4LF6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6Q00
4A3LH 4K0KL 2NVYH 4JI4Q 4JI8L 2K52A 4JBMA 4OO1I 4LF5L 2WB1G 4DK3C 4L5SA 5IP9H 4YCVA 3I4NH 3OTOL 1X3GA 3ULJA 1N36Q 4NXMQ 1DGSA 5HGQA 1N34L 4LFAL 4LF4L 4IPHA 3KJPA 4TVAB 3FKIH 3NENA 3S1NH 1FJGL 4X66Q 5AJ3L 4P75A 1KXLA 4A93H 2AKWB 4QY7A 1MKHA 3E9IA 3CCSA 2LXJA 1MIUA 2N3SA 2LSSA 1KAWA 4YWMA 2ID0A 4A3FH 3F1ZA 2C35B 1S3OA 2NN6G 2KHIA 1CKOA 2AWOA 1VQBA 2WP8J 4GLAC 4AQYQ 1PH7A 3U50C 1GD7A 2PQAA 2D62A 4HJAA 1YJWA 2VUMH 4C3IH 3H3VH 4IOCA 4POGA 5C0XJ 3I4MH 2JJQA 2MO0A 3A74A 3G71A 1V1QA 3HOXG 4A75A 1VQGA 2IHEA 4A3KH 1JJ2A 3CD6A 1XTDA 3HOXH 2OTJA 3K80C 1N34Q 1PH6A 1Q1BA 3UE1A 3K7UC 1WI5A 4A93G 2Z6KA 1Q1EA 3KFUA 2Q2TA 3PF5A 2F52A 3J80i 5J3BA 1XMOQ 1XNRL 2CQOA 3B6YA 1XJVA 4X64Q 2A19A 1CKNB 1Y1VG 1WJJA 1TXYA 2YV5A 3S24A 3RNUA 1B7YB 4PZ6A 1G51A 4UP7A 4A3FG 1KQSA 3RLFA 3KLWA 1HZAA 1YIJA 3MEFA 4JBJA 4LUZA 1SN8A 1KIXA 1N8RC 3HOUH 3M3YH 1XPOA 3I4MG 3CXCA 2OCEA 4YWKA 3CCRA 1XMOL 1XNRQ 4BBRG 2BH8A 2K4KA 4UY8C 3S1QH 3OW2A 4BBSG 4JC0A 3KF6A 2YU9H 5JEAJ 1SLJA 1HNZQ 1VQMA 1SFOH 4DR6Q 1W3SA 2JA8H 2VW9A 1YHQA 4KHPL 4B3SQ 4BA1I 4NXML 4DR1L 2GN5A 4LF6L 1HZ9A 2KENA 4FDBA 3UE0A 5GAEC 1VQEA 2IT1A 3OYYA 4X66L 2A8VA 3NEMA 3ZJYC 4OWXB 3CF5A 3W1BA 2R93H 1HNZL 5C4JH 3HOUG 1CKMA 4L5QA 4O2DA 4EQ5A 2MNAA 1PHJA 4BXXG 1WCMG 4IO9A 2R7ZH 1QZHA 1WCMH 1X3FA 2ASBA 4LWCA 4KHPQ 2H5XA 4DR2L 4B3MQ 2LXKA 5FJ8H 4DUYQ 3J81c 1N33L 1IZ6A 2JE6I 2UXCL 1JMCA 3PCOB 4AH6A 4YY3L 1Y1WG 1I94L 3E0EA 2NVTH 1LYLA 5C4XH 4GNXC 1V9PA 2PI2A 4LF5Q 1L1OC 2D0OA 3J81i 3I7FA 4NXNQ 4IFDI 3T1HQ 4DV7L 3CQZH 4A3IH 2EQSA 4AIMA 1SROA 4DV4Q 1KRTA 3DM3A 2KCMA 1PH3A 1IBKL 3PUWA 3CCQA 1QVFA 3GTGH 3FKIG 3FHWA 3HFZB 3GTLH 4A3BH 4YCUA 1YI2A 3PF4A 1QVCA 3I4OA 4X64L 3GTJH 2HHHL 1OXXK 1N9WA 3I56A 4GN4B 2BH2A 1X55A 4JOIC 1SR3A 3H3VI 2AMCB 4A3CH 1VQ9A 4LF7L 2N78A 3CC2A 1JJGA 3CPWA 2HIVA 5IT9c 2XTIA 4IPCA 3Q8DA 4YCWA 4GKJQ 4YWLA 4A3GH 3PV0A 4QGUA 2EIFA 4MTNA 4QIWE 5IP7H 4B3SL 3D0FA 2KBNA 4AQYL 1AH9A 2E5LL 1E7ZA 4JI3Q 4JI1L 2HT1A 1EYGA 1Q12A 2WFWA 4BA2I 3KYHC 3M9BA 1BBUA 3PUYA 1J5EL 1NE3A 3M4PA 3NBHB 3S2DH 4X62Q 2UUAQ 2NZHA 4UP9A 3PIPA 3PO3H 4DKAC 3JAMi 4DR5Q 4A3MG 4MZ9A 1HZCA 1MJEA 5M5WH 2L15A 1VQ8A 4BY7H 4LUVA 1XNQQ 2VUMG 2PQAB 4BY7G 2PI2E 1K83H 2Y0SG 1J5EQ 3RR5A 2D0PA 4JCVE 4QL5A 2JK8A 1HJPA 2HQLA 1Q8KA 1BKBA 1LTLA 1EQQA 1MJCA 1M1KC 4WJ3M 4AYBG 2A1AA 4JI7Q 4DNIA 3HOVH 4DR1Q 5IWAL 1NMGA 1NJIC 3S15H 4C3HH 1HNXL 2WAQG 3HKZG 4DV5L 2YTXA 1E3PA 4X62L 2UUAL 1ASYA 3PUZA 1A8VA 2MFIA 4IJHA 4JBWA 4DV1Q 3HOZG 4R4QA 4HIKA 3S1MH 4A3EH 1Q81C 2B3GA 4DR5L 1EIYB 1C0AA 1K3RA 1GM5A 1UE1A 2IHFA 3W1GA 4HIOA 3KDFB 2UUBL 5IWAQ 1E22A 1I3QH 1VQCA 2R7FA 1I5FA 1A62A 4OONA 4BBRH 1FL0A 1PVOA 4KHZA 2OWOA 3H0GG 3S16H 1IBMQ 2BA0A 1M90C 2UU9Q 2R92G 5JJIA 3RN2A 2BA1A 4H02A 1X6OA 1JT8A 1I50H 2VQFL 3GTMH 3GTKH 3HOWG 5C44G 1VQDA 1XNQL 2UXBL 5M3MH 4DK6C 1VQHA 2FXQA 5M3MG 2R7DA 3RLOA 4LF8Q 4A3EG 4JI2Q 2F4VL 1J6QA 2OQKA 2RCNA 2B63H 1L0WA 4HJ5A 2NVXH 1EIFA 3CMAA 2B63G 4BXXH 1YBYA 2MO1A 4DR3L 3CPFA 5IYCG 4EX5A 4OWTB 5GAGC 4QJFA 1JE5A 4A3CG 4JBKA 3KDFA 1Y1WH 1XMQQ 1E1TA 2OQ0A 3CCEA 4DR7L 4DV6Q 4LF4Q 1K9MC 1HR0W 5IYBH 1OXTA 5IP7G 2I5HA 2R93G 2OTLA 1GO3E 3K0XA 1XMQL 3RZDH 2DGYA 2RF4A 3GO5A 1VQNA 2B29A 5IYCH 2UU9L 2DUDA 1I6HH 3UDXA 1L1OB 1SMXA 4DV6L 2E2JH 1JJCB 4ALPA 3ER0A 3T1YL 4DR4L 4DV3L 1C7YA 1PH1A 4DV4L 4IPGA 4TQUS 4A3LG 3STBC 1B70B 4OO1G 3UDIA 4LFBL 2CWPA 1FVIA 2JEAI 3F2CA 4HIMA 1SE8A 4DV0L 1HR0L 4X65L 1EWIA 4IJLA 4C3JH 4A3IG 1V43A 1VQJA 1K8GA 2JA6G 3NELA 4P71A 1HZBA 4UPAA 1VCIA 5M5XH 2PNHA 3BZKA 4JI3L 1NMFA 1ASZA 5AJ3Q 2NVQH 3S2HH 3M4QA 4L5RC 3ICEA 2YTVA 4DV3Q 1HNXQ 2CKZB 1VQFA 2IX1A 2Q2UA 2N8NA 1VQPA 3TEHB 1TWFH 2QEXA 2JEBI 4DV0Q 5GQOA 1HR0Q 3KJOA 3S1RH 1E1OA 1XPUA 2WB1E 5GAHC 3HKSA 1YJNA 1WFQA 4JI0Q 5LMUQ 4JYAL 2I0QA 4RG1A 4NB3A 1TWAH 3L7ZC 1K0RA 1VQLA 4PZ8A 3GTPH 1U0LA 2HHHQ 2ZTEA 3CCLA 2VZAA 4R4CA 2E2HH 1VQ6A 1UEBA 3G6EA 3LGJA 3GTOH 4ME3A 3H0GH 1YHBA 2VQFQ 4GNXA 3E9HA 3CP0A 1K8AC 1L1OA 3M7NA 4DV5Q 3RLNA 4K0KQ 4LFBQ 2Q2HA 1CUKA 1Z9FA 2Z0SA 4GLVB 5ELNA 1Z47A 5M3FG 2ZTDA 3PUVA 3K81C 4P74A 5M3FH 3J7ZC 4A3MH 1I94Q 4GKKL 2KCTA 4DAMA 1QUQA 1RL2A 1PH4A 3S14H 4GN5A 1PH5A 2KHJA 3AFPA 2GVBA 2AHOB 3TS2A 1AE3A 4JI6Q 4NXNL 3KF8B 4RMFA 2RHQB 5FLMG 4YHHL 1P8LA 3ERSX 4JOIA 4POFA 1B8AA 2HIXA 3TQYA 4HJ8A 2ES2A 3CMEA 3M85A 1IBML 4LFCQ 2CWAA 3L2PA 4B3TL 5ELOA 1PH8A 1KD1C 3GD7A 5JJKA 1IYJB 2ZM6Q 2K5VA 3KOJA 2E8GA 5IY0A 3CC7A 1XPRA 2JA8G 1X65A 4GLXA 1LUZA 1Y1VH 3FP9A 2CCZA 1Q82C 2UUBQ 3F8TA 4JI5Q 3JAMc 1IBLQ 3HOZH 1AE2A 4JV5Q 3CCUA 4DAYB 1UE6A 1VQAA 1CSQA 1O7IA 4MNOA 5DLQE 4IPDA 3J81j 4QQBX 1WYDA 1UE7A 3U4VA 1UE5A 5IE8A 1YHAA 3ULPA 3VDYA 3GTQH 4A3DH 1TWCH 4NPSA 1G291 3J80c 2VL6A 4GS3A 4DR2Q 1H95A 2JA9A 4R4TA 3W5OA 1PA6A 4GOPC 3EN2A 3HKZE 4LF9Q 3A5UA 1FJGQ 5K36G 1X9NA 2VS1A 5JEAG 5FJ8G 1VQKA 4A3JH 3TS0A 4R4OA 2CFMA 3HOYH 4DV1L 1HH2P 1VQOA 1A63A 5BR8L 5C44H 3D31A 2I5MX 2JA5G 1N32L 3K8AA 2E5LQ 1EUJA 5IP9G 4JI5L 4A4IA 3I4NG 1VQ5A 2ZJQA 1IBLL 4HJ9A 4BY1H 2UXDL 5C0XI 3CC4A 3TRZA 1HNWL 1YZ6A 1QVGA 2E2IH 4DR6L 3J7A5 2ZJPA 4OWWB 5HY6A 3AQQA 1E24A 1U5KA 4DR7Q 2UXBQ 4A76A 2R6GA 3WWVA 1TWHH 3M4OH 4JI6L 4DUZQ 3HOYG 1YJ9A 4P73A 4JI2L 1UWVA 3CCVA 2JQOA 2WAQE 4DV2Q 2F4VQ 1YVCA 4R4IA 1OXUA 2EXDA 4L5TA 5GROA 1VQ7A 2JA5H 1P16A 1N33Q 4B3RQ 3EIVA 1CKNA 1FGUA 1VQ4A 2JA6H 3CCJA 1Q46A 2VY3A 2Y0SE 4LUOA 2VQEL 5LMNW 2UUCQ 4DV7Q 1L2FA 1CSPA 5IYDG 3RN5A 1X3EA 4APVA 1S40A 3UDGA 3I2ZA 3HOVG 4IFDG 1PYBA 2NN6I 2K5HA 2ATWA 3MXNB 4JI4L 4O0AA 3L0OA 4DPGA 3KF6B 4P72A 2MQHA 5FLXc 1TWGH 2PMZE 3A5ZB 4OX9Q 4LF9L 2YTYA 2K14A 1PH2A 5LMUL 4JYAQ 1GVPA 3RZOH 1Y14B 3PIOA 2V1CC 1YEZA 3AEVA 2UXDQ 3PO2H 2IX0A 3BU2A 3CCMA 1BBWA 2RHSB 4KI0A 4JI8Q 3PO2G 3CW2C 4GN3B 5BR8Q 1X56A 4BBSH 1OXVA 2N49A 1KHIA 3T1YQ 1S72A 2ZM6L 4DR4Q 3EBEA 1YITA 3UDFA 3F2DA 4GNXB 3BJUA 4JG2A 3I55A 2ALYB 3A0JA 1OTCA 1G6PA 1BVSA 2XGTA 2Z6KC 4XTCS 4LFCL 1Q86C 4X65Q 4GOPB 1IXRA 1QZGA 3ULLA 1A0IA 1QUQB 1LM0A 1T9HA 1R9TH 3CAMA 4OX9L 2VQEQ 2UUCL 4A3DG 4HIDA 3G4SA 3F2BA 4R1JA 1KL9A 5FLMH 5LMNQ 4LW1A 4A3KG 1IBKQ 5E7NA 1PV4A 4DV2L 5C0XG 3IRBA 2F3IA 4KLKA 4PZ7A 3SGIA 4B3TQ 3BZCA 4LFAQ 3AFQA 2QA4A 4A3JG 4J15A 2R92H 2K5NA 3JC66 1N36L 2ZJRA 2JA7H 4OXPA 4LF7Q 3PGZA 3PSIA 4PG3A 1Q7YC 5JJLA 4HJ7A 4LF6Q 1PYSB 5C3EG 4YHHQ 2K75A 4LNQA 1GKHA 3HOWH 3S17H 5C3EH 1VQIA 1RIPA 4C2MH 1YNXA 2NZOA 1HNWQ 4LF8L 4PMWA 1PFSA 2YYZA 3PUXA 2ZTCA 4Y7NH 4GOPA 3U58A 1IL2A 3OTOQ 2I5LX 1K73C 1JB7A 2VNUD 3T1HL 1SRUA 4DR3Q 4JI1Q 3TREA 3U4ZA 4DUZL 2IY5B 1NBWA 1NTGA 4JV5L 1W2BA 5C4XG 3H15A 4YY3Q 4GKKQ 1D8LA 5EAYA 3G48A 2JA7G 4A3GG 4IOAA 4B3RL 5H1SE 1N32Q 1D7QA 4IFDJ 4UP8A 2GVAA 1PH9A 4BY1G 2Q2IA 3AYHB 4X6AH 1KC8C 1NY4A 3K7AH 5IYBG 5GADC 3GDEA 2UXCQ 2R7ZG 4A3BG 5IYDH 1EFWA 3STBD 5M5YH 4Y52H 2AWNA 1C9OA 2K50A 4AYBE 1X54A 1KRSA 3DLLA 4XIGS 1VS0A 1EOVA 1EQRA 4JI7L 4JI0L 1OXSC 4WJ4A 3PO3G 2QGQA 5LMNL 1WOCA 4DUYL 4B3ML 4GKJL
chains in the Genus database with same CATH superfamily
3ZYYX 4OO1I 1WVLA 4L5SA 5IP9H 2I46A 4YCVA 3HOVB 1X3GA 2FHTA 1DGSA 1MBYA 5HGQA 5EKIA 4LFAL 1R4PB 3NENA 4RHRA 2X69A 1FJGL 2Z8LA 1KXLA 3KUPA 2JA8B 2F0MA 1MKHA 3S2HB 4IFDH 2N3SA 2LSSA 1HTPA 4OELB 3U50C 1GUNA 2PQAA 4P2CB 2H1EA 4H7BA 4C3IH 3H3VH 5KYIA 3G71A 1VQGA 3G6JB 1LTID 4C2MB 2RQXA 2OTJA 3UE1A 3K7UC 1HA5A 3HOWB 3S17B 2E2IB 2F52A 1XNRL 4C3HG 5IT9E 2A19A 3RNUA 2C5CA 2SDFA 1YIJA 4JBJA 4LUZA 4J1MA 2EJGC 1O80A 1LACA 3HOUH 2AQ3B 1XPOA 1K28A 4RCOA 3CXCA 2A6EC 1XNRQ 1UAPA 1EY4A 2BH8A 3OW2A 4L8JA 4F7XA 2YU9H 5JEAJ 3FDTA 2O4XA 1VQMA 5EGTA 1W3SA 1EFID 4KK7A 1YHQA 4KHVA 4BA1I 5FO9B 4NXML 1KTKA 4IUPA 2KENA 4FDBA 1AFPA 1S5ED 2IT1A 3A8KE 3OYYA 3R2IA 3U9OA 3NEMA 5E4WC 3ZJYC 4CDEC 4FF4A 1SNMA 1DD2A 1HNZL 3NWTA 3HOUG 3KK7A 2QW7A 4EQ5A 1PHJA 2MNAA 4IO9A 1XYIA 1WCMH 5I2YA 4LWCA 2ASBA 2H5XA 4DR2L 4B3MQ 2M00A 5FJ8H 5JEAH 4DUYQ 4AH6A 1Y1WG 1VDZA 3E0EA 4CDFC 4GNXC 3IFTA 2C9OA 4FNFA 3J81i 4NXNQ 2JYOA 2Q8IB 4DV4Q 1KRTA 5D3IB 3PIP3 3UI2A 4KKSA 3FKIG 3GTLH 4I65A 1EU3A 4B08A 3H3VI 4A3CH 1CK1A 1KABA 4FF1A 2N78A 1JJGA 3TZDA 2HIVA 5IT9c 4GKJQ 1HUNA 2FJ2A 1FD7D 1HFGA 2EIFA 3QOJA 5C5MA 1A6XA 4AQYL 2KBNA 1NR4A 3KLRA 1AH9A 2EPBA 4A3JB 3NP8A 3PUYA 4X62Q 1BO0A 2NZHA 4UP9A 5M5WB 2KA7A 3PIPA 3PO3H 2F0OA 1MJEA 1GHJA 4DNRB 3K59A 4LUVA 3LWUA 1ICWA 2VUMG 4ILWA 4HMIA 3D4WA 3FPUB 2IJ0A 3LWEA 2ZXRA 1HRJA 2Z4IA 4KD4A 3S15H 1NCVA 4R4QA 4HIKA 3PO2B 1HCZA 2PW5A 4DR5L 3NPPA 3KF8A 4HCEA 3EQLC 2EYOA 2IL8A 1SNPA 2R7FA 4BBRH 1BOSA 3K7AB 2OWOA 3H0GG 3WOEA 3RN2A 2N88A 1MSGA 2BA1A 3SK5A 1I50H 3HP3A 3VR6A 4JVZA 5M3MG 5ELFA 4LF8Q 4JI2Q 3SVMA 2F4VL 1J6QA 3N52A 2B63H 1LLRD 2A69D 2NVXH 2B2WC 2B63G 2IPKD 2EY2A 1RCVD 1QB5D 1O78A 4OWTB 3MFYA 4KN4C 1WTQA 2XRSD 1WTXA 1IKLA 1IYVA 2X6LA 1HR0W 1OXTA 3I72A 4YIJA 2L5TA 3K0XA 1F2LA 1PYWD 2A74C 5IYCH 3Q24A 1I6HH 1SMXA 4A3KB 2EVBA 5T1IA 2F0VA 5I6YA 2K03A 1PLFA 1C7YA 1PH1A 5FLXE 2HUGA 5LHY1 4IPGA 4TQUS 4A3LG 1SYGA 2EYPA 3STBC 4OO1G 3UDIA 4A3DB 2CWPA 1FVIA 4HIMA 4DV0L 1CI3M 4KD3A 4C3JH 5M5XH 1SE2A 5D65A 2NVQH 2CHBD 4L5RC 2PMZB 4RGMA 3PIO3 5IODA 4DV3Q 1EU4A 1WTHA 5ELEA 1L0YB 2N8NA 1JE4A 1A3UA 2M9VA 5A35A 1XPUA 2CW0D 2K33A 4DN4M 2VXWA 3HKSA 4JI0Q 2XSCA 5LMUQ 4JYAL 4RG1A 4NB3A 4CGYB 1K0RA 1UEBA 3GTOH 2VQFQ 1SDFA 1L1OA 3M7NA 4DV5Q 4K2KA 3RLNA 2Q2HA 4GLVB 2Q8RE 1Z47A 1PZID 3K81C 4A3MH 1RL2A 4MTKA 3F2UA 1C48A 3DMUA 5A2QE 4NXNL 5FLMG 1K3BC 2KUMA 3ERSX 3I90A 2L4NA 2V4DA 4POFA 1B8AA 1LTAD 4HJ8A 2PPBC 1I4XA 4U673 2E74C 4B3TL 3KOJA 5IY0A 2DY8A 2E8GA 1GHKA 1X65A 1Y1VH 5CV7A 2UUBQ 2FMMA 3F8TA 1IBLQ 1UE6A 3EVQA 3H94A 3KLSX 4K14A 4MNOA 4LJZC 5ELDA 1Y69U 1UE5A 1SNQA 1YHAA 3GTQH 4A3DH 1TWCH 4QIWB 2JA9A 4R4TA 3W5OA 1PA6A 1GXDC 4GOPC 5K36G 4WRDA 4A3JH 4R4OA 3VA7A 1X3QA 1VQOA 1KNEA 3D31A 4IUTA 1N32L 2E5LQ 1DCZA 4JI5L 3QIAA 5IT9L 4BY1H 4AYBB 2WIIB 3BDCA 5HGTA 5C0XI 4OIKA 4E6IA 1QVGA 4DR6L 3DWAA 3J7A5 2ZJPA 1U5KA 2PO4A 4CJ0B 2EYJA 4A76A 2R6GA 4K5XA 4FXGC 3T13A 4JI6L 1BCPB 1M8AA 5IGFA 4JI2L 1UWVA 2F4VQ 2WAQE 1YVCA 5EKKA 4R4IA 1H9KA 1OXUA 1Q3LA 3GTKB 2F0HA 1VQ7A 2KECA 4B3RQ 1B2TA 3S9WA 3EIVA 1VQ4A 1Q46A 4LUOA 2UUCQ 5C4HA 4DV7Q 2JA5B 4BS9A 1L2FA 1X3EA 4IFDG 4UDUC 3J7AV 2AQ1B 2PMZE 1B4OA 2NN6H 2BE5C 3TP6A 3PIOA 3AEVA 4PNYA 5C4ZA 1KDAA 2RHSB 1TY0A 3PO2G 5FKAC 2F0FA 4GN3B 5BR8Q 5C3WA 4RFBA 3RD4A 2N49A 1KHIA 1PRTC 4DR4Q 2B39A 1RD9D 3I55A 3A0JA 4HAEA 1IYUA 1TQOA 5DAUA 5BN5A 2XGTA 2Z6KC 1E2WA 3HEJA 3DEOA 1B44D 2WB1B 1IXRA 4GOPB 5CR3A 2DNEA 1LM0A 5I4DA 2L1BA 3CAMA 4OX9L 4FXDA 2KCNA 1DOKA 1M4VA 4A3DG 2BCOA 5E7NA 1PV4A 5FO7B 4DV2L 4PZ7A 5IGCA 3QJYA 3NSWA 4J15A 1X32A 3T56B 2R92H 4BY1B 4HJ7A 1FNVA 4YHHQ 4LF6Q 4LNQA 3BZDB 2A73B 4FO2A 1RIPA 1HNWQ 1SMYD 4Y7NH 2WKCA 4GOPA 1STGA 2I5LX 2D5DA 4C3JB 3QOLA 2Z4HA 2F03A 2RDFA 4DR3Q 4JI1Q 3C3LA 3U4ZA 2F1MA 2OT2A 4NP5A 1Y8PB 1W2BA 4F88A 5H1SE 1BQQT 1PH9A 5EBDA 1E2VA 5IYBG 2XWBB 2Q8TA 1F9PA 3K5OA 1EFWA 1Y8OB 1C9OA 2QKIC 4AYBE 1X54A 1TU2B 4O42A 1EQRA 1CA6A 5M5YB 2EDGA 1OXSC 4WJ4A 1I4GA 2PNRC 2QGQA 1V8QA 5EQ0A 3M4OB 4JI4Q 4JI8L 2PCFB 2WB1G 3I4NH 4DXFA 3ULJA 1N36Q 4NXMQ 2DJFC 4A93B 3E5SA 4ZUIA 1ZYRD 3FKIH 3IFDA 1GUWA 4ZK9B 4P75A 1F9QA 4XT1B 1WD0A 4QY7A 1MIUA 5FOBB 2J4XA 4YWMA 1SMYC 2C35B 2KHIA 2AWOA 2B8GA 1GD7A 4BBRB 1TR5A 1G2TA 2VUMH 3A74A 4A75A 2IHEA 2E2JB 3SEBA 1PH6A 1RF2D 1WI5A 4A93G 2Z6KA 3VYUA 2B2TC 1TWFB 5F2DA 3PF5A 3GV3A 1XJVA 1B9MA 1EZ8A 4X64Q 3OSOA 1AZPA 2RSNA 4QMGA 4UP7A 1KQSA 3RLFA 3FMCA 2Z6BA 1B3AA 1N8RC 3M3YH 4QF4A 1CHPD 1B50A 4YWKA 3CCRA 2JXMB 4QB4A 2K4KA 4UY8C 2MJ8A 4JC0A 3DWPA 4CJ1B 2WKDA 1U4RA 3MFGA 5IGGA 3D8GA 5TSSA 1PZKD 4KHPL 2TSSA 4EVOA 4LF6L 4CJ2C 1VQEA 4X66L 2B2UC 3MWYW 1CKMA 2ZXOA 3M4YA 2G9DA 2NVYB 1WCMG 2ZT9C 3I91A 2LXKA 3S1RB 3OOCA 2O5JC 2EXZA 2RA4A 4J6HA 3TMEA 5C4XH 1V9PA 4LF5Q 1FYCA 4IFDI 3T1HQ 1MSHA 4G7HC 1SROA 1D1KA 4DNTB 3DM3A 1PH3A 2SOBA 1QVFA 1CZGA 3FHWA 4JPBW 4YCUA 3PF4A 1QILA 2XIWA 3I4OA 3GTJH 1OXXK 1ZXTA 1N9WA 2BH2A 1AP0A 1SR3A 2AMCB 4LF7L 1O7LA 3CPWA 4RWSC 4YCWA 3AMUA 3PO3B 4ZLTF 4CKEA 3A56A 4QIWE 3CRKC 2CVRA 5C3EB 1CM9A 4HEDA 2XNAC 3VR3A 4JI3Q 2WFWA 1FNUA 3KYHC 1BBUA 2JA6B 3M4PA 4DXGA 1RTNA 5HURA 4OHJA 1EQTA 1BUVT 1F2YA 4XQQA 3X3NA 3JAMi 1D5ZC 3V2TA 3R93A 1SNOA 1K83H 2Y0SG 1J5EQ 3RR5A 4QL5A 2D9UA 4HR7B 1BKBA 1LTLA 1UUPA 1MJCA 4JI7Q 2KCCA 5BN3A 1F2ZA 3HOVH 2L55A 1NNXA 2DY7A 3MAQA 1NJIC 1SEBD 3HKZG 3NBHA 1ASYA 3JAME 1A8VA 2MFIA 3HG9A 4IN3A 1W6KA 4CKCA 3HOZG 4A3EH 2I07B 1K3RA 3EJIA 5KNCA 1PXUA 5JVG3 2K5DA 1KLGD 2UUBL 3KDFB 1E22A 1JR0D 5COYA 4KN7C 1STBA 1A62A 1SJED 4OONA 1FL0A 4LK1C 4IUUA 1A3VA 4G7ZC 1TWGB 5JJIA 3MXPA 2B2UA 3NUCA 3D4DA 1B9NA 5M3MH 4ZKBB 1VQHA 2FXQA 1LT4D 4A3EG 4ID6A 1ESFA 4HJ5A 5FLXL 3CMAA 3MVVA 4BXXH 2EY6A 2MO1A 4DR3L 3CPFA 5IYCG 1JE5A 1XMQQ 1E1TA 3CCEA 4RGNA 1O7YA 4DR7L 2WACA 3P75A 1K9MC 1LTRD 2D2CC 3CHBD 3NTIA 2I5HA 5IP7G 2R93G 1GO3E 1VF5C 2TMPA 2UU9L 2DUDA 1L1OB 5CV8A 4DV6L 3D4RA 2E2JH 1JJCB 2F0PA 3T1YL 4DV3L 3MXNA 1B70B 3A8JE 1SE8A 1K8GA 1JORA 4UPAA 3HOZB 1VCIA 2PNHA 1ILPA 3P1HA 1EIHA 1HNXQ 1IW7C 1JWSD 1BBXC 2Q2UA 1JOQA 2A5HA 5A2QL 1Y8NB 2BDOA 2JEBI 4L63B 5GQOA 4DV0Q 1W6JA 3MXUA 3KJOA 3DWQA 2SNSA 1ILQA 2H4OA 3I8ZA 5GAHC 4A3MB 1PTOH 1WFQA 1YJNA 2DJGC 2RKSA 1HHVA 1U0LA 1A3TA 1KDCA 2HHHQ 3CCLA 4R4CA 2E2HH 3G6EA 3A7AB 1CQFA 1YHBA 3GTJB 1K8AC 3TZUA 4K0KQ 3TN2A 1Z9FA 5M3FG 4P74A 5M3FH 4KY5A 1QUQA 3FPPA 1PH4A 4GN5A 1PH5A 2MPMA 3K57A 1STHA 2KQ3A 5FK9C 3TS2A 1AE3A 4JI6Q 1ENCA 3TSSA 4RMFA 4KMUC 1XWEA 2BOSA 2ES2A 3TQYA 3CMEA 4NKLA 3Q0AA 4V190 1PH8A 2F3VA 2A6HC 3L3OC 3CC7A 1U4MA 1HUMA 4JI5Q 1KDBA 5IOCA 5C44B 4JV5Q 1VQAA 4QQBX 4IPDA 2NWGA 5IE8A 4RGTA 2BE5D 1NSNS 3IL8A 2VL6A 2O2LD 1PTOC 1TS2A 2VS1A 3TS0A 2CFMA 1DYQA 3BDLA 5IP9G 2LMCB 1SSOA 1IBLL 3P7JA 4HJ9A 2JA7B 1HNWL 1YZ6A 5FO8B 2E2IH 1EQVA 5LL6S 2NB0A 5NUCA 4OWWB 1E24A 1QJOA 1TS3A 1EYAA 5CV6A 2UXBQ 2B63B 3WWVA 4M1UB 1SJHD 3HOYG 4KY6A 4P73A 1I4RA 4DV2Q 3QG1A 3J7YW 2EXDA 4L5TA 3BVZA 2JA5H 1P16A 1N33Q 2E76C 3FKIB 1YNNC 1RJTA 4DK0A 2JA6H 1KNAA 1CSPA 3RN5A 3TBIB 3UDGA 2NN6I 3L0OA 2QF7A 4DPGA 3KF6B 1V1OA 2MQHA 1TWGH 4OX9Q 1PH2A 1A2UA 5LMUL 4JYAQ 3RZOH 2UXDQ 2V1CC 1YEZA 2J7ZA 3PO2H 5E3FA 3BU2A 1JWUD 1I6HB 4KI0A 2MGSA 1U4PA 5CYUA 3K6OA 4J8QA 3SXHA 1X56A 2MP1A 3HGBA 2XRQD 4X3KA 1LT5D 1STAA 2ZM6L 3T1YQ 3IAYA 3F2DA 3QB3A 4GNXB 1PMRA 2K6AA 4JG2A 1G6PA 3J7AF 5T1GA 4LFCL 1PRTD 3OMGA 1QZGA 1ENAA 3ULLA 1WTWA 1QUQB 1E2ZA 2UUCL 4HCSA 2PZWA 4HIDA 1KL9A 5LMNQ 4LW1A 1ET9A 1BCPC 3IRBA 3SGIA 4KLKA 1PRTB 3BZCA 1E0BA 5C0XH 3URYA 3MEHA 2K5NA 3JC66 2ZJRA 2K01A 4OXPA 4LMQD 2A69C 4ABNA 1PYSB 3BVGA 3HOWH 3S17H 1T5EA 1UEAB 1QNUA 2NUCA 2R92B 5EJWA 1ZKOA 4C2MH 2NZOA 1HFNA 2YYZA 2CW0C 3OTOQ 1VMPA 1JB7A 2VNUD 4N9TA 3FRPB 3HOUB 1NTGA 4JV5L 5C4XG 3H15A 4YY3Q 4GKKQ 4B3RL 1QWYA 4TRDA 1N32Q 4ULLA 1D7QA 4RKLA 3G7LA 4H44C 2GVAA 5M3FB 4X6AH 4CBVA 1KC8C 3S16B 2UXCQ 1EIGA 3VA5A 2R7ZG 1JICA 3STBD 3J80E 1FNWA 3K5NA 1S5DD 1KRSA 2E2HB 1VS0A 4JI7L 3PO3G 2NTSA 4A3LH 4Y7NB 4K0KL 4C3HB 1U4LA 1SYEA 1WCMB 2F3WA 4DK3C 1H9JA 1BCPD 3OTOL 4LF4L 4TVAB 1SXTA 5CBAE 3S1NH 5AJ3L 3O13A 4A93H 3E9IA 1I50B 2LXJA 1SBBB 5D3DA 1QG7A 1ZYRC 1YNJD 5DM63 4A3FH 1TWAB 3F1ZA 1S3OA 1CKOA 2WP8J 3RUZA 1PH7A 3T16A 4HJAA 1YJWA 2N55A 4C3JG 5C6AA 4DFAA 1SE3A 4POGA 2JJQA 5EPKA 2B2YA 2MO0A 3HOXG 4A3KH 1JJ2A 3HOXH 2B8FA 1Z6HA 2Q2TA 3NBIA 1STEA 1XMOQ 3J80i 2CQOA 3B6YA 3MC0B 2RBMA 1CKNB 1WJJA 2YV5A 2RSOA 4A3FG 1N33L 1G51A 1B53A 1SE4A 1HZAA 4A3GB 5ELBA 3MEFA 3W3AA 2F0NA 1GUSA 1SN8A 1G6ZA 1JQYD 1I4QA 3I4MG 2OCEA 1XMOL 4BBRG 4U68A 3S1QH 3I73A 3KF6A 3GTGB 1SLJA 1SFOH 2JA8H 2G9HD 3GQBA 1EY7A 5CC4A 4B3SQ 4DR1L 2GN5A 3UE0A 5CV4A 1SYCA 5GAEC 4KJNA 1XX8A 2A8VA 3D6CA 4OWXB 3QR8A 3W1BA 3A55A 3LNNA 5C4JH 1EYCA 4L5QA 3DM1A 4BXXG 2R7ZH 1RHPA 4KHPQ 3J81c 1IZ6A 2JE6I 4A3FB 1I6VC 1JMCA 1I94L 1TS4A 2NVTH 2IX3A 2PI2A 2RCFA 3OWEB 2D0OA 3I7FA 4XXEA 5JPNC 4DV7L 2R93B 1JC7A 4AIMA 5KIXA 2KCMA 1IBKL 3CCQA 4A3BH 1YI2A 1QVCA 3K5LA 4X64L 1LT3D 3NTKA 2F0IA 1ESRA 1VQ9A 1SFOB 1AW7A 4G57A 4KY7A 3CC2A 3KLSA 3Q8DA 4A3GH 3PV0A 3HKZB 3OMCA 1TIID 4HTHA 4QGUA 5IP7H 1PFMA 2E5LL 1E7ZA 1EYGA 3JAML 4BA2I 3M9BA 1J5EL 3GV6A 1NE3A 3S2DH 4I7ZC 1B1ZA 3Q22A 2YU9B 3VR4A 2NYZD 4DR5Q 4A3MG 2L15A 1CTMA 2A68C 2PQAB 4BY7G 1TWCB 2PI2E 3L9AX 3E3XA 4JCVE 1OO9B 2JK8A 1HJPA 3I3CA 1EQQA 5J39A 4DNIA 5KNDA 2WAQG 3I4NB 5LL6X 4X62L 3SE0A 1WTPA 4JBWA 4DV1Q 3S1MH 1Q81C 2B3GA 1EIYB 1GM5A 2IHFA 3W1GA 2EYLA 2KVMA 1LTBD 1G8ZD 1I5FA 2F0EA 1PVOA 1LO5D 1SAPA 2F4IA 2KOLA 4HMJA 3S16H 4O1NA 3BVMA 1IHZA 2F0LA 4H02A 2SEBD 3RMHA 1X6OA 1IW7D 2VQFL 3GTKH 1VQDA 2F0JA 4CKBA 1CQVA 5CV9A 2R7DA 1SNDA 3J81L 3GTMB 4DK1A 2PZUA 4ZQ3A 1L0WA 3A8IE 1GUOA 1YBYA 4EX5A 1GOZA 4K6LA 1Y1WH 4JBKA 5G3LF 2LKVA 1JB3A 3S15B 4DV6Q 2LS01 3OWFA 4UHVA 4LF4Q 5IGBA 1QOHA 5IYBH 2KEDA 3HZXA 2AUKA 1XMQL 4B9XA 1CFMA 2B2TA 2DGYA 2RF4A 1WTVA 3GO5A 1VQNA 1H9SB 2B29A 3GTPB 4QCLA 3UDXA 4K5VA 5DEHA 1LTGD 3C2PA 2DNCA 5M9OA 4DR4L 2K28A 2Z1CA 4DV4L 2L11A 4PV1C 1LV9A 2E2DC 1HR0L 3M3YB 4X65L 1EWIA 4IJLA 1R4QB 4A3IG 2JA6G 3NELA 4P71A 1HZBA 2QILA 3BZKA 1NMFA 1ASZA 5AJ3Q 3S2HH 3M4QA 3NWSA 3ND9A 1VQPA 1TWFH 2K5QA 3SR1A 1ENFA 4TSSA 2Y0SB 4WJWA 3W2DA 1D2BA 2WB1E 2NVTB 4PZ8A 3S1NB 2G5DA 2E75C 3VR5A 3LGJA 4ME3A 2RDGA 1ML0D 1U9RA 3CP0A 4IZ8A 3KBXA 4FP5D 4LFBQ 2Z0SA 4RCNA 1H9SA 2ZTDA 3OW7A 3J7ZC 1I94Q 4GKKL 1L0XB 1RODA 2KHJA 2OXPA 3TP7A 5CMDA 1CT1D 2CH4W 3KF8B 2RHQB 1P8LA 4JOIA 1LT6D 2QDLA 4K6DA 2F0DA 1GUTA 4FVMA 2RVLA 1IBML 2CWAA 1Q8IA 5ELOA 1KD1C 3GD7A 5JJKA 2K04A 1IYJB 1TKWB 2K5VA 5C3XA 2ZM6Q 2F0WA 3MHBA 1XPRA 3SDZA 5J1ZA 3FP9A 4Q0FA 2CCZA 3P20A 3U9SA 4DF7A 1Q82C 3CCUA 2A6HD 4MIUA 5K5PA 3ULPA 1T5XD 4NPSA 1EOTA 4XDXA 1G291 3J80c 4X3TA 3M7GA 3R8BA 2B2YC 4LF9Q 1FJGQ 4WORA 2F0QA 5KGUA 5JEAG 5FJ8G 1BR9A 1EEFD 1VQKA 3HOYH 3FEWX 1A63A 3ERQA 5C44H 2XVSA 2JA5G 3K8AA 3WDNA 3I4NG 1VQ5A 2ZJQA 4V0BA 2UXDL 1ZEQX 3TRZA 2KEEA 4G4KA 1XTCD 2F0KA 1STNA 4DR7Q 4C3IB 3Q6SA 2NTTA 4BBSB 1CHQD 1XXGA 1TWHH 2EY5A 4OIJA 1YJ9A 3CCVA 2JQOA 2EJMA 1EY0A 5GROA 2HCCA 1QE6A 4DAYA 3CCJA 5LMNW 4XYQA 2VQEL 1JCKB 4OGQC 4APVA 1EY8A 1SYFA 2ATWA 1K8MA 3MXNB 4HSPA 4P72A 3LX0A 5FLXc 4CDDC 3A5ZB 4LF9L 4OO1H 3HRZC 3VR2A 1GVPA 1Y14B 1BDOA 1G91A 1BBWA 1PTOB 3CW2C 1OXVA 3GTLB 4HSVA 3X3MA 3EBEA 2JSOA 1YITA 1WD1A 3V05A 2ALYB 1K8OA 1FR3A 1TT2A 3NQTA 1Q90A 3OPOA 1Q86C 2EE1A 4EQOA 4G7OC 4RAUC 4K2LA 5G3LD 2L12A 1T9HA 1NR2A 1RKNA 3C1FA 3G4SA 4R1JA 5FLMH 1S5BD 4A3KG 1JWMD 2AQ2B 5C0XG 4PMBA 4RGOS 4A3BB 2NBFA 1VF7A 2QA4A 1AZQA 3I4LA 1N36L 3PGZA 4PG3A 1Z7TA 2RDHA 5JJLA 5C3EG 2K75A 5D14A 5C3EH 3HS0C 1YNXA 4M8AA 4MHEA 4LF8L 1PFSA 2ZTCA 3U58A 2HDMA 1SRUA 1O7ZA 1HQRD 3EROA 4DUZL 2IY5B 2F0GA 1NBWA 3K5MA 1LTTD 2F0UA 4PMCA 1HQMC 5EAYA 3G48A 3MXGA 2JA7G 1V1PA 4A3GG 3S2DB 2L0CA 2R61A 1ICFB 5CORA 4UP8A 1CA5A 4BY1G 2Q2IA 1NY4A 5GADC 2HDLA 3GDEA 4A3BG 1EYDA 1CZWA 3H0GB 4Y52H 2EYFA 2AWNA 3VYRA 3DLLA 5K36H 3BYTB 1EWHA 4PQXA 1BCPF 3A7LA 5LMNL 1KLUD 1WOCA 5I9OA 3SK4A 4EGVA 4GKJL 1AN8A 2NVYH 2K52A 4JBMA 4LF5L 2NVQB 3T51B 1V1PB 1J8IA 4XQJA 1N34L 4IPHA 3KJPA 1BF4A 5BN4A 4X66Q 2WAQB 2AKWB 2PYKA 5IIFA 4FF3A 3CCSA 2QCPX 1PZJD 2CQAA 4K5WA 1SNCA 1KAWA 2ID0A 2B2VA 2NN6G 3BYYB 1VQBA 4GLAC 4ME5A 4AQYQ 3H6MA 2Z9HA 3RZDB 2D62A 4FYDA 4R8IA 3BG3A 5J22A 4IOCA 3I4MH 5C0XJ 4NMZA 4C1NI 1V1QA 3CD6A 5EPLA 1XTDA 3K80C 4KKTA 1N34Q 1Q1BA 4GZYC 2F0TA 1Q1EA 3KFUA 1JOOA 3DHQA 5J3BA 2BDNA 2VB3X 1Y1VG 1TXYA 3S24A 1B7YB 2ICEC 4ODGA 4PZ6A 3KLWA 3S1QB 1KIXA 3NHHA 4ZYSA 3WOFA 3K0YA 2EYHA 4ZRZA 4BBSG 4TKOB 1HNZQ 4DGZA 5JAVA 4DR6Q 2LY7A 3NE5B 2VW9A 2L9HA 2SNMA 1SYDA 1HZ9A 2P5ZX 4IURA 1F77A 3CF5A 1HXYD 1B3QA 2R93H 5JPMC 3R2TA 1PTOD 1EEID 2NZ1D 4O2DA 2VUMB 1QZHA 5KYLA 1X3FA 5IGDA 5C4JB 2DN8A 2EZVA 4Z9CB 1PTOF 5KRUA 2UXCL 3PCOB 4YY3L 3S14B 3DXJC 1LYLA 1QNKA 3SK8A 1L1OC 1PFBA 1EL0A 3CQZH 4A3IH 2EQSA 5IGEA 5CBEE 3GTGH 3PUWA 3HFZB 5CV5A 3ONAB 5JJZA 1I4HA 2HHHL 4FXKC 4I7AA 3I56A 1DZ1A 4GN4B 3VYSA 1X55A 4JOIC 5ISRA 4N8X1 2KHSA 3VYTA 4DU9A 2XTIA 4IPCA 2CH4A 4YWLA 2M2LA 4A3EB 2A6ED 1Y1VB 5ELCA 4MTNA 4B9WA 4B3SL 2MUYA 1LABA 3D0FA 4RA8A 3ND8A 4JI1L 2HT1A 1Q12A 2K32A 3NBHB 2B2VC 2UUAQ 1A2TA 3D3RA 2PW7A 4DKAC 4MZ9A 1HZCA 4RHSA 3MA2B 4CHTB 5I6WA 5M5WH 1VQ8A 4BY7H 2X6GA 1XNQQ 2HD3A 3NXWA 2WV6D 1R9TB 4IALA 2D0PA 1II3A 1K0SA 2HQLA 1Q8KA 1H9MA 2K7VA 1M1KC 4QUCA 4WJ3M 4AYBG 2A1AA 4BWGB 4DR1Q 5IWAL 1NMGA 3AU7A 4C3HH 1HNXL 1DM0B 3ITPA 4HN7A 2YTXA 4DV5L 1E3PA 2UUAL 3CQZB 4A3IB 3PUZA 4IJHA 3OIQA 4IUVA 1RTOA 3OHXC 1F9SA 2K1BA 3J80L 1C0AA 4X3UA 1DONA 3PMFA 1UE1A 4C3IG 1S5FD 4HIOA 5I9PA 1ET6A 1GUGA 5IWAQ 1I3QH 4XT3B 1VQCA 2PQEA 4ZCKA 4KHZA 1QCBD 1S4ZA 3DUZA 2QEJC 1IBMQ 2BA0A 1M90C 2UU9Q 2R92G 4EQPA 1STYA 5L37A 1JT8A 2UXBL 3HOWG 3GTMH 5C44G 4S3SA 1XNQL 1MGSA 4DK6C 1PDQA 2IW3A 5EPJA 4UAIA 3V96A 3RLOA 1YNJC 2JP1A 1DOMA 2OQKA 2RCNA 3E0JA 3BDOA 1EIFA 1HTLD 2EOTA 3EA6A 1EY6A 4A3CG 5GAGC 2LFNA 3N6RA 4QJFA 4IUNA 3KDFA 2XN9C 2OQ0A 5DM73 1DXMA 3C46A 3MTSA 1PFNA 3FVQA 3A54A 5E1FA 2O5IC 2VB2X 2OTLA 1BNZA 3T4AC 4K8IA 4JW0A 3RZDH 4IQZA 2HQEA 3K58A 1Y1WB 1D5XC 1EZ6A 4ALPA 3ER0A 4ZAIA 4RKBA 5JOBA 1EY9A 1J9OA 5EKLA 3SK6A 4DA2A 4LFBL 1EY5A 2JEAI 3F2CA 3MZ5A 1H9RA 1BXTA 4F87A 1V43A 1VQJA 1S5CD 4L6TB 4JI3L 2KJXA 3ICEA 4EQNA 4WFN3 2OEOA 2YTVA 2CKZB 2ZXPA 4XQNA 4X3SA 1VQFA 2IX1A 3TEHB 1G2SA 4CDCC 2QEXA 1HR0Q 1FGBD 4NDXA 4C56C 3S1RH 1MHWC 1E1OA 1HPCA 5EBCA 4N8FA 2FFKB 2EYMA 2MHVA 2I0QA 3NQIA 1TWAH 3L7ZC 1VQLA 1TS5A 3RZOB 5C5LA 3GTPH 5M3MB 3I70A 2ZTEA 1MI2A 2VZAA 4KV6A 1VQ6A 3H0GH 4GNXA 3E9HA 4H13C 2HCIA 3GTOB 5ELNA 1CUKA 1NUCA 3PUVA 2KCTA 4DAMA 3S14H 3CU7A 4RH6A 3AFPA 2GVBA 3D6WA 2AHOB 4ZUJA 4R9WA 1F9RA 4YHHL 4K8JA 4KTAA 1GJXA 2HIXA 1MD2D 3M85A 4LFCQ 3L2PA 1D5MC 1PRTF 2JA8G 4DAVA 3TDQA 3AB9A 5CGKA 1IL8A 1WTOA 4GLXA 1LUZA 4N9PA 3JAMc 3HOZH 1AE2A 4DAYB 3J81j 1CSQA 1O7IA 5DLQE 1WYDA 1UE7A 3E6ZX 3U4VA 3VDYA 2A68D 3H09A 4GS3A 4DR2Q 1H95A 3QWNA 3EN2A 3HKZE 3A5UA 1F2MA 1X9NA 3SHLA 3S1MB 1RDPD 1UNSA 4DV1L 1HH2P 2R3ZA 3R3OA 5BR8L 3TP5A 2EJFC 2I5MX 1EUJA 4A4IA 4KKUA 1SYBA 3CC4A 2XWJB 5HY6A 3AQQA 4C1NK 1DOLA 3HOYB 1YNND 3Q23A 3M4OH 4DUZQ 1C4QA 5AFWA 1CKNA 1FGUA 2GA4B 2VY3A 2Y0SE 3QO2A 3T53B 1DJRD 2K05A 5IYDG 4OL7A 1S40A 1EWCA 2EY1A 3CRLC 3I2ZA 4IUQA 3CKIB 4MN3A 1ONLA 3HOVG 1PYBA 4DAPA 2K5HA 3J81E 1TWHB 4JI4L 3H3VC 1HA6A 3KBGA 4O0AA 2YTYA 2K14A 3BS1A 5C4XB 1VMCA 2J0TD 2IX0A 2B2WA 2FMCA 3CCMA 2R7ZB 2NVXB 4JI8Q 4XYOA 4QUFA 4BBSH 1TY2A 4JK1C 2WINB 4LAAA 5DNFA 1S72A 5E4XA 3UDFA 5M5XB 1AEXA 1JOKA 3BJUA 5JVH3 1OTCA 1BVSA 4XTCS 2AUJD 3DEPA 5KNBA 2ENBA 4X65Q 4BY7B 1A0IA 1K83B 1I4PA 1R9TH 2VQEQ 3F2BA 2IWHA 1TVXA 4H0LC 3C1EA 1NAPA 1C8CA 3EFXD 1IBKQ 4B3TQ 2F3IA 4R8NA 4LFAQ 3AFQA 4A3JG 2JN4A 1X3PA 1D6EC 2PZTA 3H91A 2JA7H 4LF7Q 3PSIA 1Q7YC 3GP7A 1GKHA 2K5WA 4OEMB 1VQIA 1LTSD 4KJOA 3HOXB 1A15A 1WTRA 4PMWA 3PUXA 1IL2A 1I3QB 1K73C 4ZKCB 5KEEA 3T1HL 3GTQB 2OF1A 2QDBA 4NW2A 3TREA 2F0SA 1D8LA 3OIPA 4IOAA 4IFDJ 1IKMA 2FINB 3AYHB 4F8MA 2ICIA 4Q5VA 1D1IA 3K7AH 5IYDH 3PQIA 3IKJA 5M5YH 3I4MB 2K50A 1KAAA 4XIGS 3NK9A 1EOVA 4JI0L 3NTHA 4DUYL 3TP8A 4B3ML 4FF2A 5I2XA
chains in the Genus database with same CATH topology
4A3LH 4K0KL 2NVYH 4JI4Q 4JI8L 2K52A 4JBMA 4OO1I 4LF5L 2WB1G 4DK3C 4L5SA 5IP9H 4YCVA 3I4NH 3OTOL 1X3GA 3ULJA 1N36Q 4NXMQ 1DGSA 5HGQA 1N34L 4LFAL 4LF4L 4IPHA 3KJPA 4TVAB 3FKIH 3NENA 3S1NH 1FJGL 4X66Q 5AJ3L 4P75A 1KXLA 4A93H 2AKWB 4QY7A 1MKHA 3E9IA 3CCSA 2LXJA 1MIUA 2N3SA 2LSSA 1KAWA 4YWMA 2ID0A 4A3FH 3F1ZA 2C35B 1S3OA 2NN6G 2KHIA 1CKOA 2AWOA 1VQBA 2WP8J 4GLAC 4AQYQ 1PH7A 3U50C 1GD7A 2PQAA 2D62A 4HJAA 1YJWA 2VUMH 4C3IH 3H3VH 4IOCA 4POGA 5C0XJ 3I4MH 2JJQA 2MO0A 3A74A 3G71A 1V1QA 3HOXG 4A75A 1VQGA 2IHEA 4A3KH 1JJ2A 3CD6A 1XTDA 3HOXH 2OTJA 3K80C 1N34Q 1PH6A 1Q1BA 3UE1A 3K7UC 1WI5A 4A93G 2Z6KA 1Q1EA 3KFUA 2Q2TA 3PF5A 2F52A 3J80i 5J3BA 1XMOQ 1XNRL 2CQOA 3B6YA 1XJVA 4X64Q 2A19A 1CKNB 1Y1VG 1WJJA 1TXYA 2YV5A 3S24A 3RNUA 1B7YB 4PZ6A 1G51A 4UP7A 4A3FG 1KQSA 3RLFA 3KLWA 1HZAA 1YIJA 3MEFA 4JBJA 4LUZA 1SN8A 1KIXA 1N8RC 3HOUH 3M3YH 1XPOA 3I4MG 3CXCA 2OCEA 4YWKA 3CCRA 1XMOL 1XNRQ 4BBRG 2BH8A 2K4KA 4UY8C 3S1QH 3OW2A 4BBSG 4JC0A 3KF6A 2YU9H 5JEAJ 1SLJA 1HNZQ 1VQMA 1SFOH 4DR6Q 1W3SA 2JA8H 2VW9A 1YHQA 4KHPL 4B3SQ 4BA1I 4NXML 4DR1L 2GN5A 4LF6L 1HZ9A 2KENA 4FDBA 3UE0A 5GAEC 1VQEA 2IT1A 3OYYA 4X66L 2A8VA 3NEMA 3ZJYC 4OWXB 3CF5A 3W1BA 2R93H 1HNZL 5C4JH 3HOUG 1CKMA 4L5QA 4O2DA 4EQ5A 2MNAA 1PHJA 4BXXG 1WCMG 4IO9A 2R7ZH 1QZHA 1WCMH 1X3FA 2ASBA 4LWCA 4KHPQ 2H5XA 4DR2L 4B3MQ 2LXKA 5FJ8H 4DUYQ 3J81c 1N33L 1IZ6A 2JE6I 2UXCL 1JMCA 3PCOB 4AH6A 4YY3L 1Y1WG 1I94L 3E0EA 2NVTH 1LYLA 5C4XH 4GNXC 1V9PA 2PI2A 4LF5Q 1L1OC 2D0OA 3J81i 3I7FA 4NXNQ 4IFDI 3T1HQ 4DV7L 3CQZH 4A3IH 2EQSA 4AIMA 1SROA 4DV4Q 1KRTA 3DM3A 2KCMA 1PH3A 1IBKL 3PUWA 3CCQA 1QVFA 3GTGH 3FKIG 3FHWA 3HFZB 3GTLH 4A3BH 4YCUA 1YI2A 3PF4A 1QVCA 3I4OA 4X64L 3GTJH 2HHHL 1OXXK 1N9WA 3I56A 4GN4B 2BH2A 1X55A 4JOIC 1SR3A 3H3VI 2AMCB 4A3CH 1VQ9A 4LF7L 2N78A 3CC2A 1JJGA 3CPWA 2HIVA 5IT9c 2XTIA 4IPCA 3Q8DA 4YCWA 4GKJQ 4YWLA 4A3GH 3PV0A 4QGUA 2EIFA 4MTNA 4QIWE 5IP7H 4B3SL 3D0FA 2KBNA 4AQYL 1AH9A 2E5LL 1E7ZA 4JI3Q 4JI1L 2HT1A 1EYGA 1Q12A 2WFWA 4BA2I 3KYHC 3M9BA 1BBUA 3PUYA 1J5EL 1NE3A 3M4PA 3NBHB 3S2DH 4X62Q 2UUAQ 2NZHA 4UP9A 3PIPA 3PO3H 4DKAC 3JAMi 4DR5Q 4A3MG 4MZ9A 1HZCA 1MJEA 5M5WH 2L15A 1VQ8A 4BY7H 4LUVA 1XNQQ 2VUMG 2PQAB 4BY7G 2PI2E 1K83H 2Y0SG 1J5EQ 3RR5A 2D0PA 4JCVE 4QL5A 2JK8A 1HJPA 2HQLA 1Q8KA 1BKBA 1LTLA 1EQQA 1MJCA 1M1KC 4WJ3M 4AYBG 2A1AA 4JI7Q 4DNIA 3HOVH 4DR1Q 5IWAL 1NMGA 1NJIC 3S15H 4C3HH 1HNXL 2WAQG 3HKZG 4DV5L 2YTXA 1E3PA 4X62L 2UUAL 1ASYA 3PUZA 1A8VA 2MFIA 4IJHA 4JBWA 4DV1Q 3HOZG 4R4QA 4HIKA 3S1MH 4A3EH 1Q81C 2B3GA 4DR5L 1EIYB 1C0AA 1K3RA 1GM5A 1UE1A 2IHFA 3W1GA 4HIOA 3KDFB 2UUBL 5IWAQ 1E22A 1I3QH 1VQCA 2R7FA 1I5FA 1A62A 4OONA 4BBRH 1FL0A 1PVOA 4KHZA 2OWOA 3H0GG 3S16H 1IBMQ 2BA0A 1M90C 2UU9Q 2R92G 5JJIA 3RN2A 2BA1A 4H02A 1X6OA 1JT8A 1I50H 2VQFL 3GTMH 3GTKH 3HOWG 5C44G 1VQDA 1XNQL 2UXBL 5M3MH 4DK6C 1VQHA 2FXQA 5M3MG 2R7DA 3RLOA 4LF8Q 4A3EG 4JI2Q 2F4VL 1J6QA 2OQKA 2RCNA 2B63H 1L0WA 4HJ5A 2NVXH 1EIFA 3CMAA 2B63G 4BXXH 1YBYA 2MO1A 4DR3L 3CPFA 5IYCG 4EX5A 4OWTB 5GAGC 4QJFA 1JE5A 4A3CG 4JBKA 3KDFA 1Y1WH 1XMQQ 1E1TA 2OQ0A 3CCEA 4DR7L 4DV6Q 4LF4Q 1K9MC 1HR0W 5IYBH 1OXTA 5IP7G 2I5HA 2R93G 2OTLA 1GO3E 3K0XA 1XMQL 3RZDH 2DGYA 2RF4A 3GO5A 1VQNA 2B29A 5IYCH 2UU9L 2DUDA 1I6HH 3UDXA 1L1OB 1SMXA 4DV6L 2E2JH 1JJCB 4ALPA 3ER0A 3T1YL 4DR4L 4DV3L 1C7YA 1PH1A 4DV4L 4IPGA 4TQUS 4A3LG 3STBC 1B70B 4OO1G 3UDIA 4LFBL 2CWPA 1FVIA 2JEAI 3F2CA 4HIMA 1SE8A 4DV0L 1HR0L 4X65L 1EWIA 4IJLA 4C3JH 4A3IG 1V43A 1VQJA 1K8GA 2JA6G 3NELA 4P71A 1HZBA 4UPAA 1VCIA 5M5XH 2PNHA 3BZKA 4JI3L 1NMFA 1ASZA 5AJ3Q 2NVQH 3S2HH 3M4QA 4L5RC 3ICEA 2YTVA 4DV3Q 1HNXQ 2CKZB 1VQFA 2IX1A 2Q2UA 2N8NA 1VQPA 3TEHB 1TWFH 2QEXA 2JEBI 4DV0Q 5GQOA 1HR0Q 3KJOA 3S1RH 1E1OA 1XPUA 2WB1E 5GAHC 3HKSA 1YJNA 1WFQA 4JI0Q 5LMUQ 4JYAL 2I0QA 4RG1A 4NB3A 1TWAH 3L7ZC 1K0RA 1VQLA 4PZ8A 3GTPH 1U0LA 2HHHQ 2ZTEA 3CCLA 2VZAA 4R4CA 2E2HH 1VQ6A 1UEBA 3G6EA 3LGJA 3GTOH 4ME3A 3H0GH 1YHBA 2VQFQ 4GNXA 3E9HA 3CP0A 1K8AC 1L1OA 3M7NA 4DV5Q 3RLNA 4K0KQ 4LFBQ 2Q2HA 1CUKA 1Z9FA 2Z0SA 4GLVB 5ELNA 1Z47A 5M3FG 2ZTDA 3PUVA 3K81C 4P74A 5M3FH 3J7ZC 4A3MH 1I94Q 4GKKL 2KCTA 4DAMA 1QUQA 1RL2A 1PH4A 3S14H 4GN5A 1PH5A 2KHJA 3AFPA 2GVBA 2AHOB 3TS2A 1AE3A 4JI6Q 4NXNL 3KF8B 4RMFA 2RHQB 5FLMG 4YHHL 1P8LA 3ERSX 4JOIA 4POFA 1B8AA 2HIXA 3TQYA 4HJ8A 2ES2A 3CMEA 3M85A 1IBML 4LFCQ 2CWAA 3L2PA 4B3TL 5ELOA 1PH8A 1KD1C 3GD7A 5JJKA 1IYJB 2ZM6Q 2K5VA 3KOJA 2E8GA 5IY0A 3CC7A 1XPRA 2JA8G 1X65A 4GLXA 1LUZA 1Y1VH 3FP9A 2CCZA 1Q82C 2UUBQ 3F8TA 4JI5Q 3JAMc 1IBLQ 3HOZH 1AE2A 4JV5Q 3CCUA 4DAYB 1UE6A 1VQAA 1CSQA 1O7IA 4MNOA 5DLQE 4IPDA 3J81j 4QQBX 1WYDA 1UE7A 3U4VA 1UE5A 5IE8A 1YHAA 3ULPA 3VDYA 3GTQH 4A3DH 1TWCH 4NPSA 1G291 3J80c 2VL6A 4GS3A 4DR2Q 1H95A 2JA9A 4R4TA 3W5OA 1PA6A 4GOPC 3EN2A 3HKZE 4LF9Q 3A5UA 1FJGQ 5K36G 1X9NA 2VS1A 5JEAG 5FJ8G 1VQKA 4A3JH 3TS0A 4R4OA 2CFMA 3HOYH 4DV1L 1HH2P 1VQOA 1A63A 5BR8L 5C44H 3D31A 2I5MX 2JA5G 1N32L 3K8AA 2E5LQ 1EUJA 5IP9G 4JI5L 4A4IA 3I4NG 1VQ5A 2ZJQA 1IBLL 4HJ9A 4BY1H 2UXDL 5C0XI 3CC4A 3TRZA 1HNWL 1YZ6A 1QVGA 2E2IH 4DR6L 3J7A5 2ZJPA 4OWWB 5HY6A 3AQQA 1E24A 1U5KA 4DR7Q 2UXBQ 4A76A 2R6GA 3WWVA 1TWHH 3M4OH 4JI6L 4DUZQ 3HOYG 1YJ9A 4P73A 4JI2L 1UWVA 3CCVA 2JQOA 2WAQE 4DV2Q 2F4VQ 1YVCA 4R4IA 1OXUA 2EXDA 4L5TA 5GROA 1VQ7A 2JA5H 1P16A 1N33Q 4B3RQ 3EIVA 1CKNA 1FGUA 1VQ4A 2JA6H 3CCJA 1Q46A 2VY3A 2Y0SE 4LUOA 2VQEL 5LMNW 2UUCQ 4DV7Q 1L2FA 1CSPA 5IYDG 3RN5A 1X3EA 4APVA 1S40A 3UDGA 3I2ZA 3HOVG 4IFDG 1PYBA 2NN6I 2K5HA 2ATWA 3MXNB 4JI4L 4O0AA 3L0OA 4DPGA 3KF6B 4P72A 2MQHA 5FLXc 1TWGH 2PMZE 3A5ZB 4OX9Q 4LF9L 2YTYA 2K14A 1PH2A 5LMUL 4JYAQ 1GVPA 3RZOH 1Y14B 3PIOA 2V1CC 1YEZA 3AEVA 2UXDQ 3PO2H 2IX0A 3BU2A 3CCMA 1BBWA 2RHSB 4KI0A 4JI8Q 3PO2G 3CW2C 4GN3B 5BR8Q 1X56A 4BBSH 1OXVA 2N49A 1KHIA 3T1YQ 1S72A 2ZM6L 4DR4Q 3EBEA 1YITA 3UDFA 3F2DA 4GNXB 3BJUA 4JG2A 3I55A 2ALYB 3A0JA 1OTCA 1G6PA 1BVSA 2XGTA 2Z6KC 4XTCS 4LFCL 1Q86C 4X65Q 4GOPB 1IXRA 1QZGA 3ULLA 1A0IA 1QUQB 1LM0A 1T9HA 1R9TH 3CAMA 4OX9L 2VQEQ 2UUCL 4A3DG 4HIDA 3G4SA 3F2BA 4R1JA 1KL9A 5FLMH 5LMNQ 4LW1A 4A3KG 1IBKQ 5E7NA 1PV4A 4DV2L 5C0XG 3IRBA 2F3IA 4KLKA 4PZ7A 3SGIA 4B3TQ 3BZCA 4LFAQ 3AFQA 2QA4A 4A3JG 4J15A 2R92H 2K5NA 3JC66 1N36L 2ZJRA 2JA7H 4OXPA 4LF7Q 3PGZA 3PSIA 4PG3A 1Q7YC 5JJLA 4HJ7A 4LF6Q 1PYSB 5C3EG 4YHHQ 2K75A 4LNQA 1GKHA 3HOWH 3S17H 5C3EH 1VQIA 1RIPA 4C2MH 1YNXA 2NZOA 1HNWQ 4LF8L 4PMWA 1PFSA 2YYZA 3PUXA 2ZTCA 4Y7NH 4GOPA 3U58A 1IL2A 3OTOQ 2I5LX 1K73C 1JB7A 2VNUD 3T1HL 1SRUA 4DR3Q 4JI1Q 3TREA 3U4ZA 4DUZL 2IY5B 1NBWA 1NTGA 4JV5L 1W2BA 5C4XG 3H15A 4YY3Q 4GKKQ 1D8LA 5EAYA 3G48A 2JA7G 4A3GG 4IOAA 4B3RL 5H1SE 1N32Q 1D7QA 4IFDJ 4UP8A 2GVAA 1PH9A 4BY1G 2Q2IA 3AYHB 4X6AH 1KC8C 1NY4A 3K7AH 5IYBG 5GADC 3GDEA 2UXCQ 2R7ZG 4A3BG 5IYDH 1EFWA 3STBD 5M5YH 4Y52H 2AWNA 1C9OA 2K50A 4AYBE 1X54A 1KRSA 3DLLA 4XIGS 1VS0A 1EOVA 1EQRA 4JI7L 4JI0L 1OXSC 4WJ4A 3PO3G 2QGQA 5LMNL 1WOCA 4DUYL 4B3ML 4GKJL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L H;  4K0K L;  2NVY H;  4JI4 Q;  4JI8 L;  2K52 A;  4JBM A;  4OO1 I;  4LF5 L;  2WB1 G;  4DK3 C;  4L5S A;  5IP9 H;  4YCV A;  3I4N H;  3OTO L;  1X3G A;  3ULJ A;  1N36 Q;  4NXM Q;  1DGS A;  5HGQ A;  1N34 L;  4LFA L;  4LF4 L;  4IPH A;  3KJP A;  4TVA B;  3FKI H;  3NEN A;  3S1N H;  1FJG L;  4X66 Q;  5AJ3 L;  4P75 A;  1KXL A;  4A93 H;  2AKW B;  4QY7 A;  1MKH A;  3E9I A;  3CCS A;  2LXJ A;  1MIU A;  2N3S A;  2LSS A;  1KAW A;  4YWM A;  2ID0 A;  4A3F H;  3F1Z A;  2C35 B;  1S3O A;  2NN6 G;  2KHI A;  1CKO A;  2AWO A;  1VQB A;  2WP8 J;  4GLA C;  4AQY Q;  1PH7 A;  3U50 C;  1GD7 A;  2PQA A;  2D62 A;  4HJA A;  1YJW A;  2VUM H;  4C3I H;  3H3V H;  4IOC A;  4POG A;  5C0X J;  3I4M H;  2JJQ A;  2MO0 A;  3A74 A;  3G71 A;  1V1Q A;  3HOX G;  4A75 A;  1VQG A;  2IHE A;  4A3K H;  1JJ2 A;  3CD6 A;  1XTD A;  3HOX H;  2OTJ A;  3K80 C;  1N34 Q;  1PH6 A;  1Q1B A;  3UE1 A;  3K7U C;  1WI5 A;  4A93 G;  2Z6K A;  1Q1E A;  3KFU A;  2Q2T A;  3PF5 A;  2F52 A;  3J80 i;  5J3B A;  1XMO Q;  1XNR L;  2CQO A;  3B6Y A;  1XJV A;  4X64 Q;  2A19 A;  1CKN B;  1Y1V G;  1WJJ A;  1TXY A;  2YV5 A;  3S24 A;  3RNU A;  1B7Y B;  4PZ6 A;  1G51 A;  4UP7 A;  4A3F G;  1KQS A;  3RLF A;  3KLW A;  1HZA A;  1YIJ A;  3MEF A;  4JBJ A;  4LUZ A;  1SN8 A;  1KIX A;  1N8R C;  3HOU H;  3M3Y H;  1XPO A;  3I4M G;  3CXC A;  2OCE A;  4YWK A;  3CCR A;  1XMO L;  1XNR Q;  4BBR G;  2BH8 A;  2K4K A;  4UY8 C;  3S1Q H;  3OW2 A;  4BBS G;  4JC0 A;  3KF6 A;  2YU9 H;  5JEA J;  1SLJ A;  1HNZ Q;  1VQM A;  1SFO H;  4DR6 Q;  1W3S A;  2JA8 H;  2VW9 A;  1YHQ A;  4KHP L;  4B3S Q;  4BA1 I;  4NXM L;  4DR1 L;  2GN5 A;  4LF6 L;  1HZ9 A;  2KEN A;  4FDB A;  3UE0 A;  5GAE C;  1VQE A;  2IT1 A;  3OYY A;  4X66 L;  2A8V A;  3NEM A;  3ZJY C;  4OWX B;  3CF5 A;  3W1B A;  2R93 H;  1HNZ L;  5C4J H;  3HOU G;  1CKM A;  4L5Q A;  4O2D A;  4EQ5 A;  2MNA A;  1PHJ A;  4BXX G;  1WCM G;  4IO9 A;  2R7Z H;  1QZH A;  1WCM H;  1X3F A;  2ASB A;  4LWC A;  4KHP Q;  2H5X A;  4DR2 L;  4B3M Q;  2LXK A;  5FJ8 H;  4DUY Q;  3J81 c;  1N33 L;  1IZ6 A;  2JE6 I;  2UXC L;  1JMC A;  3PCO B;  4AH6 A;  4YY3 L;  1Y1W G;  1I94 L;  3E0E A;  2NVT H;  1LYL A;  5C4X H;  4GNX C;  1V9P A;  2PI2 A;  4LF5 Q;  1L1O C;  2D0O A;  3J81 i;  3I7F A;  4NXN Q;  4IFD I;  3T1H Q;  4DV7 L;  3CQZ H;  4A3I H;  2EQS A;  4AIM A;  1SRO A;  4DV4 Q;  1KRT A;  3DM3 A;  2KCM A;  1PH3 A;  1IBK L;  3PUW A;  3CCQ A;  1QVF A;  3GTG H;  3FKI G;  3FHW A;  3HFZ B;  3GTL H;  4A3B H;  4YCU A;  1YI2 A;  3PF4 A;  1QVC A;  3I4O A;  4X64 L;  3GTJ H;  2HHH L;  1OXX K;  1N9W A;  3I56 A;  4GN4 B;  2BH2 A;  1X55 A;  4JOI C;  1SR3 A;  3H3V I;  2AMC B;  4A3C H;  1VQ9 A;  4LF7 L;  2N78 A;  3CC2 A;  1JJG A;  3CPW A;  2HIV A;  5IT9 c;  2XTI A;  4IPC A;  3Q8D A;  4YCW A;  4GKJ Q;  4YWL A;  4A3G H;  3PV0 A;  4QGU A;  2EIF A;  4MTN A;  4QIW E;  5IP7 H;  4B3S L;  3D0F A;  2KBN A;  4AQY L;  1AH9 A;  2E5L L;  1E7Z A;  4JI3 Q;  4JI1 L;  2HT1 A;  1EYG A;  1Q12 A;  2WFW A;  4BA2 I;  3KYH C;  3M9B A;  1BBU A;  3PUY A;  1J5E L;  1NE3 A;  3M4P A;  3NBH B;  3S2D H;  4X62 Q;  2UUA Q;  2NZH A;  4UP9 A;  3PIP A;  3PO3 H;  4DKA C;  3JAM i;  4DR5 Q;  4A3M G;  4MZ9 A;  1HZC A;  1MJE A;  5M5W H;  2L15 A;  1VQ8 A;  4BY7 H;  4LUV A;  1XNQ Q;  2VUM G;  2PQA B;  4BY7 G;  2PI2 E;  1K83 H;  2Y0S G;  1J5E Q;  3RR5 A;  2D0P A;  4JCV E;  4QL5 A;  2JK8 A;  1HJP A;  2HQL A;  1Q8K A;  1BKB A;  1LTL A;  1EQQ A;  1MJC A;  1M1K C;  4WJ3 M;  4AYB G;  2A1A A;  4JI7 Q;  4DNI A;  3HOV H;  4DR1 Q;  5IWA L;  1NMG A;  1NJI C;  3S15 H;  4C3H H;  1HNX L;  2WAQ G;  3HKZ G;  4DV5 L;  2YTX A;  1E3P A;  4X62 L;  2UUA L;  1ASY A;  3PUZ A;  1A8V A;  2MFI A;  4IJH A;  4JBW A;  4DV1 Q;  3HOZ G;  4R4Q A;  4HIK A;  3S1M H;  4A3E H;  1Q81 C;  2B3G A;  4DR5 L;  1EIY B;  1C0A A;  1K3R A;  1GM5 A;  1UE1 A;  2IHF A;  3W1G A;  4HIO A;  3KDF B;  2UUB L;  5IWA Q;  1E22 A;  1I3Q H;  1VQC A;  2R7F A;  1I5F A;  1A62 A;  4OON A;  4BBR H;  1FL0 A;  1PVO A;  4KHZ A;  2OWO A;  3H0G G;  3S16 H;  1IBM Q;  2BA0 A;  1M90 C;  2UU9 Q;  2R92 G;  5JJI A;  3RN2 A;  2BA1 A;  4H02 A;  1X6O A;  1JT8 A;  1I50 H;  2VQF L;  3GTM H;  3GTK H;  3HOW G;  5C44 G;  1VQD A;  1XNQ L;  2UXB L;  5M3M H;  4DK6 C;  1VQH A;  2FXQ A;  5M3M G;  2R7D A;  3RLO A;  4LF8 Q;  4A3E G;  4JI2 Q;  2F4V L;  1J6Q A;  2OQK A;  2RCN A;  2B63 H;  1L0W A;  4HJ5 A;  2NVX H;  1EIF A;  3CMA A;  2B63 G;  4BXX H;  1YBY A;  2MO1 A;  4DR3 L;  3CPF A;  5IYC G;  4EX5 A;  4OWT B;  5GAG C;  4QJF A;  1JE5 A;  4A3C G;  4JBK A;  3KDF A;  1Y1W H;  1XMQ Q;  1E1T A;  2OQ0 A;  3CCE A;  4DR7 L;  4DV6 Q;  4LF4 Q;  1K9M C;  1HR0 W;  5IYB H;  1OXT A;  5IP7 G;  2I5H A;  2R93 G;  2OTL A;  1GO3 E;  3K0X A;  1XMQ L;  3RZD H;  2DGY A;  2RF4 A;  3GO5 A;  1VQN A;  2B29 A;  5IYC H;  2UU9 L;  2DUD A;  1I6H H;  3UDX A;  1L1O B;  1SMX A;  4DV6 L;  2E2J H;  1JJC B;  4ALP A;  3ER0 A;  3T1Y L;  4DR4 L;  4DV3 L;  1C7Y A;  1PH1 A;  4DV4 L;  4IPG A;  4TQU S;  4A3L G;  3STB C;  1B70 B;  4OO1 G;  3UDI A;  4LFB L;  2CWP A;  1FVI A;  2JEA I;  3F2C A;  4HIM A;  1SE8 A;  4DV0 L;  1HR0 L;  4X65 L;  1EWI A;  4IJL A;  4C3J H;  4A3I G;  1V43 A;  1VQJ A;  1K8G A;  2JA6 G;  3NEL A;  4P71 A;  1HZB A;  4UPA A;  1VCI A;  5M5X H;  2PNH A;  3BZK A;  4JI3 L;  1NMF A;  1ASZ A;  5AJ3 Q;  2NVQ H;  3S2H H;  3M4Q A;  4L5R C;  3ICE A;  2YTV A;  4DV3 Q;  1HNX Q;  2CKZ B;  1VQF A;  2IX1 A;  2Q2U A;  2N8N A;  1VQP A;  3TEH B;  1TWF H;  2QEX A;  2JEB I;  4DV0 Q;  5GQO A;  1HR0 Q;  3KJO A;  3S1R H;  1E1O A;  1XPU A;  2WB1 E;  5GAH C;  3HKS A;  1YJN A;  1WFQ A;  4JI0 Q;  5LMU Q;  4JYA L;  2I0Q A;  4RG1 A;  4NB3 A;  1TWA H;  3L7Z C;  1K0R A;  1VQL A;  4PZ8 A;  3GTP H;  1U0L A;  2HHH Q;  2ZTE A;  3CCL A;  2VZA A;  4R4C A;  2E2H H;  1VQ6 A;  1UEB A;  3G6E A;  3LGJ A;  3GTO H;  4ME3 A;  3H0G H;  1YHB A;  2VQF Q;  4GNX A;  3E9H A;  3CP0 A;  1K8A C;  1L1O A;  3M7N A;  4DV5 Q;  3RLN A;  4K0K Q;  4LFB Q;  2Q2H A;  1CUK A;  1Z9F A;  2Z0S A;  4GLV B;  5ELN A;  1Z47 A;  5M3F G;  2ZTD A;  3PUV A;  3K81 C;  4P74 A;  5M3F H;  3J7Z C;  4A3M H;  1I94 Q;  4GKK L;  2KCT A;  4DAM A;  1QUQ A;  1RL2 A;  1PH4 A;  3S14 H;  4GN5 A;  1PH5 A;  2KHJ A;  3AFP A;  2GVB A;  2AHO B;  3TS2 A;  1AE3 A;  4JI6 Q;  4NXN L;  3KF8 B;  4RMF A;  2RHQ B;  5FLM G;  4YHH L;  1P8L A;  3ERS X;  4JOI A;  4POF A;  1B8A A;  2HIX A;  3TQY A;  4HJ8 A;  2ES2 A;  3CME A;  3M85 A;  1IBM L;  4LFC Q;  2CWA A;  3L2P A;  4B3T L;  5ELO A;  1PH8 A;  1KD1 C;  3GD7 A;  5JJK A;  1IYJ B;  2ZM6 Q;  2K5V A;  3KOJ A;  2E8G A;  5IY0 A;  3CC7 A;  1XPR A;  2JA8 G;  1X65 A;  4GLX A;  1LUZ A;  1Y1V H;  3FP9 A;  2CCZ A;  1Q82 C;  2UUB Q;  3F8T A;  4JI5 Q;  3JAM c;  1IBL Q;  3HOZ H;  1AE2 A;  4JV5 Q;  3CCU A;  4DAY B;  1UE6 A;  1VQA A;  1CSQ A;  1O7I A;  4MNO A;  5DLQ E;  4IPD A;  3J81 j;  4QQB X;  1WYD A;  1UE7 A;  3U4V A;  1UE5 A;  5IE8 A;  1YHA A;  3ULP A;  3VDY A;  3GTQ H;  4A3D H;  1TWC H;  4NPS A;  1G29 1;  3J80 c;  2VL6 A;  4GS3 A;  4DR2 Q;  1H95 A;  2JA9 A;  4R4T A;  3W5O A;  1PA6 A;  4GOP C;  3EN2 A;  3HKZ E;  4LF9 Q;  3A5U A;  1FJG Q;  5K36 G;  1X9N A;  2VS1 A;  5JEA G;  5FJ8 G;  1VQK A;  4A3J H;  3TS0 A;  4R4O A;  2CFM A;  3HOY H;  4DV1 L;  1HH2 P;  1VQO A;  1A63 A;  5BR8 L;  5C44 H;  3D31 A;  2I5M X;  2JA5 G;  1N32 L;  3K8A A;  2E5L Q;  1EUJ A;  5IP9 G;  4JI5 L;  4A4I A;  3I4N G;  1VQ5 A;  2ZJQ A;  1IBL L;  4HJ9 A;  4BY1 H;  2UXD L;  5C0X I;  3CC4 A;  3TRZ A;  1HNW L;  1YZ6 A;  1QVG A;  2E2I H;  4DR6 L;  3J7A 5;  2ZJP A;  4OWW B;  5HY6 A;  3AQQ A;  1E24 A;  1U5K A;  4DR7 Q;  2UXB Q;  4A76 A;  2R6G A;  3WWV A;  1TWH H;  3M4O H;  4JI6 L;  4DUZ Q;  3HOY G;  1YJ9 A;  4P73 A;  4JI2 L;  1UWV A;  3CCV A;  2JQO A;  2WAQ E;  4DV2 Q;  2F4V Q;  1YVC A;  4R4I A;  1OXU A;  2EXD A;  4L5T A;  5GRO A;  1VQ7 A;  2JA5 H;  1P16 A;  1N33 Q;  4B3R Q;  3EIV A;  1CKN A;  1FGU A;  1VQ4 A;  2JA6 H;  3CCJ A;  1Q46 A;  2VY3 A;  2Y0S E;  4LUO A;  2VQE L;  5LMN W;  2UUC Q;  4DV7 Q;  1L2F A;  1CSP A;  5IYD G;  3RN5 A;  1X3E A;  4APV A;  1S40 A;  3UDG A;  3I2Z A;  3HOV G;  4IFD G;  1PYB A;  2NN6 I;  2K5H A;  2ATW A;  3MXN B;  4JI4 L;  4O0A A;  3L0O A;  4DPG A;  3KF6 B;  4P72 A;  2MQH A;  5FLX c;  1TWG H;  2PMZ E;  3A5Z B;  4OX9 Q;  4LF9 L;  2YTY A;  2K14 A;  1PH2 A;  5LMU L;  4JYA Q;  1GVP A;  3RZO H;  1Y14 B;  3PIO A;  2V1C C;  1YEZ A;  3AEV A;  2UXD Q;  3PO2 H;  2IX0 A;  3BU2 A;  3CCM A;  1BBW A;  2RHS B;  4KI0 A;  4JI8 Q;  3PO2 G;  3CW2 C;  4GN3 B;  5BR8 Q;  1X56 A;  4BBS H;  1OXV A;  2N49 A;  1KHI A;  3T1Y Q;  1S72 A;  2ZM6 L;  4DR4 Q;  3EBE A;  1YIT A;  3UDF A;  3F2D A;  4GNX B;  3BJU A;  4JG2 A;  3I55 A;  2ALY B;  3A0J A;  1OTC A;  1G6P A;  1BVS A;  2XGT A;  2Z6K C;  4XTC S;  4LFC L;  1Q86 C;  4X65 Q;  4GOP B;  1IXR A;  1QZG A;  3ULL A;  1A0I A;  1QUQ B;  1LM0 A;  1T9H A;  1R9T H;  3CAM A;  4OX9 L;  2VQE Q;  2UUC L;  4A3D G;  4HID A;  3G4S A;  3F2B A;  4R1J A;  1KL9 A;  5FLM H;  5LMN Q;  4LW1 A;  4A3K G;  1IBK Q;  5E7N A;  1PV4 A;  4DV2 L;  5C0X G;  3IRB A;  2F3I A;  4KLK A;  4PZ7 A;  3SGI A;  4B3T Q;  3BZC A;  4LFA Q;  3AFQ A;  2QA4 A;  4A3J G;  4J15 A;  2R92 H;  2K5N A;  3JC6 6;  1N36 L;  2ZJR A;  2JA7 H;  4OXP A;  4LF7 Q;  3PGZ A;  3PSI A;  4PG3 A;  1Q7Y C;  5JJL A;  4HJ7 A;  4LF6 Q;  1PYS B;  5C3E G;  4YHH Q;  2K75 A;  4LNQ A;  1GKH A;  3HOW H;  3S17 H;  5C3E H;  1VQI A;  1RIP A;  4C2M H;  1YNX A;  2NZO A;  1HNW Q;  4LF8 L;  4PMW A;  1PFS A;  2YYZ A;  3PUX A;  2ZTC A;  4Y7N H;  4GOP A;  3U58 A;  1IL2 A;  3OTO Q;  2I5L X;  1K73 C;  1JB7 A;  2VNU D;  3T1H L;  1SRU A;  4DR3 Q;  4JI1 Q;  3TRE A;  3U4Z A;  4DUZ L;  2IY5 B;  1NBW A;  1NTG A;  4JV5 L;  1W2B A;  5C4X G;  3H15 A;  4YY3 Q;  4GKK Q;  1D8L A;  5EAY A;  3G48 A;  2JA7 G;  4A3G G;  4IOA A;  4B3R L;  5H1S E;  1N32 Q;  1D7Q A;  4IFD J;  4UP8 A;  2GVA A;  1PH9 A;  4BY1 G;  2Q2I A;  3AYH B;  4X6A H;  1KC8 C;  1NY4 A;  3K7A H;  5IYB G;  5GAD C;  3GDE A;  2UXC Q;  2R7Z G;  4A3B G;  5IYD H;  1EFW A;  3STB D;  5M5Y H;  4Y52 H;  2AWN A;  1C9O A;  2K50 A;  4AYB E;  1X54 A;  1KRS A;  3DLL A;  4XIG S;  1VS0 A;  1EOV A;  1EQR A;  4JI7 L;  4JI0 L;  1OXS C;  4WJ4 A;  3PO3 G;  2QGQ A;  5LMN L;  1WOC A;  4DUY L;  4B3M L;  4GKJ L; 
#chains in the Genus database with same CATH topology
 3ZYY X;  4OO1 I;  1WVL A;  4L5S A;  5IP9 H;  2I46 A;  4YCV A;  3HOV B;  1X3G A;  2FHT A;  1DGS A;  1MBY A;  5HGQ A;  5EKI A;  4LFA L;  1R4P B;  3NEN A;  4RHR A;  2X69 A;  1FJG L;  2Z8L A;  1KXL A;  3KUP A;  2JA8 B;  2F0M A;  1MKH A;  3S2H B;  4IFD H;  2N3S A;  2LSS A;  1HTP A;  4OEL B;  3U50 C;  1GUN A;  2PQA A;  4P2C B;  2H1E A;  4H7B A;  4C3I H;  3H3V H;  5KYI A;  3G71 A;  1VQG A;  3G6J B;  1LTI D;  4C2M B;  2RQX A;  2OTJ A;  3UE1 A;  3K7U C;  1HA5 A;  3HOW B;  3S17 B;  2E2I B;  2F52 A;  1XNR L;  4C3H G;  5IT9 E;  2A19 A;  3RNU A;  2C5C A;  2SDF A;  1YIJ A;  4JBJ A;  4LUZ A;  4J1M A;  2EJG C;  1O80 A;  1LAC A;  3HOU H;  2AQ3 B;  1XPO A;  1K28 A;  4RCO A;  3CXC A;  2A6E C;  1XNR Q;  1UAP A;  1EY4 A;  2BH8 A;  3OW2 A;  4L8J A;  4F7X A;  2YU9 H;  5JEA J;  3FDT A;  2O4X A;  1VQM A;  5EGT A;  1W3S A;  1EFI D;  4KK7 A;  1YHQ A;  4KHV A;  4BA1 I;  5FO9 B;  4NXM L;  1KTK A;  4IUP A;  2KEN A;  4FDB A;  1AFP A;  1S5E D;  2IT1 A;  3A8K E;  3OYY A;  3R2I A;  3U9O A;  3NEM A;  5E4W C;  3ZJY C;  4CDE C;  4FF4 A;  1SNM A;  1DD2 A;  1HNZ L;  3NWT A;  3HOU G;  3KK7 A;  2QW7 A;  4EQ5 A;  1PHJ A;  2MNA A;  4IO9 A;  1XYI A;  1WCM H;  5I2Y A;  4LWC A;  2ASB A;  2H5X A;  4DR2 L;  4B3M Q;  2M00 A;  5FJ8 H;  5JEA H;  4DUY Q;  4AH6 A;  1Y1W G;  1VDZ A;  3E0E A;  4CDF C;  4GNX C;  3IFT A;  2C9O A;  4FNF A;  3J81 i;  4NXN Q;  2JYO A;  2Q8I B;  4DV4 Q;  1KRT A;  5D3I B;  3PIP 3;  3UI2 A;  4KKS A;  3FKI G;  3GTL H;  4I65 A;  1EU3 A;  4B08 A;  3H3V I;  4A3C H;  1CK1 A;  1KAB A;  4FF1 A;  2N78 A;  1JJG A;  3TZD A;  2HIV A;  5IT9 c;  4GKJ Q;  1HUN A;  2FJ2 A;  1FD7 D;  1HFG A;  2EIF A;  3QOJ A;  5C5M A;  1A6X A;  4AQY L;  2KBN A;  1NR4 A;  3KLR A;  1AH9 A;  2EPB A;  4A3J B;  3NP8 A;  3PUY A;  4X62 Q;  1BO0 A;  2NZH A;  4UP9 A;  5M5W B;  2KA7 A;  3PIP A;  3PO3 H;  2F0O A;  1MJE A;  1GHJ A;  4DNR B;  3K59 A;  4LUV A;  3LWU A;  1ICW A;  2VUM G;  4ILW A;  4HMI A;  3D4W A;  3FPU B;  2IJ0 A;  3LWE A;  2ZXR A;  1HRJ A;  2Z4I A;  4KD4 A;  3S15 H;  1NCV A;  4R4Q A;  4HIK A;  3PO2 B;  1HCZ A;  2PW5 A;  4DR5 L;  3NPP A;  3KF8 A;  4HCE A;  3EQL C;  2EYO A;  2IL8 A;  1SNP A;  2R7F A;  4BBR H;  1BOS A;  3K7A B;  2OWO A;  3H0G G;  3WOE A;  3RN2 A;  2N88 A;  1MSG A;  2BA1 A;  3SK5 A;  1I50 H;  3HP3 A;  3VR6 A;  4JVZ A;  5M3M G;  5ELF A;  4LF8 Q;  4JI2 Q;  3SVM A;  2F4V L;  1J6Q A;  3N52 A;  2B63 H;  1LLR D;  2A69 D;  2NVX H;  2B2W C;  2B63 G;  2IPK D;  2EY2 A;  1RCV D;  1QB5 D;  1O78 A;  4OWT B;  3MFY A;  4KN4 C;  1WTQ A;  2XRS D;  1WTX A;  1IKL A;  1IYV A;  2X6L A;  1HR0 W;  1OXT A;  3I72 A;  4YIJ A;  2L5T A;  3K0X A;  1F2L A;  1PYW D;  2A74 C;  5IYC H;  3Q24 A;  1I6H H;  1SMX A;  4A3K B;  2EVB A;  5T1I A;  2F0V A;  5I6Y A;  2K03 A;  1PLF A;  1C7Y A;  1PH1 A;  5FLX E;  2HUG A;  5LHY 1;  4IPG A;  4TQU S;  4A3L G;  1SYG A;  2EYP A;  3STB C;  4OO1 G;  3UDI A;  4A3D B;  2CWP A;  1FVI A;  4HIM A;  4DV0 L;  1CI3 M;  4KD3 A;  4C3J H;  5M5X H;  1SE2 A;  5D65 A;  2NVQ H;  2CHB D;  4L5R C;  2PMZ B;  4RGM A;  3PIO 3;  5IOD A;  4DV3 Q;  1EU4 A;  1WTH A;  5ELE A;  1L0Y B;  2N8N A;  1JE4 A;  1A3U A;  2M9V A;  5A35 A;  1XPU A;  2CW0 D;  2K33 A;  4DN4 M;  2VXW A;  3HKS A;  4JI0 Q;  2XSC A;  5LMU Q;  4JYA L;  4RG1 A;  4NB3 A;  4CGY B;  1K0R A;  1UEB A;  3GTO H;  2VQF Q;  1SDF A;  1L1O A;  3M7N A;  4DV5 Q;  4K2K A;  3RLN A;  2Q2H A;  4GLV B;  2Q8R E;  1Z47 A;  1PZI D;  3K81 C;  4A3M H;  1RL2 A;  4MTK A;  3F2U A;  1C48 A;  3DMU A;  5A2Q E;  4NXN L;  5FLM G;  1K3B C;  2KUM A;  3ERS X;  3I90 A;  2L4N A;  2V4D A;  4POF A;  1B8A A;  1LTA D;  4HJ8 A;  2PPB C;  1I4X A;  4U67 3;  2E74 C;  4B3T L;  3KOJ A;  5IY0 A;  2DY8 A;  2E8G A;  1GHK A;  1X65 A;  1Y1V H;  5CV7 A;  2UUB Q;  2FMM A;  3F8T A;  1IBL Q;  1UE6 A;  3EVQ A;  3H94 A;  3KLS X;  4K14 A;  4MNO A;  4LJZ C;  5ELD A;  1Y69 U;  1UE5 A;  1SNQ A;  1YHA A;  3GTQ H;  4A3D H;  1TWC H;  4QIW B;  2JA9 A;  4R4T A;  3W5O A;  1PA6 A;  1GXD C;  4GOP C;  5K36 G;  4WRD A;  4A3J H;  4R4O A;  3VA7 A;  1X3Q A;  1VQO A;  1KNE A;  3D31 A;  4IUT A;  1N32 L;  2E5L Q;  1DCZ A;  4JI5 L;  3QIA A;  5IT9 L;  4BY1 H;  4AYB B;  2WII B;  3BDC A;  5HGT A;  5C0X I;  4OIK A;  4E6I A;  1QVG A;  4DR6 L;  3DWA A;  3J7A 5;  2ZJP A;  1U5K A;  2PO4 A;  4CJ0 B;  2EYJ A;  4A76 A;  2R6G A;  4K5X A;  4FXG C;  3T13 A;  4JI6 L;  1BCP B;  1M8A A;  5IGF A;  4JI2 L;  1UWV A;  2F4V Q;  2WAQ E;  1YVC A;  5EKK A;  4R4I A;  1H9K A;  1OXU A;  1Q3L A;  3GTK B;  2F0H A;  1VQ7 A;  2KEC A;  4B3R Q;  1B2T A;  3S9W A;  3EIV A;  1VQ4 A;  1Q46 A;  4LUO A;  2UUC Q;  5C4H A;  4DV7 Q;  2JA5 B;  4BS9 A;  1L2F A;  1X3E A;  4IFD G;  4UDU C;  3J7A V;  2AQ1 B;  2PMZ E;  1B4O A;  2NN6 H;  2BE5 C;  3TP6 A;  3PIO A;  3AEV A;  4PNY A;  5C4Z A;  1KDA A;  2RHS B;  1TY0 A;  3PO2 G;  5FKA C;  2F0F A;  4GN3 B;  5BR8 Q;  5C3W A;  4RFB A;  3RD4 A;  2N49 A;  1KHI A;  1PRT C;  4DR4 Q;  2B39 A;  1RD9 D;  3I55 A;  3A0J A;  4HAE A;  1IYU A;  1TQO A;  5DAU A;  5BN5 A;  2XGT A;  2Z6K C;  1E2W A;  3HEJ A;  3DEO A;  1B44 D;  2WB1 B;  1IXR A;  4GOP B;  5CR3 A;  2DNE A;  1LM0 A;  5I4D A;  2L1B A;  3CAM A;  4OX9 L;  4FXD A;  2KCN A;  1DOK A;  1M4V A;  4A3D G;  2BCO A;  5E7N A;  1PV4 A;  5FO7 B;  4DV2 L;  4PZ7 A;  5IGC A;  3QJY A;  3NSW A;  4J15 A;  1X32 A;  3T56 B;  2R92 H;  4BY1 B;  4HJ7 A;  1FNV A;  4YHH Q;  4LF6 Q;  4LNQ A;  3BZD B;  2A73 B;  4FO2 A;  1RIP A;  1HNW Q;  1SMY D;  4Y7N H;  2WKC A;  4GOP A;  1STG A;  2I5L X;  2D5D A;  4C3J B;  3QOL A;  2Z4H A;  2F03 A;  2RDF A;  4DR3 Q;  4JI1 Q;  3C3L A;  3U4Z A;  2F1M A;  2OT2 A;  4NP5 A;  1Y8P B;  1W2B A;  4F88 A;  5H1S E;  1BQQ T;  1PH9 A;  5EBD A;  1E2V A;  5IYB G;  2XWB B;  2Q8T A;  1F9P A;  3K5O A;  1EFW A;  1Y8O B;  1C9O A;  2QKI C;  4AYB E;  1X54 A;  1TU2 B;  4O42 A;  1EQR A;  1CA6 A;  5M5Y B;  2EDG A;  1OXS C;  4WJ4 A;  1I4G A;  2PNR C;  2QGQ A;  1V8Q A;  5EQ0 A;  3M4O B;  4JI4 Q;  4JI8 L;  2PCF B;  2WB1 G;  3I4N H;  4DXF A;  3ULJ A;  1N36 Q;  4NXM Q;  2DJF C;  4A93 B;  3E5S A;  4ZUI A;  1ZYR D;  3FKI H;  3IFD A;  1GUW A;  4ZK9 B;  4P75 A;  1F9Q A;  4XT1 B;  1WD0 A;  4QY7 A;  1MIU A;  5FOB B;  2J4X A;  4YWM A;  1SMY C;  2C35 B;  2KHI A;  2AWO A;  2B8G A;  1GD7 A;  4BBR B;  1TR5 A;  1G2T A;  2VUM H;  3A74 A;  4A75 A;  2IHE A;  2E2J B;  3SEB A;  1PH6 A;  1RF2 D;  1WI5 A;  4A93 G;  2Z6K A;  3VYU A;  2B2T C;  1TWF B;  5F2D A;  3PF5 A;  3GV3 A;  1XJV A;  1B9M A;  1EZ8 A;  4X64 Q;  3OSO A;  1AZP A;  2RSN A;  4QMG A;  4UP7 A;  1KQS A;  3RLF A;  3FMC A;  2Z6B A;  1B3A A;  1N8R C;  3M3Y H;  4QF4 A;  1CHP D;  1B50 A;  4YWK A;  3CCR A;  2JXM B;  4QB4 A;  2K4K A;  4UY8 C;  2MJ8 A;  4JC0 A;  3DWP A;  4CJ1 B;  2WKD A;  1U4R A;  3MFG A;  5IGG A;  3D8G A;  5TSS A;  1PZK D;  4KHP L;  2TSS A;  4EVO A;  4LF6 L;  4CJ2 C;  1VQE A;  4X66 L;  2B2U C;  3MWY W;  1CKM A;  2ZXO A;  3M4Y A;  2G9D A;  2NVY B;  1WCM G;  2ZT9 C;  3I91 A;  2LXK A;  3S1R B;  3OOC A;  2O5J C;  2EXZ A;  2RA4 A;  4J6H A;  3TME A;  5C4X H;  1V9P A;  4LF5 Q;  1FYC A;  4IFD I;  3T1H Q;  1MSH A;  4G7H C;  1SRO A;  1D1K A;  4DNT B;  3DM3 A;  1PH3 A;  2SOB A;  1QVF A;  1CZG A;  3FHW A;  4JPB W;  4YCU A;  3PF4 A;  1QIL A;  2XIW A;  3I4O A;  3GTJ H;  1OXX K;  1ZXT A;  1N9W A;  2BH2 A;  1AP0 A;  1SR3 A;  2AMC B;  4LF7 L;  1O7L A;  3CPW A;  4RWS C;  4YCW A;  3AMU A;  3PO3 B;  4ZLT F;  4CKE A;  3A56 A;  4QIW E;  3CRK C;  2CVR A;  5C3E B;  1CM9 A;  4HED A;  2XNA C;  3VR3 A;  4JI3 Q;  2WFW A;  1FNU A;  3KYH C;  1BBU A;  2JA6 B;  3M4P A;  4DXG A;  1RTN A;  5HUR A;  4OHJ A;  1EQT A;  1BUV T;  1F2Y A;  4XQQ A;  3X3N A;  3JAM i;  1D5Z C;  3V2T A;  3R93 A;  1SNO A;  1K83 H;  2Y0S G;  1J5E Q;  3RR5 A;  4QL5 A;  2D9U A;  4HR7 B;  1BKB A;  1LTL A;  1UUP A;  1MJC A;  4JI7 Q;  2KCC A;  5BN3 A;  1F2Z A;  3HOV H;  2L55 A;  1NNX A;  2DY7 A;  3MAQ A;  1NJI C;  1SEB D;  3HKZ G;  3NBH A;  1ASY A;  3JAM E;  1A8V A;  2MFI A;  3HG9 A;  4IN3 A;  1W6K A;  4CKC A;  3HOZ G;  4A3E H;  2I07 B;  1K3R A;  3EJI A;  5KNC A;  1PXU A;  5JVG 3;  2K5D A;  1KLG D;  2UUB L;  3KDF B;  1E22 A;  1JR0 D;  5COY A;  4KN7 C;  1STB A;  1A62 A;  1SJE D;  4OON A;  1FL0 A;  4LK1 C;  4IUU A;  1A3V A;  4G7Z C;  1TWG B;  5JJI A;  3MXP A;  2B2U A;  3NUC A;  3D4D A;  1B9N A;  5M3M H;  4ZKB B;  1VQH A;  2FXQ A;  1LT4 D;  4A3E G;  4ID6 A;  1ESF A;  4HJ5 A;  5FLX L;  3CMA A;  3MVV A;  4BXX H;  2EY6 A;  2MO1 A;  4DR3 L;  3CPF A;  5IYC G;  1JE5 A;  1XMQ Q;  1E1T A;  3CCE A;  4RGN A;  1O7Y A;  4DR7 L;  2WAC A;  3P75 A;  1K9M C;  1LTR D;  2D2C C;  3CHB D;  3NTI A;  2I5H A;  5IP7 G;  2R93 G;  1GO3 E;  1VF5 C;  2TMP A;  2UU9 L;  2DUD A;  1L1O B;  5CV8 A;  4DV6 L;  3D4R A;  2E2J H;  1JJC B;  2F0P A;  3T1Y L;  4DV3 L;  3MXN A;  1B70 B;  3A8J E;  1SE8 A;  1K8G A;  1JOR A;  4UPA A;  3HOZ B;  1VCI A;  2PNH A;  1ILP A;  3P1H A;  1EIH A;  1HNX Q;  1IW7 C;  1JWS D;  1BBX C;  2Q2U A;  1JOQ A;  2A5H A;  5A2Q L;  1Y8N B;  2BDO A;  2JEB I;  4L63 B;  5GQO A;  4DV0 Q;  1W6J A;  3MXU A;  3KJO A;  3DWQ A;  2SNS A;  1ILQ A;  2H4O A;  3I8Z A;  5GAH C;  4A3M B;  1PTO H;  1WFQ A;  1YJN A;  2DJG C;  2RKS A;  1HHV A;  1U0L A;  1A3T A;  1KDC A;  2HHH Q;  3CCL A;  4R4C A;  2E2H H;  3G6E A;  3A7A B;  1CQF A;  1YHB A;  3GTJ B;  1K8A C;  3TZU A;  4K0K Q;  3TN2 A;  1Z9F A;  5M3F G;  4P74 A;  5M3F H;  4KY5 A;  1QUQ A;  3FPP A;  1PH4 A;  4GN5 A;  1PH5 A;  2MPM A;  3K57 A;  1STH A;  2KQ3 A;  5FK9 C;  3TS2 A;  1AE3 A;  4JI6 Q;  1ENC A;  3TSS A;  4RMF A;  4KMU C;  1XWE A;  2BOS A;  2ES2 A;  3TQY A;  3CME A;  4NKL A;  3Q0A A;  4V19 0;  1PH8 A;  2F3V A;  2A6H C;  3L3O C;  3CC7 A;  1U4M A;  1HUM A;  4JI5 Q;  1KDB A;  5IOC A;  5C44 B;  4JV5 Q;  1VQA A;  4QQB X;  4IPD A;  2NWG A;  5IE8 A;  4RGT A;  2BE5 D;  1NSN S;  3IL8 A;  2VL6 A;  2O2L D;  1PTO C;  1TS2 A;  2VS1 A;  3TS0 A;  2CFM A;  1DYQ A;  3BDL A;  5IP9 G;  2LMC B;  1SSO A;  1IBL L;  3P7J A;  4HJ9 A;  2JA7 B;  1HNW L;  1YZ6 A;  5FO8 B;  2E2I H;  1EQV A;  5LL6 S;  2NB0 A;  5NUC A;  4OWW B;  1E24 A;  1QJO A;  1TS3 A;  1EYA A;  5CV6 A;  2UXB Q;  2B63 B;  3WWV A;  4M1U B;  1SJH D;  3HOY G;  4KY6 A;  4P73 A;  1I4R A;  4DV2 Q;  3QG1 A;  3J7Y W;  2EXD A;  4L5T A;  3BVZ A;  2JA5 H;  1P16 A;  1N33 Q;  2E76 C;  3FKI B;  1YNN C;  1RJT A;  4DK0 A;  2JA6 H;  1KNA A;  1CSP A;  3RN5 A;  3TBI B;  3UDG A;  2NN6 I;  3L0O A;  2QF7 A;  4DPG A;  3KF6 B;  1V1O A;  2MQH A;  1TWG H;  4OX9 Q;  1PH2 A;  1A2U A;  5LMU L;  4JYA Q;  3RZO H;  2UXD Q;  2V1C C;  1YEZ A;  2J7Z A;  3PO2 H;  5E3F A;  3BU2 A;  1JWU D;  1I6H B;  4KI0 A;  2MGS A;  1U4P A;  5CYU A;  3K6O A;  4J8Q A;  3SXH A;  1X56 A;  2MP1 A;  3HGB A;  2XRQ D;  4X3K A;  1LT5 D;  1STA A;  2ZM6 L;  3T1Y Q;  3IAY A;  3F2D A;  3QB3 A;  4GNX B;  1PMR A;  2K6A A;  4JG2 A;  1G6P A;  3J7A F;  5T1G A;  4LFC L;  1PRT D;  3OMG A;  1QZG A;  1ENA A;  3ULL A;  1WTW A;  1QUQ B;  1E2Z A;  2UUC L;  4HCS A;  2PZW A;  4HID A;  1KL9 A;  5LMN Q;  4LW1 A;  1ET9 A;  1BCP C;  3IRB A;  3SGI A;  4KLK A;  1PRT B;  3BZC A;  1E0B A;  5C0X H;  3URY A;  3MEH A;  2K5N A;  3JC6 6;  2ZJR A;  2K01 A;  4OXP A;  4LMQ D;  2A69 C;  4ABN A;  1PYS B;  3BVG A;  3HOW H;  3S17 H;  1T5E A;  1UEA B;  1QNU A;  2NUC A;  2R92 B;  5EJW A;  1ZKO A;  4C2M H;  2NZO A;  1HFN A;  2YYZ A;  2CW0 C;  3OTO Q;  1VMP A;  1JB7 A;  2VNU D;  4N9T A;  3FRP B;  3HOU B;  1NTG A;  4JV5 L;  5C4X G;  3H15 A;  4YY3 Q;  4GKK Q;  4B3R L;  1QWY A;  4TRD A;  1N32 Q;  4ULL A;  1D7Q A;  4RKL A;  3G7L A;  4H44 C;  2GVA A;  5M3F B;  4X6A H;  4CBV A;  1KC8 C;  3S16 B;  2UXC Q;  1EIG A;  3VA5 A;  2R7Z G;  1JIC A;  3STB D;  3J80 E;  1FNW A;  3K5N A;  1S5D D;  1KRS A;  2E2H B;  1VS0 A;  4JI7 L;  3PO3 G;  2NTS A;  4A3L H;  4Y7N B;  4K0K L;  4C3H B;  1U4L A;  1SYE A;  1WCM B;  2F3W A;  4DK3 C;  1H9J A;  1BCP D;  3OTO L;  4LF4 L;  4TVA B;  1SXT A;  5CBA E;  3S1N H;  5AJ3 L;  3O13 A;  4A93 H;  3E9I A;  1I50 B;  2LXJ A;  1SBB B;  5D3D A;  1QG7 A;  1ZYR C;  1YNJ D;  5DM6 3;  4A3F H;  1TWA B;  3F1Z A;  1S3O A;  1CKO A;  2WP8 J;  3RUZ A;  1PH7 A;  3T16 A;  4HJA A;  1YJW A;  2N55 A;  4C3J G;  5C6A A;  4DFA A;  1SE3 A;  4POG A;  2JJQ A;  5EPK A;  2B2Y A;  2MO0 A;  3HOX G;  4A3K H;  1JJ2 A;  3HOX H;  2B8F A;  1Z6H A;  2Q2T A;  3NBI A;  1STE A;  1XMO Q;  3J80 i;  2CQO A;  3B6Y A;  3MC0 B;  2RBM A;  1CKN B;  1WJJ A;  2YV5 A;  2RSO A;  4A3F G;  1N33 L;  1G51 A;  1B53 A;  1SE4 A;  1HZA A;  4A3G B;  5ELB A;  3MEF A;  3W3A A;  2F0N A;  1GUS A;  1SN8 A;  1G6Z A;  1JQY D;  1I4Q A;  3I4M G;  2OCE A;  1XMO L;  4BBR G;  4U68 A;  3S1Q H;  3I73 A;  3KF6 A;  3GTG B;  1SLJ A;  1SFO H;  2JA8 H;  2G9H D;  3GQB A;  1EY7 A;  5CC4 A;  4B3S Q;  4DR1 L;  2GN5 A;  3UE0 A;  5CV4 A;  1SYC A;  5GAE C;  4KJN A;  1XX8 A;  2A8V A;  3D6C A;  4OWX B;  3QR8 A;  3W1B A;  3A55 A;  3LNN A;  5C4J H;  1EYC A;  4L5Q A;  3DM1 A;  4BXX G;  2R7Z H;  1RHP A;  4KHP Q;  3J81 c;  1IZ6 A;  2JE6 I;  4A3F B;  1I6V C;  1JMC A;  1I94 L;  1TS4 A;  2NVT H;  2IX3 A;  2PI2 A;  2RCF A;  3OWE B;  2D0O A;  3I7F A;  4XXE A;  5JPN C;  4DV7 L;  2R93 B;  1JC7 A;  4AIM A;  5KIX A;  2KCM A;  1IBK L;  3CCQ A;  4A3B H;  1YI2 A;  1QVC A;  3K5L A;  4X64 L;  1LT3 D;  3NTK A;  2F0I A;  1ESR A;  1VQ9 A;  1SFO B;  1AW7 A;  4G57 A;  4KY7 A;  3CC2 A;  3KLS A;  3Q8D A;  4A3G H;  3PV0 A;  3HKZ B;  3OMC A;  1TII D;  4HTH A;  4QGU A;  5IP7 H;  1PFM A;  2E5L L;  1E7Z A;  1EYG A;  3JAM L;  4BA2 I;  3M9B A;  1J5E L;  3GV6 A;  1NE3 A;  3S2D H;  4I7Z C;  1B1Z A;  3Q22 A;  2YU9 B;  3VR4 A;  2NYZ D;  4DR5 Q;  4A3M G;  2L15 A;  1CTM A;  2A68 C;  2PQA B;  4BY7 G;  1TWC B;  2PI2 E;  3L9A X;  3E3X A;  4JCV E;  1OO9 B;  2JK8 A;  1HJP A;  3I3C A;  1EQQ A;  5J39 A;  4DNI A;  5KND A;  2WAQ G;  3I4N B;  5LL6 X;  4X62 L;  3SE0 A;  1WTP A;  4JBW A;  4DV1 Q;  3S1M H;  1Q81 C;  2B3G A;  1EIY B;  1GM5 A;  2IHF A;  3W1G A;  2EYL A;  2KVM A;  1LTB D;  1G8Z D;  1I5F A;  2F0E A;  1PVO A;  1LO5 D;  1SAP A;  2F4I A;  2KOL A;  4HMJ A;  3S16 H;  4O1N A;  3BVM A;  1IHZ A;  2F0L A;  4H02 A;  2SEB D;  3RMH A;  1X6O A;  1IW7 D;  2VQF L;  3GTK H;  1VQD A;  2F0J A;  4CKB A;  1CQV A;  5CV9 A;  2R7D A;  1SND A;  3J81 L;  3GTM B;  4DK1 A;  2PZU A;  4ZQ3 A;  1L0W A;  3A8I E;  1GUO A;  1YBY A;  4EX5 A;  1GOZ A;  4K6L A;  1Y1W H;  4JBK A;  5G3L F;  2LKV A;  1JB3 A;  3S15 B;  4DV6 Q;  2LS0 1;  3OWF A;  4UHV A;  4LF4 Q;  5IGB A;  1QOH A;  5IYB H;  2KED A;  3HZX A;  2AUK A;  1XMQ L;  4B9X A;  1CFM A;  2B2T A;  2DGY A;  2RF4 A;  1WTV A;  3GO5 A;  1VQN A;  1H9S B;  2B29 A;  3GTP B;  4QCL A;  3UDX A;  4K5V A;  5DEH A;  1LTG D;  3C2P A;  2DNC A;  5M9O A;  4DR4 L;  2K28 A;  2Z1C A;  4DV4 L;  2L11 A;  4PV1 C;  1LV9 A;  2E2D C;  1HR0 L;  3M3Y B;  4X65 L;  1EWI A;  4IJL A;  1R4Q B;  4A3I G;  2JA6 G;  3NEL A;  4P71 A;  1HZB A;  2QIL A;  3BZK A;  1NMF A;  1ASZ A;  5AJ3 Q;  3S2H H;  3M4Q A;  3NWS A;  3ND9 A;  1VQP A;  1TWF H;  2K5Q A;  3SR1 A;  1ENF A;  4TSS A;  2Y0S B;  4WJW A;  3W2D A;  1D2B A;  2WB1 E;  2NVT B;  4PZ8 A;  3S1N B;  2G5D A;  2E75 C;  3VR5 A;  3LGJ A;  4ME3 A;  2RDG A;  1ML0 D;  1U9R A;  3CP0 A;  4IZ8 A;  3KBX A;  4FP5 D;  4LFB Q;  2Z0S A;  4RCN A;  1H9S A;  2ZTD A;  3OW7 A;  3J7Z C;  1I94 Q;  4GKK L;  1L0X B;  1ROD A;  2KHJ A;  2OXP A;  3TP7 A;  5CMD A;  1CT1 D;  2CH4 W;  3KF8 B;  2RHQ B;  1P8L A;  4JOI A;  1LT6 D;  2QDL A;  4K6D A;  2F0D A;  1GUT A;  4FVM A;  2RVL A;  1IBM L;  2CWA A;  1Q8I A;  5ELO A;  1KD1 C;  3GD7 A;  5JJK A;  2K04 A;  1IYJ B;  1TKW B;  2K5V A;  5C3X A;  2ZM6 Q;  2F0W A;  3MHB A;  1XPR A;  3SDZ A;  5J1Z A;  3FP9 A;  4Q0F A;  2CCZ A;  3P20 A;  3U9S A;  4DF7 A;  1Q82 C;  3CCU A;  2A6H D;  4MIU A;  5K5P A;  3ULP A;  1T5X D;  4NPS A;  1EOT A;  4XDX A;  1G29 1;  3J80 c;  4X3T A;  3M7G A;  3R8B A;  2B2Y C;  4LF9 Q;  1FJG Q;  4WOR A;  2F0Q A;  5KGU A;  5JEA G;  5FJ8 G;  1BR9 A;  1EEF D;  1VQK A;  3HOY H;  3FEW X;  1A63 A;  3ERQ A;  5C44 H;  2XVS A;  2JA5 G;  3K8A A;  3WDN A;  3I4N G;  1VQ5 A;  2ZJQ A;  4V0B A;  2UXD L;  1ZEQ X;  3TRZ A;  2KEE A;  4G4K A;  1XTC D;  2F0K A;  1STN A;  4DR7 Q;  4C3I B;  3Q6S A;  2NTT A;  4BBS B;  1CHQ D;  1XXG A;  1TWH H;  2EY5 A;  4OIJ A;  1YJ9 A;  3CCV A;  2JQO A;  2EJM A;  1EY0 A;  5GRO A;  2HCC A;  1QE6 A;  4DAY A;  3CCJ A;  5LMN W;  4XYQ A;  2VQE L;  1JCK B;  4OGQ C;  4APV A;  1EY8 A;  1SYF A;  2ATW A;  1K8M A;  3MXN B;  4HSP A;  4P72 A;  3LX0 A;  5FLX c;  4CDD C;  3A5Z B;  4LF9 L;  4OO1 H;  3HRZ C;  3VR2 A;  1GVP A;  1Y14 B;  1BDO A;  1G91 A;  1BBW A;  1PTO B;  3CW2 C;  1OXV A;  3GTL B;  4HSV A;  3X3M A;  3EBE A;  2JSO A;  1YIT A;  1WD1 A;  3V05 A;  2ALY B;  1K8O A;  1FR3 A;  1TT2 A;  3NQT A;  1Q90 A;  3OPO A;  1Q86 C;  2EE1 A;  4EQO A;  4G7O C;  4RAU C;  4K2L A;  5G3L D;  2L12 A;  1T9H A;  1NR2 A;  1RKN A;  3C1F A;  3G4S A;  4R1J A;  5FLM H;  1S5B D;  4A3K G;  1JWM D;  2AQ2 B;  5C0X G;  4PMB A;  4RGO S;  4A3B B;  2NBF A;  1VF7 A;  2QA4 A;  1AZQ A;  3I4L A;  1N36 L;  3PGZ A;  4PG3 A;  1Z7T A;  2RDH A;  5JJL A;  5C3E G;  2K75 A;  5D14 A;  5C3E H;  3HS0 C;  1YNX A;  4M8A A;  4MHE A;  4LF8 L;  1PFS A;  2ZTC A;  3U58 A;  2HDM A;  1SRU A;  1O7Z A;  1HQR D;  3ERO A;  4DUZ L;  2IY5 B;  2F0G A;  1NBW A;  3K5M A;  1LTT D;  2F0U A;  4PMC A;  1HQM C;  5EAY A;  3G48 A;  3MXG A;  2JA7 G;  1V1P A;  4A3G G;  3S2D B;  2L0C A;  2R61 A;  1ICF B;  5COR A;  4UP8 A;  1CA5 A;  4BY1 G;  2Q2I A;  1NY4 A;  5GAD C;  2HDL A;  3GDE A;  4A3B G;  1EYD A;  1CZW A;  3H0G B;  4Y52 H;  2EYF A;  2AWN A;  3VYR A;  3DLL A;  5K36 H;  3BYT B;  1EWH A;  4PQX A;  1BCP F;  3A7L A;  5LMN L;  1KLU D;  1WOC A;  5I9O A;  3SK4 A;  4EGV A;  4GKJ L;  1AN8 A;  2NVY H;  2K52 A;  4JBM A;  4LF5 L;  2NVQ B;  3T51 B;  1V1P B;  1J8I A;  4XQJ A;  1N34 L;  4IPH A;  3KJP A;  1BF4 A;  5BN4 A;  4X66 Q;  2WAQ B;  2AKW B;  2PYK A;  5IIF A;  4FF3 A;  3CCS A;  2QCP X;  1PZJ D;  2CQA A;  4K5W A;  1SNC A;  1KAW A;  2ID0 A;  2B2V A;  2NN6 G;  3BYY B;  1VQB A;  4GLA C;  4ME5 A;  4AQY Q;  3H6M A;  2Z9H A;  3RZD B;  2D62 A;  4FYD A;  4R8I A;  3BG3 A;  5J22 A;  4IOC A;  3I4M H;  5C0X J;  4NMZ A;  4C1N I;  1V1Q A;  3CD6 A;  5EPL A;  1XTD A;  3K80 C;  4KKT A;  1N34 Q;  1Q1B A;  4GZY C;  2F0T A;  1Q1E A;  3KFU A;  1JOO A;  3DHQ A;  5J3B A;  2BDN A;  2VB3 X;  1Y1V G;  1TXY A;  3S24 A;  1B7Y B;  2ICE C;  4ODG A;  4PZ6 A;  3KLW A;  3S1Q B;  1KIX A;  3NHH A;  4ZYS A;  3WOF A;  3K0Y A;  2EYH A;  4ZRZ A;  4BBS G;  4TKO B;  1HNZ Q;  4DGZ A;  5JAV A;  4DR6 Q;  2LY7 A;  3NE5 B;  2VW9 A;  2L9H A;  2SNM A;  1SYD A;  1HZ9 A;  2P5Z X;  4IUR A;  1F77 A;  3CF5 A;  1HXY D;  1B3Q A;  2R93 H;  5JPM C;  3R2T A;  1PTO D;  1EEI D;  2NZ1 D;  4O2D A;  2VUM B;  1QZH A;  5KYL A;  1X3F A;  5IGD A;  5C4J B;  2DN8 A;  2EZV A;  4Z9C B;  1PTO F;  5KRU A;  2UXC L;  3PCO B;  4YY3 L;  3S14 B;  3DXJ C;  1LYL A;  1QNK A;  3SK8 A;  1L1O C;  1PFB A;  1EL0 A;  3CQZ H;  4A3I H;  2EQS A;  5IGE A;  5CBE E;  3GTG H;  3PUW A;  3HFZ B;  5CV5 A;  3ONA B;  5JJZ A;  1I4H A;  2HHH L;  4FXK C;  4I7A A;  3I56 A;  1DZ1 A;  4GN4 B;  3VYS A;  1X55 A;  4JOI C;  5ISR A;  4N8X 1;  2KHS A;  3VYT A;  4DU9 A;  2XTI A;  4IPC A;  2CH4 A;  4YWL A;  2M2L A;  4A3E B;  2A6E D;  1Y1V B;  5ELC A;  4MTN A;  4B9W A;  4B3S L;  2MUY A;  1LAB A;  3D0F A;  4RA8 A;  3ND8 A;  4JI1 L;  2HT1 A;  1Q12 A;  2K32 A;  3NBH B;  2B2V C;  2UUA Q;  1A2T A;  3D3R A;  2PW7 A;  4DKA C;  4MZ9 A;  1HZC A;  4RHS A;  3MA2 B;  4CHT B;  5I6W A;  5M5W H;  1VQ8 A;  4BY7 H;  2X6G A;  1XNQ Q;  2HD3 A;  3NXW A;  2WV6 D;  1R9T B;  4IAL A;  2D0P A;  1II3 A;  1K0S A;  2HQL A;  1Q8K A;  1H9M A;  2K7V A;  1M1K C;  4QUC A;  4WJ3 M;  4AYB G;  2A1A A;  4BWG B;  4DR1 Q;  5IWA L;  1NMG A;  3AU7 A;  4C3H H;  1HNX L;  1DM0 B;  3ITP A;  4HN7 A;  2YTX A;  4DV5 L;  1E3P A;  2UUA L;  3CQZ B;  4A3I B;  3PUZ A;  4IJH A;  3OIQ A;  4IUV A;  1RTO A;  3OHX C;  1F9S A;  2K1B A;  3J80 L;  1C0A A;  4X3U A;  1DON A;  3PMF A;  1UE1 A;  4C3I G;  1S5F D;  4HIO A;  5I9P A;  1ET6 A;  1GUG A;  5IWA Q;  1I3Q H;  4XT3 B;  1VQC A;  2PQE A;  4ZCK A;  4KHZ A;  1QCB D;  1S4Z A;  3DUZ A;  2QEJ C;  1IBM Q;  2BA0 A;  1M90 C;  2UU9 Q;  2R92 G;  4EQP A;  1STY A;  5L37 A;  1JT8 A;  2UXB L;  3HOW G;  3GTM H;  5C44 G;  4S3S A;  1XNQ L;  1MGS A;  4DK6 C;  1PDQ A;  2IW3 A;  5EPJ A;  4UAI A;  3V96 A;  3RLO A;  1YNJ C;  2JP1 A;  1DOM A;  2OQK A;  2RCN A;  3E0J A;  3BDO A;  1EIF A;  1HTL D;  2EOT A;  3EA6 A;  1EY6 A;  4A3C G;  5GAG C;  2LFN A;  3N6R A;  4QJF A;  4IUN A;  3KDF A;  2XN9 C;  2OQ0 A;  5DM7 3;  1DXM A;  3C46 A;  3MTS A;  1PFN A;  3FVQ A;  3A54 A;  5E1F A;  2O5I C;  2VB2 X;  2OTL A;  1BNZ A;  3T4A C;  4K8I A;  4JW0 A;  3RZD H;  4IQZ A;  2HQE A;  3K58 A;  1Y1W B;  1D5X C;  1EZ6 A;  4ALP A;  3ER0 A;  4ZAI A;  4RKB A;  5JOB A;  1EY9 A;  1J9O A;  5EKL A;  3SK6 A;  4DA2 A;  4LFB L;  1EY5 A;  2JEA I;  3F2C A;  3MZ5 A;  1H9R A;  1BXT A;  4F87 A;  1V43 A;  1VQJ A;  1S5C D;  4L6T B;  4JI3 L;  2KJX A;  3ICE A;  4EQN A;  4WFN 3;  2OEO A;  2YTV A;  2CKZ B;  2ZXP A;  4XQN A;  4X3S A;  1VQF A;  2IX1 A;  3TEH B;  1G2S A;  4CDC C;  2QEX A;  1HR0 Q;  1FGB D;  4NDX A;  4C56 C;  3S1R H;  1MHW C;  1E1O A;  1HPC A;  5EBC A;  4N8F A;  2FFK B;  2EYM A;  2MHV A;  2I0Q A;  3NQI A;  1TWA H;  3L7Z C;  1VQL A;  1TS5 A;  3RZO B;  5C5L A;  3GTP H;  5M3M B;  3I70 A;  2ZTE A;  1MI2 A;  2VZA A;  4KV6 A;  1VQ6 A;  3H0G H;  4GNX A;  3E9H A;  4H13 C;  2HCI A;  3GTO B;  5ELN A;  1CUK A;  1NUC A;  3PUV A;  2KCT A;  4DAM A;  3S14 H;  3CU7 A;  4RH6 A;  3AFP A;  2GVB A;  3D6W A;  2AHO B;  4ZUJ A;  4R9W A;  1F9R A;  4YHH L;  4K8J A;  4KTA A;  1GJX A;  2HIX A;  1MD2 D;  3M85 A;  4LFC Q;  3L2P A;  1D5M C;  1PRT F;  2JA8 G;  4DAV A;  3TDQ A;  3AB9 A;  5CGK A;  1IL8 A;  1WTO A;  4GLX A;  1LUZ A;  4N9P A;  3JAM c;  3HOZ H;  1AE2 A;  4DAY B;  3J81 j;  1CSQ A;  1O7I A;  5DLQ E;  1WYD A;  1UE7 A;  3E6Z X;  3U4V A;  3VDY A;  2A68 D;  3H09 A;  4GS3 A;  4DR2 Q;  1H95 A;  3QWN A;  3EN2 A;  3HKZ E;  3A5U A;  1F2M A;  1X9N A;  3SHL A;  3S1M B;  1RDP D;  1UNS A;  4DV1 L;  1HH2 P;  2R3Z A;  3R3O A;  5BR8 L;  3TP5 A;  2EJF C;  2I5M X;  1EUJ A;  4A4I A;  4KKU A;  1SYB A;  3CC4 A;  2XWJ B;  5HY6 A;  3AQQ A;  4C1N K;  1DOL A;  3HOY B;  1YNN D;  3Q23 A;  3M4O H;  4DUZ Q;  1C4Q A;  5AFW A;  1CKN A;  1FGU A;  2GA4 B;  2VY3 A;  2Y0S E;  3QO2 A;  3T53 B;  1DJR D;  2K05 A;  5IYD G;  4OL7 A;  1S40 A;  1EWC A;  2EY1 A;  3CRL C;  3I2Z A;  4IUQ A;  3CKI B;  4MN3 A;  1ONL A;  3HOV G;  1PYB A;  4DAP A;  2K5H A;  3J81 E;  1TWH B;  4JI4 L;  3H3V C;  1HA6 A;  3KBG A;  4O0A A;  2YTY A;  2K14 A;  3BS1 A;  5C4X B;  1VMC A;  2J0T D;  2IX0 A;  2B2W A;  2FMC A;  3CCM A;  2R7Z B;  2NVX B;  4JI8 Q;  4XYO A;  4QUF A;  4BBS H;  1TY2 A;  4JK1 C;  2WIN B;  4LAA A;  5DNF A;  1S72 A;  5E4X A;  3UDF A;  5M5X B;  1AEX A;  1JOK A;  3BJU A;  5JVH 3;  1OTC A;  1BVS A;  4XTC S;  2AUJ D;  3DEP A;  5KNB A;  2ENB A;  4X65 Q;  4BY7 B;  1A0I A;  1K83 B;  1I4P A;  1R9T H;  2VQE Q;  3F2B A;  2IWH A;  1TVX A;  4H0L C;  3C1E A;  1NAP A;  1C8C A;  3EFX D;  1IBK Q;  4B3T Q;  2F3I A;  4R8N A;  4LFA Q;  3AFQ A;  4A3J G;  2JN4 A;  1X3P A;  1D6E C;  2PZT A;  3H91 A;  2JA7 H;  4LF7 Q;  3PSI A;  1Q7Y C;  3GP7 A;  1GKH A;  2K5W A;  4OEM B;  1VQI A;  1LTS D;  4KJO A;  3HOX B;  1A15 A;  1WTR A;  4PMW A;  3PUX A;  1IL2 A;  1I3Q B;  1K73 C;  4ZKC B;  5KEE A;  3T1H L;  3GTQ B;  2OF1 A;  2QDB A;  4NW2 A;  3TRE A;  2F0S A;  1D8L A;  3OIP A;  4IOA A;  4IFD J;  1IKM A;  2FIN B;  3AYH B;  4F8M A;  2ICI A;  4Q5V A;  1D1I A;  3K7A H;  5IYD H;  3PQI A;  3IKJ A;  5M5Y H;  3I4M B;  2K50 A;  1KAA A;  4XIG S;  3NK9 A;  1EOV A;  4JI0 L;  3NTH A;  4DUY L;  3TP8 A;  4B3M L;  4FF2 A;  5I2X A; 
#chains in the Genus database with same CATH homology
 4A3L H;  4K0K L;  2NVY H;  4JI4 Q;  4JI8 L;  2K52 A;  4JBM A;  4OO1 I;  4LF5 L;  2WB1 G;  4DK3 C;  4L5S A;  5IP9 H;  4YCV A;  3I4N H;  3OTO L;  1X3G A;  3ULJ A;  1N36 Q;  4NXM Q;  1DGS A;  5HGQ A;  1N34 L;  4LFA L;  4LF4 L;  4IPH A;  3KJP A;  4TVA B;  3FKI H;  3NEN A;  3S1N H;  1FJG L;  4X66 Q;  5AJ3 L;  4P75 A;  1KXL A;  4A93 H;  2AKW B;  4QY7 A;  1MKH A;  3E9I A;  3CCS A;  2LXJ A;  1MIU A;  2N3S A;  2LSS A;  1KAW A;  4YWM A;  2ID0 A;  4A3F H;  3F1Z A;  2C35 B;  1S3O A;  2NN6 G;  2KHI A;  1CKO A;  2AWO A;  1VQB A;  2WP8 J;  4GLA C;  4AQY Q;  1PH7 A;  3U50 C;  1GD7 A;  2PQA A;  2D62 A;  4HJA A;  1YJW A;  2VUM H;  4C3I H;  3H3V H;  4IOC A;  4POG A;  5C0X J;  3I4M H;  2JJQ A;  2MO0 A;  3A74 A;  3G71 A;  1V1Q A;  3HOX G;  4A75 A;  1VQG A;  2IHE A;  4A3K H;  1JJ2 A;  3CD6 A;  1XTD A;  3HOX H;  2OTJ A;  3K80 C;  1N34 Q;  1PH6 A;  1Q1B A;  3UE1 A;  3K7U C;  1WI5 A;  4A93 G;  2Z6K A;  1Q1E A;  3KFU A;  2Q2T A;  3PF5 A;  2F52 A;  3J80 i;  5J3B A;  1XMO Q;  1XNR L;  2CQO A;  3B6Y A;  1XJV A;  4X64 Q;  2A19 A;  1CKN B;  1Y1V G;  1WJJ A;  1TXY A;  2YV5 A;  3S24 A;  3RNU A;  1B7Y B;  4PZ6 A;  1G51 A;  4UP7 A;  4A3F G;  1KQS A;  3RLF A;  3KLW A;  1HZA A;  1YIJ A;  3MEF A;  4JBJ A;  4LUZ A;  1SN8 A;  1KIX A;  1N8R C;  3HOU H;  3M3Y H;  1XPO A;  3I4M G;  3CXC A;  2OCE A;  4YWK A;  3CCR A;  1XMO L;  1XNR Q;  4BBR G;  2BH8 A;  2K4K A;  4UY8 C;  3S1Q H;  3OW2 A;  4BBS G;  4JC0 A;  3KF6 A;  2YU9 H;  5JEA J;  1SLJ A;  1HNZ Q;  1VQM A;  1SFO H;  4DR6 Q;  1W3S A;  2JA8 H;  2VW9 A;  1YHQ A;  4KHP L;  4B3S Q;  4BA1 I;  4NXM L;  4DR1 L;  2GN5 A;  4LF6 L;  1HZ9 A;  2KEN A;  4FDB A;  3UE0 A;  5GAE C;  1VQE A;  2IT1 A;  3OYY A;  4X66 L;  2A8V A;  3NEM A;  3ZJY C;  4OWX B;  3CF5 A;  3W1B A;  2R93 H;  1HNZ L;  5C4J H;  3HOU G;  1CKM A;  4L5Q A;  4O2D A;  4EQ5 A;  2MNA A;  1PHJ A;  4BXX G;  1WCM G;  4IO9 A;  2R7Z H;  1QZH A;  1WCM H;  1X3F A;  2ASB A;  4LWC A;  4KHP Q;  2H5X A;  4DR2 L;  4B3M Q;  2LXK A;  5FJ8 H;  4DUY Q;  3J81 c;  1N33 L;  1IZ6 A;  2JE6 I;  2UXC L;  1JMC A;  3PCO B;  4AH6 A;  4YY3 L;  1Y1W G;  1I94 L;  3E0E A;  2NVT H;  1LYL A;  5C4X H;  4GNX C;  1V9P A;  2PI2 A;  4LF5 Q;  1L1O C;  2D0O A;  3J81 i;  3I7F A;  4NXN Q;  4IFD I;  3T1H Q;  4DV7 L;  3CQZ H;  4A3I H;  2EQS A;  4AIM A;  1SRO A;  4DV4 Q;  1KRT A;  3DM3 A;  2KCM A;  1PH3 A;  1IBK L;  3PUW A;  3CCQ A;  1QVF A;  3GTG H;  3FKI G;  3FHW A;  3HFZ B;  3GTL H;  4A3B H;  4YCU A;  1YI2 A;  3PF4 A;  1QVC A;  3I4O A;  4X64 L;  3GTJ H;  2HHH L;  1OXX K;  1N9W A;  3I56 A;  4GN4 B;  2BH2 A;  1X55 A;  4JOI C;  1SR3 A;  3H3V I;  2AMC B;  4A3C H;  1VQ9 A;  4LF7 L;  2N78 A;  3CC2 A;  1JJG A;  3CPW A;  2HIV A;  5IT9 c;  2XTI A;  4IPC A;  3Q8D A;  4YCW A;  4GKJ Q;  4YWL A;  4A3G H;  3PV0 A;  4QGU A;  2EIF A;  4MTN A;  4QIW E;  5IP7 H;  4B3S L;  3D0F A;  2KBN A;  4AQY L;  1AH9 A;  2E5L L;  1E7Z A;  4JI3 Q;  4JI1 L;  2HT1 A;  1EYG A;  1Q12 A;  2WFW A;  4BA2 I;  3KYH C;  3M9B A;  1BBU A;  3PUY A;  1J5E L;  1NE3 A;  3M4P A;  3NBH B;  3S2D H;  4X62 Q;  2UUA Q;  2NZH A;  4UP9 A;  3PIP A;  3PO3 H;  4DKA C;  3JAM i;  4DR5 Q;  4A3M G;  4MZ9 A;  1HZC A;  1MJE A;  5M5W H;  2L15 A;  1VQ8 A;  4BY7 H;  4LUV A;  1XNQ Q;  2VUM G;  2PQA B;  4BY7 G;  2PI2 E;  1K83 H;  2Y0S G;  1J5E Q;  3RR5 A;  2D0P A;  4JCV E;  4QL5 A;  2JK8 A;  1HJP A;  2HQL A;  1Q8K A;  1BKB A;  1LTL A;  1EQQ A;  1MJC A;  1M1K C;  4WJ3 M;  4AYB G;  2A1A A;  4JI7 Q;  4DNI A;  3HOV H;  4DR1 Q;  5IWA L;  1NMG A;  1NJI C;  3S15 H;  4C3H H;  1HNX L;  2WAQ G;  3HKZ G;  4DV5 L;  2YTX A;  1E3P A;  4X62 L;  2UUA L;  1ASY A;  3PUZ A;  1A8V A;  2MFI A;  4IJH A;  4JBW A;  4DV1 Q;  3HOZ G;  4R4Q A;  4HIK A;  3S1M H;  4A3E H;  1Q81 C;  2B3G A;  4DR5 L;  1EIY B;  1C0A A;  1K3R A;  1GM5 A;  1UE1 A;  2IHF A;  3W1G A;  4HIO A;  3KDF B;  2UUB L;  5IWA Q;  1E22 A;  1I3Q H;  1VQC A;  2R7F A;  1I5F A;  1A62 A;  4OON A;  4BBR H;  1FL0 A;  1PVO A;  4KHZ A;  2OWO A;  3H0G G;  3S16 H;  1IBM Q;  2BA0 A;  1M90 C;  2UU9 Q;  2R92 G;  5JJI A;  3RN2 A;  2BA1 A;  4H02 A;  1X6O A;  1JT8 A;  1I50 H;  2VQF L;  3GTM H;  3GTK H;  3HOW G;  5C44 G;  1VQD A;  1XNQ L;  2UXB L;  5M3M H;  4DK6 C;  1VQH A;  2FXQ A;  5M3M G;  2R7D A;  3RLO A;  4LF8 Q;  4A3E G;  4JI2 Q;  2F4V L;  1J6Q A;  2OQK A;  2RCN A;  2B63 H;  1L0W A;  4HJ5 A;  2NVX H;  1EIF A;  3CMA A;  2B63 G;  4BXX H;  1YBY A;  2MO1 A;  4DR3 L;  3CPF A;  5IYC G;  4EX5 A;  4OWT B;  5GAG C;  4QJF A;  1JE5 A;  4A3C G;  4JBK A;  3KDF A;  1Y1W H;  1XMQ Q;  1E1T A;  2OQ0 A;  3CCE A;  4DR7 L;  4DV6 Q;  4LF4 Q;  1K9M C;  1HR0 W;  5IYB H;  1OXT A;  5IP7 G;  2I5H A;  2R93 G;  2OTL A;  1GO3 E;  3K0X A;  1XMQ L;  3RZD H;  2DGY A;  2RF4 A;  3GO5 A;  1VQN A;  2B29 A;  5IYC H;  2UU9 L;  2DUD A;  1I6H H;  3UDX A;  1L1O B;  1SMX A;  4DV6 L;  2E2J H;  1JJC B;  4ALP A;  3ER0 A;  3T1Y L;  4DR4 L;  4DV3 L;  1C7Y A;  1PH1 A;  4DV4 L;  4IPG A;  4TQU S;  4A3L G;  3STB C;  1B70 B;  4OO1 G;  3UDI A;  4LFB L;  2CWP A;  1FVI A;  2JEA I;  3F2C A;  4HIM A;  1SE8 A;  4DV0 L;  1HR0 L;  4X65 L;  1EWI A;  4IJL A;  4C3J H;  4A3I G;  1V43 A;  1VQJ A;  1K8G A;  2JA6 G;  3NEL A;  4P71 A;  1HZB A;  4UPA A;  1VCI A;  5M5X H;  2PNH A;  3BZK A;  4JI3 L;  1NMF A;  1ASZ A;  5AJ3 Q;  2NVQ H;  3S2H H;  3M4Q A;  4L5R C;  3ICE A;  2YTV A;  4DV3 Q;  1HNX Q;  2CKZ B;  1VQF A;  2IX1 A;  2Q2U A;  2N8N A;  1VQP A;  3TEH B;  1TWF H;  2QEX A;  2JEB I;  4DV0 Q;  5GQO A;  1HR0 Q;  3KJO A;  3S1R H;  1E1O A;  1XPU A;  2WB1 E;  5GAH C;  3HKS A;  1YJN A;  1WFQ A;  4JI0 Q;  5LMU Q;  4JYA L;  2I0Q A;  4RG1 A;  4NB3 A;  1TWA H;  3L7Z C;  1K0R A;  1VQL A;  4PZ8 A;  3GTP H;  1U0L A;  2HHH Q;  2ZTE A;  3CCL A;  2VZA A;  4R4C A;  2E2H H;  1VQ6 A;  1UEB A;  3G6E A;  3LGJ A;  3GTO H;  4ME3 A;  3H0G H;  1YHB A;  2VQF Q;  4GNX A;  3E9H A;  3CP0 A;  1K8A C;  1L1O A;  3M7N A;  4DV5 Q;  3RLN A;  4K0K Q;  4LFB Q;  2Q2H A;  1CUK A;  1Z9F A;  2Z0S A;  4GLV B;  5ELN A;  1Z47 A;  5M3F G;  2ZTD A;  3PUV A;  3K81 C;  4P74 A;  5M3F H;  3J7Z C;  4A3M H;  1I94 Q;  4GKK L;  2KCT A;  4DAM A;  1QUQ A;  1RL2 A;  1PH4 A;  3S14 H;  4GN5 A;  1PH5 A;  2KHJ A;  3AFP A;  2GVB A;  2AHO B;  3TS2 A;  1AE3 A;  4JI6 Q;  4NXN L;  3KF8 B;  4RMF A;  2RHQ B;  5FLM G;  4YHH L;  1P8L A;  3ERS X;  4JOI A;  4POF A;  1B8A A;  2HIX A;  3TQY A;  4HJ8 A;  2ES2 A;  3CME A;  3M85 A;  1IBM L;  4LFC Q;  2CWA A;  3L2P A;  4B3T L;  5ELO A;  1PH8 A;  1KD1 C;  3GD7 A;  5JJK A;  1IYJ B;  2ZM6 Q;  2K5V A;  3KOJ A;  2E8G A;  5IY0 A;  3CC7 A;  1XPR A;  2JA8 G;  1X65 A;  4GLX A;  1LUZ A;  1Y1V H;  3FP9 A;  2CCZ A;  1Q82 C;  2UUB Q;  3F8T A;  4JI5 Q;  3JAM c;  1IBL Q;  3HOZ H;  1AE2 A;  4JV5 Q;  3CCU A;  4DAY B;  1UE6 A;  1VQA A;  1CSQ A;  1O7I A;  4MNO A;  5DLQ E;  4IPD A;  3J81 j;  4QQB X;  1WYD A;  1UE7 A;  3U4V A;  1UE5 A;  5IE8 A;  1YHA A;  3ULP A;  3VDY A;  3GTQ H;  4A3D H;  1TWC H;  4NPS A;  1G29 1;  3J80 c;  2VL6 A;  4GS3 A;  4DR2 Q;  1H95 A;  2JA9 A;  4R4T A;  3W5O A;  1PA6 A;  4GOP C;  3EN2 A;  3HKZ E;  4LF9 Q;  3A5U A;  1FJG Q;  5K36 G;  1X9N A;  2VS1 A;  5JEA G;  5FJ8 G;  1VQK A;  4A3J H;  3TS0 A;  4R4O A;  2CFM A;  3HOY H;  4DV1 L;  1HH2 P;  1VQO A;  1A63 A;  5BR8 L;  5C44 H;  3D31 A;  2I5M X;  2JA5 G;  1N32 L;  3K8A A;  2E5L Q;  1EUJ A;  5IP9 G;  4JI5 L;  4A4I A;  3I4N G;  1VQ5 A;  2ZJQ A;  1IBL L;  4HJ9 A;  4BY1 H;  2UXD L;  5C0X I;  3CC4 A;  3TRZ A;  1HNW L;  1YZ6 A;  1QVG A;  2E2I H;  4DR6 L;  3J7A 5;  2ZJP A;  4OWW B;  5HY6 A;  3AQQ A;  1E24 A;  1U5K A;  4DR7 Q;  2UXB Q;  4A76 A;  2R6G A;  3WWV A;  1TWH H;  3M4O H;  4JI6 L;  4DUZ Q;  3HOY G;  1YJ9 A;  4P73 A;  4JI2 L;  1UWV A;  3CCV A;  2JQO A;  2WAQ E;  4DV2 Q;  2F4V Q;  1YVC A;  4R4I A;  1OXU A;  2EXD A;  4L5T A;  5GRO A;  1VQ7 A;  2JA5 H;  1P16 A;  1N33 Q;  4B3R Q;  3EIV A;  1CKN A;  1FGU A;  1VQ4 A;  2JA6 H;  3CCJ A;  1Q46 A;  2VY3 A;  2Y0S E;  4LUO A;  2VQE L;  5LMN W;  2UUC Q;  4DV7 Q;  1L2F A;  1CSP A;  5IYD G;  3RN5 A;  1X3E A;  4APV A;  1S40 A;  3UDG A;  3I2Z A;  3HOV G;  4IFD G;  1PYB A;  2NN6 I;  2K5H A;  2ATW A;  3MXN B;  4JI4 L;  4O0A A;  3L0O A;  4DPG A;  3KF6 B;  4P72 A;  2MQH A;  5FLX c;  1TWG H;  2PMZ E;  3A5Z B;  4OX9 Q;  4LF9 L;  2YTY A;  2K14 A;  1PH2 A;  5LMU L;  4JYA Q;  1GVP A;  3RZO H;  1Y14 B;  3PIO A;  2V1C C;  1YEZ A;  3AEV A;  2UXD Q;  3PO2 H;  2IX0 A;  3BU2 A;  3CCM A;  1BBW A;  2RHS B;  4KI0 A;  4JI8 Q;  3PO2 G;  3CW2 C;  4GN3 B;  5BR8 Q;  1X56 A;  4BBS H;  1OXV A;  2N49 A;  1KHI A;  3T1Y Q;  1S72 A;  2ZM6 L;  4DR4 Q;  3EBE A;  1YIT A;  3UDF A;  3F2D A;  4GNX B;  3BJU A;  4JG2 A;  3I55 A;  2ALY B;  3A0J A;  1OTC A;  1G6P A;  1BVS A;  2XGT A;  2Z6K C;  4XTC S;  4LFC L;  1Q86 C;  4X65 Q;  4GOP B;  1IXR A;  1QZG A;  3ULL A;  1A0I A;  1QUQ B;  1LM0 A;  1T9H A;  1R9T H;  3CAM A;  4OX9 L;  2VQE Q;  2UUC L;  4A3D G;  4HID A;  3G4S A;  3F2B A;  4R1J A;  1KL9 A;  5FLM H;  5LMN Q;  4LW1 A;  4A3K G;  1IBK Q;  5E7N A;  1PV4 A;  4DV2 L;  5C0X G;  3IRB A;  2F3I A;  4KLK A;  4PZ7 A;  3SGI A;  4B3T Q;  3BZC A;  4LFA Q;  3AFQ A;  2QA4 A;  4A3J G;  4J15 A;  2R92 H;  2K5N A;  3JC6 6;  1N36 L;  2ZJR A;  2JA7 H;  4OXP A;  4LF7 Q;  3PGZ A;  3PSI A;  4PG3 A;  1Q7Y C;  5JJL A;  4HJ7 A;  4LF6 Q;  1PYS B;  5C3E G;  4YHH Q;  2K75 A;  4LNQ A;  1GKH A;  3HOW H;  3S17 H;  5C3E H;  1VQI A;  1RIP A;  4C2M H;  1YNX A;  2NZO A;  1HNW Q;  4LF8 L;  4PMW A;  1PFS A;  2YYZ A;  3PUX A;  2ZTC A;  4Y7N H;  4GOP A;  3U58 A;  1IL2 A;  3OTO Q;  2I5L X;  1K73 C;  1JB7 A;  2VNU D;  3T1H L;  1SRU A;  4DR3 Q;  4JI1 Q;  3TRE A;  3U4Z A;  4DUZ L;  2IY5 B;  1NBW A;  1NTG A;  4JV5 L;  1W2B A;  5C4X G;  3H15 A;  4YY3 Q;  4GKK Q;  1D8L A;  5EAY A;  3G48 A;  2JA7 G;  4A3G G;  4IOA A;  4B3R L;  5H1S E;  1N32 Q;  1D7Q A;  4IFD J;  4UP8 A;  2GVA A;  1PH9 A;  4BY1 G;  2Q2I A;  3AYH B;  4X6A H;  1KC8 C;  1NY4 A;  3K7A H;  5IYB G;  5GAD C;  3GDE A;  2UXC Q;  2R7Z G;  4A3B G;  5IYD H;  1EFW A;  3STB D;  5M5Y H;  4Y52 H;  2AWN A;  1C9O A;  2K50 A;  4AYB E;  1X54 A;  1KRS A;  3DLL A;  4XIG S;  1VS0 A;  1EOV A;  1EQR A;  4JI7 L;  4JI0 L;  1OXS C;  4WJ4 A;  3PO3 G;  2QGQ A;  5LMN L;  1WOC A;  4DUY L;  4B3M L;  4GKJ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...