4DUYL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duyL00
4NXNL 4DUYL 5IYDH 4PZ8A 4DV5Q 1HNXL 4LUOA 2DUDA 4GNXB 5C4JH 5IP9G 2JA8H 4JI6Q 3GTLH 4PMWA 4JI5L 4B3RQ 1YNXA 2R6GA 4DR7Q 1LTLA 1UWVA 3TS0A 3PF5A 2VQFL 1A62A 1Z47A 2F3IA 1P8LA 3A74A 3FP9A 1CSPA 4JC0A 5IT9c 1I6HH 4BBRG 2I5HA 2BH2A 1VQOA 2UXCL 2OTJA 5HGQA 4APVA 1UEBA 3U58A 4A3CG 1NMFA 2ALYB 2D0OA 3STBC 1YITA 3OTOL 4IJLA 4YY3Q 2EXDA 1JT8A 1HR0L 4DR2L 3RLOA 4TQUS 4GOPC 1Y1WH 2MNAA 3RN5A 1BKBA 4PG3A 4QJFA 5GQOA 2RF4A 2VW9A 1Q7YC 2CCZA 3K0XA 3HOYG 1L1OA 1LYLA 1Z9FA 1KIXA 2ASBA 3F2BA 2ZM6Q 3HOUG 2D62A 2QGQA 2UUAQ 3S2DH 4LF4L 3CCVA 1T9HA 5M5XH 1D8LA 4OO1G 1Q8KA 1OXSC 1S72A 3T1HQ 2CQOA 1AE2A 1NMGA 3DLLA 3PGZA 1KRSA 4X64Q 3CCUA 4A3FH 2R92G 4B3RL 1YHAA 5EAYA 4JI8L 1JE5A 3KF8B 1VQMA 4IPHA 2JA6H 1PA6A 4A3BH 2YTVA 2UXBL 3HFZB 5K36G 1I94Q 2UXDQ 1Q1EA 3PUVA 5AJ3Q 1Y14B 1L0WA 2E2HH 1X54A 4DR6L 3VDYA 4OX9L 2AHOB 4DV6Q 2Z0SA 1SLJA 3HOWG 2PI2E 3EN2A 2MFIA 1OXXK 1UE6A 3CQZH 4XTCS 1B8AA 4XIGS 2UU9Q 1H95A 5GAEC 1C7YA 1XNRL 4A3GH 1X6OA 3A5ZB 4YCUA 3CXCA 4A3IG 4JI2L 1SMXA 4JI4Q 3S1NH 3GD7A 1I3QH 1MJCA 1VQDA 1N32Q 1FL0A 1Y1VH 2GVAA 3G48A 1CSQA 3GTGH 2VZAA 1Q1BA 4X65Q 1Y1WG 4GLVB 2Q2HA 4LF5Q 5LMUL 4OO1I 2CKZB 3NENA 3RN2A 4DV2Q 1YIJA 2MO0A 1HR0W 4YHHL 2I0QA 1D7QA 1N32L 4A3MH 2GN5A 1E1TA 2YTYA 3LGJA 2K5VA 4NPSA 2K50A 4X66Q 1AH9A 4L5SA 4GN3B 4J15A 2R92H 5IWAL 4GLXA 3I4NG 1VQJA 2VUMG 3PSIA 3FKIG 4NXMQ 5IY0A 3CAMA 2IHFA 2JA7H 4X62L 2N78A 2CWAA 3KOJA 1YJWA 1JJGA 5IYCG 2IX0A 1PHJA 1PFSA 3AQQA 5FLMG 4H02A 2K75A 4DPGA 3U50C 4HJ8A 2ID0A 1Q82C 2E2JH 4RMFA 2NN6G 2K52A 3RZOH 1HZBA 1HNXQ 1YEZA 5C0XG 4LFBL 4JBMA 2UXDL 5JJLA 4B3SQ 4IOAA 3UE1A 3NBHB 4UY8C 2WAQE 2AWOA 3D0FA 5IYDG 4JYAL 1E3PA 1IBKQ 4L5RC 2PNHA 1XMQL 1C0AA 1N34Q 3M7NA 4A3DH 2A19A 1HZ9A 4BY7H 2K4KA 1PH3A 5BR8Q 3DM3A 4GLAC 4A75A 2BA1A 1Q12A 3ULJA 4MNOA 1K8GA 1QUQB 2LSSA 3PV0A 4R4OA 2WFWA 1L1OC 3KJPA 3M3YH 2NZOA 2YYZA 4P71A 2UUBQ 1NTGA 1OXVA 1SRUA 4YWMA 3M4OH 5IP9H 2MO1A 2VS1A 3ULPA 1XMOL 1QUQA 3E9IA 2XGTA 3M9BA 4JI5Q 4QL5A 1GO3E 1WI5A 1XTDA 4A3GG 1TWGH 1XNQQ 1FGUA 4LW1A 2R7ZH 2JA7G 4A3EG 3EIVA 1UE7A 3S16H 3I4OA 1WCMH 4LFAQ 4A3JG 1K73C 2D0PA 1VQ5A 4IFDI 2RCNA 1XNQL 4A3CH 3GTMH 4IFDG 1PYSB 1LUZA 1KAWA 4LF6L 4LNQA 4DR4Q 4EX5A 4DV4Q 4DK6C 5C3EG 2ATWA 3GTPH 4R4QA 2ZM6L 1N33L 1A8VA 2HT1A 1QVFA 4A3DG 1QZGA 4BY7G 1WCMG 1PH6A 4YWLA 3F2CA 3CMAA 4GNXC 2E2IH 4BBSG 4K0KL 4ALPA 3HOXG 1CKNB 1EUJA 4B3TL 1Y1VG 2WAQG 4JBWA 2JA8G 3ERSX 4IPCA 4NB3A 4YY3L 3Q8DA 1O7IA 5HY6A 4HIDA 1IBKL 1YJNA 4PZ6A 2HQLA 4B3SL 2NN6I 3KDFB 1CKNA 4BY1G 5ELNA 1N9WA 1HJPA 4DV0L 3KF6A 1K8AC 2OQKA 4DR6Q 4LFCQ 1VQFA 1KHIA 2LXJA 4R1JA 3PUWA 2QA4A 3AEVA 1PH9A 2N3SA 4JI1Q 1IL2A 5M3MG 2ZJRA 1XPOA 2EIFA 1N36L 1RIPA 4LUVA 1YHBA 4B3MQ 3WWVA 3RZDH 1HNWQ 3K81C 1XNRQ 4Y52H 1MIUA 5C4XH 3CCRA 1VQ4A 1S3OA 4LFCL 2Y0SG 4QQBX 3H3VH 4X64L 1EWIA 4DV7Q 2R7FA 4DV3L 3T1YQ 4A93H 1N36Q 3W1GA 1PH1A 2HIVA 2PMZE 5M3MH 5FJ8G 1IBLQ 5LMNW 1QVGA 2UUCQ 4HIKA 4NXML 4A3FG 1I94L 3J81c 4UP8A 3S2HH 2KHJA 3H0GG 3STBD 1LM0A 4DR1L 1VQ7A 4DV7L 3M4QA 1VQKA 2ZTDA 2QEXA 3L2PA 4WJ3M 2L15A 2XTIA 5FLMH 1EYGA 5M3FG 2A8VA 2F4VQ 1Q46A 1K9MC 2ZJQA 1I50H 1UE5A 2BA0A 4YCVA 4YWKA 5GADC 4LF4Q 1CKOA 3E0EA 3HKZG 1JMCA 3I4MG 1PH7A 3HOVH 1VQEA 4DR4L 3A0JA 1SN8A 4P73A 5M5YH 5J3BA 4JCVE 3UDGA 1VQ9A 1HZCA 4B3TQ 3CCQA 4DR2Q 1I5FA 4C3HH 1M1KC 1U0LA 1WYDA 4P75A 4GS3A 4DR3Q 5IE8A 4LF8L 3F1ZA 3GTQH 5IYBG 4GNXA 4LF7L 1EQRA 3CC4A 3PUZA 3TEHB 4QIWE 1HNZQ 2JA6G 3PO3H 4QGUA 1PH5A 1TWAH 3W1BA 1W2BA 5H1SE 1VQHA 1YI2A 1PH8A 4JI4L 4IJHA 4LF6Q 4AQYL 2JA5G 4A3LG 5JJKA 2WB1E 2NZHA 1QVCA 1P16A 2MQHA 4MZ9A 4DK3C 1VQIA 2Y0SE 4JI1L 3L7ZC 1QZHA 2WP8J 1HNZL 2OTLA 4JI3Q 3TS2A 4A3EH 4JV5L 4A3KH 3PCOB 3U4ZA 2R7DA 2YU9H 2CWPA 1KRTA 4IFDJ 3ZJYC 3M4PA 2IY5B 1A0IA 1GKHA 2AWNA 2JJQA 2UUAL 1TWCH 3CCMA 3CCJA 4LWCA 4Y7NH 3S14H 2FXQA 5JEAJ 3HOYH 2YTXA 3AYHB 4L5QA 1U5KA 4WJ4A 1KL9A 4DR1Q 3T1HL 3TRZA 5C3EH 4QY7A 3SGIA 3UDIA 3OTOQ 2B63H 3G6EA 1CKMA 1SR3A 3UDXA 2N8NA 3J81i 4LF9L 3HKZE 1X55A 4IOCA 1BBUA 1GM5A 2F4VL 4K0KQ 2OWOA 3NEMA 2AKWB 4A3MG 2CFMA 3ICEA 1DGSA 3J80i 1HZAA 4UP9A 2HHHL 4JI7L 1N33Q 3S1QH 2K5NA 2VQFQ 4DV6L 1ASZA 4OX9Q 1NBWA 1FJGQ 1NE3A 4BA1I 1EOVA 2UUCL 4BA2I 5M3FH 4AIMA 4DV0Q 4R4TA 1OXUA 1GD7A 2K14A 3ULLA 4BXXH 1W3SA 5IP7G 3I7FA 4LF7Q 1HH2P 2R93H 4A93G 4A4IA 3H15A 1VQGA 3G4SA 1X3GA 2DGYA 2YV5A 4DAMA 2WB1G 4X62Q 5FJ8H 4IPGA 3W5OA 2JEBI 5GAHC 1J5EQ 3JAMi 3RR5A 5C0XJ 4R4CA 3PIOA 1YJ9A 5IYBH 4YHHQ 5C44G 1IYJB 1IZ6A 1KC8C 3BZCA 3TREA 3CW2C 4POFA 1B70B 4X6AH 4JOIA 1CUKA 3FHWA 2Q2IA 4JI3L 4LUZA 4JI2Q 5IP7H 3OW2A 4DAYB 1X65A 3CP0A 4C3JH 3F2DA 4A3JH 5JJIA 3JC66 4DR3L 4LF8Q 4GKKQ 1VQ6A 4IO9A 3KF6B 4DUZQ 2JA5H 4A3LH 4JYAQ 5LMUQ 4DR5Q 1HR0Q 3HOVG 1YVCA 4DV2L 4C2MH 1RL2A 1IBMQ 4GN4B 2E8GA 4GN5A 4HIMA 3I56A 2F52A 1E24A 3CCEA 3GTJH 3HOXH 2JEAI 4JV5Q 4MTNA 1KQSA 1EIYB 4DV1L 2HHHQ 2UUBL 3IRBA 4JI8Q 4DKAC 3PO2H 3CF5A 3H0GH 1PH2A 3S15H 2B29A 1VQ8A 4DR7L 5GAGC 3GTKH 1EQQA 1V43A 1VQNA 1JJCB 4OWXB 3E9HA 1XJVA 3U4VA 4X65L 2Z6KC 4DUYQ 2ZTEA 4NXNQ 3JAMc 5C44H 2KCTA 3PUYA 2B3GA 2E5LQ 1N8RC 1KXLA 3PF4A 5AJ3L 4YCWA 2RHSB 1MJEA 1WOCA 4X66L 3S17H 4GKJQ 4O0AA 1XPUA 1VQLA 4POGA 4A3KG 2VNUD 3S24A 1TWFH 1VCIA 5DLQE 3CD6A 1K0RA 4ME3A 3A5UA 1BBWA 2HIXA 4EQ5A 2KBNA 1E1OA 2Z6KA 3S1RH 2C35B 4JI0Q 2I5LX 3J80c 2NVQH 2JE6I 4GKJL 5M5WH 2UXBQ 2VUMH 1N34L 1K83H 4B3ML 1G291 2IHEA 1V9PA 2KENA 4AYBG 3PO3G 4L5TA 4LFAL 3I4NH 3CC7A 2B63G 2VY3A 1MKHA 3BU2A 4KHPL 2ZTCA 1VQBA 3KLWA 5ELOA 1OTCA 3ER0A 3M85A 4PZ7A 2E5LL 4DR5L 3PO2G 1EFWA 1BVSA 1TWHH 5JEAG 4DV4L 2EQSA 1XMOQ 3CMEA 5FLXc 4HJAA 3I4MH 3K7UC 1J6QA 1VQCA 1V1QA 1FJGL 4KI0A 1WFQA 2I5MX 4HJ5A 4KHPQ 4C3IH 3I2ZA 3UDFA 2PQAA 2Q2TA 1G6PA 3BZKA 3OYYA 3RNUA 4JI6L 2R7ZG 1X9NA 3HOWH 1GVPA 1HNWL 1X56A 5E7NA 2AMCB 3RLNA 2PQAB 3AFPA 1NJIC 3GDEA 2GVBA 1YZ6A 2N49A 2K5HA 3K7AH 4P72A 4LF9Q 3GTOH 4OXPA 3RLFA 1E22A 3B6YA 2PI2A 4KHZA 1L1OB 4DUZL 3FKIH 1R9TH 1FVIA 1L2FA 1KD1C 3CPFA 3I55A 1PV4A 5C0XI 2VQEL 3K8AA 3L0OA 1YHQA 4HJ7A 3H3VI 4LFBQ 4JI7Q 3KJOA 5C4XG 4OWTB 4JBKA 4DV5L 4TVAB 2JQOA 3BJUA 4LF5L 1Q86C 5GROA 1PYBA 1OXTA 1XPRA 3KFUA 2RHQB 3HOZG 4DV3Q 3T1YL 3KDFA 4UP7A 1TXYA 5BR8L 3J7ZC 4BXXG 4AQYQ 4AYBE 1VQPA 1M90C 4UPAA 3UE0A 2UU9L 5LMNQ 4OONA 4JG2A 1J5EL 3CCLA 4BY1H 1C9OA 3PUXA 4HJ9A 4A3IH 1VS0A 3HOUH 2KCMA 3S1MH 4R4IA 1EIFA 3J81j 1UE1A 4IPDA 1YBYA 2JK8A 3MEFA 3HKSA 2V1CC 3HOZH 2VL6A 4GOPB 4A76A 3NELA 5LMNL 1XMQQ 1Q81C 2ZJPA 1WJJA 1X3FA 4BBRH 2Q2UA 1E7ZA 2IT1A 4JOIC 5IYCH 2IX1A 4KLKA 4FDBA 4AH6A 4DV1Q 4BBSH 4RG1A 1VQAA 1SFOH 4A3BG 1G51A 4GKKL 1K3RA 4GOPA 3PIPA 1PVOA 3J7A5 2JA9A 4P74A 1IXRA 1S40A 1SE8A 1SROA 4JI0L 4HIOA 2NVYH 3GO5A 2H5XA 3CCSA 2A1AA 1IBML 2UXCQ 4O2DA 2R93G 3F8TA 2LXKA 5IWAQ 2OQ0A 3CPWA 1AE3A 3KYHC 1PH4A 1B7YB 4OWWB 2BH8A 3TQYA 4DNIA 1X3EA 3D31A 1ASYA 3AFQA 2KHIA 3CC2A 3MXNB 2VQEQ 4JBJA 1JB7A 2NVXH 2OCEA 3K80C 3G71A 2ES2A 1NY4A 1IBLL 3EBEA 1A63A 1JJ2A 2NVTH
chains in the Genus database with same CATH superfamily
4NXNL 2KCCA 2A68D 2QKIC 4PZ8A 5C6AA 1FGBD 4DF7A 2JA8H 4JI6Q 4JI5L 4DR7Q 5I2XA 1UWVA 3TS0A 3PF5A 1Z47A 3G6JB 2F3IA 2WKCA 1I6HH 1EYAA 5FLXL 2UXCL 2B2VC 3U58A 4APVA 4A3CG 1NMFA 2ALYB 3NSWA 3STBC 1YITA 4IJLA 2EXDA 1JICA 2LS01 4IUQA 4TQUS 4R8NA 3MTSA 1H9KA 2JA7B 1JOOA 1R9TB 5I2YA 1B3QA 1LYLA 2ZM6Q 3DXJC 2D62A 2UUAQ 1PZJD 4FO2A 3H94A 3CCVA 1PTOD 2I46A 1D8LA 3A56A 4RCNA 5JPMC 1S72A 3T1HQ 2N55A 3QOLA 3PGZA 3E6ZX 1YHAA 1S5FD 1JE5A 3KF8B 1F9RA 4IPHA 5HGTA 2UXBL 2YTVA 1G6ZA 3D4WA 5FO7B 2AQ1B 2X6LA 1WTWA 1H9SB 1X54A 3KF8A 4CJ0B 2JYOA 2AHOB 1SLJA 3S9WA 1UE6A 3C1FA 3LWUA 2UU9Q 1BBXC 1STNA 1C7YA 1XNRL 4FNFA 4JI4Q 1VQDA 1KDCA 5KYIA 3G48A 3GTGH 1KTKA 4DXGA 1EOTA 2CKZB 2B39A 3DWPA 1TWHB 3I4MB 5FO9B 3OOCA 2F0DA 1U4LA 4NPSA 4GN3B 3J80L 5BN5A 4CJ1B 3GP7A 3I4NG 1FNUA 2G9HD 3PSIA 1TY0A 1HPCA 3MC0B 5CV4A 4NXMQ 5IY0A 4RGOS 4G4KA 2Y0SB 3I8ZA 3D6CA 1LT3D 2PZWA 3CAMA 1F9QA 2N78A 2CWAA 4ZUIA 5A2QL 1TWFB 2IX0A 3AQQA 5M3MB 5FLMG 2EDGA 1DZ1A 1JWUD 4HJ8A 2ID0A 1B4OA 3S1RB 2E2JH 4RMFA 4ZUJA 1A3TA 3M3YB 2BE5C 4OELB 3T4AC 3QR8A 1QE6A 1EZ6A 3UE1A 4UY8C 2WAQE 4V0BA 4CDCC 1IBKQ 1TQOA 1C0AA 3NBHA 1I6VC 1PH3A 3DM3A 2L55A 1Q12A 1QUQB 1SNMA 1LTTD 3NWSA 3M3YH 2YYZA 1NTGA 4YWMA 3M4OH 4JI5Q 2VS1A 3M9BA 1TS5A 3GV6A 1WI5A 1XTDA 2HCIA 4LW1A 2XWBB 3EIVA 1UE7A 1Z6HA 3NQIA 4EGVA 4RA8A 2D0PA 1EIGA 1VQ5A 1STEA 3GTMH 1PYSB 4BBRB 1ENAA 1LUZA 4LF6L 4F8MA 4EX5A 4K5WA 4DK6C 2ATWA 4G7ZC 4R4QA 1A8VA 2HT1A 1SAPA 2IJ0A 1PH6A 4YWLA 3CMAA 4K0KL 1VDZA 2F0QA 5I9OA 4EVOA 3HOXG 2F0EA 2F0OA 1EUJA 4BWGB 5JJZA 1O7IA 4HIDA 1SE4A 2EYFA 4PZ6A 2NN6I 3KDFB 1LT6D 1PFNA 5ELNA 1S5CD 1K8AC 1KABA 3PUWA 4R1JA 3AEVA 1HTLD 3GQBA 4JI1Q 1IL2A 4ZKBB 1A2UA 1H9SA 2QILA 4B3MQ 1B9NA 5DM63 4N9PA 4B9XA 1XNRQ 1F2MA 1KDAA 1VQ4A 2KUMA 3H3VH 3X3MA 4IFDI 4A93H 5CV6A 3DWQA 3W1GA 1VF7A 5D3IB 4TSSA 2PMZE 2UUCQ 2M2LA 3H0GG 1E2ZA 4DR1L 5NUCA 1IYUA 2ZTDA 3SDZA 2Q8IB 3EVQA 1U4MA 1Q46A 2F0KA 2O2LD 3C1EA 4YCVA 5KNDA 4B9WA 1CKOA 1JMCA 3I4MG 1PH7A 1VQEA 4DR4L 3GTMB 4P73A 1RHPA 4JCVE 4IUPA 1VQ9A 4B3TQ 4DR2Q 2EYOA 1WYDA 4GS3A 5IE8A 3GTQH 4C1NK 5IGGA 3Q0AA 2SOBA 3CC4A 4LF7L 1DONA 4QIWE 1Y1VB 3BDLA 4OL7A 5CORA 4QGUA 1TWAH 1PH8A 2SNSA 1WCMB 5JJKA 5CC4A 2WB1E 2NZHA 3W3AA 2DN8A 1P16A 4DK3C 4JI1L 3TS2A 1F9SA 4C3IB 4JV5L 1Z7TA 4P2CB 3S1NB 4Q5VA 5I9PA 5DEHA 4IFDJ 2IY5B 3M4PA 4JW0A 2PYKA 4QUFA 4HMIA 1TWAB 4LWCA 1PFBA 2EYPA 1U5KA 4N9TA 3UDIA 2EVBA 1CKMA 1PRTC 4HMJA 2N8NA 4J8QA 3S15B 4QCLA 2JA5B 5CGKA 4LF9L 3HKZE 1GM5A 5M5WB 2F4VL 2OWOA 2P5ZX 3NEMA 2AKWB 3WDNA 2L12A 3E0JA 1D1IA 1HZAA 1NBWA 1FJGQ 1NE3A 3GTJB 3HOXB 1C4QA 4BA2I 2IX3A 3QG1A 4AIMA 1EY7A 5KGUA 4DV0Q 1F2YA 1GD7A 2K14A 3HRZC 1W3SA 3I7FA 4O42A 1GUSA 2NUCA 3G4SA 5E1FA 4HR7B 1R4QB 2F03A 2WB1G 1DOMA 1J5EQ 3W5OA 2JEBI 3JAMi 5EKKA 2K33A 2EYHA 1IZ6A 3BZCA 3CW2C 4POFA 3C3LA 3OW2A 4FF4A 4LUZA 4C3JH 1STAA 2EY1A 2TMPA 3JC66 1ML0D 1CA6A 3KF6B 2HUGA 4JYAQ 4DAYA 5LMUQ 1HR0Q 4PMCA 4C2MH 5L37A 2F0JA 3BDCA 1E24A 1WTXA 5DNFA 2B2VA 4DKAC 4JI8Q 3PO2H 3ONAB 3GTKH 3MFGA 1JJCB 3E9HA 5C44H 2CQAA 1D5ZC 2B3GA 2KCTA 1KXLA 3ND9A 3SEBA 5AJ3L 2LKVA 1SE3A 3M4YA 5F2DA 2WIIB 4CHTB 1WOCA 2A6ED 5FKAC 1GUNA 4A3KG 3S24A 3CD6A 1K0RA 1WTOA 2O5JC 3SK4A 4IURA 1CZWA 2HIXA 1E1OA 1YNJC 2C35B 3CU7A 4RHRA 4QIWB 4L6TB 4AYBG 1E0BA 3GV3A 3NE5B 4LFAL 1ZEQX 5JOBA 1MKHA 1GOZA 2ZTCA 3K7AB 1DYQA 1OTCA 2FHTA 1RKNA 5LHY1 1Y8NB 3PO2G 1XMOQ 3CMEA 3HOVB 1MHWC 1WFQA 2NN6H 1G6PA 3OYYA 3RZOB 1V1OA 3RNUA 2R7ZG 2FFKB 1ZXTA 3UI2A 1CM9A 1GVPA 3P20A 5E7NA 2AMCB 1BF4A 1JCKB 2PQAB 3GTOH 3GDEA 4XT1B 2EY2A 5EGTA 3K7AH 4P72A 1SDFA 4KHZA 1L1OB 3FKIH 2F0SA 1R9TH 4A3DB 5HURA 3CPFA 3X3NA 3I55A 1PV4A 5C0XI 1S5DD 3H3VI 1YHQA 4IFDH 4HJ7A 2M9VA 4JI7Q 3KJOA 5C4XG 4OWTB 4JBKA 5G3LF 1LTSD 2F0MA 3CHBD 2NWGA 1Q86C 5GROA 3KFUA 4KTAA 2LMCB 4UP7A 1TXYA 2RDHA 3S1QB 4HTHA 4LJZC 4UPAA 2UU9L 1GHJA 5LMNQ 1JWSD 3CCLA 4HJ9A 1HA6A 5J39A 4A3IH 3NXWA 3J81j 1UE1A 1YBYA 2E76C 5EPKA 2V1CC 1WTRA 3M7GA 1XMQQ 2F0VA 1Q81C 2Q2UA 2IX1A 4JOIC 5IYCH 4FDBA 4A3BG 4DGZA 1SFOH 4GKKL 4K8JA 3S17B 1O7ZA 4HIOA 3LWEA 3KYHC 3TP6A 1E2WA 1ASYA 5EPLA 4XQJA 1K8OA 2VQEQ 3G71A 3TP8A 1GXDC 2B8GA 3MXUA 2KA7A 4DUYL 3OIPA 1HNXL 1VMCA 1DXMA 1DM0B 1YNJD 4LUOA 4GNXB 4B3RQ 2R6GA 2HQEA 3E3XA 1X3PA 3ND8A 1KAAA 5K5PA 4IUUA 1R4PB 4JC0A 1CSPA 2I5HA 5CR3A 5HGQA 2D0OA 3HZXA 3ZYYX 3BVGA 5I4DA 1B1ZA 1JT8A 4KY7A 1JE4A 4DR2L 1Y1WH 2MNAA 3RN5A 2IPKD 1ILPA 2CW0D 5GQOA 1B3AA 3HOUG 1I4RA 2QGQA 3S2DH 5M5XH 3R2TA 5BN3A 3OHXC 3DLLA 4KJOA 1G8ZD 2R92G 2F0HA 4IALA 1W6JA 1PA6A 1L0YB 1Q1EA 1FNVA 4F88A 1WTVA 2JA8B 3S1MB 5EQ0A 4DV6Q 4OHJA 1CTMA 3HOWG 3EN2A 2LFNA 1OXXK 3CQZH 1XX8A 4XTCS 1B8AA 4XIGS 1HTPA 1GUWA 1I4PA 3K5LA 1X6OA 3A5ZB 3U9OA 4DR7L 1LV9A 4Z9CB 3J81L 5IGEA 1I3QH 1FL0A 3L3OC 2PPBC 2GVAA 2VZAA 1Q1BA 1Y1WG 4GLVB 1AEXA 3I4LA 4DV2Q 4YHHL 2E2DC 3C46A 1N32L 4A3MH 1SYDA 5A35A 1E1TA 2K5VA 1AH9A 2GA4B 2F0GA 1TKWB 4J15A 2R92H 4GLXA 2VUMG 3FKIG 5C0XH 2K5DA 5CV9A 1AFPA 2JA6B 3KOJA 4J6HA 1YJWA 4TRDA 5IYCG 4V190 5ELCA 2JXMB 1GUGA 4B08A 2KHSA 1EYDA 3RZOH 1HNXQ 3SXHA 1EU4A 2L4NA 3HG9A 3VR6A 5C0XG 4LFBL 4JBMA 2UXDL 1SYBA 3TP7A 4IOAA 1LTGD 2HCCA 5KRUA 2AWOA 5IYDG 4YIJA 2B2UC 2PNHA 1H9RA 1V1PA 1N34Q 4A3DH 3HS0C 2A19A 4BY7H 2K4KA 2DJGC 5BR8Q 5FO8B 4GLAC 2I07B 3ULJA 2XNAC 4P71A 1SEBD 1HNWL 3DWAA 1BR9A 2MO1A 1M8AA 2B2TA 4QL5A 2NYZD 1EEID 1SYFA 4A3EG 3S16H 4KKTA 2EOTA 5ELBA 1WCMH 4NDXA 1ZKOA 3J81E 4DA2A 1O78A 1KAWA 4DV4Q 3BYYB 2ZM6L 1QVFA 1QB5D 1WCMG 3F2CA 1Y1VG 2A68C 3I91A 4IPCA 3I3CA 3Q8DA 1QCBD 5HY6A 1CZGA 2QF7A 1IBKL 1YJNA 2HQLA 2OF1A 4C3JG 4KY6A 4QMGA 4LAAA 4DV0L 2QA4A 3N6RA 2N3SA 3QOJA 1N36L 1XPOA 2EIFA 1YHBA 4KD4A 4BY7B 2EJFC 3K81C 1Q8IA 1B44D 3CCRA 1SMYC 3GTLB 4LFCL 2Y0SG 5T1IA 1EWIA 4DV7Q 2R7FA 1TS2A 2BOSA 3FRPB 4NXML 2KEEA 2RA4A 4A3KB 2E2JB 4UP8A 5IGFA 1LM0A 4DV7L 3NTKA 1VQKA 3OMGA 3PIO3 1EYGA 3K0YA 3QB3A 2F4VQ 1S5ED 1DOKA 2ZJQA 1UE5A 3HKZG 3Q22A 5CV7A 3A0JA 3UDGA 1HZCA 4A3FB 4C3HH 4DU9A 4P75A 3VA7A 4LF8L 4GNXA 2KEDA 1AW7A 4KY5A 1RJTA 3OW7A 1A3UA 4JI4L 1YI2A 4A3LG 1WTQA 2Z8LA 1NSNS 2WAQB 2Y0SE 3L7ZC 2WP8J 5LL6S 5M5XB 4PQXA 3IAYA 2K03A 3DHQA 4CKBA 3G7LA 1GKHA 3OIQA 2UUAL 5J1ZA 1SNOA 5JEAJ 4KN4C 3HOYH 4HAEA 1KL9A 4DR1Q 3T1HL 5C3EH 4QY7A 2B63H 2L1BA 2AQ3B 4K8IA 3G6EA 1Y8OB 1X55A 2F0NA 4A3MG 3ICEA 4CJ2C 1HHVA 1JWMD 4UP9A 2HHHL 1K0SA 4OX9Q 2UUCL 5JVG3 1NR2A 2V4DA 2RVLA 1FYCA 4R4TA 1SYEA 2ZXOA 1OXUA 1QNKA 3TSSA 3HOUB 2EYMA 5IP7G 3EA6A 4FVMA 4LF7Q 4A4IA 3H15A 1Y8PB 1IYVA 3DEOA 5K36H 2DGYA 4X62Q 1I4XA 5ELEA 5C0XJ 4R4CA 2DY8A 5IOCA 5IYBH 1SFOB 3PO3B 1KC8C 2B8FA 1A15A 4CDFC 4OGQC 4M8AA 2F0FA 3MA2B 4JI3L 5IP7H 2Q2IA 3S16B 4HCSA 1X65A 5JJIA 4A3JH 3BDOA 4DR3L 4GKKQ 5D14A 1QILA 1I6HB 3MXPA 3HOVG 1ET6A 3V05A 4DV2L 1IBMQ 2WACA 4GN5A 4HIMA 3TDQA 3DMUA 2OT2A 4JV5Q 4O1NA 3CF5A 5IT9E 3A7LA 2XN9C 1PH2A 5GAGC 4H44C 4X3UA 4DUYQ 1CHPD 2E5LQ 3LNNA 4NMZA 4YCWA 2EYLA 3H3VC 3A8IE 1MJEA 4X66L 3S17H 2L11A 4GKJQ 1TWCB 4O0AA 1VQLA 1LTRD 1RODA 1UEAB 1TWFH 5DLQE 4ME3A 1BBWA 1VMPA 1EY0A 2FMMA 3JAME 5CBAE 2A5HA 2F0WA 3S1RH 2I5LX 2UXBQ 5M5WH 3NTIA 1GJXA 4ABNA 3PIP3 4ME5A 3S2HB 2IHEA 4EQPA 2NZ1D 2NB0A 2VY3A 1U4RA 5TSSA 3BU2A 2E75C 3KLWA 5ELOA 4DK1A 3ER0A 3M85A 1HRJA 4OEMB 1EFWA 5JEAG 5I6WA 3J80E 5FLXc 1J6QA 1V1QA 4KHPQ 1NAPA 1II3A 1AP0A 1BOSA 4C3IH 3UDFA 4PMBA 3BZKA 2ZXPA 4BBSB 4CKEA 3HOWH 1X56A 2KJXA 3AFPA 2VUMH 2GVBA 2K5QA 2A69C 3D3RA 4OXPA 3RLFA 1EWCA 4LK1C 1FVIA 3A55A 5M9OA 2VQEL 3VYSA 4LFBQ 3MFYA 4I7ZC 3L9AX 5C4ZA 1HQMC 1PYBA 2C5CA 5AFWA 3T13A 4DV3Q 3T1YL 3KDFA 2DY7A 5IT9L 1VQPA 3UE0A 3EROA 2NVYB 4OONA 4UAIA 1C9OA 2CW0C 1VS0A 2D5DA 2KCMA 2Q8RE 4R4IA 3W2DA 2JK8A 3HKSA 3K5OA 4C3IG 4GOPB 4A76A 3NELA 1WJJA 4WRDA 4BBRH 2E74C 5D3DA 4DV1Q 1VQAA 1G51A 1K3RA 4Q0FA 2RKSA 3HKZB 3PIPA 4GOPA 1PVOA 1WTPA 4ZRZA 4P74A 1S40A 1SE8A 2NVYH 1TIID 3GO5A 1EEFD 4XYQA 2UXCQ 3F8TA 2OQ0A 3CPWA 1EY8A 4K2KA 1AE3A 1CQVA 2F3WA 4DNIA 3D31A 1K8MA 2KHIA 1HQRD 4JBJA 1LACA 2OCEA 1MI2A 2ES2A 5EBDA 1IBLL 3EBEA 5C3WA 1A63A 1JJ2A 3AMUA 4DV5Q 1TU2B 5C3XA 4RWSC 2DUDA 1ESFA 4XQQA 5C4JH 5IP9G 1ET9A 5C4XB 4PMWA 3BYTB 2EJGC 1E2VA 3WOFA 5FLXE 2EZVA 1A62A 3FP9A 3A74A 2VXWA 1J8IA 4F7XA 4BBRG 2OTJA 2BH2A 1VQOA 2AUJD 1UEBA 3OMCA 5KYLA 2PZTA 3CRKC 1O7LA 4YY3Q 2NTSA 4L63B 1HR0L 1D5XC 1STGA 4GOPC 4F87A 1BKBA 4PG3A 4BY1B 3KLSA 4QJFA 1F77A 1I50B 2VW9A 1Q7YC 2CCZA 2QEJC 1L1OA 1Z9FA 1I4QA 3F2BA 5J22A 1PRTF 2X69A 3OWFA 2NVQB 1K83B 4OO1G 3D6WA 5EPJA 1Q8KA 1OXSC 1ZYRD 2F0PA 1NMGA 1AE2A 4B3RL 4A3GB 3CCUA 4X64Q 1QG7A 2JA6H 4ZQ3A 4A3BH 3E5SA 2EY5A 1D1KA 3HFZB 5IODA 2UXDQ 3PUVA 5AJ3Q 1Y14B 5BN4A 3BS1A 1L0WA 1QOHA 1WTHA 4I7AA 5C5LA 3VDYA 4OX9L 2VB2X 1H9JA 2ICIA 3ERQA 3BVZA 3TN2A 5GAEC 4A3GH 3CXCA 4JI2L 1SMXA 2KOLA 3S1NH 1MJCA 1N32Q 1Y1VH 1CSQA 4A3BB 4X65Q 4LF5Q 2F0TA 1ENFA 1GUOA 4OO1I 3VR4A 1YIJA 2MO0A 4EQNA 1HR0W 1TS3A 2I0QA 1PMRA 1D7QA 1K3BC 2YTYA 2R93B 3LGJA 1PRTD 3KK7A 2K50A 1ICFB 4X66Q 1IHZA 3A54A 5C4HA 4L5SA 4KHVA 2HDMA 5IWAL 1VQJA 4XYOA 1CHQD 2TSSA 1ILQA 4M1UB 2IHFA 2JA7H 4X62L 5CV5A 4G7OC 3FPUB 3R8BA 4C3JB 1PFSA 5A2QE 1AZQA 2CH4W 1D6EC 1CQFA 2K75A 4DPGA 2F0UA 2NN6G 1HZBA 4KKSA 1FR3A 1F2ZA 5JJLA 2D9UA 2IL8A 3EJIA 3NBHB 4FXDA 1C8CA 1ONLA 1G91A 3SK6A 3D0FA 2RSOA 3TMEA 4L5RC 3M7NA 3P1HA 4CGYB 1UAPA 4KJNA 4CDEC 4A75A 2BA1A 4LMQD 1JR0D 2K28A 4MNOA 3N52A 3PV0A 4R4OA 4FF1A 2WFWA 3KJPA 1KNEA 2NZOA 3D8GA 1OXVA 5IP9H 1XMOL 1QUQA 5D65A 2XGTA 3H09A 3K57A 5EKLA 4H13C 1CT1D 2F0LA 1XNQQ 1FGUA 2JA7G 2FINB 4LFAQ 4A3JG 2ZXRA 1K73C 1EQTA 2RCNA 3H91A 4DAPA 4LNQA 3GTPH 1I3QB 1A6XA 4GNXC 2EJMA 1CKNB 2WAQG 5C3EB 4NB3A 4A3MB 1CKNA 1M4VA 4BY1G 1Y69U 1SXTA 1N9WA 3FVQA 1HJPA 3KF6A 2OQKA 4DR6Q 2LXJA 1PH9A 4I65A 2Z4IA 4MN3A 5M3MG 1U4PA 2K6AA 3MEHA 3WWVA 1HNWQ 1STYA 2C9OA 5C4XH 2O5IC 1S3OA 5IYDH 4HSVA 4DV3L 3T1YQ 1N36Q 2HIVA 2ICEC 1QVGA 2HD3A 3AU7A 4FP5D 5E3FA 1I94L 2KHJA 1FD7D 2OXPA 3M4QA 2QEXA 3FDTA 3L2PA 5FLMH 4FXKC 5M3FG 1EL0A 4R8IA 1I50H 2BA0A 2WB1B 4YWKA 4LF4Q 2K01A 3E0EA 4A93B 1BCPB 4ZKCB 5JEAH 4AYBB 3HOVH 2G9DA 1SN8A 1SJED 5JPNC 5IIFA 4ZYSA 5DAUA 1M1KC 1U0LA 3KBGA 4H7BA 3TEHB 1CI3M 1NCVA 1SYGA 1PH5A 2RQXA 4Y7NB 2KCNA 1W2BA 5H1SE 1VQHA 1OO9B 2L5TA 2EYJA 4IJHA 4LF6Q 4AQYL 1B9MA 1CA5A 2JA5G 2SDFA 3CKIB 5EBCA 1HXYD 2H4OA 2O4XA 1QVCA 2MQHA 4MZ9A 1QZHA 1VQIA 1HNZL 4JI3Q 5G3LD 4A3KH 1PDQA 5KNBA 3KUPA 3U9SA 2A6HC 1F9PA 2YU9H 1TS4A 5IGDA 1KRTA 2AWNA 1UNSA 1TWCH 3CCJA 2PMZB 4Y7NH 2FXQA 4J1MA 1RDPD 2K04A 2YTXA 4L5QA 3CRLC 3WOEA 3TRZA 3SGIA 3KBXA 4IOCA 5M5YB 1HFNA 4XT3B 3T56B 5CBEE 5C44B 3J7YW 1BCPC 2YU9B 2B2YA 1WD0A 4JI7L 1N33Q 4DV6L 2VQFQ 3I90A 1JOQA 5CMDA 1DJRD 1EWHA 4WJWA 4K5XA 1F2LA 3H6MA 4BXXH 2R93H 1G2SA 3QJYA 1WVLA 1VQGA 2YV5A 5FJ8H 2QDLA 5GAHC 1AZPA 3PIOA 4YHHQ 1SE2A 5C44G 2VUMB 1LABA 3TZDA 2E2IB 4S3SA 3TREA 2OEOA 1EFID 1T5EA 2L9HA 4X6AH 3FHWA 5IGBA 1HA5A 4JI2Q 4DAYB 3F2DA 3HOYB 2QDBA 1VQ6A 1PZID 3VA5A 4DUZQ 2IW3A 2XSCA 4A3LH 3CQZB 1RF2D 2R61A 4ILWA 1YVCA 5EJWA 4MHEA 5E4WC 4GN4B 3J7AV 2R3ZA 2A69D 4KMUC 1GUTA 3IKJA 2HHHQ 3FKIB 4PV1C 2UUBL 1G2TA 3S15H 1VQ8A 3HOYG 1EQQA 1VQNA 3HOZB 3U4VA 2Z6KC 2ZTEA 4NXNQ 4OO1H 3PUYA 2A73B 3M4OB 1BNZA 3I4NB 2H1EA 2B2UA 2RHSB 2LY7A 1PTOB 4RGNA 1LT4D 3P7JA 4K14A 4NKLA 3SE0A 4EQ5A 2Z6KA 2K32A 3O13A 1C48A 1T5XD 3J80c 2NVQH 5EKIA 1EY4A 3I70A 1K83H 1G291 1QNUA 1V9PA 2ZT9C 3PO3G 4L5TA 3I4NH 3CC7A 3MHBA 2R92B 5IGCA 1RTOA 2F1MA 3MVVA 1VQBA 3D4DA 1ENCA 1PTOF 2MPMA 4PZ7A 2E5LL 4DR5L 2K05A 2CVRA 1U9RA 2EQSA 4H0LC 1VQCA 1PXUA 2PQAA 2K5WA 4JI6L 4RFBA 1X9NA 1JC7A 3RLNA 1NJIC 3P75A 1TWGB 2R7ZB 2Q8TA 2K5HA 3QWNA 4DUZL 5T1GA 2AQ2B 1W6KA 1L0XB 2B2WA 2QCPX 3OWEB 1NNXA 5FOBB 1EYCA 3K8AA 3L0OA 4A3JB 3DM1A 3RUZA 1SSOA 4NW2A 4TVAB 3D4RA 2JQOA 1SNDA 1SMYD 3BJUA 4FYDA 4ZCKA 4LF5L 1OXTA 1VF5C 1XPRA 2MP1A 3PQIA 4BXXG 4ZK9B 4AQYQ 3HGBA 2Z9HA 2B2YC 1I4HA 2Z6BA 4UDUC 3PUXA 3VR3A 3HOUH 1DOLA 1LTBD 4IPDA 4QUCA 2PW7A 2VL6A 3QO2A 1XTCD 5LMNL 4KV6A 3C2PA 1JQYD 1E7ZA 1TR5A 4BBSH 2DJFC 2M00A 2JA9A 1LTID 1IXRA 2EE1A 4JI0L 1GHKA 2XRSD 3CCSA 2R93G 4O2DA 1V1PB 5IWAQ 3VR5A 1PH4A 1B7YB 4EQOA 3TQYA 3SR1A 3AFQA 5LL6X 4XQNA 4NP5A 2NVXH 5C5MA 3HP3A 1NY4A 3Q6SA 1YNNC 5FK9C 2NVTH 1EU3A 1K28A 3NBIA 2DNEA 4K6LA 3GTLH 1YNXA 4GZYC 1JOKA 1LTLA 4C3HG 2VQFL 1P8LA 1MSGA 4K6DA 5IT9c 4DNRB 4CBVA 3K58A 4FF3A 1CK1A 3GTPB 3OTOL 4E6IA 1D2BA 2EXZA 3NQTA 2PW5A 3RLOA 3TZUA 2RF4A 1HCZA 1LTAD 1O7YA 3K0XA 3BG3A 1KIXA 2ASBA 2D2CC 1EZ8A 4N8X1 3TP5A 3LX0A 3K5NA 3Q23A 4LF4L 1T9HA 4G7HC 4U673 2CQOA 4A3FH 1EY6A 1BCPF 1KRSA 4DNTB 1S5BD 2BDNA 3QIAA 4PNYA 5EAYA 4MTKA 4JI8L 1VQMA 3SK8A 1I94Q 5K36G 3EQLC 1TY2A 2PQEA 3DUZA 2E2HH 1O80A 3GTKB 4DR6L 5C4JB 3VYRA 2Z0SA 1STHA 2EPBA 4IZ8A 2PI2E 2MFIA 2WKDA 1H95A 2PZUA 3JAML 4YCUA 1FNWA 4A3IG 3GD7A 3NPPA 3TBIB 5KEEA 3BVMA 2Q2HA 1TT2A 4CDDC 5LMUL 2KVMA 3NENA 3IFTA 3RN2A 1HUMA 2N88A 1S4ZA 1KLGD 1H9MA 3FEWX 2GN5A 4A3EB 1SNPA 2NTTA 2HDLA 1BCPD 4ZAIA 4FXGC 1PTOC 2RDGA 4QF4A 1JJGA 4WFN3 4RCOA 4R9WA 3K59A 1NUCA 3A8JE 4HCEA 1PHJA 4H02A 1MBYA 3U50C 1Q82C 3MAQA 2FMCA 2K52A 3J7AF 1AN8A 1YEZA 3VYUA 1XWEA 4B3SQ 1JB3A 1NR4A 4TKOB 4JYAL 1E3PA 2A74C 3MXGA 4KD3A 1XMQL 3NHHA 1HZ9A 2F0IA 4A3IB 3R2IA 1K8GA 2FJ2A 2LSSA 3A7AB 1B50A 3T16A 1L1OC 2J7ZA 4IUTA 4DXFA 2UUBQ 1SRUA 3ULPA 3E9IA 2J4XA 1GO3E 2BDOA 1DD2A 4A3GG 1EY9A 1TWGH 2R7ZH 4IUNA 4JPBW 2AUKA 3I4OA 3RD4A 4DAVA 5I6YA 2XWJB 5E4XA 3Q24A 5ISRA 1XNQL 4A3CH 1IKMA 4IFDG 1XXGA 3F2UA 4DR4Q 4C3HB 5C3EG 4A3DG 4ODGA 1QZGA 4BY7G 2E2IH 4BBSG 4ALPA 3RZDB 2NVTB 3IL8A 1BQQT 4B3TL 4IN3A 1HFGA 4JBWA 2JA8G 3ERSX 4YY3L 4B3SL 3I73A 4LFCQ 1VQFA 1KHIA 2B2WC 4KKUA 2ZJRA 1RIPA 4LUVA 4OIKA 3RZDH 1SNCA 1IKLA 4Y52H 1MIUA 4QQBX 1PRTB 3S14B 4X64L 4KK7A 3PO2B 1PH1A 5DM73 5M3MH 1TVXA 5FJ8G 1IBLQ 4MIUA 4K5VA 5LMNW 4HIKA 1MD2D 4A3FG 3J81c 3S2HH 1HUNA 1EQVA 3STBD 1VQ7A 2WV6D 1PYWD 3SHLA 4WJ3M 2SNMA 2L15A 2XTIA 4RH6A 2A8VA 1K9MC 4HN7A 4JVZA 3R3OA 2B2TC 4RGTA 3DEPA 4DN4M 5GADC 1IW7D 2E2HB 1Q3LA 3S2DB 4KN7C 1CFMA 3BZDB 5M5YH 5J3BA 3OPOA 1YNND 2KQ3A 2Z1CA 3CCQA 3PMFA 1I5FA 2DNCA 4G57A 4DR3Q 3F1ZA 5IYBG 2J0TD 5KIXA 1EQRA 3PUZA 1HNZQ 2JA6G 3PO3H 3R93A 3W1BA 4XDXA 4OIJA 5JAVA 3VR2A 1PLFA 2A6HD 1N33L 2JP1A 1KNAA 2OTLA 4A3EH 2A6EC 4HSPA 3KLRA 3PCOB 4UHVA 3U4ZA 1LT5D 2R7DA 2EY6A 2CWPA 3ZJYC 1A0IA 2JJQA 3AB9A 3CCMA 4QB4A 2BE5D 2RCFA 3S14H 3AYHB 4X3KA 4WJ4A 1SBBB 2F4IA 3OTOQ 2IWHA 1SR3A 3UDXA 1KDBA 3H0GB 5KNCA 3J81i 2MGSA 1BBUA 4K0KQ 1X3QA 3NUCA 2MJ8A 2CFMA 1A3VA 1DGSA 1B2TA 3J80i 3URYA 3S1QH 2K5NA 1ASZA 1J9OA 4BA1I 1EOVA 1UUPA 4ID6A 5M3FH 1BUVT 1I4GA 2B63B 2WINB 3ULLA 2QW7A 2RBMA 3SK5A 1HH2P 3HEJA 4A93G 3OSOA 1SNQA 1X3GA 4DAMA 4IPGA 4X3TA 3RR5A 4C1NI 1XYIA 1A2TA 1RD9D 2VB3X 1YJ9A 1IYJB 2CHBD 2SEBD 1B70B 4JOIA 4CKCA 1CUKA 2L0CA 1PZKD 3CP0A 5ELDA 1X32A 2PCFB 4LF8Q 1BO0A 3V96A 2ENBA 3SVMA 4IO9A 4WORA 2JA5H 4DR5Q 1RL2A 2NVXB 1EIHA 2E8GA 2Z4HA 1DCZA 1ZYRC 1QWYA 3I56A 1SJHD 2F52A 5CV8A 3CCEA 3MWYW 3GTJH 3HOXH 2JEAI 2MUYA 4U68A 4MTNA 1KQSA 1EIYB 4DV1L 3IRBA 3H0GH 2B29A 1V43A 4OWXB 1XJVA 4X65L 1Q90A 1IL8A 2NBFA 3JAMc 4IQZA 1N8RC 1D5MC 3PF4A 1V8QA 3ITPA 3KLSX 1XPUA 3GTGB 4POGA 1Y1WB 1ICWA 2JSOA 3K5MA 2VNUD 1VCIA 4DK0A 3A5UA 4FF2A 2KBNA 3A8KE 2BCOA 1B53A 4JI0Q 4DFAA 1RCVD 2JE6I 3T53B 3NP8A 4GKJL 1N34L 1IW7C 2MHVA 4B3ML 4N8FA 2KENA 3MZ5A 4BS9A 2XIWA 5COYA 3GTQB 4C2MB 2B63G 2F3VA 2G5DA 3EFXD 4KHPL 3VYTA 4XXEA 4IUVA 3IFDA 2PO4A 1STBA 1RTNA 1BVSA 1TWHH 4DV4L 3I4MH 1EY5A 1BDOA 1QJOA 4HJAA 3K7UC 1FJGL 4KI0A 2I5MX 4HJ5A 3I2ZA 2Q2TA 2XRQD 2K1BA 2RSNA 1YZ6A 2N49A 4LF9Q 2CH4A 1E22A 3B6YA 2PI2A 3FMCA 3K6OA 1PTOH 4ZLTF 1L2FA 4HEDA 1KD1C 1MSHA 3FPPA 4C56C 4DV5L 4RKLA 1MGSA 2X6GA 1JORA 1ESRA 4RHSA 2RHQB 3HOZG 4K2LA 1LLRD 3NTHA 4L8JA 5BR8L 3J7ZC 2JN4A 4AYBE 1M90C 2XVSA 4JG2A 4ULLA 1J5EL 4JK1C 4BY1H 1LO5D 3RMHA 3NWTA 3S1MH 1EIFA 5JVH3 4RGMA 3MEFA 3HOZH 3V2TA 1BXTA 2ZJPA 1X3FA 2IT1A 4KLKA 4AH6A 1SYCA 4RG1A 3J7A5 5CYUA 3GTOB 3T51B 2KECA 1SROA 2H5XA 2A1AA 5M3FB 1IBML 3NK9A 2LXKA 1WD1A 1PFMA 2K7VA 3I72A 4OWWB 2BH8A 5ELFA 1X3EA 2PNRC 1KLUD 3CC2A 3MXNB 3HOWB 1JB7A 3K80C 4X3SA 4RKBA 4RAUC 2RDFA 3MXNA
chains in the Genus database with same CATH topology
4NXNL 4DUYL 5IYDH 4PZ8A 4DV5Q 1HNXL 4LUOA 2DUDA 4GNXB 5C4JH 5IP9G 2JA8H 4JI6Q 3GTLH 4PMWA 4JI5L 4B3RQ 1YNXA 2R6GA 4DR7Q 1LTLA 1UWVA 3TS0A 3PF5A 2VQFL 1A62A 1Z47A 2F3IA 1P8LA 3A74A 3FP9A 1CSPA 4JC0A 5IT9c 1I6HH 4BBRG 2I5HA 2BH2A 1VQOA 2UXCL 2OTJA 5HGQA 4APVA 1UEBA 3U58A 4A3CG 1NMFA 2ALYB 2D0OA 3STBC 1YITA 3OTOL 4IJLA 4YY3Q 2EXDA 1JT8A 1HR0L 4DR2L 3RLOA 4TQUS 4GOPC 1Y1WH 2MNAA 3RN5A 1BKBA 4PG3A 4QJFA 5GQOA 2RF4A 2VW9A 1Q7YC 2CCZA 3K0XA 3HOYG 1L1OA 1LYLA 1Z9FA 1KIXA 2ASBA 3F2BA 2ZM6Q 3HOUG 2D62A 2QGQA 2UUAQ 3S2DH 4LF4L 3CCVA 1T9HA 5M5XH 1D8LA 4OO1G 1Q8KA 1OXSC 1S72A 3T1HQ 2CQOA 1AE2A 1NMGA 3DLLA 3PGZA 1KRSA 4X64Q 3CCUA 4A3FH 2R92G 4B3RL 1YHAA 5EAYA 4JI8L 1JE5A 3KF8B 1VQMA 4IPHA 2JA6H 1PA6A 4A3BH 2YTVA 2UXBL 3HFZB 5K36G 1I94Q 2UXDQ 1Q1EA 3PUVA 5AJ3Q 1Y14B 1L0WA 2E2HH 1X54A 4DR6L 3VDYA 4OX9L 2AHOB 4DV6Q 2Z0SA 1SLJA 3HOWG 2PI2E 3EN2A 2MFIA 1OXXK 1UE6A 3CQZH 4XTCS 1B8AA 4XIGS 2UU9Q 1H95A 5GAEC 1C7YA 1XNRL 4A3GH 1X6OA 3A5ZB 4YCUA 3CXCA 4A3IG 4JI2L 1SMXA 4JI4Q 3S1NH 3GD7A 1I3QH 1MJCA 1VQDA 1N32Q 1FL0A 1Y1VH 2GVAA 3G48A 1CSQA 3GTGH 2VZAA 1Q1BA 4X65Q 1Y1WG 4GLVB 2Q2HA 4LF5Q 5LMUL 4OO1I 2CKZB 3NENA 3RN2A 4DV2Q 1YIJA 2MO0A 1HR0W 4YHHL 2I0QA 1D7QA 1N32L 4A3MH 2GN5A 1E1TA 2YTYA 3LGJA 2K5VA 4NPSA 2K50A 4X66Q 1AH9A 4L5SA 4GN3B 4J15A 2R92H 5IWAL 4GLXA 3I4NG 1VQJA 2VUMG 3PSIA 3FKIG 4NXMQ 5IY0A 3CAMA 2IHFA 2JA7H 4X62L 2N78A 2CWAA 3KOJA 1YJWA 1JJGA 5IYCG 2IX0A 1PHJA 1PFSA 3AQQA 5FLMG 4H02A 2K75A 4DPGA 3U50C 4HJ8A 2ID0A 1Q82C 2E2JH 4RMFA 2NN6G 2K52A 3RZOH 1HZBA 1HNXQ 1YEZA 5C0XG 4LFBL 4JBMA 2UXDL 5JJLA 4B3SQ 4IOAA 3UE1A 3NBHB 4UY8C 2WAQE 2AWOA 3D0FA 5IYDG 4JYAL 1E3PA 1IBKQ 4L5RC 2PNHA 1XMQL 1C0AA 1N34Q 3M7NA 4A3DH 2A19A 1HZ9A 4BY7H 2K4KA 1PH3A 5BR8Q 3DM3A 4GLAC 4A75A 2BA1A 1Q12A 3ULJA 4MNOA 1K8GA 1QUQB 2LSSA 3PV0A 4R4OA 2WFWA 1L1OC 3KJPA 3M3YH 2NZOA 2YYZA 4P71A 2UUBQ 1NTGA 1OXVA 1SRUA 4YWMA 3M4OH 5IP9H 2MO1A 2VS1A 3ULPA 1XMOL 1QUQA 3E9IA 2XGTA 3M9BA 4JI5Q 4QL5A 1GO3E 1WI5A 1XTDA 4A3GG 1TWGH 1XNQQ 1FGUA 4LW1A 2R7ZH 2JA7G 4A3EG 3EIVA 1UE7A 3S16H 3I4OA 1WCMH 4LFAQ 4A3JG 1K73C 2D0PA 1VQ5A 4IFDI 2RCNA 1XNQL 4A3CH 3GTMH 4IFDG 1PYSB 1LUZA 1KAWA 4LF6L 4LNQA 4DR4Q 4EX5A 4DV4Q 4DK6C 5C3EG 2ATWA 3GTPH 4R4QA 2ZM6L 1N33L 1A8VA 2HT1A 1QVFA 4A3DG 1QZGA 4BY7G 1WCMG 1PH6A 4YWLA 3F2CA 3CMAA 4GNXC 2E2IH 4BBSG 4K0KL 4ALPA 3HOXG 1CKNB 1EUJA 4B3TL 1Y1VG 2WAQG 4JBWA 2JA8G 3ERSX 4IPCA 4NB3A 4YY3L 3Q8DA 1O7IA 5HY6A 4HIDA 1IBKL 1YJNA 4PZ6A 2HQLA 4B3SL 2NN6I 3KDFB 1CKNA 4BY1G 5ELNA 1N9WA 1HJPA 4DV0L 3KF6A 1K8AC 2OQKA 4DR6Q 4LFCQ 1VQFA 1KHIA 2LXJA 4R1JA 3PUWA 2QA4A 3AEVA 1PH9A 2N3SA 4JI1Q 1IL2A 5M3MG 2ZJRA 1XPOA 2EIFA 1N36L 1RIPA 4LUVA 1YHBA 4B3MQ 3WWVA 3RZDH 1HNWQ 3K81C 1XNRQ 4Y52H 1MIUA 5C4XH 3CCRA 1VQ4A 1S3OA 4LFCL 2Y0SG 4QQBX 3H3VH 4X64L 1EWIA 4DV7Q 2R7FA 4DV3L 3T1YQ 4A93H 1N36Q 3W1GA 1PH1A 2HIVA 2PMZE 5M3MH 5FJ8G 1IBLQ 5LMNW 1QVGA 2UUCQ 4HIKA 4NXML 4A3FG 1I94L 3J81c 4UP8A 3S2HH 2KHJA 3H0GG 3STBD 1LM0A 4DR1L 1VQ7A 4DV7L 3M4QA 1VQKA 2ZTDA 2QEXA 3L2PA 4WJ3M 2L15A 2XTIA 5FLMH 1EYGA 5M3FG 2A8VA 2F4VQ 1Q46A 1K9MC 2ZJQA 1I50H 1UE5A 2BA0A 4YCVA 4YWKA 5GADC 4LF4Q 1CKOA 3E0EA 3HKZG 1JMCA 3I4MG 1PH7A 3HOVH 1VQEA 4DR4L 3A0JA 1SN8A 4P73A 5M5YH 5J3BA 4JCVE 3UDGA 1VQ9A 1HZCA 4B3TQ 3CCQA 4DR2Q 1I5FA 4C3HH 1M1KC 1U0LA 1WYDA 4P75A 4GS3A 4DR3Q 5IE8A 4LF8L 3F1ZA 3GTQH 5IYBG 4GNXA 4LF7L 1EQRA 3CC4A 3PUZA 3TEHB 4QIWE 1HNZQ 2JA6G 3PO3H 4QGUA 1PH5A 1TWAH 3W1BA 1W2BA 5H1SE 1VQHA 1YI2A 1PH8A 4JI4L 4IJHA 4LF6Q 4AQYL 2JA5G 4A3LG 5JJKA 2WB1E 2NZHA 1QVCA 1P16A 2MQHA 4MZ9A 4DK3C 1VQIA 2Y0SE 4JI1L 3L7ZC 1QZHA 2WP8J 1HNZL 2OTLA 4JI3Q 3TS2A 4A3EH 4JV5L 4A3KH 3PCOB 3U4ZA 2R7DA 2YU9H 2CWPA 1KRTA 4IFDJ 3ZJYC 3M4PA 2IY5B 1A0IA 1GKHA 2AWNA 2JJQA 2UUAL 1TWCH 3CCMA 3CCJA 4LWCA 4Y7NH 3S14H 2FXQA 5JEAJ 3HOYH 2YTXA 3AYHB 4L5QA 1U5KA 4WJ4A 1KL9A 4DR1Q 3T1HL 3TRZA 5C3EH 4QY7A 3SGIA 3UDIA 3OTOQ 2B63H 3G6EA 1CKMA 1SR3A 3UDXA 2N8NA 3J81i 4LF9L 3HKZE 1X55A 4IOCA 1BBUA 1GM5A 2F4VL 4K0KQ 2OWOA 3NEMA 2AKWB 4A3MG 2CFMA 3ICEA 1DGSA 3J80i 1HZAA 4UP9A 2HHHL 4JI7L 1N33Q 3S1QH 2K5NA 2VQFQ 4DV6L 1ASZA 4OX9Q 1NBWA 1FJGQ 1NE3A 4BA1I 1EOVA 2UUCL 4BA2I 5M3FH 4AIMA 4DV0Q 4R4TA 1OXUA 1GD7A 2K14A 3ULLA 4BXXH 1W3SA 5IP7G 3I7FA 4LF7Q 1HH2P 2R93H 4A93G 4A4IA 3H15A 1VQGA 3G4SA 1X3GA 2DGYA 2YV5A 4DAMA 2WB1G 4X62Q 5FJ8H 4IPGA 3W5OA 2JEBI 5GAHC 1J5EQ 3JAMi 3RR5A 5C0XJ 4R4CA 3PIOA 1YJ9A 5IYBH 4YHHQ 5C44G 1IYJB 1IZ6A 1KC8C 3BZCA 3TREA 3CW2C 4POFA 1B70B 4X6AH 4JOIA 1CUKA 3FHWA 2Q2IA 4JI3L 4LUZA 4JI2Q 5IP7H 3OW2A 4DAYB 1X65A 3CP0A 4C3JH 3F2DA 4A3JH 5JJIA 3JC66 4DR3L 4LF8Q 4GKKQ 1VQ6A 4IO9A 3KF6B 4DUZQ 2JA5H 4A3LH 4JYAQ 5LMUQ 4DR5Q 1HR0Q 3HOVG 1YVCA 4DV2L 4C2MH 1RL2A 1IBMQ 4GN4B 2E8GA 4GN5A 4HIMA 3I56A 2F52A 1E24A 3CCEA 3GTJH 3HOXH 2JEAI 4JV5Q 4MTNA 1KQSA 1EIYB 4DV1L 2HHHQ 2UUBL 3IRBA 4JI8Q 4DKAC 3PO2H 3CF5A 3H0GH 1PH2A 3S15H 2B29A 1VQ8A 4DR7L 5GAGC 3GTKH 1EQQA 1V43A 1VQNA 1JJCB 4OWXB 3E9HA 1XJVA 3U4VA 4X65L 2Z6KC 4DUYQ 2ZTEA 4NXNQ 3JAMc 5C44H 2KCTA 3PUYA 2B3GA 2E5LQ 1N8RC 1KXLA 3PF4A 5AJ3L 4YCWA 2RHSB 1MJEA 1WOCA 4X66L 3S17H 4GKJQ 4O0AA 1XPUA 1VQLA 4POGA 4A3KG 2VNUD 3S24A 1TWFH 1VCIA 5DLQE 3CD6A 1K0RA 4ME3A 3A5UA 1BBWA 2HIXA 4EQ5A 2KBNA 1E1OA 2Z6KA 3S1RH 2C35B 4JI0Q 2I5LX 3J80c 2NVQH 2JE6I 4GKJL 5M5WH 2UXBQ 2VUMH 1N34L 1K83H 4B3ML 1G291 2IHEA 1V9PA 2KENA 4AYBG 3PO3G 4L5TA 4LFAL 3I4NH 3CC7A 2B63G 2VY3A 1MKHA 3BU2A 4KHPL 2ZTCA 1VQBA 3KLWA 5ELOA 1OTCA 3ER0A 3M85A 4PZ7A 2E5LL 4DR5L 3PO2G 1EFWA 1BVSA 1TWHH 5JEAG 4DV4L 2EQSA 1XMOQ 3CMEA 5FLXc 4HJAA 3I4MH 3K7UC 1J6QA 1VQCA 1V1QA 1FJGL 4KI0A 1WFQA 2I5MX 4HJ5A 4KHPQ 4C3IH 3I2ZA 3UDFA 2PQAA 2Q2TA 1G6PA 3BZKA 3OYYA 3RNUA 4JI6L 2R7ZG 1X9NA 3HOWH 1GVPA 1HNWL 1X56A 5E7NA 2AMCB 3RLNA 2PQAB 3AFPA 1NJIC 3GDEA 2GVBA 1YZ6A 2N49A 2K5HA 3K7AH 4P72A 4LF9Q 3GTOH 4OXPA 3RLFA 1E22A 3B6YA 2PI2A 4KHZA 1L1OB 4DUZL 3FKIH 1R9TH 1FVIA 1L2FA 1KD1C 3CPFA 3I55A 1PV4A 5C0XI 2VQEL 3K8AA 3L0OA 1YHQA 4HJ7A 3H3VI 4LFBQ 4JI7Q 3KJOA 5C4XG 4OWTB 4JBKA 4DV5L 4TVAB 2JQOA 3BJUA 4LF5L 1Q86C 5GROA 1PYBA 1OXTA 1XPRA 3KFUA 2RHQB 3HOZG 4DV3Q 3T1YL 3KDFA 4UP7A 1TXYA 5BR8L 3J7ZC 4BXXG 4AQYQ 4AYBE 1VQPA 1M90C 4UPAA 3UE0A 2UU9L 5LMNQ 4OONA 4JG2A 1J5EL 3CCLA 4BY1H 1C9OA 3PUXA 4HJ9A 4A3IH 1VS0A 3HOUH 2KCMA 3S1MH 4R4IA 1EIFA 3J81j 1UE1A 4IPDA 1YBYA 2JK8A 3MEFA 3HKSA 2V1CC 3HOZH 2VL6A 4GOPB 4A76A 3NELA 5LMNL 1XMQQ 1Q81C 2ZJPA 1WJJA 1X3FA 4BBRH 2Q2UA 1E7ZA 2IT1A 4JOIC 5IYCH 2IX1A 4KLKA 4FDBA 4AH6A 4DV1Q 4BBSH 4RG1A 1VQAA 1SFOH 4A3BG 1G51A 4GKKL 1K3RA 4GOPA 3PIPA 1PVOA 3J7A5 2JA9A 4P74A 1IXRA 1S40A 1SE8A 1SROA 4JI0L 4HIOA 2NVYH 3GO5A 2H5XA 3CCSA 2A1AA 1IBML 2UXCQ 4O2DA 2R93G 3F8TA 2LXKA 5IWAQ 2OQ0A 3CPWA 1AE3A 3KYHC 1PH4A 1B7YB 4OWWB 2BH8A 3TQYA 4DNIA 1X3EA 3D31A 1ASYA 3AFQA 2KHIA 3CC2A 3MXNB 2VQEQ 4JBJA 1JB7A 2NVXH 2OCEA 3K80C 3G71A 2ES2A 1NY4A 1IBLL 3EBEA 1A63A 1JJ2A 2NVTH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN L;  4DUY L;  5IYD H;  4PZ8 A;  4DV5 Q;  1HNX L;  4LUO A;  2DUD A;  4GNX B;  5C4J H;  5IP9 G;  2JA8 H;  4JI6 Q;  3GTL H;  4PMW A;  4JI5 L;  4B3R Q;  1YNX A;  2R6G A;  4DR7 Q;  1LTL A;  1UWV A;  3TS0 A;  3PF5 A;  2VQF L;  1A62 A;  1Z47 A;  2F3I A;  1P8L A;  3A74 A;  3FP9 A;  1CSP A;  4JC0 A;  5IT9 c;  1I6H H;  4BBR G;  2I5H A;  2BH2 A;  1VQO A;  2UXC L;  2OTJ A;  5HGQ A;  4APV A;  1UEB A;  3U58 A;  4A3C G;  1NMF A;  2ALY B;  2D0O A;  3STB C;  1YIT A;  3OTO L;  4IJL A;  4YY3 Q;  2EXD A;  1JT8 A;  1HR0 L;  4DR2 L;  3RLO A;  4TQU S;  4GOP C;  1Y1W H;  2MNA A;  3RN5 A;  1BKB A;  4PG3 A;  4QJF A;  5GQO A;  2RF4 A;  2VW9 A;  1Q7Y C;  2CCZ A;  3K0X A;  3HOY G;  1L1O A;  1LYL A;  1Z9F A;  1KIX A;  2ASB A;  3F2B A;  2ZM6 Q;  3HOU G;  2D62 A;  2QGQ A;  2UUA Q;  3S2D H;  4LF4 L;  3CCV A;  1T9H A;  5M5X H;  1D8L A;  4OO1 G;  1Q8K A;  1OXS C;  1S72 A;  3T1H Q;  2CQO A;  1AE2 A;  1NMG A;  3DLL A;  3PGZ A;  1KRS A;  4X64 Q;  3CCU A;  4A3F H;  2R92 G;  4B3R L;  1YHA A;  5EAY A;  4JI8 L;  1JE5 A;  3KF8 B;  1VQM A;  4IPH A;  2JA6 H;  1PA6 A;  4A3B H;  2YTV A;  2UXB L;  3HFZ B;  5K36 G;  1I94 Q;  2UXD Q;  1Q1E A;  3PUV A;  5AJ3 Q;  1Y14 B;  1L0W A;  2E2H H;  1X54 A;  4DR6 L;  3VDY A;  4OX9 L;  2AHO B;  4DV6 Q;  2Z0S A;  1SLJ A;  3HOW G;  2PI2 E;  3EN2 A;  2MFI A;  1OXX K;  1UE6 A;  3CQZ H;  4XTC S;  1B8A A;  4XIG S;  2UU9 Q;  1H95 A;  5GAE C;  1C7Y A;  1XNR L;  4A3G H;  1X6O A;  3A5Z B;  4YCU A;  3CXC A;  4A3I G;  4JI2 L;  1SMX A;  4JI4 Q;  3S1N H;  3GD7 A;  1I3Q H;  1MJC A;  1VQD A;  1N32 Q;  1FL0 A;  1Y1V H;  2GVA A;  3G48 A;  1CSQ A;  3GTG H;  2VZA A;  1Q1B A;  4X65 Q;  1Y1W G;  4GLV B;  2Q2H A;  4LF5 Q;  5LMU L;  4OO1 I;  2CKZ B;  3NEN A;  3RN2 A;  4DV2 Q;  1YIJ A;  2MO0 A;  1HR0 W;  4YHH L;  2I0Q A;  1D7Q A;  1N32 L;  4A3M H;  2GN5 A;  1E1T A;  2YTY A;  3LGJ A;  2K5V A;  4NPS A;  2K50 A;  4X66 Q;  1AH9 A;  4L5S A;  4GN3 B;  4J15 A;  2R92 H;  5IWA L;  4GLX A;  3I4N G;  1VQJ A;  2VUM G;  3PSI A;  3FKI G;  4NXM Q;  5IY0 A;  3CAM A;  2IHF A;  2JA7 H;  4X62 L;  2N78 A;  2CWA A;  3KOJ A;  1YJW A;  1JJG A;  5IYC G;  2IX0 A;  1PHJ A;  1PFS A;  3AQQ A;  5FLM G;  4H02 A;  2K75 A;  4DPG A;  3U50 C;  4HJ8 A;  2ID0 A;  1Q82 C;  2E2J H;  4RMF A;  2NN6 G;  2K52 A;  3RZO H;  1HZB A;  1HNX Q;  1YEZ A;  5C0X G;  4LFB L;  4JBM A;  2UXD L;  5JJL A;  4B3S Q;  4IOA A;  3UE1 A;  3NBH B;  4UY8 C;  2WAQ E;  2AWO A;  3D0F A;  5IYD G;  4JYA L;  1E3P A;  1IBK Q;  4L5R C;  2PNH A;  1XMQ L;  1C0A A;  1N34 Q;  3M7N A;  4A3D H;  2A19 A;  1HZ9 A;  4BY7 H;  2K4K A;  1PH3 A;  5BR8 Q;  3DM3 A;  4GLA C;  4A75 A;  2BA1 A;  1Q12 A;  3ULJ A;  4MNO A;  1K8G A;  1QUQ B;  2LSS A;  3PV0 A;  4R4O A;  2WFW A;  1L1O C;  3KJP A;  3M3Y H;  2NZO A;  2YYZ A;  4P71 A;  2UUB Q;  1NTG A;  1OXV A;  1SRU A;  4YWM A;  3M4O H;  5IP9 H;  2MO1 A;  2VS1 A;  3ULP A;  1XMO L;  1QUQ A;  3E9I A;  2XGT A;  3M9B A;  4JI5 Q;  4QL5 A;  1GO3 E;  1WI5 A;  1XTD A;  4A3G G;  1TWG H;  1XNQ Q;  1FGU A;  4LW1 A;  2R7Z H;  2JA7 G;  4A3E G;  3EIV A;  1UE7 A;  3S16 H;  3I4O A;  1WCM H;  4LFA Q;  4A3J G;  1K73 C;  2D0P A;  1VQ5 A;  4IFD I;  2RCN A;  1XNQ L;  4A3C H;  3GTM H;  4IFD G;  1PYS B;  1LUZ A;  1KAW A;  4LF6 L;  4LNQ A;  4DR4 Q;  4EX5 A;  4DV4 Q;  4DK6 C;  5C3E G;  2ATW A;  3GTP H;  4R4Q A;  2ZM6 L;  1N33 L;  1A8V A;  2HT1 A;  1QVF A;  4A3D G;  1QZG A;  4BY7 G;  1WCM G;  1PH6 A;  4YWL A;  3F2C A;  3CMA A;  4GNX C;  2E2I H;  4BBS G;  4K0K L;  4ALP A;  3HOX G;  1CKN B;  1EUJ A;  4B3T L;  1Y1V G;  2WAQ G;  4JBW A;  2JA8 G;  3ERS X;  4IPC A;  4NB3 A;  4YY3 L;  3Q8D A;  1O7I A;  5HY6 A;  4HID A;  1IBK L;  1YJN A;  4PZ6 A;  2HQL A;  4B3S L;  2NN6 I;  3KDF B;  1CKN A;  4BY1 G;  5ELN A;  1N9W A;  1HJP A;  4DV0 L;  3KF6 A;  1K8A C;  2OQK A;  4DR6 Q;  4LFC Q;  1VQF A;  1KHI A;  2LXJ A;  4R1J A;  3PUW A;  2QA4 A;  3AEV A;  1PH9 A;  2N3S A;  4JI1 Q;  1IL2 A;  5M3M G;  2ZJR A;  1XPO A;  2EIF A;  1N36 L;  1RIP A;  4LUV A;  1YHB A;  4B3M Q;  3WWV A;  3RZD H;  1HNW Q;  3K81 C;  1XNR Q;  4Y52 H;  1MIU A;  5C4X H;  3CCR A;  1VQ4 A;  1S3O A;  4LFC L;  2Y0S G;  4QQB X;  3H3V H;  4X64 L;  1EWI A;  4DV7 Q;  2R7F A;  4DV3 L;  3T1Y Q;  4A93 H;  1N36 Q;  3W1G A;  1PH1 A;  2HIV A;  2PMZ E;  5M3M H;  5FJ8 G;  1IBL Q;  5LMN W;  1QVG A;  2UUC Q;  4HIK A;  4NXM L;  4A3F G;  1I94 L;  3J81 c;  4UP8 A;  3S2H H;  2KHJ A;  3H0G G;  3STB D;  1LM0 A;  4DR1 L;  1VQ7 A;  4DV7 L;  3M4Q A;  1VQK A;  2ZTD A;  2QEX A;  3L2P A;  4WJ3 M;  2L15 A;  2XTI A;  5FLM H;  1EYG A;  5M3F G;  2A8V A;  2F4V Q;  1Q46 A;  1K9M C;  2ZJQ A;  1I50 H;  1UE5 A;  2BA0 A;  4YCV A;  4YWK A;  5GAD C;  4LF4 Q;  1CKO A;  3E0E A;  3HKZ G;  1JMC A;  3I4M G;  1PH7 A;  3HOV H;  1VQE A;  4DR4 L;  3A0J A;  1SN8 A;  4P73 A;  5M5Y H;  5J3B A;  4JCV E;  3UDG A;  1VQ9 A;  1HZC A;  4B3T Q;  3CCQ A;  4DR2 Q;  1I5F A;  4C3H H;  1M1K C;  1U0L A;  1WYD A;  4P75 A;  4GS3 A;  4DR3 Q;  5IE8 A;  4LF8 L;  3F1Z A;  3GTQ H;  5IYB G;  4GNX A;  4LF7 L;  1EQR A;  3CC4 A;  3PUZ A;  3TEH B;  4QIW E;  1HNZ Q;  2JA6 G;  3PO3 H;  4QGU A;  1PH5 A;  1TWA H;  3W1B A;  1W2B A;  5H1S E;  1VQH A;  1YI2 A;  1PH8 A;  4JI4 L;  4IJH A;  4LF6 Q;  4AQY L;  2JA5 G;  4A3L G;  5JJK A;  2WB1 E;  2NZH A;  1QVC A;  1P16 A;  2MQH A;  4MZ9 A;  4DK3 C;  1VQI A;  2Y0S E;  4JI1 L;  3L7Z C;  1QZH A;  2WP8 J;  1HNZ L;  2OTL A;  4JI3 Q;  3TS2 A;  4A3E H;  4JV5 L;  4A3K H;  3PCO B;  3U4Z A;  2R7D A;  2YU9 H;  2CWP A;  1KRT A;  4IFD J;  3ZJY C;  3M4P A;  2IY5 B;  1A0I A;  1GKH A;  2AWN A;  2JJQ A;  2UUA L;  1TWC H;  3CCM A;  3CCJ A;  4LWC A;  4Y7N H;  3S14 H;  2FXQ A;  5JEA J;  3HOY H;  2YTX A;  3AYH B;  4L5Q A;  1U5K A;  4WJ4 A;  1KL9 A;  4DR1 Q;  3T1H L;  3TRZ A;  5C3E H;  4QY7 A;  3SGI A;  3UDI A;  3OTO Q;  2B63 H;  3G6E A;  1CKM A;  1SR3 A;  3UDX A;  2N8N A;  3J81 i;  4LF9 L;  3HKZ E;  1X55 A;  4IOC A;  1BBU A;  1GM5 A;  2F4V L;  4K0K Q;  2OWO A;  3NEM A;  2AKW B;  4A3M G;  2CFM A;  3ICE A;  1DGS A;  3J80 i;  1HZA A;  4UP9 A;  2HHH L;  4JI7 L;  1N33 Q;  3S1Q H;  2K5N A;  2VQF Q;  4DV6 L;  1ASZ A;  4OX9 Q;  1NBW A;  1FJG Q;  1NE3 A;  4BA1 I;  1EOV A;  2UUC L;  4BA2 I;  5M3F H;  4AIM A;  4DV0 Q;  4R4T A;  1OXU A;  1GD7 A;  2K14 A;  3ULL A;  4BXX H;  1W3S A;  5IP7 G;  3I7F A;  4LF7 Q;  1HH2 P;  2R93 H;  4A93 G;  4A4I A;  3H15 A;  1VQG A;  3G4S A;  1X3G A;  2DGY A;  2YV5 A;  4DAM A;  2WB1 G;  4X62 Q;  5FJ8 H;  4IPG A;  3W5O A;  2JEB I;  5GAH C;  1J5E Q;  3JAM i;  3RR5 A;  5C0X J;  4R4C A;  3PIO A;  1YJ9 A;  5IYB H;  4YHH Q;  5C44 G;  1IYJ B;  1IZ6 A;  1KC8 C;  3BZC A;  3TRE A;  3CW2 C;  4POF A;  1B70 B;  4X6A H;  4JOI A;  1CUK A;  3FHW A;  2Q2I A;  4JI3 L;  4LUZ A;  4JI2 Q;  5IP7 H;  3OW2 A;  4DAY B;  1X65 A;  3CP0 A;  4C3J H;  3F2D A;  4A3J H;  5JJI A;  3JC6 6;  4DR3 L;  4LF8 Q;  4GKK Q;  1VQ6 A;  4IO9 A;  3KF6 B;  4DUZ Q;  2JA5 H;  4A3L H;  4JYA Q;  5LMU Q;  4DR5 Q;  1HR0 Q;  3HOV G;  1YVC A;  4DV2 L;  4C2M H;  1RL2 A;  1IBM Q;  4GN4 B;  2E8G A;  4GN5 A;  4HIM A;  3I56 A;  2F52 A;  1E24 A;  3CCE A;  3GTJ H;  3HOX H;  2JEA I;  4JV5 Q;  4MTN A;  1KQS A;  1EIY B;  4DV1 L;  2HHH Q;  2UUB L;  3IRB A;  4JI8 Q;  4DKA C;  3PO2 H;  3CF5 A;  3H0G H;  1PH2 A;  3S15 H;  2B29 A;  1VQ8 A;  4DR7 L;  5GAG C;  3GTK H;  1EQQ A;  1V43 A;  1VQN A;  1JJC B;  4OWX B;  3E9H A;  1XJV A;  3U4V A;  4X65 L;  2Z6K C;  4DUY Q;  2ZTE A;  4NXN Q;  3JAM c;  5C44 H;  2KCT A;  3PUY A;  2B3G A;  2E5L Q;  1N8R C;  1KXL A;  3PF4 A;  5AJ3 L;  4YCW A;  2RHS B;  1MJE A;  1WOC A;  4X66 L;  3S17 H;  4GKJ Q;  4O0A A;  1XPU A;  1VQL A;  4POG A;  4A3K G;  2VNU D;  3S24 A;  1TWF H;  1VCI A;  5DLQ E;  3CD6 A;  1K0R A;  4ME3 A;  3A5U A;  1BBW A;  2HIX A;  4EQ5 A;  2KBN A;  1E1O A;  2Z6K A;  3S1R H;  2C35 B;  4JI0 Q;  2I5L X;  3J80 c;  2NVQ H;  2JE6 I;  4GKJ L;  5M5W H;  2UXB Q;  2VUM H;  1N34 L;  1K83 H;  4B3M L;  1G29 1;  2IHE A;  1V9P A;  2KEN A;  4AYB G;  3PO3 G;  4L5T A;  4LFA L;  3I4N H;  3CC7 A;  2B63 G;  2VY3 A;  1MKH A;  3BU2 A;  4KHP L;  2ZTC A;  1VQB A;  3KLW A;  5ELO A;  1OTC A;  3ER0 A;  3M85 A;  4PZ7 A;  2E5L L;  4DR5 L;  3PO2 G;  1EFW A;  1BVS A;  1TWH H;  5JEA G;  4DV4 L;  2EQS A;  1XMO Q;  3CME A;  5FLX c;  4HJA A;  3I4M H;  3K7U C;  1J6Q A;  1VQC A;  1V1Q A;  1FJG L;  4KI0 A;  1WFQ A;  2I5M X;  4HJ5 A;  4KHP Q;  4C3I H;  3I2Z A;  3UDF A;  2PQA A;  2Q2T A;  1G6P A;  3BZK A;  3OYY A;  3RNU A;  4JI6 L;  2R7Z G;  1X9N A;  3HOW H;  1GVP A;  1HNW L;  1X56 A;  5E7N A;  2AMC B;  3RLN A;  2PQA B;  3AFP A;  1NJI C;  3GDE A;  2GVB A;  1YZ6 A;  2N49 A;  2K5H A;  3K7A H;  4P72 A;  4LF9 Q;  3GTO H;  4OXP A;  3RLF A;  1E22 A;  3B6Y A;  2PI2 A;  4KHZ A;  1L1O B;  4DUZ L;  3FKI H;  1R9T H;  1FVI A;  1L2F A;  1KD1 C;  3CPF A;  3I55 A;  1PV4 A;  5C0X I;  2VQE L;  3K8A A;  3L0O A;  1YHQ A;  4HJ7 A;  3H3V I;  4LFB Q;  4JI7 Q;  3KJO A;  5C4X G;  4OWT B;  4JBK A;  4DV5 L;  4TVA B;  2JQO A;  3BJU A;  4LF5 L;  1Q86 C;  5GRO A;  1PYB A;  1OXT A;  1XPR A;  3KFU A;  2RHQ B;  3HOZ G;  4DV3 Q;  3T1Y L;  3KDF A;  4UP7 A;  1TXY A;  5BR8 L;  3J7Z C;  4BXX G;  4AQY Q;  4AYB E;  1VQP A;  1M90 C;  4UPA A;  3UE0 A;  2UU9 L;  5LMN Q;  4OON A;  4JG2 A;  1J5E L;  3CCL A;  4BY1 H;  1C9O A;  3PUX A;  4HJ9 A;  4A3I H;  1VS0 A;  3HOU H;  2KCM A;  3S1M H;  4R4I A;  1EIF A;  3J81 j;  1UE1 A;  4IPD A;  1YBY A;  2JK8 A;  3MEF A;  3HKS A;  2V1C C;  3HOZ H;  2VL6 A;  4GOP B;  4A76 A;  3NEL A;  5LMN L;  1XMQ Q;  1Q81 C;  2ZJP A;  1WJJ A;  1X3F A;  4BBR H;  2Q2U A;  1E7Z A;  2IT1 A;  4JOI C;  5IYC H;  2IX1 A;  4KLK A;  4FDB A;  4AH6 A;  4DV1 Q;  4BBS H;  4RG1 A;  1VQA A;  1SFO H;  4A3B G;  1G51 A;  4GKK L;  1K3R A;  4GOP A;  3PIP A;  1PVO A;  3J7A 5;  2JA9 A;  4P74 A;  1IXR A;  1S40 A;  1SE8 A;  1SRO A;  4JI0 L;  4HIO A;  2NVY H;  3GO5 A;  2H5X A;  3CCS A;  2A1A A;  1IBM L;  2UXC Q;  4O2D A;  2R93 G;  3F8T A;  2LXK A;  5IWA Q;  2OQ0 A;  3CPW A;  1AE3 A;  3KYH C;  1PH4 A;  1B7Y B;  4OWW B;  2BH8 A;  3TQY A;  4DNI A;  1X3E A;  3D31 A;  1ASY A;  3AFQ A;  2KHI A;  3CC2 A;  3MXN B;  2VQE Q;  4JBJ A;  1JB7 A;  2NVX H;  2OCE A;  3K80 C;  3G71 A;  2ES2 A;  1NY4 A;  1IBL L;  3EBE A;  1A63 A;  1JJ2 A;  2NVT H; 
#chains in the Genus database with same CATH topology
 4NXN L;  2KCC A;  2A68 D;  2QKI C;  4PZ8 A;  5C6A A;  1FGB D;  4DF7 A;  2JA8 H;  4JI6 Q;  4JI5 L;  4DR7 Q;  5I2X A;  1UWV A;  3TS0 A;  3PF5 A;  1Z47 A;  3G6J B;  2F3I A;  2WKC A;  1I6H H;  1EYA A;  5FLX L;  2UXC L;  2B2V C;  3U58 A;  4APV A;  4A3C G;  1NMF A;  2ALY B;  3NSW A;  3STB C;  1YIT A;  4IJL A;  2EXD A;  1JIC A;  2LS0 1;  4IUQ A;  4TQU S;  4R8N A;  3MTS A;  1H9K A;  2JA7 B;  1JOO A;  1R9T B;  5I2Y A;  1B3Q A;  1LYL A;  2ZM6 Q;  3DXJ C;  2D62 A;  2UUA Q;  1PZJ D;  4FO2 A;  3H94 A;  3CCV A;  1PTO D;  2I46 A;  1D8L A;  3A56 A;  4RCN A;  5JPM C;  1S72 A;  3T1H Q;  2N55 A;  3QOL A;  3PGZ A;  3E6Z X;  1YHA A;  1S5F D;  1JE5 A;  3KF8 B;  1F9R A;  4IPH A;  5HGT A;  2UXB L;  2YTV A;  1G6Z A;  3D4W A;  5FO7 B;  2AQ1 B;  2X6L A;  1WTW A;  1H9S B;  1X54 A;  3KF8 A;  4CJ0 B;  2JYO A;  2AHO B;  1SLJ A;  3S9W A;  1UE6 A;  3C1F A;  3LWU A;  2UU9 Q;  1BBX C;  1STN A;  1C7Y A;  1XNR L;  4FNF A;  4JI4 Q;  1VQD A;  1KDC A;  5KYI A;  3G48 A;  3GTG H;  1KTK A;  4DXG A;  1EOT A;  2CKZ B;  2B39 A;  3DWP A;  1TWH B;  3I4M B;  5FO9 B;  3OOC A;  2F0D A;  1U4L A;  4NPS A;  4GN3 B;  3J80 L;  5BN5 A;  4CJ1 B;  3GP7 A;  3I4N G;  1FNU A;  2G9H D;  3PSI A;  1TY0 A;  1HPC A;  3MC0 B;  5CV4 A;  4NXM Q;  5IY0 A;  4RGO S;  4G4K A;  2Y0S B;  3I8Z A;  3D6C A;  1LT3 D;  2PZW A;  3CAM A;  1F9Q A;  2N78 A;  2CWA A;  4ZUI A;  5A2Q L;  1TWF B;  2IX0 A;  3AQQ A;  5M3M B;  5FLM G;  2EDG A;  1DZ1 A;  1JWU D;  4HJ8 A;  2ID0 A;  1B4O A;  3S1R B;  2E2J H;  4RMF A;  4ZUJ A;  1A3T A;  3M3Y B;  2BE5 C;  4OEL B;  3T4A C;  3QR8 A;  1QE6 A;  1EZ6 A;  3UE1 A;  4UY8 C;  2WAQ E;  4V0B A;  4CDC C;  1IBK Q;  1TQO A;  1C0A A;  3NBH A;  1I6V C;  1PH3 A;  3DM3 A;  2L55 A;  1Q12 A;  1QUQ B;  1SNM A;  1LTT D;  3NWS A;  3M3Y H;  2YYZ A;  1NTG A;  4YWM A;  3M4O H;  4JI5 Q;  2VS1 A;  3M9B A;  1TS5 A;  3GV6 A;  1WI5 A;  1XTD A;  2HCI A;  4LW1 A;  2XWB B;  3EIV A;  1UE7 A;  1Z6H A;  3NQI A;  4EGV A;  4RA8 A;  2D0P A;  1EIG A;  1VQ5 A;  1STE A;  3GTM H;  1PYS B;  4BBR B;  1ENA A;  1LUZ A;  4LF6 L;  4F8M A;  4EX5 A;  4K5W A;  4DK6 C;  2ATW A;  4G7Z C;  4R4Q A;  1A8V A;  2HT1 A;  1SAP A;  2IJ0 A;  1PH6 A;  4YWL A;  3CMA A;  4K0K L;  1VDZ A;  2F0Q A;  5I9O A;  4EVO A;  3HOX G;  2F0E A;  2F0O A;  1EUJ A;  4BWG B;  5JJZ A;  1O7I A;  4HID A;  1SE4 A;  2EYF A;  4PZ6 A;  2NN6 I;  3KDF B;  1LT6 D;  1PFN A;  5ELN A;  1S5C D;  1K8A C;  1KAB A;  3PUW A;  4R1J A;  3AEV A;  1HTL D;  3GQB A;  4JI1 Q;  1IL2 A;  4ZKB B;  1A2U A;  1H9S A;  2QIL A;  4B3M Q;  1B9N A;  5DM6 3;  4N9P A;  4B9X A;  1XNR Q;  1F2M A;  1KDA A;  1VQ4 A;  2KUM A;  3H3V H;  3X3M A;  4IFD I;  4A93 H;  5CV6 A;  3DWQ A;  3W1G A;  1VF7 A;  5D3I B;  4TSS A;  2PMZ E;  2UUC Q;  2M2L A;  3H0G G;  1E2Z A;  4DR1 L;  5NUC A;  1IYU A;  2ZTD A;  3SDZ A;  2Q8I B;  3EVQ A;  1U4M A;  1Q46 A;  2F0K A;  2O2L D;  3C1E A;  4YCV A;  5KND A;  4B9W A;  1CKO A;  1JMC A;  3I4M G;  1PH7 A;  1VQE A;  4DR4 L;  3GTM B;  4P73 A;  1RHP A;  4JCV E;  4IUP A;  1VQ9 A;  4B3T Q;  4DR2 Q;  2EYO A;  1WYD A;  4GS3 A;  5IE8 A;  3GTQ H;  4C1N K;  5IGG A;  3Q0A A;  2SOB A;  3CC4 A;  4LF7 L;  1DON A;  4QIW E;  1Y1V B;  3BDL A;  4OL7 A;  5COR A;  4QGU A;  1TWA H;  1PH8 A;  2SNS A;  1WCM B;  5JJK A;  5CC4 A;  2WB1 E;  2NZH A;  3W3A A;  2DN8 A;  1P16 A;  4DK3 C;  4JI1 L;  3TS2 A;  1F9S A;  4C3I B;  4JV5 L;  1Z7T A;  4P2C B;  3S1N B;  4Q5V A;  5I9P A;  5DEH A;  4IFD J;  2IY5 B;  3M4P A;  4JW0 A;  2PYK A;  4QUF A;  4HMI A;  1TWA B;  4LWC A;  1PFB A;  2EYP A;  1U5K A;  4N9T A;  3UDI A;  2EVB A;  1CKM A;  1PRT C;  4HMJ A;  2N8N A;  4J8Q A;  3S15 B;  4QCL A;  2JA5 B;  5CGK A;  4LF9 L;  3HKZ E;  1GM5 A;  5M5W B;  2F4V L;  2OWO A;  2P5Z X;  3NEM A;  2AKW B;  3WDN A;  2L12 A;  3E0J A;  1D1I A;  1HZA A;  1NBW A;  1FJG Q;  1NE3 A;  3GTJ B;  3HOX B;  1C4Q A;  4BA2 I;  2IX3 A;  3QG1 A;  4AIM A;  1EY7 A;  5KGU A;  4DV0 Q;  1F2Y A;  1GD7 A;  2K14 A;  3HRZ C;  1W3S A;  3I7F A;  4O42 A;  1GUS A;  2NUC A;  3G4S A;  5E1F A;  4HR7 B;  1R4Q B;  2F03 A;  2WB1 G;  1DOM A;  1J5E Q;  3W5O A;  2JEB I;  3JAM i;  5EKK A;  2K33 A;  2EYH A;  1IZ6 A;  3BZC A;  3CW2 C;  4POF A;  3C3L A;  3OW2 A;  4FF4 A;  4LUZ A;  4C3J H;  1STA A;  2EY1 A;  2TMP A;  3JC6 6;  1ML0 D;  1CA6 A;  3KF6 B;  2HUG A;  4JYA Q;  4DAY A;  5LMU Q;  1HR0 Q;  4PMC A;  4C2M H;  5L37 A;  2F0J A;  3BDC A;  1E24 A;  1WTX A;  5DNF A;  2B2V A;  4DKA C;  4JI8 Q;  3PO2 H;  3ONA B;  3GTK H;  3MFG A;  1JJC B;  3E9H A;  5C44 H;  2CQA A;  1D5Z C;  2B3G A;  2KCT A;  1KXL A;  3ND9 A;  3SEB A;  5AJ3 L;  2LKV A;  1SE3 A;  3M4Y A;  5F2D A;  2WII B;  4CHT B;  1WOC A;  2A6E D;  5FKA C;  1GUN A;  4A3K G;  3S24 A;  3CD6 A;  1K0R A;  1WTO A;  2O5J C;  3SK4 A;  4IUR A;  1CZW A;  2HIX A;  1E1O A;  1YNJ C;  2C35 B;  3CU7 A;  4RHR A;  4QIW B;  4L6T B;  4AYB G;  1E0B A;  3GV3 A;  3NE5 B;  4LFA L;  1ZEQ X;  5JOB A;  1MKH A;  1GOZ A;  2ZTC A;  3K7A B;  1DYQ A;  1OTC A;  2FHT A;  1RKN A;  5LHY 1;  1Y8N B;  3PO2 G;  1XMO Q;  3CME A;  3HOV B;  1MHW C;  1WFQ A;  2NN6 H;  1G6P A;  3OYY A;  3RZO B;  1V1O A;  3RNU A;  2R7Z G;  2FFK B;  1ZXT A;  3UI2 A;  1CM9 A;  1GVP A;  3P20 A;  5E7N A;  2AMC B;  1BF4 A;  1JCK B;  2PQA B;  3GTO H;  3GDE A;  4XT1 B;  2EY2 A;  5EGT A;  3K7A H;  4P72 A;  1SDF A;  4KHZ A;  1L1O B;  3FKI H;  2F0S A;  1R9T H;  4A3D B;  5HUR A;  3CPF A;  3X3N A;  3I55 A;  1PV4 A;  5C0X I;  1S5D D;  3H3V I;  1YHQ A;  4IFD H;  4HJ7 A;  2M9V A;  4JI7 Q;  3KJO A;  5C4X G;  4OWT B;  4JBK A;  5G3L F;  1LTS D;  2F0M A;  3CHB D;  2NWG A;  1Q86 C;  5GRO A;  3KFU A;  4KTA A;  2LMC B;  4UP7 A;  1TXY A;  2RDH A;  3S1Q B;  4HTH A;  4LJZ C;  4UPA A;  2UU9 L;  1GHJ A;  5LMN Q;  1JWS D;  3CCL A;  4HJ9 A;  1HA6 A;  5J39 A;  4A3I H;  3NXW A;  3J81 j;  1UE1 A;  1YBY A;  2E76 C;  5EPK A;  2V1C C;  1WTR A;  3M7G A;  1XMQ Q;  2F0V A;  1Q81 C;  2Q2U A;  2IX1 A;  4JOI C;  5IYC H;  4FDB A;  4A3B G;  4DGZ A;  1SFO H;  4GKK L;  4K8J A;  3S17 B;  1O7Z A;  4HIO A;  3LWE A;  3KYH C;  3TP6 A;  1E2W A;  1ASY A;  5EPL A;  4XQJ A;  1K8O A;  2VQE Q;  3G71 A;  3TP8 A;  1GXD C;  2B8G A;  3MXU A;  2KA7 A;  4DUY L;  3OIP A;  1HNX L;  1VMC A;  1DXM A;  1DM0 B;  1YNJ D;  4LUO A;  4GNX B;  4B3R Q;  2R6G A;  2HQE A;  3E3X A;  1X3P A;  3ND8 A;  1KAA A;  5K5P A;  4IUU A;  1R4P B;  4JC0 A;  1CSP A;  2I5H A;  5CR3 A;  5HGQ A;  2D0O A;  3HZX A;  3ZYY X;  3BVG A;  5I4D A;  1B1Z A;  1JT8 A;  4KY7 A;  1JE4 A;  4DR2 L;  1Y1W H;  2MNA A;  3RN5 A;  2IPK D;  1ILP A;  2CW0 D;  5GQO A;  1B3A A;  3HOU G;  1I4R A;  2QGQ A;  3S2D H;  5M5X H;  3R2T A;  5BN3 A;  3OHX C;  3DLL A;  4KJO A;  1G8Z D;  2R92 G;  2F0H A;  4IAL A;  1W6J A;  1PA6 A;  1L0Y B;  1Q1E A;  1FNV A;  4F88 A;  1WTV A;  2JA8 B;  3S1M B;  5EQ0 A;  4DV6 Q;  4OHJ A;  1CTM A;  3HOW G;  3EN2 A;  2LFN A;  1OXX K;  3CQZ H;  1XX8 A;  4XTC S;  1B8A A;  4XIG S;  1HTP A;  1GUW A;  1I4P A;  3K5L A;  1X6O A;  3A5Z B;  3U9O A;  4DR7 L;  1LV9 A;  4Z9C B;  3J81 L;  5IGE A;  1I3Q H;  1FL0 A;  3L3O C;  2PPB C;  2GVA A;  2VZA A;  1Q1B A;  1Y1W G;  4GLV B;  1AEX A;  3I4L A;  4DV2 Q;  4YHH L;  2E2D C;  3C46 A;  1N32 L;  4A3M H;  1SYD A;  5A35 A;  1E1T A;  2K5V A;  1AH9 A;  2GA4 B;  2F0G A;  1TKW B;  4J15 A;  2R92 H;  4GLX A;  2VUM G;  3FKI G;  5C0X H;  2K5D A;  5CV9 A;  1AFP A;  2JA6 B;  3KOJ A;  4J6H A;  1YJW A;  4TRD A;  5IYC G;  4V19 0;  5ELC A;  2JXM B;  1GUG A;  4B08 A;  2KHS A;  1EYD A;  3RZO H;  1HNX Q;  3SXH A;  1EU4 A;  2L4N A;  3HG9 A;  3VR6 A;  5C0X G;  4LFB L;  4JBM A;  2UXD L;  1SYB A;  3TP7 A;  4IOA A;  1LTG D;  2HCC A;  5KRU A;  2AWO A;  5IYD G;  4YIJ A;  2B2U C;  2PNH A;  1H9R A;  1V1P A;  1N34 Q;  4A3D H;  3HS0 C;  2A19 A;  4BY7 H;  2K4K A;  2DJG C;  5BR8 Q;  5FO8 B;  4GLA C;  2I07 B;  3ULJ A;  2XNA C;  4P71 A;  1SEB D;  1HNW L;  3DWA A;  1BR9 A;  2MO1 A;  1M8A A;  2B2T A;  4QL5 A;  2NYZ D;  1EEI D;  1SYF A;  4A3E G;  3S16 H;  4KKT A;  2EOT A;  5ELB A;  1WCM H;  4NDX A;  1ZKO A;  3J81 E;  4DA2 A;  1O78 A;  1KAW A;  4DV4 Q;  3BYY B;  2ZM6 L;  1QVF A;  1QB5 D;  1WCM G;  3F2C A;  1Y1V G;  2A68 C;  3I91 A;  4IPC A;  3I3C A;  3Q8D A;  1QCB D;  5HY6 A;  1CZG A;  2QF7 A;  1IBK L;  1YJN A;  2HQL A;  2OF1 A;  4C3J G;  4KY6 A;  4QMG A;  4LAA A;  4DV0 L;  2QA4 A;  3N6R A;  2N3S A;  3QOJ A;  1N36 L;  1XPO A;  2EIF A;  1YHB A;  4KD4 A;  4BY7 B;  2EJF C;  3K81 C;  1Q8I A;  1B44 D;  3CCR A;  1SMY C;  3GTL B;  4LFC L;  2Y0S G;  5T1I A;  1EWI A;  4DV7 Q;  2R7F A;  1TS2 A;  2BOS A;  3FRP B;  4NXM L;  2KEE A;  2RA4 A;  4A3K B;  2E2J B;  4UP8 A;  5IGF A;  1LM0 A;  4DV7 L;  3NTK A;  1VQK A;  3OMG A;  3PIO 3;  1EYG A;  3K0Y A;  3QB3 A;  2F4V Q;  1S5E D;  1DOK A;  2ZJQ A;  1UE5 A;  3HKZ G;  3Q22 A;  5CV7 A;  3A0J A;  3UDG A;  1HZC A;  4A3F B;  4C3H H;  4DU9 A;  4P75 A;  3VA7 A;  4LF8 L;  4GNX A;  2KED A;  1AW7 A;  4KY5 A;  1RJT A;  3OW7 A;  1A3U A;  4JI4 L;  1YI2 A;  4A3L G;  1WTQ A;  2Z8L A;  1NSN S;  2WAQ B;  2Y0S E;  3L7Z C;  2WP8 J;  5LL6 S;  5M5X B;  4PQX A;  3IAY A;  2K03 A;  3DHQ A;  4CKB A;  3G7L A;  1GKH A;  3OIQ A;  2UUA L;  5J1Z A;  1SNO A;  5JEA J;  4KN4 C;  3HOY H;  4HAE A;  1KL9 A;  4DR1 Q;  3T1H L;  5C3E H;  4QY7 A;  2B63 H;  2L1B A;  2AQ3 B;  4K8I A;  3G6E A;  1Y8O B;  1X55 A;  2F0N A;  4A3M G;  3ICE A;  4CJ2 C;  1HHV A;  1JWM D;  4UP9 A;  2HHH L;  1K0S A;  4OX9 Q;  2UUC L;  5JVG 3;  1NR2 A;  2V4D A;  2RVL A;  1FYC A;  4R4T A;  1SYE A;  2ZXO A;  1OXU A;  1QNK A;  3TSS A;  3HOU B;  2EYM A;  5IP7 G;  3EA6 A;  4FVM A;  4LF7 Q;  4A4I A;  3H15 A;  1Y8P B;  1IYV A;  3DEO A;  5K36 H;  2DGY A;  4X62 Q;  1I4X A;  5ELE A;  5C0X J;  4R4C A;  2DY8 A;  5IOC A;  5IYB H;  1SFO B;  3PO3 B;  1KC8 C;  2B8F A;  1A15 A;  4CDF C;  4OGQ C;  4M8A A;  2F0F A;  3MA2 B;  4JI3 L;  5IP7 H;  2Q2I A;  3S16 B;  4HCS A;  1X65 A;  5JJI A;  4A3J H;  3BDO A;  4DR3 L;  4GKK Q;  5D14 A;  1QIL A;  1I6H B;  3MXP A;  3HOV G;  1ET6 A;  3V05 A;  4DV2 L;  1IBM Q;  2WAC A;  4GN5 A;  4HIM A;  3TDQ A;  3DMU A;  2OT2 A;  4JV5 Q;  4O1N A;  3CF5 A;  5IT9 E;  3A7L A;  2XN9 C;  1PH2 A;  5GAG C;  4H44 C;  4X3U A;  4DUY Q;  1CHP D;  2E5L Q;  3LNN A;  4NMZ A;  4YCW A;  2EYL A;  3H3V C;  3A8I E;  1MJE A;  4X66 L;  3S17 H;  2L11 A;  4GKJ Q;  1TWC B;  4O0A A;  1VQL A;  1LTR D;  1ROD A;  1UEA B;  1TWF H;  5DLQ E;  4ME3 A;  1BBW A;  1VMP A;  1EY0 A;  2FMM A;  3JAM E;  5CBA E;  2A5H A;  2F0W A;  3S1R H;  2I5L X;  2UXB Q;  5M5W H;  3NTI A;  1GJX A;  4ABN A;  3PIP 3;  4ME5 A;  3S2H B;  2IHE A;  4EQP A;  2NZ1 D;  2NB0 A;  2VY3 A;  1U4R A;  5TSS A;  3BU2 A;  2E75 C;  3KLW A;  5ELO A;  4DK1 A;  3ER0 A;  3M85 A;  1HRJ A;  4OEM B;  1EFW A;  5JEA G;  5I6W A;  3J80 E;  5FLX c;  1J6Q A;  1V1Q A;  4KHP Q;  1NAP A;  1II3 A;  1AP0 A;  1BOS A;  4C3I H;  3UDF A;  4PMB A;  3BZK A;  2ZXP A;  4BBS B;  4CKE A;  3HOW H;  1X56 A;  2KJX A;  3AFP A;  2VUM H;  2GVB A;  2K5Q A;  2A69 C;  3D3R A;  4OXP A;  3RLF A;  1EWC A;  4LK1 C;  1FVI A;  3A55 A;  5M9O A;  2VQE L;  3VYS A;  4LFB Q;  3MFY A;  4I7Z C;  3L9A X;  5C4Z A;  1HQM C;  1PYB A;  2C5C A;  5AFW A;  3T13 A;  4DV3 Q;  3T1Y L;  3KDF A;  2DY7 A;  5IT9 L;  1VQP A;  3UE0 A;  3ERO A;  2NVY B;  4OON A;  4UAI A;  1C9O A;  2CW0 C;  1VS0 A;  2D5D A;  2KCM A;  2Q8R E;  4R4I A;  3W2D A;  2JK8 A;  3HKS A;  3K5O A;  4C3I G;  4GOP B;  4A76 A;  3NEL A;  1WJJ A;  4WRD A;  4BBR H;  2E74 C;  5D3D A;  4DV1 Q;  1VQA A;  1G51 A;  1K3R A;  4Q0F A;  2RKS A;  3HKZ B;  3PIP A;  4GOP A;  1PVO A;  1WTP A;  4ZRZ A;  4P74 A;  1S40 A;  1SE8 A;  2NVY H;  1TII D;  3GO5 A;  1EEF D;  4XYQ A;  2UXC Q;  3F8T A;  2OQ0 A;  3CPW A;  1EY8 A;  4K2K A;  1AE3 A;  1CQV A;  2F3W A;  4DNI A;  3D31 A;  1K8M A;  2KHI A;  1HQR D;  4JBJ A;  1LAC A;  2OCE A;  1MI2 A;  2ES2 A;  5EBD A;  1IBL L;  3EBE A;  5C3W A;  1A63 A;  1JJ2 A;  3AMU A;  4DV5 Q;  1TU2 B;  5C3X A;  4RWS C;  2DUD A;  1ESF A;  4XQQ A;  5C4J H;  5IP9 G;  1ET9 A;  5C4X B;  4PMW A;  3BYT B;  2EJG C;  1E2V A;  3WOF A;  5FLX E;  2EZV A;  1A62 A;  3FP9 A;  3A74 A;  2VXW A;  1J8I A;  4F7X A;  4BBR G;  2OTJ A;  2BH2 A;  1VQO A;  2AUJ D;  1UEB A;  3OMC A;  5KYL A;  2PZT A;  3CRK C;  1O7L A;  4YY3 Q;  2NTS A;  4L63 B;  1HR0 L;  1D5X C;  1STG A;  4GOP C;  4F87 A;  1BKB A;  4PG3 A;  4BY1 B;  3KLS A;  4QJF A;  1F77 A;  1I50 B;  2VW9 A;  1Q7Y C;  2CCZ A;  2QEJ C;  1L1O A;  1Z9F A;  1I4Q A;  3F2B A;  5J22 A;  1PRT F;  2X69 A;  3OWF A;  2NVQ B;  1K83 B;  4OO1 G;  3D6W A;  5EPJ A;  1Q8K A;  1OXS C;  1ZYR D;  2F0P A;  1NMG A;  1AE2 A;  4B3R L;  4A3G B;  3CCU A;  4X64 Q;  1QG7 A;  2JA6 H;  4ZQ3 A;  4A3B H;  3E5S A;  2EY5 A;  1D1K A;  3HFZ B;  5IOD A;  2UXD Q;  3PUV A;  5AJ3 Q;  1Y14 B;  5BN4 A;  3BS1 A;  1L0W A;  1QOH A;  1WTH A;  4I7A A;  5C5L A;  3VDY A;  4OX9 L;  2VB2 X;  1H9J A;  2ICI A;  3ERQ A;  3BVZ A;  3TN2 A;  5GAE C;  4A3G H;  3CXC A;  4JI2 L;  1SMX A;  2KOL A;  3S1N H;  1MJC A;  1N32 Q;  1Y1V H;  1CSQ A;  4A3B B;  4X65 Q;  4LF5 Q;  2F0T A;  1ENF A;  1GUO A;  4OO1 I;  3VR4 A;  1YIJ A;  2MO0 A;  4EQN A;  1HR0 W;  1TS3 A;  2I0Q A;  1PMR A;  1D7Q A;  1K3B C;  2YTY A;  2R93 B;  3LGJ A;  1PRT D;  3KK7 A;  2K50 A;  1ICF B;  4X66 Q;  1IHZ A;  3A54 A;  5C4H A;  4L5S A;  4KHV A;  2HDM A;  5IWA L;  1VQJ A;  4XYO A;  1CHQ D;  2TSS A;  1ILQ A;  4M1U B;  2IHF A;  2JA7 H;  4X62 L;  5CV5 A;  4G7O C;  3FPU B;  3R8B A;  4C3J B;  1PFS A;  5A2Q E;  1AZQ A;  2CH4 W;  1D6E C;  1CQF A;  2K75 A;  4DPG A;  2F0U A;  2NN6 G;  1HZB A;  4KKS A;  1FR3 A;  1F2Z A;  5JJL A;  2D9U A;  2IL8 A;  3EJI A;  3NBH B;  4FXD A;  1C8C A;  1ONL A;  1G91 A;  3SK6 A;  3D0F A;  2RSO A;  3TME A;  4L5R C;  3M7N A;  3P1H A;  4CGY B;  1UAP A;  4KJN A;  4CDE C;  4A75 A;  2BA1 A;  4LMQ D;  1JR0 D;  2K28 A;  4MNO A;  3N52 A;  3PV0 A;  4R4O A;  4FF1 A;  2WFW A;  3KJP A;  1KNE A;  2NZO A;  3D8G A;  1OXV A;  5IP9 H;  1XMO L;  1QUQ A;  5D65 A;  2XGT A;  3H09 A;  3K57 A;  5EKL A;  4H13 C;  1CT1 D;  2F0L A;  1XNQ Q;  1FGU A;  2JA7 G;  2FIN B;  4LFA Q;  4A3J G;  2ZXR A;  1K73 C;  1EQT A;  2RCN A;  3H91 A;  4DAP A;  4LNQ A;  3GTP H;  1I3Q B;  1A6X A;  4GNX C;  2EJM A;  1CKN B;  2WAQ G;  5C3E B;  4NB3 A;  4A3M B;  1CKN A;  1M4V A;  4BY1 G;  1Y69 U;  1SXT A;  1N9W A;  3FVQ A;  1HJP A;  3KF6 A;  2OQK A;  4DR6 Q;  2LXJ A;  1PH9 A;  4I65 A;  2Z4I A;  4MN3 A;  5M3M G;  1U4P A;  2K6A A;  3MEH A;  3WWV A;  1HNW Q;  1STY A;  2C9O A;  5C4X H;  2O5I C;  1S3O A;  5IYD H;  4HSV A;  4DV3 L;  3T1Y Q;  1N36 Q;  2HIV A;  2ICE C;  1QVG A;  2HD3 A;  3AU7 A;  4FP5 D;  5E3F A;  1I94 L;  2KHJ A;  1FD7 D;  2OXP A;  3M4Q A;  2QEX A;  3FDT A;  3L2P A;  5FLM H;  4FXK C;  5M3F G;  1EL0 A;  4R8I A;  1I50 H;  2BA0 A;  2WB1 B;  4YWK A;  4LF4 Q;  2K01 A;  3E0E A;  4A93 B;  1BCP B;  4ZKC B;  5JEA H;  4AYB B;  3HOV H;  2G9D A;  1SN8 A;  1SJE D;  5JPN C;  5IIF A;  4ZYS A;  5DAU A;  1M1K C;  1U0L A;  3KBG A;  4H7B A;  3TEH B;  1CI3 M;  1NCV A;  1SYG A;  1PH5 A;  2RQX A;  4Y7N B;  2KCN A;  1W2B A;  5H1S E;  1VQH A;  1OO9 B;  2L5T A;  2EYJ A;  4IJH A;  4LF6 Q;  4AQY L;  1B9M A;  1CA5 A;  2JA5 G;  2SDF A;  3CKI B;  5EBC A;  1HXY D;  2H4O A;  2O4X A;  1QVC A;  2MQH A;  4MZ9 A;  1QZH A;  1VQI A;  1HNZ L;  4JI3 Q;  5G3L D;  4A3K H;  1PDQ A;  5KNB A;  3KUP A;  3U9S A;  2A6H C;  1F9P A;  2YU9 H;  1TS4 A;  5IGD A;  1KRT A;  2AWN A;  1UNS A;  1TWC H;  3CCJ A;  2PMZ B;  4Y7N H;  2FXQ A;  4J1M A;  1RDP D;  2K04 A;  2YTX A;  4L5Q A;  3CRL C;  3WOE A;  3TRZ A;  3SGI A;  3KBX A;  4IOC A;  5M5Y B;  1HFN A;  4XT3 B;  3T56 B;  5CBE E;  5C44 B;  3J7Y W;  1BCP C;  2YU9 B;  2B2Y A;  1WD0 A;  4JI7 L;  1N33 Q;  4DV6 L;  2VQF Q;  3I90 A;  1JOQ A;  5CMD A;  1DJR D;  1EWH A;  4WJW A;  4K5X A;  1F2L A;  3H6M A;  4BXX H;  2R93 H;  1G2S A;  3QJY A;  1WVL A;  1VQG A;  2YV5 A;  5FJ8 H;  2QDL A;  5GAH C;  1AZP A;  3PIO A;  4YHH Q;  1SE2 A;  5C44 G;  2VUM B;  1LAB A;  3TZD A;  2E2I B;  4S3S A;  3TRE A;  2OEO A;  1EFI D;  1T5E A;  2L9H A;  4X6A H;  3FHW A;  5IGB A;  1HA5 A;  4JI2 Q;  4DAY B;  3F2D A;  3HOY B;  2QDB A;  1VQ6 A;  1PZI D;  3VA5 A;  4DUZ Q;  2IW3 A;  2XSC A;  4A3L H;  3CQZ B;  1RF2 D;  2R61 A;  4ILW A;  1YVC A;  5EJW A;  4MHE A;  5E4W C;  4GN4 B;  3J7A V;  2R3Z A;  2A69 D;  4KMU C;  1GUT A;  3IKJ A;  2HHH Q;  3FKI B;  4PV1 C;  2UUB L;  1G2T A;  3S15 H;  1VQ8 A;  3HOY G;  1EQQ A;  1VQN A;  3HOZ B;  3U4V A;  2Z6K C;  2ZTE A;  4NXN Q;  4OO1 H;  3PUY A;  2A73 B;  3M4O B;  1BNZ A;  3I4N B;  2H1E A;  2B2U A;  2RHS B;  2LY7 A;  1PTO B;  4RGN A;  1LT4 D;  3P7J A;  4K14 A;  4NKL A;  3SE0 A;  4EQ5 A;  2Z6K A;  2K32 A;  3O13 A;  1C48 A;  1T5X D;  3J80 c;  2NVQ H;  5EKI A;  1EY4 A;  3I70 A;  1K83 H;  1G29 1;  1QNU A;  1V9P A;  2ZT9 C;  3PO3 G;  4L5T A;  3I4N H;  3CC7 A;  3MHB A;  2R92 B;  5IGC A;  1RTO A;  2F1M A;  3MVV A;  1VQB A;  3D4D A;  1ENC A;  1PTO F;  2MPM A;  4PZ7 A;  2E5L L;  4DR5 L;  2K05 A;  2CVR A;  1U9R A;  2EQS A;  4H0L C;  1VQC A;  1PXU A;  2PQA A;  2K5W A;  4JI6 L;  4RFB A;  1X9N A;  1JC7 A;  3RLN A;  1NJI C;  3P75 A;  1TWG B;  2R7Z B;  2Q8T A;  2K5H A;  3QWN A;  4DUZ L;  5T1G A;  2AQ2 B;  1W6K A;  1L0X B;  2B2W A;  2QCP X;  3OWE B;  1NNX A;  5FOB B;  1EYC A;  3K8A A;  3L0O A;  4A3J B;  3DM1 A;  3RUZ A;  1SSO A;  4NW2 A;  4TVA B;  3D4R A;  2JQO A;  1SND A;  1SMY D;  3BJU A;  4FYD A;  4ZCK A;  4LF5 L;  1OXT A;  1VF5 C;  1XPR A;  2MP1 A;  3PQI A;  4BXX G;  4ZK9 B;  4AQY Q;  3HGB A;  2Z9H A;  2B2Y C;  1I4H A;  2Z6B A;  4UDU C;  3PUX A;  3VR3 A;  3HOU H;  1DOL A;  1LTB D;  4IPD A;  4QUC A;  2PW7 A;  2VL6 A;  3QO2 A;  1XTC D;  5LMN L;  4KV6 A;  3C2P A;  1JQY D;  1E7Z A;  1TR5 A;  4BBS H;  2DJF C;  2M00 A;  2JA9 A;  1LTI D;  1IXR A;  2EE1 A;  4JI0 L;  1GHK A;  2XRS D;  3CCS A;  2R93 G;  4O2D A;  1V1P B;  5IWA Q;  3VR5 A;  1PH4 A;  1B7Y B;  4EQO A;  3TQY A;  3SR1 A;  3AFQ A;  5LL6 X;  4XQN A;  4NP5 A;  2NVX H;  5C5M A;  3HP3 A;  1NY4 A;  3Q6S A;  1YNN C;  5FK9 C;  2NVT H;  1EU3 A;  1K28 A;  3NBI A;  2DNE A;  4K6L A;  3GTL H;  1YNX A;  4GZY C;  1JOK A;  1LTL A;  4C3H G;  2VQF L;  1P8L A;  1MSG A;  4K6D A;  5IT9 c;  4DNR B;  4CBV A;  3K58 A;  4FF3 A;  1CK1 A;  3GTP B;  3OTO L;  4E6I A;  1D2B A;  2EXZ A;  3NQT A;  2PW5 A;  3RLO A;  3TZU A;  2RF4 A;  1HCZ A;  1LTA D;  1O7Y A;  3K0X A;  3BG3 A;  1KIX A;  2ASB A;  2D2C C;  1EZ8 A;  4N8X 1;  3TP5 A;  3LX0 A;  3K5N A;  3Q23 A;  4LF4 L;  1T9H A;  4G7H C;  4U67 3;  2CQO A;  4A3F H;  1EY6 A;  1BCP F;  1KRS A;  4DNT B;  1S5B D;  2BDN A;  3QIA A;  4PNY A;  5EAY A;  4MTK A;  4JI8 L;  1VQM A;  3SK8 A;  1I94 Q;  5K36 G;  3EQL C;  1TY2 A;  2PQE A;  3DUZ A;  2E2H H;  1O80 A;  3GTK B;  4DR6 L;  5C4J B;  3VYR A;  2Z0S A;  1STH A;  2EPB A;  4IZ8 A;  2PI2 E;  2MFI A;  2WKD A;  1H95 A;  2PZU A;  3JAM L;  4YCU A;  1FNW A;  4A3I G;  3GD7 A;  3NPP A;  3TBI B;  5KEE A;  3BVM A;  2Q2H A;  1TT2 A;  4CDD C;  5LMU L;  2KVM A;  3NEN A;  3IFT A;  3RN2 A;  1HUM A;  2N88 A;  1S4Z A;  1KLG D;  1H9M A;  3FEW X;  2GN5 A;  4A3E B;  1SNP A;  2NTT A;  2HDL A;  1BCP D;  4ZAI A;  4FXG C;  1PTO C;  2RDG A;  4QF4 A;  1JJG A;  4WFN 3;  4RCO A;  4R9W A;  3K59 A;  1NUC A;  3A8J E;  4HCE A;  1PHJ A;  4H02 A;  1MBY A;  3U50 C;  1Q82 C;  3MAQ A;  2FMC A;  2K52 A;  3J7A F;  1AN8 A;  1YEZ A;  3VYU A;  1XWE A;  4B3S Q;  1JB3 A;  1NR4 A;  4TKO B;  4JYA L;  1E3P A;  2A74 C;  3MXG A;  4KD3 A;  1XMQ L;  3NHH A;  1HZ9 A;  2F0I A;  4A3I B;  3R2I A;  1K8G A;  2FJ2 A;  2LSS A;  3A7A B;  1B50 A;  3T16 A;  1L1O C;  2J7Z A;  4IUT A;  4DXF A;  2UUB Q;  1SRU A;  3ULP A;  3E9I A;  2J4X A;  1GO3 E;  2BDO A;  1DD2 A;  4A3G G;  1EY9 A;  1TWG H;  2R7Z H;  4IUN A;  4JPB W;  2AUK A;  3I4O A;  3RD4 A;  4DAV A;  5I6Y A;  2XWJ B;  5E4X A;  3Q24 A;  5ISR A;  1XNQ L;  4A3C H;  1IKM A;  4IFD G;  1XXG A;  3F2U A;  4DR4 Q;  4C3H B;  5C3E G;  4A3D G;  4ODG A;  1QZG A;  4BY7 G;  2E2I H;  4BBS G;  4ALP A;  3RZD B;  2NVT B;  3IL8 A;  1BQQ T;  4B3T L;  4IN3 A;  1HFG A;  4JBW A;  2JA8 G;  3ERS X;  4YY3 L;  4B3S L;  3I73 A;  4LFC Q;  1VQF A;  1KHI A;  2B2W C;  4KKU A;  2ZJR A;  1RIP A;  4LUV A;  4OIK A;  3RZD H;  1SNC A;  1IKL A;  4Y52 H;  1MIU A;  4QQB X;  1PRT B;  3S14 B;  4X64 L;  4KK7 A;  3PO2 B;  1PH1 A;  5DM7 3;  5M3M H;  1TVX A;  5FJ8 G;  1IBL Q;  4MIU A;  4K5V A;  5LMN W;  4HIK A;  1MD2 D;  4A3F G;  3J81 c;  3S2H H;  1HUN A;  1EQV A;  3STB D;  1VQ7 A;  2WV6 D;  1PYW D;  3SHL A;  4WJ3 M;  2SNM A;  2L15 A;  2XTI A;  4RH6 A;  2A8V A;  1K9M C;  4HN7 A;  4JVZ A;  3R3O A;  2B2T C;  4RGT A;  3DEP A;  4DN4 M;  5GAD C;  1IW7 D;  2E2H B;  1Q3L A;  3S2D B;  4KN7 C;  1CFM A;  3BZD B;  5M5Y H;  5J3B A;  3OPO A;  1YNN D;  2KQ3 A;  2Z1C A;  3CCQ A;  3PMF A;  1I5F A;  2DNC A;  4G57 A;  4DR3 Q;  3F1Z A;  5IYB G;  2J0T D;  5KIX A;  1EQR A;  3PUZ A;  1HNZ Q;  2JA6 G;  3PO3 H;  3R93 A;  3W1B A;  4XDX A;  4OIJ A;  5JAV A;  3VR2 A;  1PLF A;  2A6H D;  1N33 L;  2JP1 A;  1KNA A;  2OTL A;  4A3E H;  2A6E C;  4HSP A;  3KLR A;  3PCO B;  4UHV A;  3U4Z A;  1LT5 D;  2R7D A;  2EY6 A;  2CWP A;  3ZJY C;  1A0I A;  2JJQ A;  3AB9 A;  3CCM A;  4QB4 A;  2BE5 D;  2RCF A;  3S14 H;  3AYH B;  4X3K A;  4WJ4 A;  1SBB B;  2F4I A;  3OTO Q;  2IWH A;  1SR3 A;  3UDX A;  1KDB A;  3H0G B;  5KNC A;  3J81 i;  2MGS A;  1BBU A;  4K0K Q;  1X3Q A;  3NUC A;  2MJ8 A;  2CFM A;  1A3V A;  1DGS A;  1B2T A;  3J80 i;  3URY A;  3S1Q H;  2K5N A;  1ASZ A;  1J9O A;  4BA1 I;  1EOV A;  1UUP A;  4ID6 A;  5M3F H;  1BUV T;  1I4G A;  2B63 B;  2WIN B;  3ULL A;  2QW7 A;  2RBM A;  3SK5 A;  1HH2 P;  3HEJ A;  4A93 G;  3OSO A;  1SNQ A;  1X3G A;  4DAM A;  4IPG A;  4X3T A;  3RR5 A;  4C1N I;  1XYI A;  1A2T A;  1RD9 D;  2VB3 X;  1YJ9 A;  1IYJ B;  2CHB D;  2SEB D;  1B70 B;  4JOI A;  4CKC A;  1CUK A;  2L0C A;  1PZK D;  3CP0 A;  5ELD A;  1X32 A;  2PCF B;  4LF8 Q;  1BO0 A;  3V96 A;  2ENB A;  3SVM A;  4IO9 A;  4WOR A;  2JA5 H;  4DR5 Q;  1RL2 A;  2NVX B;  1EIH A;  2E8G A;  2Z4H A;  1DCZ A;  1ZYR C;  1QWY A;  3I56 A;  1SJH D;  2F52 A;  5CV8 A;  3CCE A;  3MWY W;  3GTJ H;  3HOX H;  2JEA I;  2MUY A;  4U68 A;  4MTN A;  1KQS A;  1EIY B;  4DV1 L;  3IRB A;  3H0G H;  2B29 A;  1V43 A;  4OWX B;  1XJV A;  4X65 L;  1Q90 A;  1IL8 A;  2NBF A;  3JAM c;  4IQZ A;  1N8R C;  1D5M C;  3PF4 A;  1V8Q A;  3ITP A;  3KLS X;  1XPU A;  3GTG B;  4POG A;  1Y1W B;  1ICW A;  2JSO A;  3K5M A;  2VNU D;  1VCI A;  4DK0 A;  3A5U A;  4FF2 A;  2KBN A;  3A8K E;  2BCO A;  1B53 A;  4JI0 Q;  4DFA A;  1RCV D;  2JE6 I;  3T53 B;  3NP8 A;  4GKJ L;  1N34 L;  1IW7 C;  2MHV A;  4B3M L;  4N8F A;  2KEN A;  3MZ5 A;  4BS9 A;  2XIW A;  5COY A;  3GTQ B;  4C2M B;  2B63 G;  2F3V A;  2G5D A;  3EFX D;  4KHP L;  3VYT A;  4XXE A;  4IUV A;  3IFD A;  2PO4 A;  1STB A;  1RTN A;  1BVS A;  1TWH H;  4DV4 L;  3I4M H;  1EY5 A;  1BDO A;  1QJO A;  4HJA A;  3K7U C;  1FJG L;  4KI0 A;  2I5M X;  4HJ5 A;  3I2Z A;  2Q2T A;  2XRQ D;  2K1B A;  2RSN A;  1YZ6 A;  2N49 A;  4LF9 Q;  2CH4 A;  1E22 A;  3B6Y A;  2PI2 A;  3FMC A;  3K6O A;  1PTO H;  4ZLT F;  1L2F A;  4HED A;  1KD1 C;  1MSH A;  3FPP A;  4C56 C;  4DV5 L;  4RKL A;  1MGS A;  2X6G A;  1JOR A;  1ESR A;  4RHS A;  2RHQ B;  3HOZ G;  4K2L A;  1LLR D;  3NTH A;  4L8J A;  5BR8 L;  3J7Z C;  2JN4 A;  4AYB E;  1M90 C;  2XVS A;  4JG2 A;  4ULL A;  1J5E L;  4JK1 C;  4BY1 H;  1LO5 D;  3RMH A;  3NWT A;  3S1M H;  1EIF A;  5JVH 3;  4RGM A;  3MEF A;  3HOZ H;  3V2T A;  1BXT A;  2ZJP A;  1X3F A;  2IT1 A;  4KLK A;  4AH6 A;  1SYC A;  4RG1 A;  3J7A 5;  5CYU A;  3GTO B;  3T51 B;  2KEC A;  1SRO A;  2H5X A;  2A1A A;  5M3F B;  1IBM L;  3NK9 A;  2LXK A;  1WD1 A;  1PFM A;  2K7V A;  3I72 A;  4OWW B;  2BH8 A;  5ELF A;  1X3E A;  2PNR C;  1KLU D;  3CC2 A;  3MXN B;  3HOW B;  1JB7 A;  3K80 C;  4X3S A;  4RKB A;  4RAU C;  2RDF A;  3MXN A; 
#chains in the Genus database with same CATH homology
 4NXN L;  4DUY L;  5IYD H;  4PZ8 A;  4DV5 Q;  1HNX L;  4LUO A;  2DUD A;  4GNX B;  5C4J H;  5IP9 G;  2JA8 H;  4JI6 Q;  3GTL H;  4PMW A;  4JI5 L;  4B3R Q;  1YNX A;  2R6G A;  4DR7 Q;  1LTL A;  1UWV A;  3TS0 A;  3PF5 A;  2VQF L;  1A62 A;  1Z47 A;  2F3I A;  1P8L A;  3A74 A;  3FP9 A;  1CSP A;  4JC0 A;  5IT9 c;  1I6H H;  4BBR G;  2I5H A;  2BH2 A;  1VQO A;  2UXC L;  2OTJ A;  5HGQ A;  4APV A;  1UEB A;  3U58 A;  4A3C G;  1NMF A;  2ALY B;  2D0O A;  3STB C;  1YIT A;  3OTO L;  4IJL A;  4YY3 Q;  2EXD A;  1JT8 A;  1HR0 L;  4DR2 L;  3RLO A;  4TQU S;  4GOP C;  1Y1W H;  2MNA A;  3RN5 A;  1BKB A;  4PG3 A;  4QJF A;  5GQO A;  2RF4 A;  2VW9 A;  1Q7Y C;  2CCZ A;  3K0X A;  3HOY G;  1L1O A;  1LYL A;  1Z9F A;  1KIX A;  2ASB A;  3F2B A;  2ZM6 Q;  3HOU G;  2D62 A;  2QGQ A;  2UUA Q;  3S2D H;  4LF4 L;  3CCV A;  1T9H A;  5M5X H;  1D8L A;  4OO1 G;  1Q8K A;  1OXS C;  1S72 A;  3T1H Q;  2CQO A;  1AE2 A;  1NMG A;  3DLL A;  3PGZ A;  1KRS A;  4X64 Q;  3CCU A;  4A3F H;  2R92 G;  4B3R L;  1YHA A;  5EAY A;  4JI8 L;  1JE5 A;  3KF8 B;  1VQM A;  4IPH A;  2JA6 H;  1PA6 A;  4A3B H;  2YTV A;  2UXB L;  3HFZ B;  5K36 G;  1I94 Q;  2UXD Q;  1Q1E A;  3PUV A;  5AJ3 Q;  1Y14 B;  1L0W A;  2E2H H;  1X54 A;  4DR6 L;  3VDY A;  4OX9 L;  2AHO B;  4DV6 Q;  2Z0S A;  1SLJ A;  3HOW G;  2PI2 E;  3EN2 A;  2MFI A;  1OXX K;  1UE6 A;  3CQZ H;  4XTC S;  1B8A A;  4XIG S;  2UU9 Q;  1H95 A;  5GAE C;  1C7Y A;  1XNR L;  4A3G H;  1X6O A;  3A5Z B;  4YCU A;  3CXC A;  4A3I G;  4JI2 L;  1SMX A;  4JI4 Q;  3S1N H;  3GD7 A;  1I3Q H;  1MJC A;  1VQD A;  1N32 Q;  1FL0 A;  1Y1V H;  2GVA A;  3G48 A;  1CSQ A;  3GTG H;  2VZA A;  1Q1B A;  4X65 Q;  1Y1W G;  4GLV B;  2Q2H A;  4LF5 Q;  5LMU L;  4OO1 I;  2CKZ B;  3NEN A;  3RN2 A;  4DV2 Q;  1YIJ A;  2MO0 A;  1HR0 W;  4YHH L;  2I0Q A;  1D7Q A;  1N32 L;  4A3M H;  2GN5 A;  1E1T A;  2YTY A;  3LGJ A;  2K5V A;  4NPS A;  2K50 A;  4X66 Q;  1AH9 A;  4L5S A;  4GN3 B;  4J15 A;  2R92 H;  5IWA L;  4GLX A;  3I4N G;  1VQJ A;  2VUM G;  3PSI A;  3FKI G;  4NXM Q;  5IY0 A;  3CAM A;  2IHF A;  2JA7 H;  4X62 L;  2N78 A;  2CWA A;  3KOJ A;  1YJW A;  1JJG A;  5IYC G;  2IX0 A;  1PHJ A;  1PFS A;  3AQQ A;  5FLM G;  4H02 A;  2K75 A;  4DPG A;  3U50 C;  4HJ8 A;  2ID0 A;  1Q82 C;  2E2J H;  4RMF A;  2NN6 G;  2K52 A;  3RZO H;  1HZB A;  1HNX Q;  1YEZ A;  5C0X G;  4LFB L;  4JBM A;  2UXD L;  5JJL A;  4B3S Q;  4IOA A;  3UE1 A;  3NBH B;  4UY8 C;  2WAQ E;  2AWO A;  3D0F A;  5IYD G;  4JYA L;  1E3P A;  1IBK Q;  4L5R C;  2PNH A;  1XMQ L;  1C0A A;  1N34 Q;  3M7N A;  4A3D H;  2A19 A;  1HZ9 A;  4BY7 H;  2K4K A;  1PH3 A;  5BR8 Q;  3DM3 A;  4GLA C;  4A75 A;  2BA1 A;  1Q12 A;  3ULJ A;  4MNO A;  1K8G A;  1QUQ B;  2LSS A;  3PV0 A;  4R4O A;  2WFW A;  1L1O C;  3KJP A;  3M3Y H;  2NZO A;  2YYZ A;  4P71 A;  2UUB Q;  1NTG A;  1OXV A;  1SRU A;  4YWM A;  3M4O H;  5IP9 H;  2MO1 A;  2VS1 A;  3ULP A;  1XMO L;  1QUQ A;  3E9I A;  2XGT A;  3M9B A;  4JI5 Q;  4QL5 A;  1GO3 E;  1WI5 A;  1XTD A;  4A3G G;  1TWG H;  1XNQ Q;  1FGU A;  4LW1 A;  2R7Z H;  2JA7 G;  4A3E G;  3EIV A;  1UE7 A;  3S16 H;  3I4O A;  1WCM H;  4LFA Q;  4A3J G;  1K73 C;  2D0P A;  1VQ5 A;  4IFD I;  2RCN A;  1XNQ L;  4A3C H;  3GTM H;  4IFD G;  1PYS B;  1LUZ A;  1KAW A;  4LF6 L;  4LNQ A;  4DR4 Q;  4EX5 A;  4DV4 Q;  4DK6 C;  5C3E G;  2ATW A;  3GTP H;  4R4Q A;  2ZM6 L;  1N33 L;  1A8V A;  2HT1 A;  1QVF A;  4A3D G;  1QZG A;  4BY7 G;  1WCM G;  1PH6 A;  4YWL A;  3F2C A;  3CMA A;  4GNX C;  2E2I H;  4BBS G;  4K0K L;  4ALP A;  3HOX G;  1CKN B;  1EUJ A;  4B3T L;  1Y1V G;  2WAQ G;  4JBW A;  2JA8 G;  3ERS X;  4IPC A;  4NB3 A;  4YY3 L;  3Q8D A;  1O7I A;  5HY6 A;  4HID A;  1IBK L;  1YJN A;  4PZ6 A;  2HQL A;  4B3S L;  2NN6 I;  3KDF B;  1CKN A;  4BY1 G;  5ELN A;  1N9W A;  1HJP A;  4DV0 L;  3KF6 A;  1K8A C;  2OQK A;  4DR6 Q;  4LFC Q;  1VQF A;  1KHI A;  2LXJ A;  4R1J A;  3PUW A;  2QA4 A;  3AEV A;  1PH9 A;  2N3S A;  4JI1 Q;  1IL2 A;  5M3M G;  2ZJR A;  1XPO A;  2EIF A;  1N36 L;  1RIP A;  4LUV A;  1YHB A;  4B3M Q;  3WWV A;  3RZD H;  1HNW Q;  3K81 C;  1XNR Q;  4Y52 H;  1MIU A;  5C4X H;  3CCR A;  1VQ4 A;  1S3O A;  4LFC L;  2Y0S G;  4QQB X;  3H3V H;  4X64 L;  1EWI A;  4DV7 Q;  2R7F A;  4DV3 L;  3T1Y Q;  4A93 H;  1N36 Q;  3W1G A;  1PH1 A;  2HIV A;  2PMZ E;  5M3M H;  5FJ8 G;  1IBL Q;  5LMN W;  1QVG A;  2UUC Q;  4HIK A;  4NXM L;  4A3F G;  1I94 L;  3J81 c;  4UP8 A;  3S2H H;  2KHJ A;  3H0G G;  3STB D;  1LM0 A;  4DR1 L;  1VQ7 A;  4DV7 L;  3M4Q A;  1VQK A;  2ZTD A;  2QEX A;  3L2P A;  4WJ3 M;  2L15 A;  2XTI A;  5FLM H;  1EYG A;  5M3F G;  2A8V A;  2F4V Q;  1Q46 A;  1K9M C;  2ZJQ A;  1I50 H;  1UE5 A;  2BA0 A;  4YCV A;  4YWK A;  5GAD C;  4LF4 Q;  1CKO A;  3E0E A;  3HKZ G;  1JMC A;  3I4M G;  1PH7 A;  3HOV H;  1VQE A;  4DR4 L;  3A0J A;  1SN8 A;  4P73 A;  5M5Y H;  5J3B A;  4JCV E;  3UDG A;  1VQ9 A;  1HZC A;  4B3T Q;  3CCQ A;  4DR2 Q;  1I5F A;  4C3H H;  1M1K C;  1U0L A;  1WYD A;  4P75 A;  4GS3 A;  4DR3 Q;  5IE8 A;  4LF8 L;  3F1Z A;  3GTQ H;  5IYB G;  4GNX A;  4LF7 L;  1EQR A;  3CC4 A;  3PUZ A;  3TEH B;  4QIW E;  1HNZ Q;  2JA6 G;  3PO3 H;  4QGU A;  1PH5 A;  1TWA H;  3W1B A;  1W2B A;  5H1S E;  1VQH A;  1YI2 A;  1PH8 A;  4JI4 L;  4IJH A;  4LF6 Q;  4AQY L;  2JA5 G;  4A3L G;  5JJK A;  2WB1 E;  2NZH A;  1QVC A;  1P16 A;  2MQH A;  4MZ9 A;  4DK3 C;  1VQI A;  2Y0S E;  4JI1 L;  3L7Z C;  1QZH A;  2WP8 J;  1HNZ L;  2OTL A;  4JI3 Q;  3TS2 A;  4A3E H;  4JV5 L;  4A3K H;  3PCO B;  3U4Z A;  2R7D A;  2YU9 H;  2CWP A;  1KRT A;  4IFD J;  3ZJY C;  3M4P A;  2IY5 B;  1A0I A;  1GKH A;  2AWN A;  2JJQ A;  2UUA L;  1TWC H;  3CCM A;  3CCJ A;  4LWC A;  4Y7N H;  3S14 H;  2FXQ A;  5JEA J;  3HOY H;  2YTX A;  3AYH B;  4L5Q A;  1U5K A;  4WJ4 A;  1KL9 A;  4DR1 Q;  3T1H L;  3TRZ A;  5C3E H;  4QY7 A;  3SGI A;  3UDI A;  3OTO Q;  2B63 H;  3G6E A;  1CKM A;  1SR3 A;  3UDX A;  2N8N A;  3J81 i;  4LF9 L;  3HKZ E;  1X55 A;  4IOC A;  1BBU A;  1GM5 A;  2F4V L;  4K0K Q;  2OWO A;  3NEM A;  2AKW B;  4A3M G;  2CFM A;  3ICE A;  1DGS A;  3J80 i;  1HZA A;  4UP9 A;  2HHH L;  4JI7 L;  1N33 Q;  3S1Q H;  2K5N A;  2VQF Q;  4DV6 L;  1ASZ A;  4OX9 Q;  1NBW A;  1FJG Q;  1NE3 A;  4BA1 I;  1EOV A;  2UUC L;  4BA2 I;  5M3F H;  4AIM A;  4DV0 Q;  4R4T A;  1OXU A;  1GD7 A;  2K14 A;  3ULL A;  4BXX H;  1W3S A;  5IP7 G;  3I7F A;  4LF7 Q;  1HH2 P;  2R93 H;  4A93 G;  4A4I A;  3H15 A;  1VQG A;  3G4S A;  1X3G A;  2DGY A;  2YV5 A;  4DAM A;  2WB1 G;  4X62 Q;  5FJ8 H;  4IPG A;  3W5O A;  2JEB I;  5GAH C;  1J5E Q;  3JAM i;  3RR5 A;  5C0X J;  4R4C A;  3PIO A;  1YJ9 A;  5IYB H;  4YHH Q;  5C44 G;  1IYJ B;  1IZ6 A;  1KC8 C;  3BZC A;  3TRE A;  3CW2 C;  4POF A;  1B70 B;  4X6A H;  4JOI A;  1CUK A;  3FHW A;  2Q2I A;  4JI3 L;  4LUZ A;  4JI2 Q;  5IP7 H;  3OW2 A;  4DAY B;  1X65 A;  3CP0 A;  4C3J H;  3F2D A;  4A3J H;  5JJI A;  3JC6 6;  4DR3 L;  4LF8 Q;  4GKK Q;  1VQ6 A;  4IO9 A;  3KF6 B;  4DUZ Q;  2JA5 H;  4A3L H;  4JYA Q;  5LMU Q;  4DR5 Q;  1HR0 Q;  3HOV G;  1YVC A;  4DV2 L;  4C2M H;  1RL2 A;  1IBM Q;  4GN4 B;  2E8G A;  4GN5 A;  4HIM A;  3I56 A;  2F52 A;  1E24 A;  3CCE A;  3GTJ H;  3HOX H;  2JEA I;  4JV5 Q;  4MTN A;  1KQS A;  1EIY B;  4DV1 L;  2HHH Q;  2UUB L;  3IRB A;  4JI8 Q;  4DKA C;  3PO2 H;  3CF5 A;  3H0G H;  1PH2 A;  3S15 H;  2B29 A;  1VQ8 A;  4DR7 L;  5GAG C;  3GTK H;  1EQQ A;  1V43 A;  1VQN A;  1JJC B;  4OWX B;  3E9H A;  1XJV A;  3U4V A;  4X65 L;  2Z6K C;  4DUY Q;  2ZTE A;  4NXN Q;  3JAM c;  5C44 H;  2KCT A;  3PUY A;  2B3G A;  2E5L Q;  1N8R C;  1KXL A;  3PF4 A;  5AJ3 L;  4YCW A;  2RHS B;  1MJE A;  1WOC A;  4X66 L;  3S17 H;  4GKJ Q;  4O0A A;  1XPU A;  1VQL A;  4POG A;  4A3K G;  2VNU D;  3S24 A;  1TWF H;  1VCI A;  5DLQ E;  3CD6 A;  1K0R A;  4ME3 A;  3A5U A;  1BBW A;  2HIX A;  4EQ5 A;  2KBN A;  1E1O A;  2Z6K A;  3S1R H;  2C35 B;  4JI0 Q;  2I5L X;  3J80 c;  2NVQ H;  2JE6 I;  4GKJ L;  5M5W H;  2UXB Q;  2VUM H;  1N34 L;  1K83 H;  4B3M L;  1G29 1;  2IHE A;  1V9P A;  2KEN A;  4AYB G;  3PO3 G;  4L5T A;  4LFA L;  3I4N H;  3CC7 A;  2B63 G;  2VY3 A;  1MKH A;  3BU2 A;  4KHP L;  2ZTC A;  1VQB A;  3KLW A;  5ELO A;  1OTC A;  3ER0 A;  3M85 A;  4PZ7 A;  2E5L L;  4DR5 L;  3PO2 G;  1EFW A;  1BVS A;  1TWH H;  5JEA G;  4DV4 L;  2EQS A;  1XMO Q;  3CME A;  5FLX c;  4HJA A;  3I4M H;  3K7U C;  1J6Q A;  1VQC A;  1V1Q A;  1FJG L;  4KI0 A;  1WFQ A;  2I5M X;  4HJ5 A;  4KHP Q;  4C3I H;  3I2Z A;  3UDF A;  2PQA A;  2Q2T A;  1G6P A;  3BZK A;  3OYY A;  3RNU A;  4JI6 L;  2R7Z G;  1X9N A;  3HOW H;  1GVP A;  1HNW L;  1X56 A;  5E7N A;  2AMC B;  3RLN A;  2PQA B;  3AFP A;  1NJI C;  3GDE A;  2GVB A;  1YZ6 A;  2N49 A;  2K5H A;  3K7A H;  4P72 A;  4LF9 Q;  3GTO H;  4OXP A;  3RLF A;  1E22 A;  3B6Y A;  2PI2 A;  4KHZ A;  1L1O B;  4DUZ L;  3FKI H;  1R9T H;  1FVI A;  1L2F A;  1KD1 C;  3CPF A;  3I55 A;  1PV4 A;  5C0X I;  2VQE L;  3K8A A;  3L0O A;  1YHQ A;  4HJ7 A;  3H3V I;  4LFB Q;  4JI7 Q;  3KJO A;  5C4X G;  4OWT B;  4JBK A;  4DV5 L;  4TVA B;  2JQO A;  3BJU A;  4LF5 L;  1Q86 C;  5GRO A;  1PYB A;  1OXT A;  1XPR A;  3KFU A;  2RHQ B;  3HOZ G;  4DV3 Q;  3T1Y L;  3KDF A;  4UP7 A;  1TXY A;  5BR8 L;  3J7Z C;  4BXX G;  4AQY Q;  4AYB E;  1VQP A;  1M90 C;  4UPA A;  3UE0 A;  2UU9 L;  5LMN Q;  4OON A;  4JG2 A;  1J5E L;  3CCL A;  4BY1 H;  1C9O A;  3PUX A;  4HJ9 A;  4A3I H;  1VS0 A;  3HOU H;  2KCM A;  3S1M H;  4R4I A;  1EIF A;  3J81 j;  1UE1 A;  4IPD A;  1YBY A;  2JK8 A;  3MEF A;  3HKS A;  2V1C C;  3HOZ H;  2VL6 A;  4GOP B;  4A76 A;  3NEL A;  5LMN L;  1XMQ Q;  1Q81 C;  2ZJP A;  1WJJ A;  1X3F A;  4BBR H;  2Q2U A;  1E7Z A;  2IT1 A;  4JOI C;  5IYC H;  2IX1 A;  4KLK A;  4FDB A;  4AH6 A;  4DV1 Q;  4BBS H;  4RG1 A;  1VQA A;  1SFO H;  4A3B G;  1G51 A;  4GKK L;  1K3R A;  4GOP A;  3PIP A;  1PVO A;  3J7A 5;  2JA9 A;  4P74 A;  1IXR A;  1S40 A;  1SE8 A;  1SRO A;  4JI0 L;  4HIO A;  2NVY H;  3GO5 A;  2H5X A;  3CCS A;  2A1A A;  1IBM L;  2UXC Q;  4O2D A;  2R93 G;  3F8T A;  2LXK A;  5IWA Q;  2OQ0 A;  3CPW A;  1AE3 A;  3KYH C;  1PH4 A;  1B7Y B;  4OWW B;  2BH8 A;  3TQY A;  4DNI A;  1X3E A;  3D31 A;  1ASY A;  3AFQ A;  2KHI A;  3CC2 A;  3MXN B;  2VQE Q;  4JBJ A;  1JB7 A;  2NVX H;  2OCE A;  3K80 C;  3G71 A;  2ES2 A;  1NY4 A;  1IBL L;  3EBE A;  1A63 A;  1JJ2 A;  2NVT H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...