4LF6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6Q00
1XNQL 4A3LG 4P72A 1JMCA 4HJ7A 3KYHC 2N49A 1UE7A 4YHHQ 3AFPA 4LFAQ 2ASBA 1MJCA 4IPGA 1VQHA 1VQIA 2EIFA 4JI4L 1N34Q 4QJFA 2ES2A 4ALPA 4GLVB 5DLQE 4DR6L 2B3GA 2PNHA 2I0QA 5IP7H 4UP8A 2Q2HA 3OW2A 2DGYA 4HIOA 1FJGQ 2HIXA 1Y1VG 3NEMA 1PA6A 4DR2L 1U5KA 4TQUS 1FJGL 3FKIH 2K14A 2BA1A 2AMCB 4R4CA 4AIMA 3UDIA 4A3DG 1HNZL 3HOXH 5J3BA 1HNZQ 2R7ZH 4OWTB 4C3JH 2R7FA 3CC2A 4PMWA 1VQAA 2CKZB 2NN6I 2ZTDA 3I4MG 1H95A 1L1OB 2E2IH 1XMOL 4LF7Q 3PUWA 5IYCG 1W3SA 3PUVA 4B3SQ 2MO1A 4JI1L 1Q1BA 2L15A 2OQ0A 4GOPB 1WCMG 2HQLA 1I94L 4JBMA 1EQRA 5C0XG 3T1YQ 1IBML 3CD6A 3T1YL 3GTKH 4UY8C 4HJAA 1BBUA 1CKMA 4LFCQ 5C3EH 3L2PA 4JOIC 3FHWA 1K83H 4JOIA 2EQSA 2N78A 2AWOA 1OXSC 2CWAA 4ME3A 4P74A 1I6HH 1OXVA 5M3FG 4MZ9A 4MTNA 5JJKA 5GROA 4QGUA 3KJOA 2K5HA 4IPDA 1YZ6A 4YWLA 4A3BG 2CFMA 3HOYG 1MJEA 4IJHA 5IYCH 3CCUA 4JI5Q 1SLJA 1WOCA 1PH7A 1KD1C 1N33Q 1TWGH 2E8GA 4R4OA 1G51A 1N9WA 2K5VA 1V9PA 3AYHB 4L5TA 1W2BA 5IP7G 2OTLA 4YY3L 2I5LX 4DV3Q 1IZ6A 1TWFH 2JA8G 3FKIG 3OYYA 1KQSA 1M1KC 5IT9c 5C4JH 5GAGC 4X6AH 1LM0A 1CKOA 1MKHA 4UP7A 1YIJA 1RL2A 1Y14B 2D0PA 2K50A 3E0EA 4C2MH 1X6OA 2QA4A 4IO9A 1YJNA 1K8GA 2BH2A 4JV5Q 1QZGA 1VQLA 4DR7Q 2AKWB 2HIVA 3W1GA 3WWVA 4A4IA 4AH6A 3J80c 4JI4Q 2A8VA 2HT1A 4BY7H 1MIUA 1HNXQ 1L1OA 2F4VQ 4DR4Q 4YHHL 4OO1I 2JE6I 4LF9L 3CQZH 5AJ3L 2CQOA 2EXDA 1HJPA 1VQNA 5C0XJ 4A3IH 4YWMA 1PH8A 5C4XG 3AQQA 1YITA 3ZJYC 2E2JH 1EFWA 3S15H 3BZKA 3PCOB 3OTOL 1HR0W 4C3HH 2IHFA 3S24A 3PO2H 4KHPL 1EQQA 2PMZE 3G6EA 3DLLA 2RCNA 1E3PA 4JI8Q 1YJWA 2C35B 2PQAB 2WB1E 3U50C 5FJ8G 4DV2Q 4O2DA 1N8RC 5E7NA 4BBSH 5M3FH 1JE5A 1ASZA 1L2FA 2A19A 2RF4A 4JI1Q 4AYBE 2MNAA 1SN8A 3EN2A 1WFQA 1NJIC 5C4XH 1HZBA 3IRBA 5FLMH 3KDFA 4A3IG 1B7YB 5M3MG 1SFOH 4JBJA 3HOXG 4JYAQ 4GNXA 4XTCS 2CCZA 5K36G 4GNXC 3U4VA 3M7NA 1Q7YC 3PO2G 4DAMA 2GVBA 2YYZA 2KBNA 1VQFA 3L0OA 1HNWQ 4TVAB 3CAMA 2IX0A 1WJJA 1SROA 1B8AA 3M9BA 5LMUQ 3M3YH 4DR1L 4A3CH 1XNRL 3PF4A 5JJIA 4XIGS 2E5LQ 3I56A 3MEFA 3CCEA 4A75A 1YJ9A 1IBLL 2R93H 4A3EH 1N34L 1VQ8A 3F8TA 3JAMi 4OWXB 4JI3L 3TEHB 4UP9A 4NXML 2WP8J 2LXKA 5GQOA 1QVGA 4BXXG 2N3SA 1PYBA 5ELOA 4X65L 2YTXA 3PO3H 2RHSB 1Q46A 3HKSA 1C0AA 1HZCA 2IX1A 2YTYA 3RN5A 4AQYQ 3T1HQ 4A3MG 4LF6Q 3T1HL 4A3BH 1YHAA 1IL2A 3DM3A 5GADC 4A3EG 4LWCA 3K0XA 1KRSA 4B3SL 2I5HA 4A3KG 4A93H 4WJ3M 3UDXA 2H5XA 1GD7A 1VQ5A 2LXJA 4WJ4A 1CKNB 2A1AA 3F1ZA 3STBD 4DV1L 1NY4A 4R4TA 2UUCQ 4OX9Q 3M4QA 1NBWA 2R7ZG 1FVIA 2KHIA 1E24A 2VUMG 4JI0L 1CUKA 3CCQA 1QVFA 3HOZG 3CC4A 3GTQH 3D0FA 3ER0A 2ZJPA 4IFDI 4DUZQ 4GKKQ 3HOUH 3CW2C 2ZM6L 4LUZA 4BBRG 2UUBQ 2JA7H 1VQ7A 4AQYL 1E1OA 3EBEA 2R6GA 2GN5A 2D0OA 1XPRA 3GDEA 3Q8DA 3J7ZC 3CCVA 4GKJQ 1XNQQ 1PFSA 1VQPA 2JK8A 5IP9H 1TWCH 3LGJA 4KI0A 1L0WA 1K3RA 4B3TQ 2UXCQ 4Y7NH 4GN5A 3ERSX 2KCMA 3TREA 1IBMQ 1P8LA 4DV7L 2LSSA 2PI2E 3EIVA 1HZ9A 5C44G 1UWVA 3BZCA 2UXCL 1L1OC 4PZ6A 5FLMG 3RZDH 3JAMc 3L7ZC 2VS1A 1YVCA 2XTIA 1N32L 4EX5A 1PH6A 3J81c 1Q86C 2I5MX 4BBSG 5LMNW 1PH5A 1X3GA 1GM5A 2PI2A 4NXMQ 2NVQH 1T9HA 3GTJH 4IOAA 2F4VL 4DR4L 4NXNL 3ULLA 5FJ8H 3HKZE 4POFA 4A3GG 3FP9A 1Q8KA 3K80C 1GVPA 4PZ7A 2ZM6Q 1Z47A 1OXXK 2IHEA 1CSQA 1SR3A 1X3EA 3BU2A 1KRTA 3PUYA 2Y0SE 5M5XH 1QUQB 1VQMA 1VQ9A 4L5SA 3H3VI 1HZAA 4DV6L 4OO1G 3CF5A 1S72A 1BKBA 3PGZA 1TWHH 3RLOA 3HOYH 1EYGA 1C7YA 2JA6G 2AWNA 1VQDA 4JG2A 1SRUA 2VNUD 1BBWA 4X64Q 4LW1A 3I7FA 1LYLA 3HOUG 1WYDA 4LF4Q 3F2DA 3S1NH 1HR0Q 4YCVA 3KDFB 1BVSA 4FDBA 2N8NA 2VZAA 3M4PA 3H0GG 3CMEA 1SMXA 4LFBL 4IJLA 4LF9Q 4LFCL 3TRZA 1JJCB 4DV7Q 4A3DH 3E9IA 3GD7A 4H02A 1I3QH 1LUZA 4DKAC 4DR7L 4KHPQ 1XMQL 3G4SA 4DV5Q 4B3ML 4DV0Q 2ZTCA 4P75A 4BA1I 2VQEL 4DR1Q 3ULJA 5FLXc 4HJ9A 3J81j 3HOVH 3PIPA 1YHQA 2B63H 2Q2IA 1G291 3G71A 2OCEA 1R9TH 5IWAQ 2VQFL 4DAYB 3NENA 4P71A 1I94Q 3W5OA 4HJ8A 4JBKA 4DV6Q 3AEVA 2UXBL 2DUDA 2NVTH 3JC66 3F2CA 4LF7L 4NPSA 3RNUA 1IBKQ 4B3RQ 5IE8A 3CCJA 2JEBI 1VQ6A 3STBC 2UXBQ 1X55A 1YNXA 2MFIA 3RR5A 4DR5Q 1JJGA 1KHIA 4GS3A 4LF6L 2F3IA 4JYAL 2IY5B 1LTLA 1VQGA 1JT8A 4DR2Q 1E22A 4A3LH 2VQEQ 5IYDH 2JA5G 2Q2TA 4DV5L 2V1CC 5AJ3Q 2JA8H 1U0LA 1J5EL 2CWPA 4A3MH 1I5FA 3KF6A 5GAEC 4JI8L 3KF8B 4IOCA 1J5EQ 2ZJQA 2UXDL 1Y1WG 3F2BA 3CMAA 3OTOQ 4GN4B 4RMFA 3PUZA 2BH8A 1DGSA 3J7A5 4QIWE 2NZOA 3AFQA 3GO5A 1YEZA 4GKJL 5HY6A 4X64L 2OTJA 1V43A 4DR3Q 1VQOA 1X9NA 2JJQA 4DV3L 4X62L 2K75A 1UE1A 1A8VA 3UE1A 3HOVG 3B6YA 2JA5H 2WAQE 1VQ4A 4IPCA 1IBKL 1XNRQ 2JA9A 4DUYQ 3PO3G 3S16H 3NBHB 4DUYL 3HOZH 1VQJA 1HR0L 3I4MH 2QEXA 4A3JG 4PG3A 1PH4A 1QUQA 4QY7A 4YWKA 3CCRA 1EUJA 4DK3C 4GN3B 1JJ2A 1TWAH 4X66Q 1A62A 1K9MC 1WCMH 2UUCL 3A74A 4LUVA 4JI6L 4NXNQ 3S1MH 2WB1G 2KENA 4HIMA 4YCUA 1KL9A 3A5ZB 3CCMA 4B3RL 2ID0A 2NZHA 1J6QA 3CCLA 4RG1A 3J80i 2MO0A 2WFWA 5JEAG 3SGIA 2FXQA 1KAWA 4A76A 1M90C 3A0JA 1EWIA 4NB3A 2R93G 1E1TA 4DNIA 1WI5A 2K5NA 1K8AC 3TS2A 4DV4Q 2RHQB 1YBYA 4EQ5A 3H0GH 2ZJRA 3KF6B 4DV4L 1N36Q 4BA2I 2F52A 1I50H 1EOVA 5ELNA 1VQKA 2OQKA 3HFZB 4QL5A 4LFBQ 1YI2A 4BY1H 4IPHA 2B63G 1NMGA 3GTLH 4IFDG 2ALYB 2PQAA 4R4QA 4HIKA 3BJUA 2OWOA 3U4ZA 2WAQG 3PUXA 4DR6Q 2ZTEA 4X66L 1OXTA 1JB7A 1ASYA 4JI2Q 5IWAL 2VQFQ 3PSIA 4GLXA 4JI2L 1XPOA 4OWWB 1AH9A 4GKKL 1VCIA 1X54A 4UPAA 1UE6A 4POGA 1QZHA 2R7DA 4MNOA 3TQYA 1Q1EA 4LF8L 5IYDG 2KHJA 5M5WH 1X56A 1N33L 1VS0A 3I4NG 5EAYA 1RIPA 4GLAC 5IYBG 4DK6C 1IYJB 1C9OA 1EIFA 4A3GH 4DR3L 4A3FG 4DV1Q 1VQEA 1XTDA 3HOWH 3G48A 1N36L 4B3TL 4L5RC 5LMNQ 1D8LA 1UE5A 1AE2A 1VQCA 3RN2A 1HNWL 5JEAJ 2Z6KC 5LMNL 1CKNA 3TS0A 1Y1WH 2Z6KA 1XMQQ 1HH2P 4B3MQ 4LF4L 1SE8A 1NE3A 2MQHA 3D31A 4K0KL 3S1QH 3H15A 1HNXL 1OTCA 3RLNA 3UDFA 5BR8L 2HHHQ 2UUBL 3S1RH 4YCWA 4DUZL 3S14H 5IP9G 1P16A 1IBLQ 1A63A 4A93G 1G6PA 5HGQA 4GOPA 1VQBA 4GOPC 1XMOQ 4LF8Q 3S2DH 3S2HH 1NTGA 4DPGA 5C44H 1KIXA 2BA0A 1X3FA 1PYSB 3RLFA 2VW9A 3GTMH 4YY3Q 3UDGA 4KLKA 4JBWA 3KOJA 3VDYA 4OXPA 1PVOA 2Q2UA 1KXLA 1EIYB 2R92H 3E9HA 4A3JH 2QGQA 1Y1VH 1S40A 1TXYA 3MXNB 3PV0A 4GNXB 4C3IH 5JJLA 1CSPA 2VUMH 2AHOB 2IT1A 3CPFA 1KC8C 3KFUA 4X62Q 4BBRH 4LFAL 4HIDA 4Y52H 3HKZG 1PV4A 3K8AA 4O0AA 2XGTA 4R4IA 2JA7G 3GTOH 1E7ZA 4KHZA 5GAHC 1D7QA 4HJ5A 4LUOA 3S17H 1N32Q 2E2HH 3CXCA 3H3VH 2B29A 1Z9FA 1IXRA 2R92G 4JI3Q 3RZOH 1OXUA 1XJVA 1PH9A 4APVA 3W1BA 1Q12A 1X65A 1S3OA 3ULPA 3GTPH 2UU9Q 3CP0A 5M3MH 1Q82C 2UUAL 5IY0A 5H1SE 1PH2A 4LF5Q 4IFDJ 1QVCA 4LNQA 2D62A 5C0XI 2YU9H 2Z0SA 3KJPA 2K52A 3I2ZA 3PIOA 1PH3A 4BY1G 4J15A 1Q81C 4JC0A 2VL6A 3M85A 2NVYH 4AYBG 1PHJA 3GTGH 4DR5L 4JV5L 3CC7A 4P73A 3I4OA 2E5LL 1NMFA 4BXXH 4PZ8A 1FGUA 2JQOA 5M5YH 2K4KA 4JI0Q 3PF5A 2YV5A 1PH1A 3HOWG 2GVAA 3KLWA 4JI6Q 5BR8Q 2HHHL 2JEAI 3CPWA 4A3FH 4OX9L 3K7UC 2ATWA 1XPUA 4BY7G 2JA6H 1A0IA 4K0KQ 1V1QA 5IYBH 2KCTA 1FL0A 3NELA 4QQBX 4A3KH 1GKHA 4R1JA 3I4NH 4OONA 3UE0A 4A3CG 3M4OH 1AE3A 3K81C 4DV0L 3A5UA 1K0RA 4LF5L 4JI5L 2YTVA 2NN6G 5C3EG 2VY3A 1GO3E 2UUAQ 4JI7Q 2UXDQ 4DV2L 2UU9L 1B70B 1O7IA 3K7AH 4JI7L 1UEBA 4L5QA 4X65Q 2Y0SG 4JCVE 3J81i 3I55A 3CCSA 1K73C 1YHBA 2NVXH 3ICEA 3U58A 5LMUL
chains in the Genus database with same CATH superfamily
4P72A 2CVRA 2N49A 3AFPA 1QILA 4CHTB 4PMBA 1BCPB 1JICA 1KABA 4IPGA 1VQIA 3J7AV 2ES2A 1RF2D 1T5XD 2P5ZX 5IP7H 3OW2A 2Q2HA 1FJGQ 1Y1VG 3NEMA 1U5KA 3ONAB 4R4CA 1CK1A 5C5LA 3HP3A 3UDIA 1HNZL 1HNZQ 2R7ZH 4C3JH 5I2XA 4N8X1 4A3IB 1H95A 1F2ZA 3NTIA 2E2IH 1XMOL 2QKIC 5I2YA 3PUVA 3PO2B 2F0GA 2OQ0A 2HQLA 1JORA 4KK7A 3X3NA 4IUVA 3GTKH 1IBML 3T1YQ 3CD6A 2NWGA 2KOLA 4J6HA 3T1YL 2KQ3A 3GTLB 3AB9A 1ICFB 4P74A 1I6HH 2LFNA 4OHJA 2B2WA 4MTNA 2XVSA 2PCFB 1JWMD 2K5HA 1YZ6A 2CFMA 2X6LA 1MJEA 4JI5Q 1SLJA 1N33Q 1ET9A 1TWGH 4K8IA 4R4OA 3NQTA 2K7VA 3AYHB 4A3EB 1S5FD 1LT3D 2GA4B 2EYLA 4BBRB 4ABNA 1TWFH 2PO4A 1PTOB 4CKEA 1M1KC 5C4JH 1B3AA 1LM0A 1CKOA 4N9PA 4QCLA 1A6XA 1RL2A 2K50A 4DXFA 4NKLA 4JV5Q 3SHLA 2HIVA 4A4IA 5CBEE 1EU4A 4BY7B 4OO1I 3SK8A 1B4OA 5AJ3L 1EL0A 2EXDA 2SEBD 1HJPA 4LMQD 4A3IH 1VQNA 4YWMA 3AQQA 1YITA 4CJ2C 3DXJC 1EWHA 1TS2A 3OTOL 1KDCA 1CI3M 3PO2H 1KDAA 4KHPL 2PMZE 2C35B 4OELB 2PQAB 3U50C 4DAPA 2X6GA 1KNEA 4DV2Q 1N8RC 4IUUA 5E7NA 2RF4A 2CW0D 3A8KE 2MJ8A 1ZEQX 1NJIC 4A3IG 5F2DA 5G3LD 1B7YB 3BVZA 4JBJA 4JYAQ 5K36G 4IALA 3U4VA 3PO2G 2Q8RE 1Q7YC 2GVBA 3D4DA 2F0TA 1HNWQ 3M3YB 3M9BA 5LMUQ 4S3SA 3RMHA 5IGFA 3I56A 3MEFA 2CH4A 1IBLL 1LTID 4A3EH 4X3SA 4OWXB 5M9OA 2R61A 1LTRD 2EY2A 1JWSD 4C3IG 5I6YA 5GQOA 5JJZA 4K2LA 2YTXA 3PO3H 2RHSB 1W6KA 1Q46A 3HKSA 2IX1A 2EYMA 1B44D 3A54A 3T1HL 3PIO3 4A3EG 1KRSA 4HSVA 4A93H 1U4MA 4WJ3M 2H5XA 5EKLA 4WFN3 1CKNB 2EJGC 1LTAD 2B2UC 4R4TA 1NBWA 2R7ZG 4ZK9B 3E3XA 3GTGB 3EQLC 1BBXC 1CUKA 3CCQA 3H91A 3GTQH 3D0FA 2ZJPA 2K1BA 3CW2C 2JA7H 3EBEA 2GN5A 2IW3A 3GDEA 3CCVA 1XNQQ 1A2TA 2JK8A 5IP9H 5EBCA 3TBIB 4Y7NH 4GN5A 2KCMA 3CHBD 1BOSA 4DV7L 5C44G 2Z9HA 1UWVA 3TZDA 2UXCL 1L1OC 4PZ6A 3RZDH 4XDXA 2E76C 1Q86C 4FYDA 2NVQH 1WTXA 1PH5A 1GM5A 1EU3A 3Q22A 1T9HA 2ZXRA 4FP5D 4X3KA 3ULLA 4POFA 2F4VL 3K80C 1WTVA 1Q8IA 1CSQA 1SR3A 4UHVA 1QUQB 4OO1G 3CF5A 1S72A 4Q5VA 3PGZA 1QWYA 2JSOA 4CKBA 3QO2A 1B50A 2AWNA 3TZUA 1BR9A 1LYLA 3HOUG 5E4XA 1HR0Q 4YCVA 5A2QL 4FDBA 2N8NA 1SYCA 4LFBL 4K6DA 3TRZA 1JJCB 3HS0C 4K5XA 4NP5A 1VF5C 2OEOA 4DKAC 4KHPQ 1XMQL 3G4SA 1AP0A 2ZTCA 4P75A 2VQEL 4DR1Q 1I6HB 5FLXc 2WAQB 3HGBA 1NR2A 1IW7D 1PRTB 3PIPA 1R9TH 1I94Q 3FVQA 3W5OA 4JBKA 4DV6Q 3E0JA 1DXMA 2Q8TA 3F2CA 1RTNA 3RNUA 1IBKQ 4B3RQ 1FR3A 2F0VA 2JEBI 3K6OA 5IE8A 2YU9B 1X55A 1YNXA 1KHIA 4GS3A 1AZQA 1WTPA 2K28A 1LTLA 2A6EC 4IUQA 4DF7A 3VA5A 2E2JB 2BE5D 2VQEQ 2V1CC 3MWYW 4G4KA 1ZKOA 1J5EL 4A3MB 4JI8L 3S14B 1XYIA 4ZLTF 5IGEA 5BN3A 1H9SB 1MGSA 4RMFA 5IGGA 2IJ0A 2QW7A 2Z4HA 3NWTA 1V43A 4DR3Q 2JJQA 3LX0A 2K75A 1UE1A 3UE1A 3NK9A 3HOVG 3J80E 2WAQE 1S5DD 3PO3G 1XNRQ 4IUTA 2XSCA 1B9NA 3HOUB 3V05A 3CCRA 4DK3C 2B2YC 2DN8A 3I73A 1TWAH 2LS01 2B2YA 3URYA 4X66Q 4NXNQ 2KEDA 4LUVA 2UUCL 4MHEA 2KENA 1PTOH 5CV4A 3A5ZB 5C4JB 3CCMA 2NZHA 2WFWA 2FXQA 2JP1A 2NBFA 1M90C 2EDGA 2R93G 1WTHA 4DNIA 4F8MA 5BN5A 4IUNA 3F2UA 3H0GB 5HURA 2F52A 1I50H 1JR0D 1STGA 2K5QA 1NMGA 2ALYB 2L1BA 3BJUA 1MSHA 1U4PA 4DR6Q 1HTLD 2MUYA 4JI2Q 4EVOA 5J22A 4GLXA 1E2VA 1AH9A 3C1EA 1VCIA 1X54A 4I7AA 3TQYA 2EY1A 4H44C 2D9UA 5LHY1 5EAYA 3H09A 1F9PA 4QB4A 4DV1Q 1VQEA 4A3FG 4MIUA 3MC0B 1N36L 4B3TL 3HOWB 4ID6A 5LMNQ 4OO1H 1ESRA 3RN2A 5JEAJ 5LMNL 2RDGA 1CKNA 5JOBA 3TS0A 3VR4A 2MQHA 3PO3B 2PPBC 2A6HD 3H15A 3OPOA 4JK1C 3RLNA 3K5LA 5BR8L 4JVZA 4DUZL 1IBLQ 1A63A 4XXEA 5KIXA 4GOPA 1XMOQ 1II3A 1G91A 1GUNA 1JE4A 4DGZA 4ZUJA 5C4HA 1PYSB 3MZ5A 4YY3Q 1PZID 4JBWA 5D65A 4OXPA 1PVOA 1F9QA 1PYWD 3E9HA 5JJLA 1HUMA 4C3IH 2VUMH 3GTQB 2IT1A 2F03A 3NTKA 5C4ZA 4X62Q 1ILQA 3BDCA 4BBRH 4EGVA 4R4IA 2XGTA 1VMCA 4DU9A 3GTOH 1E7ZA 4KHZA 1D2BA 3T53B 4PNYA 1Z9FA 4K5VA 5KRUA 1IYVA 1JQYD 5K36H 2G5DA 4HCEA 4QUCA 2UU9Q 2JA5B 5IY0A 1QG7A 1UAPA 3ND8A 4DN4M 1HPCA 4K8JA 3SVMA 4HMJA 2K52A 3I2ZA 4BY1G 3BVMA 4IFDH 3A56A 4AYBG 4C56C 3DEPA 4M1UB 2PQEA 1LTSD 4M8AA 1PTOC 5M5YH 1R4QB 1BUVT 2J0TD 2HCIA 5K5PA 3HOWG 4Z9CB 1JCKB 4OX9L 3K7UC 2ATWA 1XPUA 4BY7G 2X69A 4K0KQ 1FL0A 3NELA 4C1NI 1QOHA 3I4NH 4RFBA 3A8IE 5ELBA 5FKAC 2UUAQ 2VY3A 4JI7Q 1G8ZD 1B70B 1TKWB 1AZPA 3KBGA 4JI7L 4X65Q 2NVXH 4JCVE 1SDFA 5LMUL 1JMCA 4HJ7A 3I72A 4LFAQ 2TSSA 3D6CA 2EIFA 1R9TB 1ENAA 2G9HD 3G6JB 4QJFA 4C3HG 4ALPA 4GLVB 2WV6D 2PNHA 1KAAA 2HIXA 4TQUS 1FJGL 2BA1A 4KY5A 3HOXH 1BDOA 2R7FA 2CKZB 3I4MG 1K3BC 2HCCA 2EYHA 2ICEC 1L1OB 1Q90A 4KTAA 5C3WA 5EBDA 2HD3A 3MHBA 4BWGB 1EOTA 3TSSA 4GOPB 1WCMG 4JBMA 1EQRA 4B9WA 4RH6A 4BBSB 2JA7B 1RJTA 1BBUA 2B8FA 3VYRA 4BY1B 4JOIC 4XYQA 3K5NA 5CORA 4JOIA 5CV7A 2QDBA 2C5CA 2AWOA 4ME3A 1KLUD 2PW5A 2B2UA 1LACA 5JJKA 5GROA 1SNPA 4YWLA 4A3BG 1O80A 4IJHA 1STEA 1PH7A 3ND9A 4CBVA 1ILPA 1G51A 1N9WA 2K5VA 1JB3A 4DAYA 4L5TA 5KNDA 3IKJA 4EQPA 4A3GB 2JYOA 4RCNA 2I5LX 1IZ6A 5AFWA 2O4XA 1EY8A 5TSSA 1PDQA 4CGYB 4C3JB 5GAGC 1SNQA 4OL7A 3S2HH 1CT1D 2D0PA 2O5JC 3RZOB 2F4IA 3S1QB 1QZGA 5D3IB 4X3UA 3J80c 2HT1A 2A8VA 1L1OA 2F4VQ 4LF9L 4KD3A 3CQZH 3T16A 2EPBA 3KLSA 4LK1C 5C0XJ 5C4XG 4J1MA 4C3HB 4R8IA 3BZKA 1FNVA 2IHFA 1SE4A 1EQQA 1WTRA 3G6EA 2RCNA 1E3PA 1C4QA 4JI8Q 1HHVA 1I50B 1Z7TA 4BBSH 1JOKA 1L2FA 2K04A 1SMYD 3OMGA 1RTOA 5C4XH 3IRBA 5FLMH 3CRLC 1O78A 5CYUA 5IOCA 2G9DA 4KD4A 2MHVA 2YYZA 4ULLA 3L0OA 2ZXOA 1WJJA 1HQMC 4DR1L 1XX8A 1QNUA 2E5LQ 4A75A 1YJ9A 3SE0A 5IODA 1N34L 1QJOA 3V96A 4JI3L 4CDCC 1UNSA 4NXML 1LTGD 4OIKA 3NUCA 4L8JA 3VYTA 2LXKA 1QCBD 3TP5A 4DFAA 5ELOA 4X65L 1HTPA 1MHWC 1C0AA 1SSOA 4AQYQ 3T1HQ 2XRQD 1YHAA 4LWCA 5C3EB 1V1PB 1J9OA 1GD7A 3H94A 5EPKA 1I4QA 1YNJD 2UUCQ 1E2WA 2Y0SB 3M4QA 1CZGA 1DOLA 1E24A 1LT5D 1LTBD 2VXWA 1QVFA 3HOZG 2HDMA 4IFDI 3MFYA 4DUZQ 3HOUH 2EY6A 2VUMB 2UUBQ 1VQ7A 4AQYL 4HMIA 1EY0A 1PTOF 1XPRA 1TS3A 3Q8DA 3J7ZC 3Q6SA 5JVG3 1PFSA 1DONA 4B3TQ 2DY7A 2B63B 1IHZA 2EYFA 3KBXA 2LSSA 2KEEA 1TY2A 2FFKB 1SNCA 2J7ZA 2K03A 2VS1A 3IAYA 1YVCA 5G3LF 2AUKA 1PH6A 4IQZA 4NXMQ 1Y69U 2PZUA 4C1NK 4DR4L 2EYOA 3FP9A 1GVPA 4PZ7A 1OXXK 3NE5B 2CQAA 4C2MB 2Y0SE 1VQ9A 1A3UA 4FXGC 3IFDA 4RGMA 4XYOA 2XIWA 3BYTB 3HOXB 4ME5A 2JA6G 1RCVD 3HEJA 2VNUD 4CKCA 2PZTA 2A74C 1WYDA 4LF4Q 3S15B 3S1NB 3GP7A 2D5DA 2LKVA 2VZAA 3I4NB 3H0GG 3A55A 3RD4A 1D5XC 4LFCL 2EYPA 1LTTD 4A3DH 3E9IA 1LUZA 4FVMA 5FO8B 4DV5Q 3AU7A 5C6AA 4HJ9A 4QMGA 3HOVH 2B63H 1Q3LA 2OCEA 5IWAQ 2O2LD 2I07B 3JC66 4LF7L 4NPSA 1CHQD 3CCJA 1YNJC 1H9MA 1EY5A 4U673 2PZWA 1PTOD 2IY5B 2OT2A 4A3FB 1DD2A 5KNCA 1JT8A 2XWJB 1TS5A 4DR2Q 3S2HB 1EWCA 2E74C 5IYDH 4DV5L 3J80L 2FJ2A 2JA8H 1U0LA 3R2IA 1CFMA 1I5FA 4XT3B 3T13A 3KF8B 1J5EQ 2I46A 3ZYYX 3R3OA 4GN4B 3OSOA 4QIWE 1F9SA 2J4XA 2NZOA 3AFQA 1YEZA 3GO5A 2RQXA 4A3KB 5KYLA 2HQEA 3P1HA 1X9NA 1FNUA 4DV3L 4X62L 5EPJA 4NDXA 1A8VA 5ISRA 2JA5H 4L6TB 5LL6S 2Q8IB 1IBKL 4B3RL 1AN8A 3HOZH 1VQJA 1HR0L 3I4MH 4A3JG 4PG3A 1QUQA 3FDTA 4YWKA 3JAME 3GV3A 2BDOA 2KUMA 5I9PA 2F0UA 1WCMH 1SMYC 3S1MH 2WB1G 1KL9A 1EYDA 4IUPA 2ID0A 3J7AF 1GHKA 1J6QA 2MP1A 4RG1A 1D1IA 2MO0A 5JEAG 1HXYD 4A76A 2F0KA 1EWIA 1E1TA 1WI5A 4ZKBB 1PLFA 3TS2A 2RHQB 1YBYA 1FYCA 1SYBA 1B1ZA 1TIID 2CHBD 2E2IB 4L63B 4HEDA 3S1RB 1VQKA 3HFZB 4QL5A 1YI2A 3P20A 4IPHA 3GTLH 5ELDA 4DA2A 1CHPD 1S5ED 3U4ZA 1RODA 3PUXA 4XT1B 1SFOB 2CH4W 2ZTEA 1ASYA 1OXTA 1JB7A 1HFNA 5IWAL 1XPOA 4OWWB 1TWAB 2KHSA 4GKKL 4HAEA 3MXUA 4UPAA 1UE6A 1QZHA 1Y1VB 4MNOA 1Q1EA 2KHJA 5M5WH 2NTTA 3PMFA 1E0BA 2B2TC 5IYBG 5E3FA 2F0JA 1PZKD 2L5TA 1XTDA 5EGTA 2XN9C 4L5RC 3P7JA 3OHXC 1AE2A 5I6WA 1F2YA 1Y1WH 1XMQQ 2JXMB 4LF4L 3WOEA 4KKUA 3D31A 5HGTA 1OTCA 5JAVA 2K05A 2WIIB 2HHHQ 2EYJA 1CA6A 4KKSA 1P16A 1B53A 5ELFA 5CR3A 3C3LA 4ZYSA 3Q0AA 3FPPA 4KY6A 4DPGA 4V190 1SEBD 1X3FA 5FO9B 4KLKA 1BNZA 1KXLA 1EIYB 4TRDA 4GNXB 1RHPA 1CSPA 4H0LC 1EIGA 1K8OA 4Y52H 3WOFA 4HIDA 3HKZG 2JA7G 3K8AA 4O0AA 3ICEA 3S17H 1N32Q 3CXCA 3H3VH 2Z4IA 3RZOH 3L3OC 1OXUA 1PH9A 5C0XH 3ULPA 1S3OA 3GTPH 5C5MA 1W6JA 3C1FA 5M3MH 1Q82C 4WJWA 1PH2A 1EEID 1QVCA 2D62A 2Z0SA 1O7ZA 3PIOA 1Y1WB 3EJIA 1Q81C 2PNRC 4WRDA 2VB2X 2VL6A 3E6ZX 3TP6A 2BE5C 4DR5L 4JV5L 2E5LL 3NPPA 3SXHA 2SDFA 4PZ8A 1EZ8A 4JI0Q 3NXWA 2YV5A 1TWHB 3DMUA 4C3IB 4JI6Q 2JEAI 4A3FH 4EQNA 1V1PA 4MN3A 4HCSA 2A73B 1TQOA 4R1JA 4A3CG 3T51B 1NCVA 2JA8B 1IW7C 1QB5D 2UU9L 1O7IA 5BN4A 5J39A 2M9VA 1SAPA 2FMCA 4CJ1B 2QILA 4IOAA 1OO9B 2MPMA 4A3LG 2SNSA 4FF3A 4P2CB 3KYHC 1UE7A 3DM1A 2N88A 1WVLA 4JI4L 3T56B 2JN4A 1I4GA 5DLQE 2B3GA 3KLSX 2I0QA 1MI2A 4UP8A 2DGYA 3OOCA 4H13C 4DR2L 5CC4A 3M4YA 4ZQ3A 1WTWA 4AIMA 5J3BA 1EQVA 4OWTB 1VQAA 4FF4A 1SJED 4LF7Q 2A6HC 1SYFA 2DNCA 4JI1L 4DNRB 3BDOA 4LFCQ 1CKMA 2F0OA 5C3EH 3L2PA 1K83H 2EQSA 1D5MC 1DM0B 2LMCB 2NVXB 2AQ3B 1K8MA 2CWAA 1IYUA 3RUZA 1OXVA 4QGUA 3EVQA 1ONLA 5IT9L 1EY9A 3VR6A 5IYCH 3CCUA 1KD1C 1AEXA 4N8FA 2LY7A 2E8GA 1TWGB 1V9PA 3W2DA 1W2BA 4DV3Q 3AMUA 1STYA 2JA8G 3FKIG 3OYYA 1F2LA 5CV9A 1TWFB 1KQSA 5IGBA 2F0NA 4DAVA 1MKHA 4UP7A 1G2SA 3E0EA 4C2MH 1X6OA 4IO9A 2BH2A 4KN7C 3NSWA 1PXUA 4G7HC 2AKWB 3WWVA 1X32A 3W1GA 4BY7H 2F1MA 1HNXQ 4DR4Q 3LNNA 4KMUC 3C46A 4YHHL 1T5EA 2CQOA 2VB3X 4ZKCB 2E2JH 3ZJYC 3S15H 3MAQA 1A15A 3PCOB 4IURA 4TKOB 1HR0W 2F0EA 1YJWA 3TP7A 3K58A 1WD0A 2O5IC 5FJ8G 2KA7A 1K0SA 5M3FH 1JE5A 1ASZA 2R92B 2RA4A 4JI1Q 4AYBE 4HN7A 2EOTA 1HZBA 1QE6A 3KDFA 5M3MG 1SFOH 5I9OA 4IN3A 3HOXG 2CCZA 4XTCS 3M7NA 4DAMA 4U68A 2KBNA 2XRSD 4A3CH 2ZT9C 3M3YH 3MXPA 1XNRL 4ODGA 3CCEA 3D4WA 1R4PB 3MFGA 2R93H 5CV8A 4A3DB 4FF2A 4J8QA 3VYSA 2CW0C 1I6VC 2K01A 3JAMi 2WP8J 4BXXG 2N3SA 3HOVB 2XWBB 1TT2A 1SXTA 2F0LA 1EQTA 5IGCA 3RN5A 4A3MG 4A3BH 1KDBA 2PYKA 3HRZC 2Z8LA 3K0XA 2A6ED 1A2UA 4B3SL 1ZXTA 4ZRZA 3FKIB 2DNEA 1VQ5A 1WD1A 3F1ZA 2RVLA 2AQ1B 2KHIA 4KN4C 4JI0L 2EE1A 2SOBA 1FD7D 3CC4A 3ER0A 1DJRD 4GKKQ 2ZM6L 1C8CA 1E1OA 3JAML 2QEJC 1HFGA 2D0OA 4GKJQ 1H9RA 3CRKC 5FO7B 1VQPA 1FNWA 3OIPA 4KI0A 1L0WA 1K3RA 2AUJD 3ERSX 2R93B 1IBMQ 1P8LA 1HZ9A 3RZDB 1RDPD 3L7ZC 2XTIA 1N32L 1G2TA 4OGQC 1HCZA 1X3GA 2PI2A 3MXNA 2QDLA 3GTJH 4NXNL 2NVYB 3NTHA 1Q8KA 1Z47A 4RWSC 1X3EA 3PUYA 1SE3A 4G7ZC 1VQMA 4L5SA 2ENBA 3RLOA 1TWHH 1C7YA 1SYDA 1LLRD 4X64Q 4CDFC 3MEHA 3UI2A 3I3CA 3CMEA 1L0XB 2NTSA 1SMXA 2E2HB 3M7GA 4DV7Q 3GD7A 1I3QH 1JC7A 4B3ML 4LF6Q 4DV0Q 4BA1I 3ULJA 4RA8A 5IT9E 1STBA 3J81j 1YNNC 4KV6A 5E1FA 1YHQA 1G291 1STAA 2VQFL 4DAYB 1SNDA 5E4WC 4P71A 1HA6A 2FMMA 3AEVA 1VMPA 3SR1A 3TDQA 2MFIA 3RR5A 4DR5Q 3J7YW 3OW7A 4FXKC 2F3IA 2E75C 5JEAH 2KCNA 1BQQT 3SK6A 2JA5G 5M5YB 2B8GA 4A3MH 3QOJA 1I4PA 3KF6A 4IOCA 3CMAA 4I7ZC 3PUZA 2BH8A 2DJFC 5J1ZA 1U9RA 3T4AC 4FXDA 2TMPA 4X64L 1JOOA 1VQOA 4B08A 1FGBD 3DWPA 1XXGA 3I8ZA 3K57A 4IPCA 2V4DA 1VQ4A 2JA9A 3K59A 3NBHB 2QEXA 1GUGA 1PH4A 4F88A 3ERQA 5JVH3 4QY7A 4XQQA 2HDLA 4GN3B 2NN6H 1A62A 1K9MC 3A74A 2K33A 4HIMA 2B2VA 4YCUA 3QG1A 3CCLA 5M5XB 3SGIA 1KAWA 3GQBA 4NB3A 3LWUA 2K5NA 1K8AC 4DV4Q 5EKIA 3H0GH 3KF6B 4DV4L 1HRJA 5EQ0A 3K5MA 3I4LA 2BCOA 5ELNA 2OQKA 4LFBQ 4BY1H 4IFDG 4OEMB 2PQAA 4R4QA 4HIKA 2NB0A 1C48A 5C44B 1AW7A 3I4MB 1H9KA 2DJGC 1I4XA 3EROA 2L12A 4X66L 3GTMB 1IL8A 2VQFQ 3PSIA 2D2CC 3OIQA 1WCMB 1U4LA 3OMCA 4POGA 2R7DA 3MA2B 5IYDG 2BOSA 1N33L 1RIPA 4DK6C 1C9OA 1IYJB 4A3GH 2WKCA 4V0BA 4DR3L 3C2PA 3HOWH 5L37A 2Z6KC 2Z6KA 1NE3A 4K0KL 3S1QH 1MBYA 2F0IA 2H1EA 3BG3A 3UDFA 2UUBL 5ELEA 3S1RH 2IWHA 4A93G 3CQZB 3ITPA 1D5ZC 1K83B 5HGQA 4RAUC 4GOPC 5KEEA 3GTJB 4G7OC 1RD9D 3SK5A 1KIXA 2VW9A 3KOJA 3K5OA 4A3JH 1Y1VH 1TVXA 1S40A 4K14A 5C4XB 3CPFA 1BXTA 1E2ZA 3TN2A 1PV4A 3SDZA 3R93A 4HJ5A 1TWCB 2E2HH 2B29A 1O7LA 4JI3Q 1I3QB 1Q12A 1X65A 1EY7A 1ZYRD 3A8JE 5IIFA 1GJXA 3J81L 4LF5Q 4QUFA 4LNQA 2YU9H 2B2TA 2Z1CA 4J15A 4JC0A 2A69C 2NVYH 1PHJA 3PIP3 2C9OA 4NMZA 3CC7A 2EJMA 3I4OA 5M3FB 4BXXH 2DY8A 2JQOA 2K4KA 3VR3A 3PF5A 3HOYB 1AFPA 3KLWA 3E5SA 2H4OA 5BR8Q 1HUNA 5DEHA 3I70A 2JA6H 1A0IA 5EPLA 1V1QA 4QQBX 2QF7A 1GKHA 2F0HA 1AE3A 3S17B 1K0RA 1M4VA 5JPNC 2YTVA 2NN6G 5C3EG 1GO3E 4DV2L 4PMCA 3PQIA 3K7AH 1UEBA 5D14A 4KJOA 3QOLA 2Y0SG 3J81i 3I55A 1K73C 3FEWX 1YHBA 1XNQL 2IPKD 1STHA 1EZ6A 4YHHQ 1ENCA 1JWUD 2ASBA 1MJCA 1VQHA 1N34Q 5NUCA 3BZDB 3TP8A 4RKLA 4DR6L 2VUMG 4HIOA 3P75A 1PA6A 5KGUA 3VR5A 3FPUB 3FKIH 2K14A 3KK7A 2K5WA 1NR4A 2EJFC 2AMCB 3DWAA 4HSPA 2F0MA 5I4DA 4K2KA 4A3DG 1CA5A 1S5CD 4UDUC 4DK1A 3CC2A 4PMWA 2NN6I 4QIWB 2ZTDA 1UEAB 1EY6A 3VA7A 2A68D 1LABA 2NUCA 3PUWA 5IYCG 1W3SA 4RHSA 4B3SQ 2MO1A 4ZCKA 1Q1BA 2L15A 1SYGA 2F3VA 2XNAC 1I94L 5C0XG 4UY8C 1IKLA 4HJAA 2EVBA 3FHWA 3S2DB 2N78A 2RKSA 1OXSC 3N52A 2HUGA 3MTSA 4MZ9A 5M3FG 4EQOA 1PRTD 4R8NA 2F3WA 4IPDA 2F0QA 1PFNA 3KJOA 5FK9C 3HOYG 2K6AA 1I4HA 3S16B 1G6ZA 1WOCA 1EFID 1Y8OB 5C3XA 1EEFD 2NYZD 3EFXD 1HA5A 5IP7G 4I65A 2OTLA 4YY3L 3WDNA 4KJNA 4NW2A 5IT9c 4ILWA 3OWFA 1WTQA 4X6AH 1Y8NB 1LT4D 1YIJA 1Y14B 1YJNA 2QA4A 1K8GA 1X3QA 3U9OA 1PRTF 1VQLA 4DR7Q 4AH6A 4JI4Q 1MIUA 3SK4A 3FMCA 3VR2A 2JE6I 1DCZA 3BYYB 2IX3A 2A5HA 1TS4A 2EZVA 1PH8A 1EFWA 5FLXE 1U4RA 4C3HH 3S24A 3HG9A 3DLLA 3O13A 1BCPF 1L0YB 1KNAA 4BS9A 2WB1E 4O2DA 2M00A 2A19A 2RSNA 2MNAA 1SN8A 2F0DA 3EN2A 1WFQA 1BCPD 2OXPA 4GNXA 4GNXC 3GTOB 3CKIB 4XQJA 2MGSA 1O7YA 1VQFA 1MD2D 4TVAB 5T1GA 3CAMA 2IX0A 1SROA 1B8AA 3PF4A 5JJIA 4XIGS 4AYBB 1BCPC 4FO2A 1VQ8A 4UAIA 5A2QE 3F8TA 1XWEA 4FNFA 1S5BD 3TEHB 4UP9A 1D1KA 1QVGA 1PYBA 3J81E 1VF7A 1CM9A 1HZCA 4X3TA 2YTYA 1IL2A 3DM3A 5GADC 1RKNA 1DOMA 2I5HA 2WACA 4A3KG 1GUWA 3UDXA 2L55A 2LXJA 2WB1B 4WJ4A 2A1AA 3STBD 4DV1L 1NY4A 3GV6A 4OX9Q 1FVIA 1TY0A 3OWEB 5DAUA 5COYA 3MXGA 3NP8A 1I4RA 3KF8A 4A3JB 5ELCA 4LUZA 4BBRG 1NSNS 1Z6HA 2R6GA 2F0SA 2OF1A 2EXZA 1PFBA 4N9TA 2L4NA 5IGDA 1TWCH 3LGJA 3BS1A 4HTHA 2UXCQ 1KTKA 3TREA 3KUPA 5LL6X 2PI2E 1ESFA 3EIVA 4A3BB 3BZCA 5FLMG 3JAMc 1TU2B 4RGNA 5DM63 4RHRA 4EX5A 5KNBA 3J81c 3NBIA 2I5MX 4BBSG 5LMNW 1EYCA 4YIJA 5JPMC 4A3GG 3R8BA 5FJ8H 3HKZE 2A68C 2ZM6Q 1PMRA 2IHEA 2RDFA 2L11A 3BU2A 3L9AX 1KRTA 5DNFA 5M5XH 3Q24A 3H3VI 1HZAA 4DV6L 1DYQA 4K5WA 1BKBA 3HOYH 1EYGA 1EIHA 1VQDA 1F2MA 4JG2A 1SRUA 2EY5A 1BBWA 4PQXA 4LW1A 3I7FA 3X3MA 3F2DA 3S1NH 1B3QA 1BVSA 3KDFB 4JW0A 1EYAA 4G57A 1ET6A 2PMZB 3M4PA 4E6IA 4B9XA 2BDNA 4IJLA 3VYUA 4LF9Q 4C3JG 4H02A 5CV6A 4DR7L 1GOZA 1UUPA 1M8AA 2K5DA 4PV1C 3Q23A 2L0CA 3NWSA 2F0FA 1DOKA 1SYEA 1MSGA 5A35A 4RGTA 2Q2IA 3G71A 1LT6D 4LAAA 3K0YA 3I90A 3NENA 2E2DC 1X3PA 4HJ8A 5T1IA 3EA6A 2UXBL 2DUDA 2NVTH 1ICWA 1IKMA 1V1OA 3HKZB 2UXBQ 1VQ6A 3STBC 4JPBW 4CJ0B 1JJGA 4O1NA 1LO5D 2R7ZB 1PFMA 4GZYC 4JYAL 4F7XA 1KLGD 3KLRA 1VQGA 1SE2A 1E22A 4A3LH 4CDEC 2Q2TA 1SNOA 5AJ3Q 4Q0FA 4DXGA 2CWPA 1S4ZA 5GAEC 2ZJQA 2UXDL 1Y1WG 3F2BA 1SBBB 3OTOQ 3CU7A 4A93B 1DGSA 3J7A5 4GKJL 1J8IA 5HY6A 1D6EC 3LWEA 2OTJA 4Y7NB 3B6YA 1SNMA 4DUYQ 2NZ1D 4DUYL 3S16H 3R2TA 2KJXA 4TSSA 4FF1A 3HOZB 2PW7A 2NVQB 1EUJA 2ZXPA 3G7LA 3NBHA 1JJ2A 1QNKA 2WKDA 4JI6L 2N55A 3S1MB 2RCFA 4H7BA 2NVTB 4HR7B 3J80i 3A7AB 2Z6BA 1HQRD 3A0JA 3NQIA 5DM73 3GTKB 1H9SA 4R9WA 1B9MA 1BO0A 2WINB 3HZXA 4EQ5A 5CBAE 2ZJRA 1N36Q 4BA2I 3DWQA 2KVMA 1EOVA 2AQ2B 3S9WA 1CZWA 3K7AB 2B63G 3NHHA 1V8QA 3QJYA 3U9SA 2OWOA 2WAQG 2B2WC 2R3ZA 1PZJD 1CQFA 1TR5A 4ZUIA 4JI2L 2JA6B 5CGKA 2B39A 1ML0D 2L9HA 3TMEA 1GXDC 5M5WB 4LF8L 1X56A 1PRTC 1VS0A 2KECA 3I4NG 1CQVA 4GLAC 5FOBB 4KY7A 3H3VC 1EIFA 1NNXA 3V2TA 1CTMA 3G48A 1D8LA 1UE5A 1VQCA 2K32A 1HNWL 5EJWA 3BDLA 4B3MQ 4LF6L 1NAPA 1HH2P 1WTOA 1SE8A 3QIAA 1BF4A 1STNA 1HNXL 3I91A 4YCWA 3S14H 5IP9G 4MTKA 1G6PA 4KKTA 1VQBA 2QCPX 3S2DH 3D4RA 4QF4A 4LF8Q 1NTGA 1EY4A 5C44H 1SJHD 4RCOA 2BA0A 2RDHA 3RLFA 2FINB 3GTMH 3H6MA 1ENFA 3UDGA 3VDYA 2IL8A 2Q2UA 2R92H 3M4OB 2KCCA 2SNMA 2QGQA 1TXYA 3MXNB 3PV0A 1F77A 4O42A 2AHOB 1KC8C 3KFUA 1LV9A 2F0WA 5EKKA 5KYIA 4K6LA 2RBMA 4LFAL 1XTCD 3MVVA 3SEBA 5GAHC 4XQNA 5CV5A 1D7QA 1VDZA 4OIJA 4KHVA 1GHJA 4LUOA 2F0PA 4RKBA 2B2VC 1IXRA 2R92G 4LJZC 3DEOA 1XJVA 3GTPB 4APVA 3W1BA 1DZ1A 2M2LA 3CP0A 2UUAL 3D3RA 1JOQA 5M3MB 5H1SE 4IFDJ 1GUOA 4IZ8A 3BVGA 5C0XI 3KJPA 1PH3A 3QR8A 3FRPB 3IL8A 1B2TA 1A3TA 3DHQA 4F87A 3M85A 3GTGH 3IFTA 2FHTA 4P73A 3D6WA 4CDDC 1NMFA 1A3VA 2A69D 1FGUA 1H9JA 3W3AA 1PH1A 2GVAA 1GUSA 2HHHL 3CPWA 5CMDA 4WORA 1ZYRC 4RGOS 5D3DA 5IYBH 2KCTA 1NUCA 4A3KH 4OONA 3UE0A 3M4OH 3QWNA 1F9RA 1GUTA 3D8GA 3K81C 4DNTB 4JI5L 3A5UA 4DV0L 2ICIA 4LF5L 1YNND 2RSOA 2UXDQ 1Y8PB 3N6RA 3QB3A 4L5QA 4DK0A 5FLXL 4ZAIA 3A7LA 3DUZA 3CCSA 1K28A 3U58A
chains in the Genus database with same CATH topology
1XNQL 4A3LG 4P72A 1JMCA 4HJ7A 3KYHC 2N49A 1UE7A 4YHHQ 3AFPA 4LFAQ 2ASBA 1MJCA 4IPGA 1VQHA 1VQIA 2EIFA 4JI4L 1N34Q 4QJFA 2ES2A 4ALPA 4GLVB 5DLQE 4DR6L 2B3GA 2PNHA 2I0QA 5IP7H 4UP8A 2Q2HA 3OW2A 2DGYA 4HIOA 1FJGQ 2HIXA 1Y1VG 3NEMA 1PA6A 4DR2L 1U5KA 4TQUS 1FJGL 3FKIH 2K14A 2BA1A 2AMCB 4R4CA 4AIMA 3UDIA 4A3DG 1HNZL 3HOXH 5J3BA 1HNZQ 2R7ZH 4OWTB 4C3JH 2R7FA 3CC2A 4PMWA 1VQAA 2CKZB 2NN6I 2ZTDA 3I4MG 1H95A 1L1OB 2E2IH 1XMOL 4LF7Q 3PUWA 5IYCG 1W3SA 3PUVA 4B3SQ 2MO1A 4JI1L 1Q1BA 2L15A 2OQ0A 4GOPB 1WCMG 2HQLA 1I94L 4JBMA 1EQRA 5C0XG 3T1YQ 1IBML 3CD6A 3T1YL 3GTKH 4UY8C 4HJAA 1BBUA 1CKMA 4LFCQ 5C3EH 3L2PA 4JOIC 3FHWA 1K83H 4JOIA 2EQSA 2N78A 2AWOA 1OXSC 2CWAA 4ME3A 4P74A 1I6HH 1OXVA 5M3FG 4MZ9A 4MTNA 5JJKA 5GROA 4QGUA 3KJOA 2K5HA 4IPDA 1YZ6A 4YWLA 4A3BG 2CFMA 3HOYG 1MJEA 4IJHA 5IYCH 3CCUA 4JI5Q 1SLJA 1WOCA 1PH7A 1KD1C 1N33Q 1TWGH 2E8GA 4R4OA 1G51A 1N9WA 2K5VA 1V9PA 3AYHB 4L5TA 1W2BA 5IP7G 2OTLA 4YY3L 2I5LX 4DV3Q 1IZ6A 1TWFH 2JA8G 3FKIG 3OYYA 1KQSA 1M1KC 5IT9c 5C4JH 5GAGC 4X6AH 1LM0A 1CKOA 1MKHA 4UP7A 1YIJA 1RL2A 1Y14B 2D0PA 2K50A 3E0EA 4C2MH 1X6OA 2QA4A 4IO9A 1YJNA 1K8GA 2BH2A 4JV5Q 1QZGA 1VQLA 4DR7Q 2AKWB 2HIVA 3W1GA 3WWVA 4A4IA 4AH6A 3J80c 4JI4Q 2A8VA 2HT1A 4BY7H 1MIUA 1HNXQ 1L1OA 2F4VQ 4DR4Q 4YHHL 4OO1I 2JE6I 4LF9L 3CQZH 5AJ3L 2CQOA 2EXDA 1HJPA 1VQNA 5C0XJ 4A3IH 4YWMA 1PH8A 5C4XG 3AQQA 1YITA 3ZJYC 2E2JH 1EFWA 3S15H 3BZKA 3PCOB 3OTOL 1HR0W 4C3HH 2IHFA 3S24A 3PO2H 4KHPL 1EQQA 2PMZE 3G6EA 3DLLA 2RCNA 1E3PA 4JI8Q 1YJWA 2C35B 2PQAB 2WB1E 3U50C 5FJ8G 4DV2Q 4O2DA 1N8RC 5E7NA 4BBSH 5M3FH 1JE5A 1ASZA 1L2FA 2A19A 2RF4A 4JI1Q 4AYBE 2MNAA 1SN8A 3EN2A 1WFQA 1NJIC 5C4XH 1HZBA 3IRBA 5FLMH 3KDFA 4A3IG 1B7YB 5M3MG 1SFOH 4JBJA 3HOXG 4JYAQ 4GNXA 4XTCS 2CCZA 5K36G 4GNXC 3U4VA 3M7NA 1Q7YC 3PO2G 4DAMA 2GVBA 2YYZA 2KBNA 1VQFA 3L0OA 1HNWQ 4TVAB 3CAMA 2IX0A 1WJJA 1SROA 1B8AA 3M9BA 5LMUQ 3M3YH 4DR1L 4A3CH 1XNRL 3PF4A 5JJIA 4XIGS 2E5LQ 3I56A 3MEFA 3CCEA 4A75A 1YJ9A 1IBLL 2R93H 4A3EH 1N34L 1VQ8A 3F8TA 3JAMi 4OWXB 4JI3L 3TEHB 4UP9A 4NXML 2WP8J 2LXKA 5GQOA 1QVGA 4BXXG 2N3SA 1PYBA 5ELOA 4X65L 2YTXA 3PO3H 2RHSB 1Q46A 3HKSA 1C0AA 1HZCA 2IX1A 2YTYA 3RN5A 4AQYQ 3T1HQ 4A3MG 4LF6Q 3T1HL 4A3BH 1YHAA 1IL2A 3DM3A 5GADC 4A3EG 4LWCA 3K0XA 1KRSA 4B3SL 2I5HA 4A3KG 4A93H 4WJ3M 3UDXA 2H5XA 1GD7A 1VQ5A 2LXJA 4WJ4A 1CKNB 2A1AA 3F1ZA 3STBD 4DV1L 1NY4A 4R4TA 2UUCQ 4OX9Q 3M4QA 1NBWA 2R7ZG 1FVIA 2KHIA 1E24A 2VUMG 4JI0L 1CUKA 3CCQA 1QVFA 3HOZG 3CC4A 3GTQH 3D0FA 3ER0A 2ZJPA 4IFDI 4DUZQ 4GKKQ 3HOUH 3CW2C 2ZM6L 4LUZA 4BBRG 2UUBQ 2JA7H 1VQ7A 4AQYL 1E1OA 3EBEA 2R6GA 2GN5A 2D0OA 1XPRA 3GDEA 3Q8DA 3J7ZC 3CCVA 4GKJQ 1XNQQ 1PFSA 1VQPA 2JK8A 5IP9H 1TWCH 3LGJA 4KI0A 1L0WA 1K3RA 4B3TQ 2UXCQ 4Y7NH 4GN5A 3ERSX 2KCMA 3TREA 1IBMQ 1P8LA 4DV7L 2LSSA 2PI2E 3EIVA 1HZ9A 5C44G 1UWVA 3BZCA 2UXCL 1L1OC 4PZ6A 5FLMG 3RZDH 3JAMc 3L7ZC 2VS1A 1YVCA 2XTIA 1N32L 4EX5A 1PH6A 3J81c 1Q86C 2I5MX 4BBSG 5LMNW 1PH5A 1X3GA 1GM5A 2PI2A 4NXMQ 2NVQH 1T9HA 3GTJH 4IOAA 2F4VL 4DR4L 4NXNL 3ULLA 5FJ8H 3HKZE 4POFA 4A3GG 3FP9A 1Q8KA 3K80C 1GVPA 4PZ7A 2ZM6Q 1Z47A 1OXXK 2IHEA 1CSQA 1SR3A 1X3EA 3BU2A 1KRTA 3PUYA 2Y0SE 5M5XH 1QUQB 1VQMA 1VQ9A 4L5SA 3H3VI 1HZAA 4DV6L 4OO1G 3CF5A 1S72A 1BKBA 3PGZA 1TWHH 3RLOA 3HOYH 1EYGA 1C7YA 2JA6G 2AWNA 1VQDA 4JG2A 1SRUA 2VNUD 1BBWA 4X64Q 4LW1A 3I7FA 1LYLA 3HOUG 1WYDA 4LF4Q 3F2DA 3S1NH 1HR0Q 4YCVA 3KDFB 1BVSA 4FDBA 2N8NA 2VZAA 3M4PA 3H0GG 3CMEA 1SMXA 4LFBL 4IJLA 4LF9Q 4LFCL 3TRZA 1JJCB 4DV7Q 4A3DH 3E9IA 3GD7A 4H02A 1I3QH 1LUZA 4DKAC 4DR7L 4KHPQ 1XMQL 3G4SA 4DV5Q 4B3ML 4DV0Q 2ZTCA 4P75A 4BA1I 2VQEL 4DR1Q 3ULJA 5FLXc 4HJ9A 3J81j 3HOVH 3PIPA 1YHQA 2B63H 2Q2IA 1G291 3G71A 2OCEA 1R9TH 5IWAQ 2VQFL 4DAYB 3NENA 4P71A 1I94Q 3W5OA 4HJ8A 4JBKA 4DV6Q 3AEVA 2UXBL 2DUDA 2NVTH 3JC66 3F2CA 4LF7L 4NPSA 3RNUA 1IBKQ 4B3RQ 5IE8A 3CCJA 2JEBI 1VQ6A 3STBC 2UXBQ 1X55A 1YNXA 2MFIA 3RR5A 4DR5Q 1JJGA 1KHIA 4GS3A 4LF6L 2F3IA 4JYAL 2IY5B 1LTLA 1VQGA 1JT8A 4DR2Q 1E22A 4A3LH 2VQEQ 5IYDH 2JA5G 2Q2TA 4DV5L 2V1CC 5AJ3Q 2JA8H 1U0LA 1J5EL 2CWPA 4A3MH 1I5FA 3KF6A 5GAEC 4JI8L 3KF8B 4IOCA 1J5EQ 2ZJQA 2UXDL 1Y1WG 3F2BA 3CMAA 3OTOQ 4GN4B 4RMFA 3PUZA 2BH8A 1DGSA 3J7A5 4QIWE 2NZOA 3AFQA 3GO5A 1YEZA 4GKJL 5HY6A 4X64L 2OTJA 1V43A 4DR3Q 1VQOA 1X9NA 2JJQA 4DV3L 4X62L 2K75A 1UE1A 1A8VA 3UE1A 3HOVG 3B6YA 2JA5H 2WAQE 1VQ4A 4IPCA 1IBKL 1XNRQ 2JA9A 4DUYQ 3PO3G 3S16H 3NBHB 4DUYL 3HOZH 1VQJA 1HR0L 3I4MH 2QEXA 4A3JG 4PG3A 1PH4A 1QUQA 4QY7A 4YWKA 3CCRA 1EUJA 4DK3C 4GN3B 1JJ2A 1TWAH 4X66Q 1A62A 1K9MC 1WCMH 2UUCL 3A74A 4LUVA 4JI6L 4NXNQ 3S1MH 2WB1G 2KENA 4HIMA 4YCUA 1KL9A 3A5ZB 3CCMA 4B3RL 2ID0A 2NZHA 1J6QA 3CCLA 4RG1A 3J80i 2MO0A 2WFWA 5JEAG 3SGIA 2FXQA 1KAWA 4A76A 1M90C 3A0JA 1EWIA 4NB3A 2R93G 1E1TA 4DNIA 1WI5A 2K5NA 1K8AC 3TS2A 4DV4Q 2RHQB 1YBYA 4EQ5A 3H0GH 2ZJRA 3KF6B 4DV4L 1N36Q 4BA2I 2F52A 1I50H 1EOVA 5ELNA 1VQKA 2OQKA 3HFZB 4QL5A 4LFBQ 1YI2A 4BY1H 4IPHA 2B63G 1NMGA 3GTLH 4IFDG 2ALYB 2PQAA 4R4QA 4HIKA 3BJUA 2OWOA 3U4ZA 2WAQG 3PUXA 4DR6Q 2ZTEA 4X66L 1OXTA 1JB7A 1ASYA 4JI2Q 5IWAL 2VQFQ 3PSIA 4GLXA 4JI2L 1XPOA 4OWWB 1AH9A 4GKKL 1VCIA 1X54A 4UPAA 1UE6A 4POGA 1QZHA 2R7DA 4MNOA 3TQYA 1Q1EA 4LF8L 5IYDG 2KHJA 5M5WH 1X56A 1N33L 1VS0A 3I4NG 5EAYA 1RIPA 4GLAC 5IYBG 4DK6C 1IYJB 1C9OA 1EIFA 4A3GH 4DR3L 4A3FG 4DV1Q 1VQEA 1XTDA 3HOWH 3G48A 1N36L 4B3TL 4L5RC 5LMNQ 1D8LA 1UE5A 1AE2A 1VQCA 3RN2A 1HNWL 5JEAJ 2Z6KC 5LMNL 1CKNA 3TS0A 1Y1WH 2Z6KA 1XMQQ 1HH2P 4B3MQ 4LF4L 1SE8A 1NE3A 2MQHA 3D31A 4K0KL 3S1QH 3H15A 1HNXL 1OTCA 3RLNA 3UDFA 5BR8L 2HHHQ 2UUBL 3S1RH 4YCWA 4DUZL 3S14H 5IP9G 1P16A 1IBLQ 1A63A 4A93G 1G6PA 5HGQA 4GOPA 1VQBA 4GOPC 1XMOQ 4LF8Q 3S2DH 3S2HH 1NTGA 4DPGA 5C44H 1KIXA 2BA0A 1X3FA 1PYSB 3RLFA 2VW9A 3GTMH 4YY3Q 3UDGA 4KLKA 4JBWA 3KOJA 3VDYA 4OXPA 1PVOA 2Q2UA 1KXLA 1EIYB 2R92H 3E9HA 4A3JH 2QGQA 1Y1VH 1S40A 1TXYA 3MXNB 3PV0A 4GNXB 4C3IH 5JJLA 1CSPA 2VUMH 2AHOB 2IT1A 3CPFA 1KC8C 3KFUA 4X62Q 4BBRH 4LFAL 4HIDA 4Y52H 3HKZG 1PV4A 3K8AA 4O0AA 2XGTA 4R4IA 2JA7G 3GTOH 1E7ZA 4KHZA 5GAHC 1D7QA 4HJ5A 4LUOA 3S17H 1N32Q 2E2HH 3CXCA 3H3VH 2B29A 1Z9FA 1IXRA 2R92G 4JI3Q 3RZOH 1OXUA 1XJVA 1PH9A 4APVA 3W1BA 1Q12A 1X65A 1S3OA 3ULPA 3GTPH 2UU9Q 3CP0A 5M3MH 1Q82C 2UUAL 5IY0A 5H1SE 1PH2A 4LF5Q 4IFDJ 1QVCA 4LNQA 2D62A 5C0XI 2YU9H 2Z0SA 3KJPA 2K52A 3I2ZA 3PIOA 1PH3A 4BY1G 4J15A 1Q81C 4JC0A 2VL6A 3M85A 2NVYH 4AYBG 1PHJA 3GTGH 4DR5L 4JV5L 3CC7A 4P73A 3I4OA 2E5LL 1NMFA 4BXXH 4PZ8A 1FGUA 2JQOA 5M5YH 2K4KA 4JI0Q 3PF5A 2YV5A 1PH1A 3HOWG 2GVAA 3KLWA 4JI6Q 5BR8Q 2HHHL 2JEAI 3CPWA 4A3FH 4OX9L 3K7UC 2ATWA 1XPUA 4BY7G 2JA6H 1A0IA 4K0KQ 1V1QA 5IYBH 2KCTA 1FL0A 3NELA 4QQBX 4A3KH 1GKHA 4R1JA 3I4NH 4OONA 3UE0A 4A3CG 3M4OH 1AE3A 3K81C 4DV0L 3A5UA 1K0RA 4LF5L 4JI5L 2YTVA 2NN6G 5C3EG 2VY3A 1GO3E 2UUAQ 4JI7Q 2UXDQ 4DV2L 2UU9L 1B70B 1O7IA 3K7AH 4JI7L 1UEBA 4L5QA 4X65Q 2Y0SG 4JCVE 3J81i 3I55A 3CCSA 1K73C 1YHBA 2NVXH 3ICEA 3U58A 5LMUL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ L;  4A3L G;  4P72 A;  1JMC A;  4HJ7 A;  3KYH C;  2N49 A;  1UE7 A;  4YHH Q;  3AFP A;  4LFA Q;  2ASB A;  1MJC A;  4IPG A;  1VQH A;  1VQI A;  2EIF A;  4JI4 L;  1N34 Q;  4QJF A;  2ES2 A;  4ALP A;  4GLV B;  5DLQ E;  4DR6 L;  2B3G A;  2PNH A;  2I0Q A;  5IP7 H;  4UP8 A;  2Q2H A;  3OW2 A;  2DGY A;  4HIO A;  1FJG Q;  2HIX A;  1Y1V G;  3NEM A;  1PA6 A;  4DR2 L;  1U5K A;  4TQU S;  1FJG L;  3FKI H;  2K14 A;  2BA1 A;  2AMC B;  4R4C A;  4AIM A;  3UDI A;  4A3D G;  1HNZ L;  3HOX H;  5J3B A;  1HNZ Q;  2R7Z H;  4OWT B;  4C3J H;  2R7F A;  3CC2 A;  4PMW A;  1VQA A;  2CKZ B;  2NN6 I;  2ZTD A;  3I4M G;  1H95 A;  1L1O B;  2E2I H;  1XMO L;  4LF7 Q;  3PUW A;  5IYC G;  1W3S A;  3PUV A;  4B3S Q;  2MO1 A;  4JI1 L;  1Q1B A;  2L15 A;  2OQ0 A;  4GOP B;  1WCM G;  2HQL A;  1I94 L;  4JBM A;  1EQR A;  5C0X G;  3T1Y Q;  1IBM L;  3CD6 A;  3T1Y L;  3GTK H;  4UY8 C;  4HJA A;  1BBU A;  1CKM A;  4LFC Q;  5C3E H;  3L2P A;  4JOI C;  3FHW A;  1K83 H;  4JOI A;  2EQS A;  2N78 A;  2AWO A;  1OXS C;  2CWA A;  4ME3 A;  4P74 A;  1I6H H;  1OXV A;  5M3F G;  4MZ9 A;  4MTN A;  5JJK A;  5GRO A;  4QGU A;  3KJO A;  2K5H A;  4IPD A;  1YZ6 A;  4YWL A;  4A3B G;  2CFM A;  3HOY G;  1MJE A;  4IJH A;  5IYC H;  3CCU A;  4JI5 Q;  1SLJ A;  1WOC A;  1PH7 A;  1KD1 C;  1N33 Q;  1TWG H;  2E8G A;  4R4O A;  1G51 A;  1N9W A;  2K5V A;  1V9P A;  3AYH B;  4L5T A;  1W2B A;  5IP7 G;  2OTL A;  4YY3 L;  2I5L X;  4DV3 Q;  1IZ6 A;  1TWF H;  2JA8 G;  3FKI G;  3OYY A;  1KQS A;  1M1K C;  5IT9 c;  5C4J H;  5GAG C;  4X6A H;  1LM0 A;  1CKO A;  1MKH A;  4UP7 A;  1YIJ A;  1RL2 A;  1Y14 B;  2D0P A;  2K50 A;  3E0E A;  4C2M H;  1X6O A;  2QA4 A;  4IO9 A;  1YJN A;  1K8G A;  2BH2 A;  4JV5 Q;  1QZG A;  1VQL A;  4DR7 Q;  2AKW B;  2HIV A;  3W1G A;  3WWV A;  4A4I A;  4AH6 A;  3J80 c;  4JI4 Q;  2A8V A;  2HT1 A;  4BY7 H;  1MIU A;  1HNX Q;  1L1O A;  2F4V Q;  4DR4 Q;  4YHH L;  4OO1 I;  2JE6 I;  4LF9 L;  3CQZ H;  5AJ3 L;  2CQO A;  2EXD A;  1HJP A;  1VQN A;  5C0X J;  4A3I H;  4YWM A;  1PH8 A;  5C4X G;  3AQQ A;  1YIT A;  3ZJY C;  2E2J H;  1EFW A;  3S15 H;  3BZK A;  3PCO B;  3OTO L;  1HR0 W;  4C3H H;  2IHF A;  3S24 A;  3PO2 H;  4KHP L;  1EQQ A;  2PMZ E;  3G6E A;  3DLL A;  2RCN A;  1E3P A;  4JI8 Q;  1YJW A;  2C35 B;  2PQA B;  2WB1 E;  3U50 C;  5FJ8 G;  4DV2 Q;  4O2D A;  1N8R C;  5E7N A;  4BBS H;  5M3F H;  1JE5 A;  1ASZ A;  1L2F A;  2A19 A;  2RF4 A;  4JI1 Q;  4AYB E;  2MNA A;  1SN8 A;  3EN2 A;  1WFQ A;  1NJI C;  5C4X H;  1HZB A;  3IRB A;  5FLM H;  3KDF A;  4A3I G;  1B7Y B;  5M3M G;  1SFO H;  4JBJ A;  3HOX G;  4JYA Q;  4GNX A;  4XTC S;  2CCZ A;  5K36 G;  4GNX C;  3U4V A;  3M7N A;  1Q7Y C;  3PO2 G;  4DAM A;  2GVB A;  2YYZ A;  2KBN A;  1VQF A;  3L0O A;  1HNW Q;  4TVA B;  3CAM A;  2IX0 A;  1WJJ A;  1SRO A;  1B8A A;  3M9B A;  5LMU Q;  3M3Y H;  4DR1 L;  4A3C H;  1XNR L;  3PF4 A;  5JJI A;  4XIG S;  2E5L Q;  3I56 A;  3MEF A;  3CCE A;  4A75 A;  1YJ9 A;  1IBL L;  2R93 H;  4A3E H;  1N34 L;  1VQ8 A;  3F8T A;  3JAM i;  4OWX B;  4JI3 L;  3TEH B;  4UP9 A;  4NXM L;  2WP8 J;  2LXK A;  5GQO A;  1QVG A;  4BXX G;  2N3S A;  1PYB A;  5ELO A;  4X65 L;  2YTX A;  3PO3 H;  2RHS B;  1Q46 A;  3HKS A;  1C0A A;  1HZC A;  2IX1 A;  2YTY A;  3RN5 A;  4AQY Q;  3T1H Q;  4A3M G;  4LF6 Q;  3T1H L;  4A3B H;  1YHA A;  1IL2 A;  3DM3 A;  5GAD C;  4A3E G;  4LWC A;  3K0X A;  1KRS A;  4B3S L;  2I5H A;  4A3K G;  4A93 H;  4WJ3 M;  3UDX A;  2H5X A;  1GD7 A;  1VQ5 A;  2LXJ A;  4WJ4 A;  1CKN B;  2A1A A;  3F1Z A;  3STB D;  4DV1 L;  1NY4 A;  4R4T A;  2UUC Q;  4OX9 Q;  3M4Q A;  1NBW A;  2R7Z G;  1FVI A;  2KHI A;  1E24 A;  2VUM G;  4JI0 L;  1CUK A;  3CCQ A;  1QVF A;  3HOZ G;  3CC4 A;  3GTQ H;  3D0F A;  3ER0 A;  2ZJP A;  4IFD I;  4DUZ Q;  4GKK Q;  3HOU H;  3CW2 C;  2ZM6 L;  4LUZ A;  4BBR G;  2UUB Q;  2JA7 H;  1VQ7 A;  4AQY L;  1E1O A;  3EBE A;  2R6G A;  2GN5 A;  2D0O A;  1XPR A;  3GDE A;  3Q8D A;  3J7Z C;  3CCV A;  4GKJ Q;  1XNQ Q;  1PFS A;  1VQP A;  2JK8 A;  5IP9 H;  1TWC H;  3LGJ A;  4KI0 A;  1L0W A;  1K3R A;  4B3T Q;  2UXC Q;  4Y7N H;  4GN5 A;  3ERS X;  2KCM A;  3TRE A;  1IBM Q;  1P8L A;  4DV7 L;  2LSS A;  2PI2 E;  3EIV A;  1HZ9 A;  5C44 G;  1UWV A;  3BZC A;  2UXC L;  1L1O C;  4PZ6 A;  5FLM G;  3RZD H;  3JAM c;  3L7Z C;  2VS1 A;  1YVC A;  2XTI A;  1N32 L;  4EX5 A;  1PH6 A;  3J81 c;  1Q86 C;  2I5M X;  4BBS G;  5LMN W;  1PH5 A;  1X3G A;  1GM5 A;  2PI2 A;  4NXM Q;  2NVQ H;  1T9H A;  3GTJ H;  4IOA A;  2F4V L;  4DR4 L;  4NXN L;  3ULL A;  5FJ8 H;  3HKZ E;  4POF A;  4A3G G;  3FP9 A;  1Q8K A;  3K80 C;  1GVP A;  4PZ7 A;  2ZM6 Q;  1Z47 A;  1OXX K;  2IHE A;  1CSQ A;  1SR3 A;  1X3E A;  3BU2 A;  1KRT A;  3PUY A;  2Y0S E;  5M5X H;  1QUQ B;  1VQM A;  1VQ9 A;  4L5S A;  3H3V I;  1HZA A;  4DV6 L;  4OO1 G;  3CF5 A;  1S72 A;  1BKB A;  3PGZ A;  1TWH H;  3RLO A;  3HOY H;  1EYG A;  1C7Y A;  2JA6 G;  2AWN A;  1VQD A;  4JG2 A;  1SRU A;  2VNU D;  1BBW A;  4X64 Q;  4LW1 A;  3I7F A;  1LYL A;  3HOU G;  1WYD A;  4LF4 Q;  3F2D A;  3S1N H;  1HR0 Q;  4YCV A;  3KDF B;  1BVS A;  4FDB A;  2N8N A;  2VZA A;  3M4P A;  3H0G G;  3CME A;  1SMX A;  4LFB L;  4IJL A;  4LF9 Q;  4LFC L;  3TRZ A;  1JJC B;  4DV7 Q;  4A3D H;  3E9I A;  3GD7 A;  4H02 A;  1I3Q H;  1LUZ A;  4DKA C;  4DR7 L;  4KHP Q;  1XMQ L;  3G4S A;  4DV5 Q;  4B3M L;  4DV0 Q;  2ZTC A;  4P75 A;  4BA1 I;  2VQE L;  4DR1 Q;  3ULJ A;  5FLX c;  4HJ9 A;  3J81 j;  3HOV H;  3PIP A;  1YHQ A;  2B63 H;  2Q2I A;  1G29 1;  3G71 A;  2OCE A;  1R9T H;  5IWA Q;  2VQF L;  4DAY B;  3NEN A;  4P71 A;  1I94 Q;  3W5O A;  4HJ8 A;  4JBK A;  4DV6 Q;  3AEV A;  2UXB L;  2DUD A;  2NVT H;  3JC6 6;  3F2C A;  4LF7 L;  4NPS A;  3RNU A;  1IBK Q;  4B3R Q;  5IE8 A;  3CCJ A;  2JEB I;  1VQ6 A;  3STB C;  2UXB Q;  1X55 A;  1YNX A;  2MFI A;  3RR5 A;  4DR5 Q;  1JJG A;  1KHI A;  4GS3 A;  4LF6 L;  2F3I A;  4JYA L;  2IY5 B;  1LTL A;  1VQG A;  1JT8 A;  4DR2 Q;  1E22 A;  4A3L H;  2VQE Q;  5IYD H;  2JA5 G;  2Q2T A;  4DV5 L;  2V1C C;  5AJ3 Q;  2JA8 H;  1U0L A;  1J5E L;  2CWP A;  4A3M H;  1I5F A;  3KF6 A;  5GAE C;  4JI8 L;  3KF8 B;  4IOC A;  1J5E Q;  2ZJQ A;  2UXD L;  1Y1W G;  3F2B A;  3CMA A;  3OTO Q;  4GN4 B;  4RMF A;  3PUZ A;  2BH8 A;  1DGS A;  3J7A 5;  4QIW E;  2NZO A;  3AFQ A;  3GO5 A;  1YEZ A;  4GKJ L;  5HY6 A;  4X64 L;  2OTJ A;  1V43 A;  4DR3 Q;  1VQO A;  1X9N A;  2JJQ A;  4DV3 L;  4X62 L;  2K75 A;  1UE1 A;  1A8V A;  3UE1 A;  3HOV G;  3B6Y A;  2JA5 H;  2WAQ E;  1VQ4 A;  4IPC A;  1IBK L;  1XNR Q;  2JA9 A;  4DUY Q;  3PO3 G;  3S16 H;  3NBH B;  4DUY L;  3HOZ H;  1VQJ A;  1HR0 L;  3I4M H;  2QEX A;  4A3J G;  4PG3 A;  1PH4 A;  1QUQ A;  4QY7 A;  4YWK A;  3CCR A;  1EUJ A;  4DK3 C;  4GN3 B;  1JJ2 A;  1TWA H;  4X66 Q;  1A62 A;  1K9M C;  1WCM H;  2UUC L;  3A74 A;  4LUV A;  4JI6 L;  4NXN Q;  3S1M H;  2WB1 G;  2KEN A;  4HIM A;  4YCU A;  1KL9 A;  3A5Z B;  3CCM A;  4B3R L;  2ID0 A;  2NZH A;  1J6Q A;  3CCL A;  4RG1 A;  3J80 i;  2MO0 A;  2WFW A;  5JEA G;  3SGI A;  2FXQ A;  1KAW A;  4A76 A;  1M90 C;  3A0J A;  1EWI A;  4NB3 A;  2R93 G;  1E1T A;  4DNI A;  1WI5 A;  2K5N A;  1K8A C;  3TS2 A;  4DV4 Q;  2RHQ B;  1YBY A;  4EQ5 A;  3H0G H;  2ZJR A;  3KF6 B;  4DV4 L;  1N36 Q;  4BA2 I;  2F52 A;  1I50 H;  1EOV A;  5ELN A;  1VQK A;  2OQK A;  3HFZ B;  4QL5 A;  4LFB Q;  1YI2 A;  4BY1 H;  4IPH A;  2B63 G;  1NMG A;  3GTL H;  4IFD G;  2ALY B;  2PQA A;  4R4Q A;  4HIK A;  3BJU A;  2OWO A;  3U4Z A;  2WAQ G;  3PUX A;  4DR6 Q;  2ZTE A;  4X66 L;  1OXT A;  1JB7 A;  1ASY A;  4JI2 Q;  5IWA L;  2VQF Q;  3PSI A;  4GLX A;  4JI2 L;  1XPO A;  4OWW B;  1AH9 A;  4GKK L;  1VCI A;  1X54 A;  4UPA A;  1UE6 A;  4POG A;  1QZH A;  2R7D A;  4MNO A;  3TQY A;  1Q1E A;  4LF8 L;  5IYD G;  2KHJ A;  5M5W H;  1X56 A;  1N33 L;  1VS0 A;  3I4N G;  5EAY A;  1RIP A;  4GLA C;  5IYB G;  4DK6 C;  1IYJ B;  1C9O A;  1EIF A;  4A3G H;  4DR3 L;  4A3F G;  4DV1 Q;  1VQE A;  1XTD A;  3HOW H;  3G48 A;  1N36 L;  4B3T L;  4L5R C;  5LMN Q;  1D8L A;  1UE5 A;  1AE2 A;  1VQC A;  3RN2 A;  1HNW L;  5JEA J;  2Z6K C;  5LMN L;  1CKN A;  3TS0 A;  1Y1W H;  2Z6K A;  1XMQ Q;  1HH2 P;  4B3M Q;  4LF4 L;  1SE8 A;  1NE3 A;  2MQH A;  3D31 A;  4K0K L;  3S1Q H;  3H15 A;  1HNX L;  1OTC A;  3RLN A;  3UDF A;  5BR8 L;  2HHH Q;  2UUB L;  3S1R H;  4YCW A;  4DUZ L;  3S14 H;  5IP9 G;  1P16 A;  1IBL Q;  1A63 A;  4A93 G;  1G6P A;  5HGQ A;  4GOP A;  1VQB A;  4GOP C;  1XMO Q;  4LF8 Q;  3S2D H;  3S2H H;  1NTG A;  4DPG A;  5C44 H;  1KIX A;  2BA0 A;  1X3F A;  1PYS B;  3RLF A;  2VW9 A;  3GTM H;  4YY3 Q;  3UDG A;  4KLK A;  4JBW A;  3KOJ A;  3VDY A;  4OXP A;  1PVO A;  2Q2U A;  1KXL A;  1EIY B;  2R92 H;  3E9H A;  4A3J H;  2QGQ A;  1Y1V H;  1S40 A;  1TXY A;  3MXN B;  3PV0 A;  4GNX B;  4C3I H;  5JJL A;  1CSP A;  2VUM H;  2AHO B;  2IT1 A;  3CPF A;  1KC8 C;  3KFU A;  4X62 Q;  4BBR H;  4LFA L;  4HID A;  4Y52 H;  3HKZ G;  1PV4 A;  3K8A A;  4O0A A;  2XGT A;  4R4I A;  2JA7 G;  3GTO H;  1E7Z A;  4KHZ A;  5GAH C;  1D7Q A;  4HJ5 A;  4LUO A;  3S17 H;  1N32 Q;  2E2H H;  3CXC A;  3H3V H;  2B29 A;  1Z9F A;  1IXR A;  2R92 G;  4JI3 Q;  3RZO H;  1OXU A;  1XJV A;  1PH9 A;  4APV A;  3W1B A;  1Q12 A;  1X65 A;  1S3O A;  3ULP A;  3GTP H;  2UU9 Q;  3CP0 A;  5M3M H;  1Q82 C;  2UUA L;  5IY0 A;  5H1S E;  1PH2 A;  4LF5 Q;  4IFD J;  1QVC A;  4LNQ A;  2D62 A;  5C0X I;  2YU9 H;  2Z0S A;  3KJP A;  2K52 A;  3I2Z A;  3PIO A;  1PH3 A;  4BY1 G;  4J15 A;  1Q81 C;  4JC0 A;  2VL6 A;  3M85 A;  2NVY H;  4AYB G;  1PHJ A;  3GTG H;  4DR5 L;  4JV5 L;  3CC7 A;  4P73 A;  3I4O A;  2E5L L;  1NMF A;  4BXX H;  4PZ8 A;  1FGU A;  2JQO A;  5M5Y H;  2K4K A;  4JI0 Q;  3PF5 A;  2YV5 A;  1PH1 A;  3HOW G;  2GVA A;  3KLW A;  4JI6 Q;  5BR8 Q;  2HHH L;  2JEA I;  3CPW A;  4A3F H;  4OX9 L;  3K7U C;  2ATW A;  1XPU A;  4BY7 G;  2JA6 H;  1A0I A;  4K0K Q;  1V1Q A;  5IYB H;  2KCT A;  1FL0 A;  3NEL A;  4QQB X;  4A3K H;  1GKH A;  4R1J A;  3I4N H;  4OON A;  3UE0 A;  4A3C G;  3M4O H;  1AE3 A;  3K81 C;  4DV0 L;  3A5U A;  1K0R A;  4LF5 L;  4JI5 L;  2YTV A;  2NN6 G;  5C3E G;  2VY3 A;  1GO3 E;  2UUA Q;  4JI7 Q;  2UXD Q;  4DV2 L;  2UU9 L;  1B70 B;  1O7I A;  3K7A H;  4JI7 L;  1UEB A;  4L5Q A;  4X65 Q;  2Y0S G;  4JCV E;  3J81 i;  3I55 A;  3CCS A;  1K73 C;  1YHB A;  2NVX H;  3ICE A;  3U58 A;  5LMU L; 
#chains in the Genus database with same CATH topology
 4P72 A;  2CVR A;  2N49 A;  3AFP A;  1QIL A;  4CHT B;  4PMB A;  1BCP B;  1JIC A;  1KAB A;  4IPG A;  1VQI A;  3J7A V;  2ES2 A;  1RF2 D;  1T5X D;  2P5Z X;  5IP7 H;  3OW2 A;  2Q2H A;  1FJG Q;  1Y1V G;  3NEM A;  1U5K A;  3ONA B;  4R4C A;  1CK1 A;  5C5L A;  3HP3 A;  3UDI A;  1HNZ L;  1HNZ Q;  2R7Z H;  4C3J H;  5I2X A;  4N8X 1;  4A3I B;  1H95 A;  1F2Z A;  3NTI A;  2E2I H;  1XMO L;  2QKI C;  5I2Y A;  3PUV A;  3PO2 B;  2F0G A;  2OQ0 A;  2HQL A;  1JOR A;  4KK7 A;  3X3N A;  4IUV A;  3GTK H;  1IBM L;  3T1Y Q;  3CD6 A;  2NWG A;  2KOL A;  4J6H A;  3T1Y L;  2KQ3 A;  3GTL B;  3AB9 A;  1ICF B;  4P74 A;  1I6H H;  2LFN A;  4OHJ A;  2B2W A;  4MTN A;  2XVS A;  2PCF B;  1JWM D;  2K5H A;  1YZ6 A;  2CFM A;  2X6L A;  1MJE A;  4JI5 Q;  1SLJ A;  1N33 Q;  1ET9 A;  1TWG H;  4K8I A;  4R4O A;  3NQT A;  2K7V A;  3AYH B;  4A3E B;  1S5F D;  1LT3 D;  2GA4 B;  2EYL A;  4BBR B;  4ABN A;  1TWF H;  2PO4 A;  1PTO B;  4CKE A;  1M1K C;  5C4J H;  1B3A A;  1LM0 A;  1CKO A;  4N9P A;  4QCL A;  1A6X A;  1RL2 A;  2K50 A;  4DXF A;  4NKL A;  4JV5 Q;  3SHL A;  2HIV A;  4A4I A;  5CBE E;  1EU4 A;  4BY7 B;  4OO1 I;  3SK8 A;  1B4O A;  5AJ3 L;  1EL0 A;  2EXD A;  2SEB D;  1HJP A;  4LMQ D;  4A3I H;  1VQN A;  4YWM A;  3AQQ A;  1YIT A;  4CJ2 C;  3DXJ C;  1EWH A;  1TS2 A;  3OTO L;  1KDC A;  1CI3 M;  3PO2 H;  1KDA A;  4KHP L;  2PMZ E;  2C35 B;  4OEL B;  2PQA B;  3U50 C;  4DAP A;  2X6G A;  1KNE A;  4DV2 Q;  1N8R C;  4IUU A;  5E7N A;  2RF4 A;  2CW0 D;  3A8K E;  2MJ8 A;  1ZEQ X;  1NJI C;  4A3I G;  5F2D A;  5G3L D;  1B7Y B;  3BVZ A;  4JBJ A;  4JYA Q;  5K36 G;  4IAL A;  3U4V A;  3PO2 G;  2Q8R E;  1Q7Y C;  2GVB A;  3D4D A;  2F0T A;  1HNW Q;  3M3Y B;  3M9B A;  5LMU Q;  4S3S A;  3RMH A;  5IGF A;  3I56 A;  3MEF A;  2CH4 A;  1IBL L;  1LTI D;  4A3E H;  4X3S A;  4OWX B;  5M9O A;  2R61 A;  1LTR D;  2EY2 A;  1JWS D;  4C3I G;  5I6Y A;  5GQO A;  5JJZ A;  4K2L A;  2YTX A;  3PO3 H;  2RHS B;  1W6K A;  1Q46 A;  3HKS A;  2IX1 A;  2EYM A;  1B44 D;  3A54 A;  3T1H L;  3PIO 3;  4A3E G;  1KRS A;  4HSV A;  4A93 H;  1U4M A;  4WJ3 M;  2H5X A;  5EKL A;  4WFN 3;  1CKN B;  2EJG C;  1LTA D;  2B2U C;  4R4T A;  1NBW A;  2R7Z G;  4ZK9 B;  3E3X A;  3GTG B;  3EQL C;  1BBX C;  1CUK A;  3CCQ A;  3H91 A;  3GTQ H;  3D0F A;  2ZJP A;  2K1B A;  3CW2 C;  2JA7 H;  3EBE A;  2GN5 A;  2IW3 A;  3GDE A;  3CCV A;  1XNQ Q;  1A2T A;  2JK8 A;  5IP9 H;  5EBC A;  3TBI B;  4Y7N H;  4GN5 A;  2KCM A;  3CHB D;  1BOS A;  4DV7 L;  5C44 G;  2Z9H A;  1UWV A;  3TZD A;  2UXC L;  1L1O C;  4PZ6 A;  3RZD H;  4XDX A;  2E76 C;  1Q86 C;  4FYD A;  2NVQ H;  1WTX A;  1PH5 A;  1GM5 A;  1EU3 A;  3Q22 A;  1T9H A;  2ZXR A;  4FP5 D;  4X3K A;  3ULL A;  4POF A;  2F4V L;  3K80 C;  1WTV A;  1Q8I A;  1CSQ A;  1SR3 A;  4UHV A;  1QUQ B;  4OO1 G;  3CF5 A;  1S72 A;  4Q5V A;  3PGZ A;  1QWY A;  2JSO A;  4CKB A;  3QO2 A;  1B50 A;  2AWN A;  3TZU A;  1BR9 A;  1LYL A;  3HOU G;  5E4X A;  1HR0 Q;  4YCV A;  5A2Q L;  4FDB A;  2N8N A;  1SYC A;  4LFB L;  4K6D A;  3TRZ A;  1JJC B;  3HS0 C;  4K5X A;  4NP5 A;  1VF5 C;  2OEO A;  4DKA C;  4KHP Q;  1XMQ L;  3G4S A;  1AP0 A;  2ZTC A;  4P75 A;  2VQE L;  4DR1 Q;  1I6H B;  5FLX c;  2WAQ B;  3HGB A;  1NR2 A;  1IW7 D;  1PRT B;  3PIP A;  1R9T H;  1I94 Q;  3FVQ A;  3W5O A;  4JBK A;  4DV6 Q;  3E0J A;  1DXM A;  2Q8T A;  3F2C A;  1RTN A;  3RNU A;  1IBK Q;  4B3R Q;  1FR3 A;  2F0V A;  2JEB I;  3K6O A;  5IE8 A;  2YU9 B;  1X55 A;  1YNX A;  1KHI A;  4GS3 A;  1AZQ A;  1WTP A;  2K28 A;  1LTL A;  2A6E C;  4IUQ A;  4DF7 A;  3VA5 A;  2E2J B;  2BE5 D;  2VQE Q;  2V1C C;  3MWY W;  4G4K A;  1ZKO A;  1J5E L;  4A3M B;  4JI8 L;  3S14 B;  1XYI A;  4ZLT F;  5IGE A;  5BN3 A;  1H9S B;  1MGS A;  4RMF A;  5IGG A;  2IJ0 A;  2QW7 A;  2Z4H A;  3NWT A;  1V43 A;  4DR3 Q;  2JJQ A;  3LX0 A;  2K75 A;  1UE1 A;  3UE1 A;  3NK9 A;  3HOV G;  3J80 E;  2WAQ E;  1S5D D;  3PO3 G;  1XNR Q;  4IUT A;  2XSC A;  1B9N A;  3HOU B;  3V05 A;  3CCR A;  4DK3 C;  2B2Y C;  2DN8 A;  3I73 A;  1TWA H;  2LS0 1;  2B2Y A;  3URY A;  4X66 Q;  4NXN Q;  2KED A;  4LUV A;  2UUC L;  4MHE A;  2KEN A;  1PTO H;  5CV4 A;  3A5Z B;  5C4J B;  3CCM A;  2NZH A;  2WFW A;  2FXQ A;  2JP1 A;  2NBF A;  1M90 C;  2EDG A;  2R93 G;  1WTH A;  4DNI A;  4F8M A;  5BN5 A;  4IUN A;  3F2U A;  3H0G B;  5HUR A;  2F52 A;  1I50 H;  1JR0 D;  1STG A;  2K5Q A;  1NMG A;  2ALY B;  2L1B A;  3BJU A;  1MSH A;  1U4P A;  4DR6 Q;  1HTL D;  2MUY A;  4JI2 Q;  4EVO A;  5J22 A;  4GLX A;  1E2V A;  1AH9 A;  3C1E A;  1VCI A;  1X54 A;  4I7A A;  3TQY A;  2EY1 A;  4H44 C;  2D9U A;  5LHY 1;  5EAY A;  3H09 A;  1F9P A;  4QB4 A;  4DV1 Q;  1VQE A;  4A3F G;  4MIU A;  3MC0 B;  1N36 L;  4B3T L;  3HOW B;  4ID6 A;  5LMN Q;  4OO1 H;  1ESR A;  3RN2 A;  5JEA J;  5LMN L;  2RDG A;  1CKN A;  5JOB A;  3TS0 A;  3VR4 A;  2MQH A;  3PO3 B;  2PPB C;  2A6H D;  3H15 A;  3OPO A;  4JK1 C;  3RLN A;  3K5L A;  5BR8 L;  4JVZ A;  4DUZ L;  1IBL Q;  1A63 A;  4XXE A;  5KIX A;  4GOP A;  1XMO Q;  1II3 A;  1G91 A;  1GUN A;  1JE4 A;  4DGZ A;  4ZUJ A;  5C4H A;  1PYS B;  3MZ5 A;  4YY3 Q;  1PZI D;  4JBW A;  5D65 A;  4OXP A;  1PVO A;  1F9Q A;  1PYW D;  3E9H A;  5JJL A;  1HUM A;  4C3I H;  2VUM H;  3GTQ B;  2IT1 A;  2F03 A;  3NTK A;  5C4Z A;  4X62 Q;  1ILQ A;  3BDC A;  4BBR H;  4EGV A;  4R4I A;  2XGT A;  1VMC A;  4DU9 A;  3GTO H;  1E7Z A;  4KHZ A;  1D2B A;  3T53 B;  4PNY A;  1Z9F A;  4K5V A;  5KRU A;  1IYV A;  1JQY D;  5K36 H;  2G5D A;  4HCE A;  4QUC A;  2UU9 Q;  2JA5 B;  5IY0 A;  1QG7 A;  1UAP A;  3ND8 A;  4DN4 M;  1HPC A;  4K8J A;  3SVM A;  4HMJ A;  2K52 A;  3I2Z A;  4BY1 G;  3BVM A;  4IFD H;  3A56 A;  4AYB G;  4C56 C;  3DEP A;  4M1U B;  2PQE A;  1LTS D;  4M8A A;  1PTO C;  5M5Y H;  1R4Q B;  1BUV T;  2J0T D;  2HCI A;  5K5P A;  3HOW G;  4Z9C B;  1JCK B;  4OX9 L;  3K7U C;  2ATW A;  1XPU A;  4BY7 G;  2X69 A;  4K0K Q;  1FL0 A;  3NEL A;  4C1N I;  1QOH A;  3I4N H;  4RFB A;  3A8I E;  5ELB A;  5FKA C;  2UUA Q;  2VY3 A;  4JI7 Q;  1G8Z D;  1B70 B;  1TKW B;  1AZP A;  3KBG A;  4JI7 L;  4X65 Q;  2NVX H;  4JCV E;  1SDF A;  5LMU L;  1JMC A;  4HJ7 A;  3I72 A;  4LFA Q;  2TSS A;  3D6C A;  2EIF A;  1R9T B;  1ENA A;  2G9H D;  3G6J B;  4QJF A;  4C3H G;  4ALP A;  4GLV B;  2WV6 D;  2PNH A;  1KAA A;  2HIX A;  4TQU S;  1FJG L;  2BA1 A;  4KY5 A;  3HOX H;  1BDO A;  2R7F A;  2CKZ B;  3I4M G;  1K3B C;  2HCC A;  2EYH A;  2ICE C;  1L1O B;  1Q90 A;  4KTA A;  5C3W A;  5EBD A;  2HD3 A;  3MHB A;  4BWG B;  1EOT A;  3TSS A;  4GOP B;  1WCM G;  4JBM A;  1EQR A;  4B9W A;  4RH6 A;  4BBS B;  2JA7 B;  1RJT A;  1BBU A;  2B8F A;  3VYR A;  4BY1 B;  4JOI C;  4XYQ A;  3K5N A;  5COR A;  4JOI A;  5CV7 A;  2QDB A;  2C5C A;  2AWO A;  4ME3 A;  1KLU D;  2PW5 A;  2B2U A;  1LAC A;  5JJK A;  5GRO A;  1SNP A;  4YWL A;  4A3B G;  1O80 A;  4IJH A;  1STE A;  1PH7 A;  3ND9 A;  4CBV A;  1ILP A;  1G51 A;  1N9W A;  2K5V A;  1JB3 A;  4DAY A;  4L5T A;  5KND A;  3IKJ A;  4EQP A;  4A3G B;  2JYO A;  4RCN A;  2I5L X;  1IZ6 A;  5AFW A;  2O4X A;  1EY8 A;  5TSS A;  1PDQ A;  4CGY B;  4C3J B;  5GAG C;  1SNQ A;  4OL7 A;  3S2H H;  1CT1 D;  2D0P A;  2O5J C;  3RZO B;  2F4I A;  3S1Q B;  1QZG A;  5D3I B;  4X3U A;  3J80 c;  2HT1 A;  2A8V A;  1L1O A;  2F4V Q;  4LF9 L;  4KD3 A;  3CQZ H;  3T16 A;  2EPB A;  3KLS A;  4LK1 C;  5C0X J;  5C4X G;  4J1M A;  4C3H B;  4R8I A;  3BZK A;  1FNV A;  2IHF A;  1SE4 A;  1EQQ A;  1WTR A;  3G6E A;  2RCN A;  1E3P A;  1C4Q A;  4JI8 Q;  1HHV A;  1I50 B;  1Z7T A;  4BBS H;  1JOK A;  1L2F A;  2K04 A;  1SMY D;  3OMG A;  1RTO A;  5C4X H;  3IRB A;  5FLM H;  3CRL C;  1O78 A;  5CYU A;  5IOC A;  2G9D A;  4KD4 A;  2MHV A;  2YYZ A;  4ULL A;  3L0O A;  2ZXO A;  1WJJ A;  1HQM C;  4DR1 L;  1XX8 A;  1QNU A;  2E5L Q;  4A75 A;  1YJ9 A;  3SE0 A;  5IOD A;  1N34 L;  1QJO A;  3V96 A;  4JI3 L;  4CDC C;  1UNS A;  4NXM L;  1LTG D;  4OIK A;  3NUC A;  4L8J A;  3VYT A;  2LXK A;  1QCB D;  3TP5 A;  4DFA A;  5ELO A;  4X65 L;  1HTP A;  1MHW C;  1C0A A;  1SSO A;  4AQY Q;  3T1H Q;  2XRQ D;  1YHA A;  4LWC A;  5C3E B;  1V1P B;  1J9O A;  1GD7 A;  3H94 A;  5EPK A;  1I4Q A;  1YNJ D;  2UUC Q;  1E2W A;  2Y0S B;  3M4Q A;  1CZG A;  1DOL A;  1E24 A;  1LT5 D;  1LTB D;  2VXW A;  1QVF A;  3HOZ G;  2HDM A;  4IFD I;  3MFY A;  4DUZ Q;  3HOU H;  2EY6 A;  2VUM B;  2UUB Q;  1VQ7 A;  4AQY L;  4HMI A;  1EY0 A;  1PTO F;  1XPR A;  1TS3 A;  3Q8D A;  3J7Z C;  3Q6S A;  5JVG 3;  1PFS A;  1DON A;  4B3T Q;  2DY7 A;  2B63 B;  1IHZ A;  2EYF A;  3KBX A;  2LSS A;  2KEE A;  1TY2 A;  2FFK B;  1SNC A;  2J7Z A;  2K03 A;  2VS1 A;  3IAY A;  1YVC A;  5G3L F;  2AUK A;  1PH6 A;  4IQZ A;  4NXM Q;  1Y69 U;  2PZU A;  4C1N K;  4DR4 L;  2EYO A;  3FP9 A;  1GVP A;  4PZ7 A;  1OXX K;  3NE5 B;  2CQA A;  4C2M B;  2Y0S E;  1VQ9 A;  1A3U A;  4FXG C;  3IFD A;  4RGM A;  4XYO A;  2XIW A;  3BYT B;  3HOX B;  4ME5 A;  2JA6 G;  1RCV D;  3HEJ A;  2VNU D;  4CKC A;  2PZT A;  2A74 C;  1WYD A;  4LF4 Q;  3S15 B;  3S1N B;  3GP7 A;  2D5D A;  2LKV A;  2VZA A;  3I4N B;  3H0G G;  3A55 A;  3RD4 A;  1D5X C;  4LFC L;  2EYP A;  1LTT D;  4A3D H;  3E9I A;  1LUZ A;  4FVM A;  5FO8 B;  4DV5 Q;  3AU7 A;  5C6A A;  4HJ9 A;  4QMG A;  3HOV H;  2B63 H;  1Q3L A;  2OCE A;  5IWA Q;  2O2L D;  2I07 B;  3JC6 6;  4LF7 L;  4NPS A;  1CHQ D;  3CCJ A;  1YNJ C;  1H9M A;  1EY5 A;  4U67 3;  2PZW A;  1PTO D;  2IY5 B;  2OT2 A;  4A3F B;  1DD2 A;  5KNC A;  1JT8 A;  2XWJ B;  1TS5 A;  4DR2 Q;  3S2H B;  1EWC A;  2E74 C;  5IYD H;  4DV5 L;  3J80 L;  2FJ2 A;  2JA8 H;  1U0L A;  3R2I A;  1CFM A;  1I5F A;  4XT3 B;  3T13 A;  3KF8 B;  1J5E Q;  2I46 A;  3ZYY X;  3R3O A;  4GN4 B;  3OSO A;  4QIW E;  1F9S A;  2J4X A;  2NZO A;  3AFQ A;  1YEZ A;  3GO5 A;  2RQX A;  4A3K B;  5KYL A;  2HQE A;  3P1H A;  1X9N A;  1FNU A;  4DV3 L;  4X62 L;  5EPJ A;  4NDX A;  1A8V A;  5ISR A;  2JA5 H;  4L6T B;  5LL6 S;  2Q8I B;  1IBK L;  4B3R L;  1AN8 A;  3HOZ H;  1VQJ A;  1HR0 L;  3I4M H;  4A3J G;  4PG3 A;  1QUQ A;  3FDT A;  4YWK A;  3JAM E;  3GV3 A;  2BDO A;  2KUM A;  5I9P A;  2F0U A;  1WCM H;  1SMY C;  3S1M H;  2WB1 G;  1KL9 A;  1EYD A;  4IUP A;  2ID0 A;  3J7A F;  1GHK A;  1J6Q A;  2MP1 A;  4RG1 A;  1D1I A;  2MO0 A;  5JEA G;  1HXY D;  4A76 A;  2F0K A;  1EWI A;  1E1T A;  1WI5 A;  4ZKB B;  1PLF A;  3TS2 A;  2RHQ B;  1YBY A;  1FYC A;  1SYB A;  1B1Z A;  1TII D;  2CHB D;  2E2I B;  4L63 B;  4HED A;  3S1R B;  1VQK A;  3HFZ B;  4QL5 A;  1YI2 A;  3P20 A;  4IPH A;  3GTL H;  5ELD A;  4DA2 A;  1CHP D;  1S5E D;  3U4Z A;  1ROD A;  3PUX A;  4XT1 B;  1SFO B;  2CH4 W;  2ZTE A;  1ASY A;  1OXT A;  1JB7 A;  1HFN A;  5IWA L;  1XPO A;  4OWW B;  1TWA B;  2KHS A;  4GKK L;  4HAE A;  3MXU A;  4UPA A;  1UE6 A;  1QZH A;  1Y1V B;  4MNO A;  1Q1E A;  2KHJ A;  5M5W H;  2NTT A;  3PMF A;  1E0B A;  2B2T C;  5IYB G;  5E3F A;  2F0J A;  1PZK D;  2L5T A;  1XTD A;  5EGT A;  2XN9 C;  4L5R C;  3P7J A;  3OHX C;  1AE2 A;  5I6W A;  1F2Y A;  1Y1W H;  1XMQ Q;  2JXM B;  4LF4 L;  3WOE A;  4KKU A;  3D31 A;  5HGT A;  1OTC A;  5JAV A;  2K05 A;  2WII B;  2HHH Q;  2EYJ A;  1CA6 A;  4KKS A;  1P16 A;  1B53 A;  5ELF A;  5CR3 A;  3C3L A;  4ZYS A;  3Q0A A;  3FPP A;  4KY6 A;  4DPG A;  4V19 0;  1SEB D;  1X3F A;  5FO9 B;  4KLK A;  1BNZ A;  1KXL A;  1EIY B;  4TRD A;  4GNX B;  1RHP A;  1CSP A;  4H0L C;  1EIG A;  1K8O A;  4Y52 H;  3WOF A;  4HID A;  3HKZ G;  2JA7 G;  3K8A A;  4O0A A;  3ICE A;  3S17 H;  1N32 Q;  3CXC A;  3H3V H;  2Z4I A;  3RZO H;  3L3O C;  1OXU A;  1PH9 A;  5C0X H;  3ULP A;  1S3O A;  3GTP H;  5C5M A;  1W6J A;  3C1F A;  5M3M H;  1Q82 C;  4WJW A;  1PH2 A;  1EEI D;  1QVC A;  2D62 A;  2Z0S A;  1O7Z A;  3PIO A;  1Y1W B;  3EJI A;  1Q81 C;  2PNR C;  4WRD A;  2VB2 X;  2VL6 A;  3E6Z X;  3TP6 A;  2BE5 C;  4DR5 L;  4JV5 L;  2E5L L;  3NPP A;  3SXH A;  2SDF A;  4PZ8 A;  1EZ8 A;  4JI0 Q;  3NXW A;  2YV5 A;  1TWH B;  3DMU A;  4C3I B;  4JI6 Q;  2JEA I;  4A3F H;  4EQN A;  1V1P A;  4MN3 A;  4HCS A;  2A73 B;  1TQO A;  4R1J A;  4A3C G;  3T51 B;  1NCV A;  2JA8 B;  1IW7 C;  1QB5 D;  2UU9 L;  1O7I A;  5BN4 A;  5J39 A;  2M9V A;  1SAP A;  2FMC A;  4CJ1 B;  2QIL A;  4IOA A;  1OO9 B;  2MPM A;  4A3L G;  2SNS A;  4FF3 A;  4P2C B;  3KYH C;  1UE7 A;  3DM1 A;  2N88 A;  1WVL A;  4JI4 L;  3T56 B;  2JN4 A;  1I4G A;  5DLQ E;  2B3G A;  3KLS X;  2I0Q A;  1MI2 A;  4UP8 A;  2DGY A;  3OOC A;  4H13 C;  4DR2 L;  5CC4 A;  3M4Y A;  4ZQ3 A;  1WTW A;  4AIM A;  5J3B A;  1EQV A;  4OWT B;  1VQA A;  4FF4 A;  1SJE D;  4LF7 Q;  2A6H C;  1SYF A;  2DNC A;  4JI1 L;  4DNR B;  3BDO A;  4LFC Q;  1CKM A;  2F0O A;  5C3E H;  3L2P A;  1K83 H;  2EQS A;  1D5M C;  1DM0 B;  2LMC B;  2NVX B;  2AQ3 B;  1K8M A;  2CWA A;  1IYU A;  3RUZ A;  1OXV A;  4QGU A;  3EVQ A;  1ONL A;  5IT9 L;  1EY9 A;  3VR6 A;  5IYC H;  3CCU A;  1KD1 C;  1AEX A;  4N8F A;  2LY7 A;  2E8G A;  1TWG B;  1V9P A;  3W2D A;  1W2B A;  4DV3 Q;  3AMU A;  1STY A;  2JA8 G;  3FKI G;  3OYY A;  1F2L A;  5CV9 A;  1TWF B;  1KQS A;  5IGB A;  2F0N A;  4DAV A;  1MKH A;  4UP7 A;  1G2S A;  3E0E A;  4C2M H;  1X6O A;  4IO9 A;  2BH2 A;  4KN7 C;  3NSW A;  1PXU A;  4G7H C;  2AKW B;  3WWV A;  1X32 A;  3W1G A;  4BY7 H;  2F1M A;  1HNX Q;  4DR4 Q;  3LNN A;  4KMU C;  3C46 A;  4YHH L;  1T5E A;  2CQO A;  2VB3 X;  4ZKC B;  2E2J H;  3ZJY C;  3S15 H;  3MAQ A;  1A15 A;  3PCO B;  4IUR A;  4TKO B;  1HR0 W;  2F0E A;  1YJW A;  3TP7 A;  3K58 A;  1WD0 A;  2O5I C;  5FJ8 G;  2KA7 A;  1K0S A;  5M3F H;  1JE5 A;  1ASZ A;  2R92 B;  2RA4 A;  4JI1 Q;  4AYB E;  4HN7 A;  2EOT A;  1HZB A;  1QE6 A;  3KDF A;  5M3M G;  1SFO H;  5I9O A;  4IN3 A;  3HOX G;  2CCZ A;  4XTC S;  3M7N A;  4DAM A;  4U68 A;  2KBN A;  2XRS D;  4A3C H;  2ZT9 C;  3M3Y H;  3MXP A;  1XNR L;  4ODG A;  3CCE A;  3D4W A;  1R4P B;  3MFG A;  2R93 H;  5CV8 A;  4A3D B;  4FF2 A;  4J8Q A;  3VYS A;  2CW0 C;  1I6V C;  2K01 A;  3JAM i;  2WP8 J;  4BXX G;  2N3S A;  3HOV B;  2XWB B;  1TT2 A;  1SXT A;  2F0L A;  1EQT A;  5IGC A;  3RN5 A;  4A3M G;  4A3B H;  1KDB A;  2PYK A;  3HRZ C;  2Z8L A;  3K0X A;  2A6E D;  1A2U A;  4B3S L;  1ZXT A;  4ZRZ A;  3FKI B;  2DNE A;  1VQ5 A;  1WD1 A;  3F1Z A;  2RVL A;  2AQ1 B;  2KHI A;  4KN4 C;  4JI0 L;  2EE1 A;  2SOB A;  1FD7 D;  3CC4 A;  3ER0 A;  1DJR D;  4GKK Q;  2ZM6 L;  1C8C A;  1E1O A;  3JAM L;  2QEJ C;  1HFG A;  2D0O A;  4GKJ Q;  1H9R A;  3CRK C;  5FO7 B;  1VQP A;  1FNW A;  3OIP A;  4KI0 A;  1L0W A;  1K3R A;  2AUJ D;  3ERS X;  2R93 B;  1IBM Q;  1P8L A;  1HZ9 A;  3RZD B;  1RDP D;  3L7Z C;  2XTI A;  1N32 L;  1G2T A;  4OGQ C;  1HCZ A;  1X3G A;  2PI2 A;  3MXN A;  2QDL A;  3GTJ H;  4NXN L;  2NVY B;  3NTH A;  1Q8K A;  1Z47 A;  4RWS C;  1X3E A;  3PUY A;  1SE3 A;  4G7Z C;  1VQM A;  4L5S A;  2ENB A;  3RLO A;  1TWH H;  1C7Y A;  1SYD A;  1LLR D;  4X64 Q;  4CDF C;  3MEH A;  3UI2 A;  3I3C A;  3CME A;  1L0X B;  2NTS A;  1SMX A;  2E2H B;  3M7G A;  4DV7 Q;  3GD7 A;  1I3Q H;  1JC7 A;  4B3M L;  4LF6 Q;  4DV0 Q;  4BA1 I;  3ULJ A;  4RA8 A;  5IT9 E;  1STB A;  3J81 j;  1YNN C;  4KV6 A;  5E1F A;  1YHQ A;  1G29 1;  1STA A;  2VQF L;  4DAY B;  1SND A;  5E4W C;  4P71 A;  1HA6 A;  2FMM A;  3AEV A;  1VMP A;  3SR1 A;  3TDQ A;  2MFI A;  3RR5 A;  4DR5 Q;  3J7Y W;  3OW7 A;  4FXK C;  2F3I A;  2E75 C;  5JEA H;  2KCN A;  1BQQ T;  3SK6 A;  2JA5 G;  5M5Y B;  2B8G A;  4A3M H;  3QOJ A;  1I4P A;  3KF6 A;  4IOC A;  3CMA A;  4I7Z C;  3PUZ A;  2BH8 A;  2DJF C;  5J1Z A;  1U9R A;  3T4A C;  4FXD A;  2TMP A;  4X64 L;  1JOO A;  1VQO A;  4B08 A;  1FGB D;  3DWP A;  1XXG A;  3I8Z A;  3K57 A;  4IPC A;  2V4D A;  1VQ4 A;  2JA9 A;  3K59 A;  3NBH B;  2QEX A;  1GUG A;  1PH4 A;  4F88 A;  3ERQ A;  5JVH 3;  4QY7 A;  4XQQ A;  2HDL A;  4GN3 B;  2NN6 H;  1A62 A;  1K9M C;  3A74 A;  2K33 A;  4HIM A;  2B2V A;  4YCU A;  3QG1 A;  3CCL A;  5M5X B;  3SGI A;  1KAW A;  3GQB A;  4NB3 A;  3LWU A;  2K5N A;  1K8A C;  4DV4 Q;  5EKI A;  3H0G H;  3KF6 B;  4DV4 L;  1HRJ A;  5EQ0 A;  3K5M A;  3I4L A;  2BCO A;  5ELN A;  2OQK A;  4LFB Q;  4BY1 H;  4IFD G;  4OEM B;  2PQA A;  4R4Q A;  4HIK A;  2NB0 A;  1C48 A;  5C44 B;  1AW7 A;  3I4M B;  1H9K A;  2DJG C;  1I4X A;  3ERO A;  2L12 A;  4X66 L;  3GTM B;  1IL8 A;  2VQF Q;  3PSI A;  2D2C C;  3OIQ A;  1WCM B;  1U4L A;  3OMC A;  4POG A;  2R7D A;  3MA2 B;  5IYD G;  2BOS A;  1N33 L;  1RIP A;  4DK6 C;  1C9O A;  1IYJ B;  4A3G H;  2WKC A;  4V0B A;  4DR3 L;  3C2P A;  3HOW H;  5L37 A;  2Z6K C;  2Z6K A;  1NE3 A;  4K0K L;  3S1Q H;  1MBY A;  2F0I A;  2H1E A;  3BG3 A;  3UDF A;  2UUB L;  5ELE A;  3S1R H;  2IWH A;  4A93 G;  3CQZ B;  3ITP A;  1D5Z C;  1K83 B;  5HGQ A;  4RAU C;  4GOP C;  5KEE A;  3GTJ B;  4G7O C;  1RD9 D;  3SK5 A;  1KIX A;  2VW9 A;  3KOJ A;  3K5O A;  4A3J H;  1Y1V H;  1TVX A;  1S40 A;  4K14 A;  5C4X B;  3CPF A;  1BXT A;  1E2Z A;  3TN2 A;  1PV4 A;  3SDZ A;  3R93 A;  4HJ5 A;  1TWC B;  2E2H H;  2B29 A;  1O7L A;  4JI3 Q;  1I3Q B;  1Q12 A;  1X65 A;  1EY7 A;  1ZYR D;  3A8J E;  5IIF A;  1GJX A;  3J81 L;  4LF5 Q;  4QUF A;  4LNQ A;  2YU9 H;  2B2T A;  2Z1C A;  4J15 A;  4JC0 A;  2A69 C;  2NVY H;  1PHJ A;  3PIP 3;  2C9O A;  4NMZ A;  3CC7 A;  2EJM A;  3I4O A;  5M3F B;  4BXX H;  2DY8 A;  2JQO A;  2K4K A;  3VR3 A;  3PF5 A;  3HOY B;  1AFP A;  3KLW A;  3E5S A;  2H4O A;  5BR8 Q;  1HUN A;  5DEH A;  3I70 A;  2JA6 H;  1A0I A;  5EPL A;  1V1Q A;  4QQB X;  2QF7 A;  1GKH A;  2F0H A;  1AE3 A;  3S17 B;  1K0R A;  1M4V A;  5JPN C;  2YTV A;  2NN6 G;  5C3E G;  1GO3 E;  4DV2 L;  4PMC A;  3PQI A;  3K7A H;  1UEB A;  5D14 A;  4KJO A;  3QOL A;  2Y0S G;  3J81 i;  3I55 A;  1K73 C;  3FEW X;  1YHB A;  1XNQ L;  2IPK D;  1STH A;  1EZ6 A;  4YHH Q;  1ENC A;  1JWU D;  2ASB A;  1MJC A;  1VQH A;  1N34 Q;  5NUC A;  3BZD B;  3TP8 A;  4RKL A;  4DR6 L;  2VUM G;  4HIO A;  3P75 A;  1PA6 A;  5KGU A;  3VR5 A;  3FPU B;  3FKI H;  2K14 A;  3KK7 A;  2K5W A;  1NR4 A;  2EJF C;  2AMC B;  3DWA A;  4HSP A;  2F0M A;  5I4D A;  4K2K A;  4A3D G;  1CA5 A;  1S5C D;  4UDU C;  4DK1 A;  3CC2 A;  4PMW A;  2NN6 I;  4QIW B;  2ZTD A;  1UEA B;  1EY6 A;  3VA7 A;  2A68 D;  1LAB A;  2NUC A;  3PUW A;  5IYC G;  1W3S A;  4RHS A;  4B3S Q;  2MO1 A;  4ZCK A;  1Q1B A;  2L15 A;  1SYG A;  2F3V A;  2XNA C;  1I94 L;  5C0X G;  4UY8 C;  1IKL A;  4HJA A;  2EVB A;  3FHW A;  3S2D B;  2N78 A;  2RKS A;  1OXS C;  3N52 A;  2HUG A;  3MTS A;  4MZ9 A;  5M3F G;  4EQO A;  1PRT D;  4R8N A;  2F3W A;  4IPD A;  2F0Q A;  1PFN A;  3KJO A;  5FK9 C;  3HOY G;  2K6A A;  1I4H A;  3S16 B;  1G6Z A;  1WOC A;  1EFI D;  1Y8O B;  5C3X A;  1EEF D;  2NYZ D;  3EFX D;  1HA5 A;  5IP7 G;  4I65 A;  2OTL A;  4YY3 L;  3WDN A;  4KJN A;  4NW2 A;  5IT9 c;  4ILW A;  3OWF A;  1WTQ A;  4X6A H;  1Y8N B;  1LT4 D;  1YIJ A;  1Y14 B;  1YJN A;  2QA4 A;  1K8G A;  1X3Q A;  3U9O A;  1PRT F;  1VQL A;  4DR7 Q;  4AH6 A;  4JI4 Q;  1MIU A;  3SK4 A;  3FMC A;  3VR2 A;  2JE6 I;  1DCZ A;  3BYY B;  2IX3 A;  2A5H A;  1TS4 A;  2EZV A;  1PH8 A;  1EFW A;  5FLX E;  1U4R A;  4C3H H;  3S24 A;  3HG9 A;  3DLL A;  3O13 A;  1BCP F;  1L0Y B;  1KNA A;  4BS9 A;  2WB1 E;  4O2D A;  2M00 A;  2A19 A;  2RSN A;  2MNA A;  1SN8 A;  2F0D A;  3EN2 A;  1WFQ A;  1BCP D;  2OXP A;  4GNX A;  4GNX C;  3GTO B;  3CKI B;  4XQJ A;  2MGS A;  1O7Y A;  1VQF A;  1MD2 D;  4TVA B;  5T1G A;  3CAM A;  2IX0 A;  1SRO A;  1B8A A;  3PF4 A;  5JJI A;  4XIG S;  4AYB B;  1BCP C;  4FO2 A;  1VQ8 A;  4UAI A;  5A2Q E;  3F8T A;  1XWE A;  4FNF A;  1S5B D;  3TEH B;  4UP9 A;  1D1K A;  1QVG A;  1PYB A;  3J81 E;  1VF7 A;  1CM9 A;  1HZC A;  4X3T A;  2YTY A;  1IL2 A;  3DM3 A;  5GAD C;  1RKN A;  1DOM A;  2I5H A;  2WAC A;  4A3K G;  1GUW A;  3UDX A;  2L55 A;  2LXJ A;  2WB1 B;  4WJ4 A;  2A1A A;  3STB D;  4DV1 L;  1NY4 A;  3GV6 A;  4OX9 Q;  1FVI A;  1TY0 A;  3OWE B;  5DAU A;  5COY A;  3MXG A;  3NP8 A;  1I4R A;  3KF8 A;  4A3J B;  5ELC A;  4LUZ A;  4BBR G;  1NSN S;  1Z6H A;  2R6G A;  2F0S A;  2OF1 A;  2EXZ A;  1PFB A;  4N9T A;  2L4N A;  5IGD A;  1TWC H;  3LGJ A;  3BS1 A;  4HTH A;  2UXC Q;  1KTK A;  3TRE A;  3KUP A;  5LL6 X;  2PI2 E;  1ESF A;  3EIV A;  4A3B B;  3BZC A;  5FLM G;  3JAM c;  1TU2 B;  4RGN A;  5DM6 3;  4RHR A;  4EX5 A;  5KNB A;  3J81 c;  3NBI A;  2I5M X;  4BBS G;  5LMN W;  1EYC A;  4YIJ A;  5JPM C;  4A3G G;  3R8B A;  5FJ8 H;  3HKZ E;  2A68 C;  2ZM6 Q;  1PMR A;  2IHE A;  2RDF A;  2L11 A;  3BU2 A;  3L9A X;  1KRT A;  5DNF A;  5M5X H;  3Q24 A;  3H3V I;  1HZA A;  4DV6 L;  1DYQ A;  4K5W A;  1BKB A;  3HOY H;  1EYG A;  1EIH A;  1VQD A;  1F2M A;  4JG2 A;  1SRU A;  2EY5 A;  1BBW A;  4PQX A;  4LW1 A;  3I7F A;  3X3M A;  3F2D A;  3S1N H;  1B3Q A;  1BVS A;  3KDF B;  4JW0 A;  1EYA A;  4G57 A;  1ET6 A;  2PMZ B;  3M4P A;  4E6I A;  4B9X A;  2BDN A;  4IJL A;  3VYU A;  4LF9 Q;  4C3J G;  4H02 A;  5CV6 A;  4DR7 L;  1GOZ A;  1UUP A;  1M8A A;  2K5D A;  4PV1 C;  3Q23 A;  2L0C A;  3NWS A;  2F0F A;  1DOK A;  1SYE A;  1MSG A;  5A35 A;  4RGT A;  2Q2I A;  3G71 A;  1LT6 D;  4LAA A;  3K0Y A;  3I90 A;  3NEN A;  2E2D C;  1X3P A;  4HJ8 A;  5T1I A;  3EA6 A;  2UXB L;  2DUD A;  2NVT H;  1ICW A;  1IKM A;  1V1O A;  3HKZ B;  2UXB Q;  1VQ6 A;  3STB C;  4JPB W;  4CJ0 B;  1JJG A;  4O1N A;  1LO5 D;  2R7Z B;  1PFM A;  4GZY C;  4JYA L;  4F7X A;  1KLG D;  3KLR A;  1VQG A;  1SE2 A;  1E22 A;  4A3L H;  4CDE C;  2Q2T A;  1SNO A;  5AJ3 Q;  4Q0F A;  4DXG A;  2CWP A;  1S4Z A;  5GAE C;  2ZJQ A;  2UXD L;  1Y1W G;  3F2B A;  1SBB B;  3OTO Q;  3CU7 A;  4A93 B;  1DGS A;  3J7A 5;  4GKJ L;  1J8I A;  5HY6 A;  1D6E C;  3LWE A;  2OTJ A;  4Y7N B;  3B6Y A;  1SNM A;  4DUY Q;  2NZ1 D;  4DUY L;  3S16 H;  3R2T A;  2KJX A;  4TSS A;  4FF1 A;  3HOZ B;  2PW7 A;  2NVQ B;  1EUJ A;  2ZXP A;  3G7L A;  3NBH A;  1JJ2 A;  1QNK A;  2WKD A;  4JI6 L;  2N55 A;  3S1M B;  2RCF A;  4H7B A;  2NVT B;  4HR7 B;  3J80 i;  3A7A B;  2Z6B A;  1HQR D;  3A0J A;  3NQI A;  5DM7 3;  3GTK B;  1H9S A;  4R9W A;  1B9M A;  1BO0 A;  2WIN B;  3HZX A;  4EQ5 A;  5CBA E;  2ZJR A;  1N36 Q;  4BA2 I;  3DWQ A;  2KVM A;  1EOV A;  2AQ2 B;  3S9W A;  1CZW A;  3K7A B;  2B63 G;  3NHH A;  1V8Q A;  3QJY A;  3U9S A;  2OWO A;  2WAQ G;  2B2W C;  2R3Z A;  1PZJ D;  1CQF A;  1TR5 A;  4ZUI A;  4JI2 L;  2JA6 B;  5CGK A;  2B39 A;  1ML0 D;  2L9H A;  3TME A;  1GXD C;  5M5W B;  4LF8 L;  1X56 A;  1PRT C;  1VS0 A;  2KEC A;  3I4N G;  1CQV A;  4GLA C;  5FOB B;  4KY7 A;  3H3V C;  1EIF A;  1NNX A;  3V2T A;  1CTM A;  3G48 A;  1D8L A;  1UE5 A;  1VQC A;  2K32 A;  1HNW L;  5EJW A;  3BDL A;  4B3M Q;  4LF6 L;  1NAP A;  1HH2 P;  1WTO A;  1SE8 A;  3QIA A;  1BF4 A;  1STN A;  1HNX L;  3I91 A;  4YCW A;  3S14 H;  5IP9 G;  4MTK A;  1G6P A;  4KKT A;  1VQB A;  2QCP X;  3S2D H;  3D4R A;  4QF4 A;  4LF8 Q;  1NTG A;  1EY4 A;  5C44 H;  1SJH D;  4RCO A;  2BA0 A;  2RDH A;  3RLF A;  2FIN B;  3GTM H;  3H6M A;  1ENF A;  3UDG A;  3VDY A;  2IL8 A;  2Q2U A;  2R92 H;  3M4O B;  2KCC A;  2SNM A;  2QGQ A;  1TXY A;  3MXN B;  3PV0 A;  1F77 A;  4O42 A;  2AHO B;  1KC8 C;  3KFU A;  1LV9 A;  2F0W A;  5EKK A;  5KYI A;  4K6L A;  2RBM A;  4LFA L;  1XTC D;  3MVV A;  3SEB A;  5GAH C;  4XQN A;  5CV5 A;  1D7Q A;  1VDZ A;  4OIJ A;  4KHV A;  1GHJ A;  4LUO A;  2F0P A;  4RKB A;  2B2V C;  1IXR A;  2R92 G;  4LJZ C;  3DEO A;  1XJV A;  3GTP B;  4APV A;  3W1B A;  1DZ1 A;  2M2L A;  3CP0 A;  2UUA L;  3D3R A;  1JOQ A;  5M3M B;  5H1S E;  4IFD J;  1GUO A;  4IZ8 A;  3BVG A;  5C0X I;  3KJP A;  1PH3 A;  3QR8 A;  3FRP B;  3IL8 A;  1B2T A;  1A3T A;  3DHQ A;  4F87 A;  3M85 A;  3GTG H;  3IFT A;  2FHT A;  4P73 A;  3D6W A;  4CDD C;  1NMF A;  1A3V A;  2A69 D;  1FGU A;  1H9J A;  3W3A A;  1PH1 A;  2GVA A;  1GUS A;  2HHH L;  3CPW A;  5CMD A;  4WOR A;  1ZYR C;  4RGO S;  5D3D A;  5IYB H;  2KCT A;  1NUC A;  4A3K H;  4OON A;  3UE0 A;  3M4O H;  3QWN A;  1F9R A;  1GUT A;  3D8G A;  3K81 C;  4DNT B;  4JI5 L;  3A5U A;  4DV0 L;  2ICI A;  4LF5 L;  1YNN D;  2RSO A;  2UXD Q;  1Y8P B;  3N6R A;  3QB3 A;  4L5Q A;  4DK0 A;  5FLX L;  4ZAI A;  3A7L A;  3DUZ A;  3CCS A;  1K28 A;  3U58 A; 
#chains in the Genus database with same CATH homology
 1XNQ L;  4A3L G;  4P72 A;  1JMC A;  4HJ7 A;  3KYH C;  2N49 A;  1UE7 A;  4YHH Q;  3AFP A;  4LFA Q;  2ASB A;  1MJC A;  4IPG A;  1VQH A;  1VQI A;  2EIF A;  4JI4 L;  1N34 Q;  4QJF A;  2ES2 A;  4ALP A;  4GLV B;  5DLQ E;  4DR6 L;  2B3G A;  2PNH A;  2I0Q A;  5IP7 H;  4UP8 A;  2Q2H A;  3OW2 A;  2DGY A;  4HIO A;  1FJG Q;  2HIX A;  1Y1V G;  3NEM A;  1PA6 A;  4DR2 L;  1U5K A;  4TQU S;  1FJG L;  3FKI H;  2K14 A;  2BA1 A;  2AMC B;  4R4C A;  4AIM A;  3UDI A;  4A3D G;  1HNZ L;  3HOX H;  5J3B A;  1HNZ Q;  2R7Z H;  4OWT B;  4C3J H;  2R7F A;  3CC2 A;  4PMW A;  1VQA A;  2CKZ B;  2NN6 I;  2ZTD A;  3I4M G;  1H95 A;  1L1O B;  2E2I H;  1XMO L;  4LF7 Q;  3PUW A;  5IYC G;  1W3S A;  3PUV A;  4B3S Q;  2MO1 A;  4JI1 L;  1Q1B A;  2L15 A;  2OQ0 A;  4GOP B;  1WCM G;  2HQL A;  1I94 L;  4JBM A;  1EQR A;  5C0X G;  3T1Y Q;  1IBM L;  3CD6 A;  3T1Y L;  3GTK H;  4UY8 C;  4HJA A;  1BBU A;  1CKM A;  4LFC Q;  5C3E H;  3L2P A;  4JOI C;  3FHW A;  1K83 H;  4JOI A;  2EQS A;  2N78 A;  2AWO A;  1OXS C;  2CWA A;  4ME3 A;  4P74 A;  1I6H H;  1OXV A;  5M3F G;  4MZ9 A;  4MTN A;  5JJK A;  5GRO A;  4QGU A;  3KJO A;  2K5H A;  4IPD A;  1YZ6 A;  4YWL A;  4A3B G;  2CFM A;  3HOY G;  1MJE A;  4IJH A;  5IYC H;  3CCU A;  4JI5 Q;  1SLJ A;  1WOC A;  1PH7 A;  1KD1 C;  1N33 Q;  1TWG H;  2E8G A;  4R4O A;  1G51 A;  1N9W A;  2K5V A;  1V9P A;  3AYH B;  4L5T A;  1W2B A;  5IP7 G;  2OTL A;  4YY3 L;  2I5L X;  4DV3 Q;  1IZ6 A;  1TWF H;  2JA8 G;  3FKI G;  3OYY A;  1KQS A;  1M1K C;  5IT9 c;  5C4J H;  5GAG C;  4X6A H;  1LM0 A;  1CKO A;  1MKH A;  4UP7 A;  1YIJ A;  1RL2 A;  1Y14 B;  2D0P A;  2K50 A;  3E0E A;  4C2M H;  1X6O A;  2QA4 A;  4IO9 A;  1YJN A;  1K8G A;  2BH2 A;  4JV5 Q;  1QZG A;  1VQL A;  4DR7 Q;  2AKW B;  2HIV A;  3W1G A;  3WWV A;  4A4I A;  4AH6 A;  3J80 c;  4JI4 Q;  2A8V A;  2HT1 A;  4BY7 H;  1MIU A;  1HNX Q;  1L1O A;  2F4V Q;  4DR4 Q;  4YHH L;  4OO1 I;  2JE6 I;  4LF9 L;  3CQZ H;  5AJ3 L;  2CQO A;  2EXD A;  1HJP A;  1VQN A;  5C0X J;  4A3I H;  4YWM A;  1PH8 A;  5C4X G;  3AQQ A;  1YIT A;  3ZJY C;  2E2J H;  1EFW A;  3S15 H;  3BZK A;  3PCO B;  3OTO L;  1HR0 W;  4C3H H;  2IHF A;  3S24 A;  3PO2 H;  4KHP L;  1EQQ A;  2PMZ E;  3G6E A;  3DLL A;  2RCN A;  1E3P A;  4JI8 Q;  1YJW A;  2C35 B;  2PQA B;  2WB1 E;  3U50 C;  5FJ8 G;  4DV2 Q;  4O2D A;  1N8R C;  5E7N A;  4BBS H;  5M3F H;  1JE5 A;  1ASZ A;  1L2F A;  2A19 A;  2RF4 A;  4JI1 Q;  4AYB E;  2MNA A;  1SN8 A;  3EN2 A;  1WFQ A;  1NJI C;  5C4X H;  1HZB A;  3IRB A;  5FLM H;  3KDF A;  4A3I G;  1B7Y B;  5M3M G;  1SFO H;  4JBJ A;  3HOX G;  4JYA Q;  4GNX A;  4XTC S;  2CCZ A;  5K36 G;  4GNX C;  3U4V A;  3M7N A;  1Q7Y C;  3PO2 G;  4DAM A;  2GVB A;  2YYZ A;  2KBN A;  1VQF A;  3L0O A;  1HNW Q;  4TVA B;  3CAM A;  2IX0 A;  1WJJ A;  1SRO A;  1B8A A;  3M9B A;  5LMU Q;  3M3Y H;  4DR1 L;  4A3C H;  1XNR L;  3PF4 A;  5JJI A;  4XIG S;  2E5L Q;  3I56 A;  3MEF A;  3CCE A;  4A75 A;  1YJ9 A;  1IBL L;  2R93 H;  4A3E H;  1N34 L;  1VQ8 A;  3F8T A;  3JAM i;  4OWX B;  4JI3 L;  3TEH B;  4UP9 A;  4NXM L;  2WP8 J;  2LXK A;  5GQO A;  1QVG A;  4BXX G;  2N3S A;  1PYB A;  5ELO A;  4X65 L;  2YTX A;  3PO3 H;  2RHS B;  1Q46 A;  3HKS A;  1C0A A;  1HZC A;  2IX1 A;  2YTY A;  3RN5 A;  4AQY Q;  3T1H Q;  4A3M G;  4LF6 Q;  3T1H L;  4A3B H;  1YHA A;  1IL2 A;  3DM3 A;  5GAD C;  4A3E G;  4LWC A;  3K0X A;  1KRS A;  4B3S L;  2I5H A;  4A3K G;  4A93 H;  4WJ3 M;  3UDX A;  2H5X A;  1GD7 A;  1VQ5 A;  2LXJ A;  4WJ4 A;  1CKN B;  2A1A A;  3F1Z A;  3STB D;  4DV1 L;  1NY4 A;  4R4T A;  2UUC Q;  4OX9 Q;  3M4Q A;  1NBW A;  2R7Z G;  1FVI A;  2KHI A;  1E24 A;  2VUM G;  4JI0 L;  1CUK A;  3CCQ A;  1QVF A;  3HOZ G;  3CC4 A;  3GTQ H;  3D0F A;  3ER0 A;  2ZJP A;  4IFD I;  4DUZ Q;  4GKK Q;  3HOU H;  3CW2 C;  2ZM6 L;  4LUZ A;  4BBR G;  2UUB Q;  2JA7 H;  1VQ7 A;  4AQY L;  1E1O A;  3EBE A;  2R6G A;  2GN5 A;  2D0O A;  1XPR A;  3GDE A;  3Q8D A;  3J7Z C;  3CCV A;  4GKJ Q;  1XNQ Q;  1PFS A;  1VQP A;  2JK8 A;  5IP9 H;  1TWC H;  3LGJ A;  4KI0 A;  1L0W A;  1K3R A;  4B3T Q;  2UXC Q;  4Y7N H;  4GN5 A;  3ERS X;  2KCM A;  3TRE A;  1IBM Q;  1P8L A;  4DV7 L;  2LSS A;  2PI2 E;  3EIV A;  1HZ9 A;  5C44 G;  1UWV A;  3BZC A;  2UXC L;  1L1O C;  4PZ6 A;  5FLM G;  3RZD H;  3JAM c;  3L7Z C;  2VS1 A;  1YVC A;  2XTI A;  1N32 L;  4EX5 A;  1PH6 A;  3J81 c;  1Q86 C;  2I5M X;  4BBS G;  5LMN W;  1PH5 A;  1X3G A;  1GM5 A;  2PI2 A;  4NXM Q;  2NVQ H;  1T9H A;  3GTJ H;  4IOA A;  2F4V L;  4DR4 L;  4NXN L;  3ULL A;  5FJ8 H;  3HKZ E;  4POF A;  4A3G G;  3FP9 A;  1Q8K A;  3K80 C;  1GVP A;  4PZ7 A;  2ZM6 Q;  1Z47 A;  1OXX K;  2IHE A;  1CSQ A;  1SR3 A;  1X3E A;  3BU2 A;  1KRT A;  3PUY A;  2Y0S E;  5M5X H;  1QUQ B;  1VQM A;  1VQ9 A;  4L5S A;  3H3V I;  1HZA A;  4DV6 L;  4OO1 G;  3CF5 A;  1S72 A;  1BKB A;  3PGZ A;  1TWH H;  3RLO A;  3HOY H;  1EYG A;  1C7Y A;  2JA6 G;  2AWN A;  1VQD A;  4JG2 A;  1SRU A;  2VNU D;  1BBW A;  4X64 Q;  4LW1 A;  3I7F A;  1LYL A;  3HOU G;  1WYD A;  4LF4 Q;  3F2D A;  3S1N H;  1HR0 Q;  4YCV A;  3KDF B;  1BVS A;  4FDB A;  2N8N A;  2VZA A;  3M4P A;  3H0G G;  3CME A;  1SMX A;  4LFB L;  4IJL A;  4LF9 Q;  4LFC L;  3TRZ A;  1JJC B;  4DV7 Q;  4A3D H;  3E9I A;  3GD7 A;  4H02 A;  1I3Q H;  1LUZ A;  4DKA C;  4DR7 L;  4KHP Q;  1XMQ L;  3G4S A;  4DV5 Q;  4B3M L;  4DV0 Q;  2ZTC A;  4P75 A;  4BA1 I;  2VQE L;  4DR1 Q;  3ULJ A;  5FLX c;  4HJ9 A;  3J81 j;  3HOV H;  3PIP A;  1YHQ A;  2B63 H;  2Q2I A;  1G29 1;  3G71 A;  2OCE A;  1R9T H;  5IWA Q;  2VQF L;  4DAY B;  3NEN A;  4P71 A;  1I94 Q;  3W5O A;  4HJ8 A;  4JBK A;  4DV6 Q;  3AEV A;  2UXB L;  2DUD A;  2NVT H;  3JC6 6;  3F2C A;  4LF7 L;  4NPS A;  3RNU A;  1IBK Q;  4B3R Q;  5IE8 A;  3CCJ A;  2JEB I;  1VQ6 A;  3STB C;  2UXB Q;  1X55 A;  1YNX A;  2MFI A;  3RR5 A;  4DR5 Q;  1JJG A;  1KHI A;  4GS3 A;  4LF6 L;  2F3I A;  4JYA L;  2IY5 B;  1LTL A;  1VQG A;  1JT8 A;  4DR2 Q;  1E22 A;  4A3L H;  2VQE Q;  5IYD H;  2JA5 G;  2Q2T A;  4DV5 L;  2V1C C;  5AJ3 Q;  2JA8 H;  1U0L A;  1J5E L;  2CWP A;  4A3M H;  1I5F A;  3KF6 A;  5GAE C;  4JI8 L;  3KF8 B;  4IOC A;  1J5E Q;  2ZJQ A;  2UXD L;  1Y1W G;  3F2B A;  3CMA A;  3OTO Q;  4GN4 B;  4RMF A;  3PUZ A;  2BH8 A;  1DGS A;  3J7A 5;  4QIW E;  2NZO A;  3AFQ A;  3GO5 A;  1YEZ A;  4GKJ L;  5HY6 A;  4X64 L;  2OTJ A;  1V43 A;  4DR3 Q;  1VQO A;  1X9N A;  2JJQ A;  4DV3 L;  4X62 L;  2K75 A;  1UE1 A;  1A8V A;  3UE1 A;  3HOV G;  3B6Y A;  2JA5 H;  2WAQ E;  1VQ4 A;  4IPC A;  1IBK L;  1XNR Q;  2JA9 A;  4DUY Q;  3PO3 G;  3S16 H;  3NBH B;  4DUY L;  3HOZ H;  1VQJ A;  1HR0 L;  3I4M H;  2QEX A;  4A3J G;  4PG3 A;  1PH4 A;  1QUQ A;  4QY7 A;  4YWK A;  3CCR A;  1EUJ A;  4DK3 C;  4GN3 B;  1JJ2 A;  1TWA H;  4X66 Q;  1A62 A;  1K9M C;  1WCM H;  2UUC L;  3A74 A;  4LUV A;  4JI6 L;  4NXN Q;  3S1M H;  2WB1 G;  2KEN A;  4HIM A;  4YCU A;  1KL9 A;  3A5Z B;  3CCM A;  4B3R L;  2ID0 A;  2NZH A;  1J6Q A;  3CCL A;  4RG1 A;  3J80 i;  2MO0 A;  2WFW A;  5JEA G;  3SGI A;  2FXQ A;  1KAW A;  4A76 A;  1M90 C;  3A0J A;  1EWI A;  4NB3 A;  2R93 G;  1E1T A;  4DNI A;  1WI5 A;  2K5N A;  1K8A C;  3TS2 A;  4DV4 Q;  2RHQ B;  1YBY A;  4EQ5 A;  3H0G H;  2ZJR A;  3KF6 B;  4DV4 L;  1N36 Q;  4BA2 I;  2F52 A;  1I50 H;  1EOV A;  5ELN A;  1VQK A;  2OQK A;  3HFZ B;  4QL5 A;  4LFB Q;  1YI2 A;  4BY1 H;  4IPH A;  2B63 G;  1NMG A;  3GTL H;  4IFD G;  2ALY B;  2PQA A;  4R4Q A;  4HIK A;  3BJU A;  2OWO A;  3U4Z A;  2WAQ G;  3PUX A;  4DR6 Q;  2ZTE A;  4X66 L;  1OXT A;  1JB7 A;  1ASY A;  4JI2 Q;  5IWA L;  2VQF Q;  3PSI A;  4GLX A;  4JI2 L;  1XPO A;  4OWW B;  1AH9 A;  4GKK L;  1VCI A;  1X54 A;  4UPA A;  1UE6 A;  4POG A;  1QZH A;  2R7D A;  4MNO A;  3TQY A;  1Q1E A;  4LF8 L;  5IYD G;  2KHJ A;  5M5W H;  1X56 A;  1N33 L;  1VS0 A;  3I4N G;  5EAY A;  1RIP A;  4GLA C;  5IYB G;  4DK6 C;  1IYJ B;  1C9O A;  1EIF A;  4A3G H;  4DR3 L;  4A3F G;  4DV1 Q;  1VQE A;  1XTD A;  3HOW H;  3G48 A;  1N36 L;  4B3T L;  4L5R C;  5LMN Q;  1D8L A;  1UE5 A;  1AE2 A;  1VQC A;  3RN2 A;  1HNW L;  5JEA J;  2Z6K C;  5LMN L;  1CKN A;  3TS0 A;  1Y1W H;  2Z6K A;  1XMQ Q;  1HH2 P;  4B3M Q;  4LF4 L;  1SE8 A;  1NE3 A;  2MQH A;  3D31 A;  4K0K L;  3S1Q H;  3H15 A;  1HNX L;  1OTC A;  3RLN A;  3UDF A;  5BR8 L;  2HHH Q;  2UUB L;  3S1R H;  4YCW A;  4DUZ L;  3S14 H;  5IP9 G;  1P16 A;  1IBL Q;  1A63 A;  4A93 G;  1G6P A;  5HGQ A;  4GOP A;  1VQB A;  4GOP C;  1XMO Q;  4LF8 Q;  3S2D H;  3S2H H;  1NTG A;  4DPG A;  5C44 H;  1KIX A;  2BA0 A;  1X3F A;  1PYS B;  3RLF A;  2VW9 A;  3GTM H;  4YY3 Q;  3UDG A;  4KLK A;  4JBW A;  3KOJ A;  3VDY A;  4OXP A;  1PVO A;  2Q2U A;  1KXL A;  1EIY B;  2R92 H;  3E9H A;  4A3J H;  2QGQ A;  1Y1V H;  1S40 A;  1TXY A;  3MXN B;  3PV0 A;  4GNX B;  4C3I H;  5JJL A;  1CSP A;  2VUM H;  2AHO B;  2IT1 A;  3CPF A;  1KC8 C;  3KFU A;  4X62 Q;  4BBR H;  4LFA L;  4HID A;  4Y52 H;  3HKZ G;  1PV4 A;  3K8A A;  4O0A A;  2XGT A;  4R4I A;  2JA7 G;  3GTO H;  1E7Z A;  4KHZ A;  5GAH C;  1D7Q A;  4HJ5 A;  4LUO A;  3S17 H;  1N32 Q;  2E2H H;  3CXC A;  3H3V H;  2B29 A;  1Z9F A;  1IXR A;  2R92 G;  4JI3 Q;  3RZO H;  1OXU A;  1XJV A;  1PH9 A;  4APV A;  3W1B A;  1Q12 A;  1X65 A;  1S3O A;  3ULP A;  3GTP H;  2UU9 Q;  3CP0 A;  5M3M H;  1Q82 C;  2UUA L;  5IY0 A;  5H1S E;  1PH2 A;  4LF5 Q;  4IFD J;  1QVC A;  4LNQ A;  2D62 A;  5C0X I;  2YU9 H;  2Z0S A;  3KJP A;  2K52 A;  3I2Z A;  3PIO A;  1PH3 A;  4BY1 G;  4J15 A;  1Q81 C;  4JC0 A;  2VL6 A;  3M85 A;  2NVY H;  4AYB G;  1PHJ A;  3GTG H;  4DR5 L;  4JV5 L;  3CC7 A;  4P73 A;  3I4O A;  2E5L L;  1NMF A;  4BXX H;  4PZ8 A;  1FGU A;  2JQO A;  5M5Y H;  2K4K A;  4JI0 Q;  3PF5 A;  2YV5 A;  1PH1 A;  3HOW G;  2GVA A;  3KLW A;  4JI6 Q;  5BR8 Q;  2HHH L;  2JEA I;  3CPW A;  4A3F H;  4OX9 L;  3K7U C;  2ATW A;  1XPU A;  4BY7 G;  2JA6 H;  1A0I A;  4K0K Q;  1V1Q A;  5IYB H;  2KCT A;  1FL0 A;  3NEL A;  4QQB X;  4A3K H;  1GKH A;  4R1J A;  3I4N H;  4OON A;  3UE0 A;  4A3C G;  3M4O H;  1AE3 A;  3K81 C;  4DV0 L;  3A5U A;  1K0R A;  4LF5 L;  4JI5 L;  2YTV A;  2NN6 G;  5C3E G;  2VY3 A;  1GO3 E;  2UUA Q;  4JI7 Q;  2UXD Q;  4DV2 L;  2UU9 L;  1B70 B;  1O7I A;  3K7A H;  4JI7 L;  1UEB A;  4L5Q A;  4X65 Q;  2Y0S G;  4JCV E;  3J81 i;  3I55 A;  3CCS A;  1K73 C;  1YHB A;  2NVX H;  3ICE A;  3U58 A;  5LMU L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...