2SOBA

Sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRVLAYIYADGKMVNEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title NMR structure of a stable "OB-fold" sub-domain isolated from staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 8
structure length 103
sequence length 103
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sobA00
4ZQ3A 4F7XA 1KDBA 1SNPA 3C1EA 4K2LA 2EY5A 4QMGA 4LAAA 5KEEA 3D8GA 3SK8A 5J39A 5CV9A 4NP5A 4DF7A 1SYCA 5DAUA 5C5MA 1EY7A 1EY0A 1STNA 3QOLA 3EJIA 4QF4A 5C6AA 3OMGA 2EYOA 3DMUA 1KDCA 1II3A 4MIUA 5JOBA 5K5PA 1F2MA 2EYMA 3MZ5A 5CV7A 3P75A 3SR1A 2EY1A 2SNSA 1A2UA 2RBMA 5C3XA 4DU9A 5IGGA 4TRDA 4K5VA 2F0PA 2F0DA 3QOJA 1A3UA 4B9WA 2LKVA 1F2YA 1TQOA 4DFAA 3SK6A 4KJNA 2F0OA 3OSOA 1IHZA 4KTAA 4WORA 1U9RA 3OMCA 1RKNA 1ENCA 1SNQA 2EY2A 3H6MA 5F2DA 5ISRA 4K2KA 5IGFA 1EYCA 4WRDA 3BDCA 5CGKA 4K5WA 3ITPA 1JORA 5KYIA 2F0UA 2PZTA 1SYBA 4HTHA 4EVOA 4HMJA 2EYHA 4K14A 2OF1A 2F0KA 2EYPA 4R8NA 5DEHA 4ODGA 4ZUJA 5C5LA 3RUZA 5C3WA 2EYLA 3D4DA 2F0WA 4J6HA 4NMZA 5IOCA 1EY8A 5C4HA 4B9XA 4K8JA 5CR3A 1STGA 4PMCA 1EZ8A 4E6IA 1EQVA 3MXPA 3U9OA 1EY5A 4OL7A 1JOOA 3SXHA 4QB4A 1NUCA 1EY6A 5EKKA 3NUCA 4ZUIA 5KIXA 4K8IA 3VA5A 5J22A 4PNYA 3ERQA 4G57A 3NQTA 3D6CA 4YIJA 5IGCA 1SYFA 2F3WA 3DHQA 4K6DA 2PQEA 3NHHA 1NSNS 3MVVA 5JAVA 2PW5A 5CV5A 5KYLA 3TP7A 4EQNA 1AEXA 4K5XA 1TR5A 4KJOA 5E1FA 1EYAA 5CC4A 1STBA 1STHA 4S3SA 3T13A 1SNOA 2SOBA 2F0VA 1JOKA 1A2TA 2SNMA 3SHLA 4KD3A 5IODA 3NK9A 2EYJA 4ID6A 5EGTA 4RKBA 5KRUA 4KY5A 1JOQA 5CV6A 3PMFA 4IZ8A 5NUCA 5HURA 5IGDA 4IUNA 3BDLA 4IALA 4N9PA 3NXWA 5HGTA 2PW7A 3D4WA 2F0SA 2RKSA 4KY6A 5I9PA 5I6YA 2F0JA 2KHSA 4N9TA 3OWFA 1KAAA 3TP8A 5CV8A 2F0FA 4NDXA 2KQ3A 2OXPA 1SYGA 3TP5A 1EY9A 2F0IA 4F8MA 2NUCA 3HEJA 2M00A 2F0QA 4HMIA 4KD4A 2PZWA 1A3TA 3LX0A 5IGBA 4J1MA 3V2TA 3SK4A 1ENAA 3P1HA 2WACA 5M9OA 1EYDA 2O4XA 4NKLA 4RKLA 2EYFA 2HQEA 3E5SA 3EROA 3EVQA 2EY6A 1SNMA 2F0HA 1EY4A 3QB3A 2RDFA 1SNCA 3TMEA 5I9OA 2F3VA 2OEOA 3C1FA 3MEHA 4PMBA 5E3FA 1SNDA 2ENBA 4H7BA 4KHVA 5I6WA 3TP6A 1KABA 3SK5A 5KGUA 1A3VA 1F2ZA 2QDBA 2F0GA 3NP8A 4KY7A 2PZUA 3R3OA 1STAA 3S9WA 3HZXA 5EKLA 5CV4A 2F0TA 5C4ZA 5IIFA 1STYA 1SYEA 2F0NA 4KV6A 4DGZA 3MHBA 2F0EA 4I65A 3T16A 2PYKA 4EQPA 4EQOA 1EZ6A 2F0LA 1TT2A 2EXZA 5J1ZA 5IGEA 4ME5A 1KDAA 2F0MA 1SYDA
chains in the Genus database with same CATH superfamily
3KOJA 2K33A 1Y14B 3D8GA 1SE3A 5CV9A 4TVAB 3K8AA 1Q3LA 3F1ZA 2D0PA 3QOLA 3I55A 5AJ3Q 1MHWC 2XRQD 3OMGA 3DMUA 1QNKA 1K8OA 2WFWA 3KDFA 1PH8A 3SK6A 2F0OA 4WORA 4XTCS 1V1PA 2EVBA 2XWBB 1MIUA 2KCMA 5IGFA 3NQIA 2EIFA 3MEFA 3I4MG 4MN3A 4HMJA 4A93B 2EYPA 1N34L 1X54A 3A74A 3L0OA 2EYLA 1N9WA 1X3QA 4NMZA 2E74C 1XNQL 1QCBD 2NVXB 3HP3A 3A56A 3BG3A 2O5IC 2KA7A 1EFWA 2LY7A 3JAMc 3X3MA 1EY5A 4KKTA 1EQTA 3GTLB 1EY6A 3E6ZX 4BXXG 4KN7C 1B7YB 4Q0FA 2MHVA 3NBHA 4DAYB 3U58A 3A5ZB 4DR2L 1WTOA 3E9IA 4V0BA 3D31A 3TP7A 3T13A 1Q90A 3NEMA 1PFSA 2SNMA 3M4QA 2VQEL 3DEPA 3BYYB 2HIVA 3QR8A 3I2ZA 1VQ6A 2B63G 1SDFA 4IO9A 5FLMH 4WFN3 2IJ0A 2KJXA 5C0XH 1X9NA 2JA7G 4OIKA 2AWNA 1LACA 4JOIA 4R9WA 3QWNA 1GM5A 4KD4A 3BZCA 1M90C 1RD9D 4B3SL 3JAME 1AN8A 1RJTA 1STEA 2JA5G 1Y1WH 2HT1A 4DXFA 1G2TA 1ET9A 3D0FA 2F0HA 2JA6B 4DV0Q 2JJQA 4LF9Q 3SVMA 3T1YL 4C3HG 5KGUA 2JA6H 1EIGA 3TP6A 2H4OA 3SK5A 4JI5Q 2Z9HA 4DN4M 5GAGC 1KHIA 1E1OA 1WD1A 1BBUA 3TZDA 5C3EH 4DGZA 3I4NG 1J8IA 2NTTA 2A5HA 3R93A 4G7OC 4EX5A 1V8QA 1TS5A 3JAML 3BVGA 4DV7Q 1XJVA 1L0XB 3IRBA 4LUZA 5C6AA 4GOPB 4P73A 1II3A 5I2YA 5JVH3 4HSPA 3SR1A 2EY1A 2KECA 1A2UA 5M5XB 3CCMA 3QOJA 2XGTA 1KD1C 3J81c 4F87A 2M2LA 2IX3A 5HGQA 1ENCA 5IYDH 2DNCA 2XWJB 3BU2A 1I3QH 4B08A 2X6LA 3L7ZC 2F0KA 4NXMQ 3Q6SA 1ZKOA 1VQ9A 4B9XA 4PMCA 1D6EC 4AYBE 1MGSA 3WWVA 3L2PA 3K5MA 4HCSA 4HJAA 4UDUC 3QO2A 4DV1L 1WD0A 4OX9L 4DR4L 4UPAA 1FJGL 2Q8RE 4XQNA 2GA4B 3FKIH 2GVBA 2Q8IB 1D8LA 1AEXA 1TR5A 1BKBA 3K58A 3OTOL 3SHLA 4DR1Q 2KEEA 5EBDA 1IBML 3C46A 4ILWA 1L1OC 3VYRA 1I4PA 1IL8A 4GNXC 2SEBD 4FXGC 1L1OA 1FL0A 4A3FG 1WTVA 1N34Q 2OXPA 4GNXA 1T5XD 2WB1G 1AZPA 2PPBC 4JI8Q 5DLQE 1NMFA 2D0OA 5CMDA 2BDOA 1Q81C 4R4OA 3RLOA 1VQLA 3SK4A 1SFOH 2WACA 1LV9A 3T1HQ 3DXJC 2ZXPA 3PIPA 4GS3A 5ELDA 2R93B 2L11A 4MNOA 1EY4A 5G3LD 3RD4A 5FLMG 1U4LA 3SE0A 3QG1A 3J81L 4GN5A 3KJPA 1PTOD 3PO3B 2HCIA 2DGYA 4YCVA 3A54A 1STAA 2OQKA 3KF6B 2ZTEA 2F0TA 2RF4A 2CQAA 4HIDA 1PHJA 1IW7D 1QG7A 4DK3C 2VQEQ 4NXNQ 2CFMA 3HOXB 2F0LA 3VR4A 1HXYD 1WYDA 4RCNA 1RODA 4XDXA 1PFMA 3G7LA 2VW9A 2J0TD 4A3JH 1X55A 4JI0Q 4JYAL 4LF7Q 1WTRA 1XTDA 4R1JA 1NAPA 4Y52H 4IPGA 1F9QA 3K6OA 3GTPB 1BCPB 1VMPA 1F2YA 1AH9A 2QEJC 2UUBQ 3GTJB 4B3SQ 3GTPH 1FGUA 2LXJA 3AYHB 3GTJH 2Y0SG 4K2KA 4C3JB 5KYIA 4YCUA 1QWYA 3MAQA 4O0AA 1TY0A 1YNJD 3T1YQ 5AFWA 4IFDG 5C3WA 5K36G 1YI2A 1PH9A 4PQXA 4LFAL 1QVFA 5IOCA 2KEDA 3D3RA 4K8JA 3H3VI 3N6RA 4KI0A 5FO7B 4FDBA 3SXHA 4IUVA 5EKKA 3NUCA 3VR2A 1VQKA 2MPMA 5IYCH 2BE5D 1S72A 2F4VL 3ERQA 3RN2A 1F9RA 3HOWH 1A8VA 1SYFA 3MFGA 1XX8A 3T4AC 2VQFQ 1EEID 2Q8TA 3CCJA 5E1FA 4POFA 5CC4A 1DD2A 2MO1A 2L9HA 5D3IB 2NZOA 1D7QA 1JJCB 2R92B 4DAYA 5GAEC 4JI4L 3PMFA 4POGA 1NCVA 2R92H 2ASBA 2AUJD 2FFKB 1D5ZC 2N8NA 3A8JE 3D4WA 4AIMA 3H0GH 1KL9A 2KHSA 1PRTD 4RG1A 2FXQA 2R61A 3FKIG 4DNTB 3CCVA 2XSCA 2B2UA 5ELNA 4A3GB 5JEAG 5COYA 1ENAA 5EPKA 4KKUA 5JPNC 1GD7A 3S2DB 1H9RA 4DV1Q 2F3IA 3HOZB 3CKIB 3K0YA 4OX9Q 1SNMA 1TY2A 3E0EA 4RAUC 2VY3A 1FJGQ 4DR4Q 2AQ2B 1EEFD 1A62A 4KK7A 3J80i 1EU3A 3OTOQ 5C4JB 2B2WA 3STBD 4XQJA 1SNPA 4X3TA 1H9SB 1SXTA 3V05A 4GLXA 2WV6D 4L5TA 1GHJA 4QGUA 2UXDL 3CPFA 1HCZA 3S1QB 3LWUA 1BO0A 1MSGA 5LHY1 1Q46A 1LABA 4OO1H 4X65Q 1ILPA 1A3UA 4GOPC 3VR5A 3E9HA 1HNXL 2B29A 2NZHA 3I70A 4GOPA 2CHBD 1ASZA 1CSQA 2YU9H 4YWLA 4C3IG 4K14A 4JI6L 1EIFA 4PMWA 3I4LA 5IP9G 4Y7NB 2PI2E 1XNRL 4BA2I 1I6HH 2Q2UA 4BY7G 2KHJA 3A8IE 1HNWL 3S15H 3I4OA 4A3IB 1O7LA 4RGNA 1QILA 1D5XC 3PGZA 4KMUC 1XMOL 3ICEA 1GO3E 4JBKA 4IOAA 4BBSH 4DAMA 1DOLA 1EL0A 1LYLA 4OIJA 3D6CA 4L6TB 4LF8L 3J7YW 2UU9L 4IJLA 4LK1C 1ICFB 4JYAQ 5M5WB 2ZM6L 4CKBA 5T1IA 5M5WH 4QUCA 5FLXc 3CCLA 4JI7L 3OOCA 4OHJA 5NUCA 1IKLA 2NVYB 4N9PA 3PO2H 4H02A 3HOVH 3AQQA 2G9HD 1LTBD 3OIQA 1KAAA 2DY7A 2R7DA 4LFAQ 1ZEQX 3H15A 3HOYB 4J1MA 2X6GA 3CCUA 3H3VH 1DXMA 5FO8B 4I7ZC 1KTKA 4L63B 2EY6A 4NPSA 5CYUA 3A7AB 1RIPA 3ND9A 3CCQA 5LMNW 1HA5A 4OWTB 4IUUA 2F0GA 2JK8A 2K50A 4IUTA 4BY1B 4X64L 4X6AH 1SYEA 3GTGH 4QY7A 4YCWA 4HN7A 4YY3Q 5J1ZA 5IGDA 1G2SA 3EIVA 3Q22A 2HIXA 1KC8C 2D9UA 1X56A 4QF4A 2EYOA 3KF6A 4L8JA 4IURA 1MBYA 1DOKA 4QIWE 4A4IA 1CFMA 4FP5D 4AH6A 4JI2Q 2WAQE 1Q82C 1WOCA 1S5DD 2F0PA 3M4OH 3HFZB 3MWYW 3CRKC 3RLNA 1TIID 3F2UA 1SNQA 2KBNA 4MHEA 1RTOA 1VQDA 1EYCA 5CGKA 4FF1A 1BCPC 2MFIA 3I4MB 1SE4A 1LM0A 5DEHA 2YTVA 4NW2A 2PI2A 3I4MH 2F0WA 4UHVA 2Z6BA 1YBYA 1PTOH 2TMPA 3TZUA 1K83B 1J6QA 4A3DG 1M8AA 4BA1I 4OL7A 1K83H 3D6WA 2VB3X 1A6XA 4DV6L 3HS0C 2K03A 3ULJA 1ZYRD 5T1GA 2Z4HA 3VA5A 3M3YH 3KLSX 1B50A 3HOUG 4BXXH 1NSNS 3MVVA 3AB9A 2PW5A 4KHZA 1TU2B 2FINB 4A3EG 3A8KE 3HGBA 4S3SA 1S40A 1H9JA 2FJ2A 2OT2A 3ULPA 1HNXQ 4KY5A 4B3RL 1KRSA 4LMQD 3W2DA 3NXWA 2B63H 1WCMG 4UAIA 3S17B 1TWHH 5IP7G 2HDMA 3S17H 4CKCA 3ONAB 4JI6Q 4DV2Q 4TQUS 1WVLA 5FOBB 2F0IA 4LNQA 1RDPD 2ZTCA 5ELEA 2JA7H 3NTIA 4JI1L 3D4RA 4JW0A 3V2TA 3SDZA 1HHVA 4FYDA 5C4XB 2EJFC 4F88A 4G7ZC 1UNSA 1BCPF 1XMOQ 3PO2G 2BH2A 3HOVG 4ABNA 1SNCA 2RCNA 2JA5H 2XN9C 1HZ9A 5E3FA 3OW2A 2A6HD 1SMXA 4C3HB 2QDBA 2UU9Q 2RHQB 4XYOA 4A3LG 1JQYD 3EFXD 4DV4L 4C3HH 4A76A 4IFDI 2ZM6Q 5C4ZA 5KNBA 2JP1A 2PYKA 1EZ6A 2QA4A 4JI7Q 1I4RA 2DNEA 2JXMB 1ESFA 2EY5A 3I4NH 1JE5A 4QUFA 4NP5A 1VQPA 3AU7A 4DR5Q 1WTQA 2VUMB 5E7NA 3VR6A 3J7AV 5GROA 1TWFH 5JOBA 3CC4A 4RA8A 4K0KQ 1B3AA 2JA8B 1EQRA 2AUKA 1BDOA 5IGGA 1LTTD 5FJ8H 2E75C 2ZXOA 1HH2P 3S2HB 4X3SA 5IODA 3P20A 3OMCA 3S1MH 1VQJA 3T51B 4IQZA 2P5ZX 4DUYL 1CKMA 4OXPA 2MUYA 3IFTA 3PQIA 4XT3B 1SYBA 1CT1D 1MD2D 4EVOA 4R8NA 2XNAC 1SJED 3LNNA 4OWWB 4UP8A 2BDNA 1L2FA 3GQBA 4X64Q 2WKDA 2Q2TA 1AP0A 1KNAA 4MTNA 1NUCA 4BS9A 1JJ2A 3UE0A 4PNYA 1VQHA 3UDFA 2UXCL 4DR6L 4AYBB 1FD7D 1Y8OB 5GAHC 1UEBA 1YITA 5I4DA 3ND8A 1CKOA 1BOSA 5M5YH 3TS2A 4RKBA 5KRUA 1OXXK 4M1UB 5CV6A 5IE8A 3G71A 4XQQA 1FVIA 2MO0A 2NN6I 1CA6A 1X65A 1VQ7A 2B2VC 4L5RC 3BVMA 1CKNB 2L4NA 1LTAD 3CQZH 4Z9CB 2G5DA 1B53A 1VCIA 5L37A 2B2VA 2PZWA 1SMYC 1HUMA 4LJZC 1YHQA 1UEAB 4A3FH 2WB1B 3BS1A 4WJWA 3RLFA 1YJWA 3OPOA 3IFDA 1O7ZA 1JT8A 5JVG3 1O7IA 4U68A 2IY5B 2BOSA 3U50C 3A5UA 1S5FD 3HZXA 1UE6A 3KLRA 1X3EA 4LF6L 3TQYA 1J5EL 1HR0L 3G6JB 3EA6A 4KHPL 3GO5A 2DN8A 4DXGA 3BZDB 1QNUA 4B3RQ 4F7XA 1KDBA 2K5VA 4K2LA 4QMGA 1Y1WB 1ONLA 1NBWA 3DWAA 3GP7A 1S4ZA 1K9MC 3GTKH 1JCKB 3M9BA 3AMUA 4XYQA 5IWAL 1YNNC 2ZT9C 4JI1Q 5ELFA 4KJNA 5C3EB 4WRDA 4KKSA 1OO9B 3ITPA 5M3FG 4CJ1B 1SN8A 3VYUA 5A2QE 2YTYA 4OGQC 1X3GA 1I94L 2OF1A 1LTSD 1NNXA 3D4DA 5EBCA 1N32L 1D2BA 1DONA 1TS2A 4P74A 4IFDH 5K36H 5FJ8G 1QZHA 2A69C 4DUZL 3I7FA 2NTSA 3I91A 3BJUA 5KIXA 2D5DA 2LFNA 4P2CB 4G57A 4A3CG 2CCZA 3TREA 2E2HH 1I3QB 2JA9A 3M7GA 5CV5A 5KYLA 1F2LA 2RA4A 1C0AA 1QJOA 1DOMA 2PNHA 4J15A 3L3OC 1R9TH 1A2TA 2E76C 1IKMA 2NVQH 4R4IA 3I73A 1PXUA 1Y1VG 1EWHA 3MC0B 2L15A 5C0XJ 2NVTH 1QZGA 2K5DA 5I9PA 4BBRH 2A73B 1SYGA 1EY9A 1HTLD 5E4XA 5EJWA 1QUQB 4CDDC 3AFQA 3FKIB 2MQHA 2A19A 3F2BA 1HZBA 1R4QB 1KNEA 3UI2A 1WTHA 4HCEA 1XYIA 5JEAH 4IPDA 3VDYA 4A3BH 1SNDA 4DR6Q 1A63A 1X3FA 2QKIC 2WB1E 2K1BA 3OWEB 4RGTA 3MHBA 1K28A 1JWMD 1MI2A 1CI3M 4A3KG 1CZWA 2IX0A 4HAEA 1KDAA 4P71A 2KUMA 4DR3L 1XNQQ 4A93G 3S1RH 1SFOB 4LAAA 2A1AA 4RHSA 2NN6H 3N52A 2LXKA 4ZLTF 1KDCA 1NJIC 3OHXC 1F2MA 4GKKL 4DR2Q 4CDCC 1EFID 2CH4W 1PH3A 4B9WA 1JMCA 4DFAA 2WKCA 1TS3A 5ELOA 1U9RA 3DLLA 3TBIB 4RCOA 1OXTA 3BDCA 2K7VA 3U4ZA 4ZRZA 3EBEA 1KRTA 3ZYYX 3B6YA 3BYTB 3H09A 1PZID 2N3SA 4A3JB 2CH4A 1CZGA 4C3IH 1TWAB 2RSOA 3Q8DA 5IP9H 3H91A 5C44G 4LF6Q 1TWAH 4YHHL 2JN4A 4BY7H 2OQ0A 1BF4A 2Y0SE 5CORA 3CD6A 4KHPQ 1I50B 4JC0A 2DJGC 4DR7L 1I50H 4G7HC 1LT4D 1FNUA 3PIO3 1YHBA 3K5OA 2ZXRA 2E8GA 2VXWA 1SRUA 2RSNA 3NWSA 1B70B 2R7FA 3FMCA 3W5OA 2B8GA 1HQRD 1Q8IA 3GD7A 2RKSA 1TVXA 1HPCA 1I94Q 2F0FA 3HOWB 2LSSA 3K7UC 4H44C 4RMFA 1VQ8A 2ZJRA 1LO5D 1EIYB 3PF4A 1IXRA 3CAMA 3NTKA 1LTRD 3LX0A 3K7AH 2AKWB 4HSVA 2VNUD 1ESRA 5IT9c 1HA6A 4DUZQ 1KLUD 2TSSA 3QIAA 4O1NA 1VQAA 4RKLA 1CKNA 1E2VA 3EVQA 2QDLA 2E5LL 2CW0C 1EOTA 3LWEA 3TS0A 1VQ5A 1N8RC 2HQLA 3C1FA 1F77A 4BBRG 4C2MB 3FPUB 4FO2A 1A3VA 3H0GB 4C2MH 2PZUA 1VQFA 4BWGB 2KVMA 1N36L 2J4XA 3RZOB 2A68C 4CKEA 1XWEA 1I5FA 3RZOH 1TXYA 3T16A 3X3NA 5IGEA 4PZ8A 1SYDA 1VQIA 3IL8A 2HHHL 3CMEA 1Z47A 1SYCA 1MJEA 4A3BG 1YZ6A 2EYMA 4DU9A 4JI3L 3Q23A 4CHTB 2CWPA 3W1BA 4L5QA 5IT9E 3C2PA 4PG3A 1IHZA 1K8MA 1WTWA 2ICIA 1AZQA 4QIWB 3H94A 2SDFA 2WAQB 2R93H 1IBMQ 4HJ7A 1FYCA 2NN6G 2E2JH 1FGBD 3VYTA 4ODGA 1M4VA 2HUGA 2I46A 2AQ1B 3CHBD 1QE6A 3NBIA 4YWMA 3CU7A 1GKHA 3PCOB 4A3DB 4ULLA 4QL5A 4DPGA 4A3DH 1YIJA 5IT9L 5CBAE 3NQTA 2IW3A 2YU9B 3HOUB 3GTMH 5M3MG 2R7ZH 1XTCD 4GKKQ 3HOUH 1KIXA 1SLJA 1X6OA 1I6HB 3KBGA 2LMCB 2A6EC 4DK0A 4A3EH 1NE3A 4CJ0B 1FNWA 2ALYB 3PO3G 3S15B 4IZ8A 4B3ML 2RDHA 1G51A 3RNUA 1S3OA 4HIOA 2ZTDA 1GHKA 3WOFA 4BBSB 4HR7B 2I5MX 1WCMH 3E0JA 2EPBA 3VYSA 5IP7H 2B2YC 1SE8A 2VS1A 3NSWA 4FF3A 2O5JC 3S1NH 1YNXA 2RHSB 1E2ZA 2IHEA 4XXEA 1JC7A 3PO2B 4GKJL 1QUQA 2ENBA 1Z9FA 3HOVB 1VMCA 1PYSB 1V43A 2B2TC 1WFQA 3CPWA 2I0QA 4RWSC 1CSPA 3W3AA 3SGIA 1STYA 4C3JG 3AEVA 2VB2X 4A3LH 1E7ZA 4JCVE 4EQPA 1B2TA 5F2DA 1V1QA 2F0MA 1YVCA 4ZQ3A 4ZKBB 3JAMi 4N8FA 2L5TA 3DM1A 1BVSA 3EJIA 1QVGA 4FXDA 4L5SA 1I4XA 1ILQA 2KCTA 4WJ4A 4KN4C 2K6AA 4AQYL 5JJIA 2F4VQ 2SNSA 5JJLA 1SSOA 4DNRB 2F0DA 3S24A 1EQQA 4P72A 3GV6A 3OSOA 4FF2A 3GTGB 4IUQA 2EY2A 4ALPA 1H95A 4K5WA 1WI5A 4APVA 2HD3A 2E5LQ 2CWAA 2RQXA 2PZTA 3T53B 3K5NA 4JI4Q 3OW7A 3GTQB 4X62L 3GTQH 1N36Q 1PH2A 2L1BA 1I4HA 1SR3A 2XIWA 5EQ0A 1RHPA 1EQVA 1KLGD 5TSSA 3M4OB 5AJ3L 2DJFC 1BXTA 1G8ZD 1B1ZA 1TS4A 4EGVA 1YJ9A 1PFNA 4A3GG 1PH4A 5JAVA 4YWKA 4K5XA 3HOZG 1OXSC 4JI3Q 2F0VA 5LL6S 5DM63 2F4IA 3DM3A 1KQSA 1PTOB 1SROA 3VR3A 4CJ2C 2OTLA 1CQFA 5HGTA 4O2DA 1LT6D 3NTHA 3M3YB 4CDEC 1LUZA 2C5CA 2NUCA 3HEJA 2R7ZG 3DUZA 2I07B 2KCNA 2I5HA 2J7ZA 2UXDQ 2CQOA 1HTPA 4LWCA 4IOCA 3J81i 4IUPA 3VA7A 3NE5B 3QB3A 2RDFA 3UDGA 1WJJA 3CP0A 2B63B 1TWHB 4MTKA 2Q2IA 1WTXA 2Z6KC 3S16H 4UP7A 4LFCL 3PUYA 2JA7B 1S5BD 1HZAA 2UXBL 2Z6KA 1TWCB 1GUSA 3TDQA 1GUTA 1XNRQ 2FHTA 3A55A 4ME5A 1T5EA 1TWCH 2QW7A 3U4VA 1HNWQ 1F9SA 1ET6A 5JJZA 4CGYB 5DAUA 5C5MA 5D14A 4A3IG 1PH1A 1JJGA 2JA5B 3TN2A 1C4QA 1VQOA 2WIIB 4X3KA 1GUGA 3J7A5 2K5WA 2PQAB 1C7YA 3PF5A 3FHWA 1TWGH 4LF8Q 1EIHA 4O42A 1LTID 1TQOA 4B3TL 4LF9L 2IL8A 3GTOH 2MGSA 4JI5L 4LFBL 1JORA 3Q0AA 3I4NB 2C9OA 3UDXA 4GKJQ 3WOEA 2CVRA 4ZUJA 5M3FH 2IHFA 3J80c 1JWUD 1TWFB 2EJGC 2B8FA 1HQMC 3HKZG 2K04A 2L55A 3MA2B 1PRTB 2EXDA 1JOOA 1HFNA 2UUCL 4JBJA 3MXUA 4M8AA 1BCPD 1H9SA 5EAYA 3S1MB 1HUNA 3MTSA 1IYUA 3HOYG 2F03A 2PQEA 3NHHA 1VQNA 3LGJA 2R3ZA 1VQCA 1IYVA 4AQYQ 2NB0A 4DV3L 3CXCA 4A3CH 3KLSA 2K4KA 1EWIA 4KD3A 2EOTA 4IJHA 1AE3A 1BNZA 4R4CA 1FR3A 2GN5A 4BY1G 4NXML 4UY8C 2E2DC 5H1SE 3NWTA 3K57A 1Y1VH 1EU4A 4KY6A 4DK6C 2F0JA 2L12A 2YYZA 4N9TA 2JQOA 3TP8A 1Y69U 1PH6A 3SEBA 3R2TA 2N49A 3J80E 4X62Q 2F0QA 3GDEA 2PMZE 1OTCA 4R4TA 1CHQD 3OYYA 3QJYA 3P1HA 1EYDA 2O4XA 5M5YB 3EROA 1K73C 1GXDC 4K6LA 2O2LD 2UUAL 4H7BA 3R2IA 1I4QA 1KABA 4DR1L 2XRSD 3I3CA 2MP1A 1C9OA 3CQZB 3PIOA 4PV1C 1AE2A 2F0NA 3PUXA 2F0EA 3J80L 4R8IA 4A3FB 1TT2A 4RGOS 5GQOA 2B3GA 4A3KB 4A3MG 3ULLA 2KCCA 4OELB 4A3KH 4A93H 4JI8L 2JEAI 4LF5L 1HNZL 4MIUA 4DV6Q 1C48A 3BZKA 3URYA 3H3VC 2NVXH 3M85A 1IBLL 4C1NK 3U9SA 3I72A 3T1HL 3KF8B 4HEDA 1NMGA 1XPOA 2Z4IA 1BR9A 3GTLH 4WJ3M 3P7JA 2ICEC 3H6MA 1K3BC 2F1MA 1XMQL 3DEOA 2F0UA 2ID0A 1PZJD 2BH8A 1H9KA 3CCRA 4NXNL 3GTKB 1EUJA 4LFCQ 2K28A 3BVZA 2A8VA 2DUDA 4JOIC 2UXBQ 5C44B 1Z6HA 1GUOA 5ELBA 5C44H 4K8IA 4JI0L 1CK1A 4LF7L 2QF7A 1KAWA 2CKZB 3PSIA 1MJCA 4ZCKA 5C4XG 2UUBL 2Y0SB 3FVQA 4EQNA 4JBWA 2HDLA 2RCFA 4JK1C 1O80A 1PYBA 1PMRA 4ID6A 4B3TQ 1DYQA 1Q12A 4DV4Q 5HURA 2PW7A 3A7LA 4LFBQ 1PTOC 3EN2A 1PDQA 3L9AX 2E2HB 1HJPA 1TKWB 1ZXTA 3FPPA 4JBMA 4MZ9A 1IW7C 1LLRD 1PFBA 1R9TB 2VUMG 5A2QL 1HR0W 1J9OA 2KOLA 1UE7A 2EZVA 2UUCQ 2IX1A 2NVQB 2C35B 2VQFL 2JA8G 3AFPA 2F3VA 4J8QA 2NVTB 2OTJA 5D3DA 5M5XH 4BBRB 1G291 4KY7A 4DUYQ 1CHPD 4DV3Q 1IBKL 1OXUA 4IPHA 1SMYD 4KV6A 4I65A 3K81C 4RGMA 2EXZA 5C4HA 2XTIA 1H9MA 4RHRA 4FNFA 1DJRD 1STNA 1PV4A 1YNJC 1PH7A 1U0LA 5K5PA 3MZ5A 4A3BB 4HIMA 4G4KA 5C3XA 2UXCQ 3KBXA 3A0JA 2ES2A 1K0RA 1VQBA 3KYHC 4AYBG 4KTAA 3J7AF 2HCCA 4QCLA 1DM0B 1AW7A 4XT1B 5G3LF 2BE5C 1PTOF 2FMMA 3S1RB 1K8AC 4HTHA 1BBWA 2PQAA 2EYHA 1YEZA 2K01A 2UUAQ 4OEMB 5BN3A 2EDGA 3J81E 5EPJA 1U4RA 4IFDJ 4RFBA 1YNND 3ER0A 1F9PA 3M4YA 5ELCA 4A75A 2WINB 2AHOB 2M9VA 1O78A 1UWVA 1JE4A 2F52A 1ENFA 4OO1I 1PRTC 4X65L 1BBXC 2QILA 1G91A 4LF5Q 1HNZQ 2FMCA 2QGQA 3FP9A 1Q1BA 1CA5A 5M3MB 1K8GA 4C3IB 5M3MH 2OCEA 2A69D 3Q24A 4FXKC 1E2WA 3UDIA 1DGSA 5C0XG 4BY7B 4IALA 3PO3H 1J5EQ 1HR0Q 1JR0D 1B44D 1XMQQ 1P8LA 2K05A 4DNIA 3J7ZC 1GUWA 4NDXA 3I8ZA 2QCPX 2M00A 3PUWA 1DZ1A 1SBBB 3HRZC 4C1NI 1Y1WG 1GOZA 3HOXH 1Q7YC 5M9OA 5JEAJ 3STBC 5IWAQ 2JA6G 1SE2A 2JE6I 1CTMA 5I9OA 3MEHA 4PMBA 1HFGA 1PZKD 3NP8A 4ZAIA 3HG9A 5C3EG 3R3OA 4JG2A 1Q86C 1W2BA 4HJ8A 2AQ3B 4OWXB 3K7AB 3W1GA 1PA6A 4Q5VA 1N32Q 5A35A 4C3JH 4DV5L 3SK8A 4DF7A 1PRTF 3DWPA 1BUVT 2R6GA 5HY6A 1NR2A 3CCEA 1GVPA 5JJKA 4ME3A 5FKAC 1NY4A 4UP9A 3K5LA 1SJHD 1XPRA 1MSHA 2BA0A 3CCSA 1SAPA 4P75A 2LKVA 5DNFA 5IYDG 2LS01 4GZYC 4DAVA 4QQBX 3NPPA 2N78A 2AWOA 2EJMA 4R4QA 1PLFA 4RH6A 1KXLA 3KF8A 4N8X1 2VZAA 4FVMA 5C5LA 4YY3L 1Q8KA 1DCZA 4J6HA 1IYJB 4QJFA 1HRJA 1IBKQ 5BR8L 4ZK9B 2VL6A 4IN3A 3S14B 3RZDB 2K5HA 3S14H 3NELA 2B2UC 2V4DA 3RZDH 2MNAA 5J22A 4CBVA 4GLVB 4JI2L 2E2IB 4I7AA 2F3WA 3DHQA 3MXGA 4TKOB 3FDTA 2E2IH 3M7NA 2E2JB 3WDNA 4KJOA 1EYAA 1RCVD 1STBA 4A3GH 1RL2A 2SOBA 4V190 2EYJA 3S2DH 1Z7TA 5EGTA 1EYGA 4PZ6A 5BN4A 3HOZH 1UAPA 2JEBI 4H0LC 1LTGD 2B2WC 2NYZD 2KENA 1I4GA 1IBLQ 5KNCA 5I6YA 2IT1A 1EOVA 3OWFA 4DR3Q 4JV5L 2L0CA 2KQ3A 4F8MA 3RN5A 4CDFC 3MXNB 4HMIA 4JVZA 4HIKA 5C4JH 3GTMB 5CBEE 3RR5A 1ML0D 2R7ZB 5IGBA 1Y8PB 1PVOA 2RVLA 1W6JA 4TSSA 2R93G 4A3EB 2EYFA 1L0YB 1W6KA 2PNRC 4PZ7A 3S1QH 1YHAA 1OXVA 4X3UA 1GUNA 3CMAA 3E3XA 3JC66 3ZJYC 4ZYSA 5IYBH 1WCMB 3I90A 2D2CC 4GN4B 1VF5C 3RMHA 1BQQT 3HOXG 4EQOA 1S5CD 5FO9B 5J39A 3S1NB 5DM73 3KDFB 2JYOA 4LF4L 4DV2L 1D1KA 2YTXA 4A3JG 3F2CA 2CW0D 2B2YA 4YHHQ 1E3PA 1V1PB 5LMNL 4C56C 2ZJPA 4Y7NH 1VF7A 2K5QA 2B39A 5J3BA 2BA1A 3P75A 1T9HA 4DR7Q 3OIPA 4A3IH 5LMUL 1PH5A 1EWCA 2A68D 4K5VA 1HZCA 4TRDA 1CUKA 5KNDA 1JB3A 1NR4A 1RKNA 1CM9A 1JWSD 1ICWA 1O7YA 1ZYRC 2B2TA 3G4SA 1XXGA 3NBHB 5BN5A 1A0IA 3I56A 2NZ1D 1B3QA 1EY8A 4ZKCB 3K59A 4LUVA 2G9DA 1STGA 1QVCA 1EZ8A 3TEHB 4E6IA 3PIP3 5IYCG 3HKZB 2NVYH 3J81j 3UE1A 4DR5L 1VQ4A 4QB4A 1N33L 3HOWG 4DV5Q 4K0KL 1A15A 2Q2HA 1C8CA 1E24A 1UE1A 3FRPB 1K3RA 2K52A 4X66L 3HOYH 1STHA 1WTPA 3FEWX 3HKSA 3G48A 1JOKA 2K5NA 5JPMC 4HJ5A 2R92G 1XPUA 1G6ZA 3NK9A 1B9MA 1JICA 1VQMA 1V9PA 3H0GG 1ASYA 3BDLA 1U4MA 2Z8LA 1Y8NB 3NENA 2F0SA 2A6HC 2Z1CA 3TSSA 5E4WC 5IY0A 4BY1H 5CV8A 2HHHQ 4KLKA 1R4PB 2A74C 2NWGA 3TP5A 5FLXE 3TRZA 1E22A 2K14A 2AMCB 3T56B 2A6ED 5BR8Q 1B8AA 3CC2A 1LTLA 2V1CC 4JPBW 3M4PA 1IZ6A 2IPKD 1X3PA 1IL2A 3G6EA 2HQEA 1AFPA 2N55A 2PMZB 3K80C 2QEXA 3IKJA 5I6WA 4GN3B 4DA2A 3CRLC 2PO4A 1VQEA 2IWHA 3DWQA 1E0BA 1B4OA 4U673 2WAQG 1RTNA 5FLXL 3EQLC 2JSOA 1U4PA 3CF5A 3BDOA 1B9NA 4HJ9A 3C1EA 5KEEA 1V1OA 4A3MB 4IPCA 1EY7A 1EY0A 2H1EA 5FK9C 1UUPA 4FF4A 5I2XA 5D65A 4A3MH 4OO1G 1G6PA 4JV5Q 2MJ8A 5CV7A 1CQVA 4XIGS 2RBMA 1NTGA 5IYBG 3S16B 4DAPA 1RF2D 1LT3D 5EPLA 1VDZA 4EQ5A 5ISRA 4DK1A 3KK7A 5C0XI 1S5ED 1VQGA 2K75A 3CC7A 4NB3A 4B3MQ 3RUZA 1QOHA 1PYWD 2ATWA 2WP8J 2K32A 5CR3A 3R8BA 3PV0A 3KUPA 3MXPA 1LT5D 1Q1EA 1TWGB 3GV3A 3U9OA 4BBSG 4ZUIA 3GTOB 4LF4Q 2BCOA 4DV0L 1L0WA 2H5XA 5EKIA 5LMNQ 4YIJA 3PUVA 5IGCA 2KHIA 4K6DA 3MFYA 2I5LX 3O13A 1L1OB 1YJNA 5M3FB 3PUZA 1SNOA 3HKZE 1QB5D 5C4XH 5LMUQ 3KFUA 5LL6X 3F8TA 4GNXB 3C3LA 1MKHA 1JOQA 3F2DA 4H13C 1M1KC 2RDGA 4IUNA 3CW2C 3ERSX 2GVAA 3K0XA 4DV7L 2N88A 2OWOA 2EQSA 1I6VC 2X69A 1D5MC 1E1TA 4LUOA 2YV5A 4LW1A 4OONA 3V96A 1A3TA 2EE1A 1K0SA 2ZJQA 4DKAC 3KLWA 2DY8A 4NKLA 1VS0A 1N33Q 3E5SA 1UE5A 2VUMH 1FNVA 1X32A 3TMEA 2OEOA 2D62A 3MXNA 3KJOA 4KHVA 1D1IA 1Y1VB 2JA8H 3IAYA 1F2ZA 4GLAC 1SEBD 4X66Q 5EKLA 1U5KA 5CV4A 1JB7A 2Z0SA 3S2HH 5IIFA 1W3SA 1GJXA 2PCFB 2NBFA 5GADC 2XVSA 3S9WA 1P16A
chains in the Genus database with same CATH topology
2K33A 3D8GA 1SE3A 5CV9A 1Q3LA 3QOLA 2XRQD 3OMGA 3DMUA 1QNKA 1K8OA 3SK6A 2F0OA 4WORA 4XTCS 1V1PA 2EVBA 2XWBB 5IGFA 3NQIA 4MN3A 4HMJA 4A93B 2EYPA 2EYLA 1X3QA 4NMZA 2E74C 1QCBD 2NVXB 3HP3A 3A56A 3BG3A 2O5IC 2KA7A 2LY7A 3X3MA 1EY5A 4KKTA 1EQTA 3GTLB 1EY6A 3E6ZX 4KN7C 4Q0FA 2MHVA 3NBHA 1WTOA 4V0BA 3D31A 3TP7A 3T13A 1Q90A 2SNMA 3DEPA 3BYYB 1SDFA 4WFN3 2IJ0A 2KJXA 5C0XH 4OIKA 2AWNA 1LACA 4R9WA 3QWNA 4KD4A 1RD9D 3JAME 1AN8A 1RJTA 1STEA 4DXFA 1G2TA 1ET9A 2F0HA 2JA6B 3SVMA 4C3HG 5KGUA 1EIGA 3TP6A 2H4OA 3SK5A 4DN4M 1WD1A 3TZDA 4DGZA 1J8IA 2NTTA 2A5HA 3R93A 4G7OC 1V8QA 1TS5A 3JAML 3BVGA 1L0XB 5C6AA 5JVH3 1II3A 5I2YA 4HSPA 3SR1A 2EY1A 2KECA 1A2UA 5M5XB 3QOJA 4F87A 2M2LA 2IX3A 1ENCA 2DNCA 2XWJB 4B08A 2X6LA 3L7ZC 2F0KA 3Q6SA 1ZKOA 4B9XA 4PMCA 1D6EC 1MGSA 3K5MA 4HCSA 4UDUC 3QO2A 1WD0A 2Q8RE 4XQNA 2GA4B 2Q8IB 1AEXA 1TR5A 3K58A 3SHLA 2KEEA 5EBDA 3C46A 4ILWA 3VYRA 1I4PA 1IL8A 2SEBD 4FXGC 1WTVA 2OXPA 1T5XD 1AZPA 2PPBC 5CMDA 2BDOA 3SK4A 2WACA 1LV9A 3DXJC 2ZXPA 5ELDA 2R93B 2L11A 1EY4A 5G3LD 3RD4A 3J81L 1U4LA 3SE0A 3QG1A 1PTOD 3PO3B 2HCIA 3A54A 1STAA 2F0TA 2CQAA 1IW7D 1QG7A 3HOXB 2F0LA 3VR4A 1HXYD 4RCNA 1RODA 4XDXA 1PFMA 3G7LA 2J0TD 1WTRA 1NAPA 1F9QA 3K6OA 3GTPB 1BCPB 1VMPA 1F2YA 2QEJC 3GTJB 4K2KA 4C3JB 5KYIA 1QWYA 3MAQA 1TY0A 1YNJD 5AFWA 4IFDG 5C3WA 5K36G 4PQXA 5IOCA 2KEDA 3D3RA 4K8JA 3N6RA 4KI0A 5FO7B 3SXHA 4IUVA 5EKKA 3NUCA 3VR2A 2MPMA 2BE5D 3ERQA 1F9RA 1SYFA 3MFGA 1XX8A 3T4AC 1EEID 2Q8TA 5E1FA 5CC4A 1DD2A 2L9HA 5D3IB 2R92B 4DAYA 3PMFA 1NCVA 2AUJD 2FFKB 1D5ZC 3A8JE 3D4WA 2KHSA 1PRTD 2R61A 4DNTB 2XSCA 2B2UA 4A3GB 5JEAG 5COYA 1ENAA 5EPKA 4KKUA 5JPNC 3S2DB 1H9RA 3HOZB 3CKIB 3K0YA 1SNMA 1TY2A 4RAUC 2AQ2B 1EEFD 4KK7A 1EU3A 5C4JB 2B2WA 4XQJA 1SNPA 4X3TA 1H9SB 1SXTA 3V05A 2WV6D 1GHJA 3S1QB 1HCZA 3LWUA 1BO0A 1MSGA 5LHY1 1LABA 4OO1H 1ILPA 1A3UA 3VR5A 3I70A 2CHBD 4C3IG 4K14A 4PMWA 3I4LA 4Y7NB 4BA2I 3A8IE 4A3IB 1O7LA 4RGNA 1QILA 1D5XC 4KMUC 1DOLA 1EL0A 4OIJA 3D6CA 4L6TB 3J7YW 4LK1C 5M5WB 4CKBA 5T1IA 4QUCA 3OOCA 4OHJA 5NUCA 1IKLA 2NVYB 4N9PA 2G9HD 1LTBD 3OIQA 1KAAA 2DY7A 1ZEQX 3HOYB 4J1MA 2X6GA 1DXMA 5FO8B 4I7ZC 1KTKA 4L63B 2EY6A 5CYUA 3A7AB 3ND9A 1HA5A 4IUUA 2F0GA 4IUTA 4BY1B 1SYEA 4HN7A 5J1ZA 5IGDA 1G2SA 3Q22A 2D9UA 4QF4A 2EYOA 4L8JA 4IURA 1MBYA 1DOKA 1CFMA 4FP5D 1S5DD 2F0PA 3MWYW 3CRKC 1TIID 3F2UA 1SNQA 4MHEA 1RTOA 4FF1A 1EYCA 5CGKA 1BCPC 3I4MB 1SE4A 5DEHA 4NW2A 2F0WA 1PTOH 2TMPA 3TZUA 1K83B 1M8AA 4BA1I 4OL7A 3D6WA 2VB3X 1A6XA 3HS0C 2K03A 1ZYRD 5T1GA 2Z4HA 3VA5A 3KLSX 1B50A 1NSNS 3MVVA 3AB9A 2PW5A 4KHZA 1TU2B 2FINB 3A8KE 3HGBA 4S3SA 1H9JA 2FJ2A 2OT2A 4KY5A 4LMQD 3W2DA 3NXWA 4UAIA 3S17B 2HDMA 4CKCA 3ONAB 4TQUS 1WVLA 5FOBB 2F0IA 1RDPD 5ELEA 3NTIA 3D4RA 3V2TA 3SDZA 1HHVA 4FYDA 5C4XB 2EJFC 4F88A 4G7ZC 1UNSA 1BCPF 4ABNA 1SNCA 2XN9C 5E3FA 2A6HD 4C3HB 2QDBA 4XYOA 1JQYD 3EFXD 4IFDI 5C4ZA 5KNBA 2JP1A 2PYKA 1EZ6A 1I4RA 2DNEA 2JXMB 1ESFA 2EY5A 4QUFA 4NP5A 3AU7A 1WTQA 2VUMB 3VR6A 3J7AV 5JOBA 4RA8A 1B3AA 2JA8B 2AUKA 1BDOA 5IGGA 1LTTD 2E75C 2ZXOA 3S2HB 4X3SA 5IODA 3P20A 3OMCA 3T51B 4IQZA 2MUYA 3IFTA 4XT3B 1SYBA 1CT1D 1MD2D 4EVOA 4R8NA 2XNAC 1SJED 3LNNA 2BDNA 3GQBA 2WKDA 1AP0A 1KNAA 1NUCA 4BS9A 4PNYA 4AYBB 1FD7D 1Y8OB 5I4DA 3ND8A 1BOSA 4RKBA 5KRUA 1OXXK 4M1UB 5CV6A 4XQQA 2NN6I 1CA6A 2B2VC 3BVMA 2L4NA 1LTAD 4Z9CB 1B53A 1VCIA 2B2VA 2PZWA 1SMYC 1HUMA 4LJZC 1UEAB 2WB1B 3BS1A 4WJWA 3RLFA 3OPOA 3IFDA 1O7ZA 5JVG3 4U68A 2BOSA 1S5FD 3HZXA 3KLRA 3G6JB 3EA6A 4DXGA 3GO5A 2DN8A 3BZDB 1QNUA 4F7XA 1KDBA 4K2LA 4QMGA 1Y1WB 1ONLA 3DWAA 3GP7A 1S4ZA 1JCKB 3AMUA 4XYQA 1YNNC 2ZT9C 5ELFA 4KJNA 5C3EB 4WRDA 4KKSA 1OO9B 3ITPA 4CJ1B 3VYUA 5A2QE 4OGQC 2OF1A 1LTSD 3D4DA 5EBCA 1D2BA 1DONA 1TS2A 4IFDH 5K36H 2A69C 2NTSA 3I91A 5KIXA 2D5DA 2LFNA 4P2CB 4G57A 1I3QB 3M7GA 5CV5A 5KYLA 1F2LA 2RA4A 1QJOA 1DOMA 3L3OC 1A2TA 2E76C 1IKMA 3I73A 1PXUA 1EWHA 3MC0B 5C0XJ 2K5DA 5I9PA 2A73B 1SYGA 1EY9A 1HTLD 5E4XA 5EJWA 3FKIB 1R4QB 1KNEA 3UI2A 4HCEA 1XYIA 5JEAH 1SNDA 2QKIC 2K1BA 3OWEB 4RGTA 3MHBA 1JWMD 1MI2A 1CI3M 1CZWA 2IX0A 4HAEA 1KDAA 2KUMA 1SFOB 4LAAA 4RHSA 2NN6H 3N52A 4ZLTF 1KDCA 3OHXC 1F2MA 1EFID 4B9WA 4DFAA 2WKCA 1TS3A 1U9RA 3TBIB 4RCOA 1OXTA 3BDCA 2K7VA 4ZRZA 3ZYYX 3BYTB 3H09A 1PZID 4A3JB 1CZGA 1TWAB 2RSOA 3H91A 1BF4A 5CORA 1I50B 4G7HC 1LT4D 1FNUA 3PIO3 3K5OA 2ZXRA 2VXWA 2RSNA 3NWSA 3FMCA 2B8GA 1HQRD 1Q8IA 3GD7A 2RKSA 1TVXA 1HPCA 2F0FA 3HOWB 4H44C 1LO5D 3NTKA 1LTRD 3LX0A 4HSVA 2VNUD 1ESRA 1HA6A 1KLUD 2TSSA 3QIAA 4O1NA 4RKLA 1E2VA 3EVQA 2CW0C 1EOTA 3LWEA 3C1FA 1F77A 4C2MB 3FPUB 4FO2A 1A3VA 3H0GB 2PZUA 4BWGB 2KVMA 2J4XA 3RZOB 2A68C 4CKEA 1XWEA 3T16A 3X3NA 5IGEA 1SYDA 3IL8A 1Z47A 1SYCA 2EYMA 4DU9A 3Q23A 4CHTB 5IT9E 3C2PA 1IHZA 1K8MA 1WTWA 2ICIA 1AZQA 4QIWB 3H94A 2SDFA 2WAQB 1FYCA 2NN6G 1FGBD 3VYTA 4ODGA 1M4VA 2HUGA 2I46A 2AQ1B 3CHBD 1QE6A 3NBIA 3CU7A 4A3DB 4ULLA 5IT9L 5CBAE 3NQTA 2IW3A 2YU9B 3HOUB 1XTCD 1I6HB 3KBGA 2LMCB 2A6EC 4DK0A 4CJ0B 1FNWA 3S15B 4IZ8A 2RDHA 1GHKA 3WOFA 4BBSB 4HR7B 3E0JA 2EPBA 3VYSA 2B2YC 3NSWA 4FF3A 2O5JC 1E2ZA 4XXEA 1JC7A 3PO2B 2ENBA 3HOVB 1VMCA 1V43A 2B2TC 4RWSC 3W3AA 1STYA 4C3JG 2VB2X 4EQPA 1B2TA 5F2DA 2F0MA 4ZQ3A 4ZKBB 2L5TA 3DM1A 3EJIA 4FXDA 1I4XA 1ILQA 4KN4C 2K6AA 2SNSA 1SSOA 4DNRB 2F0DA 3GV6A 3OSOA 4FF2A 3GTGB 4IUQA 2EY2A 4K5WA 2RQXA 3T53B 2PZTA 3K5NA 3OW7A 3GTQB 2L1BA 1I4HA 2XIWA 5EQ0A 1RHPA 1EQVA 1KLGD 5TSSA 3M4OB 1BXTA 1G8ZD 1B1ZA 1TS4A 4EGVA 1PFNA 5JAVA 4K5XA 1OXSC 2F0VA 5LL6S 5DM63 2F4IA 1PTOB 3VR3A 4CJ2C 1CQFA 5HGTA 1LT6D 3NTHA 3M3YB 2C5CA 2NUCA 3HEJA 3DUZA 2I07B 2KCNA 2J7ZA 1HTPA 4IUPA 3VA7A 3NE5B 3QB3A 2RDFA 2B63B 1TWHB 1WTXA 3PUYA 2JA7B 1S5BD 3TDQA 1GUSA 1TWCB 1GUTA 2FHTA 3A55A 4ME5A 1T5EA 1F9SA 1ET6A 5JJZA 4CGYB 5DAUA 5C5MA 5D14A 2JA5B 3TN2A 1C4QA 2WIIB 4X3KA 1GUGA 2K5WA 1EIHA 4O42A 1LTID 1TQOA 2IL8A 2MGSA 1JORA 3Q0AA 3I4NB 2C9OA 3WOEA 2CVRA 4ZUJA 1JWUD 1TWFB 2EJGC 2B8FA 1HQMC 2K04A 2L55A 3MA2B 1PRTB 1JOOA 1HFNA 3MXUA 4M8AA 1BCPD 1H9SA 3S1MB 1HUNA 3MTSA 1IYUA 2F03A 2PQEA 3NHHA 2R3ZA 1IYVA 2NB0A 3KLSA 4KD3A 2EOTA 1BNZA 1FR3A 2E2DC 3NWTA 3K57A 4KY6A 1EU4A 2F0JA 2L12A 2YYZA 4N9TA 1Y69U 3TP8A 3SEBA 3R2TA 3J80E 2F0QA 1CHQD 3QJYA 3P1HA 1EYDA 2O4XA 5M5YB 3EROA 1GXDC 4K6LA 2O2LD 4H7BA 3R2IA 1I4QA 1KABA 2XRSD 3I3CA 2MP1A 3CQZB 4PV1C 2F0NA 3PUXA 2F0EA 3J80L 4R8IA 4A3FB 1TT2A 4RGOS 4A3KB 2KCCA 2JEAI 4MIUA 1C48A 3URYA 3H3VC 3M85A 4C1NK 3U9SA 3I72A 4HEDA 2Z4IA 1BR9A 3P7JA 2ICEC 3H6MA 2F1MA 3DEOA 2F0UA 2ID0A 1PZJD 1H9KA 3GTKB 2K28A 3BVZA 5C44B 1Z6HA 1GUOA 5ELBA 4K8IA 1CK1A 2QF7A 2Y0SB 3FVQA 4EQNA 4JBWA 2HDLA 4JK1C 1O80A 1PMRA 4ID6A 1DYQA 1Q12A 5HURA 2PW7A 3A7LA 1PTOC 1PDQA 3L9AX 2E2HB 1ZXTA 1TKWB 3FPPA 1IW7C 1LLRD 1PFBA 1R9TB 5A2QL 1J9OA 2KOLA 2EZVA 2NVQB 2IX1A 2F3VA 4J8QA 2NVTB 5D3DA 4BBRB 1G291 4KY7A 1CHPD 1OXUA 1SMYD 4KV6A 4I65A 4RGMA 2EXZA 5C4HA 1H9MA 4RHRA 4FNFA 1DJRD 1STNA 1YNJC 5K5PA 3MZ5A 4A3BB 4G4KA 5C3XA 3KBXA 4KTAA 3J7AF 2HCCA 4QCLA 1DM0B 1AW7A 4XT1B 5G3LF 2BE5C 1PTOF 2FMMA 3S1RB 4HTHA 2EYHA 2K01A 5BN3A 2EDGA 3J81E 5EPJA 1U4RA 4IFDJ 4RFBA 1YNND 1F9PA 3M4YA 5ELCA 2WINB 2M9VA 1O78A 1JE4A 1ENFA 4OO1I 1PRTC 1BBXC 2QILA 1G91A 2FMCA 1Q1BA 1CA5A 5M3MB 4C3IB 2A69D 3Q24A 4FXKC 1E2WA 5C0XG 4BY7B 4IALA 1JR0D 1B44D 2K05A 1GUWA 4NDXA 3I8ZA 2QCPX 2M00A 3PUWA 1DZ1A 1SBBB 3HRZC 4C1NI 1GOZA 5M9OA 5JEAJ 1SE2A 2JE6I 1CTMA 5I9OA 3MEHA 4PMBA 1HFGA 1PZKD 3NP8A 4ZAIA 3HG9A 3R3OA 2AQ3B 3K7AB 4Q5VA 5A35A 3SK8A 4DF7A 1PRTF 3DWPA 1BUVT 2R6GA 1NR2A 5FKAC 3K5LA 1SJHD 1MSHA 2BA0A 1SAPA 2LKVA 5DNFA 2LS01 4GZYC 4DAVA 3NPPA 2AWOA 2EJMA 1PLFA 4RH6A 3KF8A 4FVMA 5C5LA 1DCZA 4J6HA 1HRJA 4ZK9B 4IN3A 3S14B 3RZDB 2B2UC 2V4DA 5J22A 4CBVA 2E2IB 2F3WA 3DHQA 3MXGA 4TKOB 3FDTA 3M7NA 2E2JB 3WDNA 4KJOA 1EYAA 1RCVD 1STBA 2SOBA 4V190 2EYJA 1Z7TA 5EGTA 5BN4A 1UAPA 2JEBI 4H0LC 1LTGD 2B2WC 2NYZD 1I4GA 5KNCA 5I6YA 2IT1A 3OWFA 2L0CA 2KQ3A 4F8MA 4HMIA 3GTMB 5CBEE 1ML0D 2R7ZB 5IGBA 1Y8PB 2RVLA 1W6JA 4TSSA 4A3EB 2EYFA 1L0YB 1W6KA 2PNRC 1OXVA 4X3UA 1GUNA 4ZYSA 1WCMB 3I90A 2D2CC 1VF5C 3RMHA 1BQQT 4EQOA 1S5CD 5FO9B 5J39A 3S1NB 5DM73 2JYOA 1D1KA 2CW0D 2B2YA 1V1PB 4C56C 1VF7A 2K5QA 2B39A 2BA1A 3P75A 3OIPA 1EWCA 2A68D 4K5VA 4TRDA 5KNDA 1JB3A 1NR4A 1RKNA 1CM9A 1JWSD 1ICWA 1O7YA 1ZYRC 2B2TA 1XXGA 5BN5A 2NZ1D 1EY8A 4ZKCB 3K59A 2G9DA 1STGA 3PIP3 1EZ8A 4E6IA 3HKZB 4QB4A 1A15A 1C8CA 3FRPB 1STHA 1WTPA 3FEWX 1JOKA 5JPMC 1G6ZA 3NK9A 1B9MA 1JICA 3BDLA 1U4MA 2Z8LA 1Y8NB 2F0SA 2A6HC 2Z1CA 3TSSA 5E4WC 5CV8A 1R4PB 3TP5A 2A74C 2NWGA 5FLXE 3T56B 2A6ED 2IPKD 1X3PA 1AFPA 2HQEA 2N55A 2PMZB 3IKJA 5I6WA 4DA2A 3CRLC 2PO4A 2IWHA 3DWQA 1E0BA 1B4OA 4U673 1RTNA 5FLXL 3EQLC 2JSOA 1U4PA 3BDOA 1B9NA 3C1EA 5KEEA 1V1OA 4A3MB 1EY7A 1EY0A 2H1EA 5FK9C 1UUPA 4FF4A 5I2XA 5D65A 4OO1G 2MJ8A 5CV7A 1CQVA 4XIGS 2RBMA 3S16B 4DAPA 1RF2D 1LT3D 5EPLA 1VDZA 5ISRA 4DK1A 3KK7A 5C0XI 1S5ED 3RUZA 1QOHA 1PYWD 2WP8J 2K32A 5CR3A 3R8BA 3PV0A 3KUPA 3MXPA 1LT5D 1Q1EA 1TWGB 3GV3A 3U9OA 4ZUIA 3GTOB 2BCOA 5EKIA 4YIJA 3PUVA 5IGCA 4K6DA 3MFYA 3O13A 5M3FB 3PUZA 1SNOA 1QB5D 5LL6X 3C3LA 1JOQA 4H13C 2RDGA 4IUNA 2N88A 1I6VC 2X69A 1D5MC 3V96A 1A3TA 2EE1A 2DY8A 4NKLA 3E5SA 1FNVA 1X32A 3TMEA 2OEOA 2D62A 3MXNA 4KHVA 1D1IA 1Y1VB 3IAYA 1F2ZA 1SEBD 5EKLA 5CV4A 5IIFA 1GJXA 2PCFB 2NBFA 2XVSA 3S9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQ3 A;  4F7X A;  1KDB A;  1SNP A;  3C1E A;  4K2L A;  2EY5 A;  4QMG A;  4LAA A;  5KEE A;  3D8G A;  3SK8 A;  5J39 A;  5CV9 A;  4NP5 A;  4DF7 A;  1SYC A;  5DAU A;  5C5M A;  1EY7 A;  1EY0 A;  1STN A;  3QOL A;  3EJI A;  4QF4 A;  5C6A A;  3OMG A;  2EYO A;  3DMU A;  1KDC A;  1II3 A;  4MIU A;  5JOB A;  5K5P A;  1F2M A;  2EYM A;  3MZ5 A;  5CV7 A;  3P75 A;  3SR1 A;  2EY1 A;  2SNS A;  1A2U A;  2RBM A;  5C3X A;  4DU9 A;  5IGG A;  4TRD A;  4K5V A;  2F0P A;  2F0D A;  3QOJ A;  1A3U A;  4B9W A;  2LKV A;  1F2Y A;  1TQO A;  4DFA A;  3SK6 A;  4KJN A;  2F0O A;  3OSO A;  1IHZ A;  4KTA A;  4WOR A;  1U9R A;  3OMC A;  1RKN A;  1ENC A;  1SNQ A;  2EY2 A;  3H6M A;  5F2D A;  5ISR A;  4K2K A;  5IGF A;  1EYC A;  4WRD A;  3BDC A;  5CGK A;  4K5W A;  3ITP A;  1JOR A;  5KYI A;  2F0U A;  2PZT A;  1SYB A;  4HTH A;  4EVO A;  4HMJ A;  2EYH A;  4K14 A;  2OF1 A;  2F0K A;  2EYP A;  4R8N A;  5DEH A;  4ODG A;  4ZUJ A;  5C5L A;  3RUZ A;  5C3W A;  2EYL A;  3D4D A;  2F0W A;  4J6H A;  4NMZ A;  5IOC A;  1EY8 A;  5C4H A;  4B9X A;  4K8J A;  5CR3 A;  1STG A;  4PMC A;  1EZ8 A;  4E6I A;  1EQV A;  3MXP A;  3U9O A;  1EY5 A;  4OL7 A;  1JOO A;  3SXH A;  4QB4 A;  1NUC A;  1EY6 A;  5EKK A;  3NUC A;  4ZUI A;  5KIX A;  4K8I A;  3VA5 A;  5J22 A;  4PNY A;  3ERQ A;  4G57 A;  3NQT A;  3D6C A;  4YIJ A;  5IGC A;  1SYF A;  2F3W A;  3DHQ A;  4K6D A;  2PQE A;  3NHH A;  1NSN S;  3MVV A;  5JAV A;  2PW5 A;  5CV5 A;  5KYL A;  3TP7 A;  4EQN A;  1AEX A;  4K5X A;  1TR5 A;  4KJO A;  5E1F A;  1EYA A;  5CC4 A;  1STB A;  1STH A;  4S3S A;  3T13 A;  1SNO A;  2SOB A;  2F0V A;  1JOK A;  1A2T A;  2SNM A;  3SHL A;  4KD3 A;  5IOD A;  3NK9 A;  2EYJ A;  4ID6 A;  5EGT A;  4RKB A;  5KRU A;  4KY5 A;  1JOQ A;  5CV6 A;  3PMF A;  4IZ8 A;  5NUC A;  5HUR A;  5IGD A;  4IUN A;  3BDL A;  4IAL A;  4N9P A;  3NXW A;  5HGT A;  2PW7 A;  3D4W A;  2F0S A;  2RKS A;  4KY6 A;  5I9P A;  5I6Y A;  2F0J A;  2KHS A;  4N9T A;  3OWF A;  1KAA A;  3TP8 A;  5CV8 A;  2F0F A;  4NDX A;  2KQ3 A;  2OXP A;  1SYG A;  3TP5 A;  1EY9 A;  2F0I A;  4F8M A;  2NUC A;  3HEJ A;  2M00 A;  2F0Q A;  4HMI A;  4KD4 A;  2PZW A;  1A3T A;  3LX0 A;  5IGB A;  4J1M A;  3V2T A;  3SK4 A;  1ENA A;  3P1H A;  2WAC A;  5M9O A;  1EYD A;  2O4X A;  4NKL A;  4RKL A;  2EYF A;  2HQE A;  3E5S A;  3ERO A;  3EVQ A;  2EY6 A;  1SNM A;  2F0H A;  1EY4 A;  3QB3 A;  2RDF A;  1SNC A;  3TME A;  5I9O A;  2F3V A;  2OEO A;  3C1F A;  3MEH A;  4PMB A;  5E3F A;  1SND A;  2ENB A;  4H7B A;  4KHV A;  5I6W A;  3TP6 A;  1KAB A;  3SK5 A;  5KGU A;  1A3V A;  1F2Z A;  2QDB A;  2F0G A;  3NP8 A;  4KY7 A;  2PZU A;  3R3O A;  1STA A;  3S9W A;  3HZX A;  5EKL A;  5CV4 A;  2F0T A;  5C4Z A;  5IIF A;  1STY A;  1SYE A;  2F0N A;  4KV6 A;  4DGZ A;  3MHB A;  2F0E A;  4I65 A;  3T16 A;  2PYK A;  4EQP A;  4EQO A;  1EZ6 A;  2F0L A;  1TT2 A;  2EXZ A;  5J1Z A;  5IGE A;  4ME5 A;  1KDA A;  2F0M A;  1SYD A; 
#chains in the Genus database with same CATH topology
 3KOJ A;  2K33 A;  1Y14 B;  3D8G A;  1SE3 A;  5CV9 A;  4TVA B;  3K8A A;  1Q3L A;  3F1Z A;  2D0P A;  3QOL A;  3I55 A;  5AJ3 Q;  1MHW C;  2XRQ D;  3OMG A;  3DMU A;  1QNK A;  1K8O A;  2WFW A;  3KDF A;  1PH8 A;  3SK6 A;  2F0O A;  4WOR A;  4XTC S;  1V1P A;  2EVB A;  2XWB B;  1MIU A;  2KCM A;  5IGF A;  3NQI A;  2EIF A;  3MEF A;  3I4M G;  4MN3 A;  4HMJ A;  4A93 B;  2EYP A;  1N34 L;  1X54 A;  3A74 A;  3L0O A;  2EYL A;  1N9W A;  1X3Q A;  4NMZ A;  2E74 C;  1XNQ L;  1QCB D;  2NVX B;  3HP3 A;  3A56 A;  3BG3 A;  2O5I C;  2KA7 A;  1EFW A;  2LY7 A;  3JAM c;  3X3M A;  1EY5 A;  4KKT A;  1EQT A;  3GTL B;  1EY6 A;  3E6Z X;  4BXX G;  4KN7 C;  1B7Y B;  4Q0F A;  2MHV A;  3NBH A;  4DAY B;  3U58 A;  3A5Z B;  4DR2 L;  1WTO A;  3E9I A;  4V0B A;  3D31 A;  3TP7 A;  3T13 A;  1Q90 A;  3NEM A;  1PFS A;  2SNM A;  3M4Q A;  2VQE L;  3DEP A;  3BYY B;  2HIV A;  3QR8 A;  3I2Z A;  1VQ6 A;  2B63 G;  1SDF A;  4IO9 A;  5FLM H;  4WFN 3;  2IJ0 A;  2KJX A;  5C0X H;  1X9N A;  2JA7 G;  4OIK A;  2AWN A;  1LAC A;  4JOI A;  4R9W A;  3QWN A;  1GM5 A;  4KD4 A;  3BZC A;  1M90 C;  1RD9 D;  4B3S L;  3JAM E;  1AN8 A;  1RJT A;  1STE A;  2JA5 G;  1Y1W H;  2HT1 A;  4DXF A;  1G2T A;  1ET9 A;  3D0F A;  2F0H A;  2JA6 B;  4DV0 Q;  2JJQ A;  4LF9 Q;  3SVM A;  3T1Y L;  4C3H G;  5KGU A;  2JA6 H;  1EIG A;  3TP6 A;  2H4O A;  3SK5 A;  4JI5 Q;  2Z9H A;  4DN4 M;  5GAG C;  1KHI A;  1E1O A;  1WD1 A;  1BBU A;  3TZD A;  5C3E H;  4DGZ A;  3I4N G;  1J8I A;  2NTT A;  2A5H A;  3R93 A;  4G7O C;  4EX5 A;  1V8Q A;  1TS5 A;  3JAM L;  3BVG A;  4DV7 Q;  1XJV A;  1L0X B;  3IRB A;  4LUZ A;  5C6A A;  4GOP B;  4P73 A;  1II3 A;  5I2Y A;  5JVH 3;  4HSP A;  3SR1 A;  2EY1 A;  2KEC A;  1A2U A;  5M5X B;  3CCM A;  3QOJ A;  2XGT A;  1KD1 C;  3J81 c;  4F87 A;  2M2L A;  2IX3 A;  5HGQ A;  1ENC A;  5IYD H;  2DNC A;  2XWJ B;  3BU2 A;  1I3Q H;  4B08 A;  2X6L A;  3L7Z C;  2F0K A;  4NXM Q;  3Q6S A;  1ZKO A;  1VQ9 A;  4B9X A;  4PMC A;  1D6E C;  4AYB E;  1MGS A;  3WWV A;  3L2P A;  3K5M A;  4HCS A;  4HJA A;  4UDU C;  3QO2 A;  4DV1 L;  1WD0 A;  4OX9 L;  4DR4 L;  4UPA A;  1FJG L;  2Q8R E;  4XQN A;  2GA4 B;  3FKI H;  2GVB A;  2Q8I B;  1D8L A;  1AEX A;  1TR5 A;  1BKB A;  3K58 A;  3OTO L;  3SHL A;  4DR1 Q;  2KEE A;  5EBD A;  1IBM L;  3C46 A;  4ILW A;  1L1O C;  3VYR A;  1I4P A;  1IL8 A;  4GNX C;  2SEB D;  4FXG C;  1L1O A;  1FL0 A;  4A3F G;  1WTV A;  1N34 Q;  2OXP A;  4GNX A;  1T5X D;  2WB1 G;  1AZP A;  2PPB C;  4JI8 Q;  5DLQ E;  1NMF A;  2D0O A;  5CMD A;  2BDO A;  1Q81 C;  4R4O A;  3RLO A;  1VQL A;  3SK4 A;  1SFO H;  2WAC A;  1LV9 A;  3T1H Q;  3DXJ C;  2ZXP A;  3PIP A;  4GS3 A;  5ELD A;  2R93 B;  2L11 A;  4MNO A;  1EY4 A;  5G3L D;  3RD4 A;  5FLM G;  1U4L A;  3SE0 A;  3QG1 A;  3J81 L;  4GN5 A;  3KJP A;  1PTO D;  3PO3 B;  2HCI A;  2DGY A;  4YCV A;  3A54 A;  1STA A;  2OQK A;  3KF6 B;  2ZTE A;  2F0T A;  2RF4 A;  2CQA A;  4HID A;  1PHJ A;  1IW7 D;  1QG7 A;  4DK3 C;  2VQE Q;  4NXN Q;  2CFM A;  3HOX B;  2F0L A;  3VR4 A;  1HXY D;  1WYD A;  4RCN A;  1ROD A;  4XDX A;  1PFM A;  3G7L A;  2VW9 A;  2J0T D;  4A3J H;  1X55 A;  4JI0 Q;  4JYA L;  4LF7 Q;  1WTR A;  1XTD A;  4R1J A;  1NAP A;  4Y52 H;  4IPG A;  1F9Q A;  3K6O A;  3GTP B;  1BCP B;  1VMP A;  1F2Y A;  1AH9 A;  2QEJ C;  2UUB Q;  3GTJ B;  4B3S Q;  3GTP H;  1FGU A;  2LXJ A;  3AYH B;  3GTJ H;  2Y0S G;  4K2K A;  4C3J B;  5KYI A;  4YCU A;  1QWY A;  3MAQ A;  4O0A A;  1TY0 A;  1YNJ D;  3T1Y Q;  5AFW A;  4IFD G;  5C3W A;  5K36 G;  1YI2 A;  1PH9 A;  4PQX A;  4LFA L;  1QVF A;  5IOC A;  2KED A;  3D3R A;  4K8J A;  3H3V I;  3N6R A;  4KI0 A;  5FO7 B;  4FDB A;  3SXH A;  4IUV A;  5EKK A;  3NUC A;  3VR2 A;  1VQK A;  2MPM A;  5IYC H;  2BE5 D;  1S72 A;  2F4V L;  3ERQ A;  3RN2 A;  1F9R A;  3HOW H;  1A8V A;  1SYF A;  3MFG A;  1XX8 A;  3T4A C;  2VQF Q;  1EEI D;  2Q8T A;  3CCJ A;  5E1F A;  4POF A;  5CC4 A;  1DD2 A;  2MO1 A;  2L9H A;  5D3I B;  2NZO A;  1D7Q A;  1JJC B;  2R92 B;  4DAY A;  5GAE C;  4JI4 L;  3PMF A;  4POG A;  1NCV A;  2R92 H;  2ASB A;  2AUJ D;  2FFK B;  1D5Z C;  2N8N A;  3A8J E;  3D4W A;  4AIM A;  3H0G H;  1KL9 A;  2KHS A;  1PRT D;  4RG1 A;  2FXQ A;  2R61 A;  3FKI G;  4DNT B;  3CCV A;  2XSC A;  2B2U A;  5ELN A;  4A3G B;  5JEA G;  5COY A;  1ENA A;  5EPK A;  4KKU A;  5JPN C;  1GD7 A;  3S2D B;  1H9R A;  4DV1 Q;  2F3I A;  3HOZ B;  3CKI B;  3K0Y A;  4OX9 Q;  1SNM A;  1TY2 A;  3E0E A;  4RAU C;  2VY3 A;  1FJG Q;  4DR4 Q;  2AQ2 B;  1EEF D;  1A62 A;  4KK7 A;  3J80 i;  1EU3 A;  3OTO Q;  5C4J B;  2B2W A;  3STB D;  4XQJ A;  1SNP A;  4X3T A;  1H9S B;  1SXT A;  3V05 A;  4GLX A;  2WV6 D;  4L5T A;  1GHJ A;  4QGU A;  2UXD L;  3CPF A;  1HCZ A;  3S1Q B;  3LWU A;  1BO0 A;  1MSG A;  5LHY 1;  1Q46 A;  1LAB A;  4OO1 H;  4X65 Q;  1ILP A;  1A3U A;  4GOP C;  3VR5 A;  3E9H A;  1HNX L;  2B29 A;  2NZH A;  3I70 A;  4GOP A;  2CHB D;  1ASZ A;  1CSQ A;  2YU9 H;  4YWL A;  4C3I G;  4K14 A;  4JI6 L;  1EIF A;  4PMW A;  3I4L A;  5IP9 G;  4Y7N B;  2PI2 E;  1XNR L;  4BA2 I;  1I6H H;  2Q2U A;  4BY7 G;  2KHJ A;  3A8I E;  1HNW L;  3S15 H;  3I4O A;  4A3I B;  1O7L A;  4RGN A;  1QIL A;  1D5X C;  3PGZ A;  4KMU C;  1XMO L;  3ICE A;  1GO3 E;  4JBK A;  4IOA A;  4BBS H;  4DAM A;  1DOL A;  1EL0 A;  1LYL A;  4OIJ A;  3D6C A;  4L6T B;  4LF8 L;  3J7Y W;  2UU9 L;  4IJL A;  4LK1 C;  1ICF B;  4JYA Q;  5M5W B;  2ZM6 L;  4CKB A;  5T1I A;  5M5W H;  4QUC A;  5FLX c;  3CCL A;  4JI7 L;  3OOC A;  4OHJ A;  5NUC A;  1IKL A;  2NVY B;  4N9P A;  3PO2 H;  4H02 A;  3HOV H;  3AQQ A;  2G9H D;  1LTB D;  3OIQ A;  1KAA A;  2DY7 A;  2R7D A;  4LFA Q;  1ZEQ X;  3H15 A;  3HOY B;  4J1M A;  2X6G A;  3CCU A;  3H3V H;  1DXM A;  5FO8 B;  4I7Z C;  1KTK A;  4L63 B;  2EY6 A;  4NPS A;  5CYU A;  3A7A B;  1RIP A;  3ND9 A;  3CCQ A;  5LMN W;  1HA5 A;  4OWT B;  4IUU A;  2F0G A;  2JK8 A;  2K50 A;  4IUT A;  4BY1 B;  4X64 L;  4X6A H;  1SYE A;  3GTG H;  4QY7 A;  4YCW A;  4HN7 A;  4YY3 Q;  5J1Z A;  5IGD A;  1G2S A;  3EIV A;  3Q22 A;  2HIX A;  1KC8 C;  2D9U A;  1X56 A;  4QF4 A;  2EYO A;  3KF6 A;  4L8J A;  4IUR A;  1MBY A;  1DOK A;  4QIW E;  4A4I A;  1CFM A;  4FP5 D;  4AH6 A;  4JI2 Q;  2WAQ E;  1Q82 C;  1WOC A;  1S5D D;  2F0P A;  3M4O H;  3HFZ B;  3MWY W;  3CRK C;  3RLN A;  1TII D;  3F2U A;  1SNQ A;  2KBN A;  4MHE A;  1RTO A;  1VQD A;  1EYC A;  5CGK A;  4FF1 A;  1BCP C;  2MFI A;  3I4M B;  1SE4 A;  1LM0 A;  5DEH A;  2YTV A;  4NW2 A;  2PI2 A;  3I4M H;  2F0W A;  4UHV A;  2Z6B A;  1YBY A;  1PTO H;  2TMP A;  3TZU A;  1K83 B;  1J6Q A;  4A3D G;  1M8A A;  4BA1 I;  4OL7 A;  1K83 H;  3D6W A;  2VB3 X;  1A6X A;  4DV6 L;  3HS0 C;  2K03 A;  3ULJ A;  1ZYR D;  5T1G A;  2Z4H A;  3VA5 A;  3M3Y H;  3KLS X;  1B50 A;  3HOU G;  4BXX H;  1NSN S;  3MVV A;  3AB9 A;  2PW5 A;  4KHZ A;  1TU2 B;  2FIN B;  4A3E G;  3A8K E;  3HGB A;  4S3S A;  1S40 A;  1H9J A;  2FJ2 A;  2OT2 A;  3ULP A;  1HNX Q;  4KY5 A;  4B3R L;  1KRS A;  4LMQ D;  3W2D A;  3NXW A;  2B63 H;  1WCM G;  4UAI A;  3S17 B;  1TWH H;  5IP7 G;  2HDM A;  3S17 H;  4CKC A;  3ONA B;  4JI6 Q;  4DV2 Q;  4TQU S;  1WVL A;  5FOB B;  2F0I A;  4LNQ A;  1RDP D;  2ZTC A;  5ELE A;  2JA7 H;  3NTI A;  4JI1 L;  3D4R A;  4JW0 A;  3V2T A;  3SDZ A;  1HHV A;  4FYD A;  5C4X B;  2EJF C;  4F88 A;  4G7Z C;  1UNS A;  1BCP F;  1XMO Q;  3PO2 G;  2BH2 A;  3HOV G;  4ABN A;  1SNC A;  2RCN A;  2JA5 H;  2XN9 C;  1HZ9 A;  5E3F A;  3OW2 A;  2A6H D;  1SMX A;  4C3H B;  2QDB A;  2UU9 Q;  2RHQ B;  4XYO A;  4A3L G;  1JQY D;  3EFX D;  4DV4 L;  4C3H H;  4A76 A;  4IFD I;  2ZM6 Q;  5C4Z A;  5KNB A;  2JP1 A;  2PYK A;  1EZ6 A;  2QA4 A;  4JI7 Q;  1I4R A;  2DNE A;  2JXM B;  1ESF A;  2EY5 A;  3I4N H;  1JE5 A;  4QUF A;  4NP5 A;  1VQP A;  3AU7 A;  4DR5 Q;  1WTQ A;  2VUM B;  5E7N A;  3VR6 A;  3J7A V;  5GRO A;  1TWF H;  5JOB A;  3CC4 A;  4RA8 A;  4K0K Q;  1B3A A;  2JA8 B;  1EQR A;  2AUK A;  1BDO A;  5IGG A;  1LTT D;  5FJ8 H;  2E75 C;  2ZXO A;  1HH2 P;  3S2H B;  4X3S A;  5IOD A;  3P20 A;  3OMC A;  3S1M H;  1VQJ A;  3T51 B;  4IQZ A;  2P5Z X;  4DUY L;  1CKM A;  4OXP A;  2MUY A;  3IFT A;  3PQI A;  4XT3 B;  1SYB A;  1CT1 D;  1MD2 D;  4EVO A;  4R8N A;  2XNA C;  1SJE D;  3LNN A;  4OWW B;  4UP8 A;  2BDN A;  1L2F A;  3GQB A;  4X64 Q;  2WKD A;  2Q2T A;  1AP0 A;  1KNA A;  4MTN A;  1NUC A;  4BS9 A;  1JJ2 A;  3UE0 A;  4PNY A;  1VQH A;  3UDF A;  2UXC L;  4DR6 L;  4AYB B;  1FD7 D;  1Y8O B;  5GAH C;  1UEB A;  1YIT A;  5I4D A;  3ND8 A;  1CKO A;  1BOS A;  5M5Y H;  3TS2 A;  4RKB A;  5KRU A;  1OXX K;  4M1U B;  5CV6 A;  5IE8 A;  3G71 A;  4XQQ A;  1FVI A;  2MO0 A;  2NN6 I;  1CA6 A;  1X65 A;  1VQ7 A;  2B2V C;  4L5R C;  3BVM A;  1CKN B;  2L4N A;  1LTA D;  3CQZ H;  4Z9C B;  2G5D A;  1B53 A;  1VCI A;  5L37 A;  2B2V A;  2PZW A;  1SMY C;  1HUM A;  4LJZ C;  1YHQ A;  1UEA B;  4A3F H;  2WB1 B;  3BS1 A;  4WJW A;  3RLF A;  1YJW A;  3OPO A;  3IFD A;  1O7Z A;  1JT8 A;  5JVG 3;  1O7I A;  4U68 A;  2IY5 B;  2BOS A;  3U50 C;  3A5U A;  1S5F D;  3HZX A;  1UE6 A;  3KLR A;  1X3E A;  4LF6 L;  3TQY A;  1J5E L;  1HR0 L;  3G6J B;  3EA6 A;  4KHP L;  3GO5 A;  2DN8 A;  4DXG A;  3BZD B;  1QNU A;  4B3R Q;  4F7X A;  1KDB A;  2K5V A;  4K2L A;  4QMG A;  1Y1W B;  1ONL A;  1NBW A;  3DWA A;  3GP7 A;  1S4Z A;  1K9M C;  3GTK H;  1JCK B;  3M9B A;  3AMU A;  4XYQ A;  5IWA L;  1YNN C;  2ZT9 C;  4JI1 Q;  5ELF A;  4KJN A;  5C3E B;  4WRD A;  4KKS A;  1OO9 B;  3ITP A;  5M3F G;  4CJ1 B;  1SN8 A;  3VYU A;  5A2Q E;  2YTY A;  4OGQ C;  1X3G A;  1I94 L;  2OF1 A;  1LTS D;  1NNX A;  3D4D A;  5EBC A;  1N32 L;  1D2B A;  1DON A;  1TS2 A;  4P74 A;  4IFD H;  5K36 H;  5FJ8 G;  1QZH A;  2A69 C;  4DUZ L;  3I7F A;  2NTS A;  3I91 A;  3BJU A;  5KIX A;  2D5D A;  2LFN A;  4P2C B;  4G57 A;  4A3C G;  2CCZ A;  3TRE A;  2E2H H;  1I3Q B;  2JA9 A;  3M7G A;  5CV5 A;  5KYL A;  1F2L A;  2RA4 A;  1C0A A;  1QJO A;  1DOM A;  2PNH A;  4J15 A;  3L3O C;  1R9T H;  1A2T A;  2E76 C;  1IKM A;  2NVQ H;  4R4I A;  3I73 A;  1PXU A;  1Y1V G;  1EWH A;  3MC0 B;  2L15 A;  5C0X J;  2NVT H;  1QZG A;  2K5D A;  5I9P A;  4BBR H;  2A73 B;  1SYG A;  1EY9 A;  1HTL D;  5E4X A;  5EJW A;  1QUQ B;  4CDD C;  3AFQ A;  3FKI B;  2MQH A;  2A19 A;  3F2B A;  1HZB A;  1R4Q B;  1KNE A;  3UI2 A;  1WTH A;  4HCE A;  1XYI A;  5JEA H;  4IPD A;  3VDY A;  4A3B H;  1SND A;  4DR6 Q;  1A63 A;  1X3F A;  2QKI C;  2WB1 E;  2K1B A;  3OWE B;  4RGT A;  3MHB A;  1K28 A;  1JWM D;  1MI2 A;  1CI3 M;  4A3K G;  1CZW A;  2IX0 A;  4HAE A;  1KDA A;  4P71 A;  2KUM A;  4DR3 L;  1XNQ Q;  4A93 G;  3S1R H;  1SFO B;  4LAA A;  2A1A A;  4RHS A;  2NN6 H;  3N52 A;  2LXK A;  4ZLT F;  1KDC A;  1NJI C;  3OHX C;  1F2M A;  4GKK L;  4DR2 Q;  4CDC C;  1EFI D;  2CH4 W;  1PH3 A;  4B9W A;  1JMC A;  4DFA A;  2WKC A;  1TS3 A;  5ELO A;  1U9R A;  3DLL A;  3TBI B;  4RCO A;  1OXT A;  3BDC A;  2K7V A;  3U4Z A;  4ZRZ A;  3EBE A;  1KRT A;  3ZYY X;  3B6Y A;  3BYT B;  3H09 A;  1PZI D;  2N3S A;  4A3J B;  2CH4 A;  1CZG A;  4C3I H;  1TWA B;  2RSO A;  3Q8D A;  5IP9 H;  3H91 A;  5C44 G;  4LF6 Q;  1TWA H;  4YHH L;  2JN4 A;  4BY7 H;  2OQ0 A;  1BF4 A;  2Y0S E;  5COR A;  3CD6 A;  4KHP Q;  1I50 B;  4JC0 A;  2DJG C;  4DR7 L;  1I50 H;  4G7H C;  1LT4 D;  1FNU A;  3PIO 3;  1YHB A;  3K5O A;  2ZXR A;  2E8G A;  2VXW A;  1SRU A;  2RSN A;  3NWS A;  1B70 B;  2R7F A;  3FMC A;  3W5O A;  2B8G A;  1HQR D;  1Q8I A;  3GD7 A;  2RKS A;  1TVX A;  1HPC A;  1I94 Q;  2F0F A;  3HOW B;  2LSS A;  3K7U C;  4H44 C;  4RMF A;  1VQ8 A;  2ZJR A;  1LO5 D;  1EIY B;  3PF4 A;  1IXR A;  3CAM A;  3NTK A;  1LTR D;  3LX0 A;  3K7A H;  2AKW B;  4HSV A;  2VNU D;  1ESR A;  5IT9 c;  1HA6 A;  4DUZ Q;  1KLU D;  2TSS A;  3QIA A;  4O1N A;  1VQA A;  4RKL A;  1CKN A;  1E2V A;  3EVQ A;  2QDL A;  2E5L L;  2CW0 C;  1EOT A;  3LWE A;  3TS0 A;  1VQ5 A;  1N8R C;  2HQL A;  3C1F A;  1F77 A;  4BBR G;  4C2M B;  3FPU B;  4FO2 A;  1A3V A;  3H0G B;  4C2M H;  2PZU A;  1VQF A;  4BWG B;  2KVM A;  1N36 L;  2J4X A;  3RZO B;  2A68 C;  4CKE A;  1XWE A;  1I5F A;  3RZO H;  1TXY A;  3T16 A;  3X3N A;  5IGE A;  4PZ8 A;  1SYD A;  1VQI A;  3IL8 A;  2HHH L;  3CME A;  1Z47 A;  1SYC A;  1MJE A;  4A3B G;  1YZ6 A;  2EYM A;  4DU9 A;  4JI3 L;  3Q23 A;  4CHT B;  2CWP A;  3W1B A;  4L5Q A;  5IT9 E;  3C2P A;  4PG3 A;  1IHZ A;  1K8M A;  1WTW A;  2ICI A;  1AZQ A;  4QIW B;  3H94 A;  2SDF A;  2WAQ B;  2R93 H;  1IBM Q;  4HJ7 A;  1FYC A;  2NN6 G;  2E2J H;  1FGB D;  3VYT A;  4ODG A;  1M4V A;  2HUG A;  2I46 A;  2AQ1 B;  3CHB D;  1QE6 A;  3NBI A;  4YWM A;  3CU7 A;  1GKH A;  3PCO B;  4A3D B;  4ULL A;  4QL5 A;  4DPG A;  4A3D H;  1YIJ A;  5IT9 L;  5CBA E;  3NQT A;  2IW3 A;  2YU9 B;  3HOU B;  3GTM H;  5M3M G;  2R7Z H;  1XTC D;  4GKK Q;  3HOU H;  1KIX A;  1SLJ A;  1X6O A;  1I6H B;  3KBG A;  2LMC B;  2A6E C;  4DK0 A;  4A3E H;  1NE3 A;  4CJ0 B;  1FNW A;  2ALY B;  3PO3 G;  3S15 B;  4IZ8 A;  4B3M L;  2RDH A;  1G51 A;  3RNU A;  1S3O A;  4HIO A;  2ZTD A;  1GHK A;  3WOF A;  4BBS B;  4HR7 B;  2I5M X;  1WCM H;  3E0J A;  2EPB A;  3VYS A;  5IP7 H;  2B2Y C;  1SE8 A;  2VS1 A;  3NSW A;  4FF3 A;  2O5J C;  3S1N H;  1YNX A;  2RHS B;  1E2Z A;  2IHE A;  4XXE A;  1JC7 A;  3PO2 B;  4GKJ L;  1QUQ A;  2ENB A;  1Z9F A;  3HOV B;  1VMC A;  1PYS B;  1V43 A;  2B2T C;  1WFQ A;  3CPW A;  2I0Q A;  4RWS C;  1CSP A;  3W3A A;  3SGI A;  1STY A;  4C3J G;  3AEV A;  2VB2 X;  4A3L H;  1E7Z A;  4JCV E;  4EQP A;  1B2T A;  5F2D A;  1V1Q A;  2F0M A;  1YVC A;  4ZQ3 A;  4ZKB B;  3JAM i;  4N8F A;  2L5T A;  3DM1 A;  1BVS A;  3EJI A;  1QVG A;  4FXD A;  4L5S A;  1I4X A;  1ILQ A;  2KCT A;  4WJ4 A;  4KN4 C;  2K6A A;  4AQY L;  5JJI A;  2F4V Q;  2SNS A;  5JJL A;  1SSO A;  4DNR B;  2F0D A;  3S24 A;  1EQQ A;  4P72 A;  3GV6 A;  3OSO A;  4FF2 A;  3GTG B;  4IUQ A;  2EY2 A;  4ALP A;  1H95 A;  4K5W A;  1WI5 A;  4APV A;  2HD3 A;  2E5L Q;  2CWA A;  2RQX A;  2PZT A;  3T53 B;  3K5N A;  4JI4 Q;  3OW7 A;  3GTQ B;  4X62 L;  3GTQ H;  1N36 Q;  1PH2 A;  2L1B A;  1I4H A;  1SR3 A;  2XIW A;  5EQ0 A;  1RHP A;  1EQV A;  1KLG D;  5TSS A;  3M4O B;  5AJ3 L;  2DJF C;  1BXT A;  1G8Z D;  1B1Z A;  1TS4 A;  4EGV A;  1YJ9 A;  1PFN A;  4A3G G;  1PH4 A;  5JAV A;  4YWK A;  4K5X A;  3HOZ G;  1OXS C;  4JI3 Q;  2F0V A;  5LL6 S;  5DM6 3;  2F4I A;  3DM3 A;  1KQS A;  1PTO B;  1SRO A;  3VR3 A;  4CJ2 C;  2OTL A;  1CQF A;  5HGT A;  4O2D A;  1LT6 D;  3NTH A;  3M3Y B;  4CDE C;  1LUZ A;  2C5C A;  2NUC A;  3HEJ A;  2R7Z G;  3DUZ A;  2I07 B;  2KCN A;  2I5H A;  2J7Z A;  2UXD Q;  2CQO A;  1HTP A;  4LWC A;  4IOC A;  3J81 i;  4IUP A;  3VA7 A;  3NE5 B;  3QB3 A;  2RDF A;  3UDG A;  1WJJ A;  3CP0 A;  2B63 B;  1TWH B;  4MTK A;  2Q2I A;  1WTX A;  2Z6K C;  3S16 H;  4UP7 A;  4LFC L;  3PUY A;  2JA7 B;  1S5B D;  1HZA A;  2UXB L;  2Z6K A;  1TWC B;  1GUS A;  3TDQ A;  1GUT A;  1XNR Q;  2FHT A;  3A55 A;  4ME5 A;  1T5E A;  1TWC H;  2QW7 A;  3U4V A;  1HNW Q;  1F9S A;  1ET6 A;  5JJZ A;  4CGY B;  5DAU A;  5C5M A;  5D14 A;  4A3I G;  1PH1 A;  1JJG A;  2JA5 B;  3TN2 A;  1C4Q A;  1VQO A;  2WII B;  4X3K A;  1GUG A;  3J7A 5;  2K5W A;  2PQA B;  1C7Y A;  3PF5 A;  3FHW A;  1TWG H;  4LF8 Q;  1EIH A;  4O42 A;  1LTI D;  1TQO A;  4B3T L;  4LF9 L;  2IL8 A;  3GTO H;  2MGS A;  4JI5 L;  4LFB L;  1JOR A;  3Q0A A;  3I4N B;  2C9O A;  3UDX A;  4GKJ Q;  3WOE A;  2CVR A;  4ZUJ A;  5M3F H;  2IHF A;  3J80 c;  1JWU D;  1TWF B;  2EJG C;  2B8F A;  1HQM C;  3HKZ G;  2K04 A;  2L55 A;  3MA2 B;  1PRT B;  2EXD A;  1JOO A;  1HFN A;  2UUC L;  4JBJ A;  3MXU A;  4M8A A;  1BCP D;  1H9S A;  5EAY A;  3S1M B;  1HUN A;  3MTS A;  1IYU A;  3HOY G;  2F03 A;  2PQE A;  3NHH A;  1VQN A;  3LGJ A;  2R3Z A;  1VQC A;  1IYV A;  4AQY Q;  2NB0 A;  4DV3 L;  3CXC A;  4A3C H;  3KLS A;  2K4K A;  1EWI A;  4KD3 A;  2EOT A;  4IJH A;  1AE3 A;  1BNZ A;  4R4C A;  1FR3 A;  2GN5 A;  4BY1 G;  4NXM L;  4UY8 C;  2E2D C;  5H1S E;  3NWT A;  3K57 A;  1Y1V H;  1EU4 A;  4KY6 A;  4DK6 C;  2F0J A;  2L12 A;  2YYZ A;  4N9T A;  2JQO A;  3TP8 A;  1Y69 U;  1PH6 A;  3SEB A;  3R2T A;  2N49 A;  3J80 E;  4X62 Q;  2F0Q A;  3GDE A;  2PMZ E;  1OTC A;  4R4T A;  1CHQ D;  3OYY A;  3QJY A;  3P1H A;  1EYD A;  2O4X A;  5M5Y B;  3ERO A;  1K73 C;  1GXD C;  4K6L A;  2O2L D;  2UUA L;  4H7B A;  3R2I A;  1I4Q A;  1KAB A;  4DR1 L;  2XRS D;  3I3C A;  2MP1 A;  1C9O A;  3CQZ B;  3PIO A;  4PV1 C;  1AE2 A;  2F0N A;  3PUX A;  2F0E A;  3J80 L;  4R8I A;  4A3F B;  1TT2 A;  4RGO S;  5GQO A;  2B3G A;  4A3K B;  4A3M G;  3ULL A;  2KCC A;  4OEL B;  4A3K H;  4A93 H;  4JI8 L;  2JEA I;  4LF5 L;  1HNZ L;  4MIU A;  4DV6 Q;  1C48 A;  3BZK A;  3URY A;  3H3V C;  2NVX H;  3M85 A;  1IBL L;  4C1N K;  3U9S A;  3I72 A;  3T1H L;  3KF8 B;  4HED A;  1NMG A;  1XPO A;  2Z4I A;  1BR9 A;  3GTL H;  4WJ3 M;  3P7J A;  2ICE C;  3H6M A;  1K3B C;  2F1M A;  1XMQ L;  3DEO A;  2F0U A;  2ID0 A;  1PZJ D;  2BH8 A;  1H9K A;  3CCR A;  4NXN L;  3GTK B;  1EUJ A;  4LFC Q;  2K28 A;  3BVZ A;  2A8V A;  2DUD A;  4JOI C;  2UXB Q;  5C44 B;  1Z6H A;  1GUO A;  5ELB A;  5C44 H;  4K8I A;  4JI0 L;  1CK1 A;  4LF7 L;  2QF7 A;  1KAW A;  2CKZ B;  3PSI A;  1MJC A;  4ZCK A;  5C4X G;  2UUB L;  2Y0S B;  3FVQ A;  4EQN A;  4JBW A;  2HDL A;  2RCF A;  4JK1 C;  1O80 A;  1PYB A;  1PMR A;  4ID6 A;  4B3T Q;  1DYQ A;  1Q12 A;  4DV4 Q;  5HUR A;  2PW7 A;  3A7L A;  4LFB Q;  1PTO C;  3EN2 A;  1PDQ A;  3L9A X;  2E2H B;  1HJP A;  1TKW B;  1ZXT A;  3FPP A;  4JBM A;  4MZ9 A;  1IW7 C;  1LLR D;  1PFB A;  1R9T B;  2VUM G;  5A2Q L;  1HR0 W;  1J9O A;  2KOL A;  1UE7 A;  2EZV A;  2UUC Q;  2IX1 A;  2NVQ B;  2C35 B;  2VQF L;  2JA8 G;  3AFP A;  2F3V A;  4J8Q A;  2NVT B;  2OTJ A;  5D3D A;  5M5X H;  4BBR B;  1G29 1;  4KY7 A;  4DUY Q;  1CHP D;  4DV3 Q;  1IBK L;  1OXU A;  4IPH A;  1SMY D;  4KV6 A;  4I65 A;  3K81 C;  4RGM A;  2EXZ A;  5C4H A;  2XTI A;  1H9M A;  4RHR A;  4FNF A;  1DJR D;  1STN A;  1PV4 A;  1YNJ C;  1PH7 A;  1U0L A;  5K5P A;  3MZ5 A;  4A3B B;  4HIM A;  4G4K A;  5C3X A;  2UXC Q;  3KBX A;  3A0J A;  2ES2 A;  1K0R A;  1VQB A;  3KYH C;  4AYB G;  4KTA A;  3J7A F;  2HCC A;  4QCL A;  1DM0 B;  1AW7 A;  4XT1 B;  5G3L F;  2BE5 C;  1PTO F;  2FMM A;  3S1R B;  1K8A C;  4HTH A;  1BBW A;  2PQA A;  2EYH A;  1YEZ A;  2K01 A;  2UUA Q;  4OEM B;  5BN3 A;  2EDG A;  3J81 E;  5EPJ A;  1U4R A;  4IFD J;  4RFB A;  1YNN D;  3ER0 A;  1F9P A;  3M4Y A;  5ELC A;  4A75 A;  2WIN B;  2AHO B;  2M9V A;  1O78 A;  1UWV A;  1JE4 A;  2F52 A;  1ENF A;  4OO1 I;  1PRT C;  4X65 L;  1BBX C;  2QIL A;  1G91 A;  4LF5 Q;  1HNZ Q;  2FMC A;  2QGQ A;  3FP9 A;  1Q1B A;  1CA5 A;  5M3M B;  1K8G A;  4C3I B;  5M3M H;  2OCE A;  2A69 D;  3Q24 A;  4FXK C;  1E2W A;  3UDI A;  1DGS A;  5C0X G;  4BY7 B;  4IAL A;  3PO3 H;  1J5E Q;  1HR0 Q;  1JR0 D;  1B44 D;  1XMQ Q;  1P8L A;  2K05 A;  4DNI A;  3J7Z C;  1GUW A;  4NDX A;  3I8Z A;  2QCP X;  2M00 A;  3PUW A;  1DZ1 A;  1SBB B;  3HRZ C;  4C1N I;  1Y1W G;  1GOZ A;  3HOX H;  1Q7Y C;  5M9O A;  5JEA J;  3STB C;  5IWA Q;  2JA6 G;  1SE2 A;  2JE6 I;  1CTM A;  5I9O A;  3MEH A;  4PMB A;  1HFG A;  1PZK D;  3NP8 A;  4ZAI A;  3HG9 A;  5C3E G;  3R3O A;  4JG2 A;  1Q86 C;  1W2B A;  4HJ8 A;  2AQ3 B;  4OWX B;  3K7A B;  3W1G A;  1PA6 A;  4Q5V A;  1N32 Q;  5A35 A;  4C3J H;  4DV5 L;  3SK8 A;  4DF7 A;  1PRT F;  3DWP A;  1BUV T;  2R6G A;  5HY6 A;  1NR2 A;  3CCE A;  1GVP A;  5JJK A;  4ME3 A;  5FKA C;  1NY4 A;  4UP9 A;  3K5L A;  1SJH D;  1XPR A;  1MSH A;  2BA0 A;  3CCS A;  1SAP A;  4P75 A;  2LKV A;  5DNF A;  5IYD G;  2LS0 1;  4GZY C;  4DAV A;  4QQB X;  3NPP A;  2N78 A;  2AWO A;  2EJM A;  4R4Q A;  1PLF A;  4RH6 A;  1KXL A;  3KF8 A;  4N8X 1;  2VZA A;  4FVM A;  5C5L A;  4YY3 L;  1Q8K A;  1DCZ A;  4J6H A;  1IYJ B;  4QJF A;  1HRJ A;  1IBK Q;  5BR8 L;  4ZK9 B;  2VL6 A;  4IN3 A;  3S14 B;  3RZD B;  2K5H A;  3S14 H;  3NEL A;  2B2U C;  2V4D A;  3RZD H;  2MNA A;  5J22 A;  4CBV A;  4GLV B;  4JI2 L;  2E2I B;  4I7A A;  2F3W A;  3DHQ A;  3MXG A;  4TKO B;  3FDT A;  2E2I H;  3M7N A;  2E2J B;  3WDN A;  4KJO A;  1EYA A;  1RCV D;  1STB A;  4A3G H;  1RL2 A;  2SOB A;  4V19 0;  2EYJ A;  3S2D H;  1Z7T A;  5EGT A;  1EYG A;  4PZ6 A;  5BN4 A;  3HOZ H;  1UAP A;  2JEB I;  4H0L C;  1LTG D;  2B2W C;  2NYZ D;  2KEN A;  1I4G A;  1IBL Q;  5KNC A;  5I6Y A;  2IT1 A;  1EOV A;  3OWF A;  4DR3 Q;  4JV5 L;  2L0C A;  2KQ3 A;  4F8M A;  3RN5 A;  4CDF C;  3MXN B;  4HMI A;  4JVZ A;  4HIK A;  5C4J H;  3GTM B;  5CBE E;  3RR5 A;  1ML0 D;  2R7Z B;  5IGB A;  1Y8P B;  1PVO A;  2RVL A;  1W6J A;  4TSS A;  2R93 G;  4A3E B;  2EYF A;  1L0Y B;  1W6K A;  2PNR C;  4PZ7 A;  3S1Q H;  1YHA A;  1OXV A;  4X3U A;  1GUN A;  3CMA A;  3E3X A;  3JC6 6;  3ZJY C;  4ZYS A;  5IYB H;  1WCM B;  3I90 A;  2D2C C;  4GN4 B;  1VF5 C;  3RMH A;  1BQQ T;  3HOX G;  4EQO A;  1S5C D;  5FO9 B;  5J39 A;  3S1N B;  5DM7 3;  3KDF B;  2JYO A;  4LF4 L;  4DV2 L;  1D1K A;  2YTX A;  4A3J G;  3F2C A;  2CW0 D;  2B2Y A;  4YHH Q;  1E3P A;  1V1P B;  5LMN L;  4C56 C;  2ZJP A;  4Y7N H;  1VF7 A;  2K5Q A;  2B39 A;  5J3B A;  2BA1 A;  3P75 A;  1T9H A;  4DR7 Q;  3OIP A;  4A3I H;  5LMU L;  1PH5 A;  1EWC A;  2A68 D;  4K5V A;  1HZC A;  4TRD A;  1CUK A;  5KND A;  1JB3 A;  1NR4 A;  1RKN A;  1CM9 A;  1JWS D;  1ICW A;  1O7Y A;  1ZYR C;  2B2T A;  3G4S A;  1XXG A;  3NBH B;  5BN5 A;  1A0I A;  3I56 A;  2NZ1 D;  1B3Q A;  1EY8 A;  4ZKC B;  3K59 A;  4LUV A;  2G9D A;  1STG A;  1QVC A;  1EZ8 A;  3TEH B;  4E6I A;  3PIP 3;  5IYC G;  3HKZ B;  2NVY H;  3J81 j;  3UE1 A;  4DR5 L;  1VQ4 A;  4QB4 A;  1N33 L;  3HOW G;  4DV5 Q;  4K0K L;  1A15 A;  2Q2H A;  1C8C A;  1E24 A;  1UE1 A;  3FRP B;  1K3R A;  2K52 A;  4X66 L;  3HOY H;  1STH A;  1WTP A;  3FEW X;  3HKS A;  3G48 A;  1JOK A;  2K5N A;  5JPM C;  4HJ5 A;  2R92 G;  1XPU A;  1G6Z A;  3NK9 A;  1B9M A;  1JIC A;  1VQM A;  1V9P A;  3H0G G;  1ASY A;  3BDL A;  1U4M A;  2Z8L A;  1Y8N B;  3NEN A;  2F0S A;  2A6H C;  2Z1C A;  3TSS A;  5E4W C;  5IY0 A;  4BY1 H;  5CV8 A;  2HHH Q;  4KLK A;  1R4P B;  2A74 C;  2NWG A;  3TP5 A;  5FLX E;  3TRZ A;  1E22 A;  2K14 A;  2AMC B;  3T56 B;  2A6E D;  5BR8 Q;  1B8A A;  3CC2 A;  1LTL A;  2V1C C;  4JPB W;  3M4P A;  1IZ6 A;  2IPK D;  1X3P A;  1IL2 A;  3G6E A;  2HQE A;  1AFP A;  2N55 A;  2PMZ B;  3K80 C;  2QEX A;  3IKJ A;  5I6W A;  4GN3 B;  4DA2 A;  3CRL C;  2PO4 A;  1VQE A;  2IWH A;  3DWQ A;  1E0B A;  1B4O A;  4U67 3;  2WAQ G;  1RTN A;  5FLX L;  3EQL C;  2JSO A;  1U4P A;  3CF5 A;  3BDO A;  1B9N A;  4HJ9 A;  3C1E A;  5KEE A;  1V1O A;  4A3M B;  4IPC A;  1EY7 A;  1EY0 A;  2H1E A;  5FK9 C;  1UUP A;  4FF4 A;  5I2X A;  5D65 A;  4A3M H;  4OO1 G;  1G6P A;  4JV5 Q;  2MJ8 A;  5CV7 A;  1CQV A;  4XIG S;  2RBM A;  1NTG A;  5IYB G;  3S16 B;  4DAP A;  1RF2 D;  1LT3 D;  5EPL A;  1VDZ A;  4EQ5 A;  5ISR A;  4DK1 A;  3KK7 A;  5C0X I;  1S5E D;  1VQG A;  2K75 A;  3CC7 A;  4NB3 A;  4B3M Q;  3RUZ A;  1QOH A;  1PYW D;  2ATW A;  2WP8 J;  2K32 A;  5CR3 A;  3R8B A;  3PV0 A;  3KUP A;  3MXP A;  1LT5 D;  1Q1E A;  1TWG B;  3GV3 A;  3U9O A;  4BBS G;  4ZUI A;  3GTO B;  4LF4 Q;  2BCO A;  4DV0 L;  1L0W A;  2H5X A;  5EKI A;  5LMN Q;  4YIJ A;  3PUV A;  5IGC A;  2KHI A;  4K6D A;  3MFY A;  2I5L X;  3O13 A;  1L1O B;  1YJN A;  5M3F B;  3PUZ A;  1SNO A;  3HKZ E;  1QB5 D;  5C4X H;  5LMU Q;  3KFU A;  5LL6 X;  3F8T A;  4GNX B;  3C3L A;  1MKH A;  1JOQ A;  3F2D A;  4H13 C;  1M1K C;  2RDG A;  4IUN A;  3CW2 C;  3ERS X;  2GVA A;  3K0X A;  4DV7 L;  2N88 A;  2OWO A;  2EQS A;  1I6V C;  2X69 A;  1D5M C;  1E1T A;  4LUO A;  2YV5 A;  4LW1 A;  4OON A;  3V96 A;  1A3T A;  2EE1 A;  1K0S A;  2ZJQ A;  4DKA C;  3KLW A;  2DY8 A;  4NKL A;  1VS0 A;  1N33 Q;  3E5S A;  1UE5 A;  2VUM H;  1FNV A;  1X32 A;  3TME A;  2OEO A;  2D62 A;  3MXN A;  3KJO A;  4KHV A;  1D1I A;  1Y1V B;  2JA8 H;  3IAY A;  1F2Z A;  4GLA C;  1SEB D;  4X66 Q;  5EKL A;  1U5K A;  5CV4 A;  1JB7 A;  2Z0S A;  3S2H H;  5IIF A;  1W3S A;  1GJX A;  2PCF B;  2NBF A;  5GAD C;  2XVS A;  3S9W A;  1P16 A; 
#chains in the Genus database with same CATH homology
 2K33 A;  3D8G A;  1SE3 A;  5CV9 A;  1Q3L A;  3QOL A;  2XRQ D;  3OMG A;  3DMU A;  1QNK A;  1K8O A;  3SK6 A;  2F0O A;  4WOR A;  4XTC S;  1V1P A;  2EVB A;  2XWB B;  5IGF A;  3NQI A;  4MN3 A;  4HMJ A;  4A93 B;  2EYP A;  2EYL A;  1X3Q A;  4NMZ A;  2E74 C;  1QCB D;  2NVX B;  3HP3 A;  3A56 A;  3BG3 A;  2O5I C;  2KA7 A;  2LY7 A;  3X3M A;  1EY5 A;  4KKT A;  1EQT A;  3GTL B;  1EY6 A;  3E6Z X;  4KN7 C;  4Q0F A;  2MHV A;  3NBH A;  1WTO A;  4V0B A;  3D31 A;  3TP7 A;  3T13 A;  1Q90 A;  2SNM A;  3DEP A;  3BYY B;  1SDF A;  4WFN 3;  2IJ0 A;  2KJX A;  5C0X H;  4OIK A;  2AWN A;  1LAC A;  4R9W A;  3QWN A;  4KD4 A;  1RD9 D;  3JAM E;  1AN8 A;  1RJT A;  1STE A;  4DXF A;  1G2T A;  1ET9 A;  2F0H A;  2JA6 B;  3SVM A;  4C3H G;  5KGU A;  1EIG A;  3TP6 A;  2H4O A;  3SK5 A;  4DN4 M;  1WD1 A;  3TZD A;  4DGZ A;  1J8I A;  2NTT A;  2A5H A;  3R93 A;  4G7O C;  1V8Q A;  1TS5 A;  3JAM L;  3BVG A;  1L0X B;  5C6A A;  5JVH 3;  1II3 A;  5I2Y A;  4HSP A;  3SR1 A;  2EY1 A;  2KEC A;  1A2U A;  5M5X B;  3QOJ A;  4F87 A;  2M2L A;  2IX3 A;  1ENC A;  2DNC A;  2XWJ B;  4B08 A;  2X6L A;  3L7Z C;  2F0K A;  3Q6S A;  1ZKO A;  4B9X A;  4PMC A;  1D6E C;  1MGS A;  3K5M A;  4HCS A;  4UDU C;  3QO2 A;  1WD0 A;  2Q8R E;  4XQN A;  2GA4 B;  2Q8I B;  1AEX A;  1TR5 A;  3K58 A;  3SHL A;  2KEE A;  5EBD A;  3C46 A;  4ILW A;  3VYR A;  1I4P A;  1IL8 A;  2SEB D;  4FXG C;  1WTV A;  2OXP A;  1T5X D;  1AZP A;  2PPB C;  5CMD A;  2BDO A;  3SK4 A;  2WAC A;  1LV9 A;  3DXJ C;  2ZXP A;  5ELD A;  2R93 B;  2L11 A;  1EY4 A;  5G3L D;  3RD4 A;  3J81 L;  1U4L A;  3SE0 A;  3QG1 A;  1PTO D;  3PO3 B;  2HCI A;  3A54 A;  1STA A;  2F0T A;  2CQA A;  1IW7 D;  1QG7 A;  3HOX B;  2F0L A;  3VR4 A;  1HXY D;  4RCN A;  1ROD A;  4XDX A;  1PFM A;  3G7L A;  2J0T D;  1WTR A;  1NAP A;  1F9Q A;  3K6O A;  3GTP B;  1BCP B;  1VMP A;  1F2Y A;  2QEJ C;  3GTJ B;  4K2K A;  4C3J B;  5KYI A;  1QWY A;  3MAQ A;  1TY0 A;  1YNJ D;  5AFW A;  4IFD G;  5C3W A;  5K36 G;  4PQX A;  5IOC A;  2KED A;  3D3R A;  4K8J A;  3N6R A;  4KI0 A;  5FO7 B;  3SXH A;  4IUV A;  5EKK A;  3NUC A;  3VR2 A;  2MPM A;  2BE5 D;  3ERQ A;  1F9R A;  1SYF A;  3MFG A;  1XX8 A;  3T4A C;  1EEI D;  2Q8T A;  5E1F A;  5CC4 A;  1DD2 A;  2L9H A;  5D3I B;  2R92 B;  4DAY A;  3PMF A;  1NCV A;  2AUJ D;  2FFK B;  1D5Z C;  3A8J E;  3D4W A;  2KHS A;  1PRT D;  2R61 A;  4DNT B;  2XSC A;  2B2U A;  4A3G B;  5JEA G;  5COY A;  1ENA A;  5EPK A;  4KKU A;  5JPN C;  3S2D B;  1H9R A;  3HOZ B;  3CKI B;  3K0Y A;  1SNM A;  1TY2 A;  4RAU C;  2AQ2 B;  1EEF D;  4KK7 A;  1EU3 A;  5C4J B;  2B2W A;  4XQJ A;  1SNP A;  4X3T A;  1H9S B;  1SXT A;  3V05 A;  2WV6 D;  1GHJ A;  3S1Q B;  1HCZ A;  3LWU A;  1BO0 A;  1MSG A;  5LHY 1;  1LAB A;  4OO1 H;  1ILP A;  1A3U A;  3VR5 A;  3I70 A;  2CHB D;  4C3I G;  4K14 A;  4PMW A;  3I4L A;  4Y7N B;  4BA2 I;  3A8I E;  4A3I B;  1O7L A;  4RGN A;  1QIL A;  1D5X C;  4KMU C;  1DOL A;  1EL0 A;  4OIJ A;  3D6C A;  4L6T B;  3J7Y W;  4LK1 C;  5M5W B;  4CKB A;  5T1I A;  4QUC A;  3OOC A;  4OHJ A;  5NUC A;  1IKL A;  2NVY B;  4N9P A;  2G9H D;  1LTB D;  3OIQ A;  1KAA A;  2DY7 A;  1ZEQ X;  3HOY B;  4J1M A;  2X6G A;  1DXM A;  5FO8 B;  4I7Z C;  1KTK A;  4L63 B;  2EY6 A;  5CYU A;  3A7A B;  3ND9 A;  1HA5 A;  4IUU A;  2F0G A;  4IUT A;  4BY1 B;  1SYE A;  4HN7 A;  5J1Z A;  5IGD A;  1G2S A;  3Q22 A;  2D9U A;  4QF4 A;  2EYO A;  4L8J A;  4IUR A;  1MBY A;  1DOK A;  1CFM A;  4FP5 D;  1S5D D;  2F0P A;  3MWY W;  3CRK C;  1TII D;  3F2U A;  1SNQ A;  4MHE A;  1RTO A;  4FF1 A;  1EYC A;  5CGK A;  1BCP C;  3I4M B;  1SE4 A;  5DEH A;  4NW2 A;  2F0W A;  1PTO H;  2TMP A;  3TZU A;  1K83 B;  1M8A A;  4BA1 I;  4OL7 A;  3D6W A;  2VB3 X;  1A6X A;  3HS0 C;  2K03 A;  1ZYR D;  5T1G A;  2Z4H A;  3VA5 A;  3KLS X;  1B50 A;  1NSN S;  3MVV A;  3AB9 A;  2PW5 A;  4KHZ A;  1TU2 B;  2FIN B;  3A8K E;  3HGB A;  4S3S A;  1H9J A;  2FJ2 A;  2OT2 A;  4KY5 A;  4LMQ D;  3W2D A;  3NXW A;  4UAI A;  3S17 B;  2HDM A;  4CKC A;  3ONA B;  4TQU S;  1WVL A;  5FOB B;  2F0I A;  1RDP D;  5ELE A;  3NTI A;  3D4R A;  3V2T A;  3SDZ A;  1HHV A;  4FYD A;  5C4X B;  2EJF C;  4F88 A;  4G7Z C;  1UNS A;  1BCP F;  4ABN A;  1SNC A;  2XN9 C;  5E3F A;  2A6H D;  4C3H B;  2QDB A;  4XYO A;  1JQY D;  3EFX D;  4IFD I;  5C4Z A;  5KNB A;  2JP1 A;  2PYK A;  1EZ6 A;  1I4R A;  2DNE A;  2JXM B;  1ESF A;  2EY5 A;  4QUF A;  4NP5 A;  3AU7 A;  1WTQ A;  2VUM B;  3VR6 A;  3J7A V;  5JOB A;  4RA8 A;  1B3A A;  2JA8 B;  2AUK A;  1BDO A;  5IGG A;  1LTT D;  2E75 C;  2ZXO A;  3S2H B;  4X3S A;  5IOD A;  3P20 A;  3OMC A;  3T51 B;  4IQZ A;  2MUY A;  3IFT A;  4XT3 B;  1SYB A;  1CT1 D;  1MD2 D;  4EVO A;  4R8N A;  2XNA C;  1SJE D;  3LNN A;  2BDN A;  3GQB A;  2WKD A;  1AP0 A;  1KNA A;  1NUC A;  4BS9 A;  4PNY A;  4AYB B;  1FD7 D;  1Y8O B;  5I4D A;  3ND8 A;  1BOS A;  4RKB A;  5KRU A;  1OXX K;  4M1U B;  5CV6 A;  4XQQ A;  2NN6 I;  1CA6 A;  2B2V C;  3BVM A;  2L4N A;  1LTA D;  4Z9C B;  1B53 A;  1VCI A;  2B2V A;  2PZW A;  1SMY C;  1HUM A;  4LJZ C;  1UEA B;  2WB1 B;  3BS1 A;  4WJW A;  3RLF A;  3OPO A;  3IFD A;  1O7Z A;  5JVG 3;  4U68 A;  2BOS A;  1S5F D;  3HZX A;  3KLR A;  3G6J B;  3EA6 A;  4DXG A;  3GO5 A;  2DN8 A;  3BZD B;  1QNU A;  4F7X A;  1KDB A;  4K2L A;  4QMG A;  1Y1W B;  1ONL A;  3DWA A;  3GP7 A;  1S4Z A;  1JCK B;  3AMU A;  4XYQ A;  1YNN C;  2ZT9 C;  5ELF A;  4KJN A;  5C3E B;  4WRD A;  4KKS A;  1OO9 B;  3ITP A;  4CJ1 B;  3VYU A;  5A2Q E;  4OGQ C;  2OF1 A;  1LTS D;  3D4D A;  5EBC A;  1D2B A;  1DON A;  1TS2 A;  4IFD H;  5K36 H;  2A69 C;  2NTS A;  3I91 A;  5KIX A;  2D5D A;  2LFN A;  4P2C B;  4G57 A;  1I3Q B;  3M7G A;  5CV5 A;  5KYL A;  1F2L A;  2RA4 A;  1QJO A;  1DOM A;  3L3O C;  1A2T A;  2E76 C;  1IKM A;  3I73 A;  1PXU A;  1EWH A;  3MC0 B;  5C0X J;  2K5D A;  5I9P A;  2A73 B;  1SYG A;  1EY9 A;  1HTL D;  5E4X A;  5EJW A;  3FKI B;  1R4Q B;  1KNE A;  3UI2 A;  4HCE A;  1XYI A;  5JEA H;  1SND A;  2QKI C;  2K1B A;  3OWE B;  4RGT A;  3MHB A;  1JWM D;  1MI2 A;  1CI3 M;  1CZW A;  2IX0 A;  4HAE A;  1KDA A;  2KUM A;  1SFO B;  4LAA A;  4RHS A;  2NN6 H;  3N52 A;  4ZLT F;  1KDC A;  3OHX C;  1F2M A;  1EFI D;  4B9W A;  4DFA A;  2WKC A;  1TS3 A;  1U9R A;  3TBI B;  4RCO A;  1OXT A;  3BDC A;  2K7V A;  4ZRZ A;  3ZYY X;  3BYT B;  3H09 A;  1PZI D;  4A3J B;  1CZG A;  1TWA B;  2RSO A;  3H91 A;  1BF4 A;  5COR A;  1I50 B;  4G7H C;  1LT4 D;  1FNU A;  3PIO 3;  3K5O A;  2ZXR A;  2VXW A;  2RSN A;  3NWS A;  3FMC A;  2B8G A;  1HQR D;  1Q8I A;  3GD7 A;  2RKS A;  1TVX A;  1HPC A;  2F0F A;  3HOW B;  4H44 C;  1LO5 D;  3NTK A;  1LTR D;  3LX0 A;  4HSV A;  2VNU D;  1ESR A;  1HA6 A;  1KLU D;  2TSS A;  3QIA A;  4O1N A;  4RKL A;  1E2V A;  3EVQ A;  2CW0 C;  1EOT A;  3LWE A;  3C1F A;  1F77 A;  4C2M B;  3FPU B;  4FO2 A;  1A3V A;  3H0G B;  2PZU A;  4BWG B;  2KVM A;  2J4X A;  3RZO B;  2A68 C;  4CKE A;  1XWE A;  3T16 A;  3X3N A;  5IGE A;  1SYD A;  3IL8 A;  1Z47 A;  1SYC A;  2EYM A;  4DU9 A;  3Q23 A;  4CHT B;  5IT9 E;  3C2P A;  1IHZ A;  1K8M A;  1WTW A;  2ICI A;  1AZQ A;  4QIW B;  3H94 A;  2SDF A;  2WAQ B;  1FYC A;  2NN6 G;  1FGB D;  3VYT A;  4ODG A;  1M4V A;  2HUG A;  2I46 A;  2AQ1 B;  3CHB D;  1QE6 A;  3NBI A;  3CU7 A;  4A3D B;  4ULL A;  5IT9 L;  5CBA E;  3NQT A;  2IW3 A;  2YU9 B;  3HOU B;  1XTC D;  1I6H B;  3KBG A;  2LMC B;  2A6E C;  4DK0 A;  4CJ0 B;  1FNW A;  3S15 B;  4IZ8 A;  2RDH A;  1GHK A;  3WOF A;  4BBS B;  4HR7 B;  3E0J A;  2EPB A;  3VYS A;  2B2Y C;  3NSW A;  4FF3 A;  2O5J C;  1E2Z A;  4XXE A;  1JC7 A;  3PO2 B;  2ENB A;  3HOV B;  1VMC A;  1V43 A;  2B2T C;  4RWS C;  3W3A A;  1STY A;  4C3J G;  2VB2 X;  4EQP A;  1B2T A;  5F2D A;  2F0M A;  4ZQ3 A;  4ZKB B;  2L5T A;  3DM1 A;  3EJI A;  4FXD A;  1I4X A;  1ILQ A;  4KN4 C;  2K6A A;  2SNS A;  1SSO A;  4DNR B;  2F0D A;  3GV6 A;  3OSO A;  4FF2 A;  3GTG B;  4IUQ A;  2EY2 A;  4K5W A;  2RQX A;  3T53 B;  2PZT A;  3K5N A;  3OW7 A;  3GTQ B;  2L1B A;  1I4H A;  2XIW A;  5EQ0 A;  1RHP A;  1EQV A;  1KLG D;  5TSS A;  3M4O B;  1BXT A;  1G8Z D;  1B1Z A;  1TS4 A;  4EGV A;  1PFN A;  5JAV A;  4K5X A;  1OXS C;  2F0V A;  5LL6 S;  5DM6 3;  2F4I A;  1PTO B;  3VR3 A;  4CJ2 C;  1CQF A;  5HGT A;  1LT6 D;  3NTH A;  3M3Y B;  2C5C A;  2NUC A;  3HEJ A;  3DUZ A;  2I07 B;  2KCN A;  2J7Z A;  1HTP A;  4IUP A;  3VA7 A;  3NE5 B;  3QB3 A;  2RDF A;  2B63 B;  1TWH B;  1WTX A;  3PUY A;  2JA7 B;  1S5B D;  3TDQ A;  1GUS A;  1TWC B;  1GUT A;  2FHT A;  3A55 A;  4ME5 A;  1T5E A;  1F9S A;  1ET6 A;  5JJZ A;  4CGY B;  5DAU A;  5C5M A;  5D14 A;  2JA5 B;  3TN2 A;  1C4Q A;  2WII B;  4X3K A;  1GUG A;  2K5W A;  1EIH A;  4O42 A;  1LTI D;  1TQO A;  2IL8 A;  2MGS A;  1JOR A;  3Q0A A;  3I4N B;  2C9O A;  3WOE A;  2CVR A;  4ZUJ A;  1JWU D;  1TWF B;  2EJG C;  2B8F A;  1HQM C;  2K04 A;  2L55 A;  3MA2 B;  1PRT B;  1JOO A;  1HFN A;  3MXU A;  4M8A A;  1BCP D;  1H9S A;  3S1M B;  1HUN A;  3MTS A;  1IYU A;  2F03 A;  2PQE A;  3NHH A;  2R3Z A;  1IYV A;  2NB0 A;  3KLS A;  4KD3 A;  2EOT A;  1BNZ A;  1FR3 A;  2E2D C;  3NWT A;  3K57 A;  4KY6 A;  1EU4 A;  2F0J A;  2L12 A;  2YYZ A;  4N9T A;  1Y69 U;  3TP8 A;  3SEB A;  3R2T A;  3J80 E;  2F0Q A;  1CHQ D;  3QJY A;  3P1H A;  1EYD A;  2O4X A;  5M5Y B;  3ERO A;  1GXD C;  4K6L A;  2O2L D;  4H7B A;  3R2I A;  1I4Q A;  1KAB A;  2XRS D;  3I3C A;  2MP1 A;  3CQZ B;  4PV1 C;  2F0N A;  3PUX A;  2F0E A;  3J80 L;  4R8I A;  4A3F B;  1TT2 A;  4RGO S;  4A3K B;  2KCC A;  2JEA I;  4MIU A;  1C48 A;  3URY A;  3H3V C;  3M85 A;  4C1N K;  3U9S A;  3I72 A;  4HED A;  2Z4I A;  1BR9 A;  3P7J A;  2ICE C;  3H6M A;  2F1M A;  3DEO A;  2F0U A;  2ID0 A;  1PZJ D;  1H9K A;  3GTK B;  2K28 A;  3BVZ A;  5C44 B;  1Z6H A;  1GUO A;  5ELB A;  4K8I A;  1CK1 A;  2QF7 A;  2Y0S B;  3FVQ A;  4EQN A;  4JBW A;  2HDL A;  4JK1 C;  1O80 A;  1PMR A;  4ID6 A;  1DYQ A;  1Q12 A;  5HUR A;  2PW7 A;  3A7L A;  1PTO C;  1PDQ A;  3L9A X;  2E2H B;  1ZXT A;  1TKW B;  3FPP A;  1IW7 C;  1LLR D;  1PFB A;  1R9T B;  5A2Q L;  1J9O A;  2KOL A;  2EZV A;  2NVQ B;  2IX1 A;  2F3V A;  4J8Q A;  2NVT B;  5D3D A;  4BBR B;  1G29 1;  4KY7 A;  1CHP D;  1OXU A;  1SMY D;  4KV6 A;  4I65 A;  4RGM A;  2EXZ A;  5C4H A;  1H9M A;  4RHR A;  4FNF A;  1DJR D;  1STN A;  1YNJ C;  5K5P A;  3MZ5 A;  4A3B B;  4G4K A;  5C3X A;  3KBX A;  4KTA A;  3J7A F;  2HCC A;  4QCL A;  1DM0 B;  1AW7 A;  4XT1 B;  5G3L F;  2BE5 C;  1PTO F;  2FMM A;  3S1R B;  4HTH A;  2EYH A;  2K01 A;  5BN3 A;  2EDG A;  3J81 E;  5EPJ A;  1U4R A;  4IFD J;  4RFB A;  1YNN D;  1F9P A;  3M4Y A;  5ELC A;  2WIN B;  2M9V A;  1O78 A;  1JE4 A;  1ENF A;  4OO1 I;  1PRT C;  1BBX C;  2QIL A;  1G91 A;  2FMC A;  1Q1B A;  1CA5 A;  5M3M B;  4C3I B;  2A69 D;  3Q24 A;  4FXK C;  1E2W A;  5C0X G;  4BY7 B;  4IAL A;  1JR0 D;  1B44 D;  2K05 A;  1GUW A;  4NDX A;  3I8Z A;  2QCP X;  2M00 A;  3PUW A;  1DZ1 A;  1SBB B;  3HRZ C;  4C1N I;  1GOZ A;  5M9O A;  5JEA J;  1SE2 A;  2JE6 I;  1CTM A;  5I9O A;  3MEH A;  4PMB A;  1HFG A;  1PZK D;  3NP8 A;  4ZAI A;  3HG9 A;  3R3O A;  2AQ3 B;  3K7A B;  4Q5V A;  5A35 A;  3SK8 A;  4DF7 A;  1PRT F;  3DWP A;  1BUV T;  2R6G A;  1NR2 A;  5FKA C;  3K5L A;  1SJH D;  1MSH A;  2BA0 A;  1SAP A;  2LKV A;  5DNF A;  2LS0 1;  4GZY C;  4DAV A;  3NPP A;  2AWO A;  2EJM A;  1PLF A;  4RH6 A;  3KF8 A;  4FVM A;  5C5L A;  1DCZ A;  4J6H A;  1HRJ A;  4ZK9 B;  4IN3 A;  3S14 B;  3RZD B;  2B2U C;  2V4D A;  5J22 A;  4CBV A;  2E2I B;  2F3W A;  3DHQ A;  3MXG A;  4TKO B;  3FDT A;  3M7N A;  2E2J B;  3WDN A;  4KJO A;  1EYA A;  1RCV D;  1STB A;  2SOB A;  4V19 0;  2EYJ A;  1Z7T A;  5EGT A;  5BN4 A;  1UAP A;  2JEB I;  4H0L C;  1LTG D;  2B2W C;  2NYZ D;  1I4G A;  5KNC A;  5I6Y A;  2IT1 A;  3OWF A;  2L0C A;  2KQ3 A;  4F8M A;  4HMI A;  3GTM B;  5CBE E;  1ML0 D;  2R7Z B;  5IGB A;  1Y8P B;  2RVL A;  1W6J A;  4TSS A;  4A3E B;  2EYF A;  1L0Y B;  1W6K A;  2PNR C;  1OXV A;  4X3U A;  1GUN A;  4ZYS A;  1WCM B;  3I90 A;  2D2C C;  1VF5 C;  3RMH A;  1BQQ T;  4EQO A;  1S5C D;  5FO9 B;  5J39 A;  3S1N B;  5DM7 3;  2JYO A;  1D1K A;  2CW0 D;  2B2Y A;  1V1P B;  4C56 C;  1VF7 A;  2K5Q A;  2B39 A;  2BA1 A;  3P75 A;  3OIP A;  1EWC A;  2A68 D;  4K5V A;  4TRD A;  5KND A;  1JB3 A;  1NR4 A;  1RKN A;  1CM9 A;  1JWS D;  1ICW A;  1O7Y A;  1ZYR C;  2B2T A;  1XXG A;  5BN5 A;  2NZ1 D;  1EY8 A;  4ZKC B;  3K59 A;  2G9D A;  1STG A;  3PIP 3;  1EZ8 A;  4E6I A;  3HKZ B;  4QB4 A;  1A15 A;  1C8C A;  3FRP B;  1STH A;  1WTP A;  3FEW X;  1JOK A;  5JPM C;  1G6Z A;  3NK9 A;  1B9M A;  1JIC A;  3BDL A;  1U4M A;  2Z8L A;  1Y8N B;  2F0S A;  2A6H C;  2Z1C A;  3TSS A;  5E4W C;  5CV8 A;  1R4P B;  3TP5 A;  2A74 C;  2NWG A;  5FLX E;  3T56 B;  2A6E D;  2IPK D;  1X3P A;  1AFP A;  2HQE A;  2N55 A;  2PMZ B;  3IKJ A;  5I6W A;  4DA2 A;  3CRL C;  2PO4 A;  2IWH A;  3DWQ A;  1E0B A;  1B4O A;  4U67 3;  1RTN A;  5FLX L;  3EQL C;  2JSO A;  1U4P A;  3BDO A;  1B9N A;  3C1E A;  5KEE A;  1V1O A;  4A3M B;  1EY7 A;  1EY0 A;  2H1E A;  5FK9 C;  1UUP A;  4FF4 A;  5I2X A;  5D65 A;  4OO1 G;  2MJ8 A;  5CV7 A;  1CQV A;  4XIG S;  2RBM A;  3S16 B;  4DAP A;  1RF2 D;  1LT3 D;  5EPL A;  1VDZ A;  5ISR A;  4DK1 A;  3KK7 A;  5C0X I;  1S5E D;  3RUZ A;  1QOH A;  1PYW D;  2WP8 J;  2K32 A;  5CR3 A;  3R8B A;  3PV0 A;  3KUP A;  3MXP A;  1LT5 D;  1Q1E A;  1TWG B;  3GV3 A;  3U9O A;  4ZUI A;  3GTO B;  2BCO A;  5EKI A;  4YIJ A;  3PUV A;  5IGC A;  4K6D A;  3MFY A;  3O13 A;  5M3F B;  3PUZ A;  1SNO A;  1QB5 D;  5LL6 X;  3C3L A;  1JOQ A;  4H13 C;  2RDG A;  4IUN A;  2N88 A;  1I6V C;  2X69 A;  1D5M C;  3V96 A;  1A3T A;  2EE1 A;  2DY8 A;  4NKL A;  3E5S A;  1FNV A;  1X32 A;  3TME A;  2OEO A;  2D62 A;  3MXN A;  4KHV A;  1D1I A;  1Y1V B;  3IAY A;  1F2Z A;  1SEB D;  5EKL A;  5CV4 A;  5IIF A;  1GJX A;  2PCF B;  2NBF A;  2XVS A;  3S9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...