4LF6Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf6Q00
2HHHL 5JEAJ 1B8AA 1SRUA 3W1BA 2E2HH 1DGSA 5IWAQ 4YCVA 5HY6A 4LF8L 2ZJPA 2GN5A 3GTQH 1I50H 4JYAL 2Z6KA 2AMCB 4AYBE 4DR3Q 3PO2H 3UDXA 1YJNA 1IBLL 4UP8A 3RLOA 2VQEL 1A8VA 4DR4L 2YYZA 4LF7L 3UE0A 2D62A 4NXML 3OTOL 3H3VI 2HIVA 1RL2A 1EOVA 1YIJA 4DK3C 2NZHA 2CFMA 1N36Q 1JB7A 1NMFA 3I56A 1KXLA 4IFDI 2N3SA 1S3OA 2IY5B 3AQQA 2QEXA 3JC66 4X65Q 2JA6H 4APVA 4UP7A 4DR6Q 3D0FA 4X64L 1QVCA 4LF9Q 1C9OA 3K80C 1EYGA 2NVYH 1OXTA 1M90C 2R7DA 4IPCA 4DNIA 4WJ4A 1YNXA 4ALPA 3NEMA 3K81C 2PQAB 1VQ4A 2NVTH 1K3RA 5IY0A 4LF6Q 1FJGQ 2UXDQ 4R4CA 4JI2Q 3CCRA 3CCSA 4R4IA 2JEBI 3F2CA 2HT1A 3ULJA 2PI2A 4R1JA 5GAGC 2HHHQ 1XNRL 2Z0SA 4DV2Q 5IP9H 4J15A 2NZOA 2PNHA 5IT9c 2ES2A 2R7ZH 4JYAQ 3RR5A 1HNWL 3CMEA 1PA6A 2MO0A 3GTGH 4IOAA 3PF4A 3PO3H 5GAHC 3U4ZA 3W5OA 2VQEQ 1K73C 4A3FG 3EN2A 3KJOA 4A3EH 4LF7Q 1Q12A 1D7QA 4A3CH 1L2FA 2E8GA 4LW1A 3OTOQ 1VQBA 4IJHA 4RG1A 4A75A 1IBKL 4OXPA 3CCQA 3G6EA 1PHJA 5IYCG 1UEBA 1QUQB 2RHQB 3T1YQ 2A19A 1WCMG 1P8LA 1EFWA 1VQ7A 3HFZB 3S16H 4K0KL 3L2PA 2EIFA 1BBUA 2Q2IA 3M85A 4OWWB 3CQZH 4JOIC 5GAEC 1VQMA 1Y14B 3S1MH 1E24A 3S14H 5IYDH 3PUVA 4JBJA 4GKJL 4A93H 3FKIG 4NPSA 4DUYL 1MKHA 2NVQH 1N32L 4LF4L 3WWVA 2R6GA 1VQAA 5C0XI 1OTCA 1TWFH 3PCOB 1JMCA 3DM3A 4YHHQ 4A3DG 1YI2A 3F8TA 2I5LX 3STBC 3I4NH 4A3MH 4A3GG 1XPRA 2YTXA 2OCEA 2YTVA 1XNRQ 4MTNA 5HGQA 1XMQQ 1IBMQ 2N49A 4TVAB 1OXUA 3K7UC 4R4QA 3S1QH 3CPFA 2V1CC 2IX0A 3NELA 1J5EQ 1Q82C 1SN8A 3G71A 4R4TA 1HNWQ 2B63H 4IFDJ 2L15A 2UXCQ 4GLVB 3HOXH 1Y1VH 3TEHB 1T9HA 1GM5A 4GN3B 4UPAA 1VQ8A 1RIPA 2AKWB 4B3ML 1KAWA 1BVSA 2LSSA 5JEAG 1CSPA 5C44G 4LF5L 4JI1L 3KF8B 2UUBQ 5JJLA 1V1QA 4YCWA 5IWAL 3PUWA 4AIMA 1VQFA 3HOUH 1LTLA 1X6OA 1I5FA 4XTCS 3A5UA 4DR3L 1M1KC 4JI0L 5JJKA 4K0KQ 4P72A 1V9PA 4DR4Q 5FLXc 3M9BA 3GDEA 1L1OC 4QGUA 4HIKA 1KD1C 3UDGA 1K8GA 2PMZE 1UE5A 1Q1EA 1GO3E 2ZTDA 4DV4L 5GROA 3HOYH 4A3BG 4GKJQ 1O7IA 3A74A 4L5TA 4DUYQ 3KF6A 1N32Q 1A63A 4RMFA 1N36L 2N78A 3S17H 1VCIA 1A62A 3F1ZA 4Y52H 1X9NA 1LUZA 3KDFA 1TWGH 2WAQG 1ASYA 2JA7G 5M5WH 4PMWA 5C4XH 1K83H 3E0EA 5GQOA 4YY3L 2LXKA 2AHOB 4DR6L 3A0JA 3D31A 1WJJA 3I2ZA 2Q2TA 1Q8KA 4OO1G 2RHSB 3PV0A 3CC7A 3S1RH 3M4PA 2NN6I 3H0GG 4JOIA 4LWCA 3CCLA 2KCTA 4X62Q 3RNUA 4PZ6A 1Q46A 1GVPA 2DGYA 4FDBA 4GOPA 1FJGL 3GTMH 2UXDL 3Q8DA 1VQKA 3JAMc 4UY8C 1VQ6A 1G6PA 4YCUA 4B3MQ 1JJ2A 2VW9A 4LF5Q 1EIYB 4JI1Q 3PIPA 1W2BA 1Z9FA 3BU2A 2ZTCA 4DV2L 1X54A 1K8AC 3HOWG 2JJQA 4L5SA 2UXBL 1YVCA 5C0XJ 5FLMH 4IO9A 1C0AA 1HZCA 1TWCH 4EQ5A 2JQOA 4PZ8A 4GN5A 4QIWE 2JA5G 4JI0Q 3J7A5 5M3FH 3M3YH 2Y0SE 4JG2A 1CUKA 3S2DH 1LYLA 3HKZE 4DR2L 4BBRH 5M5XH 4DV4Q 1R9TH 3H3VH 3U4VA 1X65A 4DKAC 1X3FA 2E2JH 4NXNL 5C4JH 4GLXA 1N9WA 1VQLA 1AE2A 1XJVA 3K8AA 3T1YL 4Y7NH 4AYBG 4JI5Q 3DLLA 1MIUA 3GD7A 2KHJA 3NENA 5FJ8G 4JI8L 4YY3Q 4H02A 4PZ7A 3S15H 4A3IH 2CCZA 2F3IA 2K5HA 3UE1A 4POFA 2MNAA 3F2DA 3KYHC 4A76A 1VQ9A 3EIVA 1YHAA 4A3KH 1NTGA 4HJ5A 1L1OA 2A1AA 1Q1BA 4QY7A 4JI3Q 1E1TA 2YTYA 2A8VA 3MXNB 1VQOA 2K75A 4YHHL 1VQNA 2F4VL 1W3SA 3GTKH 1PVOA 2IHEA 3RLFA 1MJCA 5LMUQ 3RN5A 2Q2HA 3PUXA 3KF6B 2K52A 1N8RC 3AEVA 2VUMG 1WFQA 3BZCA 5AJ3L 1XMQL 1HNXL 1KIXA 1IBML 1PH5A 5IP7H 3FP9A 4O0AA 3TREA 3OYYA 1J5EL 1YBYA 4HJ9A 2AWOA 3ERSX 2UXCL 1PYSB 2VZAA 4IPHA 1QVGA 1SROA 5C3EH 4P75A 1YHQA 4DR2Q 4GKKQ 5ELOA 4P74A 2QGQA 3I4MH 2WP8J 4KI0A 4BA2I 1FVIA 4NXNQ 1L0WA 3UDFA 1CKNA 2UUBL 4GOPB 2RCNA 1NBWA 1JE5A 4BY7G 4IPDA 4JBKA 4DPGA 4DAMA 2PI2E 2D0PA 2CWPA 5E7NA 2Q2UA 3HOZG 1SLJA 1TXYA 3AFPA 1YZ6A 3GTOH 4DV6Q 1Y1WH 3TRZA 4JI8Q 1HJPA 4LUVA 4BBSH 1TWHH 2JEAI 2LXJA 2BH8A 3ZJYC 2R93H 4C2MH 1YJ9A 2R7ZG 1PV4A 1IXRA 3PO3G 1WI5A 1N34Q 3BZKA 2F4VQ 1NY4A 5IYBH 1NE3A 1AE3A 3JAMi 1XTDA 1PFSA 4OWTB 4QJFA 2RF4A 3HKSA 3STBD 1KC8C 4LFCQ 1I3QH 1HNXQ 5AJ3Q 1MJEA 1EUJA 2K5VA 2WB1E 4NB3A 4A3JH 4BXXG 3RZDH 1CSQA 5GADC 4X62L 1KHIA 4DUZL 4X66L 3VDYA 1PH8A 2CQOA 1U0LA 2ID0A 4GNXC 1OXXK 4KLKA 5IYDG 1L1OB 2IX1A 2XGTA 1JT8A 3U50C 1IL2A 2JA8H 3ICEA 3E9HA 4C3IH 4JI6L 3CD6A 1VQDA 4OX9Q 1X56A 3PUZA 2NVXH 2OTLA 1ASZA 1HZBA 3CXCA 4OWXB 4IOCA 4JBMA 1K0RA 5IE8A 4XIGS 2K5NA 1HNZQ 3B6YA 1K9MC 3CCMA 4A3MG 4IJLA 3I4NG 4A3LH 1YEZA 3CCVA 1PH4A 1XPUA 2R92H 3J80c 1EQRA 3W1GA 1HZAA 4C3JH 3RZOH 1SE8A 1GD7A 5BR8L 4PG3A 2YV5A 1SR3A 5H1SE 4BY1H 4DV3Q 1E3PA 3J81c 3H15A 4YWMA 4JI5L 4EX5A 1Q81C 2B63G 2D0OA 3CAMA 1Y1VG 3HOXG 1PH1A 1X3GA 4OO1I 1E7ZA 1V43A 2BA1A 1HZ9A 4JI7Q 1SFOH 1QZGA 5LMNL 1UE1A 2JA9A 3CCEA 3HOVH 1Q7YC 4DUZQ 4X66Q 3HOUG 2PQAA 4JI3L 2K50A 1S72A 5M3MG 2FXQA 1UE6A 2B29A 2ZTEA 1VQHA 2KCMA 1JJCB 5LMUL 1N33Q 3M4OH 3ER0A 1WOCA 3HOWH 2GVAA 1SMXA 4QQBX 3HOYG 3CPWA 1YITA 1XPOA 4JI6Q 4JCVE 4MZ9A 4GN4B 4B3TQ 2YU9H 4DV5Q 1UWVA 3GO5A 2UUAQ 2OQ0A 4AH6A 1QZHA 5C4XG 1CKOA 4KHZA 4GKKL 4HIMA 4HJ7A 2EXDA 1OXVA 1KRTA 1XNQQ 1Q86C 4GNXA 1QUQA 2I5MX 5BR8Q 3CCUA 2F52A 2ATWA 1XMOQ 2UU9L 5J3BA 4YWLA 1G291 2Y0SG 4ME3A 4DV6L 2K4KA 1YJWA 4B3RL 3HKZG 3CP0A 4LFBL 3I55A 3RN2A 1PH9A 5ELNA 1VQJA 5LMNQ 3KLWA 2UUCQ 3GTLH 4B3SL 1TWAH 4O2DA 5FLMG 5K36G 1HH2P 4JBWA 2OTJA 5EAYA 3PO2G 3KJPA 3FHWA 3PIOA 1N34L 2VUMH 5M3FG 2ZM6L 2VS1A 4DV0L 4BBRG 1KL9A 4HIDA 4LFCL 3CC2A 2IT1A 4WJ3M 2WFWA 3NBHB 3KDFB 4JI4Q 4LUZA 4IFDG 1EIFA 2VQFL 1LM0A 4A3FH 4DR1L 2XTIA 4QL5A 1PH7A 2DUDA 1S40A 3PGZA 1QVFA 5JJIA 2OQKA 3J80i 5IYCH 2JA6G 1E22A 4BY7H 2BA0A 4A3IG 5LMNW 3AFQA 4P73A 3HOZH 2IHFA 1WCMH 3GTJH 3T1HL 3ULPA 2ZJQA 4GS3A 2KENA 4DR7Q 4A3KG 4JC0A 3J81i 4OX9L 4KHPQ 2B3GA 2UU9Q 1B7YB 3S1NH 4POGA 4B3RQ 3FKIH 1OXSC 2CKZB 1HNZL 4LFBQ 1VQPA 2VY3A 4LF8Q 1IYJB 5M5YH 2JE6I 2QA4A 4AQYL 5IP7G 3CC4A 3L7ZC 1IBLQ 1H95A 4B3SQ 5IP9G 4A3DH 1VQCA 1BBWA 4DV3L 4A3GH 4NXMQ 2MQHA 3KOJA 1VQ5A 4L5QA 5C3EG 2ZM6Q 4DV1L 1NJIC 4JV5L 3EBEA 1VQIA 4GNXB 4DV0Q 4A3EG 1HR0L 4JI7L 4LNQA 4BXXH 4A3CG 1CKMA 2EQSA 4GLAC 2ZJRA 3I4MG 3RLNA 1Z47A 3U58A 1IZ6A 4TQUS 2MFIA 2VQFQ 4LFAL 1FL0A 4DR1Q 3E9IA 3M4QA 3G4SA 3LGJA 4X64Q 5C44H 2K14A 4GOPC 1G51A 2E5LL 2GVBA 3G48A 1Y1WG 1PYBA 3CMAA 2I0QA 1N33L 3UDIA 4BBSG 3J81j 3T1HQ 1B70B 4A93G 2WB1G 1X3EA 1WYDA 1YHBA 1UE7A 4DR5L 2N8NA 5C0XG 3BJUA 4B3TL 2R93G 1E1OA 4DV5L 3PF5A 2VNUD 3S24A 2UUAL 4A3BH 2Z6KC 2I5HA 1J6QA 4DAYB 5IYBG 1EQQA 1I94L 1EWIA 2HQLA 4DV7L 1PH3A 3TS0A 1BKBA 4AQYQ 1XNQL 1NMGA 5DLQE 4YWKA 3J7ZC 4A3JG 1JJGA 2JA7H 3GTPH 1U5KA 2H5XA 1VS0A 3A5ZB 1D8LA 2UXBQ 1VQGA 2HIXA 3IRBA 4MNOA 1XMOL 3SGIA 1KRSA 2R7FA 4HIOA 4BA1I 1X55A 4DV1Q 1IBKQ 1PH6A 2VL6A 1P16A 4IPGA 1CKNB 1HR0Q 4JV5Q 4R4OA 3H0GH 3K7AH 3CW2C 3AYHB 2JA8G 3I4OA 3ULLA 1PH2A 4DK6C 1VQEA 2UUCL 1GKHA 2C35B 5M3MH 1I6HH 4UP9A 2WAQE 1C7YA 1FGUA 4X6AH 4LFAQ 2ALYB 2BH2A 1AH9A 3M7NA 1KQSA 4C3HH 3F2BA 2E5LQ 2ASBA 2MO1A 3KFUA 4A3LG 4LF4Q 3L0OA 2R92G 3TQYA 2KBNA 3TS2A 2JA5H 4DR5Q 4JI4L 2CWAA 4OONA 2OWOA 4BY1G 4X65L 3S2HH 3CCJA 2JK8A 2AWNA 1HR0W 1I94Q 4LF9L 4DV7Q 4L5RC 4P71A 3CF5A 3I7FA 3MEFA 4A4IA 3PSIA 4HJAA 3OW2A 3HOVG 2NN6G 4DR7L 4LF6L 4KHPL 2E2IH 1A0IA 4JI2L 5FJ8H 3PUYA 4LUOA 4HJ8A 2KHIA 3K0XA
chains in the Genus database with same CATH superfamily
2HHHL 1SRUA 2E2HH 4H44C 4A3BB 5AFWA 1I50H 1KDAA 2I07B 2R3ZA 1YJNA 2AQ2B 4LF7L 1SYGA 3UE0A 2JA7B 1PFMA 3H3VI 1RD9D 2HIVA 3KLSX 1YIJA 2K7VA 4DK3C 1EYCA 1L0YB 1A3VA 4BS9A 1JB7A 3VR6A 1KXLA 1TIID 3J80L 3K7AB 4RGMA 2QEXA 5LHY1 5ELEA 3SK4A 1CA5A 1OXTA 3NPPA 2R7DA 4IPCA 4ZUJA 1RDPD 1HTPA 1DM0B 4IN3A 4LF6Q 5IY0A 3KBGA 1LABA 3CCRA 3ULJA 1SYCA 2Z0SA 2RKSA 3BDOA 3OMCA 1CTMA 3CRLC 2LY7A 2HCCA 2PNHA 4J15A 4JYAQ 1HNWL 3RR5A 2UXBQ 4MTKA 3T16A 5GAHC 3U4ZA 3W5OA 2M00A 3EN2A 3QOLA 3CU7A 4KN7C 1L2FA 4KY5A 3OTOQ 4A75A 1RCVD 1Q90A 4RWSC 3CCQA 3G6EA 1PHJA 3OMGA 1QUQB 2RHQB 1NNXA 2A19A 2PW7A 1EU3A 1P8LA 3HFZB 4XQJA 3L2PA 4CKCA 4OWWB 3S1MH 1QILA 1CK1A 5IYDH 5IGFA 4GKJL 4A93H 1GJXA 1OTCA 4EVOA 2I46A 3SK5A 2YTXA 2YTVA 3EJIA 3HG9A 1IBMQ 2N49A 4TVAB 3K7UC 1J5EQ 1SJED 4R4TA 5A2QL 2L15A 3K5NA 2VB3X 4X3KA 1BCPD 2NVTB 2XVSA 3QIAA 1KAWA 2LSSA 5JEAG 5C44G 4YCWA 1LTGD 1VQFA 1LTLA 1X6OA 1B3AA 2OXPA 1FNUA 4P72A 1V9PA 2N88A 3C1FA 3DWPA 3M9BA 2R7ZB 3PO3B 1KD1C 2MP1A 2PMZE 4K5XA 1JQYD 1A2TA 3KF6A 1N32Q 1PTOB 4H13C 4RHSA 5KNBA 3S17H 1LUZA 1TWGH 3DMUA 5C4XH 5M5WH 1K83H 3E0EA 4YY3L 2AHOB 3A55A 2KECA 3D31A 4UDUC 2EPBA 4OO1G 2DNCA 3S1RH 1E2ZA 1M4VA 2LMCB 1HA6A 1I4HA 4QF4A 2NVQB 2WKDA 1PRTB 1TWFB 1RKNA 2K01A 5KNCA 1G6PA 4B3MQ 4CJ1B 1W2BA 3BU2A 1K8AC 1X54A 3HOWG 5G3LF 2UXBL 5FLMH 4JI0Q 2JA5G 1Y69U 1GXDC 4JG2A 2B63B 4FP5D 3S2DH 1LYLA 1NR4A 3BYYB 5M5XH 2PMZB 2EYHA 1JR0D 3H09A 1XJVA 3VYTA 2CH4W 4KK7A 4KTAA 1MIUA 3HOUB 1EZ6A 4H02A 4PZ7A 2CCZA 2DY8A 2F3IA 1SE3A 2K5HA 3UE1A 1VQ9A 5DM73 4OGQC 1SXTA 3OHXC 4JI3Q 1E1TA 3J80E 3MXNB 1VQNA 3GTKH 4C1NK 1PVOA 2IHEA 3DM1A 2HDLA 2F0TA 2F0WA 2Q2HA 3PUXA 2K52A 3AEVA 5C5LA 3BZCA 2LKVA 5AJ3L 3I73A 1IBML 3H91A 2X6LA 3FP9A 1MSGA 4NMZA 3OYYA 3TREA 1J5EL 4J1MA 1PXUA 4P75A 2F0QA 4DR2Q 1BBXC 4P74A 5HGTA 2KQ3A 1CKNA 2RCNA 4IPDA 3SVMA 4DAMA 2CWPA 5E7NA 2Q2UA 2L4NA 2N55A 3D4WA 3AFPA 3TP7A 1YZ6A 3SDZA 1O78A 1IW7D 4DV6Q 3TDQA 1CM9A 2D5DA 3DHQA 1TWCB 1Y1WH 3TRZA 4LUVA 2LFNA 3MZ5A 2D9UA 4BBSH 1V1OA 4BBRB 2LXJA 2EYLA 1R9TB 5CMDA 4NW2A 4C2MH 4NDXA 1EQVA 3KUPA 3BZKA 4Y7NB 1NE3A 1BCPB 4DF7A 4QJFA 4OWTB 4XYQA 2K5VA 3I8ZA 1K0SA 3MWYW 1CSQA 5GADC 5EBDA 3VDYA 2WV6D 2M2LA 4X66L 3A7AB 4ZKBB 1H9SA 1L1OB 2IX1A 3IFTA 3U50C 5NUCA 1IL2A 3E9HA 5IGDA 4OX9Q 3PUZA 2AUKA 3EVQA 2NVXH 5A2QE 1HZBA 1ASZA 4OWXB 4IOCA 3A56A 2KEEA 3CCMA 4RFBA 4IJLA 2EJMA 3NE5B 4A3MG 3I4NG 1XPUA 4A3LH 2QEJC 1SE8A 1AFPA 1GD7A 1STBA 5CV6A 3MFYA 4IUUA 5J1ZA 4ZLTF 2D0OA 3HOXG 1Y1VG 1NCVA 1PH1A 2F0HA 2FMCA 4JI7Q 4U673 2CW0D 3J7AV 1QZGA 3CCEA 1Q8IA 1WD0A 1ILPA 4S3SA 1BOSA 4DUZQ 2PQAA 4JI3L 2K50A 3OOCA 1HFNA 4WFN3 3ER0A 1SMYC 1WVLA 4JI6Q 1KLGD 4JCVE 4MZ9A 4B3TQ 2YU9H 3J7YW 4DV5Q 4M8AA 3S1QB 4AH6A 1QZHA 3MXUA 1CKOA 4KHZA 4FXKC 1Y8PB 4L6TB 2TMPA 2A6EC 5BR8Q 3SE0A 1PDQA 2F52A 3D3RA 5IODA 2EXZA 2UU9L 3J7AF 5J3BA 1G291 1ML0D 2Y0SG 4ME3A 2K4KA 1TKWB 4DV6L 3CP0A 5EGTA 3I55A 3RN2A 4HCEA 1PRTC 4B3SL 4O2DA 4C3JB 5K36G 2OTJA 3VYSA 2VUMH 5M3FG 3OIPA 1ZKOA 3CC2A 2A5HA 5EKLA 2WFWA 1DONA 1EIFA 1HFGA 4CDCC 2VQFL 2VXWA 1R4PB 4QL5A 4DFAA 1PH7A 1ET9A 1WTPA 4A3IG 3AFQA 1M8AA 4FF1A 4KD4A 2ZJQA 1ET6A 4OX9L 1LACA 4KHPQ 2B2YA 4UHVA 3PIP3 1Y8NB 4POGA 1SE2A 2WACA 2H4OA 4LF8Q 5IP7G 3L7ZC 2R61A 1MGSA 2NYZD 3KOJA 1WD1A 4F8MA 1VQIA 4GNXB 4JI7L 1F2LA 2EQSA 2ZJRA 4GLAC 3I4MG 3DWAA 5C3WA 5CV5A 4R8IA 1EU4A 2J0TD 3M4YA 1JWMD 1S5ED 3RLNA 2MFIA 4LFAL 4DR1Q 4DNTB 1O7LA 1PZJD 1EIGA 5EJWA 5JEAH 3U9OA 5C44H 1BO0A 3CMAA 2NWGA 2B2TC 1SYFA 3J81j 3T1HQ 4A93G 1X3EA 3MFGA 3T13A 5C0XG 4B3TL 2R93G 1E1OA 4DV5L 3PF5A 1S4ZA 2I5HA 1EEFD 1LT6D 1I94L 4ODGA 2BCOA 4QMGA 2L9HA 4BY7B 5DLQE 1BCPC 4A3JG 3GTPH 1U4MA 1U5KA 1WCMB 2HIXA 1KRSA 4HIOA 4G7ZC 1LTTD 4OO1H 2VL6A 4IPGA 1CKNB 3S1NB 3A8IE 2ZXOA 3CW2C 3FPUB 2JA8G 3I4OA 4DK6C 5HURA 1I6HH 1GKHA 5M3MH 3P7JA 1CA6A 2WAQE 1C7YA 5M5YB 1TQOA 2BH2A 4ZKCB 4R9WA 3KFUA 1DD2A 4LF4Q 2R92G 4KY7A 2J4XA 2QILA 2JA5H 4NKLA 2CWAA 4BY1G 1BXTA 1IL8A 1EY4A 2ZXPA 3IFDA 3VYRA 1EY7A 2AWNA 1HR0W 4L5RC 2WKCA 2WINB 2JN4A 1GUNA 4HJAA 1XX8A 2NN6G 1ENAA 3HOVG 4KHPL 1HQRD 1A0IA 2E2IH 5KYLA 5ELFA 4LF8L 2GN5A 3TP5A 1JE4A 5CYUA 4QB4A 3PO2H 3UDXA 3RLOA 5JOBA 4I65A 2RQXA 2WAQB 1O7YA 1SJHD 1F9PA 2D2CC 4HMJA 3ZYYX 4K2LA 2K28A 2NZHA 5FLXL 2K04A 3R3OA 1HXYD 1EYDA 1N36Q 3DEOA 4IFDI 2N3SA 2IY5B 3JC66 4R8NA 2F0DA 4X65Q 2EYPA 4UP7A 3AMUA 3J81L 1D2BA 1WTWA 1C9OA 2NVYH 2ICEC 3SK8A 4C3HB 3EQLC 4ALPA 2PQAB 1FNWA 1K3RA 3KK7A 2UXDQ 3R2IA 4RAUC 4JI2Q 1HCZA 3CCSA 1G6ZA 4R4IA 3F2CA 2HT1A 4R1JA 4CGYB 2HHHQ 1XNRL 2EYJA 4CDDC 4DV2Q 3S2HB 3OPOA 4G57A 1JOQA 1FNVA 3GTGH 1JWUD 2MO0A 4IOAA 2XIWA 3BG3A 4YIJA 4DNRB 1HUNA 3F2UA 3I4LA 4A3EH 4LF7Q 5DM63 1D7QA 2KCNA 4LW1A 4RG1A 3V2TA 1I4PA 1GHJA 4F87A 2K05A 1G2SA 1IW7C 4K0KL 2Q2IA 4DR4L 3OSOA 3CQZH 1E24A 1CHPD 4JBJA 4V190 1MKHA 4LF4L 2R6GA 4KKUA 3HS0C 4KKSA 2NUCA 1JMCA 2DJGC 4XXEA 4A3DG 3I4NH 4A3MH 3H94A 4A3GG 1XPRA 2OCEA 4G4KA 1XMQQ 2JP1A 2JA6B 2A68D 3S1QH 1F9RA 3CPFA 2V1CC 2KA7A 3NELA 3OWEB 1Q82C 3G71A 5EBCA 1HNWQ 1CI3M 4IFDJ 3FPPA 2UXCQ 1B4OA 3HOXH 1Y1VH 4GN3B 4UPAA 1VQ8A 1RIPA 1CSPA 3PUWA 2HCIA 2SDFA 1WTVA 1MSHA 1I5FA 1M1KC 4IURA 2J7ZA 3GDEA 4QGUA 1A15A 4K6LA 3UDGA 1UE5A 3MXNA 4X3UA 1Q1EA 4A3BG 4GKJQ 4ILWA 3A74A 1K28A 1H9MA 2N78A 1N36L 1EFID 1A62A 1GHKA 1H9JA 3TBIB 2JA7G 2B2VA 2CW0C 1I4GA 3D6WA 3C3LA 3MXPA 1GUTA 5GQOA 3S16B 1NAPA 1EL0A 2EY1A 5I2YA 2Q2TA 2RHSB 3CC7A 1PTOD 4JOIA 2KCTA 3K5OA 2FJ2A 1IKLA 4KJOA 3GTMH 2UXDL 1BF4A 4HEDA 4ZCKA 1EIYB 3OIQA 3PIPA 4DV2L 5EKKA 2FINB 2PZTA 5K36H 1TS4A 3R93A 3T51B 4EQ5A 1I4QA 1ZXTA 5M3FH 1F77A 1PRTD 3HEJA 1CUKA 3HKZE 1GUGA 3U4VA 4DKAC 4RGTA 1X3FA 2E2JH 5C4JH 2L11A 5DEHA 5JPMC 1IYVA 1DXMA 4JI8L 4YY3Q 3Q24A 3S15H 4A3IH 2O5JC 2MNAA 3F2DA 3KYHC 5EPLA 3I90A 5FLXE 2EY5A 1L1OA 3HOYB 1G8ZD 4G7HC 2K75A 4IUQA 5JVH3 5LMUQ 3RN5A 3J81E 2VUMG 1HNXL 1XMQL 5KEEA 1PH5A 5IP7H 4K2KA 2DJFC 4HSPA 3ERSX 4PV1C 2UXCL 2NB0A 3MHBA 4CJ2C 3SEBA 2KVMA 3K5MA 1YHQA 4GKKQ 3I4MH 2WP8J 4KI0A 1FVIA 3HKZB 1L0WA 2QW7A 3TP6A 4GOPB 2MPMA 1TXYA 1EYAA 1SE4A 2F0SA 3GTOH 1UNSA 1HJPA 2L12A 3M3YB 4FF2A 1TWHH 5IGBA 1QWYA 1CT1D 4CDEC 2K5QA 5C0XH 2BH8A 3ZJYC 2R93H 1R4QB 2ZT9C 1YJ9A 2R7ZG 1IXRA 3PO3G 1AE3A 1XTDA 1PFSA 3R2TA 4CKBA 2RF4A 3HKSA 3STBD 3VR3A 1TS5A 5AJ3Q 1MJEA 1EUJA 4FNFA 2WB1E 4NB3A 4A3JH 4OL7A 1LV9A 5CBAE 1XWEA 4A3KB 1RF2D 1UUPA 1PH8A 3Q0AA 3MXGA 2JA8H 2KUMA 4C3IH 3IAYA 2H1EA 4I7ZC 4PMBA 3CD6A 1X56A 4ZUIA 3K6OA 4JBMA 4XYOA 3B6YA 1HNZQ 1CQFA 3CCVA 2R92H 5C3EB 1V1PB 3NUCA 2PYKA 1ONLA 4Q0FA 1SBBB 5H1SE 4BY1H 1E3PA 4RH6A 3H15A 4YWMA 3TP8A 4EX5A 2B63G 1WTOA 1X3GA 4OO1I 1E7ZA 2BA1A 1HZ9A 1B44D 1STGA 1I4XA 3NXWA 3HOVH 2NN6H 3BVGA 1CHQD 2WB1B 4X66Q 3HOUG 2IPKD 1KAAA 5M3MG 2B29A 2ZTEA 2OT2A 5IGEA 2KCMA 1JJCB 5LMUL 3M4OH 1DCZA 2B2YC 2EY6A 1WTRA 5D14A 4ZAIA 4ABNA 3CPWA 1PZID 1I3QB 3BVZA 2UUAQ 1CZWA 1GOZA 3I72A 5C4ZA 4B08A 4GKKL 1NUCA 4IUPA 5EQ0A 4HJ7A 4IUVA 1KRTA 2C9OA 1Q86C 4GNXA 1TY0A 1F2ZA 2I5MX 1VMCA 5KGUA 2K5DA 2K33A 4YWLA 1QG7A 3MC0B 4EQOA 4LFBL 2MUYA 1HA5A 5ELNA 2Z8LA 1PLFA 1VQJA 3K58A 3KLWA 3GTLH 1F2YA 4XQNA 2SNMA 3RZOB 4JBWA 3KLRA 5E4WC 5EAYA 3FHWA 3PO2G 3PIOA 4K8JA 2ZM6L 2G9HD 2XSCA 4DV0L 4BBRG 4HIDA 1KABA 4OIKA 2IT1A 3MVVA 4ME5A 4RKLA 1UEAB 5J39A 4JI4Q 1SFOB 3NK9A 1TY2A 2XTIA 5I9OA 4X3SA 1IYUA 1MI2A 4RA8A 1QVFA 2BA0A 5LMNW 4P73A 1K8MA 1QB5D 2IHFA 3GTJH 4RCNA 3HOZH 2F0IA 4GS3A 3HOWB 4DR7Q 1BR9A 1D6EC 2UU9Q 1PFNA 3E5SA 2CKZB 3E0JA 1FR3A 1HNZL 4N8X1 3NTKA 2JE6I 4AQYL 1H95A 1IBLQ 2DN8A 4B3SQ 2Q8TA 4A3DH 1ESRA 1VQCA 1BBWA 4A3GH 1SYDA 2MQHA 4IALA 4JV5L 5ELCA 1B53A 4A3EG 1HR0L 4BXXH 4LNQA 1RODA 1CKMA 1II3A 4TSSA 3U58A 1Z6HA 4TQUS 2VQFQ 1ICWA 1FL0A 3M4QA 1TWAB 4GOPC 1G51A 2E5LL 2GVBA 4RGOS 4IUNA 2B8FA 5CORA 3U9SA 1KNEA 1EOTA 1WYDA 1UE7A 1B50A 2X69A 2VNUD 2UUAL 4A3BH 1ENFA 2A68C 3EFXD 4A3FB 1QE6A 4FVMA 4HCSA 1EWIA 3H3VC 1KNAA 4DV7L 4JW0A 3Q6SA 1WTXA 4KJNA 1BKBA 4CDFC 1NMGA 3J7ZC 2JA7H 5D3DA 2H5XA 3A5ZB 3IRBA 2XNAC 4MNOA 3SGIA 4KN4C 2F0MA 2F0LA 2R7FA 1X55A 5I4DA 4DK0A 5JPNC 3K7AH 3FKIB 3NQTA 1VQEA 2RBMA 5CV7A 1GUSA 2C35B 5KNDA 4X6AH 2A73B 4LFAQ 1KQSA 3D8GA 1BDOA 1F9QA 2MO1A 4PMCA 3L0OA 3TQYA 3TS2A 2EJFC 4C3JG 1PYWD 4JI4L 4HSVA 3RZDB 2F0UA 3EA6A 3CCJA 2JK8A 1I94Q 1PTOC 4LF9L 4P71A 3I7FA 3MEFA 1STEA 1AW7A 3OW2A 3M7GA 4FF4A 1Q3LA 4DR7L 4HAEA 1BCPF 3PUYA 4HJ8A 3JAMc 2ENBA 1B8AA 5EPJA 5IWAQ 5HY6A 2ZJPA 2V4DA 1TS3A 1QNUA 5ISRA 4AYBE 2AMCB 1HUMA 4DR3Q 1T5XD 1IBLL 4UP8A 3T56B 2VQEL 2WIIB 1A8VA 4LMQD 2YYZA 2F0VA 2FFKB 2RDGA 1RL2A 1EOVA 4WJWA 2CFMA 2TSSA 3S14B 1NMFA 3I56A 2QKIC 1S3OA 3H0GB 1H9RA 3AQQA 3NWTA 1A3TA 4HMIA 4B9WA 1J8IA 2KOLA 3E3XA 4APVA 4DR6Q 1DZ1A 1YNXA 1LT3D 3NEMA 2NVTH 3DXJC 2RDFA 1FJGQ 4R4CA 5GAGC 3RUZA 4ZRZA 2ICIA 3I91A 5IP9H 5IT9c 2R7ZH 1PA6A 3PF4A 3PO3H 2A69D 1YNND 4AYBB 1K73C 3KJOA 2E74C 1JB3A 1PTOH 1B1ZA 1VQBA 3QJYA 4OXPA 2AQ1B 2G9DA 2B2VC 5IYCG 3QB3A 2E2HB 1B3QA 1WCMG 2F0JA 3WOEA 1EFWA 1LTID 4N9PA 1I50B 3M85A 1BBUA 1STYA 4JOIC 4DUYL 2NVQH 3FVQA 4OEMB 1VQAA 3WWVA 5C0XI 1TWFH 3PCOB 2XRQD 3DM3A 3F8TA 2I5LX 3STBC 1XNRQ 4MTNA 5HGQA 1JCKB 3LX0A 1OXUA 2A6HC 4R4QA 4F88A 1C8CA 2BE5C 3FEWX 1SN8A 2B63H 4JVZA 2AQ3B 3TEHB 3S9WA 2AKWB 3T53B 4LF5L 4JI1L 2JXMB 2UUBQ 5JJLA 1V1QA 3ND8A 5IWAL 1JORA 2MJ8A 4OHJA 3HOUH 1LLRD 4C3IG 4DR3L 4L63B 4RKBA 5JJKA 4K0KQ 1SEBD 4DR4Q 1C48A 5FLXc 1L1OC 4DV4L 1GO3E 2ZTDA 2PZUA 5GROA 4L5TA 1DOMA 3F1ZA 3QWNA 5EPKA 1X9NA 3CKIB 2WAQG 4DU9A 2P5ZX 1SNQA 4FXDA 3L9AX 3NTIA 5CV9A 4DR6L 3A0JA 4X3TA 2PCFB 2O4XA 5DAUA 4LWCA 2NN6I 1RTNA 4A93B 3RNUA 4GOPA 1FJGL 3VYUA 2Q8RE 5CBEE 4UY8C 4TKOB 3VA5A 1JJ2A 1SYBA 3A7LA 4C3HG 2JJQA 3T4AC 4L5SA 5C0XJ 1BNZA 4IO9A 1HZCA 1TWCH 2JQOA 4PZ8A 4QIWE 3PMFA 4BBRH 1R9TH 1SNOA 4NXNL 1VQLA 1U4RA 1AE2A 3D4DA 3K8AA 4Y7NH 2MGSA 4ULLA 3DLLA 5E4XA 1MBYA 2CHBD 1DYQA 4POFA 1E0BA 3MA2B 3EIVA 1YHAA 4HJ5A 3H6MA 2A1AA 4F7XA 1Q1BA 1EWHA 4DXFA 4QY7A 3E6ZX 2YTYA 2A8VA 2F4VL 1W3SA 3S17B 1VDZA 2PQEA 2RVLA 2EY2A 2CQAA 4P2CB 1TWGB 1N8RC 5M5WB 5C4XB 1K83B 1DJRD 1X3PA 2KJXA 2IX3A 4O0AA 1S5CD 1V1PA 1YBYA 1S5FD 3S1RB 2EYMA 2VZAA 4IPHA 1QVGA 5F2DA 4QIWB 5ELOA 1VF7A 2Z4IA 4BA2I 3A8JE 2UUBL 1NBWA 4DPGA 2D0PA 3HOZG 1SLJA 3GTQB 5DNFA 2QDLA 4JI8Q 4XT3B 3S2DB 5M5XB 1RJTA 3R8BA 1I4RA 1IKMA 1WTQA 3PIO3 4CKEA 4N8FA 1PV4A 3ND9A 5BN3A 1WI5A 1N34Q 5FO7B 1NY4A 1YNJD 4DAPA 4KD3A 1LTSD 4RCOA 1HNXQ 2CH4A 1JWSD 1PMRA 1U9RA 3BDCA 4BXXG 3RZDH 4FYDA 1KHIA 2HQEA 3BZDB 5I9PA 1HTLD 3N6RA 2M9VA 4GNXC 3GTKB 1JT8A 2XGTA 2QDBA 3ICEA 4LK1C 5G3LD 1EEID 3HGBA 3X3NA 4XIGS 3TZDA 4MHEA 3C2PA 2Q8IB 2PNRC 1K9MC 1YEZA 3J80c 1EQRA 3W1GA 5IOCA 4C3JH 2L5TA 1G91A 1SR3A 2K03A 4DV3Q 1Q81C 3GV6A 3CAMA 1SNCA 4RGNA 1V43A 1E2VA 5FOBB 5I6WA 2NTTA 5LMNL 1Y1WB 1UE1A 2JA9A 4BBSB 1FD7D 1F2MA 1A2UA 1Q7YC 3VR2A 2E75C 2ZXRA 4E6IA 2DY7A 2FXQA 4C2MB 2HD3A 2JYOA 1WOCA 2GVAA 4QQBX 3HOYG 1YITA 2NBFA 4GN4B 3QR8A 2EZVA 4ZYSA 1UWVA 4O42A 1S5DD 2AUJD 1A3UA 1EY6A 2EOTA 2OF1A 4HIMA 4EQNA 3WDNA 1XNQQ 3CCUA 1F9SA 1U4LA 1XMOQ 2KCCA 3X3MA 2NVXB 3GQBA 3CRKC 4B3RL 3HKZG 5BN4A 3KLSA 2UUCQ 3QO2A 2QCPX 5TSSA 2F0PA 2PPBC 1HH2P 2CVRA 3EROA 3KJPA 1N34L 1G2TA 3K0YA 2L55A 2VS1A 1FYCA 1KL9A 4XT1B 3KBXA 1STHA 3P20A 4LUZA 2LS01 1LM0A 1Y8OB 1H9KA 3PGZA 4I7AA 3J80i 2B2UA 5IYCH 4BY7H 1E22A 1CFMA 1XYIA 1WCMH 3KF8A 3ULPA 3IL8A 4JC0A 4A3KG 2F0OA 1AN8A 2K1BA 3A8KE 3S1NH 1B7YB 1U4PA 5IIFA 1FGBD 2YU9B 2E2DC 4LFBQ 2VY3A 1IYJB 5M5YH 2QA4A 2A69C 3CC4A 1YNNC 5IP9G 1AEXA 2MHVA 4DV3L 3NWSA 3RD4A 4NXMQ 1VQ5A 4L5QA 5C3EG 2ZM6Q 4DV1L 1NJIC 1SNPA 4DV0Q 2B2WA 4K5VA 5E3FA 2A6HD 2B8GA 2BE5D 1Z7TA 1KTKA 3E9IA 3G4SA 2EYOA 4X64Q 1AZPA 3AU7A 1PYBA 3FDTA 2I0QA 2VUMB 2XRSD 1B70B 2WB1G 2F0NA 1YHBA 1V8QA 3N52A 3VR5A 4DR5L 3BJUA 4K5WA 1EWCA 1HPCA 3S24A 1ZYRD 2F4IA 1J6QA 5IYBG 2HQLA 1PH3A 1UAPA 3TS0A 1NSNS 4AQYQ 1XNQL 4YWKA 1JJGA 4EQPA 2K32A 1VS0A 1D8LA 3W3AA 1XMOL 4KKTA 3A54A 5KRUA 3V05A 4BA1I 1IBKQ 5FO9B 1PH6A 4JV5Q 1P16A 1STAA 1HR0Q 1B9NA 3ULLA 2Z6BA 1PH2A 5T1GA 5D3IB 2UUCL 4UP9A 4KV6A 1D1IA 1QNKA 3M7NA 4K14A 4C3HH 3F2BA 2E5LQ 2ASBA 4J6HA 5I6YA 2KBNA 4QCLA 2OWOA 2EVBA 1B2TA 3HZXA 3S2HH 2SOBA 3QOJA 4OELB 5C44B 4DV7Q 3CF5A 1DOKA 4A4IA 3LNNA 4LF6L 3L3OC 4WJ4A 2RA4A 1TVXA 5JEAJ 3W1BA 1DGSA 2PZWA 4YCVA 5KIXA 1D5ZC 3OW7A 3VA7A 3GTQH 4JYAL 4IZ8A 4DA2A 2Z6KA 3TN2A 1O80A 1SSOA 5LL6S 1VMPA 2D62A 4NXML 3GTPB 3OTOL 4C56C 1LT4D 1LO5D 5FKAC 4IFDH 2K5WA 2C5CA 4CJ0B 4FO2A 2JA6H 1I6HB 5M3MB 5C5MA 3D0FA 4X64L 1QVCA 2K6AA 5CV8A 5IGGA 1PZKD 4LF9Q 3K80C 1EYGA 1PTOF 1EQTA 1M90C 4DNIA 1IHZA 1NR2A 1VQ4A 3K81C 3D6CA 4H7BA 2JEBI 2JA5B 2PI2A 5C3XA 5T1IA 4DAVA 1W6JA 1PFBA 3MTSA 2NZOA 2ES2A 1MHWC 3CMEA 3MEHA 1PRTF 2VQEQ 5L37A 4A3FG 1Q12A 4A3CH 2E8GA 4IJHA 2E2IB 1IBKL 1UEBA 3T1YQ 3BDLA 2PO4A 3WOFA 4PNYA 1VQ7A 3S16H 2EIFA 1JC7A 5GAEC 1VQMA 1Y14B 3PO2B 3Q22A 2F0KA 3PUVA 3FKIG 1KDBA 4NPSA 1N32L 4IQZA 3TSSA 4JPBW 4DXGA 1YNJC 3I70A 4YHHQ 1YI2A 3HRZC 3GV3A 1JOKA 2Z4HA 3ITPA 3BS1A 2IX0A 2NVYB 1X3QA 4GLVB 2EDGA 2G5DA 1T9HA 1ESFA 2X6GA 1GM5A 4DN4M 1SYEA 3Q23A 4B3ML 1BVSA 1QOHA 3O13A 3KF8B 4XQQA 4AIMA 4XTCS 3A5UA 5JVG3 4JI0L 3DEPA 3GTGB 3ERQA 4HIKA 4CHTB 1K8GA 5LL6X 3HOYH 1EY5A 2FHTA 1O7IA 4A3EB 4DUYQ 5CV4A 3URYA 1A63A 4RMFA 1D5MC 1VCIA 3K57A 4Y52H 3FRPB 1BUVT 3BVMA 3KDFA 3NBHA 1ASYA 4PMWA 1RTOA 2LXKA 1K8OA 5CC4A 1WJJA 3I2ZA 3CQZB 1Q8KA 3PV0A 1E2WA 1HQMC 3H0GG 3M4PA 2JSOA 3VR4A 5FO8B 3CCLA 2L0CA 4X62Q 4PZ6A 1Q46A 1GVPA 2DGYA 4FDBA 3RMHA 4U68A 3Q8DA 4QUFA 4V0BA 1VQKA 1VQ6A 4YCUA 2EJGC 4LF5Q 2VW9A 2IJ0A 4JI1Q 1ILQA 3I4NB 1Z9FA 4A3MB 2ZTCA 1CQVA 1D1KA 3BYTB 1YVCA 1C0AA 4DK1A 4GN5A 3M3YH 3J7A5 3LWEA 2Y0SE 4DR2L 5E1FA 3HOXB 1Y1VB 4DV4Q 3H3VH 4C1NI 1X65A 4GLXA 1N9WA 5EKIA 3T1YL 3AB9A 4H0LC 4AYBG 4JI5Q 4WRDA 1HHVA 5C4HA 3GD7A 2KHJA 3NENA 5FJ8G 4FXGC 1D5XC 4JK1C 4RHRA 4A76A 1BQQT 4A3KH 1NTGA 3NQIA 3W2DA 4UAIA 5M9OA 3NSWA 4KHVA 1VQOA 4YHHL 2E76C 1SNMA 3RLFA 1MJCA 2O2LD 3KF6B 5D65A 5COYA 1KLUD 1WFQA 4DAYA 3DWQA 1KIXA 5I2XA 2XWJB 2A74C 4HJ9A 1XXGA 2AWOA 2KHSA 1PYSB 4CBVA 1SROA 5C3EH 4QUCA 1I6VC 4Q5VA 2Z9HA 2SNSA 3GTMB 2QGQA 2Y0SB 4NXNQ 3UDFA 4BY7G 1JE5A 4JBKA 2PI2E 4FF3A 3ONAB 1TS2A 2L1BA 5M3FB 2VB2X 1WTHA 2JEAI 3JAML 1LT5D 4K8IA 1SAPA 2E2JB 5C4JB 2F0FA 1T5EA 2F4VQ 5IYBH 1TR5A 4M1UB 3JAMi 2HDMA 4ZK9B 1QJOA 1KC8C 4LFCQ 1I3QH 1SNDA 5FK9C 3S15B 4XDXA 4A3IB 1X32A 4X62L 4DUZL 4HTHA 3IKJA 5A35A 2CQOA 3C1EA 1VF5C 1XTCD 4OIJA 1U0LA 2ID0A 1OXXK 1MD2D 4KLKA 1EY8A 4KMUC 5IYDG 4JI6L 3C46A 1VQDA 1K3BC 1OO9B 3V96A 2OTLA 1ZYRC 2XN9C 3CXCA 4NP5A 1K0RA 5IE8A 2K5NA 2Z1CA 3P75A 1PH4A 1HZAA 2RSOA 3NTHA 3RZOH 5BR8L 4PG3A 1HRJA 2YV5A 3I4MB 1DOLA 2KEDA 4KY6A 3J81c 4JI5L 5IT9L 1GUWA 1RHPA 4ZQ3A 3GTOB 1SFOH 3FMCA 3S1MB 3D4RA 1AZQA 2XWBB 3G6JB 2B2UC 1TWHB 2EYFA 1LTBD 3DUZA 1LTRD 1S72A 2R93B 1UE6A 1VQHA 5J22A 4J8QA 1N33Q 5JJZA 3HOWH 1SMXA 1ENCA 1XPOA 4HN7A 3GO5A 4A3JB 2OQ0A 5C4XG 1STNA 3HP3A 1W6KA 2EXDA 5ELDA 2BOSA 1OXVA 3SR1A 2EE1A 1QUQA 2RCFA 3QG1A 2JA8B 2B2WC 4C3IB 1H9SB 4K6DA 2ATWA 1AP0A 4LAAA 4PQXA 1YJWA 2F1MA 1A6XA 1PH9A 5LMNQ 4HR7B 1TT2A 2R92B 1TWAH 1QCBD 5FLMG 2BDOA 5ELBA 4BY1B 4B9XA 3SHLA 2NTSA 2NZ1D 3UI2A 4LFCL 4WJ3M 3NBHB 3KDFB 4IUTA 4IFDG 4A3FH 3HOVB 4DR1L 2DUDA 2PW5A 4N9TA 1S40A 3TMEA 5JJIA 2F0GA 2OQKA 4G7OC 2JA6G 2FMMA 3M4OB 3T1HL 1TU2B 2KENA 3J81i 2B3GA 3LWUA 5IGCA 3SK6A 3MAQA 1EY0A 2GA4B 3TZUA 2F03A 4B3RQ 3FKIH 1OXSC 1VQPA 1C4QA 3OWFA 2BDNA 3NBIA 3I3CA 1L0XB 2RDHA 1GUOA 3K5LA 5CGKA 3EBEA 4A3CG 3NP8A 2F3VA 1CZGA 1SDFA 5CR3A 3JAME 1Z47A 1IZ6A 3GTLB 1ZEQX 3LGJA 2QF7A 5BN5A 2K14A 1B9MA 2O5IC 3G48A 1Y1WG 1N33L 2IWHA 3UDIA 4BBSG 4O1NA 1JOOA 2N8NA 5C6AA 2IW3A 4WORA 4Z9CB 2Z6KC 3NHHA 4MN3A 4EGVA 4DAYB 3K59A 1EQQA 4L8JA 2F0EA 5K5PA 5JAVA 2SEBD 3HOZB 3GTJB 1KDCA 1VQGA 1JICA 1LTAD 4MIUA 4DV1Q 3S14H 1ICFB 4R4OA 3H0GH 1S5BD 4DGZA 1EY9A 3AYHB 1J9OA 4ID6A 3CHBD 1FGUA 4LJZC 3P1HA 2DNEA 5IT9E 2ALYB 4A3DB 4GZYC 1AH9A 2RSNA 2HUGA 4A3GB 2IL8A 4A3LG 4TRDA 1SMYD 4DR5Q 1O7ZA 4OONA 1EIHA 3G7LA 4X65L 1EZ8A 4BWGB 5KYIA 3PSIA 2F3WA 3PQIA 2A6ED 3SXHA 2OEOA 4JI2L 5FJ8H 2B39A 4LUOA 2B2TA 3GP7A 2KHIA 3K0XA
chains in the Genus database with same CATH topology
2HHHL 5JEAJ 1B8AA 1SRUA 3W1BA 2E2HH 1DGSA 5IWAQ 4YCVA 5HY6A 4LF8L 2ZJPA 2GN5A 3GTQH 1I50H 4JYAL 2Z6KA 2AMCB 4AYBE 4DR3Q 3PO2H 3UDXA 1YJNA 1IBLL 4UP8A 3RLOA 2VQEL 1A8VA 4DR4L 2YYZA 4LF7L 3UE0A 2D62A 4NXML 3OTOL 3H3VI 2HIVA 1RL2A 1EOVA 1YIJA 4DK3C 2NZHA 2CFMA 1N36Q 1JB7A 1NMFA 3I56A 1KXLA 4IFDI 2N3SA 1S3OA 2IY5B 3AQQA 2QEXA 3JC66 4X65Q 2JA6H 4APVA 4UP7A 4DR6Q 3D0FA 4X64L 1QVCA 4LF9Q 1C9OA 3K80C 1EYGA 2NVYH 1OXTA 1M90C 2R7DA 4IPCA 4DNIA 4WJ4A 1YNXA 4ALPA 3NEMA 3K81C 2PQAB 1VQ4A 2NVTH 1K3RA 5IY0A 4LF6Q 1FJGQ 2UXDQ 4R4CA 4JI2Q 3CCRA 3CCSA 4R4IA 2JEBI 3F2CA 2HT1A 3ULJA 2PI2A 4R1JA 5GAGC 2HHHQ 1XNRL 2Z0SA 4DV2Q 5IP9H 4J15A 2NZOA 2PNHA 5IT9c 2ES2A 2R7ZH 4JYAQ 3RR5A 1HNWL 3CMEA 1PA6A 2MO0A 3GTGH 4IOAA 3PF4A 3PO3H 5GAHC 3U4ZA 3W5OA 2VQEQ 1K73C 4A3FG 3EN2A 3KJOA 4A3EH 4LF7Q 1Q12A 1D7QA 4A3CH 1L2FA 2E8GA 4LW1A 3OTOQ 1VQBA 4IJHA 4RG1A 4A75A 1IBKL 4OXPA 3CCQA 3G6EA 1PHJA 5IYCG 1UEBA 1QUQB 2RHQB 3T1YQ 2A19A 1WCMG 1P8LA 1EFWA 1VQ7A 3HFZB 3S16H 4K0KL 3L2PA 2EIFA 1BBUA 2Q2IA 3M85A 4OWWB 3CQZH 4JOIC 5GAEC 1VQMA 1Y14B 3S1MH 1E24A 3S14H 5IYDH 3PUVA 4JBJA 4GKJL 4A93H 3FKIG 4NPSA 4DUYL 1MKHA 2NVQH 1N32L 4LF4L 3WWVA 2R6GA 1VQAA 5C0XI 1OTCA 1TWFH 3PCOB 1JMCA 3DM3A 4YHHQ 4A3DG 1YI2A 3F8TA 2I5LX 3STBC 3I4NH 4A3MH 4A3GG 1XPRA 2YTXA 2OCEA 2YTVA 1XNRQ 4MTNA 5HGQA 1XMQQ 1IBMQ 2N49A 4TVAB 1OXUA 3K7UC 4R4QA 3S1QH 3CPFA 2V1CC 2IX0A 3NELA 1J5EQ 1Q82C 1SN8A 3G71A 4R4TA 1HNWQ 2B63H 4IFDJ 2L15A 2UXCQ 4GLVB 3HOXH 1Y1VH 3TEHB 1T9HA 1GM5A 4GN3B 4UPAA 1VQ8A 1RIPA 2AKWB 4B3ML 1KAWA 1BVSA 2LSSA 5JEAG 1CSPA 5C44G 4LF5L 4JI1L 3KF8B 2UUBQ 5JJLA 1V1QA 4YCWA 5IWAL 3PUWA 4AIMA 1VQFA 3HOUH 1LTLA 1X6OA 1I5FA 4XTCS 3A5UA 4DR3L 1M1KC 4JI0L 5JJKA 4K0KQ 4P72A 1V9PA 4DR4Q 5FLXc 3M9BA 3GDEA 1L1OC 4QGUA 4HIKA 1KD1C 3UDGA 1K8GA 2PMZE 1UE5A 1Q1EA 1GO3E 2ZTDA 4DV4L 5GROA 3HOYH 4A3BG 4GKJQ 1O7IA 3A74A 4L5TA 4DUYQ 3KF6A 1N32Q 1A63A 4RMFA 1N36L 2N78A 3S17H 1VCIA 1A62A 3F1ZA 4Y52H 1X9NA 1LUZA 3KDFA 1TWGH 2WAQG 1ASYA 2JA7G 5M5WH 4PMWA 5C4XH 1K83H 3E0EA 5GQOA 4YY3L 2LXKA 2AHOB 4DR6L 3A0JA 3D31A 1WJJA 3I2ZA 2Q2TA 1Q8KA 4OO1G 2RHSB 3PV0A 3CC7A 3S1RH 3M4PA 2NN6I 3H0GG 4JOIA 4LWCA 3CCLA 2KCTA 4X62Q 3RNUA 4PZ6A 1Q46A 1GVPA 2DGYA 4FDBA 4GOPA 1FJGL 3GTMH 2UXDL 3Q8DA 1VQKA 3JAMc 4UY8C 1VQ6A 1G6PA 4YCUA 4B3MQ 1JJ2A 2VW9A 4LF5Q 1EIYB 4JI1Q 3PIPA 1W2BA 1Z9FA 3BU2A 2ZTCA 4DV2L 1X54A 1K8AC 3HOWG 2JJQA 4L5SA 2UXBL 1YVCA 5C0XJ 5FLMH 4IO9A 1C0AA 1HZCA 1TWCH 4EQ5A 2JQOA 4PZ8A 4GN5A 4QIWE 2JA5G 4JI0Q 3J7A5 5M3FH 3M3YH 2Y0SE 4JG2A 1CUKA 3S2DH 1LYLA 3HKZE 4DR2L 4BBRH 5M5XH 4DV4Q 1R9TH 3H3VH 3U4VA 1X65A 4DKAC 1X3FA 2E2JH 4NXNL 5C4JH 4GLXA 1N9WA 1VQLA 1AE2A 1XJVA 3K8AA 3T1YL 4Y7NH 4AYBG 4JI5Q 3DLLA 1MIUA 3GD7A 2KHJA 3NENA 5FJ8G 4JI8L 4YY3Q 4H02A 4PZ7A 3S15H 4A3IH 2CCZA 2F3IA 2K5HA 3UE1A 4POFA 2MNAA 3F2DA 3KYHC 4A76A 1VQ9A 3EIVA 1YHAA 4A3KH 1NTGA 4HJ5A 1L1OA 2A1AA 1Q1BA 4QY7A 4JI3Q 1E1TA 2YTYA 2A8VA 3MXNB 1VQOA 2K75A 4YHHL 1VQNA 2F4VL 1W3SA 3GTKH 1PVOA 2IHEA 3RLFA 1MJCA 5LMUQ 3RN5A 2Q2HA 3PUXA 3KF6B 2K52A 1N8RC 3AEVA 2VUMG 1WFQA 3BZCA 5AJ3L 1XMQL 1HNXL 1KIXA 1IBML 1PH5A 5IP7H 3FP9A 4O0AA 3TREA 3OYYA 1J5EL 1YBYA 4HJ9A 2AWOA 3ERSX 2UXCL 1PYSB 2VZAA 4IPHA 1QVGA 1SROA 5C3EH 4P75A 1YHQA 4DR2Q 4GKKQ 5ELOA 4P74A 2QGQA 3I4MH 2WP8J 4KI0A 4BA2I 1FVIA 4NXNQ 1L0WA 3UDFA 1CKNA 2UUBL 4GOPB 2RCNA 1NBWA 1JE5A 4BY7G 4IPDA 4JBKA 4DPGA 4DAMA 2PI2E 2D0PA 2CWPA 5E7NA 2Q2UA 3HOZG 1SLJA 1TXYA 3AFPA 1YZ6A 3GTOH 4DV6Q 1Y1WH 3TRZA 4JI8Q 1HJPA 4LUVA 4BBSH 1TWHH 2JEAI 2LXJA 2BH8A 3ZJYC 2R93H 4C2MH 1YJ9A 2R7ZG 1PV4A 1IXRA 3PO3G 1WI5A 1N34Q 3BZKA 2F4VQ 1NY4A 5IYBH 1NE3A 1AE3A 3JAMi 1XTDA 1PFSA 4OWTB 4QJFA 2RF4A 3HKSA 3STBD 1KC8C 4LFCQ 1I3QH 1HNXQ 5AJ3Q 1MJEA 1EUJA 2K5VA 2WB1E 4NB3A 4A3JH 4BXXG 3RZDH 1CSQA 5GADC 4X62L 1KHIA 4DUZL 4X66L 3VDYA 1PH8A 2CQOA 1U0LA 2ID0A 4GNXC 1OXXK 4KLKA 5IYDG 1L1OB 2IX1A 2XGTA 1JT8A 3U50C 1IL2A 2JA8H 3ICEA 3E9HA 4C3IH 4JI6L 3CD6A 1VQDA 4OX9Q 1X56A 3PUZA 2NVXH 2OTLA 1ASZA 1HZBA 3CXCA 4OWXB 4IOCA 4JBMA 1K0RA 5IE8A 4XIGS 2K5NA 1HNZQ 3B6YA 1K9MC 3CCMA 4A3MG 4IJLA 3I4NG 4A3LH 1YEZA 3CCVA 1PH4A 1XPUA 2R92H 3J80c 1EQRA 3W1GA 1HZAA 4C3JH 3RZOH 1SE8A 1GD7A 5BR8L 4PG3A 2YV5A 1SR3A 5H1SE 4BY1H 4DV3Q 1E3PA 3J81c 3H15A 4YWMA 4JI5L 4EX5A 1Q81C 2B63G 2D0OA 3CAMA 1Y1VG 3HOXG 1PH1A 1X3GA 4OO1I 1E7ZA 1V43A 2BA1A 1HZ9A 4JI7Q 1SFOH 1QZGA 5LMNL 1UE1A 2JA9A 3CCEA 3HOVH 1Q7YC 4DUZQ 4X66Q 3HOUG 2PQAA 4JI3L 2K50A 1S72A 5M3MG 2FXQA 1UE6A 2B29A 2ZTEA 1VQHA 2KCMA 1JJCB 5LMUL 1N33Q 3M4OH 3ER0A 1WOCA 3HOWH 2GVAA 1SMXA 4QQBX 3HOYG 3CPWA 1YITA 1XPOA 4JI6Q 4JCVE 4MZ9A 4GN4B 4B3TQ 2YU9H 4DV5Q 1UWVA 3GO5A 2UUAQ 2OQ0A 4AH6A 1QZHA 5C4XG 1CKOA 4KHZA 4GKKL 4HIMA 4HJ7A 2EXDA 1OXVA 1KRTA 1XNQQ 1Q86C 4GNXA 1QUQA 2I5MX 5BR8Q 3CCUA 2F52A 2ATWA 1XMOQ 2UU9L 5J3BA 4YWLA 1G291 2Y0SG 4ME3A 4DV6L 2K4KA 1YJWA 4B3RL 3HKZG 3CP0A 4LFBL 3I55A 3RN2A 1PH9A 5ELNA 1VQJA 5LMNQ 3KLWA 2UUCQ 3GTLH 4B3SL 1TWAH 4O2DA 5FLMG 5K36G 1HH2P 4JBWA 2OTJA 5EAYA 3PO2G 3KJPA 3FHWA 3PIOA 1N34L 2VUMH 5M3FG 2ZM6L 2VS1A 4DV0L 4BBRG 1KL9A 4HIDA 4LFCL 3CC2A 2IT1A 4WJ3M 2WFWA 3NBHB 3KDFB 4JI4Q 4LUZA 4IFDG 1EIFA 2VQFL 1LM0A 4A3FH 4DR1L 2XTIA 4QL5A 1PH7A 2DUDA 1S40A 3PGZA 1QVFA 5JJIA 2OQKA 3J80i 5IYCH 2JA6G 1E22A 4BY7H 2BA0A 4A3IG 5LMNW 3AFQA 4P73A 3HOZH 2IHFA 1WCMH 3GTJH 3T1HL 3ULPA 2ZJQA 4GS3A 2KENA 4DR7Q 4A3KG 4JC0A 3J81i 4OX9L 4KHPQ 2B3GA 2UU9Q 1B7YB 3S1NH 4POGA 4B3RQ 3FKIH 1OXSC 2CKZB 1HNZL 4LFBQ 1VQPA 2VY3A 4LF8Q 1IYJB 5M5YH 2JE6I 2QA4A 4AQYL 5IP7G 3CC4A 3L7ZC 1IBLQ 1H95A 4B3SQ 5IP9G 4A3DH 1VQCA 1BBWA 4DV3L 4A3GH 4NXMQ 2MQHA 3KOJA 1VQ5A 4L5QA 5C3EG 2ZM6Q 4DV1L 1NJIC 4JV5L 3EBEA 1VQIA 4GNXB 4DV0Q 4A3EG 1HR0L 4JI7L 4LNQA 4BXXH 4A3CG 1CKMA 2EQSA 4GLAC 2ZJRA 3I4MG 3RLNA 1Z47A 3U58A 1IZ6A 4TQUS 2MFIA 2VQFQ 4LFAL 1FL0A 4DR1Q 3E9IA 3M4QA 3G4SA 3LGJA 4X64Q 5C44H 2K14A 4GOPC 1G51A 2E5LL 2GVBA 3G48A 1Y1WG 1PYBA 3CMAA 2I0QA 1N33L 3UDIA 4BBSG 3J81j 3T1HQ 1B70B 4A93G 2WB1G 1X3EA 1WYDA 1YHBA 1UE7A 4DR5L 2N8NA 5C0XG 3BJUA 4B3TL 2R93G 1E1OA 4DV5L 3PF5A 2VNUD 3S24A 2UUAL 4A3BH 2Z6KC 2I5HA 1J6QA 4DAYB 5IYBG 1EQQA 1I94L 1EWIA 2HQLA 4DV7L 1PH3A 3TS0A 1BKBA 4AQYQ 1XNQL 1NMGA 5DLQE 4YWKA 3J7ZC 4A3JG 1JJGA 2JA7H 3GTPH 1U5KA 2H5XA 1VS0A 3A5ZB 1D8LA 2UXBQ 1VQGA 2HIXA 3IRBA 4MNOA 1XMOL 3SGIA 1KRSA 2R7FA 4HIOA 4BA1I 1X55A 4DV1Q 1IBKQ 1PH6A 2VL6A 1P16A 4IPGA 1CKNB 1HR0Q 4JV5Q 4R4OA 3H0GH 3K7AH 3CW2C 3AYHB 2JA8G 3I4OA 3ULLA 1PH2A 4DK6C 1VQEA 2UUCL 1GKHA 2C35B 5M3MH 1I6HH 4UP9A 2WAQE 1C7YA 1FGUA 4X6AH 4LFAQ 2ALYB 2BH2A 1AH9A 3M7NA 1KQSA 4C3HH 3F2BA 2E5LQ 2ASBA 2MO1A 3KFUA 4A3LG 4LF4Q 3L0OA 2R92G 3TQYA 2KBNA 3TS2A 2JA5H 4DR5Q 4JI4L 2CWAA 4OONA 2OWOA 4BY1G 4X65L 3S2HH 3CCJA 2JK8A 2AWNA 1HR0W 1I94Q 4LF9L 4DV7Q 4L5RC 4P71A 3CF5A 3I7FA 3MEFA 4A4IA 3PSIA 4HJAA 3OW2A 3HOVG 2NN6G 4DR7L 4LF6L 4KHPL 2E2IH 1A0IA 4JI2L 5FJ8H 3PUYA 4LUOA 4HJ8A 2KHIA 3K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH L;  5JEA J;  1B8A A;  1SRU A;  3W1B A;  2E2H H;  1DGS A;  5IWA Q;  4YCV A;  5HY6 A;  4LF8 L;  2ZJP A;  2GN5 A;  3GTQ H;  1I50 H;  4JYA L;  2Z6K A;  2AMC B;  4AYB E;  4DR3 Q;  3PO2 H;  3UDX A;  1YJN A;  1IBL L;  4UP8 A;  3RLO A;  2VQE L;  1A8V A;  4DR4 L;  2YYZ A;  4LF7 L;  3UE0 A;  2D62 A;  4NXM L;  3OTO L;  3H3V I;  2HIV A;  1RL2 A;  1EOV A;  1YIJ A;  4DK3 C;  2NZH A;  2CFM A;  1N36 Q;  1JB7 A;  1NMF A;  3I56 A;  1KXL A;  4IFD I;  2N3S A;  1S3O A;  2IY5 B;  3AQQ A;  2QEX A;  3JC6 6;  4X65 Q;  2JA6 H;  4APV A;  4UP7 A;  4DR6 Q;  3D0F A;  4X64 L;  1QVC A;  4LF9 Q;  1C9O A;  3K80 C;  1EYG A;  2NVY H;  1OXT A;  1M90 C;  2R7D A;  4IPC A;  4DNI A;  4WJ4 A;  1YNX A;  4ALP A;  3NEM A;  3K81 C;  2PQA B;  1VQ4 A;  2NVT H;  1K3R A;  5IY0 A;  4LF6 Q;  1FJG Q;  2UXD Q;  4R4C A;  4JI2 Q;  3CCR A;  3CCS A;  4R4I A;  2JEB I;  3F2C A;  2HT1 A;  3ULJ A;  2PI2 A;  4R1J A;  5GAG C;  2HHH Q;  1XNR L;  2Z0S A;  4DV2 Q;  5IP9 H;  4J15 A;  2NZO A;  2PNH A;  5IT9 c;  2ES2 A;  2R7Z H;  4JYA Q;  3RR5 A;  1HNW L;  3CME A;  1PA6 A;  2MO0 A;  3GTG H;  4IOA A;  3PF4 A;  3PO3 H;  5GAH C;  3U4Z A;  3W5O A;  2VQE Q;  1K73 C;  4A3F G;  3EN2 A;  3KJO A;  4A3E H;  4LF7 Q;  1Q12 A;  1D7Q A;  4A3C H;  1L2F A;  2E8G A;  4LW1 A;  3OTO Q;  1VQB A;  4IJH A;  4RG1 A;  4A75 A;  1IBK L;  4OXP A;  3CCQ A;  3G6E A;  1PHJ A;  5IYC G;  1UEB A;  1QUQ B;  2RHQ B;  3T1Y Q;  2A19 A;  1WCM G;  1P8L A;  1EFW A;  1VQ7 A;  3HFZ B;  3S16 H;  4K0K L;  3L2P A;  2EIF A;  1BBU A;  2Q2I A;  3M85 A;  4OWW B;  3CQZ H;  4JOI C;  5GAE C;  1VQM A;  1Y14 B;  3S1M H;  1E24 A;  3S14 H;  5IYD H;  3PUV A;  4JBJ A;  4GKJ L;  4A93 H;  3FKI G;  4NPS A;  4DUY L;  1MKH A;  2NVQ H;  1N32 L;  4LF4 L;  3WWV A;  2R6G A;  1VQA A;  5C0X I;  1OTC A;  1TWF H;  3PCO B;  1JMC A;  3DM3 A;  4YHH Q;  4A3D G;  1YI2 A;  3F8T A;  2I5L X;  3STB C;  3I4N H;  4A3M H;  4A3G G;  1XPR A;  2YTX A;  2OCE A;  2YTV A;  1XNR Q;  4MTN A;  5HGQ A;  1XMQ Q;  1IBM Q;  2N49 A;  4TVA B;  1OXU A;  3K7U C;  4R4Q A;  3S1Q H;  3CPF A;  2V1C C;  2IX0 A;  3NEL A;  1J5E Q;  1Q82 C;  1SN8 A;  3G71 A;  4R4T A;  1HNW Q;  2B63 H;  4IFD J;  2L15 A;  2UXC Q;  4GLV B;  3HOX H;  1Y1V H;  3TEH B;  1T9H A;  1GM5 A;  4GN3 B;  4UPA A;  1VQ8 A;  1RIP A;  2AKW B;  4B3M L;  1KAW A;  1BVS A;  2LSS A;  5JEA G;  1CSP A;  5C44 G;  4LF5 L;  4JI1 L;  3KF8 B;  2UUB Q;  5JJL A;  1V1Q A;  4YCW A;  5IWA L;  3PUW A;  4AIM A;  1VQF A;  3HOU H;  1LTL A;  1X6O A;  1I5F A;  4XTC S;  3A5U A;  4DR3 L;  1M1K C;  4JI0 L;  5JJK A;  4K0K Q;  4P72 A;  1V9P A;  4DR4 Q;  5FLX c;  3M9B A;  3GDE A;  1L1O C;  4QGU A;  4HIK A;  1KD1 C;  3UDG A;  1K8G A;  2PMZ E;  1UE5 A;  1Q1E A;  1GO3 E;  2ZTD A;  4DV4 L;  5GRO A;  3HOY H;  4A3B G;  4GKJ Q;  1O7I A;  3A74 A;  4L5T A;  4DUY Q;  3KF6 A;  1N32 Q;  1A63 A;  4RMF A;  1N36 L;  2N78 A;  3S17 H;  1VCI A;  1A62 A;  3F1Z A;  4Y52 H;  1X9N A;  1LUZ A;  3KDF A;  1TWG H;  2WAQ G;  1ASY A;  2JA7 G;  5M5W H;  4PMW A;  5C4X H;  1K83 H;  3E0E A;  5GQO A;  4YY3 L;  2LXK A;  2AHO B;  4DR6 L;  3A0J A;  3D31 A;  1WJJ A;  3I2Z A;  2Q2T A;  1Q8K A;  4OO1 G;  2RHS B;  3PV0 A;  3CC7 A;  3S1R H;  3M4P A;  2NN6 I;  3H0G G;  4JOI A;  4LWC A;  3CCL A;  2KCT A;  4X62 Q;  3RNU A;  4PZ6 A;  1Q46 A;  1GVP A;  2DGY A;  4FDB A;  4GOP A;  1FJG L;  3GTM H;  2UXD L;  3Q8D A;  1VQK A;  3JAM c;  4UY8 C;  1VQ6 A;  1G6P A;  4YCU A;  4B3M Q;  1JJ2 A;  2VW9 A;  4LF5 Q;  1EIY B;  4JI1 Q;  3PIP A;  1W2B A;  1Z9F A;  3BU2 A;  2ZTC A;  4DV2 L;  1X54 A;  1K8A C;  3HOW G;  2JJQ A;  4L5S A;  2UXB L;  1YVC A;  5C0X J;  5FLM H;  4IO9 A;  1C0A A;  1HZC A;  1TWC H;  4EQ5 A;  2JQO A;  4PZ8 A;  4GN5 A;  4QIW E;  2JA5 G;  4JI0 Q;  3J7A 5;  5M3F H;  3M3Y H;  2Y0S E;  4JG2 A;  1CUK A;  3S2D H;  1LYL A;  3HKZ E;  4DR2 L;  4BBR H;  5M5X H;  4DV4 Q;  1R9T H;  3H3V H;  3U4V A;  1X65 A;  4DKA C;  1X3F A;  2E2J H;  4NXN L;  5C4J H;  4GLX A;  1N9W A;  1VQL A;  1AE2 A;  1XJV A;  3K8A A;  3T1Y L;  4Y7N H;  4AYB G;  4JI5 Q;  3DLL A;  1MIU A;  3GD7 A;  2KHJ A;  3NEN A;  5FJ8 G;  4JI8 L;  4YY3 Q;  4H02 A;  4PZ7 A;  3S15 H;  4A3I H;  2CCZ A;  2F3I A;  2K5H A;  3UE1 A;  4POF A;  2MNA A;  3F2D A;  3KYH C;  4A76 A;  1VQ9 A;  3EIV A;  1YHA A;  4A3K H;  1NTG A;  4HJ5 A;  1L1O A;  2A1A A;  1Q1B A;  4QY7 A;  4JI3 Q;  1E1T A;  2YTY A;  2A8V A;  3MXN B;  1VQO A;  2K75 A;  4YHH L;  1VQN A;  2F4V L;  1W3S A;  3GTK H;  1PVO A;  2IHE A;  3RLF A;  1MJC A;  5LMU Q;  3RN5 A;  2Q2H A;  3PUX A;  3KF6 B;  2K52 A;  1N8R C;  3AEV A;  2VUM G;  1WFQ A;  3BZC A;  5AJ3 L;  1XMQ L;  1HNX L;  1KIX A;  1IBM L;  1PH5 A;  5IP7 H;  3FP9 A;  4O0A A;  3TRE A;  3OYY A;  1J5E L;  1YBY A;  4HJ9 A;  2AWO A;  3ERS X;  2UXC L;  1PYS B;  2VZA A;  4IPH A;  1QVG A;  1SRO A;  5C3E H;  4P75 A;  1YHQ A;  4DR2 Q;  4GKK Q;  5ELO A;  4P74 A;  2QGQ A;  3I4M H;  2WP8 J;  4KI0 A;  4BA2 I;  1FVI A;  4NXN Q;  1L0W A;  3UDF A;  1CKN A;  2UUB L;  4GOP B;  2RCN A;  1NBW A;  1JE5 A;  4BY7 G;  4IPD A;  4JBK A;  4DPG A;  4DAM A;  2PI2 E;  2D0P A;  2CWP A;  5E7N A;  2Q2U A;  3HOZ G;  1SLJ A;  1TXY A;  3AFP A;  1YZ6 A;  3GTO H;  4DV6 Q;  1Y1W H;  3TRZ A;  4JI8 Q;  1HJP A;  4LUV A;  4BBS H;  1TWH H;  2JEA I;  2LXJ A;  2BH8 A;  3ZJY C;  2R93 H;  4C2M H;  1YJ9 A;  2R7Z G;  1PV4 A;  1IXR A;  3PO3 G;  1WI5 A;  1N34 Q;  3BZK A;  2F4V Q;  1NY4 A;  5IYB H;  1NE3 A;  1AE3 A;  3JAM i;  1XTD A;  1PFS A;  4OWT B;  4QJF A;  2RF4 A;  3HKS A;  3STB D;  1KC8 C;  4LFC Q;  1I3Q H;  1HNX Q;  5AJ3 Q;  1MJE A;  1EUJ A;  2K5V A;  2WB1 E;  4NB3 A;  4A3J H;  4BXX G;  3RZD H;  1CSQ A;  5GAD C;  4X62 L;  1KHI A;  4DUZ L;  4X66 L;  3VDY A;  1PH8 A;  2CQO A;  1U0L A;  2ID0 A;  4GNX C;  1OXX K;  4KLK A;  5IYD G;  1L1O B;  2IX1 A;  2XGT A;  1JT8 A;  3U50 C;  1IL2 A;  2JA8 H;  3ICE A;  3E9H A;  4C3I H;  4JI6 L;  3CD6 A;  1VQD A;  4OX9 Q;  1X56 A;  3PUZ A;  2NVX H;  2OTL A;  1ASZ A;  1HZB A;  3CXC A;  4OWX B;  4IOC A;  4JBM A;  1K0R A;  5IE8 A;  4XIG S;  2K5N A;  1HNZ Q;  3B6Y A;  1K9M C;  3CCM A;  4A3M G;  4IJL A;  3I4N G;  4A3L H;  1YEZ A;  3CCV A;  1PH4 A;  1XPU A;  2R92 H;  3J80 c;  1EQR A;  3W1G A;  1HZA A;  4C3J H;  3RZO H;  1SE8 A;  1GD7 A;  5BR8 L;  4PG3 A;  2YV5 A;  1SR3 A;  5H1S E;  4BY1 H;  4DV3 Q;  1E3P A;  3J81 c;  3H15 A;  4YWM A;  4JI5 L;  4EX5 A;  1Q81 C;  2B63 G;  2D0O A;  3CAM A;  1Y1V G;  3HOX G;  1PH1 A;  1X3G A;  4OO1 I;  1E7Z A;  1V43 A;  2BA1 A;  1HZ9 A;  4JI7 Q;  1SFO H;  1QZG A;  5LMN L;  1UE1 A;  2JA9 A;  3CCE A;  3HOV H;  1Q7Y C;  4DUZ Q;  4X66 Q;  3HOU G;  2PQA A;  4JI3 L;  2K50 A;  1S72 A;  5M3M G;  2FXQ A;  1UE6 A;  2B29 A;  2ZTE A;  1VQH A;  2KCM A;  1JJC B;  5LMU L;  1N33 Q;  3M4O H;  3ER0 A;  1WOC A;  3HOW H;  2GVA A;  1SMX A;  4QQB X;  3HOY G;  3CPW A;  1YIT A;  1XPO A;  4JI6 Q;  4JCV E;  4MZ9 A;  4GN4 B;  4B3T Q;  2YU9 H;  4DV5 Q;  1UWV A;  3GO5 A;  2UUA Q;  2OQ0 A;  4AH6 A;  1QZH A;  5C4X G;  1CKO A;  4KHZ A;  4GKK L;  4HIM A;  4HJ7 A;  2EXD A;  1OXV A;  1KRT A;  1XNQ Q;  1Q86 C;  4GNX A;  1QUQ A;  2I5M X;  5BR8 Q;  3CCU A;  2F52 A;  2ATW A;  1XMO Q;  2UU9 L;  5J3B A;  4YWL A;  1G29 1;  2Y0S G;  4ME3 A;  4DV6 L;  2K4K A;  1YJW A;  4B3R L;  3HKZ G;  3CP0 A;  4LFB L;  3I55 A;  3RN2 A;  1PH9 A;  5ELN A;  1VQJ A;  5LMN Q;  3KLW A;  2UUC Q;  3GTL H;  4B3S L;  1TWA H;  4O2D A;  5FLM G;  5K36 G;  1HH2 P;  4JBW A;  2OTJ A;  5EAY A;  3PO2 G;  3KJP A;  3FHW A;  3PIO A;  1N34 L;  2VUM H;  5M3F G;  2ZM6 L;  2VS1 A;  4DV0 L;  4BBR G;  1KL9 A;  4HID A;  4LFC L;  3CC2 A;  2IT1 A;  4WJ3 M;  2WFW A;  3NBH B;  3KDF B;  4JI4 Q;  4LUZ A;  4IFD G;  1EIF A;  2VQF L;  1LM0 A;  4A3F H;  4DR1 L;  2XTI A;  4QL5 A;  1PH7 A;  2DUD A;  1S40 A;  3PGZ A;  1QVF A;  5JJI A;  2OQK A;  3J80 i;  5IYC H;  2JA6 G;  1E22 A;  4BY7 H;  2BA0 A;  4A3I G;  5LMN W;  3AFQ A;  4P73 A;  3HOZ H;  2IHF A;  1WCM H;  3GTJ H;  3T1H L;  3ULP A;  2ZJQ A;  4GS3 A;  2KEN A;  4DR7 Q;  4A3K G;  4JC0 A;  3J81 i;  4OX9 L;  4KHP Q;  2B3G A;  2UU9 Q;  1B7Y B;  3S1N H;  4POG A;  4B3R Q;  3FKI H;  1OXS C;  2CKZ B;  1HNZ L;  4LFB Q;  1VQP A;  2VY3 A;  4LF8 Q;  1IYJ B;  5M5Y H;  2JE6 I;  2QA4 A;  4AQY L;  5IP7 G;  3CC4 A;  3L7Z C;  1IBL Q;  1H95 A;  4B3S Q;  5IP9 G;  4A3D H;  1VQC A;  1BBW A;  4DV3 L;  4A3G H;  4NXM Q;  2MQH A;  3KOJ A;  1VQ5 A;  4L5Q A;  5C3E G;  2ZM6 Q;  4DV1 L;  1NJI C;  4JV5 L;  3EBE A;  1VQI A;  4GNX B;  4DV0 Q;  4A3E G;  1HR0 L;  4JI7 L;  4LNQ A;  4BXX H;  4A3C G;  1CKM A;  2EQS A;  4GLA C;  2ZJR A;  3I4M G;  3RLN A;  1Z47 A;  3U58 A;  1IZ6 A;  4TQU S;  2MFI A;  2VQF Q;  4LFA L;  1FL0 A;  4DR1 Q;  3E9I A;  3M4Q A;  3G4S A;  3LGJ A;  4X64 Q;  5C44 H;  2K14 A;  4GOP C;  1G51 A;  2E5L L;  2GVB A;  3G48 A;  1Y1W G;  1PYB A;  3CMA A;  2I0Q A;  1N33 L;  3UDI A;  4BBS G;  3J81 j;  3T1H Q;  1B70 B;  4A93 G;  2WB1 G;  1X3E A;  1WYD A;  1YHB A;  1UE7 A;  4DR5 L;  2N8N A;  5C0X G;  3BJU A;  4B3T L;  2R93 G;  1E1O A;  4DV5 L;  3PF5 A;  2VNU D;  3S24 A;  2UUA L;  4A3B H;  2Z6K C;  2I5H A;  1J6Q A;  4DAY B;  5IYB G;  1EQQ A;  1I94 L;  1EWI A;  2HQL A;  4DV7 L;  1PH3 A;  3TS0 A;  1BKB A;  4AQY Q;  1XNQ L;  1NMG A;  5DLQ E;  4YWK A;  3J7Z C;  4A3J G;  1JJG A;  2JA7 H;  3GTP H;  1U5K A;  2H5X A;  1VS0 A;  3A5Z B;  1D8L A;  2UXB Q;  1VQG A;  2HIX A;  3IRB A;  4MNO A;  1XMO L;  3SGI A;  1KRS A;  2R7F A;  4HIO A;  4BA1 I;  1X55 A;  4DV1 Q;  1IBK Q;  1PH6 A;  2VL6 A;  1P16 A;  4IPG A;  1CKN B;  1HR0 Q;  4JV5 Q;  4R4O A;  3H0G H;  3K7A H;  3CW2 C;  3AYH B;  2JA8 G;  3I4O A;  3ULL A;  1PH2 A;  4DK6 C;  1VQE A;  2UUC L;  1GKH A;  2C35 B;  5M3M H;  1I6H H;  4UP9 A;  2WAQ E;  1C7Y A;  1FGU A;  4X6A H;  4LFA Q;  2ALY B;  2BH2 A;  1AH9 A;  3M7N A;  1KQS A;  4C3H H;  3F2B A;  2E5L Q;  2ASB A;  2MO1 A;  3KFU A;  4A3L G;  4LF4 Q;  3L0O A;  2R92 G;  3TQY A;  2KBN A;  3TS2 A;  2JA5 H;  4DR5 Q;  4JI4 L;  2CWA A;  4OON A;  2OWO A;  4BY1 G;  4X65 L;  3S2H H;  3CCJ A;  2JK8 A;  2AWN A;  1HR0 W;  1I94 Q;  4LF9 L;  4DV7 Q;  4L5R C;  4P71 A;  3CF5 A;  3I7F A;  3MEF A;  4A4I A;  3PSI A;  4HJA A;  3OW2 A;  3HOV G;  2NN6 G;  4DR7 L;  4LF6 L;  4KHP L;  2E2I H;  1A0I A;  4JI2 L;  5FJ8 H;  3PUY A;  4LUO A;  4HJ8 A;  2KHI A;  3K0X A; 
#chains in the Genus database with same CATH topology
 2HHH L;  1SRU A;  2E2H H;  4H44 C;  4A3B B;  5AFW A;  1I50 H;  1KDA A;  2I07 B;  2R3Z A;  1YJN A;  2AQ2 B;  4LF7 L;  1SYG A;  3UE0 A;  2JA7 B;  1PFM A;  3H3V I;  1RD9 D;  2HIV A;  3KLS X;  1YIJ A;  2K7V A;  4DK3 C;  1EYC A;  1L0Y B;  1A3V A;  4BS9 A;  1JB7 A;  3VR6 A;  1KXL A;  1TII D;  3J80 L;  3K7A B;  4RGM A;  2QEX A;  5LHY 1;  5ELE A;  3SK4 A;  1CA5 A;  1OXT A;  3NPP A;  2R7D A;  4IPC A;  4ZUJ A;  1RDP D;  1HTP A;  1DM0 B;  4IN3 A;  4LF6 Q;  5IY0 A;  3KBG A;  1LAB A;  3CCR A;  3ULJ A;  1SYC A;  2Z0S A;  2RKS A;  3BDO A;  3OMC A;  1CTM A;  3CRL C;  2LY7 A;  2HCC A;  2PNH A;  4J15 A;  4JYA Q;  1HNW L;  3RR5 A;  2UXB Q;  4MTK A;  3T16 A;  5GAH C;  3U4Z A;  3W5O A;  2M00 A;  3EN2 A;  3QOL A;  3CU7 A;  4KN7 C;  1L2F A;  4KY5 A;  3OTO Q;  4A75 A;  1RCV D;  1Q90 A;  4RWS C;  3CCQ A;  3G6E A;  1PHJ A;  3OMG A;  1QUQ B;  2RHQ B;  1NNX A;  2A19 A;  2PW7 A;  1EU3 A;  1P8L A;  3HFZ B;  4XQJ A;  3L2P A;  4CKC A;  4OWW B;  3S1M H;  1QIL A;  1CK1 A;  5IYD H;  5IGF A;  4GKJ L;  4A93 H;  1GJX A;  1OTC A;  4EVO A;  2I46 A;  3SK5 A;  2YTX A;  2YTV A;  3EJI A;  3HG9 A;  1IBM Q;  2N49 A;  4TVA B;  3K7U C;  1J5E Q;  1SJE D;  4R4T A;  5A2Q L;  2L15 A;  3K5N A;  2VB3 X;  4X3K A;  1BCP D;  2NVT B;  2XVS A;  3QIA A;  1KAW A;  2LSS A;  5JEA G;  5C44 G;  4YCW A;  1LTG D;  1VQF A;  1LTL A;  1X6O A;  1B3A A;  2OXP A;  1FNU A;  4P72 A;  1V9P A;  2N88 A;  3C1F A;  3DWP A;  3M9B A;  2R7Z B;  3PO3 B;  1KD1 C;  2MP1 A;  2PMZ E;  4K5X A;  1JQY D;  1A2T A;  3KF6 A;  1N32 Q;  1PTO B;  4H13 C;  4RHS A;  5KNB A;  3S17 H;  1LUZ A;  1TWG H;  3DMU A;  5C4X H;  5M5W H;  1K83 H;  3E0E A;  4YY3 L;  2AHO B;  3A55 A;  2KEC A;  3D31 A;  4UDU C;  2EPB A;  4OO1 G;  2DNC A;  3S1R H;  1E2Z A;  1M4V A;  2LMC B;  1HA6 A;  1I4H A;  4QF4 A;  2NVQ B;  2WKD A;  1PRT B;  1TWF B;  1RKN A;  2K01 A;  5KNC A;  1G6P A;  4B3M Q;  4CJ1 B;  1W2B A;  3BU2 A;  1K8A C;  1X54 A;  3HOW G;  5G3L F;  2UXB L;  5FLM H;  4JI0 Q;  2JA5 G;  1Y69 U;  1GXD C;  4JG2 A;  2B63 B;  4FP5 D;  3S2D H;  1LYL A;  1NR4 A;  3BYY B;  5M5X H;  2PMZ B;  2EYH A;  1JR0 D;  3H09 A;  1XJV A;  3VYT A;  2CH4 W;  4KK7 A;  4KTA A;  1MIU A;  3HOU B;  1EZ6 A;  4H02 A;  4PZ7 A;  2CCZ A;  2DY8 A;  2F3I A;  1SE3 A;  2K5H A;  3UE1 A;  1VQ9 A;  5DM7 3;  4OGQ C;  1SXT A;  3OHX C;  4JI3 Q;  1E1T A;  3J80 E;  3MXN B;  1VQN A;  3GTK H;  4C1N K;  1PVO A;  2IHE A;  3DM1 A;  2HDL A;  2F0T A;  2F0W A;  2Q2H A;  3PUX A;  2K52 A;  3AEV A;  5C5L A;  3BZC A;  2LKV A;  5AJ3 L;  3I73 A;  1IBM L;  3H91 A;  2X6L A;  3FP9 A;  1MSG A;  4NMZ A;  3OYY A;  3TRE A;  1J5E L;  4J1M A;  1PXU A;  4P75 A;  2F0Q A;  4DR2 Q;  1BBX C;  4P74 A;  5HGT A;  2KQ3 A;  1CKN A;  2RCN A;  4IPD A;  3SVM A;  4DAM A;  2CWP A;  5E7N A;  2Q2U A;  2L4N A;  2N55 A;  3D4W A;  3AFP A;  3TP7 A;  1YZ6 A;  3SDZ A;  1O78 A;  1IW7 D;  4DV6 Q;  3TDQ A;  1CM9 A;  2D5D A;  3DHQ A;  1TWC B;  1Y1W H;  3TRZ A;  4LUV A;  2LFN A;  3MZ5 A;  2D9U A;  4BBS H;  1V1O A;  4BBR B;  2LXJ A;  2EYL A;  1R9T B;  5CMD A;  4NW2 A;  4C2M H;  4NDX A;  1EQV A;  3KUP A;  3BZK A;  4Y7N B;  1NE3 A;  1BCP B;  4DF7 A;  4QJF A;  4OWT B;  4XYQ A;  2K5V A;  3I8Z A;  1K0S A;  3MWY W;  1CSQ A;  5GAD C;  5EBD A;  3VDY A;  2WV6 D;  2M2L A;  4X66 L;  3A7A B;  4ZKB B;  1H9S A;  1L1O B;  2IX1 A;  3IFT A;  3U50 C;  5NUC A;  1IL2 A;  3E9H A;  5IGD A;  4OX9 Q;  3PUZ A;  2AUK A;  3EVQ A;  2NVX H;  5A2Q E;  1HZB A;  1ASZ A;  4OWX B;  4IOC A;  3A56 A;  2KEE A;  3CCM A;  4RFB A;  4IJL A;  2EJM A;  3NE5 B;  4A3M G;  3I4N G;  1XPU A;  4A3L H;  2QEJ C;  1SE8 A;  1AFP A;  1GD7 A;  1STB A;  5CV6 A;  3MFY A;  4IUU A;  5J1Z A;  4ZLT F;  2D0O A;  3HOX G;  1Y1V G;  1NCV A;  1PH1 A;  2F0H A;  2FMC A;  4JI7 Q;  4U67 3;  2CW0 D;  3J7A V;  1QZG A;  3CCE A;  1Q8I A;  1WD0 A;  1ILP A;  4S3S A;  1BOS A;  4DUZ Q;  2PQA A;  4JI3 L;  2K50 A;  3OOC A;  1HFN A;  4WFN 3;  3ER0 A;  1SMY C;  1WVL A;  4JI6 Q;  1KLG D;  4JCV E;  4MZ9 A;  4B3T Q;  2YU9 H;  3J7Y W;  4DV5 Q;  4M8A A;  3S1Q B;  4AH6 A;  1QZH A;  3MXU A;  1CKO A;  4KHZ A;  4FXK C;  1Y8P B;  4L6T B;  2TMP A;  2A6E C;  5BR8 Q;  3SE0 A;  1PDQ A;  2F52 A;  3D3R A;  5IOD A;  2EXZ A;  2UU9 L;  3J7A F;  5J3B A;  1G29 1;  1ML0 D;  2Y0S G;  4ME3 A;  2K4K A;  1TKW B;  4DV6 L;  3CP0 A;  5EGT A;  3I55 A;  3RN2 A;  4HCE A;  1PRT C;  4B3S L;  4O2D A;  4C3J B;  5K36 G;  2OTJ A;  3VYS A;  2VUM H;  5M3F G;  3OIP A;  1ZKO A;  3CC2 A;  2A5H A;  5EKL A;  2WFW A;  1DON A;  1EIF A;  1HFG A;  4CDC C;  2VQF L;  2VXW A;  1R4P B;  4QL5 A;  4DFA A;  1PH7 A;  1ET9 A;  1WTP A;  4A3I G;  3AFQ A;  1M8A A;  4FF1 A;  4KD4 A;  2ZJQ A;  1ET6 A;  4OX9 L;  1LAC A;  4KHP Q;  2B2Y A;  4UHV A;  3PIP 3;  1Y8N B;  4POG A;  1SE2 A;  2WAC A;  2H4O A;  4LF8 Q;  5IP7 G;  3L7Z C;  2R61 A;  1MGS A;  2NYZ D;  3KOJ A;  1WD1 A;  4F8M A;  1VQI A;  4GNX B;  4JI7 L;  1F2L A;  2EQS A;  2ZJR A;  4GLA C;  3I4M G;  3DWA A;  5C3W A;  5CV5 A;  4R8I A;  1EU4 A;  2J0T D;  3M4Y A;  1JWM D;  1S5E D;  3RLN A;  2MFI A;  4LFA L;  4DR1 Q;  4DNT B;  1O7L A;  1PZJ D;  1EIG A;  5EJW A;  5JEA H;  3U9O A;  5C44 H;  1BO0 A;  3CMA A;  2NWG A;  2B2T C;  1SYF A;  3J81 j;  3T1H Q;  4A93 G;  1X3E A;  3MFG A;  3T13 A;  5C0X G;  4B3T L;  2R93 G;  1E1O A;  4DV5 L;  3PF5 A;  1S4Z A;  2I5H A;  1EEF D;  1LT6 D;  1I94 L;  4ODG A;  2BCO A;  4QMG A;  2L9H A;  4BY7 B;  5DLQ E;  1BCP C;  4A3J G;  3GTP H;  1U4M A;  1U5K A;  1WCM B;  2HIX A;  1KRS A;  4HIO A;  4G7Z C;  1LTT D;  4OO1 H;  2VL6 A;  4IPG A;  1CKN B;  3S1N B;  3A8I E;  2ZXO A;  3CW2 C;  3FPU B;  2JA8 G;  3I4O A;  4DK6 C;  5HUR A;  1I6H H;  1GKH A;  5M3M H;  3P7J A;  1CA6 A;  2WAQ E;  1C7Y A;  5M5Y B;  1TQO A;  2BH2 A;  4ZKC B;  4R9W A;  3KFU A;  1DD2 A;  4LF4 Q;  2R92 G;  4KY7 A;  2J4X A;  2QIL A;  2JA5 H;  4NKL A;  2CWA A;  4BY1 G;  1BXT A;  1IL8 A;  1EY4 A;  2ZXP A;  3IFD A;  3VYR A;  1EY7 A;  2AWN A;  1HR0 W;  4L5R C;  2WKC A;  2WIN B;  2JN4 A;  1GUN A;  4HJA A;  1XX8 A;  2NN6 G;  1ENA A;  3HOV G;  4KHP L;  1HQR D;  1A0I A;  2E2I H;  5KYL A;  5ELF A;  4LF8 L;  2GN5 A;  3TP5 A;  1JE4 A;  5CYU A;  4QB4 A;  3PO2 H;  3UDX A;  3RLO A;  5JOB A;  4I65 A;  2RQX A;  2WAQ B;  1O7Y A;  1SJH D;  1F9P A;  2D2C C;  4HMJ A;  3ZYY X;  4K2L A;  2K28 A;  2NZH A;  5FLX L;  2K04 A;  3R3O A;  1HXY D;  1EYD A;  1N36 Q;  3DEO A;  4IFD I;  2N3S A;  2IY5 B;  3JC6 6;  4R8N A;  2F0D A;  4X65 Q;  2EYP A;  4UP7 A;  3AMU A;  3J81 L;  1D2B A;  1WTW A;  1C9O A;  2NVY H;  2ICE C;  3SK8 A;  4C3H B;  3EQL C;  4ALP A;  2PQA B;  1FNW A;  1K3R A;  3KK7 A;  2UXD Q;  3R2I A;  4RAU C;  4JI2 Q;  1HCZ A;  3CCS A;  1G6Z A;  4R4I A;  3F2C A;  2HT1 A;  4R1J A;  4CGY B;  2HHH Q;  1XNR L;  2EYJ A;  4CDD C;  4DV2 Q;  3S2H B;  3OPO A;  4G57 A;  1JOQ A;  1FNV A;  3GTG H;  1JWU D;  2MO0 A;  4IOA A;  2XIW A;  3BG3 A;  4YIJ A;  4DNR B;  1HUN A;  3F2U A;  3I4L A;  4A3E H;  4LF7 Q;  5DM6 3;  1D7Q A;  2KCN A;  4LW1 A;  4RG1 A;  3V2T A;  1I4P A;  1GHJ A;  4F87 A;  2K05 A;  1G2S A;  1IW7 C;  4K0K L;  2Q2I A;  4DR4 L;  3OSO A;  3CQZ H;  1E24 A;  1CHP D;  4JBJ A;  4V19 0;  1MKH A;  4LF4 L;  2R6G A;  4KKU A;  3HS0 C;  4KKS A;  2NUC A;  1JMC A;  2DJG C;  4XXE A;  4A3D G;  3I4N H;  4A3M H;  3H94 A;  4A3G G;  1XPR A;  2OCE A;  4G4K A;  1XMQ Q;  2JP1 A;  2JA6 B;  2A68 D;  3S1Q H;  1F9R A;  3CPF A;  2V1C C;  2KA7 A;  3NEL A;  3OWE B;  1Q82 C;  3G71 A;  5EBC A;  1HNW Q;  1CI3 M;  4IFD J;  3FPP A;  2UXC Q;  1B4O A;  3HOX H;  1Y1V H;  4GN3 B;  4UPA A;  1VQ8 A;  1RIP A;  1CSP A;  3PUW A;  2HCI A;  2SDF A;  1WTV A;  1MSH A;  1I5F A;  1M1K C;  4IUR A;  2J7Z A;  3GDE A;  4QGU A;  1A15 A;  4K6L A;  3UDG A;  1UE5 A;  3MXN A;  4X3U A;  1Q1E A;  4A3B G;  4GKJ Q;  4ILW A;  3A74 A;  1K28 A;  1H9M A;  2N78 A;  1N36 L;  1EFI D;  1A62 A;  1GHK A;  1H9J A;  3TBI B;  2JA7 G;  2B2V A;  2CW0 C;  1I4G A;  3D6W A;  3C3L A;  3MXP A;  1GUT A;  5GQO A;  3S16 B;  1NAP A;  1EL0 A;  2EY1 A;  5I2Y A;  2Q2T A;  2RHS B;  3CC7 A;  1PTO D;  4JOI A;  2KCT A;  3K5O A;  2FJ2 A;  1IKL A;  4KJO A;  3GTM H;  2UXD L;  1BF4 A;  4HED A;  4ZCK A;  1EIY B;  3OIQ A;  3PIP A;  4DV2 L;  5EKK A;  2FIN B;  2PZT A;  5K36 H;  1TS4 A;  3R93 A;  3T51 B;  4EQ5 A;  1I4Q A;  1ZXT A;  5M3F H;  1F77 A;  1PRT D;  3HEJ A;  1CUK A;  3HKZ E;  1GUG A;  3U4V A;  4DKA C;  4RGT A;  1X3F A;  2E2J H;  5C4J H;  2L11 A;  5DEH A;  5JPM C;  1IYV A;  1DXM A;  4JI8 L;  4YY3 Q;  3Q24 A;  3S15 H;  4A3I H;  2O5J C;  2MNA A;  3F2D A;  3KYH C;  5EPL A;  3I90 A;  5FLX E;  2EY5 A;  1L1O A;  3HOY B;  1G8Z D;  4G7H C;  2K75 A;  4IUQ A;  5JVH 3;  5LMU Q;  3RN5 A;  3J81 E;  2VUM G;  1HNX L;  1XMQ L;  5KEE A;  1PH5 A;  5IP7 H;  4K2K A;  2DJF C;  4HSP A;  3ERS X;  4PV1 C;  2UXC L;  2NB0 A;  3MHB A;  4CJ2 C;  3SEB A;  2KVM A;  3K5M A;  1YHQ A;  4GKK Q;  3I4M H;  2WP8 J;  4KI0 A;  1FVI A;  3HKZ B;  1L0W A;  2QW7 A;  3TP6 A;  4GOP B;  2MPM A;  1TXY A;  1EYA A;  1SE4 A;  2F0S A;  3GTO H;  1UNS A;  1HJP A;  2L12 A;  3M3Y B;  4FF2 A;  1TWH H;  5IGB A;  1QWY A;  1CT1 D;  4CDE C;  2K5Q A;  5C0X H;  2BH8 A;  3ZJY C;  2R93 H;  1R4Q B;  2ZT9 C;  1YJ9 A;  2R7Z G;  1IXR A;  3PO3 G;  1AE3 A;  1XTD A;  1PFS A;  3R2T A;  4CKB A;  2RF4 A;  3HKS A;  3STB D;  3VR3 A;  1TS5 A;  5AJ3 Q;  1MJE A;  1EUJ A;  4FNF A;  2WB1 E;  4NB3 A;  4A3J H;  4OL7 A;  1LV9 A;  5CBA E;  1XWE A;  4A3K B;  1RF2 D;  1UUP A;  1PH8 A;  3Q0A A;  3MXG A;  2JA8 H;  2KUM A;  4C3I H;  3IAY A;  2H1E A;  4I7Z C;  4PMB A;  3CD6 A;  1X56 A;  4ZUI A;  3K6O A;  4JBM A;  4XYO A;  3B6Y A;  1HNZ Q;  1CQF A;  3CCV A;  2R92 H;  5C3E B;  1V1P B;  3NUC A;  2PYK A;  1ONL A;  4Q0F A;  1SBB B;  5H1S E;  4BY1 H;  1E3P A;  4RH6 A;  3H15 A;  4YWM A;  3TP8 A;  4EX5 A;  2B63 G;  1WTO A;  1X3G A;  4OO1 I;  1E7Z A;  2BA1 A;  1HZ9 A;  1B44 D;  1STG A;  1I4X A;  3NXW A;  3HOV H;  2NN6 H;  3BVG A;  1CHQ D;  2WB1 B;  4X66 Q;  3HOU G;  2IPK D;  1KAA A;  5M3M G;  2B29 A;  2ZTE A;  2OT2 A;  5IGE A;  2KCM A;  1JJC B;  5LMU L;  3M4O H;  1DCZ A;  2B2Y C;  2EY6 A;  1WTR A;  5D14 A;  4ZAI A;  4ABN A;  3CPW A;  1PZI D;  1I3Q B;  3BVZ A;  2UUA Q;  1CZW A;  1GOZ A;  3I72 A;  5C4Z A;  4B08 A;  4GKK L;  1NUC A;  4IUP A;  5EQ0 A;  4HJ7 A;  4IUV A;  1KRT A;  2C9O A;  1Q86 C;  4GNX A;  1TY0 A;  1F2Z A;  2I5M X;  1VMC A;  5KGU A;  2K5D A;  2K33 A;  4YWL A;  1QG7 A;  3MC0 B;  4EQO A;  4LFB L;  2MUY A;  1HA5 A;  5ELN A;  2Z8L A;  1PLF A;  1VQJ A;  3K58 A;  3KLW A;  3GTL H;  1F2Y A;  4XQN A;  2SNM A;  3RZO B;  4JBW A;  3KLR A;  5E4W C;  5EAY A;  3FHW A;  3PO2 G;  3PIO A;  4K8J A;  2ZM6 L;  2G9H D;  2XSC A;  4DV0 L;  4BBR G;  4HID A;  1KAB A;  4OIK A;  2IT1 A;  3MVV A;  4ME5 A;  4RKL A;  1UEA B;  5J39 A;  4JI4 Q;  1SFO B;  3NK9 A;  1TY2 A;  2XTI A;  5I9O A;  4X3S A;  1IYU A;  1MI2 A;  4RA8 A;  1QVF A;  2BA0 A;  5LMN W;  4P73 A;  1K8M A;  1QB5 D;  2IHF A;  3GTJ H;  4RCN A;  3HOZ H;  2F0I A;  4GS3 A;  3HOW B;  4DR7 Q;  1BR9 A;  1D6E C;  2UU9 Q;  1PFN A;  3E5S A;  2CKZ B;  3E0J A;  1FR3 A;  1HNZ L;  4N8X 1;  3NTK A;  2JE6 I;  4AQY L;  1H95 A;  1IBL Q;  2DN8 A;  4B3S Q;  2Q8T A;  4A3D H;  1ESR A;  1VQC A;  1BBW A;  4A3G H;  1SYD A;  2MQH A;  4IAL A;  4JV5 L;  5ELC A;  1B53 A;  4A3E G;  1HR0 L;  4BXX H;  4LNQ A;  1ROD A;  1CKM A;  1II3 A;  4TSS A;  3U58 A;  1Z6H A;  4TQU S;  2VQF Q;  1ICW A;  1FL0 A;  3M4Q A;  1TWA B;  4GOP C;  1G51 A;  2E5L L;  2GVB A;  4RGO S;  4IUN A;  2B8F A;  5COR A;  3U9S A;  1KNE A;  1EOT A;  1WYD A;  1UE7 A;  1B50 A;  2X69 A;  2VNU D;  2UUA L;  4A3B H;  1ENF A;  2A68 C;  3EFX D;  4A3F B;  1QE6 A;  4FVM A;  4HCS A;  1EWI A;  3H3V C;  1KNA A;  4DV7 L;  4JW0 A;  3Q6S A;  1WTX A;  4KJN A;  1BKB A;  4CDF C;  1NMG A;  3J7Z C;  2JA7 H;  5D3D A;  2H5X A;  3A5Z B;  3IRB A;  2XNA C;  4MNO A;  3SGI A;  4KN4 C;  2F0M A;  2F0L A;  2R7F A;  1X55 A;  5I4D A;  4DK0 A;  5JPN C;  3K7A H;  3FKI B;  3NQT A;  1VQE A;  2RBM A;  5CV7 A;  1GUS A;  2C35 B;  5KND A;  4X6A H;  2A73 B;  4LFA Q;  1KQS A;  3D8G A;  1BDO A;  1F9Q A;  2MO1 A;  4PMC A;  3L0O A;  3TQY A;  3TS2 A;  2EJF C;  4C3J G;  1PYW D;  4JI4 L;  4HSV A;  3RZD B;  2F0U A;  3EA6 A;  3CCJ A;  2JK8 A;  1I94 Q;  1PTO C;  4LF9 L;  4P71 A;  3I7F A;  3MEF A;  1STE A;  1AW7 A;  3OW2 A;  3M7G A;  4FF4 A;  1Q3L A;  4DR7 L;  4HAE A;  1BCP F;  3PUY A;  4HJ8 A;  3JAM c;  2ENB A;  1B8A A;  5EPJ A;  5IWA Q;  5HY6 A;  2ZJP A;  2V4D A;  1TS3 A;  1QNU A;  5ISR A;  4AYB E;  2AMC B;  1HUM A;  4DR3 Q;  1T5X D;  1IBL L;  4UP8 A;  3T56 B;  2VQE L;  2WII B;  1A8V A;  4LMQ D;  2YYZ A;  2F0V A;  2FFK B;  2RDG A;  1RL2 A;  1EOV A;  4WJW A;  2CFM A;  2TSS A;  3S14 B;  1NMF A;  3I56 A;  2QKI C;  1S3O A;  3H0G B;  1H9R A;  3AQQ A;  3NWT A;  1A3T A;  4HMI A;  4B9W A;  1J8I A;  2KOL A;  3E3X A;  4APV A;  4DR6 Q;  1DZ1 A;  1YNX A;  1LT3 D;  3NEM A;  2NVT H;  3DXJ C;  2RDF A;  1FJG Q;  4R4C A;  5GAG C;  3RUZ A;  4ZRZ A;  2ICI A;  3I91 A;  5IP9 H;  5IT9 c;  2R7Z H;  1PA6 A;  3PF4 A;  3PO3 H;  2A69 D;  1YNN D;  4AYB B;  1K73 C;  3KJO A;  2E74 C;  1JB3 A;  1PTO H;  1B1Z A;  1VQB A;  3QJY A;  4OXP A;  2AQ1 B;  2G9D A;  2B2V C;  5IYC G;  3QB3 A;  2E2H B;  1B3Q A;  1WCM G;  2F0J A;  3WOE A;  1EFW A;  1LTI D;  4N9P A;  1I50 B;  3M85 A;  1BBU A;  1STY A;  4JOI C;  4DUY L;  2NVQ H;  3FVQ A;  4OEM B;  1VQA A;  3WWV A;  5C0X I;  1TWF H;  3PCO B;  2XRQ D;  3DM3 A;  3F8T A;  2I5L X;  3STB C;  1XNR Q;  4MTN A;  5HGQ A;  1JCK B;  3LX0 A;  1OXU A;  2A6H C;  4R4Q A;  4F88 A;  1C8C A;  2BE5 C;  3FEW X;  1SN8 A;  2B63 H;  4JVZ A;  2AQ3 B;  3TEH B;  3S9W A;  2AKW B;  3T53 B;  4LF5 L;  4JI1 L;  2JXM B;  2UUB Q;  5JJL A;  1V1Q A;  3ND8 A;  5IWA L;  1JOR A;  2MJ8 A;  4OHJ A;  3HOU H;  1LLR D;  4C3I G;  4DR3 L;  4L63 B;  4RKB A;  5JJK A;  4K0K Q;  1SEB D;  4DR4 Q;  1C48 A;  5FLX c;  1L1O C;  4DV4 L;  1GO3 E;  2ZTD A;  2PZU A;  5GRO A;  4L5T A;  1DOM A;  3F1Z A;  3QWN A;  5EPK A;  1X9N A;  3CKI B;  2WAQ G;  4DU9 A;  2P5Z X;  1SNQ A;  4FXD A;  3L9A X;  3NTI A;  5CV9 A;  4DR6 L;  3A0J A;  4X3T A;  2PCF B;  2O4X A;  5DAU A;  4LWC A;  2NN6 I;  1RTN A;  4A93 B;  3RNU A;  4GOP A;  1FJG L;  3VYU A;  2Q8R E;  5CBE E;  4UY8 C;  4TKO B;  3VA5 A;  1JJ2 A;  1SYB A;  3A7L A;  4C3H G;  2JJQ A;  3T4A C;  4L5S A;  5C0X J;  1BNZ A;  4IO9 A;  1HZC A;  1TWC H;  2JQO A;  4PZ8 A;  4QIW E;  3PMF A;  4BBR H;  1R9T H;  1SNO A;  4NXN L;  1VQL A;  1U4R A;  1AE2 A;  3D4D A;  3K8A A;  4Y7N H;  2MGS A;  4ULL A;  3DLL A;  5E4X A;  1MBY A;  2CHB D;  1DYQ A;  4POF A;  1E0B A;  3MA2 B;  3EIV A;  1YHA A;  4HJ5 A;  3H6M A;  2A1A A;  4F7X A;  1Q1B A;  1EWH A;  4DXF A;  4QY7 A;  3E6Z X;  2YTY A;  2A8V A;  2F4V L;  1W3S A;  3S17 B;  1VDZ A;  2PQE A;  2RVL A;  2EY2 A;  2CQA A;  4P2C B;  1TWG B;  1N8R C;  5M5W B;  5C4X B;  1K83 B;  1DJR D;  1X3P A;  2KJX A;  2IX3 A;  4O0A A;  1S5C D;  1V1P A;  1YBY A;  1S5F D;  3S1R B;  2EYM A;  2VZA A;  4IPH A;  1QVG A;  5F2D A;  4QIW B;  5ELO A;  1VF7 A;  2Z4I A;  4BA2 I;  3A8J E;  2UUB L;  1NBW A;  4DPG A;  2D0P A;  3HOZ G;  1SLJ A;  3GTQ B;  5DNF A;  2QDL A;  4JI8 Q;  4XT3 B;  3S2D B;  5M5X B;  1RJT A;  3R8B A;  1I4R A;  1IKM A;  1WTQ A;  3PIO 3;  4CKE A;  4N8F A;  1PV4 A;  3ND9 A;  5BN3 A;  1WI5 A;  1N34 Q;  5FO7 B;  1NY4 A;  1YNJ D;  4DAP A;  4KD3 A;  1LTS D;  4RCO A;  1HNX Q;  2CH4 A;  1JWS D;  1PMR A;  1U9R A;  3BDC A;  4BXX G;  3RZD H;  4FYD A;  1KHI A;  2HQE A;  3BZD B;  5I9P A;  1HTL D;  3N6R A;  2M9V A;  4GNX C;  3GTK B;  1JT8 A;  2XGT A;  2QDB A;  3ICE A;  4LK1 C;  5G3L D;  1EEI D;  3HGB A;  3X3N A;  4XIG S;  3TZD A;  4MHE A;  3C2P A;  2Q8I B;  2PNR C;  1K9M C;  1YEZ A;  3J80 c;  1EQR A;  3W1G A;  5IOC A;  4C3J H;  2L5T A;  1G91 A;  1SR3 A;  2K03 A;  4DV3 Q;  1Q81 C;  3GV6 A;  3CAM A;  1SNC A;  4RGN A;  1V43 A;  1E2V A;  5FOB B;  5I6W A;  2NTT A;  5LMN L;  1Y1W B;  1UE1 A;  2JA9 A;  4BBS B;  1FD7 D;  1F2M A;  1A2U A;  1Q7Y C;  3VR2 A;  2E75 C;  2ZXR A;  4E6I A;  2DY7 A;  2FXQ A;  4C2M B;  2HD3 A;  2JYO A;  1WOC A;  2GVA A;  4QQB X;  3HOY G;  1YIT A;  2NBF A;  4GN4 B;  3QR8 A;  2EZV A;  4ZYS A;  1UWV A;  4O42 A;  1S5D D;  2AUJ D;  1A3U A;  1EY6 A;  2EOT A;  2OF1 A;  4HIM A;  4EQN A;  3WDN A;  1XNQ Q;  3CCU A;  1F9S A;  1U4L A;  1XMO Q;  2KCC A;  3X3M A;  2NVX B;  3GQB A;  3CRK C;  4B3R L;  3HKZ G;  5BN4 A;  3KLS A;  2UUC Q;  3QO2 A;  2QCP X;  5TSS A;  2F0P A;  2PPB C;  1HH2 P;  2CVR A;  3ERO A;  3KJP A;  1N34 L;  1G2T A;  3K0Y A;  2L55 A;  2VS1 A;  1FYC A;  1KL9 A;  4XT1 B;  3KBX A;  1STH A;  3P20 A;  4LUZ A;  2LS0 1;  1LM0 A;  1Y8O B;  1H9K A;  3PGZ A;  4I7A A;  3J80 i;  2B2U A;  5IYC H;  4BY7 H;  1E22 A;  1CFM A;  1XYI A;  1WCM H;  3KF8 A;  3ULP A;  3IL8 A;  4JC0 A;  4A3K G;  2F0O A;  1AN8 A;  2K1B A;  3A8K E;  3S1N H;  1B7Y B;  1U4P A;  5IIF A;  1FGB D;  2YU9 B;  2E2D C;  4LFB Q;  2VY3 A;  1IYJ B;  5M5Y H;  2QA4 A;  2A69 C;  3CC4 A;  1YNN C;  5IP9 G;  1AEX A;  2MHV A;  4DV3 L;  3NWS A;  3RD4 A;  4NXM Q;  1VQ5 A;  4L5Q A;  5C3E G;  2ZM6 Q;  4DV1 L;  1NJI C;  1SNP A;  4DV0 Q;  2B2W A;  4K5V A;  5E3F A;  2A6H D;  2B8G A;  2BE5 D;  1Z7T A;  1KTK A;  3E9I A;  3G4S A;  2EYO A;  4X64 Q;  1AZP A;  3AU7 A;  1PYB A;  3FDT A;  2I0Q A;  2VUM B;  2XRS D;  1B70 B;  2WB1 G;  2F0N A;  1YHB A;  1V8Q A;  3N52 A;  3VR5 A;  4DR5 L;  3BJU A;  4K5W A;  1EWC A;  1HPC A;  3S24 A;  1ZYR D;  2F4I A;  1J6Q A;  5IYB G;  2HQL A;  1PH3 A;  1UAP A;  3TS0 A;  1NSN S;  4AQY Q;  1XNQ L;  4YWK A;  1JJG A;  4EQP A;  2K32 A;  1VS0 A;  1D8L A;  3W3A A;  1XMO L;  4KKT A;  3A54 A;  5KRU A;  3V05 A;  4BA1 I;  1IBK Q;  5FO9 B;  1PH6 A;  4JV5 Q;  1P16 A;  1STA A;  1HR0 Q;  1B9N A;  3ULL A;  2Z6B A;  1PH2 A;  5T1G A;  5D3I B;  2UUC L;  4UP9 A;  4KV6 A;  1D1I A;  1QNK A;  3M7N A;  4K14 A;  4C3H H;  3F2B A;  2E5L Q;  2ASB A;  4J6H A;  5I6Y A;  2KBN A;  4QCL A;  2OWO A;  2EVB A;  1B2T A;  3HZX A;  3S2H H;  2SOB A;  3QOJ A;  4OEL B;  5C44 B;  4DV7 Q;  3CF5 A;  1DOK A;  4A4I A;  3LNN A;  4LF6 L;  3L3O C;  4WJ4 A;  2RA4 A;  1TVX A;  5JEA J;  3W1B A;  1DGS A;  2PZW A;  4YCV A;  5KIX A;  1D5Z C;  3OW7 A;  3VA7 A;  3GTQ H;  4JYA L;  4IZ8 A;  4DA2 A;  2Z6K A;  3TN2 A;  1O80 A;  1SSO A;  5LL6 S;  1VMP A;  2D62 A;  4NXM L;  3GTP B;  3OTO L;  4C56 C;  1LT4 D;  1LO5 D;  5FKA C;  4IFD H;  2K5W A;  2C5C A;  4CJ0 B;  4FO2 A;  2JA6 H;  1I6H B;  5M3M B;  5C5M A;  3D0F A;  4X64 L;  1QVC A;  2K6A A;  5CV8 A;  5IGG A;  1PZK D;  4LF9 Q;  3K80 C;  1EYG A;  1PTO F;  1EQT A;  1M90 C;  4DNI A;  1IHZ A;  1NR2 A;  1VQ4 A;  3K81 C;  3D6C A;  4H7B A;  2JEB I;  2JA5 B;  2PI2 A;  5C3X A;  5T1I A;  4DAV A;  1W6J A;  1PFB A;  3MTS A;  2NZO A;  2ES2 A;  1MHW C;  3CME A;  3MEH A;  1PRT F;  2VQE Q;  5L37 A;  4A3F G;  1Q12 A;  4A3C H;  2E8G A;  4IJH A;  2E2I B;  1IBK L;  1UEB A;  3T1Y Q;  3BDL A;  2PO4 A;  3WOF A;  4PNY A;  1VQ7 A;  3S16 H;  2EIF A;  1JC7 A;  5GAE C;  1VQM A;  1Y14 B;  3PO2 B;  3Q22 A;  2F0K A;  3PUV A;  3FKI G;  1KDB A;  4NPS A;  1N32 L;  4IQZ A;  3TSS A;  4JPB W;  4DXG A;  1YNJ C;  3I70 A;  4YHH Q;  1YI2 A;  3HRZ C;  3GV3 A;  1JOK A;  2Z4H A;  3ITP A;  3BS1 A;  2IX0 A;  2NVY B;  1X3Q A;  4GLV B;  2EDG A;  2G5D A;  1T9H A;  1ESF A;  2X6G A;  1GM5 A;  4DN4 M;  1SYE A;  3Q23 A;  4B3M L;  1BVS A;  1QOH A;  3O13 A;  3KF8 B;  4XQQ A;  4AIM A;  4XTC S;  3A5U A;  5JVG 3;  4JI0 L;  3DEP A;  3GTG B;  3ERQ A;  4HIK A;  4CHT B;  1K8G A;  5LL6 X;  3HOY H;  1EY5 A;  2FHT A;  1O7I A;  4A3E B;  4DUY Q;  5CV4 A;  3URY A;  1A63 A;  4RMF A;  1D5M C;  1VCI A;  3K57 A;  4Y52 H;  3FRP B;  1BUV T;  3BVM A;  3KDF A;  3NBH A;  1ASY A;  4PMW A;  1RTO A;  2LXK A;  1K8O A;  5CC4 A;  1WJJ A;  3I2Z A;  3CQZ B;  1Q8K A;  3PV0 A;  1E2W A;  1HQM C;  3H0G G;  3M4P A;  2JSO A;  3VR4 A;  5FO8 B;  3CCL A;  2L0C A;  4X62 Q;  4PZ6 A;  1Q46 A;  1GVP A;  2DGY A;  4FDB A;  3RMH A;  4U68 A;  3Q8D A;  4QUF A;  4V0B A;  1VQK A;  1VQ6 A;  4YCU A;  2EJG C;  4LF5 Q;  2VW9 A;  2IJ0 A;  4JI1 Q;  1ILQ A;  3I4N B;  1Z9F A;  4A3M B;  2ZTC A;  1CQV A;  1D1K A;  3BYT B;  1YVC A;  1C0A A;  4DK1 A;  4GN5 A;  3M3Y H;  3J7A 5;  3LWE A;  2Y0S E;  4DR2 L;  5E1F A;  3HOX B;  1Y1V B;  4DV4 Q;  3H3V H;  4C1N I;  1X65 A;  4GLX A;  1N9W A;  5EKI A;  3T1Y L;  3AB9 A;  4H0L C;  4AYB G;  4JI5 Q;  4WRD A;  1HHV A;  5C4H A;  3GD7 A;  2KHJ A;  3NEN A;  5FJ8 G;  4FXG C;  1D5X C;  4JK1 C;  4RHR A;  4A76 A;  1BQQ T;  4A3K H;  1NTG A;  3NQI A;  3W2D A;  4UAI A;  5M9O A;  3NSW A;  4KHV A;  1VQO A;  4YHH L;  2E76 C;  1SNM A;  3RLF A;  1MJC A;  2O2L D;  3KF6 B;  5D65 A;  5COY A;  1KLU D;  1WFQ A;  4DAY A;  3DWQ A;  1KIX A;  5I2X A;  2XWJ B;  2A74 C;  4HJ9 A;  1XXG A;  2AWO A;  2KHS A;  1PYS B;  4CBV A;  1SRO A;  5C3E H;  4QUC A;  1I6V C;  4Q5V A;  2Z9H A;  2SNS A;  3GTM B;  2QGQ A;  2Y0S B;  4NXN Q;  3UDF A;  4BY7 G;  1JE5 A;  4JBK A;  2PI2 E;  4FF3 A;  3ONA B;  1TS2 A;  2L1B A;  5M3F B;  2VB2 X;  1WTH A;  2JEA I;  3JAM L;  1LT5 D;  4K8I A;  1SAP A;  2E2J B;  5C4J B;  2F0F A;  1T5E A;  2F4V Q;  5IYB H;  1TR5 A;  4M1U B;  3JAM i;  2HDM A;  4ZK9 B;  1QJO A;  1KC8 C;  4LFC Q;  1I3Q H;  1SND A;  5FK9 C;  3S15 B;  4XDX A;  4A3I B;  1X32 A;  4X62 L;  4DUZ L;  4HTH A;  3IKJ A;  5A35 A;  2CQO A;  3C1E A;  1VF5 C;  1XTC D;  4OIJ A;  1U0L A;  2ID0 A;  1OXX K;  1MD2 D;  4KLK A;  1EY8 A;  4KMU C;  5IYD G;  4JI6 L;  3C46 A;  1VQD A;  1K3B C;  1OO9 B;  3V96 A;  2OTL A;  1ZYR C;  2XN9 C;  3CXC A;  4NP5 A;  1K0R A;  5IE8 A;  2K5N A;  2Z1C A;  3P75 A;  1PH4 A;  1HZA A;  2RSO A;  3NTH A;  3RZO H;  5BR8 L;  4PG3 A;  1HRJ A;  2YV5 A;  3I4M B;  1DOL A;  2KED A;  4KY6 A;  3J81 c;  4JI5 L;  5IT9 L;  1GUW A;  1RHP A;  4ZQ3 A;  3GTO B;  1SFO H;  3FMC A;  3S1M B;  3D4R A;  1AZQ A;  2XWB B;  3G6J B;  2B2U C;  1TWH B;  2EYF A;  1LTB D;  3DUZ A;  1LTR D;  1S72 A;  2R93 B;  1UE6 A;  1VQH A;  5J22 A;  4J8Q A;  1N33 Q;  5JJZ A;  3HOW H;  1SMX A;  1ENC A;  1XPO A;  4HN7 A;  3GO5 A;  4A3J B;  2OQ0 A;  5C4X G;  1STN A;  3HP3 A;  1W6K A;  2EXD A;  5ELD A;  2BOS A;  1OXV A;  3SR1 A;  2EE1 A;  1QUQ A;  2RCF A;  3QG1 A;  2JA8 B;  2B2W C;  4C3I B;  1H9S B;  4K6D A;  2ATW A;  1AP0 A;  4LAA A;  4PQX A;  1YJW A;  2F1M A;  1A6X A;  1PH9 A;  5LMN Q;  4HR7 B;  1TT2 A;  2R92 B;  1TWA H;  1QCB D;  5FLM G;  2BDO A;  5ELB A;  4BY1 B;  4B9X A;  3SHL A;  2NTS A;  2NZ1 D;  3UI2 A;  4LFC L;  4WJ3 M;  3NBH B;  3KDF B;  4IUT A;  4IFD G;  4A3F H;  3HOV B;  4DR1 L;  2DUD A;  2PW5 A;  4N9T A;  1S40 A;  3TME A;  5JJI A;  2F0G A;  2OQK A;  4G7O C;  2JA6 G;  2FMM A;  3M4O B;  3T1H L;  1TU2 B;  2KEN A;  3J81 i;  2B3G A;  3LWU A;  5IGC A;  3SK6 A;  3MAQ A;  1EY0 A;  2GA4 B;  3TZU A;  2F03 A;  4B3R Q;  3FKI H;  1OXS C;  1VQP A;  1C4Q A;  3OWF A;  2BDN A;  3NBI A;  3I3C A;  1L0X B;  2RDH A;  1GUO A;  3K5L A;  5CGK A;  3EBE A;  4A3C G;  3NP8 A;  2F3V A;  1CZG A;  1SDF A;  5CR3 A;  3JAM E;  1Z47 A;  1IZ6 A;  3GTL B;  1ZEQ X;  3LGJ A;  2QF7 A;  5BN5 A;  2K14 A;  1B9M A;  2O5I C;  3G48 A;  1Y1W G;  1N33 L;  2IWH A;  3UDI A;  4BBS G;  4O1N A;  1JOO A;  2N8N A;  5C6A A;  2IW3 A;  4WOR A;  4Z9C B;  2Z6K C;  3NHH A;  4MN3 A;  4EGV A;  4DAY B;  3K59 A;  1EQQ A;  4L8J A;  2F0E A;  5K5P A;  5JAV A;  2SEB D;  3HOZ B;  3GTJ B;  1KDC A;  1VQG A;  1JIC A;  1LTA D;  4MIU A;  4DV1 Q;  3S14 H;  1ICF B;  4R4O A;  3H0G H;  1S5B D;  4DGZ A;  1EY9 A;  3AYH B;  1J9O A;  4ID6 A;  3CHB D;  1FGU A;  4LJZ C;  3P1H A;  2DNE A;  5IT9 E;  2ALY B;  4A3D B;  4GZY C;  1AH9 A;  2RSN A;  2HUG A;  4A3G B;  2IL8 A;  4A3L G;  4TRD A;  1SMY D;  4DR5 Q;  1O7Z A;  4OON A;  1EIH A;  3G7L A;  4X65 L;  1EZ8 A;  4BWG B;  5KYI A;  3PSI A;  2F3W A;  3PQI A;  2A6E D;  3SXH A;  2OEO A;  4JI2 L;  5FJ8 H;  2B39 A;  4LUO A;  2B2T A;  3GP7 A;  2KHI A;  3K0X A; 
#chains in the Genus database with same CATH homology
 2HHH L;  5JEA J;  1B8A A;  1SRU A;  3W1B A;  2E2H H;  1DGS A;  5IWA Q;  4YCV A;  5HY6 A;  4LF8 L;  2ZJP A;  2GN5 A;  3GTQ H;  1I50 H;  4JYA L;  2Z6K A;  2AMC B;  4AYB E;  4DR3 Q;  3PO2 H;  3UDX A;  1YJN A;  1IBL L;  4UP8 A;  3RLO A;  2VQE L;  1A8V A;  4DR4 L;  2YYZ A;  4LF7 L;  3UE0 A;  2D62 A;  4NXM L;  3OTO L;  3H3V I;  2HIV A;  1RL2 A;  1EOV A;  1YIJ A;  4DK3 C;  2NZH A;  2CFM A;  1N36 Q;  1JB7 A;  1NMF A;  3I56 A;  1KXL A;  4IFD I;  2N3S A;  1S3O A;  2IY5 B;  3AQQ A;  2QEX A;  3JC6 6;  4X65 Q;  2JA6 H;  4APV A;  4UP7 A;  4DR6 Q;  3D0F A;  4X64 L;  1QVC A;  4LF9 Q;  1C9O A;  3K80 C;  1EYG A;  2NVY H;  1OXT A;  1M90 C;  2R7D A;  4IPC A;  4DNI A;  4WJ4 A;  1YNX A;  4ALP A;  3NEM A;  3K81 C;  2PQA B;  1VQ4 A;  2NVT H;  1K3R A;  5IY0 A;  4LF6 Q;  1FJG Q;  2UXD Q;  4R4C A;  4JI2 Q;  3CCR A;  3CCS A;  4R4I A;  2JEB I;  3F2C A;  2HT1 A;  3ULJ A;  2PI2 A;  4R1J A;  5GAG C;  2HHH Q;  1XNR L;  2Z0S A;  4DV2 Q;  5IP9 H;  4J15 A;  2NZO A;  2PNH A;  5IT9 c;  2ES2 A;  2R7Z H;  4JYA Q;  3RR5 A;  1HNW L;  3CME A;  1PA6 A;  2MO0 A;  3GTG H;  4IOA A;  3PF4 A;  3PO3 H;  5GAH C;  3U4Z A;  3W5O A;  2VQE Q;  1K73 C;  4A3F G;  3EN2 A;  3KJO A;  4A3E H;  4LF7 Q;  1Q12 A;  1D7Q A;  4A3C H;  1L2F A;  2E8G A;  4LW1 A;  3OTO Q;  1VQB A;  4IJH A;  4RG1 A;  4A75 A;  1IBK L;  4OXP A;  3CCQ A;  3G6E A;  1PHJ A;  5IYC G;  1UEB A;  1QUQ B;  2RHQ B;  3T1Y Q;  2A19 A;  1WCM G;  1P8L A;  1EFW A;  1VQ7 A;  3HFZ B;  3S16 H;  4K0K L;  3L2P A;  2EIF A;  1BBU A;  2Q2I A;  3M85 A;  4OWW B;  3CQZ H;  4JOI C;  5GAE C;  1VQM A;  1Y14 B;  3S1M H;  1E24 A;  3S14 H;  5IYD H;  3PUV A;  4JBJ A;  4GKJ L;  4A93 H;  3FKI G;  4NPS A;  4DUY L;  1MKH A;  2NVQ H;  1N32 L;  4LF4 L;  3WWV A;  2R6G A;  1VQA A;  5C0X I;  1OTC A;  1TWF H;  3PCO B;  1JMC A;  3DM3 A;  4YHH Q;  4A3D G;  1YI2 A;  3F8T A;  2I5L X;  3STB C;  3I4N H;  4A3M H;  4A3G G;  1XPR A;  2YTX A;  2OCE A;  2YTV A;  1XNR Q;  4MTN A;  5HGQ A;  1XMQ Q;  1IBM Q;  2N49 A;  4TVA B;  1OXU A;  3K7U C;  4R4Q A;  3S1Q H;  3CPF A;  2V1C C;  2IX0 A;  3NEL A;  1J5E Q;  1Q82 C;  1SN8 A;  3G71 A;  4R4T A;  1HNW Q;  2B63 H;  4IFD J;  2L15 A;  2UXC Q;  4GLV B;  3HOX H;  1Y1V H;  3TEH B;  1T9H A;  1GM5 A;  4GN3 B;  4UPA A;  1VQ8 A;  1RIP A;  2AKW B;  4B3M L;  1KAW A;  1BVS A;  2LSS A;  5JEA G;  1CSP A;  5C44 G;  4LF5 L;  4JI1 L;  3KF8 B;  2UUB Q;  5JJL A;  1V1Q A;  4YCW A;  5IWA L;  3PUW A;  4AIM A;  1VQF A;  3HOU H;  1LTL A;  1X6O A;  1I5F A;  4XTC S;  3A5U A;  4DR3 L;  1M1K C;  4JI0 L;  5JJK A;  4K0K Q;  4P72 A;  1V9P A;  4DR4 Q;  5FLX c;  3M9B A;  3GDE A;  1L1O C;  4QGU A;  4HIK A;  1KD1 C;  3UDG A;  1K8G A;  2PMZ E;  1UE5 A;  1Q1E A;  1GO3 E;  2ZTD A;  4DV4 L;  5GRO A;  3HOY H;  4A3B G;  4GKJ Q;  1O7I A;  3A74 A;  4L5T A;  4DUY Q;  3KF6 A;  1N32 Q;  1A63 A;  4RMF A;  1N36 L;  2N78 A;  3S17 H;  1VCI A;  1A62 A;  3F1Z A;  4Y52 H;  1X9N A;  1LUZ A;  3KDF A;  1TWG H;  2WAQ G;  1ASY A;  2JA7 G;  5M5W H;  4PMW A;  5C4X H;  1K83 H;  3E0E A;  5GQO A;  4YY3 L;  2LXK A;  2AHO B;  4DR6 L;  3A0J A;  3D31 A;  1WJJ A;  3I2Z A;  2Q2T A;  1Q8K A;  4OO1 G;  2RHS B;  3PV0 A;  3CC7 A;  3S1R H;  3M4P A;  2NN6 I;  3H0G G;  4JOI A;  4LWC A;  3CCL A;  2KCT A;  4X62 Q;  3RNU A;  4PZ6 A;  1Q46 A;  1GVP A;  2DGY A;  4FDB A;  4GOP A;  1FJG L;  3GTM H;  2UXD L;  3Q8D A;  1VQK A;  3JAM c;  4UY8 C;  1VQ6 A;  1G6P A;  4YCU A;  4B3M Q;  1JJ2 A;  2VW9 A;  4LF5 Q;  1EIY B;  4JI1 Q;  3PIP A;  1W2B A;  1Z9F A;  3BU2 A;  2ZTC A;  4DV2 L;  1X54 A;  1K8A C;  3HOW G;  2JJQ A;  4L5S A;  2UXB L;  1YVC A;  5C0X J;  5FLM H;  4IO9 A;  1C0A A;  1HZC A;  1TWC H;  4EQ5 A;  2JQO A;  4PZ8 A;  4GN5 A;  4QIW E;  2JA5 G;  4JI0 Q;  3J7A 5;  5M3F H;  3M3Y H;  2Y0S E;  4JG2 A;  1CUK A;  3S2D H;  1LYL A;  3HKZ E;  4DR2 L;  4BBR H;  5M5X H;  4DV4 Q;  1R9T H;  3H3V H;  3U4V A;  1X65 A;  4DKA C;  1X3F A;  2E2J H;  4NXN L;  5C4J H;  4GLX A;  1N9W A;  1VQL A;  1AE2 A;  1XJV A;  3K8A A;  3T1Y L;  4Y7N H;  4AYB G;  4JI5 Q;  3DLL A;  1MIU A;  3GD7 A;  2KHJ A;  3NEN A;  5FJ8 G;  4JI8 L;  4YY3 Q;  4H02 A;  4PZ7 A;  3S15 H;  4A3I H;  2CCZ A;  2F3I A;  2K5H A;  3UE1 A;  4POF A;  2MNA A;  3F2D A;  3KYH C;  4A76 A;  1VQ9 A;  3EIV A;  1YHA A;  4A3K H;  1NTG A;  4HJ5 A;  1L1O A;  2A1A A;  1Q1B A;  4QY7 A;  4JI3 Q;  1E1T A;  2YTY A;  2A8V A;  3MXN B;  1VQO A;  2K75 A;  4YHH L;  1VQN A;  2F4V L;  1W3S A;  3GTK H;  1PVO A;  2IHE A;  3RLF A;  1MJC A;  5LMU Q;  3RN5 A;  2Q2H A;  3PUX A;  3KF6 B;  2K52 A;  1N8R C;  3AEV A;  2VUM G;  1WFQ A;  3BZC A;  5AJ3 L;  1XMQ L;  1HNX L;  1KIX A;  1IBM L;  1PH5 A;  5IP7 H;  3FP9 A;  4O0A A;  3TRE A;  3OYY A;  1J5E L;  1YBY A;  4HJ9 A;  2AWO A;  3ERS X;  2UXC L;  1PYS B;  2VZA A;  4IPH A;  1QVG A;  1SRO A;  5C3E H;  4P75 A;  1YHQ A;  4DR2 Q;  4GKK Q;  5ELO A;  4P74 A;  2QGQ A;  3I4M H;  2WP8 J;  4KI0 A;  4BA2 I;  1FVI A;  4NXN Q;  1L0W A;  3UDF A;  1CKN A;  2UUB L;  4GOP B;  2RCN A;  1NBW A;  1JE5 A;  4BY7 G;  4IPD A;  4JBK A;  4DPG A;  4DAM A;  2PI2 E;  2D0P A;  2CWP A;  5E7N A;  2Q2U A;  3HOZ G;  1SLJ A;  1TXY A;  3AFP A;  1YZ6 A;  3GTO H;  4DV6 Q;  1Y1W H;  3TRZ A;  4JI8 Q;  1HJP A;  4LUV A;  4BBS H;  1TWH H;  2JEA I;  2LXJ A;  2BH8 A;  3ZJY C;  2R93 H;  4C2M H;  1YJ9 A;  2R7Z G;  1PV4 A;  1IXR A;  3PO3 G;  1WI5 A;  1N34 Q;  3BZK A;  2F4V Q;  1NY4 A;  5IYB H;  1NE3 A;  1AE3 A;  3JAM i;  1XTD A;  1PFS A;  4OWT B;  4QJF A;  2RF4 A;  3HKS A;  3STB D;  1KC8 C;  4LFC Q;  1I3Q H;  1HNX Q;  5AJ3 Q;  1MJE A;  1EUJ A;  2K5V A;  2WB1 E;  4NB3 A;  4A3J H;  4BXX G;  3RZD H;  1CSQ A;  5GAD C;  4X62 L;  1KHI A;  4DUZ L;  4X66 L;  3VDY A;  1PH8 A;  2CQO A;  1U0L A;  2ID0 A;  4GNX C;  1OXX K;  4KLK A;  5IYD G;  1L1O B;  2IX1 A;  2XGT A;  1JT8 A;  3U50 C;  1IL2 A;  2JA8 H;  3ICE A;  3E9H A;  4C3I H;  4JI6 L;  3CD6 A;  1VQD A;  4OX9 Q;  1X56 A;  3PUZ A;  2NVX H;  2OTL A;  1ASZ A;  1HZB A;  3CXC A;  4OWX B;  4IOC A;  4JBM A;  1K0R A;  5IE8 A;  4XIG S;  2K5N A;  1HNZ Q;  3B6Y A;  1K9M C;  3CCM A;  4A3M G;  4IJL A;  3I4N G;  4A3L H;  1YEZ A;  3CCV A;  1PH4 A;  1XPU A;  2R92 H;  3J80 c;  1EQR A;  3W1G A;  1HZA A;  4C3J H;  3RZO H;  1SE8 A;  1GD7 A;  5BR8 L;  4PG3 A;  2YV5 A;  1SR3 A;  5H1S E;  4BY1 H;  4DV3 Q;  1E3P A;  3J81 c;  3H15 A;  4YWM A;  4JI5 L;  4EX5 A;  1Q81 C;  2B63 G;  2D0O A;  3CAM A;  1Y1V G;  3HOX G;  1PH1 A;  1X3G A;  4OO1 I;  1E7Z A;  1V43 A;  2BA1 A;  1HZ9 A;  4JI7 Q;  1SFO H;  1QZG A;  5LMN L;  1UE1 A;  2JA9 A;  3CCE A;  3HOV H;  1Q7Y C;  4DUZ Q;  4X66 Q;  3HOU G;  2PQA A;  4JI3 L;  2K50 A;  1S72 A;  5M3M G;  2FXQ A;  1UE6 A;  2B29 A;  2ZTE A;  1VQH A;  2KCM A;  1JJC B;  5LMU L;  1N33 Q;  3M4O H;  3ER0 A;  1WOC A;  3HOW H;  2GVA A;  1SMX A;  4QQB X;  3HOY G;  3CPW A;  1YIT A;  1XPO A;  4JI6 Q;  4JCV E;  4MZ9 A;  4GN4 B;  4B3T Q;  2YU9 H;  4DV5 Q;  1UWV A;  3GO5 A;  2UUA Q;  2OQ0 A;  4AH6 A;  1QZH A;  5C4X G;  1CKO A;  4KHZ A;  4GKK L;  4HIM A;  4HJ7 A;  2EXD A;  1OXV A;  1KRT A;  1XNQ Q;  1Q86 C;  4GNX A;  1QUQ A;  2I5M X;  5BR8 Q;  3CCU A;  2F52 A;  2ATW A;  1XMO Q;  2UU9 L;  5J3B A;  4YWL A;  1G29 1;  2Y0S G;  4ME3 A;  4DV6 L;  2K4K A;  1YJW A;  4B3R L;  3HKZ G;  3CP0 A;  4LFB L;  3I55 A;  3RN2 A;  1PH9 A;  5ELN A;  1VQJ A;  5LMN Q;  3KLW A;  2UUC Q;  3GTL H;  4B3S L;  1TWA H;  4O2D A;  5FLM G;  5K36 G;  1HH2 P;  4JBW A;  2OTJ A;  5EAY A;  3PO2 G;  3KJP A;  3FHW A;  3PIO A;  1N34 L;  2VUM H;  5M3F G;  2ZM6 L;  2VS1 A;  4DV0 L;  4BBR G;  1KL9 A;  4HID A;  4LFC L;  3CC2 A;  2IT1 A;  4WJ3 M;  2WFW A;  3NBH B;  3KDF B;  4JI4 Q;  4LUZ A;  4IFD G;  1EIF A;  2VQF L;  1LM0 A;  4A3F H;  4DR1 L;  2XTI A;  4QL5 A;  1PH7 A;  2DUD A;  1S40 A;  3PGZ A;  1QVF A;  5JJI A;  2OQK A;  3J80 i;  5IYC H;  2JA6 G;  1E22 A;  4BY7 H;  2BA0 A;  4A3I G;  5LMN W;  3AFQ A;  4P73 A;  3HOZ H;  2IHF A;  1WCM H;  3GTJ H;  3T1H L;  3ULP A;  2ZJQ A;  4GS3 A;  2KEN A;  4DR7 Q;  4A3K G;  4JC0 A;  3J81 i;  4OX9 L;  4KHP Q;  2B3G A;  2UU9 Q;  1B7Y B;  3S1N H;  4POG A;  4B3R Q;  3FKI H;  1OXS C;  2CKZ B;  1HNZ L;  4LFB Q;  1VQP A;  2VY3 A;  4LF8 Q;  1IYJ B;  5M5Y H;  2JE6 I;  2QA4 A;  4AQY L;  5IP7 G;  3CC4 A;  3L7Z C;  1IBL Q;  1H95 A;  4B3S Q;  5IP9 G;  4A3D H;  1VQC A;  1BBW A;  4DV3 L;  4A3G H;  4NXM Q;  2MQH A;  3KOJ A;  1VQ5 A;  4L5Q A;  5C3E G;  2ZM6 Q;  4DV1 L;  1NJI C;  4JV5 L;  3EBE A;  1VQI A;  4GNX B;  4DV0 Q;  4A3E G;  1HR0 L;  4JI7 L;  4LNQ A;  4BXX H;  4A3C G;  1CKM A;  2EQS A;  4GLA C;  2ZJR A;  3I4M G;  3RLN A;  1Z47 A;  3U58 A;  1IZ6 A;  4TQU S;  2MFI A;  2VQF Q;  4LFA L;  1FL0 A;  4DR1 Q;  3E9I A;  3M4Q A;  3G4S A;  3LGJ A;  4X64 Q;  5C44 H;  2K14 A;  4GOP C;  1G51 A;  2E5L L;  2GVB A;  3G48 A;  1Y1W G;  1PYB A;  3CMA A;  2I0Q A;  1N33 L;  3UDI A;  4BBS G;  3J81 j;  3T1H Q;  1B70 B;  4A93 G;  2WB1 G;  1X3E A;  1WYD A;  1YHB A;  1UE7 A;  4DR5 L;  2N8N A;  5C0X G;  3BJU A;  4B3T L;  2R93 G;  1E1O A;  4DV5 L;  3PF5 A;  2VNU D;  3S24 A;  2UUA L;  4A3B H;  2Z6K C;  2I5H A;  1J6Q A;  4DAY B;  5IYB G;  1EQQ A;  1I94 L;  1EWI A;  2HQL A;  4DV7 L;  1PH3 A;  3TS0 A;  1BKB A;  4AQY Q;  1XNQ L;  1NMG A;  5DLQ E;  4YWK A;  3J7Z C;  4A3J G;  1JJG A;  2JA7 H;  3GTP H;  1U5K A;  2H5X A;  1VS0 A;  3A5Z B;  1D8L A;  2UXB Q;  1VQG A;  2HIX A;  3IRB A;  4MNO A;  1XMO L;  3SGI A;  1KRS A;  2R7F A;  4HIO A;  4BA1 I;  1X55 A;  4DV1 Q;  1IBK Q;  1PH6 A;  2VL6 A;  1P16 A;  4IPG A;  1CKN B;  1HR0 Q;  4JV5 Q;  4R4O A;  3H0G H;  3K7A H;  3CW2 C;  3AYH B;  2JA8 G;  3I4O A;  3ULL A;  1PH2 A;  4DK6 C;  1VQE A;  2UUC L;  1GKH A;  2C35 B;  5M3M H;  1I6H H;  4UP9 A;  2WAQ E;  1C7Y A;  1FGU A;  4X6A H;  4LFA Q;  2ALY B;  2BH2 A;  1AH9 A;  3M7N A;  1KQS A;  4C3H H;  3F2B A;  2E5L Q;  2ASB A;  2MO1 A;  3KFU A;  4A3L G;  4LF4 Q;  3L0O A;  2R92 G;  3TQY A;  2KBN A;  3TS2 A;  2JA5 H;  4DR5 Q;  4JI4 L;  2CWA A;  4OON A;  2OWO A;  4BY1 G;  4X65 L;  3S2H H;  3CCJ A;  2JK8 A;  2AWN A;  1HR0 W;  1I94 Q;  4LF9 L;  4DV7 Q;  4L5R C;  4P71 A;  3CF5 A;  3I7F A;  3MEF A;  4A4I A;  3PSI A;  4HJA A;  3OW2 A;  3HOV G;  2NN6 G;  4DR7 L;  4LF6 L;  4KHP L;  2E2I H;  1A0I A;  4JI2 L;  5FJ8 H;  3PUY A;  4LUO A;  4HJ8 A;  2KHI A;  3K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...