4KY5A

Crystal structure of staphylococcal nuclease variant delta+phs v23d at ph 7 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTDKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23D at pH 7 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky5A00
3QB3A 5KYIA 5CV9A 5IGGA 5KEEA 5KGUA 4ZUJA 3SXHA 2SNSA 3U9OA 2F3VA 3NHHA 5M9OA 3TP8A 1ENAA 4HMJA 1AEXA 5IODA 1JORA 1SNOA 2F0QA 3BDLA 2F0LA 4E6IA 1EYAA 4NP5A 4EVOA 1A2TA 2EY1A 1EY9A 4H7BA 2PYKA 1IHZA 4WRDA 3D4DA 1SYFA 2PQEA 4DGZA 2EYMA 2OF1A 1TR5A 4K2KA 3NP8A 3R3OA 5CV8A 2WACA 4KTAA 1SNPA 4TRDA 4PNYA 4G57A 1A3UA 4HMIA 2F0SA 1EY5A 3PMFA 4KHVA 3ERQA 2PZTA 4KD4A 5DEHA 4PMBA 3OSOA 3D6CA 2PZWA 2EYFA 2F0HA 2NUCA 2F0VA 5C3XA 5KRUA 1JOQA 5JAVA 1RKNA 1EY8A 2F3WA 4IUNA 4KJNA 5E1FA 5JOBA 5CGKA 2OXPA 2F0JA 5HURA 1EY7A 2RBMA 1A3VA 1STHA 2F0PA 2LKVA 5DAUA 2EYHA 3C1FA 5K5PA 1EYCA 4DF7A 5IGBA 1SYBA 2O4XA 3D4WA 4KY5A 4S3SA 1STYA 1EYDA 5IGEA 3HEJA 4K5XA 4KY6A 4K5WA 5F2DA 1TT2A 2EXZA 1SYGA 3EROA 1NUCA 2F0DA 4HTHA 4N9PA 4R8NA 1KDBA 5J1ZA 4B9XA 4WORA 3TP5A 1EY4A 2EYJA 1ENCA 5IGDA 3SK6A 5IGCA 4K8JA 2F0NA 5EGTA 4QF4A 3T13A 1A2UA 3TP6A 1EZ6A 1EY6A 1SYEA 1F2ZA 3VA5A 5J22A 1TQOA 5EKLA 2PW5A 3SK4A 4ZUIA 1F2MA 5C3WA 1STAA 2PW7A 5CR3A 1EQVA 2HQEA 1KDAA 4RKBA 2F0OA 3SK8A 5C6AA 4YIJA 4B9WA 3NXWA 1U9RA 4K5VA 2SOBA 1SNDA 3P1HA 4DFAA 1STNA 3MEHA 4KY7A 1KAAA 2QDBA 3C1EA 1EY0A 3D8GA 3NQTA 4NMZA 4IZ8A 2EY5A 5I6WA 3TMEA 2F0KA 3OMCA 1SYCA 3DHQA 5CV6A 5KYLA 5CV5A 4KV6A 2M00A 4I65A 5IOCA 5CV4A 4K6DA 3SK5A 3MXPA 2OEOA 3H6MA 3EVQA 3NUCA 4F8MA 4F7XA 4EQOA 5IGFA 2SNMA 1II3A 4ME5A 5NUCA 2F0UA 4ODGA 4QB4A 1A3TA 2F0IA 3OWFA 4RKLA 5C5LA 5C4ZA 5CC4A 1SNQA 2PZUA 2RKSA 3ITPA 4NKLA 3MHBA 2KHSA 4J6HA 5I6YA 4EQPA 1F2YA 2RDFA 2F0EA 3QOJA 1STGA 2EYOA 3SR1A 3LX0A 5I9PA 3EJIA 2F0TA 4K14A 2KQ3A 4KD3A 5CV7A 5KIXA 3MZ5A 3P75A 4KJOA 4J1MA 3V2TA 4DU9A 2ENBA 2F0WA 5IIFA 1NSNS 5HGTA 4LAAA 3MVVA 3TP7A 1STBA 4K8IA 2EY6A 4MIUA 3E5SA 2EYPA 2F0MA 4PMCA 1EZ8A 3DMUA 4K2LA 1JOKA 1KDCA 5I9OA 3S9WA 1SNMA 3QOLA 2F0GA 4ZQ3A 1SNCA 3SHLA 4OL7A 4IALA 3T16A 4EQNA 5ISRA 2F0FA 5J39A 4QMGA 4NDXA 2EY2A 1JOOA 4N9TA 4ID6A 5E3FA 5EKKA 3RUZA 5C4HA 1KABA 2EYLA 3BDCA 5C5MA 3NK9A 3OMGA 3HZXA 1SYDA
chains in the Genus database with same CATH superfamily
1X54A 4RG1A 2PQAA 2HDLA 2Y0SG 4P74A 1M1KC 1S5FD 1BKBA 2FMMA 3ND9A 4B3SQ 1QVFA 3RR5A 1HJPA 1G6PA 1LABA 3MXNA 2XRQD 4GOPC 1PRTF 1QUQB 3BDLA 2I0QA 4OX9L 1ET9A 1A2TA 4BBSB 3STBC 3VR3A 3KDFA 4DV0L 4UHVA 4JI8L 3M9BA 3CPFA 4LFAQ 4K2KA 3RLFA 5M5WB 1IL8A 3AYHB 1W3SA 4U673 2NN6H 4KMUC 2K33A 4ILWA 4KD4A 4QUCA 3OSOA 4KN7C 4DUYL 4C2MB 1M90C 3I73A 1CKMA 1B4OA 3NELA 3IKJA 4JOIC 3D4WA 1TWAH 4LNQA 3CHBD 1ZYRD 1H9RA 2CH4A 5D65A 4DV0Q 1TWFB 4JI8Q 2DNCA 1G8ZD 1LTRD 1HR0W 3PO2B 1CFMA 1GJXA 1E24A 2PW7A 1TWCH 4YY3Q 4DUYQ 2GVAA 4YIJA 1BCPD 4K5VA 5LL6S 1WTOA 4IZ8A 3NSWA 5CV5A 2NN6G 1FNVA 2YU9B 1E7ZA 4F7XA 1JMCA 2SNMA 3OIQA 4QB4A 1A3TA 2QEXA 2UUBQ 1J8IA 1YNND 2BOSA 1N32Q 1Q3LA 1CZWA 2Q2IA 1F77A 1HNWQ 4LFBL 4CDCC 4B3MQ 1U0LA 1NMGA 3QIAA 3DWPA 3EJIA 2KQ3A 4POFA 1PH9A 4GNXA 2R93H 2V4DA 2EY6A 3NPPA 1KDCA 1ZEQX 5FK9C 4XQJA 4KI0A 4N9TA 4JBMA 2Y0SE 3RZOH 3K6OA 4DV1L 5A35A 3KF6A 1ASZA 4CGYB 3G6EA 1BR9A 3Q0AA 2Z6BA 4LFBQ 1TS5A 2Q8TA 3C46A 1SNOA 2PI2E 2AMCB 3NQIA 2B8FA 2UXCL 3RN2A 4UP7A 4DGZA 2AQ3B 4GOPB 1X65A 1E2WA 2C9OA 1Q1EA 3R2TA 3A8IE 3R8BA 1EIFA 1EY5A 4LFCQ 2B2WC 2HQLA 4A3BH 5BN3A 1KHIA 2NUCA 1AE2A 3SVMA 2OQKA 2R93G 2ID0A 3OWEB 1IBMQ 4CJ2C 2F0JA 5LMNQ 1QOHA 1I5FA 3C1FA 1TWAB 3M4YA 1H9MA 2KVMA 5DNFA 3OW2A 1ML0D 2G9DA 3CU7A 2UXCQ 2D0PA 4B9XA 1YBYA 3G71A 1KDBA 1PFNA 2L0CA 3UDIA 1ENCA 5T1IA 1MJEA 3A7LA 5EKIA 2IY5B 3JAMc 3CMAA 4DR5Q 1TWCB 1JE5A 1I4HA 2WKCA 4R8IA 3I91A 4CJ1B 3ZYYX 4G4KA 1ICFB 3IRBA 1F9RA 2K5WA 2E5LL 4IUUA 4QIWB 1EWCA 3KJOA 4NMZA 1V1PA 3KF8A 2B2TA 1LV9A 3BS1A 2ASBA 4FF2A 3TZUA 2XRSD 1WTXA 3CKIB 2N3SA 5C3EH 4A3BG 4A3DB 4IJLA 3DWAA 4EQOA 4JI0Q 1II3A 4EX5A 1K8MA 2UXBL 3OWFA 1RIPA 3ER0A 4NKLA 2TSSA 3MHBA 4J6HA 2AKWB 5G3LD 3QOJA 4DV3Q 2B2VC 3M85A 3UDGA 4L63B 3LX0A 4O1NA 3OYYA 4DV6Q 5FKAC 3F8TA 2MNAA 4DR7L 1KC8C 3WOFA 2R93B 1QNKA 1K83H 2CHBD 1K8AC 1UEAB 1DCZA 3DUZA 2F0MA 2ICIA 3HOWH 3S9WA 1XPOA 5ELEA 4P71A 1IBLL 4IFDI 2E2DC 4DAMA 4HIMA 3RD4A 4QIWE 5I4DA 5CV9A 1TS2A 1Z47A 3FP9A 1XX8A 3DM3A 3CQZH 3QO2A 1CUKA 4KHPL 1EOTA 1LTAD 2QDLA 3M4OH 5DLQE 5C3EG 4R4CA 1EY9A 3K0XA 1SYFA 4K0KL 3A8KE 3CC4A 3IAYA 4JV5L 4P72A 2BH8A 2QEJC 4OGQC 1IBLQ 3HOXB 3T1YL 4A3BB 4JI5L 2B63H 4CBVA 3ERQA 1KQSA 1YHBA 4HSPA 5DEHA 2E2HH 1W6KA 3T1HQ 2DN8A 3HOWG 1TXYA 4KHPQ 4JI4L 4JW0A 3IL8A 1SYBA 4NXNQ 5BN5A 5JEAG 1ILPA 2CQAA 2VQEL 4JBJA 4M8AA 3WDNA 3JC66 4TSSA 3PCOB 4DNRB 3SK6A 3H3VH 3A56A 5JPNC 1QZHA 5JJKA 2K1BA 3MAQA 1D8LA 3NBHA 3PIPA 1RTNA 3T1YQ 4JI5Q 1VQJA 1EQVA 3MXNB 4BA2I 3TSSA 4A75A 1XJVA 4DR6L 1D5XC 3J81i 1HR0L 2GA4B 3N52A 3Q8DA 4GZYC 1SYCA 4JYAQ 1B9NA 5C3EB 3QWNA 3Q22A 1ET6A 2XWJB 5CV4A 2B63G 3JAML 5CBAE 1SSOA 2EQSA 4RCOA 1B8AA 1PHJA 1XPUA 3HS0C 3ITPA 4JI6L 1BF4A 1TY2A 2A8VA 3NWTA 4HEDA 4DAYA 5C0XI 2F0TA 3X3NA 1R9TH 1QE6A 3T51B 3V2TA 1K83B 1O7YA 2CVRA 5IYBH 4I7AA 1PH5A 2FFKB 3J7AV 3FMCA 1RL2A 4MHEA 2EIFA 2UUAQ 1WCMH 4DR4L 4DR3L 4GKKL 2KBNA 4I7ZC 1PTOD 3CQZB 2JJQA 3F1ZA 3URYA 4DXGA 2F3VA 2ZXOA 4J15A 3TP8A 2YTYA 3K59A 1JORA 3T56B 1EYAA 1JWSD 3M7NA 2QW7A 4CKBA 3CCJA 4WJ4A 2B2UA 1IW7D 5JPMC 3C3LA 1VQOA 3D6WA 1FL0A 3TEHB 2A68C 2CWAA 3S17H 2B63B 1HCZA 4AYBG 2R7ZH 2F0SA 4H02A 1VDZA 1EIYB 4DR4Q 2E2HB 1X56A 5IYBG 3ZJYC 1LO5D 3AFPA 1EY8A 3G48A 4KJNA 3VYTA 1WCMG 2IW3A 3UDFA 3ULPA 2RCNA 1VQ4A 1I4XA 4DV4L 1Z7TA 1TT2A 1V8QA 3KLSX 4R8NA 3GD7A 5E7NA 5KNBA 1YJ9A 1X3GA 2A6HD 2HUGA 2AHOB 1LUZA 2J7ZA 3GV6A 1I94L 4JCVE 3TP6A 5EPJA 4GN5A 1SYEA 2YYZA 2PW5A 3KK7A 2JA8H 1RHPA 2HQEA 2K5DA 4DA2A 4R4IA 1OO9B 2DJFC 3P1HA 3TMEA 2LS01 2NVTB 3CW2C 1ESRA 4LF8Q 2R7ZG 5EQ0A 1IBKL 3H6MA 4F8MA 4YHHQ 3OPOA 4LF4Q 1EU3A 1QG7A 2HT1A 3KUPA 1L0XB 4LF6Q 2VZAA 2F03A 2L9HA 5D14A 2XVSA 4DK1A 1U4PA 2D0OA 1WI5A 4CJ0B 1R9TB 1VQEA 1CSQA 5DM63 5JJIA 1IL2A 5JJLA 4HN7A 3FEWX 2G9HD 4GN3B 4EQNA 5GAGC 4OL7A 1X3FA 2Z6KA 1OTCA 4HCEA 4Q5VA 2EY2A 3D31A 2JA8G 3RUZA 2CW0C 2HDMA 2FXQA 4QY7A 3BZDB 1SE4A 4BS9A 1SXTA 5KGUA 1HRJA 3GTJB 3SXHA 2NVQH 3CCEA 2IJ0A 2OWOA 1HZAA 2R7FA 5LMUL 3KF8B 1ZYRC 1HNXL 3JAMi 4A3EH 3J80i 4LUOA 5TSSA 2OF1A 4YCUA 4AYBE 1HQMC 1K0SA 1XTCD 2JA6H 1W6JA 4IJHA 1YEZA 2R7ZB 1MKHA 3MEFA 1KRSA 1XMOQ 1VQIA 4KHVA 2HHHQ 1ESFA 4IUVA 1S5CD 3D4RA 4MTKA 2MGSA 2JYOA 1JOQA 1E2ZA 1Y1VH 2F3WA 1IZ6A 4IUNA 4FF4A 1O7ZA 3B6YA 3HFZB 1VQKA 1AN8A 2EYHA 1MJCA 3VA7A 1EYCA 5FOBB 1IXRA 5LMUQ 4A3JB 1N36L 1SROA 3OTOQ 3K0YA 3GTQH 4B3RQ 1PYSB 1B3AA 1GOZA 3JAME 2EJFC 3PV0A 2RDHA 2ZJPA 5T1GA 5IGCA 3OHXC 5M5WH 2JEAI 4L5TA 5EGTA 2DGYA 3S1RH 1XNRL 1Q8IA 2JA8B 2KCMA 4UY8C 3GTLB 2KCTA 4JI1L 4A3EG 3CF5A 4YWKA 1NR2A 4CKCA 1YITA 1VQHA 1O78A 3DEPA 4HIOA 4OEMB 2QDBA 3V05A 2JA6G 1WTHA 4DV5L 5KYLA 2NVXB 4KV6A 1N36Q 2XTIA 1TKWB 5IP9H 1UE5A 2H4OA 1JT8A 2QA4A 3G6JB 3GDEA 2F0UA 2R6GA 1KXLA 1CTMA 1WVLA 3CMEA 2PZUA 2CH4W 4GLXA 4KLKA 4EQPA 1WD0A 3HOUH 3G4SA 1GXDC 3Q23A 2JA5B 4IN3A 1TWGH 1XPRA 1LTID 1E3PA 4JI1Q 2CKZB 4J1MA 2DY7A 3A74A 2NYZD 1CK1A 1YI2A 2AWNA 3GQBA 4IALA 1FD7D 3ND8A 4MNOA 1YNJD 2B2YC 2Z8LA 1DONA 1H9SA 3Q24A 1IHZA 2H1EA 3QB3A 3KJPA 3LNNA 2FINB 1H9JA 4F88A 4A3EB 2E2IH 4E6IA 1CQVA 3HGBA 3GTOH 1T9HA 3T53B 1OXSC 3I3CA 1DOMA 1LTGD 2PQEA 2JEBI 1TR5A 3SE0A 4DK3C 1VS0A 2I5HA 4RAUC 3HOUG 3FDTA 4N8X1 4HR7B 3J81c 4HMIA 2UU9Q 3PMFA 4PMBA 2EYFA 3FPPA 4DAYB 2VQFQ 5JAVA 1DM0B 1HA6A 2UUCL 2F4VQ 5JOBA 1GUTA 3UDXA 4TKOB 5IT9c 1JB7A 2OTJA 2NTSA 1A8VA 3GTQB 3K7AH 4OHJA 4G7HC 3KBGA 1Y14B 4O2DA 4EQ5A 1MIUA 4N8FA 1MI2A 3S1RB 1FYCA 4HJ7A 1E22A 2IHFA 1EY6A 1HNZQ 3SK4A 3KLWA 1QILA 1CHPD 2SEBD 5A2QL 2GVBA 4JI3L 5C6AA 2UUCQ 1STNA 3PSIA 4JI2L 3D8GA 4RGNA 2MP1A 4OX9Q 1K9MC 1XXGA 1BXTA 4PG3A 3PUZA 3RZDH 4GLVB 3HOVH 3KLRA 2IX0A 3E3XA 4L8JA 5IGFA 2A69C 5I6YA 4A3KH 4PV1C 3HOUB 3H3VI 2KHSA 5GQOA 4Z9CB 1STEA 1TWGB 2EYOA 2KEDA 3K5MA 1VQ7A 1LT6D 2F52A 4HIDA 1X32A 5FLXc 5JVH3 1LT4D 3TBIB 1CHQD 4LAAA 3MVVA 3DMUA 1L0YB 1L1OA 2K75A 3T16A 3BVMA 3S24A 1BUVT 2L4NA 4DXFA 2ZM6L 3MTSA 1RODA 2HCCA 3BZKA 4A3DH 3HZXA 3I90A 2RHQB 4FXDA 4PZ8A 4LF9L 1HTPA 1OXUA 4POGA 2QCPX 2K5QA 3U9OA 1JE4A 1AP0A 3NHHA 4ME3A 5M9OA 4C1NK 5GAHC 2E2IB 3GTOB 1AEXA 2DNEA 4RWSC 1GUSA 2PPBC 1BBXC 1UE6A 3HOVG 3PGZA 1Q12A 1YIJA 1LTLA 1QVGA 4A3KG 5C4XH 1HQRD 1H95A 3CRLC 4X3SA 2D62A 2OT2A 3AEVA 1JR0D 4DNIA 1LACA 3I7FA 1QCBD 2BE5C 3D6CA 2PZWA 2IL8A 2F0HA 2RA4A 4B3TL 3I4LA 1WJJA 2HD3A 1EUJA 2E74C 1I50H 1SMYD 5CGKA 1JJGA 5D3DA 3N6RA 4AQYL 3K7AB 1A15A 1D6EC 2JQOA 1EYDA 1C4QA 1G91A 4K5WA 4DR2L 4A3DG 4N9PA 3J81L 5IYCH 4UPAA 4XIGS 1YJWA 1EY4A 3AFQA 1EU4A 2ZTCA 2CCZA 3PUWA 4RGMA 2NVYB 2K04A 3M4PA 1CKNA 3VA5A 3HOXH 1PH1A 5IT9L 1I4PA 4ZYSA 4DV1Q 5C4XG 3UE1A 3I4OA 1BO0A 1I4QA 4HJ5A 3S14H 4UAIA 3PUVA 5C44H 1EOVA 1ASYA 3RZDB 3HOVB 1KNAA 4I65A 2VB2X 3EQLC 3CCSA 1BVSA 3HKSA 4RFBA 2OEOA 3FPUB 4J8QA 4A3KB 4DR2Q 4NB3A 3S16B 4ME5A 1YHQA 4X3KA 1L2FA 1UAPA 1SMXA 2CWPA 2IHEA 2A6ED 3L9AX 2K7VA 3J80c 2PNHA 3LWEA 3SR1A 2K28A 3M3YB 3P75A 4DU9A 2AUJD 2XWBB 2K03A 5IYCG 1KD1C 2L5TA 3MA2B 4YWMA 1HHVA 3CD6A 4BY1H 1KL9A 3H09A 4A76A 3NE5B 2K52A 4ULLA 1WOCA 3HOXG 1S5BD 1T5XD 3OW7A 5E3FA 5C5MA 2RSOA 1BNZA 5FLXL 1GHKA 1WFQA 5C44G 3HOZH 1LM0A 4RA8A 1UUPA 3WWVA 2SDFA 4HMJA 2Z9HA 5IODA 1QJOA 3V96A 5I2XA 1NJIC 2KHJA 1TU2B 1EEFD 5C4XB 1A62A 3BZCA 1D1IA 4H7BA 1HTLD 1J5EL 2A6HC 2E5LQ 3W3AA 3D3RA 3STBD 3S1NH 4TRDA 4PNYA 4P75A 5JEAH 4Y7NB 2D2CC 2VS1A 2UXBQ 5A2QE 1K3RA 1H9KA 1I50B 1SN8A 5AFWA 4C1NI 3GTKB 4BY1G 4XXEA 3DLLA 1RTOA 2Z0SA 3IFTA 1MBYA 3T4AC 2EZVA 3BJUA 1CZGA 1PFBA 1WTVA 4DR7Q 1STYA 2Q2UA 4GS3A 3ULLA 3TQYA 5J1ZA 2JP1A 5ELCA 4A3FH 2KA7A 1FGBD 2EYJA 2RF4A 3HOZG 3T13A 2F0NA 1EZ6A 1K28A 3MC0B 4GNXC 1PZJD 1V43A 1DJRD 2F0OA 3VYRA 3AB9A 5IY0A 1RD9D 4RMFA 3S14B 5C44B 2JXMB 3KYHC 4DFAA 3OOCA 4NW2A 2O2LD 3CCQA 4Q0FA 4R4QA 2ICEC 4L5QA 2VW9A 4K6DA 4X62L 2Q8IB 4K0KQ 5AJ3L 4JV5Q 4C3JH 4IO9A 1BQQT 1S4ZA 2B3GA 5CC4A 3TREA 3R2IA 2PQAB 2R61A 3GP7A 4UP9A 4IOCA 1LLRD 2A19A 5CV7A 1VQPA 2QF7A 5JVG3 2NZ1D 2JA9A 2LMCB 5HGTA 3H15A 4A3FG 4BY1B 1B50A 3TP7A 4K8IA 3KDFB 3CCVA 4X65L 4JI4Q 2RCFA 3TN2A 2F0GA 5L37A 1IYUA 1K3BC 1PH4A 2NVTH 2K5VA 2VQEQ 2A1AA 4OWTB 3J80L 2FMCA 3OMGA 1WYDA 4OO1I 3K57A 4C56C 5IGGA 2Z4IA 4JBWA 2FHTA 3HOZB 1ONLA 3TRZA 2QGQA 2JSOA 1N33L 1KTKA 1OXXK 1S72A 1QVCA 1GM5A 1Q7YC 3PF4A 2E76C 3VYSA 4DR6Q 2ZJQA 1HR0Q 5K36H 3NTHA 4C3JG 3S1NB 2I07B 3J81E 1RDPD 3WOEA 2EOTA 1G2TA 1BDOA 1SR3A 1HH2P 1UE1A 2MO1A 5FJ8H 3CCRA 1SNPA 4LJZC 3A5ZB 4G57A 1NTGA 1JQYD 2KEEA 4M1UB 3S15H 2CFMA 4X3UA 5IT9E 2B2TC 1OXVA 1XNQL 2F0VA 1TS3A 4JI6Q 1I4RA 4AIMA 1M4VA 3MFYA 3GTJH 1V1OA 3I72A 1QUQA 1GHJA 1ILQA 1I3QB 1D5ZC 2KCCA 2XSCA 4A3FB 4FYDA 1AE3A 5DAUA 1SYGA 3VR5A 1YNXA 2B29A 3GTMH 2Z1CA 4FF1A 1UNSA 3U9SA 4ZK9B 4YWLA 4DR3Q 3NBIA 3I56A 4GKJL 4GKKQ 3A54A 3SK8A 1XNQQ 5K36G 1HFGA 4CDDC 1SNDA 4NXML 4JI7L 4GNXB 1EQRA 5LHY1 1Q8KA 5FJ8G 2WIIB 3DHQA 4QGUA 4A3JH 5CORA 2BDNA 4C3JB 3PIP3 2ZXRA 3CXCA 5ELBA 2IWHA 2EDGA 2UXDL 1F9SA 5IE8A 4ZKCB 2NN6I 3KF6B 1TWHB 1STGA 2PMZB 5COYA 1O7IA 3W1BA 1R4PB 3EN2A 3GTLH 1X3QA 4FDBA 4XQNA 1NSNS 1D7QA 3PIOA 1W2BA 2EYPA 1EZ8A 5FLMH 2IX3A 4HJAA 2ZTEA 1JC7A 1B7YB 4DV4Q 2NVXH 2PI2A 4BXXH 1CKNB 2EYLA 3K5NA 4DAVA 1U4LA 2AQ2B 4LUZA 1I94Q 2BH2A 5C4JB 2JA5H 4A3JG 4DAPA 2NZHA 1F9QA 1EWHA 4A3MH 4WRDA 2PMZE 5E4XA 3GTGB 3S15B 1IBKQ 3A7AB 1MD2D 3J7A5 2ALYB 2FJ2A 1JCKB 2KJXA 2RDGA 4XQQA 1F9PA 5E1FA 2A73B 4IPGA 5FLMG 1EY7A 1XWEA 2RBMA 3E0EA 4BY7H 2NWGA 1V1PB 1CM9A 1PA6A 1JWMD 5IGEA 4K5XA 1X3PA 4BXXG 3FHWA 3LWUA 5F2DA 4BWGB 4GOPA 3S1QH 3GTMB 1NUCA 2ZT9C 5IGDA 1GUWA 3ULJA 4QF4A 1A2UA 3HP3A 3I2ZA 5FO8B 3K80C 2JA5G 4LF5L 3RMHA 1F2MA 5E4WC 1BCPC 1Y1WH 2X6LA 2JE6I 4A3MG 1Q82C 1PH3A 3FRPB 1CSPA 4B9WA 2L15A 2C5CA 1EY0A 1J9OA 1NMFA 2R7DA 2XIWA 4IPCA 1HNXQ 1DGSA 2M00A 1HFNA 1SRUA 3MXPA 1SDFA 1YJNA 1YNNC 2VB3X 4JOIA 3J80E 5LMNW 4FF3A 1GD7A 4A3IG 4BY7G 2O5JC 1F2YA 1NR4A 2RDFA 2RSNA 1K8GA 1JWUD 2WV6D 4LK1C 4APVA 4DR1L 2B2UC 3ICEA 2CQOA 2RHSB 1LT3D 1UE7A 4RHRA 1EL0A 1YHAA 4JPBW 4QCLA 1TVXA 2MUYA 3PUXA 4PMCA 1B70B 4G7ZC 1SE2A 1M8AA 1SNMA 1XMQL 2N8NA 3OIPA 1EYGA 1E1TA 4DV2L 4WJ3M 1KNEA 1Y1WG 3AU7A 3K58A 3BDCA 1WTWA 4JK1C 2RQXA 1YZ6A 2I46A 3PUYA 1E2VA 2F3IA 1XNRQ 3UI2A 4DK6C 2JA7H 2NBFA 5BN4A 4DR1Q 1FJGL 3QR8A 3F2BA 1NAPA 4A3MB 4FO2A 4EVOA 2MO0A 2YTXA 1A6XA 3D4DA 3BDOA 3PO3H 1YVCA 1EFID 4DV5Q 1PZKD 3EBEA 5CV8A 5M3FH 4KTAA 1XMQQ 4PZ6A 2A68D 1A3UA 3NBHB 2VL6A 3GV3A 2EJMA 1DXMA 1HZ9A 1DYQA 5M3MH 5CYUA 1Y8PB 4A3IB 4BY7B 4KHZA 1PLFA 3VR4A 5HURA 3I4NH 4X66L 4EGVA 1EIGA 5K5PA 5IGBA 2I5LX 3S1QB 3HRZC 4XDXA 2K32A 3K5OA 1Z9FA 3L0OA 2B39A 1JB3A 4F87A 5ELDA 2XNAC 2A5HA 5DM73 5M5YH 2JA7G 1AZPA 4B3SL 3C2PA 1X6OA 1KIXA 2C35B 1TQOA 1Y1WB 1D1KA 5C3WA 2JK8A 1SLJA 2JN4A 3BVZA 3A55A 4OIJA 1ZKOA 2Z6KC 3PO3G 1LTSD 2B2WA 2KENA 4LFAL 4X6AH 4X66Q 1BCPB 2AUKA 5M3FG 4DUZL 3HOYH 2KUMA 3EFXD 4KKTA 2AWOA 1L0WA 5H1SE 5LL6X 3EVQA 4IPHA 5NUCA 5M3MG 5C4ZA 1C0AA 2F0IA 1SJED 1AW7A 4R9WA 4LW1A 1KAWA 3CP0A 3I4NG 2NVYH 1PRTD 2K4KA 1P16A 1B53A 3MZ5A 2H5XA 2IX1A 2K5NA 2K50A 2WFWA 1B9MA 2L12A 2YV5A 5I9OA 3VYUA 1JOKA 4JG2A 1AZQA 3SDZA 3SHLA 4DUZQ 5ISRA 1A63A 4XTCS 2F0FA 4QMGA 2WP8J 3VR2A 2J4XA 1D5MC 3R93A 4HJ8A 4YY3L 3J7YW 1PFSA 3S16H 2I5MX 1B44D 2JA7B 1MSHA 3AQQA 2CW0D 3P20A 5EBDA 1E0BA 4JVZA 4LMQD 1P8LA 3HOYG 2PCFB 1B1ZA 4JI3Q 4DK0A 2B2VA 3M3YH 3PO3B 2PYKA 2KOLA 3P7JA 1BCPF 4ZCKA 1LTBD 1NCVA 4JI2Q 5M3FB 1MSGA 2UUBL 2OCEA 2WACA 1JJ2A 1N32L 1PH8A 1HNWL 4B3ML 5M3MB 2PZTA 1RJTA 2ZXPA 5HGQA 5J3BA 1B3QA 4LUVA 4IFDJ 1RKNA 3I4NB 2Y0SB 3KOJA 5M5XB 2MPMA 2F0PA 2KHIA 2LKVA 2OQ0A 3VR6A 1LT5D 4PQXA 4MTNA 4CDEC 3TDQA 3ONAB 4KY5A 2N88A 1SBBB 3QG1A 3K81C 1VF7A 3X3MA 1CKOA 3DXJC 3I8ZA 5ELOA 2K01A 2TMPA 5M5YB 3NTKA 4YCVA 3NTIA 3J7ZC 1I6VC 3M4QA 2LFNA 5J22A 2ZM6Q 2LXJA 4ZUIA 5CR3A 4HAEA 4Y7NH 3I55A 1KDAA 3EA6A 1U5KA 1PYBA 4LF9Q 1U9RA 3KLSA 2SOBA 1KAAA 3HOYB 4KKSA 1QB5D 3GTKH 4A3CH 2F1MA 3OMCA 4L6TB 4IUTA 4QL5A 1SAPA 4A3LH 4LFCL 5EPKA 4TQUS 2Z4HA 4Y52H 3RLOA 3BVGA 4BBRH 4O42A 1IBML 1FVIA 2DUDA 2L55A 2VNUD 5LMNL 1ZXTA 2XN9C 1ENFA 1NY4A 4MZ9A 4B3TQ 5IIFA 1WTRA 4H44C 1STBA 3CRKC 4AQYQ 1VQLA 2A74C 4ZQ3A 1SNCA 1Y8OB 3AMUA 1FNWA 4FNFA 1Q90A 1Y8NB 4NPSA 4DR5L 1PH6A 2WB1G 1PTOC 1KABA 4YCWA 1C8CA 5KEEA 4GLAC 1ICWA 4A3CG 1V1QA 1VQNA 1S3OA 3DWQA 1BBWA 1VQCA 3D0FA 1PTOH 1RF2D 3J81j 1MGSA 4P2CB 3CCLA 1IW7C 4NP5A 4A3LG 1VQ6A 5ELNA 1BOSA 4LWCA 3DM1A 1N8RC 2EYMA 1Q46A 4JI0L 5C0XJ 1VQBA 4BBRG 1DOKA 3R3OA 4L5RC 3NENA 1DZ1A 3S2HH 1VMPA 3CC7A 3L7ZC 4RGOS 4DV3L 1S40A 1EFWA 2HIVA 2VXWA 4DV6L 1HPCA 1C9OA 1NE3A 5C3XA 1AFPA 1A3VA 5G3LF 2EJGC 2V1CC 1J6QA 4C3HH 3HEJA 4RHSA 3EROA 2EXZA 4GN4B 2Q2TA 1VQFA 1GUOA 4KKUA 1SFOH 4HCSA 3E9IA 1F2ZA 2BA1A 2WB1B 5KNCA 1STAA 4RKBA 1L1OC 1GKHA 1HZCA 3MEHA 1LTTD 1SE8A 5JJZA 3NQTA 3F2DA 2MQHA 2X69A 5IOCA 1I3QH 2P5ZX 1KRTA 1J5EQ 3RNUA 3S2DH 4BBRB 3RZOB 1S5DD 1JICA 1PDQA 1H9SB 3I4MH 1EQTA 2A69D 1VQAA 3T1HL 5I2YA 1PVOA 1GUNA 3GO5A 5EAYA 4C3HG 4K14A 2M9VA 4KJOA 4NXNL 2VUMH 1NNXA 1IYJB 3S1MH 1IKLA 1Q86C 2DJGC 2WB1E 3QOLA 1WTQA 4IPDA 5D3IB 3SGIA 1JOOA 1E1OA 2HIXA 3DEOA 3RN5A 1X9NA 4R4TA 5C4HA 3PF5A 1GO3E 4IQZA 4S3SA 4MIUA 4QJFA 3H94A 3CCMA 2SNSA 1PTOB 1TWHH 4QUFA 1ENAA 1XTDA 2HCIA 5ELFA 3MXUA 4JYAL 4PZ7A 3H3VC 1O7LA 2EY1A 4H13C 2MFIA 2L1BA 4JBKA 2EVBA 3L2PA 2GN5A 3I4MG 2EE1A 2AQ1B 3S2HB 4ZKBB 4RCNA 4O0AA 3PQIA 4X62Q 3L3OC 1CI3M 1AH9A 5AJ3Q 4HIKA 2VUMG 5KRUA 2BE5D 2OXPA 5C4JH 1HUNA 3TZDA 4C3HB 3A5UA 4IUPA 2UUAL 3G7LA 3K8AA 2L11A 1QWYA 1SFOB 4X65Q 3I70A 4U68A 4UP8A 4DPGA 4XT3B 2QILA 1FR3A 1K0RA 3W2DA 3FKIH 5EPLA 1V9PA 4OXPA 3GTGH 4V190 2ATWA 1EWIA 2D9UA 1VF5C 2WAQG 1QZGA 5BR8L 4AH6A 3K7UC 3MFGA 1CQFA 1Z6HA 1PTOF 1G51A 4R4OA 1G291 3HOWB 2M2LA 1N33Q 3C1EA 5I6WA 3BG3A 2MJ8A 5EBCA 1L1OB 1FNUA 4RH6A 3SK5A 3S2DB 4ABNA 2K14A 3NUCA 3U4VA 4HJ9A 3I4MB 1DOLA 2NZOA 2WKDA 4DNTB 1O80A 4RKLA 4X3TA 4X64L 4PMWA 2E2JH 2OTLA 4L5SA 5IWAL 2EXDA 3M7GA 3M4OB 1I6HH 1K73C 2KECA 2NB0A 2VUMB 1KLUD 4CHTB 5BR8Q 2ENBA 4TVAB 1HXYD 2F0WA 3S1MB 4JC0A 2R92H 4WJWA 4K2LA 1G6ZA 4LF7L 2RVLA 1UEBA 1YNJC 3FKIG 1F2LA 1B2TA 3ERSX 5EKKA 1HA5A 1TS4A 4QQBX 2PO4A 2E75C 1SYDA 3A8JE 3IFDA 4X64Q 5FLXE 4IOAA 4B08A 5GAEC 4UDUC 1HZBA 4G7OC 5IWAQ 2K5HA 2WINB 2F4IA 2WAQB 4GKJQ 2F0LA 1QNUA 2IPKD 3HG9A 4LF8L 1GVPA 4NXMQ 4YHHL 1TY0A 4JI7Q 3U58A 4ZAIA 4LF4L 1R4QB 4LF7Q 4HSVA 4LF6L 3MXGA 3GTPH 1VQ9A 1WD1A 2IT1A 4FVMA 3LGJA 1PH2A 1A0IA 4ALPA 2UXDQ 3KBXA 5GADC 2R92G 2B2YA 3NEMA 3CC2A 2EPBA 2E8GA 1STHA 2X6GA 1PMRA 1VQDA 2G5DA 2O4XA 3TS2A 1Y69U 4ZRZA 4KN4C 3BU2A 2KCNA 3VDYA 4XYOA 3TP5A 3FKIB 1PRTC 3HKZG 2MHVA 2WAQE 1PV4A 1CA5A 1G2SA 2O5IC 4AYBB 3CPWA 4OWXB 3U50C 1EEID 1N34L 1S5ED 1X3EA 1HUMA 2N78A 3NXWA 3H0GH 2Q2HA 4A3IH 4KY7A 4KK7A 5JEAJ 3UE0A 4FP5D 3U4ZA 1C7YA 3E9HA 3E6ZX 1WCMB 2DY8A 1IKMA 4BA1I 4IFDH 3SEBA 1XMOL 4OELB 1BBUA 4OIKA 4C3IH 1T5EA 4H0LC 2HHHL 3F2CA 4ODGA 2E2JB 4A3GH 1SNQA 2RKSA 5FO9B 1UWVA 1I6HB 3CCUA 3CAMA 2F0EA 2ZJRA 4P73A 4R1JA 1DD2A 4DV7L 5KIXA 1N34Q 2R92B 1Q81C 4RGTA 3OTOL 2ZTDA 4B3RL 1TIID 3S17B 1PFMA 1VQ5A 5HY6A 2XGTA 1CT1D 1RCVD 2ES2A 4OWWB 5J39A 4NDXA 2K6AA 3W5OA 4XYQA 3K5LA 1U4RA 2LY7A 4WORA 1D2BA 2Q8RE 5KYIA 4A93H 3H0GG 4IUQA 1SE3A 3HKZB 4DN4M 1EIHA 4ZUJA 1VQGA 4A4IA 1X55A 3PIO3 4LF5Q 4FXGC 2F0QA 1CA6A 4IFDG 2B8GA 4DV7Q 4C3IG 5IYDH 4BBSH 1VMCA 2J0TD 4A3GG 4XT1B 1I4GA 3GTPB 3NP8A 3O13A 2NTTA 2QKIC 1K8OA 4DKAC 3TS0A 2VY3A 3F2UA 1SEBD 4MN3A 1SMYC 5FO7B 2BA0A 4C2MH 1XYIA 1JJCB 1KLGD 4DF7A 1Q1BA 5EJWA 4V0BA 3J7AF 4KY6A 3HKZE 4HTHA 2F0DA 4A93G 1EQQA 3MWYW 4IURA 1VQ8A 1Y1VG 2LXKA 2PNRC 5CBEE 1TWFH 4OO1H 2N49A 4FXKC 4K8JA 4WFN3 5KNDA 4DV2Q 2R3ZA 1VQMA 1WTPA 3QJYA 5EKLA 3BYTB 2YTVA 3A0JA 1VCIA 5C0XH 5IYDG 5IP7H 1PRTB 3PO2H 3E0JA 3H0GB 4CDFC 1PZID 1FGUA 4BBSG 1GUGA 1SJHD 2K05A 3H91A 1C48A 5M5XH 3W1GA 2EY5A 1FJGQ 2F0KA 5CV6A 2BDOA 1NBWA 2BCOA 4K6LA 4C3IB 1PXUA 2UU9L 3FVQA 1MHWC 3EIVA 1PH7A 5CMDA 2YU9H 4A3GB 5C5LA 4OONA 2A6EC 1N9WA 2VQFL 2NVQB 2F4VL 4CKEA 1LYLA 1PYWD 5I9PA 2LSSA 4KD3A 2N55A 5IP9G 5GROA 3BYYB 3E5SA 4OO1G 1IYVA 2D5DA 2JA6B 1U4MA 1OXTA 3Q6SA 3NWSA 1HNZL 4ID6A 5C0XG 3RLNA 5IP7G 4A93B 3PO2G 4ZLTF 3NK9A 3KFUA 1Y1VB
chains in the Genus database with same CATH topology
2HDLA 1S5FD 2FMMA 3ND9A 1LABA 3MXNA 2XRQD 1PRTF 3BDLA 1ET9A 1A2TA 4BBSB 3VR3A 4K2KA 3RLFA 5M5WB 1IL8A 4U673 2NN6H 4KMUC 2K33A 4ILWA 4KD4A 4QUCA 3OSOA 4KN7C 4C2MB 3I73A 1B4OA 3IKJA 3D4WA 3CHBD 1ZYRD 1H9RA 5D65A 1TWFB 2DNCA 1G8ZD 1LTRD 3PO2B 1CFMA 1GJXA 2PW7A 4YIJA 1BCPD 4K5VA 5LL6S 1WTOA 4IZ8A 3NSWA 5CV5A 2NN6G 1FNVA 2YU9B 4F7XA 2SNMA 3OIQA 4QB4A 1A3TA 1J8IA 1YNND 2BOSA 1Q3LA 1CZWA 1F77A 3QIAA 3DWPA 3EJIA 2KQ3A 2V4DA 2EY6A 3NPPA 1KDCA 1ZEQX 5FK9C 4XQJA 4KI0A 4N9TA 3K6OA 5A35A 4CGYB 1BR9A 3Q0AA 1TS5A 2Q8TA 3C46A 1SNOA 3NQIA 2B8FA 4DGZA 2AQ3B 1E2WA 2C9OA 1Q1EA 3R2TA 3A8IE 3R8BA 1EY5A 2B2WC 5BN3A 2NUCA 3SVMA 2ID0A 3OWEB 4CJ2C 2F0JA 1QOHA 3C1FA 1TWAB 3M4YA 1H9MA 2KVMA 5DNFA 1ML0D 2G9DA 3CU7A 4B9XA 1KDBA 1PFNA 2L0CA 1ENCA 5T1IA 3A7LA 5EKIA 1TWCB 1I4HA 2WKCA 4R8IA 3I91A 4CJ1B 3ZYYX 4G4KA 1F9RA 2K5WA 4IUUA 4QIWB 1EWCA 4NMZA 1V1PA 3KF8A 2B2TA 1LV9A 3BS1A 4FF2A 3TZUA 2XRSD 1WTXA 3CKIB 4A3DB 3DWAA 4EQOA 1II3A 1K8MA 3OWFA 4NKLA 2TSSA 3MHBA 4J6HA 5G3LD 3QOJA 2B2VC 3M85A 4L63B 3LX0A 4O1NA 5FKAC 3WOFA 2R93B 1QNKA 2CHBD 1UEAB 1DCZA 3DUZA 2F0MA 2ICIA 3S9WA 5ELEA 4IFDI 2E2DC 3RD4A 5I4DA 5CV9A 1TS2A 1Z47A 1XX8A 3QO2A 1EOTA 1LTAD 1EY9A 1SYFA 3A8KE 3IAYA 2QEJC 4OGQC 3HOXB 4A3BB 4CBVA 3ERQA 4HSPA 5DEHA 1W6KA 2DN8A 3IL8A 1SYBA 5BN5A 5JEAG 1ILPA 2CQAA 4M8AA 3WDNA 4TSSA 4DNRB 3SK6A 3A56A 5JPNC 2K1BA 3MAQA 3NBHA 1RTNA 1EQVA 4BA2I 3TSSA 1D5XC 2GA4B 3N52A 4GZYC 1SYCA 1B9NA 5C3EB 3QWNA 3Q22A 1ET6A 2XWJB 5CV4A 3JAML 5CBAE 1SSOA 4RCOA 3HS0C 3ITPA 1BF4A 1TY2A 3NWTA 4HEDA 4DAYA 5C0XI 2F0TA 3X3NA 1QE6A 3T51B 3V2TA 1K83B 1O7YA 2CVRA 2FFKB 3J7AV 3FMCA 4MHEA 4I7ZC 1PTOD 3CQZB 3URYA 4DXGA 2F3VA 2ZXOA 3TP8A 3K59A 1JORA 3T56B 1EYAA 1JWSD 3M7NA 4CKBA 2B2UA 1IW7D 5JPMC 3C3LA 3D6WA 2A68C 2B63B 1HCZA 2F0SA 1VDZA 2E2HB 1LO5D 1EY8A 4KJNA 3VYTA 2IW3A 1I4XA 1Z7TA 1TT2A 1V8QA 3KLSX 5KNBA 3GD7A 4R8NA 2A6HD 2HUGA 2J7ZA 3GV6A 3TP6A 5EPJA 1SYEA 2YYZA 2PW5A 3KK7A 1RHPA 2HQEA 2K5DA 4DA2A 1OO9B 3P1HA 3TMEA 2LS01 2NVTB 1ESRA 5EQ0A 3H6MA 4F8MA 3OPOA 1EU3A 1QG7A 3KUPA 1L0XB 2F03A 2L9HA 5D14A 2XVSA 4DK1A 1U4PA 4CJ0B 1R9TB 5DM63 4HN7A 3FEWX 4EQNA 2G9HD 4OL7A 4HCEA 4Q5VA 2EY2A 3D31A 3RUZA 2CW0C 2HDMA 3BZDB 1SE4A 4BS9A 1SXTA 5KGUA 1HRJA 3GTJB 3SXHA 2IJ0A 1ZYRC 5TSSA 2OF1A 1HQMC 1XTCD 1W6JA 2R7ZB 4KHVA 1ESFA 4IUVA 1S5CD 3D4RA 2MGSA 2JYOA 1JOQA 1E2ZA 2F3WA 4IUNA 4FF4A 1O7ZA 1AN8A 2EYHA 3VA7A 1EYCA 5FOBB 4A3JB 3K0YA 1B3AA 1GOZA 3JAME 2EJFC 3PV0A 2RDHA 5T1GA 5IGCA 3OHXC 2JEAI 5EGTA 1Q8IA 2JA8B 3GTLB 1NR2A 4CKCA 1O78A 3DEPA 2QDBA 3V05A 5KYLA 2NVXB 4KV6A 1TKWB 2H4OA 3G6JB 2F0UA 2R6GA 1CTMA 1WVLA 2PZUA 4EQPA 1WD0A 1GXDC 3Q23A 2JA5B 4IN3A 1LTID 4J1MA 2DY7A 2NYZD 1CK1A 2AWNA 3GQBA 4IALA 1FD7D 3ND8A 1YNJD 2B2YC 2Z8LA 1DONA 1H9SA 3Q24A 1IHZA 2H1EA 3QB3A 3LNNA 2FINB 1H9JA 4F88A 4A3EB 4E6IA 1CQVA 3HGBA 3T53B 1OXSC 3I3CA 1DOMA 1LTGD 2PQEA 2JEBI 1TR5A 3SE0A 4RAUC 3FDTA 4HR7B 4HMIA 3PMFA 4PMBA 2EYFA 3FPPA 5JAVA 1DM0B 1HA6A 5JOBA 1GUTA 4TKOB 2NTSA 3GTQB 4OHJA 4G7HC 3KBGA 1MI2A 3S1RB 1FYCA 1EY6A 3SK4A 1QILA 1CHPD 2SEBD 5A2QL 5C6AA 1STNA 3D8GA 4RGNA 2MP1A 1XXGA 1BXTA 3PUZA 3KLRA 2IX0A 5IGFA 4L8JA 2A69C 5I6YA 4PV1C 3HOUB 2KHSA 4Z9CB 1STEA 1TWGB 2EYOA 2KEDA 3K5MA 1LT6D 1X32A 5JVH3 1LT4D 3TBIB 1CHQD 4LAAA 3MVVA 3DMUA 1L0YB 3T16A 3BVMA 1BUVT 2L4NA 4DXFA 3MTSA 1RODA 2HCCA 3HZXA 3I90A 4FXDA 1HTPA 1OXUA 2QCPX 2K5QA 3U9OA 1JE4A 1AP0A 3NHHA 5M9OA 4C1NK 2E2IB 3GTOB 1AEXA 2DNEA 4RWSC 1GUSA 2PPBC 1BBXC 1Q12A 1HQRD 3CRLC 4X3SA 2D62A 2OT2A 1JR0D 1LACA 1QCBD 2BE5C 3D6CA 2PZWA 2IL8A 2F0HA 2RA4A 3I4LA 2E74C 1SMYD 5CGKA 5D3DA 3N6RA 3K7AB 1A15A 1D6EC 1EYDA 1C4QA 1G91A 4K5WA 4N9PA 3J81L 4XIGS 1EY4A 1EU4A 3PUWA 4RGMA 2NVYB 2K04A 3VA5A 5IT9L 1I4PA 4ZYSA 1BO0A 1I4QA 4UAIA 3PUVA 3RZDB 3HOVB 1KNAA 4I65A 2VB2X 3EQLC 4RFBA 2OEOA 3FPUB 4J8QA 4A3KB 3S16B 4ME5A 4X3KA 1UAPA 2A6ED 3L9AX 2K7VA 3LWEA 3SR1A 2K28A 3M3YB 3P75A 4DU9A 2AUJD 2XWBB 2K03A 2L5TA 3MA2B 1HHVA 3H09A 3NE5B 4ULLA 1S5BD 1T5XD 3OW7A 5E3FA 5C5MA 2RSOA 1BNZA 5FLXL 1GHKA 4RA8A 1UUPA 2SDFA 4HMJA 5IODA 1QJOA 3V96A 5I2XA 1TU2B 1EEFD 5C4XB 4H7BA 1D1IA 1HTLD 2A6HC 3W3AA 3D3RA 4TRDA 4PNYA 5JEAH 4Y7NB 2D2CC 5A2QE 1H9KA 1I50B 5AFWA 4C1NI 3GTKB 4XXEA 1RTOA 3IFTA 1MBYA 3T4AC 2EZVA 1CZGA 1PFBA 1WTVA 1STYA 5J1ZA 2JP1A 5ELCA 2KA7A 1FGBD 2EYJA 3T13A 2F0NA 1EZ6A 3MC0B 1PZJD 1V43A 1DJRD 2F0OA 3VYRA 3AB9A 1RD9D 3S14B 5C44B 2JXMB 4DFAA 3OOCA 4NW2A 2O2LD 4Q0FA 2ICEC 4K6DA 2Q8IB 1BQQT 1S4ZA 5CC4A 3R2IA 2R61A 3GP7A 1LLRD 5CV7A 2QF7A 5JVG3 2NZ1D 2LMCB 5HGTA 1B50A 4BY1B 3TP7A 4K8IA 3TN2A 2F0GA 1IYUA 3J80L 2FMCA 3OMGA 4OO1I 3K57A 4C56C 5IGGA 2Z4IA 4JBWA 2FHTA 3HOZB 1ONLA 2JSOA 1KTKA 1OXXK 2E76C 3VYSA 5K36H 3NTHA 4C3JG 3S1NB 2I07B 3J81E 1RDPD 3WOEA 2EOTA 1G2TA 1BDOA 1SNPA 4LJZC 4G57A 1JQYD 2KEEA 4M1UB 4X3UA 5IT9E 2B2TC 1OXVA 2F0VA 1TS3A 1I4RA 1M4VA 3MFYA 1V1OA 3I72A 1GHJA 1ILQA 1I3QB 1D5ZC 2KCCA 2XSCA 4A3FB 4FYDA 5DAUA 1SYGA 3VR5A 2Z1CA 4FF1A 1UNSA 3U9SA 4ZK9B 3NBIA 3A54A 3SK8A 5K36G 1HFGA 1SNDA 5LHY1 2WIIB 3DHQA 5CORA 2BDNA 4C3JB 3PIP3 2ZXRA 5ELBA 2IWHA 2EDGA 1F9SA 4ZKCB 2NN6I 1TWHB 1STGA 2PMZB 5COYA 1R4PB 1X3QA 4XQNA 1NSNS 2EYPA 1EZ8A 2IX3A 1JC7A 2EYLA 3K5NA 4DAVA 1U4LA 2AQ2B 5C4JB 4DAPA 1F9QA 1EWHA 4WRDA 5E4XA 3GTGB 3S15B 3A7AB 1MD2D 2FJ2A 1JCKB 2KJXA 2RDGA 4XQQA 1F9PA 5E1FA 2A73B 1EY7A 1XWEA 2RBMA 2NWGA 1V1PB 1CM9A 1JWMD 5IGEA 4K5XA 1X3PA 3LWUA 5F2DA 4BWGB 3GTMB 1NUCA 2ZT9C 5IGDA 1GUWA 4QF4A 1A2UA 3HP3A 5FO8B 3RMHA 1F2MA 5E4WC 1BCPC 2X6LA 2JE6I 3FRPB 4B9WA 2C5CA 1EY0A 1J9OA 2XIWA 2M00A 1HFNA 3MXPA 1SDFA 1YNNC 2VB3X 3J80E 4FF3A 2O5JC 1F2YA 1NR4A 2RDFA 2RSNA 1JWUD 2WV6D 4LK1C 2B2UC 1LT3D 4RHRA 1EL0A 4QCLA 1TVXA 2MUYA 3PUXA 4PMCA 4G7ZC 1SE2A 1M8AA 1SNMA 3OIPA 1KNEA 3AU7A 3K58A 3BDCA 1WTWA 4JK1C 2RQXA 3PUYA 2I46A 1E2VA 3UI2A 2NBFA 5BN4A 1NAPA 4A3MB 4FO2A 4EVOA 1A6XA 3D4DA 3BDOA 1EFID 1PZKD 5CV8A 4KTAA 2A68D 1A3UA 3GV3A 2EJMA 1DXMA 1DYQA 5CYUA 1Y8PB 4A3IB 4BY7B 4KHZA 1PLFA 3VR4A 5HURA 4EGVA 1EIGA 5K5PA 5IGBA 3S1QB 3HRZC 4XDXA 2K32A 3K5OA 2B39A 1JB3A 4F87A 5ELDA 2XNAC 2A5HA 5DM73 1AZPA 3C2PA 1TQOA 1Y1WB 1D1KA 5C3WA 3BVZA 3A55A 4OIJA 1ZKOA 1LTSD 2B2WA 1BCPB 2AUKA 2KUMA 3EFXD 4KKTA 2AWOA 5LL6X 3EVQA 5NUCA 5C4ZA 2F0IA 1SJED 1AW7A 4R9WA 1PRTD 1B53A 3MZ5A 2IX1A 1B9MA 2L12A 5I9OA 3VYUA 1JOKA 1AZQA 3SDZA 3SHLA 5ISRA 4XTCS 2F0FA 4QMGA 2WP8J 3VR2A 2J4XA 1D5MC 3R93A 3J7YW 1B44D 2JA7B 1MSHA 2CW0D 3P20A 5EBDA 1E0BA 4LMQD 2PCFB 1B1ZA 4DK0A 2B2VA 3PO3B 2PYKA 2KOLA 3P7JA 1BCPF 1LTBD 1NCVA 5M3FB 1MSGA 2WACA 5M3MB 2PZTA 1RJTA 2ZXPA 4IFDJ 1RKNA 3I4NB 2Y0SB 5M5XB 2MPMA 2F0PA 2LKVA 3VR6A 1LT5D 4PQXA 3TDQA 3ONAB 4KY5A 2N88A 1SBBB 3QG1A 1VF7A 3X3MA 3DXJC 3I8ZA 2K01A 2TMPA 5M5YB 3NTKA 3NTIA 1I6VC 2LFNA 5J22A 4ZUIA 5CR3A 4HAEA 1KDAA 3EA6A 1U9RA 3KLSA 2SOBA 1KAAA 3HOYB 4KKSA 1QB5D 2F1MA 3OMCA 4L6TB 4IUTA 1SAPA 5EPKA 4TQUS 2Z4HA 3BVGA 4O42A 2L55A 2VNUD 1ZXTA 2XN9C 1ENFA 5IIFA 1WTRA 4H44C 1STBA 3CRKC 2A74C 4ZQ3A 1SNCA 1Y8OB 3AMUA 1FNWA 4FNFA 1Q90A 1Y8NB 1PTOC 1KABA 1C8CA 5KEEA 1ICWA 3DWQA 1PTOH 1RF2D 1MGSA 4P2CB 1IW7C 4NP5A 1BOSA 3DM1A 2EYMA 5C0XJ 1DOKA 3R3OA 1DZ1A 1VMPA 3L7ZC 4RGOS 2VXWA 1HPCA 5C3XA 1AFPA 1A3VA 5G3LF 2EJGC 3HEJA 4RHSA 3EROA 2EXZA 1GUOA 4KKUA 4HCSA 1F2ZA 2BA1A 2WB1B 5KNCA 1STAA 4RKBA 3MEHA 1LTTD 5JJZA 3NQTA 2X69A 5IOCA 4BBRB 3RZOB 1S5DD 1JICA 1PDQA 1H9SB 1EQTA 2A69D 5I2YA 1GUNA 3GO5A 4C3HG 4K14A 2M9VA 4KJOA 1IKLA 3QOLA 1WTQA 5D3IB 1JOOA 3DEOA 5C4HA 4IQZA 4S3SA 4MIUA 3H94A 2SNSA 1PTOB 4QUFA 1ENAA 2HCIA 5ELFA 3MXUA 3H3VC 1O7LA 2EY1A 4H13C 2L1BA 2EVBA 2EE1A 2AQ1B 3S2HB 4ZKBB 4RCNA 3L3OC 1CI3M 5KRUA 2BE5D 2OXPA 1HUNA 3TZDA 4C3HB 4IUPA 3G7LA 2L11A 1QWYA 1SFOB 3I70A 4U68A 4XT3B 2QILA 1FR3A 3W2DA 5EPLA 4V190 2D9UA 1VF5C 3MFGA 1CQFA 1Z6HA 1PTOF 1G291 3HOWB 2M2LA 3C1EA 5I6WA 3BG3A 2MJ8A 5EBCA 1FNUA 4RH6A 3SK5A 3S2DB 4ABNA 3NUCA 3I4MB 1DOLA 2WKDA 4DNTB 1O80A 4RKLA 4X3TA 4PMWA 3M7GA 3M4OB 2KECA 2NB0A 2VUMB 1KLUD 4CHTB 2ENBA 1HXYD 2F0WA 3S1MB 4WJWA 4K2LA 1G6ZA 2RVLA 1YNJC 1F2LA 1B2TA 5EKKA 1HA5A 1TS4A 2PO4A 2E75C 1SYDA 3A8JE 3IFDA 5FLXE 4B08A 4UDUC 4G7OC 2WINB 2F4IA 2WAQB 2F0LA 1QNUA 2IPKD 3HG9A 1TY0A 4ZAIA 1R4QB 4HSVA 3MXGA 1WD1A 2IT1A 4FVMA 3KBXA 2B2YA 2EPBA 1STHA 2X6GA 1PMRA 2O4XA 1Y69U 4ZRZA 4KN4C 2KCNA 4XYOA 3TP5A 3FKIB 1PRTC 2MHVA 1CA5A 2O5IC 1G2SA 4AYBB 1EEID 1S5ED 1HUMA 3NXWA 4KY7A 4KK7A 5JEAJ 4FP5D 3E6ZX 1WCMB 2DY8A 1IKMA 4BA1I 4IFDH 3SEBA 4OIKA 1T5EA 4H0LC 4ODGA 2E2JB 1SNQA 2RKSA 5FO9B 1I6HB 2F0EA 1DD2A 5KIXA 2R92B 4RGTA 1TIID 3S17B 1PFMA 1CT1D 1RCVD 5J39A 4NDXA 2K6AA 4XYQA 3K5LA 1U4RA 2LY7A 4WORA 1D2BA 2Q8RE 5KYIA 4IUQA 4DN4M 1SE3A 3HKZB 1EIHA 4ZUJA 3PIO3 4FXGC 2F0QA 1CA6A 4IFDG 2B8GA 4C3IG 1VMCA 2J0TD 4XT1B 1I4GA 3GTPB 3NP8A 3O13A 2NTTA 2QKIC 1K8OA 3F2UA 1SEBD 4MN3A 1SMYC 5FO7B 2BA0A 1XYIA 1KLGD 4DF7A 1Q1BA 5EJWA 4V0BA 3J7AF 4KY6A 4HTHA 2F0DA 3MWYW 4IURA 5CBEE 2PNRC 4OO1H 4FXKC 4K8JA 4WFN3 5KNDA 2R3ZA 1WTPA 3QJYA 5EKLA 3BYTB 1VCIA 5C0XH 1PRTB 3E0JA 3H0GB 1PZID 1GUGA 1SJHD 2K05A 3H91A 1C48A 2EY5A 2F0KA 5CV6A 2BDOA 2BCOA 4K6LA 4C3IB 1PXUA 3FVQA 5CMDA 4A3GB 5C5LA 2A6EC 2NVQB 4CKEA 1PYWD 5I9PA 4KD3A 2N55A 3BYYB 3E5SA 4OO1G 1IYVA 2D5DA 2JA6B 1U4MA 1OXTA 3Q6SA 3NWSA 4ID6A 5C0XG 4A93B 4ZLTF 3NK9A 1Y1VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB3 A;  5KYI A;  5CV9 A;  5IGG A;  5KEE A;  5KGU A;  4ZUJ A;  3SXH A;  2SNS A;  3U9O A;  2F3V A;  3NHH A;  5M9O A;  3TP8 A;  1ENA A;  4HMJ A;  1AEX A;  5IOD A;  1JOR A;  1SNO A;  2F0Q A;  3BDL A;  2F0L A;  4E6I A;  1EYA A;  4NP5 A;  4EVO A;  1A2T A;  2EY1 A;  1EY9 A;  4H7B A;  2PYK A;  1IHZ A;  4WRD A;  3D4D A;  1SYF A;  2PQE A;  4DGZ A;  2EYM A;  2OF1 A;  1TR5 A;  4K2K A;  3NP8 A;  3R3O A;  5CV8 A;  2WAC A;  4KTA A;  1SNP A;  4TRD A;  4PNY A;  4G57 A;  1A3U A;  4HMI A;  2F0S A;  1EY5 A;  3PMF A;  4KHV A;  3ERQ A;  2PZT A;  4KD4 A;  5DEH A;  4PMB A;  3OSO A;  3D6C A;  2PZW A;  2EYF A;  2F0H A;  2NUC A;  2F0V A;  5C3X A;  5KRU A;  1JOQ A;  5JAV A;  1RKN A;  1EY8 A;  2F3W A;  4IUN A;  4KJN A;  5E1F A;  5JOB A;  5CGK A;  2OXP A;  2F0J A;  5HUR A;  1EY7 A;  2RBM A;  1A3V A;  1STH A;  2F0P A;  2LKV A;  5DAU A;  2EYH A;  3C1F A;  5K5P A;  1EYC A;  4DF7 A;  5IGB A;  1SYB A;  2O4X A;  3D4W A;  4KY5 A;  4S3S A;  1STY A;  1EYD A;  5IGE A;  3HEJ A;  4K5X A;  4KY6 A;  4K5W A;  5F2D A;  1TT2 A;  2EXZ A;  1SYG A;  3ERO A;  1NUC A;  2F0D A;  4HTH A;  4N9P A;  4R8N A;  1KDB A;  5J1Z A;  4B9X A;  4WOR A;  3TP5 A;  1EY4 A;  2EYJ A;  1ENC A;  5IGD A;  3SK6 A;  5IGC A;  4K8J A;  2F0N A;  5EGT A;  4QF4 A;  3T13 A;  1A2U A;  3TP6 A;  1EZ6 A;  1EY6 A;  1SYE A;  1F2Z A;  3VA5 A;  5J22 A;  1TQO A;  5EKL A;  2PW5 A;  3SK4 A;  4ZUI A;  1F2M A;  5C3W A;  1STA A;  2PW7 A;  5CR3 A;  1EQV A;  2HQE A;  1KDA A;  4RKB A;  2F0O A;  3SK8 A;  5C6A A;  4YIJ A;  4B9W A;  3NXW A;  1U9R A;  4K5V A;  2SOB A;  1SND A;  3P1H A;  4DFA A;  1STN A;  3MEH A;  4KY7 A;  1KAA A;  2QDB A;  3C1E A;  1EY0 A;  3D8G A;  3NQT A;  4NMZ A;  4IZ8 A;  2EY5 A;  5I6W A;  3TME A;  2F0K A;  3OMC A;  1SYC A;  3DHQ A;  5CV6 A;  5KYL A;  5CV5 A;  4KV6 A;  2M00 A;  4I65 A;  5IOC A;  5CV4 A;  4K6D A;  3SK5 A;  3MXP A;  2OEO A;  3H6M A;  3EVQ A;  3NUC A;  4F8M A;  4F7X A;  4EQO A;  5IGF A;  2SNM A;  1II3 A;  4ME5 A;  5NUC A;  2F0U A;  4ODG A;  4QB4 A;  1A3T A;  2F0I A;  3OWF A;  4RKL A;  5C5L A;  5C4Z A;  5CC4 A;  1SNQ A;  2PZU A;  2RKS A;  3ITP A;  4NKL A;  3MHB A;  2KHS A;  4J6H A;  5I6Y A;  4EQP A;  1F2Y A;  2RDF A;  2F0E A;  3QOJ A;  1STG A;  2EYO A;  3SR1 A;  3LX0 A;  5I9P A;  3EJI A;  2F0T A;  4K14 A;  2KQ3 A;  4KD3 A;  5CV7 A;  5KIX A;  3MZ5 A;  3P75 A;  4KJO A;  4J1M A;  3V2T A;  4DU9 A;  2ENB A;  2F0W A;  5IIF A;  1NSN S;  5HGT A;  4LAA A;  3MVV A;  3TP7 A;  1STB A;  4K8I A;  2EY6 A;  4MIU A;  3E5S A;  2EYP A;  2F0M A;  4PMC A;  1EZ8 A;  3DMU A;  4K2L A;  1JOK A;  1KDC A;  5I9O A;  3S9W A;  1SNM A;  3QOL A;  2F0G A;  4ZQ3 A;  1SNC A;  3SHL A;  4OL7 A;  4IAL A;  3T16 A;  4EQN A;  5ISR A;  2F0F A;  5J39 A;  4QMG A;  4NDX A;  2EY2 A;  1JOO A;  4N9T A;  4ID6 A;  5E3F A;  5EKK A;  3RUZ A;  5C4H A;  1KAB A;  2EYL A;  3BDC A;  5C5M A;  3NK9 A;  3OMG A;  3HZX A;  1SYD A; 
#chains in the Genus database with same CATH topology
 1X54 A;  4RG1 A;  2PQA A;  2HDL A;  2Y0S G;  4P74 A;  1M1K C;  1S5F D;  1BKB A;  2FMM A;  3ND9 A;  4B3S Q;  1QVF A;  3RR5 A;  1HJP A;  1G6P A;  1LAB A;  3MXN A;  2XRQ D;  4GOP C;  1PRT F;  1QUQ B;  3BDL A;  2I0Q A;  4OX9 L;  1ET9 A;  1A2T A;  4BBS B;  3STB C;  3VR3 A;  3KDF A;  4DV0 L;  4UHV A;  4JI8 L;  3M9B A;  3CPF A;  4LFA Q;  4K2K A;  3RLF A;  5M5W B;  1IL8 A;  3AYH B;  1W3S A;  4U67 3;  2NN6 H;  4KMU C;  2K33 A;  4ILW A;  4KD4 A;  4QUC A;  3OSO A;  4KN7 C;  4DUY L;  4C2M B;  1M90 C;  3I73 A;  1CKM A;  1B4O A;  3NEL A;  3IKJ A;  4JOI C;  3D4W A;  1TWA H;  4LNQ A;  3CHB D;  1ZYR D;  1H9R A;  2CH4 A;  5D65 A;  4DV0 Q;  1TWF B;  4JI8 Q;  2DNC A;  1G8Z D;  1LTR D;  1HR0 W;  3PO2 B;  1CFM A;  1GJX A;  1E24 A;  2PW7 A;  1TWC H;  4YY3 Q;  4DUY Q;  2GVA A;  4YIJ A;  1BCP D;  4K5V A;  5LL6 S;  1WTO A;  4IZ8 A;  3NSW A;  5CV5 A;  2NN6 G;  1FNV A;  2YU9 B;  1E7Z A;  4F7X A;  1JMC A;  2SNM A;  3OIQ A;  4QB4 A;  1A3T A;  2QEX A;  2UUB Q;  1J8I A;  1YNN D;  2BOS A;  1N32 Q;  1Q3L A;  1CZW A;  2Q2I A;  1F77 A;  1HNW Q;  4LFB L;  4CDC C;  4B3M Q;  1U0L A;  1NMG A;  3QIA A;  3DWP A;  3EJI A;  2KQ3 A;  4POF A;  1PH9 A;  4GNX A;  2R93 H;  2V4D A;  2EY6 A;  3NPP A;  1KDC A;  1ZEQ X;  5FK9 C;  4XQJ A;  4KI0 A;  4N9T A;  4JBM A;  2Y0S E;  3RZO H;  3K6O A;  4DV1 L;  5A35 A;  3KF6 A;  1ASZ A;  4CGY B;  3G6E A;  1BR9 A;  3Q0A A;  2Z6B A;  4LFB Q;  1TS5 A;  2Q8T A;  3C46 A;  1SNO A;  2PI2 E;  2AMC B;  3NQI A;  2B8F A;  2UXC L;  3RN2 A;  4UP7 A;  4DGZ A;  2AQ3 B;  4GOP B;  1X65 A;  1E2W A;  2C9O A;  1Q1E A;  3R2T A;  3A8I E;  3R8B A;  1EIF A;  1EY5 A;  4LFC Q;  2B2W C;  2HQL A;  4A3B H;  5BN3 A;  1KHI A;  2NUC A;  1AE2 A;  3SVM A;  2OQK A;  2R93 G;  2ID0 A;  3OWE B;  1IBM Q;  4CJ2 C;  2F0J A;  5LMN Q;  1QOH A;  1I5F A;  3C1F A;  1TWA B;  3M4Y A;  1H9M A;  2KVM A;  5DNF A;  3OW2 A;  1ML0 D;  2G9D A;  3CU7 A;  2UXC Q;  2D0P A;  4B9X A;  1YBY A;  3G71 A;  1KDB A;  1PFN A;  2L0C A;  3UDI A;  1ENC A;  5T1I A;  1MJE A;  3A7L A;  5EKI A;  2IY5 B;  3JAM c;  3CMA A;  4DR5 Q;  1TWC B;  1JE5 A;  1I4H A;  2WKC A;  4R8I A;  3I91 A;  4CJ1 B;  3ZYY X;  4G4K A;  1ICF B;  3IRB A;  1F9R A;  2K5W A;  2E5L L;  4IUU A;  4QIW B;  1EWC A;  3KJO A;  4NMZ A;  1V1P A;  3KF8 A;  2B2T A;  1LV9 A;  3BS1 A;  2ASB A;  4FF2 A;  3TZU A;  2XRS D;  1WTX A;  3CKI B;  2N3S A;  5C3E H;  4A3B G;  4A3D B;  4IJL A;  3DWA A;  4EQO A;  4JI0 Q;  1II3 A;  4EX5 A;  1K8M A;  2UXB L;  3OWF A;  1RIP A;  3ER0 A;  4NKL A;  2TSS A;  3MHB A;  4J6H A;  2AKW B;  5G3L D;  3QOJ A;  4DV3 Q;  2B2V C;  3M85 A;  3UDG A;  4L63 B;  3LX0 A;  4O1N A;  3OYY A;  4DV6 Q;  5FKA C;  3F8T A;  2MNA A;  4DR7 L;  1KC8 C;  3WOF A;  2R93 B;  1QNK A;  1K83 H;  2CHB D;  1K8A C;  1UEA B;  1DCZ A;  3DUZ A;  2F0M A;  2ICI A;  3HOW H;  3S9W A;  1XPO A;  5ELE A;  4P71 A;  1IBL L;  4IFD I;  2E2D C;  4DAM A;  4HIM A;  3RD4 A;  4QIW E;  5I4D A;  5CV9 A;  1TS2 A;  1Z47 A;  3FP9 A;  1XX8 A;  3DM3 A;  3CQZ H;  3QO2 A;  1CUK A;  4KHP L;  1EOT A;  1LTA D;  2QDL A;  3M4O H;  5DLQ E;  5C3E G;  4R4C A;  1EY9 A;  3K0X A;  1SYF A;  4K0K L;  3A8K E;  3CC4 A;  3IAY A;  4JV5 L;  4P72 A;  2BH8 A;  2QEJ C;  4OGQ C;  1IBL Q;  3HOX B;  3T1Y L;  4A3B B;  4JI5 L;  2B63 H;  4CBV A;  3ERQ A;  1KQS A;  1YHB A;  4HSP A;  5DEH A;  2E2H H;  1W6K A;  3T1H Q;  2DN8 A;  3HOW G;  1TXY A;  4KHP Q;  4JI4 L;  4JW0 A;  3IL8 A;  1SYB A;  4NXN Q;  5BN5 A;  5JEA G;  1ILP A;  2CQA A;  2VQE L;  4JBJ A;  4M8A A;  3WDN A;  3JC6 6;  4TSS A;  3PCO B;  4DNR B;  3SK6 A;  3H3V H;  3A56 A;  5JPN C;  1QZH A;  5JJK A;  2K1B A;  3MAQ A;  1D8L A;  3NBH A;  3PIP A;  1RTN A;  3T1Y Q;  4JI5 Q;  1VQJ A;  1EQV A;  3MXN B;  4BA2 I;  3TSS A;  4A75 A;  1XJV A;  4DR6 L;  1D5X C;  3J81 i;  1HR0 L;  2GA4 B;  3N52 A;  3Q8D A;  4GZY C;  1SYC A;  4JYA Q;  1B9N A;  5C3E B;  3QWN A;  3Q22 A;  1ET6 A;  2XWJ B;  5CV4 A;  2B63 G;  3JAM L;  5CBA E;  1SSO A;  2EQS A;  4RCO A;  1B8A A;  1PHJ A;  1XPU A;  3HS0 C;  3ITP A;  4JI6 L;  1BF4 A;  1TY2 A;  2A8V A;  3NWT A;  4HED A;  4DAY A;  5C0X I;  2F0T A;  3X3N A;  1R9T H;  1QE6 A;  3T51 B;  3V2T A;  1K83 B;  1O7Y A;  2CVR A;  5IYB H;  4I7A A;  1PH5 A;  2FFK B;  3J7A V;  3FMC A;  1RL2 A;  4MHE A;  2EIF A;  2UUA Q;  1WCM H;  4DR4 L;  4DR3 L;  4GKK L;  2KBN A;  4I7Z C;  1PTO D;  3CQZ B;  2JJQ A;  3F1Z A;  3URY A;  4DXG A;  2F3V A;  2ZXO A;  4J15 A;  3TP8 A;  2YTY A;  3K59 A;  1JOR A;  3T56 B;  1EYA A;  1JWS D;  3M7N A;  2QW7 A;  4CKB A;  3CCJ A;  4WJ4 A;  2B2U A;  1IW7 D;  5JPM C;  3C3L A;  1VQO A;  3D6W A;  1FL0 A;  3TEH B;  2A68 C;  2CWA A;  3S17 H;  2B63 B;  1HCZ A;  4AYB G;  2R7Z H;  2F0S A;  4H02 A;  1VDZ A;  1EIY B;  4DR4 Q;  2E2H B;  1X56 A;  5IYB G;  3ZJY C;  1LO5 D;  3AFP A;  1EY8 A;  3G48 A;  4KJN A;  3VYT A;  1WCM G;  2IW3 A;  3UDF A;  3ULP A;  2RCN A;  1VQ4 A;  1I4X A;  4DV4 L;  1Z7T A;  1TT2 A;  1V8Q A;  3KLS X;  4R8N A;  3GD7 A;  5E7N A;  5KNB A;  1YJ9 A;  1X3G A;  2A6H D;  2HUG A;  2AHO B;  1LUZ A;  2J7Z A;  3GV6 A;  1I94 L;  4JCV E;  3TP6 A;  5EPJ A;  4GN5 A;  1SYE A;  2YYZ A;  2PW5 A;  3KK7 A;  2JA8 H;  1RHP A;  2HQE A;  2K5D A;  4DA2 A;  4R4I A;  1OO9 B;  2DJF C;  3P1H A;  3TME A;  2LS0 1;  2NVT B;  3CW2 C;  1ESR A;  4LF8 Q;  2R7Z G;  5EQ0 A;  1IBK L;  3H6M A;  4F8M A;  4YHH Q;  3OPO A;  4LF4 Q;  1EU3 A;  1QG7 A;  2HT1 A;  3KUP A;  1L0X B;  4LF6 Q;  2VZA A;  2F03 A;  2L9H A;  5D14 A;  2XVS A;  4DK1 A;  1U4P A;  2D0O A;  1WI5 A;  4CJ0 B;  1R9T B;  1VQE A;  1CSQ A;  5DM6 3;  5JJI A;  1IL2 A;  5JJL A;  4HN7 A;  3FEW X;  2G9H D;  4GN3 B;  4EQN A;  5GAG C;  4OL7 A;  1X3F A;  2Z6K A;  1OTC A;  4HCE A;  4Q5V A;  2EY2 A;  3D31 A;  2JA8 G;  3RUZ A;  2CW0 C;  2HDM A;  2FXQ A;  4QY7 A;  3BZD B;  1SE4 A;  4BS9 A;  1SXT A;  5KGU A;  1HRJ A;  3GTJ B;  3SXH A;  2NVQ H;  3CCE A;  2IJ0 A;  2OWO A;  1HZA A;  2R7F A;  5LMU L;  3KF8 B;  1ZYR C;  1HNX L;  3JAM i;  4A3E H;  3J80 i;  4LUO A;  5TSS A;  2OF1 A;  4YCU A;  4AYB E;  1HQM C;  1K0S A;  1XTC D;  2JA6 H;  1W6J A;  4IJH A;  1YEZ A;  2R7Z B;  1MKH A;  3MEF A;  1KRS A;  1XMO Q;  1VQI A;  4KHV A;  2HHH Q;  1ESF A;  4IUV A;  1S5C D;  3D4R A;  4MTK A;  2MGS A;  2JYO A;  1JOQ A;  1E2Z A;  1Y1V H;  2F3W A;  1IZ6 A;  4IUN A;  4FF4 A;  1O7Z A;  3B6Y A;  3HFZ B;  1VQK A;  1AN8 A;  2EYH A;  1MJC A;  3VA7 A;  1EYC A;  5FOB B;  1IXR A;  5LMU Q;  4A3J B;  1N36 L;  1SRO A;  3OTO Q;  3K0Y A;  3GTQ H;  4B3R Q;  1PYS B;  1B3A A;  1GOZ A;  3JAM E;  2EJF C;  3PV0 A;  2RDH A;  2ZJP A;  5T1G A;  5IGC A;  3OHX C;  5M5W H;  2JEA I;  4L5T A;  5EGT A;  2DGY A;  3S1R H;  1XNR L;  1Q8I A;  2JA8 B;  2KCM A;  4UY8 C;  3GTL B;  2KCT A;  4JI1 L;  4A3E G;  3CF5 A;  4YWK A;  1NR2 A;  4CKC A;  1YIT A;  1VQH A;  1O78 A;  3DEP A;  4HIO A;  4OEM B;  2QDB A;  3V05 A;  2JA6 G;  1WTH A;  4DV5 L;  5KYL A;  2NVX B;  4KV6 A;  1N36 Q;  2XTI A;  1TKW B;  5IP9 H;  1UE5 A;  2H4O A;  1JT8 A;  2QA4 A;  3G6J B;  3GDE A;  2F0U A;  2R6G A;  1KXL A;  1CTM A;  1WVL A;  3CME A;  2PZU A;  2CH4 W;  4GLX A;  4KLK A;  4EQP A;  1WD0 A;  3HOU H;  3G4S A;  1GXD C;  3Q23 A;  2JA5 B;  4IN3 A;  1TWG H;  1XPR A;  1LTI D;  1E3P A;  4JI1 Q;  2CKZ B;  4J1M A;  2DY7 A;  3A74 A;  2NYZ D;  1CK1 A;  1YI2 A;  2AWN A;  3GQB A;  4IAL A;  1FD7 D;  3ND8 A;  4MNO A;  1YNJ D;  2B2Y C;  2Z8L A;  1DON A;  1H9S A;  3Q24 A;  1IHZ A;  2H1E A;  3QB3 A;  3KJP A;  3LNN A;  2FIN B;  1H9J A;  4F88 A;  4A3E B;  2E2I H;  4E6I A;  1CQV A;  3HGB A;  3GTO H;  1T9H A;  3T53 B;  1OXS C;  3I3C A;  1DOM A;  1LTG D;  2PQE A;  2JEB I;  1TR5 A;  3SE0 A;  4DK3 C;  1VS0 A;  2I5H A;  4RAU C;  3HOU G;  3FDT A;  4N8X 1;  4HR7 B;  3J81 c;  4HMI A;  2UU9 Q;  3PMF A;  4PMB A;  2EYF A;  3FPP A;  4DAY B;  2VQF Q;  5JAV A;  1DM0 B;  1HA6 A;  2UUC L;  2F4V Q;  5JOB A;  1GUT A;  3UDX A;  4TKO B;  5IT9 c;  1JB7 A;  2OTJ A;  2NTS A;  1A8V A;  3GTQ B;  3K7A H;  4OHJ A;  4G7H C;  3KBG A;  1Y14 B;  4O2D A;  4EQ5 A;  1MIU A;  4N8F A;  1MI2 A;  3S1R B;  1FYC A;  4HJ7 A;  1E22 A;  2IHF A;  1EY6 A;  1HNZ Q;  3SK4 A;  3KLW A;  1QIL A;  1CHP D;  2SEB D;  5A2Q L;  2GVB A;  4JI3 L;  5C6A A;  2UUC Q;  1STN A;  3PSI A;  4JI2 L;  3D8G A;  4RGN A;  2MP1 A;  4OX9 Q;  1K9M C;  1XXG A;  1BXT A;  4PG3 A;  3PUZ A;  3RZD H;  4GLV B;  3HOV H;  3KLR A;  2IX0 A;  3E3X A;  4L8J A;  5IGF A;  2A69 C;  5I6Y A;  4A3K H;  4PV1 C;  3HOU B;  3H3V I;  2KHS A;  5GQO A;  4Z9C B;  1STE A;  1TWG B;  2EYO A;  2KED A;  3K5M A;  1VQ7 A;  1LT6 D;  2F52 A;  4HID A;  1X32 A;  5FLX c;  5JVH 3;  1LT4 D;  3TBI B;  1CHQ D;  4LAA A;  3MVV A;  3DMU A;  1L0Y B;  1L1O A;  2K75 A;  3T16 A;  3BVM A;  3S24 A;  1BUV T;  2L4N A;  4DXF A;  2ZM6 L;  3MTS A;  1ROD A;  2HCC A;  3BZK A;  4A3D H;  3HZX A;  3I90 A;  2RHQ B;  4FXD A;  4PZ8 A;  4LF9 L;  1HTP A;  1OXU A;  4POG A;  2QCP X;  2K5Q A;  3U9O A;  1JE4 A;  1AP0 A;  3NHH A;  4ME3 A;  5M9O A;  4C1N K;  5GAH C;  2E2I B;  3GTO B;  1AEX A;  2DNE A;  4RWS C;  1GUS A;  2PPB C;  1BBX C;  1UE6 A;  3HOV G;  3PGZ A;  1Q12 A;  1YIJ A;  1LTL A;  1QVG A;  4A3K G;  5C4X H;  1HQR D;  1H95 A;  3CRL C;  4X3S A;  2D62 A;  2OT2 A;  3AEV A;  1JR0 D;  4DNI A;  1LAC A;  3I7F A;  1QCB D;  2BE5 C;  3D6C A;  2PZW A;  2IL8 A;  2F0H A;  2RA4 A;  4B3T L;  3I4L A;  1WJJ A;  2HD3 A;  1EUJ A;  2E74 C;  1I50 H;  1SMY D;  5CGK A;  1JJG A;  5D3D A;  3N6R A;  4AQY L;  3K7A B;  1A15 A;  1D6E C;  2JQO A;  1EYD A;  1C4Q A;  1G91 A;  4K5W A;  4DR2 L;  4A3D G;  4N9P A;  3J81 L;  5IYC H;  4UPA A;  4XIG S;  1YJW A;  1EY4 A;  3AFQ A;  1EU4 A;  2ZTC A;  2CCZ A;  3PUW A;  4RGM A;  2NVY B;  2K04 A;  3M4P A;  1CKN A;  3VA5 A;  3HOX H;  1PH1 A;  5IT9 L;  1I4P A;  4ZYS A;  4DV1 Q;  5C4X G;  3UE1 A;  3I4O A;  1BO0 A;  1I4Q A;  4HJ5 A;  3S14 H;  4UAI A;  3PUV A;  5C44 H;  1EOV A;  1ASY A;  3RZD B;  3HOV B;  1KNA A;  4I65 A;  2VB2 X;  3EQL C;  3CCS A;  1BVS A;  3HKS A;  4RFB A;  2OEO A;  3FPU B;  4J8Q A;  4A3K B;  4DR2 Q;  4NB3 A;  3S16 B;  4ME5 A;  1YHQ A;  4X3K A;  1L2F A;  1UAP A;  1SMX A;  2CWP A;  2IHE A;  2A6E D;  3L9A X;  2K7V A;  3J80 c;  2PNH A;  3LWE A;  3SR1 A;  2K28 A;  3M3Y B;  3P75 A;  4DU9 A;  2AUJ D;  2XWB B;  2K03 A;  5IYC G;  1KD1 C;  2L5T A;  3MA2 B;  4YWM A;  1HHV A;  3CD6 A;  4BY1 H;  1KL9 A;  3H09 A;  4A76 A;  3NE5 B;  2K52 A;  4ULL A;  1WOC A;  3HOX G;  1S5B D;  1T5X D;  3OW7 A;  5E3F A;  5C5M A;  2RSO A;  1BNZ A;  5FLX L;  1GHK A;  1WFQ A;  5C44 G;  3HOZ H;  1LM0 A;  4RA8 A;  1UUP A;  3WWV A;  2SDF A;  4HMJ A;  2Z9H A;  5IOD A;  1QJO A;  3V96 A;  5I2X A;  1NJI C;  2KHJ A;  1TU2 B;  1EEF D;  5C4X B;  1A62 A;  3BZC A;  1D1I A;  4H7B A;  1HTL D;  1J5E L;  2A6H C;  2E5L Q;  3W3A A;  3D3R A;  3STB D;  3S1N H;  4TRD A;  4PNY A;  4P75 A;  5JEA H;  4Y7N B;  2D2C C;  2VS1 A;  2UXB Q;  5A2Q E;  1K3R A;  1H9K A;  1I50 B;  1SN8 A;  5AFW A;  4C1N I;  3GTK B;  4BY1 G;  4XXE A;  3DLL A;  1RTO A;  2Z0S A;  3IFT A;  1MBY A;  3T4A C;  2EZV A;  3BJU A;  1CZG A;  1PFB A;  1WTV A;  4DR7 Q;  1STY A;  2Q2U A;  4GS3 A;  3ULL A;  3TQY A;  5J1Z A;  2JP1 A;  5ELC A;  4A3F H;  2KA7 A;  1FGB D;  2EYJ A;  2RF4 A;  3HOZ G;  3T13 A;  2F0N A;  1EZ6 A;  1K28 A;  3MC0 B;  4GNX C;  1PZJ D;  1V43 A;  1DJR D;  2F0O A;  3VYR A;  3AB9 A;  5IY0 A;  1RD9 D;  4RMF A;  3S14 B;  5C44 B;  2JXM B;  3KYH C;  4DFA A;  3OOC A;  4NW2 A;  2O2L D;  3CCQ A;  4Q0F A;  4R4Q A;  2ICE C;  4L5Q A;  2VW9 A;  4K6D A;  4X62 L;  2Q8I B;  4K0K Q;  5AJ3 L;  4JV5 Q;  4C3J H;  4IO9 A;  1BQQ T;  1S4Z A;  2B3G A;  5CC4 A;  3TRE A;  3R2I A;  2PQA B;  2R61 A;  3GP7 A;  4UP9 A;  4IOC A;  1LLR D;  2A19 A;  5CV7 A;  1VQP A;  2QF7 A;  5JVG 3;  2NZ1 D;  2JA9 A;  2LMC B;  5HGT A;  3H15 A;  4A3F G;  4BY1 B;  1B50 A;  3TP7 A;  4K8I A;  3KDF B;  3CCV A;  4X65 L;  4JI4 Q;  2RCF A;  3TN2 A;  2F0G A;  5L37 A;  1IYU A;  1K3B C;  1PH4 A;  2NVT H;  2K5V A;  2VQE Q;  2A1A A;  4OWT B;  3J80 L;  2FMC A;  3OMG A;  1WYD A;  4OO1 I;  3K57 A;  4C56 C;  5IGG A;  2Z4I A;  4JBW A;  2FHT A;  3HOZ B;  1ONL A;  3TRZ A;  2QGQ A;  2JSO A;  1N33 L;  1KTK A;  1OXX K;  1S72 A;  1QVC A;  1GM5 A;  1Q7Y C;  3PF4 A;  2E76 C;  3VYS A;  4DR6 Q;  2ZJQ A;  1HR0 Q;  5K36 H;  3NTH A;  4C3J G;  3S1N B;  2I07 B;  3J81 E;  1RDP D;  3WOE A;  2EOT A;  1G2T A;  1BDO A;  1SR3 A;  1HH2 P;  1UE1 A;  2MO1 A;  5FJ8 H;  3CCR A;  1SNP A;  4LJZ C;  3A5Z B;  4G57 A;  1NTG A;  1JQY D;  2KEE A;  4M1U B;  3S15 H;  2CFM A;  4X3U A;  5IT9 E;  2B2T C;  1OXV A;  1XNQ L;  2F0V A;  1TS3 A;  4JI6 Q;  1I4R A;  4AIM A;  1M4V A;  3MFY A;  3GTJ H;  1V1O A;  3I72 A;  1QUQ A;  1GHJ A;  1ILQ A;  1I3Q B;  1D5Z C;  2KCC A;  2XSC A;  4A3F B;  4FYD A;  1AE3 A;  5DAU A;  1SYG A;  3VR5 A;  1YNX A;  2B29 A;  3GTM H;  2Z1C A;  4FF1 A;  1UNS A;  3U9S A;  4ZK9 B;  4YWL A;  4DR3 Q;  3NBI A;  3I56 A;  4GKJ L;  4GKK Q;  3A54 A;  3SK8 A;  1XNQ Q;  5K36 G;  1HFG A;  4CDD C;  1SND A;  4NXM L;  4JI7 L;  4GNX B;  1EQR A;  5LHY 1;  1Q8K A;  5FJ8 G;  2WII B;  3DHQ A;  4QGU A;  4A3J H;  5COR A;  2BDN A;  4C3J B;  3PIP 3;  2ZXR A;  3CXC A;  5ELB A;  2IWH A;  2EDG A;  2UXD L;  1F9S A;  5IE8 A;  4ZKC B;  2NN6 I;  3KF6 B;  1TWH B;  1STG A;  2PMZ B;  5COY A;  1O7I A;  3W1B A;  1R4P B;  3EN2 A;  3GTL H;  1X3Q A;  4FDB A;  4XQN A;  1NSN S;  1D7Q A;  3PIO A;  1W2B A;  2EYP A;  1EZ8 A;  5FLM H;  2IX3 A;  4HJA A;  2ZTE A;  1JC7 A;  1B7Y B;  4DV4 Q;  2NVX H;  2PI2 A;  4BXX H;  1CKN B;  2EYL A;  3K5N A;  4DAV A;  1U4L A;  2AQ2 B;  4LUZ A;  1I94 Q;  2BH2 A;  5C4J B;  2JA5 H;  4A3J G;  4DAP A;  2NZH A;  1F9Q A;  1EWH A;  4A3M H;  4WRD A;  2PMZ E;  5E4X A;  3GTG B;  3S15 B;  1IBK Q;  3A7A B;  1MD2 D;  3J7A 5;  2ALY B;  2FJ2 A;  1JCK B;  2KJX A;  2RDG A;  4XQQ A;  1F9P A;  5E1F A;  2A73 B;  4IPG A;  5FLM G;  1EY7 A;  1XWE A;  2RBM A;  3E0E A;  4BY7 H;  2NWG A;  1V1P B;  1CM9 A;  1PA6 A;  1JWM D;  5IGE A;  4K5X A;  1X3P A;  4BXX G;  3FHW A;  3LWU A;  5F2D A;  4BWG B;  4GOP A;  3S1Q H;  3GTM B;  1NUC A;  2ZT9 C;  5IGD A;  1GUW A;  3ULJ A;  4QF4 A;  1A2U A;  3HP3 A;  3I2Z A;  5FO8 B;  3K80 C;  2JA5 G;  4LF5 L;  3RMH A;  1F2M A;  5E4W C;  1BCP C;  1Y1W H;  2X6L A;  2JE6 I;  4A3M G;  1Q82 C;  1PH3 A;  3FRP B;  1CSP A;  4B9W A;  2L15 A;  2C5C A;  1EY0 A;  1J9O A;  1NMF A;  2R7D A;  2XIW A;  4IPC A;  1HNX Q;  1DGS A;  2M00 A;  1HFN A;  1SRU A;  3MXP A;  1SDF A;  1YJN A;  1YNN C;  2VB3 X;  4JOI A;  3J80 E;  5LMN W;  4FF3 A;  1GD7 A;  4A3I G;  4BY7 G;  2O5J C;  1F2Y A;  1NR4 A;  2RDF A;  2RSN A;  1K8G A;  1JWU D;  2WV6 D;  4LK1 C;  4APV A;  4DR1 L;  2B2U C;  3ICE A;  2CQO A;  2RHS B;  1LT3 D;  1UE7 A;  4RHR A;  1EL0 A;  1YHA A;  4JPB W;  4QCL A;  1TVX A;  2MUY A;  3PUX A;  4PMC A;  1B70 B;  4G7Z C;  1SE2 A;  1M8A A;  1SNM A;  1XMQ L;  2N8N A;  3OIP A;  1EYG A;  1E1T A;  4DV2 L;  4WJ3 M;  1KNE A;  1Y1W G;  3AU7 A;  3K58 A;  3BDC A;  1WTW A;  4JK1 C;  2RQX A;  1YZ6 A;  2I46 A;  3PUY A;  1E2V A;  2F3I A;  1XNR Q;  3UI2 A;  4DK6 C;  2JA7 H;  2NBF A;  5BN4 A;  4DR1 Q;  1FJG L;  3QR8 A;  3F2B A;  1NAP A;  4A3M B;  4FO2 A;  4EVO A;  2MO0 A;  2YTX A;  1A6X A;  3D4D A;  3BDO A;  3PO3 H;  1YVC A;  1EFI D;  4DV5 Q;  1PZK D;  3EBE A;  5CV8 A;  5M3F H;  4KTA A;  1XMQ Q;  4PZ6 A;  2A68 D;  1A3U A;  3NBH B;  2VL6 A;  3GV3 A;  2EJM A;  1DXM A;  1HZ9 A;  1DYQ A;  5M3M H;  5CYU A;  1Y8P B;  4A3I B;  4BY7 B;  4KHZ A;  1PLF A;  3VR4 A;  5HUR A;  3I4N H;  4X66 L;  4EGV A;  1EIG A;  5K5P A;  5IGB A;  2I5L X;  3S1Q B;  3HRZ C;  4XDX A;  2K32 A;  3K5O A;  1Z9F A;  3L0O A;  2B39 A;  1JB3 A;  4F87 A;  5ELD A;  2XNA C;  2A5H A;  5DM7 3;  5M5Y H;  2JA7 G;  1AZP A;  4B3S L;  3C2P A;  1X6O A;  1KIX A;  2C35 B;  1TQO A;  1Y1W B;  1D1K A;  5C3W A;  2JK8 A;  1SLJ A;  2JN4 A;  3BVZ A;  3A55 A;  4OIJ A;  1ZKO A;  2Z6K C;  3PO3 G;  1LTS D;  2B2W A;  2KEN A;  4LFA L;  4X6A H;  4X66 Q;  1BCP B;  2AUK A;  5M3F G;  4DUZ L;  3HOY H;  2KUM A;  3EFX D;  4KKT A;  2AWO A;  1L0W A;  5H1S E;  5LL6 X;  3EVQ A;  4IPH A;  5NUC A;  5M3M G;  5C4Z A;  1C0A A;  2F0I A;  1SJE D;  1AW7 A;  4R9W A;  4LW1 A;  1KAW A;  3CP0 A;  3I4N G;  2NVY H;  1PRT D;  2K4K A;  1P16 A;  1B53 A;  3MZ5 A;  2H5X A;  2IX1 A;  2K5N A;  2K50 A;  2WFW A;  1B9M A;  2L12 A;  2YV5 A;  5I9O A;  3VYU A;  1JOK A;  4JG2 A;  1AZQ A;  3SDZ A;  3SHL A;  4DUZ Q;  5ISR A;  1A63 A;  4XTC S;  2F0F A;  4QMG A;  2WP8 J;  3VR2 A;  2J4X A;  1D5M C;  3R93 A;  4HJ8 A;  4YY3 L;  3J7Y W;  1PFS A;  3S16 H;  2I5M X;  1B44 D;  2JA7 B;  1MSH A;  3AQQ A;  2CW0 D;  3P20 A;  5EBD A;  1E0B A;  4JVZ A;  4LMQ D;  1P8L A;  3HOY G;  2PCF B;  1B1Z A;  4JI3 Q;  4DK0 A;  2B2V A;  3M3Y H;  3PO3 B;  2PYK A;  2KOL A;  3P7J A;  1BCP F;  4ZCK A;  1LTB D;  1NCV A;  4JI2 Q;  5M3F B;  1MSG A;  2UUB L;  2OCE A;  2WAC A;  1JJ2 A;  1N32 L;  1PH8 A;  1HNW L;  4B3M L;  5M3M B;  2PZT A;  1RJT A;  2ZXP A;  5HGQ A;  5J3B A;  1B3Q A;  4LUV A;  4IFD J;  1RKN A;  3I4N B;  2Y0S B;  3KOJ A;  5M5X B;  2MPM A;  2F0P A;  2KHI A;  2LKV A;  2OQ0 A;  3VR6 A;  1LT5 D;  4PQX A;  4MTN A;  4CDE C;  3TDQ A;  3ONA B;  4KY5 A;  2N88 A;  1SBB B;  3QG1 A;  3K81 C;  1VF7 A;  3X3M A;  1CKO A;  3DXJ C;  3I8Z A;  5ELO A;  2K01 A;  2TMP A;  5M5Y B;  3NTK A;  4YCV A;  3NTI A;  3J7Z C;  1I6V C;  3M4Q A;  2LFN A;  5J22 A;  2ZM6 Q;  2LXJ A;  4ZUI A;  5CR3 A;  4HAE A;  4Y7N H;  3I55 A;  1KDA A;  3EA6 A;  1U5K A;  1PYB A;  4LF9 Q;  1U9R A;  3KLS A;  2SOB A;  1KAA A;  3HOY B;  4KKS A;  1QB5 D;  3GTK H;  4A3C H;  2F1M A;  3OMC A;  4L6T B;  4IUT A;  4QL5 A;  1SAP A;  4A3L H;  4LFC L;  5EPK A;  4TQU S;  2Z4H A;  4Y52 H;  3RLO A;  3BVG A;  4BBR H;  4O42 A;  1IBM L;  1FVI A;  2DUD A;  2L55 A;  2VNU D;  5LMN L;  1ZXT A;  2XN9 C;  1ENF A;  1NY4 A;  4MZ9 A;  4B3T Q;  5IIF A;  1WTR A;  4H44 C;  1STB A;  3CRK C;  4AQY Q;  1VQL A;  2A74 C;  4ZQ3 A;  1SNC A;  1Y8O B;  3AMU A;  1FNW A;  4FNF A;  1Q90 A;  1Y8N B;  4NPS A;  4DR5 L;  1PH6 A;  2WB1 G;  1PTO C;  1KAB A;  4YCW A;  1C8C A;  5KEE A;  4GLA C;  1ICW A;  4A3C G;  1V1Q A;  1VQN A;  1S3O A;  3DWQ A;  1BBW A;  1VQC A;  3D0F A;  1PTO H;  1RF2 D;  3J81 j;  1MGS A;  4P2C B;  3CCL A;  1IW7 C;  4NP5 A;  4A3L G;  1VQ6 A;  5ELN A;  1BOS A;  4LWC A;  3DM1 A;  1N8R C;  2EYM A;  1Q46 A;  4JI0 L;  5C0X J;  1VQB A;  4BBR G;  1DOK A;  3R3O A;  4L5R C;  3NEN A;  1DZ1 A;  3S2H H;  1VMP A;  3CC7 A;  3L7Z C;  4RGO S;  4DV3 L;  1S40 A;  1EFW A;  2HIV A;  2VXW A;  4DV6 L;  1HPC A;  1C9O A;  1NE3 A;  5C3X A;  1AFP A;  1A3V A;  5G3L F;  2EJG C;  2V1C C;  1J6Q A;  4C3H H;  3HEJ A;  4RHS A;  3ERO A;  2EXZ A;  4GN4 B;  2Q2T A;  1VQF A;  1GUO A;  4KKU A;  1SFO H;  4HCS A;  3E9I A;  1F2Z A;  2BA1 A;  2WB1 B;  5KNC A;  1STA A;  4RKB A;  1L1O C;  1GKH A;  1HZC A;  3MEH A;  1LTT D;  1SE8 A;  5JJZ A;  3NQT A;  3F2D A;  2MQH A;  2X69 A;  5IOC A;  1I3Q H;  2P5Z X;  1KRT A;  1J5E Q;  3RNU A;  3S2D H;  4BBR B;  3RZO B;  1S5D D;  1JIC A;  1PDQ A;  1H9S B;  3I4M H;  1EQT A;  2A69 D;  1VQA A;  3T1H L;  5I2Y A;  1PVO A;  1GUN A;  3GO5 A;  5EAY A;  4C3H G;  4K14 A;  2M9V A;  4KJO A;  4NXN L;  2VUM H;  1NNX A;  1IYJ B;  3S1M H;  1IKL A;  1Q86 C;  2DJG C;  2WB1 E;  3QOL A;  1WTQ A;  4IPD A;  5D3I B;  3SGI A;  1JOO A;  1E1O A;  2HIX A;  3DEO A;  3RN5 A;  1X9N A;  4R4T A;  5C4H A;  3PF5 A;  1GO3 E;  4IQZ A;  4S3S A;  4MIU A;  4QJF A;  3H94 A;  3CCM A;  2SNS A;  1PTO B;  1TWH H;  4QUF A;  1ENA A;  1XTD A;  2HCI A;  5ELF A;  3MXU A;  4JYA L;  4PZ7 A;  3H3V C;  1O7L A;  2EY1 A;  4H13 C;  2MFI A;  2L1B A;  4JBK A;  2EVB A;  3L2P A;  2GN5 A;  3I4M G;  2EE1 A;  2AQ1 B;  3S2H B;  4ZKB B;  4RCN A;  4O0A A;  3PQI A;  4X62 Q;  3L3O C;  1CI3 M;  1AH9 A;  5AJ3 Q;  4HIK A;  2VUM G;  5KRU A;  2BE5 D;  2OXP A;  5C4J H;  1HUN A;  3TZD A;  4C3H B;  3A5U A;  4IUP A;  2UUA L;  3G7L A;  3K8A A;  2L11 A;  1QWY A;  1SFO B;  4X65 Q;  3I70 A;  4U68 A;  4UP8 A;  4DPG A;  4XT3 B;  2QIL A;  1FR3 A;  1K0R A;  3W2D A;  3FKI H;  5EPL A;  1V9P A;  4OXP A;  3GTG H;  4V19 0;  2ATW A;  1EWI A;  2D9U A;  1VF5 C;  2WAQ G;  1QZG A;  5BR8 L;  4AH6 A;  3K7U C;  3MFG A;  1CQF A;  1Z6H A;  1PTO F;  1G51 A;  4R4O A;  1G29 1;  3HOW B;  2M2L A;  1N33 Q;  3C1E A;  5I6W A;  3BG3 A;  2MJ8 A;  5EBC A;  1L1O B;  1FNU A;  4RH6 A;  3SK5 A;  3S2D B;  4ABN A;  2K14 A;  3NUC A;  3U4V A;  4HJ9 A;  3I4M B;  1DOL A;  2NZO A;  2WKD A;  4DNT B;  1O80 A;  4RKL A;  4X3T A;  4X64 L;  4PMW A;  2E2J H;  2OTL A;  4L5S A;  5IWA L;  2EXD A;  3M7G A;  3M4O B;  1I6H H;  1K73 C;  2KEC A;  2NB0 A;  2VUM B;  1KLU D;  4CHT B;  5BR8 Q;  2ENB A;  4TVA B;  1HXY D;  2F0W A;  3S1M B;  4JC0 A;  2R92 H;  4WJW A;  4K2L A;  1G6Z A;  4LF7 L;  2RVL A;  1UEB A;  1YNJ C;  3FKI G;  1F2L A;  1B2T A;  3ERS X;  5EKK A;  1HA5 A;  1TS4 A;  4QQB X;  2PO4 A;  2E75 C;  1SYD A;  3A8J E;  3IFD A;  4X64 Q;  5FLX E;  4IOA A;  4B08 A;  5GAE C;  4UDU C;  1HZB A;  4G7O C;  5IWA Q;  2K5H A;  2WIN B;  2F4I A;  2WAQ B;  4GKJ Q;  2F0L A;  1QNU A;  2IPK D;  3HG9 A;  4LF8 L;  1GVP A;  4NXM Q;  4YHH L;  1TY0 A;  4JI7 Q;  3U58 A;  4ZAI A;  4LF4 L;  1R4Q B;  4LF7 Q;  4HSV A;  4LF6 L;  3MXG A;  3GTP H;  1VQ9 A;  1WD1 A;  2IT1 A;  4FVM A;  3LGJ A;  1PH2 A;  1A0I A;  4ALP A;  2UXD Q;  3KBX A;  5GAD C;  2R92 G;  2B2Y A;  3NEM A;  3CC2 A;  2EPB A;  2E8G A;  1STH A;  2X6G A;  1PMR A;  1VQD A;  2G5D A;  2O4X A;  3TS2 A;  1Y69 U;  4ZRZ A;  4KN4 C;  3BU2 A;  2KCN A;  3VDY A;  4XYO A;  3TP5 A;  3FKI B;  1PRT C;  3HKZ G;  2MHV A;  2WAQ E;  1PV4 A;  1CA5 A;  1G2S A;  2O5I C;  4AYB B;  3CPW A;  4OWX B;  3U50 C;  1EEI D;  1N34 L;  1S5E D;  1X3E A;  1HUM A;  2N78 A;  3NXW A;  3H0G H;  2Q2H A;  4A3I H;  4KY7 A;  4KK7 A;  5JEA J;  3UE0 A;  4FP5 D;  3U4Z A;  1C7Y A;  3E9H A;  3E6Z X;  1WCM B;  2DY8 A;  1IKM A;  4BA1 I;  4IFD H;  3SEB A;  1XMO L;  4OEL B;  1BBU A;  4OIK A;  4C3I H;  1T5E A;  4H0L C;  2HHH L;  3F2C A;  4ODG A;  2E2J B;  4A3G H;  1SNQ A;  2RKS A;  5FO9 B;  1UWV A;  1I6H B;  3CCU A;  3CAM A;  2F0E A;  2ZJR A;  4P73 A;  4R1J A;  1DD2 A;  4DV7 L;  5KIX A;  1N34 Q;  2R92 B;  1Q81 C;  4RGT A;  3OTO L;  2ZTD A;  4B3R L;  1TII D;  3S17 B;  1PFM A;  1VQ5 A;  5HY6 A;  2XGT A;  1CT1 D;  1RCV D;  2ES2 A;  4OWW B;  5J39 A;  4NDX A;  2K6A A;  3W5O A;  4XYQ A;  3K5L A;  1U4R A;  2LY7 A;  4WOR A;  1D2B A;  2Q8R E;  5KYI A;  4A93 H;  3H0G G;  4IUQ A;  1SE3 A;  3HKZ B;  4DN4 M;  1EIH A;  4ZUJ A;  1VQG A;  4A4I A;  1X55 A;  3PIO 3;  4LF5 Q;  4FXG C;  2F0Q A;  1CA6 A;  4IFD G;  2B8G A;  4DV7 Q;  4C3I G;  5IYD H;  4BBS H;  1VMC A;  2J0T D;  4A3G G;  4XT1 B;  1I4G A;  3GTP B;  3NP8 A;  3O13 A;  2NTT A;  2QKI C;  1K8O A;  4DKA C;  3TS0 A;  2VY3 A;  3F2U A;  1SEB D;  4MN3 A;  1SMY C;  5FO7 B;  2BA0 A;  4C2M H;  1XYI A;  1JJC B;  1KLG D;  4DF7 A;  1Q1B A;  5EJW A;  4V0B A;  3J7A F;  4KY6 A;  3HKZ E;  4HTH A;  2F0D A;  4A93 G;  1EQQ A;  3MWY W;  4IUR A;  1VQ8 A;  1Y1V G;  2LXK A;  2PNR C;  5CBE E;  1TWF H;  4OO1 H;  2N49 A;  4FXK C;  4K8J A;  4WFN 3;  5KND A;  4DV2 Q;  2R3Z A;  1VQM A;  1WTP A;  3QJY A;  5EKL A;  3BYT B;  2YTV A;  3A0J A;  1VCI A;  5C0X H;  5IYD G;  5IP7 H;  1PRT B;  3PO2 H;  3E0J A;  3H0G B;  4CDF C;  1PZI D;  1FGU A;  4BBS G;  1GUG A;  1SJH D;  2K05 A;  3H91 A;  1C48 A;  5M5X H;  3W1G A;  2EY5 A;  1FJG Q;  2F0K A;  5CV6 A;  2BDO A;  1NBW A;  2BCO A;  4K6L A;  4C3I B;  1PXU A;  2UU9 L;  3FVQ A;  1MHW C;  3EIV A;  1PH7 A;  5CMD A;  2YU9 H;  4A3G B;  5C5L A;  4OON A;  2A6E C;  1N9W A;  2VQF L;  2NVQ B;  2F4V L;  4CKE A;  1LYL A;  1PYW D;  5I9P A;  2LSS A;  4KD3 A;  2N55 A;  5IP9 G;  5GRO A;  3BYY B;  3E5S A;  4OO1 G;  1IYV A;  2D5D A;  2JA6 B;  1U4M A;  1OXT A;  3Q6S A;  3NWS A;  1HNZ L;  4ID6 A;  5C0X G;  3RLN A;  5IP7 G;  4A93 B;  3PO2 G;  4ZLT F;  3NK9 A;  3KFU A;  1Y1V B; 
#chains in the Genus database with same CATH homology
 2HDL A;  1S5F D;  2FMM A;  3ND9 A;  1LAB A;  3MXN A;  2XRQ D;  1PRT F;  3BDL A;  1ET9 A;  1A2T A;  4BBS B;  3VR3 A;  4K2K A;  3RLF A;  5M5W B;  1IL8 A;  4U67 3;  2NN6 H;  4KMU C;  2K33 A;  4ILW A;  4KD4 A;  4QUC A;  3OSO A;  4KN7 C;  4C2M B;  3I73 A;  1B4O A;  3IKJ A;  3D4W A;  3CHB D;  1ZYR D;  1H9R A;  5D65 A;  1TWF B;  2DNC A;  1G8Z D;  1LTR D;  3PO2 B;  1CFM A;  1GJX A;  2PW7 A;  4YIJ A;  1BCP D;  4K5V A;  5LL6 S;  1WTO A;  4IZ8 A;  3NSW A;  5CV5 A;  2NN6 G;  1FNV A;  2YU9 B;  4F7X A;  2SNM A;  3OIQ A;  4QB4 A;  1A3T A;  1J8I A;  1YNN D;  2BOS A;  1Q3L A;  1CZW A;  1F77 A;  3QIA A;  3DWP A;  3EJI A;  2KQ3 A;  2V4D A;  2EY6 A;  3NPP A;  1KDC A;  1ZEQ X;  5FK9 C;  4XQJ A;  4KI0 A;  4N9T A;  3K6O A;  5A35 A;  4CGY B;  1BR9 A;  3Q0A A;  1TS5 A;  2Q8T A;  3C46 A;  1SNO A;  3NQI A;  2B8F A;  4DGZ A;  2AQ3 B;  1E2W A;  2C9O A;  1Q1E A;  3R2T A;  3A8I E;  3R8B A;  1EY5 A;  2B2W C;  5BN3 A;  2NUC A;  3SVM A;  2ID0 A;  3OWE B;  4CJ2 C;  2F0J A;  1QOH A;  3C1F A;  1TWA B;  3M4Y A;  1H9M A;  2KVM A;  5DNF A;  1ML0 D;  2G9D A;  3CU7 A;  4B9X A;  1KDB A;  1PFN A;  2L0C A;  1ENC A;  5T1I A;  3A7L A;  5EKI A;  1TWC B;  1I4H A;  2WKC A;  4R8I A;  3I91 A;  4CJ1 B;  3ZYY X;  4G4K A;  1F9R A;  2K5W A;  4IUU A;  4QIW B;  1EWC A;  4NMZ A;  1V1P A;  3KF8 A;  2B2T A;  1LV9 A;  3BS1 A;  4FF2 A;  3TZU A;  2XRS D;  1WTX A;  3CKI B;  4A3D B;  3DWA A;  4EQO A;  1II3 A;  1K8M A;  3OWF A;  4NKL A;  2TSS A;  3MHB A;  4J6H A;  5G3L D;  3QOJ A;  2B2V C;  3M85 A;  4L63 B;  3LX0 A;  4O1N A;  5FKA C;  3WOF A;  2R93 B;  1QNK A;  2CHB D;  1UEA B;  1DCZ A;  3DUZ A;  2F0M A;  2ICI A;  3S9W A;  5ELE A;  4IFD I;  2E2D C;  3RD4 A;  5I4D A;  5CV9 A;  1TS2 A;  1Z47 A;  1XX8 A;  3QO2 A;  1EOT A;  1LTA D;  1EY9 A;  1SYF A;  3A8K E;  3IAY A;  2QEJ C;  4OGQ C;  3HOX B;  4A3B B;  4CBV A;  3ERQ A;  4HSP A;  5DEH A;  1W6K A;  2DN8 A;  3IL8 A;  1SYB A;  5BN5 A;  5JEA G;  1ILP A;  2CQA A;  4M8A A;  3WDN A;  4TSS A;  4DNR B;  3SK6 A;  3A56 A;  5JPN C;  2K1B A;  3MAQ A;  3NBH A;  1RTN A;  1EQV A;  4BA2 I;  3TSS A;  1D5X C;  2GA4 B;  3N52 A;  4GZY C;  1SYC A;  1B9N A;  5C3E B;  3QWN A;  3Q22 A;  1ET6 A;  2XWJ B;  5CV4 A;  3JAM L;  5CBA E;  1SSO A;  4RCO A;  3HS0 C;  3ITP A;  1BF4 A;  1TY2 A;  3NWT A;  4HED A;  4DAY A;  5C0X I;  2F0T A;  3X3N A;  1QE6 A;  3T51 B;  3V2T A;  1K83 B;  1O7Y A;  2CVR A;  2FFK B;  3J7A V;  3FMC A;  4MHE A;  4I7Z C;  1PTO D;  3CQZ B;  3URY A;  4DXG A;  2F3V A;  2ZXO A;  3TP8 A;  3K59 A;  1JOR A;  3T56 B;  1EYA A;  1JWS D;  3M7N A;  4CKB A;  2B2U A;  1IW7 D;  5JPM C;  3C3L A;  3D6W A;  2A68 C;  2B63 B;  1HCZ A;  2F0S A;  1VDZ A;  2E2H B;  1LO5 D;  1EY8 A;  4KJN A;  3VYT A;  2IW3 A;  1I4X A;  1Z7T A;  1TT2 A;  1V8Q A;  3KLS X;  5KNB A;  3GD7 A;  4R8N A;  2A6H D;  2HUG A;  2J7Z A;  3GV6 A;  3TP6 A;  5EPJ A;  1SYE A;  2YYZ A;  2PW5 A;  3KK7 A;  1RHP A;  2HQE A;  2K5D A;  4DA2 A;  1OO9 B;  3P1H A;  3TME A;  2LS0 1;  2NVT B;  1ESR A;  5EQ0 A;  3H6M A;  4F8M A;  3OPO A;  1EU3 A;  1QG7 A;  3KUP A;  1L0X B;  2F03 A;  2L9H A;  5D14 A;  2XVS A;  4DK1 A;  1U4P A;  4CJ0 B;  1R9T B;  5DM6 3;  4HN7 A;  3FEW X;  4EQN A;  2G9H D;  4OL7 A;  4HCE A;  4Q5V A;  2EY2 A;  3D31 A;  3RUZ A;  2CW0 C;  2HDM A;  3BZD B;  1SE4 A;  4BS9 A;  1SXT A;  5KGU A;  1HRJ A;  3GTJ B;  3SXH A;  2IJ0 A;  1ZYR C;  5TSS A;  2OF1 A;  1HQM C;  1XTC D;  1W6J A;  2R7Z B;  4KHV A;  1ESF A;  4IUV A;  1S5C D;  3D4R A;  2MGS A;  2JYO A;  1JOQ A;  1E2Z A;  2F3W A;  4IUN A;  4FF4 A;  1O7Z A;  1AN8 A;  2EYH A;  3VA7 A;  1EYC A;  5FOB B;  4A3J B;  3K0Y A;  1B3A A;  1GOZ A;  3JAM E;  2EJF C;  3PV0 A;  2RDH A;  5T1G A;  5IGC A;  3OHX C;  2JEA I;  5EGT A;  1Q8I A;  2JA8 B;  3GTL B;  1NR2 A;  4CKC A;  1O78 A;  3DEP A;  2QDB A;  3V05 A;  5KYL A;  2NVX B;  4KV6 A;  1TKW B;  2H4O A;  3G6J B;  2F0U A;  2R6G A;  1CTM A;  1WVL A;  2PZU A;  4EQP A;  1WD0 A;  1GXD C;  3Q23 A;  2JA5 B;  4IN3 A;  1LTI D;  4J1M A;  2DY7 A;  2NYZ D;  1CK1 A;  2AWN A;  3GQB A;  4IAL A;  1FD7 D;  3ND8 A;  1YNJ D;  2B2Y C;  2Z8L A;  1DON A;  1H9S A;  3Q24 A;  1IHZ A;  2H1E A;  3QB3 A;  3LNN A;  2FIN B;  1H9J A;  4F88 A;  4A3E B;  4E6I A;  1CQV A;  3HGB A;  3T53 B;  1OXS C;  3I3C A;  1DOM A;  1LTG D;  2PQE A;  2JEB I;  1TR5 A;  3SE0 A;  4RAU C;  3FDT A;  4HR7 B;  4HMI A;  3PMF A;  4PMB A;  2EYF A;  3FPP A;  5JAV A;  1DM0 B;  1HA6 A;  5JOB A;  1GUT A;  4TKO B;  2NTS A;  3GTQ B;  4OHJ A;  4G7H C;  3KBG A;  1MI2 A;  3S1R B;  1FYC A;  1EY6 A;  3SK4 A;  1QIL A;  1CHP D;  2SEB D;  5A2Q L;  5C6A A;  1STN A;  3D8G A;  4RGN A;  2MP1 A;  1XXG A;  1BXT A;  3PUZ A;  3KLR A;  2IX0 A;  5IGF A;  4L8J A;  2A69 C;  5I6Y A;  4PV1 C;  3HOU B;  2KHS A;  4Z9C B;  1STE A;  1TWG B;  2EYO A;  2KED A;  3K5M A;  1LT6 D;  1X32 A;  5JVH 3;  1LT4 D;  3TBI B;  1CHQ D;  4LAA A;  3MVV A;  3DMU A;  1L0Y B;  3T16 A;  3BVM A;  1BUV T;  2L4N A;  4DXF A;  3MTS A;  1ROD A;  2HCC A;  3HZX A;  3I90 A;  4FXD A;  1HTP A;  1OXU A;  2QCP X;  2K5Q A;  3U9O A;  1JE4 A;  1AP0 A;  3NHH A;  5M9O A;  4C1N K;  2E2I B;  3GTO B;  1AEX A;  2DNE A;  4RWS C;  1GUS A;  2PPB C;  1BBX C;  1Q12 A;  1HQR D;  3CRL C;  4X3S A;  2D62 A;  2OT2 A;  1JR0 D;  1LAC A;  1QCB D;  2BE5 C;  3D6C A;  2PZW A;  2IL8 A;  2F0H A;  2RA4 A;  3I4L A;  2E74 C;  1SMY D;  5CGK A;  5D3D A;  3N6R A;  3K7A B;  1A15 A;  1D6E C;  1EYD A;  1C4Q A;  1G91 A;  4K5W A;  4N9P A;  3J81 L;  4XIG S;  1EY4 A;  1EU4 A;  3PUW A;  4RGM A;  2NVY B;  2K04 A;  3VA5 A;  5IT9 L;  1I4P A;  4ZYS A;  1BO0 A;  1I4Q A;  4UAI A;  3PUV A;  3RZD B;  3HOV B;  1KNA A;  4I65 A;  2VB2 X;  3EQL C;  4RFB A;  2OEO A;  3FPU B;  4J8Q A;  4A3K B;  3S16 B;  4ME5 A;  4X3K A;  1UAP A;  2A6E D;  3L9A X;  2K7V A;  3LWE A;  3SR1 A;  2K28 A;  3M3Y B;  3P75 A;  4DU9 A;  2AUJ D;  2XWB B;  2K03 A;  2L5T A;  3MA2 B;  1HHV A;  3H09 A;  3NE5 B;  4ULL A;  1S5B D;  1T5X D;  3OW7 A;  5E3F A;  5C5M A;  2RSO A;  1BNZ A;  5FLX L;  1GHK A;  4RA8 A;  1UUP A;  2SDF A;  4HMJ A;  5IOD A;  1QJO A;  3V96 A;  5I2X A;  1TU2 B;  1EEF D;  5C4X B;  4H7B A;  1D1I A;  1HTL D;  2A6H C;  3W3A A;  3D3R A;  4TRD A;  4PNY A;  5JEA H;  4Y7N B;  2D2C C;  5A2Q E;  1H9K A;  1I50 B;  5AFW A;  4C1N I;  3GTK B;  4XXE A;  1RTO A;  3IFT A;  1MBY A;  3T4A C;  2EZV A;  1CZG A;  1PFB A;  1WTV A;  1STY A;  5J1Z A;  2JP1 A;  5ELC A;  2KA7 A;  1FGB D;  2EYJ A;  3T13 A;  2F0N A;  1EZ6 A;  3MC0 B;  1PZJ D;  1V43 A;  1DJR D;  2F0O A;  3VYR A;  3AB9 A;  1RD9 D;  3S14 B;  5C44 B;  2JXM B;  4DFA A;  3OOC A;  4NW2 A;  2O2L D;  4Q0F A;  2ICE C;  4K6D A;  2Q8I B;  1BQQ T;  1S4Z A;  5CC4 A;  3R2I A;  2R61 A;  3GP7 A;  1LLR D;  5CV7 A;  2QF7 A;  5JVG 3;  2NZ1 D;  2LMC B;  5HGT A;  1B50 A;  4BY1 B;  3TP7 A;  4K8I A;  3TN2 A;  2F0G A;  1IYU A;  3J80 L;  2FMC A;  3OMG A;  4OO1 I;  3K57 A;  4C56 C;  5IGG A;  2Z4I A;  4JBW A;  2FHT A;  3HOZ B;  1ONL A;  2JSO A;  1KTK A;  1OXX K;  2E76 C;  3VYS A;  5K36 H;  3NTH A;  4C3J G;  3S1N B;  2I07 B;  3J81 E;  1RDP D;  3WOE A;  2EOT A;  1G2T A;  1BDO A;  1SNP A;  4LJZ C;  4G57 A;  1JQY D;  2KEE A;  4M1U B;  4X3U A;  5IT9 E;  2B2T C;  1OXV A;  2F0V A;  1TS3 A;  1I4R A;  1M4V A;  3MFY A;  1V1O A;  3I72 A;  1GHJ A;  1ILQ A;  1I3Q B;  1D5Z C;  2KCC A;  2XSC A;  4A3F B;  4FYD A;  5DAU A;  1SYG A;  3VR5 A;  2Z1C A;  4FF1 A;  1UNS A;  3U9S A;  4ZK9 B;  3NBI A;  3A54 A;  3SK8 A;  5K36 G;  1HFG A;  1SND A;  5LHY 1;  2WII B;  3DHQ A;  5COR A;  2BDN A;  4C3J B;  3PIP 3;  2ZXR A;  5ELB A;  2IWH A;  2EDG A;  1F9S A;  4ZKC B;  2NN6 I;  1TWH B;  1STG A;  2PMZ B;  5COY A;  1R4P B;  1X3Q A;  4XQN A;  1NSN S;  2EYP A;  1EZ8 A;  2IX3 A;  1JC7 A;  2EYL A;  3K5N A;  4DAV A;  1U4L A;  2AQ2 B;  5C4J B;  4DAP A;  1F9Q A;  1EWH A;  4WRD A;  5E4X A;  3GTG B;  3S15 B;  3A7A B;  1MD2 D;  2FJ2 A;  1JCK B;  2KJX A;  2RDG A;  4XQQ A;  1F9P A;  5E1F A;  2A73 B;  1EY7 A;  1XWE A;  2RBM A;  2NWG A;  1V1P B;  1CM9 A;  1JWM D;  5IGE A;  4K5X A;  1X3P A;  3LWU A;  5F2D A;  4BWG B;  3GTM B;  1NUC A;  2ZT9 C;  5IGD A;  1GUW A;  4QF4 A;  1A2U A;  3HP3 A;  5FO8 B;  3RMH A;  1F2M A;  5E4W C;  1BCP C;  2X6L A;  2JE6 I;  3FRP B;  4B9W A;  2C5C A;  1EY0 A;  1J9O A;  2XIW A;  2M00 A;  1HFN A;  3MXP A;  1SDF A;  1YNN C;  2VB3 X;  3J80 E;  4FF3 A;  2O5J C;  1F2Y A;  1NR4 A;  2RDF A;  2RSN A;  1JWU D;  2WV6 D;  4LK1 C;  2B2U C;  1LT3 D;  4RHR A;  1EL0 A;  4QCL A;  1TVX A;  2MUY A;  3PUX A;  4PMC A;  4G7Z C;  1SE2 A;  1M8A A;  1SNM A;  3OIP A;  1KNE A;  3AU7 A;  3K58 A;  3BDC A;  1WTW A;  4JK1 C;  2RQX A;  3PUY A;  2I46 A;  1E2V A;  3UI2 A;  2NBF A;  5BN4 A;  1NAP A;  4A3M B;  4FO2 A;  4EVO A;  1A6X A;  3D4D A;  3BDO A;  1EFI D;  1PZK D;  5CV8 A;  4KTA A;  2A68 D;  1A3U A;  3GV3 A;  2EJM A;  1DXM A;  1DYQ A;  5CYU A;  1Y8P B;  4A3I B;  4BY7 B;  4KHZ A;  1PLF A;  3VR4 A;  5HUR A;  4EGV A;  1EIG A;  5K5P A;  5IGB A;  3S1Q B;  3HRZ C;  4XDX A;  2K32 A;  3K5O A;  2B39 A;  1JB3 A;  4F87 A;  5ELD A;  2XNA C;  2A5H A;  5DM7 3;  1AZP A;  3C2P A;  1TQO A;  1Y1W B;  1D1K A;  5C3W A;  3BVZ A;  3A55 A;  4OIJ A;  1ZKO A;  1LTS D;  2B2W A;  1BCP B;  2AUK A;  2KUM A;  3EFX D;  4KKT A;  2AWO A;  5LL6 X;  3EVQ A;  5NUC A;  5C4Z A;  2F0I A;  1SJE D;  1AW7 A;  4R9W A;  1PRT D;  1B53 A;  3MZ5 A;  2IX1 A;  1B9M A;  2L12 A;  5I9O A;  3VYU A;  1JOK A;  1AZQ A;  3SDZ A;  3SHL A;  5ISR A;  4XTC S;  2F0F A;  4QMG A;  2WP8 J;  3VR2 A;  2J4X A;  1D5M C;  3R93 A;  3J7Y W;  1B44 D;  2JA7 B;  1MSH A;  2CW0 D;  3P20 A;  5EBD A;  1E0B A;  4LMQ D;  2PCF B;  1B1Z A;  4DK0 A;  2B2V A;  3PO3 B;  2PYK A;  2KOL A;  3P7J A;  1BCP F;  1LTB D;  1NCV A;  5M3F B;  1MSG A;  2WAC A;  5M3M B;  2PZT A;  1RJT A;  2ZXP A;  4IFD J;  1RKN A;  3I4N B;  2Y0S B;  5M5X B;  2MPM A;  2F0P A;  2LKV A;  3VR6 A;  1LT5 D;  4PQX A;  3TDQ A;  3ONA B;  4KY5 A;  2N88 A;  1SBB B;  3QG1 A;  1VF7 A;  3X3M A;  3DXJ C;  3I8Z A;  2K01 A;  2TMP A;  5M5Y B;  3NTK A;  3NTI A;  1I6V C;  2LFN A;  5J22 A;  4ZUI A;  5CR3 A;  4HAE A;  1KDA A;  3EA6 A;  1U9R A;  3KLS A;  2SOB A;  1KAA A;  3HOY B;  4KKS A;  1QB5 D;  2F1M A;  3OMC A;  4L6T B;  4IUT A;  1SAP A;  5EPK A;  4TQU S;  2Z4H A;  3BVG A;  4O42 A;  2L55 A;  2VNU D;  1ZXT A;  2XN9 C;  1ENF A;  5IIF A;  1WTR A;  4H44 C;  1STB A;  3CRK C;  2A74 C;  4ZQ3 A;  1SNC A;  1Y8O B;  3AMU A;  1FNW A;  4FNF A;  1Q90 A;  1Y8N B;  1PTO C;  1KAB A;  1C8C A;  5KEE A;  1ICW A;  3DWQ A;  1PTO H;  1RF2 D;  1MGS A;  4P2C B;  1IW7 C;  4NP5 A;  1BOS A;  3DM1 A;  2EYM A;  5C0X J;  1DOK A;  3R3O A;  1DZ1 A;  1VMP A;  3L7Z C;  4RGO S;  2VXW A;  1HPC A;  5C3X A;  1AFP A;  1A3V A;  5G3L F;  2EJG C;  3HEJ A;  4RHS A;  3ERO A;  2EXZ A;  1GUO A;  4KKU A;  4HCS A;  1F2Z A;  2BA1 A;  2WB1 B;  5KNC A;  1STA A;  4RKB A;  3MEH A;  1LTT D;  5JJZ A;  3NQT A;  2X69 A;  5IOC A;  4BBR B;  3RZO B;  1S5D D;  1JIC A;  1PDQ A;  1H9S B;  1EQT A;  2A69 D;  5I2Y A;  1GUN A;  3GO5 A;  4C3H G;  4K14 A;  2M9V A;  4KJO A;  1IKL A;  3QOL A;  1WTQ A;  5D3I B;  1JOO A;  3DEO A;  5C4H A;  4IQZ A;  4S3S A;  4MIU A;  3H94 A;  2SNS A;  1PTO B;  4QUF A;  1ENA A;  2HCI A;  5ELF A;  3MXU A;  3H3V C;  1O7L A;  2EY1 A;  4H13 C;  2L1B A;  2EVB A;  2EE1 A;  2AQ1 B;  3S2H B;  4ZKB B;  4RCN A;  3L3O C;  1CI3 M;  5KRU A;  2BE5 D;  2OXP A;  1HUN A;  3TZD A;  4C3H B;  4IUP A;  3G7L A;  2L11 A;  1QWY A;  1SFO B;  3I70 A;  4U68 A;  4XT3 B;  2QIL A;  1FR3 A;  3W2D A;  5EPL A;  4V19 0;  2D9U A;  1VF5 C;  3MFG A;  1CQF A;  1Z6H A;  1PTO F;  1G29 1;  3HOW B;  2M2L A;  3C1E A;  5I6W A;  3BG3 A;  2MJ8 A;  5EBC A;  1FNU A;  4RH6 A;  3SK5 A;  3S2D B;  4ABN A;  3NUC A;  3I4M B;  1DOL A;  2WKD A;  4DNT B;  1O80 A;  4RKL A;  4X3T A;  4PMW A;  3M7G A;  3M4O B;  2KEC A;  2NB0 A;  2VUM B;  1KLU D;  4CHT B;  2ENB A;  1HXY D;  2F0W A;  3S1M B;  4WJW A;  4K2L A;  1G6Z A;  2RVL A;  1YNJ C;  1F2L A;  1B2T A;  5EKK A;  1HA5 A;  1TS4 A;  2PO4 A;  2E75 C;  1SYD A;  3A8J E;  3IFD A;  5FLX E;  4B08 A;  4UDU C;  4G7O C;  2WIN B;  2F4I A;  2WAQ B;  2F0L A;  1QNU A;  2IPK D;  3HG9 A;  1TY0 A;  4ZAI A;  1R4Q B;  4HSV A;  3MXG A;  1WD1 A;  2IT1 A;  4FVM A;  3KBX A;  2B2Y A;  2EPB A;  1STH A;  2X6G A;  1PMR A;  2O4X A;  1Y69 U;  4ZRZ A;  4KN4 C;  2KCN A;  4XYO A;  3TP5 A;  3FKI B;  1PRT C;  2MHV A;  1CA5 A;  2O5I C;  1G2S A;  4AYB B;  1EEI D;  1S5E D;  1HUM A;  3NXW A;  4KY7 A;  4KK7 A;  5JEA J;  4FP5 D;  3E6Z X;  1WCM B;  2DY8 A;  1IKM A;  4BA1 I;  4IFD H;  3SEB A;  4OIK A;  1T5E A;  4H0L C;  4ODG A;  2E2J B;  1SNQ A;  2RKS A;  5FO9 B;  1I6H B;  2F0E A;  1DD2 A;  5KIX A;  2R92 B;  4RGT A;  1TII D;  3S17 B;  1PFM A;  1CT1 D;  1RCV D;  5J39 A;  4NDX A;  2K6A A;  4XYQ A;  3K5L A;  1U4R A;  2LY7 A;  4WOR A;  1D2B A;  2Q8R E;  5KYI A;  4IUQ A;  4DN4 M;  1SE3 A;  3HKZ B;  1EIH A;  4ZUJ A;  3PIO 3;  4FXG C;  2F0Q A;  1CA6 A;  4IFD G;  2B8G A;  4C3I G;  1VMC A;  2J0T D;  4XT1 B;  1I4G A;  3GTP B;  3NP8 A;  3O13 A;  2NTT A;  2QKI C;  1K8O A;  3F2U A;  1SEB D;  4MN3 A;  1SMY C;  5FO7 B;  2BA0 A;  1XYI A;  1KLG D;  4DF7 A;  1Q1B A;  5EJW A;  4V0B A;  3J7A F;  4KY6 A;  4HTH A;  2F0D A;  3MWY W;  4IUR A;  5CBE E;  2PNR C;  4OO1 H;  4FXK C;  4K8J A;  4WFN 3;  5KND A;  2R3Z A;  1WTP A;  3QJY A;  5EKL A;  3BYT B;  1VCI A;  5C0X H;  1PRT B;  3E0J A;  3H0G B;  1PZI D;  1GUG A;  1SJH D;  2K05 A;  3H91 A;  1C48 A;  2EY5 A;  2F0K A;  5CV6 A;  2BDO A;  2BCO A;  4K6L A;  4C3I B;  1PXU A;  3FVQ A;  5CMD A;  4A3G B;  5C5L A;  2A6E C;  2NVQ B;  4CKE A;  1PYW D;  5I9P A;  4KD3 A;  2N55 A;  3BYY B;  3E5S A;  4OO1 G;  1IYV A;  2D5D A;  2JA6 B;  1U4M A;  1OXT A;  3Q6S A;  3NWS A;  4ID6 A;  5C0X G;  4A93 B;  4ZLT F;  3NK9 A;  1Y1V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...