4KY5A

Crystal structure of staphylococcal nuclease variant delta+phs v23d at ph 7 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D at pH 7 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky5A00
5F2DA 3OWFA 1KDCA 1RKNA 3SK5A 3V2TA 4B9XA 5CC4A 2F0DA 2RDFA 3U9OA 1A3UA 1U9RA 4KD3A 4ZUJA 4K14A 3P1HA 4K5XA 4RKLA 4DF7A 1IHZA 5KGUA 5IOCA 1A2TA 2F0TA 1SYDA 4ODGA 5IGGA 2F0MA 1F2YA 2EYOA 4K2LA 4H7BA 2EXZA 2PYKA 2EY1A 5ISRA 4DFAA 1JOQA 4KHVA 3R3OA 4WORA 3EVQA 2EY5A 2F0LA 1EY5A 4R8NA 1STHA 2QDBA 4DGZA 1AEXA 3ITPA 3NUCA 4F8MA 2F0VA 3OMGA 4QB4A 1SYCA 3BDCA 5E3FA 1II3A 2O4XA 5C6AA 4NKLA 3QB3A 5E1FA 5KYLA 2PZTA 3EROA 5I9OA 3S9WA 1STYA 1SYFA 2PW5A 5C3WA 2F3VA 2OEOA 3NXWA 5IGBA 3EJIA 5CV9A 5NUCA 3C1FA 1JORA 3LX0A 4K8JA 1TQOA 2PZUA 3T13A 5I9PA 4ID6A 3C1EA 4N9PA 1EY8A 2NUCA 3TMEA 5CR3A 2F0FA 1ENAA 3P75A 4LAAA 1EY0A 2EYJA 3MEHA 5CV4A 5C5LA 4E6IA 5K5PA 5EGTA 3OMCA 2F0OA 2SNMA 3H6MA 1STGA 3HZXA 1F2ZA 4QF4A 5CV8A 2HQEA 4EVOA 4YIJA 5HGTA 2F0UA 5HURA 5I6YA 3MVVA 5IGCA 4J1MA 5DEHA 5I6WA 3SR1A 5DAUA 3T16A 4HTHA 5IODA 2LKVA 2WACA 1STNA 1F2MA 1SNOA 5IGDA 4K8IA 4OL7A 2EYMA 2EYLA 3TP7A 3QOLA 4F7XA 3TP6A 3SK4A 1EY4A 1SNDA 3DMUA 4IALA 4KJNA 1EZ8A 4N9TA 4PNYA 4TRDA 2F0HA 3D8GA 4IZ8A 4NMZA 5EKLA 1NUCA 3MZ5A 3PMFA 5CV7A 2PQEA 2F3WA 1SNMA 2F0WA 2F0SA 2F0PA 4KJOA 4HMIA 4KY5A 1SNCA 4WRDA 3OSOA 1A3TA 2KQ3A 2RBMA 3D6CA 3NK9A 3TP5A 4KD4A 1KDAA 1KAAA 2F0IA 4ZUIA 5J1ZA 5KIXA 2F0GA 4KTAA 1JOOA 4J6HA 4IUNA 5CV6A 4PMCA 3VA5A 5KEEA 2F0QA 1EZ6A 4MIUA 3TP8A 5JOBA 2ENBA 5KYIA 4KY7A 5CV5A 2SOBA 4HMJA 3SK6A 4K5WA 4B9WA 3MXPA 1EYAA 2F0EA 2OXPA 3MHBA 4NDXA 2EYFA 4QMGA 4S3SA 1NSNS 4ZQ3A 2PZWA 5M9OA 1EYCA 1SNPA 1A2UA 1TR5A 2EY6A 3D4DA 4K5VA 3NP8A 1STBA 1SYGA 3DHQA 2PW7A 3D4WA 1JOKA 3NQTA 4G57A 2M00A 1SYEA 4NP5A 4EQOA 5C3XA 1EY6A 5EKKA 2KHSA 2EY2A 1STAA 4ME5A 4K2KA 1EY7A 2OF1A 4PMBA 5JAVA 1A3VA 4KV6A 4RKBA 5CGKA 1EY9A 4I65A 5J39A 3SXHA 2F0JA 3NHHA 5IIFA 5IGEA 1KDBA 1ENCA 2F0NA 2SNSA 4DU9A 2F0KA 4EQPA 2EYHA 3SK8A 3HEJA 4EQNA 3ERQA 4K6DA 2EYPA 4KY6A 1SYBA 3QOJA 1EYDA 5J22A 3BDLA 1TT2A 5C5MA 3SHLA 5C4HA 5C4ZA 5IGFA 1EQVA 5KRUA 1SNQA 1KABA 3RUZA 3E5SA 2RKSA
chains in the Genus database with same CATH superfamily
1HNZQ 4DR5Q 4TKOB 1U9RA 5ELFA 3CC4A 4A3DH 4A93H 3NBHB 1D5XC 3NWTA 2R7ZB 2HCIA 2O2LD 4DFAA 3S24A 3QR8A 4WORA 1M1KC 4LNQA 3AYHB 5FOBB 4XQNA 1EWCA 1AEXA 2J7ZA 4A93G 2JP1A 3I73A 4PQXA 2Z1CA 4YCUA 2IPKD 5E3FA 3S1MB 2QW7A 4FF4A 5C6AA 4NKLA 3QB3A 1GUWA 2I07B 1VQFA 4OO1I 4DKAC 1KLUD 2H1EA 4LUOA 5IE8A 4DV3Q 1S4ZA 2N78A 2RCNA 4IJHA 1LM0A 4ID6A 4LAAA 1EY0A 3TBIB 5C5LA 3J7YW 1KD1C 4YY3L 4A3KG 3KFUA 4BWGB 4RHRA 4GS3A 5CV8A 4GN4B 2L9HA 4OO1H 1BOSA 4LF7Q 2VXWA 3HOWH 4KKUA 3RN2A 4K6LA 1TS5A 2E5LQ 1EQQA 3G6JB 3HOVG 3HFZB 1N8RC 3CHBD 3A7AB 1VQCA 3PIPA 3LWUA 4OXPA 1I6HH 4DV0Q 2F0PA 4I7ZC 2EPBA 5IP9H 1RF2D 3UDIA 4RGNA 2B2TC 2M9VA 1A0IA 1JJ2A 3VA5A 3TN2A 2VZAA 4DR7Q 1CKMA 3TS0A 3G48A 1I3QH 1ESFA 4DNIA 5C4JB 4HIMA 5IWAQ 4X66L 4NDXA 5M9OA 2YTVA 1K3BC 5D3IB 1XNQL 5EPLA 2VQEL 4RG1A 3HOUG 3NTKA 5IYCG 1L0YB 1L0XB 1JQYD 2AHOB 2CQOA 1KTKA 2ZXRA 1VQDA 3CMEA 1X3EA 3R2IA 3PIOA 2EQSA 2K5DA 3KLRA 1EY9A 3NE5B 2FMMA 1PFSA 1ENCA 2UUAL 4A3FB 4ULLA 3UE1A 1IW7D 4DV7L 1KQSA 1VQ7A 4JI5L 1A62A 1WCMG 4IPDA 2F1MA 1VQ4A 1IXRA 2NZ1D 5FLXc 3E5SA 1MIUA 5GROA 3OWFA 4QIWE 1CSPA 1C4QA 1E1OA 2SEBD 1A3UA 3K7AB 1CA5A 1IHZA 3A8KE 4LUVA 2JN4A 5M3FG 1F2YA 5EPKA 5ISRA 2PYKA 4GN5A 2D2CC 1E2VA 1GUNA 3S1NB 1K8AC 4F8MA 2Z4HA 3J7AF 5AFWA 5LMUQ 1W6KA 3W5OA 4AIMA 5ELEA 2PNRC 4M1UB 2PMZE 3HOXG 5HY6A 5LMUL 2PZUA 4KHPQ 1VMCA 3GDEA 3WDNA 3TZUA 4DV2L 4BBSH 3CU7A 2FHTA 3RLNA 3MA2B 4BY7B 4G7HC 3OMCA 4BBRH 1BCPB 3D6WA 3CCQA 1G6ZA 1G2SA 4OX9Q 5DEHA 3A55A 2G9HD 2CVRA 3I7FA 1SNOA 1H9SB 2F52A 3S16B 3EFXD 5L37A 1HUNA 1PMRA 4KJNA 1GUOA 2L11A 4DR6Q 1N34Q 1K83B 2F0WA 4JYAQ 4KJOA 3HOYG 4A3GG 3NENA 1YNJC 4U68A 4JOIA 3W2DA 5K36H 4ZRZA 1GD7A 1S5FD 1MJCA 1G6PA 1IBKQ 4BY7H 5KYIA 1EIYB 2FJ2A 2B8FA 1HNZL 3J81E 3RMHA 1SE8A 2VNUD 2R93G 4QMGA 3CQZB 5GQOA 2I5HA 2EE1A 1NSNS 3FP9A 4BS9A 3M4PA 1TR5A 5M3MG 2R7ZH 3ULJA 3NQTA 2A6HC 2F4IA 2ZTCA 2PI2A 1DOKA 1STAA 2XSCA 4DAPA 1EY7A 4X3SA 3BZCA 3F1ZA 2UU9L 4H02A 1QVFA 4QIWB 1CHPD 2F0JA 2NZOA 1DOMA 3BDOA 5KNDA 4M8AA 4F87A 1I4RA 4YWMA 1OXTA 1AW7A 1Q8KA 1SDFA 1PFBA 3FPPA 3T1YQ 1Y8OB 3U4ZA 1IL8A 3I55A 1HZ9A 1SMYC 3CW2C 4P74A 4JI4L 1SBBB 2RDFA 1SMYD 5CC4A 1RHPA 1IW7C 1JB3A 3F2UA 4DAYA 3GTLB 1DYQA 1HXYD 4X6AH 3T51B 1JOQA 4H7BA 5BR8L 4HJ7A 1QNUA 3VYTA 2MO1A 1EY5A 1KL9A 2Q2HA 4A3KB 1TS3A 2UUBL 2FXQA 4A3JB 5IP7H 1BCPD 1WD1A 4LFCL 5GADC 4TVAB 1SYFA 1AZQA 1FGUA 3ER0A 1BUVT 3CD6A 3TMEA 1MD2D 1LT4D 1I3QB 1W3SA 4DV4L 3H6MA 1STGA 5IGDA 4JI2L 2NTTA 3HOZG 1I6HB 3KOJA 4MNOA 3OHXC 4PV1C 2E5LL 2BDOA 3F8TA 4K8IA 1L0WA 3IAYA 1TWHB 3RZDB 3RD4A 4IO9A 1SNDA 3L3OC 4A3BH 1XPRA 4HEDA 1S40A 3BVGA 1N36Q 2EJFC 4KY5A 4HJ5A 2XVSA 4YY3Q 1J6QA 3D6CA 1U4RA 1WYDA 5EPJA 5C3EG 1KDAA 1KAAA 2WIIB 3CP0A 2F0GA 4C3HG 4MIUA 1GUSA 4L5SA 1KHIA 2B2WC 4HMJA 4OGQC 1IBKL 1B1ZA 4KN4C 4FNFA 4S3SA 1V1OA 2N88A 4PZ6A 2G9DA 1VQEA 3ERSX 4G57A 2PNHA 5IYBG 4NP5A 3FPUB 3TQYA 3HKZG 4CGYB 2OCEA 1X3PA 2LMCB 2CWAA 4RKBA 3T1HL 3CKIB 1AH9A 1JC7A 4EQPA 1WTRA 2O5IC 4DK1A 3P20A 2EYPA 1SYBA 2QCPX 5C44H 5C5MA 4HCEA 1FL0A 3KF6A 3HKSA 2E2HB 3HKZB 1R9TB 4LFAL 2ATWA 1I94L 1JJGA 2L15A 3PUZA 3U9OA 1VQ6A 4BA1I 4RKLA 2XNAC 3PCOB 5JJZA 1A2TA 1QOHA 2UXCL 2EYOA 5KNBA 1FJGL 2E2IB 4KHVA 1ENFA 4ZYSA 3S1MH 2BDNA 3E0JA 2QDBA 1HA6A 2K7VA 5M3FH 3URYA 1S5DD 3U4VA 1Q82C 4O0AA 1ASZA 5CBEE 4KI0A 4JV5Q 4KN7C 4HJAA 1F77A 2OEOA 3NXWA 1I94Q 1U5KA 3TEHB 4DXGA 1D1IA 2F0FA 1KIXA 2EYJA 3MEHA 2MJ8A 3DM3A 3Q8DA 1I4QA 4BXXG 1EIHA 3HOYB 4A3JG 2SNMA 2HDMA 2O5JC 5C0XJ 3R93A 4FF1A 5DAUA 4DV3L 1RDPD 4C3JB 1PRTC 2NN6G 4N9TA 4BBRB 4FYDA 1UE7A 4NMZA 1NUCA 1VQKA 2IX1A 2A5HA 4DNRB 1EUJA 1CI3M 2KUMA 2B63H 4KD4A 1GO3E 1HQRD 2ZXOA 3I4LA 4X66Q 4PMCA 1TVXA 5FJ8H 1EZ6A 2ZXPA 3HOYH 1GKHA 1NR2A 1UWVA 2D9UA 4FXKC 1X54A 3PGZA 4K5WA 4GOPC 5IT9E 3CCMA 4ZQ3A 2R7FA 1LTRD 4IPGA 4DV6Q 4DUZQ 1TWCH 1ET6A 3GTLH 3K5LA 1STBA 5C3EB 1WTXA 4DV6L 1G291 3FKIG 4NB3A 1V1QA 4JI1Q 1OXSC 4K2KA 4RGMA 1FVIA 4X64L 1NNXA 1YNXA 1J5EL 3SXHA 2EJGC 2JEBI 4DU9A 1IYJB 1KRTA 1FD7D 2LXKA 1L1OB 1T5XD 4QQBX 1FNVA 3GD7A 3VR6A 4A3LH 1PH5A 3V2TA 2DY7A 5T1IA 1OXXK 1PRTB 4IN3A 1JMCA 3LWEA 5IGGA 3CCUA 1CA6A 2H5XA 1K28A 4YHHL 1H9MA 4IFDJ 2D62A 5I2YA 4HIDA 4CKCA 4DN4M 2MO0A 1EFID 4JI7Q 3G6EA 3HOZB 4A3GH 2L12A 3S1RH 2VB2X 3EROA 2Z9HA 5TSSA 5I9OA 1STYA 3E3XA 2PW5A 4APVA 1D6EC 2F4VL 1HZCA 2JA7H 3FVQA 5FLMH 1LUZA 4G7ZC 3HGBA 3AFQA 4GNXA 1U4LA 1ENAA 3I4MG 4LMQD 1R9TH 1XNRQ 2AUKA 1O78A 2X6LA 3J80c 2MFIA 4B3TL 3VR3A 2CH4W 2LFNA 1QB5D 1HCZA 3MVVA 5I6WA 1I50H 3M85A 2B2VA 4MN3A 3ND9A 1QZGA 3NTIA 3DMUA 4PNYA 2VUMG 3S14B 2I5MX 1HH2P 5ELOA 3Q0AA 4G7OC 4IUPA 3W1GA 4EX5A 1R4QB 4HMIA 1Y8NB 5J3BA 3J7A5 3N6RA 3Q6SA 2NYZD 3EA6A 4JBJA 4H44C 1ZXTA 1SFOB 5C44B 4DR1Q 3VYSA 5BN4A 3PO2B 1IKLA 5IP9G 2PI2E 5H1SE 4DAVA 3HOVB 2MHVA 4LUZA 3L7ZC 2EYFA 3X3NA 3E6ZX 1SNPA 2UUCL 3KUPA 3CRKC 4HIOA 1KXLA 3CCLA 5T1GA 1SYGA 2JK8A 2VQEQ 1VF7A 1ET9A 4DV7Q 2KOLA 2K6AA 2NWGA 2A68C 5LMNQ 4C56C 3J81c 2DNCA 5E7NA 3PO2G 2ES2A 3TRZA 2ZT9C 5IYBH 3MFYA 4I65A 2YU9B 2ID0A 2RQXA 2R7ZG 3S2HH 1KDBA 2BH8A 3X3MA 2B63B 1U4PA 2L5TA 3U50C 3KDFA 5J22A 1CKNA 4A75A 5JJKA 2UUCQ 1TT2A 3AU7A 5IGFA 2UUAQ 3MWYW 1SNQA 1VMPA 3NBHA 3RUZA 3OIQA 1CUKA 2TMPA 2C5CA 2RHSB 2C35B 1GHJA 3CPWA 4JI1L 2ZJRA 4DXFA 5AJ3Q 1MHWC 1PTOB 3EVQA 3RNUA 2ZTDA 2DNEA 4X62Q 4YCVA 1WCMB 3VR4A 4QCLA 4P75A 4IJLA 5LL6X 5KYLA 2XRSD 1GHKA 5IYDG 2R92H 4UP8A 3DEOA 1B50A 4K8JA 4X65Q 2HD3A 3T13A 1LYLA 3D31A 2X69A 2JA9A 4OWWB 3K80C 3HP3A 3H91A 2JA6B 3HOXH 4LF8Q 4QF4A 1G2TA 1F2ZA 2L1BA 5IGCA 1PH7A 1HTPA 3KLSX 4Y7NH 1PA6A 2VL6A 1C8CA 1STNA 4A3BB 3I4OA 1SFOH 3TP7A 2HDLA 1X3FA 3P7JA 2YTXA 3MFGA 1UEAB 2XWJB 1LTGD 1YNNC 4JI4Q 4Y7NB 3I4MB 1Y1VH 2F0SA 2ZTEA 1VCIA 3OSOA 1RODA 3BG3A 3MXUA 4V0BA 5FO7B 1J8IA 1MI2A 3U9SA 1VQ8A 5JJIA 3CPFA 3AFPA 5K36G 4B3RL 3MHBA 1X56A 1EWHA 1WTOA 4RGOS 1C7YA 2CCZA 4K5VA 1XX8A 2G5DA 3QWNA 3DHQA 3S1QH 3D4WA 2CW0C 1GJXA 1SYEA 2NVXB 4BA2I 3KLSA 1UUPA 2A6HD 1Q86C 2UXCQ 1A3VA 1HJPA 1IBML 2N55A 1SR3A 2HIXA 3IFTA 1EU3A 2AQ2B 1H9RA 1ICWA 1RL2A 4JOIC 4XT3B 1KLGD 3MTSA 2KCMA 2KVMA 4L5QA 1ZYRD 4RH6A 1TY0A 4C2MB 1KABA 2VS1A 2BE5C 1DONA 3SK5A 2OQ0A 3SE0A 5ELCA 3OTOQ 3D3RA 4LFBL 2UXBL 2WKCA 1PH3A 1TWFH 5EQ0A 1C9OA 5C0XI 2H4OA 1Y8PB 3RLOA 2K01A 2N3SA 1IL2A 4GKKL 2OWOA 4IPCA 1QNKA 2WFWA 3BDCA 1CTMA 2KA7A 4ZK9B 2CQAA 4A4IA 3GTPH 1C0AA 1LTTD 1RCVD 4PG3A 4UPAA 1RIPA 4JW0A 1RJTA 5M5YH 3KF8B 5GAEC 1HPCA 4L8JA 2JA7G 3DXJC 5FLMG 2Z4IA 2F0OA 3TS2A 1H9SA 4ABNA 5I6YA 1Y1VB 1IKMA 1VQPA 1K83H 3DLLA 1ML0D 2A6EC 2WACA 4FP5D 4B3ML 3M4YA 2EYLA 4NXNL 3Q22A 2IT1A 1BBWA 4DUYQ 1OTCA 1EOTA 3K7AH 4ZKCB 1AE2A 4K0KL 2R7DA 2DUDA 1A3TA 2KQ3A 2RBMA 3TP5A 4DA2A 5CBAE 2V4DA 2F0IA 3I4NH 1FJGQ 4FXGC 4LF9L 2A69D 2RDGA 3UI2A 1J5EQ 3FKIB 1EEFD 3I70A 4A3LG 4IUQA 4ZCKA 5C3EH 4CKBA 3U58A 1JCKB 3CRLC 1G8ZD 1K9MC 3STBD 1QJOA 4CJ2C 4A3DG 1K73C 2EY6A 1YI2A 4KHZA 1GM5A 4C1NI 3OIPA 2KEEA 4ILWA 2M00A 3RR5A 3IFDA 3SVMA 1NTGA 2FMCA 1HNWL 1I4PA 5BR8Q 4A3MG 5EKKA 4ME5A 1PTOF 4OIKA 1LABA 3CC7A 1X3QA 2OF1A 4RFBA 1PV4A 2NVTB 4UHVA 3I3CA 3I4NB 4IUVA 3NHHA 4CDFC 1SN8A 2Y0SB 2JJQA 1I50B 1KC8C 2F0KA 3AB9A 5G3LF 2CHBD 3OPOA 1VQLA 4QUCA 1AZPA 4A3IH 4BY1H 5C4HA 2XRQD 4A3MB 2BCOA 3F2BA 1HA5A 4R4QA 4ZLTF 3K6OA 4K14A 3BS1A 4A3EG 3I2ZA 2F0MA 2XIWA 3S1QB 4JCVE 1ASYA 1CFMA 1K0RA 1ZKOA 4DK6C 1EWIA 2BE5D 4X62L 5D65A 1BF4A 2VUMH 2JEAI 4QB4A 1PFNA 2E75C 1S72A 3GTKH 4OEMB 4LF4L 3M3YB 2PZTA 3S9WA 4JBMA 5NUCA 1NE3A 3K5OA 3GTJB 2WV6D 1WI5A 3EN2A 3NBIA 4DUYL 5HGQA 1CQVA 3T53B 3UDXA 5CORA 2WKDA 4KLKA 2RA4A 2LKVA 3HOUH 1VQAA 3H3VI 2ZJQA 4LFCQ 1DOLA 1V8QA 3TP6A 3SK4A 1FNUA 4DR2Q 1TS2A 3GTMH 2F0HA 1YNJD 3PMFA 4DR4L 1SNMA 2GVAA 5M3MB 4HIKA 3C3LA 1DM0B 3GTPB 2NN6H 4ZUIA 2QA4A 1TWCB 1A6XA 4XXEA 1LV9A 1E24A 1BR9A 4MTNA 3PIO3 5C4XB 2ENBA 4ZKBB 2Q2TA 1PRTF 5FO8B 2OXPA 3NTHA 2WB1B 1JWMD 2K28A 5COYA 4ME3A 5C4XH 2A73B 2A69C 2RF4A 1SJHD 3NP8A 2B8GA 3OW7A 2A19A 4AYBG 5I2XA 3H09A 2D0OA 5M3MH 5C4XG 1RTNA 1F9QA 2AMCB 1XMOQ 4HN7A 1Z9FA 3E0EA 4LFAQ 4Z9CB 4XYQA 3K81C 4OIJA 4OHJA 4KMUC 1X3GA 1CZWA 1EYDA 1TWHH 5IYCH 3K59A 3RZDH 1AFPA 1VQBA 1F9SA 2I46A 4MHEA 4JI6L 1EQRA 2AWOA 5FKAC 2RKSA 2JA8B 4TSSA 1WTQA 3KBXA 2MP1A 3T1HQ 1D5ZC 2DJFC 4GLVB 4P72A 4N8X1 1I6VC 2JA6H 3H94A 2Z0SA 1PZID 2KENA 2E2JH 4ZAIA 5EBDA 1QG7A 1CZGA 1BBXC 1LT5D 3GP7A 5C4JH 3FDTA 2JA8G 1UE5A 3M4OB 1Y1VG 2KCTA 4XQQA 2HIVA 1VQ5A 1WTVA 1CM9A 5BN5A 2NVXH 2K14A 2XN9C 4C3JG 1I4GA 4CBVA 3ULPA 1Q1EA 4B3SL 1Y1WB 1PH1A 3RZOH 1L1OC 3WOFA 2IWHA 3A54A 1SJED 2QEXA 4XT1B 4NXML 4AYBE 2OTLA 1DZ1A 4A3CH 1MSHA 1VQIA 4FVMA 4JBKA 2ICEC 1EU4A 2ZM6Q 4OWTB 1VQHA 4IZ8A 2FFKB 5M5XB 1Y1WG 4K0KQ 4A3CG 1B7YB 2K50A 4JVZA 2Q2UA 1NCVA 5AJ3L 3S15B 1TXYA 4B3RQ 1IBLL 5FK9C 3MXNA 4A3IB 2F0QA 1WTWA 1A63A 2SOBA 4GNXC 1FR3A 3I4NG 1Q12A 1UNSA 4L5RC 2K1BA 2WINB 2Y0SG 3VYUA 3C2PA 3AQQA 3H0GH 4X3TA 3BYYB 2R61A 1D1KA 1A2UA 3IL8A 3K0XA 1JWUD 1O7LA 3DWQA 4DUZL 5IT9L 3H3VC 1EY6A 4R4OA 1YIJA 1B4OA 2GVBA 1HHVA 1SE2A 4AH6A 5IIFA 2EXDA 4UP9A 5EAYA 1HTLD 2EYHA 1EIFA 4EQNA 2HT1A 1MBYA 2IW3A 5JEAJ 2PCFB 1SMXA 3IRBA 3QG1A 2OQKA 1PH2A 3AMUA 3PO3B 3S16H 2A74C 3PUYA 5IGBA 1BO0A 5F2DA 4JI3Q 4B9XA 1IYVA 4DR3Q 3PUXA 1GXDC 4ZUJA 3P1HA 4RWSC 4DF7A 5KGUA 1IBLQ 4K2LA 2EXZA 2EY1A 2K5NA 2C9OA 3SDZA 2AWNA 1AE3A 2EY5A 3DWAA 3EIVA 2RDHA 1ONLA 2MQHA 5EBCA 1BKBA 3K57A 2YU9H 2JA7B 2OT2A 5CMDA 3BZDB 5EKIA 4QGUA 2QDLA 4A3KH 3CAMA 1L2FA 1PZKD 2ZJPA 4QJFA 1XPUA 5DM63 1S3OA 1LTLA 2F4VQ 4OO1G 1PVOA 1O7ZA 1O7IA 3C1FA 1SE3A 2D5DA 3C1EA 3PUWA 2VUMB 1X9NA 4GOPA 5CR3A 1DXMA 1PHJA 4GKJL 1Z47A 4E6IA 3M7NA 2XWBB 4B3SQ 1VQJA 2J4XA 1Y14B 3NQIA 4L63B 2B2WA 3N52A 3SR1A 3T16A 3BJUA 5IODA 1EQTA 3KF6B 5LHY1 2EYMA 4CHTB 4A3MH 1H9KA 4IALA 1S5CD 3ULLA 2WB1G 3LNNA 2LSSA 2UUBQ 1M4VA 1J9OA 4A3FH 1SNCA 4WRDA 3GTQB 1Q1BA 4GKJQ 3PUVA 4DV2Q 4KTAA 2RVLA 4IUNA 5GAHC 1D7QA 4BY1G 3QO2A 4YCWA 4A3BG 1ESRA 4GOPB 2V1CC 3RN5A 1LTBD 2KECA 4GKKQ 3M3YH 2UXDQ 1EOVA 2VQFQ 3RZOB 4XYOA 4CJ1B 5G3LD 1C48A 2WAQB 2MPMA 1KAWA 1YJWA 2Z6BA 3VA7A 3G71A 4HAEA 4JI0L 2R6GA 1QVGA 4A3EB 1XMQL 3QIAA 1D2BA 3NEMA 2XGTA 4JI0Q 2NTSA 3FKIH 2B29A 2I0QA 1EEID 1R4PB 1HZAA 2E8GA 1PH9A 4DK0A 5C4ZA 4C3IG 4H0LC 4CDEC 1E7ZA 3OOCA 1HNXL 2Q2IA 1WD0A 4R8IA 2EIFA 1SYDA 3V96A 3ONAB 1YZ6A 2NVQB 5E4XA 5GAGC 2B2UC 4P71A 3VDYA 1FGBD 2JA6G 3PO3G 3HG9A 4C3IB 1VQ9A 3D4RA 4Y52H 2BOSA 1YJNA 1XPOA 1PTOH 2PO4A 2WAQE 2F3VA 3EJIA 4JPBW 3UE0A 5I9PA 4H13C 2KHJA 1HRJA 1EY8A 4NPSA 1UE6A 3VR5A 4P2CB 3PSIA 1U0LA 3G7LA 3GTOB 2HHHQ 3GO5A 1L1OA 1E1TA 5M5XH 4CDCC 1N32L 1MGSA 4IUTA 1HR0L 3MXNB 4OL7A 2EOTA 2K5HA 2A6ED 3B6YA 4I7AA 3K5MA 2IJ0A 1D5MC 1M90C 1EL0A 4TRDA 5EKLA 5JVH3 3HOWB 3JAME 5C0XH 1FNWA 1NAPA 5JPMC 1I4XA 5J1ZA 5KIXA 3H0GB 5KEEA 5CV6A 2AQ3B 4OONA 4J15A 3AEVA 3OWEB 1SLJA 1OO9B 2DY8A 4JI8L 5CYUA 1FYCA 1TY2A 3STBC 4B9WA 4HJ8A 4FF2A 1JB7A 1Z7TA 1MKHA 1QCBD 2B63G 2IL8A 3MAQA 4UAIA 1YBYA 5FJ8G 4DR6L 4JI5Q 2NVYB 4EQOA 4EQ5A 3J81L 3H0GG 1JT8A 5E4WC 4DPGA 1CSQA 3T4AC 3CCSA 3CF5A 1A8VA 3DWPA 2YTYA 4RMFA 4MTKA 4POFA 1HNWQ 1QUQB 2SNSA 3PF4A 1A15A 2QKIC 3SEBA 1P8LA 4POGA 1OXUA 3ZYYX 3PO2H 1SROA 2GA4B 4YWKA 2WAQG 2NZHA 2SDFA 1PDQA 2Z6KA 4DR2L 1BNZA 4HSVA 3I4MH 4OWXB 3G4SA 2OTJA 4JC0A 5IT9c 1KDCA 3W1BA 5IP7G 3PV0A 3MEFA 1LTSD 5IOCA 2E2DC 1VF5C 3S1RB 1XXGA 4F88A 2HCCA 3R3OA 3K5NA 3JAML 4RAUC 1T5EA 4B3TQ 3S17B 2NBFA 3M4OH 1ILPA 3NPPA 4LF6L 2DN8A 2JYOA 4R4IA 2GN5A 3EBEA 1M8AA 4WJWA 4YWLA 3CCJA 3GV3A 4BBSG 4LW1A 5C3WA 1NY4A 4HR7B 1HQMC 1SAPA 4DV1Q 4WJ3M 2PQAB 1SEBD 4IPHA 3T56B 2KCNA 5EGTA 3L2PA 2AKWB 4R9WA 1CKNB 5A2QL 1TIID 3R2TA 4KK7A 1HFGA 2ALYB 4R4TA 4GN3B 1JWSD 1DD2A 1SSOA 3A5ZB 3DM1A 4IFDG 1V1PB 1XNRL 3K58A 4A3DB 2PQEA 1AN8A 4LF8L 4BY7G 2K4KA 2L55A 1T9HA 1TWAH 2KHIA 2QILA 4L6TB 4A76A 5JEAH 3K8AA 1ILQA 1BBUA 4DAYB 2B3GA 3TP8A 3CXCA 5M5WB 3A8JE 1PXUA 2PQAA 3A7LA 3OTOL 3GTOH 1BDOA 1E22A 2RCFA 1LO5D 5JEAG 4JI7L 3MXPA 1EYAA 3DUZA 5CV9A 1Y69U 1X55A 2D0PA 1JR0D 3J81i 2EZVA 3GTKB 2EJMA 2NVQH 3HOZH 4A3GB 1G91A 3ICEA 1N36L 4YHHQ 5M5YB 1G51A 1WVLA 2LS01 3BVMA 5C44G 1V1PA 4KKSA 1GUGA 4KV6A 2IX0A 3GTMB 2UU9Q 3I8ZA 4B08A 3S15H 5IGEA 3HKZE 4U673 2R92G 4JI2Q 5IYDH 1BQQT 3TSSA 3ERQA 2KBNA 4EGVA 3I91A 2ASBA 3J81j 3D0FA 1TWFB 4ALPA 3S2HB 1K3RA 3UDFA 2L0CA 3KJPA 1N33Q 4RA8A 4QUFA 1TWGB 4K5XA 3HS0C 1XWEA 1NMFA 2EDGA 3HRZC 1CQFA 2QEJC 2RSNA 3NSWA 2PMZB 1HR0W 3ITPA 1YVCA 1MJEA 1B3AA 3CCEA 1LLRD 4O1NA 4CDDC 5KNCA 1EFWA 1O7YA 1HZBA 1ICFB 1E0BA 1OXVA 3H3VH 1QE6A 2O4XA 5E1FA 2B39A 3FRPB 4IUUA 2AUJD 4DR5L 2B2YC 3TDQA 2F3IA 3RLFA 1JORA 2N49A 4JK1C 4DR1L 3M7GA 2NUCA 4Q5VA 1HUMA 3C46A 3HOWG 1XYIA 1MSGA 2P5ZX 5HGTA 4EVOA 4X65L 1HFNA 2RSOA 4KHPL 1BVSA 3S17H 3ND8A 1PYSB 3HOXB 5IY0A 4JV5L 2B2VC 1VQMA 1EY4A 3D8GA 3GTQH 4C3HH 4QY7A 2F3WA 4GZYC 1AP0A 5DM73 3A56A 3I90A 3Q23A 2A8VA 2Q8RE 5JOBA 1IBMQ 1W6JA 3NELA 4XDXA 3F2CA 2PPBC 1RD9D 1HR0Q 2BA1A 5ELDA 4CJ0B 1YJ9A 3SK6A 4Q0FA 3GTGB 1N32Q 1F9PA 4A3FG 2R3ZA 1EYCA 1QUQA 2I5LX 4MZ9A 3D4DA 4DV4Q 1E2WA 3E9HA 2LXJA 4HSPA 2NVTH 3A5UA 2PW7A 3KF8A 4X3KA 3GTGH 1VQNA 1JE5A 2KHSA 1UEBA 2K04A 1F9RA 3PO3H 3KLWA 2KCCA 1CK1A 4V190 3IKJA 2R93B 1GOZA 3M9BA 3SK8A 1RTOA 1NR4A 1UE1A 2EVBA 4IOAA 1WOCA 1LACA 3BDLA 4PMWA 2JA5B 1TU2B 5KRUA 1B53A 3EQLC 1Q81C 1BCPF 4L5TA 2K52A 4WFN3 3M4QA 3SGIA 2B2UA 2YYZA 3BYTB 4JI8Q 4KD3A 3UDGA 2BA0A 4UDUC 5A2QE 2JA5H 1PYWD 4X64Q 3A8IE 1LT6D 3VYRA 2JE6I 4AQYQ 5DLQE 4C3IH 4R8NA 4DGZA 1S5ED 4DV0L 1JJCB 4C1NK 2JA5G 2F0VA 1Z6HA 5IWAL 5BN3A 4LF5Q 1II3A 1VS0A 2MGSA 5I4DA 3J80L 2DGYA 4NXNQ 1CHQD 1I5FA 3E9IA 3GTJH 4N8FA 4OELB 4B3MQ 4DR7L 1Q90A 1TKWB 1KNEA 4BXXH 2E2JB 4RGTA 3LX0A 1ZEQX 4LF5L 4DK3C 4NXMQ 2HHHL 4N9PA 2CKZB 1EYGA 3HOVH 2BH2A 4AQYL 4LWCA 3HZXA 4IFDI 1DCZA 1SRUA 1UAPA 2UXDL 2K5VA 1XTDA 2KJXA 4HTHA 2J0TD 1F2MA 5JPNC 3FEWX 4F7XA 2KEDA 2Z8LA 1EZ8A 4DV5L 5CV7A 2HUGA 2E2HH 3OYYA 4RCOA 1XNQQ 1JOOA 1K0SA 3K0YA 3S2DH 2K32A 2IX3A 3Q24A 5ELNA 4GLXA 1XJVA 2IY5B 1N33L 5FLXL 4PZ7A 2F0EA 2VB3X 3S2DB 2R92B 3CMAA 4A3EH 1DGSA 1YHBA 2A1AA 3FHWA 4LF6Q 1BXTA 2K05A 1LT3D 2XTIA 1PTOD 2EY2A 3OW2A 1WCMH 2K33A 3LGJA 1LTID 4GNXB 5CGKA 5J39A 4JI6Q 1XTCD 3WWVA 4HJ9A 4KKTA 2Q8IB 3H15A 3JAMi 3TZDA 2QF7A 2FINB 3SHLA 2E74C 2HQLA 3L0OA 1KNAA 1N34L 1K8OA 1E3PA 5JJLA 4CKEA 1YHQA 1TS4A 2L4NA 4BBSB 1P16A 5LMNL 4ODGA 2X6GA 2Z6KC 4FO2A 2AQ1B 1DJRD 1SE4A 1STHA 1BCPC 1NBWA 3NUCA 4IFDH 3L9AX 3FMCA 1CKOA 4DV5Q 4FF3A 3W3AA 1GUTA 1WFQA 3I56A 5M3FB 4OX9L 1JE4A 1PZJD 2M2LA 1K8GA 4HCSA 3KJOA 4C3JH 4A93B 4LJZC 3A0JA 5K5PA 1STEA 2HQEA 2F0UA 2K5WA 1B8AA 4C3HB 4IURA 3S1NH 1D8LA 2MNAA 1V9PA 1B9MA 3QOLA 1X6OA 3V05A 3KDFB 2VY3A 1PH6A 3PIP3 4XQJA 5A35A 3NK9A 3BVZA 5JVG3 1B3QA 4J6HA 1Y1WH 1S5BD 1E2ZA 1GVPA 2TSSA 3F2DA 1I4HA 3CCRA 4KY7A 1F2LA 2NN6I 3BU2A 5CV5A 1NMGA 4DR3L 5C0XG 4LF7L 1WJJA 4BBRG 1B44D 1Q8IA 2K5QA 1YITA 2NB0A 1JICA 1V43A 1B70B 4RHSA 2DJGC 3MC0B 3ZJYC 2RHQB 1IYUA 1U4MA 2WB1E 5C3XA 5FLXE 1Q3LA 1Q46A 3J7AV 5FO9B 1KRSA 3KYHC 4PMBA 4X3UA 1N9WA 4JI3L 2Q8TA 1EIGA 1PFMA 5D14A 1CT1D 2F0NA 3JAMc 1LTAD 4C2MH 3HEJA 4K6DA 3JC66 1QILA 1PTOC 3QOJA 1QZHA 1YEZA 5ELBA 3HOUB 4AYBB 2WP8J 4O2DA 4XIGS 1RKNA 2ZM6L 2F0DA 3QJYA 2ICIA 1O80A 1VQOA 1HNXQ 2F0TA 4TQUS 1PYBA 4PZ8A 1WTHA 4LF9Q 2YV5A 2CFMA 2JSOA 2F0LA 3PQIA 2B2YA 3I72A 4DV1L 1B2TA 3OMGA 1SYCA 3DEPA 3GV6A 1PLFA 4FDBA 4XTCS 2VQFL 4NW2A 3CQZH 3BZKA 2A68D 1XMQQ 1NJIC 4G4KA 1K8MA 4A3JH 4DNTB 3J80i 1VQGA 1TQOA 5D3DA 3CC2A 2NVYH 4IQZA 5CV4A 3P75A 4JG2A 2JA8H 4O42A 2QGQA 1PH8A 4YIJA 4P73A 5HURA 1YHAA 4J1MA 2LY7A 1TWAB 5EJWA 4BY1B 3J7ZC 3VR2A 4RCNA 1PH4A 3A74A 4DAMA 1ZYRC 1PRTD 1SXTA 2VW9A 5LMNW 3MZ5A 1YNND 4JYAL 4JBWA 4DR4Q 3WOEA 1W2BA 2MUYA 4WJ4A 2R93H 2Y0SE 4IOCA 3KBGA 1H95A 3R8BA 2CH4A 2K75A 3GQBA 5M5WH 4GLAC 1H9JA 3J80E 2PZWA 2CW0D 1IZ6A 1X32A 4J8QA 3T1YL 2JXMB 3TREA 2JQOA 4R1JA 4LK1C 1QWYA 1JOKA 5LL6S 3PF5A 1VDZA 4QL5A 2E76C 1X65A 4A3IG 1XMOL 4LFBQ 1QVCA 5JAVA 2E2IH 2UXBQ 2B2TA 3KK7A 2F03A 4R4CA 4LF4Q 3MXGA 3CCVA 1TWGH 2K03A 2N8NA 3K7UC 1B9NA 3O13A 2CWPA 4KY6A 1WTPA 4UY8C 1Q7YC 5DNFA 3S14H 4UP7A 1EQVA 3NWSA 4FXDA 2IHFA 2IHEA
chains in the Genus database with same CATH topology
4TKOB 1U9RA 5ELFA 1D5XC 3NWTA 2R7ZB 2HCIA 2O2LD 4DFAA 4WORA 5FOBB 4XQNA 1EWCA 1AEXA 2J7ZA 2JP1A 3I73A 4PQXA 2Z1CA 2IPKD 5E3FA 3S1MB 4FF4A 5C6AA 4NKLA 3QB3A 1GUWA 2I07B 4OO1I 1KLUD 2H1EA 1S4ZA 4ID6A 4LAAA 1EY0A 3TBIB 5C5LA 3J7YW 4BWGB 4RHRA 5CV8A 2L9HA 4OO1H 1BOSA 2VXWA 4KKUA 4K6LA 1TS5A 3G6JB 3CHBD 3A7AB 3LWUA 2F0PA 4I7ZC 2EPBA 1RF2D 4RGNA 2B2TC 2M9VA 3VA5A 3TN2A 1ESFA 5C4JB 4NDXA 5M9OA 5D3IB 5EPLA 3NTKA 1L0YB 1L0XB 1JQYD 1KTKA 2ZXRA 3R2IA 2K5DA 3KLRA 1EY9A 3NE5B 2FMMA 1ENCA 4A3FB 4ULLA 1IW7D 2F1MA 2NZ1D 3E5SA 3OWFA 1C4QA 2SEBD 1A3UA 3K7AB 1CA5A 1IHZA 3A8KE 1F2YA 5EPKA 5ISRA 2PYKA 2D2CC 1E2VA 1GUNA 3S1NB 4F8MA 2Z4HA 3J7AF 5AFWA 1W6KA 5ELEA 2PNRC 4M1UB 2PZUA 1VMCA 3WDNA 3TZUA 3CU7A 2FHTA 3MA2B 4BY7B 4G7HC 3OMCA 1BCPB 3D6WA 1G6ZA 1G2SA 5DEHA 3A55A 2G9HD 2CVRA 1SNOA 1H9SB 3S16B 3EFXD 1HUNA 1PMRA 1GUOA 4KJNA 2L11A 1K83B 2F0WA 4KJOA 1YNJC 4U68A 3W2DA 5K36H 4ZRZA 1S5FD 5KYIA 2FJ2A 2B8FA 3J81E 3RMHA 2VNUD 4QMGA 3CQZB 2EE1A 1NSNS 4BS9A 1TR5A 3NQTA 2A6HC 2F4IA 1DOKA 1STAA 2XSCA 4DAPA 1EY7A 4X3SA 4QIWB 1CHPD 2F0JA 3BDOA 1DOMA 5KNDA 4M8AA 4F87A 1I4RA 1OXTA 1AW7A 1SDFA 1PFBA 3FPPA 1Y8OB 1IL8A 1SMYC 1SBBB 2RDFA 1SMYD 5CC4A 1RHPA 1IW7C 1JB3A 3F2UA 4DAYA 3GTLB 1DYQA 1HXYD 3T51B 1JOQA 4H7BA 1QNUA 3VYTA 1EY5A 4A3KB 1TS3A 4A3JB 1BCPD 1WD1A 1SYFA 1AZQA 1BUVT 3TMEA 1MD2D 1LT4D 1I3QB 3H6MA 1STGA 5IGDA 2NTTA 1I6HB 3OHXC 4PV1C 2BDOA 4K8IA 3IAYA 1TWHB 3RZDB 3RD4A 1SNDA 3L3OC 4HEDA 3BVGA 2EJFC 4KY5A 2XVSA 1U4RA 3D6CA 5EPJA 1KDAA 1KAAA 2WIIB 2F0GA 4C3HG 4MIUA 1GUSA 2B2WC 4HMJA 4OGQC 1B1ZA 4KN4C 4FNFA 4S3SA 1V1OA 2N88A 2G9DA 4G57A 4NP5A 3FPUB 4CGYB 1X3PA 2LMCB 4RKBA 3CKIB 1JC7A 4EQPA 1WTRA 2O5IC 4DK1A 3P20A 2EYPA 1SYBA 2QCPX 5C5MA 4HCEA 2E2HB 3HKZB 1R9TB 3PUZA 3U9OA 4BA1I 4RKLA 2XNAC 5JJZA 1A2TA 1QOHA 2EYOA 5KNBA 2E2IB 4KHVA 1ENFA 4ZYSA 2BDNA 3E0JA 2QDBA 1HA6A 2K7VA 3URYA 1S5DD 5CBEE 4KI0A 4KN7C 1F77A 2OEOA 3NXWA 4DXGA 1D1IA 2F0FA 2EYJA 3MEHA 2MJ8A 1EIHA 1I4QA 3HOYB 2SNMA 2HDMA 2O5JC 5C0XJ 3R93A 4FF1A 5DAUA 1RDPD 4C3JB 1PRTC 2NN6G 4N9TA 4BBRB 4FYDA 4NMZA 1NUCA 2IX1A 2A5HA 4DNRB 1CI3M 2KUMA 4KD4A 1HQRD 2ZXOA 3I4LA 4PMCA 1TVXA 1EZ6A 2ZXPA 1NR2A 2D9UA 4FXKC 4K5WA 5IT9E 4ZQ3A 1LTRD 1ET6A 3K5LA 1STBA 5C3EB 1WTXA 1G291 1OXSC 4K2KA 4RGMA 3SXHA 2EJGC 2JEBI 4DU9A 1FD7D 1T5XD 1FNVA 3GD7A 3VR6A 3V2TA 2DY7A 5T1IA 1OXXK 1PRTB 4IN3A 3LWEA 5IGGA 1CA6A 1H9MA 4IFDJ 2D62A 5I2YA 4CKCA 4DN4M 1EFID 3HOZB 2L12A 2VB2X 3EROA 5I9OA 5TSSA 1STYA 2PW5A 1D6EC 3FVQA 4G7ZC 3HGBA 1U4LA 1ENAA 4LMQD 2AUKA 1O78A 2X6LA 3VR3A 2LFNA 1QB5D 1HCZA 3MVVA 5I6WA 3M85A 2B2VA 4MN3A 3ND9A 3NTIA 3DMUA 4PNYA 3S14B 3Q0AA 4G7OC 4IUPA 1R4QB 4HMIA 1Y8NB 3N6RA 3Q6SA 2NYZD 3EA6A 4H44C 1ZXTA 1SFOB 5C44B 3VYSA 5BN4A 3PO2B 1IKLA 4DAVA 3HOVB 2MHVA 3L7ZC 2EYFA 3X3NA 3E6ZX 1SNPA 3KUPA 3CRKC 5T1GA 1SYGA 1VF7A 1ET9A 2KOLA 2K6AA 2NWGA 2A68C 4C56C 2DNCA 2ZT9C 3MFYA 4I65A 2YU9B 2ID0A 2RQXA 1KDBA 3X3MA 2B63B 1U4PA 2L5TA 5J22A 1TT2A 3AU7A 5IGFA 1SNQA 3MWYW 1VMPA 3NBHA 3RUZA 3OIQA 2TMPA 2C5CA 1GHJA 4DXFA 1PTOB 3EVQA 2DNEA 1WCMB 3VR4A 4QCLA 5LL6X 5KYLA 2XRSD 1GHKA 3DEOA 1B50A 4K8JA 3T13A 3D31A 2X69A 3HP3A 3H91A 2JA6B 4QF4A 1G2TA 1F2ZA 2L1BA 5IGCA 1HTPA 3KLSX 1C8CA 1STNA 4A3BB 3TP7A 2HDLA 3P7JA 3MFGA 1UEAB 2XWJB 1LTGD 1YNNC 4Y7NB 3I4MB 2F0SA 1VCIA 3OSOA 1RODA 3BG3A 3MXUA 4V0BA 5FO7B 1J8IA 1MI2A 3U9SA 5K36G 3MHBA 1EWHA 1WTOA 4RGOS 4K5VA 1XX8A 3QWNA 3DHQA 3D4WA 2CW0C 1GJXA 1SYEA 2NVXB 4BA2I 3KLSA 1UUPA 2A6HD 1A3VA 2N55A 3IFTA 1EU3A 2AQ2B 1H9RA 1ICWA 4XT3B 1KLGD 3MTSA 2KVMA 1ZYRD 4RH6A 1TY0A 4C2MB 1KABA 1DONA 2BE5C 3SK5A 3SE0A 5ELCA 3D3RA 2WKCA 5EQ0A 5C0XI 2H4OA 1Y8PB 2K01A 1QNKA 3BDCA 1CTMA 2KA7A 4ZK9B 2CQAA 1LTTD 1RCVD 1RJTA 1HPCA 4L8JA 3DXJC 2Z4IA 2F0OA 1H9SA 4ABNA 5I6YA 1Y1VB 1IKMA 1ML0D 2A6EC 2WACA 4FP5D 3M4YA 2EYLA 3Q22A 2IT1A 1EOTA 4ZKCB 3TP5A 1A3TA 2KQ3A 2RBMA 4DA2A 5CBAE 2V4DA 2F0IA 4FXGC 2A69D 2RDGA 3UI2A 3FKIB 1EEFD 3I70A 4IUQA 4CKBA 1JCKB 3CRLC 1G8ZD 1QJOA 4CJ2C 2EY6A 4KHZA 4C1NI 3OIPA 2KEEA 4ILWA 2M00A 3IFDA 3SVMA 2FMCA 1I4PA 5EKKA 4ME5A 1PTOF 4OIKA 1LABA 1X3QA 2OF1A 4RFBA 2NVTB 3I3CA 3I4NB 4IUVA 3NHHA 2Y0SB 1I50B 2F0KA 3AB9A 5G3LF 2CHBD 3OPOA 4QUCA 1AZPA 5C4HA 2XRQD 4A3MB 2BCOA 1HA5A 4ZLTF 3K6OA 4K14A 3BS1A 2F0MA 2XIWA 3S1QB 1CFMA 1ZKOA 2BE5D 5D65A 1BF4A 2JEAI 4QB4A 1PFNA 2E75C 3M3YB 2PZTA 3S9WA 5NUCA 3K5OA 3GTJB 2WV6D 3NBIA 1CQVA 3T53B 5CORA 2WKDA 2RA4A 2LKVA 1DOLA 1V8QA 3TP6A 3SK4A 1FNUA 1TS2A 2F0HA 1YNJD 3PMFA 1SNMA 5M3MB 3C3LA 1DM0B 3GTPB 2NN6H 4ZUIA 1TWCB 1A6XA 4XXEA 1LV9A 1BR9A 3PIO3 5C4XB 2ENBA 4ZKBB 1PRTF 5FO8B 2OXPA 3NTHA 2WB1B 1JWMD 2K28A 5COYA 2A73B 2A69C 3NP8A 1SJHD 2B8GA 3OW7A 5I2XA 3H09A 1RTNA 1F9QA 4HN7A 4Z9CB 4XYQA 4OIJA 4OHJA 1CZWA 4KMUC 1EYDA 3K59A 1AFPA 1F9SA 2I46A 4MHEA 5FKAC 2AWOA 2RKSA 2JA8B 4TSSA 1WTQA 3KBXA 2MP1A 1D5ZC 1I6VC 3H94A 1PZID 4ZAIA 5EBDA 1QG7A 1CZGA 1BBXC 1LT5D 3GP7A 3FDTA 3M4OB 4XQQA 1WTVA 1CM9A 5BN5A 2XN9C 4C3JG 1I4GA 4CBVA 1Q1EA 1Y1WB 3WOFA 2IWHA 3A54A 1SJED 4XT1B 1DZ1A 1MSHA 4FVMA 2ICEC 1EU4A 4IZ8A 2FFKB 5M5XB 1NCVA 3S15B 5FK9C 3MXNA 4A3IB 2F0QA 1WTWA 2SOBA 1FR3A 1Q12A 1UNSA 2K1BA 2WINB 3VYUA 3C2PA 4X3TA 3BYYB 2R61A 1D1KA 1A2UA 3IL8A 1JWUD 1O7LA 3DWQA 5IT9L 3H3VC 1EY6A 1B4OA 1HHVA 1SE2A 5IIFA 1HTLD 2EYHA 4EQNA 1MBYA 2IW3A 5JEAJ 2PCFB 3QG1A 3AMUA 3PO3B 2A74C 3PUYA 5IGBA 1BO0A 5F2DA 4B9XA 1IYVA 3PUXA 1GXDC 4ZUJA 3P1HA 4RWSC 4DF7A 5KGUA 4K2LA 2EXZA 2EY1A 2C9OA 3SDZA 2AWNA 2EY5A 3DWAA 2RDHA 1ONLA 5EBCA 3K57A 2JA7B 2OT2A 5CMDA 3BZDB 5EKIA 1PZKD 5DM63 4OO1G 1O7ZA 3C1FA 1SE3A 2D5DA 3C1EA 3PUWA 2VUMB 5CR3A 1DXMA 1Z47A 4E6IA 3M7NA 2XWBB 2J4XA 3NQIA 4L63B 2B2WA 3N52A 3SR1A 3T16A 5IODA 1EQTA 5LHY1 2EYMA 4CHTB 1H9KA 4IALA 1S5CD 3LNNA 1M4VA 1J9OA 1SNCA 4WRDA 3GTQB 1Q1BA 3PUVA 4KTAA 2RVLA 4IUNA 3QO2A 1ESRA 1LTBD 2KECA 3RZOB 4XYOA 4CJ1B 5G3LD 1C48A 2WAQB 2MPMA 3VA7A 4HAEA 2R6GA 4A3EB 1D2BA 3QIAA 2NTSA 1EEID 1R4PB 4DK0A 5C4ZA 4C3IG 4H0LC 3OOCA 1WD0A 4R8IA 1SYDA 3V96A 3ONAB 2NVQB 5E4XA 2B2UC 1FGBD 3HG9A 4C3IB 3D4RA 2BOSA 1PTOH 2PO4A 2F3VA 3EJIA 5I9PA 4H13C 1HRJA 1EY8A 3VR5A 4P2CB 3G7LA 3GTOB 3GO5A 1MGSA 4IUTA 4OL7A 2EOTA 2A6ED 3K5MA 2IJ0A 1D5MC 1EL0A 4TRDA 5EKLA 5JVH3 3HOWB 3JAME 5C0XH 1FNWA 5JPMC 1NAPA 1I4XA 5J1ZA 5KIXA 3H0GB 5KEEA 5CV6A 2AQ3B 3OWEB 1OO9B 2DY8A 5CYUA 1FYCA 1TY2A 4B9WA 4FF2A 1Z7TA 1QCBD 2IL8A 3MAQA 4UAIA 2NVYB 4EQOA 3J81L 5E4WC 3T4AC 3DWPA 2SNSA 1A15A 2QKIC 3SEBA 1OXUA 3ZYYX 2GA4B 2SDFA 1PDQA 1BNZA 4HSVA 1KDCA 3PV0A 1LTSD 5IOCA 2E2DC 1VF5C 3S1RB 1XXGA 4F88A 2HCCA 3R3OA 3K5NA 3JAML 4RAUC 1T5EA 3S17B 2NBFA 1ILPA 3NPPA 2DN8A 2JYOA 1M8AA 4WJWA 3GV3A 5C3WA 4HR7B 1HQMC 1SAPA 1SEBD 3T56B 2KCNA 5EGTA 4R9WA 5A2QL 1TIID 3R2TA 4KK7A 1HFGA 1DD2A 1JWSD 1SSOA 3DM1A 4IFDG 1V1PB 3K58A 4A3DB 2PQEA 1AN8A 2L55A 2QILA 4L6TB 5JEAH 1ILQA 3TP8A 5M5WB 3A8JE 1PXUA 3A7LA 1BDOA 1LO5D 5JEAG 3MXPA 1EYAA 3DUZA 5CV9A 1Y69U 1JR0D 2EZVA 3GTKB 2EJMA 1G91A 4A3GB 5M5YB 1WVLA 2LS01 3BVMA 1V1PA 4KKSA 1GUGA 4KV6A 2IX0A 3GTMB 3I8ZA 4B08A 5IGEA 4U673 1BQQT 3TSSA 3ERQA 4EGVA 3I91A 1TWFB 3S2HB 2L0CA 4RA8A 4QUFA 1TWGB 4K5XA 3HS0C 1XWEA 2EDGA 3HRZC 1CQFA 2QEJC 2RSNA 3NSWA 2PMZB 3ITPA 1B3AA 1LLRD 4O1NA 5KNCA 1O7YA 1E0BA 1OXVA 1QE6A 2O4XA 5E1FA 2B39A 3FRPB 4IUUA 2AUJD 2B2YC 3TDQA 3RLFA 1JORA 4JK1C 3M7GA 2NUCA 4Q5VA 1HUMA 3C46A 1XYIA 1MSGA 5HGTA 4EVOA 1HFNA 2RSOA 3ND8A 3HOXB 2B2VC 1EY4A 3D8GA 2F3WA 4GZYC 1AP0A 5DM73 3A56A 3I90A 3Q23A 2Q8RE 5JOBA 1W6JA 2PPBC 4XDXA 1RD9D 2BA1A 5ELDA 4CJ0B 3SK6A 4Q0FA 3GTGB 1F9PA 2R3ZA 1EYCA 3D4DA 1E2WA 4HSPA 2PW7A 3KF8A 4X3KA 2KHSA 2K04A 1F9RA 2KCCA 1CK1A 4V190 3IKJA 2R93B 1GOZA 3SK8A 1RTOA 1NR4A 2EVBA 1LACA 3BDLA 4PMWA 2JA5B 1TU2B 5KRUA 1B53A 3EQLC 1BCPF 4WFN3 2B2UA 2YYZA 3BYTB 4KD3A 2BA0A 4UDUC 5A2QE 1PYWD 3A8IE 1LT6D 3VYRA 2JE6I 4R8NA 4DGZA 1S5ED 4C1NK 2F0VA 1Z6HA 5BN3A 1II3A 2MGSA 5I4DA 3J80L 1CHQD 1Q90A 1TKWB 1KNEA 2E2JB 4RGTA 3LX0A 1ZEQX 4N9PA 3HZXA 4IFDI 1DCZA 1UAPA 2KJXA 4HTHA 2J0TD 1F2MA 5JPNC 3FEWX 4F7XA 2KEDA 2Z8LA 1EZ8A 5CV7A 2HUGA 4RCOA 1JOOA 3K0YA 2K32A 2IX3A 3Q24A 5FLXL 2F0EA 2VB3X 3S2DB 2R92B 1BXTA 2K05A 1LT3D 1PTOD 2EY2A 2K33A 1LTID 5CGKA 5J39A 1XTCD 4KKTA 2Q8IB 3TZDA 2QF7A 2FINB 3SHLA 2E74C 1KNAA 1K8OA 4CKEA 1TS4A 2L4NA 4BBSB 4ODGA 2X6GA 4FO2A 2AQ1B 1DJRD 1SE4A 1STHA 1BCPC 3NUCA 4IFDH 3L9AX 3FMCA 4FF3A 3W3AA 1GUTA 5M3FB 1JE4A 1PZJD 2M2LA 4HCSA 4A93B 4LJZC 5K5PA 1STEA 2HQEA 2F0UA 2K5WA 4C3HB 4IURA 1B9MA 3QOLA 3V05A 3PIP3 4XQJA 5A35A 3NK9A 3BVZA 5JVG3 4J6HA 1S5BD 1E2ZA 2TSSA 1I4HA 4KY7A 1F2LA 2NN6I 5CV5A 5C0XG 1B44D 1Q8IA 2K5QA 2NB0A 1JICA 1V43A 4RHSA 3MC0B 1IYUA 1U4MA 5C3XA 5FLXE 1Q3LA 3J7AV 5FO9B 4PMBA 4X3UA 2Q8TA 1EIGA 1PFMA 5D14A 1CT1D 2F0NA 1LTAD 3HEJA 4K6DA 1QILA 1PTOC 3QOJA 5ELBA 3HOUB 4AYBB 2WP8J 4XIGS 1RKNA 2F0DA 3QJYA 2ICIA 1O80A 2F0TA 4TQUS 2JSOA 2F0LA 2B2YA 3I72A 1B2TA 3OMGA 1SYCA 3DEPA 3GV6A 1PLFA 4XTCS 4NW2A 2A68D 4G4KA 1K8MA 4DNTB 1TQOA 5D3DA 4IQZA 5CV4A 3P75A 4O42A 4YIJA 5HURA 4J1MA 2LY7A 1TWAB 5EJWA 4BY1B 3VR2A 4RCNA 1ZYRC 1PRTD 1SXTA 3MZ5A 1YNND 4JBWA 3WOEA 2MUYA 3KBGA 3R8BA 3GQBA 1H9JA 3J80E 2PZWA 2CW0D 1X32A 4J8QA 2JXMB 4LK1C 1QWYA 1JOKA 5LL6S 1VDZA 2E76C 5JAVA 2B2TA 3KK7A 2F03A 3MXGA 2K03A 1B9NA 3O13A 4KY6A 1WTPA 5DNFA 1EQVA 3NWSA 4FXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F2D A;  3OWF A;  1KDC A;  1RKN A;  3SK5 A;  3V2T A;  4B9X A;  5CC4 A;  2F0D A;  2RDF A;  3U9O A;  1A3U A;  1U9R A;  4KD3 A;  4ZUJ A;  4K14 A;  3P1H A;  4K5X A;  4RKL A;  4DF7 A;  1IHZ A;  5KGU A;  5IOC A;  1A2T A;  2F0T A;  1SYD A;  4ODG A;  5IGG A;  2F0M A;  1F2Y A;  2EYO A;  4K2L A;  4H7B A;  2EXZ A;  2PYK A;  2EY1 A;  5ISR A;  4DFA A;  1JOQ A;  4KHV A;  3R3O A;  4WOR A;  3EVQ A;  2EY5 A;  2F0L A;  1EY5 A;  4R8N A;  1STH A;  2QDB A;  4DGZ A;  1AEX A;  3ITP A;  3NUC A;  4F8M A;  2F0V A;  3OMG A;  4QB4 A;  1SYC A;  3BDC A;  5E3F A;  1II3 A;  2O4X A;  5C6A A;  4NKL A;  3QB3 A;  5E1F A;  5KYL A;  2PZT A;  3ERO A;  5I9O A;  3S9W A;  1STY A;  1SYF A;  2PW5 A;  5C3W A;  2F3V A;  2OEO A;  3NXW A;  5IGB A;  3EJI A;  5CV9 A;  5NUC A;  3C1F A;  1JOR A;  3LX0 A;  4K8J A;  1TQO A;  2PZU A;  3T13 A;  5I9P A;  4ID6 A;  3C1E A;  4N9P A;  1EY8 A;  2NUC A;  3TME A;  5CR3 A;  2F0F A;  1ENA A;  3P75 A;  4LAA A;  1EY0 A;  2EYJ A;  3MEH A;  5CV4 A;  5C5L A;  4E6I A;  5K5P A;  5EGT A;  3OMC A;  2F0O A;  2SNM A;  3H6M A;  1STG A;  3HZX A;  1F2Z A;  4QF4 A;  5CV8 A;  2HQE A;  4EVO A;  4YIJ A;  5HGT A;  2F0U A;  5HUR A;  5I6Y A;  3MVV A;  5IGC A;  4J1M A;  5DEH A;  5I6W A;  3SR1 A;  5DAU A;  3T16 A;  4HTH A;  5IOD A;  2LKV A;  2WAC A;  1STN A;  1F2M A;  1SNO A;  5IGD A;  4K8I A;  4OL7 A;  2EYM A;  2EYL A;  3TP7 A;  3QOL A;  4F7X A;  3TP6 A;  3SK4 A;  1EY4 A;  1SND A;  3DMU A;  4IAL A;  4KJN A;  1EZ8 A;  4N9T A;  4PNY A;  4TRD A;  2F0H A;  3D8G A;  4IZ8 A;  4NMZ A;  5EKL A;  1NUC A;  3MZ5 A;  3PMF A;  5CV7 A;  2PQE A;  2F3W A;  1SNM A;  2F0W A;  2F0S A;  2F0P A;  4KJO A;  4HMI A;  4KY5 A;  1SNC A;  4WRD A;  3OSO A;  1A3T A;  2KQ3 A;  2RBM A;  3D6C A;  3NK9 A;  3TP5 A;  4KD4 A;  1KDA A;  1KAA A;  2F0I A;  4ZUI A;  5J1Z A;  5KIX A;  2F0G A;  4KTA A;  1JOO A;  4J6H A;  4IUN A;  5CV6 A;  4PMC A;  3VA5 A;  5KEE A;  2F0Q A;  1EZ6 A;  4MIU A;  3TP8 A;  5JOB A;  2ENB A;  5KYI A;  4KY7 A;  5CV5 A;  2SOB A;  4HMJ A;  3SK6 A;  4K5W A;  4B9W A;  3MXP A;  1EYA A;  2F0E A;  2OXP A;  3MHB A;  4NDX A;  2EYF A;  4QMG A;  4S3S A;  1NSN S;  4ZQ3 A;  2PZW A;  5M9O A;  1EYC A;  1SNP A;  1A2U A;  1TR5 A;  2EY6 A;  3D4D A;  4K5V A;  3NP8 A;  1STB A;  1SYG A;  3DHQ A;  2PW7 A;  3D4W A;  1JOK A;  3NQT A;  4G57 A;  2M00 A;  1SYE A;  4NP5 A;  4EQO A;  5C3X A;  1EY6 A;  5EKK A;  2KHS A;  2EY2 A;  1STA A;  4ME5 A;  4K2K A;  1EY7 A;  2OF1 A;  4PMB A;  5JAV A;  1A3V A;  4KV6 A;  4RKB A;  5CGK A;  1EY9 A;  4I65 A;  5J39 A;  3SXH A;  2F0J A;  3NHH A;  5IIF A;  5IGE A;  1KDB A;  1ENC A;  2F0N A;  2SNS A;  4DU9 A;  2F0K A;  4EQP A;  2EYH A;  3SK8 A;  3HEJ A;  4EQN A;  3ERQ A;  4K6D A;  2EYP A;  4KY6 A;  1SYB A;  3QOJ A;  1EYD A;  5J22 A;  3BDL A;  1TT2 A;  5C5M A;  3SHL A;  5C4H A;  5C4Z A;  5IGF A;  1EQV A;  5KRU A;  1SNQ A;  1KAB A;  3RUZ A;  3E5S A;  2RKS A; 
#chains in the Genus database with same CATH topology
 1HNZ Q;  4DR5 Q;  4TKO B;  1U9R A;  5ELF A;  3CC4 A;  4A3D H;  4A93 H;  3NBH B;  1D5X C;  3NWT A;  2R7Z B;  2HCI A;  2O2L D;  4DFA A;  3S24 A;  3QR8 A;  4WOR A;  1M1K C;  4LNQ A;  3AYH B;  5FOB B;  4XQN A;  1EWC A;  1AEX A;  2J7Z A;  4A93 G;  2JP1 A;  3I73 A;  4PQX A;  2Z1C A;  4YCU A;  2IPK D;  5E3F A;  3S1M B;  2QW7 A;  4FF4 A;  5C6A A;  4NKL A;  3QB3 A;  1GUW A;  2I07 B;  1VQF A;  4OO1 I;  4DKA C;  1KLU D;  2H1E A;  4LUO A;  5IE8 A;  4DV3 Q;  1S4Z A;  2N78 A;  2RCN A;  4IJH A;  1LM0 A;  4ID6 A;  4LAA A;  1EY0 A;  3TBI B;  5C5L A;  3J7Y W;  1KD1 C;  4YY3 L;  4A3K G;  3KFU A;  4BWG B;  4RHR A;  4GS3 A;  5CV8 A;  4GN4 B;  2L9H A;  4OO1 H;  1BOS A;  4LF7 Q;  2VXW A;  3HOW H;  4KKU A;  3RN2 A;  4K6L A;  1TS5 A;  2E5L Q;  1EQQ A;  3G6J B;  3HOV G;  3HFZ B;  1N8R C;  3CHB D;  3A7A B;  1VQC A;  3PIP A;  3LWU A;  4OXP A;  1I6H H;  4DV0 Q;  2F0P A;  4I7Z C;  2EPB A;  5IP9 H;  1RF2 D;  3UDI A;  4RGN A;  2B2T C;  2M9V A;  1A0I A;  1JJ2 A;  3VA5 A;  3TN2 A;  2VZA A;  4DR7 Q;  1CKM A;  3TS0 A;  3G48 A;  1I3Q H;  1ESF A;  4DNI A;  5C4J B;  4HIM A;  5IWA Q;  4X66 L;  4NDX A;  5M9O A;  2YTV A;  1K3B C;  5D3I B;  1XNQ L;  5EPL A;  2VQE L;  4RG1 A;  3HOU G;  3NTK A;  5IYC G;  1L0Y B;  1L0X B;  1JQY D;  2AHO B;  2CQO A;  1KTK A;  2ZXR A;  1VQD A;  3CME A;  1X3E A;  3R2I A;  3PIO A;  2EQS A;  2K5D A;  3KLR A;  1EY9 A;  3NE5 B;  2FMM A;  1PFS A;  1ENC A;  2UUA L;  4A3F B;  4ULL A;  3UE1 A;  1IW7 D;  4DV7 L;  1KQS A;  1VQ7 A;  4JI5 L;  1A62 A;  1WCM G;  4IPD A;  2F1M A;  1VQ4 A;  1IXR A;  2NZ1 D;  5FLX c;  3E5S A;  1MIU A;  5GRO A;  3OWF A;  4QIW E;  1CSP A;  1C4Q A;  1E1O A;  2SEB D;  1A3U A;  3K7A B;  1CA5 A;  1IHZ A;  3A8K E;  4LUV A;  2JN4 A;  5M3F G;  1F2Y A;  5EPK A;  5ISR A;  2PYK A;  4GN5 A;  2D2C C;  1E2V A;  1GUN A;  3S1N B;  1K8A C;  4F8M A;  2Z4H A;  3J7A F;  5AFW A;  5LMU Q;  1W6K A;  3W5O A;  4AIM A;  5ELE A;  2PNR C;  4M1U B;  2PMZ E;  3HOX G;  5HY6 A;  5LMU L;  2PZU A;  4KHP Q;  1VMC A;  3GDE A;  3WDN A;  3TZU A;  4DV2 L;  4BBS H;  3CU7 A;  2FHT A;  3RLN A;  3MA2 B;  4BY7 B;  4G7H C;  3OMC A;  4BBR H;  1BCP B;  3D6W A;  3CCQ A;  1G6Z A;  1G2S A;  4OX9 Q;  5DEH A;  3A55 A;  2G9H D;  2CVR A;  3I7F A;  1SNO A;  1H9S B;  2F52 A;  3S16 B;  3EFX D;  5L37 A;  1HUN A;  1PMR A;  4KJN A;  1GUO A;  2L11 A;  4DR6 Q;  1N34 Q;  1K83 B;  2F0W A;  4JYA Q;  4KJO A;  3HOY G;  4A3G G;  3NEN A;  1YNJ C;  4U68 A;  4JOI A;  3W2D A;  5K36 H;  4ZRZ A;  1GD7 A;  1S5F D;  1MJC A;  1G6P A;  1IBK Q;  4BY7 H;  5KYI A;  1EIY B;  2FJ2 A;  2B8F A;  1HNZ L;  3J81 E;  3RMH A;  1SE8 A;  2VNU D;  2R93 G;  4QMG A;  3CQZ B;  5GQO A;  2I5H A;  2EE1 A;  1NSN S;  3FP9 A;  4BS9 A;  3M4P A;  1TR5 A;  5M3M G;  2R7Z H;  3ULJ A;  3NQT A;  2A6H C;  2F4I A;  2ZTC A;  2PI2 A;  1DOK A;  1STA A;  2XSC A;  4DAP A;  1EY7 A;  4X3S A;  3BZC A;  3F1Z A;  2UU9 L;  4H02 A;  1QVF A;  4QIW B;  1CHP D;  2F0J A;  2NZO A;  1DOM A;  3BDO A;  5KND A;  4M8A A;  4F87 A;  1I4R A;  4YWM A;  1OXT A;  1AW7 A;  1Q8K A;  1SDF A;  1PFB A;  3FPP A;  3T1Y Q;  1Y8O B;  3U4Z A;  1IL8 A;  3I55 A;  1HZ9 A;  1SMY C;  3CW2 C;  4P74 A;  4JI4 L;  1SBB B;  2RDF A;  1SMY D;  5CC4 A;  1RHP A;  1IW7 C;  1JB3 A;  3F2U A;  4DAY A;  3GTL B;  1DYQ A;  1HXY D;  4X6A H;  3T51 B;  1JOQ A;  4H7B A;  5BR8 L;  4HJ7 A;  1QNU A;  3VYT A;  2MO1 A;  1EY5 A;  1KL9 A;  2Q2H A;  4A3K B;  1TS3 A;  2UUB L;  2FXQ A;  4A3J B;  5IP7 H;  1BCP D;  1WD1 A;  4LFC L;  5GAD C;  4TVA B;  1SYF A;  1AZQ A;  1FGU A;  3ER0 A;  1BUV T;  3CD6 A;  3TME A;  1MD2 D;  1LT4 D;  1I3Q B;  1W3S A;  4DV4 L;  3H6M A;  1STG A;  5IGD A;  4JI2 L;  2NTT A;  3HOZ G;  1I6H B;  3KOJ A;  4MNO A;  3OHX C;  4PV1 C;  2E5L L;  2BDO A;  3F8T A;  4K8I A;  1L0W A;  3IAY A;  1TWH B;  3RZD B;  3RD4 A;  4IO9 A;  1SND A;  3L3O C;  4A3B H;  1XPR A;  4HED A;  1S40 A;  3BVG A;  1N36 Q;  2EJF C;  4KY5 A;  4HJ5 A;  2XVS A;  4YY3 Q;  1J6Q A;  3D6C A;  1U4R A;  1WYD A;  5EPJ A;  5C3E G;  1KDA A;  1KAA A;  2WII B;  3CP0 A;  2F0G A;  4C3H G;  4MIU A;  1GUS A;  4L5S A;  1KHI A;  2B2W C;  4HMJ A;  4OGQ C;  1IBK L;  1B1Z A;  4KN4 C;  4FNF A;  4S3S A;  1V1O A;  2N88 A;  4PZ6 A;  2G9D A;  1VQE A;  3ERS X;  4G57 A;  2PNH A;  5IYB G;  4NP5 A;  3FPU B;  3TQY A;  3HKZ G;  4CGY B;  2OCE A;  1X3P A;  2LMC B;  2CWA A;  4RKB A;  3T1H L;  3CKI B;  1AH9 A;  1JC7 A;  4EQP A;  1WTR A;  2O5I C;  4DK1 A;  3P20 A;  2EYP A;  1SYB A;  2QCP X;  5C44 H;  5C5M A;  4HCE A;  1FL0 A;  3KF6 A;  3HKS A;  2E2H B;  3HKZ B;  1R9T B;  4LFA L;  2ATW A;  1I94 L;  1JJG A;  2L15 A;  3PUZ A;  3U9O A;  1VQ6 A;  4BA1 I;  4RKL A;  2XNA C;  3PCO B;  5JJZ A;  1A2T A;  1QOH A;  2UXC L;  2EYO A;  5KNB A;  1FJG L;  2E2I B;  4KHV A;  1ENF A;  4ZYS A;  3S1M H;  2BDN A;  3E0J A;  2QDB A;  1HA6 A;  2K7V A;  5M3F H;  3URY A;  1S5D D;  3U4V A;  1Q82 C;  4O0A A;  1ASZ A;  5CBE E;  4KI0 A;  4JV5 Q;  4KN7 C;  4HJA A;  1F77 A;  2OEO A;  3NXW A;  1I94 Q;  1U5K A;  3TEH B;  4DXG A;  1D1I A;  2F0F A;  1KIX A;  2EYJ A;  3MEH A;  2MJ8 A;  3DM3 A;  3Q8D A;  1I4Q A;  4BXX G;  1EIH A;  3HOY B;  4A3J G;  2SNM A;  2HDM A;  2O5J C;  5C0X J;  3R93 A;  4FF1 A;  5DAU A;  4DV3 L;  1RDP D;  4C3J B;  1PRT C;  2NN6 G;  4N9T A;  4BBR B;  4FYD A;  1UE7 A;  4NMZ A;  1NUC A;  1VQK A;  2IX1 A;  2A5H A;  4DNR B;  1EUJ A;  1CI3 M;  2KUM A;  2B63 H;  4KD4 A;  1GO3 E;  1HQR D;  2ZXO A;  3I4L A;  4X66 Q;  4PMC A;  1TVX A;  5FJ8 H;  1EZ6 A;  2ZXP A;  3HOY H;  1GKH A;  1NR2 A;  1UWV A;  2D9U A;  4FXK C;  1X54 A;  3PGZ A;  4K5W A;  4GOP C;  5IT9 E;  3CCM A;  4ZQ3 A;  2R7F A;  1LTR D;  4IPG A;  4DV6 Q;  4DUZ Q;  1TWC H;  1ET6 A;  3GTL H;  3K5L A;  1STB A;  5C3E B;  1WTX A;  4DV6 L;  1G29 1;  3FKI G;  4NB3 A;  1V1Q A;  4JI1 Q;  1OXS C;  4K2K A;  4RGM A;  1FVI A;  4X64 L;  1NNX A;  1YNX A;  1J5E L;  3SXH A;  2EJG C;  2JEB I;  4DU9 A;  1IYJ B;  1KRT A;  1FD7 D;  2LXK A;  1L1O B;  1T5X D;  4QQB X;  1FNV A;  3GD7 A;  3VR6 A;  4A3L H;  1PH5 A;  3V2T A;  2DY7 A;  5T1I A;  1OXX K;  1PRT B;  4IN3 A;  1JMC A;  3LWE A;  5IGG A;  3CCU A;  1CA6 A;  2H5X A;  1K28 A;  4YHH L;  1H9M A;  4IFD J;  2D62 A;  5I2Y A;  4HID A;  4CKC A;  4DN4 M;  2MO0 A;  1EFI D;  4JI7 Q;  3G6E A;  3HOZ B;  4A3G H;  2L12 A;  3S1R H;  2VB2 X;  3ERO A;  2Z9H A;  5TSS A;  5I9O A;  1STY A;  3E3X A;  2PW5 A;  4APV A;  1D6E C;  2F4V L;  1HZC A;  2JA7 H;  3FVQ A;  5FLM H;  1LUZ A;  4G7Z C;  3HGB A;  3AFQ A;  4GNX A;  1U4L A;  1ENA A;  3I4M G;  4LMQ D;  1R9T H;  1XNR Q;  2AUK A;  1O78 A;  2X6L A;  3J80 c;  2MFI A;  4B3T L;  3VR3 A;  2CH4 W;  2LFN A;  1QB5 D;  1HCZ A;  3MVV A;  5I6W A;  1I50 H;  3M85 A;  2B2V A;  4MN3 A;  3ND9 A;  1QZG A;  3NTI A;  3DMU A;  4PNY A;  2VUM G;  3S14 B;  2I5M X;  1HH2 P;  5ELO A;  3Q0A A;  4G7O C;  4IUP A;  3W1G A;  4EX5 A;  1R4Q B;  4HMI A;  1Y8N B;  5J3B A;  3J7A 5;  3N6R A;  3Q6S A;  2NYZ D;  3EA6 A;  4JBJ A;  4H44 C;  1ZXT A;  1SFO B;  5C44 B;  4DR1 Q;  3VYS A;  5BN4 A;  3PO2 B;  1IKL A;  5IP9 G;  2PI2 E;  5H1S E;  4DAV A;  3HOV B;  2MHV A;  4LUZ A;  3L7Z C;  2EYF A;  3X3N A;  3E6Z X;  1SNP A;  2UUC L;  3KUP A;  3CRK C;  4HIO A;  1KXL A;  3CCL A;  5T1G A;  1SYG A;  2JK8 A;  2VQE Q;  1VF7 A;  1ET9 A;  4DV7 Q;  2KOL A;  2K6A A;  2NWG A;  2A68 C;  5LMN Q;  4C56 C;  3J81 c;  2DNC A;  5E7N A;  3PO2 G;  2ES2 A;  3TRZ A;  2ZT9 C;  5IYB H;  3MFY A;  4I65 A;  2YU9 B;  2ID0 A;  2RQX A;  2R7Z G;  3S2H H;  1KDB A;  2BH8 A;  3X3M A;  2B63 B;  1U4P A;  2L5T A;  3U50 C;  3KDF A;  5J22 A;  1CKN A;  4A75 A;  5JJK A;  2UUC Q;  1TT2 A;  3AU7 A;  5IGF A;  2UUA Q;  3MWY W;  1SNQ A;  1VMP A;  3NBH A;  3RUZ A;  3OIQ A;  1CUK A;  2TMP A;  2C5C A;  2RHS B;  2C35 B;  1GHJ A;  3CPW A;  4JI1 L;  2ZJR A;  4DXF A;  5AJ3 Q;  1MHW C;  1PTO B;  3EVQ A;  3RNU A;  2ZTD A;  2DNE A;  4X62 Q;  4YCV A;  1WCM B;  3VR4 A;  4QCL A;  4P75 A;  4IJL A;  5LL6 X;  5KYL A;  2XRS D;  1GHK A;  5IYD G;  2R92 H;  4UP8 A;  3DEO A;  1B50 A;  4K8J A;  4X65 Q;  2HD3 A;  3T13 A;  1LYL A;  3D31 A;  2X69 A;  2JA9 A;  4OWW B;  3K80 C;  3HP3 A;  3H91 A;  2JA6 B;  3HOX H;  4LF8 Q;  4QF4 A;  1G2T A;  1F2Z A;  2L1B A;  5IGC A;  1PH7 A;  1HTP A;  3KLS X;  4Y7N H;  1PA6 A;  2VL6 A;  1C8C A;  1STN A;  4A3B B;  3I4O A;  1SFO H;  3TP7 A;  2HDL A;  1X3F A;  3P7J A;  2YTX A;  3MFG A;  1UEA B;  2XWJ B;  1LTG D;  1YNN C;  4JI4 Q;  4Y7N B;  3I4M B;  1Y1V H;  2F0S A;  2ZTE A;  1VCI A;  3OSO A;  1ROD A;  3BG3 A;  3MXU A;  4V0B A;  5FO7 B;  1J8I A;  1MI2 A;  3U9S A;  1VQ8 A;  5JJI A;  3CPF A;  3AFP A;  5K36 G;  4B3R L;  3MHB A;  1X56 A;  1EWH A;  1WTO A;  4RGO S;  1C7Y A;  2CCZ A;  4K5V A;  1XX8 A;  2G5D A;  3QWN A;  3DHQ A;  3S1Q H;  3D4W A;  2CW0 C;  1GJX A;  1SYE A;  2NVX B;  4BA2 I;  3KLS A;  1UUP A;  2A6H D;  1Q86 C;  2UXC Q;  1A3V A;  1HJP A;  1IBM L;  2N55 A;  1SR3 A;  2HIX A;  3IFT A;  1EU3 A;  2AQ2 B;  1H9R A;  1ICW A;  1RL2 A;  4JOI C;  4XT3 B;  1KLG D;  3MTS A;  2KCM A;  2KVM A;  4L5Q A;  1ZYR D;  4RH6 A;  1TY0 A;  4C2M B;  1KAB A;  2VS1 A;  2BE5 C;  1DON A;  3SK5 A;  2OQ0 A;  3SE0 A;  5ELC A;  3OTO Q;  3D3R A;  4LFB L;  2UXB L;  2WKC A;  1PH3 A;  1TWF H;  5EQ0 A;  1C9O A;  5C0X I;  2H4O A;  1Y8P B;  3RLO A;  2K01 A;  2N3S A;  1IL2 A;  4GKK L;  2OWO A;  4IPC A;  1QNK A;  2WFW A;  3BDC A;  1CTM A;  2KA7 A;  4ZK9 B;  2CQA A;  4A4I A;  3GTP H;  1C0A A;  1LTT D;  1RCV D;  4PG3 A;  4UPA A;  1RIP A;  4JW0 A;  1RJT A;  5M5Y H;  3KF8 B;  5GAE C;  1HPC A;  4L8J A;  2JA7 G;  3DXJ C;  5FLM G;  2Z4I A;  2F0O A;  3TS2 A;  1H9S A;  4ABN A;  5I6Y A;  1Y1V B;  1IKM A;  1VQP A;  1K83 H;  3DLL A;  1ML0 D;  2A6E C;  2WAC A;  4FP5 D;  4B3M L;  3M4Y A;  2EYL A;  4NXN L;  3Q22 A;  2IT1 A;  1BBW A;  4DUY Q;  1OTC A;  1EOT A;  3K7A H;  4ZKC B;  1AE2 A;  4K0K L;  2R7D A;  2DUD A;  1A3T A;  2KQ3 A;  2RBM A;  3TP5 A;  4DA2 A;  5CBA E;  2V4D A;  2F0I A;  3I4N H;  1FJG Q;  4FXG C;  4LF9 L;  2A69 D;  2RDG A;  3UI2 A;  1J5E Q;  3FKI B;  1EEF D;  3I70 A;  4A3L G;  4IUQ A;  4ZCK A;  5C3E H;  4CKB A;  3U58 A;  1JCK B;  3CRL C;  1G8Z D;  1K9M C;  3STB D;  1QJO A;  4CJ2 C;  4A3D G;  1K73 C;  2EY6 A;  1YI2 A;  4KHZ A;  1GM5 A;  4C1N I;  3OIP A;  2KEE A;  4ILW A;  2M00 A;  3RR5 A;  3IFD A;  3SVM A;  1NTG A;  2FMC A;  1HNW L;  1I4P A;  5BR8 Q;  4A3M G;  5EKK A;  4ME5 A;  1PTO F;  4OIK A;  1LAB A;  3CC7 A;  1X3Q A;  2OF1 A;  4RFB A;  1PV4 A;  2NVT B;  4UHV A;  3I3C A;  3I4N B;  4IUV A;  3NHH A;  4CDF C;  1SN8 A;  2Y0S B;  2JJQ A;  1I50 B;  1KC8 C;  2F0K A;  3AB9 A;  5G3L F;  2CHB D;  3OPO A;  1VQL A;  4QUC A;  1AZP A;  4A3I H;  4BY1 H;  5C4H A;  2XRQ D;  4A3M B;  2BCO A;  3F2B A;  1HA5 A;  4R4Q A;  4ZLT F;  3K6O A;  4K14 A;  3BS1 A;  4A3E G;  3I2Z A;  2F0M A;  2XIW A;  3S1Q B;  4JCV E;  1ASY A;  1CFM A;  1K0R A;  1ZKO A;  4DK6 C;  1EWI A;  2BE5 D;  4X62 L;  5D65 A;  1BF4 A;  2VUM H;  2JEA I;  4QB4 A;  1PFN A;  2E75 C;  1S72 A;  3GTK H;  4OEM B;  4LF4 L;  3M3Y B;  2PZT A;  3S9W A;  4JBM A;  5NUC A;  1NE3 A;  3K5O A;  3GTJ B;  2WV6 D;  1WI5 A;  3EN2 A;  3NBI A;  4DUY L;  5HGQ A;  1CQV A;  3T53 B;  3UDX A;  5COR A;  2WKD A;  4KLK A;  2RA4 A;  2LKV A;  3HOU H;  1VQA A;  3H3V I;  2ZJQ A;  4LFC Q;  1DOL A;  1V8Q A;  3TP6 A;  3SK4 A;  1FNU A;  4DR2 Q;  1TS2 A;  3GTM H;  2F0H A;  1YNJ D;  3PMF A;  4DR4 L;  1SNM A;  2GVA A;  5M3M B;  4HIK A;  3C3L A;  1DM0 B;  3GTP B;  2NN6 H;  4ZUI A;  2QA4 A;  1TWC B;  1A6X A;  4XXE A;  1LV9 A;  1E24 A;  1BR9 A;  4MTN A;  3PIO 3;  5C4X B;  2ENB A;  4ZKB B;  2Q2T A;  1PRT F;  5FO8 B;  2OXP A;  3NTH A;  2WB1 B;  1JWM D;  2K28 A;  5COY A;  4ME3 A;  5C4X H;  2A73 B;  2A69 C;  2RF4 A;  1SJH D;  3NP8 A;  2B8G A;  3OW7 A;  2A19 A;  4AYB G;  5I2X A;  3H09 A;  2D0O A;  5M3M H;  5C4X G;  1RTN A;  1F9Q A;  2AMC B;  1XMO Q;  4HN7 A;  1Z9F A;  3E0E A;  4LFA Q;  4Z9C B;  4XYQ A;  3K81 C;  4OIJ A;  4OHJ A;  4KMU C;  1X3G A;  1CZW A;  1EYD A;  1TWH H;  5IYC H;  3K59 A;  3RZD H;  1AFP A;  1VQB A;  1F9S A;  2I46 A;  4MHE A;  4JI6 L;  1EQR A;  2AWO A;  5FKA C;  2RKS A;  2JA8 B;  4TSS A;  1WTQ A;  3KBX A;  2MP1 A;  3T1H Q;  1D5Z C;  2DJF C;  4GLV B;  4P72 A;  4N8X 1;  1I6V C;  2JA6 H;  3H94 A;  2Z0S A;  1PZI D;  2KEN A;  2E2J H;  4ZAI A;  5EBD A;  1QG7 A;  1CZG A;  1BBX C;  1LT5 D;  3GP7 A;  5C4J H;  3FDT A;  2JA8 G;  1UE5 A;  3M4O B;  1Y1V G;  2KCT A;  4XQQ A;  2HIV A;  1VQ5 A;  1WTV A;  1CM9 A;  5BN5 A;  2NVX H;  2K14 A;  2XN9 C;  4C3J G;  1I4G A;  4CBV A;  3ULP A;  1Q1E A;  4B3S L;  1Y1W B;  1PH1 A;  3RZO H;  1L1O C;  3WOF A;  2IWH A;  3A54 A;  1SJE D;  2QEX A;  4XT1 B;  4NXM L;  4AYB E;  2OTL A;  1DZ1 A;  4A3C H;  1MSH A;  1VQI A;  4FVM A;  4JBK A;  2ICE C;  1EU4 A;  2ZM6 Q;  4OWT B;  1VQH A;  4IZ8 A;  2FFK B;  5M5X B;  1Y1W G;  4K0K Q;  4A3C G;  1B7Y B;  2K50 A;  4JVZ A;  2Q2U A;  1NCV A;  5AJ3 L;  3S15 B;  1TXY A;  4B3R Q;  1IBL L;  5FK9 C;  3MXN A;  4A3I B;  2F0Q A;  1WTW A;  1A63 A;  2SOB A;  4GNX C;  1FR3 A;  3I4N G;  1Q12 A;  1UNS A;  4L5R C;  2K1B A;  2WIN B;  2Y0S G;  3VYU A;  3C2P A;  3AQQ A;  3H0G H;  4X3T A;  3BYY B;  2R61 A;  1D1K A;  1A2U A;  3IL8 A;  3K0X A;  1JWU D;  1O7L A;  3DWQ A;  4DUZ L;  5IT9 L;  3H3V C;  1EY6 A;  4R4O A;  1YIJ A;  1B4O A;  2GVB A;  1HHV A;  1SE2 A;  4AH6 A;  5IIF A;  2EXD A;  4UP9 A;  5EAY A;  1HTL D;  2EYH A;  1EIF A;  4EQN A;  2HT1 A;  1MBY A;  2IW3 A;  5JEA J;  2PCF B;  1SMX A;  3IRB A;  3QG1 A;  2OQK A;  1PH2 A;  3AMU A;  3PO3 B;  3S16 H;  2A74 C;  3PUY A;  5IGB A;  1BO0 A;  5F2D A;  4JI3 Q;  4B9X A;  1IYV A;  4DR3 Q;  3PUX A;  1GXD C;  4ZUJ A;  3P1H A;  4RWS C;  4DF7 A;  5KGU A;  1IBL Q;  4K2L A;  2EXZ A;  2EY1 A;  2K5N A;  2C9O A;  3SDZ A;  2AWN A;  1AE3 A;  2EY5 A;  3DWA A;  3EIV A;  2RDH A;  1ONL A;  2MQH A;  5EBC A;  1BKB A;  3K57 A;  2YU9 H;  2JA7 B;  2OT2 A;  5CMD A;  3BZD B;  5EKI A;  4QGU A;  2QDL A;  4A3K H;  3CAM A;  1L2F A;  1PZK D;  2ZJP A;  4QJF A;  1XPU A;  5DM6 3;  1S3O A;  1LTL A;  2F4V Q;  4OO1 G;  1PVO A;  1O7Z A;  1O7I A;  3C1F A;  1SE3 A;  2D5D A;  3C1E A;  3PUW A;  2VUM B;  1X9N A;  4GOP A;  5CR3 A;  1DXM A;  1PHJ A;  4GKJ L;  1Z47 A;  4E6I A;  3M7N A;  2XWB B;  4B3S Q;  1VQJ A;  2J4X A;  1Y14 B;  3NQI A;  4L63 B;  2B2W A;  3N52 A;  3SR1 A;  3T16 A;  3BJU A;  5IOD A;  1EQT A;  3KF6 B;  5LHY 1;  2EYM A;  4CHT B;  4A3M H;  1H9K A;  4IAL A;  1S5C D;  3ULL A;  2WB1 G;  3LNN A;  2LSS A;  2UUB Q;  1M4V A;  1J9O A;  4A3F H;  1SNC A;  4WRD A;  3GTQ B;  1Q1B A;  4GKJ Q;  3PUV A;  4DV2 Q;  4KTA A;  2RVL A;  4IUN A;  5GAH C;  1D7Q A;  4BY1 G;  3QO2 A;  4YCW A;  4A3B G;  1ESR A;  4GOP B;  2V1C C;  3RN5 A;  1LTB D;  2KEC A;  4GKK Q;  3M3Y H;  2UXD Q;  1EOV A;  2VQF Q;  3RZO B;  4XYO A;  4CJ1 B;  5G3L D;  1C48 A;  2WAQ B;  2MPM A;  1KAW A;  1YJW A;  2Z6B A;  3VA7 A;  3G71 A;  4HAE A;  4JI0 L;  2R6G A;  1QVG A;  4A3E B;  1XMQ L;  3QIA A;  1D2B A;  3NEM A;  2XGT A;  4JI0 Q;  2NTS A;  3FKI H;  2B29 A;  2I0Q A;  1EEI D;  1R4P B;  1HZA A;  2E8G A;  1PH9 A;  4DK0 A;  5C4Z A;  4C3I G;  4H0L C;  4CDE C;  1E7Z A;  3OOC A;  1HNX L;  2Q2I A;  1WD0 A;  4R8I A;  2EIF A;  1SYD A;  3V96 A;  3ONA B;  1YZ6 A;  2NVQ B;  5E4X A;  5GAG C;  2B2U C;  4P71 A;  3VDY A;  1FGB D;  2JA6 G;  3PO3 G;  3HG9 A;  4C3I B;  1VQ9 A;  3D4R A;  4Y52 H;  2BOS A;  1YJN A;  1XPO A;  1PTO H;  2PO4 A;  2WAQ E;  2F3V A;  3EJI A;  4JPB W;  3UE0 A;  5I9P A;  4H13 C;  2KHJ A;  1HRJ A;  1EY8 A;  4NPS A;  1UE6 A;  3VR5 A;  4P2C B;  3PSI A;  1U0L A;  3G7L A;  3GTO B;  2HHH Q;  3GO5 A;  1L1O A;  1E1T A;  5M5X H;  4CDC C;  1N32 L;  1MGS A;  4IUT A;  1HR0 L;  3MXN B;  4OL7 A;  2EOT A;  2K5H A;  2A6E D;  3B6Y A;  4I7A A;  3K5M A;  2IJ0 A;  1D5M C;  1M90 C;  1EL0 A;  4TRD A;  5EKL A;  5JVH 3;  3HOW B;  3JAM E;  5C0X H;  1FNW A;  1NAP A;  5JPM C;  1I4X A;  5J1Z A;  5KIX A;  3H0G B;  5KEE A;  5CV6 A;  2AQ3 B;  4OON A;  4J15 A;  3AEV A;  3OWE B;  1SLJ A;  1OO9 B;  2DY8 A;  4JI8 L;  5CYU A;  1FYC A;  1TY2 A;  3STB C;  4B9W A;  4HJ8 A;  4FF2 A;  1JB7 A;  1Z7T A;  1MKH A;  1QCB D;  2B63 G;  2IL8 A;  3MAQ A;  4UAI A;  1YBY A;  5FJ8 G;  4DR6 L;  4JI5 Q;  2NVY B;  4EQO A;  4EQ5 A;  3J81 L;  3H0G G;  1JT8 A;  5E4W C;  4DPG A;  1CSQ A;  3T4A C;  3CCS A;  3CF5 A;  1A8V A;  3DWP A;  2YTY A;  4RMF A;  4MTK A;  4POF A;  1HNW Q;  1QUQ B;  2SNS A;  3PF4 A;  1A15 A;  2QKI C;  3SEB A;  1P8L A;  4POG A;  1OXU A;  3ZYY X;  3PO2 H;  1SRO A;  2GA4 B;  4YWK A;  2WAQ G;  2NZH A;  2SDF A;  1PDQ A;  2Z6K A;  4DR2 L;  1BNZ A;  4HSV A;  3I4M H;  4OWX B;  3G4S A;  2OTJ A;  4JC0 A;  5IT9 c;  1KDC A;  3W1B A;  5IP7 G;  3PV0 A;  3MEF A;  1LTS D;  5IOC A;  2E2D C;  1VF5 C;  3S1R B;  1XXG A;  4F88 A;  2HCC A;  3R3O A;  3K5N A;  3JAM L;  4RAU C;  1T5E A;  4B3T Q;  3S17 B;  2NBF A;  3M4O H;  1ILP A;  3NPP A;  4LF6 L;  2DN8 A;  2JYO A;  4R4I A;  2GN5 A;  3EBE A;  1M8A A;  4WJW A;  4YWL A;  3CCJ A;  3GV3 A;  4BBS G;  4LW1 A;  5C3W A;  1NY4 A;  4HR7 B;  1HQM C;  1SAP A;  4DV1 Q;  4WJ3 M;  2PQA B;  1SEB D;  4IPH A;  3T56 B;  2KCN A;  5EGT A;  3L2P A;  2AKW B;  4R9W A;  1CKN B;  5A2Q L;  1TII D;  3R2T A;  4KK7 A;  1HFG A;  2ALY B;  4R4T A;  4GN3 B;  1JWS D;  1DD2 A;  1SSO A;  3A5Z B;  3DM1 A;  4IFD G;  1V1P B;  1XNR L;  3K58 A;  4A3D B;  2PQE A;  1AN8 A;  4LF8 L;  4BY7 G;  2K4K A;  2L55 A;  1T9H A;  1TWA H;  2KHI A;  2QIL A;  4L6T B;  4A76 A;  5JEA H;  3K8A A;  1ILQ A;  1BBU A;  4DAY B;  2B3G A;  3TP8 A;  3CXC A;  5M5W B;  3A8J E;  1PXU A;  2PQA A;  3A7L A;  3OTO L;  3GTO H;  1BDO A;  1E22 A;  2RCF A;  1LO5 D;  5JEA G;  4JI7 L;  3MXP A;  1EYA A;  3DUZ A;  5CV9 A;  1Y69 U;  1X55 A;  2D0P A;  1JR0 D;  3J81 i;  2EZV A;  3GTK B;  2EJM A;  2NVQ H;  3HOZ H;  4A3G B;  1G91 A;  3ICE A;  1N36 L;  4YHH Q;  5M5Y B;  1G51 A;  1WVL A;  2LS0 1;  3BVM A;  5C44 G;  1V1P A;  4KKS A;  1GUG A;  4KV6 A;  2IX0 A;  3GTM B;  2UU9 Q;  3I8Z A;  4B08 A;  3S15 H;  5IGE A;  3HKZ E;  4U67 3;  2R92 G;  4JI2 Q;  5IYD H;  1BQQ T;  3TSS A;  3ERQ A;  2KBN A;  4EGV A;  3I91 A;  2ASB A;  3J81 j;  3D0F A;  1TWF B;  4ALP A;  3S2H B;  1K3R A;  3UDF A;  2L0C A;  3KJP A;  1N33 Q;  4RA8 A;  4QUF A;  1TWG B;  4K5X A;  3HS0 C;  1XWE A;  1NMF A;  2EDG A;  3HRZ C;  1CQF A;  2QEJ C;  2RSN A;  3NSW A;  2PMZ B;  1HR0 W;  3ITP A;  1YVC A;  1MJE A;  1B3A A;  3CCE A;  1LLR D;  4O1N A;  4CDD C;  5KNC A;  1EFW A;  1O7Y A;  1HZB A;  1ICF B;  1E0B A;  1OXV A;  3H3V H;  1QE6 A;  2O4X A;  5E1F A;  2B39 A;  3FRP B;  4IUU A;  2AUJ D;  4DR5 L;  2B2Y C;  3TDQ A;  2F3I A;  3RLF A;  1JOR A;  2N49 A;  4JK1 C;  4DR1 L;  3M7G A;  2NUC A;  4Q5V A;  1HUM A;  3C46 A;  3HOW G;  1XYI A;  1MSG A;  2P5Z X;  5HGT A;  4EVO A;  4X65 L;  1HFN A;  2RSO A;  4KHP L;  1BVS A;  3S17 H;  3ND8 A;  1PYS B;  3HOX B;  5IY0 A;  4JV5 L;  2B2V C;  1VQM A;  1EY4 A;  3D8G A;  3GTQ H;  4C3H H;  4QY7 A;  2F3W A;  4GZY C;  1AP0 A;  5DM7 3;  3A56 A;  3I90 A;  3Q23 A;  2A8V A;  2Q8R E;  5JOB A;  1IBM Q;  1W6J A;  3NEL A;  4XDX A;  3F2C A;  2PPB C;  1RD9 D;  1HR0 Q;  2BA1 A;  5ELD A;  4CJ0 B;  1YJ9 A;  3SK6 A;  4Q0F A;  3GTG B;  1N32 Q;  1F9P A;  4A3F G;  2R3Z A;  1EYC A;  1QUQ A;  2I5L X;  4MZ9 A;  3D4D A;  4DV4 Q;  1E2W A;  3E9H A;  2LXJ A;  4HSP A;  2NVT H;  3A5U A;  2PW7 A;  3KF8 A;  4X3K A;  3GTG H;  1VQN A;  1JE5 A;  2KHS A;  1UEB A;  2K04 A;  1F9R A;  3PO3 H;  3KLW A;  2KCC A;  1CK1 A;  4V19 0;  3IKJ A;  2R93 B;  1GOZ A;  3M9B A;  3SK8 A;  1RTO A;  1NR4 A;  1UE1 A;  2EVB A;  4IOA A;  1WOC A;  1LAC A;  3BDL A;  4PMW A;  2JA5 B;  1TU2 B;  5KRU A;  1B53 A;  3EQL C;  1Q81 C;  1BCP F;  4L5T A;  2K52 A;  4WFN 3;  3M4Q A;  3SGI A;  2B2U A;  2YYZ A;  3BYT B;  4JI8 Q;  4KD3 A;  3UDG A;  2BA0 A;  4UDU C;  5A2Q E;  2JA5 H;  1PYW D;  4X64 Q;  3A8I E;  1LT6 D;  3VYR A;  2JE6 I;  4AQY Q;  5DLQ E;  4C3I H;  4R8N A;  4DGZ A;  1S5E D;  4DV0 L;  1JJC B;  4C1N K;  2JA5 G;  2F0V A;  1Z6H A;  5IWA L;  5BN3 A;  4LF5 Q;  1II3 A;  1VS0 A;  2MGS A;  5I4D A;  3J80 L;  2DGY A;  4NXN Q;  1CHQ D;  1I5F A;  3E9I A;  3GTJ H;  4N8F A;  4OEL B;  4B3M Q;  4DR7 L;  1Q90 A;  1TKW B;  1KNE A;  4BXX H;  2E2J B;  4RGT A;  3LX0 A;  1ZEQ X;  4LF5 L;  4DK3 C;  4NXM Q;  2HHH L;  4N9P A;  2CKZ B;  1EYG A;  3HOV H;  2BH2 A;  4AQY L;  4LWC A;  3HZX A;  4IFD I;  1DCZ A;  1SRU A;  1UAP A;  2UXD L;  2K5V A;  1XTD A;  2KJX A;  4HTH A;  2J0T D;  1F2M A;  5JPN C;  3FEW X;  4F7X A;  2KED A;  2Z8L A;  1EZ8 A;  4DV5 L;  5CV7 A;  2HUG A;  2E2H H;  3OYY A;  4RCO A;  1XNQ Q;  1JOO A;  1K0S A;  3K0Y A;  3S2D H;  2K32 A;  2IX3 A;  3Q24 A;  5ELN A;  4GLX A;  1XJV A;  2IY5 B;  1N33 L;  5FLX L;  4PZ7 A;  2F0E A;  2VB3 X;  3S2D B;  2R92 B;  3CMA A;  4A3E H;  1DGS A;  1YHB A;  2A1A A;  3FHW A;  4LF6 Q;  1BXT A;  2K05 A;  1LT3 D;  2XTI A;  1PTO D;  2EY2 A;  3OW2 A;  1WCM H;  2K33 A;  3LGJ A;  1LTI D;  4GNX B;  5CGK A;  5J39 A;  4JI6 Q;  1XTC D;  3WWV A;  4HJ9 A;  4KKT A;  2Q8I B;  3H15 A;  3JAM i;  3TZD A;  2QF7 A;  2FIN B;  3SHL A;  2E74 C;  2HQL A;  3L0O A;  1KNA A;  1N34 L;  1K8O A;  1E3P A;  5JJL A;  4CKE A;  1YHQ A;  1TS4 A;  2L4N A;  4BBS B;  1P16 A;  5LMN L;  4ODG A;  2X6G A;  2Z6K C;  4FO2 A;  2AQ1 B;  1DJR D;  1SE4 A;  1STH A;  1BCP C;  1NBW A;  3NUC A;  4IFD H;  3L9A X;  3FMC A;  1CKO A;  4DV5 Q;  4FF3 A;  3W3A A;  1GUT A;  1WFQ A;  3I56 A;  5M3F B;  4OX9 L;  1JE4 A;  1PZJ D;  2M2L A;  1K8G A;  4HCS A;  3KJO A;  4C3J H;  4A93 B;  4LJZ C;  3A0J A;  5K5P A;  1STE A;  2HQE A;  2F0U A;  2K5W A;  1B8A A;  4C3H B;  4IUR A;  3S1N H;  1D8L A;  2MNA A;  1V9P A;  1B9M A;  3QOL A;  1X6O A;  3V05 A;  3KDF B;  2VY3 A;  1PH6 A;  3PIP 3;  4XQJ A;  5A35 A;  3NK9 A;  3BVZ A;  5JVG 3;  1B3Q A;  4J6H A;  1Y1W H;  1S5B D;  1E2Z A;  1GVP A;  2TSS A;  3F2D A;  1I4H A;  3CCR A;  4KY7 A;  1F2L A;  2NN6 I;  3BU2 A;  5CV5 A;  1NMG A;  4DR3 L;  5C0X G;  4LF7 L;  1WJJ A;  4BBR G;  1B44 D;  1Q8I A;  2K5Q A;  1YIT A;  2NB0 A;  1JIC A;  1V43 A;  1B70 B;  4RHS A;  2DJG C;  3MC0 B;  3ZJY C;  2RHQ B;  1IYU A;  1U4M A;  2WB1 E;  5C3X A;  5FLX E;  1Q3L A;  1Q46 A;  3J7A V;  5FO9 B;  1KRS A;  3KYH C;  4PMB A;  4X3U A;  1N9W A;  4JI3 L;  2Q8T A;  1EIG A;  1PFM A;  5D14 A;  1CT1 D;  2F0N A;  3JAM c;  1LTA D;  4C2M H;  3HEJ A;  4K6D A;  3JC6 6;  1QIL A;  1PTO C;  3QOJ A;  1QZH A;  1YEZ A;  5ELB A;  3HOU B;  4AYB B;  2WP8 J;  4O2D A;  4XIG S;  1RKN A;  2ZM6 L;  2F0D A;  3QJY A;  2ICI A;  1O80 A;  1VQO A;  1HNX Q;  2F0T A;  4TQU S;  1PYB A;  4PZ8 A;  1WTH A;  4LF9 Q;  2YV5 A;  2CFM A;  2JSO A;  2F0L A;  3PQI A;  2B2Y A;  3I72 A;  4DV1 L;  1B2T A;  3OMG A;  1SYC A;  3DEP A;  3GV6 A;  1PLF A;  4FDB A;  4XTC S;  2VQF L;  4NW2 A;  3CQZ H;  3BZK A;  2A68 D;  1XMQ Q;  1NJI C;  4G4K A;  1K8M A;  4A3J H;  4DNT B;  3J80 i;  1VQG A;  1TQO A;  5D3D A;  3CC2 A;  2NVY H;  4IQZ A;  5CV4 A;  3P75 A;  4JG2 A;  2JA8 H;  4O42 A;  2QGQ A;  1PH8 A;  4YIJ A;  4P73 A;  5HUR A;  1YHA A;  4J1M A;  2LY7 A;  1TWA B;  5EJW A;  4BY1 B;  3J7Z C;  3VR2 A;  4RCN A;  1PH4 A;  3A74 A;  4DAM A;  1ZYR C;  1PRT D;  1SXT A;  2VW9 A;  5LMN W;  3MZ5 A;  1YNN D;  4JYA L;  4JBW A;  4DR4 Q;  3WOE A;  1W2B A;  2MUY A;  4WJ4 A;  2R93 H;  2Y0S E;  4IOC A;  3KBG A;  1H95 A;  3R8B A;  2CH4 A;  2K75 A;  3GQB A;  5M5W H;  4GLA C;  1H9J A;  3J80 E;  2PZW A;  2CW0 D;  1IZ6 A;  1X32 A;  4J8Q A;  3T1Y L;  2JXM B;  3TRE A;  2JQO A;  4R1J A;  4LK1 C;  1QWY A;  1JOK A;  5LL6 S;  3PF5 A;  1VDZ A;  4QL5 A;  2E76 C;  1X65 A;  4A3I G;  1XMO L;  4LFB Q;  1QVC A;  5JAV A;  2E2I H;  2UXB Q;  2B2T A;  3KK7 A;  2F03 A;  4R4C A;  4LF4 Q;  3MXG A;  3CCV A;  1TWG H;  2K03 A;  2N8N A;  3K7U C;  1B9N A;  3O13 A;  2CWP A;  4KY6 A;  1WTP A;  4UY8 C;  1Q7Y C;  5DNF A;  3S14 H;  4UP7 A;  1EQV A;  3NWS A;  4FXD A;  2IHF A;  2IHE A; 
#chains in the Genus database with same CATH homology
 4TKO B;  1U9R A;  5ELF A;  1D5X C;  3NWT A;  2R7Z B;  2HCI A;  2O2L D;  4DFA A;  4WOR A;  5FOB B;  4XQN A;  1EWC A;  1AEX A;  2J7Z A;  2JP1 A;  3I73 A;  4PQX A;  2Z1C A;  2IPK D;  5E3F A;  3S1M B;  4FF4 A;  5C6A A;  4NKL A;  3QB3 A;  1GUW A;  2I07 B;  4OO1 I;  1KLU D;  2H1E A;  1S4Z A;  4ID6 A;  4LAA A;  1EY0 A;  3TBI B;  5C5L A;  3J7Y W;  4BWG B;  4RHR A;  5CV8 A;  2L9H A;  4OO1 H;  1BOS A;  2VXW A;  4KKU A;  4K6L A;  1TS5 A;  3G6J B;  3CHB D;  3A7A B;  3LWU A;  2F0P A;  4I7Z C;  2EPB A;  1RF2 D;  4RGN A;  2B2T C;  2M9V A;  3VA5 A;  3TN2 A;  1ESF A;  5C4J B;  4NDX A;  5M9O A;  5D3I B;  5EPL A;  3NTK A;  1L0Y B;  1L0X B;  1JQY D;  1KTK A;  2ZXR A;  3R2I A;  2K5D A;  3KLR A;  1EY9 A;  3NE5 B;  2FMM A;  1ENC A;  4A3F B;  4ULL A;  1IW7 D;  2F1M A;  2NZ1 D;  3E5S A;  3OWF A;  1C4Q A;  2SEB D;  1A3U A;  3K7A B;  1CA5 A;  1IHZ A;  3A8K E;  1F2Y A;  5EPK A;  5ISR A;  2PYK A;  2D2C C;  1E2V A;  1GUN A;  3S1N B;  4F8M A;  2Z4H A;  3J7A F;  5AFW A;  1W6K A;  5ELE A;  2PNR C;  4M1U B;  2PZU A;  1VMC A;  3WDN A;  3TZU A;  3CU7 A;  2FHT A;  3MA2 B;  4BY7 B;  4G7H C;  3OMC A;  1BCP B;  3D6W A;  1G6Z A;  1G2S A;  5DEH A;  3A55 A;  2G9H D;  2CVR A;  1SNO A;  1H9S B;  3S16 B;  3EFX D;  1HUN A;  1PMR A;  1GUO A;  4KJN A;  2L11 A;  1K83 B;  2F0W A;  4KJO A;  1YNJ C;  4U68 A;  3W2D A;  5K36 H;  4ZRZ A;  1S5F D;  5KYI A;  2FJ2 A;  2B8F A;  3J81 E;  3RMH A;  2VNU D;  4QMG A;  3CQZ B;  2EE1 A;  1NSN S;  4BS9 A;  1TR5 A;  3NQT A;  2A6H C;  2F4I A;  1DOK A;  1STA A;  2XSC A;  4DAP A;  1EY7 A;  4X3S A;  4QIW B;  1CHP D;  2F0J A;  3BDO A;  1DOM A;  5KND A;  4M8A A;  4F87 A;  1I4R A;  1OXT A;  1AW7 A;  1SDF A;  1PFB A;  3FPP A;  1Y8O B;  1IL8 A;  1SMY C;  1SBB B;  2RDF A;  1SMY D;  5CC4 A;  1RHP A;  1IW7 C;  1JB3 A;  3F2U A;  4DAY A;  3GTL B;  1DYQ A;  1HXY D;  3T51 B;  1JOQ A;  4H7B A;  1QNU A;  3VYT A;  1EY5 A;  4A3K B;  1TS3 A;  4A3J B;  1BCP D;  1WD1 A;  1SYF A;  1AZQ A;  1BUV T;  3TME A;  1MD2 D;  1LT4 D;  1I3Q B;  3H6M A;  1STG A;  5IGD A;  2NTT A;  1I6H B;  3OHX C;  4PV1 C;  2BDO A;  4K8I A;  3IAY A;  1TWH B;  3RZD B;  3RD4 A;  1SND A;  3L3O C;  4HED A;  3BVG A;  2EJF C;  4KY5 A;  2XVS A;  1U4R A;  3D6C A;  5EPJ A;  1KDA A;  1KAA A;  2WII B;  2F0G A;  4C3H G;  4MIU A;  1GUS A;  2B2W C;  4HMJ A;  4OGQ C;  1B1Z A;  4KN4 C;  4FNF A;  4S3S A;  1V1O A;  2N88 A;  2G9D A;  4G57 A;  4NP5 A;  3FPU B;  4CGY B;  1X3P A;  2LMC B;  4RKB A;  3CKI B;  1JC7 A;  4EQP A;  1WTR A;  2O5I C;  4DK1 A;  3P20 A;  2EYP A;  1SYB A;  2QCP X;  5C5M A;  4HCE A;  2E2H B;  3HKZ B;  1R9T B;  3PUZ A;  3U9O A;  4BA1 I;  4RKL A;  2XNA C;  5JJZ A;  1A2T A;  1QOH A;  2EYO A;  5KNB A;  2E2I B;  4KHV A;  1ENF A;  4ZYS A;  2BDN A;  3E0J A;  2QDB A;  1HA6 A;  2K7V A;  3URY A;  1S5D D;  5CBE E;  4KI0 A;  4KN7 C;  1F77 A;  2OEO A;  3NXW A;  4DXG A;  1D1I A;  2F0F A;  2EYJ A;  3MEH A;  2MJ8 A;  1EIH A;  1I4Q A;  3HOY B;  2SNM A;  2HDM A;  2O5J C;  5C0X J;  3R93 A;  4FF1 A;  5DAU A;  1RDP D;  4C3J B;  1PRT C;  2NN6 G;  4N9T A;  4BBR B;  4FYD A;  4NMZ A;  1NUC A;  2IX1 A;  2A5H A;  4DNR B;  1CI3 M;  2KUM A;  4KD4 A;  1HQR D;  2ZXO A;  3I4L A;  4PMC A;  1TVX A;  1EZ6 A;  2ZXP A;  1NR2 A;  2D9U A;  4FXK C;  4K5W A;  5IT9 E;  4ZQ3 A;  1LTR D;  1ET6 A;  3K5L A;  1STB A;  5C3E B;  1WTX A;  1G29 1;  1OXS C;  4K2K A;  4RGM A;  3SXH A;  2EJG C;  2JEB I;  4DU9 A;  1FD7 D;  1T5X D;  1FNV A;  3GD7 A;  3VR6 A;  3V2T A;  2DY7 A;  5T1I A;  1OXX K;  1PRT B;  4IN3 A;  3LWE A;  5IGG A;  1CA6 A;  1H9M A;  4IFD J;  2D62 A;  5I2Y A;  4CKC A;  4DN4 M;  1EFI D;  3HOZ B;  2L12 A;  2VB2 X;  3ERO A;  5I9O A;  5TSS A;  1STY A;  2PW5 A;  1D6E C;  3FVQ A;  4G7Z C;  3HGB A;  1U4L A;  1ENA A;  4LMQ D;  2AUK A;  1O78 A;  2X6L A;  3VR3 A;  2LFN A;  1QB5 D;  1HCZ A;  3MVV A;  5I6W A;  3M85 A;  2B2V A;  4MN3 A;  3ND9 A;  3NTI A;  3DMU A;  4PNY A;  3S14 B;  3Q0A A;  4G7O C;  4IUP A;  1R4Q B;  4HMI A;  1Y8N B;  3N6R A;  3Q6S A;  2NYZ D;  3EA6 A;  4H44 C;  1ZXT A;  1SFO B;  5C44 B;  3VYS A;  5BN4 A;  3PO2 B;  1IKL A;  4DAV A;  3HOV B;  2MHV A;  3L7Z C;  2EYF A;  3X3N A;  3E6Z X;  1SNP A;  3KUP A;  3CRK C;  5T1G A;  1SYG A;  1VF7 A;  1ET9 A;  2KOL A;  2K6A A;  2NWG A;  2A68 C;  4C56 C;  2DNC A;  2ZT9 C;  3MFY A;  4I65 A;  2YU9 B;  2ID0 A;  2RQX A;  1KDB A;  3X3M A;  2B63 B;  1U4P A;  2L5T A;  5J22 A;  1TT2 A;  3AU7 A;  5IGF A;  1SNQ A;  3MWY W;  1VMP A;  3NBH A;  3RUZ A;  3OIQ A;  2TMP A;  2C5C A;  1GHJ A;  4DXF A;  1PTO B;  3EVQ A;  2DNE A;  1WCM B;  3VR4 A;  4QCL A;  5LL6 X;  5KYL A;  2XRS D;  1GHK A;  3DEO A;  1B50 A;  4K8J A;  3T13 A;  3D31 A;  2X69 A;  3HP3 A;  3H91 A;  2JA6 B;  4QF4 A;  1G2T A;  1F2Z A;  2L1B A;  5IGC A;  1HTP A;  3KLS X;  1C8C A;  1STN A;  4A3B B;  3TP7 A;  2HDL A;  3P7J A;  3MFG A;  1UEA B;  2XWJ B;  1LTG D;  1YNN C;  4Y7N B;  3I4M B;  2F0S A;  1VCI A;  3OSO A;  1ROD A;  3BG3 A;  3MXU A;  4V0B A;  5FO7 B;  1J8I A;  1MI2 A;  3U9S A;  5K36 G;  3MHB A;  1EWH A;  1WTO A;  4RGO S;  4K5V A;  1XX8 A;  3QWN A;  3DHQ A;  3D4W A;  2CW0 C;  1GJX A;  1SYE A;  2NVX B;  4BA2 I;  3KLS A;  1UUP A;  2A6H D;  1A3V A;  2N55 A;  3IFT A;  1EU3 A;  2AQ2 B;  1H9R A;  1ICW A;  4XT3 B;  1KLG D;  3MTS A;  2KVM A;  1ZYR D;  4RH6 A;  1TY0 A;  4C2M B;  1KAB A;  1DON A;  2BE5 C;  3SK5 A;  3SE0 A;  5ELC A;  3D3R A;  2WKC A;  5EQ0 A;  5C0X I;  2H4O A;  1Y8P B;  2K01 A;  1QNK A;  3BDC A;  1CTM A;  2KA7 A;  4ZK9 B;  2CQA A;  1LTT D;  1RCV D;  1RJT A;  1HPC A;  4L8J A;  3DXJ C;  2Z4I A;  2F0O A;  1H9S A;  4ABN A;  5I6Y A;  1Y1V B;  1IKM A;  1ML0 D;  2A6E C;  2WAC A;  4FP5 D;  3M4Y A;  2EYL A;  3Q22 A;  2IT1 A;  1EOT A;  4ZKC B;  3TP5 A;  1A3T A;  2KQ3 A;  2RBM A;  4DA2 A;  5CBA E;  2V4D A;  2F0I A;  4FXG C;  2A69 D;  2RDG A;  3UI2 A;  3FKI B;  1EEF D;  3I70 A;  4IUQ A;  4CKB A;  1JCK B;  3CRL C;  1G8Z D;  1QJO A;  4CJ2 C;  2EY6 A;  4KHZ A;  4C1N I;  3OIP A;  2KEE A;  4ILW A;  2M00 A;  3IFD A;  3SVM A;  2FMC A;  1I4P A;  5EKK A;  4ME5 A;  1PTO F;  4OIK A;  1LAB A;  1X3Q A;  2OF1 A;  4RFB A;  2NVT B;  3I3C A;  3I4N B;  4IUV A;  3NHH A;  2Y0S B;  1I50 B;  2F0K A;  3AB9 A;  5G3L F;  2CHB D;  3OPO A;  4QUC A;  1AZP A;  5C4H A;  2XRQ D;  4A3M B;  2BCO A;  1HA5 A;  4ZLT F;  3K6O A;  4K14 A;  3BS1 A;  2F0M A;  2XIW A;  3S1Q B;  1CFM A;  1ZKO A;  2BE5 D;  5D65 A;  1BF4 A;  2JEA I;  4QB4 A;  1PFN A;  2E75 C;  3M3Y B;  2PZT A;  3S9W A;  5NUC A;  3K5O A;  3GTJ B;  2WV6 D;  3NBI A;  1CQV A;  3T53 B;  5COR A;  2WKD A;  2RA4 A;  2LKV A;  1DOL A;  1V8Q A;  3TP6 A;  3SK4 A;  1FNU A;  1TS2 A;  2F0H A;  1YNJ D;  3PMF A;  1SNM A;  5M3M B;  3C3L A;  1DM0 B;  3GTP B;  2NN6 H;  4ZUI A;  1TWC B;  1A6X A;  4XXE A;  1LV9 A;  1BR9 A;  3PIO 3;  5C4X B;  2ENB A;  4ZKB B;  1PRT F;  5FO8 B;  2OXP A;  3NTH A;  2WB1 B;  1JWM D;  2K28 A;  5COY A;  2A73 B;  2A69 C;  3NP8 A;  1SJH D;  2B8G A;  3OW7 A;  5I2X A;  3H09 A;  1RTN A;  1F9Q A;  4HN7 A;  4Z9C B;  4XYQ A;  4OIJ A;  4OHJ A;  1CZW A;  4KMU C;  1EYD A;  3K59 A;  1AFP A;  1F9S A;  2I46 A;  4MHE A;  5FKA C;  2AWO A;  2RKS A;  2JA8 B;  4TSS A;  1WTQ A;  3KBX A;  2MP1 A;  1D5Z C;  1I6V C;  3H94 A;  1PZI D;  4ZAI A;  5EBD A;  1QG7 A;  1CZG A;  1BBX C;  1LT5 D;  3GP7 A;  3FDT A;  3M4O B;  4XQQ A;  1WTV A;  1CM9 A;  5BN5 A;  2XN9 C;  4C3J G;  1I4G A;  4CBV A;  1Q1E A;  1Y1W B;  3WOF A;  2IWH A;  3A54 A;  1SJE D;  4XT1 B;  1DZ1 A;  1MSH A;  4FVM A;  2ICE C;  1EU4 A;  4IZ8 A;  2FFK B;  5M5X B;  1NCV A;  3S15 B;  5FK9 C;  3MXN A;  4A3I B;  2F0Q A;  1WTW A;  2SOB A;  1FR3 A;  1Q12 A;  1UNS A;  2K1B A;  2WIN B;  3VYU A;  3C2P A;  4X3T A;  3BYY B;  2R61 A;  1D1K A;  1A2U A;  3IL8 A;  1JWU D;  1O7L A;  3DWQ A;  5IT9 L;  3H3V C;  1EY6 A;  1B4O A;  1HHV A;  1SE2 A;  5IIF A;  1HTL D;  2EYH A;  4EQN A;  1MBY A;  2IW3 A;  5JEA J;  2PCF B;  3QG1 A;  3AMU A;  3PO3 B;  2A74 C;  3PUY A;  5IGB A;  1BO0 A;  5F2D A;  4B9X A;  1IYV A;  3PUX A;  1GXD C;  4ZUJ A;  3P1H A;  4RWS C;  4DF7 A;  5KGU A;  4K2L A;  2EXZ A;  2EY1 A;  2C9O A;  3SDZ A;  2AWN A;  2EY5 A;  3DWA A;  2RDH A;  1ONL A;  5EBC A;  3K57 A;  2JA7 B;  2OT2 A;  5CMD A;  3BZD B;  5EKI A;  1PZK D;  5DM6 3;  4OO1 G;  1O7Z A;  3C1F A;  1SE3 A;  2D5D A;  3C1E A;  3PUW A;  2VUM B;  5CR3 A;  1DXM A;  1Z47 A;  4E6I A;  3M7N A;  2XWB B;  2J4X A;  3NQI A;  4L63 B;  2B2W A;  3N52 A;  3SR1 A;  3T16 A;  5IOD A;  1EQT A;  5LHY 1;  2EYM A;  4CHT B;  1H9K A;  4IAL A;  1S5C D;  3LNN A;  1M4V A;  1J9O A;  1SNC A;  4WRD A;  3GTQ B;  1Q1B A;  3PUV A;  4KTA A;  2RVL A;  4IUN A;  3QO2 A;  1ESR A;  1LTB D;  2KEC A;  3RZO B;  4XYO A;  4CJ1 B;  5G3L D;  1C48 A;  2WAQ B;  2MPM A;  3VA7 A;  4HAE A;  2R6G A;  4A3E B;  1D2B A;  3QIA A;  2NTS A;  1EEI D;  1R4P B;  4DK0 A;  5C4Z A;  4C3I G;  4H0L C;  3OOC A;  1WD0 A;  4R8I A;  1SYD A;  3V96 A;  3ONA B;  2NVQ B;  5E4X A;  2B2U C;  1FGB D;  3HG9 A;  4C3I B;  3D4R A;  2BOS A;  1PTO H;  2PO4 A;  2F3V A;  3EJI A;  5I9P A;  4H13 C;  1HRJ A;  1EY8 A;  3VR5 A;  4P2C B;  3G7L A;  3GTO B;  3GO5 A;  1MGS A;  4IUT A;  4OL7 A;  2EOT A;  2A6E D;  3K5M A;  2IJ0 A;  1D5M C;  1EL0 A;  4TRD A;  5EKL A;  5JVH 3;  3HOW B;  3JAM E;  5C0X H;  1FNW A;  5JPM C;  1NAP A;  1I4X A;  5J1Z A;  5KIX A;  3H0G B;  5KEE A;  5CV6 A;  2AQ3 B;  3OWE B;  1OO9 B;  2DY8 A;  5CYU A;  1FYC A;  1TY2 A;  4B9W A;  4FF2 A;  1Z7T A;  1QCB D;  2IL8 A;  3MAQ A;  4UAI A;  2NVY B;  4EQO A;  3J81 L;  5E4W C;  3T4A C;  3DWP A;  2SNS A;  1A15 A;  2QKI C;  3SEB A;  1OXU A;  3ZYY X;  2GA4 B;  2SDF A;  1PDQ A;  1BNZ A;  4HSV A;  1KDC A;  3PV0 A;  1LTS D;  5IOC A;  2E2D C;  1VF5 C;  3S1R B;  1XXG A;  4F88 A;  2HCC A;  3R3O A;  3K5N A;  3JAM L;  4RAU C;  1T5E A;  3S17 B;  2NBF A;  1ILP A;  3NPP A;  2DN8 A;  2JYO A;  1M8A A;  4WJW A;  3GV3 A;  5C3W A;  4HR7 B;  1HQM C;  1SAP A;  1SEB D;  3T56 B;  2KCN A;  5EGT A;  4R9W A;  5A2Q L;  1TII D;  3R2T A;  4KK7 A;  1HFG A;  1DD2 A;  1JWS D;  1SSO A;  3DM1 A;  4IFD G;  1V1P B;  3K58 A;  4A3D B;  2PQE A;  1AN8 A;  2L55 A;  2QIL A;  4L6T B;  5JEA H;  1ILQ A;  3TP8 A;  5M5W B;  3A8J E;  1PXU A;  3A7L A;  1BDO A;  1LO5 D;  5JEA G;  3MXP A;  1EYA A;  3DUZ A;  5CV9 A;  1Y69 U;  1JR0 D;  2EZV A;  3GTK B;  2EJM A;  1G91 A;  4A3G B;  5M5Y B;  1WVL A;  2LS0 1;  3BVM A;  1V1P A;  4KKS A;  1GUG A;  4KV6 A;  2IX0 A;  3GTM B;  3I8Z A;  4B08 A;  5IGE A;  4U67 3;  1BQQ T;  3TSS A;  3ERQ A;  4EGV A;  3I91 A;  1TWF B;  3S2H B;  2L0C A;  4RA8 A;  4QUF A;  1TWG B;  4K5X A;  3HS0 C;  1XWE A;  2EDG A;  3HRZ C;  1CQF A;  2QEJ C;  2RSN A;  3NSW A;  2PMZ B;  3ITP A;  1B3A A;  1LLR D;  4O1N A;  5KNC A;  1O7Y A;  1E0B A;  1OXV A;  1QE6 A;  2O4X A;  5E1F A;  2B39 A;  3FRP B;  4IUU A;  2AUJ D;  2B2Y C;  3TDQ A;  3RLF A;  1JOR A;  4JK1 C;  3M7G A;  2NUC A;  4Q5V A;  1HUM A;  3C46 A;  1XYI A;  1MSG A;  5HGT A;  4EVO A;  1HFN A;  2RSO A;  3ND8 A;  3HOX B;  2B2V C;  1EY4 A;  3D8G A;  2F3W A;  4GZY C;  1AP0 A;  5DM7 3;  3A56 A;  3I90 A;  3Q23 A;  2Q8R E;  5JOB A;  1W6J A;  2PPB C;  4XDX A;  1RD9 D;  2BA1 A;  5ELD A;  4CJ0 B;  3SK6 A;  4Q0F A;  3GTG B;  1F9P A;  2R3Z A;  1EYC A;  3D4D A;  1E2W A;  4HSP A;  2PW7 A;  3KF8 A;  4X3K A;  2KHS A;  2K04 A;  1F9R A;  2KCC A;  1CK1 A;  4V19 0;  3IKJ A;  2R93 B;  1GOZ A;  3SK8 A;  1RTO A;  1NR4 A;  2EVB A;  1LAC A;  3BDL A;  4PMW A;  2JA5 B;  1TU2 B;  5KRU A;  1B53 A;  3EQL C;  1BCP F;  4WFN 3;  2B2U A;  2YYZ A;  3BYT B;  4KD3 A;  2BA0 A;  4UDU C;  5A2Q E;  1PYW D;  3A8I E;  1LT6 D;  3VYR A;  2JE6 I;  4R8N A;  4DGZ A;  1S5E D;  4C1N K;  2F0V A;  1Z6H A;  5BN3 A;  1II3 A;  2MGS A;  5I4D A;  3J80 L;  1CHQ D;  1Q90 A;  1TKW B;  1KNE A;  2E2J B;  4RGT A;  3LX0 A;  1ZEQ X;  4N9P A;  3HZX A;  4IFD I;  1DCZ A;  1UAP A;  2KJX A;  4HTH A;  2J0T D;  1F2M A;  5JPN C;  3FEW X;  4F7X A;  2KED A;  2Z8L A;  1EZ8 A;  5CV7 A;  2HUG A;  4RCO A;  1JOO A;  3K0Y A;  2K32 A;  2IX3 A;  3Q24 A;  5FLX L;  2F0E A;  2VB3 X;  3S2D B;  2R92 B;  1BXT A;  2K05 A;  1LT3 D;  1PTO D;  2EY2 A;  2K33 A;  1LTI D;  5CGK A;  5J39 A;  1XTC D;  4KKT A;  2Q8I B;  3TZD A;  2QF7 A;  2FIN B;  3SHL A;  2E74 C;  1KNA A;  1K8O A;  4CKE A;  1TS4 A;  2L4N A;  4BBS B;  4ODG A;  2X6G A;  4FO2 A;  2AQ1 B;  1DJR D;  1SE4 A;  1STH A;  1BCP C;  3NUC A;  4IFD H;  3L9A X;  3FMC A;  4FF3 A;  3W3A A;  1GUT A;  5M3F B;  1JE4 A;  1PZJ D;  2M2L A;  4HCS A;  4A93 B;  4LJZ C;  5K5P A;  1STE A;  2HQE A;  2F0U A;  2K5W A;  4C3H B;  4IUR A;  1B9M A;  3QOL A;  3V05 A;  3PIP 3;  4XQJ A;  5A35 A;  3NK9 A;  3BVZ A;  5JVG 3;  4J6H A;  1S5B D;  1E2Z A;  2TSS A;  1I4H A;  4KY7 A;  1F2L A;  2NN6 I;  5CV5 A;  5C0X G;  1B44 D;  1Q8I A;  2K5Q A;  2NB0 A;  1JIC A;  1V43 A;  4RHS A;  3MC0 B;  1IYU A;  1U4M A;  5C3X A;  5FLX E;  1Q3L A;  3J7A V;  5FO9 B;  4PMB A;  4X3U A;  2Q8T A;  1EIG A;  1PFM A;  5D14 A;  1CT1 D;  2F0N A;  1LTA D;  3HEJ A;  4K6D A;  1QIL A;  1PTO C;  3QOJ A;  5ELB A;  3HOU B;  4AYB B;  2WP8 J;  4XIG S;  1RKN A;  2F0D A;  3QJY A;  2ICI A;  1O80 A;  2F0T A;  4TQU S;  2JSO A;  2F0L A;  2B2Y A;  3I72 A;  1B2T A;  3OMG A;  1SYC A;  3DEP A;  3GV6 A;  1PLF A;  4XTC S;  4NW2 A;  2A68 D;  4G4K A;  1K8M A;  4DNT B;  1TQO A;  5D3D A;  4IQZ A;  5CV4 A;  3P75 A;  4O42 A;  4YIJ A;  5HUR A;  4J1M A;  2LY7 A;  1TWA B;  5EJW A;  4BY1 B;  3VR2 A;  4RCN A;  1ZYR C;  1PRT D;  1SXT A;  3MZ5 A;  1YNN D;  4JBW A;  3WOE A;  2MUY A;  3KBG A;  3R8B A;  3GQB A;  1H9J A;  3J80 E;  2PZW A;  2CW0 D;  1X32 A;  4J8Q A;  2JXM B;  4LK1 C;  1QWY A;  1JOK A;  5LL6 S;  1VDZ A;  2E76 C;  5JAV A;  2B2T A;  3KK7 A;  2F03 A;  3MXG A;  2K03 A;  1B9N A;  3O13 A;  4KY6 A;  1WTP A;  5DNF A;  1EQV A;  3NWS A;  4FXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...