3F1ZA

Crystal structure of putative nucleic acid-binding lipoprotein (yp_001337197.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.46 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
QPGDDAVASMQTYSVAQFLQPFTLNPAKASSDYLGKWVKVRGVIVDIRRKSGIAGSYYFIVTMRDEQNKTDKRLTFNFGSHNSADVEALSNGSVATIVGQVHQVQDSTIPTLQNPKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of KPN03535 (gi|152972051), a novel putative lipoprotein from Klebsiella pneumoniae, reveals an OB-fold.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Dna binding protein
molecule keywords putative nucleic acid-binding lipoprotein
total genus 28
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2008-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3f1zA00
4IPDA 4LF6L 3Q8DA 2R93G 3EIVA 4HIDA 2JEAI 4LFBL 2E2HH 3PUVA 3HOYH 1IBLL 3S14H 4LF5Q 1S3OA 2Q2HA 4JI4L 3KFUA 1VQJA 2I5MX 3AQQA 5C4XH 1VQOA 3PIPA 2F4VL 4JI2L 3OTOL 2CQOA 3F2CA 4C3IH 4BA2I 1LYLA 4GS3A 4B3MQ 4OX9Q 1PVOA 2N8NA 1LM0A 3HOZH 4AYBE 4YHHL 1UE6A 4NXNL 2GVAA 2Y0SG 4IPGA 5HGQA 4X66L 2N49A 1Y14B 3G48A 1PH7A 3GTQH 1WOCA 3CXCA 4L5TA 3S2DH 4GN3B 2ZM6Q 4BXXH 1BKBA 4DUYQ 2R93H 1XNRL 4LF4L 4BBRH 3GD7A 3RLFA 1EOVA 1PH6A 2UUAL 4BY1H 5HY6A 3U50C 1RIPA 3J81i 3A5UA 1MJEA 1PH4A 3I2ZA 4DUZL 1XTDA 1NTGA 1FVIA 1RL2A 3CPWA 1NMFA 3CC2A 4DR1L 3M4PA 2ZM6L 4IPCA 1XNQQ 4KHPL 3E9HA 2R7ZG 4K0KQ 2YV5A 4JI8L 3I56A 4OWTB 1HZBA 1IZ6A 1Y1VG 3I55A 4YCWA 4JI7Q 3KDFB 3E0EA 3UDIA 4AYBG 3GTGH 3L0OA 1L0WA 2I5LX 1K73C 5FLXc 5M3MG 2VQEL 4DR1Q 2ALYB 1B70B 2F52A 2NN6I 4DAYB 1Y1WH 1CKMA 4P72A 4DV7Q 5AJ3Q 1P16A 4HJ8A 4OWWB 2Q2UA 2EXDA 3UDXA 3SGIA 4POGA 1I5FA 3W1GA 3K80C 1QVCA 4A3IH 3I4NH 4LFAQ 2DGYA 1VQHA 1KQSA 2VY3A 5IP7H 2CCZA 2IT1A 3M85A 2YU9H 4YCUA 1TWAH 1MKHA 4DV7L 2ZTEA 1LTLA 5C3EG 2E2JH 4IO9A 4LUVA 3NBHB 3RN2A 1SN8A 1UEBA 1HH2P 2B63H 1YHBA 4LFAL 2UXDL 4KLKA 3FKIH 3H0GG 1D7QA 3CC7A 2JA5G 2A8VA 1PHJA 4GKJQ 5M5WH 3J7A5 2XGTA 2ZTDA 3EBEA 1PH9A 3CCEA 3H15A 1VQ4A 1I3QH 5GAEC 1I6HH 2EIFA 1X56A 3NEMA 3NENA 3BZCA 3PSIA 2R7ZH 1I94L 4DR7Q 1J5EQ 1B8AA 1E24A 2C35B 4HIMA 4A3EH 5LMNQ 1HNXL 1VQBA 2BA1A 1L2FA 2XTIA 2NVYH 3PV0A 5BR8Q 1HNZL 4BY7G 1E1OA 2BH8A 4LW1A 4A3CG 1KRSA 4ME3A 5GAHC 2OWOA 3VDYA 4JI1Q 2Z0SA 1WI5A 3RLNA 3LGJA 3CAMA 3GO5A 3I4MG 5M5YH 2IX1A 2HQLA 1HNXQ 3HOXG 3AFQA 3T1YQ 2B63G 3UDFA 4IFDJ 4DV6L 1HNZQ 2Y0SE 1Z47A 3HOZG 2QEXA 4GLAC 3CCVA 1C7YA 1WCMG 2UU9Q 1WJJA 1W3SA 2D0PA 2FXQA 4A93H 2BA0A 4RG1A 1YITA 4O0AA 1VQKA 2RF4A 5ELNA 4XTCS 4X64L 2R92H 2JE6I 4QGUA 3RN5A 3L7ZC 2UUCQ 1WCMH 3J81c 1XPUA 3HOWH 3KYHC 4JI0Q 4OO1G 1YBYA 3CCUA 1FJGQ 4B3SQ 5FLMH 3T1HL 1SMXA 1AH9A 4OX9L 2JA8H 5M5XH 4GNXB 4JI3L 3KJPA 3J80c 2UXBL 1YI2A 4YY3Q 4DNIA 1VQMA 4YWKA 1TWGH 3FKIG 1L1OA 4AH6A 4C2MH 1HR0L 1A8VA 4JI6Q 2UUCL 4GKKQ 1C9OA 1O7IA 2EQSA 1YHQA 1X3FA 3K0XA 1G291 4JI0L 4A3CH 2PI2A 4GLXA 1YJ9A 3T1HQ 2OQKA 1E1TA 1VQDA 2B3GA 3KDFA 5GAGC 4A3KG 1OTCA 1N33Q 3S1QH 2F4VQ 2KCTA 1QZHA 1VS0A 2UXBQ 3K81C 1JE5A 4B3ML 1V1QA 1IBKL 4BY1G 4Y7NH 4DV0L 1Q12A 4DR2L 3L2PA 4DV1Q 5IE8A 2ZJQA 4NXNQ 3DLLA 3F2DA 2QA4A 5GROA 4X66Q 4OXPA 4X6AH 5M3FG 1L1OC 3HOVG 4P74A 3ERSX 4PZ6A 3F1ZA 2YTVA 3IRBA 1WYDA 1K83H 4MZ9A 1U0LA 1VQ8A 1G51A 2UUAQ 5JJIA 3I7FA 3KJOA 1EQRA 4DV3L 2JJQA 2AMCB 3JC66 4PZ8A 1YHAA 2NVTH 2D0OA 2K52A 3GTJH 4UY8C 1VQ5A 5C4XG 1YJNA 1Q1EA 3MEFA 4UP7A 4LF7L 1PH8A 5GQOA 4GN4B 5IYDG 2MNAA 2HHHL 4JBMA 1VQNA 5C44G 4QQBX 4UP8A 3W5OA 1OXTA 1BBUA 4JOIA 1MIUA 2E5LL 1VCIA 2PI2E 1HZAA 5IYCG 5IYCH 1M1KC 3MXNB 1CSPA 4R1JA 3HOVH 3A74A 1JJGA 3OYYA 3CF5A 2HHHQ 5AJ3L 5C44H 1K8AC 3CQZH 1YJWA 2YYZA 4DK3C 1KIXA 4NB3A 1EFWA 1VQLA 1T9HA 1J5EL 1K0RA 5LMNL 3GTLH 5IT9c 4JV5Q 1LUZA 5BR8L 4KI0A 1WFQA 3ULPA 2GN5A 4HJ5A 3F8TA 2VNUD 4OO1I 1VQ9A 1UE1A 2LXKA 1PFSA 1Q1BA 3ICEA 5DLQE 1KD1C 3PUWA 1OXVA 3KF6B 5C4JH 4L5SA 5FJ8G 1QZGA 4LF8Q 1IBML 5JJLA 2JA7G 2UXDQ 4DV2L 3H0GH 2AWOA 4DV6Q 3RZDH 4HIKA 1TWFH 3A5ZB 4A3BG 3FP9A 4DR3L 4IPHA 4TVAB 5FLMG 2PQAA 1UE5A 1TWHH 1N34L 5C3EH 4NXML 4LFCQ 1JB7A 4DR6L 2OTLA 4A3DG 2QGQA 2WP8J 1D8LA 4PG3A 1GVPA 2E2IH 3PO2G 1A0IA 4DV2Q 3J80i 2R7FA 1NY4A 1NMGA 3J81j 1VQGA 1VQAA 2PMZE 1IXRA 3ULJA 1MJCA 4FDBA 4DR3Q 3TEHB 3D31A 1IBLQ 3M4OH 4DK6C 2RCNA 2RHQB 4TQUS 1JJ2A 4LFCL 1HR0W 4LF9L 3S16H 3ER0A 1Y1WG 1XJVA 2K5HA 4EQ5A 5JEAG 4A3FG 4JI5Q 2K5VA 3HKSA 1Q46A 1YEZA 2Z6KC 3HOWG 1A62A 2KHIA 3B6YA 2K5NA 1EIYB 3D0FA 1UE7A 1E3PA 1CKNB 4JCVE 2ZJRA 1TWCH 1X9NA 2Q2IA 5IWAQ 4A93G 1QVFA 1AE3A 3CMEA 4A3GG 2DUDA 4A3EG 4LF4Q 3RNUA 1I50H 2UUBQ 3AEVA 2ID0A 4O2DA 4A3BH 2PNHA 2KHJA 3RLOA 4JYAL 3M7NA 1GM5A 1NBWA 5IWAL 5M3FH 3I4MH 2PQAB 3G71A 3OTOQ 4K0KL 2OCEA 5FJ8H 3U58A 1CUKA 4JBWA 2OQ0A 4R4QA 4HJAA 4YHHQ 1HNWQ 3KLWA 2D62A 4BBSG 3TS2A 4JYAQ 2WAQG 3J7ZC 4JI7L 4IJLA 2MQHA 2Q2TA 3I4OA 5IYDH 4A3KH 4B3RL 1EUJA 3CCSA 1XMQQ 2RHSB 1XNRQ 3M9BA 4R4OA 1N32L 1N9WA 1HZCA 1J6QA 1SLJA 3K7AH 3W1BA 3F2BA 1IBKQ 1YVCA 3M3YH 4JBKA 4A3LG 1PH3A 3CPFA 4C3HH 3AFPA 4A75A 2JA5H 2WB1E 2ASBA 3PUXA 2JA6G 4DUZQ 4OWXB 2A19A 3ZJYC 1X55A 3DM3A 3S2HH 1GO3E 2CWAA 1OXUA 3RZOH 3CMAA 4H02A 2KCMA 3RR5A 3PF4A 2JA9A 2NZHA 1BBWA 4JI8Q 1PYSB 1VQCA 1B7YB 3S24A 4KHZA 3CCMA 1Y1VH 3KF6A 4DV3Q 3G6EA 3CW2C 4OONA 1SROA 3KOJA 3CCJA 1E7ZA 1DGSA 3G4SA 1HZ9A 1QVGA 4LF7Q 2L15A 3AYHB 4POFA 5C0XI 1XMOL 1OXXK 3GTPH 1YZ6A 3STBD 3HOUH 5C0XG 4LFBQ 1K8GA 1I94Q 4DR7L 1IBMQ 1X3EA 2KENA 1FL0A 3JAMc 5LMUL 4PMWA 3TREA 1N8RC 4DR4L 3U4ZA 1V43A 2WB1G 4APVA 2IHEA 3TS0A 3S1MH 1YNXA 1VQPA 1XMOQ 4LUZA 2JA8G 2JQOA 4HIOA 2ZTCA 1CKNA 2NN6G 1JJCB 3TQYA 4BA1I 5LMUQ 2CKZB 3BU2A 2NVQH 4WJ4A 1BVSA 1KAWA 3T1YL 4BBSH 2VS1A 3PO3G 4LUOA 4MNOA 4DR5L 3K8AA 5H1SE 4IOAA 3PUZA 5IP9G 3E9IA 3PIOA 2Z6KA 1PH5A 2ZJPA 4LF9Q 4J15A 4LF8L 1H95A 3S17H 1K3RA 2UXCQ 4A3MG 4LF6Q 3GTKH 5JJKA 4DPGA 2BH2A 1UWVA 1IYJB 4UP9A 1E22A 4YWLA 4EX5A 2WFWA 1A63A 4DR5Q 3UE0A 3CCQA 1VQFA 4GN5A 4DR6Q 4JG2A 4JI1L 4L5QA 1FJGL 2VZAA 4ALPA 4P71A 5IP9H 4B3TQ 1ASYA 1C0AA 3CC4A 2AKWB 4JI2Q 2VQFQ 5ELOA 1PA6A 3PO2H 3BJUA 4JC0A 4NPSA 3STBC 4YY3L 4A3IG 1HR0Q 3S1NH 1KXLA 1XPOA 2HIXA 4X62L 1Q86C 2WAQE 1S40A 2UU9L 1YIJA 2AWNA 4B3TL 5M3MH 3UDGA 1CSQA 1SR3A 1L1OB 1X3GA 1KC8C 4A3FH 1PH1A 5C0XJ 4GOPB 1N33L 1ASZA 4C3JH 2VQFL 4BXXG 2HT1A 1OXSC 2IX0A 4Y52H 4A3LH 1AE2A 3HFZB 4XIGS 4DV0Q 1VQIA 4X62Q 4DV1L 2IHFA 4LF5L 4A3JH 1HNWL 3PO3H 3GDEA 1JT8A 1X6OA 1U5KA 1Q8KA 1M90C 1X65A 2OTJA 1NE3A 2K4KA 2NZOA 1XNQL 2N78A 4JI6L 4HJ9A 4IFDI 3HKZG 3K7UC 4GKKL 2YTYA 1XPRA 1N32Q 4A3JG 2UUBL 4IJHA 2MFIA 5JEAJ 5GADC 3M4QA 1HJPA 1QUQB 1TXYA 5E7NA 4A4IA 3H3VH 2H5XA 3HOYG 4UPAA 4A76A 4LNQA 3CCRA 2VQEQ 2CWPA 5J3BA 4JOIC 4DUYL 4AIMA 4YWMA 4A3MH 1X54A 2MO1A 1FGUA 1SE8A 3HOXH 5IYBH 3EN2A 4DR2Q 1P8LA 1KRTA 5IY0A 4DV5L 1VQ7A 2JA6H 2A1AA 4P73A 2R7DA 4MTNA 3CCLA 3JAMi 4YCVA 5IP7G 1JMCA 2ES2A 1Z9FA 2JK8A 4B3RQ 3PF5A 1KHIA 1XMQL 3S15H 5K36G 2B29A 4QJFA 2JEBI 3PGZA 4KHPQ 4RMFA 4QL5A 4A3DH 4IFDG 3GTMH 4DV5Q 4DAMA 1GKHA 2LXJA 5IYBG 2VL6A 5EAYA 3FHWA 2I0QA 2K50A 2F3IA 1EQQA 4DR4Q 4JV5L 2I5HA 3PCOB 1V9PA 1Q82C 1KL9A 3NELA 2K75A 1CKOA 4GKJL 1N36Q 4HJ7A 4DKAC 3KF8B 4GOPC 3PUYA 1IL2A 1Q81C 4LWCA 2E5LQ 3H3VI 4BY7H 1G6PA 4JBJA 1R9TH 3OW2A 2NVXH 5LMNW 1N36L 1VQEA 2E8GA 2K14A 3TRZA 4GNXA 1EWIA 4R4IA 4R4CA 2AHOB 1GD7A 1PH2A 4NXMQ 4BBRG 4QIWE 3A0JA 4WJ3M 3GTOH 3HKZE 1Q7YC 4DV4L 2GVBA 4P75A 3BZKA 3UE1A 4GNXC 3ULLA 2JA7H 1SFOH 1EYGA 2R6GA 2IY5B 1K9MC 2LSSA 3CP0A 2VUMH 4AQYL 2MO0A 1QUQA 4A3GH 2YTXA 4JI5L 4X65L 2VW9A 4DV4Q 1PV4A 2ATWA 2R92G 4GOPA 1SRUA 4GLVB 4L5RC 4X64Q 1PYBA 2KBNA 3I4NG 1NJIC 1VQ6A 4QY7A 1S72A 3S1RH 1N34Q 2HIVA 1EIFA 2N3SA 2V1CC 3WWVA 4AQYQ 4B3SL 4JI4Q 2CFMA 4PZ7A 3U4VA 4R4TA 2VUMG 4IOCA 3HOUG 4X65Q 3CD6A 2UXCL 1W2BA 4JI3Q
chains in the Genus database with same CATH superfamily
4IPDA 3GTQB 2QW7A 4RA8A 2K05A 4ABNA 1B44D 2EYFA 4CDDC 5COYA 3AQQA 5C4XH 2F4VL 2K28A 2XVSA 5FO8B 3X3MA 3F2CA 2F0WA 4BA2I 1LYLA 4GS3A 1PVOA 1V1PB 2GVAA 4CDEC 5HGQA 1GUWA 2L1BA 3S16B 1Y14B 5EPKA 2ENBA 1IKMA 1PTOD 3KLSX 1WOCA 1Q8IA 1GUOA 4FYDA 2E75C 3BVMA 4DUYQ 4OIKA 3VA7A 4RAUC 1SYGA 1W6JA 3A5UA 1AW7A 1PH4A 4DUZL 1FVIA 5I2YA 5F2DA 4DR1L 4G57A 2LFNA 2HUGA 1HZBA 1IZ6A 1E2VA 4XXEA 3SK5A 4JI7Q 4AYBG 1J9OA 1B70B 4DAYB 1Y1WH 1CKMA 3IL8A 4HJ8A 1P16A 4KV6A 3I91A 4OWWB 3PO3B 5DNFA 1F2YA 1QVCA 3NPPA 1HHVA 1KQSA 3MFYA 4K6DA 5C3XA 2CCZA 1KAAA 1U4LA 4K8IA 4DV7L 1ZEQX 1K28A 5CGKA 1B2TA 4DAYA 1HH2P 1YHBA 2UXDL 2K1BA 4IUQA 2A8VA 1G6ZA 5M5WH 3J7A5 1PH9A 1CA5A 1I6VC 3FEWX 3R3OA 1VQ4A 1HTLD 3J80L 2EIFA 3NEMA 1GJXA 3GP7A 1B8AA 2C35B 1HNXL 5LMNQ 1VQBA 4WJWA 5BR8Q 5C6AA 1HTPA 4LAAA 4JI1Q 2QKIC 3I4MG 5M5YH 2HQLA 3AFQA 3T1YQ 4DV6L 5A2QL 1BDOA 1STNA 3HOZG 4IUNA 1WCMG 4XT1B 2UU9Q 3X3NA 1W3SA 4A93H 1YITA 1I50B 3OMGA 1VQKA 2RF4A 5ELNA 2R92H 4X64L 4V190 4QGUA 5FK9C 3HOWH 1TWCB 1YBYA 1KDCA 5FLMH 1SE2A 3T1HL 4MHEA 4JI3L 2EYOA 2A6ED 4QMGA 1TR5A 3FVQA 1C9OA 2I07B 1X3FA 3K0XA 1G291 4A3CH 1YJ9A 2OQKA 1VS0A 4JK1C 3K81C 4X3UA 3V96A 1IBKL 4BY1G 1PMRA 2FINB 4DR2L 5D3DA 2ZJQA 3DLLA 2JA6B 2B2VA 1I4RA 2KOLA 3MA2B 3ERSX 4DF7A 2NVYB 3F1ZA 3IRBA 3KF8A 4MZ9A 1U0LA 2SNMA 2JJQA 2NVTH 4FVMA 1YJNA 1Q1EA 1I4XA 2PZUA 4UP7A 4LF7L 3S2DB 1A3VA 1VQNA 4JBMA 5C44G 3NQIA 4JOIA 4OEMB 1AP0A 1VCIA 2ZT9C 3TP7A 3GTLB 2LS01 5IYCG 5IYCH 4R1JA 4X3SA 4UHVA 5KGUA 1PDQA 3A74A 5I9PA 5C44H 2QDBA 3QOJA 1JORA 3OHXC 1E0BA 2RKSA 4NB3A 1K0RA 1BOSA 2RDGA 3I4LA 3GTMB 4JV5Q 1BR9A 4WFN3 1IL8A 3A7AB 4KI0A 1WFQA 5BR8L 5IIFA 2VNUD 2I46A 1PFSA 5DLQE 2L4NA 4LF8Q 4H13C 5JJLA 4H44C 1Q90A 2JA7G 3M3YB 2B2UC 2WIIB 1I4PA 4OELB 3H0GH 3U9SA 4DV2L 4DV6Q 3NE5B 3H91A 2DY8A 4IPHA 1B3QA 1UE5A 1TWHH 1LTTD 4LFCQ 1JB7A 3A8JE 2KEDA 2QGQA 3K59A 2OTLA 4A3DG 2F3WA 4PG3A 5BN5A 5CC4A 1ENAA 4RGNA 1C48A 1TWFB 3J80i 1NY4A 2TSSA 1EEFD 2PMZE 3ULJA 1IXRA 3M4OH 1MJCA 1DZ1A 3TEHB 5KYLA 2EJMA 3K5LA 4LF9L 3A56A 1SYFA 1Y1WG 2A69D 2PMZB 4JI5Q 4ULLA 2K5VA 3HKSA 4DXGA 1SE4A 1YEZA 2Z6KC 3HOWG 1A62A 1E3PA 2IW3A 4XYQA 1QVFA 1TWAB 1F2MA 1STHA 1AE3A 2R61A 4A3GG 4LF4Q 4PV1C 3RNUA 4K2LA 2UUBQ 1DJRD 1WTHA 3AEVA 4A3BH 2HD3A 2PNHA 3RLOA 4FXDA 3HS0C 5CV5A 3I4MH 2PQAB 1HQMC 2QEJC 4YHHQ 1HNWQ 4HEDA 4C3HB 3SHLA 2MQHA 1II3A 3I4OA 4KMUC 3CCSA 4CDCC 2RHSB 1PTOC 1IBKQ 1TVXA 2C5CA 4OHJA 4TKOB 2N55A 2JA6G 4Y7NB 1GO3E 5E3FA 3RR5A 3PF4A 4N8X1 2L55A 1GUGA 1U9RA 1B7YB 2B63B 4MTKA 3G6EA 1IW7C 1BCPC 1QB5D 3G4SA 1HZ9A 2KUMA 4LF7Q 5C0XI 5C44B 2NN6H 3OWEB 2A6HD 1I94Q 4DR7L 1X3EA 1FL0A 3DEPA 2KJXA 3ND9A 2BDNA 1SEBD 2QILA 2WB1G 1VQPA 3J7YW 1LTBD 2JQOA 1U4MA 5LL6S 1CKNA 1JJCB 2K04A 1C4QA 5CMDA 2CKZB 3BU2A 4WJ4A 1BVSA 4ZYSA 4BBSH 3PO3G 3CRKC 4MNOA 4DR5L 1KNEA 5H1SE 4IOAA 4A3GB 5IP9G 4L63B 1PH5A 1JWMD 4DN4M 4C3JG 3S17H 5JJKA 1R4PB 1UWVA 4UP9A 1T5EA 1FD7D 1I3QB 4P71A 2NVXB 4YIJA 1JR0D 2WINB 1BCPB 3T4AC 4NPSA 3NTIA 3STBC 3S1NH 1XPOA 4X62L 2WAQE 1S40A 1STBA 3SR1A 1WTPA 1SBBB 1N33L 3I73A 4HMJA 1ILQA 1OXSC 4Y52H 4A3LH 3HOWB 1FNUA 1QILA 4X62Q 1MD2D 3VA5A 3MHBA 1DOLA 3E3XA 1U5KA 4A93B 1RCVD 3OPOA 1JOOA 1M90C 5DM63 1NE3A 2K4KA 1GUSA 1XNQL 2OTJA 4HJ9A 5D65A 1N32Q 1HXYD 1LV9A 4IUTA 5JVH3 4IJHA 2VB3X 1GHJA 1M8AA 1TXYA 3M4QA 5E7NA 3HOYG 3H3VH 4UPAA 4EGVA 2VQEQ 5A2QE 1MI2A 1SE8A 2L12A 5IYBH 2K03A 4MTNA 1JMCA 4KKSA 2ES2A 2JK8A 3PF5A 1KHIA 1SYDA 1XMQL 3S15H 4QJFA 4A3DH 4IFDG 4DAMA 1GKHA 4QUCA 2LXJA 4A3BB 2DNEA 2K50A 2F1MA 3J80E 1B1ZA 4JV5L 1TY2A 4GKJL 2K75A 1N36Q 5KNDA 4HJ7A 2XWBB 3CKIB 1IL2A 1SXTA 2Z6BA 3ONAB 4PNYA 5K5PA 2E5LQ 3H3VI 4JBJA 2NVXH 1N36L 3TRZA 3OW7A 4R4IA 3K5OA 4R4CA 4NXMQ 3VYTA 3GV3A 1O80A 3A0JA 3H94A 4R9WA 2GVBA 1G2TA 4X3TA 3UE1A 2JA7H 1SFOH 3OOCA 1KLUD 2XSCA 1K9MC 2LSSA 2VUMH 2MO0A 1QUQA 4KKUA 3MAQA 3U9OA 4X65L 2ATWA 4N9PA 2J7ZA 4GLVB 4X64Q 1PYBA 3E5SA 3S1RH 2V1CC 1EIFA 4AQYQ 1JB3A 4DR6Q 4PZ7A 4CKCA 4R4TA 4A3JB 1FNWA 4BY7B 2UXCL 1PH1A 4JI3Q 4LF6L 3L3OC 3Q8DA 2JEAI 1BF4A 1JOKA 1ESRA 2VB2X 4LF5Q 2F0HA 1EQTA 4JI4L 3KFUA 2I5MX 2JA8B 2B2TC 4JI2L 3OTOL 4M1UB 1LM0A 3MC0B 1UE6A 4NXNL 3K58A 4LMQD 3GTQH 3OIPA 3HRZC 3CXCA 4L5TA 3S2DH 2EYPA 4XQQA 2ZM6Q 4BXXH 1BKBA 1K8OA 2R93H 4LF4L 2ICEC 5CV9A 3GD7A 2UUAL 1PH6A 2NVTB 4BY1H 3U50C 3J81i 1RIPA 2CH4W 1IYVA 3MVVA 1XTDA 1NTGA 3TMEA 3CPWA 3M4PA 4FF1A 1Z6HA 3AMUA 1XNQQ 3DHQA 2R7ZG 1SFOB 3D4WA 4L8JA 1HPCA 1Y1VG 4HR7B 1J8IA 3GTGH 3UDIA 3RMHA 2I5LX 5FLXc 2K5WA 4P72A 5C3WA 5AJ3Q 4IFDH 4I65A 5EPLA 3W1GA 3K80C 1WTQA 3I4NH 1F2ZA 2VY3A 1EWCA 5M3MB 2IT1A 2YU9H 4YCUA 2ZTEA 1LTLA 5C3EG 2EY6A 2E2HB 4LUVA 3NBHB 4DU9A 3RN2A 2IX3A 1SN8A 4LFAL 4KLKA 1D7QA 2JSOA 2JA5G 3QWNA 1AEXA 2R92B 2XGTA 2ZTDA 3EBEA 2RCFA 5GAEC 1I6HH 3TP5A 2R7ZH 1YNJD 2L11A 1EZ6A 1I94L 4DR7Q 1E24A 4HIMA 4C1NK 4A3EH 2N88A 2XTIA 1EY6A 1S5CD 4LW1A 4A3CG 1MGSA 4ME3A 5IGFA 5M5YB 2NUCA 2Z0SA 3GO5A 5G3LF 3TN2A 2XRQD 4G7HC 3UDFA 4IFDJ 1BNZA 2X6GA 1HNZQ 1TT2A 1Z47A 2Z4IA 2QEXA 3CCVA 3V05A 5IGEA 4F7XA 2F0UA 1PRTC 2FXQA 2D0PA 4LJZC 2BA0A 5E4XA 3OIQA 4XTCS 2NBFA 3HOZB 4GZYC 2CW0C 2FMCA 3RN5A 1TKWB 5CORA 4ZUJA 1WCMH 5T1IA 1XPUA 1NR4A 3CCUA 1AH9A 1PXUA 3VYRA 2DJFC 4RKLA 1YNJC 5IODA 1YI2A 4DNIA 4YWKA 1WCMB 4GKKQ 3T53B 1YHQA 5NUCA 3BZDB 1Y1VB 4GLXA 3T1HQ 1LT5D 1JE4A 2F4VQ 3R2TA 5D14A 3S15B 1EYDA 3HEJA 1C0AA 1PFBA 3L2PA 4A3MB 5IE8A 2QA4A 1SJHD 2M00A 5C5LA 5M9OA 3NBIA 3HOVG 2NZ1D 2XN9C 4P74A 3KBGA 2YTVA 1WYDA 5JJIA 4BY1B 3I7FA 4DV3L 2AMCB 5A35A 3JC66 2R93B 2H1EA 4PZ8A 1YHAA 2C9OA 1L0XB 3BG3A 2TMPA 5GQOA 4GN4B 2HHHL 1R4QB 4QQBX 4RKBA 1OXTA 1W6KA 3G6JB 2EY2A 3NQTA 5EBCA 2E5LL 2PI2E 1M1KC 3MXNB 2A68C 1JJGA 2B2YC 3OYYA 1EYCA 4RGTA 5M5XB 2DJGC 2K6AA 3IFDA 1JWSD 4DK3C 1KIXA 4A3IB 3T51B 4U68A 1F9SA 1VQLA 3BVGA 3EFXD 5LMNL 3GTLH 1EWHA 2Q8TA 2M2LA 1A3TA 3HGBA 1YNND 2KA7A 3R2IA 1KNAA 4HJ5A 3CRLC 4KKTA 1EU4A 5KNBA 1VQ9A 1UE1A 2LXKA 1Q1BA 3ICEA 5IGDA 1SNDA 1OXVA 1B50A 5FJ8G 4KN7C 1MSHA 3TZUA 2UXDQ 1EU3A 1E2ZA 4ZAIA 4HIKA 2M9VA 3A5ZB 4A3BG 1MSGA 3FP9A 3A8KE 2PQAA 5HURA 1N34L 2CHBD 1I4GA 2WP8J 2JA7B 1GVPA 4TRDA 3PO2G 1TS4A 4DV2Q 4KY7A 3KLSA 1PZJD 1CTMA 3MZ5A 4FDBA 1WD0A 2F4IA 2SDFA 1JJ2A 3MXUA 2K5HA 4J8QA 1SE3A 4K6LA 1LACA 4KY5A 1EYAA 2QF7A 1NCVA 1UE7A 3WOEA 1RTOA 3H3VC 4QIWB 1Q3LA 1ET6A 2F0QA 3LWEA 1X9NA 2E2JB 1BXTA 4Q5VA 3DWPA 2B8GA 2NTTA 1V1OA 1B9MA 3HKZB 3IKJA 4JYAL 3M7NA 1NBWA 4N8FA 5IWAL 5M3FH 4HTHA 2LMCB 3E0JA 2OCEA 1CUKA 3H6MA 4JBWA 3GTKB 2PZTA 1S4ZA 4HJAA 4BBSG 3TS2A 4JYAQ 4X3KA 1RHPA 3EA6A 1DD2A 4B3RL 3MXNA 2VUMB 3M9BA 3SEBA 4R4OA 1N9WA 3K7AH 3F2BA 3W1BA 3M3YH 1S5ED 3FPPA 1D5MC 1GHKA 4KY6A 4JBKA 1ET9A 2PNRC 4C3HH 2ASBA 1SAPA 3TP6A 4H7BA 5KYIA 3ZJYC 1EQVA 2F0SA 5EKIA 2CWAA 2Q8IB 4H02A 3I4MB 1JICA 4JI8Q 2K32A 1PYSB 4DFAA 1Y1VH 3KF6A 4OONA 3OWFA 4HCEA 1EY9A 1ENCA 5C4XB 5EKKA 1RDPD 3AYHB 2F0NA 1OXXK 1HA5A 4I7ZC 1PTOH 5C0XG 2D5DA 2J0TD 2RDHA 1RD9D 1FGBD 1X3QA 3TREA 1N8RC 4DR4L 1V43A 1DXMA 2IHEA 1DOKA 5JPMC 1XMOQ 4HIOA 2KCCA 4E6IA 3EJIA 3M4YA 4C56C 3TQYA 5LMUQ 3T1YL 1ZKOA 2EDGA 2G9HD 5I6YA 4N9TA 1TY0A 3K8AA 2Z8LA 3DM1A 3E9IA 3J81L 3PIOA 2ZJPA 4FNFA 1TWHB 2KVMA 5CBAE 3F2UA 3DWAA 1I4HA 4LF6Q 2BH2A 1E22A 3D6CA 3I72A 1A63A 4GN5A 4JI1L 4L5QA 1FJGL 3NWSA 5IP9H 1KDBA 3VR5A 1Z7TA 4JI2Q 1PA6A 2L0CA 4KN4C 3PO2H 2KEEA 3BJUA 4YY3L 4CJ0B 1KXLA 3ITPA 4IQZA 1Q86C 1TWGB 4C2MB 4XQJA 1YIJA 4NDXA 1S5FD 2AWNA 3UDGA 2F0MA 4GOPB 5IGCA 1JC7A 4XIGS 3L9AX 4DV0Q 2FMMA 2IHFA 3EQLC 4ZCKA 4A3JH 4LF5L 2F0DA 3NUCA 3GDEA 1JT8A 3MWYW 1NR2A 1Q8KA 4Q0FA 4LK1C 1X65A 3Q24A 2NZOA 3J81E 2N78A 3S2HB 3HKZG 2YTYA 1XPRA 2JA5B 2L9HA 2H5XA 1CHQD 4A76A 2F0JA 1SNOA 1GOZA 5J3BA 2MPMA 1F77A 4DUYL 5DEHA 4AIMA 4A3MH 3HOUH 1PYWD 1M4VA 1SNPA 4J1MA 4DR2Q 4M8AA 4RHSA 2JA6H 5E4WC 2A1AA 4BBSB 4ZLTF 3BDLA 4XDXA 4YCVA 3I90A 5D3IB 4B3RQ 5K36G 4KHPQ 3VR3A 4RMFA 4C3IB 5IYBG 1LT6D 2VL6A 5EAYA 3FHWA 1L0YB 4FF2A 2F3IA 1EQQA 3PCOB 2A5HA 2RBMA 1Q82C 1A2TA 4G7ZC 1Q81C 2F0FA 5DM73 1G6PA 1IW7D 2E8GA 3C3LA 2LKVA 1EWIA 4GNXA 5C5MA 2WKCA 1AN8A 1GD7A 3D6WA 4BBRG 3S1RB 3HKZE 1D1IA 4DV4L 3BZKA 1IYUA 4GNXC 3ULLA 3MFGA 1EYGA 1FNVA 1UNSA 2EJGC 1PV4A 1SDFA 1SRUA 2MP1A 2KBNA 2F0GA 2PZWA 1NJIC 5M3FB 1VQ6A 4QY7A 1S72A 2JXMB 4IURA 1CM9A 2HIVA 2N3SA 1N34Q 3WWVA 4B3SL 4QCLA 2RDFA 3U4VA 5JVG3 4WORA 1W2BA 1Y69U 4P2CB 2WAQB 2R93G 3R93A 2E2HH 1TS2A 2Z1CA 2Q2HA 1VQOA 5FOBB 3M7GA 3PIPA 3Q22A 1B53A 4C3IH 1DYQA 4U673 4B3MQ 4BWGB 4OX9Q 3HOZH 4YHHL 4B9WA 2Y0SG 4ID6A 4X66L 4R8IA 1PH7A 1SNMA 4JW0A 4NKLA 5FLXE 3E6ZX 4BBRH 3N52A 3JAME 2NYZD 1D2BA 1BO0A 2FHTA 3I2ZA 2JN4A 3K7AB 1QCBD 2L5TA 2ZM6L 2MUYA 2YV5A 4JI8L 3I8ZA 2AUJD 1EEID 3KLRA 4PQXA 4A3EB 1L0WA 1CZWA 5M3MG 2F0OA 2F52A 3WDNA 4DV7Q 2HDLA 2EXDA 3UDXA 1TQOA 1F9QA 3SGIA 4HMIA 1AZPA 1I5FA 4A3IH 4OGQC 3ZYYX 2DGYA 1VQHA 1C8CA 5IP7H 3SK4A 5J39A 3M85A 1NSNS 5CV7A 3TBIB 2E2JH 1UEBA 3BDOA 4L6TB 5LL6X 1K8MA 1SYCA 2B63H 3H0GG 2GA4B 1PHJA 1H9JA 1PTOF 3CCEA 3H15A 2A74C 5I2XA 5IT9L 3NENA 3BZCA 5C0XH 3RZOB 2E76C 1J5EQ 1DOMA 4H0LC 1B4OA 2D9UA 2NWGA 4WRDA 3P1HA 3JAML 5C3EB 3SVMA 4EQPA 3KUPA 1D6EC 5ISRA 1WI5A 4HSVA 1LTSD 3CAMA 1SJED 2EJFC 3D3RA 3VYSA 1SYEA 3H09A 2Y0SE 1QNUA 5ELFA 3LX0A 3PMFA 4GLAC 1LT3D 3BYYB 2Y0SB 1MHWC 2AQ3B 4RG1A 1B9NA 1EIGA 1XTCD 1CA6A 1RTNA 1G8ZD 2JE6I 4F87A 1PTOB 3L7ZC 2UUCQ 3J81c 2QDLA 1FJGQ 2K7VA 2JA8H 5M5XH 4GNXB 2BE5D 5E1FA 3KJPA 3J80c 2UXBL 3HZXA 1CI3M 1VQMA 1CQFA 4AH6A 1L1OA 3NK9A 4RGMA 1U4RA 1Y1WB 5T1GA 1VQDA 5GAGC 4IN3A 2CH4A 3M4OB 2KCTA 1RJTA 2UXBQ 1LTGD 2WKDA 4B3ML 1V1QA 3CHBD 4DV0L 4Y7NH 4OX9L 1Q12A 1K83B 2XWJB 4NXNQ 1X3PA 3F2DA 4X66Q 4OXPA 3UI2A 1L1OC 1HUMA 4PZ6A 1EY5A 3H0GB 2BOSA 2UUAQ 4S3SA 3DEOA 3VR6A 1EQRA 4B08A 1EFID 1KLGD 2BE5C 3T56B 1PH8A 2MNAA 3BYTB 4EQNA 2ZXPA 4UP8A 2K33A 3W5OA 5AFWA 3Q0AA 1MIUA 1VF7A 2WV6D 1WTRA 5EPJA 1B3AA 2AQ1B 1EY8A 3CF5A 2HHHQ 5AJ3L 3CQZH 1NUCA 2YYZA 1EFWA 1T9HA 2IWHA 1WTOA 5DAUA 5IT9c 3W3AA 2EYLA 3A54A 4G4KA 3F8TA 4K8JA 1IHZA 4RCOA 2ZXOA 3NHHA 3NBHA 1KD1C 3PUWA 5C4JH 4FF4A 3EROA 3GTJB 3S17B 2AWOA 4UAIA 1TWFH 1VMPA 3FMCA 4DR3L 4TVAB 5FLMG 1H9KA 4NXML 4BS9A 3J7AV 1JOQA 1VDZA 2KCNA 1K3BC 3J81j 4DR3Q 1SNQA 1IBLQ 2F0VA 4TQUS 5I9OA 2R7ZB 3ER0A 1XJVA 2PPBC 4EQ5A 5JEAG 4A3FG 2FFKB 4CGYB 1UAPA 2F3VA 1FR3A 3RUZA 4OIJA 1LTRD 1KTKA 5G3LD 3B6YA 2K5NA 2O5IC 2B2WA 4JCVE 2ZJRA 1TWCH 2Q2IA 5IWAQ 4A93G 4C3IG 3CMEA 2A68D 1I50H 3A7LA 3S1NB 1BCPD 1EY0A 3A55A 3FRPB 1GM5A 3DMUA 4K0KL 5FJ8H 3U58A 2B8FA 3HOXB 1D5ZC 2D62A 1PFNA 2WAQG 2SEBD 4IJLA 5IYDH 2OEOA 2A69C 1EUJA 2Z9HA 3HP3A 2MHVA 4R8NA 5KIXA 1XNRQ 2B2TA 1N32L 1HZCA 1SLJA 4ME5A 1J6QA 1DCZA 2E2DC 1YVCA 4A3LG 4A75A 3AFPA 1STAA 1BUVT 4OWXB 2A19A 1BBXC 1X55A 3DM3A 2VXWA 1OXUA 4G7OC 2JA9A 1BBWA 4FXKC 2OT2A 1VQCA 3D4DA 3S24A 4DV3Q 5IGGA 4K2KA 3CW2C 4ZKBB 1A2UA 1SROA 3DWQA 1DGSA 1QVGA 3I3CA 3K57A 2L15A 1AFPA 1XMOL 3SDZA 1S5BD 1K8GA 4PMCA 2F0IA 4O1NA 5KRUA 5LMUL 4PMWA 4XQNA 1ICWA 4APVA 2AQ2B 2CW0D 3S1MH 1YNXA 1GUTA 2B2UA 3SXHA 3A8IE 2ZTCA 4AYBB 4FP5D 2NN6G 4BA1I 5C4HA 2NVQH 1KAWA 1WTWA 3AB9A 4LUOA 2B39A 2E2IB 4ZKCB 3P7JA 4LF9Q 2Z6KA 4J15A 4LF8L 2EYHA 1G91A 1H95A 1K3RA 4A3MG 3GTKH 5I4DA 1IKLA 1IYJB 3QR8A 2WFWA 4DR5Q 3UE0A 5FO7B 2VZAA 3LWUA 4ALPA 4B3TQ 2A6HC 1ASYA 2AKWB 5JJZA 3QJYA 2VQFQ 5ELOA 4A3IG 4V0BA 2HIXA 3C46A 2K5QA 4DA2A 5M3MH 1CSQA 1SR3A 1L1OB 1X3GA 1TIID 2JYOA 2ZXRA 1KC8C 4BXXG 4C3JH 3LNNA 5CBEE 1ILPA 4RCNA 1AE2A 1VQIA 4DV1L 2RSOA 3C1EA 1HNWL 1QJOA 3TSSA 3PO3H 1XWEA 4PMBA 1ZYRD 4GKKL 4A3JG 2UUBL 4HSPA 2XIWA 2IPKD 5GADC 4RGOS 1HJPA 2HQEA 4A4IA 1HQRD 3T16A 2D2CC 4LNQA 1UEAB 2CWPA 2RSNA 3VR2A 3KBXA 1XYIA 1X54A 1FGUA 2RA4A 1HA6A 1EY7A 1VQ7A 4P73A 2R7DA 3QB3A 3NSWA 3JAMi 3P75A 2O2LD 1Z9FA 1H9SB 3AU7A 4NMZA 2B29A 2G9DA 1CQVA 2JEBI 5JPNC 2A6EC 2EY5A 1GUNA 4UDUC 4DV5Q 1TU2B 1X32A 1SMYD 2I0QA 2F0TA 4J6HA 5HGTA 1KL9A 3NELA 1CKOA 1EL0A 3OSOA 4DKAC 3KF8B 5EJWA 3PUYA 3NP8A 4HCSA 3GTPB 2PCFB 3FDTA 4CKBA 5LHY1 4BY7H 1HRJA 3OW2A 3C1FA 3KK7A 4QUFA 1PRTB 3BS1A 2EPBA 2F0PA 5CYUA 1Q7YC 5ELEA 1F2LA 2R6GA 1NAPA 2PW7A 4AQYL 2WACA 4CBVA 1CFMA 3RZDB 4ZUIA 4A3GH 1DM0B 1KDAA 2YTXA 1Y8PB 4JI5L 4DV4Q 2NVQB 2R92G 4K14A 3I4NG 2DN8A 1O7YA 1Y8OB 4RHRA 3GTOB 2VUMG 5M5WB 5FKAC 3CD6A 5EQ0A 3MXGA 3EIVA 4HIDA 4LFBL 2HDMA 3FKIB 3PUVA 3HOYH 5FLXL 3T13A 1IBLL 3S14H 1S3OA 1CK1A 5K36H 1VQJA 2HCIA 2JP1A 2CQOA 4F88A 4A3DB 1F9RA 2N8NA 4AYBE 4IPGA 2N49A 3G48A 4MIUA 5CR3A 1LABA 4KK7A 1EY4A 4GN3B 3DXJC 1NNXA 1XNRL 2K5DA 3RLFA 1EOVA 5HY6A 2B2YA 3NXWA 1MJEA 3PIP3 1A15A 1PLFA 2EYJA 1RL2A 1NMFA 3CC2A 4IPCA 4KHPL 3E9HA 4K0KQ 3I56A 4OWTB 1STYA 3I55A 2QCPX 4ZK9B 3EVQA 4QB4A 3QOLA 3SK6A 4YCWA 3KDFB 3E0EA 4DXFA 3L0OA 1K73C 3P20A 4DR1Q 4DAVA 2VQEL 2ALYB 2NN6I 1LLRD 3QG1A 2SOBA 4Z9CB 2Q2UA 3PQIA 4POGA 3WOFA 4LFAQ 4FF3A 4B9XA 1QG7A 1XX8A 1MBYA 1TWAH 1MKHA 1PFMA 2J4XA 4ZQ3A 5TSSA 3R8BA 1LTID 4DGZA 1XXGA 1HUNA 4EVOA 4IO9A 3I4NB 2DNCA 3FKIH 3MXPA 3CC7A 4GKJQ 4C3HG 5I6WA 1I3QH 1WVLA 3G7LA 1X56A 3PSIA 3N6RA 5J22A 5KNCA 5ELBA 2BA1A 1L2FA 3PV0A 2NVYH 4IALA 4BY7G 1HNZL 2H4OA 3O13A 1E1OA 1GXDC 2BH8A 1KRSA 5GAHC 2OWOA 3VDYA 1TS3A 2XNAC 1RF2D 3QO2A 3RLNA 3LGJA 2IX1A 1HNXQ 3HOXG 2B63G 4RH6A 2EOTA 1LO5D 5C4JB 3K5MA 1C7YA 1WJJA 2F0KA 4DK0A 4O0AA 4DK1A 2EE1A 5EBDA 2CQAA 1QNKA 4OO1G 3TP8A 3CU7A 1QWYA 3KYHC 4JI0Q 4B3SQ 1SMXA 3K5NA 2PYKA 2RQXA 3S9WA 4YY3Q 4JI6Q 4LFBQ 1TWGH 3FKIG 4C2MH 1HR0L 1D5XC 1A8VA 2UUCL 1O7IA 2EQSA 4JI0L 1KABA 2PI2A 4JVZA 5ELDA 1OTCA 1E1TA 2B3GA 3KDFA 4A3KG 3S1QH 1N33Q 1QZHA 2PW5A 1JE5A 1ONLA 2OF1A 4DV1Q 2EYMA 1O78A 4OL7A 1T5XD 5GROA 4X6AH 1AZQA 5M3FG 3NWTA 5FO9B 5BN3A 1K83H 1VQ8A 2ICIA 1G51A 1SNCA 3KJOA 1HCZA 2F03A 3MTSA 2PO4A 2R3ZA 4CHTB 2D0OA 2K52A 3RD4A 1JQYD 3GTJH 4UY8C 4BBRB 4EQOA 1VQ5A 5C4XG 3MEFA 2FJ2A 5IGBA 2EXZA 4I7AA 5IYDG 4JPBW 1H9MA 1BBUA 4KTAA 3TZDA 1HZAA 4FO2A 5KEEA 3DUZA 1CSPA 3HOVH 2IJ0A 1K8AC 1EOTA 1V8QA 1YJWA 4O42A 1J5EL 5EKLA 1LUZA 1H9SA 3ULPA 2GN5A 4RFBA 4OO1I 1JCKB 3KF6B 4L5SA 4IUVA 1QZGA 1IBML 1LTAD 3RZDH 1PRTD 2EY1A 5C3EH 2MJ8A 4DR6L 1D8LA 2E2IH 1A0IA 2R7FA 4KD4A 1OO9B 4ODGA 1NMGA 4CKEA 4XT3B 1VQGA 1VQAA 2PQEA 1EIYB 1EIHA 3D31A 4HN7A 4DK6C 2RCNA 2RHQB 1HR0W 4LFCL 3S16H 1JWUD 3W2DA 1Q46A 3HG9A 2LY7A 2XRSD 4IUUA 2KHIA 4OO1H 5L37A 3C2PA 3D0FA 3K6OA 3I70A 1CKNB 1YNNC 1A6XA 4K5WA 1SMYC 4KHVA 1STGA 2DUDA 4A3EG 2K01A 2NTSA 3IAYA 2ID0A 4O2DA 2KHJA 1V1PA 3FPUB 3G71A 3ERQA 3OTOQ 1WD1A 2OQ0A 4R4QA 5EGTA 3D4RA 4DNTB 3KLWA 1HFNA 3K0YA 1PZID 4JI7L 3J7ZC 5C4ZA 2Q2TA 4A3KH 2CVRA 1XMQQ 3J7AF 4C1NI 1E2WA 3SK8A 3D8GA 1PH3A 3CPFA 2JA5H 2WB1E 3PUXA 4CJ2C 4DUZQ 1ICFB 3S2HH 5BN4A 3RZOH 3CMAA 1H9RA 2KCMA 2WB1B 2NZHA 1R9TB 3CCMA 4KHZA 4IUPA 1CZGA 1WTXA 3KOJA 1SYBA 3CCJA 5IT9E 1E7ZA 3CQZB 2NB0A 3URYA 4POFA 3GTPH 3QIAA 1YZ6A 3STBD 1SSOA 4NW2A 1CHPD 1IBMQ 4K5XA 1PRTF 2KENA 2P5ZX 3JAMc 3U4ZA 1I4QA 1U4PA 3PO2B 3TS0A 1VF5C 3Q6SA 5CV4A 2JA8G 4LUZA 1ML0D 2X6LA 2O5JC 1BCPF 2A73B 2V4DA 3BDCA 1FYCA 5CV8A 2BDOA 3SE0A 2B2WC 2VS1A 3OMCA 4HAEA 4NP5A 5IOCA 3PUZA 1WTVA 2O4XA 4ZRZA 1F9PA 1D1KA 2E74C 2G5DA 2UXCQ 2RVLA 4DPGA 3GV6A 4YWLA 3NTKA 4EX5A 3CCQA 1VQFA 4JG2A 4QF4A 3S1MB 1QOHA 4XYOA 1ESFA 2DY7A 2EVBA 3CC4A 2KQ3A 3PIO3 1STEA 4JC0A 1HR0Q 4KJOA 4ILWA 4CDFC 1RKNA 2UU9L 1PZKD 5CV6A 4C3JB 4B3TL 3HOYB 5JEAH 4A3FH 5C0XJ 3S14B 2AUKA 3VYUA 1ASZA 2VQFL 2Q8RE 2HT1A 2IX0A 4MN3A 3GQBA 3HFZB 2OXPA 2B2VC 4TSSA 1G2SA 1O7ZA 4DAPA 1X6OA 1BQQT 1ENFA 3V2TA 3IFTA 4JI6L 4IFDI 3K7UC 1QE6A 3HOUB 5JEAJ 2MFIA 4K5VA 2MGSA 1QUQB 2BCOA 5J1ZA 2Z4HA 4RWSC 2HCCA 3CCRA 1CT1D 5JOBA 4JOIC 5ELCA 4KD3A 4YWMA 2MO1A 3HOXH 3EN2A 1P8LA 1KRTA 5IY0A 4DV5L 3CCLA 1LT4D 5IP7G 3S1QB 4FXGC 3PGZA 1I6HB 4QL5A 3GTMH 1ZXTA 3NTHA 1VMCA 4DNRB 4DR4Q 1DONA 2I5HA 2KHSA 1V9PA 1A3UA 4KJNA 2KECA 4GOPC 4A3FB 2IL8A 3TDQA 4LWCA 1EZ8A 3VR4A 3BVZA 2YU9B 3HOVB 3ND8A 4F8MA 2F0LA 5JAVA 1R9TH 5LMNW 1VQEA 2K14A 2EZVA 1Y8NB 2AHOB 3MEHA 1S5DD 1PH2A 4QIWE 1UUPA 3Q23A 4WJ3M 3GTOH 3GTGB 2X69A 4P75A 1RODA 1TS5A 4A3KB 2IY5B 3CP0A 1K0SA 2VW9A 4GOPA 1ZYRC 1O7LA 1HFGA 4L5RC 2SNSA 4CJ1B 2F0EA 4JI4Q 2CFMA 4IZ8A 4IOCA 3HOUG 4X65Q
chains in the Genus database with same CATH topology
4IPDA 4LF6L 3Q8DA 2R93G 3EIVA 4HIDA 2JEAI 4LFBL 2E2HH 3PUVA 3HOYH 1IBLL 3S14H 4LF5Q 1S3OA 2Q2HA 4JI4L 3KFUA 1VQJA 2I5MX 3AQQA 5C4XH 1VQOA 3PIPA 2F4VL 4JI2L 3OTOL 2CQOA 3F2CA 4C3IH 4BA2I 1LYLA 4GS3A 4B3MQ 4OX9Q 1PVOA 2N8NA 1LM0A 3HOZH 4AYBE 4YHHL 1UE6A 4NXNL 2GVAA 2Y0SG 4IPGA 5HGQA 4X66L 2N49A 1Y14B 3G48A 1PH7A 3GTQH 1WOCA 3CXCA 4L5TA 3S2DH 4GN3B 2ZM6Q 4BXXH 1BKBA 4DUYQ 2R93H 1XNRL 4LF4L 4BBRH 3GD7A 3RLFA 1EOVA 1PH6A 2UUAL 4BY1H 5HY6A 3U50C 1RIPA 3J81i 3A5UA 1MJEA 1PH4A 3I2ZA 4DUZL 1XTDA 1NTGA 1FVIA 1RL2A 3CPWA 1NMFA 3CC2A 4DR1L 3M4PA 2ZM6L 4IPCA 1XNQQ 4KHPL 3E9HA 2R7ZG 4K0KQ 2YV5A 4JI8L 3I56A 4OWTB 1HZBA 1IZ6A 1Y1VG 3I55A 4YCWA 4JI7Q 3KDFB 3E0EA 3UDIA 4AYBG 3GTGH 3L0OA 1L0WA 2I5LX 1K73C 5FLXc 5M3MG 2VQEL 4DR1Q 2ALYB 1B70B 2F52A 2NN6I 4DAYB 1Y1WH 1CKMA 4P72A 4DV7Q 5AJ3Q 1P16A 4HJ8A 4OWWB 2Q2UA 2EXDA 3UDXA 3SGIA 4POGA 1I5FA 3W1GA 3K80C 1QVCA 4A3IH 3I4NH 4LFAQ 2DGYA 1VQHA 1KQSA 2VY3A 5IP7H 2CCZA 2IT1A 3M85A 2YU9H 4YCUA 1TWAH 1MKHA 4DV7L 2ZTEA 1LTLA 5C3EG 2E2JH 4IO9A 4LUVA 3NBHB 3RN2A 1SN8A 1UEBA 1HH2P 2B63H 1YHBA 4LFAL 2UXDL 4KLKA 3FKIH 3H0GG 1D7QA 3CC7A 2JA5G 2A8VA 1PHJA 4GKJQ 5M5WH 3J7A5 2XGTA 2ZTDA 3EBEA 1PH9A 3CCEA 3H15A 1VQ4A 1I3QH 5GAEC 1I6HH 2EIFA 1X56A 3NEMA 3NENA 3BZCA 3PSIA 2R7ZH 1I94L 4DR7Q 1J5EQ 1B8AA 1E24A 2C35B 4HIMA 4A3EH 5LMNQ 1HNXL 1VQBA 2BA1A 1L2FA 2XTIA 2NVYH 3PV0A 5BR8Q 1HNZL 4BY7G 1E1OA 2BH8A 4LW1A 4A3CG 1KRSA 4ME3A 5GAHC 2OWOA 3VDYA 4JI1Q 2Z0SA 1WI5A 3RLNA 3LGJA 3CAMA 3GO5A 3I4MG 5M5YH 2IX1A 2HQLA 1HNXQ 3HOXG 3AFQA 3T1YQ 2B63G 3UDFA 4IFDJ 4DV6L 1HNZQ 2Y0SE 1Z47A 3HOZG 2QEXA 4GLAC 3CCVA 1C7YA 1WCMG 2UU9Q 1WJJA 1W3SA 2D0PA 2FXQA 4A93H 2BA0A 4RG1A 1YITA 4O0AA 1VQKA 2RF4A 5ELNA 4XTCS 4X64L 2R92H 2JE6I 4QGUA 3RN5A 3L7ZC 2UUCQ 1WCMH 3J81c 1XPUA 3HOWH 3KYHC 4JI0Q 4OO1G 1YBYA 3CCUA 1FJGQ 4B3SQ 5FLMH 3T1HL 1SMXA 1AH9A 4OX9L 2JA8H 5M5XH 4GNXB 4JI3L 3KJPA 3J80c 2UXBL 1YI2A 4YY3Q 4DNIA 1VQMA 4YWKA 1TWGH 3FKIG 1L1OA 4AH6A 4C2MH 1HR0L 1A8VA 4JI6Q 2UUCL 4GKKQ 1C9OA 1O7IA 2EQSA 1YHQA 1X3FA 3K0XA 1G291 4JI0L 4A3CH 2PI2A 4GLXA 1YJ9A 3T1HQ 2OQKA 1E1TA 1VQDA 2B3GA 3KDFA 5GAGC 4A3KG 1OTCA 1N33Q 3S1QH 2F4VQ 2KCTA 1QZHA 1VS0A 2UXBQ 3K81C 1JE5A 4B3ML 1V1QA 1IBKL 4BY1G 4Y7NH 4DV0L 1Q12A 4DR2L 3L2PA 4DV1Q 5IE8A 2ZJQA 4NXNQ 3DLLA 3F2DA 2QA4A 5GROA 4X66Q 4OXPA 4X6AH 5M3FG 1L1OC 3HOVG 4P74A 3ERSX 4PZ6A 3F1ZA 2YTVA 3IRBA 1WYDA 1K83H 4MZ9A 1U0LA 1VQ8A 1G51A 2UUAQ 5JJIA 3I7FA 3KJOA 1EQRA 4DV3L 2JJQA 2AMCB 3JC66 4PZ8A 1YHAA 2NVTH 2D0OA 2K52A 3GTJH 4UY8C 1VQ5A 5C4XG 1YJNA 1Q1EA 3MEFA 4UP7A 4LF7L 1PH8A 5GQOA 4GN4B 5IYDG 2MNAA 2HHHL 4JBMA 1VQNA 5C44G 4QQBX 4UP8A 3W5OA 1OXTA 1BBUA 4JOIA 1MIUA 2E5LL 1VCIA 2PI2E 1HZAA 5IYCG 5IYCH 1M1KC 3MXNB 1CSPA 4R1JA 3HOVH 3A74A 1JJGA 3OYYA 3CF5A 2HHHQ 5AJ3L 5C44H 1K8AC 3CQZH 1YJWA 2YYZA 4DK3C 1KIXA 4NB3A 1EFWA 1VQLA 1T9HA 1J5EL 1K0RA 5LMNL 3GTLH 5IT9c 4JV5Q 1LUZA 5BR8L 4KI0A 1WFQA 3ULPA 2GN5A 4HJ5A 3F8TA 2VNUD 4OO1I 1VQ9A 1UE1A 2LXKA 1PFSA 1Q1BA 3ICEA 5DLQE 1KD1C 3PUWA 1OXVA 3KF6B 5C4JH 4L5SA 5FJ8G 1QZGA 4LF8Q 1IBML 5JJLA 2JA7G 2UXDQ 4DV2L 3H0GH 2AWOA 4DV6Q 3RZDH 4HIKA 1TWFH 3A5ZB 4A3BG 3FP9A 4DR3L 4IPHA 4TVAB 5FLMG 2PQAA 1UE5A 1TWHH 1N34L 5C3EH 4NXML 4LFCQ 1JB7A 4DR6L 2OTLA 4A3DG 2QGQA 2WP8J 1D8LA 4PG3A 1GVPA 2E2IH 3PO2G 1A0IA 4DV2Q 3J80i 2R7FA 1NY4A 1NMGA 3J81j 1VQGA 1VQAA 2PMZE 1IXRA 3ULJA 1MJCA 4FDBA 4DR3Q 3TEHB 3D31A 1IBLQ 3M4OH 4DK6C 2RCNA 2RHQB 4TQUS 1JJ2A 4LFCL 1HR0W 4LF9L 3S16H 3ER0A 1Y1WG 1XJVA 2K5HA 4EQ5A 5JEAG 4A3FG 4JI5Q 2K5VA 3HKSA 1Q46A 1YEZA 2Z6KC 3HOWG 1A62A 2KHIA 3B6YA 2K5NA 1EIYB 3D0FA 1UE7A 1E3PA 1CKNB 4JCVE 2ZJRA 1TWCH 1X9NA 2Q2IA 5IWAQ 4A93G 1QVFA 1AE3A 3CMEA 4A3GG 2DUDA 4A3EG 4LF4Q 3RNUA 1I50H 2UUBQ 3AEVA 2ID0A 4O2DA 4A3BH 2PNHA 2KHJA 3RLOA 4JYAL 3M7NA 1GM5A 1NBWA 5IWAL 5M3FH 3I4MH 2PQAB 3G71A 3OTOQ 4K0KL 2OCEA 5FJ8H 3U58A 1CUKA 4JBWA 2OQ0A 4R4QA 4HJAA 4YHHQ 1HNWQ 3KLWA 2D62A 4BBSG 3TS2A 4JYAQ 2WAQG 3J7ZC 4JI7L 4IJLA 2MQHA 2Q2TA 3I4OA 5IYDH 4A3KH 4B3RL 1EUJA 3CCSA 1XMQQ 2RHSB 1XNRQ 3M9BA 4R4OA 1N32L 1N9WA 1HZCA 1J6QA 1SLJA 3K7AH 3W1BA 3F2BA 1IBKQ 1YVCA 3M3YH 4JBKA 4A3LG 1PH3A 3CPFA 4C3HH 3AFPA 4A75A 2JA5H 2WB1E 2ASBA 3PUXA 2JA6G 4DUZQ 4OWXB 2A19A 3ZJYC 1X55A 3DM3A 3S2HH 1GO3E 2CWAA 1OXUA 3RZOH 3CMAA 4H02A 2KCMA 3RR5A 3PF4A 2JA9A 2NZHA 1BBWA 4JI8Q 1PYSB 1VQCA 1B7YB 3S24A 4KHZA 3CCMA 1Y1VH 3KF6A 4DV3Q 3G6EA 3CW2C 4OONA 1SROA 3KOJA 3CCJA 1E7ZA 1DGSA 3G4SA 1HZ9A 1QVGA 4LF7Q 2L15A 3AYHB 4POFA 5C0XI 1XMOL 1OXXK 3GTPH 1YZ6A 3STBD 3HOUH 5C0XG 4LFBQ 1K8GA 1I94Q 4DR7L 1IBMQ 1X3EA 2KENA 1FL0A 3JAMc 5LMUL 4PMWA 3TREA 1N8RC 4DR4L 3U4ZA 1V43A 2WB1G 4APVA 2IHEA 3TS0A 3S1MH 1YNXA 1VQPA 1XMOQ 4LUZA 2JA8G 2JQOA 4HIOA 2ZTCA 1CKNA 2NN6G 1JJCB 3TQYA 4BA1I 5LMUQ 2CKZB 3BU2A 2NVQH 4WJ4A 1BVSA 1KAWA 3T1YL 4BBSH 2VS1A 3PO3G 4LUOA 4MNOA 4DR5L 3K8AA 5H1SE 4IOAA 3PUZA 5IP9G 3E9IA 3PIOA 2Z6KA 1PH5A 2ZJPA 4LF9Q 4J15A 4LF8L 1H95A 3S17H 1K3RA 2UXCQ 4A3MG 4LF6Q 3GTKH 5JJKA 4DPGA 2BH2A 1UWVA 1IYJB 4UP9A 1E22A 4YWLA 4EX5A 2WFWA 1A63A 4DR5Q 3UE0A 3CCQA 1VQFA 4GN5A 4DR6Q 4JG2A 4JI1L 4L5QA 1FJGL 2VZAA 4ALPA 4P71A 5IP9H 4B3TQ 1ASYA 1C0AA 3CC4A 2AKWB 4JI2Q 2VQFQ 5ELOA 1PA6A 3PO2H 3BJUA 4JC0A 4NPSA 3STBC 4YY3L 4A3IG 1HR0Q 3S1NH 1KXLA 1XPOA 2HIXA 4X62L 1Q86C 2WAQE 1S40A 2UU9L 1YIJA 2AWNA 4B3TL 5M3MH 3UDGA 1CSQA 1SR3A 1L1OB 1X3GA 1KC8C 4A3FH 1PH1A 5C0XJ 4GOPB 1N33L 1ASZA 4C3JH 2VQFL 4BXXG 2HT1A 1OXSC 2IX0A 4Y52H 4A3LH 1AE2A 3HFZB 4XIGS 4DV0Q 1VQIA 4X62Q 4DV1L 2IHFA 4LF5L 4A3JH 1HNWL 3PO3H 3GDEA 1JT8A 1X6OA 1U5KA 1Q8KA 1M90C 1X65A 2OTJA 1NE3A 2K4KA 2NZOA 1XNQL 2N78A 4JI6L 4HJ9A 4IFDI 3HKZG 3K7UC 4GKKL 2YTYA 1XPRA 1N32Q 4A3JG 2UUBL 4IJHA 2MFIA 5JEAJ 5GADC 3M4QA 1HJPA 1QUQB 1TXYA 5E7NA 4A4IA 3H3VH 2H5XA 3HOYG 4UPAA 4A76A 4LNQA 3CCRA 2VQEQ 2CWPA 5J3BA 4JOIC 4DUYL 4AIMA 4YWMA 4A3MH 1X54A 2MO1A 1FGUA 1SE8A 3HOXH 5IYBH 3EN2A 4DR2Q 1P8LA 1KRTA 5IY0A 4DV5L 1VQ7A 2JA6H 2A1AA 4P73A 2R7DA 4MTNA 3CCLA 3JAMi 4YCVA 5IP7G 1JMCA 2ES2A 1Z9FA 2JK8A 4B3RQ 3PF5A 1KHIA 1XMQL 3S15H 5K36G 2B29A 4QJFA 2JEBI 3PGZA 4KHPQ 4RMFA 4QL5A 4A3DH 4IFDG 3GTMH 4DV5Q 4DAMA 1GKHA 2LXJA 5IYBG 2VL6A 5EAYA 3FHWA 2I0QA 2K50A 2F3IA 1EQQA 4DR4Q 4JV5L 2I5HA 3PCOB 1V9PA 1Q82C 1KL9A 3NELA 2K75A 1CKOA 4GKJL 1N36Q 4HJ7A 4DKAC 3KF8B 4GOPC 3PUYA 1IL2A 1Q81C 4LWCA 2E5LQ 3H3VI 4BY7H 1G6PA 4JBJA 1R9TH 3OW2A 2NVXH 5LMNW 1N36L 1VQEA 2E8GA 2K14A 3TRZA 4GNXA 1EWIA 4R4IA 4R4CA 2AHOB 1GD7A 1PH2A 4NXMQ 4BBRG 4QIWE 3A0JA 4WJ3M 3GTOH 3HKZE 1Q7YC 4DV4L 2GVBA 4P75A 3BZKA 3UE1A 4GNXC 3ULLA 2JA7H 1SFOH 1EYGA 2R6GA 2IY5B 1K9MC 2LSSA 3CP0A 2VUMH 4AQYL 2MO0A 1QUQA 4A3GH 2YTXA 4JI5L 4X65L 2VW9A 4DV4Q 1PV4A 2ATWA 2R92G 4GOPA 1SRUA 4GLVB 4L5RC 4X64Q 1PYBA 2KBNA 3I4NG 1NJIC 1VQ6A 4QY7A 1S72A 3S1RH 1N34Q 2HIVA 1EIFA 2N3SA 2V1CC 3WWVA 4AQYQ 4B3SL 4JI4Q 2CFMA 4PZ7A 3U4VA 4R4TA 2VUMG 4IOCA 3HOUG 4X65Q 3CD6A 2UXCL 1W2BA 4JI3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPD A;  4LF6 L;  3Q8D A;  2R93 G;  3EIV A;  4HID A;  2JEA I;  4LFB L;  2E2H H;  3PUV A;  3HOY H;  1IBL L;  3S14 H;  4LF5 Q;  1S3O A;  2Q2H A;  4JI4 L;  3KFU A;  1VQJ A;  2I5M X;  3AQQ A;  5C4X H;  1VQO A;  3PIP A;  2F4V L;  4JI2 L;  3OTO L;  2CQO A;  3F2C A;  4C3I H;  4BA2 I;  1LYL A;  4GS3 A;  4B3M Q;  4OX9 Q;  1PVO A;  2N8N A;  1LM0 A;  3HOZ H;  4AYB E;  4YHH L;  1UE6 A;  4NXN L;  2GVA A;  2Y0S G;  4IPG A;  5HGQ A;  4X66 L;  2N49 A;  1Y14 B;  3G48 A;  1PH7 A;  3GTQ H;  1WOC A;  3CXC A;  4L5T A;  3S2D H;  4GN3 B;  2ZM6 Q;  4BXX H;  1BKB A;  4DUY Q;  2R93 H;  1XNR L;  4LF4 L;  4BBR H;  3GD7 A;  3RLF A;  1EOV A;  1PH6 A;  2UUA L;  4BY1 H;  5HY6 A;  3U50 C;  1RIP A;  3J81 i;  3A5U A;  1MJE A;  1PH4 A;  3I2Z A;  4DUZ L;  1XTD A;  1NTG A;  1FVI A;  1RL2 A;  3CPW A;  1NMF A;  3CC2 A;  4DR1 L;  3M4P A;  2ZM6 L;  4IPC A;  1XNQ Q;  4KHP L;  3E9H A;  2R7Z G;  4K0K Q;  2YV5 A;  4JI8 L;  3I56 A;  4OWT B;  1HZB A;  1IZ6 A;  1Y1V G;  3I55 A;  4YCW A;  4JI7 Q;  3KDF B;  3E0E A;  3UDI A;  4AYB G;  3GTG H;  3L0O A;  1L0W A;  2I5L X;  1K73 C;  5FLX c;  5M3M G;  2VQE L;  4DR1 Q;  2ALY B;  1B70 B;  2F52 A;  2NN6 I;  4DAY B;  1Y1W H;  1CKM A;  4P72 A;  4DV7 Q;  5AJ3 Q;  1P16 A;  4HJ8 A;  4OWW B;  2Q2U A;  2EXD A;  3UDX A;  3SGI A;  4POG A;  1I5F A;  3W1G A;  3K80 C;  1QVC A;  4A3I H;  3I4N H;  4LFA Q;  2DGY A;  1VQH A;  1KQS A;  2VY3 A;  5IP7 H;  2CCZ A;  2IT1 A;  3M85 A;  2YU9 H;  4YCU A;  1TWA H;  1MKH A;  4DV7 L;  2ZTE A;  1LTL A;  5C3E G;  2E2J H;  4IO9 A;  4LUV A;  3NBH B;  3RN2 A;  1SN8 A;  1UEB A;  1HH2 P;  2B63 H;  1YHB A;  4LFA L;  2UXD L;  4KLK A;  3FKI H;  3H0G G;  1D7Q A;  3CC7 A;  2JA5 G;  2A8V A;  1PHJ A;  4GKJ Q;  5M5W H;  3J7A 5;  2XGT A;  2ZTD A;  3EBE A;  1PH9 A;  3CCE A;  3H15 A;  1VQ4 A;  1I3Q H;  5GAE C;  1I6H H;  2EIF A;  1X56 A;  3NEM A;  3NEN A;  3BZC A;  3PSI A;  2R7Z H;  1I94 L;  4DR7 Q;  1J5E Q;  1B8A A;  1E24 A;  2C35 B;  4HIM A;  4A3E H;  5LMN Q;  1HNX L;  1VQB A;  2BA1 A;  1L2F A;  2XTI A;  2NVY H;  3PV0 A;  5BR8 Q;  1HNZ L;  4BY7 G;  1E1O A;  2BH8 A;  4LW1 A;  4A3C G;  1KRS A;  4ME3 A;  5GAH C;  2OWO A;  3VDY A;  4JI1 Q;  2Z0S A;  1WI5 A;  3RLN A;  3LGJ A;  3CAM A;  3GO5 A;  3I4M G;  5M5Y H;  2IX1 A;  2HQL A;  1HNX Q;  3HOX G;  3AFQ A;  3T1Y Q;  2B63 G;  3UDF A;  4IFD J;  4DV6 L;  1HNZ Q;  2Y0S E;  1Z47 A;  3HOZ G;  2QEX A;  4GLA C;  3CCV A;  1C7Y A;  1WCM G;  2UU9 Q;  1WJJ A;  1W3S A;  2D0P A;  2FXQ A;  4A93 H;  2BA0 A;  4RG1 A;  1YIT A;  4O0A A;  1VQK A;  2RF4 A;  5ELN A;  4XTC S;  4X64 L;  2R92 H;  2JE6 I;  4QGU A;  3RN5 A;  3L7Z C;  2UUC Q;  1WCM H;  3J81 c;  1XPU A;  3HOW H;  3KYH C;  4JI0 Q;  4OO1 G;  1YBY A;  3CCU A;  1FJG Q;  4B3S Q;  5FLM H;  3T1H L;  1SMX A;  1AH9 A;  4OX9 L;  2JA8 H;  5M5X H;  4GNX B;  4JI3 L;  3KJP A;  3J80 c;  2UXB L;  1YI2 A;  4YY3 Q;  4DNI A;  1VQM A;  4YWK A;  1TWG H;  3FKI G;  1L1O A;  4AH6 A;  4C2M H;  1HR0 L;  1A8V A;  4JI6 Q;  2UUC L;  4GKK Q;  1C9O A;  1O7I A;  2EQS A;  1YHQ A;  1X3F A;  3K0X A;  1G29 1;  4JI0 L;  4A3C H;  2PI2 A;  4GLX A;  1YJ9 A;  3T1H Q;  2OQK A;  1E1T A;  1VQD A;  2B3G A;  3KDF A;  5GAG C;  4A3K G;  1OTC A;  1N33 Q;  3S1Q H;  2F4V Q;  2KCT A;  1QZH A;  1VS0 A;  2UXB Q;  3K81 C;  1JE5 A;  4B3M L;  1V1Q A;  1IBK L;  4BY1 G;  4Y7N H;  4DV0 L;  1Q12 A;  4DR2 L;  3L2P A;  4DV1 Q;  5IE8 A;  2ZJQ A;  4NXN Q;  3DLL A;  3F2D A;  2QA4 A;  5GRO A;  4X66 Q;  4OXP A;  4X6A H;  5M3F G;  1L1O C;  3HOV G;  4P74 A;  3ERS X;  4PZ6 A;  3F1Z A;  2YTV A;  3IRB A;  1WYD A;  1K83 H;  4MZ9 A;  1U0L A;  1VQ8 A;  1G51 A;  2UUA Q;  5JJI A;  3I7F A;  3KJO A;  1EQR A;  4DV3 L;  2JJQ A;  2AMC B;  3JC6 6;  4PZ8 A;  1YHA A;  2NVT H;  2D0O A;  2K52 A;  3GTJ H;  4UY8 C;  1VQ5 A;  5C4X G;  1YJN A;  1Q1E A;  3MEF A;  4UP7 A;  4LF7 L;  1PH8 A;  5GQO A;  4GN4 B;  5IYD G;  2MNA A;  2HHH L;  4JBM A;  1VQN A;  5C44 G;  4QQB X;  4UP8 A;  3W5O A;  1OXT A;  1BBU A;  4JOI A;  1MIU A;  2E5L L;  1VCI A;  2PI2 E;  1HZA A;  5IYC G;  5IYC H;  1M1K C;  3MXN B;  1CSP A;  4R1J A;  3HOV H;  3A74 A;  1JJG A;  3OYY A;  3CF5 A;  2HHH Q;  5AJ3 L;  5C44 H;  1K8A C;  3CQZ H;  1YJW A;  2YYZ A;  4DK3 C;  1KIX A;  4NB3 A;  1EFW A;  1VQL A;  1T9H A;  1J5E L;  1K0R A;  5LMN L;  3GTL H;  5IT9 c;  4JV5 Q;  1LUZ A;  5BR8 L;  4KI0 A;  1WFQ A;  3ULP A;  2GN5 A;  4HJ5 A;  3F8T A;  2VNU D;  4OO1 I;  1VQ9 A;  1UE1 A;  2LXK A;  1PFS A;  1Q1B A;  3ICE A;  5DLQ E;  1KD1 C;  3PUW A;  1OXV A;  3KF6 B;  5C4J H;  4L5S A;  5FJ8 G;  1QZG A;  4LF8 Q;  1IBM L;  5JJL A;  2JA7 G;  2UXD Q;  4DV2 L;  3H0G H;  2AWO A;  4DV6 Q;  3RZD H;  4HIK A;  1TWF H;  3A5Z B;  4A3B G;  3FP9 A;  4DR3 L;  4IPH A;  4TVA B;  5FLM G;  2PQA A;  1UE5 A;  1TWH H;  1N34 L;  5C3E H;  4NXM L;  4LFC Q;  1JB7 A;  4DR6 L;  2OTL A;  4A3D G;  2QGQ A;  2WP8 J;  1D8L A;  4PG3 A;  1GVP A;  2E2I H;  3PO2 G;  1A0I A;  4DV2 Q;  3J80 i;  2R7F A;  1NY4 A;  1NMG A;  3J81 j;  1VQG A;  1VQA A;  2PMZ E;  1IXR A;  3ULJ A;  1MJC A;  4FDB A;  4DR3 Q;  3TEH B;  3D31 A;  1IBL Q;  3M4O H;  4DK6 C;  2RCN A;  2RHQ B;  4TQU S;  1JJ2 A;  4LFC L;  1HR0 W;  4LF9 L;  3S16 H;  3ER0 A;  1Y1W G;  1XJV A;  2K5H A;  4EQ5 A;  5JEA G;  4A3F G;  4JI5 Q;  2K5V A;  3HKS A;  1Q46 A;  1YEZ A;  2Z6K C;  3HOW G;  1A62 A;  2KHI A;  3B6Y A;  2K5N A;  1EIY B;  3D0F A;  1UE7 A;  1E3P A;  1CKN B;  4JCV E;  2ZJR A;  1TWC H;  1X9N A;  2Q2I A;  5IWA Q;  4A93 G;  1QVF A;  1AE3 A;  3CME A;  4A3G G;  2DUD A;  4A3E G;  4LF4 Q;  3RNU A;  1I50 H;  2UUB Q;  3AEV A;  2ID0 A;  4O2D A;  4A3B H;  2PNH A;  2KHJ A;  3RLO A;  4JYA L;  3M7N A;  1GM5 A;  1NBW A;  5IWA L;  5M3F H;  3I4M H;  2PQA B;  3G71 A;  3OTO Q;  4K0K L;  2OCE A;  5FJ8 H;  3U58 A;  1CUK A;  4JBW A;  2OQ0 A;  4R4Q A;  4HJA A;  4YHH Q;  1HNW Q;  3KLW A;  2D62 A;  4BBS G;  3TS2 A;  4JYA Q;  2WAQ G;  3J7Z C;  4JI7 L;  4IJL A;  2MQH A;  2Q2T A;  3I4O A;  5IYD H;  4A3K H;  4B3R L;  1EUJ A;  3CCS A;  1XMQ Q;  2RHS B;  1XNR Q;  3M9B A;  4R4O A;  1N32 L;  1N9W A;  1HZC A;  1J6Q A;  1SLJ A;  3K7A H;  3W1B A;  3F2B A;  1IBK Q;  1YVC A;  3M3Y H;  4JBK A;  4A3L G;  1PH3 A;  3CPF A;  4C3H H;  3AFP A;  4A75 A;  2JA5 H;  2WB1 E;  2ASB A;  3PUX A;  2JA6 G;  4DUZ Q;  4OWX B;  2A19 A;  3ZJY C;  1X55 A;  3DM3 A;  3S2H H;  1GO3 E;  2CWA A;  1OXU A;  3RZO H;  3CMA A;  4H02 A;  2KCM A;  3RR5 A;  3PF4 A;  2JA9 A;  2NZH A;  1BBW A;  4JI8 Q;  1PYS B;  1VQC A;  1B7Y B;  3S24 A;  4KHZ A;  3CCM A;  1Y1V H;  3KF6 A;  4DV3 Q;  3G6E A;  3CW2 C;  4OON A;  1SRO A;  3KOJ A;  3CCJ A;  1E7Z A;  1DGS A;  3G4S A;  1HZ9 A;  1QVG A;  4LF7 Q;  2L15 A;  3AYH B;  4POF A;  5C0X I;  1XMO L;  1OXX K;  3GTP H;  1YZ6 A;  3STB D;  3HOU H;  5C0X G;  4LFB Q;  1K8G A;  1I94 Q;  4DR7 L;  1IBM Q;  1X3E A;  2KEN A;  1FL0 A;  3JAM c;  5LMU L;  4PMW A;  3TRE A;  1N8R C;  4DR4 L;  3U4Z A;  1V43 A;  2WB1 G;  4APV A;  2IHE A;  3TS0 A;  3S1M H;  1YNX A;  1VQP A;  1XMO Q;  4LUZ A;  2JA8 G;  2JQO A;  4HIO A;  2ZTC A;  1CKN A;  2NN6 G;  1JJC B;  3TQY A;  4BA1 I;  5LMU Q;  2CKZ B;  3BU2 A;  2NVQ H;  4WJ4 A;  1BVS A;  1KAW A;  3T1Y L;  4BBS H;  2VS1 A;  3PO3 G;  4LUO A;  4MNO A;  4DR5 L;  3K8A A;  5H1S E;  4IOA A;  3PUZ A;  5IP9 G;  3E9I A;  3PIO A;  2Z6K A;  1PH5 A;  2ZJP A;  4LF9 Q;  4J15 A;  4LF8 L;  1H95 A;  3S17 H;  1K3R A;  2UXC Q;  4A3M G;  4LF6 Q;  3GTK H;  5JJK A;  4DPG A;  2BH2 A;  1UWV A;  1IYJ B;  4UP9 A;  1E22 A;  4YWL A;  4EX5 A;  2WFW A;  1A63 A;  4DR5 Q;  3UE0 A;  3CCQ A;  1VQF A;  4GN5 A;  4DR6 Q;  4JG2 A;  4JI1 L;  4L5Q A;  1FJG L;  2VZA A;  4ALP A;  4P71 A;  5IP9 H;  4B3T Q;  1ASY A;  1C0A A;  3CC4 A;  2AKW B;  4JI2 Q;  2VQF Q;  5ELO A;  1PA6 A;  3PO2 H;  3BJU A;  4JC0 A;  4NPS A;  3STB C;  4YY3 L;  4A3I G;  1HR0 Q;  3S1N H;  1KXL A;  1XPO A;  2HIX A;  4X62 L;  1Q86 C;  2WAQ E;  1S40 A;  2UU9 L;  1YIJ A;  2AWN A;  4B3T L;  5M3M H;  3UDG A;  1CSQ A;  1SR3 A;  1L1O B;  1X3G A;  1KC8 C;  4A3F H;  1PH1 A;  5C0X J;  4GOP B;  1N33 L;  1ASZ A;  4C3J H;  2VQF L;  4BXX G;  2HT1 A;  1OXS C;  2IX0 A;  4Y52 H;  4A3L H;  1AE2 A;  3HFZ B;  4XIG S;  4DV0 Q;  1VQI A;  4X62 Q;  4DV1 L;  2IHF A;  4LF5 L;  4A3J H;  1HNW L;  3PO3 H;  3GDE A;  1JT8 A;  1X6O A;  1U5K A;  1Q8K A;  1M90 C;  1X65 A;  2OTJ A;  1NE3 A;  2K4K A;  2NZO A;  1XNQ L;  2N78 A;  4JI6 L;  4HJ9 A;  4IFD I;  3HKZ G;  3K7U C;  4GKK L;  2YTY A;  1XPR A;  1N32 Q;  4A3J G;  2UUB L;  4IJH A;  2MFI A;  5JEA J;  5GAD C;  3M4Q A;  1HJP A;  1QUQ B;  1TXY A;  5E7N A;  4A4I A;  3H3V H;  2H5X A;  3HOY G;  4UPA A;  4A76 A;  4LNQ A;  3CCR A;  2VQE Q;  2CWP A;  5J3B A;  4JOI C;  4DUY L;  4AIM A;  4YWM A;  4A3M H;  1X54 A;  2MO1 A;  1FGU A;  1SE8 A;  3HOX H;  5IYB H;  3EN2 A;  4DR2 Q;  1P8L A;  1KRT A;  5IY0 A;  4DV5 L;  1VQ7 A;  2JA6 H;  2A1A A;  4P73 A;  2R7D A;  4MTN A;  3CCL A;  3JAM i;  4YCV A;  5IP7 G;  1JMC A;  2ES2 A;  1Z9F A;  2JK8 A;  4B3R Q;  3PF5 A;  1KHI A;  1XMQ L;  3S15 H;  5K36 G;  2B29 A;  4QJF A;  2JEB I;  3PGZ A;  4KHP Q;  4RMF A;  4QL5 A;  4A3D H;  4IFD G;  3GTM H;  4DV5 Q;  4DAM A;  1GKH A;  2LXJ A;  5IYB G;  2VL6 A;  5EAY A;  3FHW A;  2I0Q A;  2K50 A;  2F3I A;  1EQQ A;  4DR4 Q;  4JV5 L;  2I5H A;  3PCO B;  1V9P A;  1Q82 C;  1KL9 A;  3NEL A;  2K75 A;  1CKO A;  4GKJ L;  1N36 Q;  4HJ7 A;  4DKA C;  3KF8 B;  4GOP C;  3PUY A;  1IL2 A;  1Q81 C;  4LWC A;  2E5L Q;  3H3V I;  4BY7 H;  1G6P A;  4JBJ A;  1R9T H;  3OW2 A;  2NVX H;  5LMN W;  1N36 L;  1VQE A;  2E8G A;  2K14 A;  3TRZ A;  4GNX A;  1EWI A;  4R4I A;  4R4C A;  2AHO B;  1GD7 A;  1PH2 A;  4NXM Q;  4BBR G;  4QIW E;  3A0J A;  4WJ3 M;  3GTO H;  3HKZ E;  1Q7Y C;  4DV4 L;  2GVB A;  4P75 A;  3BZK A;  3UE1 A;  4GNX C;  3ULL A;  2JA7 H;  1SFO H;  1EYG A;  2R6G A;  2IY5 B;  1K9M C;  2LSS A;  3CP0 A;  2VUM H;  4AQY L;  2MO0 A;  1QUQ A;  4A3G H;  2YTX A;  4JI5 L;  4X65 L;  2VW9 A;  4DV4 Q;  1PV4 A;  2ATW A;  2R92 G;  4GOP A;  1SRU A;  4GLV B;  4L5R C;  4X64 Q;  1PYB A;  2KBN A;  3I4N G;  1NJI C;  1VQ6 A;  4QY7 A;  1S72 A;  3S1R H;  1N34 Q;  2HIV A;  1EIF A;  2N3S A;  2V1C C;  3WWV A;  4AQY Q;  4B3S L;  4JI4 Q;  2CFM A;  4PZ7 A;  3U4V A;  4R4T A;  2VUM G;  4IOC A;  3HOU G;  4X65 Q;  3CD6 A;  2UXC L;  1W2B A;  4JI3 Q; 
#chains in the Genus database with same CATH topology
 4IPD A;  3GTQ B;  2QW7 A;  4RA8 A;  2K05 A;  4ABN A;  1B44 D;  2EYF A;  4CDD C;  5COY A;  3AQQ A;  5C4X H;  2F4V L;  2K28 A;  2XVS A;  5FO8 B;  3X3M A;  3F2C A;  2F0W A;  4BA2 I;  1LYL A;  4GS3 A;  1PVO A;  1V1P B;  2GVA A;  4CDE C;  5HGQ A;  1GUW A;  2L1B A;  3S16 B;  1Y14 B;  5EPK A;  2ENB A;  1IKM A;  1PTO D;  3KLS X;  1WOC A;  1Q8I A;  1GUO A;  4FYD A;  2E75 C;  3BVM A;  4DUY Q;  4OIK A;  3VA7 A;  4RAU C;  1SYG A;  1W6J A;  3A5U A;  1AW7 A;  1PH4 A;  4DUZ L;  1FVI A;  5I2Y A;  5F2D A;  4DR1 L;  4G57 A;  2LFN A;  2HUG A;  1HZB A;  1IZ6 A;  1E2V A;  4XXE A;  3SK5 A;  4JI7 Q;  4AYB G;  1J9O A;  1B70 B;  4DAY B;  1Y1W H;  1CKM A;  3IL8 A;  4HJ8 A;  1P16 A;  4KV6 A;  3I91 A;  4OWW B;  3PO3 B;  5DNF A;  1F2Y A;  1QVC A;  3NPP A;  1HHV A;  1KQS A;  3MFY A;  4K6D A;  5C3X A;  2CCZ A;  1KAA A;  1U4L A;  4K8I A;  4DV7 L;  1ZEQ X;  1K28 A;  5CGK A;  1B2T A;  4DAY A;  1HH2 P;  1YHB A;  2UXD L;  2K1B A;  4IUQ A;  2A8V A;  1G6Z A;  5M5W H;  3J7A 5;  1PH9 A;  1CA5 A;  1I6V C;  3FEW X;  3R3O A;  1VQ4 A;  1HTL D;  3J80 L;  2EIF A;  3NEM A;  1GJX A;  3GP7 A;  1B8A A;  2C35 B;  1HNX L;  5LMN Q;  1VQB A;  4WJW A;  5BR8 Q;  5C6A A;  1HTP A;  4LAA A;  4JI1 Q;  2QKI C;  3I4M G;  5M5Y H;  2HQL A;  3AFQ A;  3T1Y Q;  4DV6 L;  5A2Q L;  1BDO A;  1STN A;  3HOZ G;  4IUN A;  1WCM G;  4XT1 B;  2UU9 Q;  3X3N A;  1W3S A;  4A93 H;  1YIT A;  1I50 B;  3OMG A;  1VQK A;  2RF4 A;  5ELN A;  2R92 H;  4X64 L;  4V19 0;  4QGU A;  5FK9 C;  3HOW H;  1TWC B;  1YBY A;  1KDC A;  5FLM H;  1SE2 A;  3T1H L;  4MHE A;  4JI3 L;  2EYO A;  2A6E D;  4QMG A;  1TR5 A;  3FVQ A;  1C9O A;  2I07 B;  1X3F A;  3K0X A;  1G29 1;  4A3C H;  1YJ9 A;  2OQK A;  1VS0 A;  4JK1 C;  3K81 C;  4X3U A;  3V96 A;  1IBK L;  4BY1 G;  1PMR A;  2FIN B;  4DR2 L;  5D3D A;  2ZJQ A;  3DLL A;  2JA6 B;  2B2V A;  1I4R A;  2KOL A;  3MA2 B;  3ERS X;  4DF7 A;  2NVY B;  3F1Z A;  3IRB A;  3KF8 A;  4MZ9 A;  1U0L A;  2SNM A;  2JJQ A;  2NVT H;  4FVM A;  1YJN A;  1Q1E A;  1I4X A;  2PZU A;  4UP7 A;  4LF7 L;  3S2D B;  1A3V A;  1VQN A;  4JBM A;  5C44 G;  3NQI A;  4JOI A;  4OEM B;  1AP0 A;  1VCI A;  2ZT9 C;  3TP7 A;  3GTL B;  2LS0 1;  5IYC G;  5IYC H;  4R1J A;  4X3S A;  4UHV A;  5KGU A;  1PDQ A;  3A74 A;  5I9P A;  5C44 H;  2QDB A;  3QOJ A;  1JOR A;  3OHX C;  1E0B A;  2RKS A;  4NB3 A;  1K0R A;  1BOS A;  2RDG A;  3I4L A;  3GTM B;  4JV5 Q;  1BR9 A;  4WFN 3;  1IL8 A;  3A7A B;  4KI0 A;  1WFQ A;  5BR8 L;  5IIF A;  2VNU D;  2I46 A;  1PFS A;  5DLQ E;  2L4N A;  4LF8 Q;  4H13 C;  5JJL A;  4H44 C;  1Q90 A;  2JA7 G;  3M3Y B;  2B2U C;  2WII B;  1I4P A;  4OEL B;  3H0G H;  3U9S A;  4DV2 L;  4DV6 Q;  3NE5 B;  3H91 A;  2DY8 A;  4IPH A;  1B3Q A;  1UE5 A;  1TWH H;  1LTT D;  4LFC Q;  1JB7 A;  3A8J E;  2KED A;  2QGQ A;  3K59 A;  2OTL A;  4A3D G;  2F3W A;  4PG3 A;  5BN5 A;  5CC4 A;  1ENA A;  4RGN A;  1C48 A;  1TWF B;  3J80 i;  1NY4 A;  2TSS A;  1EEF D;  2PMZ E;  3ULJ A;  1IXR A;  3M4O H;  1MJC A;  1DZ1 A;  3TEH B;  5KYL A;  2EJM A;  3K5L A;  4LF9 L;  3A56 A;  1SYF A;  1Y1W G;  2A69 D;  2PMZ B;  4JI5 Q;  4ULL A;  2K5V A;  3HKS A;  4DXG A;  1SE4 A;  1YEZ A;  2Z6K C;  3HOW G;  1A62 A;  1E3P A;  2IW3 A;  4XYQ A;  1QVF A;  1TWA B;  1F2M A;  1STH A;  1AE3 A;  2R61 A;  4A3G G;  4LF4 Q;  4PV1 C;  3RNU A;  4K2L A;  2UUB Q;  1DJR D;  1WTH A;  3AEV A;  4A3B H;  2HD3 A;  2PNH A;  3RLO A;  4FXD A;  3HS0 C;  5CV5 A;  3I4M H;  2PQA B;  1HQM C;  2QEJ C;  4YHH Q;  1HNW Q;  4HED A;  4C3H B;  3SHL A;  2MQH A;  1II3 A;  3I4O A;  4KMU C;  3CCS A;  4CDC C;  2RHS B;  1PTO C;  1IBK Q;  1TVX A;  2C5C A;  4OHJ A;  4TKO B;  2N55 A;  2JA6 G;  4Y7N B;  1GO3 E;  5E3F A;  3RR5 A;  3PF4 A;  4N8X 1;  2L55 A;  1GUG A;  1U9R A;  1B7Y B;  2B63 B;  4MTK A;  3G6E A;  1IW7 C;  1BCP C;  1QB5 D;  3G4S A;  1HZ9 A;  2KUM A;  4LF7 Q;  5C0X I;  5C44 B;  2NN6 H;  3OWE B;  2A6H D;  1I94 Q;  4DR7 L;  1X3E A;  1FL0 A;  3DEP A;  2KJX A;  3ND9 A;  2BDN A;  1SEB D;  2QIL A;  2WB1 G;  1VQP A;  3J7Y W;  1LTB D;  2JQO A;  1U4M A;  5LL6 S;  1CKN A;  1JJC B;  2K04 A;  1C4Q A;  5CMD A;  2CKZ B;  3BU2 A;  4WJ4 A;  1BVS A;  4ZYS A;  4BBS H;  3PO3 G;  3CRK C;  4MNO A;  4DR5 L;  1KNE A;  5H1S E;  4IOA A;  4A3G B;  5IP9 G;  4L63 B;  1PH5 A;  1JWM D;  4DN4 M;  4C3J G;  3S17 H;  5JJK A;  1R4P B;  1UWV A;  4UP9 A;  1T5E A;  1FD7 D;  1I3Q B;  4P71 A;  2NVX B;  4YIJ A;  1JR0 D;  2WIN B;  1BCP B;  3T4A C;  4NPS A;  3NTI A;  3STB C;  3S1N H;  1XPO A;  4X62 L;  2WAQ E;  1S40 A;  1STB A;  3SR1 A;  1WTP A;  1SBB B;  1N33 L;  3I73 A;  4HMJ A;  1ILQ A;  1OXS C;  4Y52 H;  4A3L H;  3HOW B;  1FNU A;  1QIL A;  4X62 Q;  1MD2 D;  3VA5 A;  3MHB A;  1DOL A;  3E3X A;  1U5K A;  4A93 B;  1RCV D;  3OPO A;  1JOO A;  1M90 C;  5DM6 3;  1NE3 A;  2K4K A;  1GUS A;  1XNQ L;  2OTJ A;  4HJ9 A;  5D65 A;  1N32 Q;  1HXY D;  1LV9 A;  4IUT A;  5JVH 3;  4IJH A;  2VB3 X;  1GHJ A;  1M8A A;  1TXY A;  3M4Q A;  5E7N A;  3HOY G;  3H3V H;  4UPA A;  4EGV A;  2VQE Q;  5A2Q E;  1MI2 A;  1SE8 A;  2L12 A;  5IYB H;  2K03 A;  4MTN A;  1JMC A;  4KKS A;  2ES2 A;  2JK8 A;  3PF5 A;  1KHI A;  1SYD A;  1XMQ L;  3S15 H;  4QJF A;  4A3D H;  4IFD G;  4DAM A;  1GKH A;  4QUC A;  2LXJ A;  4A3B B;  2DNE A;  2K50 A;  2F1M A;  3J80 E;  1B1Z A;  4JV5 L;  1TY2 A;  4GKJ L;  2K75 A;  1N36 Q;  5KND A;  4HJ7 A;  2XWB B;  3CKI B;  1IL2 A;  1SXT A;  2Z6B A;  3ONA B;  4PNY A;  5K5P A;  2E5L Q;  3H3V I;  4JBJ A;  2NVX H;  1N36 L;  3TRZ A;  3OW7 A;  4R4I A;  3K5O A;  4R4C A;  4NXM Q;  3VYT A;  3GV3 A;  1O80 A;  3A0J A;  3H94 A;  4R9W A;  2GVB A;  1G2T A;  4X3T A;  3UE1 A;  2JA7 H;  1SFO H;  3OOC A;  1KLU D;  2XSC A;  1K9M C;  2LSS A;  2VUM H;  2MO0 A;  1QUQ A;  4KKU A;  3MAQ A;  3U9O A;  4X65 L;  2ATW A;  4N9P A;  2J7Z A;  4GLV B;  4X64 Q;  1PYB A;  3E5S A;  3S1R H;  2V1C C;  1EIF A;  4AQY Q;  1JB3 A;  4DR6 Q;  4PZ7 A;  4CKC A;  4R4T A;  4A3J B;  1FNW A;  4BY7 B;  2UXC L;  1PH1 A;  4JI3 Q;  4LF6 L;  3L3O C;  3Q8D A;  2JEA I;  1BF4 A;  1JOK A;  1ESR A;  2VB2 X;  4LF5 Q;  2F0H A;  1EQT A;  4JI4 L;  3KFU A;  2I5M X;  2JA8 B;  2B2T C;  4JI2 L;  3OTO L;  4M1U B;  1LM0 A;  3MC0 B;  1UE6 A;  4NXN L;  3K58 A;  4LMQ D;  3GTQ H;  3OIP A;  3HRZ C;  3CXC A;  4L5T A;  3S2D H;  2EYP A;  4XQQ A;  2ZM6 Q;  4BXX H;  1BKB A;  1K8O A;  2R93 H;  4LF4 L;  2ICE C;  5CV9 A;  3GD7 A;  2UUA L;  1PH6 A;  2NVT B;  4BY1 H;  3U50 C;  3J81 i;  1RIP A;  2CH4 W;  1IYV A;  3MVV A;  1XTD A;  1NTG A;  3TME A;  3CPW A;  3M4P A;  4FF1 A;  1Z6H A;  3AMU A;  1XNQ Q;  3DHQ A;  2R7Z G;  1SFO B;  3D4W A;  4L8J A;  1HPC A;  1Y1V G;  4HR7 B;  1J8I A;  3GTG H;  3UDI A;  3RMH A;  2I5L X;  5FLX c;  2K5W A;  4P72 A;  5C3W A;  5AJ3 Q;  4IFD H;  4I65 A;  5EPL A;  3W1G A;  3K80 C;  1WTQ A;  3I4N H;  1F2Z A;  2VY3 A;  1EWC A;  5M3M B;  2IT1 A;  2YU9 H;  4YCU A;  2ZTE A;  1LTL A;  5C3E G;  2EY6 A;  2E2H B;  4LUV A;  3NBH B;  4DU9 A;  3RN2 A;  2IX3 A;  1SN8 A;  4LFA L;  4KLK A;  1D7Q A;  2JSO A;  2JA5 G;  3QWN A;  1AEX A;  2R92 B;  2XGT A;  2ZTD A;  3EBE A;  2RCF A;  5GAE C;  1I6H H;  3TP5 A;  2R7Z H;  1YNJ D;  2L11 A;  1EZ6 A;  1I94 L;  4DR7 Q;  1E24 A;  4HIM A;  4C1N K;  4A3E H;  2N88 A;  2XTI A;  1EY6 A;  1S5C D;  4LW1 A;  4A3C G;  1MGS A;  4ME3 A;  5IGF A;  5M5Y B;  2NUC A;  2Z0S A;  3GO5 A;  5G3L F;  3TN2 A;  2XRQ D;  4G7H C;  3UDF A;  4IFD J;  1BNZ A;  2X6G A;  1HNZ Q;  1TT2 A;  1Z47 A;  2Z4I A;  2QEX A;  3CCV A;  3V05 A;  5IGE A;  4F7X A;  2F0U A;  1PRT C;  2FXQ A;  2D0P A;  4LJZ C;  2BA0 A;  5E4X A;  3OIQ A;  4XTC S;  2NBF A;  3HOZ B;  4GZY C;  2CW0 C;  2FMC A;  3RN5 A;  1TKW B;  5COR A;  4ZUJ A;  1WCM H;  5T1I A;  1XPU A;  1NR4 A;  3CCU A;  1AH9 A;  1PXU A;  3VYR A;  2DJF C;  4RKL A;  1YNJ C;  5IOD A;  1YI2 A;  4DNI A;  4YWK A;  1WCM B;  4GKK Q;  3T53 B;  1YHQ A;  5NUC A;  3BZD B;  1Y1V B;  4GLX A;  3T1H Q;  1LT5 D;  1JE4 A;  2F4V Q;  3R2T A;  5D14 A;  3S15 B;  1EYD A;  3HEJ A;  1C0A A;  1PFB A;  3L2P A;  4A3M B;  5IE8 A;  2QA4 A;  1SJH D;  2M00 A;  5C5L A;  5M9O A;  3NBI A;  3HOV G;  2NZ1 D;  2XN9 C;  4P74 A;  3KBG A;  2YTV A;  1WYD A;  5JJI A;  4BY1 B;  3I7F A;  4DV3 L;  2AMC B;  5A35 A;  3JC6 6;  2R93 B;  2H1E A;  4PZ8 A;  1YHA A;  2C9O A;  1L0X B;  3BG3 A;  2TMP A;  5GQO A;  4GN4 B;  2HHH L;  1R4Q B;  4QQB X;  4RKB A;  1OXT A;  1W6K A;  3G6J B;  2EY2 A;  3NQT A;  5EBC A;  2E5L L;  2PI2 E;  1M1K C;  3MXN B;  2A68 C;  1JJG A;  2B2Y C;  3OYY A;  1EYC A;  4RGT A;  5M5X B;  2DJG C;  2K6A A;  3IFD A;  1JWS D;  4DK3 C;  1KIX A;  4A3I B;  3T51 B;  4U68 A;  1F9S A;  1VQL A;  3BVG A;  3EFX D;  5LMN L;  3GTL H;  1EWH A;  2Q8T A;  2M2L A;  1A3T A;  3HGB A;  1YNN D;  2KA7 A;  3R2I A;  1KNA A;  4HJ5 A;  3CRL C;  4KKT A;  1EU4 A;  5KNB A;  1VQ9 A;  1UE1 A;  2LXK A;  1Q1B A;  3ICE A;  5IGD A;  1SND A;  1OXV A;  1B50 A;  5FJ8 G;  4KN7 C;  1MSH A;  3TZU A;  2UXD Q;  1EU3 A;  1E2Z A;  4ZAI A;  4HIK A;  2M9V A;  3A5Z B;  4A3B G;  1MSG A;  3FP9 A;  3A8K E;  2PQA A;  5HUR A;  1N34 L;  2CHB D;  1I4G A;  2WP8 J;  2JA7 B;  1GVP A;  4TRD A;  3PO2 G;  1TS4 A;  4DV2 Q;  4KY7 A;  3KLS A;  1PZJ D;  1CTM A;  3MZ5 A;  4FDB A;  1WD0 A;  2F4I A;  2SDF A;  1JJ2 A;  3MXU A;  2K5H A;  4J8Q A;  1SE3 A;  4K6L A;  1LAC A;  4KY5 A;  1EYA A;  2QF7 A;  1NCV A;  1UE7 A;  3WOE A;  1RTO A;  3H3V C;  4QIW B;  1Q3L A;  1ET6 A;  2F0Q A;  3LWE A;  1X9N A;  2E2J B;  1BXT A;  4Q5V A;  3DWP A;  2B8G A;  2NTT A;  1V1O A;  1B9M A;  3HKZ B;  3IKJ A;  4JYA L;  3M7N A;  1NBW A;  4N8F A;  5IWA L;  5M3F H;  4HTH A;  2LMC B;  3E0J A;  2OCE A;  1CUK A;  3H6M A;  4JBW A;  3GTK B;  2PZT A;  1S4Z A;  4HJA A;  4BBS G;  3TS2 A;  4JYA Q;  4X3K A;  1RHP A;  3EA6 A;  1DD2 A;  4B3R L;  3MXN A;  2VUM B;  3M9B A;  3SEB A;  4R4O A;  1N9W A;  3K7A H;  3F2B A;  3W1B A;  3M3Y H;  1S5E D;  3FPP A;  1D5M C;  1GHK A;  4KY6 A;  4JBK A;  1ET9 A;  2PNR C;  4C3H H;  2ASB A;  1SAP A;  3TP6 A;  4H7B A;  5KYI A;  3ZJY C;  1EQV A;  2F0S A;  5EKI A;  2CWA A;  2Q8I B;  4H02 A;  3I4M B;  1JIC A;  4JI8 Q;  2K32 A;  1PYS B;  4DFA A;  1Y1V H;  3KF6 A;  4OON A;  3OWF A;  4HCE A;  1EY9 A;  1ENC A;  5C4X B;  5EKK A;  1RDP D;  3AYH B;  2F0N A;  1OXX K;  1HA5 A;  4I7Z C;  1PTO H;  5C0X G;  2D5D A;  2J0T D;  2RDH A;  1RD9 D;  1FGB D;  1X3Q A;  3TRE A;  1N8R C;  4DR4 L;  1V43 A;  1DXM A;  2IHE A;  1DOK A;  5JPM C;  1XMO Q;  4HIO A;  2KCC A;  4E6I A;  3EJI A;  3M4Y A;  4C56 C;  3TQY A;  5LMU Q;  3T1Y L;  1ZKO A;  2EDG A;  2G9H D;  5I6Y A;  4N9T A;  1TY0 A;  3K8A A;  2Z8L A;  3DM1 A;  3E9I A;  3J81 L;  3PIO A;  2ZJP A;  4FNF A;  1TWH B;  2KVM A;  5CBA E;  3F2U A;  3DWA A;  1I4H A;  4LF6 Q;  2BH2 A;  1E22 A;  3D6C A;  3I72 A;  1A63 A;  4GN5 A;  4JI1 L;  4L5Q A;  1FJG L;  3NWS A;  5IP9 H;  1KDB A;  3VR5 A;  1Z7T A;  4JI2 Q;  1PA6 A;  2L0C A;  4KN4 C;  3PO2 H;  2KEE A;  3BJU A;  4YY3 L;  4CJ0 B;  1KXL A;  3ITP A;  4IQZ A;  1Q86 C;  1TWG B;  4C2M B;  4XQJ A;  1YIJ A;  4NDX A;  1S5F D;  2AWN A;  3UDG A;  2F0M A;  4GOP B;  5IGC A;  1JC7 A;  4XIG S;  3L9A X;  4DV0 Q;  2FMM A;  2IHF A;  3EQL C;  4ZCK A;  4A3J H;  4LF5 L;  2F0D A;  3NUC A;  3GDE A;  1JT8 A;  3MWY W;  1NR2 A;  1Q8K A;  4Q0F A;  4LK1 C;  1X65 A;  3Q24 A;  2NZO A;  3J81 E;  2N78 A;  3S2H B;  3HKZ G;  2YTY A;  1XPR A;  2JA5 B;  2L9H A;  2H5X A;  1CHQ D;  4A76 A;  2F0J A;  1SNO A;  1GOZ A;  5J3B A;  2MPM A;  1F77 A;  4DUY L;  5DEH A;  4AIM A;  4A3M H;  3HOU H;  1PYW D;  1M4V A;  1SNP A;  4J1M A;  4DR2 Q;  4M8A A;  4RHS A;  2JA6 H;  5E4W C;  2A1A A;  4BBS B;  4ZLT F;  3BDL A;  4XDX A;  4YCV A;  3I90 A;  5D3I B;  4B3R Q;  5K36 G;  4KHP Q;  3VR3 A;  4RMF A;  4C3I B;  5IYB G;  1LT6 D;  2VL6 A;  5EAY A;  3FHW A;  1L0Y B;  4FF2 A;  2F3I A;  1EQQ A;  3PCO B;  2A5H A;  2RBM A;  1Q82 C;  1A2T A;  4G7Z C;  1Q81 C;  2F0F A;  5DM7 3;  1G6P A;  1IW7 D;  2E8G A;  3C3L A;  2LKV A;  1EWI A;  4GNX A;  5C5M A;  2WKC A;  1AN8 A;  1GD7 A;  3D6W A;  4BBR G;  3S1R B;  3HKZ E;  1D1I A;  4DV4 L;  3BZK A;  1IYU A;  4GNX C;  3ULL A;  3MFG A;  1EYG A;  1FNV A;  1UNS A;  2EJG C;  1PV4 A;  1SDF A;  1SRU A;  2MP1 A;  2KBN A;  2F0G A;  2PZW A;  1NJI C;  5M3F B;  1VQ6 A;  4QY7 A;  1S72 A;  2JXM B;  4IUR A;  1CM9 A;  2HIV A;  2N3S A;  1N34 Q;  3WWV A;  4B3S L;  4QCL A;  2RDF A;  3U4V A;  5JVG 3;  4WOR A;  1W2B A;  1Y69 U;  4P2C B;  2WAQ B;  2R93 G;  3R93 A;  2E2H H;  1TS2 A;  2Z1C A;  2Q2H A;  1VQO A;  5FOB B;  3M7G A;  3PIP A;  3Q22 A;  1B53 A;  4C3I H;  1DYQ A;  4U67 3;  4B3M Q;  4BWG B;  4OX9 Q;  3HOZ H;  4YHH L;  4B9W A;  2Y0S G;  4ID6 A;  4X66 L;  4R8I A;  1PH7 A;  1SNM A;  4JW0 A;  4NKL A;  5FLX E;  3E6Z X;  4BBR H;  3N52 A;  3JAM E;  2NYZ D;  1D2B A;  1BO0 A;  2FHT A;  3I2Z A;  2JN4 A;  3K7A B;  1QCB D;  2L5T A;  2ZM6 L;  2MUY A;  2YV5 A;  4JI8 L;  3I8Z A;  2AUJ D;  1EEI D;  3KLR A;  4PQX A;  4A3E B;  1L0W A;  1CZW A;  5M3M G;  2F0O A;  2F52 A;  3WDN A;  4DV7 Q;  2HDL A;  2EXD A;  3UDX A;  1TQO A;  1F9Q A;  3SGI A;  4HMI A;  1AZP A;  1I5F A;  4A3I H;  4OGQ C;  3ZYY X;  2DGY A;  1VQH A;  1C8C A;  5IP7 H;  3SK4 A;  5J39 A;  3M85 A;  1NSN S;  5CV7 A;  3TBI B;  2E2J H;  1UEB A;  3BDO A;  4L6T B;  5LL6 X;  1K8M A;  1SYC A;  2B63 H;  3H0G G;  2GA4 B;  1PHJ A;  1H9J A;  1PTO F;  3CCE A;  3H15 A;  2A74 C;  5I2X A;  5IT9 L;  3NEN A;  3BZC A;  5C0X H;  3RZO B;  2E76 C;  1J5E Q;  1DOM A;  4H0L C;  1B4O A;  2D9U A;  2NWG A;  4WRD A;  3P1H A;  3JAM L;  5C3E B;  3SVM A;  4EQP A;  3KUP A;  1D6E C;  5ISR A;  1WI5 A;  4HSV A;  1LTS D;  3CAM A;  1SJE D;  2EJF C;  3D3R A;  3VYS A;  1SYE A;  3H09 A;  2Y0S E;  1QNU A;  5ELF A;  3LX0 A;  3PMF A;  4GLA C;  1LT3 D;  3BYY B;  2Y0S B;  1MHW C;  2AQ3 B;  4RG1 A;  1B9N A;  1EIG A;  1XTC D;  1CA6 A;  1RTN A;  1G8Z D;  2JE6 I;  4F87 A;  1PTO B;  3L7Z C;  2UUC Q;  3J81 c;  2QDL A;  1FJG Q;  2K7V A;  2JA8 H;  5M5X H;  4GNX B;  2BE5 D;  5E1F A;  3KJP A;  3J80 c;  2UXB L;  3HZX A;  1CI3 M;  1VQM A;  1CQF A;  4AH6 A;  1L1O A;  3NK9 A;  4RGM A;  1U4R A;  1Y1W B;  5T1G A;  1VQD A;  5GAG C;  4IN3 A;  2CH4 A;  3M4O B;  2KCT A;  1RJT A;  2UXB Q;  1LTG D;  2WKD A;  4B3M L;  1V1Q A;  3CHB D;  4DV0 L;  4Y7N H;  4OX9 L;  1Q12 A;  1K83 B;  2XWJ B;  4NXN Q;  1X3P A;  3F2D A;  4X66 Q;  4OXP A;  3UI2 A;  1L1O C;  1HUM A;  4PZ6 A;  1EY5 A;  3H0G B;  2BOS A;  2UUA Q;  4S3S A;  3DEO A;  3VR6 A;  1EQR A;  4B08 A;  1EFI D;  1KLG D;  2BE5 C;  3T56 B;  1PH8 A;  2MNA A;  3BYT B;  4EQN A;  2ZXP A;  4UP8 A;  2K33 A;  3W5O A;  5AFW A;  3Q0A A;  1MIU A;  1VF7 A;  2WV6 D;  1WTR A;  5EPJ A;  1B3A A;  2AQ1 B;  1EY8 A;  3CF5 A;  2HHH Q;  5AJ3 L;  3CQZ H;  1NUC A;  2YYZ A;  1EFW A;  1T9H A;  2IWH A;  1WTO A;  5DAU A;  5IT9 c;  3W3A A;  2EYL A;  3A54 A;  4G4K A;  3F8T A;  4K8J A;  1IHZ A;  4RCO A;  2ZXO A;  3NHH A;  3NBH A;  1KD1 C;  3PUW A;  5C4J H;  4FF4 A;  3ERO A;  3GTJ B;  3S17 B;  2AWO A;  4UAI A;  1TWF H;  1VMP A;  3FMC A;  4DR3 L;  4TVA B;  5FLM G;  1H9K A;  4NXM L;  4BS9 A;  3J7A V;  1JOQ A;  1VDZ A;  2KCN A;  1K3B C;  3J81 j;  4DR3 Q;  1SNQ A;  1IBL Q;  2F0V A;  4TQU S;  5I9O A;  2R7Z B;  3ER0 A;  1XJV A;  2PPB C;  4EQ5 A;  5JEA G;  4A3F G;  2FFK B;  4CGY B;  1UAP A;  2F3V A;  1FR3 A;  3RUZ A;  4OIJ A;  1LTR D;  1KTK A;  5G3L D;  3B6Y A;  2K5N A;  2O5I C;  2B2W A;  4JCV E;  2ZJR A;  1TWC H;  2Q2I A;  5IWA Q;  4A93 G;  4C3I G;  3CME A;  2A68 D;  1I50 H;  3A7L A;  3S1N B;  1BCP D;  1EY0 A;  3A55 A;  3FRP B;  1GM5 A;  3DMU A;  4K0K L;  5FJ8 H;  3U58 A;  2B8F A;  3HOX B;  1D5Z C;  2D62 A;  1PFN A;  2WAQ G;  2SEB D;  4IJL A;  5IYD H;  2OEO A;  2A69 C;  1EUJ A;  2Z9H A;  3HP3 A;  2MHV A;  4R8N A;  5KIX A;  1XNR Q;  2B2T A;  1N32 L;  1HZC A;  1SLJ A;  4ME5 A;  1J6Q A;  1DCZ A;  2E2D C;  1YVC A;  4A3L G;  4A75 A;  3AFP A;  1STA A;  1BUV T;  4OWX B;  2A19 A;  1BBX C;  1X55 A;  3DM3 A;  2VXW A;  1OXU A;  4G7O C;  2JA9 A;  1BBW A;  4FXK C;  2OT2 A;  1VQC A;  3D4D A;  3S24 A;  4DV3 Q;  5IGG A;  4K2K A;  3CW2 C;  4ZKB B;  1A2U A;  1SRO A;  3DWQ A;  1DGS A;  1QVG A;  3I3C A;  3K57 A;  2L15 A;  1AFP A;  1XMO L;  3SDZ A;  1S5B D;  1K8G A;  4PMC A;  2F0I A;  4O1N A;  5KRU A;  5LMU L;  4PMW A;  4XQN A;  1ICW A;  4APV A;  2AQ2 B;  2CW0 D;  3S1M H;  1YNX A;  1GUT A;  2B2U A;  3SXH A;  3A8I E;  2ZTC A;  4AYB B;  4FP5 D;  2NN6 G;  4BA1 I;  5C4H A;  2NVQ H;  1KAW A;  1WTW A;  3AB9 A;  4LUO A;  2B39 A;  2E2I B;  4ZKC B;  3P7J A;  4LF9 Q;  2Z6K A;  4J15 A;  4LF8 L;  2EYH A;  1G91 A;  1H95 A;  1K3R A;  4A3M G;  3GTK H;  5I4D A;  1IKL A;  1IYJ B;  3QR8 A;  2WFW A;  4DR5 Q;  3UE0 A;  5FO7 B;  2VZA A;  3LWU A;  4ALP A;  4B3T Q;  2A6H C;  1ASY A;  2AKW B;  5JJZ A;  3QJY A;  2VQF Q;  5ELO A;  4A3I G;  4V0B A;  2HIX A;  3C46 A;  2K5Q A;  4DA2 A;  5M3M H;  1CSQ A;  1SR3 A;  1L1O B;  1X3G A;  1TII D;  2JYO A;  2ZXR A;  1KC8 C;  4BXX G;  4C3J H;  3LNN A;  5CBE E;  1ILP A;  4RCN A;  1AE2 A;  1VQI A;  4DV1 L;  2RSO A;  3C1E A;  1HNW L;  1QJO A;  3TSS A;  3PO3 H;  1XWE A;  4PMB A;  1ZYR D;  4GKK L;  4A3J G;  2UUB L;  4HSP A;  2XIW A;  2IPK D;  5GAD C;  4RGO S;  1HJP A;  2HQE A;  4A4I A;  1HQR D;  3T16 A;  2D2C C;  4LNQ A;  1UEA B;  2CWP A;  2RSN A;  3VR2 A;  3KBX A;  1XYI A;  1X54 A;  1FGU A;  2RA4 A;  1HA6 A;  1EY7 A;  1VQ7 A;  4P73 A;  2R7D A;  3QB3 A;  3NSW A;  3JAM i;  3P75 A;  2O2L D;  1Z9F A;  1H9S B;  3AU7 A;  4NMZ A;  2B29 A;  2G9D A;  1CQV A;  2JEB I;  5JPN C;  2A6E C;  2EY5 A;  1GUN A;  4UDU C;  4DV5 Q;  1TU2 B;  1X32 A;  1SMY D;  2I0Q A;  2F0T A;  4J6H A;  5HGT A;  1KL9 A;  3NEL A;  1CKO A;  1EL0 A;  3OSO A;  4DKA C;  3KF8 B;  5EJW A;  3PUY A;  3NP8 A;  4HCS A;  3GTP B;  2PCF B;  3FDT A;  4CKB A;  5LHY 1;  4BY7 H;  1HRJ A;  3OW2 A;  3C1F A;  3KK7 A;  4QUF A;  1PRT B;  3BS1 A;  2EPB A;  2F0P A;  5CYU A;  1Q7Y C;  5ELE A;  1F2L A;  2R6G A;  1NAP A;  2PW7 A;  4AQY L;  2WAC A;  4CBV A;  1CFM A;  3RZD B;  4ZUI A;  4A3G H;  1DM0 B;  1KDA A;  2YTX A;  1Y8P B;  4JI5 L;  4DV4 Q;  2NVQ B;  2R92 G;  4K14 A;  3I4N G;  2DN8 A;  1O7Y A;  1Y8O B;  4RHR A;  3GTO B;  2VUM G;  5M5W B;  5FKA C;  3CD6 A;  5EQ0 A;  3MXG A;  3EIV A;  4HID A;  4LFB L;  2HDM A;  3FKI B;  3PUV A;  3HOY H;  5FLX L;  3T13 A;  1IBL L;  3S14 H;  1S3O A;  1CK1 A;  5K36 H;  1VQJ A;  2HCI A;  2JP1 A;  2CQO A;  4F88 A;  4A3D B;  1F9R A;  2N8N A;  4AYB E;  4IPG A;  2N49 A;  3G48 A;  4MIU A;  5CR3 A;  1LAB A;  4KK7 A;  1EY4 A;  4GN3 B;  3DXJ C;  1NNX A;  1XNR L;  2K5D A;  3RLF A;  1EOV A;  5HY6 A;  2B2Y A;  3NXW A;  1MJE A;  3PIP 3;  1A15 A;  1PLF A;  2EYJ A;  1RL2 A;  1NMF A;  3CC2 A;  4IPC A;  4KHP L;  3E9H A;  4K0K Q;  3I56 A;  4OWT B;  1STY A;  3I55 A;  2QCP X;  4ZK9 B;  3EVQ A;  4QB4 A;  3QOL A;  3SK6 A;  4YCW A;  3KDF B;  3E0E A;  4DXF A;  3L0O A;  1K73 C;  3P20 A;  4DR1 Q;  4DAV A;  2VQE L;  2ALY B;  2NN6 I;  1LLR D;  3QG1 A;  2SOB A;  4Z9C B;  2Q2U A;  3PQI A;  4POG A;  3WOF A;  4LFA Q;  4FF3 A;  4B9X A;  1QG7 A;  1XX8 A;  1MBY A;  1TWA H;  1MKH A;  1PFM A;  2J4X A;  4ZQ3 A;  5TSS A;  3R8B A;  1LTI D;  4DGZ A;  1XXG A;  1HUN A;  4EVO A;  4IO9 A;  3I4N B;  2DNC A;  3FKI H;  3MXP A;  3CC7 A;  4GKJ Q;  4C3H G;  5I6W A;  1I3Q H;  1WVL A;  3G7L A;  1X56 A;  3PSI A;  3N6R A;  5J22 A;  5KNC A;  5ELB A;  2BA1 A;  1L2F A;  3PV0 A;  2NVY H;  4IAL A;  4BY7 G;  1HNZ L;  2H4O A;  3O13 A;  1E1O A;  1GXD C;  2BH8 A;  1KRS A;  5GAH C;  2OWO A;  3VDY A;  1TS3 A;  2XNA C;  1RF2 D;  3QO2 A;  3RLN A;  3LGJ A;  2IX1 A;  1HNX Q;  3HOX G;  2B63 G;  4RH6 A;  2EOT A;  1LO5 D;  5C4J B;  3K5M A;  1C7Y A;  1WJJ A;  2F0K A;  4DK0 A;  4O0A A;  4DK1 A;  2EE1 A;  5EBD A;  2CQA A;  1QNK A;  4OO1 G;  3TP8 A;  3CU7 A;  1QWY A;  3KYH C;  4JI0 Q;  4B3S Q;  1SMX A;  3K5N A;  2PYK A;  2RQX A;  3S9W A;  4YY3 Q;  4JI6 Q;  4LFB Q;  1TWG H;  3FKI G;  4C2M H;  1HR0 L;  1D5X C;  1A8V A;  2UUC L;  1O7I A;  2EQS A;  4JI0 L;  1KAB A;  2PI2 A;  4JVZ A;  5ELD A;  1OTC A;  1E1T A;  2B3G A;  3KDF A;  4A3K G;  3S1Q H;  1N33 Q;  1QZH A;  2PW5 A;  1JE5 A;  1ONL A;  2OF1 A;  4DV1 Q;  2EYM A;  1O78 A;  4OL7 A;  1T5X D;  5GRO A;  4X6A H;  1AZQ A;  5M3F G;  3NWT A;  5FO9 B;  5BN3 A;  1K83 H;  1VQ8 A;  2ICI A;  1G51 A;  1SNC A;  3KJO A;  1HCZ A;  2F03 A;  3MTS A;  2PO4 A;  2R3Z A;  4CHT B;  2D0O A;  2K52 A;  3RD4 A;  1JQY D;  3GTJ H;  4UY8 C;  4BBR B;  4EQO A;  1VQ5 A;  5C4X G;  3MEF A;  2FJ2 A;  5IGB A;  2EXZ A;  4I7A A;  5IYD G;  4JPB W;  1H9M A;  1BBU A;  4KTA A;  3TZD A;  1HZA A;  4FO2 A;  5KEE A;  3DUZ A;  1CSP A;  3HOV H;  2IJ0 A;  1K8A C;  1EOT A;  1V8Q A;  1YJW A;  4O42 A;  1J5E L;  5EKL A;  1LUZ A;  1H9S A;  3ULP A;  2GN5 A;  4RFB A;  4OO1 I;  1JCK B;  3KF6 B;  4L5S A;  4IUV A;  1QZG A;  1IBM L;  1LTA D;  3RZD H;  1PRT D;  2EY1 A;  5C3E H;  2MJ8 A;  4DR6 L;  1D8L A;  2E2I H;  1A0I A;  2R7F A;  4KD4 A;  1OO9 B;  4ODG A;  1NMG A;  4CKE A;  4XT3 B;  1VQG A;  1VQA A;  2PQE A;  1EIY B;  1EIH A;  3D31 A;  4HN7 A;  4DK6 C;  2RCN A;  2RHQ B;  1HR0 W;  4LFC L;  3S16 H;  1JWU D;  3W2D A;  1Q46 A;  3HG9 A;  2LY7 A;  2XRS D;  4IUU A;  2KHI A;  4OO1 H;  5L37 A;  3C2P A;  3D0F A;  3K6O A;  3I70 A;  1CKN B;  1YNN C;  1A6X A;  4K5W A;  1SMY C;  4KHV A;  1STG A;  2DUD A;  4A3E G;  2K01 A;  2NTS A;  3IAY A;  2ID0 A;  4O2D A;  2KHJ A;  1V1P A;  3FPU B;  3G71 A;  3ERQ A;  3OTO Q;  1WD1 A;  2OQ0 A;  4R4Q A;  5EGT A;  3D4R A;  4DNT B;  3KLW A;  1HFN A;  3K0Y A;  1PZI D;  4JI7 L;  3J7Z C;  5C4Z A;  2Q2T A;  4A3K H;  2CVR A;  1XMQ Q;  3J7A F;  4C1N I;  1E2W A;  3SK8 A;  3D8G A;  1PH3 A;  3CPF A;  2JA5 H;  2WB1 E;  3PUX A;  4CJ2 C;  4DUZ Q;  1ICF B;  3S2H H;  5BN4 A;  3RZO H;  3CMA A;  1H9R A;  2KCM A;  2WB1 B;  2NZH A;  1R9T B;  3CCM A;  4KHZ A;  4IUP A;  1CZG A;  1WTX A;  3KOJ A;  1SYB A;  3CCJ A;  5IT9 E;  1E7Z A;  3CQZ B;  2NB0 A;  3URY A;  4POF A;  3GTP H;  3QIA A;  1YZ6 A;  3STB D;  1SSO A;  4NW2 A;  1CHP D;  1IBM Q;  4K5X A;  1PRT F;  2KEN A;  2P5Z X;  3JAM c;  3U4Z A;  1I4Q A;  1U4P A;  3PO2 B;  3TS0 A;  1VF5 C;  3Q6S A;  5CV4 A;  2JA8 G;  4LUZ A;  1ML0 D;  2X6L A;  2O5J C;  1BCP F;  2A73 B;  2V4D A;  3BDC A;  1FYC A;  5CV8 A;  2BDO A;  3SE0 A;  2B2W C;  2VS1 A;  3OMC A;  4HAE A;  4NP5 A;  5IOC A;  3PUZ A;  1WTV A;  2O4X A;  4ZRZ A;  1F9P A;  1D1K A;  2E74 C;  2G5D A;  2UXC Q;  2RVL A;  4DPG A;  3GV6 A;  4YWL A;  3NTK A;  4EX5 A;  3CCQ A;  1VQF A;  4JG2 A;  4QF4 A;  3S1M B;  1QOH A;  4XYO A;  1ESF A;  2DY7 A;  2EVB A;  3CC4 A;  2KQ3 A;  3PIO 3;  1STE A;  4JC0 A;  1HR0 Q;  4KJO A;  4ILW A;  4CDF C;  1RKN A;  2UU9 L;  1PZK D;  5CV6 A;  4C3J B;  4B3T L;  3HOY B;  5JEA H;  4A3F H;  5C0X J;  3S14 B;  2AUK A;  3VYU A;  1ASZ A;  2VQF L;  2Q8R E;  2HT1 A;  2IX0 A;  4MN3 A;  3GQB A;  3HFZ B;  2OXP A;  2B2V C;  4TSS A;  1G2S A;  1O7Z A;  4DAP A;  1X6O A;  1BQQ T;  1ENF A;  3V2T A;  3IFT A;  4JI6 L;  4IFD I;  3K7U C;  1QE6 A;  3HOU B;  5JEA J;  2MFI A;  4K5V A;  2MGS A;  1QUQ B;  2BCO A;  5J1Z A;  2Z4H A;  4RWS C;  2HCC A;  3CCR A;  1CT1 D;  5JOB A;  4JOI C;  5ELC A;  4KD3 A;  4YWM A;  2MO1 A;  3HOX H;  3EN2 A;  1P8L A;  1KRT A;  5IY0 A;  4DV5 L;  3CCL A;  1LT4 D;  5IP7 G;  3S1Q B;  4FXG C;  3PGZ A;  1I6H B;  4QL5 A;  3GTM H;  1ZXT A;  3NTH A;  1VMC A;  4DNR B;  4DR4 Q;  1DON A;  2I5H A;  2KHS A;  1V9P A;  1A3U A;  4KJN A;  2KEC A;  4GOP C;  4A3F B;  2IL8 A;  3TDQ A;  4LWC A;  1EZ8 A;  3VR4 A;  3BVZ A;  2YU9 B;  3HOV B;  3ND8 A;  4F8M A;  2F0L A;  5JAV A;  1R9T H;  5LMN W;  1VQE A;  2K14 A;  2EZV A;  1Y8N B;  2AHO B;  3MEH A;  1S5D D;  1PH2 A;  4QIW E;  1UUP A;  3Q23 A;  4WJ3 M;  3GTO H;  3GTG B;  2X69 A;  4P75 A;  1ROD A;  1TS5 A;  4A3K B;  2IY5 B;  3CP0 A;  1K0S A;  2VW9 A;  4GOP A;  1ZYR C;  1O7L A;  1HFG A;  4L5R C;  2SNS A;  4CJ1 B;  2F0E A;  4JI4 Q;  2CFM A;  4IZ8 A;  4IOC A;  3HOU G;  4X65 Q; 
#chains in the Genus database with same CATH homology
 4IPD A;  4LF6 L;  3Q8D A;  2R93 G;  3EIV A;  4HID A;  2JEA I;  4LFB L;  2E2H H;  3PUV A;  3HOY H;  1IBL L;  3S14 H;  4LF5 Q;  1S3O A;  2Q2H A;  4JI4 L;  3KFU A;  1VQJ A;  2I5M X;  3AQQ A;  5C4X H;  1VQO A;  3PIP A;  2F4V L;  4JI2 L;  3OTO L;  2CQO A;  3F2C A;  4C3I H;  4BA2 I;  1LYL A;  4GS3 A;  4B3M Q;  4OX9 Q;  1PVO A;  2N8N A;  1LM0 A;  3HOZ H;  4AYB E;  4YHH L;  1UE6 A;  4NXN L;  2GVA A;  2Y0S G;  4IPG A;  5HGQ A;  4X66 L;  2N49 A;  1Y14 B;  3G48 A;  1PH7 A;  3GTQ H;  1WOC A;  3CXC A;  4L5T A;  3S2D H;  4GN3 B;  2ZM6 Q;  4BXX H;  1BKB A;  4DUY Q;  2R93 H;  1XNR L;  4LF4 L;  4BBR H;  3GD7 A;  3RLF A;  1EOV A;  1PH6 A;  2UUA L;  4BY1 H;  5HY6 A;  3U50 C;  1RIP A;  3J81 i;  3A5U A;  1MJE A;  1PH4 A;  3I2Z A;  4DUZ L;  1XTD A;  1NTG A;  1FVI A;  1RL2 A;  3CPW A;  1NMF A;  3CC2 A;  4DR1 L;  3M4P A;  2ZM6 L;  4IPC A;  1XNQ Q;  4KHP L;  3E9H A;  2R7Z G;  4K0K Q;  2YV5 A;  4JI8 L;  3I56 A;  4OWT B;  1HZB A;  1IZ6 A;  1Y1V G;  3I55 A;  4YCW A;  4JI7 Q;  3KDF B;  3E0E A;  3UDI A;  4AYB G;  3GTG H;  3L0O A;  1L0W A;  2I5L X;  1K73 C;  5FLX c;  5M3M G;  2VQE L;  4DR1 Q;  2ALY B;  1B70 B;  2F52 A;  2NN6 I;  4DAY B;  1Y1W H;  1CKM A;  4P72 A;  4DV7 Q;  5AJ3 Q;  1P16 A;  4HJ8 A;  4OWW B;  2Q2U A;  2EXD A;  3UDX A;  3SGI A;  4POG A;  1I5F A;  3W1G A;  3K80 C;  1QVC A;  4A3I H;  3I4N H;  4LFA Q;  2DGY A;  1VQH A;  1KQS A;  2VY3 A;  5IP7 H;  2CCZ A;  2IT1 A;  3M85 A;  2YU9 H;  4YCU A;  1TWA H;  1MKH A;  4DV7 L;  2ZTE A;  1LTL A;  5C3E G;  2E2J H;  4IO9 A;  4LUV A;  3NBH B;  3RN2 A;  1SN8 A;  1UEB A;  1HH2 P;  2B63 H;  1YHB A;  4LFA L;  2UXD L;  4KLK A;  3FKI H;  3H0G G;  1D7Q A;  3CC7 A;  2JA5 G;  2A8V A;  1PHJ A;  4GKJ Q;  5M5W H;  3J7A 5;  2XGT A;  2ZTD A;  3EBE A;  1PH9 A;  3CCE A;  3H15 A;  1VQ4 A;  1I3Q H;  5GAE C;  1I6H H;  2EIF A;  1X56 A;  3NEM A;  3NEN A;  3BZC A;  3PSI A;  2R7Z H;  1I94 L;  4DR7 Q;  1J5E Q;  1B8A A;  1E24 A;  2C35 B;  4HIM A;  4A3E H;  5LMN Q;  1HNX L;  1VQB A;  2BA1 A;  1L2F A;  2XTI A;  2NVY H;  3PV0 A;  5BR8 Q;  1HNZ L;  4BY7 G;  1E1O A;  2BH8 A;  4LW1 A;  4A3C G;  1KRS A;  4ME3 A;  5GAH C;  2OWO A;  3VDY A;  4JI1 Q;  2Z0S A;  1WI5 A;  3RLN A;  3LGJ A;  3CAM A;  3GO5 A;  3I4M G;  5M5Y H;  2IX1 A;  2HQL A;  1HNX Q;  3HOX G;  3AFQ A;  3T1Y Q;  2B63 G;  3UDF A;  4IFD J;  4DV6 L;  1HNZ Q;  2Y0S E;  1Z47 A;  3HOZ G;  2QEX A;  4GLA C;  3CCV A;  1C7Y A;  1WCM G;  2UU9 Q;  1WJJ A;  1W3S A;  2D0P A;  2FXQ A;  4A93 H;  2BA0 A;  4RG1 A;  1YIT A;  4O0A A;  1VQK A;  2RF4 A;  5ELN A;  4XTC S;  4X64 L;  2R92 H;  2JE6 I;  4QGU A;  3RN5 A;  3L7Z C;  2UUC Q;  1WCM H;  3J81 c;  1XPU A;  3HOW H;  3KYH C;  4JI0 Q;  4OO1 G;  1YBY A;  3CCU A;  1FJG Q;  4B3S Q;  5FLM H;  3T1H L;  1SMX A;  1AH9 A;  4OX9 L;  2JA8 H;  5M5X H;  4GNX B;  4JI3 L;  3KJP A;  3J80 c;  2UXB L;  1YI2 A;  4YY3 Q;  4DNI A;  1VQM A;  4YWK A;  1TWG H;  3FKI G;  1L1O A;  4AH6 A;  4C2M H;  1HR0 L;  1A8V A;  4JI6 Q;  2UUC L;  4GKK Q;  1C9O A;  1O7I A;  2EQS A;  1YHQ A;  1X3F A;  3K0X A;  1G29 1;  4JI0 L;  4A3C H;  2PI2 A;  4GLX A;  1YJ9 A;  3T1H Q;  2OQK A;  1E1T A;  1VQD A;  2B3G A;  3KDF A;  5GAG C;  4A3K G;  1OTC A;  1N33 Q;  3S1Q H;  2F4V Q;  2KCT A;  1QZH A;  1VS0 A;  2UXB Q;  3K81 C;  1JE5 A;  4B3M L;  1V1Q A;  1IBK L;  4BY1 G;  4Y7N H;  4DV0 L;  1Q12 A;  4DR2 L;  3L2P A;  4DV1 Q;  5IE8 A;  2ZJQ A;  4NXN Q;  3DLL A;  3F2D A;  2QA4 A;  5GRO A;  4X66 Q;  4OXP A;  4X6A H;  5M3F G;  1L1O C;  3HOV G;  4P74 A;  3ERS X;  4PZ6 A;  3F1Z A;  2YTV A;  3IRB A;  1WYD A;  1K83 H;  4MZ9 A;  1U0L A;  1VQ8 A;  1G51 A;  2UUA Q;  5JJI A;  3I7F A;  3KJO A;  1EQR A;  4DV3 L;  2JJQ A;  2AMC B;  3JC6 6;  4PZ8 A;  1YHA A;  2NVT H;  2D0O A;  2K52 A;  3GTJ H;  4UY8 C;  1VQ5 A;  5C4X G;  1YJN A;  1Q1E A;  3MEF A;  4UP7 A;  4LF7 L;  1PH8 A;  5GQO A;  4GN4 B;  5IYD G;  2MNA A;  2HHH L;  4JBM A;  1VQN A;  5C44 G;  4QQB X;  4UP8 A;  3W5O A;  1OXT A;  1BBU A;  4JOI A;  1MIU A;  2E5L L;  1VCI A;  2PI2 E;  1HZA A;  5IYC G;  5IYC H;  1M1K C;  3MXN B;  1CSP A;  4R1J A;  3HOV H;  3A74 A;  1JJG A;  3OYY A;  3CF5 A;  2HHH Q;  5AJ3 L;  5C44 H;  1K8A C;  3CQZ H;  1YJW A;  2YYZ A;  4DK3 C;  1KIX A;  4NB3 A;  1EFW A;  1VQL A;  1T9H A;  1J5E L;  1K0R A;  5LMN L;  3GTL H;  5IT9 c;  4JV5 Q;  1LUZ A;  5BR8 L;  4KI0 A;  1WFQ A;  3ULP A;  2GN5 A;  4HJ5 A;  3F8T A;  2VNU D;  4OO1 I;  1VQ9 A;  1UE1 A;  2LXK A;  1PFS A;  1Q1B A;  3ICE A;  5DLQ E;  1KD1 C;  3PUW A;  1OXV A;  3KF6 B;  5C4J H;  4L5S A;  5FJ8 G;  1QZG A;  4LF8 Q;  1IBM L;  5JJL A;  2JA7 G;  2UXD Q;  4DV2 L;  3H0G H;  2AWO A;  4DV6 Q;  3RZD H;  4HIK A;  1TWF H;  3A5Z B;  4A3B G;  3FP9 A;  4DR3 L;  4IPH A;  4TVA B;  5FLM G;  2PQA A;  1UE5 A;  1TWH H;  1N34 L;  5C3E H;  4NXM L;  4LFC Q;  1JB7 A;  4DR6 L;  2OTL A;  4A3D G;  2QGQ A;  2WP8 J;  1D8L A;  4PG3 A;  1GVP A;  2E2I H;  3PO2 G;  1A0I A;  4DV2 Q;  3J80 i;  2R7F A;  1NY4 A;  1NMG A;  3J81 j;  1VQG A;  1VQA A;  2PMZ E;  1IXR A;  3ULJ A;  1MJC A;  4FDB A;  4DR3 Q;  3TEH B;  3D31 A;  1IBL Q;  3M4O H;  4DK6 C;  2RCN A;  2RHQ B;  4TQU S;  1JJ2 A;  4LFC L;  1HR0 W;  4LF9 L;  3S16 H;  3ER0 A;  1Y1W G;  1XJV A;  2K5H A;  4EQ5 A;  5JEA G;  4A3F G;  4JI5 Q;  2K5V A;  3HKS A;  1Q46 A;  1YEZ A;  2Z6K C;  3HOW G;  1A62 A;  2KHI A;  3B6Y A;  2K5N A;  1EIY B;  3D0F A;  1UE7 A;  1E3P A;  1CKN B;  4JCV E;  2ZJR A;  1TWC H;  1X9N A;  2Q2I A;  5IWA Q;  4A93 G;  1QVF A;  1AE3 A;  3CME A;  4A3G G;  2DUD A;  4A3E G;  4LF4 Q;  3RNU A;  1I50 H;  2UUB Q;  3AEV A;  2ID0 A;  4O2D A;  4A3B H;  2PNH A;  2KHJ A;  3RLO A;  4JYA L;  3M7N A;  1GM5 A;  1NBW A;  5IWA L;  5M3F H;  3I4M H;  2PQA B;  3G71 A;  3OTO Q;  4K0K L;  2OCE A;  5FJ8 H;  3U58 A;  1CUK A;  4JBW A;  2OQ0 A;  4R4Q A;  4HJA A;  4YHH Q;  1HNW Q;  3KLW A;  2D62 A;  4BBS G;  3TS2 A;  4JYA Q;  2WAQ G;  3J7Z C;  4JI7 L;  4IJL A;  2MQH A;  2Q2T A;  3I4O A;  5IYD H;  4A3K H;  4B3R L;  1EUJ A;  3CCS A;  1XMQ Q;  2RHS B;  1XNR Q;  3M9B A;  4R4O A;  1N32 L;  1N9W A;  1HZC A;  1J6Q A;  1SLJ A;  3K7A H;  3W1B A;  3F2B A;  1IBK Q;  1YVC A;  3M3Y H;  4JBK A;  4A3L G;  1PH3 A;  3CPF A;  4C3H H;  3AFP A;  4A75 A;  2JA5 H;  2WB1 E;  2ASB A;  3PUX A;  2JA6 G;  4DUZ Q;  4OWX B;  2A19 A;  3ZJY C;  1X55 A;  3DM3 A;  3S2H H;  1GO3 E;  2CWA A;  1OXU A;  3RZO H;  3CMA A;  4H02 A;  2KCM A;  3RR5 A;  3PF4 A;  2JA9 A;  2NZH A;  1BBW A;  4JI8 Q;  1PYS B;  1VQC A;  1B7Y B;  3S24 A;  4KHZ A;  3CCM A;  1Y1V H;  3KF6 A;  4DV3 Q;  3G6E A;  3CW2 C;  4OON A;  1SRO A;  3KOJ A;  3CCJ A;  1E7Z A;  1DGS A;  3G4S A;  1HZ9 A;  1QVG A;  4LF7 Q;  2L15 A;  3AYH B;  4POF A;  5C0X I;  1XMO L;  1OXX K;  3GTP H;  1YZ6 A;  3STB D;  3HOU H;  5C0X G;  4LFB Q;  1K8G A;  1I94 Q;  4DR7 L;  1IBM Q;  1X3E A;  2KEN A;  1FL0 A;  3JAM c;  5LMU L;  4PMW A;  3TRE A;  1N8R C;  4DR4 L;  3U4Z A;  1V43 A;  2WB1 G;  4APV A;  2IHE A;  3TS0 A;  3S1M H;  1YNX A;  1VQP A;  1XMO Q;  4LUZ A;  2JA8 G;  2JQO A;  4HIO A;  2ZTC A;  1CKN A;  2NN6 G;  1JJC B;  3TQY A;  4BA1 I;  5LMU Q;  2CKZ B;  3BU2 A;  2NVQ H;  4WJ4 A;  1BVS A;  1KAW A;  3T1Y L;  4BBS H;  2VS1 A;  3PO3 G;  4LUO A;  4MNO A;  4DR5 L;  3K8A A;  5H1S E;  4IOA A;  3PUZ A;  5IP9 G;  3E9I A;  3PIO A;  2Z6K A;  1PH5 A;  2ZJP A;  4LF9 Q;  4J15 A;  4LF8 L;  1H95 A;  3S17 H;  1K3R A;  2UXC Q;  4A3M G;  4LF6 Q;  3GTK H;  5JJK A;  4DPG A;  2BH2 A;  1UWV A;  1IYJ B;  4UP9 A;  1E22 A;  4YWL A;  4EX5 A;  2WFW A;  1A63 A;  4DR5 Q;  3UE0 A;  3CCQ A;  1VQF A;  4GN5 A;  4DR6 Q;  4JG2 A;  4JI1 L;  4L5Q A;  1FJG L;  2VZA A;  4ALP A;  4P71 A;  5IP9 H;  4B3T Q;  1ASY A;  1C0A A;  3CC4 A;  2AKW B;  4JI2 Q;  2VQF Q;  5ELO A;  1PA6 A;  3PO2 H;  3BJU A;  4JC0 A;  4NPS A;  3STB C;  4YY3 L;  4A3I G;  1HR0 Q;  3S1N H;  1KXL A;  1XPO A;  2HIX A;  4X62 L;  1Q86 C;  2WAQ E;  1S40 A;  2UU9 L;  1YIJ A;  2AWN A;  4B3T L;  5M3M H;  3UDG A;  1CSQ A;  1SR3 A;  1L1O B;  1X3G A;  1KC8 C;  4A3F H;  1PH1 A;  5C0X J;  4GOP B;  1N33 L;  1ASZ A;  4C3J H;  2VQF L;  4BXX G;  2HT1 A;  1OXS C;  2IX0 A;  4Y52 H;  4A3L H;  1AE2 A;  3HFZ B;  4XIG S;  4DV0 Q;  1VQI A;  4X62 Q;  4DV1 L;  2IHF A;  4LF5 L;  4A3J H;  1HNW L;  3PO3 H;  3GDE A;  1JT8 A;  1X6O A;  1U5K A;  1Q8K A;  1M90 C;  1X65 A;  2OTJ A;  1NE3 A;  2K4K A;  2NZO A;  1XNQ L;  2N78 A;  4JI6 L;  4HJ9 A;  4IFD I;  3HKZ G;  3K7U C;  4GKK L;  2YTY A;  1XPR A;  1N32 Q;  4A3J G;  2UUB L;  4IJH A;  2MFI A;  5JEA J;  5GAD C;  3M4Q A;  1HJP A;  1QUQ B;  1TXY A;  5E7N A;  4A4I A;  3H3V H;  2H5X A;  3HOY G;  4UPA A;  4A76 A;  4LNQ A;  3CCR A;  2VQE Q;  2CWP A;  5J3B A;  4JOI C;  4DUY L;  4AIM A;  4YWM A;  4A3M H;  1X54 A;  2MO1 A;  1FGU A;  1SE8 A;  3HOX H;  5IYB H;  3EN2 A;  4DR2 Q;  1P8L A;  1KRT A;  5IY0 A;  4DV5 L;  1VQ7 A;  2JA6 H;  2A1A A;  4P73 A;  2R7D A;  4MTN A;  3CCL A;  3JAM i;  4YCV A;  5IP7 G;  1JMC A;  2ES2 A;  1Z9F A;  2JK8 A;  4B3R Q;  3PF5 A;  1KHI A;  1XMQ L;  3S15 H;  5K36 G;  2B29 A;  4QJF A;  2JEB I;  3PGZ A;  4KHP Q;  4RMF A;  4QL5 A;  4A3D H;  4IFD G;  3GTM H;  4DV5 Q;  4DAM A;  1GKH A;  2LXJ A;  5IYB G;  2VL6 A;  5EAY A;  3FHW A;  2I0Q A;  2K50 A;  2F3I A;  1EQQ A;  4DR4 Q;  4JV5 L;  2I5H A;  3PCO B;  1V9P A;  1Q82 C;  1KL9 A;  3NEL A;  2K75 A;  1CKO A;  4GKJ L;  1N36 Q;  4HJ7 A;  4DKA C;  3KF8 B;  4GOP C;  3PUY A;  1IL2 A;  1Q81 C;  4LWC A;  2E5L Q;  3H3V I;  4BY7 H;  1G6P A;  4JBJ A;  1R9T H;  3OW2 A;  2NVX H;  5LMN W;  1N36 L;  1VQE A;  2E8G A;  2K14 A;  3TRZ A;  4GNX A;  1EWI A;  4R4I A;  4R4C A;  2AHO B;  1GD7 A;  1PH2 A;  4NXM Q;  4BBR G;  4QIW E;  3A0J A;  4WJ3 M;  3GTO H;  3HKZ E;  1Q7Y C;  4DV4 L;  2GVB A;  4P75 A;  3BZK A;  3UE1 A;  4GNX C;  3ULL A;  2JA7 H;  1SFO H;  1EYG A;  2R6G A;  2IY5 B;  1K9M C;  2LSS A;  3CP0 A;  2VUM H;  4AQY L;  2MO0 A;  1QUQ A;  4A3G H;  2YTX A;  4JI5 L;  4X65 L;  2VW9 A;  4DV4 Q;  1PV4 A;  2ATW A;  2R92 G;  4GOP A;  1SRU A;  4GLV B;  4L5R C;  4X64 Q;  1PYB A;  2KBN A;  3I4N G;  1NJI C;  1VQ6 A;  4QY7 A;  1S72 A;  3S1R H;  1N34 Q;  2HIV A;  1EIF A;  2N3S A;  2V1C C;  3WWV A;  4AQY Q;  4B3S L;  4JI4 Q;  2CFM A;  4PZ7 A;  3U4V A;  4R4T A;  2VUM G;  4IOC A;  3HOU G;  4X65 Q;  3CD6 A;  2UXC L;  1W2B A;  4JI3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...