5I6WA

Crystal structure of staphylococcal nuclease variant delta+phs a58d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEDSAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A58D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6wA00
3OMGA 1EZ8A 4G57A 5E3FA 1U9RA 1TT2A 2F0VA 5HGTA 3NP8A 2EYFA 3MEHA 4HMIA 4KJOA 4RKLA 5K5PA 1JOOA 2F3VA 3SHLA 5DAUA 3T16A 4HTHA 4S3SA 5IOCA 2F0DA 1NSNS 3P75A 5KRUA 3EJIA 1STNA 4KD4A 4LAAA 3SR1A 5CC4A 1EYAA 2F0UA 2PZTA 4E6IA 2F3WA 3TP8A 2EXZA 2EY6A 5EKLA 2OXPA 4QF4A 3NHHA 2EYJA 1RKNA 3TP5A 4QMGA 1SNDA 1JOKA 4B9WA 3ITPA 4DF7A 1SYGA 1EYDA 5I9PA 2QDBA 1NUCA 4J1MA 2EYHA 2EY2A 2F0NA 4J6HA 2EY1A 1F2ZA 5HURA 1A3UA 5I6YA 1SNPA 5DEHA 2RKSA 1A2TA 3MVVA 5C3XA 2F0QA 5E1FA 3SK5A 4F7XA 3DHQA 2SNMA 3PMFA 4K6DA 1KABA 2F0EA 4NMZA 5JOBA 3OWFA 3NK9A 1SYFA 2M00A 1SNMA 5IGCA 5CV5A 3P1HA 4KTAA 2HQEA 2F0OA 4DGZA 2KQ3A 1SNQA 3MXPA 4R8NA 1STAA 5C4ZA 1EQVA 5CV8A 2F0FA 5CV9A 4PMBA 3R3OA 1EY6A 5I6WA 3QOJA 4NKLA 2SOBA 3H6MA 5IGBA 4ME5A 1II3A 5JAVA 4B9XA 5KYIA 5J22A 4DFAA 4ZQ3A 1SNCA 5CV4A 1JORA 3SK4A 3LX0A 4K14A 2F0TA 3QB3A 2F0LA 3ERQA 3OSOA 3T13A 1STHA 4N9TA 3TMEA 1AEXA 2F0KA 3DMUA 4K8JA 4KJNA 5C5MA 1EY7A 5EKKA 1A3TA 3HEJA 4EQOA 5I9OA 1ENAA 2ENBA 2F0JA 1F2YA 3QOLA 2F0WA 4H7BA 4HMJA 3EROA 2OF1A 4K8IA 4MIUA 2PZUA 5CR3A 3NUCA 4DU9A 2RBMA 4EQNA 5IODA 5KYLA 1SYEA 5C5LA 2OEOA 5CV6A 1KDAA 4EQPA 2NUCA 1EY5A 1SYDA 2SNSA 5KEEA 2KHSA 4N9PA 3C1FA 5IGFA 1STYA 4TRDA 1A3VA 4K5VA 1TR5A 3TP6A 3D6CA 3MZ5A 3OMCA 2PQEA 3NQTA 4IUNA 4KY6A 2F0IA 2EY5A 4QB4A 5EGTA 3TP7A 2EYMA 1KDCA 5KIXA 1EYCA 2F0MA 4ID6A 5IGEA 1A2UA 2F0PA 1SYCA 4IALA 3SK6A 4KD3A 3S9WA 3NXWA 3D4DA 2RDFA 5C6AA 5IGGA 4IZ8A 3SK8A 4PMCA 4WORA 4KY7A 3RUZA 1F2MA 1IHZA 2PZWA 4KY5A 5F2DA 1ENCA 3VA5A 4ODGA 2LKVA 4YIJA 4PNYA 4K5WA 2EYOA 4OL7A 2F0SA 2PYKA 3C1EA 1SNOA 3MHBA 4K5XA 5J1ZA 5CGKA 4RKBA 5ISRA 4ZUJA 4K2LA 5CV7A 2PW7A 2EYLA 5C4HA 5C3WA 3BDLA 4KV6A 3U9OA 3HZXA 4F8MA 5IGDA 4NDXA 2EYPA 3EVQA 4KHVA 5IIFA 4EVOA 3D8GA 3BDCA 1SYBA 2O4XA 5M9OA 1JOQA 1KDBA 4K2KA 2PW5A 4ZUIA 1EY0A 2F0HA 3SXHA 1EZ6A 4I65A 1STBA 1EY4A 3D4WA 4NP5A 1TQOA 3E5SA 5KGUA 5NUCA 5J39A 1KAAA 2F0GA 4WRDA 1STGA 1EY9A 3V2TA 2WACA 1EY8A
chains in the Genus database with same CATH superfamily
1EEID 4A3EB 3R93A 2A6ED 4DV2L 1OXXK 4C2MB 2XN9C 1TWHH 5IOCA 5M5WB 1EYAA 3I4MG 5DLQE 4JV5Q 1NNXA 2F52A 3HOVG 4DR3Q 1MJEA 1KHIA 2RHSB 2A1AA 4MTNA 4X64Q 1X32A 4GLAC 4Q0FA 1VDZA 2UXBL 4P2CB 4IFDJ 4WJ3M 2NYZD 3NK9A 4B3RL 3OTOL 1B8AA 1X3GA 2K50A 3ZJYC 4Y7NB 2L9HA 4DGZA 4JI0L 1XTCD 3GTJB 5D65A 1I5FA 1PFNA 5JPMC 3F8TA 3PIO3 4JI4Q 3DWQA 3H6MA 2AQ2B 4ME5A 3BVGA 4KHPQ 2PO4A 5GAGC 3LGJA 4WJ4A 5J3BA 5C3EH 3S1RB 4X66Q 3M4QA 5JJZA 1PTOD 4BY7B 4EQOA 5I9OA 4TRDA 5FJ8H 2R3ZA 1ZKOA 1YEZA 3NUCA 1VQCA 5M5XH 4DUZQ 1TY0A 5KNCA 2IT1A 2PMZB 4IUPA 2M9VA 1SYDA 1HR0L 1QNKA 3MWYW 4M1UB 4EX5A 1O80A 2CQAA 1TR5A 1BQQT 5JJLA 5EGTA 1BR9A 3T1YQ 1XMOL 3RN2A 4LF8L 1X3FA 4RAUC 2KEEA 1PTOF 1L1OA 2CWAA 2NVXH 3OIPA 1XWEA 4A3JG 4FXKC 3D0FA 3GTLB 1GD7A 2PZWA 2ZTDA 1IBMQ 3VR6A 4J8QA 1K28A 3KJPA 1KAWA 1PH8A 4V190 2Q2IA 3C1EA 5BN3A 4LF7Q 4UP8A 1S5ED 1WJJA 2CW0C 2EIFA 3FEWX 1XNQL 4M8AA 1CKNA 1J5EL 4DK1A 2Q2UA 1DOLA 3I56A 2JP1A 1VQAA 3T56B 4MZ9A 3MTSA 4DR4Q 1PDQA 5CYUA 1MKHA 4DV4L 1EL0A 1BCPC 3E5SA 4KLKA 3M85A 4KN4C 1JB7A 4X6AH 1I50B 1F9PA 2A19A 3I4OA 4K8IA 1PFMA 3VYTA 2ES2A 1LYLA 4S3SA 4DV1Q 4GKKQ 4A3FB 2E8GA 4A3BB 4JI5L 1IYUA 1O7LA 1YNJD 1AN8A 4X3TA 4DK0A 3CP0A 4JBJA 2EYJA 4PZ6A 1C8CA 2K75A 3A8JE 2D0PA 1NUCA 5ELCA 1TS2A 1F2ZA 1LACA 2DNEA 4HAEA 3PO2H 1EIYB 2E74C 3SE0A 3P1HA 2IX3A 4GS3A 1HNWQ 1LABA 1SNQA 4PMWA 1QVFA 2HIXA 2DUDA 3GTQB 1SLJA 4OWTB 2ZM6L 4IQZA 3KLWA 5J22A 1K83H 2OWOA 3S1MB 2F0TA 1GUGA 3BU2A 3HOUB 4C3HG 1GJXA 4IJLA 4ULLA 3KBXA 4AQYL 1QB5D 2QEJC 3A8IE 2E2HB 1TS5A 2XTIA 1D1KA 2K04A 1U5KA 1G2SA 2ZTEA 2PNRC 4P71A 2C35B 1VQFA 4ZKCB 3BVMA 2IY5B 1YNNC 3PO3G 2WV6D 3TDQA 3NELA 5D14A 2I5MX 2Z6BA 2PQEA 3NQTA 2R92H 1MI2A 4TKOB 1KXLA 3K6OA 1SSOA 3GTGB 1GUTA 4CDDC 3BDOA 3BYTB 3I91A 2H1EA 3IFTA 3EQLC 4V0BA 3TS2A 1I6VC 4Q5VA 4IFDH 1VQJA 3DM1A 1PH9A 5IYBG 3FDTA 1ICWA 1JE5A 4K5WA 2EYOA 1BVSA 2PYKA 1V1QA 5CGKA 1CQFA 4RKBA 5CV7A 1N32L 4UY8C 2JA6B 2B2YC 4JI7L 1TVXA 3HKZB 4IUUA 2B8FA 1MJCA 2ALYB 3IFDA 2JA5B 4NPSA 4LFAQ 3MXGA 3CD6A 1VQ4A 1CKMA 4K0KQ 1EFID 1TKWB 2FHTA 1E3PA 4AYBG 2KCMA 1B4OA 1U9RA 1XTDA 5M3MG 1VQ8A 3RZDB 1X9NA 1YI2A 1QVCA 3AU7A 1WTVA 3NP8A 2H5XA 2EJGC 2JA7H 2F3VA 3GTOB 3VR5A 4LAAA 4C3JG 3Q24A 3Q6SA 4OX9Q 4FF4A 2DNCA 2V1CC 1NMFA 2OXPA 3NHHA 4O42A 1AZQA 2QGQA 4NXNQ 4DR7Q 2K01A 4LF9L 2MQHA 3PSIA 1BBUA 2B2WC 3Q23A 3H3VI 1CM9A 2F0QA 4P72A 3PMFA 2PQAB 4QUFA 5IGCA 1ZYRC 4LUZA 1JWUD 1WD1A 1GVPA 4R8NA 3GTMB 3S2HB 1IBLL 3U4ZA 5CV9A 1HZ9A 4XXEA 3I3CA 3JAML 3HOWB 3QR8A 5CBEE 5H1SE 4LFCQ 1RCVD 1MSGA 3R2TA 1YHQA 1STEA 2F0JA 4H7BA 3RLFA 3EROA 3SDZA 3M4OB 4NXML 1KQSA 1I94L 4OXPA 1YJ9A 1JCKB 1CUKA 4L5RC 1STYA 3HGBA 4ZK9B 1G6PA 1E0BA 2IX0A 3D6CA 5C44G 2E5LL 3TP7A 1KDCA 1Q8KA 1U4LA 3M4PA 2K5HA 2VL6A 1BOSA 1ESFA 3G71A 4A3JB 2FXQA 4A3GH 1I4QA 1ZXTA 2L0CA 3BYYB 3E9IA 3K7AH 4YHHQ 2EE1A 2DN8A 4YY3L 1QUQB 5IGGA 2BDNA 3TS0A 1PH6A 3K5LA 3HOZB 1CHPD 1BDOA 4XT3B 2R7ZB 1EIFA 5GADC 1N33Q 1U0LA 1F9SA 4OELB 2WIIB 1DM0B 1Y1WG 2R93H 2I07B 1SYBA 3I73A 1PRTD 4QCLA 1STBA 4BBSB 3E0JA 2QEXA 4HSVA 4HJ9A 1N36Q 2JQOA 4CKEA 2P5ZX 1NCVA 3W2DA 2VUMH 2KHSA 1JB3A 1G8ZD 2KUMA 2OQKA 4LF4Q 1DZ1A 1R9TB 5LL6X 1R4QB 2RSOA 3MEFA 4XQJA 4PG3A 1JOOA 2UUCQ 2D2CC 4DUYL 1VQLA 3VYUA 3J7YW 4U673 1E24A 1RHPA 2YTVA 1PRTF 1YJNA 4IPDA 1UUPA 3TBIB 5CBAE 1QVGA 3HOXH 1X56A 1K3RA 4DR5L 3KF8A 4P73A 2EY1A 1SNPA 4RCOA 1JC7A 2HD3A 1HHVA 2LS01 1LTAD 5JOBA 4GZYC 2NZHA 3LWEA 5D3IB 5CV5A 1TWCB 4CBVA 1KNAA 4IOAA 2MO0A 2A69C 2DGYA 3IRBA 4FDBA 4IUTA 4UP7A 5JAVA 5KNBA 5KYIA 4JI3Q 1ZEQX 1DCZA 4C3HB 1JICA 3RD4A 5ELBA 5LMNL 4KI0A 3QB3A 4ILWA 2XGTA 5A2QL 1VQIA 4IJHA 1O7IA 3GTPH 3F1ZA 1ENAA 2HHHL 3HOYH 3AQQA 2F0WA 2K1BA 4GNXC 2PZUA 2BE5C 4KKSA 1HZAA 1C7YA 2Z1CA 3D31A 1F2LA 3FPPA 1LTGD 4K5VA 1CA5A 2LSSA 2K4KA 3CQZB 1EYCA 2XWBB 1Y8OB 3PUVA 3SK6A 2GVBA 1JT8A 2RA4A 3A0JA 4DR6L 3CC4A 3H0GB 3P20A 2YU9H 1IHZA 1EQRA 1WCMB 1P16A 1IW7D 1FL0A 1XX8A 3OWEB 4PNYA 3KDFB 1FJGQ 2B29A 2Q2HA 2LXJA 4NDXA 1AFPA 3I8ZA 5M9OA 4B3SQ 1EWIA 3K5NA 1ASYA 4XT1B 1I6HB 1EY4A 2JA8H 2V4DA 2MO1A 4DV2Q 4FNFA 5IGFA 2JN4A 1Q7YC 5C3EG 3MXNA 4UP9A 4WFN3 2K03A 2K33A 4KKTA 1IBKL 3J81E 5K5PA 4ABNA 2N3SA 5FJ8G 1KLGD 3S1NH 1ONLA 2A68C 4CHTB 4KD4A 3K57A 4OWWB 4RCNA 4A75A 1LT4D 2A6HD 3GV3A 5EPJA 1U4RA 5DNFA 1QG7A 4L5TA 4Y52H 1JWMD 2NN6I 2PMZE 2UXBQ 1Q1EA 4B3RQ 2B2TA 3S1QB 5EJWA 1HA5A 5BN5A 3OTOQ 1P8LA 4LF5Q 1A3UA 4JI0Q 4ZAIA 3F2CA 3QIAA 5M5YB 1Y8NB 1MGSA 1E2ZA 4OIJA 4C1NI 2VQEL 3S14H 3PUYA 3ND8A 4L5SA 2WAQB 1II3A 4DPGA 4B9XA 1X3PA 1SNCA 2K5WA 5EPKA 1CI3M 1SMYC 4UAIA 3LX0A 3OSOA 1KL9A 1RL2A 5C4JH 3CW2C 1E1TA 1M90C 3F2BA 1HR0Q 2B2VC 1B1ZA 2RSNA 3GTKB 1GUNA 3CRKC 2Z8LA 2OEOA 4JVZA 3RZOH 2I5LX 1M1KC 1X65A 2C9OA 3FP9A 3QJYA 1XMOQ 1PH2A 2AMCB 3S17B 4LF8Q 2Z4HA 3OYYA 1RTOA 1EOVA 3TP6A 1NMGA 1HZCA 3S15B 2MPMA 2PCFB 4Z9CB 2OQ0A 2HCCA 1FR3A 1TWAH 2GVAA 1KLUD 3UI2A 4TVAB 4N8FA 1DJRD 2G5DA 1XNQQ 2AHOB 5IWAL 1OXTA 3V05A 1J5EQ 2HQLA 2NVQH 2EXDA 4OONA 4ODGA 2LKVA 1CSPA 3MHBA 1VF7A 1Y1WB 3D3RA 1HFGA 1C4QA 4DV4Q 3FPUB 4KV6A 3PO2G 3CXCA 3AFQA 3L0OA 5I2YA 2KA7A 1GUWA 1JOQA 1KNEA 4A3IB 3OHXC 5ELDA 2NWGA 2F03A 4ZCKA 5CMDA 5E3FA 3DWAA 3FKIH 2O2LD 4JI5Q 1Q81C 1L0YB 5BR8L 1UEBA 3WOFA 1J9OA 1K0SA 1SJHD 1K3BC 5KRUA 1SR3A 2E2IH 2XWJB 2KCCA 1FNUA 3PUWA 1UWVA 3TP8A 1AP0A 4A3CH 1RODA 2EOTA 1SNDA 1XMQL 2VQFL 2R7DA 1QE6A 2R92G 4A3EH 2F1MA 1PTOB 3A55A 4X62L 1IYJB 3VYSA 4C2MH 2NVTB 2FFKB 4H13C 2ZM6Q 3DXJC 1SNMA 3CCMA 5M3FH 5M5WH 3I4NH 4IFDG 2F0OA 3MXPA 2WKCA 3EN2A 5C4ZA 2N88A 1ILPA 1D5XC 2KENA 1VQ7A 3SEBA 3ER0A 4JPBW 1FYCA 1GOZA 3L2PA 4AQYQ 4R4OA 4R4CA 5GROA 1HNXL 1Y1VB 1UE7A 3RR5A 3K0XA 1X3QA 1D5ZC 1F2YA 2XSCA 5KYLA 3HKZE 4RGOS 4K6LA 1KDAA 4EQPA 3MA2B 4A3MB 4CJ1B 4OIKA 1S5FD 2K5QA 4N9PA 3PCOB 1S72A 2Q2TA 1KIXA 1U4MA 3K7UC 1WTHA 3CAMA 1HR0W 2UXDL 3MZ5A 2JA7G 4KY6A 3S1RH 4BY1H 3S16H 1D1IA 3CRLC 1CZGA 1H9SB 1LTBD 1X54A 2IHEA 2NTSA 4WORA 1N32Q 5IYDH 1EOTA 2VY3A 3I72A 4JI7Q 4OL7A 1W3SA 2XRQD 2K5VA 5A2QE 1T9HA 2PW7A 3BVZA 5C4HA 3CC2A 5FLMH 4GOPB 5IGDA 2OCEA 1XJVA 3EVQA 4BXXH 4H02A 1EU4A 3NBIA 1EY0A 1S5BD 2F0HA 1LUZA 3W1BA 3H91A 3GTLH 5C3EB 4BBRB 1SROA 2N78A 2RHQB 2WB1E 2D0OA 3X3NA 1X3EA 4J15A 5M5XB 4G7HC 1HCZA 3GD7A 3JC66 1VQ9A 4LF9Q 5EBDA 1XPRA 4JYAL 2NZ1D 3HS0C 1UNSA 3M4YA 5I9PA 1D8LA 1BKBA 1I50H 1BBWA 2TMPA 3QG1A 3J81i 3A7LA 3KYHC 4DKAC 2NVXB 2B2UC 2RCFA 3E6ZX 4A3GG 1PZID 4B3TL 1IBLQ 1J8IA 2HUGA 1WYDA 3KK7A 4YWMA 4A3FH 1I3QB 4KTAA 1JMCA 4A3BH 2KQ3A 3PGZA 4FVMA 3ULLA 5CV8A 2A5HA 2K28A 3R3OA 4RGMA 1GHKA 1A0IA 4A3KB 1KRSA 1B53A 5FO8B 1TWFB 1DXMA 1SE2A 4JI6Q 2OTJA 4NXMQ 2GN5A 5BN4A 3ERQA 4F88A 1I94Q 2R93G 3K5OA 4QQBX 2YYZA 4C3IH 2Z9HA 3BZCA 5IODA 1Y14B 4OO1H 1FGUA 2YV5A 3N52A 2E5LQ 2F4IA 3GTQH 1DGSA 2B3GA 4GNXB 2G9HD 1EY5A 2FMMA 2VUMG 2D5DA 3CU7A 1VQOA 4YWKA 2AKWB 3P7JA 4DNTB 4YY3Q 2XNAC 1BO0A 4IUNA 3CPWA 3S1MH 1CT1D 1L2FA 3J80E 4DV0L 4ID6A 2NN6H 3J81c 3D4DA 2WFWA 4HJ8A 1C0AA 1DOKA 4KY5A 5F2DA 3HOXG 3CF5A 1O7ZA 2VZAA 4FXDA 4HIMA 4YIJA 1QZHA 2F0SA 2JSOA 3UE1A 1S4ZA 2L1BA 2EYLA 3BDLA 1JJ2A 4WJWA 1G291 2EYPA 5DM63 4GLVB 3A74A 2Y0SG 1NY4A 2IWHA 1V1PB 3A7AB 1CHQD 1JE4A 3GTGH 1G51A 4K2KA 3U50C 3OOCA 1K83B 3M7GA 4NP5A 1CTMA 3J81L 1HJPA 1CKNB 1S5DD 2AUJD 3I55A 2L4NA 4RH6A 4JV5L 3OMGA 1RF2D 2A6EC 1TT2A 1N9WA 4C56C 3ULPA 1VF5C 2UUBL 4PV1C 1VQMA 4HIOA 2MP1A 4UPAA 3RLOA 2JA6H 2PNHA 4PZ7A 3HOYG 1O78A 4CKBA 2M2LA 4DR5Q 3UDGA 2D62A 2QKIC 4IOCA 2JA5H 3L3OC 5D3DA 4QF4A 4JOIA 3IL8A 3NPPA 3N6RA 3PV0A 3UDIA 1UE5A 1B2TA 2F0NA 3VA7A 3CC7A 5JEAJ 3H3VC 1I4GA 1J6QA 4MTKA 4XIGS 2HCIA 1SFOH 1A2TA 5C3XA 1MIUA 4MHEA 3GTOH 3G7LA 1BNZA 1B3AA 1VQHA 4IO9A 4LF6L 2ICIA 1Q82C 1QUQA 1Q3LA 2JA9A 2XIWA 3WWVA 5LMNQ 3I4MB 1OTCA 5AJ3L 2F0FA 2QILA 4ME3A 2QW7A 3T1HL 2SOBA 1GXDC 2HHHQ 3HOVB 5CV4A 1GM5A 3SK4A 1LLRD 1CQVA 1PTOC 2KJXA 1PZJD 3I7FA 2MGSA 2ENBA 3QOLA 2JA8G 1S3OA 2RBMA 3J7A5 3MFYA 3GTMH 3LWUA 4GKJQ 2JA7B 1M4VA 1YZ6A 4HJ5A 3GO5A 4A3DH 1XYIA 1VQ6A 4XDXA 3HOWH 1EQQA 4DR6Q 4NW2A 3STBD 4F87A 5LHY1 1HFNA 5FO9B 2RDFA 4DK3C 5EAYA 1V8QA 1PV4A 4FYDA 3VA5A 3PIPA 3MC0B 2N49A 4POGA 4CDFC 1RJTA 1E1OA 3BZKA 4JI1L 1B50A 3TSSA 2IPKD 1N34L 4QJFA 4GN3B 4ZUIA 1IL2A 4GKKL 1TWGB 3HOZH 1IBKQ 4KMUC 4A3LH 1STGA 5FOBB 4KD3A 2R7ZH 2WAQE 2CWPA 3KBGA 3KF6B 5T1IA 4GOPC 3Q22A 4HEDA 1B9NA 3TZDA 1RD9D 1C9OA 4HTHA 1R4PB 5IY0A 5FK9C 1YNJC 5C0XI 3SR1A 1A6XA 4E6IA 2F0UA 4RHRA 5ELFA 3U9SA 1H95A 5HY6A 3EIVA 4BBSH 2BOSA 4MNOA 4JW0A 2ID0A 4JK1C 4A3GB 1F9QA 1EYDA 5COYA 2EY2A 1S5CD 4LUOA 3DEPA 2VQEQ 2L12A 1VMPA 2B8GA 4QY7A 4DV5L 3EBEA 3GV6A 1SE8A 1Z47A 3KUPA 2MJ8A 1VQEA 3T51B 1EY6A 1EWCA 4NKLA 4X3SA 2E76C 3KDFA 2WP8J 4R1JA 1FNWA 2DY7A 4CDCC 4B3SL 1JORA 2ICEC 2B39A 4KJNA 5LMNW 2ZXRA 1RIPA 1EY7A 3E3XA 4G4KA 3TZUA 1O7YA 3RUZA 1TIID 1LT5D 3HKSA 2VUMB 1TWCH 2LFNA 1G91A 4DAYB 2CH4A 1I4RA 3FKIG 5I4DA 3FRPB 3OW2A 3NWSA 3M3YH 2F0IA 3GQBA 4BWGB 5IWAQ 2F0PA 3NTHA 5JEAH 1NBWA 2F4VL 3HOXB 1K0RA 4A3CG 1QWYA 1SRUA 4LK1C 1JJCB 4KY7A 4X3UA 5E4WC 3T53B 1LM0A 3DLLA 2X69A 1I4PA 4A3EG 3U4VA 1FVIA 4K5XA 3PO3B 1EU3A 1HTLD 2L11A 3J80i 2Y0SB 4GN4B 3SVMA 3U9OA 4BA1I 5IYCH 3CQZH 1VQNA 3F2UA 5M3FG 2HDLA 5IP9H 3I4NG 5FLXc 4CJ2C 1K8OA 2KOLA 5ELNA 4IURA 3H0GH 4N8X1 1WCMH 5BR8Q 4WRDA 3V2TA 1HRJA 4LWCA 4DV3L 1B70B 1JQYD 1N8RC 4HMIA 3MEHA 2MNAA 3B6YA 1XMQQ 2VQFQ 5LMUL 2F3WA 5FLXL 1PYBA 3DWPA 4YCWA 2KVMA 2HDMA 2EY6A 3RLNA 1Y8PB 4X62Q 1D5MC 1RKNA 1JOKA 3L9AX 2QDBA 3CKIB 4AYBB 5I6YA 1YNXA 3L7ZC 4BY1G 5HURA 1Q12A 5M3MB 3FVQA 2A8VA 1VS0A 4GN5A 4OO1I 4CKCA 4CGYB 4ZKBB 2M00A 4JI8L 4AIMA 3NBHB 5IYDG 1KD1C 2HQEA 4C3JB 3J80c 5TSSA 1STAA 3R8BA 3STBC 1NTGA 1HNXQ 1KTKA 3OW7A 2X6GA 4DFAA 3UE0A 5FLMG 2K32A 3GDEA 4K14A 3T13A 2F0LA 1XPUA 4N9TA 1PFSA 3DMUA 4QIWB 2JA8B 1UEAB 4A93H 4BXXG 1F77A 5M5YH 2SDFA 3MAQA 3S2DH 2OF1A 5LL6S 1HPCA 2B2YA 3M7NA 2UXDQ 3J80L 3A5ZB 2K05A 2NUCA 1QJOA 5K36H 4ZYSA 2EQSA 3EA6A 1H9RA 2FINB 3OMCA 4IUVA 3WOEA 3J7AF 3GP7A 4DR1L 1MSHA 1SYCA 1OXSC 4TQUS 3CCEA 2HIVA 3SK8A 1XNRL 2JEAI 4JI2L 1A63A 1AE3A 3S17H 1DONA 1W6JA 4HCEA 2F3IA 4ZUJA 3A54A 5C44B 1JJGA 1YBYA 2BH2A 2CW0D 2NVYH 4A3FG 3S14B 1YVCA 1PRTC 4A3BG 2B2WA 4IN3A 2B63H 3H09A 2ZT9C 2HT1A 1BCPD 4X3KA 1E2VA 5C4JB 4G57A 1EZ8A 4DNRB 3K5MA 4O1NA 4JYAQ 4YCVA 4DNIA 4QUCA 4UHVA 4C3IG 3SHLA 2UU9L 2KHJA 1ET9A 3RZOB 2KCTA 1AW7A 4OO1G 3AMUA 4L6TB 1ET6A 2K52A 4A3IH 3KLRA 3MXNB 4P75A 2PPBC 2E2JH 3EFXD 1EWHA 1BUVT 1B7YB 4B3TQ 3Q8DA 1OXVA 1BCPF 1SYGA 4I7AA 4J6HA 3X3MA 1PXUA 3K8AA 4I7ZC 3WDNA 2NN6G 2SNMA 5I2XA 1LO5D 4JC0A 1H9SA 2G9DA 3I90A 2UUAL 1SEBD 4PMBA 5C4XH 3J7AV 2CKZB 3K80C 3A56A 1D6EC 2I5HA 3KLSA 1IKMA 4GOPA 3J7ZC 3IKJA 4HSPA 1VQPA 4HMJA 4R8IA 4KKUA 1AZPA 4FF3A 1PMRA 3FKIB 4DAVA 2ZXOA 2IX1A 4R4QA 4MN3A 4YWLA 2R6GA 4DV0Q 2UXCL 1IXRA 2JE6I 2ZXPA 4L8JA 3K0YA 3I4LA 3J81j 5C0XH 1YNND 2JA6G 3V96A 1Y1VH 1YHBA 3HKZG 1GUSA 1CFMA 1AH9A 1HXYD 1U4PA 1VQKA 1GKHA 1HNZL 1MBYA 2CQOA 2VW9A 4JCVE 3URYA 1IW7C 4C1NK 1UAPA 4A3MH 1ENCA 1TU2B 4UDUC 4Y7NH 4H44C 4LFBL 5J1ZA 4B08A 4P74A 1ESRA 1W6KA 3NQIA 3GTJH 1PYSB 2C5CA 5M3FB 3I4NB 1TWHB 3D8GA 4QGUA 1KDBA 1Q46A 4DK6C 2EVBA 2WINB 4HR7B 2J7ZA 1WTXA 2Q8RE 4BY7H 5J39A 1MHWC 2UUBQ 1KAAA 2F0GA 1EY9A 1GO3E 2L5TA 1EY8A 1LTLA 2KECA 4RHSA 1TY2A 5HGTA 1IZ6A 4LF5L 3G6JB 3T16A 2DY8A 1HA6A 2F0DA 1NSNS 3P75A 2A6HC 5GQOA 1Z9FA 2RVLA 2WB1G 5E4XA 2EXZA 2NZOA 3DM3A 1TS3A 4BBRH 4GNXA 4BY1B 3TP5A 4A3DG 4OHJA 3S16B 3HOWG 2XRSD 4LF6Q 1T5EA 1YITA 4JBWA 4DV7L 4DV6L 3CPFA 1YIJA 3ULJA 5AJ3Q 3DHQA 1EEFD 4HJ7A 4IPGA 2F0EA 4FF1A 1SYFA 1WTQA 3T1HQ 3C3LA 4O0AA 4LUVA 4FF2A 1ZYRD 2J0TD 1HH2P 4DR2L 3E9HA 3LNNA 3NEMA 2QCPX 1DD2A 4EGVA 1AE2A 4NB3A 3RNUA 5JVG3 1AEXA 2R61A 5L37A 4OGQC 4DAPA 1LT6D 3K81C 1WTWA 1V1PA 5FLXE 1XPOA 5KNDA 4EQNA 1I3QH 3PIOA 4LNQA 3HOZG 4A3LG 3PUZA 1YHAA 2RCNA 1K73C 2NB0A 4X65L 5KEEA 1QOHA 5EQ0A 3TRZA 3C1FA 2R7ZG 1UE6A 4A3KH 5HGQA 4B3ML 4L5QA 1TWFH 1WFQA 2QF7A 4JG2A 2EJMA 1SJED 4G7ZC 4RGTA 4BBSG 2IHFA 2BH8A 4IUQA 4PMCA 4JI1Q 1G6ZA 2DJFC 2RDHA 4ZLTF 2N55A 4RG1A 1B9MA 1N34Q 4DXFA 2A73B 4XQNA 1VQDA 2LXKA 5JVH3 1M8AA 3HZXA 2O5JC 3PUXA 4EVOA 3BDCA 1B44D 2JEBI 3SXHA 3HOUH 1EZ6A 1ICFB 4LJZC 1TXYA 1H9MA 5KGUA 5NUCA 1PFBA 1PHJA 2E2HH 4C3IB 5IP7H 4POFA 1H9JA 4BS9A 1LT3D 2L15A 1E2WA 3C2PA 1B3QA 2EYFA 2Z6KC 2ZJQA 3PO2B 1PH5A 2IL8A 2SEBD 1L1OB 1ENFA 4KN7C 4CJ0B 3OIQA 4GLXA 2D9UA 3NWTA 2PQAA 1QCBD 5DM73 2B2VA 3ND9A 1BF4A 2I46A 1JWSD 3TN2A 1VQ5A 3CCLA 4J1MA 2JK8A 2X6LA 4DV5Q 1PA6A 5DEHA 1K8GA 3IAYA 4DUYQ 4F7XA 2LY7A 3TREA 5JEAG 1A15A 3ZYYX 3F2DA 4DR3L 3HFZB 2KEDA 4X64L 3KJOA 3AYHB 4ALPA 2A69D 1WTPA 2KHIA 1OO9B 2CHBD 3JAMi 2YTYA 4ZRZA 2R92B 5IYCG 2AQ1B 1KRTA 1S40A 2O5IC 1HQMC 4JI4L 1PZKD 1EQTA 2Y0SE 3VDYA 3G6EA 5GAEC 5IP9G 5EKKA 1HUNA 4KHPL 4RA8A 3RZDH 4FO2A 4MIUA 4DU9A 5CR3A 3TQYA 3H0GG 1SYEA 2NBFA 2B2TC 5C5LA 4X66L 1WCMG 2BE5D 3FMCA 4KK7A 5A35A 3BS1A 3A5UA 3I4MH 4KHZA 1Q8IA 2L55A 1A3VA 4DUZL 1E7ZA 2F4VQ 3PIP3 3HOVH 5JPNC 2EY5A 3CHBD 3KF6A 1K8MA 4R9WA 1H9KA 1QILA 1SDFA 2E2DC 2K6AA 2F0MA 1PH7A 1F9RA 2K7VA 2R7FA 1EYGA 4IZ8A 3T1YL 2IJ0A 1K8AC 5EBCA 1UE1A 3VR2A 1SFOB 5IT9c 2ZJRA 2FJ2A 2CFMA 3S2HH 4K2LA 2KBNA 1K9MC 1IBML 3HG9A 4AYBE 3I70A 3NE5B 1TS4A 1LTSD 4LF7L 1I4XA 1V1OA 2IW3A 1PH1A 2PW5A 4DV3Q 3JAMc 4JBKA 4PQXA 1W2BA 4I65A 1TQOA 2JYOA 1PRTB 5G3LD 2KCNA 1Y69U 1NJIC 4DR4L 3M4OH 3E0EA 3MXUA 1ML0D 4H0LC 5IT9L 2F0VA 5LMUQ 4A93G 4KJOA 5DAUA 3MFGA 4L63B 2WB1B 4QIWE 3ERSX 3ICEA 2A68D 2PZTA 4A3DB 4DAYA 1TWGH 4A3JH 5K36G 4DV1L 5G3LF 2WAQG 4B9WA 3U58A 3PF4A 2Z4IA 4JI8Q 4A4IA 3CMAA 4JI6L 2EPBA 4OWXB 3DUZA 2Q8IB 1PVOA 2MUYA 4NMZA 1GHJA 3CCUA 1HTPA 1VMCA 2GA4B 2MFIA 4HJAA 2CVRA 1MD2D 1C48A 3QOJA 5GAHC 4G7OC 4ZQ3A 2VXWA 1HNWL 3QWNA 1X55A 2JJQA 1STHA 1SMYD 2F0KA 4K8JA 3Q0AA 4PZ8A 1NAPA 2EDGA 3K7AB 2B63G 1LTTD 1R9TH 1RTNA 2J4XA 1IKLA 5CV6A 1KC8C 1CK1A 4DA2A 2SNSA 4DR1Q 1IYVA 3H94A 4LW1A 4QB4A 2PI2E 1XNRQ 1X6OA 3CMEA 5KIXA 2R93B 4JI2Q 2CCZA 4IALA 4A3IG 3S9WA 3NXWA 1QNUA 2XVSA 4OEMB 5C6AA 3HP3A 4JBMA 1T5XD 1F2MA 1WI5A 5ISRA 1SE3A 2NTTA 1PH4A 1DYQA 2A74C 4C3HH 1EFWA 2AUKA 2B2UA 2BA1A 3NBHA 2K5DA 2RQXA 5C4XG 5CORA 3W1GA 2UU9Q 2WACA 3R2IA 2FMCA 1XXGA 3RMHA 4YCUA 4LFAL 3PO3H 1D2BA 4RKLA 4K0KL 4DAMA 3KLSX 1OXUA 2MHVA 1QZGA 2E75C 3EJIA 4XYOA 2OT2A 5CC4A 1YJWA 3M3YB 1Q86C 4QMGA 4DF7A 3ITPA 5C0XG 1V43A 3SGIA 5IYBH 1LV9A 1G2TA 4OX9L 2AWOA 4CDEC 1Y1VG 3QO2A 2UUAQ 3MVVA 4NXNL 5E1FA 1Q90A 2AQ3B 4DR7L 1CSQA 3CCRA 3W3AA 1WTRA 2Z0SA 3GTPB 3BG3A 4EQ5A 3HOYB 1EIHA 1L1OC 4TSSA 1L0WA 3D6WA 1EUJA 4XYQA 4A3MG 1EQVA 1PLFA 2I0QA 1WOCA 3W5OA 4GKJL 1I6HH 5C0XJ 1WVLA 2EJFC 5M3MH 3TMEA 5IGEA 2Z6KA 5C5MA 1DOMA 1VQGA 2H4OA 3D4RA 3AFPA 1A3TA 3M9BA 2QA4A 1NR2A 1VQBA 1FNVA 4RFBA 2UXCQ 4U68A 4XTCS 2RF4A 3C46A 2YU9B 4C3JH 2OTLA 2VB2X 4BY7G 4LFCL 1A62A 1Z7TA 1PH3A 1ILQA 3KF8B 1I4HA 3T4AC 3TEHB 1HNZQ 2PI2A 2Q8TA 3S1QH 1A2UA 2YTXA 1LTID 3VR4A 2TSSA 4FXGC 4LFBQ 5EKIA 3AB9A 1BCPB 4BBRG 1JR0D 1VCIA 5AFWA 3OPOA 4YHHL 1LTRD 1SBBB 1CZWA 1SNOA 1PYWD 4XQQA 5ELEA 1BXTA 5ELOA 2ZTCA 3VYRA 3PF5A 1V9PA 3G4SA 1RDPD 5C3WA 3AEVA 3S1NB 4HN7A 4KHVA 2O4XA 1L0XB 4HIDA 4APVA 1CKOA 1N33L 3I2ZA 3D4WA 3NTKA 2ASBA 4IPCA 3KFUA 3GTKH 4A93B 5JJKA 5JJIA 3CCQA 1A8VA 4R4TA 3S2DB 3H15A 5C44H 1NR4A 1N36L 3PQIA 2EZVA 1D7QA 3BZDB 4LF4L 3ONAB 3S15H 1STNA 2ZJPA 3UDFA 3CCSA 3K59A 4DXGA 3O13A 2K5NA 5EKLA 4DV6Q 4DV7Q 2UUCL 2LMCB 2VNUD 5IE8A 4A3KG 4RGNA 5E7NA 1Q1BA 2EYHA 1EIGA 1SXTA 4IFDI 2AWNA 2RDGA 2BA0A 2RKSA 2QDLA 4DR2Q 3SK5A 4K6DA 3RN5A 1WTOA 1KABA 3A8KE 3OWFA 1Y1WH 2N8NA 2VS1A 4HIKA 1HQRD 3VR3A 1E22A 3NSWA 5I6WA 2WKDA 4R4IA 5IGBA 5IT9E 2NVYB 1SAPA 4RWSC 4FP5D 1GUOA 2B63B 4JI3L 4X65Q 3HEJA 2ATWA 3H3VH 1TWAB 2CH4W 4JOIC 3HOUG 5EPLA 3JAME 2JXMB 1WD0A 4B3MQ 2NVQB 5IP7G 3BJUA 3NTIA 3NENA 4RMFA 1SE4A 4QL5A 3CCJA 3G48A 4DN4M 1NE3A 1BBXC 3HRZC 2EYMA 4LMQD 1HUMA 4IPHA 2E2JB 3DEOA 4BA2I 5FO7B 2DJGC 1PTOH 3FHWA 2BDOA 1SMXA 4O2DA 4AH6A 1HZBA 2NVTH 2BCOA 2VB3X 1ASZA 1CA6A 4F8MA 1Z6HA 5FKAC 5IIFA 5T1GA 3UDXA 2E2IB 5C4XB 1FD7D 3CCVA 1FJGL 3KOJA 2K14A 1SN8A 4A76A 3S24A 3K58A 4HCSA 1IL8A 2JA5G 1FGBD
chains in the Genus database with same CATH topology
1EEID 4A3EB 3R93A 2A6ED 1OXXK 4C2MB 2XN9C 5IOCA 5M5WB 1EYAA 1X32A 4Q0FA 1VDZA 4P2CB 4IFDJ 2NYZD 3NK9A 4Y7NB 2L9HA 4DGZA 1XTCD 3GTJB 5D65A 1PFNA 5JPMC 3PIO3 3DWQA 3H6MA 2AQ2B 4ME5A 3BVGA 2PO4A 3S1RB 5JJZA 1PTOD 4BY7B 4EQOA 5I9OA 4TRDA 2R3ZA 1ZKOA 3NUCA 1TY0A 5KNCA 2IT1A 2PMZB 4IUPA 2M9VA 1SYDA 1QNKA 3MWYW 4M1UB 1O80A 2CQAA 1TR5A 1BQQT 5EGTA 1BR9A 4RAUC 2KEEA 1PTOF 3OIPA 1XWEA 4FXKC 3GTLB 2PZWA 3VR6A 4J8QA 4V190 3C1EA 5BN3A 1S5ED 2CW0C 3FEWX 4M8AA 4DK1A 1DOLA 2JP1A 3T56B 3MTSA 1PDQA 5CYUA 1EL0A 1BCPC 3E5SA 3M85A 4KN4C 1I50B 1F9PA 3VYTA 4K8IA 1PFMA 4S3SA 4A3FB 4A3BB 1IYUA 1O7LA 1YNJD 1AN8A 4X3TA 4DK0A 2EYJA 1C8CA 3A8JE 1NUCA 5ELCA 1TS2A 1F2ZA 1LACA 2DNEA 4HAEA 2E74C 3SE0A 3P1HA 2IX3A 1LABA 1SNQA 4PMWA 3GTQB 4IQZA 5J22A 3S1MB 2F0TA 1GUGA 3HOUB 4C3HG 1GJXA 4ULLA 3KBXA 1QB5D 2QEJC 3A8IE 2E2HB 1TS5A 1D1KA 2K04A 1G2SA 2PNRC 4ZKCB 3BVMA 1YNNC 2WV6D 3TDQA 5D14A 2PQEA 3NQTA 1MI2A 4TKOB 3K6OA 1SSOA 3GTGB 1GUTA 3BDOA 3BYTB 3I91A 2H1EA 3IFTA 3EQLC 4V0BA 4IFDH 1I6VC 4Q5VA 3DM1A 3FDTA 1ICWA 4K5WA 2EYOA 2PYKA 5CGKA 1CQFA 4RKBA 5CV7A 2JA6B 2B2YC 1TVXA 3HKZB 4IUUA 2B8FA 3IFDA 2JA5B 3MXGA 1EFID 1TKWB 2FHTA 1B4OA 1U9RA 3RZDB 3AU7A 1WTVA 3NP8A 2EJGC 2F3VA 3GTOB 3VR5A 4LAAA 4C3JG 3Q24A 3Q6SA 4FF4A 2DNCA 2OXPA 3NHHA 4O42A 1AZQA 2K01A 2B2WC 3Q23A 1CM9A 2F0QA 3PMFA 4QUFA 5IGCA 1ZYRC 1JWUD 1WD1A 4R8NA 3GTMB 3S2HB 5CV9A 4XXEA 3I3CA 3JAML 3HOWB 5CBEE 1RCVD 1MSGA 3R2TA 1STEA 2F0JA 4H7BA 3RLFA 3EROA 3SDZA 3M4OB 1JCKB 1STYA 3HGBA 4ZK9B 1E0BA 2IX0A 3D6CA 3TP7A 1KDCA 1U4LA 1BOSA 1ESFA 4A3JB 1I4QA 1ZXTA 2L0CA 3BYYB 2EE1A 2DN8A 5IGGA 2BDNA 3K5LA 3HOZB 1CHPD 1BDOA 4XT3B 2R7ZB 1F9SA 2WIIB 1DM0B 2I07B 1SYBA 3I73A 1PRTD 4QCLA 1STBA 4BBSB 3E0JA 4HSVA 4CKEA 1NCVA 3W2DA 2KHSA 1JB3A 1G8ZD 2KUMA 1DZ1A 1R9TB 5LL6X 1R4QB 2RSOA 4XQJA 1JOOA 2D2CC 3VYUA 3J7YW 4U673 1RHPA 1PRTF 1UUPA 3TBIB 5CBAE 3KF8A 2EY1A 1SNPA 4RCOA 1JC7A 1HHVA 2LS01 5JOBA 1LTAD 4GZYC 3LWEA 5D3IB 5CV5A 1TWCB 4CBVA 1KNAA 2A69C 4IUTA 5JAVA 5KNBA 5KYIA 1ZEQX 1DCZA 4C3HB 1JICA 3RD4A 5ELBA 4KI0A 3QB3A 4ILWA 5A2QL 1ENAA 2F0WA 2K1BA 2PZUA 2BE5C 4KKSA 2Z1CA 3D31A 1F2LA 3FPPA 1LTGD 4K5VA 1CA5A 3CQZB 1EYCA 2XWBB 1Y8OB 3PUVA 3SK6A 2RA4A 3H0GB 3P20A 1IHZA 1WCMB 1IW7D 1XX8A 3OWEB 4PNYA 4NDXA 1AFPA 3I8ZA 5M9OA 3K5NA 4XT1B 1I6HB 1EY4A 2V4DA 4FNFA 5IGFA 3MXNA 4WFN3 2K03A 2K33A 4KKTA 3J81E 5K5PA 4ABNA 1KLGD 1ONLA 2A68C 4CHTB 4KD4A 3K57A 4RCNA 1LT4D 2A6HD 3GV3A 5EPJA 1U4RA 5DNFA 1QG7A 1JWMD 2NN6I 1Q1EA 2B2TA 3S1QB 5EJWA 1HA5A 5BN5A 1A3UA 4ZAIA 3QIAA 5M5YB 1Y8NB 1MGSA 1E2ZA 4OIJA 4C1NI 3PUYA 3ND8A 2WAQB 1II3A 4B9XA 1X3PA 1SNCA 2K5WA 5EPKA 1CI3M 1SMYC 4UAIA 3LX0A 3OSOA 2B2VC 1B1ZA 2RSNA 3GTKB 1GUNA 3CRKC 2Z8LA 2OEOA 3QJYA 2C9OA 3S17B 2Z4HA 1RTOA 3TP6A 3S15B 2MPMA 2PCFB 4Z9CB 2HCCA 1FR3A 1KLUD 3UI2A 1DJRD 1OXTA 3V05A 4ODGA 2LKVA 3MHBA 1VF7A 1Y1WB 3D3RA 1HFGA 1C4QA 3FPUB 4KV6A 5I2YA 2KA7A 1GUWA 1JOQA 1KNEA 4A3IB 3OHXC 5ELDA 2NWGA 2F03A 5CMDA 5E3FA 3DWAA 2O2LD 1L0YB 3WOFA 1J9OA 1SJHD 5KRUA 2XWJB 2KCCA 1FNUA 3PUWA 3TP8A 1AP0A 1RODA 2EOTA 1SNDA 1QE6A 2F1MA 1PTOB 3A55A 3VYSA 2NVTB 2FFKB 4H13C 3DXJC 1SNMA 4IFDG 2F0OA 3MXPA 2WKCA 5C4ZA 2N88A 1ILPA 1D5XC 3SEBA 1FYCA 1GOZA 1Y1VB 1X3QA 1D5ZC 1F2YA 2XSCA 5KYLA 4RGOS 4K6LA 1KDAA 4EQPA 3MA2B 4A3MB 4CJ1B 4OIKA 1S5FD 2K5QA 4N9PA 1U4MA 3MZ5A 4KY6A 1D1IA 3CRLC 1CZGA 1H9SB 1LTBD 2NTSA 4WORA 1EOTA 3I72A 4OL7A 2XRQD 5A2QE 2PW7A 3BVZA 5C4HA 5IGDA 3EVQA 1EU4A 3NBIA 1EY0A 1S5BD 2F0HA 3H91A 5C3EB 4BBRB 3X3NA 5M5XB 4G7HC 1HCZA 3GD7A 5EBDA 2NZ1D 3HS0C 1UNSA 3M4YA 5I9PA 2TMPA 3QG1A 3A7LA 2NVXB 2B2UC 3E6ZX 1PZID 1J8IA 2HUGA 3KK7A 1I3QB 4KTAA 2KQ3A 4FVMA 5CV8A 2A5HA 2K28A 3R3OA 4RGMA 1GHKA 4A3KB 1B53A 5FO8B 1TWFB 1DXMA 1SE2A 5BN4A 3ERQA 4F88A 3K5OA 2YYZA 5IODA 4OO1H 3N52A 2F4IA 2G9HD 1EY5A 2FMMA 2D5DA 3CU7A 3P7JA 4DNTB 2XNAC 1BO0A 4IUNA 1CT1D 3J80E 4ID6A 2NN6H 3D4DA 1DOKA 4KY5A 5F2DA 1O7ZA 4FXDA 4YIJA 2F0SA 2JSOA 1S4ZA 2L1BA 2EYLA 3BDLA 4WJWA 1G291 2EYPA 5DM63 2IWHA 1V1PB 3A7AB 1CHQD 1JE4A 4K2KA 3OOCA 1K83B 3M7GA 4NP5A 1CTMA 3J81L 1S5DD 2AUJD 2L4NA 4RH6A 3OMGA 1RF2D 2A6EC 1TT2A 4C56C 1VF5C 4PV1C 2MP1A 1O78A 4CKBA 2M2LA 2D62A 2QKIC 3L3OC 5D3DA 4QF4A 3IL8A 3NPPA 3N6RA 3PV0A 1B2TA 2F0NA 3VA7A 3H3VC 5JEAJ 1I4GA 4XIGS 2HCIA 1A2TA 5C3XA 4MHEA 3G7LA 1BNZA 1B3AA 2ICIA 1Q3LA 2XIWA 3I4MB 2F0FA 2QILA 2SOBA 1GXDC 3HOVB 5CV4A 3SK4A 1LLRD 1CQVA 1PTOC 2KJXA 1PZJD 2MGSA 2ENBA 3QOLA 2RBMA 3MFYA 3LWUA 2JA7B 1M4VA 3GO5A 1XYIA 4XDXA 4NW2A 4F87A 5LHY1 1HFNA 5FO9B 2RDFA 1V8QA 4FYDA 3VA5A 3MC0B 1RJTA 1B50A 3TSSA 2IPKD 4ZUIA 1TWGB 4KMUC 1STGA 5FOBB 4KD3A 3KBGA 5T1IA 3Q22A 4HEDA 1B9NA 3TZDA 1RD9D 4HTHA 1R4PB 5FK9C 1YNJC 5C0XI 3SR1A 1A6XA 4E6IA 2F0UA 4RHRA 5ELFA 3U9SA 2BOSA 2ID0A 4JK1C 4A3GB 1F9QA 1EYDA 5COYA 2EY2A 1S5CD 3DEPA 2L12A 1VMPA 2B8GA 3GV6A 1Z47A 3KUPA 2MJ8A 3T51B 1EY6A 1EWCA 4NKLA 4X3SA 2E76C 2WP8J 1FNWA 2DY7A 1JORA 2ICEC 2B39A 4KJNA 2ZXRA 1EY7A 4G4KA 3TZUA 1O7YA 3RUZA 1TIID 1LT5D 2VUMB 2LFNA 1G91A 1I4RA 5I4DA 3FRPB 3NWSA 2F0IA 3GQBA 4BWGB 2F0PA 3NTHA 5JEAH 3HOXB 1QWYA 4LK1C 4KY7A 4X3UA 5E4WC 3T53B 2X69A 1I4PA 4K5XA 3PO3B 1EU3A 1HTLD 2L11A 2Y0SB 3SVMA 3U9OA 4BA1I 3F2UA 2HDLA 1K8OA 4CJ2C 2KOLA 4IURA 4WRDA 3V2TA 1HRJA 1JQYD 4HMIA 3MEHA 2F3WA 5FLXL 3DWPA 2KVMA 2HDMA 2EY6A 1Y8PB 1D5MC 1RKNA 1JOKA 3L9AX 2QDBA 3CKIB 4AYBB 5I6YA 5M3MB 3L7ZC 5HURA 1Q12A 3FVQA 4OO1I 4CKCA 4CGYB 4ZKBB 2M00A 2HQEA 4C3JB 5TSSA 1STAA 3R8BA 1KTKA 3OW7A 2X6GA 4DFAA 2K32A 4K14A 3T13A 2F0LA 4N9TA 3DMUA 4QIWB 2JA8B 1UEAB 1F77A 2SDFA 3MAQA 2OF1A 5LL6S 1HPCA 2B2YA 3M7NA 3J80L 2K05A 2NUCA 1QJOA 5K36H 4ZYSA 3EA6A 1H9RA 2FINB 3OMCA 4IUVA 3WOEA 3J7AF 3GP7A 1MSHA 1SYCA 1OXSC 4TQUS 3SK8A 2JEAI 1DONA 1W6JA 4HCEA 4ZUJA 3A54A 5C44B 2CW0D 3S14B 1PRTC 2B2WA 4IN3A 3H09A 2ZT9C 1BCPD 4X3KA 1E2VA 5C4JB 4G57A 1EZ8A 4DNRB 3K5MA 4O1NA 4QUCA 4C3IG 3SHLA 1ET9A 3RZOB 1AW7A 4OO1G 3AMUA 4L6TB 1ET6A 3KLRA 2PPBC 3EFXD 1EWHA 1BUVT 1OXVA 1BCPF 1SYGA 4J6HA 3X3MA 1PXUA 4I7ZC 3WDNA 2NN6G 2SNMA 5I2XA 1LO5D 1H9SA 2G9DA 3I90A 1SEBD 4PMBA 3J7AV 3A56A 1D6EC 3KLSA 1IKMA 3IKJA 4HSPA 4HMJA 4R8IA 4KKUA 1AZPA 4FF3A 1PMRA 3FKIB 4DAVA 2ZXOA 2IX1A 4MN3A 2R6GA 2JE6I 2ZXPA 4L8JA 3K0YA 3I4LA 5C0XH 1YNND 3V96A 1GUSA 1CFMA 1HXYD 1U4PA 1MBYA 3URYA 1IW7C 4C1NK 1UAPA 1ENCA 1TU2B 4UDUC 4H44C 5J1ZA 4B08A 1ESRA 1W6KA 3NQIA 2C5CA 5M3FB 3I4NB 1TWHB 3D8GA 1KDBA 2EVBA 2WINB 4HR7B 2J7ZA 1WTXA 2Q8RE 5J39A 1KAAA 2F0GA 1EY9A 2L5TA 1EY8A 2KECA 4RHSA 1TY2A 5HGTA 3G6JB 3T16A 2DY8A 1HA6A 2F0DA 1NSNS 3P75A 2A6HC 2RVLA 5E4XA 2EXZA 1TS3A 4BY1B 3TP5A 4OHJA 3S16B 2XRSD 1T5EA 4JBWA 3DHQA 1EEFD 2F0EA 4FF1A 1SYFA 1WTQA 3C3LA 4FF2A 1ZYRD 2J0TD 3LNNA 2QCPX 1DD2A 4EGVA 5JVG3 1AEXA 2R61A 4OGQC 4DAPA 1LT6D 1WTWA 1V1PA 5FLXE 5KNDA 4EQNA 3PUZA 2NB0A 5KEEA 1QOHA 5EQ0A 3C1FA 2QF7A 2EJMA 1SJED 4G7ZC 4RGTA 4IUQA 4PMCA 1G6ZA 2RDHA 4ZLTF 2N55A 1B9MA 4DXFA 2A73B 4XQNA 5JVH3 1M8AA 3HZXA 2O5JC 3PUXA 4EVOA 3BDCA 1B44D 2JEBI 3SXHA 1EZ6A 4LJZC 1H9MA 5KGUA 5NUCA 1PFBA 4C3IB 1H9JA 4BS9A 1LT3D 1E2WA 3C2PA 2EYFA 3PO2B 2IL8A 2SEBD 1ENFA 4KN7C 4CJ0B 3OIQA 2D9UA 3NWTA 1QCBD 5DM73 2B2VA 3ND9A 1BF4A 2I46A 1JWSD 3TN2A 4J1MA 2X6LA 5DEHA 3IAYA 4F7XA 2LY7A 5JEAG 1A15A 3ZYYX 2KEDA 2A69D 1WTPA 1OO9B 2CHBD 4ZRZA 2R92B 2AQ1B 2O5IC 1HQMC 1PZKD 1EQTA 1HUNA 5EKKA 4RA8A 4FO2A 4MIUA 4DU9A 5CR3A 1SYEA 2NBFA 2B2TC 5C5LA 2BE5D 3FMCA 4KK7A 5A35A 3BS1A 4KHZA 1Q8IA 2L55A 1A3VA 3PIP3 5JPNC 2EY5A 3CHBD 1K8MA 4R9WA 1H9KA 1SDFA 1QILA 2E2DC 2K6AA 2F0MA 1F9RA 2K7VA 4IZ8A 2IJ0A 5EBCA 3VR2A 1SFOB 2FJ2A 4K2LA 3HG9A 3I70A 3NE5B 1TS4A 1LTSD 1I4XA 1V1OA 2IW3A 2PW5A 4PQXA 4I65A 1TQOA 2JYOA 1PRTB 5G3LD 2KCNA 1Y69U 3MXUA 1ML0D 4H0LC 5IT9L 2F0VA 4KJOA 5DAUA 3MFGA 4L63B 2WB1B 2A68D 2PZTA 4A3DB 4DAYA 5K36G 5G3LF 4B9WA 2Z4IA 2EPBA 3DUZA 2Q8IB 2MUYA 4NMZA 1GHJA 1HTPA 1VMCA 2GA4B 2CVRA 1MD2D 1C48A 3QOJA 4G7OC 4ZQ3A 2VXWA 3QWNA 1STHA 1SMYD 2F0KA 4K8JA 3Q0AA 1NAPA 2EDGA 3K7AB 1LTTD 1RTNA 2J4XA 1IKLA 5CV6A 1CK1A 4DA2A 2SNSA 1IYVA 3H94A 4QB4A 5KIXA 2R93B 4IALA 3S9WA 3NXWA 1QNUA 2XVSA 5C6AA 3HP3A 1T5XD 1F2MA 5ISRA 1SE3A 2NTTA 1DYQA 2A74C 2AUKA 2B2UA 2BA1A 3NBHA 2K5DA 2RQXA 5CORA 2WACA 3R2IA 2FMCA 1XXGA 3RMHA 1D2BA 4RKLA 3KLSX 1OXUA 2MHVA 2E75C 3EJIA 4XYOA 2OT2A 5CC4A 3M3YB 4QMGA 4DF7A 3ITPA 5C0XG 1V43A 1LV9A 1G2TA 2AWOA 3QO2A 3MVVA 5E1FA 1Q90A 2AQ3B 1WTRA 3W3AA 3GTPB 3BG3A 3HOYB 1EIHA 4TSSA 3D6WA 4XYQA 1EQVA 1PLFA 5C0XJ 1WVLA 2EJFC 3TMEA 5IGEA 5C5MA 1DOMA 2H4OA 3D4RA 1A3TA 1NR2A 1FNVA 4RFBA 4U68A 4XTCS 3C46A 2YU9B 2VB2X 1Z7TA 1ILQA 1I4HA 3T4AC 2Q8TA 1A2UA 1LTID 3VR4A 2TSSA 4FXGC 5EKIA 3AB9A 1BCPB 1JR0D 1VCIA 5AFWA 3OPOA 1LTRD 1SBBB 1CZWA 1SNOA 1PYWD 4XQQA 5ELEA 1BXTA 3VYRA 1RDPD 5C3WA 3S1NB 4HN7A 4KHVA 2O4XA 1L0XB 3D4WA 3NTKA 4A93B 3S2DB 1NR4A 2EZVA 3BZDB 3ONAB 1STNA 3K59A 4DXGA 3O13A 5EKLA 2LMCB 2VNUD 4RGNA 1Q1BA 2EYHA 1EIGA 1SXTA 4IFDI 2AWNA 2RDGA 2BA0A 2RKSA 3SK5A 4K6DA 1WTOA 1KABA 3A8KE 3OWFA 1HQRD 3VR3A 3NSWA 5I6WA 2WKDA 5IGBA 5IT9E 2NVYB 1SAPA 4RWSC 4FP5D 1GUOA 2B63B 3HEJA 1TWAB 5EPLA 3JAME 2JXMB 1WD0A 2NVQB 3NTIA 1SE4A 4DN4M 1BBXC 3HRZC 2EYMA 4LMQD 1HUMA 2E2JB 3DEOA 4BA2I 5FO7B 1PTOH 2BDOA 2BCOA 2VB3X 1CA6A 4F8MA 1Z6HA 5FKAC 5IIFA 5T1GA 2E2IB 5C4XB 1FD7D 3K58A 4HCSA 1IL8A 1FGBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  1EZ8 A;  4G57 A;  5E3F A;  1U9R A;  1TT2 A;  2F0V A;  5HGT A;  3NP8 A;  2EYF A;  3MEH A;  4HMI A;  4KJO A;  4RKL A;  5K5P A;  1JOO A;  2F3V A;  3SHL A;  5DAU A;  3T16 A;  4HTH A;  4S3S A;  5IOC A;  2F0D A;  1NSN S;  3P75 A;  5KRU A;  3EJI A;  1STN A;  4KD4 A;  4LAA A;  3SR1 A;  5CC4 A;  1EYA A;  2F0U A;  2PZT A;  4E6I A;  2F3W A;  3TP8 A;  2EXZ A;  2EY6 A;  5EKL A;  2OXP A;  4QF4 A;  3NHH A;  2EYJ A;  1RKN A;  3TP5 A;  4QMG A;  1SND A;  1JOK A;  4B9W A;  3ITP A;  4DF7 A;  1SYG A;  1EYD A;  5I9P A;  2QDB A;  1NUC A;  4J1M A;  2EYH A;  2EY2 A;  2F0N A;  4J6H A;  2EY1 A;  1F2Z A;  5HUR A;  1A3U A;  5I6Y A;  1SNP A;  5DEH A;  2RKS A;  1A2T A;  3MVV A;  5C3X A;  2F0Q A;  5E1F A;  3SK5 A;  4F7X A;  3DHQ A;  2SNM A;  3PMF A;  4K6D A;  1KAB A;  2F0E A;  4NMZ A;  5JOB A;  3OWF A;  3NK9 A;  1SYF A;  2M00 A;  1SNM A;  5IGC A;  5CV5 A;  3P1H A;  4KTA A;  2HQE A;  2F0O A;  4DGZ A;  2KQ3 A;  1SNQ A;  3MXP A;  4R8N A;  1STA A;  5C4Z A;  1EQV A;  5CV8 A;  2F0F A;  5CV9 A;  4PMB A;  3R3O A;  1EY6 A;  5I6W A;  3QOJ A;  4NKL A;  2SOB A;  3H6M A;  5IGB A;  4ME5 A;  1II3 A;  5JAV A;  4B9X A;  5KYI A;  5J22 A;  4DFA A;  4ZQ3 A;  1SNC A;  5CV4 A;  1JOR A;  3SK4 A;  3LX0 A;  4K14 A;  2F0T A;  3QB3 A;  2F0L A;  3ERQ A;  3OSO A;  3T13 A;  1STH A;  4N9T A;  3TME A;  1AEX A;  2F0K A;  3DMU A;  4K8J A;  4KJN A;  5C5M A;  1EY7 A;  5EKK A;  1A3T A;  3HEJ A;  4EQO A;  5I9O A;  1ENA A;  2ENB A;  2F0J A;  1F2Y A;  3QOL A;  2F0W A;  4H7B A;  4HMJ A;  3ERO A;  2OF1 A;  4K8I A;  4MIU A;  2PZU A;  5CR3 A;  3NUC A;  4DU9 A;  2RBM A;  4EQN A;  5IOD A;  5KYL A;  1SYE A;  5C5L A;  2OEO A;  5CV6 A;  1KDA A;  4EQP A;  2NUC A;  1EY5 A;  1SYD A;  2SNS A;  5KEE A;  2KHS A;  4N9P A;  3C1F A;  5IGF A;  1STY A;  4TRD A;  1A3V A;  4K5V A;  1TR5 A;  3TP6 A;  3D6C A;  3MZ5 A;  3OMC A;  2PQE A;  3NQT A;  4IUN A;  4KY6 A;  2F0I A;  2EY5 A;  4QB4 A;  5EGT A;  3TP7 A;  2EYM A;  1KDC A;  5KIX A;  1EYC A;  2F0M A;  4ID6 A;  5IGE A;  1A2U A;  2F0P A;  1SYC A;  4IAL A;  3SK6 A;  4KD3 A;  3S9W A;  3NXW A;  3D4D A;  2RDF A;  5C6A A;  5IGG A;  4IZ8 A;  3SK8 A;  4PMC A;  4WOR A;  4KY7 A;  3RUZ A;  1F2M A;  1IHZ A;  2PZW A;  4KY5 A;  5F2D A;  1ENC A;  3VA5 A;  4ODG A;  2LKV A;  4YIJ A;  4PNY A;  4K5W A;  2EYO A;  4OL7 A;  2F0S A;  2PYK A;  3C1E A;  1SNO A;  3MHB A;  4K5X A;  5J1Z A;  5CGK A;  4RKB A;  5ISR A;  4ZUJ A;  4K2L A;  5CV7 A;  2PW7 A;  2EYL A;  5C4H A;  5C3W A;  3BDL A;  4KV6 A;  3U9O A;  3HZX A;  4F8M A;  5IGD A;  4NDX A;  2EYP A;  3EVQ A;  4KHV A;  5IIF A;  4EVO A;  3D8G A;  3BDC A;  1SYB A;  2O4X A;  5M9O A;  1JOQ A;  1KDB A;  4K2K A;  2PW5 A;  4ZUI A;  1EY0 A;  2F0H A;  3SXH A;  1EZ6 A;  4I65 A;  1STB A;  1EY4 A;  3D4W A;  4NP5 A;  1TQO A;  3E5S A;  5KGU A;  5NUC A;  5J39 A;  1KAA A;  2F0G A;  4WRD A;  1STG A;  1EY9 A;  3V2T A;  2WAC A;  1EY8 A; 
#chains in the Genus database with same CATH topology
 1EEI D;  4A3E B;  3R93 A;  2A6E D;  4DV2 L;  1OXX K;  4C2M B;  2XN9 C;  1TWH H;  5IOC A;  5M5W B;  1EYA A;  3I4M G;  5DLQ E;  4JV5 Q;  1NNX A;  2F52 A;  3HOV G;  4DR3 Q;  1MJE A;  1KHI A;  2RHS B;  2A1A A;  4MTN A;  4X64 Q;  1X32 A;  4GLA C;  4Q0F A;  1VDZ A;  2UXB L;  4P2C B;  4IFD J;  4WJ3 M;  2NYZ D;  3NK9 A;  4B3R L;  3OTO L;  1B8A A;  1X3G A;  2K50 A;  3ZJY C;  4Y7N B;  2L9H A;  4DGZ A;  4JI0 L;  1XTC D;  3GTJ B;  5D65 A;  1I5F A;  1PFN A;  5JPM C;  3F8T A;  3PIO 3;  4JI4 Q;  3DWQ A;  3H6M A;  2AQ2 B;  4ME5 A;  3BVG A;  4KHP Q;  2PO4 A;  5GAG C;  3LGJ A;  4WJ4 A;  5J3B A;  5C3E H;  3S1R B;  4X66 Q;  3M4Q A;  5JJZ A;  1PTO D;  4BY7 B;  4EQO A;  5I9O A;  4TRD A;  5FJ8 H;  2R3Z A;  1ZKO A;  1YEZ A;  3NUC A;  1VQC A;  5M5X H;  4DUZ Q;  1TY0 A;  5KNC A;  2IT1 A;  2PMZ B;  4IUP A;  2M9V A;  1SYD A;  1HR0 L;  1QNK A;  3MWY W;  4M1U B;  4EX5 A;  1O80 A;  2CQA A;  1TR5 A;  1BQQ T;  5JJL A;  5EGT A;  1BR9 A;  3T1Y Q;  1XMO L;  3RN2 A;  4LF8 L;  1X3F A;  4RAU C;  2KEE A;  1PTO F;  1L1O A;  2CWA A;  2NVX H;  3OIP A;  1XWE A;  4A3J G;  4FXK C;  3D0F A;  3GTL B;  1GD7 A;  2PZW A;  2ZTD A;  1IBM Q;  3VR6 A;  4J8Q A;  1K28 A;  3KJP A;  1KAW A;  1PH8 A;  4V19 0;  2Q2I A;  3C1E A;  5BN3 A;  4LF7 Q;  4UP8 A;  1S5E D;  1WJJ A;  2CW0 C;  2EIF A;  3FEW X;  1XNQ L;  4M8A A;  1CKN A;  1J5E L;  4DK1 A;  2Q2U A;  1DOL A;  3I56 A;  2JP1 A;  1VQA A;  3T56 B;  4MZ9 A;  3MTS A;  4DR4 Q;  1PDQ A;  5CYU A;  1MKH A;  4DV4 L;  1EL0 A;  1BCP C;  3E5S A;  4KLK A;  3M85 A;  4KN4 C;  1JB7 A;  4X6A H;  1I50 B;  1F9P A;  2A19 A;  3I4O A;  4K8I A;  1PFM A;  3VYT A;  2ES2 A;  1LYL A;  4S3S A;  4DV1 Q;  4GKK Q;  4A3F B;  2E8G A;  4A3B B;  4JI5 L;  1IYU A;  1O7L A;  1YNJ D;  1AN8 A;  4X3T A;  4DK0 A;  3CP0 A;  4JBJ A;  2EYJ A;  4PZ6 A;  1C8C A;  2K75 A;  3A8J E;  2D0P A;  1NUC A;  5ELC A;  1TS2 A;  1F2Z A;  1LAC A;  2DNE A;  4HAE A;  3PO2 H;  1EIY B;  2E74 C;  3SE0 A;  3P1H A;  2IX3 A;  4GS3 A;  1HNW Q;  1LAB A;  1SNQ A;  4PMW A;  1QVF A;  2HIX A;  2DUD A;  3GTQ B;  1SLJ A;  4OWT B;  2ZM6 L;  4IQZ A;  3KLW A;  5J22 A;  1K83 H;  2OWO A;  3S1M B;  2F0T A;  1GUG A;  3BU2 A;  3HOU B;  4C3H G;  1GJX A;  4IJL A;  4ULL A;  3KBX A;  4AQY L;  1QB5 D;  2QEJ C;  3A8I E;  2E2H B;  1TS5 A;  2XTI A;  1D1K A;  2K04 A;  1U5K A;  1G2S A;  2ZTE A;  2PNR C;  4P71 A;  2C35 B;  1VQF A;  4ZKC B;  3BVM A;  2IY5 B;  1YNN C;  3PO3 G;  2WV6 D;  3TDQ A;  3NEL A;  5D14 A;  2I5M X;  2Z6B A;  2PQE A;  3NQT A;  2R92 H;  1MI2 A;  4TKO B;  1KXL A;  3K6O A;  1SSO A;  3GTG B;  1GUT A;  4CDD C;  3BDO A;  3BYT B;  3I91 A;  2H1E A;  3IFT A;  3EQL C;  4V0B A;  3TS2 A;  1I6V C;  4Q5V A;  4IFD H;  1VQJ A;  3DM1 A;  1PH9 A;  5IYB G;  3FDT A;  1ICW A;  1JE5 A;  4K5W A;  2EYO A;  1BVS A;  2PYK A;  1V1Q A;  5CGK A;  1CQF A;  4RKB A;  5CV7 A;  1N32 L;  4UY8 C;  2JA6 B;  2B2Y C;  4JI7 L;  1TVX A;  3HKZ B;  4IUU A;  2B8F A;  1MJC A;  2ALY B;  3IFD A;  2JA5 B;  4NPS A;  4LFA Q;  3MXG A;  3CD6 A;  1VQ4 A;  1CKM A;  4K0K Q;  1EFI D;  1TKW B;  2FHT A;  1E3P A;  4AYB G;  2KCM A;  1B4O A;  1U9R A;  1XTD A;  5M3M G;  1VQ8 A;  3RZD B;  1X9N A;  1YI2 A;  1QVC A;  3AU7 A;  1WTV A;  3NP8 A;  2H5X A;  2EJG C;  2JA7 H;  2F3V A;  3GTO B;  3VR5 A;  4LAA A;  4C3J G;  3Q24 A;  3Q6S A;  4OX9 Q;  4FF4 A;  2DNC A;  2V1C C;  1NMF A;  2OXP A;  3NHH A;  4O42 A;  1AZQ A;  2QGQ A;  4NXN Q;  4DR7 Q;  2K01 A;  4LF9 L;  2MQH A;  3PSI A;  1BBU A;  2B2W C;  3Q23 A;  3H3V I;  1CM9 A;  2F0Q A;  4P72 A;  3PMF A;  2PQA B;  4QUF A;  5IGC A;  1ZYR C;  4LUZ A;  1JWU D;  1WD1 A;  1GVP A;  4R8N A;  3GTM B;  3S2H B;  1IBL L;  3U4Z A;  5CV9 A;  1HZ9 A;  4XXE A;  3I3C A;  3JAM L;  3HOW B;  3QR8 A;  5CBE E;  5H1S E;  4LFC Q;  1RCV D;  1MSG A;  3R2T A;  1YHQ A;  1STE A;  2F0J A;  4H7B A;  3RLF A;  3ERO A;  3SDZ A;  3M4O B;  4NXM L;  1KQS A;  1I94 L;  4OXP A;  1YJ9 A;  1JCK B;  1CUK A;  4L5R C;  1STY A;  3HGB A;  4ZK9 B;  1G6P A;  1E0B A;  2IX0 A;  3D6C A;  5C44 G;  2E5L L;  3TP7 A;  1KDC A;  1Q8K A;  1U4L A;  3M4P A;  2K5H A;  2VL6 A;  1BOS A;  1ESF A;  3G71 A;  4A3J B;  2FXQ A;  4A3G H;  1I4Q A;  1ZXT A;  2L0C A;  3BYY B;  3E9I A;  3K7A H;  4YHH Q;  2EE1 A;  2DN8 A;  4YY3 L;  1QUQ B;  5IGG A;  2BDN A;  3TS0 A;  1PH6 A;  3K5L A;  3HOZ B;  1CHP D;  1BDO A;  4XT3 B;  2R7Z B;  1EIF A;  5GAD C;  1N33 Q;  1U0L A;  1F9S A;  4OEL B;  2WII B;  1DM0 B;  1Y1W G;  2R93 H;  2I07 B;  1SYB A;  3I73 A;  1PRT D;  4QCL A;  1STB A;  4BBS B;  3E0J A;  2QEX A;  4HSV A;  4HJ9 A;  1N36 Q;  2JQO A;  4CKE A;  2P5Z X;  1NCV A;  3W2D A;  2VUM H;  2KHS A;  1JB3 A;  1G8Z D;  2KUM A;  2OQK A;  4LF4 Q;  1DZ1 A;  1R9T B;  5LL6 X;  1R4Q B;  2RSO A;  3MEF A;  4XQJ A;  4PG3 A;  1JOO A;  2UUC Q;  2D2C C;  4DUY L;  1VQL A;  3VYU A;  3J7Y W;  4U67 3;  1E24 A;  1RHP A;  2YTV A;  1PRT F;  1YJN A;  4IPD A;  1UUP A;  3TBI B;  5CBA E;  1QVG A;  3HOX H;  1X56 A;  1K3R A;  4DR5 L;  3KF8 A;  4P73 A;  2EY1 A;  1SNP A;  4RCO A;  1JC7 A;  2HD3 A;  1HHV A;  2LS0 1;  1LTA D;  5JOB A;  4GZY C;  2NZH A;  3LWE A;  5D3I B;  5CV5 A;  1TWC B;  4CBV A;  1KNA A;  4IOA A;  2MO0 A;  2A69 C;  2DGY A;  3IRB A;  4FDB A;  4IUT A;  4UP7 A;  5JAV A;  5KNB A;  5KYI A;  4JI3 Q;  1ZEQ X;  1DCZ A;  4C3H B;  1JIC A;  3RD4 A;  5ELB A;  5LMN L;  4KI0 A;  3QB3 A;  4ILW A;  2XGT A;  5A2Q L;  1VQI A;  4IJH A;  1O7I A;  3GTP H;  3F1Z A;  1ENA A;  2HHH L;  3HOY H;  3AQQ A;  2F0W A;  2K1B A;  4GNX C;  2PZU A;  2BE5 C;  4KKS A;  1HZA A;  1C7Y A;  2Z1C A;  3D31 A;  1F2L A;  3FPP A;  1LTG D;  4K5V A;  1CA5 A;  2LSS A;  2K4K A;  3CQZ B;  1EYC A;  2XWB B;  1Y8O B;  3PUV A;  3SK6 A;  2GVB A;  1JT8 A;  2RA4 A;  3A0J A;  4DR6 L;  3CC4 A;  3H0G B;  3P20 A;  2YU9 H;  1IHZ A;  1EQR A;  1WCM B;  1P16 A;  1IW7 D;  1FL0 A;  1XX8 A;  3OWE B;  4PNY A;  3KDF B;  1FJG Q;  2B29 A;  2Q2H A;  2LXJ A;  4NDX A;  1AFP A;  3I8Z A;  5M9O A;  4B3S Q;  1EWI A;  3K5N A;  1ASY A;  4XT1 B;  1I6H B;  1EY4 A;  2JA8 H;  2V4D A;  2MO1 A;  4DV2 Q;  4FNF A;  5IGF A;  2JN4 A;  1Q7Y C;  5C3E G;  3MXN A;  4UP9 A;  4WFN 3;  2K03 A;  2K33 A;  4KKT A;  1IBK L;  3J81 E;  5K5P A;  4ABN A;  2N3S A;  5FJ8 G;  1KLG D;  3S1N H;  1ONL A;  2A68 C;  4CHT B;  4KD4 A;  3K57 A;  4OWW B;  4RCN A;  4A75 A;  1LT4 D;  2A6H D;  3GV3 A;  5EPJ A;  1U4R A;  5DNF A;  1QG7 A;  4L5T A;  4Y52 H;  1JWM D;  2NN6 I;  2PMZ E;  2UXB Q;  1Q1E A;  4B3R Q;  2B2T A;  3S1Q B;  5EJW A;  1HA5 A;  5BN5 A;  3OTO Q;  1P8L A;  4LF5 Q;  1A3U A;  4JI0 Q;  4ZAI A;  3F2C A;  3QIA A;  5M5Y B;  1Y8N B;  1MGS A;  1E2Z A;  4OIJ A;  4C1N I;  2VQE L;  3S14 H;  3PUY A;  3ND8 A;  4L5S A;  2WAQ B;  1II3 A;  4DPG A;  4B9X A;  1X3P A;  1SNC A;  2K5W A;  5EPK A;  1CI3 M;  1SMY C;  4UAI A;  3LX0 A;  3OSO A;  1KL9 A;  1RL2 A;  5C4J H;  3CW2 C;  1E1T A;  1M90 C;  3F2B A;  1HR0 Q;  2B2V C;  1B1Z A;  2RSN A;  3GTK B;  1GUN A;  3CRK C;  2Z8L A;  2OEO A;  4JVZ A;  3RZO H;  2I5L X;  1M1K C;  1X65 A;  2C9O A;  3FP9 A;  3QJY A;  1XMO Q;  1PH2 A;  2AMC B;  3S17 B;  4LF8 Q;  2Z4H A;  3OYY A;  1RTO A;  1EOV A;  3TP6 A;  1NMG A;  1HZC A;  3S15 B;  2MPM A;  2PCF B;  4Z9C B;  2OQ0 A;  2HCC A;  1FR3 A;  1TWA H;  2GVA A;  1KLU D;  3UI2 A;  4TVA B;  4N8F A;  1DJR D;  2G5D A;  1XNQ Q;  2AHO B;  5IWA L;  1OXT A;  3V05 A;  1J5E Q;  2HQL A;  2NVQ H;  2EXD A;  4OON A;  4ODG A;  2LKV A;  1CSP A;  3MHB A;  1VF7 A;  1Y1W B;  3D3R A;  1HFG A;  1C4Q A;  4DV4 Q;  3FPU B;  4KV6 A;  3PO2 G;  3CXC A;  3AFQ A;  3L0O A;  5I2Y A;  2KA7 A;  1GUW A;  1JOQ A;  1KNE A;  4A3I B;  3OHX C;  5ELD A;  2NWG A;  2F03 A;  4ZCK A;  5CMD A;  5E3F A;  3DWA A;  3FKI H;  2O2L D;  4JI5 Q;  1Q81 C;  1L0Y B;  5BR8 L;  1UEB A;  3WOF A;  1J9O A;  1K0S A;  1SJH D;  1K3B C;  5KRU A;  1SR3 A;  2E2I H;  2XWJ B;  2KCC A;  1FNU A;  3PUW A;  1UWV A;  3TP8 A;  1AP0 A;  4A3C H;  1ROD A;  2EOT A;  1SND A;  1XMQ L;  2VQF L;  2R7D A;  1QE6 A;  2R92 G;  4A3E H;  2F1M A;  1PTO B;  3A55 A;  4X62 L;  1IYJ B;  3VYS A;  4C2M H;  2NVT B;  2FFK B;  4H13 C;  2ZM6 Q;  3DXJ C;  1SNM A;  3CCM A;  5M3F H;  5M5W H;  3I4N H;  4IFD G;  2F0O A;  3MXP A;  2WKC A;  3EN2 A;  5C4Z A;  2N88 A;  1ILP A;  1D5X C;  2KEN A;  1VQ7 A;  3SEB A;  3ER0 A;  4JPB W;  1FYC A;  1GOZ A;  3L2P A;  4AQY Q;  4R4O A;  4R4C A;  5GRO A;  1HNX L;  1Y1V B;  1UE7 A;  3RR5 A;  3K0X A;  1X3Q A;  1D5Z C;  1F2Y A;  2XSC A;  5KYL A;  3HKZ E;  4RGO S;  4K6L A;  1KDA A;  4EQP A;  3MA2 B;  4A3M B;  4CJ1 B;  4OIK A;  1S5F D;  2K5Q A;  4N9P A;  3PCO B;  1S72 A;  2Q2T A;  1KIX A;  1U4M A;  3K7U C;  1WTH A;  3CAM A;  1HR0 W;  2UXD L;  3MZ5 A;  2JA7 G;  4KY6 A;  3S1R H;  4BY1 H;  3S16 H;  1D1I A;  3CRL C;  1CZG A;  1H9S B;  1LTB D;  1X54 A;  2IHE A;  2NTS A;  4WOR A;  1N32 Q;  5IYD H;  1EOT A;  2VY3 A;  3I72 A;  4JI7 Q;  4OL7 A;  1W3S A;  2XRQ D;  2K5V A;  5A2Q E;  1T9H A;  2PW7 A;  3BVZ A;  5C4H A;  3CC2 A;  5FLM H;  4GOP B;  5IGD A;  2OCE A;  1XJV A;  3EVQ A;  4BXX H;  4H02 A;  1EU4 A;  3NBI A;  1EY0 A;  1S5B D;  2F0H A;  1LUZ A;  3W1B A;  3H91 A;  3GTL H;  5C3E B;  4BBR B;  1SRO A;  2N78 A;  2RHQ B;  2WB1 E;  2D0O A;  3X3N A;  1X3E A;  4J15 A;  5M5X B;  4G7H C;  1HCZ A;  3GD7 A;  3JC6 6;  1VQ9 A;  4LF9 Q;  5EBD A;  1XPR A;  4JYA L;  2NZ1 D;  3HS0 C;  1UNS A;  3M4Y A;  5I9P A;  1D8L A;  1BKB A;  1I50 H;  1BBW A;  2TMP A;  3QG1 A;  3J81 i;  3A7L A;  3KYH C;  4DKA C;  2NVX B;  2B2U C;  2RCF A;  3E6Z X;  4A3G G;  1PZI D;  4B3T L;  1IBL Q;  1J8I A;  2HUG A;  1WYD A;  3KK7 A;  4YWM A;  4A3F H;  1I3Q B;  4KTA A;  1JMC A;  4A3B H;  2KQ3 A;  3PGZ A;  4FVM A;  3ULL A;  5CV8 A;  2A5H A;  2K28 A;  3R3O A;  4RGM A;  1GHK A;  1A0I A;  4A3K B;  1KRS A;  1B53 A;  5FO8 B;  1TWF B;  1DXM A;  1SE2 A;  4JI6 Q;  2OTJ A;  4NXM Q;  2GN5 A;  5BN4 A;  3ERQ A;  4F88 A;  1I94 Q;  2R93 G;  3K5O A;  4QQB X;  2YYZ A;  4C3I H;  2Z9H A;  3BZC A;  5IOD A;  1Y14 B;  4OO1 H;  1FGU A;  2YV5 A;  3N52 A;  2E5L Q;  2F4I A;  3GTQ H;  1DGS A;  2B3G A;  4GNX B;  2G9H D;  1EY5 A;  2FMM A;  2VUM G;  2D5D A;  3CU7 A;  1VQO A;  4YWK A;  2AKW B;  3P7J A;  4DNT B;  4YY3 Q;  2XNA C;  1BO0 A;  4IUN A;  3CPW A;  3S1M H;  1CT1 D;  1L2F A;  3J80 E;  4DV0 L;  4ID6 A;  2NN6 H;  3J81 c;  3D4D A;  2WFW A;  4HJ8 A;  1C0A A;  1DOK A;  4KY5 A;  5F2D A;  3HOX G;  3CF5 A;  1O7Z A;  2VZA A;  4FXD A;  4HIM A;  4YIJ A;  1QZH A;  2F0S A;  2JSO A;  3UE1 A;  1S4Z A;  2L1B A;  2EYL A;  3BDL A;  1JJ2 A;  4WJW A;  1G29 1;  2EYP A;  5DM6 3;  4GLV B;  3A74 A;  2Y0S G;  1NY4 A;  2IWH A;  1V1P B;  3A7A B;  1CHQ D;  1JE4 A;  3GTG H;  1G51 A;  4K2K A;  3U50 C;  3OOC A;  1K83 B;  3M7G A;  4NP5 A;  1CTM A;  3J81 L;  1HJP A;  1CKN B;  1S5D D;  2AUJ D;  3I55 A;  2L4N A;  4RH6 A;  4JV5 L;  3OMG A;  1RF2 D;  2A6E C;  1TT2 A;  1N9W A;  4C56 C;  3ULP A;  1VF5 C;  2UUB L;  4PV1 C;  1VQM A;  4HIO A;  2MP1 A;  4UPA A;  3RLO A;  2JA6 H;  2PNH A;  4PZ7 A;  3HOY G;  1O78 A;  4CKB A;  2M2L A;  4DR5 Q;  3UDG A;  2D62 A;  2QKI C;  4IOC A;  2JA5 H;  3L3O C;  5D3D A;  4QF4 A;  4JOI A;  3IL8 A;  3NPP A;  3N6R A;  3PV0 A;  3UDI A;  1UE5 A;  1B2T A;  2F0N A;  3VA7 A;  3CC7 A;  5JEA J;  3H3V C;  1I4G A;  1J6Q A;  4MTK A;  4XIG S;  2HCI A;  1SFO H;  1A2T A;  5C3X A;  1MIU A;  4MHE A;  3GTO H;  3G7L A;  1BNZ A;  1B3A A;  1VQH A;  4IO9 A;  4LF6 L;  2ICI A;  1Q82 C;  1QUQ A;  1Q3L A;  2JA9 A;  2XIW A;  3WWV A;  5LMN Q;  3I4M B;  1OTC A;  5AJ3 L;  2F0F A;  2QIL A;  4ME3 A;  2QW7 A;  3T1H L;  2SOB A;  1GXD C;  2HHH Q;  3HOV B;  5CV4 A;  1GM5 A;  3SK4 A;  1LLR D;  1CQV A;  1PTO C;  2KJX A;  1PZJ D;  3I7F A;  2MGS A;  2ENB A;  3QOL A;  2JA8 G;  1S3O A;  2RBM A;  3J7A 5;  3MFY A;  3GTM H;  3LWU A;  4GKJ Q;  2JA7 B;  1M4V A;  1YZ6 A;  4HJ5 A;  3GO5 A;  4A3D H;  1XYI A;  1VQ6 A;  4XDX A;  3HOW H;  1EQQ A;  4DR6 Q;  4NW2 A;  3STB D;  4F87 A;  5LHY 1;  1HFN A;  5FO9 B;  2RDF A;  4DK3 C;  5EAY A;  1V8Q A;  1PV4 A;  4FYD A;  3VA5 A;  3PIP A;  3MC0 B;  2N49 A;  4POG A;  4CDF C;  1RJT A;  1E1O A;  3BZK A;  4JI1 L;  1B50 A;  3TSS A;  2IPK D;  1N34 L;  4QJF A;  4GN3 B;  4ZUI A;  1IL2 A;  4GKK L;  1TWG B;  3HOZ H;  1IBK Q;  4KMU C;  4A3L H;  1STG A;  5FOB B;  4KD3 A;  2R7Z H;  2WAQ E;  2CWP A;  3KBG A;  3KF6 B;  5T1I A;  4GOP C;  3Q22 A;  4HED A;  1B9N A;  3TZD A;  1RD9 D;  1C9O A;  4HTH A;  1R4P B;  5IY0 A;  5FK9 C;  1YNJ C;  5C0X I;  3SR1 A;  1A6X A;  4E6I A;  2F0U A;  4RHR A;  5ELF A;  3U9S A;  1H95 A;  5HY6 A;  3EIV A;  4BBS H;  2BOS A;  4MNO A;  4JW0 A;  2ID0 A;  4JK1 C;  4A3G B;  1F9Q A;  1EYD A;  5COY A;  2EY2 A;  1S5C D;  4LUO A;  3DEP A;  2VQE Q;  2L12 A;  1VMP A;  2B8G A;  4QY7 A;  4DV5 L;  3EBE A;  3GV6 A;  1SE8 A;  1Z47 A;  3KUP A;  2MJ8 A;  1VQE A;  3T51 B;  1EY6 A;  1EWC A;  4NKL A;  4X3S A;  2E76 C;  3KDF A;  2WP8 J;  4R1J A;  1FNW A;  2DY7 A;  4CDC C;  4B3S L;  1JOR A;  2ICE C;  2B39 A;  4KJN A;  5LMN W;  2ZXR A;  1RIP A;  1EY7 A;  3E3X A;  4G4K A;  3TZU A;  1O7Y A;  3RUZ A;  1TII D;  1LT5 D;  3HKS A;  2VUM B;  1TWC H;  2LFN A;  1G91 A;  4DAY B;  2CH4 A;  1I4R A;  3FKI G;  5I4D A;  3FRP B;  3OW2 A;  3NWS A;  3M3Y H;  2F0I A;  3GQB A;  4BWG B;  5IWA Q;  2F0P A;  3NTH A;  5JEA H;  1NBW A;  2F4V L;  3HOX B;  1K0R A;  4A3C G;  1QWY A;  1SRU A;  4LK1 C;  1JJC B;  4KY7 A;  4X3U A;  5E4W C;  3T53 B;  1LM0 A;  3DLL A;  2X69 A;  1I4P A;  4A3E G;  3U4V A;  1FVI A;  4K5X A;  3PO3 B;  1EU3 A;  1HTL D;  2L11 A;  3J80 i;  2Y0S B;  4GN4 B;  3SVM A;  3U9O A;  4BA1 I;  5IYC H;  3CQZ H;  1VQN A;  3F2U A;  5M3F G;  2HDL A;  5IP9 H;  3I4N G;  5FLX c;  4CJ2 C;  1K8O A;  2KOL A;  5ELN A;  4IUR A;  3H0G H;  4N8X 1;  1WCM H;  5BR8 Q;  4WRD A;  3V2T A;  1HRJ A;  4LWC A;  4DV3 L;  1B70 B;  1JQY D;  1N8R C;  4HMI A;  3MEH A;  2MNA A;  3B6Y A;  1XMQ Q;  2VQF Q;  5LMU L;  2F3W A;  5FLX L;  1PYB A;  3DWP A;  4YCW A;  2KVM A;  2HDM A;  2EY6 A;  3RLN A;  1Y8P B;  4X62 Q;  1D5M C;  1RKN A;  1JOK A;  3L9A X;  2QDB A;  3CKI B;  4AYB B;  5I6Y A;  1YNX A;  3L7Z C;  4BY1 G;  5HUR A;  1Q12 A;  5M3M B;  3FVQ A;  2A8V A;  1VS0 A;  4GN5 A;  4OO1 I;  4CKC A;  4CGY B;  4ZKB B;  2M00 A;  4JI8 L;  4AIM A;  3NBH B;  5IYD G;  1KD1 C;  2HQE A;  4C3J B;  3J80 c;  5TSS A;  1STA A;  3R8B A;  3STB C;  1NTG A;  1HNX Q;  1KTK A;  3OW7 A;  2X6G A;  4DFA A;  3UE0 A;  5FLM G;  2K32 A;  3GDE A;  4K14 A;  3T13 A;  2F0L A;  1XPU A;  4N9T A;  1PFS A;  3DMU A;  4QIW B;  2JA8 B;  1UEA B;  4A93 H;  4BXX G;  1F77 A;  5M5Y H;  2SDF A;  3MAQ A;  3S2D H;  2OF1 A;  5LL6 S;  1HPC A;  2B2Y A;  3M7N A;  2UXD Q;  3J80 L;  3A5Z B;  2K05 A;  2NUC A;  1QJO A;  5K36 H;  4ZYS A;  2EQS A;  3EA6 A;  1H9R A;  2FIN B;  3OMC A;  4IUV A;  3WOE A;  3J7A F;  3GP7 A;  4DR1 L;  1MSH A;  1SYC A;  1OXS C;  4TQU S;  3CCE A;  2HIV A;  3SK8 A;  1XNR L;  2JEA I;  4JI2 L;  1A63 A;  1AE3 A;  3S17 H;  1DON A;  1W6J A;  4HCE A;  2F3I A;  4ZUJ A;  3A54 A;  5C44 B;  1JJG A;  1YBY A;  2BH2 A;  2CW0 D;  2NVY H;  4A3F G;  3S14 B;  1YVC A;  1PRT C;  4A3B G;  2B2W A;  4IN3 A;  2B63 H;  3H09 A;  2ZT9 C;  2HT1 A;  1BCP D;  4X3K A;  1E2V A;  5C4J B;  4G57 A;  1EZ8 A;  4DNR B;  3K5M A;  4O1N A;  4JYA Q;  4YCV A;  4DNI A;  4QUC A;  4UHV A;  4C3I G;  3SHL A;  2UU9 L;  2KHJ A;  1ET9 A;  3RZO B;  2KCT A;  1AW7 A;  4OO1 G;  3AMU A;  4L6T B;  1ET6 A;  2K52 A;  4A3I H;  3KLR A;  3MXN B;  4P75 A;  2PPB C;  2E2J H;  3EFX D;  1EWH A;  1BUV T;  1B7Y B;  4B3T Q;  3Q8D A;  1OXV A;  1BCP F;  1SYG A;  4I7A A;  4J6H A;  3X3M A;  1PXU A;  3K8A A;  4I7Z C;  3WDN A;  2NN6 G;  2SNM A;  5I2X A;  1LO5 D;  4JC0 A;  1H9S A;  2G9D A;  3I90 A;  2UUA L;  1SEB D;  4PMB A;  5C4X H;  3J7A V;  2CKZ B;  3K80 C;  3A56 A;  1D6E C;  2I5H A;  3KLS A;  1IKM A;  4GOP A;  3J7Z C;  3IKJ A;  4HSP A;  1VQP A;  4HMJ A;  4R8I A;  4KKU A;  1AZP A;  4FF3 A;  1PMR A;  3FKI B;  4DAV A;  2ZXO A;  2IX1 A;  4R4Q A;  4MN3 A;  4YWL A;  2R6G A;  4DV0 Q;  2UXC L;  1IXR A;  2JE6 I;  2ZXP A;  4L8J A;  3K0Y A;  3I4L A;  3J81 j;  5C0X H;  1YNN D;  2JA6 G;  3V96 A;  1Y1V H;  1YHB A;  3HKZ G;  1GUS A;  1CFM A;  1AH9 A;  1HXY D;  1U4P A;  1VQK A;  1GKH A;  1HNZ L;  1MBY A;  2CQO A;  2VW9 A;  4JCV E;  3URY A;  1IW7 C;  4C1N K;  1UAP A;  4A3M H;  1ENC A;  1TU2 B;  4UDU C;  4Y7N H;  4H44 C;  4LFB L;  5J1Z A;  4B08 A;  4P74 A;  1ESR A;  1W6K A;  3NQI A;  3GTJ H;  1PYS B;  2C5C A;  5M3F B;  3I4N B;  1TWH B;  3D8G A;  4QGU A;  1KDB A;  1Q46 A;  4DK6 C;  2EVB A;  2WIN B;  4HR7 B;  2J7Z A;  1WTX A;  2Q8R E;  4BY7 H;  5J39 A;  1MHW C;  2UUB Q;  1KAA A;  2F0G A;  1EY9 A;  1GO3 E;  2L5T A;  1EY8 A;  1LTL A;  2KEC A;  4RHS A;  1TY2 A;  5HGT A;  1IZ6 A;  4LF5 L;  3G6J B;  3T16 A;  2DY8 A;  1HA6 A;  2F0D A;  1NSN S;  3P75 A;  2A6H C;  5GQO A;  1Z9F A;  2RVL A;  2WB1 G;  5E4X A;  2EXZ A;  2NZO A;  3DM3 A;  1TS3 A;  4BBR H;  4GNX A;  4BY1 B;  3TP5 A;  4A3D G;  4OHJ A;  3S16 B;  3HOW G;  2XRS D;  4LF6 Q;  1T5E A;  1YIT A;  4JBW A;  4DV7 L;  4DV6 L;  3CPF A;  1YIJ A;  3ULJ A;  5AJ3 Q;  3DHQ A;  1EEF D;  4HJ7 A;  4IPG A;  2F0E A;  4FF1 A;  1SYF A;  1WTQ A;  3T1H Q;  3C3L A;  4O0A A;  4LUV A;  4FF2 A;  1ZYR D;  2J0T D;  1HH2 P;  4DR2 L;  3E9H A;  3LNN A;  3NEM A;  2QCP X;  1DD2 A;  4EGV A;  1AE2 A;  4NB3 A;  3RNU A;  5JVG 3;  1AEX A;  2R61 A;  5L37 A;  4OGQ C;  4DAP A;  1LT6 D;  3K81 C;  1WTW A;  1V1P A;  5FLX E;  1XPO A;  5KND A;  4EQN A;  1I3Q H;  3PIO A;  4LNQ A;  3HOZ G;  4A3L G;  3PUZ A;  1YHA A;  2RCN A;  1K73 C;  2NB0 A;  4X65 L;  5KEE A;  1QOH A;  5EQ0 A;  3TRZ A;  3C1F A;  2R7Z G;  1UE6 A;  4A3K H;  5HGQ A;  4B3M L;  4L5Q A;  1TWF H;  1WFQ A;  2QF7 A;  4JG2 A;  2EJM A;  1SJE D;  4G7Z C;  4RGT A;  4BBS G;  2IHF A;  2BH8 A;  4IUQ A;  4PMC A;  4JI1 Q;  1G6Z A;  2DJF C;  2RDH A;  4ZLT F;  2N55 A;  4RG1 A;  1B9M A;  1N34 Q;  4DXF A;  2A73 B;  4XQN A;  1VQD A;  2LXK A;  5JVH 3;  1M8A A;  3HZX A;  2O5J C;  3PUX A;  4EVO A;  3BDC A;  1B44 D;  2JEB I;  3SXH A;  3HOU H;  1EZ6 A;  1ICF B;  4LJZ C;  1TXY A;  1H9M A;  5KGU A;  5NUC A;  1PFB A;  1PHJ A;  2E2H H;  4C3I B;  5IP7 H;  4POF A;  1H9J A;  4BS9 A;  1LT3 D;  2L15 A;  1E2W A;  3C2P A;  1B3Q A;  2EYF A;  2Z6K C;  2ZJQ A;  3PO2 B;  1PH5 A;  2IL8 A;  2SEB D;  1L1O B;  1ENF A;  4KN7 C;  4CJ0 B;  3OIQ A;  4GLX A;  2D9U A;  3NWT A;  2PQA A;  1QCB D;  5DM7 3;  2B2V A;  3ND9 A;  1BF4 A;  2I46 A;  1JWS D;  3TN2 A;  1VQ5 A;  3CCL A;  4J1M A;  2JK8 A;  2X6L A;  4DV5 Q;  1PA6 A;  5DEH A;  1K8G A;  3IAY A;  4DUY Q;  4F7X A;  2LY7 A;  3TRE A;  5JEA G;  1A15 A;  3ZYY X;  3F2D A;  4DR3 L;  3HFZ B;  2KED A;  4X64 L;  3KJO A;  3AYH B;  4ALP A;  2A69 D;  1WTP A;  2KHI A;  1OO9 B;  2CHB D;  3JAM i;  2YTY A;  4ZRZ A;  2R92 B;  5IYC G;  2AQ1 B;  1KRT A;  1S40 A;  2O5I C;  1HQM C;  4JI4 L;  1PZK D;  1EQT A;  2Y0S E;  3VDY A;  3G6E A;  5GAE C;  5IP9 G;  5EKK A;  1HUN A;  4KHP L;  4RA8 A;  3RZD H;  4FO2 A;  4MIU A;  4DU9 A;  5CR3 A;  3TQY A;  3H0G G;  1SYE A;  2NBF A;  2B2T C;  5C5L A;  4X66 L;  1WCM G;  2BE5 D;  3FMC A;  4KK7 A;  5A35 A;  3BS1 A;  3A5U A;  3I4M H;  4KHZ A;  1Q8I A;  2L55 A;  1A3V A;  4DUZ L;  1E7Z A;  2F4V Q;  3PIP 3;  3HOV H;  5JPN C;  2EY5 A;  3CHB D;  3KF6 A;  1K8M A;  4R9W A;  1H9K A;  1QIL A;  1SDF A;  2E2D C;  2K6A A;  2F0M A;  1PH7 A;  1F9R A;  2K7V A;  2R7F A;  1EYG A;  4IZ8 A;  3T1Y L;  2IJ0 A;  1K8A C;  5EBC A;  1UE1 A;  3VR2 A;  1SFO B;  5IT9 c;  2ZJR A;  2FJ2 A;  2CFM A;  3S2H H;  4K2L A;  2KBN A;  1K9M C;  1IBM L;  3HG9 A;  4AYB E;  3I70 A;  3NE5 B;  1TS4 A;  1LTS D;  4LF7 L;  1I4X A;  1V1O A;  2IW3 A;  1PH1 A;  2PW5 A;  4DV3 Q;  3JAM c;  4JBK A;  4PQX A;  1W2B A;  4I65 A;  1TQO A;  2JYO A;  1PRT B;  5G3L D;  2KCN A;  1Y69 U;  1NJI C;  4DR4 L;  3M4O H;  3E0E A;  3MXU A;  1ML0 D;  4H0L C;  5IT9 L;  2F0V A;  5LMU Q;  4A93 G;  4KJO A;  5DAU A;  3MFG A;  4L63 B;  2WB1 B;  4QIW E;  3ERS X;  3ICE A;  2A68 D;  2PZT A;  4A3D B;  4DAY A;  1TWG H;  4A3J H;  5K36 G;  4DV1 L;  5G3L F;  2WAQ G;  4B9W A;  3U58 A;  3PF4 A;  2Z4I A;  4JI8 Q;  4A4I A;  3CMA A;  4JI6 L;  2EPB A;  4OWX B;  3DUZ A;  2Q8I B;  1PVO A;  2MUY A;  4NMZ A;  1GHJ A;  3CCU A;  1HTP A;  1VMC A;  2GA4 B;  2MFI A;  4HJA A;  2CVR A;  1MD2 D;  1C48 A;  3QOJ A;  5GAH C;  4G7O C;  4ZQ3 A;  2VXW A;  1HNW L;  3QWN A;  1X55 A;  2JJQ A;  1STH A;  1SMY D;  2F0K A;  4K8J A;  3Q0A A;  4PZ8 A;  1NAP A;  2EDG A;  3K7A B;  2B63 G;  1LTT D;  1R9T H;  1RTN A;  2J4X A;  1IKL A;  5CV6 A;  1KC8 C;  1CK1 A;  4DA2 A;  2SNS A;  4DR1 Q;  1IYV A;  3H94 A;  4LW1 A;  4QB4 A;  2PI2 E;  1XNR Q;  1X6O A;  3CME A;  5KIX A;  2R93 B;  4JI2 Q;  2CCZ A;  4IAL A;  4A3I G;  3S9W A;  3NXW A;  1QNU A;  2XVS A;  4OEM B;  5C6A A;  3HP3 A;  4JBM A;  1T5X D;  1F2M A;  1WI5 A;  5ISR A;  1SE3 A;  2NTT A;  1PH4 A;  1DYQ A;  2A74 C;  4C3H H;  1EFW A;  2AUK A;  2B2U A;  2BA1 A;  3NBH A;  2K5D A;  2RQX A;  5C4X G;  5COR A;  3W1G A;  2UU9 Q;  2WAC A;  3R2I A;  2FMC A;  1XXG A;  3RMH A;  4YCU A;  4LFA L;  3PO3 H;  1D2B A;  4RKL A;  4K0K L;  4DAM A;  3KLS X;  1OXU A;  2MHV A;  1QZG A;  2E75 C;  3EJI A;  4XYO A;  2OT2 A;  5CC4 A;  1YJW A;  3M3Y B;  1Q86 C;  4QMG A;  4DF7 A;  3ITP A;  5C0X G;  1V43 A;  3SGI A;  5IYB H;  1LV9 A;  1G2T A;  4OX9 L;  2AWO A;  4CDE C;  1Y1V G;  3QO2 A;  2UUA Q;  3MVV A;  4NXN L;  5E1F A;  1Q90 A;  2AQ3 B;  4DR7 L;  1CSQ A;  3CCR A;  3W3A A;  1WTR A;  2Z0S A;  3GTP B;  3BG3 A;  4EQ5 A;  3HOY B;  1EIH A;  1L1O C;  4TSS A;  1L0W A;  3D6W A;  1EUJ A;  4XYQ A;  4A3M G;  1EQV A;  1PLF A;  2I0Q A;  1WOC A;  3W5O A;  4GKJ L;  1I6H H;  5C0X J;  1WVL A;  2EJF C;  5M3M H;  3TME A;  5IGE A;  2Z6K A;  5C5M A;  1DOM A;  1VQG A;  2H4O A;  3D4R A;  3AFP A;  1A3T A;  3M9B A;  2QA4 A;  1NR2 A;  1VQB A;  1FNV A;  4RFB A;  2UXC Q;  4U68 A;  4XTC S;  2RF4 A;  3C46 A;  2YU9 B;  4C3J H;  2OTL A;  2VB2 X;  4BY7 G;  4LFC L;  1A62 A;  1Z7T A;  1PH3 A;  1ILQ A;  3KF8 B;  1I4H A;  3T4A C;  3TEH B;  1HNZ Q;  2PI2 A;  2Q8T A;  3S1Q H;  1A2U A;  2YTX A;  1LTI D;  3VR4 A;  2TSS A;  4FXG C;  4LFB Q;  5EKI A;  3AB9 A;  1BCP B;  4BBR G;  1JR0 D;  1VCI A;  5AFW A;  3OPO A;  4YHH L;  1LTR D;  1SBB B;  1CZW A;  1SNO A;  1PYW D;  4XQQ A;  5ELE A;  1BXT A;  5ELO A;  2ZTC A;  3VYR A;  3PF5 A;  1V9P A;  3G4S A;  1RDP D;  5C3W A;  3AEV A;  3S1N B;  4HN7 A;  4KHV A;  2O4X A;  1L0X B;  4HID A;  4APV A;  1CKO A;  1N33 L;  3I2Z A;  3D4W A;  3NTK A;  2ASB A;  4IPC A;  3KFU A;  3GTK H;  4A93 B;  5JJK A;  5JJI A;  3CCQ A;  1A8V A;  4R4T A;  3S2D B;  3H15 A;  5C44 H;  1NR4 A;  1N36 L;  3PQI A;  2EZV A;  1D7Q A;  3BZD B;  4LF4 L;  3ONA B;  3S15 H;  1STN A;  2ZJP A;  3UDF A;  3CCS A;  3K59 A;  4DXG A;  3O13 A;  2K5N A;  5EKL A;  4DV6 Q;  4DV7 Q;  2UUC L;  2LMC B;  2VNU D;  5IE8 A;  4A3K G;  4RGN A;  5E7N A;  1Q1B A;  2EYH A;  1EIG A;  1SXT A;  4IFD I;  2AWN A;  2RDG A;  2BA0 A;  2RKS A;  2QDL A;  4DR2 Q;  3SK5 A;  4K6D A;  3RN5 A;  1WTO A;  1KAB A;  3A8K E;  3OWF A;  1Y1W H;  2N8N A;  2VS1 A;  4HIK A;  1HQR D;  3VR3 A;  1E22 A;  3NSW A;  5I6W A;  2WKD A;  4R4I A;  5IGB A;  5IT9 E;  2NVY B;  1SAP A;  4RWS C;  4FP5 D;  1GUO A;  2B63 B;  4JI3 L;  4X65 Q;  3HEJ A;  2ATW A;  3H3V H;  1TWA B;  2CH4 W;  4JOI C;  3HOU G;  5EPL A;  3JAM E;  2JXM B;  1WD0 A;  4B3M Q;  2NVQ B;  5IP7 G;  3BJU A;  3NTI A;  3NEN A;  4RMF A;  1SE4 A;  4QL5 A;  3CCJ A;  3G48 A;  4DN4 M;  1NE3 A;  1BBX C;  3HRZ C;  2EYM A;  4LMQ D;  1HUM A;  4IPH A;  2E2J B;  3DEO A;  4BA2 I;  5FO7 B;  2DJG C;  1PTO H;  3FHW A;  2BDO A;  1SMX A;  4O2D A;  4AH6 A;  1HZB A;  2NVT H;  2BCO A;  2VB3 X;  1ASZ A;  1CA6 A;  4F8M A;  1Z6H A;  5FKA C;  5IIF A;  5T1G A;  3UDX A;  2E2I B;  5C4X B;  1FD7 D;  3CCV A;  1FJG L;  3KOJ A;  2K14 A;  1SN8 A;  4A76 A;  3S24 A;  3K58 A;  4HCS A;  1IL8 A;  2JA5 G;  1FGB D; 
#chains in the Genus database with same CATH homology
 1EEI D;  4A3E B;  3R93 A;  2A6E D;  1OXX K;  4C2M B;  2XN9 C;  5IOC A;  5M5W B;  1EYA A;  1X32 A;  4Q0F A;  1VDZ A;  4P2C B;  4IFD J;  2NYZ D;  3NK9 A;  4Y7N B;  2L9H A;  4DGZ A;  1XTC D;  3GTJ B;  5D65 A;  1PFN A;  5JPM C;  3PIO 3;  3DWQ A;  3H6M A;  2AQ2 B;  4ME5 A;  3BVG A;  2PO4 A;  3S1R B;  5JJZ A;  1PTO D;  4BY7 B;  4EQO A;  5I9O A;  4TRD A;  2R3Z A;  1ZKO A;  3NUC A;  1TY0 A;  5KNC A;  2IT1 A;  2PMZ B;  4IUP A;  2M9V A;  1SYD A;  1QNK A;  3MWY W;  4M1U B;  1O80 A;  2CQA A;  1TR5 A;  1BQQ T;  5EGT A;  1BR9 A;  4RAU C;  2KEE A;  1PTO F;  3OIP A;  1XWE A;  4FXK C;  3GTL B;  2PZW A;  3VR6 A;  4J8Q A;  4V19 0;  3C1E A;  5BN3 A;  1S5E D;  2CW0 C;  3FEW X;  4M8A A;  4DK1 A;  1DOL A;  2JP1 A;  3T56 B;  3MTS A;  1PDQ A;  5CYU A;  1EL0 A;  1BCP C;  3E5S A;  3M85 A;  4KN4 C;  1I50 B;  1F9P A;  3VYT A;  4K8I A;  1PFM A;  4S3S A;  4A3F B;  4A3B B;  1IYU A;  1O7L A;  1YNJ D;  1AN8 A;  4X3T A;  4DK0 A;  2EYJ A;  1C8C A;  3A8J E;  1NUC A;  5ELC A;  1TS2 A;  1F2Z A;  1LAC A;  2DNE A;  4HAE A;  2E74 C;  3SE0 A;  3P1H A;  2IX3 A;  1LAB A;  1SNQ A;  4PMW A;  3GTQ B;  4IQZ A;  5J22 A;  3S1M B;  2F0T A;  1GUG A;  3HOU B;  4C3H G;  1GJX A;  4ULL A;  3KBX A;  1QB5 D;  2QEJ C;  3A8I E;  2E2H B;  1TS5 A;  1D1K A;  2K04 A;  1G2S A;  2PNR C;  4ZKC B;  3BVM A;  1YNN C;  2WV6 D;  3TDQ A;  5D14 A;  2PQE A;  3NQT A;  1MI2 A;  4TKO B;  3K6O A;  1SSO A;  3GTG B;  1GUT A;  3BDO A;  3BYT B;  3I91 A;  2H1E A;  3IFT A;  3EQL C;  4V0B A;  4IFD H;  1I6V C;  4Q5V A;  3DM1 A;  3FDT A;  1ICW A;  4K5W A;  2EYO A;  2PYK A;  5CGK A;  1CQF A;  4RKB A;  5CV7 A;  2JA6 B;  2B2Y C;  1TVX A;  3HKZ B;  4IUU A;  2B8F A;  3IFD A;  2JA5 B;  3MXG A;  1EFI D;  1TKW B;  2FHT A;  1B4O A;  1U9R A;  3RZD B;  3AU7 A;  1WTV A;  3NP8 A;  2EJG C;  2F3V A;  3GTO B;  3VR5 A;  4LAA A;  4C3J G;  3Q24 A;  3Q6S A;  4FF4 A;  2DNC A;  2OXP A;  3NHH A;  4O42 A;  1AZQ A;  2K01 A;  2B2W C;  3Q23 A;  1CM9 A;  2F0Q A;  3PMF A;  4QUF A;  5IGC A;  1ZYR C;  1JWU D;  1WD1 A;  4R8N A;  3GTM B;  3S2H B;  5CV9 A;  4XXE A;  3I3C A;  3JAM L;  3HOW B;  5CBE E;  1RCV D;  1MSG A;  3R2T A;  1STE A;  2F0J A;  4H7B A;  3RLF A;  3ERO A;  3SDZ A;  3M4O B;  1JCK B;  1STY A;  3HGB A;  4ZK9 B;  1E0B A;  2IX0 A;  3D6C A;  3TP7 A;  1KDC A;  1U4L A;  1BOS A;  1ESF A;  4A3J B;  1I4Q A;  1ZXT A;  2L0C A;  3BYY B;  2EE1 A;  2DN8 A;  5IGG A;  2BDN A;  3K5L A;  3HOZ B;  1CHP D;  1BDO A;  4XT3 B;  2R7Z B;  1F9S A;  2WII B;  1DM0 B;  2I07 B;  1SYB A;  3I73 A;  1PRT D;  4QCL A;  1STB A;  4BBS B;  3E0J A;  4HSV A;  4CKE A;  1NCV A;  3W2D A;  2KHS A;  1JB3 A;  1G8Z D;  2KUM A;  1DZ1 A;  1R9T B;  5LL6 X;  1R4Q B;  2RSO A;  4XQJ A;  1JOO A;  2D2C C;  3VYU A;  3J7Y W;  4U67 3;  1RHP A;  1PRT F;  1UUP A;  3TBI B;  5CBA E;  3KF8 A;  2EY1 A;  1SNP A;  4RCO A;  1JC7 A;  1HHV A;  2LS0 1;  5JOB A;  1LTA D;  4GZY C;  3LWE A;  5D3I B;  5CV5 A;  1TWC B;  4CBV A;  1KNA A;  2A69 C;  4IUT A;  5JAV A;  5KNB A;  5KYI A;  1ZEQ X;  1DCZ A;  4C3H B;  1JIC A;  3RD4 A;  5ELB A;  4KI0 A;  3QB3 A;  4ILW A;  5A2Q L;  1ENA A;  2F0W A;  2K1B A;  2PZU A;  2BE5 C;  4KKS A;  2Z1C A;  3D31 A;  1F2L A;  3FPP A;  1LTG D;  4K5V A;  1CA5 A;  3CQZ B;  1EYC A;  2XWB B;  1Y8O B;  3PUV A;  3SK6 A;  2RA4 A;  3H0G B;  3P20 A;  1IHZ A;  1WCM B;  1IW7 D;  1XX8 A;  3OWE B;  4PNY A;  4NDX A;  1AFP A;  3I8Z A;  5M9O A;  3K5N A;  4XT1 B;  1I6H B;  1EY4 A;  2V4D A;  4FNF A;  5IGF A;  3MXN A;  4WFN 3;  2K03 A;  2K33 A;  4KKT A;  3J81 E;  5K5P A;  4ABN A;  1KLG D;  1ONL A;  2A68 C;  4CHT B;  4KD4 A;  3K57 A;  4RCN A;  1LT4 D;  2A6H D;  3GV3 A;  5EPJ A;  1U4R A;  5DNF A;  1QG7 A;  1JWM D;  2NN6 I;  1Q1E A;  2B2T A;  3S1Q B;  5EJW A;  1HA5 A;  5BN5 A;  1A3U A;  4ZAI A;  3QIA A;  5M5Y B;  1Y8N B;  1MGS A;  1E2Z A;  4OIJ A;  4C1N I;  3PUY A;  3ND8 A;  2WAQ B;  1II3 A;  4B9X A;  1X3P A;  1SNC A;  2K5W A;  5EPK A;  1CI3 M;  1SMY C;  4UAI A;  3LX0 A;  3OSO A;  2B2V C;  1B1Z A;  2RSN A;  3GTK B;  1GUN A;  3CRK C;  2Z8L A;  2OEO A;  3QJY A;  2C9O A;  3S17 B;  2Z4H A;  1RTO A;  3TP6 A;  3S15 B;  2MPM A;  2PCF B;  4Z9C B;  2HCC A;  1FR3 A;  1KLU D;  3UI2 A;  1DJR D;  1OXT A;  3V05 A;  4ODG A;  2LKV A;  3MHB A;  1VF7 A;  1Y1W B;  3D3R A;  1HFG A;  1C4Q A;  3FPU B;  4KV6 A;  5I2Y A;  2KA7 A;  1GUW A;  1JOQ A;  1KNE A;  4A3I B;  3OHX C;  5ELD A;  2NWG A;  2F03 A;  5CMD A;  5E3F A;  3DWA A;  2O2L D;  1L0Y B;  3WOF A;  1J9O A;  1SJH D;  5KRU A;  2XWJ B;  2KCC A;  1FNU A;  3PUW A;  3TP8 A;  1AP0 A;  1ROD A;  2EOT A;  1SND A;  1QE6 A;  2F1M A;  1PTO B;  3A55 A;  3VYS A;  2NVT B;  2FFK B;  4H13 C;  3DXJ C;  1SNM A;  4IFD G;  2F0O A;  3MXP A;  2WKC A;  5C4Z A;  2N88 A;  1ILP A;  1D5X C;  3SEB A;  1FYC A;  1GOZ A;  1Y1V B;  1X3Q A;  1D5Z C;  1F2Y A;  2XSC A;  5KYL A;  4RGO S;  4K6L A;  1KDA A;  4EQP A;  3MA2 B;  4A3M B;  4CJ1 B;  4OIK A;  1S5F D;  2K5Q A;  4N9P A;  1U4M A;  3MZ5 A;  4KY6 A;  1D1I A;  3CRL C;  1CZG A;  1H9S B;  1LTB D;  2NTS A;  4WOR A;  1EOT A;  3I72 A;  4OL7 A;  2XRQ D;  5A2Q E;  2PW7 A;  3BVZ A;  5C4H A;  5IGD A;  3EVQ A;  1EU4 A;  3NBI A;  1EY0 A;  1S5B D;  2F0H A;  3H91 A;  5C3E B;  4BBR B;  3X3N A;  5M5X B;  4G7H C;  1HCZ A;  3GD7 A;  5EBD A;  2NZ1 D;  3HS0 C;  1UNS A;  3M4Y A;  5I9P A;  2TMP A;  3QG1 A;  3A7L A;  2NVX B;  2B2U C;  3E6Z X;  1PZI D;  1J8I A;  2HUG A;  3KK7 A;  1I3Q B;  4KTA A;  2KQ3 A;  4FVM A;  5CV8 A;  2A5H A;  2K28 A;  3R3O A;  4RGM A;  1GHK A;  4A3K B;  1B53 A;  5FO8 B;  1TWF B;  1DXM A;  1SE2 A;  5BN4 A;  3ERQ A;  4F88 A;  3K5O A;  2YYZ A;  5IOD A;  4OO1 H;  3N52 A;  2F4I A;  2G9H D;  1EY5 A;  2FMM A;  2D5D A;  3CU7 A;  3P7J A;  4DNT B;  2XNA C;  1BO0 A;  4IUN A;  1CT1 D;  3J80 E;  4ID6 A;  2NN6 H;  3D4D A;  1DOK A;  4KY5 A;  5F2D A;  1O7Z A;  4FXD A;  4YIJ A;  2F0S A;  2JSO A;  1S4Z A;  2L1B A;  2EYL A;  3BDL A;  4WJW A;  1G29 1;  2EYP A;  5DM6 3;  2IWH A;  1V1P B;  3A7A B;  1CHQ D;  1JE4 A;  4K2K A;  3OOC A;  1K83 B;  3M7G A;  4NP5 A;  1CTM A;  3J81 L;  1S5D D;  2AUJ D;  2L4N A;  4RH6 A;  3OMG A;  1RF2 D;  2A6E C;  1TT2 A;  4C56 C;  1VF5 C;  4PV1 C;  2MP1 A;  1O78 A;  4CKB A;  2M2L A;  2D62 A;  2QKI C;  3L3O C;  5D3D A;  4QF4 A;  3IL8 A;  3NPP A;  3N6R A;  3PV0 A;  1B2T A;  2F0N A;  3VA7 A;  3H3V C;  5JEA J;  1I4G A;  4XIG S;  2HCI A;  1A2T A;  5C3X A;  4MHE A;  3G7L A;  1BNZ A;  1B3A A;  2ICI A;  1Q3L A;  2XIW A;  3I4M B;  2F0F A;  2QIL A;  2SOB A;  1GXD C;  3HOV B;  5CV4 A;  3SK4 A;  1LLR D;  1CQV A;  1PTO C;  2KJX A;  1PZJ D;  2MGS A;  2ENB A;  3QOL A;  2RBM A;  3MFY A;  3LWU A;  2JA7 B;  1M4V A;  3GO5 A;  1XYI A;  4XDX A;  4NW2 A;  4F87 A;  5LHY 1;  1HFN A;  5FO9 B;  2RDF A;  1V8Q A;  4FYD A;  3VA5 A;  3MC0 B;  1RJT A;  1B50 A;  3TSS A;  2IPK D;  4ZUI A;  1TWG B;  4KMU C;  1STG A;  5FOB B;  4KD3 A;  3KBG A;  5T1I A;  3Q22 A;  4HED A;  1B9N A;  3TZD A;  1RD9 D;  4HTH A;  1R4P B;  5FK9 C;  1YNJ C;  5C0X I;  3SR1 A;  1A6X A;  4E6I A;  2F0U A;  4RHR A;  5ELF A;  3U9S A;  2BOS A;  2ID0 A;  4JK1 C;  4A3G B;  1F9Q A;  1EYD A;  5COY A;  2EY2 A;  1S5C D;  3DEP A;  2L12 A;  1VMP A;  2B8G A;  3GV6 A;  1Z47 A;  3KUP A;  2MJ8 A;  3T51 B;  1EY6 A;  1EWC A;  4NKL A;  4X3S A;  2E76 C;  2WP8 J;  1FNW A;  2DY7 A;  1JOR A;  2ICE C;  2B39 A;  4KJN A;  2ZXR A;  1EY7 A;  4G4K A;  3TZU A;  1O7Y A;  3RUZ A;  1TII D;  1LT5 D;  2VUM B;  2LFN A;  1G91 A;  1I4R A;  5I4D A;  3FRP B;  3NWS A;  2F0I A;  3GQB A;  4BWG B;  2F0P A;  3NTH A;  5JEA H;  3HOX B;  1QWY A;  4LK1 C;  4KY7 A;  4X3U A;  5E4W C;  3T53 B;  2X69 A;  1I4P A;  4K5X A;  3PO3 B;  1EU3 A;  1HTL D;  2L11 A;  2Y0S B;  3SVM A;  3U9O A;  4BA1 I;  3F2U A;  2HDL A;  1K8O A;  4CJ2 C;  2KOL A;  4IUR A;  4WRD A;  3V2T A;  1HRJ A;  1JQY D;  4HMI A;  3MEH A;  2F3W A;  5FLX L;  3DWP A;  2KVM A;  2HDM A;  2EY6 A;  1Y8P B;  1D5M C;  1RKN A;  1JOK A;  3L9A X;  2QDB A;  3CKI B;  4AYB B;  5I6Y A;  5M3M B;  3L7Z C;  5HUR A;  1Q12 A;  3FVQ A;  4OO1 I;  4CKC A;  4CGY B;  4ZKB B;  2M00 A;  2HQE A;  4C3J B;  5TSS A;  1STA A;  3R8B A;  1KTK A;  3OW7 A;  2X6G A;  4DFA A;  2K32 A;  4K14 A;  3T13 A;  2F0L A;  4N9T A;  3DMU A;  4QIW B;  2JA8 B;  1UEA B;  1F77 A;  2SDF A;  3MAQ A;  2OF1 A;  5LL6 S;  1HPC A;  2B2Y A;  3M7N A;  3J80 L;  2K05 A;  2NUC A;  1QJO A;  5K36 H;  4ZYS A;  3EA6 A;  1H9R A;  2FIN B;  3OMC A;  4IUV A;  3WOE A;  3J7A F;  3GP7 A;  1MSH A;  1SYC A;  1OXS C;  4TQU S;  3SK8 A;  2JEA I;  1DON A;  1W6J A;  4HCE A;  4ZUJ A;  3A54 A;  5C44 B;  2CW0 D;  3S14 B;  1PRT C;  2B2W A;  4IN3 A;  3H09 A;  2ZT9 C;  1BCP D;  4X3K A;  1E2V A;  5C4J B;  4G57 A;  1EZ8 A;  4DNR B;  3K5M A;  4O1N A;  4QUC A;  4C3I G;  3SHL A;  1ET9 A;  3RZO B;  1AW7 A;  4OO1 G;  3AMU A;  4L6T B;  1ET6 A;  3KLR A;  2PPB C;  3EFX D;  1EWH A;  1BUV T;  1OXV A;  1BCP F;  1SYG A;  4J6H A;  3X3M A;  1PXU A;  4I7Z C;  3WDN A;  2NN6 G;  2SNM A;  5I2X A;  1LO5 D;  1H9S A;  2G9D A;  3I90 A;  1SEB D;  4PMB A;  3J7A V;  3A56 A;  1D6E C;  3KLS A;  1IKM A;  3IKJ A;  4HSP A;  4HMJ A;  4R8I A;  4KKU A;  1AZP A;  4FF3 A;  1PMR A;  3FKI B;  4DAV A;  2ZXO A;  2IX1 A;  4MN3 A;  2R6G A;  2JE6 I;  2ZXP A;  4L8J A;  3K0Y A;  3I4L A;  5C0X H;  1YNN D;  3V96 A;  1GUS A;  1CFM A;  1HXY D;  1U4P A;  1MBY A;  3URY A;  1IW7 C;  4C1N K;  1UAP A;  1ENC A;  1TU2 B;  4UDU C;  4H44 C;  5J1Z A;  4B08 A;  1ESR A;  1W6K A;  3NQI A;  2C5C A;  5M3F B;  3I4N B;  1TWH B;  3D8G A;  1KDB A;  2EVB A;  2WIN B;  4HR7 B;  2J7Z A;  1WTX A;  2Q8R E;  5J39 A;  1KAA A;  2F0G A;  1EY9 A;  2L5T A;  1EY8 A;  2KEC A;  4RHS A;  1TY2 A;  5HGT A;  3G6J B;  3T16 A;  2DY8 A;  1HA6 A;  2F0D A;  1NSN S;  3P75 A;  2A6H C;  2RVL A;  5E4X A;  2EXZ A;  1TS3 A;  4BY1 B;  3TP5 A;  4OHJ A;  3S16 B;  2XRS D;  1T5E A;  4JBW A;  3DHQ A;  1EEF D;  2F0E A;  4FF1 A;  1SYF A;  1WTQ A;  3C3L A;  4FF2 A;  1ZYR D;  2J0T D;  3LNN A;  2QCP X;  1DD2 A;  4EGV A;  5JVG 3;  1AEX A;  2R61 A;  4OGQ C;  4DAP A;  1LT6 D;  1WTW A;  1V1P A;  5FLX E;  5KND A;  4EQN A;  3PUZ A;  2NB0 A;  5KEE A;  1QOH A;  5EQ0 A;  3C1F A;  2QF7 A;  2EJM A;  1SJE D;  4G7Z C;  4RGT A;  4IUQ A;  4PMC A;  1G6Z A;  2RDH A;  4ZLT F;  2N55 A;  1B9M A;  4DXF A;  2A73 B;  4XQN A;  5JVH 3;  1M8A A;  3HZX A;  2O5J C;  3PUX A;  4EVO A;  3BDC A;  1B44 D;  2JEB I;  3SXH A;  1EZ6 A;  4LJZ C;  1H9M A;  5KGU A;  5NUC A;  1PFB A;  4C3I B;  1H9J A;  4BS9 A;  1LT3 D;  1E2W A;  3C2P A;  2EYF A;  3PO2 B;  2IL8 A;  2SEB D;  1ENF A;  4KN7 C;  4CJ0 B;  3OIQ A;  2D9U A;  3NWT A;  1QCB D;  5DM7 3;  2B2V A;  3ND9 A;  1BF4 A;  2I46 A;  1JWS D;  3TN2 A;  4J1M A;  2X6L A;  5DEH A;  3IAY A;  4F7X A;  2LY7 A;  5JEA G;  1A15 A;  3ZYY X;  2KED A;  2A69 D;  1WTP A;  1OO9 B;  2CHB D;  4ZRZ A;  2R92 B;  2AQ1 B;  2O5I C;  1HQM C;  1PZK D;  1EQT A;  1HUN A;  5EKK A;  4RA8 A;  4FO2 A;  4MIU A;  4DU9 A;  5CR3 A;  1SYE A;  2NBF A;  2B2T C;  5C5L A;  2BE5 D;  3FMC A;  4KK7 A;  5A35 A;  3BS1 A;  4KHZ A;  1Q8I A;  2L55 A;  1A3V A;  3PIP 3;  5JPN C;  2EY5 A;  3CHB D;  1K8M A;  4R9W A;  1H9K A;  1SDF A;  1QIL A;  2E2D C;  2K6A A;  2F0M A;  1F9R A;  2K7V A;  4IZ8 A;  2IJ0 A;  5EBC A;  3VR2 A;  1SFO B;  2FJ2 A;  4K2L A;  3HG9 A;  3I70 A;  3NE5 B;  1TS4 A;  1LTS D;  1I4X A;  1V1O A;  2IW3 A;  2PW5 A;  4PQX A;  4I65 A;  1TQO A;  2JYO A;  1PRT B;  5G3L D;  2KCN A;  1Y69 U;  3MXU A;  1ML0 D;  4H0L C;  5IT9 L;  2F0V A;  4KJO A;  5DAU A;  3MFG A;  4L63 B;  2WB1 B;  2A68 D;  2PZT A;  4A3D B;  4DAY A;  5K36 G;  5G3L F;  4B9W A;  2Z4I A;  2EPB A;  3DUZ A;  2Q8I B;  2MUY A;  4NMZ A;  1GHJ A;  1HTP A;  1VMC A;  2GA4 B;  2CVR A;  1MD2 D;  1C48 A;  3QOJ A;  4G7O C;  4ZQ3 A;  2VXW A;  3QWN A;  1STH A;  1SMY D;  2F0K A;  4K8J A;  3Q0A A;  1NAP A;  2EDG A;  3K7A B;  1LTT D;  1RTN A;  2J4X A;  1IKL A;  5CV6 A;  1CK1 A;  4DA2 A;  2SNS A;  1IYV A;  3H94 A;  4QB4 A;  5KIX A;  2R93 B;  4IAL A;  3S9W A;  3NXW A;  1QNU A;  2XVS A;  5C6A A;  3HP3 A;  1T5X D;  1F2M A;  5ISR A;  1SE3 A;  2NTT A;  1DYQ A;  2A74 C;  2AUK A;  2B2U A;  2BA1 A;  3NBH A;  2K5D A;  2RQX A;  5COR A;  2WAC A;  3R2I A;  2FMC A;  1XXG A;  3RMH A;  1D2B A;  4RKL A;  3KLS X;  1OXU A;  2MHV A;  2E75 C;  3EJI A;  4XYO A;  2OT2 A;  5CC4 A;  3M3Y B;  4QMG A;  4DF7 A;  3ITP A;  5C0X G;  1V43 A;  1LV9 A;  1G2T A;  2AWO A;  3QO2 A;  3MVV A;  5E1F A;  1Q90 A;  2AQ3 B;  1WTR A;  3W3A A;  3GTP B;  3BG3 A;  3HOY B;  1EIH A;  4TSS A;  3D6W A;  4XYQ A;  1EQV A;  1PLF A;  5C0X J;  1WVL A;  2EJF C;  3TME A;  5IGE A;  5C5M A;  1DOM A;  2H4O A;  3D4R A;  1A3T A;  1NR2 A;  1FNV A;  4RFB A;  4U68 A;  4XTC S;  3C46 A;  2YU9 B;  2VB2 X;  1Z7T A;  1ILQ A;  1I4H A;  3T4A C;  2Q8T A;  1A2U A;  1LTI D;  3VR4 A;  2TSS A;  4FXG C;  5EKI A;  3AB9 A;  1BCP B;  1JR0 D;  1VCI A;  5AFW A;  3OPO A;  1LTR D;  1SBB B;  1CZW A;  1SNO A;  1PYW D;  4XQQ A;  5ELE A;  1BXT A;  3VYR A;  1RDP D;  5C3W A;  3S1N B;  4HN7 A;  4KHV A;  2O4X A;  1L0X B;  3D4W A;  3NTK A;  4A93 B;  3S2D B;  1NR4 A;  2EZV A;  3BZD B;  3ONA B;  1STN A;  3K59 A;  4DXG A;  3O13 A;  5EKL A;  2LMC B;  2VNU D;  4RGN A;  1Q1B A;  2EYH A;  1EIG A;  1SXT A;  4IFD I;  2AWN A;  2RDG A;  2BA0 A;  2RKS A;  3SK5 A;  4K6D A;  1WTO A;  1KAB A;  3A8K E;  3OWF A;  1HQR D;  3VR3 A;  3NSW A;  5I6W A;  2WKD A;  5IGB A;  5IT9 E;  2NVY B;  1SAP A;  4RWS C;  4FP5 D;  1GUO A;  2B63 B;  3HEJ A;  1TWA B;  5EPL A;  3JAM E;  2JXM B;  1WD0 A;  2NVQ B;  3NTI A;  1SE4 A;  4DN4 M;  1BBX C;  3HRZ C;  2EYM A;  4LMQ D;  1HUM A;  2E2J B;  3DEO A;  4BA2 I;  5FO7 B;  1PTO H;  2BDO A;  2BCO A;  2VB3 X;  1CA6 A;  4F8M A;  1Z6H A;  5FKA C;  5IIF A;  5T1G A;  2E2I B;  5C4X B;  1FD7 D;  3K58 A;  4HCS A;  1IL8 A;  1FGB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...