4DUYL

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4duyL00
1U5KA 3M3YH 4LF6L 2R92H 3SGIA 4RG1A 1M1KC 3D31A 3G4SA 4X6AH 1ASYA 2KBNA 2PMZE 4DUYL 4LFAL 5IYBG 3D0FA 4MZ9A 4JI6Q 2JA7G 5GQOA 1HR0L 1P8LA 4JI3L 4PZ6A 3FKIH 3I55A 1N32L 3TRZA 2KCTA 2XTIA 2L15A 1J6QA 1E22A 3Q8DA 3GO5A 4A3BH 1K8GA 4O0AA 3W5OA 4C3HH 5M5YH 4KLKA 5C44G 4DV3Q 1X6OA 4GKKL 3J81c 4HJ5A 4AH6A 4JI0L 2NVYH 4P71A 4YHHL 3E9HA 1N36L 4LUZA 1V43A 1UE6A 2LSSA 4QIWE 2VQEL 1X65A 1SN8A 4DPGA 5IP7G 3F1ZA 1AE3A 3HOXH 4DV0L 1E3PA 1BKBA 3JC66 5JEAJ 5JEAG 1YHAA 4X62L 4DV4L 1GD7A 5AJ3L 5LMUL 1EFWA 1PH4A 3TS2A 4JBWA 1DGSA 5FJ8H 3HOZG 1H95A 1VQ6A 4YCWA 5IYCG 2ID0A 3F8TA 1Y1VG 4LFAQ 1VQFA 4BY7G 5H1SE 3GTLH 1SMXA 1S3OA 5C4XG 3HKZE 1MIUA 2VL6A 2JA8H 4DKAC 4BBSG 1D8LA 2I5MX 2JA9A 3F2DA 1QVGA 1MJEA 1YHQA 2QA4A 2E5LL 1VS0A 4JBMA 2UUBQ 1G291 3TS0A 5IYDH 3OYYA 4C3JH 4GOPC 4JG2A 3S1QH 4A3LG 3K7AH 4RMFA 3RNUA 1KXLA 1U0LA 3K7UC 3HOUH 4B3TL 3CCSA 2R7DA 5M3MG 2NVTH 1V9PA 2PQAB 3PO3H 1L2FA 2DUDA 2R6GA 3ER0A 4POGA 3PF4A 2BH2A 2E2JH 1Z9FA 4JI5Q 3CF5A 1BVSA 1FJGL 4BBRG 4A3IG 2LXJA 4QJFA 4XTCS 1Y1WG 4IFDI 3UDIA 4PG3A 1B7YB 4EQ5A 2UXBL 3CCVA 3S14H 4B3RL 1R9TH 3MEFA 1PH8A 1EIYB 4AQYL 1IBMQ 5C0XJ 3AFPA 5C0XG 4A3FH 1HZAA 4JI4Q 1HNWL 2LXKA 2R7FA 3OTOQ 1WOCA 4A3GG 2E5LQ 1VQOA 4R4IA 1OXVA 1YIJA 5DLQE 4LFBL 1YNXA 4GN3B 2Q2TA 4OWWB 1JJCB 1JJGA 1PYSB 4GN5A 2IX1A 4DAYB 4YCUA 4NB3A 3J80i 1I50H 4UP7A 1GM5A 5GADC 3HOYG 3NEMA 1YITA 4C2MH 2B63G 3I4MG 4A93H 4KI0A 3M4PA 5LMNQ 1PA6A 2JA6G 3J7A5 2VNUD 4LUOA 2PNHA 3CP0A 1HNZL 4IO9A 1VQ4A 1M90C 1KIXA 3BJUA 2C35B 3KYHC 1RL2A 2E2IH 4R4OA 3H15A 2JA7H 4DR3Q 1XNRQ 2Y0SG 2YYZA 4B3SL 3S1MH 4JI1Q 1NJIC 4GNXC 3GTPH 3HKSA 1C7YA 2HQLA 4TQUS 1YJ9A 1NE3A 3TEHB 2MFIA 4B3RQ 4JC0A 1PH5A 4IPDA 2V1CC 2UXCL 1XPRA 1I6HH 4A3EG 4AQYQ 2ALYB 2VS1A 1A63A 3K0XA 4UY8C 4DR2Q 3RLOA 1YZ6A 1Q12A 1IL2A 3PIOA 2WB1E 1KC8C 1PH3A 2R7ZH 1C0AA 1VQ8A 3PGZA 5C0XI 4DR1Q 1UE1A 1UEBA 2YV5A 2K14A 2ZTCA 3ULLA 4Y7NH 4DV7Q 4BXXG 4DV6Q 2K5VA 1WYDA 1VQCA 2NVXH 4EX5A 3T1YL 1Y14B 2WFWA 3MXNB 4A3KG 2YTXA 1V1QA 3F2BA 1WJJA 3G71A 3CCJA 1CKOA 5M3FG 4Y52H 2NN6I 4DV1Q 1K83H 3H0GG 3M9BA 4K0KL 3TREA 1YI2A 2IX0A 1Y1VH 1L1OA 3S1NH 2EIFA 4GN4B 4MTNA 2N49A 3EN2A 4BY7H 4OWTB 3UE1A 1JJ2A 2K5HA 4B3SQ 1QVCA 3L0OA 1JT8A 4BBSH 2KENA 4DV5Q 5IE8A 3KOJA 1Q46A 1OXUA 4DK6C 3UE0A 4GLAC 3PUVA 1TWGH 2UXCQ 2ATWA 1VQMA 2RF4A 4JOIA 1OXTA 2N78A 4GNXB 3UDXA 5K36G 2Q2IA 3PCOB 4LF4Q 1CSPA 4DV2Q 4JYAL 2VW9A 2K50A 3CXCA 1XMQQ 1HR0W 4A3CH 2UXDQ 2I5HA 2UUBL 4QL5A 3JAMi 4PZ7A 3CPWA 1CKNA 2BA1A 5IWAQ 1SRUA 2OQ0A 1MJCA 2N3SA 2HHHQ 3T1YQ 3T1HL 4NXML 4IJLA 3GTMH 1KAWA 5C3EH 2PI2A 3HKZG 2JA5H 4BBRH 5C4JH 1YJWA 5FLXc 4OWXB 4L5SA 4AIMA 1NY4A 4K0KQ 1J5EQ 2MO0A 3CC4A 4LWCA 2IT1A 4X64Q 4IFDJ 2VUMG 1VQAA 4IFDG 3S16H 1I5FA 4JI5L 2ASBA 3ICEA 3PV0A 1LYLA 4A3MG 3A5ZB 4A3DH 2OQKA 2MO1A 1TXYA 2NZOA 3HOWH 1X3GA 4LUVA 1TWCH 3KF8B 1EQQA 2IHEA 3CC7A 1K8AC 5FLMG 1IBML 4JI4L 4HIMA 4HIOA 4JYAQ 3HOYH 3ZJYC 3OTOL 1S72A 1Q1EA 3EBEA 1TWHH 2PI2E 3KDFA 4DR6Q 2BH8A 4LF9L 4A3JG 3T1HQ 4NXMQ 4DR5Q 5GAEC 2JE6I 3M85A 1YHBA 3W1BA 3ULPA 4L5TA 1L0WA 4L5RC 5LMNL 1SFOH 4JI8Q 1NMFA 2K75A 1N34Q 1W3SA 5BR8Q 3CCRA 4QGUA 1N33Q 2I5LX 2Z6KA 2GN5A 4LNQA 2JJQA 5GAHC 4R4CA 3J80c 4DR3L 4GS3A 1XNRL 1VQ7A 1BBWA 1Q1BA 4JI1L 2YTVA 1C9OA 1VQLA 3K81C 4DV4Q 4R4TA 4LF7Q 3KF6A 4HJAA 1SROA 3U58A 1XPUA 2CCZA 4BXXH 3CD6A 2ES2A 4DR2L 2F52A 2OTJA 2F4VL 3M4QA 2Q2UA 2NZHA 3J7ZC 3I4NG 2CWAA 4DR1L 1VQ9A 2JQOA 3WWVA 3KF6B 1VQGA 1KRTA 2DGYA 4DV6L 4DV7L 4LF9Q 4DR4Q 1PVOA 4QY7A 2NN6G 2AMCB 4WJ4A 3AEVA 1IBKQ 4R4QA 1VQNA 4P75A 3HOVH 3M4OH 4B3MQ 3ERSX 5JJKA 1WI5A 4LFCQ 1HJPA 3I4OA 3HOXG 4DV1L 3AQQA 1I94Q 2WB1G 3GTOH 3S24A 3CCUA 2KCMA 2ZJQA 4AYBE 1BBUA 5HGQA 2VY3A 3CCMA 1SLJA 5M5WH 5IYBH 3GTQH 1W2BA 1PH9A 4BY1G 3CMEA 4GOPA 3OW2A 1P16A 1QUQA 1GKHA 1PHJA 1NTGA 3B6YA 3NENA 3GDEA 4DV5L 1XMOQ 1Q81C 1HNXQ 1HZ9A 4GLVB 3CMAA 1IYJB 3RZDH 2JEAI 4KHZA 4DAMA 5E7NA 5C44H 2Q2HA 2OWOA 1JE5A 1EUJA 4LF4L 3I2ZA 2R93G 4DV2L 2F4VQ 4YY3Q 2AKWB 2B3GA 1XMQL 2UXDL 4IOAA 3S2HH 1CKMA 1VQBA 2JEBI 4OONA 5IP7H 5IWAL 4UP8A 2VQFL 1MKHA 1T9HA 5JJIA 4HJ8A 2HHHL 4IPCA 3M7NA 4A75A 2VUMH 5JJLA 2E8GA 3PO3G 1EOVA 5GAGC 3HOZH 3CCQA 4IJHA 3L7ZC 3LGJA 5IYCH 3A5UA 4WJ3M 1J5EL 4HIDA 3ULJA 1K73C 2CQOA 1PYBA 4X64L 4DUZQ 4JCVE 1HH2P 5C4XH 3RZOH 1E7ZA 1TWFH 3GTGH 3FHWA 4DK3C 2GVBA 2WAQE 2UUCQ 3CQZH 2UUAQ 1L1OB 4A3FG 2XGTA 3VDYA 1YBYA 2ZTEA 3KJOA 4A3LH 4HJ7A 4OO1G 4TVAB 1A8VA 1SR3A 3RR5A 2RHQB 1XJVA 4UP9A 1I3QH 3HFZB 5M3MH 1Q86C 3KJPA 1VQHA 3E0EA 4DR6L 2YTYA 4OXPA 2VQFQ 3S17H 1X3EA 2K5NA 1GVPA 4LF5Q 4DR5L 1YVCA 4KHPQ 1N9WA 4A3IH 3TQYA 1PH1A 4LF8Q 4GKJQ 4APVA 1Y1WH 4JI7Q 4JI8L 2AWOA 1PH6A 1K3RA 1WCMG 1CKNB 1X3FA 3CPFA 1N34L 5BR8L 5IP9G 1N33L 3PUYA 5M5XH 1EIFA 4HJ9A 1IBLQ 4DNIA 2QGQA 3W1GA 2UU9Q 3GTJH 2Z6KC 4OX9Q 4A3GH 1X9NA 1D7QA 2AHOB 1VQ5A 3NELA 1OTCA 4LF7L 3I4NH 3F2CA 1K0RA 2CFMA 1XNQQ 3K8AA 3PO2G 1YEZA 1HZBA 1WFQA 1EQRA 2CWPA 4PMWA 2R7ZG 1X55A 3G48A 4JI2Q 3I4MH 3H3VI 2B63H 4IPHA 4DR7Q 1PV4A 1ASZA 4OO1I 3UDFA 2JA6H 3G6EA 1LUZA 2ZTDA 5HY6A 3STBC 1PH2A 1EYGA 2JK8A 2GVAA 4X66L 4DR4L 4P72A 4JV5Q 4X65Q 1AH9A 3K80C 3I56A 3BU2A 1VQKA 3CC2A 1IBKL 1IZ6A 4B3ML 4BY1H 4LF6Q 1KRSA 5GROA 1E1TA 4LFCL 5EAYA 4YCVA 3CW2C 3EIVA 1KL9A 2OCEA 3KLWA 2HIVA 2K52A 4DUYQ 4XIGS 1I94L 2D0PA 3KDFB 3AYHB 3J81i 3BZKA 1HR0Q 4A76A 1O7IA 2D62A 1CSQA 2WP8J 5LMNW 3GD7A 2A19A 2Z0SA 4A3EH 1E24A 1TWAH 4JI3Q 2R92G 1N32Q 1QZGA 2MNAA 2PQAA 1JMCA 2R93H 1XMOL 1HNXL 1A0IA 2N8NA 4MNOA 1G6PA 1RIPA 3CCLA 2I0QA 2RCNA 3KFUA 1S40A 2E2HH 4GKKQ 1VQPA 3FKIG 1UWVA 2HIXA 4IPGA 4YWLA 5IT9c 3L2PA 4JI0Q 3S2DH 3PIPA 3U4VA 4AYBG 4FDBA 4YHHQ 3DLLA 2CKZB 1N36Q 4A3BG 4A3CG 1VQDA 4YY3L 2ZJPA 4A3KH 2VQEQ 1UE5A 2K4KA 5M3FH 2MQHA 4X66Q 2H5XA 3H0GH 4YWMA 4PZ8A 4DV0Q 1PH7A 2VZAA 4X62Q 5C3EG 1NBWA 5AJ3Q 3BZCA 2EQSA 4POFA 5LMUQ 2EXDA 2JA5G 1G51A 2RHSB 3IRBA 3RN2A 3CCEA 3DM3A 3E9IA 4P73A 4R1JA 4JBKA 1VQJA 4LW1A 1K9MC 4DUZL 4A3DG 2F3IA 5FJ8G 3J81j 3H3VH 1JB7A 2IY5B 1SE8A 2YU9H 2FXQA 1L1OC 1VCIA 5ELOA 3HOWG 2HT1A 3S15H 1X54A 4A4IA 2ZM6L 2KHJA 1FVIA 1GO3E 2UUCL 4BA2I 3I7FA 2UUAL 2JA8G 3RN5A 1KD1C 4C3IH 1X56A 4NXNL 4B3TQ 1B8AA 4GOPB 4JOIC 1AE2A 1QUQB 4BA1I 5IYDG 3A0JA 2QEXA 4J15A 4ALPA 1VQIA 1A62A 1Q82C 1WCMH 2WAQG 3HOUG 1FJGQ 1XTDA 3PUZA 4LF5L 3NBHB 5IP9H 1KHIA 4H02A 3STBD 1LM0A 1YJNA 4NPSA 2D0OA 4KHPL 4A3MH 2KHIA 4IOCA 1EWIA 2ZJRA 1XPOA 4LF8L 1Z47A 4GKJL 2UXBQ 4JI7L 4P74A 5IY0A 3JAMc 5J3BA 3A74A 3AFQA 1CUKA 4JI6L 4GLXA 5FLMH 5ELNA 3U50C 1IBLL 2AWNA 3PF5A 2NVQH 1KQSA 1HNWQ 3PO2H 1Q8KA 1FGUA 2UU9L 1QVFA 4ME3A 3PUXA 4JBJA 2ZM6Q 3UDGA 4OX9L 4QQBX 1LTLA 4HIKA 4LFBQ 1E1OA 3CAMA 1UE7A 2Y0SE 4DV3L 1NMGA 3FP9A 1VQEA 1XNQL 2IHFA 3PUWA 2BA0A 3PSIA 4L5QA 1IXRA 4O2DA 4UPAA 4NXNQ 4A3JH 4JI2L 1Q7YC 4YWKA 1N8RC 3RLNA 4DR7L 1HZCA 1FL0A 3U4ZA 1HNZQ 1OXSC 1OXXK 4GNXA 4JV5L 3RLFA 1PFSA 4X65L 2A1AA 3GTKH 3HOVG 3S1RH 2B29A 2OTLA 4A93G 1B70B 2A8VA 1QZHA
chains in the Genus database with same CATH superfamily
4KKUA 4LF6L 2B2TA 3SGIA 4RG1A 1M1KC 3KLRA 1ENCA 4LFAL 2EYMA 4N9TA 1E22A 1WTHA 3C1FA 3GO5A 2IWHA 4ZQ3A 5C44G 2NZ1D 4X3TA 4H7BA 4DV3Q 3J81c 4GKKL 1I6HB 1SMYC 2F0KA 4P71A 1NR4A 1SYGA 4ID6A 3E9HA 1CA6A 4Y7NB 3VYTA 2TMPA 3HOXH 2K05A 5JEAG 1G2SA 1PZID 1HTPA 5JOBA 1PH4A 3HOZG 1VQ6A 3SVMA 2ID0A 1VQFA 4QCLA 1PTOH 1Y1VB 5C4XG 2F0WA 2JA8H 2VL6A 1DZ1A 1D2BA 1MJEA 3RZOB 1TWFB 2E5LL 1G291 5DM63 4C3JH 1VF7A 5C3XA 3RNUA 1KXLA 1FNWA 3HOUH 1RCVD 2NB0A 1B9NA 5JPNC 3CCSA 1EU4A 4U68A 2PQAB 4E6IA 4B08A 4OHJA 2X6GA 2Z4IA 3UI2A 4DN4M 1L2FA 5M3MB 3PO3H 4R8NA 2R6GA 3ER0A 1PFNA 2BH2A 1Z9FA 1AP0A 4JI5Q 2MPMA 5CC4A 4A3IB 1Y1WG 4JVZA 3A8JE 3E6ZX 1ML0D 4NP5A 4A3FH 5C0XG 5KIXA 3OTOQ 2DNEA 2LFNA 2EPBA 3CHBD 4A3GB 1YNXA 4FYDA 1FR3A 3J80i 1BO0A 4UP7A 3A55A 3I4MG 1TT2A 1AEXA 3TDQA 4C2MH 2B63G 3NWSA 3M4PA 2JA6G 4XYQA 1HNZL 1UNSA 3D6WA 5G3LD 1VQ4A 1JOOA 2WKDA 3S1MH 1NJIC 3GTPH 2Y0SB 1RD9D 2OXPA 4JC0A 3ND9A 1XPRA 2LMCB 1ZXTA 3MXNA 1E0BA 1KC8C 1KNAA 2KEDA 4TSSA 2I07B 3PGZA 2F0MA 1UE1A 4DR1Q 2YV5A 3BVZA 3DWAA 4BXXG 3P7JA 2K5VA 1F9RA 1BXTA 2LS01 2NVXH 4EX5A 1Y14B 2PMZB 1V1QA 3VYRA 4X3UA 5HGTA 3TREA 3S1NH 2EIFA 3FRPB 1K28A 1PMRA 4BY7H 1CTMA 3UE1A 3NTHA 1L0YB 1XWEA 5KRUA 2K5HA 2KENA 4C1NI 3FVQA 1OXUA 1RODA 2UXCQ 2ATWA 2N78A 3UDXA 4KHVA 5I6WA 5ISRA 2YU9B 1SYFA 3U9OA 4DV2Q 4JYAL 3CXCA 1SXTA 2H1EA 1HR0W 2UXDQ 4PZ7A 4XQJA 1MJCA 2N3SA 2FJ2A 2HHHQ 4NXML 1PRTF 1RKNA 2Q8IB 5FLXc 1KLUD 4RH6A 4R9WA 4K0KQ 1QJOA 4CDFC 3QB3A 4X64Q 3EQLC 1GJXA 2EY6A 1RF2D 4IFDG 1VQAA 3S16H 4JI5L 3NHHA 2VUMB 3DEOA 2MO1A 4A3MB 2RDHA 2K5DA 2F0JA 2Z4HA 5FO7B 3K58A 1ET6A 2IHEA 2TSSA 3NE5B 5CBAE 4HIMA 1XXGA 3HOYH 3OTOL 1Q1EA 3J7AV 3G6JB 1RDPD 3EBEA 1TWHH 2PI2E 3KDFA 4A3JG 1CM9A 1XX8A 3R2IA 3ULPA 1SDFA 4F7XA 2X6LA 5JVG3 3P75A 4JI8Q 4I7AA 5JAVA 1W3SA 3CCRA 1RJTA 4QGUA 4HAEA 1C4QA 2Z6KA 3GTKB 2JJQA 4EQOA 2E2DC 3J81E 1WVLA 3SHLA 1C9OA 1VQLA 1DXMA 4LF7Q 3KF6A 1KDAA 1HRJA 3J81L 1E2VA 3N6RA 1XPUA 5C3WA 3CD6A 5M5XB 2F52A 4CKEA 2F0QA 4FXKC 3J7ZC 3I4NG 4DR1L 4DR4Q 4HSVA 4X3SA 4TRDA 1PTOF 2NN6G 2B39A 3AEVA 4R4QA 2WIIB 1EYCA 3M4OH 4S3SA 1JICA 2IW3A 4LFCQ 3K5OA 3I4OA 1GUOA 3AQQA 3CCUA 2KCMA 3X3NA 2ZJQA 3HOXB 1B50A 1JCKB 2RCFA 3D3RA 1W2BA 1H9SA 1O7YA 3MFGA 4IUNA 5K36H 1FYCA 1STGA 2FMMA 3B6YA 3GDEA 1VF5C 1HNXQ 3H3VC 1SE2A 2JEAI 4CBVA 1D5XC 1SBBB 5C44H 2Q2HA 2JA8B 2SEBD 4DV2L 2F4VQ 4YY3Q 3V05A 2B3GA 2R93B 2HDLA 1FNUA 4IOAA 2UXDL 3MA2B 4C3JB 5T1IA 2HHHL 2K7VA 5AFWA 3HOUB 1EOVA 3SK5A 5GAGC 3HOZH 3L7ZC 3LGJA 3PO3B 1STHA 3MVVA 3GQBA 4X64L 4JCVE 1HH2P 5C4XH 4FO2A 1B1ZA 1GUGA 3PIO3 3FHWA 1LTBD 3QIAA 2WAQE 2L12A 3K5MA 3CQZH 2UUAQ 2XGTA 4F87A 1YBYA 2ZTEA 4A3FB 1SSOA 5IOCA 1LT6D 1I3QH 4UP9A 3S15B 2VB2X 1I4PA 4WJWA 3OOCA 1EWHA 3E0EA 2SDFA 2YTYA 4EQPA 2B2WC 2K5NA 4LF5Q 2ENBA 4DAVA 3U9SA 4C2MB 4KY6A 4CDDC 2F3VA 1F2LA 4APVA 1Y1WH 4JI8L 1YNJD 1PH6A 1IBLQ 1U4PA 1EIHA 1HA6A 1HQRD 2UU9Q 2RSNA 1X9NA 4LF7L 1A6XA 4U673 2CFMA 1TS2A 3C3LA 4JI2Q 3I4MH 1LTTD 2B63H 4CJ2C 4DR7Q 4ZLTF 1PV4A 3TZUA 2JA6H 1PH2A 4DXFA 4DR4L 4JV5Q 1R4PB 1Q8IA 4NDXA 2NVXB 1IZ6A 4PQXA 1O7LA 2A5HA 1KRSA 4LFCL 4XT3B 2OCEA 3VR4A 2D0PA 3KDFB 3S1NB 3BZKA 1HR0Q 4K14A 3VYSA 1CSQA 2WP8J 5LMNW 3Q24A 4JI3Q 4I65A 1HNXL 1G6PA 2C9OA 3IFDA 1BR9A 1EYDA 5D65A 1PRTD 5FLXE 2E2HH 1UWVA 2NWGA 5IT9c 4JI0Q 2K32A 3U4VA 2EY1A 5FLXL 4YY3L 1TS4A 1KABA 3SK4A 1UE5A 3I3CA 2MQHA 3QOLA 2H5XA 1IW7D 4PZ8A 1PH7A 1EY8A 2VZAA 5AJ3Q 3BZCA 1Y8PB 2KHSA 1MGSA 2NVYB 1CHQD 1YNJC 3CCEA 5D3IB 3RN2A 1RHPA 3DWQA 3CRKC 3TBIB 1G6ZA 3HG9A 4JBKA 5IODA 4LW1A 1K9MC 3H3VH 3S16B 2IY5B 2PQEA 4OO1H 5EKKA 1AN8A 2XWJB 4KJNA 4A4IA 1EY0A 5EPKA 1F2YA 3I7FA 2UUAL 2JA8G 1H9SB 4JOIC 4BA1I 4C3JG 3TP7A 4J15A 2J0TD 2EJFC 1VQIA 3W3AA 1WCMH 2WAQG 4K6LA 3HOUG 1XTDA 4LF5L 1KHIA 2DJGC 1LM0A 4NPSA 4IUVA 2QEJC 2NVTB 2X69A 2ZJRA 2UXBQ 4JI6L 1IBLL 1G8ZD 3PO2H 5K5PA 1FGUA 2UU9L 4BWGB 4ME3A 5CV4A 1TY2A 3UDGA 1NCVA 2EJGC 4QQBX 1I4RA 1PTOD 1IYVA 3PUWA 4B9XA 4L5QA 4A3JH 4BS9A 4JI2L 1IW7C 4DR7L 2V4DA 3U4ZA 2J4XA 3C46A 1HFGA 4GNXA 4JV5L 3HOVG 2OTLA 1AZQA 2EY2A 5KNDA 3M4OB 1TR5A 2SOBA 4X6AH 2KBNA 1A2UA 1WD1A 3D0FA 5GQOA 3LWUA 4HCEA 1HR0L 4JI3L 2SNMA 3FKIH 4QIWB 3TRZA 2RBMA 2L15A 1J6QA 2XN9C 1K8GA 1G2TA 2D5DA 5M5YH 4KLKA 2XSCA 5C44B 4HJ5A 4JI0L 5A2QE 1JE4A 1ILPA 1U4LA 3HKZB 4QIWE 1X65A 3KF8A 2MJ8A 3F1ZA 3JAML 1E3PA 5EBDA 1EFWA 1GD7A 5AJ3L 4JBWA 5IGCA 3PQIA 4V190 4YCWA 5IYCG 3F8TA 4TKOB 3HOZB 5HURA 4LFAQ 4BY7G 5H1SE 3MXUA 1ICFB 3T16A 3HKZE 2M2LA 3NTIA 4DKAC 3RD4A 5C4XB 2JA9A 3QJYA 3F2DA 1PTOC 1YHQA 1J9OA 2B2WA 5EQ0A 3SDZA 4A3LG 3CQZB 4P2CB 4HEDA 4CHTB 4H0LC 1DOMA 1U0LA 3K7UC 1XYIA 3V96A 1GUNA 1EEID 4ULLA 2XRSD 4MIUA 4XTCS 4IFDI 3D8GA 4KKSA 3UDIA 2UXBL 2Q8TA 3CCVA 1Y1WB 1PH8A 3I72A 1IBMQ 4JI4Q 3PIP3 1EY7A 2NTSA 1LTRD 2R7FA 1IL8A 1WOCA 2E5LQ 4R8IA 1VQOA 1SYDA 1BUVT 1D5MC 1YIJA 4GN3B 4HN7A 2N55A 2DY8A 4GN5A 5DM73 3T51B 1CI3M 1GM5A 3URYA 3HOYG 5GADC 4G57A 1H9KA 1SNPA 2CH4A 5LMNQ 3J7A5 3I4MB 4J1MA 2B63B 4IURA 3V2TA 2JA6B 1SNDA 2WB1B 4G7OC 3H15A 2JA7H 4DR3Q 4B3SL 1LO5D 5IT9E 3HKSA 1C7YA 1V1PA 2F0FA 4HR7B 1STEA 1I6VC 1PH5A 4A3EG 5IT9L 1A63A 3K0XA 1BCPF 2B8FA 1IL2A 2WB1E 1PH3A 1C0AA 1U4RA 4XYOA 4L6TB 1VQ8A 2EJMA 2K14A 3ULLA 1LABA 1RTNA 4DV6Q 2E2HB 2F03A 1VQCA 5EPLA 1STNA 4A3KG 1WJJA 2NYZD 4ZYSA 1NUCA 2NN6I 3M9BA 3QR8A 1EYAA 2IX0A 4F8MA 1JJ2A 1QVCA 3L0OA 4BBSH 3KOJA 1KNEA 2G5DA 1K8OA 1VQMA 2AUKA 4JOIA 4GNXB 5K36G 5M5WB 2Q2IA 5E1FA 2VW9A 5L37A 3X3MA 2F0OA 2NBFA 5D14A 5IIFA 4QL5A 3CPWA 5IWAQ 2QDLA 3T1HL 2KVMA 2PI2A 3HKZG 4KTAA 4BBRH 5ELDA 4L5SA 4PV1C 3LX0A 2MO0A 4G4KA 2K5QA 4RGOS 1LYLA 3E3XA 3A5ZB 5CGKA 2OQKA 2RDFA 3C1EA 2PPBC 4LUVA 2F3WA 1TWCH 3KF8B 2G9HD 2IPKD 3CC7A 3T56B 1SJHD 5T1GA 1EIGA 5ELCA 3SE0A 1IBML 4JI4L 4CKCA 2Z6BA 1Z6HA 1FNVA 4HIOA 4JYAQ 3ZJYC 1ZKOA 5ELEA 1CZGA 3PO2B 2BH8A 4LF9L 1EY6A 2LKVA 4NXMQ 1YHBA 4A3JB 5LMNL 1NMFA 1UEAB 2ICEC 1N34Q 4I7ZC 2GN5A 3J80c 4DR3L 1BBWA 2EVBA 3K81C 2Z1CA 4QUCA 4RGTA 4NMZA 4RFBA 1TQOA 3FKIB 1MSHA 3NSWA 2OTJA 2Q2UA 1W6JA 5ELBA 4EQNA 2JQOA 5M5YB 5C5MA 3I4NB 2DGYA 4DV6L 2ZT9C 2K33A 4HCSA 3IAYA 2R3ZA 2AMCB 1IBKQ 1VQNA 3HOVH 1TKWB 3DEPA 3CRLC 1KTKA 2XNAC 1I94Q 2WB1G 5DAUA 1K3BC 4AYBE 2VY3A 3GTQH 2B8GA 1PH9A 1I4HA 3CMEA 3OW2A 2RKSA 1XMOQ 2QW7A 1X32A 3C2PA 2BDOA 1IYJB 3CMAA 3RZDH 2P5ZX 4KHZA 4DAMA 2KA7A 3IL8A 4KKTA 1U4MA 1JE5A 2QDBA 1E2WA 5EKIA 1V1PB 1IKMA 5IWAL 3AMUA 2VQFL 4RGNA 4DFAA 4A75A 3M4YA 4CDCC 4IJHA 5IYCH 4QMGA 1K73C 5CV7A 1PYBA 3DWPA 4XQQA 2RQXA 4NW2A 3NUCA 4KY5A 4DK3C 1WTOA 3T4AC 2ICIA 1Q90A 3I91A 3VDYA 4A3LH 4OO1G 4TVAB 3RR5A 2RHQB 1XJVA 3HFZB 1PZJD 2GA4B 3DUZA 5CMDA 3VA7A 1Q86C 4C1NK 2KOLA 4V0BA 1A3UA 2HD3A 2F0LA 2QCPX 4G7ZC 1B44D 1NNXA 3MAQA 4KHPQ 1C48A 3TQYA 2E74C 4GKJQ 4ABNA 1BCPD 1I4GA 1WCMG 1X3FA 1N34L 3A7AB 3GV3A 5FK9C 5C6AA 2JA7B 2QGQA 1MSGA 4UHVA 4OX9Q 1D7QA 1JQYD 1VQ5A 3MC0B 3F2CA 3OIQA 1PRTB 3PO2G 1WFQA 1EQRA 1X55A 4FXGC 1SE4A 3G6EA 1II3A 4RHRA 5LL6X 3STBC 1EYGA 4FF1A 2JK8A 4X66L 2A6ED 4KN7C 3K80C 3BU2A 1IBKL 1CT1D 4BY1H 1E1TA 3CW2C 3EIVA 1I94L 4DUYQ 5JPMC 4XIGS 3AYHB 5E4WC 1O7IA 4X3KA 2D62A 1HHVA 3GD7A 2A19A 4A3EH 1E24A 1TWAH 1PFBA 1QZGA 1PZKD 4DGZA 4BBSB 1XMOL 1PYWD 2N8NA 4MNOA 3CCLA 1PDQA 1B9MA 3FKIG 4IPGA 3S2DH 3L2PA 1EZ6A 4K5XA 4AYBG 4FDBA 1N36Q 1NSNS 4A3KH 2HCCA 2O5JC 2F0SA 4DV0Q 1T5EA 4DV4Q 5C3EG 5LMUQ 2EQSA 1ET9A 2EXDA 2PNRC 1BCPC 1PLFA 1TU2B 4LAAA 4P73A 1VQJA 2EDGA 3AU7A 1WTVA 4DXGA 1JB7A 5CYUA 3QO2A 1FVIA 1TWCB 1PTOB 1WTRA 1ENAA 1FD7D 4B3TQ 1F9SA 3ND8A 4H44C 1EEFD 3A0JA 2B2YC 3J80E 2A6EC 3VR2A 2CW0D 1A62A 2F0HA 3OW7A 4Q5VA 1FJGQ 3J80L 1ZYRD 2WAQB 2D0OA 3H6MA 4XQNA 4KHPL 4EVOA 3WOFA 4GKJL 4P74A 5IY0A 3JAMc 5J3BA 1GOZA 3A74A 3BDLA 1EL0A 3PF5A 1QVFA 2C5CA 3OMGA 4FXDA 3G7LA 3PUXA 4OX9L 2EXZA 1LTLA 4LFBQ 4N9PA 1STYA 3TSSA 4IUQA 5IGGA 1NMGA 3FP9A 2F1MA 2BA0A 3BZDB 3PSIA 4O2DA 3VA5A 1DOKA 2KCNA 5ELFA 4YWKA 1N8RC 3RLNA 1FL0A 5KEEA 4CJ0B 3HRZC 4JPBW 3I4LA 2A1AA 3S1RH 2QF7A 2A8VA 3BVGA 3HOVB 2N88A 2F0PA 2MUYA 2B2VC 3D31A 3G4SA 1ASYA 2A68C 4DUYL 4MHEA 4MZ9A 4JI6Q 2JA7G 1CQFA 3GTQB 4PZ6A 2PW7A 1I4QA 4K8JA 3S1MB 2KCTA 2XTIA 1EU3A 1H9MA 2VXWA 3DMUA 4KD3A 5KYIA 1IHZA 3GTPB 4A3BH 3RZDB 2F0TA 1X6OA 4AH6A 3A56A 1SJED 1HXYD 1AZPA 2CW0C 1N36L 4LUZA 3I8ZA 5DEHA 1CHPD 3EJIA 1SN8A 4DPGA 4ZK9B 5IP7G 4RA8A 1SAPA 1ZYRC 4DV0L 5DNFA 1BKBA 3JC66 4ILWA 5JEAJ 4DV4L 3TS2A 5LMUL 5CBEE 1BBXC 4FF3A 1DGSA 1EQVA 1EOTA 4ZUJA 5BN5A 4ZKBB 4ZUIA 1BF4A 1SMXA 1S3OA 3GTLH 4BY7B 2ZXPA 1MIUA 4BBSG 2D9UA 2I5MX 3BDOA 4K2KA 4WRDA 2EY5A 3TP8A 2AQ3B 2UUBQ 3TS0A 3OYYA 4JG2A 3S1QH 3K7AH 4RMFA 5F2DA 3E5SA 5I2YA 4B3TL 1JOKA 2WINB 3LWEA 1V9PA 1DM0B 2WKCA 4K2LA 2DUDA 2E2JH 4UAIA 4HTHA 5EKLA 1WTQA 1BVSA 1FJGL 2MHVA 4BBRG 5BN4A 1EZ8A 1O78A 4QJFA 1Y8NB 3E0JA 4EQ5A 4B3RL 1R9TH 3MEFA 3OMCA 1EIYB 4AQYL 1IKLA 5C0XJ 4RKLA 1HZAA 2LXKA 2OT2A 1OXVA 4LFBL 4OWWB 2Q2TA 2R61A 3MXPA 1DD2A 3KBXA 1I50H 2EOTA 3GV6A 1YITA 5J39A 4KI0A 3HOYB 2VNUD 1DJRD 2KUMA 2PNHA 3CP0A 1TWHB 1KIXA 1M90C 2E2IH 1S4ZA 2C35B 3BJUA 3KYHC 4R4OA 2BDNA 4HSPA 4L63B 1XNRQ 2YYZA 2L1BA 1DOLA 4BY1B 3QOJA 2V1CC 4IPDA 4KMUC 2B2TC 1I6HH 2ALYB 2RSOA 4DR2Q 4K6DA 3RLOA 3VR5A 1TWAB 4A3EB 1Q12A 3GP7A 2FHTA 5C0XI 1UEBA 2L11A 2ZTCA 4Y7NH 4DV7Q 5I9OA 4OIJA 1AFPA 1LT4D 3T1YL 3S2DB 2WFWA 4RCOA 3F2BA 5M3FG 3G71A 3CCJA 5BN3A 4Y52H 4A3KB 4DV1Q 1K83H 3H0GG 1Y1VH 1ILQA 4GN4B 3EN2A 1SNQA 4B3SQ 1EY9A 5IE8A 3Q6SA 1Q46A 4RAUC 3UE0A 3PUVA 1JWSD 2M00A 2RF4A 2B2YA 3PCOB 1SYEA 5CV6A 2K50A 3HZXA 2O5IC 2UUBL 2F0NA 1CKNA 2BA1A 3CU7A 4C3IG 1LTSD 1SRUA 3K6OA 1QNUA 3NQIA 3I90A 4IJLA 3JAME 5C3EH 1IYUA 2OF1A 2XIWA 3HS0C 3NQTA 4OWXB 3PMFA 1NY4A 3ZYYX 3OWEB 1DCZA 1B53A 1SNCA 4IFDJ 1HFNA 2ASBA 3ICEA 3PV0A 1TXYA 2NZOA 5CV5A 3I70A 1X3GA 5KGUA 1K8AC 4RWSC 5FLMG 1QNKA 2F0IA 1ONLA 1SEBD 3P1HA 2EYLA 1JORA 1FGBD 1GXDC 1A3TA 1EQTA 1GUTA 5JVH3 5I6YA 2O2LD 3T1HQ 2B2VA 4DR5Q 3M85A 3EA6A 3W1BA 1L0WA 1I3QB 4L5RC 1LTAD 2OEOA 2K75A 3NK9A 1Q3LA 3HGBA 1N33Q 4LNQA 4KK7A 1K8MA 1XNRL 2HUGA 1Q1BA 3KBGA 1Y69U 1EFID 1EY4A 2CCZA 2PW5A 1SNMA 4DR2L 2Z8LA 1S5DD 3OWFA 3M4QA 2NZHA 4C3HG 1CZWA 5CORA 4A3BB 2CWAA 3KLSA 4KJOA 4DV7L 1KRTA 4LF9Q 1PVOA 2KQ3A 2JSOA 4EGVA 2K6AA 4QY7A 2AUJD 5JJKA 4N8FA 4P75A 1M8AA 3ERSX 3R8BA 4B3MQ 1WI5A 3BVMA 1HJPA 4IUTA 4L8JA 3VYUA 1YNND 4QB4A 4DV1L 3GTOH 1Z7TA 3S24A 4M8AA 1BBUA 3CCMA 1SLJA 3M7GA 4BY1G 2VB3X 1P16A 4OELB 1PHJA 1NTGA 1LTID 2CHBD 1Q81C 1HZ9A 1D6EC 1SYBA 4GLVB 4CKBA 1TIID 5E7NA 3GTLB 3OHXC 2M9VA 1EUJA 1MHWC 1Y8OB 3NXWA 1B2TA 2F0EA 4B9WA 1A2TA 4ME5A 1JWUD 3S2HH 4IUUA 1CKMA 5M9OA 3S1QB 3F2UA 5IP7H 1HCZA 4UP8A 1LLRD 1MKHA 3K7AB 5JJIA 4HJ8A 2BE5D 4IPCA 2VUMH 3K0YA 3SR1A 3CCQA 3WOEA 2EYJA 3T53B 4HIDA 2DNCA 1BCPB 2KECA 1KDBA 5TSSA 1E7ZA 3Q0AA 4IALA 3GTGH 2L0CA 2PZTA 3LNNA 2GVBA 5FOBB 1GUSA 4Q0FA 4HJ7A 3MHBA 1A8VA 2IJ0A 1NAPA 3KJPA 5I9PA 4OEMB 1S5FD 2VQFQ 4GZYC 3S17H 2K01A 4DU9A 1YNNC 1I50B 3K5LA 2XWBB 4DR5L 3H94A 1N9WA 5CV9A 4JI7Q 1J8IA 1K3RA 1CKNB 4IZ8A 2E2IB 3BDCA 1WCMB 5M5XH 1N33L 4HJ9A 4DNIA 3R2TA 1HQMC 3J7AF 1LT5D 3GTJH 3BYTB 2QKIC 2Z6KC 5I4DA 2AHOB 3NELA 1G91A 3RUZA 4DNRB 3K8AA 4CGYB 1HZBA 2CWPA 2L9HA 2R7ZG 1WTPA 3G48A 3FDTA 4H13C 4G7HC 4IPHA 3NPPA 2PCFB 2BE5C 2G9DA 5HY6A 2NUCA 4P72A 2HQEA 4X65Q 3TP5A 3I56A 1VQKA 4B3ML 3N52A 5EAYA 1KL9A 3KLWA 1K83B 2HIVA 1ESFA 2LY7A 3J81i 4JW0A 2Z0SA 1N32Q 2H4OA 1TVXA 3K59A 1JMCA 3I73A 2R93H 1NR2A 5EBCA 1RIPA 2I0QA 2RCNA 3KFUA 1S40A 1KLGD 2HIXA 3K5NA 1ENFA 4YWLA 1B3QA 1D5ZC 1X3PA 3D4DA 1CK1A 3CKIB 4YHHQ 2CKZB 5JJZA 3DLLA 4A3BG 4A3CG 1VQDA 2JP1A 4LMQD 4AYBB 2ZJPA 2VQEQ 3NBIA 3DXJC 5M3FH 1SE3A 4X66Q 4YWMA 3H0GH 2O4XA 4X62Q 2JA5G 4K5WA 4POFA 1G51A 3IRBA 5C3EB 1OO9B 2D2CC 4C56C 3DM3A 2RA4A 3E9IA 3BS1A 5FKAC 4DAYA 4A3DG 2F3IA 1L1OC 1VCIA 3HOWG 3S15H 1X54A 1O80A 5EPJA 2ZM6L 2F0UA 3D6CA 2KHJA 4RCNA 4Z9CB 4K8IA 4BA2I 1KD1C 1EWCA 3O13A 4C3IH 4NXNL 1AE2A 3A54A 2MP1A 3SK8A 4NKLA 2QEXA 1Q82C 3NBHB 5IP9H 3STBD 4H02A 1M4VA 4FF4A 2K28A 4IOCA 1CA5A 1PFMA 2PZWA 1Z47A 1XPOA 1VMCA 4JI7L 3AFQA 3W2DA 5FLMH 1TS3A 5ELNA 2NVQH 1H9JA 4FVMA 1QOHA 1KQSA 1HNWQ 1Q8KA 4DF7A 4RKBA 1HUMA 1GHJA 3RMHA 1UE7A 1CFMA 2Y0SE 4DV3L 3D4WA 2FMCA 2IHFA 5CV8A 4IQZA 2RDGA 4ZKCB 2JYOA 1Q7YC 1JOQA 1HZCA 1OXXK 4JK1C 4X65L 5KNCA 4XDXA 1SNOA 1B70B 5KNBA 1QZHA 1U5KA 3M3YH 2R92H 3HP3A 4CDEC 2PMZE 3GTOB 3KK7A 5IYBG 1F9QA 1P8LA 1BDOA 3I55A 1N32L 2ZXOA 2WACA 3Q8DA 4KN4C 4O0AA 1LTGD 3W5OA 4C3HH 1F9PA 4J6HA 2NVYH 2J7ZA 1TY0A 1UUPA 3ERQA 4YHHL 1V43A 1UE6A 2LSSA 5CR3A 1HA5A 2VQEL 3S2HB 1AE3A 1YHAA 3H91A 4X62L 3MEHA 1A15A 5FJ8H 1H95A 4N8X1 1Y1VG 4UDUC 1U9RA 4CJ1B 1D8LA 1H9RA 3MZ5A 1QVGA 3A8IE 2QA4A 4OL7A 2MGSA 1VS0A 1X3QA 4HMJA 2CVRA 4JBMA 3GTGB 1O7ZA 2PYKA 2ZXRA 5IYDH 1V8QA 4GOPC 2E76C 5EJWA 1BOSA 2R7DA 5M3MG 2NVTH 3D4RA 1CQVA 1SYCA 2AQ2B 4POGA 3PF4A 4LK1C 3QWNA 2QILA 3S17B 3CF5A 1ICWA 1C8CA 1T5XD 4A3IG 1QCBD 3Q22A 2LXJA 2I46A 4BBRB 3NTKA 1DONA 4PG3A 1B7YB 3S14H 5FO9B 3AFPA 2A68D 2BOSA 1JWMD 1HNWL 5I2XA 4A3GG 3GTJB 2EE1A 4R4IA 5DLQE 4DA2A 1KAAA 2DY7A 1JJCB 1JJGA 1PYSB 2KCCA 2IX1A 2AQ1B 4DAYB 4YCUA 4NB3A 3KLSX 3NEMA 4A93H 1PA6A 4LUOA 3ONAB 4IO9A 2F0GA 1RL2A 3TP6A 4KD4A 2Y0SG 4JI1Q 4GNXC 1V1OA 2HQLA 4TQUS 1YJ9A 1F2MA 1NE3A 3TEHB 2MFIA 4B3RQ 2UXCL 4WORA 4AQYQ 2VS1A 4UY8C 2A73B 3SXHA 1YZ6A 3PIOA 2R7ZH 3BG3A 5A35A 5EGTA 1WYDA 4ODGA 2EYPA 5JEAH 2EYOA 3MXNB 2YTXA 3MXGA 1CKOA 3EROA 5M3FB 2JN4A 4K0KL 1YI2A 1L1OA 4FNFA 3H0GB 4MTNA 2N49A 4OWTB 5D3DA 2IX3A 1JT8A 1PXUA 4O42A 3H09A 4DV5Q 1GUWA 4DK6C 3TMEA 4GLAC 1EY5A 1TWGH 3MFYA 1OXTA 4LF4Q 5C4ZA 1CSPA 3FEWX 3T13A 1XMQQ 3FPUB 4A3CH 5IGEA 3HEJA 2I5HA 5COYA 3JAMi 2OQ0A 3T1YQ 4C3IB 3GTMH 1QILA 1KAWA 2JA5H 5C4JH 1YJWA 1QB5D 4AIMA 3QG1A 4XT1B 1J5EQ 3CC4A 4F88A 4LWCA 2IT1A 3MWYW 1JB3A 1B3AA 2VUMG 2KJXA 4K5VA 1I5FA 4A3DH 4A3MG 5C0XH 3HOWH 2K04A 1EQQA 2L55A 4ZCKA 2NVQB 4ZRZA 1S5BD 1B4OA 3SEBA 1ESRA 1S72A 3TZDA 4DK0A 3NP8A 3IKJA 4DR6Q 2CQAA 5GAEC 2JE6I 4L5TA 4YIJA 1UAPA 5NUCA 1SFOH 2NTTA 5FO8B 3FMCA 5BR8Q 3EFXD 2F4IA 2SNSA 2I5LX 2KEEA 2PZUA 5GAHC 2B2UC 4QF4A 4R4CA 4GS3A 1VQ7A 4JI1L 2YTVA 3M3YB 2R92B 1XTCD 4R4TA 3IFTA 4HJAA 1SROA 3U58A 4BXXH 2ES2A 3K57A 2F4VL 4MN3A 2EYHA 1VQ9A 4C3HB 3WWVA 3KF6B 1VQGA 4HMIA 1VMPA 3L9AX 1WD0A 4WJ4A 4IN3A 1KDCA 2XVSA 4O1NA 3HOXG 4OGQC 3EVQA 1BQQT 1F2ZA 2HDMA 5HGQA 1WTWA 3NWTA 5M5WH 5IYBH 1TS5A 4PMBA 4GOPA 1QUQA 1GKHA 4DV5L 3NENA 2FINB 4WFN3 4DK1A 3MTSA 2OWOA 4J8QA 3S9WA 4LF4L 3I2ZA 2R93G 2E75C 2AKWB 1XMQL 1A3VA 2JEBI 1VQBA 4OONA 1T9HA 3M7NA 4IFDH 5JJLA 2Z9HA 3OSOA 1LV9A 2E8GA 3PO3G 5J1ZA 1JR0D 3A5UA 4WJ3M 1J5EL 3ULJA 1MBYA 2CQOA 4DUZQ 2CH4W 3RZOH 1TWFH 1PRTC 3KUPA 1RTOA 3OIPA 5C5LA 1K0SA 1F77A 1STAA 2UUCQ 3S14B 1L1OB 4A3FG 1QWYA 3KJOA 3DHQA 1SR3A 1HUNA 1MI2A 1R4QB 5M3MH 3WDNA 1AW7A 1VQHA 4KY7A 2F0VA 4DR6L 2A74C 4OXPA 1S5CD 1X3EA 1GVPA 1QG7A 2K1BA 4A93B 1YVCA 1WTXA 3L3OC 4A3IH 3A8KE 2EYFA 1PH1A 2WV6D 3SK6A 4LF8Q 2AWOA 3CPFA 2A69D 5BR8L 5IP9G 2A6HD 3PUYA 1EIFA 5IGBA 3W1GA 5E3FA 1QE6A 3TN2A 1I4XA 4A3GH 3R93A 3R3OA 5LHY1 1OTCA 1STBA 3I4NH 1K0RA 2K03A 1XNQQ 1YEZA 4PMWA 2NN6H 4DAPA 3H3VI 2R7ZB 1W6KA 1ASZA 4OO1I 3UDFA 2K5WA 1LUZA 2HCIA 2ZTDA 4MTKA 5A2QL 2GVAA 2BCOA 4FF2A 1AH9A 3CC2A 1HTLD 2XRQD 4LF6Q 5GROA 4FP5D 1VDZA 4YCVA 2K52A 2EZVA 4PNYA 5LL6S 3BYYB 4A76A 3S1RB 5G3LF 2PO4A 2R92G 2RVLA 3A7LA 2PQAA 2MNAA 1A0IA 1JC7A 1TWGB 4GKKQ 1VQPA 2Q8RE 3OPOA 2DJFC 1BNZA 3PIPA 5KYLA 2K4KA 3FPPA 5IGDA 2DN8A 2IL8A 2F0DA 1NBWA 3VR3A 3GTMB 2RHSB 2JA5B 5C4JB 2A69C 2A6HC 4R1JA 2L5TA 4DUZL 5FJ8G 3J81j 1SE8A 2YU9H 4A3DB 2FXQA 5ELOA 2HT1A 1D1IA 3HOWB 1S5ED 4PMCA 1GO3E 2UUCL 1E2ZA 4M1UB 3RN5A 1GHKA 3VR6A 3NBHA 1X56A 1B8AA 4GOPB 1LACA 1QUQB 5IYDG 1SMYD 5J22A 4OIKA 2B2UA 4ALPA 5C4HA 1LT3D 3PUZA 2L4NA 4ZAIA 1L0XB 1YJNA 4A3MH 2KHIA 1EWIA 1SFOB 4LF8L 1CUKA 3AB9A 3ITPA 2E2JB 1D1KA 4GLXA 4RGMA 3U50C 2AWNA 1HPCA 4QUFA 2JXMB 2ZM6Q 4JBJA 3P20A 4HIKA 4IUPA 4KV6A 3Q23A 1E1OA 3CAMA 4RHSA 1R9TB 5IGFA 1VQEA 1XNQL 4UPAA 1IXRA 4NXNQ 4XXEA 5E4XA 3J7YW 1HNZQ 1OXSC 3DM1A 4DNTB 1ZEQX 3RLFA 1PFSA 4A93G 3GTKH 2FFKB 2B29A 1MD2D 4LJZC 1DYQA
chains in the Genus database with same CATH topology
1U5KA 3M3YH 4LF6L 2R92H 3SGIA 4RG1A 1M1KC 3D31A 3G4SA 4X6AH 1ASYA 2KBNA 2PMZE 4DUYL 4LFAL 5IYBG 3D0FA 4MZ9A 4JI6Q 2JA7G 5GQOA 1HR0L 1P8LA 4JI3L 4PZ6A 3FKIH 3I55A 1N32L 3TRZA 2KCTA 2XTIA 2L15A 1J6QA 1E22A 3Q8DA 3GO5A 4A3BH 1K8GA 4O0AA 3W5OA 4C3HH 5M5YH 4KLKA 5C44G 4DV3Q 1X6OA 4GKKL 3J81c 4HJ5A 4AH6A 4JI0L 2NVYH 4P71A 4YHHL 3E9HA 1N36L 4LUZA 1V43A 1UE6A 2LSSA 4QIWE 2VQEL 1X65A 1SN8A 4DPGA 5IP7G 3F1ZA 1AE3A 3HOXH 4DV0L 1E3PA 1BKBA 3JC66 5JEAJ 5JEAG 1YHAA 4X62L 4DV4L 1GD7A 5AJ3L 5LMUL 1EFWA 1PH4A 3TS2A 4JBWA 1DGSA 5FJ8H 3HOZG 1H95A 1VQ6A 4YCWA 5IYCG 2ID0A 3F8TA 1Y1VG 4LFAQ 1VQFA 4BY7G 5H1SE 3GTLH 1SMXA 1S3OA 5C4XG 3HKZE 1MIUA 2VL6A 2JA8H 4DKAC 4BBSG 1D8LA 2I5MX 2JA9A 3F2DA 1QVGA 1MJEA 1YHQA 2QA4A 2E5LL 1VS0A 4JBMA 2UUBQ 1G291 3TS0A 5IYDH 3OYYA 4C3JH 4GOPC 4JG2A 3S1QH 4A3LG 3K7AH 4RMFA 3RNUA 1KXLA 1U0LA 3K7UC 3HOUH 4B3TL 3CCSA 2R7DA 5M3MG 2NVTH 1V9PA 2PQAB 3PO3H 1L2FA 2DUDA 2R6GA 3ER0A 4POGA 3PF4A 2BH2A 2E2JH 1Z9FA 4JI5Q 3CF5A 1BVSA 1FJGL 4BBRG 4A3IG 2LXJA 4QJFA 4XTCS 1Y1WG 4IFDI 3UDIA 4PG3A 1B7YB 4EQ5A 2UXBL 3CCVA 3S14H 4B3RL 1R9TH 3MEFA 1PH8A 1EIYB 4AQYL 1IBMQ 5C0XJ 3AFPA 5C0XG 4A3FH 1HZAA 4JI4Q 1HNWL 2LXKA 2R7FA 3OTOQ 1WOCA 4A3GG 2E5LQ 1VQOA 4R4IA 1OXVA 1YIJA 5DLQE 4LFBL 1YNXA 4GN3B 2Q2TA 4OWWB 1JJCB 1JJGA 1PYSB 4GN5A 2IX1A 4DAYB 4YCUA 4NB3A 3J80i 1I50H 4UP7A 1GM5A 5GADC 3HOYG 3NEMA 1YITA 4C2MH 2B63G 3I4MG 4A93H 4KI0A 3M4PA 5LMNQ 1PA6A 2JA6G 3J7A5 2VNUD 4LUOA 2PNHA 3CP0A 1HNZL 4IO9A 1VQ4A 1M90C 1KIXA 3BJUA 2C35B 3KYHC 1RL2A 2E2IH 4R4OA 3H15A 2JA7H 4DR3Q 1XNRQ 2Y0SG 2YYZA 4B3SL 3S1MH 4JI1Q 1NJIC 4GNXC 3GTPH 3HKSA 1C7YA 2HQLA 4TQUS 1YJ9A 1NE3A 3TEHB 2MFIA 4B3RQ 4JC0A 1PH5A 4IPDA 2V1CC 2UXCL 1XPRA 1I6HH 4A3EG 4AQYQ 2ALYB 2VS1A 1A63A 3K0XA 4UY8C 4DR2Q 3RLOA 1YZ6A 1Q12A 1IL2A 3PIOA 2WB1E 1KC8C 1PH3A 2R7ZH 1C0AA 1VQ8A 3PGZA 5C0XI 4DR1Q 1UE1A 1UEBA 2YV5A 2K14A 2ZTCA 3ULLA 4Y7NH 4DV7Q 4BXXG 4DV6Q 2K5VA 1WYDA 1VQCA 2NVXH 4EX5A 3T1YL 1Y14B 2WFWA 3MXNB 4A3KG 2YTXA 1V1QA 3F2BA 1WJJA 3G71A 3CCJA 1CKOA 5M3FG 4Y52H 2NN6I 4DV1Q 1K83H 3H0GG 3M9BA 4K0KL 3TREA 1YI2A 2IX0A 1Y1VH 1L1OA 3S1NH 2EIFA 4GN4B 4MTNA 2N49A 3EN2A 4BY7H 4OWTB 3UE1A 1JJ2A 2K5HA 4B3SQ 1QVCA 3L0OA 1JT8A 4BBSH 2KENA 4DV5Q 5IE8A 3KOJA 1Q46A 1OXUA 4DK6C 3UE0A 4GLAC 3PUVA 1TWGH 2UXCQ 2ATWA 1VQMA 2RF4A 4JOIA 1OXTA 2N78A 4GNXB 3UDXA 5K36G 2Q2IA 3PCOB 4LF4Q 1CSPA 4DV2Q 4JYAL 2VW9A 2K50A 3CXCA 1XMQQ 1HR0W 4A3CH 2UXDQ 2I5HA 2UUBL 4QL5A 3JAMi 4PZ7A 3CPWA 1CKNA 2BA1A 5IWAQ 1SRUA 2OQ0A 1MJCA 2N3SA 2HHHQ 3T1YQ 3T1HL 4NXML 4IJLA 3GTMH 1KAWA 5C3EH 2PI2A 3HKZG 2JA5H 4BBRH 5C4JH 1YJWA 5FLXc 4OWXB 4L5SA 4AIMA 1NY4A 4K0KQ 1J5EQ 2MO0A 3CC4A 4LWCA 2IT1A 4X64Q 4IFDJ 2VUMG 1VQAA 4IFDG 3S16H 1I5FA 4JI5L 2ASBA 3ICEA 3PV0A 1LYLA 4A3MG 3A5ZB 4A3DH 2OQKA 2MO1A 1TXYA 2NZOA 3HOWH 1X3GA 4LUVA 1TWCH 3KF8B 1EQQA 2IHEA 3CC7A 1K8AC 5FLMG 1IBML 4JI4L 4HIMA 4HIOA 4JYAQ 3HOYH 3ZJYC 3OTOL 1S72A 1Q1EA 3EBEA 1TWHH 2PI2E 3KDFA 4DR6Q 2BH8A 4LF9L 4A3JG 3T1HQ 4NXMQ 4DR5Q 5GAEC 2JE6I 3M85A 1YHBA 3W1BA 3ULPA 4L5TA 1L0WA 4L5RC 5LMNL 1SFOH 4JI8Q 1NMFA 2K75A 1N34Q 1W3SA 5BR8Q 3CCRA 4QGUA 1N33Q 2I5LX 2Z6KA 2GN5A 4LNQA 2JJQA 5GAHC 4R4CA 3J80c 4DR3L 4GS3A 1XNRL 1VQ7A 1BBWA 1Q1BA 4JI1L 2YTVA 1C9OA 1VQLA 3K81C 4DV4Q 4R4TA 4LF7Q 3KF6A 4HJAA 1SROA 3U58A 1XPUA 2CCZA 4BXXH 3CD6A 2ES2A 4DR2L 2F52A 2OTJA 2F4VL 3M4QA 2Q2UA 2NZHA 3J7ZC 3I4NG 2CWAA 4DR1L 1VQ9A 2JQOA 3WWVA 3KF6B 1VQGA 1KRTA 2DGYA 4DV6L 4DV7L 4LF9Q 4DR4Q 1PVOA 4QY7A 2NN6G 2AMCB 4WJ4A 3AEVA 1IBKQ 4R4QA 1VQNA 4P75A 3HOVH 3M4OH 4B3MQ 3ERSX 5JJKA 1WI5A 4LFCQ 1HJPA 3I4OA 3HOXG 4DV1L 3AQQA 1I94Q 2WB1G 3GTOH 3S24A 3CCUA 2KCMA 2ZJQA 4AYBE 1BBUA 5HGQA 2VY3A 3CCMA 1SLJA 5M5WH 5IYBH 3GTQH 1W2BA 1PH9A 4BY1G 3CMEA 4GOPA 3OW2A 1P16A 1QUQA 1GKHA 1PHJA 1NTGA 3B6YA 3NENA 3GDEA 4DV5L 1XMOQ 1Q81C 1HNXQ 1HZ9A 4GLVB 3CMAA 1IYJB 3RZDH 2JEAI 4KHZA 4DAMA 5E7NA 5C44H 2Q2HA 2OWOA 1JE5A 1EUJA 4LF4L 3I2ZA 2R93G 4DV2L 2F4VQ 4YY3Q 2AKWB 2B3GA 1XMQL 2UXDL 4IOAA 3S2HH 1CKMA 1VQBA 2JEBI 4OONA 5IP7H 5IWAL 4UP8A 2VQFL 1MKHA 1T9HA 5JJIA 4HJ8A 2HHHL 4IPCA 3M7NA 4A75A 2VUMH 5JJLA 2E8GA 3PO3G 1EOVA 5GAGC 3HOZH 3CCQA 4IJHA 3L7ZC 3LGJA 5IYCH 3A5UA 4WJ3M 1J5EL 4HIDA 3ULJA 1K73C 2CQOA 1PYBA 4X64L 4DUZQ 4JCVE 1HH2P 5C4XH 3RZOH 1E7ZA 1TWFH 3GTGH 3FHWA 4DK3C 2GVBA 2WAQE 2UUCQ 3CQZH 2UUAQ 1L1OB 4A3FG 2XGTA 3VDYA 1YBYA 2ZTEA 3KJOA 4A3LH 4HJ7A 4OO1G 4TVAB 1A8VA 1SR3A 3RR5A 2RHQB 1XJVA 4UP9A 1I3QH 3HFZB 5M3MH 1Q86C 3KJPA 1VQHA 3E0EA 4DR6L 2YTYA 4OXPA 2VQFQ 3S17H 1X3EA 2K5NA 1GVPA 4LF5Q 4DR5L 1YVCA 4KHPQ 1N9WA 4A3IH 3TQYA 1PH1A 4LF8Q 4GKJQ 4APVA 1Y1WH 4JI7Q 4JI8L 2AWOA 1PH6A 1K3RA 1WCMG 1CKNB 1X3FA 3CPFA 1N34L 5BR8L 5IP9G 1N33L 3PUYA 5M5XH 1EIFA 4HJ9A 1IBLQ 4DNIA 2QGQA 3W1GA 2UU9Q 3GTJH 2Z6KC 4OX9Q 4A3GH 1X9NA 1D7QA 2AHOB 1VQ5A 3NELA 1OTCA 4LF7L 3I4NH 3F2CA 1K0RA 2CFMA 1XNQQ 3K8AA 3PO2G 1YEZA 1HZBA 1WFQA 1EQRA 2CWPA 4PMWA 2R7ZG 1X55A 3G48A 4JI2Q 3I4MH 3H3VI 2B63H 4IPHA 4DR7Q 1PV4A 1ASZA 4OO1I 3UDFA 2JA6H 3G6EA 1LUZA 2ZTDA 5HY6A 3STBC 1PH2A 1EYGA 2JK8A 2GVAA 4X66L 4DR4L 4P72A 4JV5Q 4X65Q 1AH9A 3K80C 3I56A 3BU2A 1VQKA 3CC2A 1IBKL 1IZ6A 4B3ML 4BY1H 4LF6Q 1KRSA 5GROA 1E1TA 4LFCL 5EAYA 4YCVA 3CW2C 3EIVA 1KL9A 2OCEA 3KLWA 2HIVA 2K52A 4DUYQ 4XIGS 1I94L 2D0PA 3KDFB 3AYHB 3J81i 3BZKA 1HR0Q 4A76A 1O7IA 2D62A 1CSQA 2WP8J 5LMNW 3GD7A 2A19A 2Z0SA 4A3EH 1E24A 1TWAH 4JI3Q 2R92G 1N32Q 1QZGA 2MNAA 2PQAA 1JMCA 2R93H 1XMOL 1HNXL 1A0IA 2N8NA 4MNOA 1G6PA 1RIPA 3CCLA 2I0QA 2RCNA 3KFUA 1S40A 2E2HH 4GKKQ 1VQPA 3FKIG 1UWVA 2HIXA 4IPGA 4YWLA 5IT9c 3L2PA 4JI0Q 3S2DH 3PIPA 3U4VA 4AYBG 4FDBA 4YHHQ 3DLLA 2CKZB 1N36Q 4A3BG 4A3CG 1VQDA 4YY3L 2ZJPA 4A3KH 2VQEQ 1UE5A 2K4KA 5M3FH 2MQHA 4X66Q 2H5XA 3H0GH 4YWMA 4PZ8A 4DV0Q 1PH7A 2VZAA 4X62Q 5C3EG 1NBWA 5AJ3Q 3BZCA 2EQSA 4POFA 5LMUQ 2EXDA 2JA5G 1G51A 2RHSB 3IRBA 3RN2A 3CCEA 3DM3A 3E9IA 4P73A 4R1JA 4JBKA 1VQJA 4LW1A 1K9MC 4DUZL 4A3DG 2F3IA 5FJ8G 3J81j 3H3VH 1JB7A 2IY5B 1SE8A 2YU9H 2FXQA 1L1OC 1VCIA 5ELOA 3HOWG 2HT1A 3S15H 1X54A 4A4IA 2ZM6L 2KHJA 1FVIA 1GO3E 2UUCL 4BA2I 3I7FA 2UUAL 2JA8G 3RN5A 1KD1C 4C3IH 1X56A 4NXNL 4B3TQ 1B8AA 4GOPB 4JOIC 1AE2A 1QUQB 4BA1I 5IYDG 3A0JA 2QEXA 4J15A 4ALPA 1VQIA 1A62A 1Q82C 1WCMH 2WAQG 3HOUG 1FJGQ 1XTDA 3PUZA 4LF5L 3NBHB 5IP9H 1KHIA 4H02A 3STBD 1LM0A 1YJNA 4NPSA 2D0OA 4KHPL 4A3MH 2KHIA 4IOCA 1EWIA 2ZJRA 1XPOA 4LF8L 1Z47A 4GKJL 2UXBQ 4JI7L 4P74A 5IY0A 3JAMc 5J3BA 3A74A 3AFQA 1CUKA 4JI6L 4GLXA 5FLMH 5ELNA 3U50C 1IBLL 2AWNA 3PF5A 2NVQH 1KQSA 1HNWQ 3PO2H 1Q8KA 1FGUA 2UU9L 1QVFA 4ME3A 3PUXA 4JBJA 2ZM6Q 3UDGA 4OX9L 4QQBX 1LTLA 4HIKA 4LFBQ 1E1OA 3CAMA 1UE7A 2Y0SE 4DV3L 1NMGA 3FP9A 1VQEA 1XNQL 2IHFA 3PUWA 2BA0A 3PSIA 4L5QA 1IXRA 4O2DA 4UPAA 4NXNQ 4A3JH 4JI2L 1Q7YC 4YWKA 1N8RC 3RLNA 4DR7L 1HZCA 1FL0A 3U4ZA 1HNZQ 1OXSC 1OXXK 4GNXA 4JV5L 3RLFA 1PFSA 4X65L 2A1AA 3GTKH 3HOVG 3S1RH 2B29A 2OTLA 4A93G 1B70B 2A8VA 1QZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5K A;  3M3Y H;  4LF6 L;  2R92 H;  3SGI A;  4RG1 A;  1M1K C;  3D31 A;  3G4S A;  4X6A H;  1ASY A;  2KBN A;  2PMZ E;  4DUY L;  4LFA L;  5IYB G;  3D0F A;  4MZ9 A;  4JI6 Q;  2JA7 G;  5GQO A;  1HR0 L;  1P8L A;  4JI3 L;  4PZ6 A;  3FKI H;  3I55 A;  1N32 L;  3TRZ A;  2KCT A;  2XTI A;  2L15 A;  1J6Q A;  1E22 A;  3Q8D A;  3GO5 A;  4A3B H;  1K8G A;  4O0A A;  3W5O A;  4C3H H;  5M5Y H;  4KLK A;  5C44 G;  4DV3 Q;  1X6O A;  4GKK L;  3J81 c;  4HJ5 A;  4AH6 A;  4JI0 L;  2NVY H;  4P71 A;  4YHH L;  3E9H A;  1N36 L;  4LUZ A;  1V43 A;  1UE6 A;  2LSS A;  4QIW E;  2VQE L;  1X65 A;  1SN8 A;  4DPG A;  5IP7 G;  3F1Z A;  1AE3 A;  3HOX H;  4DV0 L;  1E3P A;  1BKB A;  3JC6 6;  5JEA J;  5JEA G;  1YHA A;  4X62 L;  4DV4 L;  1GD7 A;  5AJ3 L;  5LMU L;  1EFW A;  1PH4 A;  3TS2 A;  4JBW A;  1DGS A;  5FJ8 H;  3HOZ G;  1H95 A;  1VQ6 A;  4YCW A;  5IYC G;  2ID0 A;  3F8T A;  1Y1V G;  4LFA Q;  1VQF A;  4BY7 G;  5H1S E;  3GTL H;  1SMX A;  1S3O A;  5C4X G;  3HKZ E;  1MIU A;  2VL6 A;  2JA8 H;  4DKA C;  4BBS G;  1D8L A;  2I5M X;  2JA9 A;  3F2D A;  1QVG A;  1MJE A;  1YHQ A;  2QA4 A;  2E5L L;  1VS0 A;  4JBM A;  2UUB Q;  1G29 1;  3TS0 A;  5IYD H;  3OYY A;  4C3J H;  4GOP C;  4JG2 A;  3S1Q H;  4A3L G;  3K7A H;  4RMF A;  3RNU A;  1KXL A;  1U0L A;  3K7U C;  3HOU H;  4B3T L;  3CCS A;  2R7D A;  5M3M G;  2NVT H;  1V9P A;  2PQA B;  3PO3 H;  1L2F A;  2DUD A;  2R6G A;  3ER0 A;  4POG A;  3PF4 A;  2BH2 A;  2E2J H;  1Z9F A;  4JI5 Q;  3CF5 A;  1BVS A;  1FJG L;  4BBR G;  4A3I G;  2LXJ A;  4QJF A;  4XTC S;  1Y1W G;  4IFD I;  3UDI A;  4PG3 A;  1B7Y B;  4EQ5 A;  2UXB L;  3CCV A;  3S14 H;  4B3R L;  1R9T H;  3MEF A;  1PH8 A;  1EIY B;  4AQY L;  1IBM Q;  5C0X J;  3AFP A;  5C0X G;  4A3F H;  1HZA A;  4JI4 Q;  1HNW L;  2LXK A;  2R7F A;  3OTO Q;  1WOC A;  4A3G G;  2E5L Q;  1VQO A;  4R4I A;  1OXV A;  1YIJ A;  5DLQ E;  4LFB L;  1YNX A;  4GN3 B;  2Q2T A;  4OWW B;  1JJC B;  1JJG A;  1PYS B;  4GN5 A;  2IX1 A;  4DAY B;  4YCU A;  4NB3 A;  3J80 i;  1I50 H;  4UP7 A;  1GM5 A;  5GAD C;  3HOY G;  3NEM A;  1YIT A;  4C2M H;  2B63 G;  3I4M G;  4A93 H;  4KI0 A;  3M4P A;  5LMN Q;  1PA6 A;  2JA6 G;  3J7A 5;  2VNU D;  4LUO A;  2PNH A;  3CP0 A;  1HNZ L;  4IO9 A;  1VQ4 A;  1M90 C;  1KIX A;  3BJU A;  2C35 B;  3KYH C;  1RL2 A;  2E2I H;  4R4O A;  3H15 A;  2JA7 H;  4DR3 Q;  1XNR Q;  2Y0S G;  2YYZ A;  4B3S L;  3S1M H;  4JI1 Q;  1NJI C;  4GNX C;  3GTP H;  3HKS A;  1C7Y A;  2HQL A;  4TQU S;  1YJ9 A;  1NE3 A;  3TEH B;  2MFI A;  4B3R Q;  4JC0 A;  1PH5 A;  4IPD A;  2V1C C;  2UXC L;  1XPR A;  1I6H H;  4A3E G;  4AQY Q;  2ALY B;  2VS1 A;  1A63 A;  3K0X A;  4UY8 C;  4DR2 Q;  3RLO A;  1YZ6 A;  1Q12 A;  1IL2 A;  3PIO A;  2WB1 E;  1KC8 C;  1PH3 A;  2R7Z H;  1C0A A;  1VQ8 A;  3PGZ A;  5C0X I;  4DR1 Q;  1UE1 A;  1UEB A;  2YV5 A;  2K14 A;  2ZTC A;  3ULL A;  4Y7N H;  4DV7 Q;  4BXX G;  4DV6 Q;  2K5V A;  1WYD A;  1VQC A;  2NVX H;  4EX5 A;  3T1Y L;  1Y14 B;  2WFW A;  3MXN B;  4A3K G;  2YTX A;  1V1Q A;  3F2B A;  1WJJ A;  3G71 A;  3CCJ A;  1CKO A;  5M3F G;  4Y52 H;  2NN6 I;  4DV1 Q;  1K83 H;  3H0G G;  3M9B A;  4K0K L;  3TRE A;  1YI2 A;  2IX0 A;  1Y1V H;  1L1O A;  3S1N H;  2EIF A;  4GN4 B;  4MTN A;  2N49 A;  3EN2 A;  4BY7 H;  4OWT B;  3UE1 A;  1JJ2 A;  2K5H A;  4B3S Q;  1QVC A;  3L0O A;  1JT8 A;  4BBS H;  2KEN A;  4DV5 Q;  5IE8 A;  3KOJ A;  1Q46 A;  1OXU A;  4DK6 C;  3UE0 A;  4GLA C;  3PUV A;  1TWG H;  2UXC Q;  2ATW A;  1VQM A;  2RF4 A;  4JOI A;  1OXT A;  2N78 A;  4GNX B;  3UDX A;  5K36 G;  2Q2I A;  3PCO B;  4LF4 Q;  1CSP A;  4DV2 Q;  4JYA L;  2VW9 A;  2K50 A;  3CXC A;  1XMQ Q;  1HR0 W;  4A3C H;  2UXD Q;  2I5H A;  2UUB L;  4QL5 A;  3JAM i;  4PZ7 A;  3CPW A;  1CKN A;  2BA1 A;  5IWA Q;  1SRU A;  2OQ0 A;  1MJC A;  2N3S A;  2HHH Q;  3T1Y Q;  3T1H L;  4NXM L;  4IJL A;  3GTM H;  1KAW A;  5C3E H;  2PI2 A;  3HKZ G;  2JA5 H;  4BBR H;  5C4J H;  1YJW A;  5FLX c;  4OWX B;  4L5S A;  4AIM A;  1NY4 A;  4K0K Q;  1J5E Q;  2MO0 A;  3CC4 A;  4LWC A;  2IT1 A;  4X64 Q;  4IFD J;  2VUM G;  1VQA A;  4IFD G;  3S16 H;  1I5F A;  4JI5 L;  2ASB A;  3ICE A;  3PV0 A;  1LYL A;  4A3M G;  3A5Z B;  4A3D H;  2OQK A;  2MO1 A;  1TXY A;  2NZO A;  3HOW H;  1X3G A;  4LUV A;  1TWC H;  3KF8 B;  1EQQ A;  2IHE A;  3CC7 A;  1K8A C;  5FLM G;  1IBM L;  4JI4 L;  4HIM A;  4HIO A;  4JYA Q;  3HOY H;  3ZJY C;  3OTO L;  1S72 A;  1Q1E A;  3EBE A;  1TWH H;  2PI2 E;  3KDF A;  4DR6 Q;  2BH8 A;  4LF9 L;  4A3J G;  3T1H Q;  4NXM Q;  4DR5 Q;  5GAE C;  2JE6 I;  3M85 A;  1YHB A;  3W1B A;  3ULP A;  4L5T A;  1L0W A;  4L5R C;  5LMN L;  1SFO H;  4JI8 Q;  1NMF A;  2K75 A;  1N34 Q;  1W3S A;  5BR8 Q;  3CCR A;  4QGU A;  1N33 Q;  2I5L X;  2Z6K A;  2GN5 A;  4LNQ A;  2JJQ A;  5GAH C;  4R4C A;  3J80 c;  4DR3 L;  4GS3 A;  1XNR L;  1VQ7 A;  1BBW A;  1Q1B A;  4JI1 L;  2YTV A;  1C9O A;  1VQL A;  3K81 C;  4DV4 Q;  4R4T A;  4LF7 Q;  3KF6 A;  4HJA A;  1SRO A;  3U58 A;  1XPU A;  2CCZ A;  4BXX H;  3CD6 A;  2ES2 A;  4DR2 L;  2F52 A;  2OTJ A;  2F4V L;  3M4Q A;  2Q2U A;  2NZH A;  3J7Z C;  3I4N G;  2CWA A;  4DR1 L;  1VQ9 A;  2JQO A;  3WWV A;  3KF6 B;  1VQG A;  1KRT A;  2DGY A;  4DV6 L;  4DV7 L;  4LF9 Q;  4DR4 Q;  1PVO A;  4QY7 A;  2NN6 G;  2AMC B;  4WJ4 A;  3AEV A;  1IBK Q;  4R4Q A;  1VQN A;  4P75 A;  3HOV H;  3M4O H;  4B3M Q;  3ERS X;  5JJK A;  1WI5 A;  4LFC Q;  1HJP A;  3I4O A;  3HOX G;  4DV1 L;  3AQQ A;  1I94 Q;  2WB1 G;  3GTO H;  3S24 A;  3CCU A;  2KCM A;  2ZJQ A;  4AYB E;  1BBU A;  5HGQ A;  2VY3 A;  3CCM A;  1SLJ A;  5M5W H;  5IYB H;  3GTQ H;  1W2B A;  1PH9 A;  4BY1 G;  3CME A;  4GOP A;  3OW2 A;  1P16 A;  1QUQ A;  1GKH A;  1PHJ A;  1NTG A;  3B6Y A;  3NEN A;  3GDE A;  4DV5 L;  1XMO Q;  1Q81 C;  1HNX Q;  1HZ9 A;  4GLV B;  3CMA A;  1IYJ B;  3RZD H;  2JEA I;  4KHZ A;  4DAM A;  5E7N A;  5C44 H;  2Q2H A;  2OWO A;  1JE5 A;  1EUJ A;  4LF4 L;  3I2Z A;  2R93 G;  4DV2 L;  2F4V Q;  4YY3 Q;  2AKW B;  2B3G A;  1XMQ L;  2UXD L;  4IOA A;  3S2H H;  1CKM A;  1VQB A;  2JEB I;  4OON A;  5IP7 H;  5IWA L;  4UP8 A;  2VQF L;  1MKH A;  1T9H A;  5JJI A;  4HJ8 A;  2HHH L;  4IPC A;  3M7N A;  4A75 A;  2VUM H;  5JJL A;  2E8G A;  3PO3 G;  1EOV A;  5GAG C;  3HOZ H;  3CCQ A;  4IJH A;  3L7Z C;  3LGJ A;  5IYC H;  3A5U A;  4WJ3 M;  1J5E L;  4HID A;  3ULJ A;  1K73 C;  2CQO A;  1PYB A;  4X64 L;  4DUZ Q;  4JCV E;  1HH2 P;  5C4X H;  3RZO H;  1E7Z A;  1TWF H;  3GTG H;  3FHW A;  4DK3 C;  2GVB A;  2WAQ E;  2UUC Q;  3CQZ H;  2UUA Q;  1L1O B;  4A3F G;  2XGT A;  3VDY A;  1YBY A;  2ZTE A;  3KJO A;  4A3L H;  4HJ7 A;  4OO1 G;  4TVA B;  1A8V A;  1SR3 A;  3RR5 A;  2RHQ B;  1XJV A;  4UP9 A;  1I3Q H;  3HFZ B;  5M3M H;  1Q86 C;  3KJP A;  1VQH A;  3E0E A;  4DR6 L;  2YTY A;  4OXP A;  2VQF Q;  3S17 H;  1X3E A;  2K5N A;  1GVP A;  4LF5 Q;  4DR5 L;  1YVC A;  4KHP Q;  1N9W A;  4A3I H;  3TQY A;  1PH1 A;  4LF8 Q;  4GKJ Q;  4APV A;  1Y1W H;  4JI7 Q;  4JI8 L;  2AWO A;  1PH6 A;  1K3R A;  1WCM G;  1CKN B;  1X3F A;  3CPF A;  1N34 L;  5BR8 L;  5IP9 G;  1N33 L;  3PUY A;  5M5X H;  1EIF A;  4HJ9 A;  1IBL Q;  4DNI A;  2QGQ A;  3W1G A;  2UU9 Q;  3GTJ H;  2Z6K C;  4OX9 Q;  4A3G H;  1X9N A;  1D7Q A;  2AHO B;  1VQ5 A;  3NEL A;  1OTC A;  4LF7 L;  3I4N H;  3F2C A;  1K0R A;  2CFM A;  1XNQ Q;  3K8A A;  3PO2 G;  1YEZ A;  1HZB A;  1WFQ A;  1EQR A;  2CWP A;  4PMW A;  2R7Z G;  1X55 A;  3G48 A;  4JI2 Q;  3I4M H;  3H3V I;  2B63 H;  4IPH A;  4DR7 Q;  1PV4 A;  1ASZ A;  4OO1 I;  3UDF A;  2JA6 H;  3G6E A;  1LUZ A;  2ZTD A;  5HY6 A;  3STB C;  1PH2 A;  1EYG A;  2JK8 A;  2GVA A;  4X66 L;  4DR4 L;  4P72 A;  4JV5 Q;  4X65 Q;  1AH9 A;  3K80 C;  3I56 A;  3BU2 A;  1VQK A;  3CC2 A;  1IBK L;  1IZ6 A;  4B3M L;  4BY1 H;  4LF6 Q;  1KRS A;  5GRO A;  1E1T A;  4LFC L;  5EAY A;  4YCV A;  3CW2 C;  3EIV A;  1KL9 A;  2OCE A;  3KLW A;  2HIV A;  2K52 A;  4DUY Q;  4XIG S;  1I94 L;  2D0P A;  3KDF B;  3AYH B;  3J81 i;  3BZK A;  1HR0 Q;  4A76 A;  1O7I A;  2D62 A;  1CSQ A;  2WP8 J;  5LMN W;  3GD7 A;  2A19 A;  2Z0S A;  4A3E H;  1E24 A;  1TWA H;  4JI3 Q;  2R92 G;  1N32 Q;  1QZG A;  2MNA A;  2PQA A;  1JMC A;  2R93 H;  1XMO L;  1HNX L;  1A0I A;  2N8N A;  4MNO A;  1G6P A;  1RIP A;  3CCL A;  2I0Q A;  2RCN A;  3KFU A;  1S40 A;  2E2H H;  4GKK Q;  1VQP A;  3FKI G;  1UWV A;  2HIX A;  4IPG A;  4YWL A;  5IT9 c;  3L2P A;  4JI0 Q;  3S2D H;  3PIP A;  3U4V A;  4AYB G;  4FDB A;  4YHH Q;  3DLL A;  2CKZ B;  1N36 Q;  4A3B G;  4A3C G;  1VQD A;  4YY3 L;  2ZJP A;  4A3K H;  2VQE Q;  1UE5 A;  2K4K A;  5M3F H;  2MQH A;  4X66 Q;  2H5X A;  3H0G H;  4YWM A;  4PZ8 A;  4DV0 Q;  1PH7 A;  2VZA A;  4X62 Q;  5C3E G;  1NBW A;  5AJ3 Q;  3BZC A;  2EQS A;  4POF A;  5LMU Q;  2EXD A;  2JA5 G;  1G51 A;  2RHS B;  3IRB A;  3RN2 A;  3CCE A;  3DM3 A;  3E9I A;  4P73 A;  4R1J A;  4JBK A;  1VQJ A;  4LW1 A;  1K9M C;  4DUZ L;  4A3D G;  2F3I A;  5FJ8 G;  3J81 j;  3H3V H;  1JB7 A;  2IY5 B;  1SE8 A;  2YU9 H;  2FXQ A;  1L1O C;  1VCI A;  5ELO A;  3HOW G;  2HT1 A;  3S15 H;  1X54 A;  4A4I A;  2ZM6 L;  2KHJ A;  1FVI A;  1GO3 E;  2UUC L;  4BA2 I;  3I7F A;  2UUA L;  2JA8 G;  3RN5 A;  1KD1 C;  4C3I H;  1X56 A;  4NXN L;  4B3T Q;  1B8A A;  4GOP B;  4JOI C;  1AE2 A;  1QUQ B;  4BA1 I;  5IYD G;  3A0J A;  2QEX A;  4J15 A;  4ALP A;  1VQI A;  1A62 A;  1Q82 C;  1WCM H;  2WAQ G;  3HOU G;  1FJG Q;  1XTD A;  3PUZ A;  4LF5 L;  3NBH B;  5IP9 H;  1KHI A;  4H02 A;  3STB D;  1LM0 A;  1YJN A;  4NPS A;  2D0O A;  4KHP L;  4A3M H;  2KHI A;  4IOC A;  1EWI A;  2ZJR A;  1XPO A;  4LF8 L;  1Z47 A;  4GKJ L;  2UXB Q;  4JI7 L;  4P74 A;  5IY0 A;  3JAM c;  5J3B A;  3A74 A;  3AFQ A;  1CUK A;  4JI6 L;  4GLX A;  5FLM H;  5ELN A;  3U50 C;  1IBL L;  2AWN A;  3PF5 A;  2NVQ H;  1KQS A;  1HNW Q;  3PO2 H;  1Q8K A;  1FGU A;  2UU9 L;  1QVF A;  4ME3 A;  3PUX A;  4JBJ A;  2ZM6 Q;  3UDG A;  4OX9 L;  4QQB X;  1LTL A;  4HIK A;  4LFB Q;  1E1O A;  3CAM A;  1UE7 A;  2Y0S E;  4DV3 L;  1NMG A;  3FP9 A;  1VQE A;  1XNQ L;  2IHF A;  3PUW A;  2BA0 A;  3PSI A;  4L5Q A;  1IXR A;  4O2D A;  4UPA A;  4NXN Q;  4A3J H;  4JI2 L;  1Q7Y C;  4YWK A;  1N8R C;  3RLN A;  4DR7 L;  1HZC A;  1FL0 A;  3U4Z A;  1HNZ Q;  1OXS C;  1OXX K;  4GNX A;  4JV5 L;  3RLF A;  1PFS A;  4X65 L;  2A1A A;  3GTK H;  3HOV G;  3S1R H;  2B29 A;  2OTL A;  4A93 G;  1B70 B;  2A8V A;  1QZH A; 
#chains in the Genus database with same CATH topology
 4KKU A;  4LF6 L;  2B2T A;  3SGI A;  4RG1 A;  1M1K C;  3KLR A;  1ENC A;  4LFA L;  2EYM A;  4N9T A;  1E22 A;  1WTH A;  3C1F A;  3GO5 A;  2IWH A;  4ZQ3 A;  5C44 G;  2NZ1 D;  4X3T A;  4H7B A;  4DV3 Q;  3J81 c;  4GKK L;  1I6H B;  1SMY C;  2F0K A;  4P71 A;  1NR4 A;  1SYG A;  4ID6 A;  3E9H A;  1CA6 A;  4Y7N B;  3VYT A;  2TMP A;  3HOX H;  2K05 A;  5JEA G;  1G2S A;  1PZI D;  1HTP A;  5JOB A;  1PH4 A;  3HOZ G;  1VQ6 A;  3SVM A;  2ID0 A;  1VQF A;  4QCL A;  1PTO H;  1Y1V B;  5C4X G;  2F0W A;  2JA8 H;  2VL6 A;  1DZ1 A;  1D2B A;  1MJE A;  3RZO B;  1TWF B;  2E5L L;  1G29 1;  5DM6 3;  4C3J H;  1VF7 A;  5C3X A;  3RNU A;  1KXL A;  1FNW A;  3HOU H;  1RCV D;  2NB0 A;  1B9N A;  5JPN C;  3CCS A;  1EU4 A;  4U68 A;  2PQA B;  4E6I A;  4B08 A;  4OHJ A;  2X6G A;  2Z4I A;  3UI2 A;  4DN4 M;  1L2F A;  5M3M B;  3PO3 H;  4R8N A;  2R6G A;  3ER0 A;  1PFN A;  2BH2 A;  1Z9F A;  1AP0 A;  4JI5 Q;  2MPM A;  5CC4 A;  4A3I B;  1Y1W G;  4JVZ A;  3A8J E;  3E6Z X;  1ML0 D;  4NP5 A;  4A3F H;  5C0X G;  5KIX A;  3OTO Q;  2DNE A;  2LFN A;  2EPB A;  3CHB D;  4A3G B;  1YNX A;  4FYD A;  1FR3 A;  3J80 i;  1BO0 A;  4UP7 A;  3A55 A;  3I4M G;  1TT2 A;  1AEX A;  3TDQ A;  4C2M H;  2B63 G;  3NWS A;  3M4P A;  2JA6 G;  4XYQ A;  1HNZ L;  1UNS A;  3D6W A;  5G3L D;  1VQ4 A;  1JOO A;  2WKD A;  3S1M H;  1NJI C;  3GTP H;  2Y0S B;  1RD9 D;  2OXP A;  4JC0 A;  3ND9 A;  1XPR A;  2LMC B;  1ZXT A;  3MXN A;  1E0B A;  1KC8 C;  1KNA A;  2KED A;  4TSS A;  2I07 B;  3PGZ A;  2F0M A;  1UE1 A;  4DR1 Q;  2YV5 A;  3BVZ A;  3DWA A;  4BXX G;  3P7J A;  2K5V A;  1F9R A;  1BXT A;  2LS0 1;  2NVX H;  4EX5 A;  1Y14 B;  2PMZ B;  1V1Q A;  3VYR A;  4X3U A;  5HGT A;  3TRE A;  3S1N H;  2EIF A;  3FRP B;  1K28 A;  1PMR A;  4BY7 H;  1CTM A;  3UE1 A;  3NTH A;  1L0Y B;  1XWE A;  5KRU A;  2K5H A;  2KEN A;  4C1N I;  3FVQ A;  1OXU A;  1ROD A;  2UXC Q;  2ATW A;  2N78 A;  3UDX A;  4KHV A;  5I6W A;  5ISR A;  2YU9 B;  1SYF A;  3U9O A;  4DV2 Q;  4JYA L;  3CXC A;  1SXT A;  2H1E A;  1HR0 W;  2UXD Q;  4PZ7 A;  4XQJ A;  1MJC A;  2N3S A;  2FJ2 A;  2HHH Q;  4NXM L;  1PRT F;  1RKN A;  2Q8I B;  5FLX c;  1KLU D;  4RH6 A;  4R9W A;  4K0K Q;  1QJO A;  4CDF C;  3QB3 A;  4X64 Q;  3EQL C;  1GJX A;  2EY6 A;  1RF2 D;  4IFD G;  1VQA A;  3S16 H;  4JI5 L;  3NHH A;  2VUM B;  3DEO A;  2MO1 A;  4A3M B;  2RDH A;  2K5D A;  2F0J A;  2Z4H A;  5FO7 B;  3K58 A;  1ET6 A;  2IHE A;  2TSS A;  3NE5 B;  5CBA E;  4HIM A;  1XXG A;  3HOY H;  3OTO L;  1Q1E A;  3J7A V;  3G6J B;  1RDP D;  3EBE A;  1TWH H;  2PI2 E;  3KDF A;  4A3J G;  1CM9 A;  1XX8 A;  3R2I A;  3ULP A;  1SDF A;  4F7X A;  2X6L A;  5JVG 3;  3P75 A;  4JI8 Q;  4I7A A;  5JAV A;  1W3S A;  3CCR A;  1RJT A;  4QGU A;  4HAE A;  1C4Q A;  2Z6K A;  3GTK B;  2JJQ A;  4EQO A;  2E2D C;  3J81 E;  1WVL A;  3SHL A;  1C9O A;  1VQL A;  1DXM A;  4LF7 Q;  3KF6 A;  1KDA A;  1HRJ A;  3J81 L;  1E2V A;  3N6R A;  1XPU A;  5C3W A;  3CD6 A;  5M5X B;  2F52 A;  4CKE A;  2F0Q A;  4FXK C;  3J7Z C;  3I4N G;  4DR1 L;  4DR4 Q;  4HSV A;  4X3S A;  4TRD A;  1PTO F;  2NN6 G;  2B39 A;  3AEV A;  4R4Q A;  2WII B;  1EYC A;  3M4O H;  4S3S A;  1JIC A;  2IW3 A;  4LFC Q;  3K5O A;  3I4O A;  1GUO A;  3AQQ A;  3CCU A;  2KCM A;  3X3N A;  2ZJQ A;  3HOX B;  1B50 A;  1JCK B;  2RCF A;  3D3R A;  1W2B A;  1H9S A;  1O7Y A;  3MFG A;  4IUN A;  5K36 H;  1FYC A;  1STG A;  2FMM A;  3B6Y A;  3GDE A;  1VF5 C;  1HNX Q;  3H3V C;  1SE2 A;  2JEA I;  4CBV A;  1D5X C;  1SBB B;  5C44 H;  2Q2H A;  2JA8 B;  2SEB D;  4DV2 L;  2F4V Q;  4YY3 Q;  3V05 A;  2B3G A;  2R93 B;  2HDL A;  1FNU A;  4IOA A;  2UXD L;  3MA2 B;  4C3J B;  5T1I A;  2HHH L;  2K7V A;  5AFW A;  3HOU B;  1EOV A;  3SK5 A;  5GAG C;  3HOZ H;  3L7Z C;  3LGJ A;  3PO3 B;  1STH A;  3MVV A;  3GQB A;  4X64 L;  4JCV E;  1HH2 P;  5C4X H;  4FO2 A;  1B1Z A;  1GUG A;  3PIO 3;  3FHW A;  1LTB D;  3QIA A;  2WAQ E;  2L12 A;  3K5M A;  3CQZ H;  2UUA Q;  2XGT A;  4F87 A;  1YBY A;  2ZTE A;  4A3F B;  1SSO A;  5IOC A;  1LT6 D;  1I3Q H;  4UP9 A;  3S15 B;  2VB2 X;  1I4P A;  4WJW A;  3OOC A;  1EWH A;  3E0E A;  2SDF A;  2YTY A;  4EQP A;  2B2W C;  2K5N A;  4LF5 Q;  2ENB A;  4DAV A;  3U9S A;  4C2M B;  4KY6 A;  4CDD C;  2F3V A;  1F2L A;  4APV A;  1Y1W H;  4JI8 L;  1YNJ D;  1PH6 A;  1IBL Q;  1U4P A;  1EIH A;  1HA6 A;  1HQR D;  2UU9 Q;  2RSN A;  1X9N A;  4LF7 L;  1A6X A;  4U67 3;  2CFM A;  1TS2 A;  3C3L A;  4JI2 Q;  3I4M H;  1LTT D;  2B63 H;  4CJ2 C;  4DR7 Q;  4ZLT F;  1PV4 A;  3TZU A;  2JA6 H;  1PH2 A;  4DXF A;  4DR4 L;  4JV5 Q;  1R4P B;  1Q8I A;  4NDX A;  2NVX B;  1IZ6 A;  4PQX A;  1O7L A;  2A5H A;  1KRS A;  4LFC L;  4XT3 B;  2OCE A;  3VR4 A;  2D0P A;  3KDF B;  3S1N B;  3BZK A;  1HR0 Q;  4K14 A;  3VYS A;  1CSQ A;  2WP8 J;  5LMN W;  3Q24 A;  4JI3 Q;  4I65 A;  1HNX L;  1G6P A;  2C9O A;  3IFD A;  1BR9 A;  1EYD A;  5D65 A;  1PRT D;  5FLX E;  2E2H H;  1UWV A;  2NWG A;  5IT9 c;  4JI0 Q;  2K32 A;  3U4V A;  2EY1 A;  5FLX L;  4YY3 L;  1TS4 A;  1KAB A;  3SK4 A;  1UE5 A;  3I3C A;  2MQH A;  3QOL A;  2H5X A;  1IW7 D;  4PZ8 A;  1PH7 A;  1EY8 A;  2VZA A;  5AJ3 Q;  3BZC A;  1Y8P B;  2KHS A;  1MGS A;  2NVY B;  1CHQ D;  1YNJ C;  3CCE A;  5D3I B;  3RN2 A;  1RHP A;  3DWQ A;  3CRK C;  3TBI B;  1G6Z A;  3HG9 A;  4JBK A;  5IOD A;  4LW1 A;  1K9M C;  3H3V H;  3S16 B;  2IY5 B;  2PQE A;  4OO1 H;  5EKK A;  1AN8 A;  2XWJ B;  4KJN A;  4A4I A;  1EY0 A;  5EPK A;  1F2Y A;  3I7F A;  2UUA L;  2JA8 G;  1H9S B;  4JOI C;  4BA1 I;  4C3J G;  3TP7 A;  4J15 A;  2J0T D;  2EJF C;  1VQI A;  3W3A A;  1WCM H;  2WAQ G;  4K6L A;  3HOU G;  1XTD A;  4LF5 L;  1KHI A;  2DJG C;  1LM0 A;  4NPS A;  4IUV A;  2QEJ C;  2NVT B;  2X69 A;  2ZJR A;  2UXB Q;  4JI6 L;  1IBL L;  1G8Z D;  3PO2 H;  5K5P A;  1FGU A;  2UU9 L;  4BWG B;  4ME3 A;  5CV4 A;  1TY2 A;  3UDG A;  1NCV A;  2EJG C;  4QQB X;  1I4R A;  1PTO D;  1IYV A;  3PUW A;  4B9X A;  4L5Q A;  4A3J H;  4BS9 A;  4JI2 L;  1IW7 C;  4DR7 L;  2V4D A;  3U4Z A;  2J4X A;  3C46 A;  1HFG A;  4GNX A;  4JV5 L;  3HOV G;  2OTL A;  1AZQ A;  2EY2 A;  5KND A;  3M4O B;  1TR5 A;  2SOB A;  4X6A H;  2KBN A;  1A2U A;  1WD1 A;  3D0F A;  5GQO A;  3LWU A;  4HCE A;  1HR0 L;  4JI3 L;  2SNM A;  3FKI H;  4QIW B;  3TRZ A;  2RBM A;  2L15 A;  1J6Q A;  2XN9 C;  1K8G A;  1G2T A;  2D5D A;  5M5Y H;  4KLK A;  2XSC A;  5C44 B;  4HJ5 A;  4JI0 L;  5A2Q E;  1JE4 A;  1ILP A;  1U4L A;  3HKZ B;  4QIW E;  1X65 A;  3KF8 A;  2MJ8 A;  3F1Z A;  3JAM L;  1E3P A;  5EBD A;  1EFW A;  1GD7 A;  5AJ3 L;  4JBW A;  5IGC A;  3PQI A;  4V19 0;  4YCW A;  5IYC G;  3F8T A;  4TKO B;  3HOZ B;  5HUR A;  4LFA Q;  4BY7 G;  5H1S E;  3MXU A;  1ICF B;  3T16 A;  3HKZ E;  2M2L A;  3NTI A;  4DKA C;  3RD4 A;  5C4X B;  2JA9 A;  3QJY A;  3F2D A;  1PTO C;  1YHQ A;  1J9O A;  2B2W A;  5EQ0 A;  3SDZ A;  4A3L G;  3CQZ B;  4P2C B;  4HED A;  4CHT B;  4H0L C;  1DOM A;  1U0L A;  3K7U C;  1XYI A;  3V96 A;  1GUN A;  1EEI D;  4ULL A;  2XRS D;  4MIU A;  4XTC S;  4IFD I;  3D8G A;  4KKS A;  3UDI A;  2UXB L;  2Q8T A;  3CCV A;  1Y1W B;  1PH8 A;  3I72 A;  1IBM Q;  4JI4 Q;  3PIP 3;  1EY7 A;  2NTS A;  1LTR D;  2R7F A;  1IL8 A;  1WOC A;  2E5L Q;  4R8I A;  1VQO A;  1SYD A;  1BUV T;  1D5M C;  1YIJ A;  4GN3 B;  4HN7 A;  2N55 A;  2DY8 A;  4GN5 A;  5DM7 3;  3T51 B;  1CI3 M;  1GM5 A;  3URY A;  3HOY G;  5GAD C;  4G57 A;  1H9K A;  1SNP A;  2CH4 A;  5LMN Q;  3J7A 5;  3I4M B;  4J1M A;  2B63 B;  4IUR A;  3V2T A;  2JA6 B;  1SND A;  2WB1 B;  4G7O C;  3H15 A;  2JA7 H;  4DR3 Q;  4B3S L;  1LO5 D;  5IT9 E;  3HKS A;  1C7Y A;  1V1P A;  2F0F A;  4HR7 B;  1STE A;  1I6V C;  1PH5 A;  4A3E G;  5IT9 L;  1A63 A;  3K0X A;  1BCP F;  2B8F A;  1IL2 A;  2WB1 E;  1PH3 A;  1C0A A;  1U4R A;  4XYO A;  4L6T B;  1VQ8 A;  2EJM A;  2K14 A;  3ULL A;  1LAB A;  1RTN A;  4DV6 Q;  2E2H B;  2F03 A;  1VQC A;  5EPL A;  1STN A;  4A3K G;  1WJJ A;  2NYZ D;  4ZYS A;  1NUC A;  2NN6 I;  3M9B A;  3QR8 A;  1EYA A;  2IX0 A;  4F8M A;  1JJ2 A;  1QVC A;  3L0O A;  4BBS H;  3KOJ A;  1KNE A;  2G5D A;  1K8O A;  1VQM A;  2AUK A;  4JOI A;  4GNX B;  5K36 G;  5M5W B;  2Q2I A;  5E1F A;  2VW9 A;  5L37 A;  3X3M A;  2F0O A;  2NBF A;  5D14 A;  5IIF A;  4QL5 A;  3CPW A;  5IWA Q;  2QDL A;  3T1H L;  2KVM A;  2PI2 A;  3HKZ G;  4KTA A;  4BBR H;  5ELD A;  4L5S A;  4PV1 C;  3LX0 A;  2MO0 A;  4G4K A;  2K5Q A;  4RGO S;  1LYL A;  3E3X A;  3A5Z B;  5CGK A;  2OQK A;  2RDF A;  3C1E A;  2PPB C;  4LUV A;  2F3W A;  1TWC H;  3KF8 B;  2G9H D;  2IPK D;  3CC7 A;  3T56 B;  1SJH D;  5T1G A;  1EIG A;  5ELC A;  3SE0 A;  1IBM L;  4JI4 L;  4CKC A;  2Z6B A;  1Z6H A;  1FNV A;  4HIO A;  4JYA Q;  3ZJY C;  1ZKO A;  5ELE A;  1CZG A;  3PO2 B;  2BH8 A;  4LF9 L;  1EY6 A;  2LKV A;  4NXM Q;  1YHB A;  4A3J B;  5LMN L;  1NMF A;  1UEA B;  2ICE C;  1N34 Q;  4I7Z C;  2GN5 A;  3J80 c;  4DR3 L;  1BBW A;  2EVB A;  3K81 C;  2Z1C A;  4QUC A;  4RGT A;  4NMZ A;  4RFB A;  1TQO A;  3FKI B;  1MSH A;  3NSW A;  2OTJ A;  2Q2U A;  1W6J A;  5ELB A;  4EQN A;  2JQO A;  5M5Y B;  5C5M A;  3I4N B;  2DGY A;  4DV6 L;  2ZT9 C;  2K33 A;  4HCS A;  3IAY A;  2R3Z A;  2AMC B;  1IBK Q;  1VQN A;  3HOV H;  1TKW B;  3DEP A;  3CRL C;  1KTK A;  2XNA C;  1I94 Q;  2WB1 G;  5DAU A;  1K3B C;  4AYB E;  2VY3 A;  3GTQ H;  2B8G A;  1PH9 A;  1I4H A;  3CME A;  3OW2 A;  2RKS A;  1XMO Q;  2QW7 A;  1X32 A;  3C2P A;  2BDO A;  1IYJ B;  3CMA A;  3RZD H;  2P5Z X;  4KHZ A;  4DAM A;  2KA7 A;  3IL8 A;  4KKT A;  1U4M A;  1JE5 A;  2QDB A;  1E2W A;  5EKI A;  1V1P B;  1IKM A;  5IWA L;  3AMU A;  2VQF L;  4RGN A;  4DFA A;  4A75 A;  3M4Y A;  4CDC C;  4IJH A;  5IYC H;  4QMG A;  1K73 C;  5CV7 A;  1PYB A;  3DWP A;  4XQQ A;  2RQX A;  4NW2 A;  3NUC A;  4KY5 A;  4DK3 C;  1WTO A;  3T4A C;  2ICI A;  1Q90 A;  3I91 A;  3VDY A;  4A3L H;  4OO1 G;  4TVA B;  3RR5 A;  2RHQ B;  1XJV A;  3HFZ B;  1PZJ D;  2GA4 B;  3DUZ A;  5CMD A;  3VA7 A;  1Q86 C;  4C1N K;  2KOL A;  4V0B A;  1A3U A;  2HD3 A;  2F0L A;  2QCP X;  4G7Z C;  1B44 D;  1NNX A;  3MAQ A;  4KHP Q;  1C48 A;  3TQY A;  2E74 C;  4GKJ Q;  4ABN A;  1BCP D;  1I4G A;  1WCM G;  1X3F A;  1N34 L;  3A7A B;  3GV3 A;  5FK9 C;  5C6A A;  2JA7 B;  2QGQ A;  1MSG A;  4UHV A;  4OX9 Q;  1D7Q A;  1JQY D;  1VQ5 A;  3MC0 B;  3F2C A;  3OIQ A;  1PRT B;  3PO2 G;  1WFQ A;  1EQR A;  1X55 A;  4FXG C;  1SE4 A;  3G6E A;  1II3 A;  4RHR A;  5LL6 X;  3STB C;  1EYG A;  4FF1 A;  2JK8 A;  4X66 L;  2A6E D;  4KN7 C;  3K80 C;  3BU2 A;  1IBK L;  1CT1 D;  4BY1 H;  1E1T A;  3CW2 C;  3EIV A;  1I94 L;  4DUY Q;  5JPM C;  4XIG S;  3AYH B;  5E4W C;  1O7I A;  4X3K A;  2D62 A;  1HHV A;  3GD7 A;  2A19 A;  4A3E H;  1E24 A;  1TWA H;  1PFB A;  1QZG A;  1PZK D;  4DGZ A;  4BBS B;  1XMO L;  1PYW D;  2N8N A;  4MNO A;  3CCL A;  1PDQ A;  1B9M A;  3FKI G;  4IPG A;  3S2D H;  3L2P A;  1EZ6 A;  4K5X A;  4AYB G;  4FDB A;  1N36 Q;  1NSN S;  4A3K H;  2HCC A;  2O5J C;  2F0S A;  4DV0 Q;  1T5E A;  4DV4 Q;  5C3E G;  5LMU Q;  2EQS A;  1ET9 A;  2EXD A;  2PNR C;  1BCP C;  1PLF A;  1TU2 B;  4LAA A;  4P73 A;  1VQJ A;  2EDG A;  3AU7 A;  1WTV A;  4DXG A;  1JB7 A;  5CYU A;  3QO2 A;  1FVI A;  1TWC B;  1PTO B;  1WTR A;  1ENA A;  1FD7 D;  4B3T Q;  1F9S A;  3ND8 A;  4H44 C;  1EEF D;  3A0J A;  2B2Y C;  3J80 E;  2A6E C;  3VR2 A;  2CW0 D;  1A62 A;  2F0H A;  3OW7 A;  4Q5V A;  1FJG Q;  3J80 L;  1ZYR D;  2WAQ B;  2D0O A;  3H6M A;  4XQN A;  4KHP L;  4EVO A;  3WOF A;  4GKJ L;  4P74 A;  5IY0 A;  3JAM c;  5J3B A;  1GOZ A;  3A74 A;  3BDL A;  1EL0 A;  3PF5 A;  1QVF A;  2C5C A;  3OMG A;  4FXD A;  3G7L A;  3PUX A;  4OX9 L;  2EXZ A;  1LTL A;  4LFB Q;  4N9P A;  1STY A;  3TSS A;  4IUQ A;  5IGG A;  1NMG A;  3FP9 A;  2F1M A;  2BA0 A;  3BZD B;  3PSI A;  4O2D A;  3VA5 A;  1DOK A;  2KCN A;  5ELF A;  4YWK A;  1N8R C;  3RLN A;  1FL0 A;  5KEE A;  4CJ0 B;  3HRZ C;  4JPB W;  3I4L A;  2A1A A;  3S1R H;  2QF7 A;  2A8V A;  3BVG A;  3HOV B;  2N88 A;  2F0P A;  2MUY A;  2B2V C;  3D31 A;  3G4S A;  1ASY A;  2A68 C;  4DUY L;  4MHE A;  4MZ9 A;  4JI6 Q;  2JA7 G;  1CQF A;  3GTQ B;  4PZ6 A;  2PW7 A;  1I4Q A;  4K8J A;  3S1M B;  2KCT A;  2XTI A;  1EU3 A;  1H9M A;  2VXW A;  3DMU A;  4KD3 A;  5KYI A;  1IHZ A;  3GTP B;  4A3B H;  3RZD B;  2F0T A;  1X6O A;  4AH6 A;  3A56 A;  1SJE D;  1HXY D;  1AZP A;  2CW0 C;  1N36 L;  4LUZ A;  3I8Z A;  5DEH A;  1CHP D;  3EJI A;  1SN8 A;  4DPG A;  4ZK9 B;  5IP7 G;  4RA8 A;  1SAP A;  1ZYR C;  4DV0 L;  5DNF A;  1BKB A;  3JC6 6;  4ILW A;  5JEA J;  4DV4 L;  3TS2 A;  5LMU L;  5CBE E;  1BBX C;  4FF3 A;  1DGS A;  1EQV A;  1EOT A;  4ZUJ A;  5BN5 A;  4ZKB B;  4ZUI A;  1BF4 A;  1SMX A;  1S3O A;  3GTL H;  4BY7 B;  2ZXP A;  1MIU A;  4BBS G;  2D9U A;  2I5M X;  3BDO A;  4K2K A;  4WRD A;  2EY5 A;  3TP8 A;  2AQ3 B;  2UUB Q;  3TS0 A;  3OYY A;  4JG2 A;  3S1Q H;  3K7A H;  4RMF A;  5F2D A;  3E5S A;  5I2Y A;  4B3T L;  1JOK A;  2WIN B;  3LWE A;  1V9P A;  1DM0 B;  2WKC A;  4K2L A;  2DUD A;  2E2J H;  4UAI A;  4HTH A;  5EKL A;  1WTQ A;  1BVS A;  1FJG L;  2MHV A;  4BBR G;  5BN4 A;  1EZ8 A;  1O78 A;  4QJF A;  1Y8N B;  3E0J A;  4EQ5 A;  4B3R L;  1R9T H;  3MEF A;  3OMC A;  1EIY B;  4AQY L;  1IKL A;  5C0X J;  4RKL A;  1HZA A;  2LXK A;  2OT2 A;  1OXV A;  4LFB L;  4OWW B;  2Q2T A;  2R61 A;  3MXP A;  1DD2 A;  3KBX A;  1I50 H;  2EOT A;  3GV6 A;  1YIT A;  5J39 A;  4KI0 A;  3HOY B;  2VNU D;  1DJR D;  2KUM A;  2PNH A;  3CP0 A;  1TWH B;  1KIX A;  1M90 C;  2E2I H;  1S4Z A;  2C35 B;  3BJU A;  3KYH C;  4R4O A;  2BDN A;  4HSP A;  4L63 B;  1XNR Q;  2YYZ A;  2L1B A;  1DOL A;  4BY1 B;  3QOJ A;  2V1C C;  4IPD A;  4KMU C;  2B2T C;  1I6H H;  2ALY B;  2RSO A;  4DR2 Q;  4K6D A;  3RLO A;  3VR5 A;  1TWA B;  4A3E B;  1Q12 A;  3GP7 A;  2FHT A;  5C0X I;  1UEB A;  2L11 A;  2ZTC A;  4Y7N H;  4DV7 Q;  5I9O A;  4OIJ A;  1AFP A;  1LT4 D;  3T1Y L;  3S2D B;  2WFW A;  4RCO A;  3F2B A;  5M3F G;  3G71 A;  3CCJ A;  5BN3 A;  4Y52 H;  4A3K B;  4DV1 Q;  1K83 H;  3H0G G;  1Y1V H;  1ILQ A;  4GN4 B;  3EN2 A;  1SNQ A;  4B3S Q;  1EY9 A;  5IE8 A;  3Q6S A;  1Q46 A;  4RAU C;  3UE0 A;  3PUV A;  1JWS D;  2M00 A;  2RF4 A;  2B2Y A;  3PCO B;  1SYE A;  5CV6 A;  2K50 A;  3HZX A;  2O5I C;  2UUB L;  2F0N A;  1CKN A;  2BA1 A;  3CU7 A;  4C3I G;  1LTS D;  1SRU A;  3K6O A;  1QNU A;  3NQI A;  3I90 A;  4IJL A;  3JAM E;  5C3E H;  1IYU A;  2OF1 A;  2XIW A;  3HS0 C;  3NQT A;  4OWX B;  3PMF A;  1NY4 A;  3ZYY X;  3OWE B;  1DCZ A;  1B53 A;  1SNC A;  4IFD J;  1HFN A;  2ASB A;  3ICE A;  3PV0 A;  1TXY A;  2NZO A;  5CV5 A;  3I70 A;  1X3G A;  5KGU A;  1K8A C;  4RWS C;  5FLM G;  1QNK A;  2F0I A;  1ONL A;  1SEB D;  3P1H A;  2EYL A;  1JOR A;  1FGB D;  1GXD C;  1A3T A;  1EQT A;  1GUT A;  5JVH 3;  5I6Y A;  2O2L D;  3T1H Q;  2B2V A;  4DR5 Q;  3M85 A;  3EA6 A;  3W1B A;  1L0W A;  1I3Q B;  4L5R C;  1LTA D;  2OEO A;  2K75 A;  3NK9 A;  1Q3L A;  3HGB A;  1N33 Q;  4LNQ A;  4KK7 A;  1K8M A;  1XNR L;  2HUG A;  1Q1B A;  3KBG A;  1Y69 U;  1EFI D;  1EY4 A;  2CCZ A;  2PW5 A;  1SNM A;  4DR2 L;  2Z8L A;  1S5D D;  3OWF A;  3M4Q A;  2NZH A;  4C3H G;  1CZW A;  5COR A;  4A3B B;  2CWA A;  3KLS A;  4KJO A;  4DV7 L;  1KRT A;  4LF9 Q;  1PVO A;  2KQ3 A;  2JSO A;  4EGV A;  2K6A A;  4QY7 A;  2AUJ D;  5JJK A;  4N8F A;  4P75 A;  1M8A A;  3ERS X;  3R8B A;  4B3M Q;  1WI5 A;  3BVM A;  1HJP A;  4IUT A;  4L8J A;  3VYU A;  1YNN D;  4QB4 A;  4DV1 L;  3GTO H;  1Z7T A;  3S24 A;  4M8A A;  1BBU A;  3CCM A;  1SLJ A;  3M7G A;  4BY1 G;  2VB3 X;  1P16 A;  4OEL B;  1PHJ A;  1NTG A;  1LTI D;  2CHB D;  1Q81 C;  1HZ9 A;  1D6E C;  1SYB A;  4GLV B;  4CKB A;  1TII D;  5E7N A;  3GTL B;  3OHX C;  2M9V A;  1EUJ A;  1MHW C;  1Y8O B;  3NXW A;  1B2T A;  2F0E A;  4B9W A;  1A2T A;  4ME5 A;  1JWU D;  3S2H H;  4IUU A;  1CKM A;  5M9O A;  3S1Q B;  3F2U A;  5IP7 H;  1HCZ A;  4UP8 A;  1LLR D;  1MKH A;  3K7A B;  5JJI A;  4HJ8 A;  2BE5 D;  4IPC A;  2VUM H;  3K0Y A;  3SR1 A;  3CCQ A;  3WOE A;  2EYJ A;  3T53 B;  4HID A;  2DNC A;  1BCP B;  2KEC A;  1KDB A;  5TSS A;  1E7Z A;  3Q0A A;  4IAL A;  3GTG H;  2L0C A;  2PZT A;  3LNN A;  2GVB A;  5FOB B;  1GUS A;  4Q0F A;  4HJ7 A;  3MHB A;  1A8V A;  2IJ0 A;  1NAP A;  3KJP A;  5I9P A;  4OEM B;  1S5F D;  2VQF Q;  4GZY C;  3S17 H;  2K01 A;  4DU9 A;  1YNN C;  1I50 B;  3K5L A;  2XWB B;  4DR5 L;  3H94 A;  1N9W A;  5CV9 A;  4JI7 Q;  1J8I A;  1K3R A;  1CKN B;  4IZ8 A;  2E2I B;  3BDC A;  1WCM B;  5M5X H;  1N33 L;  4HJ9 A;  4DNI A;  3R2T A;  1HQM C;  3J7A F;  1LT5 D;  3GTJ H;  3BYT B;  2QKI C;  2Z6K C;  5I4D A;  2AHO B;  3NEL A;  1G91 A;  3RUZ A;  4DNR B;  3K8A A;  4CGY B;  1HZB A;  2CWP A;  2L9H A;  2R7Z G;  1WTP A;  3G48 A;  3FDT A;  4H13 C;  4G7H C;  4IPH A;  3NPP A;  2PCF B;  2BE5 C;  2G9D A;  5HY6 A;  2NUC A;  4P72 A;  2HQE A;  4X65 Q;  3TP5 A;  3I56 A;  1VQK A;  4B3M L;  3N52 A;  5EAY A;  1KL9 A;  3KLW A;  1K83 B;  2HIV A;  1ESF A;  2LY7 A;  3J81 i;  4JW0 A;  2Z0S A;  1N32 Q;  2H4O A;  1TVX A;  3K59 A;  1JMC A;  3I73 A;  2R93 H;  1NR2 A;  5EBC A;  1RIP A;  2I0Q A;  2RCN A;  3KFU A;  1S40 A;  1KLG D;  2HIX A;  3K5N A;  1ENF A;  4YWL A;  1B3Q A;  1D5Z C;  1X3P A;  3D4D A;  1CK1 A;  3CKI B;  4YHH Q;  2CKZ B;  5JJZ A;  3DLL A;  4A3B G;  4A3C G;  1VQD A;  2JP1 A;  4LMQ D;  4AYB B;  2ZJP A;  2VQE Q;  3NBI A;  3DXJ C;  5M3F H;  1SE3 A;  4X66 Q;  4YWM A;  3H0G H;  2O4X A;  4X62 Q;  2JA5 G;  4K5W A;  4POF A;  1G51 A;  3IRB A;  5C3E B;  1OO9 B;  2D2C C;  4C56 C;  3DM3 A;  2RA4 A;  3E9I A;  3BS1 A;  5FKA C;  4DAY A;  4A3D G;  2F3I A;  1L1O C;  1VCI A;  3HOW G;  3S15 H;  1X54 A;  1O80 A;  5EPJ A;  2ZM6 L;  2F0U A;  3D6C A;  2KHJ A;  4RCN A;  4Z9C B;  4K8I A;  4BA2 I;  1KD1 C;  1EWC A;  3O13 A;  4C3I H;  4NXN L;  1AE2 A;  3A54 A;  2MP1 A;  3SK8 A;  4NKL A;  2QEX A;  1Q82 C;  3NBH B;  5IP9 H;  3STB D;  4H02 A;  1M4V A;  4FF4 A;  2K28 A;  4IOC A;  1CA5 A;  1PFM A;  2PZW A;  1Z47 A;  1XPO A;  1VMC A;  4JI7 L;  3AFQ A;  3W2D A;  5FLM H;  1TS3 A;  5ELN A;  2NVQ H;  1H9J A;  4FVM A;  1QOH A;  1KQS A;  1HNW Q;  1Q8K A;  4DF7 A;  4RKB A;  1HUM A;  1GHJ A;  3RMH A;  1UE7 A;  1CFM A;  2Y0S E;  4DV3 L;  3D4W A;  2FMC A;  2IHF A;  5CV8 A;  4IQZ A;  2RDG A;  4ZKC B;  2JYO A;  1Q7Y C;  1JOQ A;  1HZC A;  1OXX K;  4JK1 C;  4X65 L;  5KNC A;  4XDX A;  1SNO A;  1B70 B;  5KNB A;  1QZH A;  1U5K A;  3M3Y H;  2R92 H;  3HP3 A;  4CDE C;  2PMZ E;  3GTO B;  3KK7 A;  5IYB G;  1F9Q A;  1P8L A;  1BDO A;  3I55 A;  1N32 L;  2ZXO A;  2WAC A;  3Q8D A;  4KN4 C;  4O0A A;  1LTG D;  3W5O A;  4C3H H;  1F9P A;  4J6H A;  2NVY H;  2J7Z A;  1TY0 A;  1UUP A;  3ERQ A;  4YHH L;  1V43 A;  1UE6 A;  2LSS A;  5CR3 A;  1HA5 A;  2VQE L;  3S2H B;  1AE3 A;  1YHA A;  3H91 A;  4X62 L;  3MEH A;  1A15 A;  5FJ8 H;  1H95 A;  4N8X 1;  1Y1V G;  4UDU C;  1U9R A;  4CJ1 B;  1D8L A;  1H9R A;  3MZ5 A;  1QVG A;  3A8I E;  2QA4 A;  4OL7 A;  2MGS A;  1VS0 A;  1X3Q A;  4HMJ A;  2CVR A;  4JBM A;  3GTG B;  1O7Z A;  2PYK A;  2ZXR A;  5IYD H;  1V8Q A;  4GOP C;  2E76 C;  5EJW A;  1BOS A;  2R7D A;  5M3M G;  2NVT H;  3D4R A;  1CQV A;  1SYC A;  2AQ2 B;  4POG A;  3PF4 A;  4LK1 C;  3QWN A;  2QIL A;  3S17 B;  3CF5 A;  1ICW A;  1C8C A;  1T5X D;  4A3I G;  1QCB D;  3Q22 A;  2LXJ A;  2I46 A;  4BBR B;  3NTK A;  1DON A;  4PG3 A;  1B7Y B;  3S14 H;  5FO9 B;  3AFP A;  2A68 D;  2BOS A;  1JWM D;  1HNW L;  5I2X A;  4A3G G;  3GTJ B;  2EE1 A;  4R4I A;  5DLQ E;  4DA2 A;  1KAA A;  2DY7 A;  1JJC B;  1JJG A;  1PYS B;  2KCC A;  2IX1 A;  2AQ1 B;  4DAY B;  4YCU A;  4NB3 A;  3KLS X;  3NEM A;  4A93 H;  1PA6 A;  4LUO A;  3ONA B;  4IO9 A;  2F0G A;  1RL2 A;  3TP6 A;  4KD4 A;  2Y0S G;  4JI1 Q;  4GNX C;  1V1O A;  2HQL A;  4TQU S;  1YJ9 A;  1F2M A;  1NE3 A;  3TEH B;  2MFI A;  4B3R Q;  2UXC L;  4WOR A;  4AQY Q;  2VS1 A;  4UY8 C;  2A73 B;  3SXH A;  1YZ6 A;  3PIO A;  2R7Z H;  3BG3 A;  5A35 A;  5EGT A;  1WYD A;  4ODG A;  2EYP A;  5JEA H;  2EYO A;  3MXN B;  2YTX A;  3MXG A;  1CKO A;  3ERO A;  5M3F B;  2JN4 A;  4K0K L;  1YI2 A;  1L1O A;  4FNF A;  3H0G B;  4MTN A;  2N49 A;  4OWT B;  5D3D A;  2IX3 A;  1JT8 A;  1PXU A;  4O42 A;  3H09 A;  4DV5 Q;  1GUW A;  4DK6 C;  3TME A;  4GLA C;  1EY5 A;  1TWG H;  3MFY A;  1OXT A;  4LF4 Q;  5C4Z A;  1CSP A;  3FEW X;  3T13 A;  1XMQ Q;  3FPU B;  4A3C H;  5IGE A;  3HEJ A;  2I5H A;  5COY A;  3JAM i;  2OQ0 A;  3T1Y Q;  4C3I B;  3GTM H;  1QIL A;  1KAW A;  2JA5 H;  5C4J H;  1YJW A;  1QB5 D;  4AIM A;  3QG1 A;  4XT1 B;  1J5E Q;  3CC4 A;  4F88 A;  4LWC A;  2IT1 A;  3MWY W;  1JB3 A;  1B3A A;  2VUM G;  2KJX A;  4K5V A;  1I5F A;  4A3D H;  4A3M G;  5C0X H;  3HOW H;  2K04 A;  1EQQ A;  2L55 A;  4ZCK A;  2NVQ B;  4ZRZ A;  1S5B D;  1B4O A;  3SEB A;  1ESR A;  1S72 A;  3TZD A;  4DK0 A;  3NP8 A;  3IKJ A;  4DR6 Q;  2CQA A;  5GAE C;  2JE6 I;  4L5T A;  4YIJ A;  1UAP A;  5NUC A;  1SFO H;  2NTT A;  5FO8 B;  3FMC A;  5BR8 Q;  3EFX D;  2F4I A;  2SNS A;  2I5L X;  2KEE A;  2PZU A;  5GAH C;  2B2U C;  4QF4 A;  4R4C A;  4GS3 A;  1VQ7 A;  4JI1 L;  2YTV A;  3M3Y B;  2R92 B;  1XTC D;  4R4T A;  3IFT A;  4HJA A;  1SRO A;  3U58 A;  4BXX H;  2ES2 A;  3K57 A;  2F4V L;  4MN3 A;  2EYH A;  1VQ9 A;  4C3H B;  3WWV A;  3KF6 B;  1VQG A;  4HMI A;  1VMP A;  3L9A X;  1WD0 A;  4WJ4 A;  4IN3 A;  1KDC A;  2XVS A;  4O1N A;  3HOX G;  4OGQ C;  3EVQ A;  1BQQ T;  1F2Z A;  2HDM A;  5HGQ A;  1WTW A;  3NWT A;  5M5W H;  5IYB H;  1TS5 A;  4PMB A;  4GOP A;  1QUQ A;  1GKH A;  4DV5 L;  3NEN A;  2FIN B;  4WFN 3;  4DK1 A;  3MTS A;  2OWO A;  4J8Q A;  3S9W A;  4LF4 L;  3I2Z A;  2R93 G;  2E75 C;  2AKW B;  1XMQ L;  1A3V A;  2JEB I;  1VQB A;  4OON A;  1T9H A;  3M7N A;  4IFD H;  5JJL A;  2Z9H A;  3OSO A;  1LV9 A;  2E8G A;  3PO3 G;  5J1Z A;  1JR0 D;  3A5U A;  4WJ3 M;  1J5E L;  3ULJ A;  1MBY A;  2CQO A;  4DUZ Q;  2CH4 W;  3RZO H;  1TWF H;  1PRT C;  3KUP A;  1RTO A;  3OIP A;  5C5L A;  1K0S A;  1F77 A;  1STA A;  2UUC Q;  3S14 B;  1L1O B;  4A3F G;  1QWY A;  3KJO A;  3DHQ A;  1SR3 A;  1HUN A;  1MI2 A;  1R4Q B;  5M3M H;  3WDN A;  1AW7 A;  1VQH A;  4KY7 A;  2F0V A;  4DR6 L;  2A74 C;  4OXP A;  1S5C D;  1X3E A;  1GVP A;  1QG7 A;  2K1B A;  4A93 B;  1YVC A;  1WTX A;  3L3O C;  4A3I H;  3A8K E;  2EYF A;  1PH1 A;  2WV6 D;  3SK6 A;  4LF8 Q;  2AWO A;  3CPF A;  2A69 D;  5BR8 L;  5IP9 G;  2A6H D;  3PUY A;  1EIF A;  5IGB A;  3W1G A;  5E3F A;  1QE6 A;  3TN2 A;  1I4X A;  4A3G H;  3R93 A;  3R3O A;  5LHY 1;  1OTC A;  1STB A;  3I4N H;  1K0R A;  2K03 A;  1XNQ Q;  1YEZ A;  4PMW A;  2NN6 H;  4DAP A;  3H3V I;  2R7Z B;  1W6K A;  1ASZ A;  4OO1 I;  3UDF A;  2K5W A;  1LUZ A;  2HCI A;  2ZTD A;  4MTK A;  5A2Q L;  2GVA A;  2BCO A;  4FF2 A;  1AH9 A;  3CC2 A;  1HTL D;  2XRQ D;  4LF6 Q;  5GRO A;  4FP5 D;  1VDZ A;  4YCV A;  2K52 A;  2EZV A;  4PNY A;  5LL6 S;  3BYY B;  4A76 A;  3S1R B;  5G3L F;  2PO4 A;  2R92 G;  2RVL A;  3A7L A;  2PQA A;  2MNA A;  1A0I A;  1JC7 A;  1TWG B;  4GKK Q;  1VQP A;  2Q8R E;  3OPO A;  2DJF C;  1BNZ A;  3PIP A;  5KYL A;  2K4K A;  3FPP A;  5IGD A;  2DN8 A;  2IL8 A;  2F0D A;  1NBW A;  3VR3 A;  3GTM B;  2RHS B;  2JA5 B;  5C4J B;  2A69 C;  2A6H C;  4R1J A;  2L5T A;  4DUZ L;  5FJ8 G;  3J81 j;  1SE8 A;  2YU9 H;  4A3D B;  2FXQ A;  5ELO A;  2HT1 A;  1D1I A;  3HOW B;  1S5E D;  4PMC A;  1GO3 E;  2UUC L;  1E2Z A;  4M1U B;  3RN5 A;  1GHK A;  3VR6 A;  3NBH A;  1X56 A;  1B8A A;  4GOP B;  1LAC A;  1QUQ B;  5IYD G;  1SMY D;  5J22 A;  4OIK A;  2B2U A;  4ALP A;  5C4H A;  1LT3 D;  3PUZ A;  2L4N A;  4ZAI A;  1L0X B;  1YJN A;  4A3M H;  2KHI A;  1EWI A;  1SFO B;  4LF8 L;  1CUK A;  3AB9 A;  3ITP A;  2E2J B;  1D1K A;  4GLX A;  4RGM A;  3U50 C;  2AWN A;  1HPC A;  4QUF A;  2JXM B;  2ZM6 Q;  4JBJ A;  3P20 A;  4HIK A;  4IUP A;  4KV6 A;  3Q23 A;  1E1O A;  3CAM A;  4RHS A;  1R9T B;  5IGF A;  1VQE A;  1XNQ L;  4UPA A;  1IXR A;  4NXN Q;  4XXE A;  5E4X A;  3J7Y W;  1HNZ Q;  1OXS C;  3DM1 A;  4DNT B;  1ZEQ X;  3RLF A;  1PFS A;  4A93 G;  3GTK H;  2FFK B;  2B29 A;  1MD2 D;  4LJZ C;  1DYQ A; 
#chains in the Genus database with same CATH homology
 1U5K A;  3M3Y H;  4LF6 L;  2R92 H;  3SGI A;  4RG1 A;  1M1K C;  3D31 A;  3G4S A;  4X6A H;  1ASY A;  2KBN A;  2PMZ E;  4DUY L;  4LFA L;  5IYB G;  3D0F A;  4MZ9 A;  4JI6 Q;  2JA7 G;  5GQO A;  1HR0 L;  1P8L A;  4JI3 L;  4PZ6 A;  3FKI H;  3I55 A;  1N32 L;  3TRZ A;  2KCT A;  2XTI A;  2L15 A;  1J6Q A;  1E22 A;  3Q8D A;  3GO5 A;  4A3B H;  1K8G A;  4O0A A;  3W5O A;  4C3H H;  5M5Y H;  4KLK A;  5C44 G;  4DV3 Q;  1X6O A;  4GKK L;  3J81 c;  4HJ5 A;  4AH6 A;  4JI0 L;  2NVY H;  4P71 A;  4YHH L;  3E9H A;  1N36 L;  4LUZ A;  1V43 A;  1UE6 A;  2LSS A;  4QIW E;  2VQE L;  1X65 A;  1SN8 A;  4DPG A;  5IP7 G;  3F1Z A;  1AE3 A;  3HOX H;  4DV0 L;  1E3P A;  1BKB A;  3JC6 6;  5JEA J;  5JEA G;  1YHA A;  4X62 L;  4DV4 L;  1GD7 A;  5AJ3 L;  5LMU L;  1EFW A;  1PH4 A;  3TS2 A;  4JBW A;  1DGS A;  5FJ8 H;  3HOZ G;  1H95 A;  1VQ6 A;  4YCW A;  5IYC G;  2ID0 A;  3F8T A;  1Y1V G;  4LFA Q;  1VQF A;  4BY7 G;  5H1S E;  3GTL H;  1SMX A;  1S3O A;  5C4X G;  3HKZ E;  1MIU A;  2VL6 A;  2JA8 H;  4DKA C;  4BBS G;  1D8L A;  2I5M X;  2JA9 A;  3F2D A;  1QVG A;  1MJE A;  1YHQ A;  2QA4 A;  2E5L L;  1VS0 A;  4JBM A;  2UUB Q;  1G29 1;  3TS0 A;  5IYD H;  3OYY A;  4C3J H;  4GOP C;  4JG2 A;  3S1Q H;  4A3L G;  3K7A H;  4RMF A;  3RNU A;  1KXL A;  1U0L A;  3K7U C;  3HOU H;  4B3T L;  3CCS A;  2R7D A;  5M3M G;  2NVT H;  1V9P A;  2PQA B;  3PO3 H;  1L2F A;  2DUD A;  2R6G A;  3ER0 A;  4POG A;  3PF4 A;  2BH2 A;  2E2J H;  1Z9F A;  4JI5 Q;  3CF5 A;  1BVS A;  1FJG L;  4BBR G;  4A3I G;  2LXJ A;  4QJF A;  4XTC S;  1Y1W G;  4IFD I;  3UDI A;  4PG3 A;  1B7Y B;  4EQ5 A;  2UXB L;  3CCV A;  3S14 H;  4B3R L;  1R9T H;  3MEF A;  1PH8 A;  1EIY B;  4AQY L;  1IBM Q;  5C0X J;  3AFP A;  5C0X G;  4A3F H;  1HZA A;  4JI4 Q;  1HNW L;  2LXK A;  2R7F A;  3OTO Q;  1WOC A;  4A3G G;  2E5L Q;  1VQO A;  4R4I A;  1OXV A;  1YIJ A;  5DLQ E;  4LFB L;  1YNX A;  4GN3 B;  2Q2T A;  4OWW B;  1JJC B;  1JJG A;  1PYS B;  4GN5 A;  2IX1 A;  4DAY B;  4YCU A;  4NB3 A;  3J80 i;  1I50 H;  4UP7 A;  1GM5 A;  5GAD C;  3HOY G;  3NEM A;  1YIT A;  4C2M H;  2B63 G;  3I4M G;  4A93 H;  4KI0 A;  3M4P A;  5LMN Q;  1PA6 A;  2JA6 G;  3J7A 5;  2VNU D;  4LUO A;  2PNH A;  3CP0 A;  1HNZ L;  4IO9 A;  1VQ4 A;  1M90 C;  1KIX A;  3BJU A;  2C35 B;  3KYH C;  1RL2 A;  2E2I H;  4R4O A;  3H15 A;  2JA7 H;  4DR3 Q;  1XNR Q;  2Y0S G;  2YYZ A;  4B3S L;  3S1M H;  4JI1 Q;  1NJI C;  4GNX C;  3GTP H;  3HKS A;  1C7Y A;  2HQL A;  4TQU S;  1YJ9 A;  1NE3 A;  3TEH B;  2MFI A;  4B3R Q;  4JC0 A;  1PH5 A;  4IPD A;  2V1C C;  2UXC L;  1XPR A;  1I6H H;  4A3E G;  4AQY Q;  2ALY B;  2VS1 A;  1A63 A;  3K0X A;  4UY8 C;  4DR2 Q;  3RLO A;  1YZ6 A;  1Q12 A;  1IL2 A;  3PIO A;  2WB1 E;  1KC8 C;  1PH3 A;  2R7Z H;  1C0A A;  1VQ8 A;  3PGZ A;  5C0X I;  4DR1 Q;  1UE1 A;  1UEB A;  2YV5 A;  2K14 A;  2ZTC A;  3ULL A;  4Y7N H;  4DV7 Q;  4BXX G;  4DV6 Q;  2K5V A;  1WYD A;  1VQC A;  2NVX H;  4EX5 A;  3T1Y L;  1Y14 B;  2WFW A;  3MXN B;  4A3K G;  2YTX A;  1V1Q A;  3F2B A;  1WJJ A;  3G71 A;  3CCJ A;  1CKO A;  5M3F G;  4Y52 H;  2NN6 I;  4DV1 Q;  1K83 H;  3H0G G;  3M9B A;  4K0K L;  3TRE A;  1YI2 A;  2IX0 A;  1Y1V H;  1L1O A;  3S1N H;  2EIF A;  4GN4 B;  4MTN A;  2N49 A;  3EN2 A;  4BY7 H;  4OWT B;  3UE1 A;  1JJ2 A;  2K5H A;  4B3S Q;  1QVC A;  3L0O A;  1JT8 A;  4BBS H;  2KEN A;  4DV5 Q;  5IE8 A;  3KOJ A;  1Q46 A;  1OXU A;  4DK6 C;  3UE0 A;  4GLA C;  3PUV A;  1TWG H;  2UXC Q;  2ATW A;  1VQM A;  2RF4 A;  4JOI A;  1OXT A;  2N78 A;  4GNX B;  3UDX A;  5K36 G;  2Q2I A;  3PCO B;  4LF4 Q;  1CSP A;  4DV2 Q;  4JYA L;  2VW9 A;  2K50 A;  3CXC A;  1XMQ Q;  1HR0 W;  4A3C H;  2UXD Q;  2I5H A;  2UUB L;  4QL5 A;  3JAM i;  4PZ7 A;  3CPW A;  1CKN A;  2BA1 A;  5IWA Q;  1SRU A;  2OQ0 A;  1MJC A;  2N3S A;  2HHH Q;  3T1Y Q;  3T1H L;  4NXM L;  4IJL A;  3GTM H;  1KAW A;  5C3E H;  2PI2 A;  3HKZ G;  2JA5 H;  4BBR H;  5C4J H;  1YJW A;  5FLX c;  4OWX B;  4L5S A;  4AIM A;  1NY4 A;  4K0K Q;  1J5E Q;  2MO0 A;  3CC4 A;  4LWC A;  2IT1 A;  4X64 Q;  4IFD J;  2VUM G;  1VQA A;  4IFD G;  3S16 H;  1I5F A;  4JI5 L;  2ASB A;  3ICE A;  3PV0 A;  1LYL A;  4A3M G;  3A5Z B;  4A3D H;  2OQK A;  2MO1 A;  1TXY A;  2NZO A;  3HOW H;  1X3G A;  4LUV A;  1TWC H;  3KF8 B;  1EQQ A;  2IHE A;  3CC7 A;  1K8A C;  5FLM G;  1IBM L;  4JI4 L;  4HIM A;  4HIO A;  4JYA Q;  3HOY H;  3ZJY C;  3OTO L;  1S72 A;  1Q1E A;  3EBE A;  1TWH H;  2PI2 E;  3KDF A;  4DR6 Q;  2BH8 A;  4LF9 L;  4A3J G;  3T1H Q;  4NXM Q;  4DR5 Q;  5GAE C;  2JE6 I;  3M85 A;  1YHB A;  3W1B A;  3ULP A;  4L5T A;  1L0W A;  4L5R C;  5LMN L;  1SFO H;  4JI8 Q;  1NMF A;  2K75 A;  1N34 Q;  1W3S A;  5BR8 Q;  3CCR A;  4QGU A;  1N33 Q;  2I5L X;  2Z6K A;  2GN5 A;  4LNQ A;  2JJQ A;  5GAH C;  4R4C A;  3J80 c;  4DR3 L;  4GS3 A;  1XNR L;  1VQ7 A;  1BBW A;  1Q1B A;  4JI1 L;  2YTV A;  1C9O A;  1VQL A;  3K81 C;  4DV4 Q;  4R4T A;  4LF7 Q;  3KF6 A;  4HJA A;  1SRO A;  3U58 A;  1XPU A;  2CCZ A;  4BXX H;  3CD6 A;  2ES2 A;  4DR2 L;  2F52 A;  2OTJ A;  2F4V L;  3M4Q A;  2Q2U A;  2NZH A;  3J7Z C;  3I4N G;  2CWA A;  4DR1 L;  1VQ9 A;  2JQO A;  3WWV A;  3KF6 B;  1VQG A;  1KRT A;  2DGY A;  4DV6 L;  4DV7 L;  4LF9 Q;  4DR4 Q;  1PVO A;  4QY7 A;  2NN6 G;  2AMC B;  4WJ4 A;  3AEV A;  1IBK Q;  4R4Q A;  1VQN A;  4P75 A;  3HOV H;  3M4O H;  4B3M Q;  3ERS X;  5JJK A;  1WI5 A;  4LFC Q;  1HJP A;  3I4O A;  3HOX G;  4DV1 L;  3AQQ A;  1I94 Q;  2WB1 G;  3GTO H;  3S24 A;  3CCU A;  2KCM A;  2ZJQ A;  4AYB E;  1BBU A;  5HGQ A;  2VY3 A;  3CCM A;  1SLJ A;  5M5W H;  5IYB H;  3GTQ H;  1W2B A;  1PH9 A;  4BY1 G;  3CME A;  4GOP A;  3OW2 A;  1P16 A;  1QUQ A;  1GKH A;  1PHJ A;  1NTG A;  3B6Y A;  3NEN A;  3GDE A;  4DV5 L;  1XMO Q;  1Q81 C;  1HNX Q;  1HZ9 A;  4GLV B;  3CMA A;  1IYJ B;  3RZD H;  2JEA I;  4KHZ A;  4DAM A;  5E7N A;  5C44 H;  2Q2H A;  2OWO A;  1JE5 A;  1EUJ A;  4LF4 L;  3I2Z A;  2R93 G;  4DV2 L;  2F4V Q;  4YY3 Q;  2AKW B;  2B3G A;  1XMQ L;  2UXD L;  4IOA A;  3S2H H;  1CKM A;  1VQB A;  2JEB I;  4OON A;  5IP7 H;  5IWA L;  4UP8 A;  2VQF L;  1MKH A;  1T9H A;  5JJI A;  4HJ8 A;  2HHH L;  4IPC A;  3M7N A;  4A75 A;  2VUM H;  5JJL A;  2E8G A;  3PO3 G;  1EOV A;  5GAG C;  3HOZ H;  3CCQ A;  4IJH A;  3L7Z C;  3LGJ A;  5IYC H;  3A5U A;  4WJ3 M;  1J5E L;  4HID A;  3ULJ A;  1K73 C;  2CQO A;  1PYB A;  4X64 L;  4DUZ Q;  4JCV E;  1HH2 P;  5C4X H;  3RZO H;  1E7Z A;  1TWF H;  3GTG H;  3FHW A;  4DK3 C;  2GVB A;  2WAQ E;  2UUC Q;  3CQZ H;  2UUA Q;  1L1O B;  4A3F G;  2XGT A;  3VDY A;  1YBY A;  2ZTE A;  3KJO A;  4A3L H;  4HJ7 A;  4OO1 G;  4TVA B;  1A8V A;  1SR3 A;  3RR5 A;  2RHQ B;  1XJV A;  4UP9 A;  1I3Q H;  3HFZ B;  5M3M H;  1Q86 C;  3KJP A;  1VQH A;  3E0E A;  4DR6 L;  2YTY A;  4OXP A;  2VQF Q;  3S17 H;  1X3E A;  2K5N A;  1GVP A;  4LF5 Q;  4DR5 L;  1YVC A;  4KHP Q;  1N9W A;  4A3I H;  3TQY A;  1PH1 A;  4LF8 Q;  4GKJ Q;  4APV A;  1Y1W H;  4JI7 Q;  4JI8 L;  2AWO A;  1PH6 A;  1K3R A;  1WCM G;  1CKN B;  1X3F A;  3CPF A;  1N34 L;  5BR8 L;  5IP9 G;  1N33 L;  3PUY A;  5M5X H;  1EIF A;  4HJ9 A;  1IBL Q;  4DNI A;  2QGQ A;  3W1G A;  2UU9 Q;  3GTJ H;  2Z6K C;  4OX9 Q;  4A3G H;  1X9N A;  1D7Q A;  2AHO B;  1VQ5 A;  3NEL A;  1OTC A;  4LF7 L;  3I4N H;  3F2C A;  1K0R A;  2CFM A;  1XNQ Q;  3K8A A;  3PO2 G;  1YEZ A;  1HZB A;  1WFQ A;  1EQR A;  2CWP A;  4PMW A;  2R7Z G;  1X55 A;  3G48 A;  4JI2 Q;  3I4M H;  3H3V I;  2B63 H;  4IPH A;  4DR7 Q;  1PV4 A;  1ASZ A;  4OO1 I;  3UDF A;  2JA6 H;  3G6E A;  1LUZ A;  2ZTD A;  5HY6 A;  3STB C;  1PH2 A;  1EYG A;  2JK8 A;  2GVA A;  4X66 L;  4DR4 L;  4P72 A;  4JV5 Q;  4X65 Q;  1AH9 A;  3K80 C;  3I56 A;  3BU2 A;  1VQK A;  3CC2 A;  1IBK L;  1IZ6 A;  4B3M L;  4BY1 H;  4LF6 Q;  1KRS A;  5GRO A;  1E1T A;  4LFC L;  5EAY A;  4YCV A;  3CW2 C;  3EIV A;  1KL9 A;  2OCE A;  3KLW A;  2HIV A;  2K52 A;  4DUY Q;  4XIG S;  1I94 L;  2D0P A;  3KDF B;  3AYH B;  3J81 i;  3BZK A;  1HR0 Q;  4A76 A;  1O7I A;  2D62 A;  1CSQ A;  2WP8 J;  5LMN W;  3GD7 A;  2A19 A;  2Z0S A;  4A3E H;  1E24 A;  1TWA H;  4JI3 Q;  2R92 G;  1N32 Q;  1QZG A;  2MNA A;  2PQA A;  1JMC A;  2R93 H;  1XMO L;  1HNX L;  1A0I A;  2N8N A;  4MNO A;  1G6P A;  1RIP A;  3CCL A;  2I0Q A;  2RCN A;  3KFU A;  1S40 A;  2E2H H;  4GKK Q;  1VQP A;  3FKI G;  1UWV A;  2HIX A;  4IPG A;  4YWL A;  5IT9 c;  3L2P A;  4JI0 Q;  3S2D H;  3PIP A;  3U4V A;  4AYB G;  4FDB A;  4YHH Q;  3DLL A;  2CKZ B;  1N36 Q;  4A3B G;  4A3C G;  1VQD A;  4YY3 L;  2ZJP A;  4A3K H;  2VQE Q;  1UE5 A;  2K4K A;  5M3F H;  2MQH A;  4X66 Q;  2H5X A;  3H0G H;  4YWM A;  4PZ8 A;  4DV0 Q;  1PH7 A;  2VZA A;  4X62 Q;  5C3E G;  1NBW A;  5AJ3 Q;  3BZC A;  2EQS A;  4POF A;  5LMU Q;  2EXD A;  2JA5 G;  1G51 A;  2RHS B;  3IRB A;  3RN2 A;  3CCE A;  3DM3 A;  3E9I A;  4P73 A;  4R1J A;  4JBK A;  1VQJ A;  4LW1 A;  1K9M C;  4DUZ L;  4A3D G;  2F3I A;  5FJ8 G;  3J81 j;  3H3V H;  1JB7 A;  2IY5 B;  1SE8 A;  2YU9 H;  2FXQ A;  1L1O C;  1VCI A;  5ELO A;  3HOW G;  2HT1 A;  3S15 H;  1X54 A;  4A4I A;  2ZM6 L;  2KHJ A;  1FVI A;  1GO3 E;  2UUC L;  4BA2 I;  3I7F A;  2UUA L;  2JA8 G;  3RN5 A;  1KD1 C;  4C3I H;  1X56 A;  4NXN L;  4B3T Q;  1B8A A;  4GOP B;  4JOI C;  1AE2 A;  1QUQ B;  4BA1 I;  5IYD G;  3A0J A;  2QEX A;  4J15 A;  4ALP A;  1VQI A;  1A62 A;  1Q82 C;  1WCM H;  2WAQ G;  3HOU G;  1FJG Q;  1XTD A;  3PUZ A;  4LF5 L;  3NBH B;  5IP9 H;  1KHI A;  4H02 A;  3STB D;  1LM0 A;  1YJN A;  4NPS A;  2D0O A;  4KHP L;  4A3M H;  2KHI A;  4IOC A;  1EWI A;  2ZJR A;  1XPO A;  4LF8 L;  1Z47 A;  4GKJ L;  2UXB Q;  4JI7 L;  4P74 A;  5IY0 A;  3JAM c;  5J3B A;  3A74 A;  3AFQ A;  1CUK A;  4JI6 L;  4GLX A;  5FLM H;  5ELN A;  3U50 C;  1IBL L;  2AWN A;  3PF5 A;  2NVQ H;  1KQS A;  1HNW Q;  3PO2 H;  1Q8K A;  1FGU A;  2UU9 L;  1QVF A;  4ME3 A;  3PUX A;  4JBJ A;  2ZM6 Q;  3UDG A;  4OX9 L;  4QQB X;  1LTL A;  4HIK A;  4LFB Q;  1E1O A;  3CAM A;  1UE7 A;  2Y0S E;  4DV3 L;  1NMG A;  3FP9 A;  1VQE A;  1XNQ L;  2IHF A;  3PUW A;  2BA0 A;  3PSI A;  4L5Q A;  1IXR A;  4O2D A;  4UPA A;  4NXN Q;  4A3J H;  4JI2 L;  1Q7Y C;  4YWK A;  1N8R C;  3RLN A;  4DR7 L;  1HZC A;  1FL0 A;  3U4Z A;  1HNZ Q;  1OXS C;  1OXX K;  4GNX A;  4JV5 L;  3RLF A;  1PFS A;  4X65 L;  2A1A A;  3GTK H;  3HOV G;  3S1R H;  2B29 A;  2OTL A;  4A93 G;  1B70 B;  2A8V A;  1QZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...