4KY5A

Crystal structure of staphylococcal nuclease variant delta+phs v23d at ph 7 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D at pH 7 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky5A00
4RKLA 4ID6A 2QDBA 1EY4A 1SNQA 1KDCA 4KTAA 3HZXA 5KIXA 2F0TA 2F3WA 3NHHA 3C1EA 4KJNA 5EKKA 3RUZA 5CV7A 5J39A 5EGTA 4F7XA 5J22A 2EYOA 3TMEA 4J6HA 5C4ZA 1ENAA 4ME5A 5ISRA 5JAVA 4QMGA 2PZUA 4DU9A 4YIJA 1SYDA 2WACA 3SR1A 1SYEA 3NUCA 3OWFA 4KY6A 2F3VA 1TT2A 1U9RA 4KD3A 1SYBA 4PMCA 5EKLA 3R3OA 1AEXA 1SNMA 4PNYA 2F0DA 5E3FA 3T13A 1NUCA 1SNOA 4KHVA 2RBMA 4EVOA 5C6AA 2F0MA 2SNSA 1EY5A 1EZ8A 2EYLA 2O4XA 2PYKA 1EY6A 3H6MA 3TP6A 1EQVA 4B9XA 1JORA 4K8IA 1EY7A 4K5WA 3EJIA 4DF7A 1SNDA 1SYFA 2LKVA 2PW7A 4ZUIA 5IODA 1A3VA 1JOOA 1NSNS 3V2TA 5KRUA 1ENCA 1A3UA 3ERQA 4R8NA 5E1FA 4K2KA 4IZ8A 5IGBA 3QB3A 4F8MA 2EY1A 4NDXA 4ZQ3A 4K5XA 3D4WA 3TP8A 4NMZA 4IALA 5CV4A 1EZ6A 4OL7A 4DGZA 3E5SA 1A3TA 3EVQA 1A2TA 2EYPA 2PZWA 4I65A 1SYGA 5CV5A 2HQEA 4KD4A 4LAAA 5C5LA 1SYCA 2OF1A 3D6CA 4ZUJA 2F0FA 3VA5A 3OSOA 5IGFA 2ENBA 3NXWA 2SNMA 2PW5A 1STBA 1STAA 5JOBA 3TP5A 5I9PA 4IUNA 1EYCA 5K5PA 4N9TA 2EYHA 2RKSA 3LX0A 5I6WA 5IGGA 5IGCA 2EYJA 1KAAA 3SK4A 5CV8A 5C3XA 4KV6A 2F0QA 2F0VA 4DFAA 4EQPA 5HGTA 3DHQA 3MVVA 2EYMA 1F2ZA 1RKNA 4K8JA 4NP5A 1STYA 1SNPA 3MXPA 1KABA 2M00A 2OXPA 3MEHA 4K2LA 4WRDA 3D4DA 2F0HA 4KY7A 1TR5A 5I6YA 4S3SA 5IGEA 2KHSA 3BDCA 3SK8A 5CC4A 5KEEA 5CV6A 5J1ZA 3PMFA 2F0WA 2F0EA 5CV9A 2EXZA 3P75A 5KGUA 1EYAA 5CGKA 3TP7A 1EY8A 2EY2A 1TQOA 2NUCA 4QF4A 4K5VA 3D8GA 3T16A 2F0LA 2EY6A 2PZTA 3QOJA 4J1MA 3BDLA 4KY5A 5IOCA 4EQNA 1KDAA 2F0OA 2OEOA 4NKLA 4QB4A 3SXHA 4G57A 5IGDA 5KYLA 4N9PA 5F2DA 5C3WA 3MHBA 4E6IA 1STNA 2F0NA 4WORA 4EQOA 3NP8A 5C5MA 5I9OA 1EY9A 3MZ5A 1F2YA 3SHLA 4TRDA 1A2UA 1JOKA 4HMJA 2F0PA 2RDFA 3OMCA 3C1FA 1F2MA 2F0SA 3EROA 4B9WA 2F0GA 3SK5A 4KJOA 3U9OA 2EYFA 3DMUA 2F0IA 3SK6A 2EY5A 3NQTA 3QOLA 1IHZA 5KYIA 2F0JA 1II3A 2SOBA 2PQEA 1EYDA 2F0UA 1SNCA 3OMGA 4PMBA 5DAUA 3ITPA 4K14A 4MIUA 5DEHA 5C4HA 3NK9A 1STHA 5IIFA 1STGA 5CR3A 3S9WA 5HURA 5NUCA 4HTHA 1JOQA 1KDBA 3P1HA 4HMIA 2KQ3A 4H7BA 3HEJA 4K6DA 4ODGA 2F0KA 5M9OA 1EY0A 4RKBA
chains in the Genus database with same CATH superfamily
4RKLA 2GN5A 2QDBA 2XIWA 4HIKA 4BXXH 1KNAA 4P72A 1IZ6A 2A8VA 2B29A 2BA1A 4J6HA 1G91A 3AMUA 3A5ZB 3U58A 1UEBA 2RBMA 3PUXA 4B9XA 3FKIH 4U68A 5A2QE 3K5MA 5BR8Q 1G8ZD 3IRBA 3V2TA 3KBGA 2FINB 4A3FG 3BZDB 2MNAA 1KTKA 4DR4Q 1E0BA 2PNRC 5CV4A 2K1BA 3J80i 2MPMA 3V96A 4LF9Q 2L1BA 1VQ4A 3S1NB 3KDFA 5JJIA 2PZWA 2NVTH 2JA5H 1HZAA 4RGOS 4B3TQ 1CFMA 4BBSH 2Z4IA 1B2TA 1D5ZC 3H09A 1HTLD 4G4KA 4GN4B 1STBA 2MJ8A 4IN3A 1E3PA 1L2FA 1V8QA 2Z6KA 4NXNL 4RAUC 3PIOA 4B3ML 1J6QA 4X65L 4JI2L 3HFZB 2Q8TA 1SE3A 3S1QB 1FL0A 3GTKH 2Q2IA 2K03A 5CV6A 2F0EA 4Z9CB 2XSCA 2N88A 2NZOA 3S2DH 4A93B 3T16A 2KEDA 4J1MA 4MN3A 1KDAA 3ERSX 3LWEA 2MFIA 3I4NG 3I4MB 3KLSA 2K50A 4IUQA 5G3LD 3L9AX 4JW0A 2PCFB 1FR3A 1BBUA 2R92H 1EWHA 1KLUD 1CZWA 2ZXRA 3RLOA 2RDHA 4IPDA 3AFPA 5LL6S 1CM9A 4QIWB 3ZJYC 4RHRA 5C4HA 4K14A 1PA6A 3D6WA 4RCNA 4QY7A 4ZYSA 1D5XC 3I55A 5NUCA 1BXTA 1SRUA 3HOYB 3S14B 1WCMB 5C0XJ 5LL6X 4R4QA 5T1IA 1IXRA 5ELNA 3V05A 1D7QA 1NBWA 4XIGS 5CV7A 2GVBA 3KUPA 4A3JH 3PO2H 3D0FA 5EBDA 1YJNA 1TXYA 1IW7C 1FNWA 3PIP3 1XYIA 1CK1A 1G291 4LF7Q 4PNYA 1SNOA 4UDUC 4OX9Q 3H6MA 2JEBI 2DNCA 1RTOA 3K0XA 2LKVA 1U4LA 1YNJD 1VQOA 5GADC 2WP8J 4LW1A 3QB3A 5IP9H 4BY1B 1A0IA 1H9KA 2IT1A 4OWWB 5AJ3L 3UDIA 4DR7Q 2DY7A 1XJVA 2A6HD 2PI2E 3RNUA 5EPJA 1Z6HA 2RSNA 2KCMA 1EQTA 3ULLA 4JCVE 5JEAJ 2X6GA 2IL8A 3HOXG 4DNIA 1P16A 2SNMA 3S1NH 1QZGA 4XYOA 4GN5A 4AIMA 3BVMA 1VQ7A 3DHQA 3I56A 4GS3A 5BR8L 4K8JA 3OYYA 5HY6A 5M3FH 1SNPA 3NTKA 2Q2TA 1R9TB 1PH7A 1XPUA 3IFTA 5IGEA 3F2BA 4IQZA 4DR4L 1DONA 2AMCB 2CH4W 4LF9L 2D0OA 2NYZD 2AHOB 1F9PA 4R9WA 2NUCA 2PZTA 1CA5A 5IOCA 3IAYA 1B9MA 3K58A 1XTCD 1AW7A 1HUMA 4A3LG 4BBRB 1N36Q 4RA8A 1XXGA 4UP7A 3PIO3 1VQ8A 1EY9A 1HH2P 1W6KA 4YWMA 1ESFA 1F2MA 1PFNA 1IBKL 5FKAC 2DN8A 4JI8Q 1GUNA 1IBMQ 3I4MH 2K4KA 2GA4B 1B7YB 3T1HQ 1DOKA 1G6PA 3Q8DA 1STGA 4H13C 3CP0A 2EOTA 4CKCA 2NVXB 1FNVA 3DM3A 1C0AA 1EY4A 2K33A 1M1KC 4NW2A 3HOYH 4A4IA 3S14H 1WCMH 2K75A 2UUCQ 2A74C 4A3GG 2DGYA 3K81C 2PZUA 4NB3A 2G9HD 2B2WA 1LO5D 2I5LX 3S1RB 2F0DA 1L1OB 2PYKA 2CWAA 1K9MC 2SDFA 3L2PA 3EIVA 4X3SA 1NSNS 4DXFA 1AN8A 5E1FA 2WB1E 4F8MA 4YY3Q 3S2HB 5CBEE 1CQFA 4XYQA 2WIIB 2MO1A 1YHAA 4CDDC 2Y0SE 2ZXPA 3BZCA 3CW2C 3H3VH 4LF7L 5JOBA 3TP5A 1J9OA 2OT2A 3R8BA 3A8IE 4OX9L 4OO1H 1SMXA 3W5OA 4C3IB 5IGCA 4G7HC 1XTDA 1JWUD 1UNSA 3P7JA 1PH5A 4DV5Q 3K7AB 1V1PA 2K5VA 1W6JA 3FKIG 3RN2A 2RF4A 1WTVA 2NTSA 4P2CB 3EBEA 1U4RA 4Y7NB 2Q2HA 4DR7L 4OXPA 2OWOA 1RODA 1EYAA 4APVA 3NENA 1H9RA 2X69A 2A6ED 1EWIA 1XNRQ 5E4WC 2JA6G 1PRTF 2YV5A 2CW0D 4DAYB 3KJPA 3J81L 3CMAA 1W3SA 5C0XH 1T5EA 3NP8A 4C1NI 2JA5G 1X56A 3D31A 4CJ1B 2JYOA 1PYSB 4IPCA 4C2MH 2VQEQ 4UP8A 1CKMA 1I50B 2RQXA 2OQKA 2B2VA 1AP0A 3U9OA 3D4RA 4BBRH 1GHJA 3N6RA 2EJGC 1YI2A 1L0YB 3S1MB 3TZUA 4KHPQ 4RMFA 5DLQE 5C4JB 3M4PA 1PYWD 4HMIA 1JT8A 1JWMD 1SJED 2KA7A 3S17B 3L0OA 4LNQA 4ID6A 2RSOA 3GTJB 3ND9A 1BCPF 3RR5A 4RFBA 4N8X1 5COYA 1N36L 5M5XB 4I7ZC 3AU7A 4XQQA 4ZAIA 1U9RA 3J7A5 2PMZB 3AFQA 4JI8L 3WOEA 4A3FH 1I6HB 2A5HA 4KHVA 5I4DA 1K8AC 1PTOH 3AYHB 2Z8LA 5JEAH 2R92G 3UE0A 3T1HL 3A0JA 3KDFB 3TREA 4O2DA 1RIPA 3HKZG 5KRUA 1ENCA 1A3UA 3S1RH 1FVIA 2BH8A 4IZ8A 5C3EB 1DOMA 3CC7A 1S5BD 2EY1A 1LACA 2ES2A 1SJHD 5BN4A 1DCZA 3NSWA 1YITA 2EIFA 1LLRD 4OHJA 1X55A 2K14A 1C7YA 2QGQA 1K0RA 3KYHC 2UUCL 3EFXD 2HQEA 2DJFC 2LXJA 2N3SA 1GD7A 1RL2A 3FP9A 3OOCA 3S2HH 1KXLA 5I9PA 3M4YA 5LMNQ 4A3JG 1CA6A 1E2ZA 4N9TA 3ICEA 1PXUA 2DY8A 5FLXc 2K28A 5CV8A 2NTTA 5EKIA 3MA2B 1KC8C 4WJ3M 3NQIA 2JE6I 4JI5L 2XGTA 2BH2A 4AQYQ 2NWGA 4WRDA 4YY3L 2MO0A 4FDBA 4C3IH 4V0BA 5KEEA 2R7FA 3K7AH 1CQVA 5JPNC 5IP9G 1TQOA 1UUPA 4K5VA 4Y7NH 1SXTA 3BJUA 1NMFA 4A3DB 3GTOB 2KEEA 3DM1A 2Z6BA 2VB2X 2H1EA 3VYRA 1EIHA 4WORA 5I9OA 1IKMA 1JJ2A 3K5NA 3VYTA 3CPWA 1SFOB 4DV5L 4B9WA 4XT3B 4FF1A 4JG2A 1IHZA 4RCOA 1S40A 4RGTA 4PMBA 4R4TA 5CR3A 1WTQA 3A8JE 4CGYB 1XNRL 1YEZA 3S1MH 1CKNA 4LK1C 3DWPA 3H3VC 1VQEA 4KTAA 1V9PA 5J39A 1BDOA 4KMUC 1B9NA 3CCLA 1QG7A 2E2JB 4QQBX 1KL9A 2KVMA 5K36H 2XWJB 1DOLA 2L0CA 4GKKQ 3PUWA 3FHWA 4YIJA 4A3KB 3GTJH 2YTVA 1NAPA 1PLFA 5C6AA 3TQYA 4EGVA 1A62A 4A93G 5M5XH 1B4OA 2DNEA 4KHPL 2NVYB 1VQ6A 3I4MG 4AYBE 1I6HH 3DWQA 2UUAQ 3TP8A 1TWFB 3R2IA 1UE6A 4O1NA 3HOXH 3J81E 1PYBA 4LF6Q 1RTNA 1MSHA 1WTPA 2F03A 1N32Q 2HT1A 2VW9A 2IHEA 5C3EH 2JXMB 1WFQA 1YJWA 1S5CD 1PH1A 1UAPA 3CPFA 4ZUJA 2CQOA 3OTOQ 3VDYA 2VZAA 3DLLA 3HOYG 4JI4Q 1GHKA 1QCBD 1KQSA 2XRSD 1EIYB 1KAAA 2F52A 3BDOA 3HOVB 1HHVA 1ET9A 5LHY1 2XN9C 1NR4A 1YBYA 1CHPD 1QVCA 3DUZA 2NZHA 4JOIA 5AFWA 1G51A 3K5OA 4X66Q 2AKWB 1JJCB 5J1ZA 5TSSA 2EY2A 4YHHQ 1WYDA 2LSSA 1LTBD 1YNND 3S15B 4DR2Q 3GDEA 1EOVA 2OEOA 1EUJA 2K5WA 4G57A 1J5EQ 1PV4A 1STNA 1H9MA 2OQ0A 2ZTEA 2A73B 4LUZA 3VYSA 4BY1G 5LMNL 2H5XA 4U673 2F0PA 1E2WA 2RDFA 4CDEC 4A3DH 4MHEA 3GTOH 4DR3Q 2A68D 1QZHA 1L1OC 4OO1G 3NELA 3NQTA 4AQYL 3P20A 4GNXC 1L0XB 2F0UA 1Q1BA 1SFOH 5EPKA 1JOQA 1KDBA 4H7BA 4JI0Q 3KFUA 1I4PA 1VF7A 1C9OA 3HKZB 4N8FA 4LF8L 2QA4A 1E24A 1WTWA 4F7XA 1I4RA 3SEBA 1Z7TA 4L6TB 1BBXC 3EN2A 3GTLB 1ESRA 2R7ZB 4GOPA 2WACA 4NPSA 4L5SA 4XDXA 3PIPA 1SYBA 5C0XG 4DNTB 1SNMA 2EPBA 2E2HB 3I4OA 2QILA 5KNCA 3RZDH 5M5YB 4XTCS 1AE3A 4XQNA 3TP6A 3CMEA 1HTPA 4JYAQ 1LM0A 4A3KH 3J7YW 4POFA 1LV9A 1YNJC 2ATWA 1Q8IA 3GV3A 1HNZQ 1Q12A 2R93B 2NVYH 2A6HC 2ZJPA 1EL0A 1OXSC 5CBAE 3S24A 1XMOQ 5M3MB 4JI6Q 4GKKL 1V1PB 1MD2D 1SYCA 2OF1A 2EJFC 3PO3B 1LT6D 3M9BA 2KUMA 2E2DC 4X64Q 4DV0L 4RGNA 3G6EA 1HZBA 3JAMi 2G9DA 4RHSA 4TKOB 5JEAG 3A5UA 2UUAL 3OIPA 4HSVA 2JA6H 1VQ9A 2V4DA 2N8NA 5LMNW 2EVBA 4OWTB 1P8LA 1D5MC 3HOVH 2F0WA 3PQIA 2EJMA 1JE4A 1RF2D 1VDZA 2FXQA 3M3YB 1EEID 1N32L 4QF4A 2K5DA 1MHWC 2F0LA 2WKCA 3I90A 4EQNA 2F0OA 2AWNA 4MNOA 3WOFA 3OTOL 2E5LQ 1PRTD 3TZDA 5EQ0A 4DKAC 1EU3A 4QGUA 1R4PB 2JA8B 1OXXK 2L4NA 1X54A 4F87A 2HD3A 1IKLA 4JVZA 2F4IA 1HR0Q 1CKOA 5JPMC 1JB3A 2F0JA 4KLKA 4ZRZA 3OMGA 1QOHA 3H3VI 2MUYA 3EQLC 1HCZA 3LGJA 4HTHA 1Q86C 3HOZB 4OO1I 2HHHQ 5EAYA 4YHHL 2WKDA 4CJ2C 4C3IG 1E1TA 3IKJA 4C56C 4HR7B 4DR2L 2P5ZX 1J5EL 4LJZC 1BNZA 1LTLA 2QKIC 1BCPD 2F3IA 2Z6KC 3PGZA 3RZOH 3VR3A 1VQHA 3SR1A 1BQQT 1J8IA 4KD3A 4DR3L 1AEXA 5D3IB 2F0MA 1Q90A 2LMCB 1JORA 1NMGA 1AE2A 3GTLH 1YVCA 3ND8A 2R7ZH 5C0XI 1F77A 2E2HH 1BKBA 1SN8A 5M5YH 4JI0L 2JA9A 4P71A 4DV6Q 4KKTA 3QO2A 3WDNA 4EX5A 1B8AA 5C44B 2CCZA 2AUKA 2N78A 4DV1Q 5C5LA 2R93H 4FF4A 3T56B 4AH6A 2NN6H 3J80L 5K36G 2Q8IB 5M5WB 3LX0A 5DNFA 4DR5Q 2TSSA 4JYAL 5M3MH 4PZ8A 4EQPA 1RJTA 3K5LA 1JICA 1NCVA 1YHQA 3PO3H 1UE1A 1XMQQ 1TWGB 1HNZL 1FJGQ 3NPPA 2LS01 2NB0A 4S3SA 1Y14B 2JSOA 1PMRA 5T1GA 3P75A 3TP7A 3J7ZC 1KIXA 1Y8NB 1EEFD 5LMUQ 1YNXA 4FXGC 1XMOL 4JI6L 1HNXQ 1N34Q 4V190 5IYDH 3CRKC 3JC66 1LTTD 5C3EG 2WAQG 1GKHA 1K8GA 3M3YH 3SHLA 4X64L 1JOKA 2RA4A 1PH6A 2KECA 2RCFA 3RLNA 4A3CH 4PZ6A 2IW3A 3OHXC 1CKNB 4A3IB 1UWVA 2HIXA 1II3A 1KRTA 1SROA 4DAVA 2JA8H 5DM73 3HOWB 2MHVA 2RDGA 3E0JA 3S1QH 5JJZA 2E2IB 1VMPA 2KQ3A 2A69C 4B3TL 1DYQA 1SE2A 2F0KA 3NWTA 1ASYA 2E5LL 2GVAA 4QCLA 1MJCA 4JC0A 4A93H 5J22A 3HOZH 3HRZC 1TS2A 2XWBB 5CYUA 3ER0A 4JI1Q 4O0AA 2NVQB 1JJGA 3NUCA 4DUZQ 2O5IC 1HR0L 2SNSA 3HP3A 2O4XA 1WD1A 1E1OA 2B2YA 2VL6A 4K8IA 4C3HB 4A3DG 3TRZA 2TMPA 1WOCA 1I3QB 1KNEA 3KLRA 1C8CA 1CHQD 2FFKB 5C4XB 2HHHL 4LUVA 4FXDA 5IWAQ 4R4IA 4BY7B 4H02A 2C35B 4KKUA 2LY7A 2K6AA 2PMZE 2BCOA 3QG1A 3BZKA 3MFGA 3B6YA 1BCPB 3GTQB 1A2TA 5IT9c 3M85A 2EYPA 3K80C 1UEAB 2K5QA 1U4MA 4WJWA 1ET6A 3A55A 3VA5A 2KBNA 5IY0A 3NXWA 3RMHA 2F4VQ 1R4QB 2RKSA 4IJHA 2EYJA 5C44H 3NEMA 2M2LA 2K01A 5FO8B 1BUVT 3VA7A 1HFGA 2ZXOA 1F2ZA 2ID0A 4NP5A 4JPBW 4K2LA 5M5WH 4A3KG 4OWXB 2A1AA 1QILA 3A8KE 5CC4A 4DV6L 1W2BA 5CV9A 3QWNA 5CGKA 4BY1H 4LFBQ 1EY8A 4IUUA 1VQCA 2B2WC 4FF2A 1OO9B 3BVGA 1VQGA 4DV1L 3SXHA 5IGDA 1VS0A 3MHBA 1K83B 1LTGD 1V43A 4IFDJ 2ZJQA 4FVMA 4P73A 4X6AH 1D2BA 1O78A 4DXGA 2C9OA 4DR5L 1LTID 4I7AA 4R4OA 3URYA 5IYBH 1IW7D 1C48A 4EQ5A 4NXMQ 1D6EC 3SK6A 1TIID 1XMQL 5KYIA 2B3GA 5JVH3 1SMYD 2PQEA 2CFMA 1FJGL 1SNCA 4IUVA 1VQ5A 5DEHA 3CC2A 4A3BG 3I7FA 3NK9A 2RHQB 1R9TH 4K6DA 4GOPB 1PH3A 4RG1A 5LMUL 4HIMA 3H0GB 1IYVA 2UU9Q 1YZ6A 1HR0W 5EPLA 1XNQQ 1KDCA 1N34L 3FEWX 5KIXA 3J80E 1HNXL 3HOVG 3NHHA 1JC7A 2I46A 5EKKA 2K32A 2B63B 3NBIA 1NTGA 2AQ1B 2E2IH 4IO9A 3K8AA 1JMCA 2HCIA 2E74C 1HNWQ 2K7VA 2MGSA 1E2VA 5E3FA 3Q6SA 1X9NA 1EY6A 3FPPA 1EQVA 2XNAC 4DF7A 1LTSD 4LF5Q 2NVQH 5ELCA 4IOAA 1JOOA 3D3RA 4C3JB 4A3EB 1LT3D 4NDXA 1VF5C 1TY0A 2KCCA 4IALA 1FD7D 4C3HH 1KLGD 2NVXH 1H9SA 2QF7A 4JK1C 1TS3A 5C4XH 2B2VC 2PQAA 4DK0A 1GOZA 4LAAA 1QNKA 1IBML 4JI1L 1VQMA 1PTOF 4DUZL 3GTQH 3A7AB 3I73A 3G6JB 1ILPA 3MVVA 1QB5D 2WAQB 1FGBD 2L15A 1S3OA 4HCSA 4B3SQ 3QJYA 1HZCA 1Z9FA 2QCPX 3CC4A 4LMQD 4ZKBB 2R7ZG 3K59A 1AZPA 2KHSA 4FNFA 4O42A 1A6XA 2CHBD 3I2ZA 3JAMc 1YNNC 1CI3M 4NKLA 2PPBC 5IYCH 4E6IA 4HEDA 1PFMA 3MTSA 3TBIB 2F4VL 4XT1B 1F2LA 2R93G 1JCKB 2WB1B 2RVLA 3EROA 2A68C 2NN6G 3J81j 4IURA 1K83H 1M90C 1LABA 2VNUD 2FJ2A 2HIVA 3QOLA 2D0PA 3FRPB 3K57A 5M3MG 5DAUA 2Y0SB 3S9WA 1BF4A 3PO3G 4HCEA 3P1HA 4LFBL 1VCIA 5ELEA 5KNDA 1ZXTA 2XVSA 4KKSA 4KI0A 3M4QA 2I0QA 5JAVA 1FGUA 1MGSA 1PFBA 3H0GH 5IYDG 1Y1WB 4UY8C 3NE5B 3E6ZX 1QJOA 3CCUA 3WWVA 3PCOB 1NUCA 4NXML 2B63H 1EZ8A 1ICFB 3HKZE 1I50H 4A3CG 4HSPA 5IODA 1LYLA 4R8NA 5FO7B 3ERQA 1TWHB 5EJWA 2BA0A 2JA8G 3RN5A 1Q3LA 2UU9L 1IL2A 1EZ6A 4OIKA 1XNQL 5C4JH 3A74A 3S17H 1D1IA 3EVQA 2VQEL 1SYGA 3ULPA 4A3EH 4KK7A 3CKIB 2VUMB 1HNWL 3DEPA 4L8JA 5IGFA 2ENBA 3HOZG 2PW5A 4PQXA 5CMDA 2YYZA 5D65A 1X32A 5JJKA 1O7YA 1TWCB 1XX8A 4TQUS 4LFAQ 3SK4A 1CZGA 4LF5L 1DZ1A 1Y8PB 2PO4A 1PFSA 3E9IA 2JN4A 2JA7G 2N49A 1TY2A 3DEOA 4HJ7A 1NJIC 3D4DA 4YWLA 2UXCQ 3KF8B 5I6YA 2AQ3B 3VR6A 2EXZA 1MIUA 2B2UA 2IX0A 3D8GA 4A3BB 4M1UB 2EY6A 2V1CC 4KY5A 1WTXA 4KN4C 5KYLA 2WV6D 5C3WA 3BYYB 3CU7A 4EQOA 4DNRB 1Y1VB 1I4XA 3OPOA 5JVG3 3KF6B 3FPUB 2R7DA 1WTHA 4DR1Q 1CUKA 4GLAC 2BDOA 4B3SL 4DV3Q 4L5TA 4DK6C 5C44G 3GO5A 1CSQA 1EYDA 2KHIA 5DM63 2RHSB 1STHA 3Q23A 2HDMA 2H4OA 1VQFA 2NN6I 1X3FA 4IPGA 4CDCC 1DM0B 2F1MA 3E3XA 4JI2Q 4X65Q 4DPGA 2SEBD 1MI2A 4R4CA 1RDPD 1SNQA 2I5MX 3RUZA 5EGTA 1BCPC 3A7LA 4HIOA 1NNXA 5ISRA 1D8LA 4QMGA 5E7NA 3CCVA 3OWFA 1XPRA 1X65A 1HA5A 1SSOA 1EYGA 4JOIC 3E9HA 3GD7A 3LNNA 2QEJC 1NR2A 4K5WA 3A54A 3EJIA 5IYBG 1Y1WH 1SNDA 2ZM6Q 5ELBA 1A3VA 1OXUA 2K52A 2PI2A 4K5XA 1EFID 1E22A 1EWCA 3D4WA 1HRJA 5FOBB 1B3QA 5GAHC 3IL8A 1DXMA 1EIGA 3K0YA 4QIWE 5IT9L 1RHPA 1KAWA 4JV5Q 4A3IG 1B44D 1OXTA 1TWHH 3K6OA 4BA2I 3TS2A 1K28A 3HOWG 2B2TA 1EQRA 1BBWA 1GUOA 1HQMC 2F0FA 3T51B 3UE1A 2NZ1D 2E2JH 3VYUA 4IUNA 3Q0AA 5K5PA 2EYHA 2A19A 4Q5VA 4H44C 3TN2A 4GKJQ 1TS5A 1PH8A 2F0QA 2UUBQ 3I72A 3W1BA 3J81c 2M9VA 1I94Q 1STYA 1IBLQ 3MEHA 3PSIA 4P74A 3M7NA 4OGQC 2ZJRA 1K0SA 4QJFA 4WJ4A 1WTOA 1GO3E 1ZEQX 4X3TA 4JBKA 1F9RA 1HFNA 1CSPA 3BS1A 1DGSA 1TWFH 4DV4Q 2PNHA 4GOPC 4R8IA 3C46A 4ZLTF 3CCQA 4C3HG 3PO2B 1S72A 1TVXA 1QUQA 5C4XG 1SBBB 1VQLA 1FNUA 2UXDQ 1Q7YC 1F2YA 5FJ8H 4AYBB 2IHFA 4HMJA 4LFAL 4A3BH 4BY7G 2B39A 2QW7A 3UDFA 4UHVA 4DAPA 2E8GA 1I6VC 1TU2B 1UE5A 1SAPA 4IJLA 3F8TA 4LF6L 1Y1VH 2UXCL 4M8AA 1JQYD 4LFCQ 2AUJD 1DD2A 4OEMB 3OW7A 1O7IA 3NWSA 3HEJA 5M9OA 3GV6A 3I70A 4UAIA 4BWGB 1EIFA 4JI4L 2R3ZA 3U4ZA 1PZID 2Q8RE 4A3MB 2F3WA 1B1ZA 1ZYRD 2J4XA 2EYOA 1U5KA 1QVGA 5C4ZA 1ENAA 3S15H 3G71A 1BVSA 1BO0A 2WFWA 5IYCG 1JR0D 3UDXA 4DR1L 5GAEC 4DV3L 5FK9C 4X66L 2BDNA 5M3FB 1VQBA 2BE5D 1EY7A 1H9SB 2DUDA 3MEFA 1B3AA 3ONAB 1SYFA 4X3KA 3DWAA 1Q81C 1JWSD 3W3AA 1UE7A 2PQAB 1IBKQ 4CJ0B 1K3BC 4CKBA 1T5XD 2CH4A 4OIJA 3HGBA 2YTYA 4G7OC 1Q46A 2JA7B 3R2TA 1S5DD 1NY4A 3KK7A 1A8VA 2XTIA 3W2DA 3D6CA 1ONLA 2ZT9C 3DXJC 3LWUA 2K04A 4DUYQ 3FDTA 4UPAA 5IGGA 3H0GG 1PTOD 3J7AV 1L0WA 5I2YA 2ZM6L 4KHZA 3MAQA 2B63G 1C4QA 1S5ED 1B50A 2L12A 3OIQA 1VQJA 1TR5A 3H15A 4YCWA 2G5DA 1WTRA 4MTKA 2KCNA 1PH4A 3H91A 3JAML 1X3GA 4JV5L 4HIDA 3HS0C 1ZKOA 1QVFA 1I4QA 2RCNA 2R6GA 5FLXL 1OTCA 5EBCA 1VQIA 1Z47A 2JEAI 1F9QA 4ZKCB 4C3JG 2KENA 4A3EG 1VMCA 1LTRD 4GKJL 5ELOA 2UUBL 3OMCA 3K7UC 3SK5A 1I94L 3DMUA 1IBLL 1VQAA 1Q82C 3KJOA 1ASZA 2ZTDA 2I5HA 1SMYC 3AQQA 3PF4A 2IX3A 5IT9E 4IFDG 2A6EC 5IIFA 4GZYC 4IOCA 3IFDA 4ZCKA 3STBD 4WFN3 4DV4L 1Q1EA 4RH6A 2CW0C 3KOJA 3KF8A 3ULJA 1B70B 2F0TA 4DV7Q 3PUZA 1BR9A 2JP1A 5J3BA 4HAEA 1WJJA 2UXDL 4ME5A 3CRLC 4XXEA 2O5JC 3QIAA 3F2CA 2B8GA 5EKLA 4KY6A 2F3VA 1TT2A 4JBWA 3T13A 4EVOA 4A3MH 4IUPA 2J0TD 1EY5A 1KHIA 4HJAA 3PUVA 3KF6A 3HG9A 3TEHB 4LFCL 5IGBA 1SDFA 2WB1G 4B08A 1PRTB 4JBMA 3CF5A 3PF5A 4DGZA 4CHTB 1XWEA 1K8MA 4DA2A 1HA6A 2I07B 4GLVB 5GROA 2Y0SG 1EQQA 1A15A 4C2MB 2XRQD 2JA7H 1G2SA 1EYCA 4XQJA 3QR8A 4ALPA 4JI3Q 3MXUA 3L3OC 1QWYA 2R61A 1YIJA 1DJRD 2D9UA 4JBJA 4DFAA 3G48A 2J7ZA 3U50C 1N9WA 4ABNA 2Q2UA 1GUGA 1KABA 4BS9A 3KLWA 4DN4M 1Y1WG 3MXNA 5GQOA 3KLSX 5D14A 1QNUA 1X6OA 3BDCA 4LWCA 3J81i 1LT5D 1GUSA 4LF4Q 3GTGB 1AZQA 4BA1I 4HJ5A 3ZYYX 2K05A 3HOUG 3AEVA 4DV2Q 3EA6A 1IL8A 2WAQE 3CXCA 2B2YC 3AB9A 4DK1A 1MKHA 1ILQA 3GTPB 4DUYL 2E76C 1H95A 3FVQA 4A3FB 4POGA 1PTOB 2F0SA 1PVOA 1TKWB 3MWYW 3CHBD 4KJOA 5GAGC 1PHJA 2F0IA 1D1KA 1XPOA 5D3DA 4PZ7A 1O7ZA 2YTXA 4MTNA 2VUMG 2HQLA 5BN3A 1LT4D 1IYUA 4GNXB 1PZKD 5HURA 1TWGH 2AWOA 5I2XA 4ODGA 2D2CC 1Y69U 3I4LA 4JI5Q 3UI2A 1O80A 4GLXA 4IFDI 1RCVD 3MFYA 4RWSC 3C1EA 3VR4A 4B3RQ 3TMEA 2O2LD 2VQFQ 1TS4A 5FLMG 5IP7G 1LTAD 3BVZA 1SYDA 2BOSA 1SYEA 4PMCA 4BXXG 3MXGA 1CTMA 2D62A 2QEXA 4Y52H 1PH2A 5FJ8G 2HUGA 3Q22A 1PH9A 1HPCA 3U4VA 1LUZA 4YWKA 1PDQA 3JAME 2K5HA 2PW7A 3FMCA 3I4NB 2JJQA 4A3IH 2NBFA 1HQRD 1I4GA 3X3NA 1TWAB 3BYTB 1MSGA 5FLXE 1Y1VG 3OW2A 5A35A 3PUYA 3HOWH 4HJ9A 2L55A 1OXVA 4DK3C 1WI5A 4DV7L 2OCEA 3CAMA 1WD0A 1QE6A 3E5SA 3CCEA 3RLFA 3GP7A 3MC0B 3CCJA 2WINB 2EXDA 5L37A 3NBHB 2K5NA 4JI7Q 2VB3X 2CKZB 4YCUA 2B8FA 4K6LA 3GQBA 4G7ZC 2EYMA 4BBSG 3F1ZA 4DR6Q 2HCCA 3MXPA 1X3PA 2M00A 2OXPA 3CQZB 4KY7A 1I3QH 1QUQB 4K0KQ 3VR2A 5IE8A 2FMCA 3SDZA 4BY7H 3BU2A 2A69D 1HXYD 1SLJA 5G3LF 4HN7A 4N9PA 5F2DA 2EDGA 1I5FA 1RD9D 3GTGH 3S16B 1GXDC 4JI3L 4FF3A 2Z4HA 1GUWA 1JB7A 1A2UA 1V1OA 4UP9A 3PV0A 4CKEA 2Z0SA 2F0GA 1VQNA 4X62Q 5IWAL 4HJ8A 3GTPH 1SEBD 1I4HA 3C3LA 3ITPA 2KHJA 1STEA 2CWPA 4MIUA 3HOXB 2AQ2B 4LF4L 3NTHA 3T1YQ 1JE5A 1N33Q 4YCVA 1EY0A 1M4VA 2IY5B 3A56A 4RKBA 3F2UA 4A75A 2KOLA 4OONA 4DV2L 2VXWA 4KJNA 4OELB 1YHBA 3J7AF 1M8AA 4DU9A 2X6LA 1SE8A 4L5RC 4J8QA 3L7ZC 1EU4A 5ELFA 3E0EA 2EYLA 1YJ9A 3HKSA 5BN5A 1KRSA 3PO2G 2HDLA 4ZUIA 3I91A 3J80c 1H9JA 3O13A 2YU9B 4K2KA 4PV1C 1SE4A 4AYBG 4F88A 4NMZA 4X3UA 2C5CA 2L5TA 4OL7A 1B53A 3VR5A 3I4NH 4A76A 4FP5D 4B3RL 1A3TA 1X3QA 1VQPA 4KN7C 2VQFL 1TWAH 4I65A 3G4SA 2MQHA 4ZK9B 1ICWA 4KD4A 2ZTCA 2IWHA 1STAA 3BG3A 4LF8Q 1F9SA 3HOUB 3CCRA 5I6WA 4QUFA 1KD1C 1S4ZA 2VS1A 4KV6A 2F0VA 4TVAB 5HGTA 2ASBA 4A3MG 2DJGC 5ELDA 2OTJA 1Q8KA 4FO2A 3R93A 4A3GB 2F0HA 5KNBA 3GTMB 4ILWA 5A2QL 4IUTA 3T4AC 3M4OB 3PMFA 5E4XA 4C3JH 5KGUA 2JQOA 2UXBQ 5M3FG 3TDQA 1AFPA 3BDLA 3CQZH 4QB4A 4L5QA 2N55A 3UDGA 1X3EA 2LXKA 3M7GA 4JI7L 3RZDB 2L9HA 4TRDA 1HJPA 2FMMA 5H1SE 1HUNA 4C1NK 2CVRA 1V1QA 4IFDH 2QDLA 1ENFA 4DR6L 2IX1A 2EYFA 2E75C 3S16H 2EQSA 1GVPA 1S5FD 4MZ9A 4IPHA 4DV0Q 3OWEB 1G6ZA 4J15A 2L11A 4K0KL 3SGIA 2FHTA 3U9SA 3NTIA 1AH9A 1SR3A 1PRTC 2OTLA 3HZXA 4RGMA 1GJXA 1ZYRC 3FKIB 1O7LA 1FYCA 1K8OA 4CBVA 4QL5A 3R3OA 1VQDA 3N52A 4X62L 4FYDA 1EOTA 2D5DA 3TS0A 1WCMG 2BE5C 2B2UC 2JA6B 2ICIA 5HGQA 4NXNQ 5CORA 4B3MQ 1PZJD 2KCTA 3SE0A 3T1YL 4P75A 3H94A 1N33L 2NVTB 1VQKA 2JA5B 4ZQ3A 1L1OA 3Q24A 1E7ZA 2EE1A 4BBSB 2EZVA 3RD4A 1U0LA 2ICEC 2JK8A 1K73C 2ALYB 4GNXA 1WVLA 5JJLA 4PG3A 4Q0FA 4A3LH 2YU9H 3C2PA 1EFWA 1GUTA 4PMWA 5FO9B 5CV5A 4DAMA 3I8ZA 4QUCA 3OSOA 1NE3A 3T53B 1G2TA 3MXNB 4CDFC 4FXKC 1Y8OB 3GTKB 1PTOC 3SVMA 5C3XA 3KBXA 1MBYA 3CCSA 1N8RC 2LFNA 4GN3B 1RKNA 3S2DB 1K3RA 2VY3A 1BOSA 3HOUH 3SK8A 4TSSA 3X3MA 1A63A 1GM5A 3QOJA 2R92B 4A3GH 4LUOA 3RZOB 3GTMH 1U4PA 4ULLA 3M4OH 2F0NA 3W1GA 3CCMA 1IYJB 5C5MA 3MZ5A 2KJXA 2VUMH 2Z1CA 3C1FA 3G7LA 1CT1D 1ML0D 3I3CA 3NBHA 1TWCH 2EY5A 1T9HA 4L63B 3TSSA 4DAYA 2SOBA 3F2DA 1HZ9A 2Z9HA 2CQAA 4H0LC 3CD6A 4ME3A 2MP1A 3STBC 2IPKD 5FLMH 2UXBL 5IP7H 4A3JB 2IJ0A 2B2TC 4BBRG 4R1JA 5AJ3Q 1MJEA
chains in the Genus database with same CATH topology
4RKLA 2QDBA 2XIWA 1KNAA 2BA1A 4J6HA 1G91A 3AMUA 2RBMA 3PUXA 4B9XA 4U68A 5A2QE 3K5MA 1G8ZD 3V2TA 3KBGA 2FINB 3BZDB 1KTKA 1E0BA 2PNRC 5CV4A 2K1BA 2MPMA 3V96A 2L1BA 3S1NB 2PZWA 4RGOS 1CFMA 2Z4IA 1B2TA 1D5ZC 3H09A 1HTLD 4G4KA 1STBA 2MJ8A 4IN3A 1V8QA 4RAUC 2Q8TA 1SE3A 3S1QB 2K03A 5CV6A 2F0EA 4Z9CB 2XSCA 2N88A 4A93B 3T16A 2KEDA 4J1MA 4MN3A 1KDAA 3LWEA 3I4MB 3KLSA 4IUQA 5G3LD 3L9AX 2PCFB 1FR3A 1EWHA 1KLUD 1CZWA 2ZXRA 2RDHA 5LL6S 1CM9A 4QIWB 4RHRA 5C4HA 4K14A 3D6WA 4RCNA 4ZYSA 1D5XC 5NUCA 1BXTA 3HOYB 3S14B 1WCMB 5C0XJ 5LL6X 5T1IA 3V05A 4XIGS 5CV7A 3KUPA 5EBDA 1IW7C 1FNWA 3PIP3 1XYIA 1CK1A 1G291 4PNYA 1SNOA 4UDUC 3H6MA 2JEBI 2DNCA 1RTOA 2LKVA 1U4LA 1YNJD 2WP8J 3QB3A 4BY1B 1H9KA 2IT1A 2DY7A 2A6HD 5EPJA 1Z6HA 2RSNA 1EQTA 5JEAJ 2X6GA 2IL8A 2SNMA 4XYOA 3BVMA 3DHQA 4K8JA 1SNPA 3NTKA 1R9TB 3IFTA 5IGEA 4IQZA 1DONA 2NYZD 1F9PA 4R9WA 2NUCA 2PZTA 1CA5A 5IOCA 3IAYA 1B9MA 3K58A 1XTCD 1AW7A 1HUMA 4BBRB 4RA8A 1XXGA 3PIO3 1EY9A 1W6KA 1ESFA 1F2MA 1PFNA 5FKAC 2DN8A 1GUNA 2GA4B 1DOKA 1STGA 4H13C 2EOTA 4CKCA 2NVXB 1FNVA 1EY4A 2K33A 4NW2A 2A74C 2PZUA 2G9HD 2B2WA 1LO5D 3S1RB 2F0DA 2PYKA 2SDFA 4X3SA 1NSNS 4DXFA 1AN8A 5E1FA 4F8MA 3S2HB 5CBEE 1CQFA 4XYQA 2WIIB 2ZXPA 5JOBA 3TP5A 1J9OA 2OT2A 3R8BA 3A8IE 4OO1H 4C3IB 5IGCA 4G7HC 1JWUD 1UNSA 3P7JA 3K7AB 1V1PA 1W6JA 1WTVA 2NTSA 4P2CB 1U4RA 4Y7NB 1RODA 1EYAA 1H9RA 2X69A 2A6ED 5E4WC 1PRTF 2CW0D 3J81L 5C0XH 1T5EA 3NP8A 4C1NI 3D31A 4CJ1B 2JYOA 1I50B 2RQXA 2B2VA 1AP0A 3U9OA 3D4RA 1GHJA 3N6RA 2EJGC 3S1MB 1L0YB 3TZUA 5C4JB 1PYWD 4HMIA 1JWMD 1SJED 2KA7A 3S17B 4ID6A 2RSOA 3GTJB 3ND9A 1BCPF 4RFBA 5COYA 5M5XB 4I7ZC 3AU7A 4XQQA 4ZAIA 1U9RA 2PMZB 3WOEA 1I6HB 2A5HA 4KHVA 5I4DA 1PTOH 2Z8LA 5JEAH 5KRUA 1ENCA 1A3UA 5C3EB 4IZ8A 1DOMA 1S5BD 2EY1A 1LACA 1SJHD 5BN4A 1DCZA 3NSWA 1LLRD 4OHJA 3EFXD 2HQEA 3OOCA 5I9PA 3M4YA 1CA6A 4N9TA 1E2ZA 1PXUA 2DY8A 2K28A 5CV8A 2NTTA 5EKIA 3MA2B 3NQIA 2JE6I 2NWGA 4WRDA 4V0BA 5KEEA 1CQVA 5JPNC 1TQOA 1UUPA 4K5VA 1SXTA 4A3DB 3GTOB 2KEEA 3DM1A 2VB2X 2H1EA 3VYRA 1EIHA 4WORA 5I9OA 1IKMA 3K5NA 3VYTA 1SFOB 4B9WA 4XT3B 4FF1A 1IHZA 4RCOA 4RGTA 4PMBA 5CR3A 1WTQA 3A8JE 4CGYB 4LK1C 3DWPA 3H3VC 4KTAA 5J39A 1BDOA 4KMUC 1B9NA 1QG7A 2E2JB 2KVMA 5K36H 2XWJB 1DOLA 2L0CA 3PUWA 4YIJA 4A3KB 1NAPA 1PLFA 5C6AA 4EGVA 1B4OA 2DNEA 2NVYB 3DWQA 3TP8A 1TWFB 3R2IA 4O1NA 3J81E 1RTNA 1MSHA 1WTPA 2F03A 2JXMB 1S5CD 1UAPA 4ZUJA 1GHKA 1QCBD 2XRSD 1KAAA 3BDOA 3HOVB 1HHVA 1ET9A 5LHY1 2XN9C 1NR4A 1CHPD 3DUZA 5AFWA 3K5OA 5J1ZA 5TSSA 2EY2A 1LTBD 1YNND 3S15B 2OEOA 2K5WA 4G57A 1STNA 1H9MA 2A73B 3VYSA 4U673 2F0PA 1E2WA 2RDFA 4MHEA 2A68D 4OO1G 3NQTA 3P20A 1L0XB 2F0UA 1Q1BA 5EPKA 1JOQA 1KDBA 4H7BA 1I4PA 1VF7A 3HKZB 1WTWA 4F7XA 1I4RA 3SEBA 1Z7TA 4L6TB 1BBXC 3GTLB 1ESRA 2R7ZB 2WACA 4XDXA 1SYBA 5C0XG 4DNTB 1SNMA 2EPBA 2E2HB 2QILA 5KNCA 5M5YB 4XTCS 4XQNA 3TP6A 1HTPA 3J7YW 1LV9A 1YNJC 1Q8IA 3GV3A 1Q12A 2R93B 2A6HC 1EL0A 1OXSC 5CBAE 5M3MB 1V1PB 1MD2D 1SYCA 2OF1A 2EJFC 3PO3B 1LT6D 2KUMA 2E2DC 4RGNA 2G9DA 4RHSA 4TKOB 5JEAG 3OIPA 4HSVA 2V4DA 2EVBA 1D5MC 2F0WA 2EJMA 1JE4A 1RF2D 1VDZA 3M3YB 1EEID 4QF4A 2K5DA 2F0LA 2WKCA 3I90A 4EQNA 2F0OA 2AWNA 3WOFA 1PRTD 3TZDA 5EQ0A 1EU3A 1R4PB 2JA8B 1OXXK 2L4NA 4F87A 1IKLA 2F4IA 5JPMC 1JB3A 2F0JA 4ZRZA 3OMGA 1QOHA 2MUYA 3EQLC 1HCZA 3HOZB 4HTHA 4OO1I 2WKDA 4CJ2C 4C3IG 3IKJA 4C56C 4HR7B 4LJZC 1BNZA 2QKIC 1BCPD 3VR3A 3SR1A 1BQQT 1J8IA 4KD3A 1AEXA 5D3IB 2F0MA 1Q90A 2LMCB 1JORA 3ND8A 5C0XI 1F77A 4KKTA 3QO2A 3WDNA 5C44B 2AUKA 5C5LA 4FF4A 3T56B 2NN6H 3J80L 5K36G 2Q8IB 5M5WB 3LX0A 5DNFA 2TSSA 4EQPA 1RJTA 3K5LA 1JICA 1NCVA 1TWGB 3NPPA 2LS01 2NB0A 4S3SA 2JSOA 1PMRA 5T1GA 3P75A 3TP7A 1Y8NB 1EEFD 4FXGC 4V190 3CRKC 1LTTD 3SHLA 1JOKA 2RA4A 2KECA 2IW3A 3OHXC 4A3IB 1II3A 4DAVA 5DM73 3HOWB 2MHVA 2RDGA 3E0JA 5JJZA 2E2IB 1VMPA 2KQ3A 2A69C 1DYQA 1SE2A 2F0KA 3NWTA 4QCLA 5J22A 3HRZC 1TS2A 2XWBB 5CYUA 2NVQB 3NUCA 2O5IC 2SNSA 3HP3A 2O4XA 1WD1A 2B2YA 4K8IA 4C3HB 2TMPA 1I3QB 1KNEA 3KLRA 1C8CA 1CHQD 2FFKB 5C4XB 4FXDA 4BY7B 4KKUA 2LY7A 2K6AA 2BCOA 3QG1A 3MFGA 3GTQB 1BCPB 1A2TA 3M85A 2EYPA 1UEAB 2K5QA 1U4MA 4WJWA 1ET6A 3A55A 3VA5A 3NXWA 3RMHA 1R4QB 2RKSA 2EYJA 2M2LA 2K01A 5FO8B 1BUVT 3VA7A 1HFGA 2ZXOA 1F2ZA 2ID0A 4NP5A 4K2LA 3A8KE 1QILA 5CC4A 5CV9A 3QWNA 5CGKA 1EY8A 4IUUA 2B2WC 4FF2A 1OO9B 3BVGA 3SXHA 5IGDA 3MHBA 1K83B 1LTGD 1V43A 4IFDJ 4FVMA 1D2BA 1O78A 4DXGA 2C9OA 1LTID 3URYA 1IW7D 1C48A 1D6EC 3SK6A 1TIID 5KYIA 5JVH3 1SMYD 2PQEA 1SNCA 4IUVA 5DEHA 3NK9A 4K6DA 3H0GB 1IYVA 5EPLA 1KDCA 3FEWX 5KIXA 3J80E 3NHHA 1JC7A 2I46A 5EKKA 2K32A 2B63B 3NBIA 2AQ1B 2HCIA 2E74C 2K7VA 2MGSA 1E2VA 5E3FA 3Q6SA 1EY6A 3FPPA 1EQVA 2XNAC 4DF7A 1LTSD 5ELCA 1JOOA 3D3RA 4C3JB 4A3EB 1LT3D 4NDXA 1VF5C 1TY0A 2KCCA 4IALA 1FD7D 1KLGD 1H9SA 2QF7A 4JK1C 1TS3A 2B2VC 4DK0A 1GOZA 4LAAA 1QNKA 1PTOF 3A7AB 3I73A 3G6JB 1ILPA 3MVVA 1QB5D 2WAQB 1FGBD 4HCSA 3QJYA 2QCPX 4LMQD 4ZKBB 3K59A 1AZPA 2KHSA 4FNFA 4O42A 1A6XA 2CHBD 1YNNC 1CI3M 4NKLA 2PPBC 4E6IA 4HEDA 1PFMA 3MTSA 3TBIB 4XT1B 1F2LA 1JCKB 2WB1B 2RVLA 3EROA 2A68C 2NN6G 4IURA 1LABA 2VNUD 2FJ2A 3QOLA 3FRPB 3K57A 5DAUA 2Y0SB 3S9WA 1BF4A 4HCEA 3P1HA 1VCIA 5ELEA 5KNDA 1ZXTA 2XVSA 4KKSA 4KI0A 5JAVA 1MGSA 1PFBA 1Y1WB 3NE5B 3E6ZX 1QJOA 1NUCA 1EZ8A 4HSPA 5IODA 4R8NA 5FO7B 3ERQA 1TWHB 5EJWA 2BA0A 1Q3LA 1EZ6A 4OIKA 1D1IA 3EVQA 1SYGA 4KK7A 3CKIB 2VUMB 3DEPA 4L8JA 5IGFA 2ENBA 2PW5A 4PQXA 5CMDA 2YYZA 5D65A 1X32A 1O7YA 1TWCB 1XX8A 4TQUS 3SK4A 1CZGA 1DZ1A 1Y8PB 2PO4A 1TY2A 3DEOA 3D4DA 5I6YA 2AQ3B 3VR6A 2EXZA 2B2UA 2IX0A 3D8GA 4A3BB 4M1UB 2EY6A 4KY5A 1WTXA 4KN4C 5KYLA 2WV6D 5C3WA 3BYYB 3CU7A 4EQOA 4DNRB 1Y1VB 1I4XA 3OPOA 5JVG3 3FPUB 2BDOA 3GO5A 1EYDA 5DM63 1STHA 3Q23A 2HDMA 2H4OA 2NN6I 1DM0B 2F1MA 2SEBD 1MI2A 1RDPD 1SNQA 3RUZA 5EGTA 1BCPC 3A7LA 5ISRA 4QMGA 3OWFA 1HA5A 1SSOA 3GD7A 3LNNA 2QEJC 1NR2A 4K5WA 3A54A 3EJIA 1SNDA 5ELBA 1A3VA 1OXUA 4K5XA 1EFID 3D4WA 1EWCA 1HRJA 5FOBB 3IL8A 1DXMA 1EIGA 3K0YA 5IT9L 1RHPA 1B44D 1OXTA 3K6OA 4BA2I 2B2TA 2F0FA 1GUOA 1HQMC 3T51B 2NZ1D 3VYUA 4IUNA 3Q0AA 5K5PA 2EYHA 4Q5VA 4H44C 3TN2A 1TS5A 2F0QA 3I72A 2M9VA 1STYA 3MEHA 3M7NA 4OGQC 1WTOA 1ZEQX 4X3TA 1F9RA 1HFNA 3BS1A 4R8IA 3C46A 4ZLTF 4C3HG 3PO2B 1TVXA 1SBBB 1FNUA 1F2YA 4AYBB 4HMJA 2B39A 4DAPA 1I6VC 1TU2B 1SAPA 4M8AA 1JQYD 2AUJD 1DD2A 3OW7A 3NWSA 3HEJA 5M9OA 3GV6A 3I70A 4UAIA 4BWGB 2R3ZA 1PZID 2Q8RE 4A3MB 2F3WA 1B1ZA 1ZYRD 2J4XA 2EYOA 5C4ZA 1ENAA 1BO0A 1JR0D 5FK9C 2BDNA 5M3FB 2BE5D 1EY7A 1H9SB 1B3AA 3ONAB 1SYFA 4X3KA 3DWAA 1JWSD 3W3AA 4CJ0B 4CKBA 1T5XD 4OIJA 3HGBA 4G7OC 2JA7B 3R2TA 1S5DD 3KK7A 3W2DA 3D6CA 1ONLA 2ZT9C 3DXJC 3LWUA 2K04A 3FDTA 5IGGA 1PTOD 3J7AV 5I2YA 4KHZA 3MAQA 1C4QA 1S5ED 1B50A 2L12A 3OIQA 1TR5A 1WTRA 2KCNA 3H91A 3JAML 3HS0C 1ZKOA 1I4QA 2R6GA 5FLXL 5EBCA 1Z47A 2JEAI 1F9QA 4ZKCB 4C3JG 1VMCA 1LTRD 3OMCA 3SK5A 3DMUA 1SMYC 2IX3A 5IT9E 4IFDG 2A6EC 5IIFA 4GZYC 3IFDA 4WFN3 1Q1EA 4RH6A 2CW0C 3KF8A 2F0TA 3PUZA 1BR9A 2JP1A 4HAEA 4ME5A 3CRLC 4XXEA 2O5JC 3QIAA 2B8GA 5EKLA 4KY6A 2F3VA 1TT2A 4JBWA 3T13A 4EVOA 4IUPA 2J0TD 1EY5A 3PUVA 3HG9A 5IGBA 1SDFA 4B08A 1PRTB 4DGZA 4CHTB 1XWEA 1K8MA 4DA2A 1HA6A 2I07B 1A15A 4C2MB 2XRQD 1G2SA 1EYCA 4XQJA 3MXUA 3L3OC 1QWYA 2R61A 1DJRD 2D9UA 4DFAA 2J7ZA 4ABNA 1GUGA 1KABA 4BS9A 4DN4M 3MXNA 3KLSX 5D14A 1QNUA 3BDCA 1LT5D 1GUSA 3GTGB 1AZQA 4BA1I 3ZYYX 2K05A 3EA6A 1IL8A 2B2YC 4DK1A 3AB9A 1ILQA 3GTPB 2E76C 3FVQA 4A3FB 1PTOB 2F0SA 1TKWB 3MWYW 3CHBD 4KJOA 2F0IA 1D1KA 5D3DA 1O7ZA 5BN3A 1LT4D 1IYUA 1PZKD 5HURA 2AWOA 5I2XA 4ODGA 2D2CC 1Y69U 3I4LA 3UI2A 1O80A 4IFDI 1RCVD 3MFYA 4RWSC 3C1EA 3VR4A 3TMEA 2O2LD 1TS4A 1LTAD 3BVZA 1SYDA 2BOSA 1SYEA 4PMCA 3MXGA 1CTMA 2D62A 2HUGA 3Q22A 1HPCA 1PDQA 3JAME 3FMCA 2PW7A 3I4NB 2NBFA 1HQRD 1I4GA 3X3NA 1TWAB 3BYTB 1MSGA 5FLXE 5A35A 3PUYA 2L55A 1OXVA 1WD0A 1QE6A 3E5SA 3RLFA 3GP7A 3MC0B 2WINB 2VB3X 2B8FA 4K6LA 3GQBA 4G7ZC 2EYMA 2HCCA 3MXPA 1X3PA 2M00A 2OXPA 3CQZB 4KY7A 3VR2A 2FMCA 3SDZA 2A69D 1HXYD 5G3LF 4HN7A 4N9PA 5F2DA 2EDGA 1RD9D 3S16B 1GXDC 4FF3A 2Z4HA 1GUWA 1A2UA 1V1OA 3PV0A 4CKEA 2F0GA 1SEBD 1I4HA 3C3LA 3ITPA 4MIUA 1STEA 3HOXB 2AQ2B 3NTHA 1EY0A 1M4VA 3A56A 4RKBA 3F2UA 2KOLA 2VXWA 4KJNA 3J7AF 1M8AA 4DU9A 2X6LA 4J8QA 3L7ZC 1EU4A 5ELFA 2EYLA 5BN5A 2HDLA 4ZUIA 3I91A 1H9JA 3O13A 2YU9B 4K2KA 4PV1C 1SE4A 4F88A 4NMZA 4X3UA 2C5CA 2L5TA 4OL7A 1B53A 3VR5A 4FP5D 1A3TA 1X3QA 4KN7C 4I65A 4ZK9B 1ICWA 4KD4A 2IWHA 1STAA 3BG3A 1F9SA 3HOUB 5I6WA 4QUFA 1S4ZA 4KV6A 2F0VA 5HGTA 5ELDA 4FO2A 3R93A 4A3GB 2F0HA 5KNBA 3GTMB 4ILWA 5A2QL 4IUTA 3T4AC 3M4OB 3PMFA 5E4XA 5KGUA 3TDQA 1AFPA 3BDLA 4QB4A 2N55A 3M7GA 3RZDB 2L9HA 4TRDA 2FMMA 1HUNA 4C1NK 2CVRA 4IFDH 1ENFA 2IX1A 2EYFA 2E75C 1S5FD 3OWEB 1G6ZA 2L11A 2FHTA 3U9SA 3NTIA 1PRTC 3HZXA 4RGMA 1GJXA 1ZYRC 3FKIB 1O7LA 1FYCA 1K8OA 4CBVA 3R3OA 3N52A 4FYDA 1EOTA 2D5DA 2BE5C 2B2UC 2JA6B 2ICIA 5CORA 1PZJD 3SE0A 3H94A 2NVTB 2JA5B 4ZQ3A 3Q24A 2EE1A 4BBSB 2EZVA 3RD4A 2ICEC 1WVLA 4Q0FA 3C2PA 1GUTA 4PMWA 5FO9B 5CV5A 3I8ZA 4QUCA 3OSOA 3T53B 1G2TA 4FXKC 1Y8OB 3GTKB 1PTOC 3SVMA 5C3XA 3KBXA 1MBYA 2LFNA 1RKNA 3S2DB 1BOSA 3SK8A 4TSSA 3X3MA 3QOJA 2R92B 3RZOB 1U4PA 4ULLA 2F0NA 5C5MA 3MZ5A 2KJXA 2Z1CA 3C1FA 3G7LA 1CT1D 1ML0D 3I3CA 3NBHA 2EY5A 4L63B 3TSSA 4DAYA 2SOBA 2CQAA 4H0LC 2MP1A 2IPKD 4A3JB 2IJ0A 2B2TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKL A;  4ID6 A;  2QDB A;  1EY4 A;  1SNQ A;  1KDC A;  4KTA A;  3HZX A;  5KIX A;  2F0T A;  2F3W A;  3NHH A;  3C1E A;  4KJN A;  5EKK A;  3RUZ A;  5CV7 A;  5J39 A;  5EGT A;  4F7X A;  5J22 A;  2EYO A;  3TME A;  4J6H A;  5C4Z A;  1ENA A;  4ME5 A;  5ISR A;  5JAV A;  4QMG A;  2PZU A;  4DU9 A;  4YIJ A;  1SYD A;  2WAC A;  3SR1 A;  1SYE A;  3NUC A;  3OWF A;  4KY6 A;  2F3V A;  1TT2 A;  1U9R A;  4KD3 A;  1SYB A;  4PMC A;  5EKL A;  3R3O A;  1AEX A;  1SNM A;  4PNY A;  2F0D A;  5E3F A;  3T13 A;  1NUC A;  1SNO A;  4KHV A;  2RBM A;  4EVO A;  5C6A A;  2F0M A;  2SNS A;  1EY5 A;  1EZ8 A;  2EYL A;  2O4X A;  2PYK A;  1EY6 A;  3H6M A;  3TP6 A;  1EQV A;  4B9X A;  1JOR A;  4K8I A;  1EY7 A;  4K5W A;  3EJI A;  4DF7 A;  1SND A;  1SYF A;  2LKV A;  2PW7 A;  4ZUI A;  5IOD A;  1A3V A;  1JOO A;  1NSN S;  3V2T A;  5KRU A;  1ENC A;  1A3U A;  3ERQ A;  4R8N A;  5E1F A;  4K2K A;  4IZ8 A;  5IGB A;  3QB3 A;  4F8M A;  2EY1 A;  4NDX A;  4ZQ3 A;  4K5X A;  3D4W A;  3TP8 A;  4NMZ A;  4IAL A;  5CV4 A;  1EZ6 A;  4OL7 A;  4DGZ A;  3E5S A;  1A3T A;  3EVQ A;  1A2T A;  2EYP A;  2PZW A;  4I65 A;  1SYG A;  5CV5 A;  2HQE A;  4KD4 A;  4LAA A;  5C5L A;  1SYC A;  2OF1 A;  3D6C A;  4ZUJ A;  2F0F A;  3VA5 A;  3OSO A;  5IGF A;  2ENB A;  3NXW A;  2SNM A;  2PW5 A;  1STB A;  1STA A;  5JOB A;  3TP5 A;  5I9P A;  4IUN A;  1EYC A;  5K5P A;  4N9T A;  2EYH A;  2RKS A;  3LX0 A;  5I6W A;  5IGG A;  5IGC A;  2EYJ A;  1KAA A;  3SK4 A;  5CV8 A;  5C3X A;  4KV6 A;  2F0Q A;  2F0V A;  4DFA A;  4EQP A;  5HGT A;  3DHQ A;  3MVV A;  2EYM A;  1F2Z A;  1RKN A;  4K8J A;  4NP5 A;  1STY A;  1SNP A;  3MXP A;  1KAB A;  2M00 A;  2OXP A;  3MEH A;  4K2L A;  4WRD A;  3D4D A;  2F0H A;  4KY7 A;  1TR5 A;  5I6Y A;  4S3S A;  5IGE A;  2KHS A;  3BDC A;  3SK8 A;  5CC4 A;  5KEE A;  5CV6 A;  5J1Z A;  3PMF A;  2F0W A;  2F0E A;  5CV9 A;  2EXZ A;  3P75 A;  5KGU A;  1EYA A;  5CGK A;  3TP7 A;  1EY8 A;  2EY2 A;  1TQO A;  2NUC A;  4QF4 A;  4K5V A;  3D8G A;  3T16 A;  2F0L A;  2EY6 A;  2PZT A;  3QOJ A;  4J1M A;  3BDL A;  4KY5 A;  5IOC A;  4EQN A;  1KDA A;  2F0O A;  2OEO A;  4NKL A;  4QB4 A;  3SXH A;  4G57 A;  5IGD A;  5KYL A;  4N9P A;  5F2D A;  5C3W A;  3MHB A;  4E6I A;  1STN A;  2F0N A;  4WOR A;  4EQO A;  3NP8 A;  5C5M A;  5I9O A;  1EY9 A;  3MZ5 A;  1F2Y A;  3SHL A;  4TRD A;  1A2U A;  1JOK A;  4HMJ A;  2F0P A;  2RDF A;  3OMC A;  3C1F A;  1F2M A;  2F0S A;  3ERO A;  4B9W A;  2F0G A;  3SK5 A;  4KJO A;  3U9O A;  2EYF A;  3DMU A;  2F0I A;  3SK6 A;  2EY5 A;  3NQT A;  3QOL A;  1IHZ A;  5KYI A;  2F0J A;  1II3 A;  2SOB A;  2PQE A;  1EYD A;  2F0U A;  1SNC A;  3OMG A;  4PMB A;  5DAU A;  3ITP A;  4K14 A;  4MIU A;  5DEH A;  5C4H A;  3NK9 A;  1STH A;  5IIF A;  1STG A;  5CR3 A;  3S9W A;  5HUR A;  5NUC A;  4HTH A;  1JOQ A;  1KDB A;  3P1H A;  4HMI A;  2KQ3 A;  4H7B A;  3HEJ A;  4K6D A;  4ODG A;  2F0K A;  5M9O A;  1EY0 A;  4RKB A; 
#chains in the Genus database with same CATH topology
 4RKL A;  2GN5 A;  2QDB A;  2XIW A;  4HIK A;  4BXX H;  1KNA A;  4P72 A;  1IZ6 A;  2A8V A;  2B29 A;  2BA1 A;  4J6H A;  1G91 A;  3AMU A;  3A5Z B;  3U58 A;  1UEB A;  2RBM A;  3PUX A;  4B9X A;  3FKI H;  4U68 A;  5A2Q E;  3K5M A;  5BR8 Q;  1G8Z D;  3IRB A;  3V2T A;  3KBG A;  2FIN B;  4A3F G;  3BZD B;  2MNA A;  1KTK A;  4DR4 Q;  1E0B A;  2PNR C;  5CV4 A;  2K1B A;  3J80 i;  2MPM A;  3V96 A;  4LF9 Q;  2L1B A;  1VQ4 A;  3S1N B;  3KDF A;  5JJI A;  2PZW A;  2NVT H;  2JA5 H;  1HZA A;  4RGO S;  4B3T Q;  1CFM A;  4BBS H;  2Z4I A;  1B2T A;  1D5Z C;  3H09 A;  1HTL D;  4G4K A;  4GN4 B;  1STB A;  2MJ8 A;  4IN3 A;  1E3P A;  1L2F A;  1V8Q A;  2Z6K A;  4NXN L;  4RAU C;  3PIO A;  4B3M L;  1J6Q A;  4X65 L;  4JI2 L;  3HFZ B;  2Q8T A;  1SE3 A;  3S1Q B;  1FL0 A;  3GTK H;  2Q2I A;  2K03 A;  5CV6 A;  2F0E A;  4Z9C B;  2XSC A;  2N88 A;  2NZO A;  3S2D H;  4A93 B;  3T16 A;  2KED A;  4J1M A;  4MN3 A;  1KDA A;  3ERS X;  3LWE A;  2MFI A;  3I4N G;  3I4M B;  3KLS A;  2K50 A;  4IUQ A;  5G3L D;  3L9A X;  4JW0 A;  2PCF B;  1FR3 A;  1BBU A;  2R92 H;  1EWH A;  1KLU D;  1CZW A;  2ZXR A;  3RLO A;  2RDH A;  4IPD A;  3AFP A;  5LL6 S;  1CM9 A;  4QIW B;  3ZJY C;  4RHR A;  5C4H A;  4K14 A;  1PA6 A;  3D6W A;  4RCN A;  4QY7 A;  4ZYS A;  1D5X C;  3I55 A;  5NUC A;  1BXT A;  1SRU A;  3HOY B;  3S14 B;  1WCM B;  5C0X J;  5LL6 X;  4R4Q A;  5T1I A;  1IXR A;  5ELN A;  3V05 A;  1D7Q A;  1NBW A;  4XIG S;  5CV7 A;  2GVB A;  3KUP A;  4A3J H;  3PO2 H;  3D0F A;  5EBD A;  1YJN A;  1TXY A;  1IW7 C;  1FNW A;  3PIP 3;  1XYI A;  1CK1 A;  1G29 1;  4LF7 Q;  4PNY A;  1SNO A;  4UDU C;  4OX9 Q;  3H6M A;  2JEB I;  2DNC A;  1RTO A;  3K0X A;  2LKV A;  1U4L A;  1YNJ D;  1VQO A;  5GAD C;  2WP8 J;  4LW1 A;  3QB3 A;  5IP9 H;  4BY1 B;  1A0I A;  1H9K A;  2IT1 A;  4OWW B;  5AJ3 L;  3UDI A;  4DR7 Q;  2DY7 A;  1XJV A;  2A6H D;  2PI2 E;  3RNU A;  5EPJ A;  1Z6H A;  2RSN A;  2KCM A;  1EQT A;  3ULL A;  4JCV E;  5JEA J;  2X6G A;  2IL8 A;  3HOX G;  4DNI A;  1P16 A;  2SNM A;  3S1N H;  1QZG A;  4XYO A;  4GN5 A;  4AIM A;  3BVM A;  1VQ7 A;  3DHQ A;  3I56 A;  4GS3 A;  5BR8 L;  4K8J A;  3OYY A;  5HY6 A;  5M3F H;  1SNP A;  3NTK A;  2Q2T A;  1R9T B;  1PH7 A;  1XPU A;  3IFT A;  5IGE A;  3F2B A;  4IQZ A;  4DR4 L;  1DON A;  2AMC B;  2CH4 W;  4LF9 L;  2D0O A;  2NYZ D;  2AHO B;  1F9P A;  4R9W A;  2NUC A;  2PZT A;  1CA5 A;  5IOC A;  3IAY A;  1B9M A;  3K58 A;  1XTC D;  1AW7 A;  1HUM A;  4A3L G;  4BBR B;  1N36 Q;  4RA8 A;  1XXG A;  4UP7 A;  3PIO 3;  1VQ8 A;  1EY9 A;  1HH2 P;  1W6K A;  4YWM A;  1ESF A;  1F2M A;  1PFN A;  1IBK L;  5FKA C;  2DN8 A;  4JI8 Q;  1GUN A;  1IBM Q;  3I4M H;  2K4K A;  2GA4 B;  1B7Y B;  3T1H Q;  1DOK A;  1G6P A;  3Q8D A;  1STG A;  4H13 C;  3CP0 A;  2EOT A;  4CKC A;  2NVX B;  1FNV A;  3DM3 A;  1C0A A;  1EY4 A;  2K33 A;  1M1K C;  4NW2 A;  3HOY H;  4A4I A;  3S14 H;  1WCM H;  2K75 A;  2UUC Q;  2A74 C;  4A3G G;  2DGY A;  3K81 C;  2PZU A;  4NB3 A;  2G9H D;  2B2W A;  1LO5 D;  2I5L X;  3S1R B;  2F0D A;  1L1O B;  2PYK A;  2CWA A;  1K9M C;  2SDF A;  3L2P A;  3EIV A;  4X3S A;  1NSN S;  4DXF A;  1AN8 A;  5E1F A;  2WB1 E;  4F8M A;  4YY3 Q;  3S2H B;  5CBE E;  1CQF A;  4XYQ A;  2WII B;  2MO1 A;  1YHA A;  4CDD C;  2Y0S E;  2ZXP A;  3BZC A;  3CW2 C;  3H3V H;  4LF7 L;  5JOB A;  3TP5 A;  1J9O A;  2OT2 A;  3R8B A;  3A8I E;  4OX9 L;  4OO1 H;  1SMX A;  3W5O A;  4C3I B;  5IGC A;  4G7H C;  1XTD A;  1JWU D;  1UNS A;  3P7J A;  1PH5 A;  4DV5 Q;  3K7A B;  1V1P A;  2K5V A;  1W6J A;  3FKI G;  3RN2 A;  2RF4 A;  1WTV A;  2NTS A;  4P2C B;  3EBE A;  1U4R A;  4Y7N B;  2Q2H A;  4DR7 L;  4OXP A;  2OWO A;  1ROD A;  1EYA A;  4APV A;  3NEN A;  1H9R A;  2X69 A;  2A6E D;  1EWI A;  1XNR Q;  5E4W C;  2JA6 G;  1PRT F;  2YV5 A;  2CW0 D;  4DAY B;  3KJP A;  3J81 L;  3CMA A;  1W3S A;  5C0X H;  1T5E A;  3NP8 A;  4C1N I;  2JA5 G;  1X56 A;  3D31 A;  4CJ1 B;  2JYO A;  1PYS B;  4IPC A;  4C2M H;  2VQE Q;  4UP8 A;  1CKM A;  1I50 B;  2RQX A;  2OQK A;  2B2V A;  1AP0 A;  3U9O A;  3D4R A;  4BBR H;  1GHJ A;  3N6R A;  2EJG C;  1YI2 A;  1L0Y B;  3S1M B;  3TZU A;  4KHP Q;  4RMF A;  5DLQ E;  5C4J B;  3M4P A;  1PYW D;  4HMI A;  1JT8 A;  1JWM D;  1SJE D;  2KA7 A;  3S17 B;  3L0O A;  4LNQ A;  4ID6 A;  2RSO A;  3GTJ B;  3ND9 A;  1BCP F;  3RR5 A;  4RFB A;  4N8X 1;  5COY A;  1N36 L;  5M5X B;  4I7Z C;  3AU7 A;  4XQQ A;  4ZAI A;  1U9R A;  3J7A 5;  2PMZ B;  3AFQ A;  4JI8 L;  3WOE A;  4A3F H;  1I6H B;  2A5H A;  4KHV A;  5I4D A;  1K8A C;  1PTO H;  3AYH B;  2Z8L A;  5JEA H;  2R92 G;  3UE0 A;  3T1H L;  3A0J A;  3KDF B;  3TRE A;  4O2D A;  1RIP A;  3HKZ G;  5KRU A;  1ENC A;  1A3U A;  3S1R H;  1FVI A;  2BH8 A;  4IZ8 A;  5C3E B;  1DOM A;  3CC7 A;  1S5B D;  2EY1 A;  1LAC A;  2ES2 A;  1SJH D;  5BN4 A;  1DCZ A;  3NSW A;  1YIT A;  2EIF A;  1LLR D;  4OHJ A;  1X55 A;  2K14 A;  1C7Y A;  2QGQ A;  1K0R A;  3KYH C;  2UUC L;  3EFX D;  2HQE A;  2DJF C;  2LXJ A;  2N3S A;  1GD7 A;  1RL2 A;  3FP9 A;  3OOC A;  3S2H H;  1KXL A;  5I9P A;  3M4Y A;  5LMN Q;  4A3J G;  1CA6 A;  1E2Z A;  4N9T A;  3ICE A;  1PXU A;  2DY8 A;  5FLX c;  2K28 A;  5CV8 A;  2NTT A;  5EKI A;  3MA2 B;  1KC8 C;  4WJ3 M;  3NQI A;  2JE6 I;  4JI5 L;  2XGT A;  2BH2 A;  4AQY Q;  2NWG A;  4WRD A;  4YY3 L;  2MO0 A;  4FDB A;  4C3I H;  4V0B A;  5KEE A;  2R7F A;  3K7A H;  1CQV A;  5JPN C;  5IP9 G;  1TQO A;  1UUP A;  4K5V A;  4Y7N H;  1SXT A;  3BJU A;  1NMF A;  4A3D B;  3GTO B;  2KEE A;  3DM1 A;  2Z6B A;  2VB2 X;  2H1E A;  3VYR A;  1EIH A;  4WOR A;  5I9O A;  1IKM A;  1JJ2 A;  3K5N A;  3VYT A;  3CPW A;  1SFO B;  4DV5 L;  4B9W A;  4XT3 B;  4FF1 A;  4JG2 A;  1IHZ A;  4RCO A;  1S40 A;  4RGT A;  4PMB A;  4R4T A;  5CR3 A;  1WTQ A;  3A8J E;  4CGY B;  1XNR L;  1YEZ A;  3S1M H;  1CKN A;  4LK1 C;  3DWP A;  3H3V C;  1VQE A;  4KTA A;  1V9P A;  5J39 A;  1BDO A;  4KMU C;  1B9N A;  3CCL A;  1QG7 A;  2E2J B;  4QQB X;  1KL9 A;  2KVM A;  5K36 H;  2XWJ B;  1DOL A;  2L0C A;  4GKK Q;  3PUW A;  3FHW A;  4YIJ A;  4A3K B;  3GTJ H;  2YTV A;  1NAP A;  1PLF A;  5C6A A;  3TQY A;  4EGV A;  1A62 A;  4A93 G;  5M5X H;  1B4O A;  2DNE A;  4KHP L;  2NVY B;  1VQ6 A;  3I4M G;  4AYB E;  1I6H H;  3DWQ A;  2UUA Q;  3TP8 A;  1TWF B;  3R2I A;  1UE6 A;  4O1N A;  3HOX H;  3J81 E;  1PYB A;  4LF6 Q;  1RTN A;  1MSH A;  1WTP A;  2F03 A;  1N32 Q;  2HT1 A;  2VW9 A;  2IHE A;  5C3E H;  2JXM B;  1WFQ A;  1YJW A;  1S5C D;  1PH1 A;  1UAP A;  3CPF A;  4ZUJ A;  2CQO A;  3OTO Q;  3VDY A;  2VZA A;  3DLL A;  3HOY G;  4JI4 Q;  1GHK A;  1QCB D;  1KQS A;  2XRS D;  1EIY B;  1KAA A;  2F52 A;  3BDO A;  3HOV B;  1HHV A;  1ET9 A;  5LHY 1;  2XN9 C;  1NR4 A;  1YBY A;  1CHP D;  1QVC A;  3DUZ A;  2NZH A;  4JOI A;  5AFW A;  1G51 A;  3K5O A;  4X66 Q;  2AKW B;  1JJC B;  5J1Z A;  5TSS A;  2EY2 A;  4YHH Q;  1WYD A;  2LSS A;  1LTB D;  1YNN D;  3S15 B;  4DR2 Q;  3GDE A;  1EOV A;  2OEO A;  1EUJ A;  2K5W A;  4G57 A;  1J5E Q;  1PV4 A;  1STN A;  1H9M A;  2OQ0 A;  2ZTE A;  2A73 B;  4LUZ A;  3VYS A;  4BY1 G;  5LMN L;  2H5X A;  4U67 3;  2F0P A;  1E2W A;  2RDF A;  4CDE C;  4A3D H;  4MHE A;  3GTO H;  4DR3 Q;  2A68 D;  1QZH A;  1L1O C;  4OO1 G;  3NEL A;  3NQT A;  4AQY L;  3P20 A;  4GNX C;  1L0X B;  2F0U A;  1Q1B A;  1SFO H;  5EPK A;  1JOQ A;  1KDB A;  4H7B A;  4JI0 Q;  3KFU A;  1I4P A;  1VF7 A;  1C9O A;  3HKZ B;  4N8F A;  4LF8 L;  2QA4 A;  1E24 A;  1WTW A;  4F7X A;  1I4R A;  3SEB A;  1Z7T A;  4L6T B;  1BBX C;  3EN2 A;  3GTL B;  1ESR A;  2R7Z B;  4GOP A;  2WAC A;  4NPS A;  4L5S A;  4XDX A;  3PIP A;  1SYB A;  5C0X G;  4DNT B;  1SNM A;  2EPB A;  2E2H B;  3I4O A;  2QIL A;  5KNC A;  3RZD H;  5M5Y B;  4XTC S;  1AE3 A;  4XQN A;  3TP6 A;  3CME A;  1HTP A;  4JYA Q;  1LM0 A;  4A3K H;  3J7Y W;  4POF A;  1LV9 A;  1YNJ C;  2ATW A;  1Q8I A;  3GV3 A;  1HNZ Q;  1Q12 A;  2R93 B;  2NVY H;  2A6H C;  2ZJP A;  1EL0 A;  1OXS C;  5CBA E;  3S24 A;  1XMO Q;  5M3M B;  4JI6 Q;  4GKK L;  1V1P B;  1MD2 D;  1SYC A;  2OF1 A;  2EJF C;  3PO3 B;  1LT6 D;  3M9B A;  2KUM A;  2E2D C;  4X64 Q;  4DV0 L;  4RGN A;  3G6E A;  1HZB A;  3JAM i;  2G9D A;  4RHS A;  4TKO B;  5JEA G;  3A5U A;  2UUA L;  3OIP A;  4HSV A;  2JA6 H;  1VQ9 A;  2V4D A;  2N8N A;  5LMN W;  2EVB A;  4OWT B;  1P8L A;  1D5M C;  3HOV H;  2F0W A;  3PQI A;  2EJM A;  1JE4 A;  1RF2 D;  1VDZ A;  2FXQ A;  3M3Y B;  1EEI D;  1N32 L;  4QF4 A;  2K5D A;  1MHW C;  2F0L A;  2WKC A;  3I90 A;  4EQN A;  2F0O A;  2AWN A;  4MNO A;  3WOF A;  3OTO L;  2E5L Q;  1PRT D;  3TZD A;  5EQ0 A;  4DKA C;  1EU3 A;  4QGU A;  1R4P B;  2JA8 B;  1OXX K;  2L4N A;  1X54 A;  4F87 A;  2HD3 A;  1IKL A;  4JVZ A;  2F4I A;  1HR0 Q;  1CKO A;  5JPM C;  1JB3 A;  2F0J A;  4KLK A;  4ZRZ A;  3OMG A;  1QOH A;  3H3V I;  2MUY A;  3EQL C;  1HCZ A;  3LGJ A;  4HTH A;  1Q86 C;  3HOZ B;  4OO1 I;  2HHH Q;  5EAY A;  4YHH L;  2WKD A;  4CJ2 C;  4C3I G;  1E1T A;  3IKJ A;  4C56 C;  4HR7 B;  4DR2 L;  2P5Z X;  1J5E L;  4LJZ C;  1BNZ A;  1LTL A;  2QKI C;  1BCP D;  2F3I A;  2Z6K C;  3PGZ A;  3RZO H;  3VR3 A;  1VQH A;  3SR1 A;  1BQQ T;  1J8I A;  4KD3 A;  4DR3 L;  1AEX A;  5D3I B;  2F0M A;  1Q90 A;  2LMC B;  1JOR A;  1NMG A;  1AE2 A;  3GTL H;  1YVC A;  3ND8 A;  2R7Z H;  5C0X I;  1F77 A;  2E2H H;  1BKB A;  1SN8 A;  5M5Y H;  4JI0 L;  2JA9 A;  4P71 A;  4DV6 Q;  4KKT A;  3QO2 A;  3WDN A;  4EX5 A;  1B8A A;  5C44 B;  2CCZ A;  2AUK A;  2N78 A;  4DV1 Q;  5C5L A;  2R93 H;  4FF4 A;  3T56 B;  4AH6 A;  2NN6 H;  3J80 L;  5K36 G;  2Q8I B;  5M5W B;  3LX0 A;  5DNF A;  4DR5 Q;  2TSS A;  4JYA L;  5M3M H;  4PZ8 A;  4EQP A;  1RJT A;  3K5L A;  1JIC A;  1NCV A;  1YHQ A;  3PO3 H;  1UE1 A;  1XMQ Q;  1TWG B;  1HNZ L;  1FJG Q;  3NPP A;  2LS0 1;  2NB0 A;  4S3S A;  1Y14 B;  2JSO A;  1PMR A;  5T1G A;  3P75 A;  3TP7 A;  3J7Z C;  1KIX A;  1Y8N B;  1EEF D;  5LMU Q;  1YNX A;  4FXG C;  1XMO L;  4JI6 L;  1HNX Q;  1N34 Q;  4V19 0;  5IYD H;  3CRK C;  3JC6 6;  1LTT D;  5C3E G;  2WAQ G;  1GKH A;  1K8G A;  3M3Y H;  3SHL A;  4X64 L;  1JOK A;  2RA4 A;  1PH6 A;  2KEC A;  2RCF A;  3RLN A;  4A3C H;  4PZ6 A;  2IW3 A;  3OHX C;  1CKN B;  4A3I B;  1UWV A;  2HIX A;  1II3 A;  1KRT A;  1SRO A;  4DAV A;  2JA8 H;  5DM7 3;  3HOW B;  2MHV A;  2RDG A;  3E0J A;  3S1Q H;  5JJZ A;  2E2I B;  1VMP A;  2KQ3 A;  2A69 C;  4B3T L;  1DYQ A;  1SE2 A;  2F0K A;  3NWT A;  1ASY A;  2E5L L;  2GVA A;  4QCL A;  1MJC A;  4JC0 A;  4A93 H;  5J22 A;  3HOZ H;  3HRZ C;  1TS2 A;  2XWB B;  5CYU A;  3ER0 A;  4JI1 Q;  4O0A A;  2NVQ B;  1JJG A;  3NUC A;  4DUZ Q;  2O5I C;  1HR0 L;  2SNS A;  3HP3 A;  2O4X A;  1WD1 A;  1E1O A;  2B2Y A;  2VL6 A;  4K8I A;  4C3H B;  4A3D G;  3TRZ A;  2TMP A;  1WOC A;  1I3Q B;  1KNE A;  3KLR A;  1C8C A;  1CHQ D;  2FFK B;  5C4X B;  2HHH L;  4LUV A;  4FXD A;  5IWA Q;  4R4I A;  4BY7 B;  4H02 A;  2C35 B;  4KKU A;  2LY7 A;  2K6A A;  2PMZ E;  2BCO A;  3QG1 A;  3BZK A;  3MFG A;  3B6Y A;  1BCP B;  3GTQ B;  1A2T A;  5IT9 c;  3M85 A;  2EYP A;  3K80 C;  1UEA B;  2K5Q A;  1U4M A;  4WJW A;  1ET6 A;  3A55 A;  3VA5 A;  2KBN A;  5IY0 A;  3NXW A;  3RMH A;  2F4V Q;  1R4Q B;  2RKS A;  4IJH A;  2EYJ A;  5C44 H;  3NEM A;  2M2L A;  2K01 A;  5FO8 B;  1BUV T;  3VA7 A;  1HFG A;  2ZXO A;  1F2Z A;  2ID0 A;  4NP5 A;  4JPB W;  4K2L A;  5M5W H;  4A3K G;  4OWX B;  2A1A A;  1QIL A;  3A8K E;  5CC4 A;  4DV6 L;  1W2B A;  5CV9 A;  3QWN A;  5CGK A;  4BY1 H;  4LFB Q;  1EY8 A;  4IUU A;  1VQC A;  2B2W C;  4FF2 A;  1OO9 B;  3BVG A;  1VQG A;  4DV1 L;  3SXH A;  5IGD A;  1VS0 A;  3MHB A;  1K83 B;  1LTG D;  1V43 A;  4IFD J;  2ZJQ A;  4FVM A;  4P73 A;  4X6A H;  1D2B A;  1O78 A;  4DXG A;  2C9O A;  4DR5 L;  1LTI D;  4I7A A;  4R4O A;  3URY A;  5IYB H;  1IW7 D;  1C48 A;  4EQ5 A;  4NXM Q;  1D6E C;  3SK6 A;  1TII D;  1XMQ L;  5KYI A;  2B3G A;  5JVH 3;  1SMY D;  2PQE A;  2CFM A;  1FJG L;  1SNC A;  4IUV A;  1VQ5 A;  5DEH A;  3CC2 A;  4A3B G;  3I7F A;  3NK9 A;  2RHQ B;  1R9T H;  4K6D A;  4GOP B;  1PH3 A;  4RG1 A;  5LMU L;  4HIM A;  3H0G B;  1IYV A;  2UU9 Q;  1YZ6 A;  1HR0 W;  5EPL A;  1XNQ Q;  1KDC A;  1N34 L;  3FEW X;  5KIX A;  3J80 E;  1HNX L;  3HOV G;  3NHH A;  1JC7 A;  2I46 A;  5EKK A;  2K32 A;  2B63 B;  3NBI A;  1NTG A;  2AQ1 B;  2E2I H;  4IO9 A;  3K8A A;  1JMC A;  2HCI A;  2E74 C;  1HNW Q;  2K7V A;  2MGS A;  1E2V A;  5E3F A;  3Q6S A;  1X9N A;  1EY6 A;  3FPP A;  1EQV A;  2XNA C;  4DF7 A;  1LTS D;  4LF5 Q;  2NVQ H;  5ELC A;  4IOA A;  1JOO A;  3D3R A;  4C3J B;  4A3E B;  1LT3 D;  4NDX A;  1VF5 C;  1TY0 A;  2KCC A;  4IAL A;  1FD7 D;  4C3H H;  1KLG D;  2NVX H;  1H9S A;  2QF7 A;  4JK1 C;  1TS3 A;  5C4X H;  2B2V C;  2PQA A;  4DK0 A;  1GOZ A;  4LAA A;  1QNK A;  1IBM L;  4JI1 L;  1VQM A;  1PTO F;  4DUZ L;  3GTQ H;  3A7A B;  3I73 A;  3G6J B;  1ILP A;  3MVV A;  1QB5 D;  2WAQ B;  1FGB D;  2L15 A;  1S3O A;  4HCS A;  4B3S Q;  3QJY A;  1HZC A;  1Z9F A;  2QCP X;  3CC4 A;  4LMQ D;  4ZKB B;  2R7Z G;  3K59 A;  1AZP A;  2KHS A;  4FNF A;  4O42 A;  1A6X A;  2CHB D;  3I2Z A;  3JAM c;  1YNN C;  1CI3 M;  4NKL A;  2PPB C;  5IYC H;  4E6I A;  4HED A;  1PFM A;  3MTS A;  3TBI B;  2F4V L;  4XT1 B;  1F2L A;  2R93 G;  1JCK B;  2WB1 B;  2RVL A;  3ERO A;  2A68 C;  2NN6 G;  3J81 j;  4IUR A;  1K83 H;  1M90 C;  1LAB A;  2VNU D;  2FJ2 A;  2HIV A;  3QOL A;  2D0P A;  3FRP B;  3K57 A;  5M3M G;  5DAU A;  2Y0S B;  3S9W A;  1BF4 A;  3PO3 G;  4HCE A;  3P1H A;  4LFB L;  1VCI A;  5ELE A;  5KND A;  1ZXT A;  2XVS A;  4KKS A;  4KI0 A;  3M4Q A;  2I0Q A;  5JAV A;  1FGU A;  1MGS A;  1PFB A;  3H0G H;  5IYD G;  1Y1W B;  4UY8 C;  3NE5 B;  3E6Z X;  1QJO A;  3CCU A;  3WWV A;  3PCO B;  1NUC A;  4NXM L;  2B63 H;  1EZ8 A;  1ICF B;  3HKZ E;  1I50 H;  4A3C G;  4HSP A;  5IOD A;  1LYL A;  4R8N A;  5FO7 B;  3ERQ A;  1TWH B;  5EJW A;  2BA0 A;  2JA8 G;  3RN5 A;  1Q3L A;  2UU9 L;  1IL2 A;  1EZ6 A;  4OIK A;  1XNQ L;  5C4J H;  3A74 A;  3S17 H;  1D1I A;  3EVQ A;  2VQE L;  1SYG A;  3ULP A;  4A3E H;  4KK7 A;  3CKI B;  2VUM B;  1HNW L;  3DEP A;  4L8J A;  5IGF A;  2ENB A;  3HOZ G;  2PW5 A;  4PQX A;  5CMD A;  2YYZ A;  5D65 A;  1X32 A;  5JJK A;  1O7Y A;  1TWC B;  1XX8 A;  4TQU S;  4LFA Q;  3SK4 A;  1CZG A;  4LF5 L;  1DZ1 A;  1Y8P B;  2PO4 A;  1PFS A;  3E9I A;  2JN4 A;  2JA7 G;  2N49 A;  1TY2 A;  3DEO A;  4HJ7 A;  1NJI C;  3D4D A;  4YWL A;  2UXC Q;  3KF8 B;  5I6Y A;  2AQ3 B;  3VR6 A;  2EXZ A;  1MIU A;  2B2U A;  2IX0 A;  3D8G A;  4A3B B;  4M1U B;  2EY6 A;  2V1C C;  4KY5 A;  1WTX A;  4KN4 C;  5KYL A;  2WV6 D;  5C3W A;  3BYY B;  3CU7 A;  4EQO A;  4DNR B;  1Y1V B;  1I4X A;  3OPO A;  5JVG 3;  3KF6 B;  3FPU B;  2R7D A;  1WTH A;  4DR1 Q;  1CUK A;  4GLA C;  2BDO A;  4B3S L;  4DV3 Q;  4L5T A;  4DK6 C;  5C44 G;  3GO5 A;  1CSQ A;  1EYD A;  2KHI A;  5DM6 3;  2RHS B;  1STH A;  3Q23 A;  2HDM A;  2H4O A;  1VQF A;  2NN6 I;  1X3F A;  4IPG A;  4CDC C;  1DM0 B;  2F1M A;  3E3X A;  4JI2 Q;  4X65 Q;  4DPG A;  2SEB D;  1MI2 A;  4R4C A;  1RDP D;  1SNQ A;  2I5M X;  3RUZ A;  5EGT A;  1BCP C;  3A7L A;  4HIO A;  1NNX A;  5ISR A;  1D8L A;  4QMG A;  5E7N A;  3CCV A;  3OWF A;  1XPR A;  1X65 A;  1HA5 A;  1SSO A;  1EYG A;  4JOI C;  3E9H A;  3GD7 A;  3LNN A;  2QEJ C;  1NR2 A;  4K5W A;  3A54 A;  3EJI A;  5IYB G;  1Y1W H;  1SND A;  2ZM6 Q;  5ELB A;  1A3V A;  1OXU A;  2K52 A;  2PI2 A;  4K5X A;  1EFI D;  1E22 A;  1EWC A;  3D4W A;  1HRJ A;  5FOB B;  1B3Q A;  5GAH C;  3IL8 A;  1DXM A;  1EIG A;  3K0Y A;  4QIW E;  5IT9 L;  1RHP A;  1KAW A;  4JV5 Q;  4A3I G;  1B44 D;  1OXT A;  1TWH H;  3K6O A;  4BA2 I;  3TS2 A;  1K28 A;  3HOW G;  2B2T A;  1EQR A;  1BBW A;  1GUO A;  1HQM C;  2F0F A;  3T51 B;  3UE1 A;  2NZ1 D;  2E2J H;  3VYU A;  4IUN A;  3Q0A A;  5K5P A;  2EYH A;  2A19 A;  4Q5V A;  4H44 C;  3TN2 A;  4GKJ Q;  1TS5 A;  1PH8 A;  2F0Q A;  2UUB Q;  3I72 A;  3W1B A;  3J81 c;  2M9V A;  1I94 Q;  1STY A;  1IBL Q;  3MEH A;  3PSI A;  4P74 A;  3M7N A;  4OGQ C;  2ZJR A;  1K0S A;  4QJF A;  4WJ4 A;  1WTO A;  1GO3 E;  1ZEQ X;  4X3T A;  4JBK A;  1F9R A;  1HFN A;  1CSP A;  3BS1 A;  1DGS A;  1TWF H;  4DV4 Q;  2PNH A;  4GOP C;  4R8I A;  3C46 A;  4ZLT F;  3CCQ A;  4C3H G;  3PO2 B;  1S72 A;  1TVX A;  1QUQ A;  5C4X G;  1SBB B;  1VQL A;  1FNU A;  2UXD Q;  1Q7Y C;  1F2Y A;  5FJ8 H;  4AYB B;  2IHF A;  4HMJ A;  4LFA L;  4A3B H;  4BY7 G;  2B39 A;  2QW7 A;  3UDF A;  4UHV A;  4DAP A;  2E8G A;  1I6V C;  1TU2 B;  1UE5 A;  1SAP A;  4IJL A;  3F8T A;  4LF6 L;  1Y1V H;  2UXC L;  4M8A A;  1JQY D;  4LFC Q;  2AUJ D;  1DD2 A;  4OEM B;  3OW7 A;  1O7I A;  3NWS A;  3HEJ A;  5M9O A;  3GV6 A;  3I70 A;  4UAI A;  4BWG B;  1EIF A;  4JI4 L;  2R3Z A;  3U4Z A;  1PZI D;  2Q8R E;  4A3M B;  2F3W A;  1B1Z A;  1ZYR D;  2J4X A;  2EYO A;  1U5K A;  1QVG A;  5C4Z A;  1ENA A;  3S15 H;  3G71 A;  1BVS A;  1BO0 A;  2WFW A;  5IYC G;  1JR0 D;  3UDX A;  4DR1 L;  5GAE C;  4DV3 L;  5FK9 C;  4X66 L;  2BDN A;  5M3F B;  1VQB A;  2BE5 D;  1EY7 A;  1H9S B;  2DUD A;  3MEF A;  1B3A A;  3ONA B;  1SYF A;  4X3K A;  3DWA A;  1Q81 C;  1JWS D;  3W3A A;  1UE7 A;  2PQA B;  1IBK Q;  4CJ0 B;  1K3B C;  4CKB A;  1T5X D;  2CH4 A;  4OIJ A;  3HGB A;  2YTY A;  4G7O C;  1Q46 A;  2JA7 B;  3R2T A;  1S5D D;  1NY4 A;  3KK7 A;  1A8V A;  2XTI A;  3W2D A;  3D6C A;  1ONL A;  2ZT9 C;  3DXJ C;  3LWU A;  2K04 A;  4DUY Q;  3FDT A;  4UPA A;  5IGG A;  3H0G G;  1PTO D;  3J7A V;  1L0W A;  5I2Y A;  2ZM6 L;  4KHZ A;  3MAQ A;  2B63 G;  1C4Q A;  1S5E D;  1B50 A;  2L12 A;  3OIQ A;  1VQJ A;  1TR5 A;  3H15 A;  4YCW A;  2G5D A;  1WTR A;  4MTK A;  2KCN A;  1PH4 A;  3H91 A;  3JAM L;  1X3G A;  4JV5 L;  4HID A;  3HS0 C;  1ZKO A;  1QVF A;  1I4Q A;  2RCN A;  2R6G A;  5FLX L;  1OTC A;  5EBC A;  1VQI A;  1Z47 A;  2JEA I;  1F9Q A;  4ZKC B;  4C3J G;  2KEN A;  4A3E G;  1VMC A;  1LTR D;  4GKJ L;  5ELO A;  2UUB L;  3OMC A;  3K7U C;  3SK5 A;  1I94 L;  3DMU A;  1IBL L;  1VQA A;  1Q82 C;  3KJO A;  1ASZ A;  2ZTD A;  2I5H A;  1SMY C;  3AQQ A;  3PF4 A;  2IX3 A;  5IT9 E;  4IFD G;  2A6E C;  5IIF A;  4GZY C;  4IOC A;  3IFD A;  4ZCK A;  3STB D;  4WFN 3;  4DV4 L;  1Q1E A;  4RH6 A;  2CW0 C;  3KOJ A;  3KF8 A;  3ULJ A;  1B70 B;  2F0T A;  4DV7 Q;  3PUZ A;  1BR9 A;  2JP1 A;  5J3B A;  4HAE A;  1WJJ A;  2UXD L;  4ME5 A;  3CRL C;  4XXE A;  2O5J C;  3QIA A;  3F2C A;  2B8G A;  5EKL A;  4KY6 A;  2F3V A;  1TT2 A;  4JBW A;  3T13 A;  4EVO A;  4A3M H;  4IUP A;  2J0T D;  1EY5 A;  1KHI A;  4HJA A;  3PUV A;  3KF6 A;  3HG9 A;  3TEH B;  4LFC L;  5IGB A;  1SDF A;  2WB1 G;  4B08 A;  1PRT B;  4JBM A;  3CF5 A;  3PF5 A;  4DGZ A;  4CHT B;  1XWE A;  1K8M A;  4DA2 A;  1HA6 A;  2I07 B;  4GLV B;  5GRO A;  2Y0S G;  1EQQ A;  1A15 A;  4C2M B;  2XRQ D;  2JA7 H;  1G2S A;  1EYC A;  4XQJ A;  3QR8 A;  4ALP A;  4JI3 Q;  3MXU A;  3L3O C;  1QWY A;  2R61 A;  1YIJ A;  1DJR D;  2D9U A;  4JBJ A;  4DFA A;  3G48 A;  2J7Z A;  3U50 C;  1N9W A;  4ABN A;  2Q2U A;  1GUG A;  1KAB A;  4BS9 A;  3KLW A;  4DN4 M;  1Y1W G;  3MXN A;  5GQO A;  3KLS X;  5D14 A;  1QNU A;  1X6O A;  3BDC A;  4LWC A;  3J81 i;  1LT5 D;  1GUS A;  4LF4 Q;  3GTG B;  1AZQ A;  4BA1 I;  4HJ5 A;  3ZYY X;  2K05 A;  3HOU G;  3AEV A;  4DV2 Q;  3EA6 A;  1IL8 A;  2WAQ E;  3CXC A;  2B2Y C;  3AB9 A;  4DK1 A;  1MKH A;  1ILQ A;  3GTP B;  4DUY L;  2E76 C;  1H95 A;  3FVQ A;  4A3F B;  4POG A;  1PTO B;  2F0S A;  1PVO A;  1TKW B;  3MWY W;  3CHB D;  4KJO A;  5GAG C;  1PHJ A;  2F0I A;  1D1K A;  1XPO A;  5D3D A;  4PZ7 A;  1O7Z A;  2YTX A;  4MTN A;  2VUM G;  2HQL A;  5BN3 A;  1LT4 D;  1IYU A;  4GNX B;  1PZK D;  5HUR A;  1TWG H;  2AWO A;  5I2X A;  4ODG A;  2D2C C;  1Y69 U;  3I4L A;  4JI5 Q;  3UI2 A;  1O80 A;  4GLX A;  4IFD I;  1RCV D;  3MFY A;  4RWS C;  3C1E A;  3VR4 A;  4B3R Q;  3TME A;  2O2L D;  2VQF Q;  1TS4 A;  5FLM G;  5IP7 G;  1LTA D;  3BVZ A;  1SYD A;  2BOS A;  1SYE A;  4PMC A;  4BXX G;  3MXG A;  1CTM A;  2D62 A;  2QEX A;  4Y52 H;  1PH2 A;  5FJ8 G;  2HUG A;  3Q22 A;  1PH9 A;  1HPC A;  3U4V A;  1LUZ A;  4YWK A;  1PDQ A;  3JAM E;  2K5H A;  2PW7 A;  3FMC A;  3I4N B;  2JJQ A;  4A3I H;  2NBF A;  1HQR D;  1I4G A;  3X3N A;  1TWA B;  3BYT B;  1MSG A;  5FLX E;  1Y1V G;  3OW2 A;  5A35 A;  3PUY A;  3HOW H;  4HJ9 A;  2L55 A;  1OXV A;  4DK3 C;  1WI5 A;  4DV7 L;  2OCE A;  3CAM A;  1WD0 A;  1QE6 A;  3E5S A;  3CCE A;  3RLF A;  3GP7 A;  3MC0 B;  3CCJ A;  2WIN B;  2EXD A;  5L37 A;  3NBH B;  2K5N A;  4JI7 Q;  2VB3 X;  2CKZ B;  4YCU A;  2B8F A;  4K6L A;  3GQB A;  4G7Z C;  2EYM A;  4BBS G;  3F1Z A;  4DR6 Q;  2HCC A;  3MXP A;  1X3P A;  2M00 A;  2OXP A;  3CQZ B;  4KY7 A;  1I3Q H;  1QUQ B;  4K0K Q;  3VR2 A;  5IE8 A;  2FMC A;  3SDZ A;  4BY7 H;  3BU2 A;  2A69 D;  1HXY D;  1SLJ A;  5G3L F;  4HN7 A;  4N9P A;  5F2D A;  2EDG A;  1I5F A;  1RD9 D;  3GTG H;  3S16 B;  1GXD C;  4JI3 L;  4FF3 A;  2Z4H A;  1GUW A;  1JB7 A;  1A2U A;  1V1O A;  4UP9 A;  3PV0 A;  4CKE A;  2Z0S A;  2F0G A;  1VQN A;  4X62 Q;  5IWA L;  4HJ8 A;  3GTP H;  1SEB D;  1I4H A;  3C3L A;  3ITP A;  2KHJ A;  1STE A;  2CWP A;  4MIU A;  3HOX B;  2AQ2 B;  4LF4 L;  3NTH A;  3T1Y Q;  1JE5 A;  1N33 Q;  4YCV A;  1EY0 A;  1M4V A;  2IY5 B;  3A56 A;  4RKB A;  3F2U A;  4A75 A;  2KOL A;  4OON A;  4DV2 L;  2VXW A;  4KJN A;  4OEL B;  1YHB A;  3J7A F;  1M8A A;  4DU9 A;  2X6L A;  1SE8 A;  4L5R C;  4J8Q A;  3L7Z C;  1EU4 A;  5ELF A;  3E0E A;  2EYL A;  1YJ9 A;  3HKS A;  5BN5 A;  1KRS A;  3PO2 G;  2HDL A;  4ZUI A;  3I91 A;  3J80 c;  1H9J A;  3O13 A;  2YU9 B;  4K2K A;  4PV1 C;  1SE4 A;  4AYB G;  4F88 A;  4NMZ A;  4X3U A;  2C5C A;  2L5T A;  4OL7 A;  1B53 A;  3VR5 A;  3I4N H;  4A76 A;  4FP5 D;  4B3R L;  1A3T A;  1X3Q A;  1VQP A;  4KN7 C;  2VQF L;  1TWA H;  4I65 A;  3G4S A;  2MQH A;  4ZK9 B;  1ICW A;  4KD4 A;  2ZTC A;  2IWH A;  1STA A;  3BG3 A;  4LF8 Q;  1F9S A;  3HOU B;  3CCR A;  5I6W A;  4QUF A;  1KD1 C;  1S4Z A;  2VS1 A;  4KV6 A;  2F0V A;  4TVA B;  5HGT A;  2ASB A;  4A3M G;  2DJG C;  5ELD A;  2OTJ A;  1Q8K A;  4FO2 A;  3R93 A;  4A3G B;  2F0H A;  5KNB A;  3GTM B;  4ILW A;  5A2Q L;  4IUT A;  3T4A C;  3M4O B;  3PMF A;  5E4X A;  4C3J H;  5KGU A;  2JQO A;  2UXB Q;  5M3F G;  3TDQ A;  1AFP A;  3BDL A;  3CQZ H;  4QB4 A;  4L5Q A;  2N55 A;  3UDG A;  1X3E A;  2LXK A;  3M7G A;  4JI7 L;  3RZD B;  2L9H A;  4TRD A;  1HJP A;  2FMM A;  5H1S E;  1HUN A;  4C1N K;  2CVR A;  1V1Q A;  4IFD H;  2QDL A;  1ENF A;  4DR6 L;  2IX1 A;  2EYF A;  2E75 C;  3S16 H;  2EQS A;  1GVP A;  1S5F D;  4MZ9 A;  4IPH A;  4DV0 Q;  3OWE B;  1G6Z A;  4J15 A;  2L11 A;  4K0K L;  3SGI A;  2FHT A;  3U9S A;  3NTI A;  1AH9 A;  1SR3 A;  1PRT C;  2OTL A;  3HZX A;  4RGM A;  1GJX A;  1ZYR C;  3FKI B;  1O7L A;  1FYC A;  1K8O A;  4CBV A;  4QL5 A;  3R3O A;  1VQD A;  3N52 A;  4X62 L;  4FYD A;  1EOT A;  2D5D A;  3TS0 A;  1WCM G;  2BE5 C;  2B2U C;  2JA6 B;  2ICI A;  5HGQ A;  4NXN Q;  5COR A;  4B3M Q;  1PZJ D;  2KCT A;  3SE0 A;  3T1Y L;  4P75 A;  3H94 A;  1N33 L;  2NVT B;  1VQK A;  2JA5 B;  4ZQ3 A;  1L1O A;  3Q24 A;  1E7Z A;  2EE1 A;  4BBS B;  2EZV A;  3RD4 A;  1U0L A;  2ICE C;  2JK8 A;  1K73 C;  2ALY B;  4GNX A;  1WVL A;  5JJL A;  4PG3 A;  4Q0F A;  4A3L H;  2YU9 H;  3C2P A;  1EFW A;  1GUT A;  4PMW A;  5FO9 B;  5CV5 A;  4DAM A;  3I8Z A;  4QUC A;  3OSO A;  1NE3 A;  3T53 B;  1G2T A;  3MXN B;  4CDF C;  4FXK C;  1Y8O B;  3GTK B;  1PTO C;  3SVM A;  5C3X A;  3KBX A;  1MBY A;  3CCS A;  1N8R C;  2LFN A;  4GN3 B;  1RKN A;  3S2D B;  1K3R A;  2VY3 A;  1BOS A;  3HOU H;  3SK8 A;  4TSS A;  3X3M A;  1A63 A;  1GM5 A;  3QOJ A;  2R92 B;  4A3G H;  4LUO A;  3RZO B;  3GTM H;  1U4P A;  4ULL A;  3M4O H;  2F0N A;  3W1G A;  3CCM A;  1IYJ B;  5C5M A;  3MZ5 A;  2KJX A;  2VUM H;  2Z1C A;  3C1F A;  3G7L A;  1CT1 D;  1ML0 D;  3I3C A;  3NBH A;  1TWC H;  2EY5 A;  1T9H A;  4L63 B;  3TSS A;  4DAY A;  2SOB A;  3F2D A;  1HZ9 A;  2Z9H A;  2CQA A;  4H0L C;  3CD6 A;  4ME3 A;  2MP1 A;  3STB C;  2IPK D;  5FLM H;  2UXB L;  5IP7 H;  4A3J B;  2IJ0 A;  2B2T C;  4BBR G;  4R1J A;  5AJ3 Q;  1MJE A; 
#chains in the Genus database with same CATH homology
 4RKL A;  2QDB A;  2XIW A;  1KNA A;  2BA1 A;  4J6H A;  1G91 A;  3AMU A;  2RBM A;  3PUX A;  4B9X A;  4U68 A;  5A2Q E;  3K5M A;  1G8Z D;  3V2T A;  3KBG A;  2FIN B;  3BZD B;  1KTK A;  1E0B A;  2PNR C;  5CV4 A;  2K1B A;  2MPM A;  3V96 A;  2L1B A;  3S1N B;  2PZW A;  4RGO S;  1CFM A;  2Z4I A;  1B2T A;  1D5Z C;  3H09 A;  1HTL D;  4G4K A;  1STB A;  2MJ8 A;  4IN3 A;  1V8Q A;  4RAU C;  2Q8T A;  1SE3 A;  3S1Q B;  2K03 A;  5CV6 A;  2F0E A;  4Z9C B;  2XSC A;  2N88 A;  4A93 B;  3T16 A;  2KED A;  4J1M A;  4MN3 A;  1KDA A;  3LWE A;  3I4M B;  3KLS A;  4IUQ A;  5G3L D;  3L9A X;  2PCF B;  1FR3 A;  1EWH A;  1KLU D;  1CZW A;  2ZXR A;  2RDH A;  5LL6 S;  1CM9 A;  4QIW B;  4RHR A;  5C4H A;  4K14 A;  3D6W A;  4RCN A;  4ZYS A;  1D5X C;  5NUC A;  1BXT A;  3HOY B;  3S14 B;  1WCM B;  5C0X J;  5LL6 X;  5T1I A;  3V05 A;  4XIG S;  5CV7 A;  3KUP A;  5EBD A;  1IW7 C;  1FNW A;  3PIP 3;  1XYI A;  1CK1 A;  1G29 1;  4PNY A;  1SNO A;  4UDU C;  3H6M A;  2JEB I;  2DNC A;  1RTO A;  2LKV A;  1U4L A;  1YNJ D;  2WP8 J;  3QB3 A;  4BY1 B;  1H9K A;  2IT1 A;  2DY7 A;  2A6H D;  5EPJ A;  1Z6H A;  2RSN A;  1EQT A;  5JEA J;  2X6G A;  2IL8 A;  2SNM A;  4XYO A;  3BVM A;  3DHQ A;  4K8J A;  1SNP A;  3NTK A;  1R9T B;  3IFT A;  5IGE A;  4IQZ A;  1DON A;  2NYZ D;  1F9P A;  4R9W A;  2NUC A;  2PZT A;  1CA5 A;  5IOC A;  3IAY A;  1B9M A;  3K58 A;  1XTC D;  1AW7 A;  1HUM A;  4BBR B;  4RA8 A;  1XXG A;  3PIO 3;  1EY9 A;  1W6K A;  1ESF A;  1F2M A;  1PFN A;  5FKA C;  2DN8 A;  1GUN A;  2GA4 B;  1DOK A;  1STG A;  4H13 C;  2EOT A;  4CKC A;  2NVX B;  1FNV A;  1EY4 A;  2K33 A;  4NW2 A;  2A74 C;  2PZU A;  2G9H D;  2B2W A;  1LO5 D;  3S1R B;  2F0D A;  2PYK A;  2SDF A;  4X3S A;  1NSN S;  4DXF A;  1AN8 A;  5E1F A;  4F8M A;  3S2H B;  5CBE E;  1CQF A;  4XYQ A;  2WII B;  2ZXP A;  5JOB A;  3TP5 A;  1J9O A;  2OT2 A;  3R8B A;  3A8I E;  4OO1 H;  4C3I B;  5IGC A;  4G7H C;  1JWU D;  1UNS A;  3P7J A;  3K7A B;  1V1P A;  1W6J A;  1WTV A;  2NTS A;  4P2C B;  1U4R A;  4Y7N B;  1ROD A;  1EYA A;  1H9R A;  2X69 A;  2A6E D;  5E4W C;  1PRT F;  2CW0 D;  3J81 L;  5C0X H;  1T5E A;  3NP8 A;  4C1N I;  3D31 A;  4CJ1 B;  2JYO A;  1I50 B;  2RQX A;  2B2V A;  1AP0 A;  3U9O A;  3D4R A;  1GHJ A;  3N6R A;  2EJG C;  3S1M B;  1L0Y B;  3TZU A;  5C4J B;  1PYW D;  4HMI A;  1JWM D;  1SJE D;  2KA7 A;  3S17 B;  4ID6 A;  2RSO A;  3GTJ B;  3ND9 A;  1BCP F;  4RFB A;  5COY A;  5M5X B;  4I7Z C;  3AU7 A;  4XQQ A;  4ZAI A;  1U9R A;  2PMZ B;  3WOE A;  1I6H B;  2A5H A;  4KHV A;  5I4D A;  1PTO H;  2Z8L A;  5JEA H;  5KRU A;  1ENC A;  1A3U A;  5C3E B;  4IZ8 A;  1DOM A;  1S5B D;  2EY1 A;  1LAC A;  1SJH D;  5BN4 A;  1DCZ A;  3NSW A;  1LLR D;  4OHJ A;  3EFX D;  2HQE A;  3OOC A;  5I9P A;  3M4Y A;  1CA6 A;  4N9T A;  1E2Z A;  1PXU A;  2DY8 A;  2K28 A;  5CV8 A;  2NTT A;  5EKI A;  3MA2 B;  3NQI A;  2JE6 I;  2NWG A;  4WRD A;  4V0B A;  5KEE A;  1CQV A;  5JPN C;  1TQO A;  1UUP A;  4K5V A;  1SXT A;  4A3D B;  3GTO B;  2KEE A;  3DM1 A;  2VB2 X;  2H1E A;  3VYR A;  1EIH A;  4WOR A;  5I9O A;  1IKM A;  3K5N A;  3VYT A;  1SFO B;  4B9W A;  4XT3 B;  4FF1 A;  1IHZ A;  4RCO A;  4RGT A;  4PMB A;  5CR3 A;  1WTQ A;  3A8J E;  4CGY B;  4LK1 C;  3DWP A;  3H3V C;  4KTA A;  5J39 A;  1BDO A;  4KMU C;  1B9N A;  1QG7 A;  2E2J B;  2KVM A;  5K36 H;  2XWJ B;  1DOL A;  2L0C A;  3PUW A;  4YIJ A;  4A3K B;  1NAP A;  1PLF A;  5C6A A;  4EGV A;  1B4O A;  2DNE A;  2NVY B;  3DWQ A;  3TP8 A;  1TWF B;  3R2I A;  4O1N A;  3J81 E;  1RTN A;  1MSH A;  1WTP A;  2F03 A;  2JXM B;  1S5C D;  1UAP A;  4ZUJ A;  1GHK A;  1QCB D;  2XRS D;  1KAA A;  3BDO A;  3HOV B;  1HHV A;  1ET9 A;  5LHY 1;  2XN9 C;  1NR4 A;  1CHP D;  3DUZ A;  5AFW A;  3K5O A;  5J1Z A;  5TSS A;  2EY2 A;  1LTB D;  1YNN D;  3S15 B;  2OEO A;  2K5W A;  4G57 A;  1STN A;  1H9M A;  2A73 B;  3VYS A;  4U67 3;  2F0P A;  1E2W A;  2RDF A;  4MHE A;  2A68 D;  4OO1 G;  3NQT A;  3P20 A;  1L0X B;  2F0U A;  1Q1B A;  5EPK A;  1JOQ A;  1KDB A;  4H7B A;  1I4P A;  1VF7 A;  3HKZ B;  1WTW A;  4F7X A;  1I4R A;  3SEB A;  1Z7T A;  4L6T B;  1BBX C;  3GTL B;  1ESR A;  2R7Z B;  2WAC A;  4XDX A;  1SYB A;  5C0X G;  4DNT B;  1SNM A;  2EPB A;  2E2H B;  2QIL A;  5KNC A;  5M5Y B;  4XTC S;  4XQN A;  3TP6 A;  1HTP A;  3J7Y W;  1LV9 A;  1YNJ C;  1Q8I A;  3GV3 A;  1Q12 A;  2R93 B;  2A6H C;  1EL0 A;  1OXS C;  5CBA E;  5M3M B;  1V1P B;  1MD2 D;  1SYC A;  2OF1 A;  2EJF C;  3PO3 B;  1LT6 D;  2KUM A;  2E2D C;  4RGN A;  2G9D A;  4RHS A;  4TKO B;  5JEA G;  3OIP A;  4HSV A;  2V4D A;  2EVB A;  1D5M C;  2F0W A;  2EJM A;  1JE4 A;  1RF2 D;  1VDZ A;  3M3Y B;  1EEI D;  4QF4 A;  2K5D A;  2F0L A;  2WKC A;  3I90 A;  4EQN A;  2F0O A;  2AWN A;  3WOF A;  1PRT D;  3TZD A;  5EQ0 A;  1EU3 A;  1R4P B;  2JA8 B;  1OXX K;  2L4N A;  4F87 A;  1IKL A;  2F4I A;  5JPM C;  1JB3 A;  2F0J A;  4ZRZ A;  3OMG A;  1QOH A;  2MUY A;  3EQL C;  1HCZ A;  3HOZ B;  4HTH A;  4OO1 I;  2WKD A;  4CJ2 C;  4C3I G;  3IKJ A;  4C56 C;  4HR7 B;  4LJZ C;  1BNZ A;  2QKI C;  1BCP D;  3VR3 A;  3SR1 A;  1BQQ T;  1J8I A;  4KD3 A;  1AEX A;  5D3I B;  2F0M A;  1Q90 A;  2LMC B;  1JOR A;  3ND8 A;  5C0X I;  1F77 A;  4KKT A;  3QO2 A;  3WDN A;  5C44 B;  2AUK A;  5C5L A;  4FF4 A;  3T56 B;  2NN6 H;  3J80 L;  5K36 G;  2Q8I B;  5M5W B;  3LX0 A;  5DNF A;  2TSS A;  4EQP A;  1RJT A;  3K5L A;  1JIC A;  1NCV A;  1TWG B;  3NPP A;  2LS0 1;  2NB0 A;  4S3S A;  2JSO A;  1PMR A;  5T1G A;  3P75 A;  3TP7 A;  1Y8N B;  1EEF D;  4FXG C;  4V19 0;  3CRK C;  1LTT D;  3SHL A;  1JOK A;  2RA4 A;  2KEC A;  2IW3 A;  3OHX C;  4A3I B;  1II3 A;  4DAV A;  5DM7 3;  3HOW B;  2MHV A;  2RDG A;  3E0J A;  5JJZ A;  2E2I B;  1VMP A;  2KQ3 A;  2A69 C;  1DYQ A;  1SE2 A;  2F0K A;  3NWT A;  4QCL A;  5J22 A;  3HRZ C;  1TS2 A;  2XWB B;  5CYU A;  2NVQ B;  3NUC A;  2O5I C;  2SNS A;  3HP3 A;  2O4X A;  1WD1 A;  2B2Y A;  4K8I A;  4C3H B;  2TMP A;  1I3Q B;  1KNE A;  3KLR A;  1C8C A;  1CHQ D;  2FFK B;  5C4X B;  4FXD A;  4BY7 B;  4KKU A;  2LY7 A;  2K6A A;  2BCO A;  3QG1 A;  3MFG A;  3GTQ B;  1BCP B;  1A2T A;  3M85 A;  2EYP A;  1UEA B;  2K5Q A;  1U4M A;  4WJW A;  1ET6 A;  3A55 A;  3VA5 A;  3NXW A;  3RMH A;  1R4Q B;  2RKS A;  2EYJ A;  2M2L A;  2K01 A;  5FO8 B;  1BUV T;  3VA7 A;  1HFG A;  2ZXO A;  1F2Z A;  2ID0 A;  4NP5 A;  4K2L A;  3A8K E;  1QIL A;  5CC4 A;  5CV9 A;  3QWN A;  5CGK A;  1EY8 A;  4IUU A;  2B2W C;  4FF2 A;  1OO9 B;  3BVG A;  3SXH A;  5IGD A;  3MHB A;  1K83 B;  1LTG D;  1V43 A;  4IFD J;  4FVM A;  1D2B A;  1O78 A;  4DXG A;  2C9O A;  1LTI D;  3URY A;  1IW7 D;  1C48 A;  1D6E C;  3SK6 A;  1TII D;  5KYI A;  5JVH 3;  1SMY D;  2PQE A;  1SNC A;  4IUV A;  5DEH A;  3NK9 A;  4K6D A;  3H0G B;  1IYV A;  5EPL A;  1KDC A;  3FEW X;  5KIX A;  3J80 E;  3NHH A;  1JC7 A;  2I46 A;  5EKK A;  2K32 A;  2B63 B;  3NBI A;  2AQ1 B;  2HCI A;  2E74 C;  2K7V A;  2MGS A;  1E2V A;  5E3F A;  3Q6S A;  1EY6 A;  3FPP A;  1EQV A;  2XNA C;  4DF7 A;  1LTS D;  5ELC A;  1JOO A;  3D3R A;  4C3J B;  4A3E B;  1LT3 D;  4NDX A;  1VF5 C;  1TY0 A;  2KCC A;  4IAL A;  1FD7 D;  1KLG D;  1H9S A;  2QF7 A;  4JK1 C;  1TS3 A;  2B2V C;  4DK0 A;  1GOZ A;  4LAA A;  1QNK A;  1PTO F;  3A7A B;  3I73 A;  3G6J B;  1ILP A;  3MVV A;  1QB5 D;  2WAQ B;  1FGB D;  4HCS A;  3QJY A;  2QCP X;  4LMQ D;  4ZKB B;  3K59 A;  1AZP A;  2KHS A;  4FNF A;  4O42 A;  1A6X A;  2CHB D;  1YNN C;  1CI3 M;  4NKL A;  2PPB C;  4E6I A;  4HED A;  1PFM A;  3MTS A;  3TBI B;  4XT1 B;  1F2L A;  1JCK B;  2WB1 B;  2RVL A;  3ERO A;  2A68 C;  2NN6 G;  4IUR A;  1LAB A;  2VNU D;  2FJ2 A;  3QOL A;  3FRP B;  3K57 A;  5DAU A;  2Y0S B;  3S9W A;  1BF4 A;  4HCE A;  3P1H A;  1VCI A;  5ELE A;  5KND A;  1ZXT A;  2XVS A;  4KKS A;  4KI0 A;  5JAV A;  1MGS A;  1PFB A;  1Y1W B;  3NE5 B;  3E6Z X;  1QJO A;  1NUC A;  1EZ8 A;  4HSP A;  5IOD A;  4R8N A;  5FO7 B;  3ERQ A;  1TWH B;  5EJW A;  2BA0 A;  1Q3L A;  1EZ6 A;  4OIK A;  1D1I A;  3EVQ A;  1SYG A;  4KK7 A;  3CKI B;  2VUM B;  3DEP A;  4L8J A;  5IGF A;  2ENB A;  2PW5 A;  4PQX A;  5CMD A;  2YYZ A;  5D65 A;  1X32 A;  1O7Y A;  1TWC B;  1XX8 A;  4TQU S;  3SK4 A;  1CZG A;  1DZ1 A;  1Y8P B;  2PO4 A;  1TY2 A;  3DEO A;  3D4D A;  5I6Y A;  2AQ3 B;  3VR6 A;  2EXZ A;  2B2U A;  2IX0 A;  3D8G A;  4A3B B;  4M1U B;  2EY6 A;  4KY5 A;  1WTX A;  4KN4 C;  5KYL A;  2WV6 D;  5C3W A;  3BYY B;  3CU7 A;  4EQO A;  4DNR B;  1Y1V B;  1I4X A;  3OPO A;  5JVG 3;  3FPU B;  2BDO A;  3GO5 A;  1EYD A;  5DM6 3;  1STH A;  3Q23 A;  2HDM A;  2H4O A;  2NN6 I;  1DM0 B;  2F1M A;  2SEB D;  1MI2 A;  1RDP D;  1SNQ A;  3RUZ A;  5EGT A;  1BCP C;  3A7L A;  5ISR A;  4QMG A;  3OWF A;  1HA5 A;  1SSO A;  3GD7 A;  3LNN A;  2QEJ C;  1NR2 A;  4K5W A;  3A54 A;  3EJI A;  1SND A;  5ELB A;  1A3V A;  1OXU A;  4K5X A;  1EFI D;  3D4W A;  1EWC A;  1HRJ A;  5FOB B;  3IL8 A;  1DXM A;  1EIG A;  3K0Y A;  5IT9 L;  1RHP A;  1B44 D;  1OXT A;  3K6O A;  4BA2 I;  2B2T A;  2F0F A;  1GUO A;  1HQM C;  3T51 B;  2NZ1 D;  3VYU A;  4IUN A;  3Q0A A;  5K5P A;  2EYH A;  4Q5V A;  4H44 C;  3TN2 A;  1TS5 A;  2F0Q A;  3I72 A;  2M9V A;  1STY A;  3MEH A;  3M7N A;  4OGQ C;  1WTO A;  1ZEQ X;  4X3T A;  1F9R A;  1HFN A;  3BS1 A;  4R8I A;  3C46 A;  4ZLT F;  4C3H G;  3PO2 B;  1TVX A;  1SBB B;  1FNU A;  1F2Y A;  4AYB B;  4HMJ A;  2B39 A;  4DAP A;  1I6V C;  1TU2 B;  1SAP A;  4M8A A;  1JQY D;  2AUJ D;  1DD2 A;  3OW7 A;  3NWS A;  3HEJ A;  5M9O A;  3GV6 A;  3I70 A;  4UAI A;  4BWG B;  2R3Z A;  1PZI D;  2Q8R E;  4A3M B;  2F3W A;  1B1Z A;  1ZYR D;  2J4X A;  2EYO A;  5C4Z A;  1ENA A;  1BO0 A;  1JR0 D;  5FK9 C;  2BDN A;  5M3F B;  2BE5 D;  1EY7 A;  1H9S B;  1B3A A;  3ONA B;  1SYF A;  4X3K A;  3DWA A;  1JWS D;  3W3A A;  4CJ0 B;  4CKB A;  1T5X D;  4OIJ A;  3HGB A;  4G7O C;  2JA7 B;  3R2T A;  1S5D D;  3KK7 A;  3W2D A;  3D6C A;  1ONL A;  2ZT9 C;  3DXJ C;  3LWU A;  2K04 A;  3FDT A;  5IGG A;  1PTO D;  3J7A V;  5I2Y A;  4KHZ A;  3MAQ A;  1C4Q A;  1S5E D;  1B50 A;  2L12 A;  3OIQ A;  1TR5 A;  1WTR A;  2KCN A;  3H91 A;  3JAM L;  3HS0 C;  1ZKO A;  1I4Q A;  2R6G A;  5FLX L;  5EBC A;  1Z47 A;  2JEA I;  1F9Q A;  4ZKC B;  4C3J G;  1VMC A;  1LTR D;  3OMC A;  3SK5 A;  3DMU A;  1SMY C;  2IX3 A;  5IT9 E;  4IFD G;  2A6E C;  5IIF A;  4GZY C;  3IFD A;  4WFN 3;  1Q1E A;  4RH6 A;  2CW0 C;  3KF8 A;  2F0T A;  3PUZ A;  1BR9 A;  2JP1 A;  4HAE A;  4ME5 A;  3CRL C;  4XXE A;  2O5J C;  3QIA A;  2B8G A;  5EKL A;  4KY6 A;  2F3V A;  1TT2 A;  4JBW A;  3T13 A;  4EVO A;  4IUP A;  2J0T D;  1EY5 A;  3PUV A;  3HG9 A;  5IGB A;  1SDF A;  4B08 A;  1PRT B;  4DGZ A;  4CHT B;  1XWE A;  1K8M A;  4DA2 A;  1HA6 A;  2I07 B;  1A15 A;  4C2M B;  2XRQ D;  1G2S A;  1EYC A;  4XQJ A;  3MXU A;  3L3O C;  1QWY A;  2R61 A;  1DJR D;  2D9U A;  4DFA A;  2J7Z A;  4ABN A;  1GUG A;  1KAB A;  4BS9 A;  4DN4 M;  3MXN A;  3KLS X;  5D14 A;  1QNU A;  3BDC A;  1LT5 D;  1GUS A;  3GTG B;  1AZQ A;  4BA1 I;  3ZYY X;  2K05 A;  3EA6 A;  1IL8 A;  2B2Y C;  4DK1 A;  3AB9 A;  1ILQ A;  3GTP B;  2E76 C;  3FVQ A;  4A3F B;  1PTO B;  2F0S A;  1TKW B;  3MWY W;  3CHB D;  4KJO A;  2F0I A;  1D1K A;  5D3D A;  1O7Z A;  5BN3 A;  1LT4 D;  1IYU A;  1PZK D;  5HUR A;  2AWO A;  5I2X A;  4ODG A;  2D2C C;  1Y69 U;  3I4L A;  3UI2 A;  1O80 A;  4IFD I;  1RCV D;  3MFY A;  4RWS C;  3C1E A;  3VR4 A;  3TME A;  2O2L D;  1TS4 A;  1LTA D;  3BVZ A;  1SYD A;  2BOS A;  1SYE A;  4PMC A;  3MXG A;  1CTM A;  2D62 A;  2HUG A;  3Q22 A;  1HPC A;  1PDQ A;  3JAM E;  3FMC A;  2PW7 A;  3I4N B;  2NBF A;  1HQR D;  1I4G A;  3X3N A;  1TWA B;  3BYT B;  1MSG A;  5FLX E;  5A35 A;  3PUY A;  2L55 A;  1OXV A;  1WD0 A;  1QE6 A;  3E5S A;  3RLF A;  3GP7 A;  3MC0 B;  2WIN B;  2VB3 X;  2B8F A;  4K6L A;  3GQB A;  4G7Z C;  2EYM A;  2HCC A;  3MXP A;  1X3P A;  2M00 A;  2OXP A;  3CQZ B;  4KY7 A;  3VR2 A;  2FMC A;  3SDZ A;  2A69 D;  1HXY D;  5G3L F;  4HN7 A;  4N9P A;  5F2D A;  2EDG A;  1RD9 D;  3S16 B;  1GXD C;  4FF3 A;  2Z4H A;  1GUW A;  1A2U A;  1V1O A;  3PV0 A;  4CKE A;  2F0G A;  1SEB D;  1I4H A;  3C3L A;  3ITP A;  4MIU A;  1STE A;  3HOX B;  2AQ2 B;  3NTH A;  1EY0 A;  1M4V A;  3A56 A;  4RKB A;  3F2U A;  2KOL A;  2VXW A;  4KJN A;  3J7A F;  1M8A A;  4DU9 A;  2X6L A;  4J8Q A;  3L7Z C;  1EU4 A;  5ELF A;  2EYL A;  5BN5 A;  2HDL A;  4ZUI A;  3I91 A;  1H9J A;  3O13 A;  2YU9 B;  4K2K A;  4PV1 C;  1SE4 A;  4F88 A;  4NMZ A;  4X3U A;  2C5C A;  2L5T A;  4OL7 A;  1B53 A;  3VR5 A;  4FP5 D;  1A3T A;  1X3Q A;  4KN7 C;  4I65 A;  4ZK9 B;  1ICW A;  4KD4 A;  2IWH A;  1STA A;  3BG3 A;  1F9S A;  3HOU B;  5I6W A;  4QUF A;  1S4Z A;  4KV6 A;  2F0V A;  5HGT A;  5ELD A;  4FO2 A;  3R93 A;  4A3G B;  2F0H A;  5KNB A;  3GTM B;  4ILW A;  5A2Q L;  4IUT A;  3T4A C;  3M4O B;  3PMF A;  5E4X A;  5KGU A;  3TDQ A;  1AFP A;  3BDL A;  4QB4 A;  2N55 A;  3M7G A;  3RZD B;  2L9H A;  4TRD A;  2FMM A;  1HUN A;  4C1N K;  2CVR A;  4IFD H;  1ENF A;  2IX1 A;  2EYF A;  2E75 C;  1S5F D;  3OWE B;  1G6Z A;  2L11 A;  2FHT A;  3U9S A;  3NTI A;  1PRT C;  3HZX A;  4RGM A;  1GJX A;  1ZYR C;  3FKI B;  1O7L A;  1FYC A;  1K8O A;  4CBV A;  3R3O A;  3N52 A;  4FYD A;  1EOT A;  2D5D A;  2BE5 C;  2B2U C;  2JA6 B;  2ICI A;  5COR A;  1PZJ D;  3SE0 A;  3H94 A;  2NVT B;  2JA5 B;  4ZQ3 A;  3Q24 A;  2EE1 A;  4BBS B;  2EZV A;  3RD4 A;  2ICE C;  1WVL A;  4Q0F A;  3C2P A;  1GUT A;  4PMW A;  5FO9 B;  5CV5 A;  3I8Z A;  4QUC A;  3OSO A;  3T53 B;  1G2T A;  4FXK C;  1Y8O B;  3GTK B;  1PTO C;  3SVM A;  5C3X A;  3KBX A;  1MBY A;  2LFN A;  1RKN A;  3S2D B;  1BOS A;  3SK8 A;  4TSS A;  3X3M A;  3QOJ A;  2R92 B;  3RZO B;  1U4P A;  4ULL A;  2F0N A;  5C5M A;  3MZ5 A;  2KJX A;  2Z1C A;  3C1F A;  3G7L A;  1CT1 D;  1ML0 D;  3I3C A;  3NBH A;  2EY5 A;  4L63 B;  3TSS A;  4DAY A;  2SOB A;  2CQA A;  4H0L C;  2MP1 A;  2IPK D;  4A3J B;  2IJ0 A;  2B2T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...