1Y69U

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y69U01
2L5TA 1VF5C 2E74C 3DXJC 3H94A 2AUJD 1ZKOA 3M85A 1Q90A 2A6HC 3A7AB 3L7ZC 1HCZA 2D2CC 2BE5C 1VCIA 1GUTA 1GJXA 3MFYA 5BN3A 5KNDA 2QF7A 1O7LA 3I73A 3P20A 4JK1C 4H0LC 2DNCA 2B8FA 3FMCA 1V43A 3GD7A 3VR4A 1V8QA 2NN6H 4HR7B 1ONLA 3PUWA 5JEAG 4KI0A 2EJMA 2EJGC 4BA2I 1IW7C 3LWUA 1GUOA 1H9MA 3AB9A 4XTCS 5BN5A 1DD2A 3LNNA 4L8JA 1OXXK 1GHKA 5C0XG 4KMUC 4BA1I 3M7NA 1QJOA 2EDGA 1OXSC 2A6EC 1SMYC 2YYZA 1H9KA 2BA1A 1G291 1YNNC 1B9MA 2JEAI 4DK1A 3T53B 3D4RA 3PUZA 2D5DA 2NN6G 3KLRA 2K32A 1YNJC 1A6XA 4PV1C 2K33A 1OXVA 3PUYA 1K8MA 4DNTB 4I7ZC 2A68C 2R6GA 5K36G 1IW7D 3ND9A 5A35A 1Y69U 2BA0A 1IYVA 3BDOA 1H9SA 3QG1A 2Q8IB 4DNRB 1FR3A 1Y8NB 1Z7TA 2O5JC 2EVBA 2KA7A 3IKJA 4TKOB 2A6ED 1B9NA 4KKTA 1H9JA 2D62A 1CFMA 1VDZA 2A69D 2JXMB 2LMCB 3I72A 2ZT9C 3IFTA 4OO1H 1DCZA 4GZYC 3QJYA 1GUSA 1Q12A 1EWHA 2NN6I 1BDOA 1VF7A 5C0XH 3A7LA 4G7HC 4XIGS 2IT1A 5KNCA 1GHJA 3U9SA 5JEAH 4H13C 3A8IE 2PCFB 3M4YA 3N6RA 4KKSA 3A8JE 3VR2A 2CW0C 3OPOA 2O5IC 1E2VA 2BDOA 3GQBA 4KN7C 1O78A 5KNBA 1HQMC 1IYUA 2K7VA 2BE5D 1Q1EA 4G7ZC 3VR5A 3VR3A 1Y8PB 1Q1BA 3I4LA 3BG3A 4IQZA 4OGQC 1E2ZA 3A8KE 3OW7A 3FPPA 1T5EA 3CRKC 1FYCA 1H9RA 2DN8A 3CRLC 2JEBI 2AUKA 2DNEA 5K36H 1GUNA 4TQUS 2V4DA 1CI3M 4G7OC 4KHZA 3SDZA 3VA7A 1LABA 2E75C 3PV0A 1GUGA 3PUVA 1HTPA 2KCCA 3QIAA 3SE0A 4OO1G 2A68D 3T56B 4H44C 5BN4A 1DXMA 1PMRA 4RCNA 1E2WA 4IFDH 2A6HD 4LK1C 3VR6A 1I6VC 1OXUA 2PPBC 3ND8A 2F1MA 2JE6I 2PNRC 3MXUA 3NE5B 4KN4C 3RLFA 1H9SB 2A69C 1TU2B 2B8GA 3T51B 3HGBA 2EJFC 1TKWB 1LACA 1OXTA 2AWOA 3EQLC 1CTMA 1Z6HA 3W3AA 4JBWA 3D31A 3PUXA 3WDNA 4DK0A 3OOCA 1ZYRC 1Y8OB 4KKUA 2E76C 1HPCA 1K8OA 3TZUA 4IFDG 4LJZC
chains in the Genus database with same CATH superfamily
1JE5A 4A3JG 2UUBQ 1X3QA 1CHQD 1KLGD 2A6HC 4ME3A 2C5CA 1LT5D 1K3BC 3GTPB 1G2SA 3MFYA 2LY7A 2QF7A 1PH5A 2F0KA 3I4OA 2DNCA 1PH6A 4B08A 1V43A 3CMEA 3GD7A 3TN2A 3G6EA 1VQ9A 2KEDA 3T1YQ 2K5HA 3HOYB 2WFWA 4FF2A 2K5NA 1JORA 3NBHA 1KDBA 1TWAB 4RFBA 4HJ8A 4IZ8A 5BN5A 1SAPA 3H0GH 4JOIC 5C0XG 1CM9A 4K5VA 4XT1B 1CUKA 4A3LG 3DWAA 4DUZL 1SFOB 2IW3A 4UHVA 4DAYA 1MHWC 3O13A 4ILWA 3C1FA 2XSCA 3E6ZX 2A68C 3FRPB 1Y69U 4A3DG 2Q8IB 1JB3A 4LF7Q 3HKZG 2EVBA 1LTBD 1UE6A 5ELEA 1CQVA 4DUZQ 1ASYA 3DWQA 1QUQB 2IHFA 5J3BA 2VUMB 4DV5Q 3BYYB 1VQ6A 3A7LA 3S1QH 4UP9A 4JI3L 2RSNA 3IAYA 2NWGA 3VYUA 4PZ8A 4JI6L 3OPOA 2IWHA 1ET6A 2WB1E 2ZTDA 4IJLA 3R8BA 4DA2A 1FNUA 4GNXA 1NMGA 1E2ZA 4P72A 2VXWA 1FYCA 3CRKC 2OWOA 2JEBI 2AUKA 4P2CB 2OF1A 2M9VA 3VA7A 4YCWA 1JQYD 4KY7A 3H15A 1GUGA 3E5SA 1ET9A 2E5LL 3L0OA 3E3XA 1RIPA 3MXNA 4LW1A 3KF6A 4X3UA 3AFPA 2KUMA 2DUDA 4GOPA 2F0FA 4A93B 2C9OA 1EQRA 2VL6A 1B44D 3KUPA 4N8FA 2K4KA 5FLXc 2JA7G 4FP5D 1FGBD 1RL2A 2ZXRA 1EU4A 3RZDB 1ASZA 4DV7L 1EQVA 3H94A 3CF5A 2BCOA 5IY0A 1QG7A 2WIIB 3FKIB 1PTOH 1N36L 3VDYA 1X56A 3NXWA 1HQRD 5BN3A 1X3FA 1BCPB 4A3BB 2PNHA 2KHSA 1AP0A 1F2ZA 3IL8A 1MI2A 1LTGD 4BA2I 3S15H 4CDEC 3GTLH 4KMUC 4HEDA 4BA1I 2EZVA 3FP9A 1SROA 4LFAL 3UI2A 3GTQH 3TBIB 3CCSA 4P71A 4KHPL 1E1TA 1EUJA 1PLFA 5C4HA 5CV5A 2SEBD 3RMHA 1XNRQ 1VQPA 4A3IG 1EWCA 4BY1H 1MJCA 1UE5A 3BVZA 3ZJYC 1NUCA 3UDXA 1FR3A 4FO2A 3ULJA 4X3KA 4KKTA 2D62A 4OO1H 2EE1A 1F9PA 3S2DH 2ZT9C 1I50H 4RGNA 2NN6I 4JBJA 4S3SA 3ITPA 4EVOA 1IKLA 4ZCKA 1NE3A 4KKSA 1VMPA 1I5FA 1VQ4A 3S1NH 3DMUA 3Q6SA 3KBXA 1YNND 1B50A 4FF3A 2K50A 4IURA 3G4SA 3K5OA 1U4LA 2KBNA 3BJUA 4A3CH 2B2TC 4DF7A 2EYMA 3CAMA 3GP7A 5ELNA 1U4RA 2F0IA 1GD7A 2A68D 4H44C 1PTOB 4HCEA 3EN2A 1WTHA 1EYGA 1U5KA 4X66L 2PPBC 1SNQA 4XT3B 3SK8A 3KFUA 1TWHH 1SDFA 2E2HB 1IBKQ 4Y52H 1UE1A 4CJ0B 5GAEC 1CK1A 3K7UC 3J80E 2FINB 1N8RC 2ZJQA 1LUZA 5CV6A 4C3IB 1ZYRC 2XIWA 4KKUA 5ELDA 1D1KA 4OEMB 1BBXC 3QOLA 2NVYH 1VQGA 5C3EH 4CBVA 3M85A 3AU7A 3A7AB 2JYOA 4DV3Q 2JA6G 3I8ZA 1KAWA 1NMFA 1X32A 3U4VA 1KRTA 1K0SA 3I73A 2XGTA 2Q2IA 3KJOA 2UXCQ 2F0PA 3BZCA 1HR0L 3ICEA 5CC4A 1XX8A 4FDBA 1GUOA 1QOHA 4DV4L 4JI0L 4A93H 3A55A 3NSWA 5FJ8H 1SYFA 1SYBA 1PTOD 5FK9C 4L6TB 3Q22A 3HOUB 4QUFA 4MN3A 1F2LA 3DM1A 3I4NB 4LF6Q 2EQSA 1TWGH 2K6AA 4DR4L 3M4PA 1STYA 2G5DA 3TS2A 2ZJPA 1S5BD 2QCPX 4C3IH 2WKDA 5FO9B 3S1RB 1X9NA 4A3CG 3UDFA 1ESRA 1LTAD 5I6WA 5DLQE 1SE8A 1AH9A 1B9NA 1PFMA 3CC2A 2JXMB 3I72A 4IN3A 3VA5A 1YHQA 1SNMA 2HDMA 3AMUA 3OIQA 1TWCB 1N33Q 2I0QA 4ULLA 4GLVB 3BYTB 1N32L 2Z1CA 3A8JE 1NY4A 2EIFA 4DAPA 3E9HA 3CC7A 2O5IC 2ICIA 1L0YB 4KN7C 3M4OB 4XYQA 1G51A 1PZKD 3A8KE 3R3OA 3X3NA 3GTKB 4A3KH 4TQUS 1IBML 5LMNL 3J80L 1PRTD 3H09A 3PO3H 1N32Q 3EA6A 3RN2A 2JA7H 3RUZA 4QJFA 3S1MH 1PMRA 3FPUB 1QWYA 4JYAQ 3NE5B 2EYOA 1P16A 3DWPA 1YHAA 4NXMQ 5C6AA 2F0DA 5FO8B 4BXXH 2N55A 3EQLC 5IYDH 1CTMA 3GTOB 2I5MX 2B2WA 1HFNA 1F9SA 2FJ2A 4EGVA 4P74A 4X62L 2SOBA 2AHOB 4JYAL 3CCMA 4IFDG 3U9OA 3GTJH 1Q90A 1HCZA 5M3FB 1B70B 4GOPC 5IWAL 4A3EG 3DM3A 5IE8A 1YITA 4CDFC 1K83B 3HOZG 4K2LA 4K2KA 1MD2D 1J9OA 3FEWX 3L2PA 2KCMA 1A62A 1BQQT 1D6EC 2JP1A 4C3IG 3VR4A 4GOPB 3KBGA 4BBSB 3T1HL 1DD2A 4L8JA 3BDLA 1I50B 2JQOA 4X3SA 4K0KQ 1SMYC 5IP7H 3CMAA 2BA1A 3OTOQ 1XNQQ 4DK1A 2WV6D 1KDCA 3PUZA 4WJ4A 3BS1A 2PMZB 2F3IA 3DUZA 2F4VL 2PQAA 3N52A 1ZYRD 3PGZA 3GTGH 2Y0SB 1EU3A 2JA5G 3QG1A 1WJJA 2SNSA 1Z7TA 4KTAA 1JJCB 3IKJA 5AJ3L 4TKOB 3I4MG 3K8AA 1H9JA 2YV5A 1MKHA 4K5WA 2H4OA 4GZYC 1RJTA 5C0XH 1I3QB 1SXTA 3RR5A 2VS1A 3F2CA 4KV6A 2XTIA 1L2FA 5HY6A 2R93G 5IGGA 5GADC 4DV1Q 1IBLL 1WTWA 2L55A 4HSPA 4G7ZC 2EXZA 4CDCC 4F87A 4JBMA 1BR9A 1KLUD 1X55A 2KVMA 2LFNA 2NBFA 4ME5A 4DAYB 3M9BA 1N34L 4C2MH 1DZ1A 3S14B 2RDHA 1GUWA 2RCFA 4HTHA 3EROA 3W2DA 4OO1G 1WTVA 1JE4A 2M00A 2PI2A 4DV1L 5KYLA 1IBLQ 1I4GA 5KGUA 4IFDH 2DGYA 1XJVA 2RCNA 3MXUA 2JA6H 4C3HB 4OONA 3SK5A 4KY5A 1XYIA 1TU2B 1N34Q 3T51B 1JMCA 1L1OC 2L1BA 4A3IB 4EQPA 1JJ2A 2L4NA 1RCVD 1TVXA 1E3PA 5C0XJ 3T1YL 1MGSA 3J7ZC 2FXQA 1HPCA 3CC4A 2XRQD 2UUAQ 3JAME 1PH9A 1ENFA 1EZ6A 1L1OA 1BXTA 4HR7B 4XQNA 4B9XA 2L0CA 4FF4A 4KJNA 2FHTA 2JA8G 1Y1WG 2MHVA 4XTCS 1JOOA 2VQEQ 3LNNA 1HUNA 1JOKA 3AYHB 3EFXD 2E5LQ 1PH7A 3S17H 1XXGA 3I4MH 4IFDJ 4HN7A 2R93H 4TRDA 3HOXH 2JSOA 1GM5A 1CSQA 2K33A 1EYAA 4C3HH 4ODGA 3TP7A 1WYDA 4BBRB 3A74A 1LTSD 4QIWB 1IYVA 2MFIA 1H9SA 4K8JA 2PZWA 2UXDL 4QL5A 1SFOH 1MBYA 3RLNA 2XWJB 2KA7A 5EJWA 2B63G 1EY6A 2A6ED 1KNAA 3T16A 2CH4W 1YVCA 2PZTA 1B53A 1Q7YC 4LFBQ 4YWMA 5GROA 3TREA 1GVPA 4NB3A 4NXNQ 1FJGL 1HNXQ 1X3GA 1I4PA 1CSPA 3HFZB 1R4PB 2Q2HA 4BY7G 3SK6A 4N8X1 1O78A 1WTRA 2NUCA 3CW2C 2NZHA 3H3VC 4LFAQ 4J8QA 1HR0W 2CVRA 1WTQA 2F3VA 4IUUA 1STHA 3PSIA 2K04A 3JAMi 3PUVA 4A3KB 5BN4A 1PH8A 2HQLA 4R4TA 4XXEA 3HS0C 4A3LH 2VY3A 4KN4C 1Q81C 1KABA 2MGSA 5F2DA 2UXBQ 4X65Q 3K81C 1N36Q 4A3DB 1QILA 1CA5A 3K57A 3PF5A 1PYSB 3NK9A 3FKIH 4DK3C 2UU9Q 1SJED 2FMMA 3PO3G 5IYBH 4Q0FA 1WCMB 2VB2X 3KOJA 1W3SA 4N9TA 3CCUA 4LJZC 2L5TA 2E74C 2IY5B 3NHHA 2NVQB 2AUJD 2EY1A 5G3LF 2BE5C 3BVMA 3HOWH 1S5ED 4R4IA 3NQTA 1BCPF 1O80A 1XPOA 4BXXG 3S1NB 1TY0A 2ICEC 4B3RL 1RHPA 5JEAG 5C44B 4DR7L 2EJGC 5LMUL 4IOAA 3EBEA 3AB9A 3NELA 3D4WA 4XDXA 1GHKA 2XRSD 1UEBA 2YYZA 4ID6A 1Z9FA 1D5MC 4IOCA 5HURA 1HZAA 3AEVA 1STEA 1FGUA 4CKEA 2NVTB 4RKBA 3TRZA 4B3RQ 3KDFB 1M90C 4UP7A 2XWBB 3S2HB 2YTYA 4P75A 3CCJA 4OWWB 3K0XA 3TMEA 4ZKBB 5FLMG 2NVXH 2OTLA 3S17B 1VQLA 2A1AA 4R8NA 5C4XB 1U0LA 4A3MB 1BCPD 3A54A 4Y7NH 1TS5A 2XVSA 4DNRB 5CV8A 4OL7A 1KHIA 4HJ5A 2K5DA 2XNAC 4L5QA 3TEHB 5AFWA 1TWCH 3FVQA 3MHBA 4Q5VA 4A93G 3STBC 5C4ZA 5IGCA 4HJ9A 3PF4A 3M4OH 1J5EQ 3R93A 3CCQA 3P1HA 3B6YA 1H95A 5ISRA 1FL0A 3I56A 2JJQA 2KJXA 1YI2A 2B2YC 1AN8A 1DOKA 2B2UA 4HMJA 4LUOA 2EYLA 1EY9A 2OT2A 2DN8A 3S15B 3G71A 1IZ6A 2X6LA 1IBKL 1EFID 3RZDH 1NBWA 3MFGA 1CI3M 4NKLA 4X64Q 4RHRA 3PV0A 2WAQE 3K80C 5E1FA 1MJEA 2A73B 3UDGA 1VQFA 1I6VC 3IFDA 1EIGA 4O0AA 3NWTA 4DV3L 3URYA 1U4MA 1JC7A 4FXGC 2B8GA 2B3GA 5E4WC 2WAQB 2K5VA 3S1RH 4JBWA 2F52A 2OCEA 3OOCA 3L3OC 1HR0Q 3M4QA 3PIP3 2L12A 2JA8B 2A8VA 4Z9CB 3SEBA 1MSGA 3S2DB 3TZUA 3S16B 1BKBA 4LNQA 3HOUG 3HOXB 4LFCL 3I7FA 2F0GA 2IPKD 3OIPA 5CV4A 4RGTA 1GUTA 1PZJD 1SRUA 4PMBA 1SE2A 2WKCA 4ZUIA 1F2YA 4L5RC 4NP5A 2NN6H 3CPWA 3CCRA 2YTXA 2Z6KA 4LF5L 2CHBD 1TXYA 1HFGA 4QMGA 1W6JA 4A3DH 3HOYG 1TS3A 3FDTA 2IX0A 1B2TA 2RF4A 2L11A 1K28A 3DEOA 5IODA 2R92H 3KLRA 3CD6A 4G57A 4NXML 4BY1G 3GO5A 4LF5Q 2F0HA 4F7XA 4DN4M 2IHEA 4A3FG 2CW0D 1IW7D 4ZUJA 2QGQA 2MPMA 5KEEA 2QILA 1G8ZD 1Q86C 3C46A 4MNOA 2O5JC 3H3VH 5COYA 3MAQA 4LF9Q 2MO1A 4HMIA 3A5ZB 5FOBB 3K5MA 4DV2L 3OYYA 5M5YB 1HZ9A 3NTHA 4J1MA 4GN5A 4OELB 2F0WA 1PTOF 2PCFB 4A3JH 2Q2TA 1SR3A 1KXLA 5JOBA 5C4JB 5EPLA 4QGUA 2R3ZA 2R7ZG 3GQBA 2BDOA 3OSOA 5GQOA 1N9WA 1Q1BA 2F0VA 1VQHA 1EIYB 4K0KL 4LF9L 5CBEE 3MTSA 2GVAA 1YHBA 1S5DD 4JV5Q 2NZOA 4K14A 3D3RA 3PQIA 3T4AC 3QIAA 1TR5A 2KCCA 3NUCA 5CGKA 2B2VA 1JR0D 1TS4A 3CQZH 5C3EG 4A3IH 4LK1C 4BY1B 1PTOC 4GKKQ 4EX5A 1SLJA 2ZXPA 3I3CA 1NAPA 3TQYA 2A69C 1I94Q 3HGBA 4JI7Q 2AWOA 5KRUA 4B3SL 1S40A 4A3GB 1I6HH 1ENCA 4UPAA 1VQIA 4HAEA 1EWIA 4QUCA 4C2MB 4RKLA 5ELBA 4C1NK 1ZKOA 3HKZE 3W1GA 2QKIC 3OTOL 4A3FH 2X69A 4JK1C 2JA8H 1Y1WB 5M3FG 1HNZL 4B3SQ 2NZ1D 4IUNA 1LTTD 3HOXG 1B3QA 5E3FA 1EFWA 3LWUA 2E2IH 2RVLA 3FKIG 4OXPA 4K5XA 2ATWA 2Z6KC 3E0JA 3Q24A 4HCSA 4IUTA 4NDXA 4A3KG 1CHPD 4ALPA 2NN6G 1K0RA 1G6ZA 1OTCA 2F0UA 2B2VC 3PUYA 5K5PA 2GA4B 4A3GH 2B39A 3PIOA 4V0BA 1I6HB 3P7JA 3GTMH 4DR1L 3F1ZA 2OTJA 5I9OA 4IPDA 5CV9A 2UUBL 3TDQA 3BVGA 5JJKA 2R7FA 5EKIA 1DCZA 1X54A 1VF7A 4B3MQ 1YNJD 1DM0B 1KDAA 4MHEA 4DAMA 2F3WA 4RGMA 2R7ZH 1NCVA 1A2UA 1K83H 4C3JG 1PA6A 1B3AA 3ERQA 4M8AA 1DOMA 1WD0A 1CKNB 2Z4HA 4BWGB 2VB3X 2R7ZB 3OW7A 4QQBX 5DAUA 1LTRD 2V4DA 1U9RA 3STBD 2JA9A 3EJIA 3GV3A 3PO2G 1SYDA 1HTPA 4AH6A 3H0GG 4UAIA 2Z4IA 1DXMA 1SN8A 1JWUD 2YTVA 2A5HA 2A6HD 4JOIA 4KJOA 2Q2UA 5JVG3 5DNFA 3MZ5A 4BBRH 4K6DA 2ZTCA 1T9HA 3ULLA 1VQNA 4AYBE 1V1OA 1FVIA 1HZBA 2JA5B 2N78A 2WP8J 1R4QB 3D31A 4H02A 3V2TA 4LFBL 1LTID 1HNXL 1SMYD 3CPFA 1B1ZA 1C9OA 4PMCA 4GLXA 1GJXA 3NENA 1QB5D 1D2BA 4LMQD 5M5XH 3RN5A 3KLWA 1VQAA 1YNXA 3K7AB 4MTNA 4R4OA 1UEAB 3BZDB 4J6HA 3T13A 5EBDA 4R4QA 1NNXA 1QVCA 4HJAA 1G291 2RSOA 4IUPA 1WCMH 1F9QA 4X6AH 3UDIA 2AWNA 3RNUA 2EY6A 3U50C 2F0JA 4R1JA 4X65L 2DJFC 4DR3L 1DJRD 1K3RA 4JI2Q 2CQOA 2KHIA 1XTDA 5IYDG 2ZXOA 1LTLA 3I90A 3ZYYX 1SYEA 3NQIA 4LUVA 3RZOH 4ZRZA 1ILPA 2RDGA 1Y8NB 3MEHA 1EEFD 4KLKA 2LMCB 4KD4A 4LUZA 1D5XC 3KJPA 3J81i 4GNXB 3TP6A 4BY7B 2K52A 4JI2L 1S3OA 1SEBD 3HG9A 3V96A 4JW0A 1GOZA 1ZEQX 4XYOA 1A3VA 2F0MA 2K7VA 2KEEA 1EQTA 4V190 1T5EA 3F8TA 2N8NA 5J39A 1XPRA 3QB3A 3TS0A 2B63B 4HIDA 2PYKA 2RA4A 4KHZA 5G3LD 2DJGC 2E2JH 3KLSA 4BBRG 5IGBA 1XNRL 5FLXE 3QWNA 3D8GA 4APVA 3NBIA 3KF8B 1WTPA 1V9PA 2ES2A 5KIXA 2F0LA 1HTLD 2ZTEA 4A3MG 3CHBD 3HOVG 1TKWB 1Y1VH 1Z6HA 1JWSD 3PUXA 4DK0A 2VQFQ 4JI5Q 2IX1A 4KK7A 1NSNS 1JOQA 3KF6B 2VNUD 4LF7L 2PZUA 1KL9A 1CKMA 2R61A 1YEZA 3HZXA 5DM63 1VCIA 1VQ7A 5I2YA 1QZHA 2MUYA 2CWPA 2R7DA 3GTLB 1SNOA 1V8QA 5J1ZA 3GV6A 4GN4B 4DV0Q 2WAQG 4DPGA 1I4QA 1HH2P 4F88A 3NP8A 2CWAA 3R2IA 5D14A 2F0EA 1OXXK 4O2DA 2MQHA 5IGFA 2G9DA 1P8LA 2JA5H 2D0OA 1O7IA 2R92G 2A6EC 1Y1VG 3RLOA 2MNAA 1B9MA 1YNNC 3CCEA 1LM0A 4X66Q 1RTOA 4AQYQ 3T53B 2TSSA 1C48A 1WVLA 2K05A 5GAGC 3CCVA 4DV0L 3FHWA 2GVBA 4K8IA 2K01A 1PXUA 4WJ3M 2Z6BA 1TWFB 3M3YB 2LXJA 1J5EL 1VMCA 3GTPH 2WB1G 3W1BA 1BOSA 3PIPA 1LT3D 2NYZD 3J81c 2HQEA 3JC66 5FLXL 5EPKA 2KCTA 2MJ8A 5T1GA 3IFTA 2ZM6Q 5IIFA 4IALA 1B7YB 4OIJA 1PV4A 3N6RA 1AEXA 4IO9A 1XTCD 2GN5A 3P75A 3NTIA 3CU7A 4B3TL 5EKLA 4P73A 1BNZA 3I4MB 2Q8TA 5A2QL 2LXKA 4G7OC 1O7ZA 1DYQA 1O7YA 1ESFA 1SSOA 2E75C 3TP8A 2NTTA 1QCBD 4JBKA 1KNEA 3SE0A 4LF6L 1VQBA 1D1IA 4NW2A 3K58A 4CKCA 1Q8KA 2BH8A 4DR5Q 3VR6A 4KHPQ 1OXUA 5M5XB 1HA5A 2I07B 5I4DA 4IPGA 1BBUA 2LS01 2J7ZA 5CBAE 1PFSA 5LHY1 4DV6Q 2F0QA 1C8CA 5E4XA 1F9RA 1PH1A 3MWYW 5I6YA 2BDNA 3J7YW 4DV2Q 4KY6A 3KDFA 1WTOA 1XMOQ 4DR2Q 2EYFA 3EIVA 2HD3A 2K1BA 1Y1WH 4A3FB 4DU9A 2EY2A 1LT6D 1F2MA 3L7ZC 1SBBB 3GDEA 4PG3A 3WOEA 4A3EB 1STAA 2NVXB 1WCMG 4OX9L 1TQOA 3PCOB 1YJNA 4DK6C 1VQJA 3SVMA 2O2LD 1YIJA 4JV5L 2EJMA 1KC8C 1OO9B 1IBMQ 2K75A 1CZGA 4OWXB 5LMNQ 3I91A 1BCPC 1H9MA 3GTOH 3LX0A 1EYDA 1QJOA 2JEAI 3I70A 1PRTB 2QEXA 2AMCB 3CQZB 3S1MB 1I94L 1Z47A 1SE3A 2E2HH 2OXPA 1WFQA 2JA7B 2EPBA 5BR8Q 3HP3A 4YCVA 4JVZA 1K8MA 1EY0A 2B63H 1K8AC 1TS2A 1AE2A 1TT2A 2EXDA 4PQXA 1JCKB 4X62Q 2CCZA 4GLAC 4JC0A 3HOVB 3QOJA 1EY5A 1M8AA 1WI5A 1C4QA 2TMPA 5BR8L 4C3JH 3M4YA 2OQ0A 1VQ5A 1STNA 3JAML 1E2VA 3T1HQ 4RG1A 3SXHA 2B29A 4HIOA 4L5SA 2X6GA 4JG2A 4OHJA 4GKKL 3RZOB 4NPSA 4L63B 4JI7L 1R9TH 1LO5D 3S16H 1GKHA 1LABA 1S4ZA 4FXKC 3A5UA 2HIVA 2D0PA 2Y0SE 1II3A 2CFMA 4DR6L 4RCNA 5FLMH 3K0YA 3I4NG 5EBCA 2F1MA 2PNRC 1H9SB 4ZK9B 3BU2A 5IT9c 2RHSB 5I9PA 3J81E 1PYWD 1HNZQ 3GTMB 3GTJB 4A3BG 4R9WA 1G2TA 1PRTC 3GTQB 3I2ZA 2Q8RE 3J7AV 5C44G 1HRJA 1XPUA 3MXGA 3TP5A 4A75A 5D65A 2UUCQ 1VF5C 1C7YA 4H7BA 4WJWA 3ER0A 3L9AX 3KYHC 1EYCA 1IL8A 3S1QB 1MSHA 1V1PB 1FNWA 1I4HA 1O7LA 3CXCA 4H0LC 2QDLA 4BBSG 2B8FA 5C3WA 4RCOA 1IW7C 3UE0A 1SJHD 3AQQA 3E0EA 1S5CD 3F2DA 1LYLA 2AQ2B 2MO0A 3PIO3 1TWHB 3PO3B 2UUCL 4DAVA 1EEID 3H6MA 4X3TA 5DEHA 4GNXC 1A8VA 2C35B 2RDFA 2LKVA 4DR1Q 2F03A 2SDFA 4LF4Q 5JPMC 4DNIA 3G7LA 4PV1C 1OXVA 1CKNA 3E9IA 4RWSC 4DNTB 4I7ZC 5CV7A 2R6GA 3SGIA 3ND9A 1M4VA 2PQEA 2BA0A 5A35A 1G91A 4O42A 1EY4A 4M1UB 1NTGA 1JJGA 4HSVA 4DFAA 4FYDA 5EKKA 2PMZE 4CHTB 4YY3Q 1CKOA 2A69D 1EQQA 1AE3A 5C5MA 4E6IA 1EL0A 4J15A 3HOZH 1CQFA 5M3FH 3BDCA 4G7HC 1JB7A 1WOCA 4XIGS 2IT1A 2L9HA 3G48A 1BVSA 2NVTH 4LAAA 4F8MA 2DY7A 3K6OA 3C3LA 2ASBA 1IKMA 3SR1A 2H1EA 1VS0A 2HHHQ 3D0FA 4MIUA 2WINB 3BG3A 2DY8A 5FJ8G 4DKAC 3PO2H 4Y7NB 2PW5A 5EGTA 2NVQH 3DEPA 5HGQA 4A3MH 3C2PA 3OWFA 2FMCA 4CDDC 1LT4D 1IL2A 2N49A 1Y1VB 5EAYA 4JPBW 1QNKA 3ND8A 2UXDQ 1NJIC 3UE1A 3J81L 5FO7B 1CT1D 1EY7A 1VQ8A 2B2YA 2QEJC 3W3AA 4WORA 1I4RA 3K5NA 2PQAB 1Y8OB 3OMCA 3Q8DA 3HOZB 4JI4Q 3F2BA 3I4NH 1FJGQ 5AJ3Q 2ID0A 3GTKH 4BY7H 3OW2A 2R92B 3Q0AA 1DONA 2YU9B 1MIUA 1PFBA 4RA8A 1U4PA 3U58A 4CKBA 1RDPD 5JEAJ 2NB0A 4GKJQ 1UWVA 5JPNC 1EIHA 5M5WB 3D4DA 1BUVT 4YCUA 1RF2D 2PO4A 5C3XA 5M3MB 2Z9HA 4IJHA 4DGZA 2I5HA 3D4RA 4C3HG 1UNSA 5HGTA 2HIXA 1SE4A 1YNJC 2EYJA 4PMWA 1A6XA 1K9MC 2K5WA 2Z8LA 2IX3A 2ZJRA 2KENA 2AQ1B 2OQKA 3CKIB 2UU9L 1JWMD 1R9TB 1L0XB 3BDOA 1T5XD 1A15A 3SK4A 2IL8A 3HEJA 1HNWL 1KRSA 1QNUA 4EQNA 1Q82C 4ZKCB 5ELCA 3CCLA 2BH2A 2IJ0A 2EYPA 1IXRA 5KNCA 2LSSA 1J8IA 5JEAH 4YHHQ 5C3EB 4RHSA 1QZGA 3A8IE 3VR2A 1XWEA 3RD4A 2UUAL 1UE7A 1HXYD 1VQKA 3NBHB 2XN9C 1A3TA 4A3EH 2BE5D 1KQSA 4RH6A 1DGSA 1I4XA 3FPPA 5C4XG 4HIMA 2DNEA 4AQYL 1UUPA 5H1SE 4JI3Q 4N9PA 3SDZA 4YHHL 2VQEL 4JI5L 2VQFL 2K03A 4A76A 2R93B 2Y0SG 3LGJA 4R4CA 2N3SA 2FFKB 2F0OA 4DXFA 3A56A 5ELFA 3J80i 2EYHA 4PZ7A 1HA6A 1ILQA 3D6CA 2HCCA 2AQ3B 5IP7G 1NR2A 2K14A 3MEFA 4G4KA 5DM73 5KYIA 5M3MH 1BO0A 1VQMA 4OIKA 5CR3A 1HZCA 2D2CC 4DV5L 3VYRA 3OWEB 1KAAA 4I65A 3HOWG 5LL6S 1S5FD 4POGA 4NXNL 3VYTA 4IUQA 5JJLA 4JI6Q 1ICFB 4DV7Q 3D6WA 1CA6A 2G9HD 4A3BH 4AYBG 3ONAB 4DR5L 1AZQA 1IYJB 2K28A 2KQ3A 3H0GB 1TWAH 1NR4A 3Q23A 5LMNW 5M5WH 4CJ1B 2ZM6L 2K32A 4KD3A 5L37A 2RKSA 5CORA 5LL6X 3KK7A 2AKWB 1S72A 1GXDC 5K36G 5IYBG 1XMOL 1JICA 2D9UA 4DR2L 1X3EA 2YU9H 1RKNA 2O4XA 2CKZB 2UXBL 3PMFA 1Y14B 4YIJA 4C1NI 4C3JB 3K59A 3H3VI 1A3UA 1E7ZA 1VDZA 5C4XH 4GS3A 5JVH3 4B3TQ 4WFN3 4UY8C 1TWFH 3M3YH 2E2IB 1GUSA 4PNYA 2MP1A 4EQ5A 1HJPA 4OX9Q 2A74C 1WD1A 3R2TA 1G6PA 2CH4A 1I3QH 4L5TA 4NMZA 3S9WA 1PFNA 3OMGA 1IHZA 3NEMA 3I55A 3KLSX 1PH4A 1Q1EA 1D5ZC 1Y8PB 1SNPA 1Q8IA 3CRLC 4IPCA 4DV6L 5K36H 1PHJA 4IFDI 1TIID 2QA4A 1KIXA 4DR7Q 5LMUQ 2I5LX 2WB1B 3C1EA 4QIWE 1K73C 1EY8A 3K5LA 1XMQL 4FNFA 5NUCA 1ENAA 3ULPA 2I46A 5T1IA 1LACA 1LLRD 1OXTA 2RQXA 2H5XA 1ICWA 5D3IB 3IRBA 1X6OA 4I7AA 3EVQA 3G6JB 1HHVA 1D7QA 1XMQQ 1RD9D 4IUVA 1EOVA 3K7AH 4UP8A 2HCIA 2JK8A 3JAMc 4CGYB 3J81j 2JA6B 5C4JH 5IYCH 1YJWA 3A0JA 3U4ZA 4U68A 4AIMA 3NTKA 1L0WA 1ONLA 3PUWA 4QB4A 2E2DC 5ELOA 1FD7D 5IP9G 3HOWB 4CJ2C 1GO3E 2J4XA 4IPHA 1VQOA 3M7NA 1PYBA 1SNDA 2EDGA 1OXSC 2VUMH 3J7AF 1H9KA 1RODA 3MA2B 3MC0B 2B2UC 3S14H 2CQAA 1QE6A 5C44H 4X64L 3WWVA 2D5DA 4ZQ3A 1C0AA 5IGEA 4FF1A 1E24A 5IT9L 1VQCA 1FNVA 2P5ZX 4DV4Q 4O1NA 1F77A 4HIKA 5M9OA 4DUYL 1EIFA 2E8GA 3F2UA 2F4IA 1VQEA 4OO1I 1TY2A 1TWGB 1QVFA 1EWHA 1BDOA 3NWSA 2EOTA 3MXPA 5CYUA 4DR4Q 1GHJA 5JJIA 3U9SA 2VUMG 5A2QE 4H13C 1PH2A 1AFPA 4LFCQ 2RBMA 2CW0C 2B2WC 1X65A 1X3PA 4DR6Q 4DUYQ 3PO2B 1IYUA 1ZXTA 5CMDA 3VR3A 3I4LA 4IQZA 4OGQC 4TVAB 2ENBA 1YBYA 1H9RA 1PH3A 5J22A 4GN3B 2UXCL 2HUGA 2E2JB 4ZAIA 1PVOA 2F0NA 2VW9A 4JI0Q 1STBA 4JI8L 4ZYSA 3T56B 5IT9E 1AW7A 4AYBB 3KF8A 4QCLA 2JE6I 2OEOA 3GTGB 3RLFA 2K5QA 3AFQA 1K8GA 2PI2E 2JN4A 2WACA 2EJFC 4MZ9A 1YZ6A 4HJ7A 1JT8A 2VZAA 3WDNA 3V05A 4JI8Q 3J80c 4B3ML 2J0TD 4YWLA 3HOVH 1PDQA 4R8IA 3W5OA 1ML0D 4A4IA 1W2BA 1SYCA 4C56C 3DXJC 1BBWA 2F0SA 1E0BA 1V1QA 4A3JB 3NPPA 3VYSA 2KECA 2KHJA 1J6QA 1PRTF 2RHQB 3CP0A 4U673 2KOLA 2HHHL 4LF4L 1SYGA 1PZID 3H91A 1V1PA 2NVYB 5KNDA 1N33L 3P20A 3FMCA 4KI0A 4ABNA 1RTNA 3HRZC 1EZ8A 4POFA 1SMXA 5IGDA 4UDUC 4FXDA 4MTKA 3DLLA 4JCVE 1A63A 3LWEA 1KTKA 1DOLA 2BOSA 3M7GA 1STGA 5IWAQ 2Z0SA 4YY3L 5M5YH 4PZ6A 4KHVA 2QW7A 5TSSA 3WOFA 5D3DA 2ALYB 5IOCA 1M1KC 2F0TA 1SNCA 4LF8L 2NTSA 3SHLA 2HT1A 3S24A 5GAHC 4XQJA 3S2HH 3X3MA 2A19A 1YJ9A 4BS9A 1LV9A 2M2LA 2KCNA 5IYCG 4A3GG 2QDBA 1AZPA 1E1OA 2EY5A 2L15A 1CFMA 4DXGA 1WTXA 2PW7A 3BZKA 4QY7A 1CZWA 3QJYA 1Q12A 3TSSA 2HDLA 3ERSX 5I2XA 5C0XI 4LF8Q 4RGOS 1QVGA 3MXNB 4EQOA 4K6LA 1A0IA 5C5LA 4JI1Q 4TSSA 1E22A 3MVVA 3TZDA 5KNBA 4B9WA 1Q3LA 4RAUC 1HQMC 3VR5A 3HOYH 4FVMA 1HUMA 4BBSH 3QO2A 5EPJA 1KD1C 1GUNA 3QR8A 3HOUH 3HKZB 4OWTB 5EQ0A 5JAVA 4JI1L 4WRDA 3DHQA 4YWKA 4ZLTF 4DR3Q 4RMFA 4XQQA 4JI4L 1A2TA 2B2TA 5M3MG 1E2WA 5E7NA 1L1OB 1XNQL 5FKAC 1UAPA 1W6KA 3OHXC 4QF4A 2F4VQ 1QUQA 1VQDA 1HNWQ 2N88A 1BF4A 2SNMA 2V1CC 1Q46A 4LWCA 1B8AA 3J7A5 1B4OA 5JJZA 4GKJL 2E76C 3HKSA 1K8OA 5IP9H 1D8LA 1EOTA
chains in the Genus database with same CATH topology
1X3QA 1CHQD 1KLGD 2A6HC 2C5CA 1LT5D 3GTPB 1G2SA 3MFYA 2LY7A 2QF7A 2F0KA 2DNCA 4B08A 1V43A 3GD7A 3TN2A 2KEDA 3HOYB 4FF2A 1JORA 3NBHA 1KDBA 1TWAB 4RFBA 4IZ8A 5BN5A 1SAPA 5C0XG 1CM9A 4K5VA 4XT1B 3DWAA 1SFOB 2IW3A 4DAYA 3O13A 4ILWA 3C1FA 2XSCA 3E6ZX 2A68C 3FRPB 1Y69U 2Q8IB 1JB3A 2EVBA 1LTBD 5ELEA 1CQVA 3DWQA 2VUMB 3BYYB 3A7LA 2RSNA 3IAYA 2NWGA 3VYUA 3OPOA 2IWHA 1ET6A 3R8BA 4DA2A 1FNUA 1E2ZA 2VXWA 1FYCA 3CRKC 2JEBI 2AUKA 4P2CB 2OF1A 2M9VA 3VA7A 1JQYD 4KY7A 1GUGA 3E5SA 1ET9A 3MXNA 4X3UA 2KUMA 2F0FA 4A93B 2C9OA 1B44D 3KUPA 4FP5D 1FGBD 2ZXRA 1EU4A 3RZDB 1EQVA 3H94A 2BCOA 1QG7A 2WIIB 3FKIB 1PTOH 3NXWA 1HQRD 5BN3A 1BCPB 4A3BB 2KHSA 1AP0A 1F2ZA 3IL8A 1MI2A 1LTGD 4BA2I 4KMUC 4HEDA 4BA1I 2EZVA 3UI2A 3TBIB 1PLFA 5C4HA 5CV5A 2SEBD 3RMHA 1EWCA 3BVZA 1NUCA 1FR3A 4FO2A 4X3KA 4KKTA 2D62A 4OO1H 2EE1A 1F9PA 2ZT9C 4RGNA 2NN6I 4S3SA 3ITPA 4EVOA 1IKLA 4KKSA 1VMPA 3DMUA 3Q6SA 3KBXA 1YNND 1B50A 4FF3A 4IURA 3K5OA 1U4LA 2B2TC 4DF7A 2EYMA 3GP7A 1U4RA 2F0IA 2A68D 4H44C 1PTOB 4HCEA 2PPBC 1SNQA 4XT3B 3SK8A 1SDFA 2E2HB 4CJ0B 1CK1A 3J80E 2FINB 5CV6A 4C3IB 1ZYRC 2XIWA 4KKUA 5ELDA 1D1KA 1BBXC 3QOLA 4CBVA 3M85A 3AU7A 3A7AB 2JYOA 3I8ZA 1X32A 3I73A 2F0PA 5CC4A 1XX8A 1GUOA 1QOHA 3A55A 3NSWA 1SYFA 1SYBA 1PTOD 5FK9C 4L6TB 3Q22A 3HOUB 4QUFA 4MN3A 1F2LA 3DM1A 3I4NB 2K6AA 1STYA 1S5BD 2QCPX 5FO9B 2WKDA 3S1RB 1ESRA 1LTAD 5I6WA 1B9NA 1PFMA 2JXMB 3I72A 4IN3A 3VA5A 1SNMA 2HDMA 3AMUA 3OIQA 1TWCB 4ULLA 3BYTB 2Z1CA 3A8JE 4DAPA 2O5IC 2ICIA 1L0YB 4KN7C 3M4OB 4XYQA 1PZKD 3A8KE 3R3OA 3X3NA 3GTKB 4TQUS 3J80L 1PRTD 3H09A 3EA6A 3RUZA 1PMRA 3FPUB 1QWYA 3NE5B 2EYOA 3DWPA 5C6AA 2F0DA 5FO8B 2N55A 3EQLC 1CTMA 3GTOB 2B2WA 1HFNA 1F9SA 2FJ2A 4EGVA 2SOBA 4IFDG 3U9OA 1Q90A 1HCZA 5M3FB 1K83B 1MD2D 3FEWX 4K2LA 1J9OA 4K2KA 1BQQT 1D6EC 2JP1A 4C3IG 3VR4A 3KBGA 4BBSB 1DD2A 4L8JA 3BDLA 1I50B 4X3SA 1SMYC 2BA1A 4DK1A 2WV6D 1KDCA 3PUZA 3BS1A 2PMZB 3DUZA 3N52A 1ZYRD 2Y0SB 1EU3A 3QG1A 2SNSA 1Z7TA 4KTAA 3IKJA 4TKOB 1H9JA 4K5WA 2H4OA 4GZYC 1RJTA 5C0XH 1I3QB 1SXTA 4KV6A 5IGGA 1WTWA 2L55A 4HSPA 4G7ZC 2EXZA 4F87A 1BR9A 1KLUD 2NBFA 2KVMA 2LFNA 4ME5A 1DZ1A 3S14B 2RDHA 1GUWA 4HTHA 3EROA 3W2DA 4OO1G 1WTVA 1JE4A 2M00A 5KYLA 1I4GA 5KGUA 4IFDH 3MXUA 4C3HB 3SK5A 4KY5A 1XYIA 1TU2B 3T51B 2L1BA 4A3IB 4EQPA 2L4NA 1RCVD 1TVXA 5C0XJ 1MGSA 1HPCA 2XRQD 3JAME 1ENFA 1EZ6A 1BXTA 4HR7B 4XQNA 4B9XA 2L0CA 4FF4A 4KJNA 2FHTA 2MHVA 4XTCS 1JOOA 1HUNA 3LNNA 1JOKA 3EFXD 1XXGA 4IFDJ 4HN7A 4TRDA 2JSOA 2K33A 1EYAA 4ODGA 3TP7A 4BBRB 1LTSD 4QIWB 1IYVA 1H9SA 4K8JA 2PZWA 1MBYA 2XWJB 2KA7A 5EJWA 1EY6A 2A6ED 1KNAA 3T16A 2PZTA 1B53A 1I4PA 1R4PB 3SK6A 1O78A 1WTRA 2NUCA 3H3VC 4J8QA 2CVRA 1WTQA 2F3VA 4IUUA 1STHA 2K04A 3PUVA 4A3KB 5BN4A 4XXEA 3HS0C 4KN4C 1KABA 2MGSA 5F2DA 4A3DB 1QILA 1CA5A 3K57A 3NK9A 1SJED 2FMMA 4Q0FA 1WCMB 2VB2X 4N9TA 4LJZC 2L5TA 2E74C 3NHHA 2NVQB 2AUJD 2EY1A 5G3LF 2BE5C 3BVMA 1S5ED 3NQTA 1BCPF 1O80A 3S1NB 1TY0A 2ICEC 1RHPA 5JEAG 5C44B 2EJGC 3AB9A 3D4WA 4XDXA 1GHKA 2XRSD 2YYZA 4ID6A 1D5MC 5HURA 1STEA 4CKEA 2NVTB 4RKBA 2XWBB 3S2HB 3TMEA 4ZKBB 3S17B 5C4XB 4R8NA 4A3MB 1BCPD 3A54A 1TS5A 2XVSA 4DNRB 5CV8A 4OL7A 2K5DA 2XNAC 5AFWA 3FVQA 3MHBA 4Q5VA 5C4ZA 5IGCA 3R93A 3P1HA 5ISRA 2KJXA 2B2YC 1AN8A 1DOKA 2B2UA 4HMJA 2EYLA 1EY9A 2OT2A 2DN8A 3S15B 2X6LA 1EFID 3MFGA 1CI3M 4NKLA 4RHRA 3PV0A 5E1FA 2A73B 1I6VC 3IFDA 1EIGA 3NWTA 3URYA 1U4MA 1JC7A 4FXGC 2B8GA 5E4WC 2WAQB 4JBWA 3OOCA 3L3OC 3PIP3 2L12A 2JA8B 4Z9CB 3SEBA 1MSGA 3S2DB 3TZUA 3S16B 3HOXB 2F0GA 2IPKD 3OIPA 5CV4A 4RGTA 1GUTA 1PZJD 4PMBA 1SE2A 2WKCA 4ZUIA 1F2YA 4NP5A 2NN6H 2CHBD 1HFGA 4QMGA 1W6JA 1TS3A 3FDTA 2IX0A 1B2TA 2L11A 5IODA 3DEOA 3KLRA 4G57A 3GO5A 2F0HA 4F7XA 4DN4M 2CW0D 1IW7D 4ZUJA 2MPMA 5KEEA 2QILA 1G8ZD 3C46A 2O5JC 5COYA 3MAQA 4HMIA 5FOBB 3K5MA 5M5YB 3NTHA 4J1MA 2F0WA 1PTOF 2PCFB 5JOBA 5C4JB 5EPLA 2R3ZA 3GQBA 2BDOA 3OSOA 1Q1BA 2F0VA 5CBEE 3MTSA 1S5DD 4K14A 3D3RA 3T4AC 2KCCA 1TR5A 3QIAA 3NUCA 5CGKA 2B2VA 1JR0D 1TS4A 4LK1C 4BY1B 1PTOC 3I3CA 2ZXPA 1NAPA 2A69C 3HGBA 2AWOA 5KRUA 4A3GB 1ENCA 4HAEA 4QUCA 4C2MB 4RKLA 5ELBA 4C1NK 1ZKOA 2QKIC 2X69A 4JK1C 1Y1WB 2NZ1D 4IUNA 1LTTD 5E3FA 3LWUA 2RVLA 4K5XA 3E0JA 3Q24A 4HCSA 4IUTA 4NDXA 1CHPD 2NN6G 1G6ZA 2F0UA 2B2VC 3PUYA 5K5PA 2GA4B 1I6HB 2B39A 4V0BA 3P7JA 5I9OA 5CV9A 3TDQA 3BVGA 5EKIA 1DCZA 1VF7A 1YNJD 1DM0B 1KDAA 4MHEA 2F3WA 4RGMA 1NCVA 1A2UA 4C3JG 1B3AA 3ERQA 4M8AA 1DOMA 1WD0A 2Z4HA 4BWGB 2VB3X 2R7ZB 3OW7A 5DAUA 1LTRD 2V4DA 1U9RA 3EJIA 3GV3A 1SYDA 1HTPA 4UAIA 2Z4IA 1DXMA 1JWUD 2A5HA 2A6HD 4KJOA 5JVG3 5DNFA 3MZ5A 4K6DA 1V1OA 2JA5B 2WP8J 1R4QB 3D31A 3V2TA 1LTID 1SMYD 1B1ZA 4PMCA 1GJXA 1QB5D 1D2BA 4LMQD 3K7AB 1UEAB 3BZDB 4J6HA 3T13A 5EBDA 1G291 2RSOA 4IUPA 1F9QA 2AWNA 2EY6A 2F0JA 1DJRD 2ZXOA 3I90A 3ZYYX 1SYEA 3NQIA 4ZRZA 1ILPA 2RDGA 1Y8NB 3MEHA 1EEFD 2LMCB 4KD4A 1D5XC 3TP6A 4BY7B 1SEBD 3HG9A 3V96A 1GOZA 1ZEQX 4XYOA 1A3VA 2F0MA 2K7VA 2KEEA 1EQTA 4V190 1T5EA 5J39A 3QB3A 2B63B 2PYKA 2RA4A 4KHZA 5G3LD 3KLSA 5IGBA 5FLXE 3QWNA 3D8GA 3NBIA 1WTPA 5KIXA 2F0LA 1HTLD 3CHBD 1TKWB 1Z6HA 1JWSD 3PUXA 4DK0A 2IX1A 4KK7A 1NSNS 1JOQA 2VNUD 2PZUA 2R61A 3HZXA 5DM63 1VCIA 5I2YA 2MUYA 3GTLB 1SNOA 1V8QA 5J1ZA 3GV6A 1I4QA 4F88A 3NP8A 3R2IA 5D14A 2F0EA 1OXXK 5IGFA 2G9DA 2A6EC 1B9MA 1YNNC 1RTOA 3T53B 2TSSA 1C48A 1WVLA 2K05A 4K8IA 2K01A 1PXUA 1TWFB 3M3YB 1VMCA 1BOSA 1LT3D 2NYZD 2HQEA 5FLXL 5EPKA 2MJ8A 5T1GA 3IFTA 5IIFA 4IALA 4OIJA 3N6RA 1AEXA 1XTCD 3P75A 3NTIA 3CU7A 5EKLA 1BNZA 3I4MB 2Q8TA 5A2QL 4G7OC 1O7ZA 1DYQA 1O7YA 1ESFA 1SSOA 2E75C 3TP8A 2NTTA 1QCBD 1KNEA 3SE0A 1D1IA 4NW2A 3K58A 4CKCA 3VR6A 1OXUA 5M5XB 1HA5A 2I07B 5I4DA 2LS01 2J7ZA 5CBAE 5LHY1 2F0QA 1C8CA 5E4XA 1F9RA 3MWYW 5I6YA 2BDNA 3J7YW 4KY6A 1WTOA 2EYFA 2K1BA 4A3FB 4DU9A 2EY2A 1LT6D 1F2MA 3L7ZC 1SBBB 3WOEA 4A3EB 1STAA 2NVXB 1TQOA 3SVMA 2O2LD 2EJMA 1OO9B 1CZGA 3I91A 1BCPC 1H9MA 3LX0A 1EYDA 1QJOA 2JEAI 3I70A 1PRTB 3CQZB 3S1MB 1Z47A 1SE3A 2OXPA 2JA7B 2EPBA 3HP3A 1K8MA 1EY0A 1TS2A 1TT2A 4PQXA 1JCKB 3HOVB 3QOJA 1EY5A 1M8AA 1C4QA 2TMPA 3M4YA 1STNA 3JAML 1E2VA 3SXHA 2X6GA 4OHJA 3RZOB 4L63B 1LO5D 1LABA 1S4ZA 4FXKC 1II3A 4RCNA 3K0YA 5EBCA 2F1MA 2PNRC 1H9SB 4ZK9B 5I9PA 3J81E 1PYWD 3GTMB 3GTJB 4R9WA 1G2TA 1PRTC 3GTQB 2Q8RE 3J7AV 1HRJA 3MXGA 3TP5A 5D65A 1VF5C 4H7BA 4WJWA 3L9AX 1EYCA 1IL8A 3S1QB 1MSHA 1V1PB 1FNWA 1I4HA 1O7LA 4H0LC 2B8FA 5C3WA 4RCOA 1IW7C 1SJHD 1S5CD 2AQ2B 3PIO3 1TWHB 3PO3B 4DAVA 1EEID 3H6MA 4X3TA 5DEHA 2RDFA 2LKVA 2F03A 2SDFA 5JPMC 3G7LA 4PV1C 1OXVA 4RWSC 4DNTB 4I7ZC 5CV7A 2R6GA 3ND9A 1M4VA 2PQEA 2BA0A 5A35A 1G91A 4O42A 1EY4A 4M1UB 4HSVA 4DFAA 4FYDA 5EKKA 4CHTB 2A69D 5C5MA 4E6IA 1EL0A 1CQFA 4G7HC 3BDCA 4XIGS 2IT1A 2L9HA 4LAAA 4F8MA 2DY7A 3C3LA 3K6OA 1IKMA 3SR1A 2H1EA 4MIUA 2WINB 3BG3A 2DY8A 4Y7NB 2PW5A 5EGTA 3DEPA 3C2PA 3OWFA 2FMCA 1LT4D 1Y1VB 1QNKA 3ND8A 3J81L 5FO7B 1CT1D 1EY7A 2B2YA 2QEJC 3W3AA 4WORA 1I4RA 3K5NA 1Y8OB 3OMCA 3HOZB 2ID0A 2R92B 3Q0AA 1DONA 2YU9B 1PFBA 4RA8A 1U4PA 4CKBA 1RDPD 5JEAJ 2NB0A 5JPNC 1EIHA 5M5WB 3D4DA 1BUVT 1RF2D 2PO4A 5C3XA 5M3MB 4DGZA 3D4RA 4C3HG 1UNSA 5HGTA 1SE4A 1YNJC 2EYJA 4PMWA 1A6XA 2K5WA 2Z8LA 2IX3A 2AQ1B 3CKIB 1JWMD 1R9TB 1L0XB 3BDOA 1T5XD 1A15A 3SK4A 2IL8A 3HEJA 1QNUA 4EQNA 4ZKCB 5ELCA 2IJ0A 2EYPA 5KNCA 1J8IA 5JEAH 5C3EB 4RHSA 3A8IE 3VR2A 1XWEA 3RD4A 1HXYD 2XN9C 1A3TA 2BE5D 4RH6A 1I4XA 3FPPA 2DNEA 1UUPA 4N9PA 3SDZA 2K03A 2R93B 2FFKB 2F0OA 4DXFA 3A56A 5ELFA 2EYHA 1HA6A 1ILQA 3D6CA 2HCCA 2AQ3B 1NR2A 4G4KA 5DM73 5KYIA 1BO0A 4OIKA 5CR3A 2D2CC 3VYRA 3OWEB 1KAAA 4I65A 5LL6S 1S5FD 3VYTA 4IUQA 3D6WA 1CA6A 2G9HD 3ONAB 1AZQA 2K28A 2KQ3A 3H0GB 1NR4A 3Q23A 4CJ1B 2K32A 4KD3A 2RKSA 5CORA 5LL6X 3KK7A 1GXDC 5K36G 1JICA 2D9UA 1RKNA 2O4XA 3PMFA 4YIJA 4C1NI 4C3JB 3K59A 1A3UA 1VDZA 5JVH3 4WFN3 2E2IB 1GUSA 4PNYA 2MP1A 2A74C 1WD1A 3R2TA 4NMZA 3S9WA 1PFNA 3OMGA 1IHZA 3KLSX 1Q1EA 1D5ZC 1Y8PB 1SNPA 1Q8IA 3CRLC 5K36H 4IFDI 1TIID 2WB1B 3C1EA 1EY8A 3K5LA 4FNFA 5NUCA 1ENAA 2I46A 5T1IA 1LACA 1LLRD 1OXTA 2RQXA 1ICWA 5D3IB 3EVQA 3G6JB 1HHVA 1RD9D 4IUVA 2HCIA 4CGYB 2JA6B 4U68A 3NTKA 1ONLA 3PUWA 4QB4A 2E2DC 1FD7D 3HOWB 4CJ2C 2J4XA 3M7NA 1SNDA 2EDGA 1OXSC 3J7AF 1H9KA 1RODA 3MA2B 3MC0B 2B2UC 2CQAA 1QE6A 2D5DA 4ZQ3A 5IGEA 4FF1A 5IT9L 1FNVA 4O1NA 1F77A 5M9OA 3F2UA 2F4IA 4OO1I 1TY2A 1TWGB 1EWHA 1BDOA 3NWSA 2EOTA 3MXPA 5CYUA 1GHJA 3U9SA 5A2QE 4H13C 1AFPA 2RBMA 2CW0C 2B2WC 1X3PA 3PO2B 1IYUA 1ZXTA 5CMDA 3VR3A 3I4LA 4IQZA 4OGQC 2ENBA 1H9RA 5J22A 2HUGA 2E2JB 4ZAIA 2F0NA 1STBA 4ZYSA 3T56B 5IT9E 1AW7A 4AYBB 3KF8A 4QCLA 3GTGB 2JE6I 2OEOA 3RLFA 2K5QA 2WACA 2EJFC 3WDNA 3V05A 2J0TD 1PDQA 4R8IA 1ML0D 1SYCA 4C56C 3DXJC 2F0SA 4A3JB 1E0BA 3NPPA 3VYSA 2KECA 1PRTF 4U673 2KOLA 1SYGA 1PZID 3H91A 5KNDA 1V1PA 2NVYB 3P20A 3FMCA 4KI0A 4ABNA 1RTNA 3HRZC 1EZ8A 5IGDA 4UDUC 4FXDA 3LWEA 1KTKA 1DOLA 2BOSA 3M7GA 1STGA 4KHVA 5TSSA 3WOFA 5D3DA 5IOCA 2F0TA 1SNCA 2NTSA 3SHLA 4XQJA 3X3MA 4BS9A 1LV9A 2M2LA 2KCNA 2QDBA 1AZPA 2EY5A 1CFMA 1WTXA 4DXGA 2PW7A 1CZWA 3QJYA 1Q12A 3TSSA 2HDLA 5I2XA 5C0XI 4RGOS 4EQOA 4K6LA 5C5LA 4TSSA 3MVVA 3TZDA 5KNBA 4B9WA 1Q3LA 4RAUC 1HQMC 3VR5A 4FVMA 1HUMA 3QO2A 5EPJA 1GUNA 3HKZB 5EQ0A 5JAVA 4WRDA 3DHQA 4ZLTF 4XQQA 1A2TA 2B2TA 1E2WA 5FKAC 1UAPA 1W6KA 3OHXC 4QF4A 2N88A 1BF4A 2SNMA 1B4OA 5JJZA 2E76C 1K8OA 1EOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5T A;  1VF5 C;  2E74 C;  3DXJ C;  3H94 A;  2AUJ D;  1ZKO A;  3M85 A;  1Q90 A;  2A6H C;  3A7A B;  3L7Z C;  1HCZ A;  2D2C C;  2BE5 C;  1VCI A;  1GUT A;  1GJX A;  3MFY A;  5BN3 A;  5KND A;  2QF7 A;  1O7L A;  3I73 A;  3P20 A;  4JK1 C;  4H0L C;  2DNC A;  2B8F A;  3FMC A;  1V43 A;  3GD7 A;  3VR4 A;  1V8Q A;  2NN6 H;  4HR7 B;  1ONL A;  3PUW A;  5JEA G;  4KI0 A;  2EJM A;  2EJG C;  4BA2 I;  1IW7 C;  3LWU A;  1GUO A;  1H9M A;  3AB9 A;  4XTC S;  5BN5 A;  1DD2 A;  3LNN A;  4L8J A;  1OXX K;  1GHK A;  5C0X G;  4KMU C;  4BA1 I;  3M7N A;  1QJO A;  2EDG A;  1OXS C;  2A6E C;  1SMY C;  2YYZ A;  1H9K A;  2BA1 A;  1G29 1;  1YNN C;  1B9M A;  2JEA I;  4DK1 A;  3T53 B;  3D4R A;  3PUZ A;  2D5D A;  2NN6 G;  3KLR A;  2K32 A;  1YNJ C;  1A6X A;  4PV1 C;  2K33 A;  1OXV A;  3PUY A;  1K8M A;  4DNT B;  4I7Z C;  2A68 C;  2R6G A;  5K36 G;  1IW7 D;  3ND9 A;  5A35 A;  1Y69 U;  2BA0 A;  1IYV A;  3BDO A;  1H9S A;  3QG1 A;  2Q8I B;  4DNR B;  1FR3 A;  1Y8N B;  1Z7T A;  2O5J C;  2EVB A;  2KA7 A;  3IKJ A;  4TKO B;  2A6E D;  1B9N A;  4KKT A;  1H9J A;  2D62 A;  1CFM A;  1VDZ A;  2A69 D;  2JXM B;  2LMC B;  3I72 A;  2ZT9 C;  3IFT A;  4OO1 H;  1DCZ A;  4GZY C;  3QJY A;  1GUS A;  1Q12 A;  1EWH A;  2NN6 I;  1BDO A;  1VF7 A;  5C0X H;  3A7L A;  4G7H C;  4XIG S;  2IT1 A;  5KNC A;  1GHJ A;  3U9S A;  5JEA H;  4H13 C;  3A8I E;  2PCF B;  3M4Y A;  3N6R A;  4KKS A;  3A8J E;  3VR2 A;  2CW0 C;  3OPO A;  2O5I C;  1E2V A;  2BDO A;  3GQB A;  4KN7 C;  1O78 A;  5KNB A;  1HQM C;  1IYU A;  2K7V A;  2BE5 D;  1Q1E A;  4G7Z C;  3VR5 A;  3VR3 A;  1Y8P B;  1Q1B A;  3I4L A;  3BG3 A;  4IQZ A;  4OGQ C;  1E2Z A;  3A8K E;  3OW7 A;  3FPP A;  1T5E A;  3CRK C;  1FYC A;  1H9R A;  2DN8 A;  3CRL C;  2JEB I;  2AUK A;  2DNE A;  5K36 H;  1GUN A;  4TQU S;  2V4D A;  1CI3 M;  4G7O C;  4KHZ A;  3SDZ A;  3VA7 A;  1LAB A;  2E75 C;  3PV0 A;  1GUG A;  3PUV A;  1HTP A;  2KCC A;  3QIA A;  3SE0 A;  4OO1 G;  2A68 D;  3T56 B;  4H44 C;  5BN4 A;  1DXM A;  1PMR A;  4RCN A;  1E2W A;  4IFD H;  2A6H D;  4LK1 C;  3VR6 A;  1I6V C;  1OXU A;  2PPB C;  3ND8 A;  2F1M A;  2JE6 I;  2PNR C;  3MXU A;  3NE5 B;  4KN4 C;  3RLF A;  1H9S B;  2A69 C;  1TU2 B;  2B8G A;  3T51 B;  3HGB A;  2EJF C;  1TKW B;  1LAC A;  1OXT A;  2AWO A;  3EQL C;  1CTM A;  1Z6H A;  3W3A A;  4JBW A;  3D31 A;  3PUX A;  3WDN A;  4DK0 A;  3OOC A;  1ZYR C;  1Y8O B;  4KKU A;  2E76 C;  1HPC A;  1K8O A;  3TZU A;  4IFD G;  4LJZ C; 
#chains in the Genus database with same CATH topology
 1JE5 A;  4A3J G;  2UUB Q;  1X3Q A;  1CHQ D;  1KLG D;  2A6H C;  4ME3 A;  2C5C A;  1LT5 D;  1K3B C;  3GTP B;  1G2S A;  3MFY A;  2LY7 A;  2QF7 A;  1PH5 A;  2F0K A;  3I4O A;  2DNC A;  1PH6 A;  4B08 A;  1V43 A;  3CME A;  3GD7 A;  3TN2 A;  3G6E A;  1VQ9 A;  2KED A;  3T1Y Q;  2K5H A;  3HOY B;  2WFW A;  4FF2 A;  2K5N A;  1JOR A;  3NBH A;  1KDB A;  1TWA B;  4RFB A;  4HJ8 A;  4IZ8 A;  5BN5 A;  1SAP A;  3H0G H;  4JOI C;  5C0X G;  1CM9 A;  4K5V A;  4XT1 B;  1CUK A;  4A3L G;  3DWA A;  4DUZ L;  1SFO B;  2IW3 A;  4UHV A;  4DAY A;  1MHW C;  3O13 A;  4ILW A;  3C1F A;  2XSC A;  3E6Z X;  2A68 C;  3FRP B;  1Y69 U;  4A3D G;  2Q8I B;  1JB3 A;  4LF7 Q;  3HKZ G;  2EVB A;  1LTB D;  1UE6 A;  5ELE A;  1CQV A;  4DUZ Q;  1ASY A;  3DWQ A;  1QUQ B;  2IHF A;  5J3B A;  2VUM B;  4DV5 Q;  3BYY B;  1VQ6 A;  3A7L A;  3S1Q H;  4UP9 A;  4JI3 L;  2RSN A;  3IAY A;  2NWG A;  3VYU A;  4PZ8 A;  4JI6 L;  3OPO A;  2IWH A;  1ET6 A;  2WB1 E;  2ZTD A;  4IJL A;  3R8B A;  4DA2 A;  1FNU A;  4GNX A;  1NMG A;  1E2Z A;  4P72 A;  2VXW A;  1FYC A;  3CRK C;  2OWO A;  2JEB I;  2AUK A;  4P2C B;  2OF1 A;  2M9V A;  3VA7 A;  4YCW A;  1JQY D;  4KY7 A;  3H15 A;  1GUG A;  3E5S A;  1ET9 A;  2E5L L;  3L0O A;  3E3X A;  1RIP A;  3MXN A;  4LW1 A;  3KF6 A;  4X3U A;  3AFP A;  2KUM A;  2DUD A;  4GOP A;  2F0F A;  4A93 B;  2C9O A;  1EQR A;  2VL6 A;  1B44 D;  3KUP A;  4N8F A;  2K4K A;  5FLX c;  2JA7 G;  4FP5 D;  1FGB D;  1RL2 A;  2ZXR A;  1EU4 A;  3RZD B;  1ASZ A;  4DV7 L;  1EQV A;  3H94 A;  3CF5 A;  2BCO A;  5IY0 A;  1QG7 A;  2WII B;  3FKI B;  1PTO H;  1N36 L;  3VDY A;  1X56 A;  3NXW A;  1HQR D;  5BN3 A;  1X3F A;  1BCP B;  4A3B B;  2PNH A;  2KHS A;  1AP0 A;  1F2Z A;  3IL8 A;  1MI2 A;  1LTG D;  4BA2 I;  3S15 H;  4CDE C;  3GTL H;  4KMU C;  4HED A;  4BA1 I;  2EZV A;  3FP9 A;  1SRO A;  4LFA L;  3UI2 A;  3GTQ H;  3TBI B;  3CCS A;  4P71 A;  4KHP L;  1E1T A;  1EUJ A;  1PLF A;  5C4H A;  5CV5 A;  2SEB D;  3RMH A;  1XNR Q;  1VQP A;  4A3I G;  1EWC A;  4BY1 H;  1MJC A;  1UE5 A;  3BVZ A;  3ZJY C;  1NUC A;  3UDX A;  1FR3 A;  4FO2 A;  3ULJ A;  4X3K A;  4KKT A;  2D62 A;  4OO1 H;  2EE1 A;  1F9P A;  3S2D H;  2ZT9 C;  1I50 H;  4RGN A;  2NN6 I;  4JBJ A;  4S3S A;  3ITP A;  4EVO A;  1IKL A;  4ZCK A;  1NE3 A;  4KKS A;  1VMP A;  1I5F A;  1VQ4 A;  3S1N H;  3DMU A;  3Q6S A;  3KBX A;  1YNN D;  1B50 A;  4FF3 A;  2K50 A;  4IUR A;  3G4S A;  3K5O A;  1U4L A;  2KBN A;  3BJU A;  4A3C H;  2B2T C;  4DF7 A;  2EYM A;  3CAM A;  3GP7 A;  5ELN A;  1U4R A;  2F0I A;  1GD7 A;  2A68 D;  4H44 C;  1PTO B;  4HCE A;  3EN2 A;  1WTH A;  1EYG A;  1U5K A;  4X66 L;  2PPB C;  1SNQ A;  4XT3 B;  3SK8 A;  3KFU A;  1TWH H;  1SDF A;  2E2H B;  1IBK Q;  4Y52 H;  1UE1 A;  4CJ0 B;  5GAE C;  1CK1 A;  3K7U C;  3J80 E;  2FIN B;  1N8R C;  2ZJQ A;  1LUZ A;  5CV6 A;  4C3I B;  1ZYR C;  2XIW A;  4KKU A;  5ELD A;  1D1K A;  4OEM B;  1BBX C;  3QOL A;  2NVY H;  1VQG A;  5C3E H;  4CBV A;  3M85 A;  3AU7 A;  3A7A B;  2JYO A;  4DV3 Q;  2JA6 G;  3I8Z A;  1KAW A;  1NMF A;  1X32 A;  3U4V A;  1KRT A;  1K0S A;  3I73 A;  2XGT A;  2Q2I A;  3KJO A;  2UXC Q;  2F0P A;  3BZC A;  1HR0 L;  3ICE A;  5CC4 A;  1XX8 A;  4FDB A;  1GUO A;  1QOH A;  4DV4 L;  4JI0 L;  4A93 H;  3A55 A;  3NSW A;  5FJ8 H;  1SYF A;  1SYB A;  1PTO D;  5FK9 C;  4L6T B;  3Q22 A;  3HOU B;  4QUF A;  4MN3 A;  1F2L A;  3DM1 A;  3I4N B;  4LF6 Q;  2EQS A;  1TWG H;  2K6A A;  4DR4 L;  3M4P A;  1STY A;  2G5D A;  3TS2 A;  2ZJP A;  1S5B D;  2QCP X;  4C3I H;  2WKD A;  5FO9 B;  3S1R B;  1X9N A;  4A3C G;  3UDF A;  1ESR A;  1LTA D;  5I6W A;  5DLQ E;  1SE8 A;  1AH9 A;  1B9N A;  1PFM A;  3CC2 A;  2JXM B;  3I72 A;  4IN3 A;  3VA5 A;  1YHQ A;  1SNM A;  2HDM A;  3AMU A;  3OIQ A;  1TWC B;  1N33 Q;  2I0Q A;  4ULL A;  4GLV B;  3BYT B;  1N32 L;  2Z1C A;  3A8J E;  1NY4 A;  2EIF A;  4DAP A;  3E9H A;  3CC7 A;  2O5I C;  2ICI A;  1L0Y B;  4KN7 C;  3M4O B;  4XYQ A;  1G51 A;  1PZK D;  3A8K E;  3R3O A;  3X3N A;  3GTK B;  4A3K H;  4TQU S;  1IBM L;  5LMN L;  3J80 L;  1PRT D;  3H09 A;  3PO3 H;  1N32 Q;  3EA6 A;  3RN2 A;  2JA7 H;  3RUZ A;  4QJF A;  3S1M H;  1PMR A;  3FPU B;  1QWY A;  4JYA Q;  3NE5 B;  2EYO A;  1P16 A;  3DWP A;  1YHA A;  4NXM Q;  5C6A A;  2F0D A;  5FO8 B;  4BXX H;  2N55 A;  3EQL C;  5IYD H;  1CTM A;  3GTO B;  2I5M X;  2B2W A;  1HFN A;  1F9S A;  2FJ2 A;  4EGV A;  4P74 A;  4X62 L;  2SOB A;  2AHO B;  4JYA L;  3CCM A;  4IFD G;  3U9O A;  3GTJ H;  1Q90 A;  1HCZ A;  5M3F B;  1B70 B;  4GOP C;  5IWA L;  4A3E G;  3DM3 A;  5IE8 A;  1YIT A;  4CDF C;  1K83 B;  3HOZ G;  4K2L A;  4K2K A;  1MD2 D;  1J9O A;  3FEW X;  3L2P A;  2KCM A;  1A62 A;  1BQQ T;  1D6E C;  2JP1 A;  4C3I G;  3VR4 A;  4GOP B;  3KBG A;  4BBS B;  3T1H L;  1DD2 A;  4L8J A;  3BDL A;  1I50 B;  2JQO A;  4X3S A;  4K0K Q;  1SMY C;  5IP7 H;  3CMA A;  2BA1 A;  3OTO Q;  1XNQ Q;  4DK1 A;  2WV6 D;  1KDC A;  3PUZ A;  4WJ4 A;  3BS1 A;  2PMZ B;  2F3I A;  3DUZ A;  2F4V L;  2PQA A;  3N52 A;  1ZYR D;  3PGZ A;  3GTG H;  2Y0S B;  1EU3 A;  2JA5 G;  3QG1 A;  1WJJ A;  2SNS A;  1Z7T A;  4KTA A;  1JJC B;  3IKJ A;  5AJ3 L;  4TKO B;  3I4M G;  3K8A A;  1H9J A;  2YV5 A;  1MKH A;  4K5W A;  2H4O A;  4GZY C;  1RJT A;  5C0X H;  1I3Q B;  1SXT A;  3RR5 A;  2VS1 A;  3F2C A;  4KV6 A;  2XTI A;  1L2F A;  5HY6 A;  2R93 G;  5IGG A;  5GAD C;  4DV1 Q;  1IBL L;  1WTW A;  2L55 A;  4HSP A;  4G7Z C;  2EXZ A;  4CDC C;  4F87 A;  4JBM A;  1BR9 A;  1KLU D;  1X55 A;  2KVM A;  2LFN A;  2NBF A;  4ME5 A;  4DAY B;  3M9B A;  1N34 L;  4C2M H;  1DZ1 A;  3S14 B;  2RDH A;  1GUW A;  2RCF A;  4HTH A;  3ERO A;  3W2D A;  4OO1 G;  1WTV A;  1JE4 A;  2M00 A;  2PI2 A;  4DV1 L;  5KYL A;  1IBL Q;  1I4G A;  5KGU A;  4IFD H;  2DGY A;  1XJV A;  2RCN A;  3MXU A;  2JA6 H;  4C3H B;  4OON A;  3SK5 A;  4KY5 A;  1XYI A;  1TU2 B;  1N34 Q;  3T51 B;  1JMC A;  1L1O C;  2L1B A;  4A3I B;  4EQP A;  1JJ2 A;  2L4N A;  1RCV D;  1TVX A;  1E3P A;  5C0X J;  3T1Y L;  1MGS A;  3J7Z C;  2FXQ A;  1HPC A;  3CC4 A;  2XRQ D;  2UUA Q;  3JAM E;  1PH9 A;  1ENF A;  1EZ6 A;  1L1O A;  1BXT A;  4HR7 B;  4XQN A;  4B9X A;  2L0C A;  4FF4 A;  4KJN A;  2FHT A;  2JA8 G;  1Y1W G;  2MHV A;  4XTC S;  1JOO A;  2VQE Q;  3LNN A;  1HUN A;  1JOK A;  3AYH B;  3EFX D;  2E5L Q;  1PH7 A;  3S17 H;  1XXG A;  3I4M H;  4IFD J;  4HN7 A;  2R93 H;  4TRD A;  3HOX H;  2JSO A;  1GM5 A;  1CSQ A;  2K33 A;  1EYA A;  4C3H H;  4ODG A;  3TP7 A;  1WYD A;  4BBR B;  3A74 A;  1LTS D;  4QIW B;  1IYV A;  2MFI A;  1H9S A;  4K8J A;  2PZW A;  2UXD L;  4QL5 A;  1SFO H;  1MBY A;  3RLN A;  2XWJ B;  2KA7 A;  5EJW A;  2B63 G;  1EY6 A;  2A6E D;  1KNA A;  3T16 A;  2CH4 W;  1YVC A;  2PZT A;  1B53 A;  1Q7Y C;  4LFB Q;  4YWM A;  5GRO A;  3TRE A;  1GVP A;  4NB3 A;  4NXN Q;  1FJG L;  1HNX Q;  1X3G A;  1I4P A;  1CSP A;  3HFZ B;  1R4P B;  2Q2H A;  4BY7 G;  3SK6 A;  4N8X 1;  1O78 A;  1WTR A;  2NUC A;  3CW2 C;  2NZH A;  3H3V C;  4LFA Q;  4J8Q A;  1HR0 W;  2CVR A;  1WTQ A;  2F3V A;  4IUU A;  1STH A;  3PSI A;  2K04 A;  3JAM i;  3PUV A;  4A3K B;  5BN4 A;  1PH8 A;  2HQL A;  4R4T A;  4XXE A;  3HS0 C;  4A3L H;  2VY3 A;  4KN4 C;  1Q81 C;  1KAB A;  2MGS A;  5F2D A;  2UXB Q;  4X65 Q;  3K81 C;  1N36 Q;  4A3D B;  1QIL A;  1CA5 A;  3K57 A;  3PF5 A;  1PYS B;  3NK9 A;  3FKI H;  4DK3 C;  2UU9 Q;  1SJE D;  2FMM A;  3PO3 G;  5IYB H;  4Q0F A;  1WCM B;  2VB2 X;  3KOJ A;  1W3S A;  4N9T A;  3CCU A;  4LJZ C;  2L5T A;  2E74 C;  2IY5 B;  3NHH A;  2NVQ B;  2AUJ D;  2EY1 A;  5G3L F;  2BE5 C;  3BVM A;  3HOW H;  1S5E D;  4R4I A;  3NQT A;  1BCP F;  1O80 A;  1XPO A;  4BXX G;  3S1N B;  1TY0 A;  2ICE C;  4B3R L;  1RHP A;  5JEA G;  5C44 B;  4DR7 L;  2EJG C;  5LMU L;  4IOA A;  3EBE A;  3AB9 A;  3NEL A;  3D4W A;  4XDX A;  1GHK A;  2XRS D;  1UEB A;  2YYZ A;  4ID6 A;  1Z9F A;  1D5M C;  4IOC A;  5HUR A;  1HZA A;  3AEV A;  1STE A;  1FGU A;  4CKE A;  2NVT B;  4RKB A;  3TRZ A;  4B3R Q;  3KDF B;  1M90 C;  4UP7 A;  2XWB B;  3S2H B;  2YTY A;  4P75 A;  3CCJ A;  4OWW B;  3K0X A;  3TME A;  4ZKB B;  5FLM G;  2NVX H;  2OTL A;  3S17 B;  1VQL A;  2A1A A;  4R8N A;  5C4X B;  1U0L A;  4A3M B;  1BCP D;  3A54 A;  4Y7N H;  1TS5 A;  2XVS A;  4DNR B;  5CV8 A;  4OL7 A;  1KHI A;  4HJ5 A;  2K5D A;  2XNA C;  4L5Q A;  3TEH B;  5AFW A;  1TWC H;  3FVQ A;  3MHB A;  4Q5V A;  4A93 G;  3STB C;  5C4Z A;  5IGC A;  4HJ9 A;  3PF4 A;  3M4O H;  1J5E Q;  3R93 A;  3CCQ A;  3P1H A;  3B6Y A;  1H95 A;  5ISR A;  1FL0 A;  3I56 A;  2JJQ A;  2KJX A;  1YI2 A;  2B2Y C;  1AN8 A;  1DOK A;  2B2U A;  4HMJ A;  4LUO A;  2EYL A;  1EY9 A;  2OT2 A;  2DN8 A;  3S15 B;  3G71 A;  1IZ6 A;  2X6L A;  1IBK L;  1EFI D;  3RZD H;  1NBW A;  3MFG A;  1CI3 M;  4NKL A;  4X64 Q;  4RHR A;  3PV0 A;  2WAQ E;  3K80 C;  5E1F A;  1MJE A;  2A73 B;  3UDG A;  1VQF A;  1I6V C;  3IFD A;  1EIG A;  4O0A A;  3NWT A;  4DV3 L;  3URY A;  1U4M A;  1JC7 A;  4FXG C;  2B8G A;  2B3G A;  5E4W C;  2WAQ B;  2K5V A;  3S1R H;  4JBW A;  2F52 A;  2OCE A;  3OOC A;  3L3O C;  1HR0 Q;  3M4Q A;  3PIP 3;  2L12 A;  2JA8 B;  2A8V A;  4Z9C B;  3SEB A;  1MSG A;  3S2D B;  3TZU A;  3S16 B;  1BKB A;  4LNQ A;  3HOU G;  3HOX B;  4LFC L;  3I7F A;  2F0G A;  2IPK D;  3OIP A;  5CV4 A;  4RGT A;  1GUT A;  1PZJ D;  1SRU A;  4PMB A;  1SE2 A;  2WKC A;  4ZUI A;  1F2Y A;  4L5R C;  4NP5 A;  2NN6 H;  3CPW A;  3CCR A;  2YTX A;  2Z6K A;  4LF5 L;  2CHB D;  1TXY A;  1HFG A;  4QMG A;  1W6J A;  4A3D H;  3HOY G;  1TS3 A;  3FDT A;  2IX0 A;  1B2T A;  2RF4 A;  2L11 A;  1K28 A;  3DEO A;  5IOD A;  2R92 H;  3KLR A;  3CD6 A;  4G57 A;  4NXM L;  4BY1 G;  3GO5 A;  4LF5 Q;  2F0H A;  4F7X A;  4DN4 M;  2IHE A;  4A3F G;  2CW0 D;  1IW7 D;  4ZUJ A;  2QGQ A;  2MPM A;  5KEE A;  2QIL A;  1G8Z D;  1Q86 C;  3C46 A;  4MNO A;  2O5J C;  3H3V H;  5COY A;  3MAQ A;  4LF9 Q;  2MO1 A;  4HMI A;  3A5Z B;  5FOB B;  3K5M A;  4DV2 L;  3OYY A;  5M5Y B;  1HZ9 A;  3NTH A;  4J1M A;  4GN5 A;  4OEL B;  2F0W A;  1PTO F;  2PCF B;  4A3J H;  2Q2T A;  1SR3 A;  1KXL A;  5JOB A;  5C4J B;  5EPL A;  4QGU A;  2R3Z A;  2R7Z G;  3GQB A;  2BDO A;  3OSO A;  5GQO A;  1N9W A;  1Q1B A;  2F0V A;  1VQH A;  1EIY B;  4K0K L;  4LF9 L;  5CBE E;  3MTS A;  2GVA A;  1YHB A;  1S5D D;  4JV5 Q;  2NZO A;  4K14 A;  3D3R A;  3PQI A;  3T4A C;  3QIA A;  1TR5 A;  2KCC A;  3NUC A;  5CGK A;  2B2V A;  1JR0 D;  1TS4 A;  3CQZ H;  5C3E G;  4A3I H;  4LK1 C;  4BY1 B;  1PTO C;  4GKK Q;  4EX5 A;  1SLJ A;  2ZXP A;  3I3C A;  1NAP A;  3TQY A;  2A69 C;  1I94 Q;  3HGB A;  4JI7 Q;  2AWO A;  5KRU A;  4B3S L;  1S40 A;  4A3G B;  1I6H H;  1ENC A;  4UPA A;  1VQI A;  4HAE A;  1EWI A;  4QUC A;  4C2M B;  4RKL A;  5ELB A;  4C1N K;  1ZKO A;  3HKZ E;  3W1G A;  2QKI C;  3OTO L;  4A3F H;  2X69 A;  4JK1 C;  2JA8 H;  1Y1W B;  5M3F G;  1HNZ L;  4B3S Q;  2NZ1 D;  4IUN A;  1LTT D;  3HOX G;  1B3Q A;  5E3F A;  1EFW A;  3LWU A;  2E2I H;  2RVL A;  3FKI G;  4OXP A;  4K5X A;  2ATW A;  2Z6K C;  3E0J A;  3Q24 A;  4HCS A;  4IUT A;  4NDX A;  4A3K G;  1CHP D;  4ALP A;  2NN6 G;  1K0R A;  1G6Z A;  1OTC A;  2F0U A;  2B2V C;  3PUY A;  5K5P A;  2GA4 B;  4A3G H;  2B39 A;  3PIO A;  4V0B A;  1I6H B;  3P7J A;  3GTM H;  4DR1 L;  3F1Z A;  2OTJ A;  5I9O A;  4IPD A;  5CV9 A;  2UUB L;  3TDQ A;  3BVG A;  5JJK A;  2R7F A;  5EKI A;  1DCZ A;  1X54 A;  1VF7 A;  4B3M Q;  1YNJ D;  1DM0 B;  1KDA A;  4MHE A;  4DAM A;  2F3W A;  4RGM A;  2R7Z H;  1NCV A;  1A2U A;  1K83 H;  4C3J G;  1PA6 A;  1B3A A;  3ERQ A;  4M8A A;  1DOM A;  1WD0 A;  1CKN B;  2Z4H A;  4BWG B;  2VB3 X;  2R7Z B;  3OW7 A;  4QQB X;  5DAU A;  1LTR D;  2V4D A;  1U9R A;  3STB D;  2JA9 A;  3EJI A;  3GV3 A;  3PO2 G;  1SYD A;  1HTP A;  4AH6 A;  3H0G G;  4UAI A;  2Z4I A;  1DXM A;  1SN8 A;  1JWU D;  2YTV A;  2A5H A;  2A6H D;  4JOI A;  4KJO A;  2Q2U A;  5JVG 3;  5DNF A;  3MZ5 A;  4BBR H;  4K6D A;  2ZTC A;  1T9H A;  3ULL A;  1VQN A;  4AYB E;  1V1O A;  1FVI A;  1HZB A;  2JA5 B;  2N78 A;  2WP8 J;  1R4Q B;  3D31 A;  4H02 A;  3V2T A;  4LFB L;  1LTI D;  1HNX L;  1SMY D;  3CPF A;  1B1Z A;  1C9O A;  4PMC A;  4GLX A;  1GJX A;  3NEN A;  1QB5 D;  1D2B A;  4LMQ D;  5M5X H;  3RN5 A;  3KLW A;  1VQA A;  1YNX A;  3K7A B;  4MTN A;  4R4O A;  1UEA B;  3BZD B;  4J6H A;  3T13 A;  5EBD A;  4R4Q A;  1NNX A;  1QVC A;  4HJA A;  1G29 1;  2RSO A;  4IUP A;  1WCM H;  1F9Q A;  4X6A H;  3UDI A;  2AWN A;  3RNU A;  2EY6 A;  3U50 C;  2F0J A;  4R1J A;  4X65 L;  2DJF C;  4DR3 L;  1DJR D;  1K3R A;  4JI2 Q;  2CQO A;  2KHI A;  1XTD A;  5IYD G;  2ZXO A;  1LTL A;  3I90 A;  3ZYY X;  1SYE A;  3NQI A;  4LUV A;  3RZO H;  4ZRZ A;  1ILP A;  2RDG A;  1Y8N B;  3MEH A;  1EEF D;  4KLK A;  2LMC B;  4KD4 A;  4LUZ A;  1D5X C;  3KJP A;  3J81 i;  4GNX B;  3TP6 A;  4BY7 B;  2K52 A;  4JI2 L;  1S3O A;  1SEB D;  3HG9 A;  3V96 A;  4JW0 A;  1GOZ A;  1ZEQ X;  4XYO A;  1A3V A;  2F0M A;  2K7V A;  2KEE A;  1EQT A;  4V19 0;  1T5E A;  3F8T A;  2N8N A;  5J39 A;  1XPR A;  3QB3 A;  3TS0 A;  2B63 B;  4HID A;  2PYK A;  2RA4 A;  4KHZ A;  5G3L D;  2DJG C;  2E2J H;  3KLS A;  4BBR G;  5IGB A;  1XNR L;  5FLX E;  3QWN A;  3D8G A;  4APV A;  3NBI A;  3KF8 B;  1WTP A;  1V9P A;  2ES2 A;  5KIX A;  2F0L A;  1HTL D;  2ZTE A;  4A3M G;  3CHB D;  3HOV G;  1TKW B;  1Y1V H;  1Z6H A;  1JWS D;  3PUX A;  4DK0 A;  2VQF Q;  4JI5 Q;  2IX1 A;  4KK7 A;  1NSN S;  1JOQ A;  3KF6 B;  2VNU D;  4LF7 L;  2PZU A;  1KL9 A;  1CKM A;  2R61 A;  1YEZ A;  3HZX A;  5DM6 3;  1VCI A;  1VQ7 A;  5I2Y A;  1QZH A;  2MUY A;  2CWP A;  2R7D A;  3GTL B;  1SNO A;  1V8Q A;  5J1Z A;  3GV6 A;  4GN4 B;  4DV0 Q;  2WAQ G;  4DPG A;  1I4Q A;  1HH2 P;  4F88 A;  3NP8 A;  2CWA A;  3R2I A;  5D14 A;  2F0E A;  1OXX K;  4O2D A;  2MQH A;  5IGF A;  2G9D A;  1P8L A;  2JA5 H;  2D0O A;  1O7I A;  2R92 G;  2A6E C;  1Y1V G;  3RLO A;  2MNA A;  1B9M A;  1YNN C;  3CCE A;  1LM0 A;  4X66 Q;  1RTO A;  4AQY Q;  3T53 B;  2TSS A;  1C48 A;  1WVL A;  2K05 A;  5GAG C;  3CCV A;  4DV0 L;  3FHW A;  2GVB A;  4K8I A;  2K01 A;  1PXU A;  4WJ3 M;  2Z6B A;  1TWF B;  3M3Y B;  2LXJ A;  1J5E L;  1VMC A;  3GTP H;  2WB1 G;  3W1B A;  1BOS A;  3PIP A;  1LT3 D;  2NYZ D;  3J81 c;  2HQE A;  3JC6 6;  5FLX L;  5EPK A;  2KCT A;  2MJ8 A;  5T1G A;  3IFT A;  2ZM6 Q;  5IIF A;  4IAL A;  1B7Y B;  4OIJ A;  1PV4 A;  3N6R A;  1AEX A;  4IO9 A;  1XTC D;  2GN5 A;  3P75 A;  3NTI A;  3CU7 A;  4B3T L;  5EKL A;  4P73 A;  1BNZ A;  3I4M B;  2Q8T A;  5A2Q L;  2LXK A;  4G7O C;  1O7Z A;  1DYQ A;  1O7Y A;  1ESF A;  1SSO A;  2E75 C;  3TP8 A;  2NTT A;  1QCB D;  4JBK A;  1KNE A;  3SE0 A;  4LF6 L;  1VQB A;  1D1I A;  4NW2 A;  3K58 A;  4CKC A;  1Q8K A;  2BH8 A;  4DR5 Q;  3VR6 A;  4KHP Q;  1OXU A;  5M5X B;  1HA5 A;  2I07 B;  5I4D A;  4IPG A;  1BBU A;  2LS0 1;  2J7Z A;  5CBA E;  1PFS A;  5LHY 1;  4DV6 Q;  2F0Q A;  1C8C A;  5E4X A;  1F9R A;  1PH1 A;  3MWY W;  5I6Y A;  2BDN A;  3J7Y W;  4DV2 Q;  4KY6 A;  3KDF A;  1WTO A;  1XMO Q;  4DR2 Q;  2EYF A;  3EIV A;  2HD3 A;  2K1B A;  1Y1W H;  4A3F B;  4DU9 A;  2EY2 A;  1LT6 D;  1F2M A;  3L7Z C;  1SBB B;  3GDE A;  4PG3 A;  3WOE A;  4A3E B;  1STA A;  2NVX B;  1WCM G;  4OX9 L;  1TQO A;  3PCO B;  1YJN A;  4DK6 C;  1VQJ A;  3SVM A;  2O2L D;  1YIJ A;  4JV5 L;  2EJM A;  1KC8 C;  1OO9 B;  1IBM Q;  2K75 A;  1CZG A;  4OWX B;  5LMN Q;  3I91 A;  1BCP C;  1H9M A;  3GTO H;  3LX0 A;  1EYD A;  1QJO A;  2JEA I;  3I70 A;  1PRT B;  2QEX A;  2AMC B;  3CQZ B;  3S1M B;  1I94 L;  1Z47 A;  1SE3 A;  2E2H H;  2OXP A;  1WFQ A;  2JA7 B;  2EPB A;  5BR8 Q;  3HP3 A;  4YCV A;  4JVZ A;  1K8M A;  1EY0 A;  2B63 H;  1K8A C;  1TS2 A;  1AE2 A;  1TT2 A;  2EXD A;  4PQX A;  1JCK B;  4X62 Q;  2CCZ A;  4GLA C;  4JC0 A;  3HOV B;  3QOJ A;  1EY5 A;  1M8A A;  1WI5 A;  1C4Q A;  2TMP A;  5BR8 L;  4C3J H;  3M4Y A;  2OQ0 A;  1VQ5 A;  1STN A;  3JAM L;  1E2V A;  3T1H Q;  4RG1 A;  3SXH A;  2B29 A;  4HIO A;  4L5S A;  2X6G A;  4JG2 A;  4OHJ A;  4GKK L;  3RZO B;  4NPS A;  4L63 B;  4JI7 L;  1R9T H;  1LO5 D;  3S16 H;  1GKH A;  1LAB A;  1S4Z A;  4FXK C;  3A5U A;  2HIV A;  2D0P A;  2Y0S E;  1II3 A;  2CFM A;  4DR6 L;  4RCN A;  5FLM H;  3K0Y A;  3I4N G;  5EBC A;  2F1M A;  2PNR C;  1H9S B;  4ZK9 B;  3BU2 A;  5IT9 c;  2RHS B;  5I9P A;  3J81 E;  1PYW D;  1HNZ Q;  3GTM B;  3GTJ B;  4A3B G;  4R9W A;  1G2T A;  1PRT C;  3GTQ B;  3I2Z A;  2Q8R E;  3J7A V;  5C44 G;  1HRJ A;  1XPU A;  3MXG A;  3TP5 A;  4A75 A;  5D65 A;  2UUC Q;  1VF5 C;  1C7Y A;  4H7B A;  4WJW A;  3ER0 A;  3L9A X;  3KYH C;  1EYC A;  1IL8 A;  3S1Q B;  1MSH A;  1V1P B;  1FNW A;  1I4H A;  1O7L A;  3CXC A;  4H0L C;  2QDL A;  4BBS G;  2B8F A;  5C3W A;  4RCO A;  1IW7 C;  3UE0 A;  1SJH D;  3AQQ A;  3E0E A;  1S5C D;  3F2D A;  1LYL A;  2AQ2 B;  2MO0 A;  3PIO 3;  1TWH B;  3PO3 B;  2UUC L;  4DAV A;  1EEI D;  3H6M A;  4X3T A;  5DEH A;  4GNX C;  1A8V A;  2C35 B;  2RDF A;  2LKV A;  4DR1 Q;  2F03 A;  2SDF A;  4LF4 Q;  5JPM C;  4DNI A;  3G7L A;  4PV1 C;  1OXV A;  1CKN A;  3E9I A;  4RWS C;  4DNT B;  4I7Z C;  5CV7 A;  2R6G A;  3SGI A;  3ND9 A;  1M4V A;  2PQE A;  2BA0 A;  5A35 A;  1G91 A;  4O42 A;  1EY4 A;  4M1U B;  1NTG A;  1JJG A;  4HSV A;  4DFA A;  4FYD A;  5EKK A;  2PMZ E;  4CHT B;  4YY3 Q;  1CKO A;  2A69 D;  1EQQ A;  1AE3 A;  5C5M A;  4E6I A;  1EL0 A;  4J15 A;  3HOZ H;  1CQF A;  5M3F H;  3BDC A;  4G7H C;  1JB7 A;  1WOC A;  4XIG S;  2IT1 A;  2L9H A;  3G48 A;  1BVS A;  2NVT H;  4LAA A;  4F8M A;  2DY7 A;  3K6O A;  3C3L A;  2ASB A;  1IKM A;  3SR1 A;  2H1E A;  1VS0 A;  2HHH Q;  3D0F A;  4MIU A;  2WIN B;  3BG3 A;  2DY8 A;  5FJ8 G;  4DKA C;  3PO2 H;  4Y7N B;  2PW5 A;  5EGT A;  2NVQ H;  3DEP A;  5HGQ A;  4A3M H;  3C2P A;  3OWF A;  2FMC A;  4CDD C;  1LT4 D;  1IL2 A;  2N49 A;  1Y1V B;  5EAY A;  4JPB W;  1QNK A;  3ND8 A;  2UXD Q;  1NJI C;  3UE1 A;  3J81 L;  5FO7 B;  1CT1 D;  1EY7 A;  1VQ8 A;  2B2Y A;  2QEJ C;  3W3A A;  4WOR A;  1I4R A;  3K5N A;  2PQA B;  1Y8O B;  3OMC A;  3Q8D A;  3HOZ B;  4JI4 Q;  3F2B A;  3I4N H;  1FJG Q;  5AJ3 Q;  2ID0 A;  3GTK H;  4BY7 H;  3OW2 A;  2R92 B;  3Q0A A;  1DON A;  2YU9 B;  1MIU A;  1PFB A;  4RA8 A;  1U4P A;  3U58 A;  4CKB A;  1RDP D;  5JEA J;  2NB0 A;  4GKJ Q;  1UWV A;  5JPN C;  1EIH A;  5M5W B;  3D4D A;  1BUV T;  4YCU A;  1RF2 D;  2PO4 A;  5C3X A;  5M3M B;  2Z9H A;  4IJH A;  4DGZ A;  2I5H A;  3D4R A;  4C3H G;  1UNS A;  5HGT A;  2HIX A;  1SE4 A;  1YNJ C;  2EYJ A;  4PMW A;  1A6X A;  1K9M C;  2K5W A;  2Z8L A;  2IX3 A;  2ZJR A;  2KEN A;  2AQ1 B;  2OQK A;  3CKI B;  2UU9 L;  1JWM D;  1R9T B;  1L0X B;  3BDO A;  1T5X D;  1A15 A;  3SK4 A;  2IL8 A;  3HEJ A;  1HNW L;  1KRS A;  1QNU A;  4EQN A;  1Q82 C;  4ZKC B;  5ELC A;  3CCL A;  2BH2 A;  2IJ0 A;  2EYP A;  1IXR A;  5KNC A;  2LSS A;  1J8I A;  5JEA H;  4YHH Q;  5C3E B;  4RHS A;  1QZG A;  3A8I E;  3VR2 A;  1XWE A;  3RD4 A;  2UUA L;  1UE7 A;  1HXY D;  1VQK A;  3NBH B;  2XN9 C;  1A3T A;  4A3E H;  2BE5 D;  1KQS A;  4RH6 A;  1DGS A;  1I4X A;  3FPP A;  5C4X G;  4HIM A;  2DNE A;  4AQY L;  1UUP A;  5H1S E;  4JI3 Q;  4N9P A;  3SDZ A;  4YHH L;  2VQE L;  4JI5 L;  2VQF L;  2K03 A;  4A76 A;  2R93 B;  2Y0S G;  3LGJ A;  4R4C A;  2N3S A;  2FFK B;  2F0O A;  4DXF A;  3A56 A;  5ELF A;  3J80 i;  2EYH A;  4PZ7 A;  1HA6 A;  1ILQ A;  3D6C A;  2HCC A;  2AQ3 B;  5IP7 G;  1NR2 A;  2K14 A;  3MEF A;  4G4K A;  5DM7 3;  5KYI A;  5M3M H;  1BO0 A;  1VQM A;  4OIK A;  5CR3 A;  1HZC A;  2D2C C;  4DV5 L;  3VYR A;  3OWE B;  1KAA A;  4I65 A;  3HOW G;  5LL6 S;  1S5F D;  4POG A;  4NXN L;  3VYT A;  4IUQ A;  5JJL A;  4JI6 Q;  1ICF B;  4DV7 Q;  3D6W A;  1CA6 A;  2G9H D;  4A3B H;  4AYB G;  3ONA B;  4DR5 L;  1AZQ A;  1IYJ B;  2K28 A;  2KQ3 A;  3H0G B;  1TWA H;  1NR4 A;  3Q23 A;  5LMN W;  5M5W H;  4CJ1 B;  2ZM6 L;  2K32 A;  4KD3 A;  5L37 A;  2RKS A;  5COR A;  5LL6 X;  3KK7 A;  2AKW B;  1S72 A;  1GXD C;  5K36 G;  5IYB G;  1XMO L;  1JIC A;  2D9U A;  4DR2 L;  1X3E A;  2YU9 H;  1RKN A;  2O4X A;  2CKZ B;  2UXB L;  3PMF A;  1Y14 B;  4YIJ A;  4C1N I;  4C3J B;  3K59 A;  3H3V I;  1A3U A;  1E7Z A;  1VDZ A;  5C4X H;  4GS3 A;  5JVH 3;  4B3T Q;  4WFN 3;  4UY8 C;  1TWF H;  3M3Y H;  2E2I B;  1GUS A;  4PNY A;  2MP1 A;  4EQ5 A;  1HJP A;  4OX9 Q;  2A74 C;  1WD1 A;  3R2T A;  1G6P A;  2CH4 A;  1I3Q H;  4L5T A;  4NMZ A;  3S9W A;  1PFN A;  3OMG A;  1IHZ A;  3NEM A;  3I55 A;  3KLS X;  1PH4 A;  1Q1E A;  1D5Z C;  1Y8P B;  1SNP A;  1Q8I A;  3CRL C;  4IPC A;  4DV6 L;  5K36 H;  1PHJ A;  4IFD I;  1TII D;  2QA4 A;  1KIX A;  4DR7 Q;  5LMU Q;  2I5L X;  2WB1 B;  3C1E A;  4QIW E;  1K73 C;  1EY8 A;  3K5L A;  1XMQ L;  4FNF A;  5NUC A;  1ENA A;  3ULP A;  2I46 A;  5T1I A;  1LAC A;  1LLR D;  1OXT A;  2RQX A;  2H5X A;  1ICW A;  5D3I B;  3IRB A;  1X6O A;  4I7A A;  3EVQ A;  3G6J B;  1HHV A;  1D7Q A;  1XMQ Q;  1RD9 D;  4IUV A;  1EOV A;  3K7A H;  4UP8 A;  2HCI A;  2JK8 A;  3JAM c;  4CGY B;  3J81 j;  2JA6 B;  5C4J H;  5IYC H;  1YJW A;  3A0J A;  3U4Z A;  4U68 A;  4AIM A;  3NTK A;  1L0W A;  1ONL A;  3PUW A;  4QB4 A;  2E2D C;  5ELO A;  1FD7 D;  5IP9 G;  3HOW B;  4CJ2 C;  1GO3 E;  2J4X A;  4IPH A;  1VQO A;  3M7N A;  1PYB A;  1SND A;  2EDG A;  1OXS C;  2VUM H;  3J7A F;  1H9K A;  1ROD A;  3MA2 B;  3MC0 B;  2B2U C;  3S14 H;  2CQA A;  1QE6 A;  5C44 H;  4X64 L;  3WWV A;  2D5D A;  4ZQ3 A;  1C0A A;  5IGE A;  4FF1 A;  1E24 A;  5IT9 L;  1VQC A;  1FNV A;  2P5Z X;  4DV4 Q;  4O1N A;  1F77 A;  4HIK A;  5M9O A;  4DUY L;  1EIF A;  2E8G A;  3F2U A;  2F4I A;  1VQE A;  4OO1 I;  1TY2 A;  1TWG B;  1QVF A;  1EWH A;  1BDO A;  3NWS A;  2EOT A;  3MXP A;  5CYU A;  4DR4 Q;  1GHJ A;  5JJI A;  3U9S A;  2VUM G;  5A2Q E;  4H13 C;  1PH2 A;  1AFP A;  4LFC Q;  2RBM A;  2CW0 C;  2B2W C;  1X65 A;  1X3P A;  4DR6 Q;  4DUY Q;  3PO2 B;  1IYU A;  1ZXT A;  5CMD A;  3VR3 A;  3I4L A;  4IQZ A;  4OGQ C;  4TVA B;  2ENB A;  1YBY A;  1H9R A;  1PH3 A;  5J22 A;  4GN3 B;  2UXC L;  2HUG A;  2E2J B;  4ZAI A;  1PVO A;  2F0N A;  2VW9 A;  4JI0 Q;  1STB A;  4JI8 L;  4ZYS A;  3T56 B;  5IT9 E;  1AW7 A;  4AYB B;  3KF8 A;  4QCL A;  2JE6 I;  2OEO A;  3GTG B;  3RLF A;  2K5Q A;  3AFQ A;  1K8G A;  2PI2 E;  2JN4 A;  2WAC A;  2EJF C;  4MZ9 A;  1YZ6 A;  4HJ7 A;  1JT8 A;  2VZA A;  3WDN A;  3V05 A;  4JI8 Q;  3J80 c;  4B3M L;  2J0T D;  4YWL A;  3HOV H;  1PDQ A;  4R8I A;  3W5O A;  1ML0 D;  4A4I A;  1W2B A;  1SYC A;  4C56 C;  3DXJ C;  1BBW A;  2F0S A;  1E0B A;  1V1Q A;  4A3J B;  3NPP A;  3VYS A;  2KEC A;  2KHJ A;  1J6Q A;  1PRT F;  2RHQ B;  3CP0 A;  4U67 3;  2KOL A;  2HHH L;  4LF4 L;  1SYG A;  1PZI D;  3H91 A;  1V1P A;  2NVY B;  5KND A;  1N33 L;  3P20 A;  3FMC A;  4KI0 A;  4ABN A;  1RTN A;  3HRZ C;  1EZ8 A;  4POF A;  1SMX A;  5IGD A;  4UDU C;  4FXD A;  4MTK A;  3DLL A;  4JCV E;  1A63 A;  3LWE A;  1KTK A;  1DOL A;  2BOS A;  3M7G A;  1STG A;  5IWA Q;  2Z0S A;  4YY3 L;  5M5Y H;  4PZ6 A;  4KHV A;  2QW7 A;  5TSS A;  3WOF A;  5D3D A;  2ALY B;  5IOC A;  1M1K C;  2F0T A;  1SNC A;  4LF8 L;  2NTS A;  3SHL A;  2HT1 A;  3S24 A;  5GAH C;  4XQJ A;  3S2H H;  3X3M A;  2A19 A;  1YJ9 A;  4BS9 A;  1LV9 A;  2M2L A;  2KCN A;  5IYC G;  4A3G G;  2QDB A;  1AZP A;  1E1O A;  2EY5 A;  2L15 A;  1CFM A;  4DXG A;  1WTX A;  2PW7 A;  3BZK A;  4QY7 A;  1CZW A;  3QJY A;  1Q12 A;  3TSS A;  2HDL A;  3ERS X;  5I2X A;  5C0X I;  4LF8 Q;  4RGO S;  1QVG A;  3MXN B;  4EQO A;  4K6L A;  1A0I A;  5C5L A;  4JI1 Q;  4TSS A;  1E22 A;  3MVV A;  3TZD A;  5KNB A;  4B9W A;  1Q3L A;  4RAU C;  1HQM C;  3VR5 A;  3HOY H;  4FVM A;  1HUM A;  4BBS H;  3QO2 A;  5EPJ A;  1KD1 C;  1GUN A;  3QR8 A;  3HOU H;  3HKZ B;  4OWT B;  5EQ0 A;  5JAV A;  4JI1 L;  4WRD A;  3DHQ A;  4YWK A;  4ZLT F;  4DR3 Q;  4RMF A;  4XQQ A;  4JI4 L;  1A2T A;  2B2T A;  5M3M G;  1E2W A;  5E7N A;  1L1O B;  1XNQ L;  5FKA C;  1UAP A;  1W6K A;  3OHX C;  4QF4 A;  2F4V Q;  1QUQ A;  1VQD A;  1HNW Q;  2N88 A;  1BF4 A;  2SNM A;  2V1C C;  1Q46 A;  4LWC A;  1B8A A;  3J7A 5;  1B4O A;  5JJZ A;  4GKJ L;  2E76 C;  3HKS A;  1K8O A;  5IP9 H;  1D8L A;  1EOT A; 
#chains in the Genus database with same CATH homology
 1X3Q A;  1CHQ D;  1KLG D;  2A6H C;  2C5C A;  1LT5 D;  3GTP B;  1G2S A;  3MFY A;  2LY7 A;  2QF7 A;  2F0K A;  2DNC A;  4B08 A;  1V43 A;  3GD7 A;  3TN2 A;  2KED A;  3HOY B;  4FF2 A;  1JOR A;  3NBH A;  1KDB A;  1TWA B;  4RFB A;  4IZ8 A;  5BN5 A;  1SAP A;  5C0X G;  1CM9 A;  4K5V A;  4XT1 B;  3DWA A;  1SFO B;  2IW3 A;  4DAY A;  3O13 A;  4ILW A;  3C1F A;  2XSC A;  3E6Z X;  2A68 C;  3FRP B;  1Y69 U;  2Q8I B;  1JB3 A;  2EVB A;  1LTB D;  5ELE A;  1CQV A;  3DWQ A;  2VUM B;  3BYY B;  3A7L A;  2RSN A;  3IAY A;  2NWG A;  3VYU A;  3OPO A;  2IWH A;  1ET6 A;  3R8B A;  4DA2 A;  1FNU A;  1E2Z A;  2VXW A;  1FYC A;  3CRK C;  2JEB I;  2AUK A;  4P2C B;  2OF1 A;  2M9V A;  3VA7 A;  1JQY D;  4KY7 A;  1GUG A;  3E5S A;  1ET9 A;  3MXN A;  4X3U A;  2KUM A;  2F0F A;  4A93 B;  2C9O A;  1B44 D;  3KUP A;  4FP5 D;  1FGB D;  2ZXR A;  1EU4 A;  3RZD B;  1EQV A;  3H94 A;  2BCO A;  1QG7 A;  2WII B;  3FKI B;  1PTO H;  3NXW A;  1HQR D;  5BN3 A;  1BCP B;  4A3B B;  2KHS A;  1AP0 A;  1F2Z A;  3IL8 A;  1MI2 A;  1LTG D;  4BA2 I;  4KMU C;  4HED A;  4BA1 I;  2EZV A;  3UI2 A;  3TBI B;  1PLF A;  5C4H A;  5CV5 A;  2SEB D;  3RMH A;  1EWC A;  3BVZ A;  1NUC A;  1FR3 A;  4FO2 A;  4X3K A;  4KKT A;  2D62 A;  4OO1 H;  2EE1 A;  1F9P A;  2ZT9 C;  4RGN A;  2NN6 I;  4S3S A;  3ITP A;  4EVO A;  1IKL A;  4KKS A;  1VMP A;  3DMU A;  3Q6S A;  3KBX A;  1YNN D;  1B50 A;  4FF3 A;  4IUR A;  3K5O A;  1U4L A;  2B2T C;  4DF7 A;  2EYM A;  3GP7 A;  1U4R A;  2F0I A;  2A68 D;  4H44 C;  1PTO B;  4HCE A;  2PPB C;  1SNQ A;  4XT3 B;  3SK8 A;  1SDF A;  2E2H B;  4CJ0 B;  1CK1 A;  3J80 E;  2FIN B;  5CV6 A;  4C3I B;  1ZYR C;  2XIW A;  4KKU A;  5ELD A;  1D1K A;  1BBX C;  3QOL A;  4CBV A;  3M85 A;  3AU7 A;  3A7A B;  2JYO A;  3I8Z A;  1X32 A;  3I73 A;  2F0P A;  5CC4 A;  1XX8 A;  1GUO A;  1QOH A;  3A55 A;  3NSW A;  1SYF A;  1SYB A;  1PTO D;  5FK9 C;  4L6T B;  3Q22 A;  3HOU B;  4QUF A;  4MN3 A;  1F2L A;  3DM1 A;  3I4N B;  2K6A A;  1STY A;  1S5B D;  2QCP X;  5FO9 B;  2WKD A;  3S1R B;  1ESR A;  1LTA D;  5I6W A;  1B9N A;  1PFM A;  2JXM B;  3I72 A;  4IN3 A;  3VA5 A;  1SNM A;  2HDM A;  3AMU A;  3OIQ A;  1TWC B;  4ULL A;  3BYT B;  2Z1C A;  3A8J E;  4DAP A;  2O5I C;  2ICI A;  1L0Y B;  4KN7 C;  3M4O B;  4XYQ A;  1PZK D;  3A8K E;  3R3O A;  3X3N A;  3GTK B;  4TQU S;  3J80 L;  1PRT D;  3H09 A;  3EA6 A;  3RUZ A;  1PMR A;  3FPU B;  1QWY A;  3NE5 B;  2EYO A;  3DWP A;  5C6A A;  2F0D A;  5FO8 B;  2N55 A;  3EQL C;  1CTM A;  3GTO B;  2B2W A;  1HFN A;  1F9S A;  2FJ2 A;  4EGV A;  2SOB A;  4IFD G;  3U9O A;  1Q90 A;  1HCZ A;  5M3F B;  1K83 B;  1MD2 D;  3FEW X;  4K2L A;  1J9O A;  4K2K A;  1BQQ T;  1D6E C;  2JP1 A;  4C3I G;  3VR4 A;  3KBG A;  4BBS B;  1DD2 A;  4L8J A;  3BDL A;  1I50 B;  4X3S A;  1SMY C;  2BA1 A;  4DK1 A;  2WV6 D;  1KDC A;  3PUZ A;  3BS1 A;  2PMZ B;  3DUZ A;  3N52 A;  1ZYR D;  2Y0S B;  1EU3 A;  3QG1 A;  2SNS A;  1Z7T A;  4KTA A;  3IKJ A;  4TKO B;  1H9J A;  4K5W A;  2H4O A;  4GZY C;  1RJT A;  5C0X H;  1I3Q B;  1SXT A;  4KV6 A;  5IGG A;  1WTW A;  2L55 A;  4HSP A;  4G7Z C;  2EXZ A;  4F87 A;  1BR9 A;  1KLU D;  2NBF A;  2KVM A;  2LFN A;  4ME5 A;  1DZ1 A;  3S14 B;  2RDH A;  1GUW A;  4HTH A;  3ERO A;  3W2D A;  4OO1 G;  1WTV A;  1JE4 A;  2M00 A;  5KYL A;  1I4G A;  5KGU A;  4IFD H;  3MXU A;  4C3H B;  3SK5 A;  4KY5 A;  1XYI A;  1TU2 B;  3T51 B;  2L1B A;  4A3I B;  4EQP A;  2L4N A;  1RCV D;  1TVX A;  5C0X J;  1MGS A;  1HPC A;  2XRQ D;  3JAM E;  1ENF A;  1EZ6 A;  1BXT A;  4HR7 B;  4XQN A;  4B9X A;  2L0C A;  4FF4 A;  4KJN A;  2FHT A;  2MHV A;  4XTC S;  1JOO A;  1HUN A;  3LNN A;  1JOK A;  3EFX D;  1XXG A;  4IFD J;  4HN7 A;  4TRD A;  2JSO A;  2K33 A;  1EYA A;  4ODG A;  3TP7 A;  4BBR B;  1LTS D;  4QIW B;  1IYV A;  1H9S A;  4K8J A;  2PZW A;  1MBY A;  2XWJ B;  2KA7 A;  5EJW A;  1EY6 A;  2A6E D;  1KNA A;  3T16 A;  2PZT A;  1B53 A;  1I4P A;  1R4P B;  3SK6 A;  1O78 A;  1WTR A;  2NUC A;  3H3V C;  4J8Q A;  2CVR A;  1WTQ A;  2F3V A;  4IUU A;  1STH A;  2K04 A;  3PUV A;  4A3K B;  5BN4 A;  4XXE A;  3HS0 C;  4KN4 C;  1KAB A;  2MGS A;  5F2D A;  4A3D B;  1QIL A;  1CA5 A;  3K57 A;  3NK9 A;  1SJE D;  2FMM A;  4Q0F A;  1WCM B;  2VB2 X;  4N9T A;  4LJZ C;  2L5T A;  2E74 C;  3NHH A;  2NVQ B;  2AUJ D;  2EY1 A;  5G3L F;  2BE5 C;  3BVM A;  1S5E D;  3NQT A;  1BCP F;  1O80 A;  3S1N B;  1TY0 A;  2ICE C;  1RHP A;  5JEA G;  5C44 B;  2EJG C;  3AB9 A;  3D4W A;  4XDX A;  1GHK A;  2XRS D;  2YYZ A;  4ID6 A;  1D5M C;  5HUR A;  1STE A;  4CKE A;  2NVT B;  4RKB A;  2XWB B;  3S2H B;  3TME A;  4ZKB B;  3S17 B;  5C4X B;  4R8N A;  4A3M B;  1BCP D;  3A54 A;  1TS5 A;  2XVS A;  4DNR B;  5CV8 A;  4OL7 A;  2K5D A;  2XNA C;  5AFW A;  3FVQ A;  3MHB A;  4Q5V A;  5C4Z A;  5IGC A;  3R93 A;  3P1H A;  5ISR A;  2KJX A;  2B2Y C;  1AN8 A;  1DOK A;  2B2U A;  4HMJ A;  2EYL A;  1EY9 A;  2OT2 A;  2DN8 A;  3S15 B;  2X6L A;  1EFI D;  3MFG A;  1CI3 M;  4NKL A;  4RHR A;  3PV0 A;  5E1F A;  2A73 B;  1I6V C;  3IFD A;  1EIG A;  3NWT A;  3URY A;  1U4M A;  1JC7 A;  4FXG C;  2B8G A;  5E4W C;  2WAQ B;  4JBW A;  3OOC A;  3L3O C;  3PIP 3;  2L12 A;  2JA8 B;  4Z9C B;  3SEB A;  1MSG A;  3S2D B;  3TZU A;  3S16 B;  3HOX B;  2F0G A;  2IPK D;  3OIP A;  5CV4 A;  4RGT A;  1GUT A;  1PZJ D;  4PMB A;  1SE2 A;  2WKC A;  4ZUI A;  1F2Y A;  4NP5 A;  2NN6 H;  2CHB D;  1HFG A;  4QMG A;  1W6J A;  1TS3 A;  3FDT A;  2IX0 A;  1B2T A;  2L11 A;  5IOD A;  3DEO A;  3KLR A;  4G57 A;  3GO5 A;  2F0H A;  4F7X A;  4DN4 M;  2CW0 D;  1IW7 D;  4ZUJ A;  2MPM A;  5KEE A;  2QIL A;  1G8Z D;  3C46 A;  2O5J C;  5COY A;  3MAQ A;  4HMI A;  5FOB B;  3K5M A;  5M5Y B;  3NTH A;  4J1M A;  2F0W A;  1PTO F;  2PCF B;  5JOB A;  5C4J B;  5EPL A;  2R3Z A;  3GQB A;  2BDO A;  3OSO A;  1Q1B A;  2F0V A;  5CBE E;  3MTS A;  1S5D D;  4K14 A;  3D3R A;  3T4A C;  2KCC A;  1TR5 A;  3QIA A;  3NUC A;  5CGK A;  2B2V A;  1JR0 D;  1TS4 A;  4LK1 C;  4BY1 B;  1PTO C;  3I3C A;  2ZXP A;  1NAP A;  2A69 C;  3HGB A;  2AWO A;  5KRU A;  4A3G B;  1ENC A;  4HAE A;  4QUC A;  4C2M B;  4RKL A;  5ELB A;  4C1N K;  1ZKO A;  2QKI C;  2X69 A;  4JK1 C;  1Y1W B;  2NZ1 D;  4IUN A;  1LTT D;  5E3F A;  3LWU A;  2RVL A;  4K5X A;  3E0J A;  3Q24 A;  4HCS A;  4IUT A;  4NDX A;  1CHP D;  2NN6 G;  1G6Z A;  2F0U A;  2B2V C;  3PUY A;  5K5P A;  2GA4 B;  1I6H B;  2B39 A;  4V0B A;  3P7J A;  5I9O A;  5CV9 A;  3TDQ A;  3BVG A;  5EKI A;  1DCZ A;  1VF7 A;  1YNJ D;  1DM0 B;  1KDA A;  4MHE A;  2F3W A;  4RGM A;  1NCV A;  1A2U A;  4C3J G;  1B3A A;  3ERQ A;  4M8A A;  1DOM A;  1WD0 A;  2Z4H A;  4BWG B;  2VB3 X;  2R7Z B;  3OW7 A;  5DAU A;  1LTR D;  2V4D A;  1U9R A;  3EJI A;  3GV3 A;  1SYD A;  1HTP A;  4UAI A;  2Z4I A;  1DXM A;  1JWU D;  2A5H A;  2A6H D;  4KJO A;  5JVG 3;  5DNF A;  3MZ5 A;  4K6D A;  1V1O A;  2JA5 B;  2WP8 J;  1R4Q B;  3D31 A;  3V2T A;  1LTI D;  1SMY D;  1B1Z A;  4PMC A;  1GJX A;  1QB5 D;  1D2B A;  4LMQ D;  3K7A B;  1UEA B;  3BZD B;  4J6H A;  3T13 A;  5EBD A;  1G29 1;  2RSO A;  4IUP A;  1F9Q A;  2AWN A;  2EY6 A;  2F0J A;  1DJR D;  2ZXO A;  3I90 A;  3ZYY X;  1SYE A;  3NQI A;  4ZRZ A;  1ILP A;  2RDG A;  1Y8N B;  3MEH A;  1EEF D;  2LMC B;  4KD4 A;  1D5X C;  3TP6 A;  4BY7 B;  1SEB D;  3HG9 A;  3V96 A;  1GOZ A;  1ZEQ X;  4XYO A;  1A3V A;  2F0M A;  2K7V A;  2KEE A;  1EQT A;  4V19 0;  1T5E A;  5J39 A;  3QB3 A;  2B63 B;  2PYK A;  2RA4 A;  4KHZ A;  5G3L D;  3KLS A;  5IGB A;  5FLX E;  3QWN A;  3D8G A;  3NBI A;  1WTP A;  5KIX A;  2F0L A;  1HTL D;  3CHB D;  1TKW B;  1Z6H A;  1JWS D;  3PUX A;  4DK0 A;  2IX1 A;  4KK7 A;  1NSN S;  1JOQ A;  2VNU D;  2PZU A;  2R61 A;  3HZX A;  5DM6 3;  1VCI A;  5I2Y A;  2MUY A;  3GTL B;  1SNO A;  1V8Q A;  5J1Z A;  3GV6 A;  1I4Q A;  4F88 A;  3NP8 A;  3R2I A;  5D14 A;  2F0E A;  1OXX K;  5IGF A;  2G9D A;  2A6E C;  1B9M A;  1YNN C;  1RTO A;  3T53 B;  2TSS A;  1C48 A;  1WVL A;  2K05 A;  4K8I A;  2K01 A;  1PXU A;  1TWF B;  3M3Y B;  1VMC A;  1BOS A;  1LT3 D;  2NYZ D;  2HQE A;  5FLX L;  5EPK A;  2MJ8 A;  5T1G A;  3IFT A;  5IIF A;  4IAL A;  4OIJ A;  3N6R A;  1AEX A;  1XTC D;  3P75 A;  3NTI A;  3CU7 A;  5EKL A;  1BNZ A;  3I4M B;  2Q8T A;  5A2Q L;  4G7O C;  1O7Z A;  1DYQ A;  1O7Y A;  1ESF A;  1SSO A;  2E75 C;  3TP8 A;  2NTT A;  1QCB D;  1KNE A;  3SE0 A;  1D1I A;  4NW2 A;  3K58 A;  4CKC A;  3VR6 A;  1OXU A;  5M5X B;  1HA5 A;  2I07 B;  5I4D A;  2LS0 1;  2J7Z A;  5CBA E;  5LHY 1;  2F0Q A;  1C8C A;  5E4X A;  1F9R A;  3MWY W;  5I6Y A;  2BDN A;  3J7Y W;  4KY6 A;  1WTO A;  2EYF A;  2K1B A;  4A3F B;  4DU9 A;  2EY2 A;  1LT6 D;  1F2M A;  3L7Z C;  1SBB B;  3WOE A;  4A3E B;  1STA A;  2NVX B;  1TQO A;  3SVM A;  2O2L D;  2EJM A;  1OO9 B;  1CZG A;  3I91 A;  1BCP C;  1H9M A;  3LX0 A;  1EYD A;  1QJO A;  2JEA I;  3I70 A;  1PRT B;  3CQZ B;  3S1M B;  1Z47 A;  1SE3 A;  2OXP A;  2JA7 B;  2EPB A;  3HP3 A;  1K8M A;  1EY0 A;  1TS2 A;  1TT2 A;  4PQX A;  1JCK B;  3HOV B;  3QOJ A;  1EY5 A;  1M8A A;  1C4Q A;  2TMP A;  3M4Y A;  1STN A;  3JAM L;  1E2V A;  3SXH A;  2X6G A;  4OHJ A;  3RZO B;  4L63 B;  1LO5 D;  1LAB A;  1S4Z A;  4FXK C;  1II3 A;  4RCN A;  3K0Y A;  5EBC A;  2F1M A;  2PNR C;  1H9S B;  4ZK9 B;  5I9P A;  3J81 E;  1PYW D;  3GTM B;  3GTJ B;  4R9W A;  1G2T A;  1PRT C;  3GTQ B;  2Q8R E;  3J7A V;  1HRJ A;  3MXG A;  3TP5 A;  5D65 A;  1VF5 C;  4H7B A;  4WJW A;  3L9A X;  1EYC A;  1IL8 A;  3S1Q B;  1MSH A;  1V1P B;  1FNW A;  1I4H A;  1O7L A;  4H0L C;  2B8F A;  5C3W A;  4RCO A;  1IW7 C;  1SJH D;  1S5C D;  2AQ2 B;  3PIO 3;  1TWH B;  3PO3 B;  4DAV A;  1EEI D;  3H6M A;  4X3T A;  5DEH A;  2RDF A;  2LKV A;  2F03 A;  2SDF A;  5JPM C;  3G7L A;  4PV1 C;  1OXV A;  4RWS C;  4DNT B;  4I7Z C;  5CV7 A;  2R6G A;  3ND9 A;  1M4V A;  2PQE A;  2BA0 A;  5A35 A;  1G91 A;  4O42 A;  1EY4 A;  4M1U B;  4HSV A;  4DFA A;  4FYD A;  5EKK A;  4CHT B;  2A69 D;  5C5M A;  4E6I A;  1EL0 A;  1CQF A;  4G7H C;  3BDC A;  4XIG S;  2IT1 A;  2L9H A;  4LAA A;  4F8M A;  2DY7 A;  3C3L A;  3K6O A;  1IKM A;  3SR1 A;  2H1E A;  4MIU A;  2WIN B;  3BG3 A;  2DY8 A;  4Y7N B;  2PW5 A;  5EGT A;  3DEP A;  3C2P A;  3OWF A;  2FMC A;  1LT4 D;  1Y1V B;  1QNK A;  3ND8 A;  3J81 L;  5FO7 B;  1CT1 D;  1EY7 A;  2B2Y A;  2QEJ C;  3W3A A;  4WOR A;  1I4R A;  3K5N A;  1Y8O B;  3OMC A;  3HOZ B;  2ID0 A;  2R92 B;  3Q0A A;  1DON A;  2YU9 B;  1PFB A;  4RA8 A;  1U4P A;  4CKB A;  1RDP D;  5JEA J;  2NB0 A;  5JPN C;  1EIH A;  5M5W B;  3D4D A;  1BUV T;  1RF2 D;  2PO4 A;  5C3X A;  5M3M B;  4DGZ A;  3D4R A;  4C3H G;  1UNS A;  5HGT A;  1SE4 A;  1YNJ C;  2EYJ A;  4PMW A;  1A6X A;  2K5W A;  2Z8L A;  2IX3 A;  2AQ1 B;  3CKI B;  1JWM D;  1R9T B;  1L0X B;  3BDO A;  1T5X D;  1A15 A;  3SK4 A;  2IL8 A;  3HEJ A;  1QNU A;  4EQN A;  4ZKC B;  5ELC A;  2IJ0 A;  2EYP A;  5KNC A;  1J8I A;  5JEA H;  5C3E B;  4RHS A;  3A8I E;  3VR2 A;  1XWE A;  3RD4 A;  1HXY D;  2XN9 C;  1A3T A;  2BE5 D;  4RH6 A;  1I4X A;  3FPP A;  2DNE A;  1UUP A;  4N9P A;  3SDZ A;  2K03 A;  2R93 B;  2FFK B;  2F0O A;  4DXF A;  3A56 A;  5ELF A;  2EYH A;  1HA6 A;  1ILQ A;  3D6C A;  2HCC A;  2AQ3 B;  1NR2 A;  4G4K A;  5DM7 3;  5KYI A;  1BO0 A;  4OIK A;  5CR3 A;  2D2C C;  3VYR A;  3OWE B;  1KAA A;  4I65 A;  5LL6 S;  1S5F D;  3VYT A;  4IUQ A;  3D6W A;  1CA6 A;  2G9H D;  3ONA B;  1AZQ A;  2K28 A;  2KQ3 A;  3H0G B;  1NR4 A;  3Q23 A;  4CJ1 B;  2K32 A;  4KD3 A;  2RKS A;  5COR A;  5LL6 X;  3KK7 A;  1GXD C;  5K36 G;  1JIC A;  2D9U A;  1RKN A;  2O4X A;  3PMF A;  4YIJ A;  4C1N I;  4C3J B;  3K59 A;  1A3U A;  1VDZ A;  5JVH 3;  4WFN 3;  2E2I B;  1GUS A;  4PNY A;  2MP1 A;  2A74 C;  1WD1 A;  3R2T A;  4NMZ A;  3S9W A;  1PFN A;  3OMG A;  1IHZ A;  3KLS X;  1Q1E A;  1D5Z C;  1Y8P B;  1SNP A;  1Q8I A;  3CRL C;  5K36 H;  4IFD I;  1TII D;  2WB1 B;  3C1E A;  1EY8 A;  3K5L A;  4FNF A;  5NUC A;  1ENA A;  2I46 A;  5T1I A;  1LAC A;  1LLR D;  1OXT A;  2RQX A;  1ICW A;  5D3I B;  3EVQ A;  3G6J B;  1HHV A;  1RD9 D;  4IUV A;  2HCI A;  4CGY B;  2JA6 B;  4U68 A;  3NTK A;  1ONL A;  3PUW A;  4QB4 A;  2E2D C;  1FD7 D;  3HOW B;  4CJ2 C;  2J4X A;  3M7N A;  1SND A;  2EDG A;  1OXS C;  3J7A F;  1H9K A;  1ROD A;  3MA2 B;  3MC0 B;  2B2U C;  2CQA A;  1QE6 A;  2D5D A;  4ZQ3 A;  5IGE A;  4FF1 A;  5IT9 L;  1FNV A;  4O1N A;  1F77 A;  5M9O A;  3F2U A;  2F4I A;  4OO1 I;  1TY2 A;  1TWG B;  1EWH A;  1BDO A;  3NWS A;  2EOT A;  3MXP A;  5CYU A;  1GHJ A;  3U9S A;  5A2Q E;  4H13 C;  1AFP A;  2RBM A;  2CW0 C;  2B2W C;  1X3P A;  3PO2 B;  1IYU A;  1ZXT A;  5CMD A;  3VR3 A;  3I4L A;  4IQZ A;  4OGQ C;  2ENB A;  1H9R A;  5J22 A;  2HUG A;  2E2J B;  4ZAI A;  2F0N A;  1STB A;  4ZYS A;  3T56 B;  5IT9 E;  1AW7 A;  4AYB B;  3KF8 A;  4QCL A;  3GTG B;  2JE6 I;  2OEO A;  3RLF A;  2K5Q A;  2WAC A;  2EJF C;  3WDN A;  3V05 A;  2J0T D;  1PDQ A;  4R8I A;  1ML0 D;  1SYC A;  4C56 C;  3DXJ C;  2F0S A;  4A3J B;  1E0B A;  3NPP A;  3VYS A;  2KEC A;  1PRT F;  4U67 3;  2KOL A;  1SYG A;  1PZI D;  3H91 A;  5KND A;  1V1P A;  2NVY B;  3P20 A;  3FMC A;  4KI0 A;  4ABN A;  1RTN A;  3HRZ C;  1EZ8 A;  5IGD A;  4UDU C;  4FXD A;  3LWE A;  1KTK A;  1DOL A;  2BOS A;  3M7G A;  1STG A;  4KHV A;  5TSS A;  3WOF A;  5D3D A;  5IOC A;  2F0T A;  1SNC A;  2NTS A;  3SHL A;  4XQJ A;  3X3M A;  4BS9 A;  1LV9 A;  2M2L A;  2KCN A;  2QDB A;  1AZP A;  2EY5 A;  1CFM A;  1WTX A;  4DXG A;  2PW7 A;  1CZW A;  3QJY A;  1Q12 A;  3TSS A;  2HDL A;  5I2X A;  5C0X I;  4RGO S;  4EQO A;  4K6L A;  5C5L A;  4TSS A;  3MVV A;  3TZD A;  5KNB A;  4B9W A;  1Q3L A;  4RAU C;  1HQM C;  3VR5 A;  4FVM A;  1HUM A;  3QO2 A;  5EPJ A;  1GUN A;  3HKZ B;  5EQ0 A;  5JAV A;  4WRD A;  3DHQ A;  4ZLT F;  4XQQ A;  1A2T A;  2B2T A;  1E2W A;  5FKA C;  1UAP A;  1W6K A;  3OHX C;  4QF4 A;  2N88 A;  1BF4 A;  2SNM A;  1B4O A;  5JJZ A;  2E76 C;  1K8O A;  1EOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...