1Y69U

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y69U01
2BA1A 1CTMA 3VR6A 3T53B 1VDZA 1Y69U 3H94A 3TZUA 3VR2A 1DXMA 4JBWA 3RLFA 5KNBA 1YNNC 4KN4C 3W3AA 2YYZA 3QG1A 5K36H 4KKTA 1IW7C 2A6HC 1GUGA 3ND8A 2D62A 2KCCA 1IYUA 1IW7D 2A6HD 1ZKOA 3MFYA 1GUOA 2LMCB 1FYCA 2EJFC 1HTPA 2B8GA 2EJGC 2QF7A 2NN6H 4IFDG 3PUXA 3I4LA 2K33A 1T5EA 3D31A 2A6EC 4LJZC 5C0XH 3KLRA 3EQLC 1Q12A 2NN6I 3GQBA 1OXTA 1SMYC 1E2WA 2BE5C 2A6ED 1V43A 3M4YA 2JEBI 3BDOA 2Q8IB 4KKUA 2BE5D 2A68D 5KNDA 4OO1H 1K8OA 3A7LA 1PMRA 1O7LA 2BDOA 4JK1C 1H9KA 1BDOA 3PUZA 2E74C 2L5TA 3IFTA 3I73A 4PV1C 3HGBA 2E76C 3A8IE 1VCIA 1HQMC 1H9JA 3QJYA 3I72A 4H0LC 4RCNA 3SE0A 5A35A 5K36G 1GUSA 3A7AB 1GUTA 1CI3M 3PV0A 1YNJC 1Y8NB 2K7VA 4BA2I 3GD7A 1B9NA 1K8MA 4DK0A 1Y8OB 2O5IC 4HR7B 2DNCA 3MXUA 4L8JA 3DXJC 2DNEA 4OGQC 1G291 3M7NA 1HCZA 1TKWB 3FPPA 5JEAH 2DN8A 1GJXA 3T56B 3U9SA 1ZYRC 3P20A 4H13C 4H44C 5BN3A 4TKOB 4G7HC 3D4RA 4XIGS 4XTCS 2D2CC 1Q1BA 2K32A 3A8JE 2O5JC 4DK1A 3LWUA 1FR3A 4OO1G 1H9SA 1CFMA 3CRLC 3WDNA 3LNNA 4KI0A 2B8FA 3FMCA 2JE6I 3PUYA 1OXXK 1QJOA 3M85A 4TQUS 1V8QA 3L7ZC 2JXMB 3IKJA 1B9MA 1LABA 1OXUA 3PUVA 2V4DA 3OW7A 4DNRB 4IFDH 1ONLA 1E2ZA 1OXVA 2AUJD 3QIAA 2R6GA 1H9SB 2ZT9C 2KA7A 4KKSA 2NN6G 1VF5C 1GHKA 1IYVA 1OXSC 2BA0A 5C0XG 5KNCA 5JEAG 2AUKA 3AB9A 2JEAI 1DD2A 1HPCA 1H9RA 3VR3A 5BN5A 2EDGA 1H9MA 2PCFB 4G7ZC 2EJMA 2PNRC 1Q1EA 1LACA 4KN7C 3OPOA 3T51B 1E2VA 2A69C 2CW0C 1VF7A 3N6RA 4LK1C 1TU2B 2EVBA 3VA7A 1I6VC 3BG3A 1GUNA 2E75C 2D5DA 2A69D 1DCZA 4BA1I 1O78A 4DNTB 4GZYC 2AWOA 3OOCA 3A8KE 3SDZA 3VR5A 2F1MA 3CRKC 3NE5B 1EWHA 4KHZA 1Z6HA 2PPBC 4I7ZC 4IQZA 3VR4A 1Y8PB 4G7OC 1A6XA 1Z7TA 2IT1A 2A68C 4KMUC 3ND9A 3PUWA 5BN4A 1Q90A 1GHJA
chains in the Genus database with same CATH superfamily
1CTMA 2QEJC 4RWSC 2FMMA 3PMFA 3RZDB 3HOUB 3TSSA 1IBMQ 1WTWA 1CHQD 5E4WC 1O80A 1BBXC 5IGDA 5LMUL 1QZGA 1SNQA 1PRTB 2LMCB 2H5XA 1HR0W 1QCBD 1CA5A 2JA8G 3NEMA 3K5LA 1MKHA 2NN6I 3RUZA 1IXRA 3SR1A 2LY7A 4F87A 5IT9L 3M4QA 1JQYD 1J6QA 1FGBD 1HR0Q 4JK1C 4CJ1B 2MHVA 2V1CC 4FNFA 4HN7A 5DLQE 3H3VH 4R4CA 3PF4A 4DAPA 1C0AA 1G8ZD 1Y8OB 4PQXA 5M3FB 1TS4A 2B29A 3RLNA 2F0VA 4P71A 1TKWB 2M2LA 3W1BA 3FPPA 2PZUA 3NUCA 3J80i 5JEAH 5JVH3 1Q81C 3GTMH 3OMGA 4H44C 3ULLA 2KECA 1YI2A 3T1HL 1HR0L 5CV4A 1PYSB 1PHJA 2QCPX 5EKLA 2NZHA 4R1JA 4S3SA 3CRLC 3AMUA 1F2YA 2B8FA 1JOQA 1QVCA 1I3QB 3F2BA 1HFNA 5ELFA 1PV4A 2V4DA 4CKCA 4DV7L 1ONLA 5IGFA 3E0JA 3GTOH 3S2HB 1EWCA 1IYVA 4PZ8A 1L1OA 4JI3Q 3DHQA 4GLVB 4TVAB 4A3MB 4JI0Q 4MN3A 1I4XA 4ZQ3A 3VYUA 1YHQA 3ONAB 4J8QA 4EX5A 4POFA 1BCPB 2OF1A 3G6JB 1BR9A 2A69C 4OWWB 2A69D 5ELBA 4LF8L 1HUMA 2RDFA 4GOPB 1JMCA 2WFWA 3S17B 2CH4A 1WTVA 3NE5B 2DUDA 5F2DA 2F0DA 3EN2A 5EPLA 4JI3L 1PH3A 1GHJA 3GV6A 4OL7A 5AFWA 4A3EG 2EXZA 5EJWA 5I4DA 2PI2A 5CYUA 3HKZB 3HEJA 3KJPA 3HOUG 4G57A 2HIXA 2H1EA 1AW7A 3A56A 4FF2A 3MFYA 1TWFB 4TRDA 3GTGB 1KRTA 1EL0A 5C0XH 2N49A 3KYHC 1A8VA 3GQBA 4CDDC 4RGNA 1HRJA 4XDXA 1KC8C 2LSSA 1IHZA 2E76C 4RHRA 3QJYA 3CMEA 1Y1VB 4UDUC 2EOTA 3A7AB 3F2CA 1O7YA 2NBFA 5AJ3Q 2E2JH 2RSOA 1C9OA 2PW7A 1CK1A 1YITA 5T1GA 1IYJB 3DM1A 5GADC 1PA6A 4IALA 3I8ZA 1R9TH 4A3CG 1HUNA 1GM5A 1LTSD 2K04A 2D2CC 2Z6KC 2ZTCA 5IY0A 1G2SA 5IP7H 1KAAA 5EQ0A 4C3IH 3S16B 1EZ6A 2KVMA 2QILA 3FMCA 5AJ3L 4HTHA 4GKKQ 3G6EA 4RH6A 1OXVA 3H91A 1B3QA 4Y7NH 3QR8A 2QDLA 3BJUA 1KDAA 5LL6S 2Q2TA 5EPJA 3TRZA 3JC66 4BBSG 2NVYB 3S1RB 1QUQB 2K5DA 1LYLA 2PNRC 2QW7A 4L63B 1S5DD 4WJWA 3T51B 3CCMA 4GKKL 2L11A 1B44D 5HY6A 5C5LA 1DGSA 2R93H 5M9OA 3A5ZB 1EOVA 4KHZA 4HSPA 2MUYA 2ZJPA 1Z7TA 1I4GA 2B2VA 3K6OA 4DR4Q 5JVG3 4A3IG 3S1MH 2B63H 1U0LA 4K2KA 2WACA 5LL6X 4KJOA 4FXDA 4ME3A 3PIOA 4CKEA 1CKNB 3RLFA 3SHLA 3RZDH 4OWTB 1TIID 1G91A 3W3AA 2HDLA 3HKZG 2HDMA 2KCCA 1JJCB 1ZKOA 2GVBA 1EY8A 5A2QL 3EBEA 3PIPA 5IGBA 4XXEA 2VB3X 4KY6A 5EBDA 5FLXL 1EYCA 1ICWA 3QOLA 1VQHA 4IFDJ 4EQ5A 3SVMA 1K8OA 1NBWA 3AU7A 3D3RA 4CDEC 1XMQL 3HG9A 1S5ED 2L5TA 3DM3A 1W3SA 2XNAC 1XXGA 3MA2B 1WOCA 3CQZH 3SE0A 1G6ZA 2UXCQ 1TWCB 3A0JA 2XN9C 4LF7L 1YNJC 1Y1VG 1YNJD 1K8MA 5FLMG 1SEBD 4L5QA 4X62Q 2DNCA 4OWXB 1EQVA 2D0OA 1LTLA 1LUZA 1SAPA 4YCVA 3M3YB 4J6HA 5M3FH 5C3WA 2ATWA 3HZXA 5EGTA 1GKHA 2NUCA 1Q1BA 3FKIG 3A8JE 4NXMQ 1LTTD 1H9SA 3ZYYX 5CBAE 1NMFA 2VXWA 2UXCL 3FDTA 3HKSA 3I4NB 1AE3A 2R7DA 1EY7A 4MTKA 1JC7A 2Z9HA 4X62L 5D3IB 4UY8C 4QY7A 3FVQA 4UP7A 1I3QH 3PO3B 2TMPA 2DJGC 1Q82C 2KCTA 4PMWA 4B9XA 3JAME 4DV4Q 3KF6B 4A3LG 4Q5VA 3NK9A 2ZXOA 2WAQG 3GTKB 3S2HH 3HOZH 4YCUA 4M8AA 5M5WH 1N9WA 2MGSA 1Q1EA 1STYA 1E2VA 1GVPA 1TU2B 1B8AA 3WOEA 4QF4A 5I2YA 1S5BD 5C44H 1K83H 2EYMA 4A76A 1CZGA 2F0NA 4DV4L 2KEDA 1HH2P 2WP8J 3S17H 1JOOA 4MHEA 2CCZA 1Q3LA 3HOYB 1G51A 5C3XA 2YU9H 2NTTA 2WB1G 3CHBD 3DWQA 2F0TA 2Y0SB 4R8IA 1VDZA 1JWSD 5KYIA 1RF2D 3H0GH 2B3GA 2MJ8A 2ZJQA 3N52A 4X66Q 3TP7A 3MHBA 3I56A 3R93A 1XPOA 4L5TA 3SGIA 3MFGA 4ME5A 1S5FD 5CV6A 2EJFC 4N8X1 4J15A 2QF7A 1TWFH 3E5SA 5J3BA 2OT2A 5LHY1 3Q0AA 1EQQA 1T5EA 4PG3A 1Q12A 2PNHA 1B2TA 3NELA 1TWGB 4DR5Q 4X66L 3HOWH 1H9KA 1VQMA 4C3JH 3UDGA 3NBIA 2KEEA 3GTPH 1SJHD 3KDFB 4GLXA 2CH4W 3M9BA 2NVXH 2IL8A 5COYA 4DK0A 5IP9H 4DR3Q 3J7A5 2DY7A 2NVQH 1D7QA 5EAYA 2OXPA 5BN3A 3P20A 1PH2A 4G7HC 4DK1A 4OO1G 4CJ2C 5M3MG 4A3GG 1VQNA 1IL2A 3H09A 4YCWA 2E2IH 2JE6I 2IY5B 3EA6A 1BBUA 3L7ZC 4DPGA 5ELNA 4WFN3 2I07B 1Q8KA 3ZJYC 1R4PB 4IFDI 2BA0A 2K01A 1TQOA 4C2MB 1CHPD 2J0TD 1QILA 1UE1A 3EJIA 3H6MA 2ZTEA 4XQQA 4A3FH 2NVYH 5CV7A 2ICIA 2EVBA 3HOXB 1DCZA 2I0QA 4DNTB 1AH9A 1FNUA 2AWOA 5I6YA 1STNA 1TY2A 3D4DA 4DXGA 1TT2A 1WD0A 3GTOB 2EPBA 1JJGA 1EWHA 1VQGA 3EFXD 3VR4A 1AE2A 1TS3A 4NP5A 3J81E 4F8MA 2L9HA 4L5RC 2BA1A 5DM73 4CGYB 1HXYD 4GKJL 4JI2L 3C1FA 2I5LX 2JA5H 4BBRG 3JAML 2Y0SG 4O1NA 3J80c 4V0BA 2K05A 1EFID 3Q23A 4IPHA 2K52A 5FO7B 1WTRA 2IX0A 1I4QA 2CWAA 3GTJH 4XT3B 1WYDA 4P74A 3U58A 2JP1A 1BOSA 2MNAA 4C3HH 3K80C 2R7ZB 1VS0A 1AP0A 4BWGB 2JN4A 1HZAA 4EQOA 3IFTA 2UUBL 4OO1I 1HQMC 5CV9A 4JI6Q 3Q6SA 2B2TC 3FRPB 4FO2A 2RCFA 2Z4IA 1Q8IA 3I70A 3OIQA 1TWCH 3GD7A 4DV1L 1WFQA 4DNIA 4IOCA 1SRUA 3SK5A 2O2LD 3M4PA 4QB4A 3GTLB 3M7NA 2RQXA 2K6AA 1F9SA 2PQEA 1X65A 3DUZA 1BVSA 1ZYRC 5CMDA 1DZ1A 2L4NA 5I9PA 2N8NA 3PIP3 4X3UA 1ZYRD 4QGUA 3BZCA 4JI6L 1N36Q 2EY2A 1OO9B 1SFOB 2XWJB 1OTCA 1DONA 2E2JB 1Z47A 3IKJA 3W2DA 1GXDC 3OW7A 4FXGC 3I4NH 4RHSA 4LNQA 4BS9A 3NTKA 2NN6G 1KNEA 1VQ4A 1R9TB 3A74A 4IJHA 4KHPL 4NW2A 1XMOQ 3PO3H 3PCOB 5JEAG 3AEVA 4ZAIA 2EDGA 1HTLD 4G7ZC 4C3IB 4XYOA 1N36L 5J22A 3GTKH 1KRSA 2JA6B 4B3SQ 4BY7H 4IJLA 5C0XJ 4IUNA 3HFZB 1F9RA 4DK3C 1B70B 1L1OB 4G4KA 1LT6D 2ZXRA 1O7ZA 1VQDA 4PZ7A 4Y7NB 1KTKA 1Q7YC 4HMJA 1CSQA 1G6PA 3K5MA 1XMOL 1NY4A 1VQFA 1X3QA 1PTOC 4JCVE 1HZ9A 4R4TA 5G3LD 1PTOD 2MO0A 4P72A 1HZCA 1PH1A 1UUPA 4B3SL 2Q2IA 3VYRA 1O7IA 4CHTB 1QE6A 3J7YW 3A54A 1BBWA 1PZKD 1YNNC 3QG1A 2R93B 3L2PA 4IURA 1WCMB 1L0XB 1YNND 1N32Q 1K8AC 1Q46A 4GNXA 1RL2A 3K58A 1ILPA 1UE5A 5ELDA 4PZ6A 2YTYA 3PUXA 3S1MB 2DY8A 3D31A 3DWAA 1ENCA 3K59A 1XNQQ 1WI5A 3NQIA 1QB5D 4LF4Q 2F3WA 2JEBI 4B3RL 3Q24A 4P73A 3DEOA 5CR3A 5I9OA 3IL8A 1PMRA 4NKLA 2L55A 1X6OA 1PZID 1EIHA 1PRTC 3J81L 2VL6A 1TWGH 3I73A 4MNOA 4PV1C 4YWLA 2K5VA 1N32L 3KF8A 2I5HA 1E7ZA 3KOJA 1RTNA 2B2YC 3H3VI 2XSCA 1PYBA 1XNQL 1WTHA 4OGQC 4LF4L 5KEEA 1GJXA 1QNKA 2R92B 4MTNA 1MGSA 2EXDA 1K73C 1X56A 1IBKL 2FHTA 1VQCA 4OIKA 3T1HQ 4BY1H 3CQZB 4ZUJA 1JR0D 3L0OA 1BF4A 2VQEL 1NTGA 3EIVA 2NZOA 2JXMB 1JJ2A 2Y0SE 2EQSA 3NSWA 4OEMB 3V05A 1MSGA 2CQOA 2KUMA 3GO5A 1YHBA 4DV7Q 1STEA 1KD1C 1J8IA 1YJWA 1KLGD 5JJZA 3S14H 2XWBB 3TP5A 1V9PA 2EJMA 4C2MH 1WTPA 3OPOA 5IP7G 5CV5A 4C3IG 4MZ9A 4GZYC 2F0EA 4A3BH 2K1BA 3ERSX 1MIUA 4DUYQ 3HOXH 5EBCA 4LF8Q 1AEXA 3MZ5A 3CXCA 4QIWE 3CKIB 1ENAA 5C4XH 4JBKA 1LTRD 1LT4D 1SNOA 2IT1A 3MC0B 2A68C 4KV6A 3S1NH 3F8TA 4ZLTF 1BCPC 2TSSA 1YEZA 3HOZB 1Q90A 1HA6A 5M5WB 1QWYA 3VDYA 1BCPD 1LTGD 1NAPA 3T53B 4NDXA 4PMCA 3T4AC 2AQ2B 4ZYSA 4GOPC 2RCNA 3VR2A 5A2QE 3OIPA 1JB3A 1SMXA 2Z1CA 3UDFA 4A4IA 5CGKA 2A6HC 5C44B 1K83B 1KLUD 1B4OA 1QOHA 4ILWA 4DUYL 2A6HD 2VY3A 2PMZB 1UNSA 4DU9A 2K5NA 5FLXE 2R93G 4XT1B 1E1OA 1SLJA 1T5XD 2BOSA 3P7JA 4XYQA 2YU9B 4ULLA 4A3KB 3D6WA 1RTOA 1GOZA 2B63G 2K28A 5C0XI 3H0GB 2F3IA 4QUFA 1YJ9A 3R2IA 3FP9A 4KHVA 1XJVA 2LFNA 5HGTA 2R7ZH 1I94L 4LFAL 3S9WA 4JI4L 1V1QA 2KOLA 4K6LA 5A35A 3TBIB 2VUMH 3RLOA 2IPKD 2DGYA 2JK8A 4ZUIA 2DNEA 1PH6A 4IPCA 4KD3A 1K3BC 1KHIA 2EYHA 4DV3Q 3KFUA 1ESFA 3GTLH 3TREA 3PF5A 3LWEA 4ZK9B 3HOWB 2K32A 2CHBD 1XWEA 1ICFB 4C3JB 1FR3A 2WIIB 3CF5A 1PFBA 4WJ4A 4YWMA 3GTPB 2ZTDA 4LMQD 1VQAA 3LNNA 1PH4A 1JOKA 2G5DA 3PUYA 4WRDA 3NWTA 1PXUA 2NVXB 3PUVA 4DK6C 4F7XA 4F88A 1SFOH 1CQFA 2NVQB 1H9SB 1Y1WB 4DV3L 1JE5A 1P8LA 2EZVA 3MWYW 5M3FG 3NP8A 4FXKC 4HJ9A 3DWPA 4YHHQ 3C3LA 3G4SA 2X6LA 1VQBA 2E2IB 1S5CD 3BZDB 4R8NA 4LK1C 1EU3A 1S72A 1S3OA 2D5DA 2UU9L 2JA6H 3K0YA 3A5UA 2C35B 4HJAA 2AKWB 1N8RC 1U4RA 5GAEC 3HRZC 2KCNA 1B50A 4OELB 1TWAB 3X3NA 5K5PA 1A6XA 5IGCA 3O13A 4DR1L 3EVQA 1SYBA 4RMFA 5BN4A 4YHHL 4A3FB 3VR6A 3E9IA 3SK4A 5M5YB 4ALPA 3U9OA 3HOZG 2JA7H 1H95A 4JBWA 2K14A 4A3MG 5KNBA 1VQLA 3JAMi 5FK9C 4KKTA 1X3GA 1IYUA 2K03A 1A62A 5C44G 1HTPA 1WCMH 1NR4A 4EQPA 4JG2A 4V190 3KLRA 1HNWQ 2OCEA 4HIMA 4X3KA 2WV6D 5CC4A 4KKUA 2JA5B 4HMIA 1O7LA 1UEAB 3OW2A 3GDEA 1D5ZC 2N78A 2NVTB 1LV9A 4RCNA 4K0KL 1XMQQ 4ID6A 4RCOA 2PZTA 4N9PA 2K7VA 2KQ3A 3NPPA 1V1OA 2HCIA 1LTBD 3GTJB 4LF7Q 3CC2A 4RGTA 5NUCA 2D0PA 3I90A 3A55A 3KK7A 1HNWL 5EKIA 4C3HB 2F0JA 4ZCKA 3RNUA 4A3EH 1I4PA 2UUAQ 2Q8TA 2R92H 3I4MB 4PMBA 1MJCA 4OHJA 1NJIC 2F4IA 4QL5A 4C3JG 5I6WA 4B3TL 2WKDA 1SE3A 1VQEA 4IUUA 1OXUA 3PQIA 1STHA 4DNRB 1C4QA 1E2ZA 1B7YB 5IP9G 1DM0B 3KLSA 1BUVT 4DGZA 2UUAL 2AUKA 1XTDA 1DD2A 3NBHA 1H9RA 3RMHA 3KBXA 1F9QA 1FNVA 5BN5A 5E1FA 4KJNA 4LF9Q 3HS0C 4LF6L 1W6KA 2PI2E 1VQ5A 4LF5Q 1VMPA 1EEFD 2HHHL 2QKIC 5JAVA 2LXKA 1VF7A 3CCJA 3BG3A 1GUNA 1TXYA 1MBYA 2SNMA 2F0KA 2QDBA 2FMCA 2NZ1D 3ULJA 2PPBC 4IQZA 3CCUA 4UAIA 1NR2A 4KMUC 3ND9A 2XIWA 4LF9L 1A2UA 4LAAA 4LF5L 1QVFA 4BY7B 3AFPA 2QGQA 4A3FG 4DV6L 4DAVA 1PDQA 1MD2D 1ILQA 3GV3A 4FYDA 2C9OA 1NMGA 5KGUA 5C4HA 2B8GA 4IFDG 3KUPA 4X65Q 5FKAC 5T1IA 2HUGA 2Z6KA 3TN2A 1IL8A 1V1PA 3EQLC 4AQYL 3UE0A 3R3OA 4A3KH 5D3DA 4IUTA 2JA9A 1JB7A 2F52A 2JA5G 5DNFA 1RD9D 3R8BA 3TS2A 3J81i 2CVRA 1SR3A 1GUSA 4HCSA 5C5MA 4ABNA 4JI7L 3M4OH 4X65L 1B53A 1TWHB 3AYHB 1HCZA 2MO1A 4CJ0B 4DXFA 4DV0Q 1ZEQX 3U9SA 1CA6A 1SYCA 3TP8A 3D4RA 4C3HG 1YHAA 1YIJA 1SE4A 3R2TA 2B39A 2BDNA 2AQ1B 4C56C 3TZDA 4KI0A 2MQHA 4QIWB 1EWIA 2PQAA 1N34Q 5IOCA 1SBBB 5L37A 4DV0L 1EOTA 1UAPA 3OYYA 1VF5C 4H02A 2R3ZA 1JWMD 1GUWA 2K5QA 1Y1WH 1PZJD 2B2WC 2LXJA 5E3FA 5BR8Q 3H3VC 2PMZE 4FF4A 2Z0SA 5IODA 3IFDA 4BY1B 4K14A 1CT1D 2Q2UA 1AFPA 3GP7A 1KL9A 1HFGA 1RHPA 3VA7A 4NMZA 3CP0A 2VNUD 3A8KE 1I5FA 3SDZA 1N34L 1A2TA 3U4VA 3I4NG 4IUVA 3SK6A 3K8AA 4OIJA 1L0YB 4JOIC 1HZBA 5BR8L 3BVZA 3S14B 3DLLA 2RDHA 1TWAH 5LMNW 3PO3G 4DN4M 1LTID 2I46A 4A3DB 4JI1Q 5M5YH 4GKJQ 5C3EB 1LM0A 4JI2Q 4BY7G 1D1IA 4KN4C 3E3XA 2IX1A 1IW7C 2ASBA 4A3BB 5C4JH 5LMNQ 2F3VA 5FJ8H 1KABA 1IW7D 4B3MQ 3MEHA 1GUOA 1BQQT 1E0BA 1PVOA 5C4XB 1RCVD 4IOAA 3G71A 1EY5A 1M90C 2EYJA 3DMUA 3S1NB 2K33A 4A3LH 3I55A 4L5SA 3UDIA 2OTJA 1STGA 3LX0A 1XNRQ 4GNXB 4JI1L 3HOYG 5IYBH 1FD7D 1C7YA 1BDOA 1D1KA 3Q22A 2NWGA 5FOBB 5LMNL 3A8IE 4RGMA 4H0LC 1FNWA 4B3ML 3P1HA 5JPMC 3PV0A 2UUBQ 4K6DA 2NVTH 1CZWA 2VQFQ 1JORA 2ID0A 4LFCL 2XRQD 4L8JA 2OQKA 1VQKA 2KENA 1VQ6A 4FF1A 3HOVB 1M1KC 3STBC 4DV1Q 1J9OA 2NYZD 1XNRL 3QOJA 3KF8B 3T56B 3STBD 4TKOB 3GTQH 4DR6L 2O5JC 4KY5A 1IKMA 2F0FA 2H4OA 1B1ZA 2LKVA 3I4MH 3IRBA 1VQ9A 2VUMB 1II3A 1OXXK 4U68A 4H7BA 2RHQB 2SOBA 2VQFL 2ES2A 1B9MA 2SNSA 4HIKA 4JI8L 2EYOA 1F2ZA 5G3LF 3E0EA 2Z4HA 3CC4A 1PTOF 1SYFA 1ESRA 3PO2H 2PW5A 2RA4A 1TR5A 4DUZL 3H15A 1I4RA 3L9AX 4KHPQ 2PCFB 3TDQA 2OQ0A 3LGJA 2AQ3B 3SK8A 3TQYA 4QUCA 2EYLA 1QNUA 3CCQA 1PH8A 3D4WA 4BXXH 2JA8B 2A73B 2AHOB 3AFQA 4X3TA 4Z9CB 1A3TA 4CDFC 4I7ZC 1EY6A 4A3JH 3KLSX 1HNXL 2Q2HA 3PUWA 1AN8A 3K7AH 3CPFA 3PUZA 2UXBQ 1PH9A 1L1OC 3BU2A 5KYLA 1Y69U 4Q0FA 4GN3B 1EY0A 2MPMA 3MAQA 4IPGA 5K36H 2Z6BA 1K0RA 4RG1A 3ND8A 3OTOQ 4IUQA 1NE3A 4A3BG 2L12A 4GN4B 3HOXG 4A93H 4IZ8A 1WTXA 3S15B 3RN2A 4CBVA 4R9WA 1K28A 2UXBL 1OXTA 2F0HA 2UUCL 4R4IA 3BDOA 2JA7B 2ZXPA 4YIJA 3CCSA 4B3RQ 1VQ7A 2E74C 2X6GA 3OTOL 1VCIA 2KJXA 1U9RA 3M7GA 1GUTA 4I7AA 1XPUA 2RSNA 1I6HH 1XPRA 1HA5A 1FVIA 4GS3A 2GN5A 1N33L 2KHSA 4RAUC 4JBMA 2XRSD 2DN8A 1TWHH 2FXQA 5IYCH 1NNXA 1STBA 3CW2C 1GD7A 2A74C 2L15A 2IHFA 1PTOB 3F2DA 4ZKBB 1IBKQ 2R7ZG 1JT8A 5JJKA 2RKSA 2K4KA 1PRTD 1SE8A 2VUMG 2VQEQ 1S4ZA 2JJQA 5GROA 2KA7A 3S2DB 1GHKA 3JAMc 4A3EB 1L0WA 1JCKB 1BCPF 5C0XG 5KNCA 2JEAI 3SXHA 1Y14B 4JVZA 5ISRA 2F0UA 5GAHC 5ELEA 2K50A 1D2BA 5I2XA 1WJJA 1ASZA 3URYA 5J1ZA 1MSHA 2E2DC 2IW3A 1FL0A 1T9HA 4DR7Q 3MXPA 2SEBD 1X54A 5M5XH 2YTXA 1Y8PB 4G7OC 1SE2A 2GA4B 1IBML 2EY6A 1C8CA 1JWUD 3H94A 1G2TA 2B2TA 5CORA 1PLFA 1A3VA 1BKBA 4L6TB 4DR7L 1X3PA 3MXNA 4A3DH 1A0IA 4K2LA 2JA6G 4K8IA 2HIVA 5C3EH 4JW0A 3T1YQ 1EU4A 4DA2A 1E22A 4HAEA 2NN6H 4KD4A 1PFNA 1EUJA 2A6EC 2A8VA 1ENFA 4HJ8A 1EZ8A 2A6ED 3BVMA 2B2VC 4UPAA 2A68D 4X64Q 3UE1A 1BNZA 4DF7A 2BDOA 1A3UA 2JA7G 5FO8B 1SNDA 3HGBA 2L0CA 4GLAC 1ET6A 4EGVA 1I4HA 5JOBA 4LFAQ 3D0FA 3T1YL 1CI3M 1I94Q 4JI4Q 2PZWA 1X3EA 1Y8NB 4B08A 1RJTA 1D6EC 3FEWX 1WCMG 3DXJC 4HJ5A 4DAYA 4BBSB 2KHJA 1D8LA 4X64L 3HOVH 2K5WA 3IAYA 1PFSA 1M8AA 3WWVA 1SN8A 4UP8A 2PYKA 4FVMA 3T16A 3BYYB 4POGA 1ZXTA 4EQNA 2F0IA 4N8FA 1YBYA 1V8QA 4NPSA 1LABA 3M4OB 5IYDH 2I5MX 3BDCA 4A3IB 2CKZB 3QIAA 4ZKCB 5TSSA 3NWSA 1LT5D 2JSOA 3HP3A 4DR2Q 3EROA 4JI0L 1K0SA 4QJFA 3G7LA 3ERQA 1XYIA 2HQEA 1HJPA 1H9MA 1PH5A 2G9HD 2R92G 1LACA 2EYFA 2F0PA 2R61A 1Q86C 4LWCA 3WOFA 2X69A 1ML0D 1EYGA 3NBHB 2ICEC 4OONA 1EQTA 2UU9Q 3NTHA 4DR2L 5IE8A 4JV5Q 2JA8H 1Z6HA 3W1GA 3QWNA 1PYWD 3J81c 4AIMA 3CCRA 1YJNA 5E4XA 4TSSA 3K0XA 1SXTA 3RZOH 4DR1Q 1DXMA 4OX9Q 3J80E 1CUKA 2B2YA 1NSNS 2WKCA 3OWFA 2D62A 4JV5L 3V96A 4I65A 4MIUA 3S1QB 3NXWA 1YVCA 1EY4A 5IT9c 3E6ZX 4LJZC 2HD3A 3KJOA 3FKIB 3NHHA 1CQVA 4H13C 3OMCA 1HHVA 3CU7A 3S15H 2Q8IB 4OXPA 1X3FA 2LS01 1E1TA 5KNDA 3A7LA 1KDBA 4OX9L 1CKOA 2F0WA 4DKAC 4WORA 3CCEA 1J5EQ 1MI2A 2E2HH 5C4JB 3ICEA 3VYTA 1EY9A 4UP9A 3OSOA 1V1PB 2IX3A 1WVLA 3RN5A 1F2MA 2F4VQ 4JPBW 2RBMA 2QEXA 2F03A 1LT3D 4LFBQ 4K0KQ 3J7AV 2F0SA 1B9NA 1X32A 1EQRA 3K81C 2RDGA 2WAQB 3PGZA 4AYBB 4QQBX 1K9MC 2RF4A 1K8GA 4XIGS 4XTCS 1J5EL 4A3KG 2F0LA 4B9WA 2DJFC 3CCVA 2HQLA 1CFMA 3H0GG 1EIGA 1PTOH 2F4VL 5J39A 4LFBL 4CKBA 1K3RA 2BH8A 3D6CA 4QMGA 4APVA 1JICA 2JYOA 5FO9B 4B3TQ 2AUJD 3B6YA 3BDLA 1E3PA 1PH7A 2WB1B 4KKSA 1BO0A 2J4XA 2SDFA 3GTQB 1YZ6A 3MTSA 3VA5A 3S2DH 4GOPA 1W2BA 2AWNA 1F2LA 2EY5A 2XVSA 5GQOA 4FP5D 3T13A 2PQAB 3HOUH 3RD4A 1DJRD 1LTAD 3HOWG 4LF6Q 4K5XA 1I6VC 4RKLA 5GAGC 1S40A 1RKNA 2A1AA 2HHHQ 2CWPA 4DR4L 2Z8LA 3CRKC 1XTCD 3PO2B 1UEBA 3MEFA 4RFBA 3BS1A 1KIXA 3F2UA 3E9HA 1Y1WG 1TY0A 3CMAA 1I50B 4GN5A 4O2DA 1DOMA 3C2PA 5IGEA 2B2UC 3I91A 3BYTB 3K57A 1CM9A 1GUGA 2F0QA 1QZHA 1MJEA 1SNMA 1B3AA 1XX8A 4O42A 4DV6Q 4KK7A 4IUPA 2YV5A 2EJGC 3OWEB 4A3JB 5C4ZA 1SYDA 3I4LA 2XTIA 3K7AB 1PFMA 4A3CH 3NQTA 1VQOA 2BE5C 5M3MB 1D5XC 1V43A 4RKBA 4A3GB 1EYAA 2BE5D 4AQYQ 4IO9A 1YNXA 1LO5D 2IJ0A 4XQJA 2OEOA 2WINB 4X3SA 3I72A 3I4OA 2O4XA 4P75A 5FJ8G 4BA2I 4A93B 2ENBA 4ODGA 2O5IC 5EKKA 4HR7B 4J1MA 3J80L 5HURA 1F9PA 1L2FA 4JI7Q 2R7FA 4C1NK 4NXML 4R4OA 2Q8RE 4BBSH 4AYBG 3P75A 2JQOA 1EYDA 4A3MH 2EY1A 3MXGA 5IYBG 1I6HB 1QJOA 4N9TA 1AZQA 1QUQA 2ALYB 3K5NA 1WD1A 1DOLA 4HIOA 5H1SE 5EPKA 3F1ZA 4A3IH 4K5WA 5DAUA 4BBRB 1HPCA 4CDCC 1NCVA 3UDXA 1F77A 4WJ3M 3TEHB 2CW0C 3BVGA 3L3OC 3Q8DA 3I4MG 4O0AA 2CW0D 1Z9FA 1RIPA 5IGGA 2F0MA 1TS5A 4R4QA 4LUZA 2NTSA 2L1BA 1CKNA 3GTGH 3J7AF 1HQRD 1CKMA 4JI5Q 4JBJA 3PO2G 2KBNA 2IHEA 4IPDA 1HNZQ 2FFKB 1SSOA 2OWOA 3TZUA 3V2TA 5DM63 1X55A 4U673 3C46A 4DAMA 4Y52H 4RGOS 1BXTA 2MP1A 5M5XB 1Y1VH 4BXXG 1UWVA 5FLXc 5FLMH 4FDBA 1KAWA 4EVOA 4JI5L 2IWHA 1WTQA 2ZM6Q 4DFAA 3S1QH 1ASYA 3TMEA 1A15A 1SYGA 5D14A 3MVVA 4A3JG 2NB0A 4DR5L 1HNZL 1GO3E 1EFWA 3FKIH 4HSVA 3VYSA 3K5OA 3CPWA 4C1NI 1FJGQ 1SNCA 3G48A 2BH2A 5IWAQ 2A5HA 3QB3A 4LW1A 3FHWA 1DYQA 1VQPA 1KQSA 1EEID 1H9JA 5K36G 3S16H 4AH6A 4DR3L 3U50C 4FF3A 2F0OA 5CV8A 2VB2X 3QO2A 4HJ7A 5JJIA 4YWKA 2ZM6L 3HKZE 3MXUA 1IBLQ 3GTMB 3FPUB 4GNXC 1G291 4A93G 2FINB 4LFCQ 5ELCA 1LLRD 1QG7A 1WTOA 1FJGL 3UI2A 4JYAQ 5IWAL 2B2UA 1VQJA 4XQNA 4DR6Q 3S1RH 3WDNA 3J7ZC 4PNYA 3BZKA 3KF6A 3RR5A 3ULPA 5E7NA 1CSPA 3CD6A 3S24A 3KBGA 4UHVA 4IFDH 1IBLL 4RA8A 1SYEA 1KNAA 2M00A 2ZT9C 4JI8Q 1FGUA 3CCLA 3OHXC 2ZJRA 4JYAL 1QVGA 1MHWC 1E24A 1C48A 3VR3A 5CBEE 5IYCG 5KRUA 1SJED 2EE1A 2N55A 1DOKA 4DUZQ 5JEAJ 1U4LA 3N6RA 4YY3Q 1TS2A 4P2CB 3J81j 2XGTA 2D9UA 4LUOA 3VR5A 5IT9E 2OTLA 2F1MA 2HCCA 1JE4A 1UE7A 2K5HA 3C1EA 4QCLA 3ITPA 2G9DA 2HT1A 5JJLA 1W6JA 1HNXQ 2F0GA 3K7UC 2M9VA 4DV2Q 4LUVA 1STAA 1U4MA 2WAQE 4E6IA 5HGQA 1KXLA 4YY3L 5DEHA 4AYBE 1TVXA 1P16A 2UXDQ 4BY1G 2YYZA 3TP6A 1I50H 4K8JA 3I3CA 3I7FA 3PIO3 2PO4A 1SNPA 1EIFA 1FYCA 3CC7A 1NUCA 5ELOA 2CFMA 4HIDA 1SDFA 1U4PA 3RZOB 5IIFA 3M4YA 1SMYC 1E2WA 3KDFA 3MXNB 1R4QB 5JPNC 3M3YH 4DV2L 2KCMA 1SMYD 4OO1H 2UUCQ 5M3MH 2UXDL 4A3GH 2FJ2A 2WB1E 1VQ8A 1PRTF 1VQIA 3ER0A 2N88A 1KDCA 1RODA 4A3DG 1RDPD 4ZRZA 2VS1A 2EIFA 2RVLA 5C3EG 3X3MA 4HEDA 4X6AH 1IKLA 1U5KA 1SROA 2B2WA 3W5OA 4KY7A 1N33Q 2EYPA 3I2ZA 2J7ZA 5C4XG 3D8GA 2N3SA 3LWUA 2E2HB 3NTIA 3AQQA 2E5LQ 3U4ZA 2E8GA 3SEBA 4DAYB 4NXNQ 4JC0A 1ET9A 4DV5Q 3M85A 4TQUS 4HCEA 4JOIA 2K75A 3PSIA 5D65A 1VMCA 4A75A 4IN3A 2R6GA 1A63A 2VZAA 2AMCB 3KLWA 1OXSC 1IZ6A 2VW9A 2A19A 2C5CA 3AB9A 1EIYB 3NENA 3HOYH 3HOVG 2KHIA 3DEPA 4NXNL 2E5LL 2P5ZX 4KTAA 5C6AA 4BBRH 4KN7C 4DV5L 2YTVA 1M4VA 1X9NA 2E75C 2CQAA 4NB3A 4BA1I 1D5MC 1O78A 2GVAA 3CAMA 3OOCA 3TS0A 4KLKA 5IYDG 5LMUQ 2RHSB 4K5VA 1UE6A 2B63B 2MFIA 4M1UB 1AZPA 5KIXA 2BCOA 2QA4A
chains in the Genus database with same CATH topology
1CTMA 2QEJC 4RWSC 2FMMA 3PMFA 3RZDB 3HOUB 3TSSA 1WTWA 1CHQD 5E4WC 1O80A 1BBXC 5IGDA 1SNQA 1PRTB 2LMCB 1QCBD 1CA5A 3K5LA 2NN6I 3RUZA 3SR1A 2LY7A 4F87A 5IT9L 1JQYD 1FGBD 4JK1C 4CJ1B 2MHVA 4FNFA 4HN7A 4DAPA 1G8ZD 1Y8OB 4PQXA 5M3FB 1TS4A 2F0VA 1TKWB 2M2LA 3FPPA 2PZUA 3NUCA 5JEAH 5JVH3 3OMGA 4H44C 2KECA 5CV4A 2QCPX 5EKLA 4S3SA 3CRLC 3AMUA 1F2YA 2B8FA 1JOQA 1I3QB 1HFNA 5ELFA 2V4DA 4CKCA 1ONLA 5IGFA 3E0JA 3S2HB 1EWCA 1IYVA 3DHQA 4A3MB 4MN3A 1I4XA 4ZQ3A 3VYUA 3ONAB 4J8QA 1BCPB 2OF1A 3G6JB 1BR9A 2A69C 2A69D 5ELBA 1HUMA 2RDFA 3S17B 1WTVA 3NE5B 5F2DA 2F0DA 5EPLA 1GHJA 3GV6A 4OL7A 5AFWA 2EXZA 5EJWA 5I4DA 5CYUA 3HKZB 3HEJA 4G57A 2H1EA 1AW7A 3A56A 4FF2A 3MFYA 1TWFB 4TRDA 3GTGB 1EL0A 5C0XH 3GQBA 4RGNA 1HRJA 4XDXA 1IHZA 2E76C 4RHRA 3QJYA 1Y1VB 4UDUC 2EOTA 3A7AB 1O7YA 2NBFA 2RSOA 2PW7A 1CK1A 5T1GA 3DM1A 4IALA 3I8ZA 1HUNA 1LTSD 2K04A 2D2CC 1G2SA 1KAAA 5EQ0A 3S16B 1EZ6A 2KVMA 2QILA 3FMCA 4HTHA 4RH6A 1OXVA 3H91A 1KDAA 5LL6S 5EPJA 2NVYB 3S1RB 2K5DA 2PNRC 4L63B 1S5DD 4WJWA 3T51B 2L11A 1B44D 5C5LA 5M9OA 4KHZA 4HSPA 2MUYA 1Z7TA 1I4GA 2B2VA 3K6OA 5JVG3 4K2KA 2WACA 5LL6X 4KJOA 4FXDA 4CKEA 3RLFA 3SHLA 1TIID 1G91A 3W3AA 2HDLA 2HDMA 2KCCA 1ZKOA 1EY8A 5A2QL 5IGBA 4XXEA 2VB3X 4KY6A 5EBDA 5FLXL 1EYCA 1ICWA 3QOLA 4IFDJ 3SVMA 1K8OA 3AU7A 3D3RA 3HG9A 1S5ED 2L5TA 2XNAC 1XXGA 3MA2B 1G6ZA 3SE0A 1TWCB 2XN9C 1YNJC 1YNJD 1K8MA 1SEBD 2DNCA 1EQVA 1SAPA 3M3YB 4J6HA 5C3WA 3HZXA 5EGTA 1Q1BA 2NUCA 3A8JE 1LTTD 1H9SA 3ZYYX 5CBAE 2VXWA 3FDTA 3I4NB 1EY7A 1JC7A 5D3IB 3FVQA 3PO3B 2TMPA 4B9XA 4PMWA 3JAME 4Q5VA 3NK9A 2ZXOA 3GTKB 4M8AA 2MGSA 1Q1EA 1STYA 1E2VA 1TU2B 3WOEA 4QF4A 5I2YA 1S5BD 2EYMA 1CZGA 2F0NA 2KEDA 2WP8J 1JOOA 4MHEA 1Q3LA 3HOYB 5C3XA 2NTTA 3CHBD 3DWQA 2F0TA 2Y0SB 4R8IA 1VDZA 1JWSD 5KYIA 1RF2D 2MJ8A 3N52A 3TP7A 3MHBA 3R93A 3MFGA 4ME5A 1S5FD 5CV6A 2EJFC 2QF7A 3E5SA 2OT2A 5LHY1 3Q0AA 1T5EA 1Q12A 1B2TA 1TWGB 1H9KA 3NBIA 2KEEA 1SJHD 2IL8A 5COYA 4DK0A 2DY7A 2OXPA 5BN3A 3P20A 4G7HC 4DK1A 4OO1G 4CJ2C 3H09A 2JE6I 3EA6A 3L7ZC 4WFN3 2I07B 1R4PB 4IFDI 2BA0A 2K01A 1TQOA 4C2MB 1CHPD 2J0TD 1QILA 3EJIA 3H6MA 4XQQA 5CV7A 2ICIA 2EVBA 3HOXB 1DCZA 4DNTB 1FNUA 2AWOA 5I6YA 1STNA 1TY2A 3D4DA 4DXGA 1TT2A 1WD0A 3GTOB 2EPBA 1EWHA 3EFXD 3VR4A 1TS3A 4NP5A 3J81E 4F8MA 2L9HA 2BA1A 5DM73 4CGYB 1HXYD 3C1FA 3JAML 4O1NA 4V0BA 2K05A 1EFID 3Q23A 5FO7B 1WTRA 2IX0A 1I4QA 4XT3B 2JP1A 1BOSA 2R7ZB 1AP0A 4BWGB 4EQOA 3IFTA 4OO1I 1HQMC 5CV9A 3Q6SA 2B2TC 3FRPB 4FO2A 2Z4IA 1Q8IA 3I70A 3OIQA 3GD7A 3SK5A 2O2LD 4QB4A 3GTLB 3M7NA 2RQXA 2K6AA 1F9SA 2PQEA 3DUZA 1ZYRC 1DZ1A 5CMDA 2L4NA 5I9PA 3PIP3 4X3UA 1ZYRD 2EY2A 1OO9B 1SFOB 2XWJB 1DONA 2E2JB 1Z47A 3IKJA 3W2DA 1GXDC 3OW7A 4FXGC 4RHSA 4BS9A 3NTKA 2NN6G 1KNEA 1R9TB 4NW2A 5JEAG 4ZAIA 2EDGA 1HTLD 4G7ZC 4C3IB 4XYOA 5J22A 2JA6B 5C0XJ 4IUNA 1F9RA 4G4KA 1LT6D 2ZXRA 1O7ZA 4Y7NB 1KTKA 4HMJA 3K5MA 1X3QA 1PTOC 5G3LD 1PTOD 1UUPA 3VYRA 4CHTB 1QE6A 3J7YW 3A54A 1PZKD 1YNNC 3QG1A 2R93B 4IURA 1WCMB 1L0XB 1YNND 3K58A 1ILPA 5ELDA 3PUXA 3S1MB 2DY8A 3D31A 3DWAA 1ENCA 3K59A 1QB5D 3NQIA 2F3WA 2JEBI 3Q24A 3DEOA 5CR3A 5I9OA 3IL8A 1PMRA 4NKLA 2L55A 1PZID 1EIHA 1PRTC 3J81L 3I73A 4PV1C 3KF8A 1RTNA 2B2YC 2XSCA 4OGQC 5KEEA 1GJXA 1QNKA 2R92B 1MGSA 2FHTA 4OIKA 3CQZB 4ZUJA 1JR0D 1BF4A 2JXMB 3NSWA 3V05A 1MSGA 3GO5A 2KUMA 1STEA 1J8IA 1KLGD 5JJZA 2XWBB 3TP5A 2EJMA 1WTPA 3OPOA 5CV5A 4C3IG 4GZYC 2F0EA 2K1BA 5EBCA 1AEXA 3MZ5A 3CKIB 1ENAA 1LTRD 1LT4D 1SNOA 2IT1A 3MC0B 2A68C 4KV6A 4ZLTF 1BCPC 2TSSA 3HOZB 1Q90A 1HA6A 5M5WB 1QWYA 1BCPD 1LTGD 1NAPA 3T53B 4NDXA 4PMCA 3T4AC 2AQ2B 4ZYSA 3VR2A 5A2QE 3OIPA 1JB3A 2Z1CA 5CGKA 2A6HC 5C44B 1K83B 1KLUD 1B4OA 1QOHA 4ILWA 2A6HD 2PMZB 1UNSA 4DU9A 5FLXE 4XT1B 1T5XD 2BOSA 3P7JA 4XYQA 2YU9B 4ULLA 4A3KB 3D6WA 1RTOA 1GOZA 2K28A 5C0XI 3H0GB 4QUFA 3R2IA 4KHVA 2LFNA 5HGTA 3S9WA 2KOLA 4K6LA 5A35A 3TBIB 2IPKD 4ZUIA 2DNEA 4KD3A 2EYHA 1ESFA 3LWEA 4ZK9B 3HOWB 2K32A 2CHBD 1XWEA 4C3JB 1FR3A 2WIIB 1PFBA 3GTPB 4LMQD 3LNNA 1JOKA 3PUYA 4WRDA 3NWTA 1PXUA 2NVXB 3PUVA 4F7XA 4F88A 1CQFA 2NVQB 1H9SB 1Y1WB 2EZVA 3MWYW 3NP8A 4FXKC 3DWPA 3C3LA 2X6LA 2E2IB 1S5CD 3BZDB 4R8NA 4LK1C 1EU3A 2D5DA 3K0YA 1U4RA 3HRZC 2KCNA 1B50A 1TWAB 3X3NA 5K5PA 1A6XA 5IGCA 3O13A 3EVQA 1SYBA 5BN4A 4A3FB 3VR6A 3SK4A 5M5YB 3U9OA 4JBWA 5KNBA 5FK9C 4KKTA 1IYUA 2K03A 1HTPA 4EQPA 1NR4A 4V190 3KLRA 4X3KA 2WV6D 5CC4A 4KKUA 2JA5B 4HMIA 1O7LA 1UEAB 1D5ZC 2NVTB 1LV9A 4RCNA 4ID6A 4RCOA 2PZTA 4N9PA 2K7VA 2KQ3A 3NPPA 1V1OA 2HCIA 1LTBD 3GTJB 4RGTA 5NUCA 3I90A 3A55A 3KK7A 5EKIA 4C3HB 2F0JA 1I4PA 2Q8TA 3I4MB 4PMBA 4OHJA 2F4IA 4C3JG 5I6WA 2WKDA 1SE3A 4IUUA 1OXUA 1STHA 4DNRB 1C4QA 1E2ZA 1DM0B 3KLSA 1BUVT 4DGZA 2AUKA 1DD2A 3NBHA 1H9RA 3RMHA 3KBXA 1F9QA 1FNVA 5BN5A 5E1FA 4KJNA 3HS0C 1W6KA 1VMPA 1EEFD 2QKIC 5JAVA 1VF7A 3BG3A 1GUNA 1MBYA 2SNMA 2F0KA 2QDBA 2FMCA 2NZ1D 2PPBC 4IQZA 4UAIA 1NR2A 4KMUC 3ND9A 2XIWA 1A2UA 4LAAA 4BY7B 4DAVA 1PDQA 1MD2D 1ILQA 3GV3A 4FYDA 2C9OA 5KGUA 5C4HA 2B8GA 4IFDG 3KUPA 5FKAC 5T1IA 2HUGA 3TN2A 1IL8A 1V1PA 3EQLC 3R3OA 5D3DA 4IUTA 5DNFA 1RD9D 3R8BA 2CVRA 1GUSA 4HCSA 5C5MA 4ABNA 1B53A 1TWHB 1HCZA 4CJ0B 4DXFA 1ZEQX 3U9SA 1CA6A 1SYCA 3TP8A 3D4RA 4C3HG 1SE4A 3R2TA 2B39A 2BDNA 2AQ1B 4C56C 3TZDA 4KI0A 4QIWB 5IOCA 1SBBB 1EOTA 1UAPA 1VF5C 2R3ZA 1JWMD 1GUWA 2K5QA 1PZJD 2B2WC 5E3FA 3H3VC 4FF4A 5IODA 3IFDA 4BY1B 4K14A 1CT1D 1AFPA 3GP7A 1RHPA 1HFGA 3VA7A 4NMZA 2VNUD 3A8KE 3SDZA 1A2TA 4IUVA 3SK6A 4OIJA 1L0YB 3BVZA 3S14B 2RDHA 4DN4M 1LTID 2I46A 4A3DB 5C3EB 1D1IA 4KN4C 2IX1A 1IW7C 4A3BB 2F3VA 1KABA 1IW7D 3MEHA 1GUOA 1BQQT 1E0BA 5C4XB 1RCVD 1EY5A 3S1NB 2EYJA 3DMUA 2K33A 1STGA 3LX0A 1FD7D 1BDOA 1D1KA 3Q22A 2NWGA 5FOBB 3A8IE 4RGMA 4H0LC 1FNWA 3P1HA 5JPMC 3PV0A 4K6DA 1CZWA 1JORA 2ID0A 2XRQD 4L8JA 4FF1A 3HOVB 1J9OA 2NYZD 3QOJA 3T56B 4TKOB 2O5JC 4KY5A 1IKMA 2F0FA 2H4OA 1B1ZA 2LKVA 2VUMB 1II3A 1OXXK 4U68A 4H7BA 2SOBA 1B9MA 2SNSA 2EYOA 1F2ZA 5G3LF 2Z4HA 1PTOF 1SYFA 1ESRA 2PW5A 2RA4A 1TR5A 1I4RA 3L9AX 2PCFB 3TDQA 2AQ3B 3SK8A 4QUCA 2EYLA 1QNUA 3D4WA 2JA8B 2A73B 4X3TA 4Z9CB 1A3TA 4I7ZC 1EY6A 3KLSX 3PUWA 1AN8A 3PUZA 5KYLA 1Y69U 4Q0FA 1EY0A 2MPMA 3MAQA 5K36H 3ND8A 4IUQA 2L12A 4IZ8A 1WTXA 3S15B 4CBVA 4R9WA 1OXTA 2F0HA 3BDOA 2JA7B 2ZXPA 4YIJA 2E74C 2X6GA 1VCIA 2KJXA 1U9RA 3M7GA 1GUTA 2RSNA 1HA5A 2KHSA 4RAUC 2XRSD 2DN8A 1STBA 2A74C 1PTOB 4ZKBB 2RKSA 1PRTD 1S4ZA 2KA7A 3S2DB 1GHKA 4A3EB 1JCKB 1BCPF 5C0XG 5KNCA 2JEAI 3SXHA 5ISRA 2F0UA 5ELEA 1D2BA 5I2XA 3URYA 5J1ZA 1MSHA 2E2DC 2IW3A 3MXPA 2SEBD 1Y8PB 4G7OC 1SE2A 2GA4B 2EY6A 1C8CA 1JWUD 3H94A 1G2TA 2B2TA 5CORA 1PLFA 1A3VA 4L6TB 1X3PA 3MXNA 4K2LA 4K8IA 1EU4A 4DA2A 4HAEA 2NN6H 4KD4A 1PFNA 2A6EC 1ENFA 1EZ8A 2A6ED 3BVMA 2B2VC 2A68D 1BNZA 4DF7A 2BDOA 1A3UA 5FO8B 1SNDA 3HGBA 2L0CA 1ET6A 4EGVA 1I4HA 5JOBA 1CI3M 2PZWA 1Y8NB 4B08A 1RJTA 1D6EC 3FEWX 3DXJC 4DAYA 4BBSB 2K5WA 3IAYA 1M8AA 2PYKA 4FVMA 3T16A 3BYYB 1ZXTA 4EQNA 2F0IA 1V8QA 1LABA 3M4OB 3BDCA 4A3IB 3QIAA 4ZKCB 5TSSA 3NWSA 1LT5D 2JSOA 3HP3A 3EROA 3G7LA 3ERQA 1XYIA 2HQEA 1H9MA 2G9HD 1LACA 2EYFA 2F0PA 2R61A 3WOFA 2X69A 1ML0D 2ICEC 1EQTA 3NTHA 1Z6HA 3QWNA 1PYWD 5E4XA 4TSSA 1SXTA 1DXMA 3J80E 2B2YA 1NSNS 2WKCA 3OWFA 2D62A 3V96A 4I65A 4MIUA 3S1QB 3NXWA 1EY4A 3E6ZX 4LJZC 3FKIB 3NHHA 1CQVA 4H13C 3OMCA 1HHVA 3CU7A 2Q8IB 2LS01 5KNDA 3A7LA 1KDBA 2F0WA 4WORA 1MI2A 5C4JB 3VYTA 1EY9A 3OSOA 1V1PB 2IX3A 1WVLA 1F2MA 2RBMA 2F03A 1LT3D 3J7AV 2F0SA 1B9NA 1X32A 2RDGA 2WAQB 4AYBB 4XIGS 4XTCS 2F0LA 4B9WA 1CFMA 1EIGA 1PTOH 5J39A 4CKBA 3D6CA 4QMGA 1JICA 2JYOA 5FO9B 2AUJD 3BDLA 4KKSA 2WB1B 1BO0A 2J4XA 2SDFA 3GTQB 3MTSA 3VA5A 2AWNA 1F2LA 2EY5A 2XVSA 4FP5D 3T13A 3RD4A 1DJRD 1LTAD 4K5XA 1I6VC 4RKLA 1RKNA 2Z8LA 3CRKC 1XTCD 3PO2B 4RFBA 3BS1A 3F2UA 1TY0A 1I50B 1DOMA 3C2PA 5IGEA 2B2UC 3I91A 3BYTB 3K57A 1CM9A 1GUGA 2F0QA 1SNMA 1B3AA 1XX8A 4O42A 4KK7A 4IUPA 2EJGC 3OWEB 4A3JB 5C4ZA 1SYDA 3I4LA 3K7AB 1PFMA 3NQTA 2BE5C 5M3MB 1D5XC 1V43A 4RKBA 4A3GB 1EYAA 2BE5D 4XQJA 1LO5D 2IJ0A 2OEOA 4X3SA 2WINB 3I72A 2O4XA 4BA2I 4A93B 2ENBA 4ODGA 2O5IC 5EKKA 4HR7B 4J1MA 3J80L 5HURA 1F9PA 4C1NK 2Q8RE 3P75A 1EYDA 2EY1A 3MXGA 1I6HB 1QJOA 4N9TA 1AZQA 3K5NA 1WD1A 1DOLA 5EPKA 4K5WA 5DAUA 4BBRB 1HPCA 1NCVA 1F77A 2CW0C 3BVGA 3L3OC 2CW0D 5IGGA 2F0MA 1TS5A 2NTSA 2L1BA 3J7AF 1HQRD 2FFKB 1SSOA 3TZUA 3V2TA 5DM63 4U673 3C46A 4RGOS 1BXTA 2MP1A 5M5XB 4EVOA 2IWHA 1WTQA 4DFAA 3TMEA 1SYGA 1A15A 5D14A 3MVVA 2NB0A 4HSVA 3VYSA 3K5OA 4C1NI 1SNCA 2A5HA 3QB3A 1DYQA 1EEID 1H9JA 5K36G 4FF3A 2F0OA 5CV8A 2VB2X 3QO2A 3MXUA 3GTMB 3FPUB 1G291 2FINB 5ELCA 1LLRD 1QG7A 1WTOA 3UI2A 2B2UA 4XQNA 3WDNA 4PNYA 3KBGA 4IFDH 4RA8A 1SYEA 1KNAA 2M00A 2ZT9C 3OHXC 1C48A 3VR3A 5CBEE 5KRUA 1SJED 2EE1A 2N55A 1DOKA 5JEAJ 1U4LA 3N6RA 1TS2A 4P2CB 2D9UA 3VR5A 5IT9E 2F1MA 2HCCA 1JE4A 3C1EA 4QCLA 3ITPA 2G9DA 1W6JA 2F0GA 2M9VA 1STAA 1U4MA 4E6IA 5DEHA 1TVXA 2YYZA 3TP6A 4K8JA 3I3CA 3PIO3 2PO4A 1SNPA 1FYCA 1NUCA 1SDFA 1U4PA 3RZOB 5IIFA 3M4YA 1SMYC 1E2WA 1R4QB 5JPNC 1SMYD 4OO1H 2FJ2A 1PRTF 2N88A 1KDCA 1RODA 1RDPD 4ZRZA 2RVLA 3X3MA 4HEDA 1IKLA 2B2WA 4KY7A 2EYPA 2J7ZA 3D8GA 3LWUA 2E2HB 3NTIA 3SEBA 1ET9A 3M85A 4TQUS 4HCEA 5D65A 1VMCA 4IN3A 2R6GA 1OXSC 2C5CA 3AB9A 3DEPA 4KTAA 5C6AA 4KN7C 1M4VA 2E75C 2CQAA 4BA1I 1D5MC 1O78A 3OOCA 4K5VA 2B63B 4M1UB 1AZPA 5KIXA 2BCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA1 A;  1CTM A;  3VR6 A;  3T53 B;  1VDZ A;  1Y69 U;  3H94 A;  3TZU A;  3VR2 A;  1DXM A;  4JBW A;  3RLF A;  5KNB A;  1YNN C;  4KN4 C;  3W3A A;  2YYZ A;  3QG1 A;  5K36 H;  4KKT A;  1IW7 C;  2A6H C;  1GUG A;  3ND8 A;  2D62 A;  2KCC A;  1IYU A;  1IW7 D;  2A6H D;  1ZKO A;  3MFY A;  1GUO A;  2LMC B;  1FYC A;  2EJF C;  1HTP A;  2B8G A;  2EJG C;  2QF7 A;  2NN6 H;  4IFD G;  3PUX A;  3I4L A;  2K33 A;  1T5E A;  3D31 A;  2A6E C;  4LJZ C;  5C0X H;  3KLR A;  3EQL C;  1Q12 A;  2NN6 I;  3GQB A;  1OXT A;  1SMY C;  1E2W A;  2BE5 C;  2A6E D;  1V43 A;  3M4Y A;  2JEB I;  3BDO A;  2Q8I B;  4KKU A;  2BE5 D;  2A68 D;  5KND A;  4OO1 H;  1K8O A;  3A7L A;  1PMR A;  1O7L A;  2BDO A;  4JK1 C;  1H9K A;  1BDO A;  3PUZ A;  2E74 C;  2L5T A;  3IFT A;  3I73 A;  4PV1 C;  3HGB A;  2E76 C;  3A8I E;  1VCI A;  1HQM C;  1H9J A;  3QJY A;  3I72 A;  4H0L C;  4RCN A;  3SE0 A;  5A35 A;  5K36 G;  1GUS A;  3A7A B;  1GUT A;  1CI3 M;  3PV0 A;  1YNJ C;  1Y8N B;  2K7V A;  4BA2 I;  3GD7 A;  1B9N A;  1K8M A;  4DK0 A;  1Y8O B;  2O5I C;  4HR7 B;  2DNC A;  3MXU A;  4L8J A;  3DXJ C;  2DNE A;  4OGQ C;  1G29 1;  3M7N A;  1HCZ A;  1TKW B;  3FPP A;  5JEA H;  2DN8 A;  1GJX A;  3T56 B;  3U9S A;  1ZYR C;  3P20 A;  4H13 C;  4H44 C;  5BN3 A;  4TKO B;  4G7H C;  3D4R A;  4XIG S;  4XTC S;  2D2C C;  1Q1B A;  2K32 A;  3A8J E;  2O5J C;  4DK1 A;  3LWU A;  1FR3 A;  4OO1 G;  1H9S A;  1CFM A;  3CRL C;  3WDN A;  3LNN A;  4KI0 A;  2B8F A;  3FMC A;  2JE6 I;  3PUY A;  1OXX K;  1QJO A;  3M85 A;  4TQU S;  1V8Q A;  3L7Z C;  2JXM B;  3IKJ A;  1B9M A;  1LAB A;  1OXU A;  3PUV A;  2V4D A;  3OW7 A;  4DNR B;  4IFD H;  1ONL A;  1E2Z A;  1OXV A;  2AUJ D;  3QIA A;  2R6G A;  1H9S B;  2ZT9 C;  2KA7 A;  4KKS A;  2NN6 G;  1VF5 C;  1GHK A;  1IYV A;  1OXS C;  2BA0 A;  5C0X G;  5KNC A;  5JEA G;  2AUK A;  3AB9 A;  2JEA I;  1DD2 A;  1HPC A;  1H9R A;  3VR3 A;  5BN5 A;  2EDG A;  1H9M A;  2PCF B;  4G7Z C;  2EJM A;  2PNR C;  1Q1E A;  1LAC A;  4KN7 C;  3OPO A;  3T51 B;  1E2V A;  2A69 C;  2CW0 C;  1VF7 A;  3N6R A;  4LK1 C;  1TU2 B;  2EVB A;  3VA7 A;  1I6V C;  3BG3 A;  1GUN A;  2E75 C;  2D5D A;  2A69 D;  1DCZ A;  4BA1 I;  1O78 A;  4DNT B;  4GZY C;  2AWO A;  3OOC A;  3A8K E;  3SDZ A;  3VR5 A;  2F1M A;  3CRK C;  3NE5 B;  1EWH A;  4KHZ A;  1Z6H A;  2PPB C;  4I7Z C;  4IQZ A;  3VR4 A;  1Y8P B;  4G7O C;  1A6X A;  1Z7T A;  2IT1 A;  2A68 C;  4KMU C;  3ND9 A;  3PUW A;  5BN4 A;  1Q90 A;  1GHJ A; 
#chains in the Genus database with same CATH topology
 1CTM A;  2QEJ C;  4RWS C;  2FMM A;  3PMF A;  3RZD B;  3HOU B;  3TSS A;  1IBM Q;  1WTW A;  1CHQ D;  5E4W C;  1O80 A;  1BBX C;  5IGD A;  5LMU L;  1QZG A;  1SNQ A;  1PRT B;  2LMC B;  2H5X A;  1HR0 W;  1QCB D;  1CA5 A;  2JA8 G;  3NEM A;  3K5L A;  1MKH A;  2NN6 I;  3RUZ A;  1IXR A;  3SR1 A;  2LY7 A;  4F87 A;  5IT9 L;  3M4Q A;  1JQY D;  1J6Q A;  1FGB D;  1HR0 Q;  4JK1 C;  4CJ1 B;  2MHV A;  2V1C C;  4FNF A;  4HN7 A;  5DLQ E;  3H3V H;  4R4C A;  3PF4 A;  4DAP A;  1C0A A;  1G8Z D;  1Y8O B;  4PQX A;  5M3F B;  1TS4 A;  2B29 A;  3RLN A;  2F0V A;  4P71 A;  1TKW B;  2M2L A;  3W1B A;  3FPP A;  2PZU A;  3NUC A;  3J80 i;  5JEA H;  5JVH 3;  1Q81 C;  3GTM H;  3OMG A;  4H44 C;  3ULL A;  2KEC A;  1YI2 A;  3T1H L;  1HR0 L;  5CV4 A;  1PYS B;  1PHJ A;  2QCP X;  5EKL A;  2NZH A;  4R1J A;  4S3S A;  3CRL C;  3AMU A;  1F2Y A;  2B8F A;  1JOQ A;  1QVC A;  1I3Q B;  3F2B A;  1HFN A;  5ELF A;  1PV4 A;  2V4D A;  4CKC A;  4DV7 L;  1ONL A;  5IGF A;  3E0J A;  3GTO H;  3S2H B;  1EWC A;  1IYV A;  4PZ8 A;  1L1O A;  4JI3 Q;  3DHQ A;  4GLV B;  4TVA B;  4A3M B;  4JI0 Q;  4MN3 A;  1I4X A;  4ZQ3 A;  3VYU A;  1YHQ A;  3ONA B;  4J8Q A;  4EX5 A;  4POF A;  1BCP B;  2OF1 A;  3G6J B;  1BR9 A;  2A69 C;  4OWW B;  2A69 D;  5ELB A;  4LF8 L;  1HUM A;  2RDF A;  4GOP B;  1JMC A;  2WFW A;  3S17 B;  2CH4 A;  1WTV A;  3NE5 B;  2DUD A;  5F2D A;  2F0D A;  3EN2 A;  5EPL A;  4JI3 L;  1PH3 A;  1GHJ A;  3GV6 A;  4OL7 A;  5AFW A;  4A3E G;  2EXZ A;  5EJW A;  5I4D A;  2PI2 A;  5CYU A;  3HKZ B;  3HEJ A;  3KJP A;  3HOU G;  4G57 A;  2HIX A;  2H1E A;  1AW7 A;  3A56 A;  4FF2 A;  3MFY A;  1TWF B;  4TRD A;  3GTG B;  1KRT A;  1EL0 A;  5C0X H;  2N49 A;  3KYH C;  1A8V A;  3GQB A;  4CDD C;  4RGN A;  1HRJ A;  4XDX A;  1KC8 C;  2LSS A;  1IHZ A;  2E76 C;  4RHR A;  3QJY A;  3CME A;  1Y1V B;  4UDU C;  2EOT A;  3A7A B;  3F2C A;  1O7Y A;  2NBF A;  5AJ3 Q;  2E2J H;  2RSO A;  1C9O A;  2PW7 A;  1CK1 A;  1YIT A;  5T1G A;  1IYJ B;  3DM1 A;  5GAD C;  1PA6 A;  4IAL A;  3I8Z A;  1R9T H;  4A3C G;  1HUN A;  1GM5 A;  1LTS D;  2K04 A;  2D2C C;  2Z6K C;  2ZTC A;  5IY0 A;  1G2S A;  5IP7 H;  1KAA A;  5EQ0 A;  4C3I H;  3S16 B;  1EZ6 A;  2KVM A;  2QIL A;  3FMC A;  5AJ3 L;  4HTH A;  4GKK Q;  3G6E A;  4RH6 A;  1OXV A;  3H91 A;  1B3Q A;  4Y7N H;  3QR8 A;  2QDL A;  3BJU A;  1KDA A;  5LL6 S;  2Q2T A;  5EPJ A;  3TRZ A;  3JC6 6;  4BBS G;  2NVY B;  3S1R B;  1QUQ B;  2K5D A;  1LYL A;  2PNR C;  2QW7 A;  4L63 B;  1S5D D;  4WJW A;  3T51 B;  3CCM A;  4GKK L;  2L11 A;  1B44 D;  5HY6 A;  5C5L A;  1DGS A;  2R93 H;  5M9O A;  3A5Z B;  1EOV A;  4KHZ A;  4HSP A;  2MUY A;  2ZJP A;  1Z7T A;  1I4G A;  2B2V A;  3K6O A;  4DR4 Q;  5JVG 3;  4A3I G;  3S1M H;  2B63 H;  1U0L A;  4K2K A;  2WAC A;  5LL6 X;  4KJO A;  4FXD A;  4ME3 A;  3PIO A;  4CKE A;  1CKN B;  3RLF A;  3SHL A;  3RZD H;  4OWT B;  1TII D;  1G91 A;  3W3A A;  2HDL A;  3HKZ G;  2HDM A;  2KCC A;  1JJC B;  1ZKO A;  2GVB A;  1EY8 A;  5A2Q L;  3EBE A;  3PIP A;  5IGB A;  4XXE A;  2VB3 X;  4KY6 A;  5EBD A;  5FLX L;  1EYC A;  1ICW A;  3QOL A;  1VQH A;  4IFD J;  4EQ5 A;  3SVM A;  1K8O A;  1NBW A;  3AU7 A;  3D3R A;  4CDE C;  1XMQ L;  3HG9 A;  1S5E D;  2L5T A;  3DM3 A;  1W3S A;  2XNA C;  1XXG A;  3MA2 B;  1WOC A;  3CQZ H;  3SE0 A;  1G6Z A;  2UXC Q;  1TWC B;  3A0J A;  2XN9 C;  4LF7 L;  1YNJ C;  1Y1V G;  1YNJ D;  1K8M A;  5FLM G;  1SEB D;  4L5Q A;  4X62 Q;  2DNC A;  4OWX B;  1EQV A;  2D0O A;  1LTL A;  1LUZ A;  1SAP A;  4YCV A;  3M3Y B;  4J6H A;  5M3F H;  5C3W A;  2ATW A;  3HZX A;  5EGT A;  1GKH A;  2NUC A;  1Q1B A;  3FKI G;  3A8J E;  4NXM Q;  1LTT D;  1H9S A;  3ZYY X;  5CBA E;  1NMF A;  2VXW A;  2UXC L;  3FDT A;  3HKS A;  3I4N B;  1AE3 A;  2R7D A;  1EY7 A;  4MTK A;  1JC7 A;  2Z9H A;  4X62 L;  5D3I B;  4UY8 C;  4QY7 A;  3FVQ A;  4UP7 A;  1I3Q H;  3PO3 B;  2TMP A;  2DJG C;  1Q82 C;  2KCT A;  4PMW A;  4B9X A;  3JAM E;  4DV4 Q;  3KF6 B;  4A3L G;  4Q5V A;  3NK9 A;  2ZXO A;  2WAQ G;  3GTK B;  3S2H H;  3HOZ H;  4YCU A;  4M8A A;  5M5W H;  1N9W A;  2MGS A;  1Q1E A;  1STY A;  1E2V A;  1GVP A;  1TU2 B;  1B8A A;  3WOE A;  4QF4 A;  5I2Y A;  1S5B D;  5C44 H;  1K83 H;  2EYM A;  4A76 A;  1CZG A;  2F0N A;  4DV4 L;  2KED A;  1HH2 P;  2WP8 J;  3S17 H;  1JOO A;  4MHE A;  2CCZ A;  1Q3L A;  3HOY B;  1G51 A;  5C3X A;  2YU9 H;  2NTT A;  2WB1 G;  3CHB D;  3DWQ A;  2F0T A;  2Y0S B;  4R8I A;  1VDZ A;  1JWS D;  5KYI A;  1RF2 D;  3H0G H;  2B3G A;  2MJ8 A;  2ZJQ A;  3N52 A;  4X66 Q;  3TP7 A;  3MHB A;  3I56 A;  3R93 A;  1XPO A;  4L5T A;  3SGI A;  3MFG A;  4ME5 A;  1S5F D;  5CV6 A;  2EJF C;  4N8X 1;  4J15 A;  2QF7 A;  1TWF H;  3E5S A;  5J3B A;  2OT2 A;  5LHY 1;  3Q0A A;  1EQQ A;  1T5E A;  4PG3 A;  1Q12 A;  2PNH A;  1B2T A;  3NEL A;  1TWG B;  4DR5 Q;  4X66 L;  3HOW H;  1H9K A;  1VQM A;  4C3J H;  3UDG A;  3NBI A;  2KEE A;  3GTP H;  1SJH D;  3KDF B;  4GLX A;  2CH4 W;  3M9B A;  2NVX H;  2IL8 A;  5COY A;  4DK0 A;  5IP9 H;  4DR3 Q;  3J7A 5;  2DY7 A;  2NVQ H;  1D7Q A;  5EAY A;  2OXP A;  5BN3 A;  3P20 A;  1PH2 A;  4G7H C;  4DK1 A;  4OO1 G;  4CJ2 C;  5M3M G;  4A3G G;  1VQN A;  1IL2 A;  3H09 A;  4YCW A;  2E2I H;  2JE6 I;  2IY5 B;  3EA6 A;  1BBU A;  3L7Z C;  4DPG A;  5ELN A;  4WFN 3;  2I07 B;  1Q8K A;  3ZJY C;  1R4P B;  4IFD I;  2BA0 A;  2K01 A;  1TQO A;  4C2M B;  1CHP D;  2J0T D;  1QIL A;  1UE1 A;  3EJI A;  3H6M A;  2ZTE A;  4XQQ A;  4A3F H;  2NVY H;  5CV7 A;  2ICI A;  2EVB A;  3HOX B;  1DCZ A;  2I0Q A;  4DNT B;  1AH9 A;  1FNU A;  2AWO A;  5I6Y A;  1STN A;  1TY2 A;  3D4D A;  4DXG A;  1TT2 A;  1WD0 A;  3GTO B;  2EPB A;  1JJG A;  1EWH A;  1VQG A;  3EFX D;  3VR4 A;  1AE2 A;  1TS3 A;  4NP5 A;  3J81 E;  4F8M A;  2L9H A;  4L5R C;  2BA1 A;  5DM7 3;  4CGY B;  1HXY D;  4GKJ L;  4JI2 L;  3C1F A;  2I5L X;  2JA5 H;  4BBR G;  3JAM L;  2Y0S G;  4O1N A;  3J80 c;  4V0B A;  2K05 A;  1EFI D;  3Q23 A;  4IPH A;  2K52 A;  5FO7 B;  1WTR A;  2IX0 A;  1I4Q A;  2CWA A;  3GTJ H;  4XT3 B;  1WYD A;  4P74 A;  3U58 A;  2JP1 A;  1BOS A;  2MNA A;  4C3H H;  3K80 C;  2R7Z B;  1VS0 A;  1AP0 A;  4BWG B;  2JN4 A;  1HZA A;  4EQO A;  3IFT A;  2UUB L;  4OO1 I;  1HQM C;  5CV9 A;  4JI6 Q;  3Q6S A;  2B2T C;  3FRP B;  4FO2 A;  2RCF A;  2Z4I A;  1Q8I A;  3I70 A;  3OIQ A;  1TWC H;  3GD7 A;  4DV1 L;  1WFQ A;  4DNI A;  4IOC A;  1SRU A;  3SK5 A;  2O2L D;  3M4P A;  4QB4 A;  3GTL B;  3M7N A;  2RQX A;  2K6A A;  1F9S A;  2PQE A;  1X65 A;  3DUZ A;  1BVS A;  1ZYR C;  5CMD A;  1DZ1 A;  2L4N A;  5I9P A;  2N8N A;  3PIP 3;  4X3U A;  1ZYR D;  4QGU A;  3BZC A;  4JI6 L;  1N36 Q;  2EY2 A;  1OO9 B;  1SFO B;  2XWJ B;  1OTC A;  1DON A;  2E2J B;  1Z47 A;  3IKJ A;  3W2D A;  1GXD C;  3OW7 A;  4FXG C;  3I4N H;  4RHS A;  4LNQ A;  4BS9 A;  3NTK A;  2NN6 G;  1KNE A;  1VQ4 A;  1R9T B;  3A74 A;  4IJH A;  4KHP L;  4NW2 A;  1XMO Q;  3PO3 H;  3PCO B;  5JEA G;  3AEV A;  4ZAI A;  2EDG A;  1HTL D;  4G7Z C;  4C3I B;  4XYO A;  1N36 L;  5J22 A;  3GTK H;  1KRS A;  2JA6 B;  4B3S Q;  4BY7 H;  4IJL A;  5C0X J;  4IUN A;  3HFZ B;  1F9R A;  4DK3 C;  1B70 B;  1L1O B;  4G4K A;  1LT6 D;  2ZXR A;  1O7Z A;  1VQD A;  4PZ7 A;  4Y7N B;  1KTK A;  1Q7Y C;  4HMJ A;  1CSQ A;  1G6P A;  3K5M A;  1XMO L;  1NY4 A;  1VQF A;  1X3Q A;  1PTO C;  4JCV E;  1HZ9 A;  4R4T A;  5G3L D;  1PTO D;  2MO0 A;  4P72 A;  1HZC A;  1PH1 A;  1UUP A;  4B3S L;  2Q2I A;  3VYR A;  1O7I A;  4CHT B;  1QE6 A;  3J7Y W;  3A54 A;  1BBW A;  1PZK D;  1YNN C;  3QG1 A;  2R93 B;  3L2P A;  4IUR A;  1WCM B;  1L0X B;  1YNN D;  1N32 Q;  1K8A C;  1Q46 A;  4GNX A;  1RL2 A;  3K58 A;  1ILP A;  1UE5 A;  5ELD A;  4PZ6 A;  2YTY A;  3PUX A;  3S1M B;  2DY8 A;  3D31 A;  3DWA A;  1ENC A;  3K59 A;  1XNQ Q;  1WI5 A;  3NQI A;  1QB5 D;  4LF4 Q;  2F3W A;  2JEB I;  4B3R L;  3Q24 A;  4P73 A;  3DEO A;  5CR3 A;  5I9O A;  3IL8 A;  1PMR A;  4NKL A;  2L55 A;  1X6O A;  1PZI D;  1EIH A;  1PRT C;  3J81 L;  2VL6 A;  1TWG H;  3I73 A;  4MNO A;  4PV1 C;  4YWL A;  2K5V A;  1N32 L;  3KF8 A;  2I5H A;  1E7Z A;  3KOJ A;  1RTN A;  2B2Y C;  3H3V I;  2XSC A;  1PYB A;  1XNQ L;  1WTH A;  4OGQ C;  4LF4 L;  5KEE A;  1GJX A;  1QNK A;  2R92 B;  4MTN A;  1MGS A;  2EXD A;  1K73 C;  1X56 A;  1IBK L;  2FHT A;  1VQC A;  4OIK A;  3T1H Q;  4BY1 H;  3CQZ B;  4ZUJ A;  1JR0 D;  3L0O A;  1BF4 A;  2VQE L;  1NTG A;  3EIV A;  2NZO A;  2JXM B;  1JJ2 A;  2Y0S E;  2EQS A;  3NSW A;  4OEM B;  3V05 A;  1MSG A;  2CQO A;  2KUM A;  3GO5 A;  1YHB A;  4DV7 Q;  1STE A;  1KD1 C;  1J8I A;  1YJW A;  1KLG D;  5JJZ A;  3S14 H;  2XWB B;  3TP5 A;  1V9P A;  2EJM A;  4C2M H;  1WTP A;  3OPO A;  5IP7 G;  5CV5 A;  4C3I G;  4MZ9 A;  4GZY C;  2F0E A;  4A3B H;  2K1B A;  3ERS X;  1MIU A;  4DUY Q;  3HOX H;  5EBC A;  4LF8 Q;  1AEX A;  3MZ5 A;  3CXC A;  4QIW E;  3CKI B;  1ENA A;  5C4X H;  4JBK A;  1LTR D;  1LT4 D;  1SNO A;  2IT1 A;  3MC0 B;  2A68 C;  4KV6 A;  3S1N H;  3F8T A;  4ZLT F;  1BCP C;  2TSS A;  1YEZ A;  3HOZ B;  1Q90 A;  1HA6 A;  5M5W B;  1QWY A;  3VDY A;  1BCP D;  1LTG D;  1NAP A;  3T53 B;  4NDX A;  4PMC A;  3T4A C;  2AQ2 B;  4ZYS A;  4GOP C;  2RCN A;  3VR2 A;  5A2Q E;  3OIP A;  1JB3 A;  1SMX A;  2Z1C A;  3UDF A;  4A4I A;  5CGK A;  2A6H C;  5C44 B;  1K83 B;  1KLU D;  1B4O A;  1QOH A;  4ILW A;  4DUY L;  2A6H D;  2VY3 A;  2PMZ B;  1UNS A;  4DU9 A;  2K5N A;  5FLX E;  2R93 G;  4XT1 B;  1E1O A;  1SLJ A;  1T5X D;  2BOS A;  3P7J A;  4XYQ A;  2YU9 B;  4ULL A;  4A3K B;  3D6W A;  1RTO A;  1GOZ A;  2B63 G;  2K28 A;  5C0X I;  3H0G B;  2F3I A;  4QUF A;  1YJ9 A;  3R2I A;  3FP9 A;  4KHV A;  1XJV A;  2LFN A;  5HGT A;  2R7Z H;  1I94 L;  4LFA L;  3S9W A;  4JI4 L;  1V1Q A;  2KOL A;  4K6L A;  5A35 A;  3TBI B;  2VUM H;  3RLO A;  2IPK D;  2DGY A;  2JK8 A;  4ZUI A;  2DNE A;  1PH6 A;  4IPC A;  4KD3 A;  1K3B C;  1KHI A;  2EYH A;  4DV3 Q;  3KFU A;  1ESF A;  3GTL H;  3TRE A;  3PF5 A;  3LWE A;  4ZK9 B;  3HOW B;  2K32 A;  2CHB D;  1XWE A;  1ICF B;  4C3J B;  1FR3 A;  2WII B;  3CF5 A;  1PFB A;  4WJ4 A;  4YWM A;  3GTP B;  2ZTD A;  4LMQ D;  1VQA A;  3LNN A;  1PH4 A;  1JOK A;  2G5D A;  3PUY A;  4WRD A;  3NWT A;  1PXU A;  2NVX B;  3PUV A;  4DK6 C;  4F7X A;  4F88 A;  1SFO H;  1CQF A;  2NVQ B;  1H9S B;  1Y1W B;  4DV3 L;  1JE5 A;  1P8L A;  2EZV A;  3MWY W;  5M3F G;  3NP8 A;  4FXK C;  4HJ9 A;  3DWP A;  4YHH Q;  3C3L A;  3G4S A;  2X6L A;  1VQB A;  2E2I B;  1S5C D;  3BZD B;  4R8N A;  4LK1 C;  1EU3 A;  1S72 A;  1S3O A;  2D5D A;  2UU9 L;  2JA6 H;  3K0Y A;  3A5U A;  2C35 B;  4HJA A;  2AKW B;  1N8R C;  1U4R A;  5GAE C;  3HRZ C;  2KCN A;  1B50 A;  4OEL B;  1TWA B;  3X3N A;  5K5P A;  1A6X A;  5IGC A;  3O13 A;  4DR1 L;  3EVQ A;  1SYB A;  4RMF A;  5BN4 A;  4YHH L;  4A3F B;  3VR6 A;  3E9I A;  3SK4 A;  5M5Y B;  4ALP A;  3U9O A;  3HOZ G;  2JA7 H;  1H95 A;  4JBW A;  2K14 A;  4A3M G;  5KNB A;  1VQL A;  3JAM i;  5FK9 C;  4KKT A;  1X3G A;  1IYU A;  2K03 A;  1A62 A;  5C44 G;  1HTP A;  1WCM H;  1NR4 A;  4EQP A;  4JG2 A;  4V19 0;  3KLR A;  1HNW Q;  2OCE A;  4HIM A;  4X3K A;  2WV6 D;  5CC4 A;  4KKU A;  2JA5 B;  4HMI A;  1O7L A;  1UEA B;  3OW2 A;  3GDE A;  1D5Z C;  2N78 A;  2NVT B;  1LV9 A;  4RCN A;  4K0K L;  1XMQ Q;  4ID6 A;  4RCO A;  2PZT A;  4N9P A;  2K7V A;  2KQ3 A;  3NPP A;  1V1O A;  2HCI A;  1LTB D;  3GTJ B;  4LF7 Q;  3CC2 A;  4RGT A;  5NUC A;  2D0P A;  3I90 A;  3A55 A;  3KK7 A;  1HNW L;  5EKI A;  4C3H B;  2F0J A;  4ZCK A;  3RNU A;  4A3E H;  1I4P A;  2UUA Q;  2Q8T A;  2R92 H;  3I4M B;  4PMB A;  1MJC A;  4OHJ A;  1NJI C;  2F4I A;  4QL5 A;  4C3J G;  5I6W A;  4B3T L;  2WKD A;  1SE3 A;  1VQE A;  4IUU A;  1OXU A;  3PQI A;  1STH A;  4DNR B;  1C4Q A;  1E2Z A;  1B7Y B;  5IP9 G;  1DM0 B;  3KLS A;  1BUV T;  4DGZ A;  2UUA L;  2AUK A;  1XTD A;  1DD2 A;  3NBH A;  1H9R A;  3RMH A;  3KBX A;  1F9Q A;  1FNV A;  5BN5 A;  5E1F A;  4KJN A;  4LF9 Q;  3HS0 C;  4LF6 L;  1W6K A;  2PI2 E;  1VQ5 A;  4LF5 Q;  1VMP A;  1EEF D;  2HHH L;  2QKI C;  5JAV A;  2LXK A;  1VF7 A;  3CCJ A;  3BG3 A;  1GUN A;  1TXY A;  1MBY A;  2SNM A;  2F0K A;  2QDB A;  2FMC A;  2NZ1 D;  3ULJ A;  2PPB C;  4IQZ A;  3CCU A;  4UAI A;  1NR2 A;  4KMU C;  3ND9 A;  2XIW A;  4LF9 L;  1A2U A;  4LAA A;  4LF5 L;  1QVF A;  4BY7 B;  3AFP A;  2QGQ A;  4A3F G;  4DV6 L;  4DAV A;  1PDQ A;  1MD2 D;  1ILQ A;  3GV3 A;  4FYD A;  2C9O A;  1NMG A;  5KGU A;  5C4H A;  2B8G A;  4IFD G;  3KUP A;  4X65 Q;  5FKA C;  5T1I A;  2HUG A;  2Z6K A;  3TN2 A;  1IL8 A;  1V1P A;  3EQL C;  4AQY L;  3UE0 A;  3R3O A;  4A3K H;  5D3D A;  4IUT A;  2JA9 A;  1JB7 A;  2F52 A;  2JA5 G;  5DNF A;  1RD9 D;  3R8B A;  3TS2 A;  3J81 i;  2CVR A;  1SR3 A;  1GUS A;  4HCS A;  5C5M A;  4ABN A;  4JI7 L;  3M4O H;  4X65 L;  1B53 A;  1TWH B;  3AYH B;  1HCZ A;  2MO1 A;  4CJ0 B;  4DXF A;  4DV0 Q;  1ZEQ X;  3U9S A;  1CA6 A;  1SYC A;  3TP8 A;  3D4R A;  4C3H G;  1YHA A;  1YIJ A;  1SE4 A;  3R2T A;  2B39 A;  2BDN A;  2AQ1 B;  4C56 C;  3TZD A;  4KI0 A;  2MQH A;  4QIW B;  1EWI A;  2PQA A;  1N34 Q;  5IOC A;  1SBB B;  5L37 A;  4DV0 L;  1EOT A;  1UAP A;  3OYY A;  1VF5 C;  4H02 A;  2R3Z A;  1JWM D;  1GUW A;  2K5Q A;  1Y1W H;  1PZJ D;  2B2W C;  2LXJ A;  5E3F A;  5BR8 Q;  3H3V C;  2PMZ E;  4FF4 A;  2Z0S A;  5IOD A;  3IFD A;  4BY1 B;  4K14 A;  1CT1 D;  2Q2U A;  1AFP A;  3GP7 A;  1KL9 A;  1HFG A;  1RHP A;  3VA7 A;  4NMZ A;  3CP0 A;  2VNU D;  3A8K E;  1I5F A;  3SDZ A;  1N34 L;  1A2T A;  3U4V A;  3I4N G;  4IUV A;  3SK6 A;  3K8A A;  4OIJ A;  1L0Y B;  4JOI C;  1HZB A;  5BR8 L;  3BVZ A;  3S14 B;  3DLL A;  2RDH A;  1TWA H;  5LMN W;  3PO3 G;  4DN4 M;  1LTI D;  2I46 A;  4A3D B;  4JI1 Q;  5M5Y H;  4GKJ Q;  5C3E B;  1LM0 A;  4JI2 Q;  4BY7 G;  1D1I A;  4KN4 C;  3E3X A;  2IX1 A;  1IW7 C;  2ASB A;  4A3B B;  5C4J H;  5LMN Q;  2F3V A;  5FJ8 H;  1KAB A;  1IW7 D;  4B3M Q;  3MEH A;  1GUO A;  1BQQ T;  1E0B A;  1PVO A;  5C4X B;  1RCV D;  4IOA A;  3G71 A;  1EY5 A;  1M90 C;  2EYJ A;  3DMU A;  3S1N B;  2K33 A;  4A3L H;  3I55 A;  4L5S A;  3UDI A;  2OTJ A;  1STG A;  3LX0 A;  1XNR Q;  4GNX B;  4JI1 L;  3HOY G;  5IYB H;  1FD7 D;  1C7Y A;  1BDO A;  1D1K A;  3Q22 A;  2NWG A;  5FOB B;  5LMN L;  3A8I E;  4RGM A;  4H0L C;  1FNW A;  4B3M L;  3P1H A;  5JPM C;  3PV0 A;  2UUB Q;  4K6D A;  2NVT H;  1CZW A;  2VQF Q;  1JOR A;  2ID0 A;  4LFC L;  2XRQ D;  4L8J A;  2OQK A;  1VQK A;  2KEN A;  1VQ6 A;  4FF1 A;  3HOV B;  1M1K C;  3STB C;  4DV1 Q;  1J9O A;  2NYZ D;  1XNR L;  3QOJ A;  3KF8 B;  3T56 B;  3STB D;  4TKO B;  3GTQ H;  4DR6 L;  2O5J C;  4KY5 A;  1IKM A;  2F0F A;  2H4O A;  1B1Z A;  2LKV A;  3I4M H;  3IRB A;  1VQ9 A;  2VUM B;  1II3 A;  1OXX K;  4U68 A;  4H7B A;  2RHQ B;  2SOB A;  2VQF L;  2ES2 A;  1B9M A;  2SNS A;  4HIK A;  4JI8 L;  2EYO A;  1F2Z A;  5G3L F;  3E0E A;  2Z4H A;  3CC4 A;  1PTO F;  1SYF A;  1ESR A;  3PO2 H;  2PW5 A;  2RA4 A;  1TR5 A;  4DUZ L;  3H15 A;  1I4R A;  3L9A X;  4KHP Q;  2PCF B;  3TDQ A;  2OQ0 A;  3LGJ A;  2AQ3 B;  3SK8 A;  3TQY A;  4QUC A;  2EYL A;  1QNU A;  3CCQ A;  1PH8 A;  3D4W A;  4BXX H;  2JA8 B;  2A73 B;  2AHO B;  3AFQ A;  4X3T A;  4Z9C B;  1A3T A;  4CDF C;  4I7Z C;  1EY6 A;  4A3J H;  3KLS X;  1HNX L;  2Q2H A;  3PUW A;  1AN8 A;  3K7A H;  3CPF A;  3PUZ A;  2UXB Q;  1PH9 A;  1L1O C;  3BU2 A;  5KYL A;  1Y69 U;  4Q0F A;  4GN3 B;  1EY0 A;  2MPM A;  3MAQ A;  4IPG A;  5K36 H;  2Z6B A;  1K0R A;  4RG1 A;  3ND8 A;  3OTO Q;  4IUQ A;  1NE3 A;  4A3B G;  2L12 A;  4GN4 B;  3HOX G;  4A93 H;  4IZ8 A;  1WTX A;  3S15 B;  3RN2 A;  4CBV A;  4R9W A;  1K28 A;  2UXB L;  1OXT A;  2F0H A;  2UUC L;  4R4I A;  3BDO A;  2JA7 B;  2ZXP A;  4YIJ A;  3CCS A;  4B3R Q;  1VQ7 A;  2E74 C;  2X6G A;  3OTO L;  1VCI A;  2KJX A;  1U9R A;  3M7G A;  1GUT A;  4I7A A;  1XPU A;  2RSN A;  1I6H H;  1XPR A;  1HA5 A;  1FVI A;  4GS3 A;  2GN5 A;  1N33 L;  2KHS A;  4RAU C;  4JBM A;  2XRS D;  2DN8 A;  1TWH H;  2FXQ A;  5IYC H;  1NNX A;  1STB A;  3CW2 C;  1GD7 A;  2A74 C;  2L15 A;  2IHF A;  1PTO B;  3F2D A;  4ZKB B;  1IBK Q;  2R7Z G;  1JT8 A;  5JJK A;  2RKS A;  2K4K A;  1PRT D;  1SE8 A;  2VUM G;  2VQE Q;  1S4Z A;  2JJQ A;  5GRO A;  2KA7 A;  3S2D B;  1GHK A;  3JAM c;  4A3E B;  1L0W A;  1JCK B;  1BCP F;  5C0X G;  5KNC A;  2JEA I;  3SXH A;  1Y14 B;  4JVZ A;  5ISR A;  2F0U A;  5GAH C;  5ELE A;  2K50 A;  1D2B A;  5I2X A;  1WJJ A;  1ASZ A;  3URY A;  5J1Z A;  1MSH A;  2E2D C;  2IW3 A;  1FL0 A;  1T9H A;  4DR7 Q;  3MXP A;  2SEB D;  1X54 A;  5M5X H;  2YTX A;  1Y8P B;  4G7O C;  1SE2 A;  2GA4 B;  1IBM L;  2EY6 A;  1C8C A;  1JWU D;  3H94 A;  1G2T A;  2B2T A;  5COR A;  1PLF A;  1A3V A;  1BKB A;  4L6T B;  4DR7 L;  1X3P A;  3MXN A;  4A3D H;  1A0I A;  4K2L A;  2JA6 G;  4K8I A;  2HIV A;  5C3E H;  4JW0 A;  3T1Y Q;  1EU4 A;  4DA2 A;  1E22 A;  4HAE A;  2NN6 H;  4KD4 A;  1PFN A;  1EUJ A;  2A6E C;  2A8V A;  1ENF A;  4HJ8 A;  1EZ8 A;  2A6E D;  3BVM A;  2B2V C;  4UPA A;  2A68 D;  4X64 Q;  3UE1 A;  1BNZ A;  4DF7 A;  2BDO A;  1A3U A;  2JA7 G;  5FO8 B;  1SND A;  3HGB A;  2L0C A;  4GLA C;  1ET6 A;  4EGV A;  1I4H A;  5JOB A;  4LFA Q;  3D0F A;  3T1Y L;  1CI3 M;  1I94 Q;  4JI4 Q;  2PZW A;  1X3E A;  1Y8N B;  4B08 A;  1RJT A;  1D6E C;  3FEW X;  1WCM G;  3DXJ C;  4HJ5 A;  4DAY A;  4BBS B;  2KHJ A;  1D8L A;  4X64 L;  3HOV H;  2K5W A;  3IAY A;  1PFS A;  1M8A A;  3WWV A;  1SN8 A;  4UP8 A;  2PYK A;  4FVM A;  3T16 A;  3BYY B;  4POG A;  1ZXT A;  4EQN A;  2F0I A;  4N8F A;  1YBY A;  1V8Q A;  4NPS A;  1LAB A;  3M4O B;  5IYD H;  2I5M X;  3BDC A;  4A3I B;  2CKZ B;  3QIA A;  4ZKC B;  5TSS A;  3NWS A;  1LT5 D;  2JSO A;  3HP3 A;  4DR2 Q;  3ERO A;  4JI0 L;  1K0S A;  4QJF A;  3G7L A;  3ERQ A;  1XYI A;  2HQE A;  1HJP A;  1H9M A;  1PH5 A;  2G9H D;  2R92 G;  1LAC A;  2EYF A;  2F0P A;  2R61 A;  1Q86 C;  4LWC A;  3WOF A;  2X69 A;  1ML0 D;  1EYG A;  3NBH B;  2ICE C;  4OON A;  1EQT A;  2UU9 Q;  3NTH A;  4DR2 L;  5IE8 A;  4JV5 Q;  2JA8 H;  1Z6H A;  3W1G A;  3QWN A;  1PYW D;  3J81 c;  4AIM A;  3CCR A;  1YJN A;  5E4X A;  4TSS A;  3K0X A;  1SXT A;  3RZO H;  4DR1 Q;  1DXM A;  4OX9 Q;  3J80 E;  1CUK A;  2B2Y A;  1NSN S;  2WKC A;  3OWF A;  2D62 A;  4JV5 L;  3V96 A;  4I65 A;  4MIU A;  3S1Q B;  3NXW A;  1YVC A;  1EY4 A;  5IT9 c;  3E6Z X;  4LJZ C;  2HD3 A;  3KJO A;  3FKI B;  3NHH A;  1CQV A;  4H13 C;  3OMC A;  1HHV A;  3CU7 A;  3S15 H;  2Q8I B;  4OXP A;  1X3F A;  2LS0 1;  1E1T A;  5KND A;  3A7L A;  1KDB A;  4OX9 L;  1CKO A;  2F0W A;  4DKA C;  4WOR A;  3CCE A;  1J5E Q;  1MI2 A;  2E2H H;  5C4J B;  3ICE A;  3VYT A;  1EY9 A;  4UP9 A;  3OSO A;  1V1P B;  2IX3 A;  1WVL A;  3RN5 A;  1F2M A;  2F4V Q;  4JPB W;  2RBM A;  2QEX A;  2F03 A;  1LT3 D;  4LFB Q;  4K0K Q;  3J7A V;  2F0S A;  1B9N A;  1X32 A;  1EQR A;  3K81 C;  2RDG A;  2WAQ B;  3PGZ A;  4AYB B;  4QQB X;  1K9M C;  2RF4 A;  1K8G A;  4XIG S;  4XTC S;  1J5E L;  4A3K G;  2F0L A;  4B9W A;  2DJF C;  3CCV A;  2HQL A;  1CFM A;  3H0G G;  1EIG A;  1PTO H;  2F4V L;  5J39 A;  4LFB L;  4CKB A;  1K3R A;  2BH8 A;  3D6C A;  4QMG A;  4APV A;  1JIC A;  2JYO A;  5FO9 B;  4B3T Q;  2AUJ D;  3B6Y A;  3BDL A;  1E3P A;  1PH7 A;  2WB1 B;  4KKS A;  1BO0 A;  2J4X A;  2SDF A;  3GTQ B;  1YZ6 A;  3MTS A;  3VA5 A;  3S2D H;  4GOP A;  1W2B A;  2AWN A;  1F2L A;  2EY5 A;  2XVS A;  5GQO A;  4FP5 D;  3T13 A;  2PQA B;  3HOU H;  3RD4 A;  1DJR D;  1LTA D;  3HOW G;  4LF6 Q;  4K5X A;  1I6V C;  4RKL A;  5GAG C;  1S40 A;  1RKN A;  2A1A A;  2HHH Q;  2CWP A;  4DR4 L;  2Z8L A;  3CRK C;  1XTC D;  3PO2 B;  1UEB A;  3MEF A;  4RFB A;  3BS1 A;  1KIX A;  3F2U A;  3E9H A;  1Y1W G;  1TY0 A;  3CMA A;  1I50 B;  4GN5 A;  4O2D A;  1DOM A;  3C2P A;  5IGE A;  2B2U C;  3I91 A;  3BYT B;  3K57 A;  1CM9 A;  1GUG A;  2F0Q A;  1QZH A;  1MJE A;  1SNM A;  1B3A A;  1XX8 A;  4O42 A;  4DV6 Q;  4KK7 A;  4IUP A;  2YV5 A;  2EJG C;  3OWE B;  4A3J B;  5C4Z A;  1SYD A;  3I4L A;  2XTI A;  3K7A B;  1PFM A;  4A3C H;  3NQT A;  1VQO A;  2BE5 C;  5M3M B;  1D5X C;  1V43 A;  4RKB A;  4A3G B;  1EYA A;  2BE5 D;  4AQY Q;  4IO9 A;  1YNX A;  1LO5 D;  2IJ0 A;  4XQJ A;  2OEO A;  2WIN B;  4X3S A;  3I72 A;  3I4O A;  2O4X A;  4P75 A;  5FJ8 G;  4BA2 I;  4A93 B;  2ENB A;  4ODG A;  2O5I C;  5EKK A;  4HR7 B;  4J1M A;  3J80 L;  5HUR A;  1F9P A;  1L2F A;  4JI7 Q;  2R7F A;  4C1N K;  4NXM L;  4R4O A;  2Q8R E;  4BBS H;  4AYB G;  3P75 A;  2JQO A;  1EYD A;  4A3M H;  2EY1 A;  3MXG A;  5IYB G;  1I6H B;  1QJO A;  4N9T A;  1AZQ A;  1QUQ A;  2ALY B;  3K5N A;  1WD1 A;  1DOL A;  4HIO A;  5H1S E;  5EPK A;  3F1Z A;  4A3I H;  4K5W A;  5DAU A;  4BBR B;  1HPC A;  4CDC C;  1NCV A;  3UDX A;  1F77 A;  4WJ3 M;  3TEH B;  2CW0 C;  3BVG A;  3L3O C;  3Q8D A;  3I4M G;  4O0A A;  2CW0 D;  1Z9F A;  1RIP A;  5IGG A;  2F0M A;  1TS5 A;  4R4Q A;  4LUZ A;  2NTS A;  2L1B A;  1CKN A;  3GTG H;  3J7A F;  1HQR D;  1CKM A;  4JI5 Q;  4JBJ A;  3PO2 G;  2KBN A;  2IHE A;  4IPD A;  1HNZ Q;  2FFK B;  1SSO A;  2OWO A;  3TZU A;  3V2T A;  5DM6 3;  1X55 A;  4U67 3;  3C46 A;  4DAM A;  4Y52 H;  4RGO S;  1BXT A;  2MP1 A;  5M5X B;  1Y1V H;  4BXX G;  1UWV A;  5FLX c;  5FLM H;  4FDB A;  1KAW A;  4EVO A;  4JI5 L;  2IWH A;  1WTQ A;  2ZM6 Q;  4DFA A;  3S1Q H;  1ASY A;  3TME A;  1A15 A;  1SYG A;  5D14 A;  3MVV A;  4A3J G;  2NB0 A;  4DR5 L;  1HNZ L;  1GO3 E;  1EFW A;  3FKI H;  4HSV A;  3VYS A;  3K5O A;  3CPW A;  4C1N I;  1FJG Q;  1SNC A;  3G48 A;  2BH2 A;  5IWA Q;  2A5H A;  3QB3 A;  4LW1 A;  3FHW A;  1DYQ A;  1VQP A;  1KQS A;  1EEI D;  1H9J A;  5K36 G;  3S16 H;  4AH6 A;  4DR3 L;  3U50 C;  4FF3 A;  2F0O A;  5CV8 A;  2VB2 X;  3QO2 A;  4HJ7 A;  5JJI A;  4YWK A;  2ZM6 L;  3HKZ E;  3MXU A;  1IBL Q;  3GTM B;  3FPU B;  4GNX C;  1G29 1;  4A93 G;  2FIN B;  4LFC Q;  5ELC A;  1LLR D;  1QG7 A;  1WTO A;  1FJG L;  3UI2 A;  4JYA Q;  5IWA L;  2B2U A;  1VQJ A;  4XQN A;  4DR6 Q;  3S1R H;  3WDN A;  3J7Z C;  4PNY A;  3BZK A;  3KF6 A;  3RR5 A;  3ULP A;  5E7N A;  1CSP A;  3CD6 A;  3S24 A;  3KBG A;  4UHV A;  4IFD H;  1IBL L;  4RA8 A;  1SYE A;  1KNA A;  2M00 A;  2ZT9 C;  4JI8 Q;  1FGU A;  3CCL A;  3OHX C;  2ZJR A;  4JYA L;  1QVG A;  1MHW C;  1E24 A;  1C48 A;  3VR3 A;  5CBE E;  5IYC G;  5KRU A;  1SJE D;  2EE1 A;  2N55 A;  1DOK A;  4DUZ Q;  5JEA J;  1U4L A;  3N6R A;  4YY3 Q;  1TS2 A;  4P2C B;  3J81 j;  2XGT A;  2D9U A;  4LUO A;  3VR5 A;  5IT9 E;  2OTL A;  2F1M A;  2HCC A;  1JE4 A;  1UE7 A;  2K5H A;  3C1E A;  4QCL A;  3ITP A;  2G9D A;  2HT1 A;  5JJL A;  1W6J A;  1HNX Q;  2F0G A;  3K7U C;  2M9V A;  4DV2 Q;  4LUV A;  1STA A;  1U4M A;  2WAQ E;  4E6I A;  5HGQ A;  1KXL A;  4YY3 L;  5DEH A;  4AYB E;  1TVX A;  1P16 A;  2UXD Q;  4BY1 G;  2YYZ A;  3TP6 A;  1I50 H;  4K8J A;  3I3C A;  3I7F A;  3PIO 3;  2PO4 A;  1SNP A;  1EIF A;  1FYC A;  3CC7 A;  1NUC A;  5ELO A;  2CFM A;  4HID A;  1SDF A;  1U4P A;  3RZO B;  5IIF A;  3M4Y A;  1SMY C;  1E2W A;  3KDF A;  3MXN B;  1R4Q B;  5JPN C;  3M3Y H;  4DV2 L;  2KCM A;  1SMY D;  4OO1 H;  2UUC Q;  5M3M H;  2UXD L;  4A3G H;  2FJ2 A;  2WB1 E;  1VQ8 A;  1PRT F;  1VQI A;  3ER0 A;  2N88 A;  1KDC A;  1ROD A;  4A3D G;  1RDP D;  4ZRZ A;  2VS1 A;  2EIF A;  2RVL A;  5C3E G;  3X3M A;  4HED A;  4X6A H;  1IKL A;  1U5K A;  1SRO A;  2B2W A;  3W5O A;  4KY7 A;  1N33 Q;  2EYP A;  3I2Z A;  2J7Z A;  5C4X G;  3D8G A;  2N3S A;  3LWU A;  2E2H B;  3NTI A;  3AQQ A;  2E5L Q;  3U4Z A;  2E8G A;  3SEB A;  4DAY B;  4NXN Q;  4JC0 A;  1ET9 A;  4DV5 Q;  3M85 A;  4TQU S;  4HCE A;  4JOI A;  2K75 A;  3PSI A;  5D65 A;  1VMC A;  4A75 A;  4IN3 A;  2R6G A;  1A63 A;  2VZA A;  2AMC B;  3KLW A;  1OXS C;  1IZ6 A;  2VW9 A;  2A19 A;  2C5C A;  3AB9 A;  1EIY B;  3NEN A;  3HOY H;  3HOV G;  2KHI A;  3DEP A;  4NXN L;  2E5L L;  2P5Z X;  4KTA A;  5C6A A;  4BBR H;  4KN7 C;  4DV5 L;  2YTV A;  1M4V A;  1X9N A;  2E75 C;  2CQA A;  4NB3 A;  4BA1 I;  1D5M C;  1O78 A;  2GVA A;  3CAM A;  3OOC A;  3TS0 A;  4KLK A;  5IYD G;  5LMU Q;  2RHS B;  4K5V A;  1UE6 A;  2B63 B;  2MFI A;  4M1U B;  1AZP A;  5KIX A;  2BCO A;  2QA4 A; 
#chains in the Genus database with same CATH homology
 1CTM A;  2QEJ C;  4RWS C;  2FMM A;  3PMF A;  3RZD B;  3HOU B;  3TSS A;  1WTW A;  1CHQ D;  5E4W C;  1O80 A;  1BBX C;  5IGD A;  1SNQ A;  1PRT B;  2LMC B;  1QCB D;  1CA5 A;  3K5L A;  2NN6 I;  3RUZ A;  3SR1 A;  2LY7 A;  4F87 A;  5IT9 L;  1JQY D;  1FGB D;  4JK1 C;  4CJ1 B;  2MHV A;  4FNF A;  4HN7 A;  4DAP A;  1G8Z D;  1Y8O B;  4PQX A;  5M3F B;  1TS4 A;  2F0V A;  1TKW B;  2M2L A;  3FPP A;  2PZU A;  3NUC A;  5JEA H;  5JVH 3;  3OMG A;  4H44 C;  2KEC A;  5CV4 A;  2QCP X;  5EKL A;  4S3S A;  3CRL C;  3AMU A;  1F2Y A;  2B8F A;  1JOQ A;  1I3Q B;  1HFN A;  5ELF A;  2V4D A;  4CKC A;  1ONL A;  5IGF A;  3E0J A;  3S2H B;  1EWC A;  1IYV A;  3DHQ A;  4A3M B;  4MN3 A;  1I4X A;  4ZQ3 A;  3VYU A;  3ONA B;  4J8Q A;  1BCP B;  2OF1 A;  3G6J B;  1BR9 A;  2A69 C;  2A69 D;  5ELB A;  1HUM A;  2RDF A;  3S17 B;  1WTV A;  3NE5 B;  5F2D A;  2F0D A;  5EPL A;  1GHJ A;  3GV6 A;  4OL7 A;  5AFW A;  2EXZ A;  5EJW A;  5I4D A;  5CYU A;  3HKZ B;  3HEJ A;  4G57 A;  2H1E A;  1AW7 A;  3A56 A;  4FF2 A;  3MFY A;  1TWF B;  4TRD A;  3GTG B;  1EL0 A;  5C0X H;  3GQB A;  4RGN A;  1HRJ A;  4XDX A;  1IHZ A;  2E76 C;  4RHR A;  3QJY A;  1Y1V B;  4UDU C;  2EOT A;  3A7A B;  1O7Y A;  2NBF A;  2RSO A;  2PW7 A;  1CK1 A;  5T1G A;  3DM1 A;  4IAL A;  3I8Z A;  1HUN A;  1LTS D;  2K04 A;  2D2C C;  1G2S A;  1KAA A;  5EQ0 A;  3S16 B;  1EZ6 A;  2KVM A;  2QIL A;  3FMC A;  4HTH A;  4RH6 A;  1OXV A;  3H91 A;  1KDA A;  5LL6 S;  5EPJ A;  2NVY B;  3S1R B;  2K5D A;  2PNR C;  4L63 B;  1S5D D;  4WJW A;  3T51 B;  2L11 A;  1B44 D;  5C5L A;  5M9O A;  4KHZ A;  4HSP A;  2MUY A;  1Z7T A;  1I4G A;  2B2V A;  3K6O A;  5JVG 3;  4K2K A;  2WAC A;  5LL6 X;  4KJO A;  4FXD A;  4CKE A;  3RLF A;  3SHL A;  1TII D;  1G91 A;  3W3A A;  2HDL A;  2HDM A;  2KCC A;  1ZKO A;  1EY8 A;  5A2Q L;  5IGB A;  4XXE A;  2VB3 X;  4KY6 A;  5EBD A;  5FLX L;  1EYC A;  1ICW A;  3QOL A;  4IFD J;  3SVM A;  1K8O A;  3AU7 A;  3D3R A;  3HG9 A;  1S5E D;  2L5T A;  2XNA C;  1XXG A;  3MA2 B;  1G6Z A;  3SE0 A;  1TWC B;  2XN9 C;  1YNJ C;  1YNJ D;  1K8M A;  1SEB D;  2DNC A;  1EQV A;  1SAP A;  3M3Y B;  4J6H A;  5C3W A;  3HZX A;  5EGT A;  1Q1B A;  2NUC A;  3A8J E;  1LTT D;  1H9S A;  3ZYY X;  5CBA E;  2VXW A;  3FDT A;  3I4N B;  1EY7 A;  1JC7 A;  5D3I B;  3FVQ A;  3PO3 B;  2TMP A;  4B9X A;  4PMW A;  3JAM E;  4Q5V A;  3NK9 A;  2ZXO A;  3GTK B;  4M8A A;  2MGS A;  1Q1E A;  1STY A;  1E2V A;  1TU2 B;  3WOE A;  4QF4 A;  5I2Y A;  1S5B D;  2EYM A;  1CZG A;  2F0N A;  2KED A;  2WP8 J;  1JOO A;  4MHE A;  1Q3L A;  3HOY B;  5C3X A;  2NTT A;  3CHB D;  3DWQ A;  2F0T A;  2Y0S B;  4R8I A;  1VDZ A;  1JWS D;  5KYI A;  1RF2 D;  2MJ8 A;  3N52 A;  3TP7 A;  3MHB A;  3R93 A;  3MFG A;  4ME5 A;  1S5F D;  5CV6 A;  2EJF C;  2QF7 A;  3E5S A;  2OT2 A;  5LHY 1;  3Q0A A;  1T5E A;  1Q12 A;  1B2T A;  1TWG B;  1H9K A;  3NBI A;  2KEE A;  1SJH D;  2IL8 A;  5COY A;  4DK0 A;  2DY7 A;  2OXP A;  5BN3 A;  3P20 A;  4G7H C;  4DK1 A;  4OO1 G;  4CJ2 C;  3H09 A;  2JE6 I;  3EA6 A;  3L7Z C;  4WFN 3;  2I07 B;  1R4P B;  4IFD I;  2BA0 A;  2K01 A;  1TQO A;  4C2M B;  1CHP D;  2J0T D;  1QIL A;  3EJI A;  3H6M A;  4XQQ A;  5CV7 A;  2ICI A;  2EVB A;  3HOX B;  1DCZ A;  4DNT B;  1FNU A;  2AWO A;  5I6Y A;  1STN A;  1TY2 A;  3D4D A;  4DXG A;  1TT2 A;  1WD0 A;  3GTO B;  2EPB A;  1EWH A;  3EFX D;  3VR4 A;  1TS3 A;  4NP5 A;  3J81 E;  4F8M A;  2L9H A;  2BA1 A;  5DM7 3;  4CGY B;  1HXY D;  3C1F A;  3JAM L;  4O1N A;  4V0B A;  2K05 A;  1EFI D;  3Q23 A;  5FO7 B;  1WTR A;  2IX0 A;  1I4Q A;  4XT3 B;  2JP1 A;  1BOS A;  2R7Z B;  1AP0 A;  4BWG B;  4EQO A;  3IFT A;  4OO1 I;  1HQM C;  5CV9 A;  3Q6S A;  2B2T C;  3FRP B;  4FO2 A;  2Z4I A;  1Q8I A;  3I70 A;  3OIQ A;  3GD7 A;  3SK5 A;  2O2L D;  4QB4 A;  3GTL B;  3M7N A;  2RQX A;  2K6A A;  1F9S A;  2PQE A;  3DUZ A;  1ZYR C;  1DZ1 A;  5CMD A;  2L4N A;  5I9P A;  3PIP 3;  4X3U A;  1ZYR D;  2EY2 A;  1OO9 B;  1SFO B;  2XWJ B;  1DON A;  2E2J B;  1Z47 A;  3IKJ A;  3W2D A;  1GXD C;  3OW7 A;  4FXG C;  4RHS A;  4BS9 A;  3NTK A;  2NN6 G;  1KNE A;  1R9T B;  4NW2 A;  5JEA G;  4ZAI A;  2EDG A;  1HTL D;  4G7Z C;  4C3I B;  4XYO A;  5J22 A;  2JA6 B;  5C0X J;  4IUN A;  1F9R A;  4G4K A;  1LT6 D;  2ZXR A;  1O7Z A;  4Y7N B;  1KTK A;  4HMJ A;  3K5M A;  1X3Q A;  1PTO C;  5G3L D;  1PTO D;  1UUP A;  3VYR A;  4CHT B;  1QE6 A;  3J7Y W;  3A54 A;  1PZK D;  1YNN C;  3QG1 A;  2R93 B;  4IUR A;  1WCM B;  1L0X B;  1YNN D;  3K58 A;  1ILP A;  5ELD A;  3PUX A;  3S1M B;  2DY8 A;  3D31 A;  3DWA A;  1ENC A;  3K59 A;  1QB5 D;  3NQI A;  2F3W A;  2JEB I;  3Q24 A;  3DEO A;  5CR3 A;  5I9O A;  3IL8 A;  1PMR A;  4NKL A;  2L55 A;  1PZI D;  1EIH A;  1PRT C;  3J81 L;  3I73 A;  4PV1 C;  3KF8 A;  1RTN A;  2B2Y C;  2XSC A;  4OGQ C;  5KEE A;  1GJX A;  1QNK A;  2R92 B;  1MGS A;  2FHT A;  4OIK A;  3CQZ B;  4ZUJ A;  1JR0 D;  1BF4 A;  2JXM B;  3NSW A;  3V05 A;  1MSG A;  3GO5 A;  2KUM A;  1STE A;  1J8I A;  1KLG D;  5JJZ A;  2XWB B;  3TP5 A;  2EJM A;  1WTP A;  3OPO A;  5CV5 A;  4C3I G;  4GZY C;  2F0E A;  2K1B A;  5EBC A;  1AEX A;  3MZ5 A;  3CKI B;  1ENA A;  1LTR D;  1LT4 D;  1SNO A;  2IT1 A;  3MC0 B;  2A68 C;  4KV6 A;  4ZLT F;  1BCP C;  2TSS A;  3HOZ B;  1Q90 A;  1HA6 A;  5M5W B;  1QWY A;  1BCP D;  1LTG D;  1NAP A;  3T53 B;  4NDX A;  4PMC A;  3T4A C;  2AQ2 B;  4ZYS A;  3VR2 A;  5A2Q E;  3OIP A;  1JB3 A;  2Z1C A;  5CGK A;  2A6H C;  5C44 B;  1K83 B;  1KLU D;  1B4O A;  1QOH A;  4ILW A;  2A6H D;  2PMZ B;  1UNS A;  4DU9 A;  5FLX E;  4XT1 B;  1T5X D;  2BOS A;  3P7J A;  4XYQ A;  2YU9 B;  4ULL A;  4A3K B;  3D6W A;  1RTO A;  1GOZ A;  2K28 A;  5C0X I;  3H0G B;  4QUF A;  3R2I A;  4KHV A;  2LFN A;  5HGT A;  3S9W A;  2KOL A;  4K6L A;  5A35 A;  3TBI B;  2IPK D;  4ZUI A;  2DNE A;  4KD3 A;  2EYH A;  1ESF A;  3LWE A;  4ZK9 B;  3HOW B;  2K32 A;  2CHB D;  1XWE A;  4C3J B;  1FR3 A;  2WII B;  1PFB A;  3GTP B;  4LMQ D;  3LNN A;  1JOK A;  3PUY A;  4WRD A;  3NWT A;  1PXU A;  2NVX B;  3PUV A;  4F7X A;  4F88 A;  1CQF A;  2NVQ B;  1H9S B;  1Y1W B;  2EZV A;  3MWY W;  3NP8 A;  4FXK C;  3DWP A;  3C3L A;  2X6L A;  2E2I B;  1S5C D;  3BZD B;  4R8N A;  4LK1 C;  1EU3 A;  2D5D A;  3K0Y A;  1U4R A;  3HRZ C;  2KCN A;  1B50 A;  1TWA B;  3X3N A;  5K5P A;  1A6X A;  5IGC A;  3O13 A;  3EVQ A;  1SYB A;  5BN4 A;  4A3F B;  3VR6 A;  3SK4 A;  5M5Y B;  3U9O A;  4JBW A;  5KNB A;  5FK9 C;  4KKT A;  1IYU A;  2K03 A;  1HTP A;  4EQP A;  1NR4 A;  4V19 0;  3KLR A;  4X3K A;  2WV6 D;  5CC4 A;  4KKU A;  2JA5 B;  4HMI A;  1O7L A;  1UEA B;  1D5Z C;  2NVT B;  1LV9 A;  4RCN A;  4ID6 A;  4RCO A;  2PZT A;  4N9P A;  2K7V A;  2KQ3 A;  3NPP A;  1V1O A;  2HCI A;  1LTB D;  3GTJ B;  4RGT A;  5NUC A;  3I90 A;  3A55 A;  3KK7 A;  5EKI A;  4C3H B;  2F0J A;  1I4P A;  2Q8T A;  3I4M B;  4PMB A;  4OHJ A;  2F4I A;  4C3J G;  5I6W A;  2WKD A;  1SE3 A;  4IUU A;  1OXU A;  1STH A;  4DNR B;  1C4Q A;  1E2Z A;  1DM0 B;  3KLS A;  1BUV T;  4DGZ A;  2AUK A;  1DD2 A;  3NBH A;  1H9R A;  3RMH A;  3KBX A;  1F9Q A;  1FNV A;  5BN5 A;  5E1F A;  4KJN A;  3HS0 C;  1W6K A;  1VMP A;  1EEF D;  2QKI C;  5JAV A;  1VF7 A;  3BG3 A;  1GUN A;  1MBY A;  2SNM A;  2F0K A;  2QDB A;  2FMC A;  2NZ1 D;  2PPB C;  4IQZ A;  4UAI A;  1NR2 A;  4KMU C;  3ND9 A;  2XIW A;  1A2U A;  4LAA A;  4BY7 B;  4DAV A;  1PDQ A;  1MD2 D;  1ILQ A;  3GV3 A;  4FYD A;  2C9O A;  5KGU A;  5C4H A;  2B8G A;  4IFD G;  3KUP A;  5FKA C;  5T1I A;  2HUG A;  3TN2 A;  1IL8 A;  1V1P A;  3EQL C;  3R3O A;  5D3D A;  4IUT A;  5DNF A;  1RD9 D;  3R8B A;  2CVR A;  1GUS A;  4HCS A;  5C5M A;  4ABN A;  1B53 A;  1TWH B;  1HCZ A;  4CJ0 B;  4DXF A;  1ZEQ X;  3U9S A;  1CA6 A;  1SYC A;  3TP8 A;  3D4R A;  4C3H G;  1SE4 A;  3R2T A;  2B39 A;  2BDN A;  2AQ1 B;  4C56 C;  3TZD A;  4KI0 A;  4QIW B;  5IOC A;  1SBB B;  1EOT A;  1UAP A;  1VF5 C;  2R3Z A;  1JWM D;  1GUW A;  2K5Q A;  1PZJ D;  2B2W C;  5E3F A;  3H3V C;  4FF4 A;  5IOD A;  3IFD A;  4BY1 B;  4K14 A;  1CT1 D;  1AFP A;  3GP7 A;  1RHP A;  1HFG A;  3VA7 A;  4NMZ A;  2VNU D;  3A8K E;  3SDZ A;  1A2T A;  4IUV A;  3SK6 A;  4OIJ A;  1L0Y B;  3BVZ A;  3S14 B;  2RDH A;  4DN4 M;  1LTI D;  2I46 A;  4A3D B;  5C3E B;  1D1I A;  4KN4 C;  2IX1 A;  1IW7 C;  4A3B B;  2F3V A;  1KAB A;  1IW7 D;  3MEH A;  1GUO A;  1BQQ T;  1E0B A;  5C4X B;  1RCV D;  1EY5 A;  3S1N B;  2EYJ A;  3DMU A;  2K33 A;  1STG A;  3LX0 A;  1FD7 D;  1BDO A;  1D1K A;  3Q22 A;  2NWG A;  5FOB B;  3A8I E;  4RGM A;  4H0L C;  1FNW A;  3P1H A;  5JPM C;  3PV0 A;  4K6D A;  1CZW A;  1JOR A;  2ID0 A;  2XRQ D;  4L8J A;  4FF1 A;  3HOV B;  1J9O A;  2NYZ D;  3QOJ A;  3T56 B;  4TKO B;  2O5J C;  4KY5 A;  1IKM A;  2F0F A;  2H4O A;  1B1Z A;  2LKV A;  2VUM B;  1II3 A;  1OXX K;  4U68 A;  4H7B A;  2SOB A;  1B9M A;  2SNS A;  2EYO A;  1F2Z A;  5G3L F;  2Z4H A;  1PTO F;  1SYF A;  1ESR A;  2PW5 A;  2RA4 A;  1TR5 A;  1I4R A;  3L9A X;  2PCF B;  3TDQ A;  2AQ3 B;  3SK8 A;  4QUC A;  2EYL A;  1QNU A;  3D4W A;  2JA8 B;  2A73 B;  4X3T A;  4Z9C B;  1A3T A;  4I7Z C;  1EY6 A;  3KLS X;  3PUW A;  1AN8 A;  3PUZ A;  5KYL A;  1Y69 U;  4Q0F A;  1EY0 A;  2MPM A;  3MAQ A;  5K36 H;  3ND8 A;  4IUQ A;  2L12 A;  4IZ8 A;  1WTX A;  3S15 B;  4CBV A;  4R9W A;  1OXT A;  2F0H A;  3BDO A;  2JA7 B;  2ZXP A;  4YIJ A;  2E74 C;  2X6G A;  1VCI A;  2KJX A;  1U9R A;  3M7G A;  1GUT A;  2RSN A;  1HA5 A;  2KHS A;  4RAU C;  2XRS D;  2DN8 A;  1STB A;  2A74 C;  1PTO B;  4ZKB B;  2RKS A;  1PRT D;  1S4Z A;  2KA7 A;  3S2D B;  1GHK A;  4A3E B;  1JCK B;  1BCP F;  5C0X G;  5KNC A;  2JEA I;  3SXH A;  5ISR A;  2F0U A;  5ELE A;  1D2B A;  5I2X A;  3URY A;  5J1Z A;  1MSH A;  2E2D C;  2IW3 A;  3MXP A;  2SEB D;  1Y8P B;  4G7O C;  1SE2 A;  2GA4 B;  2EY6 A;  1C8C A;  1JWU D;  3H94 A;  1G2T A;  2B2T A;  5COR A;  1PLF A;  1A3V A;  4L6T B;  1X3P A;  3MXN A;  4K2L A;  4K8I A;  1EU4 A;  4DA2 A;  4HAE A;  2NN6 H;  4KD4 A;  1PFN A;  2A6E C;  1ENF A;  1EZ8 A;  2A6E D;  3BVM A;  2B2V C;  2A68 D;  1BNZ A;  4DF7 A;  2BDO A;  1A3U A;  5FO8 B;  1SND A;  3HGB A;  2L0C A;  1ET6 A;  4EGV A;  1I4H A;  5JOB A;  1CI3 M;  2PZW A;  1Y8N B;  4B08 A;  1RJT A;  1D6E C;  3FEW X;  3DXJ C;  4DAY A;  4BBS B;  2K5W A;  3IAY A;  1M8A A;  2PYK A;  4FVM A;  3T16 A;  3BYY B;  1ZXT A;  4EQN A;  2F0I A;  1V8Q A;  1LAB A;  3M4O B;  3BDC A;  4A3I B;  3QIA A;  4ZKC B;  5TSS A;  3NWS A;  1LT5 D;  2JSO A;  3HP3 A;  3ERO A;  3G7L A;  3ERQ A;  1XYI A;  2HQE A;  1H9M A;  2G9H D;  1LAC A;  2EYF A;  2F0P A;  2R61 A;  3WOF A;  2X69 A;  1ML0 D;  2ICE C;  1EQT A;  3NTH A;  1Z6H A;  3QWN A;  1PYW D;  5E4X A;  4TSS A;  1SXT A;  1DXM A;  3J80 E;  2B2Y A;  1NSN S;  2WKC A;  3OWF A;  2D62 A;  3V96 A;  4I65 A;  4MIU A;  3S1Q B;  3NXW A;  1EY4 A;  3E6Z X;  4LJZ C;  3FKI B;  3NHH A;  1CQV A;  4H13 C;  3OMC A;  1HHV A;  3CU7 A;  2Q8I B;  2LS0 1;  5KND A;  3A7L A;  1KDB A;  2F0W A;  4WOR A;  1MI2 A;  5C4J B;  3VYT A;  1EY9 A;  3OSO A;  1V1P B;  2IX3 A;  1WVL A;  1F2M A;  2RBM A;  2F03 A;  1LT3 D;  3J7A V;  2F0S A;  1B9N A;  1X32 A;  2RDG A;  2WAQ B;  4AYB B;  4XIG S;  4XTC S;  2F0L A;  4B9W A;  1CFM A;  1EIG A;  1PTO H;  5J39 A;  4CKB A;  3D6C A;  4QMG A;  1JIC A;  2JYO A;  5FO9 B;  2AUJ D;  3BDL A;  4KKS A;  2WB1 B;  1BO0 A;  2J4X A;  2SDF A;  3GTQ B;  3MTS A;  3VA5 A;  2AWN A;  1F2L A;  2EY5 A;  2XVS A;  4FP5 D;  3T13 A;  3RD4 A;  1DJR D;  1LTA D;  4K5X A;  1I6V C;  4RKL A;  1RKN A;  2Z8L A;  3CRK C;  1XTC D;  3PO2 B;  4RFB A;  3BS1 A;  3F2U A;  1TY0 A;  1I50 B;  1DOM A;  3C2P A;  5IGE A;  2B2U C;  3I91 A;  3BYT B;  3K57 A;  1CM9 A;  1GUG A;  2F0Q A;  1SNM A;  1B3A A;  1XX8 A;  4O42 A;  4KK7 A;  4IUP A;  2EJG C;  3OWE B;  4A3J B;  5C4Z A;  1SYD A;  3I4L A;  3K7A B;  1PFM A;  3NQT A;  2BE5 C;  5M3M B;  1D5X C;  1V43 A;  4RKB A;  4A3G B;  1EYA A;  2BE5 D;  4XQJ A;  1LO5 D;  2IJ0 A;  2OEO A;  4X3S A;  2WIN B;  3I72 A;  2O4X A;  4BA2 I;  4A93 B;  2ENB A;  4ODG A;  2O5I C;  5EKK A;  4HR7 B;  4J1M A;  3J80 L;  5HUR A;  1F9P A;  4C1N K;  2Q8R E;  3P75 A;  1EYD A;  2EY1 A;  3MXG A;  1I6H B;  1QJO A;  4N9T A;  1AZQ A;  3K5N A;  1WD1 A;  1DOL A;  5EPK A;  4K5W A;  5DAU A;  4BBR B;  1HPC A;  1NCV A;  1F77 A;  2CW0 C;  3BVG A;  3L3O C;  2CW0 D;  5IGG A;  2F0M A;  1TS5 A;  2NTS A;  2L1B A;  3J7A F;  1HQR D;  2FFK B;  1SSO A;  3TZU A;  3V2T A;  5DM6 3;  4U67 3;  3C46 A;  4RGO S;  1BXT A;  2MP1 A;  5M5X B;  4EVO A;  2IWH A;  1WTQ A;  4DFA A;  3TME A;  1SYG A;  1A15 A;  5D14 A;  3MVV A;  2NB0 A;  4HSV A;  3VYS A;  3K5O A;  4C1N I;  1SNC A;  2A5H A;  3QB3 A;  1DYQ A;  1EEI D;  1H9J A;  5K36 G;  4FF3 A;  2F0O A;  5CV8 A;  2VB2 X;  3QO2 A;  3MXU A;  3GTM B;  3FPU B;  1G29 1;  2FIN B;  5ELC A;  1LLR D;  1QG7 A;  1WTO A;  3UI2 A;  2B2U A;  4XQN A;  3WDN A;  4PNY A;  3KBG A;  4IFD H;  4RA8 A;  1SYE A;  1KNA A;  2M00 A;  2ZT9 C;  3OHX C;  1C48 A;  3VR3 A;  5CBE E;  5KRU A;  1SJE D;  2EE1 A;  2N55 A;  1DOK A;  5JEA J;  1U4L A;  3N6R A;  1TS2 A;  4P2C B;  2D9U A;  3VR5 A;  5IT9 E;  2F1M A;  2HCC A;  1JE4 A;  3C1E A;  4QCL A;  3ITP A;  2G9D A;  1W6J A;  2F0G A;  2M9V A;  1STA A;  1U4M A;  4E6I A;  5DEH A;  1TVX A;  2YYZ A;  3TP6 A;  4K8J A;  3I3C A;  3PIO 3;  2PO4 A;  1SNP A;  1FYC A;  1NUC A;  1SDF A;  1U4P A;  3RZO B;  5IIF A;  3M4Y A;  1SMY C;  1E2W A;  1R4Q B;  5JPN C;  1SMY D;  4OO1 H;  2FJ2 A;  1PRT F;  2N88 A;  1KDC A;  1ROD A;  1RDP D;  4ZRZ A;  2RVL A;  3X3M A;  4HED A;  1IKL A;  2B2W A;  4KY7 A;  2EYP A;  2J7Z A;  3D8G A;  3LWU A;  2E2H B;  3NTI A;  3SEB A;  1ET9 A;  3M85 A;  4TQU S;  4HCE A;  5D65 A;  1VMC A;  4IN3 A;  2R6G A;  1OXS C;  2C5C A;  3AB9 A;  3DEP A;  4KTA A;  5C6A A;  4KN7 C;  1M4V A;  2E75 C;  2CQA A;  4BA1 I;  1D5M C;  1O78 A;  3OOC A;  4K5V A;  2B63 B;  4M1U B;  1AZP A;  5KIX A;  2BCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...