3GTGH

Backtracked rna polymerase ii complex with 12mer rna
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
146
structure length
136
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
total genus 15
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3gtgH00
1NJIC 2Y0SG 1KRSA 3CCRA 2C35B 1WOCA 5IY0A 5C44G 3CCJA 2JEAI 1PVOA 1Q7YC 1TXYA 4DV5Q 3I4MH 1VQCA 1C9OA 4HIMA 2JK8A 1PH4A 3CXCA 1U0LA 1Q8KA 2Z6KA 4JC0A 1YIJA 1OXSC 2OTLA 3HOYH 4GOPB 2VY3A 4IPCA 3J80i 4JI1Q 2Q2TA 2ALYB 2F52A 1NY4A 1PH9A 4L5RC 4AQYQ 3HOWG 3S1NH 1Q46A 3J7ZC 4JI7Q 1CSQA 4DUZL 4B3TQ 4YWMA 3S14H 3GTMH 1D7QA 4DV4L 1PHJA 4LW1A 2N49A 2B3GA 2N8NA 3AFQA 3E9IA 3I4OA 1TWGH 4DV2L 2VW9A 3KF6B 2VUMH 1IXRA 3PIPA 1HH2P 3S1RH 1XMOL 1XPRA 1UWVA 4OWXB 4GNXB 5K36G 1N32L 2A8VA 4MZ9A 4GOPA 5IYDG 1HR0W 1A63A 4KI0A 1YHQA 5AJ3L 2PMZE 2RF4A 3WWVA 4YHHL 3L7ZC 4MTNA 1HZ9A 4IO9A 2RCNA 4LUZA 3J80c 3PF4A 2CCZA 5IYCH 1VS0A 2R7FA 3S15H 3TEHB 2NZOA 4OO1G 2MO0A 4JI4L 4HJ7A 4DV6L 4NXML 1YNXA 5FJ8G 1X3EA 1UE7A 4FDBA 4DV4Q 4LUVA 3KF6A 3EBEA 1BVSA 4C2MH 4DV2Q 4GNXA 1NMGA 3PUXA 4LF4Q 4X64L 1XMOQ 2PI2A 4JI0L 4YCWA 1N32Q 4K0KL 1FL0A 4L5QA 1FJGL 1D8LA 1Q1BA 2CWPA 1EOVA 5AJ3Q 4X66L 2IX0A 4YHHQ 1SFOH 2NVXH 1T9HA 3J7A5 2JA8H 1WFQA 2B29A 2KHIA 5GAEC 3CCEA 2NVQH 4KLKA 3UDXA 5IWAL 1R9TH 1K83H 3CQZH 3PIOA 4JI2L 2MQHA 1YI2A 1N8RC 1I3QH 4DV6Q 4JI4Q 4A3DG 3BZCA 4H02A 3TRZA 2D62A 2YTVA 3JC66 3HOVH 2N3SA 2ZJQA 5JJLA 4OONA 1CSPA 1G51A 4GNXC 4DR3L 2BA1A 1B8AA 4IPDA 4A3EH 5IP7G 4X64Q 4JOIA 3KDFB 4JI0Q 2IHEA 1SE8A 4YY3Q 1M1KC 4K0KQ 2E8GA 1K9MC 3HKZE 4BBRG 2HHHL 1FJGQ 3KYHC 4X66Q 1Q81C 1KQSA 2CKZB 1YBYA 3G48A 4RMFA 1VQIA 5C4XH 3LGJA 2OTJA 1OTCA 3HOXG 5IWAQ 2JA7H 2GN5A 4A3BH 4GKKL 1QZHA 2VZAA 3T1YL 4JI2Q 4POFA 1KHIA 1K0RA 1YJWA 1VQBA 3TREA 4P71A 3UE0A 4A3JG 1CUKA 1JE5A 4IOCA 1VQGA 2EQSA 1V1QA 2VS1A 5LMNW 2WB1E 4DR3Q 3KDFA 3S16H 1PH5A 3H0GG 1JT8A 4JOIC 3AQQA 1YVCA 1Y1WG 2R92G 3U4ZA 4PZ8A 3OW2A 3VDYA 4KHPL 3U4VA 4DUYL 1HZAA 3PUZA 2HHHQ 3FKIG 2MNAA 1SLJA 3I7FA 1NE3A 3KJOA 2E2IH 2E5LL 1UE1A 3ULPA 3I4NH 4GKJL 1SRUA 2AWNA 4LF7L 4A3GH 3ULLA 5ELNA 1VQFA 4GKKQ 3T1YQ 1S40A 4OWWB 5JJIA 3GTKH 3J81c 5FLMH 1I94L 1A0IA 3ER0A 1CKMA 1C0AA 5M3MH 4LF5L 4UP9A 2ID0A 2K50A 3DLLA 5M3FG 4TVAB 3K7UC 1Y1VH 2YYZA 4DUYQ 2HIXA 3A5ZB 1WJJA 5GADC 2PNHA 2YTXA 3K80C 3RLNA 3CCMA 2ZTDA 1E1OA 3CPFA 3S24A 2E5LQ 4B3SL 1AE3A 1HNZL 5C0XJ 2E2HH 4GKJQ 1X54A 4LF7Q 4AQYL 4L5SA 3GTOH 4DPGA 1SN8A 1I94Q 4BY7G 2BH2A 3PUVA 1XMQL 3M4PA 4AYBG 4HIOA 2WP8J 4KHZA 1LM0A 2OCEA 3UDIA 4DR5L 4B3TL 4LF5Q 3PO3G 3A0JA 1EQQA 4A3CG 4A93G 4P72A 4IOAA 4L5TA 5E7NA 3JAMi 3H3VI 2VL6A 3F2DA 1L1OB 3SGIA 4JV5Q 1XJVA 4LFAL 3STBC 2VQFL 3L0OA 1KRTA 4B3SQ 3CCUA 2OQ0A 2K5VA 1SMXA 2PQAB 4HJ8A 4HJAA 4DAYB 1HNZQ 4JBKA 1VQOA 1G6PA 1YJNA 2I5MX 2B63H 1X3FA 3D0FA 4JI6L 3HOUH 5C3EH 1K73C 1IBML 3I2ZA 1PH6A 4XTCS 1JJ2A 1H95A 1QVCA 2GVAA 4LFCL 1XMQQ 3M7NA 2AKWB 1TWAH 2WAQE 3FHWA 4DR5Q 1N36L 2UUAQ 4BY1G 3GO5A 1X3GA 3MEFA 4JBWA 1L1OA 2OQKA 3STBD 5IP9H 4A3LH 1K3RA 4A76A 4LF4L 4C3JH 3JAMc 2HIVA 1N33L 4YCUA 2PQAA 4LFAQ 4BBSG 2Z6KC 2VQFQ 2UXBL 3RR5A 4C3HH 4WJ4A 2L15A 5GAGC 3CC2A 1YHAA 4GN3B 4DV7Q 1AH9A 4DNIA 1E24A 4JI6Q 4UY8C 1IBMQ 1IBKL 3RN2A 4X65L 3M9BA 1PFSA 3EIVA 3KLWA 4LFCQ 1X55A 3TS2A 4PMWA 3CMEA 4ALPA 1N36Q 1HZCA 1A8VA 3AYHB 2K5NA 2LXKA 1QUQB 1FGUA 4YWLA 1GO3E 2JEBI 1N33Q 4GOPC 1YITA 4DV1L 4YY3L 2UXBQ 2QGQA 4Y52H 3GDEA 3CPWA 5LMUL 1GVPA 3S2DH 4LWCA 3CC7A 3RZOH 5DLQE 3M3YH 4OXPA 4A3JH 1IBLL 2CQOA 4QGUA 3M85A 1IL2A 1IBKQ 1ASZA 4X65Q 3RLFA 1HJPA 4APVA 1Y1WH 1VQLA 4JG2A 1E1TA 3UE1A 1MKHA 4OWTB 4BA1I 4JYAL 1E3PA 3CCQA 1QUQA 3PSIA 1PYSB 3FKIH 4DKAC 1VQ6A 2Y0SE 2UXDQ 2FXQA 3KF8B 1Q86C 4PZ7A 1M90C 1PH3A 1HR0L 1GD7A 3CP0A 4DV1Q 2MO1A 1O7IA 4LUOA 5LMUQ 1AE2A 1EYGA 2H5XA 3ICEA 4R4CA 4A4IA 2CWAA 1P16A 3RNUA 3UDGA 1XPOA 1HZBA 3W1BA 2PI2E 1JB7A 1IBLQ 4GLVB 3NBHB 3A74A 5JEAJ 3OTOL 3GTJH 5C0XG 1S3OA 4NXNL 2JQOA 1KXLA 3PUYA 1KC8C 2AWOA 4JYAQ 1L2FA 3M4OH 3PUWA 1V9PA 3CD6A 4HJ9A 1GKHA 1HR0Q 1PH1A 3S1QH 4NB3A 1WYDA 4DR6L 1WCMG 3PF5A 1S72A 3S1MH 1XTDA 2V1CC 1Q1EA 5M5XH 2UUBL 3M4QA 1CKNB 3MXNB 4QY7A 5HY6A 4QL5A 2Q2HA 2ZM6L 1N9WA 1JJCB 3K8AA 3OTOQ 3PO3H 3ULJA 4IJHA 2JA8G 4IPHA 1X56A 2AMCB 2BH8A 2GVBA 1DGSA 2WAQG 3K0XA 5EAYA 5C44H 4A3MG 1K8GA 3PO2G 1SROA 4DK3C 1BBWA 2QEXA 4BA2I 4DR4L 3ZJYC 1OXXK 5H1SE 3PGZA 4DR7L 2LXJA 2IT1A 3BU2A 3PCOB 4QJFA 1Q82C 2I0QA 3HOZG 2OWOA 3HOVG 4DR6Q 1HNWQ 1BKBA 1CKNA 4JV5L 1VQHA 2UUBQ 2RHQB 3AFPA 1XPUA 3HOWH 5IYBG 1VCIA 3RZDH 4A3EG 4MNOA 4LF9L 2JA6G 4IFDJ 4BXXG 3GD7A 3T1HL 1TWHH 4A3IG 2ZM6Q 1MJEA 1LYLA 4DR1L 4DK6C 1I5FA 1E7ZA 5C4XG 3BZKA 5C0XI 4HJ5A 5BR8L 4A3FG 4IFDI 2MFIA 5LMNL 2NVTH 1RIPA 2JA7G 4A3BG 4A3KG 4DR4Q 4BBSH 4DR7Q 2R93G 2KCMA 5IYDH 2UUAL 4GLAC 4DAMA 2K5HA 1P8LA 4P73A 3TQYA 3F1ZA 4UPAA 4AIMA 3RLOA 4DV0L 4LF9Q 3CAMA 2VNUD 1EIFA 3T1HQ 1OXUA 2JA5G 5FJ8H 2ZTEA 4DV7L 3NENA 4DR1Q 4GN5A 1KIXA 3S2HH 4C3IH 1SR3A 2BA0A 5BR8Q 1VQ5A 2E2JH 3I4NG 5LMNQ 3GTPH 1IYJB 4A3GG 4LFBL 5GAHC 4EX5A 1X65A 5FLMG 2D0OA 2VQEQ 2K52A 4R1JA 5M3MG 2K4KA 1VQAA 3HKZG 4AH6A 1TWFH 2KENA 1VQJA 3FP9A 4DV0Q 4LNQA 1OXTA 4A3DH 1Y1VG 5C4JH 4PZ6A 2I5LX 3B6YA 2R7ZG 1KD1C 3GTLH 1L0WA 2D0PA 3ERSX 4YWKA 1Y14B 2A1AA 1CKOA 3KOJA 5HGQA 1UE5A 3CF5A 5IP7H 4LFBQ 5JEAG 3CCVA 3NELA 2K75A 1PYBA 2WB1G 3U50C 1XNQL 1JMCA 5FLXc 4QQBX 1L1OC 3F8TA 4BBRH 2UXDL 2UXCL 1NTGA 3S17H 1K8AC 2Z0SA 3CMAA 1QVFA 3J81j 4OX9L 1FVIA 4ME3A 2YV5A 3W1GA 1PV4A 4R4QA 3HOXH 1VQ9A 3KFUA 3HKSA 1I50H 2I5HA 4LF6L 1B70B 2UUCL 4WJ3M 1IZ6A 1VQNA 3I4MG 3DM3A 2NN6I 2JE6I 2ZJRA 1VQ4A 2AHOB 4B3ML 3OYYA 4POGA 4NPSA 4UP8A 1W2BA 3NEMA 3PV0A 4J15A 3HOYG 3KJPA 1EFWA 2RHSB 4R4OA 3H3VH 3H0GH 2B63G 4EQ5A 2HQLA 4DUZQ 4HIDA 4X6AH 2R92H 1YHBA 5GQOA 3IRBA 5M5YH 5C3EG 2KCTA 1WCMH 4AYBE 3F2BA 1XNQQ 3HOUG 4TQUS 2HT1A 2UXCQ 2IY5B 3E0EA 1VQPA 4P75A 4XIGS 4JI5L 1V43A 4OX9Q 2WFWA 4IJLA 2JJQA 1J5EL 1VQKA 1X6OA 5IP9G 3RN5A 4LF6Q 4A3LG 1Z9FA 2UUCQ 1KAWA 2DUDA 2VUMG 4A3MH 4B3RL 1Z47A 4JI3L 4B3MQ 3G4SA 1LUZA 3PO2H 1VQ7A 5IT9c 1X9NA 1YJ9A 4IFDG 2YTYA 2UU9L 4NXMQ 1J6QA 1PH7A 3G6EA 5M3FH 1VQ8A 2EIFA 5IYCG 2ASBA 3HOZH 4RG1A 2N78A 2ES2A 3Q8DA 4JCVE 2F4VL 5IYBH 5ELOA 1ASYA 1N34L 4JI5Q 1TWCH 2JA6H 4BXXH 1HNWL 1J5EQ 1E22A 4P74A 2R6GA 3F2CA 4JI8L 4A3IH 4JBMA 1RL2A 4JBJA 4QIWE 4BY7H 4A3FH 4JI3Q 4B3RQ 4X62L 1GM5A 2YU9H 3CW2C 2XTIA 1U5KA 4A3KH 3J81i 4A3CH 1QZGA 3K81C 2R93H 1MJCA 2UU9Q 3U58A 4A93H 1A62A 3CCLA 1NBWA 1NMFA 3GTGH 1G291 1YEZA 2A19A 4OO1I 2CFMA 4Y7NH 3TS0A 3CCSA 3UDFA 2QA4A 3L2PA 2F4VQ 3GTQH 5JJKA 1N34Q 1EQRA 4UP7A 1B7YB 5J3BA 2IX1A 2F3IA 2KBNA 2JA5H 5GROA 4JI8Q 1I6HH 1UEBA 1XNRL 4O2DA 4HIKA 3A5UA 4DV3L 4DR2L 1HNXL 4X62Q 3AEVA 4PG3A 1C7YA 3E9HA 1KL9A 4GLXA 2ATWA 3CC4A 4GS3A 4IPGA 4R4IA 1LTLA 2JA9A 1VQMA 4BY1H 2K14A 4LF8L 4R4TA 5IE8A 1UE6A 5M5WH 4A75A 1VQEA 3HFZB 3H15A 2EXDA 1W3SA 4O0AA 2VQEL 4KHPQ 1OXVA 1EUJA 2ZJPA 4DV5L 1PH8A 2ZTCA 1JJGA 2IHFA 2Q2IA 1QVGA 2R7ZH 3W5OA 2R7DA 1EWIA 3BJUA 1XNRQ 2NZHA 2NN6G 1VQDA 2XGTA 4YCVA 4JI1L 4DV3Q 2NVYH 3D31A 3I56A 4DR2Q 1HNXQ 3K7AH 4GN4B 3I55A 2KHJA 1MIUA 2Q2UA 4NXNQ 2LSSA 1BBUA 3G71A 1PH2A 1EIYB 4JI7L 4LF8Q 1WI5A 1YZ6A 3EN2A 2DGYA 1Q12A 1PA6A
chains in the Genus database with same CATH superfamily
1KRSA 1WOCA 4DN4M 4DV5Q 1WTRA 3A8IE 3D4DA 1VQCA 3I4MH 3GTQB 3CXCA 1YIJA 1EY9A 2VY3A 2E2IB 2O5JC 2ALYB 2F52A 1IL8A 3MXUA 4HAEA 1PH9A 3I4NB 2NB0A 2FHTA 2BDOA 1Y69U 3J7ZC 3R8BA 1ENFA 1WD0A 1I6VC 4B3TQ 4YWMA 3S14H 1EY8A 3KLRA 3TP5A 3E9IA 5M3MB 3I4OA 2IL8A 1TWGH 4DV2L 2VW9A 1SE3A 4IUUA 5KYIA 1XPRA 1UWVA 4JK1C 3A7LA 4L63B 1PMRA 4GOPA 2A8VA 1A63A 3R3OA 4KI0A 3SEBA 5AJ3L 1YHQA 4YHHL 1SNDA 1STNA 2AUJD 5LL6X 4R8IA 5IYCH 1EOTA 3TEHB 4OO1G 3D6CA 1CQFA 5FJ8G 1X3EA 4X3UA 3KF6A 4CKEA 3R2IA 4S3SA 4C1NK 3GQBA 4JI0L 2A5HA 3I4MB 4ODGA 2CWPA 3NQTA 4CJ2C 2JA8H 1BR9A 1O7YA 1SYEA 2NVQH 3A7AB 1EU4A 2B63B 2CHBD 3L3OC 2MQHA 3BVMA 1N8RC 4DV6Q 3TRZA 2YTVA 3HOVH 2N3SA 2MUYA 1HTLD 1G51A 4DR3L 1B53A 4C56C 2VB3X 1G2TA 4K0KQ 2E8GA 1K9MC 2HHHL 1FJGQ 4C3JB 3KYHC 1KQSA 4KV6A 1SYCA 2CKZB 4RMFA 4CHTB 5C4XH 1C48A 1CZGA 1VQIA 3LGJA 5KRUA 3FEWX 1OTCA 2WKDA 1CFMA 2GN5A 5AFWA 1QE6A 1YJWA 4KK7A 4KJNA 4PMCA 2A68C 4IOCA 1VQGA 2EQSA 5LMNW 2XWJB 5E1FA 1F2LA 3H0GG 3UI2A 1Y1WG 3ZYYX 3U4ZA 2NN6H 1HZAA 3PUZA 3U9OA 3KJOA 1NE3A 1ML0D 2IWHA 3CU7A 2F0UA 2RVLA 1G91A 4GKKQ 3P1HA 4K5VA 2NVQB 1S40A 3GTKH 3V05A 3TZUA 1C0AA 3DLLA 2RQXA 3HG9A 5CV5A 1Y1VH 2YYZA 3F2UA 3GP7A 5KIXA 1GUGA 3TSSA 2PNHA 2YTXA 3RLNA 4B3SL 3S24A 4GKJQ 1B3AA 4LF7Q 2L12A 4BWGB 2SOBA 1I94Q 3GTJB 3M4YA 4F8MA 1XMQL 4HIOA 2EPBA 1EQQA 1JICA 3K5LA 1HXYD 3JAMi 3H3VI 1KNAA 2F0WA 4V190 4LFAL 3Q22A 4N8FA 2VQFL 3CHBD 4G4KA 1KRTA 3S1MB 2PQAB 1SMXA 4HJAA 1HNZQ 2F0PA 2BE5C 2K32A 4OEMB 4JI6L 2N55A 1STHA 3HOUH 3I2ZA 3SE0A 1SJHD 1N36L 1CHQD 1LTAD 2UUAQ 1KLGD 3MEFA 3STBD 4A3LH 1SMYD 2L9HA 1G2SA 4DAYA 3RR5A 2AQ3B 2KEDA 2EVBA 2L15A 5GAGC 1YHAA 4DNIA 2QF7A 4UHVA 4LFCQ 1F9QA 4QUCA 1RTOA 2KECA 5I6WA 3TS2A 1HA5A 4ALPA 1HZCA 1V1PB 2ZXOA 1AFPA 1QUQB 3DUZA 2JEBI 1YITA 3CPWA 4KHVA 3S2DH 4LWCA 5BN4A 3CC7A 3RZOH 5DLQE 2B8GA 4RA8A 4OXPA 4KD3A 1ASZA 4ZUIA 2PNRC 3QIAA 4APVA 1HQRD 3TDQA 4C3IB 2E2JB 4JYAL 1ILQA 5D3IB 3DXJC 3KF8B 1Q86C 1PH3A 3CP0A 5BN3A 2P5ZX 2H5XA 3ICEA 1HZBA 3W1BA 1TT2A 4A3DB 5C4JB 2F0DA 1S4ZA 1EIHA 1KXLA 2EDGA 1L2FA 1IHZA 4KKUA 3M4OH 1LT4D 2FJ2A 1J8IA 3TP7A 3S1QH 3P7JA 1S72A 1WVLA 3FRPB 4E6IA 3HOXB 1UAPA 3DEPA 4QY7A 4IN3A 3NBHA 5EKKA 5HY6A 2Q2HA 1JJCB 3PO3H 4X3TA 4NXNQ 2PZTA 3K5MA 3PO2G 1II3A 1BBWA 2QEXA 4BA2I 3KLSA 1A3TA 1ICFB 4DR7L 4CKCA 2LXJA 2HDMA 1STAA 3HOZG 1BKBA 2A6HD 1CKNA 1F77A 2DY7A 4MNOA 4LF9L 4A3IG 1MJEA 4DR1L 4DK6C 1E7ZA 3MA2B 3FPUB 4HJ5A 4IFDI 5BR8L 2M2LA 5M3FB 4KKSA 3M4OB 2KQ3A 2HD3A 4KY7A 4J6HA 3F1ZA 4AIMA 2VNUD 1EIFA 3T1HQ 3NTKA 5FJ8H 2ZTEA 4BY7B 2YU9B 5EKIA 2PYKA 3S2HH 3I4NG 2BA0A 3PO3B 1K0SA 3GTPH 4A93B 2K5QA 5GAHC 3GTGB 1Z6HA 1PTOD 2D0OA 5A2QL 1PRTC 2K52A 4R1JA 5M3MG 4AH6A 3K57A 4DAPA 1XYIA 1KD1C 4IALA 3GTLH 1IYVA 1QJOA 4YWKA 3AU7A 4L6TB 3KOJA 5HGQA 4ZYSA 2CH4A 5JEAG 3NELA 3VA7A 1PYBA 2UXCL 1NTGA 2NZ1D 1JOKA 1PTOF 3CMAA 1B9NA 5C5MA 1SAPA 2YV5A 3W1GA 1VQ9A 4R4QA 2L55A 3KFUA 4BS9A 4LF6L 1B70B 4J1MA 3I4MG 2F0KA 3OW7A 1VQNA 3IFDA 3J80L 4PNYA 2K03A 2AHOB 4POGA 3PV0A 1H9JA 3H0GH 2B63G 1EWCA 3S2HB 4DK0A 5M5YH 1SYFA 3GTPB 3F2BA 2IPKD 1ZYRC 4OX9Q 3SVMA 1X6OA 2N88A 4DA2A 2DY8A 3MAQA 1HTPA 2UUCQ 1RTNA 4A3MH 4C3JG 1G6ZA 4B3RL 4JI3L 4B3MQ 3G6JB 2PW5A 1LABA 5ELEA 1WTVA 1YJ9A 2CW0C 2UU9L 1SYDA 1PH7A 3S1NB 2SNMA 5IYCG 4RG1A 4JCVE 3MFGA 1U4PA 5CBEE 4JI5Q 2CQAA 2JA6H 2K05A 4ZCKA 1LTGD 3I73A 3MWYW 1PFNA 3CW2C 2EJFC 1MJCA 5T1GA 1A62A 3CCLA 1YEZA 2RSOA 3EA6A 4EQOA 1EU3A 3J80E 4ZKCB 1EQRA 1QB5D 5J3BA 4C2MB 2F3IA 1NAPA 3V96A 1SE4A 1I6HH 1FNVA 4FO2A 4A3MB 2WAQB 3E5SA 3VYSA 4IPGA 2B2VA 4R4IA 1LTLA 1VQMA 3CQZB 4LF8L 1ONLA 5IE8A 1UE6A 2BCOA 3OIQA 2VQEL 2DNEA 4A3EB 1QVGA 4WRDA 2JA6B 1K28A 1QNKA 1XNRQ 2NN6G 3S9WA 3I70A 4DV3Q 2NVYH 1O7LA 3K7AH 2O5IC 2KHJA 1G8ZD 2Q2UA 1BXTA 1F9RA 1EIYB 1IKLA 3EN2A 2DGYA 4RCOA 5CMDA 1PVOA 1TXYA 1C9OA 3IKJA 5CR3A 1WTPA 3HOYH 1I6HB 1EFID 3CRKC 4L5RC 2X6GA 2EYHA 4DU9A 4A3GB 3H09A 4ILWA 3IL8A 2F0LA 2MP1A 4DV4L 4LW1A 2B3GA 3HKZB 4H44C 4YIJA 3PIPA 2BOSA 3QWNA 1X32A 2PMZE 4ZK9B 1KAAA 4RAUC 2RCNA 4LUZA 3J80c 1HUMA 2E2HB 1EZ6A 1VS0A 2EYJA 5K5PA 2MJ8A 2WINB 3S15H 2C9OA 3IAYA 2MO0A 3VA5A 4HJ7A 1UE7A 3KK7A 1UUPA 1D1IA 2C5CA 1L0YB 4C3IG 1BVSA 3VR4A 1SNCA 4GNXA 4X64L 1XMOQ 1DONA 1N32Q 1FL0A 1Q1BA 2IX0A 1SFOH 3HOYB 5IWAL 1K83H 2IW3A 5IGGA 4DXFA 4A3DG 4JI4Q 1I3QH 3BZCA 1D5MC 5HURA 4RCNA 3DEOA 2Z1CA 2ZJQA 3NUCA 4ID6A 4OONA 1CSPA 5L37A 4CJ0B 4GNXC 3QB3A 4G57A 3H6MA 1XXGA 5IP7G 5CV9A 4JOIA 1BOSA 3KDFB 1QILA 3HKZE 4X66Q 3I3CA 1YBYA 1AEXA 1HFNA 5I4DA 1KLUD 3NWSA 5E3FA 3HOXG 1PFMA 3C1FA 1QZHA 4JI2Q 2KEEA 1EEFD 1KHIA 1K0RA 4P71A 1CUKA 1JE5A 1IYUA 1V1QA 1TU2B 1GUSA 4TSSA 5EBDA 1PH5A 4JOIC 4KJOA 4FF1A 1SNQA 3VDYA 2Q8RE 4XYOA 3PMFA 2MNAA 1SLJA 2E2IH 3ULPA 3I4NH 1SFOB 3V2TA 5ELNA 1VQFA 5LHY1 2EY2A 3T1YQ 4OWWB 3M3YB 2KJXA 2A68D 4OIKA 3J81c 1A0IA 3ER0A 5M3MH 4OHJA 4LF5L 1D5ZC 4FNFA 1FD7D 5M3FG 5CC4A 1KDAA 3IFTA 4DUYQ 2EYLA 1WJJA 1PZJD 2E5LQ 3CPFA 5C0XJ 1QG7A 1LT5D 4ULLA 1PFBA 3NHHA 4OGQC 2MPMA 5JEAH 4AQYL 4L5SA 3GTOH 4DPGA 1SN8A 1IKMA 3SXHA 2DJFC 4BY7G 2XN9C 3PUVA 4XYQA 4F7XA 4N8X1 3DMUA 3PO3G 4A93G 4H13C 4IOAA 5E7NA 2F0EA 1XJVA 5IGEA 3CCUA 4FF4A 1DM0B 5M5XB 1SJED 2KCCA 2B63H 3D0FA 4MHEA 1JJ2A 3M7NA 1FGBD 2AKWB 1TWAH 3FHWA 4DR5Q 3CKIB 2CVRA 3L9AX 3OWFA 3GO5A 1X3GA 5EBCA 1L1OA 1H9SA 2LY7A 1HHVA 4A76A 4C3JH 2HIVA 4UAIA 1EY5A 1GHJA 2UXBL 2BE5D 3HOWB 3RZDB 4IQZA 3CC2A 4GN3B 1AH9A 1X3QA 2H1EA 1IBMQ 1B44D 1IBKL 3GTOB 3J7AF 3KLWA 1X55A 5C5LA 1TS3A 4PMWA 3AYHB 2LXKA 1GO3E 5CV7A 1N33Q 2J0TD 4GOPC 3MXGA 1VMPA 4YY3L 1PTOH 1ET9A 1AZPA 1GVPA 2X6LA 4HTHA 3TN2A 1DOMA 4G7ZC 1IL2A 4X65Q 1E2ZA 2A73B 1AP0A 3ITPA 4OWTB 1E3PA 3CCQA 1TWAB 4FYDA 1PYSB 3FKIH 5EQ0A 5IGFA 1VQ6A 1B2TA 4PZ7A 2JSOA 4DV1Q 4RWSC 4LUOA 2HUGA 1EWHA 5LMUQ 5FK9C 1TWFB 1K3BC 4A4IA 4K2KA 4UDUC 5IT9L 2ICEC 2SEBD 2J4XA 4QUFA 1IBLQ 1GUTA 3OTOL 3GTJH 3LWEA 4IUQA 4R8NA 2WIIB 1S3OA 1TY0A 3PUYA 4WORA 2F0JA 3PUWA 5D3DA 4HSVA 1HPCA 1YNNC 3W2DA 4CBVA 4R9WA 5CBAE 1GKHA 4HJ9A 1HR0Q 1Q8IA 2RSNA 4GZYC 1O7ZA 4NB3A 4X3KA 3S1MH 3S17B 1DJRD 2UUBL 4TRDA 1ENAA 3TMEA 3MXNB 1PTOB 1MGSA 1I50B 1LT6D 4QL5A 3K8AA 2PO4A 4XXEA 3E0JA 4IPHA 2AMCB 1Y8OB 2BH8A 2WAQG 2RDFA 3K0XA 4HCSA 4NDXA 5EAYA 4A3MG 1SROA 1XX8A 4NMZA 4DR4L 1EIGA 2R92B 3PGZA 3BG3A 1U4MA 4IUPA 3BU2A 3PCOB 4QJFA 3URYA 2FMMA 2LFNA 1Q82C 3FKIB 4DR6Q 1L0XB 1VQHA 2RHQB 1XPUA 1HRJA 4A3EG 2JA6G 4IFDJ 1SE2A 2HDLA 2ZM6Q 3EJIA 1CT1D 5C0XI 1FNWA 4G7HC 3NK9A 1PXUA 2MFIA 5LMNL 3M7GA 5C6AA 2KCMA 2ENBA 1BDOA 2K5HA 3D4RA 5IT9E 5A35A 4KN4C 4FF2A 1TWCB 1D2BA 4K14A 3X3MA 4UPAA 2DN8A 5KGUA 1JOOA 4HMIA 3EROA 1JQYD 4U68A 3NENA 4DGZA 4I65A 4AYBB 4C3IH 2E2JH 4A3GG 1EQTA 5KNDA 2B39A 1X65A 1EL0A 3BVGA 1EY6A 4Y7NB 2VQEQ 4K6DA 1BCPC 2KVMA 1JE4A 3HKZG 2R3ZA 1CZWA 4NKLA 2EOTA 2KENA 4O42A 2R61A 3BYTB 4DV0Q 1RODA 4EQNA 4A3DH 2DJGC 5C4JH 2I5LX 1EEID 3ERSX 1C4QA 5KNBA 1SYGA 2A1AA 1CKOA 1WTWA 1UE5A 4BY1B 5IP7H 1PRTD 3CCVA 4LFBQ 2K75A 3U50C 1WTXA 1XNQL 5M5WB 2KHSA 4PMBA 2Q8TA 5J39A 2Q8IB 1FVIA 4NP5A 3HOXH 3N6RA 2R7ZB 4XQQA 2JE6I 1VQ4A 1NR4A 1STBA 1W2BA 3HOYG 4R4OA 3H3VH 4EQ5A 3Q24A 1S5FD 1YHBA 4N9TA 1E0BA 2KCTA 4AYBE 4HMJA 5EPJA 1PRTF 3HS0C 2TSSA 3AMUA 3P20A 1J5EL 1VQKA 5IP9G 3RN5A 4FP5D 1I4GA 1KAWA 1RKNA 2DUDA 1I4RA 1R4QB 4DFAA 2M9VA 2VXWA 3RD4A 4DNTB 1VQ7A 5IT9c 1T5EA 3I72A 3MZ5A 3G6EA 5M3FH 2N78A 1ZYRD 3K0YA 2FFKB 3GTMB 5FO8B 2F4VL 5IYBH 2XWBB 1NCVA 1N34L 2K28A 5C4HA 4BXXH 1E22A 4P74A 5ELCA 3S1RB 1NR2A 1RL2A 4JBJA 2PCFB 4IUTA 1M8AA 4A3FH 4BY7H 2OXPA 4X62L 2YU9H 2F0NA 2XTIA 3J81i 3U58A 4A93H 1NBWA 4OO1I 3GTGH 1G291 2Z4IA 3BDOA 5I2XA 1F9SA 3L2PA 2QA4A 2G9DA 1B7YB 1LT3D 4JI8Q 5FO7B 3VR6A 1GJXA 4O2DA 4HIKA 2NVXB 4FVMA 5I9PA 4PG3A 3E9HA 2KUMA 4GLXA 1D6EC 3CC4A 1R9TB 5T1IA 4GS3A 2JA9A 2K14A 1U4RA 4R4TA 1JR0D 1VQEA 2OT2A 2NTTA 3H15A 4O0AA 1YNJC 3NWTA 1PH8A 4DV5L 3E3XA 4XDXA 1JCKB 2Q2IA 2V4DA 1LTTD 4M1UB 1STEA 1SDFA 3BJUA 1VQDA 4DR2Q 1HNXQ 4A3FB 3OSOA 2JA7B 4A3BB 1BBUA 1PH2A 5C4ZA 5IGDA 5IOCA 3I8ZA 1SNMA 1NJIC 1DCZA 3CCRA 2C35B 2WKCA 4CDCC 3BS1A 3CCJA 2JEAI 1Q7YC 1A2UA 5LL6S 2F0MA 4HIMA 2JK8A 3NTHA 4CJ1B 3DWPA 1SMYC 1Q8KA 4QMGA 2Z6KA 2OTLA 1OXSC 4GOPB 2TMPA 4JI1Q 2Q2TA 4OELB 1GUNA 4AQYQ 3HOWG 1CA5A 3S1NH 4FF3A 1Q46A 4JI7Q 1CSQA 5D65A 2L11A 1XWEA 2M00A 4CGYB 1D7QA 1PHJA 2N49A 2Z4HA 5JJZA 1X3PA 3KF6B 1IXRA 3JAML 1T5XD 2QDLA 2EYMA 2K5WA 3OIPA 4OWXB 4MZ9A 5IYDG 1HR0W 3A56A 3U9SA 2RF4A 5HGTA 3T51B 4IFDH 3HEJA 1AN8A 3D3RA 3PF4A 2EJMA 4DV6L 4NXML 2D2CC 1HA6A 5FLXL 4LUVA 2J7ZA 1ILPA 3EBEA 3QO2A 4DV2Q 4C2MH 1E2WA 1I4QA 3PUXA 4YCWA 1QOHA 1IW7C 4K0KL 1F2ZA 1I4XA 1D8LA 1FJGL 5AJ3Q 4Q5VA 4YHHQ 3GV3A 4KN7C 1T9HA 1WFQA 3NPPA 4LMQD 2KHIA 1VF5C 5GAEC 1TY2A 4KLKA 5A2QE 3QOJA 3CQZH 1YI2A 4LJZC 5C3EB 3QR8A 2ZT9C 4OIJA 1EYCA 3A8JE 1ZKOA 4QF4A 2LMCB 4XQJA 3J7YW 4A3EH 1H9MA 4HCEA 4JI0Q 5COYA 1LO5D 4YY3Q 1M1KC 1CI3M 2KA7A 2EJGC 2K01A 3SDZA 1RCVD 1SNOA 4RHRA 5CV4A 4GKKL 1QCBD 4XT1B 3JAME 3PQIA 4POFA 1I4HA 3KLSX 3UE0A 4DR3Q 4H0LC 4KHPL 1YVCA 2R92G 4PZ8A 2NTSA 3U4VA 2HHHQ 4RFBA 3FKIG 3I7FA 2B2UA 3MFYA 4F87A 2A6HC 5FLXE 4GKJL 5J1ZA 1TS4A 5EGTA 1SRUA 1O80A 4LF7L 4A3GH 1FR3A 2PZWA 1VMCA 5JJIA 3NE5B 1I94L 1ESFA 2ZXRA 1CKMA 4UP9A 3CRLC 4LK1C 2ID0A 2K50A 4IUVA 1LLRD 2NBFA 4TVAB 1KDCA 3K7UC 3DM1A 2HIXA 3A5ZB 5GADC 1SBBB 2B2UC 4RGMA 3CCMA 2L5TA 1E1OA 2JYOA 1AE3A 1HNZL 2E2HH 1Q3LA 1HFGA 2B2VC 1TS2A 4PV1C 4AYBG 4KHZA 2QILA 1LM0A 3UDIA 4LAAA 4A3CG 3A0JA 1MI2A 4L5TA 3F2DA 3SGIA 3QG1A 1Z7TA 3L0OA 4B3SQ 4DK1A 3PIP3 4DAYB 3VYTA 1VQOA 1G6PA 1YJNA 2I5MX 3SHLA 4KKTA 3DWAA 1ESRA 1K73C 1H95A 2Y0SB 2GVAA 4LFCL 5JVH3 1XMQQ 1EYAA 2WAQE 1A6XA 5C44B 1DOLA 2EYFA 5NUCA 4BY1G 1DZ1A 4JBWA 5IP9H 4LF4L 2G9HD 3JAMc 4YCUA 2PQAA 4LFAQ 2VQFQ 4C3HH 4WJ4A 1JWUD 3D6WA 3QOLA 4KTAA 2PQEA 4JI6Q 4UY8C 1TWHB 3RN2A 3H94A 1PFSA 1N36Q 3CMEA 5JAVA 1A8VA 1CQVA 2K5NA 4QIWB 1FGUA 1VF7A 2QGQA 4Y52H 2LS01 2PW7A 1M4VA 4ZUJA 2F1MA 1TR5A 4RGOS 3M3YH 4A3JH 5JPMC 4QGUA 3M85A 3RLFA 1HJPA 1V1PA 1VQLA 3T16A 4JG2A 1O78A 3UE1A 1MKHA 3FPPA 2EE1A 2LKVA 3PSIA 1QUQA 2Y0SE 4RKLA 2FXQA 3D8GA 2F0GA 1TS5A 1KDBA 1GD7A 3HZXA 1O7IA 3TP8A 1EYGA 3T4AC 3RNUA 2CWAA 4C3HB 1XPOA 2VB2X 1D1KA 3OOCA 2PI2E 3NBHB 3NSWA 3SK5A 1LACA 5C0XG 2EYPA 4NXNL 3TBIB 2D9UA 2AWOA 4JYAQ 2F0QA 3KF8A 2K5DA 3CD6A 4HSPA 2B8FA 1NSNS 4BBRB 2A69C 3KBGA 1WYDA 2XRSD 3PF5A 1XTCD 2V1CC 5M5XH 3M4QA 1CKNB 4NW2A 1CTMA 3ONAB 3OHXC 2B2TA 3N52A 4K6LA 3WOFA 4KMUC 1C8CA 4A3JB 1X56A 3AEVA 2GVBA 1K8GA 2CH4W 3NP8A 3MHBA 3ZJYC 3NTIA 3I90A 1JORA 2OWOA 4JV5L 1AW7A 1PRTB 3HOWH 4HR7B 5IYBG 1LV9A 3RZDH 1W6KA 3Q6SA 2QKIC 4BXXG 1BUVT 3GD7A 3T1HL 2B2TC 3VR2A 1LYLA 2E76C 3G7LA 2F3VA 1I4PA 3BZKA 2XNAC 4A3FG 3NQIA 2NVTH 5KNCA 2JA7G 4A3BG 4L8JA 2PZUA 4BBSH 4DR7Q 4C1NI 2EYOA 5IYDH 4GLAC 3K5NA 4V0BA 4DAMA 1P8LA 2B2WA 4P73A 4IUNA 1HQMC 1PZID 3BZDB 3MC0B 4LF9Q 4A3IB 3CAMA 5G3LD 1A15A 3EVQA 4DV7L 1DOKA 4DR1Q 3MTSA 4GN5A 4K2LA 1KIXA 3ND8A 4K5XA 1SR3A 5BR8Q 3KBXA 5EJWA 1S5DD 3BYYB 5CV6A 4RGNA 4RHSA 1WTQA 2A6EC 5FLMG 5F2DA 1F9PA 3A54A 2K4KA 1K8OA 2B2WC 3VR5A 1GOZA 1TWFH 5CORA 1VQJA 3DHQA 1DYQA 4LNQA 5KYLA 1RDPD 2QDBA 2FINB 3R2TA 5G3LF 1Y14B 2QEJC 3CF5A 4U673 1BCPD 2NVTB 1JMCA 1L1OC 3F8TA 4B9WA 4BBSB 2UXDL 1RHPA 2F0VA 2K6AA 3S17H 3OWEB 2Z0SA 1QVFA 1MHWC 3J81j 4OX9L 2DNCA 2PPBC 2XSCA 3HKSA 1I50H 2UUCL 2MHVA 4WJ3M 5FOBB 3DM3A 2NN6I 4XT3B 4B3ML 3OYYA 2EY5A 4NPSA 3NEMA 2L4NA 3FMCA 3KJPA 2RHSB 5JVG3 4TKOB 5IIFA 5IGBA 2HQEA 2R92H 5C3EG 1WCMH 2NUCA 4Q0FA 2G5DA 4TQUS 2UXCQ 3E0EA 1VQPA 1BCPF 4XIGS 4JI5L 1V43A 1GHKA 1PZKD 2WFWA 2JJQA 1EY0A 4LF6Q 5KEEA 1PYWD 1Z47A 2BDNA 2FMCA 2ZXPA 1LTID 4IFDG 1JB3A 2YTYA 3D4WA 1J6QA 4NXMQ 4MIUA 3Q8DA 4ABNA 3S14B 3MXPA 4H7BA 5ELOA 3QJYA 4MN3A 3BDLA 1TWGB 1TWCH 1HNWL 2RBMA 2R6GA 3OMGA 5E4XA 5DEHA 2X69A 4B3RQ 4JI3Q 3O13A 1GM5A 4A3KH 3MVVA 4A3CH 2R93H 1QZGA 3K81C 2UU9Q 2IX3A 1PLFA 3A55A 1ENCA 2A19A 3KUPA 1STGA 1JWMD 5C3XA 4Y7NH 3TS0A 3K59A 1WCMB 5JJKA 3Q23A 1K8MA 4IZ8A 2KBNA 2JA5H 5GROA 1QWYA 4CDEC 5TSSA 1XNRL 3A5UA 4DV3L 2JA8B 2JP1A 1C7YA 1KL9A 5FO9B 1STYA 5CGKA 4BY1H 4A75A 5M5WH 3HFZB 1S5BD 3HOVB 1W3SA 4KHPQ 1EUJA 1CM9A 2IHFA 3T56B 4JPBW 2R7ZH 3W5OA 2R7DA 5IGCA 1BO0A 1EWIA 4K5WA 4YCVA 3D31A 5C4XB 1FNUA 4I7AA 4QB4A 1NNXA 4GN4B 5CYUA 3I55A 2LSSA 4A3KB 4LF8Q 2R93B 1WI5A 1YZ6A 2B2YA 1BF4A 1YNJD 1Q12A 1PA6A 2Y0SG 1V8QA 5IY0A 5C44G 1CHPD 2H4OA 2AQ1B 2RA4A 2QCPX 1PH4A 1U0LA 3I91A 3OMCA 4JC0A 4DNRB 2JA5B 4IPCA 3J80i 1SEBD 3Q0AA 3FVQA 1NY4A 3SK6A 3HGBA 2B2YC 4DUZL 3GTKB 3GTMH 1A3VA 2N8NA 3AFQA 4KY6A 2VUMH 3DWQA 1HH2P 3S1RH 1XMOL 5K36G 4GNXB 1SNPA 4ZQ3A 1N32L 1Y1VB 4O1NA 1HCZA 3WWVA 5C0XH 3L7ZC 4MTNA 1HZ9A 4IO9A 2IJ0A 2CCZA 2ICIA 5IODA 2R7FA 4DXGA 2NZOA 4JI4L 2WB1B 1YNXA 4FDBA 4DV4Q 3PIO3 1W6JA 3T13A 1NMGA 2K7VA 2MGSA 4LF4Q 2PI2A 5DM73 4L5QA 1ZXTA 1EOVA 4X66L 2NVXH 3J7A5 2B29A 2K04A 1HUNA 3CCEA 3UDXA 1R9TH 4C3HG 3PIOA 4JI2L 3WDNA 3HOUB 3BDCA 4H02A 4K8JA 2RKSA 2D62A 3JC66 2WV6D 3HRZC 5JJLA 5ISRA 3LX0A 1IW7D 2BA1A 1B8AA 4IPDA 3SR1A 4X64Q 5I6YA 1BBXC 4DAVA 2IHEA 1SE8A 2VUMB 4BBRG 4XQNA 1Q81C 3G48A 5CV8A 2CW0D 2OTJA 4IURA 5IWAQ 2K1BA 2JA7H 4A3BH 1LTBD 2VZAA 5ELFA 3T1YL 3HP3A 1EZ8A 1VQBA 3TREA 5I9OA 4A3JG 1PDQA 4FXKC 2L0CA 2VS1A 2WB1E 3AB9A 3KDFA 3VYUA 3S16H 1JT8A 3K6OA 1B1ZA 3AQQA 1GUWA 1NUCA 3OW2A 2EZVA 2O2LD 4DUYL 1DD2A 2AQ2B 4ZLTF 2E75C 2E5LL 3C2PA 1UE1A 2L1BA 3S2DB 1LTSD 4FXGC 5M9OA 2AWNA 1EY7A 3RZOB 3ULLA 4RKBA 1EQVA 5DAUA 3MEHA 5FLMH 3TZDA 4MTKA 1U9RA 3E6ZX 1FYCA 2QW7A 2AUKA 2F0OA 3K80C 2ZTDA 2O4XA 3A8KE 3R93A 2SDFA 1X54A 1SSOA 1U4LA 3I4LA 2BH2A 3M4PA 4B3TL 1H9KA 2SNSA 2OCEA 2WP8J 3LNNA 2RDHA 4DR5L 4LF5Q 3ERQA 4EGVA 4P72A 4B08A 1WTHA 3FDTA 3S16B 3LWUA 3NBIA 3SK4A 2VL6A 3X3NA 1L1OB 1H9SB 4JV5Q 1QNUA 3STBC 3S1QB 1R4PB 1Q90A 2OQ0A 2K5VA 4HJ8A 4JBKA 4OO1H 1B3QA 1X3FA 2JXMB 5C3EH 1IBML 1D5XC 1PH6A 4DF7A 4XTCS 1WD1A 1QVCA 2OQKA 1K3RA 4BBSG 1N33L 1H9RA 2Z6KC 2JN4A 4EVOA 1CA6A 3WOEA 4JW0A 4DV7Q 1E24A 4X65L 3M9BA 3EIVA 1ET6A 4B9XA 1V1OA 1JC7A 5JOBA 4JVZA 4YWLA 2XVSA 4DV1L 1SXTA 2I07B 2UXBQ 3GDEA 5LMUL 2RCFA 1B9MA 1IBLL 1UEAB 1Y8PB 2CQOA 1IBKQ 1BQQT 1RJTA 1TIID 1Y1WH 3K58A 1E1TA 4BA1I 4DKAC 2WACA 1F2YA 2UXDQ 1KABA 1M90C 1HR0L 4WFN3 2F3WA 2MO1A 1AE2A 3ND9A 4R4CA 1P16A 3UDGA 2F03A 4CKBA 2NWGA 1JB7A 1SYBA 4GLVB 3A74A 5JEAJ 1VDZA 3C46A 3GTLB 1F2MA 2JQOA 1KC8C 1V9PA 4OL7A 4ZRZA 1PH1A 3C3LA 4DR6L 1WCMG 3EFXD 1XTDA 5ELDA 1Q1EA 5I2YA 5J22A 1J9OA 1LTRD 2ZM6L 1N9WA 3OTOQ 4N9PA 3ULJA 5JPNC 4IJHA 2JA8G 4RGTA 1DGSA 5C44H 3BVZA 4DK3C 2F0TA 5BN5A 3H0GB 2A69D 1Y1WB 1OXXK 5H1SE 5M5YB 1EYDA 2IT1A 2I0QA 4HN7A 4F88A 3HOVG 1HNWQ 1JOQA 3MXNA 2UUBQ 3AFPA 3J7AV 1BCPB 1VCIA 2F0SA 4KY5A 1TWHH 2E74C 1MSHA 1ZEQX 3J81L 1I5FA 5C4XG 4WJWA 2NYZD 1RIPA 4DR4Q 4A3KG 5K36H 2R93G 4CDFC 2UUAL 5ELBA 5FKAC 1Y8NB 2PMZB 4X3SA 1BNZA 5EKLA 3VR3A 1PTOC 2HCIA 1KNEA 1GXDC 3TQYA 2E2DC 1KTKA 3RLOA 4DV0L 1OXUA 4QCLA 2JA5G 1MSGA 3T53B 2XRQD 2HCCA 1VQ5A 5LMNQ 5DNFA 1IYJB 4LFBL 1TVXA 4EX5A 1RF2D 4K8IA 2KOLA 1MBYA 1VQAA 2K33A 5DM63 3FP9A 1OXTA 1Y1VG 1WTOA 4PZ6A 3B6YA 2R7ZG 1RD9D 2F0FA 2D0PA 1L0WA 4P2CB 1S5ED 2A6ED 4J8QA 3RUZA 4RH6A 3SK8A 4EQPA 2WB1G 1AZQA 4QQBX 1GUOA 5FLXc 4BBRH 4HEDA 1JWSD 3VYRA 1K8AC 1MD2D 3J81E 4ME3A 1PV4A 1CK1A 1B50A 2I5HA 4ZKBB 1IZ6A 2ZJRA 4FXDA 2NVYB 4UP8A 4J15A 3K7AB 3K5OA 3GV6A 1EFWA 3TP6A 4X6AH 4HIDA 2HQLA 3RMHA 4DUZQ 5GQOA 3EQLC 3IRBA 1XNQQ 3HOUG 1A3UA 1DXMA 4ME5A 4ZAIA 2HT1A 2IY5B 4P75A 4G7OC 4IJLA 2OEOA 4A3LG 1Z9FA 2VUMG 4M8AA 2EY1A 3G4SA 1LUZA 3PO2H 1X9NA 1UNSA 1E2VA 2GA4B 2EIFA 1VQ8A 2ASBA 2A74C 3P75A 2I46A 3HOZH 2ES2A 3C1EA 3NXWA 1ASYA 1S5CD 2F0HA 1J5EQ 5D14A 3F2CA 2KCNA 4PQXA 4JI8L 4A3IH 4JBMA 4QIWE 2D5DA 2F0IA 1A2TA 5EPLA 2Z9HA 1U5KA 4Z9CB 3OPOA 1YNND 1NMFA 5E4WC 3S15B 2CFMA 2EY6A 3CCSA 4I7ZC 3UDFA 2F4VQ 1ICWA 3GTQH 4KD4A 1N34Q 4UP7A 2IX1A 4CDDC 1UEBA 4DR2L 1OO9B 1HNXL 4X62Q 2ATWA 3PO2B 1K83B 3H91A 2RDGA 1I3QB 3HOZB 1TQOA 2EXDA 1OXVA 2ZJPA 2OF1A 2ZTCA 2Z6BA 1JJGA 1B4OA 2Z8LA 1EY4A 2EXZA 2XIWA 2F4IA 2NZHA 2XGTA 4JI1L 3I56A 1TKWB 5EPKA 1MIUA 3H3VC 5C3WA 3G71A 4JI7L 3W3AA
chains in the Genus database with same CATH topology
1NJIC 2Y0SG 1KRSA 3CCRA 2C35B 1WOCA 5IY0A 5C44G 3CCJA 2JEAI 1PVOA 1Q7YC 1TXYA 4DV5Q 3I4MH 1VQCA 1C9OA 4HIMA 2JK8A 1PH4A 3CXCA 1U0LA 1Q8KA 2Z6KA 4JC0A 1YIJA 1OXSC 2OTLA 3HOYH 4GOPB 2VY3A 4IPCA 3J80i 4JI1Q 2Q2TA 2ALYB 2F52A 1NY4A 1PH9A 4L5RC 4AQYQ 3HOWG 3S1NH 1Q46A 3J7ZC 4JI7Q 1CSQA 4DUZL 4B3TQ 4YWMA 3S14H 3GTMH 1D7QA 4DV4L 1PHJA 4LW1A 2N49A 2B3GA 2N8NA 3AFQA 3E9IA 3I4OA 1TWGH 4DV2L 2VW9A 3KF6B 2VUMH 1IXRA 3PIPA 1HH2P 3S1RH 1XMOL 1XPRA 1UWVA 4OWXB 4GNXB 5K36G 1N32L 2A8VA 4MZ9A 4GOPA 5IYDG 1HR0W 1A63A 4KI0A 1YHQA 5AJ3L 2PMZE 2RF4A 3WWVA 4YHHL 3L7ZC 4MTNA 1HZ9A 4IO9A 2RCNA 4LUZA 3J80c 3PF4A 2CCZA 5IYCH 1VS0A 2R7FA 3S15H 3TEHB 2NZOA 4OO1G 2MO0A 4JI4L 4HJ7A 4DV6L 4NXML 1YNXA 5FJ8G 1X3EA 1UE7A 4FDBA 4DV4Q 4LUVA 3KF6A 3EBEA 1BVSA 4C2MH 4DV2Q 4GNXA 1NMGA 3PUXA 4LF4Q 4X64L 1XMOQ 2PI2A 4JI0L 4YCWA 1N32Q 4K0KL 1FL0A 4L5QA 1FJGL 1D8LA 1Q1BA 2CWPA 1EOVA 5AJ3Q 4X66L 2IX0A 4YHHQ 1SFOH 2NVXH 1T9HA 3J7A5 2JA8H 1WFQA 2B29A 2KHIA 5GAEC 3CCEA 2NVQH 4KLKA 3UDXA 5IWAL 1R9TH 1K83H 3CQZH 3PIOA 4JI2L 2MQHA 1YI2A 1N8RC 1I3QH 4DV6Q 4JI4Q 4A3DG 3BZCA 4H02A 3TRZA 2D62A 2YTVA 3JC66 3HOVH 2N3SA 2ZJQA 5JJLA 4OONA 1CSPA 1G51A 4GNXC 4DR3L 2BA1A 1B8AA 4IPDA 4A3EH 5IP7G 4X64Q 4JOIA 3KDFB 4JI0Q 2IHEA 1SE8A 4YY3Q 1M1KC 4K0KQ 2E8GA 1K9MC 3HKZE 4BBRG 2HHHL 1FJGQ 3KYHC 4X66Q 1Q81C 1KQSA 2CKZB 1YBYA 3G48A 4RMFA 1VQIA 5C4XH 3LGJA 2OTJA 1OTCA 3HOXG 5IWAQ 2JA7H 2GN5A 4A3BH 4GKKL 1QZHA 2VZAA 3T1YL 4JI2Q 4POFA 1KHIA 1K0RA 1YJWA 1VQBA 3TREA 4P71A 3UE0A 4A3JG 1CUKA 1JE5A 4IOCA 1VQGA 2EQSA 1V1QA 2VS1A 5LMNW 2WB1E 4DR3Q 3KDFA 3S16H 1PH5A 3H0GG 1JT8A 4JOIC 3AQQA 1YVCA 1Y1WG 2R92G 3U4ZA 4PZ8A 3OW2A 3VDYA 4KHPL 3U4VA 4DUYL 1HZAA 3PUZA 2HHHQ 3FKIG 2MNAA 1SLJA 3I7FA 1NE3A 3KJOA 2E2IH 2E5LL 1UE1A 3ULPA 3I4NH 4GKJL 1SRUA 2AWNA 4LF7L 4A3GH 3ULLA 5ELNA 1VQFA 4GKKQ 3T1YQ 1S40A 4OWWB 5JJIA 3GTKH 3J81c 5FLMH 1I94L 1A0IA 3ER0A 1CKMA 1C0AA 5M3MH 4LF5L 4UP9A 2ID0A 2K50A 3DLLA 5M3FG 4TVAB 3K7UC 1Y1VH 2YYZA 4DUYQ 2HIXA 3A5ZB 1WJJA 5GADC 2PNHA 2YTXA 3K80C 3RLNA 3CCMA 2ZTDA 1E1OA 3CPFA 3S24A 2E5LQ 4B3SL 1AE3A 1HNZL 5C0XJ 2E2HH 4GKJQ 1X54A 4LF7Q 4AQYL 4L5SA 3GTOH 4DPGA 1SN8A 1I94Q 4BY7G 2BH2A 3PUVA 1XMQL 3M4PA 4AYBG 4HIOA 2WP8J 4KHZA 1LM0A 2OCEA 3UDIA 4DR5L 4B3TL 4LF5Q 3PO3G 3A0JA 1EQQA 4A3CG 4A93G 4P72A 4IOAA 4L5TA 5E7NA 3JAMi 3H3VI 2VL6A 3F2DA 1L1OB 3SGIA 4JV5Q 1XJVA 4LFAL 3STBC 2VQFL 3L0OA 1KRTA 4B3SQ 3CCUA 2OQ0A 2K5VA 1SMXA 2PQAB 4HJ8A 4HJAA 4DAYB 1HNZQ 4JBKA 1VQOA 1G6PA 1YJNA 2I5MX 2B63H 1X3FA 3D0FA 4JI6L 3HOUH 5C3EH 1K73C 1IBML 3I2ZA 1PH6A 4XTCS 1JJ2A 1H95A 1QVCA 2GVAA 4LFCL 1XMQQ 3M7NA 2AKWB 1TWAH 2WAQE 3FHWA 4DR5Q 1N36L 2UUAQ 4BY1G 3GO5A 1X3GA 3MEFA 4JBWA 1L1OA 2OQKA 3STBD 5IP9H 4A3LH 1K3RA 4A76A 4LF4L 4C3JH 3JAMc 2HIVA 1N33L 4YCUA 2PQAA 4LFAQ 4BBSG 2Z6KC 2VQFQ 2UXBL 3RR5A 4C3HH 4WJ4A 2L15A 5GAGC 3CC2A 1YHAA 4GN3B 4DV7Q 1AH9A 4DNIA 1E24A 4JI6Q 4UY8C 1IBMQ 1IBKL 3RN2A 4X65L 3M9BA 1PFSA 3EIVA 3KLWA 4LFCQ 1X55A 3TS2A 4PMWA 3CMEA 4ALPA 1N36Q 1HZCA 1A8VA 3AYHB 2K5NA 2LXKA 1QUQB 1FGUA 4YWLA 1GO3E 2JEBI 1N33Q 4GOPC 1YITA 4DV1L 4YY3L 2UXBQ 2QGQA 4Y52H 3GDEA 3CPWA 5LMUL 1GVPA 3S2DH 4LWCA 3CC7A 3RZOH 5DLQE 3M3YH 4OXPA 4A3JH 1IBLL 2CQOA 4QGUA 3M85A 1IL2A 1IBKQ 1ASZA 4X65Q 3RLFA 1HJPA 4APVA 1Y1WH 1VQLA 4JG2A 1E1TA 3UE1A 1MKHA 4OWTB 4BA1I 4JYAL 1E3PA 3CCQA 1QUQA 3PSIA 1PYSB 3FKIH 4DKAC 1VQ6A 2Y0SE 2UXDQ 2FXQA 3KF8B 1Q86C 4PZ7A 1M90C 1PH3A 1HR0L 1GD7A 3CP0A 4DV1Q 2MO1A 1O7IA 4LUOA 5LMUQ 1AE2A 1EYGA 2H5XA 3ICEA 4R4CA 4A4IA 2CWAA 1P16A 3RNUA 3UDGA 1XPOA 1HZBA 3W1BA 2PI2E 1JB7A 1IBLQ 4GLVB 3NBHB 3A74A 5JEAJ 3OTOL 3GTJH 5C0XG 1S3OA 4NXNL 2JQOA 1KXLA 3PUYA 1KC8C 2AWOA 4JYAQ 1L2FA 3M4OH 3PUWA 1V9PA 3CD6A 4HJ9A 1GKHA 1HR0Q 1PH1A 3S1QH 4NB3A 1WYDA 4DR6L 1WCMG 3PF5A 1S72A 3S1MH 1XTDA 2V1CC 1Q1EA 5M5XH 2UUBL 3M4QA 1CKNB 3MXNB 4QY7A 5HY6A 4QL5A 2Q2HA 2ZM6L 1N9WA 1JJCB 3K8AA 3OTOQ 3PO3H 3ULJA 4IJHA 2JA8G 4IPHA 1X56A 2AMCB 2BH8A 2GVBA 1DGSA 2WAQG 3K0XA 5EAYA 5C44H 4A3MG 1K8GA 3PO2G 1SROA 4DK3C 1BBWA 2QEXA 4BA2I 4DR4L 3ZJYC 1OXXK 5H1SE 3PGZA 4DR7L 2LXJA 2IT1A 3BU2A 3PCOB 4QJFA 1Q82C 2I0QA 3HOZG 2OWOA 3HOVG 4DR6Q 1HNWQ 1BKBA 1CKNA 4JV5L 1VQHA 2UUBQ 2RHQB 3AFPA 1XPUA 3HOWH 5IYBG 1VCIA 3RZDH 4A3EG 4MNOA 4LF9L 2JA6G 4IFDJ 4BXXG 3GD7A 3T1HL 1TWHH 4A3IG 2ZM6Q 1MJEA 1LYLA 4DR1L 4DK6C 1I5FA 1E7ZA 5C4XG 3BZKA 5C0XI 4HJ5A 5BR8L 4A3FG 4IFDI 2MFIA 5LMNL 2NVTH 1RIPA 2JA7G 4A3BG 4A3KG 4DR4Q 4BBSH 4DR7Q 2R93G 2KCMA 5IYDH 2UUAL 4GLAC 4DAMA 2K5HA 1P8LA 4P73A 3TQYA 3F1ZA 4UPAA 4AIMA 3RLOA 4DV0L 4LF9Q 3CAMA 2VNUD 1EIFA 3T1HQ 1OXUA 2JA5G 5FJ8H 2ZTEA 4DV7L 3NENA 4DR1Q 4GN5A 1KIXA 3S2HH 4C3IH 1SR3A 2BA0A 5BR8Q 1VQ5A 2E2JH 3I4NG 5LMNQ 3GTPH 1IYJB 4A3GG 4LFBL 5GAHC 4EX5A 1X65A 5FLMG 2D0OA 2VQEQ 2K52A 4R1JA 5M3MG 2K4KA 1VQAA 3HKZG 4AH6A 1TWFH 2KENA 1VQJA 3FP9A 4DV0Q 4LNQA 1OXTA 4A3DH 1Y1VG 5C4JH 4PZ6A 2I5LX 3B6YA 2R7ZG 1KD1C 3GTLH 1L0WA 2D0PA 3ERSX 4YWKA 1Y14B 2A1AA 1CKOA 3KOJA 5HGQA 1UE5A 3CF5A 5IP7H 4LFBQ 5JEAG 3CCVA 3NELA 2K75A 1PYBA 2WB1G 3U50C 1XNQL 1JMCA 5FLXc 4QQBX 1L1OC 3F8TA 4BBRH 2UXDL 2UXCL 1NTGA 3S17H 1K8AC 2Z0SA 3CMAA 1QVFA 3J81j 4OX9L 1FVIA 4ME3A 2YV5A 3W1GA 1PV4A 4R4QA 3HOXH 1VQ9A 3KFUA 3HKSA 1I50H 2I5HA 4LF6L 1B70B 2UUCL 4WJ3M 1IZ6A 1VQNA 3I4MG 3DM3A 2NN6I 2JE6I 2ZJRA 1VQ4A 2AHOB 4B3ML 3OYYA 4POGA 4NPSA 4UP8A 1W2BA 3NEMA 3PV0A 4J15A 3HOYG 3KJPA 1EFWA 2RHSB 4R4OA 3H3VH 3H0GH 2B63G 4EQ5A 2HQLA 4DUZQ 4HIDA 4X6AH 2R92H 1YHBA 5GQOA 3IRBA 5M5YH 5C3EG 2KCTA 1WCMH 4AYBE 3F2BA 1XNQQ 3HOUG 4TQUS 2HT1A 2UXCQ 2IY5B 3E0EA 1VQPA 4P75A 4XIGS 4JI5L 1V43A 4OX9Q 2WFWA 4IJLA 2JJQA 1J5EL 1VQKA 1X6OA 5IP9G 3RN5A 4LF6Q 4A3LG 1Z9FA 2UUCQ 1KAWA 2DUDA 2VUMG 4A3MH 4B3RL 1Z47A 4JI3L 4B3MQ 3G4SA 1LUZA 3PO2H 1VQ7A 5IT9c 1X9NA 1YJ9A 4IFDG 2YTYA 2UU9L 4NXMQ 1J6QA 1PH7A 3G6EA 5M3FH 1VQ8A 2EIFA 5IYCG 2ASBA 3HOZH 4RG1A 2N78A 2ES2A 3Q8DA 4JCVE 2F4VL 5IYBH 5ELOA 1ASYA 1N34L 4JI5Q 1TWCH 2JA6H 4BXXH 1HNWL 1J5EQ 1E22A 4P74A 2R6GA 3F2CA 4JI8L 4A3IH 4JBMA 1RL2A 4JBJA 4QIWE 4BY7H 4A3FH 4JI3Q 4B3RQ 4X62L 1GM5A 2YU9H 3CW2C 2XTIA 1U5KA 4A3KH 3J81i 4A3CH 1QZGA 3K81C 2R93H 1MJCA 2UU9Q 3U58A 4A93H 1A62A 3CCLA 1NBWA 1NMFA 3GTGH 1G291 1YEZA 2A19A 4OO1I 2CFMA 4Y7NH 3TS0A 3CCSA 3UDFA 2QA4A 3L2PA 2F4VQ 3GTQH 5JJKA 1N34Q 1EQRA 4UP7A 1B7YB 5J3BA 2IX1A 2F3IA 2KBNA 2JA5H 5GROA 4JI8Q 1I6HH 1UEBA 1XNRL 4O2DA 4HIKA 3A5UA 4DV3L 4DR2L 1HNXL 4X62Q 3AEVA 4PG3A 1C7YA 3E9HA 1KL9A 4GLXA 2ATWA 3CC4A 4GS3A 4IPGA 4R4IA 1LTLA 2JA9A 1VQMA 4BY1H 2K14A 4LF8L 4R4TA 5IE8A 1UE6A 5M5WH 4A75A 1VQEA 3HFZB 3H15A 2EXDA 1W3SA 4O0AA 2VQEL 4KHPQ 1OXVA 1EUJA 2ZJPA 4DV5L 1PH8A 2ZTCA 1JJGA 2IHFA 2Q2IA 1QVGA 2R7ZH 3W5OA 2R7DA 1EWIA 3BJUA 1XNRQ 2NZHA 2NN6G 1VQDA 2XGTA 4YCVA 4JI1L 4DV3Q 2NVYH 3D31A 3I56A 4DR2Q 1HNXQ 3K7AH 4GN4B 3I55A 2KHJA 1MIUA 2Q2UA 4NXNQ 2LSSA 1BBUA 3G71A 1PH2A 1EIYB 4JI7L 4LF8Q 1WI5A 1YZ6A 3EN2A 2DGYA 1Q12A 1PA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI C;  2Y0S G;  1KRS A;  3CCR A;  2C35 B;  1WOC A;  5IY0 A;  5C44 G;  3CCJ A;  2JEA I;  1PVO A;  1Q7Y C;  1TXY A;  4DV5 Q;  3I4M H;  1VQC A;  1C9O A;  4HIM A;  2JK8 A;  1PH4 A;  3CXC A;  1U0L A;  1Q8K A;  2Z6K A;  4JC0 A;  1YIJ A;  1OXS C;  2OTL A;  3HOY H;  4GOP B;  2VY3 A;  4IPC A;  3J80 i;  4JI1 Q;  2Q2T A;  2ALY B;  2F52 A;  1NY4 A;  1PH9 A;  4L5R C;  4AQY Q;  3HOW G;  3S1N H;  1Q46 A;  3J7Z C;  4JI7 Q;  1CSQ A;  4DUZ L;  4B3T Q;  4YWM A;  3S14 H;  3GTM H;  1D7Q A;  4DV4 L;  1PHJ A;  4LW1 A;  2N49 A;  2B3G A;  2N8N A;  3AFQ A;  3E9I A;  3I4O A;  1TWG H;  4DV2 L;  2VW9 A;  3KF6 B;  2VUM H;  1IXR A;  3PIP A;  1HH2 P;  3S1R H;  1XMO L;  1XPR A;  1UWV A;  4OWX B;  4GNX B;  5K36 G;  1N32 L;  2A8V A;  4MZ9 A;  4GOP A;  5IYD G;  1HR0 W;  1A63 A;  4KI0 A;  1YHQ A;  5AJ3 L;  2PMZ E;  2RF4 A;  3WWV A;  4YHH L;  3L7Z C;  4MTN A;  1HZ9 A;  4IO9 A;  2RCN A;  4LUZ A;  3J80 c;  3PF4 A;  2CCZ A;  5IYC H;  1VS0 A;  2R7F A;  3S15 H;  3TEH B;  2NZO A;  4OO1 G;  2MO0 A;  4JI4 L;  4HJ7 A;  4DV6 L;  4NXM L;  1YNX A;  5FJ8 G;  1X3E A;  1UE7 A;  4FDB A;  4DV4 Q;  4LUV A;  3KF6 A;  3EBE A;  1BVS A;  4C2M H;  4DV2 Q;  4GNX A;  1NMG A;  3PUX A;  4LF4 Q;  4X64 L;  1XMO Q;  2PI2 A;  4JI0 L;  4YCW A;  1N32 Q;  4K0K L;  1FL0 A;  4L5Q A;  1FJG L;  1D8L A;  1Q1B A;  2CWP A;  1EOV A;  5AJ3 Q;  4X66 L;  2IX0 A;  4YHH Q;  1SFO H;  2NVX H;  1T9H A;  3J7A 5;  2JA8 H;  1WFQ A;  2B29 A;  2KHI A;  5GAE C;  3CCE A;  2NVQ H;  4KLK A;  3UDX A;  5IWA L;  1R9T H;  1K83 H;  3CQZ H;  3PIO A;  4JI2 L;  2MQH A;  1YI2 A;  1N8R C;  1I3Q H;  4DV6 Q;  4JI4 Q;  4A3D G;  3BZC A;  4H02 A;  3TRZ A;  2D62 A;  2YTV A;  3JC6 6;  3HOV H;  2N3S A;  2ZJQ A;  5JJL A;  4OON A;  1CSP A;  1G51 A;  4GNX C;  4DR3 L;  2BA1 A;  1B8A A;  4IPD A;  4A3E H;  5IP7 G;  4X64 Q;  4JOI A;  3KDF B;  4JI0 Q;  2IHE A;  1SE8 A;  4YY3 Q;  1M1K C;  4K0K Q;  2E8G A;  1K9M C;  3HKZ E;  4BBR G;  2HHH L;  1FJG Q;  3KYH C;  4X66 Q;  1Q81 C;  1KQS A;  2CKZ B;  1YBY A;  3G48 A;  4RMF A;  1VQI A;  5C4X H;  3LGJ A;  2OTJ A;  1OTC A;  3HOX G;  5IWA Q;  2JA7 H;  2GN5 A;  4A3B H;  4GKK L;  1QZH A;  2VZA A;  3T1Y L;  4JI2 Q;  4POF A;  1KHI A;  1K0R A;  1YJW A;  1VQB A;  3TRE A;  4P71 A;  3UE0 A;  4A3J G;  1CUK A;  1JE5 A;  4IOC A;  1VQG A;  2EQS A;  1V1Q A;  2VS1 A;  5LMN W;  2WB1 E;  4DR3 Q;  3KDF A;  3S16 H;  1PH5 A;  3H0G G;  1JT8 A;  4JOI C;  3AQQ A;  1YVC A;  1Y1W G;  2R92 G;  3U4Z A;  4PZ8 A;  3OW2 A;  3VDY A;  4KHP L;  3U4V A;  4DUY L;  1HZA A;  3PUZ A;  2HHH Q;  3FKI G;  2MNA A;  1SLJ A;  3I7F A;  1NE3 A;  3KJO A;  2E2I H;  2E5L L;  1UE1 A;  3ULP A;  3I4N H;  4GKJ L;  1SRU A;  2AWN A;  4LF7 L;  4A3G H;  3ULL A;  5ELN A;  1VQF A;  4GKK Q;  3T1Y Q;  1S40 A;  4OWW B;  5JJI A;  3GTK H;  3J81 c;  5FLM H;  1I94 L;  1A0I A;  3ER0 A;  1CKM A;  1C0A A;  5M3M H;  4LF5 L;  4UP9 A;  2ID0 A;  2K50 A;  3DLL A;  5M3F G;  4TVA B;  3K7U C;  1Y1V H;  2YYZ A;  4DUY Q;  2HIX A;  3A5Z B;  1WJJ A;  5GAD C;  2PNH A;  2YTX A;  3K80 C;  3RLN A;  3CCM A;  2ZTD A;  1E1O A;  3CPF A;  3S24 A;  2E5L Q;  4B3S L;  1AE3 A;  1HNZ L;  5C0X J;  2E2H H;  4GKJ Q;  1X54 A;  4LF7 Q;  4AQY L;  4L5S A;  3GTO H;  4DPG A;  1SN8 A;  1I94 Q;  4BY7 G;  2BH2 A;  3PUV A;  1XMQ L;  3M4P A;  4AYB G;  4HIO A;  2WP8 J;  4KHZ A;  1LM0 A;  2OCE A;  3UDI A;  4DR5 L;  4B3T L;  4LF5 Q;  3PO3 G;  3A0J A;  1EQQ A;  4A3C G;  4A93 G;  4P72 A;  4IOA A;  4L5T A;  5E7N A;  3JAM i;  3H3V I;  2VL6 A;  3F2D A;  1L1O B;  3SGI A;  4JV5 Q;  1XJV A;  4LFA L;  3STB C;  2VQF L;  3L0O A;  1KRT A;  4B3S Q;  3CCU A;  2OQ0 A;  2K5V A;  1SMX A;  2PQA B;  4HJ8 A;  4HJA A;  4DAY B;  1HNZ Q;  4JBK A;  1VQO A;  1G6P A;  1YJN A;  2I5M X;  2B63 H;  1X3F A;  3D0F A;  4JI6 L;  3HOU H;  5C3E H;  1K73 C;  1IBM L;  3I2Z A;  1PH6 A;  4XTC S;  1JJ2 A;  1H95 A;  1QVC A;  2GVA A;  4LFC L;  1XMQ Q;  3M7N A;  2AKW B;  1TWA H;  2WAQ E;  3FHW A;  4DR5 Q;  1N36 L;  2UUA Q;  4BY1 G;  3GO5 A;  1X3G A;  3MEF A;  4JBW A;  1L1O A;  2OQK A;  3STB D;  5IP9 H;  4A3L H;  1K3R A;  4A76 A;  4LF4 L;  4C3J H;  3JAM c;  2HIV A;  1N33 L;  4YCU A;  2PQA A;  4LFA Q;  4BBS G;  2Z6K C;  2VQF Q;  2UXB L;  3RR5 A;  4C3H H;  4WJ4 A;  2L15 A;  5GAG C;  3CC2 A;  1YHA A;  4GN3 B;  4DV7 Q;  1AH9 A;  4DNI A;  1E24 A;  4JI6 Q;  4UY8 C;  1IBM Q;  1IBK L;  3RN2 A;  4X65 L;  3M9B A;  1PFS A;  3EIV A;  3KLW A;  4LFC Q;  1X55 A;  3TS2 A;  4PMW A;  3CME A;  4ALP A;  1N36 Q;  1HZC A;  1A8V A;  3AYH B;  2K5N A;  2LXK A;  1QUQ B;  1FGU A;  4YWL A;  1GO3 E;  2JEB I;  1N33 Q;  4GOP C;  1YIT A;  4DV1 L;  4YY3 L;  2UXB Q;  2QGQ A;  4Y52 H;  3GDE A;  3CPW A;  5LMU L;  1GVP A;  3S2D H;  4LWC A;  3CC7 A;  3RZO H;  5DLQ E;  3M3Y H;  4OXP A;  4A3J H;  1IBL L;  2CQO A;  4QGU A;  3M85 A;  1IL2 A;  1IBK Q;  1ASZ A;  4X65 Q;  3RLF A;  1HJP A;  4APV A;  1Y1W H;  1VQL A;  4JG2 A;  1E1T A;  3UE1 A;  1MKH A;  4OWT B;  4BA1 I;  4JYA L;  1E3P A;  3CCQ A;  1QUQ A;  3PSI A;  1PYS B;  3FKI H;  4DKA C;  1VQ6 A;  2Y0S E;  2UXD Q;  2FXQ A;  3KF8 B;  1Q86 C;  4PZ7 A;  1M90 C;  1PH3 A;  1HR0 L;  1GD7 A;  3CP0 A;  4DV1 Q;  2MO1 A;  1O7I A;  4LUO A;  5LMU Q;  1AE2 A;  1EYG A;  2H5X A;  3ICE A;  4R4C A;  4A4I A;  2CWA A;  1P16 A;  3RNU A;  3UDG A;  1XPO A;  1HZB A;  3W1B A;  2PI2 E;  1JB7 A;  1IBL Q;  4GLV B;  3NBH B;  3A74 A;  5JEA J;  3OTO L;  3GTJ H;  5C0X G;  1S3O A;  4NXN L;  2JQO A;  1KXL A;  3PUY A;  1KC8 C;  2AWO A;  4JYA Q;  1L2F A;  3M4O H;  3PUW A;  1V9P A;  3CD6 A;  4HJ9 A;  1GKH A;  1HR0 Q;  1PH1 A;  3S1Q H;  4NB3 A;  1WYD A;  4DR6 L;  1WCM G;  3PF5 A;  1S72 A;  3S1M H;  1XTD A;  2V1C C;  1Q1E A;  5M5X H;  2UUB L;  3M4Q A;  1CKN B;  3MXN B;  4QY7 A;  5HY6 A;  4QL5 A;  2Q2H A;  2ZM6 L;  1N9W A;  1JJC B;  3K8A A;  3OTO Q;  3PO3 H;  3ULJ A;  4IJH A;  2JA8 G;  4IPH A;  1X56 A;  2AMC B;  2BH8 A;  2GVB A;  1DGS A;  2WAQ G;  3K0X A;  5EAY A;  5C44 H;  4A3M G;  1K8G A;  3PO2 G;  1SRO A;  4DK3 C;  1BBW A;  2QEX A;  4BA2 I;  4DR4 L;  3ZJY C;  1OXX K;  5H1S E;  3PGZ A;  4DR7 L;  2LXJ A;  2IT1 A;  3BU2 A;  3PCO B;  4QJF A;  1Q82 C;  2I0Q A;  3HOZ G;  2OWO A;  3HOV G;  4DR6 Q;  1HNW Q;  1BKB A;  1CKN A;  4JV5 L;  1VQH A;  2UUB Q;  2RHQ B;  3AFP A;  1XPU A;  3HOW H;  5IYB G;  1VCI A;  3RZD H;  4A3E G;  4MNO A;  4LF9 L;  2JA6 G;  4IFD J;  4BXX G;  3GD7 A;  3T1H L;  1TWH H;  4A3I G;  2ZM6 Q;  1MJE A;  1LYL A;  4DR1 L;  4DK6 C;  1I5F A;  1E7Z A;  5C4X G;  3BZK A;  5C0X I;  4HJ5 A;  5BR8 L;  4A3F G;  4IFD I;  2MFI A;  5LMN L;  2NVT H;  1RIP A;  2JA7 G;  4A3B G;  4A3K G;  4DR4 Q;  4BBS H;  4DR7 Q;  2R93 G;  2KCM A;  5IYD H;  2UUA L;  4GLA C;  4DAM A;  2K5H A;  1P8L A;  4P73 A;  3TQY A;  3F1Z A;  4UPA A;  4AIM A;  3RLO A;  4DV0 L;  4LF9 Q;  3CAM A;  2VNU D;  1EIF A;  3T1H Q;  1OXU A;  2JA5 G;  5FJ8 H;  2ZTE A;  4DV7 L;  3NEN A;  4DR1 Q;  4GN5 A;  1KIX A;  3S2H H;  4C3I H;  1SR3 A;  2BA0 A;  5BR8 Q;  1VQ5 A;  2E2J H;  3I4N G;  5LMN Q;  3GTP H;  1IYJ B;  4A3G G;  4LFB L;  5GAH C;  4EX5 A;  1X65 A;  5FLM G;  2D0O A;  2VQE Q;  2K52 A;  4R1J A;  5M3M G;  2K4K A;  1VQA A;  3HKZ G;  4AH6 A;  1TWF H;  2KEN A;  1VQJ A;  3FP9 A;  4DV0 Q;  4LNQ A;  1OXT A;  4A3D H;  1Y1V G;  5C4J H;  4PZ6 A;  2I5L X;  3B6Y A;  2R7Z G;  1KD1 C;  3GTL H;  1L0W A;  2D0P A;  3ERS X;  4YWK A;  1Y14 B;  2A1A A;  1CKO A;  3KOJ A;  5HGQ A;  1UE5 A;  3CF5 A;  5IP7 H;  4LFB Q;  5JEA G;  3CCV A;  3NEL A;  2K75 A;  1PYB A;  2WB1 G;  3U50 C;  1XNQ L;  1JMC A;  5FLX c;  4QQB X;  1L1O C;  3F8T A;  4BBR H;  2UXD L;  2UXC L;  1NTG A;  3S17 H;  1K8A C;  2Z0S A;  3CMA A;  1QVF A;  3J81 j;  4OX9 L;  1FVI A;  4ME3 A;  2YV5 A;  3W1G A;  1PV4 A;  4R4Q A;  3HOX H;  1VQ9 A;  3KFU A;  3HKS A;  1I50 H;  2I5H A;  4LF6 L;  1B70 B;  2UUC L;  4WJ3 M;  1IZ6 A;  1VQN A;  3I4M G;  3DM3 A;  2NN6 I;  2JE6 I;  2ZJR A;  1VQ4 A;  2AHO B;  4B3M L;  3OYY A;  4POG A;  4NPS A;  4UP8 A;  1W2B A;  3NEM A;  3PV0 A;  4J15 A;  3HOY G;  3KJP A;  1EFW A;  2RHS B;  4R4O A;  3H3V H;  3H0G H;  2B63 G;  4EQ5 A;  2HQL A;  4DUZ Q;  4HID A;  4X6A H;  2R92 H;  1YHB A;  5GQO A;  3IRB A;  5M5Y H;  5C3E G;  2KCT A;  1WCM H;  4AYB E;  3F2B A;  1XNQ Q;  3HOU G;  4TQU S;  2HT1 A;  2UXC Q;  2IY5 B;  3E0E A;  1VQP A;  4P75 A;  4XIG S;  4JI5 L;  1V43 A;  4OX9 Q;  2WFW A;  4IJL A;  2JJQ A;  1J5E L;  1VQK A;  1X6O A;  5IP9 G;  3RN5 A;  4LF6 Q;  4A3L G;  1Z9F A;  2UUC Q;  1KAW A;  2DUD A;  2VUM G;  4A3M H;  4B3R L;  1Z47 A;  4JI3 L;  4B3M Q;  3G4S A;  1LUZ A;  3PO2 H;  1VQ7 A;  5IT9 c;  1X9N A;  1YJ9 A;  4IFD G;  2YTY A;  2UU9 L;  4NXM Q;  1J6Q A;  1PH7 A;  3G6E A;  5M3F H;  1VQ8 A;  2EIF A;  5IYC G;  2ASB A;  3HOZ H;  4RG1 A;  2N78 A;  2ES2 A;  3Q8D A;  4JCV E;  2F4V L;  5IYB H;  5ELO A;  1ASY A;  1N34 L;  4JI5 Q;  1TWC H;  2JA6 H;  4BXX H;  1HNW L;  1J5E Q;  1E22 A;  4P74 A;  2R6G A;  3F2C A;  4JI8 L;  4A3I H;  4JBM A;  1RL2 A;  4JBJ A;  4QIW E;  4BY7 H;  4A3F H;  4JI3 Q;  4B3R Q;  4X62 L;  1GM5 A;  2YU9 H;  3CW2 C;  2XTI A;  1U5K A;  4A3K H;  3J81 i;  4A3C H;  1QZG A;  3K81 C;  2R93 H;  1MJC A;  2UU9 Q;  3U58 A;  4A93 H;  1A62 A;  3CCL A;  1NBW A;  1NMF A;  3GTG H;  1G29 1;  1YEZ A;  2A19 A;  4OO1 I;  2CFM A;  4Y7N H;  3TS0 A;  3CCS A;  3UDF A;  2QA4 A;  3L2P A;  2F4V Q;  3GTQ H;  5JJK A;  1N34 Q;  1EQR A;  4UP7 A;  1B7Y B;  5J3B A;  2IX1 A;  2F3I A;  2KBN A;  2JA5 H;  5GRO A;  4JI8 Q;  1I6H H;  1UEB A;  1XNR L;  4O2D A;  4HIK A;  3A5U A;  4DV3 L;  4DR2 L;  1HNX L;  4X62 Q;  3AEV A;  4PG3 A;  1C7Y A;  3E9H A;  1KL9 A;  4GLX A;  2ATW A;  3CC4 A;  4GS3 A;  4IPG A;  4R4I A;  1LTL A;  2JA9 A;  1VQM A;  4BY1 H;  2K14 A;  4LF8 L;  4R4T A;  5IE8 A;  1UE6 A;  5M5W H;  4A75 A;  1VQE A;  3HFZ B;  3H15 A;  2EXD A;  1W3S A;  4O0A A;  2VQE L;  4KHP Q;  1OXV A;  1EUJ A;  2ZJP A;  4DV5 L;  1PH8 A;  2ZTC A;  1JJG A;  2IHF A;  2Q2I A;  1QVG A;  2R7Z H;  3W5O A;  2R7D A;  1EWI A;  3BJU A;  1XNR Q;  2NZH A;  2NN6 G;  1VQD A;  2XGT A;  4YCV A;  4JI1 L;  4DV3 Q;  2NVY H;  3D31 A;  3I56 A;  4DR2 Q;  1HNX Q;  3K7A H;  4GN4 B;  3I55 A;  2KHJ A;  1MIU A;  2Q2U A;  4NXN Q;  2LSS A;  1BBU A;  3G71 A;  1PH2 A;  1EIY B;  4JI7 L;  4LF8 Q;  1WI5 A;  1YZ6 A;  3EN2 A;  2DGY A;  1Q12 A;  1PA6 A; 
#chains in the Genus database with same CATH topology
 1KRS A;  1WOC A;  4DN4 M;  4DV5 Q;  1WTR A;  3A8I E;  3D4D A;  1VQC A;  3I4M H;  3GTQ B;  3CXC A;  1YIJ A;  1EY9 A;  2VY3 A;  2E2I B;  2O5J C;  2ALY B;  2F52 A;  1IL8 A;  3MXU A;  4HAE A;  1PH9 A;  3I4N B;  2NB0 A;  2FHT A;  2BDO A;  1Y69 U;  3J7Z C;  3R8B A;  1ENF A;  1WD0 A;  1I6V C;  4B3T Q;  4YWM A;  3S14 H;  1EY8 A;  3KLR A;  3TP5 A;  3E9I A;  5M3M B;  3I4O A;  2IL8 A;  1TWG H;  4DV2 L;  2VW9 A;  1SE3 A;  4IUU A;  5KYI A;  1XPR A;  1UWV A;  4JK1 C;  3A7L A;  4L63 B;  1PMR A;  4GOP A;  2A8V A;  1A63 A;  3R3O A;  4KI0 A;  3SEB A;  5AJ3 L;  1YHQ A;  4YHH L;  1SND A;  1STN A;  2AUJ D;  5LL6 X;  4R8I A;  5IYC H;  1EOT A;  3TEH B;  4OO1 G;  3D6C A;  1CQF A;  5FJ8 G;  1X3E A;  4X3U A;  3KF6 A;  4CKE A;  3R2I A;  4S3S A;  4C1N K;  3GQB A;  4JI0 L;  2A5H A;  3I4M B;  4ODG A;  2CWP A;  3NQT A;  4CJ2 C;  2JA8 H;  1BR9 A;  1O7Y A;  1SYE A;  2NVQ H;  3A7A B;  1EU4 A;  2B63 B;  2CHB D;  3L3O C;  2MQH A;  3BVM A;  1N8R C;  4DV6 Q;  3TRZ A;  2YTV A;  3HOV H;  2N3S A;  2MUY A;  1HTL D;  1G51 A;  4DR3 L;  1B53 A;  4C56 C;  2VB3 X;  1G2T A;  4K0K Q;  2E8G A;  1K9M C;  2HHH L;  1FJG Q;  4C3J B;  3KYH C;  1KQS A;  4KV6 A;  1SYC A;  2CKZ B;  4RMF A;  4CHT B;  5C4X H;  1C48 A;  1CZG A;  1VQI A;  3LGJ A;  5KRU A;  3FEW X;  1OTC A;  2WKD A;  1CFM A;  2GN5 A;  5AFW A;  1QE6 A;  1YJW A;  4KK7 A;  4KJN A;  4PMC A;  2A68 C;  4IOC A;  1VQG A;  2EQS A;  5LMN W;  2XWJ B;  5E1F A;  1F2L A;  3H0G G;  3UI2 A;  1Y1W G;  3ZYY X;  3U4Z A;  2NN6 H;  1HZA A;  3PUZ A;  3U9O A;  3KJO A;  1NE3 A;  1ML0 D;  2IWH A;  3CU7 A;  2F0U A;  2RVL A;  1G91 A;  4GKK Q;  3P1H A;  4K5V A;  2NVQ B;  1S40 A;  3GTK H;  3V05 A;  3TZU A;  1C0A A;  3DLL A;  2RQX A;  3HG9 A;  5CV5 A;  1Y1V H;  2YYZ A;  3F2U A;  3GP7 A;  5KIX A;  1GUG A;  3TSS A;  2PNH A;  2YTX A;  3RLN A;  4B3S L;  3S24 A;  4GKJ Q;  1B3A A;  4LF7 Q;  2L12 A;  4BWG B;  2SOB A;  1I94 Q;  3GTJ B;  3M4Y A;  4F8M A;  1XMQ L;  4HIO A;  2EPB A;  1EQQ A;  1JIC A;  3K5L A;  1HXY D;  3JAM i;  3H3V I;  1KNA A;  2F0W A;  4V19 0;  4LFA L;  3Q22 A;  4N8F A;  2VQF L;  3CHB D;  4G4K A;  1KRT A;  3S1M B;  2PQA B;  1SMX A;  4HJA A;  1HNZ Q;  2F0P A;  2BE5 C;  2K32 A;  4OEM B;  4JI6 L;  2N55 A;  1STH A;  3HOU H;  3I2Z A;  3SE0 A;  1SJH D;  1N36 L;  1CHQ D;  1LTA D;  2UUA Q;  1KLG D;  3MEF A;  3STB D;  4A3L H;  1SMY D;  2L9H A;  1G2S A;  4DAY A;  3RR5 A;  2AQ3 B;  2KED A;  2EVB A;  2L15 A;  5GAG C;  1YHA A;  4DNI A;  2QF7 A;  4UHV A;  4LFC Q;  1F9Q A;  4QUC A;  1RTO A;  2KEC A;  5I6W A;  3TS2 A;  1HA5 A;  4ALP A;  1HZC A;  1V1P B;  2ZXO A;  1AFP A;  1QUQ B;  3DUZ A;  2JEB I;  1YIT A;  3CPW A;  4KHV A;  3S2D H;  4LWC A;  5BN4 A;  3CC7 A;  3RZO H;  5DLQ E;  2B8G A;  4RA8 A;  4OXP A;  4KD3 A;  1ASZ A;  4ZUI A;  2PNR C;  3QIA A;  4APV A;  1HQR D;  3TDQ A;  4C3I B;  2E2J B;  4JYA L;  1ILQ A;  5D3I B;  3DXJ C;  3KF8 B;  1Q86 C;  1PH3 A;  3CP0 A;  5BN3 A;  2P5Z X;  2H5X A;  3ICE A;  1HZB A;  3W1B A;  1TT2 A;  4A3D B;  5C4J B;  2F0D A;  1S4Z A;  1EIH A;  1KXL A;  2EDG A;  1L2F A;  1IHZ A;  4KKU A;  3M4O H;  1LT4 D;  2FJ2 A;  1J8I A;  3TP7 A;  3S1Q H;  3P7J A;  1S72 A;  1WVL A;  3FRP B;  4E6I A;  3HOX B;  1UAP A;  3DEP A;  4QY7 A;  4IN3 A;  3NBH A;  5EKK A;  5HY6 A;  2Q2H A;  1JJC B;  3PO3 H;  4X3T A;  4NXN Q;  2PZT A;  3K5M A;  3PO2 G;  1II3 A;  1BBW A;  2QEX A;  4BA2 I;  3KLS A;  1A3T A;  1ICF B;  4DR7 L;  4CKC A;  2LXJ A;  2HDM A;  1STA A;  3HOZ G;  1BKB A;  2A6H D;  1CKN A;  1F77 A;  2DY7 A;  4MNO A;  4LF9 L;  4A3I G;  1MJE A;  4DR1 L;  4DK6 C;  1E7Z A;  3MA2 B;  3FPU B;  4HJ5 A;  4IFD I;  5BR8 L;  2M2L A;  5M3F B;  4KKS A;  3M4O B;  2KQ3 A;  2HD3 A;  4KY7 A;  4J6H A;  3F1Z A;  4AIM A;  2VNU D;  1EIF A;  3T1H Q;  3NTK A;  5FJ8 H;  2ZTE A;  4BY7 B;  2YU9 B;  5EKI A;  2PYK A;  3S2H H;  3I4N G;  2BA0 A;  3PO3 B;  1K0S A;  3GTP H;  4A93 B;  2K5Q A;  5GAH C;  3GTG B;  1Z6H A;  1PTO D;  2D0O A;  5A2Q L;  1PRT C;  2K52 A;  4R1J A;  5M3M G;  4AH6 A;  3K57 A;  4DAP A;  1XYI A;  1KD1 C;  4IAL A;  3GTL H;  1IYV A;  1QJO A;  4YWK A;  3AU7 A;  4L6T B;  3KOJ A;  5HGQ A;  4ZYS A;  2CH4 A;  5JEA G;  3NEL A;  3VA7 A;  1PYB A;  2UXC L;  1NTG A;  2NZ1 D;  1JOK A;  1PTO F;  3CMA A;  1B9N A;  5C5M A;  1SAP A;  2YV5 A;  3W1G A;  1VQ9 A;  4R4Q A;  2L55 A;  3KFU A;  4BS9 A;  4LF6 L;  1B70 B;  4J1M A;  3I4M G;  2F0K A;  3OW7 A;  1VQN A;  3IFD A;  3J80 L;  4PNY A;  2K03 A;  2AHO B;  4POG A;  3PV0 A;  1H9J A;  3H0G H;  2B63 G;  1EWC A;  3S2H B;  4DK0 A;  5M5Y H;  1SYF A;  3GTP B;  3F2B A;  2IPK D;  1ZYR C;  4OX9 Q;  3SVM A;  1X6O A;  2N88 A;  4DA2 A;  2DY8 A;  3MAQ A;  1HTP A;  2UUC Q;  1RTN A;  4A3M H;  4C3J G;  1G6Z A;  4B3R L;  4JI3 L;  4B3M Q;  3G6J B;  2PW5 A;  1LAB A;  5ELE A;  1WTV A;  1YJ9 A;  2CW0 C;  2UU9 L;  1SYD A;  1PH7 A;  3S1N B;  2SNM A;  5IYC G;  4RG1 A;  4JCV E;  3MFG A;  1U4P A;  5CBE E;  4JI5 Q;  2CQA A;  2JA6 H;  2K05 A;  4ZCK A;  1LTG D;  3I73 A;  3MWY W;  1PFN A;  3CW2 C;  2EJF C;  1MJC A;  5T1G A;  1A62 A;  3CCL A;  1YEZ A;  2RSO A;  3EA6 A;  4EQO A;  1EU3 A;  3J80 E;  4ZKC B;  1EQR A;  1QB5 D;  5J3B A;  4C2M B;  2F3I A;  1NAP A;  3V96 A;  1SE4 A;  1I6H H;  1FNV A;  4FO2 A;  4A3M B;  2WAQ B;  3E5S A;  3VYS A;  4IPG A;  2B2V A;  4R4I A;  1LTL A;  1VQM A;  3CQZ B;  4LF8 L;  1ONL A;  5IE8 A;  1UE6 A;  2BCO A;  3OIQ A;  2VQE L;  2DNE A;  4A3E B;  1QVG A;  4WRD A;  2JA6 B;  1K28 A;  1QNK A;  1XNR Q;  2NN6 G;  3S9W A;  3I70 A;  4DV3 Q;  2NVY H;  1O7L A;  3K7A H;  2O5I C;  2KHJ A;  1G8Z D;  2Q2U A;  1BXT A;  1F9R A;  1EIY B;  1IKL A;  3EN2 A;  2DGY A;  4RCO A;  5CMD A;  1PVO A;  1TXY A;  1C9O A;  3IKJ A;  5CR3 A;  1WTP A;  3HOY H;  1I6H B;  1EFI D;  3CRK C;  4L5R C;  2X6G A;  2EYH A;  4DU9 A;  4A3G B;  3H09 A;  4ILW A;  3IL8 A;  2F0L A;  2MP1 A;  4DV4 L;  4LW1 A;  2B3G A;  3HKZ B;  4H44 C;  4YIJ A;  3PIP A;  2BOS A;  3QWN A;  1X32 A;  2PMZ E;  4ZK9 B;  1KAA A;  4RAU C;  2RCN A;  4LUZ A;  3J80 c;  1HUM A;  2E2H B;  1EZ6 A;  1VS0 A;  2EYJ A;  5K5P A;  2MJ8 A;  2WIN B;  3S15 H;  2C9O A;  3IAY A;  2MO0 A;  3VA5 A;  4HJ7 A;  1UE7 A;  3KK7 A;  1UUP A;  1D1I A;  2C5C A;  1L0Y B;  4C3I G;  1BVS A;  3VR4 A;  1SNC A;  4GNX A;  4X64 L;  1XMO Q;  1DON A;  1N32 Q;  1FL0 A;  1Q1B A;  2IX0 A;  1SFO H;  3HOY B;  5IWA L;  1K83 H;  2IW3 A;  5IGG A;  4DXF A;  4A3D G;  4JI4 Q;  1I3Q H;  3BZC A;  1D5M C;  5HUR A;  4RCN A;  3DEO A;  2Z1C A;  2ZJQ A;  3NUC A;  4ID6 A;  4OON A;  1CSP A;  5L37 A;  4CJ0 B;  4GNX C;  3QB3 A;  4G57 A;  3H6M A;  1XXG A;  5IP7 G;  5CV9 A;  4JOI A;  1BOS A;  3KDF B;  1QIL A;  3HKZ E;  4X66 Q;  3I3C A;  1YBY A;  1AEX A;  1HFN A;  5I4D A;  1KLU D;  3NWS A;  5E3F A;  3HOX G;  1PFM A;  3C1F A;  1QZH A;  4JI2 Q;  2KEE A;  1EEF D;  1KHI A;  1K0R A;  4P71 A;  1CUK A;  1JE5 A;  1IYU A;  1V1Q A;  1TU2 B;  1GUS A;  4TSS A;  5EBD A;  1PH5 A;  4JOI C;  4KJO A;  4FF1 A;  1SNQ A;  3VDY A;  2Q8R E;  4XYO A;  3PMF A;  2MNA A;  1SLJ A;  2E2I H;  3ULP A;  3I4N H;  1SFO B;  3V2T A;  5ELN A;  1VQF A;  5LHY 1;  2EY2 A;  3T1Y Q;  4OWW B;  3M3Y B;  2KJX A;  2A68 D;  4OIK A;  3J81 c;  1A0I A;  3ER0 A;  5M3M H;  4OHJ A;  4LF5 L;  1D5Z C;  4FNF A;  1FD7 D;  5M3F G;  5CC4 A;  1KDA A;  3IFT A;  4DUY Q;  2EYL A;  1WJJ A;  1PZJ D;  2E5L Q;  3CPF A;  5C0X J;  1QG7 A;  1LT5 D;  4ULL A;  1PFB A;  3NHH A;  4OGQ C;  2MPM A;  5JEA H;  4AQY L;  4L5S A;  3GTO H;  4DPG A;  1SN8 A;  1IKM A;  3SXH A;  2DJF C;  4BY7 G;  2XN9 C;  3PUV A;  4XYQ A;  4F7X A;  4N8X 1;  3DMU A;  3PO3 G;  4A93 G;  4H13 C;  4IOA A;  5E7N A;  2F0E A;  1XJV A;  5IGE A;  3CCU A;  4FF4 A;  1DM0 B;  5M5X B;  1SJE D;  2KCC A;  2B63 H;  3D0F A;  4MHE A;  1JJ2 A;  3M7N A;  1FGB D;  2AKW B;  1TWA H;  3FHW A;  4DR5 Q;  3CKI B;  2CVR A;  3L9A X;  3OWF A;  3GO5 A;  1X3G A;  5EBC A;  1L1O A;  1H9S A;  2LY7 A;  1HHV A;  4A76 A;  4C3J H;  2HIV A;  4UAI A;  1EY5 A;  1GHJ A;  2UXB L;  2BE5 D;  3HOW B;  3RZD B;  4IQZ A;  3CC2 A;  4GN3 B;  1AH9 A;  1X3Q A;  2H1E A;  1IBM Q;  1B44 D;  1IBK L;  3GTO B;  3J7A F;  3KLW A;  1X55 A;  5C5L A;  1TS3 A;  4PMW A;  3AYH B;  2LXK A;  1GO3 E;  5CV7 A;  1N33 Q;  2J0T D;  4GOP C;  3MXG A;  1VMP A;  4YY3 L;  1PTO H;  1ET9 A;  1AZP A;  1GVP A;  2X6L A;  4HTH A;  3TN2 A;  1DOM A;  4G7Z C;  1IL2 A;  4X65 Q;  1E2Z A;  2A73 B;  1AP0 A;  3ITP A;  4OWT B;  1E3P A;  3CCQ A;  1TWA B;  4FYD A;  1PYS B;  3FKI H;  5EQ0 A;  5IGF A;  1VQ6 A;  1B2T A;  4PZ7 A;  2JSO A;  4DV1 Q;  4RWS C;  4LUO A;  2HUG A;  1EWH A;  5LMU Q;  5FK9 C;  1TWF B;  1K3B C;  4A4I A;  4K2K A;  4UDU C;  5IT9 L;  2ICE C;  2SEB D;  2J4X A;  4QUF A;  1IBL Q;  1GUT A;  3OTO L;  3GTJ H;  3LWE A;  4IUQ A;  4R8N A;  2WII B;  1S3O A;  1TY0 A;  3PUY A;  4WOR A;  2F0J A;  3PUW A;  5D3D A;  4HSV A;  1HPC A;  1YNN C;  3W2D A;  4CBV A;  4R9W A;  5CBA E;  1GKH A;  4HJ9 A;  1HR0 Q;  1Q8I A;  2RSN A;  4GZY C;  1O7Z A;  4NB3 A;  4X3K A;  3S1M H;  3S17 B;  1DJR D;  2UUB L;  4TRD A;  1ENA A;  3TME A;  3MXN B;  1PTO B;  1MGS A;  1I50 B;  1LT6 D;  4QL5 A;  3K8A A;  2PO4 A;  4XXE A;  3E0J A;  4IPH A;  2AMC B;  1Y8O B;  2BH8 A;  2WAQ G;  2RDF A;  3K0X A;  4HCS A;  4NDX A;  5EAY A;  4A3M G;  1SRO A;  1XX8 A;  4NMZ A;  4DR4 L;  1EIG A;  2R92 B;  3PGZ A;  3BG3 A;  1U4M A;  4IUP A;  3BU2 A;  3PCO B;  4QJF A;  3URY A;  2FMM A;  2LFN A;  1Q82 C;  3FKI B;  4DR6 Q;  1L0X B;  1VQH A;  2RHQ B;  1XPU A;  1HRJ A;  4A3E G;  2JA6 G;  4IFD J;  1SE2 A;  2HDL A;  2ZM6 Q;  3EJI A;  1CT1 D;  5C0X I;  1FNW A;  4G7H C;  3NK9 A;  1PXU A;  2MFI A;  5LMN L;  3M7G A;  5C6A A;  2KCM A;  2ENB A;  1BDO A;  2K5H A;  3D4R A;  5IT9 E;  5A35 A;  4KN4 C;  4FF2 A;  1TWC B;  1D2B A;  4K14 A;  3X3M A;  4UPA A;  2DN8 A;  5KGU A;  1JOO A;  4HMI A;  3ERO A;  1JQY D;  4U68 A;  3NEN A;  4DGZ A;  4I65 A;  4AYB B;  4C3I H;  2E2J H;  4A3G G;  1EQT A;  5KND A;  2B39 A;  1X65 A;  1EL0 A;  3BVG A;  1EY6 A;  4Y7N B;  2VQE Q;  4K6D A;  1BCP C;  2KVM A;  1JE4 A;  3HKZ G;  2R3Z A;  1CZW A;  4NKL A;  2EOT A;  2KEN A;  4O42 A;  2R61 A;  3BYT B;  4DV0 Q;  1ROD A;  4EQN A;  4A3D H;  2DJG C;  5C4J H;  2I5L X;  1EEI D;  3ERS X;  1C4Q A;  5KNB A;  1SYG A;  2A1A A;  1CKO A;  1WTW A;  1UE5 A;  4BY1 B;  5IP7 H;  1PRT D;  3CCV A;  4LFB Q;  2K75 A;  3U50 C;  1WTX A;  1XNQ L;  5M5W B;  2KHS A;  4PMB A;  2Q8T A;  5J39 A;  2Q8I B;  1FVI A;  4NP5 A;  3HOX H;  3N6R A;  2R7Z B;  4XQQ A;  2JE6 I;  1VQ4 A;  1NR4 A;  1STB A;  1W2B A;  3HOY G;  4R4O A;  3H3V H;  4EQ5 A;  3Q24 A;  1S5F D;  1YHB A;  4N9T A;  1E0B A;  2KCT A;  4AYB E;  4HMJ A;  5EPJ A;  1PRT F;  3HS0 C;  2TSS A;  3AMU A;  3P20 A;  1J5E L;  1VQK A;  5IP9 G;  3RN5 A;  4FP5 D;  1I4G A;  1KAW A;  1RKN A;  2DUD A;  1I4R A;  1R4Q B;  4DFA A;  2M9V A;  2VXW A;  3RD4 A;  4DNT B;  1VQ7 A;  5IT9 c;  1T5E A;  3I72 A;  3MZ5 A;  3G6E A;  5M3F H;  2N78 A;  1ZYR D;  3K0Y A;  2FFK B;  3GTM B;  5FO8 B;  2F4V L;  5IYB H;  2XWB B;  1NCV A;  1N34 L;  2K28 A;  5C4H A;  4BXX H;  1E22 A;  4P74 A;  5ELC A;  3S1R B;  1NR2 A;  1RL2 A;  4JBJ A;  2PCF B;  4IUT A;  1M8A A;  4A3F H;  4BY7 H;  2OXP A;  4X62 L;  2YU9 H;  2F0N A;  2XTI A;  3J81 i;  3U58 A;  4A93 H;  1NBW A;  4OO1 I;  3GTG H;  1G29 1;  2Z4I A;  3BDO A;  5I2X A;  1F9S A;  3L2P A;  2QA4 A;  2G9D A;  1B7Y B;  1LT3 D;  4JI8 Q;  5FO7 B;  3VR6 A;  1GJX A;  4O2D A;  4HIK A;  2NVX B;  4FVM A;  5I9P A;  4PG3 A;  3E9H A;  2KUM A;  4GLX A;  1D6E C;  3CC4 A;  1R9T B;  5T1I A;  4GS3 A;  2JA9 A;  2K14 A;  1U4R A;  4R4T A;  1JR0 D;  1VQE A;  2OT2 A;  2NTT A;  3H15 A;  4O0A A;  1YNJ C;  3NWT A;  1PH8 A;  4DV5 L;  3E3X A;  4XDX A;  1JCK B;  2Q2I A;  2V4D A;  1LTT D;  4M1U B;  1STE A;  1SDF A;  3BJU A;  1VQD A;  4DR2 Q;  1HNX Q;  4A3F B;  3OSO A;  2JA7 B;  4A3B B;  1BBU A;  1PH2 A;  5C4Z A;  5IGD A;  5IOC A;  3I8Z A;  1SNM A;  1NJI C;  1DCZ A;  3CCR A;  2C35 B;  2WKC A;  4CDC C;  3BS1 A;  3CCJ A;  2JEA I;  1Q7Y C;  1A2U A;  5LL6 S;  2F0M A;  4HIM A;  2JK8 A;  3NTH A;  4CJ1 B;  3DWP A;  1SMY C;  1Q8K A;  4QMG A;  2Z6K A;  2OTL A;  1OXS C;  4GOP B;  2TMP A;  4JI1 Q;  2Q2T A;  4OEL B;  1GUN A;  4AQY Q;  3HOW G;  1CA5 A;  3S1N H;  4FF3 A;  1Q46 A;  4JI7 Q;  1CSQ A;  5D65 A;  2L11 A;  1XWE A;  2M00 A;  4CGY B;  1D7Q A;  1PHJ A;  2N49 A;  2Z4H A;  5JJZ A;  1X3P A;  3KF6 B;  1IXR A;  3JAM L;  1T5X D;  2QDL A;  2EYM A;  2K5W A;  3OIP A;  4OWX B;  4MZ9 A;  5IYD G;  1HR0 W;  3A56 A;  3U9S A;  2RF4 A;  5HGT A;  3T51 B;  4IFD H;  3HEJ A;  1AN8 A;  3D3R A;  3PF4 A;  2EJM A;  4DV6 L;  4NXM L;  2D2C C;  1HA6 A;  5FLX L;  4LUV A;  2J7Z A;  1ILP A;  3EBE A;  3QO2 A;  4DV2 Q;  4C2M H;  1E2W A;  1I4Q A;  3PUX A;  4YCW A;  1QOH A;  1IW7 C;  4K0K L;  1F2Z A;  1I4X A;  1D8L A;  1FJG L;  5AJ3 Q;  4Q5V A;  4YHH Q;  3GV3 A;  4KN7 C;  1T9H A;  1WFQ A;  3NPP A;  4LMQ D;  2KHI A;  1VF5 C;  5GAE C;  1TY2 A;  4KLK A;  5A2Q E;  3QOJ A;  3CQZ H;  1YI2 A;  4LJZ C;  5C3E B;  3QR8 A;  2ZT9 C;  4OIJ A;  1EYC A;  3A8J E;  1ZKO A;  4QF4 A;  2LMC B;  4XQJ A;  3J7Y W;  4A3E H;  1H9M A;  4HCE A;  4JI0 Q;  5COY A;  1LO5 D;  4YY3 Q;  1M1K C;  1CI3 M;  2KA7 A;  2EJG C;  2K01 A;  3SDZ A;  1RCV D;  1SNO A;  4RHR A;  5CV4 A;  4GKK L;  1QCB D;  4XT1 B;  3JAM E;  3PQI A;  4POF A;  1I4H A;  3KLS X;  3UE0 A;  4DR3 Q;  4H0L C;  4KHP L;  1YVC A;  2R92 G;  4PZ8 A;  2NTS A;  3U4V A;  2HHH Q;  4RFB A;  3FKI G;  3I7F A;  2B2U A;  3MFY A;  4F87 A;  2A6H C;  5FLX E;  4GKJ L;  5J1Z A;  1TS4 A;  5EGT A;  1SRU A;  1O80 A;  4LF7 L;  4A3G H;  1FR3 A;  2PZW A;  1VMC A;  5JJI A;  3NE5 B;  1I94 L;  1ESF A;  2ZXR A;  1CKM A;  4UP9 A;  3CRL C;  4LK1 C;  2ID0 A;  2K50 A;  4IUV A;  1LLR D;  2NBF A;  4TVA B;  1KDC A;  3K7U C;  3DM1 A;  2HIX A;  3A5Z B;  5GAD C;  1SBB B;  2B2U C;  4RGM A;  3CCM A;  2L5T A;  1E1O A;  2JYO A;  1AE3 A;  1HNZ L;  2E2H H;  1Q3L A;  1HFG A;  2B2V C;  1TS2 A;  4PV1 C;  4AYB G;  4KHZ A;  2QIL A;  1LM0 A;  3UDI A;  4LAA A;  4A3C G;  3A0J A;  1MI2 A;  4L5T A;  3F2D A;  3SGI A;  3QG1 A;  1Z7T A;  3L0O A;  4B3S Q;  4DK1 A;  3PIP 3;  4DAY B;  3VYT A;  1VQO A;  1G6P A;  1YJN A;  2I5M X;  3SHL A;  4KKT A;  3DWA A;  1ESR A;  1K73 C;  1H95 A;  2Y0S B;  2GVA A;  4LFC L;  5JVH 3;  1XMQ Q;  1EYA A;  2WAQ E;  1A6X A;  5C44 B;  1DOL A;  2EYF A;  5NUC A;  4BY1 G;  1DZ1 A;  4JBW A;  5IP9 H;  4LF4 L;  2G9H D;  3JAM c;  4YCU A;  2PQA A;  4LFA Q;  2VQF Q;  4C3H H;  4WJ4 A;  1JWU D;  3D6W A;  3QOL A;  4KTA A;  2PQE A;  4JI6 Q;  4UY8 C;  1TWH B;  3RN2 A;  3H94 A;  1PFS A;  1N36 Q;  3CME A;  5JAV A;  1A8V A;  1CQV A;  2K5N A;  4QIW B;  1FGU A;  1VF7 A;  2QGQ A;  4Y52 H;  2LS0 1;  2PW7 A;  1M4V A;  4ZUJ A;  2F1M A;  1TR5 A;  4RGO S;  3M3Y H;  4A3J H;  5JPM C;  4QGU A;  3M85 A;  3RLF A;  1HJP A;  1V1P A;  1VQL A;  3T16 A;  4JG2 A;  1O78 A;  3UE1 A;  1MKH A;  3FPP A;  2EE1 A;  2LKV A;  3PSI A;  1QUQ A;  2Y0S E;  4RKL A;  2FXQ A;  3D8G A;  2F0G A;  1TS5 A;  1KDB A;  1GD7 A;  3HZX A;  1O7I A;  3TP8 A;  1EYG A;  3T4A C;  3RNU A;  2CWA A;  4C3H B;  1XPO A;  2VB2 X;  1D1K A;  3OOC A;  2PI2 E;  3NBH B;  3NSW A;  3SK5 A;  1LAC A;  5C0X G;  2EYP A;  4NXN L;  3TBI B;  2D9U A;  2AWO A;  4JYA Q;  2F0Q A;  3KF8 A;  2K5D A;  3CD6 A;  4HSP A;  2B8F A;  1NSN S;  4BBR B;  2A69 C;  3KBG A;  1WYD A;  2XRS D;  3PF5 A;  1XTC D;  2V1C C;  5M5X H;  3M4Q A;  1CKN B;  4NW2 A;  1CTM A;  3ONA B;  3OHX C;  2B2T A;  3N52 A;  4K6L A;  3WOF A;  4KMU C;  1C8C A;  4A3J B;  1X56 A;  3AEV A;  2GVB A;  1K8G A;  2CH4 W;  3NP8 A;  3MHB A;  3ZJY C;  3NTI A;  3I90 A;  1JOR A;  2OWO A;  4JV5 L;  1AW7 A;  1PRT B;  3HOW H;  4HR7 B;  5IYB G;  1LV9 A;  3RZD H;  1W6K A;  3Q6S A;  2QKI C;  4BXX G;  1BUV T;  3GD7 A;  3T1H L;  2B2T C;  3VR2 A;  1LYL A;  2E76 C;  3G7L A;  2F3V A;  1I4P A;  3BZK A;  2XNA C;  4A3F G;  3NQI A;  2NVT H;  5KNC A;  2JA7 G;  4A3B G;  4L8J A;  2PZU A;  4BBS H;  4DR7 Q;  4C1N I;  2EYO A;  5IYD H;  4GLA C;  3K5N A;  4V0B A;  4DAM A;  1P8L A;  2B2W A;  4P73 A;  4IUN A;  1HQM C;  1PZI D;  3BZD B;  3MC0 B;  4LF9 Q;  4A3I B;  3CAM A;  5G3L D;  1A15 A;  3EVQ A;  4DV7 L;  1DOK A;  4DR1 Q;  3MTS A;  4GN5 A;  4K2L A;  1KIX A;  3ND8 A;  4K5X A;  1SR3 A;  5BR8 Q;  3KBX A;  5EJW A;  1S5D D;  3BYY B;  5CV6 A;  4RGN A;  4RHS A;  1WTQ A;  2A6E C;  5FLM G;  5F2D A;  1F9P A;  3A54 A;  2K4K A;  1K8O A;  2B2W C;  3VR5 A;  1GOZ A;  1TWF H;  5COR A;  1VQJ A;  3DHQ A;  1DYQ A;  4LNQ A;  5KYL A;  1RDP D;  2QDB A;  2FIN B;  3R2T A;  5G3L F;  1Y14 B;  2QEJ C;  3CF5 A;  4U67 3;  1BCP D;  2NVT B;  1JMC A;  1L1O C;  3F8T A;  4B9W A;  4BBS B;  2UXD L;  1RHP A;  2F0V A;  2K6A A;  3S17 H;  3OWE B;  2Z0S A;  1QVF A;  1MHW C;  3J81 j;  4OX9 L;  2DNC A;  2PPB C;  2XSC A;  3HKS A;  1I50 H;  2UUC L;  2MHV A;  4WJ3 M;  5FOB B;  3DM3 A;  2NN6 I;  4XT3 B;  4B3M L;  3OYY A;  2EY5 A;  4NPS A;  3NEM A;  2L4N A;  3FMC A;  3KJP A;  2RHS B;  5JVG 3;  4TKO B;  5IIF A;  5IGB A;  2HQE A;  2R92 H;  5C3E G;  1WCM H;  2NUC A;  4Q0F A;  2G5D A;  4TQU S;  2UXC Q;  3E0E A;  1VQP A;  1BCP F;  4XIG S;  4JI5 L;  1V43 A;  1GHK A;  1PZK D;  2WFW A;  2JJQ A;  1EY0 A;  4LF6 Q;  5KEE A;  1PYW D;  1Z47 A;  2BDN A;  2FMC A;  2ZXP A;  1LTI D;  4IFD G;  1JB3 A;  2YTY A;  3D4W A;  1J6Q A;  4NXM Q;  4MIU A;  3Q8D A;  4ABN A;  3S14 B;  3MXP A;  4H7B A;  5ELO A;  3QJY A;  4MN3 A;  3BDL A;  1TWG B;  1TWC H;  1HNW L;  2RBM A;  2R6G A;  3OMG A;  5E4X A;  5DEH A;  2X69 A;  4B3R Q;  4JI3 Q;  3O13 A;  1GM5 A;  4A3K H;  3MVV A;  4A3C H;  2R93 H;  1QZG A;  3K81 C;  2UU9 Q;  2IX3 A;  1PLF A;  3A55 A;  1ENC A;  2A19 A;  3KUP A;  1STG A;  1JWM D;  5C3X A;  4Y7N H;  3TS0 A;  3K59 A;  1WCM B;  5JJK A;  3Q23 A;  1K8M A;  4IZ8 A;  2KBN A;  2JA5 H;  5GRO A;  1QWY A;  4CDE C;  5TSS A;  1XNR L;  3A5U A;  4DV3 L;  2JA8 B;  2JP1 A;  1C7Y A;  1KL9 A;  5FO9 B;  1STY A;  5CGK A;  4BY1 H;  4A75 A;  5M5W H;  3HFZ B;  1S5B D;  3HOV B;  1W3S A;  4KHP Q;  1EUJ A;  1CM9 A;  2IHF A;  3T56 B;  4JPB W;  2R7Z H;  3W5O A;  2R7D A;  5IGC A;  1BO0 A;  1EWI A;  4K5W A;  4YCV A;  3D31 A;  5C4X B;  1FNU A;  4I7A A;  4QB4 A;  1NNX A;  4GN4 B;  5CYU A;  3I55 A;  2LSS A;  4A3K B;  4LF8 Q;  2R93 B;  1WI5 A;  1YZ6 A;  2B2Y A;  1BF4 A;  1YNJ D;  1Q12 A;  1PA6 A;  2Y0S G;  1V8Q A;  5IY0 A;  5C44 G;  1CHP D;  2H4O A;  2AQ1 B;  2RA4 A;  2QCP X;  1PH4 A;  1U0L A;  3I91 A;  3OMC A;  4JC0 A;  4DNR B;  2JA5 B;  4IPC A;  3J80 i;  1SEB D;  3Q0A A;  3FVQ A;  1NY4 A;  3SK6 A;  3HGB A;  2B2Y C;  4DUZ L;  3GTK B;  3GTM H;  1A3V A;  2N8N A;  3AFQ A;  4KY6 A;  2VUM H;  3DWQ A;  1HH2 P;  3S1R H;  1XMO L;  5K36 G;  4GNX B;  1SNP A;  4ZQ3 A;  1N32 L;  1Y1V B;  4O1N A;  1HCZ A;  3WWV A;  5C0X H;  3L7Z C;  4MTN A;  1HZ9 A;  4IO9 A;  2IJ0 A;  2CCZ A;  2ICI A;  5IOD A;  2R7F A;  4DXG A;  2NZO A;  4JI4 L;  2WB1 B;  1YNX A;  4FDB A;  4DV4 Q;  3PIO 3;  1W6J A;  3T13 A;  1NMG A;  2K7V A;  2MGS A;  4LF4 Q;  2PI2 A;  5DM7 3;  4L5Q A;  1ZXT A;  1EOV A;  4X66 L;  2NVX H;  3J7A 5;  2B29 A;  2K04 A;  1HUN A;  3CCE A;  3UDX A;  1R9T H;  4C3H G;  3PIO A;  4JI2 L;  3WDN A;  3HOU B;  3BDC A;  4H02 A;  4K8J A;  2RKS A;  2D62 A;  3JC6 6;  2WV6 D;  3HRZ C;  5JJL A;  5ISR A;  3LX0 A;  1IW7 D;  2BA1 A;  1B8A A;  4IPD A;  3SR1 A;  4X64 Q;  5I6Y A;  1BBX C;  4DAV A;  2IHE A;  1SE8 A;  2VUM B;  4BBR G;  4XQN A;  1Q81 C;  3G48 A;  5CV8 A;  2CW0 D;  2OTJ A;  4IUR A;  5IWA Q;  2K1B A;  2JA7 H;  4A3B H;  1LTB D;  2VZA A;  5ELF A;  3T1Y L;  3HP3 A;  1EZ8 A;  1VQB A;  3TRE A;  5I9O A;  4A3J G;  1PDQ A;  4FXK C;  2L0C A;  2VS1 A;  2WB1 E;  3AB9 A;  3KDF A;  3VYU A;  3S16 H;  1JT8 A;  3K6O A;  1B1Z A;  3AQQ A;  1GUW A;  1NUC A;  3OW2 A;  2EZV A;  2O2L D;  4DUY L;  1DD2 A;  2AQ2 B;  4ZLT F;  2E75 C;  2E5L L;  3C2P A;  1UE1 A;  2L1B A;  3S2D B;  1LTS D;  4FXG C;  5M9O A;  2AWN A;  1EY7 A;  3RZO B;  3ULL A;  4RKB A;  1EQV A;  5DAU A;  3MEH A;  5FLM H;  3TZD A;  4MTK A;  1U9R A;  3E6Z X;  1FYC A;  2QW7 A;  2AUK A;  2F0O A;  3K80 C;  2ZTD A;  2O4X A;  3A8K E;  3R93 A;  2SDF A;  1X54 A;  1SSO A;  1U4L A;  3I4L A;  2BH2 A;  3M4P A;  4B3T L;  1H9K A;  2SNS A;  2OCE A;  2WP8 J;  3LNN A;  2RDH A;  4DR5 L;  4LF5 Q;  3ERQ A;  4EGV A;  4P72 A;  4B08 A;  1WTH A;  3FDT A;  3S16 B;  3LWU A;  3NBI A;  3SK4 A;  2VL6 A;  3X3N A;  1L1O B;  1H9S B;  4JV5 Q;  1QNU A;  3STB C;  3S1Q B;  1R4P B;  1Q90 A;  2OQ0 A;  2K5V A;  4HJ8 A;  4JBK A;  4OO1 H;  1B3Q A;  1X3F A;  2JXM B;  5C3E H;  1IBM L;  1D5X C;  1PH6 A;  4DF7 A;  4XTC S;  1WD1 A;  1QVC A;  2OQK A;  1K3R A;  4BBS G;  1N33 L;  1H9R A;  2Z6K C;  2JN4 A;  4EVO A;  1CA6 A;  3WOE A;  4JW0 A;  4DV7 Q;  1E24 A;  4X65 L;  3M9B A;  3EIV A;  1ET6 A;  4B9X A;  1V1O A;  1JC7 A;  5JOB A;  4JVZ A;  4YWL A;  2XVS A;  4DV1 L;  1SXT A;  2I07 B;  2UXB Q;  3GDE A;  5LMU L;  2RCF A;  1B9M A;  1IBL L;  1UEA B;  1Y8P B;  2CQO A;  1IBK Q;  1BQQ T;  1RJT A;  1TII D;  1Y1W H;  3K58 A;  1E1T A;  4BA1 I;  4DKA C;  2WAC A;  1F2Y A;  2UXD Q;  1KAB A;  1M90 C;  1HR0 L;  4WFN 3;  2F3W A;  2MO1 A;  1AE2 A;  3ND9 A;  4R4C A;  1P16 A;  3UDG A;  2F03 A;  4CKB A;  2NWG A;  1JB7 A;  1SYB A;  4GLV B;  3A74 A;  5JEA J;  1VDZ A;  3C46 A;  3GTL B;  1F2M A;  2JQO A;  1KC8 C;  1V9P A;  4OL7 A;  4ZRZ A;  1PH1 A;  3C3L A;  4DR6 L;  1WCM G;  3EFX D;  1XTD A;  5ELD A;  1Q1E A;  5I2Y A;  5J22 A;  1J9O A;  1LTR D;  2ZM6 L;  1N9W A;  3OTO Q;  4N9P A;  3ULJ A;  5JPN C;  4IJH A;  2JA8 G;  4RGT A;  1DGS A;  5C44 H;  3BVZ A;  4DK3 C;  2F0T A;  5BN5 A;  3H0G B;  2A69 D;  1Y1W B;  1OXX K;  5H1S E;  5M5Y B;  1EYD A;  2IT1 A;  2I0Q A;  4HN7 A;  4F88 A;  3HOV G;  1HNW Q;  1JOQ A;  3MXN A;  2UUB Q;  3AFP A;  3J7A V;  1BCP B;  1VCI A;  2F0S A;  4KY5 A;  1TWH H;  2E74 C;  1MSH A;  1ZEQ X;  3J81 L;  1I5F A;  5C4X G;  4WJW A;  2NYZ D;  1RIP A;  4DR4 Q;  4A3K G;  5K36 H;  2R93 G;  4CDF C;  2UUA L;  5ELB A;  5FKA C;  1Y8N B;  2PMZ B;  4X3S A;  1BNZ A;  5EKL A;  3VR3 A;  1PTO C;  2HCI A;  1KNE A;  1GXD C;  3TQY A;  2E2D C;  1KTK A;  3RLO A;  4DV0 L;  1OXU A;  4QCL A;  2JA5 G;  1MSG A;  3T53 B;  2XRQ D;  2HCC A;  1VQ5 A;  5LMN Q;  5DNF A;  1IYJ B;  4LFB L;  1TVX A;  4EX5 A;  1RF2 D;  4K8I A;  2KOL A;  1MBY A;  1VQA A;  2K33 A;  5DM6 3;  3FP9 A;  1OXT A;  1Y1V G;  1WTO A;  4PZ6 A;  3B6Y A;  2R7Z G;  1RD9 D;  2F0F A;  2D0P A;  1L0W A;  4P2C B;  1S5E D;  2A6E D;  4J8Q A;  3RUZ A;  4RH6 A;  3SK8 A;  4EQP A;  2WB1 G;  1AZQ A;  4QQB X;  1GUO A;  5FLX c;  4BBR H;  4HED A;  1JWS D;  3VYR A;  1K8A C;  1MD2 D;  3J81 E;  4ME3 A;  1PV4 A;  1CK1 A;  1B50 A;  2I5H A;  4ZKB B;  1IZ6 A;  2ZJR A;  4FXD A;  2NVY B;  4UP8 A;  4J15 A;  3K7A B;  3K5O A;  3GV6 A;  1EFW A;  3TP6 A;  4X6A H;  4HID A;  2HQL A;  3RMH A;  4DUZ Q;  5GQO A;  3EQL C;  3IRB A;  1XNQ Q;  3HOU G;  1A3U A;  1DXM A;  4ME5 A;  4ZAI A;  2HT1 A;  2IY5 B;  4P75 A;  4G7O C;  4IJL A;  2OEO A;  4A3L G;  1Z9F A;  2VUM G;  4M8A A;  2EY1 A;  3G4S A;  1LUZ A;  3PO2 H;  1X9N A;  1UNS A;  1E2V A;  2GA4 B;  2EIF A;  1VQ8 A;  2ASB A;  2A74 C;  3P75 A;  2I46 A;  3HOZ H;  2ES2 A;  3C1E A;  3NXW A;  1ASY A;  1S5C D;  2F0H A;  1J5E Q;  5D14 A;  3F2C A;  2KCN A;  4PQX A;  4JI8 L;  4A3I H;  4JBM A;  4QIW E;  2D5D A;  2F0I A;  1A2T A;  5EPL A;  2Z9H A;  1U5K A;  4Z9C B;  3OPO A;  1YNN D;  1NMF A;  5E4W C;  3S15 B;  2CFM A;  2EY6 A;  3CCS A;  4I7Z C;  3UDF A;  2F4V Q;  1ICW A;  3GTQ H;  4KD4 A;  1N34 Q;  4UP7 A;  2IX1 A;  4CDD C;  1UEB A;  4DR2 L;  1OO9 B;  1HNX L;  4X62 Q;  2ATW A;  3PO2 B;  1K83 B;  3H91 A;  2RDG A;  1I3Q B;  3HOZ B;  1TQO A;  2EXD A;  1OXV A;  2ZJP A;  2OF1 A;  2ZTC A;  2Z6B A;  1JJG A;  1B4O A;  2Z8L A;  1EY4 A;  2EXZ A;  2XIW A;  2F4I A;  2NZH A;  2XGT A;  4JI1 L;  3I56 A;  1TKW B;  5EPK A;  1MIU A;  3H3V C;  5C3W A;  3G71 A;  4JI7 L;  3W3A A; 
#chains in the Genus database with same CATH homology
 1NJI C;  2Y0S G;  1KRS A;  3CCR A;  2C35 B;  1WOC A;  5IY0 A;  5C44 G;  3CCJ A;  2JEA I;  1PVO A;  1Q7Y C;  1TXY A;  4DV5 Q;  3I4M H;  1VQC A;  1C9O A;  4HIM A;  2JK8 A;  1PH4 A;  3CXC A;  1U0L A;  1Q8K A;  2Z6K A;  4JC0 A;  1YIJ A;  1OXS C;  2OTL A;  3HOY H;  4GOP B;  2VY3 A;  4IPC A;  3J80 i;  4JI1 Q;  2Q2T A;  2ALY B;  2F52 A;  1NY4 A;  1PH9 A;  4L5R C;  4AQY Q;  3HOW G;  3S1N H;  1Q46 A;  3J7Z C;  4JI7 Q;  1CSQ A;  4DUZ L;  4B3T Q;  4YWM A;  3S14 H;  3GTM H;  1D7Q A;  4DV4 L;  1PHJ A;  4LW1 A;  2N49 A;  2B3G A;  2N8N A;  3AFQ A;  3E9I A;  3I4O A;  1TWG H;  4DV2 L;  2VW9 A;  3KF6 B;  2VUM H;  1IXR A;  3PIP A;  1HH2 P;  3S1R H;  1XMO L;  1XPR A;  1UWV A;  4OWX B;  4GNX B;  5K36 G;  1N32 L;  2A8V A;  4MZ9 A;  4GOP A;  5IYD G;  1HR0 W;  1A63 A;  4KI0 A;  1YHQ A;  5AJ3 L;  2PMZ E;  2RF4 A;  3WWV A;  4YHH L;  3L7Z C;  4MTN A;  1HZ9 A;  4IO9 A;  2RCN A;  4LUZ A;  3J80 c;  3PF4 A;  2CCZ A;  5IYC H;  1VS0 A;  2R7F A;  3S15 H;  3TEH B;  2NZO A;  4OO1 G;  2MO0 A;  4JI4 L;  4HJ7 A;  4DV6 L;  4NXM L;  1YNX A;  5FJ8 G;  1X3E A;  1UE7 A;  4FDB A;  4DV4 Q;  4LUV A;  3KF6 A;  3EBE A;  1BVS A;  4C2M H;  4DV2 Q;  4GNX A;  1NMG A;  3PUX A;  4LF4 Q;  4X64 L;  1XMO Q;  2PI2 A;  4JI0 L;  4YCW A;  1N32 Q;  4K0K L;  1FL0 A;  4L5Q A;  1FJG L;  1D8L A;  1Q1B A;  2CWP A;  1EOV A;  5AJ3 Q;  4X66 L;  2IX0 A;  4YHH Q;  1SFO H;  2NVX H;  1T9H A;  3J7A 5;  2JA8 H;  1WFQ A;  2B29 A;  2KHI A;  5GAE C;  3CCE A;  2NVQ H;  4KLK A;  3UDX A;  5IWA L;  1R9T H;  1K83 H;  3CQZ H;  3PIO A;  4JI2 L;  2MQH A;  1YI2 A;  1N8R C;  1I3Q H;  4DV6 Q;  4JI4 Q;  4A3D G;  3BZC A;  4H02 A;  3TRZ A;  2D62 A;  2YTV A;  3JC6 6;  3HOV H;  2N3S A;  2ZJQ A;  5JJL A;  4OON A;  1CSP A;  1G51 A;  4GNX C;  4DR3 L;  2BA1 A;  1B8A A;  4IPD A;  4A3E H;  5IP7 G;  4X64 Q;  4JOI A;  3KDF B;  4JI0 Q;  2IHE A;  1SE8 A;  4YY3 Q;  1M1K C;  4K0K Q;  2E8G A;  1K9M C;  3HKZ E;  4BBR G;  2HHH L;  1FJG Q;  3KYH C;  4X66 Q;  1Q81 C;  1KQS A;  2CKZ B;  1YBY A;  3G48 A;  4RMF A;  1VQI A;  5C4X H;  3LGJ A;  2OTJ A;  1OTC A;  3HOX G;  5IWA Q;  2JA7 H;  2GN5 A;  4A3B H;  4GKK L;  1QZH A;  2VZA A;  3T1Y L;  4JI2 Q;  4POF A;  1KHI A;  1K0R A;  1YJW A;  1VQB A;  3TRE A;  4P71 A;  3UE0 A;  4A3J G;  1CUK A;  1JE5 A;  4IOC A;  1VQG A;  2EQS A;  1V1Q A;  2VS1 A;  5LMN W;  2WB1 E;  4DR3 Q;  3KDF A;  3S16 H;  1PH5 A;  3H0G G;  1JT8 A;  4JOI C;  3AQQ A;  1YVC A;  1Y1W G;  2R92 G;  3U4Z A;  4PZ8 A;  3OW2 A;  3VDY A;  4KHP L;  3U4V A;  4DUY L;  1HZA A;  3PUZ A;  2HHH Q;  3FKI G;  2MNA A;  1SLJ A;  3I7F A;  1NE3 A;  3KJO A;  2E2I H;  2E5L L;  1UE1 A;  3ULP A;  3I4N H;  4GKJ L;  1SRU A;  2AWN A;  4LF7 L;  4A3G H;  3ULL A;  5ELN A;  1VQF A;  4GKK Q;  3T1Y Q;  1S40 A;  4OWW B;  5JJI A;  3GTK H;  3J81 c;  5FLM H;  1I94 L;  1A0I A;  3ER0 A;  1CKM A;  1C0A A;  5M3M H;  4LF5 L;  4UP9 A;  2ID0 A;  2K50 A;  3DLL A;  5M3F G;  4TVA B;  3K7U C;  1Y1V H;  2YYZ A;  4DUY Q;  2HIX A;  3A5Z B;  1WJJ A;  5GAD C;  2PNH A;  2YTX A;  3K80 C;  3RLN A;  3CCM A;  2ZTD A;  1E1O A;  3CPF A;  3S24 A;  2E5L Q;  4B3S L;  1AE3 A;  1HNZ L;  5C0X J;  2E2H H;  4GKJ Q;  1X54 A;  4LF7 Q;  4AQY L;  4L5S A;  3GTO H;  4DPG A;  1SN8 A;  1I94 Q;  4BY7 G;  2BH2 A;  3PUV A;  1XMQ L;  3M4P A;  4AYB G;  4HIO A;  2WP8 J;  4KHZ A;  1LM0 A;  2OCE A;  3UDI A;  4DR5 L;  4B3T L;  4LF5 Q;  3PO3 G;  3A0J A;  1EQQ A;  4A3C G;  4A93 G;  4P72 A;  4IOA A;  4L5T A;  5E7N A;  3JAM i;  3H3V I;  2VL6 A;  3F2D A;  1L1O B;  3SGI A;  4JV5 Q;  1XJV A;  4LFA L;  3STB C;  2VQF L;  3L0O A;  1KRT A;  4B3S Q;  3CCU A;  2OQ0 A;  2K5V A;  1SMX A;  2PQA B;  4HJ8 A;  4HJA A;  4DAY B;  1HNZ Q;  4JBK A;  1VQO A;  1G6P A;  1YJN A;  2I5M X;  2B63 H;  1X3F A;  3D0F A;  4JI6 L;  3HOU H;  5C3E H;  1K73 C;  1IBM L;  3I2Z A;  1PH6 A;  4XTC S;  1JJ2 A;  1H95 A;  1QVC A;  2GVA A;  4LFC L;  1XMQ Q;  3M7N A;  2AKW B;  1TWA H;  2WAQ E;  3FHW A;  4DR5 Q;  1N36 L;  2UUA Q;  4BY1 G;  3GO5 A;  1X3G A;  3MEF A;  4JBW A;  1L1O A;  2OQK A;  3STB D;  5IP9 H;  4A3L H;  1K3R A;  4A76 A;  4LF4 L;  4C3J H;  3JAM c;  2HIV A;  1N33 L;  4YCU A;  2PQA A;  4LFA Q;  4BBS G;  2Z6K C;  2VQF Q;  2UXB L;  3RR5 A;  4C3H H;  4WJ4 A;  2L15 A;  5GAG C;  3CC2 A;  1YHA A;  4GN3 B;  4DV7 Q;  1AH9 A;  4DNI A;  1E24 A;  4JI6 Q;  4UY8 C;  1IBM Q;  1IBK L;  3RN2 A;  4X65 L;  3M9B A;  1PFS A;  3EIV A;  3KLW A;  4LFC Q;  1X55 A;  3TS2 A;  4PMW A;  3CME A;  4ALP A;  1N36 Q;  1HZC A;  1A8V A;  3AYH B;  2K5N A;  2LXK A;  1QUQ B;  1FGU A;  4YWL A;  1GO3 E;  2JEB I;  1N33 Q;  4GOP C;  1YIT A;  4DV1 L;  4YY3 L;  2UXB Q;  2QGQ A;  4Y52 H;  3GDE A;  3CPW A;  5LMU L;  1GVP A;  3S2D H;  4LWC A;  3CC7 A;  3RZO H;  5DLQ E;  3M3Y H;  4OXP A;  4A3J H;  1IBL L;  2CQO A;  4QGU A;  3M85 A;  1IL2 A;  1IBK Q;  1ASZ A;  4X65 Q;  3RLF A;  1HJP A;  4APV A;  1Y1W H;  1VQL A;  4JG2 A;  1E1T A;  3UE1 A;  1MKH A;  4OWT B;  4BA1 I;  4JYA L;  1E3P A;  3CCQ A;  1QUQ A;  3PSI A;  1PYS B;  3FKI H;  4DKA C;  1VQ6 A;  2Y0S E;  2UXD Q;  2FXQ A;  3KF8 B;  1Q86 C;  4PZ7 A;  1M90 C;  1PH3 A;  1HR0 L;  1GD7 A;  3CP0 A;  4DV1 Q;  2MO1 A;  1O7I A;  4LUO A;  5LMU Q;  1AE2 A;  1EYG A;  2H5X A;  3ICE A;  4R4C A;  4A4I A;  2CWA A;  1P16 A;  3RNU A;  3UDG A;  1XPO A;  1HZB A;  3W1B A;  2PI2 E;  1JB7 A;  1IBL Q;  4GLV B;  3NBH B;  3A74 A;  5JEA J;  3OTO L;  3GTJ H;  5C0X G;  1S3O A;  4NXN L;  2JQO A;  1KXL A;  3PUY A;  1KC8 C;  2AWO A;  4JYA Q;  1L2F A;  3M4O H;  3PUW A;  1V9P A;  3CD6 A;  4HJ9 A;  1GKH A;  1HR0 Q;  1PH1 A;  3S1Q H;  4NB3 A;  1WYD A;  4DR6 L;  1WCM G;  3PF5 A;  1S72 A;  3S1M H;  1XTD A;  2V1C C;  1Q1E A;  5M5X H;  2UUB L;  3M4Q A;  1CKN B;  3MXN B;  4QY7 A;  5HY6 A;  4QL5 A;  2Q2H A;  2ZM6 L;  1N9W A;  1JJC B;  3K8A A;  3OTO Q;  3PO3 H;  3ULJ A;  4IJH A;  2JA8 G;  4IPH A;  1X56 A;  2AMC B;  2BH8 A;  2GVB A;  1DGS A;  2WAQ G;  3K0X A;  5EAY A;  5C44 H;  4A3M G;  1K8G A;  3PO2 G;  1SRO A;  4DK3 C;  1BBW A;  2QEX A;  4BA2 I;  4DR4 L;  3ZJY C;  1OXX K;  5H1S E;  3PGZ A;  4DR7 L;  2LXJ A;  2IT1 A;  3BU2 A;  3PCO B;  4QJF A;  1Q82 C;  2I0Q A;  3HOZ G;  2OWO A;  3HOV G;  4DR6 Q;  1HNW Q;  1BKB A;  1CKN A;  4JV5 L;  1VQH A;  2UUB Q;  2RHQ B;  3AFP A;  1XPU A;  3HOW H;  5IYB G;  1VCI A;  3RZD H;  4A3E G;  4MNO A;  4LF9 L;  2JA6 G;  4IFD J;  4BXX G;  3GD7 A;  3T1H L;  1TWH H;  4A3I G;  2ZM6 Q;  1MJE A;  1LYL A;  4DR1 L;  4DK6 C;  1I5F A;  1E7Z A;  5C4X G;  3BZK A;  5C0X I;  4HJ5 A;  5BR8 L;  4A3F G;  4IFD I;  2MFI A;  5LMN L;  2NVT H;  1RIP A;  2JA7 G;  4A3B G;  4A3K G;  4DR4 Q;  4BBS H;  4DR7 Q;  2R93 G;  2KCM A;  5IYD H;  2UUA L;  4GLA C;  4DAM A;  2K5H A;  1P8L A;  4P73 A;  3TQY A;  3F1Z A;  4UPA A;  4AIM A;  3RLO A;  4DV0 L;  4LF9 Q;  3CAM A;  2VNU D;  1EIF A;  3T1H Q;  1OXU A;  2JA5 G;  5FJ8 H;  2ZTE A;  4DV7 L;  3NEN A;  4DR1 Q;  4GN5 A;  1KIX A;  3S2H H;  4C3I H;  1SR3 A;  2BA0 A;  5BR8 Q;  1VQ5 A;  2E2J H;  3I4N G;  5LMN Q;  3GTP H;  1IYJ B;  4A3G G;  4LFB L;  5GAH C;  4EX5 A;  1X65 A;  5FLM G;  2D0O A;  2VQE Q;  2K52 A;  4R1J A;  5M3M G;  2K4K A;  1VQA A;  3HKZ G;  4AH6 A;  1TWF H;  2KEN A;  1VQJ A;  3FP9 A;  4DV0 Q;  4LNQ A;  1OXT A;  4A3D H;  1Y1V G;  5C4J H;  4PZ6 A;  2I5L X;  3B6Y A;  2R7Z G;  1KD1 C;  3GTL H;  1L0W A;  2D0P A;  3ERS X;  4YWK A;  1Y14 B;  2A1A A;  1CKO A;  3KOJ A;  5HGQ A;  1UE5 A;  3CF5 A;  5IP7 H;  4LFB Q;  5JEA G;  3CCV A;  3NEL A;  2K75 A;  1PYB A;  2WB1 G;  3U50 C;  1XNQ L;  1JMC A;  5FLX c;  4QQB X;  1L1O C;  3F8T A;  4BBR H;  2UXD L;  2UXC L;  1NTG A;  3S17 H;  1K8A C;  2Z0S A;  3CMA A;  1QVF A;  3J81 j;  4OX9 L;  1FVI A;  4ME3 A;  2YV5 A;  3W1G A;  1PV4 A;  4R4Q A;  3HOX H;  1VQ9 A;  3KFU A;  3HKS A;  1I50 H;  2I5H A;  4LF6 L;  1B70 B;  2UUC L;  4WJ3 M;  1IZ6 A;  1VQN A;  3I4M G;  3DM3 A;  2NN6 I;  2JE6 I;  2ZJR A;  1VQ4 A;  2AHO B;  4B3M L;  3OYY A;  4POG A;  4NPS A;  4UP8 A;  1W2B A;  3NEM A;  3PV0 A;  4J15 A;  3HOY G;  3KJP A;  1EFW A;  2RHS B;  4R4O A;  3H3V H;  3H0G H;  2B63 G;  4EQ5 A;  2HQL A;  4DUZ Q;  4HID A;  4X6A H;  2R92 H;  1YHB A;  5GQO A;  3IRB A;  5M5Y H;  5C3E G;  2KCT A;  1WCM H;  4AYB E;  3F2B A;  1XNQ Q;  3HOU G;  4TQU S;  2HT1 A;  2UXC Q;  2IY5 B;  3E0E A;  1VQP A;  4P75 A;  4XIG S;  4JI5 L;  1V43 A;  4OX9 Q;  2WFW A;  4IJL A;  2JJQ A;  1J5E L;  1VQK A;  1X6O A;  5IP9 G;  3RN5 A;  4LF6 Q;  4A3L G;  1Z9F A;  2UUC Q;  1KAW A;  2DUD A;  2VUM G;  4A3M H;  4B3R L;  1Z47 A;  4JI3 L;  4B3M Q;  3G4S A;  1LUZ A;  3PO2 H;  1VQ7 A;  5IT9 c;  1X9N A;  1YJ9 A;  4IFD G;  2YTY A;  2UU9 L;  4NXM Q;  1J6Q A;  1PH7 A;  3G6E A;  5M3F H;  1VQ8 A;  2EIF A;  5IYC G;  2ASB A;  3HOZ H;  4RG1 A;  2N78 A;  2ES2 A;  3Q8D A;  4JCV E;  2F4V L;  5IYB H;  5ELO A;  1ASY A;  1N34 L;  4JI5 Q;  1TWC H;  2JA6 H;  4BXX H;  1HNW L;  1J5E Q;  1E22 A;  4P74 A;  2R6G A;  3F2C A;  4JI8 L;  4A3I H;  4JBM A;  1RL2 A;  4JBJ A;  4QIW E;  4BY7 H;  4A3F H;  4JI3 Q;  4B3R Q;  4X62 L;  1GM5 A;  2YU9 H;  3CW2 C;  2XTI A;  1U5K A;  4A3K H;  3J81 i;  4A3C H;  1QZG A;  3K81 C;  2R93 H;  1MJC A;  2UU9 Q;  3U58 A;  4A93 H;  1A62 A;  3CCL A;  1NBW A;  1NMF A;  3GTG H;  1G29 1;  1YEZ A;  2A19 A;  4OO1 I;  2CFM A;  4Y7N H;  3TS0 A;  3CCS A;  3UDF A;  2QA4 A;  3L2P A;  2F4V Q;  3GTQ H;  5JJK A;  1N34 Q;  1EQR A;  4UP7 A;  1B7Y B;  5J3B A;  2IX1 A;  2F3I A;  2KBN A;  2JA5 H;  5GRO A;  4JI8 Q;  1I6H H;  1UEB A;  1XNR L;  4O2D A;  4HIK A;  3A5U A;  4DV3 L;  4DR2 L;  1HNX L;  4X62 Q;  3AEV A;  4PG3 A;  1C7Y A;  3E9H A;  1KL9 A;  4GLX A;  2ATW A;  3CC4 A;  4GS3 A;  4IPG A;  4R4I A;  1LTL A;  2JA9 A;  1VQM A;  4BY1 H;  2K14 A;  4LF8 L;  4R4T A;  5IE8 A;  1UE6 A;  5M5W H;  4A75 A;  1VQE A;  3HFZ B;  3H15 A;  2EXD A;  1W3S A;  4O0A A;  2VQE L;  4KHP Q;  1OXV A;  1EUJ A;  2ZJP A;  4DV5 L;  1PH8 A;  2ZTC A;  1JJG A;  2IHF A;  2Q2I A;  1QVG A;  2R7Z H;  3W5O A;  2R7D A;  1EWI A;  3BJU A;  1XNR Q;  2NZH A;  2NN6 G;  1VQD A;  2XGT A;  4YCV A;  4JI1 L;  4DV3 Q;  2NVY H;  3D31 A;  3I56 A;  4DR2 Q;  1HNX Q;  3K7A H;  4GN4 B;  3I55 A;  2KHJ A;  1MIU A;  2Q2U A;  4NXN Q;  2LSS A;  1BBU A;  3G71 A;  1PH2 A;  1EIY B;  4JI7 L;  4LF8 Q;  1WI5 A;  1YZ6 A;  3EN2 A;  2DGY A;  1Q12 A;  1PA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...