3F1ZA

Crystal structure of putative nucleic acid-binding lipoprotein (yp_001337197.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.46 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLGKWVKVRGVIVDIRRKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative nucleic acid-binding lipoprotein
publication title The structure of KPN03535 (gi|152972051), a novel putative lipoprotein from Klebsiella pneumoniae, reveals an OB-fold.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Dna binding protein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3f1zA00
1IBKL 1UE7A 1S3OA 5C0XI 1YI2A 1SROA 1QZGA 1NMFA 4XTCS 2OWOA 1XNRL 3HOYH 3OTOL 5IYCH 5C44G 3RN2A 4B3TQ 3HOWG 2Y0SE 1Q1EA 3S15H 4GNXA 2VUMH 4OX9L 2JJQA 3CXCA 4JI0Q 1N32Q 1GVPA 2A1AA 5JJLA 1LM0A 5LMNW 1FJGL 1L1OA 1XNQQ 2K75A 1E22A 1QUQA 2HHHQ 2KBNA 3VDYA 4QQBX 2YV5A 3FP9A 2R7FA 3PGZA 2Y0SG 1IXRA 1G6PA 1LUZA 1NJIC 1EOVA 4FDBA 4C3HH 3NENA 4GN3B 3OTOQ 4RMFA 3I55A 1PH9A 4JI3Q 2NVTH 2A19A 2R92H 2F4VQ 4HJ7A 1PH7A 3HOUH 3G6EA 1B7YB 3HOYG 1H95A 3CCUA 4LFCQ 4OONA 2VNUD 1VQOA 1KC8C 1UE6A 2K5HA 2IT1A 5C0XJ 2VUMG 2I5HA 2K14A 1N33L 3M3YH 1X65A 1N36L 1JT8A 5FJ8H 4HJ9A 3HKZE 2UUBL 1TWAH 4GOPA 3GTPH 3M85A 2PNHA 4DV1L 1S40A 3RZDH 4NB3A 3PUVA 4HIKA 3PF4A 1HR0W 4JV5L 1VQMA 2H5XA 1NY4A 3U58A 2UXBQ 2R92G 3J80c 3PO2H 1I6HH 3HOUG 3HKZG 3HOXG 4X64Q 4JI2Q 1Q46A 4YCUA 4K0KQ 1YHQA 4DR1L 1SMXA 4PMWA 2UUBQ 2A8VA 4Y52H 4P71A 2AMCB 2ID0A 1PH6A 3TQYA 4R4CA 3CCQA 4JI1Q 4IJHA 3G4SA 1BBUA 2JA5H 2VS1A 3CC2A 2KCMA 3TS2A 1PYSB 4LF4L 4LFBQ 4DV4L 1KRTA 1RL2A 3W1GA 1HJPA 1RIPA 1EYGA 1XMOL 3M4OH 1PH1A 4IPGA 1J5EL 1PH4A 3H3VH 4NXNL 5C0XG 4R1JA 3J81c 2QGQA 1WYDA 4YWKA 2E5LL 4DV3Q 3T1YQ 3ICEA 2OTLA 1AE3A 1P16A 1VCIA 5IWAQ 5C3EH 4A3IH 1N34Q 2I0QA 4BBRG 1QVGA 2KHJA 2V1CC 5GQOA 3JAMc 2CWPA 3B6YA 3CCJA 4DV6Q 4GNXC 2WP8J 1HNWL 1L2FA 4LW1A 1Z9FA 4ALPA 4IPDA 1L1OC 2JA5G 3ERSX 1PFSA 4OWTB 2Z0SA 4DV4Q 1K83H 2BA0A 2NVQH 1T9HA 1K0RA 2N3SA 1VQ9A 1GKHA 1Y1VG 4L5RC 4DV0Q 1ASZA 1LYLA 5GAEC 4HJ5A 5H1SE 4C2MH 4JI7L 3J81i 2F3IA 3KOJA 1HNWQ 4P74A 4JI5L 2VQFL 5C3EG 2WB1E 3PCOB 5M5XH 4A3JH 4DUZL 2Z6KA 4R4QA 2BH8A 3CD6A 3A5UA 1EUJA 3RR5A 2RF4A 1IL2A 4JG2A 2UXCQ 4A4IA 3A5ZB 4GOPC 2LXJA 5FLMH 1VQ7A 1VQGA 3AFPA 2KCTA 3FKIH 1V1QA 2YU9H 4A3LG 3K8AA 1YITA 2Q2HA 3CCMA 1PH5A 4A3EH 4LF9L 3HOVH 4MZ9A 2ZTCA 2XTIA 4GKKQ 3CC7A 2WAQE 1XMQQ 4JI5Q 4LF5Q 5K36G 3CPWA 2NZHA 1NE3A 3AQQA 1CKOA 3KJPA 3STBC 3AFQA 4YHHQ 2VQEL 4GLVB 1X3GA 1VQ5A 1CKNA 4A3GG 3K81C 3EBEA 1G51A 3CCEA 2ZJRA 4X66L 5C44H 3U4ZA 4B3SQ 3HOZG 4JYAL 1JMCA 4A3EG 2B63G 3HOVG 3CMEA 5IE8A 1OXXK 5IP9G 3CQZH 1YNXA 1QZHA 5M5YH 4WJ4A 2HIXA 4JBWA 2VQEQ 1DGSA 4JI6L 1E3PA 3GDEA 1K3RA 1NMGA 3PUWA 3KF6A 5LMUQ 4JI8Q 1Q86C 1VQDA 1VQCA 1X6OA 3L2PA 3D0FA 1Q7YC 4DV7L 1HNXL 2CCZA 3IRBA 4QGUA 1YVCA 1KD1C 1TWFH 4POGA 1M1KC 1V9PA 3PUYA 4DV2Q 4B3ML 1EQQA 1XTDA 4LWCA 2UUCL 4A75A 1SRUA 1VQJA 2N49A 3JC66 3J7A5 4AYBG 4AQYL 5AJ3L 4KHPL 2R93G 1KRSA 2F52A 4DK3C 1VQHA 1OXSC 5BR8Q 1Q82C 4DR4Q 1Q81C 1M90C 4LF7L 4X6AH 1VQIA 3BZCA 3TS0A 1IBKQ 4Y7NH 1XNRQ 1VQ6A 1CKMA 4B3MQ 3GTMH 2KENA 4O2DA 2Z6KC 4DR6L 3AEVA 3M7NA 5IP7G 3HKSA 3HOXH 2Q2TA 1EQRA 4OX9Q 4OO1I 1HZCA 1G291 3LGJA 1NTGA 2CKZB 5AJ3Q 3S2DH 4DR7L 4C3JH 2I5MX 1FJGQ 1VQBA 1Z47A 2D0PA 3J7ZC 3CF5A 4X62L 3KJOA 2R7DA 3T1HL 3CCSA 1CKNB 4C3IH 3UDIA 3HFZB 1QVCA 2CQOA 3EIVA 4YCVA 1KL9A 1YHBA 4OWXB 1UE1A 4DV5L 3CPFA 1OXVA 2JEBI 4DPGA 1A0IA 1MJEA 3M9BA 1VQ8A 1UE5A 1R9TH 3KYHC 1PV4A 5DLQE 1WCMH 1W3SA 5GAGC 1Y1WG 1IYJB 2JA8G 4LUVA 4O0AA 3U50C 1PH2A 1N33Q 1N36Q 1TXYA 2XGTA 3D31A 2UXDL 1SN8A 2JK8A 1E24A 4BBRH 4A3CH 4DV1Q 1WJJA 3M4QA 4A3BH 1UWVA 4JV5Q 3K80C 4LF6L 1E1OA 2WFWA 3RLFA 4DNIA 3BU2A 3S1QH 1MKHA 4QIWE 1ASYA 1OTCA 4LNQA 1N8RC 4XIGS 3PSIA 3I4MG 3S2HH 3J80i 4GNXB 2ZJPA 1WCMG 1Y1VH 1WFQA 2AKWB 3F1ZA 4PZ7A 2QEXA 4DR1Q 2UU9L 4JI4L 4MNOA 1L1OB 3E9HA 2GVAA 4IOAA 3KF8B 1QUQB 3S1RH 1X56A 1VQLA 4HIMA 2PI2E 1PA6A 1X3EA 4A3BG 1I50H 1OXUA 4YY3L 1PHJA 3L0OA 3NBHB 2NN6I 1P8LA 1SE8A 2N78A 3S24A 4LF4Q 2VL6A 4ME3A 2HT1A 1JJGA 4JI4Q 4QL5A 1XMOQ 4KLKA 5ELNA 1J5EQ 4A3LH 1YJWA 4NXNQ 1D8LA 2ASBA 2E5LQ 1N9WA 3E0EA 1IBLL 2LXKA 1X54A 2JA9A 4H02A 3CCRA 1PH8A 4HIDA 4GOPB 1C9OA 2OQ0A 1A63A 2UUCQ 1SFOH 4OO1G 1VQPA 1KIXA 1I5FA 4GKJL 3TREA 4EX5A 2K50A 2L15A 1HZBA 4TQUS 4GS3A 3JAMi 2JA6H 4DR5L 1K73C 2NVYH 4A3GH 4BY7G 4X65L 3BJUA 3PIPA 5IY0A 4OWWB 5FLXc 4A3CG 3L7ZC 3GTKH 4DKAC 4YCWA 1I94L 1IBLQ 1Q12A 1Q8KA 1SLJA 2WB1G 3KDFA 1L0WA 3PUZA 4EQ5A 3OYYA 4JI7Q 2JA7G 2B63H 1XPUA 3HOZH 5M3MG 3I4NG 4LUZA 3EN2A 3NEMA 3UE0A 1LTLA 1X3FA 5IP9H 2VQFQ 4DUZQ 5JEAJ 1C7YA 2JE6I 2HIVA 3A74A 1YBYA 4YWMA 4DK6C 1X9NA 1K9MC 1GM5A 3I2ZA 3OW2A 3ULPA 2JA6G 4GLXA 4MTNA 4LF8L 4NXML 2WAQG 2OQKA 4HJAA 1HNZL 1FL0A 2PQAA 4LF9Q 3S1MH 4DAYB 4L5QA 2PI2A 1YJNA 3H0GG 4L5SA 4A3KH 2VW9A 1JB7A 2R93H 3RLOA 3GD7A 3U4VA 1JE5A 2E2HH 3F8TA 2MO0A 1U0LA 2K5VA 4R4OA 4UPAA 4A93G 4GLAC 1VQAA 1YEZA 4IPCA 4APVA 2C35B 2K4KA 2UUAL 4X66Q 1HNZQ 4DAMA 3G48A 4JYAQ 5IP7H 4A3DG 3BZKA 4WJ3M 4P73A 4DUYL 4OXPA 2YTXA 2CWAA 4GN5A 3W5OA 1BBWA 5M5WH 4A76A 1EFWA 4YWLA 4DR3L 2VZAA 4A3KG 3ER0A 4NPSA 3J81j 5JEAG 4JI6Q 4RG1A 4UP7A 3K7AH 1EIYB 3S1NH 4B3RL 4B3TL 1Y14B 3TRZA 1D7QA 1IBML 5HGQA 3UDFA 4DV7Q 1HNXQ 3DM3A 3F2CA 4UY8C 4A3FG 1N32L 2B29A 4UP9A 4BBSG 3CAMA 4IFDI 2EQSA 2NZOA 3KLWA 4UP8A 1BVSA 1Y1WH 2HQLA 3I4OA 2HHHL 5ELOA 2MNAA 4DR3Q 2JA8H 4AQYQ 5GADC 3CMAA 1GO3E 4KHPQ 5E7NA 5HY6A 2Q2UA 4JI3L 3S14H 4B3RQ 2OCEA 2F4VL 2R7ZH 1C0AA 1IBMQ 4LF7Q 3I56A 2ATWA 2MQHA 4LFCL 3FHWA 1YIJA 2EIFA 3E9IA 3CW2C 4BA2I 1KHIA 2PQAB 4DR6Q 1UEBA 2RHSB 4IJLA 5IT9c 2ES2A 1CSQA 2JEAI 3I4MH 2D62A 2IX0A 3F2DA 4DR7Q 4IFDJ 1B70B 1K8AC 1MIUA 4X62Q 3GTGH 3H3VI 3T1HQ 1CUKA 2NVXH 1VQFA 2UXBL 3PV0A 5IYCG 3KF6B 2ZTEA 3PUXA 1YHAA 4JBMA 2R7ZG 3PO3H 3A0JA 4X64L 4DV5Q 2BA1A 4JI2L 1VS0A 3WWVA 4K0KL 1PYBA 2MO1A 1NBWA 4QJFA 4A3MH 1TWCH 2ZM6L 3K0XA 1EIFA 1A62A 1TWHH 4QY7A 4JI1L 3S17H 3TEHB 4AIMA 2IHEA 3CCLA 2UXDQ 5C4XH 1EWIA 3H15A 1MJCA 2QA4A 3G71A 4LFBL 2MFIA 2IX1A 1A8VA 1U5KA 1YJ9A 5GROA 4LF6Q 3PO3G 3GTOH 2OTJA 2EXDA 3GTLH 4P75A 2ZM6Q 2CFMA 1VQNA 4BY7H 4PG3A 5FJ8G 4DV3L 2DGYA 3UE1A 3T1YL 5IWAL 1N34L 2E2JH 2IY5B 4A3MG 2BH2A 1JJCB 1E1TA 3RN5A 1S72A 2AHOB 3M4PA 4JCVE 4DV6L 3ZJYC 2UU9Q 1XPOA 2JA7H 4LUOA 4IFDG 4JC0A 2VY3A 3CC4A 4BY1H 5M3MH 3GO5A 3I4NH 3GTJH 3PO2G 5C4XG 1HZ9A 2Q2IA 2YTYA 1VQKA 4PZ8A 1X55A 2B3GA 2YYZA 3STBD 4YY3Q 1V43A 2I5LX 2LSSA 4JOIA 4DV0L 4HJ8A 4IOCA 2E8GA 1TWGH 2ZJQA 2R6GA 1PH3A 1OXTA 1J6QA 1I3QH 2DUDA 1KQSA 2IHFA 3DLLA 5M3FH 3SGIA 3F2BA 3H0GH 3RNUA 2UXCL 2GVBA 3K7UC 3MEFA 2ZTDA 4BY1G 4AH6A 1XJVA 1B8AA 4GKJQ 1KAWA 2KHIA 4P72A 1JJ2A 4BXXH 4IPHA 3UDXA 1IZ6A 1BKBA 4DR5Q 2FXQA 4A93H 4X65Q 2RCNA 4GKKL 1XMQL 5LMNL 4LF5L 4A3IG 4R4TA 5JJKA 1YZ6A 3NELA 1SR3A 4R4IA 3PF5A 1I94Q 3GTQH 3AYHB 1K8GA 3S16H 4KHZA 4TVAB 1VQ4A 3RZOH 3I7FA 1WI5A 4A3DH 2AWOA 4YHHL 2YTVA 2AWNA 1W2BA 5M3FG 4J15A 3KFUA 1AE2A 2N8NA 3RLNA 1FGUA 2GN5A 4DR2L 4LFAL 4BXXG 5LMNQ 4GN4B 1XPRA 4B3SL 3PIOA 1HZAA 4L5TA 5J3BA 4KI0A 5IYBH 4A3FH 4LF8Q 4NXMQ 4BBSH 5JJIA 4HIOA 4A3JG 4JBKA 5LMUL 1QVFA 5IYDH 4JI8L 1HH2P 4BA1I 2NN6G 4JBJA 1HR0L 2E2IH 5FLMG 5C4JH 3CCVA 3FKIG 4LFAQ 4DR2Q 3UDGA 2RHQB 3ULLA 3HOWH 2K5NA 1Q1BA 4DV2L 4PZ6A 1WOCA 4POFA 1VQEA 1KXLA 3Q8DA 5GAHC 1GD7A 2UUAQ 1AH9A 3CP0A 4IO9A 2D0OA 5IYBG 4JI0L 2PMZE 3MXNB 3ULJA 3W1BA 2ALYB 2JQOA 3KDFB 4JOIC 4AYBE 5BR8L 5EAYA 4DUYQ 2K52A 1HR0Q 1XNQL 4DR4L 1CSPA 1FVIA 5IYDG 1E7ZA 1O7IA 1PVOA
chains in the Genus database with same CATH superfamily
1IBKL 1XNRL 2XSCA 3IL8A 1WD0A 2OWOA 3Q23A 2F0MA 2Y0SE 3S15H 2MHVA 4GNXA 5JJLA 1FR3A 1LTSD 4JI0Q 1GVPA 3R2IA 1FJGL 5FLXE 1E22A 3HP3A 2EYPA 4QQBX 2YV5A 2J7ZA 1G6PA 4FP5D 4C3HH 3K0YA 2A19A 4ZYSA 1CHQD 4K6DA 1EZ8A 1H95A 5I4DA 2A6HD 4LAAA 4ZAIA 4MHEA 1VQOA 1KC8C 2K5HA 3I8ZA 2VNUD 2B2WC 5A2QE 5C0XJ 1DOKA 2B2YA 4HEDA 1KNEA 1TWAH 1LT3D 1LLRD 4HIKA 4JV5L 5M3MB 4PQXA 4C3HG 2PNRC 3U58A 5DM63 1I6HH 2A69C 1D1KA 3DM1A 4R8NA 1Q46A 1MBYA 2Z8LA 4DR1L 4PMWA 4Y52H 2AMCB 1SJED 4C3IG 1PFNA 3G4SA 2KCMA 3DWQA 2F0UA 4LF4L 4LFBQ 5KEEA 4DV4L 1RL2A 3M4OH 1HJPA 1PH4A 3H3VH 1B44D 4DAYA 1WYDA 4YWKA 4DV3Q 3T1YQ 5CV9A 1HUNA 1VCIA 2I0QA 2UUCL 4GNXC 4KY5A 2EOTA 2RDGA 4ALPA 3FKIB 4IALA 3ERSX 1PFSA 1K83H 1T9HA 4ILWA 1GKHA 4OHJA 4L5RC 3MZ5A 1ASZA 2QF7A 4C2MH 3J81i 4ME5A 4QCLA 3EQLC 3TZDA 4JI5L 2VQFL 4A3JH 4LK1C 1EQVA 2Z6KA 3A5UA 2B2YC 1B2TA 5EPJA 4JG2A 4O42A 3A5ZB 1QE6A 2LXJA 5FLMH 1K8OA 3VR5A 1PH5A 3HOVH 4GKKQ 3CC7A 1F77A 5JJZA 2X6GA 4KKSA 4N8X1 2ZT9C 5E4XA 2TSSA 1CKOA 3P7JA 4YHHQ 2VQEL 4EQPA 1CKNA 1WTHA 2D9UA 3KUPA 2XVSA 2ZJRA 2EJGC 3TMEA 4H7BA 4B3SQ 4JYAL 1JMCA 3HOVG 4IUUA 4F87A 5IE8A 5IP9G 1QZHA 1I6VC 2G9HD 4M8AA 1EOTA 4CDFC 2KEEA 2SDFA 3GDEA 4QUFA 1NMGA 4JI8Q 1Q86C 1VQDA 1SYCA 4C3HB 3L2PA 3DEPA 1Q7YC 1HNXL 4ULLA 3Q0AA 1KD1C 5IIFA 1V9PA 3PUYA 3S2DB 3P20A 3KBGA 2J0TD 1G6ZA 4C3IB 1V1OA 4KHPL 2F52A 4DK3C 2NYZD 2B8GA 1Q81C 1M90C 4X6AH 3HRZC 1VQIA 3A56A 4RGTA 1FD7D 1CKMA 2F0VA 2KENA 4O2DA 2AUJD 2Z6KC 3M7NA 5IP7G 4FXGC 3HKSA 4ZLTF 3EA6A 4DR7L 2I5MX 2D0PA 3T1HL 1MSGA 4HCEA 2JP1A 1QVCA 1SJHD 2CQOA 4YCVA 5JVG3 3CPFA 1OXVA 1H9KA 2JEBI 4DPGA 3KLSA 4C1NI 1VQ8A 1ESFA 3M4OB 1II3A 4KKUA 1IYJB 1XX8A 3SK8A 2JA8G 3U50C 1EY9A 4O0AA 1M4VA 5D14A 5C0XH 1PH2A 1FNUA 1TXYA 3LWEA 1DOMA 4FXKC 4BBRH 4A3CH 2A6ED 3C1EA 1JOKA 3K80C 1E1OA 2KQ3A 1WTXA 4QIWE 4LNQA 3PSIA 1GUTA 3I4MG 3S2HH 1SE2A 4G7ZC 1K0SA 2AKWB 4PZ7A 4C2MB 4JI4L 1L1OB 1C48A 4A3JB 3KF8B 2AUKA 2Z1CA 2A5HA 2NVYB 2QDLA 2BDNA 1SYFA 2O2LD 1SSOA 2EJFC 3L0OA 3VYUA 2N78A 4ME3A 2HT1A 5C3XA 2NTSA 3W2DA 1J5EQ 3HOVB 4A3LH 1YJWA 1D8LA 2E5LQ 4XT1B 3E0EA 1X54A 2JA9A 1HXYD 3ONAB 4RHSA 5JOBA 4B9WA 4OO1G 4GKJL 2IL8A 3TREA 4V0BA 4IUPA 4GS3A 3BYYB 2JA6H 1KDAA 4BS9A 4A3GH 4RWSC 4JVZA 4X65L 5IY0A 5FLXc 1PZJD 2PMZB 1SDFA 2EPBA 2R61A 2EVBA 4DKAC 1I94L 4UHVA 1IBLQ 2WKCA 4FF1A 1L0WA 3SHLA 3OYYA 3PIO3 2B63H 1XPUA 3I4NG 1IL8A 1UEAB 1LTLA 5CYUA 2KCNA 5DM73 5JEAJ 1ILPA 1ZYRC 2HIVA 1X9NA 3EFXD 4TSSA 1WD1A 2JA6G 4L63B 3SR1A 1S5CD 1HNZL 2L5TA 1JORA 3L3OC 2PI2A 1CA5A 1VDZA 1YNJC 3RLOA 3T4AC 3GD7A 3U4VA 1JE5A 2E2HH 2MO0A 2K5VA 5CBAE 3QB3A 2B39A 4GLAC 1JE4A 2C35B 2K4KA 3URYA 2EYLA 4X66Q 2JA8B 5BN4A 3BZKA 4KN4C 3J81E 5C5LA 3K5OA 4HAEA 4A76A 1EFWA 4YWLA 3X3MA 3IFTA 4NKLA 1F2ZA 1SYDA 4A3FG 4OGQC 3I4MB 4CGYB 1BVSA 1Y1WH 4ZKCB 1KAAA 2MNAA 3CMAA 1LT4D 2H4OA 1S5BD 1V1PA 5E7NA 2Q2UA 3MAQA 3I56A 2MQHA 3FHWA 1YIJA 1SYBA 1KHIA 3DHQA 4CJ1B 1UEBA 2QKIC 2QDBA 5FOBB 4PV1C 1BR9A 2FJ2A 3F2DA 4IFDJ 3U9SA 4IURA 1MIUA 1EYCA 4KN7C 5IYCG 1A3UA 4R9WA 5T1IA 1YHAA 1AZQA 2NZ1D 3WOEA 3VA5A 2F3VA 1TWCH 1PXUA 3K0XA 2ZM6L 4XYQA 4KTAA 3FMCA 3I91A 3S17H 5EKIA 3I4NB 1IYVA 4KJNA 3P1HA 1HFNA 3CCLA 2UXDQ 5IGBA 1PRTF 1D5XC 4DFAA 1SNPA 3G71A 4LFBL 3DUZA 1B9MA 4LF6Q 2JA6B 3GTLH 4P75A 5JPMC 5COYA 2CFMA 2B2UA 1VQNA 4PG3A 3NBIA 4DV3L 2DGYA 3T1YL 4BY7H 4FYDA 2E2JH 3H3VC 1I4GA 1JJCB 3S9WA 3RN5A 3M4PA 4JCVE 3TN2A 2JA7H 3VR6A 3GO5A 1HZ9A 1AW7A 2YYZA 3STBD 3I4LA 1V43A 2ZJQA 1TIID 1TWGH 3RZOB 2B2TA 4BWGB 1OXTA 1J6QA 4N9PA 4ZRZA 2IHFA 1F9PA 4U68A 5M3FH 1F9QA 1LTGD 1PTOB 2F0QA 2EYOA 3A8IE 5EPKA 3VR2A 3MFGA 2E2HB 2B2VA 1JJ2A 5D3DA 4A3FB 1IZ6A 5LL6S 5ELBA 3RUZA 2FXQA 1C8CA 4GKKL 2RCNA 3LWUA 1WTVA 4R4TA 5JJKA 3NELA 3AYHB 1PRTC 1VQ4A 2PZWA 3I7FA 2P5ZX 1WI5A 4A3DH 5I2YA 5C4JB 1EU3A 2K5WA 3TP6A 4YHHL 2AWNA 1W2BA 5M3FG 4J15A 2DN8A 1FGUA 5JEAH 2GN5A 3I73A 2XRSD 1J9OA 3BZDB 5LMNQ 4B3SL 4L5TA 5J3BA 1DCZA 4NXMQ 3H91A 1CQFA 1Y1WB 2OT2A 4ZCKA 4JI8L 2B2UC 4DXFA 1M8AA 4DR2Q 1NNXA 3ULLA 3HOWH 1Q1BA 3MTSA 2F0PA 3PMFA 3A8KE 2UUAQ 3CP0A 4I65A 1PLFA 2K5DA 3ULJA 3W1BA 2ALYB 3KDFB 1HR0Q 1IYUA 1FGBD 1BO0A 3MXGA 1PVOA 1EYAA 1S3OA 3HOYH 4QIWB 4XTCS 3QOLA 3U9OA 5C44G 2WACA 3HOWG 2CHBD 4CKBA 2D2CC 2F0FA 5LMNW 2B2VC 1TWCB 1XNQQ 1Y8OB 2K75A 1QUQA 1NJIC 1PH9A 1JQYD 3KK7A 4RMFA 3OTOQ 3I55A 1PH7A 3HOUH 3G6EA 3HOYG 1QCBD 3NTHA 4LFCQ 4OONA 1ZKOA 3GTLB 1UE6A 3SXHA 2F0LA 2I5HA 3TDQA 2B8FA 3M3YH 1X65A 5FJ8H 1EQTA 3GTPH 3M85A 3NTIA 4X3TA 2F0OA 1DONA 3N52A 3PF4A 4IFDH 1HR0W 2H5XA 5DNFA 2UXBQ 1JWUD 3HOUG 3HKZG 3HOXG 1TWGB 1Y69U 1HFGA 4K6LA 1SMXA 3BDOA 2UUBQ 5IGDA 1TKWB 2Z9HA 3K59A 3TQYA 1D5MC 2KVMA 3J7YW 5M3FB 1BBUA 3DWAA 1YNNC 4KJOA 1PYSB 5EPLA 3WOFA 1RKNA 4J6HA 3M7GA 1RIPA 1J5EL 3J81c 2E5LL 1PTOD 3WDNA 1SMYC 3T51B 5FO7B 1VQLA 4C1NK 4DV6Q 4A3DB 2CWPA 3B6YA 2KA7A 2WP8J 1L2FA 3MC0B 1VF5C 2Z0SA 1KDBA 5TSSA 1WTPA 3DMUA 2EXZA 1VQ9A 1Y1VG 5C3WA 1VF7A 1STBA 3KOJA 2JN4A 1D6EC 1HNWQ 4TRDA 2DJFC 1ENAA 1HQMC 3CD6A 5ISRA 3RR5A 4FVMA 1SNQA 2UXCQ 2L9HA 5C44B 5F2DA 3HOWB 2B2WA 5LHY1 1VQ7A 3FKIH 2KCTA 2YU9H 3K8AA 2Q2HA 3CCMA 4IUVA 3J80L 2ZTCA 2XTIA 1TY2A 5K36G 1DYQA 4KMUC 3AQQA 2E75C 2IX3A 3AFQA 4GLVB 1TWFB 1X3GA 1VQ5A 2ICIA 3K81C 4DNRB 3EBEA 3HOYB 3QG1A 2MUYA 5C4ZA 1EY8A 1ICFB 4X66L 1EWCA 1PDQA 1AFPA 2A73B 3HOZG 4HR7B 1OXXK 1STGA 3CQZH 5M5YH 1BCPB 3D3RA 1TR5A 1E3PA 1KLUD 3PUWA 1JWMD 1VQCA 2NBFA 4O1NA 3D0FA 4RKBA 4CKEA 3JAML 3K5NA 3IRBA 3HOUB 3HOXB 4B3ML 1EQQA 1XTDA 4LWCA 4A75A 1SRUA 2N49A 3J7A5 3M3YB 5AJ3L 2R93G 4CDEC 1KRSA 1RODA 3GTPB 1G2TA 1OXSC 1Q82C 1QJOA 2QW7A 3MHBA 5CC4A 1PYWD 2BE5C 2VXWA 4J1MA 1R9TB 4Y7NH 4E6IA 3AMUA 1CA6A 2MP1A 1U4MA 3NBHA 4CBVA 3E5SA 1A2TA 1CTMA 5I2XA 3S2DH 5D65A 3NPPA 3ERQA 2SNMA 2ENBA 1FNVA 3A7AB 3KJOA 4N9TA 2IJ0A 2NTTA 1CKNB 5ELCA 4C3IH 3MEHA 3HFZB 3EIVA 4M1UB 3HG9A 1D5ZC 4Z9CB 5FO8B 1Y1VB 1UE5A 2KHSA 3TBIB 1LT6D 1ICWA 1WCMH 1N33Q 4GZYC 3D31A 1SYGA 4QF4A 2UXDL 1SN8A 1E24A 4IN3A 1D2BA 4DV1Q 3TP5A 1QG7A 1X3QA 3H6MA 4LF6L 4DNIA 3S1QH 2GA4B 1MKHA 1ASYA 3KLRA 1OTCA 5FO9B 1GUGA 1G8ZD 3SVMA 1WCMG 1NR2A 3F1ZA 5EBCA 1A3TA 1K8MA 5KGUA 1HCZA 3MFYA 5EKKA 3E9HA 1CT1D 3VA7A 3IAYA 1BQQT 4NW2A 3AU7A 2A6HC 2SNSA 1I4PA 4HIMA 1X3EA 4MTKA 1OXUA 1E2WA 2F03A 3S24A 3P75A 2VL6A 2YU9B 1JJGA 3HOZB 4QL5A 1XMOQ 1TT2A 5I6YA 1PH8A 3CCRA 4IUNA 3G7LA 4GOPB 5C5MA 1VQPA 1KIXA 1IW7D 1BBXC 3OHXC 4EX5A 4ZUIA 2K50A 2RDHA 4JK1C 1K73C 2NVYH 1LTID 1W6JA 4XT3B 3L7ZC 3ND8A 4YCWA 3MXNA 5IT9L 1SLJA 4KHVA 1PZID 4HSPA 4JI7Q 3CQZB 4HCSA 2R93B 5M5YB 2TMPA 3EN2A 5IP9H 1L0XB 1G91A 5BN3A 5FKAC 1SNCA 4DUZQ 1EEFD 5C6AA 3D4DA 3A74A 4DK6C 4YWMA 2F0DA 1GM5A 4DK0A 3I2ZA 1EWHA 2KJXA 5EKLA 4LMQD 4GLXA 3OW2A 3J80E 2RSOA 1BCPD 4MTNA 4WRDA 4NXML 4LF9Q 1FL0A 1BF4A 4H13C 2XWBB 4WFN3 1B3AA 1DZ1A 3H0GG 1UUPA 5E4WC 2VW9A 1ET6A 1KLGD 4G4KA 4G57A 3D4WA 3F8TA 1U0LA 4UPAA 4Y7NB 4A93G 1VQAA 3E6ZX 1L0YB 2UUAL 4U673 4XQQA 3OMGA 3G48A 2CQAA 5IP7H 2Z6BA 4JW0A 2RBMA 5M5WH 3K5LA 1STEA 2C5CA 2F1MA 1TQOA 4JI6Q 1MD2D 3JAME 4P2CB 2PW5A 1Y14B 1X3PA 4FNFA 3T13A 3BVZA 4BBSG 3CAMA 2NZOA 3KLWA 1WCMB 4K2KA 4WORA 2HQLA 3I4OA 5ELOA 3T56B 4ZKBB 4DR3Q 2JA8H 4AQYQ 1GO3E 4B3RQ 5HY6A 4XQJA 3S14H 2OCEA 1IBMQ 3OWEB 1NUCA 3E3XA 4LF7Q 2RVLA 4LFCL 3R8BA 3S1QB 3CW2C 2BCOA 4CJ2C 4KV6A 1JICA 2Z4IA 4DAPA 4IJLA 1UAPA 1EY0A 1CSQA 3I4MH 2D62A 3QIAA 1K8AC 4X62Q 3H3VI 1JC7A 2UXBL 3PV0A 1H9MA 3KF6B 4WJWA 3GTOB 3V96A 4JBMA 3PO3H 4X3UA 1PMRA 5KNBA 4DV5Q 1WTQA 1VS0A 1SNDA 1PYBA 1TU2B 3V05A 2RSNA 1D1IA 3A54A 1A62A 3AB9A 1TWHH 4QY7A 4K5WA 1MI2A 2CW0D 4DU9A 2IX1A 4OO1H 1A8VA 1U5KA 3CU7A 5GROA 3PO3G 1STHA 2OF1A 2OTJA 2EXDA 5K5PA 2IY5B 4Q0FA 1E1TA 5J39A 3H0GB 4ID6A 4QB4A 4DV6L 2QEJC 4B9XA 1KTKA 4JC0A 4DXGA 4BY1H 3I4NH 5M9OA 1B4OA 3PO2G 1ONLA 4A93B 3NSWA 1BOSA 1SNMA 4IZ8A 2BOSA 4RCOA 5JPNC 3QWNA 4KY7A 5IGGA 5JAVA 3MVVA 2A6EC 4I7AA 1E0BA 4N8FA 3SGIA 3F2BA 2UXCL 2GVBA 4CJ0B 3MEFA 4BY1G 2ZTDA 1B8AA 4P72A 1SAPA 1BKBA 4BBSB 4L8JA 5IT9E 1H9SA 2K01A 4A3IG 1MSHA 4R4IA 1SR3A 3GTQH 3T16A 3RZOH 2E2IB 2NN6H 2YTVA 2O4XA 5M5WB 2R3ZA 1F2MA 1AZPA 4K5XA 3KFUA 1SYEA 1AE2A 3GP7A 3RLNA 1PTOH 1QILA 1XTCD 3FRPB 1UNSA 3PIOA 1HZAA 5IYBH 3VYRA 4A3FH 4FF3A 1ENCA 2HDLA 4RHRA 1STNA 2QILA 4JBKA 3TP8A 5IYDH 4YIJA 4BA1I 2NN6G 4JBJA 5KIXA 4H0LC 3S14B 4OL7A 5C4JH 3CCVA 1AN8A 4LFAQ 2RHQB 4IQZA 3O13A 3DXJC 1WOCA 1CZWA 2DY7A 5NUCA 4POFA 5GAHC 4IO9A 3FDTA 5IYBG 4JI0L 2E2DC 4AYBE 2E76C 2K52A 5IYDG 3ZYYX 3SEBA 1UE7A 5C0XI 1YI2A 1QZGA 1SROA 1EL0A 2L1BA 3PO3B 5IYCH 3RN2A 3FPPA 2JJQA 1SBBB 3CXCA 2A1AA 1CK1A 1LM0A 3BDLA 3MXUA 4CDDC 1L1OA 1TWHB 1XWEA 3I3CA 2MGSA 1G2SA 3PO2B 1EOVA 3NENA 4GN3B 5KNCA 4JI3Q 4QUCA 1V8QA 2F4VQ 1Z6HA 2K32A 3CCUA 3SK4A 2EY6A 2IT1A 3Q22A 2EYMA 1N33L 4HJ9A 2K5QA 3HKZE 4DAVA 4IUTA 5I6WA 2RQXA 2A74C 2PNHA 4DV1L 1S40A 1EY5A 4BY1B 3J80c 1K3BC 4K0KQ 5DEHA 5CMDA 4C3JG 4A3IB 1HHVA 2L4NA 4P71A 4XXEA 4B08A 3RMHA 3CCQA 1SE4A 3NTKA 4JI1Q 4IJHA 1O7YA 3EROA 2VS1A 2VB3X 1LT5D 1KRTA 3W1GA 1EYGA 2AQ1B 1XMOL 3V2TA 1PH1A 4IPGA 2M2LA 1WTRA 4R1JA 2QGQA 1JOOA 3OW7A 5G3LD 3GTQB 2OTLA 2RCFA 5IWAQ 1P16A 5LL6X 5C3EH 4DN4M 4JPBW 1SNOA 2V1CC 5GQOA 4K5VA 1A2UA 3JAMc 3CCJA 4LW1A 1Z9FA 2PCFB 1L1OC 4OWTB 4DV4Q 2NVQH 1Y8NB 2N3SA 3PQIA 4S3SA 4DV0Q 1LYLA 4G7HC 5H1SE 4JI7L 2K1BA 5C3EG 2ZXOA 3PCOB 5M5XH 1B1ZA 5KRUA 4DUZL 4R4QA 2BH8A 2RF4A 1IL2A 3CHBD 3BDCA 2I07B 1FYCA 1F2LA 1JR0D 1XYIA 3X3NA 3AFPA 1V1QA 1YITA 4KD3A 4NP5A 4LF9L 1XMQQ 1S5FD 4JI5Q 2XRQD 4LF5Q 3CPWA 4DGZA 1NE3A 3STBC 1Q90A 3FVQA 2DY8A 3HEJA 1G51A 1HA5A 1BXTA 1MHWC 5C44H 3U4ZA 3CRLC 1YNXA 2F0GA 4KY6A 4WJ4A 1RD9D 3BVMA 1DGSA 3TZUA 2VQEQ 4JI6L 5J22A 5EBDA 5LMUQ 4K8JA 1E2ZA 3A8JE 4QGUA 1YVCA 1TWFH 3T53B 4C3JB 2PO4A 3SDZA 4EQNA 3I70A 1BDOA 4AYBG 4AQYL 1VQHA 5BR8Q 4HTHA 4LF7L 3BZCA 1RJTA 3TS0A 1VMPA 3GTMH 1U4RA 2MPMA 3GQBA 4HMJA 4FO2A 3HOXH 2Q2TA 4OX9Q 1HZCA 1G291 1O78A 4V190 1KABA 1Z47A 3CF5A 1EFID 4X62L 4RGNA 3CCSA 1KL9A 1YHBA 4OWXB 1UE1A 4DV5L 1DD2A 1HA6A 3NQIA 4ODGA 1A0IA 1MJEA 3M9BA 1TS3A 1R9TH 2F0WA 1PV4A 5DLQE 5GAGC 1PFMA 1W3SA 1W6KA 1AP0A 1LV9A 1LO5D 5C3EB 1N36Q 1ENFA 3S1RB 2JK8A 2FMMA 4J8QA 1O7LA 1WJJA 4A3BH 1LTTD 2NVQB 5KNDA 1TS4A 1N8RC 4XIGS 2Z4HA 3J80i 1PTOF 4GNXB 2ZJPA 1Y1VH 2QEXA 3NE5B 1A6XA 4MNOA 1TS5A 2L11A 5M5XB 1BUVT 2A68D 1X56A 3SK6A 1ML0D 2PI2E 1PA6A 5ELFA 2FHTA 4A3BG 4NDXA 3SK5A 1Z7TA 1EZ6A 1GUWA 3NBHB 1SE8A 3I90A 4JI4Q 4QMGA 5IOCA 5KYIA 2CH4W 4NXNQ 1CM9A 1ZXTA 2LS01 1N9WA 1IBLL 2LXKA 4H02A 1BNZA 5K36H 4HIDA 2OQ0A 1VMCA 3Q6SA 5IGFA 2NUCA 2L15A 1HZBA 3JAMi 2K28A 2PZTA 3PIPA 4OWWB 4TKOB 1TY0A 2WIIB 2HUGA 1CHPD 4AYBB 1Q8KA 3HZXA 3KDFA 3HOZH 2NB0A 5M3MG 3HGBA 2CVRA 1K28A 2JE6I 1LACA 1YBYA 1PTOC 2Q8RE 1RHPA 3CKIB 4K14A 4HJAA 2K05A 2PQAA 3NXWA 1O7ZA 4DAYB 4DF7A 1YJNA 4L5SA 1EYDA 2R93H 3NQTA 4R4OA 2M9VA 3GTMB 2HCIA 4RAUC 3IKJA 1HNZQ 1JOQA 2EYHA 3HKZB 4RKLA 4DAMA 2J4XA 3CRKC 4WJ3M 4OIJA 1HTPA 2EY1A 3W5OA 3IFDA 1RCVD 3QOJA 5ELDA 4DK1A 3D6CA 4RG1A 4K8IA 1B53A 3K7AH 5DAUA 3S1NH 3TRZA 5HGQA 2FFKB 3UDFA 4DV7Q 3F2CA 2B29A 4IFDI 3BG3A 1U4PA 3KLSX 4UP8A 3C3LA 2A69D 3LNNA 1H9JA 2NVXB 5GADC 1J8IA 4JI3L 2F4VL 2R7ZH 2AQ2B 4A3BB 1S5ED 1SXTA 2XN9C 2HCCA 2Q8IB 3E9IA 3GV3A 1WTOA 4BA2I 2IWHA 4Q5VA 4DR6Q 1AEXA 3OIPA 5IGCA 2IX0A 1EIHA 2O5IC 5I9OA 5AFWA 1B70B 5E1FA 1VQFA 2DNEA 3PUXA 2R7ZG 3NP8A 4K0KL 3WWVA 3M4YA 1NBWA 4QJFA 4A3MH 1EIFA 3EVQA 3SE0A 1I4QA 4JI1L 4AIMA 2IHEA 5C4XH 3H15A 1MJCA 4KK7A 2QA4A 3OWFA 2F0HA 2EYFA 2OXPA 3GTOH 2ZM6Q 1I3QB 5IWAL 4G7OC 4A3MG 1S72A 3C46A 2UU9Q 1XPOA 1RTNA 3CC4A 1EY7A 3GTJH 5C4XG 1SEBD 2CH4A 1LTBD 2K33A 1X55A 2B3GA 2FINB 4YY3Q 4JOIA 2I5LX 4DV0L 2E8GA 1TVXA 5L37A 2R6GA 3A55A 3H09A 1GHKA 1LABA 3DLLA 3RNUA 3H0GH 3NWTA 1XJVA 2F0SA 5CORA 1XXGA 4BXXH 3UDXA 4DR5Q 1BCPF 4ZK9B 4A93H 1Y8PB 2DJGC 3DEOA 1XMQL 5LMNL 4LF5L 1STYA 1YZ6A 3S16H 3PF5A 1K8GA 4TVAB 2AWOA 1GUSA 1RF2D 2EJMA 1X32A 1S5DD 5HGTA 1KNAA 3K7AB 3S1NB 1WVLA 3MXPA 4DR2L 4BXXG 1U9RA 4PNYA 1CZGA 4GN4B 4RGOS 3QR8A 4KI0A 5CR3A 3VR4A 4LF8Q 4BBSH 5JJIA 2K04A 4HIOA 4A3JG 1IW7C 2F0NA 5LMUL 1DXMA 1I4XA 2LMCB 1HR0L 2E2IH 5FLMG 3UDGA 2R7ZB 3S15B 2XNAC 1HQRD 2K5NA 1PFBA 2OEOA 4PZ6A 1AH9A 2D0OA 3J81L 1ESRA 3NK9A 2JQOA 3OMCA 4JOIC 1RDPD 4DUYQ 5BR8L 1XNQL 2F3WA 1CSPA 1FVIA 4KD4A 2JXMB 1BCPC 2JSOA 4F7XA 1NMFA 3OTOL 2ICEC 4B3TQ 5ELEA 1H9SB 2ZXPA 1Q1EA 2VUMH 4OX9L 1HUMA 1N32Q 1TWAB 4A3MB 2HDMA 2K03A 2BDOA 2HHHQ 2KBNA 3VDYA 3FP9A 2R7FA 3PGZA 2Y0SG 1IXRA 2LKVA 1LUZA 4PMBA 1I6HB 4FDBA 4EQOA 4C56C 1LTAD 2R92H 5C4XB 2NVTH 1NCVA 2HQEA 4HJ7A 2I46A 1B7YB 2K6AA 2VUMG 2K14A 5FK9C 1JT8A 4RFBA 1N36L 2UUBL 4GOPA 1GOZA 3I72A 3ND9A 4OEMB 3RZDH 4NB3A 3PUVA 1EIGA 1VQMA 3GTJB 1NY4A 2R92G 3N6RA 3PO2H 1Q8IA 1TS2A 5J1ZA 4X64Q 4JI2Q 4YCUA 4UDUC 1YHQA 2A8VA 1NAPA 3LX0A 5BN5A 1S4ZA 1WTWA 2ID0A 1PH6A 4R4CA 1K83B 2JA5H 2QCPX 4KKTA 1V1PB 3CC2A 3TS2A 2X69A 2H1EA 3NWSA 5HURA 5EGTA 1MGSA 1EY6A 2IPKD 1ZYRD 1B50A 4NXNL 5C0XG 3ICEA 3C2PA 3S16B 1AE3A 3A7LA 1EU4A 4A3IH 1N34Q 4BBRG 1QVGA 2KHJA 5EQ0A 4A3CG 1HNWL 2KUMA 5I9PA 4HMIA 4IPDA 2JA5G 3J7AF 2BA0A 5T1GA 1GJXA 1YNJD 1K0RA 5CV7A 1PRTB 1O80A 1GUOA 4XDXA 5GAEC 4HJ5A 2F3IA 2CW0C 2D5DA 1DOLA 4P74A 1GHJA 2WB1E 5CV6A 1R4QB 1SE3A 3BS1A 2KEDA 1EUJA 2F0KA 1EEID 4RGMA 4A4IA 2LY7A 4K2LA 4GOPC 1C4QA 1B3QA 1VQGA 4ABNA 4A3LG 3H94A 2K7VA 4A3EH 4NMZA 4MZ9A 2WAQE 4MIUA 2NZHA 3ITPA 4HN7A 2Y0SB 1HRJA 3R2TA 3KJPA 2EY5A 1F9SA 4A3GG 3CCEA 2N55A 5E3FA 1ZEQX 2PQEA 2E74C 2VUMB 1IKLA 3D8GA 4A3EG 2B63G 3CMEA 2HIXA 4JBWA 2WINB 2KOLA 1K3RA 3KF6A 1X6OA 2R92B 1A3VA 2NVTB 4DV7L 2CCZA 1Q3LA 4POGA 1M1KC 1R4PB 4RA8A 4DV2Q 2EY2A 1CI3M 1VQJA 4RCNA 4DA2A 3D6WA 3JC66 3OSOA 1JWSD 2O5JC 2NWGA 4DR4Q 1F9RA 3RZDB 2X6LA 3KF8A 4UAIA 1IBKQ 1XNRQ 1VQ6A 4B3MQ 3HS0C 3OIQA 1JCKB 1RTOA 3AEVA 4DR6L 2XIWA 3F2UA 1EQRA 4OO1I 3LGJA 5AJ3Q 1NTGA 2CKZB 4C3JH 1FJGQ 1VQBA 4MN3A 3J7ZC 4BBRB 2R7DA 2AQ3B 4F88A 3R93A 3UDIA 2JA5B 1KDCA 1DJRD 3S2HB 5A35A 3KYHC 1Y1WG 5C4HA 1PZKD 2VB2X 3VR3A 4LUVA 2L55A 2F0TA 2XGTA 2DNCA 3M4QA 1UWVA 4JV5Q 4CDCC 2WFWA 3RLFA 3BU2A 3J7AV 3BVGA 1T5XD 1U4LA 3K58A 4FF2A 4DR1Q 1WFQA 5G3LF 2UU9L 1H9RA 4IOAA 2GVAA 1QUQB 3S1RH 1PRTD 2KCCA 4A3GB 4ZUJA 1I50H 2C9OA 4YY3L 1PHJA 2F4IA 1QNUA 2F0EA 1P8LA 2NN6I 1HTLD 4LF4Q 2PW7A 2B63B 4KLKA 5ELNA 4A3EB 2ASBA 1DM0B 4XQNA 2RA4A 1C9OA 1A63A 2UUCQ 1SFOH 3VYTA 1I5FA 1QNKA 1JB3A 2V4DA 4TQUS 4DR5L 4BY7G 3BJUA 4LJZC 3GTKH 1Q12A 2WB1G 4EQ5A 2JA7G 3PUZA 3W3AA 5CBEE 2MJ8A 3DWPA 4LUZA 3NEMA 3UE0A 1X3FA 2VQFQ 3KBXA 1C7YA 2EE1A 4OELB 1IHZA 3C1FA 1K9MC 2G9DA 3ULPA 4ZQ3A 4F8MA 4LF8L 2WAQG 2OQKA 5CGKA 4FF4A 3S1MH 3NUCA 4L5QA 3R3OA 2EYJA 4A3KH 1JB7A 1OO9B 1QWYA 4CKCA 4XYOA 3UI2A 1YEZA 2LFNA 4IPCA 4APVA 3QJYA 4JYAQ 3MWYW 4A3DG 5EJWA 4P73A 4DUYL 4OXPA 2YTXA 2CWAA 4GN5A 3VYSA 1BBWA 3K5MA 4A3KG 4DR3L 2VZAA 5KYLA 3ER0A 4NPSA 3J81j 5JEAG 4PMCA 3OPOA 4UP7A 1I4RA 1EIYB 4B3RL 4B3TL 1NSNS 1D7QA 1IBML 1HNXQ 3DM3A 4HSVA 5CV4A 4UY8C 1N32L 2M00A 4UP9A 2EQSA 5D3IB 2L12A 2HHHL 2B2TC 5FLXL 1EY4A 4KHPQ 1C0AA 5CV5A 2SEBD 2ATWA 4CHTB 5JVH3 2WV6D 3QO2A 2IW3A 4L6TB 2EIFA 1YNND 2PQAB 2F0IA 2RHSB 4OIKA 5IT9c 5A2QL 3S17B 2ES2A 2JEAI 4DR7Q 2EZVA 4EVOA 3GTGH 1F2YA 3T1HQ 1CUKA 2NVXH 1SMYD 3Q24A 2ZTEA 5IODA 1I50B 3A0JA 4X64L 2BA1A 4JI2L 4BY7B 2E2JB 3L9AX 2MO1A 1STAA 4H44C 2WB1B 2JA7B 4DNTB 4X3SA 4FXDA 3TSSA 3TEHB 3D4RA 1EWIA 1SFOB 3G6JB 4I7ZC 2MFIA 1GXDC 1YJ9A 2WAQB 3GTKB 5FJ8G 3UE1A 1N34L 2BH2A 2N88A 2JYOA 2AHOB 3ZJYC 4LUOA 4IFDG 2VY3A 3MA2B 5M3MH 2Q2IA 2YTYA 1VQKA 4PZ8A 4IUQA 4RH6A 5CV8A 1B9NA 2LSSA 4HJ8A 4IOCA 3PIP3 4X3KA 1GUNA 2PYKA 2PPBC 1PH3A 4R8IA 3S1MB 2PZUA 2WKDA 1FNWA 1I3QH 2DUDA 1KQSA 1IKMA 2L0CA 1A15A 4A3KB 3K6OA 1ILQA 2KECA 1T5EA 1QB5D 3K7UC 4AH6A 1NR4A 3RD4A 4GKJQ 1KAWA 2KHIA 1QOHA 4IPHA 4X65Q 2G5DA 1E2VA 2EDGA 1I94Q 2A68C 4KHZA 3K57A 2XWJB 2HD3A 3GV6A 2N8NA 2SOBA 3EJIA 3TP7A 4LFAL 1ET9A 2F0JA 1XPRA 1LTRD 2RKSA 2Q8TA 2BE5D 1CFMA 1HPCA 1QVFA 1HH2P 3BYTB 3FPUB 5IGEA 3FKIG 1CQVA 4DV2L 2ZXRA 1KXLA 1VQEA 3Q8DA 3E0JA 1GD7A 4EGVA 2PMZE 1I4HA 3MXNB 3NHHA 2RDFA 4DR4L 5EAYA 3FEWX 3GTGB 1E7ZA 3OOCA 1O7IA 2FMCA
chains in the Genus database with same CATH topology
1IBKL 1UE7A 1S3OA 5C0XI 1YI2A 1SROA 1QZGA 1NMFA 4XTCS 2OWOA 1XNRL 3HOYH 3OTOL 5IYCH 5C44G 3RN2A 4B3TQ 3HOWG 2Y0SE 1Q1EA 3S15H 4GNXA 2VUMH 4OX9L 2JJQA 3CXCA 4JI0Q 1N32Q 1GVPA 2A1AA 5JJLA 1LM0A 5LMNW 1FJGL 1L1OA 1XNQQ 2K75A 1E22A 1QUQA 2HHHQ 2KBNA 3VDYA 4QQBX 2YV5A 3FP9A 2R7FA 3PGZA 2Y0SG 1IXRA 1G6PA 1LUZA 1NJIC 1EOVA 4FDBA 4C3HH 3NENA 4GN3B 3OTOQ 4RMFA 3I55A 1PH9A 4JI3Q 2NVTH 2A19A 2R92H 2F4VQ 4HJ7A 1PH7A 3HOUH 3G6EA 1B7YB 3HOYG 1H95A 3CCUA 4LFCQ 4OONA 2VNUD 1VQOA 1KC8C 1UE6A 2K5HA 2IT1A 5C0XJ 2VUMG 2I5HA 2K14A 1N33L 3M3YH 1X65A 1N36L 1JT8A 5FJ8H 4HJ9A 3HKZE 2UUBL 1TWAH 4GOPA 3GTPH 3M85A 2PNHA 4DV1L 1S40A 3RZDH 4NB3A 3PUVA 4HIKA 3PF4A 1HR0W 4JV5L 1VQMA 2H5XA 1NY4A 3U58A 2UXBQ 2R92G 3J80c 3PO2H 1I6HH 3HOUG 3HKZG 3HOXG 4X64Q 4JI2Q 1Q46A 4YCUA 4K0KQ 1YHQA 4DR1L 1SMXA 4PMWA 2UUBQ 2A8VA 4Y52H 4P71A 2AMCB 2ID0A 1PH6A 3TQYA 4R4CA 3CCQA 4JI1Q 4IJHA 3G4SA 1BBUA 2JA5H 2VS1A 3CC2A 2KCMA 3TS2A 1PYSB 4LF4L 4LFBQ 4DV4L 1KRTA 1RL2A 3W1GA 1HJPA 1RIPA 1EYGA 1XMOL 3M4OH 1PH1A 4IPGA 1J5EL 1PH4A 3H3VH 4NXNL 5C0XG 4R1JA 3J81c 2QGQA 1WYDA 4YWKA 2E5LL 4DV3Q 3T1YQ 3ICEA 2OTLA 1AE3A 1P16A 1VCIA 5IWAQ 5C3EH 4A3IH 1N34Q 2I0QA 4BBRG 1QVGA 2KHJA 2V1CC 5GQOA 3JAMc 2CWPA 3B6YA 3CCJA 4DV6Q 4GNXC 2WP8J 1HNWL 1L2FA 4LW1A 1Z9FA 4ALPA 4IPDA 1L1OC 2JA5G 3ERSX 1PFSA 4OWTB 2Z0SA 4DV4Q 1K83H 2BA0A 2NVQH 1T9HA 1K0RA 2N3SA 1VQ9A 1GKHA 1Y1VG 4L5RC 4DV0Q 1ASZA 1LYLA 5GAEC 4HJ5A 5H1SE 4C2MH 4JI7L 3J81i 2F3IA 3KOJA 1HNWQ 4P74A 4JI5L 2VQFL 5C3EG 2WB1E 3PCOB 5M5XH 4A3JH 4DUZL 2Z6KA 4R4QA 2BH8A 3CD6A 3A5UA 1EUJA 3RR5A 2RF4A 1IL2A 4JG2A 2UXCQ 4A4IA 3A5ZB 4GOPC 2LXJA 5FLMH 1VQ7A 1VQGA 3AFPA 2KCTA 3FKIH 1V1QA 2YU9H 4A3LG 3K8AA 1YITA 2Q2HA 3CCMA 1PH5A 4A3EH 4LF9L 3HOVH 4MZ9A 2ZTCA 2XTIA 4GKKQ 3CC7A 2WAQE 1XMQQ 4JI5Q 4LF5Q 5K36G 3CPWA 2NZHA 1NE3A 3AQQA 1CKOA 3KJPA 3STBC 3AFQA 4YHHQ 2VQEL 4GLVB 1X3GA 1VQ5A 1CKNA 4A3GG 3K81C 3EBEA 1G51A 3CCEA 2ZJRA 4X66L 5C44H 3U4ZA 4B3SQ 3HOZG 4JYAL 1JMCA 4A3EG 2B63G 3HOVG 3CMEA 5IE8A 1OXXK 5IP9G 3CQZH 1YNXA 1QZHA 5M5YH 4WJ4A 2HIXA 4JBWA 2VQEQ 1DGSA 4JI6L 1E3PA 3GDEA 1K3RA 1NMGA 3PUWA 3KF6A 5LMUQ 4JI8Q 1Q86C 1VQDA 1VQCA 1X6OA 3L2PA 3D0FA 1Q7YC 4DV7L 1HNXL 2CCZA 3IRBA 4QGUA 1YVCA 1KD1C 1TWFH 4POGA 1M1KC 1V9PA 3PUYA 4DV2Q 4B3ML 1EQQA 1XTDA 4LWCA 2UUCL 4A75A 1SRUA 1VQJA 2N49A 3JC66 3J7A5 4AYBG 4AQYL 5AJ3L 4KHPL 2R93G 1KRSA 2F52A 4DK3C 1VQHA 1OXSC 5BR8Q 1Q82C 4DR4Q 1Q81C 1M90C 4LF7L 4X6AH 1VQIA 3BZCA 3TS0A 1IBKQ 4Y7NH 1XNRQ 1VQ6A 1CKMA 4B3MQ 3GTMH 2KENA 4O2DA 2Z6KC 4DR6L 3AEVA 3M7NA 5IP7G 3HKSA 3HOXH 2Q2TA 1EQRA 4OX9Q 4OO1I 1HZCA 1G291 3LGJA 1NTGA 2CKZB 5AJ3Q 3S2DH 4DR7L 4C3JH 2I5MX 1FJGQ 1VQBA 1Z47A 2D0PA 3J7ZC 3CF5A 4X62L 3KJOA 2R7DA 3T1HL 3CCSA 1CKNB 4C3IH 3UDIA 3HFZB 1QVCA 2CQOA 3EIVA 4YCVA 1KL9A 1YHBA 4OWXB 1UE1A 4DV5L 3CPFA 1OXVA 2JEBI 4DPGA 1A0IA 1MJEA 3M9BA 1VQ8A 1UE5A 1R9TH 3KYHC 1PV4A 5DLQE 1WCMH 1W3SA 5GAGC 1Y1WG 1IYJB 2JA8G 4LUVA 4O0AA 3U50C 1PH2A 1N33Q 1N36Q 1TXYA 2XGTA 3D31A 2UXDL 1SN8A 2JK8A 1E24A 4BBRH 4A3CH 4DV1Q 1WJJA 3M4QA 4A3BH 1UWVA 4JV5Q 3K80C 4LF6L 1E1OA 2WFWA 3RLFA 4DNIA 3BU2A 3S1QH 1MKHA 4QIWE 1ASYA 1OTCA 4LNQA 1N8RC 4XIGS 3PSIA 3I4MG 3S2HH 3J80i 4GNXB 2ZJPA 1WCMG 1Y1VH 1WFQA 2AKWB 3F1ZA 4PZ7A 2QEXA 4DR1Q 2UU9L 4JI4L 4MNOA 1L1OB 3E9HA 2GVAA 4IOAA 3KF8B 1QUQB 3S1RH 1X56A 1VQLA 4HIMA 2PI2E 1PA6A 1X3EA 4A3BG 1I50H 1OXUA 4YY3L 1PHJA 3L0OA 3NBHB 2NN6I 1P8LA 1SE8A 2N78A 3S24A 4LF4Q 2VL6A 4ME3A 2HT1A 1JJGA 4JI4Q 4QL5A 1XMOQ 4KLKA 5ELNA 1J5EQ 4A3LH 1YJWA 4NXNQ 1D8LA 2ASBA 2E5LQ 1N9WA 3E0EA 1IBLL 2LXKA 1X54A 2JA9A 4H02A 3CCRA 1PH8A 4HIDA 4GOPB 1C9OA 2OQ0A 1A63A 2UUCQ 1SFOH 4OO1G 1VQPA 1KIXA 1I5FA 4GKJL 3TREA 4EX5A 2K50A 2L15A 1HZBA 4TQUS 4GS3A 3JAMi 2JA6H 4DR5L 1K73C 2NVYH 4A3GH 4BY7G 4X65L 3BJUA 3PIPA 5IY0A 4OWWB 5FLXc 4A3CG 3L7ZC 3GTKH 4DKAC 4YCWA 1I94L 1IBLQ 1Q12A 1Q8KA 1SLJA 2WB1G 3KDFA 1L0WA 3PUZA 4EQ5A 3OYYA 4JI7Q 2JA7G 2B63H 1XPUA 3HOZH 5M3MG 3I4NG 4LUZA 3EN2A 3NEMA 3UE0A 1LTLA 1X3FA 5IP9H 2VQFQ 4DUZQ 5JEAJ 1C7YA 2JE6I 2HIVA 3A74A 1YBYA 4YWMA 4DK6C 1X9NA 1K9MC 1GM5A 3I2ZA 3OW2A 3ULPA 2JA6G 4GLXA 4MTNA 4LF8L 4NXML 2WAQG 2OQKA 4HJAA 1HNZL 1FL0A 2PQAA 4LF9Q 3S1MH 4DAYB 4L5QA 2PI2A 1YJNA 3H0GG 4L5SA 4A3KH 2VW9A 1JB7A 2R93H 3RLOA 3GD7A 3U4VA 1JE5A 2E2HH 3F8TA 2MO0A 1U0LA 2K5VA 4R4OA 4UPAA 4A93G 4GLAC 1VQAA 1YEZA 4IPCA 4APVA 2C35B 2K4KA 2UUAL 4X66Q 1HNZQ 4DAMA 3G48A 4JYAQ 5IP7H 4A3DG 3BZKA 4WJ3M 4P73A 4DUYL 4OXPA 2YTXA 2CWAA 4GN5A 3W5OA 1BBWA 5M5WH 4A76A 1EFWA 4YWLA 4DR3L 2VZAA 4A3KG 3ER0A 4NPSA 3J81j 5JEAG 4JI6Q 4RG1A 4UP7A 3K7AH 1EIYB 3S1NH 4B3RL 4B3TL 1Y14B 3TRZA 1D7QA 1IBML 5HGQA 3UDFA 4DV7Q 1HNXQ 3DM3A 3F2CA 4UY8C 4A3FG 1N32L 2B29A 4UP9A 4BBSG 3CAMA 4IFDI 2EQSA 2NZOA 3KLWA 4UP8A 1BVSA 1Y1WH 2HQLA 3I4OA 2HHHL 5ELOA 2MNAA 4DR3Q 2JA8H 4AQYQ 5GADC 3CMAA 1GO3E 4KHPQ 5E7NA 5HY6A 2Q2UA 4JI3L 3S14H 4B3RQ 2OCEA 2F4VL 2R7ZH 1C0AA 1IBMQ 4LF7Q 3I56A 2ATWA 2MQHA 4LFCL 3FHWA 1YIJA 2EIFA 3E9IA 3CW2C 4BA2I 1KHIA 2PQAB 4DR6Q 1UEBA 2RHSB 4IJLA 5IT9c 2ES2A 1CSQA 2JEAI 3I4MH 2D62A 2IX0A 3F2DA 4DR7Q 4IFDJ 1B70B 1K8AC 1MIUA 4X62Q 3GTGH 3H3VI 3T1HQ 1CUKA 2NVXH 1VQFA 2UXBL 3PV0A 5IYCG 3KF6B 2ZTEA 3PUXA 1YHAA 4JBMA 2R7ZG 3PO3H 3A0JA 4X64L 4DV5Q 2BA1A 4JI2L 1VS0A 3WWVA 4K0KL 1PYBA 2MO1A 1NBWA 4QJFA 4A3MH 1TWCH 2ZM6L 3K0XA 1EIFA 1A62A 1TWHH 4QY7A 4JI1L 3S17H 3TEHB 4AIMA 2IHEA 3CCLA 2UXDQ 5C4XH 1EWIA 3H15A 1MJCA 2QA4A 3G71A 4LFBL 2MFIA 2IX1A 1A8VA 1U5KA 1YJ9A 5GROA 4LF6Q 3PO3G 3GTOH 2OTJA 2EXDA 3GTLH 4P75A 2ZM6Q 2CFMA 1VQNA 4BY7H 4PG3A 5FJ8G 4DV3L 2DGYA 3UE1A 3T1YL 5IWAL 1N34L 2E2JH 2IY5B 4A3MG 2BH2A 1JJCB 1E1TA 3RN5A 1S72A 2AHOB 3M4PA 4JCVE 4DV6L 3ZJYC 2UU9Q 1XPOA 2JA7H 4LUOA 4IFDG 4JC0A 2VY3A 3CC4A 4BY1H 5M3MH 3GO5A 3I4NH 3GTJH 3PO2G 5C4XG 1HZ9A 2Q2IA 2YTYA 1VQKA 4PZ8A 1X55A 2B3GA 2YYZA 3STBD 4YY3Q 1V43A 2I5LX 2LSSA 4JOIA 4DV0L 4HJ8A 4IOCA 2E8GA 1TWGH 2ZJQA 2R6GA 1PH3A 1OXTA 1J6QA 1I3QH 2DUDA 1KQSA 2IHFA 3DLLA 5M3FH 3SGIA 3F2BA 3H0GH 3RNUA 2UXCL 2GVBA 3K7UC 3MEFA 2ZTDA 4BY1G 4AH6A 1XJVA 1B8AA 4GKJQ 1KAWA 2KHIA 4P72A 1JJ2A 4BXXH 4IPHA 3UDXA 1IZ6A 1BKBA 4DR5Q 2FXQA 4A93H 4X65Q 2RCNA 4GKKL 1XMQL 5LMNL 4LF5L 4A3IG 4R4TA 5JJKA 1YZ6A 3NELA 1SR3A 4R4IA 3PF5A 1I94Q 3GTQH 3AYHB 1K8GA 3S16H 4KHZA 4TVAB 1VQ4A 3RZOH 3I7FA 1WI5A 4A3DH 2AWOA 4YHHL 2YTVA 2AWNA 1W2BA 5M3FG 4J15A 3KFUA 1AE2A 2N8NA 3RLNA 1FGUA 2GN5A 4DR2L 4LFAL 4BXXG 5LMNQ 4GN4B 1XPRA 4B3SL 3PIOA 1HZAA 4L5TA 5J3BA 4KI0A 5IYBH 4A3FH 4LF8Q 4NXMQ 4BBSH 5JJIA 4HIOA 4A3JG 4JBKA 5LMUL 1QVFA 5IYDH 4JI8L 1HH2P 4BA1I 2NN6G 4JBJA 1HR0L 2E2IH 5FLMG 5C4JH 3CCVA 3FKIG 4LFAQ 4DR2Q 3UDGA 2RHQB 3ULLA 3HOWH 2K5NA 1Q1BA 4DV2L 4PZ6A 1WOCA 4POFA 1VQEA 1KXLA 3Q8DA 5GAHC 1GD7A 2UUAQ 1AH9A 3CP0A 4IO9A 2D0OA 5IYBG 4JI0L 2PMZE 3MXNB 3ULJA 3W1BA 2ALYB 2JQOA 3KDFB 4JOIC 4AYBE 5BR8L 5EAYA 4DUYQ 2K52A 1HR0Q 1XNQL 4DR4L 1CSPA 1FVIA 5IYDG 1E7ZA 1O7IA 1PVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK L;  1UE7 A;  1S3O A;  5C0X I;  1YI2 A;  1SRO A;  1QZG A;  1NMF A;  4XTC S;  2OWO A;  1XNR L;  3HOY H;  3OTO L;  5IYC H;  5C44 G;  3RN2 A;  4B3T Q;  3HOW G;  2Y0S E;  1Q1E A;  3S15 H;  4GNX A;  2VUM H;  4OX9 L;  2JJQ A;  3CXC A;  4JI0 Q;  1N32 Q;  1GVP A;  2A1A A;  5JJL A;  1LM0 A;  5LMN W;  1FJG L;  1L1O A;  1XNQ Q;  2K75 A;  1E22 A;  1QUQ A;  2HHH Q;  2KBN A;  3VDY A;  4QQB X;  2YV5 A;  3FP9 A;  2R7F A;  3PGZ A;  2Y0S G;  1IXR A;  1G6P A;  1LUZ A;  1NJI C;  1EOV A;  4FDB A;  4C3H H;  3NEN A;  4GN3 B;  3OTO Q;  4RMF A;  3I55 A;  1PH9 A;  4JI3 Q;  2NVT H;  2A19 A;  2R92 H;  2F4V Q;  4HJ7 A;  1PH7 A;  3HOU H;  3G6E A;  1B7Y B;  3HOY G;  1H95 A;  3CCU A;  4LFC Q;  4OON A;  2VNU D;  1VQO A;  1KC8 C;  1UE6 A;  2K5H A;  2IT1 A;  5C0X J;  2VUM G;  2I5H A;  2K14 A;  1N33 L;  3M3Y H;  1X65 A;  1N36 L;  1JT8 A;  5FJ8 H;  4HJ9 A;  3HKZ E;  2UUB L;  1TWA H;  4GOP A;  3GTP H;  3M85 A;  2PNH A;  4DV1 L;  1S40 A;  3RZD H;  4NB3 A;  3PUV A;  4HIK A;  3PF4 A;  1HR0 W;  4JV5 L;  1VQM A;  2H5X A;  1NY4 A;  3U58 A;  2UXB Q;  2R92 G;  3J80 c;  3PO2 H;  1I6H H;  3HOU G;  3HKZ G;  3HOX G;  4X64 Q;  4JI2 Q;  1Q46 A;  4YCU A;  4K0K Q;  1YHQ A;  4DR1 L;  1SMX A;  4PMW A;  2UUB Q;  2A8V A;  4Y52 H;  4P71 A;  2AMC B;  2ID0 A;  1PH6 A;  3TQY A;  4R4C A;  3CCQ A;  4JI1 Q;  4IJH A;  3G4S A;  1BBU A;  2JA5 H;  2VS1 A;  3CC2 A;  2KCM A;  3TS2 A;  1PYS B;  4LF4 L;  4LFB Q;  4DV4 L;  1KRT A;  1RL2 A;  3W1G A;  1HJP A;  1RIP A;  1EYG A;  1XMO L;  3M4O H;  1PH1 A;  4IPG A;  1J5E L;  1PH4 A;  3H3V H;  4NXN L;  5C0X G;  4R1J A;  3J81 c;  2QGQ A;  1WYD A;  4YWK A;  2E5L L;  4DV3 Q;  3T1Y Q;  3ICE A;  2OTL A;  1AE3 A;  1P16 A;  1VCI A;  5IWA Q;  5C3E H;  4A3I H;  1N34 Q;  2I0Q A;  4BBR G;  1QVG A;  2KHJ A;  2V1C C;  5GQO A;  3JAM c;  2CWP A;  3B6Y A;  3CCJ A;  4DV6 Q;  4GNX C;  2WP8 J;  1HNW L;  1L2F A;  4LW1 A;  1Z9F A;  4ALP A;  4IPD A;  1L1O C;  2JA5 G;  3ERS X;  1PFS A;  4OWT B;  2Z0S A;  4DV4 Q;  1K83 H;  2BA0 A;  2NVQ H;  1T9H A;  1K0R A;  2N3S A;  1VQ9 A;  1GKH A;  1Y1V G;  4L5R C;  4DV0 Q;  1ASZ A;  1LYL A;  5GAE C;  4HJ5 A;  5H1S E;  4C2M H;  4JI7 L;  3J81 i;  2F3I A;  3KOJ A;  1HNW Q;  4P74 A;  4JI5 L;  2VQF L;  5C3E G;  2WB1 E;  3PCO B;  5M5X H;  4A3J H;  4DUZ L;  2Z6K A;  4R4Q A;  2BH8 A;  3CD6 A;  3A5U A;  1EUJ A;  3RR5 A;  2RF4 A;  1IL2 A;  4JG2 A;  2UXC Q;  4A4I A;  3A5Z B;  4GOP C;  2LXJ A;  5FLM H;  1VQ7 A;  1VQG A;  3AFP A;  2KCT A;  3FKI H;  1V1Q A;  2YU9 H;  4A3L G;  3K8A A;  1YIT A;  2Q2H A;  3CCM A;  1PH5 A;  4A3E H;  4LF9 L;  3HOV H;  4MZ9 A;  2ZTC A;  2XTI A;  4GKK Q;  3CC7 A;  2WAQ E;  1XMQ Q;  4JI5 Q;  4LF5 Q;  5K36 G;  3CPW A;  2NZH A;  1NE3 A;  3AQQ A;  1CKO A;  3KJP A;  3STB C;  3AFQ A;  4YHH Q;  2VQE L;  4GLV B;  1X3G A;  1VQ5 A;  1CKN A;  4A3G G;  3K81 C;  3EBE A;  1G51 A;  3CCE A;  2ZJR A;  4X66 L;  5C44 H;  3U4Z A;  4B3S Q;  3HOZ G;  4JYA L;  1JMC A;  4A3E G;  2B63 G;  3HOV G;  3CME A;  5IE8 A;  1OXX K;  5IP9 G;  3CQZ H;  1YNX A;  1QZH A;  5M5Y H;  4WJ4 A;  2HIX A;  4JBW A;  2VQE Q;  1DGS A;  4JI6 L;  1E3P A;  3GDE A;  1K3R A;  1NMG A;  3PUW A;  3KF6 A;  5LMU Q;  4JI8 Q;  1Q86 C;  1VQD A;  1VQC A;  1X6O A;  3L2P A;  3D0F A;  1Q7Y C;  4DV7 L;  1HNX L;  2CCZ A;  3IRB A;  4QGU A;  1YVC A;  1KD1 C;  1TWF H;  4POG A;  1M1K C;  1V9P A;  3PUY A;  4DV2 Q;  4B3M L;  1EQQ A;  1XTD A;  4LWC A;  2UUC L;  4A75 A;  1SRU A;  1VQJ A;  2N49 A;  3JC6 6;  3J7A 5;  4AYB G;  4AQY L;  5AJ3 L;  4KHP L;  2R93 G;  1KRS A;  2F52 A;  4DK3 C;  1VQH A;  1OXS C;  5BR8 Q;  1Q82 C;  4DR4 Q;  1Q81 C;  1M90 C;  4LF7 L;  4X6A H;  1VQI A;  3BZC A;  3TS0 A;  1IBK Q;  4Y7N H;  1XNR Q;  1VQ6 A;  1CKM A;  4B3M Q;  3GTM H;  2KEN A;  4O2D A;  2Z6K C;  4DR6 L;  3AEV A;  3M7N A;  5IP7 G;  3HKS A;  3HOX H;  2Q2T A;  1EQR A;  4OX9 Q;  4OO1 I;  1HZC A;  1G29 1;  3LGJ A;  1NTG A;  2CKZ B;  5AJ3 Q;  3S2D H;  4DR7 L;  4C3J H;  2I5M X;  1FJG Q;  1VQB A;  1Z47 A;  2D0P A;  3J7Z C;  3CF5 A;  4X62 L;  3KJO A;  2R7D A;  3T1H L;  3CCS A;  1CKN B;  4C3I H;  3UDI A;  3HFZ B;  1QVC A;  2CQO A;  3EIV A;  4YCV A;  1KL9 A;  1YHB A;  4OWX B;  1UE1 A;  4DV5 L;  3CPF A;  1OXV A;  2JEB I;  4DPG A;  1A0I A;  1MJE A;  3M9B A;  1VQ8 A;  1UE5 A;  1R9T H;  3KYH C;  1PV4 A;  5DLQ E;  1WCM H;  1W3S A;  5GAG C;  1Y1W G;  1IYJ B;  2JA8 G;  4LUV A;  4O0A A;  3U50 C;  1PH2 A;  1N33 Q;  1N36 Q;  1TXY A;  2XGT A;  3D31 A;  2UXD L;  1SN8 A;  2JK8 A;  1E24 A;  4BBR H;  4A3C H;  4DV1 Q;  1WJJ A;  3M4Q A;  4A3B H;  1UWV A;  4JV5 Q;  3K80 C;  4LF6 L;  1E1O A;  2WFW A;  3RLF A;  4DNI A;  3BU2 A;  3S1Q H;  1MKH A;  4QIW E;  1ASY A;  1OTC A;  4LNQ A;  1N8R C;  4XIG S;  3PSI A;  3I4M G;  3S2H H;  3J80 i;  4GNX B;  2ZJP A;  1WCM G;  1Y1V H;  1WFQ A;  2AKW B;  3F1Z A;  4PZ7 A;  2QEX A;  4DR1 Q;  2UU9 L;  4JI4 L;  4MNO A;  1L1O B;  3E9H A;  2GVA A;  4IOA A;  3KF8 B;  1QUQ B;  3S1R H;  1X56 A;  1VQL A;  4HIM A;  2PI2 E;  1PA6 A;  1X3E A;  4A3B G;  1I50 H;  1OXU A;  4YY3 L;  1PHJ A;  3L0O A;  3NBH B;  2NN6 I;  1P8L A;  1SE8 A;  2N78 A;  3S24 A;  4LF4 Q;  2VL6 A;  4ME3 A;  2HT1 A;  1JJG A;  4JI4 Q;  4QL5 A;  1XMO Q;  4KLK A;  5ELN A;  1J5E Q;  4A3L H;  1YJW A;  4NXN Q;  1D8L A;  2ASB A;  2E5L Q;  1N9W A;  3E0E A;  1IBL L;  2LXK A;  1X54 A;  2JA9 A;  4H02 A;  3CCR A;  1PH8 A;  4HID A;  4GOP B;  1C9O A;  2OQ0 A;  1A63 A;  2UUC Q;  1SFO H;  4OO1 G;  1VQP A;  1KIX A;  1I5F A;  4GKJ L;  3TRE A;  4EX5 A;  2K50 A;  2L15 A;  1HZB A;  4TQU S;  4GS3 A;  3JAM i;  2JA6 H;  4DR5 L;  1K73 C;  2NVY H;  4A3G H;  4BY7 G;  4X65 L;  3BJU A;  3PIP A;  5IY0 A;  4OWW B;  5FLX c;  4A3C G;  3L7Z C;  3GTK H;  4DKA C;  4YCW A;  1I94 L;  1IBL Q;  1Q12 A;  1Q8K A;  1SLJ A;  2WB1 G;  3KDF A;  1L0W A;  3PUZ A;  4EQ5 A;  3OYY A;  4JI7 Q;  2JA7 G;  2B63 H;  1XPU A;  3HOZ H;  5M3M G;  3I4N G;  4LUZ A;  3EN2 A;  3NEM A;  3UE0 A;  1LTL A;  1X3F A;  5IP9 H;  2VQF Q;  4DUZ Q;  5JEA J;  1C7Y A;  2JE6 I;  2HIV A;  3A74 A;  1YBY A;  4YWM A;  4DK6 C;  1X9N A;  1K9M C;  1GM5 A;  3I2Z A;  3OW2 A;  3ULP A;  2JA6 G;  4GLX A;  4MTN A;  4LF8 L;  4NXM L;  2WAQ G;  2OQK A;  4HJA A;  1HNZ L;  1FL0 A;  2PQA A;  4LF9 Q;  3S1M H;  4DAY B;  4L5Q A;  2PI2 A;  1YJN A;  3H0G G;  4L5S A;  4A3K H;  2VW9 A;  1JB7 A;  2R93 H;  3RLO A;  3GD7 A;  3U4V A;  1JE5 A;  2E2H H;  3F8T A;  2MO0 A;  1U0L A;  2K5V A;  4R4O A;  4UPA A;  4A93 G;  4GLA C;  1VQA A;  1YEZ A;  4IPC A;  4APV A;  2C35 B;  2K4K A;  2UUA L;  4X66 Q;  1HNZ Q;  4DAM A;  3G48 A;  4JYA Q;  5IP7 H;  4A3D G;  3BZK A;  4WJ3 M;  4P73 A;  4DUY L;  4OXP A;  2YTX A;  2CWA A;  4GN5 A;  3W5O A;  1BBW A;  5M5W H;  4A76 A;  1EFW A;  4YWL A;  4DR3 L;  2VZA A;  4A3K G;  3ER0 A;  4NPS A;  3J81 j;  5JEA G;  4JI6 Q;  4RG1 A;  4UP7 A;  3K7A H;  1EIY B;  3S1N H;  4B3R L;  4B3T L;  1Y14 B;  3TRZ A;  1D7Q A;  1IBM L;  5HGQ A;  3UDF A;  4DV7 Q;  1HNX Q;  3DM3 A;  3F2C A;  4UY8 C;  4A3F G;  1N32 L;  2B29 A;  4UP9 A;  4BBS G;  3CAM A;  4IFD I;  2EQS A;  2NZO A;  3KLW A;  4UP8 A;  1BVS A;  1Y1W H;  2HQL A;  3I4O A;  2HHH L;  5ELO A;  2MNA A;  4DR3 Q;  2JA8 H;  4AQY Q;  5GAD C;  3CMA A;  1GO3 E;  4KHP Q;  5E7N A;  5HY6 A;  2Q2U A;  4JI3 L;  3S14 H;  4B3R Q;  2OCE A;  2F4V L;  2R7Z H;  1C0A A;  1IBM Q;  4LF7 Q;  3I56 A;  2ATW A;  2MQH A;  4LFC L;  3FHW A;  1YIJ A;  2EIF A;  3E9I A;  3CW2 C;  4BA2 I;  1KHI A;  2PQA B;  4DR6 Q;  1UEB A;  2RHS B;  4IJL A;  5IT9 c;  2ES2 A;  1CSQ A;  2JEA I;  3I4M H;  2D62 A;  2IX0 A;  3F2D A;  4DR7 Q;  4IFD J;  1B70 B;  1K8A C;  1MIU A;  4X62 Q;  3GTG H;  3H3V I;  3T1H Q;  1CUK A;  2NVX H;  1VQF A;  2UXB L;  3PV0 A;  5IYC G;  3KF6 B;  2ZTE A;  3PUX A;  1YHA A;  4JBM A;  2R7Z G;  3PO3 H;  3A0J A;  4X64 L;  4DV5 Q;  2BA1 A;  4JI2 L;  1VS0 A;  3WWV A;  4K0K L;  1PYB A;  2MO1 A;  1NBW A;  4QJF A;  4A3M H;  1TWC H;  2ZM6 L;  3K0X A;  1EIF A;  1A62 A;  1TWH H;  4QY7 A;  4JI1 L;  3S17 H;  3TEH B;  4AIM A;  2IHE A;  3CCL A;  2UXD Q;  5C4X H;  1EWI A;  3H15 A;  1MJC A;  2QA4 A;  3G71 A;  4LFB L;  2MFI A;  2IX1 A;  1A8V A;  1U5K A;  1YJ9 A;  5GRO A;  4LF6 Q;  3PO3 G;  3GTO H;  2OTJ A;  2EXD A;  3GTL H;  4P75 A;  2ZM6 Q;  2CFM A;  1VQN A;  4BY7 H;  4PG3 A;  5FJ8 G;  4DV3 L;  2DGY A;  3UE1 A;  3T1Y L;  5IWA L;  1N34 L;  2E2J H;  2IY5 B;  4A3M G;  2BH2 A;  1JJC B;  1E1T A;  3RN5 A;  1S72 A;  2AHO B;  3M4P A;  4JCV E;  4DV6 L;  3ZJY C;  2UU9 Q;  1XPO A;  2JA7 H;  4LUO A;  4IFD G;  4JC0 A;  2VY3 A;  3CC4 A;  4BY1 H;  5M3M H;  3GO5 A;  3I4N H;  3GTJ H;  3PO2 G;  5C4X G;  1HZ9 A;  2Q2I A;  2YTY A;  1VQK A;  4PZ8 A;  1X55 A;  2B3G A;  2YYZ A;  3STB D;  4YY3 Q;  1V43 A;  2I5L X;  2LSS A;  4JOI A;  4DV0 L;  4HJ8 A;  4IOC A;  2E8G A;  1TWG H;  2ZJQ A;  2R6G A;  1PH3 A;  1OXT A;  1J6Q A;  1I3Q H;  2DUD A;  1KQS A;  2IHF A;  3DLL A;  5M3F H;  3SGI A;  3F2B A;  3H0G H;  3RNU A;  2UXC L;  2GVB A;  3K7U C;  3MEF A;  2ZTD A;  4BY1 G;  4AH6 A;  1XJV A;  1B8A A;  4GKJ Q;  1KAW A;  2KHI A;  4P72 A;  1JJ2 A;  4BXX H;  4IPH A;  3UDX A;  1IZ6 A;  1BKB A;  4DR5 Q;  2FXQ A;  4A93 H;  4X65 Q;  2RCN A;  4GKK L;  1XMQ L;  5LMN L;  4LF5 L;  4A3I G;  4R4T A;  5JJK A;  1YZ6 A;  3NEL A;  1SR3 A;  4R4I A;  3PF5 A;  1I94 Q;  3GTQ H;  3AYH B;  1K8G A;  3S16 H;  4KHZ A;  4TVA B;  1VQ4 A;  3RZO H;  3I7F A;  1WI5 A;  4A3D H;  2AWO A;  4YHH L;  2YTV A;  2AWN A;  1W2B A;  5M3F G;  4J15 A;  3KFU A;  1AE2 A;  2N8N A;  3RLN A;  1FGU A;  2GN5 A;  4DR2 L;  4LFA L;  4BXX G;  5LMN Q;  4GN4 B;  1XPR A;  4B3S L;  3PIO A;  1HZA A;  4L5T A;  5J3B A;  4KI0 A;  5IYB H;  4A3F H;  4LF8 Q;  4NXM Q;  4BBS H;  5JJI A;  4HIO A;  4A3J G;  4JBK A;  5LMU L;  1QVF A;  5IYD H;  4JI8 L;  1HH2 P;  4BA1 I;  2NN6 G;  4JBJ A;  1HR0 L;  2E2I H;  5FLM G;  5C4J H;  3CCV A;  3FKI G;  4LFA Q;  4DR2 Q;  3UDG A;  2RHQ B;  3ULL A;  3HOW H;  2K5N A;  1Q1B A;  4DV2 L;  4PZ6 A;  1WOC A;  4POF A;  1VQE A;  1KXL A;  3Q8D A;  5GAH C;  1GD7 A;  2UUA Q;  1AH9 A;  3CP0 A;  4IO9 A;  2D0O A;  5IYB G;  4JI0 L;  2PMZ E;  3MXN B;  3ULJ A;  3W1B A;  2ALY B;  2JQO A;  3KDF B;  4JOI C;  4AYB E;  5BR8 L;  5EAY A;  4DUY Q;  2K52 A;  1HR0 Q;  1XNQ L;  4DR4 L;  1CSP A;  1FVI A;  5IYD G;  1E7Z A;  1O7I A;  1PVO A; 
#chains in the Genus database with same CATH topology
 1IBK L;  1XNR L;  2XSC A;  3IL8 A;  1WD0 A;  2OWO A;  3Q23 A;  2F0M A;  2Y0S E;  3S15 H;  2MHV A;  4GNX A;  5JJL A;  1FR3 A;  1LTS D;  4JI0 Q;  1GVP A;  3R2I A;  1FJG L;  5FLX E;  1E22 A;  3HP3 A;  2EYP A;  4QQB X;  2YV5 A;  2J7Z A;  1G6P A;  4FP5 D;  4C3H H;  3K0Y A;  2A19 A;  4ZYS A;  1CHQ D;  4K6D A;  1EZ8 A;  1H95 A;  5I4D A;  2A6H D;  4LAA A;  4ZAI A;  4MHE A;  1VQO A;  1KC8 C;  2K5H A;  3I8Z A;  2VNU D;  2B2W C;  5A2Q E;  5C0X J;  1DOK A;  2B2Y A;  4HED A;  1KNE A;  1TWA H;  1LT3 D;  1LLR D;  4HIK A;  4JV5 L;  5M3M B;  4PQX A;  4C3H G;  2PNR C;  3U58 A;  5DM6 3;  1I6H H;  2A69 C;  1D1K A;  3DM1 A;  4R8N A;  1Q46 A;  1MBY A;  2Z8L A;  4DR1 L;  4PMW A;  4Y52 H;  2AMC B;  1SJE D;  4C3I G;  1PFN A;  3G4S A;  2KCM A;  3DWQ A;  2F0U A;  4LF4 L;  4LFB Q;  5KEE A;  4DV4 L;  1RL2 A;  3M4O H;  1HJP A;  1PH4 A;  3H3V H;  1B44 D;  4DAY A;  1WYD A;  4YWK A;  4DV3 Q;  3T1Y Q;  5CV9 A;  1HUN A;  1VCI A;  2I0Q A;  2UUC L;  4GNX C;  4KY5 A;  2EOT A;  2RDG A;  4ALP A;  3FKI B;  4IAL A;  3ERS X;  1PFS A;  1K83 H;  1T9H A;  4ILW A;  1GKH A;  4OHJ A;  4L5R C;  3MZ5 A;  1ASZ A;  2QF7 A;  4C2M H;  3J81 i;  4ME5 A;  4QCL A;  3EQL C;  3TZD A;  4JI5 L;  2VQF L;  4A3J H;  4LK1 C;  1EQV A;  2Z6K A;  3A5U A;  2B2Y C;  1B2T A;  5EPJ A;  4JG2 A;  4O42 A;  3A5Z B;  1QE6 A;  2LXJ A;  5FLM H;  1K8O A;  3VR5 A;  1PH5 A;  3HOV H;  4GKK Q;  3CC7 A;  1F77 A;  5JJZ A;  2X6G A;  4KKS A;  4N8X 1;  2ZT9 C;  5E4X A;  2TSS A;  1CKO A;  3P7J A;  4YHH Q;  2VQE L;  4EQP A;  1CKN A;  1WTH A;  2D9U A;  3KUP A;  2XVS A;  2ZJR A;  2EJG C;  3TME A;  4H7B A;  4B3S Q;  4JYA L;  1JMC A;  3HOV G;  4IUU A;  4F87 A;  5IE8 A;  5IP9 G;  1QZH A;  1I6V C;  2G9H D;  4M8A A;  1EOT A;  4CDF C;  2KEE A;  2SDF A;  3GDE A;  4QUF A;  1NMG A;  4JI8 Q;  1Q86 C;  1VQD A;  1SYC A;  4C3H B;  3L2P A;  3DEP A;  1Q7Y C;  1HNX L;  4ULL A;  3Q0A A;  1KD1 C;  5IIF A;  1V9P A;  3PUY A;  3S2D B;  3P20 A;  3KBG A;  2J0T D;  1G6Z A;  4C3I B;  1V1O A;  4KHP L;  2F52 A;  4DK3 C;  2NYZ D;  2B8G A;  1Q81 C;  1M90 C;  4X6A H;  3HRZ C;  1VQI A;  3A56 A;  4RGT A;  1FD7 D;  1CKM A;  2F0V A;  2KEN A;  4O2D A;  2AUJ D;  2Z6K C;  3M7N A;  5IP7 G;  4FXG C;  3HKS A;  4ZLT F;  3EA6 A;  4DR7 L;  2I5M X;  2D0P A;  3T1H L;  1MSG A;  4HCE A;  2JP1 A;  1QVC A;  1SJH D;  2CQO A;  4YCV A;  5JVG 3;  3CPF A;  1OXV A;  1H9K A;  2JEB I;  4DPG A;  3KLS A;  4C1N I;  1VQ8 A;  1ESF A;  3M4O B;  1II3 A;  4KKU A;  1IYJ B;  1XX8 A;  3SK8 A;  2JA8 G;  3U50 C;  1EY9 A;  4O0A A;  1M4V A;  5D14 A;  5C0X H;  1PH2 A;  1FNU A;  1TXY A;  3LWE A;  1DOM A;  4FXK C;  4BBR H;  4A3C H;  2A6E D;  3C1E A;  1JOK A;  3K80 C;  1E1O A;  2KQ3 A;  1WTX A;  4QIW E;  4LNQ A;  3PSI A;  1GUT A;  3I4M G;  3S2H H;  1SE2 A;  4G7Z C;  1K0S A;  2AKW B;  4PZ7 A;  4C2M B;  4JI4 L;  1L1O B;  1C48 A;  4A3J B;  3KF8 B;  2AUK A;  2Z1C A;  2A5H A;  2NVY B;  2QDL A;  2BDN A;  1SYF A;  2O2L D;  1SSO A;  2EJF C;  3L0O A;  3VYU A;  2N78 A;  4ME3 A;  2HT1 A;  5C3X A;  2NTS A;  3W2D A;  1J5E Q;  3HOV B;  4A3L H;  1YJW A;  1D8L A;  2E5L Q;  4XT1 B;  3E0E A;  1X54 A;  2JA9 A;  1HXY D;  3ONA B;  4RHS A;  5JOB A;  4B9W A;  4OO1 G;  4GKJ L;  2IL8 A;  3TRE A;  4V0B A;  4IUP A;  4GS3 A;  3BYY B;  2JA6 H;  1KDA A;  4BS9 A;  4A3G H;  4RWS C;  4JVZ A;  4X65 L;  5IY0 A;  5FLX c;  1PZJ D;  2PMZ B;  1SDF A;  2EPB A;  2R61 A;  2EVB A;  4DKA C;  1I94 L;  4UHV A;  1IBL Q;  2WKC A;  4FF1 A;  1L0W A;  3SHL A;  3OYY A;  3PIO 3;  2B63 H;  1XPU A;  3I4N G;  1IL8 A;  1UEA B;  1LTL A;  5CYU A;  2KCN A;  5DM7 3;  5JEA J;  1ILP A;  1ZYR C;  2HIV A;  1X9N A;  3EFX D;  4TSS A;  1WD1 A;  2JA6 G;  4L63 B;  3SR1 A;  1S5C D;  1HNZ L;  2L5T A;  1JOR A;  3L3O C;  2PI2 A;  1CA5 A;  1VDZ A;  1YNJ C;  3RLO A;  3T4A C;  3GD7 A;  3U4V A;  1JE5 A;  2E2H H;  2MO0 A;  2K5V A;  5CBA E;  3QB3 A;  2B39 A;  4GLA C;  1JE4 A;  2C35 B;  2K4K A;  3URY A;  2EYL A;  4X66 Q;  2JA8 B;  5BN4 A;  3BZK A;  4KN4 C;  3J81 E;  5C5L A;  3K5O A;  4HAE A;  4A76 A;  1EFW A;  4YWL A;  3X3M A;  3IFT A;  4NKL A;  1F2Z A;  1SYD A;  4A3F G;  4OGQ C;  3I4M B;  4CGY B;  1BVS A;  1Y1W H;  4ZKC B;  1KAA A;  2MNA A;  3CMA A;  1LT4 D;  2H4O A;  1S5B D;  1V1P A;  5E7N A;  2Q2U A;  3MAQ A;  3I56 A;  2MQH A;  3FHW A;  1YIJ A;  1SYB A;  1KHI A;  3DHQ A;  4CJ1 B;  1UEB A;  2QKI C;  2QDB A;  5FOB B;  4PV1 C;  1BR9 A;  2FJ2 A;  3F2D A;  4IFD J;  3U9S A;  4IUR A;  1MIU A;  1EYC A;  4KN7 C;  5IYC G;  1A3U A;  4R9W A;  5T1I A;  1YHA A;  1AZQ A;  2NZ1 D;  3WOE A;  3VA5 A;  2F3V A;  1TWC H;  1PXU A;  3K0X A;  2ZM6 L;  4XYQ A;  4KTA A;  3FMC A;  3I91 A;  3S17 H;  5EKI A;  3I4N B;  1IYV A;  4KJN A;  3P1H A;  1HFN A;  3CCL A;  2UXD Q;  5IGB A;  1PRT F;  1D5X C;  4DFA A;  1SNP A;  3G71 A;  4LFB L;  3DUZ A;  1B9M A;  4LF6 Q;  2JA6 B;  3GTL H;  4P75 A;  5JPM C;  5COY A;  2CFM A;  2B2U A;  1VQN A;  4PG3 A;  3NBI A;  4DV3 L;  2DGY A;  3T1Y L;  4BY7 H;  4FYD A;  2E2J H;  3H3V C;  1I4G A;  1JJC B;  3S9W A;  3RN5 A;  3M4P A;  4JCV E;  3TN2 A;  2JA7 H;  3VR6 A;  3GO5 A;  1HZ9 A;  1AW7 A;  2YYZ A;  3STB D;  3I4L A;  1V43 A;  2ZJQ A;  1TII D;  1TWG H;  3RZO B;  2B2T A;  4BWG B;  1OXT A;  1J6Q A;  4N9P A;  4ZRZ A;  2IHF A;  1F9P A;  4U68 A;  5M3F H;  1F9Q A;  1LTG D;  1PTO B;  2F0Q A;  2EYO A;  3A8I E;  5EPK A;  3VR2 A;  3MFG A;  2E2H B;  2B2V A;  1JJ2 A;  5D3D A;  4A3F B;  1IZ6 A;  5LL6 S;  5ELB A;  3RUZ A;  2FXQ A;  1C8C A;  4GKK L;  2RCN A;  3LWU A;  1WTV A;  4R4T A;  5JJK A;  3NEL A;  3AYH B;  1PRT C;  1VQ4 A;  2PZW A;  3I7F A;  2P5Z X;  1WI5 A;  4A3D H;  5I2Y A;  5C4J B;  1EU3 A;  2K5W A;  3TP6 A;  4YHH L;  2AWN A;  1W2B A;  5M3F G;  4J15 A;  2DN8 A;  1FGU A;  5JEA H;  2GN5 A;  3I73 A;  2XRS D;  1J9O A;  3BZD B;  5LMN Q;  4B3S L;  4L5T A;  5J3B A;  1DCZ A;  4NXM Q;  3H91 A;  1CQF A;  1Y1W B;  2OT2 A;  4ZCK A;  4JI8 L;  2B2U C;  4DXF A;  1M8A A;  4DR2 Q;  1NNX A;  3ULL A;  3HOW H;  1Q1B A;  3MTS A;  2F0P A;  3PMF A;  3A8K E;  2UUA Q;  3CP0 A;  4I65 A;  1PLF A;  2K5D A;  3ULJ A;  3W1B A;  2ALY B;  3KDF B;  1HR0 Q;  1IYU A;  1FGB D;  1BO0 A;  3MXG A;  1PVO A;  1EYA A;  1S3O A;  3HOY H;  4QIW B;  4XTC S;  3QOL A;  3U9O A;  5C44 G;  2WAC A;  3HOW G;  2CHB D;  4CKB A;  2D2C C;  2F0F A;  5LMN W;  2B2V C;  1TWC B;  1XNQ Q;  1Y8O B;  2K75 A;  1QUQ A;  1NJI C;  1PH9 A;  1JQY D;  3KK7 A;  4RMF A;  3OTO Q;  3I55 A;  1PH7 A;  3HOU H;  3G6E A;  3HOY G;  1QCB D;  3NTH A;  4LFC Q;  4OON A;  1ZKO A;  3GTL B;  1UE6 A;  3SXH A;  2F0L A;  2I5H A;  3TDQ A;  2B8F A;  3M3Y H;  1X65 A;  5FJ8 H;  1EQT A;  3GTP H;  3M85 A;  3NTI A;  4X3T A;  2F0O A;  1DON A;  3N52 A;  3PF4 A;  4IFD H;  1HR0 W;  2H5X A;  5DNF A;  2UXB Q;  1JWU D;  3HOU G;  3HKZ G;  3HOX G;  1TWG B;  1Y69 U;  1HFG A;  4K6L A;  1SMX A;  3BDO A;  2UUB Q;  5IGD A;  1TKW B;  2Z9H A;  3K59 A;  3TQY A;  1D5M C;  2KVM A;  3J7Y W;  5M3F B;  1BBU A;  3DWA A;  1YNN C;  4KJO A;  1PYS B;  5EPL A;  3WOF A;  1RKN A;  4J6H A;  3M7G A;  1RIP A;  1J5E L;  3J81 c;  2E5L L;  1PTO D;  3WDN A;  1SMY C;  3T51 B;  5FO7 B;  1VQL A;  4C1N K;  4DV6 Q;  4A3D B;  2CWP A;  3B6Y A;  2KA7 A;  2WP8 J;  1L2F A;  3MC0 B;  1VF5 C;  2Z0S A;  1KDB A;  5TSS A;  1WTP A;  3DMU A;  2EXZ A;  1VQ9 A;  1Y1V G;  5C3W A;  1VF7 A;  1STB A;  3KOJ A;  2JN4 A;  1D6E C;  1HNW Q;  4TRD A;  2DJF C;  1ENA A;  1HQM C;  3CD6 A;  5ISR A;  3RR5 A;  4FVM A;  1SNQ A;  2UXC Q;  2L9H A;  5C44 B;  5F2D A;  3HOW B;  2B2W A;  5LHY 1;  1VQ7 A;  3FKI H;  2KCT A;  2YU9 H;  3K8A A;  2Q2H A;  3CCM A;  4IUV A;  3J80 L;  2ZTC A;  2XTI A;  1TY2 A;  5K36 G;  1DYQ A;  4KMU C;  3AQQ A;  2E75 C;  2IX3 A;  3AFQ A;  4GLV B;  1TWF B;  1X3G A;  1VQ5 A;  2ICI A;  3K81 C;  4DNR B;  3EBE A;  3HOY B;  3QG1 A;  2MUY A;  5C4Z A;  1EY8 A;  1ICF B;  4X66 L;  1EWC A;  1PDQ A;  1AFP A;  2A73 B;  3HOZ G;  4HR7 B;  1OXX K;  1STG A;  3CQZ H;  5M5Y H;  1BCP B;  3D3R A;  1TR5 A;  1E3P A;  1KLU D;  3PUW A;  1JWM D;  1VQC A;  2NBF A;  4O1N A;  3D0F A;  4RKB A;  4CKE A;  3JAM L;  3K5N A;  3IRB A;  3HOU B;  3HOX B;  4B3M L;  1EQQ A;  1XTD A;  4LWC A;  4A75 A;  1SRU A;  2N49 A;  3J7A 5;  3M3Y B;  5AJ3 L;  2R93 G;  4CDE C;  1KRS A;  1ROD A;  3GTP B;  1G2T A;  1OXS C;  1Q82 C;  1QJO A;  2QW7 A;  3MHB A;  5CC4 A;  1PYW D;  2BE5 C;  2VXW A;  4J1M A;  1R9T B;  4Y7N H;  4E6I A;  3AMU A;  1CA6 A;  2MP1 A;  1U4M A;  3NBH A;  4CBV A;  3E5S A;  1A2T A;  1CTM A;  5I2X A;  3S2D H;  5D65 A;  3NPP A;  3ERQ A;  2SNM A;  2ENB A;  1FNV A;  3A7A B;  3KJO A;  4N9T A;  2IJ0 A;  2NTT A;  1CKN B;  5ELC A;  4C3I H;  3MEH A;  3HFZ B;  3EIV A;  4M1U B;  3HG9 A;  1D5Z C;  4Z9C B;  5FO8 B;  1Y1V B;  1UE5 A;  2KHS A;  3TBI B;  1LT6 D;  1ICW A;  1WCM H;  1N33 Q;  4GZY C;  3D31 A;  1SYG A;  4QF4 A;  2UXD L;  1SN8 A;  1E24 A;  4IN3 A;  1D2B A;  4DV1 Q;  3TP5 A;  1QG7 A;  1X3Q A;  3H6M A;  4LF6 L;  4DNI A;  3S1Q H;  2GA4 B;  1MKH A;  1ASY A;  3KLR A;  1OTC A;  5FO9 B;  1GUG A;  1G8Z D;  3SVM A;  1WCM G;  1NR2 A;  3F1Z A;  5EBC A;  1A3T A;  1K8M A;  5KGU A;  1HCZ A;  3MFY A;  5EKK A;  3E9H A;  1CT1 D;  3VA7 A;  3IAY A;  1BQQ T;  4NW2 A;  3AU7 A;  2A6H C;  2SNS A;  1I4P A;  4HIM A;  1X3E A;  4MTK A;  1OXU A;  1E2W A;  2F03 A;  3S24 A;  3P75 A;  2VL6 A;  2YU9 B;  1JJG A;  3HOZ B;  4QL5 A;  1XMO Q;  1TT2 A;  5I6Y A;  1PH8 A;  3CCR A;  4IUN A;  3G7L A;  4GOP B;  5C5M A;  1VQP A;  1KIX A;  1IW7 D;  1BBX C;  3OHX C;  4EX5 A;  4ZUI A;  2K50 A;  2RDH A;  4JK1 C;  1K73 C;  2NVY H;  1LTI D;  1W6J A;  4XT3 B;  3L7Z C;  3ND8 A;  4YCW A;  3MXN A;  5IT9 L;  1SLJ A;  4KHV A;  1PZI D;  4HSP A;  4JI7 Q;  3CQZ B;  4HCS A;  2R93 B;  5M5Y B;  2TMP A;  3EN2 A;  5IP9 H;  1L0X B;  1G91 A;  5BN3 A;  5FKA C;  1SNC A;  4DUZ Q;  1EEF D;  5C6A A;  3D4D A;  3A74 A;  4DK6 C;  4YWM A;  2F0D A;  1GM5 A;  4DK0 A;  3I2Z A;  1EWH A;  2KJX A;  5EKL A;  4LMQ D;  4GLX A;  3OW2 A;  3J80 E;  2RSO A;  1BCP D;  4MTN A;  4WRD A;  4NXM L;  4LF9 Q;  1FL0 A;  1BF4 A;  4H13 C;  2XWB B;  4WFN 3;  1B3A A;  1DZ1 A;  3H0G G;  1UUP A;  5E4W C;  2VW9 A;  1ET6 A;  1KLG D;  4G4K A;  4G57 A;  3D4W A;  3F8T A;  1U0L A;  4UPA A;  4Y7N B;  4A93 G;  1VQA A;  3E6Z X;  1L0Y B;  2UUA L;  4U67 3;  4XQQ A;  3OMG A;  3G48 A;  2CQA A;  5IP7 H;  2Z6B A;  4JW0 A;  2RBM A;  5M5W H;  3K5L A;  1STE A;  2C5C A;  2F1M A;  1TQO A;  4JI6 Q;  1MD2 D;  3JAM E;  4P2C B;  2PW5 A;  1Y14 B;  1X3P A;  4FNF A;  3T13 A;  3BVZ A;  4BBS G;  3CAM A;  2NZO A;  3KLW A;  1WCM B;  4K2K A;  4WOR A;  2HQL A;  3I4O A;  5ELO A;  3T56 B;  4ZKB B;  4DR3 Q;  2JA8 H;  4AQY Q;  1GO3 E;  4B3R Q;  5HY6 A;  4XQJ A;  3S14 H;  2OCE A;  1IBM Q;  3OWE B;  1NUC A;  3E3X A;  4LF7 Q;  2RVL A;  4LFC L;  3R8B A;  3S1Q B;  3CW2 C;  2BCO A;  4CJ2 C;  4KV6 A;  1JIC A;  2Z4I A;  4DAP A;  4IJL A;  1UAP A;  1EY0 A;  1CSQ A;  3I4M H;  2D62 A;  3QIA A;  1K8A C;  4X62 Q;  3H3V I;  1JC7 A;  2UXB L;  3PV0 A;  1H9M A;  3KF6 B;  4WJW A;  3GTO B;  3V96 A;  4JBM A;  3PO3 H;  4X3U A;  1PMR A;  5KNB A;  4DV5 Q;  1WTQ A;  1VS0 A;  1SND A;  1PYB A;  1TU2 B;  3V05 A;  2RSN A;  1D1I A;  3A54 A;  1A62 A;  3AB9 A;  1TWH H;  4QY7 A;  4K5W A;  1MI2 A;  2CW0 D;  4DU9 A;  2IX1 A;  4OO1 H;  1A8V A;  1U5K A;  3CU7 A;  5GRO A;  3PO3 G;  1STH A;  2OF1 A;  2OTJ A;  2EXD A;  5K5P A;  2IY5 B;  4Q0F A;  1E1T A;  5J39 A;  3H0G B;  4ID6 A;  4QB4 A;  4DV6 L;  2QEJ C;  4B9X A;  1KTK A;  4JC0 A;  4DXG A;  4BY1 H;  3I4N H;  5M9O A;  1B4O A;  3PO2 G;  1ONL A;  4A93 B;  3NSW A;  1BOS A;  1SNM A;  4IZ8 A;  2BOS A;  4RCO A;  5JPN C;  3QWN A;  4KY7 A;  5IGG A;  5JAV A;  3MVV A;  2A6E C;  4I7A A;  1E0B A;  4N8F A;  3SGI A;  3F2B A;  2UXC L;  2GVB A;  4CJ0 B;  3MEF A;  4BY1 G;  2ZTD A;  1B8A A;  4P72 A;  1SAP A;  1BKB A;  4BBS B;  4L8J A;  5IT9 E;  1H9S A;  2K01 A;  4A3I G;  1MSH A;  4R4I A;  1SR3 A;  3GTQ H;  3T16 A;  3RZO H;  2E2I B;  2NN6 H;  2YTV A;  2O4X A;  5M5W B;  2R3Z A;  1F2M A;  1AZP A;  4K5X A;  3KFU A;  1SYE A;  1AE2 A;  3GP7 A;  3RLN A;  1PTO H;  1QIL A;  1XTC D;  3FRP B;  1UNS A;  3PIO A;  1HZA A;  5IYB H;  3VYR A;  4A3F H;  4FF3 A;  1ENC A;  2HDL A;  4RHR A;  1STN A;  2QIL A;  4JBK A;  3TP8 A;  5IYD H;  4YIJ A;  4BA1 I;  2NN6 G;  4JBJ A;  5KIX A;  4H0L C;  3S14 B;  4OL7 A;  5C4J H;  3CCV A;  1AN8 A;  4LFA Q;  2RHQ B;  4IQZ A;  3O13 A;  3DXJ C;  1WOC A;  1CZW A;  2DY7 A;  5NUC A;  4POF A;  5GAH C;  4IO9 A;  3FDT A;  5IYB G;  4JI0 L;  2E2D C;  4AYB E;  2E76 C;  2K52 A;  5IYD G;  3ZYY X;  3SEB A;  1UE7 A;  5C0X I;  1YI2 A;  1QZG A;  1SRO A;  1EL0 A;  2L1B A;  3PO3 B;  5IYC H;  3RN2 A;  3FPP A;  2JJQ A;  1SBB B;  3CXC A;  2A1A A;  1CK1 A;  1LM0 A;  3BDL A;  3MXU A;  4CDD C;  1L1O A;  1TWH B;  1XWE A;  3I3C A;  2MGS A;  1G2S A;  3PO2 B;  1EOV A;  3NEN A;  4GN3 B;  5KNC A;  4JI3 Q;  4QUC A;  1V8Q A;  2F4V Q;  1Z6H A;  2K32 A;  3CCU A;  3SK4 A;  2EY6 A;  2IT1 A;  3Q22 A;  2EYM A;  1N33 L;  4HJ9 A;  2K5Q A;  3HKZ E;  4DAV A;  4IUT A;  5I6W A;  2RQX A;  2A74 C;  2PNH A;  4DV1 L;  1S40 A;  1EY5 A;  4BY1 B;  3J80 c;  1K3B C;  4K0K Q;  5DEH A;  5CMD A;  4C3J G;  4A3I B;  1HHV A;  2L4N A;  4P71 A;  4XXE A;  4B08 A;  3RMH A;  3CCQ A;  1SE4 A;  3NTK A;  4JI1 Q;  4IJH A;  1O7Y A;  3ERO A;  2VS1 A;  2VB3 X;  1LT5 D;  1KRT A;  3W1G A;  1EYG A;  2AQ1 B;  1XMO L;  3V2T A;  1PH1 A;  4IPG A;  2M2L A;  1WTR A;  4R1J A;  2QGQ A;  1JOO A;  3OW7 A;  5G3L D;  3GTQ B;  2OTL A;  2RCF A;  5IWA Q;  1P16 A;  5LL6 X;  5C3E H;  4DN4 M;  4JPB W;  1SNO A;  2V1C C;  5GQO A;  4K5V A;  1A2U A;  3JAM c;  3CCJ A;  4LW1 A;  1Z9F A;  2PCF B;  1L1O C;  4OWT B;  4DV4 Q;  2NVQ H;  1Y8N B;  2N3S A;  3PQI A;  4S3S A;  4DV0 Q;  1LYL A;  4G7H C;  5H1S E;  4JI7 L;  2K1B A;  5C3E G;  2ZXO A;  3PCO B;  5M5X H;  1B1Z A;  5KRU A;  4DUZ L;  4R4Q A;  2BH8 A;  2RF4 A;  1IL2 A;  3CHB D;  3BDC A;  2I07 B;  1FYC A;  1F2L A;  1JR0 D;  1XYI A;  3X3N A;  3AFP A;  1V1Q A;  1YIT A;  4KD3 A;  4NP5 A;  4LF9 L;  1XMQ Q;  1S5F D;  4JI5 Q;  2XRQ D;  4LF5 Q;  3CPW A;  4DGZ A;  1NE3 A;  3STB C;  1Q90 A;  3FVQ A;  2DY8 A;  3HEJ A;  1G51 A;  1HA5 A;  1BXT A;  1MHW C;  5C44 H;  3U4Z A;  3CRL C;  1YNX A;  2F0G A;  4KY6 A;  4WJ4 A;  1RD9 D;  3BVM A;  1DGS A;  3TZU A;  2VQE Q;  4JI6 L;  5J22 A;  5EBD A;  5LMU Q;  4K8J A;  1E2Z A;  3A8J E;  4QGU A;  1YVC A;  1TWF H;  3T53 B;  4C3J B;  2PO4 A;  3SDZ A;  4EQN A;  3I70 A;  1BDO A;  4AYB G;  4AQY L;  1VQH A;  5BR8 Q;  4HTH A;  4LF7 L;  3BZC A;  1RJT A;  3TS0 A;  1VMP A;  3GTM H;  1U4R A;  2MPM A;  3GQB A;  4HMJ A;  4FO2 A;  3HOX H;  2Q2T A;  4OX9 Q;  1HZC A;  1G29 1;  1O78 A;  4V19 0;  1KAB A;  1Z47 A;  3CF5 A;  1EFI D;  4X62 L;  4RGN A;  3CCS A;  1KL9 A;  1YHB A;  4OWX B;  1UE1 A;  4DV5 L;  1DD2 A;  1HA6 A;  3NQI A;  4ODG A;  1A0I A;  1MJE A;  3M9B A;  1TS3 A;  1R9T H;  2F0W A;  1PV4 A;  5DLQ E;  5GAG C;  1PFM A;  1W3S A;  1W6K A;  1AP0 A;  1LV9 A;  1LO5 D;  5C3E B;  1N36 Q;  1ENF A;  3S1R B;  2JK8 A;  2FMM A;  4J8Q A;  1O7L A;  1WJJ A;  4A3B H;  1LTT D;  2NVQ B;  5KND A;  1TS4 A;  1N8R C;  4XIG S;  2Z4H A;  3J80 i;  1PTO F;  4GNX B;  2ZJP A;  1Y1V H;  2QEX A;  3NE5 B;  1A6X A;  4MNO A;  1TS5 A;  2L11 A;  5M5X B;  1BUV T;  2A68 D;  1X56 A;  3SK6 A;  1ML0 D;  2PI2 E;  1PA6 A;  5ELF A;  2FHT A;  4A3B G;  4NDX A;  3SK5 A;  1Z7T A;  1EZ6 A;  1GUW A;  3NBH B;  1SE8 A;  3I90 A;  4JI4 Q;  4QMG A;  5IOC A;  5KYI A;  2CH4 W;  4NXN Q;  1CM9 A;  1ZXT A;  2LS0 1;  1N9W A;  1IBL L;  2LXK A;  4H02 A;  1BNZ A;  5K36 H;  4HID A;  2OQ0 A;  1VMC A;  3Q6S A;  5IGF A;  2NUC A;  2L15 A;  1HZB A;  3JAM i;  2K28 A;  2PZT A;  3PIP A;  4OWW B;  4TKO B;  1TY0 A;  2WII B;  2HUG A;  1CHP D;  4AYB B;  1Q8K A;  3HZX A;  3KDF A;  3HOZ H;  2NB0 A;  5M3M G;  3HGB A;  2CVR A;  1K28 A;  2JE6 I;  1LAC A;  1YBY A;  1PTO C;  2Q8R E;  1RHP A;  3CKI B;  4K14 A;  4HJA A;  2K05 A;  2PQA A;  3NXW A;  1O7Z A;  4DAY B;  4DF7 A;  1YJN A;  4L5S A;  1EYD A;  2R93 H;  3NQT A;  4R4O A;  2M9V A;  3GTM B;  2HCI A;  4RAU C;  3IKJ A;  1HNZ Q;  1JOQ A;  2EYH A;  3HKZ B;  4RKL A;  4DAM A;  2J4X A;  3CRK C;  4WJ3 M;  4OIJ A;  1HTP A;  2EY1 A;  3W5O A;  3IFD A;  1RCV D;  3QOJ A;  5ELD A;  4DK1 A;  3D6C A;  4RG1 A;  4K8I A;  1B53 A;  3K7A H;  5DAU A;  3S1N H;  3TRZ A;  5HGQ A;  2FFK B;  3UDF A;  4DV7 Q;  3F2C A;  2B29 A;  4IFD I;  3BG3 A;  1U4P A;  3KLS X;  4UP8 A;  3C3L A;  2A69 D;  3LNN A;  1H9J A;  2NVX B;  5GAD C;  1J8I A;  4JI3 L;  2F4V L;  2R7Z H;  2AQ2 B;  4A3B B;  1S5E D;  1SXT A;  2XN9 C;  2HCC A;  2Q8I B;  3E9I A;  3GV3 A;  1WTO A;  4BA2 I;  2IWH A;  4Q5V A;  4DR6 Q;  1AEX A;  3OIP A;  5IGC A;  2IX0 A;  1EIH A;  2O5I C;  5I9O A;  5AFW A;  1B70 B;  5E1F A;  1VQF A;  2DNE A;  3PUX A;  2R7Z G;  3NP8 A;  4K0K L;  3WWV A;  3M4Y A;  1NBW A;  4QJF A;  4A3M H;  1EIF A;  3EVQ A;  3SE0 A;  1I4Q A;  4JI1 L;  4AIM A;  2IHE A;  5C4X H;  3H15 A;  1MJC A;  4KK7 A;  2QA4 A;  3OWF A;  2F0H A;  2EYF A;  2OXP A;  3GTO H;  2ZM6 Q;  1I3Q B;  5IWA L;  4G7O C;  4A3M G;  1S72 A;  3C46 A;  2UU9 Q;  1XPO A;  1RTN A;  3CC4 A;  1EY7 A;  3GTJ H;  5C4X G;  1SEB D;  2CH4 A;  1LTB D;  2K33 A;  1X55 A;  2B3G A;  2FIN B;  4YY3 Q;  4JOI A;  2I5L X;  4DV0 L;  2E8G A;  1TVX A;  5L37 A;  2R6G A;  3A55 A;  3H09 A;  1GHK A;  1LAB A;  3DLL A;  3RNU A;  3H0G H;  3NWT A;  1XJV A;  2F0S A;  5COR A;  1XXG A;  4BXX H;  3UDX A;  4DR5 Q;  1BCP F;  4ZK9 B;  4A93 H;  1Y8P B;  2DJG C;  3DEO A;  1XMQ L;  5LMN L;  4LF5 L;  1STY A;  1YZ6 A;  3S16 H;  3PF5 A;  1K8G A;  4TVA B;  2AWO A;  1GUS A;  1RF2 D;  2EJM A;  1X32 A;  1S5D D;  5HGT A;  1KNA A;  3K7A B;  3S1N B;  1WVL A;  3MXP A;  4DR2 L;  4BXX G;  1U9R A;  4PNY A;  1CZG A;  4GN4 B;  4RGO S;  3QR8 A;  4KI0 A;  5CR3 A;  3VR4 A;  4LF8 Q;  4BBS H;  5JJI A;  2K04 A;  4HIO A;  4A3J G;  1IW7 C;  2F0N A;  5LMU L;  1DXM A;  1I4X A;  2LMC B;  1HR0 L;  2E2I H;  5FLM G;  3UDG A;  2R7Z B;  3S15 B;  2XNA C;  1HQR D;  2K5N A;  1PFB A;  2OEO A;  4PZ6 A;  1AH9 A;  2D0O A;  3J81 L;  1ESR A;  3NK9 A;  2JQO A;  3OMC A;  4JOI C;  1RDP D;  4DUY Q;  5BR8 L;  1XNQ L;  2F3W A;  1CSP A;  1FVI A;  4KD4 A;  2JXM B;  1BCP C;  2JSO A;  4F7X A;  1NMF A;  3OTO L;  2ICE C;  4B3T Q;  5ELE A;  1H9S B;  2ZXP A;  1Q1E A;  2VUM H;  4OX9 L;  1HUM A;  1N32 Q;  1TWA B;  4A3M B;  2HDM A;  2K03 A;  2BDO A;  2HHH Q;  2KBN A;  3VDY A;  3FP9 A;  2R7F A;  3PGZ A;  2Y0S G;  1IXR A;  2LKV A;  1LUZ A;  4PMB A;  1I6H B;  4FDB A;  4EQO A;  4C56 C;  1LTA D;  2R92 H;  5C4X B;  2NVT H;  1NCV A;  2HQE A;  4HJ7 A;  2I46 A;  1B7Y B;  2K6A A;  2VUM G;  2K14 A;  5FK9 C;  1JT8 A;  4RFB A;  1N36 L;  2UUB L;  4GOP A;  1GOZ A;  3I72 A;  3ND9 A;  4OEM B;  3RZD H;  4NB3 A;  3PUV A;  1EIG A;  1VQM A;  3GTJ B;  1NY4 A;  2R92 G;  3N6R A;  3PO2 H;  1Q8I A;  1TS2 A;  5J1Z A;  4X64 Q;  4JI2 Q;  4YCU A;  4UDU C;  1YHQ A;  2A8V A;  1NAP A;  3LX0 A;  5BN5 A;  1S4Z A;  1WTW A;  2ID0 A;  1PH6 A;  4R4C A;  1K83 B;  2JA5 H;  2QCP X;  4KKT A;  1V1P B;  3CC2 A;  3TS2 A;  2X69 A;  2H1E A;  3NWS A;  5HUR A;  5EGT A;  1MGS A;  1EY6 A;  2IPK D;  1ZYR D;  1B50 A;  4NXN L;  5C0X G;  3ICE A;  3C2P A;  3S16 B;  1AE3 A;  3A7L A;  1EU4 A;  4A3I H;  1N34 Q;  4BBR G;  1QVG A;  2KHJ A;  5EQ0 A;  4A3C G;  1HNW L;  2KUM A;  5I9P A;  4HMI A;  4IPD A;  2JA5 G;  3J7A F;  2BA0 A;  5T1G A;  1GJX A;  1YNJ D;  1K0R A;  5CV7 A;  1PRT B;  1O80 A;  1GUO A;  4XDX A;  5GAE C;  4HJ5 A;  2F3I A;  2CW0 C;  2D5D A;  1DOL A;  4P74 A;  1GHJ A;  2WB1 E;  5CV6 A;  1R4Q B;  1SE3 A;  3BS1 A;  2KED A;  1EUJ A;  2F0K A;  1EEI D;  4RGM A;  4A4I A;  2LY7 A;  4K2L A;  4GOP C;  1C4Q A;  1B3Q A;  1VQG A;  4ABN A;  4A3L G;  3H94 A;  2K7V A;  4A3E H;  4NMZ A;  4MZ9 A;  2WAQ E;  4MIU A;  2NZH A;  3ITP A;  4HN7 A;  2Y0S B;  1HRJ A;  3R2T A;  3KJP A;  2EY5 A;  1F9S A;  4A3G G;  3CCE A;  2N55 A;  5E3F A;  1ZEQ X;  2PQE A;  2E74 C;  2VUM B;  1IKL A;  3D8G A;  4A3E G;  2B63 G;  3CME A;  2HIX A;  4JBW A;  2WIN B;  2KOL A;  1K3R A;  3KF6 A;  1X6O A;  2R92 B;  1A3V A;  2NVT B;  4DV7 L;  2CCZ A;  1Q3L A;  4POG A;  1M1K C;  1R4P B;  4RA8 A;  4DV2 Q;  2EY2 A;  1CI3 M;  1VQJ A;  4RCN A;  4DA2 A;  3D6W A;  3JC6 6;  3OSO A;  1JWS D;  2O5J C;  2NWG A;  4DR4 Q;  1F9R A;  3RZD B;  2X6L A;  3KF8 A;  4UAI A;  1IBK Q;  1XNR Q;  1VQ6 A;  4B3M Q;  3HS0 C;  3OIQ A;  1JCK B;  1RTO A;  3AEV A;  4DR6 L;  2XIW A;  3F2U A;  1EQR A;  4OO1 I;  3LGJ A;  5AJ3 Q;  1NTG A;  2CKZ B;  4C3J H;  1FJG Q;  1VQB A;  4MN3 A;  3J7Z C;  4BBR B;  2R7D A;  2AQ3 B;  4F88 A;  3R93 A;  3UDI A;  2JA5 B;  1KDC A;  1DJR D;  3S2H B;  5A35 A;  3KYH C;  1Y1W G;  5C4H A;  1PZK D;  2VB2 X;  3VR3 A;  4LUV A;  2L55 A;  2F0T A;  2XGT A;  2DNC A;  3M4Q A;  1UWV A;  4JV5 Q;  4CDC C;  2WFW A;  3RLF A;  3BU2 A;  3J7A V;  3BVG A;  1T5X D;  1U4L A;  3K58 A;  4FF2 A;  4DR1 Q;  1WFQ A;  5G3L F;  2UU9 L;  1H9R A;  4IOA A;  2GVA A;  1QUQ B;  3S1R H;  1PRT D;  2KCC A;  4A3G B;  4ZUJ A;  1I50 H;  2C9O A;  4YY3 L;  1PHJ A;  2F4I A;  1QNU A;  2F0E A;  1P8L A;  2NN6 I;  1HTL D;  4LF4 Q;  2PW7 A;  2B63 B;  4KLK A;  5ELN A;  4A3E B;  2ASB A;  1DM0 B;  4XQN A;  2RA4 A;  1C9O A;  1A63 A;  2UUC Q;  1SFO H;  3VYT A;  1I5F A;  1QNK A;  1JB3 A;  2V4D A;  4TQU S;  4DR5 L;  4BY7 G;  3BJU A;  4LJZ C;  3GTK H;  1Q12 A;  2WB1 G;  4EQ5 A;  2JA7 G;  3PUZ A;  3W3A A;  5CBE E;  2MJ8 A;  3DWP A;  4LUZ A;  3NEM A;  3UE0 A;  1X3F A;  2VQF Q;  3KBX A;  1C7Y A;  2EE1 A;  4OEL B;  1IHZ A;  3C1F A;  1K9M C;  2G9D A;  3ULP A;  4ZQ3 A;  4F8M A;  4LF8 L;  2WAQ G;  2OQK A;  5CGK A;  4FF4 A;  3S1M H;  3NUC A;  4L5Q A;  3R3O A;  2EYJ A;  4A3K H;  1JB7 A;  1OO9 B;  1QWY A;  4CKC A;  4XYO A;  3UI2 A;  1YEZ A;  2LFN A;  4IPC A;  4APV A;  3QJY A;  4JYA Q;  3MWY W;  4A3D G;  5EJW A;  4P73 A;  4DUY L;  4OXP A;  2YTX A;  2CWA A;  4GN5 A;  3VYS A;  1BBW A;  3K5M A;  4A3K G;  4DR3 L;  2VZA A;  5KYL A;  3ER0 A;  4NPS A;  3J81 j;  5JEA G;  4PMC A;  3OPO A;  4UP7 A;  1I4R A;  1EIY B;  4B3R L;  4B3T L;  1NSN S;  1D7Q A;  1IBM L;  1HNX Q;  3DM3 A;  4HSV A;  5CV4 A;  4UY8 C;  1N32 L;  2M00 A;  4UP9 A;  2EQS A;  5D3I B;  2L12 A;  2HHH L;  2B2T C;  5FLX L;  1EY4 A;  4KHP Q;  1C0A A;  5CV5 A;  2SEB D;  2ATW A;  4CHT B;  5JVH 3;  2WV6 D;  3QO2 A;  2IW3 A;  4L6T B;  2EIF A;  1YNN D;  2PQA B;  2F0I A;  2RHS B;  4OIK A;  5IT9 c;  5A2Q L;  3S17 B;  2ES2 A;  2JEA I;  4DR7 Q;  2EZV A;  4EVO A;  3GTG H;  1F2Y A;  3T1H Q;  1CUK A;  2NVX H;  1SMY D;  3Q24 A;  2ZTE A;  5IOD A;  1I50 B;  3A0J A;  4X64 L;  2BA1 A;  4JI2 L;  4BY7 B;  2E2J B;  3L9A X;  2MO1 A;  1STA A;  4H44 C;  2WB1 B;  2JA7 B;  4DNT B;  4X3S A;  4FXD A;  3TSS A;  3TEH B;  3D4R A;  1EWI A;  1SFO B;  3G6J B;  4I7Z C;  2MFI A;  1GXD C;  1YJ9 A;  2WAQ B;  3GTK B;  5FJ8 G;  3UE1 A;  1N34 L;  2BH2 A;  2N88 A;  2JYO A;  2AHO B;  3ZJY C;  4LUO A;  4IFD G;  2VY3 A;  3MA2 B;  5M3M H;  2Q2I A;  2YTY A;  1VQK A;  4PZ8 A;  4IUQ A;  4RH6 A;  5CV8 A;  1B9N A;  2LSS A;  4HJ8 A;  4IOC A;  3PIP 3;  4X3K A;  1GUN A;  2PYK A;  2PPB C;  1PH3 A;  4R8I A;  3S1M B;  2PZU A;  2WKD A;  1FNW A;  1I3Q H;  2DUD A;  1KQS A;  1IKM A;  2L0C A;  1A15 A;  4A3K B;  3K6O A;  1ILQ A;  2KEC A;  1T5E A;  1QB5 D;  3K7U C;  4AH6 A;  1NR4 A;  3RD4 A;  4GKJ Q;  1KAW A;  2KHI A;  1QOH A;  4IPH A;  4X65 Q;  2G5D A;  1E2V A;  2EDG A;  1I94 Q;  2A68 C;  4KHZ A;  3K57 A;  2XWJ B;  2HD3 A;  3GV6 A;  2N8N A;  2SOB A;  3EJI A;  3TP7 A;  4LFA L;  1ET9 A;  2F0J A;  1XPR A;  1LTR D;  2RKS A;  2Q8T A;  2BE5 D;  1CFM A;  1HPC A;  1QVF A;  1HH2 P;  3BYT B;  3FPU B;  5IGE A;  3FKI G;  1CQV A;  4DV2 L;  2ZXR A;  1KXL A;  1VQE A;  3Q8D A;  3E0J A;  1GD7 A;  4EGV A;  2PMZ E;  1I4H A;  3MXN B;  3NHH A;  2RDF A;  4DR4 L;  5EAY A;  3FEW X;  3GTG B;  1E7Z A;  3OOC A;  1O7I A;  2FMC A; 
#chains in the Genus database with same CATH homology
 1IBK L;  1UE7 A;  1S3O A;  5C0X I;  1YI2 A;  1SRO A;  1QZG A;  1NMF A;  4XTC S;  2OWO A;  1XNR L;  3HOY H;  3OTO L;  5IYC H;  5C44 G;  3RN2 A;  4B3T Q;  3HOW G;  2Y0S E;  1Q1E A;  3S15 H;  4GNX A;  2VUM H;  4OX9 L;  2JJQ A;  3CXC A;  4JI0 Q;  1N32 Q;  1GVP A;  2A1A A;  5JJL A;  1LM0 A;  5LMN W;  1FJG L;  1L1O A;  1XNQ Q;  2K75 A;  1E22 A;  1QUQ A;  2HHH Q;  2KBN A;  3VDY A;  4QQB X;  2YV5 A;  3FP9 A;  2R7F A;  3PGZ A;  2Y0S G;  1IXR A;  1G6P A;  1LUZ A;  1NJI C;  1EOV A;  4FDB A;  4C3H H;  3NEN A;  4GN3 B;  3OTO Q;  4RMF A;  3I55 A;  1PH9 A;  4JI3 Q;  2NVT H;  2A19 A;  2R92 H;  2F4V Q;  4HJ7 A;  1PH7 A;  3HOU H;  3G6E A;  1B7Y B;  3HOY G;  1H95 A;  3CCU A;  4LFC Q;  4OON A;  2VNU D;  1VQO A;  1KC8 C;  1UE6 A;  2K5H A;  2IT1 A;  5C0X J;  2VUM G;  2I5H A;  2K14 A;  1N33 L;  3M3Y H;  1X65 A;  1N36 L;  1JT8 A;  5FJ8 H;  4HJ9 A;  3HKZ E;  2UUB L;  1TWA H;  4GOP A;  3GTP H;  3M85 A;  2PNH A;  4DV1 L;  1S40 A;  3RZD H;  4NB3 A;  3PUV A;  4HIK A;  3PF4 A;  1HR0 W;  4JV5 L;  1VQM A;  2H5X A;  1NY4 A;  3U58 A;  2UXB Q;  2R92 G;  3J80 c;  3PO2 H;  1I6H H;  3HOU G;  3HKZ G;  3HOX G;  4X64 Q;  4JI2 Q;  1Q46 A;  4YCU A;  4K0K Q;  1YHQ A;  4DR1 L;  1SMX A;  4PMW A;  2UUB Q;  2A8V A;  4Y52 H;  4P71 A;  2AMC B;  2ID0 A;  1PH6 A;  3TQY A;  4R4C A;  3CCQ A;  4JI1 Q;  4IJH A;  3G4S A;  1BBU A;  2JA5 H;  2VS1 A;  3CC2 A;  2KCM A;  3TS2 A;  1PYS B;  4LF4 L;  4LFB Q;  4DV4 L;  1KRT A;  1RL2 A;  3W1G A;  1HJP A;  1RIP A;  1EYG A;  1XMO L;  3M4O H;  1PH1 A;  4IPG A;  1J5E L;  1PH4 A;  3H3V H;  4NXN L;  5C0X G;  4R1J A;  3J81 c;  2QGQ A;  1WYD A;  4YWK A;  2E5L L;  4DV3 Q;  3T1Y Q;  3ICE A;  2OTL A;  1AE3 A;  1P16 A;  1VCI A;  5IWA Q;  5C3E H;  4A3I H;  1N34 Q;  2I0Q A;  4BBR G;  1QVG A;  2KHJ A;  2V1C C;  5GQO A;  3JAM c;  2CWP A;  3B6Y A;  3CCJ A;  4DV6 Q;  4GNX C;  2WP8 J;  1HNW L;  1L2F A;  4LW1 A;  1Z9F A;  4ALP A;  4IPD A;  1L1O C;  2JA5 G;  3ERS X;  1PFS A;  4OWT B;  2Z0S A;  4DV4 Q;  1K83 H;  2BA0 A;  2NVQ H;  1T9H A;  1K0R A;  2N3S A;  1VQ9 A;  1GKH A;  1Y1V G;  4L5R C;  4DV0 Q;  1ASZ A;  1LYL A;  5GAE C;  4HJ5 A;  5H1S E;  4C2M H;  4JI7 L;  3J81 i;  2F3I A;  3KOJ A;  1HNW Q;  4P74 A;  4JI5 L;  2VQF L;  5C3E G;  2WB1 E;  3PCO B;  5M5X H;  4A3J H;  4DUZ L;  2Z6K A;  4R4Q A;  2BH8 A;  3CD6 A;  3A5U A;  1EUJ A;  3RR5 A;  2RF4 A;  1IL2 A;  4JG2 A;  2UXC Q;  4A4I A;  3A5Z B;  4GOP C;  2LXJ A;  5FLM H;  1VQ7 A;  1VQG A;  3AFP A;  2KCT A;  3FKI H;  1V1Q A;  2YU9 H;  4A3L G;  3K8A A;  1YIT A;  2Q2H A;  3CCM A;  1PH5 A;  4A3E H;  4LF9 L;  3HOV H;  4MZ9 A;  2ZTC A;  2XTI A;  4GKK Q;  3CC7 A;  2WAQ E;  1XMQ Q;  4JI5 Q;  4LF5 Q;  5K36 G;  3CPW A;  2NZH A;  1NE3 A;  3AQQ A;  1CKO A;  3KJP A;  3STB C;  3AFQ A;  4YHH Q;  2VQE L;  4GLV B;  1X3G A;  1VQ5 A;  1CKN A;  4A3G G;  3K81 C;  3EBE A;  1G51 A;  3CCE A;  2ZJR A;  4X66 L;  5C44 H;  3U4Z A;  4B3S Q;  3HOZ G;  4JYA L;  1JMC A;  4A3E G;  2B63 G;  3HOV G;  3CME A;  5IE8 A;  1OXX K;  5IP9 G;  3CQZ H;  1YNX A;  1QZH A;  5M5Y H;  4WJ4 A;  2HIX A;  4JBW A;  2VQE Q;  1DGS A;  4JI6 L;  1E3P A;  3GDE A;  1K3R A;  1NMG A;  3PUW A;  3KF6 A;  5LMU Q;  4JI8 Q;  1Q86 C;  1VQD A;  1VQC A;  1X6O A;  3L2P A;  3D0F A;  1Q7Y C;  4DV7 L;  1HNX L;  2CCZ A;  3IRB A;  4QGU A;  1YVC A;  1KD1 C;  1TWF H;  4POG A;  1M1K C;  1V9P A;  3PUY A;  4DV2 Q;  4B3M L;  1EQQ A;  1XTD A;  4LWC A;  2UUC L;  4A75 A;  1SRU A;  1VQJ A;  2N49 A;  3JC6 6;  3J7A 5;  4AYB G;  4AQY L;  5AJ3 L;  4KHP L;  2R93 G;  1KRS A;  2F52 A;  4DK3 C;  1VQH A;  1OXS C;  5BR8 Q;  1Q82 C;  4DR4 Q;  1Q81 C;  1M90 C;  4LF7 L;  4X6A H;  1VQI A;  3BZC A;  3TS0 A;  1IBK Q;  4Y7N H;  1XNR Q;  1VQ6 A;  1CKM A;  4B3M Q;  3GTM H;  2KEN A;  4O2D A;  2Z6K C;  4DR6 L;  3AEV A;  3M7N A;  5IP7 G;  3HKS A;  3HOX H;  2Q2T A;  1EQR A;  4OX9 Q;  4OO1 I;  1HZC A;  1G29 1;  3LGJ A;  1NTG A;  2CKZ B;  5AJ3 Q;  3S2D H;  4DR7 L;  4C3J H;  2I5M X;  1FJG Q;  1VQB A;  1Z47 A;  2D0P A;  3J7Z C;  3CF5 A;  4X62 L;  3KJO A;  2R7D A;  3T1H L;  3CCS A;  1CKN B;  4C3I H;  3UDI A;  3HFZ B;  1QVC A;  2CQO A;  3EIV A;  4YCV A;  1KL9 A;  1YHB A;  4OWX B;  1UE1 A;  4DV5 L;  3CPF A;  1OXV A;  2JEB I;  4DPG A;  1A0I A;  1MJE A;  3M9B A;  1VQ8 A;  1UE5 A;  1R9T H;  3KYH C;  1PV4 A;  5DLQ E;  1WCM H;  1W3S A;  5GAG C;  1Y1W G;  1IYJ B;  2JA8 G;  4LUV A;  4O0A A;  3U50 C;  1PH2 A;  1N33 Q;  1N36 Q;  1TXY A;  2XGT A;  3D31 A;  2UXD L;  1SN8 A;  2JK8 A;  1E24 A;  4BBR H;  4A3C H;  4DV1 Q;  1WJJ A;  3M4Q A;  4A3B H;  1UWV A;  4JV5 Q;  3K80 C;  4LF6 L;  1E1O A;  2WFW A;  3RLF A;  4DNI A;  3BU2 A;  3S1Q H;  1MKH A;  4QIW E;  1ASY A;  1OTC A;  4LNQ A;  1N8R C;  4XIG S;  3PSI A;  3I4M G;  3S2H H;  3J80 i;  4GNX B;  2ZJP A;  1WCM G;  1Y1V H;  1WFQ A;  2AKW B;  3F1Z A;  4PZ7 A;  2QEX A;  4DR1 Q;  2UU9 L;  4JI4 L;  4MNO A;  1L1O B;  3E9H A;  2GVA A;  4IOA A;  3KF8 B;  1QUQ B;  3S1R H;  1X56 A;  1VQL A;  4HIM A;  2PI2 E;  1PA6 A;  1X3E A;  4A3B G;  1I50 H;  1OXU A;  4YY3 L;  1PHJ A;  3L0O A;  3NBH B;  2NN6 I;  1P8L A;  1SE8 A;  2N78 A;  3S24 A;  4LF4 Q;  2VL6 A;  4ME3 A;  2HT1 A;  1JJG A;  4JI4 Q;  4QL5 A;  1XMO Q;  4KLK A;  5ELN A;  1J5E Q;  4A3L H;  1YJW A;  4NXN Q;  1D8L A;  2ASB A;  2E5L Q;  1N9W A;  3E0E A;  1IBL L;  2LXK A;  1X54 A;  2JA9 A;  4H02 A;  3CCR A;  1PH8 A;  4HID A;  4GOP B;  1C9O A;  2OQ0 A;  1A63 A;  2UUC Q;  1SFO H;  4OO1 G;  1VQP A;  1KIX A;  1I5F A;  4GKJ L;  3TRE A;  4EX5 A;  2K50 A;  2L15 A;  1HZB A;  4TQU S;  4GS3 A;  3JAM i;  2JA6 H;  4DR5 L;  1K73 C;  2NVY H;  4A3G H;  4BY7 G;  4X65 L;  3BJU A;  3PIP A;  5IY0 A;  4OWW B;  5FLX c;  4A3C G;  3L7Z C;  3GTK H;  4DKA C;  4YCW A;  1I94 L;  1IBL Q;  1Q12 A;  1Q8K A;  1SLJ A;  2WB1 G;  3KDF A;  1L0W A;  3PUZ A;  4EQ5 A;  3OYY A;  4JI7 Q;  2JA7 G;  2B63 H;  1XPU A;  3HOZ H;  5M3M G;  3I4N G;  4LUZ A;  3EN2 A;  3NEM A;  3UE0 A;  1LTL A;  1X3F A;  5IP9 H;  2VQF Q;  4DUZ Q;  5JEA J;  1C7Y A;  2JE6 I;  2HIV A;  3A74 A;  1YBY A;  4YWM A;  4DK6 C;  1X9N A;  1K9M C;  1GM5 A;  3I2Z A;  3OW2 A;  3ULP A;  2JA6 G;  4GLX A;  4MTN A;  4LF8 L;  4NXM L;  2WAQ G;  2OQK A;  4HJA A;  1HNZ L;  1FL0 A;  2PQA A;  4LF9 Q;  3S1M H;  4DAY B;  4L5Q A;  2PI2 A;  1YJN A;  3H0G G;  4L5S A;  4A3K H;  2VW9 A;  1JB7 A;  2R93 H;  3RLO A;  3GD7 A;  3U4V A;  1JE5 A;  2E2H H;  3F8T A;  2MO0 A;  1U0L A;  2K5V A;  4R4O A;  4UPA A;  4A93 G;  4GLA C;  1VQA A;  1YEZ A;  4IPC A;  4APV A;  2C35 B;  2K4K A;  2UUA L;  4X66 Q;  1HNZ Q;  4DAM A;  3G48 A;  4JYA Q;  5IP7 H;  4A3D G;  3BZK A;  4WJ3 M;  4P73 A;  4DUY L;  4OXP A;  2YTX A;  2CWA A;  4GN5 A;  3W5O A;  1BBW A;  5M5W H;  4A76 A;  1EFW A;  4YWL A;  4DR3 L;  2VZA A;  4A3K G;  3ER0 A;  4NPS A;  3J81 j;  5JEA G;  4JI6 Q;  4RG1 A;  4UP7 A;  3K7A H;  1EIY B;  3S1N H;  4B3R L;  4B3T L;  1Y14 B;  3TRZ A;  1D7Q A;  1IBM L;  5HGQ A;  3UDF A;  4DV7 Q;  1HNX Q;  3DM3 A;  3F2C A;  4UY8 C;  4A3F G;  1N32 L;  2B29 A;  4UP9 A;  4BBS G;  3CAM A;  4IFD I;  2EQS A;  2NZO A;  3KLW A;  4UP8 A;  1BVS A;  1Y1W H;  2HQL A;  3I4O A;  2HHH L;  5ELO A;  2MNA A;  4DR3 Q;  2JA8 H;  4AQY Q;  5GAD C;  3CMA A;  1GO3 E;  4KHP Q;  5E7N A;  5HY6 A;  2Q2U A;  4JI3 L;  3S14 H;  4B3R Q;  2OCE A;  2F4V L;  2R7Z H;  1C0A A;  1IBM Q;  4LF7 Q;  3I56 A;  2ATW A;  2MQH A;  4LFC L;  3FHW A;  1YIJ A;  2EIF A;  3E9I A;  3CW2 C;  4BA2 I;  1KHI A;  2PQA B;  4DR6 Q;  1UEB A;  2RHS B;  4IJL A;  5IT9 c;  2ES2 A;  1CSQ A;  2JEA I;  3I4M H;  2D62 A;  2IX0 A;  3F2D A;  4DR7 Q;  4IFD J;  1B70 B;  1K8A C;  1MIU A;  4X62 Q;  3GTG H;  3H3V I;  3T1H Q;  1CUK A;  2NVX H;  1VQF A;  2UXB L;  3PV0 A;  5IYC G;  3KF6 B;  2ZTE A;  3PUX A;  1YHA A;  4JBM A;  2R7Z G;  3PO3 H;  3A0J A;  4X64 L;  4DV5 Q;  2BA1 A;  4JI2 L;  1VS0 A;  3WWV A;  4K0K L;  1PYB A;  2MO1 A;  1NBW A;  4QJF A;  4A3M H;  1TWC H;  2ZM6 L;  3K0X A;  1EIF A;  1A62 A;  1TWH H;  4QY7 A;  4JI1 L;  3S17 H;  3TEH B;  4AIM A;  2IHE A;  3CCL A;  2UXD Q;  5C4X H;  1EWI A;  3H15 A;  1MJC A;  2QA4 A;  3G71 A;  4LFB L;  2MFI A;  2IX1 A;  1A8V A;  1U5K A;  1YJ9 A;  5GRO A;  4LF6 Q;  3PO3 G;  3GTO H;  2OTJ A;  2EXD A;  3GTL H;  4P75 A;  2ZM6 Q;  2CFM A;  1VQN A;  4BY7 H;  4PG3 A;  5FJ8 G;  4DV3 L;  2DGY A;  3UE1 A;  3T1Y L;  5IWA L;  1N34 L;  2E2J H;  2IY5 B;  4A3M G;  2BH2 A;  1JJC B;  1E1T A;  3RN5 A;  1S72 A;  2AHO B;  3M4P A;  4JCV E;  4DV6 L;  3ZJY C;  2UU9 Q;  1XPO A;  2JA7 H;  4LUO A;  4IFD G;  4JC0 A;  2VY3 A;  3CC4 A;  4BY1 H;  5M3M H;  3GO5 A;  3I4N H;  3GTJ H;  3PO2 G;  5C4X G;  1HZ9 A;  2Q2I A;  2YTY A;  1VQK A;  4PZ8 A;  1X55 A;  2B3G A;  2YYZ A;  3STB D;  4YY3 Q;  1V43 A;  2I5L X;  2LSS A;  4JOI A;  4DV0 L;  4HJ8 A;  4IOC A;  2E8G A;  1TWG H;  2ZJQ A;  2R6G A;  1PH3 A;  1OXT A;  1J6Q A;  1I3Q H;  2DUD A;  1KQS A;  2IHF A;  3DLL A;  5M3F H;  3SGI A;  3F2B A;  3H0G H;  3RNU A;  2UXC L;  2GVB A;  3K7U C;  3MEF A;  2ZTD A;  4BY1 G;  4AH6 A;  1XJV A;  1B8A A;  4GKJ Q;  1KAW A;  2KHI A;  4P72 A;  1JJ2 A;  4BXX H;  4IPH A;  3UDX A;  1IZ6 A;  1BKB A;  4DR5 Q;  2FXQ A;  4A93 H;  4X65 Q;  2RCN A;  4GKK L;  1XMQ L;  5LMN L;  4LF5 L;  4A3I G;  4R4T A;  5JJK A;  1YZ6 A;  3NEL A;  1SR3 A;  4R4I A;  3PF5 A;  1I94 Q;  3GTQ H;  3AYH B;  1K8G A;  3S16 H;  4KHZ A;  4TVA B;  1VQ4 A;  3RZO H;  3I7F A;  1WI5 A;  4A3D H;  2AWO A;  4YHH L;  2YTV A;  2AWN A;  1W2B A;  5M3F G;  4J15 A;  3KFU A;  1AE2 A;  2N8N A;  3RLN A;  1FGU A;  2GN5 A;  4DR2 L;  4LFA L;  4BXX G;  5LMN Q;  4GN4 B;  1XPR A;  4B3S L;  3PIO A;  1HZA A;  4L5T A;  5J3B A;  4KI0 A;  5IYB H;  4A3F H;  4LF8 Q;  4NXM Q;  4BBS H;  5JJI A;  4HIO A;  4A3J G;  4JBK A;  5LMU L;  1QVF A;  5IYD H;  4JI8 L;  1HH2 P;  4BA1 I;  2NN6 G;  4JBJ A;  1HR0 L;  2E2I H;  5FLM G;  5C4J H;  3CCV A;  3FKI G;  4LFA Q;  4DR2 Q;  3UDG A;  2RHQ B;  3ULL A;  3HOW H;  2K5N A;  1Q1B A;  4DV2 L;  4PZ6 A;  1WOC A;  4POF A;  1VQE A;  1KXL A;  3Q8D A;  5GAH C;  1GD7 A;  2UUA Q;  1AH9 A;  3CP0 A;  4IO9 A;  2D0O A;  5IYB G;  4JI0 L;  2PMZ E;  3MXN B;  3ULJ A;  3W1B A;  2ALY B;  2JQO A;  3KDF B;  4JOI C;  4AYB E;  5BR8 L;  5EAY A;  4DUY Q;  2K52 A;  1HR0 Q;  1XNQ L;  4DR4 L;  1CSP A;  1FVI A;  5IYD G;  1E7Z A;  1O7I A;  1PVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...