2SOBA

Sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRVLAYIYADGKMVNEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title NMR structure of a stable "OB-fold" sub-domain isolated from staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 8
structure length 103
sequence length 103
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sobA00
5C3XA 3QOJA 4PNYA 2PZWA 3SHLA 4B9WA 4EQOA 5IGGA 2F0IA 1JORA 4J1MA 5C5LA 2ENBA 2EYOA 2M00A 2PZTA 3TP5A 5IODA 2EYMA 3DHQA 1F2MA 4N9PA 1JOQA 2LKVA 4LAAA 3ITPA 1KDBA 2KQ3A 3MXPA 5I6YA 2F0VA 2EY6A 4B9XA 1EZ6A 2PYKA 1TR5A 3EJIA 1EYAA 1SYBA 2O4XA 4KJNA 4KTAA 1II3A 2F0NA 1JOKA 1STGA 4E6IA 2F0HA 4K5VA 5C4ZA 3SK5A 3MVVA 1EY4A 2F0DA 3VA5A 2F0WA 3OMGA 4KY7A 2F0EA 1U9RA 3D8GA 5CR3A 4YIJA 1SYGA 3NXWA 3P1HA 4NKLA 3ERQA 1A2TA 5JOBA 4OL7A 3SK4A 3MZ5A 4IZ8A 5IOCA 2PW5A 1EYDA 4MIUA 4QMGA 1EY7A 2KHSA 1STBA 1SNPA 2F0JA 2RBMA 3TP7A 2F3VA 4ODGA 4S3SA 4QB4A 1A3VA 3S9WA 3NK9A 1EYCA 4ME5A 3T13A 4DF7A 1STHA 1SNDA 4K5WA 5C6AA 1F2YA 3TP6A 4EQPA 1SYCA 4TRDA 5IGFA 1SYDA 5KIXA 2HQEA 2EYHA 1KDAA 4QF4A 3SXHA 5CV8A 1NSNS 4NDXA 4K14A 3LX0A 1A3TA 5I9OA 3OMCA 4K6DA 4H7BA 3R3OA 4NMZA 3V2TA 5IIFA 1SNOA 3P75A 5J39A 4HMJA 5HURA 1ENAA 2PW7A 4I65A 5KRUA 3HEJA 2EY2A 4HTHA 5K5PA 5CC4A 1RKNA 2PZUA 4K5XA 4RKLA 5CV9A 5EGTA 3T16A 4N9TA 3EROA 4IALA 1EY6A 5DAUA 3MHBA 3H6MA 1EY9A 5ISRA 2F0SA 2EYPA 3SK6A 5KYIA 3BDLA 3HZXA 2OF1A 4KJOA 1AEXA 3SK8A 2EYFA 5I6WA 2F0GA 4EQNA 2EXZA 1JOOA 4KY6A 4ZUIA 1SYFA 2OXPA 5C3WA 5CV5A 4EVOA 2F0MA 2WACA 4DFAA 2RDFA 4KHVA 4F7XA 1STYA 2NUCA 2SNSA 1TQOA 5CV7A 5E1FA 5M9OA 2EY5A 5EKLA 3OWFA 2F0PA 2F0OA 3OSOA 5C5MA 1EY5A 4K2LA 1EY0A 3QB3A 4RKBA 5IGCA 2SOBA 1A2UA 4NP5A 2SNMA 4WRDA 3D4DA 2PQEA 5IGDA 2F3WA 1EY8A 4WORA 3NUCA 5CV6A 5C4HA 3BDCA 2EYLA 1NUCA 2RKSA 4KY5A 3TP8A 4F8MA 5I9PA 5JAVA 5KGUA 5EKKA 4ZQ3A 3C1EA 4DU9A 1SYEA 1A3UA 1EZ8A 3EVQA 4ZUJA 3PMFA 2EY1A 5CGKA 2F0QA 5IGBA 5CV4A 4K8IA 4G57A 2F0LA 1SNQA 2EYJA 5NUCA 3NQTA 5HGTA 5E3FA 5DEHA 2F0TA 4K2KA 1TT2A 1STNA 3SR1A 5IGEA 1KAAA 2QDBA 3DMUA 1SNMA 4KD3A 4KV6A 3D4WA 5KEEA 4ID6A 4PMCA 5KYLA 5J1ZA 3D6CA 5J22A 1EQVA 1F2ZA 1KABA 3TMEA 4R8NA 2F0KA 4DGZA 4J6HA 4IUNA 3C1FA 3MEHA 1KDCA 4PMBA 3QOLA 4HMIA 3RUZA 1STAA 3E5SA 3NP8A 3NHHA 3U9OA 5F2DA 2F0UA 4KD4A 2OEOA 1IHZA 4K8JA 1ENCA 2F0FA 1SNCA
chains in the Genus database with same CATH superfamily
4OO1H 2VL6A 4GKJL 3I2ZA 2Z6KC 2UUBQ 3GTLB 1J5EQ 2R93G 1LACA 2Z0SA 1T5EA 5M3MH 2EE1A 4X62Q 5LMNQ 2ES2A 4IOCA 2UU9Q 2B2WC 2EQSA 2PMZB 5EQ0A 3VA5A 1RF2D 2I5HA 1SYGA 5EPKA 3SK4A 5IT9E 3GTKH 2N8NA 3OW2A 2BE5C 1CT1D 1GUOA 4QIWE 3H0GG 1V43A 3F1ZA 3HOVB 2EOTA 4LFAQ 1F2YA 1D1KA 1ZYRD 3G48A 4JI8L 1I94L 3VYTA 1RL2A 2TMPA 1O7IA 1HPCA 3FEWX 1IZ6A 1GUSA 1OXTA 3I72A 4A3BB 1BBWA 1RTNA 5C44G 1VQ7A 1LT4D 1HNXQ 5IWAL 4DV7Q 1OO9B 4CKCA 3J81j 1ENAA 2PW7A 5EPLA 5ELOA 3CCVA 4DV1L 4KMUC 4WJ3M 1LTLA 4OHJA 3EROA 3I90A 2K28A 1HH2P 2PI2E 4CKEA 1XNQQ 1N34Q 3BDLA 3HRZC 3GTJH 1X32A 4EGVA 3J7A5 1TXYA 4BWGB 4U68A 3S14H 1C0AA 1HHVA 1CUKA 1SEBD 2F4VL 3BG3A 3U4ZA 3T1YL 3SEBA 2MGSA 3S16H 1HNWQ 4XTCS 1VQ6A 5DM63 5M5WH 3CXCA 2F3WA 1TWHH 1KTKA 4P2CB 5JJLA 2RKSA 4MNOA 3JAMi 1MBYA 3HOWG 4ZQ3A 3STBC 3S2DH 1EZ8A 2ICEC 5CGKA 3FP9A 1D2BA 5IYCH 1WTRA 2HIVA 3ND8A 1Q3LA 2LFNA 4BY7H 2B2TA 4KV6A 5J22A 1VQ9A 2E2IH 4GNXB 4HIOA 3RUZA 1DGSA 1E1TA 1FGUA 3MEHA 3HOUG 4L5QA 1EIYB 1MSHA 3GD7A 3NHHA 3TBIB 4LUOA 3V96A 2DNCA 3A8KE 5I2YA 5C3XA 3P7JA 3GTOH 1GO3E 3TS2A 3KF8B 1E1OA 1O7YA 2ALYB 2K5QA 3HG9A 4B3ML 1JOQA 4N9PA 3GTKB 3HOYB 2XRSD 3MXPA 1H9RA 4C3IG 4BY1H 3IRBA 2DY8A 4UP7A 1U4RA 3CAMA 2VS1A 2BDNA 3BZDB 2OT2A 4KY7A 4YIJA 2YTVA 3A74A 1FJGL 2G9HD 1A2TA 3I55A 4MN3A 1PH5A 1NE3A 2F52A 5E7NA 4JI7Q 4NPSA 1M1KC 2A19A 4RAUC 4Y52H 1XPRA 3GP7A 5LMNW 2UXCQ 1STHA 4L63B 2ZXPA 5EBDA 4PV1C 3A5UA 2K5VA 5IT9L 3CC2A 3T4AC 2SDFA 1JCKB 1H9JA 3FKIB 2N49A 3AU7A 3DM1A 3J7AV 4FP5D 3K58A 5AFWA 4A3KH 3GTJB 4A3FG 4HMJA 4O42A 2JA5H 3G71A 5K5PA 1LT5D 1GKHA 1AZPA 4PG3A 1V9PA 1YHAA 4J15A 4FF1A 1YHQA 3L3OC 1BCPB 3J81E 4R4QA 3HOVG 2AWOA 1SYFA 2VUMH 4CDDC 1TWAH 1SRUA 5IP7H 2LXKA 3MXNA 1QNKA 1EY5A 3NELA 3BYTB 4PZ6A 4NP5A 1GUNA 1F77A 1E24A 1PA6A 2BCOA 3QO2A 4BY7B 2R92G 1XNRL 5CBAE 4HN7A 2MJ8A 3TSSA 4QL5A 3TDQA 1SE2A 2EY1A 2K6AA 3I4MH 1I3QH 4A3CG 2C35B 2BOSA 4DR2Q 3D31A 4DAYA 1RTOA 5IYDG 4LJZC 2B2UC 3B6YA 3GQBA 2QILA 1IBLL 5IYBG 3DWPA 4J6HA 2VQFQ 2UUAL 3QOLA 3Q22A 5F2DA 5LL6X 1K28A 4Z9CB 4K8JA 4OEMB 2ZJRA 4A3GG 3VYRA 1SNCA 4IFDJ 3LWEA 3Q8DA 5GQOA 4IUPA 3A5ZB 3EA6A 3KBGA 4F87A 2EYOA 1A62A 2PZTA 3ULJA 1VS0A 3NTHA 4LAAA 1J8IA 4TKOB 1EZ6A 1TR5A 1EYGA 1II3A 1LTTD 1WYDA 2F0HA 3PIOA 1IBMQ 2R7ZB 4DNRB 1B3AA 2F0EA 4OO1G 1N8RC 2EJFC 4G4KA 4MIUA 5G3LD 3UDIA 4ZKBB 2E2HH 4LF7Q 5FLXE 4DV4Q 4GNXC 4OELB 3TP7A 1EQQA 5TSSA 2JN4A 4DUYL 5M3MG 5HY6A 1OXXK 4DA2A 5CMDA 4A3KB 1CI3M 2K05A 2HQEA 2AKWB 1EU4A 1I4GA 2JA5B 2B29A 2MP1A 1ML0D 1Z9FA 2B39A 2A73B 1DD2A 2ZM6Q 4NMZA 3GTQB 2VUMB 3SGIA 4GKJQ 3RZOH 3PO3B 4N9TA 3PV0A 2I07B 1EY6A 4B3TQ 1PHJA 1EY9A 2IX3A 5KYIA 1Y1WH 1KLUD 2CFMA 4BA1I 4TVAB 1FYCA 4BBRB 4EQNA 4FXDA 3ER0A 2XGTA 1T9HA 2IY5B 3OTOL 1V1OA 4DFAA 2MUYA 1ILPA 4DUZL 1PH9A 1SMYD 2JE6I 2JEBI 4G7OC 1U0LA 3J81L 3DEOA 4CDEC 1IKMA 1K8AC 4F88A 1AZQA 3RN2A 2K5DA 3U58A 1IW7D 2ATWA 4JI3L 2CQAA 4LF5L 1QZGA 3ULPA 1S5ED 3DLLA 4JI8Q 1I94Q 1Y8NB 1EIFA 4KKUA 3PIO3 4LF6L 4RWSC 5NUCA 3NQTA 2UUBL 1NMGA 4JC0A 4AQYL 1UE7A 1BCPC 4OWXB 2K5WA 5IWAQ 2QGQA 1GVPA 1KDCA 1CSPA 3NP8A 3J7ZC 4DV1Q 2B8FA 4DV6Q 5IYCG 5C5LA 4BY7G 4X66L 2A68D 3DHQA 1UUPA 3MA2B 1Y8OB 1GHJA 3W5OA 2C9OA 4GOPA 3AMUA 1NCVA 3JAMc 5ELNA 2YTXA 2F4VQ 5T1IA 1BDOA 3T1YQ 1O80A 4E6IA 2CW0D 1WTWA 1D1IA 2F0DA 2DGYA 2Z4IA 3NXWA 1XYIA 1D8LA 1YZ6A 3CMEA 4MTKA 3DEPA 4GN5A 2GA4B 4HCEA 1MIUA 1GOZA 1GXDC 4A3IH 2NBFA 4BY1G 3KOJA 2MPMA 1AW7A 1HTPA 1VQKA 4FF2A 2OCEA 3I8ZA 2O5IC 1UE6A 3W1GA 5FLXL 2WAQE 1TS4A 4FYDA 2NZ1D 4QF4A 2F4IA 2N3SA 1JB3A 4X6AH 4MTNA 4CJ1B 1A8VA 3FMCA 4C3HH 1WFQA 3CU7A 4H13C 2ZXRA 3W3AA 4OIJA 2NWGA 4K6DA 3GTGB 5FLMH 3H09A 4HIMA 1YNJC 4C2MH 3HEJA 5CORA 1UE1A 4RKLA 3PQIA 2J4XA 4DR3L 3K5OA 4B3MQ 1PFSA 2EYPA 3LGJA 3SK6A 1YBYA 3IFDA 3H3VC 2WIIB 3M7NA 2EYFA 4DR5L 4DR7L 2FINB 1JOOA 4A3KG 3K0YA 2RDFA 2LS01 3IFTA 3MXGA 5CV7A 3SE0A 3CF5A 1FJGQ 2RCFA 1R9TH 2R3ZA 4X3UA 1WVLA 4KK7A 1GHKA 5DLQE 1C7YA 1C8CA 3BDCA 2EYLA 2KVMA 4KHZA 4YWKA 1AH9A 2VUMG 1J6QA 2FHTA 1SYEA 3PF4A 2NVTH 5IGBA 5IP7G 1Q12A 4P75A 3VR4A 2D62A 5E3FA 5DEHA 1SLJA 4A93H 4XXEA 3HS0C 1PFNA 3NBIA 2V4DA 1SJHD 5J1ZA 5T1GA 3ICEA 4L5SA 2XIWA 2D0PA 1YJWA 1JJCB 2Z9HA 3OW7A 3I4MG 2OEOA 1PDQA 2CVRA 3QIAA 5EAYA 5I2XA 5IGGA 1YNND 1HUNA 2R93B 1JORA 4IPDA 4RCNA 1HA6A 4MZ9A 4LUVA 1FL0A 3ITPA 1KDBA 4G7HC 1L1OB 4MHEA 3VR3A 2PQAA 2TSSA 4KJNA 1KHIA 3GV3A 5COYA 2F0NA 4AYBE 1PTOD 1PRTB 1EWCA 4JBWA 3P1HA 1SBBB 4C3JH 3S1MH 2J0TD 1STBA 1XNRQ 1YVCA 2F0JA 4C56C 2LY7A 2XNAC 4ODGA 1JQYD 3IKJA 4WJ4A 2VB2X 4QQBX 5IGFA 2L0CA 2WAQG 4C2MB 3IL8A 4XIGS 5C44B 2XN9C 2B2VC 5A2QL 3JAML 1LO5D 1QVGA 1QG7A 3LX0A 2XWJB 1IBLQ 1VQJA 1VQ4A 3CPWA 2UUAQ 3CC4A 2VB3X 4ZK9B 3MEFA 3LNNA 2N78A 3BDOA 1HZ9A 2A6HD 2QCPX 5G3LF 1PVOA 1X55A 3MHBA 4TSSA 4ILWA 1EWIA 1BOSA 3MXNB 5JJZA 5JPMC 4ZUIA 1NMFA 2KCTA 3MTSA 3I3CA 1JWMD 2KCCA 1PTOH 4F7XA 5AJ3L 1TQOA 3TS0A 1LTGD 4JI5L 1MGSA 2ZTDA 5E4WC 3DWAA 1QCBD 2RHQB 2I5LX 4HIDA 1XX8A 1A6XA 4A93B 1Y1WG 3HOWB 4X64L 4ZCKA 4DUYQ 3CQZH 5M5XH 1XTCD 4DAYB 4P72A 1I4XA 2IW3A 4I7ZC 1U4LA 4GLAC 5FO7B 1X6OA 3PSIA 4A3LH 1H9MA 3HOUB 1D5MC 2K75A 3S1QH 4QJFA 1DOKA 1F9SA 3S1RH 3KLSA 3V05A 3Q6SA 1S5DD 3BVMA 1KL9A 1SMXA 2I5MX 4C3IB 2M9VA 3MAQA 1S4ZA 3OTOQ 1U4PA 4B9XA 4DUZQ 3PGZA 1JJ2A 1Q46A 1QUQA 2NVYB 3GTPH 5C4ZA 1CA6A 3VR2A 3VR5A 1LM0A 4QIWB 1YIJA 4KKTA 1CHQD 1EYDA 4JI3Q 1EY7A 4LF5Q 1XXGA 1G6ZA 4XYOA 3S15B 1X3EA 1HTLD 1M4VA 3T13A 4LF6Q 3VYSA 2AUJD 1VQEA 5IT9c 1SMYC 4B3TL 1VMPA 5BN3A 4AQYQ 1FR3A 2RQXA 4RGNA 1IW7C 1SDFA 3EIVA 4XT3B 1L1OC 4A3FB 1XJVA 4BS9A 1NR2A 2GVAA 4A3IG 2D5DA 3DM3A 2K33A 4LW1A 3PUYA 2VQEL 3M4OH 2NB0A 2K5HA 4I65A 1PRTC 1VQBA 2DN8A 2QEJC 1T5XD 2YU9H 2SEBD 4X66Q 2JQOA 1K73C 4WJWA 5C0XI 2OTJA 4C3HG 2QDLA 4ZRZA 2EXZA 3BZKA 1XPUA 2BDOA 5C3WA 5FLMG 5EJWA 1CM9A 3CMAA 4R4IA 2YV5A 4JYAL 1F9PA 2AQ2B 3KDFA 3N52A 1WTVA 5C3EH 2R92B 2SOBA 1E3PA 4AH6A 2Z1CA 4F8MA 3D4RA 5M5YH 3EVQA 3TN2A 4DV6L 4DV2L 2Z6BA 2KJXA 4UHVA 1B2TA 1Q82C 2JK8A 1G2SA 3RR5A 3OPOA 1P16A 2NVQB 5IGEA 1NR4A 3NEMA 4CDFC 3DMUA 1OXUA 2A8VA 5L37A 3AQQA 1L2FA 3EQLC 2K50A 1D6EC 4A3GB 1WCMH 3C1FA 3HFZB 2OQKA 4GZYC 4OONA 3HOZH 1PZID 1G2TA 1RIPA 1HFNA 4DR3Q 3J80i 3GTPB 3G4SA 4A93G 4GOPB 1Q8IA 1L0XB 4DR5Q 3CCQA 4DR7Q 2M00A 1G91A 2EYMA 1VQ8A 2JA7H 5LMUL 4BBSH 1AP0A 3S2HH 2F0VA 1FD7D 2RHSB 3MC0B 1KD1C 1EYAA 3WOEA 1MKHA 1CFMA 1B1ZA 1XTDA 4YWMA 2EZVA 2WKCA 5JOBA 3PUVA 2LXJA 4NB3A 2KEEA 1LV9A 1W3SA 5M3MB 3RN5A 1N36L 3E0JA 2IT1A 2MHVA 3HKSA 3NK9A 2DY7A 4XYQA 3A8JE 4ALPA 1NJIC 3K6OA 1CA5A 2J7ZA 1VQFA 3WOFA 4C3JG 3BJUA 2YU9B 1A3TA 2ZJPA 1PTOF 3H91A 4DR6L 2I0QA 3P75A 4DAMA 1KQSA 4JPBW 1E2WA 1O7ZA 1D5ZC 1EOTA 4ME3A 2ZTCA 4IALA 2KOLA 3BZCA 4R9WA 5E4XA 5C3EB 2KENA 4LUZA 4XQQA 4B08A 4QGUA 1Y69U 2B2WA 3O13A 4CJ0B 1IBKL 4IJHA 3I4LA 5EKLA 4YCVA 3X3NA 3VR6A 2F0OA 3J81c 1YNNC 4OGQC 3QG1A 4X65L 3FHWA 4K6LA 2RDHA 2RCNA 4UP8A 1K3BC 2DUDA 3S14B 1CHPD 1SE8A 2LMCB 3VDYA 3QR8A 3TRZA 1Q7YC 2L11A 4HIKA 2Q2UA 3S16B 2EYJA 2Q2IA 1S5CD 1ZKOA 2F0TA 2GVBA 5M5WB 2UXBL 3SR1A 1TWHB 2EJMA 4IUQA 1DCZA 4KD3A 2NYZD 2XVSA 4DR4L 4R4OA 3PO2H 1PMRA 3LWUA 1KABA 3S2DB 4QUCA 3RMHA 2VW9A 4BBSB 2IHFA 3S2HB 2AWNA 4R4CA 5D14A 1ENCA 5JJIA 1ASZA 1HZCA 1GUGA 4A3MH 2JYOA 4QY7A 4IQZA 1YI2A 2E2IB 4A3LG 5IODA 3K0XA 5ELDA 1ICWA 1Y1VH 3EFXD 1L0YB 5AJ3Q 3GTOB 4JI5Q 1JOKA 1NTGA 3SK5A 5I6YA 2VXWA 2ID0A 4X64Q 4IZ8A 1NAPA 1E22A 2PW5A 1MJEA 4N8FA 5EBCA 2MO1A 3OYYA 4BY1B 2BA0A 1J9OA 3CRKC 1S3OA 2CKZB 4Y7NH 4OWTB 5C6AA 2H4OA 1DXMA 3M85A 5H1SE 5JEAH 4IN3A 5FLXc 4DK6C 1PV4A 4GOPC 3I91A 1LLRD 2CWPA 1LTID 2N88A 1TWCH 3A7LA 3QJYA 4LFCL 4R1JA 1TY0A 4DAPA 2IJ0A 1Q1BA 3AFPA 1RCVD 2AMCB 3T56B 4H02A 3UE1A 4P73A 1N33L 1WD1A 2NTTA 2FJ2A 1GUWA 1Z7TA 4LF8L 2FMMA 2PZUA 3RD4A 3T16A 1HJPA 2GN5A 3ONAB 2ASBA 1PZKD 3Q23A 4KJOA 2Z4HA 3R2IA 2CCZA 3CKIB 3KFUA 4KN7C 4KHVA 1DJRD 5E1FA 5D3DA 1LUZA 1XMOL 1H9SA 3RLFA 4K2LA 3QB3A 4APVA 5IGCA 3C3LA 4JCVE 2SNMA 4FXGC 2EDGA 1AE2A 2CWAA 1TWAB 3GV6A 1X9NA 3TP8A 5JAVA 4YY3L 1A3UA 2EIFA 4K8IA 4RMFA 1PYWD 3A0JA 4L5RC 5C3EG 2HDMA 5KEEA 1QOHA 5DNFA 2ZTEA 3A54A 3I4MB 2VQEQ 1I3QB 1ESFA 2X69A 2ZT9C 4DV3L 1EQRA 2F0FA 1WD0A 4BXXH 1EUJA 4FNFA 1EIGA 1JB7A 1O78A 1QUQB 2E76C 4X3KA 1PFBA 2B2YC 2A1AA 1WCMG 4JYAQ 1STGA 3HOZG 4Y7NB 1U9RA 1B9NA 4JBJA 5CR3A 3CP0A 3RZDH 1Q8KA 1H9KA 4G7ZC 4JOIA 4ZKCB 5KNBA 1PH2A 1DZ1A 1ZYRC 1ICFB 1C48A 5C0XH 2JA7G 1TWCB 2F3VA 5LHY1 4BBSG 2Y0SE 4DV2Q 2DJGC 4ME5A 2WAQB 1VQCA 1D5XC 1QVCA 5JVG3 3NPPA 3GTMH 1SSOA 4HJ5A 2E2HB 2B2UA 3CCLA 4IJLA 5C4XH 3E6ZX 1HUMA 1LT6D 1BNZA 3KJOA 1C9OA 4YCWA 1UE5A 4RFBA 1PH7A 4YHHL 3J80E 2IL8A 3AFQA 5EGTA 5IP9H 3DXJC 2A74C 1V1PA 2KBNA 3EBEA 5LMUQ 4Q5VA 5JJKA 3D6WA 5I6WA 2UXDL 2FMCA 1ZXTA 1DOLA 1IYJB 3KLRA 1R4PB 4I7AA 1SE4A 1A63A 3RZOB 1NY4A 1SAPA 1CZGA 1Y1WB 2L4NA 2Q8TA 1EY0A 3P20A 1N36Q 2B63H 1JR0D 3E3XA 3CCSA 3W1BA 3DWQA 2X6GA 2WB1E 4ZUJA 1Q81C 3GDEA 4C1NI 5FO8B 2DJFC 4DV0L 1TU2B 4JBMA 4RCOA 1GM5A 3G7LA 2E2JH 1S40A 1ET9A 1SNMA 5KYLA 1SN8A 4DR6Q 2X6LA 1KXLA 2RF4A 1OXVA 1UAPA 1B9MA 5EKKA 4DNIA 1M90C 4B9WA 3CCEA 3PIPA 4DK3C 3SVMA 1BF4A 4TQUS 3I73A 4UY8C 2AHOB 1VQDA 4FO2A 3PO2G 1QE6A 4AYBB 3A56A 1IBKQ 1AN8A 2UUCL 1SYBA 4HJ9A 2F0WA 2NVXH 4X65Q 2IPKD 1VQLA 4A3MG 3BYYB 4OL7A 1WTQA 4QMGA 2HCIA 2RBMA 3EN2A 2Y0SG 4M8AA 5FK9C 1Y1VG 4JI2L 4QB4A 3J7AF 1EEID 5C4XB 1CKNA 4DF7A 4K5WA 4EQPA 1SYDA 2UXBQ 3PUZA 1IXRA 3M7GA 3OIPA 5GAGC 1SFOH 1RJTA 4NXNL 4DR4Q 4FVMA 1IYUA 2C5CA 4JK1C 4K14A 1VQHA 4A3IB 1VQNA 2AUKA 1S72A 3I4NH 1VQGA 1K8OA 3H3VI 1EU3A 4KHPL 2BA1A 5HGQA 4FF3A 5JEAG 3CCMA 3CHBD 2G5DA 3VA7A 4C3HB 2KEDA 2BH2A 4YWLA 5DAUA 1PXUA 2OF1A 4O0AA 5BN4A 5GADC 3HOXH 4GN4B 1WTPA 1B3QA 2OXPA 4YCUA 3J80L 1KIXA 2JA6H 1TS5A 2KHIA 2SNSA 4IO9A 3PIP3 2MFIA 1YJ9A 2LSSA 4A4IA 3HKZE 2E2JB 2PQEA 1KAWA 2Q2TA 4JI4L 3NUCA 3TEHB 5C4HA 1HA5A 1VQIA 1UEAB 5KGUA 1UNSA 2WB1G 1IKLA 5GROA 2KCMA 1R9TB 2F0QA 5FOBB 3S1NH 1SNQA 5M3FH 4A3JH 4PZ8A 4K2KA 5DM73 4KI0A 5EPJA 4LFCQ 2WP8J 2FXQA 4L5TA 1YNXA 4XT1B 3FDTA 1N33Q 2A5HA 1CQVA 2NVTB 2RA4A 4HMIA 4DNTB 1HQRD 3U9OA 4LF8Q 1N32L 2ZXOA 4DKAC 4LFBL 1BR9A 2PZWA 4RGOS 2F0IA 2ICIA 2NVXB 1LT3D 4ZYSA 3H15A 1HNZL 1I6VC 2QKIC 2WKDA 2EY6A 1X3QA 3EJIA 3NE5B 1B70B 3I70A 5FJ8H 1XMOQ 1PH4A 1E2VA 3WWVA 4IPCA 1LTAD 4BXXG 4NXML 1W2BA 2NN6I 4LWCA 3FRPB 1LYLA 3IAYA 3KF6A 2M2LA 1LABA 4A3BH 4YY3Q 1O7LA 1K9MC 3KBXA 5I4DA 3KJPA 4LNQA 5C4JH 1B53A 2K7VA 4C3JB 2IX1A 1WTHA 3S1MB 2QEXA 5K36H 3A55A 4IPGA 1UWVA 3D3RA 4GKKL 5I9OA 4P74A 2IHEA 4AYBG 2B2TC 3E9HA 5C0XG 1TIID 4DV3Q 1IL8A 2E5LL 1LTRD 1KC8C 4QCLA 3MFYA 1PFMA 3R93A 3PUXA 4HTHA 2E75C 2CQOA 4X3SA 1RKNA 4K5XA 1YHBA 3M4YA 2OTLA 5C4XG 3RLNA 2L15A 1XWEA 2F3IA 4A3DH 1I50H 1U4MA 4KY6A 4JW0A 1VF7A 1MJCA 2KCNA 1H9SB 3PF5A 2K32A 1STYA 2E74C 5GAHC 1K0SA 1MD2D 4LMQD 1L0WA 2EY5A 3HKZG 3S1NB 3OWFA 3OSOA 3NENA 5IP9G 4A3JB 4Q0FA 3T1HL 1EY8A 5CV6A 1AE3A 3PUWA 1FNUA 3C46A 5EKIA 4L6TB 1PTOB 2JA8H 1QZHA 2CH4A 4G57A 4J8QA 3ZYYX 3GO5A 2B2VA 4K0KL 4DXGA 1KAAA 2O5JC 2R61A 3CQZB 3Q0AA 2WV6D 2B63G 3D4WA 5M5XB 5ELEA 1QNUA 3TMEA 1B50A 2MO0A 3K5LA 3HOYH 4JI6L 1STAA 4YHHQ 1BCPD 2K14A 2A68C 2PNHA 1FVIA 4HJ7A 1ESRA 4IFDI 1RDPD 4EQOA 1PLFA 1D7QA 3S1QB 2UXDQ 1ZEQX 4A3EH 3QWNA 2CW0C 2LKVA 3HP3A 3NBHA 1TY2A 2IX0A 3OIQA 1IYVA 3S1RB 1GD7A 1PYBA 4KTAA 1Q90A 5C4JB 4OX9L 4JI1L 2L1BA 3MVVA 3D8GA 4GN3B 4NKLA 4AIMA 2EVBA 2PMZE 3TQYA 4ZLTF 2XSCA 5IOCA 2H1EA 2K04A 5FO9B 3FKIH 2A69D 1XPOA 3CRLC 2WFWA 3CC7A 3S9WA 4CGYB 4RGMA 4DV0Q 1SNDA 4FDBA 2PO4A 3TP6A 3S24A 1RODA 1B7YB 2EYHA 1V8QA 1G8ZD 2XRQD 3SXHA 2PPBC 2R7FA 1W6JA 5A35A 2L5TA 3MWYW 3V2TA 4A3DB 1I50B 5HURA 5KRUA 3J7YW 4LK1C 1G51A 1V1PB 2XWBB 2Q2HA 5CV9A 4B3RL 2MQHA 1Y8PB 3L9AX 1YNJD 1E7ZA 1BXTA 4HJAA 1S5BD 3HZXA 3TREA 1V1QA 3E9IA 3I4NG 1RD9D 3M4OB 2UUCQ 1ONLA 2F0MA 5JEAJ 1E2ZA 2JA8B 2NUCA 3ND9A 1CKMA 1R4QB 2F03A 5IGDA 2I46A 4JI2Q 1ET6A 3BVZA 3X3MA 2EXDA 3HOXG 1NUCA 2HHHL 2KHJA 3BVGA 1ENFA 2OQ0A 2Z6KA 3AYHB 1YJNA 2KA7A 2JA6G 3FVQA 1TVXA 4C1NK 5KNCA 1X65A 4NXNQ 1BKBA 1EOVA 5ELFA 1L1OA 4ID6A 3F2CA 5M5YB 1F2ZA 4A3EB 4KHPQ 1I5FA 1SR3A 1Y14B 3K80C 3NWSA 3T51B 4IUVA 5M3FG 3QOJA 4JG2A 2JSOA 4A3JG 2HT1A 3NTKA 2HUGA 2R7ZH 2E8GA 1VQMA 2A6ED 4IUUA 4DV5L 1WCMB 4KKSA 3ZJYC 1H95A 1PTOC 1PZJD 3HOZB 3TZDA 4FF4A 2HQLA 2B3GA 3WDNA 3H3VH 1A0IA 1FNWA 4U673 1JJGA 1QWYA 1B44D 1EY4A 1JE5A 3NSWA 4ABNA 2JA7B 3F2DA 4JI4Q 1GJXA 1CKNB 1MHWC 4UDUC 5D65A 4JV5L 1HR0L 1SE3A 1A3VA 1IL2A 4LF4L 4CKBA 1SYCA 1EFWA 1VCIA 5FJ8G 4HR7B 3GTQH 2PQAB 4OIKA 1SXTA 1HZBA 1BVSA 2A6HC 3PO3H 1S5FD 2KECA 4A3BG 3S17H 3MFGA 4B3SL 2RSOA 1N32Q 4HJ8A 4BBRH 3N6RA 5J39A 3OWEB 4JOIC 1VQPA 2HCCA 4LFBQ 5CC4A 3D0FA 1HNZQ 5K36G 3H6MA 5C0XJ 3G6JB 2F0SA 1NNXA 1DYQA 3I4OA 2F0GA 4DK1A 3L2PA 4GLVB 2RSNA 3K57A 1I4RA 3L7ZC 2EPBA 4H0LC 1I4QA 2RVLA 1TS3A 1KLGD 1G291 4NXMQ 5C5MA 2OWOA 4WFN3 3D4DA 2Q8IB 4RHRA 1LTBD 2VY3A 4A3DG 5LL6S 1K83H 1OXSC 1X54A 3C1EA 3UDFA 3W2DA 1HCZA 1SROA 5CV4A 2K01A 2L12A 5BR8L 3I56A 3F2BA 4IUTA 3RNUA 3U50C 4CJ2C 1TT2A 1U5KA 4GKKQ 3URYA 1XMQL 2NN6H 4ULLA 2E5LQ 4KLKA 3G6EA 1X3PA 2JA8G 4PMBA 4OXPA 1M8AA 3E0EA 1F2LA 4KD4A 3K59A 1IHZA 1YITA 3I7FA 4PNYA 1QILA 3Q24A 3BU2A 2QA4A 4LF9L 3PO2B 3KK7A 4HSPA 2B8GA 5ELCA 2N55A 3TP5A 1VDZA 2PNRC 4R8IA 1SJED 4ZAIA 3K81C 2PYKA 2AQ1B 3HOYG 5FKAC 4A3MB 3CCRA 3KF6B 1TKWB 2JJQA 3T1HQ 2Y0SB 3MZ5A 1Y1VB 4PMWA 2KHSA 1I4HA 1SNPA 1BCPF 4A3EG 1Q1EA 4JI0L 3PCOB 3KYHC 4UPAA 2K4KA 4BA2I 3S17B 4DR1L 2PI2A 1EYCA 3VYUA 2JXMB 1WJJA 4CBVA 1MSGA 3GTGH 4FXKC 1PH3A 4OO1I 3HGBA 3L0OA 1JE4A 4K0KQ 1PH8A 3AB9A 1JC7A 1NSNS 1ASYA 4EQ5A 3FKIG 3TZUA 4JI6Q 4H7BA 3R3OA 2AQ3B 2Q8RE 3M4PA 2K1BA 3CCUA 2IWHA 2PCFB 3K7AH 1Z6HA 1PYSB 2ZJQA 2VZAA 2O2LD 1KNAA 2D9UA 2CH4W 1PRTD 3SK8A 2BE5D 2K52A 1J5EL 1F9RA 1Q86C 3J80c 2WACA 4OX9Q 1E0BA 1K83B 4JI1Q 4X62L 5LMNL 4IPHA 2UU9L 2BH8A 3MXUA 5D3IB 4IFDH 3U4VA 4OWWB 2H5XA 2WB1B 1K3RA 2K5NA 4R4TA 4DU9A 1EL0A 2L9HA 4KN4C 2E2DC 4LFAL 3T53B 1I6HH 5HGTA 2EJGC 5JPNC 4XQJA 1G6PA 3KDFB 2MNAA 4PMCA 3RLOA 2A69C 2R93H 2G9DA 1HFGA 4DGZA 1HNXL 5CYUA 3E5SA 3ULLA 4DV7L 4IOAA 2F0UA 3NQIA 1KRSA 4GNXA 2QDBA 3M3YH 3ERSX 4B3RQ 5A2QE 3JAME 4L8JA 1BBUA 1BUVT 4J1MA 3NBHB 1K8MA 2ENBA 1XNQL 1HRJA 3H0GH 3U9SA 3KF8A 1N34L 2D2CC 2O4XA 3STBD 4HSVA 2HD3A 1TWFH 3H94A 4K5VA 4RGTA 2KUMA 1EFID 4XDXA 3ERQA 4QUFA 4CDCC 2R7ZG 3A8IE 4DXFA 1HNWL 2YYZA 5C44H 3AEVA 4A75A 2Z8LA 2HHHQ 4S3SA 1TWGH 5IY0A 2HIXA 1HZAA 1BO0A 1PH1A 1I4PA 4V190 2YTYA 4TRDA 3RZDB 1LTSD 1KDAA 3K5MA 3K7AB 1W6KA 5CV8A 3M4QA 2JA5G 1AFPA 2HDLA 5BN5A 4DK0A 3CD6A 5GAEC 1KNEA 2WINB 3GTMB 4PQXA 1TS2A 1VMCA 1FNVA 2R6GA 1A15A 5IE8A 3KUPA 1DOMA 1CSQA 2R7DA 4DV5Q 1EWHA 1FGBD 4NW2A 4O1NA 1QB5D 3PO3G 4M1UB 2B2YA 2K03A 3HOWH 4HCSA 4EVOA 1WTOA 4BBRG 1JWUD 5KNDA 3HKZB 3OOCA 3KLSX 3UDGA 1KRTA 1VQ5A 4A76A 1RHPA 1Z47A 1I6HB 1CK1A 4O2DA 4JV5Q 4DPGA 1HR0Q 2A6EC 4UP9A 1OTCA 3HOUH 4LF4Q 4JI7L 4HAEA 3PMFA 2UXCL 2QF7A 2F0LA 1HXYD 3KLWA 2B63B 1VQAA 4DN4M 3M3YB 4IURA 1PH6A 1ILQA 3D6CA 4B3SQ 2F1MA 1JT8A 1STEA 2F0KA 4C3IH 1YEZA 3H0GB 1DONA 3FPUB 1EQTA 2QW7A 1QVFA 2NZOA 2NVYH 2NTSA 3A7AB 3SHLA 1TWFB 1X3FA 4CHTB 1K8GA 2NN6G 1F2MA 1K0RA 4GLXA 2CHBD 3J81i 1BBXC 1WI5A 2KQ3A 4RA8A 2L55A 1JICA 1TWGB 4RG1A 3S15H 3NWTA 3OHXC 1JMCA 5CBEE 1DM0B 4DAVA 2FFKB 1WOCA 3OMGA 3F2UA 3GTLH 1QJOA 1WTXA 2JA9A 4JBKA 1NBWA 1N9WA 3K5NA 1JWSD 2XTIA 3F8TA 1P8LA 2V1CC 4P71A 4RHSA 5ELBA 4A3FH 1EEFD 5BR8Q 5KIXA 4POGA 1BQQT 4JVZA 4PZ7A 4H44C 3JC66 3UDXA 3SDZA 1XMQQ 4UAIA 4DR2L 1HQMC 4NDXA 1CKOA 4GS3A 3HOVH 2P5ZX 3OMCA 3FPPA 5IIFA 1SNOA 2VQFL 2EY2A 1SFOB 4LF9Q 3I4NB 1B4OA 1EIHA 5ISRA 2JP1A 1AEXA 2R92H 3CPFA 3CW2C 5CV5A 2RDGA 4V0BA 2D0OA 5J3BA 4A3CH 3C2PA 3K8AA 5M9OA 2F0PA 1IBML 4N8X1 4RKBA 1VQOA 3DUZA 5IYDH 3HOXB 1A2UA 4WRDA 4JI0Q 2VNUD 2NVQH 4WORA 5I9PA 4DR1Q 4KY5A 5IYBH 4DV4L 4XQNA 4LF7L 2JA6B 1VF5C 3NTIA 1GUTA 1CQFA 3UE0A 4A3GH 1PRTF 2DNEA 1X3GA 4EX5A 4HEDA 4X3TA 1UEBA 1CZWA 1STNA 1MI2A 1HR0W 4IFDG 3BS1A 3M9BA 2JEAI 1EQVA 2NZHA 4R8NA 1CTMA 2ZM6L 1F9QA 4RH6A 1C4QA 4IUNA 3UI2A 1X56A 3R2TA 5M3FB 3K7UC 1B8AA 3CCJA 3R8BA 5JVH3 4POFA
chains in the Genus database with same CATH topology
4OO1H 3GTLB 1LACA 1T5EA 2EE1A 2B2WC 2PMZB 5EQ0A 3VA5A 1RF2D 1SYGA 5EPKA 3SK4A 5IT9E 2BE5C 1CT1D 1GUOA 1V43A 3HOVB 2EOTA 1F2YA 1D1KA 1ZYRD 3VYTA 2TMPA 1HPCA 3FEWX 1GUSA 1OXTA 3I72A 4A3BB 1RTNA 1LT4D 1OO9B 4CKCA 1ENAA 2PW7A 5EPLA 4KMUC 4OHJA 3EROA 3I90A 2K28A 4CKEA 3BDLA 3HRZC 1X32A 4EGVA 4BWGB 4U68A 1HHVA 1SEBD 3BG3A 3SEBA 2MGSA 4XTCS 5DM63 2F3WA 4P2CB 1KTKA 2RKSA 1MBYA 4ZQ3A 1EZ8A 2ICEC 5CGKA 1D2BA 1WTRA 3ND8A 1Q3LA 2LFNA 2B2TA 4KV6A 5J22A 3RUZA 3MEHA 1MSHA 3GD7A 3NHHA 3TBIB 3V96A 2DNCA 3A8KE 5I2YA 5C3XA 3P7JA 3HG9A 1O7YA 2K5QA 1JOQA 4N9PA 3GTKB 3HOYB 2XRSD 3MXPA 1H9RA 4C3IG 2DY8A 1U4RA 2BDNA 3BZDB 2OT2A 4KY7A 4YIJA 2G9HD 1A2TA 4MN3A 4RAUC 3GP7A 1STHA 4L63B 2ZXPA 5EBDA 4PV1C 5IT9L 3T4AC 2SDFA 1JCKB 1H9JA 3FKIB 3AU7A 3DM1A 3J7AV 4FP5D 3K58A 5AFWA 3GTJB 4HMJA 4O42A 5K5PA 1LT5D 1AZPA 4FF1A 3L3OC 1BCPB 3J81E 2AWOA 1SYFA 3MXNA 1QNKA 1EY5A 3BYTB 4NP5A 1GUNA 1F77A 2BCOA 3QO2A 4BY7B 5CBAE 4HN7A 2MJ8A 3TSSA 3TDQA 1SE2A 2EY1A 2K6AA 2BOSA 3D31A 4DAYA 1RTOA 4LJZC 2B2UC 3GQBA 2QILA 3DWPA 4J6HA 3QOLA 3Q22A 5F2DA 5LL6X 4Z9CB 4K8JA 3VYRA 1SNCA 4IFDJ 3LWEA 4IUPA 3EA6A 3KBGA 4F87A 2EYOA 2PZTA 3NTHA 4LAAA 1J8IA 4TKOB 1EZ6A 1TR5A 1II3A 1LTTD 2F0HA 2R7ZB 4DNRB 1B3AA 2F0EA 4OO1G 2EJFC 4G4KA 4MIUA 5G3LD 4ZKBB 5FLXE 3TP7A 5TSSA 1OXXK 4DA2A 5CMDA 4A3KB 1CI3M 2K05A 2HQEA 1EU4A 1I4GA 2JA5B 2MP1A 1ML0D 2B39A 2A73B 1DD2A 4NMZA 3GTQB 2VUMB 3PO3B 4N9TA 3PV0A 2I07B 1EY6A 1EY9A 2IX3A 5KYIA 1KLUD 4BA1I 4BBRB 1FYCA 4EQNA 4FXDA 1V1OA 4DFAA 2MUYA 1ILPA 1SMYD 2JE6I 2JEBI 4G7OC 3J81L 3DEOA 1IKMA 4F88A 1AZQA 2K5DA 1IW7D 2CQAA 1S5ED 1Y8NB 4KKUA 3PIO3 4RWSC 5NUCA 3NQTA 1BCPC 2K5WA 1KDCA 3NP8A 2B8FA 5C5LA 2A68D 1UUPA 3DHQA 3MA2B 1Y8OB 1GHJA 2C9OA 3AMUA 1NCVA 5T1IA 1BDOA 1WTWA 1O80A 4E6IA 2CW0D 1D1IA 2F0DA 2Z4IA 3NXWA 1XYIA 3DEPA 2GA4B 4HCEA 1GOZA 1GXDC 2NBFA 2MPMA 1AW7A 1HTPA 4FF2A 3I8ZA 2O5IC 5FLXL 1TS4A 4FYDA 2NZ1D 4QF4A 2F4IA 1JB3A 4CJ1B 3FMCA 3CU7A 4H13C 2ZXRA 3W3AA 4OIJA 2NWGA 4K6DA 3GTGB 3H09A 1YNJC 3HEJA 5CORA 4RKLA 2J4XA 3K5OA 2EYPA 3SK6A 3IFDA 3H3VC 2WIIB 3M7NA 2EYFA 2FINB 1JOOA 3K0YA 2RDFA 2LS01 3IFTA 3MXGA 5CV7A 3SE0A 2R3ZA 4X3UA 1WVLA 4KK7A 1GHKA 1C8CA 3BDCA 2EYLA 2KVMA 4KHZA 2FHTA 1SYEA 5IGBA 1Q12A 3VR4A 2D62A 5E3FA 5DEHA 4XXEA 3HS0C 1PFNA 3NBIA 2V4DA 1SJHD 5J1ZA 5T1GA 2XIWA 3OW7A 2OEOA 1PDQA 2CVRA 3QIAA 5I2XA 5IGGA 1YNND 1HUNA 2R93B 1JORA 4RCNA 1HA6A 3ITPA 4G7HC 1KDBA 4MHEA 3VR3A 2TSSA 4KJNA 3GV3A 5COYA 2F0NA 1PTOD 1PRTB 1EWCA 4JBWA 3P1HA 1SBBB 2J0TD 1STBA 4C56C 2F0JA 2LY7A 2XNAC 4ODGA 1JQYD 3IKJA 2VB2X 5IGFA 2L0CA 4C2MB 3IL8A 4XIGS 5C44B 2XN9C 2B2VC 5A2QL 3JAML 1LO5D 1QG7A 3LX0A 2XWJB 2VB3X 4ZK9B 3LNNA 3BDOA 2A6HD 2QCPX 5G3LF 3MHBA 4TSSA 4ILWA 1BOSA 5JJZA 5JPMC 4ZUIA 3MTSA 3I3CA 1JWMD 2KCCA 1PTOH 4F7XA 1TQOA 1LTGD 1MGSA 5E4WC 3DWAA 1QCBD 1XX8A 1A6XA 4A93B 3HOWB 1XTCD 1I4XA 2IW3A 4I7ZC 1U4LA 5FO7B 1H9MA 3HOUB 1D5MC 1DOKA 1F9SA 3KLSA 3V05A 3Q6SA 1S5DD 3BVMA 4C3IB 2M9VA 3MAQA 1S4ZA 1U4PA 4B9XA 2NVYB 5C4ZA 1CA6A 3VR2A 3VR5A 4QIWB 4KKTA 1CHQD 1EYDA 1EY7A 1XXGA 1G6ZA 4XYOA 3S15B 1HTLD 1M4VA 3T13A 3VYSA 2AUJD 1SMYC 1VMPA 5BN3A 1FR3A 2RQXA 4RGNA 1IW7C 1SDFA 4XT3B 4A3FB 4BS9A 1NR2A 2D5DA 2K33A 3PUYA 2NB0A 4I65A 1PRTC 2DN8A 2QEJC 1T5XD 2SEBD 4WJWA 5C0XI 4C3HG 4ZRZA 2EXZA 2BDOA 5C3WA 5EJWA 1CM9A 1F9PA 2AQ2B 3N52A 1WTVA 2R92B 2SOBA 2Z1CA 4F8MA 3D4RA 3EVQA 3TN2A 2KJXA 1B2TA 1G2SA 3OPOA 2NVQB 5IGEA 1NR4A 3DMUA 1OXUA 3EQLC 1D6EC 4A3GB 3C1FA 4GZYC 1G2TA 1PZID 1HFNA 3GTPB 1Q8IA 1L0XB 2M00A 1G91A 2EYMA 1AP0A 2F0VA 1FD7D 3MC0B 1EYAA 3WOEA 1CFMA 1B1ZA 2EZVA 2WKCA 5JOBA 3PUVA 2KEEA 1LV9A 5M3MB 3E0JA 2IT1A 2MHVA 3NK9A 2DY7A 4XYQA 3A8JE 3K6OA 1CA5A 2J7ZA 3WOFA 4C3JG 2YU9B 1A3TA 1PTOF 3H91A 3P75A 1E2WA 1O7ZA 1D5ZC 1EOTA 4IALA 2KOLA 4R9WA 5E4XA 5C3EB 4XQQA 4B08A 1Y69U 2B2WA 3O13A 4CJ0B 3I4LA 5EKLA 3X3NA 3VR6A 2F0OA 1YNNC 4OGQC 3QG1A 4K6LA 2RDHA 3S14B 1CHPD 2LMCB 2L11A 3S16B 2EYJA 1S5CD 1ZKOA 2F0TA 5M5WB 3SR1A 1TWHB 2EJMA 4IUQA 1DCZA 4KD3A 2NYZD 2XVSA 1PMRA 3LWUA 1KABA 3S2DB 4QUCA 3RMHA 4BBSB 3S2HB 2AWNA 5D14A 1ENCA 1GUGA 2JYOA 4IQZA 2E2IB 5IODA 5ELDA 1ICWA 3EFXD 1L0YB 3GTOB 1JOKA 3SK5A 5I6YA 2VXWA 2ID0A 4IZ8A 1NAPA 2PW5A 5EBCA 4BY1B 2BA0A 1J9OA 3CRKC 5C6AA 2H4OA 1DXMA 3M85A 5JEAH 4IN3A 3I91A 1LLRD 1LTID 2N88A 3A7LA 3QJYA 1TY0A 4DAPA 2IJ0A 1Q1BA 3T56B 1RCVD 1WD1A 2NTTA 2FJ2A 1GUWA 1Z7TA 2FMMA 2PZUA 3RD4A 3T16A 3ONAB 1PZKD 3Q23A 4KJOA 2Z4HA 3R2IA 3CKIB 4KN7C 4KHVA 1DJRD 5E1FA 5D3DA 1H9SA 3RLFA 4K2LA 3QB3A 3C3LA 5IGCA 2SNMA 4FXGC 2EDGA 1TWAB 3GV6A 3TP8A 5JAVA 1A3UA 4K8IA 1PYWD 2HDMA 5KEEA 1QOHA 5DNFA 3A54A 3I4MB 1I3QB 1ESFA 2X69A 2ZT9C 2F0FA 1WD0A 4FNFA 1EIGA 1O78A 2E76C 4X3KA 1PFBA 2B2YC 1STGA 4Y7NB 1U9RA 1B9NA 5CR3A 1H9KA 4G7ZC 4ZKCB 5KNBA 1DZ1A 1ZYRC 1C48A 5C0XH 1TWCB 2F3VA 5LHY1 4ME5A 2WAQB 1D5XC 5JVG3 3NPPA 1SSOA 2E2HB 2B2UA 3E6ZX 1HUMA 1LT6D 1BNZA 4RFBA 3J80E 2IL8A 5EGTA 3DXJC 2A74C 1V1PA 4Q5VA 3D6WA 5I6WA 2FMCA 1ZXTA 1DOLA 3KLRA 1R4PB 1SE4A 3RZOB 1SAPA 1CZGA 1Y1WB 2L4NA 2Q8TA 1EY0A 3P20A 1JR0D 3DWQA 2X6GA 4ZUJA 4C1NI 5FO8B 1TU2B 4RCOA 3G7LA 1ET9A 1SNMA 5KYLA 2X6LA 1OXVA 1UAPA 1B9MA 5EKKA 4B9WA 3SVMA 1BF4A 4TQUS 3I73A 4FO2A 1QE6A 4AYBB 3A56A 1AN8A 1SYBA 2F0WA 2IPKD 3BYYB 4OL7A 1WTQA 4QMGA 2HCIA 2RBMA 5FK9C 4M8AA 5C4XB 3J7AF 4QB4A 1EEID 4DF7A 4K5WA 4EQPA 1SYDA 3PUZA 3M7GA 3OIPA 1RJTA 4FVMA 1IYUA 2C5CA 4JK1C 4K14A 4A3IB 2AUKA 1K8OA 1EU3A 2BA1A 4FF3A 5JEAG 3CHBD 3VA7A 4C3HB 2KEDA 5DAUA 1PXUA 2OF1A 5BN4A 1WTPA 2OXPA 3J80L 1TS5A 2SNSA 3PIP3 2E2JB 2PQEA 3NUCA 5C4HA 1HA5A 1UEAB 5KGUA 1UNSA 1IKLA 1R9TB 2F0QA 5FOBB 1SNQA 4K2KA 5DM73 4KI0A 5EPJA 2WP8J 4XT1B 3FDTA 2A5HA 1CQVA 2NVTB 2RA4A 4HMIA 4DNTB 1HQRD 3U9OA 2ZXOA 1BR9A 2PZWA 4RGOS 2F0IA 2ICIA 2NVXB 1LT3D 4ZYSA 1I6VC 2QKIC 2WKDA 2EY6A 1X3QA 3EJIA 3NE5B 3I70A 1E2VA 1LTAD 2NN6I 3FRPB 3IAYA 2M2LA 1LABA 1O7LA 3KBXA 5I4DA 1B53A 2K7VA 4C3JB 2IX1A 3S1MB 5K36H 3A55A 3D3RA 5I9OA 2B2TC 5C0XG 1TIID 1IL8A 1LTRD 4QCLA 3MFYA 1PFMA 3R93A 3PUXA 4HTHA 2E75C 4X3SA 1RKNA 4K5XA 3M4YA 1XWEA 1U4MA 4KY6A 1VF7A 2KCNA 1H9SB 2K32A 1STYA 2E74C 1MD2D 4LMQD 2EY5A 3S1NB 3OWFA 3OSOA 4A3JB 4Q0FA 1EY8A 5CV6A 3PUWA 1FNUA 3C46A 5EKIA 4L6TB 1PTOB 4G57A 4J8QA 3ZYYX 3GO5A 2B2VA 4DXGA 1KAAA 2O5JC 2R61A 3CQZB 3Q0AA 2WV6D 3D4WA 5M5XB 5ELEA 1QNUA 3TMEA 1B50A 3K5LA 1STAA 1BCPD 2A68C 1ESRA 4IFDI 1RDPD 4EQOA 1PLFA 3S1QB 1ZEQX 2LKVA 2CW0C 3QWNA 3HP3A 3NBHA 1TY2A 2IX0A 3OIQA 1IYVA 3S1RB 4KTAA 1Q90A 5C4JB 2L1BA 3MVVA 3D8GA 4NKLA 2EVBA 4ZLTF 2XSCA 5IOCA 2H1EA 2K04A 5FO9B 2A69D 3CRLC 3S9WA 4CGYB 4RGMA 1SNDA 2PO4A 3TP6A 1RODA 2EYHA 1V8QA 1G8ZD 2XRQD 3SXHA 2PPBC 1W6JA 5A35A 2L5TA 3MWYW 3V2TA 4A3DB 1I50B 5HURA 5KRUA 3J7YW 4LK1C 1V1PB 2XWBB 5CV9A 1Y8PB 3L9AX 1YNJD 1BXTA 1S5BD 3HZXA 1RD9D 3M4OB 1ONLA 2F0MA 5JEAJ 1E2ZA 2JA8B 2NUCA 3ND9A 1R4QB 2F03A 5IGDA 2I46A 1ET6A 3BVZA 3X3MA 1NUCA 1ENFA 3BVGA 2KA7A 3FVQA 1TVXA 4C1NK 5KNCA 5ELFA 4ID6A 5M5YB 1F2ZA 4A3EB 3NWSA 3T51B 4IUVA 3QOJA 2JSOA 3NTKA 2HUGA 2A6ED 4IUUA 1WCMB 4KKSA 1PTOC 1PZJD 3HOZB 3TZDA 4FF4A 3WDNA 1FNWA 4U673 1QWYA 1B44D 1EY4A 3NSWA 4ABNA 2JA7B 1GJXA 5D65A 4UDUC 1SE3A 1A3VA 4CKBA 1SYCA 1VCIA 4HR7B 4OIKA 1SXTA 2A6HC 1S5FD 2KECA 3MFGA 2RSOA 3N6RA 5J39A 3OWEB 2HCCA 5CC4A 5K36G 3H6MA 5C0XJ 3G6JB 2F0SA 1DYQA 2F0GA 4DK1A 2RSNA 3K57A 1I4RA 3L7ZC 2EPBA 4H0LC 1I4QA 2RVLA 1TS3A 1KLGD 1G291 5C5MA 4WFN3 3D4DA 2Q8IB 4RHRA 1LTBD 5LL6S 1OXSC 3C1EA 3W2DA 1HCZA 5CV4A 2K01A 2L12A 4IUTA 4CJ2C 1TT2A 3URYA 2NN6H 4ULLA 1X3PA 4PMBA 1M8AA 1F2LA 4KD4A 3K59A 1IHZA 4PNYA 1QILA 3Q24A 3PO2B 3KK7A 4HSPA 2B8GA 5ELCA 2N55A 3TP5A 1VDZA 2PNRC 4R8IA 1SJED 4ZAIA 2PYKA 2AQ1B 5FKAC 4A3MB 1TKWB 2Y0SB 3MZ5A 1Y1VB 4PMWA 2KHSA 1I4HA 1SNPA 1BCPF 1Q1EA 4BA2I 3S17B 1EYCA 3VYUA 2JXMB 4CBVA 1MSGA 4FXKC 4OO1I 3HGBA 1JE4A 3AB9A 1JC7A 1NSNS 3TZUA 4H7BA 3R3OA 2AQ3B 2Q8RE 2K1BA 2IWHA 2PCFB 1Z6HA 2O2LD 1KNAA 2D9UA 1PRTD 3SK8A 2BE5D 1F9RA 2WACA 1E0BA 1K83B 3MXUA 5D3IB 4IFDH 2WB1B 4DU9A 1EL0A 2L9HA 4KN4C 2E2DC 3T53B 5HGTA 2EJGC 5JPNC 4XQJA 4PMCA 2A69C 2G9DA 1HFGA 4DGZA 5CYUA 3E5SA 2F0UA 3NQIA 2QDBA 5A2QE 3JAME 4L8JA 1BUVT 4J1MA 1K8MA 2ENBA 1HRJA 3U9SA 3KF8A 2D2CC 2O4XA 4HSVA 3H94A 4K5VA 4RGTA 2KUMA 1EFID 4XDXA 3ERQA 4QUFA 3A8IE 4DXFA 2YYZA 2Z8LA 4S3SA 1BO0A 1I4PA 4V190 4TRDA 3RZDB 1LTSD 1KDAA 3K5MA 3K7AB 1W6KA 5CV8A 1AFPA 2HDLA 5BN5A 4DK0A 1KNEA 2WINB 3GTMB 4PQXA 1TS2A 1VMCA 1FNVA 2R6GA 1A15A 3KUPA 1DOMA 1EWHA 1FGBD 4NW2A 4O1NA 1QB5D 4M1UB 2B2YA 2K03A 4HCSA 4EVOA 1WTOA 5KNDA 1JWUD 3HKZB 3OOCA 3KLSX 1RHPA 1Z47A 1I6HB 1CK1A 2A6EC 4HAEA 3PMFA 2QF7A 2F0LA 1HXYD 2B63B 4DN4M 3M3YB 4IURA 1ILQA 3D6CA 2F1MA 1STEA 2F0KA 3H0GB 1DONA 3FPUB 1EQTA 2NTSA 3A7AB 3SHLA 1TWFB 4CHTB 2NN6G 1F2MA 2CHBD 1BBXC 2KQ3A 4RA8A 2L55A 1JICA 1TWGB 3NWTA 3OHXC 5CBEE 1DM0B 4DAVA 2FFKB 3OMGA 3F2UA 1QJOA 1WTXA 3K5NA 1JWSD 4RHSA 5ELBA 1EEFD 5KIXA 1BQQT 4H44C 3SDZA 4UAIA 1HQMC 4NDXA 3OMCA 3FPPA 5IIFA 1SNOA 2EY2A 1SFOB 3I4NB 1B4OA 1EIHA 5ISRA 2JP1A 1AEXA 5CV5A 2RDGA 4V0BA 3C2PA 5M9OA 2F0PA 4RKBA 3DUZA 3HOXB 1A2UA 4WRDA 2VNUD 4WORA 5I9PA 4KY5A 2JA6B 4XQNA 1VF5C 3NTIA 1GUTA 1CQFA 1PRTF 2DNEA 4HEDA 4X3TA 1CZWA 1STNA 1MI2A 4IFDG 3BS1A 2JEAI 1EQVA 4R8NA 1CTMA 1F9QA 4RH6A 1C4QA 4IUNA 3UI2A 3R2TA 5M3FB 3R8BA 5JVH3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3X A;  3QOJ A;  4PNY A;  2PZW A;  3SHL A;  4B9W A;  4EQO A;  5IGG A;  2F0I A;  1JOR A;  4J1M A;  5C5L A;  2ENB A;  2EYO A;  2M00 A;  2PZT A;  3TP5 A;  5IOD A;  2EYM A;  3DHQ A;  1F2M A;  4N9P A;  1JOQ A;  2LKV A;  4LAA A;  3ITP A;  1KDB A;  2KQ3 A;  3MXP A;  5I6Y A;  2F0V A;  2EY6 A;  4B9X A;  1EZ6 A;  2PYK A;  1TR5 A;  3EJI A;  1EYA A;  1SYB A;  2O4X A;  4KJN A;  4KTA A;  1II3 A;  2F0N A;  1JOK A;  1STG A;  4E6I A;  2F0H A;  4K5V A;  5C4Z A;  3SK5 A;  3MVV A;  1EY4 A;  2F0D A;  3VA5 A;  2F0W A;  3OMG A;  4KY7 A;  2F0E A;  1U9R A;  3D8G A;  5CR3 A;  4YIJ A;  1SYG A;  3NXW A;  3P1H A;  4NKL A;  3ERQ A;  1A2T A;  5JOB A;  4OL7 A;  3SK4 A;  3MZ5 A;  4IZ8 A;  5IOC A;  2PW5 A;  1EYD A;  4MIU A;  4QMG A;  1EY7 A;  2KHS A;  1STB A;  1SNP A;  2F0J A;  2RBM A;  3TP7 A;  2F3V A;  4ODG A;  4S3S A;  4QB4 A;  1A3V A;  3S9W A;  3NK9 A;  1EYC A;  4ME5 A;  3T13 A;  4DF7 A;  1STH A;  1SND A;  4K5W A;  5C6A A;  1F2Y A;  3TP6 A;  4EQP A;  1SYC A;  4TRD A;  5IGF A;  1SYD A;  5KIX A;  2HQE A;  2EYH A;  1KDA A;  4QF4 A;  3SXH A;  5CV8 A;  1NSN S;  4NDX A;  4K14 A;  3LX0 A;  1A3T A;  5I9O A;  3OMC A;  4K6D A;  4H7B A;  3R3O A;  4NMZ A;  3V2T A;  5IIF A;  1SNO A;  3P75 A;  5J39 A;  4HMJ A;  5HUR A;  1ENA A;  2PW7 A;  4I65 A;  5KRU A;  3HEJ A;  2EY2 A;  4HTH A;  5K5P A;  5CC4 A;  1RKN A;  2PZU A;  4K5X A;  4RKL A;  5CV9 A;  5EGT A;  3T16 A;  4N9T A;  3ERO A;  4IAL A;  1EY6 A;  5DAU A;  3MHB A;  3H6M A;  1EY9 A;  5ISR A;  2F0S A;  2EYP A;  3SK6 A;  5KYI A;  3BDL A;  3HZX A;  2OF1 A;  4KJO A;  1AEX A;  3SK8 A;  2EYF A;  5I6W A;  2F0G A;  4EQN A;  2EXZ A;  1JOO A;  4KY6 A;  4ZUI A;  1SYF A;  2OXP A;  5C3W A;  5CV5 A;  4EVO A;  2F0M A;  2WAC A;  4DFA A;  2RDF A;  4KHV A;  4F7X A;  1STY A;  2NUC A;  2SNS A;  1TQO A;  5CV7 A;  5E1F A;  5M9O A;  2EY5 A;  5EKL A;  3OWF A;  2F0P A;  2F0O A;  3OSO A;  5C5M A;  1EY5 A;  4K2L A;  1EY0 A;  3QB3 A;  4RKB A;  5IGC A;  2SOB A;  1A2U A;  4NP5 A;  2SNM A;  4WRD A;  3D4D A;  2PQE A;  5IGD A;  2F3W A;  1EY8 A;  4WOR A;  3NUC A;  5CV6 A;  5C4H A;  3BDC A;  2EYL A;  1NUC A;  2RKS A;  4KY5 A;  3TP8 A;  4F8M A;  5I9P A;  5JAV A;  5KGU A;  5EKK A;  4ZQ3 A;  3C1E A;  4DU9 A;  1SYE A;  1A3U A;  1EZ8 A;  3EVQ A;  4ZUJ A;  3PMF A;  2EY1 A;  5CGK A;  2F0Q A;  5IGB A;  5CV4 A;  4K8I A;  4G57 A;  2F0L A;  1SNQ A;  2EYJ A;  5NUC A;  3NQT A;  5HGT A;  5E3F A;  5DEH A;  2F0T A;  4K2K A;  1TT2 A;  1STN A;  3SR1 A;  5IGE A;  1KAA A;  2QDB A;  3DMU A;  1SNM A;  4KD3 A;  4KV6 A;  3D4W A;  5KEE A;  4ID6 A;  4PMC A;  5KYL A;  5J1Z A;  3D6C A;  5J22 A;  1EQV A;  1F2Z A;  1KAB A;  3TME A;  4R8N A;  2F0K A;  4DGZ A;  4J6H A;  4IUN A;  3C1F A;  3MEH A;  1KDC A;  4PMB A;  3QOL A;  4HMI A;  3RUZ A;  1STA A;  3E5S A;  3NP8 A;  3NHH A;  3U9O A;  5F2D A;  2F0U A;  4KD4 A;  2OEO A;  1IHZ A;  4K8J A;  1ENC A;  2F0F A;  1SNC A; 
#chains in the Genus database with same CATH topology
 4OO1 H;  2VL6 A;  4GKJ L;  3I2Z A;  2Z6K C;  2UUB Q;  3GTL B;  1J5E Q;  2R93 G;  1LAC A;  2Z0S A;  1T5E A;  5M3M H;  2EE1 A;  4X62 Q;  5LMN Q;  2ES2 A;  4IOC A;  2UU9 Q;  2B2W C;  2EQS A;  2PMZ B;  5EQ0 A;  3VA5 A;  1RF2 D;  2I5H A;  1SYG A;  5EPK A;  3SK4 A;  5IT9 E;  3GTK H;  2N8N A;  3OW2 A;  2BE5 C;  1CT1 D;  1GUO A;  4QIW E;  3H0G G;  1V43 A;  3F1Z A;  3HOV B;  2EOT A;  4LFA Q;  1F2Y A;  1D1K A;  1ZYR D;  3G48 A;  4JI8 L;  1I94 L;  3VYT A;  1RL2 A;  2TMP A;  1O7I A;  1HPC A;  3FEW X;  1IZ6 A;  1GUS A;  1OXT A;  3I72 A;  4A3B B;  1BBW A;  1RTN A;  5C44 G;  1VQ7 A;  1LT4 D;  1HNX Q;  5IWA L;  4DV7 Q;  1OO9 B;  4CKC A;  3J81 j;  1ENA A;  2PW7 A;  5EPL A;  5ELO A;  3CCV A;  4DV1 L;  4KMU C;  4WJ3 M;  1LTL A;  4OHJ A;  3ERO A;  3I90 A;  2K28 A;  1HH2 P;  2PI2 E;  4CKE A;  1XNQ Q;  1N34 Q;  3BDL A;  3HRZ C;  3GTJ H;  1X32 A;  4EGV A;  3J7A 5;  1TXY A;  4BWG B;  4U68 A;  3S14 H;  1C0A A;  1HHV A;  1CUK A;  1SEB D;  2F4V L;  3BG3 A;  3U4Z A;  3T1Y L;  3SEB A;  2MGS A;  3S16 H;  1HNW Q;  4XTC S;  1VQ6 A;  5DM6 3;  5M5W H;  3CXC A;  2F3W A;  1TWH H;  1KTK A;  4P2C B;  5JJL A;  2RKS A;  4MNO A;  3JAM i;  1MBY A;  3HOW G;  4ZQ3 A;  3STB C;  3S2D H;  1EZ8 A;  2ICE C;  5CGK A;  3FP9 A;  1D2B A;  5IYC H;  1WTR A;  2HIV A;  3ND8 A;  1Q3L A;  2LFN A;  4BY7 H;  2B2T A;  4KV6 A;  5J22 A;  1VQ9 A;  2E2I H;  4GNX B;  4HIO A;  3RUZ A;  1DGS A;  1E1T A;  1FGU A;  3MEH A;  3HOU G;  4L5Q A;  1EIY B;  1MSH A;  3GD7 A;  3NHH A;  3TBI B;  4LUO A;  3V96 A;  2DNC A;  3A8K E;  5I2Y A;  5C3X A;  3P7J A;  3GTO H;  1GO3 E;  3TS2 A;  3KF8 B;  1E1O A;  1O7Y A;  2ALY B;  2K5Q A;  3HG9 A;  4B3M L;  1JOQ A;  4N9P A;  3GTK B;  3HOY B;  2XRS D;  3MXP A;  1H9R A;  4C3I G;  4BY1 H;  3IRB A;  2DY8 A;  4UP7 A;  1U4R A;  3CAM A;  2VS1 A;  2BDN A;  3BZD B;  2OT2 A;  4KY7 A;  4YIJ A;  2YTV A;  3A74 A;  1FJG L;  2G9H D;  1A2T A;  3I55 A;  4MN3 A;  1PH5 A;  1NE3 A;  2F52 A;  5E7N A;  4JI7 Q;  4NPS A;  1M1K C;  2A19 A;  4RAU C;  4Y52 H;  1XPR A;  3GP7 A;  5LMN W;  2UXC Q;  1STH A;  4L63 B;  2ZXP A;  5EBD A;  4PV1 C;  3A5U A;  2K5V A;  5IT9 L;  3CC2 A;  3T4A C;  2SDF A;  1JCK B;  1H9J A;  3FKI B;  2N49 A;  3AU7 A;  3DM1 A;  3J7A V;  4FP5 D;  3K58 A;  5AFW A;  4A3K H;  3GTJ B;  4A3F G;  4HMJ A;  4O42 A;  2JA5 H;  3G71 A;  5K5P A;  1LT5 D;  1GKH A;  1AZP A;  4PG3 A;  1V9P A;  1YHA A;  4J15 A;  4FF1 A;  1YHQ A;  3L3O C;  1BCP B;  3J81 E;  4R4Q A;  3HOV G;  2AWO A;  1SYF A;  2VUM H;  4CDD C;  1TWA H;  1SRU A;  5IP7 H;  2LXK A;  3MXN A;  1QNK A;  1EY5 A;  3NEL A;  3BYT B;  4PZ6 A;  4NP5 A;  1GUN A;  1F77 A;  1E24 A;  1PA6 A;  2BCO A;  3QO2 A;  4BY7 B;  2R92 G;  1XNR L;  5CBA E;  4HN7 A;  2MJ8 A;  3TSS A;  4QL5 A;  3TDQ A;  1SE2 A;  2EY1 A;  2K6A A;  3I4M H;  1I3Q H;  4A3C G;  2C35 B;  2BOS A;  4DR2 Q;  3D31 A;  4DAY A;  1RTO A;  5IYD G;  4LJZ C;  2B2U C;  3B6Y A;  3GQB A;  2QIL A;  1IBL L;  5IYB G;  3DWP A;  4J6H A;  2VQF Q;  2UUA L;  3QOL A;  3Q22 A;  5F2D A;  5LL6 X;  1K28 A;  4Z9C B;  4K8J A;  4OEM B;  2ZJR A;  4A3G G;  3VYR A;  1SNC A;  4IFD J;  3LWE A;  3Q8D A;  5GQO A;  4IUP A;  3A5Z B;  3EA6 A;  3KBG A;  4F87 A;  2EYO A;  1A62 A;  2PZT A;  3ULJ A;  1VS0 A;  3NTH A;  4LAA A;  1J8I A;  4TKO B;  1EZ6 A;  1TR5 A;  1EYG A;  1II3 A;  1LTT D;  1WYD A;  2F0H A;  3PIO A;  1IBM Q;  2R7Z B;  4DNR B;  1B3A A;  2F0E A;  4OO1 G;  1N8R C;  2EJF C;  4G4K A;  4MIU A;  5G3L D;  3UDI A;  4ZKB B;  2E2H H;  4LF7 Q;  5FLX E;  4DV4 Q;  4GNX C;  4OEL B;  3TP7 A;  1EQQ A;  5TSS A;  2JN4 A;  4DUY L;  5M3M G;  5HY6 A;  1OXX K;  4DA2 A;  5CMD A;  4A3K B;  1CI3 M;  2K05 A;  2HQE A;  2AKW B;  1EU4 A;  1I4G A;  2JA5 B;  2B29 A;  2MP1 A;  1ML0 D;  1Z9F A;  2B39 A;  2A73 B;  1DD2 A;  2ZM6 Q;  4NMZ A;  3GTQ B;  2VUM B;  3SGI A;  4GKJ Q;  3RZO H;  3PO3 B;  4N9T A;  3PV0 A;  2I07 B;  1EY6 A;  4B3T Q;  1PHJ A;  1EY9 A;  2IX3 A;  5KYI A;  1Y1W H;  1KLU D;  2CFM A;  4BA1 I;  4TVA B;  1FYC A;  4BBR B;  4EQN A;  4FXD A;  3ER0 A;  2XGT A;  1T9H A;  2IY5 B;  3OTO L;  1V1O A;  4DFA A;  2MUY A;  1ILP A;  4DUZ L;  1PH9 A;  1SMY D;  2JE6 I;  2JEB I;  4G7O C;  1U0L A;  3J81 L;  3DEO A;  4CDE C;  1IKM A;  1K8A C;  4F88 A;  1AZQ A;  3RN2 A;  2K5D A;  3U58 A;  1IW7 D;  2ATW A;  4JI3 L;  2CQA A;  4LF5 L;  1QZG A;  3ULP A;  1S5E D;  3DLL A;  4JI8 Q;  1I94 Q;  1Y8N B;  1EIF A;  4KKU A;  3PIO 3;  4LF6 L;  4RWS C;  5NUC A;  3NQT A;  2UUB L;  1NMG A;  4JC0 A;  4AQY L;  1UE7 A;  1BCP C;  4OWX B;  2K5W A;  5IWA Q;  2QGQ A;  1GVP A;  1KDC A;  1CSP A;  3NP8 A;  3J7Z C;  4DV1 Q;  2B8F A;  4DV6 Q;  5IYC G;  5C5L A;  4BY7 G;  4X66 L;  2A68 D;  3DHQ A;  1UUP A;  3MA2 B;  1Y8O B;  1GHJ A;  3W5O A;  2C9O A;  4GOP A;  3AMU A;  1NCV A;  3JAM c;  5ELN A;  2YTX A;  2F4V Q;  5T1I A;  1BDO A;  3T1Y Q;  1O80 A;  4E6I A;  2CW0 D;  1WTW A;  1D1I A;  2F0D A;  2DGY A;  2Z4I A;  3NXW A;  1XYI A;  1D8L A;  1YZ6 A;  3CME A;  4MTK A;  3DEP A;  4GN5 A;  2GA4 B;  4HCE A;  1MIU A;  1GOZ A;  1GXD C;  4A3I H;  2NBF A;  4BY1 G;  3KOJ A;  2MPM A;  1AW7 A;  1HTP A;  1VQK A;  4FF2 A;  2OCE A;  3I8Z A;  2O5I C;  1UE6 A;  3W1G A;  5FLX L;  2WAQ E;  1TS4 A;  4FYD A;  2NZ1 D;  4QF4 A;  2F4I A;  2N3S A;  1JB3 A;  4X6A H;  4MTN A;  4CJ1 B;  1A8V A;  3FMC A;  4C3H H;  1WFQ A;  3CU7 A;  4H13 C;  2ZXR A;  3W3A A;  4OIJ A;  2NWG A;  4K6D A;  3GTG B;  5FLM H;  3H09 A;  4HIM A;  1YNJ C;  4C2M H;  3HEJ A;  5COR A;  1UE1 A;  4RKL A;  3PQI A;  2J4X A;  4DR3 L;  3K5O A;  4B3M Q;  1PFS A;  2EYP A;  3LGJ A;  3SK6 A;  1YBY A;  3IFD A;  3H3V C;  2WII B;  3M7N A;  2EYF A;  4DR5 L;  4DR7 L;  2FIN B;  1JOO A;  4A3K G;  3K0Y A;  2RDF A;  2LS0 1;  3IFT A;  3MXG A;  5CV7 A;  3SE0 A;  3CF5 A;  1FJG Q;  2RCF A;  1R9T H;  2R3Z A;  4X3U A;  1WVL A;  4KK7 A;  1GHK A;  5DLQ E;  1C7Y A;  1C8C A;  3BDC A;  2EYL A;  2KVM A;  4KHZ A;  4YWK A;  1AH9 A;  2VUM G;  1J6Q A;  2FHT A;  1SYE A;  3PF4 A;  2NVT H;  5IGB A;  5IP7 G;  1Q12 A;  4P75 A;  3VR4 A;  2D62 A;  5E3F A;  5DEH A;  1SLJ A;  4A93 H;  4XXE A;  3HS0 C;  1PFN A;  3NBI A;  2V4D A;  1SJH D;  5J1Z A;  5T1G A;  3ICE A;  4L5S A;  2XIW A;  2D0P A;  1YJW A;  1JJC B;  2Z9H A;  3OW7 A;  3I4M G;  2OEO A;  1PDQ A;  2CVR A;  3QIA A;  5EAY A;  5I2X A;  5IGG A;  1YNN D;  1HUN A;  2R93 B;  1JOR A;  4IPD A;  4RCN A;  1HA6 A;  4MZ9 A;  4LUV A;  1FL0 A;  3ITP A;  1KDB A;  4G7H C;  1L1O B;  4MHE A;  3VR3 A;  2PQA A;  2TSS A;  4KJN A;  1KHI A;  3GV3 A;  5COY A;  2F0N A;  4AYB E;  1PTO D;  1PRT B;  1EWC A;  4JBW A;  3P1H A;  1SBB B;  4C3J H;  3S1M H;  2J0T D;  1STB A;  1XNR Q;  1YVC A;  2F0J A;  4C56 C;  2LY7 A;  2XNA C;  4ODG A;  1JQY D;  3IKJ A;  4WJ4 A;  2VB2 X;  4QQB X;  5IGF A;  2L0C A;  2WAQ G;  4C2M B;  3IL8 A;  4XIG S;  5C44 B;  2XN9 C;  2B2V C;  5A2Q L;  3JAM L;  1LO5 D;  1QVG A;  1QG7 A;  3LX0 A;  2XWJ B;  1IBL Q;  1VQJ A;  1VQ4 A;  3CPW A;  2UUA Q;  3CC4 A;  2VB3 X;  4ZK9 B;  3MEF A;  3LNN A;  2N78 A;  3BDO A;  1HZ9 A;  2A6H D;  2QCP X;  5G3L F;  1PVO A;  1X55 A;  3MHB A;  4TSS A;  4ILW A;  1EWI A;  1BOS A;  3MXN B;  5JJZ A;  5JPM C;  4ZUI A;  1NMF A;  2KCT A;  3MTS A;  3I3C A;  1JWM D;  2KCC A;  1PTO H;  4F7X A;  5AJ3 L;  1TQO A;  3TS0 A;  1LTG D;  4JI5 L;  1MGS A;  2ZTD A;  5E4W C;  3DWA A;  1QCB D;  2RHQ B;  2I5L X;  4HID A;  1XX8 A;  1A6X A;  4A93 B;  1Y1W G;  3HOW B;  4X64 L;  4ZCK A;  4DUY Q;  3CQZ H;  5M5X H;  1XTC D;  4DAY B;  4P72 A;  1I4X A;  2IW3 A;  4I7Z C;  1U4L A;  4GLA C;  5FO7 B;  1X6O A;  3PSI A;  4A3L H;  1H9M A;  3HOU B;  1D5M C;  2K75 A;  3S1Q H;  4QJF A;  1DOK A;  1F9S A;  3S1R H;  3KLS A;  3V05 A;  3Q6S A;  1S5D D;  3BVM A;  1KL9 A;  1SMX A;  2I5M X;  4C3I B;  2M9V A;  3MAQ A;  1S4Z A;  3OTO Q;  1U4P A;  4B9X A;  4DUZ Q;  3PGZ A;  1JJ2 A;  1Q46 A;  1QUQ A;  2NVY B;  3GTP H;  5C4Z A;  1CA6 A;  3VR2 A;  3VR5 A;  1LM0 A;  4QIW B;  1YIJ A;  4KKT A;  1CHQ D;  1EYD A;  4JI3 Q;  1EY7 A;  4LF5 Q;  1XXG A;  1G6Z A;  4XYO A;  3S15 B;  1X3E A;  1HTL D;  1M4V A;  3T13 A;  4LF6 Q;  3VYS A;  2AUJ D;  1VQE A;  5IT9 c;  1SMY C;  4B3T L;  1VMP A;  5BN3 A;  4AQY Q;  1FR3 A;  2RQX A;  4RGN A;  1IW7 C;  1SDF A;  3EIV A;  4XT3 B;  1L1O C;  4A3F B;  1XJV A;  4BS9 A;  1NR2 A;  2GVA A;  4A3I G;  2D5D A;  3DM3 A;  2K33 A;  4LW1 A;  3PUY A;  2VQE L;  3M4O H;  2NB0 A;  2K5H A;  4I65 A;  1PRT C;  1VQB A;  2DN8 A;  2QEJ C;  1T5X D;  2YU9 H;  2SEB D;  4X66 Q;  2JQO A;  1K73 C;  4WJW A;  5C0X I;  2OTJ A;  4C3H G;  2QDL A;  4ZRZ A;  2EXZ A;  3BZK A;  1XPU A;  2BDO A;  5C3W A;  5FLM G;  5EJW A;  1CM9 A;  3CMA A;  4R4I A;  2YV5 A;  4JYA L;  1F9P A;  2AQ2 B;  3KDF A;  3N52 A;  1WTV A;  5C3E H;  2R92 B;  2SOB A;  1E3P A;  4AH6 A;  2Z1C A;  4F8M A;  3D4R A;  5M5Y H;  3EVQ A;  3TN2 A;  4DV6 L;  4DV2 L;  2Z6B A;  2KJX A;  4UHV A;  1B2T A;  1Q82 C;  2JK8 A;  1G2S A;  3RR5 A;  3OPO A;  1P16 A;  2NVQ B;  5IGE A;  1NR4 A;  3NEM A;  4CDF C;  3DMU A;  1OXU A;  2A8V A;  5L37 A;  3AQQ A;  1L2F A;  3EQL C;  2K50 A;  1D6E C;  4A3G B;  1WCM H;  3C1F A;  3HFZ B;  2OQK A;  4GZY C;  4OON A;  3HOZ H;  1PZI D;  1G2T A;  1RIP A;  1HFN A;  4DR3 Q;  3J80 i;  3GTP B;  3G4S A;  4A93 G;  4GOP B;  1Q8I A;  1L0X B;  4DR5 Q;  3CCQ A;  4DR7 Q;  2M00 A;  1G91 A;  2EYM A;  1VQ8 A;  2JA7 H;  5LMU L;  4BBS H;  1AP0 A;  3S2H H;  2F0V A;  1FD7 D;  2RHS B;  3MC0 B;  1KD1 C;  1EYA A;  3WOE A;  1MKH A;  1CFM A;  1B1Z A;  1XTD A;  4YWM A;  2EZV A;  2WKC A;  5JOB A;  3PUV A;  2LXJ A;  4NB3 A;  2KEE A;  1LV9 A;  1W3S A;  5M3M B;  3RN5 A;  1N36 L;  3E0J A;  2IT1 A;  2MHV A;  3HKS A;  3NK9 A;  2DY7 A;  4XYQ A;  3A8J E;  4ALP A;  1NJI C;  3K6O A;  1CA5 A;  2J7Z A;  1VQF A;  3WOF A;  4C3J G;  3BJU A;  2YU9 B;  1A3T A;  2ZJP A;  1PTO F;  3H91 A;  4DR6 L;  2I0Q A;  3P75 A;  4DAM A;  1KQS A;  4JPB W;  1E2W A;  1O7Z A;  1D5Z C;  1EOT A;  4ME3 A;  2ZTC A;  4IAL A;  2KOL A;  3BZC A;  4R9W A;  5E4X A;  5C3E B;  2KEN A;  4LUZ A;  4XQQ A;  4B08 A;  4QGU A;  1Y69 U;  2B2W A;  3O13 A;  4CJ0 B;  1IBK L;  4IJH A;  3I4L A;  5EKL A;  4YCV A;  3X3N A;  3VR6 A;  2F0O A;  3J81 c;  1YNN C;  4OGQ C;  3QG1 A;  4X65 L;  3FHW A;  4K6L A;  2RDH A;  2RCN A;  4UP8 A;  1K3B C;  2DUD A;  3S14 B;  1CHP D;  1SE8 A;  2LMC B;  3VDY A;  3QR8 A;  3TRZ A;  1Q7Y C;  2L11 A;  4HIK A;  2Q2U A;  3S16 B;  2EYJ A;  2Q2I A;  1S5C D;  1ZKO A;  2F0T A;  2GVB A;  5M5W B;  2UXB L;  3SR1 A;  1TWH B;  2EJM A;  4IUQ A;  1DCZ A;  4KD3 A;  2NYZ D;  2XVS A;  4DR4 L;  4R4O A;  3PO2 H;  1PMR A;  3LWU A;  1KAB A;  3S2D B;  4QUC A;  3RMH A;  2VW9 A;  4BBS B;  2IHF A;  3S2H B;  2AWN A;  4R4C A;  5D14 A;  1ENC A;  5JJI A;  1ASZ A;  1HZC A;  1GUG A;  4A3M H;  2JYO A;  4QY7 A;  4IQZ A;  1YI2 A;  2E2I B;  4A3L G;  5IOD A;  3K0X A;  5ELD A;  1ICW A;  1Y1V H;  3EFX D;  1L0Y B;  5AJ3 Q;  3GTO B;  4JI5 Q;  1JOK A;  1NTG A;  3SK5 A;  5I6Y A;  2VXW A;  2ID0 A;  4X64 Q;  4IZ8 A;  1NAP A;  1E22 A;  2PW5 A;  1MJE A;  4N8F A;  5EBC A;  2MO1 A;  3OYY A;  4BY1 B;  2BA0 A;  1J9O A;  3CRK C;  1S3O A;  2CKZ B;  4Y7N H;  4OWT B;  5C6A A;  2H4O A;  1DXM A;  3M85 A;  5H1S E;  5JEA H;  4IN3 A;  5FLX c;  4DK6 C;  1PV4 A;  4GOP C;  3I91 A;  1LLR D;  2CWP A;  1LTI D;  2N88 A;  1TWC H;  3A7L A;  3QJY A;  4LFC L;  4R1J A;  1TY0 A;  4DAP A;  2IJ0 A;  1Q1B A;  3AFP A;  1RCV D;  2AMC B;  3T56 B;  4H02 A;  3UE1 A;  4P73 A;  1N33 L;  1WD1 A;  2NTT A;  2FJ2 A;  1GUW A;  1Z7T A;  4LF8 L;  2FMM A;  2PZU A;  3RD4 A;  3T16 A;  1HJP A;  2GN5 A;  3ONA B;  2ASB A;  1PZK D;  3Q23 A;  4KJO A;  2Z4H A;  3R2I A;  2CCZ A;  3CKI B;  3KFU A;  4KN7 C;  4KHV A;  1DJR D;  5E1F A;  5D3D A;  1LUZ A;  1XMO L;  1H9S A;  3RLF A;  4K2L A;  3QB3 A;  4APV A;  5IGC A;  3C3L A;  4JCV E;  2SNM A;  4FXG C;  2EDG A;  1AE2 A;  2CWA A;  1TWA B;  3GV6 A;  1X9N A;  3TP8 A;  5JAV A;  4YY3 L;  1A3U A;  2EIF A;  4K8I A;  4RMF A;  1PYW D;  3A0J A;  4L5R C;  5C3E G;  2HDM A;  5KEE A;  1QOH A;  5DNF A;  2ZTE A;  3A54 A;  3I4M B;  2VQE Q;  1I3Q B;  1ESF A;  2X69 A;  2ZT9 C;  4DV3 L;  1EQR A;  2F0F A;  1WD0 A;  4BXX H;  1EUJ A;  4FNF A;  1EIG A;  1JB7 A;  1O78 A;  1QUQ B;  2E76 C;  4X3K A;  1PFB A;  2B2Y C;  2A1A A;  1WCM G;  4JYA Q;  1STG A;  3HOZ G;  4Y7N B;  1U9R A;  1B9N A;  4JBJ A;  5CR3 A;  3CP0 A;  3RZD H;  1Q8K A;  1H9K A;  4G7Z C;  4JOI A;  4ZKC B;  5KNB A;  1PH2 A;  1DZ1 A;  1ZYR C;  1ICF B;  1C48 A;  5C0X H;  2JA7 G;  1TWC B;  2F3V A;  5LHY 1;  4BBS G;  2Y0S E;  4DV2 Q;  2DJG C;  4ME5 A;  2WAQ B;  1VQC A;  1D5X C;  1QVC A;  5JVG 3;  3NPP A;  3GTM H;  1SSO A;  4HJ5 A;  2E2H B;  2B2U A;  3CCL A;  4IJL A;  5C4X H;  3E6Z X;  1HUM A;  1LT6 D;  1BNZ A;  3KJO A;  1C9O A;  4YCW A;  1UE5 A;  4RFB A;  1PH7 A;  4YHH L;  3J80 E;  2IL8 A;  3AFQ A;  5EGT A;  5IP9 H;  3DXJ C;  2A74 C;  1V1P A;  2KBN A;  3EBE A;  5LMU Q;  4Q5V A;  5JJK A;  3D6W A;  5I6W A;  2UXD L;  2FMC A;  1ZXT A;  1DOL A;  1IYJ B;  3KLR A;  1R4P B;  4I7A A;  1SE4 A;  1A63 A;  3RZO B;  1NY4 A;  1SAP A;  1CZG A;  1Y1W B;  2L4N A;  2Q8T A;  1EY0 A;  3P20 A;  1N36 Q;  2B63 H;  1JR0 D;  3E3X A;  3CCS A;  3W1B A;  3DWQ A;  2X6G A;  2WB1 E;  4ZUJ A;  1Q81 C;  3GDE A;  4C1N I;  5FO8 B;  2DJF C;  4DV0 L;  1TU2 B;  4JBM A;  4RCO A;  1GM5 A;  3G7L A;  2E2J H;  1S40 A;  1ET9 A;  1SNM A;  5KYL A;  1SN8 A;  4DR6 Q;  2X6L A;  1KXL A;  2RF4 A;  1OXV A;  1UAP A;  1B9M A;  5EKK A;  4DNI A;  1M90 C;  4B9W A;  3CCE A;  3PIP A;  4DK3 C;  3SVM A;  1BF4 A;  4TQU S;  3I73 A;  4UY8 C;  2AHO B;  1VQD A;  4FO2 A;  3PO2 G;  1QE6 A;  4AYB B;  3A56 A;  1IBK Q;  1AN8 A;  2UUC L;  1SYB A;  4HJ9 A;  2F0W A;  2NVX H;  4X65 Q;  2IPK D;  1VQL A;  4A3M G;  3BYY B;  4OL7 A;  1WTQ A;  4QMG A;  2HCI A;  2RBM A;  3EN2 A;  2Y0S G;  4M8A A;  5FK9 C;  1Y1V G;  4JI2 L;  4QB4 A;  3J7A F;  1EEI D;  5C4X B;  1CKN A;  4DF7 A;  4K5W A;  4EQP A;  1SYD A;  2UXB Q;  3PUZ A;  1IXR A;  3M7G A;  3OIP A;  5GAG C;  1SFO H;  1RJT A;  4NXN L;  4DR4 Q;  4FVM A;  1IYU A;  2C5C A;  4JK1 C;  4K14 A;  1VQH A;  4A3I B;  1VQN A;  2AUK A;  1S72 A;  3I4N H;  1VQG A;  1K8O A;  3H3V I;  1EU3 A;  4KHP L;  2BA1 A;  5HGQ A;  4FF3 A;  5JEA G;  3CCM A;  3CHB D;  2G5D A;  3VA7 A;  4C3H B;  2KED A;  2BH2 A;  4YWL A;  5DAU A;  1PXU A;  2OF1 A;  4O0A A;  5BN4 A;  5GAD C;  3HOX H;  4GN4 B;  1WTP A;  1B3Q A;  2OXP A;  4YCU A;  3J80 L;  1KIX A;  2JA6 H;  1TS5 A;  2KHI A;  2SNS A;  4IO9 A;  3PIP 3;  2MFI A;  1YJ9 A;  2LSS A;  4A4I A;  3HKZ E;  2E2J B;  2PQE A;  1KAW A;  2Q2T A;  4JI4 L;  3NUC A;  3TEH B;  5C4H A;  1HA5 A;  1VQI A;  1UEA B;  5KGU A;  1UNS A;  2WB1 G;  1IKL A;  5GRO A;  2KCM A;  1R9T B;  2F0Q A;  5FOB B;  3S1N H;  1SNQ A;  5M3F H;  4A3J H;  4PZ8 A;  4K2K A;  5DM7 3;  4KI0 A;  5EPJ A;  4LFC Q;  2WP8 J;  2FXQ A;  4L5T A;  1YNX A;  4XT1 B;  3FDT A;  1N33 Q;  2A5H A;  1CQV A;  2NVT B;  2RA4 A;  4HMI A;  4DNT B;  1HQR D;  3U9O A;  4LF8 Q;  1N32 L;  2ZXO A;  4DKA C;  4LFB L;  1BR9 A;  2PZW A;  4RGO S;  2F0I A;  2ICI A;  2NVX B;  1LT3 D;  4ZYS A;  3H15 A;  1HNZ L;  1I6V C;  2QKI C;  2WKD A;  2EY6 A;  1X3Q A;  3EJI A;  3NE5 B;  1B70 B;  3I70 A;  5FJ8 H;  1XMO Q;  1PH4 A;  1E2V A;  3WWV A;  4IPC A;  1LTA D;  4BXX G;  4NXM L;  1W2B A;  2NN6 I;  4LWC A;  3FRP B;  1LYL A;  3IAY A;  3KF6 A;  2M2L A;  1LAB A;  4A3B H;  4YY3 Q;  1O7L A;  1K9M C;  3KBX A;  5I4D A;  3KJP A;  4LNQ A;  5C4J H;  1B53 A;  2K7V A;  4C3J B;  2IX1 A;  1WTH A;  3S1M B;  2QEX A;  5K36 H;  3A55 A;  4IPG A;  1UWV A;  3D3R A;  4GKK L;  5I9O A;  4P74 A;  2IHE A;  4AYB G;  2B2T C;  3E9H A;  5C0X G;  1TII D;  4DV3 Q;  1IL8 A;  2E5L L;  1LTR D;  1KC8 C;  4QCL A;  3MFY A;  1PFM A;  3R93 A;  3PUX A;  4HTH A;  2E75 C;  2CQO A;  4X3S A;  1RKN A;  4K5X A;  1YHB A;  3M4Y A;  2OTL A;  5C4X G;  3RLN A;  2L15 A;  1XWE A;  2F3I A;  4A3D H;  1I50 H;  1U4M A;  4KY6 A;  4JW0 A;  1VF7 A;  1MJC A;  2KCN A;  1H9S B;  3PF5 A;  2K32 A;  1STY A;  2E74 C;  5GAH C;  1K0S A;  1MD2 D;  4LMQ D;  1L0W A;  2EY5 A;  3HKZ G;  3S1N B;  3OWF A;  3OSO A;  3NEN A;  5IP9 G;  4A3J B;  4Q0F A;  3T1H L;  1EY8 A;  5CV6 A;  1AE3 A;  3PUW A;  1FNU A;  3C46 A;  5EKI A;  4L6T B;  1PTO B;  2JA8 H;  1QZH A;  2CH4 A;  4G57 A;  4J8Q A;  3ZYY X;  3GO5 A;  2B2V A;  4K0K L;  4DXG A;  1KAA A;  2O5J C;  2R61 A;  3CQZ B;  3Q0A A;  2WV6 D;  2B63 G;  3D4W A;  5M5X B;  5ELE A;  1QNU A;  3TME A;  1B50 A;  2MO0 A;  3K5L A;  3HOY H;  4JI6 L;  1STA A;  4YHH Q;  1BCP D;  2K14 A;  2A68 C;  2PNH A;  1FVI A;  4HJ7 A;  1ESR A;  4IFD I;  1RDP D;  4EQO A;  1PLF A;  1D7Q A;  3S1Q B;  2UXD Q;  1ZEQ X;  4A3E H;  3QWN A;  2CW0 C;  2LKV A;  3HP3 A;  3NBH A;  1TY2 A;  2IX0 A;  3OIQ A;  1IYV A;  3S1R B;  1GD7 A;  1PYB A;  4KTA A;  1Q90 A;  5C4J B;  4OX9 L;  4JI1 L;  2L1B A;  3MVV A;  3D8G A;  4GN3 B;  4NKL A;  4AIM A;  2EVB A;  2PMZ E;  3TQY A;  4ZLT F;  2XSC A;  5IOC A;  2H1E A;  2K04 A;  5FO9 B;  3FKI H;  2A69 D;  1XPO A;  3CRL C;  2WFW A;  3CC7 A;  3S9W A;  4CGY B;  4RGM A;  4DV0 Q;  1SND A;  4FDB A;  2PO4 A;  3TP6 A;  3S24 A;  1ROD A;  1B7Y B;  2EYH A;  1V8Q A;  1G8Z D;  2XRQ D;  3SXH A;  2PPB C;  2R7F A;  1W6J A;  5A35 A;  2L5T A;  3MWY W;  3V2T A;  4A3D B;  1I50 B;  5HUR A;  5KRU A;  3J7Y W;  4LK1 C;  1G51 A;  1V1P B;  2XWB B;  2Q2H A;  5CV9 A;  4B3R L;  2MQH A;  1Y8P B;  3L9A X;  1YNJ D;  1E7Z A;  1BXT A;  4HJA A;  1S5B D;  3HZX A;  3TRE A;  1V1Q A;  3E9I A;  3I4N G;  1RD9 D;  3M4O B;  2UUC Q;  1ONL A;  2F0M A;  5JEA J;  1E2Z A;  2JA8 B;  2NUC A;  3ND9 A;  1CKM A;  1R4Q B;  2F03 A;  5IGD A;  2I46 A;  4JI2 Q;  1ET6 A;  3BVZ A;  3X3M A;  2EXD A;  3HOX G;  1NUC A;  2HHH L;  2KHJ A;  3BVG A;  1ENF A;  2OQ0 A;  2Z6K A;  3AYH B;  1YJN A;  2KA7 A;  2JA6 G;  3FVQ A;  1TVX A;  4C1N K;  5KNC A;  1X65 A;  4NXN Q;  1BKB A;  1EOV A;  5ELF A;  1L1O A;  4ID6 A;  3F2C A;  5M5Y B;  1F2Z A;  4A3E B;  4KHP Q;  1I5F A;  1SR3 A;  1Y14 B;  3K80 C;  3NWS A;  3T51 B;  4IUV A;  5M3F G;  3QOJ A;  4JG2 A;  2JSO A;  4A3J G;  2HT1 A;  3NTK A;  2HUG A;  2R7Z H;  2E8G A;  1VQM A;  2A6E D;  4IUU A;  4DV5 L;  1WCM B;  4KKS A;  3ZJY C;  1H95 A;  1PTO C;  1PZJ D;  3HOZ B;  3TZD A;  4FF4 A;  2HQL A;  2B3G A;  3WDN A;  3H3V H;  1A0I A;  1FNW A;  4U67 3;  1JJG A;  1QWY A;  1B44 D;  1EY4 A;  1JE5 A;  3NSW A;  4ABN A;  2JA7 B;  3F2D A;  4JI4 Q;  1GJX A;  1CKN B;  1MHW C;  4UDU C;  5D65 A;  4JV5 L;  1HR0 L;  1SE3 A;  1A3V A;  1IL2 A;  4LF4 L;  4CKB A;  1SYC A;  1EFW A;  1VCI A;  5FJ8 G;  4HR7 B;  3GTQ H;  2PQA B;  4OIK A;  1SXT A;  1HZB A;  1BVS A;  2A6H C;  3PO3 H;  1S5F D;  2KEC A;  4A3B G;  3S17 H;  3MFG A;  4B3S L;  2RSO A;  1N32 Q;  4HJ8 A;  4BBR H;  3N6R A;  5J39 A;  3OWE B;  4JOI C;  1VQP A;  2HCC A;  4LFB Q;  5CC4 A;  3D0F A;  1HNZ Q;  5K36 G;  3H6M A;  5C0X J;  3G6J B;  2F0S A;  1NNX A;  1DYQ A;  3I4O A;  2F0G A;  4DK1 A;  3L2P A;  4GLV B;  2RSN A;  3K57 A;  1I4R A;  3L7Z C;  2EPB A;  4H0L C;  1I4Q A;  2RVL A;  1TS3 A;  1KLG D;  1G29 1;  4NXM Q;  5C5M A;  2OWO A;  4WFN 3;  3D4D A;  2Q8I B;  4RHR A;  1LTB D;  2VY3 A;  4A3D G;  5LL6 S;  1K83 H;  1OXS C;  1X54 A;  3C1E A;  3UDF A;  3W2D A;  1HCZ A;  1SRO A;  5CV4 A;  2K01 A;  2L12 A;  5BR8 L;  3I56 A;  3F2B A;  4IUT A;  3RNU A;  3U50 C;  4CJ2 C;  1TT2 A;  1U5K A;  4GKK Q;  3URY A;  1XMQ L;  2NN6 H;  4ULL A;  2E5L Q;  4KLK A;  3G6E A;  1X3P A;  2JA8 G;  4PMB A;  4OXP A;  1M8A A;  3E0E A;  1F2L A;  4KD4 A;  3K59 A;  1IHZ A;  1YIT A;  3I7F A;  4PNY A;  1QIL A;  3Q24 A;  3BU2 A;  2QA4 A;  4LF9 L;  3PO2 B;  3KK7 A;  4HSP A;  2B8G A;  5ELC A;  2N55 A;  3TP5 A;  1VDZ A;  2PNR C;  4R8I A;  1SJE D;  4ZAI A;  3K81 C;  2PYK A;  2AQ1 B;  3HOY G;  5FKA C;  4A3M B;  3CCR A;  3KF6 B;  1TKW B;  2JJQ A;  3T1H Q;  2Y0S B;  3MZ5 A;  1Y1V B;  4PMW A;  2KHS A;  1I4H A;  1SNP A;  1BCP F;  4A3E G;  1Q1E A;  4JI0 L;  3PCO B;  3KYH C;  4UPA A;  2K4K A;  4BA2 I;  3S17 B;  4DR1 L;  2PI2 A;  1EYC A;  3VYU A;  2JXM B;  1WJJ A;  4CBV A;  1MSG A;  3GTG H;  4FXK C;  1PH3 A;  4OO1 I;  3HGB A;  3L0O A;  1JE4 A;  4K0K Q;  1PH8 A;  3AB9 A;  1JC7 A;  1NSN S;  1ASY A;  4EQ5 A;  3FKI G;  3TZU A;  4JI6 Q;  4H7B A;  3R3O A;  2AQ3 B;  2Q8R E;  3M4P A;  2K1B A;  3CCU A;  2IWH A;  2PCF B;  3K7A H;  1Z6H A;  1PYS B;  2ZJQ A;  2VZA A;  2O2L D;  1KNA A;  2D9U A;  2CH4 W;  1PRT D;  3SK8 A;  2BE5 D;  2K52 A;  1J5E L;  1F9R A;  1Q86 C;  3J80 c;  2WAC A;  4OX9 Q;  1E0B A;  1K83 B;  4JI1 Q;  4X62 L;  5LMN L;  4IPH A;  2UU9 L;  2BH8 A;  3MXU A;  5D3I B;  4IFD H;  3U4V A;  4OWW B;  2H5X A;  2WB1 B;  1K3R A;  2K5N A;  4R4T A;  4DU9 A;  1EL0 A;  2L9H A;  4KN4 C;  2E2D C;  4LFA L;  3T53 B;  1I6H H;  5HGT A;  2EJG C;  5JPN C;  4XQJ A;  1G6P A;  3KDF B;  2MNA A;  4PMC A;  3RLO A;  2A69 C;  2R93 H;  2G9D A;  1HFG A;  4DGZ A;  1HNX L;  5CYU A;  3E5S A;  3ULL A;  4DV7 L;  4IOA A;  2F0U A;  3NQI A;  1KRS A;  4GNX A;  2QDB A;  3M3Y H;  3ERS X;  4B3R Q;  5A2Q E;  3JAM E;  4L8J A;  1BBU A;  1BUV T;  4J1M A;  3NBH B;  1K8M A;  2ENB A;  1XNQ L;  1HRJ A;  3H0G H;  3U9S A;  3KF8 A;  1N34 L;  2D2C C;  2O4X A;  3STB D;  4HSV A;  2HD3 A;  1TWF H;  3H94 A;  4K5V A;  4RGT A;  2KUM A;  1EFI D;  4XDX A;  3ERQ A;  4QUF A;  4CDC C;  2R7Z G;  3A8I E;  4DXF A;  1HNW L;  2YYZ A;  5C44 H;  3AEV A;  4A75 A;  2Z8L A;  2HHH Q;  4S3S A;  1TWG H;  5IY0 A;  2HIX A;  1HZA A;  1BO0 A;  1PH1 A;  1I4P A;  4V19 0;  2YTY A;  4TRD A;  3RZD B;  1LTS D;  1KDA A;  3K5M A;  3K7A B;  1W6K A;  5CV8 A;  3M4Q A;  2JA5 G;  1AFP A;  2HDL A;  5BN5 A;  4DK0 A;  3CD6 A;  5GAE C;  1KNE A;  2WIN B;  3GTM B;  4PQX A;  1TS2 A;  1VMC A;  1FNV A;  2R6G A;  1A15 A;  5IE8 A;  3KUP A;  1DOM A;  1CSQ A;  2R7D A;  4DV5 Q;  1EWH A;  1FGB D;  4NW2 A;  4O1N A;  1QB5 D;  3PO3 G;  4M1U B;  2B2Y A;  2K03 A;  3HOW H;  4HCS A;  4EVO A;  1WTO A;  4BBR G;  1JWU D;  5KND A;  3HKZ B;  3OOC A;  3KLS X;  3UDG A;  1KRT A;  1VQ5 A;  4A76 A;  1RHP A;  1Z47 A;  1I6H B;  1CK1 A;  4O2D A;  4JV5 Q;  4DPG A;  1HR0 Q;  2A6E C;  4UP9 A;  1OTC A;  3HOU H;  4LF4 Q;  4JI7 L;  4HAE A;  3PMF A;  2UXC L;  2QF7 A;  2F0L A;  1HXY D;  3KLW A;  2B63 B;  1VQA A;  4DN4 M;  3M3Y B;  4IUR A;  1PH6 A;  1ILQ A;  3D6C A;  4B3S Q;  2F1M A;  1JT8 A;  1STE A;  2F0K A;  4C3I H;  1YEZ A;  3H0G B;  1DON A;  3FPU B;  1EQT A;  2QW7 A;  1QVF A;  2NZO A;  2NVY H;  2NTS A;  3A7A B;  3SHL A;  1TWF B;  1X3F A;  4CHT B;  1K8G A;  2NN6 G;  1F2M A;  1K0R A;  4GLX A;  2CHB D;  3J81 i;  1BBX C;  1WI5 A;  2KQ3 A;  4RA8 A;  2L55 A;  1JIC A;  1TWG B;  4RG1 A;  3S15 H;  3NWT A;  3OHX C;  1JMC A;  5CBE E;  1DM0 B;  4DAV A;  2FFK B;  1WOC A;  3OMG A;  3F2U A;  3GTL H;  1QJO A;  1WTX A;  2JA9 A;  4JBK A;  1NBW A;  1N9W A;  3K5N A;  1JWS D;  2XTI A;  3F8T A;  1P8L A;  2V1C C;  4P71 A;  4RHS A;  5ELB A;  4A3F H;  1EEF D;  5BR8 Q;  5KIX A;  4POG A;  1BQQ T;  4JVZ A;  4PZ7 A;  4H44 C;  3JC6 6;  3UDX A;  3SDZ A;  1XMQ Q;  4UAI A;  4DR2 L;  1HQM C;  4NDX A;  1CKO A;  4GS3 A;  3HOV H;  2P5Z X;  3OMC A;  3FPP A;  5IIF A;  1SNO A;  2VQF L;  2EY2 A;  1SFO B;  4LF9 Q;  3I4N B;  1B4O A;  1EIH A;  5ISR A;  2JP1 A;  1AEX A;  2R92 H;  3CPF A;  3CW2 C;  5CV5 A;  2RDG A;  4V0B A;  2D0O A;  5J3B A;  4A3C H;  3C2P A;  3K8A A;  5M9O A;  2F0P A;  1IBM L;  4N8X 1;  4RKB A;  1VQO A;  3DUZ A;  5IYD H;  3HOX B;  1A2U A;  4WRD A;  4JI0 Q;  2VNU D;  2NVQ H;  4WOR A;  5I9P A;  4DR1 Q;  4KY5 A;  5IYB H;  4DV4 L;  4XQN A;  4LF7 L;  2JA6 B;  1VF5 C;  3NTI A;  1GUT A;  1CQF A;  3UE0 A;  4A3G H;  1PRT F;  2DNE A;  1X3G A;  4EX5 A;  4HED A;  4X3T A;  1UEB A;  1CZW A;  1STN A;  1MI2 A;  1HR0 W;  4IFD G;  3BS1 A;  3M9B A;  2JEA I;  1EQV A;  2NZH A;  4R8N A;  1CTM A;  2ZM6 L;  1F9Q A;  4RH6 A;  1C4Q A;  4IUN A;  3UI2 A;  1X56 A;  3R2T A;  5M3F B;  3K7U C;  1B8A A;  3CCJ A;  3R8B A;  5JVH 3;  4POF A; 
#chains in the Genus database with same CATH homology
 4OO1 H;  3GTL B;  1LAC A;  1T5E A;  2EE1 A;  2B2W C;  2PMZ B;  5EQ0 A;  3VA5 A;  1RF2 D;  1SYG A;  5EPK A;  3SK4 A;  5IT9 E;  2BE5 C;  1CT1 D;  1GUO A;  1V43 A;  3HOV B;  2EOT A;  1F2Y A;  1D1K A;  1ZYR D;  3VYT A;  2TMP A;  1HPC A;  3FEW X;  1GUS A;  1OXT A;  3I72 A;  4A3B B;  1RTN A;  1LT4 D;  1OO9 B;  4CKC A;  1ENA A;  2PW7 A;  5EPL A;  4KMU C;  4OHJ A;  3ERO A;  3I90 A;  2K28 A;  4CKE A;  3BDL A;  3HRZ C;  1X32 A;  4EGV A;  4BWG B;  4U68 A;  1HHV A;  1SEB D;  3BG3 A;  3SEB A;  2MGS A;  4XTC S;  5DM6 3;  2F3W A;  4P2C B;  1KTK A;  2RKS A;  1MBY A;  4ZQ3 A;  1EZ8 A;  2ICE C;  5CGK A;  1D2B A;  1WTR A;  3ND8 A;  1Q3L A;  2LFN A;  2B2T A;  4KV6 A;  5J22 A;  3RUZ A;  3MEH A;  1MSH A;  3GD7 A;  3NHH A;  3TBI B;  3V96 A;  2DNC A;  3A8K E;  5I2Y A;  5C3X A;  3P7J A;  3HG9 A;  1O7Y A;  2K5Q A;  1JOQ A;  4N9P A;  3GTK B;  3HOY B;  2XRS D;  3MXP A;  1H9R A;  4C3I G;  2DY8 A;  1U4R A;  2BDN A;  3BZD B;  2OT2 A;  4KY7 A;  4YIJ A;  2G9H D;  1A2T A;  4MN3 A;  4RAU C;  3GP7 A;  1STH A;  4L63 B;  2ZXP A;  5EBD A;  4PV1 C;  5IT9 L;  3T4A C;  2SDF A;  1JCK B;  1H9J A;  3FKI B;  3AU7 A;  3DM1 A;  3J7A V;  4FP5 D;  3K58 A;  5AFW A;  3GTJ B;  4HMJ A;  4O42 A;  5K5P A;  1LT5 D;  1AZP A;  4FF1 A;  3L3O C;  1BCP B;  3J81 E;  2AWO A;  1SYF A;  3MXN A;  1QNK A;  1EY5 A;  3BYT B;  4NP5 A;  1GUN A;  1F77 A;  2BCO A;  3QO2 A;  4BY7 B;  5CBA E;  4HN7 A;  2MJ8 A;  3TSS A;  3TDQ A;  1SE2 A;  2EY1 A;  2K6A A;  2BOS A;  3D31 A;  4DAY A;  1RTO A;  4LJZ C;  2B2U C;  3GQB A;  2QIL A;  3DWP A;  4J6H A;  3QOL A;  3Q22 A;  5F2D A;  5LL6 X;  4Z9C B;  4K8J A;  3VYR A;  1SNC A;  4IFD J;  3LWE A;  4IUP A;  3EA6 A;  3KBG A;  4F87 A;  2EYO A;  2PZT A;  3NTH A;  4LAA A;  1J8I A;  4TKO B;  1EZ6 A;  1TR5 A;  1II3 A;  1LTT D;  2F0H A;  2R7Z B;  4DNR B;  1B3A A;  2F0E A;  4OO1 G;  2EJF C;  4G4K A;  4MIU A;  5G3L D;  4ZKB B;  5FLX E;  3TP7 A;  5TSS A;  1OXX K;  4DA2 A;  5CMD A;  4A3K B;  1CI3 M;  2K05 A;  2HQE A;  1EU4 A;  1I4G A;  2JA5 B;  2MP1 A;  1ML0 D;  2B39 A;  2A73 B;  1DD2 A;  4NMZ A;  3GTQ B;  2VUM B;  3PO3 B;  4N9T A;  3PV0 A;  2I07 B;  1EY6 A;  1EY9 A;  2IX3 A;  5KYI A;  1KLU D;  4BA1 I;  4BBR B;  1FYC A;  4EQN A;  4FXD A;  1V1O A;  4DFA A;  2MUY A;  1ILP A;  1SMY D;  2JE6 I;  2JEB I;  4G7O C;  3J81 L;  3DEO A;  1IKM A;  4F88 A;  1AZQ A;  2K5D A;  1IW7 D;  2CQA A;  1S5E D;  1Y8N B;  4KKU A;  3PIO 3;  4RWS C;  5NUC A;  3NQT A;  1BCP C;  2K5W A;  1KDC A;  3NP8 A;  2B8F A;  5C5L A;  2A68 D;  1UUP A;  3DHQ A;  3MA2 B;  1Y8O B;  1GHJ A;  2C9O A;  3AMU A;  1NCV A;  5T1I A;  1BDO A;  1WTW A;  1O80 A;  4E6I A;  2CW0 D;  1D1I A;  2F0D A;  2Z4I A;  3NXW A;  1XYI A;  3DEP A;  2GA4 B;  4HCE A;  1GOZ A;  1GXD C;  2NBF A;  2MPM A;  1AW7 A;  1HTP A;  4FF2 A;  3I8Z A;  2O5I C;  5FLX L;  1TS4 A;  4FYD A;  2NZ1 D;  4QF4 A;  2F4I A;  1JB3 A;  4CJ1 B;  3FMC A;  3CU7 A;  4H13 C;  2ZXR A;  3W3A A;  4OIJ A;  2NWG A;  4K6D A;  3GTG B;  3H09 A;  1YNJ C;  3HEJ A;  5COR A;  4RKL A;  2J4X A;  3K5O A;  2EYP A;  3SK6 A;  3IFD A;  3H3V C;  2WII B;  3M7N A;  2EYF A;  2FIN B;  1JOO A;  3K0Y A;  2RDF A;  2LS0 1;  3IFT A;  3MXG A;  5CV7 A;  3SE0 A;  2R3Z A;  4X3U A;  1WVL A;  4KK7 A;  1GHK A;  1C8C A;  3BDC A;  2EYL A;  2KVM A;  4KHZ A;  2FHT A;  1SYE A;  5IGB A;  1Q12 A;  3VR4 A;  2D62 A;  5E3F A;  5DEH A;  4XXE A;  3HS0 C;  1PFN A;  3NBI A;  2V4D A;  1SJH D;  5J1Z A;  5T1G A;  2XIW A;  3OW7 A;  2OEO A;  1PDQ A;  2CVR A;  3QIA A;  5I2X A;  5IGG A;  1YNN D;  1HUN A;  2R93 B;  1JOR A;  4RCN A;  1HA6 A;  3ITP A;  4G7H C;  1KDB A;  4MHE A;  3VR3 A;  2TSS A;  4KJN A;  3GV3 A;  5COY A;  2F0N A;  1PTO D;  1PRT B;  1EWC A;  4JBW A;  3P1H A;  1SBB B;  2J0T D;  1STB A;  4C56 C;  2F0J A;  2LY7 A;  2XNA C;  4ODG A;  1JQY D;  3IKJ A;  2VB2 X;  5IGF A;  2L0C A;  4C2M B;  3IL8 A;  4XIG S;  5C44 B;  2XN9 C;  2B2V C;  5A2Q L;  3JAM L;  1LO5 D;  1QG7 A;  3LX0 A;  2XWJ B;  2VB3 X;  4ZK9 B;  3LNN A;  3BDO A;  2A6H D;  2QCP X;  5G3L F;  3MHB A;  4TSS A;  4ILW A;  1BOS A;  5JJZ A;  5JPM C;  4ZUI A;  3MTS A;  3I3C A;  1JWM D;  2KCC A;  1PTO H;  4F7X A;  1TQO A;  1LTG D;  1MGS A;  5E4W C;  3DWA A;  1QCB D;  1XX8 A;  1A6X A;  4A93 B;  3HOW B;  1XTC D;  1I4X A;  2IW3 A;  4I7Z C;  1U4L A;  5FO7 B;  1H9M A;  3HOU B;  1D5M C;  1DOK A;  1F9S A;  3KLS A;  3V05 A;  3Q6S A;  1S5D D;  3BVM A;  4C3I B;  2M9V A;  3MAQ A;  1S4Z A;  1U4P A;  4B9X A;  2NVY B;  5C4Z A;  1CA6 A;  3VR2 A;  3VR5 A;  4QIW B;  4KKT A;  1CHQ D;  1EYD A;  1EY7 A;  1XXG A;  1G6Z A;  4XYO A;  3S15 B;  1HTL D;  1M4V A;  3T13 A;  3VYS A;  2AUJ D;  1SMY C;  1VMP A;  5BN3 A;  1FR3 A;  2RQX A;  4RGN A;  1IW7 C;  1SDF A;  4XT3 B;  4A3F B;  4BS9 A;  1NR2 A;  2D5D A;  2K33 A;  3PUY A;  2NB0 A;  4I65 A;  1PRT C;  2DN8 A;  2QEJ C;  1T5X D;  2SEB D;  4WJW A;  5C0X I;  4C3H G;  4ZRZ A;  2EXZ A;  2BDO A;  5C3W A;  5EJW A;  1CM9 A;  1F9P A;  2AQ2 B;  3N52 A;  1WTV A;  2R92 B;  2SOB A;  2Z1C A;  4F8M A;  3D4R A;  3EVQ A;  3TN2 A;  2KJX A;  1B2T A;  1G2S A;  3OPO A;  2NVQ B;  5IGE A;  1NR4 A;  3DMU A;  1OXU A;  3EQL C;  1D6E C;  4A3G B;  3C1F A;  4GZY C;  1G2T A;  1PZI D;  1HFN A;  3GTP B;  1Q8I A;  1L0X B;  2M00 A;  1G91 A;  2EYM A;  1AP0 A;  2F0V A;  1FD7 D;  3MC0 B;  1EYA A;  3WOE A;  1CFM A;  1B1Z A;  2EZV A;  2WKC A;  5JOB A;  3PUV A;  2KEE A;  1LV9 A;  5M3M B;  3E0J A;  2IT1 A;  2MHV A;  3NK9 A;  2DY7 A;  4XYQ A;  3A8J E;  3K6O A;  1CA5 A;  2J7Z A;  3WOF A;  4C3J G;  2YU9 B;  1A3T A;  1PTO F;  3H91 A;  3P75 A;  1E2W A;  1O7Z A;  1D5Z C;  1EOT A;  4IAL A;  2KOL A;  4R9W A;  5E4X A;  5C3E B;  4XQQ A;  4B08 A;  1Y69 U;  2B2W A;  3O13 A;  4CJ0 B;  3I4L A;  5EKL A;  3X3N A;  3VR6 A;  2F0O A;  1YNN C;  4OGQ C;  3QG1 A;  4K6L A;  2RDH A;  3S14 B;  1CHP D;  2LMC B;  2L11 A;  3S16 B;  2EYJ A;  1S5C D;  1ZKO A;  2F0T A;  5M5W B;  3SR1 A;  1TWH B;  2EJM A;  4IUQ A;  1DCZ A;  4KD3 A;  2NYZ D;  2XVS A;  1PMR A;  3LWU A;  1KAB A;  3S2D B;  4QUC A;  3RMH A;  4BBS B;  3S2H B;  2AWN A;  5D14 A;  1ENC A;  1GUG A;  2JYO A;  4IQZ A;  2E2I B;  5IOD A;  5ELD A;  1ICW A;  3EFX D;  1L0Y B;  3GTO B;  1JOK A;  3SK5 A;  5I6Y A;  2VXW A;  2ID0 A;  4IZ8 A;  1NAP A;  2PW5 A;  5EBC A;  4BY1 B;  2BA0 A;  1J9O A;  3CRK C;  5C6A A;  2H4O A;  1DXM A;  3M85 A;  5JEA H;  4IN3 A;  3I91 A;  1LLR D;  1LTI D;  2N88 A;  3A7L A;  3QJY A;  1TY0 A;  4DAP A;  2IJ0 A;  1Q1B A;  3T56 B;  1RCV D;  1WD1 A;  2NTT A;  2FJ2 A;  1GUW A;  1Z7T A;  2FMM A;  2PZU A;  3RD4 A;  3T16 A;  3ONA B;  1PZK D;  3Q23 A;  4KJO A;  2Z4H A;  3R2I A;  3CKI B;  4KN7 C;  4KHV A;  1DJR D;  5E1F A;  5D3D A;  1H9S A;  3RLF A;  4K2L A;  3QB3 A;  3C3L A;  5IGC A;  2SNM A;  4FXG C;  2EDG A;  1TWA B;  3GV6 A;  3TP8 A;  5JAV A;  1A3U A;  4K8I A;  1PYW D;  2HDM A;  5KEE A;  1QOH A;  5DNF A;  3A54 A;  3I4M B;  1I3Q B;  1ESF A;  2X69 A;  2ZT9 C;  2F0F A;  1WD0 A;  4FNF A;  1EIG A;  1O78 A;  2E76 C;  4X3K A;  1PFB A;  2B2Y C;  1STG A;  4Y7N B;  1U9R A;  1B9N A;  5CR3 A;  1H9K A;  4G7Z C;  4ZKC B;  5KNB A;  1DZ1 A;  1ZYR C;  1C48 A;  5C0X H;  1TWC B;  2F3V A;  5LHY 1;  4ME5 A;  2WAQ B;  1D5X C;  5JVG 3;  3NPP A;  1SSO A;  2E2H B;  2B2U A;  3E6Z X;  1HUM A;  1LT6 D;  1BNZ A;  4RFB A;  3J80 E;  2IL8 A;  5EGT A;  3DXJ C;  2A74 C;  1V1P A;  4Q5V A;  3D6W A;  5I6W A;  2FMC A;  1ZXT A;  1DOL A;  3KLR A;  1R4P B;  1SE4 A;  3RZO B;  1SAP A;  1CZG A;  1Y1W B;  2L4N A;  2Q8T A;  1EY0 A;  3P20 A;  1JR0 D;  3DWQ A;  2X6G A;  4ZUJ A;  4C1N I;  5FO8 B;  1TU2 B;  4RCO A;  3G7L A;  1ET9 A;  1SNM A;  5KYL A;  2X6L A;  1OXV A;  1UAP A;  1B9M A;  5EKK A;  4B9W A;  3SVM A;  1BF4 A;  4TQU S;  3I73 A;  4FO2 A;  1QE6 A;  4AYB B;  3A56 A;  1AN8 A;  1SYB A;  2F0W A;  2IPK D;  3BYY B;  4OL7 A;  1WTQ A;  4QMG A;  2HCI A;  2RBM A;  5FK9 C;  4M8A A;  5C4X B;  3J7A F;  4QB4 A;  1EEI D;  4DF7 A;  4K5W A;  4EQP A;  1SYD A;  3PUZ A;  3M7G A;  3OIP A;  1RJT A;  4FVM A;  1IYU A;  2C5C A;  4JK1 C;  4K14 A;  4A3I B;  2AUK A;  1K8O A;  1EU3 A;  2BA1 A;  4FF3 A;  5JEA G;  3CHB D;  3VA7 A;  4C3H B;  2KED A;  5DAU A;  1PXU A;  2OF1 A;  5BN4 A;  1WTP A;  2OXP A;  3J80 L;  1TS5 A;  2SNS A;  3PIP 3;  2E2J B;  2PQE A;  3NUC A;  5C4H A;  1HA5 A;  1UEA B;  5KGU A;  1UNS A;  1IKL A;  1R9T B;  2F0Q A;  5FOB B;  1SNQ A;  4K2K A;  5DM7 3;  4KI0 A;  5EPJ A;  2WP8 J;  4XT1 B;  3FDT A;  2A5H A;  1CQV A;  2NVT B;  2RA4 A;  4HMI A;  4DNT B;  1HQR D;  3U9O A;  2ZXO A;  1BR9 A;  2PZW A;  4RGO S;  2F0I A;  2ICI A;  2NVX B;  1LT3 D;  4ZYS A;  1I6V C;  2QKI C;  2WKD A;  2EY6 A;  1X3Q A;  3EJI A;  3NE5 B;  3I70 A;  1E2V A;  1LTA D;  2NN6 I;  3FRP B;  3IAY A;  2M2L A;  1LAB A;  1O7L A;  3KBX A;  5I4D A;  1B53 A;  2K7V A;  4C3J B;  2IX1 A;  3S1M B;  5K36 H;  3A55 A;  3D3R A;  5I9O A;  2B2T C;  5C0X G;  1TII D;  1IL8 A;  1LTR D;  4QCL A;  3MFY A;  1PFM A;  3R93 A;  3PUX A;  4HTH A;  2E75 C;  4X3S A;  1RKN A;  4K5X A;  3M4Y A;  1XWE A;  1U4M A;  4KY6 A;  1VF7 A;  2KCN A;  1H9S B;  2K32 A;  1STY A;  2E74 C;  1MD2 D;  4LMQ D;  2EY5 A;  3S1N B;  3OWF A;  3OSO A;  4A3J B;  4Q0F A;  1EY8 A;  5CV6 A;  3PUW A;  1FNU A;  3C46 A;  5EKI A;  4L6T B;  1PTO B;  4G57 A;  4J8Q A;  3ZYY X;  3GO5 A;  2B2V A;  4DXG A;  1KAA A;  2O5J C;  2R61 A;  3CQZ B;  3Q0A A;  2WV6 D;  3D4W A;  5M5X B;  5ELE A;  1QNU A;  3TME A;  1B50 A;  3K5L A;  1STA A;  1BCP D;  2A68 C;  1ESR A;  4IFD I;  1RDP D;  4EQO A;  1PLF A;  3S1Q B;  1ZEQ X;  2LKV A;  2CW0 C;  3QWN A;  3HP3 A;  3NBH A;  1TY2 A;  2IX0 A;  3OIQ A;  1IYV A;  3S1R B;  4KTA A;  1Q90 A;  5C4J B;  2L1B A;  3MVV A;  3D8G A;  4NKL A;  2EVB A;  4ZLT F;  2XSC A;  5IOC A;  2H1E A;  2K04 A;  5FO9 B;  2A69 D;  3CRL C;  3S9W A;  4CGY B;  4RGM A;  1SND A;  2PO4 A;  3TP6 A;  1ROD A;  2EYH A;  1V8Q A;  1G8Z D;  2XRQ D;  3SXH A;  2PPB C;  1W6J A;  5A35 A;  2L5T A;  3MWY W;  3V2T A;  4A3D B;  1I50 B;  5HUR A;  5KRU A;  3J7Y W;  4LK1 C;  1V1P B;  2XWB B;  5CV9 A;  1Y8P B;  3L9A X;  1YNJ D;  1BXT A;  1S5B D;  3HZX A;  1RD9 D;  3M4O B;  1ONL A;  2F0M A;  5JEA J;  1E2Z A;  2JA8 B;  2NUC A;  3ND9 A;  1R4Q B;  2F03 A;  5IGD A;  2I46 A;  1ET6 A;  3BVZ A;  3X3M A;  1NUC A;  1ENF A;  3BVG A;  2KA7 A;  3FVQ A;  1TVX A;  4C1N K;  5KNC A;  5ELF A;  4ID6 A;  5M5Y B;  1F2Z A;  4A3E B;  3NWS A;  3T51 B;  4IUV A;  3QOJ A;  2JSO A;  3NTK A;  2HUG A;  2A6E D;  4IUU A;  1WCM B;  4KKS A;  1PTO C;  1PZJ D;  3HOZ B;  3TZD A;  4FF4 A;  3WDN A;  1FNW A;  4U67 3;  1QWY A;  1B44 D;  1EY4 A;  3NSW A;  4ABN A;  2JA7 B;  1GJX A;  5D65 A;  4UDU C;  1SE3 A;  1A3V A;  4CKB A;  1SYC A;  1VCI A;  4HR7 B;  4OIK A;  1SXT A;  2A6H C;  1S5F D;  2KEC A;  3MFG A;  2RSO A;  3N6R A;  5J39 A;  3OWE B;  2HCC A;  5CC4 A;  5K36 G;  3H6M A;  5C0X J;  3G6J B;  2F0S A;  1DYQ A;  2F0G A;  4DK1 A;  2RSN A;  3K57 A;  1I4R A;  3L7Z C;  2EPB A;  4H0L C;  1I4Q A;  2RVL A;  1TS3 A;  1KLG D;  1G29 1;  5C5M A;  4WFN 3;  3D4D A;  2Q8I B;  4RHR A;  1LTB D;  5LL6 S;  1OXS C;  3C1E A;  3W2D A;  1HCZ A;  5CV4 A;  2K01 A;  2L12 A;  4IUT A;  4CJ2 C;  1TT2 A;  3URY A;  2NN6 H;  4ULL A;  1X3P A;  4PMB A;  1M8A A;  1F2L A;  4KD4 A;  3K59 A;  1IHZ A;  4PNY A;  1QIL A;  3Q24 A;  3PO2 B;  3KK7 A;  4HSP A;  2B8G A;  5ELC A;  2N55 A;  3TP5 A;  1VDZ A;  2PNR C;  4R8I A;  1SJE D;  4ZAI A;  2PYK A;  2AQ1 B;  5FKA C;  4A3M B;  1TKW B;  2Y0S B;  3MZ5 A;  1Y1V B;  4PMW A;  2KHS A;  1I4H A;  1SNP A;  1BCP F;  1Q1E A;  4BA2 I;  3S17 B;  1EYC A;  3VYU A;  2JXM B;  4CBV A;  1MSG A;  4FXK C;  4OO1 I;  3HGB A;  1JE4 A;  3AB9 A;  1JC7 A;  1NSN S;  3TZU A;  4H7B A;  3R3O A;  2AQ3 B;  2Q8R E;  2K1B A;  2IWH A;  2PCF B;  1Z6H A;  2O2L D;  1KNA A;  2D9U A;  1PRT D;  3SK8 A;  2BE5 D;  1F9R A;  2WAC A;  1E0B A;  1K83 B;  3MXU A;  5D3I B;  4IFD H;  2WB1 B;  4DU9 A;  1EL0 A;  2L9H A;  4KN4 C;  2E2D C;  3T53 B;  5HGT A;  2EJG C;  5JPN C;  4XQJ A;  4PMC A;  2A69 C;  2G9D A;  1HFG A;  4DGZ A;  5CYU A;  3E5S A;  2F0U A;  3NQI A;  2QDB A;  5A2Q E;  3JAM E;  4L8J A;  1BUV T;  4J1M A;  1K8M A;  2ENB A;  1HRJ A;  3U9S A;  3KF8 A;  2D2C C;  2O4X A;  4HSV A;  3H94 A;  4K5V A;  4RGT A;  2KUM A;  1EFI D;  4XDX A;  3ERQ A;  4QUF A;  3A8I E;  4DXF A;  2YYZ A;  2Z8L A;  4S3S A;  1BO0 A;  1I4P A;  4V19 0;  4TRD A;  3RZD B;  1LTS D;  1KDA A;  3K5M A;  3K7A B;  1W6K A;  5CV8 A;  1AFP A;  2HDL A;  5BN5 A;  4DK0 A;  1KNE A;  2WIN B;  3GTM B;  4PQX A;  1TS2 A;  1VMC A;  1FNV A;  2R6G A;  1A15 A;  3KUP A;  1DOM A;  1EWH A;  1FGB D;  4NW2 A;  4O1N A;  1QB5 D;  4M1U B;  2B2Y A;  2K03 A;  4HCS A;  4EVO A;  1WTO A;  5KND A;  1JWU D;  3HKZ B;  3OOC A;  3KLS X;  1RHP A;  1Z47 A;  1I6H B;  1CK1 A;  2A6E C;  4HAE A;  3PMF A;  2QF7 A;  2F0L A;  1HXY D;  2B63 B;  4DN4 M;  3M3Y B;  4IUR A;  1ILQ A;  3D6C A;  2F1M A;  1STE A;  2F0K A;  3H0G B;  1DON A;  3FPU B;  1EQT A;  2NTS A;  3A7A B;  3SHL A;  1TWF B;  4CHT B;  2NN6 G;  1F2M A;  2CHB D;  1BBX C;  2KQ3 A;  4RA8 A;  2L55 A;  1JIC A;  1TWG B;  3NWT A;  3OHX C;  5CBE E;  1DM0 B;  4DAV A;  2FFK B;  3OMG A;  3F2U A;  1QJO A;  1WTX A;  3K5N A;  1JWS D;  4RHS A;  5ELB A;  1EEF D;  5KIX A;  1BQQ T;  4H44 C;  3SDZ A;  4UAI A;  1HQM C;  4NDX A;  3OMC A;  3FPP A;  5IIF A;  1SNO A;  2EY2 A;  1SFO B;  3I4N B;  1B4O A;  1EIH A;  5ISR A;  2JP1 A;  1AEX A;  5CV5 A;  2RDG A;  4V0B A;  3C2P A;  5M9O A;  2F0P A;  4RKB A;  3DUZ A;  3HOX B;  1A2U A;  4WRD A;  2VNU D;  4WOR A;  5I9P A;  4KY5 A;  2JA6 B;  4XQN A;  1VF5 C;  3NTI A;  1GUT A;  1CQF A;  1PRT F;  2DNE A;  4HED A;  4X3T A;  1CZW A;  1STN A;  1MI2 A;  4IFD G;  3BS1 A;  2JEA I;  1EQV A;  4R8N A;  1CTM A;  1F9Q A;  4RH6 A;  1C4Q A;  4IUN A;  3UI2 A;  3R2T A;  5M3F B;  3R8B A;  5JVH 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...