3F1ZA

Crystal structure of putative nucleic acid-binding lipoprotein (yp_001337197.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.46 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'QPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLGKWVKVRGVIVDIRRKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative nucleic acid-binding lipoprotein
publication title The structure of KPN03535 (gi|152972051), a novel putative lipoprotein from Klebsiella pneumoniae, reveals an OB-fold.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Dna binding protein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3f1zA00
2ZTCA 5GAEC 4YCUA 3GTMH 2JJQA 4LUZA 1CKMA 4DR3L 1EOVA 1IBMQ 2PI2A 1N8RC 2Y0SE 2ZJPA 1IL2A 3RN2A 4DUYQ 3A5UA 1JE5A 2ZM6L 1J5EQ 5JEAG 3CW2C 1WFQA 4WJ4A 1VQIA 4BA1I 1E24A 4P73A 5M5YH 3PIPA 4LF5Q 4A3MG 2E2JH 2JQOA 3DLLA 4JI6L 4DR7L 4HJ9A 4HJ8A 2CWPA 3TREA 1M1KC 2R93H 3MXNB 3I4MH 1VQGA 1P8LA 3I4NG 4DR1L 3GTLH 4A93G 4O0AA 4JI8L 1N34L 4LF8Q 1B70B 1UWVA 2IX1A 1SR3A 3HKZG 1K83H 3PSIA 4RG1A 3L2PA 4HIOA 1S40A 1VQNA 2AMCB 1P16A 2UXCQ 1FJGQ 2UU9L 1AE2A 4A3GG 3CCVA 2N8NA 3JAMc 4DV0Q 1D7QA 4BY1H 3AYHB 4DK6C 3AFPA 4IFDJ 1UE5A 1Q1BA 1RIPA 3FKIH 2K52A 3F2CA 2DUDA 2R7ZH 1HNWQ 1Q12A 2VQEL 1VQ6A 4B3TL 2KHIA 3TS2A 4R4IA 3W1GA 2IT1A 2K75A 2AWOA 4YHHQ 1ASZA 4A3FH 3KFUA 4YY3L 3GD7A 4DV6L 1YI2A 2ATWA 3HKZE 1YJWA 4BXXH 1QUQB 4YWLA 2RHQB 2VQFQ 2L15A 4C2MH 3JC66 2OQKA 1R9TH 5ELNA 2R93G 1GVPA 1OXTA 2PNHA 3I7FA 1KC8C 2HIVA 4BBSG 2WAQG 2NVXH 3EIVA 4BY7G 5IYDH 4JV5Q 5JJIA 4QIWE 2Z0SA 4GKJL 2GN5A 1VQ4A 3U4ZA 3S1QH 1E1OA 2RHSB 3KJPA 1I94Q 1C9OA 1VQAA 4XTCS 4BY1G 3S1RH 1YIJA 4HIKA 1XMQL 4LF6L 2A1AA 3E9HA 3HOUH 4IOAA 2LXKA 1IBKL 3GTKH 1A8VA 1U5KA 3BZCA 5ELOA 4GOPA 2BA1A 2R7ZG 1JJGA 4JI1L 4IFDI 2JE6I 4DV5Q 2I5MX 2R92G 1VQCA 2ZJQA 4R4CA 2WAQE 4A3KH 1W3SA 4GOPC 1N36Q 1WCMH 4X62L 2E5LQ 1KAWA 1LTLA 4LF9Q 4BXXG 4P72A 2FXQA 4QL5A 4HJ7A 3T1HQ 2UUBL 4A3IH 1XMOL 5C0XI 3CCRA 4R1JA 4GKKQ 2LXJA 4JI3Q 1NY4A 3F1ZA 1PHJA 5IYDG 4A3EH 2VUMH 2R6GA 3H0GH 5IE8A 2CCZA 4NXNL 1IBML 1G291 1GM5A 1SLJA 1TWAH 2KCTA 4X65Q 4DUYL 2OCEA 5HGQA 1JMCA 2KHJA 2AWNA 5AJ3Q 1J5EL 2A19A 3KF8B 1N33L 1VS0A 3HOZG 4LUVA 1PH3A 1X65A 3Q8DA 4LF5L 3F2BA 4B3MQ 4UP7A 3PO2G 3HOUG 5IYBH 2ALYB 1W2BA 4OWTB 4LF8L 2WP8J 4GN3B 1I5FA 4IJHA 1HH2P 3NEMA 2KBNA 3GO5A 1UE6A 1LYLA 1MIUA 5M3FH 1FJGL 2VL6A 2UXCL 1JJ2A 3I4OA 1E1TA 3RLFA 1IBKQ 1PH7A 3D0FA 1K9MC 3AEVA 4LNQA 3OYYA 3K80C 4A3IG 4HJ5A 3I4NH 3A74A 3BU2A 3PCOB 4DV0L 2EQSA 1X56A 5IWAQ 4DUZQ 3HOWH 4A93H 5BR8Q 4A3EG 2VUMG 3CD6A 2F3IA 1ASYA 1TWHH 5EAYA 2XTIA 1Q82C 1Y1VH 4JI7Q 1HNWL 3T1YQ 3KLWA 4A3GH 1PFSA 2PQAA 4XIGS 2H5XA 2EXDA 4DR4Q 5DLQE 5HY6A 4YHHL 1CKNA 2V1CC 4KLKA 4IJLA 1HR0Q 1OTCA 1EFWA 3CC4A 4NXNQ 3S1NH 3KDFA 2VQFL 4DV3Q 5IYBG 1SMXA 4PMWA 1N33Q 1PYBA 2K5HA 4DV2Q 3OW2A 3K8AA 1EQQA 2Q2IA 1NE3A 4LWCA 1K73C 3WWVA 2F4VL 2MO0A 4JV5L 1BVSA 2A8VA 5GROA 1PVOA 3L0OA 2K5NA 1FL0A 1YHBA 2IHEA 1E7ZA 5M3FG 5LMUQ 4YCWA 4OO1I 4OO1G 5FLXc 4JBMA 1VQBA 4WJ3M 3HOXH 3MEFA 1I94L 4BBSH 3BZKA 4A4IA 3HOWG 1L1OB 2RF4A 4BY7H 2N49A 5K36G 2YV5A 2JA6H 1WJJA 3NELA 3ER0A 1IBLQ 4DNIA 5M5XH 1Y1VG 3HFZB 1QVGA 4LUOA 1KD1C 2ZTEA 3NENA 4C3JH 1Z47A 4DV5L 3KYHC 2KENA 5GAHC 1VQPA 3K7UC 4DAMA 1PH5A 2ES2A 3KF6B 4H02A 1N36L 1KRTA 4LF9L 2E5LL 2UXDQ 1XPUA 3EN2A 4LF4Q 3T1HL 1NJIC 3CMEA 3CCLA 3UDGA 2R92H 4GKKL 4QQBX 4NB3A 3CMAA 4JI3L 2KCMA 4POGA 3CC2A 1HNZQ 2K14A 4QY7A 2QA4A 5C4XH 1V43A 3ULJA 3J7ZC 3RNUA 4KHPQ 5FLMG 4X65L 3TRZA 4DV7Q 3GTPH 2ZTDA 2GVAA 5AJ3L 1OXXK 4GLXA 3OTOQ 3M7NA 4P74A 2I5LX 3HOXG 2GVBA 4BBRG 1KL9A 4A76A 3J7A5 1N32Q 1S72A 3CPFA 2F4VQ 4L5TA 3ZJYC 2JA6G 4B3ML 4A3CH 4P71A 3K0XA 2YTYA 4OWXB 4DV4Q 4X64Q 1CUKA 4PG3A 3D31A 4JI0L 2CKZB 3HOZH 4IOCA 1CKOA 1OXUA 3GDEA 4GN4B 1KRSA 4IPCA 2NVYH 3PO2H 1X3FA 2VS1A 2CFMA 1FGUA 2VW9A 3CP0A 2N3SA 1HZAA 3ULLA 1GKHA 1YHQA 2Q2UA 1XNRQ 5C4JH 2R7FA 2LSSA 1YZ6A 1QVFA 1G51A 1K8GA 1X54A 4TQUS 4LFAQ 1B8AA 1E3PA 5E7NA 5JJKA 4DUZL 1PYSB 5IWAL 3PF5A 2VNUD 2QEXA 1UEBA 2YTVA 5BR8L 4KHZA 1QUQA 1AH9A 3PGZA 3K7AH 4JC0A 3TS0A 4B3RQ 5C4XG 3M4QA 2YYZA 4J15A 4JI7L 3T1YL 2UXBQ 1PA6A 1OXSC 4A3DH 1VQ8A 4UY8C 1BBWA 1K0RA 4DR4L 1HJPA 3J80i 2RCNA 1VQDA 1HR0L 5LMNQ 2K4KA 1X6OA 2BH2A 3PF4A 3A0JA 2YTXA 4A3CG 4JG2A 1KHIA 4QGUA 5GADC 4DV3L 1K8AC 1QZHA 3PO3H 1I6HH 4JBJA 1X3EA 5C3EG 4DV2L 2NN6G 3HOYH 1VQOA 1L0WA 3GTOH 4LW1A 3VDYA 4IO9A 1EUJA 5GQOA 3TQYA 3UE1A 2MQHA 1IZ6A 2JK8A 4GN5A 3W5OA 5LMUL 4RMFA 2NZOA 2JA8H 2Q2HA 1I3QH 1VQHA 4GNXB 3E9IA 4JI0Q 2PMZE 2UUCL 3S24A 2PI2E 4APVA 4B3SQ 5IT9c 2CQOA 1PH1A 1SN8A 1Q81C 1YNXA 4R4QA 1XNQQ 1EQRA 1IBLL 4X6AH 3STBC 3G6EA 1TWGH 1YJNA 3F8TA 1VQEA 2QGQA 1YHAA 4UP8A 4YWKA 2PQAB 3U58A 1PH8A 1PV4A 4QJFA 5IP9H 4PZ6A 1VQ5A 1CKNB 2UXDL 4JI2Q 1KXLA 4A3JG 3KJOA 1U0LA 4KI0A 4Y7NH 4LF4L 3PO3G 1UE7A 3H15A 4NXMQ 5IYCG 2JA7G 1VQKA 4L5QA 2JEAI 3HOYG 3LGJA 3PUWA 3GTGH 3HKSA 1HNZL 1CSQA 4KHPL 1SFOH 3E0EA 1S3OA 3U50C 5M5WH 3RLOA 4DV7L 2JA8G 4UPAA 1K3RA 1HZ9A 3DM3A 1A63A 3OTOL 4JCVE 2HQLA 3M85A 1N32L 2E2HH 3J81j 4DR6Q 4DPGA 3CCSA 2HHHQ 2AHOB 5FLMH 4A3LH 1N9WA 3STBD 4DV4L 1VQ7A 1BBUA 1Q8KA 1SRUA 1KQSA 4X64L 4DV1Q 3ICEA 3CCMA 4BBRH 2JA9A 2UUCQ 1YVCA 1M90C 1IXRA 1SE8A 4OONA 5IP9G 2WB1G 1XNRL 2IX0A 4DR2Q 3ERSX 4JI4Q 1PH9A 4P75A 3UDFA 3PV0A 2MNAA 1PH4A 4K0KL 4LFAL 1GO3E 3CCEA 2YU9H 1C0AA 1VQFA 2D0PA 2ZJRA 3J81i 1J6QA 1WOCA 4JI5Q 4B3RL 1YITA 3BJUA 4X66L 4LFCQ 4DR5Q 1X3GA 4OX9Q 4A3BH 4LFBQ 2IY5B 2Q2TA 3HOVG 1NMFA 3M4OH 2UXBL 1X55A 3RZDH 2JA5H 1Q7YC 4JYAQ 4POFA 1X9NA 1Q1EA 4UP9A 3GTQH 3IRBA 2B63G 2OWOA 3S14H 3W1BA 5LMNL 1WI5A 4L5SA 4A3LG 2WB1E 4AQYQ 2B29A 4DK3C 1XJVA 3RN5A 3UE0A 1SROA 4JBKA 1L1OA 5FJ8H 1KIXA 2HT1A 2UUAQ 4HIDA 3J80c 1Y1WH 4A3DG 4MTNA 4OWWB 1QZGA 2OQ0A 3M9BA 4NPSA 2NVQH 4GLAC 1G6PA 2IHFA 1EIYB 1CSPA 1L1OC 3K81C 1MKHA 2BH8A 3AFQA 4MNOA 1HNXQ 5C3EH 4GOPB 4DKAC 1XTDA 1UE1A 5JJLA 1E22A 3KF6A 1YEZA 4B3SL 1V1QA 4DR3Q 5C0XJ 2ID0A 1IYJB 3PUXA 5C44H 1TWCH 4PZ7A 1VQ9A 5IY0A 3S17H 3CPWA 1XNQL 2VY3A 3M3YH 1EYGA 2BA0A 4A3BG 3U4VA 2ZM6Q 2I0QA 3I4MG 3G48A 4K0KQ 1EWIA 3I2ZA 1MJEA 2JA5G 2E2IH 2K5VA 1OXVA 3PUYA 3S2DH 4AH6A 1JT8A 3B6YA 4DR7Q 5LMNW 4JI6Q 4X66Q 4JI2L 3CCQA 3S2HH 1NMGA 4DAYB 5GAGC 1C7YA 4NXML 1EIFA 3S1MH 3JAMi 5FJ8G 4DR1Q 4L5RC 2I5HA 4JI8Q 1N34Q 1XPOA 3ULPA 1Y1WG 4C3IH 4EQ5A 1VQMA 1BKBA 3I56A 4GLVB 4O2DA 3RLNA 2CWAA 3CXCA 3G4SA 3S16H 4A3JH 4OXPA 3FKIG 1AE3A 3KOJA 1PH2A 4AYBG 4PZ8A 1FVIA 3L7ZC 4EX5A 1VQLA 2UU9Q 2N78A 3PUZA 3EBEA 2E8GA 5IYCH 1XPRA 2JA7H 4IFDG 2NN6I 4AIMA 2NVTH 4IPHA 1H95A 5M3MH 2Z6KA 4DR6L 3AQQA 2MO1A 3GTJH 2HHHL 2D0OA 2R7DA 4A3FG 4IPDA 5C44G 2ASBA 3CCJA 4LF7L 2OTLA 1Q46A 3CCUA 4YCVA 2VQEQ 1RL2A 4DV1L 3H3VH 1HZCA 3CAMA 2Z6KC 5J3BA 5C0XG 3F2DA 3RR5A 4B3TQ 4FDBA 1GD7A 4YWMA 5H1SE 1LM0A 1TWFH 2OTJA 4YY3Q 4DV6Q 2NZHA 1YJ9A 5IP7H 4DR2L 4JI4L 3A5ZB 3G71A 3CQZH 3TEHB 1HZBA 3NBHB 2AKWB 1DGSA 4AYBE 3PIOA 2DGYA 3CC7A 3S15H 2EIFA 3RZOH 3PUVA 4BA2I 1Y14B 2B3GA 3SGIA 5JEAJ 1MJCA 4JI5L 4HJAA 4HIMA 4LFCL 1JB7A 1HR0W 1T9HA 1VQJA 4DR5L 4OX9L 4GKJQ 4LFBL 1V9PA 1LUZA 3KDFB 1NTGA 1YBYA 1B7YB 4IPGA 2D62A 2F52A 4JOIA 4C3HH 4ALPA 1A0IA 1I50H 2WFWA 4JYAL 4Y52H 1Z9FA 2VZAA 5M3MG 1XMQQ 4A3MH 3J81c 4LF6Q 2Y0SG 4A3KG 3CF5A 1PH6A 1VCIA 1QVCA 1WCMG 2XGTA 4R4OA 1D8LA 3I55A 4AQYL 3FHWA 4JOIC 3HOVH 4R4TA 4GNXA 1O7IA 3H3VI 4JI1Q 2C35B 2MFIA 1Q86C 4MZ9A 2UUAL 2B63H 4A75A 4JBWA 1NBWA 4TVAB 2JEBI 1TXYA 1A62A 3FP9A 1L2FA 3H0GG 3M4PA 2HIXA 3UDXA 4X62Q 4GNXC 4ME3A 4LF7Q 1WYDA 4GS3A 5IP7G 1JJCB 2K50A 1HNXL 2UUBQ 1XMOQ 3UDIA
chains in the Genus database with same CATH superfamily
5GAEC 4CKCA 3BG3A 4HEDA 2IWHA 4KKUA 3OIQA 3SR1A 3HOZB 4J6HA 2ZM6L 3I90A 1WFQA 3PO2B 1Y8NB 5C6AA 4FXDA 4A3MG 3BDLA 1CK1A 2JQOA 3D4WA 4DR7L 1BOSA 3TREA 2R93H 1LTTD 5J22A 3I4NG 4LF8Q 4RG1A 3HKZG 1IYUA 2H1EA 4RGOS 1VQNA 1U4RA 2AMCB 1EFID 2UXCQ 4B08A 4PV1C 3TSSA 4NW2A 1JE4A 1TU2B 1RD9D 3D4RA 3SK4A 4XT3B 1I6HB 1Q1BA 3FMCA 4ILWA 3F2CA 2DUDA 1YNND 3HOYB 3IFTA 3R3OA 3TS2A 2F4IA 3MWYW 3A8IE 3W1GA 2A69C 5JAVA 3GD7A 1EEID 4DV6L 2WKDA 3NUCA 4YWLA 3C46A 4C2MH 1R9TH 5ELNA 1GVPA 2XNAC 2LMCB 3CKIB 2F0MA 3EIVA 4BY7G 3QG1A 4JK1C 2Z0SA 1EY7A 2IX3A 3D4DA 2QDBA 1R4PB 1VQ4A 3S1QH 1Y8PB 1I94Q 1C9OA 1XMQL 2G9HD 3DHQA 1Y1VB 3DUZA 4IUNA 2A1AA 3E9HA 1IBKL 5ELOA 3GTGB 4IFDI 2JE6I 4DV5Q 2I5MX 1VQCA 2ZJQA 3DWQA 4GOPC 2E5LQ 5D3DA 4QL5A 1T5XD 1F77A 2IW3A 2E2HB 4KJNA 3FVQA 1ICFB 2LXJA 4IUTA 1NY4A 5IYDG 4A3EH 2CCZA 1IBML 1G291 4UDUC 2MUYA 1PZKD 2KQ3A 4H7BA 4O42A 1LTAD 4DUYL 3T51B 2AWNA 2KHJA 1LLRD 3KF8B 1VS0A 1O7YA 3E6ZX 3HOZG 1AZPA 3Q8DA 4CDFC 2C9OA 2F0HA 5G3LF 3F2BA 4ZYSA 4UP7A 3PO2G 3V05A 4H44C 2WP8J 4GN3B 4DA2A 4FNFA 3ONAB 1HH2P 1MIUA 2EY2A 1LT5D 3SXHA 1E1TA 5DM63 1PH7A 1K9MC 3C1FA 5G3LD 2M00A 1IYVA 3NWSA 4RH6A 3LWUA 1F9QA 2XTIA 4Q5VA 3JAME 2I46A 4A3GH 1Y1WB 2PQAA 4XIGS 2H5XA 2F0EA 4DR4Q 1WTQA 2V1CC 1HR0Q 5EPKA 4IJLA 1OTCA 1FNWA 4NXNQ 5C3EB 1QCBD 1ET9A 4IUUA 5KNBA 5IYBG 4DV3Q 1IW7D 1N33Q 4FF2A 3KLSA 4HCSA 5CORA 5BN5A 3M3YB 5GROA 1PVOA 3L0OA 2IHEA 5LMUQ 1VF5C 4JBMA 4K2LA 3HOXH 1NSNS 5DAUA 4A4IA 2A74C 2K33A 2N49A 3U9OA 3S2HB 5ELEA 1S5BD 1I4PA 2EYPA 1IBLQ 4ZUJA 5M5XH 1Y1VG 1CQFA 4LUOA 3NENA 1U4LA 4BS9A 4H02A 1T5EA 2HUGA 3EN2A 2NVTB 3A8KE 2QILA 3CMEA 3H6MA 1SJHD 4QQBX 2F0VA 4JI3L 2KCMA 1II3A 4KHPQ 1V43A 1CZGA 1ESFA 3VYUA 3TRZA 4DV7Q 2ZTDA 2GVAA 1FR3A 5IGCA 1W6JA 1TWFB 4GLXA 1SE3A 4P74A 4A76A 2F4VQ 4L5TA 3ZJYC 2JA6G 3MXUA 4H0LC 1EOTA 2XRSD 4X64Q 1CUKA 4PG3A 2XIWA 3GDEA 4IPCA 3E5SA 1BXTA 2CFMA 1FGUA 3CP0A 2N3SA 1HZAA 1XNRQ 1MHWC 1PFMA 2Q2UA 5IGEA 2R7FA 2EYLA 1A2TA 1K8GA 5KNDA 2E2DC 2VNUD 2YTVA 1QUQA 3AMUA 1I6VC 4J1MA 5C4XG 2F0TA 2YYZA 4JI7L 1STBA 2F0DA 2B63B 5CV4A 2B39A 2RCNA 4A3CG 2G5DA 3M4YA 4QGUA 5C3WA 3IFDA 1QZHA 3PO3H 2EY1A 1X3EA 5C3EG 1EU4A 4DV2L 2CHBD 3VR6A 2NN6G 1EY4A 3L3OC 2A68C 2Q8IB 1PFBA 1EUJA 1RJTA 5GQOA 2F0GA 4WJWA 4IO9A 1BDOA 5I2XA 1IZ6A 1BCPC 2JA8H 3VYTA 1BUVT 4EQNA 3E9IA 4JI0Q 2PI2E 1Z7TA 4B3SQ 1ML0D 4A3BB 1BR9A 2R93B 4NMZA 4R4QA 1EQRA 3STBC 1DOKA 1YJNA 1JCKB 2QGQA 1YHAA 5E4XA 1U4MA 2PQAB 1CHPD 1PV4A 4M8AA 2LKVA 1VQ5A 2UXDL 1AFPA 1KXLA 1MI2A 4CKEA 1UE7A 2Z6BA 1VQKA 4L5QA 2JEAI 1F2MA 5EBCA 1X32A 4L8JA 1SFOH 2EDGA 4UPAA 4JCVE 2N88A 4C2MB 1K28A 5FLMH 5EKIA 2EYHA 3ICEA 3CCMA 4OONA 5IP9G 3S1QB 2IX0A 3ERSX 2F0SA 1PH9A 3PV0A 1BNZA 4FF4A 2YU9H 4XDXA 3J81i 1J6QA 1YITA 4LFCQ 4IZ8A 4NP5A 4OX9Q 1HA5A 1NUCA 1NMFA 3M4OH 2NZ1D 2Y0SB 1X9NA 2B63G 3S14H 1GUNA 5LMNL 4RFBA 2C5CA 4AQYQ 1XJVA 3C2PA 1SROA 4JBKA 2AQ1B 1DOMA 4ZCKA 5IODA 1DOLA 4MTNA 2FMMA 1SMYD 1CSPA 2QCPX 3GQBA 3QO2A 4HR7B 5EQ0A 1D5ZC 4DR3Q 3S17H 3CPWA 2VY3A 3DWAA 1PLFA 4X3SA 4A3BG 4K0KQ 4DK0A 2JA5G 1ENAA 1D2BA 1OXVA 3PUYA 5EKKA 5ISRA 2ICIA 5F2DA 5LMNW 4JI6Q 5EBDA 3OIPA 1O78A 1JWSD 3EJIA 5FJ8G 4DR1Q 3KUPA 2CWAA 4A3GB 1NCVA 1WTHA 4A3JH 1VQLA 3L7ZC 4EX5A 2N78A 3PUZA 1XPRA 2JA7H 2NN6I 4AIMA 4JPBW 4CKBA 2Q8RE 2Z6KA 3GTJH 1ZKOA 5C3XA 1HUMA 2D0OA 2HHHL 4IPDA 2OTLA 1Q46A 3CCUA 2EY6A 3H3VH 2F0KA 1S5ED 5KRUA 1LM0A 5M9OA 1B50A 2E75C 1YJ9A 3HOXB 4JI4L 3A5ZB 3G71A 3CQZH 3TEHB 2AKWB 3CC7A 2DGYA 3PIP3 2ZXOA 3VYSA 1G91A 5M5XB 4JI5L 3K5MA 1I4QA 5KYIA 1LUZA 3KDFB 3TP7A 5JEAH 2F0WA 4DF7A 4IPGA 2D62A 4C3HH 2A6EC 4Y52H 2VZAA 1C48A 5FO7B 3L9AX 3TBIB 2Y0SG 3CF5A 1Q3LA 4DAPA 4G57A 3FHWA 3HOVH 1D5XC 4JI1Q 3OMCA 4H13C 4MZ9A 5A2QL 3M4PA 1A62A 4X62Q 4KKTA 4LF7Q 5IP7G 1Y69U 2K50A 3J80E 3NK9A 2UUBQ 2A6HD 5T1IA 4X3KA 2KA7A 5J39A 1IL2A 3VA7A 1I4GA 2BDNA 4WJ4A 4ME5A 1E24A 3HOUB 2KEEA 4KD3A 1EZ8A 4LF5Q 3R2IA 1CI3M 1HXYD 3KLRA 4KK7A 1KDAA 2WIIB 5IOCA 2WACA 1M1KC 2B2TA 2MJ8A 4C1NI 1C4QA 1P8LA 1GXDC 3GTLH 4JI8L 1O7ZA 3VA5A 3TZDA 1B70B 3DWPA 1P16A 5NUCA 1FJGQ 2UU9L 4Q0FA 4A3GG 3CCVA 2EJGC 3JAMc 3I72A 2FMCA 3AYHB 4DK6C 3M7GA 3BYTB 3AFPA 3I70A 4IFDJ 1LT4D 3PO3B 3FKIH 1EU3A 2B8FA 2DN8A 2EVBA 5BN4A 4B3TL 2KHIA 1OO9B 1M8AA 5C4HA 2J4XA 1ASZA 4A3FH 2JA8B 3NTHA 3HKZE 1YJWA 2L4NA 2HCCA 2RHQB 3JC66 1WTVA 3DM1A 3U9SA 2I07B 5CMDA 3BVGA 2HIVA 2WAQG 4ZKBB 4PQXA 3HP3A 1RDPD 3DEPA 5JJIA 1RCVD 4QIWE 4GKJL 1KDCA 1E1OA 2RHSB 3QOJA 2PNRC 3OPOA 4BY1G 4HIKA 3J81L 2LY7A 2EZVA 1A8VA 2R7ZG 2BA1A 1JJGA 2QDLA 3R8BA 3T16A 1SFOB 4R4CA 4OHJA 1W3SA 1D6EC 4BXXG 1KAWA 1LTLA 4QF4A 2DY7A 4A3IH 1W6KA 4IUQA 4GKKQ 3F1ZA 1PHJA 2RSOA 3H0GH 2F03A 4NXNL 1TWAH 4X65Q 5JVG3 4DAYA 5HGQA 1J5EL 1N33L 2A19A 1TS3A 2NB0A 4LUVA 1KTKA 1X65A 4B3MQ 4F87A 3HOUG 1GJXA 2YU9B 2ALYB 4FYDA 1HTLD 3AB9A 4OWTB 1I4HA 1WTOA 1I5FA 1B3QA 4C1NK 2KBNA 3M4OB 1UE6A 2SNSA 2VL6A 1JJ2A 3I4OA 2B2WA 4OO1H 3AEVA 3S14B 1X3QA 2RVLA 4HJ5A 3BU2A 3J7AF 4DV0L 2EQSA 4DUZQ 5IWAQ 4A93H 5IGFA 2VUMG 3CD6A 2WKCA 1TWHH 1HNWL 3DMUA 4UHVA 1PFSA 2K5WA 1D5MC 2EXDA 1ILQA 5DLQE 4YHHL 1CKNA 4KLKA 3CC4A 3T4AC 1EFWA 1G8ZD 3MXPA 2VQFL 2OEOA 3OW2A 4K5XA 1EQQA 2CW0C 2K5QA 2F4VL 4JV5L 1HRJA 2A8VA 4R8IA 1SE4A 2KCCA 5M3FG 2OF1A 5FLXc 2EYMA 1VQBA 4F7XA 4WJ3M 1EWCA 4BBSH 1KLUD 3BZKA 4RGNA 3HOWG 3ER0A 3HFZB 1QVGA 1KD1C 3TZUA 5ELFA 1Z47A 1WD1A 2JP1A 4DAMA 1PH5A 4A3JB 2OT2A 2Z8LA 2ES2A 1N36L 4LF9L 4C56C 1XPUA 4DK1A 2JA7B 4LF4Q 3T1HL 5J1ZA 3CCLA 3GTJB 3LWEA 3BS1A 4POGA 1ILPA 1HNZQ 2A5HA 1PDQA 1SEBD 4ID6A 5FLMG 3MXNA 1H9SA 3GTPH 5AJ3L 1OXXK 1TY0A 2F1MA 1K8OA 2AUJD 3OTOQ 3M7NA 3J7A5 1N32Q 2RSNA 1KL9A 2BCOA 3CQZB 5EPJA 4RHSA 4OWXB 4HN7A 4DGZA 4EQPA 3TDQA 3LX0A 3A54A 4JI0L 1B1ZA 1AW7A 3Q22A 2NVYH 4EVOA 2B2YA 2VW9A 3ULLA 4C3HB 1C8CA 1QVFA 2B2VA 2PZWA 2NTTA 1SYBA 1B8AA 4DNRB 3RMHA 4RGMA 2QEXA 5BR8L 1AH9A 3HOVB 3PGZA 4XQQA 2F0QA 1B2TA 2IPKD 3M4QA 2RQXA 1U9RA 3T1YL 4B9XA 1F2ZA 4A3DH 1A15A 1G2TA 4WFN3 1DYQA 2EY5A 1U4PA 2D2CC 2K4KA 1X6OA 2BH2A 3A0JA 1A2UA 5FK9C 4FF1A 2WINB 5FOBB 1PRTC 1UAPA 2R61A 1VQOA 3GTOH 5E1FA 4OIJA 1HTPA 1A3UA 3I3CA 3W5OA 2JK8A 1QJOA 1QWYA 1SJED 4KKSA 3S24A 4APVA 5EGTA 1B44D 2X6GA 1YNXA 1XNQQ 4X3UA 4X6AH 2K1BA 3GTLB 3BDOA 3F8TA 1VQEA 1VDZA 2HDLA 4DU9A 2L1BA 1HQRD 3F2UA 3EQLC 5K36H 4QJFA 4PZ6A 1CKNB 4JI2Q 4A3JG 3IL8A 1PZID 3Q6SA 4CGYB 4ABNA 2BOSA 2OXPA 1Q90A 2JA7G 5C5LA 3HOYG 3PUWA 3FKIB 3HKSA 4ULLA 1CSQA 1KAAA 2RDFA 4AYBB 1KABA 3E0EA 4CDCC 1S3OA 3U50C 5JPMC 5M5WH 1F2LA 3RLOA 1HZ9A 4A3FB 1QG7A 1K8MA 4TRDA 4DR6Q 3CCSA 3J80L 1GHKA 1I4XA 4A3LH 4DV4L 1VQ7A 1BBUA 5JVH3 2M2LA 4RKBA 4BBRH 3K57A 1D1KA 2JA9A 1TQOA 2UUCQ 4DXGA 1YVCA 1QNUA 1IXRA 2KVMA 2MNAA 1PH4A 4K0KL 4LFAL 4C3HG 1GO3E 1C0AA 1YNJD 2ZJRA 1WOCA 2XVSA 2MHVA 4B3RL 4LFBQ 2UXBL 3HOVG 1Q7YC 5CV6A 3E0JA 4ZQ3A 3GTQH 3IRBA 3OHXC 3W1BA 2K01A 3X3MA 4A3IB 3HG9A 4DK3C 3RN5A 5CGKA 1L1OA 3H0GB 4HIDA 3J80c 1TWAB 4OWWB 2PYKA 2OQ0A 2NVQH 1MKHA 3R2TA 1RODA 1H9KA 2PPBC 5JJLA 3KF6A 5C0XJ 2ID0A 5C44H 1TWCH 4PZ7A 4K5WA 4I7ZC 2J7ZA 1EYGA 2BA0A 3PIO3 2K28A 1ZYRC 4TKOB 2ZM6Q 2I0QA 5IT9E 4V0BA 4PMBA 3I2ZA 1MJEA 1JOOA 4JVZA 3J7YW 2F0FA 1PTOD 2Z1CA 1DONA 1LACA 4DR7Q 3CCQA 4A93B 5KEEA 4NXML 3S1MH 3JAMi 3H3VC 1TWHB 2I5HA 1BBXC 1XPOA 4RWSC 5HURA 1Y1WG 4ODGA 3HS0C 1VQMA 1BKBA 3CRKC 2LFNA 3FKIG 1AE3A 3IKJA 3KOJA 3MA2B 3VYRA 4AYBG 2E8GA 3K5LA 2FHTA 5M3MH 1WTPA 2MO1A 4MN3A 4A3FG 2R7DA 3CCJA 4LF7L 5EKLA 5A35A 3TP6A 1PMRA 4DV1L 1HZCA 5C0XG 3F2DA 4YWMA 1D1IA 2OTJA 5FLXE 4DV6Q 2XWBB 2NZHA 4DR2L 2Z4HA 4BBSB 3ZYYX 2DNCA 1TIID 3S15H 2EIFA 3I73A 4MIUA 2EYJA 3PUVA 1Y14B 4BA2I 2B3GA 4NDXA 1A3VA 4QB4A 4S3SA 4HIMA 1EYAA 2EYFA 4DR5L 3T56B 1YBYA 4HSPA 1RTOA 4JOIA 4JYAL 5TSSA 2WFWA 1Z9FA 1XMQQ 4B9WA 3PMFA 4A3MH 3S16H 1SXTA 2XGTA 2B2UA 3P20A 2L55A 4GNXA 5EPLA 3H3VI 1Q86C 2UUAL 1V1PA 1G6ZA 1NBWA 4TVAB 1LTID 3T53B 2JEBI 2HDMA 1R9TB 3H0GG 1AZQA 3GTPB 1S5DD 2HIXA 1SYCA 3GV6A 4I65A 5FKAC 4IALA 1WYDA 1O80A 2XWJB 1JJCB 1AP0A 1HNXL 4HJAA 2ZTCA 1STHA 2XSCA 4YCUA 3GTMH 2JJQA 2BE5D 1RHPA 1CKMA 4WRDA 1DD2A 1EOVA 1FD7D 4OIKA 1IBMQ 2Y0SE 2ZJPA 3RN2A 4DUYQ 2RDGA 1JE5A 1YNNC 2F3WA 3CW2C 2Q8TA 2NVYB 1LTSD 1VQIA 4P73A 5M5YH 1AEXA 3WDNA 4K8IA 2E2JH 3DLLA 2WV6D 4HJ9A 4HJ8A 2CWPA 2EXZA 4A93G 2NYZD 4O0AA 5C5MA 1N34L 1UWVA 3TP5A 3W2DA 1SR3A 1K83H 5EJWA 4HIOA 1I4RA 4A3DB 4X3TA 1A6XA 4A3EB 5DNFA 4I7AA 4ZUIA 1D7QA 3MHBA 1CA5A 2D5DA 1UE5A 1E2WA 5ELDA 1Q12A 2VQEL 2P5ZX 1VQ6A 3GTOB 4KJOA 2IT1A 1NAPA 4PMCA 4YY3L 1QUQB 3NTKA 2L15A 3CHBD 2K32A 1ENCA 2R93G 1BQQT 1OXTA 3MTSA 3I7FA 2FJ2A 1KC8C 4BBSG 2NVXH 5IYDH 2AUKA 3O13A 1GUTA 2GN5A 3U4ZA 3UI2A 3KJPA 1VQAA 3S1RH 1YIJA 3QWNA 4LF6L 4HCEA 1SYDA 4IOAA 1A3TA 3GTKH 3BZCA 4GOPA 2QKIC 4O1NA 3TP8A 1EWHA 3VR5A 2GA4B 1L0XB 1R4QB 2WAQE 2A69D 5M5WB 3KBGA 1WCMH 4FP5D 4P72A 1UEAB 2RKSA 4HJ7A 2RBMA 4IUPA 1XMOL 5C0XI 3CCRA 4R1JA 1EQVA 4JI3Q 3KK7A 4V190 1SNPA 2R6GA 5IE8A 2JXMB 3D6WA 1F9RA 4MHEA 1HFNA 4BBRB 1SAPA 2L12A 1JICA 1PH3A 2O2LD 4KV6A 1WD0A 4RA8A 4M1UB 5DM73 2L11A 1TR5A 5IYBH 2NBFA 1STNA 1IW7C 4LF8L 1JWUD 1V1PB 3GO5A 1LYLA 2UXCL 3RLFA 3GTQB 2NUCA 3D0FA 4LNQA 4A3DG 2M9VA 5CBAE 3PCOB 2EJFC 3N6RA 1VF7A 3JAML 3KLSX 4A3EG 3QR8A 1FNVA 2F3IA 1QB5D 1TS5A 2PMZB 1Q82C 1Y1VH 4JI7Q 5CV9A 3CRLC 2NVQB 3QB3A 3S1NH 1S5FD 2PZTA 2TMPA 1XWEA 1PYBA 4DV2Q 3K8AA 2HCIA 1NE3A 1TWCB 4LWCA 5C44B 3WWVA 2MO0A 1BVSA 1WVLA 1SYEA 3K58A 1QOHA 4OO1I 4XXEA 2QW7A 1SBBB 3MEFA 3EVQA 1I94L 2RF4A 2Z9HA 5K36G 2JA6H 1WJJA 5LL6X 1B53A 3NELA 3S1MB 4DNIA 4N9TA 4C3JH 1GUOA 4DV5L 1WTRA 2KENA 5GAHC 3K7UC 3H09A 2E5LL 3RUZA 2UXDQ 1Q8IA 4MTKA 1NJIC 5M3MB 1S5CD 2PW7A 2R92H 1IL8A 2NTSA 2FINB 1ZEQX 4EGVA 4G4KA 3OWEB 4QY7A 5C4XH 4U673 3ERQA 1Z6HA 2ZXRA 4KTAA 2I5LX 3HOXG 4BBRG 4K5VA 1LT3D 1S72A 2F3VA 2H4OA 4A3CH 3K0XA 3S15B 4RGTA 3D31A 1B9MA 4IOCA 2WB1B 1S4ZA 3LNNA 2MPMA 2CQAA 3FEWX 4GN4B 3I91A 5E4WC 1HHVA 5IT9L 3P75A 1UUPA 1YHQA 5C4JH 2LSSA 4ZAIA 4K6LA 1X54A 2L0CA 3SHLA 3S16B 5JJKA 1PYSB 1UEBA 5IGBA 4KHZA 3H91A 3URYA 3K7AH 3VR2A 4J15A 2K7VA 3AU7A 3SK8A 1HQMC 1OXSC 3HKZB 4DR4L 4UY8C 1BBWA 1K0RA 3H94A 3VR3A 3X3NA 3J80i 1HR0L 5LMNQ 1LTBD 4JG2A 4ZKCB 5GADC 4DV3L 3GTMB 1JC7A 1B9NA 1GOZA 1H9RA 4RCOA 4LW1A 1L0YB 5CV5A 3SK6A 3UE1A 5FO8B 1CZWA 3CU7A 1KNAA 5LMUL 2NZOA 1I3QH 3WOEA 5M5YB 5FLXL 2UUCL 3Q24A 4G7HC 2E2JB 5HGTA 4DN4M 5IT9c 2CQOA 4CBVA 1K0SA 1Q81C 4CJ0B 1IBLL 3SDZA 1TWGH 3K5NA 5ELBA 1Y8OB 2K04A 4UP8A 1BCPF 1K83B 1B4OA 4K14A 4YWKA 4XQNA 1GUWA 1PH8A 5IP9H 2F0NA 2ZT9C 3P1HA 3W3AA 4KI0A 3KF8A 4Y7NH 3PO3G 1EIHA 2A68D 4CHTB 2KJXA 5JJZA 3EROA 4KHPL 1WTXA 1BCPD 1SSOA 3KBXA 4DV7L 1JWMD 2JA8G 1MD2D 3T13A 3S17B 3M85A 2DY8A 4Z9CB 4DPGA 2HHHQ 3QOLA 3STBD 1Q8KA 2NVXB 1SRUA 3K5OA 4X64L 1KQSA 5KIXA 4KMUC 4OELB 4L63B 5LHY1 4DAVA 1SMYC 2MP1A 2WB1G 4HTHA 3OSOA 1XNRL 5T1GA 1F9SA 4JI4Q 3S1RB 4P75A 2HQEA 2LS01 3ND8A 3MVVA 3R93A 3GTKB 4JI5Q 3BJUA 4A3BH 2BDOA 1F9PA 3RZDH 3FRPB 1FNUA 2AQ3B 2JA5H 4POFA 1Q1EA 4UP9A 1E2ZA 1WCMB 2OWOA 3UDIA 1WI5A 5JOBA 3SVMA 1RF2D 2B29A 5IGGA 4CDDC 5FJ8H 1KIXA 2HT1A 3PQIA 4NPSA 4GLAC 1EIYB 1ICWA 4FO2A 1M4VA 3HEJA 4DKAC 1UE1A 2XN9C 4B3SL 1PTOH 1V1QA 1IYJB 2DNEA 1VQ9A 3EFXD 5IY0A 1XTCD 3A56A 1SDFA 1EZ6A 4EQOA 1DM0B 2E2IH 1QNKA 4KY7A 1JT8A 3S2DH 3QIAA 3B6YA 3V96A 3WOFA 4X66Q 3EA6A 4DAYB 5GAGC 1EIFA 4L5RC 2E76C 1BCPB 4JI8Q 3ULPA 4C3IH 3CXCA 3I56A 4OXPA 2UU9Q 3NHHA 2DJFC 2F0PA 4HAEA 3EBEA 5IYCH 1H95A 1H9JA 4XQJA 3S1NB 3AQQA 2ASBA 1TVXA 4KY5A 1RL2A 5J3BA 4B3TQ 2Z6KC 1XX8A 1SNMA 4FDBA 1GD7A 4N8X1 2KHSA 2L5TA 3A7AB 5IP7H 1HZBA 3DXJC 1NR2A 4AYBE 2X6LA 2JA6B 1SNOA 3RZOH 2A6HC 3SGIA 5JEAJ 2VXWA 2G9DA 4C3JB 4LFCL 1JB7A 4GKJQ 4IURA 4OX9L 1V9PA 1B7YB 2F52A 1GHJA 4ALPA 1A0IA 1I50H 1MSHA 3N52A 3SK5A 3ND9A 2PO4A 1ENFA 1MSGA 4XYQA 1VCIA 1WCMG 3G6JB 4R4OA 4AQYL 1LTRD 2R92B 1SNCA 4RCNA 2RDHA 2C35B 3GP7A 2MFIA 2PW5A 5DEHA 5C4XB 4A75A 2F0LA 1SNDA 1TXYA 3FP9A 1L2FA 5CV8A 4ZRZA 2E74C 4ME3A 3A7LA 4QUCA 2RCFA 1G2SA 4RAUC 5A2QE 4R8NA 1SYGA 5CC4A 4LUZA 4DR3L 1JB3A 1E2VA 4UAIA 1QE6A 2PI2A 4FVMA 1N8RC 3A5UA 2F0JA 1J5EQ 5JEAG 2A6ED 4CJ1B 4BA1I 3PIPA 5C4JB 2JN4A 4JI6L 1IKMA 1K3BC 3MXNB 1H9SB 1VQGA 2ENBA 4IN3A 3I4MH 4DR1L 3GV3A 3K7AB 1VMPA 5CR3A 3MEHA 2IX1A 4RHRA 1S40A 3PSIA 1B3AA 5I4DA 3L2PA 2QEJC 2B2TC 1AE2A 2N8NA 1LT6D 4DV0Q 4BY1H 3C3LA 5D65A 1CM9A 1RIPA 2K52A 1EQTA 1HNWQ 2R7ZH 1PTOF 4DFAA 2RA4A 4IFDH 5D14A 2J0TD 4R4IA 3TN2A 1J8IA 2K75A 4YHHQ 2AWOA 3KFUA 4BXXH 1YI2A 2ATWA 1I3QB 2VQFQ 2OQKA 2PNHA 1CA6A 4TSSA 4HMJA 4JV5Q 3S9WA 1TWGB 1XYIA 4C3JG 4ZLTF 4XTCS 4WORA 4Y7NB 1AN8A 1CT1D 1TY2A 3HOUH 2LXKA 1U5KA 2NWGA 4JI1L 1GUSA 3J81E 5I6YA 2R92G 4QMGA 3E3XA 4A3KH 1N36Q 4LF9Q 4X62L 2FXQA 3T1HQ 2UUBL 1BO0A 3G7LA 1CHQD 1V1OA 2EE1A 2VUMH 2K03A 3HRZC 4N8FA 5COYA 1GM5A 1SLJA 2KCTA 1EY6A 2OCEA 1JMCA 5AJ3Q 2SDFA 5KNCA 1WTWA 5CYUA 2F0OA 5C4ZA 4LF5L 4BWGB 1HFGA 5K5PA 3V2TA 1KLGD 4CJ2C 4LJZC 4PNYA 1W2BA 4K6DA 3C1EA 4IJHA 2KECA 3NEMA 1EY9A 3RZDB 5M3FH 1FJGL 1PZJD 1IBKQ 2JA5B 3FPUB 1XXGA 5E3FA 3OYYA 3D6CA 3K80C 4A3IG 3I4NH 3A74A 1X56A 2AQ2B 3HOWH 4KD4A 5BR8Q 1ASYA 2B2WC 5EAYA 3BZDB 3T1YQ 3KLWA 1FGBD 1QILA 2Z4IA 5HY6A 1NR4A 2KOLA 2FFKB 1ZXTA 2F0IA 3KDFA 3DEOA 1SMXA 4PMWA 3MC0B 1PTOB 2O5IC 2K5HA 2Q2IA 1K73C 3QJYA 2F0UA 4K8JA 2L9HA 4NKLA 2O5JC 2PZUA 1GUGA 1FL0A 1O7LA 1YHBA 1E7ZA 2K5NA 1JQYD 4YCWA 2E2IB 4OO1G 2KUMA 3S2DB 3D8GA 3IAYA 1L1OB 5KYLA 1DCZA 4FF3A 4BY7H 2YV5A 1STGA 5CBEE 1DZ1A 2TSSA 2ZTEA 5L37A 3ITPA 1X3PA 4C3IB 1HA6A 3KYHC 4LK1C 1VQPA 1PYWD 2EPBA 1EYCA 2JSOA 4JW0A 1IHZA 3KF6B 1SYFA 1KRTA 2KEDA 3J7AV 3BVMA 1RTNA 2MGSA 4OEMB 2B8GA 1HPCA 3BYYB 3UDGA 2CW0D 4GKKL 4NB3A 3CMAA 3OMGA 3K0YA 3CC2A 2K14A 2QA4A 3ULJA 2EYOA 3J7ZC 3NTIA 3RNUA 4X65L 4KN4C 3NP8A 2DJGC 1TT2A 4E6IA 2GVBA 2EJMA 3CPFA 4B3ML 1JOKA 4P71A 1RKNA 1TS2A 3NQTA 2YTYA 3NPPA 4DV4Q 3RZOB 4G7ZC 4KN7C 2CKZB 3HOZH 1CKOA 1OXUA 4N9PA 1KRSA 3PO2H 1X3FA 2VS1A 3A8JE 3SEBA 1GKHA 1I50B 1YZ6A 1G51A 4TQUS 4J8QA 4LFAQ 1E3PA 5E7NA 4DUZL 5IWAL 3PF5A 3FDTA 2B2YC 2O4XA 4K2KA 1HUNA 3BVZA 1J9OA 4JC0A 3TS0A 4B3RQ 2B2VC 4QCLA 2UXBQ 1TKWB 1PA6A 5JPNC 4G7OC 1VQ8A 2CVRA 4CDEC 1DXMA 4U68A 1HJPA 2SNMA 1VQDA 1STAA 3PF4A 2YTXA 1KHIA 1K8AC 3SE0A 1I6HH 4JBJA 1DJRD 3HOYH 5LL6S 1L0WA 3VDYA 3TQYA 3NE5B 3I8ZA 4GN5A 2MQHA 3NWTA 4RMFA 2Q2HA 2D9UA 3I4LA 1VQHA 4GNXB 1CQVA 2PMZE 4KHVA 5AFWA 1PRTF 1EY5A 1PH1A 1SN8A 2QF7A 3I4MB 3G6EA 3Q0AA 2WAQB 4OL7A 3NBIA 1VMCA 4GZYC 3U58A 1CFMA 2ZXPA 1HCZA 4C3IG 1SNQA 3MFYA 3HGBA 3KJOA 1U0LA 3NBHA 4BY1B 4LF4L 1PRTD 2CH4W 3H15A 1V8QA 4NXMQ 5IGDA 5IYCG 4QUFA 1YNJC 1LABA 3LGJA 3GTGH 1TS4A 1HNZL 4DXFA 2R7ZB 1LTGD 2SEBD 2XRQD 1K3RA 3DM3A 1A63A 1F2YA 3OTOL 1BF4A 5D3IB 2HQLA 1N32L 2E2HH 3J81j 4P2CB 2AHOB 4LMQD 3RD4A 5I9OA 1N9WA 3MZ5A 1STYA 1PXUA 3Q23A 4DV1Q 4HSVA 3MAQA 1JORA 1M90C 1SE8A 1PFNA 1EY8A 4FXKC 4KY6A 4LAAA 2K05A 4DR2Q 1EIGA 3UDFA 2PQEA 1SE2A 3CCEA 3A55A 1VQFA 2D0PA 1STEA 5BN3A 4X66L 2X69A 4DR5Q 1X3GA 2HD3A 2IY5B 4HMIA 2Q2TA 5FO9B 1X55A 2PCFB 5IIFA 3P7JA 4JYAQ 2R3ZA 4A3KB 3OOCA 4XT1B 4L5SA 1PTOC 1LO5D 5ELCA 4A3LG 2WB1E 3UE0A 5KGUA 2VUMB 1EEFD 3HZXA 3K59A 2UUAQ 3D3RA 1LV9A 1Y1WH 3VR4A 1QZGA 3M9BA 5I2YA 1G6PA 2IHFA 1L1OC 2IJ0A 3K81C 1EYDA 2BH8A 5I9PA 3AFQA 4MNOA 1HNXQ 5C3EH 4OGQC 4GOPB 2NN6H 1XTDA 3K6OA 1E22A 1YEZA 2IL8A 3TMEA 3PUXA 2EOTA 1XNQL 3M3YH 2N55A 2A73B 3U4VA 3I4MG 3FPPA 3G48A 5C0XH 1EWIA 4A3MB 4YIJA 5M3FB 2K5VA 1E0BA 4AH6A 1PRTB 5I6WA 3MXGA 4JI2L 1EY0A 3I4NB 3S2HH 3HOWB 1NMGA 1C7YA 1N34Q 3NQIA 4EQ5A 4GLVB 3OW7A 3OWFA 4O2DA 3RLNA 3G4SA 1PH2A 4PZ8A 1FVIA 4IUVA 1ET6A 3NSWA 4QIWB 4IFDG 2NVTH 4IPHA 2V4DA 4IQZA 4DNTB 4L6TB 4DR6L 5C44G 1ESRA 5CV7A 2K5DA 2VB3X 4ZK9B 1ZYRD 3NXWA 4YCVA 2VQEQ 3CAMA 3RR5A 1H9MA 5H1SE 1MBYA 1TWFH 4F8MA 4YY3Q 1JR0D 4FXGC 3MFGA 4BY7B 2ICEC 3NBHB 1DGSA 1CTMA 3PIOA 2KCNA 1NNXA 3BDCA 2BE5C 1MJCA 2K6AA 2SOBA 1HR0W 1T9HA 1VQJA 2VB2X 4LFBL 1NTGA 1UNSA 5M3MG 3J81c 4LF6Q 4A3KG 1PH6A 1QVCA 1MGSA 1D8LA 3I55A 4JOIC 4R4TA 1IKLA 1O7IA 1ONLA 1FYCA 4RKLA 4JBWA 2B2UC 4XYOA 4F88A 2B63H 2CH4A 1EL0A 1JOQA 3UDXA 4GNXC 1KDBA 4GS3A 1KNEA 4R9WA 1XMOQ 2JYOA
chains in the Genus database with same CATH topology
2ZTCA 5GAEC 4YCUA 3GTMH 2JJQA 4LUZA 1CKMA 4DR3L 1EOVA 1IBMQ 2PI2A 1N8RC 2Y0SE 2ZJPA 1IL2A 3RN2A 4DUYQ 3A5UA 1JE5A 2ZM6L 1J5EQ 5JEAG 3CW2C 1WFQA 4WJ4A 1VQIA 4BA1I 1E24A 4P73A 5M5YH 3PIPA 4LF5Q 4A3MG 2E2JH 2JQOA 3DLLA 4JI6L 4DR7L 4HJ9A 4HJ8A 2CWPA 3TREA 1M1KC 2R93H 3MXNB 3I4MH 1VQGA 1P8LA 3I4NG 4DR1L 3GTLH 4A93G 4O0AA 4JI8L 1N34L 4LF8Q 1B70B 1UWVA 2IX1A 1SR3A 3HKZG 1K83H 3PSIA 4RG1A 3L2PA 4HIOA 1S40A 1VQNA 2AMCB 1P16A 2UXCQ 1FJGQ 2UU9L 1AE2A 4A3GG 3CCVA 2N8NA 3JAMc 4DV0Q 1D7QA 4BY1H 3AYHB 4DK6C 3AFPA 4IFDJ 1UE5A 1Q1BA 1RIPA 3FKIH 2K52A 3F2CA 2DUDA 2R7ZH 1HNWQ 1Q12A 2VQEL 1VQ6A 4B3TL 2KHIA 3TS2A 4R4IA 3W1GA 2IT1A 2K75A 2AWOA 4YHHQ 1ASZA 4A3FH 3KFUA 4YY3L 3GD7A 4DV6L 1YI2A 2ATWA 3HKZE 1YJWA 4BXXH 1QUQB 4YWLA 2RHQB 2VQFQ 2L15A 4C2MH 3JC66 2OQKA 1R9TH 5ELNA 2R93G 1GVPA 1OXTA 2PNHA 3I7FA 1KC8C 2HIVA 4BBSG 2WAQG 2NVXH 3EIVA 4BY7G 5IYDH 4JV5Q 5JJIA 4QIWE 2Z0SA 4GKJL 2GN5A 1VQ4A 3U4ZA 3S1QH 1E1OA 2RHSB 3KJPA 1I94Q 1C9OA 1VQAA 4XTCS 4BY1G 3S1RH 1YIJA 4HIKA 1XMQL 4LF6L 2A1AA 3E9HA 3HOUH 4IOAA 2LXKA 1IBKL 3GTKH 1A8VA 1U5KA 3BZCA 5ELOA 4GOPA 2BA1A 2R7ZG 1JJGA 4JI1L 4IFDI 2JE6I 4DV5Q 2I5MX 2R92G 1VQCA 2ZJQA 4R4CA 2WAQE 4A3KH 1W3SA 4GOPC 1N36Q 1WCMH 4X62L 2E5LQ 1KAWA 1LTLA 4LF9Q 4BXXG 4P72A 2FXQA 4QL5A 4HJ7A 3T1HQ 2UUBL 4A3IH 1XMOL 5C0XI 3CCRA 4R1JA 4GKKQ 2LXJA 4JI3Q 1NY4A 3F1ZA 1PHJA 5IYDG 4A3EH 2VUMH 2R6GA 3H0GH 5IE8A 2CCZA 4NXNL 1IBML 1G291 1GM5A 1SLJA 1TWAH 2KCTA 4X65Q 4DUYL 2OCEA 5HGQA 1JMCA 2KHJA 2AWNA 5AJ3Q 1J5EL 2A19A 3KF8B 1N33L 1VS0A 3HOZG 4LUVA 1PH3A 1X65A 3Q8DA 4LF5L 3F2BA 4B3MQ 4UP7A 3PO2G 3HOUG 5IYBH 2ALYB 1W2BA 4OWTB 4LF8L 2WP8J 4GN3B 1I5FA 4IJHA 1HH2P 3NEMA 2KBNA 3GO5A 1UE6A 1LYLA 1MIUA 5M3FH 1FJGL 2VL6A 2UXCL 1JJ2A 3I4OA 1E1TA 3RLFA 1IBKQ 1PH7A 3D0FA 1K9MC 3AEVA 4LNQA 3OYYA 3K80C 4A3IG 4HJ5A 3I4NH 3A74A 3BU2A 3PCOB 4DV0L 2EQSA 1X56A 5IWAQ 4DUZQ 3HOWH 4A93H 5BR8Q 4A3EG 2VUMG 3CD6A 2F3IA 1ASYA 1TWHH 5EAYA 2XTIA 1Q82C 1Y1VH 4JI7Q 1HNWL 3T1YQ 3KLWA 4A3GH 1PFSA 2PQAA 4XIGS 2H5XA 2EXDA 4DR4Q 5DLQE 5HY6A 4YHHL 1CKNA 2V1CC 4KLKA 4IJLA 1HR0Q 1OTCA 1EFWA 3CC4A 4NXNQ 3S1NH 3KDFA 2VQFL 4DV3Q 5IYBG 1SMXA 4PMWA 1N33Q 1PYBA 2K5HA 4DV2Q 3OW2A 3K8AA 1EQQA 2Q2IA 1NE3A 4LWCA 1K73C 3WWVA 2F4VL 2MO0A 4JV5L 1BVSA 2A8VA 5GROA 1PVOA 3L0OA 2K5NA 1FL0A 1YHBA 2IHEA 1E7ZA 5M3FG 5LMUQ 4YCWA 4OO1I 4OO1G 5FLXc 4JBMA 1VQBA 4WJ3M 3HOXH 3MEFA 1I94L 4BBSH 3BZKA 4A4IA 3HOWG 1L1OB 2RF4A 4BY7H 2N49A 5K36G 2YV5A 2JA6H 1WJJA 3NELA 3ER0A 1IBLQ 4DNIA 5M5XH 1Y1VG 3HFZB 1QVGA 4LUOA 1KD1C 2ZTEA 3NENA 4C3JH 1Z47A 4DV5L 3KYHC 2KENA 5GAHC 1VQPA 3K7UC 4DAMA 1PH5A 2ES2A 3KF6B 4H02A 1N36L 1KRTA 4LF9L 2E5LL 2UXDQ 1XPUA 3EN2A 4LF4Q 3T1HL 1NJIC 3CMEA 3CCLA 3UDGA 2R92H 4GKKL 4QQBX 4NB3A 3CMAA 4JI3L 2KCMA 4POGA 3CC2A 1HNZQ 2K14A 4QY7A 2QA4A 5C4XH 1V43A 3ULJA 3J7ZC 3RNUA 4KHPQ 5FLMG 4X65L 3TRZA 4DV7Q 3GTPH 2ZTDA 2GVAA 5AJ3L 1OXXK 4GLXA 3OTOQ 3M7NA 4P74A 2I5LX 3HOXG 2GVBA 4BBRG 1KL9A 4A76A 3J7A5 1N32Q 1S72A 3CPFA 2F4VQ 4L5TA 3ZJYC 2JA6G 4B3ML 4A3CH 4P71A 3K0XA 2YTYA 4OWXB 4DV4Q 4X64Q 1CUKA 4PG3A 3D31A 4JI0L 2CKZB 3HOZH 4IOCA 1CKOA 1OXUA 3GDEA 4GN4B 1KRSA 4IPCA 2NVYH 3PO2H 1X3FA 2VS1A 2CFMA 1FGUA 2VW9A 3CP0A 2N3SA 1HZAA 3ULLA 1GKHA 1YHQA 2Q2UA 1XNRQ 5C4JH 2R7FA 2LSSA 1YZ6A 1QVFA 1G51A 1K8GA 1X54A 4TQUS 4LFAQ 1B8AA 1E3PA 5E7NA 5JJKA 4DUZL 1PYSB 5IWAL 3PF5A 2VNUD 2QEXA 1UEBA 2YTVA 5BR8L 4KHZA 1QUQA 1AH9A 3PGZA 3K7AH 4JC0A 3TS0A 4B3RQ 5C4XG 3M4QA 2YYZA 4J15A 4JI7L 3T1YL 2UXBQ 1PA6A 1OXSC 4A3DH 1VQ8A 4UY8C 1BBWA 1K0RA 4DR4L 1HJPA 3J80i 2RCNA 1VQDA 1HR0L 5LMNQ 2K4KA 1X6OA 2BH2A 3PF4A 3A0JA 2YTXA 4A3CG 4JG2A 1KHIA 4QGUA 5GADC 4DV3L 1K8AC 1QZHA 3PO3H 1I6HH 4JBJA 1X3EA 5C3EG 4DV2L 2NN6G 3HOYH 1VQOA 1L0WA 3GTOH 4LW1A 3VDYA 4IO9A 1EUJA 5GQOA 3TQYA 3UE1A 2MQHA 1IZ6A 2JK8A 4GN5A 3W5OA 5LMUL 4RMFA 2NZOA 2JA8H 2Q2HA 1I3QH 1VQHA 4GNXB 3E9IA 4JI0Q 2PMZE 2UUCL 3S24A 2PI2E 4APVA 4B3SQ 5IT9c 2CQOA 1PH1A 1SN8A 1Q81C 1YNXA 4R4QA 1XNQQ 1EQRA 1IBLL 4X6AH 3STBC 3G6EA 1TWGH 1YJNA 3F8TA 1VQEA 2QGQA 1YHAA 4UP8A 4YWKA 2PQAB 3U58A 1PH8A 1PV4A 4QJFA 5IP9H 4PZ6A 1VQ5A 1CKNB 2UXDL 4JI2Q 1KXLA 4A3JG 3KJOA 1U0LA 4KI0A 4Y7NH 4LF4L 3PO3G 1UE7A 3H15A 4NXMQ 5IYCG 2JA7G 1VQKA 4L5QA 2JEAI 3HOYG 3LGJA 3PUWA 3GTGH 3HKSA 1HNZL 1CSQA 4KHPL 1SFOH 3E0EA 1S3OA 3U50C 5M5WH 3RLOA 4DV7L 2JA8G 4UPAA 1K3RA 1HZ9A 3DM3A 1A63A 3OTOL 4JCVE 2HQLA 3M85A 1N32L 2E2HH 3J81j 4DR6Q 4DPGA 3CCSA 2HHHQ 2AHOB 5FLMH 4A3LH 1N9WA 3STBD 4DV4L 1VQ7A 1BBUA 1Q8KA 1SRUA 1KQSA 4X64L 4DV1Q 3ICEA 3CCMA 4BBRH 2JA9A 2UUCQ 1YVCA 1M90C 1IXRA 1SE8A 4OONA 5IP9G 2WB1G 1XNRL 2IX0A 4DR2Q 3ERSX 4JI4Q 1PH9A 4P75A 3UDFA 3PV0A 2MNAA 1PH4A 4K0KL 4LFAL 1GO3E 3CCEA 2YU9H 1C0AA 1VQFA 2D0PA 2ZJRA 3J81i 1J6QA 1WOCA 4JI5Q 4B3RL 1YITA 3BJUA 4X66L 4LFCQ 4DR5Q 1X3GA 4OX9Q 4A3BH 4LFBQ 2IY5B 2Q2TA 3HOVG 1NMFA 3M4OH 2UXBL 1X55A 3RZDH 2JA5H 1Q7YC 4JYAQ 4POFA 1X9NA 1Q1EA 4UP9A 3GTQH 3IRBA 2B63G 2OWOA 3S14H 3W1BA 5LMNL 1WI5A 4L5SA 4A3LG 2WB1E 4AQYQ 2B29A 4DK3C 1XJVA 3RN5A 3UE0A 1SROA 4JBKA 1L1OA 5FJ8H 1KIXA 2HT1A 2UUAQ 4HIDA 3J80c 1Y1WH 4A3DG 4MTNA 4OWWB 1QZGA 2OQ0A 3M9BA 4NPSA 2NVQH 4GLAC 1G6PA 2IHFA 1EIYB 1CSPA 1L1OC 3K81C 1MKHA 2BH8A 3AFQA 4MNOA 1HNXQ 5C3EH 4GOPB 4DKAC 1XTDA 1UE1A 5JJLA 1E22A 3KF6A 1YEZA 4B3SL 1V1QA 4DR3Q 5C0XJ 2ID0A 1IYJB 3PUXA 5C44H 1TWCH 4PZ7A 1VQ9A 5IY0A 3S17H 3CPWA 1XNQL 2VY3A 3M3YH 1EYGA 2BA0A 4A3BG 3U4VA 2ZM6Q 2I0QA 3I4MG 3G48A 4K0KQ 1EWIA 3I2ZA 1MJEA 2JA5G 2E2IH 2K5VA 1OXVA 3PUYA 3S2DH 4AH6A 1JT8A 3B6YA 4DR7Q 5LMNW 4JI6Q 4X66Q 4JI2L 3CCQA 3S2HH 1NMGA 4DAYB 5GAGC 1C7YA 4NXML 1EIFA 3S1MH 3JAMi 5FJ8G 4DR1Q 4L5RC 2I5HA 4JI8Q 1N34Q 1XPOA 3ULPA 1Y1WG 4C3IH 4EQ5A 1VQMA 1BKBA 3I56A 4GLVB 4O2DA 3RLNA 2CWAA 3CXCA 3G4SA 3S16H 4A3JH 4OXPA 3FKIG 1AE3A 3KOJA 1PH2A 4AYBG 4PZ8A 1FVIA 3L7ZC 4EX5A 1VQLA 2UU9Q 2N78A 3PUZA 3EBEA 2E8GA 5IYCH 1XPRA 2JA7H 4IFDG 2NN6I 4AIMA 2NVTH 4IPHA 1H95A 5M3MH 2Z6KA 4DR6L 3AQQA 2MO1A 3GTJH 2HHHL 2D0OA 2R7DA 4A3FG 4IPDA 5C44G 2ASBA 3CCJA 4LF7L 2OTLA 1Q46A 3CCUA 4YCVA 2VQEQ 1RL2A 4DV1L 3H3VH 1HZCA 3CAMA 2Z6KC 5J3BA 5C0XG 3F2DA 3RR5A 4B3TQ 4FDBA 1GD7A 4YWMA 5H1SE 1LM0A 1TWFH 2OTJA 4YY3Q 4DV6Q 2NZHA 1YJ9A 5IP7H 4DR2L 4JI4L 3A5ZB 3G71A 3CQZH 3TEHB 1HZBA 3NBHB 2AKWB 1DGSA 4AYBE 3PIOA 2DGYA 3CC7A 3S15H 2EIFA 3RZOH 3PUVA 4BA2I 1Y14B 2B3GA 3SGIA 5JEAJ 1MJCA 4JI5L 4HJAA 4HIMA 4LFCL 1JB7A 1HR0W 1T9HA 1VQJA 4DR5L 4OX9L 4GKJQ 4LFBL 1V9PA 1LUZA 3KDFB 1NTGA 1YBYA 1B7YB 4IPGA 2D62A 2F52A 4JOIA 4C3HH 4ALPA 1A0IA 1I50H 2WFWA 4JYAL 4Y52H 1Z9FA 2VZAA 5M3MG 1XMQQ 4A3MH 3J81c 4LF6Q 2Y0SG 4A3KG 3CF5A 1PH6A 1VCIA 1QVCA 1WCMG 2XGTA 4R4OA 1D8LA 3I55A 4AQYL 3FHWA 4JOIC 3HOVH 4R4TA 4GNXA 1O7IA 3H3VI 4JI1Q 2C35B 2MFIA 1Q86C 4MZ9A 2UUAL 2B63H 4A75A 4JBWA 1NBWA 4TVAB 2JEBI 1TXYA 1A62A 3FP9A 1L2FA 3H0GG 3M4PA 2HIXA 3UDXA 4X62Q 4GNXC 4ME3A 4LF7Q 1WYDA 4GS3A 5IP7G 1JJCB 2K50A 1HNXL 2UUBQ 1XMOQ 3UDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTC A;  5GAE C;  4YCU A;  3GTM H;  2JJQ A;  4LUZ A;  1CKM A;  4DR3 L;  1EOV A;  1IBM Q;  2PI2 A;  1N8R C;  2Y0S E;  2ZJP A;  1IL2 A;  3RN2 A;  4DUY Q;  3A5U A;  1JE5 A;  2ZM6 L;  1J5E Q;  5JEA G;  3CW2 C;  1WFQ A;  4WJ4 A;  1VQI A;  4BA1 I;  1E24 A;  4P73 A;  5M5Y H;  3PIP A;  4LF5 Q;  4A3M G;  2E2J H;  2JQO A;  3DLL A;  4JI6 L;  4DR7 L;  4HJ9 A;  4HJ8 A;  2CWP A;  3TRE A;  1M1K C;  2R93 H;  3MXN B;  3I4M H;  1VQG A;  1P8L A;  3I4N G;  4DR1 L;  3GTL H;  4A93 G;  4O0A A;  4JI8 L;  1N34 L;  4LF8 Q;  1B70 B;  1UWV A;  2IX1 A;  1SR3 A;  3HKZ G;  1K83 H;  3PSI A;  4RG1 A;  3L2P A;  4HIO A;  1S40 A;  1VQN A;  2AMC B;  1P16 A;  2UXC Q;  1FJG Q;  2UU9 L;  1AE2 A;  4A3G G;  3CCV A;  2N8N A;  3JAM c;  4DV0 Q;  1D7Q A;  4BY1 H;  3AYH B;  4DK6 C;  3AFP A;  4IFD J;  1UE5 A;  1Q1B A;  1RIP A;  3FKI H;  2K52 A;  3F2C A;  2DUD A;  2R7Z H;  1HNW Q;  1Q12 A;  2VQE L;  1VQ6 A;  4B3T L;  2KHI A;  3TS2 A;  4R4I A;  3W1G A;  2IT1 A;  2K75 A;  2AWO A;  4YHH Q;  1ASZ A;  4A3F H;  3KFU A;  4YY3 L;  3GD7 A;  4DV6 L;  1YI2 A;  2ATW A;  3HKZ E;  1YJW A;  4BXX H;  1QUQ B;  4YWL A;  2RHQ B;  2VQF Q;  2L15 A;  4C2M H;  3JC6 6;  2OQK A;  1R9T H;  5ELN A;  2R93 G;  1GVP A;  1OXT A;  2PNH A;  3I7F A;  1KC8 C;  2HIV A;  4BBS G;  2WAQ G;  2NVX H;  3EIV A;  4BY7 G;  5IYD H;  4JV5 Q;  5JJI A;  4QIW E;  2Z0S A;  4GKJ L;  2GN5 A;  1VQ4 A;  3U4Z A;  3S1Q H;  1E1O A;  2RHS B;  3KJP A;  1I94 Q;  1C9O A;  1VQA A;  4XTC S;  4BY1 G;  3S1R H;  1YIJ A;  4HIK A;  1XMQ L;  4LF6 L;  2A1A A;  3E9H A;  3HOU H;  4IOA A;  2LXK A;  1IBK L;  3GTK H;  1A8V A;  1U5K A;  3BZC A;  5ELO A;  4GOP A;  2BA1 A;  2R7Z G;  1JJG A;  4JI1 L;  4IFD I;  2JE6 I;  4DV5 Q;  2I5M X;  2R92 G;  1VQC A;  2ZJQ A;  4R4C A;  2WAQ E;  4A3K H;  1W3S A;  4GOP C;  1N36 Q;  1WCM H;  4X62 L;  2E5L Q;  1KAW A;  1LTL A;  4LF9 Q;  4BXX G;  4P72 A;  2FXQ A;  4QL5 A;  4HJ7 A;  3T1H Q;  2UUB L;  4A3I H;  1XMO L;  5C0X I;  3CCR A;  4R1J A;  4GKK Q;  2LXJ A;  4JI3 Q;  1NY4 A;  3F1Z A;  1PHJ A;  5IYD G;  4A3E H;  2VUM H;  2R6G A;  3H0G H;  5IE8 A;  2CCZ A;  4NXN L;  1IBM L;  1G29 1;  1GM5 A;  1SLJ A;  1TWA H;  2KCT A;  4X65 Q;  4DUY L;  2OCE A;  5HGQ A;  1JMC A;  2KHJ A;  2AWN A;  5AJ3 Q;  1J5E L;  2A19 A;  3KF8 B;  1N33 L;  1VS0 A;  3HOZ G;  4LUV A;  1PH3 A;  1X65 A;  3Q8D A;  4LF5 L;  3F2B A;  4B3M Q;  4UP7 A;  3PO2 G;  3HOU G;  5IYB H;  2ALY B;  1W2B A;  4OWT B;  4LF8 L;  2WP8 J;  4GN3 B;  1I5F A;  4IJH A;  1HH2 P;  3NEM A;  2KBN A;  3GO5 A;  1UE6 A;  1LYL A;  1MIU A;  5M3F H;  1FJG L;  2VL6 A;  2UXC L;  1JJ2 A;  3I4O A;  1E1T A;  3RLF A;  1IBK Q;  1PH7 A;  3D0F A;  1K9M C;  3AEV A;  4LNQ A;  3OYY A;  3K80 C;  4A3I G;  4HJ5 A;  3I4N H;  3A74 A;  3BU2 A;  3PCO B;  4DV0 L;  2EQS A;  1X56 A;  5IWA Q;  4DUZ Q;  3HOW H;  4A93 H;  5BR8 Q;  4A3E G;  2VUM G;  3CD6 A;  2F3I A;  1ASY A;  1TWH H;  5EAY A;  2XTI A;  1Q82 C;  1Y1V H;  4JI7 Q;  1HNW L;  3T1Y Q;  3KLW A;  4A3G H;  1PFS A;  2PQA A;  4XIG S;  2H5X A;  2EXD A;  4DR4 Q;  5DLQ E;  5HY6 A;  4YHH L;  1CKN A;  2V1C C;  4KLK A;  4IJL A;  1HR0 Q;  1OTC A;  1EFW A;  3CC4 A;  4NXN Q;  3S1N H;  3KDF A;  2VQF L;  4DV3 Q;  5IYB G;  1SMX A;  4PMW A;  1N33 Q;  1PYB A;  2K5H A;  4DV2 Q;  3OW2 A;  3K8A A;  1EQQ A;  2Q2I A;  1NE3 A;  4LWC A;  1K73 C;  3WWV A;  2F4V L;  2MO0 A;  4JV5 L;  1BVS A;  2A8V A;  5GRO A;  1PVO A;  3L0O A;  2K5N A;  1FL0 A;  1YHB A;  2IHE A;  1E7Z A;  5M3F G;  5LMU Q;  4YCW A;  4OO1 I;  4OO1 G;  5FLX c;  4JBM A;  1VQB A;  4WJ3 M;  3HOX H;  3MEF A;  1I94 L;  4BBS H;  3BZK A;  4A4I A;  3HOW G;  1L1O B;  2RF4 A;  4BY7 H;  2N49 A;  5K36 G;  2YV5 A;  2JA6 H;  1WJJ A;  3NEL A;  3ER0 A;  1IBL Q;  4DNI A;  5M5X H;  1Y1V G;  3HFZ B;  1QVG A;  4LUO A;  1KD1 C;  2ZTE A;  3NEN A;  4C3J H;  1Z47 A;  4DV5 L;  3KYH C;  2KEN A;  5GAH C;  1VQP A;  3K7U C;  4DAM A;  1PH5 A;  2ES2 A;  3KF6 B;  4H02 A;  1N36 L;  1KRT A;  4LF9 L;  2E5L L;  2UXD Q;  1XPU A;  3EN2 A;  4LF4 Q;  3T1H L;  1NJI C;  3CME A;  3CCL A;  3UDG A;  2R92 H;  4GKK L;  4QQB X;  4NB3 A;  3CMA A;  4JI3 L;  2KCM A;  4POG A;  3CC2 A;  1HNZ Q;  2K14 A;  4QY7 A;  2QA4 A;  5C4X H;  1V43 A;  3ULJ A;  3J7Z C;  3RNU A;  4KHP Q;  5FLM G;  4X65 L;  3TRZ A;  4DV7 Q;  3GTP H;  2ZTD A;  2GVA A;  5AJ3 L;  1OXX K;  4GLX A;  3OTO Q;  3M7N A;  4P74 A;  2I5L X;  3HOX G;  2GVB A;  4BBR G;  1KL9 A;  4A76 A;  3J7A 5;  1N32 Q;  1S72 A;  3CPF A;  2F4V Q;  4L5T A;  3ZJY C;  2JA6 G;  4B3M L;  4A3C H;  4P71 A;  3K0X A;  2YTY A;  4OWX B;  4DV4 Q;  4X64 Q;  1CUK A;  4PG3 A;  3D31 A;  4JI0 L;  2CKZ B;  3HOZ H;  4IOC A;  1CKO A;  1OXU A;  3GDE A;  4GN4 B;  1KRS A;  4IPC A;  2NVY H;  3PO2 H;  1X3F A;  2VS1 A;  2CFM A;  1FGU A;  2VW9 A;  3CP0 A;  2N3S A;  1HZA A;  3ULL A;  1GKH A;  1YHQ A;  2Q2U A;  1XNR Q;  5C4J H;  2R7F A;  2LSS A;  1YZ6 A;  1QVF A;  1G51 A;  1K8G A;  1X54 A;  4TQU S;  4LFA Q;  1B8A A;  1E3P A;  5E7N A;  5JJK A;  4DUZ L;  1PYS B;  5IWA L;  3PF5 A;  2VNU D;  2QEX A;  1UEB A;  2YTV A;  5BR8 L;  4KHZ A;  1QUQ A;  1AH9 A;  3PGZ A;  3K7A H;  4JC0 A;  3TS0 A;  4B3R Q;  5C4X G;  3M4Q A;  2YYZ A;  4J15 A;  4JI7 L;  3T1Y L;  2UXB Q;  1PA6 A;  1OXS C;  4A3D H;  1VQ8 A;  4UY8 C;  1BBW A;  1K0R A;  4DR4 L;  1HJP A;  3J80 i;  2RCN A;  1VQD A;  1HR0 L;  5LMN Q;  2K4K A;  1X6O A;  2BH2 A;  3PF4 A;  3A0J A;  2YTX A;  4A3C G;  4JG2 A;  1KHI A;  4QGU A;  5GAD C;  4DV3 L;  1K8A C;  1QZH A;  3PO3 H;  1I6H H;  4JBJ A;  1X3E A;  5C3E G;  4DV2 L;  2NN6 G;  3HOY H;  1VQO A;  1L0W A;  3GTO H;  4LW1 A;  3VDY A;  4IO9 A;  1EUJ A;  5GQO A;  3TQY A;  3UE1 A;  2MQH A;  1IZ6 A;  2JK8 A;  4GN5 A;  3W5O A;  5LMU L;  4RMF A;  2NZO A;  2JA8 H;  2Q2H A;  1I3Q H;  1VQH A;  4GNX B;  3E9I A;  4JI0 Q;  2PMZ E;  2UUC L;  3S24 A;  2PI2 E;  4APV A;  4B3S Q;  5IT9 c;  2CQO A;  1PH1 A;  1SN8 A;  1Q81 C;  1YNX A;  4R4Q A;  1XNQ Q;  1EQR A;  1IBL L;  4X6A H;  3STB C;  3G6E A;  1TWG H;  1YJN A;  3F8T A;  1VQE A;  2QGQ A;  1YHA A;  4UP8 A;  4YWK A;  2PQA B;  3U58 A;  1PH8 A;  1PV4 A;  4QJF A;  5IP9 H;  4PZ6 A;  1VQ5 A;  1CKN B;  2UXD L;  4JI2 Q;  1KXL A;  4A3J G;  3KJO A;  1U0L A;  4KI0 A;  4Y7N H;  4LF4 L;  3PO3 G;  1UE7 A;  3H15 A;  4NXM Q;  5IYC G;  2JA7 G;  1VQK A;  4L5Q A;  2JEA I;  3HOY G;  3LGJ A;  3PUW A;  3GTG H;  3HKS A;  1HNZ L;  1CSQ A;  4KHP L;  1SFO H;  3E0E A;  1S3O A;  3U50 C;  5M5W H;  3RLO A;  4DV7 L;  2JA8 G;  4UPA A;  1K3R A;  1HZ9 A;  3DM3 A;  1A63 A;  3OTO L;  4JCV E;  2HQL A;  3M85 A;  1N32 L;  2E2H H;  3J81 j;  4DR6 Q;  4DPG A;  3CCS A;  2HHH Q;  2AHO B;  5FLM H;  4A3L H;  1N9W A;  3STB D;  4DV4 L;  1VQ7 A;  1BBU A;  1Q8K A;  1SRU A;  1KQS A;  4X64 L;  4DV1 Q;  3ICE A;  3CCM A;  4BBR H;  2JA9 A;  2UUC Q;  1YVC A;  1M90 C;  1IXR A;  1SE8 A;  4OON A;  5IP9 G;  2WB1 G;  1XNR L;  2IX0 A;  4DR2 Q;  3ERS X;  4JI4 Q;  1PH9 A;  4P75 A;  3UDF A;  3PV0 A;  2MNA A;  1PH4 A;  4K0K L;  4LFA L;  1GO3 E;  3CCE A;  2YU9 H;  1C0A A;  1VQF A;  2D0P A;  2ZJR A;  3J81 i;  1J6Q A;  1WOC A;  4JI5 Q;  4B3R L;  1YIT A;  3BJU A;  4X66 L;  4LFC Q;  4DR5 Q;  1X3G A;  4OX9 Q;  4A3B H;  4LFB Q;  2IY5 B;  2Q2T A;  3HOV G;  1NMF A;  3M4O H;  2UXB L;  1X55 A;  3RZD H;  2JA5 H;  1Q7Y C;  4JYA Q;  4POF A;  1X9N A;  1Q1E A;  4UP9 A;  3GTQ H;  3IRB A;  2B63 G;  2OWO A;  3S14 H;  3W1B A;  5LMN L;  1WI5 A;  4L5S A;  4A3L G;  2WB1 E;  4AQY Q;  2B29 A;  4DK3 C;  1XJV A;  3RN5 A;  3UE0 A;  1SRO A;  4JBK A;  1L1O A;  5FJ8 H;  1KIX A;  2HT1 A;  2UUA Q;  4HID A;  3J80 c;  1Y1W H;  4A3D G;  4MTN A;  4OWW B;  1QZG A;  2OQ0 A;  3M9B A;  4NPS A;  2NVQ H;  4GLA C;  1G6P A;  2IHF A;  1EIY B;  1CSP A;  1L1O C;  3K81 C;  1MKH A;  2BH8 A;  3AFQ A;  4MNO A;  1HNX Q;  5C3E H;  4GOP B;  4DKA C;  1XTD A;  1UE1 A;  5JJL A;  1E22 A;  3KF6 A;  1YEZ A;  4B3S L;  1V1Q A;  4DR3 Q;  5C0X J;  2ID0 A;  1IYJ B;  3PUX A;  5C44 H;  1TWC H;  4PZ7 A;  1VQ9 A;  5IY0 A;  3S17 H;  3CPW A;  1XNQ L;  2VY3 A;  3M3Y H;  1EYG A;  2BA0 A;  4A3B G;  3U4V A;  2ZM6 Q;  2I0Q A;  3I4M G;  3G48 A;  4K0K Q;  1EWI A;  3I2Z A;  1MJE A;  2JA5 G;  2E2I H;  2K5V A;  1OXV A;  3PUY A;  3S2D H;  4AH6 A;  1JT8 A;  3B6Y A;  4DR7 Q;  5LMN W;  4JI6 Q;  4X66 Q;  4JI2 L;  3CCQ A;  3S2H H;  1NMG A;  4DAY B;  5GAG C;  1C7Y A;  4NXM L;  1EIF A;  3S1M H;  3JAM i;  5FJ8 G;  4DR1 Q;  4L5R C;  2I5H A;  4JI8 Q;  1N34 Q;  1XPO A;  3ULP A;  1Y1W G;  4C3I H;  4EQ5 A;  1VQM A;  1BKB A;  3I56 A;  4GLV B;  4O2D A;  3RLN A;  2CWA A;  3CXC A;  3G4S A;  3S16 H;  4A3J H;  4OXP A;  3FKI G;  1AE3 A;  3KOJ A;  1PH2 A;  4AYB G;  4PZ8 A;  1FVI A;  3L7Z C;  4EX5 A;  1VQL A;  2UU9 Q;  2N78 A;  3PUZ A;  3EBE A;  2E8G A;  5IYC H;  1XPR A;  2JA7 H;  4IFD G;  2NN6 I;  4AIM A;  2NVT H;  4IPH A;  1H95 A;  5M3M H;  2Z6K A;  4DR6 L;  3AQQ A;  2MO1 A;  3GTJ H;  2HHH L;  2D0O A;  2R7D A;  4A3F G;  4IPD A;  5C44 G;  2ASB A;  3CCJ A;  4LF7 L;  2OTL A;  1Q46 A;  3CCU A;  4YCV A;  2VQE Q;  1RL2 A;  4DV1 L;  3H3V H;  1HZC A;  3CAM A;  2Z6K C;  5J3B A;  5C0X G;  3F2D A;  3RR5 A;  4B3T Q;  4FDB A;  1GD7 A;  4YWM A;  5H1S E;  1LM0 A;  1TWF H;  2OTJ A;  4YY3 Q;  4DV6 Q;  2NZH A;  1YJ9 A;  5IP7 H;  4DR2 L;  4JI4 L;  3A5Z B;  3G71 A;  3CQZ H;  3TEH B;  1HZB A;  3NBH B;  2AKW B;  1DGS A;  4AYB E;  3PIO A;  2DGY A;  3CC7 A;  3S15 H;  2EIF A;  3RZO H;  3PUV A;  4BA2 I;  1Y14 B;  2B3G A;  3SGI A;  5JEA J;  1MJC A;  4JI5 L;  4HJA A;  4HIM A;  4LFC L;  1JB7 A;  1HR0 W;  1T9H A;  1VQJ A;  4DR5 L;  4OX9 L;  4GKJ Q;  4LFB L;  1V9P A;  1LUZ A;  3KDF B;  1NTG A;  1YBY A;  1B7Y B;  4IPG A;  2D62 A;  2F52 A;  4JOI A;  4C3H H;  4ALP A;  1A0I A;  1I50 H;  2WFW A;  4JYA L;  4Y52 H;  1Z9F A;  2VZA A;  5M3M G;  1XMQ Q;  4A3M H;  3J81 c;  4LF6 Q;  2Y0S G;  4A3K G;  3CF5 A;  1PH6 A;  1VCI A;  1QVC A;  1WCM G;  2XGT A;  4R4O A;  1D8L A;  3I55 A;  4AQY L;  3FHW A;  4JOI C;  3HOV H;  4R4T A;  4GNX A;  1O7I A;  3H3V I;  4JI1 Q;  2C35 B;  2MFI A;  1Q86 C;  4MZ9 A;  2UUA L;  2B63 H;  4A75 A;  4JBW A;  1NBW A;  4TVA B;  2JEB I;  1TXY A;  1A62 A;  3FP9 A;  1L2F A;  3H0G G;  3M4P A;  2HIX A;  3UDX A;  4X62 Q;  4GNX C;  4ME3 A;  4LF7 Q;  1WYD A;  4GS3 A;  5IP7 G;  1JJC B;  2K50 A;  1HNX L;  2UUB Q;  1XMO Q;  3UDI A; 
#chains in the Genus database with same CATH topology
 5GAE C;  4CKC A;  3BG3 A;  4HED A;  2IWH A;  4KKU A;  3OIQ A;  3SR1 A;  3HOZ B;  4J6H A;  2ZM6 L;  3I90 A;  1WFQ A;  3PO2 B;  1Y8N B;  5C6A A;  4FXD A;  4A3M G;  3BDL A;  1CK1 A;  2JQO A;  3D4W A;  4DR7 L;  1BOS A;  3TRE A;  2R93 H;  1LTT D;  5J22 A;  3I4N G;  4LF8 Q;  4RG1 A;  3HKZ G;  1IYU A;  2H1E A;  4RGO S;  1VQN A;  1U4R A;  2AMC B;  1EFI D;  2UXC Q;  4B08 A;  4PV1 C;  3TSS A;  4NW2 A;  1JE4 A;  1TU2 B;  1RD9 D;  3D4R A;  3SK4 A;  4XT3 B;  1I6H B;  1Q1B A;  3FMC A;  4ILW A;  3F2C A;  2DUD A;  1YNN D;  3HOY B;  3IFT A;  3R3O A;  3TS2 A;  2F4I A;  3MWY W;  3A8I E;  3W1G A;  2A69 C;  5JAV A;  3GD7 A;  1EEI D;  4DV6 L;  2WKD A;  3NUC A;  4YWL A;  3C46 A;  4C2M H;  1R9T H;  5ELN A;  1GVP A;  2XNA C;  2LMC B;  3CKI B;  2F0M A;  3EIV A;  4BY7 G;  3QG1 A;  4JK1 C;  2Z0S A;  1EY7 A;  2IX3 A;  3D4D A;  2QDB A;  1R4P B;  1VQ4 A;  3S1Q H;  1Y8P B;  1I94 Q;  1C9O A;  1XMQ L;  2G9H D;  3DHQ A;  1Y1V B;  3DUZ A;  4IUN A;  2A1A A;  3E9H A;  1IBK L;  5ELO A;  3GTG B;  4IFD I;  2JE6 I;  4DV5 Q;  2I5M X;  1VQC A;  2ZJQ A;  3DWQ A;  4GOP C;  2E5L Q;  5D3D A;  4QL5 A;  1T5X D;  1F77 A;  2IW3 A;  2E2H B;  4KJN A;  3FVQ A;  1ICF B;  2LXJ A;  4IUT A;  1NY4 A;  5IYD G;  4A3E H;  2CCZ A;  1IBM L;  1G29 1;  4UDU C;  2MUY A;  1PZK D;  2KQ3 A;  4H7B A;  4O42 A;  1LTA D;  4DUY L;  3T51 B;  2AWN A;  2KHJ A;  1LLR D;  3KF8 B;  1VS0 A;  1O7Y A;  3E6Z X;  3HOZ G;  1AZP A;  3Q8D A;  4CDF C;  2C9O A;  2F0H A;  5G3L F;  3F2B A;  4ZYS A;  4UP7 A;  3PO2 G;  3V05 A;  4H44 C;  2WP8 J;  4GN3 B;  4DA2 A;  4FNF A;  3ONA B;  1HH2 P;  1MIU A;  2EY2 A;  1LT5 D;  3SXH A;  1E1T A;  5DM6 3;  1PH7 A;  1K9M C;  3C1F A;  5G3L D;  2M00 A;  1IYV A;  3NWS A;  4RH6 A;  3LWU A;  1F9Q A;  2XTI A;  4Q5V A;  3JAM E;  2I46 A;  4A3G H;  1Y1W B;  2PQA A;  4XIG S;  2H5X A;  2F0E A;  4DR4 Q;  1WTQ A;  2V1C C;  1HR0 Q;  5EPK A;  4IJL A;  1OTC A;  1FNW A;  4NXN Q;  5C3E B;  1QCB D;  1ET9 A;  4IUU A;  5KNB A;  5IYB G;  4DV3 Q;  1IW7 D;  1N33 Q;  4FF2 A;  3KLS A;  4HCS A;  5COR A;  5BN5 A;  3M3Y B;  5GRO A;  1PVO A;  3L0O A;  2IHE A;  5LMU Q;  1VF5 C;  4JBM A;  4K2L A;  3HOX H;  1NSN S;  5DAU A;  4A4I A;  2A74 C;  2K33 A;  2N49 A;  3U9O A;  3S2H B;  5ELE A;  1S5B D;  1I4P A;  2EYP A;  1IBL Q;  4ZUJ A;  5M5X H;  1Y1V G;  1CQF A;  4LUO A;  3NEN A;  1U4L A;  4BS9 A;  4H02 A;  1T5E A;  2HUG A;  3EN2 A;  2NVT B;  3A8K E;  2QIL A;  3CME A;  3H6M A;  1SJH D;  4QQB X;  2F0V A;  4JI3 L;  2KCM A;  1II3 A;  4KHP Q;  1V43 A;  1CZG A;  1ESF A;  3VYU A;  3TRZ A;  4DV7 Q;  2ZTD A;  2GVA A;  1FR3 A;  5IGC A;  1W6J A;  1TWF B;  4GLX A;  1SE3 A;  4P74 A;  4A76 A;  2F4V Q;  4L5T A;  3ZJY C;  2JA6 G;  3MXU A;  4H0L C;  1EOT A;  2XRS D;  4X64 Q;  1CUK A;  4PG3 A;  2XIW A;  3GDE A;  4IPC A;  3E5S A;  1BXT A;  2CFM A;  1FGU A;  3CP0 A;  2N3S A;  1HZA A;  1XNR Q;  1MHW C;  1PFM A;  2Q2U A;  5IGE A;  2R7F A;  2EYL A;  1A2T A;  1K8G A;  5KND A;  2E2D C;  2VNU D;  2YTV A;  1QUQ A;  3AMU A;  1I6V C;  4J1M A;  5C4X G;  2F0T A;  2YYZ A;  4JI7 L;  1STB A;  2F0D A;  2B63 B;  5CV4 A;  2B39 A;  2RCN A;  4A3C G;  2G5D A;  3M4Y A;  4QGU A;  5C3W A;  3IFD A;  1QZH A;  3PO3 H;  2EY1 A;  1X3E A;  5C3E G;  1EU4 A;  4DV2 L;  2CHB D;  3VR6 A;  2NN6 G;  1EY4 A;  3L3O C;  2A68 C;  2Q8I B;  1PFB A;  1EUJ A;  1RJT A;  5GQO A;  2F0G A;  4WJW A;  4IO9 A;  1BDO A;  5I2X A;  1IZ6 A;  1BCP C;  2JA8 H;  3VYT A;  1BUV T;  4EQN A;  3E9I A;  4JI0 Q;  2PI2 E;  1Z7T A;  4B3S Q;  1ML0 D;  4A3B B;  1BR9 A;  2R93 B;  4NMZ A;  4R4Q A;  1EQR A;  3STB C;  1DOK A;  1YJN A;  1JCK B;  2QGQ A;  1YHA A;  5E4X A;  1U4M A;  2PQA B;  1CHP D;  1PV4 A;  4M8A A;  2LKV A;  1VQ5 A;  2UXD L;  1AFP A;  1KXL A;  1MI2 A;  4CKE A;  1UE7 A;  2Z6B A;  1VQK A;  4L5Q A;  2JEA I;  1F2M A;  5EBC A;  1X32 A;  4L8J A;  1SFO H;  2EDG A;  4UPA A;  4JCV E;  2N88 A;  4C2M B;  1K28 A;  5FLM H;  5EKI A;  2EYH A;  3ICE A;  3CCM A;  4OON A;  5IP9 G;  3S1Q B;  2IX0 A;  3ERS X;  2F0S A;  1PH9 A;  3PV0 A;  1BNZ A;  4FF4 A;  2YU9 H;  4XDX A;  3J81 i;  1J6Q A;  1YIT A;  4LFC Q;  4IZ8 A;  4NP5 A;  4OX9 Q;  1HA5 A;  1NUC A;  1NMF A;  3M4O H;  2NZ1 D;  2Y0S B;  1X9N A;  2B63 G;  3S14 H;  1GUN A;  5LMN L;  4RFB A;  2C5C A;  4AQY Q;  1XJV A;  3C2P A;  1SRO A;  4JBK A;  2AQ1 B;  1DOM A;  4ZCK A;  5IOD A;  1DOL A;  4MTN A;  2FMM A;  1SMY D;  1CSP A;  2QCP X;  3GQB A;  3QO2 A;  4HR7 B;  5EQ0 A;  1D5Z C;  4DR3 Q;  3S17 H;  3CPW A;  2VY3 A;  3DWA A;  1PLF A;  4X3S A;  4A3B G;  4K0K Q;  4DK0 A;  2JA5 G;  1ENA A;  1D2B A;  1OXV A;  3PUY A;  5EKK A;  5ISR A;  2ICI A;  5F2D A;  5LMN W;  4JI6 Q;  5EBD A;  3OIP A;  1O78 A;  1JWS D;  3EJI A;  5FJ8 G;  4DR1 Q;  3KUP A;  2CWA A;  4A3G B;  1NCV A;  1WTH A;  4A3J H;  1VQL A;  3L7Z C;  4EX5 A;  2N78 A;  3PUZ A;  1XPR A;  2JA7 H;  2NN6 I;  4AIM A;  4JPB W;  4CKB A;  2Q8R E;  2Z6K A;  3GTJ H;  1ZKO A;  5C3X A;  1HUM A;  2D0O A;  2HHH L;  4IPD A;  2OTL A;  1Q46 A;  3CCU A;  2EY6 A;  3H3V H;  2F0K A;  1S5E D;  5KRU A;  1LM0 A;  5M9O A;  1B50 A;  2E75 C;  1YJ9 A;  3HOX B;  4JI4 L;  3A5Z B;  3G71 A;  3CQZ H;  3TEH B;  2AKW B;  3CC7 A;  2DGY A;  3PIP 3;  2ZXO A;  3VYS A;  1G91 A;  5M5X B;  4JI5 L;  3K5M A;  1I4Q A;  5KYI A;  1LUZ A;  3KDF B;  3TP7 A;  5JEA H;  2F0W A;  4DF7 A;  4IPG A;  2D62 A;  4C3H H;  2A6E C;  4Y52 H;  2VZA A;  1C48 A;  5FO7 B;  3L9A X;  3TBI B;  2Y0S G;  3CF5 A;  1Q3L A;  4DAP A;  4G57 A;  3FHW A;  3HOV H;  1D5X C;  4JI1 Q;  3OMC A;  4H13 C;  4MZ9 A;  5A2Q L;  3M4P A;  1A62 A;  4X62 Q;  4KKT A;  4LF7 Q;  5IP7 G;  1Y69 U;  2K50 A;  3J80 E;  3NK9 A;  2UUB Q;  2A6H D;  5T1I A;  4X3K A;  2KA7 A;  5J39 A;  1IL2 A;  3VA7 A;  1I4G A;  2BDN A;  4WJ4 A;  4ME5 A;  1E24 A;  3HOU B;  2KEE A;  4KD3 A;  1EZ8 A;  4LF5 Q;  3R2I A;  1CI3 M;  1HXY D;  3KLR A;  4KK7 A;  1KDA A;  2WII B;  5IOC A;  2WAC A;  1M1K C;  2B2T A;  2MJ8 A;  4C1N I;  1C4Q A;  1P8L A;  1GXD C;  3GTL H;  4JI8 L;  1O7Z A;  3VA5 A;  3TZD A;  1B70 B;  3DWP A;  1P16 A;  5NUC A;  1FJG Q;  2UU9 L;  4Q0F A;  4A3G G;  3CCV A;  2EJG C;  3JAM c;  3I72 A;  2FMC A;  3AYH B;  4DK6 C;  3M7G A;  3BYT B;  3AFP A;  3I70 A;  4IFD J;  1LT4 D;  3PO3 B;  3FKI H;  1EU3 A;  2B8F A;  2DN8 A;  2EVB A;  5BN4 A;  4B3T L;  2KHI A;  1OO9 B;  1M8A A;  5C4H A;  2J4X A;  1ASZ A;  4A3F H;  2JA8 B;  3NTH A;  3HKZ E;  1YJW A;  2L4N A;  2HCC A;  2RHQ B;  3JC6 6;  1WTV A;  3DM1 A;  3U9S A;  2I07 B;  5CMD A;  3BVG A;  2HIV A;  2WAQ G;  4ZKB B;  4PQX A;  3HP3 A;  1RDP D;  3DEP A;  5JJI A;  1RCV D;  4QIW E;  4GKJ L;  1KDC A;  1E1O A;  2RHS B;  3QOJ A;  2PNR C;  3OPO A;  4BY1 G;  4HIK A;  3J81 L;  2LY7 A;  2EZV A;  1A8V A;  2R7Z G;  2BA1 A;  1JJG A;  2QDL A;  3R8B A;  3T16 A;  1SFO B;  4R4C A;  4OHJ A;  1W3S A;  1D6E C;  4BXX G;  1KAW A;  1LTL A;  4QF4 A;  2DY7 A;  4A3I H;  1W6K A;  4IUQ A;  4GKK Q;  3F1Z A;  1PHJ A;  2RSO A;  3H0G H;  2F03 A;  4NXN L;  1TWA H;  4X65 Q;  5JVG 3;  4DAY A;  5HGQ A;  1J5E L;  1N33 L;  2A19 A;  1TS3 A;  2NB0 A;  4LUV A;  1KTK A;  1X65 A;  4B3M Q;  4F87 A;  3HOU G;  1GJX A;  2YU9 B;  2ALY B;  4FYD A;  1HTL D;  3AB9 A;  4OWT B;  1I4H A;  1WTO A;  1I5F A;  1B3Q A;  4C1N K;  2KBN A;  3M4O B;  1UE6 A;  2SNS A;  2VL6 A;  1JJ2 A;  3I4O A;  2B2W A;  4OO1 H;  3AEV A;  3S14 B;  1X3Q A;  2RVL A;  4HJ5 A;  3BU2 A;  3J7A F;  4DV0 L;  2EQS A;  4DUZ Q;  5IWA Q;  4A93 H;  5IGF A;  2VUM G;  3CD6 A;  2WKC A;  1TWH H;  1HNW L;  3DMU A;  4UHV A;  1PFS A;  2K5W A;  1D5M C;  2EXD A;  1ILQ A;  5DLQ E;  4YHH L;  1CKN A;  4KLK A;  3CC4 A;  3T4A C;  1EFW A;  1G8Z D;  3MXP A;  2VQF L;  2OEO A;  3OW2 A;  4K5X A;  1EQQ A;  2CW0 C;  2K5Q A;  2F4V L;  4JV5 L;  1HRJ A;  2A8V A;  4R8I A;  1SE4 A;  2KCC A;  5M3F G;  2OF1 A;  5FLX c;  2EYM A;  1VQB A;  4F7X A;  4WJ3 M;  1EWC A;  4BBS H;  1KLU D;  3BZK A;  4RGN A;  3HOW G;  3ER0 A;  3HFZ B;  1QVG A;  1KD1 C;  3TZU A;  5ELF A;  1Z47 A;  1WD1 A;  2JP1 A;  4DAM A;  1PH5 A;  4A3J B;  2OT2 A;  2Z8L A;  2ES2 A;  1N36 L;  4LF9 L;  4C56 C;  1XPU A;  4DK1 A;  2JA7 B;  4LF4 Q;  3T1H L;  5J1Z A;  3CCL A;  3GTJ B;  3LWE A;  3BS1 A;  4POG A;  1ILP A;  1HNZ Q;  2A5H A;  1PDQ A;  1SEB D;  4ID6 A;  5FLM G;  3MXN A;  1H9S A;  3GTP H;  5AJ3 L;  1OXX K;  1TY0 A;  2F1M A;  1K8O A;  2AUJ D;  3OTO Q;  3M7N A;  3J7A 5;  1N32 Q;  2RSN A;  1KL9 A;  2BCO A;  3CQZ B;  5EPJ A;  4RHS A;  4OWX B;  4HN7 A;  4DGZ A;  4EQP A;  3TDQ A;  3LX0 A;  3A54 A;  4JI0 L;  1B1Z A;  1AW7 A;  3Q22 A;  2NVY H;  4EVO A;  2B2Y A;  2VW9 A;  3ULL A;  4C3H B;  1C8C A;  1QVF A;  2B2V A;  2PZW A;  2NTT A;  1SYB A;  1B8A A;  4DNR B;  3RMH A;  4RGM A;  2QEX A;  5BR8 L;  1AH9 A;  3HOV B;  3PGZ A;  4XQQ A;  2F0Q A;  1B2T A;  2IPK D;  3M4Q A;  2RQX A;  1U9R A;  3T1Y L;  4B9X A;  1F2Z A;  4A3D H;  1A15 A;  1G2T A;  4WFN 3;  1DYQ A;  2EY5 A;  1U4P A;  2D2C C;  2K4K A;  1X6O A;  2BH2 A;  3A0J A;  1A2U A;  5FK9 C;  4FF1 A;  2WIN B;  5FOB B;  1PRT C;  1UAP A;  2R61 A;  1VQO A;  3GTO H;  5E1F A;  4OIJ A;  1HTP A;  1A3U A;  3I3C A;  3W5O A;  2JK8 A;  1QJO A;  1QWY A;  1SJE D;  4KKS A;  3S24 A;  4APV A;  5EGT A;  1B44 D;  2X6G A;  1YNX A;  1XNQ Q;  4X3U A;  4X6A H;  2K1B A;  3GTL B;  3BDO A;  3F8T A;  1VQE A;  1VDZ A;  2HDL A;  4DU9 A;  2L1B A;  1HQR D;  3F2U A;  3EQL C;  5K36 H;  4QJF A;  4PZ6 A;  1CKN B;  4JI2 Q;  4A3J G;  3IL8 A;  1PZI D;  3Q6S A;  4CGY B;  4ABN A;  2BOS A;  2OXP A;  1Q90 A;  2JA7 G;  5C5L A;  3HOY G;  3PUW A;  3FKI B;  3HKS A;  4ULL A;  1CSQ A;  1KAA A;  2RDF A;  4AYB B;  1KAB A;  3E0E A;  4CDC C;  1S3O A;  3U50 C;  5JPM C;  5M5W H;  1F2L A;  3RLO A;  1HZ9 A;  4A3F B;  1QG7 A;  1K8M A;  4TRD A;  4DR6 Q;  3CCS A;  3J80 L;  1GHK A;  1I4X A;  4A3L H;  4DV4 L;  1VQ7 A;  1BBU A;  5JVH 3;  2M2L A;  4RKB A;  4BBR H;  3K57 A;  1D1K A;  2JA9 A;  1TQO A;  2UUC Q;  4DXG A;  1YVC A;  1QNU A;  1IXR A;  2KVM A;  2MNA A;  1PH4 A;  4K0K L;  4LFA L;  4C3H G;  1GO3 E;  1C0A A;  1YNJ D;  2ZJR A;  1WOC A;  2XVS A;  2MHV A;  4B3R L;  4LFB Q;  2UXB L;  3HOV G;  1Q7Y C;  5CV6 A;  3E0J A;  4ZQ3 A;  3GTQ H;  3IRB A;  3OHX C;  3W1B A;  2K01 A;  3X3M A;  4A3I B;  3HG9 A;  4DK3 C;  3RN5 A;  5CGK A;  1L1O A;  3H0G B;  4HID A;  3J80 c;  1TWA B;  4OWW B;  2PYK A;  2OQ0 A;  2NVQ H;  1MKH A;  3R2T A;  1ROD A;  1H9K A;  2PPB C;  5JJL A;  3KF6 A;  5C0X J;  2ID0 A;  5C44 H;  1TWC H;  4PZ7 A;  4K5W A;  4I7Z C;  2J7Z A;  1EYG A;  2BA0 A;  3PIO 3;  2K28 A;  1ZYR C;  4TKO B;  2ZM6 Q;  2I0Q A;  5IT9 E;  4V0B A;  4PMB A;  3I2Z A;  1MJE A;  1JOO A;  4JVZ A;  3J7Y W;  2F0F A;  1PTO D;  2Z1C A;  1DON A;  1LAC A;  4DR7 Q;  3CCQ A;  4A93 B;  5KEE A;  4NXM L;  3S1M H;  3JAM i;  3H3V C;  1TWH B;  2I5H A;  1BBX C;  1XPO A;  4RWS C;  5HUR A;  1Y1W G;  4ODG A;  3HS0 C;  1VQM A;  1BKB A;  3CRK C;  2LFN A;  3FKI G;  1AE3 A;  3IKJ A;  3KOJ A;  3MA2 B;  3VYR A;  4AYB G;  2E8G A;  3K5L A;  2FHT A;  5M3M H;  1WTP A;  2MO1 A;  4MN3 A;  4A3F G;  2R7D A;  3CCJ A;  4LF7 L;  5EKL A;  5A35 A;  3TP6 A;  1PMR A;  4DV1 L;  1HZC A;  5C0X G;  3F2D A;  4YWM A;  1D1I A;  2OTJ A;  5FLX E;  4DV6 Q;  2XWB B;  2NZH A;  4DR2 L;  2Z4H A;  4BBS B;  3ZYY X;  2DNC A;  1TII D;  3S15 H;  2EIF A;  3I73 A;  4MIU A;  2EYJ A;  3PUV A;  1Y14 B;  4BA2 I;  2B3G A;  4NDX A;  1A3V A;  4QB4 A;  4S3S A;  4HIM A;  1EYA A;  2EYF A;  4DR5 L;  3T56 B;  1YBY A;  4HSP A;  1RTO A;  4JOI A;  4JYA L;  5TSS A;  2WFW A;  1Z9F A;  1XMQ Q;  4B9W A;  3PMF A;  4A3M H;  3S16 H;  1SXT A;  2XGT A;  2B2U A;  3P20 A;  2L55 A;  4GNX A;  5EPL A;  3H3V I;  1Q86 C;  2UUA L;  1V1P A;  1G6Z A;  1NBW A;  4TVA B;  1LTI D;  3T53 B;  2JEB I;  2HDM A;  1R9T B;  3H0G G;  1AZQ A;  3GTP B;  1S5D D;  2HIX A;  1SYC A;  3GV6 A;  4I65 A;  5FKA C;  4IAL A;  1WYD A;  1O80 A;  2XWJ B;  1JJC B;  1AP0 A;  1HNX L;  4HJA A;  2ZTC A;  1STH A;  2XSC A;  4YCU A;  3GTM H;  2JJQ A;  2BE5 D;  1RHP A;  1CKM A;  4WRD A;  1DD2 A;  1EOV A;  1FD7 D;  4OIK A;  1IBM Q;  2Y0S E;  2ZJP A;  3RN2 A;  4DUY Q;  2RDG A;  1JE5 A;  1YNN C;  2F3W A;  3CW2 C;  2Q8T A;  2NVY B;  1LTS D;  1VQI A;  4P73 A;  5M5Y H;  1AEX A;  3WDN A;  4K8I A;  2E2J H;  3DLL A;  2WV6 D;  4HJ9 A;  4HJ8 A;  2CWP A;  2EXZ A;  4A93 G;  2NYZ D;  4O0A A;  5C5M A;  1N34 L;  1UWV A;  3TP5 A;  3W2D A;  1SR3 A;  1K83 H;  5EJW A;  4HIO A;  1I4R A;  4A3D B;  4X3T A;  1A6X A;  4A3E B;  5DNF A;  4I7A A;  4ZUI A;  1D7Q A;  3MHB A;  1CA5 A;  2D5D A;  1UE5 A;  1E2W A;  5ELD A;  1Q12 A;  2VQE L;  2P5Z X;  1VQ6 A;  3GTO B;  4KJO A;  2IT1 A;  1NAP A;  4PMC A;  4YY3 L;  1QUQ B;  3NTK A;  2L15 A;  3CHB D;  2K32 A;  1ENC A;  2R93 G;  1BQQ T;  1OXT A;  3MTS A;  3I7F A;  2FJ2 A;  1KC8 C;  4BBS G;  2NVX H;  5IYD H;  2AUK A;  3O13 A;  1GUT A;  2GN5 A;  3U4Z A;  3UI2 A;  3KJP A;  1VQA A;  3S1R H;  1YIJ A;  3QWN A;  4LF6 L;  4HCE A;  1SYD A;  4IOA A;  1A3T A;  3GTK H;  3BZC A;  4GOP A;  2QKI C;  4O1N A;  3TP8 A;  1EWH A;  3VR5 A;  2GA4 B;  1L0X B;  1R4Q B;  2WAQ E;  2A69 D;  5M5W B;  3KBG A;  1WCM H;  4FP5 D;  4P72 A;  1UEA B;  2RKS A;  4HJ7 A;  2RBM A;  4IUP A;  1XMO L;  5C0X I;  3CCR A;  4R1J A;  1EQV A;  4JI3 Q;  3KK7 A;  4V19 0;  1SNP A;  2R6G A;  5IE8 A;  2JXM B;  3D6W A;  1F9R A;  4MHE A;  1HFN A;  4BBR B;  1SAP A;  2L12 A;  1JIC A;  1PH3 A;  2O2L D;  4KV6 A;  1WD0 A;  4RA8 A;  4M1U B;  5DM7 3;  2L11 A;  1TR5 A;  5IYB H;  2NBF A;  1STN A;  1IW7 C;  4LF8 L;  1JWU D;  1V1P B;  3GO5 A;  1LYL A;  2UXC L;  3RLF A;  3GTQ B;  2NUC A;  3D0F A;  4LNQ A;  4A3D G;  2M9V A;  5CBA E;  3PCO B;  2EJF C;  3N6R A;  1VF7 A;  3JAM L;  3KLS X;  4A3E G;  3QR8 A;  1FNV A;  2F3I A;  1QB5 D;  1TS5 A;  2PMZ B;  1Q82 C;  1Y1V H;  4JI7 Q;  5CV9 A;  3CRL C;  2NVQ B;  3QB3 A;  3S1N H;  1S5F D;  2PZT A;  2TMP A;  1XWE A;  1PYB A;  4DV2 Q;  3K8A A;  2HCI A;  1NE3 A;  1TWC B;  4LWC A;  5C44 B;  3WWV A;  2MO0 A;  1BVS A;  1WVL A;  1SYE A;  3K58 A;  1QOH A;  4OO1 I;  4XXE A;  2QW7 A;  1SBB B;  3MEF A;  3EVQ A;  1I94 L;  2RF4 A;  2Z9H A;  5K36 G;  2JA6 H;  1WJJ A;  5LL6 X;  1B53 A;  3NEL A;  3S1M B;  4DNI A;  4N9T A;  4C3J H;  1GUO A;  4DV5 L;  1WTR A;  2KEN A;  5GAH C;  3K7U C;  3H09 A;  2E5L L;  3RUZ A;  2UXD Q;  1Q8I A;  4MTK A;  1NJI C;  5M3M B;  1S5C D;  2PW7 A;  2R92 H;  1IL8 A;  2NTS A;  2FIN B;  1ZEQ X;  4EGV A;  4G4K A;  3OWE B;  4QY7 A;  5C4X H;  4U67 3;  3ERQ A;  1Z6H A;  2ZXR A;  4KTA A;  2I5L X;  3HOX G;  4BBR G;  4K5V A;  1LT3 D;  1S72 A;  2F3V A;  2H4O A;  4A3C H;  3K0X A;  3S15 B;  4RGT A;  3D31 A;  1B9M A;  4IOC A;  2WB1 B;  1S4Z A;  3LNN A;  2MPM A;  2CQA A;  3FEW X;  4GN4 B;  3I91 A;  5E4W C;  1HHV A;  5IT9 L;  3P75 A;  1UUP A;  1YHQ A;  5C4J H;  2LSS A;  4ZAI A;  4K6L A;  1X54 A;  2L0C A;  3SHL A;  3S16 B;  5JJK A;  1PYS B;  1UEB A;  5IGB A;  4KHZ A;  3H91 A;  3URY A;  3K7A H;  3VR2 A;  4J15 A;  2K7V A;  3AU7 A;  3SK8 A;  1HQM C;  1OXS C;  3HKZ B;  4DR4 L;  4UY8 C;  1BBW A;  1K0R A;  3H94 A;  3VR3 A;  3X3N A;  3J80 i;  1HR0 L;  5LMN Q;  1LTB D;  4JG2 A;  4ZKC B;  5GAD C;  4DV3 L;  3GTM B;  1JC7 A;  1B9N A;  1GOZ A;  1H9R A;  4RCO A;  4LW1 A;  1L0Y B;  5CV5 A;  3SK6 A;  3UE1 A;  5FO8 B;  1CZW A;  3CU7 A;  1KNA A;  5LMU L;  2NZO A;  1I3Q H;  3WOE A;  5M5Y B;  5FLX L;  2UUC L;  3Q24 A;  4G7H C;  2E2J B;  5HGT A;  4DN4 M;  5IT9 c;  2CQO A;  4CBV A;  1K0S A;  1Q81 C;  4CJ0 B;  1IBL L;  3SDZ A;  1TWG H;  3K5N A;  5ELB A;  1Y8O B;  2K04 A;  4UP8 A;  1BCP F;  1K83 B;  1B4O A;  4K14 A;  4YWK A;  4XQN A;  1GUW A;  1PH8 A;  5IP9 H;  2F0N A;  2ZT9 C;  3P1H A;  3W3A A;  4KI0 A;  3KF8 A;  4Y7N H;  3PO3 G;  1EIH A;  2A68 D;  4CHT B;  2KJX A;  5JJZ A;  3ERO A;  4KHP L;  1WTX A;  1BCP D;  1SSO A;  3KBX A;  4DV7 L;  1JWM D;  2JA8 G;  1MD2 D;  3T13 A;  3S17 B;  3M85 A;  2DY8 A;  4Z9C B;  4DPG A;  2HHH Q;  3QOL A;  3STB D;  1Q8K A;  2NVX B;  1SRU A;  3K5O A;  4X64 L;  1KQS A;  5KIX A;  4KMU C;  4OEL B;  4L63 B;  5LHY 1;  4DAV A;  1SMY C;  2MP1 A;  2WB1 G;  4HTH A;  3OSO A;  1XNR L;  5T1G A;  1F9S A;  4JI4 Q;  3S1R B;  4P75 A;  2HQE A;  2LS0 1;  3ND8 A;  3MVV A;  3R93 A;  3GTK B;  4JI5 Q;  3BJU A;  4A3B H;  2BDO A;  1F9P A;  3RZD H;  3FRP B;  1FNU A;  2AQ3 B;  2JA5 H;  4POF A;  1Q1E A;  4UP9 A;  1E2Z A;  1WCM B;  2OWO A;  3UDI A;  1WI5 A;  5JOB A;  3SVM A;  1RF2 D;  2B29 A;  5IGG A;  4CDD C;  5FJ8 H;  1KIX A;  2HT1 A;  3PQI A;  4NPS A;  4GLA C;  1EIY B;  1ICW A;  4FO2 A;  1M4V A;  3HEJ A;  4DKA C;  1UE1 A;  2XN9 C;  4B3S L;  1PTO H;  1V1Q A;  1IYJ B;  2DNE A;  1VQ9 A;  3EFX D;  5IY0 A;  1XTC D;  3A56 A;  1SDF A;  1EZ6 A;  4EQO A;  1DM0 B;  2E2I H;  1QNK A;  4KY7 A;  1JT8 A;  3S2D H;  3QIA A;  3B6Y A;  3V96 A;  3WOF A;  4X66 Q;  3EA6 A;  4DAY B;  5GAG C;  1EIF A;  4L5R C;  2E76 C;  1BCP B;  4JI8 Q;  3ULP A;  4C3I H;  3CXC A;  3I56 A;  4OXP A;  2UU9 Q;  3NHH A;  2DJF C;  2F0P A;  4HAE A;  3EBE A;  5IYC H;  1H95 A;  1H9J A;  4XQJ A;  3S1N B;  3AQQ A;  2ASB A;  1TVX A;  4KY5 A;  1RL2 A;  5J3B A;  4B3T Q;  2Z6K C;  1XX8 A;  1SNM A;  4FDB A;  1GD7 A;  4N8X 1;  2KHS A;  2L5T A;  3A7A B;  5IP7 H;  1HZB A;  3DXJ C;  1NR2 A;  4AYB E;  2X6L A;  2JA6 B;  1SNO A;  3RZO H;  2A6H C;  3SGI A;  5JEA J;  2VXW A;  2G9D A;  4C3J B;  4LFC L;  1JB7 A;  4GKJ Q;  4IUR A;  4OX9 L;  1V9P A;  1B7Y B;  2F52 A;  1GHJ A;  4ALP A;  1A0I A;  1I50 H;  1MSH A;  3N52 A;  3SK5 A;  3ND9 A;  2PO4 A;  1ENF A;  1MSG A;  4XYQ A;  1VCI A;  1WCM G;  3G6J B;  4R4O A;  4AQY L;  1LTR D;  2R92 B;  1SNC A;  4RCN A;  2RDH A;  2C35 B;  3GP7 A;  2MFI A;  2PW5 A;  5DEH A;  5C4X B;  4A75 A;  2F0L A;  1SND A;  1TXY A;  3FP9 A;  1L2F A;  5CV8 A;  4ZRZ A;  2E74 C;  4ME3 A;  3A7L A;  4QUC A;  2RCF A;  1G2S A;  4RAU C;  5A2Q E;  4R8N A;  1SYG A;  5CC4 A;  4LUZ A;  4DR3 L;  1JB3 A;  1E2V A;  4UAI A;  1QE6 A;  2PI2 A;  4FVM A;  1N8R C;  3A5U A;  2F0J A;  1J5E Q;  5JEA G;  2A6E D;  4CJ1 B;  4BA1 I;  3PIP A;  5C4J B;  2JN4 A;  4JI6 L;  1IKM A;  1K3B C;  3MXN B;  1H9S B;  1VQG A;  2ENB A;  4IN3 A;  3I4M H;  4DR1 L;  3GV3 A;  3K7A B;  1VMP A;  5CR3 A;  3MEH A;  2IX1 A;  4RHR A;  1S40 A;  3PSI A;  1B3A A;  5I4D A;  3L2P A;  2QEJ C;  2B2T C;  1AE2 A;  2N8N A;  1LT6 D;  4DV0 Q;  4BY1 H;  3C3L A;  5D65 A;  1CM9 A;  1RIP A;  2K52 A;  1EQT A;  1HNW Q;  2R7Z H;  1PTO F;  4DFA A;  2RA4 A;  4IFD H;  5D14 A;  2J0T D;  4R4I A;  3TN2 A;  1J8I A;  2K75 A;  4YHH Q;  2AWO A;  3KFU A;  4BXX H;  1YI2 A;  2ATW A;  1I3Q B;  2VQF Q;  2OQK A;  2PNH A;  1CA6 A;  4TSS A;  4HMJ A;  4JV5 Q;  3S9W A;  1TWG B;  1XYI A;  4C3J G;  4ZLT F;  4XTC S;  4WOR A;  4Y7N B;  1AN8 A;  1CT1 D;  1TY2 A;  3HOU H;  2LXK A;  1U5K A;  2NWG A;  4JI1 L;  1GUS A;  3J81 E;  5I6Y A;  2R92 G;  4QMG A;  3E3X A;  4A3K H;  1N36 Q;  4LF9 Q;  4X62 L;  2FXQ A;  3T1H Q;  2UUB L;  1BO0 A;  3G7L A;  1CHQ D;  1V1O A;  2EE1 A;  2VUM H;  2K03 A;  3HRZ C;  4N8F A;  5COY A;  1GM5 A;  1SLJ A;  2KCT A;  1EY6 A;  2OCE A;  1JMC A;  5AJ3 Q;  2SDF A;  5KNC A;  1WTW A;  5CYU A;  2F0O A;  5C4Z A;  4LF5 L;  4BWG B;  1HFG A;  5K5P A;  3V2T A;  1KLG D;  4CJ2 C;  4LJZ C;  4PNY A;  1W2B A;  4K6D A;  3C1E A;  4IJH A;  2KEC A;  3NEM A;  1EY9 A;  3RZD B;  5M3F H;  1FJG L;  1PZJ D;  1IBK Q;  2JA5 B;  3FPU B;  1XXG A;  5E3F A;  3OYY A;  3D6C A;  3K80 C;  4A3I G;  3I4N H;  3A74 A;  1X56 A;  2AQ2 B;  3HOW H;  4KD4 A;  5BR8 Q;  1ASY A;  2B2W C;  5EAY A;  3BZD B;  3T1Y Q;  3KLW A;  1FGB D;  1QIL A;  2Z4I A;  5HY6 A;  1NR4 A;  2KOL A;  2FFK B;  1ZXT A;  2F0I A;  3KDF A;  3DEO A;  1SMX A;  4PMW A;  3MC0 B;  1PTO B;  2O5I C;  2K5H A;  2Q2I A;  1K73 C;  3QJY A;  2F0U A;  4K8J A;  2L9H A;  4NKL A;  2O5J C;  2PZU A;  1GUG A;  1FL0 A;  1O7L A;  1YHB A;  1E7Z A;  2K5N A;  1JQY D;  4YCW A;  2E2I B;  4OO1 G;  2KUM A;  3S2D B;  3D8G A;  3IAY A;  1L1O B;  5KYL A;  1DCZ A;  4FF3 A;  4BY7 H;  2YV5 A;  1STG A;  5CBE E;  1DZ1 A;  2TSS A;  2ZTE A;  5L37 A;  3ITP A;  1X3P A;  4C3I B;  1HA6 A;  3KYH C;  4LK1 C;  1VQP A;  1PYW D;  2EPB A;  1EYC A;  2JSO A;  4JW0 A;  1IHZ A;  3KF6 B;  1SYF A;  1KRT A;  2KED A;  3J7A V;  3BVM A;  1RTN A;  2MGS A;  4OEM B;  2B8G A;  1HPC A;  3BYY B;  3UDG A;  2CW0 D;  4GKK L;  4NB3 A;  3CMA A;  3OMG A;  3K0Y A;  3CC2 A;  2K14 A;  2QA4 A;  3ULJ A;  2EYO A;  3J7Z C;  3NTI A;  3RNU A;  4X65 L;  4KN4 C;  3NP8 A;  2DJG C;  1TT2 A;  4E6I A;  2GVB A;  2EJM A;  3CPF A;  4B3M L;  1JOK A;  4P71 A;  1RKN A;  1TS2 A;  3NQT A;  2YTY A;  3NPP A;  4DV4 Q;  3RZO B;  4G7Z C;  4KN7 C;  2CKZ B;  3HOZ H;  1CKO A;  1OXU A;  4N9P A;  1KRS A;  3PO2 H;  1X3F A;  2VS1 A;  3A8J E;  3SEB A;  1GKH A;  1I50 B;  1YZ6 A;  1G51 A;  4TQU S;  4J8Q A;  4LFA Q;  1E3P A;  5E7N A;  4DUZ L;  5IWA L;  3PF5 A;  3FDT A;  2B2Y C;  2O4X A;  4K2K A;  1HUN A;  3BVZ A;  1J9O A;  4JC0 A;  3TS0 A;  4B3R Q;  2B2V C;  4QCL A;  2UXB Q;  1TKW B;  1PA6 A;  5JPN C;  4G7O C;  1VQ8 A;  2CVR A;  4CDE C;  1DXM A;  4U68 A;  1HJP A;  2SNM A;  1VQD A;  1STA A;  3PF4 A;  2YTX A;  1KHI A;  1K8A C;  3SE0 A;  1I6H H;  4JBJ A;  1DJR D;  3HOY H;  5LL6 S;  1L0W A;  3VDY A;  3TQY A;  3NE5 B;  3I8Z A;  4GN5 A;  2MQH A;  3NWT A;  4RMF A;  2Q2H A;  2D9U A;  3I4L A;  1VQH A;  4GNX B;  1CQV A;  2PMZ E;  4KHV A;  5AFW A;  1PRT F;  1EY5 A;  1PH1 A;  1SN8 A;  2QF7 A;  3I4M B;  3G6E A;  3Q0A A;  2WAQ B;  4OL7 A;  3NBI A;  1VMC A;  4GZY C;  3U58 A;  1CFM A;  2ZXP A;  1HCZ A;  4C3I G;  1SNQ A;  3MFY A;  3HGB A;  3KJO A;  1U0L A;  3NBH A;  4BY1 B;  4LF4 L;  1PRT D;  2CH4 W;  3H15 A;  1V8Q A;  4NXM Q;  5IGD A;  5IYC G;  4QUF A;  1YNJ C;  1LAB A;  3LGJ A;  3GTG H;  1TS4 A;  1HNZ L;  4DXF A;  2R7Z B;  1LTG D;  2SEB D;  2XRQ D;  1K3R A;  3DM3 A;  1A63 A;  1F2Y A;  3OTO L;  1BF4 A;  5D3I B;  2HQL A;  1N32 L;  2E2H H;  3J81 j;  4P2C B;  2AHO B;  4LMQ D;  3RD4 A;  5I9O A;  1N9W A;  3MZ5 A;  1STY A;  1PXU A;  3Q23 A;  4DV1 Q;  4HSV A;  3MAQ A;  1JOR A;  1M90 C;  1SE8 A;  1PFN A;  1EY8 A;  4FXK C;  4KY6 A;  4LAA A;  2K05 A;  4DR2 Q;  1EIG A;  3UDF A;  2PQE A;  1SE2 A;  3CCE A;  3A55 A;  1VQF A;  2D0P A;  1STE A;  5BN3 A;  4X66 L;  2X69 A;  4DR5 Q;  1X3G A;  2HD3 A;  2IY5 B;  4HMI A;  2Q2T A;  5FO9 B;  1X55 A;  2PCF B;  5IIF A;  3P7J A;  4JYA Q;  2R3Z A;  4A3K B;  3OOC A;  4XT1 B;  4L5S A;  1PTO C;  1LO5 D;  5ELC A;  4A3L G;  2WB1 E;  3UE0 A;  5KGU A;  2VUM B;  1EEF D;  3HZX A;  3K59 A;  2UUA Q;  3D3R A;  1LV9 A;  1Y1W H;  3VR4 A;  1QZG A;  3M9B A;  5I2Y A;  1G6P A;  2IHF A;  1L1O C;  2IJ0 A;  3K81 C;  1EYD A;  2BH8 A;  5I9P A;  3AFQ A;  4MNO A;  1HNX Q;  5C3E H;  4OGQ C;  4GOP B;  2NN6 H;  1XTD A;  3K6O A;  1E22 A;  1YEZ A;  2IL8 A;  3TME A;  3PUX A;  2EOT A;  1XNQ L;  3M3Y H;  2N55 A;  2A73 B;  3U4V A;  3I4M G;  3FPP A;  3G48 A;  5C0X H;  1EWI A;  4A3M B;  4YIJ A;  5M3F B;  2K5V A;  1E0B A;  4AH6 A;  1PRT B;  5I6W A;  3MXG A;  4JI2 L;  1EY0 A;  3I4N B;  3S2H H;  3HOW B;  1NMG A;  1C7Y A;  1N34 Q;  3NQI A;  4EQ5 A;  4GLV B;  3OW7 A;  3OWF A;  4O2D A;  3RLN A;  3G4S A;  1PH2 A;  4PZ8 A;  1FVI A;  4IUV A;  1ET6 A;  3NSW A;  4QIW B;  4IFD G;  2NVT H;  4IPH A;  2V4D A;  4IQZ A;  4DNT B;  4L6T B;  4DR6 L;  5C44 G;  1ESR A;  5CV7 A;  2K5D A;  2VB3 X;  4ZK9 B;  1ZYR D;  3NXW A;  4YCV A;  2VQE Q;  3CAM A;  3RR5 A;  1H9M A;  5H1S E;  1MBY A;  1TWF H;  4F8M A;  4YY3 Q;  1JR0 D;  4FXG C;  3MFG A;  4BY7 B;  2ICE C;  3NBH B;  1DGS A;  1CTM A;  3PIO A;  2KCN A;  1NNX A;  3BDC A;  2BE5 C;  1MJC A;  2K6A A;  2SOB A;  1HR0 W;  1T9H A;  1VQJ A;  2VB2 X;  4LFB L;  1NTG A;  1UNS A;  5M3M G;  3J81 c;  4LF6 Q;  4A3K G;  1PH6 A;  1QVC A;  1MGS A;  1D8L A;  3I55 A;  4JOI C;  4R4T A;  1IKL A;  1O7I A;  1ONL A;  1FYC A;  4RKL A;  4JBW A;  2B2U C;  4XYO A;  4F88 A;  2B63 H;  2CH4 A;  1EL0 A;  1JOQ A;  3UDX A;  4GNX C;  1KDB A;  4GS3 A;  1KNE A;  4R9W A;  1XMO Q;  2JYO A; 
#chains in the Genus database with same CATH homology
 2ZTC A;  5GAE C;  4YCU A;  3GTM H;  2JJQ A;  4LUZ A;  1CKM A;  4DR3 L;  1EOV A;  1IBM Q;  2PI2 A;  1N8R C;  2Y0S E;  2ZJP A;  1IL2 A;  3RN2 A;  4DUY Q;  3A5U A;  1JE5 A;  2ZM6 L;  1J5E Q;  5JEA G;  3CW2 C;  1WFQ A;  4WJ4 A;  1VQI A;  4BA1 I;  1E24 A;  4P73 A;  5M5Y H;  3PIP A;  4LF5 Q;  4A3M G;  2E2J H;  2JQO A;  3DLL A;  4JI6 L;  4DR7 L;  4HJ9 A;  4HJ8 A;  2CWP A;  3TRE A;  1M1K C;  2R93 H;  3MXN B;  3I4M H;  1VQG A;  1P8L A;  3I4N G;  4DR1 L;  3GTL H;  4A93 G;  4O0A A;  4JI8 L;  1N34 L;  4LF8 Q;  1B70 B;  1UWV A;  2IX1 A;  1SR3 A;  3HKZ G;  1K83 H;  3PSI A;  4RG1 A;  3L2P A;  4HIO A;  1S40 A;  1VQN A;  2AMC B;  1P16 A;  2UXC Q;  1FJG Q;  2UU9 L;  1AE2 A;  4A3G G;  3CCV A;  2N8N A;  3JAM c;  4DV0 Q;  1D7Q A;  4BY1 H;  3AYH B;  4DK6 C;  3AFP A;  4IFD J;  1UE5 A;  1Q1B A;  1RIP A;  3FKI H;  2K52 A;  3F2C A;  2DUD A;  2R7Z H;  1HNW Q;  1Q12 A;  2VQE L;  1VQ6 A;  4B3T L;  2KHI A;  3TS2 A;  4R4I A;  3W1G A;  2IT1 A;  2K75 A;  2AWO A;  4YHH Q;  1ASZ A;  4A3F H;  3KFU A;  4YY3 L;  3GD7 A;  4DV6 L;  1YI2 A;  2ATW A;  3HKZ E;  1YJW A;  4BXX H;  1QUQ B;  4YWL A;  2RHQ B;  2VQF Q;  2L15 A;  4C2M H;  3JC6 6;  2OQK A;  1R9T H;  5ELN A;  2R93 G;  1GVP A;  1OXT A;  2PNH A;  3I7F A;  1KC8 C;  2HIV A;  4BBS G;  2WAQ G;  2NVX H;  3EIV A;  4BY7 G;  5IYD H;  4JV5 Q;  5JJI A;  4QIW E;  2Z0S A;  4GKJ L;  2GN5 A;  1VQ4 A;  3U4Z A;  3S1Q H;  1E1O A;  2RHS B;  3KJP A;  1I94 Q;  1C9O A;  1VQA A;  4XTC S;  4BY1 G;  3S1R H;  1YIJ A;  4HIK A;  1XMQ L;  4LF6 L;  2A1A A;  3E9H A;  3HOU H;  4IOA A;  2LXK A;  1IBK L;  3GTK H;  1A8V A;  1U5K A;  3BZC A;  5ELO A;  4GOP A;  2BA1 A;  2R7Z G;  1JJG A;  4JI1 L;  4IFD I;  2JE6 I;  4DV5 Q;  2I5M X;  2R92 G;  1VQC A;  2ZJQ A;  4R4C A;  2WAQ E;  4A3K H;  1W3S A;  4GOP C;  1N36 Q;  1WCM H;  4X62 L;  2E5L Q;  1KAW A;  1LTL A;  4LF9 Q;  4BXX G;  4P72 A;  2FXQ A;  4QL5 A;  4HJ7 A;  3T1H Q;  2UUB L;  4A3I H;  1XMO L;  5C0X I;  3CCR A;  4R1J A;  4GKK Q;  2LXJ A;  4JI3 Q;  1NY4 A;  3F1Z A;  1PHJ A;  5IYD G;  4A3E H;  2VUM H;  2R6G A;  3H0G H;  5IE8 A;  2CCZ A;  4NXN L;  1IBM L;  1G29 1;  1GM5 A;  1SLJ A;  1TWA H;  2KCT A;  4X65 Q;  4DUY L;  2OCE A;  5HGQ A;  1JMC A;  2KHJ A;  2AWN A;  5AJ3 Q;  1J5E L;  2A19 A;  3KF8 B;  1N33 L;  1VS0 A;  3HOZ G;  4LUV A;  1PH3 A;  1X65 A;  3Q8D A;  4LF5 L;  3F2B A;  4B3M Q;  4UP7 A;  3PO2 G;  3HOU G;  5IYB H;  2ALY B;  1W2B A;  4OWT B;  4LF8 L;  2WP8 J;  4GN3 B;  1I5F A;  4IJH A;  1HH2 P;  3NEM A;  2KBN A;  3GO5 A;  1UE6 A;  1LYL A;  1MIU A;  5M3F H;  1FJG L;  2VL6 A;  2UXC L;  1JJ2 A;  3I4O A;  1E1T A;  3RLF A;  1IBK Q;  1PH7 A;  3D0F A;  1K9M C;  3AEV A;  4LNQ A;  3OYY A;  3K80 C;  4A3I G;  4HJ5 A;  3I4N H;  3A74 A;  3BU2 A;  3PCO B;  4DV0 L;  2EQS A;  1X56 A;  5IWA Q;  4DUZ Q;  3HOW H;  4A93 H;  5BR8 Q;  4A3E G;  2VUM G;  3CD6 A;  2F3I A;  1ASY A;  1TWH H;  5EAY A;  2XTI A;  1Q82 C;  1Y1V H;  4JI7 Q;  1HNW L;  3T1Y Q;  3KLW A;  4A3G H;  1PFS A;  2PQA A;  4XIG S;  2H5X A;  2EXD A;  4DR4 Q;  5DLQ E;  5HY6 A;  4YHH L;  1CKN A;  2V1C C;  4KLK A;  4IJL A;  1HR0 Q;  1OTC A;  1EFW A;  3CC4 A;  4NXN Q;  3S1N H;  3KDF A;  2VQF L;  4DV3 Q;  5IYB G;  1SMX A;  4PMW A;  1N33 Q;  1PYB A;  2K5H A;  4DV2 Q;  3OW2 A;  3K8A A;  1EQQ A;  2Q2I A;  1NE3 A;  4LWC A;  1K73 C;  3WWV A;  2F4V L;  2MO0 A;  4JV5 L;  1BVS A;  2A8V A;  5GRO A;  1PVO A;  3L0O A;  2K5N A;  1FL0 A;  1YHB A;  2IHE A;  1E7Z A;  5M3F G;  5LMU Q;  4YCW A;  4OO1 I;  4OO1 G;  5FLX c;  4JBM A;  1VQB A;  4WJ3 M;  3HOX H;  3MEF A;  1I94 L;  4BBS H;  3BZK A;  4A4I A;  3HOW G;  1L1O B;  2RF4 A;  4BY7 H;  2N49 A;  5K36 G;  2YV5 A;  2JA6 H;  1WJJ A;  3NEL A;  3ER0 A;  1IBL Q;  4DNI A;  5M5X H;  1Y1V G;  3HFZ B;  1QVG A;  4LUO A;  1KD1 C;  2ZTE A;  3NEN A;  4C3J H;  1Z47 A;  4DV5 L;  3KYH C;  2KEN A;  5GAH C;  1VQP A;  3K7U C;  4DAM A;  1PH5 A;  2ES2 A;  3KF6 B;  4H02 A;  1N36 L;  1KRT A;  4LF9 L;  2E5L L;  2UXD Q;  1XPU A;  3EN2 A;  4LF4 Q;  3T1H L;  1NJI C;  3CME A;  3CCL A;  3UDG A;  2R92 H;  4GKK L;  4QQB X;  4NB3 A;  3CMA A;  4JI3 L;  2KCM A;  4POG A;  3CC2 A;  1HNZ Q;  2K14 A;  4QY7 A;  2QA4 A;  5C4X H;  1V43 A;  3ULJ A;  3J7Z C;  3RNU A;  4KHP Q;  5FLM G;  4X65 L;  3TRZ A;  4DV7 Q;  3GTP H;  2ZTD A;  2GVA A;  5AJ3 L;  1OXX K;  4GLX A;  3OTO Q;  3M7N A;  4P74 A;  2I5L X;  3HOX G;  2GVB A;  4BBR G;  1KL9 A;  4A76 A;  3J7A 5;  1N32 Q;  1S72 A;  3CPF A;  2F4V Q;  4L5T A;  3ZJY C;  2JA6 G;  4B3M L;  4A3C H;  4P71 A;  3K0X A;  2YTY A;  4OWX B;  4DV4 Q;  4X64 Q;  1CUK A;  4PG3 A;  3D31 A;  4JI0 L;  2CKZ B;  3HOZ H;  4IOC A;  1CKO A;  1OXU A;  3GDE A;  4GN4 B;  1KRS A;  4IPC A;  2NVY H;  3PO2 H;  1X3F A;  2VS1 A;  2CFM A;  1FGU A;  2VW9 A;  3CP0 A;  2N3S A;  1HZA A;  3ULL A;  1GKH A;  1YHQ A;  2Q2U A;  1XNR Q;  5C4J H;  2R7F A;  2LSS A;  1YZ6 A;  1QVF A;  1G51 A;  1K8G A;  1X54 A;  4TQU S;  4LFA Q;  1B8A A;  1E3P A;  5E7N A;  5JJK A;  4DUZ L;  1PYS B;  5IWA L;  3PF5 A;  2VNU D;  2QEX A;  1UEB A;  2YTV A;  5BR8 L;  4KHZ A;  1QUQ A;  1AH9 A;  3PGZ A;  3K7A H;  4JC0 A;  3TS0 A;  4B3R Q;  5C4X G;  3M4Q A;  2YYZ A;  4J15 A;  4JI7 L;  3T1Y L;  2UXB Q;  1PA6 A;  1OXS C;  4A3D H;  1VQ8 A;  4UY8 C;  1BBW A;  1K0R A;  4DR4 L;  1HJP A;  3J80 i;  2RCN A;  1VQD A;  1HR0 L;  5LMN Q;  2K4K A;  1X6O A;  2BH2 A;  3PF4 A;  3A0J A;  2YTX A;  4A3C G;  4JG2 A;  1KHI A;  4QGU A;  5GAD C;  4DV3 L;  1K8A C;  1QZH A;  3PO3 H;  1I6H H;  4JBJ A;  1X3E A;  5C3E G;  4DV2 L;  2NN6 G;  3HOY H;  1VQO A;  1L0W A;  3GTO H;  4LW1 A;  3VDY A;  4IO9 A;  1EUJ A;  5GQO A;  3TQY A;  3UE1 A;  2MQH A;  1IZ6 A;  2JK8 A;  4GN5 A;  3W5O A;  5LMU L;  4RMF A;  2NZO A;  2JA8 H;  2Q2H A;  1I3Q H;  1VQH A;  4GNX B;  3E9I A;  4JI0 Q;  2PMZ E;  2UUC L;  3S24 A;  2PI2 E;  4APV A;  4B3S Q;  5IT9 c;  2CQO A;  1PH1 A;  1SN8 A;  1Q81 C;  1YNX A;  4R4Q A;  1XNQ Q;  1EQR A;  1IBL L;  4X6A H;  3STB C;  3G6E A;  1TWG H;  1YJN A;  3F8T A;  1VQE A;  2QGQ A;  1YHA A;  4UP8 A;  4YWK A;  2PQA B;  3U58 A;  1PH8 A;  1PV4 A;  4QJF A;  5IP9 H;  4PZ6 A;  1VQ5 A;  1CKN B;  2UXD L;  4JI2 Q;  1KXL A;  4A3J G;  3KJO A;  1U0L A;  4KI0 A;  4Y7N H;  4LF4 L;  3PO3 G;  1UE7 A;  3H15 A;  4NXM Q;  5IYC G;  2JA7 G;  1VQK A;  4L5Q A;  2JEA I;  3HOY G;  3LGJ A;  3PUW A;  3GTG H;  3HKS A;  1HNZ L;  1CSQ A;  4KHP L;  1SFO H;  3E0E A;  1S3O A;  3U50 C;  5M5W H;  3RLO A;  4DV7 L;  2JA8 G;  4UPA A;  1K3R A;  1HZ9 A;  3DM3 A;  1A63 A;  3OTO L;  4JCV E;  2HQL A;  3M85 A;  1N32 L;  2E2H H;  3J81 j;  4DR6 Q;  4DPG A;  3CCS A;  2HHH Q;  2AHO B;  5FLM H;  4A3L H;  1N9W A;  3STB D;  4DV4 L;  1VQ7 A;  1BBU A;  1Q8K A;  1SRU A;  1KQS A;  4X64 L;  4DV1 Q;  3ICE A;  3CCM A;  4BBR H;  2JA9 A;  2UUC Q;  1YVC A;  1M90 C;  1IXR A;  1SE8 A;  4OON A;  5IP9 G;  2WB1 G;  1XNR L;  2IX0 A;  4DR2 Q;  3ERS X;  4JI4 Q;  1PH9 A;  4P75 A;  3UDF A;  3PV0 A;  2MNA A;  1PH4 A;  4K0K L;  4LFA L;  1GO3 E;  3CCE A;  2YU9 H;  1C0A A;  1VQF A;  2D0P A;  2ZJR A;  3J81 i;  1J6Q A;  1WOC A;  4JI5 Q;  4B3R L;  1YIT A;  3BJU A;  4X66 L;  4LFC Q;  4DR5 Q;  1X3G A;  4OX9 Q;  4A3B H;  4LFB Q;  2IY5 B;  2Q2T A;  3HOV G;  1NMF A;  3M4O H;  2UXB L;  1X55 A;  3RZD H;  2JA5 H;  1Q7Y C;  4JYA Q;  4POF A;  1X9N A;  1Q1E A;  4UP9 A;  3GTQ H;  3IRB A;  2B63 G;  2OWO A;  3S14 H;  3W1B A;  5LMN L;  1WI5 A;  4L5S A;  4A3L G;  2WB1 E;  4AQY Q;  2B29 A;  4DK3 C;  1XJV A;  3RN5 A;  3UE0 A;  1SRO A;  4JBK A;  1L1O A;  5FJ8 H;  1KIX A;  2HT1 A;  2UUA Q;  4HID A;  3J80 c;  1Y1W H;  4A3D G;  4MTN A;  4OWW B;  1QZG A;  2OQ0 A;  3M9B A;  4NPS A;  2NVQ H;  4GLA C;  1G6P A;  2IHF A;  1EIY B;  1CSP A;  1L1O C;  3K81 C;  1MKH A;  2BH8 A;  3AFQ A;  4MNO A;  1HNX Q;  5C3E H;  4GOP B;  4DKA C;  1XTD A;  1UE1 A;  5JJL A;  1E22 A;  3KF6 A;  1YEZ A;  4B3S L;  1V1Q A;  4DR3 Q;  5C0X J;  2ID0 A;  1IYJ B;  3PUX A;  5C44 H;  1TWC H;  4PZ7 A;  1VQ9 A;  5IY0 A;  3S17 H;  3CPW A;  1XNQ L;  2VY3 A;  3M3Y H;  1EYG A;  2BA0 A;  4A3B G;  3U4V A;  2ZM6 Q;  2I0Q A;  3I4M G;  3G48 A;  4K0K Q;  1EWI A;  3I2Z A;  1MJE A;  2JA5 G;  2E2I H;  2K5V A;  1OXV A;  3PUY A;  3S2D H;  4AH6 A;  1JT8 A;  3B6Y A;  4DR7 Q;  5LMN W;  4JI6 Q;  4X66 Q;  4JI2 L;  3CCQ A;  3S2H H;  1NMG A;  4DAY B;  5GAG C;  1C7Y A;  4NXM L;  1EIF A;  3S1M H;  3JAM i;  5FJ8 G;  4DR1 Q;  4L5R C;  2I5H A;  4JI8 Q;  1N34 Q;  1XPO A;  3ULP A;  1Y1W G;  4C3I H;  4EQ5 A;  1VQM A;  1BKB A;  3I56 A;  4GLV B;  4O2D A;  3RLN A;  2CWA A;  3CXC A;  3G4S A;  3S16 H;  4A3J H;  4OXP A;  3FKI G;  1AE3 A;  3KOJ A;  1PH2 A;  4AYB G;  4PZ8 A;  1FVI A;  3L7Z C;  4EX5 A;  1VQL A;  2UU9 Q;  2N78 A;  3PUZ A;  3EBE A;  2E8G A;  5IYC H;  1XPR A;  2JA7 H;  4IFD G;  2NN6 I;  4AIM A;  2NVT H;  4IPH A;  1H95 A;  5M3M H;  2Z6K A;  4DR6 L;  3AQQ A;  2MO1 A;  3GTJ H;  2HHH L;  2D0O A;  2R7D A;  4A3F G;  4IPD A;  5C44 G;  2ASB A;  3CCJ A;  4LF7 L;  2OTL A;  1Q46 A;  3CCU A;  4YCV A;  2VQE Q;  1RL2 A;  4DV1 L;  3H3V H;  1HZC A;  3CAM A;  2Z6K C;  5J3B A;  5C0X G;  3F2D A;  3RR5 A;  4B3T Q;  4FDB A;  1GD7 A;  4YWM A;  5H1S E;  1LM0 A;  1TWF H;  2OTJ A;  4YY3 Q;  4DV6 Q;  2NZH A;  1YJ9 A;  5IP7 H;  4DR2 L;  4JI4 L;  3A5Z B;  3G71 A;  3CQZ H;  3TEH B;  1HZB A;  3NBH B;  2AKW B;  1DGS A;  4AYB E;  3PIO A;  2DGY A;  3CC7 A;  3S15 H;  2EIF A;  3RZO H;  3PUV A;  4BA2 I;  1Y14 B;  2B3G A;  3SGI A;  5JEA J;  1MJC A;  4JI5 L;  4HJA A;  4HIM A;  4LFC L;  1JB7 A;  1HR0 W;  1T9H A;  1VQJ A;  4DR5 L;  4OX9 L;  4GKJ Q;  4LFB L;  1V9P A;  1LUZ A;  3KDF B;  1NTG A;  1YBY A;  1B7Y B;  4IPG A;  2D62 A;  2F52 A;  4JOI A;  4C3H H;  4ALP A;  1A0I A;  1I50 H;  2WFW A;  4JYA L;  4Y52 H;  1Z9F A;  2VZA A;  5M3M G;  1XMQ Q;  4A3M H;  3J81 c;  4LF6 Q;  2Y0S G;  4A3K G;  3CF5 A;  1PH6 A;  1VCI A;  1QVC A;  1WCM G;  2XGT A;  4R4O A;  1D8L A;  3I55 A;  4AQY L;  3FHW A;  4JOI C;  3HOV H;  4R4T A;  4GNX A;  1O7I A;  3H3V I;  4JI1 Q;  2C35 B;  2MFI A;  1Q86 C;  4MZ9 A;  2UUA L;  2B63 H;  4A75 A;  4JBW A;  1NBW A;  4TVA B;  2JEB I;  1TXY A;  1A62 A;  3FP9 A;  1L2F A;  3H0G G;  3M4P A;  2HIX A;  3UDX A;  4X62 Q;  4GNX C;  4ME3 A;  4LF7 Q;  1WYD A;  4GS3 A;  5IP7 G;  1JJC B;  2K50 A;  1HNX L;  2UUB Q;  1XMO Q;  3UDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...