4DUYL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duyL00
3CPFA 3A5ZB 2WB1E 2A8VA 1Q46A 3GTGH 1K0RA 4Y7NH 1EIYB 2B3GA 1C9OA 4DUYL 1AH9A 1TWCH 4QJFA 1MKHA 2IHEA 2RF4A 4BY1G 3U4ZA 4A3MG 4BA2I 1CSPA 1JE5A 1T9HA 1CKMA 2ID0A 2JA7H 4KHPL 3RLNA 3CXCA 3KJOA 3CCEA 1SLJA 2R7FA 4GN3B 3D0FA 3M85A 5M3FH 2JA5G 2JEBI 3PO3G 2IX0A 5C44G 2L15A 1IBKQ 1N33L 1BBWA 2VQFL 1UE6A 1V1QA 3CCMA 2C35B 1HNXL 3I4MH 3S2DH 1HNWQ 2HHHL 5FLMH 4JYAQ 1EOVA 2ZM6L 4JI6L 3KDFB 1XNRL 3T1HL 3JAMc 2Y0SG 4JI4L 1JJCB 4R4TA 4YWKA 4MZ9A 3PUVA 5FJ8G 1KC8C 2N78A 5JEAG 4HJ8A 4GN5A 4BBRH 4BXXG 1IBML 4DR5Q 3KF6A 1OTCA 4L5QA 2BH8A 1C0AA 4A3KH 1VQHA 1J6QA 4A3LH 2VW9A 4A3BG 4JI8Q 2JEAI 4JBKA 3CCVA 2PNHA 2KENA 4IFDG 3NBHB 1VQ4A 2IHFA 3CCQA 4DKAC 4LF7L 5BR8L 5IP9G 3T1YL 2UXCL 3DM3A 1VQ5A 3HFZB 4IJLA 3CD6A 1LTLA 2UUCQ 4NXNQ 1IYJB 1VQ8A 1Q7YC 4A93G 1KL9A 3GDEA 1NMFA 1KRTA 4BY7H 1GO3E 1IBLL 4J15A 4HJ9A 1AE2A 1AE3A 4QQBX 1YVCA 2I0QA 4A3FG 1FVIA 1I6HH 4K0KL 3F2DA 3HOYH 1SFOH 1TWFH 2XGTA 1E24A 4HIDA 2GVAA 5K36G 4B3TQ 1VQDA 1A0IA 1G291 4B3SQ 4GKJQ 1Q8KA 4PZ8A 3RR5A 4LWCA 4RMFA 4X65Q 4YY3Q 1Q1EA 2N49A 3G48A 3RN5A 2JA6G 2R93H 2BA0A 2YTVA 4DV6L 3K0XA 1R9TH 4B3RQ 2B63G 2IY5B 1Q12A 4DR7L 3M3YH 2DGYA 3K8AA 1VQAA 3CCSA 1KAWA 4JV5L 4GKKL 2HIXA 1IZ6A 1PH8A 3UDIA 2VS1A 1HJPA 3PUZA 2OCEA 3J7A5 3NENA 1CUKA 1EUJA 3PUYA 2Q2IA 2Z0SA 3PUWA 1XMOL 4HJ5A 1S72A 1PH1A 1HZBA 4UPAA 4TVAB 2MQHA 4OX9Q 4AYBE 4GLVB 1CKOA 1VQIA 2Q2HA 4DV1L 2A19A 4DV0L 1SR3A 4LUOA 2CWPA 4IFDI 5IYDH 2JA8G 1K9MC 5M3MH 1SMXA 4DV3L 2JA7G 4XIGS 1FJGQ 2I5LX 2NN6I 4DAYB 4Y52H 4WJ4A 3DLLA 3CF5A 3E0EA 1LM0A 2K50A 3UDFA 1BBUA 3RN2A 3HKSA 2ZTEA 5LMNL 1V43A 1B8AA 2D62A 4P71A 1I50H 4PZ6A 5GQOA 5C3EH 5M3FG 1J5EL 1G6PA 4YHHL 1Y1VH 1QVCA 3I4OA 4A76A 2ATWA 3I4MG 3KF8B 4LFBQ 2OTLA 2NVYH 5FLMG 4L5SA 2EQSA 1N32Q 2Q2TA 1BVSA 3AYHB 1EWIA 2AWNA 2FXQA 3BJUA 3L2PA 1QVFA 2K5VA 4DV7Q 5M5YH 5C0XI 4LFAQ 4HIMA 4HIOA 4B3ML 2H5XA 4R1JA 3L7ZC 1N36L 1VQOA 2RHQB 4A3CG 2UXDQ 4A3LG 3MXNB 3CMAA 2ZJPA 4L5RC 1WCMH 4JI5Q 2VNUD 3Q8DA 4JBMA 4DV4Q 5AJ3L 4LF6Q 1Y1WG 3GTKH 3H3VH 4IJHA 1CKNA 4AH6A 1A63A 4A3EH 2GN5A 3KOJA 4LF5Q 4MTNA 3PSIA 2K5NA 2NVTH 3M4PA 4JI7L 4AQYQ 2HIVA 2I5HA 4DV5L 4BBSH 5JEAJ 3W1GA 1S3OA 3G6EA 1HNZQ 4BY7G 1I3QH 4HJ7A 1L1OB 4GN4B 2E2JH 1XPOA 4NXML 2CQOA 2NVQH 3HOYG 4DAMA 1Z9FA 2PQAA 4JI2L 4X65L 3HOWG 2WAQG 1X6OA 4R4QA 1PVOA 1YNXA 4OWTB 4IO9A 1HR0W 3AFQA 4EQ5A 4IFDJ 3GTJH 1W2BA 4P73A 5IWAQ 2E8GA 1X3FA 2R92H 4IOCA 4PZ7A 1UE5A 4DR3Q 1VS0A 1QUQB 1X55A 2F4VL 2JA9A 2UXBQ 2KHIA 4X62L 1JMCA 1Q1BA 2UU9Q 4A3GH 1B7YB 1L2FA 3GD7A 3AFPA 1A8VA 3BZCA 1XMQQ 3HOVH 2Z6KA 2JJQA 3J80i 4LUZA 3BZKA 4JI0Q 1NBWA 5FLXc 4LF9L 5GADC 3I4NG 1VQJA 1PYBA 4OONA 5IY0A 4JBJA 2R7ZH 1I94L 1JT8A 1XJVA 4GOPA 5JJLA 1TWAH 4JG2A 3H0GH 4FDBA 4DR2Q 2UUAL 1Q82C 1VQ6A 3S15H 3S14H 1JJGA 3J7ZC 2WP8J 1KQSA 4X66L 4A3DH 4IPCA 1E3PA 5IYDG 4QL5A 3BU2A 3PO2H 3TS0A 4DNIA 5M3MG 1L0WA 1CSQA 2NN6G 2KCMA 4TQUS 1LUZA 5J3BA 1GM5A 1HZAA 3J81i 1PH7A 1YHBA 1PFSA 1MIUA 2NVXH 2VUMH 2BA1A 1K8GA 1QZHA 2K75A 4JI3Q 1NJIC 5GAHC 2VQEQ 4GLXA 4PG3A 5C3EG 2HQLA 5M5WH 2Z6KC 1N9WA 3OTOL 5HY6A 3F2CA 3HOUH 1PH2A 1N34Q 1Y1VG 2E5LQ 4KI0A 3CCRA 4LNQA 5LMUL 2BH2A 1FL0A 4DV7L 1OXTA 5IT9c 2F52A 3FKIH 4LF8Q 4A3IH 4GOPC 1NY4A 2VL6A 1YJWA 2DUDA 3F1ZA 3K7UC 5C0XG 2UXDL 5ELOA 1VQFA 2Y0SE 4X64Q 3F2BA 1PH9A 3S1MH 4JI1L 4GNXB 1EQRA 1QUQA 1G51A 1VCIA 4UP9A 4ME3A 3A5UA 2QEXA 1PV4A 3KDFA 3VDYA 1QZGA 1HNZL 4LF4Q 3PIOA 4C3JH 4DV2Q 4A3EG 4LFCQ 1GVPA 3K80C 1VQEA 1KHIA 3HOXG 1M1KC 1ASYA 1TWGH 5GAEC 4DUYQ 5GROA 1K83H 3CPWA 4A3JH 1U0LA 2JA5H 1B70B 5C44H 4KHPQ 3K7AH 1C7YA 2NZOA 1WI5A 1N8RC 5IWAL 5IE8A 2KBNA 2K52A 1KD1C 2AWOA 3E9IA 1X56A 4YWLA 3J80c 3TREA 1IBKL 3HOZH 1HNWL 4O2DA 2A1AA 4AIMA 5M5XH 2VQFQ 1HNXQ 4JYAL 4PMWA 3GTMH 2N8NA 2HHHQ 2R92G 2R7DA 5HGQA 2ZM6Q 4JI6Q 4POGA 4OXPA 3T1HQ 1XNRQ 4DR6Q 4KLKA 3GTQH 1J5EQ 2K4KA 4DR5L 1W3SA 4A3GG 1YHQA 1EIFA 4DUZQ 3PGZA 4YCVA 3RNUA 1IBMQ 1VQLA 2CCZA 3HOVG 3PCOB 1VQBA 3RZDH 2IT1A 1HH2P 1YHAA 2VZAA 3J81c 4BBRG 1X9NA 1TXYA 4JI8L 3B6YA 5C4XH 4OO1I 4APVA 1UEBA 2WB1G 3ERSX 2PI2E 1X54A 3AQQA 2AHOB 2YTYA 1OXVA 4A3KG 4LF7Q 5BR8Q 3T1YQ 1VQCA 2UUCL 2UXCQ 1NMGA 2R6GA 4NXNL 5IP7H 3CCLA 4L5TA 1V9PA 1TWHH 3H15A 4HJAA 4POFA 1K8AC 2UUBQ 2OQ0A 3PO2G 5GAGC 4P74A 1IBLQ 1YJ9A 3H3VI 1VQGA 1E1TA 3UE1A 4LW1A 1SROA 4R4CA 3TQYA 4K0KQ 2PMZE 3D31A 4B3TL 2B29A 1E22A 4GKJL 3KF6B 2GVBA 4NB3A 4NPSA 1U5KA 3HKZG 3L0OA 3ICEA 1JB7A 5DLQE 1OXUA 1K3RA 4YY3L 4X64L 1QVGA 1GD7A 3FKIG 3UE0A 4UY8C 4B3RL 2ZJRA 2ASBA 1IXRA 1X3EA 4DV6Q 4QIWE 1PH3A 3I2ZA 2RCNA 1YBYA 1NTGA 2MO1A 4R4OA 4DR7Q 4IPHA 4LF4L 1E1OA 2R93G 3M7NA 4GKKQ 4GLAC 4DV2L 1UE7A 4OWWB 1VQKA 4KHZA 4B3SL 1HR0L 1KIXA 3ULLA 4A4IA 2YU9H 1Z47A 2Q2UA 3OYYA 1XMOQ 1SE8A 2ZTCA 1YI2A 4OX9L 1YZ6A 3WWVA 2JA8H 3U50C 4JC0A 1X65A 3IRBA 1Y14B 2D0PA 1P8LA 4C3HH 4DV1Q 2YTXA 3RZOH 4DV0Q 3I7FA 3GTLH 3PV0A 5C0XJ 1BKBA 3S1NH 1WFQA 3FHWA 4A3JG 1EQQA 1FJGL 4DV3Q 5IYCH 1I5FA 1Q81C 3GTOH 3M4QA 1MJCA 4A75A 1D8LA 3TS2A 2CFMA 3CP0A 5LMNQ 3HKZE 3HOZG 3STBC 4DR6L 3S2HH 2OQKA 4LFBL 5IYBH 4YHHQ 2WAQE 4JOIA 1JJ2A 2V1CC 1N32L 4YWMA 3W5OA 4DUZL 1RIPA 2YV5A 4IPDA 3J81j 2AMCB 3KFUA 1L1OA 3S1QH 3KYHC 1KRSA 1IL2A 2JK8A 1GKHA 1KXLA 1XTDA 4A3CH 4LFAL 5EAYA 1EYGA 4DR4Q 4B3MQ 2PI2A 1Y1WH 2CWAA 1PH6A 3CC4A 2K5HA 3EN2A 4GS3A 3CCJA 4OO1G 5JJIA 1PYSB 1N36Q 4JI5L 5C4XG 1HZCA 4DV4L 4LF6L 4AYBG 1XNQQ 2IX1A 2XTIA 1EFWA 4IPGA 1LYLA 1E7ZA 1WYDA 3K81C 3RLFA 5AJ3Q 3UDGA 2UUBL 3TEHB 4H02A 2F3IA 1VQPA 5E7NA 1K73C 4LF5L 4WJ3M 1NE3A 3ER0A 1WCMG 5IP7G 2ZTDA 3ULJA 1FGUA 4AQYL 1YIJA 1YJNA 1PHJA 1Q86C 4JI7Q 4DV5Q 4BY1H 2I5MX 2K14A 4DR1Q 1VQ7A 4JOIC 4A3MH 3CC2A 4JBWA 3GTPH 4XTCS 3HOWH 1OXSC 4P72A 2JE6I 3U4VA 2ALYB 4ALPA 1L1OC 3PF4A 4BBSG 4UP7A 3MEFA 5C4JH 4NXMQ 1XPUA 4JI2Q 4P75A 2LSSA 3PO3H 1XPRA 3RLOA 4BA1I 4X6AH 3KJPA 3CQZH 5JJKA 3CMEA 4RG1A 3I56A 1PA6A 4QY7A 2RHSB 4DR3L 3PUXA 3A0JA 2WFWA 3TRZA 5FJ8H 1S40A 1N33Q 2UXBL 4MNOA 3U58A 1CKNB 2UU9L 1YITA 2F4VQ 3S17H 4DPGA 1A62A 4BXXH 3I4NH 1XMQL 2EIFA 3M9BA 4X62Q 1PH4A 1WJJA 2ZJQA 4JI4Q 2LXJA 5H1SE 4JI0L 3OW2A 4LF9Q 4JCVE 1UE1A 4C2MH 4A3BH 5LMNW 1HZ9A 3EBEA 1SRUA 1WOCA 1I94Q 3GO5A 3A74A 4DR2L 1ASZA 5IP9H 2PQAB 3JC66 3JAMi 1M90C 3M4OH 1D7QA 2MFIA 2UUAQ 1MJEA 2R7ZG 3ZJYC 4A93H 2YYZA 3FP9A 4QGUA 4X66Q 4GNXA 3F8TA 3STBD 3H0GG 1PH5A 3SGIA 3G4SA 2QA4A 4A3FH 3LGJA 1HR0Q 5IYCG 2ES2A 2HT1A 4A3DG 4JI3L 2KCTA 1OXXK 1SN8A 1P16A 1VQMA 2VQEL 1DGSA 3CCUA 1H95A 3CAMA 2KHJA 2LXKA 2E2HH 2E5LL 4DK3C 2D0OA 3NELA 4C3IH 1N34L 3OTOQ 3G71A 1VQ9A 3AEVA 5IYBG 2VUMG 1O7IA 4HIKA 4EX5A 5LMUQ 1YEZA 3CC7A 4LF8L 2EXDA 3KLWA 3I55A 4YCWA 4DR4L 2JA6H 3S1RH 4GOPB 3HOUG 2E2IH 1X3GA 2QGQA 2B63H 2CKZB 4LUVA 3UDXA 4OWXB 2NZHA 4DK6C 3EIVA 2JQOA 5ELNA 3W1BA 1XNQL 2OWOA 4YCUA 4IOAA 3PIPA 2MO0A 4JI1Q 3S24A 2MNAA 4A3IG 4GNXC 2AKWB 4R4IA 4O0AA 1UWVA 3PF5A 3S16H 3ULPA 3CW2C 3HOXH 2OTJA 4JV5Q 4DR1L 1RL2A 2N3SA 4LFCL 3NEMA 4UP8A 3E9HA 2VY3A 1VQNA
chains in the Genus database with same CATH superfamily
3CPFA 3A5ZB 5KYIA 2A8VA 1A2UA 4Y7NH 2B3GA 1D2BA 1C9OA 1TWCH 4BY1G 2RF4A 2IHEA 4BA2I 1DOLA 1JE5A 3ITPA 3MA2B 1BCPC 4KHPL 1TKWB 3TMEA 3RLNA 2JYOA 2KEEA 1T5EA 1JB3A 5L37A 3D0FA 2QW7A 3OOCA 3M85A 2JA5G 2JEBI 3PO3G 1IBKQ 1BBWA 1HNXL 3OPOA 2HHHL 2YU9B 2ZM6L 4JI6L 3NUCA 4B9WA 1ESRA 2A6HC 2Y0SG 1KC8C 4R4TA 2N78A 4HJ8A 4BBRH 4BXXG 3GTLB 3S1NB 4L5QA 1TS5A 4DNRB 1SYEA 1VQHA 1J6QA 4A3LH 2VW9A 4JI8Q 3AB9A 2MHVA 4JBKA 3MFYA 4R9WA 5ELDA 2PNHA 5IIFA 3NBHB 3CCQA 3NK9A 5KGUA 3DM3A 1VQ5A 1LTLA 4NXNQ 4BY7H 1GO3E 5EKKA 1AE2A 1CZGA 1CI3M 1JQYD 2MUYA 1FVIA 4K5WA 3HZXA 4K0KL 3F2DA 4EQOA 1FNWA 1GHJA 1E24A 2GA4B 2KCCA 1B3QA 2L11A 2D9UA 3A55A 3OMCA 1X3QA 1S4ZA 5IOCA 1E2VA 1Q1EA 3D6WA 3H3VC 1B50A 2N49A 4KY7A 3SK5A 1TS4A 2EY5A 2JA6G 2R93H 4DV6L 3K0XA 1Y8OB 2B63G 2IY5B 4DR7L 3FRPB 4F87A 2B8GA 2DGYA 2F0VA 3K8AA 3CCSA 1KAWA 3U9OA 4J6HA 1HJPA 2OCEA 1M4VA 1STNA 1SMYC 1XMOL 2Q2IA 1S72A 4KY6A 4TVAB 5CV5A 5I4DA 4KD4A 4ZUJA 1SNCA 4IFDI 5IYDH 2RDHA 1K9MC 2JA8G 1HA5A 5CV6A 1SMXA 2K6AA 3T4AC 1FJGQ 4DAYB 3S17B 1NR2A 4WJ4A 3CF5A 3UDFA 1BBUA 2ZTEA 2D2CC 4K8IA 2D62A 5M3FG 5GQOA 2F03A 4A3BB 1QVCA 4A76A 1XX8A 3TP5A 5JJZA 2NVYH 5CYUA 3D6CA 1LT3D 2EQSA 4DA2A 4KHVA 3OWFA 4MN3A 1LTSD 2F0MA 2QEJC 5C0XH 2F0OA 4ZKCB 3EFXD 4LFAQ 3NTKA 3DM1A 1MHWC 2DJGC 3NBIA 4A3FB 1EEFD 5CR3A 3MXNB 4JI5Q 1KDBA 4DV4Q 4LF6Q 2EXZA 1EY8A 5LL6X 2E2HB 4A3EH 4LF5Q 4MTNA 1EYDA 4JI7L 2HIVA 2I5HA 4O42A 3TZUA 3W1GA 3G6EA 4OEMB 4DFAA 3S1RB 1HNZQ 4HJ7A 3R2IA 2H1EA 4XXEA 1XPOA 4NXML 2EYLA 5CV8A 4DAMA 4JI2L 2F0EA 1UNSA 2WAQG 1TU2B 4OWTB 4IO9A 3OHXC 4IFDJ 4EQ5A 5IT9L 2KUMA 1SE3A 3P20A 4NP5A 4P73A 3LWEA 5G3LD 1SYCA 1X3FA 3QO2A 5C3WA 1X55A 1JORA 1TY2A 2NVQB 2MGSA 4YIJA 4NMZA 2JA7B 3J80i 4LUZA 3BZKA 1CQFA 5EJWA 2EYJA 4OONA 1BDOA 5IY0A 2R7ZH 1XJVA 2EY2A 4FDBA 2UUAL 1Q82C 3I4MB 3S14H 1JJGA 3J7ZC 1KQSA 4X66L 4A3DH 4IPCA 1F2LA 3ERQA 5M3MG 2NN6G 1S5BD 2KCMA 2ZXRA 4ZAIA 1HQRD 1YHBA 2NVXH 1XTCD 2VUMH 5J39A 1M8AA 1TWAB 5E4XA 5C3EG 4A3KB 1PH2A 2E5LQ 1Y1VG 2Z4IA 4KI0A 2IX3A 1JOQA 5IT9c 4LF8Q 1JR0D 2VL6A 3F1ZA 3S1MH 5IT9E 2QF7A 4GNXB 5EPKA 4RCNA 1VCIA 4UP9A 1B2TA 3NQTA 3NTIA 4RKLA 2B2YA 4XQJA 3HKZB 2TSSA 2QEXA 3KDFA 1PFMA 4IUQA 1HNZL 1ENFA 3BDOA 1VQEA 1KHIA 2ICEC 1TVXA 5GROA 1PTOC 1B70B 4K2KA 1C7YA 4KKSA 1I4QA 3IFDA 2M00A 2K52A 3K0YA 2P5ZX 3E9IA 2XIWA 2B2UC 2LMCB 2A1AA 5M5XH 2VQFQ 4PMWA 1LTBD 1TWGB 5HGQA 4EQNA 4POGA 4XT3B 1KAAA 3HG9A 4K5XA 4DR5L 1W3SA 4XQNA 1YHQA 2QDLA 4A3GG 1IBMQ 2I07B 3HOVG 3PCOB 1W6KA 4ZKBB 4OO1H 1DOKA 2L9HA 1UEBA 3ERSX 2PI2E 1X54A 2NWGA 5BR8Q 2UXCQ 1NMGA 5IP7H 3CCLA 1LLRD 4HJAA 1KNEA 3H15A 4I7ZC 1K8AC 4IUVA 1JC7A 1ENCA 4NW2A 4P74A 1EY6A 1DZ1A 1E1TA 4EQPA 1SROA 3TQYA 1WTVA 3MVVA 2QKIC 4B3TL 5EPLA 4RHRA 3CRKC 5CGKA 2HD3A 5ELBA 3ICEA 1K3RA 3GTKB 3FKIG 4B3RL 2V4DA 4M8AA 2NVTB 2ASBA 1X3EA 4QIWE 4CGYB 4BBSB 4JPBW 2MO1A 5C4ZA 1I3QB 1GHKA 1NR4A 3URYA 4GKKQ 4F88A 1C4QA 3VR6A 1HR0L 1KIXA 2YU9H 3BVZA 1GUNA 1YI2A 1SAPA 4JC0A 1B9MA 2VB3X 1P8LA 4CBVA 4X3TA 2R92B 1X3PA 1STAA 4DV0Q 5LHY1 3GTLH 2ZXPA 5C0XJ 1BKBA 3S1NH 1AZQA 4A3JG 2AQ3B 1H9RA 4DV3Q 5ISRA 1U4PA 3AU7A 1L0XB 1UEAB 1PRTB 3OIPA 3TS2A 2OQKA 4V190 5IYBH 4YHHQ 5IODA 4JOIA 1BOSA 2WB1B 3RZOB 3J81j 2YV5A 3KFUA 3D8GA 3KYHC 2FHTA 4ZUIA 3ONAB 1SJHD 3TP8A 1EY4A 4DR4Q 3PO2B 2F0TA 4F8MA 3VYRA 3T51B 2EE1A 1PH6A 3RUZA 1PYSB 4G4KA 2IX1A 4IPGA 1Q90A 3K81C 2PZUA 3TEHB 3TP6A 3HOUB 3S1QB 1YJNA 1E0BA 1FGUA 1BR9A 4CDFC 1Q86C 1QNKA 2XN9C 4DR1Q 1Y8PB 4A3MH 5DM63 3PIO3 4LMQD 2E2DC 4FF3A 1EZ8A 1BXTA 3QG1A 5BN3A 3MTSA 4UP7A 1ML0D 4DU9A 1XPUA 1XPRA 1CQVA 4KV6A 1LT5D 5JJKA 5FK9C 2A69D 1VMPA 2RHSB 4DR3L 1MGSA 2WFWA 3TRZA 1A6XA 5EQ0A 3VR5A 3U58A 5EGTA 5IGBA 2F4VQ 3S17H 3TBIB 4X62Q 1PH4A 1CM9A 1K83B 4JI4Q 4JI0L 5C5LA 2JA5B 1SXTA 3K5LA 1SYDA 4J8QA 4A3BH 5EPJA 4FVMA 4HCSA 3GO5A 3A74A 2DNCA 1ASZA 5IP9H 3JC66 3HOZB 4A93H 5FO8B 4UDUC 3F8TA 3P7JA 3UI2A 1AN8A 3SGIA 4A3FH 5IYCG 3HP3A 4CHTB 2MJ8A 1DONA 2VQEL 1DGSA 1H95A 3RZDB 3CAMA 1SNPA 2E2HH 3FMCA 3AEVA 4DK3C 1VQ9A 3OTOQ 5C4XB 4HIKA 1Q8IA 3KLWA 4DR4L 4YCWA 3S1RH 2XSCA 2OT2A 2QGQA 1KDAA 2CH4W 2PNRC 4OWXB 1S5DD 2RBMA 3QOJA 1HPCA 2B39A 3S24A 4A3IG 2MNAA 5JPMC 3IFTA 3ULPA 1VMCA 1SDFA 1A3UA 4LAAA 3DUZA 4DR1L 3NEMA 2JA6B 1JWSD 3E9HA 2VY3A 1VQNA 4HAEA 2N88A 1K0RA 4PMBA 3VYUA 3CHBD 3CU7A 1CSPA 1T9HA 2JA7H 1STBA 1AW7A 2A68D 1SLJA 3J7AF 1D1KA 4IUUA 1U4MA 2A74C 2IX0A 1HNWQ 3CCMA 1V1QA 2C35B 3I4MH 3QJYA 5FLMH 1EOVA 1D5ZC 3KDFB 1XNRL 2JA8B 5KIXA 4JI4L 1JJCB 1J5EQ 4MZ9A 2PMZB 5ELCA 3HS0C 4ILWA 4C3HB 5E1FA 1OTCA 1V1PA 1WTXA 4ZYSA 1KLGD 4A3KH 5TSSA 4H0LC 4KN4C 2KA7A 3GTOB 4IFDG 5CORA 4G7OC 1VQ4A 2IHFA 2HUGA 3C1FA 3T1YL 3VA7A 1EQVA 3HFZB 4IJLA 3CD6A 2UUCQ 4CJ2C 1Q7YC 1PZKD 3GDEA 1IBLL 4HJ9A 4RA8A 2I0QA 4HIDA 3WOEA 3C1EA 2GVAA 1XXGA 1A0IA 1GUSA 4OIJA 3KBGA 4CKBA 2RA4A 3FEWX 3G48A 1RHPA 2BA0A 5FKAC 4I7AA 2PPBC 3QR8A 1EWCA 3K5OA 3QIAA 1DJRD 1F2ZA 4ZQ3A 2WAQB 1FGBD 4U673 3UDIA 1KABA 4R8NA 1SNOA 5C4JB 3J7YW 1H9SB 1WVLA 1CUKA 1EUJA 1H9JA 4KN7C 4HJ5A 1EY7A 3FPUB 2M9VA 2PZTA 2MQHA 4OX9Q 3CQZB 4GLVB 1CKOA 4NDXA 3F2UA 2I5LX 1O7YA 2PCFB 3DLLA 1SBBB 3RN2A 3VA5A 5LMNL 4P71A 1J5EL 1G6PA 2L4NA 4C2MB 3I4OA 2ATWA 2K5WA 2OF1A 4L5SA 2OXPA 1N32Q 2Q2TA 1EWIA 2AWNA 3BJUA 3T53B 1QVFA 3Q24A 3BVGA 4HIMA 4B3ML 1JCKB 2H5XA 3L7ZC 3G7LA 3DXJC 2CW0C 4A3CG 4A3LG 2EYMA 3CMAA 3OIQA 3NQIA 5AJ3L 1Y1WG 3GTKH 4IJHA 1CKNA 2Z6BA 4C3IB 4FF1A 3KOJA 2NVTH 2K5NA 1SEBD 1HCZA 3KK7A 4AQYQ 4DV5L 4BBSH 5M9OA 1YNND 1F9PA 3LWUA 4BY7G 1I3QH 2E2IB 4GN4B 2B8FA 1X6OA 2N55A 4R4QA 1YNXA 4NKLA 1PVOA 2B2VC 3S16B 4G7HC 4XDXA 2R92H 4IOCA 3DEPA 4FO2A 2F0JA 2JA9A 2KQ3A 2UXBQ 2UU9Q 2A69C 1Q1BA 1B7YB 3GD7A 1XMQQ 3BZCA 2KCNA 2Q8IB 4HN7A 4LF9L 3I4NG 1PYBA 5ELFA 4CKEA 1HTPA 1JT8A 4Z9CB 2E74C 5JJLA 4M1UB 4DR2Q 3MWYW 3S15H 4L8JA 4A3GB 4K6LA 5IYDG 3HOVB 3PO2H 4DNIA 2QDBA 1L0WA 1GM5A 2AUJD 1OO9B 1PH7A 4RGOS 1MIUA 2BA1A 1K8GA 1QZHA 2K75A 1BNZA 5GAHC 1EYAA 4ABNA 2HQLA 4G7ZC 2Z6KC 1HFGA 3HOUH 2XWJB 3CCRA 5LMUL 2L12A 3NWSA 2BCOA 5D3DA 3BZDB 4GOPC 2B2TC 2A6ED 1NY4A 4Q5VA 1RJTA 5C0XG 1VQFA 4X64Q 3F2BA 3J81L 2PYKA 4JI1L 1UUPA 1QUQA 4ME3A 3A5UA 3HOYB 4O1NA 4LF4Q 1S5CD 4A3EG 2FFKB 3K80C 3Q22A 3HOXG 1M1KC 4DUYQ 3T16A 1K83H 4KTAA 1BBXC 4K8JA 2JA5H 4MIUA 3DHQA 1O7ZA 1WI5A 1N8RC 5IE8A 2KBNA 2NBFA 1KD1C 5KNCA 1IBKL 3HOZH 3TREA 3MZ5A 4O2DA 4S3SA 2KHSA 2F0NA 4KK7A 5CBEE 3T1HQ 1S5FD 3FPPA 1VQLA 3J7AV 4CDCC 1VQBA 2G5DA 4WFN3 3RZDH 1HH2P 5I2XA 1BUVT 5EKLA 3J81c 2K32A 1TXYA 4JI8L 5C4XH 1I50B 1OXVA 4LF7Q 1X32A 4K5VA 3H91A 4NXNL 3DWQA 3J81E 4E6IA 2JXMB 1KDCA 1V9PA 3EROA 2JP1A 4POFA 2UUBQ 2OQ0A 1YJ9A 4OIKA 1VQGA 1HRJA 2Q8RE 3UE1A 5I6WA 4RGMA 1F9QA 2CH4A 4LW1A 5DEHA 3D31A 2B29A 1E22A 1D5XC 1RTNA 4NPSA 3L0OA 1IL8A 1PZID 1QVGA 4X64L 1GD7A 3N52A 2ZJRA 2B2WC 1O80A 2IJ0A 3I2ZA 2RCNA 4R4OA 4ODGA 4HTHA 4IPHA 4LF4L 3FVQA 3KLSA 4GLAC 1UE7A 4OWWB 2E2JB 4KHZA 4FF2A 4MTKA 3ULLA 2PQEA 1Z47A 2Q2UA 1SE8A 2JA8H 1YZ6A 4WJWA 3GTJB 1X65A 1TS2A 3I70A 4RGNA 2EYOA 3V2TA 4C3HH 4DV1Q 2EZVA 3I7FA 3SEBA 1FJGL 4XQQA 1PRTD 2XRSD 1I5FA 3GTOH 3K58A 3P75A 3O13A 1D8LA 2K04A 3CP0A 3HKZE 1MSGA 5KYLA 2V1CC 3W5OA 1I4GA 1S5ED 1CT1D 1L1OA 4C1NK 5F2DA 3OMGA 4LFAL 5EAYA 1K8OA 5C5MA 3MC0B 3H6MA 1GUWA 4OO1G 4GS3A 1N36Q 4JI5L 5T1IA 4DV4L 1YNJC 4LF6L 2XTIA 1LYLA 1E7ZA 2UUBL 5M5WB 4H02A 2F3IA 1K73C 4LF5L 4WJ3M 3ER0A 1WCMG 5IP7G 2ZTDA 1PHJA 2NZ1D 1EU3A 2K14A 3CC2A 4XTCS 4A3IB 4P72A 2JE6I 3VR3A 1YNNC 5C4JH 1BO0A 2LSSA 3EA6A 1WD0A 2G9HD 3CQZH 2BDNA 3I56A 3PUXA 4C3JB 1J8IA 5FJ8H 4LK1C 1S40A 5JEAH 4MNOA 1CKNB 3BDCA 3EVQA 2EIFA 1RKNA 1SSOA 1L0YB 4N8FA 2ZJQA 3TZDA 5CBAE 5IGFA 3OW2A 3A7AB 4C2MH 4QB4A 5JVH3 2WACA 4H13C 1I94Q 4IN3A 1DYQA 2NN6H 2FJ2A 1Q3LA 2KOLA 1MJEA 3ZJYC 3FP9A 4QGUA 3STBD 5FOBB 2SNSA 3H0GG 2QA4A 3GTQB 3LGJA 3QB3A 2ES2A 2HT1A 2EVBA 3SHLA 1P16A 1SE2A 5K36H 4PNYA 3VYSA 4JK1C 2E5LL 4C3IH 3NELA 2L1BA 5IYBG 2RVLA 4AYBB 1O7IA 4EX5A 1O7LA 3ZYYX 3K57A 4LF8L 1NSNS 2EXDA 4B08A 1WTRA 3WOFA 2E2IH 3UDXA 4IURA 1TWHB 3EIVA 2JQOA 1PRTF 3W1BA 5D65A 3EQLC 4GNXC 3S16H 1STYA 2OTJA 4CDEC 2N3SA 2CHBD 2G9DA 1KNAA 2WB1E 1WTHA 3U4ZA 4A3MG 3NPPA 2ID0A 3DWPA 1HQMC 4RAUC 2NUCA 3KJOA 3CXCA 1JWUD 1NNXA 3QOLA 5C44G 3X3MA 2VQFL 3D4WA 1CHPD 4FNFA 4JYAQ 3T13A 4J1MA 1ZYRD 2ZT9C 3KUPA 2E75C 2VB2X 2NTTA 4YWKA 2CQAA 2F0HA 2F0KA 4GN5A 2PW5A 1IBML 1GOZA 2LFNA 3KF6A 2BDOA 4RH6A 2B2TA 4EVOA 1A15A 1JWMD 4A3BG 2JEAI 1IW7D 4KD3A 1WTOA 4DKAC 5BR8L 5HURA 5IP9G 2UXCL 4H44C 5I2YA 1IYJB 4A93G 3V96A 1KRTA 4J15A 2WKDA 1D5MC 1AE3A 1CTMA 1YVCA 4A3FG 4ZRZA 3HOYH 3QWNA 1HA6A 4DXGA 1Y1WB 1WTQA 3L9AX 3I3CA 1G291 4GKJQ 1Q8KA 4ID6A 4X3SA 3RR5A 4LWCA 3KBXA 4QF4A 4YY3Q 2AQ1B 3RN5A 2M2LA 4FP5D 4KKUA 1Q12A 4BY1B 1DCZA 4GKKL 2HIXA 1PH8A 2HDLA 4PV1C 5T1GA 3PUZA 3J7A5 1BCPD 3NENA 1UAPA 4B3SQ 3PUYA 3PUWA 5J22A 3PO3B 4UPAA 4IUTA 1G2TA 1QG7A 1SNMA 3GV6A 1VQIA 2A19A 4DV0L 2EDGA 2Y0SB 1Y8NB 2DY8A 3GP7A 3NHHA 4XIGS 4DV3L 2WV6D 2JA7G 3TDQA 2NN6I 3SK6A 3I4NB 1KLUD 4HMIA 4OHJA 3E0EA 1LM0A 2K50A 4IUPA 1PRTC 1B8AA 3U9SA 3C3LA 1I50H 4YHHL 1ESFA 3PMFA 3I4MG 4LFBQ 3DMUA 2PO4A 2RQXA 5FLMG 3I72A 3M4OB 1BVSA 1SYFA 5D3IB 3L2PA 1JICA 2K5VA 1EY9A 2J7ZA 3A56A 1DD2A 5FLXL 3LX0A 1II3A 4ZCKA 4IALA 1H9KA 1QOHA 3BYYB 1RTOA 2UXDQ 3BG3A 1GUOA 3PIP3 4X3KA 4HEDA 2KJXA 3NTHA 4B9XA 5JEAJ 2BE5D 1S3OA 2WKCA 2B63B 1L1OB 2E2JH 4OELB 2CQOA 2NVQH 2PQAA 3HOWG 1HUMA 1HR0W 2F3VA 3AFQA 4DAYA 3GTJH 2EJFC 3HOXB 2E8GA 3MFGA 2RDGA 1EYCA 1ZEQX 1FYCA 3PQIA 4X3UA 2F4VL 1SMYD 3GTGB 2KHIA 2C5CA 5JOBA 4X62L 1JMCA 3AFPA 1A8VA 2KVMA 3BS1A 1EQTA 1NBWA 5FLXc 2K01A 2D5DA 1RODA 4JBJA 5M3FB 1TWAH 4KJNA 4K6DA 1PFBA 4IUNA 1G6ZA 1VQ6A 3S2DB 5FLXE 2AQ2B 5I9OA 2WP8J 1STGA 4RWSC 2J0TD 4QL5A 1EIGA 3TS0A 4TQUS 1LUZA 3J81i 2KEDA 4WORA 4JI3Q 4TRDA 1DM0B 1NJIC 4GLXA 1SNDA 1BCPF 5M5WH 3OTOL 1N9WA 5HY6A 4U68A 1N34Q 3I73A 4LNQA 2BH2A 1FL0A 2X6LA 1OXTA 1D1IA 1LT6D 2F52A 5EBCA 1BQQT 4A3IH 2F0FA 1YJWA 2DUDA 4DF7A 1AFPA 2UXDL 5ELOA 1PH9A 2B2UA 3W3AA 1EQRA 3E6ZX 5IGDA 1LV9A 3LNNA 1I6HB 2EJMA 1SFOB 1TWFB 1QZGA 4N9PA 3SR1A 4ZK9B 3PIOA 4C3JH 3P1HA 4LFCQ 1GVPA 3MXUA 4GZYC 1RCVD 1ASYA 1TWGH 5GAEC 3WDNA 4PMCA 1BCPB 1R9TB 1JE4A 1DOMA 2K33A 4KHPQ 4QUCA 2NZOA 3M3YB 3I4LA 2R61A 3SXHA 2AWOA 1HNWL 1TIID 4MHEA 5HGTA 1HNXQ 2N8NA 2HHHQ 2LKVA 2R92G 2R7DA 2ZM6Q 4JI6Q 2X6GA 1I4PA 4DR6Q 4KLKA 3GTQH 1CA5A 2EPBA 3BVMA 5J1ZA 1EIFA 4DUZQ 1PYWD 2K28A 2CCZA 5M3MB 1EU4A 4FXDA 1FNUA 4BBRG 3HGBA 1BF4A 1I4HA 2SEBD 2WB1G 5CV7A 1V1OA 3AQQA 5D14A 2YTYA 5C3EB 1J9OA 1VQCA 2UUCL 1IW7C 1Y1VB 2R6GA 1PXUA 4L5TA 1TWHH 3MXGA 3PO2G 1IKMA 2NYZD 2L0CA 4R4CA 4FXKC 3R2TA 4K0KQ 5M5YB 5IGEA 4DAPA 2FMMA 3KF6B 2GVBA 4KKTA 4NB3A 1U5KA 1WCMB 3K5NA 1OXUA 3BDLA 3V05A 2F1MA 4UY8C 4RCOA 1IXRA 4DV6Q 1FNVA 4DR7Q 1NTGA 3MAQA 3DWAA 2C9OA 2R93G 1F2YA 1R4PB 3TN2A 2IL8A 1QILA 3A8JE 4FF4A 3KF8A 1VQKA 1PTOD 1EL0A 5JAVA 2F0DA 1ZKOA 1EZ6A 5KNBA 3OYYA 1XMOQ 2SNMA 4OX9L 1Y14B 2D0PA 3RZOH 2YTXA 2XVSA 4LJZC 2JN4A 1WFQA 3FHWA 4UAIA 2ENBA 2A5HA 2Z4HA 3CRLC 4RHSA 1KXLA 2CFMA 2K1BA 3HOZG 4DR6L 2F4IA 3SDZA 2BOSA 3Q0AA 2F0WA 1JJ2A 2IWHA 1N32L 1Z6HA 4DUZL 1RIPA 2DNEA 2AMCB 2HQEA 1VF5C 3H0GB 2O5IC 5FO7B 3S1QH 1SNQA 2A73B 5JPNC 1IL2A 1GKHA 3SK8A 4A3CH 4ULLA 5A2QL 2EJGC 2PI2A 1Y1WH 3OW7A 3CC4A 2K5HA 3EN2A 4BWGB 5C4XG 1EOTA 1HZCA 2LY7A 3NP8A 4FXGC 1WYDA 3RLFA 5E7NA 4AQYL 3ULJA 1YIJA 1K8MA 4JI7Q 1FR3A 3FKIB 4BY1H 2I5MX 1AEXA 5DAUA 4JOIC 1I4RA 4JBWA 1LACA 1OXSC 5I6YA 3U4VA 1IKLA 4ALPA 3PF4A 2BE5C 1VDZA 3MEFA 4NXMQ 1HHVA 1TQOA 4JI2Q 1C48A 3PO3H 4DAVA 4BA1I 4X6AH 2F0LA 3KJPA 2NB0A 3CMEA 4RG1A 3SK4A 2A68C 3A0JA 1CK1A 1QNUA 4A3MB 1N33Q 2UXBL 2UU9L 1YITA 2EYFA 4DPGA 1A62A 2E76C 4BXXH 3I4NH 1XMQL 3EJIA 3M9BA 2K7VA 4A3JB 3C46A 4EGVA 2LXJA 5H1SE 2OEOA 5KEEA 5C44B 3K7AB 2L5TA 4JCVE 5LMNW 1B4OA 4K14A 1WOCA 2NTSA 4DR2L 3FDTA 3M4OH 2PQAB 2J4XA 3N6RA 2MFIA 2UUAQ 3K6OA 3E5SA 5A2QE 1GJXA 2R7ZG 3GTMB 4C3HG 4X66Q 1DXMA 1MBYA 1F9RA 1PH5A 2F0GA 2KECA 4A3DG 1OXXK 4DXFA 1K28A 2L55A 4DK1A 1VQMA 1B3AA 4BS9A 3C2PA 1PTOF 2KHJA 3L3OC 3G71A 2VUMG 3JAML 4A93B 3CC7A 2JA6H 1V1PB 3K5MA 1VF7A 2B63H 4TKOB 3D3RA 2NZHA 4DK6C 1C8CA 4IOAA 2H4OA 2F0UA 1UWVA 2HCCA 4N8X1 1U9RA 3CW2C 5IGGA 1HTLD 3HOXH 4JV5Q 1TS3A 4UP8A 1LT4D 2K5QA 1Q46A 3GTGH 1EIYB 4DUYL 1RF2D 1AH9A 4QJFA 1MKHA 1PTOB 1GUGA 1MSHA 1CKMA 1GXDC 1LTRD 1O78A 1LO5D 3CCEA 3TP7A 1XYIA 1PDQA 2R7FA 1I6VC 4GN3B 2IW3A 5M3FH 1EWHA 2L15A 4JW0A 1N33L 1UE6A 3S2DH 1B44D 2PW7A 3K59A 1SJED 3A7LA 1E2ZA 4TSSA 3T1HL 3JAMc 3IAYA 5FJ8G 3PUVA 5EKIA 5JEAG 2I46A 2O4XA 4DR5Q 2Q8TA 2BH8A 1NCVA 1TR5A 3JAME 1C0AA 3CCVA 2KENA 1WTPA 1U4RA 4LF7L 3S2HB 3KLSX 1VQ8A 2XNAC 1KL9A 1EIHA 1NMFA 5BN4A 1E2WA 2LS01 4QQBX 1PLFA 1SYBA 1XWEA 3NXWA 1I6HH 5CV4A 1SFOH 1TWFH 1TT2A 2XGTA 1B1ZA 5K36G 4B3TQ 1VQDA 3NE5B 5CMDA 4C3IG 3HEJA 1PZJD 4PZ8A 1ZXTA 4RMFA 4X65Q 1HFNA 2Z1CA 1K3BC 2QCPX 2YTVA 1R9TH 4B3RQ 2IPKD 3M3YH 4QCLA 2MP1A 2F0PA 3W2DA 1VQAA 2F3WA 3GTPB 3HOWB 4JV5L 1ET6A 1IZ6A 3TSSA 2VS1A 4L6TB 1HR0Q 3I90A 2Z0SA 1PH1A 1HZBA 4AYBE 2Q2HA 4DV1L 1SR3A 4HMJA 4LUOA 2CWPA 1A2TA 4R8IA 5M3MH 4OGQC 2Z9HA 4ME5A 4Y52H 1CZWA 1GUTA 4ZLTF 3M7GA 1G2SA 1TY0A 3GQBA 1QCBD 3HKSA 1QB5D 1V43A 3H94A 4PZ6A 5C3XA 4HCEA 5C3EH 1Y1VH 3KF8B 3M4YA 2OTLA 3A8KE 3AYHB 2FXQA 2JSOA 2WIIB 4DV7Q 5M5YH 5C0XI 4HIOA 2B2VA 4K2LA 4R1JA 3Q23A 1N36L 2SDFA 1VQOA 3IKJA 2RHQB 3DEOA 5G3LF 5DM73 2ZJPA 4L5RC 2VNUD 1WCMH 3Q8DA 4JBMA 2A6EC 3OWEB 3RMHA 3H3VH 1HUNA 5COYA 4AH6A 1A63A 1ICWA 2GN5A 2RCFA 3PSIA 1EFID 3M4PA 5AFWA 1H9SA 4QUFA 2EOTA 4H7BA 1EEID 3MHBA 3HOYG 1CHQD 1G8ZD 1Z9FA 2R3ZA 2Z8LA 4X65L 2O2LD 2EYHA 4UHVA 2ICIA 1W2BA 3BYTB 5IWAQ 1ILPA 1V8QA 1T5XD 4PZ7A 1FD7D 1UE5A 4DR3Q 1VS0A 1QUQB 1PMRA 4Y7NB 3Q6SA 4A3GH 1L2FA 1TWCB 1LTTD 3HOVH 2EY6A 2Z6KA 2JJQA 4JI0Q 2DY7A 5GADC 1VQJA 1SYGA 1I94L 5C6AA 4GOPA 5I9PA 4JG2A 3H0GH 1B9NA 3VYTA 2O5JC 4JVZA 4QIWB 1E3PA 2AUKA 3BU2A 1W6JA 1CSQA 5J3BA 1HZAA 4BBRB 3E3XA 3H09A 1PFSA 4CJ1B 3J80L 1LTID 1IYUA 2VQEQ 1CA6A 4PG3A 3F2CA 1B53A 3S15B 4XYQA 4DV7L 4PQXA 3FKIH 2CW0D 4RKBA 3K7UC 2Y0SE 4BY7B 1JOOA 4HR7B 2TMPA 1G51A 3GV3A 1PV4A 2K5DA 4DGZA 3VDYA 4DV2Q 3ND8A 3A54A 4C1NI 1A3TA 1NAPA 1K0SA 2MPMA 3CPWA 4A3JH 2R93B 1U0LA 5C44H 1A3VA 3K7AH 3NBHA 5IWAL 4RFBA 5FO9B 3J80c 1X56A 2CVRA 4YWLA 2A6HD 4DK0A 4AIMA 4JYAL 2K03A 2DN8A 3GTMH 5K5PA 3IL8A 5KNDA 4OXPA 1XNRQ 2RDFA 3J80E 3S9WA 4IZ8A 3AMUA 2K4KA 1LABA 3PGZA 4YCVA 3RNUA 2F0SA 1NUCA 2DJFC 2IT1A 1YHAA 1LTGD 2VZAA 1I4XA 1MI2A 1X9NA 3B6YA 4V0BA 1CFMA 4OO1I 5JVG3 4APVA 5EBDA 5IGCA 2B2WA 2AHOB 4A3KG 3T1YQ 3E0JA 1WD1A 2NVYB 2F0QA 2PZWA 4KMUC 4RGTA 1QWYA 5GAGC 1IBLQ 3H3VI 5E4WC 1ONLA 2EY1A 3A8IE 3D4RA 3I8ZA 2PMZE 3SVMA 4FYDA 2SOBA 4GKJL 4CDDC 3NWTA 1R4QB 3HKZG 2WINB 1RD9D 4XYOA 1JB7A 5DLQE 4YY3L 4C56C 5BN5A 1PTOH 3UE0A 4A3EB 1PH3A 1YBYA 1F9SA 1E1OA 3CKIB 5CV9A 4DV2L 4B3SL 4A4IA 1Z7TA 2ZTCA 3WWVA 3U50C 4C3JG 5A35A 4QMGA 3IRBA 4I65A 3PV0A 1EQQA 1IYVA 3D4DA 3HRZC 3MXNA 2RSOA 5IYCH 5KRUA 1ET9A 1Q81C 3M4QA 1MJCA 2RKSA 4A75A 5LMNQ 3STBC 3KLRA 3S2HH 4LFBL 2WAQE 2R7ZB 1F77A 4YWMA 1QJOA 1STEA 1IHZA 4HSVA 4IPDA 4IQZA 1KRSA 3S14B 2JK8A 1STHA 1ICFB 1XTDA 4A3DB 1SE4A 1EYGA 4B3MQ 2CWAA 3VR2A 3CCJA 5JJIA 2NVXB 2VUMB 4AYBG 1XNQQ 1EFWA 5AJ3Q 3UDGA 1AZPA 1VQPA 2FINB 4F7XA 1NE3A 4Q0FA 4DV5Q 1VQ7A 3M7NA 3R8BA 4P2CB 1MD2D 3GTPH 3HOWH 1WTWA 2ALYB 1L1OC 4BBSG 1PFNA 5DNFA 2XWBB 3S1MB 2ZXOA 4P75A 3SE0A 2QILA 3R3OA 3RLOA 3VR4A 1U4LA 3MEHA 1PA6A 4N9TA 4QY7A 1JOKA 1LTAD 4KJOA 5LL6S 2B2YC 3OSOA 1WJJA 1D6EC 3ND9A 1ZYRC 4LF9Q 1UE1A 1HXYD 1HZ9A 1KTKA 1AP0A 3RD4A 3EBEA 4IFDH 1SRUA 1M90C 3JAMi 1RDPD 1D7QA 2K05A 4G57A 5M5XB 4HSPA 1Y69U 2YYZA 4GNXA 3X3NA 3G4SA 2X69A 1ILQA 4L63B 4JI3L 2KCTA 1SN8A 4CJ0B 4WRDA 3CCUA 2LXKA 4XT1B 1G91A 2HCIA 1N34L 2D0OA 3R93A 2HDMA 1H9MA 4OL7A 3G6JB 5LMUQ 1YEZA 3I55A 1F2MA 1QE6A 2VXWA 5E3FA 5ELEA 3MXPA 1YNJD 2EYPA 5CC4A 4GOPB 3HOUG 1X3GA 2XRQD 2FMCA 2CKZB 4LUVA 4CKCA 5C4HA 5ELNA 1XNQL 5NUCA 1ENAA 4YCUA 2OWOA 4DN4M 1EY0A 2MO0A 3I91A 2RSNA 4JI1Q 3PIPA 2AKWB 4R4IA 4O0AA 3T56B 3PF5A 2F0IA 1RL2A 4DNTB 4LFCL 4KY5A 3NSWA 1EY5A
chains in the Genus database with same CATH topology
3CPFA 3A5ZB 2WB1E 2A8VA 1Q46A 3GTGH 1K0RA 4Y7NH 1EIYB 2B3GA 1C9OA 4DUYL 1AH9A 1TWCH 4QJFA 1MKHA 2IHEA 2RF4A 4BY1G 3U4ZA 4A3MG 4BA2I 1CSPA 1JE5A 1T9HA 1CKMA 2ID0A 2JA7H 4KHPL 3RLNA 3CXCA 3KJOA 3CCEA 1SLJA 2R7FA 4GN3B 3D0FA 3M85A 5M3FH 2JA5G 2JEBI 3PO3G 2IX0A 5C44G 2L15A 1IBKQ 1N33L 1BBWA 2VQFL 1UE6A 1V1QA 3CCMA 2C35B 1HNXL 3I4MH 3S2DH 1HNWQ 2HHHL 5FLMH 4JYAQ 1EOVA 2ZM6L 4JI6L 3KDFB 1XNRL 3T1HL 3JAMc 2Y0SG 4JI4L 1JJCB 4R4TA 4YWKA 4MZ9A 3PUVA 5FJ8G 1KC8C 2N78A 5JEAG 4HJ8A 4GN5A 4BBRH 4BXXG 1IBML 4DR5Q 3KF6A 1OTCA 4L5QA 2BH8A 1C0AA 4A3KH 1VQHA 1J6QA 4A3LH 2VW9A 4A3BG 4JI8Q 2JEAI 4JBKA 3CCVA 2PNHA 2KENA 4IFDG 3NBHB 1VQ4A 2IHFA 3CCQA 4DKAC 4LF7L 5BR8L 5IP9G 3T1YL 2UXCL 3DM3A 1VQ5A 3HFZB 4IJLA 3CD6A 1LTLA 2UUCQ 4NXNQ 1IYJB 1VQ8A 1Q7YC 4A93G 1KL9A 3GDEA 1NMFA 1KRTA 4BY7H 1GO3E 1IBLL 4J15A 4HJ9A 1AE2A 1AE3A 4QQBX 1YVCA 2I0QA 4A3FG 1FVIA 1I6HH 4K0KL 3F2DA 3HOYH 1SFOH 1TWFH 2XGTA 1E24A 4HIDA 2GVAA 5K36G 4B3TQ 1VQDA 1A0IA 1G291 4B3SQ 4GKJQ 1Q8KA 4PZ8A 3RR5A 4LWCA 4RMFA 4X65Q 4YY3Q 1Q1EA 2N49A 3G48A 3RN5A 2JA6G 2R93H 2BA0A 2YTVA 4DV6L 3K0XA 1R9TH 4B3RQ 2B63G 2IY5B 1Q12A 4DR7L 3M3YH 2DGYA 3K8AA 1VQAA 3CCSA 1KAWA 4JV5L 4GKKL 2HIXA 1IZ6A 1PH8A 3UDIA 2VS1A 1HJPA 3PUZA 2OCEA 3J7A5 3NENA 1CUKA 1EUJA 3PUYA 2Q2IA 2Z0SA 3PUWA 1XMOL 4HJ5A 1S72A 1PH1A 1HZBA 4UPAA 4TVAB 2MQHA 4OX9Q 4AYBE 4GLVB 1CKOA 1VQIA 2Q2HA 4DV1L 2A19A 4DV0L 1SR3A 4LUOA 2CWPA 4IFDI 5IYDH 2JA8G 1K9MC 5M3MH 1SMXA 4DV3L 2JA7G 4XIGS 1FJGQ 2I5LX 2NN6I 4DAYB 4Y52H 4WJ4A 3DLLA 3CF5A 3E0EA 1LM0A 2K50A 3UDFA 1BBUA 3RN2A 3HKSA 2ZTEA 5LMNL 1V43A 1B8AA 2D62A 4P71A 1I50H 4PZ6A 5GQOA 5C3EH 5M3FG 1J5EL 1G6PA 4YHHL 1Y1VH 1QVCA 3I4OA 4A76A 2ATWA 3I4MG 3KF8B 4LFBQ 2OTLA 2NVYH 5FLMG 4L5SA 2EQSA 1N32Q 2Q2TA 1BVSA 3AYHB 1EWIA 2AWNA 2FXQA 3BJUA 3L2PA 1QVFA 2K5VA 4DV7Q 5M5YH 5C0XI 4LFAQ 4HIMA 4HIOA 4B3ML 2H5XA 4R1JA 3L7ZC 1N36L 1VQOA 2RHQB 4A3CG 2UXDQ 4A3LG 3MXNB 3CMAA 2ZJPA 4L5RC 1WCMH 4JI5Q 2VNUD 3Q8DA 4JBMA 4DV4Q 5AJ3L 4LF6Q 1Y1WG 3GTKH 3H3VH 4IJHA 1CKNA 4AH6A 1A63A 4A3EH 2GN5A 3KOJA 4LF5Q 4MTNA 3PSIA 2K5NA 2NVTH 3M4PA 4JI7L 4AQYQ 2HIVA 2I5HA 4DV5L 4BBSH 5JEAJ 3W1GA 1S3OA 3G6EA 1HNZQ 4BY7G 1I3QH 4HJ7A 1L1OB 4GN4B 2E2JH 1XPOA 4NXML 2CQOA 2NVQH 3HOYG 4DAMA 1Z9FA 2PQAA 4JI2L 4X65L 3HOWG 2WAQG 1X6OA 4R4QA 1PVOA 1YNXA 4OWTB 4IO9A 1HR0W 3AFQA 4EQ5A 4IFDJ 3GTJH 1W2BA 4P73A 5IWAQ 2E8GA 1X3FA 2R92H 4IOCA 4PZ7A 1UE5A 4DR3Q 1VS0A 1QUQB 1X55A 2F4VL 2JA9A 2UXBQ 2KHIA 4X62L 1JMCA 1Q1BA 2UU9Q 4A3GH 1B7YB 1L2FA 3GD7A 3AFPA 1A8VA 3BZCA 1XMQQ 3HOVH 2Z6KA 2JJQA 3J80i 4LUZA 3BZKA 4JI0Q 1NBWA 5FLXc 4LF9L 5GADC 3I4NG 1VQJA 1PYBA 4OONA 5IY0A 4JBJA 2R7ZH 1I94L 1JT8A 1XJVA 4GOPA 5JJLA 1TWAH 4JG2A 3H0GH 4FDBA 4DR2Q 2UUAL 1Q82C 1VQ6A 3S15H 3S14H 1JJGA 3J7ZC 2WP8J 1KQSA 4X66L 4A3DH 4IPCA 1E3PA 5IYDG 4QL5A 3BU2A 3PO2H 3TS0A 4DNIA 5M3MG 1L0WA 1CSQA 2NN6G 2KCMA 4TQUS 1LUZA 5J3BA 1GM5A 1HZAA 3J81i 1PH7A 1YHBA 1PFSA 1MIUA 2NVXH 2VUMH 2BA1A 1K8GA 1QZHA 2K75A 4JI3Q 1NJIC 5GAHC 2VQEQ 4GLXA 4PG3A 5C3EG 2HQLA 5M5WH 2Z6KC 1N9WA 3OTOL 5HY6A 3F2CA 3HOUH 1PH2A 1N34Q 1Y1VG 2E5LQ 4KI0A 3CCRA 4LNQA 5LMUL 2BH2A 1FL0A 4DV7L 1OXTA 5IT9c 2F52A 3FKIH 4LF8Q 4A3IH 4GOPC 1NY4A 2VL6A 1YJWA 2DUDA 3F1ZA 3K7UC 5C0XG 2UXDL 5ELOA 1VQFA 2Y0SE 4X64Q 3F2BA 1PH9A 3S1MH 4JI1L 4GNXB 1EQRA 1QUQA 1G51A 1VCIA 4UP9A 4ME3A 3A5UA 2QEXA 1PV4A 3KDFA 3VDYA 1QZGA 1HNZL 4LF4Q 3PIOA 4C3JH 4DV2Q 4A3EG 4LFCQ 1GVPA 3K80C 1VQEA 1KHIA 3HOXG 1M1KC 1ASYA 1TWGH 5GAEC 4DUYQ 5GROA 1K83H 3CPWA 4A3JH 1U0LA 2JA5H 1B70B 5C44H 4KHPQ 3K7AH 1C7YA 2NZOA 1WI5A 1N8RC 5IWAL 5IE8A 2KBNA 2K52A 1KD1C 2AWOA 3E9IA 1X56A 4YWLA 3J80c 3TREA 1IBKL 3HOZH 1HNWL 4O2DA 2A1AA 4AIMA 5M5XH 2VQFQ 1HNXQ 4JYAL 4PMWA 3GTMH 2N8NA 2HHHQ 2R92G 2R7DA 5HGQA 2ZM6Q 4JI6Q 4POGA 4OXPA 3T1HQ 1XNRQ 4DR6Q 4KLKA 3GTQH 1J5EQ 2K4KA 4DR5L 1W3SA 4A3GG 1YHQA 1EIFA 4DUZQ 3PGZA 4YCVA 3RNUA 1IBMQ 1VQLA 2CCZA 3HOVG 3PCOB 1VQBA 3RZDH 2IT1A 1HH2P 1YHAA 2VZAA 3J81c 4BBRG 1X9NA 1TXYA 4JI8L 3B6YA 5C4XH 4OO1I 4APVA 1UEBA 2WB1G 3ERSX 2PI2E 1X54A 3AQQA 2AHOB 2YTYA 1OXVA 4A3KG 4LF7Q 5BR8Q 3T1YQ 1VQCA 2UUCL 2UXCQ 1NMGA 2R6GA 4NXNL 5IP7H 3CCLA 4L5TA 1V9PA 1TWHH 3H15A 4HJAA 4POFA 1K8AC 2UUBQ 2OQ0A 3PO2G 5GAGC 4P74A 1IBLQ 1YJ9A 3H3VI 1VQGA 1E1TA 3UE1A 4LW1A 1SROA 4R4CA 3TQYA 4K0KQ 2PMZE 3D31A 4B3TL 2B29A 1E22A 4GKJL 3KF6B 2GVBA 4NB3A 4NPSA 1U5KA 3HKZG 3L0OA 3ICEA 1JB7A 5DLQE 1OXUA 1K3RA 4YY3L 4X64L 1QVGA 1GD7A 3FKIG 3UE0A 4UY8C 4B3RL 2ZJRA 2ASBA 1IXRA 1X3EA 4DV6Q 4QIWE 1PH3A 3I2ZA 2RCNA 1YBYA 1NTGA 2MO1A 4R4OA 4DR7Q 4IPHA 4LF4L 1E1OA 2R93G 3M7NA 4GKKQ 4GLAC 4DV2L 1UE7A 4OWWB 1VQKA 4KHZA 4B3SL 1HR0L 1KIXA 3ULLA 4A4IA 2YU9H 1Z47A 2Q2UA 3OYYA 1XMOQ 1SE8A 2ZTCA 1YI2A 4OX9L 1YZ6A 3WWVA 2JA8H 3U50C 4JC0A 1X65A 3IRBA 1Y14B 2D0PA 1P8LA 4C3HH 4DV1Q 2YTXA 3RZOH 4DV0Q 3I7FA 3GTLH 3PV0A 5C0XJ 1BKBA 3S1NH 1WFQA 3FHWA 4A3JG 1EQQA 1FJGL 4DV3Q 5IYCH 1I5FA 1Q81C 3GTOH 3M4QA 1MJCA 4A75A 1D8LA 3TS2A 2CFMA 3CP0A 5LMNQ 3HKZE 3HOZG 3STBC 4DR6L 3S2HH 2OQKA 4LFBL 5IYBH 4YHHQ 2WAQE 4JOIA 1JJ2A 2V1CC 1N32L 4YWMA 3W5OA 4DUZL 1RIPA 2YV5A 4IPDA 3J81j 2AMCB 3KFUA 1L1OA 3S1QH 3KYHC 1KRSA 1IL2A 2JK8A 1GKHA 1KXLA 1XTDA 4A3CH 4LFAL 5EAYA 1EYGA 4DR4Q 4B3MQ 2PI2A 1Y1WH 2CWAA 1PH6A 3CC4A 2K5HA 3EN2A 4GS3A 3CCJA 4OO1G 5JJIA 1PYSB 1N36Q 4JI5L 5C4XG 1HZCA 4DV4L 4LF6L 4AYBG 1XNQQ 2IX1A 2XTIA 1EFWA 4IPGA 1LYLA 1E7ZA 1WYDA 3K81C 3RLFA 5AJ3Q 3UDGA 2UUBL 3TEHB 4H02A 2F3IA 1VQPA 5E7NA 1K73C 4LF5L 4WJ3M 1NE3A 3ER0A 1WCMG 5IP7G 2ZTDA 3ULJA 1FGUA 4AQYL 1YIJA 1YJNA 1PHJA 1Q86C 4JI7Q 4DV5Q 4BY1H 2I5MX 2K14A 4DR1Q 1VQ7A 4JOIC 4A3MH 3CC2A 4JBWA 3GTPH 4XTCS 3HOWH 1OXSC 4P72A 2JE6I 3U4VA 2ALYB 4ALPA 1L1OC 3PF4A 4BBSG 4UP7A 3MEFA 5C4JH 4NXMQ 1XPUA 4JI2Q 4P75A 2LSSA 3PO3H 1XPRA 3RLOA 4BA1I 4X6AH 3KJPA 3CQZH 5JJKA 3CMEA 4RG1A 3I56A 1PA6A 4QY7A 2RHSB 4DR3L 3PUXA 3A0JA 2WFWA 3TRZA 5FJ8H 1S40A 1N33Q 2UXBL 4MNOA 3U58A 1CKNB 2UU9L 1YITA 2F4VQ 3S17H 4DPGA 1A62A 4BXXH 3I4NH 1XMQL 2EIFA 3M9BA 4X62Q 1PH4A 1WJJA 2ZJQA 4JI4Q 2LXJA 5H1SE 4JI0L 3OW2A 4LF9Q 4JCVE 1UE1A 4C2MH 4A3BH 5LMNW 1HZ9A 3EBEA 1SRUA 1WOCA 1I94Q 3GO5A 3A74A 4DR2L 1ASZA 5IP9H 2PQAB 3JC66 3JAMi 1M90C 3M4OH 1D7QA 2MFIA 2UUAQ 1MJEA 2R7ZG 3ZJYC 4A93H 2YYZA 3FP9A 4QGUA 4X66Q 4GNXA 3F8TA 3STBD 3H0GG 1PH5A 3SGIA 3G4SA 2QA4A 4A3FH 3LGJA 1HR0Q 5IYCG 2ES2A 2HT1A 4A3DG 4JI3L 2KCTA 1OXXK 1SN8A 1P16A 1VQMA 2VQEL 1DGSA 3CCUA 1H95A 3CAMA 2KHJA 2LXKA 2E2HH 2E5LL 4DK3C 2D0OA 3NELA 4C3IH 1N34L 3OTOQ 3G71A 1VQ9A 3AEVA 5IYBG 2VUMG 1O7IA 4HIKA 4EX5A 5LMUQ 1YEZA 3CC7A 4LF8L 2EXDA 3KLWA 3I55A 4YCWA 4DR4L 2JA6H 3S1RH 4GOPB 3HOUG 2E2IH 1X3GA 2QGQA 2B63H 2CKZB 4LUVA 3UDXA 4OWXB 2NZHA 4DK6C 3EIVA 2JQOA 5ELNA 3W1BA 1XNQL 2OWOA 4YCUA 4IOAA 3PIPA 2MO0A 4JI1Q 3S24A 2MNAA 4A3IG 4GNXC 2AKWB 4R4IA 4O0AA 1UWVA 3PF5A 3S16H 3ULPA 3CW2C 3HOXH 2OTJA 4JV5Q 4DR1L 1RL2A 2N3SA 4LFCL 3NEMA 4UP8A 3E9HA 2VY3A 1VQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  3A5Z B;  2WB1 E;  2A8V A;  1Q46 A;  3GTG H;  1K0R A;  4Y7N H;  1EIY B;  2B3G A;  1C9O A;  4DUY L;  1AH9 A;  1TWC H;  4QJF A;  1MKH A;  2IHE A;  2RF4 A;  4BY1 G;  3U4Z A;  4A3M G;  4BA2 I;  1CSP A;  1JE5 A;  1T9H A;  1CKM A;  2ID0 A;  2JA7 H;  4KHP L;  3RLN A;  3CXC A;  3KJO A;  3CCE A;  1SLJ A;  2R7F A;  4GN3 B;  3D0F A;  3M85 A;  5M3F H;  2JA5 G;  2JEB I;  3PO3 G;  2IX0 A;  5C44 G;  2L15 A;  1IBK Q;  1N33 L;  1BBW A;  2VQF L;  1UE6 A;  1V1Q A;  3CCM A;  2C35 B;  1HNX L;  3I4M H;  3S2D H;  1HNW Q;  2HHH L;  5FLM H;  4JYA Q;  1EOV A;  2ZM6 L;  4JI6 L;  3KDF B;  1XNR L;  3T1H L;  3JAM c;  2Y0S G;  4JI4 L;  1JJC B;  4R4T A;  4YWK A;  4MZ9 A;  3PUV A;  5FJ8 G;  1KC8 C;  2N78 A;  5JEA G;  4HJ8 A;  4GN5 A;  4BBR H;  4BXX G;  1IBM L;  4DR5 Q;  3KF6 A;  1OTC A;  4L5Q A;  2BH8 A;  1C0A A;  4A3K H;  1VQH A;  1J6Q A;  4A3L H;  2VW9 A;  4A3B G;  4JI8 Q;  2JEA I;  4JBK A;  3CCV A;  2PNH A;  2KEN A;  4IFD G;  3NBH B;  1VQ4 A;  2IHF A;  3CCQ A;  4DKA C;  4LF7 L;  5BR8 L;  5IP9 G;  3T1Y L;  2UXC L;  3DM3 A;  1VQ5 A;  3HFZ B;  4IJL A;  3CD6 A;  1LTL A;  2UUC Q;  4NXN Q;  1IYJ B;  1VQ8 A;  1Q7Y C;  4A93 G;  1KL9 A;  3GDE A;  1NMF A;  1KRT A;  4BY7 H;  1GO3 E;  1IBL L;  4J15 A;  4HJ9 A;  1AE2 A;  1AE3 A;  4QQB X;  1YVC A;  2I0Q A;  4A3F G;  1FVI A;  1I6H H;  4K0K L;  3F2D A;  3HOY H;  1SFO H;  1TWF H;  2XGT A;  1E24 A;  4HID A;  2GVA A;  5K36 G;  4B3T Q;  1VQD A;  1A0I A;  1G29 1;  4B3S Q;  4GKJ Q;  1Q8K A;  4PZ8 A;  3RR5 A;  4LWC A;  4RMF A;  4X65 Q;  4YY3 Q;  1Q1E A;  2N49 A;  3G48 A;  3RN5 A;  2JA6 G;  2R93 H;  2BA0 A;  2YTV A;  4DV6 L;  3K0X A;  1R9T H;  4B3R Q;  2B63 G;  2IY5 B;  1Q12 A;  4DR7 L;  3M3Y H;  2DGY A;  3K8A A;  1VQA A;  3CCS A;  1KAW A;  4JV5 L;  4GKK L;  2HIX A;  1IZ6 A;  1PH8 A;  3UDI A;  2VS1 A;  1HJP A;  3PUZ A;  2OCE A;  3J7A 5;  3NEN A;  1CUK A;  1EUJ A;  3PUY A;  2Q2I A;  2Z0S A;  3PUW A;  1XMO L;  4HJ5 A;  1S72 A;  1PH1 A;  1HZB A;  4UPA A;  4TVA B;  2MQH A;  4OX9 Q;  4AYB E;  4GLV B;  1CKO A;  1VQI A;  2Q2H A;  4DV1 L;  2A19 A;  4DV0 L;  1SR3 A;  4LUO A;  2CWP A;  4IFD I;  5IYD H;  2JA8 G;  1K9M C;  5M3M H;  1SMX A;  4DV3 L;  2JA7 G;  4XIG S;  1FJG Q;  2I5L X;  2NN6 I;  4DAY B;  4Y52 H;  4WJ4 A;  3DLL A;  3CF5 A;  3E0E A;  1LM0 A;  2K50 A;  3UDF A;  1BBU A;  3RN2 A;  3HKS A;  2ZTE A;  5LMN L;  1V43 A;  1B8A A;  2D62 A;  4P71 A;  1I50 H;  4PZ6 A;  5GQO A;  5C3E H;  5M3F G;  1J5E L;  1G6P A;  4YHH L;  1Y1V H;  1QVC A;  3I4O A;  4A76 A;  2ATW A;  3I4M G;  3KF8 B;  4LFB Q;  2OTL A;  2NVY H;  5FLM G;  4L5S A;  2EQS A;  1N32 Q;  2Q2T A;  1BVS A;  3AYH B;  1EWI A;  2AWN A;  2FXQ A;  3BJU A;  3L2P A;  1QVF A;  2K5V A;  4DV7 Q;  5M5Y H;  5C0X I;  4LFA Q;  4HIM A;  4HIO A;  4B3M L;  2H5X A;  4R1J A;  3L7Z C;  1N36 L;  1VQO A;  2RHQ B;  4A3C G;  2UXD Q;  4A3L G;  3MXN B;  3CMA A;  2ZJP A;  4L5R C;  1WCM H;  4JI5 Q;  2VNU D;  3Q8D A;  4JBM A;  4DV4 Q;  5AJ3 L;  4LF6 Q;  1Y1W G;  3GTK H;  3H3V H;  4IJH A;  1CKN A;  4AH6 A;  1A63 A;  4A3E H;  2GN5 A;  3KOJ A;  4LF5 Q;  4MTN A;  3PSI A;  2K5N A;  2NVT H;  3M4P A;  4JI7 L;  4AQY Q;  2HIV A;  2I5H A;  4DV5 L;  4BBS H;  5JEA J;  3W1G A;  1S3O A;  3G6E A;  1HNZ Q;  4BY7 G;  1I3Q H;  4HJ7 A;  1L1O B;  4GN4 B;  2E2J H;  1XPO A;  4NXM L;  2CQO A;  2NVQ H;  3HOY G;  4DAM A;  1Z9F A;  2PQA A;  4JI2 L;  4X65 L;  3HOW G;  2WAQ G;  1X6O A;  4R4Q A;  1PVO A;  1YNX A;  4OWT B;  4IO9 A;  1HR0 W;  3AFQ A;  4EQ5 A;  4IFD J;  3GTJ H;  1W2B A;  4P73 A;  5IWA Q;  2E8G A;  1X3F A;  2R92 H;  4IOC A;  4PZ7 A;  1UE5 A;  4DR3 Q;  1VS0 A;  1QUQ B;  1X55 A;  2F4V L;  2JA9 A;  2UXB Q;  2KHI A;  4X62 L;  1JMC A;  1Q1B A;  2UU9 Q;  4A3G H;  1B7Y B;  1L2F A;  3GD7 A;  3AFP A;  1A8V A;  3BZC A;  1XMQ Q;  3HOV H;  2Z6K A;  2JJQ A;  3J80 i;  4LUZ A;  3BZK A;  4JI0 Q;  1NBW A;  5FLX c;  4LF9 L;  5GAD C;  3I4N G;  1VQJ A;  1PYB A;  4OON A;  5IY0 A;  4JBJ A;  2R7Z H;  1I94 L;  1JT8 A;  1XJV A;  4GOP A;  5JJL A;  1TWA H;  4JG2 A;  3H0G H;  4FDB A;  4DR2 Q;  2UUA L;  1Q82 C;  1VQ6 A;  3S15 H;  3S14 H;  1JJG A;  3J7Z C;  2WP8 J;  1KQS A;  4X66 L;  4A3D H;  4IPC A;  1E3P A;  5IYD G;  4QL5 A;  3BU2 A;  3PO2 H;  3TS0 A;  4DNI A;  5M3M G;  1L0W A;  1CSQ A;  2NN6 G;  2KCM A;  4TQU S;  1LUZ A;  5J3B A;  1GM5 A;  1HZA A;  3J81 i;  1PH7 A;  1YHB A;  1PFS A;  1MIU A;  2NVX H;  2VUM H;  2BA1 A;  1K8G A;  1QZH A;  2K75 A;  4JI3 Q;  1NJI C;  5GAH C;  2VQE Q;  4GLX A;  4PG3 A;  5C3E G;  2HQL A;  5M5W H;  2Z6K C;  1N9W A;  3OTO L;  5HY6 A;  3F2C A;  3HOU H;  1PH2 A;  1N34 Q;  1Y1V G;  2E5L Q;  4KI0 A;  3CCR A;  4LNQ A;  5LMU L;  2BH2 A;  1FL0 A;  4DV7 L;  1OXT A;  5IT9 c;  2F52 A;  3FKI H;  4LF8 Q;  4A3I H;  4GOP C;  1NY4 A;  2VL6 A;  1YJW A;  2DUD A;  3F1Z A;  3K7U C;  5C0X G;  2UXD L;  5ELO A;  1VQF A;  2Y0S E;  4X64 Q;  3F2B A;  1PH9 A;  3S1M H;  4JI1 L;  4GNX B;  1EQR A;  1QUQ A;  1G51 A;  1VCI A;  4UP9 A;  4ME3 A;  3A5U A;  2QEX A;  1PV4 A;  3KDF A;  3VDY A;  1QZG A;  1HNZ L;  4LF4 Q;  3PIO A;  4C3J H;  4DV2 Q;  4A3E G;  4LFC Q;  1GVP A;  3K80 C;  1VQE A;  1KHI A;  3HOX G;  1M1K C;  1ASY A;  1TWG H;  5GAE C;  4DUY Q;  5GRO A;  1K83 H;  3CPW A;  4A3J H;  1U0L A;  2JA5 H;  1B70 B;  5C44 H;  4KHP Q;  3K7A H;  1C7Y A;  2NZO A;  1WI5 A;  1N8R C;  5IWA L;  5IE8 A;  2KBN A;  2K52 A;  1KD1 C;  2AWO A;  3E9I A;  1X56 A;  4YWL A;  3J80 c;  3TRE A;  1IBK L;  3HOZ H;  1HNW L;  4O2D A;  2A1A A;  4AIM A;  5M5X H;  2VQF Q;  1HNX Q;  4JYA L;  4PMW A;  3GTM H;  2N8N A;  2HHH Q;  2R92 G;  2R7D A;  5HGQ A;  2ZM6 Q;  4JI6 Q;  4POG A;  4OXP A;  3T1H Q;  1XNR Q;  4DR6 Q;  4KLK A;  3GTQ H;  1J5E Q;  2K4K A;  4DR5 L;  1W3S A;  4A3G G;  1YHQ A;  1EIF A;  4DUZ Q;  3PGZ A;  4YCV A;  3RNU A;  1IBM Q;  1VQL A;  2CCZ A;  3HOV G;  3PCO B;  1VQB A;  3RZD H;  2IT1 A;  1HH2 P;  1YHA A;  2VZA A;  3J81 c;  4BBR G;  1X9N A;  1TXY A;  4JI8 L;  3B6Y A;  5C4X H;  4OO1 I;  4APV A;  1UEB A;  2WB1 G;  3ERS X;  2PI2 E;  1X54 A;  3AQQ A;  2AHO B;  2YTY A;  1OXV A;  4A3K G;  4LF7 Q;  5BR8 Q;  3T1Y Q;  1VQC A;  2UUC L;  2UXC Q;  1NMG A;  2R6G A;  4NXN L;  5IP7 H;  3CCL A;  4L5T A;  1V9P A;  1TWH H;  3H15 A;  4HJA A;  4POF A;  1K8A C;  2UUB Q;  2OQ0 A;  3PO2 G;  5GAG C;  4P74 A;  1IBL Q;  1YJ9 A;  3H3V I;  1VQG A;  1E1T A;  3UE1 A;  4LW1 A;  1SRO A;  4R4C A;  3TQY A;  4K0K Q;  2PMZ E;  3D31 A;  4B3T L;  2B29 A;  1E22 A;  4GKJ L;  3KF6 B;  2GVB A;  4NB3 A;  4NPS A;  1U5K A;  3HKZ G;  3L0O A;  3ICE A;  1JB7 A;  5DLQ E;  1OXU A;  1K3R A;  4YY3 L;  4X64 L;  1QVG A;  1GD7 A;  3FKI G;  3UE0 A;  4UY8 C;  4B3R L;  2ZJR A;  2ASB A;  1IXR A;  1X3E A;  4DV6 Q;  4QIW E;  1PH3 A;  3I2Z A;  2RCN A;  1YBY A;  1NTG A;  2MO1 A;  4R4O A;  4DR7 Q;  4IPH A;  4LF4 L;  1E1O A;  2R93 G;  3M7N A;  4GKK Q;  4GLA C;  4DV2 L;  1UE7 A;  4OWW B;  1VQK A;  4KHZ A;  4B3S L;  1HR0 L;  1KIX A;  3ULL A;  4A4I A;  2YU9 H;  1Z47 A;  2Q2U A;  3OYY A;  1XMO Q;  1SE8 A;  2ZTC A;  1YI2 A;  4OX9 L;  1YZ6 A;  3WWV A;  2JA8 H;  3U50 C;  4JC0 A;  1X65 A;  3IRB A;  1Y14 B;  2D0P A;  1P8L A;  4C3H H;  4DV1 Q;  2YTX A;  3RZO H;  4DV0 Q;  3I7F A;  3GTL H;  3PV0 A;  5C0X J;  1BKB A;  3S1N H;  1WFQ A;  3FHW A;  4A3J G;  1EQQ A;  1FJG L;  4DV3 Q;  5IYC H;  1I5F A;  1Q81 C;  3GTO H;  3M4Q A;  1MJC A;  4A75 A;  1D8L A;  3TS2 A;  2CFM A;  3CP0 A;  5LMN Q;  3HKZ E;  3HOZ G;  3STB C;  4DR6 L;  3S2H H;  2OQK A;  4LFB L;  5IYB H;  4YHH Q;  2WAQ E;  4JOI A;  1JJ2 A;  2V1C C;  1N32 L;  4YWM A;  3W5O A;  4DUZ L;  1RIP A;  2YV5 A;  4IPD A;  3J81 j;  2AMC B;  3KFU A;  1L1O A;  3S1Q H;  3KYH C;  1KRS A;  1IL2 A;  2JK8 A;  1GKH A;  1KXL A;  1XTD A;  4A3C H;  4LFA L;  5EAY A;  1EYG A;  4DR4 Q;  4B3M Q;  2PI2 A;  1Y1W H;  2CWA A;  1PH6 A;  3CC4 A;  2K5H A;  3EN2 A;  4GS3 A;  3CCJ A;  4OO1 G;  5JJI A;  1PYS B;  1N36 Q;  4JI5 L;  5C4X G;  1HZC A;  4DV4 L;  4LF6 L;  4AYB G;  1XNQ Q;  2IX1 A;  2XTI A;  1EFW A;  4IPG A;  1LYL A;  1E7Z A;  1WYD A;  3K81 C;  3RLF A;  5AJ3 Q;  3UDG A;  2UUB L;  3TEH B;  4H02 A;  2F3I A;  1VQP A;  5E7N A;  1K73 C;  4LF5 L;  4WJ3 M;  1NE3 A;  3ER0 A;  1WCM G;  5IP7 G;  2ZTD A;  3ULJ A;  1FGU A;  4AQY L;  1YIJ A;  1YJN A;  1PHJ A;  1Q86 C;  4JI7 Q;  4DV5 Q;  4BY1 H;  2I5M X;  2K14 A;  4DR1 Q;  1VQ7 A;  4JOI C;  4A3M H;  3CC2 A;  4JBW A;  3GTP H;  4XTC S;  3HOW H;  1OXS C;  4P72 A;  2JE6 I;  3U4V A;  2ALY B;  4ALP A;  1L1O C;  3PF4 A;  4BBS G;  4UP7 A;  3MEF A;  5C4J H;  4NXM Q;  1XPU A;  4JI2 Q;  4P75 A;  2LSS A;  3PO3 H;  1XPR A;  3RLO A;  4BA1 I;  4X6A H;  3KJP A;  3CQZ H;  5JJK A;  3CME A;  4RG1 A;  3I56 A;  1PA6 A;  4QY7 A;  2RHS B;  4DR3 L;  3PUX A;  3A0J A;  2WFW A;  3TRZ A;  5FJ8 H;  1S40 A;  1N33 Q;  2UXB L;  4MNO A;  3U58 A;  1CKN B;  2UU9 L;  1YIT A;  2F4V Q;  3S17 H;  4DPG A;  1A62 A;  4BXX H;  3I4N H;  1XMQ L;  2EIF A;  3M9B A;  4X62 Q;  1PH4 A;  1WJJ A;  2ZJQ A;  4JI4 Q;  2LXJ A;  5H1S E;  4JI0 L;  3OW2 A;  4LF9 Q;  4JCV E;  1UE1 A;  4C2M H;  4A3B H;  5LMN W;  1HZ9 A;  3EBE A;  1SRU A;  1WOC A;  1I94 Q;  3GO5 A;  3A74 A;  4DR2 L;  1ASZ A;  5IP9 H;  2PQA B;  3JC6 6;  3JAM i;  1M90 C;  3M4O H;  1D7Q A;  2MFI A;  2UUA Q;  1MJE A;  2R7Z G;  3ZJY C;  4A93 H;  2YYZ A;  3FP9 A;  4QGU A;  4X66 Q;  4GNX A;  3F8T A;  3STB D;  3H0G G;  1PH5 A;  3SGI A;  3G4S A;  2QA4 A;  4A3F H;  3LGJ A;  1HR0 Q;  5IYC G;  2ES2 A;  2HT1 A;  4A3D G;  4JI3 L;  2KCT A;  1OXX K;  1SN8 A;  1P16 A;  1VQM A;  2VQE L;  1DGS A;  3CCU A;  1H95 A;  3CAM A;  2KHJ A;  2LXK A;  2E2H H;  2E5L L;  4DK3 C;  2D0O A;  3NEL A;  4C3I H;  1N34 L;  3OTO Q;  3G71 A;  1VQ9 A;  3AEV A;  5IYB G;  2VUM G;  1O7I A;  4HIK A;  4EX5 A;  5LMU Q;  1YEZ A;  3CC7 A;  4LF8 L;  2EXD A;  3KLW A;  3I55 A;  4YCW A;  4DR4 L;  2JA6 H;  3S1R H;  4GOP B;  3HOU G;  2E2I H;  1X3G A;  2QGQ A;  2B63 H;  2CKZ B;  4LUV A;  3UDX A;  4OWX B;  2NZH A;  4DK6 C;  3EIV A;  2JQO A;  5ELN A;  3W1B A;  1XNQ L;  2OWO A;  4YCU A;  4IOA A;  3PIP A;  2MO0 A;  4JI1 Q;  3S24 A;  2MNA A;  4A3I G;  4GNX C;  2AKW B;  4R4I A;  4O0A A;  1UWV A;  3PF5 A;  3S16 H;  3ULP A;  3CW2 C;  3HOX H;  2OTJ A;  4JV5 Q;  4DR1 L;  1RL2 A;  2N3S A;  4LFC L;  3NEM A;  4UP8 A;  3E9H A;  2VY3 A;  1VQN A; 
#chains in the Genus database with same CATH topology
 3CPF A;  3A5Z B;  5KYI A;  2A8V A;  1A2U A;  4Y7N H;  2B3G A;  1D2B A;  1C9O A;  1TWC H;  4BY1 G;  2RF4 A;  2IHE A;  4BA2 I;  1DOL A;  1JE5 A;  3ITP A;  3MA2 B;  1BCP C;  4KHP L;  1TKW B;  3TME A;  3RLN A;  2JYO A;  2KEE A;  1T5E A;  1JB3 A;  5L37 A;  3D0F A;  2QW7 A;  3OOC A;  3M85 A;  2JA5 G;  2JEB I;  3PO3 G;  1IBK Q;  1BBW A;  1HNX L;  3OPO A;  2HHH L;  2YU9 B;  2ZM6 L;  4JI6 L;  3NUC A;  4B9W A;  1ESR A;  2A6H C;  2Y0S G;  1KC8 C;  4R4T A;  2N78 A;  4HJ8 A;  4BBR H;  4BXX G;  3GTL B;  3S1N B;  4L5Q A;  1TS5 A;  4DNR B;  1SYE A;  1VQH A;  1J6Q A;  4A3L H;  2VW9 A;  4JI8 Q;  3AB9 A;  2MHV A;  4JBK A;  3MFY A;  4R9W A;  5ELD A;  2PNH A;  5IIF A;  3NBH B;  3CCQ A;  3NK9 A;  5KGU A;  3DM3 A;  1VQ5 A;  1LTL A;  4NXN Q;  4BY7 H;  1GO3 E;  5EKK A;  1AE2 A;  1CZG A;  1CI3 M;  1JQY D;  2MUY A;  1FVI A;  4K5W A;  3HZX A;  4K0K L;  3F2D A;  4EQO A;  1FNW A;  1GHJ A;  1E24 A;  2GA4 B;  2KCC A;  1B3Q A;  2L11 A;  2D9U A;  3A55 A;  3OMC A;  1X3Q A;  1S4Z A;  5IOC A;  1E2V A;  1Q1E A;  3D6W A;  3H3V C;  1B50 A;  2N49 A;  4KY7 A;  3SK5 A;  1TS4 A;  2EY5 A;  2JA6 G;  2R93 H;  4DV6 L;  3K0X A;  1Y8O B;  2B63 G;  2IY5 B;  4DR7 L;  3FRP B;  4F87 A;  2B8G A;  2DGY A;  2F0V A;  3K8A A;  3CCS A;  1KAW A;  3U9O A;  4J6H A;  1HJP A;  2OCE A;  1M4V A;  1STN A;  1SMY C;  1XMO L;  2Q2I A;  1S72 A;  4KY6 A;  4TVA B;  5CV5 A;  5I4D A;  4KD4 A;  4ZUJ A;  1SNC A;  4IFD I;  5IYD H;  2RDH A;  1K9M C;  2JA8 G;  1HA5 A;  5CV6 A;  1SMX A;  2K6A A;  3T4A C;  1FJG Q;  4DAY B;  3S17 B;  1NR2 A;  4WJ4 A;  3CF5 A;  3UDF A;  1BBU A;  2ZTE A;  2D2C C;  4K8I A;  2D62 A;  5M3F G;  5GQO A;  2F03 A;  4A3B B;  1QVC A;  4A76 A;  1XX8 A;  3TP5 A;  5JJZ A;  2NVY H;  5CYU A;  3D6C A;  1LT3 D;  2EQS A;  4DA2 A;  4KHV A;  3OWF A;  4MN3 A;  1LTS D;  2F0M A;  2QEJ C;  5C0X H;  2F0O A;  4ZKC B;  3EFX D;  4LFA Q;  3NTK A;  3DM1 A;  1MHW C;  2DJG C;  3NBI A;  4A3F B;  1EEF D;  5CR3 A;  3MXN B;  4JI5 Q;  1KDB A;  4DV4 Q;  4LF6 Q;  2EXZ A;  1EY8 A;  5LL6 X;  2E2H B;  4A3E H;  4LF5 Q;  4MTN A;  1EYD A;  4JI7 L;  2HIV A;  2I5H A;  4O42 A;  3TZU A;  3W1G A;  3G6E A;  4OEM B;  4DFA A;  3S1R B;  1HNZ Q;  4HJ7 A;  3R2I A;  2H1E A;  4XXE A;  1XPO A;  4NXM L;  2EYL A;  5CV8 A;  4DAM A;  4JI2 L;  2F0E A;  1UNS A;  2WAQ G;  1TU2 B;  4OWT B;  4IO9 A;  3OHX C;  4IFD J;  4EQ5 A;  5IT9 L;  2KUM A;  1SE3 A;  3P20 A;  4NP5 A;  4P73 A;  3LWE A;  5G3L D;  1SYC A;  1X3F A;  3QO2 A;  5C3W A;  1X55 A;  1JOR A;  1TY2 A;  2NVQ B;  2MGS A;  4YIJ A;  4NMZ A;  2JA7 B;  3J80 i;  4LUZ A;  3BZK A;  1CQF A;  5EJW A;  2EYJ A;  4OON A;  1BDO A;  5IY0 A;  2R7Z H;  1XJV A;  2EY2 A;  4FDB A;  2UUA L;  1Q82 C;  3I4M B;  3S14 H;  1JJG A;  3J7Z C;  1KQS A;  4X66 L;  4A3D H;  4IPC A;  1F2L A;  3ERQ A;  5M3M G;  2NN6 G;  1S5B D;  2KCM A;  2ZXR A;  4ZAI A;  1HQR D;  1YHB A;  2NVX H;  1XTC D;  2VUM H;  5J39 A;  1M8A A;  1TWA B;  5E4X A;  5C3E G;  4A3K B;  1PH2 A;  2E5L Q;  1Y1V G;  2Z4I A;  4KI0 A;  2IX3 A;  1JOQ A;  5IT9 c;  4LF8 Q;  1JR0 D;  2VL6 A;  3F1Z A;  3S1M H;  5IT9 E;  2QF7 A;  4GNX B;  5EPK A;  4RCN A;  1VCI A;  4UP9 A;  1B2T A;  3NQT A;  3NTI A;  4RKL A;  2B2Y A;  4XQJ A;  3HKZ B;  2TSS A;  2QEX A;  3KDF A;  1PFM A;  4IUQ A;  1HNZ L;  1ENF A;  3BDO A;  1VQE A;  1KHI A;  2ICE C;  1TVX A;  5GRO A;  1PTO C;  1B70 B;  4K2K A;  1C7Y A;  4KKS A;  1I4Q A;  3IFD A;  2M00 A;  2K52 A;  3K0Y A;  2P5Z X;  3E9I A;  2XIW A;  2B2U C;  2LMC B;  2A1A A;  5M5X H;  2VQF Q;  4PMW A;  1LTB D;  1TWG B;  5HGQ A;  4EQN A;  4POG A;  4XT3 B;  1KAA A;  3HG9 A;  4K5X A;  4DR5 L;  1W3S A;  4XQN A;  1YHQ A;  2QDL A;  4A3G G;  1IBM Q;  2I07 B;  3HOV G;  3PCO B;  1W6K A;  4ZKB B;  4OO1 H;  1DOK A;  2L9H A;  1UEB A;  3ERS X;  2PI2 E;  1X54 A;  2NWG A;  5BR8 Q;  2UXC Q;  1NMG A;  5IP7 H;  3CCL A;  1LLR D;  4HJA A;  1KNE A;  3H15 A;  4I7Z C;  1K8A C;  4IUV A;  1JC7 A;  1ENC A;  4NW2 A;  4P74 A;  1EY6 A;  1DZ1 A;  1E1T A;  4EQP A;  1SRO A;  3TQY A;  1WTV A;  3MVV A;  2QKI C;  4B3T L;  5EPL A;  4RHR A;  3CRK C;  5CGK A;  2HD3 A;  5ELB A;  3ICE A;  1K3R A;  3GTK B;  3FKI G;  4B3R L;  2V4D A;  4M8A A;  2NVT B;  2ASB A;  1X3E A;  4QIW E;  4CGY B;  4BBS B;  4JPB W;  2MO1 A;  5C4Z A;  1I3Q B;  1GHK A;  1NR4 A;  3URY A;  4GKK Q;  4F88 A;  1C4Q A;  3VR6 A;  1HR0 L;  1KIX A;  2YU9 H;  3BVZ A;  1GUN A;  1YI2 A;  1SAP A;  4JC0 A;  1B9M A;  2VB3 X;  1P8L A;  4CBV A;  4X3T A;  2R92 B;  1X3P A;  1STA A;  4DV0 Q;  5LHY 1;  3GTL H;  2ZXP A;  5C0X J;  1BKB A;  3S1N H;  1AZQ A;  4A3J G;  2AQ3 B;  1H9R A;  4DV3 Q;  5ISR A;  1U4P A;  3AU7 A;  1L0X B;  1UEA B;  1PRT B;  3OIP A;  3TS2 A;  2OQK A;  4V19 0;  5IYB H;  4YHH Q;  5IOD A;  4JOI A;  1BOS A;  2WB1 B;  3RZO B;  3J81 j;  2YV5 A;  3KFU A;  3D8G A;  3KYH C;  2FHT A;  4ZUI A;  3ONA B;  1SJH D;  3TP8 A;  1EY4 A;  4DR4 Q;  3PO2 B;  2F0T A;  4F8M A;  3VYR A;  3T51 B;  2EE1 A;  1PH6 A;  3RUZ A;  1PYS B;  4G4K A;  2IX1 A;  4IPG A;  1Q90 A;  3K81 C;  2PZU A;  3TEH B;  3TP6 A;  3HOU B;  3S1Q B;  1YJN A;  1E0B A;  1FGU A;  1BR9 A;  4CDF C;  1Q86 C;  1QNK A;  2XN9 C;  4DR1 Q;  1Y8P B;  4A3M H;  5DM6 3;  3PIO 3;  4LMQ D;  2E2D C;  4FF3 A;  1EZ8 A;  1BXT A;  3QG1 A;  5BN3 A;  3MTS A;  4UP7 A;  1ML0 D;  4DU9 A;  1XPU A;  1XPR A;  1CQV A;  4KV6 A;  1LT5 D;  5JJK A;  5FK9 C;  2A69 D;  1VMP A;  2RHS B;  4DR3 L;  1MGS A;  2WFW A;  3TRZ A;  1A6X A;  5EQ0 A;  3VR5 A;  3U58 A;  5EGT A;  5IGB A;  2F4V Q;  3S17 H;  3TBI B;  4X62 Q;  1PH4 A;  1CM9 A;  1K83 B;  4JI4 Q;  4JI0 L;  5C5L A;  2JA5 B;  1SXT A;  3K5L A;  1SYD A;  4J8Q A;  4A3B H;  5EPJ A;  4FVM A;  4HCS A;  3GO5 A;  3A74 A;  2DNC A;  1ASZ A;  5IP9 H;  3JC6 6;  3HOZ B;  4A93 H;  5FO8 B;  4UDU C;  3F8T A;  3P7J A;  3UI2 A;  1AN8 A;  3SGI A;  4A3F H;  5IYC G;  3HP3 A;  4CHT B;  2MJ8 A;  1DON A;  2VQE L;  1DGS A;  1H95 A;  3RZD B;  3CAM A;  1SNP A;  2E2H H;  3FMC A;  3AEV A;  4DK3 C;  1VQ9 A;  3OTO Q;  5C4X B;  4HIK A;  1Q8I A;  3KLW A;  4DR4 L;  4YCW A;  3S1R H;  2XSC A;  2OT2 A;  2QGQ A;  1KDA A;  2CH4 W;  2PNR C;  4OWX B;  1S5D D;  2RBM A;  3QOJ A;  1HPC A;  2B39 A;  3S24 A;  4A3I G;  2MNA A;  5JPM C;  3IFT A;  3ULP A;  1VMC A;  1SDF A;  1A3U A;  4LAA A;  3DUZ A;  4DR1 L;  3NEM A;  2JA6 B;  1JWS D;  3E9H A;  2VY3 A;  1VQN A;  4HAE A;  2N88 A;  1K0R A;  4PMB A;  3VYU A;  3CHB D;  3CU7 A;  1CSP A;  1T9H A;  2JA7 H;  1STB A;  1AW7 A;  2A68 D;  1SLJ A;  3J7A F;  1D1K A;  4IUU A;  1U4M A;  2A74 C;  2IX0 A;  1HNW Q;  3CCM A;  1V1Q A;  2C35 B;  3I4M H;  3QJY A;  5FLM H;  1EOV A;  1D5Z C;  3KDF B;  1XNR L;  2JA8 B;  5KIX A;  4JI4 L;  1JJC B;  1J5E Q;  4MZ9 A;  2PMZ B;  5ELC A;  3HS0 C;  4ILW A;  4C3H B;  5E1F A;  1OTC A;  1V1P A;  1WTX A;  4ZYS A;  1KLG D;  4A3K H;  5TSS A;  4H0L C;  4KN4 C;  2KA7 A;  3GTO B;  4IFD G;  5COR A;  4G7O C;  1VQ4 A;  2IHF A;  2HUG A;  3C1F A;  3T1Y L;  3VA7 A;  1EQV A;  3HFZ B;  4IJL A;  3CD6 A;  2UUC Q;  4CJ2 C;  1Q7Y C;  1PZK D;  3GDE A;  1IBL L;  4HJ9 A;  4RA8 A;  2I0Q A;  4HID A;  3WOE A;  3C1E A;  2GVA A;  1XXG A;  1A0I A;  1GUS A;  4OIJ A;  3KBG A;  4CKB A;  2RA4 A;  3FEW X;  3G48 A;  1RHP A;  2BA0 A;  5FKA C;  4I7A A;  2PPB C;  3QR8 A;  1EWC A;  3K5O A;  3QIA A;  1DJR D;  1F2Z A;  4ZQ3 A;  2WAQ B;  1FGB D;  4U67 3;  3UDI A;  1KAB A;  4R8N A;  1SNO A;  5C4J B;  3J7Y W;  1H9S B;  1WVL A;  1CUK A;  1EUJ A;  1H9J A;  4KN7 C;  4HJ5 A;  1EY7 A;  3FPU B;  2M9V A;  2PZT A;  2MQH A;  4OX9 Q;  3CQZ B;  4GLV B;  1CKO A;  4NDX A;  3F2U A;  2I5L X;  1O7Y A;  2PCF B;  3DLL A;  1SBB B;  3RN2 A;  3VA5 A;  5LMN L;  4P71 A;  1J5E L;  1G6P A;  2L4N A;  4C2M B;  3I4O A;  2ATW A;  2K5W A;  2OF1 A;  4L5S A;  2OXP A;  1N32 Q;  2Q2T A;  1EWI A;  2AWN A;  3BJU A;  3T53 B;  1QVF A;  3Q24 A;  3BVG A;  4HIM A;  4B3M L;  1JCK B;  2H5X A;  3L7Z C;  3G7L A;  3DXJ C;  2CW0 C;  4A3C G;  4A3L G;  2EYM A;  3CMA A;  3OIQ A;  3NQI A;  5AJ3 L;  1Y1W G;  3GTK H;  4IJH A;  1CKN A;  2Z6B A;  4C3I B;  4FF1 A;  3KOJ A;  2NVT H;  2K5N A;  1SEB D;  1HCZ A;  3KK7 A;  4AQY Q;  4DV5 L;  4BBS H;  5M9O A;  1YNN D;  1F9P A;  3LWU A;  4BY7 G;  1I3Q H;  2E2I B;  4GN4 B;  2B8F A;  1X6O A;  2N55 A;  4R4Q A;  1YNX A;  4NKL A;  1PVO A;  2B2V C;  3S16 B;  4G7H C;  4XDX A;  2R92 H;  4IOC A;  3DEP A;  4FO2 A;  2F0J A;  2JA9 A;  2KQ3 A;  2UXB Q;  2UU9 Q;  2A69 C;  1Q1B A;  1B7Y B;  3GD7 A;  1XMQ Q;  3BZC A;  2KCN A;  2Q8I B;  4HN7 A;  4LF9 L;  3I4N G;  1PYB A;  5ELF A;  4CKE A;  1HTP A;  1JT8 A;  4Z9C B;  2E74 C;  5JJL A;  4M1U B;  4DR2 Q;  3MWY W;  3S15 H;  4L8J A;  4A3G B;  4K6L A;  5IYD G;  3HOV B;  3PO2 H;  4DNI A;  2QDB A;  1L0W A;  1GM5 A;  2AUJ D;  1OO9 B;  1PH7 A;  4RGO S;  1MIU A;  2BA1 A;  1K8G A;  1QZH A;  2K75 A;  1BNZ A;  5GAH C;  1EYA A;  4ABN A;  2HQL A;  4G7Z C;  2Z6K C;  1HFG A;  3HOU H;  2XWJ B;  3CCR A;  5LMU L;  2L12 A;  3NWS A;  2BCO A;  5D3D A;  3BZD B;  4GOP C;  2B2T C;  2A6E D;  1NY4 A;  4Q5V A;  1RJT A;  5C0X G;  1VQF A;  4X64 Q;  3F2B A;  3J81 L;  2PYK A;  4JI1 L;  1UUP A;  1QUQ A;  4ME3 A;  3A5U A;  3HOY B;  4O1N A;  4LF4 Q;  1S5C D;  4A3E G;  2FFK B;  3K80 C;  3Q22 A;  3HOX G;  1M1K C;  4DUY Q;  3T16 A;  1K83 H;  4KTA A;  1BBX C;  4K8J A;  2JA5 H;  4MIU A;  3DHQ A;  1O7Z A;  1WI5 A;  1N8R C;  5IE8 A;  2KBN A;  2NBF A;  1KD1 C;  5KNC A;  1IBK L;  3HOZ H;  3TRE A;  3MZ5 A;  4O2D A;  4S3S A;  2KHS A;  2F0N A;  4KK7 A;  5CBE E;  3T1H Q;  1S5F D;  3FPP A;  1VQL A;  3J7A V;  4CDC C;  1VQB A;  2G5D A;  4WFN 3;  3RZD H;  1HH2 P;  5I2X A;  1BUV T;  5EKL A;  3J81 c;  2K32 A;  1TXY A;  4JI8 L;  5C4X H;  1I50 B;  1OXV A;  4LF7 Q;  1X32 A;  4K5V A;  3H91 A;  4NXN L;  3DWQ A;  3J81 E;  4E6I A;  2JXM B;  1KDC A;  1V9P A;  3ERO A;  2JP1 A;  4POF A;  2UUB Q;  2OQ0 A;  1YJ9 A;  4OIK A;  1VQG A;  1HRJ A;  2Q8R E;  3UE1 A;  5I6W A;  4RGM A;  1F9Q A;  2CH4 A;  4LW1 A;  5DEH A;  3D31 A;  2B29 A;  1E22 A;  1D5X C;  1RTN A;  4NPS A;  3L0O A;  1IL8 A;  1PZI D;  1QVG A;  4X64 L;  1GD7 A;  3N52 A;  2ZJR A;  2B2W C;  1O80 A;  2IJ0 A;  3I2Z A;  2RCN A;  4R4O A;  4ODG A;  4HTH A;  4IPH A;  4LF4 L;  3FVQ A;  3KLS A;  4GLA C;  1UE7 A;  4OWW B;  2E2J B;  4KHZ A;  4FF2 A;  4MTK A;  3ULL A;  2PQE A;  1Z47 A;  2Q2U A;  1SE8 A;  2JA8 H;  1YZ6 A;  4WJW A;  3GTJ B;  1X65 A;  1TS2 A;  3I70 A;  4RGN A;  2EYO A;  3V2T A;  4C3H H;  4DV1 Q;  2EZV A;  3I7F A;  3SEB A;  1FJG L;  4XQQ A;  1PRT D;  2XRS D;  1I5F A;  3GTO H;  3K58 A;  3P75 A;  3O13 A;  1D8L A;  2K04 A;  3CP0 A;  3HKZ E;  1MSG A;  5KYL A;  2V1C C;  3W5O A;  1I4G A;  1S5E D;  1CT1 D;  1L1O A;  4C1N K;  5F2D A;  3OMG A;  4LFA L;  5EAY A;  1K8O A;  5C5M A;  3MC0 B;  3H6M A;  1GUW A;  4OO1 G;  4GS3 A;  1N36 Q;  4JI5 L;  5T1I A;  4DV4 L;  1YNJ C;  4LF6 L;  2XTI A;  1LYL A;  1E7Z A;  2UUB L;  5M5W B;  4H02 A;  2F3I A;  1K73 C;  4LF5 L;  4WJ3 M;  3ER0 A;  1WCM G;  5IP7 G;  2ZTD A;  1PHJ A;  2NZ1 D;  1EU3 A;  2K14 A;  3CC2 A;  4XTC S;  4A3I B;  4P72 A;  2JE6 I;  3VR3 A;  1YNN C;  5C4J H;  1BO0 A;  2LSS A;  3EA6 A;  1WD0 A;  2G9H D;  3CQZ H;  2BDN A;  3I56 A;  3PUX A;  4C3J B;  1J8I A;  5FJ8 H;  4LK1 C;  1S40 A;  5JEA H;  4MNO A;  1CKN B;  3BDC A;  3EVQ A;  2EIF A;  1RKN A;  1SSO A;  1L0Y B;  4N8F A;  2ZJQ A;  3TZD A;  5CBA E;  5IGF A;  3OW2 A;  3A7A B;  4C2M H;  4QB4 A;  5JVH 3;  2WAC A;  4H13 C;  1I94 Q;  4IN3 A;  1DYQ A;  2NN6 H;  2FJ2 A;  1Q3L A;  2KOL A;  1MJE A;  3ZJY C;  3FP9 A;  4QGU A;  3STB D;  5FOB B;  2SNS A;  3H0G G;  2QA4 A;  3GTQ B;  3LGJ A;  3QB3 A;  2ES2 A;  2HT1 A;  2EVB A;  3SHL A;  1P16 A;  1SE2 A;  5K36 H;  4PNY A;  3VYS A;  4JK1 C;  2E5L L;  4C3I H;  3NEL A;  2L1B A;  5IYB G;  2RVL A;  4AYB B;  1O7I A;  4EX5 A;  1O7L A;  3ZYY X;  3K57 A;  4LF8 L;  1NSN S;  2EXD A;  4B08 A;  1WTR A;  3WOF A;  2E2I H;  3UDX A;  4IUR A;  1TWH B;  3EIV A;  2JQO A;  1PRT F;  3W1B A;  5D65 A;  3EQL C;  4GNX C;  3S16 H;  1STY A;  2OTJ A;  4CDE C;  2N3S A;  2CHB D;  2G9D A;  1KNA A;  2WB1 E;  1WTH A;  3U4Z A;  4A3M G;  3NPP A;  2ID0 A;  3DWP A;  1HQM C;  4RAU C;  2NUC A;  3KJO A;  3CXC A;  1JWU D;  1NNX A;  3QOL A;  5C44 G;  3X3M A;  2VQF L;  3D4W A;  1CHP D;  4FNF A;  4JYA Q;  3T13 A;  4J1M A;  1ZYR D;  2ZT9 C;  3KUP A;  2E75 C;  2VB2 X;  2NTT A;  4YWK A;  2CQA A;  2F0H A;  2F0K A;  4GN5 A;  2PW5 A;  1IBM L;  1GOZ A;  2LFN A;  3KF6 A;  2BDO A;  4RH6 A;  2B2T A;  4EVO A;  1A15 A;  1JWM D;  4A3B G;  2JEA I;  1IW7 D;  4KD3 A;  1WTO A;  4DKA C;  5BR8 L;  5HUR A;  5IP9 G;  2UXC L;  4H44 C;  5I2Y A;  1IYJ B;  4A93 G;  3V96 A;  1KRT A;  4J15 A;  2WKD A;  1D5M C;  1AE3 A;  1CTM A;  1YVC A;  4A3F G;  4ZRZ A;  3HOY H;  3QWN A;  1HA6 A;  4DXG A;  1Y1W B;  1WTQ A;  3L9A X;  3I3C A;  1G29 1;  4GKJ Q;  1Q8K A;  4ID6 A;  4X3S A;  3RR5 A;  4LWC A;  3KBX A;  4QF4 A;  4YY3 Q;  2AQ1 B;  3RN5 A;  2M2L A;  4FP5 D;  4KKU A;  1Q12 A;  4BY1 B;  1DCZ A;  4GKK L;  2HIX A;  1PH8 A;  2HDL A;  4PV1 C;  5T1G A;  3PUZ A;  3J7A 5;  1BCP D;  3NEN A;  1UAP A;  4B3S Q;  3PUY A;  3PUW A;  5J22 A;  3PO3 B;  4UPA A;  4IUT A;  1G2T A;  1QG7 A;  1SNM A;  3GV6 A;  1VQI A;  2A19 A;  4DV0 L;  2EDG A;  2Y0S B;  1Y8N B;  2DY8 A;  3GP7 A;  3NHH A;  4XIG S;  4DV3 L;  2WV6 D;  2JA7 G;  3TDQ A;  2NN6 I;  3SK6 A;  3I4N B;  1KLU D;  4HMI A;  4OHJ A;  3E0E A;  1LM0 A;  2K50 A;  4IUP A;  1PRT C;  1B8A A;  3U9S A;  3C3L A;  1I50 H;  4YHH L;  1ESF A;  3PMF A;  3I4M G;  4LFB Q;  3DMU A;  2PO4 A;  2RQX A;  5FLM G;  3I72 A;  3M4O B;  1BVS A;  1SYF A;  5D3I B;  3L2P A;  1JIC A;  2K5V A;  1EY9 A;  2J7Z A;  3A56 A;  1DD2 A;  5FLX L;  3LX0 A;  1II3 A;  4ZCK A;  4IAL A;  1H9K A;  1QOH A;  3BYY B;  1RTO A;  2UXD Q;  3BG3 A;  1GUO A;  3PIP 3;  4X3K A;  4HED A;  2KJX A;  3NTH A;  4B9X A;  5JEA J;  2BE5 D;  1S3O A;  2WKC A;  2B63 B;  1L1O B;  2E2J H;  4OEL B;  2CQO A;  2NVQ H;  2PQA A;  3HOW G;  1HUM A;  1HR0 W;  2F3V A;  3AFQ A;  4DAY A;  3GTJ H;  2EJF C;  3HOX B;  2E8G A;  3MFG A;  2RDG A;  1EYC A;  1ZEQ X;  1FYC A;  3PQI A;  4X3U A;  2F4V L;  1SMY D;  3GTG B;  2KHI A;  2C5C A;  5JOB A;  4X62 L;  1JMC A;  3AFP A;  1A8V A;  2KVM A;  3BS1 A;  1EQT A;  1NBW A;  5FLX c;  2K01 A;  2D5D A;  1ROD A;  4JBJ A;  5M3F B;  1TWA H;  4KJN A;  4K6D A;  1PFB A;  4IUN A;  1G6Z A;  1VQ6 A;  3S2D B;  5FLX E;  2AQ2 B;  5I9O A;  2WP8 J;  1STG A;  4RWS C;  2J0T D;  4QL5 A;  1EIG A;  3TS0 A;  4TQU S;  1LUZ A;  3J81 i;  2KED A;  4WOR A;  4JI3 Q;  4TRD A;  1DM0 B;  1NJI C;  4GLX A;  1SND A;  1BCP F;  5M5W H;  3OTO L;  1N9W A;  5HY6 A;  4U68 A;  1N34 Q;  3I73 A;  4LNQ A;  2BH2 A;  1FL0 A;  2X6L A;  1OXT A;  1D1I A;  1LT6 D;  2F52 A;  5EBC A;  1BQQ T;  4A3I H;  2F0F A;  1YJW A;  2DUD A;  4DF7 A;  1AFP A;  2UXD L;  5ELO A;  1PH9 A;  2B2U A;  3W3A A;  1EQR A;  3E6Z X;  5IGD A;  1LV9 A;  3LNN A;  1I6H B;  2EJM A;  1SFO B;  1TWF B;  1QZG A;  4N9P A;  3SR1 A;  4ZK9 B;  3PIO A;  4C3J H;  3P1H A;  4LFC Q;  1GVP A;  3MXU A;  4GZY C;  1RCV D;  1ASY A;  1TWG H;  5GAE C;  3WDN A;  4PMC A;  1BCP B;  1R9T B;  1JE4 A;  1DOM A;  2K33 A;  4KHP Q;  4QUC A;  2NZO A;  3M3Y B;  3I4L A;  2R61 A;  3SXH A;  2AWO A;  1HNW L;  1TII D;  4MHE A;  5HGT A;  1HNX Q;  2N8N A;  2HHH Q;  2LKV A;  2R92 G;  2R7D A;  2ZM6 Q;  4JI6 Q;  2X6G A;  1I4P A;  4DR6 Q;  4KLK A;  3GTQ H;  1CA5 A;  2EPB A;  3BVM A;  5J1Z A;  1EIF A;  4DUZ Q;  1PYW D;  2K28 A;  2CCZ A;  5M3M B;  1EU4 A;  4FXD A;  1FNU A;  4BBR G;  3HGB A;  1BF4 A;  1I4H A;  2SEB D;  2WB1 G;  5CV7 A;  1V1O A;  3AQQ A;  5D14 A;  2YTY A;  5C3E B;  1J9O A;  1VQC A;  2UUC L;  1IW7 C;  1Y1V B;  2R6G A;  1PXU A;  4L5T A;  1TWH H;  3MXG A;  3PO2 G;  1IKM A;  2NYZ D;  2L0C A;  4R4C A;  4FXK C;  3R2T A;  4K0K Q;  5M5Y B;  5IGE A;  4DAP A;  2FMM A;  3KF6 B;  2GVB A;  4KKT A;  4NB3 A;  1U5K A;  1WCM B;  3K5N A;  1OXU A;  3BDL A;  3V05 A;  2F1M A;  4UY8 C;  4RCO A;  1IXR A;  4DV6 Q;  1FNV A;  4DR7 Q;  1NTG A;  3MAQ A;  3DWA A;  2C9O A;  2R93 G;  1F2Y A;  1R4P B;  3TN2 A;  2IL8 A;  1QIL A;  3A8J E;  4FF4 A;  3KF8 A;  1VQK A;  1PTO D;  1EL0 A;  5JAV A;  2F0D A;  1ZKO A;  1EZ6 A;  5KNB A;  3OYY A;  1XMO Q;  2SNM A;  4OX9 L;  1Y14 B;  2D0P A;  3RZO H;  2YTX A;  2XVS A;  4LJZ C;  2JN4 A;  1WFQ A;  3FHW A;  4UAI A;  2ENB A;  2A5H A;  2Z4H A;  3CRL C;  4RHS A;  1KXL A;  2CFM A;  2K1B A;  3HOZ G;  4DR6 L;  2F4I A;  3SDZ A;  2BOS A;  3Q0A A;  2F0W A;  1JJ2 A;  2IWH A;  1N32 L;  1Z6H A;  4DUZ L;  1RIP A;  2DNE A;  2AMC B;  2HQE A;  1VF5 C;  3H0G B;  2O5I C;  5FO7 B;  3S1Q H;  1SNQ A;  2A73 B;  5JPN C;  1IL2 A;  1GKH A;  3SK8 A;  4A3C H;  4ULL A;  5A2Q L;  2EJG C;  2PI2 A;  1Y1W H;  3OW7 A;  3CC4 A;  2K5H A;  3EN2 A;  4BWG B;  5C4X G;  1EOT A;  1HZC A;  2LY7 A;  3NP8 A;  4FXG C;  1WYD A;  3RLF A;  5E7N A;  4AQY L;  3ULJ A;  1YIJ A;  1K8M A;  4JI7 Q;  1FR3 A;  3FKI B;  4BY1 H;  2I5M X;  1AEX A;  5DAU A;  4JOI C;  1I4R A;  4JBW A;  1LAC A;  1OXS C;  5I6Y A;  3U4V A;  1IKL A;  4ALP A;  3PF4 A;  2BE5 C;  1VDZ A;  3MEF A;  4NXM Q;  1HHV A;  1TQO A;  4JI2 Q;  1C48 A;  3PO3 H;  4DAV A;  4BA1 I;  4X6A H;  2F0L A;  3KJP A;  2NB0 A;  3CME A;  4RG1 A;  3SK4 A;  2A68 C;  3A0J A;  1CK1 A;  1QNU A;  4A3M B;  1N33 Q;  2UXB L;  2UU9 L;  1YIT A;  2EYF A;  4DPG A;  1A62 A;  2E76 C;  4BXX H;  3I4N H;  1XMQ L;  3EJI A;  3M9B A;  2K7V A;  4A3J B;  3C46 A;  4EGV A;  2LXJ A;  5H1S E;  2OEO A;  5KEE A;  5C44 B;  3K7A B;  2L5T A;  4JCV E;  5LMN W;  1B4O A;  4K14 A;  1WOC A;  2NTS A;  4DR2 L;  3FDT A;  3M4O H;  2PQA B;  2J4X A;  3N6R A;  2MFI A;  2UUA Q;  3K6O A;  3E5S A;  5A2Q E;  1GJX A;  2R7Z G;  3GTM B;  4C3H G;  4X66 Q;  1DXM A;  1MBY A;  1F9R A;  1PH5 A;  2F0G A;  2KEC A;  4A3D G;  1OXX K;  4DXF A;  1K28 A;  2L55 A;  4DK1 A;  1VQM A;  1B3A A;  4BS9 A;  3C2P A;  1PTO F;  2KHJ A;  3L3O C;  3G71 A;  2VUM G;  3JAM L;  4A93 B;  3CC7 A;  2JA6 H;  1V1P B;  3K5M A;  1VF7 A;  2B63 H;  4TKO B;  3D3R A;  2NZH A;  4DK6 C;  1C8C A;  4IOA A;  2H4O A;  2F0U A;  1UWV A;  2HCC A;  4N8X 1;  1U9R A;  3CW2 C;  5IGG A;  1HTL D;  3HOX H;  4JV5 Q;  1TS3 A;  4UP8 A;  1LT4 D;  2K5Q A;  1Q46 A;  3GTG H;  1EIY B;  4DUY L;  1RF2 D;  1AH9 A;  4QJF A;  1MKH A;  1PTO B;  1GUG A;  1MSH A;  1CKM A;  1GXD C;  1LTR D;  1O78 A;  1LO5 D;  3CCE A;  3TP7 A;  1XYI A;  1PDQ A;  2R7F A;  1I6V C;  4GN3 B;  2IW3 A;  5M3F H;  1EWH A;  2L15 A;  4JW0 A;  1N33 L;  1UE6 A;  3S2D H;  1B44 D;  2PW7 A;  3K59 A;  1SJE D;  3A7L A;  1E2Z A;  4TSS A;  3T1H L;  3JAM c;  3IAY A;  5FJ8 G;  3PUV A;  5EKI A;  5JEA G;  2I46 A;  2O4X A;  4DR5 Q;  2Q8T A;  2BH8 A;  1NCV A;  1TR5 A;  3JAM E;  1C0A A;  3CCV A;  2KEN A;  1WTP A;  1U4R A;  4LF7 L;  3S2H B;  3KLS X;  1VQ8 A;  2XNA C;  1KL9 A;  1EIH A;  1NMF A;  5BN4 A;  1E2W A;  2LS0 1;  4QQB X;  1PLF A;  1SYB A;  1XWE A;  3NXW A;  1I6H H;  5CV4 A;  1SFO H;  1TWF H;  1TT2 A;  2XGT A;  1B1Z A;  5K36 G;  4B3T Q;  1VQD A;  3NE5 B;  5CMD A;  4C3I G;  3HEJ A;  1PZJ D;  4PZ8 A;  1ZXT A;  4RMF A;  4X65 Q;  1HFN A;  2Z1C A;  1K3B C;  2QCP X;  2YTV A;  1R9T H;  4B3R Q;  2IPK D;  3M3Y H;  4QCL A;  2MP1 A;  2F0P A;  3W2D A;  1VQA A;  2F3W A;  3GTP B;  3HOW B;  4JV5 L;  1ET6 A;  1IZ6 A;  3TSS A;  2VS1 A;  4L6T B;  1HR0 Q;  3I90 A;  2Z0S A;  1PH1 A;  1HZB A;  4AYB E;  2Q2H A;  4DV1 L;  1SR3 A;  4HMJ A;  4LUO A;  2CWP A;  1A2T A;  4R8I A;  5M3M H;  4OGQ C;  2Z9H A;  4ME5 A;  4Y52 H;  1CZW A;  1GUT A;  4ZLT F;  3M7G A;  1G2S A;  1TY0 A;  3GQB A;  1QCB D;  3HKS A;  1QB5 D;  1V43 A;  3H94 A;  4PZ6 A;  5C3X A;  4HCE A;  5C3E H;  1Y1V H;  3KF8 B;  3M4Y A;  2OTL A;  3A8K E;  3AYH B;  2FXQ A;  2JSO A;  2WII B;  4DV7 Q;  5M5Y H;  5C0X I;  4HIO A;  2B2V A;  4K2L A;  4R1J A;  3Q23 A;  1N36 L;  2SDF A;  1VQO A;  3IKJ A;  2RHQ B;  3DEO A;  5G3L F;  5DM7 3;  2ZJP A;  4L5R C;  2VNU D;  1WCM H;  3Q8D A;  4JBM A;  2A6E C;  3OWE B;  3RMH A;  3H3V H;  1HUN A;  5COY A;  4AH6 A;  1A63 A;  1ICW A;  2GN5 A;  2RCF A;  3PSI A;  1EFI D;  3M4P A;  5AFW A;  1H9S A;  4QUF A;  2EOT A;  4H7B A;  1EEI D;  3MHB A;  3HOY G;  1CHQ D;  1G8Z D;  1Z9F A;  2R3Z A;  2Z8L A;  4X65 L;  2O2L D;  2EYH A;  4UHV A;  2ICI A;  1W2B A;  3BYT B;  5IWA Q;  1ILP A;  1V8Q A;  1T5X D;  4PZ7 A;  1FD7 D;  1UE5 A;  4DR3 Q;  1VS0 A;  1QUQ B;  1PMR A;  4Y7N B;  3Q6S A;  4A3G H;  1L2F A;  1TWC B;  1LTT D;  3HOV H;  2EY6 A;  2Z6K A;  2JJQ A;  4JI0 Q;  2DY7 A;  5GAD C;  1VQJ A;  1SYG A;  1I94 L;  5C6A A;  4GOP A;  5I9P A;  4JG2 A;  3H0G H;  1B9N A;  3VYT A;  2O5J C;  4JVZ A;  4QIW B;  1E3P A;  2AUK A;  3BU2 A;  1W6J A;  1CSQ A;  5J3B A;  1HZA A;  4BBR B;  3E3X A;  3H09 A;  1PFS A;  4CJ1 B;  3J80 L;  1LTI D;  1IYU A;  2VQE Q;  1CA6 A;  4PG3 A;  3F2C A;  1B53 A;  3S15 B;  4XYQ A;  4DV7 L;  4PQX A;  3FKI H;  2CW0 D;  4RKB A;  3K7U C;  2Y0S E;  4BY7 B;  1JOO A;  4HR7 B;  2TMP A;  1G51 A;  3GV3 A;  1PV4 A;  2K5D A;  4DGZ A;  3VDY A;  4DV2 Q;  3ND8 A;  3A54 A;  4C1N I;  1A3T A;  1NAP A;  1K0S A;  2MPM A;  3CPW A;  4A3J H;  2R93 B;  1U0L A;  5C44 H;  1A3V A;  3K7A H;  3NBH A;  5IWA L;  4RFB A;  5FO9 B;  3J80 c;  1X56 A;  2CVR A;  4YWL A;  2A6H D;  4DK0 A;  4AIM A;  4JYA L;  2K03 A;  2DN8 A;  3GTM H;  5K5P A;  3IL8 A;  5KND A;  4OXP A;  1XNR Q;  2RDF A;  3J80 E;  3S9W A;  4IZ8 A;  3AMU A;  2K4K A;  1LAB A;  3PGZ A;  4YCV A;  3RNU A;  2F0S A;  1NUC A;  2DJF C;  2IT1 A;  1YHA A;  1LTG D;  2VZA A;  1I4X A;  1MI2 A;  1X9N A;  3B6Y A;  4V0B A;  1CFM A;  4OO1 I;  5JVG 3;  4APV A;  5EBD A;  5IGC A;  2B2W A;  2AHO B;  4A3K G;  3T1Y Q;  3E0J A;  1WD1 A;  2NVY B;  2F0Q A;  2PZW A;  4KMU C;  4RGT A;  1QWY A;  5GAG C;  1IBL Q;  3H3V I;  5E4W C;  1ONL A;  2EY1 A;  3A8I E;  3D4R A;  3I8Z A;  2PMZ E;  3SVM A;  4FYD A;  2SOB A;  4GKJ L;  4CDD C;  3NWT A;  1R4Q B;  3HKZ G;  2WIN B;  1RD9 D;  4XYO A;  1JB7 A;  5DLQ E;  4YY3 L;  4C56 C;  5BN5 A;  1PTO H;  3UE0 A;  4A3E B;  1PH3 A;  1YBY A;  1F9S A;  1E1O A;  3CKI B;  5CV9 A;  4DV2 L;  4B3S L;  4A4I A;  1Z7T A;  2ZTC A;  3WWV A;  3U50 C;  4C3J G;  5A35 A;  4QMG A;  3IRB A;  4I65 A;  3PV0 A;  1EQQ A;  1IYV A;  3D4D A;  3HRZ C;  3MXN A;  2RSO A;  5IYC H;  5KRU A;  1ET9 A;  1Q81 C;  3M4Q A;  1MJC A;  2RKS A;  4A75 A;  5LMN Q;  3STB C;  3KLR A;  3S2H H;  4LFB L;  2WAQ E;  2R7Z B;  1F77 A;  4YWM A;  1QJO A;  1STE A;  1IHZ A;  4HSV A;  4IPD A;  4IQZ A;  1KRS A;  3S14 B;  2JK8 A;  1STH A;  1ICF B;  1XTD A;  4A3D B;  1SE4 A;  1EYG A;  4B3M Q;  2CWA A;  3VR2 A;  3CCJ A;  5JJI A;  2NVX B;  2VUM B;  4AYB G;  1XNQ Q;  1EFW A;  5AJ3 Q;  3UDG A;  1AZP A;  1VQP A;  2FIN B;  4F7X A;  1NE3 A;  4Q0F A;  4DV5 Q;  1VQ7 A;  3M7N A;  3R8B A;  4P2C B;  1MD2 D;  3GTP H;  3HOW H;  1WTW A;  2ALY B;  1L1O C;  4BBS G;  1PFN A;  5DNF A;  2XWB B;  3S1M B;  2ZXO A;  4P75 A;  3SE0 A;  2QIL A;  3R3O A;  3RLO A;  3VR4 A;  1U4L A;  3MEH A;  1PA6 A;  4N9T A;  4QY7 A;  1JOK A;  1LTA D;  4KJO A;  5LL6 S;  2B2Y C;  3OSO A;  1WJJ A;  1D6E C;  3ND9 A;  1ZYR C;  4LF9 Q;  1UE1 A;  1HXY D;  1HZ9 A;  1KTK A;  1AP0 A;  3RD4 A;  3EBE A;  4IFD H;  1SRU A;  1M90 C;  3JAM i;  1RDP D;  1D7Q A;  2K05 A;  4G57 A;  5M5X B;  4HSP A;  1Y69 U;  2YYZ A;  4GNX A;  3X3N A;  3G4S A;  2X69 A;  1ILQ A;  4L63 B;  4JI3 L;  2KCT A;  1SN8 A;  4CJ0 B;  4WRD A;  3CCU A;  2LXK A;  4XT1 B;  1G91 A;  2HCI A;  1N34 L;  2D0O A;  3R93 A;  2HDM A;  1H9M A;  4OL7 A;  3G6J B;  5LMU Q;  1YEZ A;  3I55 A;  1F2M A;  1QE6 A;  2VXW A;  5E3F A;  5ELE A;  3MXP A;  1YNJ D;  2EYP A;  5CC4 A;  4GOP B;  3HOU G;  1X3G A;  2XRQ D;  2FMC A;  2CKZ B;  4LUV A;  4CKC A;  5C4H A;  5ELN A;  1XNQ L;  5NUC A;  1ENA A;  4YCU A;  2OWO A;  4DN4 M;  1EY0 A;  2MO0 A;  3I91 A;  2RSN A;  4JI1 Q;  3PIP A;  2AKW B;  4R4I A;  4O0A A;  3T56 B;  3PF5 A;  2F0I A;  1RL2 A;  4DNT B;  4LFC L;  4KY5 A;  3NSW A;  1EY5 A; 
#chains in the Genus database with same CATH homology
 3CPF A;  3A5Z B;  2WB1 E;  2A8V A;  1Q46 A;  3GTG H;  1K0R A;  4Y7N H;  1EIY B;  2B3G A;  1C9O A;  4DUY L;  1AH9 A;  1TWC H;  4QJF A;  1MKH A;  2IHE A;  2RF4 A;  4BY1 G;  3U4Z A;  4A3M G;  4BA2 I;  1CSP A;  1JE5 A;  1T9H A;  1CKM A;  2ID0 A;  2JA7 H;  4KHP L;  3RLN A;  3CXC A;  3KJO A;  3CCE A;  1SLJ A;  2R7F A;  4GN3 B;  3D0F A;  3M85 A;  5M3F H;  2JA5 G;  2JEB I;  3PO3 G;  2IX0 A;  5C44 G;  2L15 A;  1IBK Q;  1N33 L;  1BBW A;  2VQF L;  1UE6 A;  1V1Q A;  3CCM A;  2C35 B;  1HNX L;  3I4M H;  3S2D H;  1HNW Q;  2HHH L;  5FLM H;  4JYA Q;  1EOV A;  2ZM6 L;  4JI6 L;  3KDF B;  1XNR L;  3T1H L;  3JAM c;  2Y0S G;  4JI4 L;  1JJC B;  4R4T A;  4YWK A;  4MZ9 A;  3PUV A;  5FJ8 G;  1KC8 C;  2N78 A;  5JEA G;  4HJ8 A;  4GN5 A;  4BBR H;  4BXX G;  1IBM L;  4DR5 Q;  3KF6 A;  1OTC A;  4L5Q A;  2BH8 A;  1C0A A;  4A3K H;  1VQH A;  1J6Q A;  4A3L H;  2VW9 A;  4A3B G;  4JI8 Q;  2JEA I;  4JBK A;  3CCV A;  2PNH A;  2KEN A;  4IFD G;  3NBH B;  1VQ4 A;  2IHF A;  3CCQ A;  4DKA C;  4LF7 L;  5BR8 L;  5IP9 G;  3T1Y L;  2UXC L;  3DM3 A;  1VQ5 A;  3HFZ B;  4IJL A;  3CD6 A;  1LTL A;  2UUC Q;  4NXN Q;  1IYJ B;  1VQ8 A;  1Q7Y C;  4A93 G;  1KL9 A;  3GDE A;  1NMF A;  1KRT A;  4BY7 H;  1GO3 E;  1IBL L;  4J15 A;  4HJ9 A;  1AE2 A;  1AE3 A;  4QQB X;  1YVC A;  2I0Q A;  4A3F G;  1FVI A;  1I6H H;  4K0K L;  3F2D A;  3HOY H;  1SFO H;  1TWF H;  2XGT A;  1E24 A;  4HID A;  2GVA A;  5K36 G;  4B3T Q;  1VQD A;  1A0I A;  1G29 1;  4B3S Q;  4GKJ Q;  1Q8K A;  4PZ8 A;  3RR5 A;  4LWC A;  4RMF A;  4X65 Q;  4YY3 Q;  1Q1E A;  2N49 A;  3G48 A;  3RN5 A;  2JA6 G;  2R93 H;  2BA0 A;  2YTV A;  4DV6 L;  3K0X A;  1R9T H;  4B3R Q;  2B63 G;  2IY5 B;  1Q12 A;  4DR7 L;  3M3Y H;  2DGY A;  3K8A A;  1VQA A;  3CCS A;  1KAW A;  4JV5 L;  4GKK L;  2HIX A;  1IZ6 A;  1PH8 A;  3UDI A;  2VS1 A;  1HJP A;  3PUZ A;  2OCE A;  3J7A 5;  3NEN A;  1CUK A;  1EUJ A;  3PUY A;  2Q2I A;  2Z0S A;  3PUW A;  1XMO L;  4HJ5 A;  1S72 A;  1PH1 A;  1HZB A;  4UPA A;  4TVA B;  2MQH A;  4OX9 Q;  4AYB E;  4GLV B;  1CKO A;  1VQI A;  2Q2H A;  4DV1 L;  2A19 A;  4DV0 L;  1SR3 A;  4LUO A;  2CWP A;  4IFD I;  5IYD H;  2JA8 G;  1K9M C;  5M3M H;  1SMX A;  4DV3 L;  2JA7 G;  4XIG S;  1FJG Q;  2I5L X;  2NN6 I;  4DAY B;  4Y52 H;  4WJ4 A;  3DLL A;  3CF5 A;  3E0E A;  1LM0 A;  2K50 A;  3UDF A;  1BBU A;  3RN2 A;  3HKS A;  2ZTE A;  5LMN L;  1V43 A;  1B8A A;  2D62 A;  4P71 A;  1I50 H;  4PZ6 A;  5GQO A;  5C3E H;  5M3F G;  1J5E L;  1G6P A;  4YHH L;  1Y1V H;  1QVC A;  3I4O A;  4A76 A;  2ATW A;  3I4M G;  3KF8 B;  4LFB Q;  2OTL A;  2NVY H;  5FLM G;  4L5S A;  2EQS A;  1N32 Q;  2Q2T A;  1BVS A;  3AYH B;  1EWI A;  2AWN A;  2FXQ A;  3BJU A;  3L2P A;  1QVF A;  2K5V A;  4DV7 Q;  5M5Y H;  5C0X I;  4LFA Q;  4HIM A;  4HIO A;  4B3M L;  2H5X A;  4R1J A;  3L7Z C;  1N36 L;  1VQO A;  2RHQ B;  4A3C G;  2UXD Q;  4A3L G;  3MXN B;  3CMA A;  2ZJP A;  4L5R C;  1WCM H;  4JI5 Q;  2VNU D;  3Q8D A;  4JBM A;  4DV4 Q;  5AJ3 L;  4LF6 Q;  1Y1W G;  3GTK H;  3H3V H;  4IJH A;  1CKN A;  4AH6 A;  1A63 A;  4A3E H;  2GN5 A;  3KOJ A;  4LF5 Q;  4MTN A;  3PSI A;  2K5N A;  2NVT H;  3M4P A;  4JI7 L;  4AQY Q;  2HIV A;  2I5H A;  4DV5 L;  4BBS H;  5JEA J;  3W1G A;  1S3O A;  3G6E A;  1HNZ Q;  4BY7 G;  1I3Q H;  4HJ7 A;  1L1O B;  4GN4 B;  2E2J H;  1XPO A;  4NXM L;  2CQO A;  2NVQ H;  3HOY G;  4DAM A;  1Z9F A;  2PQA A;  4JI2 L;  4X65 L;  3HOW G;  2WAQ G;  1X6O A;  4R4Q A;  1PVO A;  1YNX A;  4OWT B;  4IO9 A;  1HR0 W;  3AFQ A;  4EQ5 A;  4IFD J;  3GTJ H;  1W2B A;  4P73 A;  5IWA Q;  2E8G A;  1X3F A;  2R92 H;  4IOC A;  4PZ7 A;  1UE5 A;  4DR3 Q;  1VS0 A;  1QUQ B;  1X55 A;  2F4V L;  2JA9 A;  2UXB Q;  2KHI A;  4X62 L;  1JMC A;  1Q1B A;  2UU9 Q;  4A3G H;  1B7Y B;  1L2F A;  3GD7 A;  3AFP A;  1A8V A;  3BZC A;  1XMQ Q;  3HOV H;  2Z6K A;  2JJQ A;  3J80 i;  4LUZ A;  3BZK A;  4JI0 Q;  1NBW A;  5FLX c;  4LF9 L;  5GAD C;  3I4N G;  1VQJ A;  1PYB A;  4OON A;  5IY0 A;  4JBJ A;  2R7Z H;  1I94 L;  1JT8 A;  1XJV A;  4GOP A;  5JJL A;  1TWA H;  4JG2 A;  3H0G H;  4FDB A;  4DR2 Q;  2UUA L;  1Q82 C;  1VQ6 A;  3S15 H;  3S14 H;  1JJG A;  3J7Z C;  2WP8 J;  1KQS A;  4X66 L;  4A3D H;  4IPC A;  1E3P A;  5IYD G;  4QL5 A;  3BU2 A;  3PO2 H;  3TS0 A;  4DNI A;  5M3M G;  1L0W A;  1CSQ A;  2NN6 G;  2KCM A;  4TQU S;  1LUZ A;  5J3B A;  1GM5 A;  1HZA A;  3J81 i;  1PH7 A;  1YHB A;  1PFS A;  1MIU A;  2NVX H;  2VUM H;  2BA1 A;  1K8G A;  1QZH A;  2K75 A;  4JI3 Q;  1NJI C;  5GAH C;  2VQE Q;  4GLX A;  4PG3 A;  5C3E G;  2HQL A;  5M5W H;  2Z6K C;  1N9W A;  3OTO L;  5HY6 A;  3F2C A;  3HOU H;  1PH2 A;  1N34 Q;  1Y1V G;  2E5L Q;  4KI0 A;  3CCR A;  4LNQ A;  5LMU L;  2BH2 A;  1FL0 A;  4DV7 L;  1OXT A;  5IT9 c;  2F52 A;  3FKI H;  4LF8 Q;  4A3I H;  4GOP C;  1NY4 A;  2VL6 A;  1YJW A;  2DUD A;  3F1Z A;  3K7U C;  5C0X G;  2UXD L;  5ELO A;  1VQF A;  2Y0S E;  4X64 Q;  3F2B A;  1PH9 A;  3S1M H;  4JI1 L;  4GNX B;  1EQR A;  1QUQ A;  1G51 A;  1VCI A;  4UP9 A;  4ME3 A;  3A5U A;  2QEX A;  1PV4 A;  3KDF A;  3VDY A;  1QZG A;  1HNZ L;  4LF4 Q;  3PIO A;  4C3J H;  4DV2 Q;  4A3E G;  4LFC Q;  1GVP A;  3K80 C;  1VQE A;  1KHI A;  3HOX G;  1M1K C;  1ASY A;  1TWG H;  5GAE C;  4DUY Q;  5GRO A;  1K83 H;  3CPW A;  4A3J H;  1U0L A;  2JA5 H;  1B70 B;  5C44 H;  4KHP Q;  3K7A H;  1C7Y A;  2NZO A;  1WI5 A;  1N8R C;  5IWA L;  5IE8 A;  2KBN A;  2K52 A;  1KD1 C;  2AWO A;  3E9I A;  1X56 A;  4YWL A;  3J80 c;  3TRE A;  1IBK L;  3HOZ H;  1HNW L;  4O2D A;  2A1A A;  4AIM A;  5M5X H;  2VQF Q;  1HNX Q;  4JYA L;  4PMW A;  3GTM H;  2N8N A;  2HHH Q;  2R92 G;  2R7D A;  5HGQ A;  2ZM6 Q;  4JI6 Q;  4POG A;  4OXP A;  3T1H Q;  1XNR Q;  4DR6 Q;  4KLK A;  3GTQ H;  1J5E Q;  2K4K A;  4DR5 L;  1W3S A;  4A3G G;  1YHQ A;  1EIF A;  4DUZ Q;  3PGZ A;  4YCV A;  3RNU A;  1IBM Q;  1VQL A;  2CCZ A;  3HOV G;  3PCO B;  1VQB A;  3RZD H;  2IT1 A;  1HH2 P;  1YHA A;  2VZA A;  3J81 c;  4BBR G;  1X9N A;  1TXY A;  4JI8 L;  3B6Y A;  5C4X H;  4OO1 I;  4APV A;  1UEB A;  2WB1 G;  3ERS X;  2PI2 E;  1X54 A;  3AQQ A;  2AHO B;  2YTY A;  1OXV A;  4A3K G;  4LF7 Q;  5BR8 Q;  3T1Y Q;  1VQC A;  2UUC L;  2UXC Q;  1NMG A;  2R6G A;  4NXN L;  5IP7 H;  3CCL A;  4L5T A;  1V9P A;  1TWH H;  3H15 A;  4HJA A;  4POF A;  1K8A C;  2UUB Q;  2OQ0 A;  3PO2 G;  5GAG C;  4P74 A;  1IBL Q;  1YJ9 A;  3H3V I;  1VQG A;  1E1T A;  3UE1 A;  4LW1 A;  1SRO A;  4R4C A;  3TQY A;  4K0K Q;  2PMZ E;  3D31 A;  4B3T L;  2B29 A;  1E22 A;  4GKJ L;  3KF6 B;  2GVB A;  4NB3 A;  4NPS A;  1U5K A;  3HKZ G;  3L0O A;  3ICE A;  1JB7 A;  5DLQ E;  1OXU A;  1K3R A;  4YY3 L;  4X64 L;  1QVG A;  1GD7 A;  3FKI G;  3UE0 A;  4UY8 C;  4B3R L;  2ZJR A;  2ASB A;  1IXR A;  1X3E A;  4DV6 Q;  4QIW E;  1PH3 A;  3I2Z A;  2RCN A;  1YBY A;  1NTG A;  2MO1 A;  4R4O A;  4DR7 Q;  4IPH A;  4LF4 L;  1E1O A;  2R93 G;  3M7N A;  4GKK Q;  4GLA C;  4DV2 L;  1UE7 A;  4OWW B;  1VQK A;  4KHZ A;  4B3S L;  1HR0 L;  1KIX A;  3ULL A;  4A4I A;  2YU9 H;  1Z47 A;  2Q2U A;  3OYY A;  1XMO Q;  1SE8 A;  2ZTC A;  1YI2 A;  4OX9 L;  1YZ6 A;  3WWV A;  2JA8 H;  3U50 C;  4JC0 A;  1X65 A;  3IRB A;  1Y14 B;  2D0P A;  1P8L A;  4C3H H;  4DV1 Q;  2YTX A;  3RZO H;  4DV0 Q;  3I7F A;  3GTL H;  3PV0 A;  5C0X J;  1BKB A;  3S1N H;  1WFQ A;  3FHW A;  4A3J G;  1EQQ A;  1FJG L;  4DV3 Q;  5IYC H;  1I5F A;  1Q81 C;  3GTO H;  3M4Q A;  1MJC A;  4A75 A;  1D8L A;  3TS2 A;  2CFM A;  3CP0 A;  5LMN Q;  3HKZ E;  3HOZ G;  3STB C;  4DR6 L;  3S2H H;  2OQK A;  4LFB L;  5IYB H;  4YHH Q;  2WAQ E;  4JOI A;  1JJ2 A;  2V1C C;  1N32 L;  4YWM A;  3W5O A;  4DUZ L;  1RIP A;  2YV5 A;  4IPD A;  3J81 j;  2AMC B;  3KFU A;  1L1O A;  3S1Q H;  3KYH C;  1KRS A;  1IL2 A;  2JK8 A;  1GKH A;  1KXL A;  1XTD A;  4A3C H;  4LFA L;  5EAY A;  1EYG A;  4DR4 Q;  4B3M Q;  2PI2 A;  1Y1W H;  2CWA A;  1PH6 A;  3CC4 A;  2K5H A;  3EN2 A;  4GS3 A;  3CCJ A;  4OO1 G;  5JJI A;  1PYS B;  1N36 Q;  4JI5 L;  5C4X G;  1HZC A;  4DV4 L;  4LF6 L;  4AYB G;  1XNQ Q;  2IX1 A;  2XTI A;  1EFW A;  4IPG A;  1LYL A;  1E7Z A;  1WYD A;  3K81 C;  3RLF A;  5AJ3 Q;  3UDG A;  2UUB L;  3TEH B;  4H02 A;  2F3I A;  1VQP A;  5E7N A;  1K73 C;  4LF5 L;  4WJ3 M;  1NE3 A;  3ER0 A;  1WCM G;  5IP7 G;  2ZTD A;  3ULJ A;  1FGU A;  4AQY L;  1YIJ A;  1YJN A;  1PHJ A;  1Q86 C;  4JI7 Q;  4DV5 Q;  4BY1 H;  2I5M X;  2K14 A;  4DR1 Q;  1VQ7 A;  4JOI C;  4A3M H;  3CC2 A;  4JBW A;  3GTP H;  4XTC S;  3HOW H;  1OXS C;  4P72 A;  2JE6 I;  3U4V A;  2ALY B;  4ALP A;  1L1O C;  3PF4 A;  4BBS G;  4UP7 A;  3MEF A;  5C4J H;  4NXM Q;  1XPU A;  4JI2 Q;  4P75 A;  2LSS A;  3PO3 H;  1XPR A;  3RLO A;  4BA1 I;  4X6A H;  3KJP A;  3CQZ H;  5JJK A;  3CME A;  4RG1 A;  3I56 A;  1PA6 A;  4QY7 A;  2RHS B;  4DR3 L;  3PUX A;  3A0J A;  2WFW A;  3TRZ A;  5FJ8 H;  1S40 A;  1N33 Q;  2UXB L;  4MNO A;  3U58 A;  1CKN B;  2UU9 L;  1YIT A;  2F4V Q;  3S17 H;  4DPG A;  1A62 A;  4BXX H;  3I4N H;  1XMQ L;  2EIF A;  3M9B A;  4X62 Q;  1PH4 A;  1WJJ A;  2ZJQ A;  4JI4 Q;  2LXJ A;  5H1S E;  4JI0 L;  3OW2 A;  4LF9 Q;  4JCV E;  1UE1 A;  4C2M H;  4A3B H;  5LMN W;  1HZ9 A;  3EBE A;  1SRU A;  1WOC A;  1I94 Q;  3GO5 A;  3A74 A;  4DR2 L;  1ASZ A;  5IP9 H;  2PQA B;  3JC6 6;  3JAM i;  1M90 C;  3M4O H;  1D7Q A;  2MFI A;  2UUA Q;  1MJE A;  2R7Z G;  3ZJY C;  4A93 H;  2YYZ A;  3FP9 A;  4QGU A;  4X66 Q;  4GNX A;  3F8T A;  3STB D;  3H0G G;  1PH5 A;  3SGI A;  3G4S A;  2QA4 A;  4A3F H;  3LGJ A;  1HR0 Q;  5IYC G;  2ES2 A;  2HT1 A;  4A3D G;  4JI3 L;  2KCT A;  1OXX K;  1SN8 A;  1P16 A;  1VQM A;  2VQE L;  1DGS A;  3CCU A;  1H95 A;  3CAM A;  2KHJ A;  2LXK A;  2E2H H;  2E5L L;  4DK3 C;  2D0O A;  3NEL A;  4C3I H;  1N34 L;  3OTO Q;  3G71 A;  1VQ9 A;  3AEV A;  5IYB G;  2VUM G;  1O7I A;  4HIK A;  4EX5 A;  5LMU Q;  1YEZ A;  3CC7 A;  4LF8 L;  2EXD A;  3KLW A;  3I55 A;  4YCW A;  4DR4 L;  2JA6 H;  3S1R H;  4GOP B;  3HOU G;  2E2I H;  1X3G A;  2QGQ A;  2B63 H;  2CKZ B;  4LUV A;  3UDX A;  4OWX B;  2NZH A;  4DK6 C;  3EIV A;  2JQO A;  5ELN A;  3W1B A;  1XNQ L;  2OWO A;  4YCU A;  4IOA A;  3PIP A;  2MO0 A;  4JI1 Q;  3S24 A;  2MNA A;  4A3I G;  4GNX C;  2AKW B;  4R4I A;  4O0A A;  1UWV A;  3PF5 A;  3S16 H;  3ULP A;  3CW2 C;  3HOX H;  2OTJ A;  4JV5 Q;  4DR1 L;  1RL2 A;  2N3S A;  4LFC L;  3NEM A;  4UP8 A;  3E9H A;  2VY3 A;  1VQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...