1Y69U

Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
84
structure length
84
Chain Sequence
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFALSDGKVVFINKGKGARFISIEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title X-ray crystallography on ribosome recycling: mechanism of binding and action of RRF on the 50S ribosomal subunit
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 7
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1y69U01
1IYVA 2IT1A 1OXVA 3T51B 1A6XA 3OW7A 2Q8IB 1TKWB 1B9MA 1V43A 1IW7D 2A6HC 2O5JC 2CW0C 4HR7B 1LACA 4G7HC 1GHKA 2E74C 1H9KA 4I7ZC 3VR3A 2YYZA 5C0XH 3D4RA 5C0XG 5BN3A 1E2WA 2D5DA 1GUSA 3EQLC 4DK1A 3U9SA 4H13C 4XTCS 2PCFB 1E2VA 1K8OA 1GUOA 1K8MA 1GUNA 3TZUA 3RLFA 1Q1BA 3SDZA 1VCIA 1CI3M 1OXXK 1T5EA 3LWUA 2D2CC 2KCCA 2ZT9C 3H94A 1V8QA 1ZYRC 4JBWA 2EVBA 3PUWA 3M7NA 3HGBA 1H9RA 3GQBA 2O5IC 3KLRA 2K32A 2AWOA 2DNCA 3A8KE 2LMCB 1CFMA 2A68D 2BDOA 1SMYC 1GJXA 1H9JA 3ND9A 1Z7TA 1H9MA 4KKTA 4L8JA 3WDNA 2NN6H 2R6GA 2NN6G 3IFTA 1IYUA 1OXTA 1EWHA 1H9SB 4XIGS 3VR4A 2PPBC 3D31A 1DD2A 4GZYC 1CTMA 1I6VC 1H9SA 2A69D 3BG3A 4H44C 4BA2I 3T56B 1Q1EA 2AUKA 4OGQC 4DNRB 3QJYA 1PMRA 2QF7A 2DNEA 3A7LA 1Y8OB 4JK1C 3M85A 4KKUA 1HTPA 3VA7A 4KN4C 5JEAG 3DXJC 2BA0A 3VR5A 2JEBI 4BA1I 1ZKOA 3N6RA 4TKOB 5BN4A 3A8JE 1GUGA 1Q90A 3L7ZC 1O7LA 2BE5C 1YNJC 2B8FA 4KI0A 1VF7A 3FPPA 2NN6I 1O78A 2KA7A 3PUYA 4KHZA 5KNDA 4G7OC 5KNCA 1BDOA 1TU2B 2K7VA 1Y8PB 4KKSA 4KN7C 3I4LA 5BN5A 3VR6A 2A6HD 2JE6I 2A6EC 3AB9A 4DK0A 3M4YA 1OXSC 1Q12A 3SE0A 3T53B 1HCZA 2EDGA 3A7AB 3OPOA 3QG1A 4IFDG 1QJOA 2AUJD 2V4DA 3QIAA 2JXMB 3CRLC 1Z6HA 3FMCA 1ONLA 2EJGC 2E76C 4RCNA 1OXUA 3GD7A 2BA1A 3MXUA 3I72A 5JEAH 4KMUC 2A68C 4G7ZC 1DXMA 2EJFC 2D62A 3CRKC 4LJZC 1IW7C 3MFYA 3ND8A 3VR2A 1HPCA 3PV0A 4PV1C 1HQMC 3LNNA 4DNTB 1E2ZA 1FYCA 1GHJA 5K36G 5K36H 3PUZA 3P20A 2EJMA 3IKJA 1GUTA 1G291 2A69C 1LABA 2BE5D 3OOCA 2F1MA 3PUXA 4LK1C 3PUVA 3BDOA 3W3AA 1DCZA 3NE5B 2PNRC 4IFDH 2A6ED 4H0LC 1Y69U 1Y8NB 1VF5C 1YNNC 4TQUS 1B9NA 4OO1H 2E75C 2DN8A 3A8IE 5A35A 4OO1G 4IQZA 1FR3A 2K33A 2B8GA 2L5TA 2JEAI 1VDZA 5KNBA 3I73A
chains in the Genus database with same CATH superfamily
3S2HH 1D2BA 1XPUA 3J81i 2EY5A 2XWBB 5CV7A 1GUWA 1IKLA 3P7JA 1V43A 5D3DA 1X3QA 3JAML 1WTRA 1Y1VG 2NWGA 1PFNA 2K52A 2Z0SA 2UUCL 2DY7A 1NUCA 2B2WC 4H13C 3IAYA 3PQIA 3L0OA 3HOXG 1HFNA 4J15A 1K8MA 3UE1A 3DUZA 1N32L 4A3GG 1SN8A 1PTOH 2ZJPA 3M7GA 1STNA 1ZYRC 2XRQD 2EVBA 4ODGA 5FJ8G 3FP9A 1WD1A 3A0JA 1GJXA 3F8TA 1H9JA 3S15H 3D6WA 4C3HG 1NE3A 4IUTA 1SSOA 2JA7H 5M5WB 4GNXB 3V2TA 2AQ2B 3T56B 2WFWA 4L5SA 1MGSA 4WJ4A 3J7ZC 3RUZA 2QF7A 1WTWA 2OTJA 2GVBA 3KYHC 4XYOA 2D0PA 2EYMA 1JWMD 4RCOA 2WKCA 5T1GA 3GTPH 1VQLA 1SYGA 3WWVA 1I4PA 1SMXA 2P5ZX 3PUYA 4RA8A 5I6YA 1IL8A 3K8AA 1STEA 1UEAB 4YWMA 3J7A5 3VR6A 4A3IB 3AU7A 2N88A 1YITA 1LTLA 3OYYA 3QOJA 1IBKL 4JVZA 4HCSA 3UDXA 2BA1A 4G7ZC 3ICEA 1BXTA 2D62A 2NYZD 1QB5D 2K5VA 2KHSA 3NBIA 3W5OA 1I4GA 1STGA 1MHWC 1JB3A 4CKCA 5E7NA 4YY3Q 2QW7A 1L1OC 1O7IA 2IX0A 3G6JB 1I94L 4E6IA 4WORA 3JAME 3NE5B 3NEMA 2PNRC 4PMCA 4CDEC 4AQYQ 4JCVE 4AIMA 1YNNC 4A93H 3S16B 5KGUA 2K04A 3OWEB 2F0HA 1LTAD 4WRDA 1SYDA 4I7AA 4NXML 3OW7A 1WD0A 1A15A 1X9NA 3TZDA 3M3YH 1TS3A 2D5DA 3ERQA 3E0JA 3GTMB 1IZ6A 4O42A 3TBIB 3I4MG 4B3RQ 3PO3G 3MFGA 1E2VA 3T13A 1KDAA 2UUAQ 5C44H 5FK9C 3I56A 1PZJD 2TMPA 1EUJA 2B2TA 4LF9L 5AJ3Q 4DR6L 1EQQA 2X69A 4JW0A 1K8AC 1PFSA 1QCBD 3FDTA 2VB2X 4C3JB 5HURA 1FGUA 3M7NA 1G51A 2KVMA 4DAYA 2K32A 3D3RA 2OTLA 1PXUA 4H02A 4L8JA 5I2XA 1L0WA 5JOBA 1IYUA 2N78A 4J1MA 2JA7G 1U4MA 4JI5L 1XTCD 3K81C 2UUBQ 3HOXB 2BH8A 3M4PA 4A3GB 5IYDH 3KBGA 1FD7D 5IIFA 1BCPD 2R93H 4GLXA 1X65A 1YHAA 2MGSA 5IWAQ 1YBYA 3T1HL 1ZYRD 3CPFA 5G3LD 5DAUA 2AKWB 5C4ZA 1SXTA 4V190 1E0BA 4OONA 2JA8B 4K8IA 1G6PA 4LFCQ 3VDYA 4TVAB 2EDGA 1FNVA 2MQHA 3FKIH 3NQTA 3SK5A 1IXRA 1NMGA 3GDEA 5D14A 1N9WA 4GLVB 2R92G 4DV5Q 3HKZE 2E2IB 1WTOA 2ALYB 1G2TA 3HP3A 3I70A 3GV6A 3MXUA 4G4KA 2FINB 5JEAH 5FOBB 2A68C 1EQRA 1XMOL 4TSSA 1XX8A 3W1GA 2Y0SG 5IYCH 1W3SA 1RD9D 3CU7A 5C3WA 1VQNA 1F2MA 1S5BD 4RMFA 4FDBA 3CCMA 2Z6KC 4HCEA 2X6LA 4A93G 4UPAA 2XSCA 5JVH3 1BBXC 3DWQA 1FR3A 3D4DA 1Y1WH 1A3TA 3RN2A 2HHHQ 3C2PA 4Y7NH 1XMQL 1KABA 2B2UA 1ML0D 4N9TA 2Q8IB 1S3OA 3G6EA 3LGJA 1Q3LA 4HR7B 1P8LA 3VR3A 4JI3L 4A3LH 3H3VC 4QIWB 3F2CA 3F2DA 4IFDI 2CQAA 2ZTDA 4OWTB 5C4JB 2L0CA 2PCFB 3J7YW 4G57A 1KDBA 3K5NA 1GUNA 4KHVA 3ONAB 1Z9FA 1RTNA 1SNMA 1MBYA 2HQEA 1YNND 2LKVA 2O2LD 3S2HB 3UDIA 3CD6A 4DV1Q 3VA5A 3HFZB 3RZDH 1KIXA 1H9RA 5IP7H 1YZ6A 1F9SA 5CV8A 4FXKC 1J5EQ 2UXBQ 1SNPA 5C0XI 4N9PA 3P75A 1STHA 4HTHA 5DNFA 4B3TL 2N49A 3H15A 2NN6H 1BCPB 1QE6A 3PO3B 1I6VC 3MXPA 2UU9Q 5GADC 4ILWA 4U673 4J8QA 2RDGA 4OIKA 3KDFB 5BR8Q 1PTOB 3DXJC 2JEBI 1HTLD 5I9OA 1I4HA 2R93G 3OMCA 2NZHA 1HR0Q 3MXGA 1E1OA 5C4XH 2F3IA 4DUYL 4PZ7A 1VF7A 2KA7A 3S15B 1QILA 4WJ3M 3RZOH 1GVPA 2ZXRA 3DEPA 4KN7C 1L0YB 2JA7B 2ZXOA 3KJOA 4C3IH 1JMCA 3URYA 1WTVA 4DGZA 1HCZA 4DV3Q 1FNWA 3FKIG 1QJOA 4DR7L 4JC0A 1VQ5A 5EPJA 3L2PA 1OXUA 1E7ZA 3U58A 3KF6B 3GTPB 2EIFA 1R4PB 2I46A 1AE2A 3VYUA 3CMAA 4PV1C 1ASYA 1HQMC 1VMCA 2F0UA 5LMUL 1VQ6A 3OTOQ 1G291 1IL2A 2A69C 4K0KL 3OOCA 3OMGA 4U68A 3GTQH 4WFN3 3E9HA 4HAEA 2KBNA 2R92B 2DN8A 3A8IE 5IP9H 4YWLA 2FXQA 2PI2A 4FYDA 3PMFA 5JJZA 3OHXC 4HJAA 1ET9A 4DUZL 2F0QA 4UP8A 4QJFA 4ZQ3A 1BVSA 3E6ZX 3K59A 1SYEA 1AFPA 5CORA 2Y0SB 4IPHA 1A0IA 1N33L 1CSPA 3A55A 1H9KA 3HOVH 1VQKA 5CGKA 2OWOA 1EOVA 3QOLA 2F52A 3E0EA 2JA6G 2MHVA 4ZLTF 1EYDA 5ELFA 4DR3Q 4A93B 4LF4L 4DR4Q 1LTRD 1C48A 2E5LQ 4R4OA 1IBLL 1O80A 2AQ3B 2I0QA 2NUCA 1CA6A 4RGOS 3TP5A 4HIOA 4BS9A 3M3YB 3I3CA 3ND9A 3ULPA 4HJ8A 4ZUIA 2OXPA 2A1AA 2NN6G 4CKEA 1DYQA 4K2KA 5CC4A 3T1YL 4H44C 4F88A 4PQXA 1XWEA 1LT6D 5I4DA 4DXGA 4JI1Q 5EQ0A 1FL0A 4X66L 2VQFL 1LYLA 1PFBA 3IL8A 2F0JA 3MEFA 1HH2P 3HOWG 4XQQA 3DHQA 3KFUA 1HNWL 4P71A 5C4XG 4X6AH 3CCRA 1QUQA 2MPMA 2F0EA 4LWCA 1KTKA 1GO3E 3KK7A 4QUCA 1UE5A 5D3IB 1EU3A 2Q2HA 3UI2A 1SRUA 1O7ZA 3CAMA 4GN3B 1Z6HA 1ONLA 4C1NI 1HNXL 2E76C 4O1NA 5JPNC 1NR4A 3C1FA 2R93B 3BZDB 3Q8DA 4HSVA 4KMUC 4BBRH 1IW7C 3ND8A 2PNHA 2JP1A 2R7ZH 3PUZA 5C3EG 2WB1E 4JI6L 3QWNA 1L0XB 1LT3D 3PUXA 3WOFA 3HOUH 2JQOA 1IBKQ 3FKIB 2D9UA 1VQIA 3EVQA 4YIJA 3H6MA 3EBEA 4RG1A 3FEWX 1K83H 5IP9G 2NVQH 3I4NH 2A8VA 2CQOA 3W1BA 4HIMA 4JI4Q 3MTSA 4CJ2C 3T51B 2K6AA 3KF6A 5J22A 1NBWA 1JICA 2C35B 1BO0A 4G7HC 2LS01 5M5XH 1LO5D 4I7ZC 3HOVG 4GS3A 4MIUA 5EAYA 3CCSA 4XTCS 4OL7A 2IY5B 3J80E 1EFWA 2IX3A 1S5FD 3I8ZA 4NPSA 2MJ8A 3LWUA 3FPUB 1Y1WB 2RVLA 4Y7NB 3SVMA 1DM0B 3PUWA 1NJIC 3HGBA 4ME5A 1SAPA 1QZHA 1L1OA 3K57A 1CFMA 1SMYC 2PMZB 2BCOA 1XTDA 3G7LA 5EKIA 4ZK9B 1Y1VH 1TWHH 2VS1A 4A3KH 2OCEA 2PPBC 5FO9B 1STAA 4FP5D 3BG3A 2FJ2A 3DM1A 1V1PB 2JN4A 1TS5A 1Y8OB 1TS4A 2UXDL 1G6ZA 4A3GH 1SYCA 1WJJA 4DV4Q 1TWGH 4DR5Q 3RZDB 1TR5A 5C3XA 1GUGA 2B2YC 5FJ8H 4KI0A 4KHZA 3QO2A 5LMNQ 4QMGA 5DLQE 2K7VA 2OQKA 1JT8A 5FLMG 4C3HH 4HIDA 3PSIA 3NELA 4JV5L 1Q12A 4IZ8A 5M5YH 3CCQA 4S3SA 2VNUD 1PA6A 3CW2C 4PMWA 2F4VQ 2E2IH 3EA6A 2DGYA 2F0WA 5C4XB 5K36H 4EX5A 1IBMQ 2R7ZG 3IKJA 4LNQA 3MXNB 2QDBA 2X6GA 5EBDA 3LWEA 4C3IB 1OO9B 1VQPA 1D7QA 1CHPD 2F0LA 2F3VA 4KD3A 4ZKBB 1E3PA 2L12A 3W3AA 1VQAA 1XPOA 2C9OA 4R4CA 4OO1H 3I4NG 4R4TA 2A5HA 4CDFC 2QEJC 1FGBD 4B3ML 3GTGH 1VQJA 5ELNA 2BOSA 2NBFA 1A2TA 5I9PA 2B63G 2WAQE 1EY9A 2N55A 2IT1A 4JI2Q 2PO4A 4YCVA 2JSOA 1B2TA 1IW7D 4DK6C 4JI8L 2EXDA 3D4RA 3GTQB 1JJGA 1EIGA 3HOYG 2YU9H 4A3EG 4OHJA 4DAPA 3TZUA 1HZ9A 1VQDA 3GTOH 4PZ6A 3HKSA 4DF7A 1UE6A 2F0GA 1ENFA 5I2YA 2UXCL 4F7XA 4DAYB 2O5IC 2MP1A 4DV7L 4OX9L 3KLRA 5KYLA 1PV4A 1X32A 3HOVB 2L9HA 3PF4A 3HEJA 2Z6KA 5ELDA 4A3KG 1SFOH 3TQYA 4IALA 5IGGA 4B3SQ 3I4MH 4JYAL 1LTID 3PO3H 1B4OA 2F0OA 2K28A 2AUKA 3LX0A 3CQZH 4OWXB 2N8NA 1QOHA 4F8MA 3A7LA 1IHZA 4K5VA 1LTGD 1RJTA 1PZID 2HDLA 5JJIA 1E1TA 1LT5D 1XYIA 3GTKH 1K0SA 2EQSA 4FF4A 1JWUD 2BE5C 4FNFA 3SEBA 3QR8A 2L11A 5CV6A 4K5WA 3MC0B 3CCUA 1SMYD 1SEBD 1YHBA 3PF5A 4XQJA 1TY0A 2YTYA 4IUUA 3HKZG 4L5QA 2EE1A 1AZQA 1WOCA 2F4IA 2GVAA 1KXLA 3MHBA 1PH6A 4RCNA 1V1PA 1FJGQ 1HNZQ 2Q8TA 1T9HA 1WCMG 2QGQA 3JAMi 4DUYQ 3VR2A 3TS2A 2CKZB 2J7ZA 1E2ZA 1E22A 5JJLA 3U4ZA 5K36G 4X64L 1PH4A 2LFNA 1W6KA 3R8BA 4ALPA 1S5ED 5DM73 1M90C 4Y52H 1KNEA 1B53A 5H1SE 2AWNA 3A5UA 4XDXA 1CKOA 3RD4A 1PDQA 1KLGD 5E1FA 2PYKA 4TQUS 2R92H 4OO1G 5ELBA 4LFAL 4KHPQ 1PRTB 1MKHA 4R1JA 1HQRD 2ASBA 1JORA 3KJPA 4BBRB 2RDHA 1C9OA 5LHY1 4IO9A 3NWSA 4KV6A 3RN5A 1B50A 2Z6BA 2R7ZB 4FF1A 2ZJQA 4K0KQ 1SE8A 1Q46A 1GHKA 3HOZG 4NDXA 5BN3A 3MXNA 3U9SA 3HOUB 1XPRA 4GKKQ 4JI7Q 1CZGA 1QNKA 2E2HH 4KY6A 4MHEA 3HG9A 3I4NB 1K83B 3BS1A 2NVQB 4LF8L 4GOPC 1OXXK 4DR2L 2B63B 3V96A 2QDLA 2M9VA 1U4RA 2QCPX 2F0IA 2CH4A 3OW2A 4DR1Q 1VQBA 1S4ZA 5J3BA 5M5XB 3SK4A 1DGSA 2NB0A 3G48A 2R6GA 2A74C 3L9AX 4HJ9A 2OQ0A 4DV2L 1H9SA 3NK9A 4BA2I 1X3FA 1LUZA 1CKMA 3G4SA 5HY6A 4LF7Q 1IBLQ 5GQOA 4IOCA 5FKAC 5KIXA 3TS0A 2KHIA 4KN4C 3CCLA 2BH2A 4NXNQ 5EJWA 3ITPA 5M3FH 1SLJA 3BYYB 3I4OA 5GAGC 1YIJA 1NCVA 4GKJL 1L2FA 2NN6I 3BJUA 1PZKD 1BDOA 3J81j 1Y1VB 1TWHB 4IN3A 4A3KB 2CCZA 4RFBA 2CWAA 3AB9A 2ZM6Q 3M4YA 4X62Q 4FVMA 2VQFQ 4HIKA 2K01A 4R4QA 5JPMC 2NTSA 3CRLC 5EPKA 1CKNA 3A5ZB 2LXJA 1TXYA 3GD7A 1KD1C 1K28A 1TWGB 2SDFA 3KOJA 2VUMG 4JPBW 1HRJA 4ZCKA 1W2BA 3D8GA 4DNTB 2AHOB 2J0TD 1GHJA 1ZXTA 3N52A 5IGEA 1J6QA 3P20A 4BY1G 2MNAA 2BE5D 3I91A 4GN4B 3B6YA 4C3HB 2F1MA 4RGMA 4UAIA 4LF5Q 3A56A 4BWGB 1Q7YC 3S1NH 1KHIA 2PW7A 3BDOA 3HKZB 5M5YB 1HNXQ 3T4AC 1KRTA 4DXFA 3DWPA 5CV5A 1JOKA 2RCNA 3OIQA 2L5TA 5KNBA 4X65Q 5KEEA 4JBKA 1U4PA 1KDCA 1NMFA 1VQEA 5CV9A 4CJ1B 5IT9c 1N36L 3K58A 3P1HA 1WYDA 4FO2A 3VYTA 3C3LA 1MSHA 2IPKD 1X6OA 1WI5A 2M2LA 4LUVA 1EOTA 4JI0Q 3GTGB 2EYFA 2EYOA 2NVYH 2VW9A 3H3VH 4X3KA 2SNMA 2DNCA 2KUMA 3M4OH 3HS0C 1SYFA 2RCFA 3J80c 4AH6A 3AQQA 2K4KA 4LFBQ 2PZWA 1ASZA 1NR2A 3CPWA 1HXYD 2YU9B 4GZYC 2VQEL 4MNOA 2JA6H 1ESRA 4K5XA 1I6HH 1Q1EA 3FRPB 4IUPA 4LW1A 1U5KA 3GTOB 1PH8A 4LF6L 2CH4W 3M85A 2KCNA 3D0FA 1EIHA 5M3FG 3AEVA 3TSSA 1NSNS 3VR5A 1QUQB 2DJGC 1VQMA 4R8NA 5EBCA 4HJ7A 2K5WA 1SFOB 3I4MB 3CHBD 4RHSA 4EQOA 1C7YA 3QG1A 3OPOA 1K8GA 3CQZB 2G5DA 3BZCA 1YJ9A 3S9WA 3CMEA 1BKBA 4A76A 3MVVA 3HOWH 4HEDA 3GTKB 3MFYA 1RIPA 2R7DA 3PV0A 2WB1G 1A8VA 4BY7G 1QWYA 3GO5A 4JV5Q 1BR9A 4DV6Q 2K05A 4P74A 4QB4A 4EVOA 1Y69U 1EQVA 2KEEA 1XNRQ 1SNDA 2B2YA 1VDZA 4KJOA 5JAVA 4DV0L 3I73A 5GAHC 1RKNA 1IYVA 1A6XA 1D5XC 2JA5H 4RH6A 4BY1B 2A6HC 3K5OA 5E4WC 1D6EC 5C3EH 1TVXA 3GTJH 1HFGA 4A3BG 3HZXA 2KCMA 3EQLC 1BF4A 1SE2A 3R3OA 5ELCA 1V1QA 3AFPA 4EQ5A 1PYWD 3SDZA 3ZJYC 2WKDA 4OELB 1HZCA 3GV3A 2MUYA 1X54A 2ZT9C 3CCEA 1V8QA 5E4XA 3F2BA 1L1OB 1JJCB 4R9WA 2KJXA 1K3RA 2LMCB 2A68D 2BDOA 1OTCA 1PTOF 1Z7TA 1A3VA 3OSOA 3WDNA 3BDCA 3NTIA 4XXEA 4YY3L 5LL6S 5IT9L 1EIYB 1CTMA 2J4XA 4B08A 2E2HB 2WINB 4HJ5A 1JC7A 4YHHQ 4KJNA 4AQYL 2DNEA 2EY2A 3S1QH 3R2TA 4IOAA 1YVCA 2KHJA 1C0AA 1W6JA 1II3A 1CA5A 2ICEC 3BVZA 1KLUD 5IY0A 2UUCQ 2MO0A 2JE6I 3H0GH 3J80L 1H95A 1AH9A 1OXSC 2CVRA 2G9HD 3A7AB 4AYBG 1LM0A 2AUJD 1B7YB 1N32Q 4XYQA 4BBSH 2UUAL 1EYGA 1MSGA 2RHQB 3I55A 3DEOA 1N34L 1UE7A 5M3FB 3PIP3 2Z4IA 1SNOA 3ULLA 2QKIC 3OIPA 2XIWA 1FYCA 1CQVA 1M4VA 4K6DA 1TWCB 5CR3A 1EY6A 4BXXG 2B2WA 3K0YA 2NVXH 5FLMH 1GM5A 2Z1CA 3RLNA 2SOBA 4H0LC 2UUBL 2K75A 1XNQL 1D5MC 4UDUC 1SDFA 2WAQG 3FHWA 4PNYA 1I3QH 4CDDC 4GNXC 3L3OC 1S40A 2SNSA 1F2LA 1VQ8A 2WB1B 3PCOB 5FO7B 1LV9A 3A54A 5IWAL 3J80i 4LAAA 4A3JH 2JA5G 3GTLH 5IGCA 1LLRD 2KCTA 4NKLA 3S1NB 3EN2A 4OO1I 4LFCL 2K5NA 4LFAQ 1GUOA 2Z4HA 2GA4B 3I2ZA 5IE8A 1PH1A 3EIVA 5IT9E 3RLFA 1LTTD 2WIIB 4X3TA 2XRSD 4DV5L 1ET6A 5GROA 4XQNA 2KENA 4M8AA 2EY6A 4EGVA 3PIO3 2B63H 1JB7A 1YJWA 1PYBA 1KRSA 2NZ1D 2H1EA 2B2UC 1I94Q 4A3BB 3CCJA 3ULJA 3CCVA 1YEZA 5EGTA 2A69D 2A19A 3WOEA 1UAPA 2NTTA 3HOYH 4A3EH 1TIID 2KEDA 4JK1C 2TSSA 3IFDA 1C4QA 4P73A 2NVYB 4NXMQ 2PQEA 3BVMA 1ENCA 2HHHL 2F0SA 1O7LA 3M4OB 2QILA 5KRUA 4Z9CB 5CBAE 1V9PA 2F3WA 2SEBD 3H0GG 4LUOA 3K5LA 2JA6B 3T53B 1I6HB 4GOPA 3SK6A 4IFDG 1EEID 1LTSD 2WP8J 3KUPA 4PG3A 1VQCA 2AQ1B 4LF9Q 4DR6Q 4BBSG 2XN9C 1EY0A 3DM3A 2PQAA 1AZPA 4DFAA 4C1NK 2IHEA 1A3UA 3CRKC 4OEMB 2HDMA 4DV1L 1J5EL 4NMZA 3KLWA 2UXBL 1LABA 1CM9A 4JI5Q 4C2MB 5CV4A 1AW7A 5DM63 3U9OA 2UU9L 1JR0D 3A74A 3RMHA 2RQXA 3H09A 4HSPA 2ENBA 4AYBE 3R2IA 3HOWB 3RR5A 1HA6A 2O4XA 3T1HQ 1WCMH 1RL2A 3S14H 1CQFA 2F0MA 1HR0L 2OF1A 4A3JG 2CW0C 2FFKB 2DY8A 2E74C 1CUKA 2ZTEA 1EZ8A 2IW3A 4DV3L 5J39A 4YCUA 3W2DA 2WAQB 4A3MH 4A3FH 3K80C 4L63B 1XMOQ 2ATWA 1ILPA 1B44D 4RGNA 2JA5B 1ICFB 1SROA 4ME3A 5C3EB 1B70B 3GTJB 3FVQA 3OTOL 1YHQA 4IFDJ 3HOZH 1H9SB 2I5LX 2RBMA 1DD2A 3D31A 4A3DH 3F2UA 3TRZA 2JA9A 1FNUA 1HJPA 2G9DA 4O0AA 5I6WA 4DPGA 1DONA 3EROA 4IUVA 3K6OA 1DOLA 3QB3A 4JOIC 1XMQQ 2BA0A 1IYJB 3NENA 1AP0A 5LL6X 5BN4A 3A8JE 1QNUA 4UP7A 2IJ0A 5C0XJ 2EY1A 3L7ZC 4N8X1 1DZ1A 1SNQA 4G7OC 4JI3Q 2B39A 4DKAC 3S24A 1QVCA 4UY8C 1TT2A 4KKSA 1AN8A 2GN5A 4EQNA 1EY5A 3V05A 2IWHA 5BN5A 3O13A 3CC2A 2RHSB 4UP9A 4OXPA 4R4IA 5NUCA 4POGA 2CFMA 4GLAC 1SBBB 2V4DA 1BOSA 2JXMB 1K0RA 4F87A 1CKNB 4DR3L 1G8ZD 3S1QB 1I4XA 4DR4L 3SXHA 1MD2D 2E5LL 1VQFA 3U50C 4C3JG 3TREA 1F9RA 2Q2TA 3CC7A 1HZBA 4XT3B 3LNNA 3NPPA 1SNCA 1K3BC 4B3TQ 3NTKA 3MZ5A 2LY7A 1R9TB 3UDFA 1BNZA 3S1RH 4P72A 2IHFA 3J7AF 3H0GB 1M1KC 2VXWA 3BDLA 1TQOA 5E3FA 1B9NA 1BCPC 4KD4A 4CGYB 1QZGA 1PH2A 1KL9A 4BBSB 4JI1L 4IQZA 2R7FA 2F0DA 5EPLA 2JEAI 3S1MH 1S72A 1G91A 3KF8B 1QVFA 1PH3A 1OXVA 2VL6A 2VUMH 4DAVA 1TKWB 1VS0A 1NTGA 1PTOC 1PHJA 5IGFA 4BY1H 2NVXB 1CZWA 1Q81C 2JA8G 1U0LA 4CHTB 2FMMA 2R3ZA 1AEXA 3J81E 4POFA 4DR7Q 2K5DA 4K6LA 1K8OA 3PGZA 3EJIA 3NBHA 1JE4A 4DV0Q 4A3MG 1I3QB 1TWAH 1T5EA 4A3FG 2V1CC 4R8IA 3TEHB 1GKHA 4NB3A 5LMUQ 2RKSA 1EY7A 3K7UC 3GTLB 4A3JB 2L55A 1SJHD 1H9MA 1Z47A 5ELEA 2F03A 4V0BA 1B3AA 2CW0D 1J9OA 2B3GA 3ERSX 2CWPA 1ILQA 3BU2A 4A3DG 2HQLA 5IGBA 1YI2A 4DNRB 3QJYA 2F0VA 1PMRA 4XT1B 4DUZQ 3H3VI 1CSQA 3TP8A 1T5XD 1ZKOA 3MEHA 2E8GA 5AFWA 4JI4L 4JBJA 5ELOA 3TP6A 5C4HA 3K5MA 1YNJC 4JBMA 1N33Q 1LT4D 1K9MC 2VZAA 4YCWA 5CMDA 1RDPD 2RSOA 4HMIA 4HN7A 4UHVA 1O7YA 4NW2A 3I4LA 4IJHA 1DJRD 5HGQA 3RLOA 1A62A 4DK0A 3SE0A 4A3EB 3HOYB 4LF4Q 2NZOA 1EYAA 1VQ4A 5T1IA 1VQOA 1EFID 2Q8RE 1DXMA 4IURA 4LJZC 5A2QL 1STYA 3NWTA 3CXCA 1M8AA 3CC4A 1PRTF 1F9PA 3T1YQ 4APVA 4A4IA 1TWCH 1DOMA 3IRBA 2H5XA 1AE3A 3AYHB 4X66Q 1VF5C 1N34Q 3AFQA 2HCIA 4B9XA 4QCLA 1TWFH 5M9OA 4FXDA 1HNWQ 3SGIA 4DV4L 4CJ0B 4DR5L 1QG7A 1NNXA 3BVGA 1EZ6A 2F0FA 4K2LA 4RKLA 4BY7H 4ID6A 5LMNL 1PVOA 3VYRA 3OWFA 1XNQQ 4O2DA 2E2DC 1S5DD 1X55A 3PIPA 3D6CA 5CYUA 1F77A 2D2CC 4ZUJA 4CDCC 2F4VL 1Q82C 2F0KA 1WCMB 2IL8A 1CK1A 3S14B 2EYJA 3KF8A 3A8KE 2AWOA 5JJKA 4JI6Q 1D8LA 2OT2A 1IBML 1EL0A 1NAPA 1PTOD 5GAEC 3BZKA 1OXTA 4A3BH 5CBEE 2D0OA 1PH7A 1SE4A 2B2VC 5IODA 2Q2IA 2RF4A 1RHPA 4GNXA 3HRZC 1GOZA 5IOCA 4A3MB 1I50H 2Z8LA 3ER0A 3KLSA 2PI2E 4A3FB 3PO2H 4ZKCB 3S17H 2ZJRA 1UEBA 2HUGA 1WTXA 1RCVD 4JI2L 2OEOA 4GN5A 4L5TA 1KNAA 2EYPA 5A2QE 4A3CH 3HOZB 2YTXA 1Y8PB 2MO1A 4A3DB 2A6EC 2I5HA 3SK8A 2ICIA 1I4RA 4P75A 5COYA 2PZUA 1HHVA 3PIOA 2YV5A 3NSWA 1IKMA 4ZYSA 3S2DH 1BBWA 2VB3X 4PMBA 2KECA 1EY8A 3STBC 4RAUC 1MJEA 1YNJD 4KY5A 4LK1C 1JE5A 4OIJA 3E9IA 2L1BA 3BYTB 1PFMA 3C46A 4IUNA 4C2MH 4QIWE 1A63A 4B3SL 1VQ7A 2LSSA 5C5MA 5C44G 2UXDQ 3MA2B 2K33A 1VQ9A 1UUPA 3G71A 4QUFA 4IPGA 4QL5A 3NP8A 2NVTH 1KQSA 4QF4A 1GD7A 3S1RB 3M9BA 4BXXH 1X56A 5DEHA 3J7AV 2E2JH 1GUSA 1KAWA 1VQHA 4IJLA 1SR3A 4RHRA 4IUQA 1Q1BA 2ZTCA 4B9WA 5IYDG 3S1MB 2K1BA 3GP7A 3H94A 4KLKA 2WV6D 3JC66 3VYSA 1A2UA 2R61A 4JBWA 1HR0W 2VUMB 1FJGL 1HNZL 1RODA 1B1ZA 1SE3A 1NY4A 3DMUA 1MIUA 3DWAA 4XIGS 2KQ3A 4FF2A 2LXKA 2Q2UA 1D1KA 1JQYD 2F0PA 4LUZA 3AMUA 1EWIA 4L5RC 1Y14B 3X3NA 4B3MQ 3UE0A 4DU9A 2M00A 1BCPF 1TWAB 2ES2A 5JEAG 1X3EA 4BA1I 5FO8B 2JYOA 5EKKA 3PO2G 4KHPL 3N6RA 4TKOB 5K5PA 4QGUA 5G3LF 5L37A 4JI8Q 5IYCG 1Q8IA 5M3MH 1KAAA 1JOOA 1TU2B 3Q23A 4DA2A 4A3CG 1B8AA 1CHQD 3I90A 1F2ZA 4GOPB 2C5CA 4QQBX 4GKKL 2K03A 3QIAA 4JI7L 3U4VA 4WJWA 3K7AH 1JJ2A 2HCCA 2IX1A 2PQAB 1EQTA 2XVSA 3E3XA 4OWWB 3Q6SA 1Y1WG 1PYSB 2UXCQ 1JCKB 1R4QB 1SJED 3ZYYX 4DV7Q 4OX9Q 1BQQT 3NXWA 1DOKA 1HPCA 5FLXc 2B2TC 5TSSA 4TRDA 5KYIA 2RSNA 1GUTA 4PZ8A 5IGDA 4DR1L 4A3LG 1WFQA 1UWVA 2Y0SE 4A75A 1R9TH 2WACA 4JYAQ 1WTPA 3KLSX 4RGTA 5JVG3 1DCZA 4IFDH 2A6ED 1Y8NB 4JOIA 4B3RL 4N8FA 5A35A 2K5QA 2XWJB 5EKLA 1RTOA 4LF7L 2QA4A 1GXDC 4HMJA 2HD3A 4NXNL 5IP7G 5AJ3L 2ZXPA 5IYBH 1WTHA 4X3UA 1LACA 1PH5A 2PZTA 2KOLA 3STBD 1MJCA 5C0XH 1EY4A 5D65A 4DK1A 1JOQA 4L6TB 1U4LA 1I5FA 4IPCA 1D5ZC 4MZ9A 5M5WH 2ZM6L 4P2CB 2VY3A 4X62L 5JEAJ 1TY2A 5C44B 1BBUA 1MI2A 2MFIA 1XJVA 1TWFB 2KCCA 4YWKA 2DUDA 4MTNA 4IPDA 3Q24A 1F2YA 3J81c 4X64Q 5F2DA 3T16A 3SR1A 4K8JA 4BY7B 1P16A 3IFTA 3H91A 4H7BA 1EWHA 3VR4A 4C3IG 3Q0AA 3CKIB 4A3IH 2FHTA 4J6HA 4LF5L 4OGQC 3TN2A 4CKBA 3UDGA 4CBVA 4KKUA 3KDFA 1HTPA 3NHHA 4KY7A 4NP5A 2RA4A 1FVIA 1Q90A 4X65L 3X3MA 1ICWA 2B8FA 1G2SA 5KNDA 5M3MG 1PRTC 2K14A 2B29A 2A6HD 1Q86C 2YTVA 4DAMA 4EQPA 1PH9A 1PLFA 2HT1A 2I5MX 3K0XA 3KBXA 4LF8Q 3RNUA 1I50B 4DR2Q 3S16H 1HA5A 2EJGC 1VQGA 2AMCB 3PO2B 4JI0L 3S17B 1ENAA 3I72A 2EJFC 1EIFA 1X3PA 2EPBA 3JAMc 2EZVA 2ID0A 3E5SA 3CF5A 1KC8C 4DV2Q 1E24A 3TDQA 4LFBL 1QVGA 3GTMH 1UE1A 3TP7A 3NTHA 1RF2D 4ABNA 1SYBA 3S2DB 4KTAA 1HZAA 4Q5VA 4GKJQ 4ZRZA 4C3JH 5IYBG 1B9MA 5C6AA 3SHLA 2O5JC 1TS2A 1B3QA 1BUVT 1UNSA 5FLXL 2YYZA 5C0XG 3CP0A 3D4WA 1EU4A 1F9QA 1E2WA 2F0TA 1STBA 2PMZE 1WVLA 2XNAC 5C5LA 1U9RA 2RDFA 4AYBB 3MWYW 3NBHB 4K14A 1X3GA 3HOXH 4MTKA 2L4NA 1WTQA 2K5HA 1VCIA 1CI3M 4DN4M 1ZEQX 2DJFC 4C56C 5BR8L 1Q8KA 4M1UB 1HUMA 3DLLA 4FF3A 3GQBA 1S5CD 2NVTB 2EYLA 5LMNW 2H4OA 2HIXA 4KKTA 3I7FA 4RWSC 3NUCA 2CHBD 4MN3A 2E2JB 4Q0FA 2JA8H 4DNIA 4A3IG 4DV6L 2EXZA 2A73B 4ULLA 2F0NA 2PW5A 1N8RC 1XNRL 4LMQD 2EYHA 1YNXA 3EFXD 4BBRG 1CT1D 1J8IA 3NQIA 5J1ZA 2Z9HA 1JWSD 3Q22A 1N36Q 3FPPA 1O78A 3RZOB 5KNCA 3J81L 1ESFA 2XTIA 1XXGA 3MAQA 3HOUG 1I4QA 2EOTA 4X3SA 1V1OA 1LTBD 1YJNA 3FMCA 3F1ZA 3M4QA 2JJQA 2L15A 2XGTA 5ISRA 2HIVA 2BDNA 1EWCA 4FXGC 5M3MB 2EJMA 2B2VA 2QEXA 2FMCA 2K50A 1D1IA 4ZAIA 5HGTA 4KK7A 1PRTD 2VQEQ 1EYCA 4JG2A 1EEFD 2N3SA 3PUVA 5FLXE 2I07B 5C4JH 1HUNA 4I65A 1K73C 3K7AB 1C8CA 4DK3C 2E75C 4LF6Q 4RKBA 4YHHL 3R93A 2B8GA 1VMPA 4QY7A 3TMEA 3C1EA 3VA7A 2JK8A
chains in the Genus database with same CATH topology
1D2BA 2EY5A 2XWBB 5CV7A 1GUWA 1IKLA 3P7JA 1V43A 5D3DA 1X3QA 3JAML 1WTRA 2NWGA 1PFNA 2DY7A 1NUCA 2B2WC 4H13C 3IAYA 1HFNA 1K8MA 3DUZA 1PTOH 3M7GA 1STNA 1ZYRC 2XRQD 2EVBA 4ODGA 1WD1A 1GJXA 1H9JA 3D6WA 4C3HG 4IUTA 1SSOA 5M5WB 3V2TA 2AQ2B 3T56B 1MGSA 3RUZA 2QF7A 1WTWA 4XYOA 2EYMA 1JWMD 4RCOA 2WKCA 5T1GA 1SYGA 1I4PA 3PUYA 4RA8A 5I6YA 1IL8A 1STEA 1UEAB 3VR6A 4A3IB 3AU7A 2N88A 3QOJA 4HCSA 2BA1A 4G7ZC 1BXTA 2D62A 2NYZD 1QB5D 2KHSA 3NBIA 1STGA 1I4GA 1JB3A 4CKCA 2IX0A 3G6JB 4E6IA 4WORA 3JAME 3NE5B 4PMCA 2PNRC 1YNNC 3S16B 5KGUA 2K04A 3OWEB 2F0HA 1LTAD 4WRDA 1SYDA 3OW7A 1WD0A 1A15A 3TZDA 1TS3A 2D5DA 3ERQA 3E0JA 3GTMB 3TBIB 4O42A 3MFGA 1E2VA 3T13A 1KDAA 5FK9C 1PZJD 2TMPA 2B2TA 2X69A 1QCBD 3FDTA 2VB2X 4C3JB 5HURA 3M7NA 2KVMA 4DAYA 2K32A 3D3RA 1PXUA 4L8JA 5I2XA 5JOBA 1IYUA 4J1MA 1U4MA 1XTCD 3HOXB 4A3GB 3KBGA 1FD7D 5IIFA 1BCPD 2MGSA 1ZYRD 5G3LD 5DAUA 5C4ZA 1SXTA 4V190 1E0BA 2JA8B 4K8IA 2EDGA 1FNVA 3NQTA 3SK5A 5D14A 2E2IB 1WTOA 1G2TA 3HP3A 3I70A 3GV6A 3MXUA 4G4KA 2FINB 5JEAH 5FOBB 2A68C 4TSSA 1XX8A 1RD9D 3CU7A 5C3WA 1F2MA 1S5BD 4HCEA 2X6LA 2XSCA 5JVH3 1BBXC 3DWQA 1FR3A 3D4DA 1A3TA 3C2PA 1KABA 2B2UA 1ML0D 4N9TA 2Q8IB 1Q3LA 4HR7B 3VR3A 3H3VC 4QIWB 4IFDI 2CQAA 5C4JB 2L0CA 2PCFB 3J7YW 4G57A 1KDBA 3K5NA 1GUNA 4KHVA 3ONAB 1RTNA 1SNMA 1MBYA 2HQEA 1YNND 2LKVA 2O2LD 3S2HB 3VA5A 1H9RA 1F9SA 5CV8A 4FXKC 1SNPA 5C0XI 4N9PA 3P75A 1STHA 4HTHA 5DNFA 2NN6H 1BCPB 1QE6A 3PO3B 1I6VC 3MXPA 4ILWA 4U673 4J8QA 2RDGA 4OIKA 1PTOB 3DXJC 2JEBI 1HTLD 5I9OA 1I4HA 3OMCA 3MXGA 1VF7A 2KA7A 3S15B 1QILA 2ZXRA 3DEPA 4KN7C 1L0YB 2JA7B 2ZXOA 3URYA 1WTVA 4DGZA 1HCZA 1FNWA 1QJOA 5EPJA 1OXUA 3GTPB 1R4PB 2I46A 3VYUA 4PV1C 1HQMC 1VMCA 2F0UA 1G291 2A69C 3OOCA 3OMGA 4U68A 4WFN3 4HAEA 2R92B 2DN8A 3A8IE 4FYDA 3PMFA 5JJZA 3OHXC 1ET9A 2F0QA 4ZQ3A 3K59A 3E6ZX 1SYEA 1AFPA 5CORA 2Y0SB 3A55A 1H9KA 5CGKA 3QOLA 2MHVA 4ZLTF 1EYDA 5ELFA 4A93B 1LTRD 1C48A 1O80A 2AQ3B 2NUCA 1CA6A 4RGOS 3TP5A 4BS9A 3M3YB 3I3CA 3ND9A 4ZUIA 2OXPA 5CC4A 4CKEA 2NN6G 1DYQA 4K2KA 4H44C 4F88A 4PQXA 1XWEA 1LT6D 5I4DA 4DXGA 5EQ0A 1PFBA 3IL8A 2F0JA 4XQQA 3DHQA 2MPMA 2F0EA 1KTKA 3KK7A 4QUCA 5D3IB 1EU3A 3UI2A 1O7ZA 1Z6HA 1ONLA 4C1NI 2E76C 4O1NA 5JPNC 1NR4A 3C1FA 2R93B 3BZDB 4HSVA 4KMUC 1IW7C 3ND8A 2JP1A 3PUZA 3QWNA 1L0XB 1LT3D 3PUXA 3WOFA 3FKIB 2D9UA 3EVQA 4YIJA 3H6MA 3FEWX 3MTSA 4CJ2C 3T51B 2K6AA 5J22A 1JICA 1BO0A 4G7HC 2LS01 1LO5D 4I7ZC 4MIUA 4XTCS 4OL7A 3J80E 2IX3A 1S5FD 3I8ZA 2MJ8A 3LWUA 3FPUB 1Y1WB 2RVLA 4Y7NB 3SVMA 1DM0B 3PUWA 3HGBA 4ME5A 1SAPA 3K57A 1CFMA 1SMYC 2PMZB 2BCOA 3G7LA 5EKIA 4ZK9B 2PPBC 5FO9B 1STAA 4FP5D 3BG3A 2FJ2A 3DM1A 1V1PB 1TS5A 1Y8OB 1TS4A 1G6ZA 1SYCA 3RZDB 1TR5A 5C3XA 1GUGA 2B2YC 4KI0A 4KHZA 3QO2A 4QMGA 2K7VA 1Q12A 4IZ8A 4S3SA 2VNUD 4PMWA 3EA6A 2F0WA 5C4XB 5K36H 3IKJA 2QDBA 2X6GA 5EBDA 3LWEA 4C3IB 1OO9B 1CHPD 2F0LA 2F3VA 4KD3A 4ZKBB 2L12A 3W3AA 2C9OA 4OO1H 2A5HA 2QEJC 1FGBD 2BOSA 2NBFA 1A2TA 5I9PA 1EY9A 2N55A 2IT1A 2PO4A 2JSOA 1B2TA 1IW7D 3D4RA 3GTQB 1EIGA 4OHJA 4DAPA 3TZUA 4DF7A 2F0GA 5I2YA 1ENFA 4F7XA 2O5IC 2MP1A 3KLRA 5KYLA 1X32A 3HOVB 2L9HA 3HEJA 5ELDA 4IALA 5IGGA 1LTID 1B4OA 2F0OA 2K28A 2AUKA 3LX0A 1QOHA 4F8MA 3A7LA 1IHZA 4K5VA 1LTGD 1RJTA 1PZID 2HDLA 1LT5D 1XYIA 4FF4A 1JWUD 2BE5C 4FNFA 3SEBA 2L11A 5CV6A 4K5WA 3MC0B 1SMYD 1SEBD 4XQJA 1TY0A 4IUUA 2EE1A 1AZQA 2F4IA 3MHBA 4RCNA 1V1PA 2Q8TA 3VR2A 2J7ZA 1E2ZA 5K36G 2LFNA 1W6KA 3R8BA 1S5ED 5DM73 1KNEA 1B53A 2AWNA 4XDXA 3RD4A 1PDQA 1KLGD 5E1FA 2PYKA 4TQUS 4OO1G 5ELBA 1PRTB 1HQRD 1JORA 4BBRB 2RDHA 5LHY1 3NWSA 4KV6A 1B50A 2R7ZB 4FF1A 1GHKA 4NDXA 5BN3A 3MXNA 3U9SA 3HOUB 1CZGA 1QNKA 4KY6A 4MHEA 3HG9A 3I4NB 1K83B 3BS1A 2NVQB 1OXXK 2B63B 3V96A 2M9VA 1U4RA 2QCPX 2F0IA 1S4ZA 5M5XB 3SK4A 2NB0A 2R6GA 2A74C 3L9AX 1H9SA 3NK9A 4BA2I 5FKAC 5KIXA 4KN4C 5EJWA 3ITPA 3BYYB 1NCVA 2NN6I 1PZKD 1BDOA 1Y1VB 1TWHB 4IN3A 4A3KB 4RFBA 3AB9A 3M4YA 4FVMA 2K01A 5JPMC 2NTSA 3CRLC 5EPKA 3GD7A 1TWGB 2SDFA 1HRJA 3D8GA 4DNTB 2J0TD 1GHJA 1ZXTA 3N52A 5IGEA 3P20A 2BE5D 3I91A 4C3HB 2F1MA 4RGMA 4UAIA 3A56A 4BWGB 2PW7A 3BDOA 3HKZB 5M5YB 3T4AC 4DXFA 3DWPA 5CV5A 1JOKA 3OIQA 2L5TA 5KNBA 5KEEA 1U4PA 1KDCA 5CV9A 4CJ1B 3K58A 3P1HA 4FO2A 3VYTA 3C3LA 1MSHA 2IPKD 2M2LA 1EOTA 3GTGB 2EYFA 2EYOA 4X3KA 2SNMA 2DNCA 2KUMA 3HS0C 1SYFA 2PZWA 1NR2A 1HXYD 2YU9B 4GZYC 1ESRA 4K5XA 1Q1EA 3FRPB 4IUPA 3GTOB 3M85A 2KCNA 1EIHA 3TSSA 1NSNS 3VR5A 4R8NA 5EBCA 2K5WA 1SFOB 3I4MB 3CHBD 4RHSA 4EQOA 3QG1A 3OPOA 3CQZB 3S9WA 3MVVA 4HEDA 3GTKB 3MFYA 3PV0A 1QWYA 3GO5A 1BR9A 2K05A 4QB4A 4EVOA 1Y69U 1EQVA 2KEEA 1SNDA 2B2YA 1VDZA 4KJOA 5JAVA 3I73A 1RKNA 1IYVA 1A6XA 1D5XC 4RH6A 4BY1B 2A6HC 3K5OA 5E4WC 1D6EC 1TVXA 1HFGA 3HZXA 3EQLC 1BF4A 1SE2A 3R3OA 5ELCA 1PYWD 3SDZA 2WKDA 3GV3A 2MUYA 2ZT9C 1V8QA 5E4XA 4R9WA 2KJXA 2LMCB 2A68D 2BDOA 1PTOF 1Z7TA 1A3VA 3OSOA 3WDNA 3BDCA 3NTIA 4XXEA 5LL6S 5IT9L 1CTMA 2J4XA 4B08A 2E2HB 2WINB 1JC7A 4KJNA 2DNEA 2EY2A 3R2TA 1W6JA 1II3A 1CA5A 2ICEC 3BVZA 1KLUD 2JE6I 3J80L 1OXSC 2CVRA 2G9HD 3A7AB 2AUJD 4XYQA 1MSGA 3DEOA 5M3FB 3PIP3 2Z4IA 1SNOA 2QKIC 3OIPA 2XIWA 1FYCA 1CQVA 1M4VA 4K6DA 1TWCB 5CR3A 1EY6A 2B2WA 3K0YA 2Z1CA 2SOBA 4H0LC 1D5MC 4UDUC 1SDFA 4PNYA 3L3OC 2SNSA 1F2LA 2WB1B 5FO7B 1LV9A 3A54A 4LAAA 5IGCA 1LLRD 3S1NB 4NKLA 4OO1I 1GUOA 2Z4HA 2GA4B 5IT9E 3RLFA 1LTTD 2WIIB 4X3TA 2XRSD 1ET6A 4XQNA 4M8AA 2EY6A 4EGVA 3PIO3 2NZ1D 2H1EA 2B2UC 4A3BB 5EGTA 2A69D 3WOEA 1UAPA 2NTTA 1TIID 2KEDA 4JK1C 2TSSA 3IFDA 1C4QA 2NVYB 2PQEA 3BVMA 1ENCA 2F0SA 1O7LA 3M4OB 2QILA 5KRUA 4Z9CB 5CBAE 2F3WA 2SEBD 2JA6B 3K5LA 3T53B 1I6HB 3SK6A 4IFDG 1EEID 1LTSD 2WP8J 3KUPA 2AQ1B 2XN9C 1EY0A 1AZPA 4DFAA 4C1NK 1A3UA 3CRKC 2HDMA 4NMZA 1LABA 1CM9A 4C2MB 5CV4A 1AW7A 5DM63 3U9OA 1JR0D 3RMHA 2RQXA 3H09A 4HSPA 2ENBA 3R2IA 3HOWB 1HA6A 2O4XA 1CQFA 2F0MA 2OF1A 2CW0C 2FFKB 2DY8A 2E74C 1EZ8A 2IW3A 5J39A 3W2DA 2WAQB 4L63B 1ILPA 1B44D 4RGNA 2JA5B 5C3EB 3GTJB 3FVQA 4IFDJ 1H9SB 2RBMA 1DD2A 3D31A 3F2UA 1FNUA 2G9DA 5I6WA 1DONA 3EROA 4IUVA 3K6OA 1DOLA 3QB3A 2BA0A 1AP0A 5LL6X 5BN4A 3A8JE 1QNUA 2IJ0A 5C0XJ 2EY1A 3L7ZC 1DZ1A 1SNQA 4G7OC 2B39A 1TT2A 4KKSA 1AN8A 5BN5A 4EQNA 1EY5A 3V05A 2IWHA 3O13A 5NUCA 1SBBB 2V4DA 1BOSA 2JXMB 4F87A 1G8ZD 3S1QB 1I4XA 3SXHA 1MD2D 4C3JG 1F9RA 4XT3B 3LNNA 3NPPA 1SNCA 3NTKA 3MZ5A 2LY7A 1R9TB 1BNZA 3J7AF 3H0GB 2VXWA 3BDLA 1TQOA 5E3FA 1B9NA 1BCPC 4KD4A 4CGYB 4BBSB 4IQZA 2F0DA 5EPLA 2JEAI 1G91A 1OXVA 4DAVA 1TKWB 1PTOC 5IGFA 2NVXB 1CZWA 4CHTB 2FMMA 2R3ZA 1AEXA 3J81E 2K5DA 4K6LA 1K8OA 3EJIA 3NBHA 1JE4A 1I3QB 1T5EA 4R8IA 2RKSA 1EY7A 3GTLB 4A3JB 2L55A 1SJHD 1H9MA 1Z47A 5ELEA 2F03A 4V0BA 1B3AA 2CW0D 1J9OA 1ILQA 5IGBA 4DNRB 3QJYA 2F0VA 1PMRA 4XT1B 3TP8A 1T5XD 1ZKOA 3MEHA 5AFWA 3TP6A 5C4HA 3K5MA 1YNJC 1LT4D 5CMDA 1RDPD 2RSOA 4HMIA 4HN7A 1O7YA 4NW2A 3I4LA 1DJRD 3HOYB 4DK0A 3SE0A 4A3EB 1EYAA 5T1IA 1EFID 2Q8RE 1DXMA 4IURA 4LJZC 5A2QL 1STYA 3NWTA 1M8AA 1PRTF 1F9PA 1DOMA 1VF5C 2HCIA 4B9XA 4QCLA 5M9OA 4FXDA 4CJ0B 1QG7A 3BVGA 1EZ6A 2F0FA 4K2LA 4RKLA 4ID6A 3VYRA 3OWFA 2E2DC 1S5DD 3D6CA 5CYUA 1F77A 2D2CC 4ZUJA 2F0KA 1WCMB 2IL8A 1CK1A 3S14B 2EYJA 3KF8A 3A8KE 2AWOA 2OT2A 1EL0A 1NAPA 1PTOD 1OXTA 5CBEE 1SE4A 2B2VC 5IODA 1RHPA 3HRZC 1GOZA 5IOCA 4A3MB 2Z8LA 3KLSA 4A3FB 4ZKCB 2HUGA 1WTXA 1RCVD 2OEOA 1KNAA 2EYPA 5A2QE 3HOZB 1Y8PB 4A3DB 2A6EC 3SK8A 2ICIA 1I4RA 5COYA 2PZUA 1HHVA 3NSWA 1IKMA 4ZYSA 2VB3X 4PMBA 2KECA 1EY8A 4RAUC 1YNJD 4KY5A 4LK1C 4OIJA 2L1BA 3BYTB 1PFMA 3C46A 4IUNA 5C5MA 3MA2B 2K33A 1UUPA 4QUFA 3NP8A 4QF4A 3S1RB 5DEHA 3J7AV 1GUSA 4RHRA 4IUQA 1Q1BA 4B9WA 3S1MB 2K1BA 3GP7A 3H94A 2WV6D 3VYSA 1A2UA 2R61A 4JBWA 2VUMB 1RODA 1B1ZA 1SE3A 3DMUA 3DWAA 4XIGS 2KQ3A 4FF2A 1D1KA 1JQYD 2F0PA 3AMUA 3X3NA 4DU9A 2M00A 1BCPF 1TWAB 5JEAG 5FO8B 4BA1I 5EKKA 3N6RA 4TKOB 5K5PA 5G3LF 1Q8IA 1KAAA 1JOOA 1TU2B 3Q23A 4DA2A 1CHQD 3I90A 1F2ZA 2C5CA 2K03A 3QIAA 4WJWA 2HCCA 2IX1A 1EQTA 2XVSA 3Q6SA 1JCKB 1R4QB 1SJED 3ZYYX 1BQQT 3NXWA 1DOKA 1HPCA 2B2TC 5TSSA 4TRDA 5KYIA 2RSNA 1GUTA 5IGDA 2WACA 1WTPA 3KLSX 4RGTA 5JVG3 1DCZA 4IFDH 2A6ED 1Y8NB 5A35A 2K5QA 2XWJB 5EKLA 1RTOA 1GXDC 4HMJA 2ZXPA 4X3UA 1LACA 2PZTA 2KOLA 5C0XH 1EY4A 5D65A 4DK1A 1JOQA 4L6TB 1U4LA 1D5ZC 4P2CB 5JEAJ 1TY2A 5C44B 1MI2A 1TWFB 2KCCA 3Q24A 1F2YA 5F2DA 3T16A 3SR1A 4K8JA 4BY7B 3IFTA 3H91A 4H7BA 1EWHA 3VR4A 4C3IG 3Q0AA 3CKIB 2FHTA 4J6HA 4OGQC 3TN2A 4CKBA 4CBVA 4KKUA 1HTPA 3NHHA 4KY7A 4NP5A 2RA4A 1Q90A 3X3MA 1ICWA 2B8FA 1G2SA 5KNDA 1PRTC 2A6HD 4EQPA 1PLFA 3KBXA 1I50B 1HA5A 2EJGC 3PO2B 3S17B 1ENAA 3I72A 2EJFC 1X3PA 2EPBA 2EZVA 2ID0A 3E5SA 3TDQA 3TP7A 3NTHA 1RF2D 4ABNA 1SYBA 3S2DB 4KTAA 4Q5VA 4ZRZA 1B9MA 5C6AA 3SHLA 2O5JC 1TS2A 1BUVT 1UNSA 5FLXL 2YYZA 5C0XG 3D4WA 1EU4A 1F9QA 1E2WA 2F0TA 1STBA 1WVLA 2XNAC 5C5LA 1U9RA 2RDFA 4AYBB 3MWYW 4K14A 2L4NA 1WTQA 1VCIA 1CI3M 4DN4M 1ZEQX 4C56C 4M1UB 1HUMA 4FF3A 3GQBA 1S5CD 2NVTB 2EYLA 2H4OA 4KKTA 4RWSC 3NUCA 2CHBD 4MN3A 2E2JB 4Q0FA 2EXZA 2A73B 4ULLA 2F0NA 2PW5A 4LMQD 2EYHA 3EFXD 1CT1D 1J8IA 3NQIA 5J1ZA 1JWSD 3Q22A 3FPPA 1O78A 3RZOB 5KNCA 3J81L 1ESFA 1XXGA 3MAQA 1I4QA 2EOTA 4X3SA 1V1OA 1LTBD 3FMCA 5ISRA 2BDNA 1EWCA 4FXGC 5M3MB 2EJMA 2B2VA 2FMCA 1D1IA 4ZAIA 5HGTA 4KK7A 1PRTD 1EYCA 1EEFD 3PUVA 5FLXE 2I07B 1HUNA 4I65A 1C8CA 3K7AB 2E75C 4RKBA 3R93A 2B8GA 1VMPA 3TMEA 3C1EA 3VA7A 2JYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYV A;  2IT1 A;  1OXV A;  3T51 B;  1A6X A;  3OW7 A;  2Q8I B;  1TKW B;  1B9M A;  1V43 A;  1IW7 D;  2A6H C;  2O5J C;  2CW0 C;  4HR7 B;  1LAC A;  4G7H C;  1GHK A;  2E74 C;  1H9K A;  4I7Z C;  3VR3 A;  2YYZ A;  5C0X H;  3D4R A;  5C0X G;  5BN3 A;  1E2W A;  2D5D A;  1GUS A;  3EQL C;  4DK1 A;  3U9S A;  4H13 C;  4XTC S;  2PCF B;  1E2V A;  1K8O A;  1GUO A;  1K8M A;  1GUN A;  3TZU A;  3RLF A;  1Q1B A;  3SDZ A;  1VCI A;  1CI3 M;  1OXX K;  1T5E A;  3LWU A;  2D2C C;  2KCC A;  2ZT9 C;  3H94 A;  1V8Q A;  1ZYR C;  4JBW A;  2EVB A;  3PUW A;  3M7N A;  3HGB A;  1H9R A;  3GQB A;  2O5I C;  3KLR A;  2K32 A;  2AWO A;  2DNC A;  3A8K E;  2LMC B;  1CFM A;  2A68 D;  2BDO A;  1SMY C;  1GJX A;  1H9J A;  3ND9 A;  1Z7T A;  1H9M A;  4KKT A;  4L8J A;  3WDN A;  2NN6 H;  2R6G A;  2NN6 G;  3IFT A;  1IYU A;  1OXT A;  1EWH A;  1H9S B;  4XIG S;  3VR4 A;  2PPB C;  3D31 A;  1DD2 A;  4GZY C;  1CTM A;  1I6V C;  1H9S A;  2A69 D;  3BG3 A;  4H44 C;  4BA2 I;  3T56 B;  1Q1E A;  2AUK A;  4OGQ C;  4DNR B;  3QJY A;  1PMR A;  2QF7 A;  2DNE A;  3A7L A;  1Y8O B;  4JK1 C;  3M85 A;  4KKU A;  1HTP A;  3VA7 A;  4KN4 C;  5JEA G;  3DXJ C;  2BA0 A;  3VR5 A;  2JEB I;  4BA1 I;  1ZKO A;  3N6R A;  4TKO B;  5BN4 A;  3A8J E;  1GUG A;  1Q90 A;  3L7Z C;  1O7L A;  2BE5 C;  1YNJ C;  2B8F A;  4KI0 A;  1VF7 A;  3FPP A;  2NN6 I;  1O78 A;  2KA7 A;  3PUY A;  4KHZ A;  5KND A;  4G7O C;  5KNC A;  1BDO A;  1TU2 B;  2K7V A;  1Y8P B;  4KKS A;  4KN7 C;  3I4L A;  5BN5 A;  3VR6 A;  2A6H D;  2JE6 I;  2A6E C;  3AB9 A;  4DK0 A;  3M4Y A;  1OXS C;  1Q12 A;  3SE0 A;  3T53 B;  1HCZ A;  2EDG A;  3A7A B;  3OPO A;  3QG1 A;  4IFD G;  1QJO A;  2AUJ D;  2V4D A;  3QIA A;  2JXM B;  3CRL C;  1Z6H A;  3FMC A;  1ONL A;  2EJG C;  2E76 C;  4RCN A;  1OXU A;  3GD7 A;  2BA1 A;  3MXU A;  3I72 A;  5JEA H;  4KMU C;  2A68 C;  4G7Z C;  1DXM A;  2EJF C;  2D62 A;  3CRK C;  4LJZ C;  1IW7 C;  3MFY A;  3ND8 A;  3VR2 A;  1HPC A;  3PV0 A;  4PV1 C;  1HQM C;  3LNN A;  4DNT B;  1E2Z A;  1FYC A;  1GHJ A;  5K36 G;  5K36 H;  3PUZ A;  3P20 A;  2EJM A;  3IKJ A;  1GUT A;  1G29 1;  2A69 C;  1LAB A;  2BE5 D;  3OOC A;  2F1M A;  3PUX A;  4LK1 C;  3PUV A;  3BDO A;  3W3A A;  1DCZ A;  3NE5 B;  2PNR C;  4IFD H;  2A6E D;  4H0L C;  1Y69 U;  1Y8N B;  1VF5 C;  1YNN C;  4TQU S;  1B9N A;  4OO1 H;  2E75 C;  2DN8 A;  3A8I E;  5A35 A;  4OO1 G;  4IQZ A;  1FR3 A;  2K33 A;  2B8G A;  2L5T A;  2JEA I;  1VDZ A;  5KNB A;  3I73 A; 
#chains in the Genus database with same CATH topology
 3S2H H;  1D2B A;  1XPU A;  3J81 i;  2EY5 A;  2XWB B;  5CV7 A;  1GUW A;  1IKL A;  3P7J A;  1V43 A;  5D3D A;  1X3Q A;  3JAM L;  1WTR A;  1Y1V G;  2NWG A;  1PFN A;  2K52 A;  2Z0S A;  2UUC L;  2DY7 A;  1NUC A;  2B2W C;  4H13 C;  3IAY A;  3PQI A;  3L0O A;  3HOX G;  1HFN A;  4J15 A;  1K8M A;  3UE1 A;  3DUZ A;  1N32 L;  4A3G G;  1SN8 A;  1PTO H;  2ZJP A;  3M7G A;  1STN A;  1ZYR C;  2XRQ D;  2EVB A;  4ODG A;  5FJ8 G;  3FP9 A;  1WD1 A;  3A0J A;  1GJX A;  3F8T A;  1H9J A;  3S15 H;  3D6W A;  4C3H G;  1NE3 A;  4IUT A;  1SSO A;  2JA7 H;  5M5W B;  4GNX B;  3V2T A;  2AQ2 B;  3T56 B;  2WFW A;  4L5S A;  1MGS A;  4WJ4 A;  3J7Z C;  3RUZ A;  2QF7 A;  1WTW A;  2OTJ A;  2GVB A;  3KYH C;  4XYO A;  2D0P A;  2EYM A;  1JWM D;  4RCO A;  2WKC A;  5T1G A;  3GTP H;  1VQL A;  1SYG A;  3WWV A;  1I4P A;  1SMX A;  2P5Z X;  3PUY A;  4RA8 A;  5I6Y A;  1IL8 A;  3K8A A;  1STE A;  1UEA B;  4YWM A;  3J7A 5;  3VR6 A;  4A3I B;  3AU7 A;  2N88 A;  1YIT A;  1LTL A;  3OYY A;  3QOJ A;  1IBK L;  4JVZ A;  4HCS A;  3UDX A;  2BA1 A;  4G7Z C;  3ICE A;  1BXT A;  2D62 A;  2NYZ D;  1QB5 D;  2K5V A;  2KHS A;  3NBI A;  3W5O A;  1I4G A;  1STG A;  1MHW C;  1JB3 A;  4CKC A;  5E7N A;  4YY3 Q;  2QW7 A;  1L1O C;  1O7I A;  2IX0 A;  3G6J B;  1I94 L;  4E6I A;  4WOR A;  3JAM E;  3NE5 B;  3NEM A;  2PNR C;  4PMC A;  4CDE C;  4AQY Q;  4JCV E;  4AIM A;  1YNN C;  4A93 H;  3S16 B;  5KGU A;  2K04 A;  3OWE B;  2F0H A;  1LTA D;  4WRD A;  1SYD A;  4I7A A;  4NXM L;  3OW7 A;  1WD0 A;  1A15 A;  1X9N A;  3TZD A;  3M3Y H;  1TS3 A;  2D5D A;  3ERQ A;  3E0J A;  3GTM B;  1IZ6 A;  4O42 A;  3TBI B;  3I4M G;  4B3R Q;  3PO3 G;  3MFG A;  1E2V A;  3T13 A;  1KDA A;  2UUA Q;  5C44 H;  5FK9 C;  3I56 A;  1PZJ D;  2TMP A;  1EUJ A;  2B2T A;  4LF9 L;  5AJ3 Q;  4DR6 L;  1EQQ A;  2X69 A;  4JW0 A;  1K8A C;  1PFS A;  1QCB D;  3FDT A;  2VB2 X;  4C3J B;  5HUR A;  1FGU A;  3M7N A;  1G51 A;  2KVM A;  4DAY A;  2K32 A;  3D3R A;  2OTL A;  1PXU A;  4H02 A;  4L8J A;  5I2X A;  1L0W A;  5JOB A;  1IYU A;  2N78 A;  4J1M A;  2JA7 G;  1U4M A;  4JI5 L;  1XTC D;  3K81 C;  2UUB Q;  3HOX B;  2BH8 A;  3M4P A;  4A3G B;  5IYD H;  3KBG A;  1FD7 D;  5IIF A;  1BCP D;  2R93 H;  4GLX A;  1X65 A;  1YHA A;  2MGS A;  5IWA Q;  1YBY A;  3T1H L;  1ZYR D;  3CPF A;  5G3L D;  5DAU A;  2AKW B;  5C4Z A;  1SXT A;  4V19 0;  1E0B A;  4OON A;  2JA8 B;  4K8I A;  1G6P A;  4LFC Q;  3VDY A;  4TVA B;  2EDG A;  1FNV A;  2MQH A;  3FKI H;  3NQT A;  3SK5 A;  1IXR A;  1NMG A;  3GDE A;  5D14 A;  1N9W A;  4GLV B;  2R92 G;  4DV5 Q;  3HKZ E;  2E2I B;  1WTO A;  2ALY B;  1G2T A;  3HP3 A;  3I70 A;  3GV6 A;  3MXU A;  4G4K A;  2FIN B;  5JEA H;  5FOB B;  2A68 C;  1EQR A;  1XMO L;  4TSS A;  1XX8 A;  3W1G A;  2Y0S G;  5IYC H;  1W3S A;  1RD9 D;  3CU7 A;  5C3W A;  1VQN A;  1F2M A;  1S5B D;  4RMF A;  4FDB A;  3CCM A;  2Z6K C;  4HCE A;  2X6L A;  4A93 G;  4UPA A;  2XSC A;  5JVH 3;  1BBX C;  3DWQ A;  1FR3 A;  3D4D A;  1Y1W H;  1A3T A;  3RN2 A;  2HHH Q;  3C2P A;  4Y7N H;  1XMQ L;  1KAB A;  2B2U A;  1ML0 D;  4N9T A;  2Q8I B;  1S3O A;  3G6E A;  3LGJ A;  1Q3L A;  4HR7 B;  1P8L A;  3VR3 A;  4JI3 L;  4A3L H;  3H3V C;  4QIW B;  3F2C A;  3F2D A;  4IFD I;  2CQA A;  2ZTD A;  4OWT B;  5C4J B;  2L0C A;  2PCF B;  3J7Y W;  4G57 A;  1KDB A;  3K5N A;  1GUN A;  4KHV A;  3ONA B;  1Z9F A;  1RTN A;  1SNM A;  1MBY A;  2HQE A;  1YNN D;  2LKV A;  2O2L D;  3S2H B;  3UDI A;  3CD6 A;  4DV1 Q;  3VA5 A;  3HFZ B;  3RZD H;  1KIX A;  1H9R A;  5IP7 H;  1YZ6 A;  1F9S A;  5CV8 A;  4FXK C;  1J5E Q;  2UXB Q;  1SNP A;  5C0X I;  4N9P A;  3P75 A;  1STH A;  4HTH A;  5DNF A;  4B3T L;  2N49 A;  3H15 A;  2NN6 H;  1BCP B;  1QE6 A;  3PO3 B;  1I6V C;  3MXP A;  2UU9 Q;  5GAD C;  4ILW A;  4U67 3;  4J8Q A;  2RDG A;  4OIK A;  3KDF B;  5BR8 Q;  1PTO B;  3DXJ C;  2JEB I;  1HTL D;  5I9O A;  1I4H A;  2R93 G;  3OMC A;  2NZH A;  1HR0 Q;  3MXG A;  1E1O A;  5C4X H;  2F3I A;  4DUY L;  4PZ7 A;  1VF7 A;  2KA7 A;  3S15 B;  1QIL A;  4WJ3 M;  3RZO H;  1GVP A;  2ZXR A;  3DEP A;  4KN7 C;  1L0Y B;  2JA7 B;  2ZXO A;  3KJO A;  4C3I H;  1JMC A;  3URY A;  1WTV A;  4DGZ A;  1HCZ A;  4DV3 Q;  1FNW A;  3FKI G;  1QJO A;  4DR7 L;  4JC0 A;  1VQ5 A;  5EPJ A;  3L2P A;  1OXU A;  1E7Z A;  3U58 A;  3KF6 B;  3GTP B;  2EIF A;  1R4P B;  2I46 A;  1AE2 A;  3VYU A;  3CMA A;  4PV1 C;  1ASY A;  1HQM C;  1VMC A;  2F0U A;  5LMU L;  1VQ6 A;  3OTO Q;  1G29 1;  1IL2 A;  2A69 C;  4K0K L;  3OOC A;  3OMG A;  4U68 A;  3GTQ H;  4WFN 3;  3E9H A;  4HAE A;  2KBN A;  2R92 B;  2DN8 A;  3A8I E;  5IP9 H;  4YWL A;  2FXQ A;  2PI2 A;  4FYD A;  3PMF A;  5JJZ A;  3OHX C;  4HJA A;  1ET9 A;  4DUZ L;  2F0Q A;  4UP8 A;  4QJF A;  4ZQ3 A;  1BVS A;  3E6Z X;  3K59 A;  1SYE A;  1AFP A;  5COR A;  2Y0S B;  4IPH A;  1A0I A;  1N33 L;  1CSP A;  3A55 A;  1H9K A;  3HOV H;  1VQK A;  5CGK A;  2OWO A;  1EOV A;  3QOL A;  2F52 A;  3E0E A;  2JA6 G;  2MHV A;  4ZLT F;  1EYD A;  5ELF A;  4DR3 Q;  4A93 B;  4LF4 L;  4DR4 Q;  1LTR D;  1C48 A;  2E5L Q;  4R4O A;  1IBL L;  1O80 A;  2AQ3 B;  2I0Q A;  2NUC A;  1CA6 A;  4RGO S;  3TP5 A;  4HIO A;  4BS9 A;  3M3Y B;  3I3C A;  3ND9 A;  3ULP A;  4HJ8 A;  4ZUI A;  2OXP A;  2A1A A;  2NN6 G;  4CKE A;  1DYQ A;  4K2K A;  5CC4 A;  3T1Y L;  4H44 C;  4F88 A;  4PQX A;  1XWE A;  1LT6 D;  5I4D A;  4DXG A;  4JI1 Q;  5EQ0 A;  1FL0 A;  4X66 L;  2VQF L;  1LYL A;  1PFB A;  3IL8 A;  2F0J A;  3MEF A;  1HH2 P;  3HOW G;  4XQQ A;  3DHQ A;  3KFU A;  1HNW L;  4P71 A;  5C4X G;  4X6A H;  3CCR A;  1QUQ A;  2MPM A;  2F0E A;  4LWC A;  1KTK A;  1GO3 E;  3KK7 A;  4QUC A;  1UE5 A;  5D3I B;  1EU3 A;  2Q2H A;  3UI2 A;  1SRU A;  1O7Z A;  3CAM A;  4GN3 B;  1Z6H A;  1ONL A;  4C1N I;  1HNX L;  2E76 C;  4O1N A;  5JPN C;  1NR4 A;  3C1F A;  2R93 B;  3BZD B;  3Q8D A;  4HSV A;  4KMU C;  4BBR H;  1IW7 C;  3ND8 A;  2PNH A;  2JP1 A;  2R7Z H;  3PUZ A;  5C3E G;  2WB1 E;  4JI6 L;  3QWN A;  1L0X B;  1LT3 D;  3PUX A;  3WOF A;  3HOU H;  2JQO A;  1IBK Q;  3FKI B;  2D9U A;  1VQI A;  3EVQ A;  4YIJ A;  3H6M A;  3EBE A;  4RG1 A;  3FEW X;  1K83 H;  5IP9 G;  2NVQ H;  3I4N H;  2A8V A;  2CQO A;  3W1B A;  4HIM A;  4JI4 Q;  3MTS A;  4CJ2 C;  3T51 B;  2K6A A;  3KF6 A;  5J22 A;  1NBW A;  1JIC A;  2C35 B;  1BO0 A;  4G7H C;  2LS0 1;  5M5X H;  1LO5 D;  4I7Z C;  3HOV G;  4GS3 A;  4MIU A;  5EAY A;  3CCS A;  4XTC S;  4OL7 A;  2IY5 B;  3J80 E;  1EFW A;  2IX3 A;  1S5F D;  3I8Z A;  4NPS A;  2MJ8 A;  3LWU A;  3FPU B;  1Y1W B;  2RVL A;  4Y7N B;  3SVM A;  1DM0 B;  3PUW A;  1NJI C;  3HGB A;  4ME5 A;  1SAP A;  1QZH A;  1L1O A;  3K57 A;  1CFM A;  1SMY C;  2PMZ B;  2BCO A;  1XTD A;  3G7L A;  5EKI A;  4ZK9 B;  1Y1V H;  1TWH H;  2VS1 A;  4A3K H;  2OCE A;  2PPB C;  5FO9 B;  1STA A;  4FP5 D;  3BG3 A;  2FJ2 A;  3DM1 A;  1V1P B;  2JN4 A;  1TS5 A;  1Y8O B;  1TS4 A;  2UXD L;  1G6Z A;  4A3G H;  1SYC A;  1WJJ A;  4DV4 Q;  1TWG H;  4DR5 Q;  3RZD B;  1TR5 A;  5C3X A;  1GUG A;  2B2Y C;  5FJ8 H;  4KI0 A;  4KHZ A;  3QO2 A;  5LMN Q;  4QMG A;  5DLQ E;  2K7V A;  2OQK A;  1JT8 A;  5FLM G;  4C3H H;  4HID A;  3PSI A;  3NEL A;  4JV5 L;  1Q12 A;  4IZ8 A;  5M5Y H;  3CCQ A;  4S3S A;  2VNU D;  1PA6 A;  3CW2 C;  4PMW A;  2F4V Q;  2E2I H;  3EA6 A;  2DGY A;  2F0W A;  5C4X B;  5K36 H;  4EX5 A;  1IBM Q;  2R7Z G;  3IKJ A;  4LNQ A;  3MXN B;  2QDB A;  2X6G A;  5EBD A;  3LWE A;  4C3I B;  1OO9 B;  1VQP A;  1D7Q A;  1CHP D;  2F0L A;  2F3V A;  4KD3 A;  4ZKB B;  1E3P A;  2L12 A;  3W3A A;  1VQA A;  1XPO A;  2C9O A;  4R4C A;  4OO1 H;  3I4N G;  4R4T A;  2A5H A;  4CDF C;  2QEJ C;  1FGB D;  4B3M L;  3GTG H;  1VQJ A;  5ELN A;  2BOS A;  2NBF A;  1A2T A;  5I9P A;  2B63 G;  2WAQ E;  1EY9 A;  2N55 A;  2IT1 A;  4JI2 Q;  2PO4 A;  4YCV A;  2JSO A;  1B2T A;  1IW7 D;  4DK6 C;  4JI8 L;  2EXD A;  3D4R A;  3GTQ B;  1JJG A;  1EIG A;  3HOY G;  2YU9 H;  4A3E G;  4OHJ A;  4DAP A;  3TZU A;  1HZ9 A;  1VQD A;  3GTO H;  4PZ6 A;  3HKS A;  4DF7 A;  1UE6 A;  2F0G A;  1ENF A;  5I2Y A;  2UXC L;  4F7X A;  4DAY B;  2O5I C;  2MP1 A;  4DV7 L;  4OX9 L;  3KLR A;  5KYL A;  1PV4 A;  1X32 A;  3HOV B;  2L9H A;  3PF4 A;  3HEJ A;  2Z6K A;  5ELD A;  4A3K G;  1SFO H;  3TQY A;  4IAL A;  5IGG A;  4B3S Q;  3I4M H;  4JYA L;  1LTI D;  3PO3 H;  1B4O A;  2F0O A;  2K28 A;  2AUK A;  3LX0 A;  3CQZ H;  4OWX B;  2N8N A;  1QOH A;  4F8M A;  3A7L A;  1IHZ A;  4K5V A;  1LTG D;  1RJT A;  1PZI D;  2HDL A;  5JJI A;  1E1T A;  1LT5 D;  1XYI A;  3GTK H;  1K0S A;  2EQS A;  4FF4 A;  1JWU D;  2BE5 C;  4FNF A;  3SEB A;  3QR8 A;  2L11 A;  5CV6 A;  4K5W A;  3MC0 B;  3CCU A;  1SMY D;  1SEB D;  1YHB A;  3PF5 A;  4XQJ A;  1TY0 A;  2YTY A;  4IUU A;  3HKZ G;  4L5Q A;  2EE1 A;  1AZQ A;  1WOC A;  2F4I A;  2GVA A;  1KXL A;  3MHB A;  1PH6 A;  4RCN A;  1V1P A;  1FJG Q;  1HNZ Q;  2Q8T A;  1T9H A;  1WCM G;  2QGQ A;  3JAM i;  4DUY Q;  3VR2 A;  3TS2 A;  2CKZ B;  2J7Z A;  1E2Z A;  1E22 A;  5JJL A;  3U4Z A;  5K36 G;  4X64 L;  1PH4 A;  2LFN A;  1W6K A;  3R8B A;  4ALP A;  1S5E D;  5DM7 3;  1M90 C;  4Y52 H;  1KNE A;  1B53 A;  5H1S E;  2AWN A;  3A5U A;  4XDX A;  1CKO A;  3RD4 A;  1PDQ A;  1KLG D;  5E1F A;  2PYK A;  4TQU S;  2R92 H;  4OO1 G;  5ELB A;  4LFA L;  4KHP Q;  1PRT B;  1MKH A;  4R1J A;  1HQR D;  2ASB A;  1JOR A;  3KJP A;  4BBR B;  2RDH A;  1C9O A;  5LHY 1;  4IO9 A;  3NWS A;  4KV6 A;  3RN5 A;  1B50 A;  2Z6B A;  2R7Z B;  4FF1 A;  2ZJQ A;  4K0K Q;  1SE8 A;  1Q46 A;  1GHK A;  3HOZ G;  4NDX A;  5BN3 A;  3MXN A;  3U9S A;  3HOU B;  1XPR A;  4GKK Q;  4JI7 Q;  1CZG A;  1QNK A;  2E2H H;  4KY6 A;  4MHE A;  3HG9 A;  3I4N B;  1K83 B;  3BS1 A;  2NVQ B;  4LF8 L;  4GOP C;  1OXX K;  4DR2 L;  2B63 B;  3V96 A;  2QDL A;  2M9V A;  1U4R A;  2QCP X;  2F0I A;  2CH4 A;  3OW2 A;  4DR1 Q;  1VQB A;  1S4Z A;  5J3B A;  5M5X B;  3SK4 A;  1DGS A;  2NB0 A;  3G48 A;  2R6G A;  2A74 C;  3L9A X;  4HJ9 A;  2OQ0 A;  4DV2 L;  1H9S A;  3NK9 A;  4BA2 I;  1X3F A;  1LUZ A;  1CKM A;  3G4S A;  5HY6 A;  4LF7 Q;  1IBL Q;  5GQO A;  4IOC A;  5FKA C;  5KIX A;  3TS0 A;  2KHI A;  4KN4 C;  3CCL A;  2BH2 A;  4NXN Q;  5EJW A;  3ITP A;  5M3F H;  1SLJ A;  3BYY B;  3I4O A;  5GAG C;  1YIJ A;  1NCV A;  4GKJ L;  1L2F A;  2NN6 I;  3BJU A;  1PZK D;  1BDO A;  3J81 j;  1Y1V B;  1TWH B;  4IN3 A;  4A3K B;  2CCZ A;  4RFB A;  2CWA A;  3AB9 A;  2ZM6 Q;  3M4Y A;  4X62 Q;  4FVM A;  2VQF Q;  4HIK A;  2K01 A;  4R4Q A;  5JPM C;  2NTS A;  3CRL C;  5EPK A;  1CKN A;  3A5Z B;  2LXJ A;  1TXY A;  3GD7 A;  1KD1 C;  1K28 A;  1TWG B;  2SDF A;  3KOJ A;  2VUM G;  4JPB W;  1HRJ A;  4ZCK A;  1W2B A;  3D8G A;  4DNT B;  2AHO B;  2J0T D;  1GHJ A;  1ZXT A;  3N52 A;  5IGE A;  1J6Q A;  3P20 A;  4BY1 G;  2MNA A;  2BE5 D;  3I91 A;  4GN4 B;  3B6Y A;  4C3H B;  2F1M A;  4RGM A;  4UAI A;  4LF5 Q;  3A56 A;  4BWG B;  1Q7Y C;  3S1N H;  1KHI A;  2PW7 A;  3BDO A;  3HKZ B;  5M5Y B;  1HNX Q;  3T4A C;  1KRT A;  4DXF A;  3DWP A;  5CV5 A;  1JOK A;  2RCN A;  3OIQ A;  2L5T A;  5KNB A;  4X65 Q;  5KEE A;  4JBK A;  1U4P A;  1KDC A;  1NMF A;  1VQE A;  5CV9 A;  4CJ1 B;  5IT9 c;  1N36 L;  3K58 A;  3P1H A;  1WYD A;  4FO2 A;  3VYT A;  3C3L A;  1MSH A;  2IPK D;  1X6O A;  1WI5 A;  2M2L A;  4LUV A;  1EOT A;  4JI0 Q;  3GTG B;  2EYF A;  2EYO A;  2NVY H;  2VW9 A;  3H3V H;  4X3K A;  2SNM A;  2DNC A;  2KUM A;  3M4O H;  3HS0 C;  1SYF A;  2RCF A;  3J80 c;  4AH6 A;  3AQQ A;  2K4K A;  4LFB Q;  2PZW A;  1ASZ A;  1NR2 A;  3CPW A;  1HXY D;  2YU9 B;  4GZY C;  2VQE L;  4MNO A;  2JA6 H;  1ESR A;  4K5X A;  1I6H H;  1Q1E A;  3FRP B;  4IUP A;  4LW1 A;  1U5K A;  3GTO B;  1PH8 A;  4LF6 L;  2CH4 W;  3M85 A;  2KCN A;  3D0F A;  1EIH A;  5M3F G;  3AEV A;  3TSS A;  1NSN S;  3VR5 A;  1QUQ B;  2DJG C;  1VQM A;  4R8N A;  5EBC A;  4HJ7 A;  2K5W A;  1SFO B;  3I4M B;  3CHB D;  4RHS A;  4EQO A;  1C7Y A;  3QG1 A;  3OPO A;  1K8G A;  3CQZ B;  2G5D A;  3BZC A;  1YJ9 A;  3S9W A;  3CME A;  1BKB A;  4A76 A;  3MVV A;  3HOW H;  4HED A;  3GTK B;  3MFY A;  1RIP A;  2R7D A;  3PV0 A;  2WB1 G;  1A8V A;  4BY7 G;  1QWY A;  3GO5 A;  4JV5 Q;  1BR9 A;  4DV6 Q;  2K05 A;  4P74 A;  4QB4 A;  4EVO A;  1Y69 U;  1EQV A;  2KEE A;  1XNR Q;  1SND A;  2B2Y A;  1VDZ A;  4KJO A;  5JAV A;  4DV0 L;  3I73 A;  5GAH C;  1RKN A;  1IYV A;  1A6X A;  1D5X C;  2JA5 H;  4RH6 A;  4BY1 B;  2A6H C;  3K5O A;  5E4W C;  1D6E C;  5C3E H;  1TVX A;  3GTJ H;  1HFG A;  4A3B G;  3HZX A;  2KCM A;  3EQL C;  1BF4 A;  1SE2 A;  3R3O A;  5ELC A;  1V1Q A;  3AFP A;  4EQ5 A;  1PYW D;  3SDZ A;  3ZJY C;  2WKD A;  4OEL B;  1HZC A;  3GV3 A;  2MUY A;  1X54 A;  2ZT9 C;  3CCE A;  1V8Q A;  5E4X A;  3F2B A;  1L1O B;  1JJC B;  4R9W A;  2KJX A;  1K3R A;  2LMC B;  2A68 D;  2BDO A;  1OTC A;  1PTO F;  1Z7T A;  1A3V A;  3OSO A;  3WDN A;  3BDC A;  3NTI A;  4XXE A;  4YY3 L;  5LL6 S;  5IT9 L;  1EIY B;  1CTM A;  2J4X A;  4B08 A;  2E2H B;  2WIN B;  4HJ5 A;  1JC7 A;  4YHH Q;  4KJN A;  4AQY L;  2DNE A;  2EY2 A;  3S1Q H;  3R2T A;  4IOA A;  1YVC A;  2KHJ A;  1C0A A;  1W6J A;  1II3 A;  1CA5 A;  2ICE C;  3BVZ A;  1KLU D;  5IY0 A;  2UUC Q;  2MO0 A;  2JE6 I;  3H0G H;  3J80 L;  1H95 A;  1AH9 A;  1OXS C;  2CVR A;  2G9H D;  3A7A B;  4AYB G;  1LM0 A;  2AUJ D;  1B7Y B;  1N32 Q;  4XYQ A;  4BBS H;  2UUA L;  1EYG A;  1MSG A;  2RHQ B;  3I55 A;  3DEO A;  1N34 L;  1UE7 A;  5M3F B;  3PIP 3;  2Z4I A;  1SNO A;  3ULL A;  2QKI C;  3OIP A;  2XIW A;  1FYC A;  1CQV A;  1M4V A;  4K6D A;  1TWC B;  5CR3 A;  1EY6 A;  4BXX G;  2B2W A;  3K0Y A;  2NVX H;  5FLM H;  1GM5 A;  2Z1C A;  3RLN A;  2SOB A;  4H0L C;  2UUB L;  2K75 A;  1XNQ L;  1D5M C;  4UDU C;  1SDF A;  2WAQ G;  3FHW A;  4PNY A;  1I3Q H;  4CDD C;  4GNX C;  3L3O C;  1S40 A;  2SNS A;  1F2L A;  1VQ8 A;  2WB1 B;  3PCO B;  5FO7 B;  1LV9 A;  3A54 A;  5IWA L;  3J80 i;  4LAA A;  4A3J H;  2JA5 G;  3GTL H;  5IGC A;  1LLR D;  2KCT A;  4NKL A;  3S1N B;  3EN2 A;  4OO1 I;  4LFC L;  2K5N A;  4LFA Q;  1GUO A;  2Z4H A;  2GA4 B;  3I2Z A;  5IE8 A;  1PH1 A;  3EIV A;  5IT9 E;  3RLF A;  1LTT D;  2WII B;  4X3T A;  2XRS D;  4DV5 L;  1ET6 A;  5GRO A;  4XQN A;  2KEN A;  4M8A A;  2EY6 A;  4EGV A;  3PIO 3;  2B63 H;  1JB7 A;  1YJW A;  1PYB A;  1KRS A;  2NZ1 D;  2H1E A;  2B2U C;  1I94 Q;  4A3B B;  3CCJ A;  3ULJ A;  3CCV A;  1YEZ A;  5EGT A;  2A69 D;  2A19 A;  3WOE A;  1UAP A;  2NTT A;  3HOY H;  4A3E H;  1TII D;  2KED A;  4JK1 C;  2TSS A;  3IFD A;  1C4Q A;  4P73 A;  2NVY B;  4NXM Q;  2PQE A;  3BVM A;  1ENC A;  2HHH L;  2F0S A;  1O7L A;  3M4O B;  2QIL A;  5KRU A;  4Z9C B;  5CBA E;  1V9P A;  2F3W A;  2SEB D;  3H0G G;  4LUO A;  3K5L A;  2JA6 B;  3T53 B;  1I6H B;  4GOP A;  3SK6 A;  4IFD G;  1EEI D;  1LTS D;  2WP8 J;  3KUP A;  4PG3 A;  1VQC A;  2AQ1 B;  4LF9 Q;  4DR6 Q;  4BBS G;  2XN9 C;  1EY0 A;  3DM3 A;  2PQA A;  1AZP A;  4DFA A;  4C1N K;  2IHE A;  1A3U A;  3CRK C;  4OEM B;  2HDM A;  4DV1 L;  1J5E L;  4NMZ A;  3KLW A;  2UXB L;  1LAB A;  1CM9 A;  4JI5 Q;  4C2M B;  5CV4 A;  1AW7 A;  5DM6 3;  3U9O A;  2UU9 L;  1JR0 D;  3A74 A;  3RMH A;  2RQX A;  3H09 A;  4HSP A;  2ENB A;  4AYB E;  3R2I A;  3HOW B;  3RR5 A;  1HA6 A;  2O4X A;  3T1H Q;  1WCM H;  1RL2 A;  3S14 H;  1CQF A;  2F0M A;  1HR0 L;  2OF1 A;  4A3J G;  2CW0 C;  2FFK B;  2DY8 A;  2E74 C;  1CUK A;  2ZTE A;  1EZ8 A;  2IW3 A;  4DV3 L;  5J39 A;  4YCU A;  3W2D A;  2WAQ B;  4A3M H;  4A3F H;  3K80 C;  4L63 B;  1XMO Q;  2ATW A;  1ILP A;  1B44 D;  4RGN A;  2JA5 B;  1ICF B;  1SRO A;  4ME3 A;  5C3E B;  1B70 B;  3GTJ B;  3FVQ A;  3OTO L;  1YHQ A;  4IFD J;  3HOZ H;  1H9S B;  2I5L X;  2RBM A;  1DD2 A;  3D31 A;  4A3D H;  3F2U A;  3TRZ A;  2JA9 A;  1FNU A;  1HJP A;  2G9D A;  4O0A A;  5I6W A;  4DPG A;  1DON A;  3ERO A;  4IUV A;  3K6O A;  1DOL A;  3QB3 A;  4JOI C;  1XMQ Q;  2BA0 A;  1IYJ B;  3NEN A;  1AP0 A;  5LL6 X;  5BN4 A;  3A8J E;  1QNU A;  4UP7 A;  2IJ0 A;  5C0X J;  2EY1 A;  3L7Z C;  4N8X 1;  1DZ1 A;  1SNQ A;  4G7O C;  4JI3 Q;  2B39 A;  4DKA C;  3S24 A;  1QVC A;  4UY8 C;  1TT2 A;  4KKS A;  1AN8 A;  2GN5 A;  4EQN A;  1EY5 A;  3V05 A;  2IWH A;  5BN5 A;  3O13 A;  3CC2 A;  2RHS B;  4UP9 A;  4OXP A;  4R4I A;  5NUC A;  4POG A;  2CFM A;  4GLA C;  1SBB B;  2V4D A;  1BOS A;  2JXM B;  1K0R A;  4F87 A;  1CKN B;  4DR3 L;  1G8Z D;  3S1Q B;  1I4X A;  4DR4 L;  3SXH A;  1MD2 D;  2E5L L;  1VQF A;  3U50 C;  4C3J G;  3TRE A;  1F9R A;  2Q2T A;  3CC7 A;  1HZB A;  4XT3 B;  3LNN A;  3NPP A;  1SNC A;  1K3B C;  4B3T Q;  3NTK A;  3MZ5 A;  2LY7 A;  1R9T B;  3UDF A;  1BNZ A;  3S1R H;  4P72 A;  2IHF A;  3J7A F;  3H0G B;  1M1K C;  2VXW A;  3BDL A;  1TQO A;  5E3F A;  1B9N A;  1BCP C;  4KD4 A;  4CGY B;  1QZG A;  1PH2 A;  1KL9 A;  4BBS B;  4JI1 L;  4IQZ A;  2R7F A;  2F0D A;  5EPL A;  2JEA I;  3S1M H;  1S72 A;  1G91 A;  3KF8 B;  1QVF A;  1PH3 A;  1OXV A;  2VL6 A;  2VUM H;  4DAV A;  1TKW B;  1VS0 A;  1NTG A;  1PTO C;  1PHJ A;  5IGF A;  4BY1 H;  2NVX B;  1CZW A;  1Q81 C;  2JA8 G;  1U0L A;  4CHT B;  2FMM A;  2R3Z A;  1AEX A;  3J81 E;  4POF A;  4DR7 Q;  2K5D A;  4K6L A;  1K8O A;  3PGZ A;  3EJI A;  3NBH A;  1JE4 A;  4DV0 Q;  4A3M G;  1I3Q B;  1TWA H;  1T5E A;  4A3F G;  2V1C C;  4R8I A;  3TEH B;  1GKH A;  4NB3 A;  5LMU Q;  2RKS A;  1EY7 A;  3K7U C;  3GTL B;  4A3J B;  2L55 A;  1SJH D;  1H9M A;  1Z47 A;  5ELE A;  2F03 A;  4V0B A;  1B3A A;  2CW0 D;  1J9O A;  2B3G A;  3ERS X;  2CWP A;  1ILQ A;  3BU2 A;  4A3D G;  2HQL A;  5IGB A;  1YI2 A;  4DNR B;  3QJY A;  2F0V A;  1PMR A;  4XT1 B;  4DUZ Q;  3H3V I;  1CSQ A;  3TP8 A;  1T5X D;  1ZKO A;  3MEH A;  2E8G A;  5AFW A;  4JI4 L;  4JBJ A;  5ELO A;  3TP6 A;  5C4H A;  3K5M A;  1YNJ C;  4JBM A;  1N33 Q;  1LT4 D;  1K9M C;  2VZA A;  4YCW A;  5CMD A;  1RDP D;  2RSO A;  4HMI A;  4HN7 A;  4UHV A;  1O7Y A;  4NW2 A;  3I4L A;  4IJH A;  1DJR D;  5HGQ A;  3RLO A;  1A62 A;  4DK0 A;  3SE0 A;  4A3E B;  3HOY B;  4LF4 Q;  2NZO A;  1EYA A;  1VQ4 A;  5T1I A;  1VQO A;  1EFI D;  2Q8R E;  1DXM A;  4IUR A;  4LJZ C;  5A2Q L;  1STY A;  3NWT A;  3CXC A;  1M8A A;  3CC4 A;  1PRT F;  1F9P A;  3T1Y Q;  4APV A;  4A4I A;  1TWC H;  1DOM A;  3IRB A;  2H5X A;  1AE3 A;  3AYH B;  4X66 Q;  1VF5 C;  1N34 Q;  3AFQ A;  2HCI A;  4B9X A;  4QCL A;  1TWF H;  5M9O A;  4FXD A;  1HNW Q;  3SGI A;  4DV4 L;  4CJ0 B;  4DR5 L;  1QG7 A;  1NNX A;  3BVG A;  1EZ6 A;  2F0F A;  4K2L A;  4RKL A;  4BY7 H;  4ID6 A;  5LMN L;  1PVO A;  3VYR A;  3OWF A;  1XNQ Q;  4O2D A;  2E2D C;  1S5D D;  1X55 A;  3PIP A;  3D6C A;  5CYU A;  1F77 A;  2D2C C;  4ZUJ A;  4CDC C;  2F4V L;  1Q82 C;  2F0K A;  1WCM B;  2IL8 A;  1CK1 A;  3S14 B;  2EYJ A;  3KF8 A;  3A8K E;  2AWO A;  5JJK A;  4JI6 Q;  1D8L A;  2OT2 A;  1IBM L;  1EL0 A;  1NAP A;  1PTO D;  5GAE C;  3BZK A;  1OXT A;  4A3B H;  5CBE E;  2D0O A;  1PH7 A;  1SE4 A;  2B2V C;  5IOD A;  2Q2I A;  2RF4 A;  1RHP A;  4GNX A;  3HRZ C;  1GOZ A;  5IOC A;  4A3M B;  1I50 H;  2Z8L A;  3ER0 A;  3KLS A;  2PI2 E;  4A3F B;  3PO2 H;  4ZKC B;  3S17 H;  2ZJR A;  1UEB A;  2HUG A;  1WTX A;  1RCV D;  4JI2 L;  2OEO A;  4GN5 A;  4L5T A;  1KNA A;  2EYP A;  5A2Q E;  4A3C H;  3HOZ B;  2YTX A;  1Y8P B;  2MO1 A;  4A3D B;  2A6E C;  2I5H A;  3SK8 A;  2ICI A;  1I4R A;  4P75 A;  5COY A;  2PZU A;  1HHV A;  3PIO A;  2YV5 A;  3NSW A;  1IKM A;  4ZYS A;  3S2D H;  1BBW A;  2VB3 X;  4PMB A;  2KEC A;  1EY8 A;  3STB C;  4RAU C;  1MJE A;  1YNJ D;  4KY5 A;  4LK1 C;  1JE5 A;  4OIJ A;  3E9I A;  2L1B A;  3BYT B;  1PFM A;  3C46 A;  4IUN A;  4C2M H;  4QIW E;  1A63 A;  4B3S L;  1VQ7 A;  2LSS A;  5C5M A;  5C44 G;  2UXD Q;  3MA2 B;  2K33 A;  1VQ9 A;  1UUP A;  3G71 A;  4QUF A;  4IPG A;  4QL5 A;  3NP8 A;  2NVT H;  1KQS A;  4QF4 A;  1GD7 A;  3S1R B;  3M9B A;  4BXX H;  1X56 A;  5DEH A;  3J7A V;  2E2J H;  1GUS A;  1KAW A;  1VQH A;  4IJL A;  1SR3 A;  4RHR A;  4IUQ A;  1Q1B A;  2ZTC A;  4B9W A;  5IYD G;  3S1M B;  2K1B A;  3GP7 A;  3H94 A;  4KLK A;  2WV6 D;  3JC6 6;  3VYS A;  1A2U A;  2R61 A;  4JBW A;  1HR0 W;  2VUM B;  1FJG L;  1HNZ L;  1ROD A;  1B1Z A;  1SE3 A;  1NY4 A;  3DMU A;  1MIU A;  3DWA A;  4XIG S;  2KQ3 A;  4FF2 A;  2LXK A;  2Q2U A;  1D1K A;  1JQY D;  2F0P A;  4LUZ A;  3AMU A;  1EWI A;  4L5R C;  1Y14 B;  3X3N A;  4B3M Q;  3UE0 A;  4DU9 A;  2M00 A;  1BCP F;  1TWA B;  2ES2 A;  5JEA G;  1X3E A;  4BA1 I;  5FO8 B;  2JYO A;  5EKK A;  3PO2 G;  4KHP L;  3N6R A;  4TKO B;  5K5P A;  4QGU A;  5G3L F;  5L37 A;  4JI8 Q;  5IYC G;  1Q8I A;  5M3M H;  1KAA A;  1JOO A;  1TU2 B;  3Q23 A;  4DA2 A;  4A3C G;  1B8A A;  1CHQ D;  3I90 A;  1F2Z A;  4GOP B;  2C5C A;  4QQB X;  4GKK L;  2K03 A;  3QIA A;  4JI7 L;  3U4V A;  4WJW A;  3K7A H;  1JJ2 A;  2HCC A;  2IX1 A;  2PQA B;  1EQT A;  2XVS A;  3E3X A;  4OWW B;  3Q6S A;  1Y1W G;  1PYS B;  2UXC Q;  1JCK B;  1R4Q B;  1SJE D;  3ZYY X;  4DV7 Q;  4OX9 Q;  1BQQ T;  3NXW A;  1DOK A;  1HPC A;  5FLX c;  2B2T C;  5TSS A;  4TRD A;  5KYI A;  2RSN A;  1GUT A;  4PZ8 A;  5IGD A;  4DR1 L;  4A3L G;  1WFQ A;  1UWV A;  2Y0S E;  4A75 A;  1R9T H;  2WAC A;  4JYA Q;  1WTP A;  3KLS X;  4RGT A;  5JVG 3;  1DCZ A;  4IFD H;  2A6E D;  1Y8N B;  4JOI A;  4B3R L;  4N8F A;  5A35 A;  2K5Q A;  2XWJ B;  5EKL A;  1RTO A;  4LF7 L;  2QA4 A;  1GXD C;  4HMJ A;  2HD3 A;  4NXN L;  5IP7 G;  5AJ3 L;  2ZXP A;  5IYB H;  1WTH A;  4X3U A;  1LAC A;  1PH5 A;  2PZT A;  2KOL A;  3STB D;  1MJC A;  5C0X H;  1EY4 A;  5D65 A;  4DK1 A;  1JOQ A;  4L6T B;  1U4L A;  1I5F A;  4IPC A;  1D5Z C;  4MZ9 A;  5M5W H;  2ZM6 L;  4P2C B;  2VY3 A;  4X62 L;  5JEA J;  1TY2 A;  5C44 B;  1BBU A;  1MI2 A;  2MFI A;  1XJV A;  1TWF B;  2KCC A;  4YWK A;  2DUD A;  4MTN A;  4IPD A;  3Q24 A;  1F2Y A;  3J81 c;  4X64 Q;  5F2D A;  3T16 A;  3SR1 A;  4K8J A;  4BY7 B;  1P16 A;  3IFT A;  3H91 A;  4H7B A;  1EWH A;  3VR4 A;  4C3I G;  3Q0A A;  3CKI B;  4A3I H;  2FHT A;  4J6H A;  4LF5 L;  4OGQ C;  3TN2 A;  4CKB A;  3UDG A;  4CBV A;  4KKU A;  3KDF A;  1HTP A;  3NHH A;  4KY7 A;  4NP5 A;  2RA4 A;  1FVI A;  1Q90 A;  4X65 L;  3X3M A;  1ICW A;  2B8F A;  1G2S A;  5KND A;  5M3M G;  1PRT C;  2K14 A;  2B29 A;  2A6H D;  1Q86 C;  2YTV A;  4DAM A;  4EQP A;  1PH9 A;  1PLF A;  2HT1 A;  2I5M X;  3K0X A;  3KBX A;  4LF8 Q;  3RNU A;  1I50 B;  4DR2 Q;  3S16 H;  1HA5 A;  2EJG C;  1VQG A;  2AMC B;  3PO2 B;  4JI0 L;  3S17 B;  1ENA A;  3I72 A;  2EJF C;  1EIF A;  1X3P A;  2EPB A;  3JAM c;  2EZV A;  2ID0 A;  3E5S A;  3CF5 A;  1KC8 C;  4DV2 Q;  1E24 A;  3TDQ A;  4LFB L;  1QVG A;  3GTM H;  1UE1 A;  3TP7 A;  3NTH A;  1RF2 D;  4ABN A;  1SYB A;  3S2D B;  4KTA A;  1HZA A;  4Q5V A;  4GKJ Q;  4ZRZ A;  4C3J H;  5IYB G;  1B9M A;  5C6A A;  3SHL A;  2O5J C;  1TS2 A;  1B3Q A;  1BUV T;  1UNS A;  5FLX L;  2YYZ A;  5C0X G;  3CP0 A;  3D4W A;  1EU4 A;  1F9Q A;  1E2W A;  2F0T A;  1STB A;  2PMZ E;  1WVL A;  2XNA C;  5C5L A;  1U9R A;  2RDF A;  4AYB B;  3MWY W;  3NBH B;  4K14 A;  1X3G A;  3HOX H;  4MTK A;  2L4N A;  1WTQ A;  2K5H A;  1VCI A;  1CI3 M;  4DN4 M;  1ZEQ X;  2DJF C;  4C56 C;  5BR8 L;  1Q8K A;  4M1U B;  1HUM A;  3DLL A;  4FF3 A;  3GQB A;  1S5C D;  2NVT B;  2EYL A;  5LMN W;  2H4O A;  2HIX A;  4KKT A;  3I7F A;  4RWS C;  3NUC A;  2CHB D;  4MN3 A;  2E2J B;  4Q0F A;  2JA8 H;  4DNI A;  4A3I G;  4DV6 L;  2EXZ A;  2A73 B;  4ULL A;  2F0N A;  2PW5 A;  1N8R C;  1XNR L;  4LMQ D;  2EYH A;  1YNX A;  3EFX D;  4BBR G;  1CT1 D;  1J8I A;  3NQI A;  5J1Z A;  2Z9H A;  1JWS D;  3Q22 A;  1N36 Q;  3FPP A;  1O78 A;  3RZO B;  5KNC A;  3J81 L;  1ESF A;  2XTI A;  1XXG A;  3MAQ A;  3HOU G;  1I4Q A;  2EOT A;  4X3S A;  1V1O A;  1LTB D;  1YJN A;  3FMC A;  3F1Z A;  3M4Q A;  2JJQ A;  2L15 A;  2XGT A;  5ISR A;  2HIV A;  2BDN A;  1EWC A;  4FXG C;  5M3M B;  2EJM A;  2B2V A;  2QEX A;  2FMC A;  2K50 A;  1D1I A;  4ZAI A;  5HGT A;  4KK7 A;  1PRT D;  2VQE Q;  1EYC A;  4JG2 A;  1EEF D;  2N3S A;  3PUV A;  5FLX E;  2I07 B;  5C4J H;  1HUN A;  4I65 A;  1K73 C;  3K7A B;  1C8C A;  4DK3 C;  2E75 C;  4LF6 Q;  4RKB A;  4YHH L;  3R93 A;  2B8G A;  1VMP A;  4QY7 A;  3TME A;  3C1E A;  3VA7 A;  2JK8 A; 
#chains in the Genus database with same CATH homology
 1D2B A;  2EY5 A;  2XWB B;  5CV7 A;  1GUW A;  1IKL A;  3P7J A;  1V43 A;  5D3D A;  1X3Q A;  3JAM L;  1WTR A;  2NWG A;  1PFN A;  2DY7 A;  1NUC A;  2B2W C;  4H13 C;  3IAY A;  1HFN A;  1K8M A;  3DUZ A;  1PTO H;  3M7G A;  1STN A;  1ZYR C;  2XRQ D;  2EVB A;  4ODG A;  1WD1 A;  1GJX A;  1H9J A;  3D6W A;  4C3H G;  4IUT A;  1SSO A;  5M5W B;  3V2T A;  2AQ2 B;  3T56 B;  1MGS A;  3RUZ A;  2QF7 A;  1WTW A;  4XYO A;  2EYM A;  1JWM D;  4RCO A;  2WKC A;  5T1G A;  1SYG A;  1I4P A;  3PUY A;  4RA8 A;  5I6Y A;  1IL8 A;  1STE A;  1UEA B;  3VR6 A;  4A3I B;  3AU7 A;  2N88 A;  3QOJ A;  4HCS A;  2BA1 A;  4G7Z C;  1BXT A;  2D62 A;  2NYZ D;  1QB5 D;  2KHS A;  3NBI A;  1STG A;  1I4G A;  1JB3 A;  4CKC A;  2IX0 A;  3G6J B;  4E6I A;  4WOR A;  3JAM E;  3NE5 B;  4PMC A;  2PNR C;  1YNN C;  3S16 B;  5KGU A;  2K04 A;  3OWE B;  2F0H A;  1LTA D;  4WRD A;  1SYD A;  3OW7 A;  1WD0 A;  1A15 A;  3TZD A;  1TS3 A;  2D5D A;  3ERQ A;  3E0J A;  3GTM B;  3TBI B;  4O42 A;  3MFG A;  1E2V A;  3T13 A;  1KDA A;  5FK9 C;  1PZJ D;  2TMP A;  2B2T A;  2X69 A;  1QCB D;  3FDT A;  2VB2 X;  4C3J B;  5HUR A;  3M7N A;  2KVM A;  4DAY A;  2K32 A;  3D3R A;  1PXU A;  4L8J A;  5I2X A;  5JOB A;  1IYU A;  4J1M A;  1U4M A;  1XTC D;  3HOX B;  4A3G B;  3KBG A;  1FD7 D;  5IIF A;  1BCP D;  2MGS A;  1ZYR D;  5G3L D;  5DAU A;  5C4Z A;  1SXT A;  4V19 0;  1E0B A;  2JA8 B;  4K8I A;  2EDG A;  1FNV A;  3NQT A;  3SK5 A;  5D14 A;  2E2I B;  1WTO A;  1G2T A;  3HP3 A;  3I70 A;  3GV6 A;  3MXU A;  4G4K A;  2FIN B;  5JEA H;  5FOB B;  2A68 C;  4TSS A;  1XX8 A;  1RD9 D;  3CU7 A;  5C3W A;  1F2M A;  1S5B D;  4HCE A;  2X6L A;  2XSC A;  5JVH 3;  1BBX C;  3DWQ A;  1FR3 A;  3D4D A;  1A3T A;  3C2P A;  1KAB A;  2B2U A;  1ML0 D;  4N9T A;  2Q8I B;  1Q3L A;  4HR7 B;  3VR3 A;  3H3V C;  4QIW B;  4IFD I;  2CQA A;  5C4J B;  2L0C A;  2PCF B;  3J7Y W;  4G57 A;  1KDB A;  3K5N A;  1GUN A;  4KHV A;  3ONA B;  1RTN A;  1SNM A;  1MBY A;  2HQE A;  1YNN D;  2LKV A;  2O2L D;  3S2H B;  3VA5 A;  1H9R A;  1F9S A;  5CV8 A;  4FXK C;  1SNP A;  5C0X I;  4N9P A;  3P75 A;  1STH A;  4HTH A;  5DNF A;  2NN6 H;  1BCP B;  1QE6 A;  3PO3 B;  1I6V C;  3MXP A;  4ILW A;  4U67 3;  4J8Q A;  2RDG A;  4OIK A;  1PTO B;  3DXJ C;  2JEB I;  1HTL D;  5I9O A;  1I4H A;  3OMC A;  3MXG A;  1VF7 A;  2KA7 A;  3S15 B;  1QIL A;  2ZXR A;  3DEP A;  4KN7 C;  1L0Y B;  2JA7 B;  2ZXO A;  3URY A;  1WTV A;  4DGZ A;  1HCZ A;  1FNW A;  1QJO A;  5EPJ A;  1OXU A;  3GTP B;  1R4P B;  2I46 A;  3VYU A;  4PV1 C;  1HQM C;  1VMC A;  2F0U A;  1G29 1;  2A69 C;  3OOC A;  3OMG A;  4U68 A;  4WFN 3;  4HAE A;  2R92 B;  2DN8 A;  3A8I E;  4FYD A;  3PMF A;  5JJZ A;  3OHX C;  1ET9 A;  2F0Q A;  4ZQ3 A;  3K59 A;  3E6Z X;  1SYE A;  1AFP A;  5COR A;  2Y0S B;  3A55 A;  1H9K A;  5CGK A;  3QOL A;  2MHV A;  4ZLT F;  1EYD A;  5ELF A;  4A93 B;  1LTR D;  1C48 A;  1O80 A;  2AQ3 B;  2NUC A;  1CA6 A;  4RGO S;  3TP5 A;  4BS9 A;  3M3Y B;  3I3C A;  3ND9 A;  4ZUI A;  2OXP A;  5CC4 A;  4CKE A;  2NN6 G;  1DYQ A;  4K2K A;  4H44 C;  4F88 A;  4PQX A;  1XWE A;  1LT6 D;  5I4D A;  4DXG A;  5EQ0 A;  1PFB A;  3IL8 A;  2F0J A;  4XQQ A;  3DHQ A;  2MPM A;  2F0E A;  1KTK A;  3KK7 A;  4QUC A;  5D3I B;  1EU3 A;  3UI2 A;  1O7Z A;  1Z6H A;  1ONL A;  4C1N I;  2E76 C;  4O1N A;  5JPN C;  1NR4 A;  3C1F A;  2R93 B;  3BZD B;  4HSV A;  4KMU C;  1IW7 C;  3ND8 A;  2JP1 A;  3PUZ A;  3QWN A;  1L0X B;  1LT3 D;  3PUX A;  3WOF A;  3FKI B;  2D9U A;  3EVQ A;  4YIJ A;  3H6M A;  3FEW X;  3MTS A;  4CJ2 C;  3T51 B;  2K6A A;  5J22 A;  1JIC A;  1BO0 A;  4G7H C;  2LS0 1;  1LO5 D;  4I7Z C;  4MIU A;  4XTC S;  4OL7 A;  3J80 E;  2IX3 A;  1S5F D;  3I8Z A;  2MJ8 A;  3LWU A;  3FPU B;  1Y1W B;  2RVL A;  4Y7N B;  3SVM A;  1DM0 B;  3PUW A;  3HGB A;  4ME5 A;  1SAP A;  3K57 A;  1CFM A;  1SMY C;  2PMZ B;  2BCO A;  3G7L A;  5EKI A;  4ZK9 B;  2PPB C;  5FO9 B;  1STA A;  4FP5 D;  3BG3 A;  2FJ2 A;  3DM1 A;  1V1P B;  1TS5 A;  1Y8O B;  1TS4 A;  1G6Z A;  1SYC A;  3RZD B;  1TR5 A;  5C3X A;  1GUG A;  2B2Y C;  4KI0 A;  4KHZ A;  3QO2 A;  4QMG A;  2K7V A;  1Q12 A;  4IZ8 A;  4S3S A;  2VNU D;  4PMW A;  3EA6 A;  2F0W A;  5C4X B;  5K36 H;  3IKJ A;  2QDB A;  2X6G A;  5EBD A;  3LWE A;  4C3I B;  1OO9 B;  1CHP D;  2F0L A;  2F3V A;  4KD3 A;  4ZKB B;  2L12 A;  3W3A A;  2C9O A;  4OO1 H;  2A5H A;  2QEJ C;  1FGB D;  2BOS A;  2NBF A;  1A2T A;  5I9P A;  1EY9 A;  2N55 A;  2IT1 A;  2PO4 A;  2JSO A;  1B2T A;  1IW7 D;  3D4R A;  3GTQ B;  1EIG A;  4OHJ A;  4DAP A;  3TZU A;  4DF7 A;  2F0G A;  5I2Y A;  1ENF A;  4F7X A;  2O5I C;  2MP1 A;  3KLR A;  5KYL A;  1X32 A;  3HOV B;  2L9H A;  3HEJ A;  5ELD A;  4IAL A;  5IGG A;  1LTI D;  1B4O A;  2F0O A;  2K28 A;  2AUK A;  3LX0 A;  1QOH A;  4F8M A;  3A7L A;  1IHZ A;  4K5V A;  1LTG D;  1RJT A;  1PZI D;  2HDL A;  1LT5 D;  1XYI A;  4FF4 A;  1JWU D;  2BE5 C;  4FNF A;  3SEB A;  2L11 A;  5CV6 A;  4K5W A;  3MC0 B;  1SMY D;  1SEB D;  4XQJ A;  1TY0 A;  4IUU A;  2EE1 A;  1AZQ A;  2F4I A;  3MHB A;  4RCN A;  1V1P A;  2Q8T A;  3VR2 A;  2J7Z A;  1E2Z A;  5K36 G;  2LFN A;  1W6K A;  3R8B A;  1S5E D;  5DM7 3;  1KNE A;  1B53 A;  2AWN A;  4XDX A;  3RD4 A;  1PDQ A;  1KLG D;  5E1F A;  2PYK A;  4TQU S;  4OO1 G;  5ELB A;  1PRT B;  1HQR D;  1JOR A;  4BBR B;  2RDH A;  5LHY 1;  3NWS A;  4KV6 A;  1B50 A;  2R7Z B;  4FF1 A;  1GHK A;  4NDX A;  5BN3 A;  3MXN A;  3U9S A;  3HOU B;  1CZG A;  1QNK A;  4KY6 A;  4MHE A;  3HG9 A;  3I4N B;  1K83 B;  3BS1 A;  2NVQ B;  1OXX K;  2B63 B;  3V96 A;  2M9V A;  1U4R A;  2QCP X;  2F0I A;  1S4Z A;  5M5X B;  3SK4 A;  2NB0 A;  2R6G A;  2A74 C;  3L9A X;  1H9S A;  3NK9 A;  4BA2 I;  5FKA C;  5KIX A;  4KN4 C;  5EJW A;  3ITP A;  3BYY B;  1NCV A;  2NN6 I;  1PZK D;  1BDO A;  1Y1V B;  1TWH B;  4IN3 A;  4A3K B;  4RFB A;  3AB9 A;  3M4Y A;  4FVM A;  2K01 A;  5JPM C;  2NTS A;  3CRL C;  5EPK A;  3GD7 A;  1TWG B;  2SDF A;  1HRJ A;  3D8G A;  4DNT B;  2J0T D;  1GHJ A;  1ZXT A;  3N52 A;  5IGE A;  3P20 A;  2BE5 D;  3I91 A;  4C3H B;  2F1M A;  4RGM A;  4UAI A;  3A56 A;  4BWG B;  2PW7 A;  3BDO A;  3HKZ B;  5M5Y B;  3T4A C;  4DXF A;  3DWP A;  5CV5 A;  1JOK A;  3OIQ A;  2L5T A;  5KNB A;  5KEE A;  1U4P A;  1KDC A;  5CV9 A;  4CJ1 B;  3K58 A;  3P1H A;  4FO2 A;  3VYT A;  3C3L A;  1MSH A;  2IPK D;  2M2L A;  1EOT A;  3GTG B;  2EYF A;  2EYO A;  4X3K A;  2SNM A;  2DNC A;  2KUM A;  3HS0 C;  1SYF A;  2PZW A;  1NR2 A;  1HXY D;  2YU9 B;  4GZY C;  1ESR A;  4K5X A;  1Q1E A;  3FRP B;  4IUP A;  3GTO B;  3M85 A;  2KCN A;  1EIH A;  3TSS A;  1NSN S;  3VR5 A;  4R8N A;  5EBC A;  2K5W A;  1SFO B;  3I4M B;  3CHB D;  4RHS A;  4EQO A;  3QG1 A;  3OPO A;  3CQZ B;  3S9W A;  3MVV A;  4HED A;  3GTK B;  3MFY A;  3PV0 A;  1QWY A;  3GO5 A;  1BR9 A;  2K05 A;  4QB4 A;  4EVO A;  1Y69 U;  1EQV A;  2KEE A;  1SND A;  2B2Y A;  1VDZ A;  4KJO A;  5JAV A;  3I73 A;  1RKN A;  1IYV A;  1A6X A;  1D5X C;  4RH6 A;  4BY1 B;  2A6H C;  3K5O A;  5E4W C;  1D6E C;  1TVX A;  1HFG A;  3HZX A;  3EQL C;  1BF4 A;  1SE2 A;  3R3O A;  5ELC A;  1PYW D;  3SDZ A;  2WKD A;  3GV3 A;  2MUY A;  2ZT9 C;  1V8Q A;  5E4X A;  4R9W A;  2KJX A;  2LMC B;  2A68 D;  2BDO A;  1PTO F;  1Z7T A;  1A3V A;  3OSO A;  3WDN A;  3BDC A;  3NTI A;  4XXE A;  5LL6 S;  5IT9 L;  1CTM A;  2J4X A;  4B08 A;  2E2H B;  2WIN B;  1JC7 A;  4KJN A;  2DNE A;  2EY2 A;  3R2T A;  1W6J A;  1II3 A;  1CA5 A;  2ICE C;  3BVZ A;  1KLU D;  2JE6 I;  3J80 L;  1OXS C;  2CVR A;  2G9H D;  3A7A B;  2AUJ D;  4XYQ A;  1MSG A;  3DEO A;  5M3F B;  3PIP 3;  2Z4I A;  1SNO A;  2QKI C;  3OIP A;  2XIW A;  1FYC A;  1CQV A;  1M4V A;  4K6D A;  1TWC B;  5CR3 A;  1EY6 A;  2B2W A;  3K0Y A;  2Z1C A;  2SOB A;  4H0L C;  1D5M C;  4UDU C;  1SDF A;  4PNY A;  3L3O C;  2SNS A;  1F2L A;  2WB1 B;  5FO7 B;  1LV9 A;  3A54 A;  4LAA A;  5IGC A;  1LLR D;  3S1N B;  4NKL A;  4OO1 I;  1GUO A;  2Z4H A;  2GA4 B;  5IT9 E;  3RLF A;  1LTT D;  2WII B;  4X3T A;  2XRS D;  1ET6 A;  4XQN A;  4M8A A;  2EY6 A;  4EGV A;  3PIO 3;  2NZ1 D;  2H1E A;  2B2U C;  4A3B B;  5EGT A;  2A69 D;  3WOE A;  1UAP A;  2NTT A;  1TII D;  2KED A;  4JK1 C;  2TSS A;  3IFD A;  1C4Q A;  2NVY B;  2PQE A;  3BVM A;  1ENC A;  2F0S A;  1O7L A;  3M4O B;  2QIL A;  5KRU A;  4Z9C B;  5CBA E;  2F3W A;  2SEB D;  2JA6 B;  3K5L A;  3T53 B;  1I6H B;  3SK6 A;  4IFD G;  1EEI D;  1LTS D;  2WP8 J;  3KUP A;  2AQ1 B;  2XN9 C;  1EY0 A;  1AZP A;  4DFA A;  4C1N K;  1A3U A;  3CRK C;  2HDM A;  4NMZ A;  1LAB A;  1CM9 A;  4C2M B;  5CV4 A;  1AW7 A;  5DM6 3;  3U9O A;  1JR0 D;  3RMH A;  2RQX A;  3H09 A;  4HSP A;  2ENB A;  3R2I A;  3HOW B;  1HA6 A;  2O4X A;  1CQF A;  2F0M A;  2OF1 A;  2CW0 C;  2FFK B;  2DY8 A;  2E74 C;  1EZ8 A;  2IW3 A;  5J39 A;  3W2D A;  2WAQ B;  4L63 B;  1ILP A;  1B44 D;  4RGN A;  2JA5 B;  5C3E B;  3GTJ B;  3FVQ A;  4IFD J;  1H9S B;  2RBM A;  1DD2 A;  3D31 A;  3F2U A;  1FNU A;  2G9D A;  5I6W A;  1DON A;  3ERO A;  4IUV A;  3K6O A;  1DOL A;  3QB3 A;  2BA0 A;  1AP0 A;  5LL6 X;  5BN4 A;  3A8J E;  1QNU A;  2IJ0 A;  5C0X J;  2EY1 A;  3L7Z C;  1DZ1 A;  1SNQ A;  4G7O C;  2B39 A;  1TT2 A;  4KKS A;  1AN8 A;  5BN5 A;  4EQN A;  1EY5 A;  3V05 A;  2IWH A;  3O13 A;  5NUC A;  1SBB B;  2V4D A;  1BOS A;  2JXM B;  4F87 A;  1G8Z D;  3S1Q B;  1I4X A;  3SXH A;  1MD2 D;  4C3J G;  1F9R A;  4XT3 B;  3LNN A;  3NPP A;  1SNC A;  3NTK A;  3MZ5 A;  2LY7 A;  1R9T B;  1BNZ A;  3J7A F;  3H0G B;  2VXW A;  3BDL A;  1TQO A;  5E3F A;  1B9N A;  1BCP C;  4KD4 A;  4CGY B;  4BBS B;  4IQZ A;  2F0D A;  5EPL A;  2JEA I;  1G91 A;  1OXV A;  4DAV A;  1TKW B;  1PTO C;  5IGF A;  2NVX B;  1CZW A;  4CHT B;  2FMM A;  2R3Z A;  1AEX A;  3J81 E;  2K5D A;  4K6L A;  1K8O A;  3EJI A;  3NBH A;  1JE4 A;  1I3Q B;  1T5E A;  4R8I A;  2RKS A;  1EY7 A;  3GTL B;  4A3J B;  2L55 A;  1SJH D;  1H9M A;  1Z47 A;  5ELE A;  2F03 A;  4V0B A;  1B3A A;  2CW0 D;  1J9O A;  1ILQ A;  5IGB A;  4DNR B;  3QJY A;  2F0V A;  1PMR A;  4XT1 B;  3TP8 A;  1T5X D;  1ZKO A;  3MEH A;  5AFW A;  3TP6 A;  5C4H A;  3K5M A;  1YNJ C;  1LT4 D;  5CMD A;  1RDP D;  2RSO A;  4HMI A;  4HN7 A;  1O7Y A;  4NW2 A;  3I4L A;  1DJR D;  3HOY B;  4DK0 A;  3SE0 A;  4A3E B;  1EYA A;  5T1I A;  1EFI D;  2Q8R E;  1DXM A;  4IUR A;  4LJZ C;  5A2Q L;  1STY A;  3NWT A;  1M8A A;  1PRT F;  1F9P A;  1DOM A;  1VF5 C;  2HCI A;  4B9X A;  4QCL A;  5M9O A;  4FXD A;  4CJ0 B;  1QG7 A;  3BVG A;  1EZ6 A;  2F0F A;  4K2L A;  4RKL A;  4ID6 A;  3VYR A;  3OWF A;  2E2D C;  1S5D D;  3D6C A;  5CYU A;  1F77 A;  2D2C C;  4ZUJ A;  2F0K A;  1WCM B;  2IL8 A;  1CK1 A;  3S14 B;  2EYJ A;  3KF8 A;  3A8K E;  2AWO A;  2OT2 A;  1EL0 A;  1NAP A;  1PTO D;  1OXT A;  5CBE E;  1SE4 A;  2B2V C;  5IOD A;  1RHP A;  3HRZ C;  1GOZ A;  5IOC A;  4A3M B;  2Z8L A;  3KLS A;  4A3F B;  4ZKC B;  2HUG A;  1WTX A;  1RCV D;  2OEO A;  1KNA A;  2EYP A;  5A2Q E;  3HOZ B;  1Y8P B;  4A3D B;  2A6E C;  3SK8 A;  2ICI A;  1I4R A;  5COY A;  2PZU A;  1HHV A;  3NSW A;  1IKM A;  4ZYS A;  2VB3 X;  4PMB A;  2KEC A;  1EY8 A;  4RAU C;  1YNJ D;  4KY5 A;  4LK1 C;  4OIJ A;  2L1B A;  3BYT B;  1PFM A;  3C46 A;  4IUN A;  5C5M A;  3MA2 B;  2K33 A;  1UUP A;  4QUF A;  3NP8 A;  4QF4 A;  3S1R B;  5DEH A;  3J7A V;  1GUS A;  4RHR A;  4IUQ A;  1Q1B A;  4B9W A;  3S1M B;  2K1B A;  3GP7 A;  3H94 A;  2WV6 D;  3VYS A;  1A2U A;  2R61 A;  4JBW A;  2VUM B;  1ROD A;  1B1Z A;  1SE3 A;  3DMU A;  3DWA A;  4XIG S;  2KQ3 A;  4FF2 A;  1D1K A;  1JQY D;  2F0P A;  3AMU A;  3X3N A;  4DU9 A;  2M00 A;  1BCP F;  1TWA B;  5JEA G;  5FO8 B;  4BA1 I;  5EKK A;  3N6R A;  4TKO B;  5K5P A;  5G3L F;  1Q8I A;  1KAA A;  1JOO A;  1TU2 B;  3Q23 A;  4DA2 A;  1CHQ D;  3I90 A;  1F2Z A;  2C5C A;  2K03 A;  3QIA A;  4WJW A;  2HCC A;  2IX1 A;  1EQT A;  2XVS A;  3Q6S A;  1JCK B;  1R4Q B;  1SJE D;  3ZYY X;  1BQQ T;  3NXW A;  1DOK A;  1HPC A;  2B2T C;  5TSS A;  4TRD A;  5KYI A;  2RSN A;  1GUT A;  5IGD A;  2WAC A;  1WTP A;  3KLS X;  4RGT A;  5JVG 3;  1DCZ A;  4IFD H;  2A6E D;  1Y8N B;  5A35 A;  2K5Q A;  2XWJ B;  5EKL A;  1RTO A;  1GXD C;  4HMJ A;  2ZXP A;  4X3U A;  1LAC A;  2PZT A;  2KOL A;  5C0X H;  1EY4 A;  5D65 A;  4DK1 A;  1JOQ A;  4L6T B;  1U4L A;  1D5Z C;  4P2C B;  5JEA J;  1TY2 A;  5C44 B;  1MI2 A;  1TWF B;  2KCC A;  3Q24 A;  1F2Y A;  5F2D A;  3T16 A;  3SR1 A;  4K8J A;  4BY7 B;  3IFT A;  3H91 A;  4H7B A;  1EWH A;  3VR4 A;  4C3I G;  3Q0A A;  3CKI B;  2FHT A;  4J6H A;  4OGQ C;  3TN2 A;  4CKB A;  4CBV A;  4KKU A;  1HTP A;  3NHH A;  4KY7 A;  4NP5 A;  2RA4 A;  1Q90 A;  3X3M A;  1ICW A;  2B8F A;  1G2S A;  5KND A;  1PRT C;  2A6H D;  4EQP A;  1PLF A;  3KBX A;  1I50 B;  1HA5 A;  2EJG C;  3PO2 B;  3S17 B;  1ENA A;  3I72 A;  2EJF C;  1X3P A;  2EPB A;  2EZV A;  2ID0 A;  3E5S A;  3TDQ A;  3TP7 A;  3NTH A;  1RF2 D;  4ABN A;  1SYB A;  3S2D B;  4KTA A;  4Q5V A;  4ZRZ A;  1B9M A;  5C6A A;  3SHL A;  2O5J C;  1TS2 A;  1BUV T;  1UNS A;  5FLX L;  2YYZ A;  5C0X G;  3D4W A;  1EU4 A;  1F9Q A;  1E2W A;  2F0T A;  1STB A;  1WVL A;  2XNA C;  5C5L A;  1U9R A;  2RDF A;  4AYB B;  3MWY W;  4K14 A;  2L4N A;  1WTQ A;  1VCI A;  1CI3 M;  4DN4 M;  1ZEQ X;  4C56 C;  4M1U B;  1HUM A;  4FF3 A;  3GQB A;  1S5C D;  2NVT B;  2EYL A;  2H4O A;  4KKT A;  4RWS C;  3NUC A;  2CHB D;  4MN3 A;  2E2J B;  4Q0F A;  2EXZ A;  2A73 B;  4ULL A;  2F0N A;  2PW5 A;  4LMQ D;  2EYH A;  3EFX D;  1CT1 D;  1J8I A;  3NQI A;  5J1Z A;  1JWS D;  3Q22 A;  3FPP A;  1O78 A;  3RZO B;  5KNC A;  3J81 L;  1ESF A;  1XXG A;  3MAQ A;  1I4Q A;  2EOT A;  4X3S A;  1V1O A;  1LTB D;  3FMC A;  5ISR A;  2BDN A;  1EWC A;  4FXG C;  5M3M B;  2EJM A;  2B2V A;  2FMC A;  1D1I A;  4ZAI A;  5HGT A;  4KK7 A;  1PRT D;  1EYC A;  1EEF D;  3PUV A;  5FLX E;  2I07 B;  1HUN A;  4I65 A;  1C8C A;  3K7A B;  2E75 C;  4RKB A;  3R93 A;  2B8G A;  1VMP A;  3TME A;  3C1E A;  3VA7 A;  2JYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...