3GTGH

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription, transferase/dna/rna hybrid
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtgH00
5C0XJ 5JJLA 2Q2HA 3KF6B 2D0OA 5GROA 1I6HH 5FJ8G 1UE1A 1PH2A 4DV7L 4R4IA 4K0KQ 4JI5L 5C0XI 4IO9A 3T1HL 5C3EG 4LF9Q 5JEAG 5IYBH 2I5MX 4Y7NH 2ZM6Q 2VQEL 2YU9H 2V1CC 3A5UA 4R4OA 3PIPA 2QEXA 1UWVA 3U4VA 1IXRA 1RL2A 1Y14B 3W1BA 4YCUA 4DUZQ 2IY5B 1LTLA 4KHZA 1EOVA 1Z47A 1Z9FA 1BBUA 2B29A 3RLFA 3J81j 3CF5A 1EYGA 1E1TA 3S15H 1A8VA 3A74A 2ZTEA 4P72A 3L7ZC 1K3RA 2VZAA 2Z0SA 3EIVA 3H0GH 4LWCA 4QL5A 1SN8A 1Q46A 2LXKA 1N32Q 2YYZA 2H5XA 1QVCA 4TVAB 3ZJYC 3CMEA 2UXDQ 4APVA 2JE6I 3NENA 3KJOA 1AE3A 3CCRA 1PH7A 2L15A 2N8NA 4YHHQ 1TXYA 1HNXQ 1NBWA 3PF5A 3BJUA 3KLWA 4LFAQ 3ULPA 3VDYA 5C4XH 2NVQH 4DV5L 3CCUA 4LF7L 4JYAL 4AYBG 1TWAH 2F4VQ 4DR4L 2K52A 4IPCA 4C3JH 4DV0L 4DR2Q 4POFA 4B3SL 1SE8A 3A0JA 4X65Q 2R93H 4X6AH 4IPHA 4DAYB 4MNOA 4BXXH 4EQ5A 4IPGA 5HGQA 5AJ3Q 3D31A 4LFBL 1Q7YC 1EIYB 1VQHA 4DV6L 3TS0A 1PH4A 1Y1VH 1HZBA 4GLXA 3K81C 2UXBL 2XTIA 2AWNA 4LF4Q 4JI8L 3HOYH 4KI0A 4JI3Q 1XPOA 1B8AA 1X3FA 2A19A 1CKNB 4NXNQ 1AH9A 1E24A 1WCMH 2N3SA 1FL0A 1WYDA 2Y0SG 3DM3A 5FLMH 4LF8L 1EQQA 5C4XG 1IL2A 2WAQE 4GOPA 4DR6L 4A3LH 3BZKA 2IHEA 4X62L 4L5SA 3RZDH 4JI4L 2KCTA 1KQSA 1XMQL 2R93G 3PO2H 2EIFA 2FXQA 1E1OA 1LUZA 4P73A 4NXMQ 4O2DA 4DV2L 3TQYA 4HIMA 2IX1A 4BXXG 1SROA 4GKKL 3HOVH 4DR3L 2K4KA 4A3CH 1D7QA 3FKIH 4KLKA 4J15A 2UUBQ 1FJGQ 2ZJQA 4WJ4A 1Q1EA 1J6QA 2HT1A 3RR5A 1Y1VG 3H3VI 1Y1WH 1HNWL 1H95A 5C44H 1NE3A 2PI2E 3GD7A 1PH3A 3G48A 3HOYG 1OXXK 4BBRG 2MQHA 2AKWB 4PMWA 3GTPH 2ZJPA 5M3MH 5FLMG 3W1GA 4DK3C 1Q81C 3M4PA 4DR5L 1IBLL 4L5RC 2UUCL 1HR0L 1HZCA 1HNZQ 4GN5A 4DPGA 3RNUA 4GKJQ 3ERSX 3L2PA 2E5LL 3GDEA 1OXSC 2JEBI 4NB3A 1PH9A 1X3GA 4DV4Q 3F1ZA 4DV3L 1YJ9A 3EN2A 3NEMA 4YWLA 1OTCA 3HOXH 4DAMA 4IJLA 1NTGA 4OX9Q 3HOWH 1VQEA 4ME3A 3I4MH 4A3CG 4EX5A 3HOVG 4OWWB 2EQSA 3FKIG 4GS3A 2A8VA 3UE0A 3UDIA 3H15A 1O7IA 5DLQE 2K50A 5C0XG 3G6EA 4P74A 1IYJB 2RHQB 4A3IH 3AFQA 4A3MH 1M1KC 2CKZB 3RLOA 4JBKA 4YY3L 5IT9c 1X6OA 3CQZH 3J7ZC 2E2HH 2B63H 1L1OB 3KF6A 2E2JH 3I7FA 4YCWA 3HFZB 4ALPA 4X66Q 1B70B 5M3MG 5LMUQ 2VL6A 1FGUA 3SGIA 2MO0A 3KDFB 2I5HA 1WJJA 4YWMA 3T1YL 2A1AA 3FP9A 1W3SA 2AHOB 2N78A 3OTOL 2CWPA 3JC66 1HZAA 5LMNQ 4AQYL 2IHFA 3HOXG 5JJIA 3U58A 4JBMA 3TREA 4B3ML 1IBML 4LUOA 1SFOH 3I4MG 1MJCA 1UE6A 5ELOA 3F2CA 1XNRL 3GTQH 3Q8DA 4KHPQ 2EXDA 3PUZA 1OXUA 3EBEA 1VQKA 2VUMH 4K0KL 4UPAA 4A3IG 2UUAQ 3KFUA 3UE1A 4A3MG 3TEHB 4HIKA 3MEFA 3KJPA 3J81c 5IP9H 1VQPA 2B63G 2ZM6L 4QJFA 4IJHA 5IWAQ 1VQMA 4HJAA 2NVXH 4UP7A 3CD6A 4DNIA 4DUZL 3WWVA 1S3OA 2K5HA 2VQFQ 1L0WA 2YV5A 2JA5H 2OTJA 1S72A 1N9WA 2HIVA 4LF5L 2Q2TA 4O0AA 4PZ8A 1N32L 1GKHA 4GOPC 1V43A 5GAHC 2QA4A 2VNUD 2UXDL 4YWKA 1XMOQ 3J81i 1NJIC 1VQJA 1BBWA 2KHJA 1KRSA 4YHHL 1HNXL 2VUMG 1WFQA 3GTKH 4C3IH 1ASZA 2PMZE 5IP9G 4LFAL 4A3DH 1X3EA 1KHIA 1GVPA 2F4VL 3U4ZA 4DR2L 1PH6A 4IFDJ 1CKNA 2F52A 1YHAA 4LFCQ 4A3BH 2AWOA 2NZHA 4POGA 4IFDI 2JA5G 5AJ3L 3BU2A 3PF4A 3ER0A 4PG3A 1PYSB 1CKOA 5M5WH 4JI7Q 3AFPA 3PUYA 4HIOA 4BY7H 2YTYA 1YJNA 3CPFA 3S2DH 1PA6A 2LXJA 4UP9A 4QGUA 4JI3L 1QVGA 4NXNL 3AEVA 2Q2IA 3F2BA 1XNQL 1X55A 1UE7A 5JEAJ 4A3FH 4GNXB 4BBRH 4JI1L 3PCOB 2VY3A 2Z6KA 4A3DG 3M3YH 1FVIA 1EWIA 1VQCA 3TRZA 2OQ0A 1VQIA 2PQAB 4JOIA 4L5QA 4JYAQ 4LF7Q 5BR8Q 2UU9Q 3G71A 2NVTH 3A5ZB 4A3BG 3MXNB 4NXML 4A93H 4DUYQ 2OCEA 1VQBA 1XJVA 4IOCA 1A62A 3AYHB 2PI2A 2BH8A 4JCVE 1FJGL 4JBWA 3J80c 3RN5A 1Q8KA 2R7DA 2MNAA 4BY7G 4LF6L 1X56A 1D8LA 2ASBA 1VQ6A 2I0QA 2WAQG 4LFBQ 4BA2I 1SMXA 2CWAA 4OO1I 5JJKA 5IE8A 4UP8A 2OTLA 1VQFA 1HR0W 1G6PA 4JI0Q 3S1QH 3I2ZA 1V9PA 3K80C 4LUZA 1EQRA 1K73C 4JI6L 2E2IH 4JI8Q 4A3FG 3S17H 4R4TA 4BBSH 5C4JH 2RHSB 1C0AA 1N34Q 2NN6G 4JBJA 3HKSA 4XTCS 3CCQA 4DR1Q 1KIXA 4GKJL 2HIXA 3IRBA 2GVAA 4A3GH 2D0PA 3LGJA 4JV5Q 4XIGS 1K83H 1L1OA 2UXCQ 2BH2A 4OX9L 4QIWE 1SRUA 3E0EA 4P75A 3J80i 4AH6A 5M3FG 1J5EQ 2JQOA 1U5KA 4H02A 4DR7Q 1UEBA 4A93G 2DGYA 3KDFA 1GM5A 1QVFA 2JA6H 4HJ9A 3GTMH 3RLNA 5GQOA 4IOAA 1KL9A 2ZTCA 1BVSA 5IYDH 5FLXc 2VS1A 1YIJA 4PZ6A 4OWXB 3W5OA 3RN2A 3CAMA 1K8AC 2JJQA 1IBKQ 1VQ4A 1NMFA 1TWCH 3CXCA 4BBSG 4X66L 2WFWA 1N36Q 1GO3E 3S2HH 5LMUL 3M7NA 3F2DA 3DLLA 1YVCA 1M90C 4BY1H 2RCNA 2JA8H 1I5FA 4A3GG 1TWHH 4JI2Q 4DR5Q 1I94L 3M4OH 2IX0A 2JEAI 3JAMc 3K7UC 1YI2A 5K36G 5ELNA 2K5NA 2KBNA 2JK8A 1QZHA 1KC8C 2HHHQ 1KD1C 4DV3Q 2PNHA 2I5LX 2HQLA 2JA6G 1G291 4DK6C 1SR3A 3I4OA 4KHPL 1MJEA 1VQ9A 3CC2A 3PIOA 5IYDG 3S14H 4HJ8A 1X65A 2UUAL 4B3RQ 1N33Q 3PUWA 4B3TQ 3CCJA 3ICEA 1PFSA 5IWAL 4LF9L 3E9HA 2GN5A 1ASYA 2R7ZH 5GADC 3K8AA 1I3QH 2D62A 4GN3B 1E3PA 1VQDA 4BY1G 3JAMi 1CSPA 2JA8G 1K9MC 4WJ3M 4UY8C 2QGQA 3M4QA 4GN4B 2R92H 3T1YQ 3FHWA 1C7YA 3G4SA 1VQ7A 2NZOA 2Z6KC 3PGZA 4DV1Q 3ULJA 1PYBA 5IY0A 1QUQB 1L2FA 2IT1A 1N8RC 4AIMA 1XPRA 1X54A 1Q86C 4JOIC 1PHJA 3UDGA 4B3MQ 1XMOL 1IBMQ 1PV4A 3H3VH 2C35B 3GO5A 1CUKA 2WB1E 4X64Q 4LNQA 1XPUA 1XNRQ 4A75A 1JJCB 2R7FA 1KRTA 5H1SE 1PH1A 3UDFA 2WP8J 3M85A 4DV7Q 1JJGA 1JT8A 1K8GA 4BA1I 1S40A 3T1HQ 4JI5Q 2R7ZG 2N49A 2WB1G 3PV0A 4GNXA 4LFCL 1RIPA 1T9HA 4OONA 1YHQA 1Q12A 1CSQA 2CQOA 2K5VA 3KF8B 2VQEQ 4X65L 2R92G 4A76A 1CKMA 3CC4A 4A3KG 1C9OA 3NBHB 4JI7L 2PQAA 1PH8A 4L5TA 1UE5A 1JJ2A 2JA7H 2E8GA 1YJWA 1DGSA 3KOJA 2AMCB 1A0IA 1LM0A 4GLAC 4RMFA 4LF5Q 2OQKA 3CW2C 3OW2A 4OO1G 4QQBX 1YZ6A 1P16A 1L1OC 2MFIA 5GAGC 1GD7A 2R6GA 1OXTA 1EUJA 4AYBE 4A3JH 2KENA 1Q1BA 4LF4L 3CCMA 1P8LA 4A4IA 2B3GA 1U0LA 1HH2P 3HOUH 2BA1A 3UDXA 2Q2UA 2BA0A 5IYBG 1YITA 4NPSA 1MKHA 2GVBA 3TS2A 5BR8L 2UU9L 1YEZA 3NELA 4P71A 4HJ7A 3HOZH 3GTGH 4DUYL 4DV5Q 3PSIA 4LUVA 4DR4Q 4DV0Q 3CCLA 5M3FH 1Q82C 2JA9A 2YTVA 1I50H 4B3SQ 1LYLA 2XGTA 2JA7G 3STBC 1VQ8A 2Y0SE 3M9BA 2VW9A 4R4CA 3U50C 3CC7A 4TQUS 2UUBL 3KYHC 3H0GG 2OWOA 5IYCH 1Y1WG 4JI0L 3L0OA 4A3JG 4DV6Q 5HY6A 1PVOA 3CCEA 3D0FA 1YBYA 3HKZE 3HOUG 1XNQQ 2UXBQ 1VS0A 1N34L 3STBD 4C2MH 4DR1L 1HJPA 3I56A 4JI1Q 4GLVB 2CFMA 4JV5L 4JC0A 1HNZL 3E9IA 3S1NH 2UXCL 2ID0A 3GTOH 1K0RA 1A63A 4LF8Q 3HOZG 1J5EL 4DR7L 5J3BA 3GTLH 2ALYB 3HKZG 1JE5A 4DR6Q 4DV4L 3GTJH 3CCSA 1JMCA 4DKAC 1VQGA 4RG1A 4X62Q 1TWFH 4JI4Q 5M5XH 1JB7A 1XMQQ 4YCVA 4Y52H 1KAWA 3BZCA 3OYYA 3PO3H 1EIFA 4DV2Q 4GKKQ 4LF6Q 5IYCG 4DR3Q 1IBKL 5M5YH 1OXVA 4A3EH 1YHBA 4LW1A 4OWTB 1W2BA 1N36L 1HNWQ 3I55A 5LMNW 1WCMG 3S24A 4GOPB 3ULLA 4JI6Q 3I4NH 4C3HH 4JI2L 1WOCA 4IPDA 1WI5A 3PUVA 2K14A 1YNXA 4PZ7A 4A3LG 1SLJA 1IZ6A 2KHIA 4MTNA 3F8TA 1R9TH 1IBLQ 2ZTDA 2UUCQ 5IP7H 5GAEC 5E7NA 1HR0Q 2HHHL 3B6YA 2DUDA 5LMNL 3CCVA 2YTXA 4HJ5A 2E5LQ 3PO2G 3RZOH 5EAYA 2ZJRA 1PH5A 4OXPA 1VQNA 4B3RL 1HZ9A 2MO1A 4GNXC 3S16H 3PO3G 1N33L 1KXLA 1NMGA 1QUQA 4B3TL 3S1MH 3PUXA 2LSSA 3K0XA 5C44G 5FJ8H 1TWGH 4QY7A 1QZGA 4A3EG 2KCMA 1XTDA 2NVYH 3CP0A 1B7YB 5C3EH 1E22A 4YY3Q 1VQOA 2ES2A 1VQAA 3I4NG 1VQ5A 2NN6I 3AQQA 4FDBA 1NY4A 1MIUA 4MZ9A 2VQFL 3CPWA 1AE2A 1E7ZA 1G51A 1V1QA 4DV1L 1I94Q 4R4QA 5IP7G 4IFDG 4JG2A 4A3KH 4R1JA 4HIDA 3K7AH 3CMAA 1BKBA 3OTOQ 2K75A 1EFWA 1VQLA 2CCZA 3HOWG 3J7A5 4X64L 4AQYQ 1VCIA 2ATWA 2RF4A 3S1RH 2F3IA 1X9NA
chains in the Genus database with same CATH superfamily
2Q2HA 3KF6B 5GROA 4R8NA 1D6EC 2L5TA 2Q8RE 4ZKBB 3E0JA 4JI5L 5JEAG 1FNUA 2EDGA 2ZM6Q 2K28A 2YU9H 2V1CC 3A5UA 1XYIA 2QEXA 1TY2A 1G2SA 1Y14B 3CF5A 1E1TA 3S15H 1H9RA 4K14A 1D5MC 1SN8A 1MD2D 3E3XA 4EQOA 3OIPA 3CMEA 2UXDQ 2JE6I 2L15A 2N8NA 4G7HC 1TXYA 1HNXQ 2NVXB 1HQMC 3BJUA 4Y7NB 3ULPA 3VDYA 2NVQH 4JYAL 2BDNA 3CCUA 4DV5L 3IFTA 2F4VQ 3T16A 2KEEA 4N8FA 4B3SL 4X6AH 1O7ZA 4DAYB 4BXXH 4KY6A 3A7AB 3GQBA 4LFBL 1B50A 1VF7A 4GLXA 2B2TA 3HOYH 1LACA 4JI3Q 3SHLA 1XPOA 1K28A 5IT9E 4NXNQ 3DM3A 4RGMA 2NTTA 5ISRA 2V4DA 1EQQA 1IL2A 4GOPA 4I7AA 4C3JG 3QWNA 1T5EA 3BZKA 2IHEA 3Q0AA 1MGSA 4L5SA 4JI4L 2R93G 1KQSA 2B2WC 2C5CA 4FF2A 5M5WB 3DWAA 4HIMA 4DAPA 1B1ZA 1HCZA 3N6RA 2K4KA 1FJGQ 4HMIA 3SK8A 1Q1EA 1EY4A 2MPMA 1PRTD 1Y1VG 2PZUA 3N52A 3RR5A 2CW0C 3K6OA 1PH3A 1OXXK 3QB3A 4QF4A 1XXGA 4PMWA 2EYOA 1ZKOA 5FLMG 4DK3C 1Q81C 4DR5L 2UUCL 1HR0L 3J80L 2NVTB 4GKJQ 3RNUA 3GDEA 1ICFB 4NB3A 1X3GA 3F1ZA 1YJ9A 1OTCA 4OX9Q 4YWLA 4DAMA 3HOWH 1IYVA 4ME3A 4A3CG 4EX5A 1O7IA 4A3IH 4N8X1 4OL7A 3AFQA 1CFMA 2CKZB 1DM0B 5IT9c 1L1OB 3KF6A 3HFZB 1BCPF 1B70B 5M3MG 2VL6A 2I5HA 3MXUA 4EGVA 2N78A 4CKBA 2EY6A 3HOXG 4LUOA 3I4MG 1MJCA 1Y69U 5JJZA 1XNRL 2G5DA 2A6ED 3Q8DA 1OXUA 1JR0D 3EBEA 4UPAA 4A3MB 1EYAA 1TWCB 2OEOA 3S2HB 1VQPA 5IP9H 2B63G 5KNDA 4FVMA 5IWAQ 3SR1A 2NVXH 1JORA 4DUZL 1TWHB 1BXTA 1S3OA 2YV5A 1E2WA 5NUCA 3VR2A 5EBDA 1S72A 4O0AA 2KHSA 3BDOA 4FO2A 2LKVA 1N32L 1GKHA 1EQTA 3S14B 2VNUD 4DAYA 1VQJA 1BBWA 2HUGA 1KRSA 2KHJA 4YHHL 2VUMG 1EEID 2F0UA 3MEHA 1X3EA 4XYOA 1GVPA 1HRJA 4HEDA 3U4ZA 2QCPX 5EPJA 5IGFA 5CYUA 1YHAA 2QKIC 3IAYA 1ILQA 4POGA 1O78A 3A56A 1AW7A 3HP3A 3P75A 5M5WH 1WTOA 1WVLA 2YTYA 1YJNA 4KY5A 4DFAA 3F2BA 1X55A 1ONLA 1HA6A 3PCOB 1EWIA 1K8MA 5JVH3 4JYAQ 3IL8A 4LK1C 3G71A 1PRTC 2NVTH 4A3BG 4DUYQ 3SK4A 4L6TB 4JCVE 1SMYD 1Q8KA 2R7DA 2MNAA 4BY7B 1OO9B 1CI3M 1VQ6A 4XT1B 4LFBQ 2WAQG 1SMXA 1K3BC 1IKLA 1VQFA 2RDHA 5C0XH 1K73C 1GUSA 4A3FG 3NSWA 1BCPB 4ZLTF 1N34Q 2JXMB 1KIXA 1DOKA 1TS2A 2O4XA 1F9QA 3BVMA 3RMHA 5FO8B 2WV6D 3LGJA 3HOZB 1S5ED 4XIGS 1L1OA 4JV5Q 1DJRD 4QCLA 5K36H 3J80i 1I50B 5M3FG 4NKLA 2JQOA 4H02A 1QVFA 5C4ZA 4IOAA 4F8MA 1BUVT 5I6YA 1I4RA 1BVSA 1KDCA 1YIJA 4QIWB 1EIHA 3CAMA 3I91A 3C46A 1VQ4A 2J4XA 1TWCH 2R3ZA 4FF1A 4X66L 4BBSG 3S2HH 1N36Q 1PYWD 2IX3A 3ONAB 1JWMD 1ENCA 1STNA 3SK6A 1WTWA 3GTOB 2RCNA 1I5FA 1TWHH 4DR5Q 2L11A 2K5NA 2KBNA 2JK8A 2HHHQ 4TKOB 2I5LX 4JW0A 3PO3B 1Y8OB 2ZXRA 3S14H 1Q3LA 3PUWA 2F3WA 4KJNA 1SYCA 3SE0A 4EVOA 1ASYA 1Z7TA 2I07B 5IODA 4GN3B 1E3PA 2QEJC 4OELB 2JA8G 4WJ3M 3OWEB 3M4QA 2EZVA 4UAIA 2EJFC 4DA2A 3PGZA 2D9UA 4Z9CB 3S16B 1XPRA 1PHJA 4JOIC 5CV6A 2DY7A 2LMCB 4LNQA 1A3TA 4G57A 1SNCA 1XNRQ 5CV9A 1PH1A 5EGTA 5IGBA 1JT8A 3T51B 2WB1B 3PV0A 2EYMA 4KD4A 3K5OA 1F2MA 1B3QA 3GV3A 1CSQA 4X65L 2R92G 4KN7C 1CKMA 3NBHB 4JI7L 1A0IA 3S1RB 1KAAA 1YZ6A 2F0FA 5I4DA 2RA4A 1PRTF 1E0BA 1SYDA 1Q1BA 4LF4L 3CCMA 4A4IA 1HH2P 2K01A 2QDLA 4ZUIA 2KECA 3UDXA 4O42A 2BA0A 1SXTA 4NDXA 4OIJA 1YITA 3EQLC 4NPSA 4I65A 2WINB 5EKKA 5KYIA 3NELA 4P71A 3HOZH 4R8IA 1JCKB 4LUVA 4DV0Q 1Q82C 2JA9A 2YTVA 1I50H 5DM73 3TP6A 4ZUJA 2UUBL 3CC7A 4TQUS 3H0GB 4JI0L 4A3JG 1PVOA 5CORA 3CCEA 3D0FA 1JOKA 3EFXD 2RSNA 4DK0A 4DR1L 3L3OC 5ELFA 4C3JB 3GTOH 1DCZA 5J3BA 2R93B 1JE5A 1HA5A 4DV4L 1SYGA 1CT1D 3CCSA 3QOJA 2B8GA 1GOZA 4QB4A 4X62Q 3MAQA 2M00A 3BZCA 3PO3H 1F2ZA 1Y1VB 2VB3X 2EYPA 5IYCG 1S5BD 2Z4IA 1V1OA 4EQPA 4RKLA 4OWTB 4ZQ3A 1HNWQ 4LMQD 3S24A 3I73A 1B2TA 3ITPA 5FKAC 4L8JA 4JI2L 3S1NB 4IPDA 3PUVA 2K14A 4PZ7A 3H3VC 1IZ6A 2KHIA 4MTNA 3RUZA 2ZTDA 3RZDB 4CKEA 5LMNL 2L12A 3EA6A 3P7JA 2QW7A 1PH5A 3S16H 3FDTA 5A2QE 1KXLA 5JPNC 1NMGA 3QOLA 3A55A 5JVG3 4A3EG 1XTDA 2MUYA 3BDCA 5JEAH 2O5JC 2B2WA 5M3MB 3IFDA 2ES2A 4ABNA 4G7ZC 3I4NG 3BVGA 1AE2A 1E7ZA 2K05A 4R4QA 1HTLD 3HOXB 4JK1C 3CMAA 2K75A 3I4MB 1Y8NB 2K04A 1VQLA 1A15A 2A73B 2ATWA 4OO1H 2RF4A 3QG1A 3NBHA 3FEWX 1PRTB 4EQNA 3S1RH 3TS2A 5JJLA 5J39A 5FK9C 1UE1A 1PH2A 3CQZB 2B63B 2E2JB 2I5MX 2IW3A 3NHHA 1IKMA 1GUOA 1LT5D 2H1EA 3PIPA 1G91A 3J7YW 3U4VA 3W1BA 1SYBA 1EOVA 2L0CA 1Z9FA 3RLFA 3J81j 3S9WA 1EYGA 1A8VA 2RDGA 3H0GH 4LWCA 3DM1A 2K5WA 1SJED 2LXKA 2VUMB 2Q8TA 3FVQA 3NENA 1G2TA 4M8AA 1U4MA 1GUTA 5JPMC 1RJTA 2SNMA 1NBWA 3PF5A 1HFGA 1SYEA 2K7VA 4ZYSA 3NQIA 2K52A 4IPCA 4C3JH 1L0XB 4DR2Q 1O80A 1SE8A 2H4OA 4X65Q 2R93H 1YNNC 4IUTA 1HUNA 4EQ5A 5HGQA 5J22A 4DV6L 1Y1VH 5BN3A 2FFKB 5KNBA 1HZBA 3GTKB 2XTIA 3NWTA 1DXMA 4LF4Q 4JI8L 2B2VC 4KI0A 1B8AA 2EPBA 1WYDA 3HRZC 5FLMH 2BE5C 3KLSX 4LF8L 5C4XG 5CGKA 3TSSA 4A3BB 4A3LH 5A2QL 5DAUA 3RZDH 2KCTA 2A69D 1XMQL 3ZYYX 1STHA 2F0DA 4P73A 4NXMQ 2IX1A 4A3CH 4DR3L 2WAQB 1D7QA 1EY0A 2EE1A 2UUBQ 4KHVA 1H95A 3C1FA 3G7LA 5CC4A 4A3FB 2PI2E 3D3RA 3OWFA 4TSSA 4BBRG 5I2XA 1SBBB 3I8ZA 3M3YB 1TS3A 3CKIB 1STGA 4XQQA 1DOMA 5M3MH 3P1HA 1QWYA 1F77A 3MFYA 1IBLL 1HZCA 1STYA 2CW0D 2WIIB 1ET9A 1QJOA 3ERSX 2E5LL 1QNKA 1XX8A 3KBGA 1PH9A 4DV4Q 3AMUA 1O7LA 3HOXH 4S3SA 3I4MH 3BZDB 3OHXC 3D4RA 3R2TA 1FNVA 4GS3A 5M9OA 3UE0A 1BBXC 1AZQA 3UDIA 5DLQE 1Y1WG 2K50A 4J8QA 2RHQB 3S17B 1F9PA 4BBSB 4YY3L 5C4JB 1X6OA 2XNAC 3CQZH 4RHSA 5C5LA 2B63H 2E2JH 2RKSA 4YCWA 1SNOA 1RTOA 2EJMA 5LMUQ 3SGIA 1FGUA 1K83B 3KDFB 1D5ZC 2AHOB 3OTOL 2CWPA 1NR2A 5FLXL 3GTMB 1HZAA 5LMNQ 4IZ8A 2IHFA 1IW7D 3TREA 4C56C 1RDPD 4KHPQ 5KEEA 5T1GA 4K0KL 2VUMH 4A3IB 1R4PB 2UUAQ 3TEHB 3X3NA 3MEFA 4HIKA 1EY6A 5JOBA 1SJHD 3BDLA 3JAML 4IJHA 4MN3A 2JA8B 4UP7A 4DNIA 1MSGA 3WWVA 3M4OB 3I70A 1JOQA 2O5IC 5CBAE 2K5HA 2OTJA 4IUUA 2AQ2B 2NTSA 2PZWA 5GAHC 1XMOQ 1NJIC 5ELDA 3J81i 3GTKH 2NB0A 2NWGA 3K5MA 4LFAL 1D1KA 3V96A 1PH6A 4IFDJ 1EYDA 3KLSA 2R92B 3R3OA 4A3BH 1ENFA 1W6KA 2PMZB 4IFDI 5AJ3L 3BU2A 3NK9A 1CKOA 3PUYA 1AN8A 1STAA 2A6HC 3MXGA 3ERQA 1A3UA 3C2PA 2Q2IA 4A3FH 3K57A 4JI1L 3NE5B 2A69C 3M3YH 1PZJD 1HHVA 1VQCA 3EJIA 3TRZA 4IUQA 2OF1A 4JOIA 4L5QA 1I4QA 1S4ZA 5BR8Q 1TQOA 3MXNB 3TZUA 4IOCA 2BH8A 4JBWA 3J80c 1R4QB 3H94A 2ASBA 5IE8A 3Q24A 4LUZA 4JI8Q 1D1IA 3S17H 2AQ1B 4R4TA 4BBSH 5C4JH 3IKJA 1UUPA 1C0AA 2NN6G 4JBJA 3HKSA 5D14A 3IRBA 2GVAA 3FRPB 1K83H 2MJ8A 4AH6A 4DK1A 5COYA 1J5EQ 3HGBA 3KDFA 3K0YA 5CBEE 3GTMH 2K32A 3RLNA 1ESRA 2RVLA 1KL9A 1TVXA 4MTKA 1SYFA 3UI2A 2OT2A 3PIP3 3NUCA 4PZ6A 4OWXB 1K8AC 5D65A 2JJQA 3R2IA 1HQRD 1IBKQ 3X3MA 3GV6A 4C2MB 1JWSD 1LV9A 3CXCA 3M7NA 3MZ5A 1YVCA 1IW7C 1M90C 2JA8H 5I9OA 1I94L 3M4OH 2IX0A 1TT2A 3SK5A 2CHBD 2EYLA 1TWFB 2JA6G 2O2LD 4XQNA 1PLFA 3NQTA 1G291 3I4OA 1MJEA 1VQ9A 2A5HA 4A3EB 1N33Q 2Z8LA 4DXFA 2NZ1D 4B3TQ 3ICEA 1WTQA 2F0JA 2GN5A 1AZPA 2X6GA 5CMDA 3I4NB 4C3HB 2D62A 4P2CB 3JAMi 4BY1G 1WTPA 4UY8C 2QGQA 2F0MA 2R92H 3FHWA 5C3XA 4ZK9B 2IPKD 4C1NK 1VQ7A 3TDQA 3RZOB 1YNJD 3VA7A 2IT1A 4AIMA 5IT9L 3UDGA 4KK7A 1PV4A 3H3VH 1XPUA 4JPBW 1HFNA 4OEMB 1KRTA 1WD0A 5ELBA 5C6AA 1SNQA 3NTKA 1BQQT 1MBYA 1LTGD 2K6AA 1LTID 4BA1I 4JI5Q 1KDAA 2Z1CA 5KIXA 3I4LA 4LFCL 1RIPA 2K5VA 4A3KG 4L5TA 1UE5A 4DAVA 3MXPA 2E8GA 4QMGA 3R8BA 3KOJA 1LM0A 1ET6A 3MXNA 3OW2A 4QQBX 2GA4B 1EUJA 1HPCA 2R6GA 1XWEA 3A8IE 4AYBE 4A3JH 2B2UC 1I6HB 1LO5D 2WKCA 1LTBD 1P8LA 4N9PA 4GZYC 2JP1A 2UU9L 3H91A 2F0VA 4K5XA 4DV5Q 1D2BA 2PW7A 2LFNA 3TP7A 3I3CA 2F0LA 3DXJC 4M1UB 3SDZA 4B3SQ 3STBC 2Y0SE 4DNTB 4F87A 5IYCH 5DM63 4IN3A 5IGGA 1KNEA 3HKZE 3HOUG 4HR7B 4C2MH 1HJPA 3KLRA 4JI1Q 5C4XB 5EJWA 1A2UA 2UXCL 1TWAB 3E9IA 3FMCA 1HNZL 2ID0A 4DR7L 4IUPA 1TS5A 2EYJA 3HKZG 4K8IA 1CZWA 2NYZD 5E1FA 1JMCA 4DKAC 1NR4A 1TWFH 4JI4Q 3DEPA 4YCVA 1OXVA 4A3EH 1YHBA 1WCMB 5LMNW 3FPUB 3NXWA 2F0OA 1X32A 3KUPA 2EY5A 4C3HH 3I4NH 1F9RA 4KD3A 1WI5A 5LL6S 2UUCQ 1CA5A 1HR0Q 2X69A 5E7NA 3A8JE 3B6YA 2BOSA 2FHTA 3PO2B 2B2VA 2YTXA 3RZOH 4B3RL 2LY7A 4GNXC 1PXUA 5D3DA 4CHTB 1Y1WB 5C44B 2LSSA 4RHRA 3OPOA 1EIGA 3CP0A 1FYCA 2L1BA 4K2LA 1YNJC 1UAPA 5I9PA 1MIUA 1FNWA 2TMPA 3I90A 4DV1L 1I94Q 4FYDA 4ME5A 4PNYA 5IP7G 4CJ1B 2F0EA 1L0YB 1B53A 4ULLA 1BKBA 3HOWG 1CHPD 2WKDA 1JWUD 4DXGA 4X64L 2AUJD 5C0XJ 3VR4A 2PPBC 1I6HH 4DV7L 5C0XI 3T1HL 2BDOA 5C3EG 5IYBH 2LS01 5EPKA 2VQEL 1TS4A 4R4OA 1SE4A 1WD1A 1KLGD 1UWVA 4DUZQ 1RL2A 5KGUA 2IY5B 4KHZA 5CV5A 3F2UA 2JN4A 4KKUA 1BBUA 3GTQB 4RAUC 3A74A 2ZTEA 3VYUA 4ZKCB 4P72A 3MA2B 3CU7A 4QL5A 1DD2A 1N32Q 1Q46A 5C3WA 1QVCA 3ZJYC 3CCRA 3KJOA 1AE3A 1PH7A 5EQ0A 1SEBD 1KLUD 4YHHQ 2FJ2A 2DJGC 1H9MA 3KLWA 3TMEA 5C4XH 3U9SA 4LF7L 4KJOA 1TWAH 4DR4L 4POFA 2PW5A 4X3SA 2TSSA 3HZXA 5EPLA 1PH4A 4OIKA 2UXBL 4U673 4FP5D 1STBA 1NAPA 4J1MA 4KMUC 1YNND 5I2YA 5HURA 2SEBD 1E24A 1WCMH 2N3SA 1FL0A 1RKNA 3HEJA 2QDBA 4DR6L 3KBXA 1LTRD 5FOBB 1JC7A 4ZAIA 5CR3A 1CZGA 4UHVA 3BVZA 3PO2H 2EIFA 2K03A 1LUZA 1GXDC 4O2DA 5C4HA 2ZT9C 1LTTD 4DV2L 2BE5D 1SROA 4GKKL 3S2DB 5C5MA 4KTAA 4J15A 2ZJQA 4WJ4A 2HT1A 3C1EA 1B9MA 1Y1WH 2PCFB 1GUWA 3NBIA 5C44H 1JQYD 1NE3A 1F2LA 3G48A 2MQHA 2AKWB 3K5NA 1HTPA 3D8GA 3ND8A 3GTPH 4DGZA 1VF5C 3W1GA 3M4PA 3BYYB 4L5RC 1STEA 1PFMA 1HNZQ 1SAPA 1M8AA 4DV3L 4R9WA 3EN2A 4IJLA 1VQEA 1TY0A 3DWPA 3HOVG 4OWWB 2F4IA 2EQSA 1LABA 3FKIG 2NUCA 1PFNA 3M4YA 3S1QB 2XRQD 2SOBA 2EYHA 5C0XG 4P74A 1M1KC 1LT4D 1DYQA 3RLOA 4JBKA 5BN5A 3J7ZC 2QF7A 3CHBD 4CKCA 4X66Q 1SNMA 4FXDA 2MP1A 4CJ0B 1WJJA 4WJWA 3FP9A 4CDFC 1W3SA 1CTMA 1SE2A 2JA6B 4AQYL 5JJIA 3R93A 4B3ML 1IBML 3LWUA 2F0NA 1UE6A 2Z4HA 4X3UA 5ELOA 2EXZA 3F2CA 3GTQH 5LHY1 1VQKA 2EY2A 3KFUA 4A3MG 2F3VA 3J81c 3BG3A 2ZM6L 1VMCA 2F1MA 4QJFA 3VYSA 4BY1B 1PZID 1KABA 1S5FD 4KN4C 5IOCA 4ID6A 1ILPA 1DOLA 2XN9C 1PDQA 2KVMA 2M9VA 5I6WA 2ICEC 2RDFA 2HIVA 4LF5L 1RCVD 1MI2A 1V43A 1ENAA 2QA4A 2UXDL 1PTOC 1HNXL 1WFQA 1ASZA 3W2DA 4IUVA 1I3QB 2F4VL 2F52A 1M4VA 1XTCD 2JA5G 3PF4A 4PQXA 1GUNA 3ER0A 2N55A 3OMGA 4PG3A 5IGCA 4JI7Q 3AFPA 4HIOA 2G9DA 3S2DH 1DONA 2D5DA 2LXJA 4UP9A 2KUMA 2F03A 4JI3L 4NXNL 1UE7A 5JEAJ 3A8KE 2PO4A 4K6DA 4C3IG 4GNXB 5IGEA 2VY3A 3OSOA 4A3DG 1FVIA 2NN6H 4DN4M 2A6HD 4LF7Q 2QILA 4IURA 1H9JA 3A5ZB 1XJVA 1VQBA 1WTHA 4PMCA 1FJGL 3RN5A 3D6WA 4BY7G 1D8LA 1X56A 5JJKA 3AU7A 4BA2I 4OO1I 2CWAA 3LX0A 2Q8IB 1HR0W 1G6PA 4JI0Q 3S1QH 3DEOA 3I2ZA 3K80C 1U9RA 2RHSB 4Q5VA 1Z6HA 3D4WA 4MHEA 4XTCS 5DNFA 4DR1Q 3RD4A 4GKJL 3GTGB 1AEXA 4OX9L 2B2UA 4QIWE 1IL8A 3E0EA 4P75A 2IWHA 5M3FB 4O1NA 4A93G 1U5KA 1UEBA 2DGYA 1GM5A 2JA6H 1ICWA 1X3QA 5TSSA 2SNSA 5GQOA 3SEBA 2ZTCA 3K5LA 5E4XA 5FLXc 2VS1A 1JOOA 1BO0A 3VA5A 3RN2A 1FD7D 4RGOS 3D4DA 2WFWA 3DLLA 4HCEA 4BY1H 4XT3B 1NCVA 3T53B 4A3GG 5KYLA 4JI2Q 4YIJA 3JAMc 4NMZA 5D3IB 2JEAI 4H0LC 5ELNA 4V190 1EZ6A 2A8VA 1KC8C 3G6JB 5M5XB 4DV3Q 2EOTA 2HDMA 2HQLA 2PNHA 2XRSD 1SR3A 1CA6A 3H09A 3CC2A 5E3FA 3PIOA 5IYDG 1X65A 5IWAL 4LF9L 2JYOA 5GADC 2ZXOA 3K8AA 3VR6A 1I3QH 1VQDA 1PTOF 1K9MC 1R9TB 3V05A 4GN4B 4TRDA 2E76C 3VR3A 3G4SA 1EEFD 1EY5A 2Z6KC 3ULJA 1QNUA 1L2FA 3J80E 1X54A 1SE3A 4B3MQ 4QUCA 1EZ8A 1IBMQ 1BCPC 2C35B 3GO5A 2WB1E 1TWGB 4A75A 1JJCB 4V0BA 1BF4A 1EWHA 2R7FA 5H1SE 3C3LA 2NVYB 5C3EB 1WTXA 1JJGA 2R7ZG 5T1IA 1S40A 2N49A 4WRDA 2WB1G 4GNXA 1T9HA 3T13A 1Q12A 3KF8B 1U4PA 4A76A 1C9OA 1QG7A 3K7AB 4LAAA 1PH8A 1JJ2A 3FPPA 1DGSA 2KEDA 2AMCB 4GLAC 4LF5Q 4RMFA 4OO1G 3CW2C 1G6ZA 1P16A 2MFIA 2RBMA 1IYUA 1I4GA 2B3GA 4NW2A 1U0LA 3HOUH 1AP0A 2BA1A 2ENBA 1RD9D 1TKWB 1TIID 2XIWA 5ELEA 4KY7A 2GVBA 1YEZA 4XYQA 3GTGH 4DUYL 3PSIA 4F7XA 1QILA 5M3FH 2WACA 1H9SB 1LYLA 4BS9A 2JA7G 1VQ8A 5AFWA 3M9BA 4DNRB 2VW9A 3H0GG 2OWOA 2J7ZA 4A3JB 2AUKA 3L0OA 1QE6A 4DV6Q 1I6VC 2EJGC 1YBYA 4UDUC 1II3A 4C1NI 3TN2A 3STBD 1N34L 3I56A 5EKIA 2CVRA 4GLVB 4BWGB 2CFMA 4JV5L 3K58A 3M7GA 4RH6A 1A63A 1SSOA 4LF8Q 2CH4A 1V8QA 2ALYB 3DWQA 1C48A 4QUFA 2RCFA 1TR5A 1Q8IA 2J0TD 4RG1A 4Y52H 5M5XH 1JB7A 3WDNA 1XMQQ 2Z9HA 1KAWA 1EIFA 4CDCC 1QOHA 4DR3Q 1BDOA 1ZXTA 4LW1A 1MHWC 1N36L 3I55A 3ULLA 1PTOB 1WOCA 4KKSA 2DN8A 4A3LG 3HS0C 1IBLQ 1R9TH 5IP7H 1FGBD 2HHHL 2SDFA 2DUDA 2KQ3A 3CCVA 2E5LQ 1RHPA 1CQVA 3BS1A 3MTSA 5EAYA 3HOVB 4OXPA 3FKIB 3OOCA 3QR8A 1CM9A 1LT6D 4X3TA 1EWCA 1MSHA 5HGTA 3K0XA 2A68C 1TWGH 4QY7A 1QZGA 4FXGC 1VDZA 2NVYH 5C3EH 1EFID 4Q0FA 3QJYA 3DHQA 4YY3Q 2FINB 1ZYRD 1VQ5A 3AQQA 4FDBA 4WFN3 4MZ9A 5BN4A 2VQFL 2IJ0A 1V1QA 1G51A 4IFDG 2EYFA 2B2YC 4HIDA 3K7AH 3OTOQ 2CCZA 3KF8A 3E5SA 3EROA 1VCIA 4ODGA 2F3IA 1X9NA 2D0OA 5E4WC 5FJ8G 1GHKA 2E2HB 4R4IA 4K0KQ 3NTIA 4IO9A 5KNCA 4LF9Q 3H6MA 1AFPA 4Y7NH 5K5PA 4HAEA 1IXRA 1V1PB 4YCUA 1LTLA 1BOSA 2M2LA 1X3PA 3QO2A 1Z47A 2HCIA 3DUZA 1SFOB 2B29A 3QIAA 4K2KA 3L7ZC 1K3RA 2VZAA 2Z0SA 3EIVA 1H9SA 2F0GA 2YYZA 2H5XA 4TVAB 1B9NA 2CH4W 3O13A 4APVA 4IQZA 1S5CD 2F0PA 1EL0A 2RSOA 5L37A 2KA7A 4K8JA 4LFAQ 4CGYB 4AYBG 4DV0L 3URYA 2VB2X 2JA5B 3A0JA 3MWYW 2XSCA 3LWEA 4DF7A 4IPHA 1CQFA 3Q6SA 4MNOA 4XDXA 4IPGA 5AJ3Q 3D31A 1Q7YC 1EIYB 1VQHA 3TS0A 2F0HA 1FR3A 3K81C 2AWNA 4C3IB 5IGDA 2BCOA 1X3FA 2A19A 1CKNB 4A3DB 1AH9A 3MVVA 5FO7B 2Y0SG 1I4HA 3PIO3 1PTOH 2WAQE 1NUCA 5G3LD 1I4PA 1E2ZA 3U9OA 1ZEQX 4X62L 2FXQA 1E1OA 3TQYA 4BXXG 5CV8A 3HOVH 3FKIH 4KLKA 4HMJA 1J6QA 1JE4A 3TP8A 3H3VI 4IUNA 3HG9A 1HNWL 3GD7A 3HOYG 4BBRB 3SVMA 3VYTA 3NTHA 2L9HA 3VR5A 2ZJPA 3GP7A 4J6HA 4GN5A 2MGSA 4DPGA 3L2PA 4A93B 1OXSC 3AB9A 2JEBI 4B08A 3PQIA 1C4QA 3NEMA 1NTGA 2K5DA 3OIQA 4OGQC 2K5QA 2DY8A 1ZYRC 1TU2B 4HCSA 2A74C 3H15A 4U68A 1GHJA 3G6EA 1IYJB 2RQXA 4A3MH 2KCCA 2E2IB 1I4XA 3L9AX 3MHBA 2E2HH 3I7FA 4L63B 4ALPA 3GTPB 5ELCA 4A3GB 2FMCA 4DU9A 2MO0A 4F88A 4YWMA 2A6EC 3T1YL 2A1AA 1K8OA 1U4LA 3NWSA 3JC66 2D2CC 5CV7A 3NP8A 2NBFA 3LNNA 4RWSC 3U58A 4JBMA 5DEHA 1V1PA 5JAVA 1SFOH 5F2DA 2IL8A 4CBVA 3I72A 3E6ZX 4CJ2C 2F0QA 2EXDA 3PUZA 4I7ZC 1RF2D 3K59A 4A3IG 3A54A 3UE1A 3T4AC 3KJPA 2P5ZX 1EYCA 1B4OA 1SNDA 4H13C 1VQMA 4HJAA 2F0WA 3CD6A 1LTAD 2B2TC 1WTVA 4JVZA 2VQFQ 1L0WA 2HD3A 2JA5H 2E2DC 4LJZC 3DMUA 1N9WA 1U4RA 2Q2TA 4PZ8A 2KCNA 4GOPC 4B9XA 4XQJA 4RFBA 4YWKA 2JSOA 2L55A 4C3IH 2L4NA 2B39A 2R7ZB 2PMZE 5IP9G 4A3DH 2E75C 1LT3D 1KHIA 3Q22A 4DR2L 1CKNA 3W3AA 1UNSA 1PTOD 1T5XD 4LFCQ 2AWOA 2NZHA 5CV4A 1JICA 2PYKA 4KKTA 1PYSB 5LL6X 4BY7H 3D6CA 3CPFA 1PA6A 4QGUA 1B44D 1QVGA 4K5VA 3AEVA 1XNQL 1A3VA 2DNCA 4BBRH 3CRKC 2EY1A 1A6XA 1SMYC 2Z6KA 4WORA 2OQ0A 1VQIA 2PQAB 1EY7A 3WOEA 2UU9Q 4NP5A 4NXML 4A93H 2OCEA 2JA7B 1RODA 4CDEC 1A62A 2PI2A 3AYHB 3MFGA 4H44C 1HUMA 3MC0B 1E2VA 3J7AF 1G8ZD 4LF6L 2I0QA 1Y8PB 2OTLA 4UP8A 1Q90A 1V9PA 4JI6L 1EQRA 2E2IH 2XWJB 4OHJA 4HTHA 3J81E 2XWBB 5FO9B 1J8IA 1EOTA 4FXKC 1KDBA 3CRLC 3CCQA 1GJXA 2HIXA 4A3GH 2EVBA 2D0PA 5EBCA 2UXCQ 2BH2A 2OXPA 4HSVA 1SRUA 4DR7Q 4HJ9A 1EY8A 4RGNA 5IYDH 2PZTA 3EVQA 1S5DD 1LTSD 3W5OA 2HCCA 1NMFA 2F0KA 2PNRC 4RKBA 1K0SA 1GO3E 5LMUL 3F2DA 4FF3A 4MIUA 1ESFA 1SDFA 3TZDA 2ZXPA 3GTLB 3GTJB 4XXEA 3K7UC 1YI2A 5K36G 4ZCKA 3KK7A 1QZHA 1KD1C 4DK6C 4KHPL 1W6JA 4B3RQ 4HJ8A 2UUAL 5M5YB 2K33A 3V2TA 3CCJA 1PFSA 3OW7A 3E9HA 2FMMA 1SNPA 2R7ZH 3T56B 4C3HG 2E74C 3J7AV 1CSPA 4K6LA 3T1YQ 1C7YA 1IHZA 2NZOA 4RCNA 4E6IA 4DV1Q 1PYBA 1EY9A 1F2YA 1QUQB 3A7LA 3ND9A 5IY0A 4ILWA 1N8RC 2DNEA 1Q86C 2HDLA 1XMOL 3S1MB 1CUKA 4X64Q 1NNXA 3BYTB 2Z6BA 3VYRA 1EQVA 2K1BA 4G7OC 1GUGA 1QB5D 3UDFA 2WP8J 3M85A 1RTNA 1ML0D 4DV7Q 1K8GA 4HN7A 3T1HQ 2XVSA 1BCPD 1PZKD 1D5XC 4OONA 1YHQA 2VQEQ 2CQOA 5G3LF 4A3KB 3TBIB 3CC4A 1F9SA 2PQAA 1H9KA 1HXYD 2JA7H 2PQEA 1YJWA 2OQKA 3J81L 4ZRZA 1L1OC 5KRUA 5GAGC 1GD7A 5FLXE 1OXTA 3Q23A 2KENA 1O7YA 2ICIA 4G4KA 2C9OA 2Q2UA 2B2YA 1C8CA 5EKLA 5IYBG 1UEAB 1MKHA 1QCBD 4AYBB 2YU9B 5BR8L 1DZ1A 4HJ7A 3NPPA 4FNFA 4H7BA 1KNAA 3JAME 4DR4Q 3CCLA 2F0IA 2XGTA 3S15B 2G9HD 4FF4A 4R4CA 3U50C 2X6LA 3KYHC 3PMFA 1VMPA 1EU3A 5HY6A 3TP5A 4N9TA 4HSPA 3HOUB 2UXBQ 5A35A 1XNQQ 1VS0A 2Y0SB 2DJFC 2NVQB 3P20A 2I46A 2F0TA 4JC0A 3S1NH 1KTKA 3SXHA 1K0RA 4X3KA 4CDDC 3HOZG 1J5EL 3HKZB 4KV6A 3GTLH 4DR6Q 1B3AA 4PMBA 3GTJH 1BNZA 5J1ZA 2N88A 1VQGA 2MHVA 2F0SA 3OYYA 4DV2Q 1EU4A 4GKKQ 3WOFA 4LF6Q 1IBKL 1A2TA 5M5YH 3HOYB 1W2BA 4JI6Q 1WCMG 4GOPB 1LLRD 4IALA 2CQAA 2AQ3B 1YNXA 1PFBA 4RA8A 1SLJA 4IFDH 3F8TA 2B8FA 4K5WA 5GAEC 2R61A 4HJ5A 3PO2G 2KOLA 1CHQD 2ZJRA 1J9OA 1VQNA 1HZ9A 2MO1A 3PO3G 1N33L 4PV1C 1QUQA 4B3TL 3S1MH 3PUXA 5C44G 5FJ8H 4RGTA 2KCMA 1B7YB 4B9WA 1E22A 1VQOA 1NSNS 1VQAA 2NN6I 2HQEA 1NY4A 1WTRA 2A68D 3OMCA 3CPWA 1JB3A 2VXWA 1BR9A 4JG2A 1PMRA 4A3KH 4R1JA 2KJXA 4RCOA 3HOWB 5IIFA 1CK1A 1EFWA 3J7A5 4AQYQ
chains in the Genus database with same CATH topology
5C0XJ 5JJLA 2Q2HA 3KF6B 2D0OA 5GROA 1I6HH 5FJ8G 1UE1A 1PH2A 4DV7L 4R4IA 4K0KQ 4JI5L 5C0XI 4IO9A 3T1HL 5C3EG 4LF9Q 5JEAG 5IYBH 2I5MX 4Y7NH 2ZM6Q 2VQEL 2YU9H 2V1CC 3A5UA 4R4OA 3PIPA 2QEXA 1UWVA 3U4VA 1IXRA 1RL2A 1Y14B 3W1BA 4YCUA 4DUZQ 2IY5B 1LTLA 4KHZA 1EOVA 1Z47A 1Z9FA 1BBUA 2B29A 3RLFA 3J81j 3CF5A 1EYGA 1E1TA 3S15H 1A8VA 3A74A 2ZTEA 4P72A 3L7ZC 1K3RA 2VZAA 2Z0SA 3EIVA 3H0GH 4LWCA 4QL5A 1SN8A 1Q46A 2LXKA 1N32Q 2YYZA 2H5XA 1QVCA 4TVAB 3ZJYC 3CMEA 2UXDQ 4APVA 2JE6I 3NENA 3KJOA 1AE3A 3CCRA 1PH7A 2L15A 2N8NA 4YHHQ 1TXYA 1HNXQ 1NBWA 3PF5A 3BJUA 3KLWA 4LFAQ 3ULPA 3VDYA 5C4XH 2NVQH 4DV5L 3CCUA 4LF7L 4JYAL 4AYBG 1TWAH 2F4VQ 4DR4L 2K52A 4IPCA 4C3JH 4DV0L 4DR2Q 4POFA 4B3SL 1SE8A 3A0JA 4X65Q 2R93H 4X6AH 4IPHA 4DAYB 4MNOA 4BXXH 4EQ5A 4IPGA 5HGQA 5AJ3Q 3D31A 4LFBL 1Q7YC 1EIYB 1VQHA 4DV6L 3TS0A 1PH4A 1Y1VH 1HZBA 4GLXA 3K81C 2UXBL 2XTIA 2AWNA 4LF4Q 4JI8L 3HOYH 4KI0A 4JI3Q 1XPOA 1B8AA 1X3FA 2A19A 1CKNB 4NXNQ 1AH9A 1E24A 1WCMH 2N3SA 1FL0A 1WYDA 2Y0SG 3DM3A 5FLMH 4LF8L 1EQQA 5C4XG 1IL2A 2WAQE 4GOPA 4DR6L 4A3LH 3BZKA 2IHEA 4X62L 4L5SA 3RZDH 4JI4L 2KCTA 1KQSA 1XMQL 2R93G 3PO2H 2EIFA 2FXQA 1E1OA 1LUZA 4P73A 4NXMQ 4O2DA 4DV2L 3TQYA 4HIMA 2IX1A 4BXXG 1SROA 4GKKL 3HOVH 4DR3L 2K4KA 4A3CH 1D7QA 3FKIH 4KLKA 4J15A 2UUBQ 1FJGQ 2ZJQA 4WJ4A 1Q1EA 1J6QA 2HT1A 3RR5A 1Y1VG 3H3VI 1Y1WH 1HNWL 1H95A 5C44H 1NE3A 2PI2E 3GD7A 1PH3A 3G48A 3HOYG 1OXXK 4BBRG 2MQHA 2AKWB 4PMWA 3GTPH 2ZJPA 5M3MH 5FLMG 3W1GA 4DK3C 1Q81C 3M4PA 4DR5L 1IBLL 4L5RC 2UUCL 1HR0L 1HZCA 1HNZQ 4GN5A 4DPGA 3RNUA 4GKJQ 3ERSX 3L2PA 2E5LL 3GDEA 1OXSC 2JEBI 4NB3A 1PH9A 1X3GA 4DV4Q 3F1ZA 4DV3L 1YJ9A 3EN2A 3NEMA 4YWLA 1OTCA 3HOXH 4DAMA 4IJLA 1NTGA 4OX9Q 3HOWH 1VQEA 4ME3A 3I4MH 4A3CG 4EX5A 3HOVG 4OWWB 2EQSA 3FKIG 4GS3A 2A8VA 3UE0A 3UDIA 3H15A 1O7IA 5DLQE 2K50A 5C0XG 3G6EA 4P74A 1IYJB 2RHQB 4A3IH 3AFQA 4A3MH 1M1KC 2CKZB 3RLOA 4JBKA 4YY3L 5IT9c 1X6OA 3CQZH 3J7ZC 2E2HH 2B63H 1L1OB 3KF6A 2E2JH 3I7FA 4YCWA 3HFZB 4ALPA 4X66Q 1B70B 5M3MG 5LMUQ 2VL6A 1FGUA 3SGIA 2MO0A 3KDFB 2I5HA 1WJJA 4YWMA 3T1YL 2A1AA 3FP9A 1W3SA 2AHOB 2N78A 3OTOL 2CWPA 3JC66 1HZAA 5LMNQ 4AQYL 2IHFA 3HOXG 5JJIA 3U58A 4JBMA 3TREA 4B3ML 1IBML 4LUOA 1SFOH 3I4MG 1MJCA 1UE6A 5ELOA 3F2CA 1XNRL 3GTQH 3Q8DA 4KHPQ 2EXDA 3PUZA 1OXUA 3EBEA 1VQKA 2VUMH 4K0KL 4UPAA 4A3IG 2UUAQ 3KFUA 3UE1A 4A3MG 3TEHB 4HIKA 3MEFA 3KJPA 3J81c 5IP9H 1VQPA 2B63G 2ZM6L 4QJFA 4IJHA 5IWAQ 1VQMA 4HJAA 2NVXH 4UP7A 3CD6A 4DNIA 4DUZL 3WWVA 1S3OA 2K5HA 2VQFQ 1L0WA 2YV5A 2JA5H 2OTJA 1S72A 1N9WA 2HIVA 4LF5L 2Q2TA 4O0AA 4PZ8A 1N32L 1GKHA 4GOPC 1V43A 5GAHC 2QA4A 2VNUD 2UXDL 4YWKA 1XMOQ 3J81i 1NJIC 1VQJA 1BBWA 2KHJA 1KRSA 4YHHL 1HNXL 2VUMG 1WFQA 3GTKH 4C3IH 1ASZA 2PMZE 5IP9G 4LFAL 4A3DH 1X3EA 1KHIA 1GVPA 2F4VL 3U4ZA 4DR2L 1PH6A 4IFDJ 1CKNA 2F52A 1YHAA 4LFCQ 4A3BH 2AWOA 2NZHA 4POGA 4IFDI 2JA5G 5AJ3L 3BU2A 3PF4A 3ER0A 4PG3A 1PYSB 1CKOA 5M5WH 4JI7Q 3AFPA 3PUYA 4HIOA 4BY7H 2YTYA 1YJNA 3CPFA 3S2DH 1PA6A 2LXJA 4UP9A 4QGUA 4JI3L 1QVGA 4NXNL 3AEVA 2Q2IA 3F2BA 1XNQL 1X55A 1UE7A 5JEAJ 4A3FH 4GNXB 4BBRH 4JI1L 3PCOB 2VY3A 2Z6KA 4A3DG 3M3YH 1FVIA 1EWIA 1VQCA 3TRZA 2OQ0A 1VQIA 2PQAB 4JOIA 4L5QA 4JYAQ 4LF7Q 5BR8Q 2UU9Q 3G71A 2NVTH 3A5ZB 4A3BG 3MXNB 4NXML 4A93H 4DUYQ 2OCEA 1VQBA 1XJVA 4IOCA 1A62A 3AYHB 2PI2A 2BH8A 4JCVE 1FJGL 4JBWA 3J80c 3RN5A 1Q8KA 2R7DA 2MNAA 4BY7G 4LF6L 1X56A 1D8LA 2ASBA 1VQ6A 2I0QA 2WAQG 4LFBQ 4BA2I 1SMXA 2CWAA 4OO1I 5JJKA 5IE8A 4UP8A 2OTLA 1VQFA 1HR0W 1G6PA 4JI0Q 3S1QH 3I2ZA 1V9PA 3K80C 4LUZA 1EQRA 1K73C 4JI6L 2E2IH 4JI8Q 4A3FG 3S17H 4R4TA 4BBSH 5C4JH 2RHSB 1C0AA 1N34Q 2NN6G 4JBJA 3HKSA 4XTCS 3CCQA 4DR1Q 1KIXA 4GKJL 2HIXA 3IRBA 2GVAA 4A3GH 2D0PA 3LGJA 4JV5Q 4XIGS 1K83H 1L1OA 2UXCQ 2BH2A 4OX9L 4QIWE 1SRUA 3E0EA 4P75A 3J80i 4AH6A 5M3FG 1J5EQ 2JQOA 1U5KA 4H02A 4DR7Q 1UEBA 4A93G 2DGYA 3KDFA 1GM5A 1QVFA 2JA6H 4HJ9A 3GTMH 3RLNA 5GQOA 4IOAA 1KL9A 2ZTCA 1BVSA 5IYDH 5FLXc 2VS1A 1YIJA 4PZ6A 4OWXB 3W5OA 3RN2A 3CAMA 1K8AC 2JJQA 1IBKQ 1VQ4A 1NMFA 1TWCH 3CXCA 4BBSG 4X66L 2WFWA 1N36Q 1GO3E 3S2HH 5LMUL 3M7NA 3F2DA 3DLLA 1YVCA 1M90C 4BY1H 2RCNA 2JA8H 1I5FA 4A3GG 1TWHH 4JI2Q 4DR5Q 1I94L 3M4OH 2IX0A 2JEAI 3JAMc 3K7UC 1YI2A 5K36G 5ELNA 2K5NA 2KBNA 2JK8A 1QZHA 1KC8C 2HHHQ 1KD1C 4DV3Q 2PNHA 2I5LX 2HQLA 2JA6G 1G291 4DK6C 1SR3A 3I4OA 4KHPL 1MJEA 1VQ9A 3CC2A 3PIOA 5IYDG 3S14H 4HJ8A 1X65A 2UUAL 4B3RQ 1N33Q 3PUWA 4B3TQ 3CCJA 3ICEA 1PFSA 5IWAL 4LF9L 3E9HA 2GN5A 1ASYA 2R7ZH 5GADC 3K8AA 1I3QH 2D62A 4GN3B 1E3PA 1VQDA 4BY1G 3JAMi 1CSPA 2JA8G 1K9MC 4WJ3M 4UY8C 2QGQA 3M4QA 4GN4B 2R92H 3T1YQ 3FHWA 1C7YA 3G4SA 1VQ7A 2NZOA 2Z6KC 3PGZA 4DV1Q 3ULJA 1PYBA 5IY0A 1QUQB 1L2FA 2IT1A 1N8RC 4AIMA 1XPRA 1X54A 1Q86C 4JOIC 1PHJA 3UDGA 4B3MQ 1XMOL 1IBMQ 1PV4A 3H3VH 2C35B 3GO5A 1CUKA 2WB1E 4X64Q 4LNQA 1XPUA 1XNRQ 4A75A 1JJCB 2R7FA 1KRTA 5H1SE 1PH1A 3UDFA 2WP8J 3M85A 4DV7Q 1JJGA 1JT8A 1K8GA 4BA1I 1S40A 3T1HQ 4JI5Q 2R7ZG 2N49A 2WB1G 3PV0A 4GNXA 4LFCL 1RIPA 1T9HA 4OONA 1YHQA 1Q12A 1CSQA 2CQOA 2K5VA 3KF8B 2VQEQ 4X65L 2R92G 4A76A 1CKMA 3CC4A 4A3KG 1C9OA 3NBHB 4JI7L 2PQAA 1PH8A 4L5TA 1UE5A 1JJ2A 2JA7H 2E8GA 1YJWA 1DGSA 3KOJA 2AMCB 1A0IA 1LM0A 4GLAC 4RMFA 4LF5Q 2OQKA 3CW2C 3OW2A 4OO1G 4QQBX 1YZ6A 1P16A 1L1OC 2MFIA 5GAGC 1GD7A 2R6GA 1OXTA 1EUJA 4AYBE 4A3JH 2KENA 1Q1BA 4LF4L 3CCMA 1P8LA 4A4IA 2B3GA 1U0LA 1HH2P 3HOUH 2BA1A 3UDXA 2Q2UA 2BA0A 5IYBG 1YITA 4NPSA 1MKHA 2GVBA 3TS2A 5BR8L 2UU9L 1YEZA 3NELA 4P71A 4HJ7A 3HOZH 3GTGH 4DUYL 4DV5Q 3PSIA 4LUVA 4DR4Q 4DV0Q 3CCLA 5M3FH 1Q82C 2JA9A 2YTVA 1I50H 4B3SQ 1LYLA 2XGTA 2JA7G 3STBC 1VQ8A 2Y0SE 3M9BA 2VW9A 4R4CA 3U50C 3CC7A 4TQUS 2UUBL 3KYHC 3H0GG 2OWOA 5IYCH 1Y1WG 4JI0L 3L0OA 4A3JG 4DV6Q 5HY6A 1PVOA 3CCEA 3D0FA 1YBYA 3HKZE 3HOUG 1XNQQ 2UXBQ 1VS0A 1N34L 3STBD 4C2MH 4DR1L 1HJPA 3I56A 4JI1Q 4GLVB 2CFMA 4JV5L 4JC0A 1HNZL 3E9IA 3S1NH 2UXCL 2ID0A 3GTOH 1K0RA 1A63A 4LF8Q 3HOZG 1J5EL 4DR7L 5J3BA 3GTLH 2ALYB 3HKZG 1JE5A 4DR6Q 4DV4L 3GTJH 3CCSA 1JMCA 4DKAC 1VQGA 4RG1A 4X62Q 1TWFH 4JI4Q 5M5XH 1JB7A 1XMQQ 4YCVA 4Y52H 1KAWA 3BZCA 3OYYA 3PO3H 1EIFA 4DV2Q 4GKKQ 4LF6Q 5IYCG 4DR3Q 1IBKL 5M5YH 1OXVA 4A3EH 1YHBA 4LW1A 4OWTB 1W2BA 1N36L 1HNWQ 3I55A 5LMNW 1WCMG 3S24A 4GOPB 3ULLA 4JI6Q 3I4NH 4C3HH 4JI2L 1WOCA 4IPDA 1WI5A 3PUVA 2K14A 1YNXA 4PZ7A 4A3LG 1SLJA 1IZ6A 2KHIA 4MTNA 3F8TA 1R9TH 1IBLQ 2ZTDA 2UUCQ 5IP7H 5GAEC 5E7NA 1HR0Q 2HHHL 3B6YA 2DUDA 5LMNL 3CCVA 2YTXA 4HJ5A 2E5LQ 3PO2G 3RZOH 5EAYA 2ZJRA 1PH5A 4OXPA 1VQNA 4B3RL 1HZ9A 2MO1A 4GNXC 3S16H 3PO3G 1N33L 1KXLA 1NMGA 1QUQA 4B3TL 3S1MH 3PUXA 2LSSA 3K0XA 5C44G 5FJ8H 1TWGH 4QY7A 1QZGA 4A3EG 2KCMA 1XTDA 2NVYH 3CP0A 1B7YB 5C3EH 1E22A 4YY3Q 1VQOA 2ES2A 1VQAA 3I4NG 1VQ5A 2NN6I 3AQQA 4FDBA 1NY4A 1MIUA 4MZ9A 2VQFL 3CPWA 1AE2A 1E7ZA 1G51A 1V1QA 4DV1L 1I94Q 4R4QA 5IP7G 4IFDG 4JG2A 4A3KH 4R1JA 4HIDA 3K7AH 3CMAA 1BKBA 3OTOQ 2K75A 1EFWA 1VQLA 2CCZA 3HOWG 3J7A5 4X64L 4AQYQ 1VCIA 2ATWA 2RF4A 3S1RH 2F3IA 1X9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X J;  5JJL A;  2Q2H A;  3KF6 B;  2D0O A;  5GRO A;  1I6H H;  5FJ8 G;  1UE1 A;  1PH2 A;  4DV7 L;  4R4I A;  4K0K Q;  4JI5 L;  5C0X I;  4IO9 A;  3T1H L;  5C3E G;  4LF9 Q;  5JEA G;  5IYB H;  2I5M X;  4Y7N H;  2ZM6 Q;  2VQE L;  2YU9 H;  2V1C C;  3A5U A;  4R4O A;  3PIP A;  2QEX A;  1UWV A;  3U4V A;  1IXR A;  1RL2 A;  1Y14 B;  3W1B A;  4YCU A;  4DUZ Q;  2IY5 B;  1LTL A;  4KHZ A;  1EOV A;  1Z47 A;  1Z9F A;  1BBU A;  2B29 A;  3RLF A;  3J81 j;  3CF5 A;  1EYG A;  1E1T A;  3S15 H;  1A8V A;  3A74 A;  2ZTE A;  4P72 A;  3L7Z C;  1K3R A;  2VZA A;  2Z0S A;  3EIV A;  3H0G H;  4LWC A;  4QL5 A;  1SN8 A;  1Q46 A;  2LXK A;  1N32 Q;  2YYZ A;  2H5X A;  1QVC A;  4TVA B;  3ZJY C;  3CME A;  2UXD Q;  4APV A;  2JE6 I;  3NEN A;  3KJO A;  1AE3 A;  3CCR A;  1PH7 A;  2L15 A;  2N8N A;  4YHH Q;  1TXY A;  1HNX Q;  1NBW A;  3PF5 A;  3BJU A;  3KLW A;  4LFA Q;  3ULP A;  3VDY A;  5C4X H;  2NVQ H;  4DV5 L;  3CCU A;  4LF7 L;  4JYA L;  4AYB G;  1TWA H;  2F4V Q;  4DR4 L;  2K52 A;  4IPC A;  4C3J H;  4DV0 L;  4DR2 Q;  4POF A;  4B3S L;  1SE8 A;  3A0J A;  4X65 Q;  2R93 H;  4X6A H;  4IPH A;  4DAY B;  4MNO A;  4BXX H;  4EQ5 A;  4IPG A;  5HGQ A;  5AJ3 Q;  3D31 A;  4LFB L;  1Q7Y C;  1EIY B;  1VQH A;  4DV6 L;  3TS0 A;  1PH4 A;  1Y1V H;  1HZB A;  4GLX A;  3K81 C;  2UXB L;  2XTI A;  2AWN A;  4LF4 Q;  4JI8 L;  3HOY H;  4KI0 A;  4JI3 Q;  1XPO A;  1B8A A;  1X3F A;  2A19 A;  1CKN B;  4NXN Q;  1AH9 A;  1E24 A;  1WCM H;  2N3S A;  1FL0 A;  1WYD A;  2Y0S G;  3DM3 A;  5FLM H;  4LF8 L;  1EQQ A;  5C4X G;  1IL2 A;  2WAQ E;  4GOP A;  4DR6 L;  4A3L H;  3BZK A;  2IHE A;  4X62 L;  4L5S A;  3RZD H;  4JI4 L;  2KCT A;  1KQS A;  1XMQ L;  2R93 G;  3PO2 H;  2EIF A;  2FXQ A;  1E1O A;  1LUZ A;  4P73 A;  4NXM Q;  4O2D A;  4DV2 L;  3TQY A;  4HIM A;  2IX1 A;  4BXX G;  1SRO A;  4GKK L;  3HOV H;  4DR3 L;  2K4K A;  4A3C H;  1D7Q A;  3FKI H;  4KLK A;  4J15 A;  2UUB Q;  1FJG Q;  2ZJQ A;  4WJ4 A;  1Q1E A;  1J6Q A;  2HT1 A;  3RR5 A;  1Y1V G;  3H3V I;  1Y1W H;  1HNW L;  1H95 A;  5C44 H;  1NE3 A;  2PI2 E;  3GD7 A;  1PH3 A;  3G48 A;  3HOY G;  1OXX K;  4BBR G;  2MQH A;  2AKW B;  4PMW A;  3GTP H;  2ZJP A;  5M3M H;  5FLM G;  3W1G A;  4DK3 C;  1Q81 C;  3M4P A;  4DR5 L;  1IBL L;  4L5R C;  2UUC L;  1HR0 L;  1HZC A;  1HNZ Q;  4GN5 A;  4DPG A;  3RNU A;  4GKJ Q;  3ERS X;  3L2P A;  2E5L L;  3GDE A;  1OXS C;  2JEB I;  4NB3 A;  1PH9 A;  1X3G A;  4DV4 Q;  3F1Z A;  4DV3 L;  1YJ9 A;  3EN2 A;  3NEM A;  4YWL A;  1OTC A;  3HOX H;  4DAM A;  4IJL A;  1NTG A;  4OX9 Q;  3HOW H;  1VQE A;  4ME3 A;  3I4M H;  4A3C G;  4EX5 A;  3HOV G;  4OWW B;  2EQS A;  3FKI G;  4GS3 A;  2A8V A;  3UE0 A;  3UDI A;  3H15 A;  1O7I A;  5DLQ E;  2K50 A;  5C0X G;  3G6E A;  4P74 A;  1IYJ B;  2RHQ B;  4A3I H;  3AFQ A;  4A3M H;  1M1K C;  2CKZ B;  3RLO A;  4JBK A;  4YY3 L;  5IT9 c;  1X6O A;  3CQZ H;  3J7Z C;  2E2H H;  2B63 H;  1L1O B;  3KF6 A;  2E2J H;  3I7F A;  4YCW A;  3HFZ B;  4ALP A;  4X66 Q;  1B70 B;  5M3M G;  5LMU Q;  2VL6 A;  1FGU A;  3SGI A;  2MO0 A;  3KDF B;  2I5H A;  1WJJ A;  4YWM A;  3T1Y L;  2A1A A;  3FP9 A;  1W3S A;  2AHO B;  2N78 A;  3OTO L;  2CWP A;  3JC6 6;  1HZA A;  5LMN Q;  4AQY L;  2IHF A;  3HOX G;  5JJI A;  3U58 A;  4JBM A;  3TRE A;  4B3M L;  1IBM L;  4LUO A;  1SFO H;  3I4M G;  1MJC A;  1UE6 A;  5ELO A;  3F2C A;  1XNR L;  3GTQ H;  3Q8D A;  4KHP Q;  2EXD A;  3PUZ A;  1OXU A;  3EBE A;  1VQK A;  2VUM H;  4K0K L;  4UPA A;  4A3I G;  2UUA Q;  3KFU A;  3UE1 A;  4A3M G;  3TEH B;  4HIK A;  3MEF A;  3KJP A;  3J81 c;  5IP9 H;  1VQP A;  2B63 G;  2ZM6 L;  4QJF A;  4IJH A;  5IWA Q;  1VQM A;  4HJA A;  2NVX H;  4UP7 A;  3CD6 A;  4DNI A;  4DUZ L;  3WWV A;  1S3O A;  2K5H A;  2VQF Q;  1L0W A;  2YV5 A;  2JA5 H;  2OTJ A;  1S72 A;  1N9W A;  2HIV A;  4LF5 L;  2Q2T A;  4O0A A;  4PZ8 A;  1N32 L;  1GKH A;  4GOP C;  1V43 A;  5GAH C;  2QA4 A;  2VNU D;  2UXD L;  4YWK A;  1XMO Q;  3J81 i;  1NJI C;  1VQJ A;  1BBW A;  2KHJ A;  1KRS A;  4YHH L;  1HNX L;  2VUM G;  1WFQ A;  3GTK H;  4C3I H;  1ASZ A;  2PMZ E;  5IP9 G;  4LFA L;  4A3D H;  1X3E A;  1KHI A;  1GVP A;  2F4V L;  3U4Z A;  4DR2 L;  1PH6 A;  4IFD J;  1CKN A;  2F52 A;  1YHA A;  4LFC Q;  4A3B H;  2AWO A;  2NZH A;  4POG A;  4IFD I;  2JA5 G;  5AJ3 L;  3BU2 A;  3PF4 A;  3ER0 A;  4PG3 A;  1PYS B;  1CKO A;  5M5W H;  4JI7 Q;  3AFP A;  3PUY A;  4HIO A;  4BY7 H;  2YTY A;  1YJN A;  3CPF A;  3S2D H;  1PA6 A;  2LXJ A;  4UP9 A;  4QGU A;  4JI3 L;  1QVG A;  4NXN L;  3AEV A;  2Q2I A;  3F2B A;  1XNQ L;  1X55 A;  1UE7 A;  5JEA J;  4A3F H;  4GNX B;  4BBR H;  4JI1 L;  3PCO B;  2VY3 A;  2Z6K A;  4A3D G;  3M3Y H;  1FVI A;  1EWI A;  1VQC A;  3TRZ A;  2OQ0 A;  1VQI A;  2PQA B;  4JOI A;  4L5Q A;  4JYA Q;  4LF7 Q;  5BR8 Q;  2UU9 Q;  3G71 A;  2NVT H;  3A5Z B;  4A3B G;  3MXN B;  4NXM L;  4A93 H;  4DUY Q;  2OCE A;  1VQB A;  1XJV A;  4IOC A;  1A62 A;  3AYH B;  2PI2 A;  2BH8 A;  4JCV E;  1FJG L;  4JBW A;  3J80 c;  3RN5 A;  1Q8K A;  2R7D A;  2MNA A;  4BY7 G;  4LF6 L;  1X56 A;  1D8L A;  2ASB A;  1VQ6 A;  2I0Q A;  2WAQ G;  4LFB Q;  4BA2 I;  1SMX A;  2CWA A;  4OO1 I;  5JJK A;  5IE8 A;  4UP8 A;  2OTL A;  1VQF A;  1HR0 W;  1G6P A;  4JI0 Q;  3S1Q H;  3I2Z A;  1V9P A;  3K80 C;  4LUZ A;  1EQR A;  1K73 C;  4JI6 L;  2E2I H;  4JI8 Q;  4A3F G;  3S17 H;  4R4T A;  4BBS H;  5C4J H;  2RHS B;  1C0A A;  1N34 Q;  2NN6 G;  4JBJ A;  3HKS A;  4XTC S;  3CCQ A;  4DR1 Q;  1KIX A;  4GKJ L;  2HIX A;  3IRB A;  2GVA A;  4A3G H;  2D0P A;  3LGJ A;  4JV5 Q;  4XIG S;  1K83 H;  1L1O A;  2UXC Q;  2BH2 A;  4OX9 L;  4QIW E;  1SRU A;  3E0E A;  4P75 A;  3J80 i;  4AH6 A;  5M3F G;  1J5E Q;  2JQO A;  1U5K A;  4H02 A;  4DR7 Q;  1UEB A;  4A93 G;  2DGY A;  3KDF A;  1GM5 A;  1QVF A;  2JA6 H;  4HJ9 A;  3GTM H;  3RLN A;  5GQO A;  4IOA A;  1KL9 A;  2ZTC A;  1BVS A;  5IYD H;  5FLX c;  2VS1 A;  1YIJ A;  4PZ6 A;  4OWX B;  3W5O A;  3RN2 A;  3CAM A;  1K8A C;  2JJQ A;  1IBK Q;  1VQ4 A;  1NMF A;  1TWC H;  3CXC A;  4BBS G;  4X66 L;  2WFW A;  1N36 Q;  1GO3 E;  3S2H H;  5LMU L;  3M7N A;  3F2D A;  3DLL A;  1YVC A;  1M90 C;  4BY1 H;  2RCN A;  2JA8 H;  1I5F A;  4A3G G;  1TWH H;  4JI2 Q;  4DR5 Q;  1I94 L;  3M4O H;  2IX0 A;  2JEA I;  3JAM c;  3K7U C;  1YI2 A;  5K36 G;  5ELN A;  2K5N A;  2KBN A;  2JK8 A;  1QZH A;  1KC8 C;  2HHH Q;  1KD1 C;  4DV3 Q;  2PNH A;  2I5L X;  2HQL A;  2JA6 G;  1G29 1;  4DK6 C;  1SR3 A;  3I4O A;  4KHP L;  1MJE A;  1VQ9 A;  3CC2 A;  3PIO A;  5IYD G;  3S14 H;  4HJ8 A;  1X65 A;  2UUA L;  4B3R Q;  1N33 Q;  3PUW A;  4B3T Q;  3CCJ A;  3ICE A;  1PFS A;  5IWA L;  4LF9 L;  3E9H A;  2GN5 A;  1ASY A;  2R7Z H;  5GAD C;  3K8A A;  1I3Q H;  2D62 A;  4GN3 B;  1E3P A;  1VQD A;  4BY1 G;  3JAM i;  1CSP A;  2JA8 G;  1K9M C;  4WJ3 M;  4UY8 C;  2QGQ A;  3M4Q A;  4GN4 B;  2R92 H;  3T1Y Q;  3FHW A;  1C7Y A;  3G4S A;  1VQ7 A;  2NZO A;  2Z6K C;  3PGZ A;  4DV1 Q;  3ULJ A;  1PYB A;  5IY0 A;  1QUQ B;  1L2F A;  2IT1 A;  1N8R C;  4AIM A;  1XPR A;  1X54 A;  1Q86 C;  4JOI C;  1PHJ A;  3UDG A;  4B3M Q;  1XMO L;  1IBM Q;  1PV4 A;  3H3V H;  2C35 B;  3GO5 A;  1CUK A;  2WB1 E;  4X64 Q;  4LNQ A;  1XPU A;  1XNR Q;  4A75 A;  1JJC B;  2R7F A;  1KRT A;  5H1S E;  1PH1 A;  3UDF A;  2WP8 J;  3M85 A;  4DV7 Q;  1JJG A;  1JT8 A;  1K8G A;  4BA1 I;  1S40 A;  3T1H Q;  4JI5 Q;  2R7Z G;  2N49 A;  2WB1 G;  3PV0 A;  4GNX A;  4LFC L;  1RIP A;  1T9H A;  4OON A;  1YHQ A;  1Q12 A;  1CSQ A;  2CQO A;  2K5V A;  3KF8 B;  2VQE Q;  4X65 L;  2R92 G;  4A76 A;  1CKM A;  3CC4 A;  4A3K G;  1C9O A;  3NBH B;  4JI7 L;  2PQA A;  1PH8 A;  4L5T A;  1UE5 A;  1JJ2 A;  2JA7 H;  2E8G A;  1YJW A;  1DGS A;  3KOJ A;  2AMC B;  1A0I A;  1LM0 A;  4GLA C;  4RMF A;  4LF5 Q;  2OQK A;  3CW2 C;  3OW2 A;  4OO1 G;  4QQB X;  1YZ6 A;  1P16 A;  1L1O C;  2MFI A;  5GAG C;  1GD7 A;  2R6G A;  1OXT A;  1EUJ A;  4AYB E;  4A3J H;  2KEN A;  1Q1B A;  4LF4 L;  3CCM A;  1P8L A;  4A4I A;  2B3G A;  1U0L A;  1HH2 P;  3HOU H;  2BA1 A;  3UDX A;  2Q2U A;  2BA0 A;  5IYB G;  1YIT A;  4NPS A;  1MKH A;  2GVB A;  3TS2 A;  5BR8 L;  2UU9 L;  1YEZ A;  3NEL A;  4P71 A;  4HJ7 A;  3HOZ H;  3GTG H;  4DUY L;  4DV5 Q;  3PSI A;  4LUV A;  4DR4 Q;  4DV0 Q;  3CCL A;  5M3F H;  1Q82 C;  2JA9 A;  2YTV A;  1I50 H;  4B3S Q;  1LYL A;  2XGT A;  2JA7 G;  3STB C;  1VQ8 A;  2Y0S E;  3M9B A;  2VW9 A;  4R4C A;  3U50 C;  3CC7 A;  4TQU S;  2UUB L;  3KYH C;  3H0G G;  2OWO A;  5IYC H;  1Y1W G;  4JI0 L;  3L0O A;  4A3J G;  4DV6 Q;  5HY6 A;  1PVO A;  3CCE A;  3D0F A;  1YBY A;  3HKZ E;  3HOU G;  1XNQ Q;  2UXB Q;  1VS0 A;  1N34 L;  3STB D;  4C2M H;  4DR1 L;  1HJP A;  3I56 A;  4JI1 Q;  4GLV B;  2CFM A;  4JV5 L;  4JC0 A;  1HNZ L;  3E9I A;  3S1N H;  2UXC L;  2ID0 A;  3GTO H;  1K0R A;  1A63 A;  4LF8 Q;  3HOZ G;  1J5E L;  4DR7 L;  5J3B A;  3GTL H;  2ALY B;  3HKZ G;  1JE5 A;  4DR6 Q;  4DV4 L;  3GTJ H;  3CCS A;  1JMC A;  4DKA C;  1VQG A;  4RG1 A;  4X62 Q;  1TWF H;  4JI4 Q;  5M5X H;  1JB7 A;  1XMQ Q;  4YCV A;  4Y52 H;  1KAW A;  3BZC A;  3OYY A;  3PO3 H;  1EIF A;  4DV2 Q;  4GKK Q;  4LF6 Q;  5IYC G;  4DR3 Q;  1IBK L;  5M5Y H;  1OXV A;  4A3E H;  1YHB A;  4LW1 A;  4OWT B;  1W2B A;  1N36 L;  1HNW Q;  3I55 A;  5LMN W;  1WCM G;  3S24 A;  4GOP B;  3ULL A;  4JI6 Q;  3I4N H;  4C3H H;  4JI2 L;  1WOC A;  4IPD A;  1WI5 A;  3PUV A;  2K14 A;  1YNX A;  4PZ7 A;  4A3L G;  1SLJ A;  1IZ6 A;  2KHI A;  4MTN A;  3F8T A;  1R9T H;  1IBL Q;  2ZTD A;  2UUC Q;  5IP7 H;  5GAE C;  5E7N A;  1HR0 Q;  2HHH L;  3B6Y A;  2DUD A;  5LMN L;  3CCV A;  2YTX A;  4HJ5 A;  2E5L Q;  3PO2 G;  3RZO H;  5EAY A;  2ZJR A;  1PH5 A;  4OXP A;  1VQN A;  4B3R L;  1HZ9 A;  2MO1 A;  4GNX C;  3S16 H;  3PO3 G;  1N33 L;  1KXL A;  1NMG A;  1QUQ A;  4B3T L;  3S1M H;  3PUX A;  2LSS A;  3K0X A;  5C44 G;  5FJ8 H;  1TWG H;  4QY7 A;  1QZG A;  4A3E G;  2KCM A;  1XTD A;  2NVY H;  3CP0 A;  1B7Y B;  5C3E H;  1E22 A;  4YY3 Q;  1VQO A;  2ES2 A;  1VQA A;  3I4N G;  1VQ5 A;  2NN6 I;  3AQQ A;  4FDB A;  1NY4 A;  1MIU A;  4MZ9 A;  2VQF L;  3CPW A;  1AE2 A;  1E7Z A;  1G51 A;  1V1Q A;  4DV1 L;  1I94 Q;  4R4Q A;  5IP7 G;  4IFD G;  4JG2 A;  4A3K H;  4R1J A;  4HID A;  3K7A H;  3CMA A;  1BKB A;  3OTO Q;  2K75 A;  1EFW A;  1VQL A;  2CCZ A;  3HOW G;  3J7A 5;  4X64 L;  4AQY Q;  1VCI A;  2ATW A;  2RF4 A;  3S1R H;  2F3I A;  1X9N A; 
#chains in the Genus database with same CATH topology
 2Q2H A;  3KF6 B;  5GRO A;  4R8N A;  1D6E C;  2L5T A;  2Q8R E;  4ZKB B;  3E0J A;  4JI5 L;  5JEA G;  1FNU A;  2EDG A;  2ZM6 Q;  2K28 A;  2YU9 H;  2V1C C;  3A5U A;  1XYI A;  2QEX A;  1TY2 A;  1G2S A;  1Y14 B;  3CF5 A;  1E1T A;  3S15 H;  1H9R A;  4K14 A;  1D5M C;  1SN8 A;  1MD2 D;  3E3X A;  4EQO A;  3OIP A;  3CME A;  2UXD Q;  2JE6 I;  2L15 A;  2N8N A;  4G7H C;  1TXY A;  1HNX Q;  2NVX B;  1HQM C;  3BJU A;  4Y7N B;  3ULP A;  3VDY A;  2NVQ H;  4JYA L;  2BDN A;  3CCU A;  4DV5 L;  3IFT A;  2F4V Q;  3T16 A;  2KEE A;  4N8F A;  4B3S L;  4X6A H;  1O7Z A;  4DAY B;  4BXX H;  4KY6 A;  3A7A B;  3GQB A;  4LFB L;  1B50 A;  1VF7 A;  4GLX A;  2B2T A;  3HOY H;  1LAC A;  4JI3 Q;  3SHL A;  1XPO A;  1K28 A;  5IT9 E;  4NXN Q;  3DM3 A;  4RGM A;  2NTT A;  5ISR A;  2V4D A;  1EQQ A;  1IL2 A;  4GOP A;  4I7A A;  4C3J G;  3QWN A;  1T5E A;  3BZK A;  2IHE A;  3Q0A A;  1MGS A;  4L5S A;  4JI4 L;  2R93 G;  1KQS A;  2B2W C;  2C5C A;  4FF2 A;  5M5W B;  3DWA A;  4HIM A;  4DAP A;  1B1Z A;  1HCZ A;  3N6R A;  2K4K A;  1FJG Q;  4HMI A;  3SK8 A;  1Q1E A;  1EY4 A;  2MPM A;  1PRT D;  1Y1V G;  2PZU A;  3N52 A;  3RR5 A;  2CW0 C;  3K6O A;  1PH3 A;  1OXX K;  3QB3 A;  4QF4 A;  1XXG A;  4PMW A;  2EYO A;  1ZKO A;  5FLM G;  4DK3 C;  1Q81 C;  4DR5 L;  2UUC L;  1HR0 L;  3J80 L;  2NVT B;  4GKJ Q;  3RNU A;  3GDE A;  1ICF B;  4NB3 A;  1X3G A;  3F1Z A;  1YJ9 A;  1OTC A;  4OX9 Q;  4YWL A;  4DAM A;  3HOW H;  1IYV A;  4ME3 A;  4A3C G;  4EX5 A;  1O7I A;  4A3I H;  4N8X 1;  4OL7 A;  3AFQ A;  1CFM A;  2CKZ B;  1DM0 B;  5IT9 c;  1L1O B;  3KF6 A;  3HFZ B;  1BCP F;  1B70 B;  5M3M G;  2VL6 A;  2I5H A;  3MXU A;  4EGV A;  2N78 A;  4CKB A;  2EY6 A;  3HOX G;  4LUO A;  3I4M G;  1MJC A;  1Y69 U;  5JJZ A;  1XNR L;  2G5D A;  2A6E D;  3Q8D A;  1OXU A;  1JR0 D;  3EBE A;  4UPA A;  4A3M B;  1EYA A;  1TWC B;  2OEO A;  3S2H B;  1VQP A;  5IP9 H;  2B63 G;  5KND A;  4FVM A;  5IWA Q;  3SR1 A;  2NVX H;  1JOR A;  4DUZ L;  1TWH B;  1BXT A;  1S3O A;  2YV5 A;  1E2W A;  5NUC A;  3VR2 A;  5EBD A;  1S72 A;  4O0A A;  2KHS A;  3BDO A;  4FO2 A;  2LKV A;  1N32 L;  1GKH A;  1EQT A;  3S14 B;  2VNU D;  4DAY A;  1VQJ A;  1BBW A;  2HUG A;  1KRS A;  2KHJ A;  4YHH L;  2VUM G;  1EEI D;  2F0U A;  3MEH A;  1X3E A;  4XYO A;  1GVP A;  1HRJ A;  4HED A;  3U4Z A;  2QCP X;  5EPJ A;  5IGF A;  5CYU A;  1YHA A;  2QKI C;  3IAY A;  1ILQ A;  4POG A;  1O78 A;  3A56 A;  1AW7 A;  3HP3 A;  3P75 A;  5M5W H;  1WTO A;  1WVL A;  2YTY A;  1YJN A;  4KY5 A;  4DFA A;  3F2B A;  1X55 A;  1ONL A;  1HA6 A;  3PCO B;  1EWI A;  1K8M A;  5JVH 3;  4JYA Q;  3IL8 A;  4LK1 C;  3G71 A;  1PRT C;  2NVT H;  4A3B G;  4DUY Q;  3SK4 A;  4L6T B;  4JCV E;  1SMY D;  1Q8K A;  2R7D A;  2MNA A;  4BY7 B;  1OO9 B;  1CI3 M;  1VQ6 A;  4XT1 B;  4LFB Q;  2WAQ G;  1SMX A;  1K3B C;  1IKL A;  1VQF A;  2RDH A;  5C0X H;  1K73 C;  1GUS A;  4A3F G;  3NSW A;  1BCP B;  4ZLT F;  1N34 Q;  2JXM B;  1KIX A;  1DOK A;  1TS2 A;  2O4X A;  1F9Q A;  3BVM A;  3RMH A;  5FO8 B;  2WV6 D;  3LGJ A;  3HOZ B;  1S5E D;  4XIG S;  1L1O A;  4JV5 Q;  1DJR D;  4QCL A;  5K36 H;  3J80 i;  1I50 B;  5M3F G;  4NKL A;  2JQO A;  4H02 A;  1QVF A;  5C4Z A;  4IOA A;  4F8M A;  1BUV T;  5I6Y A;  1I4R A;  1BVS A;  1KDC A;  1YIJ A;  4QIW B;  1EIH A;  3CAM A;  3I91 A;  3C46 A;  1VQ4 A;  2J4X A;  1TWC H;  2R3Z A;  4FF1 A;  4X66 L;  4BBS G;  3S2H H;  1N36 Q;  1PYW D;  2IX3 A;  3ONA B;  1JWM D;  1ENC A;  1STN A;  3SK6 A;  1WTW A;  3GTO B;  2RCN A;  1I5F A;  1TWH H;  4DR5 Q;  2L11 A;  2K5N A;  2KBN A;  2JK8 A;  2HHH Q;  4TKO B;  2I5L X;  4JW0 A;  3PO3 B;  1Y8O B;  2ZXR A;  3S14 H;  1Q3L A;  3PUW A;  2F3W A;  4KJN A;  1SYC A;  3SE0 A;  4EVO A;  1ASY A;  1Z7T A;  2I07 B;  5IOD A;  4GN3 B;  1E3P A;  2QEJ C;  4OEL B;  2JA8 G;  4WJ3 M;  3OWE B;  3M4Q A;  2EZV A;  4UAI A;  2EJF C;  4DA2 A;  3PGZ A;  2D9U A;  4Z9C B;  3S16 B;  1XPR A;  1PHJ A;  4JOI C;  5CV6 A;  2DY7 A;  2LMC B;  4LNQ A;  1A3T A;  4G57 A;  1SNC A;  1XNR Q;  5CV9 A;  1PH1 A;  5EGT A;  5IGB A;  1JT8 A;  3T51 B;  2WB1 B;  3PV0 A;  2EYM A;  4KD4 A;  3K5O A;  1F2M A;  1B3Q A;  3GV3 A;  1CSQ A;  4X65 L;  2R92 G;  4KN7 C;  1CKM A;  3NBH B;  4JI7 L;  1A0I A;  3S1R B;  1KAA A;  1YZ6 A;  2F0F A;  5I4D A;  2RA4 A;  1PRT F;  1E0B A;  1SYD A;  1Q1B A;  4LF4 L;  3CCM A;  4A4I A;  1HH2 P;  2K01 A;  2QDL A;  4ZUI A;  2KEC A;  3UDX A;  4O42 A;  2BA0 A;  1SXT A;  4NDX A;  4OIJ A;  1YIT A;  3EQL C;  4NPS A;  4I65 A;  2WIN B;  5EKK A;  5KYI A;  3NEL A;  4P71 A;  3HOZ H;  4R8I A;  1JCK B;  4LUV A;  4DV0 Q;  1Q82 C;  2JA9 A;  2YTV A;  1I50 H;  5DM7 3;  3TP6 A;  4ZUJ A;  2UUB L;  3CC7 A;  4TQU S;  3H0G B;  4JI0 L;  4A3J G;  1PVO A;  5COR A;  3CCE A;  3D0F A;  1JOK A;  3EFX D;  2RSN A;  4DK0 A;  4DR1 L;  3L3O C;  5ELF A;  4C3J B;  3GTO H;  1DCZ A;  5J3B A;  2R93 B;  1JE5 A;  1HA5 A;  4DV4 L;  1SYG A;  1CT1 D;  3CCS A;  3QOJ A;  2B8G A;  1GOZ A;  4QB4 A;  4X62 Q;  3MAQ A;  2M00 A;  3BZC A;  3PO3 H;  1F2Z A;  1Y1V B;  2VB3 X;  2EYP A;  5IYC G;  1S5B D;  2Z4I A;  1V1O A;  4EQP A;  4RKL A;  4OWT B;  4ZQ3 A;  1HNW Q;  4LMQ D;  3S24 A;  3I73 A;  1B2T A;  3ITP A;  5FKA C;  4L8J A;  4JI2 L;  3S1N B;  4IPD A;  3PUV A;  2K14 A;  4PZ7 A;  3H3V C;  1IZ6 A;  2KHI A;  4MTN A;  3RUZ A;  2ZTD A;  3RZD B;  4CKE A;  5LMN L;  2L12 A;  3EA6 A;  3P7J A;  2QW7 A;  1PH5 A;  3S16 H;  3FDT A;  5A2Q E;  1KXL A;  5JPN C;  1NMG A;  3QOL A;  3A55 A;  5JVG 3;  4A3E G;  1XTD A;  2MUY A;  3BDC A;  5JEA H;  2O5J C;  2B2W A;  5M3M B;  3IFD A;  2ES2 A;  4ABN A;  4G7Z C;  3I4N G;  3BVG A;  1AE2 A;  1E7Z A;  2K05 A;  4R4Q A;  1HTL D;  3HOX B;  4JK1 C;  3CMA A;  2K75 A;  3I4M B;  1Y8N B;  2K04 A;  1VQL A;  1A15 A;  2A73 B;  2ATW A;  4OO1 H;  2RF4 A;  3QG1 A;  3NBH A;  3FEW X;  1PRT B;  4EQN A;  3S1R H;  3TS2 A;  5JJL A;  5J39 A;  5FK9 C;  1UE1 A;  1PH2 A;  3CQZ B;  2B63 B;  2E2J B;  2I5M X;  2IW3 A;  3NHH A;  1IKM A;  1GUO A;  1LT5 D;  2H1E A;  3PIP A;  1G91 A;  3J7Y W;  3U4V A;  3W1B A;  1SYB A;  1EOV A;  2L0C A;  1Z9F A;  3RLF A;  3J81 j;  3S9W A;  1EYG A;  1A8V A;  2RDG A;  3H0G H;  4LWC A;  3DM1 A;  2K5W A;  1SJE D;  2LXK A;  2VUM B;  2Q8T A;  3FVQ A;  3NEN A;  1G2T A;  4M8A A;  1U4M A;  1GUT A;  5JPM C;  1RJT A;  2SNM A;  1NBW A;  3PF5 A;  1HFG A;  1SYE A;  2K7V A;  4ZYS A;  3NQI A;  2K52 A;  4IPC A;  4C3J H;  1L0X B;  4DR2 Q;  1O80 A;  1SE8 A;  2H4O A;  4X65 Q;  2R93 H;  1YNN C;  4IUT A;  1HUN A;  4EQ5 A;  5HGQ A;  5J22 A;  4DV6 L;  1Y1V H;  5BN3 A;  2FFK B;  5KNB A;  1HZB A;  3GTK B;  2XTI A;  3NWT A;  1DXM A;  4LF4 Q;  4JI8 L;  2B2V C;  4KI0 A;  1B8A A;  2EPB A;  1WYD A;  3HRZ C;  5FLM H;  2BE5 C;  3KLS X;  4LF8 L;  5C4X G;  5CGK A;  3TSS A;  4A3B B;  4A3L H;  5A2Q L;  5DAU A;  3RZD H;  2KCT A;  2A69 D;  1XMQ L;  3ZYY X;  1STH A;  2F0D A;  4P73 A;  4NXM Q;  2IX1 A;  4A3C H;  4DR3 L;  2WAQ B;  1D7Q A;  1EY0 A;  2EE1 A;  2UUB Q;  4KHV A;  1H95 A;  3C1F A;  3G7L A;  5CC4 A;  4A3F B;  2PI2 E;  3D3R A;  3OWF A;  4TSS A;  4BBR G;  5I2X A;  1SBB B;  3I8Z A;  3M3Y B;  1TS3 A;  3CKI B;  1STG A;  4XQQ A;  1DOM A;  5M3M H;  3P1H A;  1QWY A;  1F77 A;  3MFY A;  1IBL L;  1HZC A;  1STY A;  2CW0 D;  2WII B;  1ET9 A;  1QJO A;  3ERS X;  2E5L L;  1QNK A;  1XX8 A;  3KBG A;  1PH9 A;  4DV4 Q;  3AMU A;  1O7L A;  3HOX H;  4S3S A;  3I4M H;  3BZD B;  3OHX C;  3D4R A;  3R2T A;  1FNV A;  4GS3 A;  5M9O A;  3UE0 A;  1BBX C;  1AZQ A;  3UDI A;  5DLQ E;  1Y1W G;  2K50 A;  4J8Q A;  2RHQ B;  3S17 B;  1F9P A;  4BBS B;  4YY3 L;  5C4J B;  1X6O A;  2XNA C;  3CQZ H;  4RHS A;  5C5L A;  2B63 H;  2E2J H;  2RKS A;  4YCW A;  1SNO A;  1RTO A;  2EJM A;  5LMU Q;  3SGI A;  1FGU A;  1K83 B;  3KDF B;  1D5Z C;  2AHO B;  3OTO L;  2CWP A;  1NR2 A;  5FLX L;  3GTM B;  1HZA A;  5LMN Q;  4IZ8 A;  2IHF A;  1IW7 D;  3TRE A;  4C56 C;  1RDP D;  4KHP Q;  5KEE A;  5T1G A;  4K0K L;  2VUM H;  4A3I B;  1R4P B;  2UUA Q;  3TEH B;  3X3N A;  3MEF A;  4HIK A;  1EY6 A;  5JOB A;  1SJH D;  3BDL A;  3JAM L;  4IJH A;  4MN3 A;  2JA8 B;  4UP7 A;  4DNI A;  1MSG A;  3WWV A;  3M4O B;  3I70 A;  1JOQ A;  2O5I C;  5CBA E;  2K5H A;  2OTJ A;  4IUU A;  2AQ2 B;  2NTS A;  2PZW A;  5GAH C;  1XMO Q;  1NJI C;  5ELD A;  3J81 i;  3GTK H;  2NB0 A;  2NWG A;  3K5M A;  4LFA L;  1D1K A;  3V96 A;  1PH6 A;  4IFD J;  1EYD A;  3KLS A;  2R92 B;  3R3O A;  4A3B H;  1ENF A;  1W6K A;  2PMZ B;  4IFD I;  5AJ3 L;  3BU2 A;  3NK9 A;  1CKO A;  3PUY A;  1AN8 A;  1STA A;  2A6H C;  3MXG A;  3ERQ A;  1A3U A;  3C2P A;  2Q2I A;  4A3F H;  3K57 A;  4JI1 L;  3NE5 B;  2A69 C;  3M3Y H;  1PZJ D;  1HHV A;  1VQC A;  3EJI A;  3TRZ A;  4IUQ A;  2OF1 A;  4JOI A;  4L5Q A;  1I4Q A;  1S4Z A;  5BR8 Q;  1TQO A;  3MXN B;  3TZU A;  4IOC A;  2BH8 A;  4JBW A;  3J80 c;  1R4Q B;  3H94 A;  2ASB A;  5IE8 A;  3Q24 A;  4LUZ A;  4JI8 Q;  1D1I A;  3S17 H;  2AQ1 B;  4R4T A;  4BBS H;  5C4J H;  3IKJ A;  1UUP A;  1C0A A;  2NN6 G;  4JBJ A;  3HKS A;  5D14 A;  3IRB A;  2GVA A;  3FRP B;  1K83 H;  2MJ8 A;  4AH6 A;  4DK1 A;  5COY A;  1J5E Q;  3HGB A;  3KDF A;  3K0Y A;  5CBE E;  3GTM H;  2K32 A;  3RLN A;  1ESR A;  2RVL A;  1KL9 A;  1TVX A;  4MTK A;  1SYF A;  3UI2 A;  2OT2 A;  3PIP 3;  3NUC A;  4PZ6 A;  4OWX B;  1K8A C;  5D65 A;  2JJQ A;  3R2I A;  1HQR D;  1IBK Q;  3X3M A;  3GV6 A;  4C2M B;  1JWS D;  1LV9 A;  3CXC A;  3M7N A;  3MZ5 A;  1YVC A;  1IW7 C;  1M90 C;  2JA8 H;  5I9O A;  1I94 L;  3M4O H;  2IX0 A;  1TT2 A;  3SK5 A;  2CHB D;  2EYL A;  1TWF B;  2JA6 G;  2O2L D;  4XQN A;  1PLF A;  3NQT A;  1G29 1;  3I4O A;  1MJE A;  1VQ9 A;  2A5H A;  4A3E B;  1N33 Q;  2Z8L A;  4DXF A;  2NZ1 D;  4B3T Q;  3ICE A;  1WTQ A;  2F0J A;  2GN5 A;  1AZP A;  2X6G A;  5CMD A;  3I4N B;  4C3H B;  2D62 A;  4P2C B;  3JAM i;  4BY1 G;  1WTP A;  4UY8 C;  2QGQ A;  2F0M A;  2R92 H;  3FHW A;  5C3X A;  4ZK9 B;  2IPK D;  4C1N K;  1VQ7 A;  3TDQ A;  3RZO B;  1YNJ D;  3VA7 A;  2IT1 A;  4AIM A;  5IT9 L;  3UDG A;  4KK7 A;  1PV4 A;  3H3V H;  1XPU A;  4JPB W;  1HFN A;  4OEM B;  1KRT A;  1WD0 A;  5ELB A;  5C6A A;  1SNQ A;  3NTK A;  1BQQ T;  1MBY A;  1LTG D;  2K6A A;  1LTI D;  4BA1 I;  4JI5 Q;  1KDA A;  2Z1C A;  5KIX A;  3I4L A;  4LFC L;  1RIP A;  2K5V A;  4A3K G;  4L5T A;  1UE5 A;  4DAV A;  3MXP A;  2E8G A;  4QMG A;  3R8B A;  3KOJ A;  1LM0 A;  1ET6 A;  3MXN A;  3OW2 A;  4QQB X;  2GA4 B;  1EUJ A;  1HPC A;  2R6G A;  1XWE A;  3A8I E;  4AYB E;  4A3J H;  2B2U C;  1I6H B;  1LO5 D;  2WKC A;  1LTB D;  1P8L A;  4N9P A;  4GZY C;  2JP1 A;  2UU9 L;  3H91 A;  2F0V A;  4K5X A;  4DV5 Q;  1D2B A;  2PW7 A;  2LFN A;  3TP7 A;  3I3C A;  2F0L A;  3DXJ C;  4M1U B;  3SDZ A;  4B3S Q;  3STB C;  2Y0S E;  4DNT B;  4F87 A;  5IYC H;  5DM6 3;  4IN3 A;  5IGG A;  1KNE A;  3HKZ E;  3HOU G;  4HR7 B;  4C2M H;  1HJP A;  3KLR A;  4JI1 Q;  5C4X B;  5EJW A;  1A2U A;  2UXC L;  1TWA B;  3E9I A;  3FMC A;  1HNZ L;  2ID0 A;  4DR7 L;  4IUP A;  1TS5 A;  2EYJ A;  3HKZ G;  4K8I A;  1CZW A;  2NYZ D;  5E1F A;  1JMC A;  4DKA C;  1NR4 A;  1TWF H;  4JI4 Q;  3DEP A;  4YCV A;  1OXV A;  4A3E H;  1YHB A;  1WCM B;  5LMN W;  3FPU B;  3NXW A;  2F0O A;  1X32 A;  3KUP A;  2EY5 A;  4C3H H;  3I4N H;  1F9R A;  4KD3 A;  1WI5 A;  5LL6 S;  2UUC Q;  1CA5 A;  1HR0 Q;  2X69 A;  5E7N A;  3A8J E;  3B6Y A;  2BOS A;  2FHT A;  3PO2 B;  2B2V A;  2YTX A;  3RZO H;  4B3R L;  2LY7 A;  4GNX C;  1PXU A;  5D3D A;  4CHT B;  1Y1W B;  5C44 B;  2LSS A;  4RHR A;  3OPO A;  1EIG A;  3CP0 A;  1FYC A;  2L1B A;  4K2L A;  1YNJ C;  1UAP A;  5I9P A;  1MIU A;  1FNW A;  2TMP A;  3I90 A;  4DV1 L;  1I94 Q;  4FYD A;  4ME5 A;  4PNY A;  5IP7 G;  4CJ1 B;  2F0E A;  1L0Y B;  1B53 A;  4ULL A;  1BKB A;  3HOW G;  1CHP D;  2WKD A;  1JWU D;  4DXG A;  4X64 L;  2AUJ D;  5C0X J;  3VR4 A;  2PPB C;  1I6H H;  4DV7 L;  5C0X I;  3T1H L;  2BDO A;  5C3E G;  5IYB H;  2LS0 1;  5EPK A;  2VQE L;  1TS4 A;  4R4O A;  1SE4 A;  1WD1 A;  1KLG D;  1UWV A;  4DUZ Q;  1RL2 A;  5KGU A;  2IY5 B;  4KHZ A;  5CV5 A;  3F2U A;  2JN4 A;  4KKU A;  1BBU A;  3GTQ B;  4RAU C;  3A74 A;  2ZTE A;  3VYU A;  4ZKC B;  4P72 A;  3MA2 B;  3CU7 A;  4QL5 A;  1DD2 A;  1N32 Q;  1Q46 A;  5C3W A;  1QVC A;  3ZJY C;  3CCR A;  3KJO A;  1AE3 A;  1PH7 A;  5EQ0 A;  1SEB D;  1KLU D;  4YHH Q;  2FJ2 A;  2DJG C;  1H9M A;  3KLW A;  3TME A;  5C4X H;  3U9S A;  4LF7 L;  4KJO A;  1TWA H;  4DR4 L;  4POF A;  2PW5 A;  4X3S A;  2TSS A;  3HZX A;  5EPL A;  1PH4 A;  4OIK A;  2UXB L;  4U67 3;  4FP5 D;  1STB A;  1NAP A;  4J1M A;  4KMU C;  1YNN D;  5I2Y A;  5HUR A;  2SEB D;  1E24 A;  1WCM H;  2N3S A;  1FL0 A;  1RKN A;  3HEJ A;  2QDB A;  4DR6 L;  3KBX A;  1LTR D;  5FOB B;  1JC7 A;  4ZAI A;  5CR3 A;  1CZG A;  4UHV A;  3BVZ A;  3PO2 H;  2EIF A;  2K03 A;  1LUZ A;  1GXD C;  4O2D A;  5C4H A;  2ZT9 C;  1LTT D;  4DV2 L;  2BE5 D;  1SRO A;  4GKK L;  3S2D B;  5C5M A;  4KTA A;  4J15 A;  2ZJQ A;  4WJ4 A;  2HT1 A;  3C1E A;  1B9M A;  1Y1W H;  2PCF B;  1GUW A;  3NBI A;  5C44 H;  1JQY D;  1NE3 A;  1F2L A;  3G48 A;  2MQH A;  2AKW B;  3K5N A;  1HTP A;  3D8G A;  3ND8 A;  3GTP H;  4DGZ A;  1VF5 C;  3W1G A;  3M4P A;  3BYY B;  4L5R C;  1STE A;  1PFM A;  1HNZ Q;  1SAP A;  1M8A A;  4DV3 L;  4R9W A;  3EN2 A;  4IJL A;  1VQE A;  1TY0 A;  3DWP A;  3HOV G;  4OWW B;  2F4I A;  2EQS A;  1LAB A;  3FKI G;  2NUC A;  1PFN A;  3M4Y A;  3S1Q B;  2XRQ D;  2SOB A;  2EYH A;  5C0X G;  4P74 A;  1M1K C;  1LT4 D;  1DYQ A;  3RLO A;  4JBK A;  5BN5 A;  3J7Z C;  2QF7 A;  3CHB D;  4CKC A;  4X66 Q;  1SNM A;  4FXD A;  2MP1 A;  4CJ0 B;  1WJJ A;  4WJW A;  3FP9 A;  4CDF C;  1W3S A;  1CTM A;  1SE2 A;  2JA6 B;  4AQY L;  5JJI A;  3R93 A;  4B3M L;  1IBM L;  3LWU A;  2F0N A;  1UE6 A;  2Z4H A;  4X3U A;  5ELO A;  2EXZ A;  3F2C A;  3GTQ H;  5LHY 1;  1VQK A;  2EY2 A;  3KFU A;  4A3M G;  2F3V A;  3J81 c;  3BG3 A;  2ZM6 L;  1VMC A;  2F1M A;  4QJF A;  3VYS A;  4BY1 B;  1PZI D;  1KAB A;  1S5F D;  4KN4 C;  5IOC A;  4ID6 A;  1ILP A;  1DOL A;  2XN9 C;  1PDQ A;  2KVM A;  2M9V A;  5I6W A;  2ICE C;  2RDF A;  2HIV A;  4LF5 L;  1RCV D;  1MI2 A;  1V43 A;  1ENA A;  2QA4 A;  2UXD L;  1PTO C;  1HNX L;  1WFQ A;  1ASZ A;  3W2D A;  4IUV A;  1I3Q B;  2F4V L;  2F52 A;  1M4V A;  1XTC D;  2JA5 G;  3PF4 A;  4PQX A;  1GUN A;  3ER0 A;  2N55 A;  3OMG A;  4PG3 A;  5IGC A;  4JI7 Q;  3AFP A;  4HIO A;  2G9D A;  3S2D H;  1DON A;  2D5D A;  2LXJ A;  4UP9 A;  2KUM A;  2F03 A;  4JI3 L;  4NXN L;  1UE7 A;  5JEA J;  3A8K E;  2PO4 A;  4K6D A;  4C3I G;  4GNX B;  5IGE A;  2VY3 A;  3OSO A;  4A3D G;  1FVI A;  2NN6 H;  4DN4 M;  2A6H D;  4LF7 Q;  2QIL A;  4IUR A;  1H9J A;  3A5Z B;  1XJV A;  1VQB A;  1WTH A;  4PMC A;  1FJG L;  3RN5 A;  3D6W A;  4BY7 G;  1D8L A;  1X56 A;  5JJK A;  3AU7 A;  4BA2 I;  4OO1 I;  2CWA A;  3LX0 A;  2Q8I B;  1HR0 W;  1G6P A;  4JI0 Q;  3S1Q H;  3DEO A;  3I2Z A;  3K80 C;  1U9R A;  2RHS B;  4Q5V A;  1Z6H A;  3D4W A;  4MHE A;  4XTC S;  5DNF A;  4DR1 Q;  3RD4 A;  4GKJ L;  3GTG B;  1AEX A;  4OX9 L;  2B2U A;  4QIW E;  1IL8 A;  3E0E A;  4P75 A;  2IWH A;  5M3F B;  4O1N A;  4A93 G;  1U5K A;  1UEB A;  2DGY A;  1GM5 A;  2JA6 H;  1ICW A;  1X3Q A;  5TSS A;  2SNS A;  5GQO A;  3SEB A;  2ZTC A;  3K5L A;  5E4X A;  5FLX c;  2VS1 A;  1JOO A;  1BO0 A;  3VA5 A;  3RN2 A;  1FD7 D;  4RGO S;  3D4D A;  2WFW A;  3DLL A;  4HCE A;  4BY1 H;  4XT3 B;  1NCV A;  3T53 B;  4A3G G;  5KYL A;  4JI2 Q;  4YIJ A;  3JAM c;  4NMZ A;  5D3I B;  2JEA I;  4H0L C;  5ELN A;  4V19 0;  1EZ6 A;  2A8V A;  1KC8 C;  3G6J B;  5M5X B;  4DV3 Q;  2EOT A;  2HDM A;  2HQL A;  2PNH A;  2XRS D;  1SR3 A;  1CA6 A;  3H09 A;  3CC2 A;  5E3F A;  3PIO A;  5IYD G;  1X65 A;  5IWA L;  4LF9 L;  2JYO A;  5GAD C;  2ZXO A;  3K8A A;  3VR6 A;  1I3Q H;  1VQD A;  1PTO F;  1K9M C;  1R9T B;  3V05 A;  4GN4 B;  4TRD A;  2E76 C;  3VR3 A;  3G4S A;  1EEF D;  1EY5 A;  2Z6K C;  3ULJ A;  1QNU A;  1L2F A;  3J80 E;  1X54 A;  1SE3 A;  4B3M Q;  4QUC A;  1EZ8 A;  1IBM Q;  1BCP C;  2C35 B;  3GO5 A;  2WB1 E;  1TWG B;  4A75 A;  1JJC B;  4V0B A;  1BF4 A;  1EWH A;  2R7F A;  5H1S E;  3C3L A;  2NVY B;  5C3E B;  1WTX A;  1JJG A;  2R7Z G;  5T1I A;  1S40 A;  2N49 A;  4WRD A;  2WB1 G;  4GNX A;  1T9H A;  3T13 A;  1Q12 A;  3KF8 B;  1U4P A;  4A76 A;  1C9O A;  1QG7 A;  3K7A B;  4LAA A;  1PH8 A;  1JJ2 A;  3FPP A;  1DGS A;  2KED A;  2AMC B;  4GLA C;  4LF5 Q;  4RMF A;  4OO1 G;  3CW2 C;  1G6Z A;  1P16 A;  2MFI A;  2RBM A;  1IYU A;  1I4G A;  2B3G A;  4NW2 A;  1U0L A;  3HOU H;  1AP0 A;  2BA1 A;  2ENB A;  1RD9 D;  1TKW B;  1TII D;  2XIW A;  5ELE A;  4KY7 A;  2GVB A;  1YEZ A;  4XYQ A;  3GTG H;  4DUY L;  3PSI A;  4F7X A;  1QIL A;  5M3F H;  2WAC A;  1H9S B;  1LYL A;  4BS9 A;  2JA7 G;  1VQ8 A;  5AFW A;  3M9B A;  4DNR B;  2VW9 A;  3H0G G;  2OWO A;  2J7Z A;  4A3J B;  2AUK A;  3L0O A;  1QE6 A;  4DV6 Q;  1I6V C;  2EJG C;  1YBY A;  4UDU C;  1II3 A;  4C1N I;  3TN2 A;  3STB D;  1N34 L;  3I56 A;  5EKI A;  2CVR A;  4GLV B;  4BWG B;  2CFM A;  4JV5 L;  3K58 A;  3M7G A;  4RH6 A;  1A63 A;  1SSO A;  4LF8 Q;  2CH4 A;  1V8Q A;  2ALY B;  3DWQ A;  1C48 A;  4QUF A;  2RCF A;  1TR5 A;  1Q8I A;  2J0T D;  4RG1 A;  4Y52 H;  5M5X H;  1JB7 A;  3WDN A;  1XMQ Q;  2Z9H A;  1KAW A;  1EIF A;  4CDC C;  1QOH A;  4DR3 Q;  1BDO A;  1ZXT A;  4LW1 A;  1MHW C;  1N36 L;  3I55 A;  3ULL A;  1PTO B;  1WOC A;  4KKS A;  2DN8 A;  4A3L G;  3HS0 C;  1IBL Q;  1R9T H;  5IP7 H;  1FGB D;  2HHH L;  2SDF A;  2DUD A;  2KQ3 A;  3CCV A;  2E5L Q;  1RHP A;  1CQV A;  3BS1 A;  3MTS A;  5EAY A;  3HOV B;  4OXP A;  3FKI B;  3OOC A;  3QR8 A;  1CM9 A;  1LT6 D;  4X3T A;  1EWC A;  1MSH A;  5HGT A;  3K0X A;  2A68 C;  1TWG H;  4QY7 A;  1QZG A;  4FXG C;  1VDZ A;  2NVY H;  5C3E H;  1EFI D;  4Q0F A;  3QJY A;  3DHQ A;  4YY3 Q;  2FIN B;  1ZYR D;  1VQ5 A;  3AQQ A;  4FDB A;  4WFN 3;  4MZ9 A;  5BN4 A;  2VQF L;  2IJ0 A;  1V1Q A;  1G51 A;  4IFD G;  2EYF A;  2B2Y C;  4HID A;  3K7A H;  3OTO Q;  2CCZ A;  3KF8 A;  3E5S A;  3ERO A;  1VCI A;  4ODG A;  2F3I A;  1X9N A;  2D0O A;  5E4W C;  5FJ8 G;  1GHK A;  2E2H B;  4R4I A;  4K0K Q;  3NTI A;  4IO9 A;  5KNC A;  4LF9 Q;  3H6M A;  1AFP A;  4Y7N H;  5K5P A;  4HAE A;  1IXR A;  1V1P B;  4YCU A;  1LTL A;  1BOS A;  2M2L A;  1X3P A;  3QO2 A;  1Z47 A;  2HCI A;  3DUZ A;  1SFO B;  2B29 A;  3QIA A;  4K2K A;  3L7Z C;  1K3R A;  2VZA A;  2Z0S A;  3EIV A;  1H9S A;  2F0G A;  2YYZ A;  2H5X A;  4TVA B;  1B9N A;  2CH4 W;  3O13 A;  4APV A;  4IQZ A;  1S5C D;  2F0P A;  1EL0 A;  2RSO A;  5L37 A;  2KA7 A;  4K8J A;  4LFA Q;  4CGY B;  4AYB G;  4DV0 L;  3URY A;  2VB2 X;  2JA5 B;  3A0J A;  3MWY W;  2XSC A;  3LWE A;  4DF7 A;  4IPH A;  1CQF A;  3Q6S A;  4MNO A;  4XDX A;  4IPG A;  5AJ3 Q;  3D31 A;  1Q7Y C;  1EIY B;  1VQH A;  3TS0 A;  2F0H A;  1FR3 A;  3K81 C;  2AWN A;  4C3I B;  5IGD A;  2BCO A;  1X3F A;  2A19 A;  1CKN B;  4A3D B;  1AH9 A;  3MVV A;  5FO7 B;  2Y0S G;  1I4H A;  3PIO 3;  1PTO H;  2WAQ E;  1NUC A;  5G3L D;  1I4P A;  1E2Z A;  3U9O A;  1ZEQ X;  4X62 L;  2FXQ A;  1E1O A;  3TQY A;  4BXX G;  5CV8 A;  3HOV H;  3FKI H;  4KLK A;  4HMJ A;  1J6Q A;  1JE4 A;  3TP8 A;  3H3V I;  4IUN A;  3HG9 A;  1HNW L;  3GD7 A;  3HOY G;  4BBR B;  3SVM A;  3VYT A;  3NTH A;  2L9H A;  3VR5 A;  2ZJP A;  3GP7 A;  4J6H A;  4GN5 A;  2MGS A;  4DPG A;  3L2P A;  4A93 B;  1OXS C;  3AB9 A;  2JEB I;  4B08 A;  3PQI A;  1C4Q A;  3NEM A;  1NTG A;  2K5D A;  3OIQ A;  4OGQ C;  2K5Q A;  2DY8 A;  1ZYR C;  1TU2 B;  4HCS A;  2A74 C;  3H15 A;  4U68 A;  1GHJ A;  3G6E A;  1IYJ B;  2RQX A;  4A3M H;  2KCC A;  2E2I B;  1I4X A;  3L9A X;  3MHB A;  2E2H H;  3I7F A;  4L63 B;  4ALP A;  3GTP B;  5ELC A;  4A3G B;  2FMC A;  4DU9 A;  2MO0 A;  4F88 A;  4YWM A;  2A6E C;  3T1Y L;  2A1A A;  1K8O A;  1U4L A;  3NWS A;  3JC6 6;  2D2C C;  5CV7 A;  3NP8 A;  2NBF A;  3LNN A;  4RWS C;  3U58 A;  4JBM A;  5DEH A;  1V1P A;  5JAV A;  1SFO H;  5F2D A;  2IL8 A;  4CBV A;  3I72 A;  3E6Z X;  4CJ2 C;  2F0Q A;  2EXD A;  3PUZ A;  4I7Z C;  1RF2 D;  3K59 A;  4A3I G;  3A54 A;  3UE1 A;  3T4A C;  3KJP A;  2P5Z X;  1EYC A;  1B4O A;  1SND A;  4H13 C;  1VQM A;  4HJA A;  2F0W A;  3CD6 A;  1LTA D;  2B2T C;  1WTV A;  4JVZ A;  2VQF Q;  1L0W A;  2HD3 A;  2JA5 H;  2E2D C;  4LJZ C;  3DMU A;  1N9W A;  1U4R A;  2Q2T A;  4PZ8 A;  2KCN A;  4GOP C;  4B9X A;  4XQJ A;  4RFB A;  4YWK A;  2JSO A;  2L55 A;  4C3I H;  2L4N A;  2B39 A;  2R7Z B;  2PMZ E;  5IP9 G;  4A3D H;  2E75 C;  1LT3 D;  1KHI A;  3Q22 A;  4DR2 L;  1CKN A;  3W3A A;  1UNS A;  1PTO D;  1T5X D;  4LFC Q;  2AWO A;  2NZH A;  5CV4 A;  1JIC A;  2PYK A;  4KKT A;  1PYS B;  5LL6 X;  4BY7 H;  3D6C A;  3CPF A;  1PA6 A;  4QGU A;  1B44 D;  1QVG A;  4K5V A;  3AEV A;  1XNQ L;  1A3V A;  2DNC A;  4BBR H;  3CRK C;  2EY1 A;  1A6X A;  1SMY C;  2Z6K A;  4WOR A;  2OQ0 A;  1VQI A;  2PQA B;  1EY7 A;  3WOE A;  2UU9 Q;  4NP5 A;  4NXM L;  4A93 H;  2OCE A;  2JA7 B;  1ROD A;  4CDE C;  1A62 A;  2PI2 A;  3AYH B;  3MFG A;  4H44 C;  1HUM A;  3MC0 B;  1E2V A;  3J7A F;  1G8Z D;  4LF6 L;  2I0Q A;  1Y8P B;  2OTL A;  4UP8 A;  1Q90 A;  1V9P A;  4JI6 L;  1EQR A;  2E2I H;  2XWJ B;  4OHJ A;  4HTH A;  3J81 E;  2XWB B;  5FO9 B;  1J8I A;  1EOT A;  4FXK C;  1KDB A;  3CRL C;  3CCQ A;  1GJX A;  2HIX A;  4A3G H;  2EVB A;  2D0P A;  5EBC A;  2UXC Q;  2BH2 A;  2OXP A;  4HSV A;  1SRU A;  4DR7 Q;  4HJ9 A;  1EY8 A;  4RGN A;  5IYD H;  2PZT A;  3EVQ A;  1S5D D;  1LTS D;  3W5O A;  2HCC A;  1NMF A;  2F0K A;  2PNR C;  4RKB A;  1K0S A;  1GO3 E;  5LMU L;  3F2D A;  4FF3 A;  4MIU A;  1ESF A;  1SDF A;  3TZD A;  2ZXP A;  3GTL B;  3GTJ B;  4XXE A;  3K7U C;  1YI2 A;  5K36 G;  4ZCK A;  3KK7 A;  1QZH A;  1KD1 C;  4DK6 C;  4KHP L;  1W6J A;  4B3R Q;  4HJ8 A;  2UUA L;  5M5Y B;  2K33 A;  3V2T A;  3CCJ A;  1PFS A;  3OW7 A;  3E9H A;  2FMM A;  1SNP A;  2R7Z H;  3T56 B;  4C3H G;  2E74 C;  3J7A V;  1CSP A;  4K6L A;  3T1Y Q;  1C7Y A;  1IHZ A;  2NZO A;  4RCN A;  4E6I A;  4DV1 Q;  1PYB A;  1EY9 A;  1F2Y A;  1QUQ B;  3A7L A;  3ND9 A;  5IY0 A;  4ILW A;  1N8R C;  2DNE A;  1Q86 C;  2HDL A;  1XMO L;  3S1M B;  1CUK A;  4X64 Q;  1NNX A;  3BYT B;  2Z6B A;  3VYR A;  1EQV A;  2K1B A;  4G7O C;  1GUG A;  1QB5 D;  3UDF A;  2WP8 J;  3M85 A;  1RTN A;  1ML0 D;  4DV7 Q;  1K8G A;  4HN7 A;  3T1H Q;  2XVS A;  1BCP D;  1PZK D;  1D5X C;  4OON A;  1YHQ A;  2VQE Q;  2CQO A;  5G3L F;  4A3K B;  3TBI B;  3CC4 A;  1F9S A;  2PQA A;  1H9K A;  1HXY D;  2JA7 H;  2PQE A;  1YJW A;  2OQK A;  3J81 L;  4ZRZ A;  1L1O C;  5KRU A;  5GAG C;  1GD7 A;  5FLX E;  1OXT A;  3Q23 A;  2KEN A;  1O7Y A;  2ICI A;  4G4K A;  2C9O A;  2Q2U A;  2B2Y A;  1C8C A;  5EKL A;  5IYB G;  1UEA B;  1MKH A;  1QCB D;  4AYB B;  2YU9 B;  5BR8 L;  1DZ1 A;  4HJ7 A;  3NPP A;  4FNF A;  4H7B A;  1KNA A;  3JAM E;  4DR4 Q;  3CCL A;  2F0I A;  2XGT A;  3S15 B;  2G9H D;  4FF4 A;  4R4C A;  3U50 C;  2X6L A;  3KYH C;  3PMF A;  1VMP A;  1EU3 A;  5HY6 A;  3TP5 A;  4N9T A;  4HSP A;  3HOU B;  2UXB Q;  5A35 A;  1XNQ Q;  1VS0 A;  2Y0S B;  2DJF C;  2NVQ B;  3P20 A;  2I46 A;  2F0T A;  4JC0 A;  3S1N H;  1KTK A;  3SXH A;  1K0R A;  4X3K A;  4CDD C;  3HOZ G;  1J5E L;  3HKZ B;  4KV6 A;  3GTL H;  4DR6 Q;  1B3A A;  4PMB A;  3GTJ H;  1BNZ A;  5J1Z A;  2N88 A;  1VQG A;  2MHV A;  2F0S A;  3OYY A;  4DV2 Q;  1EU4 A;  4GKK Q;  3WOF A;  4LF6 Q;  1IBK L;  1A2T A;  5M5Y H;  3HOY B;  1W2B A;  4JI6 Q;  1WCM G;  4GOP B;  1LLR D;  4IAL A;  2CQA A;  2AQ3 B;  1YNX A;  1PFB A;  4RA8 A;  1SLJ A;  4IFD H;  3F8T A;  2B8F A;  4K5W A;  5GAE C;  2R61 A;  4HJ5 A;  3PO2 G;  2KOL A;  1CHQ D;  2ZJR A;  1J9O A;  1VQN A;  1HZ9 A;  2MO1 A;  3PO3 G;  1N33 L;  4PV1 C;  1QUQ A;  4B3T L;  3S1M H;  3PUX A;  5C44 G;  5FJ8 H;  4RGT A;  2KCM A;  1B7Y B;  4B9W A;  1E22 A;  1VQO A;  1NSN S;  1VQA A;  2NN6 I;  2HQE A;  1NY4 A;  1WTR A;  2A68 D;  3OMC A;  3CPW A;  1JB3 A;  2VXW A;  1BR9 A;  4JG2 A;  1PMR A;  4A3K H;  4R1J A;  2KJX A;  4RCO A;  3HOW B;  5IIF A;  1CK1 A;  1EFW A;  3J7A 5;  4AQY Q; 
#chains in the Genus database with same CATH homology
 5C0X J;  5JJL A;  2Q2H A;  3KF6 B;  2D0O A;  5GRO A;  1I6H H;  5FJ8 G;  1UE1 A;  1PH2 A;  4DV7 L;  4R4I A;  4K0K Q;  4JI5 L;  5C0X I;  4IO9 A;  3T1H L;  5C3E G;  4LF9 Q;  5JEA G;  5IYB H;  2I5M X;  4Y7N H;  2ZM6 Q;  2VQE L;  2YU9 H;  2V1C C;  3A5U A;  4R4O A;  3PIP A;  2QEX A;  1UWV A;  3U4V A;  1IXR A;  1RL2 A;  1Y14 B;  3W1B A;  4YCU A;  4DUZ Q;  2IY5 B;  1LTL A;  4KHZ A;  1EOV A;  1Z47 A;  1Z9F A;  1BBU A;  2B29 A;  3RLF A;  3J81 j;  3CF5 A;  1EYG A;  1E1T A;  3S15 H;  1A8V A;  3A74 A;  2ZTE A;  4P72 A;  3L7Z C;  1K3R A;  2VZA A;  2Z0S A;  3EIV A;  3H0G H;  4LWC A;  4QL5 A;  1SN8 A;  1Q46 A;  2LXK A;  1N32 Q;  2YYZ A;  2H5X A;  1QVC A;  4TVA B;  3ZJY C;  3CME A;  2UXD Q;  4APV A;  2JE6 I;  3NEN A;  3KJO A;  1AE3 A;  3CCR A;  1PH7 A;  2L15 A;  2N8N A;  4YHH Q;  1TXY A;  1HNX Q;  1NBW A;  3PF5 A;  3BJU A;  3KLW A;  4LFA Q;  3ULP A;  3VDY A;  5C4X H;  2NVQ H;  4DV5 L;  3CCU A;  4LF7 L;  4JYA L;  4AYB G;  1TWA H;  2F4V Q;  4DR4 L;  2K52 A;  4IPC A;  4C3J H;  4DV0 L;  4DR2 Q;  4POF A;  4B3S L;  1SE8 A;  3A0J A;  4X65 Q;  2R93 H;  4X6A H;  4IPH A;  4DAY B;  4MNO A;  4BXX H;  4EQ5 A;  4IPG A;  5HGQ A;  5AJ3 Q;  3D31 A;  4LFB L;  1Q7Y C;  1EIY B;  1VQH A;  4DV6 L;  3TS0 A;  1PH4 A;  1Y1V H;  1HZB A;  4GLX A;  3K81 C;  2UXB L;  2XTI A;  2AWN A;  4LF4 Q;  4JI8 L;  3HOY H;  4KI0 A;  4JI3 Q;  1XPO A;  1B8A A;  1X3F A;  2A19 A;  1CKN B;  4NXN Q;  1AH9 A;  1E24 A;  1WCM H;  2N3S A;  1FL0 A;  1WYD A;  2Y0S G;  3DM3 A;  5FLM H;  4LF8 L;  1EQQ A;  5C4X G;  1IL2 A;  2WAQ E;  4GOP A;  4DR6 L;  4A3L H;  3BZK A;  2IHE A;  4X62 L;  4L5S A;  3RZD H;  4JI4 L;  2KCT A;  1KQS A;  1XMQ L;  2R93 G;  3PO2 H;  2EIF A;  2FXQ A;  1E1O A;  1LUZ A;  4P73 A;  4NXM Q;  4O2D A;  4DV2 L;  3TQY A;  4HIM A;  2IX1 A;  4BXX G;  1SRO A;  4GKK L;  3HOV H;  4DR3 L;  2K4K A;  4A3C H;  1D7Q A;  3FKI H;  4KLK A;  4J15 A;  2UUB Q;  1FJG Q;  2ZJQ A;  4WJ4 A;  1Q1E A;  1J6Q A;  2HT1 A;  3RR5 A;  1Y1V G;  3H3V I;  1Y1W H;  1HNW L;  1H95 A;  5C44 H;  1NE3 A;  2PI2 E;  3GD7 A;  1PH3 A;  3G48 A;  3HOY G;  1OXX K;  4BBR G;  2MQH A;  2AKW B;  4PMW A;  3GTP H;  2ZJP A;  5M3M H;  5FLM G;  3W1G A;  4DK3 C;  1Q81 C;  3M4P A;  4DR5 L;  1IBL L;  4L5R C;  2UUC L;  1HR0 L;  1HZC A;  1HNZ Q;  4GN5 A;  4DPG A;  3RNU A;  4GKJ Q;  3ERS X;  3L2P A;  2E5L L;  3GDE A;  1OXS C;  2JEB I;  4NB3 A;  1PH9 A;  1X3G A;  4DV4 Q;  3F1Z A;  4DV3 L;  1YJ9 A;  3EN2 A;  3NEM A;  4YWL A;  1OTC A;  3HOX H;  4DAM A;  4IJL A;  1NTG A;  4OX9 Q;  3HOW H;  1VQE A;  4ME3 A;  3I4M H;  4A3C G;  4EX5 A;  3HOV G;  4OWW B;  2EQS A;  3FKI G;  4GS3 A;  2A8V A;  3UE0 A;  3UDI A;  3H15 A;  1O7I A;  5DLQ E;  2K50 A;  5C0X G;  3G6E A;  4P74 A;  1IYJ B;  2RHQ B;  4A3I H;  3AFQ A;  4A3M H;  1M1K C;  2CKZ B;  3RLO A;  4JBK A;  4YY3 L;  5IT9 c;  1X6O A;  3CQZ H;  3J7Z C;  2E2H H;  2B63 H;  1L1O B;  3KF6 A;  2E2J H;  3I7F A;  4YCW A;  3HFZ B;  4ALP A;  4X66 Q;  1B70 B;  5M3M G;  5LMU Q;  2VL6 A;  1FGU A;  3SGI A;  2MO0 A;  3KDF B;  2I5H A;  1WJJ A;  4YWM A;  3T1Y L;  2A1A A;  3FP9 A;  1W3S A;  2AHO B;  2N78 A;  3OTO L;  2CWP A;  3JC6 6;  1HZA A;  5LMN Q;  4AQY L;  2IHF A;  3HOX G;  5JJI A;  3U58 A;  4JBM A;  3TRE A;  4B3M L;  1IBM L;  4LUO A;  1SFO H;  3I4M G;  1MJC A;  1UE6 A;  5ELO A;  3F2C A;  1XNR L;  3GTQ H;  3Q8D A;  4KHP Q;  2EXD A;  3PUZ A;  1OXU A;  3EBE A;  1VQK A;  2VUM H;  4K0K L;  4UPA A;  4A3I G;  2UUA Q;  3KFU A;  3UE1 A;  4A3M G;  3TEH B;  4HIK A;  3MEF A;  3KJP A;  3J81 c;  5IP9 H;  1VQP A;  2B63 G;  2ZM6 L;  4QJF A;  4IJH A;  5IWA Q;  1VQM A;  4HJA A;  2NVX H;  4UP7 A;  3CD6 A;  4DNI A;  4DUZ L;  3WWV A;  1S3O A;  2K5H A;  2VQF Q;  1L0W A;  2YV5 A;  2JA5 H;  2OTJ A;  1S72 A;  1N9W A;  2HIV A;  4LF5 L;  2Q2T A;  4O0A A;  4PZ8 A;  1N32 L;  1GKH A;  4GOP C;  1V43 A;  5GAH C;  2QA4 A;  2VNU D;  2UXD L;  4YWK A;  1XMO Q;  3J81 i;  1NJI C;  1VQJ A;  1BBW A;  2KHJ A;  1KRS A;  4YHH L;  1HNX L;  2VUM G;  1WFQ A;  3GTK H;  4C3I H;  1ASZ A;  2PMZ E;  5IP9 G;  4LFA L;  4A3D H;  1X3E A;  1KHI A;  1GVP A;  2F4V L;  3U4Z A;  4DR2 L;  1PH6 A;  4IFD J;  1CKN A;  2F52 A;  1YHA A;  4LFC Q;  4A3B H;  2AWO A;  2NZH A;  4POG A;  4IFD I;  2JA5 G;  5AJ3 L;  3BU2 A;  3PF4 A;  3ER0 A;  4PG3 A;  1PYS B;  1CKO A;  5M5W H;  4JI7 Q;  3AFP A;  3PUY A;  4HIO A;  4BY7 H;  2YTY A;  1YJN A;  3CPF A;  3S2D H;  1PA6 A;  2LXJ A;  4UP9 A;  4QGU A;  4JI3 L;  1QVG A;  4NXN L;  3AEV A;  2Q2I A;  3F2B A;  1XNQ L;  1X55 A;  1UE7 A;  5JEA J;  4A3F H;  4GNX B;  4BBR H;  4JI1 L;  3PCO B;  2VY3 A;  2Z6K A;  4A3D G;  3M3Y H;  1FVI A;  1EWI A;  1VQC A;  3TRZ A;  2OQ0 A;  1VQI A;  2PQA B;  4JOI A;  4L5Q A;  4JYA Q;  4LF7 Q;  5BR8 Q;  2UU9 Q;  3G71 A;  2NVT H;  3A5Z B;  4A3B G;  3MXN B;  4NXM L;  4A93 H;  4DUY Q;  2OCE A;  1VQB A;  1XJV A;  4IOC A;  1A62 A;  3AYH B;  2PI2 A;  2BH8 A;  4JCV E;  1FJG L;  4JBW A;  3J80 c;  3RN5 A;  1Q8K A;  2R7D A;  2MNA A;  4BY7 G;  4LF6 L;  1X56 A;  1D8L A;  2ASB A;  1VQ6 A;  2I0Q A;  2WAQ G;  4LFB Q;  4BA2 I;  1SMX A;  2CWA A;  4OO1 I;  5JJK A;  5IE8 A;  4UP8 A;  2OTL A;  1VQF A;  1HR0 W;  1G6P A;  4JI0 Q;  3S1Q H;  3I2Z A;  1V9P A;  3K80 C;  4LUZ A;  1EQR A;  1K73 C;  4JI6 L;  2E2I H;  4JI8 Q;  4A3F G;  3S17 H;  4R4T A;  4BBS H;  5C4J H;  2RHS B;  1C0A A;  1N34 Q;  2NN6 G;  4JBJ A;  3HKS A;  4XTC S;  3CCQ A;  4DR1 Q;  1KIX A;  4GKJ L;  2HIX A;  3IRB A;  2GVA A;  4A3G H;  2D0P A;  3LGJ A;  4JV5 Q;  4XIG S;  1K83 H;  1L1O A;  2UXC Q;  2BH2 A;  4OX9 L;  4QIW E;  1SRU A;  3E0E A;  4P75 A;  3J80 i;  4AH6 A;  5M3F G;  1J5E Q;  2JQO A;  1U5K A;  4H02 A;  4DR7 Q;  1UEB A;  4A93 G;  2DGY A;  3KDF A;  1GM5 A;  1QVF A;  2JA6 H;  4HJ9 A;  3GTM H;  3RLN A;  5GQO A;  4IOA A;  1KL9 A;  2ZTC A;  1BVS A;  5IYD H;  5FLX c;  2VS1 A;  1YIJ A;  4PZ6 A;  4OWX B;  3W5O A;  3RN2 A;  3CAM A;  1K8A C;  2JJQ A;  1IBK Q;  1VQ4 A;  1NMF A;  1TWC H;  3CXC A;  4BBS G;  4X66 L;  2WFW A;  1N36 Q;  1GO3 E;  3S2H H;  5LMU L;  3M7N A;  3F2D A;  3DLL A;  1YVC A;  1M90 C;  4BY1 H;  2RCN A;  2JA8 H;  1I5F A;  4A3G G;  1TWH H;  4JI2 Q;  4DR5 Q;  1I94 L;  3M4O H;  2IX0 A;  2JEA I;  3JAM c;  3K7U C;  1YI2 A;  5K36 G;  5ELN A;  2K5N A;  2KBN A;  2JK8 A;  1QZH A;  1KC8 C;  2HHH Q;  1KD1 C;  4DV3 Q;  2PNH A;  2I5L X;  2HQL A;  2JA6 G;  1G29 1;  4DK6 C;  1SR3 A;  3I4O A;  4KHP L;  1MJE A;  1VQ9 A;  3CC2 A;  3PIO A;  5IYD G;  3S14 H;  4HJ8 A;  1X65 A;  2UUA L;  4B3R Q;  1N33 Q;  3PUW A;  4B3T Q;  3CCJ A;  3ICE A;  1PFS A;  5IWA L;  4LF9 L;  3E9H A;  2GN5 A;  1ASY A;  2R7Z H;  5GAD C;  3K8A A;  1I3Q H;  2D62 A;  4GN3 B;  1E3P A;  1VQD A;  4BY1 G;  3JAM i;  1CSP A;  2JA8 G;  1K9M C;  4WJ3 M;  4UY8 C;  2QGQ A;  3M4Q A;  4GN4 B;  2R92 H;  3T1Y Q;  3FHW A;  1C7Y A;  3G4S A;  1VQ7 A;  2NZO A;  2Z6K C;  3PGZ A;  4DV1 Q;  3ULJ A;  1PYB A;  5IY0 A;  1QUQ B;  1L2F A;  2IT1 A;  1N8R C;  4AIM A;  1XPR A;  1X54 A;  1Q86 C;  4JOI C;  1PHJ A;  3UDG A;  4B3M Q;  1XMO L;  1IBM Q;  1PV4 A;  3H3V H;  2C35 B;  3GO5 A;  1CUK A;  2WB1 E;  4X64 Q;  4LNQ A;  1XPU A;  1XNR Q;  4A75 A;  1JJC B;  2R7F A;  1KRT A;  5H1S E;  1PH1 A;  3UDF A;  2WP8 J;  3M85 A;  4DV7 Q;  1JJG A;  1JT8 A;  1K8G A;  4BA1 I;  1S40 A;  3T1H Q;  4JI5 Q;  2R7Z G;  2N49 A;  2WB1 G;  3PV0 A;  4GNX A;  4LFC L;  1RIP A;  1T9H A;  4OON A;  1YHQ A;  1Q12 A;  1CSQ A;  2CQO A;  2K5V A;  3KF8 B;  2VQE Q;  4X65 L;  2R92 G;  4A76 A;  1CKM A;  3CC4 A;  4A3K G;  1C9O A;  3NBH B;  4JI7 L;  2PQA A;  1PH8 A;  4L5T A;  1UE5 A;  1JJ2 A;  2JA7 H;  2E8G A;  1YJW A;  1DGS A;  3KOJ A;  2AMC B;  1A0I A;  1LM0 A;  4GLA C;  4RMF A;  4LF5 Q;  2OQK A;  3CW2 C;  3OW2 A;  4OO1 G;  4QQB X;  1YZ6 A;  1P16 A;  1L1O C;  2MFI A;  5GAG C;  1GD7 A;  2R6G A;  1OXT A;  1EUJ A;  4AYB E;  4A3J H;  2KEN A;  1Q1B A;  4LF4 L;  3CCM A;  1P8L A;  4A4I A;  2B3G A;  1U0L A;  1HH2 P;  3HOU H;  2BA1 A;  3UDX A;  2Q2U A;  2BA0 A;  5IYB G;  1YIT A;  4NPS A;  1MKH A;  2GVB A;  3TS2 A;  5BR8 L;  2UU9 L;  1YEZ A;  3NEL A;  4P71 A;  4HJ7 A;  3HOZ H;  3GTG H;  4DUY L;  4DV5 Q;  3PSI A;  4LUV A;  4DR4 Q;  4DV0 Q;  3CCL A;  5M3F H;  1Q82 C;  2JA9 A;  2YTV A;  1I50 H;  4B3S Q;  1LYL A;  2XGT A;  2JA7 G;  3STB C;  1VQ8 A;  2Y0S E;  3M9B A;  2VW9 A;  4R4C A;  3U50 C;  3CC7 A;  4TQU S;  2UUB L;  3KYH C;  3H0G G;  2OWO A;  5IYC H;  1Y1W G;  4JI0 L;  3L0O A;  4A3J G;  4DV6 Q;  5HY6 A;  1PVO A;  3CCE A;  3D0F A;  1YBY A;  3HKZ E;  3HOU G;  1XNQ Q;  2UXB Q;  1VS0 A;  1N34 L;  3STB D;  4C2M H;  4DR1 L;  1HJP A;  3I56 A;  4JI1 Q;  4GLV B;  2CFM A;  4JV5 L;  4JC0 A;  1HNZ L;  3E9I A;  3S1N H;  2UXC L;  2ID0 A;  3GTO H;  1K0R A;  1A63 A;  4LF8 Q;  3HOZ G;  1J5E L;  4DR7 L;  5J3B A;  3GTL H;  2ALY B;  3HKZ G;  1JE5 A;  4DR6 Q;  4DV4 L;  3GTJ H;  3CCS A;  1JMC A;  4DKA C;  1VQG A;  4RG1 A;  4X62 Q;  1TWF H;  4JI4 Q;  5M5X H;  1JB7 A;  1XMQ Q;  4YCV A;  4Y52 H;  1KAW A;  3BZC A;  3OYY A;  3PO3 H;  1EIF A;  4DV2 Q;  4GKK Q;  4LF6 Q;  5IYC G;  4DR3 Q;  1IBK L;  5M5Y H;  1OXV A;  4A3E H;  1YHB A;  4LW1 A;  4OWT B;  1W2B A;  1N36 L;  1HNW Q;  3I55 A;  5LMN W;  1WCM G;  3S24 A;  4GOP B;  3ULL A;  4JI6 Q;  3I4N H;  4C3H H;  4JI2 L;  1WOC A;  4IPD A;  1WI5 A;  3PUV A;  2K14 A;  1YNX A;  4PZ7 A;  4A3L G;  1SLJ A;  1IZ6 A;  2KHI A;  4MTN A;  3F8T A;  1R9T H;  1IBL Q;  2ZTD A;  2UUC Q;  5IP7 H;  5GAE C;  5E7N A;  1HR0 Q;  2HHH L;  3B6Y A;  2DUD A;  5LMN L;  3CCV A;  2YTX A;  4HJ5 A;  2E5L Q;  3PO2 G;  3RZO H;  5EAY A;  2ZJR A;  1PH5 A;  4OXP A;  1VQN A;  4B3R L;  1HZ9 A;  2MO1 A;  4GNX C;  3S16 H;  3PO3 G;  1N33 L;  1KXL A;  1NMG A;  1QUQ A;  4B3T L;  3S1M H;  3PUX A;  2LSS A;  3K0X A;  5C44 G;  5FJ8 H;  1TWG H;  4QY7 A;  1QZG A;  4A3E G;  2KCM A;  1XTD A;  2NVY H;  3CP0 A;  1B7Y B;  5C3E H;  1E22 A;  4YY3 Q;  1VQO A;  2ES2 A;  1VQA A;  3I4N G;  1VQ5 A;  2NN6 I;  3AQQ A;  4FDB A;  1NY4 A;  1MIU A;  4MZ9 A;  2VQF L;  3CPW A;  1AE2 A;  1E7Z A;  1G51 A;  1V1Q A;  4DV1 L;  1I94 Q;  4R4Q A;  5IP7 G;  4IFD G;  4JG2 A;  4A3K H;  4R1J A;  4HID A;  3K7A H;  3CMA A;  1BKB A;  3OTO Q;  2K75 A;  1EFW A;  1VQL A;  2CCZ A;  3HOW G;  3J7A 5;  4X64 L;  4AQY Q;  1VCI A;  2ATW A;  2RF4 A;  3S1R H;  2F3I A;  1X9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...