3F1ZA

Crystal structure of putative nucleic acid-binding lipoprotein (yp_001337197.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.46 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLGKWVKVRGVIVDIRRKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords putative nucleic acid-binding lipoprotein
publication title The structure of KPN03535 (gi|152972051), a novel putative lipoprotein from Klebsiella pneumoniae, reveals an OB-fold.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3f1zA00
4HJ9A 4MTNA 2VQFQ 5BR8Q 1G51A 3L2PA 1HR0L 3GO5A 4GKKL 2KHJA 3UDXA 1YJWA 2JK8A 5E7NA 1UE1A 1KHIA 4JOIC 3PO3G 4JOIA 2B29A 5ELOA 4BBRG 4B3ML 3G6EA 1W3SA 4DUYQ 1MJCA 3HKSA 1HNWL 4DKAC 4LFBQ 3KYHC 1W2BA 2MO0A 4BBSG 4MNOA 4A3CG 4GS3A 4AYBG 1PH7A 1B70B 2Q2IA 5JEAG 3GTGH 2Z0SA 5FJ8H 2NN6I 4GOPB 1SFOH 1XNQQ 3S1QH 3L7ZC 2VNUD 4DV0Q 3RLFA 5C44G 1EQQA 3M4PA 5K36G 3PSIA 1N34L 1I94Q 2F4VL 1RIPA 1FJGL 2WB1E 4POGA 5IYCG 4DV6Q 4A3CH 4DV5Q 3PIPA 4LF8L 3GTQH 3PO3H 1Y1VH 1IBKQ 4C3HH 4OXPA 1XJVA 4JI3L 4C3JH 1JB7A 2I0QA 4B3SL 3T1HQ 3S1RH 4LF6L 1FVIA 3I2ZA 3D31A 5IYDH 4GKJQ 2AKWB 1E7ZA 4JI4Q 1E24A 2AMCB 2N8NA 4A76A 4LNQA 3TEHB 3W1BA 4IOCA 1SN8A 4LFAL 1U0LA 4B3RL 1Q86C 1YITA 1IXRA 4DR5L 1MIUA 1XPOA 2UUCL 5DLQE 3BJUA 4DR6Q 5FJ8G 1IZ6A 4O2DA 4A3DH 4B3TQ 1MKHA 2OQKA 4YWLA 4A3KG 4UPAA 3FP9A 4LF9Q 1IBMQ 5LMNW 2R7ZG 1VQIA 1XPUA 1JJ2A 1EWIA 1PH5A 3CAMA 1N32Q 2HHHQ 4GN4B 3A74A 4C2MH 1Y1VG 2EIFA 2FXQA 2OCEA 5LMNQ 2UUBL 3RZDH 1JE5A 5LMUL 2K14A 4R1JA 5IYDG 3OYYA 2YV5A 3K81C 3BZCA 1YJ9A 2BH8A 4YWKA 1CKMA 2OTLA 4TQUS 3JAMi 4YHHL 1PYSB 3ULPA 1U5KA 4GNXB 3S14H 1QVGA 4WJ3M 1LM0A 5IYBH 1JT8A 2PI2A 1K3RA 2F52A 1EIYB 3LGJA 1S40A 3CCUA 3AFQA 2RCNA 4YCWA 1BBUA 4K0KQ 2QGQA 4DV4Q 1S3OA 4FDBA 3PF4A 1C7YA 1PH3A 3CQZH 1Y14B 1X3FA 2K50A 4OWXB 4AYBE 3I7FA 3M85A 4NPSA 2YTVA 3PUYA 4PG3A 3K7AH 4RG1A 4JI5L 4LF4Q 4X65Q 2VUMG 3RZOH 4EX5A 4GLAC 2JQOA 4C3IH 3HFZB 3TQYA 3U4VA 1VQCA 4QGUA 1V1QA 4JBWA 2GVBA 1JJCB 5M3FH 2D0PA 3M4OH 3CD6A 1EFWA 1NMGA 4UP8A 1PH9A 5M3MH 3ER0A 4JBMA 1J6QA 2LXKA 2E2IH 1OXUA 4JBKA 4PZ8A 4JI2Q 5IYBG 4X64Q 4A3JH 2IX1A 5HY6A 1HZAA 5GQOA 1FL0A 5H1SE 5C4JH 2CQOA 3CC4A 2JA7H 4KHPQ 4AIMA 2WAQG 3L0OA 1N33L 1QVCA 2EXDA 4O0AA 1K9MC 1E1TA 3UE1A 2NVXH 3TRZA 4JI1L 5M5WH 2KBNA 2UU9L 3K7UC 4JI8Q 3CF5A 1Z47A 4XIGS 1WFQA 1FGUA 3CXCA 4DUZQ 1YHAA 1AE3A 4X62L 4X66Q 1ASYA 4LF5L 3NENA 3KDFB 3NELA 2RF4A 4DV3L 2YU9H 4WJ4A 2A19A 4NXNL 2UXDL 4JV5L 1X6OA 5M3FG 5C44H 2DUDA 5BR8L 4HIOA 2Q2HA 4LFCQ 4DR3Q 4RMFA 2RHSB 1I50H 1SROA 3RR5A 1YEZA 4A3JG 1LUZA 1EYGA 5IYCH 3PF5A 4DV2L 5FLMH 1Q1EA 2CFMA 4DR7L 4HIKA 1GO3E 1CUKA 1QUQA 3D0FA 1SMXA 3UDIA 3CCQA 1XMOQ 4BY1H 1PHJA 2JA7G 4OX9L 3KF8B 4R4QA 2MFIA 2HT1A 1B8AA 2K52A 1XNQL 3M3YH 3J7ZC 1XNRQ 4A3GH 1CSQA 5JEAJ 4UP9A 3JAMc 1K8GA 1S72A 4DV7Q 2ID0A 4YCVA 5IP9H 1I94L 4A93H 1Q8KA 1TWFH 3J81c 3TS0A 2ALYB 1K8AC 1VQ9A 3NBHB 3RN2A 1YI2A 1IL2A 3GTPH 1I3QH 2BA0A 3DLLA 1PH4A 5M5XH 3I4OA 1C0AA 4UP7A 5HGQA 4GOPC 3U4ZA 4GOPA 3TREA 2I5MX 1SE8A 4JI7Q 3HOYG 3U58A 4A3KH 3G48A 3MEFA 4DK3C 4LUVA 2NVQH 4PMWA 1Q46A 3ERSX 2R7ZH 4A3LH 2N3SA 1VQ4A 2IHFA 2MO1A 1VQPA 2E5LQ 3W1GA 5FLMG 3OTOQ 3F2CA 4JI6Q 2UXBQ 1V43A 1A63A 4A3IH 4AQYQ 2JA5H 2B3GA 1YHBA 4BY1G 1HR0W 3PO2G 4IPDA 4HIDA 4A3EH 2H5XA 1CKNA 3W5OA 4DR6L 4JC0A 1NBWA 4A3FH 4GLXA 2UXCL 1VQ6A 3CMAA 2R7DA 3KJPA 2AWNA 1HR0Q 3F1ZA 1PV4A 4A3GG 3EIVA 4JI0L 4GKKQ 2YTYA 5IP9G 3M4QA 5M5YH 1IBML 2L15A 3TS2A 1X54A 2K5NA 2PQAA 4B3MQ 2YTXA 4A3LG 3FHWA 4A93G 2PI2E 4QIWE 1OTCA 4DV1Q 3UE0A 2K5VA 1WOCA 5AJ3L 2HHHL 3DM3A 3JC66 3AFPA 3KF6B 2DGYA 2E2JH 3I56A 2QEXA 4GN3B 2LXJA 1HNXQ 3CPFA 4GN5A 3CCVA 3B6YA 2KCTA 1M90C 2MQHA 4P74A 3Q8DA 4H02A 2LSSA 1N34Q 4IFDJ 4YWMA 4A3IG 2JA5G 3PIOA 2IHEA 1SLJA 4DR2L 1G291 2VUMH 3GTKH 1PVOA 4IJLA 5J3BA 4A3EG 2A8VA 3KJOA 1Q81C 2PNHA 1QZGA 4A3FG 1K73C 2R6GA 4Y7NH 4JI3Q 4B3SQ 3BZKA 4LF6Q 1RL2A 3HOWH 4GNXC 4JYAQ 4GNXA 3GD7A 1OXTA 3STBC 4NXMQ 2UUAL 3J81i 3HKZG 2OTJA 3H3VH 4IPGA 2AHOB 4LFAQ 3CCEA 1L1OB 2Y0SG 3HOUG 4R4IA 4QQBX 1BVSA 2KCMA 1VS0A 3GTMH 4B3RQ 2ZJRA 4X65L 4DR5Q 1XMQL 1GD7A 1P8LA 2UUCQ 5C0XI 2JA6H 2WP8J 1HZ9A 1KRSA 1Y1WG 2Q2TA 1I6HH 4JBJA 1VQBA 3S24A 3PUXA 3CP0A 3HOXG 4P71A 4BXXH 1X56A 2CWPA 4JI2L 3T1YL 1N8RC 3K0XA 1PH1A 3HOZG 2NN6G 1X65A 1KRTA 3CPWA 1SRUA 2UUBQ 2ZJQA 5LMUQ 4OO1I 3HOWG 1DGSA 4EQ5A 3AEVA 1O7IA 4YHHQ 3H15A 2XGTA 1R9TH 2ASBA 5GADC 1NJIC 1TWAH 2VS1A 4JI8L 3S1NH 3MXNB 2JEAI 2JA6G 2HIXA 3PGZA 3J80i 4BA1I 1YHQA 3UDGA 2KHIA 2Z6KC 2ATWA 3CW2C 1N9WA 4XTCS 1KAWA 3I4NG 2V1CC 4LF7Q 4BXXG 4LFCL 2QA4A 3GTJH 2K4KA 2HQLA 3ULJA 2VW9A 3KDFA 5IP7G 3AQQA 2R7FA 2VL6A 4LW1A 1XTDA 1D7QA 2WFWA 3CCLA 4JI5Q 2R92H 2JEBI 2VQEQ 5C0XJ 3S16H 2VQFL 3HOYH 4BY7H 2K75A 1D8LA 4DR1Q 1T9HA 1ASZA 2ZM6Q 4KI0A 1YJNA 3GTLH 1L2FA 3PUWA 1XNRL 4DUYL 1X3GA 4TVAB 2B63H 1HNZQ 2RHQB 2OWOA 3A5UA 4LFBL 2JE6I 4A4IA 1EUJA 3E0EA 3PO2H 5JJKA 1N36Q 3M7NA 2BA1A 3E9IA 4MZ9A 1VCIA 1IBLQ 1TXYA 1KIXA 1NE3A 4DV0L 1VQDA 3S2HH 1VQ7A 1N33Q 4BA2I 1YNXA 2F3IA 1LTLA 4IPHA 1E1OA 3AYHB 4DAMA 2UU9Q 3PUZA 4L5QA 4DV6L 1B7YB 1BBWA 3OTOL 1WCMH 1WYDA 4DV5L 3H0GH 3RNUA 3S15H 4LF5Q 2NVTH 1X3EA 2R92G 1TWCH 2CCZA 4DAYB 3RN5A 1M1KC 4DV3Q 1MJEA 4PZ7A 1IBKL 4BY7G 1CSPA 4YY3Q 3F2DA 4NXNQ 3T1HL 1QVFA 4JV5Q 1QUQB 4GKJL 1OXVA 4PZ6A 5IWAQ 1H95A 3S17H 2E8GA 2VY3A 1YBYA 1UE7A 3WWVA 3CCJA 4JI4L 1Q7YC 3HOVH 1VQKA 2B63G 1VQ5A 3I4MG 1NY4A 1J5EQ 3KOJA 1VQFA 4DV2Q 2EQSA 1L0WA 4DR7Q 1JJGA 4DV1L 1HZCA 1VQ8A 4DR4Q 4A75A 4OO1G 1KC8C 2AWOA 4OX9Q 4B3TL 4LF9L 4QL5A 1KQSA 1HNXL 3I55A 3RLNA 2C35B 2D0OA 1HNWQ 1AH9A 1NMFA 3ZJYC 1VQJA 1WCMG 3HOUH 3H0GG 4ME3A 4P73A 1N32L 2WAQE 3U50C 3ULLA 2NZOA 3KF6A 5LMNL 1VQMA 3SGIA 1EOVA 2GN5A 3J80c 1Q1BA 1HJPA 4GLVB 1Y1WH 1VQGA 2NVYH 1K83H 4X6AH 5IT9c 2I5HA 4P72A 3HOXH 1CKNB 3HOVG 4JYAL 3RLOA 1JMCA 1E22A 4L5SA 2F4VQ 4NXML 1WI5A 1FJGQ 4HJ8A 4L5TA 3HOZH 3A0JA 3KFUA 1X9NA 3G71A 5C4XH 4A3MH 4LF8Q 3FKIH 5JJIA 4HJAA 2PQAB 4OWWB 4IOAA 1YZ6A 2CWAA 1EIFA 4L5RC 4K0KL 1VQHA 1PH2A 4R4OA 4DV4L 4ALPA 1I5FA 5FLXc 1BKBA 2UXCQ 4IPCA 2HIVA 4YCUA 4JI0Q 1L1OC 4KLKA 5GAHC 1L1OA 2K5HA 1GM5A 3CMEA 3E9HA 1VQAA 4QY7A 4J15A 3CC7A 4LF4L 3J7A5 1GKHA 4AH6A 4IO9A 1G6PA 5AJ3Q 1V9PA 4HIMA 2CKZB 2A1AA 2ZTEA 4HJ5A 1UE5A 4QJFA 5ELNA 5GAEC 3I4NH 1HZBA 4DR4L 1TWHH 4DNIA 1IYJB 3STBD 3NEMA 4POFA 4IFDG 4P75A 1A0IA 2ES2A 4X64L 5C3EH 1PYBA 1PFSA 2XTIA 3K80C 5IP7H 3CCSA 3VDYA 4A3MG 4OWTB 3J81j 1YIJA 5C4XG 3A5ZB 4DR2Q 3FKIG 2MNAA 1AE2A 4NB3A 5JJLA 2OQ0A 4KHPL 4LUOA 4IJHA 1OXXK 4A3DG 4DPGA 3BU2A 3PV0A 5GROA 4LF7L 2ZJPA 1E3PA 2UUAQ 4DUZL 4A3BH 1QZHA 4X66L 1VQLA 2ZTDA 3CCRA 1LYLA 2JJQA 3F8TA 1EQRA 2WB1G 2JA9A 4APVA 2Z6KA 2VQEL 1XMQQ 2Q2UA 3UDFA 3K8AA 3H3VI 1KD1C 1HH2P 2D62A 4HJ7A 1GVPA 4LWCA 4DR1L 4DR3L 2BH2A 3S2DH 2ZM6L 1VQOA 1Q12A 2JA8H 4Y52H 2N78A 5C3EG 3F2BA 4KHZA 1UWVA 2N49A 1VQNA 3OW2A 1NTGA 1UE6A 1HNZL 3T1YQ 2KENA 4JCVE 1XMOL 4UY8C 5IE8A 1P16A 3S1MH 1XPRA 2NZHA 4JG2A 2R93H 4R4TA 1X55A 3GDEA 1N36L 1A8VA 3PUVA 2IY5B 1IBLL 3EBEA 4IFDI 1KXLA 3GTOH 2IX0A 4DV7L 1Z9FA 2ZTCA 1PH6A 3I4MH 4A3BG 1VQEA 4BBRH 3ICEA 5GAGC 3CCMA 1WJJA 1K0RA 1Q82C 1C9OA 4BBSH 1A62A 3M9BA 4R4CA 5EAYA 3G4SA 1UEBA 4JI7L 3HKZE 4DK6C 4YY3L 2PMZE 1KL9A 2YYZA 2JA8G 4JI1Q 5IWAL 2Y0SE 1OXSC 1CKOA 5M3MG 3PCOB 2E5LL 4JI6L 2UXBL 1PA6A 2I5LX 1PH8A 2E2HH 4X62Q 4AQYL 2IT1A 5C0XG 3KLWA 1SR3A 1J5EL 3IRBA 2R93G 3CC2A 1YVCA 4OONA 2GVAA 3EN2A 4LUZA 2UXDQ 2VZAA 1TWGH 5IY0A
chains in the Genus database with same CATH superfamily
1SXTA 2VQFQ 1B4OA 5F2DA 3P1HA 5C4HA 1HR0L 3GO5A 4LK1C 3UDXA 5JOBA 3MA2B 5ELOA 3K5NA 1CQVA 1CA5A 1HNWL 1JOQA 3HKSA 3OSOA 4DKAC 2XSCA 4LFBQ 4GS3A 4AYBG 5FJ8H 2PZTA 5I9OA 1SFOH 3S1QH 2O5JC 4N9TA 4DV0Q 2EY2A 1NUCA 3W2DA 1I94Q 1O7LA 2F4VL 2M9VA 1ML0D 1QNUA 3K5OA 3H94A 4LF8L 1IBKQ 4C3HH 4A3FB 1XJVA 3S1RH 3I2ZA 4KK7A 3D31A 1GHJA 1U4LA 2AKWB 5M5YB 2LMCB 3EA6A 1E24A 2AMCB 3HKZB 1NAPA 2ZXPA 5KYIA 1X3QA 1H9SB 2TSSA 2KJXA 5JVH3 1IXRA 1HUNA 5FJ8G 4O2DA 1Y1WB 4A3DH 4ZRZA 2PNRC 2OQKA 2HD3A 3FP9A 4QMGA 3HOXB 2K04A 2R7ZG 1EL0A 1VQIA 1EWIA 2F1MA 5NUCA 2QEJC 2A73B 3MFYA 4TKOB 2UUBL 4C3HG 1SYBA 4Y7NB 5CBEE 4XT1B 2OTLA 2OXPA 2PYKA 1PYSB 3ULPA 2GA4B 4KD4A 1PRTC 4DK1A 4ID6A 1BBUA 4G7OC 4F8MA 1TT2A 1MGSA 3M85A 3D4DA 2FMCA 4RG1A 1PRTD 2WINB 5A2QE 3TP5A 3U4VA 1VQCA 5KIXA 3CRLC 5C5LA 3CD6A 1EFWA 1TS3A 1S5CD 1J6QA 2E2IH 3D4RA 4PZ8A 4JI2Q 3S1NB 2QW7A 3QJYA 1V1OA 5HY6A 1HZAA 5H1SE 2RCFA 3SE0A 2PZUA 4B08A 4KKUA 2WAQG 3A55A 4O0AA 2NVXH 4KJOA 1TS2A 2KBNA 4CJ2C 3P75A 3BS1A 2OT2A 1SAPA 4J1MA 1ASYA 3J81E 2R93B 4BY7B 1RHPA 1ILPA 4RMFA 5CV8A 3NK9A 3I4MB 1SROA 4DV2L 5FLMH 1Q1EA 2F0GA 2CFMA 4OL7A 1CUKA 1QUQA 3CCQA 4OX9L 2IWHA 4R4QA 5BN5A 3GP7A 2P5ZX 1EWHA 1CZGA 4K8IA 1ZYRD 5IGBA 4YCVA 2DN8A 4A93H 3TS0A 2NVTB 4DXFA 3RN2A 4UDUC 2XN9C 3I4OA 4UP7A 2E74C 5HGQA 4GOPC 3U4ZA 4GOPA 2F0OA 1Q90A 4A3KH 2EYJA 2DJGC 4LUVA 3HOVB 2A68C 2NVQH 4ULLA 1Q46A 2IPKD 3W1GA 5FLMG 1BUVT 2UXBQ 1GJXA 2B3GA 1YHBA 3I3CA 1STHA 1HR0W 4IPDA 4XYOA 4A3EH 1CKNA 3W5OA 3GTGB 4DR6L 1PZJD 2EJMA 1HR0Q 3KJPA 3F1ZA 2A68D 2I07B 3TS2A 4A93G 1X54A 3SEBA 1BCPC 4CHTB 3DM3A 3AFPA 3KF6B 2E2JH 4GN3B 3IFDA 4HMIA 4WRDA 1CA6A 3K59A 1UEAB 1EY8A 1NNXA 4PMBA 4DR2L 2VUMH 3GTKH 4QB4A 1BCPD 4A3EG 1DM0B 4DFAA 1TR5A 1K73C 1IYVA 3HOWH 3STBC 5EBCA 4DAPA 4R8NA 4IPGA 4QQBX 3HOUG 1BVSA 2WB1B 3GTMH 2JA6H 1XMQL 3E6ZX 3MXPA 1LT6D 1ONLA 2EJGC 2Q2TA 3PUXA 1PDQA 2A69C 1GUWA 1PH1A 1N8RC 2EY6A 2UUBQ 4QIWB 2ZJQA 1RTNA 4OO1I 3HOWG 1XWEA 4RWSC 4XT3B 3VR5A 2B2VC 2B2VA 2A69D 3MWYW 1NJIC 1HHVA 4JI8L 3IFTA 5E1FA 2JEAI 2JA6G 3PGZA 1SE4A 2Z6KC 2ATWA 3CW2C 3I4NG 4EQPA 2K4KA 2HQLA 3KDFA 1D1IA 4C1NI 1DOLA 3VYSA 2WFWA 1EY4A 2R92H 2JEBI 4L63B 2AQ2B 2JA7B 1JOOA 1ASZA 3K58A 3BG3A 4KTAA 4NMZA 4F88A 3GTOB 1L2FA 4PQXA 1XNRL 1XTCD 3AB9A 3OW7A 1TS5A 3PO2H 2K5QA 3M7NA 2K6AA 5TSSA 1JCKB 3SDZA 2F3IA 1BR9A 4IPHA 4DAMA 1KLGD 1BBWA 1WCMH 4DV5L 5E4XA 1JWSD 2R92G 4DAYB 3RN5A 1M1KC 1MJEA 3SK8A 4G7HC 3F2DA 3T1HL 3J80E 3NQTA 4GKJL 5IWAQ 2E8GA 4JI4L 1TS4A 1UE7A 4U673 3CCJA 1Q7YC 5FKAC 3WOEA 1U4MA 4K6DA 5EQ0A 4DV2Q 2EQSA 1LO5D 1HZCA 2F0FA 4DR4Q 5CGKA 1GUNA 1SFOB 3J7AF 4OX9Q 2F03A 2K33A 4LF9L 3FRPB 1KQSA 2IJ0A 3RLNA 2R7ZB 4GZYC 1WTQA 4RH6A 1F2MA 4EQNA 1WCMG 1SNCA 2L9HA 4ME3A 1N32L 2MP1A 3U50C 4M1UB 1LT4D 1OO9B 2SNMA 2GN5A 3EQLC 4C3HB 1Q1BA 4HEDA 1Y1WH 2NVYH 2I5HA 4P72A 3HOXH 3RLOA 1SMYC 1X9NA 3H91A 1RD9D 1ESRA 4HJAA 2PQAB 1B2TA 2EE1A 4K0KL 4L5RC 1V1PB 2EYOA 4DV4L 1BKBA 4YCUA 2F0QA 4KY7A 1L1OC 2BOSA 2M2LA 1L1OA 2F0SA 2F0UA 1C48A 1SMYD 4QY7A 1QB5D 2ICEC 1V9PA 3HS0C 2A1AA 2SEBD 4DAVA 5ELNA 5GAEC 2CW0C 1HZBA 1TWHH 3A8IE 4DNIA 3C1FA 5G3LD 4RGTA 2ES2A 2EY1A 3K80C 5IP7H 1R4PB 4XYQA 4DR2Q 4G7ZC 4NB3A 2OQ0A 4KHPL 3KUPA 2WAQB 4H0LC 4IJHA 2A5HA 1E2WA 3BU2A 5GROA 3NPPA 4DUZL 1T5XD 4X66L 1VQLA 1CM9A 2AUJD 4IZ8A 2JJQA 2LFNA 1PYWD 2LKVA 1XMQQ 2Q2UA 4WORA 3UDFA 1HTLD 3H3VI 1CT1D 2D62A 1GVPA 2BH2A 1A2UA 2ICIA 2NB0A 1Q12A 2N49A 1J8IA 4X3TA 5IE8A 2R93H 1XPRA 3DWQA 3CKIB 1W6KA 2IY5B 2F0HA 2NVXB 3EBEA 1S4ZA 3I4MH 3L9AX 1PH6A 4LMQD 4BBRH 3ICEA 4H7BA 4I7ZC 1DYQA 4OO1H 3M9BA 3OMCA 4DK6C 2EPBA 2YYZA 2Y0SE 1IHZA 2WIIB 1SYEA 1CKOA 5M3MG 4JI6L 1PA6A 2E2HH 1PH8A 1SNMA 3I91A 2IT1A 2WV6D 3KLWA 1J5EL 2R93G 1YVCA 4OONA 4LUZA 4ZUJA 1TWGH 3UI2A 5IY0A 4HAEA 1G51A 3L2PA 3S2HB 2JK8A 3NQIA 5E7NA 3A8JE 4A93B 4BBRG 4B3ML 3G6EA 1DXMA 4ZK9B 1KDCA 3T16A 5EJWA 3BVGA 1B70B 3E0JA 3GTGH 3FMCA 5CC4A 1XNQQ 3L7ZC 2VNUD 3DMUA 5C44G 3K5LA 3M4PA 2NZ1D 4YIJA 5K36G 1N34L 1RIPA 1FJGL 5IYCG 3S9WA 4DV5Q 4A3EB 5C4ZA 3GTQH 1Y1VH 4JI3L 4C3JH 1H9RA 2I0QA 3T1HQ 4LF6L 1FVIA 1VF5C 4GKJQ 4JI4Q 1B44D 2DY8A 4A76A 3W1BA 3V96A 4X3UA 3HOUB 1JOKA 1B9NA 1U0LA 4B3RL 3MFGA 1YITA 1XPOA 1MIUA 2UUCL 1NR2A 3BJUA 4UPAA 4LF9Q 1IBMQ 5FO8B 2K5WA 5CV6A 3CAMA 1F77A 1N32Q 2HHHQ 4C2MH 1Y1VG 2FXQA 2OCEA 2NUCA 3RZDH 4KY5A 4H13C 4C3JG 1ET9A 2K14A 1LABA 3HOWB 3OYYA 2XWBB 2YV5A 3TP6A 1YJ9A 2KHSA 1H9KA 1IL8A 3RMHA 1JQYD 1QVGA 1G6ZA 2PI2A 3GTMB 1EIYB 1A3TA 2F0KA 3U9OA 2JA6B 3LGJA 1SYCA 2AQ3B 3CCUA 1SDFA 4K0KQ 3I4NB 2E75C 4B9XA 1S3OA 4DV4Q 5KNDA 4PV1C 1F9PA 1PH3A 4K2LA 3MXNA 5EKKA 2BDNA 2K50A 4OWXB 2TMPA 1F9QA 1SJHD 3I7FA 1QCBD 1KDAA 4JI5L 4X65Q 4EX5A 4GLAC 2JQOA 2DNEA 3HFZB 3TQYA 4QGUA 1V1QA 2GVBA 4ZCKA 5M3FH 4UP8A 1PH9A 4JBMA 3ER0A 4JBKA 1S5FD 2CQAA 2IX1A 3PIO3 1GOZA 3CU7A 3J80L 5GQOA 1E0BA 5C4JH 2JA7H 3CC4A 4KHPQ 5CMDA 1K9MC 1E1TA 1O7YA 3T51B 4JI1L 1F2LA 2UU9L 1DOKA 4DUZQ 1Z47A 3DUZA 5EPKA 1DJRD 1AE3A 4X62L 4MHEA 4X66Q 1IW7C 3NENA 2R92B 1LT3D 4RCNA 4WJ4A 1F9RA 2A19A 4JV5L 2E2DC 4KKSA 5M3FG 4RKLA 2DUDA 5BR8L 4LFCQ 2RHSB 3RR5A 1MSHA 3TDQA 1G8ZD 3D0FA 3K0YA 3H3VH 2JA7G 3T4AC 3KF8B 2EY5A 2MFIA 2HT1A 1B8AA 1D5MC 2K52A 3TSSA 2PW5A 3DEPA 1HQMC 4A3GH 3QB3A 4UP9A 2Q8RE 1S72A 2ID0A 1WCMB 1XXGA 2XRQD 1VQ9A 3J81c 3GTPH 4A3LH 1K8AC 2HCIA 2FINB 2KQ3A 5KGUA 1I3QH 1I4QA 4DXGA 1BDOA 2I5MX 3HOYG 3U58A 4FNFA 3G48A 4DA2A 1JICA 1EIHA 1AZPA 4FF4A 2R7ZH 2N3SA 2R61A 2MO1A 4JI6Q 5I4DA 3F2CA 4F7XA 4A3IH 3MC0B 2JA5H 2B8FA 4OGQC 4EGVA 3FPPA 2H5XA 1SNDA 4FF1A 2B2YC 3HP3A 4CJ0B 1LTID 4A3GG 1PV4A 4RHSA 3EIVA 4JI0L 1VMPA 3M4QA 4HTHA 1HPCA 2L15A 4A3LG 2K5NA 4B3MQ 2KCCA 2PI2E 4DV1Q 1WOCA 1PZKD 1VDZA 2NVYB 3I56A 1FR3A 3SK4A 1M90C 1DZ1A 3EJIA 1N34Q 4CKEA 4IFDJ 4YWMA 4A3IG 2JA5G 3PIOA 2F0MA 3NTHA 1I4PA 1TKWB 4J8QA 5KNBA 5HGTA 5J3BA 2A8VA 3OPOA 3KJOA 1HA5A 2PNHA 3GV6A 1QZGA 4JI3Q 1EY9A 3BZKA 3NUCA 4LF6Q 4HMJA 5EGTA 1RF2D 1B9MA 4NKLA 3H09A 1JORA 3CCEA 2RKSA 2Y0SG 4R4IA 2KCMA 4B3RQ 2KA7A 1GD7A 2UUCQ 3I8ZA 3J7AV 1HQRD 1TWHB 4F87A 5DAUA 3BYYB 1I6HH 4ZUIA 4BXXH 4P71A 2ENBA 3G6JB 2CWPA 3HOZG 1KRTA 4OEMB 1HUMA 3M7GA 3PIP3 5J39A 1PRTB 4IUNA 5ELFA 2HCCA 4L8JA 2XGTA 2ASBA 1BO0A 1NCVA 5COYA 3RZOB 3J80i 1SBBB 1PTOC 3N52A 2N55A 4C56C 2V1CC 4LF7Q 3M4OB 4BXXG 3MAQA 5IGDA 5M3MB 2JYOA 1PFNA 1PZID 4ILWA 2SOBA 3PMFA 4TRDA 2WACA 3AQQA 2R7FA 4LW1A 5C5MA 3CCLA 4JI5Q 4A3CH 4BWGB 2VQEQ 1CZWA 5C0XJ 2K75A 1PTOD 4DR1Q 4I65A 1EEID 1T9HA 4FVMA 4BBRB 1X3GA 1HNZQ 3A5UA 4X3KA 2JSOA 1TXYA 4CDCC 1O7ZA 1VQDA 3S2HH 1VQ7A 5C44B 1G91A 1LTGD 2NBFA 1YNXA 1LTLA 2E2HB 1E1OA 2UU9Q 1S5BD 1SE2A 4L5QA 4OHJA 5IODA 3OTOL 1WYDA 3RNUA 4IQZA 1TWGB 1X3EA 1TWCH 3VYUA 4A3CG 5BN4A 5I2XA 1QWYA 4PZ7A 4YY3Q 1Y8OB 4JV5Q 1QUQB 4PZ6A 1STEA 5IT9E 2F0PA 1DCZA 5CV5A 1Y8PB 3BVMA 2QILA 2X69A 5L37A 1KABA 4QL5A 1HNXL 2IL8A 3KBGA 2C35B 2D0OA 1HNWQ 1NMFA 5E4WC 3HOUH 3GTQB 1Y1VB 5LMNL 3KF6A 1F2YA 4C3JB 2PQEA 5CV4A 3J80c 2L5TA 4GLVB 1KDBA 1K83H 4S3SA 4X6AH 3NBIA 3J7YW 1CKNB 4JYAL 2VB2X 1JMCA 2F4VQ 4NXML 1WI5A 3KFUA 5C4XH 3K5MA 4LF8Q 2FHTA 3FKIH 5JJIA 1X3PA 3NP8A 2CWAA 3ONAB 1PH2A 1LTBD 1BCPB 3A54A 2LS01 2IW3A 4ALPA 3TBIB 3C3LA 4JI0Q 3IAYA 4KLKA 2K5HA 1FGBD 1Y69U 3CMEA 4C2MB 1AW7A 3CC7A 3RZDB 4LF4L 2C9OA 3DHQA 5J1ZA 1G6PA 3A7AB 4HIMA 5DNFA 1UE5A 4QJFA 3Q6SA 3I4NH 1IYJB 3STBD 4U68A 4POFA 4FYDA 5JAVA 1FNUA 1EU4A 5C3EH 1PYBA 3I73A 3CCSA 5C4XG 1H9MA 3A5ZB 3NE5B 3FKIG 1IYUA 2MNAA 1AE2A 5JJLA 3WDNA 2F0VA 5IOCA 1NSNS 4DPGA 2ZJPA 1GUGA 2ZTDA 3CCRA 3F8TA 1SE3A 2RDGA 2NWGA 1B3QA 2JA9A 2Z6KA 5M3FB 2Z4HA 5C3WA 1HH2P 1SYFA 4DR3L 3S2DH 2F0TA 2ZM6L 1VQOA 2N78A 1PFBA 5C3EG 2AUKA 1TWAB 3TP8A 1EOTA 1DONA 5C4JB 5IGEA 1N36L 1D2BA 1A8VA 3PUVA 1UAPA 3KLSA 1IBLL 4I7AA 1BF4A 1I4HA 2IX0A 4DV7L 1Z9FA 2ZTCA 1GUTA 1WJJA 2BE5C 1LACA 1KAAA 1VMCA 1A62A 2L55A 1LV9A 4R4CA 3G4SA 4JI7L 1UEBA 3HOYB 4ZAIA 2PMZE 3NXWA 4CDEC 2MJ8A 4G57A 4FO2A 3NBHA 1TU2B 2E5LL 4FF2A 2I5LX 4EQOA 4CKCA 1SR3A 2BE5D 3IRBA 2VZAA 2NYZD 2MHVA 4MTNA 4DGZA 4A3GB 2QDBA 2AQ1B 1UE1A 1KHIA 4JOIC 4DU9A 4JOIA 2L11A 2RVLA 1W3SA 1EY0A 3GTPB 4Q5VA 1I3QB 2MO0A 2F4IA 4MNOA 1PH7A 4FP5D 2Q2IA 3QOJA 2NN6I 4V190 1BCPF 1EYCA 3RLFA 1A3UA 2ZXOA 1EQQA 4EVOA 2K5DA 1TY0A 3PSIA 1ILQA 4A3IB 2JA5B 2WB1E 4POGA 1B1ZA 2Z8LA 1XYIA 4RAUC 4B3SL 1JWMD 5T1GA 3Q24A 1E7ZA 2V4DA 2N8NA 5A2QL 4IOCA 4LFAL 2Y0SB 4G4KA 5DLQE 4DR6Q 1CK1A 4K2KA 1CQFA 4CDFC 3D6CA 1MKHA 4YWLA 3D3RA 4UHVA 1WTRA 5LMNW 4KHVA 1JJ2A 1SYDA 3HOZB 3MXGA 3A74A 2EIFA 5LMNQ 3R2IA 4ZYSA 4RKBA 3K81C 2BH8A 2B2UC 1CKMA 2B2UA 4TQUS 1O78A 3J81L 4GNXB 4WJ3M 3DXJC 1JT8A 2OF1A 1K3RA 2EOTA 2B2WC 2CHBD 1SEBD 3AFQA 2RCNA 2X6LA 1I6HB 2CW0D 2NTTA 1U9RA 2QGQA 3OWFA 4FDBA 3HZXA 5FOBB 3PF4A 1STYA 2F0JA 2D2CC 1X3FA 4KV6A 4AYBE 2KVMA 1MHWC 2YTVA 4PG3A 1K28A 3FPUB 3ITPA 4LF4Q 3RZOH 2O5IC 5KEEA 3R8BA 1JJCB 5M9OA 3M4OH 1NMGA 5M3MH 3V05A 1EZ8A 2LXKA 1L0YB 1OXUA 3KLSX 4KD3A 1FL0A 4QCLA 1DOMA 2RA4A 1YNNC 5IT9L 3L0OA 2X6GA 5JJZA 1QVCA 2EXDA 1SJED 4HSPA 4WJWA 5M5WH 1PTOH 2O4XA 4JI8Q 3LWUA 4XIGS 3JAME 3CF5A 1FGUA 2HQEA 1I6VC 1Q3LA 2YU9H 2J4XA 1PXUA 2RQXA 2UXDL 5CYUA 2J7ZA 1YNND 5C44H 4O1NA 2Q2HA 4DR3Q 5K36H 1F2ZA 3EFXD 4KY6A 1EYGA 1A3VA 1LUZA 5IYCH 4V0BA 3C46A 3PF5A 4HIKA 4JK1C 1GO3E 1SMXA 4BY1H 1PHJA 5KYLA 3OWEB 4WFN3 1EY7A 1B50A 1XNRQ 5EKIA 4DV7Q 1I94L 1TWFH 1MSGA 2ALYB 1TWCB 3IKJA 3SK6A 3DLLA 5M5XH 4ZQ3A 1HA6A 3TREA 4JI7Q 3EROA 2SNSA 1KNAA 2A74C 2PO4A 2B2TC 2B2TA 2HUGA 1HCZA 2IHFA 1VQPA 2E5LQ 2KECA 1FYCA 5CBAE 1WTOA 4BY1G 1MD2D 1HTPA 4XXEA 4IUVA 2Q8TA 1QE6A 4GLXA 2UXCL 1VQ6A 3CMAA 2YTYA 2DY7A 3NTIA 2KUMA 1GXDC 3MTSA 1A2TA 4KKTA 3UE0A 2K5VA 1EYAA 1ENAA 2DGYA 1K83B 1LLRD 2QEXA 2SDFA 2LXJA 3CPFA 2K03A 1J9OA 2B8GA 2KCTA 1ET6A 4ME5A 4P74A 3Q8DA 2LSSA 5C4XB 4DF7A 1SLJA 3FKIB 1BOSA 1PVOA 2NN6H 1ZEQX 3ND8A 3I4LA 4ZKCB 4B3SQ 1B53A 3GD7A 3TMEA 1EIGA 3J81i 2L1BA 5CV9A 1CHPD 5D14A 3VR2A 3URYA 4XQJA 2NTSA 2AHOB 4HN7A 4LFAQ 1Z6HA 1VS0A 3ZYYX 4ABNA 2F0NA 3HGBA 1HZ9A 4IN3A 1EQTA 1STBA 4JBJA 1VQBA 5C3EB 3T56B 3Q22A 4X3SA 2F0WA 4JI2L 1YNJC 2FMMA 2QCPX 3K0XA 1EY5A 2NN6G 5D3IB 2XRSD 1DGSA 4EQ5A 3AEVA 1O7IA 1RDPD 5KRUA 3W3AA 1R9TH 5GADC 1TWAH 4L6TB 1YNJD 4XDXA 3MXNB 2K1BA 3OIQA 2HIXA 4BA1I 3S2DB 4FF3A 1I4XA 1N9WA 3ND9A 1KAWA 1WTWA 3SR1A 3GTJH 1GUOA 3ULJA 1JB3A 2F0DA 3NWSA 1XTDA 2VXWA 3MEHA 1D7QA 3HOYH 1BXTA 3F2UA 1YJNA 3GTLH 1M4VA 5JPMC 2RBMA 2XIWA 3PUWA 4DUYL 4TVAB 2B63H 2OWOA 1SNPA 2JE6I 3NWTA 1IW7D 2PZWA 4A4IA 4B9WA 3E0EA 3KF8A 2H1EA 4MN3A 1CHQD 2HDMA 4MZ9A 4MTKA 4RCOA 1KIXA 1NE3A 1IKMA 3FVQA 2JP1A 3PUZA 4DV6L 4BS9A 1EWCA 1B7YB 3S15H 3H0GH 2E76C 2CCZA 3I70A 4C1NK 1WTPA 3BDOA 1CSPA 3GQBA 3U9SA 4DNTB 3VA7A 5D3DA 1OXVA 1H95A 3S17H 3M3YB 3WWVA 1II3A 1YBYA 1VQKA 4K14A 1WD0A 4DNRB 2B63G 1VQ5A 1NY4A 4R8IA 1J5EQ 3KOJA 1WTVA 3I72A 2XNAC 1L0WA 2L0CA 1VQ8A 3C2PA 2B2YA 2R3ZA 1KC8C 2AWOA 5IIFA 1WTHA 4B3TL 1H9SA 3I55A 2HDLA 5FLXE 4ZLTF 2KEDA 3ZJYC 3AU7A 3H0GG 1I4GA 1LTRD 4ODGA 1VQMA 2NZOA 2Q8IB 3SGIA 1LTSD 1EFID 1HJPA 1VQGA 4K5VA 5IT9c 2EVBA 1E22A 3X3NA 4L5SA 1K8OA 1JR0D 1Y8NB 1FJGQ 2CH4A 4LJZC 3HOZH 4A3MH 1DD2A 1B3AA 1U4RA 1TIID 4OWWB 2RDHA 4PNYA 4IOAA 1EIFA 1VQHA 4N9PA 4RFBA 3KBXA 1I5FA 2UXCQ 4JVZA 5DM73 3VYRA 5GAHC 1GM5A 3E9HA 1VQAA 3P20A 1QILA 5C6AA 2LY7A 1AFPA 4IO9A 3R93A 3TP7A 5ELBA 2Z1CA 2CKZB 1AP0A 4HJ5A 2Z9HA 4RHRA 5I6WA 2PCFB 3NEMA 4QF4A 3JAML 1A0IA 3LNNA 4X64L 1M8AA 2XTIA 4K5WA 4A3MG 3DWPA 3J81j 4Z9CB 1HFNA 2KOLA 1STNA 5FO7B 1RTOA 1C8CA 4A3DG 1XX8A 4IUUA 3QO2A 3PV0A 4K6LA 4A3BH 1QZHA 2JN4A 5EPLA 3A8KE 1RCVD 4APVA 1ENFA 2H4OA 5IGFA 1E2VA 4LWCA 1I4RA 2JA8H 3G7LA 5KNCA 1UWVA 1ESFA 3OW2A 1Q8IA 3Q0AA 1XMOL 2MUYA 4UY8C 4JG2A 1X55A 3GDEA 1EU3A 1RODA 2K01A 5M5WB 1KXLA 1PTOB 2WKCA 4R9WA 4A3BG 1VQEA 2YU9B 1Q82C 1QJOA 4BBSH 3S16B 4FXKC 5EAYA 5IGGA 5JEAH 3HKZE 2JA8G 4JI1Q 5IWAL 4J6HA 3R2TA 3PCOB 1ZYRC 1K0SA 4UAIA 3D4WA 5CR3A 4X62Q 4AQYL 1G2TA 2L4NA 4BY1B 3CC2A 3N6RA 4DR4L 1MBYA 2EJFC 4HJ9A 5BR8Q 4IUPA 4N8X1 4GKKL 3RD4A 2KHJA 1YJWA 3WOFA 5IGCA 2B29A 1TWFB 1TQOA 1SSOA 4DUYQ 1MJCA 3KYHC 5M5XB 1W2BA 4BBSG 3CRKC 1EYDA 5JEAG 4RGOS 2Z0SA 2PW7A 2QF7A 4GOPB 4K8JA 2B39A 3SVMA 1STGA 1A15A 4DV6Q 5ELDA 4IURA 3PIPA 2VB3X 4H44C 3PO3H 1D5XC 4OXPA 2EYHA 1JB7A 5IYDH 2PMZB 1X32A 4LNQA 3TEHB 1SN8A 1KLUD 3DM1A 3DWAA 2F3WA 3E5SA 3VR6A 1Q86C 1D6EC 4DR5L 2ZT9C 4RGMA 1PRTF 1IZ6A 2DNCA 4B3TQ 4A3KG 2FJ2A 2EYMA 4KN4C 1XPUA 3MHBA 1PH5A 3R3OA 2RSNA 5K5PA 3PO3G 4GN4B 4OIKA 1JE5A 3QOLA 5LMUL 4R1JA 5IYDG 3BZCA 1TY2A 4YWKA 1EQVA 2F0LA 3JAMi 4YHHL 1RJTA 1U5KA 3S14H 2J0TD 1HFGA 1LM0A 5IYBH 1U4PA 2F52A 2D9UA 5FK9C 1QOHA 1S40A 4YCWA 1AEXA 4O42A 5LHY1 1PTOF 3BDCA 5CV7A 1C7YA 3CQZH 2DJFC 1Y14B 2G9HD 4NPSA 3PUYA 3K7AH 1S5ED 2VUMG 1F9SA 4C3IH 5DEHA 4JBWA 2D0PA 1R9TB 4Q0FA 3MXUA 2Z6BA 5IYBG 1BBXC 1GUSA 4X64Q 4A3JH 1H9JA 1FNVA 1G2SA 1HRJA 2FFKB 2EYFA 1E2ZA 2G9DA 2N88A 2CQOA 3TZUA 4AIMA 4CDDC 1SNOA 3QIAA 1N33L 3TRZA 3UE1A 1FD7D 3GTJB 1UNSA 3K7UC 4XQQA 2K32A 3CXCA 1WFQA 1YHAA 4HR7B 4LF5L 1LTAD 3KDFB 3NELA 2RF4A 4C3IG 4DV3L 4NXNL 1X6OA 3GTLB 3HG9A 3OHXC 5FLXL 3VR4A 4HIOA 2BCOA 2B63B 1I50H 3MVVA 3TN2A 1YEZA 3NHHA 4A3JG 3H3VC 4DAYA 4DR7L 1XMOQ 3S1MH 3UDIA 4AYBB 2K05A 4K5XA 1XNQL 3M3YH 3J7ZC 1JE4A 1CSQA 4IALA 5JEAJ 1ZKOA 3JAMc 4E6IA 1K8GA 5IP9H 3S15B 1Q8KA 3H0GB 4IFDI 4FXDA 1T5EA 4IUTA 3NBHB 1YI2A 1IL2A 2EYPA 5JPNC 2BA0A 2WKDA 1PH4A 1C0AA 1EY6A 3FEWX 4NP5A 3RUZA 1SE8A 3S17B 4DK3C 3MEFA 3PQIA 1EEFD 4PMWA 3ERSX 3ERQA 1VQ4A 1A63A 5I6YA 3LX0A 3NTKA 3OTOQ 4KMUC 2RSOA 1V43A 4PMCA 4AQYQ 5JVG3 4DN4M 3PO2G 4HIDA 3IL8A 3T53B 1VF7A 1STAA 4JC0A 1SYGA 1NBWA 4A3FH 2QDLA 3S1QB 4CGYB 2R7DA 2AWNA 4GKKQ 5IP9G 5M5YH 1IBML 1D1KA 2PQAA 5A35A 2YTXA 3FHWA 4QIWE 1D5ZC 1OTCA 4CBVA 1V1PA 4JPBW 2HHHL 5AJ3L 3JC66 1HNXQ 3S1RB 5ELCA 4GN5A 1EZ6A 3CCVA 3B6YA 2D5DA 3A7LA 1V8QA 3V2TA 2MQHA 4H02A 2Z4IA 4A3MB 2IHEA 1G291 1PMRA 2KCNA 1ICWA 1K8MA 4IJLA 1IKLA 1WTXA 1Q81C 4A3FG 2R6GA 4Y7NH 4A3DB 1UUPA 3EVQA 1RL2A 4GNXC 3BZDB 4JYAQ 4GNXA 1OXTA 4NXMQ 2UUAL 3QR8A 3HKZG 4HCSA 2OTJA 4N8FA 4QUCA 3LWEA 3VA5A 1L1OB 2B2WA 4LAAA 2ZJRA 4X65L 4DR5Q 1P8LA 5C0XI 2WP8J 1NR4A 1KRSA 1Y1WG 2M00A 1CFMA 1JC7A 3SHLA 3S24A 3CP0A 3HOXG 3TZDA 2IX3A 2XWJB 4OIJA 1X56A 2EXZA 3T1YL 2C5CA 3BDLA 1PLFA 4DK0A 1X65A 3CPWA 5J22A 1SRUA 4NDXA 4MIUA 4RGNA 5LMUQ 4TSSA 3K57A 2A6EC 1ICFB 3OIPA 4A3BB 1C4QA 4YHHQ 3H15A 2L12A 3D6WA 2VS1A 3S1NH 1HXYD 5FO9B 1LTTD 3D8GA 1MI2A 1YHQA 3UDGA 2KHIA 5HURA 2F3VA 2JA8B 4XTCS 3MZ5A 4LFCL 1KNEA 2A6ED 4IUQA 2QA4A 2E2IB 4HCEA 1AZQA 2VW9A 5IP7G 2EYLA 5T1IA 2VL6A 4NW2A 5I9PA 2KEEA 3S16H 2VQFL 4BY7H 1D8LA 2F0EA 4KJNA 5LL6X 4KI0A 2ZM6Q 2G5DA 3C1EA 2RHQB 4LFBL 2F0IA 1ZXTA 1EUJA 4BBSB 5ISRA 4QUFA 5JJKA 3OOCA 1N36Q 2BA1A 3E9IA 1VCIA 1IBLQ 4HSVA 2QKIC 1R4QB 2XVSA 4XQNA 2A6HC 3BYTB 3OMGA 4DV0L 4P2CB 1N33Q 4BA2I 3I90A 3VR3A 4CKBA 3AYHB 3T13A 1JWUD 5EKLA 4M8AA 1K3BC 1LT5D 4LF5Q 2NVTH 1RKNA 5DM63 1IBKL 5BN3A 4DV3Q 1TVXA 4BY7G 4NXNQ 3SK5A 1QVFA 3P7JA 2A6HD 3HRZC 2VY3A 5ELEA 3HOVH 3E3XA 3I4MG 2EZVA 5D65A 1VQFA 3BVZA 1ENCA 4DR7Q 1JJGA 4DV1L 4A75A 4OO1G 3NSWA 1O80A 4CJ1B 4A3KB 3Q23A 2NVQB 1GHKA 2O2LD 1AH9A 2MGSA 5G3LF 1VQJA 4P73A 3PO3B 2WAQE 5I2YA 3ULLA 5LL6S 1EOVA 4KN7C 3HOVG 1WVLA 4IFDH 4HJ8A 4L5TA 3A0JA 1PFMA 3G71A 2E2JB 1AN8A 1YZ6A 4R4OA 5FLXc 5AFWA 5EPJA 3KLRA 4IPCA 2HIVA 1WD1A 1CI3M 4J15A 3J7A5 3GTKB 2VUMB 1GKHA 1KTKA 4AH6A 5AJ3Q 2EDGA 4RA8A 1BNZA 4FXGC 2ZTEA 3VYTA 3FDTA 3QWNA 4IFDG 4P75A 3S14B 1PFSA 1YIJA 3VDYA 3A56A 4OWTB 4ZKBB 5E3FA 1QNKA 3X3MA 3HEJA 1W6JA 4LUOA 2MPMA 1OXXK 3SXHA 4LF7L 3CQZB 3QG1A 1E3PA 2UUAQ 1FNWA 3K7AB 3O13A 1LYLA 4C3IB 1EQRA 2WB1G 2PPBC 1Z7TA 2VQEL 2ZXRA 3K8AA 1KD1C 4HJ7A 4DR1L 2K28A 4Y52H 3F2BA 4A3JB 3GV3A 4KHZA 4OELB 3H6MA 1VQNA 2CVRA 1NTGA 1UE6A 1HNZL 3T1YQ 2KENA 1L0XB 2K7VA 4JCVE 5C0XH 1A6XA 1P16A 2I46A 2NZHA 4R4TA 1S5DD 5EBDA 3AMUA 2BDOA 2JXMB 3GTOH 2OEOA 5GAGC 3CCMA 1K0RA 1SNQA 3KK7A 1C9OA 3CHBD 2CH4W 3K6OA 1QG7A 4YY3L 2RDFA 1KL9A 1I50B 5CORA 1OXSC 1CTMA 3DEOA 2UXBL 5C3XA 3L3OC 5C0XG 3S1MB 1BQQT 3PO2B 3M4YA 2GVAA 3EN2A 4JW0A 2UXDQ
chains in the Genus database with same CATH topology
4HJ9A 4MTNA 2VQFQ 5BR8Q 1G51A 3L2PA 1HR0L 3GO5A 4GKKL 2KHJA 3UDXA 1YJWA 2JK8A 5E7NA 1UE1A 1KHIA 4JOIC 3PO3G 4JOIA 2B29A 5ELOA 4BBRG 4B3ML 3G6EA 1W3SA 4DUYQ 1MJCA 3HKSA 1HNWL 4DKAC 4LFBQ 3KYHC 1W2BA 2MO0A 4BBSG 4MNOA 4A3CG 4GS3A 4AYBG 1PH7A 1B70B 2Q2IA 5JEAG 3GTGH 2Z0SA 5FJ8H 2NN6I 4GOPB 1SFOH 1XNQQ 3S1QH 3L7ZC 2VNUD 4DV0Q 3RLFA 5C44G 1EQQA 3M4PA 5K36G 3PSIA 1N34L 1I94Q 2F4VL 1RIPA 1FJGL 2WB1E 4POGA 5IYCG 4DV6Q 4A3CH 4DV5Q 3PIPA 4LF8L 3GTQH 3PO3H 1Y1VH 1IBKQ 4C3HH 4OXPA 1XJVA 4JI3L 4C3JH 1JB7A 2I0QA 4B3SL 3T1HQ 3S1RH 4LF6L 1FVIA 3I2ZA 3D31A 5IYDH 4GKJQ 2AKWB 1E7ZA 4JI4Q 1E24A 2AMCB 2N8NA 4A76A 4LNQA 3TEHB 3W1BA 4IOCA 1SN8A 4LFAL 1U0LA 4B3RL 1Q86C 1YITA 1IXRA 4DR5L 1MIUA 1XPOA 2UUCL 5DLQE 3BJUA 4DR6Q 5FJ8G 1IZ6A 4O2DA 4A3DH 4B3TQ 1MKHA 2OQKA 4YWLA 4A3KG 4UPAA 3FP9A 4LF9Q 1IBMQ 5LMNW 2R7ZG 1VQIA 1XPUA 1JJ2A 1EWIA 1PH5A 3CAMA 1N32Q 2HHHQ 4GN4B 3A74A 4C2MH 1Y1VG 2EIFA 2FXQA 2OCEA 5LMNQ 2UUBL 3RZDH 1JE5A 5LMUL 2K14A 4R1JA 5IYDG 3OYYA 2YV5A 3K81C 3BZCA 1YJ9A 2BH8A 4YWKA 1CKMA 2OTLA 4TQUS 3JAMi 4YHHL 1PYSB 3ULPA 1U5KA 4GNXB 3S14H 1QVGA 4WJ3M 1LM0A 5IYBH 1JT8A 2PI2A 1K3RA 2F52A 1EIYB 3LGJA 1S40A 3CCUA 3AFQA 2RCNA 4YCWA 1BBUA 4K0KQ 2QGQA 4DV4Q 1S3OA 4FDBA 3PF4A 1C7YA 1PH3A 3CQZH 1Y14B 1X3FA 2K50A 4OWXB 4AYBE 3I7FA 3M85A 4NPSA 2YTVA 3PUYA 4PG3A 3K7AH 4RG1A 4JI5L 4LF4Q 4X65Q 2VUMG 3RZOH 4EX5A 4GLAC 2JQOA 4C3IH 3HFZB 3TQYA 3U4VA 1VQCA 4QGUA 1V1QA 4JBWA 2GVBA 1JJCB 5M3FH 2D0PA 3M4OH 3CD6A 1EFWA 1NMGA 4UP8A 1PH9A 5M3MH 3ER0A 4JBMA 1J6QA 2LXKA 2E2IH 1OXUA 4JBKA 4PZ8A 4JI2Q 5IYBG 4X64Q 4A3JH 2IX1A 5HY6A 1HZAA 5GQOA 1FL0A 5H1SE 5C4JH 2CQOA 3CC4A 2JA7H 4KHPQ 4AIMA 2WAQG 3L0OA 1N33L 1QVCA 2EXDA 4O0AA 1K9MC 1E1TA 3UE1A 2NVXH 3TRZA 4JI1L 5M5WH 2KBNA 2UU9L 3K7UC 4JI8Q 3CF5A 1Z47A 4XIGS 1WFQA 1FGUA 3CXCA 4DUZQ 1YHAA 1AE3A 4X62L 4X66Q 1ASYA 4LF5L 3NENA 3KDFB 3NELA 2RF4A 4DV3L 2YU9H 4WJ4A 2A19A 4NXNL 2UXDL 4JV5L 1X6OA 5M3FG 5C44H 2DUDA 5BR8L 4HIOA 2Q2HA 4LFCQ 4DR3Q 4RMFA 2RHSB 1I50H 1SROA 3RR5A 1YEZA 4A3JG 1LUZA 1EYGA 5IYCH 3PF5A 4DV2L 5FLMH 1Q1EA 2CFMA 4DR7L 4HIKA 1GO3E 1CUKA 1QUQA 3D0FA 1SMXA 3UDIA 3CCQA 1XMOQ 4BY1H 1PHJA 2JA7G 4OX9L 3KF8B 4R4QA 2MFIA 2HT1A 1B8AA 2K52A 1XNQL 3M3YH 3J7ZC 1XNRQ 4A3GH 1CSQA 5JEAJ 4UP9A 3JAMc 1K8GA 1S72A 4DV7Q 2ID0A 4YCVA 5IP9H 1I94L 4A93H 1Q8KA 1TWFH 3J81c 3TS0A 2ALYB 1K8AC 1VQ9A 3NBHB 3RN2A 1YI2A 1IL2A 3GTPH 1I3QH 2BA0A 3DLLA 1PH4A 5M5XH 3I4OA 1C0AA 4UP7A 5HGQA 4GOPC 3U4ZA 4GOPA 3TREA 2I5MX 1SE8A 4JI7Q 3HOYG 3U58A 4A3KH 3G48A 3MEFA 4DK3C 4LUVA 2NVQH 4PMWA 1Q46A 3ERSX 2R7ZH 4A3LH 2N3SA 1VQ4A 2IHFA 2MO1A 1VQPA 2E5LQ 3W1GA 5FLMG 3OTOQ 3F2CA 4JI6Q 2UXBQ 1V43A 1A63A 4A3IH 4AQYQ 2JA5H 2B3GA 1YHBA 4BY1G 1HR0W 3PO2G 4IPDA 4HIDA 4A3EH 2H5XA 1CKNA 3W5OA 4DR6L 4JC0A 1NBWA 4A3FH 4GLXA 2UXCL 1VQ6A 3CMAA 2R7DA 3KJPA 2AWNA 1HR0Q 3F1ZA 1PV4A 4A3GG 3EIVA 4JI0L 4GKKQ 2YTYA 5IP9G 3M4QA 5M5YH 1IBML 2L15A 3TS2A 1X54A 2K5NA 2PQAA 4B3MQ 2YTXA 4A3LG 3FHWA 4A93G 2PI2E 4QIWE 1OTCA 4DV1Q 3UE0A 2K5VA 1WOCA 5AJ3L 2HHHL 3DM3A 3JC66 3AFPA 3KF6B 2DGYA 2E2JH 3I56A 2QEXA 4GN3B 2LXJA 1HNXQ 3CPFA 4GN5A 3CCVA 3B6YA 2KCTA 1M90C 2MQHA 4P74A 3Q8DA 4H02A 2LSSA 1N34Q 4IFDJ 4YWMA 4A3IG 2JA5G 3PIOA 2IHEA 1SLJA 4DR2L 1G291 2VUMH 3GTKH 1PVOA 4IJLA 5J3BA 4A3EG 2A8VA 3KJOA 1Q81C 2PNHA 1QZGA 4A3FG 1K73C 2R6GA 4Y7NH 4JI3Q 4B3SQ 3BZKA 4LF6Q 1RL2A 3HOWH 4GNXC 4JYAQ 4GNXA 3GD7A 1OXTA 3STBC 4NXMQ 2UUAL 3J81i 3HKZG 2OTJA 3H3VH 4IPGA 2AHOB 4LFAQ 3CCEA 1L1OB 2Y0SG 3HOUG 4R4IA 4QQBX 1BVSA 2KCMA 1VS0A 3GTMH 4B3RQ 2ZJRA 4X65L 4DR5Q 1XMQL 1GD7A 1P8LA 2UUCQ 5C0XI 2JA6H 2WP8J 1HZ9A 1KRSA 1Y1WG 2Q2TA 1I6HH 4JBJA 1VQBA 3S24A 3PUXA 3CP0A 3HOXG 4P71A 4BXXH 1X56A 2CWPA 4JI2L 3T1YL 1N8RC 3K0XA 1PH1A 3HOZG 2NN6G 1X65A 1KRTA 3CPWA 1SRUA 2UUBQ 2ZJQA 5LMUQ 4OO1I 3HOWG 1DGSA 4EQ5A 3AEVA 1O7IA 4YHHQ 3H15A 2XGTA 1R9TH 2ASBA 5GADC 1NJIC 1TWAH 2VS1A 4JI8L 3S1NH 3MXNB 2JEAI 2JA6G 2HIXA 3PGZA 3J80i 4BA1I 1YHQA 3UDGA 2KHIA 2Z6KC 2ATWA 3CW2C 1N9WA 4XTCS 1KAWA 3I4NG 2V1CC 4LF7Q 4BXXG 4LFCL 2QA4A 3GTJH 2K4KA 2HQLA 3ULJA 2VW9A 3KDFA 5IP7G 3AQQA 2R7FA 2VL6A 4LW1A 1XTDA 1D7QA 2WFWA 3CCLA 4JI5Q 2R92H 2JEBI 2VQEQ 5C0XJ 3S16H 2VQFL 3HOYH 4BY7H 2K75A 1D8LA 4DR1Q 1T9HA 1ASZA 2ZM6Q 4KI0A 1YJNA 3GTLH 1L2FA 3PUWA 1XNRL 4DUYL 1X3GA 4TVAB 2B63H 1HNZQ 2RHQB 2OWOA 3A5UA 4LFBL 2JE6I 4A4IA 1EUJA 3E0EA 3PO2H 5JJKA 1N36Q 3M7NA 2BA1A 3E9IA 4MZ9A 1VCIA 1IBLQ 1TXYA 1KIXA 1NE3A 4DV0L 1VQDA 3S2HH 1VQ7A 1N33Q 4BA2I 1YNXA 2F3IA 1LTLA 4IPHA 1E1OA 3AYHB 4DAMA 2UU9Q 3PUZA 4L5QA 4DV6L 1B7YB 1BBWA 3OTOL 1WCMH 1WYDA 4DV5L 3H0GH 3RNUA 3S15H 4LF5Q 2NVTH 1X3EA 2R92G 1TWCH 2CCZA 4DAYB 3RN5A 1M1KC 4DV3Q 1MJEA 4PZ7A 1IBKL 4BY7G 1CSPA 4YY3Q 3F2DA 4NXNQ 3T1HL 1QVFA 4JV5Q 1QUQB 4GKJL 1OXVA 4PZ6A 5IWAQ 1H95A 3S17H 2E8GA 2VY3A 1YBYA 1UE7A 3WWVA 3CCJA 4JI4L 1Q7YC 3HOVH 1VQKA 2B63G 1VQ5A 3I4MG 1NY4A 1J5EQ 3KOJA 1VQFA 4DV2Q 2EQSA 1L0WA 4DR7Q 1JJGA 4DV1L 1HZCA 1VQ8A 4DR4Q 4A75A 4OO1G 1KC8C 2AWOA 4OX9Q 4B3TL 4LF9L 4QL5A 1KQSA 1HNXL 3I55A 3RLNA 2C35B 2D0OA 1HNWQ 1AH9A 1NMFA 3ZJYC 1VQJA 1WCMG 3HOUH 3H0GG 4ME3A 4P73A 1N32L 2WAQE 3U50C 3ULLA 2NZOA 3KF6A 5LMNL 1VQMA 3SGIA 1EOVA 2GN5A 3J80c 1Q1BA 1HJPA 4GLVB 1Y1WH 1VQGA 2NVYH 1K83H 4X6AH 5IT9c 2I5HA 4P72A 3HOXH 1CKNB 3HOVG 4JYAL 3RLOA 1JMCA 1E22A 4L5SA 2F4VQ 4NXML 1WI5A 1FJGQ 4HJ8A 4L5TA 3HOZH 3A0JA 3KFUA 1X9NA 3G71A 5C4XH 4A3MH 4LF8Q 3FKIH 5JJIA 4HJAA 2PQAB 4OWWB 4IOAA 1YZ6A 2CWAA 1EIFA 4L5RC 4K0KL 1VQHA 1PH2A 4R4OA 4DV4L 4ALPA 1I5FA 5FLXc 1BKBA 2UXCQ 4IPCA 2HIVA 4YCUA 4JI0Q 1L1OC 4KLKA 5GAHC 1L1OA 2K5HA 1GM5A 3CMEA 3E9HA 1VQAA 4QY7A 4J15A 3CC7A 4LF4L 3J7A5 1GKHA 4AH6A 4IO9A 1G6PA 5AJ3Q 1V9PA 4HIMA 2CKZB 2A1AA 2ZTEA 4HJ5A 1UE5A 4QJFA 5ELNA 5GAEC 3I4NH 1HZBA 4DR4L 1TWHH 4DNIA 1IYJB 3STBD 3NEMA 4POFA 4IFDG 4P75A 1A0IA 2ES2A 4X64L 5C3EH 1PYBA 1PFSA 2XTIA 3K80C 5IP7H 3CCSA 3VDYA 4A3MG 4OWTB 3J81j 1YIJA 5C4XG 3A5ZB 4DR2Q 3FKIG 2MNAA 1AE2A 4NB3A 5JJLA 2OQ0A 4KHPL 4LUOA 4IJHA 1OXXK 4A3DG 4DPGA 3BU2A 3PV0A 5GROA 4LF7L 2ZJPA 1E3PA 2UUAQ 4DUZL 4A3BH 1QZHA 4X66L 1VQLA 2ZTDA 3CCRA 1LYLA 2JJQA 3F8TA 1EQRA 2WB1G 2JA9A 4APVA 2Z6KA 2VQEL 1XMQQ 2Q2UA 3UDFA 3K8AA 3H3VI 1KD1C 1HH2P 2D62A 4HJ7A 1GVPA 4LWCA 4DR1L 4DR3L 2BH2A 3S2DH 2ZM6L 1VQOA 1Q12A 2JA8H 4Y52H 2N78A 5C3EG 3F2BA 4KHZA 1UWVA 2N49A 1VQNA 3OW2A 1NTGA 1UE6A 1HNZL 3T1YQ 2KENA 4JCVE 1XMOL 4UY8C 5IE8A 1P16A 3S1MH 1XPRA 2NZHA 4JG2A 2R93H 4R4TA 1X55A 3GDEA 1N36L 1A8VA 3PUVA 2IY5B 1IBLL 3EBEA 4IFDI 1KXLA 3GTOH 2IX0A 4DV7L 1Z9FA 2ZTCA 1PH6A 3I4MH 4A3BG 1VQEA 4BBRH 3ICEA 5GAGC 3CCMA 1WJJA 1K0RA 1Q82C 1C9OA 4BBSH 1A62A 3M9BA 4R4CA 5EAYA 3G4SA 1UEBA 4JI7L 3HKZE 4DK6C 4YY3L 2PMZE 1KL9A 2YYZA 2JA8G 4JI1Q 5IWAL 2Y0SE 1OXSC 1CKOA 5M3MG 3PCOB 2E5LL 4JI6L 2UXBL 1PA6A 2I5LX 1PH8A 2E2HH 4X62Q 4AQYL 2IT1A 5C0XG 3KLWA 1SR3A 1J5EL 3IRBA 2R93G 3CC2A 1YVCA 4OONA 2GVAA 3EN2A 4LUZA 2UXDQ 2VZAA 1TWGH 5IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ9 A;  4MTN A;  2VQF Q;  5BR8 Q;  1G51 A;  3L2P A;  1HR0 L;  3GO5 A;  4GKK L;  2KHJ A;  3UDX A;  1YJW A;  2JK8 A;  5E7N A;  1UE1 A;  1KHI A;  4JOI C;  3PO3 G;  4JOI A;  2B29 A;  5ELO A;  4BBR G;  4B3M L;  3G6E A;  1W3S A;  4DUY Q;  1MJC A;  3HKS A;  1HNW L;  4DKA C;  4LFB Q;  3KYH C;  1W2B A;  2MO0 A;  4BBS G;  4MNO A;  4A3C G;  4GS3 A;  4AYB G;  1PH7 A;  1B70 B;  2Q2I A;  5JEA G;  3GTG H;  2Z0S A;  5FJ8 H;  2NN6 I;  4GOP B;  1SFO H;  1XNQ Q;  3S1Q H;  3L7Z C;  2VNU D;  4DV0 Q;  3RLF A;  5C44 G;  1EQQ A;  3M4P A;  5K36 G;  3PSI A;  1N34 L;  1I94 Q;  2F4V L;  1RIP A;  1FJG L;  2WB1 E;  4POG A;  5IYC G;  4DV6 Q;  4A3C H;  4DV5 Q;  3PIP A;  4LF8 L;  3GTQ H;  3PO3 H;  1Y1V H;  1IBK Q;  4C3H H;  4OXP A;  1XJV A;  4JI3 L;  4C3J H;  1JB7 A;  2I0Q A;  4B3S L;  3T1H Q;  3S1R H;  4LF6 L;  1FVI A;  3I2Z A;  3D31 A;  5IYD H;  4GKJ Q;  2AKW B;  1E7Z A;  4JI4 Q;  1E24 A;  2AMC B;  2N8N A;  4A76 A;  4LNQ A;  3TEH B;  3W1B A;  4IOC A;  1SN8 A;  4LFA L;  1U0L A;  4B3R L;  1Q86 C;  1YIT A;  1IXR A;  4DR5 L;  1MIU A;  1XPO A;  2UUC L;  5DLQ E;  3BJU A;  4DR6 Q;  5FJ8 G;  1IZ6 A;  4O2D A;  4A3D H;  4B3T Q;  1MKH A;  2OQK A;  4YWL A;  4A3K G;  4UPA A;  3FP9 A;  4LF9 Q;  1IBM Q;  5LMN W;  2R7Z G;  1VQI A;  1XPU A;  1JJ2 A;  1EWI A;  1PH5 A;  3CAM A;  1N32 Q;  2HHH Q;  4GN4 B;  3A74 A;  4C2M H;  1Y1V G;  2EIF A;  2FXQ A;  2OCE A;  5LMN Q;  2UUB L;  3RZD H;  1JE5 A;  5LMU L;  2K14 A;  4R1J A;  5IYD G;  3OYY A;  2YV5 A;  3K81 C;  3BZC A;  1YJ9 A;  2BH8 A;  4YWK A;  1CKM A;  2OTL A;  4TQU S;  3JAM i;  4YHH L;  1PYS B;  3ULP A;  1U5K A;  4GNX B;  3S14 H;  1QVG A;  4WJ3 M;  1LM0 A;  5IYB H;  1JT8 A;  2PI2 A;  1K3R A;  2F52 A;  1EIY B;  3LGJ A;  1S40 A;  3CCU A;  3AFQ A;  2RCN A;  4YCW A;  1BBU A;  4K0K Q;  2QGQ A;  4DV4 Q;  1S3O A;  4FDB A;  3PF4 A;  1C7Y A;  1PH3 A;  3CQZ H;  1Y14 B;  1X3F A;  2K50 A;  4OWX B;  4AYB E;  3I7F A;  3M85 A;  4NPS A;  2YTV A;  3PUY A;  4PG3 A;  3K7A H;  4RG1 A;  4JI5 L;  4LF4 Q;  4X65 Q;  2VUM G;  3RZO H;  4EX5 A;  4GLA C;  2JQO A;  4C3I H;  3HFZ B;  3TQY A;  3U4V A;  1VQC A;  4QGU A;  1V1Q A;  4JBW A;  2GVB A;  1JJC B;  5M3F H;  2D0P A;  3M4O H;  3CD6 A;  1EFW A;  1NMG A;  4UP8 A;  1PH9 A;  5M3M H;  3ER0 A;  4JBM A;  1J6Q A;  2LXK A;  2E2I H;  1OXU A;  4JBK A;  4PZ8 A;  4JI2 Q;  5IYB G;  4X64 Q;  4A3J H;  2IX1 A;  5HY6 A;  1HZA A;  5GQO A;  1FL0 A;  5H1S E;  5C4J H;  2CQO A;  3CC4 A;  2JA7 H;  4KHP Q;  4AIM A;  2WAQ G;  3L0O A;  1N33 L;  1QVC A;  2EXD A;  4O0A A;  1K9M C;  1E1T A;  3UE1 A;  2NVX H;  3TRZ A;  4JI1 L;  5M5W H;  2KBN A;  2UU9 L;  3K7U C;  4JI8 Q;  3CF5 A;  1Z47 A;  4XIG S;  1WFQ A;  1FGU A;  3CXC A;  4DUZ Q;  1YHA A;  1AE3 A;  4X62 L;  4X66 Q;  1ASY A;  4LF5 L;  3NEN A;  3KDF B;  3NEL A;  2RF4 A;  4DV3 L;  2YU9 H;  4WJ4 A;  2A19 A;  4NXN L;  2UXD L;  4JV5 L;  1X6O A;  5M3F G;  5C44 H;  2DUD A;  5BR8 L;  4HIO A;  2Q2H A;  4LFC Q;  4DR3 Q;  4RMF A;  2RHS B;  1I50 H;  1SRO A;  3RR5 A;  1YEZ A;  4A3J G;  1LUZ A;  1EYG A;  5IYC H;  3PF5 A;  4DV2 L;  5FLM H;  1Q1E A;  2CFM A;  4DR7 L;  4HIK A;  1GO3 E;  1CUK A;  1QUQ A;  3D0F A;  1SMX A;  3UDI A;  3CCQ A;  1XMO Q;  4BY1 H;  1PHJ A;  2JA7 G;  4OX9 L;  3KF8 B;  4R4Q A;  2MFI A;  2HT1 A;  1B8A A;  2K52 A;  1XNQ L;  3M3Y H;  3J7Z C;  1XNR Q;  4A3G H;  1CSQ A;  5JEA J;  4UP9 A;  3JAM c;  1K8G A;  1S72 A;  4DV7 Q;  2ID0 A;  4YCV A;  5IP9 H;  1I94 L;  4A93 H;  1Q8K A;  1TWF H;  3J81 c;  3TS0 A;  2ALY B;  1K8A C;  1VQ9 A;  3NBH B;  3RN2 A;  1YI2 A;  1IL2 A;  3GTP H;  1I3Q H;  2BA0 A;  3DLL A;  1PH4 A;  5M5X H;  3I4O A;  1C0A A;  4UP7 A;  5HGQ A;  4GOP C;  3U4Z A;  4GOP A;  3TRE A;  2I5M X;  1SE8 A;  4JI7 Q;  3HOY G;  3U58 A;  4A3K H;  3G48 A;  3MEF A;  4DK3 C;  4LUV A;  2NVQ H;  4PMW A;  1Q46 A;  3ERS X;  2R7Z H;  4A3L H;  2N3S A;  1VQ4 A;  2IHF A;  2MO1 A;  1VQP A;  2E5L Q;  3W1G A;  5FLM G;  3OTO Q;  3F2C A;  4JI6 Q;  2UXB Q;  1V43 A;  1A63 A;  4A3I H;  4AQY Q;  2JA5 H;  2B3G A;  1YHB A;  4BY1 G;  1HR0 W;  3PO2 G;  4IPD A;  4HID A;  4A3E H;  2H5X A;  1CKN A;  3W5O A;  4DR6 L;  4JC0 A;  1NBW A;  4A3F H;  4GLX A;  2UXC L;  1VQ6 A;  3CMA A;  2R7D A;  3KJP A;  2AWN A;  1HR0 Q;  3F1Z A;  1PV4 A;  4A3G G;  3EIV A;  4JI0 L;  4GKK Q;  2YTY A;  5IP9 G;  3M4Q A;  5M5Y H;  1IBM L;  2L15 A;  3TS2 A;  1X54 A;  2K5N A;  2PQA A;  4B3M Q;  2YTX A;  4A3L G;  3FHW A;  4A93 G;  2PI2 E;  4QIW E;  1OTC A;  4DV1 Q;  3UE0 A;  2K5V A;  1WOC A;  5AJ3 L;  2HHH L;  3DM3 A;  3JC6 6;  3AFP A;  3KF6 B;  2DGY A;  2E2J H;  3I56 A;  2QEX A;  4GN3 B;  2LXJ A;  1HNX Q;  3CPF A;  4GN5 A;  3CCV A;  3B6Y A;  2KCT A;  1M90 C;  2MQH A;  4P74 A;  3Q8D A;  4H02 A;  2LSS A;  1N34 Q;  4IFD J;  4YWM A;  4A3I G;  2JA5 G;  3PIO A;  2IHE A;  1SLJ A;  4DR2 L;  1G29 1;  2VUM H;  3GTK H;  1PVO A;  4IJL A;  5J3B A;  4A3E G;  2A8V A;  3KJO A;  1Q81 C;  2PNH A;  1QZG A;  4A3F G;  1K73 C;  2R6G A;  4Y7N H;  4JI3 Q;  4B3S Q;  3BZK A;  4LF6 Q;  1RL2 A;  3HOW H;  4GNX C;  4JYA Q;  4GNX A;  3GD7 A;  1OXT A;  3STB C;  4NXM Q;  2UUA L;  3J81 i;  3HKZ G;  2OTJ A;  3H3V H;  4IPG A;  2AHO B;  4LFA Q;  3CCE A;  1L1O B;  2Y0S G;  3HOU G;  4R4I A;  4QQB X;  1BVS A;  2KCM A;  1VS0 A;  3GTM H;  4B3R Q;  2ZJR A;  4X65 L;  4DR5 Q;  1XMQ L;  1GD7 A;  1P8L A;  2UUC Q;  5C0X I;  2JA6 H;  2WP8 J;  1HZ9 A;  1KRS A;  1Y1W G;  2Q2T A;  1I6H H;  4JBJ A;  1VQB A;  3S24 A;  3PUX A;  3CP0 A;  3HOX G;  4P71 A;  4BXX H;  1X56 A;  2CWP A;  4JI2 L;  3T1Y L;  1N8R C;  3K0X A;  1PH1 A;  3HOZ G;  2NN6 G;  1X65 A;  1KRT A;  3CPW A;  1SRU A;  2UUB Q;  2ZJQ A;  5LMU Q;  4OO1 I;  3HOW G;  1DGS A;  4EQ5 A;  3AEV A;  1O7I A;  4YHH Q;  3H15 A;  2XGT A;  1R9T H;  2ASB A;  5GAD C;  1NJI C;  1TWA H;  2VS1 A;  4JI8 L;  3S1N H;  3MXN B;  2JEA I;  2JA6 G;  2HIX A;  3PGZ A;  3J80 i;  4BA1 I;  1YHQ A;  3UDG A;  2KHI A;  2Z6K C;  2ATW A;  3CW2 C;  1N9W A;  4XTC S;  1KAW A;  3I4N G;  2V1C C;  4LF7 Q;  4BXX G;  4LFC L;  2QA4 A;  3GTJ H;  2K4K A;  2HQL A;  3ULJ A;  2VW9 A;  3KDF A;  5IP7 G;  3AQQ A;  2R7F A;  2VL6 A;  4LW1 A;  1XTD A;  1D7Q A;  2WFW A;  3CCL A;  4JI5 Q;  2R92 H;  2JEB I;  2VQE Q;  5C0X J;  3S16 H;  2VQF L;  3HOY H;  4BY7 H;  2K75 A;  1D8L A;  4DR1 Q;  1T9H A;  1ASZ A;  2ZM6 Q;  4KI0 A;  1YJN A;  3GTL H;  1L2F A;  3PUW A;  1XNR L;  4DUY L;  1X3G A;  4TVA B;  2B63 H;  1HNZ Q;  2RHQ B;  2OWO A;  3A5U A;  4LFB L;  2JE6 I;  4A4I A;  1EUJ A;  3E0E A;  3PO2 H;  5JJK A;  1N36 Q;  3M7N A;  2BA1 A;  3E9I A;  4MZ9 A;  1VCI A;  1IBL Q;  1TXY A;  1KIX A;  1NE3 A;  4DV0 L;  1VQD A;  3S2H H;  1VQ7 A;  1N33 Q;  4BA2 I;  1YNX A;  2F3I A;  1LTL A;  4IPH A;  1E1O A;  3AYH B;  4DAM A;  2UU9 Q;  3PUZ A;  4L5Q A;  4DV6 L;  1B7Y B;  1BBW A;  3OTO L;  1WCM H;  1WYD A;  4DV5 L;  3H0G H;  3RNU A;  3S15 H;  4LF5 Q;  2NVT H;  1X3E A;  2R92 G;  1TWC H;  2CCZ A;  4DAY B;  3RN5 A;  1M1K C;  4DV3 Q;  1MJE A;  4PZ7 A;  1IBK L;  4BY7 G;  1CSP A;  4YY3 Q;  3F2D A;  4NXN Q;  3T1H L;  1QVF A;  4JV5 Q;  1QUQ B;  4GKJ L;  1OXV A;  4PZ6 A;  5IWA Q;  1H95 A;  3S17 H;  2E8G A;  2VY3 A;  1YBY A;  1UE7 A;  3WWV A;  3CCJ A;  4JI4 L;  1Q7Y C;  3HOV H;  1VQK A;  2B63 G;  1VQ5 A;  3I4M G;  1NY4 A;  1J5E Q;  3KOJ A;  1VQF A;  4DV2 Q;  2EQS A;  1L0W A;  4DR7 Q;  1JJG A;  4DV1 L;  1HZC A;  1VQ8 A;  4DR4 Q;  4A75 A;  4OO1 G;  1KC8 C;  2AWO A;  4OX9 Q;  4B3T L;  4LF9 L;  4QL5 A;  1KQS A;  1HNX L;  3I55 A;  3RLN A;  2C35 B;  2D0O A;  1HNW Q;  1AH9 A;  1NMF A;  3ZJY C;  1VQJ A;  1WCM G;  3HOU H;  3H0G G;  4ME3 A;  4P73 A;  1N32 L;  2WAQ E;  3U50 C;  3ULL A;  2NZO A;  3KF6 A;  5LMN L;  1VQM A;  3SGI A;  1EOV A;  2GN5 A;  3J80 c;  1Q1B A;  1HJP A;  4GLV B;  1Y1W H;  1VQG A;  2NVY H;  1K83 H;  4X6A H;  5IT9 c;  2I5H A;  4P72 A;  3HOX H;  1CKN B;  3HOV G;  4JYA L;  3RLO A;  1JMC A;  1E22 A;  4L5S A;  2F4V Q;  4NXM L;  1WI5 A;  1FJG Q;  4HJ8 A;  4L5T A;  3HOZ H;  3A0J A;  3KFU A;  1X9N A;  3G71 A;  5C4X H;  4A3M H;  4LF8 Q;  3FKI H;  5JJI A;  4HJA A;  2PQA B;  4OWW B;  4IOA A;  1YZ6 A;  2CWA A;  1EIF A;  4L5R C;  4K0K L;  1VQH A;  1PH2 A;  4R4O A;  4DV4 L;  4ALP A;  1I5F A;  5FLX c;  1BKB A;  2UXC Q;  4IPC A;  2HIV A;  4YCU A;  4JI0 Q;  1L1O C;  4KLK A;  5GAH C;  1L1O A;  2K5H A;  1GM5 A;  3CME A;  3E9H A;  1VQA A;  4QY7 A;  4J15 A;  3CC7 A;  4LF4 L;  3J7A 5;  1GKH A;  4AH6 A;  4IO9 A;  1G6P A;  5AJ3 Q;  1V9P A;  4HIM A;  2CKZ B;  2A1A A;  2ZTE A;  4HJ5 A;  1UE5 A;  4QJF A;  5ELN A;  5GAE C;  3I4N H;  1HZB A;  4DR4 L;  1TWH H;  4DNI A;  1IYJ B;  3STB D;  3NEM A;  4POF A;  4IFD G;  4P75 A;  1A0I A;  2ES2 A;  4X64 L;  5C3E H;  1PYB A;  1PFS A;  2XTI A;  3K80 C;  5IP7 H;  3CCS A;  3VDY A;  4A3M G;  4OWT B;  3J81 j;  1YIJ A;  5C4X G;  3A5Z B;  4DR2 Q;  3FKI G;  2MNA A;  1AE2 A;  4NB3 A;  5JJL A;  2OQ0 A;  4KHP L;  4LUO A;  4IJH A;  1OXX K;  4A3D G;  4DPG A;  3BU2 A;  3PV0 A;  5GRO A;  4LF7 L;  2ZJP A;  1E3P A;  2UUA Q;  4DUZ L;  4A3B H;  1QZH A;  4X66 L;  1VQL A;  2ZTD A;  3CCR A;  1LYL A;  2JJQ A;  3F8T A;  1EQR A;  2WB1 G;  2JA9 A;  4APV A;  2Z6K A;  2VQE L;  1XMQ Q;  2Q2U A;  3UDF A;  3K8A A;  3H3V I;  1KD1 C;  1HH2 P;  2D62 A;  4HJ7 A;  1GVP A;  4LWC A;  4DR1 L;  4DR3 L;  2BH2 A;  3S2D H;  2ZM6 L;  1VQO A;  1Q12 A;  2JA8 H;  4Y52 H;  2N78 A;  5C3E G;  3F2B A;  4KHZ A;  1UWV A;  2N49 A;  1VQN A;  3OW2 A;  1NTG A;  1UE6 A;  1HNZ L;  3T1Y Q;  2KEN A;  4JCV E;  1XMO L;  4UY8 C;  5IE8 A;  1P16 A;  3S1M H;  1XPR A;  2NZH A;  4JG2 A;  2R93 H;  4R4T A;  1X55 A;  3GDE A;  1N36 L;  1A8V A;  3PUV A;  2IY5 B;  1IBL L;  3EBE A;  4IFD I;  1KXL A;  3GTO H;  2IX0 A;  4DV7 L;  1Z9F A;  2ZTC A;  1PH6 A;  3I4M H;  4A3B G;  1VQE A;  4BBR H;  3ICE A;  5GAG C;  3CCM A;  1WJJ A;  1K0R A;  1Q82 C;  1C9O A;  4BBS H;  1A62 A;  3M9B A;  4R4C A;  5EAY A;  3G4S A;  1UEB A;  4JI7 L;  3HKZ E;  4DK6 C;  4YY3 L;  2PMZ E;  1KL9 A;  2YYZ A;  2JA8 G;  4JI1 Q;  5IWA L;  2Y0S E;  1OXS C;  1CKO A;  5M3M G;  3PCO B;  2E5L L;  4JI6 L;  2UXB L;  1PA6 A;  2I5L X;  1PH8 A;  2E2H H;  4X62 Q;  4AQY L;  2IT1 A;  5C0X G;  3KLW A;  1SR3 A;  1J5E L;  3IRB A;  2R93 G;  3CC2 A;  1YVC A;  4OON A;  2GVA A;  3EN2 A;  4LUZ A;  2UXD Q;  2VZA A;  1TWG H;  5IY0 A; 
#chains in the Genus database with same CATH topology
 1SXT A;  2VQF Q;  1B4O A;  5F2D A;  3P1H A;  5C4H A;  1HR0 L;  3GO5 A;  4LK1 C;  3UDX A;  5JOB A;  3MA2 B;  5ELO A;  3K5N A;  1CQV A;  1CA5 A;  1HNW L;  1JOQ A;  3HKS A;  3OSO A;  4DKA C;  2XSC A;  4LFB Q;  4GS3 A;  4AYB G;  5FJ8 H;  2PZT A;  5I9O A;  1SFO H;  3S1Q H;  2O5J C;  4N9T A;  4DV0 Q;  2EY2 A;  1NUC A;  3W2D A;  1I94 Q;  1O7L A;  2F4V L;  2M9V A;  1ML0 D;  1QNU A;  3K5O A;  3H94 A;  4LF8 L;  1IBK Q;  4C3H H;  4A3F B;  1XJV A;  3S1R H;  3I2Z A;  4KK7 A;  3D31 A;  1GHJ A;  1U4L A;  2AKW B;  5M5Y B;  2LMC B;  3EA6 A;  1E24 A;  2AMC B;  3HKZ B;  1NAP A;  2ZXP A;  5KYI A;  1X3Q A;  1H9S B;  2TSS A;  2KJX A;  5JVH 3;  1IXR A;  1HUN A;  5FJ8 G;  4O2D A;  1Y1W B;  4A3D H;  4ZRZ A;  2PNR C;  2OQK A;  2HD3 A;  3FP9 A;  4QMG A;  3HOX B;  2K04 A;  2R7Z G;  1EL0 A;  1VQI A;  1EWI A;  2F1M A;  5NUC A;  2QEJ C;  2A73 B;  3MFY A;  4TKO B;  2UUB L;  4C3H G;  1SYB A;  4Y7N B;  5CBE E;  4XT1 B;  2OTL A;  2OXP A;  2PYK A;  1PYS B;  3ULP A;  2GA4 B;  4KD4 A;  1PRT C;  4DK1 A;  4ID6 A;  1BBU A;  4G7O C;  4F8M A;  1TT2 A;  1MGS A;  3M85 A;  3D4D A;  2FMC A;  4RG1 A;  1PRT D;  2WIN B;  5A2Q E;  3TP5 A;  3U4V A;  1VQC A;  5KIX A;  3CRL C;  5C5L A;  3CD6 A;  1EFW A;  1TS3 A;  1S5C D;  1J6Q A;  2E2I H;  3D4R A;  4PZ8 A;  4JI2 Q;  3S1N B;  2QW7 A;  3QJY A;  1V1O A;  5HY6 A;  1HZA A;  5H1S E;  2RCF A;  3SE0 A;  2PZU A;  4B08 A;  4KKU A;  2WAQ G;  3A55 A;  4O0A A;  2NVX H;  4KJO A;  1TS2 A;  2KBN A;  4CJ2 C;  3P75 A;  3BS1 A;  2OT2 A;  1SAP A;  4J1M A;  1ASY A;  3J81 E;  2R93 B;  4BY7 B;  1RHP A;  1ILP A;  4RMF A;  5CV8 A;  3NK9 A;  3I4M B;  1SRO A;  4DV2 L;  5FLM H;  1Q1E A;  2F0G A;  2CFM A;  4OL7 A;  1CUK A;  1QUQ A;  3CCQ A;  4OX9 L;  2IWH A;  4R4Q A;  5BN5 A;  3GP7 A;  2P5Z X;  1EWH A;  1CZG A;  4K8I A;  1ZYR D;  5IGB A;  4YCV A;  2DN8 A;  4A93 H;  3TS0 A;  2NVT B;  4DXF A;  3RN2 A;  4UDU C;  2XN9 C;  3I4O A;  4UP7 A;  2E74 C;  5HGQ A;  4GOP C;  3U4Z A;  4GOP A;  2F0O A;  1Q90 A;  4A3K H;  2EYJ A;  2DJG C;  4LUV A;  3HOV B;  2A68 C;  2NVQ H;  4ULL A;  1Q46 A;  2IPK D;  3W1G A;  5FLM G;  1BUV T;  2UXB Q;  1GJX A;  2B3G A;  1YHB A;  3I3C A;  1STH A;  1HR0 W;  4IPD A;  4XYO A;  4A3E H;  1CKN A;  3W5O A;  3GTG B;  4DR6 L;  1PZJ D;  2EJM A;  1HR0 Q;  3KJP A;  3F1Z A;  2A68 D;  2I07 B;  3TS2 A;  4A93 G;  1X54 A;  3SEB A;  1BCP C;  4CHT B;  3DM3 A;  3AFP A;  3KF6 B;  2E2J H;  4GN3 B;  3IFD A;  4HMI A;  4WRD A;  1CA6 A;  3K59 A;  1UEA B;  1EY8 A;  1NNX A;  4PMB A;  4DR2 L;  2VUM H;  3GTK H;  4QB4 A;  1BCP D;  4A3E G;  1DM0 B;  4DFA A;  1TR5 A;  1K73 C;  1IYV A;  3HOW H;  3STB C;  5EBC A;  4DAP A;  4R8N A;  4IPG A;  4QQB X;  3HOU G;  1BVS A;  2WB1 B;  3GTM H;  2JA6 H;  1XMQ L;  3E6Z X;  3MXP A;  1LT6 D;  1ONL A;  2EJG C;  2Q2T A;  3PUX A;  1PDQ A;  2A69 C;  1GUW A;  1PH1 A;  1N8R C;  2EY6 A;  2UUB Q;  4QIW B;  2ZJQ A;  1RTN A;  4OO1 I;  3HOW G;  1XWE A;  4RWS C;  4XT3 B;  3VR5 A;  2B2V C;  2B2V A;  2A69 D;  3MWY W;  1NJI C;  1HHV A;  4JI8 L;  3IFT A;  5E1F A;  2JEA I;  2JA6 G;  3PGZ A;  1SE4 A;  2Z6K C;  2ATW A;  3CW2 C;  3I4N G;  4EQP A;  2K4K A;  2HQL A;  3KDF A;  1D1I A;  4C1N I;  1DOL A;  3VYS A;  2WFW A;  1EY4 A;  2R92 H;  2JEB I;  4L63 B;  2AQ2 B;  2JA7 B;  1JOO A;  1ASZ A;  3K58 A;  3BG3 A;  4KTA A;  4NMZ A;  4F88 A;  3GTO B;  1L2F A;  4PQX A;  1XNR L;  1XTC D;  3AB9 A;  3OW7 A;  1TS5 A;  3PO2 H;  2K5Q A;  3M7N A;  2K6A A;  5TSS A;  1JCK B;  3SDZ A;  2F3I A;  1BR9 A;  4IPH A;  4DAM A;  1KLG D;  1BBW A;  1WCM H;  4DV5 L;  5E4X A;  1JWS D;  2R92 G;  4DAY B;  3RN5 A;  1M1K C;  1MJE A;  3SK8 A;  4G7H C;  3F2D A;  3T1H L;  3J80 E;  3NQT A;  4GKJ L;  5IWA Q;  2E8G A;  4JI4 L;  1TS4 A;  1UE7 A;  4U67 3;  3CCJ A;  1Q7Y C;  5FKA C;  3WOE A;  1U4M A;  4K6D A;  5EQ0 A;  4DV2 Q;  2EQS A;  1LO5 D;  1HZC A;  2F0F A;  4DR4 Q;  5CGK A;  1GUN A;  1SFO B;  3J7A F;  4OX9 Q;  2F03 A;  2K33 A;  4LF9 L;  3FRP B;  1KQS A;  2IJ0 A;  3RLN A;  2R7Z B;  4GZY C;  1WTQ A;  4RH6 A;  1F2M A;  4EQN A;  1WCM G;  1SNC A;  2L9H A;  4ME3 A;  1N32 L;  2MP1 A;  3U50 C;  4M1U B;  1LT4 D;  1OO9 B;  2SNM A;  2GN5 A;  3EQL C;  4C3H B;  1Q1B A;  4HED A;  1Y1W H;  2NVY H;  2I5H A;  4P72 A;  3HOX H;  3RLO A;  1SMY C;  1X9N A;  3H91 A;  1RD9 D;  1ESR A;  4HJA A;  2PQA B;  1B2T A;  2EE1 A;  4K0K L;  4L5R C;  1V1P B;  2EYO A;  4DV4 L;  1BKB A;  4YCU A;  2F0Q A;  4KY7 A;  1L1O C;  2BOS A;  2M2L A;  1L1O A;  2F0S A;  2F0U A;  1C48 A;  1SMY D;  4QY7 A;  1QB5 D;  2ICE C;  1V9P A;  3HS0 C;  2A1A A;  2SEB D;  4DAV A;  5ELN A;  5GAE C;  2CW0 C;  1HZB A;  1TWH H;  3A8I E;  4DNI A;  3C1F A;  5G3L D;  4RGT A;  2ES2 A;  2EY1 A;  3K80 C;  5IP7 H;  1R4P B;  4XYQ A;  4DR2 Q;  4G7Z C;  4NB3 A;  2OQ0 A;  4KHP L;  3KUP A;  2WAQ B;  4H0L C;  4IJH A;  2A5H A;  1E2W A;  3BU2 A;  5GRO A;  3NPP A;  4DUZ L;  1T5X D;  4X66 L;  1VQL A;  1CM9 A;  2AUJ D;  4IZ8 A;  2JJQ A;  2LFN A;  1PYW D;  2LKV A;  1XMQ Q;  2Q2U A;  4WOR A;  3UDF A;  1HTL D;  3H3V I;  1CT1 D;  2D62 A;  1GVP A;  2BH2 A;  1A2U A;  2ICI A;  2NB0 A;  1Q12 A;  2N49 A;  1J8I A;  4X3T A;  5IE8 A;  2R93 H;  1XPR A;  3DWQ A;  3CKI B;  1W6K A;  2IY5 B;  2F0H A;  2NVX B;  3EBE A;  1S4Z A;  3I4M H;  3L9A X;  1PH6 A;  4LMQ D;  4BBR H;  3ICE A;  4H7B A;  4I7Z C;  1DYQ A;  4OO1 H;  3M9B A;  3OMC A;  4DK6 C;  2EPB A;  2YYZ A;  2Y0S E;  1IHZ A;  2WII B;  1SYE A;  1CKO A;  5M3M G;  4JI6 L;  1PA6 A;  2E2H H;  1PH8 A;  1SNM A;  3I91 A;  2IT1 A;  2WV6 D;  3KLW A;  1J5E L;  2R93 G;  1YVC A;  4OON A;  4LUZ A;  4ZUJ A;  1TWG H;  3UI2 A;  5IY0 A;  4HAE A;  1G51 A;  3L2P A;  3S2H B;  2JK8 A;  3NQI A;  5E7N A;  3A8J E;  4A93 B;  4BBR G;  4B3M L;  3G6E A;  1DXM A;  4ZK9 B;  1KDC A;  3T16 A;  5EJW A;  3BVG A;  1B70 B;  3E0J A;  3GTG H;  3FMC A;  5CC4 A;  1XNQ Q;  3L7Z C;  2VNU D;  3DMU A;  5C44 G;  3K5L A;  3M4P A;  2NZ1 D;  4YIJ A;  5K36 G;  1N34 L;  1RIP A;  1FJG L;  5IYC G;  3S9W A;  4DV5 Q;  4A3E B;  5C4Z A;  3GTQ H;  1Y1V H;  4JI3 L;  4C3J H;  1H9R A;  2I0Q A;  3T1H Q;  4LF6 L;  1FVI A;  1VF5 C;  4GKJ Q;  4JI4 Q;  1B44 D;  2DY8 A;  4A76 A;  3W1B A;  3V96 A;  4X3U A;  3HOU B;  1JOK A;  1B9N A;  1U0L A;  4B3R L;  3MFG A;  1YIT A;  1XPO A;  1MIU A;  2UUC L;  1NR2 A;  3BJU A;  4UPA A;  4LF9 Q;  1IBM Q;  5FO8 B;  2K5W A;  5CV6 A;  3CAM A;  1F77 A;  1N32 Q;  2HHH Q;  4C2M H;  1Y1V G;  2FXQ A;  2OCE A;  2NUC A;  3RZD H;  4KY5 A;  4H13 C;  4C3J G;  1ET9 A;  2K14 A;  1LAB A;  3HOW B;  3OYY A;  2XWB B;  2YV5 A;  3TP6 A;  1YJ9 A;  2KHS A;  1H9K A;  1IL8 A;  3RMH A;  1JQY D;  1QVG A;  1G6Z A;  2PI2 A;  3GTM B;  1EIY B;  1A3T A;  2F0K A;  3U9O A;  2JA6 B;  3LGJ A;  1SYC A;  2AQ3 B;  3CCU A;  1SDF A;  4K0K Q;  3I4N B;  2E75 C;  4B9X A;  1S3O A;  4DV4 Q;  5KND A;  4PV1 C;  1F9P A;  1PH3 A;  4K2L A;  3MXN A;  5EKK A;  2BDN A;  2K50 A;  4OWX B;  2TMP A;  1F9Q A;  1SJH D;  3I7F A;  1QCB D;  1KDA A;  4JI5 L;  4X65 Q;  4EX5 A;  4GLA C;  2JQO A;  2DNE A;  3HFZ B;  3TQY A;  4QGU A;  1V1Q A;  2GVB A;  4ZCK A;  5M3F H;  4UP8 A;  1PH9 A;  4JBM A;  3ER0 A;  4JBK A;  1S5F D;  2CQA A;  2IX1 A;  3PIO 3;  1GOZ A;  3CU7 A;  3J80 L;  5GQO A;  1E0B A;  5C4J H;  2JA7 H;  3CC4 A;  4KHP Q;  5CMD A;  1K9M C;  1E1T A;  1O7Y A;  3T51 B;  4JI1 L;  1F2L A;  2UU9 L;  1DOK A;  4DUZ Q;  1Z47 A;  3DUZ A;  5EPK A;  1DJR D;  1AE3 A;  4X62 L;  4MHE A;  4X66 Q;  1IW7 C;  3NEN A;  2R92 B;  1LT3 D;  4RCN A;  4WJ4 A;  1F9R A;  2A19 A;  4JV5 L;  2E2D C;  4KKS A;  5M3F G;  4RKL A;  2DUD A;  5BR8 L;  4LFC Q;  2RHS B;  3RR5 A;  1MSH A;  3TDQ A;  1G8Z D;  3D0F A;  3K0Y A;  3H3V H;  2JA7 G;  3T4A C;  3KF8 B;  2EY5 A;  2MFI A;  2HT1 A;  1B8A A;  1D5M C;  2K52 A;  3TSS A;  2PW5 A;  3DEP A;  1HQM C;  4A3G H;  3QB3 A;  4UP9 A;  2Q8R E;  1S72 A;  2ID0 A;  1WCM B;  1XXG A;  2XRQ D;  1VQ9 A;  3J81 c;  3GTP H;  4A3L H;  1K8A C;  2HCI A;  2FIN B;  2KQ3 A;  5KGU A;  1I3Q H;  1I4Q A;  4DXG A;  1BDO A;  2I5M X;  3HOY G;  3U58 A;  4FNF A;  3G48 A;  4DA2 A;  1JIC A;  1EIH A;  1AZP A;  4FF4 A;  2R7Z H;  2N3S A;  2R61 A;  2MO1 A;  4JI6 Q;  5I4D A;  3F2C A;  4F7X A;  4A3I H;  3MC0 B;  2JA5 H;  2B8F A;  4OGQ C;  4EGV A;  3FPP A;  2H5X A;  1SND A;  4FF1 A;  2B2Y C;  3HP3 A;  4CJ0 B;  1LTI D;  4A3G G;  1PV4 A;  4RHS A;  3EIV A;  4JI0 L;  1VMP A;  3M4Q A;  4HTH A;  1HPC A;  2L15 A;  4A3L G;  2K5N A;  4B3M Q;  2KCC A;  2PI2 E;  4DV1 Q;  1WOC A;  1PZK D;  1VDZ A;  2NVY B;  3I56 A;  1FR3 A;  3SK4 A;  1M90 C;  1DZ1 A;  3EJI A;  1N34 Q;  4CKE A;  4IFD J;  4YWM A;  4A3I G;  2JA5 G;  3PIO A;  2F0M A;  3NTH A;  1I4P A;  1TKW B;  4J8Q A;  5KNB A;  5HGT A;  5J3B A;  2A8V A;  3OPO A;  3KJO A;  1HA5 A;  2PNH A;  3GV6 A;  1QZG A;  4JI3 Q;  1EY9 A;  3BZK A;  3NUC A;  4LF6 Q;  4HMJ A;  5EGT A;  1RF2 D;  1B9M A;  4NKL A;  3H09 A;  1JOR A;  3CCE A;  2RKS A;  2Y0S G;  4R4I A;  2KCM A;  4B3R Q;  2KA7 A;  1GD7 A;  2UUC Q;  3I8Z A;  3J7A V;  1HQR D;  1TWH B;  4F87 A;  5DAU A;  3BYY B;  1I6H H;  4ZUI A;  4BXX H;  4P71 A;  2ENB A;  3G6J B;  2CWP A;  3HOZ G;  1KRT A;  4OEM B;  1HUM A;  3M7G A;  3PIP 3;  5J39 A;  1PRT B;  4IUN A;  5ELF A;  2HCC A;  4L8J A;  2XGT A;  2ASB A;  1BO0 A;  1NCV A;  5COY A;  3RZO B;  3J80 i;  1SBB B;  1PTO C;  3N52 A;  2N55 A;  4C56 C;  2V1C C;  4LF7 Q;  3M4O B;  4BXX G;  3MAQ A;  5IGD A;  5M3M B;  2JYO A;  1PFN A;  1PZI D;  4ILW A;  2SOB A;  3PMF A;  4TRD A;  2WAC A;  3AQQ A;  2R7F A;  4LW1 A;  5C5M A;  3CCL A;  4JI5 Q;  4A3C H;  4BWG B;  2VQE Q;  1CZW A;  5C0X J;  2K75 A;  1PTO D;  4DR1 Q;  4I65 A;  1EEI D;  1T9H A;  4FVM A;  4BBR B;  1X3G A;  1HNZ Q;  3A5U A;  4X3K A;  2JSO A;  1TXY A;  4CDC C;  1O7Z A;  1VQD A;  3S2H H;  1VQ7 A;  5C44 B;  1G91 A;  1LTG D;  2NBF A;  1YNX A;  1LTL A;  2E2H B;  1E1O A;  2UU9 Q;  1S5B D;  1SE2 A;  4L5Q A;  4OHJ A;  5IOD A;  3OTO L;  1WYD A;  3RNU A;  4IQZ A;  1TWG B;  1X3E A;  1TWC H;  3VYU A;  4A3C G;  5BN4 A;  5I2X A;  1QWY A;  4PZ7 A;  4YY3 Q;  1Y8O B;  4JV5 Q;  1QUQ B;  4PZ6 A;  1STE A;  5IT9 E;  2F0P A;  1DCZ A;  5CV5 A;  1Y8P B;  3BVM A;  2QIL A;  2X69 A;  5L37 A;  1KAB A;  4QL5 A;  1HNX L;  2IL8 A;  3KBG A;  2C35 B;  2D0O A;  1HNW Q;  1NMF A;  5E4W C;  3HOU H;  3GTQ B;  1Y1V B;  5LMN L;  3KF6 A;  1F2Y A;  4C3J B;  2PQE A;  5CV4 A;  3J80 c;  2L5T A;  4GLV B;  1KDB A;  1K83 H;  4S3S A;  4X6A H;  3NBI A;  3J7Y W;  1CKN B;  4JYA L;  2VB2 X;  1JMC A;  2F4V Q;  4NXM L;  1WI5 A;  3KFU A;  5C4X H;  3K5M A;  4LF8 Q;  2FHT A;  3FKI H;  5JJI A;  1X3P A;  3NP8 A;  2CWA A;  3ONA B;  1PH2 A;  1LTB D;  1BCP B;  3A54 A;  2LS0 1;  2IW3 A;  4ALP A;  3TBI B;  3C3L A;  4JI0 Q;  3IAY A;  4KLK A;  2K5H A;  1FGB D;  1Y69 U;  3CME A;  4C2M B;  1AW7 A;  3CC7 A;  3RZD B;  4LF4 L;  2C9O A;  3DHQ A;  5J1Z A;  1G6P A;  3A7A B;  4HIM A;  5DNF A;  1UE5 A;  4QJF A;  3Q6S A;  3I4N H;  1IYJ B;  3STB D;  4U68 A;  4POF A;  4FYD A;  5JAV A;  1FNU A;  1EU4 A;  5C3E H;  1PYB A;  3I73 A;  3CCS A;  5C4X G;  1H9M A;  3A5Z B;  3NE5 B;  3FKI G;  1IYU A;  2MNA A;  1AE2 A;  5JJL A;  3WDN A;  2F0V A;  5IOC A;  1NSN S;  4DPG A;  2ZJP A;  1GUG A;  2ZTD A;  3CCR A;  3F8T A;  1SE3 A;  2RDG A;  2NWG A;  1B3Q A;  2JA9 A;  2Z6K A;  5M3F B;  2Z4H A;  5C3W A;  1HH2 P;  1SYF A;  4DR3 L;  3S2D H;  2F0T A;  2ZM6 L;  1VQO A;  2N78 A;  1PFB A;  5C3E G;  2AUK A;  1TWA B;  3TP8 A;  1EOT A;  1DON A;  5C4J B;  5IGE A;  1N36 L;  1D2B A;  1A8V A;  3PUV A;  1UAP A;  3KLS A;  1IBL L;  4I7A A;  1BF4 A;  1I4H A;  2IX0 A;  4DV7 L;  1Z9F A;  2ZTC A;  1GUT A;  1WJJ A;  2BE5 C;  1LAC A;  1KAA A;  1VMC A;  1A62 A;  2L55 A;  1LV9 A;  4R4C A;  3G4S A;  4JI7 L;  1UEB A;  3HOY B;  4ZAI A;  2PMZ E;  3NXW A;  4CDE C;  2MJ8 A;  4G57 A;  4FO2 A;  3NBH A;  1TU2 B;  2E5L L;  4FF2 A;  2I5L X;  4EQO A;  4CKC A;  1SR3 A;  2BE5 D;  3IRB A;  2VZA A;  2NYZ D;  2MHV A;  4MTN A;  4DGZ A;  4A3G B;  2QDB A;  2AQ1 B;  1UE1 A;  1KHI A;  4JOI C;  4DU9 A;  4JOI A;  2L11 A;  2RVL A;  1W3S A;  1EY0 A;  3GTP B;  4Q5V A;  1I3Q B;  2MO0 A;  2F4I A;  4MNO A;  1PH7 A;  4FP5 D;  2Q2I A;  3QOJ A;  2NN6 I;  4V19 0;  1BCP F;  1EYC A;  3RLF A;  1A3U A;  2ZXO A;  1EQQ A;  4EVO A;  2K5D A;  1TY0 A;  3PSI A;  1ILQ A;  4A3I B;  2JA5 B;  2WB1 E;  4POG A;  1B1Z A;  2Z8L A;  1XYI A;  4RAU C;  4B3S L;  1JWM D;  5T1G A;  3Q24 A;  1E7Z A;  2V4D A;  2N8N A;  5A2Q L;  4IOC A;  4LFA L;  2Y0S B;  4G4K A;  5DLQ E;  4DR6 Q;  1CK1 A;  4K2K A;  1CQF A;  4CDF C;  3D6C A;  1MKH A;  4YWL A;  3D3R A;  4UHV A;  1WTR A;  5LMN W;  4KHV A;  1JJ2 A;  1SYD A;  3HOZ B;  3MXG A;  3A74 A;  2EIF A;  5LMN Q;  3R2I A;  4ZYS A;  4RKB A;  3K81 C;  2BH8 A;  2B2U C;  1CKM A;  2B2U A;  4TQU S;  1O78 A;  3J81 L;  4GNX B;  4WJ3 M;  3DXJ C;  1JT8 A;  2OF1 A;  1K3R A;  2EOT A;  2B2W C;  2CHB D;  1SEB D;  3AFQ A;  2RCN A;  2X6L A;  1I6H B;  2CW0 D;  2NTT A;  1U9R A;  2QGQ A;  3OWF A;  4FDB A;  3HZX A;  5FOB B;  3PF4 A;  1STY A;  2F0J A;  2D2C C;  1X3F A;  4KV6 A;  4AYB E;  2KVM A;  1MHW C;  2YTV A;  4PG3 A;  1K28 A;  3FPU B;  3ITP A;  4LF4 Q;  3RZO H;  2O5I C;  5KEE A;  3R8B A;  1JJC B;  5M9O A;  3M4O H;  1NMG A;  5M3M H;  3V05 A;  1EZ8 A;  2LXK A;  1L0Y B;  1OXU A;  3KLS X;  4KD3 A;  1FL0 A;  4QCL A;  1DOM A;  2RA4 A;  1YNN C;  5IT9 L;  3L0O A;  2X6G A;  5JJZ A;  1QVC A;  2EXD A;  1SJE D;  4HSP A;  4WJW A;  5M5W H;  1PTO H;  2O4X A;  4JI8 Q;  3LWU A;  4XIG S;  3JAM E;  3CF5 A;  1FGU A;  2HQE A;  1I6V C;  1Q3L A;  2YU9 H;  2J4X A;  1PXU A;  2RQX A;  2UXD L;  5CYU A;  2J7Z A;  1YNN D;  5C44 H;  4O1N A;  2Q2H A;  4DR3 Q;  5K36 H;  1F2Z A;  3EFX D;  4KY6 A;  1EYG A;  1A3V A;  1LUZ A;  5IYC H;  4V0B A;  3C46 A;  3PF5 A;  4HIK A;  4JK1 C;  1GO3 E;  1SMX A;  4BY1 H;  1PHJ A;  5KYL A;  3OWE B;  4WFN 3;  1EY7 A;  1B50 A;  1XNR Q;  5EKI A;  4DV7 Q;  1I94 L;  1TWF H;  1MSG A;  2ALY B;  1TWC B;  3IKJ A;  3SK6 A;  3DLL A;  5M5X H;  4ZQ3 A;  1HA6 A;  3TRE A;  4JI7 Q;  3ERO A;  2SNS A;  1KNA A;  2A74 C;  2PO4 A;  2B2T C;  2B2T A;  2HUG A;  1HCZ A;  2IHF A;  1VQP A;  2E5L Q;  2KEC A;  1FYC A;  5CBA E;  1WTO A;  4BY1 G;  1MD2 D;  1HTP A;  4XXE A;  4IUV A;  2Q8T A;  1QE6 A;  4GLX A;  2UXC L;  1VQ6 A;  3CMA A;  2YTY A;  2DY7 A;  3NTI A;  2KUM A;  1GXD C;  3MTS A;  1A2T A;  4KKT A;  3UE0 A;  2K5V A;  1EYA A;  1ENA A;  2DGY A;  1K83 B;  1LLR D;  2QEX A;  2SDF A;  2LXJ A;  3CPF A;  2K03 A;  1J9O A;  2B8G A;  2KCT A;  1ET6 A;  4ME5 A;  4P74 A;  3Q8D A;  2LSS A;  5C4X B;  4DF7 A;  1SLJ A;  3FKI B;  1BOS A;  1PVO A;  2NN6 H;  1ZEQ X;  3ND8 A;  3I4L A;  4ZKC B;  4B3S Q;  1B53 A;  3GD7 A;  3TME A;  1EIG A;  3J81 i;  2L1B A;  5CV9 A;  1CHP D;  5D14 A;  3VR2 A;  3URY A;  4XQJ A;  2NTS A;  2AHO B;  4HN7 A;  4LFA Q;  1Z6H A;  1VS0 A;  3ZYY X;  4ABN A;  2F0N A;  3HGB A;  1HZ9 A;  4IN3 A;  1EQT A;  1STB A;  4JBJ A;  1VQB A;  5C3E B;  3T56 B;  3Q22 A;  4X3S A;  2F0W A;  4JI2 L;  1YNJ C;  2FMM A;  2QCP X;  3K0X A;  1EY5 A;  2NN6 G;  5D3I B;  2XRS D;  1DGS A;  4EQ5 A;  3AEV A;  1O7I A;  1RDP D;  5KRU A;  3W3A A;  1R9T H;  5GAD C;  1TWA H;  4L6T B;  1YNJ D;  4XDX A;  3MXN B;  2K1B A;  3OIQ A;  2HIX A;  4BA1 I;  3S2D B;  4FF3 A;  1I4X A;  1N9W A;  3ND9 A;  1KAW A;  1WTW A;  3SR1 A;  3GTJ H;  1GUO A;  3ULJ A;  1JB3 A;  2F0D A;  3NWS A;  1XTD A;  2VXW A;  3MEH A;  1D7Q A;  3HOY H;  1BXT A;  3F2U A;  1YJN A;  3GTL H;  1M4V A;  5JPM C;  2RBM A;  2XIW A;  3PUW A;  4DUY L;  4TVA B;  2B63 H;  2OWO A;  1SNP A;  2JE6 I;  3NWT A;  1IW7 D;  2PZW A;  4A4I A;  4B9W A;  3E0E A;  3KF8 A;  2H1E A;  4MN3 A;  1CHQ D;  2HDM A;  4MZ9 A;  4MTK A;  4RCO A;  1KIX A;  1NE3 A;  1IKM A;  3FVQ A;  2JP1 A;  3PUZ A;  4DV6 L;  4BS9 A;  1EWC A;  1B7Y B;  3S15 H;  3H0G H;  2E76 C;  2CCZ A;  3I70 A;  4C1N K;  1WTP A;  3BDO A;  1CSP A;  3GQB A;  3U9S A;  4DNT B;  3VA7 A;  5D3D A;  1OXV A;  1H95 A;  3S17 H;  3M3Y B;  3WWV A;  1II3 A;  1YBY A;  1VQK A;  4K14 A;  1WD0 A;  4DNR B;  2B63 G;  1VQ5 A;  1NY4 A;  4R8I A;  1J5E Q;  3KOJ A;  1WTV A;  3I72 A;  2XNA C;  1L0W A;  2L0C A;  1VQ8 A;  3C2P A;  2B2Y A;  2R3Z A;  1KC8 C;  2AWO A;  5IIF A;  1WTH A;  4B3T L;  1H9S A;  3I55 A;  2HDL A;  5FLX E;  4ZLT F;  2KED A;  3ZJY C;  3AU7 A;  3H0G G;  1I4G A;  1LTR D;  4ODG A;  1VQM A;  2NZO A;  2Q8I B;  3SGI A;  1LTS D;  1EFI D;  1HJP A;  1VQG A;  4K5V A;  5IT9 c;  2EVB A;  1E22 A;  3X3N A;  4L5S A;  1K8O A;  1JR0 D;  1Y8N B;  1FJG Q;  2CH4 A;  4LJZ C;  3HOZ H;  4A3M H;  1DD2 A;  1B3A A;  1U4R A;  1TII D;  4OWW B;  2RDH A;  4PNY A;  4IOA A;  1EIF A;  1VQH A;  4N9P A;  4RFB A;  3KBX A;  1I5F A;  2UXC Q;  4JVZ A;  5DM7 3;  3VYR A;  5GAH C;  1GM5 A;  3E9H A;  1VQA A;  3P20 A;  1QIL A;  5C6A A;  2LY7 A;  1AFP A;  4IO9 A;  3R93 A;  3TP7 A;  5ELB A;  2Z1C A;  2CKZ B;  1AP0 A;  4HJ5 A;  2Z9H A;  4RHR A;  5I6W A;  2PCF B;  3NEM A;  4QF4 A;  3JAM L;  1A0I A;  3LNN A;  4X64 L;  1M8A A;  2XTI A;  4K5W A;  4A3M G;  3DWP A;  3J81 j;  4Z9C B;  1HFN A;  2KOL A;  1STN A;  5FO7 B;  1RTO A;  1C8C A;  4A3D G;  1XX8 A;  4IUU A;  3QO2 A;  3PV0 A;  4K6L A;  4A3B H;  1QZH A;  2JN4 A;  5EPL A;  3A8K E;  1RCV D;  4APV A;  1ENF A;  2H4O A;  5IGF A;  1E2V A;  4LWC A;  1I4R A;  2JA8 H;  3G7L A;  5KNC A;  1UWV A;  1ESF A;  3OW2 A;  1Q8I A;  3Q0A A;  1XMO L;  2MUY A;  4UY8 C;  4JG2 A;  1X55 A;  3GDE A;  1EU3 A;  1ROD A;  2K01 A;  5M5W B;  1KXL A;  1PTO B;  2WKC A;  4R9W A;  4A3B G;  1VQE A;  2YU9 B;  1Q82 C;  1QJO A;  4BBS H;  3S16 B;  4FXK C;  5EAY A;  5IGG A;  5JEA H;  3HKZ E;  2JA8 G;  4JI1 Q;  5IWA L;  4J6H A;  3R2T A;  3PCO B;  1ZYR C;  1K0S A;  4UAI A;  3D4W A;  5CR3 A;  4X62 Q;  4AQY L;  1G2T A;  2L4N A;  4BY1 B;  3CC2 A;  3N6R A;  4DR4 L;  1MBY A;  2EJF C;  4HJ9 A;  5BR8 Q;  4IUP A;  4N8X 1;  4GKK L;  3RD4 A;  2KHJ A;  1YJW A;  3WOF A;  5IGC A;  2B29 A;  1TWF B;  1TQO A;  1SSO A;  4DUY Q;  1MJC A;  3KYH C;  5M5X B;  1W2B A;  4BBS G;  3CRK C;  1EYD A;  5JEA G;  4RGO S;  2Z0S A;  2PW7 A;  2QF7 A;  4GOP B;  4K8J A;  2B39 A;  3SVM A;  1STG A;  1A15 A;  4DV6 Q;  5ELD A;  4IUR A;  3PIP A;  2VB3 X;  4H44 C;  3PO3 H;  1D5X C;  4OXP A;  2EYH A;  1JB7 A;  5IYD H;  2PMZ B;  1X32 A;  4LNQ A;  3TEH B;  1SN8 A;  1KLU D;  3DM1 A;  3DWA A;  2F3W A;  3E5S A;  3VR6 A;  1Q86 C;  1D6E C;  4DR5 L;  2ZT9 C;  4RGM A;  1PRT F;  1IZ6 A;  2DNC A;  4B3T Q;  4A3K G;  2FJ2 A;  2EYM A;  4KN4 C;  1XPU A;  3MHB A;  1PH5 A;  3R3O A;  2RSN A;  5K5P A;  3PO3 G;  4GN4 B;  4OIK A;  1JE5 A;  3QOL A;  5LMU L;  4R1J A;  5IYD G;  3BZC A;  1TY2 A;  4YWK A;  1EQV A;  2F0L A;  3JAM i;  4YHH L;  1RJT A;  1U5K A;  3S14 H;  2J0T D;  1HFG A;  1LM0 A;  5IYB H;  1U4P A;  2F52 A;  2D9U A;  5FK9 C;  1QOH A;  1S40 A;  4YCW A;  1AEX A;  4O42 A;  5LHY 1;  1PTO F;  3BDC A;  5CV7 A;  1C7Y A;  3CQZ H;  2DJF C;  1Y14 B;  2G9H D;  4NPS A;  3PUY A;  3K7A H;  1S5E D;  2VUM G;  1F9S A;  4C3I H;  5DEH A;  4JBW A;  2D0P A;  1R9T B;  4Q0F A;  3MXU A;  2Z6B A;  5IYB G;  1BBX C;  1GUS A;  4X64 Q;  4A3J H;  1H9J A;  1FNV A;  1G2S A;  1HRJ A;  2FFK B;  2EYF A;  1E2Z A;  2G9D A;  2N88 A;  2CQO A;  3TZU A;  4AIM A;  4CDD C;  1SNO A;  3QIA A;  1N33 L;  3TRZ A;  3UE1 A;  1FD7 D;  3GTJ B;  1UNS A;  3K7U C;  4XQQ A;  2K32 A;  3CXC A;  1WFQ A;  1YHA A;  4HR7 B;  4LF5 L;  1LTA D;  3KDF B;  3NEL A;  2RF4 A;  4C3I G;  4DV3 L;  4NXN L;  1X6O A;  3GTL B;  3HG9 A;  3OHX C;  5FLX L;  3VR4 A;  4HIO A;  2BCO A;  2B63 B;  1I50 H;  3MVV A;  3TN2 A;  1YEZ A;  3NHH A;  4A3J G;  3H3V C;  4DAY A;  4DR7 L;  1XMO Q;  3S1M H;  3UDI A;  4AYB B;  2K05 A;  4K5X A;  1XNQ L;  3M3Y H;  3J7Z C;  1JE4 A;  1CSQ A;  4IAL A;  5JEA J;  1ZKO A;  3JAM c;  4E6I A;  1K8G A;  5IP9 H;  3S15 B;  1Q8K A;  3H0G B;  4IFD I;  4FXD A;  1T5E A;  4IUT A;  3NBH B;  1YI2 A;  1IL2 A;  2EYP A;  5JPN C;  2BA0 A;  2WKD A;  1PH4 A;  1C0A A;  1EY6 A;  3FEW X;  4NP5 A;  3RUZ A;  1SE8 A;  3S17 B;  4DK3 C;  3MEF A;  3PQI A;  1EEF D;  4PMW A;  3ERS X;  3ERQ A;  1VQ4 A;  1A63 A;  5I6Y A;  3LX0 A;  3NTK A;  3OTO Q;  4KMU C;  2RSO A;  1V43 A;  4PMC A;  4AQY Q;  5JVG 3;  4DN4 M;  3PO2 G;  4HID A;  3IL8 A;  3T53 B;  1VF7 A;  1STA A;  4JC0 A;  1SYG A;  1NBW A;  4A3F H;  2QDL A;  3S1Q B;  4CGY B;  2R7D A;  2AWN A;  4GKK Q;  5IP9 G;  5M5Y H;  1IBM L;  1D1K A;  2PQA A;  5A35 A;  2YTX A;  3FHW A;  4QIW E;  1D5Z C;  1OTC A;  4CBV A;  1V1P A;  4JPB W;  2HHH L;  5AJ3 L;  3JC6 6;  1HNX Q;  3S1R B;  5ELC A;  4GN5 A;  1EZ6 A;  3CCV A;  3B6Y A;  2D5D A;  3A7L A;  1V8Q A;  3V2T A;  2MQH A;  4H02 A;  2Z4I A;  4A3M B;  2IHE A;  1G29 1;  1PMR A;  2KCN A;  1ICW A;  1K8M A;  4IJL A;  1IKL A;  1WTX A;  1Q81 C;  4A3F G;  2R6G A;  4Y7N H;  4A3D B;  1UUP A;  3EVQ A;  1RL2 A;  4GNX C;  3BZD B;  4JYA Q;  4GNX A;  1OXT A;  4NXM Q;  2UUA L;  3QR8 A;  3HKZ G;  4HCS A;  2OTJ A;  4N8F A;  4QUC A;  3LWE A;  3VA5 A;  1L1O B;  2B2W A;  4LAA A;  2ZJR A;  4X65 L;  4DR5 Q;  1P8L A;  5C0X I;  2WP8 J;  1NR4 A;  1KRS A;  1Y1W G;  2M00 A;  1CFM A;  1JC7 A;  3SHL A;  3S24 A;  3CP0 A;  3HOX G;  3TZD A;  2IX3 A;  2XWJ B;  4OIJ A;  1X56 A;  2EXZ A;  3T1Y L;  2C5C A;  3BDL A;  1PLF A;  4DK0 A;  1X65 A;  3CPW A;  5J22 A;  1SRU A;  4NDX A;  4MIU A;  4RGN A;  5LMU Q;  4TSS A;  3K57 A;  2A6E C;  1ICF B;  3OIP A;  4A3B B;  1C4Q A;  4YHH Q;  3H15 A;  2L12 A;  3D6W A;  2VS1 A;  3S1N H;  1HXY D;  5FO9 B;  1LTT D;  3D8G A;  1MI2 A;  1YHQ A;  3UDG A;  2KHI A;  5HUR A;  2F3V A;  2JA8 B;  4XTC S;  3MZ5 A;  4LFC L;  1KNE A;  2A6E D;  4IUQ A;  2QA4 A;  2E2I B;  4HCE A;  1AZQ A;  2VW9 A;  5IP7 G;  2EYL A;  5T1I A;  2VL6 A;  4NW2 A;  5I9P A;  2KEE A;  3S16 H;  2VQF L;  4BY7 H;  1D8L A;  2F0E A;  4KJN A;  5LL6 X;  4KI0 A;  2ZM6 Q;  2G5D A;  3C1E A;  2RHQ B;  4LFB L;  2F0I A;  1ZXT A;  1EUJ A;  4BBS B;  5ISR A;  4QUF A;  5JJK A;  3OOC A;  1N36 Q;  2BA1 A;  3E9I A;  1VCI A;  1IBL Q;  4HSV A;  2QKI C;  1R4Q B;  2XVS A;  4XQN A;  2A6H C;  3BYT B;  3OMG A;  4DV0 L;  4P2C B;  1N33 Q;  4BA2 I;  3I90 A;  3VR3 A;  4CKB A;  3AYH B;  3T13 A;  1JWU D;  5EKL A;  4M8A A;  1K3B C;  1LT5 D;  4LF5 Q;  2NVT H;  1RKN A;  5DM6 3;  1IBK L;  5BN3 A;  4DV3 Q;  1TVX A;  4BY7 G;  4NXN Q;  3SK5 A;  1QVF A;  3P7J A;  2A6H D;  3HRZ C;  2VY3 A;  5ELE A;  3HOV H;  3E3X A;  3I4M G;  2EZV A;  5D65 A;  1VQF A;  3BVZ A;  1ENC A;  4DR7 Q;  1JJG A;  4DV1 L;  4A75 A;  4OO1 G;  3NSW A;  1O80 A;  4CJ1 B;  4A3K B;  3Q23 A;  2NVQ B;  1GHK A;  2O2L D;  1AH9 A;  2MGS A;  5G3L F;  1VQJ A;  4P73 A;  3PO3 B;  2WAQ E;  5I2Y A;  3ULL A;  5LL6 S;  1EOV A;  4KN7 C;  3HOV G;  1WVL A;  4IFD H;  4HJ8 A;  4L5T A;  3A0J A;  1PFM A;  3G71 A;  2E2J B;  1AN8 A;  1YZ6 A;  4R4O A;  5FLX c;  5AFW A;  5EPJ A;  3KLR A;  4IPC A;  2HIV A;  1WD1 A;  1CI3 M;  4J15 A;  3J7A 5;  3GTK B;  2VUM B;  1GKH A;  1KTK A;  4AH6 A;  5AJ3 Q;  2EDG A;  4RA8 A;  1BNZ A;  4FXG C;  2ZTE A;  3VYT A;  3FDT A;  3QWN A;  4IFD G;  4P75 A;  3S14 B;  1PFS A;  1YIJ A;  3VDY A;  3A56 A;  4OWT B;  4ZKB B;  5E3F A;  1QNK A;  3X3M A;  3HEJ A;  1W6J A;  4LUO A;  2MPM A;  1OXX K;  3SXH A;  4LF7 L;  3CQZ B;  3QG1 A;  1E3P A;  2UUA Q;  1FNW A;  3K7A B;  3O13 A;  1LYL A;  4C3I B;  1EQR A;  2WB1 G;  2PPB C;  1Z7T A;  2VQE L;  2ZXR A;  3K8A A;  1KD1 C;  4HJ7 A;  4DR1 L;  2K28 A;  4Y52 H;  3F2B A;  4A3J B;  3GV3 A;  4KHZ A;  4OEL B;  3H6M A;  1VQN A;  2CVR A;  1NTG A;  1UE6 A;  1HNZ L;  3T1Y Q;  2KEN A;  1L0X B;  2K7V A;  4JCV E;  5C0X H;  1A6X A;  1P16 A;  2I46 A;  2NZH A;  4R4T A;  1S5D D;  5EBD A;  3AMU A;  2BDO A;  2JXM B;  3GTO H;  2OEO A;  5GAG C;  3CCM A;  1K0R A;  1SNQ A;  3KK7 A;  1C9O A;  3CHB D;  2CH4 W;  3K6O A;  1QG7 A;  4YY3 L;  2RDF A;  1KL9 A;  1I50 B;  5COR A;  1OXS C;  1CTM A;  3DEO A;  2UXB L;  5C3X A;  3L3O C;  5C0X G;  3S1M B;  1BQQ T;  3PO2 B;  3M4Y A;  2GVA A;  3EN2 A;  4JW0 A;  2UXD Q; 
#chains in the Genus database with same CATH homology
 4HJ9 A;  4MTN A;  2VQF Q;  5BR8 Q;  1G51 A;  3L2P A;  1HR0 L;  3GO5 A;  4GKK L;  2KHJ A;  3UDX A;  1YJW A;  2JK8 A;  5E7N A;  1UE1 A;  1KHI A;  4JOI C;  3PO3 G;  4JOI A;  2B29 A;  5ELO A;  4BBR G;  4B3M L;  3G6E A;  1W3S A;  4DUY Q;  1MJC A;  3HKS A;  1HNW L;  4DKA C;  4LFB Q;  3KYH C;  1W2B A;  2MO0 A;  4BBS G;  4MNO A;  4A3C G;  4GS3 A;  4AYB G;  1PH7 A;  1B70 B;  2Q2I A;  5JEA G;  3GTG H;  2Z0S A;  5FJ8 H;  2NN6 I;  4GOP B;  1SFO H;  1XNQ Q;  3S1Q H;  3L7Z C;  2VNU D;  4DV0 Q;  3RLF A;  5C44 G;  1EQQ A;  3M4P A;  5K36 G;  3PSI A;  1N34 L;  1I94 Q;  2F4V L;  1RIP A;  1FJG L;  2WB1 E;  4POG A;  5IYC G;  4DV6 Q;  4A3C H;  4DV5 Q;  3PIP A;  4LF8 L;  3GTQ H;  3PO3 H;  1Y1V H;  1IBK Q;  4C3H H;  4OXP A;  1XJV A;  4JI3 L;  4C3J H;  1JB7 A;  2I0Q A;  4B3S L;  3T1H Q;  3S1R H;  4LF6 L;  1FVI A;  3I2Z A;  3D31 A;  5IYD H;  4GKJ Q;  2AKW B;  1E7Z A;  4JI4 Q;  1E24 A;  2AMC B;  2N8N A;  4A76 A;  4LNQ A;  3TEH B;  3W1B A;  4IOC A;  1SN8 A;  4LFA L;  1U0L A;  4B3R L;  1Q86 C;  1YIT A;  1IXR A;  4DR5 L;  1MIU A;  1XPO A;  2UUC L;  5DLQ E;  3BJU A;  4DR6 Q;  5FJ8 G;  1IZ6 A;  4O2D A;  4A3D H;  4B3T Q;  1MKH A;  2OQK A;  4YWL A;  4A3K G;  4UPA A;  3FP9 A;  4LF9 Q;  1IBM Q;  5LMN W;  2R7Z G;  1VQI A;  1XPU A;  1JJ2 A;  1EWI A;  1PH5 A;  3CAM A;  1N32 Q;  2HHH Q;  4GN4 B;  3A74 A;  4C2M H;  1Y1V G;  2EIF A;  2FXQ A;  2OCE A;  5LMN Q;  2UUB L;  3RZD H;  1JE5 A;  5LMU L;  2K14 A;  4R1J A;  5IYD G;  3OYY A;  2YV5 A;  3K81 C;  3BZC A;  1YJ9 A;  2BH8 A;  4YWK A;  1CKM A;  2OTL A;  4TQU S;  3JAM i;  4YHH L;  1PYS B;  3ULP A;  1U5K A;  4GNX B;  3S14 H;  1QVG A;  4WJ3 M;  1LM0 A;  5IYB H;  1JT8 A;  2PI2 A;  1K3R A;  2F52 A;  1EIY B;  3LGJ A;  1S40 A;  3CCU A;  3AFQ A;  2RCN A;  4YCW A;  1BBU A;  4K0K Q;  2QGQ A;  4DV4 Q;  1S3O A;  4FDB A;  3PF4 A;  1C7Y A;  1PH3 A;  3CQZ H;  1Y14 B;  1X3F A;  2K50 A;  4OWX B;  4AYB E;  3I7F A;  3M85 A;  4NPS A;  2YTV A;  3PUY A;  4PG3 A;  3K7A H;  4RG1 A;  4JI5 L;  4LF4 Q;  4X65 Q;  2VUM G;  3RZO H;  4EX5 A;  4GLA C;  2JQO A;  4C3I H;  3HFZ B;  3TQY A;  3U4V A;  1VQC A;  4QGU A;  1V1Q A;  4JBW A;  2GVB A;  1JJC B;  5M3F H;  2D0P A;  3M4O H;  3CD6 A;  1EFW A;  1NMG A;  4UP8 A;  1PH9 A;  5M3M H;  3ER0 A;  4JBM A;  1J6Q A;  2LXK A;  2E2I H;  1OXU A;  4JBK A;  4PZ8 A;  4JI2 Q;  5IYB G;  4X64 Q;  4A3J H;  2IX1 A;  5HY6 A;  1HZA A;  5GQO A;  1FL0 A;  5H1S E;  5C4J H;  2CQO A;  3CC4 A;  2JA7 H;  4KHP Q;  4AIM A;  2WAQ G;  3L0O A;  1N33 L;  1QVC A;  2EXD A;  4O0A A;  1K9M C;  1E1T A;  3UE1 A;  2NVX H;  3TRZ A;  4JI1 L;  5M5W H;  2KBN A;  2UU9 L;  3K7U C;  4JI8 Q;  3CF5 A;  1Z47 A;  4XIG S;  1WFQ A;  1FGU A;  3CXC A;  4DUZ Q;  1YHA A;  1AE3 A;  4X62 L;  4X66 Q;  1ASY A;  4LF5 L;  3NEN A;  3KDF B;  3NEL A;  2RF4 A;  4DV3 L;  2YU9 H;  4WJ4 A;  2A19 A;  4NXN L;  2UXD L;  4JV5 L;  1X6O A;  5M3F G;  5C44 H;  2DUD A;  5BR8 L;  4HIO A;  2Q2H A;  4LFC Q;  4DR3 Q;  4RMF A;  2RHS B;  1I50 H;  1SRO A;  3RR5 A;  1YEZ A;  4A3J G;  1LUZ A;  1EYG A;  5IYC H;  3PF5 A;  4DV2 L;  5FLM H;  1Q1E A;  2CFM A;  4DR7 L;  4HIK A;  1GO3 E;  1CUK A;  1QUQ A;  3D0F A;  1SMX A;  3UDI A;  3CCQ A;  1XMO Q;  4BY1 H;  1PHJ A;  2JA7 G;  4OX9 L;  3KF8 B;  4R4Q A;  2MFI A;  2HT1 A;  1B8A A;  2K52 A;  1XNQ L;  3M3Y H;  3J7Z C;  1XNR Q;  4A3G H;  1CSQ A;  5JEA J;  4UP9 A;  3JAM c;  1K8G A;  1S72 A;  4DV7 Q;  2ID0 A;  4YCV A;  5IP9 H;  1I94 L;  4A93 H;  1Q8K A;  1TWF H;  3J81 c;  3TS0 A;  2ALY B;  1K8A C;  1VQ9 A;  3NBH B;  3RN2 A;  1YI2 A;  1IL2 A;  3GTP H;  1I3Q H;  2BA0 A;  3DLL A;  1PH4 A;  5M5X H;  3I4O A;  1C0A A;  4UP7 A;  5HGQ A;  4GOP C;  3U4Z A;  4GOP A;  3TRE A;  2I5M X;  1SE8 A;  4JI7 Q;  3HOY G;  3U58 A;  4A3K H;  3G48 A;  3MEF A;  4DK3 C;  4LUV A;  2NVQ H;  4PMW A;  1Q46 A;  3ERS X;  2R7Z H;  4A3L H;  2N3S A;  1VQ4 A;  2IHF A;  2MO1 A;  1VQP A;  2E5L Q;  3W1G A;  5FLM G;  3OTO Q;  3F2C A;  4JI6 Q;  2UXB Q;  1V43 A;  1A63 A;  4A3I H;  4AQY Q;  2JA5 H;  2B3G A;  1YHB A;  4BY1 G;  1HR0 W;  3PO2 G;  4IPD A;  4HID A;  4A3E H;  2H5X A;  1CKN A;  3W5O A;  4DR6 L;  4JC0 A;  1NBW A;  4A3F H;  4GLX A;  2UXC L;  1VQ6 A;  3CMA A;  2R7D A;  3KJP A;  2AWN A;  1HR0 Q;  3F1Z A;  1PV4 A;  4A3G G;  3EIV A;  4JI0 L;  4GKK Q;  2YTY A;  5IP9 G;  3M4Q A;  5M5Y H;  1IBM L;  2L15 A;  3TS2 A;  1X54 A;  2K5N A;  2PQA A;  4B3M Q;  2YTX A;  4A3L G;  3FHW A;  4A93 G;  2PI2 E;  4QIW E;  1OTC A;  4DV1 Q;  3UE0 A;  2K5V A;  1WOC A;  5AJ3 L;  2HHH L;  3DM3 A;  3JC6 6;  3AFP A;  3KF6 B;  2DGY A;  2E2J H;  3I56 A;  2QEX A;  4GN3 B;  2LXJ A;  1HNX Q;  3CPF A;  4GN5 A;  3CCV A;  3B6Y A;  2KCT A;  1M90 C;  2MQH A;  4P74 A;  3Q8D A;  4H02 A;  2LSS A;  1N34 Q;  4IFD J;  4YWM A;  4A3I G;  2JA5 G;  3PIO A;  2IHE A;  1SLJ A;  4DR2 L;  1G29 1;  2VUM H;  3GTK H;  1PVO A;  4IJL A;  5J3B A;  4A3E G;  2A8V A;  3KJO A;  1Q81 C;  2PNH A;  1QZG A;  4A3F G;  1K73 C;  2R6G A;  4Y7N H;  4JI3 Q;  4B3S Q;  3BZK A;  4LF6 Q;  1RL2 A;  3HOW H;  4GNX C;  4JYA Q;  4GNX A;  3GD7 A;  1OXT A;  3STB C;  4NXM Q;  2UUA L;  3J81 i;  3HKZ G;  2OTJ A;  3H3V H;  4IPG A;  2AHO B;  4LFA Q;  3CCE A;  1L1O B;  2Y0S G;  3HOU G;  4R4I A;  4QQB X;  1BVS A;  2KCM A;  1VS0 A;  3GTM H;  4B3R Q;  2ZJR A;  4X65 L;  4DR5 Q;  1XMQ L;  1GD7 A;  1P8L A;  2UUC Q;  5C0X I;  2JA6 H;  2WP8 J;  1HZ9 A;  1KRS A;  1Y1W G;  2Q2T A;  1I6H H;  4JBJ A;  1VQB A;  3S24 A;  3PUX A;  3CP0 A;  3HOX G;  4P71 A;  4BXX H;  1X56 A;  2CWP A;  4JI2 L;  3T1Y L;  1N8R C;  3K0X A;  1PH1 A;  3HOZ G;  2NN6 G;  1X65 A;  1KRT A;  3CPW A;  1SRU A;  2UUB Q;  2ZJQ A;  5LMU Q;  4OO1 I;  3HOW G;  1DGS A;  4EQ5 A;  3AEV A;  1O7I A;  4YHH Q;  3H15 A;  2XGT A;  1R9T H;  2ASB A;  5GAD C;  1NJI C;  1TWA H;  2VS1 A;  4JI8 L;  3S1N H;  3MXN B;  2JEA I;  2JA6 G;  2HIX A;  3PGZ A;  3J80 i;  4BA1 I;  1YHQ A;  3UDG A;  2KHI A;  2Z6K C;  2ATW A;  3CW2 C;  1N9W A;  4XTC S;  1KAW A;  3I4N G;  2V1C C;  4LF7 Q;  4BXX G;  4LFC L;  2QA4 A;  3GTJ H;  2K4K A;  2HQL A;  3ULJ A;  2VW9 A;  3KDF A;  5IP7 G;  3AQQ A;  2R7F A;  2VL6 A;  4LW1 A;  1XTD A;  1D7Q A;  2WFW A;  3CCL A;  4JI5 Q;  2R92 H;  2JEB I;  2VQE Q;  5C0X J;  3S16 H;  2VQF L;  3HOY H;  4BY7 H;  2K75 A;  1D8L A;  4DR1 Q;  1T9H A;  1ASZ A;  2ZM6 Q;  4KI0 A;  1YJN A;  3GTL H;  1L2F A;  3PUW A;  1XNR L;  4DUY L;  1X3G A;  4TVA B;  2B63 H;  1HNZ Q;  2RHQ B;  2OWO A;  3A5U A;  4LFB L;  2JE6 I;  4A4I A;  1EUJ A;  3E0E A;  3PO2 H;  5JJK A;  1N36 Q;  3M7N A;  2BA1 A;  3E9I A;  4MZ9 A;  1VCI A;  1IBL Q;  1TXY A;  1KIX A;  1NE3 A;  4DV0 L;  1VQD A;  3S2H H;  1VQ7 A;  1N33 Q;  4BA2 I;  1YNX A;  2F3I A;  1LTL A;  4IPH A;  1E1O A;  3AYH B;  4DAM A;  2UU9 Q;  3PUZ A;  4L5Q A;  4DV6 L;  1B7Y B;  1BBW A;  3OTO L;  1WCM H;  1WYD A;  4DV5 L;  3H0G H;  3RNU A;  3S15 H;  4LF5 Q;  2NVT H;  1X3E A;  2R92 G;  1TWC H;  2CCZ A;  4DAY B;  3RN5 A;  1M1K C;  4DV3 Q;  1MJE A;  4PZ7 A;  1IBK L;  4BY7 G;  1CSP A;  4YY3 Q;  3F2D A;  4NXN Q;  3T1H L;  1QVF A;  4JV5 Q;  1QUQ B;  4GKJ L;  1OXV A;  4PZ6 A;  5IWA Q;  1H95 A;  3S17 H;  2E8G A;  2VY3 A;  1YBY A;  1UE7 A;  3WWV A;  3CCJ A;  4JI4 L;  1Q7Y C;  3HOV H;  1VQK A;  2B63 G;  1VQ5 A;  3I4M G;  1NY4 A;  1J5E Q;  3KOJ A;  1VQF A;  4DV2 Q;  2EQS A;  1L0W A;  4DR7 Q;  1JJG A;  4DV1 L;  1HZC A;  1VQ8 A;  4DR4 Q;  4A75 A;  4OO1 G;  1KC8 C;  2AWO A;  4OX9 Q;  4B3T L;  4LF9 L;  4QL5 A;  1KQS A;  1HNX L;  3I55 A;  3RLN A;  2C35 B;  2D0O A;  1HNW Q;  1AH9 A;  1NMF A;  3ZJY C;  1VQJ A;  1WCM G;  3HOU H;  3H0G G;  4ME3 A;  4P73 A;  1N32 L;  2WAQ E;  3U50 C;  3ULL A;  2NZO A;  3KF6 A;  5LMN L;  1VQM A;  3SGI A;  1EOV A;  2GN5 A;  3J80 c;  1Q1B A;  1HJP A;  4GLV B;  1Y1W H;  1VQG A;  2NVY H;  1K83 H;  4X6A H;  5IT9 c;  2I5H A;  4P72 A;  3HOX H;  1CKN B;  3HOV G;  4JYA L;  3RLO A;  1JMC A;  1E22 A;  4L5S A;  2F4V Q;  4NXM L;  1WI5 A;  1FJG Q;  4HJ8 A;  4L5T A;  3HOZ H;  3A0J A;  3KFU A;  1X9N A;  3G71 A;  5C4X H;  4A3M H;  4LF8 Q;  3FKI H;  5JJI A;  4HJA A;  2PQA B;  4OWW B;  4IOA A;  1YZ6 A;  2CWA A;  1EIF A;  4L5R C;  4K0K L;  1VQH A;  1PH2 A;  4R4O A;  4DV4 L;  4ALP A;  1I5F A;  5FLX c;  1BKB A;  2UXC Q;  4IPC A;  2HIV A;  4YCU A;  4JI0 Q;  1L1O C;  4KLK A;  5GAH C;  1L1O A;  2K5H A;  1GM5 A;  3CME A;  3E9H A;  1VQA A;  4QY7 A;  4J15 A;  3CC7 A;  4LF4 L;  3J7A 5;  1GKH A;  4AH6 A;  4IO9 A;  1G6P A;  5AJ3 Q;  1V9P A;  4HIM A;  2CKZ B;  2A1A A;  2ZTE A;  4HJ5 A;  1UE5 A;  4QJF A;  5ELN A;  5GAE C;  3I4N H;  1HZB A;  4DR4 L;  1TWH H;  4DNI A;  1IYJ B;  3STB D;  3NEM A;  4POF A;  4IFD G;  4P75 A;  1A0I A;  2ES2 A;  4X64 L;  5C3E H;  1PYB A;  1PFS A;  2XTI A;  3K80 C;  5IP7 H;  3CCS A;  3VDY A;  4A3M G;  4OWT B;  3J81 j;  1YIJ A;  5C4X G;  3A5Z B;  4DR2 Q;  3FKI G;  2MNA A;  1AE2 A;  4NB3 A;  5JJL A;  2OQ0 A;  4KHP L;  4LUO A;  4IJH A;  1OXX K;  4A3D G;  4DPG A;  3BU2 A;  3PV0 A;  5GRO A;  4LF7 L;  2ZJP A;  1E3P A;  2UUA Q;  4DUZ L;  4A3B H;  1QZH A;  4X66 L;  1VQL A;  2ZTD A;  3CCR A;  1LYL A;  2JJQ A;  3F8T A;  1EQR A;  2WB1 G;  2JA9 A;  4APV A;  2Z6K A;  2VQE L;  1XMQ Q;  2Q2U A;  3UDF A;  3K8A A;  3H3V I;  1KD1 C;  1HH2 P;  2D62 A;  4HJ7 A;  1GVP A;  4LWC A;  4DR1 L;  4DR3 L;  2BH2 A;  3S2D H;  2ZM6 L;  1VQO A;  1Q12 A;  2JA8 H;  4Y52 H;  2N78 A;  5C3E G;  3F2B A;  4KHZ A;  1UWV A;  2N49 A;  1VQN A;  3OW2 A;  1NTG A;  1UE6 A;  1HNZ L;  3T1Y Q;  2KEN A;  4JCV E;  1XMO L;  4UY8 C;  5IE8 A;  1P16 A;  3S1M H;  1XPR A;  2NZH A;  4JG2 A;  2R93 H;  4R4T A;  1X55 A;  3GDE A;  1N36 L;  1A8V A;  3PUV A;  2IY5 B;  1IBL L;  3EBE A;  4IFD I;  1KXL A;  3GTO H;  2IX0 A;  4DV7 L;  1Z9F A;  2ZTC A;  1PH6 A;  3I4M H;  4A3B G;  1VQE A;  4BBR H;  3ICE A;  5GAG C;  3CCM A;  1WJJ A;  1K0R A;  1Q82 C;  1C9O A;  4BBS H;  1A62 A;  3M9B A;  4R4C A;  5EAY A;  3G4S A;  1UEB A;  4JI7 L;  3HKZ E;  4DK6 C;  4YY3 L;  2PMZ E;  1KL9 A;  2YYZ A;  2JA8 G;  4JI1 Q;  5IWA L;  2Y0S E;  1OXS C;  1CKO A;  5M3M G;  3PCO B;  2E5L L;  4JI6 L;  2UXB L;  1PA6 A;  2I5L X;  1PH8 A;  2E2H H;  4X62 Q;  4AQY L;  2IT1 A;  5C0X G;  3KLW A;  1SR3 A;  1J5E L;  3IRB A;  2R93 G;  3CC2 A;  1YVC A;  4OON A;  2GVA A;  3EN2 A;  4LUZ A;  2UXD Q;  2VZA A;  1TWG H;  5IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...