1Y69U

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y69U01
2K7VA 1E2ZA 1GJXA 3QJYA 3PUWA 1Q12A 3FPPA 1VF5C 3I72A 2BA1A 2YYZA 2D2CC 3QIAA 4XTCS 2BDOA 2JEBI 3U9SA 2K33A 3MXUA 3PUYA 4JK1C 2JXMB 1H9KA 4KN4C 4RCNA 1HQMC 3BDOA 5JEAG 3OPOA 2A6HC 3CRKC 1YNNC 4KKTA 3VR6A 3N6RA 3W3AA 3MFYA 4KI0A 1BDOA 3A8IE 2E75C 1HCZA 2PPBC 2A69C 4G7HC 3T56B 1V43A 2B8GA 4H44C 2B8FA 3TZUA 1Y8NB 3A7LA 3I73A 3L7ZC 2A6EC 2EJFC 3EQLC 1TKWB 1V8QA 2L5TA 4PV1C 4DNRB 1HPCA 2A6HD 5C0XG 4G7OC 4DK1A 5BN3A 3M4YA 1Y8OB 4TQUS 1EWHA 1GHJA 2NN6H 2A69D 4IFDH 4IQZA 1ZKOA 4DK0A 1HTPA 1K8MA 2AWOA 1H9RA 1PMRA 1E2VA 2A6ED 3CRLC 5C0XH 3OW7A 1Z7TA 3SDZA 1Q1EA 3VR3A 4G7ZC 1GUNA 2E74C 3D31A 1LABA 3RLFA 2R6GA 3VR4A 1Y69U 1IYUA 2NN6G 1H9JA 1H9MA 2DNCA 3LWUA 1VCIA 4IFDG 1DD2A 3HGBA 3VA7A 3OOCA 1TU2B 5K36H 1H9SB 4I7ZC 1FYCA 1Y8PB 2E76C 2JE6I 1I6VC 1CTMA 2V4DA 3A8KE 3AB9A 3QG1A 4KKUA 5KNBA 1CFMA 3H94A 3SE0A 1T5EA 2DNEA 3T53B 4DNTB 3GD7A 2D62A 4TKOB 1GUTA 1ZYRC 1GUSA 1SMYC 1O7LA 3LNNA 2Q8IB 4H0LC 5KNCA 1VF7A 3ND9A 3M85A 2NN6I 4LJZC 3T51B 3VR2A 5K36G 5BN4A 2IT1A 2QF7A 2O5IC 1VDZA 4BA2I 1DXMA 1QJOA 2CW0C 2EVBA 3PUZA 4OGQC 3PV0A 1DCZA 2PNRC 3PUXA 1CI3M 1OXTA 2F1MA 2D5DA 4LK1C 2KCCA 2AUJD 3P20A 4KMUC 3WDNA 5KNDA 4GZYC 1GHKA 2EJMA 4OO1H 2JEAI 1B9NA 4L8JA 3D4RA 3BG3A 2BE5C 1GUGA 2AUKA 3KLRA 1K8OA 2EJGC 3A8JE 1Z6HA 2PCFB 4H13C 4JBWA 3GQBA 3VR5A 1OXSC 1E2WA 3PUVA 1Q90A 2ZT9C 1YNJC 2BA0A 1IW7C 2K32A 1LACA 3IFTA 3IKJA 4KN7C 1IYVA 2A68C 3DXJC 1OXUA 2BE5D 1Q1BA 2O5JC 3FMCA 4OO1G 4KHZA 2DN8A 1FR3A 3M7NA 2LMCB 4KKSA 1A6XA 1OXVA 2EDGA 1O78A 1ONLA 1B9MA 1OXXK 3NE5B 1IW7D 5BN5A 1G291 3A7AB 4BA1I 2KA7A 5A35A 2A68D 5JEAH 1H9SA 4HR7B 4XIGS 3ND8A 1GUOA 3I4LA
chains in the Genus database with same CATH superfamily
3S1QH 5D65A 1GJXA 1EOTA 1XJVA 4B3TL 4XTCS 1Q7YC 3NSWA 3PUYA 3H0GH 2JXMB 1H9KA 4ME5A 1HR0L 3CRKC 4KKTA 5EJWA 1LT4D 1EIGA 2E75C 2KHJA 2E5LL 1PLFA 3VDYA 4A3JH 4XXEA 1BCPF 3OWEB 3NEMA 4ZKBB 5E1FA 1WJJA 2DY7A 5J22A 1WTVA 1Q81C 3GP7A 5DNFA 4QMGA 1JMCA 2RDFA 1Y8OB 4MIUA 3UE1A 1XPRA 1HNXL 1EWHA 1G6PA 1DJRD 2UXCQ 4BS9A 1S5FD 4H02A 4IQZA 2KEDA 5IGEA 2ZTCA 2WINB 2IX0A 1SYCA 2Y0SE 2RSNA 2UU9L 1PFBA 3L9AX 2YV5A 4WRDA 4JG2A 1HRJA 2KHIA 3LWUA 1JB3A 3VA7A 5JJKA 4LF5L 1I4QA 4A3GG 1H9SB 3KK7A 3L0OA 2NBFA 1TWCH 4H7BA 1PH1A 3R8BA 3T53B 3HZXA 2G9HD 1DGSA 1QNUA 3W1BA 4FNFA 2CCZA 4HCSA 3KF6A 1F9QA 2FXQA 1E0BA 4BBSB 1SE3A 2GN5A 3VA5A 4AH6A 2Z4IA 2JA8G 1KNEA 4X65L 1EFWA 1K8GA 1TWFH 3NBHA 4F87A 3DUZA 5IGFA 3CCQA 3WDNA 4X62L 2QEXA 4HIDA 1XMQQ 1PVOA 4L8JA 4PNYA 3G7LA 4WFN3 3KLRA 5IGBA 1S40A 4EQOA 1K8OA 1IL8A 1PDQA 1Z6HA 1II3A 3EA6A 3HOZH 3CF5A 4K0KL 3S16H 4LW1A 1PZID 1B1ZA 4R8IA 1BCPB 1D8LA 3NTIA 4DNIA 4HJ8A 1SE8A 1OXUA 2WKCA 1S5CD 1IBLQ 1IBKQ 4JBMA 2DN8A 4L5TA 3CD6A 2FMMA 5D14A 4B3RL 5CV9A 4GNXC 4JI1Q 1BOSA 2F0JA 5HGQA 1EY5A 3GO5A 1O7YA 4DUZL 4M8AA 4A3MH 4C3IH 1KAWA 4NXML 3BJUA 3HOVB 1I50H 1N8RC 5JPNC 4IUNA 3PUWA 4HIMA 4N8FA 1A3VA 5BR8L 3HOXG 4C1NI 4A3KH 1YZ6A 1EUJA 2R7ZG 2JA5B 3UDXA 1V1PA 4K0KQ 5FLMH 5C4HA 3K0XA 1HZBA 4KY7A 1YHAA 4DNRB 4IALA 1PZJD 4BY7G 1HNZQ 3RZDB 1PMRA 1Z47A 3J81j 4BY1G 1JCKB 2NTSA 3KF6B 3TP7A 2B2TC 2M2LA 4BBRB 4AQYL 4N9PA 1SAPA 4JI5Q 3NBHB 1MIUA 4JI4Q 1EY8A 5D3DA 1DD2A 2EYPA 3V05A 4BXXH 3P7JA 3D0FA 2R7FA 5FLXc 4DPGA 5IY0A 2GVBA 5KNBA 3SE0A 1AN8A 3JAMc 3U4ZA 3GTKB 5AJ3Q 3PO3H 1VQKA 2RDHA 3SR1A 5KNCA 3ULLA 5I2YA 3G6EA 2Z8LA 4CKBA 5IGCA 1JE5A 2Y0SB 2F0SA 3E0EA 4F88A 3TDQA 2EVBA 3SGIA 1MJCA 1X3PA 4RGMA 2KCCA 4JI6Q 1YJNA 3TEHB 1GHKA 3QWNA 3T1HQ 1I4RA 1B9NA 1X9NA 2K6AA 2L1BA 1UNSA 4OXPA 3VR5A 2I5LX 5C4JB 1E2WA 2BA0A 1HNWL 2ZJQA 4GN5A 1K73C 1B3QA 1LV9A 3NELA 5CV8A 2XTIA 1TWGH 2UUCQ 1Y1VG 3PO2G 5LHY1 4KJOA 2EY1A 2EDGA 3W1GA 4CBVA 1STAA 1VQHA 2OTLA 5EPKA 1R9TH 1CKOA 4HR7B 1XNRQ 2F4VQ 1EEID 2NVTH 1X3FA 1YVCA 2K7VA 3A74A 3M4PA 3ERSX 3KOJA 4X6AH 1PTOD 2D2CC 5C0XJ 1U4MA 1JB7A 4KN4C 1WOCA 4RCNA 5IODA 2UUAQ 3VR6A 1YNNC 1FJGL 1D5MC 3N6RA 1ICWA 2B63H 4KI0A 3ZJYC 4A3CH 3I4OA 2E2DC 1TS4A 4U68A 2B8FA 1DYQA 1I5FA 2H4OA 3R2TA 1A62A 3T16A 3MZ5A 3J7AF 1V8QA 1S4ZA 4DF7A 4A3LH 4ZRZA 5E3FA 5IT9L 2PYKA 2A8VA 3MFGA 2CWPA 3FEWX 2B2VC 2OWOA 2HHHL 2XGTA 4Y7NB 4ALPA 2KOLA 4OWXB 1EZ8A 5FO8B 4POGA 1E24A 3VYRA 3LGJA 3BDCA 2K4KA 5LMUQ 3CC2A 3TP6A 3J80c 1ENAA 1N9WA 1Y1WH 2MP1A 3PF5A 1GD7A 2WV6D 3CC7A 5JVG3 4YIJA 1KLUD 1RTOA 2E76C 2N49A 3ULPA 3FVQA 4DV4Q 4X64Q 1MGSA 1XXGA 1B8AA 3GD7A 1XTDA 4WORA 1VS0A 1TY2A 1VQGA 1XTCD 4LF7L 4BBSG 2R93H 4XT1B 4PMWA 4KY5A 2VQFQ 1DXMA 3HEJA 2E2IB 4NP5A 4O1NA 5IT9c 1DCZA 2IX1A 3T4AC 4QUFA 2JA7G 5GAGC 4CJ0B 4GZYC 2PW7A 2I46A 5CV5A 2LFNA 1PYWD 1HTLD 3DWPA 1SJHD 4OWWB 3NPPA 5IYBH 4H13C 1KTKA 1FNWA 5CGKA 4GKKQ 3CCEA 2IY5B 4IUVA 3OYYA 1F2ZA 2VQEQ 2NZHA 3IKJA 2NB0A 4NKLA 3QB3A 3C46A 3ICEA 5C44B 1D1IA 1KQSA 1FGUA 4DK6C 2F0FA 4G57A 1PFSA 2I5MX 3R93A 1B3AA 1CUKA 4DV0Q 1A2UA 3R3OA 1SLJA 2NVXH 2L0CA 2LKVA 2KQ3A 4GOPC 2XNAC 1S5BD 4B9XA 4DV5L 4DR2Q 3S14H 2EXZA 2ICEC 4OL7A 5C4XH 3C3LA 1KDBA 2NZ1D 5JEAG 3PMFA 3VYUA 1J5EL 2F0TA 3S17B 3QOJA 5EBCA 5JPMC 4KHPQ 2JA5G 3A8IE 2PPBC 4FO2A 5M5WB 2GVAA 4DR6L 1YI2A 3QO2A 4YWMA 5LL6X 1SNMA 1L1OA 3TSSA 1YNND 1JJCB 1VQ6A 4EQ5A 4JI7L 4J1MA 4DAVA 3J81E 1PXUA 3OW7A 1ESRA 4CDCC 4A3IB 1SXTA 2HUGA 2MUYA 3RLFA 2QEJC 3RLOA 1Y69U 1I6HH 2ID0A 1HUMA 5C3EB 2NVYH 1T9HA 3J81L 4DV5Q 1RKNA 4DR5Q 1FYCA 1Y8PB 3EROA 4IZ8A 3HOYG 3A8KE 2V4DA 2RHSB 1STHA 1I4GA 1EEFD 2K50A 4GKJQ 2B3GA 5IYCH 5ELNA 1N34L 5DLQE 1NBWA 2PNHA 2JA6H 4A93G 5FO9B 4J8QA 1HFNA 2Y0SG 4AIMA 4DV2Q 1NR4A 4OGQC 5M3FG 1BBWA 1HA5A 2IL8A 2KVMA 4ZAIA 3P20A 4JI7Q 2CFMA 2HIXA 1F2LA 2EJMA 2O2LD 3NUCA 5FJ8G 3MEHA 1HQRD 4A3BB 3E9HA 3A8JE 1A2TA 2JK8A 4A3FG 3RLNA 3MXNA 2UXBL 1GUWA 2VUMB 2LMCB 4JI0Q 4L63B 2E2HB 3CMAA 2UXDL 1O80A 1ONLA 1G291 3TREA 4K8IA 1YHQA 4DAYA 4XIGS 1CZWA 3CKIB 4K5WA 3FRPB 3QJYA 1Q12A 1NY4A 2KUMA 4FXGC 4FYDA 4HJ7A 1XPUA 1U4LA 2RA4A 3H3VC 1SNDA 1C0AA 1NUCA 3ZYYX 1VQOA 2ENBA 1IZ6A 1JT8A 2AMCB 3S2DH 4LWCA 2YTVA 4JI2Q 4A3EB 1HPCA 1C4QA 4ZLTF 5M5YH 1A63A 4YWLA 4ZK9B 4DFAA 4KD3A 1YHBA 1KDAA 3STBC 1HXYD 4HSVA 4LFBQ 4A3GH 4LF8Q 1H9RA 2AQ1B 2VZAA 4F7XA 1P8LA 5CV7A 1PRTC 2A5HA 2N55A 3C1EA 4QF4A 4DUYQ 2RF4A 1KXLA 1YJ9A 4JOIA 2Z6KC 1M1KC 4OX9L 4DR1Q 3E6ZX 2JA8H 2BH2A 3BDLA 4A4IA 1TIID 4C2MB 4DK3C 2OF1A 1CTMA 3TQYA 3QG1A 1QUQB 1V9PA 1CK1A 3VYTA 1LO5D 1BBUA 2K05A 3M85A 4DV6Q 5K36G 3CQZH 4L5RC 4JI8L 3E0JA 2ZXRA 4C3JB 1EZ6A 1TXYA 1I94L 1B7YB 3CP0A 3KLWA 4HMIA 4MHEA 5CV6A 4DAYB 3DMUA 1VQPA 4OX9Q 1HJPA 1EWCA 3PUVA 3IAYA 4C1NK 2LXJA 1OTCA 1TWHB 3S2HH 4XQQA 1D5XC 2JSOA 2FINB 1LTGD 2J7ZA 4NDXA 5CR3A 1D6EC 1D1KA 1I3QH 3HOXH 1H9SA 5C5MA 3H0GB 4B9WA 2R7ZH 2C9OA 2FJ2A 1WTHA 5FO7B 5A2QL 4A3JB 2BA1A 2EY5A 4IURA 1RDPD 2SNMA 1PH7A 2QDLA 4DR7L 2WIIB 3OPOA 4BY7H 3W3AA 3MFYA 2NWGA 2VY3A 4BY1H 5JJLA 3CHBD 1H95A 3EN2A 1UE1A 5J1ZA 1QOHA 2QKIC 4HIOA 3UDGA 4R4OA 3NWSA 3H3VH 1VQBA 2J4XA 4DK1A 4DR4Q 1GHJA 3HOWG 3S1RH 5HY6A 3EJIA 1ASYA 1SFOH 4G4KA 3K6OA 2XN9C 1XNQL 5M5XH 1FL0A 2F03A 2XRSD 3OMGA 3NBIA 2SNSA 4DR3Q 4GLXA 1TWCB 1N32L 2AQ2B 2F0OA 3I4MB 3BZKA 5C3EG 1EU3A 3TN2A 4IFDG 2VXWA 2KHSA 3K8AA 1PRTD 5G3LD 1XPOA 4I7ZC 4DR7Q 3I91A 5KIXA 1LTRD 3I56A 3MC0B 2DNEA 1EYAA 1RD9D 5CV4A 5JVH3 1CM9A 3K7AH 1MKHA 5JAVA 4JV5Q 2K5DA 2IT1A 3GTLH 1Q3LA 4JBJA 1G6ZA 2PNRC 2F0DA 4X66L 1W6JA 1PH8A 2Q2IA 4B3TQ 4P73A 3DLLA 3MTSA 1F2YA 1Y1VH 3TP8A 4A76A 2BE5C 1HR0Q 1GUGA 3PO2H 5IGGA 4DV1L 2PCFB 3GQBA 1LYLA 2E5LQ 1X3QA 2XRQD 1Q90A 1XWEA 1IW7C 1W6KA 4JBKA 4A3MB 1C48A 3WOFA 3F2CA 1HNXQ 3RMHA 2YU9B 3F2UA 1I50B 1PYBA 4DXGA 1VQIA 2KECA 2WB1E 2KA7A 4P2CB 1SYFA 1M90C 2UU9Q 4AYBE 4RWSC 1EIHA 3TZDA 1KIXA 2RHQB 1EYGA 1KRTA 3I7FA 3ITPA 3W5OA 2RVLA 2MHVA 4LF5Q 1K0RA 1NE3A 4RA8A 3F1ZA 5GQOA 4GNXA 2HQEA 2L15A 5CORA 2HQLA 1QVGA 1SE2A 2OT2A 3SHLA 1S5ED 3A0JA 5FLXE 3HG9A 5KEEA 5DAUA 4A3EG 3OWFA 4RCOA 4G7OC 3CU7A 4X65Q 4LUOA 4LFCL 5T1GA 2FMCA 1SYBA 2RSOA 5FLXL 1AE3A 4I7AA 5EAYA 4X62Q 3UI2A 1PTOF 2MO1A 1YBYA 2M9VA 2WACA 4KK7A 5C0XH 5M3MG 1Q1EA 1QZGA 5CYUA 1GUNA 2UUBL 3JAML 4UY8C 1JOKA 3BZDB 5IYDG 2B2WA 3MXGA 4YY3L 1H9JA 2EZVA 2MFIA 3PSIA 2WAQE 1B50A 2XSCA 1X56A 2EYJA 2BOSA 2RBMA 4R4IA 4CGYB 1ENCA 1EY4A 1JICA 2R3ZA 4PZ6A 2JA7H 3OIQA 4B3RQ 2B39A 3H3VI 3I2ZA 4H0LC 2B2TA 1STEA 4LJZC 4Q0FA 3MAQA 4DUZQ 3VR2A 4LMQD 2HIVA 4NXMQ 2NVQH 1JC7A 3D6WA 3PUXA 1OXTA 3GV6A 1R4PB 3SK8A 4EGVA 3K81C 5BR8Q 2Q2TA 1UUPA 2I07B 1JJ2A 1RL2A 2RCFA 2EYLA 3TBIB 3OHXC 4EQPA 4LF9L 3GTQH 4YY3Q 4XT3B 4EX5A 3T1YL 1NSNS 2N8NA 2BE5D 4QY7A 2VB2X 2F0VA 4GS3A 5FK9C 4GNXB 3DM1A 1RTNA 1O78A 4HSPA 5BN5A 1IW7D 1SNQA 4FDBA 1PTOB 4IJHA 5JEAH 1CQFA 2HT1A 4JYAL 2D9UA 3H0GG 4AQYQ 2JA5H 2PO4A 4QJFA 2B63B 1E2ZA 4QCLA 1STBA 3J7AV 2BDOA 4ME3A 4GN4B 2MJ8A 2MNAA 1MBYA 3D4WA 4LF9Q 4IUTA 2A69C 1V43A 2B8GA 4X3KA 3T1YQ 2K03A 5CC4A 5CMDA 1BR9A 2OTJA 3DM3A 2WB1B 1VMCA 2CQOA 1LM0A 1X6OA 1C7YA 4LF6L 3J80L 2OQKA 2IW3A 3NXWA 4AYBB 1Y1WB 4KY6A 3TP5A 1IKMA 3HOYH 3DEOA 1ET9A 3M3YH 3IRBA 2XWBB 3D31A 4HCEA 2AWNA 2WFWA 5IT9E 1A3TA 5NUCA 3I4MG 1RIPA 1K83H 3AQQA 4A93H 5LMNL 1TU2B 3OTOL 4B3ML 1XMOL 4QIWE 3HKZE 1HNWQ 1EY9A 5FOBB 3HP3A 2R93B 4KHVA 5M3FH 4LNQA 4CKEA 4CDEC 3E5SA 3AU7A 1T5EA 1JORA 5EPJA 3N52A 3J7A5 1O7LA 5FJ8H 2F0UA 3FPUB 3U50C 3URYA 4IPCA 2D0PA 2A74C 3AFQA 4BA2I 4A3FH 3CCJA 1K8AC 4HJ5A 4UDUC 4RGOS 3V2TA 4O2DA 5C0XI 3NWTA 2RDGA 2J0TD 1HR0W 2WAQB 3BG3A 1CQVA 3CAMA 3B6YA 1FJGQ 2AKWB 2EJGC 1SE4A 4JBWA 1F77A 2EPBA 4RKBA 2L9HA 3MXPA 3CPWA 1EIFA 3P1HA 1SRUA 3M4OB 1XMOQ 4B3SL 1IYVA 1N33L 3OMCA 4FF3A 1WTWA 1CKMA 3UDIA 4RHSA 3J7ZC 2HHHQ 4CKCA 5TSSA 2K04A 2QW7A 5JEAJ 3S14B 1PH5A 3NQIA 1HZCA 5EKIA 2ZTEA 2F3VA 2CHBD 4V190 4O0AA 5C3WA 4DU9A 3G71A 3U9SA 5C5LA 1YJWA 4OWTB 2F4IA 4ZYSA 1Q86C 3GTGH 4C3HB 3A54A 1YEZA 4G7HC 2A73B 3SK5A 3T56B 1Q8IA 4JI3L 3K7UC 1CKNA 3L7ZC 1G2SA 1LT6D 2MQHA 4DKAC 4LF7Q 1NJIC 2SDFA 1B70B 2A69D 1BNZA 1C8CA 3HOVG 1XX8A 3K5OA 4FXDA 3LWEA 3D3RA 1KNAA 1E2VA 4RH6A 2PQEA 3H91A 4P75A 1CA6A 1IBML 2ES2A 2CQAA 4BXXG 2B2YA 1QNKA 3ULJA 4DN4M 4MZ9A 2CWAA 2R6GA 4QGUA 2JA9A 2NN6G 1VQAA 1HUNA 2CKZB 2VB3X 1NAPA 2NTTA 4DV3L 5K36H 1BQQT 4M1UB 2JA6B 2EY6A 3H94A 2F52A 2HDMA 4XDXA 1X54A 2ZXOA 1GUTA 3TS2A 3BVGA 3A5ZB 3IL8A 1BF4A 1X55A 1KAAA 1GKHA 4NXNL 1DOLA 2K28A 3D8GA 1MHWC 4BBRG 4ZUIA 1VDZA 4DXFA 1UWVA 2JYOA 3NENA 2L4NA 2ZTDA 4NB3A 3OIPA 1UE7A 1O7IA 1DOKA 1VQFA 2JEAI 1L1OC 1HZAA 2KBNA 2B2UC 4L5QA 2L11A 3HKZB 4QIWB 3X3NA 1J5EQ 5KYIA 1N36L 2QA4A 1OXSC 1MSGA 1UAPA 5EKLA 1Q8KA 1CHPD 4DV3Q 4DV7L 4DR6Q 2JJQA 2A68C 3DXJC 1ILQA 1K28A 3HOUB 1Q1BA 2F0WA 2ZM6L 3S1NH 2X69A 4RFBA 4OO1G 2O5JC 1G8ZD 2IPKD 1U4RA 3RN5A 3FKIB 4LFAL 3NE5B 1B9MA 2EYHA 4NXNQ 3PGZA 1JOOA 3EFXD 1GOZA 3EBEA 4YCWA 1CKNB 4OONA 2DGYA 1MI2A 4E6IA 1QUQA 4GOPB 3J81i 1VF5C 3I72A 3PCOB 4CJ1B 2F3IA 1NR2A 2N78A 2Z4HA 3MXUA 3S1MB 3S2DB 1LTTD 1UEBA 3HOWH 5M5YB 3KLSX 5CBEE 1BDOA 3H15A 1HCZA 2SOBA 2OEOA 2O4XA 4H44C 4A3GB 3I4NB 3GTOH 1N34Q 1M8AA 4QB4A 2A6EC 4MTKA 3RR5A 3TMEA 3PQIA 4PV1C 1CZGA 4BWGB 3I70A 1UE5A 4UP8A 4IOCA 3C1FA 4TQUS 4K2LA 5HURA 4IFDH 5C6AA 2K75A 4KTAA 1JQYD 4AYBG 2AWOA 4IPHA 4NW2A 4JVZA 2JA8B 1QG7A 1DM0B 4K6DA 4KJNA 2YTYA 5F2DA 5GADC 5IWAL 4G7ZC 2E74C 1YNXA 2RKSA 1LABA 5J3BA 3RNUA 1DONA 1IXRA 1IYUA 4LAAA 5AFWA 1AZPA 2R92B 2E8GA 1TWAB 1BUVT 2UXBQ 4F8MA 1JWMD 4EQNA 1WTXA 2KCTA 1PV4A 2HDLA 2PI2E 4MTNA 4PZ7A 5DM63 2HCCA 4A3DB 2UXDQ 1ZYRC 2Q8IB 1SMYC 5IP7G 4QQBX 4OIJA 3UDFA 1WCMB 2F0KA 5I9PA 4K8JA 5GROA 1S72A 2Z6KA 5C3XA 2GA4B 1CI3M 2F1MA 2XVSA 4KMUC 3NTKA 3SEBA 1PH6A 1Q46A 2Q8RE 2AHOB 2OQ0A 3PIPA 2WAQG 1TS3A 2WP8J 2AUKA 1WTPA 3D4DA 1JJGA 3MVVA 3CCMA 5CBAE 1QB5D 3BU2A 5JJZA 2K5VA 2EQSA 4MNOA 3HOXB 3CPFA 4PZ8A 2E2JH 1TT2A 1NMGA 1V1QA 4PG3A 2VNUD 4PQXA 2Q2UA 3DWQA 1A6XA 2PQAA 4HTHA 3SXHA 4JC0A 1OXXK 4QUCA 2HCIA 3Q0AA 2A68D 1EY7A 2QILA 2F0LA 2CH4A 3GTJH 1EFID 1U4PA 2YTXA 1AEXA 5EGTA 4BY7B 1YITA 5ELEA 4J15A 4BY1B 2KCNA 2PI2A 4A3EH 4N9TA 4FF4A 4YCVA 1AFPA 1LTID 4JK1C 5KGUA 1L0YB 5JJIA 3IFDA 1X3GA 3MHBA 4ID6A 3ERQA 1D7QA 2A6HC 3KJPA 4C3HG 3F2BA 1L2FA 3S1RB 3S1QB 1SFOB 5C44G 5M5XB 1FNVA 2PW5A 5M3MH 4CJ2C 5A2QE 2ICIA 4R4TA 3HKSA 3RUZA 1PHJA 2L12A 3Q23A 3CCSA 5IYDH 4I65A 5LL6S 4IFDJ 1GXDC 2K1BA 3F8TA 2C35B 4JI8Q 1K8MA 1I94Q 4XYOA 2A6ED 3CRLC 3S15H 3E3XA 1PRTB 1Z7TA 1ILPA 4TVAB 1GM5A 3OSOA 1D2BA 1TS2A 1H9MA 3KF8A 3HGBA 2EOTA 3K7AB 3OOCA 1WTQA 4Z9CB 1QCBD 1SDFA 3GTLB 3GTPH 1WFQA 2B29A 1SNCA 2Z9HA 3RZOH 3GV3A 4IFDI 3PO2B 2UXCL 1TR5A 1QJOA 2CW0C 2OXPA 3DHQA 4APVA 5ELCA 4A3IG 2PQAB 3STBD 4LK1C 1BKBA 1SMYD 1TWHH 3GTMH 2PZUA 2N88A 1OO9B 1NNXA 1QWYA 4ULLA 5ELDA 3L3OC 1TWFB 1VQ4A 3H09A 4ZKCB 1BCPC 2ZT9C 5ELOA 3E9IA 4IN3A 1JE4A 3IFTA 4ILWA 1SNOA 3UE0A 1SROA 1VQEA 2QGQA 3FMCA 3HOUG 1VQ8A 4KKSA 3T13A 3WOEA 3ONAB 4DGZA 1SEBD 1KLGD 1LT3D 3MWYW 3FKIG 1XNQQ 3HOZB 4BA1I 3S16B 5A35A 1PFNA 5L37A 1K3BC 2K5HA 1EWIA 1N32Q 1CHQD 4A3BG 1AZQA 2F0NA 4X3TA 3O13A 3Q24A 1LT5D 1EYCA 2QDBA 2VW9A 1XMQL 1J8IA 3HRZC 1LLRD 1NTGA 4C3IB 2VUMG 1ZXTA 2DJFC 3KUPA 4RKLA 3BVMA 4UPAA 5IP9G 1RJTA 1SN8A 3SVMA 3KF8B 3Q8DA 4KD4A 3I4NG 1M4VA 2EJFC 1F9RA 1IBLL 1TKWB 1O7ZA 1IBKL 2A6HD 4K5XA 2XIWA 4A3KB 3I4MH 1B44D 1STNA 1K3RA 2KCMA 3G6JB 4JI1L 4DK0A 4X66Q 3OW2A 1F9SA 1P16A 1VMPA 2EYMA 4CHTB 4DA2A 1PH4A 3VR4A 4DV1Q 2JA7B 1JOQA 2EY2A 2R92G 5EKKA 3HFZB 1BBXC 1VQNA 2F0MA 2NVQB 3KLSA 4K14A 4TKOB 4X3UA 2DUDA 3JAME 4A3DG 1RODA 3M9BA 5K5PA 1VF7A 2OCEA 2K01A 1WCMG 4Q5VA 2H1EA 1KABA 1HNZL 1ASZA 3GTQB 5D3IB 3VYSA 3PO3B 5KNDA 1PTOC 4BBSH 1E1TA 4ODGA 1Z9FA 4P72A 5I6WA 4JI5L 1I4HA 2CW0D 1S3OA 2X6GA 4OEMB 1L0WA 3EVQA 1GVPA 4YHHL 2YU9H 4JI4L 3C2PA 4P71A 1KC8C 3ER0A 4HAEA 1ET6A 2FFKB 1I4PA 1YNJC 2AQ3B 4RAUC 2K5QA 3D6CA 4FVMA 1EQTA 3AMUA 5AJ3L 3GDEA 2F0EA 4LFCQ 2B2WC 4C3JG 2CH4W 1BCPD 3CCLA 2KJXA 5ELFA 1SR3A 4L5SA 2BDNA 3JAMi 4UP9A 2G5DA 2UUBQ 1TWGB 4JI6L 5I9OA 3T1HL 2LXKA 4IO9A 3KFUA 1CT1D 1K0SA 1R9TB 3BDOA 1LTAD 1EOVA 4O42A 4YHHQ 3NHHA 3HOVH 2R7DA 4HN7A 2NVTB 4OELB 1U0LA 4NPSA 3FP9A 3K5LA 1VQDA 2KEEA 3HOYB 5M9OA 3M3YB 4KLKA 2IHEA 5BN3A 3M4YA 2UUCL 2NN6H 2BCOA 3NK9A 4OHJA 1KHIA 1UE6A 1K83B 1E1OA 4A93B 4A3JG 1XNRL 2IX3A 2F4VL 4NMZA 3K5NA 5M3FB 3S9WA 4GLVB 4RG1A 2QCPX 3CCRA 1W3SA 2PZWA 3RZDH 2DNCA 3QOLA 1VCIA 1E3PA 3J80E 4HIKA 4BBRH 2MO0A 3DEPA 1AP0A 4TRDA 4QL5A 2UUAL 1UEAB 4A3FB 1KRSA 2XWJB 4X3SA 4EVOA 1B53A 1RF2D 2V1CC 4JYAQ 1WI5A 1LTLA 2IWHA 2TMPA 2A1AA 1R4QB 1CA5A 3GTKH 3PV0A 1V1PB 4R1JA 4OO1H 3CMEA 1F2MA 3X3MA 5LMUL 5IE8A 4RGTA 4K6LA 2B2VA 3M4QA 2R61A 3KBXA 3CCUA 1KDCA 1VQMA 1PTOH 4ZUJA 1TQOA 2K32A 3K0YA 1BVSA 3J7YW 2SEBD 1IHZA 3I90A 3I55A 4DV4L 5I6YA 4LF6Q 3M7NA 1ICFB 4X64L 4K5VA 3J80i 2Z0SA 1T5XD 5ELBA 1VQLA 1EY6A 5C4JH 2K5WA 5T1IA 1YNJD 3KDFA 2I0QA 3HOZG 2NYZD 4UAIA 5KRUA 1EIYB 1F9PA 1A0IA 2VQFL 3GTGB 4IUQA 1GUOA 3I4LA 4FF2A 1STGA 2CVRA 1JWSD 5E4XA 4PMCA 3FPPA 4XQJA 1Y14B 2JEBI 5LMNQ 3OTOQ 4B3MQ 2Z1CA 1E7ZA 1SJED 1PH2A 1K9MC 2MPMA 4A3MG 1PFMA 4C3IG 1EY0A 4P74A 4GKKL 2K52A 2NVXB 2VQEL 3BS1A 3WWVA 3A7LA 2DY8A 3EQLC 1LUZA 5GAHC 2JP1A 5C0XG 3K58A 5C4XB 1A8VA 1SYGA 5COYA 3SK6A 4A3KG 4RMFA 1A15A 1D5ZC 1ZKOA 3I3CA 1HTPA 5DEHA 2M00A 4DV0L 1IL2A 5GAEC 3SK4A 1VQ9A 5FLMG 2LS01 2MGSA 4JPBW 3KBGA 5IP7H 4Y7NH 1GO3E 4IUPA 4DR2L 1ENFA 4JCVE 4ZQ3A 4B3SQ 1QVFA 1X32A 1N33Q 4FXKC 1I6VC 3AB9A 4KHPL 1CFMA 3KYHC 3MEFA 4JW0A 2EE1A 4B08A 4GOPA 3CXCA 1I6HB 4CDFC 3LNNA 1GUSA 3TRZA 3R2IA 2NVYB 3AYHB 3TS0A 2NN6I 3T51B 1B2TA 1ESFA 5I2XA 3I8ZA 1RCVD 4CDDC 1PA6A 2LSSA 3H6MA 3M4OH 1CSQA 3PO3G 4IPGA 1WD0A 1G2TA 3KDFB 2F0PA 1B4OA 1RHPA 1EQRA 2TSSA 5EPLA 4POFA 4C56C 1AH9A 1HHVA 4R8NA 3D4RA 1HZ9A 1EQQA 4N8X1 4RHRA 1QE6A 3S1NB 4R4CA 2E2IH 2ALYB 1J6QA 1YIJA 1SYEA 1EL0A 5E4WC 1G51A 2F0GA 3A56A 4HJAA 4DR5L 2D0OA 1LACA 4JI3Q 3U58A 4FF1A 2C5CA 3MA2B 2B2YC 4KHZA 3DWAA 1CSPA 1I4XA 2K14A 3FHWA 4GKJL 3K80C 3F2DA 3PF4A 4DAPA 4LUZA 1W2BA 1QZHA 1PH9A 5HGTA 1IBMQ 2KENA 5I4DA 5IIFA 2A19A 2N3SA 2PMZE 2B2UA 4HEDA 4TSSA 4C3HH 4V0BA 3NQTA 3HOWB 3ND8A 3VR3A 4DV2L 3LX0A 5DM73 5C44H 1VQ5A 2ATWA 4OO1I 2K5NA 4IUUA 4UP7A 2YYZA 3QIAA 3K5MA 3GTOB 3PIOA 4YCUA 3A55A 1AE2A 4WJ4A 3PIO3 1G91A 3Q22A 2EXDA 3I73A 3K59A 3RD4A 3BZCA 3S17H 5ISRA 1FNUA 2ZXPA 4JI0L 3M7GA 5M5WH 2B63G 2JQOA 1QVCA 3G4SA 1Q82C 4A3CG 4WJWA 4K2KA 4J6HA 3G48A 4ZCKA 4A3LG 1JWUD 2FHTA 4IJLA 2Z6BA 1N36Q 4FP5D 2VL6A 1AW7A 4PMBA 4XQNA 1PYSB 4IOAA 3NTHA 4DV7Q 1FVIA 4Y52H 1HFGA 2JE6I 1WTRA 2WB1G 2ZM6Q 4A3IH 5IGDA 2L55A 4DNTB 2LY7A 5C3EH 3CW2C 1V1OA 3P75A 2VS1A 1IYJB 5EBDA 4LFAQ 1Y1WG 3CCVA 3J81c 4JI2L 3BVZA 5BN4A 1U9RA 2QF7A 4XYQA 2O5IC 2F0HA 2IJ0A 3PUZA 5IOCA 4LFBL 2D5DA 4LF8L 3U9OA 2F3WA 2NUCA 4HJ9A 1SSOA 3HOUH 2NZOA 1E22A 1L1OB 4LF4L 2E2JB 3W2DA 4DUYL 2R93G 1ML0D 1TS5A 4GN3B 2P5ZX 4U673 3CQZB 1XYIA 3FKIH 1FGBD 3K57A 4DR1L 2BH8A 1NMFA 3S24A 4S3SA 4KN7C 2ZJRA 1EQVA 3CC4A 5EQ0A 3GTJB 4WJ3M 1FR3A 2RCNA 4A3BH 2ZJPA 2I5HA 2Q8TA 5IYBG 3S1MH 3U4VA 3A7AB 4DV6L 1STYA 2VUMH 3S2HB 1FD7D 1PRTF 5G3LF 3RN2A 4MN3A 1ZEQX 5IWAQ 5IP9H 2E2HH 3AFPA 3I4NH 3PIP3 3EIVA 5LMNW 5C4ZA 1DOMA 1I3QB 2K33A 1PZKD 5M3MB 4LF4Q 1HQMC 3BYTB 2R7ZB 4ABNA 4JOIC 3A5UA 1L0XB 4RGNA 5FKAC 2JN4A 2PZTA 3FDTA 1DZ1A 3TZUA 1Y8NB 4R9WA 3Q6SA 4A75A 3S15B 2L5TA 5J39A 1JR0D 1SYDA 5C4XG 1MSHA 4UHVA 2PMZB 1X3EA 1MJEA 1LTBD 2R92H 4HMJA 3L2PA 1EU4A 1MD2D 1TWAH 3MXNB 1HH2P 1U5KA 1SMXA 3SDZA 1KL9A 4GLAC 3GTPB 4A3DH 4IPDA 2EYOA 2RQXA 1WCMH 2F0IA 3JC66 1VQCA 1IKLA 3RZOB 1EYDA 5E7NA 2DJGC 4KKUA 2HD3A 2D62A 1SNPA 1WD1A 1A3UA 1X65A 3GTMB 3ND9A 2X6LA 4C2MH 4DR4L 1BXTA 1LTSD 1J9OA 1VQJA 2H5XA 1VQ7A 1HA6A 2AUJD 1KD1C 1S5DD 1WYDA 5JOBA 5IYCG 4DR3L 2F0QA 2WKDA 1WTOA 1WVLA 1TY0A 3NP8A 4LUVA 5H1SE 2JA6G 1QILA 4C3JH 3BYYB 4DAMA 1BO0A 3AEVA 2EIFA 2Q2HA 4OIKA 1Y1VB 3KJOA 1NCVA 1TVXA 2IHFA 1OXVA 1PH3A 5KYLA 1C9OA 1ZYRD 3V96A 2ASBA 1SBBB 4KV6A 2EYFA 2G9DA 3HS0C 3QR8A 4L6TB 4R4QA 4JV5L 4YWKA 3HKZG
chains in the Genus database with same CATH topology
5D65A 1GJXA 1EOTA 4XTCS 3NSWA 3PUYA 2JXMB 1H9KA 4ME5A 3CRKC 4KKTA 5EJWA 1LT4D 1EIGA 2E75C 1PLFA 4XXEA 1BCPF 3OWEB 4ZKBB 5E1FA 5J22A 2DY7A 1WTVA 3GP7A 5DNFA 4QMGA 2RDFA 1Y8OB 4MIUA 1EWHA 1DJRD 4BS9A 1S5FD 4IQZA 2KEDA 5IGEA 2WINB 2IX0A 1SYCA 2RSNA 1PFBA 3L9AX 4WRDA 1HRJA 3LWUA 1JB3A 3VA7A 1I4QA 1H9SB 3KK7A 2NBFA 4H7BA 3R8BA 3T53B 3HZXA 2G9HD 1QNUA 4FNFA 4HCSA 1F9QA 4BBSB 1E0BA 1SE3A 3VA5A 2Z4IA 1KNEA 3NBHA 4F87A 3DUZA 5IGFA 3WDNA 4L8JA 4PNYA 3G7LA 4WFN3 3KLRA 5IGBA 1K8OA 4EQOA 1IL8A 1PDQA 1Z6HA 1II3A 3EA6A 1PZID 1B1ZA 4R8IA 1BCPB 3NTIA 2WKCA 1OXUA 1S5CD 2DN8A 2FMMA 5D14A 5CV9A 1BOSA 2F0JA 1EY5A 3GO5A 1O7YA 4M8AA 3HOVB 5JPNC 4IUNA 3PUWA 1A3VA 4C1NI 2JA5B 1V1PA 5C4HA 4KY7A 4DNRB 4IALA 1PZJD 3RZDB 1PMRA 1Z47A 1JCKB 2NTSA 3TP7A 4BBRB 2B2TC 2M2LA 4N9PA 1SAPA 1EY8A 5D3DA 1DD2A 2EYPA 3V05A 3P7JA 5KNBA 3SE0A 1AN8A 3GTKB 2RDHA 3SR1A 5KNCA 5I2YA 2Z8LA 4CKBA 5IGCA 2Y0SB 2F0SA 4F88A 3TDQA 2EVBA 1X3PA 4RGMA 2KCCA 1GHKA 3QWNA 1I4RA 1B9NA 2K6AA 2L1BA 1UNSA 3VR5A 5C4JB 1E2WA 2BA0A 1LV9A 5CV8A 5LHY1 4KJOA 2EY1A 2EDGA 4CBVA 1STAA 5EPKA 4HR7B 1EEID 2K7VA 1PTOD 2D2CC 5C0XJ 1U4MA 4KN4C 4RCNA 5IODA 3VR6A 1YNNC 1D5MC 3N6RA 1ICWA 4KI0A 2E2DC 1TS4A 4U68A 2B8FA 1DYQA 2H4OA 3R2TA 3T16A 3MZ5A 3J7AF 1V8QA 1S4ZA 4DF7A 4ZRZA 5E3FA 5IT9L 2PYKA 3MFGA 3FEWX 2B2VC 4Y7NB 2KOLA 1EZ8A 5FO8B 3VYRA 3BDCA 3TP6A 1ENAA 2MP1A 2WV6D 5JVG3 4YIJA 1KLUD 1RTOA 2E76C 3FVQA 1MGSA 1XXGA 3GD7A 4WORA 1TY2A 1XTCD 4XT1B 4PMWA 4KY5A 1DXMA 3HEJA 2E2IB 4NP5A 4O1NA 1DCZA 2IX1A 3T4AC 4QUFA 4CJ0B 4GZYC 2PW7A 2I46A 5CV5A 2LFNA 1PYWD 1HTLD 3DWPA 1SJHD 3NPPA 4H13C 1KTKA 1FNWA 5CGKA 4IUVA 1F2ZA 3IKJA 2NB0A 4NKLA 3QB3A 3C46A 5C44B 1D1IA 2F0FA 4G57A 3R93A 1B3AA 1A2UA 3R3OA 2L0CA 2LKVA 2KQ3A 2XNAC 1S5BD 4B9XA 2EXZA 2ICEC 4OL7A 3C3LA 1KDBA 2NZ1D 5JEAG 3PMFA 3VYUA 2F0TA 3S17B 3QOJA 5EBCA 5JPMC 3A8IE 2PPBC 4FO2A 5M5WB 3QO2A 5LL6X 1SNMA 3TSSA 1YNND 4J1MA 4DAVA 3J81E 1PXUA 3OW7A 1ESRA 4A3IB 1SXTA 2HUGA 2MUYA 3RLFA 2QEJC 1Y69U 2ID0A 1HUMA 5C3EB 3J81L 1RKNA 1FYCA 1Y8PB 3EROA 4IZ8A 3A8KE 2V4DA 1STHA 1I4GA 1EEFD 5FO9B 4J8QA 1HFNA 1NR4A 4OGQC 1HA5A 2IL8A 2KVMA 4ZAIA 3P20A 3NUCA 1F2LA 2EJMA 2O2LD 3MEHA 1HQRD 4A3BB 3A8JE 1A2TA 3MXNA 1GUWA 2VUMB 2LMCB 4L63B 2E2HB 1O80A 1ONLA 1G291 4K8IA 4DAYA 4XIGS 1CZWA 3CKIB 4K5WA 3FRPB 3QJYA 1Q12A 2KUMA 4FXGC 4FYDA 1U4LA 2RA4A 3H3VC 1SNDA 1NUCA 3ZYYX 2ENBA 4A3EB 1HPCA 1C4QA 4ZLTF 4ZK9B 4DFAA 4KD3A 1KDAA 1HXYD 4HSVA 1H9RA 2AQ1B 4F7XA 5CV7A 1PRTC 2A5HA 2N55A 3C1EA 4QF4A 3E6ZX 3BDLA 1TIID 4C2MB 2OF1A 1CTMA 3QG1A 1CK1A 3VYTA 1LO5D 2K05A 3M85A 5K36G 3E0JA 2ZXRA 4C3JB 1EZ6A 4HMIA 4MHEA 5CV6A 3DMUA 1EWCA 3PUVA 3IAYA 4C1NK 1TWHB 4XQQA 1D5XC 2JSOA 2FINB 1LTGD 2J7ZA 4NDXA 5CR3A 1D6EC 1D1KA 1H9SA 5C5MA 3H0GB 4B9WA 2C9OA 2FJ2A 5FO7B 5A2QL 4A3JB 2BA1A 2EY5A 4IURA 1RDPD 2SNMA 2WIIB 3OPOA 3W3AA 3MFYA 2NWGA 3CHBD 5J1ZA 1QOHA 2QKIC 3NWSA 2J4XA 4DK1A 1GHJA 3EJIA 4G4KA 3K6OA 2XN9C 2F03A 2XRSD 3OMGA 3NBIA 2SNSA 1TWCB 2AQ2B 2F0OA 3I4MB 1EU3A 3TN2A 4IFDG 2VXWA 2KHSA 1PRTD 5G3LD 4I7ZC 3I91A 5KIXA 1LTRD 3MC0B 2DNEA 1EYAA 1RD9D 5CV4A 5JVH3 1CM9A 5JAVA 2K5DA 2IT1A 1Q3LA 1G6ZA 2PNRC 2F0DA 1W6JA 3MTSA 1F2YA 3TP8A 2BE5C 1GUGA 5IGGA 2PCFB 3GQBA 1X3QA 2XRQD 1Q90A 1XWEA 1IW7C 1W6KA 4A3MB 1C48A 3WOFA 3RMHA 2YU9B 3F2UA 1I50B 4DXGA 2KECA 2KA7A 4P2CB 1SYFA 4RWSC 1EIHA 3TZDA 3ITPA 2RVLA 2MHVA 4RA8A 2HQEA 5CORA 1SE2A 2OT2A 3SHLA 1S5ED 5FLXE 5KEEA 3HG9A 5DAUA 4G7OC 3OWFA 4RCOA 3CU7A 5T1GA 2FMCA 1SYBA 2RSOA 5FLXL 3UI2A 1PTOF 2M9VA 2WACA 4KK7A 5C0XH 1Q1EA 5CYUA 1GUNA 3JAML 1JOKA 3BZDB 2B2WA 3MXGA 1H9JA 2EZVA 1B50A 2XSCA 2EYJA 2BOSA 2RBMA 4CGYB 1ENCA 1EY4A 1JICA 2R3ZA 3OIQA 2B39A 4H0LC 2B2TA 1STEA 4LJZC 4Q0FA 3MAQA 3VR2A 4LMQD 1JC7A 3D6WA 3PUXA 1OXTA 3GV6A 1R4PB 3SK8A 4EGVA 1UUPA 2I07B 2EYLA 3TBIB 3OHXC 4EQPA 4XT3B 1NSNS 2BE5D 2VB2X 2F0VA 5FK9C 3DM1A 1RTNA 1O78A 4HSPA 5BN5A 1IW7D 1SNQA 1PTOB 5JEAH 1CQFA 2D9UA 2PO4A 2B63B 1E2ZA 4QCLA 1STBA 3J7AV 2BDOA 2MJ8A 1MBYA 3D4WA 4IUTA 2A69C 1V43A 2B8GA 4X3KA 2K03A 5CMDA 5CC4A 1BR9A 2WB1B 1VMCA 3J80L 2IW3A 3NXWA 4AYBB 1Y1WB 4KY6A 3TP5A 1IKMA 3DEOA 1ET9A 2XWBB 3D31A 4HCEA 2AWNA 5IT9E 1A3TA 5NUCA 1TU2B 1EY9A 5FOBB 3HP3A 2R93B 4KHVA 4CKEA 3E5SA 3AU7A 1T5EA 1JORA 5EPJA 3N52A 1O7LA 2F0UA 3FPUB 3URYA 2A74C 4BA2I 4UDUC 4RGOS 3V2TA 5C0XI 3NWTA 2RDGA 2J0TD 2WAQB 3BG3A 1CQVA 2EJGC 1SE4A 4JBWA 1F77A 2EPBA 4RKBA 2L9HA 3MXPA 3P1HA 3M4OB 1IYVA 3OMCA 4FF3A 1WTWA 4RHSA 4CKCA 5TSSA 2K04A 5JEAJ 3S14B 3NQIA 5EKIA 2F3VA 2CHBD 4V190 5C3WA 4DU9A 3U9SA 5C5LA 2F4IA 4ZYSA 4C3HB 3A54A 4G7HC 2A73B 3SK5A 3T56B 1Q8IA 3L7ZC 1G2SA 1LT6D 2SDFA 1BNZA 2A69D 1C8CA 1XX8A 3K5OA 4FXDA 3D3RA 3LWEA 1KNAA 1E2VA 4RH6A 2PQEA 3H91A 1CA6A 2CQAA 2B2YA 1QNKA 4DN4M 2R6GA 2NN6G 1HUNA 2VB3X 1NAPA 2NTTA 5K36H 1BQQT 4M1UB 2JA6B 2EY6A 3H94A 2HDMA 4XDXA 2ZXOA 1GUTA 3BVGA 3IL8A 1BF4A 1KAAA 1DOLA 2K28A 3D8GA 4ZUIA 1VDZA 4DXFA 2JYOA 2L4NA 3OIPA 1DOKA 2JEAI 2B2UC 2L11A 3HKZB 4QIWB 3X3NA 5KYIA 1OXSC 1MSGA 1UAPA 5EKLA 1CHPD 2A68C 3DXJC 1ILQA 3HOUB 1Q1BA 2F0WA 4OO1G 2O5JC 2X69A 4RFBA 1G8ZD 2IPKD 1U4RA 3FKIB 3NE5B 1B9MA 2EYHA 1JOOA 3EFXD 1GOZA 1MI2A 4E6IA 1VF5C 3I72A 4CJ1B 1NR2A 3S1MB 2Z4HA 3MXUA 3S2DB 1LTTD 5M5YB 3KLSX 5CBEE 1BDOA 1HCZA 2SOBA 2OEOA 2O4XA 4H44C 4A3GB 3I4NB 1M8AA 4QB4A 2A6EC 3TMEA 4PV1C 1CZGA 4BWGB 3I70A 3C1FA 4TQUS 4K2LA 5HURA 4IFDH 5C6AA 4KTAA 1JQYD 2AWOA 4NW2A 2JA8B 1QG7A 1DM0B 4K6DA 4KJNA 5F2DA 4G7ZC 2E74C 2RKSA 1LABA 1DONA 1IYUA 4LAAA 5AFWA 1AZPA 2R92B 1TWAB 1BUVT 4F8MA 1JWMD 4EQNA 1WTXA 2HDLA 5DM63 2HCCA 4A3DB 1ZYRC 2Q8IB 1SMYC 4OIJA 1WCMB 2F0KA 5I9PA 4K8JA 5C3XA 2GA4B 1CI3M 2F1MA 2XVSA 4KMUC 3NTKA 3SEBA 2Q8RE 1TS3A 2WP8J 2AUKA 1WTPA 3D4DA 3MVVA 5CBAE 1QB5D 5JJZA 3HOXB 1TT2A 2VNUD 4PQXA 3DWQA 1A6XA 4HTHA 3SXHA 1OXXK 4QUCA 2HCIA 3Q0AA 2A68D 1EY7A 2QILA 2F0LA 1EFID 1U4PA 1AEXA 5EGTA 4BY7B 5ELEA 4BY1B 2KCNA 4N9TA 4FF4A 1AFPA 1LTID 4JK1C 5KGUA 1L0YB 3IFDA 3MHBA 4ID6A 3ERQA 2A6HC 4C3HG 3S1RB 3S1QB 1SFOB 5M5XB 1FNVA 2PW5A 4CJ2C 5A2QE 2ICIA 3RUZA 2L12A 3Q23A 4I65A 5LL6S 4IFDJ 1GXDC 2K1BA 1K8MA 4XYOA 2A6ED 3CRLC 1PRTB 1Z7TA 1ILPA 3OSOA 1D2BA 1TS2A 1H9MA 3KF8A 3HGBA 2EOTA 3K7AB 3OOCA 1WTQA 4Z9CB 1QCBD 1SDFA 3GTLB 1SNCA 3GV3A 4IFDI 3PO2B 1TR5A 1QJOA 2CW0C 2OXPA 3DHQA 5ELCA 4LK1C 1SMYD 2PZUA 2N88A 1OO9B 1QWYA 4ULLA 5ELDA 3L3OC 1TWFB 3H09A 4ZKCB 1BCPC 2ZT9C 4IN3A 1JE4A 3IFTA 4ILWA 1SNOA 3FMCA 4KKSA 3T13A 3WOEA 3ONAB 4DGZA 1SEBD 1KLGD 1LT3D 3MWYW 3HOZB 4BA1I 3S16B 5A35A 1PFNA 1CHQD 1AZQA 2F0NA 4X3TA 3O13A 3Q24A 1LT5D 1EYCA 2QDBA 1J8IA 3HRZC 1LLRD 4C3IB 1ZXTA 3KUPA 4RKLA 3BVMA 1RJTA 3SVMA 4KD4A 1M4VA 2EJFC 1F9RA 1TKWB 1O7ZA 2A6HD 4K5XA 2XIWA 4A3KB 1B44D 1STNA 3G6JB 4DK0A 1F9SA 1VMPA 2EYMA 4CHTB 4DA2A 3VR4A 2JA7B 1JOQA 2EY2A 5EKKA 1BBXC 2F0MA 2NVQB 3KLSA 4K14A 4TKOB 4X3UA 3JAME 1RODA 5K5PA 1VF7A 2K01A 4Q5VA 2H1EA 1KABA 3GTQB 5D3IB 3VYSA 3PO3B 5KNDA 1PTOC 4ODGA 5I6WA 1I4HA 2CW0D 2X6GA 3C2PA 3EVQA 4HAEA 1ET6A 2FFKB 1I4PA 1YNJC 2AQ3B 4RAUC 2K5QA 3D6CA 4FVMA 1EQTA 3AMUA 2F0EA 2B2WC 4C3JG 1BCPD 2KJXA 5ELFA 2BDNA 1TWGB 5I9OA 1CT1D 1R9TB 3BDOA 1LTAD 4O42A 3NHHA 4HN7A 2NVTB 3K5LA 2KEEA 3HOYB 5M9OA 3M3YB 5BN3A 3M4YA 2NN6H 2BCOA 3NK9A 4OHJA 1K83B 4A93B 2IX3A 4NMZA 3K5NA 5M3FB 3S9WA 2QCPX 2PZWA 2DNCA 3QOLA 1VCIA 3J80E 3DEPA 1AP0A 4TRDA 1UEAB 4A3FB 2XWJB 4X3SA 4EVOA 1B53A 1RF2D 2IWHA 2TMPA 1R4QB 1CA5A 3PV0A 1V1PB 4OO1H 1F2MA 3X3MA 4RGTA 4K6LA 2B2VA 2R61A 3KBXA 1KDCA 1PTOH 4ZUJA 1TQOA 2K32A 3K0YA 3J7YW 2SEBD 1IHZA 3I90A 5I6YA 3M7NA 4K5VA 1T5XD 5ELBA 1EY6A 2K5WA 5T1IA 1YNJD 2NYZD 4UAIA 5KRUA 1F9PA 3GTGB 4IUQA 1GUOA 3I4LA 4FF2A 1STGA 2CVRA 1JWSD 5E4XA 4PMCA 3FPPA 4XQJA 2JEBI 2Z1CA 1SJED 2MPMA 1PFMA 4C3IG 1EY0A 2NVXB 3BS1A 3A7LA 2DY8A 3EQLC 2JP1A 5C0XG 3K58A 5C4XB 1SYGA 5COYA 3SK6A 1A15A 1D5ZC 1ZKOA 3I3CA 1HTPA 5DEHA 2M00A 3SK4A 2LS01 2MGSA 3KBGA 4IUPA 1ENFA 4ZQ3A 1X32A 4FXKC 1I6VC 3AB9A 1CFMA 2EE1A 4B08A 1I6HB 3LNNA 1GUSA 3R2IA 2NVYB 2NN6I 3T51B 1B2TA 1ESFA 5I2XA 3I8ZA 1RCVD 3H6MA 1WD0A 1G2TA 2F0PA 1B4OA 1RHPA 2TSSA 5EPLA 1HHVA 4C56C 4R8NA 3D4RA 4RHRA 3S1NB 1QE6A 1SYEA 1EL0A 5E4WC 2F0GA 3A56A 4FF1A 1LACA 2C5CA 3MA2B 2B2YC 4KHZA 3DWAA 1I4XA 4DAPA 5HGTA 5IIFA 5I4DA 2B2UA 4HEDA 4TSSA 4V0BA 3NQTA 3HOWB 3ND8A 3VR3A 3LX0A 5DM73 4OO1I 4IUUA 2YYZA 3QIAA 3K5MA 3GTOB 3A55A 3PIO3 1G91A 3Q22A 3I73A 3K59A 3RD4A 5ISRA 1FNUA 2ZXPA 3M7GA 4WJWA 4K2KA 4J6HA 1JWUD 2FHTA 4FP5D 1AW7A 4PMBA 4XQNA 3NTHA 1HFGA 2JE6I 1WTRA 5IGDA 2L55A 4DNTB 2LY7A 1V1OA 3P75A 5EBDA 3BVZA 5BN4A 1U9RA 2QF7A 4XYQA 2O5IC 2F0HA 2IJ0A 3PUZA 5IOCA 2D5DA 3U9OA 2F3WA 2NUCA 1SSOA 2E2JB 3W2DA 1ML0D 1TS5A 4U673 3CQZB 1XYIA 1FGBD 3K57A 4S3SA 4KN7C 1EQVA 5EQ0A 3GTJB 1FR3A 2Q8TA 3A7AB 1STYA 3S2HB 1FD7D 1PRTF 5G3LF 4MN3A 1ZEQX 3PIP3 5C4ZA 1DOMA 1I3QB 2K33A 1PZKD 5M3MB 1HQMC 3BYTB 2R7ZB 4ABNA 1L0XB 4RGNA 5FKAC 2PZTA 3FDTA 1DZ1A 3TZUA 1Y8NB 4R9WA 3Q6SA 3S15B 2L5TA 5J39A 1JR0D 1SYDA 1MSHA 2PMZB 1LTBD 4HMJA 1EU4A 1MD2D 3SDZA 3GTPB 2EYOA 2RQXA 2F0IA 1IKLA 3RZOB 1EYDA 4KKUA 2D62A 1SNPA 1WD1A 1A3UA 3GTMB 3ND9A 2X6LA 1BXTA 1LTSD 1J9OA 1HA6A 2AUJD 1S5DD 5JOBA 2F0QA 2WKDA 1WTOA 1WVLA 1TY0A 3NP8A 1QILA 3BYYB 1BO0A 4OIKA 1Y1VB 1NCVA 1TVXA 1OXVA 5KYLA 1ZYRD 3V96A 1SBBB 4KV6A 2EYFA 2G9DA 3HS0C 4L6TB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7V A;  1E2Z A;  1GJX A;  3QJY A;  3PUW A;  1Q12 A;  3FPP A;  1VF5 C;  3I72 A;  2BA1 A;  2YYZ A;  2D2C C;  3QIA A;  4XTC S;  2BDO A;  2JEB I;  3U9S A;  2K33 A;  3MXU A;  3PUY A;  4JK1 C;  2JXM B;  1H9K A;  4KN4 C;  4RCN A;  1HQM C;  3BDO A;  5JEA G;  3OPO A;  2A6H C;  3CRK C;  1YNN C;  4KKT A;  3VR6 A;  3N6R A;  3W3A A;  3MFY A;  4KI0 A;  1BDO A;  3A8I E;  2E75 C;  1HCZ A;  2PPB C;  2A69 C;  4G7H C;  3T56 B;  1V43 A;  2B8G A;  4H44 C;  2B8F A;  3TZU A;  1Y8N B;  3A7L A;  3I73 A;  3L7Z C;  2A6E C;  2EJF C;  3EQL C;  1TKW B;  1V8Q A;  2L5T A;  4PV1 C;  4DNR B;  1HPC A;  2A6H D;  5C0X G;  4G7O C;  4DK1 A;  5BN3 A;  3M4Y A;  1Y8O B;  4TQU S;  1EWH A;  1GHJ A;  2NN6 H;  2A69 D;  4IFD H;  4IQZ A;  1ZKO A;  4DK0 A;  1HTP A;  1K8M A;  2AWO A;  1H9R A;  1PMR A;  1E2V A;  2A6E D;  3CRL C;  5C0X H;  3OW7 A;  1Z7T A;  3SDZ A;  1Q1E A;  3VR3 A;  4G7Z C;  1GUN A;  2E74 C;  3D31 A;  1LAB A;  3RLF A;  2R6G A;  3VR4 A;  1Y69 U;  1IYU A;  2NN6 G;  1H9J A;  1H9M A;  2DNC A;  3LWU A;  1VCI A;  4IFD G;  1DD2 A;  3HGB A;  3VA7 A;  3OOC A;  1TU2 B;  5K36 H;  1H9S B;  4I7Z C;  1FYC A;  1Y8P B;  2E76 C;  2JE6 I;  1I6V C;  1CTM A;  2V4D A;  3A8K E;  3AB9 A;  3QG1 A;  4KKU A;  5KNB A;  1CFM A;  3H94 A;  3SE0 A;  1T5E A;  2DNE A;  3T53 B;  4DNT B;  3GD7 A;  2D62 A;  4TKO B;  1GUT A;  1ZYR C;  1GUS A;  1SMY C;  1O7L A;  3LNN A;  2Q8I B;  4H0L C;  5KNC A;  1VF7 A;  3ND9 A;  3M85 A;  2NN6 I;  4LJZ C;  3T51 B;  3VR2 A;  5K36 G;  5BN4 A;  2IT1 A;  2QF7 A;  2O5I C;  1VDZ A;  4BA2 I;  1DXM A;  1QJO A;  2CW0 C;  2EVB A;  3PUZ A;  4OGQ C;  3PV0 A;  1DCZ A;  2PNR C;  3PUX A;  1CI3 M;  1OXT A;  2F1M A;  2D5D A;  4LK1 C;  2KCC A;  2AUJ D;  3P20 A;  4KMU C;  3WDN A;  5KND A;  4GZY C;  1GHK A;  2EJM A;  4OO1 H;  2JEA I;  1B9N A;  4L8J A;  3D4R A;  3BG3 A;  2BE5 C;  1GUG A;  2AUK A;  3KLR A;  1K8O A;  2EJG C;  3A8J E;  1Z6H A;  2PCF B;  4H13 C;  4JBW A;  3GQB A;  3VR5 A;  1OXS C;  1E2W A;  3PUV A;  1Q90 A;  2ZT9 C;  1YNJ C;  2BA0 A;  1IW7 C;  2K32 A;  1LAC A;  3IFT A;  3IKJ A;  4KN7 C;  1IYV A;  2A68 C;  3DXJ C;  1OXU A;  2BE5 D;  1Q1B A;  2O5J C;  3FMC A;  4OO1 G;  4KHZ A;  2DN8 A;  1FR3 A;  3M7N A;  2LMC B;  4KKS A;  1A6X A;  1OXV A;  2EDG A;  1O78 A;  1ONL A;  1B9M A;  1OXX K;  3NE5 B;  1IW7 D;  5BN5 A;  1G29 1;  3A7A B;  4BA1 I;  2KA7 A;  5A35 A;  2A68 D;  5JEA H;  1H9S A;  4HR7 B;  4XIG S;  3ND8 A;  1GUO A;  3I4L A; 
#chains in the Genus database with same CATH topology
 3S1Q H;  5D65 A;  1GJX A;  1EOT A;  1XJV A;  4B3T L;  4XTC S;  1Q7Y C;  3NSW A;  3PUY A;  3H0G H;  2JXM B;  1H9K A;  4ME5 A;  1HR0 L;  3CRK C;  4KKT A;  5EJW A;  1LT4 D;  1EIG A;  2E75 C;  2KHJ A;  2E5L L;  1PLF A;  3VDY A;  4A3J H;  4XXE A;  1BCP F;  3OWE B;  3NEM A;  4ZKB B;  5E1F A;  1WJJ A;  2DY7 A;  5J22 A;  1WTV A;  1Q81 C;  3GP7 A;  5DNF A;  4QMG A;  1JMC A;  2RDF A;  1Y8O B;  4MIU A;  3UE1 A;  1XPR A;  1HNX L;  1EWH A;  1G6P A;  1DJR D;  2UXC Q;  4BS9 A;  1S5F D;  4H02 A;  4IQZ A;  2KED A;  5IGE A;  2ZTC A;  2WIN B;  2IX0 A;  1SYC A;  2Y0S E;  2RSN A;  2UU9 L;  1PFB A;  3L9A X;  2YV5 A;  4WRD A;  4JG2 A;  1HRJ A;  2KHI A;  3LWU A;  1JB3 A;  3VA7 A;  5JJK A;  4LF5 L;  1I4Q A;  4A3G G;  1H9S B;  3KK7 A;  3L0O A;  2NBF A;  1TWC H;  4H7B A;  1PH1 A;  3R8B A;  3T53 B;  3HZX A;  2G9H D;  1DGS A;  1QNU A;  3W1B A;  4FNF A;  2CCZ A;  4HCS A;  3KF6 A;  1F9Q A;  2FXQ A;  1E0B A;  4BBS B;  1SE3 A;  2GN5 A;  3VA5 A;  4AH6 A;  2Z4I A;  2JA8 G;  1KNE A;  4X65 L;  1EFW A;  1K8G A;  1TWF H;  3NBH A;  4F87 A;  3DUZ A;  5IGF A;  3CCQ A;  3WDN A;  4X62 L;  2QEX A;  4HID A;  1XMQ Q;  1PVO A;  4L8J A;  4PNY A;  3G7L A;  4WFN 3;  3KLR A;  5IGB A;  1S40 A;  4EQO A;  1K8O A;  1IL8 A;  1PDQ A;  1Z6H A;  1II3 A;  3EA6 A;  3HOZ H;  3CF5 A;  4K0K L;  3S16 H;  4LW1 A;  1PZI D;  1B1Z A;  4R8I A;  1BCP B;  1D8L A;  3NTI A;  4DNI A;  4HJ8 A;  1SE8 A;  1OXU A;  2WKC A;  1S5C D;  1IBL Q;  1IBK Q;  4JBM A;  2DN8 A;  4L5T A;  3CD6 A;  2FMM A;  5D14 A;  4B3R L;  5CV9 A;  4GNX C;  4JI1 Q;  1BOS A;  2F0J A;  5HGQ A;  1EY5 A;  3GO5 A;  1O7Y A;  4DUZ L;  4M8A A;  4A3M H;  4C3I H;  1KAW A;  4NXM L;  3BJU A;  3HOV B;  1I50 H;  1N8R C;  5JPN C;  4IUN A;  3PUW A;  4HIM A;  4N8F A;  1A3V A;  5BR8 L;  3HOX G;  4C1N I;  4A3K H;  1YZ6 A;  1EUJ A;  2R7Z G;  2JA5 B;  3UDX A;  1V1P A;  4K0K Q;  5FLM H;  5C4H A;  3K0X A;  1HZB A;  4KY7 A;  1YHA A;  4DNR B;  4IAL A;  1PZJ D;  4BY7 G;  1HNZ Q;  3RZD B;  1PMR A;  1Z47 A;  3J81 j;  4BY1 G;  1JCK B;  2NTS A;  3KF6 B;  3TP7 A;  2B2T C;  2M2L A;  4BBR B;  4AQY L;  4N9P A;  1SAP A;  4JI5 Q;  3NBH B;  1MIU A;  4JI4 Q;  1EY8 A;  5D3D A;  1DD2 A;  2EYP A;  3V05 A;  4BXX H;  3P7J A;  3D0F A;  2R7F A;  5FLX c;  4DPG A;  5IY0 A;  2GVB A;  5KNB A;  3SE0 A;  1AN8 A;  3JAM c;  3U4Z A;  3GTK B;  5AJ3 Q;  3PO3 H;  1VQK A;  2RDH A;  3SR1 A;  5KNC A;  3ULL A;  5I2Y A;  3G6E A;  2Z8L A;  4CKB A;  5IGC A;  1JE5 A;  2Y0S B;  2F0S A;  3E0E A;  4F88 A;  3TDQ A;  2EVB A;  3SGI A;  1MJC A;  1X3P A;  4RGM A;  2KCC A;  4JI6 Q;  1YJN A;  3TEH B;  1GHK A;  3QWN A;  3T1H Q;  1I4R A;  1B9N A;  1X9N A;  2K6A A;  2L1B A;  1UNS A;  4OXP A;  3VR5 A;  2I5L X;  5C4J B;  1E2W A;  2BA0 A;  1HNW L;  2ZJQ A;  4GN5 A;  1K73 C;  1B3Q A;  1LV9 A;  3NEL A;  5CV8 A;  2XTI A;  1TWG H;  2UUC Q;  1Y1V G;  3PO2 G;  5LHY 1;  4KJO A;  2EY1 A;  2EDG A;  3W1G A;  4CBV A;  1STA A;  1VQH A;  2OTL A;  5EPK A;  1R9T H;  1CKO A;  4HR7 B;  1XNR Q;  2F4V Q;  1EEI D;  2NVT H;  1X3F A;  1YVC A;  2K7V A;  3A74 A;  3M4P A;  3ERS X;  3KOJ A;  4X6A H;  1PTO D;  2D2C C;  5C0X J;  1U4M A;  1JB7 A;  4KN4 C;  1WOC A;  4RCN A;  5IOD A;  2UUA Q;  3VR6 A;  1YNN C;  1FJG L;  1D5M C;  3N6R A;  1ICW A;  2B63 H;  4KI0 A;  3ZJY C;  4A3C H;  3I4O A;  2E2D C;  1TS4 A;  4U68 A;  2B8F A;  1DYQ A;  1I5F A;  2H4O A;  3R2T A;  1A62 A;  3T16 A;  3MZ5 A;  3J7A F;  1V8Q A;  1S4Z A;  4DF7 A;  4A3L H;  4ZRZ A;  5E3F A;  5IT9 L;  2PYK A;  2A8V A;  3MFG A;  2CWP A;  3FEW X;  2B2V C;  2OWO A;  2HHH L;  2XGT A;  4Y7N B;  4ALP A;  2KOL A;  4OWX B;  1EZ8 A;  5FO8 B;  4POG A;  1E24 A;  3VYR A;  3LGJ A;  3BDC A;  2K4K A;  5LMU Q;  3CC2 A;  3TP6 A;  3J80 c;  1ENA A;  1N9W A;  1Y1W H;  2MP1 A;  3PF5 A;  1GD7 A;  2WV6 D;  3CC7 A;  5JVG 3;  4YIJ A;  1KLU D;  1RTO A;  2E76 C;  2N49 A;  3ULP A;  3FVQ A;  4DV4 Q;  4X64 Q;  1MGS A;  1XXG A;  1B8A A;  3GD7 A;  1XTD A;  4WOR A;  1VS0 A;  1TY2 A;  1VQG A;  1XTC D;  4LF7 L;  4BBS G;  2R93 H;  4XT1 B;  4PMW A;  4KY5 A;  2VQF Q;  1DXM A;  3HEJ A;  2E2I B;  4NP5 A;  4O1N A;  5IT9 c;  1DCZ A;  2IX1 A;  3T4A C;  4QUF A;  2JA7 G;  5GAG C;  4CJ0 B;  4GZY C;  2PW7 A;  2I46 A;  5CV5 A;  2LFN A;  1PYW D;  1HTL D;  3DWP A;  1SJH D;  4OWW B;  3NPP A;  5IYB H;  4H13 C;  1KTK A;  1FNW A;  5CGK A;  4GKK Q;  3CCE A;  2IY5 B;  4IUV A;  3OYY A;  1F2Z A;  2VQE Q;  2NZH A;  3IKJ A;  2NB0 A;  4NKL A;  3QB3 A;  3C46 A;  3ICE A;  5C44 B;  1D1I A;  1KQS A;  1FGU A;  4DK6 C;  2F0F A;  4G57 A;  1PFS A;  2I5M X;  3R93 A;  1B3A A;  1CUK A;  4DV0 Q;  1A2U A;  3R3O A;  1SLJ A;  2NVX H;  2L0C A;  2LKV A;  2KQ3 A;  4GOP C;  2XNA C;  1S5B D;  4B9X A;  4DV5 L;  4DR2 Q;  3S14 H;  2EXZ A;  2ICE C;  4OL7 A;  5C4X H;  3C3L A;  1KDB A;  2NZ1 D;  5JEA G;  3PMF A;  3VYU A;  1J5E L;  2F0T A;  3S17 B;  3QOJ A;  5EBC A;  5JPM C;  4KHP Q;  2JA5 G;  3A8I E;  2PPB C;  4FO2 A;  5M5W B;  2GVA A;  4DR6 L;  1YI2 A;  3QO2 A;  4YWM A;  5LL6 X;  1SNM A;  1L1O A;  3TSS A;  1YNN D;  1JJC B;  1VQ6 A;  4EQ5 A;  4JI7 L;  4J1M A;  4DAV A;  3J81 E;  1PXU A;  3OW7 A;  1ESR A;  4CDC C;  4A3I B;  1SXT A;  2HUG A;  2MUY A;  3RLF A;  2QEJ C;  3RLO A;  1Y69 U;  1I6H H;  2ID0 A;  1HUM A;  5C3E B;  2NVY H;  1T9H A;  3J81 L;  4DV5 Q;  1RKN A;  4DR5 Q;  1FYC A;  1Y8P B;  3ERO A;  4IZ8 A;  3HOY G;  3A8K E;  2V4D A;  2RHS B;  1STH A;  1I4G A;  1EEF D;  2K50 A;  4GKJ Q;  2B3G A;  5IYC H;  5ELN A;  1N34 L;  5DLQ E;  1NBW A;  2PNH A;  2JA6 H;  4A93 G;  5FO9 B;  4J8Q A;  1HFN A;  2Y0S G;  4AIM A;  4DV2 Q;  1NR4 A;  4OGQ C;  5M3F G;  1BBW A;  1HA5 A;  2IL8 A;  2KVM A;  4ZAI A;  3P20 A;  4JI7 Q;  2CFM A;  2HIX A;  1F2L A;  2EJM A;  2O2L D;  3NUC A;  5FJ8 G;  3MEH A;  1HQR D;  4A3B B;  3E9H A;  3A8J E;  1A2T A;  2JK8 A;  4A3F G;  3RLN A;  3MXN A;  2UXB L;  1GUW A;  2VUM B;  2LMC B;  4JI0 Q;  4L63 B;  2E2H B;  3CMA A;  2UXD L;  1O80 A;  1ONL A;  1G29 1;  3TRE A;  4K8I A;  1YHQ A;  4DAY A;  4XIG S;  1CZW A;  3CKI B;  4K5W A;  3FRP B;  3QJY A;  1Q12 A;  1NY4 A;  2KUM A;  4FXG C;  4FYD A;  4HJ7 A;  1XPU A;  1U4L A;  2RA4 A;  3H3V C;  1SND A;  1C0A A;  1NUC A;  3ZYY X;  1VQO A;  2ENB A;  1IZ6 A;  1JT8 A;  2AMC B;  3S2D H;  4LWC A;  2YTV A;  4JI2 Q;  4A3E B;  1HPC A;  1C4Q A;  4ZLT F;  5M5Y H;  1A63 A;  4YWL A;  4ZK9 B;  4DFA A;  4KD3 A;  1YHB A;  1KDA A;  3STB C;  1HXY D;  4HSV A;  4LFB Q;  4A3G H;  4LF8 Q;  1H9R A;  2AQ1 B;  2VZA A;  4F7X A;  1P8L A;  5CV7 A;  1PRT C;  2A5H A;  2N55 A;  3C1E A;  4QF4 A;  4DUY Q;  2RF4 A;  1KXL A;  1YJ9 A;  4JOI A;  2Z6K C;  1M1K C;  4OX9 L;  4DR1 Q;  3E6Z X;  2JA8 H;  2BH2 A;  3BDL A;  4A4I A;  1TII D;  4C2M B;  4DK3 C;  2OF1 A;  1CTM A;  3TQY A;  3QG1 A;  1QUQ B;  1V9P A;  1CK1 A;  3VYT A;  1LO5 D;  1BBU A;  2K05 A;  3M85 A;  4DV6 Q;  5K36 G;  3CQZ H;  4L5R C;  4JI8 L;  3E0J A;  2ZXR A;  4C3J B;  1EZ6 A;  1TXY A;  1I94 L;  1B7Y B;  3CP0 A;  3KLW A;  4HMI A;  4MHE A;  5CV6 A;  4DAY B;  3DMU A;  1VQP A;  4OX9 Q;  1HJP A;  1EWC A;  3PUV A;  3IAY A;  4C1N K;  2LXJ A;  1OTC A;  1TWH B;  3S2H H;  4XQQ A;  1D5X C;  2JSO A;  2FIN B;  1LTG D;  2J7Z A;  4NDX A;  5CR3 A;  1D6E C;  1D1K A;  1I3Q H;  3HOX H;  1H9S A;  5C5M A;  3H0G B;  4B9W A;  2R7Z H;  2C9O A;  2FJ2 A;  1WTH A;  5FO7 B;  5A2Q L;  4A3J B;  2BA1 A;  2EY5 A;  4IUR A;  1RDP D;  2SNM A;  1PH7 A;  2QDL A;  4DR7 L;  2WII B;  3OPO A;  4BY7 H;  3W3A A;  3MFY A;  2NWG A;  2VY3 A;  4BY1 H;  5JJL A;  3CHB D;  1H95 A;  3EN2 A;  1UE1 A;  5J1Z A;  1QOH A;  2QKI C;  4HIO A;  3UDG A;  4R4O A;  3NWS A;  3H3V H;  1VQB A;  2J4X A;  4DK1 A;  4DR4 Q;  1GHJ A;  3HOW G;  3S1R H;  5HY6 A;  3EJI A;  1ASY A;  1SFO H;  4G4K A;  3K6O A;  2XN9 C;  1XNQ L;  5M5X H;  1FL0 A;  2F03 A;  2XRS D;  3OMG A;  3NBI A;  2SNS A;  4DR3 Q;  4GLX A;  1TWC B;  1N32 L;  2AQ2 B;  2F0O A;  3I4M B;  3BZK A;  5C3E G;  1EU3 A;  3TN2 A;  4IFD G;  2VXW A;  2KHS A;  3K8A A;  1PRT D;  5G3L D;  1XPO A;  4I7Z C;  4DR7 Q;  3I91 A;  5KIX A;  1LTR D;  3I56 A;  3MC0 B;  2DNE A;  1EYA A;  1RD9 D;  5CV4 A;  5JVH 3;  1CM9 A;  3K7A H;  1MKH A;  5JAV A;  4JV5 Q;  2K5D A;  2IT1 A;  3GTL H;  1Q3L A;  4JBJ A;  1G6Z A;  2PNR C;  2F0D A;  4X66 L;  1W6J A;  1PH8 A;  2Q2I A;  4B3T Q;  4P73 A;  3DLL A;  3MTS A;  1F2Y A;  1Y1V H;  3TP8 A;  4A76 A;  2BE5 C;  1HR0 Q;  1GUG A;  3PO2 H;  5IGG A;  4DV1 L;  2PCF B;  3GQB A;  1LYL A;  2E5L Q;  1X3Q A;  2XRQ D;  1Q90 A;  1XWE A;  1IW7 C;  1W6K A;  4JBK A;  4A3M B;  1C48 A;  3WOF A;  3F2C A;  1HNX Q;  3RMH A;  2YU9 B;  3F2U A;  1I50 B;  1PYB A;  4DXG A;  1VQI A;  2KEC A;  2WB1 E;  2KA7 A;  4P2C B;  1SYF A;  1M90 C;  2UU9 Q;  4AYB E;  4RWS C;  1EIH A;  3TZD A;  1KIX A;  2RHQ B;  1EYG A;  1KRT A;  3I7F A;  3ITP A;  3W5O A;  2RVL A;  2MHV A;  4LF5 Q;  1K0R A;  1NE3 A;  4RA8 A;  3F1Z A;  5GQO A;  4GNX A;  2HQE A;  2L15 A;  5COR A;  2HQL A;  1QVG A;  1SE2 A;  2OT2 A;  3SHL A;  1S5E D;  3A0J A;  5FLX E;  3HG9 A;  5KEE A;  5DAU A;  4A3E G;  3OWF A;  4RCO A;  4G7O C;  3CU7 A;  4X65 Q;  4LUO A;  4LFC L;  5T1G A;  2FMC A;  1SYB A;  2RSO A;  5FLX L;  1AE3 A;  4I7A A;  5EAY A;  4X62 Q;  3UI2 A;  1PTO F;  2MO1 A;  1YBY A;  2M9V A;  2WAC A;  4KK7 A;  5C0X H;  5M3M G;  1Q1E A;  1QZG A;  5CYU A;  1GUN A;  2UUB L;  3JAM L;  4UY8 C;  1JOK A;  3BZD B;  5IYD G;  2B2W A;  3MXG A;  4YY3 L;  1H9J A;  2EZV A;  2MFI A;  3PSI A;  2WAQ E;  1B50 A;  2XSC A;  1X56 A;  2EYJ A;  2BOS A;  2RBM A;  4R4I A;  4CGY B;  1ENC A;  1EY4 A;  1JIC A;  2R3Z A;  4PZ6 A;  2JA7 H;  3OIQ A;  4B3R Q;  2B39 A;  3H3V I;  3I2Z A;  4H0L C;  2B2T A;  1STE A;  4LJZ C;  4Q0F A;  3MAQ A;  4DUZ Q;  3VR2 A;  4LMQ D;  2HIV A;  4NXM Q;  2NVQ H;  1JC7 A;  3D6W A;  3PUX A;  1OXT A;  3GV6 A;  1R4P B;  3SK8 A;  4EGV A;  3K81 C;  5BR8 Q;  2Q2T A;  1UUP A;  2I07 B;  1JJ2 A;  1RL2 A;  2RCF A;  2EYL A;  3TBI B;  3OHX C;  4EQP A;  4LF9 L;  3GTQ H;  4YY3 Q;  4XT3 B;  4EX5 A;  3T1Y L;  1NSN S;  2N8N A;  2BE5 D;  4QY7 A;  2VB2 X;  2F0V A;  4GS3 A;  5FK9 C;  4GNX B;  3DM1 A;  1RTN A;  1O78 A;  4HSP A;  5BN5 A;  1IW7 D;  1SNQ A;  4FDB A;  1PTO B;  4IJH A;  5JEA H;  1CQF A;  2HT1 A;  4JYA L;  2D9U A;  3H0G G;  4AQY Q;  2JA5 H;  2PO4 A;  4QJF A;  2B63 B;  1E2Z A;  4QCL A;  1STB A;  3J7A V;  2BDO A;  4ME3 A;  4GN4 B;  2MJ8 A;  2MNA A;  1MBY A;  3D4W A;  4LF9 Q;  4IUT A;  2A69 C;  1V43 A;  2B8G A;  4X3K A;  3T1Y Q;  2K03 A;  5CC4 A;  5CMD A;  1BR9 A;  2OTJ A;  3DM3 A;  2WB1 B;  1VMC A;  2CQO A;  1LM0 A;  1X6O A;  1C7Y A;  4LF6 L;  3J80 L;  2OQK A;  2IW3 A;  3NXW A;  4AYB B;  1Y1W B;  4KY6 A;  3TP5 A;  1IKM A;  3HOY H;  3DEO A;  1ET9 A;  3M3Y H;  3IRB A;  2XWB B;  3D31 A;  4HCE A;  2AWN A;  2WFW A;  5IT9 E;  1A3T A;  5NUC A;  3I4M G;  1RIP A;  1K83 H;  3AQQ A;  4A93 H;  5LMN L;  1TU2 B;  3OTO L;  4B3M L;  1XMO L;  4QIW E;  3HKZ E;  1HNW Q;  1EY9 A;  5FOB B;  3HP3 A;  2R93 B;  4KHV A;  5M3F H;  4LNQ A;  4CKE A;  4CDE C;  3E5S A;  3AU7 A;  1T5E A;  1JOR A;  5EPJ A;  3N52 A;  3J7A 5;  1O7L A;  5FJ8 H;  2F0U A;  3FPU B;  3U50 C;  3URY A;  4IPC A;  2D0P A;  2A74 C;  3AFQ A;  4BA2 I;  4A3F H;  3CCJ A;  1K8A C;  4HJ5 A;  4UDU C;  4RGO S;  3V2T A;  4O2D A;  5C0X I;  3NWT A;  2RDG A;  2J0T D;  1HR0 W;  2WAQ B;  3BG3 A;  1CQV A;  3CAM A;  3B6Y A;  1FJG Q;  2AKW B;  2EJG C;  1SE4 A;  4JBW A;  1F77 A;  2EPB A;  4RKB A;  2L9H A;  3MXP A;  3CPW A;  1EIF A;  3P1H A;  1SRU A;  3M4O B;  1XMO Q;  4B3S L;  1IYV A;  1N33 L;  3OMC A;  4FF3 A;  1WTW A;  1CKM A;  3UDI A;  4RHS A;  3J7Z C;  2HHH Q;  4CKC A;  5TSS A;  2K04 A;  2QW7 A;  5JEA J;  3S14 B;  1PH5 A;  3NQI A;  1HZC A;  5EKI A;  2ZTE A;  2F3V A;  2CHB D;  4V19 0;  4O0A A;  5C3W A;  4DU9 A;  3G71 A;  3U9S A;  5C5L A;  1YJW A;  4OWT B;  2F4I A;  4ZYS A;  1Q86 C;  3GTG H;  4C3H B;  3A54 A;  1YEZ A;  4G7H C;  2A73 B;  3SK5 A;  3T56 B;  1Q8I A;  4JI3 L;  3K7U C;  1CKN A;  3L7Z C;  1G2S A;  1LT6 D;  2MQH A;  4DKA C;  4LF7 Q;  1NJI C;  2SDF A;  1B70 B;  2A69 D;  1BNZ A;  1C8C A;  3HOV G;  1XX8 A;  3K5O A;  4FXD A;  3LWE A;  3D3R A;  1KNA A;  1E2V A;  4RH6 A;  2PQE A;  3H91 A;  4P75 A;  1CA6 A;  1IBM L;  2ES2 A;  2CQA A;  4BXX G;  2B2Y A;  1QNK A;  3ULJ A;  4DN4 M;  4MZ9 A;  2CWA A;  2R6G A;  4QGU A;  2JA9 A;  2NN6 G;  1VQA A;  1HUN A;  2CKZ B;  2VB3 X;  1NAP A;  2NTT A;  4DV3 L;  5K36 H;  1BQQ T;  4M1U B;  2JA6 B;  2EY6 A;  3H94 A;  2F52 A;  2HDM A;  4XDX A;  1X54 A;  2ZXO A;  1GUT A;  3TS2 A;  3BVG A;  3A5Z B;  3IL8 A;  1BF4 A;  1X55 A;  1KAA A;  1GKH A;  4NXN L;  1DOL A;  2K28 A;  3D8G A;  1MHW C;  4BBR G;  4ZUI A;  1VDZ A;  4DXF A;  1UWV A;  2JYO A;  3NEN A;  2L4N A;  2ZTD A;  4NB3 A;  3OIP A;  1UE7 A;  1O7I A;  1DOK A;  1VQF A;  2JEA I;  1L1O C;  1HZA A;  2KBN A;  2B2U C;  4L5Q A;  2L11 A;  3HKZ B;  4QIW B;  3X3N A;  1J5E Q;  5KYI A;  1N36 L;  2QA4 A;  1OXS C;  1MSG A;  1UAP A;  5EKL A;  1Q8K A;  1CHP D;  4DV3 Q;  4DV7 L;  4DR6 Q;  2JJQ A;  2A68 C;  3DXJ C;  1ILQ A;  1K28 A;  3HOU B;  1Q1B A;  2F0W A;  2ZM6 L;  3S1N H;  2X69 A;  4RFB A;  4OO1 G;  2O5J C;  1G8Z D;  2IPK D;  1U4R A;  3RN5 A;  3FKI B;  4LFA L;  3NE5 B;  1B9M A;  2EYH A;  4NXN Q;  3PGZ A;  1JOO A;  3EFX D;  1GOZ A;  3EBE A;  4YCW A;  1CKN B;  4OON A;  2DGY A;  1MI2 A;  4E6I A;  1QUQ A;  4GOP B;  3J81 i;  1VF5 C;  3I72 A;  3PCO B;  4CJ1 B;  2F3I A;  1NR2 A;  2N78 A;  2Z4H A;  3MXU A;  3S1M B;  3S2D B;  1LTT D;  1UEB A;  3HOW H;  5M5Y B;  3KLS X;  5CBE E;  1BDO A;  3H15 A;  1HCZ A;  2SOB A;  2OEO A;  2O4X A;  4H44 C;  4A3G B;  3I4N B;  3GTO H;  1N34 Q;  1M8A A;  4QB4 A;  2A6E C;  4MTK A;  3RR5 A;  3TME A;  3PQI A;  4PV1 C;  1CZG A;  4BWG B;  3I70 A;  1UE5 A;  4UP8 A;  4IOC A;  3C1F A;  4TQU S;  4K2L A;  5HUR A;  4IFD H;  5C6A A;  2K75 A;  4KTA A;  1JQY D;  4AYB G;  2AWO A;  4IPH A;  4NW2 A;  4JVZ A;  2JA8 B;  1QG7 A;  1DM0 B;  4K6D A;  4KJN A;  2YTY A;  5F2D A;  5GAD C;  5IWA L;  4G7Z C;  2E74 C;  1YNX A;  2RKS A;  1LAB A;  5J3B A;  3RNU A;  1DON A;  1IXR A;  1IYU A;  4LAA A;  5AFW A;  1AZP A;  2R92 B;  2E8G A;  1TWA B;  1BUV T;  2UXB Q;  4F8M A;  1JWM D;  4EQN A;  1WTX A;  2KCT A;  1PV4 A;  2HDL A;  2PI2 E;  4MTN A;  4PZ7 A;  5DM6 3;  2HCC A;  4A3D B;  2UXD Q;  1ZYR C;  2Q8I B;  1SMY C;  5IP7 G;  4QQB X;  4OIJ A;  3UDF A;  1WCM B;  2F0K A;  5I9P A;  4K8J A;  5GRO A;  1S72 A;  2Z6K A;  5C3X A;  2GA4 B;  1CI3 M;  2F1M A;  2XVS A;  4KMU C;  3NTK A;  3SEB A;  1PH6 A;  1Q46 A;  2Q8R E;  2AHO B;  2OQ0 A;  3PIP A;  2WAQ G;  1TS3 A;  2WP8 J;  2AUK A;  1WTP A;  3D4D A;  1JJG A;  3MVV A;  3CCM A;  5CBA E;  1QB5 D;  3BU2 A;  5JJZ A;  2K5V A;  2EQS A;  4MNO A;  3HOX B;  3CPF A;  4PZ8 A;  2E2J H;  1TT2 A;  1NMG A;  1V1Q A;  4PG3 A;  2VNU D;  4PQX A;  2Q2U A;  3DWQ A;  1A6X A;  2PQA A;  4HTH A;  3SXH A;  4JC0 A;  1OXX K;  4QUC A;  2HCI A;  3Q0A A;  2A68 D;  1EY7 A;  2QIL A;  2F0L A;  2CH4 A;  3GTJ H;  1EFI D;  1U4P A;  2YTX A;  1AEX A;  5EGT A;  4BY7 B;  1YIT A;  5ELE A;  4J15 A;  4BY1 B;  2KCN A;  2PI2 A;  4A3E H;  4N9T A;  4FF4 A;  4YCV A;  1AFP A;  1LTI D;  4JK1 C;  5KGU A;  1L0Y B;  5JJI A;  3IFD A;  1X3G A;  3MHB A;  4ID6 A;  3ERQ A;  1D7Q A;  2A6H C;  3KJP A;  4C3H G;  3F2B A;  1L2F A;  3S1R B;  3S1Q B;  1SFO B;  5C44 G;  5M5X B;  1FNV A;  2PW5 A;  5M3M H;  4CJ2 C;  5A2Q E;  2ICI A;  4R4T A;  3HKS A;  3RUZ A;  1PHJ A;  2L12 A;  3Q23 A;  3CCS A;  5IYD H;  4I65 A;  5LL6 S;  4IFD J;  1GXD C;  2K1B A;  3F8T A;  2C35 B;  4JI8 Q;  1K8M A;  1I94 Q;  4XYO A;  2A6E D;  3CRL C;  3S15 H;  3E3X A;  1PRT B;  1Z7T A;  1ILP A;  4TVA B;  1GM5 A;  3OSO A;  1D2B A;  1TS2 A;  1H9M A;  3KF8 A;  3HGB A;  2EOT A;  3K7A B;  3OOC A;  1WTQ A;  4Z9C B;  1QCB D;  1SDF A;  3GTL B;  3GTP H;  1WFQ A;  2B29 A;  1SNC A;  2Z9H A;  3RZO H;  3GV3 A;  4IFD I;  3PO2 B;  2UXC L;  1TR5 A;  1QJO A;  2CW0 C;  2OXP A;  3DHQ A;  4APV A;  5ELC A;  4A3I G;  2PQA B;  3STB D;  4LK1 C;  1BKB A;  1SMY D;  1TWH H;  3GTM H;  2PZU A;  2N88 A;  1OO9 B;  1NNX A;  1QWY A;  4ULL A;  5ELD A;  3L3O C;  1TWF B;  1VQ4 A;  3H09 A;  4ZKC B;  1BCP C;  2ZT9 C;  5ELO A;  3E9I A;  4IN3 A;  1JE4 A;  3IFT A;  4ILW A;  1SNO A;  3UE0 A;  1SRO A;  1VQE A;  2QGQ A;  3FMC A;  3HOU G;  1VQ8 A;  4KKS A;  3T13 A;  3WOE A;  3ONA B;  4DGZ A;  1SEB D;  1KLG D;  1LT3 D;  3MWY W;  3FKI G;  1XNQ Q;  3HOZ B;  4BA1 I;  3S16 B;  5A35 A;  1PFN A;  5L37 A;  1K3B C;  2K5H A;  1EWI A;  1N32 Q;  1CHQ D;  4A3B G;  1AZQ A;  2F0N A;  4X3T A;  3O13 A;  3Q24 A;  1LT5 D;  1EYC A;  2QDB A;  2VW9 A;  1XMQ L;  1J8I A;  3HRZ C;  1LLR D;  1NTG A;  4C3I B;  2VUM G;  1ZXT A;  2DJF C;  3KUP A;  4RKL A;  3BVM A;  4UPA A;  5IP9 G;  1RJT A;  1SN8 A;  3SVM A;  3KF8 B;  3Q8D A;  4KD4 A;  3I4N G;  1M4V A;  2EJF C;  1F9R A;  1IBL L;  1TKW B;  1O7Z A;  1IBK L;  2A6H D;  4K5X A;  2XIW A;  4A3K B;  3I4M H;  1B44 D;  1STN A;  1K3R A;  2KCM A;  3G6J B;  4JI1 L;  4DK0 A;  4X66 Q;  3OW2 A;  1F9S A;  1P16 A;  1VMP A;  2EYM A;  4CHT B;  4DA2 A;  1PH4 A;  3VR4 A;  4DV1 Q;  2JA7 B;  1JOQ A;  2EY2 A;  2R92 G;  5EKK A;  3HFZ B;  1BBX C;  1VQN A;  2F0M A;  2NVQ B;  3KLS A;  4K14 A;  4TKO B;  4X3U A;  2DUD A;  3JAM E;  4A3D G;  1ROD A;  3M9B A;  5K5P A;  1VF7 A;  2OCE A;  2K01 A;  1WCM G;  4Q5V A;  2H1E A;  1KAB A;  1HNZ L;  1ASZ A;  3GTQ B;  5D3I B;  3VYS A;  3PO3 B;  5KND A;  1PTO C;  4BBS H;  1E1T A;  4ODG A;  1Z9F A;  4P72 A;  5I6W A;  4JI5 L;  1I4H A;  2CW0 D;  1S3O A;  2X6G A;  4OEM B;  1L0W A;  3EVQ A;  1GVP A;  4YHH L;  2YU9 H;  4JI4 L;  3C2P A;  4P71 A;  1KC8 C;  3ER0 A;  4HAE A;  1ET6 A;  2FFK B;  1I4P A;  1YNJ C;  2AQ3 B;  4RAU C;  2K5Q A;  3D6C A;  4FVM A;  1EQT A;  3AMU A;  5AJ3 L;  3GDE A;  2F0E A;  4LFC Q;  2B2W C;  4C3J G;  2CH4 W;  1BCP D;  3CCL A;  2KJX A;  5ELF A;  1SR3 A;  4L5S A;  2BDN A;  3JAM i;  4UP9 A;  2G5D A;  2UUB Q;  1TWG B;  4JI6 L;  5I9O A;  3T1H L;  2LXK A;  4IO9 A;  3KFU A;  1CT1 D;  1K0S A;  1R9T B;  3BDO A;  1LTA D;  1EOV A;  4O42 A;  4YHH Q;  3NHH A;  3HOV H;  2R7D A;  4HN7 A;  2NVT B;  4OEL B;  1U0L A;  4NPS A;  3FP9 A;  3K5L A;  1VQD A;  2KEE A;  3HOY B;  5M9O A;  3M3Y B;  4KLK A;  2IHE A;  5BN3 A;  3M4Y A;  2UUC L;  2NN6 H;  2BCO A;  3NK9 A;  4OHJ A;  1KHI A;  1UE6 A;  1K83 B;  1E1O A;  4A93 B;  4A3J G;  1XNR L;  2IX3 A;  2F4V L;  4NMZ A;  3K5N A;  5M3F B;  3S9W A;  4GLV B;  4RG1 A;  2QCP X;  3CCR A;  1W3S A;  2PZW A;  3RZD H;  2DNC A;  3QOL A;  1VCI A;  1E3P A;  3J80 E;  4HIK A;  4BBR H;  2MO0 A;  3DEP A;  1AP0 A;  4TRD A;  4QL5 A;  2UUA L;  1UEA B;  4A3F B;  1KRS A;  2XWJ B;  4X3S A;  4EVO A;  1B53 A;  1RF2 D;  2V1C C;  4JYA Q;  1WI5 A;  1LTL A;  2IWH A;  2TMP A;  2A1A A;  1R4Q B;  1CA5 A;  3GTK H;  3PV0 A;  1V1P B;  4R1J A;  4OO1 H;  3CME A;  1F2M A;  3X3M A;  5LMU L;  5IE8 A;  4RGT A;  4K6L A;  2B2V A;  3M4Q A;  2R61 A;  3KBX A;  3CCU A;  1KDC A;  1VQM A;  1PTO H;  4ZUJ A;  1TQO A;  2K32 A;  3K0Y A;  1BVS A;  3J7Y W;  2SEB D;  1IHZ A;  3I90 A;  3I55 A;  4DV4 L;  5I6Y A;  4LF6 Q;  3M7N A;  1ICF B;  4X64 L;  4K5V A;  3J80 i;  2Z0S A;  1T5X D;  5ELB A;  1VQL A;  1EY6 A;  5C4J H;  2K5W A;  5T1I A;  1YNJ D;  3KDF A;  2I0Q A;  3HOZ G;  2NYZ D;  4UAI A;  5KRU A;  1EIY B;  1F9P A;  1A0I A;  2VQF L;  3GTG B;  4IUQ A;  1GUO A;  3I4L A;  4FF2 A;  1STG A;  2CVR A;  1JWS D;  5E4X A;  4PMC A;  3FPP A;  4XQJ A;  1Y14 B;  2JEB I;  5LMN Q;  3OTO Q;  4B3M Q;  2Z1C A;  1E7Z A;  1SJE D;  1PH2 A;  1K9M C;  2MPM A;  4A3M G;  1PFM A;  4C3I G;  1EY0 A;  4P74 A;  4GKK L;  2K52 A;  2NVX B;  2VQE L;  3BS1 A;  3WWV A;  3A7L A;  2DY8 A;  3EQL C;  1LUZ A;  5GAH C;  2JP1 A;  5C0X G;  3K58 A;  5C4X B;  1A8V A;  1SYG A;  5COY A;  3SK6 A;  4A3K G;  4RMF A;  1A15 A;  1D5Z C;  1ZKO A;  3I3C A;  1HTP A;  5DEH A;  2M00 A;  4DV0 L;  1IL2 A;  5GAE C;  3SK4 A;  1VQ9 A;  5FLM G;  2LS0 1;  2MGS A;  4JPB W;  3KBG A;  5IP7 H;  4Y7N H;  1GO3 E;  4IUP A;  4DR2 L;  1ENF A;  4JCV E;  4ZQ3 A;  4B3S Q;  1QVF A;  1X32 A;  1N33 Q;  4FXK C;  1I6V C;  3AB9 A;  4KHP L;  1CFM A;  3KYH C;  3MEF A;  4JW0 A;  2EE1 A;  4B08 A;  4GOP A;  3CXC A;  1I6H B;  4CDF C;  3LNN A;  1GUS A;  3TRZ A;  3R2I A;  2NVY B;  3AYH B;  3TS0 A;  2NN6 I;  3T51 B;  1B2T A;  1ESF A;  5I2X A;  3I8Z A;  1RCV D;  4CDD C;  1PA6 A;  2LSS A;  3H6M A;  3M4O H;  1CSQ A;  3PO3 G;  4IPG A;  1WD0 A;  1G2T A;  3KDF B;  2F0P A;  1B4O A;  1RHP A;  1EQR A;  2TSS A;  5EPL A;  4POF A;  4C56 C;  1AH9 A;  1HHV A;  4R8N A;  3D4R A;  1HZ9 A;  1EQQ A;  4N8X 1;  4RHR A;  1QE6 A;  3S1N B;  4R4C A;  2E2I H;  2ALY B;  1J6Q A;  1YIJ A;  1SYE A;  1EL0 A;  5E4W C;  1G51 A;  2F0G A;  3A56 A;  4HJA A;  4DR5 L;  2D0O A;  1LAC A;  4JI3 Q;  3U58 A;  4FF1 A;  2C5C A;  3MA2 B;  2B2Y C;  4KHZ A;  3DWA A;  1CSP A;  1I4X A;  2K14 A;  3FHW A;  4GKJ L;  3K80 C;  3F2D A;  3PF4 A;  4DAP A;  4LUZ A;  1W2B A;  1QZH A;  1PH9 A;  5HGT A;  1IBM Q;  2KEN A;  5I4D A;  5IIF A;  2A19 A;  2N3S A;  2PMZ E;  2B2U A;  4HED A;  4TSS A;  4C3H H;  4V0B A;  3NQT A;  3HOW B;  3ND8 A;  3VR3 A;  4DV2 L;  3LX0 A;  5DM7 3;  5C44 H;  1VQ5 A;  2ATW A;  4OO1 I;  2K5N A;  4IUU A;  4UP7 A;  2YYZ A;  3QIA A;  3K5M A;  3GTO B;  3PIO A;  4YCU A;  3A55 A;  1AE2 A;  4WJ4 A;  3PIO 3;  1G91 A;  3Q22 A;  2EXD A;  3I73 A;  3K59 A;  3RD4 A;  3BZC A;  3S17 H;  5ISR A;  1FNU A;  2ZXP A;  4JI0 L;  3M7G A;  5M5W H;  2B63 G;  2JQO A;  1QVC A;  3G4S A;  1Q82 C;  4A3C G;  4WJW A;  4K2K A;  4J6H A;  3G48 A;  4ZCK A;  4A3L G;  1JWU D;  2FHT A;  4IJL A;  2Z6B A;  1N36 Q;  4FP5 D;  2VL6 A;  1AW7 A;  4PMB A;  4XQN A;  1PYS B;  4IOA A;  3NTH A;  4DV7 Q;  1FVI A;  4Y52 H;  1HFG A;  2JE6 I;  1WTR A;  2WB1 G;  2ZM6 Q;  4A3I H;  5IGD A;  2L55 A;  4DNT B;  2LY7 A;  5C3E H;  3CW2 C;  1V1O A;  3P75 A;  2VS1 A;  1IYJ B;  5EBD A;  4LFA Q;  1Y1W G;  3CCV A;  3J81 c;  4JI2 L;  3BVZ A;  5BN4 A;  1U9R A;  2QF7 A;  4XYQ A;  2O5I C;  2F0H A;  2IJ0 A;  3PUZ A;  5IOC A;  4LFB L;  2D5D A;  4LF8 L;  3U9O A;  2F3W A;  2NUC A;  4HJ9 A;  1SSO A;  3HOU H;  2NZO A;  1E22 A;  1L1O B;  4LF4 L;  2E2J B;  3W2D A;  4DUY L;  2R93 G;  1ML0 D;  1TS5 A;  4GN3 B;  2P5Z X;  4U67 3;  3CQZ B;  1XYI A;  3FKI H;  1FGB D;  3K57 A;  4DR1 L;  2BH8 A;  1NMF A;  3S24 A;  4S3S A;  4KN7 C;  2ZJR A;  1EQV A;  3CC4 A;  5EQ0 A;  3GTJ B;  4WJ3 M;  1FR3 A;  2RCN A;  4A3B H;  2ZJP A;  2I5H A;  2Q8T A;  5IYB G;  3S1M H;  3U4V A;  3A7A B;  4DV6 L;  1STY A;  2VUM H;  3S2H B;  1FD7 D;  1PRT F;  5G3L F;  3RN2 A;  4MN3 A;  1ZEQ X;  5IWA Q;  5IP9 H;  2E2H H;  3AFP A;  3I4N H;  3PIP 3;  3EIV A;  5LMN W;  5C4Z A;  1DOM A;  1I3Q B;  2K33 A;  1PZK D;  5M3M B;  4LF4 Q;  1HQM C;  3BYT B;  2R7Z B;  4ABN A;  4JOI C;  3A5U A;  1L0X B;  4RGN A;  5FKA C;  2JN4 A;  2PZT A;  3FDT A;  1DZ1 A;  3TZU A;  1Y8N B;  4R9W A;  3Q6S A;  4A75 A;  3S15 B;  2L5T A;  5J39 A;  1JR0 D;  1SYD A;  5C4X G;  1MSH A;  4UHV A;  2PMZ B;  1X3E A;  1MJE A;  1LTB D;  2R92 H;  4HMJ A;  3L2P A;  1EU4 A;  1MD2 D;  1TWA H;  3MXN B;  1HH2 P;  1U5K A;  1SMX A;  3SDZ A;  1KL9 A;  4GLA C;  3GTP B;  4A3D H;  4IPD A;  2EYO A;  2RQX A;  1WCM H;  2F0I A;  3JC6 6;  1VQC A;  1IKL A;  3RZO B;  1EYD A;  5E7N A;  2DJG C;  4KKU A;  2HD3 A;  2D62 A;  1SNP A;  1WD1 A;  1A3U A;  1X65 A;  3GTM B;  3ND9 A;  2X6L A;  4C2M H;  4DR4 L;  1BXT A;  1LTS D;  1J9O A;  1VQJ A;  2H5X A;  1VQ7 A;  1HA6 A;  2AUJ D;  1KD1 C;  1S5D D;  1WYD A;  5JOB A;  5IYC G;  4DR3 L;  2F0Q A;  2WKD A;  1WTO A;  1WVL A;  1TY0 A;  3NP8 A;  4LUV A;  5H1S E;  2JA6 G;  1QIL A;  4C3J H;  3BYY B;  4DAM A;  1BO0 A;  3AEV A;  2EIF A;  2Q2H A;  4OIK A;  1Y1V B;  3KJO A;  1NCV A;  1TVX A;  2IHF A;  1OXV A;  1PH3 A;  5KYL A;  1C9O A;  1ZYR D;  3V96 A;  2ASB A;  1SBB B;  4KV6 A;  2EYF A;  2G9D A;  3HS0 C;  3QR8 A;  4L6T B;  4R4Q A;  4JV5 L;  4YWK A;  3HKZ G; 
#chains in the Genus database with same CATH homology
 5D65 A;  1GJX A;  1EOT A;  4XTC S;  3NSW A;  3PUY A;  2JXM B;  1H9K A;  4ME5 A;  3CRK C;  4KKT A;  5EJW A;  1LT4 D;  1EIG A;  2E75 C;  1PLF A;  4XXE A;  1BCP F;  3OWE B;  4ZKB B;  5E1F A;  5J22 A;  2DY7 A;  1WTV A;  3GP7 A;  5DNF A;  4QMG A;  2RDF A;  1Y8O B;  4MIU A;  1EWH A;  1DJR D;  4BS9 A;  1S5F D;  4IQZ A;  2KED A;  5IGE A;  2WIN B;  2IX0 A;  1SYC A;  2RSN A;  1PFB A;  3L9A X;  4WRD A;  1HRJ A;  3LWU A;  1JB3 A;  3VA7 A;  1I4Q A;  1H9S B;  3KK7 A;  2NBF A;  4H7B A;  3R8B A;  3T53 B;  3HZX A;  2G9H D;  1QNU A;  4FNF A;  4HCS A;  1F9Q A;  4BBS B;  1E0B A;  1SE3 A;  3VA5 A;  2Z4I A;  1KNE A;  3NBH A;  4F87 A;  3DUZ A;  5IGF A;  3WDN A;  4L8J A;  4PNY A;  3G7L A;  4WFN 3;  3KLR A;  5IGB A;  1K8O A;  4EQO A;  1IL8 A;  1PDQ A;  1Z6H A;  1II3 A;  3EA6 A;  1PZI D;  1B1Z A;  4R8I A;  1BCP B;  3NTI A;  2WKC A;  1OXU A;  1S5C D;  2DN8 A;  2FMM A;  5D14 A;  5CV9 A;  1BOS A;  2F0J A;  1EY5 A;  3GO5 A;  1O7Y A;  4M8A A;  3HOV B;  5JPN C;  4IUN A;  3PUW A;  1A3V A;  4C1N I;  2JA5 B;  1V1P A;  5C4H A;  4KY7 A;  4DNR B;  4IAL A;  1PZJ D;  3RZD B;  1PMR A;  1Z47 A;  1JCK B;  2NTS A;  3TP7 A;  4BBR B;  2B2T C;  2M2L A;  4N9P A;  1SAP A;  1EY8 A;  5D3D A;  1DD2 A;  2EYP A;  3V05 A;  3P7J A;  5KNB A;  3SE0 A;  1AN8 A;  3GTK B;  2RDH A;  3SR1 A;  5KNC A;  5I2Y A;  2Z8L A;  4CKB A;  5IGC A;  2Y0S B;  2F0S A;  4F88 A;  3TDQ A;  2EVB A;  1X3P A;  4RGM A;  2KCC A;  1GHK A;  3QWN A;  1I4R A;  1B9N A;  2K6A A;  2L1B A;  1UNS A;  3VR5 A;  5C4J B;  1E2W A;  2BA0 A;  1LV9 A;  5CV8 A;  5LHY 1;  4KJO A;  2EY1 A;  2EDG A;  4CBV A;  1STA A;  5EPK A;  4HR7 B;  1EEI D;  2K7V A;  1PTO D;  2D2C C;  5C0X J;  1U4M A;  4KN4 C;  4RCN A;  5IOD A;  3VR6 A;  1YNN C;  1D5M C;  3N6R A;  1ICW A;  4KI0 A;  2E2D C;  1TS4 A;  4U68 A;  2B8F A;  1DYQ A;  2H4O A;  3R2T A;  3T16 A;  3MZ5 A;  3J7A F;  1V8Q A;  1S4Z A;  4DF7 A;  4ZRZ A;  5E3F A;  5IT9 L;  2PYK A;  3MFG A;  3FEW X;  2B2V C;  4Y7N B;  2KOL A;  1EZ8 A;  5FO8 B;  3VYR A;  3BDC A;  3TP6 A;  1ENA A;  2MP1 A;  2WV6 D;  5JVG 3;  4YIJ A;  1KLU D;  1RTO A;  2E76 C;  3FVQ A;  1MGS A;  1XXG A;  3GD7 A;  4WOR A;  1TY2 A;  1XTC D;  4XT1 B;  4PMW A;  4KY5 A;  1DXM A;  3HEJ A;  2E2I B;  4NP5 A;  4O1N A;  1DCZ A;  2IX1 A;  3T4A C;  4QUF A;  4CJ0 B;  4GZY C;  2PW7 A;  2I46 A;  5CV5 A;  2LFN A;  1PYW D;  1HTL D;  3DWP A;  1SJH D;  3NPP A;  4H13 C;  1KTK A;  1FNW A;  5CGK A;  4IUV A;  1F2Z A;  3IKJ A;  2NB0 A;  4NKL A;  3QB3 A;  3C46 A;  5C44 B;  1D1I A;  2F0F A;  4G57 A;  3R93 A;  1B3A A;  1A2U A;  3R3O A;  2L0C A;  2LKV A;  2KQ3 A;  2XNA C;  1S5B D;  4B9X A;  2EXZ A;  2ICE C;  4OL7 A;  3C3L A;  1KDB A;  2NZ1 D;  5JEA G;  3PMF A;  3VYU A;  2F0T A;  3S17 B;  3QOJ A;  5EBC A;  5JPM C;  3A8I E;  2PPB C;  4FO2 A;  5M5W B;  3QO2 A;  5LL6 X;  1SNM A;  3TSS A;  1YNN D;  4J1M A;  4DAV A;  3J81 E;  1PXU A;  3OW7 A;  1ESR A;  4A3I B;  1SXT A;  2HUG A;  2MUY A;  3RLF A;  2QEJ C;  1Y69 U;  2ID0 A;  1HUM A;  5C3E B;  3J81 L;  1RKN A;  1FYC A;  1Y8P B;  3ERO A;  4IZ8 A;  3A8K E;  2V4D A;  1STH A;  1I4G A;  1EEF D;  5FO9 B;  4J8Q A;  1HFN A;  1NR4 A;  4OGQ C;  1HA5 A;  2IL8 A;  2KVM A;  4ZAI A;  3P20 A;  3NUC A;  1F2L A;  2EJM A;  2O2L D;  3MEH A;  1HQR D;  4A3B B;  3A8J E;  1A2T A;  3MXN A;  1GUW A;  2VUM B;  2LMC B;  4L63 B;  2E2H B;  1O80 A;  1ONL A;  1G29 1;  4K8I A;  4DAY A;  4XIG S;  1CZW A;  3CKI B;  4K5W A;  3FRP B;  3QJY A;  1Q12 A;  2KUM A;  4FXG C;  4FYD A;  1U4L A;  2RA4 A;  3H3V C;  1SND A;  1NUC A;  3ZYY X;  2ENB A;  4A3E B;  1HPC A;  1C4Q A;  4ZLT F;  4ZK9 B;  4DFA A;  4KD3 A;  1KDA A;  1HXY D;  4HSV A;  1H9R A;  2AQ1 B;  4F7X A;  5CV7 A;  1PRT C;  2A5H A;  2N55 A;  3C1E A;  4QF4 A;  3E6Z X;  3BDL A;  1TII D;  4C2M B;  2OF1 A;  1CTM A;  3QG1 A;  1CK1 A;  3VYT A;  1LO5 D;  2K05 A;  3M85 A;  5K36 G;  3E0J A;  2ZXR A;  4C3J B;  1EZ6 A;  4HMI A;  4MHE A;  5CV6 A;  3DMU A;  1EWC A;  3PUV A;  3IAY A;  4C1N K;  1TWH B;  4XQQ A;  1D5X C;  2JSO A;  2FIN B;  1LTG D;  2J7Z A;  4NDX A;  5CR3 A;  1D6E C;  1D1K A;  1H9S A;  5C5M A;  3H0G B;  4B9W A;  2C9O A;  2FJ2 A;  5FO7 B;  5A2Q L;  4A3J B;  2BA1 A;  2EY5 A;  4IUR A;  1RDP D;  2SNM A;  2WII B;  3OPO A;  3W3A A;  3MFY A;  2NWG A;  3CHB D;  5J1Z A;  1QOH A;  2QKI C;  3NWS A;  2J4X A;  4DK1 A;  1GHJ A;  3EJI A;  4G4K A;  3K6O A;  2XN9 C;  2F03 A;  2XRS D;  3OMG A;  3NBI A;  2SNS A;  1TWC B;  2AQ2 B;  2F0O A;  3I4M B;  1EU3 A;  3TN2 A;  4IFD G;  2VXW A;  2KHS A;  1PRT D;  5G3L D;  4I7Z C;  3I91 A;  5KIX A;  1LTR D;  3MC0 B;  2DNE A;  1EYA A;  1RD9 D;  5CV4 A;  5JVH 3;  1CM9 A;  5JAV A;  2K5D A;  2IT1 A;  1Q3L A;  1G6Z A;  2PNR C;  2F0D A;  1W6J A;  3MTS A;  1F2Y A;  3TP8 A;  2BE5 C;  1GUG A;  5IGG A;  2PCF B;  3GQB A;  1X3Q A;  2XRQ D;  1Q90 A;  1XWE A;  1IW7 C;  1W6K A;  4A3M B;  1C48 A;  3WOF A;  3RMH A;  2YU9 B;  3F2U A;  1I50 B;  4DXG A;  2KEC A;  2KA7 A;  4P2C B;  1SYF A;  4RWS C;  1EIH A;  3TZD A;  3ITP A;  2RVL A;  2MHV A;  4RA8 A;  2HQE A;  5COR A;  1SE2 A;  2OT2 A;  3SHL A;  1S5E D;  5FLX E;  5KEE A;  3HG9 A;  5DAU A;  4G7O C;  3OWF A;  4RCO A;  3CU7 A;  5T1G A;  2FMC A;  1SYB A;  2RSO A;  5FLX L;  3UI2 A;  1PTO F;  2M9V A;  2WAC A;  4KK7 A;  5C0X H;  1Q1E A;  5CYU A;  1GUN A;  3JAM L;  1JOK A;  3BZD B;  2B2W A;  3MXG A;  1H9J A;  2EZV A;  1B50 A;  2XSC A;  2EYJ A;  2BOS A;  2RBM A;  4CGY B;  1ENC A;  1EY4 A;  1JIC A;  2R3Z A;  3OIQ A;  2B39 A;  4H0L C;  2B2T A;  1STE A;  4LJZ C;  4Q0F A;  3MAQ A;  3VR2 A;  4LMQ D;  1JC7 A;  3D6W A;  3PUX A;  1OXT A;  3GV6 A;  1R4P B;  3SK8 A;  4EGV A;  1UUP A;  2I07 B;  2EYL A;  3TBI B;  3OHX C;  4EQP A;  4XT3 B;  1NSN S;  2BE5 D;  2VB2 X;  2F0V A;  5FK9 C;  3DM1 A;  1RTN A;  1O78 A;  4HSP A;  5BN5 A;  1IW7 D;  1SNQ A;  1PTO B;  5JEA H;  1CQF A;  2D9U A;  2PO4 A;  2B63 B;  1E2Z A;  4QCL A;  1STB A;  3J7A V;  2BDO A;  2MJ8 A;  1MBY A;  3D4W A;  4IUT A;  2A69 C;  1V43 A;  2B8G A;  4X3K A;  2K03 A;  5CMD A;  5CC4 A;  1BR9 A;  2WB1 B;  1VMC A;  3J80 L;  2IW3 A;  3NXW A;  4AYB B;  1Y1W B;  4KY6 A;  3TP5 A;  1IKM A;  3DEO A;  1ET9 A;  2XWB B;  3D31 A;  4HCE A;  2AWN A;  5IT9 E;  1A3T A;  5NUC A;  1TU2 B;  1EY9 A;  5FOB B;  3HP3 A;  2R93 B;  4KHV A;  4CKE A;  3E5S A;  3AU7 A;  1T5E A;  1JOR A;  5EPJ A;  3N52 A;  1O7L A;  2F0U A;  3FPU B;  3URY A;  2A74 C;  4BA2 I;  4UDU C;  4RGO S;  3V2T A;  5C0X I;  3NWT A;  2RDG A;  2J0T D;  2WAQ B;  3BG3 A;  1CQV A;  2EJG C;  1SE4 A;  4JBW A;  1F77 A;  2EPB A;  4RKB A;  2L9H A;  3MXP A;  3P1H A;  3M4O B;  1IYV A;  3OMC A;  4FF3 A;  1WTW A;  4RHS A;  4CKC A;  5TSS A;  2K04 A;  5JEA J;  3S14 B;  3NQI A;  5EKI A;  2F3V A;  2CHB D;  4V19 0;  5C3W A;  4DU9 A;  3U9S A;  5C5L A;  2F4I A;  4ZYS A;  4C3H B;  3A54 A;  4G7H C;  2A73 B;  3SK5 A;  3T56 B;  1Q8I A;  3L7Z C;  1G2S A;  1LT6 D;  2SDF A;  1BNZ A;  2A69 D;  1C8C A;  1XX8 A;  3K5O A;  4FXD A;  3D3R A;  3LWE A;  1KNA A;  1E2V A;  4RH6 A;  2PQE A;  3H91 A;  1CA6 A;  2CQA A;  2B2Y A;  1QNK A;  4DN4 M;  2R6G A;  2NN6 G;  1HUN A;  2VB3 X;  1NAP A;  2NTT A;  5K36 H;  1BQQ T;  4M1U B;  2JA6 B;  2EY6 A;  3H94 A;  2HDM A;  4XDX A;  2ZXO A;  1GUT A;  3BVG A;  3IL8 A;  1BF4 A;  1KAA A;  1DOL A;  2K28 A;  3D8G A;  4ZUI A;  1VDZ A;  4DXF A;  2JYO A;  2L4N A;  3OIP A;  1DOK A;  2JEA I;  2B2U C;  2L11 A;  3HKZ B;  4QIW B;  3X3N A;  5KYI A;  1OXS C;  1MSG A;  1UAP A;  5EKL A;  1CHP D;  2A68 C;  3DXJ C;  1ILQ A;  3HOU B;  1Q1B A;  2F0W A;  4OO1 G;  2O5J C;  2X69 A;  4RFB A;  1G8Z D;  2IPK D;  1U4R A;  3FKI B;  3NE5 B;  1B9M A;  2EYH A;  1JOO A;  3EFX D;  1GOZ A;  1MI2 A;  4E6I A;  1VF5 C;  3I72 A;  4CJ1 B;  1NR2 A;  3S1M B;  2Z4H A;  3MXU A;  3S2D B;  1LTT D;  5M5Y B;  3KLS X;  5CBE E;  1BDO A;  1HCZ A;  2SOB A;  2OEO A;  2O4X A;  4H44 C;  4A3G B;  3I4N B;  1M8A A;  4QB4 A;  2A6E C;  3TME A;  4PV1 C;  1CZG A;  4BWG B;  3I70 A;  3C1F A;  4TQU S;  4K2L A;  5HUR A;  4IFD H;  5C6A A;  4KTA A;  1JQY D;  2AWO A;  4NW2 A;  2JA8 B;  1QG7 A;  1DM0 B;  4K6D A;  4KJN A;  5F2D A;  4G7Z C;  2E74 C;  2RKS A;  1LAB A;  1DON A;  1IYU A;  4LAA A;  5AFW A;  1AZP A;  2R92 B;  1TWA B;  1BUV T;  4F8M A;  1JWM D;  4EQN A;  1WTX A;  2HDL A;  5DM6 3;  2HCC A;  4A3D B;  1ZYR C;  2Q8I B;  1SMY C;  4OIJ A;  1WCM B;  2F0K A;  5I9P A;  4K8J A;  5C3X A;  2GA4 B;  1CI3 M;  2F1M A;  2XVS A;  4KMU C;  3NTK A;  3SEB A;  2Q8R E;  1TS3 A;  2WP8 J;  2AUK A;  1WTP A;  3D4D A;  3MVV A;  5CBA E;  1QB5 D;  5JJZ A;  3HOX B;  1TT2 A;  2VNU D;  4PQX A;  3DWQ A;  1A6X A;  4HTH A;  3SXH A;  1OXX K;  4QUC A;  2HCI A;  3Q0A A;  2A68 D;  1EY7 A;  2QIL A;  2F0L A;  1EFI D;  1U4P A;  1AEX A;  5EGT A;  4BY7 B;  5ELE A;  4BY1 B;  2KCN A;  4N9T A;  4FF4 A;  1AFP A;  1LTI D;  4JK1 C;  5KGU A;  1L0Y B;  3IFD A;  3MHB A;  4ID6 A;  3ERQ A;  2A6H C;  4C3H G;  3S1R B;  3S1Q B;  1SFO B;  5M5X B;  1FNV A;  2PW5 A;  4CJ2 C;  5A2Q E;  2ICI A;  3RUZ A;  2L12 A;  3Q23 A;  4I65 A;  5LL6 S;  4IFD J;  1GXD C;  2K1B A;  1K8M A;  4XYO A;  2A6E D;  3CRL C;  1PRT B;  1Z7T A;  1ILP A;  3OSO A;  1D2B A;  1TS2 A;  1H9M A;  3KF8 A;  3HGB A;  2EOT A;  3K7A B;  3OOC A;  1WTQ A;  4Z9C B;  1QCB D;  1SDF A;  3GTL B;  1SNC A;  3GV3 A;  4IFD I;  3PO2 B;  1TR5 A;  1QJO A;  2CW0 C;  2OXP A;  3DHQ A;  5ELC A;  4LK1 C;  1SMY D;  2PZU A;  2N88 A;  1OO9 B;  1QWY A;  4ULL A;  5ELD A;  3L3O C;  1TWF B;  3H09 A;  4ZKC B;  1BCP C;  2ZT9 C;  4IN3 A;  1JE4 A;  3IFT A;  4ILW A;  1SNO A;  3FMC A;  4KKS A;  3T13 A;  3WOE A;  3ONA B;  4DGZ A;  1SEB D;  1KLG D;  1LT3 D;  3MWY W;  3HOZ B;  4BA1 I;  3S16 B;  5A35 A;  1PFN A;  1CHQ D;  1AZQ A;  2F0N A;  4X3T A;  3O13 A;  3Q24 A;  1LT5 D;  1EYC A;  2QDB A;  1J8I A;  3HRZ C;  1LLR D;  4C3I B;  1ZXT A;  3KUP A;  4RKL A;  3BVM A;  1RJT A;  3SVM A;  4KD4 A;  1M4V A;  2EJF C;  1F9R A;  1TKW B;  1O7Z A;  2A6H D;  4K5X A;  2XIW A;  4A3K B;  1B44 D;  1STN A;  3G6J B;  4DK0 A;  1F9S A;  1VMP A;  2EYM A;  4CHT B;  4DA2 A;  3VR4 A;  2JA7 B;  1JOQ A;  2EY2 A;  5EKK A;  1BBX C;  2F0M A;  2NVQ B;  3KLS A;  4K14 A;  4TKO B;  4X3U A;  3JAM E;  1ROD A;  5K5P A;  1VF7 A;  2K01 A;  4Q5V A;  2H1E A;  1KAB A;  3GTQ B;  5D3I B;  3VYS A;  3PO3 B;  5KND A;  1PTO C;  4ODG A;  5I6W A;  1I4H A;  2CW0 D;  2X6G A;  3C2P A;  3EVQ A;  4HAE A;  1ET6 A;  2FFK B;  1I4P A;  1YNJ C;  2AQ3 B;  4RAU C;  2K5Q A;  3D6C A;  4FVM A;  1EQT A;  3AMU A;  2F0E A;  2B2W C;  4C3J G;  1BCP D;  2KJX A;  5ELF A;  2BDN A;  1TWG B;  5I9O A;  1CT1 D;  1R9T B;  3BDO A;  1LTA D;  4O42 A;  3NHH A;  4HN7 A;  2NVT B;  3K5L A;  2KEE A;  3HOY B;  5M9O A;  3M3Y B;  5BN3 A;  3M4Y A;  2NN6 H;  2BCO A;  3NK9 A;  4OHJ A;  1K83 B;  4A93 B;  2IX3 A;  4NMZ A;  3K5N A;  5M3F B;  3S9W A;  2QCP X;  2PZW A;  2DNC A;  3QOL A;  1VCI A;  3J80 E;  3DEP A;  1AP0 A;  4TRD A;  1UEA B;  4A3F B;  2XWJ B;  4X3S A;  4EVO A;  1B53 A;  1RF2 D;  2IWH A;  2TMP A;  1R4Q B;  1CA5 A;  3PV0 A;  1V1P B;  4OO1 H;  1F2M A;  3X3M A;  4RGT A;  4K6L A;  2B2V A;  2R61 A;  3KBX A;  1KDC A;  1PTO H;  4ZUJ A;  1TQO A;  2K32 A;  3K0Y A;  3J7Y W;  2SEB D;  1IHZ A;  3I90 A;  5I6Y A;  3M7N A;  4K5V A;  1T5X D;  5ELB A;  1EY6 A;  2K5W A;  5T1I A;  1YNJ D;  2NYZ D;  4UAI A;  5KRU A;  1F9P A;  3GTG B;  4IUQ A;  1GUO A;  3I4L A;  4FF2 A;  1STG A;  2CVR A;  1JWS D;  5E4X A;  4PMC A;  3FPP A;  4XQJ A;  2JEB I;  2Z1C A;  1SJE D;  2MPM A;  1PFM A;  4C3I G;  1EY0 A;  2NVX B;  3BS1 A;  3A7L A;  2DY8 A;  3EQL C;  2JP1 A;  5C0X G;  3K58 A;  5C4X B;  1SYG A;  5COY A;  3SK6 A;  1A15 A;  1D5Z C;  1ZKO A;  3I3C A;  1HTP A;  5DEH A;  2M00 A;  3SK4 A;  2LS0 1;  2MGS A;  3KBG A;  4IUP A;  1ENF A;  4ZQ3 A;  1X32 A;  4FXK C;  1I6V C;  3AB9 A;  1CFM A;  2EE1 A;  4B08 A;  1I6H B;  3LNN A;  1GUS A;  3R2I A;  2NVY B;  2NN6 I;  3T51 B;  1B2T A;  1ESF A;  5I2X A;  3I8Z A;  1RCV D;  3H6M A;  1WD0 A;  1G2T A;  2F0P A;  1B4O A;  1RHP A;  2TSS A;  5EPL A;  1HHV A;  4C56 C;  4R8N A;  3D4R A;  4RHR A;  3S1N B;  1QE6 A;  1SYE A;  1EL0 A;  5E4W C;  2F0G A;  3A56 A;  4FF1 A;  1LAC A;  2C5C A;  3MA2 B;  2B2Y C;  4KHZ A;  3DWA A;  1I4X A;  4DAP A;  5HGT A;  5IIF A;  5I4D A;  2B2U A;  4HED A;  4TSS A;  4V0B A;  3NQT A;  3HOW B;  3ND8 A;  3VR3 A;  3LX0 A;  5DM7 3;  4OO1 I;  4IUU A;  2YYZ A;  3QIA A;  3K5M A;  3GTO B;  3A55 A;  3PIO 3;  1G91 A;  3Q22 A;  3I73 A;  3K59 A;  3RD4 A;  5ISR A;  1FNU A;  2ZXP A;  3M7G A;  4WJW A;  4K2K A;  4J6H A;  1JWU D;  2FHT A;  4FP5 D;  1AW7 A;  4PMB A;  4XQN A;  3NTH A;  1HFG A;  2JE6 I;  1WTR A;  5IGD A;  2L55 A;  4DNT B;  2LY7 A;  1V1O A;  3P75 A;  5EBD A;  3BVZ A;  5BN4 A;  1U9R A;  2QF7 A;  4XYQ A;  2O5I C;  2F0H A;  2IJ0 A;  3PUZ A;  5IOC A;  2D5D A;  3U9O A;  2F3W A;  2NUC A;  1SSO A;  2E2J B;  3W2D A;  1ML0 D;  1TS5 A;  4U67 3;  3CQZ B;  1XYI A;  1FGB D;  3K57 A;  4S3S A;  4KN7 C;  1EQV A;  5EQ0 A;  3GTJ B;  1FR3 A;  2Q8T A;  3A7A B;  1STY A;  3S2H B;  1FD7 D;  1PRT F;  5G3L F;  4MN3 A;  1ZEQ X;  3PIP 3;  5C4Z A;  1DOM A;  1I3Q B;  2K33 A;  1PZK D;  5M3M B;  1HQM C;  3BYT B;  2R7Z B;  4ABN A;  1L0X B;  4RGN A;  5FKA C;  2PZT A;  3FDT A;  1DZ1 A;  3TZU A;  1Y8N B;  4R9W A;  3Q6S A;  3S15 B;  2L5T A;  5J39 A;  1JR0 D;  1SYD A;  1MSH A;  2PMZ B;  1LTB D;  4HMJ A;  1EU4 A;  1MD2 D;  3SDZ A;  3GTP B;  2EYO A;  2RQX A;  2F0I A;  1IKL A;  3RZO B;  1EYD A;  4KKU A;  2D62 A;  1SNP A;  1WD1 A;  1A3U A;  3GTM B;  3ND9 A;  2X6L A;  1BXT A;  1LTS D;  1J9O A;  1HA6 A;  2AUJ D;  1S5D D;  5JOB A;  2F0Q A;  2WKD A;  1WTO A;  1WVL A;  1TY0 A;  3NP8 A;  1QIL A;  3BYY B;  1BO0 A;  4OIK A;  1Y1V B;  1NCV A;  1TVX A;  1OXV A;  5KYL A;  1ZYR D;  3V96 A;  1SBB B;  4KV6 A;  2EYF A;  2G9D A;  3HS0 C;  4L6T B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...