4LF6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6Q00
5IT9c 3BU2A 1LYLA 3CCJA 2OQ0A 4A76A 4JI6Q 2N3SA 4K0KQ 3CCRA 3KF8B 2WAQE 4GKJL 4AYBG 4X62Q 4L5SA 4LUZA 3J80c 2UUBL 3FP9A 5IYBH 1Q86C 5IWAQ 2VQFQ 4LF6Q 4DR7Q 2BA0A 5IP7H 1HH2P 1SRUA 1UE1A 2B63G 4DV4Q 4XTCS 1VQ5A 4H02A 1VQKA 2UXDQ 4LF4Q 1Q8KA 1Y1WH 3U4VA 3ULLA 3L7ZC 1VQIA 2QGQA 3H15A 4JI0L 1SLJA 1M1KC 1WJJA 2WFWA 2ATWA 4KHPL 3E9HA 1QZGA 3ULPA 2E2HH 5FLMG 5C4JH 3A5UA 1GKHA 4AQYL 1SROA 1XMOL 1PH4A 1NMFA 4O0AA 1PH6A 1RIPA 4OX9L 3I4OA 2I5HA 1Q1BA 4DK3C 5H1SE 5M3FH 4BBSG 2Z6KA 5HGQA 4JI8Q 2AWNA 1SE8A 2A8VA 2I5MX 4OONA 3H3VI 3J7ZC 4DV6L 2CWAA 4L5TA 4JI3L 1E7ZA 1E1TA 1WOCA 1YHBA 1C9OA 1MIUA 3SGIA 5M5WH 4ALPA 2ES2A 4X6AH 4B3TL 4BXXG 3VDYA 2ID0A 1KAWA 4FDBA 1XTDA 2A1AA 5C0XJ 1K8GA 4JBMA 2B63H 3S1MH 3HOZH 1E3PA 4NXNL 3K7AH 3CW2C 3PUVA 3PUZA 3S14H 3PO3G 3M9BA 3CQZH 2ZTEA 3K8AA 3T1HQ 1VQOA 2JA6G 3HOWG 1W2BA 4DR5L 3U58A 1V43A 1XMQQ 2UXBQ 4RG1A 4GN4B 3GTGH 1X56A 4KI0A 5FLMH 3G4SA 3GTPH 1N34L 3M7NA 4JV5Q 2JA5G 4LF5L 4JCVE 3CCUA 4LF6L 1PH1A 4DR1Q 1K73C 2AHOB 4JC0A 4JYAQ 2ZTDA 1A8VA 4DKAC 2E8GA 1VQDA 2UXCQ 4IPHA 2HIVA 5JEAG 4OWXB 1SMXA 2MO1A 4GLAC 3CPWA 1V9PA 3UDXA 1PH8A 2HT1A 1Z9FA 4P72A 2BH8A 2QEXA 3H0GH 1BKBA 3EIVA 2E5LL 4JI5L 5EAYA 4KHZA 5GAEC 2CQOA 4UPAA 1Z47A 4DK6C 1L2FA 1YHAA 3RLFA 4A3IH 1GM5A 4NXMQ 4B3RL 1EIFA 3F1ZA 3PO3H 1KQSA 1IBLL 1CSPA 3F2DA 4DV7Q 2JA6H 4X65Q 1EFWA 1JT8A 4B3ML 4JI1Q 5J3BA 4PZ7A 5LMNW 3CCLA 1VQEA 3RN2A 1IBKL 1UE5A 2D0OA 2ZJPA 2WAQG 1EYGA 1WYDA 1W3SA 4IOAA 2PMZE 2YV5A 4GKJQ 2JA5H 3CCEA 2B3GA 4GOPC 2UUBQ 3UE0A 1YZ6A 3A74A 2GVAA 3A0JA 5M3MG 3U50C 2D62A 4C2MH 4OWTB 1IZ6A 3OTOL 3CXCA 1VQMA 3ER0A 1OTCA 2GVBA 3IRBA 4QJFA 1QZHA 1PFSA 3T1HL 2NVTH 1KRSA 3JC66 3PV0A 4IPDA 1KC8C 2VUMG 4AH6A 4QY7A 4JI0Q 4ME3A 5JJIA 4GKKL 2Q2TA 1YNXA 4KHPQ 2UXBL 3CF5A 5IYDH 3S2DH 1IBML 1KIXA 1B8AA 5LMNL 1VQFA 4JI7L 4B3MQ 2IHFA 4DR6L 4AQYQ 4IFDI 3KOJA 1XMOQ 2Y0SE 1NE3A 2VL6A 4PZ6A 4DR2L 4OX9Q 1K83H 1A0IA 3K7UC 3H3VH 3E9IA 4HIDA 1TWAH 4A4IA 4HIOA 1KL9A 3CPFA 4P75A 2R7ZG 2I5LX 5AJ3L 1Y1VG 2DUDA 2CWPA 3S24A 3STBC 1YJ9A 4DV6Q 4A3KG 1R9TH 4JI3Q 3TRZA 1S3OA 1JB7A 5M3MH 1E24A 1L1OA 4NB3A 5C44G 5FJ8H 1JMCA 4B3TQ 4A3DG 3GTMH 2NVQH 1G6PA 5IY0A 4P74A 4NXNQ 3I56A 2AWOA 1S72A 2MFIA 4IJHA 3AFQA 4A3MG 1YJWA 1LUZA 2A19A 4DAMA 3E0EA 4DR5Q 1K3RA 2OQKA 4B3SL 2F4VL 3I4MG 2V1CC 4QQBX 5JJLA 3CMEA 3D0FA 1N34Q 3JAMi 3TS0A 1XJVA 1X3EA 3RLOA 1FJGQ 4LF5Q 2ZJRA 3STBD 1Q7YC 3TQYA 1D7QA 3KJOA 3NEMA 5JJKA 4A3GG 2JJQA 2LSSA 3G71A 3HOZG 4A3EG 1J6QA 1O7IA 3CCSA 2R7ZH 4IFDG 2NZHA 1IXRA 1OXSC 1Y1VH 1NMGA 3FKIG 1XNQL 1XPUA 5FLXc 4LWCA 1L1OB 3Q8DA 4A3KH 1CUKA 1VQ6A 4WJ3M 4X66L 4IO9A 5C44H 2E5LQ 1VQHA 1KHIA 4JI5Q 4A3DH 2JA8G 3KFUA 4YHHL 1VQNA 1I50H 4B3RQ 2ALYB 3TREA 3ICEA 2CCZA 1JJGA 3HOUG 2JEBI 1IBLQ 4A3MH 2VZAA 1CKNA 1VQLA 5BR8L 1PHJA 3I4MH 4JBWA 3L2PA 1UWVA 1IBKQ 4JG2A 3RZDH 3M4QA 1GVPA 4HJ8A 3T1YL 5GQOA 1X55A 2RCNA 1N33L 3CP0A 3H0GG 3J81j 4OO1I 2K14A 4UY8C 1MJCA 4MNOA 4R4OA 3OTOQ 2UUCL 4LF7L 4A3EH 1UE7A 4A3IG 3PGZA 1HZBA 2MO0A 1AH9A 2Z6KC 3FKIH 1PH7A 4EQ5A 1G51A 2KCMA 3PO2G 2F3IA 4GN3B 3S15H 1HNXL 3M3YH 4GKKQ 2AKWB 1J5EL 3MXNB 2K5NA 2R7FA 3ZJYC 1IBMQ 5LMNQ 4JI7Q 1FVIA 2Y0SG 2JA8H 4DR6Q 4YWKA 4DR2Q 2NVXH 1FJGL 1K8AC 3HOUH 1CKNB 2VW9A 2VQEL 1X3GA 2H5XA 2JEAI 3CCVA 3GO5A 4QGUA 1I3QH 4LUOA 4HIMA 1TWHH 2Q2HA 3M85A 1GO3E 1VQGA 4DNIA 3J7A5 1E22A 4KLKA 5AJ3Q 2K52A 1M90C 5JEAJ 3HFZB 4A75A 1NJIC 3I7FA 2YU9H 2IHEA 2JQOA 3TEHB 5IYDG 4YCWA 1Y14B 2D0PA 4LUVA 4Y52H 1QVFA 2BA1A 4JI2Q 2LXKA 4A3CH 3NELA 3PF4A 4JOIA 3PO2H 3M4PA 2DGYA 4EX5A 4HJAA 1PV4A 1PYSB 4B3SQ 2AMCB 1XPRA 1D8LA 2F4VQ 4OO1G 4A3LG 4BY7G 2R7DA 1OXVA 1Q12A 4A93G 4GLVB 2VY3A 2XTIA 3K80C 1P8LA 1HZAA 4R4CA 4DUZL 1S40A 2VS1A 3GTOH 1OXTA 3I55A 2LXJA 3DLLA 4L5RC 1PVOA 2C35B 4DV2L 1OXXK 3K81C 5FJ8G 3W1GA 4BY1G 1VQ7A 2KENA 1HJPA 4POFA 4PZ8A 3WWVA 1XNQQ 1BBUA 4DUYL 2N8NA 1MJEA 4L5QA 4X66Q 4HJ9A 2NN6I 4HIKA 5HY6A 1HZCA 1DGSA 3G48A 4YHHQ 3W1BA 4DV1L 1HNWL 1A63A 2CKZB 2YYZA 3J80i 2WP8J 1SFOH 4BA1I 2R93G 1K0RA 2ASBA 2EQSA 3EN2A 3W5OA 3F8TA 3G6EA 5BR8Q 4A3JG 1HNZL 4BY7H 4A3LH 2CFMA 5C3EG 4IJLA 3UDGA 3BZCA 1VQ4A 4A93H 2WB1E 1T9HA 3T1YQ 1VQPA 1HR0L 4DR3L 2VNUD 1VQBA 4BBRG 1JJ2A 1N33Q 3RR5A 1NBWA 2UUCQ 2OWOA 4BY1H 4LF7Q 4LF9Q 1N32L 3B6YA 1Q81C 4JI2L 1JE5A 1N36L 1I5FA 1KRTA 1K9MC 4NPSA 4HJ7A 2RHQB 4YCUA 2RF4A 3RZOH 2OTJA 3KYHC 4O2DA 1HNXQ 3L0OA 2UU9L 4GNXA 1EQQA 1J5EQ 4C3HH 1AE3A 1Q46A 4JBJA 1L1OC 1H95A 2R93H 1QVGA 1JJCB 5K36G 4DAYB 4DV0Q 1XPOA 2VQEQ 4POGA 2NVYH 1EOVA 2HHHL 4A3JH 1G291 1YI2A 1SR3A 5C3EH 3CCQA 1VCIA 1XNRL 3AFPA 4J15A 2HIXA 4BBRH 4WJ4A 2JA9A 4P71A 1N8RC 1VQAA 3GDEA 3UDFA 5C0XI 1YITA 4LF8L 4IFDJ 5ELNA 3I4NG 3M4OH 1P16A 4C3JH 1ASYA 1AE2A 1Q1EA 2R92G 4YWMA 1YIJA 2E2IH 1TXYA 3PSIA 3RNUA 2JA7G 4JI4Q 3TS2A 1NY4A 2JE6I 2ZM6L 2EXDA 1PYBA 2IX0A 2ZJQA 4GNXB 3ULJA 4OWWB 2ZTCA 4DV3L 2HQLA 3HKZE 5E7NA 5LMUL 4GLXA 1C0AA 3CMAA 1X9NA 2YTYA 1CKOA 1MKHA 4HJ5A 4TQUS 3CC4A 4OXPA 4DUZQ 2KCTA 5C4XG 3S1NH 2I0QA 5GADC 4DV2Q 2Q2UA 4YCVA 1X65A 1EWIA 3KJPA 4LF9L 1WI5A 4X64L 4PG3A 1GD7A 1TWCH 1BBWA 5GAHC 3J81i 1PA6A 4LFAL 1FL0A 4IPGA 3S16H 2K4KA 5IP9G 4A3CG 1QVCA 1A62A 2Q2IA 1YJNA 4DUYQ 4R4TA 4LFBQ 3I4NH 2UUAL 4DR4L 1CSQA 2KHIA 2BH2A 2R92H 1PH5A 3KDFA 1LM0A 4YY3L 5M5XH 1HNWQ 2JA7H 4DV1Q 1X3FA 4DV5L 2E2JH 4A3BG 1OXUA 3MEFA 3JAMc 4DV0L 3HOYG 5C0XG 4DPGA 3GTQH 1VQCA 1NTGA 1CKMA 1HNZQ 4QIWE 1C7YA 2WB1G 3FHWA 4Y7NH 3F2CA 4UP9A 3BJUA 1YHQA 1I94L 1HR0Q 4DR3Q 3CC2A 3S17H 4YWLA 3GTJH 3S1RH 2IY5B 3A5ZB 5C4XH 3DM3A 2RHSB 2OCEA 3AYHB 3D31A 4PMWA 4JI6L 3HOVG 4UP8A 1I6HH 4K0KL 5GROA 1N32Q 3CD6A 3GTLH 4JI4L 5IP9H 4X62L 1N36Q 4GS3A 4LW1A 3RLNA 4AYBE 4BA2I 2NZOA 3U4ZA 5IWAL 2VQFL 3HKSA 1X6OA 2R6GA 4GN5A 4DR7L 1VQ8A 3CAMA 3KDFB 4IPCA 2FXQA 3OW2A 2UU9Q 4BBSH 4C3IH 2PNHA 4DV4L 3PUXA 4APVA 2UXDL 4A3BH 3BZKA 4LF4L 3F2BA 3I2ZA 1HZ9A 3PF5A 4UP7A 3HOYH 2PQAA 1IL2A 2K5HA 2HHHQ 4R1JA 3GD7A 4AIMA 4BXXH 1Q82C 4JOIC 1PH9A 4GOPA 1ASZA 1HR0W 1XNRQ 1L0WA 3J81c 4LFCQ 2GN5A 3KF6A 1N9WA 4R4IA 4TVAB 3GTKH 3HOWH 5ELOA 4LFBL 2B29A 4LF8Q 2N78A 4XIGS 2IX1A 2K50A 2YTVA 3PIOA 3HOVH 2F52A 3RN5A 1RL2A 1B70B 5IYCG 4JI8L 1KD1C 5M5YH 3PUYA 3PIPA 1WCMG 3K0XA 1WFQA 1YBYA 2ZM6Q 1E1OA 1SN8A 2EIFA 1YEZA 3CC7A 1U5KA 2PI2E 4A3FG 3HKZG 3PCOB 1B7YB 4MZ9A 1QUQA 3NENA 4DV3Q 3KLWA 5LMUQ 5IE8A 4R4QA 3AEVA 2MNAA 2PQAB 3S1QH 2VUMH 3EBEA 3HOXG 4QL5A 4MTNA 4GOPB 1XMQL 1EIYB 2Z0SA 2XGTA 3LGJA 4LNQA 4A3GH 1BVSA 3UDIA 1EUJA 4RMFA 4X64Q 1EQRA 2MQHA 2K5VA 3KF6B 4LFAQ 1VQJA 1X54A 1VS0A 2YTXA 1PH3A 1TWGH 3AQQA 1VQ9A 4JV5L 1KXLA 4IOCA 3ERSX 1U0LA 5IYBG 2K75A 4JBKA 4DR1L 1YVCA 3UE1A 4JYAL 2UUAQ 2KHJA 5IP7G 4P73A 4DR4Q 1UE6A 1V1QA 2UXCL 5IYCH 4YY3Q 2OTLA 4DV5Q 1WCMH 1IYJB 5GAGC 1Y1WG 1UEBA 2IT1A 2PI2A 2QA4A 1QUQB 3S2HH 2L15A 4A3FH 1TWFH 2NN6G 2N49A 3PUWA 4NXML 1FGUA 3NBHB 4LFCL 1PH2A 3CCMA 1I94Q 2KBNA 4GNXC 1LTLA 4DV7L 3OYYA 4X65L 5DLQE 3HOXH 5M3FG 4JI1L 2JK8A
chains in the Genus database with same CATH superfamily
3BU2A 3GTLB 3GTPB 2J4XA 3J80L 4AYBG 4X62Q 1Q90A 3J80c 2F1MA 5IYBH 3W3AA 5IWAQ 1X32A 5NUCA 1BCPD 2BA0A 1SRUA 1VQKA 4H02A 1Y1WH 3IL8A 1M1KC 1SSOA 1QZGA 5C4JH 2X6LA 4AQYL 1SROA 1QOHA 1PH6A 1RIPA 1F9RA 2I5HA 1Q1BA 4IURA 2AWNA 5EBCA 3NTKA 2A8VA 2I5MX 4OONA 4C2MB 3I3CA 4L5TA 1GXDC 1C9OA 2ES2A 4ALPA 3A8KE 2WV6D 4IN3A 2B2VA 4CJ0B 4JBMA 3P1HA 2B63H 1JOOA 1F2ZA 1E3PA 1W6JA 3K7AH 3PO3G 4UDUC 1WTHA 2ZTEA 3CQZH 3K8AA 1VQOA 1TVXA 2JA6G 2XRSD 1NUCA 3S2DB 3DHQA 1V43A 3J81E 4MTKA 4RG1A 4RGNA 4K2LA 1X56A 4KI0A 3GTGH 5FLMH 1LTRD 4LF5L 2G9DA 1DONA 5CV8A 4LF6L 2KEDA 4RCOA 2RSOA 1G6ZA 1AW7A 2MO1A 3S2HB 3H0GH 1BKBA 1CHQD 5D3IB 4PNYA 4JI5L 4KHZA 5GAEC 1L0XB 2K1BA 4UPAA 3KLRA 1YHAA 3RLFA 4A3IH 1I4RA 2VUMB 3IAYA 1KQSA 4DV7Q 1CK1A 1VQEA 2D0OA 2Z1CA 2PMZE 3K5MA 4GOPC 1H9SB 1RODA 4KMUC 2D62A 4OWTB 1IZ6A 3I72A 1Y1VB 4NMZA 1F77A 5JEAH 3IRBA 4QIWB 1KC8C 4L6TB 1HQMC 1YNXA 2UXBL 1I50B 3CF5A 2ZXOA 2TSSA 2IHFA 4AQYQ 3KOJA 2Y0SE 4PZ6A 1QNUA 3I4MB 3T4AC 3E9IA 4HIDA 4B08A 1Y8NB 4HIOA 1KL9A 4AYBB 4HAEA 2R7ZG 3SXHA 3I73A 2DUDA 1BOSA 2HD3A 1L1OA 4NB3A 5C44G 5EQ0A 1PRTD 3R2IA 4A3DG 5FLXE 1FNWA 1TKWB 2JN4A 1CA6A 4A3MG 1MHWC 1RHPA 3D0FA 1LABA 3BVGA 1HFGA 1XTCD 4LF5Q 1D7QA 3KJOA 4A3GG 4I65A 2LSSA 3HOZG 4A3EG 1J6QA 4N9PA 1LTID 1K0SA 3W2DA 1OXSC 1MSHA 3C2PA 4LWCA 3Q8DA 1CUKA 4MN3A 1S4ZA 3TZUA 3DM1A 1VQHA 4JI5Q 3KFUA 4YHHL 3PO2B 3D6CA 3HOUG 1W6KA 2JEBI 3Q0AA 2PW5A 4IUPA 1PHJA 1LTSD 1VF5C 2NUCA 4JG2A 3RZDH 2NBFA 4TSSA 3C3LA 4UY8C 4R4OA 3PIO3 2UUCL 3ND8A 5E3FA 2B2WA 2J0TD 3PIP3 1S5CD 1PH7A 1G51A 1QJOA 2VB2X 4GN3B 3S15H 3K59A 1HNXL 3ITPA 1J5EL 3MXNB 1DZ1A 1FJGL 3BYYB 1CKNB 2QDBA 3SK4A 1U4RA 2H5XA 3NHHA 1I3QH 4LUOA 4G57A 2K7VA 5C3XA 4KKTA 2MJ8A 5JEAJ 2E74C 3EROA 2YU9H 5IYDG 3TEHB 1GUGA 3A8JE 4DU9A 3N52A 1SNPA 5JVG3 3H91A 3NELA 4JOIA 1MBYA 1PV4A 5AFWA 2AMCB 4BY7G 4U68A 3EFXD 4CBVA 1PTOC 2R93B 2VY3A 2XTIA 2QF7A 3OOCA 1HZAA 2VS1A 2XIWA 4PMCA 1OXTA 3I55A 2SDFA 2C35B 3MFYA 1BNZA 5C4ZA 5C6AA 1E0BA 3L9AX 4FP5D 1EWHA 1UUPA 1O7LA 3R93A 4PZ8A 5C44B 1O7YA 3A56A 1EU4A 2F0VA 3BDLA 5HY6A 1DGSA 3HZXA 4YHHQ 5EKLA 1HNWL 1ET9A 5ELEA 5A2QE 1SFOH 2A6ED 3V96A 3EN2A 3W5OA 3F8TA 4DAYA 5J39A 1KDCA 4A3LH 1QB5D 4IJLA 1RTOA 4EQOA 2WB1E 1O78A 1T9HA 1VQPA 4DR3L 1VQBA 4BBRG 1EYAA 1JJ2A 1EQTA 5T1GA 2UUCQ 2QEJC 2OWOA 4C3JG 3B6YA 1Q81C 4JI2L 2NB0A 1JE5A 1YNNC 3E3XA 1K9MC 4NPSA 1WTOA 2RCFA 5E4WC 2BDOA 4I7ZC 4C1NI 1HNXQ 1EQQA 1J5EQ 4C3HH 2E2JB 3HOUB 2VB3X 1RCVD 4BWGB 2NWGA 1QVGA 1BBXC 4DV0Q 1JWSD 1G291 2F0DA 1YI2A 1SR3A 5C3EH 1XNRL 2OT2A 1PYWD 5KGUA 4P71A 1N8RC 1VQAA 3UDFA 1ILQA 5EPLA 2R92G 1STAA 4N8X1 4YWMA 1YIJA 3TS2A 3TP6A 2JE6I 4IUVA 2DJGC 1SYGA 1PYBA 2IX0A 2ZJQA 3T53B 3ULJA 3HKZE 3JAME 3HOYB 1XX8A 5HGTA 5K36H 1ENAA 3S1NH 1FGBD 5GADC 2Q2UA 3GQBA 3SK8A 4EVOA 1O80A 2C9OA 1WI5A 4X64L 3KJPA 1TWCH 1PA6A 1BBWA 3J81i 4LFAL 2F0EA 3S16H 5IP9G 1QVCA 1YJNA 4R4TA 3A54A 1QWYA 1HA6A 1CSQA 5M5YB 4HSPA 3NQIA 1G91A 1LM0A 4YY3L 2AQ1B 2JA7H 1HNWQ 3G6JB 3MEFA 4R8IA 2LKVA 1QE6A 4QIWE 4KJOA 2XWJB 3S1QB 4UP9A 3BJUA 4DN4M 4DR3Q 3CC2A 3K0YA 4F8MA 3S1RH 3URYA 2KEEA 4PMWA 3FPPA 1ZKOA 4UP8A 4XQQA 3RD4A 1JB3A 4GZYC 3RZOB 1A2UA 1BXTA 3RLNA 4AYBE 2B2TA 3HKSA 1X6OA 4IPCA 5ELCA 1X3PA 4C3IH 2D5DA 1HZ9A 4A3FB 3PF5A 4QMGA 5C0XH 5CV4A 1O7ZA 3MHBA 1Q82C 4GOPA 1XNRQ 4BBRB 5KNDA 1HUNA 5IOCA 4LFCQ 1N9WA 4R4IA 3M4OB 2N78A 4C3JB 1WTXA 3PIOA 3T13A 1EY5A 2HUGA 5IYCG 1TS4A 1KD1C 1U9RA 4ZRZA 3PIPA 2O5IC 1EIHA 1LTGD 4LAAA 1E1OA 3CC7A 2PI2E 2IWHA 1LT5D 3PCOB 3E5SA 1EY0A 5IE8A 5JOBA 1GOZA 1LTBD 4XXEA 4QL5A 4MTNA 5C4JB 1CQVA 1DOLA 2XGTA 4ABNA 3O13A 4HMJA 4X64Q 1EQRA 4LFAQ 1AZPA 4JV5L 4LK1C 1K28A 4CKBA 4IOCA 3ERSX 3A7LA 4DR1L 3UE1A 4WRDA 4JYAL 3QR8A 1UE6A 2MHVA 3X3NA 2DJFC 4OIJA 3J80E 2UXCL 5FO9B 4YY3Q 1SYFA 1LO5D 2PI2A 1PFMA 1BCPC 4Y7NB 1TWFH 2NN6G 5KYLA 2B63B 3K7AB 1SJED 4NXML 3CQZB 1FGUA 3CCMA 4OHJA 4XDXA 4RAUC 1I6HB 2DNCA 3HOXH 1K3BC 5IT9L 5M3FG 4JI1L 5IT9c 1SMYD 2FINB 3CCRA 3KF8B 2PZTA 3MWYW 2PPBC 4LUZA 4BBSB 3I8ZA 5C5MA 1QNKA 5IP7H 4IUQA 1VMCA 4XTCS 1ESRA 2SNSA 3U4VA 2ENBA 1VQIA 3H15A 4JI0L 2OXPA 1PTOH 3ZYYX 5KRUA 1WJJA 4KHPL 2ATWA 2L9HA 2E2HH 3A5UA 4B3ML 5KNBA 3HOWB 1PH4A 1NMFA 1SYCA 4OX9L 2XSCA 4OIKA 4PMBA 4ZLTF 1IYUA 3MTSA 4RGMA 2IX3A 1Y8PB 1JOQA 4LMQD 2AUJD 3J7ZC 4DV6L 4PQXA 1YHBA 5M5WH 1T5XD 5IGCA 5C0XJ 4A3GH 1CA5A 3HOZH 4G4KA 4NXNL 3M7GA 2LMCB 1F9SA 3T1HQ 1MGSA 1IW7C 5K5PA 1F9PA 4GN4B 2F3VA 2Q8RE 1B3AA 1N34L 4UHVA 4JV5Q 2E76C 3CCUA 1PH1A 4DR1Q 2AHOB 1STYA 4JYAQ 1RD9D 3OWFA 4DKAC 1VQDA 2UXCQ 2HIVA 1NNXA 1V9PA 2HT1A 2KECA 1Z9FA 4P72A 3EIVA 5ELDA 5EAYA 1GHKA 2CQOA 1Z47A 1EY9A 3DWAA 1DJRD 1L2FA 1PZJD 4ZCKA 4NXMQ 3WDNA 1EIFA 3F1ZA 1CSPA 2K01A 4ZQ3A 3F2DA 3VR2A 1JT8A 3G7LA 4JI1Q 5J3BA 4PZ7A 2ZJPA 2WAQG 4IOAA 2JA5H 2B3GA 3UE0A 5KYIA 3A0JA 4QUFA 2M9VA 3ER0A 4K6LA 1H9RA 1D5XC 4QJFA 1QZHA 2NVTH 2VUMG 1CQFA 4WFN3 4QY7A 4JI0Q 4ME3A 5JJIA 4GKKL 2Q2TA 4KHPQ 3QB3A 5IYDH 5I6WA 3QOLA 4B3MQ 1NE3A 2VL6A 4OX9Q 1K83H 1A0IA 2CH4A 3HS0C 1TWAH 3RZDB 1PRTB 4KJNA 5ELFA 2F0WA 2FMMA 2I5LX 3S9WA 5AJ3L 1Y1VG 1F9QA 2CWPA 3FDTA 1R9TH 1JCKB 4DV6Q 3TRZA 5CGKA 3SE0A 1JB7A 5M3MH 1SNMA 1A3TA 3GTMH 3BVMA 2K28A 1STEA 5DM73 3KBGA 4NXNQ 5KIXA 3I56A 2AWOA 3J7AF 2A6HD 1TR5A 1B3QA 2HDLA 3I91A 5CBAE 4B3SL 3I4MG 1K3RA 2F4VL 5BN4A 4QQBX 5JJLA 4KN7C 2RBMA 1AN8A 1N34Q 3JAMi 1I4QA 2ZJRA 3KLSX 3KK7A 3G71A 2AUKA 1IXRA 4J8QA 1LTAD 1XNQL 4A3KH 1VQ6A 4WJ3M 3C46A 5BN5A 1BDOA 1GHJA 4IO9A 2JA8G 3MXGA 1G2TA 3KUPA 3QWNA 2JYOA 4ZKCB 1C4QA 1JJGA 4DK0A 2F0SA 2NYZD 5DAUA 2VZAA 4K8IA 5CV7A 1CT1D 1GVPA 1B4OA 2BCOA 1X55A 5FO7B 3CP0A 4MNOA 4XQJA 1EY4A 3PGZA 1HZBA 4IFDH 1AH9A 4L8JA 2F4IA 3FKIH 2EE1A 2O4XA 4EQ5A 2KCMA 3IKJA 1VF7A 4JPBW 3PO2G 1BR9A 4GKKQ 5JPNC 2F0UA 2R7FA 2V4DA 1FVIA 1SFOB 5EGTA 1CZWA 3OMGA 2A68C 1X3GA 3CCVA 3GO5A 4QGUA 2WAQB 1TWHH 3M85A 1GO3E 1VQGA 2BE5D 3J7A5 1E22A 5AJ3Q 1SE4A 4FNFA 2NVQB 3HFZB 4A75A 1NJIC 3I7FA 2IHEA 2JQOA 1WTWA 2EYHA 1Y14B 2B2TC 1ZXTA 2EYLA 2LXKA 3PF4A 1SNOA 2DGYA 4B3SQ 1B2TA 2F4VQ 2R7DA 1OXVA 2AQ2B 1Q12A 4GLVB 2EYPA 4R4CA 4DUZL 1S40A 2A6EC 3GTOH 3DWPA 2LXJA 3D8GA 3DLLA 5C3EB 4DV2L 3K81C 5FJ8G 4KN4C 4K2KA 3IFTA 4KK7A 2XN9C 2F0LA 2KENA 1EY6A 2X6GA 1Z6HA 4POFA 1XNQQ 3WWVA 1BBUA 4DUYL 4DF7A 1VDZA 3PQIA 3MXUA 3RUZA 4HIKA 1HZCA 3G48A 1EL0A 4K5WA 3TSSA 2YYZA 4H13C 3J80i 2R93G 2ASBA 1RDPD 2EQSA 4RH6A 2QILA 1MD2D 4OO1H 3K57A 1CTMA 2KA7A 4A93H 1VQ4A 4DFAA 2F0PA 5IGFA 3S1NB 1E2VA 2C5CA 2QDLA 3SR1A 1D1KA 1I4PA 1ONLA 3T56B 4N8FA 2JSOA 4BY1H 4X3TA 3S16B 1EY7A 2KOLA 3QG1A 5I2YA 3E6ZX 1KRTA 5I9PA 3M3YB 4HJ7A 1SXTA 3I4LA 4YCUA 4HCSA 2JA8B 2OTJA 2NZ1D 1TT2A 1YNJD 5LHY1 4JBJA 2K32A 1XPOA 1M4VA 2BOSA 3WOFA 4A3JH 2PZWA 1VCIA 2CVRA 5CC4A 1LT4D 4IALA 4WJ4A 2L55A 5C0XI 1YITA 4IFDJ 5ELNA 2DNEA 4K5VA 4J6HA 3CHBD 2KCCA 1HA5A 1JWMD 5CORA 1TXYA 2E2IH 3RNUA 2ZM6L 2EXDA 1WTQA 4JVZA 3D4DA 4GNXB 2CW0D 2HQLA 4K14A 5CMDA 2EJMA 2F0TA 4GLXA 2PW7A 3CMAA 1X9NA 1MKHA 3CC4A 4TQUS 4DUZQ 2QKIC 4DV2Q 3H3VC 1X65A 2NN6H 1PMRA 1SYDA 4KY7A 1GD7A 1IKLA 4FXGC 1FL0A 1NCVA 2L4NA 4IPGA 3TP5A 1D2BA 4RHRA 4G7OC 4DUYQ 3VYSA 4K8JA 3KLSA 3I4NH 3VA5A 2UUAL 1KAAA 3K6OA 4DA2A 2BH2A 3KDFA 4S3SA 4A3BG 4YIJA 1S5DD 4B9XA 4DV0L 3HOYG 1QG7A 4DPGA 3GTQH 1HTPA 1S5BD 4FXDA 1WTPA 5CV6A 3K5NA 1I94L 1B1ZA 1U4MA 1EZ8A 1M8AA 3GTJH 3A5ZB 5C4XH 2RHSB 1HCZA 1ZEQX 4JI6L 3HOVG 5IGGA 3ONAB 2QCPX 5GROA 3GTLH 1GUWA 3BVZA 2B8FA 2NZOA 5EKKA 1FR3A 2VQFL 1TS2A 2R6GA 1EY8A 2SNMA 4CHTB 2EY5A 3CAMA 2L1BA 4DV4L 2UXDL 2IPKD 3BZKA 4LF4L 3BDOA 2PQAA 1IL2A 1A3VA 3GD7A 3R2TA 5D3DA 3U9SA 3J81L 4DGZA 5DEHA 3J81c 3HOXB 4TVAB 3BG3A 3NPPA 5ELOA 1D5MC 1TY0A 2YTVA 2CH4W 1AFPA 2Z8LA 4JI8L 3TZDA 1WFQA 4ID6A 1UNSA 2ZM6Q 1PTOF 4RFBA 4ZAIA 4A3FG 2F3WA 3NENA 5E4XA 3KLWA 4JW0A 4R4QA 4WORA 4U673 2CQAA 3OW7A 3D3RA 1EIYB 2E2HB 2Z0SA 3LGJA 1PH3A 3IFDA 3KF6B 3NTIA 2K5VA 2EY1A 1X54A 1VQ9A 1KXLA 2I07B 4QF4A 5IYBG 2K75A 1A6XA 2UUAQ 3D4WA 5M5XB 4P73A 1SYEA 3HGBA 3SK6A 1WCMH 1Y1WG 2RKSA 1TS3A 1UEBA 1QUQB 1UEAB 3S2HH 2N49A 5EKIA 1G2SA 4FVMA 3NBHB 4LFCL 1I94Q 5ISRA 4X65L 3OMCA 2VUMH 1FNUA 2JK8A 4A76A 1LYLA 5EPKA 3CCJA 4JI6Q 4Q0FA 2WAQE 3FP9A 3TMEA 5CR3A 2VQFQ 1JICA 3V2TA 4XYQA 2A69D 4A3BB 5A35A 2B63G 1SE2A 1UE1A 4DV4Q 5I2XA 2UXDQ 4LF4Q 3ULLA 3L7ZC 1E2WA 5JAVA 2JP1A 4KD3A 5G3LF 1R4PB 3E9HA 1GJXA 3GTKB 5FLMG 1CZGA 1XMOL 3T51B 4O0AA 3HOVB 4DK3C 5H1SE 4HEDA 4X3UA 4O1NA 2XRQD 1GUNA 4BBSG 1KDBA 1RTNA 4JI8Q 2WACA 1SE8A 1RF2D 2BDNA 2RQXA 2CWAA 4JI3L 1Q86C 1E7ZA 1E1TA 1WOCA 3SGIA 1MIUA 1MI2A 1STNA 4X6AH 4HN7A 4B3TL 1B53A 1JOKA 2ID0A 1KAWA 3DXJC 1CFMA 3CW2C 1F2LA 3S14H 3M9BA 3HOWG 1OO9B 1FD7D 4DR5L 3U58A 1LT6D 1B9NA 4FYDA 2KCNA 1TWGB 5EJWA 2DY7A 1K83B 1FYCA 3G4SA 2L0CA 4JCVE 1TWAB 4JC0A 1H9SA 2ZTDA 1A8VA 2M2LA 3V05A 4R8NA 2E8GA 3OSOA 5JEAG 4GLAC 3CPWA 5M3MB 1PH8A 4MIUA 2QEXA 4RGOS 4ZK9B 2E5LL 4KY6A 3VR3A 3VR4A 2K5WA 4KD4A 4B3RL 1GM5A 3PO3H 1SBBB 2HQEA 3D4RA 4X65Q 2JA6H 3HRZC 4P2CB 3HEJA 5LMNW 1GUTA 3VYUA 1B9MA 1UE5A 1EYGA 1W3SA 1LT3D 3CCEA 2GVAA 3A74A 3SDZA 4XT1B 3OTOL 5JPMC 3CXCA 1VQMA 1KDAA 1OTCA 1Y1WB 2GVBA 4IUNA 2IJ0A 3T1HL 4NW2A 1BF4A 3Q23A 1D1IA 4HR7B 1IBML 1V8QA 1B8AA 1VQFA 4DR6L 1PTOD 4IFDI 5IGEA 4DR2L 1XMOQ 2A6HC 4MHEA 3H3VH 1KTKA 2A5HA 2GA4B 3CPFA 2K03A 2F0KA 2P5ZX 3S24A 3CU7A 1YJ9A 5D14A 5M9OA 4JI3Q 1S3OA 3VR5A 1JQYD 1E24A 1TQOA 1XYIA 1A3UA 5FJ8H 3NWTA 1JMCA 4B3TQ 3F2UA 3FKIB 4HMIA 5IY0A 4P74A 5TSSA 1S72A 2Z9HA 3AFQA 1LUZA 2A19A 5IGBA 3E0EA 4DR5Q 4DNRB 5I9OA 3GTGB 2V1CC 2FFKB 4IQZA 2MP1A 4TKOB 1X3QA 3STBD 1Q7YC 3TQYA 2X69A 3NEMA 2JJQA 2ZXPA 1O7IA 2R7ZH 3H0GB 1BCPF 1NMGA 4OL7A 2XWBB 3A7AB 1L1OB 1KLGD 4X66L 5C44H 4A3IB 2E5LQ 1EIGA 1KHIA 4A3DH 2XNAC 5I6YA 3MXNA 4B3RQ 2ICEC 1A15A 2CCZA 3HG9A 2EY6A 3DEOA 4Q5VA 4A3MH 1SNQA 1CKNA 2LY7A 4RCNA 1PZID 2Y0SB 1SAPA 1XWEA 2DY8A 3OHXC 2LS01 3J7AV 1DOMA 2RCNA 1N33L 2XVSA 4CKEA 2AQ3B 3ERQA 4OO1I 2K14A 4DK1A 1PZKD 3OTOQ 3VYRA 4LF7L 4A3EH 1UE7A 4N9TA 2Z6KC 2EY2A 2F3IA 1WVLA 3P7JA 2B2YC 2Z6BA 3ZJYC 1PFNA 3TDQA 1IBMQ 4DR6Q 4YWKA 4DR2Q 2NVXH 1K8AC 3HOUH 2VQEL 4HIMA 4A93B 2Q2HA 4DNIA 3Q6SA 2RDFA 4XT3B 1Z7TA 2B2UC 4BY1B 1STHA 5J22A 2D0PA 4LUVA 4Y52H 1QVFA 4DXFA 2BA1A 4M1UB 3CRLC 4KKUA 3M4PA 3EQLC 4HJAA 1PYSB 1D8LA 4A3LG 4X3KA 3TBIB 1J9OA 1P8LA 4A3JB 4ZYSA 4L5RC 1NAPA 1STGA 1CI3M 3ND9A 4F7XA 3UI2A 3W1GA 2RA4A 4O42A 1VQ7A 2N8NA 1MJEA 4L5QA 4X66Q 1PRTC 1EFID 4HJ9A 2NN6I 2E2IB 4ZUJA 4DV1L 1A63A 2CKZB 1PDQA 2EJGC 1TIID 5LL6S 4DNTB 3G6EA 1HNZL 4V0BA 4BY7H 5C3EG 3NTHA 3Q24A 4OEMB 3FPUB 1SJHD 2VNUD 1N33Q 5BN3A 4ZUIA 4CDFC 2KHSA 4K5XA 4R9WA 1SNCA 4LF7Q 4LF9Q 4F88A 1WTVA 1N36L 1K8MA 1D6EC 3S15B 3RZOH 3KYHC 4IUTA 4O2DA 2UU9L 3CKIB 1JC7A 2Q8IB 1H95A 5JVH3 3GTQB 2E75C 1I3QB 5K36G 4DAYB 1WD1A 1HRJA 2VQEQ 2NVYH 3TN2A 2HHHL 3WOEA 5EBDA 4J15A 2ICIA 2HIXA 3PMFA 2IW3A 5C4XB 4RKLA 1MSGA 4BBRH 4NP5A 2YU9B 3GDEA 3H6MA 4LF8L 3M4OH 2EYOA 2F0IA 1HQRD 1AE2A 4C3JH 4QCLA 3QOJA 2JA7G 1JE4A 3PSIA 4JI4Q 1NY4A 4RA8A 4OWWB 1EEFD 4DV3L 2G5DA 3NK9A 5E1FA 5E7NA 3R3OA 2LFNA 1C0AA 4H44C 2YTYA 1EYDA 3OWEB 4HJ5A 3U9OA 4OXPA 2KCTA 5I4DA 2EYFA 2I0QA 2WB1B 4PG3A 5GAHC 4A3CG 1A62A 1EU3A 4HSVA 4LFBQ 3AU7A 5ELBA 3OPOA 1QCBD 2B39A 2KHIA 5D65A 2R92H 1PH5A 4C3IG 3I70A 2FHTA 1B50A 4DV1Q 4DV5L 1OXUA 2I46A 5C0XG 1HNZQ 1C7YA 1JWUD 4EGVA 1LV9A 3FHWA 4CDEC 4Y7NH 3F2CA 3I90A 1XXGA 5C4HA 1YHQA 3S17H 1IL8A 2IY5B 1RJTA 3AYHB 3D31A 1I6HH 3RMHA 4K0KL 2MGSA 3CD6A 2PZUA 5IP9H 1N36Q 3MFGA 3HP3A 2MPMA 4GS3A 4KKSA 4HTHA 3U4ZA 1ENFA 4ZKBB 4C3HB 4GN5A 1EYCA 4DR7L 4FO2A 2UU9Q 2SOBA 4BBSH 2FXQA 1IKMA 2G9HD 2MUYA 1ML0D 1WCMB 1ZYRD 4APVA 3I2ZA 2F0OA 1CHPD 4QUCA 4H0LC 3HKZB 2K5HA 2HHHQ 1IW7D 4R1JA 1AEXA 4RKBA 1PH9A 1ASZA 1L0WA 2GN5A 3H94A 4DAPA 5CBEE 3HOWH 1CM9A 3R8BA 4LF8Q 4XIGS 2K50A 2HDMA 3RN5A 1RL2A 2K04A 4XQNA 1UAPA 3PUYA 3K0XA 1YBYA 1SN8A 1NSNS 1B44D 1U5KA 4PV1C 4MZ9A 4DV3Q 3AEVA 2MNAA 2EVBA 3K5OA 2N55A 1KLUD 3HOXG 2KVMA 1TWCB 3P20A 4GOPB 1XMQL 5IIFA 1BVSA 1EUJA 4RMFA 1VS0A 2KJXA 2WINB 3AQQA 3KF8A 1SDFA 4IUUA 4JBKA 1GUOA 1TS5A 1YVCA 3M4YA 5IP7G 2JA7B 3LX0A 5IYCH 1PXUA 2O5JC 4DXGA 1DD2A 2OTLA 4DV5Q 1IYJB 5GAGC 2EXZA 2IT1A 2A69C 1Y8OB 1TY2A 4V190 3S14B 3PUWA 3S1RB 1HXYD 1TU2B 2KBNA 4GNXC 3QIAA 2Z4HA 2K5DA 2OQ0A 2PO4A 2N3SA 4K0KQ 1BUVT 4GKJL 4L5SA 1KNEA 2EPBA 2UUBL 3MAQA 3D6WA 1SE3A 1PFBA 3TP8A 4LF6Q 3DWQA 4C3IB 4DR7Q 3P75A 4ME5A 1HH2P 1I4HA 1V1OA 1NR4A 1VQ5A 3OIPA 1Q8KA 2QGQA 1EEID 1SLJA 5J1ZA 1EWCA 2WFWA 1U4PA 4FF4A 3EVQA 3ULPA 1DYQA 3PO3B 3MZ5A 1GKHA 2JA6B 2RDHA 3NBIA 3I4OA 3E0JA 5M3FH 1S5FD 2D9UA 2Z6KA 3H09A 3MEHA 1WTRA 5HGQA 2B2YA 1BQQT 3H3VI 4ILWA 2EZVA 4BXXG 3VDYA 1HTLD 3LWEA 1V1PA 4FDBA 1XTDA 2A1AA 1K8GA 2RVLA 1ET6A 3S1MH 3PUVA 3PUZA 1DM0B 2HCCA 2SEBD 5FKAC 1W2BA 2EYJA 1HPCA 1E2ZA 1XMQQ 1VMPA 2UXBQ 2B2UA 3GTPH 3M7NA 5IGDA 2N88A 4TRDA 2JA5G 1C8CA 4OELB 2QW7A 2L11A 2FMCA 1K73C 5C3WA 4IPHA 5CV5A 1EQVA 1SMXA 4OWXB 3LNNA 2NTSA 3UDXA 1I4XA 1TWFB 2BH8A 1K8OA 1JR0D 2L5TA 4DK6C 4J1MA 5C5LA 1PVOA 1IBLL 2EDGA 1EFWA 2F03A 2A68D 1H9KA 3CCLA 3AMUA 3RN2A 1IBKL 1WYDA 1A2TA 2F0NA 2YV5A 4I7AA 4GKJQ 4NDXA 3A55A 2UUBQ 5LL6X 1YZ6A 5M3MG 3U50C 4C2MH 2R7ZB 2K6AA 2WIIB 1ICWA 1PTOB 1PFSA 1KRSA 3JC66 3PV0A 3BDCA 4IPDA 4A3DB 4AH6A 5FOBB 2KUMA 5IODA 3S2DH 1KIXA 4JI7L 5LMNL 4CJ2C 3NUCA 4A3MB 5IT9E 3K7UC 4DAVA 1GUSA 1SMYC 4A4IA 3C1EA 4M8AA 1NR2A 4UAIA 4P75A 2D2CC 3VR6A 5M5WB 4K6DA 3STBC 4A3KG 2ZT9C 3BYTB 4A3GB 3HOZB 4A3EB 2NVQH 1G6PA 3NWSA 1DXMA 1EZ6A 3MA2B 2MFIA 1WD0A 4IJHA 4XYOA 1YJWA 2F0QA 4QB4A 4DAMA 4FF1A 2OQKA 1U4LA 1C48A 2NVXB 1I4GA 3CMEA 3TS0A 1XJVA 1X3EA 3RLOA 1FJGQ 3FEWX 1IHZA 2K05A 5JJKA 3GV6A 4E6IA 3CCSA 4IFDG 5FLXL 2NZHA 1Y1VH 1HUMA 3FKIG 2PCFB 5FLXc 1XPUA 2RSNA 1DOKA 3K58A 2R61A 1VQNA 1I50H 2ALYB 3TREA 3ICEA 5DNFA 1IBLQ 3SK5A 4FF2A 1L0YB 2PQEA 1VQLA 5BR8L 3I4MH 4JBWA 3J7YW 3L2PA 1UWVA 1IBKQ 2JA5B 3M4QA 1H9JA 3TP7A 1F2YA 5GQOA 4BS9A 4HJ8A 3T1YL 1H9MA 3H0GG 1KABA 3J81j 4KHVA 1MJCA 1ESFA 4A3IG 2JXMB 2NVTB 2MO0A 3SEBA 2F0MA 1HFNA 3KBXA 3QJYA 1QILA 3X3MA 1S5ED 2L12A 4RWSC 3M3YH 2AKWB 3DEPA 3MVVA 2K5NA 4G7ZC 4JI7Q 2JA8H 5LMNQ 2Y0SG 3T16A 4CKCA 1G8ZD 2B2VC 2VW9A 4BY7B 2JEAI 2R3ZA 4G7HC 3VA7A 1R9TB 4KLKA 1AZQA 2K52A 1JORA 1M90C 3BS1A 3GTMB 1AP0A 2VXWA 2Q8TA 1RKNA 4YCWA 3Q22A 5CV9A 1ICFB 1I6VC 2H1EA 3EJIA 4JI2Q 4CDCC 5EPJA 4A3CH 3PO2H 2OEOA 2EOTA 4EX5A 4OO1G 2B8GA 1XPRA 4JK1C 4A93G 3K80C 4KY5A 5F2DA 2NVYB 5CYUA 5HURA 1F2MA 1BO0A 4NKLA 1OXXK 2ZXRA 3SHLA 2WKDA 4BY1G 4CDDC 4A3KB 1HJPA 2KQ3A 3MC0B 2FJ2A 1T5EA 1Q8IA 1EOTA 3W1BA 1LACA 2WP8J 4BA1I 1K0RA 2F0GA 4RHSA 5BR8Q 4C56C 4A3JG 4H7BA 2A73B 2CFMA 3UDGA 3BZCA 3T1YQ 2K33A 1HR0L 4L63B 3RR5A 4ULLA 5T1IA 2NTTA 1NBWA 3L3OC 1N32L 1I5FA 3FVQA 3GV3A 2RHQB 5A2QL 2RF4A 2R92B 3L0OA 4GNXA 2Z4IA 1AE3A 1Q46A 1L1OC 2R93H 5FK9C 1JJCB 1TWHB 4POGA 1EOVA 2PMZB 3CCQA 3AFPA 3S17B 5JJZA 1YNND 4KV6A 2JA9A 2F0HA 3I4NG 1LTTD 3EA6A 1P16A 1ASYA 1Q1EA 1BCPB 3NP8A 2ZTCA 5LMUL 3MXPA 3CRKC 3GTOB 4F87A 1CKOA 5G3LD 4OGQC 5C4XG 3NQTA 2PNRC 2WKCA 2A74C 2TMPA 4YCVA 1ENCA 1DCZA 1EWIA 2BE5C 4LF9L 4EQNA 4FXKC 1STBA 2K4KA 2DN8A 2F0FA 2Q2IA 2IL8A 2HCIA 4DR4L 3A8IE 1KNAA 1R4QB 2CHBD 5M5XH 3JAML 1X3FA 2E2JH 3JAMc 5KEEA 2B2WC 1VQCA 1SYBA 1NTGA 1CKMA 1ZYRC 3K5LA 2WB1G 1HR0Q 1SEBD 4CJ1B 4YWLA 5COYA 3DM3A 2M00A 4CGYB 2OCEA 1Y69U 2J7ZA 4RGTA 1N32Q 4JI4L 4X62L 2RDGA 4LW1A 4BA2I 5IWAL 2O2LD 1VQ8A 3KDFB 3OW2A 1LLRD 4KTAA 2PNHA 5L37A 3PUXA 4A3BH 3F2BA 4B9WA 4UP7A 3HOYH 4ODGA 1V1PB 4AIMA 4LJZC 2EYMA 4BXXH 4JOIC 2PYKA 4HCEA 1HR0W 1J8IA 2OF1A 3GTKH 3KF6A 4LFBL 3DMUA 2B29A 2IX1A 3HOVH 1PLFA 2F52A 3SVMA 1IYVA 4C3HG 3FMCA 1B70B 5M5YH 2F0JA 1ILPA 1WCMG 5DM63 2EIFA 3FRPB 1YEZA 3LWUA 3C1FA 3HKZG 1B7YB 4EQPA 1QUQA 1YNJC 3NSWA 3OIQA 1SNDA 2E2DC 5LMUQ 3NE5B 3N6RA 5KNCA 2PQAB 1HHVA 3GP7A 3NBHA 3S1QH 3EBEA 4Z9CB 1D5ZC 4LNQA 3UDIA 3VYTA 2MQHA 2EJFC 1VQJA 2YTXA 1TWGH 1PRTF 3NXWA 5M3FB 3I4NB 1II3A 1U0LA 4IZ8A 2H4OA 2KHJA 5FO8B 4DR4Q 1V1QA 1Q3LA 4C1NK 2QA4A 3AB9A 2L15A 4A3FH 2CW0C 3S1MB 3GTJB 4FF3A 4WJWA 3BZDB 1PH2A 3DUZA 3QO2A 2K5QA 1FNVA 1LTLA 3OYYA 4DV7L 5DLQE 4X3SA
chains in the Genus database with same CATH topology
5IT9c 3BU2A 1LYLA 3CCJA 2OQ0A 4A76A 4JI6Q 2N3SA 4K0KQ 3CCRA 3KF8B 2WAQE 4GKJL 4AYBG 4X62Q 4L5SA 4LUZA 3J80c 2UUBL 3FP9A 5IYBH 1Q86C 5IWAQ 2VQFQ 4LF6Q 4DR7Q 2BA0A 5IP7H 1HH2P 1SRUA 1UE1A 2B63G 4DV4Q 4XTCS 1VQ5A 4H02A 1VQKA 2UXDQ 4LF4Q 1Q8KA 1Y1WH 3U4VA 3ULLA 3L7ZC 1VQIA 2QGQA 3H15A 4JI0L 1SLJA 1M1KC 1WJJA 2WFWA 2ATWA 4KHPL 3E9HA 1QZGA 3ULPA 2E2HH 5FLMG 5C4JH 3A5UA 1GKHA 4AQYL 1SROA 1XMOL 1PH4A 1NMFA 4O0AA 1PH6A 1RIPA 4OX9L 3I4OA 2I5HA 1Q1BA 4DK3C 5H1SE 5M3FH 4BBSG 2Z6KA 5HGQA 4JI8Q 2AWNA 1SE8A 2A8VA 2I5MX 4OONA 3H3VI 3J7ZC 4DV6L 2CWAA 4L5TA 4JI3L 1E7ZA 1E1TA 1WOCA 1YHBA 1C9OA 1MIUA 3SGIA 5M5WH 4ALPA 2ES2A 4X6AH 4B3TL 4BXXG 3VDYA 2ID0A 1KAWA 4FDBA 1XTDA 2A1AA 5C0XJ 1K8GA 4JBMA 2B63H 3S1MH 3HOZH 1E3PA 4NXNL 3K7AH 3CW2C 3PUVA 3PUZA 3S14H 3PO3G 3M9BA 3CQZH 2ZTEA 3K8AA 3T1HQ 1VQOA 2JA6G 3HOWG 1W2BA 4DR5L 3U58A 1V43A 1XMQQ 2UXBQ 4RG1A 4GN4B 3GTGH 1X56A 4KI0A 5FLMH 3G4SA 3GTPH 1N34L 3M7NA 4JV5Q 2JA5G 4LF5L 4JCVE 3CCUA 4LF6L 1PH1A 4DR1Q 1K73C 2AHOB 4JC0A 4JYAQ 2ZTDA 1A8VA 4DKAC 2E8GA 1VQDA 2UXCQ 4IPHA 2HIVA 5JEAG 4OWXB 1SMXA 2MO1A 4GLAC 3CPWA 1V9PA 3UDXA 1PH8A 2HT1A 1Z9FA 4P72A 2BH8A 2QEXA 3H0GH 1BKBA 3EIVA 2E5LL 4JI5L 5EAYA 4KHZA 5GAEC 2CQOA 4UPAA 1Z47A 4DK6C 1L2FA 1YHAA 3RLFA 4A3IH 1GM5A 4NXMQ 4B3RL 1EIFA 3F1ZA 3PO3H 1KQSA 1IBLL 1CSPA 3F2DA 4DV7Q 2JA6H 4X65Q 1EFWA 1JT8A 4B3ML 4JI1Q 5J3BA 4PZ7A 5LMNW 3CCLA 1VQEA 3RN2A 1IBKL 1UE5A 2D0OA 2ZJPA 2WAQG 1EYGA 1WYDA 1W3SA 4IOAA 2PMZE 2YV5A 4GKJQ 2JA5H 3CCEA 2B3GA 4GOPC 2UUBQ 3UE0A 1YZ6A 3A74A 2GVAA 3A0JA 5M3MG 3U50C 2D62A 4C2MH 4OWTB 1IZ6A 3OTOL 3CXCA 1VQMA 3ER0A 1OTCA 2GVBA 3IRBA 4QJFA 1QZHA 1PFSA 3T1HL 2NVTH 1KRSA 3JC66 3PV0A 4IPDA 1KC8C 2VUMG 4AH6A 4QY7A 4JI0Q 4ME3A 5JJIA 4GKKL 2Q2TA 1YNXA 4KHPQ 2UXBL 3CF5A 5IYDH 3S2DH 1IBML 1KIXA 1B8AA 5LMNL 1VQFA 4JI7L 4B3MQ 2IHFA 4DR6L 4AQYQ 4IFDI 3KOJA 1XMOQ 2Y0SE 1NE3A 2VL6A 4PZ6A 4DR2L 4OX9Q 1K83H 1A0IA 3K7UC 3H3VH 3E9IA 4HIDA 1TWAH 4A4IA 4HIOA 1KL9A 3CPFA 4P75A 2R7ZG 2I5LX 5AJ3L 1Y1VG 2DUDA 2CWPA 3S24A 3STBC 1YJ9A 4DV6Q 4A3KG 1R9TH 4JI3Q 3TRZA 1S3OA 1JB7A 5M3MH 1E24A 1L1OA 4NB3A 5C44G 5FJ8H 1JMCA 4B3TQ 4A3DG 3GTMH 2NVQH 1G6PA 5IY0A 4P74A 4NXNQ 3I56A 2AWOA 1S72A 2MFIA 4IJHA 3AFQA 4A3MG 1YJWA 1LUZA 2A19A 4DAMA 3E0EA 4DR5Q 1K3RA 2OQKA 4B3SL 2F4VL 3I4MG 2V1CC 4QQBX 5JJLA 3CMEA 3D0FA 1N34Q 3JAMi 3TS0A 1XJVA 1X3EA 3RLOA 1FJGQ 4LF5Q 2ZJRA 3STBD 1Q7YC 3TQYA 1D7QA 3KJOA 3NEMA 5JJKA 4A3GG 2JJQA 2LSSA 3G71A 3HOZG 4A3EG 1J6QA 1O7IA 3CCSA 2R7ZH 4IFDG 2NZHA 1IXRA 1OXSC 1Y1VH 1NMGA 3FKIG 1XNQL 1XPUA 5FLXc 4LWCA 1L1OB 3Q8DA 4A3KH 1CUKA 1VQ6A 4WJ3M 4X66L 4IO9A 5C44H 2E5LQ 1VQHA 1KHIA 4JI5Q 4A3DH 2JA8G 3KFUA 4YHHL 1VQNA 1I50H 4B3RQ 2ALYB 3TREA 3ICEA 2CCZA 1JJGA 3HOUG 2JEBI 1IBLQ 4A3MH 2VZAA 1CKNA 1VQLA 5BR8L 1PHJA 3I4MH 4JBWA 3L2PA 1UWVA 1IBKQ 4JG2A 3RZDH 3M4QA 1GVPA 4HJ8A 3T1YL 5GQOA 1X55A 2RCNA 1N33L 3CP0A 3H0GG 3J81j 4OO1I 2K14A 4UY8C 1MJCA 4MNOA 4R4OA 3OTOQ 2UUCL 4LF7L 4A3EH 1UE7A 4A3IG 3PGZA 1HZBA 2MO0A 1AH9A 2Z6KC 3FKIH 1PH7A 4EQ5A 1G51A 2KCMA 3PO2G 2F3IA 4GN3B 3S15H 1HNXL 3M3YH 4GKKQ 2AKWB 1J5EL 3MXNB 2K5NA 2R7FA 3ZJYC 1IBMQ 5LMNQ 4JI7Q 1FVIA 2Y0SG 2JA8H 4DR6Q 4YWKA 4DR2Q 2NVXH 1FJGL 1K8AC 3HOUH 1CKNB 2VW9A 2VQEL 1X3GA 2H5XA 2JEAI 3CCVA 3GO5A 4QGUA 1I3QH 4LUOA 4HIMA 1TWHH 2Q2HA 3M85A 1GO3E 1VQGA 4DNIA 3J7A5 1E22A 4KLKA 5AJ3Q 2K52A 1M90C 5JEAJ 3HFZB 4A75A 1NJIC 3I7FA 2YU9H 2IHEA 2JQOA 3TEHB 5IYDG 4YCWA 1Y14B 2D0PA 4LUVA 4Y52H 1QVFA 2BA1A 4JI2Q 2LXKA 4A3CH 3NELA 3PF4A 4JOIA 3PO2H 3M4PA 2DGYA 4EX5A 4HJAA 1PV4A 1PYSB 4B3SQ 2AMCB 1XPRA 1D8LA 2F4VQ 4OO1G 4A3LG 4BY7G 2R7DA 1OXVA 1Q12A 4A93G 4GLVB 2VY3A 2XTIA 3K80C 1P8LA 1HZAA 4R4CA 4DUZL 1S40A 2VS1A 3GTOH 1OXTA 3I55A 2LXJA 3DLLA 4L5RC 1PVOA 2C35B 4DV2L 1OXXK 3K81C 5FJ8G 3W1GA 4BY1G 1VQ7A 2KENA 1HJPA 4POFA 4PZ8A 3WWVA 1XNQQ 1BBUA 4DUYL 2N8NA 1MJEA 4L5QA 4X66Q 4HJ9A 2NN6I 4HIKA 5HY6A 1HZCA 1DGSA 3G48A 4YHHQ 3W1BA 4DV1L 1HNWL 1A63A 2CKZB 2YYZA 3J80i 2WP8J 1SFOH 4BA1I 2R93G 1K0RA 2ASBA 2EQSA 3EN2A 3W5OA 3F8TA 3G6EA 5BR8Q 4A3JG 1HNZL 4BY7H 4A3LH 2CFMA 5C3EG 4IJLA 3UDGA 3BZCA 1VQ4A 4A93H 2WB1E 1T9HA 3T1YQ 1VQPA 1HR0L 4DR3L 2VNUD 1VQBA 4BBRG 1JJ2A 1N33Q 3RR5A 1NBWA 2UUCQ 2OWOA 4BY1H 4LF7Q 4LF9Q 1N32L 3B6YA 1Q81C 4JI2L 1JE5A 1N36L 1I5FA 1KRTA 1K9MC 4NPSA 4HJ7A 2RHQB 4YCUA 2RF4A 3RZOH 2OTJA 3KYHC 4O2DA 1HNXQ 3L0OA 2UU9L 4GNXA 1EQQA 1J5EQ 4C3HH 1AE3A 1Q46A 4JBJA 1L1OC 1H95A 2R93H 1QVGA 1JJCB 5K36G 4DAYB 4DV0Q 1XPOA 2VQEQ 4POGA 2NVYH 1EOVA 2HHHL 4A3JH 1G291 1YI2A 1SR3A 5C3EH 3CCQA 1VCIA 1XNRL 3AFPA 4J15A 2HIXA 4BBRH 4WJ4A 2JA9A 4P71A 1N8RC 1VQAA 3GDEA 3UDFA 5C0XI 1YITA 4LF8L 4IFDJ 5ELNA 3I4NG 3M4OH 1P16A 4C3JH 1ASYA 1AE2A 1Q1EA 2R92G 4YWMA 1YIJA 2E2IH 1TXYA 3PSIA 3RNUA 2JA7G 4JI4Q 3TS2A 1NY4A 2JE6I 2ZM6L 2EXDA 1PYBA 2IX0A 2ZJQA 4GNXB 3ULJA 4OWWB 2ZTCA 4DV3L 2HQLA 3HKZE 5E7NA 5LMUL 4GLXA 1C0AA 3CMAA 1X9NA 2YTYA 1CKOA 1MKHA 4HJ5A 4TQUS 3CC4A 4OXPA 4DUZQ 2KCTA 5C4XG 3S1NH 2I0QA 5GADC 4DV2Q 2Q2UA 4YCVA 1X65A 1EWIA 3KJPA 4LF9L 1WI5A 4X64L 4PG3A 1GD7A 1TWCH 1BBWA 5GAHC 3J81i 1PA6A 4LFAL 1FL0A 4IPGA 3S16H 2K4KA 5IP9G 4A3CG 1QVCA 1A62A 2Q2IA 1YJNA 4DUYQ 4R4TA 4LFBQ 3I4NH 2UUAL 4DR4L 1CSQA 2KHIA 2BH2A 2R92H 1PH5A 3KDFA 1LM0A 4YY3L 5M5XH 1HNWQ 2JA7H 4DV1Q 1X3FA 4DV5L 2E2JH 4A3BG 1OXUA 3MEFA 3JAMc 4DV0L 3HOYG 5C0XG 4DPGA 3GTQH 1VQCA 1NTGA 1CKMA 1HNZQ 4QIWE 1C7YA 2WB1G 3FHWA 4Y7NH 3F2CA 4UP9A 3BJUA 1YHQA 1I94L 1HR0Q 4DR3Q 3CC2A 3S17H 4YWLA 3GTJH 3S1RH 2IY5B 3A5ZB 5C4XH 3DM3A 2RHSB 2OCEA 3AYHB 3D31A 4PMWA 4JI6L 3HOVG 4UP8A 1I6HH 4K0KL 5GROA 1N32Q 3CD6A 3GTLH 4JI4L 5IP9H 4X62L 1N36Q 4GS3A 4LW1A 3RLNA 4AYBE 4BA2I 2NZOA 3U4ZA 5IWAL 2VQFL 3HKSA 1X6OA 2R6GA 4GN5A 4DR7L 1VQ8A 3CAMA 3KDFB 4IPCA 2FXQA 3OW2A 2UU9Q 4BBSH 4C3IH 2PNHA 4DV4L 3PUXA 4APVA 2UXDL 4A3BH 3BZKA 4LF4L 3F2BA 3I2ZA 1HZ9A 3PF5A 4UP7A 3HOYH 2PQAA 1IL2A 2K5HA 2HHHQ 4R1JA 3GD7A 4AIMA 4BXXH 1Q82C 4JOIC 1PH9A 4GOPA 1ASZA 1HR0W 1XNRQ 1L0WA 3J81c 4LFCQ 2GN5A 3KF6A 1N9WA 4R4IA 4TVAB 3GTKH 3HOWH 5ELOA 4LFBL 2B29A 4LF8Q 2N78A 4XIGS 2IX1A 2K50A 2YTVA 3PIOA 3HOVH 2F52A 3RN5A 1RL2A 1B70B 5IYCG 4JI8L 1KD1C 5M5YH 3PUYA 3PIPA 1WCMG 3K0XA 1WFQA 1YBYA 2ZM6Q 1E1OA 1SN8A 2EIFA 1YEZA 3CC7A 1U5KA 2PI2E 4A3FG 3HKZG 3PCOB 1B7YB 4MZ9A 1QUQA 3NENA 4DV3Q 3KLWA 5LMUQ 5IE8A 4R4QA 3AEVA 2MNAA 2PQAB 3S1QH 2VUMH 3EBEA 3HOXG 4QL5A 4MTNA 4GOPB 1XMQL 1EIYB 2Z0SA 2XGTA 3LGJA 4LNQA 4A3GH 1BVSA 3UDIA 1EUJA 4RMFA 4X64Q 1EQRA 2MQHA 2K5VA 3KF6B 4LFAQ 1VQJA 1X54A 1VS0A 2YTXA 1PH3A 1TWGH 3AQQA 1VQ9A 4JV5L 1KXLA 4IOCA 3ERSX 1U0LA 5IYBG 2K75A 4JBKA 4DR1L 1YVCA 3UE1A 4JYAL 2UUAQ 2KHJA 5IP7G 4P73A 4DR4Q 1UE6A 1V1QA 2UXCL 5IYCH 4YY3Q 2OTLA 4DV5Q 1WCMH 1IYJB 5GAGC 1Y1WG 1UEBA 2IT1A 2PI2A 2QA4A 1QUQB 3S2HH 2L15A 4A3FH 1TWFH 2NN6G 2N49A 3PUWA 4NXML 1FGUA 3NBHB 4LFCL 1PH2A 3CCMA 1I94Q 2KBNA 4GNXC 1LTLA 4DV7L 3OYYA 4X65L 5DLQE 3HOXH 5M3FG 4JI1L 2JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 c;  3BU2 A;  1LYL A;  3CCJ A;  2OQ0 A;  4A76 A;  4JI6 Q;  2N3S A;  4K0K Q;  3CCR A;  3KF8 B;  2WAQ E;  4GKJ L;  4AYB G;  4X62 Q;  4L5S A;  4LUZ A;  3J80 c;  2UUB L;  3FP9 A;  5IYB H;  1Q86 C;  5IWA Q;  2VQF Q;  4LF6 Q;  4DR7 Q;  2BA0 A;  5IP7 H;  1HH2 P;  1SRU A;  1UE1 A;  2B63 G;  4DV4 Q;  4XTC S;  1VQ5 A;  4H02 A;  1VQK A;  2UXD Q;  4LF4 Q;  1Q8K A;  1Y1W H;  3U4V A;  3ULL A;  3L7Z C;  1VQI A;  2QGQ A;  3H15 A;  4JI0 L;  1SLJ A;  1M1K C;  1WJJ A;  2WFW A;  2ATW A;  4KHP L;  3E9H A;  1QZG A;  3ULP A;  2E2H H;  5FLM G;  5C4J H;  3A5U A;  1GKH A;  4AQY L;  1SRO A;  1XMO L;  1PH4 A;  1NMF A;  4O0A A;  1PH6 A;  1RIP A;  4OX9 L;  3I4O A;  2I5H A;  1Q1B A;  4DK3 C;  5H1S E;  5M3F H;  4BBS G;  2Z6K A;  5HGQ A;  4JI8 Q;  2AWN A;  1SE8 A;  2A8V A;  2I5M X;  4OON A;  3H3V I;  3J7Z C;  4DV6 L;  2CWA A;  4L5T A;  4JI3 L;  1E7Z A;  1E1T A;  1WOC A;  1YHB A;  1C9O A;  1MIU A;  3SGI A;  5M5W H;  4ALP A;  2ES2 A;  4X6A H;  4B3T L;  4BXX G;  3VDY A;  2ID0 A;  1KAW A;  4FDB A;  1XTD A;  2A1A A;  5C0X J;  1K8G A;  4JBM A;  2B63 H;  3S1M H;  3HOZ H;  1E3P A;  4NXN L;  3K7A H;  3CW2 C;  3PUV A;  3PUZ A;  3S14 H;  3PO3 G;  3M9B A;  3CQZ H;  2ZTE A;  3K8A A;  3T1H Q;  1VQO A;  2JA6 G;  3HOW G;  1W2B A;  4DR5 L;  3U58 A;  1V43 A;  1XMQ Q;  2UXB Q;  4RG1 A;  4GN4 B;  3GTG H;  1X56 A;  4KI0 A;  5FLM H;  3G4S A;  3GTP H;  1N34 L;  3M7N A;  4JV5 Q;  2JA5 G;  4LF5 L;  4JCV E;  3CCU A;  4LF6 L;  1PH1 A;  4DR1 Q;  1K73 C;  2AHO B;  4JC0 A;  4JYA Q;  2ZTD A;  1A8V A;  4DKA C;  2E8G A;  1VQD A;  2UXC Q;  4IPH A;  2HIV A;  5JEA G;  4OWX B;  1SMX A;  2MO1 A;  4GLA C;  3CPW A;  1V9P A;  3UDX A;  1PH8 A;  2HT1 A;  1Z9F A;  4P72 A;  2BH8 A;  2QEX A;  3H0G H;  1BKB A;  3EIV A;  2E5L L;  4JI5 L;  5EAY A;  4KHZ A;  5GAE C;  2CQO A;  4UPA A;  1Z47 A;  4DK6 C;  1L2F A;  1YHA A;  3RLF A;  4A3I H;  1GM5 A;  4NXM Q;  4B3R L;  1EIF A;  3F1Z A;  3PO3 H;  1KQS A;  1IBL L;  1CSP A;  3F2D A;  4DV7 Q;  2JA6 H;  4X65 Q;  1EFW A;  1JT8 A;  4B3M L;  4JI1 Q;  5J3B A;  4PZ7 A;  5LMN W;  3CCL A;  1VQE A;  3RN2 A;  1IBK L;  1UE5 A;  2D0O A;  2ZJP A;  2WAQ G;  1EYG A;  1WYD A;  1W3S A;  4IOA A;  2PMZ E;  2YV5 A;  4GKJ Q;  2JA5 H;  3CCE A;  2B3G A;  4GOP C;  2UUB Q;  3UE0 A;  1YZ6 A;  3A74 A;  2GVA A;  3A0J A;  5M3M G;  3U50 C;  2D62 A;  4C2M H;  4OWT B;  1IZ6 A;  3OTO L;  3CXC A;  1VQM A;  3ER0 A;  1OTC A;  2GVB A;  3IRB A;  4QJF A;  1QZH A;  1PFS A;  3T1H L;  2NVT H;  1KRS A;  3JC6 6;  3PV0 A;  4IPD A;  1KC8 C;  2VUM G;  4AH6 A;  4QY7 A;  4JI0 Q;  4ME3 A;  5JJI A;  4GKK L;  2Q2T A;  1YNX A;  4KHP Q;  2UXB L;  3CF5 A;  5IYD H;  3S2D H;  1IBM L;  1KIX A;  1B8A A;  5LMN L;  1VQF A;  4JI7 L;  4B3M Q;  2IHF A;  4DR6 L;  4AQY Q;  4IFD I;  3KOJ A;  1XMO Q;  2Y0S E;  1NE3 A;  2VL6 A;  4PZ6 A;  4DR2 L;  4OX9 Q;  1K83 H;  1A0I A;  3K7U C;  3H3V H;  3E9I A;  4HID A;  1TWA H;  4A4I A;  4HIO A;  1KL9 A;  3CPF A;  4P75 A;  2R7Z G;  2I5L X;  5AJ3 L;  1Y1V G;  2DUD A;  2CWP A;  3S24 A;  3STB C;  1YJ9 A;  4DV6 Q;  4A3K G;  1R9T H;  4JI3 Q;  3TRZ A;  1S3O A;  1JB7 A;  5M3M H;  1E24 A;  1L1O A;  4NB3 A;  5C44 G;  5FJ8 H;  1JMC A;  4B3T Q;  4A3D G;  3GTM H;  2NVQ H;  1G6P A;  5IY0 A;  4P74 A;  4NXN Q;  3I56 A;  2AWO A;  1S72 A;  2MFI A;  4IJH A;  3AFQ A;  4A3M G;  1YJW A;  1LUZ A;  2A19 A;  4DAM A;  3E0E A;  4DR5 Q;  1K3R A;  2OQK A;  4B3S L;  2F4V L;  3I4M G;  2V1C C;  4QQB X;  5JJL A;  3CME A;  3D0F A;  1N34 Q;  3JAM i;  3TS0 A;  1XJV A;  1X3E A;  3RLO A;  1FJG Q;  4LF5 Q;  2ZJR A;  3STB D;  1Q7Y C;  3TQY A;  1D7Q A;  3KJO A;  3NEM A;  5JJK A;  4A3G G;  2JJQ A;  2LSS A;  3G71 A;  3HOZ G;  4A3E G;  1J6Q A;  1O7I A;  3CCS A;  2R7Z H;  4IFD G;  2NZH A;  1IXR A;  1OXS C;  1Y1V H;  1NMG A;  3FKI G;  1XNQ L;  1XPU A;  5FLX c;  4LWC A;  1L1O B;  3Q8D A;  4A3K H;  1CUK A;  1VQ6 A;  4WJ3 M;  4X66 L;  4IO9 A;  5C44 H;  2E5L Q;  1VQH A;  1KHI A;  4JI5 Q;  4A3D H;  2JA8 G;  3KFU A;  4YHH L;  1VQN A;  1I50 H;  4B3R Q;  2ALY B;  3TRE A;  3ICE A;  2CCZ A;  1JJG A;  3HOU G;  2JEB I;  1IBL Q;  4A3M H;  2VZA A;  1CKN A;  1VQL A;  5BR8 L;  1PHJ A;  3I4M H;  4JBW A;  3L2P A;  1UWV A;  1IBK Q;  4JG2 A;  3RZD H;  3M4Q A;  1GVP A;  4HJ8 A;  3T1Y L;  5GQO A;  1X55 A;  2RCN A;  1N33 L;  3CP0 A;  3H0G G;  3J81 j;  4OO1 I;  2K14 A;  4UY8 C;  1MJC A;  4MNO A;  4R4O A;  3OTO Q;  2UUC L;  4LF7 L;  4A3E H;  1UE7 A;  4A3I G;  3PGZ A;  1HZB A;  2MO0 A;  1AH9 A;  2Z6K C;  3FKI H;  1PH7 A;  4EQ5 A;  1G51 A;  2KCM A;  3PO2 G;  2F3I A;  4GN3 B;  3S15 H;  1HNX L;  3M3Y H;  4GKK Q;  2AKW B;  1J5E L;  3MXN B;  2K5N A;  2R7F A;  3ZJY C;  1IBM Q;  5LMN Q;  4JI7 Q;  1FVI A;  2Y0S G;  2JA8 H;  4DR6 Q;  4YWK A;  4DR2 Q;  2NVX H;  1FJG L;  1K8A C;  3HOU H;  1CKN B;  2VW9 A;  2VQE L;  1X3G A;  2H5X A;  2JEA I;  3CCV A;  3GO5 A;  4QGU A;  1I3Q H;  4LUO A;  4HIM A;  1TWH H;  2Q2H A;  3M85 A;  1GO3 E;  1VQG A;  4DNI A;  3J7A 5;  1E22 A;  4KLK A;  5AJ3 Q;  2K52 A;  1M90 C;  5JEA J;  3HFZ B;  4A75 A;  1NJI C;  3I7F A;  2YU9 H;  2IHE A;  2JQO A;  3TEH B;  5IYD G;  4YCW A;  1Y14 B;  2D0P A;  4LUV A;  4Y52 H;  1QVF A;  2BA1 A;  4JI2 Q;  2LXK A;  4A3C H;  3NEL A;  3PF4 A;  4JOI A;  3PO2 H;  3M4P A;  2DGY A;  4EX5 A;  4HJA A;  1PV4 A;  1PYS B;  4B3S Q;  2AMC B;  1XPR A;  1D8L A;  2F4V Q;  4OO1 G;  4A3L G;  4BY7 G;  2R7D A;  1OXV A;  1Q12 A;  4A93 G;  4GLV B;  2VY3 A;  2XTI A;  3K80 C;  1P8L A;  1HZA A;  4R4C A;  4DUZ L;  1S40 A;  2VS1 A;  3GTO H;  1OXT A;  3I55 A;  2LXJ A;  3DLL A;  4L5R C;  1PVO A;  2C35 B;  4DV2 L;  1OXX K;  3K81 C;  5FJ8 G;  3W1G A;  4BY1 G;  1VQ7 A;  2KEN A;  1HJP A;  4POF A;  4PZ8 A;  3WWV A;  1XNQ Q;  1BBU A;  4DUY L;  2N8N A;  1MJE A;  4L5Q A;  4X66 Q;  4HJ9 A;  2NN6 I;  4HIK A;  5HY6 A;  1HZC A;  1DGS A;  3G48 A;  4YHH Q;  3W1B A;  4DV1 L;  1HNW L;  1A63 A;  2CKZ B;  2YYZ A;  3J80 i;  2WP8 J;  1SFO H;  4BA1 I;  2R93 G;  1K0R A;  2ASB A;  2EQS A;  3EN2 A;  3W5O A;  3F8T A;  3G6E A;  5BR8 Q;  4A3J G;  1HNZ L;  4BY7 H;  4A3L H;  2CFM A;  5C3E G;  4IJL A;  3UDG A;  3BZC A;  1VQ4 A;  4A93 H;  2WB1 E;  1T9H A;  3T1Y Q;  1VQP A;  1HR0 L;  4DR3 L;  2VNU D;  1VQB A;  4BBR G;  1JJ2 A;  1N33 Q;  3RR5 A;  1NBW A;  2UUC Q;  2OWO A;  4BY1 H;  4LF7 Q;  4LF9 Q;  1N32 L;  3B6Y A;  1Q81 C;  4JI2 L;  1JE5 A;  1N36 L;  1I5F A;  1KRT A;  1K9M C;  4NPS A;  4HJ7 A;  2RHQ B;  4YCU A;  2RF4 A;  3RZO H;  2OTJ A;  3KYH C;  4O2D A;  1HNX Q;  3L0O A;  2UU9 L;  4GNX A;  1EQQ A;  1J5E Q;  4C3H H;  1AE3 A;  1Q46 A;  4JBJ A;  1L1O C;  1H95 A;  2R93 H;  1QVG A;  1JJC B;  5K36 G;  4DAY B;  4DV0 Q;  1XPO A;  2VQE Q;  4POG A;  2NVY H;  1EOV A;  2HHH L;  4A3J H;  1G29 1;  1YI2 A;  1SR3 A;  5C3E H;  3CCQ A;  1VCI A;  1XNR L;  3AFP A;  4J15 A;  2HIX A;  4BBR H;  4WJ4 A;  2JA9 A;  4P71 A;  1N8R C;  1VQA A;  3GDE A;  3UDF A;  5C0X I;  1YIT A;  4LF8 L;  4IFD J;  5ELN A;  3I4N G;  3M4O H;  1P16 A;  4C3J H;  1ASY A;  1AE2 A;  1Q1E A;  2R92 G;  4YWM A;  1YIJ A;  2E2I H;  1TXY A;  3PSI A;  3RNU A;  2JA7 G;  4JI4 Q;  3TS2 A;  1NY4 A;  2JE6 I;  2ZM6 L;  2EXD A;  1PYB A;  2IX0 A;  2ZJQ A;  4GNX B;  3ULJ A;  4OWW B;  2ZTC A;  4DV3 L;  2HQL A;  3HKZ E;  5E7N A;  5LMU L;  4GLX A;  1C0A A;  3CMA A;  1X9N A;  2YTY A;  1CKO A;  1MKH A;  4HJ5 A;  4TQU S;  3CC4 A;  4OXP A;  4DUZ Q;  2KCT A;  5C4X G;  3S1N H;  2I0Q A;  5GAD C;  4DV2 Q;  2Q2U A;  4YCV A;  1X65 A;  1EWI A;  3KJP A;  4LF9 L;  1WI5 A;  4X64 L;  4PG3 A;  1GD7 A;  1TWC H;  1BBW A;  5GAH C;  3J81 i;  1PA6 A;  4LFA L;  1FL0 A;  4IPG A;  3S16 H;  2K4K A;  5IP9 G;  4A3C G;  1QVC A;  1A62 A;  2Q2I A;  1YJN A;  4DUY Q;  4R4T A;  4LFB Q;  3I4N H;  2UUA L;  4DR4 L;  1CSQ A;  2KHI A;  2BH2 A;  2R92 H;  1PH5 A;  3KDF A;  1LM0 A;  4YY3 L;  5M5X H;  1HNW Q;  2JA7 H;  4DV1 Q;  1X3F A;  4DV5 L;  2E2J H;  4A3B G;  1OXU A;  3MEF A;  3JAM c;  4DV0 L;  3HOY G;  5C0X G;  4DPG A;  3GTQ H;  1VQC A;  1NTG A;  1CKM A;  1HNZ Q;  4QIW E;  1C7Y A;  2WB1 G;  3FHW A;  4Y7N H;  3F2C A;  4UP9 A;  3BJU A;  1YHQ A;  1I94 L;  1HR0 Q;  4DR3 Q;  3CC2 A;  3S17 H;  4YWL A;  3GTJ H;  3S1R H;  2IY5 B;  3A5Z B;  5C4X H;  3DM3 A;  2RHS B;  2OCE A;  3AYH B;  3D31 A;  4PMW A;  4JI6 L;  3HOV G;  4UP8 A;  1I6H H;  4K0K L;  5GRO A;  1N32 Q;  3CD6 A;  3GTL H;  4JI4 L;  5IP9 H;  4X62 L;  1N36 Q;  4GS3 A;  4LW1 A;  3RLN A;  4AYB E;  4BA2 I;  2NZO A;  3U4Z A;  5IWA L;  2VQF L;  3HKS A;  1X6O A;  2R6G A;  4GN5 A;  4DR7 L;  1VQ8 A;  3CAM A;  3KDF B;  4IPC A;  2FXQ A;  3OW2 A;  2UU9 Q;  4BBS H;  4C3I H;  2PNH A;  4DV4 L;  3PUX A;  4APV A;  2UXD L;  4A3B H;  3BZK A;  4LF4 L;  3F2B A;  3I2Z A;  1HZ9 A;  3PF5 A;  4UP7 A;  3HOY H;  2PQA A;  1IL2 A;  2K5H A;  2HHH Q;  4R1J A;  3GD7 A;  4AIM A;  4BXX H;  1Q82 C;  4JOI C;  1PH9 A;  4GOP A;  1ASZ A;  1HR0 W;  1XNR Q;  1L0W A;  3J81 c;  4LFC Q;  2GN5 A;  3KF6 A;  1N9W A;  4R4I A;  4TVA B;  3GTK H;  3HOW H;  5ELO A;  4LFB L;  2B29 A;  4LF8 Q;  2N78 A;  4XIG S;  2IX1 A;  2K50 A;  2YTV A;  3PIO A;  3HOV H;  2F52 A;  3RN5 A;  1RL2 A;  1B70 B;  5IYC G;  4JI8 L;  1KD1 C;  5M5Y H;  3PUY A;  3PIP A;  1WCM G;  3K0X A;  1WFQ A;  1YBY A;  2ZM6 Q;  1E1O A;  1SN8 A;  2EIF A;  1YEZ A;  3CC7 A;  1U5K A;  2PI2 E;  4A3F G;  3HKZ G;  3PCO B;  1B7Y B;  4MZ9 A;  1QUQ A;  3NEN A;  4DV3 Q;  3KLW A;  5LMU Q;  5IE8 A;  4R4Q A;  3AEV A;  2MNA A;  2PQA B;  3S1Q H;  2VUM H;  3EBE A;  3HOX G;  4QL5 A;  4MTN A;  4GOP B;  1XMQ L;  1EIY B;  2Z0S A;  2XGT A;  3LGJ A;  4LNQ A;  4A3G H;  1BVS A;  3UDI A;  1EUJ A;  4RMF A;  4X64 Q;  1EQR A;  2MQH A;  2K5V A;  3KF6 B;  4LFA Q;  1VQJ A;  1X54 A;  1VS0 A;  2YTX A;  1PH3 A;  1TWG H;  3AQQ A;  1VQ9 A;  4JV5 L;  1KXL A;  4IOC A;  3ERS X;  1U0L A;  5IYB G;  2K75 A;  4JBK A;  4DR1 L;  1YVC A;  3UE1 A;  4JYA L;  2UUA Q;  2KHJ A;  5IP7 G;  4P73 A;  4DR4 Q;  1UE6 A;  1V1Q A;  2UXC L;  5IYC H;  4YY3 Q;  2OTL A;  4DV5 Q;  1WCM H;  1IYJ B;  5GAG C;  1Y1W G;  1UEB A;  2IT1 A;  2PI2 A;  2QA4 A;  1QUQ B;  3S2H H;  2L15 A;  4A3F H;  1TWF H;  2NN6 G;  2N49 A;  3PUW A;  4NXM L;  1FGU A;  3NBH B;  4LFC L;  1PH2 A;  3CCM A;  1I94 Q;  2KBN A;  4GNX C;  1LTL A;  4DV7 L;  3OYY A;  4X65 L;  5DLQ E;  3HOX H;  5M3F G;  4JI1 L;  2JK8 A; 
#chains in the Genus database with same CATH topology
 3BU2 A;  3GTL B;  3GTP B;  2J4X A;  3J80 L;  4AYB G;  4X62 Q;  1Q90 A;  3J80 c;  2F1M A;  5IYB H;  3W3A A;  5IWA Q;  1X32 A;  5NUC A;  1BCP D;  2BA0 A;  1SRU A;  1VQK A;  4H02 A;  1Y1W H;  3IL8 A;  1M1K C;  1SSO A;  1QZG A;  5C4J H;  2X6L A;  4AQY L;  1SRO A;  1QOH A;  1PH6 A;  1RIP A;  1F9R A;  2I5H A;  1Q1B A;  4IUR A;  2AWN A;  5EBC A;  3NTK A;  2A8V A;  2I5M X;  4OON A;  4C2M B;  3I3C A;  4L5T A;  1GXD C;  1C9O A;  2ES2 A;  4ALP A;  3A8K E;  2WV6 D;  4IN3 A;  2B2V A;  4CJ0 B;  4JBM A;  3P1H A;  2B63 H;  1JOO A;  1F2Z A;  1E3P A;  1W6J A;  3K7A H;  3PO3 G;  4UDU C;  1WTH A;  2ZTE A;  3CQZ H;  3K8A A;  1VQO A;  1TVX A;  2JA6 G;  2XRS D;  1NUC A;  3S2D B;  3DHQ A;  1V43 A;  3J81 E;  4MTK A;  4RG1 A;  4RGN A;  4K2L A;  1X56 A;  4KI0 A;  3GTG H;  5FLM H;  1LTR D;  4LF5 L;  2G9D A;  1DON A;  5CV8 A;  4LF6 L;  2KED A;  4RCO A;  2RSO A;  1G6Z A;  1AW7 A;  2MO1 A;  3S2H B;  3H0G H;  1BKB A;  1CHQ D;  5D3I B;  4PNY A;  4JI5 L;  4KHZ A;  5GAE C;  1L0X B;  2K1B A;  4UPA A;  3KLR A;  1YHA A;  3RLF A;  4A3I H;  1I4R A;  2VUM B;  3IAY A;  1KQS A;  4DV7 Q;  1CK1 A;  1VQE A;  2D0O A;  2Z1C A;  2PMZ E;  3K5M A;  4GOP C;  1H9S B;  1ROD A;  4KMU C;  2D62 A;  4OWT B;  1IZ6 A;  3I72 A;  1Y1V B;  4NMZ A;  1F77 A;  5JEA H;  3IRB A;  4QIW B;  1KC8 C;  4L6T B;  1HQM C;  1YNX A;  2UXB L;  1I50 B;  3CF5 A;  2ZXO A;  2TSS A;  2IHF A;  4AQY Q;  3KOJ A;  2Y0S E;  4PZ6 A;  1QNU A;  3I4M B;  3T4A C;  3E9I A;  4HID A;  4B08 A;  1Y8N B;  4HIO A;  1KL9 A;  4AYB B;  4HAE A;  2R7Z G;  3SXH A;  3I73 A;  2DUD A;  1BOS A;  2HD3 A;  1L1O A;  4NB3 A;  5C44 G;  5EQ0 A;  1PRT D;  3R2I A;  4A3D G;  5FLX E;  1FNW A;  1TKW B;  2JN4 A;  1CA6 A;  4A3M G;  1MHW C;  1RHP A;  3D0F A;  1LAB A;  3BVG A;  1HFG A;  1XTC D;  4LF5 Q;  1D7Q A;  3KJO A;  4A3G G;  4I65 A;  2LSS A;  3HOZ G;  4A3E G;  1J6Q A;  4N9P A;  1LTI D;  1K0S A;  3W2D A;  1OXS C;  1MSH A;  3C2P A;  4LWC A;  3Q8D A;  1CUK A;  4MN3 A;  1S4Z A;  3TZU A;  3DM1 A;  1VQH A;  4JI5 Q;  3KFU A;  4YHH L;  3PO2 B;  3D6C A;  3HOU G;  1W6K A;  2JEB I;  3Q0A A;  2PW5 A;  4IUP A;  1PHJ A;  1LTS D;  1VF5 C;  2NUC A;  4JG2 A;  3RZD H;  2NBF A;  4TSS A;  3C3L A;  4UY8 C;  4R4O A;  3PIO 3;  2UUC L;  3ND8 A;  5E3F A;  2B2W A;  2J0T D;  3PIP 3;  1S5C D;  1PH7 A;  1G51 A;  1QJO A;  2VB2 X;  4GN3 B;  3S15 H;  3K59 A;  1HNX L;  3ITP A;  1J5E L;  3MXN B;  1DZ1 A;  1FJG L;  3BYY B;  1CKN B;  2QDB A;  3SK4 A;  1U4R A;  2H5X A;  3NHH A;  1I3Q H;  4LUO A;  4G57 A;  2K7V A;  5C3X A;  4KKT A;  2MJ8 A;  5JEA J;  2E74 C;  3ERO A;  2YU9 H;  5IYD G;  3TEH B;  1GUG A;  3A8J E;  4DU9 A;  3N52 A;  1SNP A;  5JVG 3;  3H91 A;  3NEL A;  4JOI A;  1MBY A;  1PV4 A;  5AFW A;  2AMC B;  4BY7 G;  4U68 A;  3EFX D;  4CBV A;  1PTO C;  2R93 B;  2VY3 A;  2XTI A;  2QF7 A;  3OOC A;  1HZA A;  2VS1 A;  2XIW A;  4PMC A;  1OXT A;  3I55 A;  2SDF A;  2C35 B;  3MFY A;  1BNZ A;  5C4Z A;  5C6A A;  1E0B A;  3L9A X;  4FP5 D;  1EWH A;  1UUP A;  1O7L A;  3R93 A;  4PZ8 A;  5C44 B;  1O7Y A;  3A56 A;  1EU4 A;  2F0V A;  3BDL A;  5HY6 A;  1DGS A;  3HZX A;  4YHH Q;  5EKL A;  1HNW L;  1ET9 A;  5ELE A;  5A2Q E;  1SFO H;  2A6E D;  3V96 A;  3EN2 A;  3W5O A;  3F8T A;  4DAY A;  5J39 A;  1KDC A;  4A3L H;  1QB5 D;  4IJL A;  1RTO A;  4EQO A;  2WB1 E;  1O78 A;  1T9H A;  1VQP A;  4DR3 L;  1VQB A;  4BBR G;  1EYA A;  1JJ2 A;  1EQT A;  5T1G A;  2UUC Q;  2QEJ C;  2OWO A;  4C3J G;  3B6Y A;  1Q81 C;  4JI2 L;  2NB0 A;  1JE5 A;  1YNN C;  3E3X A;  1K9M C;  4NPS A;  1WTO A;  2RCF A;  5E4W C;  2BDO A;  4I7Z C;  4C1N I;  1HNX Q;  1EQQ A;  1J5E Q;  4C3H H;  2E2J B;  3HOU B;  2VB3 X;  1RCV D;  4BWG B;  2NWG A;  1QVG A;  1BBX C;  4DV0 Q;  1JWS D;  1G29 1;  2F0D A;  1YI2 A;  1SR3 A;  5C3E H;  1XNR L;  2OT2 A;  1PYW D;  5KGU A;  4P71 A;  1N8R C;  1VQA A;  3UDF A;  1ILQ A;  5EPL A;  2R92 G;  1STA A;  4N8X 1;  4YWM A;  1YIJ A;  3TS2 A;  3TP6 A;  2JE6 I;  4IUV A;  2DJG C;  1SYG A;  1PYB A;  2IX0 A;  2ZJQ A;  3T53 B;  3ULJ A;  3HKZ E;  3JAM E;  3HOY B;  1XX8 A;  5HGT A;  5K36 H;  1ENA A;  3S1N H;  1FGB D;  5GAD C;  2Q2U A;  3GQB A;  3SK8 A;  4EVO A;  1O80 A;  2C9O A;  1WI5 A;  4X64 L;  3KJP A;  1TWC H;  1PA6 A;  1BBW A;  3J81 i;  4LFA L;  2F0E A;  3S16 H;  5IP9 G;  1QVC A;  1YJN A;  4R4T A;  3A54 A;  1QWY A;  1HA6 A;  1CSQ A;  5M5Y B;  4HSP A;  3NQI A;  1G91 A;  1LM0 A;  4YY3 L;  2AQ1 B;  2JA7 H;  1HNW Q;  3G6J B;  3MEF A;  4R8I A;  2LKV A;  1QE6 A;  4QIW E;  4KJO A;  2XWJ B;  3S1Q B;  4UP9 A;  3BJU A;  4DN4 M;  4DR3 Q;  3CC2 A;  3K0Y A;  4F8M A;  3S1R H;  3URY A;  2KEE A;  4PMW A;  3FPP A;  1ZKO A;  4UP8 A;  4XQQ A;  3RD4 A;  1JB3 A;  4GZY C;  3RZO B;  1A2U A;  1BXT A;  3RLN A;  4AYB E;  2B2T A;  3HKS A;  1X6O A;  4IPC A;  5ELC A;  1X3P A;  4C3I H;  2D5D A;  1HZ9 A;  4A3F B;  3PF5 A;  4QMG A;  5C0X H;  5CV4 A;  1O7Z A;  3MHB A;  1Q82 C;  4GOP A;  1XNR Q;  4BBR B;  5KND A;  1HUN A;  5IOC A;  4LFC Q;  1N9W A;  4R4I A;  3M4O B;  2N78 A;  4C3J B;  1WTX A;  3PIO A;  3T13 A;  1EY5 A;  2HUG A;  5IYC G;  1TS4 A;  1KD1 C;  1U9R A;  4ZRZ A;  3PIP A;  2O5I C;  1EIH A;  1LTG D;  4LAA A;  1E1O A;  3CC7 A;  2PI2 E;  2IWH A;  1LT5 D;  3PCO B;  3E5S A;  1EY0 A;  5IE8 A;  5JOB A;  1GOZ A;  1LTB D;  4XXE A;  4QL5 A;  4MTN A;  5C4J B;  1CQV A;  1DOL A;  2XGT A;  4ABN A;  3O13 A;  4HMJ A;  4X64 Q;  1EQR A;  4LFA Q;  1AZP A;  4JV5 L;  4LK1 C;  1K28 A;  4CKB A;  4IOC A;  3ERS X;  3A7L A;  4DR1 L;  3UE1 A;  4WRD A;  4JYA L;  3QR8 A;  1UE6 A;  2MHV A;  3X3N A;  2DJF C;  4OIJ A;  3J80 E;  2UXC L;  5FO9 B;  4YY3 Q;  1SYF A;  1LO5 D;  2PI2 A;  1PFM A;  1BCP C;  4Y7N B;  1TWF H;  2NN6 G;  5KYL A;  2B63 B;  3K7A B;  1SJE D;  4NXM L;  3CQZ B;  1FGU A;  3CCM A;  4OHJ A;  4XDX A;  4RAU C;  1I6H B;  2DNC A;  3HOX H;  1K3B C;  5IT9 L;  5M3F G;  4JI1 L;  5IT9 c;  1SMY D;  2FIN B;  3CCR A;  3KF8 B;  2PZT A;  3MWY W;  2PPB C;  4LUZ A;  4BBS B;  3I8Z A;  5C5M A;  1QNK A;  5IP7 H;  4IUQ A;  1VMC A;  4XTC S;  1ESR A;  2SNS A;  3U4V A;  2ENB A;  1VQI A;  3H15 A;  4JI0 L;  2OXP A;  1PTO H;  3ZYY X;  5KRU A;  1WJJ A;  4KHP L;  2ATW A;  2L9H A;  2E2H H;  3A5U A;  4B3M L;  5KNB A;  3HOW B;  1PH4 A;  1NMF A;  1SYC A;  4OX9 L;  2XSC A;  4OIK A;  4PMB A;  4ZLT F;  1IYU A;  3MTS A;  4RGM A;  2IX3 A;  1Y8P B;  1JOQ A;  4LMQ D;  2AUJ D;  3J7Z C;  4DV6 L;  4PQX A;  1YHB A;  5M5W H;  1T5X D;  5IGC A;  5C0X J;  4A3G H;  1CA5 A;  3HOZ H;  4G4K A;  4NXN L;  3M7G A;  2LMC B;  1F9S A;  3T1H Q;  1MGS A;  1IW7 C;  5K5P A;  1F9P A;  4GN4 B;  2F3V A;  2Q8R E;  1B3A A;  1N34 L;  4UHV A;  4JV5 Q;  2E76 C;  3CCU A;  1PH1 A;  4DR1 Q;  2AHO B;  1STY A;  4JYA Q;  1RD9 D;  3OWF A;  4DKA C;  1VQD A;  2UXC Q;  2HIV A;  1NNX A;  1V9P A;  2HT1 A;  2KEC A;  1Z9F A;  4P72 A;  3EIV A;  5ELD A;  5EAY A;  1GHK A;  2CQO A;  1Z47 A;  1EY9 A;  3DWA A;  1DJR D;  1L2F A;  1PZJ D;  4ZCK A;  4NXM Q;  3WDN A;  1EIF A;  3F1Z A;  1CSP A;  2K01 A;  4ZQ3 A;  3F2D A;  3VR2 A;  1JT8 A;  3G7L A;  4JI1 Q;  5J3B A;  4PZ7 A;  2ZJP A;  2WAQ G;  4IOA A;  2JA5 H;  2B3G A;  3UE0 A;  5KYI A;  3A0J A;  4QUF A;  2M9V A;  3ER0 A;  4K6L A;  1H9R A;  1D5X C;  4QJF A;  1QZH A;  2NVT H;  2VUM G;  1CQF A;  4WFN 3;  4QY7 A;  4JI0 Q;  4ME3 A;  5JJI A;  4GKK L;  2Q2T A;  4KHP Q;  3QB3 A;  5IYD H;  5I6W A;  3QOL A;  4B3M Q;  1NE3 A;  2VL6 A;  4OX9 Q;  1K83 H;  1A0I A;  2CH4 A;  3HS0 C;  1TWA H;  3RZD B;  1PRT B;  4KJN A;  5ELF A;  2F0W A;  2FMM A;  2I5L X;  3S9W A;  5AJ3 L;  1Y1V G;  1F9Q A;  2CWP A;  3FDT A;  1R9T H;  1JCK B;  4DV6 Q;  3TRZ A;  5CGK A;  3SE0 A;  1JB7 A;  5M3M H;  1SNM A;  1A3T A;  3GTM H;  3BVM A;  2K28 A;  1STE A;  5DM7 3;  3KBG A;  4NXN Q;  5KIX A;  3I56 A;  2AWO A;  3J7A F;  2A6H D;  1TR5 A;  1B3Q A;  2HDL A;  3I91 A;  5CBA E;  4B3S L;  3I4M G;  1K3R A;  2F4V L;  5BN4 A;  4QQB X;  5JJL A;  4KN7 C;  2RBM A;  1AN8 A;  1N34 Q;  3JAM i;  1I4Q A;  2ZJR A;  3KLS X;  3KK7 A;  3G71 A;  2AUK A;  1IXR A;  4J8Q A;  1LTA D;  1XNQ L;  4A3K H;  1VQ6 A;  4WJ3 M;  3C46 A;  5BN5 A;  1BDO A;  1GHJ A;  4IO9 A;  2JA8 G;  3MXG A;  1G2T A;  3KUP A;  3QWN A;  2JYO A;  4ZKC B;  1C4Q A;  1JJG A;  4DK0 A;  2F0S A;  2NYZ D;  5DAU A;  2VZA A;  4K8I A;  5CV7 A;  1CT1 D;  1GVP A;  1B4O A;  2BCO A;  1X55 A;  5FO7 B;  3CP0 A;  4MNO A;  4XQJ A;  1EY4 A;  3PGZ A;  1HZB A;  4IFD H;  1AH9 A;  4L8J A;  2F4I A;  3FKI H;  2EE1 A;  2O4X A;  4EQ5 A;  2KCM A;  3IKJ A;  1VF7 A;  4JPB W;  3PO2 G;  1BR9 A;  4GKK Q;  5JPN C;  2F0U A;  2R7F A;  2V4D A;  1FVI A;  1SFO B;  5EGT A;  1CZW A;  3OMG A;  2A68 C;  1X3G A;  3CCV A;  3GO5 A;  4QGU A;  2WAQ B;  1TWH H;  3M85 A;  1GO3 E;  1VQG A;  2BE5 D;  3J7A 5;  1E22 A;  5AJ3 Q;  1SE4 A;  4FNF A;  2NVQ B;  3HFZ B;  4A75 A;  1NJI C;  3I7F A;  2IHE A;  2JQO A;  1WTW A;  2EYH A;  1Y14 B;  2B2T C;  1ZXT A;  2EYL A;  2LXK A;  3PF4 A;  1SNO A;  2DGY A;  4B3S Q;  1B2T A;  2F4V Q;  2R7D A;  1OXV A;  2AQ2 B;  1Q12 A;  4GLV B;  2EYP A;  4R4C A;  4DUZ L;  1S40 A;  2A6E C;  3GTO H;  3DWP A;  2LXJ A;  3D8G A;  3DLL A;  5C3E B;  4DV2 L;  3K81 C;  5FJ8 G;  4KN4 C;  4K2K A;  3IFT A;  4KK7 A;  2XN9 C;  2F0L A;  2KEN A;  1EY6 A;  2X6G A;  1Z6H A;  4POF A;  1XNQ Q;  3WWV A;  1BBU A;  4DUY L;  4DF7 A;  1VDZ A;  3PQI A;  3MXU A;  3RUZ A;  4HIK A;  1HZC A;  3G48 A;  1EL0 A;  4K5W A;  3TSS A;  2YYZ A;  4H13 C;  3J80 i;  2R93 G;  2ASB A;  1RDP D;  2EQS A;  4RH6 A;  2QIL A;  1MD2 D;  4OO1 H;  3K57 A;  1CTM A;  2KA7 A;  4A93 H;  1VQ4 A;  4DFA A;  2F0P A;  5IGF A;  3S1N B;  1E2V A;  2C5C A;  2QDL A;  3SR1 A;  1D1K A;  1I4P A;  1ONL A;  3T56 B;  4N8F A;  2JSO A;  4BY1 H;  4X3T A;  3S16 B;  1EY7 A;  2KOL A;  3QG1 A;  5I2Y A;  3E6Z X;  1KRT A;  5I9P A;  3M3Y B;  4HJ7 A;  1SXT A;  3I4L A;  4YCU A;  4HCS A;  2JA8 B;  2OTJ A;  2NZ1 D;  1TT2 A;  1YNJ D;  5LHY 1;  4JBJ A;  2K32 A;  1XPO A;  1M4V A;  2BOS A;  3WOF A;  4A3J H;  2PZW A;  1VCI A;  2CVR A;  5CC4 A;  1LT4 D;  4IAL A;  4WJ4 A;  2L55 A;  5C0X I;  1YIT A;  4IFD J;  5ELN A;  2DNE A;  4K5V A;  4J6H A;  3CHB D;  2KCC A;  1HA5 A;  1JWM D;  5COR A;  1TXY A;  2E2I H;  3RNU A;  2ZM6 L;  2EXD A;  1WTQ A;  4JVZ A;  3D4D A;  4GNX B;  2CW0 D;  2HQL A;  4K14 A;  5CMD A;  2EJM A;  2F0T A;  4GLX A;  2PW7 A;  3CMA A;  1X9N A;  1MKH A;  3CC4 A;  4TQU S;  4DUZ Q;  2QKI C;  4DV2 Q;  3H3V C;  1X65 A;  2NN6 H;  1PMR A;  1SYD A;  4KY7 A;  1GD7 A;  1IKL A;  4FXG C;  1FL0 A;  1NCV A;  2L4N A;  4IPG A;  3TP5 A;  1D2B A;  4RHR A;  4G7O C;  4DUY Q;  3VYS A;  4K8J A;  3KLS A;  3I4N H;  3VA5 A;  2UUA L;  1KAA A;  3K6O A;  4DA2 A;  2BH2 A;  3KDF A;  4S3S A;  4A3B G;  4YIJ A;  1S5D D;  4B9X A;  4DV0 L;  3HOY G;  1QG7 A;  4DPG A;  3GTQ H;  1HTP A;  1S5B D;  4FXD A;  1WTP A;  5CV6 A;  3K5N A;  1I94 L;  1B1Z A;  1U4M A;  1EZ8 A;  1M8A A;  3GTJ H;  3A5Z B;  5C4X H;  2RHS B;  1HCZ A;  1ZEQ X;  4JI6 L;  3HOV G;  5IGG A;  3ONA B;  2QCP X;  5GRO A;  3GTL H;  1GUW A;  3BVZ A;  2B8F A;  2NZO A;  5EKK A;  1FR3 A;  2VQF L;  1TS2 A;  2R6G A;  1EY8 A;  2SNM A;  4CHT B;  2EY5 A;  3CAM A;  2L1B A;  4DV4 L;  2UXD L;  2IPK D;  3BZK A;  4LF4 L;  3BDO A;  2PQA A;  1IL2 A;  1A3V A;  3GD7 A;  3R2T A;  5D3D A;  3U9S A;  3J81 L;  4DGZ A;  5DEH A;  3J81 c;  3HOX B;  4TVA B;  3BG3 A;  3NPP A;  5ELO A;  1D5M C;  1TY0 A;  2YTV A;  2CH4 W;  1AFP A;  2Z8L A;  4JI8 L;  3TZD A;  1WFQ A;  4ID6 A;  1UNS A;  2ZM6 Q;  1PTO F;  4RFB A;  4ZAI A;  4A3F G;  2F3W A;  3NEN A;  5E4X A;  3KLW A;  4JW0 A;  4R4Q A;  4WOR A;  4U67 3;  2CQA A;  3OW7 A;  3D3R A;  1EIY B;  2E2H B;  2Z0S A;  3LGJ A;  1PH3 A;  3IFD A;  3KF6 B;  3NTI A;  2K5V A;  2EY1 A;  1X54 A;  1VQ9 A;  1KXL A;  2I07 B;  4QF4 A;  5IYB G;  2K75 A;  1A6X A;  2UUA Q;  3D4W A;  5M5X B;  4P73 A;  1SYE A;  3HGB A;  3SK6 A;  1WCM H;  1Y1W G;  2RKS A;  1TS3 A;  1UEB A;  1QUQ B;  1UEA B;  3S2H H;  2N49 A;  5EKI A;  1G2S A;  4FVM A;  3NBH B;  4LFC L;  1I94 Q;  5ISR A;  4X65 L;  3OMC A;  2VUM H;  1FNU A;  2JK8 A;  4A76 A;  1LYL A;  5EPK A;  3CCJ A;  4JI6 Q;  4Q0F A;  2WAQ E;  3FP9 A;  3TME A;  5CR3 A;  2VQF Q;  1JIC A;  3V2T A;  4XYQ A;  2A69 D;  4A3B B;  5A35 A;  2B63 G;  1SE2 A;  1UE1 A;  4DV4 Q;  5I2X A;  2UXD Q;  4LF4 Q;  3ULL A;  3L7Z C;  1E2W A;  5JAV A;  2JP1 A;  4KD3 A;  5G3L F;  1R4P B;  3E9H A;  1GJX A;  3GTK B;  5FLM G;  1CZG A;  1XMO L;  3T51 B;  4O0A A;  3HOV B;  4DK3 C;  5H1S E;  4HED A;  4X3U A;  4O1N A;  2XRQ D;  1GUN A;  4BBS G;  1KDB A;  1RTN A;  4JI8 Q;  2WAC A;  1SE8 A;  1RF2 D;  2BDN A;  2RQX A;  2CWA A;  4JI3 L;  1Q86 C;  1E7Z A;  1E1T A;  1WOC A;  3SGI A;  1MIU A;  1MI2 A;  1STN A;  4X6A H;  4HN7 A;  4B3T L;  1B53 A;  1JOK A;  2ID0 A;  1KAW A;  3DXJ C;  1CFM A;  3CW2 C;  1F2L A;  3S14 H;  3M9B A;  3HOW G;  1OO9 B;  1FD7 D;  4DR5 L;  3U58 A;  1LT6 D;  1B9N A;  4FYD A;  2KCN A;  1TWG B;  5EJW A;  2DY7 A;  1K83 B;  1FYC A;  3G4S A;  2L0C A;  4JCV E;  1TWA B;  4JC0 A;  1H9S A;  2ZTD A;  1A8V A;  2M2L A;  3V05 A;  4R8N A;  2E8G A;  3OSO A;  5JEA G;  4GLA C;  3CPW A;  5M3M B;  1PH8 A;  4MIU A;  2QEX A;  4RGO S;  4ZK9 B;  2E5L L;  4KY6 A;  3VR3 A;  3VR4 A;  2K5W A;  4KD4 A;  4B3R L;  1GM5 A;  3PO3 H;  1SBB B;  2HQE A;  3D4R A;  4X65 Q;  2JA6 H;  3HRZ C;  4P2C B;  3HEJ A;  5LMN W;  1GUT A;  3VYU A;  1B9M A;  1UE5 A;  1EYG A;  1W3S A;  1LT3 D;  3CCE A;  2GVA A;  3A74 A;  3SDZ A;  4XT1 B;  3OTO L;  5JPM C;  3CXC A;  1VQM A;  1KDA A;  1OTC A;  1Y1W B;  2GVB A;  4IUN A;  2IJ0 A;  3T1H L;  4NW2 A;  1BF4 A;  3Q23 A;  1D1I A;  4HR7 B;  1IBM L;  1V8Q A;  1B8A A;  1VQF A;  4DR6 L;  1PTO D;  4IFD I;  5IGE A;  4DR2 L;  1XMO Q;  2A6H C;  4MHE A;  3H3V H;  1KTK A;  2A5H A;  2GA4 B;  3CPF A;  2K03 A;  2F0K A;  2P5Z X;  3S24 A;  3CU7 A;  1YJ9 A;  5D14 A;  5M9O A;  4JI3 Q;  1S3O A;  3VR5 A;  1JQY D;  1E24 A;  1TQO A;  1XYI A;  1A3U A;  5FJ8 H;  3NWT A;  1JMC A;  4B3T Q;  3F2U A;  3FKI B;  4HMI A;  5IY0 A;  4P74 A;  5TSS A;  1S72 A;  2Z9H A;  3AFQ A;  1LUZ A;  2A19 A;  5IGB A;  3E0E A;  4DR5 Q;  4DNR B;  5I9O A;  3GTG B;  2V1C C;  2FFK B;  4IQZ A;  2MP1 A;  4TKO B;  1X3Q A;  3STB D;  1Q7Y C;  3TQY A;  2X69 A;  3NEM A;  2JJQ A;  2ZXP A;  1O7I A;  2R7Z H;  3H0G B;  1BCP F;  1NMG A;  4OL7 A;  2XWB B;  3A7A B;  1L1O B;  1KLG D;  4X66 L;  5C44 H;  4A3I B;  2E5L Q;  1EIG A;  1KHI A;  4A3D H;  2XNA C;  5I6Y A;  3MXN A;  4B3R Q;  2ICE C;  1A15 A;  2CCZ A;  3HG9 A;  2EY6 A;  3DEO A;  4Q5V A;  4A3M H;  1SNQ A;  1CKN A;  2LY7 A;  4RCN A;  1PZI D;  2Y0S B;  1SAP A;  1XWE A;  2DY8 A;  3OHX C;  2LS0 1;  3J7A V;  1DOM A;  2RCN A;  1N33 L;  2XVS A;  4CKE A;  2AQ3 B;  3ERQ A;  4OO1 I;  2K14 A;  4DK1 A;  1PZK D;  3OTO Q;  3VYR A;  4LF7 L;  4A3E H;  1UE7 A;  4N9T A;  2Z6K C;  2EY2 A;  2F3I A;  1WVL A;  3P7J A;  2B2Y C;  2Z6B A;  3ZJY C;  1PFN A;  3TDQ A;  1IBM Q;  4DR6 Q;  4YWK A;  4DR2 Q;  2NVX H;  1K8A C;  3HOU H;  2VQE L;  4HIM A;  4A93 B;  2Q2H A;  4DNI A;  3Q6S A;  2RDF A;  4XT3 B;  1Z7T A;  2B2U C;  4BY1 B;  1STH A;  5J22 A;  2D0P A;  4LUV A;  4Y52 H;  1QVF A;  4DXF A;  2BA1 A;  4M1U B;  3CRL C;  4KKU A;  3M4P A;  3EQL C;  4HJA A;  1PYS B;  1D8L A;  4A3L G;  4X3K A;  3TBI B;  1J9O A;  1P8L A;  4A3J B;  4ZYS A;  4L5R C;  1NAP A;  1STG A;  1CI3 M;  3ND9 A;  4F7X A;  3UI2 A;  3W1G A;  2RA4 A;  4O42 A;  1VQ7 A;  2N8N A;  1MJE A;  4L5Q A;  4X66 Q;  1PRT C;  1EFI D;  4HJ9 A;  2NN6 I;  2E2I B;  4ZUJ A;  4DV1 L;  1A63 A;  2CKZ B;  1PDQ A;  2EJG C;  1TII D;  5LL6 S;  4DNT B;  3G6E A;  1HNZ L;  4V0B A;  4BY7 H;  5C3E G;  3NTH A;  3Q24 A;  4OEM B;  3FPU B;  1SJH D;  2VNU D;  1N33 Q;  5BN3 A;  4ZUI A;  4CDF C;  2KHS A;  4K5X A;  4R9W A;  1SNC A;  4LF7 Q;  4LF9 Q;  4F88 A;  1WTV A;  1N36 L;  1K8M A;  1D6E C;  3S15 B;  3RZO H;  3KYH C;  4IUT A;  4O2D A;  2UU9 L;  3CKI B;  1JC7 A;  2Q8I B;  1H95 A;  5JVH 3;  3GTQ B;  2E75 C;  1I3Q B;  5K36 G;  4DAY B;  1WD1 A;  1HRJ A;  2VQE Q;  2NVY H;  3TN2 A;  2HHH L;  3WOE A;  5EBD A;  4J15 A;  2ICI A;  2HIX A;  3PMF A;  2IW3 A;  5C4X B;  4RKL A;  1MSG A;  4BBR H;  4NP5 A;  2YU9 B;  3GDE A;  3H6M A;  4LF8 L;  3M4O H;  2EYO A;  2F0I A;  1HQR D;  1AE2 A;  4C3J H;  4QCL A;  3QOJ A;  2JA7 G;  1JE4 A;  3PSI A;  4JI4 Q;  1NY4 A;  4RA8 A;  4OWW B;  1EEF D;  4DV3 L;  2G5D A;  3NK9 A;  5E1F A;  5E7N A;  3R3O A;  2LFN A;  1C0A A;  4H44 C;  2YTY A;  1EYD A;  3OWE B;  4HJ5 A;  3U9O A;  4OXP A;  2KCT A;  5I4D A;  2EYF A;  2I0Q A;  2WB1 B;  4PG3 A;  5GAH C;  4A3C G;  1A62 A;  1EU3 A;  4HSV A;  4LFB Q;  3AU7 A;  5ELB A;  3OPO A;  1QCB D;  2B39 A;  2KHI A;  5D65 A;  2R92 H;  1PH5 A;  4C3I G;  3I70 A;  2FHT A;  1B50 A;  4DV1 Q;  4DV5 L;  1OXU A;  2I46 A;  5C0X G;  1HNZ Q;  1C7Y A;  1JWU D;  4EGV A;  1LV9 A;  3FHW A;  4CDE C;  4Y7N H;  3F2C A;  3I90 A;  1XXG A;  5C4H A;  1YHQ A;  3S17 H;  1IL8 A;  2IY5 B;  1RJT A;  3AYH B;  3D31 A;  1I6H H;  3RMH A;  4K0K L;  2MGS A;  3CD6 A;  2PZU A;  5IP9 H;  1N36 Q;  3MFG A;  3HP3 A;  2MPM A;  4GS3 A;  4KKS A;  4HTH A;  3U4Z A;  1ENF A;  4ZKB B;  4C3H B;  4GN5 A;  1EYC A;  4DR7 L;  4FO2 A;  2UU9 Q;  2SOB A;  4BBS H;  2FXQ A;  1IKM A;  2G9H D;  2MUY A;  1ML0 D;  1WCM B;  1ZYR D;  4APV A;  3I2Z A;  2F0O A;  1CHP D;  4QUC A;  4H0L C;  3HKZ B;  2K5H A;  2HHH Q;  1IW7 D;  4R1J A;  1AEX A;  4RKB A;  1PH9 A;  1ASZ A;  1L0W A;  2GN5 A;  3H94 A;  4DAP A;  5CBE E;  3HOW H;  1CM9 A;  3R8B A;  4LF8 Q;  4XIG S;  2K50 A;  2HDM A;  3RN5 A;  1RL2 A;  2K04 A;  4XQN A;  1UAP A;  3PUY A;  3K0X A;  1YBY A;  1SN8 A;  1NSN S;  1B44 D;  1U5K A;  4PV1 C;  4MZ9 A;  4DV3 Q;  3AEV A;  2MNA A;  2EVB A;  3K5O A;  2N55 A;  1KLU D;  3HOX G;  2KVM A;  1TWC B;  3P20 A;  4GOP B;  1XMQ L;  5IIF A;  1BVS A;  1EUJ A;  4RMF A;  1VS0 A;  2KJX A;  2WIN B;  3AQQ A;  3KF8 A;  1SDF A;  4IUU A;  4JBK A;  1GUO A;  1TS5 A;  1YVC A;  3M4Y A;  5IP7 G;  2JA7 B;  3LX0 A;  5IYC H;  1PXU A;  2O5J C;  4DXG A;  1DD2 A;  2OTL A;  4DV5 Q;  1IYJ B;  5GAG C;  2EXZ A;  2IT1 A;  2A69 C;  1Y8O B;  1TY2 A;  4V19 0;  3S14 B;  3PUW A;  3S1R B;  1HXY D;  1TU2 B;  2KBN A;  4GNX C;  3QIA A;  2Z4H A;  2K5D A;  2OQ0 A;  2PO4 A;  2N3S A;  4K0K Q;  1BUV T;  4GKJ L;  4L5S A;  1KNE A;  2EPB A;  2UUB L;  3MAQ A;  3D6W A;  1SE3 A;  1PFB A;  3TP8 A;  4LF6 Q;  3DWQ A;  4C3I B;  4DR7 Q;  3P75 A;  4ME5 A;  1HH2 P;  1I4H A;  1V1O A;  1NR4 A;  1VQ5 A;  3OIP A;  1Q8K A;  2QGQ A;  1EEI D;  1SLJ A;  5J1Z A;  1EWC A;  2WFW A;  1U4P A;  4FF4 A;  3EVQ A;  3ULP A;  1DYQ A;  3PO3 B;  3MZ5 A;  1GKH A;  2JA6 B;  2RDH A;  3NBI A;  3I4O A;  3E0J A;  5M3F H;  1S5F D;  2D9U A;  2Z6K A;  3H09 A;  3MEH A;  1WTR A;  5HGQ A;  2B2Y A;  1BQQ T;  3H3V I;  4ILW A;  2EZV A;  4BXX G;  3VDY A;  1HTL D;  3LWE A;  1V1P A;  4FDB A;  1XTD A;  2A1A A;  1K8G A;  2RVL A;  1ET6 A;  3S1M H;  3PUV A;  3PUZ A;  1DM0 B;  2HCC A;  2SEB D;  5FKA C;  1W2B A;  2EYJ A;  1HPC A;  1E2Z A;  1XMQ Q;  1VMP A;  2UXB Q;  2B2U A;  3GTP H;  3M7N A;  5IGD A;  2N88 A;  4TRD A;  2JA5 G;  1C8C A;  4OEL B;  2QW7 A;  2L11 A;  2FMC A;  1K73 C;  5C3W A;  4IPH A;  5CV5 A;  1EQV A;  1SMX A;  4OWX B;  3LNN A;  2NTS A;  3UDX A;  1I4X A;  1TWF B;  2BH8 A;  1K8O A;  1JR0 D;  2L5T A;  4DK6 C;  4J1M A;  5C5L A;  1PVO A;  1IBL L;  2EDG A;  1EFW A;  2F03 A;  2A68 D;  1H9K A;  3CCL A;  3AMU A;  3RN2 A;  1IBK L;  1WYD A;  1A2T A;  2F0N A;  2YV5 A;  4I7A A;  4GKJ Q;  4NDX A;  3A55 A;  2UUB Q;  5LL6 X;  1YZ6 A;  5M3M G;  3U50 C;  4C2M H;  2R7Z B;  2K6A A;  2WII B;  1ICW A;  1PTO B;  1PFS A;  1KRS A;  3JC6 6;  3PV0 A;  3BDC A;  4IPD A;  4A3D B;  4AH6 A;  5FOB B;  2KUM A;  5IOD A;  3S2D H;  1KIX A;  4JI7 L;  5LMN L;  4CJ2 C;  3NUC A;  4A3M B;  5IT9 E;  3K7U C;  4DAV A;  1GUS A;  1SMY C;  4A4I A;  3C1E A;  4M8A A;  1NR2 A;  4UAI A;  4P75 A;  2D2C C;  3VR6 A;  5M5W B;  4K6D A;  3STB C;  4A3K G;  2ZT9 C;  3BYT B;  4A3G B;  3HOZ B;  4A3E B;  2NVQ H;  1G6P A;  3NWS A;  1DXM A;  1EZ6 A;  3MA2 B;  2MFI A;  1WD0 A;  4IJH A;  4XYO A;  1YJW A;  2F0Q A;  4QB4 A;  4DAM A;  4FF1 A;  2OQK A;  1U4L A;  1C48 A;  2NVX B;  1I4G A;  3CME A;  3TS0 A;  1XJV A;  1X3E A;  3RLO A;  1FJG Q;  3FEW X;  1IHZ A;  2K05 A;  5JJK A;  3GV6 A;  4E6I A;  3CCS A;  4IFD G;  5FLX L;  2NZH A;  1Y1V H;  1HUM A;  3FKI G;  2PCF B;  5FLX c;  1XPU A;  2RSN A;  1DOK A;  3K58 A;  2R61 A;  1VQN A;  1I50 H;  2ALY B;  3TRE A;  3ICE A;  5DNF A;  1IBL Q;  3SK5 A;  4FF2 A;  1L0Y B;  2PQE A;  1VQL A;  5BR8 L;  3I4M H;  4JBW A;  3J7Y W;  3L2P A;  1UWV A;  1IBK Q;  2JA5 B;  3M4Q A;  1H9J A;  3TP7 A;  1F2Y A;  5GQO A;  4BS9 A;  4HJ8 A;  3T1Y L;  1H9M A;  3H0G G;  1KAB A;  3J81 j;  4KHV A;  1MJC A;  1ESF A;  4A3I G;  2JXM B;  2NVT B;  2MO0 A;  3SEB A;  2F0M A;  1HFN A;  3KBX A;  3QJY A;  1QIL A;  3X3M A;  1S5E D;  2L12 A;  4RWS C;  3M3Y H;  2AKW B;  3DEP A;  3MVV A;  2K5N A;  4G7Z C;  4JI7 Q;  2JA8 H;  5LMN Q;  2Y0S G;  3T16 A;  4CKC A;  1G8Z D;  2B2V C;  2VW9 A;  4BY7 B;  2JEA I;  2R3Z A;  4G7H C;  3VA7 A;  1R9T B;  4KLK A;  1AZQ A;  2K52 A;  1JOR A;  1M90 C;  3BS1 A;  3GTM B;  1AP0 A;  2VXW A;  2Q8T A;  1RKN A;  4YCW A;  3Q22 A;  5CV9 A;  1ICF B;  1I6V C;  2H1E A;  3EJI A;  4JI2 Q;  4CDC C;  5EPJ A;  4A3C H;  3PO2 H;  2OEO A;  2EOT A;  4EX5 A;  4OO1 G;  2B8G A;  1XPR A;  4JK1 C;  4A93 G;  3K80 C;  4KY5 A;  5F2D A;  2NVY B;  5CYU A;  5HUR A;  1F2M A;  1BO0 A;  4NKL A;  1OXX K;  2ZXR A;  3SHL A;  2WKD A;  4BY1 G;  4CDD C;  4A3K B;  1HJP A;  2KQ3 A;  3MC0 B;  2FJ2 A;  1T5E A;  1Q8I A;  1EOT A;  3W1B A;  1LAC A;  2WP8 J;  4BA1 I;  1K0R A;  2F0G A;  4RHS A;  5BR8 Q;  4C56 C;  4A3J G;  4H7B A;  2A73 B;  2CFM A;  3UDG A;  3BZC A;  3T1Y Q;  2K33 A;  1HR0 L;  4L63 B;  3RR5 A;  4ULL A;  5T1I A;  2NTT A;  1NBW A;  3L3O C;  1N32 L;  1I5F A;  3FVQ A;  3GV3 A;  2RHQ B;  5A2Q L;  2RF4 A;  2R92 B;  3L0O A;  4GNX A;  2Z4I A;  1AE3 A;  1Q46 A;  1L1O C;  2R93 H;  5FK9 C;  1JJC B;  1TWH B;  4POG A;  1EOV A;  2PMZ B;  3CCQ A;  3AFP A;  3S17 B;  5JJZ A;  1YNN D;  4KV6 A;  2JA9 A;  2F0H A;  3I4N G;  1LTT D;  3EA6 A;  1P16 A;  1ASY A;  1Q1E A;  1BCP B;  3NP8 A;  2ZTC A;  5LMU L;  3MXP A;  3CRK C;  3GTO B;  4F87 A;  1CKO A;  5G3L D;  4OGQ C;  5C4X G;  3NQT A;  2PNR C;  2WKC A;  2A74 C;  2TMP A;  4YCV A;  1ENC A;  1DCZ A;  1EWI A;  2BE5 C;  4LF9 L;  4EQN A;  4FXK C;  1STB A;  2K4K A;  2DN8 A;  2F0F A;  2Q2I A;  2IL8 A;  2HCI A;  4DR4 L;  3A8I E;  1KNA A;  1R4Q B;  2CHB D;  5M5X H;  3JAM L;  1X3F A;  2E2J H;  3JAM c;  5KEE A;  2B2W C;  1VQC A;  1SYB A;  1NTG A;  1CKM A;  1ZYR C;  3K5L A;  2WB1 G;  1HR0 Q;  1SEB D;  4CJ1 B;  4YWL A;  5COY A;  3DM3 A;  2M00 A;  4CGY B;  2OCE A;  1Y69 U;  2J7Z A;  4RGT A;  1N32 Q;  4JI4 L;  4X62 L;  2RDG A;  4LW1 A;  4BA2 I;  5IWA L;  2O2L D;  1VQ8 A;  3KDF B;  3OW2 A;  1LLR D;  4KTA A;  2PNH A;  5L37 A;  3PUX A;  4A3B H;  3F2B A;  4B9W A;  4UP7 A;  3HOY H;  4ODG A;  1V1P B;  4AIM A;  4LJZ C;  2EYM A;  4BXX H;  4JOI C;  2PYK A;  4HCE A;  1HR0 W;  1J8I A;  2OF1 A;  3GTK H;  3KF6 A;  4LFB L;  3DMU A;  2B29 A;  2IX1 A;  3HOV H;  1PLF A;  2F52 A;  3SVM A;  1IYV A;  4C3H G;  3FMC A;  1B70 B;  5M5Y H;  2F0J A;  1ILP A;  1WCM G;  5DM6 3;  2EIF A;  3FRP B;  1YEZ A;  3LWU A;  3C1F A;  3HKZ G;  1B7Y B;  4EQP A;  1QUQ A;  1YNJ C;  3NSW A;  3OIQ A;  1SND A;  2E2D C;  5LMU Q;  3NE5 B;  3N6R A;  5KNC A;  2PQA B;  1HHV A;  3GP7 A;  3NBH A;  3S1Q H;  3EBE A;  4Z9C B;  1D5Z C;  4LNQ A;  3UDI A;  3VYT A;  2MQH A;  2EJF C;  1VQJ A;  2YTX A;  1TWG H;  1PRT F;  3NXW A;  5M3F B;  3I4N B;  1II3 A;  1U0L A;  4IZ8 A;  2H4O A;  2KHJ A;  5FO8 B;  4DR4 Q;  1V1Q A;  1Q3L A;  4C1N K;  2QA4 A;  3AB9 A;  2L15 A;  4A3F H;  2CW0 C;  3S1M B;  3GTJ B;  4FF3 A;  4WJW A;  3BZD B;  1PH2 A;  3DUZ A;  3QO2 A;  2K5Q A;  1FNV A;  1LTL A;  3OYY A;  4DV7 L;  5DLQ E;  4X3S A; 
#chains in the Genus database with same CATH homology
 5IT9 c;  3BU2 A;  1LYL A;  3CCJ A;  2OQ0 A;  4A76 A;  4JI6 Q;  2N3S A;  4K0K Q;  3CCR A;  3KF8 B;  2WAQ E;  4GKJ L;  4AYB G;  4X62 Q;  4L5S A;  4LUZ A;  3J80 c;  2UUB L;  3FP9 A;  5IYB H;  1Q86 C;  5IWA Q;  2VQF Q;  4LF6 Q;  4DR7 Q;  2BA0 A;  5IP7 H;  1HH2 P;  1SRU A;  1UE1 A;  2B63 G;  4DV4 Q;  4XTC S;  1VQ5 A;  4H02 A;  1VQK A;  2UXD Q;  4LF4 Q;  1Q8K A;  1Y1W H;  3U4V A;  3ULL A;  3L7Z C;  1VQI A;  2QGQ A;  3H15 A;  4JI0 L;  1SLJ A;  1M1K C;  1WJJ A;  2WFW A;  2ATW A;  4KHP L;  3E9H A;  1QZG A;  3ULP A;  2E2H H;  5FLM G;  5C4J H;  3A5U A;  1GKH A;  4AQY L;  1SRO A;  1XMO L;  1PH4 A;  1NMF A;  4O0A A;  1PH6 A;  1RIP A;  4OX9 L;  3I4O A;  2I5H A;  1Q1B A;  4DK3 C;  5H1S E;  5M3F H;  4BBS G;  2Z6K A;  5HGQ A;  4JI8 Q;  2AWN A;  1SE8 A;  2A8V A;  2I5M X;  4OON A;  3H3V I;  3J7Z C;  4DV6 L;  2CWA A;  4L5T A;  4JI3 L;  1E7Z A;  1E1T A;  1WOC A;  1YHB A;  1C9O A;  1MIU A;  3SGI A;  5M5W H;  4ALP A;  2ES2 A;  4X6A H;  4B3T L;  4BXX G;  3VDY A;  2ID0 A;  1KAW A;  4FDB A;  1XTD A;  2A1A A;  5C0X J;  1K8G A;  4JBM A;  2B63 H;  3S1M H;  3HOZ H;  1E3P A;  4NXN L;  3K7A H;  3CW2 C;  3PUV A;  3PUZ A;  3S14 H;  3PO3 G;  3M9B A;  3CQZ H;  2ZTE A;  3K8A A;  3T1H Q;  1VQO A;  2JA6 G;  3HOW G;  1W2B A;  4DR5 L;  3U58 A;  1V43 A;  1XMQ Q;  2UXB Q;  4RG1 A;  4GN4 B;  3GTG H;  1X56 A;  4KI0 A;  5FLM H;  3G4S A;  3GTP H;  1N34 L;  3M7N A;  4JV5 Q;  2JA5 G;  4LF5 L;  4JCV E;  3CCU A;  4LF6 L;  1PH1 A;  4DR1 Q;  1K73 C;  2AHO B;  4JC0 A;  4JYA Q;  2ZTD A;  1A8V A;  4DKA C;  2E8G A;  1VQD A;  2UXC Q;  4IPH A;  2HIV A;  5JEA G;  4OWX B;  1SMX A;  2MO1 A;  4GLA C;  3CPW A;  1V9P A;  3UDX A;  1PH8 A;  2HT1 A;  1Z9F A;  4P72 A;  2BH8 A;  2QEX A;  3H0G H;  1BKB A;  3EIV A;  2E5L L;  4JI5 L;  5EAY A;  4KHZ A;  5GAE C;  2CQO A;  4UPA A;  1Z47 A;  4DK6 C;  1L2F A;  1YHA A;  3RLF A;  4A3I H;  1GM5 A;  4NXM Q;  4B3R L;  1EIF A;  3F1Z A;  3PO3 H;  1KQS A;  1IBL L;  1CSP A;  3F2D A;  4DV7 Q;  2JA6 H;  4X65 Q;  1EFW A;  1JT8 A;  4B3M L;  4JI1 Q;  5J3B A;  4PZ7 A;  5LMN W;  3CCL A;  1VQE A;  3RN2 A;  1IBK L;  1UE5 A;  2D0O A;  2ZJP A;  2WAQ G;  1EYG A;  1WYD A;  1W3S A;  4IOA A;  2PMZ E;  2YV5 A;  4GKJ Q;  2JA5 H;  3CCE A;  2B3G A;  4GOP C;  2UUB Q;  3UE0 A;  1YZ6 A;  3A74 A;  2GVA A;  3A0J A;  5M3M G;  3U50 C;  2D62 A;  4C2M H;  4OWT B;  1IZ6 A;  3OTO L;  3CXC A;  1VQM A;  3ER0 A;  1OTC A;  2GVB A;  3IRB A;  4QJF A;  1QZH A;  1PFS A;  3T1H L;  2NVT H;  1KRS A;  3JC6 6;  3PV0 A;  4IPD A;  1KC8 C;  2VUM G;  4AH6 A;  4QY7 A;  4JI0 Q;  4ME3 A;  5JJI A;  4GKK L;  2Q2T A;  1YNX A;  4KHP Q;  2UXB L;  3CF5 A;  5IYD H;  3S2D H;  1IBM L;  1KIX A;  1B8A A;  5LMN L;  1VQF A;  4JI7 L;  4B3M Q;  2IHF A;  4DR6 L;  4AQY Q;  4IFD I;  3KOJ A;  1XMO Q;  2Y0S E;  1NE3 A;  2VL6 A;  4PZ6 A;  4DR2 L;  4OX9 Q;  1K83 H;  1A0I A;  3K7U C;  3H3V H;  3E9I A;  4HID A;  1TWA H;  4A4I A;  4HIO A;  1KL9 A;  3CPF A;  4P75 A;  2R7Z G;  2I5L X;  5AJ3 L;  1Y1V G;  2DUD A;  2CWP A;  3S24 A;  3STB C;  1YJ9 A;  4DV6 Q;  4A3K G;  1R9T H;  4JI3 Q;  3TRZ A;  1S3O A;  1JB7 A;  5M3M H;  1E24 A;  1L1O A;  4NB3 A;  5C44 G;  5FJ8 H;  1JMC A;  4B3T Q;  4A3D G;  3GTM H;  2NVQ H;  1G6P A;  5IY0 A;  4P74 A;  4NXN Q;  3I56 A;  2AWO A;  1S72 A;  2MFI A;  4IJH A;  3AFQ A;  4A3M G;  1YJW A;  1LUZ A;  2A19 A;  4DAM A;  3E0E A;  4DR5 Q;  1K3R A;  2OQK A;  4B3S L;  2F4V L;  3I4M G;  2V1C C;  4QQB X;  5JJL A;  3CME A;  3D0F A;  1N34 Q;  3JAM i;  3TS0 A;  1XJV A;  1X3E A;  3RLO A;  1FJG Q;  4LF5 Q;  2ZJR A;  3STB D;  1Q7Y C;  3TQY A;  1D7Q A;  3KJO A;  3NEM A;  5JJK A;  4A3G G;  2JJQ A;  2LSS A;  3G71 A;  3HOZ G;  4A3E G;  1J6Q A;  1O7I A;  3CCS A;  2R7Z H;  4IFD G;  2NZH A;  1IXR A;  1OXS C;  1Y1V H;  1NMG A;  3FKI G;  1XNQ L;  1XPU A;  5FLX c;  4LWC A;  1L1O B;  3Q8D A;  4A3K H;  1CUK A;  1VQ6 A;  4WJ3 M;  4X66 L;  4IO9 A;  5C44 H;  2E5L Q;  1VQH A;  1KHI A;  4JI5 Q;  4A3D H;  2JA8 G;  3KFU A;  4YHH L;  1VQN A;  1I50 H;  4B3R Q;  2ALY B;  3TRE A;  3ICE A;  2CCZ A;  1JJG A;  3HOU G;  2JEB I;  1IBL Q;  4A3M H;  2VZA A;  1CKN A;  1VQL A;  5BR8 L;  1PHJ A;  3I4M H;  4JBW A;  3L2P A;  1UWV A;  1IBK Q;  4JG2 A;  3RZD H;  3M4Q A;  1GVP A;  4HJ8 A;  3T1Y L;  5GQO A;  1X55 A;  2RCN A;  1N33 L;  3CP0 A;  3H0G G;  3J81 j;  4OO1 I;  2K14 A;  4UY8 C;  1MJC A;  4MNO A;  4R4O A;  3OTO Q;  2UUC L;  4LF7 L;  4A3E H;  1UE7 A;  4A3I G;  3PGZ A;  1HZB A;  2MO0 A;  1AH9 A;  2Z6K C;  3FKI H;  1PH7 A;  4EQ5 A;  1G51 A;  2KCM A;  3PO2 G;  2F3I A;  4GN3 B;  3S15 H;  1HNX L;  3M3Y H;  4GKK Q;  2AKW B;  1J5E L;  3MXN B;  2K5N A;  2R7F A;  3ZJY C;  1IBM Q;  5LMN Q;  4JI7 Q;  1FVI A;  2Y0S G;  2JA8 H;  4DR6 Q;  4YWK A;  4DR2 Q;  2NVX H;  1FJG L;  1K8A C;  3HOU H;  1CKN B;  2VW9 A;  2VQE L;  1X3G A;  2H5X A;  2JEA I;  3CCV A;  3GO5 A;  4QGU A;  1I3Q H;  4LUO A;  4HIM A;  1TWH H;  2Q2H A;  3M85 A;  1GO3 E;  1VQG A;  4DNI A;  3J7A 5;  1E22 A;  4KLK A;  5AJ3 Q;  2K52 A;  1M90 C;  5JEA J;  3HFZ B;  4A75 A;  1NJI C;  3I7F A;  2YU9 H;  2IHE A;  2JQO A;  3TEH B;  5IYD G;  4YCW A;  1Y14 B;  2D0P A;  4LUV A;  4Y52 H;  1QVF A;  2BA1 A;  4JI2 Q;  2LXK A;  4A3C H;  3NEL A;  3PF4 A;  4JOI A;  3PO2 H;  3M4P A;  2DGY A;  4EX5 A;  4HJA A;  1PV4 A;  1PYS B;  4B3S Q;  2AMC B;  1XPR A;  1D8L A;  2F4V Q;  4OO1 G;  4A3L G;  4BY7 G;  2R7D A;  1OXV A;  1Q12 A;  4A93 G;  4GLV B;  2VY3 A;  2XTI A;  3K80 C;  1P8L A;  1HZA A;  4R4C A;  4DUZ L;  1S40 A;  2VS1 A;  3GTO H;  1OXT A;  3I55 A;  2LXJ A;  3DLL A;  4L5R C;  1PVO A;  2C35 B;  4DV2 L;  1OXX K;  3K81 C;  5FJ8 G;  3W1G A;  4BY1 G;  1VQ7 A;  2KEN A;  1HJP A;  4POF A;  4PZ8 A;  3WWV A;  1XNQ Q;  1BBU A;  4DUY L;  2N8N A;  1MJE A;  4L5Q A;  4X66 Q;  4HJ9 A;  2NN6 I;  4HIK A;  5HY6 A;  1HZC A;  1DGS A;  3G48 A;  4YHH Q;  3W1B A;  4DV1 L;  1HNW L;  1A63 A;  2CKZ B;  2YYZ A;  3J80 i;  2WP8 J;  1SFO H;  4BA1 I;  2R93 G;  1K0R A;  2ASB A;  2EQS A;  3EN2 A;  3W5O A;  3F8T A;  3G6E A;  5BR8 Q;  4A3J G;  1HNZ L;  4BY7 H;  4A3L H;  2CFM A;  5C3E G;  4IJL A;  3UDG A;  3BZC A;  1VQ4 A;  4A93 H;  2WB1 E;  1T9H A;  3T1Y Q;  1VQP A;  1HR0 L;  4DR3 L;  2VNU D;  1VQB A;  4BBR G;  1JJ2 A;  1N33 Q;  3RR5 A;  1NBW A;  2UUC Q;  2OWO A;  4BY1 H;  4LF7 Q;  4LF9 Q;  1N32 L;  3B6Y A;  1Q81 C;  4JI2 L;  1JE5 A;  1N36 L;  1I5F A;  1KRT A;  1K9M C;  4NPS A;  4HJ7 A;  2RHQ B;  4YCU A;  2RF4 A;  3RZO H;  2OTJ A;  3KYH C;  4O2D A;  1HNX Q;  3L0O A;  2UU9 L;  4GNX A;  1EQQ A;  1J5E Q;  4C3H H;  1AE3 A;  1Q46 A;  4JBJ A;  1L1O C;  1H95 A;  2R93 H;  1QVG A;  1JJC B;  5K36 G;  4DAY B;  4DV0 Q;  1XPO A;  2VQE Q;  4POG A;  2NVY H;  1EOV A;  2HHH L;  4A3J H;  1G29 1;  1YI2 A;  1SR3 A;  5C3E H;  3CCQ A;  1VCI A;  1XNR L;  3AFP A;  4J15 A;  2HIX A;  4BBR H;  4WJ4 A;  2JA9 A;  4P71 A;  1N8R C;  1VQA A;  3GDE A;  3UDF A;  5C0X I;  1YIT A;  4LF8 L;  4IFD J;  5ELN A;  3I4N G;  3M4O H;  1P16 A;  4C3J H;  1ASY A;  1AE2 A;  1Q1E A;  2R92 G;  4YWM A;  1YIJ A;  2E2I H;  1TXY A;  3PSI A;  3RNU A;  2JA7 G;  4JI4 Q;  3TS2 A;  1NY4 A;  2JE6 I;  2ZM6 L;  2EXD A;  1PYB A;  2IX0 A;  2ZJQ A;  4GNX B;  3ULJ A;  4OWW B;  2ZTC A;  4DV3 L;  2HQL A;  3HKZ E;  5E7N A;  5LMU L;  4GLX A;  1C0A A;  3CMA A;  1X9N A;  2YTY A;  1CKO A;  1MKH A;  4HJ5 A;  4TQU S;  3CC4 A;  4OXP A;  4DUZ Q;  2KCT A;  5C4X G;  3S1N H;  2I0Q A;  5GAD C;  4DV2 Q;  2Q2U A;  4YCV A;  1X65 A;  1EWI A;  3KJP A;  4LF9 L;  1WI5 A;  4X64 L;  4PG3 A;  1GD7 A;  1TWC H;  1BBW A;  5GAH C;  3J81 i;  1PA6 A;  4LFA L;  1FL0 A;  4IPG A;  3S16 H;  2K4K A;  5IP9 G;  4A3C G;  1QVC A;  1A62 A;  2Q2I A;  1YJN A;  4DUY Q;  4R4T A;  4LFB Q;  3I4N H;  2UUA L;  4DR4 L;  1CSQ A;  2KHI A;  2BH2 A;  2R92 H;  1PH5 A;  3KDF A;  1LM0 A;  4YY3 L;  5M5X H;  1HNW Q;  2JA7 H;  4DV1 Q;  1X3F A;  4DV5 L;  2E2J H;  4A3B G;  1OXU A;  3MEF A;  3JAM c;  4DV0 L;  3HOY G;  5C0X G;  4DPG A;  3GTQ H;  1VQC A;  1NTG A;  1CKM A;  1HNZ Q;  4QIW E;  1C7Y A;  2WB1 G;  3FHW A;  4Y7N H;  3F2C A;  4UP9 A;  3BJU A;  1YHQ A;  1I94 L;  1HR0 Q;  4DR3 Q;  3CC2 A;  3S17 H;  4YWL A;  3GTJ H;  3S1R H;  2IY5 B;  3A5Z B;  5C4X H;  3DM3 A;  2RHS B;  2OCE A;  3AYH B;  3D31 A;  4PMW A;  4JI6 L;  3HOV G;  4UP8 A;  1I6H H;  4K0K L;  5GRO A;  1N32 Q;  3CD6 A;  3GTL H;  4JI4 L;  5IP9 H;  4X62 L;  1N36 Q;  4GS3 A;  4LW1 A;  3RLN A;  4AYB E;  4BA2 I;  2NZO A;  3U4Z A;  5IWA L;  2VQF L;  3HKS A;  1X6O A;  2R6G A;  4GN5 A;  4DR7 L;  1VQ8 A;  3CAM A;  3KDF B;  4IPC A;  2FXQ A;  3OW2 A;  2UU9 Q;  4BBS H;  4C3I H;  2PNH A;  4DV4 L;  3PUX A;  4APV A;  2UXD L;  4A3B H;  3BZK A;  4LF4 L;  3F2B A;  3I2Z A;  1HZ9 A;  3PF5 A;  4UP7 A;  3HOY H;  2PQA A;  1IL2 A;  2K5H A;  2HHH Q;  4R1J A;  3GD7 A;  4AIM A;  4BXX H;  1Q82 C;  4JOI C;  1PH9 A;  4GOP A;  1ASZ A;  1HR0 W;  1XNR Q;  1L0W A;  3J81 c;  4LFC Q;  2GN5 A;  3KF6 A;  1N9W A;  4R4I A;  4TVA B;  3GTK H;  3HOW H;  5ELO A;  4LFB L;  2B29 A;  4LF8 Q;  2N78 A;  4XIG S;  2IX1 A;  2K50 A;  2YTV A;  3PIO A;  3HOV H;  2F52 A;  3RN5 A;  1RL2 A;  1B70 B;  5IYC G;  4JI8 L;  1KD1 C;  5M5Y H;  3PUY A;  3PIP A;  1WCM G;  3K0X A;  1WFQ A;  1YBY A;  2ZM6 Q;  1E1O A;  1SN8 A;  2EIF A;  1YEZ A;  3CC7 A;  1U5K A;  2PI2 E;  4A3F G;  3HKZ G;  3PCO B;  1B7Y B;  4MZ9 A;  1QUQ A;  3NEN A;  4DV3 Q;  3KLW A;  5LMU Q;  5IE8 A;  4R4Q A;  3AEV A;  2MNA A;  2PQA B;  3S1Q H;  2VUM H;  3EBE A;  3HOX G;  4QL5 A;  4MTN A;  4GOP B;  1XMQ L;  1EIY B;  2Z0S A;  2XGT A;  3LGJ A;  4LNQ A;  4A3G H;  1BVS A;  3UDI A;  1EUJ A;  4RMF A;  4X64 Q;  1EQR A;  2MQH A;  2K5V A;  3KF6 B;  4LFA Q;  1VQJ A;  1X54 A;  1VS0 A;  2YTX A;  1PH3 A;  1TWG H;  3AQQ A;  1VQ9 A;  4JV5 L;  1KXL A;  4IOC A;  3ERS X;  1U0L A;  5IYB G;  2K75 A;  4JBK A;  4DR1 L;  1YVC A;  3UE1 A;  4JYA L;  2UUA Q;  2KHJ A;  5IP7 G;  4P73 A;  4DR4 Q;  1UE6 A;  1V1Q A;  2UXC L;  5IYC H;  4YY3 Q;  2OTL A;  4DV5 Q;  1WCM H;  1IYJ B;  5GAG C;  1Y1W G;  1UEB A;  2IT1 A;  2PI2 A;  2QA4 A;  1QUQ B;  3S2H H;  2L15 A;  4A3F H;  1TWF H;  2NN6 G;  2N49 A;  3PUW A;  4NXM L;  1FGU A;  3NBH B;  4LFC L;  1PH2 A;  3CCM A;  1I94 Q;  2KBN A;  4GNX C;  1LTL A;  4DV7 L;  3OYY A;  4X65 L;  5DLQ E;  3HOX H;  5M3F G;  4JI1 L;  2JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...