2SOBA

Sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRVLAYIYADGKMVNEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title NMR structure of a stable "OB-fold" sub-domain isolated from staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 8
structure length 103
sequence length 103
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sobA00
4ME5A 1EZ6A 5IOCA 3SK4A 4F7XA 2O4XA 4MIUA 2EY6A 1AEXA 4EVOA 3T13A 3P75A 3DHQA 1TT2A 4WRDA 4EQPA 4DF7A 1ENCA 5IGEA 5KIXA 2F0NA 1EY4A 5KRUA 4KY6A 3TMEA 2OEOA 2EY1A 2EYLA 1A3VA 5E3FA 3RUZA 5KGUA 5J22A 1KDCA 4KD4A 2WACA 4R8NA 4ZUJA 4K2LA 5CV7A 5J1ZA 5CGKA 1STHA 2F0KA 4KD3A 4ID6A 3D4WA 2SNMA 1SNMA 1KDAA 1EY5A 2F0TA 2EY5A 1SYFA 3EROA 3NP8A 4KY7A 4S3SA 3V2TA 3SXHA 4EQNA 4K8JA 1EQVA 2NUCA 3ERQA 3NQTA 2PQEA 1EYAA 1STBA 4F8MA 1A3UA 1NUCA 3BDLA 1EYCA 4H7BA 4KTAA 2F0MA 1SYCA 4K5XA 1KABA 2EYFA 2F0OA 2EYOA 2RKSA 5K5PA 2F0DA 3NHHA 2ENBA 2F0VA 3PMFA 3S9WA 2F0LA 4TRDA 1U9RA 4RKLA 5E1FA 2F0EA 3SR1A 5C4HA 4K2KA 5EKKA 4B9WA 2PW7A 2LKVA 5IIFA 1JOOA 4NP5A 4K14A 4J1MA 5KEEA 2RBMA 4KY5A 3VA5A 4QB4A 4PMCA 2F0SA 5CV4A 1A2TA 4IUNA 2F0JA 3NUCA 3TP7A 4IALA 2PZTA 1SNPA 3QB3A 4WORA 3SK5A 2F0PA 2F0GA 3D4DA 3D6CA 4ODGA 2EYJA 2SNSA 3MEHA 5NUCA 1RKNA 2F0HA 2PW5A 5IGDA 5IGFA 3P1HA 1EY6A 5C6AA 4KJOA 3HZXA 5C3XA 4G57A 2KHSA 1EYDA 1SYDA 4N9PA 4K5WA 5C5LA 3MHBA 2EYMA 5IODA 3QOJA 1JOQA 1F2ZA 1A2UA 3SK8A 1STYA 4HTHA 3U9OA 5M9OA 5ISRA 3HEJA 4DFAA 5IGBA 5C4ZA 4HMIA 5CV5A 1JOKA 5CV8A 2OF1A 2EXZA 2OXPA 5I6WA 5I9PA 1KAAA 5HGTA 3T16A 2F3WA 1KDBA 2EY2A 1SNOA 5CR3A 5KYLA 3QOLA 1NSNS 4DU9A 4DGZA 5JOBA 4KV6A 2F0UA 4J6HA 1STAA 3OWFA 5IGCA 1A3TA 5KYIA 4NKLA 3ITPA 3MXPA 1SNQA 3D8GA 5I9OA 1SYEA 4ZQ3A 2F3VA 3R3OA 3OMCA 3H6MA 4IZ8A 5DAUA 5J39A 1JORA 4NDXA 2F0WA 2SOBA 3EVQA 4PNYA 2PZUA 4RKBA 4KHVA 4K6DA 3MZ5A 2PYKA 4PMBA 4K8IA 1F2YA 4QF4A 5C5MA 3C1EA 3NXWA 4B9XA 3TP5A 3SK6A 5I6YA 1TR5A 2QDBA 3OSOA 1SNCA 3MVVA 5EKLA 2PZWA 1IHZA 1STNA 1EY9A 2EYHA 1EZ8A 4YIJA 3TP6A 4LAAA 5JAVA 5CV9A 4OL7A 2F0IA 1SYGA 4HMJA 5CC4A 4I65A 4ZUIA 4NMZA 5C3WA 1ENAA 2KQ3A 3E5SA 4KJNA 1EY0A 1SNDA 3DMUA 3NK9A 3TP8A 4E6IA 2RDFA 2F0FA 1EY7A 5IGGA 1TQOA 4K5VA 1II3A 2M00A 4N9TA 1F2MA 3OMGA 5DEHA 5F2DA 5CV6A 2HQEA 2EYPA 3BDCA 4QMGA 4EQOA 3LX0A 1EY8A 5EGTA 3C1FA 5HURA 1STGA 3SHLA 1SYBA 3EJIA 2F0QA
chains in the Genus database with same CATH superfamily
4RG1A 2F1MA 4LFBQ 4ME5A 2I5MX 5C44G 1PYSB 2JE6I 2JN4A 1E3PA 2RCNA 4EQPA 3ND8A 3TQYA 3M4PA 4A93B 3CQZH 3S2HB 1XNRQ 1EEFD 1VQNA 3S15B 2EY1A 3RUZA 5J22A 4XT1B 5KNDA 1YHBA 1NCVA 5CGKA 1UUPA 1JJCB 3H09A 1TWCB 5D65A 3DXJC 5A2QE 1N32Q 3QJYA 1XMQL 4KTAA 4LFCQ 4DR3Q 1KABA 2D5DA 1ONLA 1Q3LA 2IL8A 1S40A 1N33L 2H4OA 4A3FH 3KLWA 4QL5A 2IT1A 1A63A 4UP8A 5C44B 3QG1A 2RSOA 3RLFA 5M3FG 1YNJC 2R92G 1XNQQ 1Y14B 1B70B 1I94L 3M4OH 2LKVA 2B39A 3MXGA 4K14A 1SBBB 1PDQA 1ASZA 1ICWA 2KHIA 1A2TA 3RR5A 1KNAA 3HOXG 2K32A 2LY7A 1HZAA 3KBXA 3SK5A 3D4DA 4A4IA 4X62L 4IUQA 1K0RA 1RKNA 1G51A 1KXLA 4Y7NB 3N6RA 2A68C 1Q12A 4DNRB 1RODA 3CF5A 1PA6A 4C3IB 1TY2A 2UUBQ 2B8FA 1FGUA 5A2QL 1RTNA 3HEJA 1QJOA 4DFAA 3CCSA 2B63B 1PH8A 1MI2A 2F3WA 4DUZQ 2Z6KA 3TS2A 5COYA 2F0UA 1OTCA 2EOTA 3ITPA 2Y0SE 5DNFA 3NBIA 3VR3A 1K8OA 4IZ8A 4RKBA 1WCMH 2PZUA 3C1EA 3GTQB 1LM0A 4QIWB 1JR0D 4BY7B 4LW1A 3J7ZC 1Y1VH 2J7ZA 2X69A 1MHWC 3U4VA 4FDBA 4B3ML 1PHJA 2B2WC 2CVRA 5CC4A 4E6IA 1LTBD 2PI2A 1KHIA 3W1BA 2P5ZX 2O2LD 1JJ2A 3H15A 3P20A 1SYBA 4A75A 2EQSA 4C56C 3HFZB 2NVXH 3JC66 1ENFA 4HSPA 3SK4A 4EGVA 1YVCA 4A3DG 1VMPA 1ZXTA 2JA8G 3S14H 4IFDJ 4KHPL 4NXNL 4KY6A 2PMZB 4B3TQ 3KF6A 2YU9B 1FGBD 3CCVA 4RGMA 2FJ2A 5IYBG 3VYSA 1YJ9A 1JWUD 5ELFA 4HIMA 3IL8A 4XT3B 1KDAA 4L5RC 3CCJA 2ZTDA 4S3SA 2DY8A 3KLSX 1G291 1EYAA 4KKUA 4JBWA 1LLRD 4RHRA 3WOEA 3I4NG 1TS3A 1VQGA 3U50C 4X3UA 2JYOA 2NVQB 3OPOA 1EFID 1BVSA 1N9WA 4L5TA 5ELEA 4A3KG 1L1OA 1Q8KA 3L2PA 3DUZA 1EEID 3CCUA 2F0EA 5C4HA 5T1GA 1SE4A 1M90C 4XQJA 1Z9FA 1TWGH 1B4OA 3HOVB 1BR9A 2ZXOA 2VQEL 5FLMH 2Z4IA 1K83H 4POFA 4DAMA 1VS0A 2EDGA 2KHJA 3STBC 2V4DA 4IUNA 3MAQA 3IAYA 4QCLA 3BVMA 4ZKBB 2ALYB 3I56A 1HNXQ 1L1OB 1A0IA 3MA2B 3GTOH 3U4ZA 2LXJA 4OO1G 1AP0A 4A3GH 2NTTA 5I2XA 1J9OA 1O78A 2C5CA 2K28A 3RLNA 5CBEE 3U9OA 2E75C 2UUCL 3PO2B 2R93B 1YEZA 1IKLA 4G4KA 4KV6A 2WB1E 1XX8A 4X66Q 5AJ3L 1BCPC 3J7AV 3K5LA 1SNQA 2NN6H 3J7AF 5JVH3 4NDXA 2F0WA 1D5XC 2VUMG 1YNNC 2JA5H 4EQ5A 1KAWA 2R7DA 3F2UA 2NN6I 1FNUA 2FXQA 3L3OC 4DK0A 4NXML 3HOYG 4RGOS 1STNA 4DR2L 2BA1A 2PNRC 2AUKA 2WIIB 3A8KE 3S1NH 1GUWA 4IJLA 2F0FA 4B3RL 3N52A 3TRZA 4HIKA 5A35A 1EY8A 1CA6A 4BWGB 5C4XB 4A3MH 2HIXA 4U68A 1LTAD 5BR8L 1EZ6A 4FXGC 4DKAC 2F52A 1IW7D 1V1OA 1LUZA 4BBRG 1VF5C 2EJMA 3CC2A 2E5LQ 3GTPH 1HUMA 4R4QA 1GM5A 1W6KA 3R2TA 1EQVA 3NQTA 1CZWA 5IP7G 2G9HD 1UEBA 1PH1A 1IYUA 2AHOB 4IUPA 2QEJC 2BOSA 3JAMi 3KBGA 4YY3L 3EN2A 4X3KA 4HCSA 1TXYA 2DN8A 5HY6A 5GAGC 2Z8LA 5IIFA 1WFQA 4A3LH 2DJFC 1Y8OB 2Z6KC 5DLQE 3QB3A 2YTXA 3S16B 1H9SA 1BDOA 4GLVB 4KKTA 2RCFA 3CCMA 1FJGQ 2RA4A 5FOBB 1B9NA 2BDNA 1K3RA 1A8VA 4K5WA 3QOJA 3UI2A 3F2DA 1T5XD 1I50B 1P8LA 2HCCA 1H9SB 1KAAA 1LTSD 1AN8A 4U673 1YZ6A 1BUVT 3W2DA 3L9AX 1FNWA 2HCIA 1JICA 3K0XA 2IWHA 4DR1L 4OXPA 3OMCA 2X6LA 2E2IH 4LF8Q 3T1YQ 4A93H 3S2HH 4J8QA 2EZVA 3FKIH 4CBVA 3TP5A 1PH4A 4ABNA 1PTOD 4HJ7A 5JAVA 2VY3A 1ZYRC 4NPSA 3AEVA 4A3FB 1LT5D 1BBXC 4JBMA 1PH5A 4F88A 2JA9A 3IFDA 1J6QA 5F2DA 1R9TB 5GAEC 3CXCA 4FVMA 1BOSA 1VQHA 4HEDA 2UXBQ 4FNFA 4EVOA 3P75A 4L8JA 4C2MH 4KHZA 2EIFA 4KLKA 4DV3L 1Y1WG 3HG9A 4MTKA 1FR3A 2ES2A 2D0OA 2ICIA 3L0OA 5GQOA 1VQ6A 1EWHA 2SNMA 1HH2P 3I2ZA 2F0TA 2EY5A 1STBA 1E2VA 4JI3L 5LL6S 4C3IH 5ELBA 2IJ0A 1Q1EA 1OXVA 3I4MB 3K5OA 5LMUQ 1S3OA 4DXFA 5C3EG 3D31A 4RCNA 4ZAIA 1QILA 1TWFB 1X3PA 2MPMA 1CTMA 4LF6Q 4GN5A 3PO3H 1GUTA 1JE4A 4LF4L 2WKCA 1WCMB 3J7YW 4FF1A 4LUOA 5TSSA 3W3AA 1IYVA 1H9RA 2AMCB 2F0SA 4DV4Q 1Y1VB 1U0LA 3H0GB 3T51B 5NUCA 4JI0Q 1S5CD 2I46A 4MN3A 3PUYA 5K36H 4V0BA 1EWIA 4DK6C 2Q8IB 4AYBB 2L12A 5E4WC 4QY7A 3CCEA 5CV5A 4FXKC 3BYYB 1ICFB 2NVXB 4JYAL 4LUVA 1PRTF 2VQFL 1QB5D 2A6HD 1EYGA 4OX9Q 1BKBA 2A8VA 3S14B 1QUQB 2MGSA 4IUUA 3AYHB 4R1JA 1HNZQ 3CMAA 1B2TA 1SYEA 2N49A 1OXSC 2YYZA 1SMYD 1U4RA 1YHAA 5IT9c 4B3SL 5IY0A 4LF9Q 4A3GG 1TVXA 2PNHA 4ZLTF 2DGYA 1JB7A 2OT2A 1EIFA 3M7NA 1ENAA 2KQ3A 3DMUA 3MFYA 1KC8C 1NTGA 2V1CC 1TQOA 4DV2Q 4A3EH 4P74A 2NVQH 1IBLL 4LJZC 4JI8Q 1K83B 1E1TA 2NN6G 4APVA 2FMMA 5IOCA 3HOVH 2K05A 3MXNB 1DOLA 1AEXA 1WTPA 2Q8RE 3GTOB 3RMHA 1P16A 3A5ZB 5DM73 4IPGA 5M5YH 1JMCA 5CV7A 3OIPA 1FL0A 1KTKA 5IYCH 4KY7A 2GA4B 4L63B 1AE2A 2A6EC 1A3UA 1SAPA 4DAVA 1WI5A 1EU3A 1PFNA 3PO2H 5LMNL 2F0OA 2XSCA 3C2PA 5K5PA 1G6PA 2BE5C 4K0KL 4JG2A 4OELB 3KJPA 2JA5B 2B2WA 1Q86C 4NP5A 2BH2A 3M3YB 1YITA 4QB4A 4JC0A 1L2FA 2CW0D 1WTWA 4IUTA 1HPCA 2EYJA 2ICEC 3S1MH 2UXCQ 4B3MQ 1ET6A 1AE3A 4RAUC 3I4LA 3GO5A 1F2ZA 4C3HG 2G9DA 1NY4A 2FINB 1WTXA 4A3MB 1CSPA 5EQ0A 3VR5A 3LWEA 2KEEA 1D7QA 3UDXA 2F4VL 3OWFA 2PO4A 4YWKA 4CDFC 5IGCA 4A3LG 1TY0A 4LFAL 2Q2IA 1DOKA 3K5NA 4DV6L 1EIYB 3J81E 3A0JA 4ILWA 3GTPB 4BY1H 3EVQA 2R7FA 4K6DA 1EQQA 1U4PA 2RQXA 1EUJA 4A3BH 1PH6A 2Z4HA 4IFDI 3K81C 5I6YA 1OXTA 2NZOA 1LT3D 5CV9A 1HNWL 2ASBA 1VQ8A 1LT6D 1S4ZA 5JJZA 1VQJA 1EY0A 3I72A 2EPBA 2XWJB 5KNCA 1EY7A 2A1AA 1M4VA 3CHBD 2ZJQA 2CQOA 1X3GA 2WINB 4JI1Q 3DWAA 4X65Q 3CU7A 4QMGA 3BDCA 4DR7L 4CJ2C 3ERSX 4DV5Q 5EBCA 4DV0L 5FO8B 3EJIA 5FO7B 1WD0A 5KNBA 4JI7Q 1JQYD 4MIUA 4A93G 4DF7A 4JI4L 2OEOA 3K6OA 1F9RA 1DXMA 1QCBD 4HSVA 1EOTA 3Q24A 4AQYQ 4ID6A 2MNAA 2QA4A 3J81c 3HOWH 4HR7B 5EAYA 1SROA 3K80C 2ATWA 2MUYA 1NUCA 4IQZA 1I50H 4O42A 2CWAA 1RJTA 2L4NA 3FDTA 1V8QA 1M1KC 1IBMQ 2L11A 1UNSA 2F0VA 3S9WA 1BCPB 3PF4A 2E2IB 1Z47A 2A5HA 1PZJD 3SR1A 1I5FA 4B9WA 4UP9A 1JOOA 1SJHD 3FKIB 2FFKB 1CA5A 2RVLA 3U58A 4GNXC 1XPRA 2H5XA 2D0PA 4WORA 3PV0A 3E9HA 3A5UA 4C3JB 3AFQA 3RN2A 3CKIB 2UXDL 1A6XA 2A19A 1TWAH 1EOVA 2DNEA 1WYDA 4C3IG 4WFN3 1CT1D 2WV6D 2KHSA 3DEPA 4RWSC 2B63G 1STYA 5IYDG 5JJKA 5IGBA 4QQBX 3ULLA 4MTNA 1JOKA 1MGSA 5CV8A 5I9PA 4LF7L 5HGTA 2K7VA 4A3JH 1R9TH 2R7ZB 3EA6A 3R8BA 4DGZA 4C2MB 2WAQE 1Q82C 2CFMA 3HOZH 2K5WA 1YIJA 1BO0A 1PRTC 3MXPA 2UU9Q 4ZQ3A 4XDXA 2RDGA 3E6ZX 2QW7A 1PLFA 2K4KA 3Q22A 1YBYA 2PYKA 4BY7G 1I4PA 3FEWX 2KJXA 3OSOA 2K6AA 1IHZA 1SE3A 1EZ8A 1RCVD 2B2UC 3NENA 2JEBI 2VXWA 3RD4A 3PIOA 1STEA 1VF7A 3G6EA 3PO3B 3A54A 4K5VA 3I4MH 2Z0SA 4NW2A 1STGA 1TWFH 3TN2A 1E24A 4NKLA 1PXUA 4OONA 4R4CA 4P75A 2L9HA 2O4XA 4FO2A 1JE5A 2B29A 1N36L 5EPLA 1I3QB 3DWPA 4I7AA 4GKJQ 4TQUS 2CKZB 3VR4A 2UUAL 3H0GH 4LUZA 3FRPB 3NPPA 5M3MB 4FYDA 4EQNA 1O7LA 1SR3A 4MNOA 4XQNA 5M5XH 1GO3E 4L6TB 2MO0A 4JV5L 2F0MA 2N78A 3CCRA 2EYFA 1ILQA 2E8GA 2KOLA 2EYOA 1N8RC 1U5KA 4DR1Q 3HOVG 4A3CH 3K5MA 4K2KA 2KCMA 4JBKA 1Q7YC 3C3LA 5E4XA 1VQAA 3GV6A 3FMCA 4DR4L 2F0PA 1M8AA 2RHQB 1X65A 1SFOB 1E22A 1HQRD 1F9QA 3K59A 1QZHA 1J5EL 3BVZA 1D8LA 4OGQC 1DD2A 3CD6A 4C1NK 3KF8A 4A3EB 3Q8DA 1LTGD 1GD7A 1SYDA 3KF6B 4N9PA 2AQ2B 2IPKD 3PO2G 1QOHA 1W2BA 1CI3M 3P7JA 1CHQD 2R93G 2OXPA 1XMOL 4X3TA 3T16A 3Q0AA 5IWAQ 1V1QA 5JOBA 2CCZA 1RIPA 1C7YA 2FHTA 5GADC 4AIMA 3KF8B 4Y52H 4OEMB 4XYOA 3AMUA 4IPCA 5C0XH 5M5YB 4M1UB 2VL6A 1RHPA 4PMBA 4X64L 3RNUA 2HHHL 3VYUA 3NBHA 1YI2A 1XTDA 4DV7L 1LABA 5C0XI 2VZAA 5IP9H 4XYQA 1PTOF 1IXRA 4OL7A 1D1KA 5FK9C 2K5QA 3GP7A 3SEBA 2K04A 1D1IA 5IGGA 1IZ6A 1HR0L 5C4XG 3NBHB 3T1HL 1O7YA 5EKIA 3C1FA 4IFDG 3A7AB 1NNXA 4TSSA 5CORA 4HJ9A 1MSHA 1VQFA 2OCEA 4ZRZA 4JK1C 3M3YH 3S1MB 1AZPA 1C48A 1DCZA 2K5VA 4QIWE 3D3RA 3CCQA 3PCOB 2YV5A 2N3SA 5T1IA 4K2LA 4DV1Q 1NR2A 1STHA 2JJQA 3I4OA 4GN3B 1XPUA 3SXHA 1XNRL 4H7BA 2XGTA 4PZ6A 3A8IE 3TZUA 3J81j 2VQFQ 5CBAE 1TKWB 1KD1C 1N32L 2B3GA 4DPGA 4BY1B 1F9PA 4RKLA 5E1FA 1NMFA 5AFWA 4A3BB 4LFCL 3PGZA 4DR3L 3ZJYC 2PI2E 1K9MC 2RSNA 4J1MA 4WJ4A 1QZGA 1G6ZA 1D5MC 2I0QA 2PMZE 3EFXD 3OHXC 2FMCA 2DUDA 1H9KA 3AU7A 3ICEA 2ZJPA 1PMRA 1PVOA 1XNQL 4C1NI 3I8ZA 1D6EC 4BXXG 3DM1A 2LMCB 5J3BA 5IGDA 5CMDA 2IX3A 4WJWA 4UHVA 1WTHA 3CPWA 1A2UA 2KCCA 1IBKQ 1GUNA 1L0XB 4HAEA 4GLAC 3JAME 1UE6A 1WTVA 1CUKA 1KQSA 2UUBL 3OWEB 1L0WA 4I7ZC 1PFMA 4JBJA 4JOIA 1JT8A 4DUZL 1E2ZA 3MXUA 4XTCS 3MZ5A 1UAPA 2NBFA 4IPHA 1EQTA 3NXWA 3HOWB 3PF5A 4DN4M 4HJAA 3W1GA 5LMNW 4JI6Q 4LF5Q 4A3FG 4KI0A 1HQMC 1ILPA 4ZUIA 1Q46A 3D0FA 5ELOA 5LMNQ 2A69D 2M00A 3QWNA 1B8AA 3JAML 4PMWA 2YTYA 2KECA 1IL2A 1U4LA 1I4HA 1S72A 1AH9A 3KYHC 2EVBA 4UDUC 2EY6A 2XTIA 1CM9A 5IGEA 4KN7C 3H3VC 1TWAB 1EY4A 2KCNA 1D5ZC 3PUZA 1VQIA 3NQIA 3TMEA 3CP0A 4DUYQ 4FF4A 4C3JH 1IW7C 1KDCA 4ZUJA 4H13C 2M9VA 4JI5Q 2IX1A 2K50A 4DR5Q 2K5DA 3Q6SA 2CHBD 1PFBA 1GUSA 3KDFA 3TREA 4A3JB 1F2LA 4UY8C 1EYCA 1R4PB 3I4MG 1YJWA 3A55A 3HOZB 5BN4A 4A3IH 2B2VA 1X3EA 4LMQD 4ZCKA 3MC0B 1WCMG 1JJGA 2Z9HA 2R7ZH 4TRDA 4DV6Q 1SEBD 1ESFA 4YHHQ 3SE0A 2EJGC 4YCWA 1WOCA 5C0XJ 1R4QB 1EU4A 2XN9C 2L15A 3KDFB 2KUMA 2L0CA 1Y1VG 4PMCA 3AB9A 3H0GG 4OIKA 1Z6HA 5M5WB 3TP7A 1SNPA 2HQLA 2VB3X 2F0GA 1OXXK 3KLSA 1N34L 2MO1A 4GLXA 3ZYYX 1SE8A 1HNWQ 1X6OA 1W6JA 1ML0D 2JP1A 3BJUA 4AYBG 1NBWA 5C5LA 4JI2Q 1TIID 2NB0A 4IOAA 1TS5A 1JWSD 2B2TC 3M4YA 1HNXL 1SSOA 1XWEA 1U4MA 2ZXRA 1PH3A 2N55A 5EJWA 5KYLA 5CR3A 1SNOA 4R4TA 4L5QA 1STAA 4GKKQ 2LFNA 3GV3A 1I6HB 3FP9A 3A56A 1KL9A 2Q2TA 2F03A 1WVLA 4DAPA 3S17H 1SMXA 1I3QH 4QF4A 4X66L 5M3FH 2R92H 5M5XB 4G7OC 4H0LC 3NE5B 2PZWA 3E0EA 5M3MH 3NELA 1EY9A 4YIJA 3K8AA 2SEBD 2AWNA 1SN8A 4HMJA 3UDGA 4GNXA 1PTOC 2RDFA 1B53A 1Q90A 1DGSA 1F2MA 5FLMG 5EBDA 1HFGA 1Y8NB 4J15A 1K3BC 4QUCA 3MWYW 1XPOA 3RN5A 3HKZG 4KMUC 3ND9A 1AW7A 1VQCA 4GNXB 1QVGA 1NR4A 3UE1A 1VQPA 1UEAB 1J8IA 2QF7A 1XMQQ 1K28A 5LL6X 5IP9G 4KD4A 1NMGA 1SFOH 4R8NA 3H3VH 2ZM6L 4DNTB 1D2BA 4OIJA 1N33Q 3WOFA 2PQEA 1JB3A 2IHEA 3H3VI 1I4RA 4F87A 1I94Q 2E5LL 2JA6B 5G3LD 1QVCA 3RLOA 2OTJA 3NHHA 3KK7A 5D3DA 2CH4W 3HKZB 2K5HA 2JA5G 5IE8A 1PRTB 4RH6A 4X62Q 2B2UA 3PQIA 3ULPA 4O1NA 2QGQA 3URYA 3OIQA 1SDFA 3PSIA 3OYYA 3NEMA 3A7LA 1HTPA 2F0JA 3GTGB 2D62A 1FD7D 1CKOA 3CRKC 2GVAA 3BU2A 2IY5B 2ID0A 4XIGS 3S1QH 4A3DH 4JOIC 2XNAC 2JA8H 4O2DA 1S5ED 3S1RH 1I6VC 2E2JH 1EYDA 5FKAC 3MHBA 4A3MG 2C35B 1MSGA 3PUXA 1SJED 1QNUA 2R6GA 4TKOB 4CKBA 1JCKB 4YWMA 1RDPD 1B1ZA 1E0BA 2EY2A 4DU9A 2CH4A 2A6HC 5JJIA 1UE5A 4IO9A 1MD2D 3QR8A 4OWWB 5DAUA 5J39A 1JWMD 4NB3A 4A3KH 2UUAQ 2XVSA 3CW2C 1K8GA 2E76C 1LACA 4B9XA 2QDBA 1RD9D 3M4QA 1SMYC 3TSSA 1E1OA 5CYUA 2QEXA 4LF8L 4AYBE 1CKNA 3T1YL 2F0IA 1SYGA 3R93A 2Z1CA 1LT4D 3TP8A 1B50A 2ZTEA 1G2SA 3F2CA 2WKDA 3KLRA 4OO1H 3I7FA 3NWTA 1PTOH 3FVQA 1K8AC 4M8AA 2X6GA 4KHPQ 1JC7A 4NXNQ 2KVMA 1CKNB 4DK1A 1Y69U 2B2VC 4OO1I 2M2LA 1CQFA 1LYLA 4V190 3GTMB 2JSOA 1GUOA 1X3QA 4MZ9A 2WAQB 5LHY1 2NZ1D 3QIAA 2JEAI 4BBSB 1GHJA 4DAYA 2WACA 2UXBL 1MKHA 1UE7A 3J80i 3UDFA 3NP8A 3FPUB 1XYIA 3PIO3 2VUMH 4OWTB 1ET9A 2HDMA 1ASYA 1QVFA 1PFSA 3BDLA 1O7ZA 2DJGC 1FYCA 2VQEQ 1YNJD 4DAYB 3HRZC 3SVMA 2HDLA 5EPJA 1U9RA 3E0JA 2VW9A 1V1PA 3FKIG 3G48A 5JVG3 2C9OA 3K0YA 3VR6A 1X56A 2RBMA 2Y0SB 4KY5A 4X64Q 5LMUL 4C3JG 4LF6L 1KIXA 2A68D 4X6AH 1K0SA 3D6CA 1SRUA 3NTHA 3KUPA 2UUCQ 1HR0W 3K7UC 2CW0C 1V1PB 4KJOA 1BQQT 4MHEA 3V96A 4B08A 4DV4L 3I70A 2A74C 1RTOA 4OHJA 1JOQA 5AJ3Q 3SDZA 4A3IG 1YHQA 5ISRA 4JI0L 3NTKA 2BH8A 3O13A 2R7ZG 2EE1A 5DM63 4IOCA 4J6HA 5H1SE 5IP7H 1LO5D 5L37A 3I73A 4Z9CB 1A62A 1TU2B 2GVBA 1HA5A 4PG3A 4NXMQ 5JEAH 4DR6L 4DR2Q 5C4JH 4H02A 1MBYA 2LSSA 4OX9L 3GTKB 2EJFC 4RMFA 1HNZL 2JA7B 1K73C 4B3RQ 2Z6BA 1VCIA 2PCFB 4LAAA 4A3IB 3RZOH 1DZ1A 3PO3G 2RHSB 1SNDA 1G91A 5BR8Q 2Q2HA 4LF9L 1VQKA 3BZCA 3MEFA 3J7A5 1CK1A 1EQRA 4N9TA 1TWHB 1NE3A 1TS4A 3NWSA 5HURA 1CSQA 1VQ4A 2F0QA 1GOZA 4TVAB 3R2IA 4DV2L 2HD3A 2WB1G 5K36G 3HGBA 2WP8J 4JI8L 1B7YB 2MFIA 3I91A 1XTCD 4DNIA 5M5WH 3F2BA 1X3FA 3BDOA 3OTOL 3K7AB 3GTJH 5J1ZA 5M3MG 2NWGA 4L5SA 1V43A 2VB2X 4Q0FA 3G7LA 2OQKA 5KYIA 1SYFA 5D14A 4YY3Q 2AUJD 4FP5D 1WTQA 1WTOA 5GROA 3BS1A 1FVIA 3A8JE 5FJ8H 2RKSA 4A76A 3BYTB 2XRQD 3PMFA 2SDFA 1W3SA 4N8X1 3STBD 3BG3A 2DNCA 3HOUH 3S17B 5EKKA 4ZKCB 3KJOA 2WB1B 1CQVA 5ELDA 1I6HH 5M3FB 2R92B 2CWPA 1H95A 2QILA 1PH9A 5CV4A 4OWXB 1LTLA 2JQOA 2DY7A 1VQOA 3HOXB 2IX0A 4N8FA 3F8TA 4A3EG 1EY6A 5C6AA 1Y1WH 1HA6A 2XWBB 2J4XA 1AZQA 2E2HH 1XJVA 2KA7A 1B44D 2ZXPA 2R61A 3DWQA 1VQBA 2IHFA 1PH2A 3LGJA 2UXCL 1F9SA 2BCOA 4IUVA 4FXDA 1BCPD 1BNZA 2RDHA 3GDEA 2E74C 1CHPD 3NTIA 3E3XA 1VQMA 4H44C 3X3NA 2QCPX 1YNND 5I9OA 1HXYD 2F3VA 2MHVA 1QE6A 5IYCG 3H6MA 4IURA 1JORA 4HJ5A 5C3EH 1B3QA 2PQAA 4K8IA 2NVTB 2J0TD 3G6JB 1SNCA 2L55A 1IL8A 3I55A 3TS0A 1PYWD 4LK1C 4P72A 2AQ1B 1Z7TA 4HIDA 4CJ0B 1CZGA 4IPDA 4QJFA 3VA7A 1G2TA 4HJ8A 2PQAB 2JA6H 3G71A 2PPBC 3PIP3 2JXMB 4DV3Q 2I5LX 2LXKA 3I90A 2AWOA 5EGTA 2QDLA 3L7ZC 3MVVA 3OW7A 3OOCA 4CDEC 2HUGA 4RGNA 4ULLA 2B2TA 3GQBA 4JI1L 1HZBA 4CDCC 4X65L 3DHQA 1C8CA 4DV5L 4A3DB 3S1QB 1GKHA 1N34Q 2JA8B 3AQQA 1GHKA 2OTLA 2HT1A 4CDDC 3PUWA 3S1RB 3GTGH 4JI3Q 2E2JB 4G7HC 2GN5A 3H94A 4JI7L 5FLXE 3EROA 3HS0C 1VQ9A 1GVPA 1B3AA 4LF4Q 1VQ5A 4PQXA 1GJXA 2L1BA 4K5XA 4KKSA 4RA8A 4AQYL 3I4NB 4BY1G 4A3BG 2RF4A 3MTSA 3K58A 4A3KB 1VQDA 3UDIA 3GD7A 4YCVA 1S5BD 2PW7A 5JEAJ 3EBEA 4FF3A 4LFBL 3VR2A 3VDYA 3V05A 1IBML 5ELNA 3FPPA 1VDZA 3ULJA 1GUGA 3C46A 5IGFA 4JYAQ 2K33A 1NJIC 2B2YC 3HZXA 2NVYH 5C3XA 4G57A 3BZKA 3B6YA 1RF2D 1PTOB 5FLXL 1O7IA 3RZDH 3F1ZA 2K52A 5C4ZA 1Y8PB 2OF1A 2QKIC 4K6LA 3D6WA 1KDBA 3DEOA 4DA2A 2O5IC 3QOLA 5FLXc 5JPMC 2XIWA 4B3SQ 3CAMA 3TEHB 2VS1A 4KN4C 2SOBA 3GTMH 3IFTA 3CRLC 3HOWG 1LTTD 2ZM6Q 1QWYA 4BBSH 2VUMB 2UU9L 1ZYRD 1IYJB 1H9MA 1HFNA 1GXDC 1IBLQ 4PV1C 2EYHA 1HHVA 4ME3A 3CCLA 3HOYB 1SE2A 3HKSA 4NMZA 5C3WA 1TS2A 3NK9A 3PIPA 1B9MA 5D3IB 4P71A 4BS9A 2K14A 3T4AC 1VQ7A 3E9IA 3LX0A 4HCEA 4C3HH 2D9UA 5JEAG 1I4GA 1C0AA 3M7GA 3T13A 1MJCA 2TMPA 4IN3A 4BBRB 3T53B 2N88A 2K1BA 2F0KA 4KD3A 4YWLA 3GTLB 1SNMA 1EY5A 4A3JG 4P2CB 4F8MA 4GKJL 2OQ0A 4GZYC 3HOZG 1YJNA 4K0KQ 1ZEQX 3OW2A 3S2DH 2CQAA 5G3LF 1HJPA 4LNQA 3JAMc 5C4JB 2A73B 2K01A 1X54A 1X55A 1SXTA 5KEEA 3DLLA 3CQZB 4IALA 2PZTA 3CC7A 3GTKH 2N8NA 3MFGA 4ODGA 4PZ8A 3MEHA 3RZOB 2KENA 3G4SA 2JA7H 4B3TL 2I5HA 3P1HA 1HZCA 5E7NA 3S15H 4Q5VA 2NZHA 5IODA 1AFPA 3EQLC 2K75A 1ESRA 2F4VQ 3SK8A 4R9WA 5FJ8G 2Q2UA 4XXEA 1TWCH 4LFAQ 4G7ZC 2EXZA 1TWHH 5BN3A 3HOUG 1NSNS 1VMCA 2KCTA 1X32A 1BXTA 2BDOA 4X3SA 3M4OB 1KLUD 3CPFA 2D2CC 2I07B 2LS01 2YTVA 3GTJB 5C44H 1WD1A 5IWAL 1CKMA 3H91A 2L5TA 3VYRA 1F2YA 2ZJRA 5BN5A 3K7AH 4BA1I 1L1OC 1XXGA 1L0YB 3WWVA 4DR7Q 3IRBA 4DV0Q 4I65A 4Y7NH 4A3CG 3KOJA 3HOUB 3OMGA 1MJEA 2NTSA 2A69C 1S5FD 4JI4Q 1C4QA 2ZTCA 4RFBA 2B63H 2VNUD 3UE0A 2H1EA 5IYDH 4GOPA 4CHTB 2B8GA 2R3ZA 4F7XA 5IT9E 4R8IA 3W5OA 1TT2A 1KRSA 1ENCA 5KIXA 3ONAB 1Y1WB 1Q8IA 1DJRD 1UE1A 2EYLA 1A3VA 5E3FA 3D4RA 2E2HB 3HOXH 1S5DD 4UAIA 1PZKD 2A6ED 2JK8A 4R4OA 4GOPB 2TSSA 4XQQA 4K8JA 5FO9B 4LWCA 3GTQH 2OWOA 2NUCA 3ERQA 4BY7H 2F4IA 2JA6G 1QUQA 1HUNA 1Q1BA 4EX5A 4DV1L 4WJ3M 1DM0B 2BE5D 5C0XG 4JCVE 2F0DA 1V9PA 4RCOA 3WDNA 1PH7A 2F0LA 4DXGA 1K8MA 1Q81C 5C3EB 3M85A 4DR6Q 1PV4A 2UXDQ 3FHWA 4BA2I 3VA5A 2NYZD 3NUCA 1C9OA 5IT9L 3NSWA 4HN7A 2NVTH 2BA0A 2SNSA 2PW5A 4LF7Q 4UPAA 4POGA 2YU9H 3T56B 2EYMA 4HTHA 5I2YA 4FF2A 5M9OA 4CJ1B 2EXDA 5I6WA 3DM3A 1BF4A 4ZYSA 3MXNA 3AFPA 5JPNC 3EIVA 2F3IA 1IBKL 1TWGB 3D8GA 1EL0A 3R3OA 4RHSA 3OTOQ 5JJLA 5C5MA 2AQ3B 1TR5A 5EKLA 2Q8TA 2G5DA 1VQLA 1HZ9A 2MJ8A 5IYBH 4A3GB 1CFMA 4CGYB 1A15A 1FJGL 2XRSD 1OO9B 4DK3C 1HTLD 4JI6L 1WTRA 4JPBW 4JVZA 4LF5L 5ELCA 3I4NH 1N36Q 4CKEA 4CKCA 2ZT9C 3SGIA 4ZK9B 4UP7A 3SHLA 3U9SA 1F77A 1QNKA 2R93H 4YCUA 1I4XA 5I4DA 3Q23A 3LNNA 4RGTA 1T9HA 2KBNA 2MP1A 2WAQG 4WRDA 1LV9A 3K57A 1IKMA 4BBSG 2F0NA 5KRUA 2NVYB 5KGUA 2AKWB 1KNEA 4JV5Q 1T5EA 4PZ7A 4IJHA 1OXUA 3RZDB 3D4WA 3TDQA 1BBUA 3V2TA 2K03A 5EPKA 3M9BA 3X3MA 3LWUA 4DUYL 5HGQA 3A74A 4ALPA 3PUVA 3S1NB 1NAPA 4JI5L 1SYCA 2KEDA 1RL2A 4DR5L 4AH6A 1DONA 1E7ZA 2ENBA 2IW3A 4DR4Q 4GN4B 5GAHC 2WFWA 1PYBA 4GS3A 2Y0SG 4JW0A 1G8ZD 1VQEA 1J5EQ 5C4XH 1SLJA 3IKJA 3QO2A 1YNXA 3J81i 1LTRD 4IFDH 1EFWA 1QG7A 2O5JC 4YHHL 2F0HA 3J80E 1BBWA 4QUFA 1XMOQ 1X9NA 1LTID 2K5NA 4O0AA 3HOYH 2MQHA 3TZDA 3CMEA 4QGUA 1HCZA 4HMIA 4C3HB 3VYTA 3HKZE 1O80A 1BCPF 1PRTD 4JI2L 2HHHQ 1EIHA 1I4QA 1WJJA 1A3TA 1FNVA 3ER0A 2HIVA 4R4IA 4DV7Q 3BZDB 3I3CA 4PNYA 1EWCA 1UWVA 4KHVA 1EIGA 1PZID 1KLGD 2JA7G 4GKKL 4GOPC 1H9JA 1KRTA 3SK6A 4BBRH 1HR0Q 3GTLH 3J81L 1DOMA 3T1HQ 3KFUA 1MIUA 3BVGA 3TP6A 3J80L 3S16H 3S2DB 4KK7A 4KJNA 3E5SA 4P73A 3CC4A 2E2DC 1E2WA 4BXXH 1II3A 3S24A 5DEHA 3J80c 5CV6A 2HQEA 2EYPA 4EQOA 1HRJA 4HIOA 1ZKOA 3TBIB 1DYQA 3HP3A 2B2YA
chains in the Genus database with same CATH topology
2F1MA 4ME5A 2JE6I 4EQPA 3ND8A 4A93B 3S2HB 1EEFD 3S15B 2EY1A 3RUZA 5J22A 4XT1B 5KNDA 1NCVA 5CGKA 1UUPA 3H09A 1TWCB 5D65A 3DXJC 5A2QE 3QJYA 4KTAA 1KABA 2D5DA 1ONLA 1Q3LA 2IL8A 2H4OA 2IT1A 5C44B 3QG1A 2RSOA 3RLFA 1YNJC 2LKVA 2B39A 3MXGA 4K14A 1SBBB 1PDQA 1ICWA 1A2TA 1KNAA 2K32A 2LY7A 3SK5A 3KBXA 3D4DA 4IUQA 1RKNA 4Y7NB 3N6RA 2A68C 1Q12A 4DNRB 1RODA 4C3IB 1TY2A 2B8FA 5A2QL 1RTNA 3HEJA 1QJOA 4DFAA 2B63B 1MI2A 2F3WA 5COYA 2F0UA 2EOTA 3ITPA 5DNFA 3NBIA 3VR3A 1K8OA 4IZ8A 4RKBA 2PZUA 3C1EA 3GTQB 4QIWB 1JR0D 4BY7B 2J7ZA 2X69A 2B2WC 2CVRA 5CC4A 4E6IA 1LTBD 2O2LD 3P20A 1SYBA 4C56C 1ENFA 4HSPA 3SK4A 4EGVA 1VMPA 1ZXTA 4IFDJ 4KY6A 2PMZB 2YU9B 1FGBD 4RGMA 2FJ2A 3VYSA 1JWUD 5ELFA 3IL8A 4XT3B 1KDAA 4S3SA 2DY8A 3KLSX 1G291 1EYAA 4KKUA 4JBWA 1LLRD 4RHRA 3WOEA 1TS3A 4X3UA 2JYOA 2NVQB 3OPOA 1EFID 5ELEA 3DUZA 1EEID 2F0EA 5C4HA 5T1GA 1SE4A 4XQJA 3HOVB 1B4OA 1BR9A 2ZXOA 2Z4IA 2EDGA 2V4DA 4IUNA 3MAQA 3IAYA 4QCLA 3BVMA 4ZKBB 3MA2B 4OO1G 1AP0A 2NTTA 5I2XA 1J9OA 1O78A 2C5CA 2K28A 5CBEE 3U9OA 2E75C 3PO2B 2R93B 1IKLA 4G4KA 4KV6A 1XX8A 1BCPC 3J7AV 3K5LA 1SNQA 2NN6H 3J7AF 5JVH3 4NDXA 2F0WA 1D5XC 1YNNC 3F2UA 2NN6I 1FNUA 3L3OC 4DK0A 4RGOS 1STNA 2BA1A 2PNRC 2AUKA 2WIIB 3A8KE 1GUWA 2F0FA 3N52A 5A35A 1EY8A 1CA6A 4BWGB 5C4XB 4U68A 1LTAD 1EZ6A 4FXGC 1IW7D 1V1OA 1VF5C 2EJMA 1HUMA 1W6KA 3R2TA 1EQVA 3NQTA 1CZWA 2G9HD 1IYUA 4IUPA 2QEJC 2BOSA 3KBGA 4X3KA 4HCSA 2DN8A 2Z8LA 5IIFA 1Y8OB 3QB3A 3S16B 1H9SA 1BDOA 4KKTA 2RA4A 5FOBB 1B9NA 2BDNA 4K5WA 3UI2A 3QOJA 1T5XD 1I50B 2HCCA 1H9SB 1KAAA 1LTSD 1AN8A 4U673 1BUVT 3W2DA 3L9AX 1FNWA 2HCIA 1JICA 2IWHA 3OMCA 2X6LA 4J8QA 2EZVA 4CBVA 3TP5A 4ABNA 1PTOD 5JAVA 1ZYRC 4A3FB 1LT5D 1BBXC 4F88A 3IFDA 5F2DA 1R9TB 4FVMA 1BOSA 4HEDA 4FNFA 4EVOA 3P75A 4L8JA 4KHZA 3HG9A 1FR3A 2ICIA 1EWHA 2SNMA 2F0TA 2EY5A 1STBA 1E2VA 5LL6S 5ELBA 2IJ0A 1Q1EA 1OXVA 3I4MB 3K5OA 4DXFA 3D31A 4ZAIA 4RCNA 1QILA 1TWFB 1X3PA 2MPMA 1CTMA 1GUTA 1JE4A 2WKCA 1WCMB 3J7YW 4FF1A 5TSSA 3W3AA 1IYVA 1H9RA 2F0SA 1Y1VB 3H0GB 3T51B 5NUCA 1S5CD 2I46A 4MN3A 3PUYA 5K36H 4V0BA 2Q8IB 4AYBB 2L12A 5E4WC 5CV5A 4FXKC 3BYYB 2NVXB 1PRTF 1QB5D 2A6HD 3S14B 2MGSA 4IUUA 1B2TA 1SYEA 1OXSC 2YYZA 1SMYD 1U4RA 1TVXA 4ZLTF 2OT2A 3M7NA 1ENAA 2KQ3A 3DMUA 3MFYA 1TQOA 4LJZC 1K83B 2NN6G 2FMMA 5IOCA 2K05A 1DOLA 1AEXA 1WTPA 2Q8RE 3GTOB 3RMHA 5DM73 5CV7A 3OIPA 1KTKA 4KY7A 2GA4B 4L63B 2A6EC 1A3UA 1SAPA 4DAVA 1EU3A 1PFNA 2F0OA 2XSCA 3C2PA 5K5PA 2BE5C 2JA5B 2B2WA 4NP5A 3M3YB 4QB4A 2CW0D 1WTWA 4IUTA 1HPCA 2EYJA 2ICEC 1ET6A 4RAUC 3I4LA 3GO5A 1F2ZA 4C3HG 2G9DA 2FINB 1WTXA 4A3MB 5EQ0A 3VR5A 3LWEA 2KEEA 3OWFA 2PO4A 5IGCA 1TY0A 1DOKA 3K5NA 3J81E 4ILWA 3GTPB 3EVQA 4K6DA 1U4PA 2RQXA 2Z4HA 4IFDI 5I6YA 1OXTA 1LT3D 5CV9A 1LT6D 1S4ZA 5JJZA 1EY0A 3I72A 2EPBA 2XWJB 5KNCA 1EY7A 1M4VA 3CHBD 2WINB 3DWAA 3CU7A 4QMGA 3BDCA 4CJ2C 5EBCA 5FO8B 3EJIA 5FO7B 1WD0A 5KNBA 1JQYD 4MIUA 4DF7A 2OEOA 3K6OA 1F9RA 1DXMA 1QCBD 4HSVA 1EOTA 3Q24A 4ID6A 4HR7B 2MUYA 1NUCA 4IQZA 4O42A 1RJTA 2L4NA 3FDTA 1V8QA 2L11A 1UNSA 2F0VA 3S9WA 1BCPB 2E2IB 1Z47A 2A5HA 1PZJD 3SR1A 4B9WA 1JOOA 1SJHD 3FKIB 2FFKB 1CA5A 2RVLA 4WORA 3PV0A 4C3JB 3CKIB 1A6XA 2DNEA 4C3IG 4WFN3 1CT1D 2WV6D 2KHSA 3DEPA 4RWSC 1STYA 5IGBA 5I9PA 1JOKA 1MGSA 5CV8A 5HGTA 2K7VA 2R7ZB 3EA6A 3R8BA 4DGZA 4C2MB 2K5WA 1BO0A 1PRTC 3MXPA 4ZQ3A 4XDXA 2RDGA 3E6ZX 1PLFA 3Q22A 2PYKA 1I4PA 3FEWX 2KJXA 3OSOA 2K6AA 1IHZA 1SE3A 1EZ8A 1RCVD 2B2UC 2JEBI 2VXWA 3RD4A 1STEA 1VF7A 3PO3B 3A54A 4K5VA 4NW2A 1STGA 3TN2A 4NKLA 1PXUA 2L9HA 2O4XA 4FO2A 5EPLA 1I3QB 3DWPA 4TQUS 3VR4A 3FRPB 3NPPA 5M3MB 4FYDA 4EQNA 1O7LA 4XQNA 4L6TB 2F0MA 2EYFA 1ILQA 2KOLA 2EYOA 3K5MA 4K2KA 3C3LA 5E4XA 3GV6A 3FMCA 2F0PA 1M8AA 1SFOB 3K59A 1HQRD 1F9QA 3BVZA 4OGQC 1DD2A 4C1NK 3KF8A 4A3EB 1LTGD 4N9PA 1SYDA 2AQ2B 2IPKD 1QOHA 1CI3M 3P7JA 1CHQD 2OXPA 4X3TA 3T16A 3Q0AA 5JOBA 2FHTA 4XYOA 3AMUA 5M5YB 5C0XH 4M1UB 1RHPA 4PMBA 3VYUA 3NBHA 1LABA 5C0XI 4XYQA 1PTOF 4OL7A 1D1KA 5FK9C 2K5QA 3GP7A 3SEBA 2K04A 1D1IA 5IGGA 1O7YA 5EKIA 3C1FA 4IFDG 3A7AB 4TSSA 5CORA 1MSHA 4ZRZA 4JK1C 3S1MB 1AZPA 1C48A 1DCZA 3D3RA 5T1IA 4K2LA 1NR2A 1STHA 3SXHA 4H7BA 3TZUA 3A8IE 5CBAE 1TKWB 4BY1B 1F9PA 4RKLA 5E1FA 5AFWA 4A3BB 2RSNA 4J1MA 1G6ZA 1D5MC 3EFXD 3OHXC 2FMCA 1H9KA 3AU7A 1PMRA 4C1NI 3I8ZA 1D6EC 3DM1A 2LMCB 5IGDA 5CMDA 2IX3A 4WJWA 1A2UA 2KCCA 1GUNA 1L0XB 4HAEA 3JAME 1WTVA 3OWEB 4I7ZC 1PFMA 1E2ZA 3MXUA 4XTCS 3MZ5A 1UAPA 2NBFA 3HOWB 1EQTA 3NXWA 4DN4M 4KI0A 1HQMC 1ILPA 4ZUIA 2A69D 2M00A 3QWNA 3JAML 4PMWA 2KECA 1U4LA 1I4HA 2EVBA 4UDUC 2EY6A 1CM9A 5IGEA 4KN7C 3H3VC 1TWAB 1EY4A 2KCNA 1D5ZC 3PUZA 3TMEA 3NQIA 4FF4A 1IW7C 1KDCA 4ZUJA 4H13C 2M9VA 2IX1A 2K5DA 3Q6SA 2CHBD 1PFBA 1GUSA 4A3JB 1F2LA 1EYCA 1R4PB 3A55A 3HOZB 5BN4A 2B2VA 4LMQD 3MC0B 4TRDA 1SEBD 1ESFA 3SE0A 2EJGC 5C0XJ 1R4QB 1EU4A 2XN9C 2KUMA 2L0CA 4PMCA 3AB9A 4OIKA 1Z6HA 5M5WB 3TP7A 1SNPA 2VB3X 2F0GA 1OXXK 3KLSA 3ZYYX 1W6JA 1ML0D 2JP1A 5C5LA 1TIID 2NB0A 1TS5A 1JWSD 2B2TC 3M4YA 1SSOA 1XWEA 1U4MA 2ZXRA 2N55A 5EJWA 5KYLA 5CR3A 1SNOA 1STAA 2LFNA 3GV3A 1I6HB 3A56A 2F03A 1WVLA 4DAPA 4QF4A 5M5XB 4G7OC 4H0LC 3NE5B 2PZWA 1EY9A 4YIJA 2SEBD 2AWNA 4HMJA 1PTOC 2RDFA 1B53A 1Q90A 1F2MA 5EBDA 1HFGA 1Y8NB 4QUCA 3MWYW 4KMUC 3ND9A 1AW7A 1NR4A 1UEAB 1J8IA 2QF7A 5LL6X 4KD4A 4R8NA 4DNTB 1D2BA 4OIJA 3WOFA 2PQEA 1JB3A 1I4RA 4F87A 2JA6B 5G3LD 3NHHA 3KK7A 5D3DA 3HKZB 1PRTB 4RH6A 2B2UA 4O1NA 3URYA 3OIQA 1SDFA 3A7LA 1HTPA 2F0JA 3GTGB 2D62A 1FD7D 3CRKC 2ID0A 4XIGS 2XNAC 1S5ED 1I6VC 1EYDA 5FKAC 3MHBA 1MSGA 3PUXA 1SJED 1QNUA 2R6GA 4TKOB 4CKBA 1JCKB 1RDPD 1B1ZA 1E0BA 2EY2A 4DU9A 2A6HC 1MD2D 5DAUA 5J39A 1JWMD 2XVSA 2E76C 1LACA 4B9XA 2QDBA 1RD9D 1SMYC 3TSSA 5CYUA 2F0IA 1SYGA 3R93A 2Z1CA 1LT4D 3TP8A 1B50A 1G2SA 2WKDA 3KLRA 4OO1H 3NWTA 1PTOH 3FVQA 4M8AA 2X6GA 1JC7A 2KVMA 4DK1A 1Y69U 2B2VC 4OO1I 2M2LA 1CQFA 4V190 3GTMB 2JSOA 1GUOA 1X3QA 2WAQB 5LHY1 2NZ1D 3QIAA 2JEAI 4BBSB 1GHJA 4DAYA 2WACA 3NP8A 3FPUB 1XYIA 3PIO3 1ET9A 2HDMA 3BDLA 1O7ZA 1FYCA 1YNJD 3HRZC 3SVMA 2HDLA 5EPJA 1U9RA 3E0JA 1V1PA 5JVG3 2C9OA 3K0YA 3VR6A 2Y0SB 2RBMA 4KY5A 4C3JG 2A68D 3D6CA 3NTHA 3KUPA 2CW0C 1V1PB 4KJOA 1BQQT 4MHEA 3V96A 4B08A 3I70A 2A74C 1RTOA 4OHJA 1JOQA 3SDZA 5ISRA 3NTKA 3O13A 2EE1A 5DM63 4J6HA 1LO5D 3I73A 4Z9CB 1TU2B 1HA5A 5JEAH 1MBYA 3GTKB 2EJFC 2JA7B 1VCIA 2PCFB 4LAAA 4A3IB 1DZ1A 1SNDA 1G91A 1CK1A 4N9TA 1TWHB 1TS4A 3NWSA 5HURA 2F0QA 1GOZA 3R2IA 5K36G 3HGBA 2WP8J 3I91A 1XTCD 3BDOA 3K7AB 5J1ZA 2NWGA 1V43A 2VB2X 4Q0FA 3G7LA 5KYIA 1SYFA 5D14A 2AUJD 4FP5D 1WTQA 1WTOA 3BS1A 3A8JE 2RKSA 3BYTB 2XRQD 3PMFA 2SDFA 3BG3A 2DNCA 3S17B 5EKKA 4ZKCB 2WB1B 1CQVA 5ELDA 5M3FB 2R92B 2QILA 5CV4A 2DY7A 3HOXB 2IX0A 1EY6A 5C6AA 1HA6A 2XWBB 2J4XA 1AZQA 2KA7A 1B44D 2ZXPA 2R61A 3DWQA 1F9SA 2BCOA 4IUVA 4FXDA 1BCPD 1BNZA 2RDHA 2E74C 1CHPD 3NTIA 4H44C 3X3NA 2QCPX 1YNND 5I9OA 1HXYD 2F3VA 2MHVA 1QE6A 3H6MA 4IURA 1JORA 4K8IA 2NVTB 2J0TD 3G6JB 1SNCA 2L55A 1IL8A 1PYWD 4LK1C 2AQ1B 1Z7TA 4CJ0B 1CZGA 3VA7A 1G2TA 2PPBC 3PIP3 2JXMB 3I90A 2AWOA 5EGTA 3L7ZC 3MVVA 3OW7A 3OOCA 2HUGA 4RGNA 4ULLA 2B2TA 3GQBA 3DHQA 1C8CA 4A3DB 3S1QB 2JA8B 1GHKA 3S1RB 3PUWA 2E2JB 4G7HC 3H94A 5FLXE 3EROA 3HS0C 1B3AA 4PQXA 1GJXA 2L1BA 4K5XA 4KKSA 4RA8A 3I4NB 3MTSA 3K58A 4A3KB 3GD7A 1S5BD 2PW7A 5JEAJ 4FF3A 3VR2A 3V05A 3FPPA 1VDZA 1GUGA 3C46A 5IGFA 2K33A 2B2YC 3HZXA 5C3XA 4G57A 1RF2D 1PTOB 5FLXL 5C4ZA 1Y8PB 2OF1A 2QKIC 4K6LA 3D6WA 1KDBA 3DEOA 4DA2A 2O5IC 3QOLA 5JPMC 2XIWA 4KN4C 2SOBA 3IFTA 3CRLC 1LTTD 1QWYA 2VUMB 1ZYRD 1H9MA 1HFNA 1GXDC 4PV1C 2EYHA 1HHVA 3HOYB 1SE2A 4NMZA 5C3WA 1TS2A 3NK9A 1B9MA 5D3IB 4BS9A 3T4AC 3LX0A 4HCEA 2D9UA 5JEAG 1I4GA 3M7GA 3T13A 2TMPA 4IN3A 4BBRB 3T53B 2N88A 2K1BA 2F0KA 4KD3A 3GTLB 1SNMA 1EY5A 4P2CB 4F8MA 4GZYC 1ZEQX 2CQAA 5G3LF 5C4JB 2A73B 2K01A 1SXTA 5KEEA 3CQZB 4IALA 2PZTA 3MFGA 4ODGA 3MEHA 3RZOB 3P1HA 4Q5VA 5IODA 1AFPA 3EQLC 1ESRA 3SK8A 4R9WA 4XXEA 4G7ZC 2EXZA 5BN3A 1NSNS 1VMCA 1X32A 1BXTA 2BDOA 4X3SA 3M4OB 1KLUD 2D2CC 2I07B 2LS01 3GTJB 1WD1A 3H91A 2L5TA 3VYRA 1F2YA 5BN5A 4BA1I 1XXGA 1L0YB 4I65A 3HOUB 3OMGA 2NTSA 2A69C 1S5FD 1C4QA 2VNUD 4RFBA 2H1EA 4CHTB 2B8GA 2R3ZA 4F7XA 5IT9E 4R8IA 1TT2A 1ENCA 5KIXA 3ONAB 1Y1WB 1Q8IA 1DJRD 2EYLA 5E3FA 1A3VA 3D4RA 2E2HB 1S5DD 4UAIA 1PZKD 2A6ED 2TSSA 4XQQA 4K8JA 5FO9B 2NUCA 3ERQA 2F4IA 1HUNA 1Q1BA 1DM0B 2BE5D 5C0XG 2F0DA 4RCOA 3WDNA 2F0LA 4DXGA 1K8MA 5C3EB 3M85A 4BA2I 3VA5A 2NYZD 3NUCA 5IT9L 3NSWA 4HN7A 2BA0A 2SNSA 2PW5A 3T56B 2EYMA 4HTHA 5I2YA 4FF2A 5M9OA 4CJ1B 5I6WA 1BF4A 4ZYSA 3MXNA 5JPNC 1TWGB 3D8GA 1EL0A 3R3OA 4RHSA 5C5MA 2AQ3B 1TR5A 5EKLA 2Q8TA 2MJ8A 4A3GB 1CFMA 4CGYB 1A15A 2XRSD 1OO9B 1HTLD 1WTRA 5ELCA 4CKEA 4CKCA 2ZT9C 4ZK9B 3SHLA 3U9SA 1F77A 1QNKA 1I4XA 5I4DA 3Q23A 3LNNA 4RGTA 2MP1A 4WRDA 1LV9A 3K57A 1IKMA 2F0NA 5KRUA 2NVYB 5KGUA 1KNEA 1T5EA 1OXUA 3RZDB 3D4WA 3TDQA 3V2TA 2K03A 5EPKA 3X3MA 3LWUA 3PUVA 3S1NB 1NAPA 1SYCA 2KEDA 1DONA 2ENBA 2IW3A 1G8ZD 3IKJA 3QO2A 1LTRD 4IFDH 1QG7A 2O5JC 2F0HA 3J80E 4QUFA 1LTID 3TZDA 1HCZA 4HMIA 4C3HB 3VYTA 1O80A 1BCPF 1PRTD 1EIHA 1I4QA 1A3TA 1FNVA 3BZDB 3I3CA 4PNYA 1EWCA 4KHVA 1EIGA 1PZID 1KLGD 1H9JA 3SK6A 3J81L 1DOMA 3BVGA 3TP6A 3J80L 3S2DB 4KK7A 4KJNA 3E5SA 2E2DC 1E2WA 1II3A 5DEHA 5CV6A 2HQEA 2EYPA 4EQOA 1HRJA 1ZKOA 3TBIB 1DYQA 3HP3A 2B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME5 A;  1EZ6 A;  5IOC A;  3SK4 A;  4F7X A;  2O4X A;  4MIU A;  2EY6 A;  1AEX A;  4EVO A;  3T13 A;  3P75 A;  3DHQ A;  1TT2 A;  4WRD A;  4EQP A;  4DF7 A;  1ENC A;  5IGE A;  5KIX A;  2F0N A;  1EY4 A;  5KRU A;  4KY6 A;  3TME A;  2OEO A;  2EY1 A;  2EYL A;  1A3V A;  5E3F A;  3RUZ A;  5KGU A;  5J22 A;  1KDC A;  4KD4 A;  2WAC A;  4R8N A;  4ZUJ A;  4K2L A;  5CV7 A;  5J1Z A;  5CGK A;  1STH A;  2F0K A;  4KD3 A;  4ID6 A;  3D4W A;  2SNM A;  1SNM A;  1KDA A;  1EY5 A;  2F0T A;  2EY5 A;  1SYF A;  3ERO A;  3NP8 A;  4KY7 A;  4S3S A;  3V2T A;  3SXH A;  4EQN A;  4K8J A;  1EQV A;  2NUC A;  3ERQ A;  3NQT A;  2PQE A;  1EYA A;  1STB A;  4F8M A;  1A3U A;  1NUC A;  3BDL A;  1EYC A;  4H7B A;  4KTA A;  2F0M A;  1SYC A;  4K5X A;  1KAB A;  2EYF A;  2F0O A;  2EYO A;  2RKS A;  5K5P A;  2F0D A;  3NHH A;  2ENB A;  2F0V A;  3PMF A;  3S9W A;  2F0L A;  4TRD A;  1U9R A;  4RKL A;  5E1F A;  2F0E A;  3SR1 A;  5C4H A;  4K2K A;  5EKK A;  4B9W A;  2PW7 A;  2LKV A;  5IIF A;  1JOO A;  4NP5 A;  4K14 A;  4J1M A;  5KEE A;  2RBM A;  4KY5 A;  3VA5 A;  4QB4 A;  4PMC A;  2F0S A;  5CV4 A;  1A2T A;  4IUN A;  2F0J A;  3NUC A;  3TP7 A;  4IAL A;  2PZT A;  1SNP A;  3QB3 A;  4WOR A;  3SK5 A;  2F0P A;  2F0G A;  3D4D A;  3D6C A;  4ODG A;  2EYJ A;  2SNS A;  3MEH A;  5NUC A;  1RKN A;  2F0H A;  2PW5 A;  5IGD A;  5IGF A;  3P1H A;  1EY6 A;  5C6A A;  4KJO A;  3HZX A;  5C3X A;  4G57 A;  2KHS A;  1EYD A;  1SYD A;  4N9P A;  4K5W A;  5C5L A;  3MHB A;  2EYM A;  5IOD A;  3QOJ A;  1JOQ A;  1F2Z A;  1A2U A;  3SK8 A;  1STY A;  4HTH A;  3U9O A;  5M9O A;  5ISR A;  3HEJ A;  4DFA A;  5IGB A;  5C4Z A;  4HMI A;  5CV5 A;  1JOK A;  5CV8 A;  2OF1 A;  2EXZ A;  2OXP A;  5I6W A;  5I9P A;  1KAA A;  5HGT A;  3T16 A;  2F3W A;  1KDB A;  2EY2 A;  1SNO A;  5CR3 A;  5KYL A;  3QOL A;  1NSN S;  4DU9 A;  4DGZ A;  5JOB A;  4KV6 A;  2F0U A;  4J6H A;  1STA A;  3OWF A;  5IGC A;  1A3T A;  5KYI A;  4NKL A;  3ITP A;  3MXP A;  1SNQ A;  3D8G A;  5I9O A;  1SYE A;  4ZQ3 A;  2F3V A;  3R3O A;  3OMC A;  3H6M A;  4IZ8 A;  5DAU A;  5J39 A;  1JOR A;  4NDX A;  2F0W A;  2SOB A;  3EVQ A;  4PNY A;  2PZU A;  4RKB A;  4KHV A;  4K6D A;  3MZ5 A;  2PYK A;  4PMB A;  4K8I A;  1F2Y A;  4QF4 A;  5C5M A;  3C1E A;  3NXW A;  4B9X A;  3TP5 A;  3SK6 A;  5I6Y A;  1TR5 A;  2QDB A;  3OSO A;  1SNC A;  3MVV A;  5EKL A;  2PZW A;  1IHZ A;  1STN A;  1EY9 A;  2EYH A;  1EZ8 A;  4YIJ A;  3TP6 A;  4LAA A;  5JAV A;  5CV9 A;  4OL7 A;  2F0I A;  1SYG A;  4HMJ A;  5CC4 A;  4I65 A;  4ZUI A;  4NMZ A;  5C3W A;  1ENA A;  2KQ3 A;  3E5S A;  4KJN A;  1EY0 A;  1SND A;  3DMU A;  3NK9 A;  3TP8 A;  4E6I A;  2RDF A;  2F0F A;  1EY7 A;  5IGG A;  1TQO A;  4K5V A;  1II3 A;  2M00 A;  4N9T A;  1F2M A;  3OMG A;  5DEH A;  5F2D A;  5CV6 A;  2HQE A;  2EYP A;  3BDC A;  4QMG A;  4EQO A;  3LX0 A;  1EY8 A;  5EGT A;  3C1F A;  5HUR A;  1STG A;  3SHL A;  1SYB A;  3EJI A;  2F0Q A; 
#chains in the Genus database with same CATH topology
 4RG1 A;  2F1M A;  4LFB Q;  4ME5 A;  2I5M X;  5C44 G;  1PYS B;  2JE6 I;  2JN4 A;  1E3P A;  2RCN A;  4EQP A;  3ND8 A;  3TQY A;  3M4P A;  4A93 B;  3CQZ H;  3S2H B;  1XNR Q;  1EEF D;  1VQN A;  3S15 B;  2EY1 A;  3RUZ A;  5J22 A;  4XT1 B;  5KND A;  1YHB A;  1NCV A;  5CGK A;  1UUP A;  1JJC B;  3H09 A;  1TWC B;  5D65 A;  3DXJ C;  5A2Q E;  1N32 Q;  3QJY A;  1XMQ L;  4KTA A;  4LFC Q;  4DR3 Q;  1KAB A;  2D5D A;  1ONL A;  1Q3L A;  2IL8 A;  1S40 A;  1N33 L;  2H4O A;  4A3F H;  3KLW A;  4QL5 A;  2IT1 A;  1A63 A;  4UP8 A;  5C44 B;  3QG1 A;  2RSO A;  3RLF A;  5M3F G;  1YNJ C;  2R92 G;  1XNQ Q;  1Y14 B;  1B70 B;  1I94 L;  3M4O H;  2LKV A;  2B39 A;  3MXG A;  4K14 A;  1SBB B;  1PDQ A;  1ASZ A;  1ICW A;  2KHI A;  1A2T A;  3RR5 A;  1KNA A;  3HOX G;  2K32 A;  2LY7 A;  1HZA A;  3KBX A;  3SK5 A;  3D4D A;  4A4I A;  4X62 L;  4IUQ A;  1K0R A;  1RKN A;  1G51 A;  1KXL A;  4Y7N B;  3N6R A;  2A68 C;  1Q12 A;  4DNR B;  1ROD A;  3CF5 A;  1PA6 A;  4C3I B;  1TY2 A;  2UUB Q;  2B8F A;  1FGU A;  5A2Q L;  1RTN A;  3HEJ A;  1QJO A;  4DFA A;  3CCS A;  2B63 B;  1PH8 A;  1MI2 A;  2F3W A;  4DUZ Q;  2Z6K A;  3TS2 A;  5COY A;  2F0U A;  1OTC A;  2EOT A;  3ITP A;  2Y0S E;  5DNF A;  3NBI A;  3VR3 A;  1K8O A;  4IZ8 A;  4RKB A;  1WCM H;  2PZU A;  3C1E A;  3GTQ B;  1LM0 A;  4QIW B;  1JR0 D;  4BY7 B;  4LW1 A;  3J7Z C;  1Y1V H;  2J7Z A;  2X69 A;  1MHW C;  3U4V A;  4FDB A;  4B3M L;  1PHJ A;  2B2W C;  2CVR A;  5CC4 A;  4E6I A;  1LTB D;  2PI2 A;  1KHI A;  3W1B A;  2P5Z X;  2O2L D;  1JJ2 A;  3H15 A;  3P20 A;  1SYB A;  4A75 A;  2EQS A;  4C56 C;  3HFZ B;  2NVX H;  3JC6 6;  1ENF A;  4HSP A;  3SK4 A;  4EGV A;  1YVC A;  4A3D G;  1VMP A;  1ZXT A;  2JA8 G;  3S14 H;  4IFD J;  4KHP L;  4NXN L;  4KY6 A;  2PMZ B;  4B3T Q;  3KF6 A;  2YU9 B;  1FGB D;  3CCV A;  4RGM A;  2FJ2 A;  5IYB G;  3VYS A;  1YJ9 A;  1JWU D;  5ELF A;  4HIM A;  3IL8 A;  4XT3 B;  1KDA A;  4L5R C;  3CCJ A;  2ZTD A;  4S3S A;  2DY8 A;  3KLS X;  1G29 1;  1EYA A;  4KKU A;  4JBW A;  1LLR D;  4RHR A;  3WOE A;  3I4N G;  1TS3 A;  1VQG A;  3U50 C;  4X3U A;  2JYO A;  2NVQ B;  3OPO A;  1EFI D;  1BVS A;  1N9W A;  4L5T A;  5ELE A;  4A3K G;  1L1O A;  1Q8K A;  3L2P A;  3DUZ A;  1EEI D;  3CCU A;  2F0E A;  5C4H A;  5T1G A;  1SE4 A;  1M90 C;  4XQJ A;  1Z9F A;  1TWG H;  1B4O A;  3HOV B;  1BR9 A;  2ZXO A;  2VQE L;  5FLM H;  2Z4I A;  1K83 H;  4POF A;  4DAM A;  1VS0 A;  2EDG A;  2KHJ A;  3STB C;  2V4D A;  4IUN A;  3MAQ A;  3IAY A;  4QCL A;  3BVM A;  4ZKB B;  2ALY B;  3I56 A;  1HNX Q;  1L1O B;  1A0I A;  3MA2 B;  3GTO H;  3U4Z A;  2LXJ A;  4OO1 G;  1AP0 A;  4A3G H;  2NTT A;  5I2X A;  1J9O A;  1O78 A;  2C5C A;  2K28 A;  3RLN A;  5CBE E;  3U9O A;  2E75 C;  2UUC L;  3PO2 B;  2R93 B;  1YEZ A;  1IKL A;  4G4K A;  4KV6 A;  2WB1 E;  1XX8 A;  4X66 Q;  5AJ3 L;  1BCP C;  3J7A V;  3K5L A;  1SNQ A;  2NN6 H;  3J7A F;  5JVH 3;  4NDX A;  2F0W A;  1D5X C;  2VUM G;  1YNN C;  2JA5 H;  4EQ5 A;  1KAW A;  2R7D A;  3F2U A;  2NN6 I;  1FNU A;  2FXQ A;  3L3O C;  4DK0 A;  4NXM L;  3HOY G;  4RGO S;  1STN A;  4DR2 L;  2BA1 A;  2PNR C;  2AUK A;  2WII B;  3A8K E;  3S1N H;  1GUW A;  4IJL A;  2F0F A;  4B3R L;  3N52 A;  3TRZ A;  4HIK A;  5A35 A;  1EY8 A;  1CA6 A;  4BWG B;  5C4X B;  4A3M H;  2HIX A;  4U68 A;  1LTA D;  5BR8 L;  1EZ6 A;  4FXG C;  4DKA C;  2F52 A;  1IW7 D;  1V1O A;  1LUZ A;  4BBR G;  1VF5 C;  2EJM A;  3CC2 A;  2E5L Q;  3GTP H;  1HUM A;  4R4Q A;  1GM5 A;  1W6K A;  3R2T A;  1EQV A;  3NQT A;  1CZW A;  5IP7 G;  2G9H D;  1UEB A;  1PH1 A;  1IYU A;  2AHO B;  4IUP A;  2QEJ C;  2BOS A;  3JAM i;  3KBG A;  4YY3 L;  3EN2 A;  4X3K A;  4HCS A;  1TXY A;  2DN8 A;  5HY6 A;  5GAG C;  2Z8L A;  5IIF A;  1WFQ A;  4A3L H;  2DJF C;  1Y8O B;  2Z6K C;  5DLQ E;  3QB3 A;  2YTX A;  3S16 B;  1H9S A;  1BDO A;  4GLV B;  4KKT A;  2RCF A;  3CCM A;  1FJG Q;  2RA4 A;  5FOB B;  1B9N A;  2BDN A;  1K3R A;  1A8V A;  4K5W A;  3QOJ A;  3UI2 A;  3F2D A;  1T5X D;  1I50 B;  1P8L A;  2HCC A;  1H9S B;  1KAA A;  1LTS D;  1AN8 A;  4U67 3;  1YZ6 A;  1BUV T;  3W2D A;  3L9A X;  1FNW A;  2HCI A;  1JIC A;  3K0X A;  2IWH A;  4DR1 L;  4OXP A;  3OMC A;  2X6L A;  2E2I H;  4LF8 Q;  3T1Y Q;  4A93 H;  3S2H H;  4J8Q A;  2EZV A;  3FKI H;  4CBV A;  3TP5 A;  1PH4 A;  4ABN A;  1PTO D;  4HJ7 A;  5JAV A;  2VY3 A;  1ZYR C;  4NPS A;  3AEV A;  4A3F B;  1LT5 D;  1BBX C;  4JBM A;  1PH5 A;  4F88 A;  2JA9 A;  3IFD A;  1J6Q A;  5F2D A;  1R9T B;  5GAE C;  3CXC A;  4FVM A;  1BOS A;  1VQH A;  4HED A;  2UXB Q;  4FNF A;  4EVO A;  3P75 A;  4L8J A;  4C2M H;  4KHZ A;  2EIF A;  4KLK A;  4DV3 L;  1Y1W G;  3HG9 A;  4MTK A;  1FR3 A;  2ES2 A;  2D0O A;  2ICI A;  3L0O A;  5GQO A;  1VQ6 A;  1EWH A;  2SNM A;  1HH2 P;  3I2Z A;  2F0T A;  2EY5 A;  1STB A;  1E2V A;  4JI3 L;  5LL6 S;  4C3I H;  5ELB A;  2IJ0 A;  1Q1E A;  1OXV A;  3I4M B;  3K5O A;  5LMU Q;  1S3O A;  4DXF A;  5C3E G;  3D31 A;  4RCN A;  4ZAI A;  1QIL A;  1TWF B;  1X3P A;  2MPM A;  1CTM A;  4LF6 Q;  4GN5 A;  3PO3 H;  1GUT A;  1JE4 A;  4LF4 L;  2WKC A;  1WCM B;  3J7Y W;  4FF1 A;  4LUO A;  5TSS A;  3W3A A;  1IYV A;  1H9R A;  2AMC B;  2F0S A;  4DV4 Q;  1Y1V B;  1U0L A;  3H0G B;  3T51 B;  5NUC A;  4JI0 Q;  1S5C D;  2I46 A;  4MN3 A;  3PUY A;  5K36 H;  4V0B A;  1EWI A;  4DK6 C;  2Q8I B;  4AYB B;  2L12 A;  5E4W C;  4QY7 A;  3CCE A;  5CV5 A;  4FXK C;  3BYY B;  1ICF B;  2NVX B;  4JYA L;  4LUV A;  1PRT F;  2VQF L;  1QB5 D;  2A6H D;  1EYG A;  4OX9 Q;  1BKB A;  2A8V A;  3S14 B;  1QUQ B;  2MGS A;  4IUU A;  3AYH B;  4R1J A;  1HNZ Q;  3CMA A;  1B2T A;  1SYE A;  2N49 A;  1OXS C;  2YYZ A;  1SMY D;  1U4R A;  1YHA A;  5IT9 c;  4B3S L;  5IY0 A;  4LF9 Q;  4A3G G;  1TVX A;  2PNH A;  4ZLT F;  2DGY A;  1JB7 A;  2OT2 A;  1EIF A;  3M7N A;  1ENA A;  2KQ3 A;  3DMU A;  3MFY A;  1KC8 C;  1NTG A;  2V1C C;  1TQO A;  4DV2 Q;  4A3E H;  4P74 A;  2NVQ H;  1IBL L;  4LJZ C;  4JI8 Q;  1K83 B;  1E1T A;  2NN6 G;  4APV A;  2FMM A;  5IOC A;  3HOV H;  2K05 A;  3MXN B;  1DOL A;  1AEX A;  1WTP A;  2Q8R E;  3GTO B;  3RMH A;  1P16 A;  3A5Z B;  5DM7 3;  4IPG A;  5M5Y H;  1JMC A;  5CV7 A;  3OIP A;  1FL0 A;  1KTK A;  5IYC H;  4KY7 A;  2GA4 B;  4L63 B;  1AE2 A;  2A6E C;  1A3U A;  1SAP A;  4DAV A;  1WI5 A;  1EU3 A;  1PFN A;  3PO2 H;  5LMN L;  2F0O A;  2XSC A;  3C2P A;  5K5P A;  1G6P A;  2BE5 C;  4K0K L;  4JG2 A;  4OEL B;  3KJP A;  2JA5 B;  2B2W A;  1Q86 C;  4NP5 A;  2BH2 A;  3M3Y B;  1YIT A;  4QB4 A;  4JC0 A;  1L2F A;  2CW0 D;  1WTW A;  4IUT A;  1HPC A;  2EYJ A;  2ICE C;  3S1M H;  2UXC Q;  4B3M Q;  1ET6 A;  1AE3 A;  4RAU C;  3I4L A;  3GO5 A;  1F2Z A;  4C3H G;  2G9D A;  1NY4 A;  2FIN B;  1WTX A;  4A3M B;  1CSP A;  5EQ0 A;  3VR5 A;  3LWE A;  2KEE A;  1D7Q A;  3UDX A;  2F4V L;  3OWF A;  2PO4 A;  4YWK A;  4CDF C;  5IGC A;  4A3L G;  1TY0 A;  4LFA L;  2Q2I A;  1DOK A;  3K5N A;  4DV6 L;  1EIY B;  3J81 E;  3A0J A;  4ILW A;  3GTP B;  4BY1 H;  3EVQ A;  2R7F A;  4K6D A;  1EQQ A;  1U4P A;  2RQX A;  1EUJ A;  4A3B H;  1PH6 A;  2Z4H A;  4IFD I;  3K81 C;  5I6Y A;  1OXT A;  2NZO A;  1LT3 D;  5CV9 A;  1HNW L;  2ASB A;  1VQ8 A;  1LT6 D;  1S4Z A;  5JJZ A;  1VQJ A;  1EY0 A;  3I72 A;  2EPB A;  2XWJ B;  5KNC A;  1EY7 A;  2A1A A;  1M4V A;  3CHB D;  2ZJQ A;  2CQO A;  1X3G A;  2WIN B;  4JI1 Q;  3DWA A;  4X65 Q;  3CU7 A;  4QMG A;  3BDC A;  4DR7 L;  4CJ2 C;  3ERS X;  4DV5 Q;  5EBC A;  4DV0 L;  5FO8 B;  3EJI A;  5FO7 B;  1WD0 A;  5KNB A;  4JI7 Q;  1JQY D;  4MIU A;  4A93 G;  4DF7 A;  4JI4 L;  2OEO A;  3K6O A;  1F9R A;  1DXM A;  1QCB D;  4HSV A;  1EOT A;  3Q24 A;  4AQY Q;  4ID6 A;  2MNA A;  2QA4 A;  3J81 c;  3HOW H;  4HR7 B;  5EAY A;  1SRO A;  3K80 C;  2ATW A;  2MUY A;  1NUC A;  4IQZ A;  1I50 H;  4O42 A;  2CWA A;  1RJT A;  2L4N A;  3FDT A;  1V8Q A;  1M1K C;  1IBM Q;  2L11 A;  1UNS A;  2F0V A;  3S9W A;  1BCP B;  3PF4 A;  2E2I B;  1Z47 A;  2A5H A;  1PZJ D;  3SR1 A;  1I5F A;  4B9W A;  4UP9 A;  1JOO A;  1SJH D;  3FKI B;  2FFK B;  1CA5 A;  2RVL A;  3U58 A;  4GNX C;  1XPR A;  2H5X A;  2D0P A;  4WOR A;  3PV0 A;  3E9H A;  3A5U A;  4C3J B;  3AFQ A;  3RN2 A;  3CKI B;  2UXD L;  1A6X A;  2A19 A;  1TWA H;  1EOV A;  2DNE A;  1WYD A;  4C3I G;  4WFN 3;  1CT1 D;  2WV6 D;  2KHS A;  3DEP A;  4RWS C;  2B63 G;  1STY A;  5IYD G;  5JJK A;  5IGB A;  4QQB X;  3ULL A;  4MTN A;  1JOK A;  1MGS A;  5CV8 A;  5I9P A;  4LF7 L;  5HGT A;  2K7V A;  4A3J H;  1R9T H;  2R7Z B;  3EA6 A;  3R8B A;  4DGZ A;  4C2M B;  2WAQ E;  1Q82 C;  2CFM A;  3HOZ H;  2K5W A;  1YIJ A;  1BO0 A;  1PRT C;  3MXP A;  2UU9 Q;  4ZQ3 A;  4XDX A;  2RDG A;  3E6Z X;  2QW7 A;  1PLF A;  2K4K A;  3Q22 A;  1YBY A;  2PYK A;  4BY7 G;  1I4P A;  3FEW X;  2KJX A;  3OSO A;  2K6A A;  1IHZ A;  1SE3 A;  1EZ8 A;  1RCV D;  2B2U C;  3NEN A;  2JEB I;  2VXW A;  3RD4 A;  3PIO A;  1STE A;  1VF7 A;  3G6E A;  3PO3 B;  3A54 A;  4K5V A;  3I4M H;  2Z0S A;  4NW2 A;  1STG A;  1TWF H;  3TN2 A;  1E24 A;  4NKL A;  1PXU A;  4OON A;  4R4C A;  4P75 A;  2L9H A;  2O4X A;  4FO2 A;  1JE5 A;  2B29 A;  1N36 L;  5EPL A;  1I3Q B;  3DWP A;  4I7A A;  4GKJ Q;  4TQU S;  2CKZ B;  3VR4 A;  2UUA L;  3H0G H;  4LUZ A;  3FRP B;  3NPP A;  5M3M B;  4FYD A;  4EQN A;  1O7L A;  1SR3 A;  4MNO A;  4XQN A;  5M5X H;  1GO3 E;  4L6T B;  2MO0 A;  4JV5 L;  2F0M A;  2N78 A;  3CCR A;  2EYF A;  1ILQ A;  2E8G A;  2KOL A;  2EYO A;  1N8R C;  1U5K A;  4DR1 Q;  3HOV G;  4A3C H;  3K5M A;  4K2K A;  2KCM A;  4JBK A;  1Q7Y C;  3C3L A;  5E4X A;  1VQA A;  3GV6 A;  3FMC A;  4DR4 L;  2F0P A;  1M8A A;  2RHQ B;  1X65 A;  1SFO B;  1E22 A;  1HQR D;  1F9Q A;  3K59 A;  1QZH A;  1J5E L;  3BVZ A;  1D8L A;  4OGQ C;  1DD2 A;  3CD6 A;  4C1N K;  3KF8 A;  4A3E B;  3Q8D A;  1LTG D;  1GD7 A;  1SYD A;  3KF6 B;  4N9P A;  2AQ2 B;  2IPK D;  3PO2 G;  1QOH A;  1W2B A;  1CI3 M;  3P7J A;  1CHQ D;  2R93 G;  2OXP A;  1XMO L;  4X3T A;  3T16 A;  3Q0A A;  5IWA Q;  1V1Q A;  5JOB A;  2CCZ A;  1RIP A;  1C7Y A;  2FHT A;  5GAD C;  4AIM A;  3KF8 B;  4Y52 H;  4OEM B;  4XYO A;  3AMU A;  4IPC A;  5C0X H;  5M5Y B;  4M1U B;  2VL6 A;  1RHP A;  4PMB A;  4X64 L;  3RNU A;  2HHH L;  3VYU A;  3NBH A;  1YI2 A;  1XTD A;  4DV7 L;  1LAB A;  5C0X I;  2VZA A;  5IP9 H;  4XYQ A;  1PTO F;  1IXR A;  4OL7 A;  1D1K A;  5FK9 C;  2K5Q A;  3GP7 A;  3SEB A;  2K04 A;  1D1I A;  5IGG A;  1IZ6 A;  1HR0 L;  5C4X G;  3NBH B;  3T1H L;  1O7Y A;  5EKI A;  3C1F A;  4IFD G;  3A7A B;  1NNX A;  4TSS A;  5COR A;  4HJ9 A;  1MSH A;  1VQF A;  2OCE A;  4ZRZ A;  4JK1 C;  3M3Y H;  3S1M B;  1AZP A;  1C48 A;  1DCZ A;  2K5V A;  4QIW E;  3D3R A;  3CCQ A;  3PCO B;  2YV5 A;  2N3S A;  5T1I A;  4K2L A;  4DV1 Q;  1NR2 A;  1STH A;  2JJQ A;  3I4O A;  4GN3 B;  1XPU A;  3SXH A;  1XNR L;  4H7B A;  2XGT A;  4PZ6 A;  3A8I E;  3TZU A;  3J81 j;  2VQF Q;  5CBA E;  1TKW B;  1KD1 C;  1N32 L;  2B3G A;  4DPG A;  4BY1 B;  1F9P A;  4RKL A;  5E1F A;  1NMF A;  5AFW A;  4A3B B;  4LFC L;  3PGZ A;  4DR3 L;  3ZJY C;  2PI2 E;  1K9M C;  2RSN A;  4J1M A;  4WJ4 A;  1QZG A;  1G6Z A;  1D5M C;  2I0Q A;  2PMZ E;  3EFX D;  3OHX C;  2FMC A;  2DUD A;  1H9K A;  3AU7 A;  3ICE A;  2ZJP A;  1PMR A;  1PVO A;  1XNQ L;  4C1N I;  3I8Z A;  1D6E C;  4BXX G;  3DM1 A;  2LMC B;  5J3B A;  5IGD A;  5CMD A;  2IX3 A;  4WJW A;  4UHV A;  1WTH A;  3CPW A;  1A2U A;  2KCC A;  1IBK Q;  1GUN A;  1L0X B;  4HAE A;  4GLA C;  3JAM E;  1UE6 A;  1WTV A;  1CUK A;  1KQS A;  2UUB L;  3OWE B;  1L0W A;  4I7Z C;  1PFM A;  4JBJ A;  4JOI A;  1JT8 A;  4DUZ L;  1E2Z A;  3MXU A;  4XTC S;  3MZ5 A;  1UAP A;  2NBF A;  4IPH A;  1EQT A;  3NXW A;  3HOW B;  3PF5 A;  4DN4 M;  4HJA A;  3W1G A;  5LMN W;  4JI6 Q;  4LF5 Q;  4A3F G;  4KI0 A;  1HQM C;  1ILP A;  4ZUI A;  1Q46 A;  3D0F A;  5ELO A;  5LMN Q;  2A69 D;  2M00 A;  3QWN A;  1B8A A;  3JAM L;  4PMW A;  2YTY A;  2KEC A;  1IL2 A;  1U4L A;  1I4H A;  1S72 A;  1AH9 A;  3KYH C;  2EVB A;  4UDU C;  2EY6 A;  2XTI A;  1CM9 A;  5IGE A;  4KN7 C;  3H3V C;  1TWA B;  1EY4 A;  2KCN A;  1D5Z C;  3PUZ A;  1VQI A;  3NQI A;  3TME A;  3CP0 A;  4DUY Q;  4FF4 A;  4C3J H;  1IW7 C;  1KDC A;  4ZUJ A;  4H13 C;  2M9V A;  4JI5 Q;  2IX1 A;  2K50 A;  4DR5 Q;  2K5D A;  3Q6S A;  2CHB D;  1PFB A;  1GUS A;  3KDF A;  3TRE A;  4A3J B;  1F2L A;  4UY8 C;  1EYC A;  1R4P B;  3I4M G;  1YJW A;  3A55 A;  3HOZ B;  5BN4 A;  4A3I H;  2B2V A;  1X3E A;  4LMQ D;  4ZCK A;  3MC0 B;  1WCM G;  1JJG A;  2Z9H A;  2R7Z H;  4TRD A;  4DV6 Q;  1SEB D;  1ESF A;  4YHH Q;  3SE0 A;  2EJG C;  4YCW A;  1WOC A;  5C0X J;  1R4Q B;  1EU4 A;  2XN9 C;  2L15 A;  3KDF B;  2KUM A;  2L0C A;  1Y1V G;  4PMC A;  3AB9 A;  3H0G G;  4OIK A;  1Z6H A;  5M5W B;  3TP7 A;  1SNP A;  2HQL A;  2VB3 X;  2F0G A;  1OXX K;  3KLS A;  1N34 L;  2MO1 A;  4GLX A;  3ZYY X;  1SE8 A;  1HNW Q;  1X6O A;  1W6J A;  1ML0 D;  2JP1 A;  3BJU A;  4AYB G;  1NBW A;  5C5L A;  4JI2 Q;  1TII D;  2NB0 A;  4IOA A;  1TS5 A;  1JWS D;  2B2T C;  3M4Y A;  1HNX L;  1SSO A;  1XWE A;  1U4M A;  2ZXR A;  1PH3 A;  2N55 A;  5EJW A;  5KYL A;  5CR3 A;  1SNO A;  4R4T A;  4L5Q A;  1STA A;  4GKK Q;  2LFN A;  3GV3 A;  1I6H B;  3FP9 A;  3A56 A;  1KL9 A;  2Q2T A;  2F03 A;  1WVL A;  4DAP A;  3S17 H;  1SMX A;  1I3Q H;  4QF4 A;  4X66 L;  5M3F H;  2R92 H;  5M5X B;  4G7O C;  4H0L C;  3NE5 B;  2PZW A;  3E0E A;  5M3M H;  3NEL A;  1EY9 A;  4YIJ A;  3K8A A;  2SEB D;  2AWN A;  1SN8 A;  4HMJ A;  3UDG A;  4GNX A;  1PTO C;  2RDF A;  1B53 A;  1Q90 A;  1DGS A;  1F2M A;  5FLM G;  5EBD A;  1HFG A;  1Y8N B;  4J15 A;  1K3B C;  4QUC A;  3MWY W;  1XPO A;  3RN5 A;  3HKZ G;  4KMU C;  3ND9 A;  1AW7 A;  1VQC A;  4GNX B;  1QVG A;  1NR4 A;  3UE1 A;  1VQP A;  1UEA B;  1J8I A;  2QF7 A;  1XMQ Q;  1K28 A;  5LL6 X;  5IP9 G;  4KD4 A;  1NMG A;  1SFO H;  4R8N A;  3H3V H;  2ZM6 L;  4DNT B;  1D2B A;  4OIJ A;  1N33 Q;  3WOF A;  2PQE A;  1JB3 A;  2IHE A;  3H3V I;  1I4R A;  4F87 A;  1I94 Q;  2E5L L;  2JA6 B;  5G3L D;  1QVC A;  3RLO A;  2OTJ A;  3NHH A;  3KK7 A;  5D3D A;  2CH4 W;  3HKZ B;  2K5H A;  2JA5 G;  5IE8 A;  1PRT B;  4RH6 A;  4X62 Q;  2B2U A;  3PQI A;  3ULP A;  4O1N A;  2QGQ A;  3URY A;  3OIQ A;  1SDF A;  3PSI A;  3OYY A;  3NEM A;  3A7L A;  1HTP A;  2F0J A;  3GTG B;  2D62 A;  1FD7 D;  1CKO A;  3CRK C;  2GVA A;  3BU2 A;  2IY5 B;  2ID0 A;  4XIG S;  3S1Q H;  4A3D H;  4JOI C;  2XNA C;  2JA8 H;  4O2D A;  1S5E D;  3S1R H;  1I6V C;  2E2J H;  1EYD A;  5FKA C;  3MHB A;  4A3M G;  2C35 B;  1MSG A;  3PUX A;  1SJE D;  1QNU A;  2R6G A;  4TKO B;  4CKB A;  1JCK B;  4YWM A;  1RDP D;  1B1Z A;  1E0B A;  2EY2 A;  4DU9 A;  2CH4 A;  2A6H C;  5JJI A;  1UE5 A;  4IO9 A;  1MD2 D;  3QR8 A;  4OWW B;  5DAU A;  5J39 A;  1JWM D;  4NB3 A;  4A3K H;  2UUA Q;  2XVS A;  3CW2 C;  1K8G A;  2E76 C;  1LAC A;  4B9X A;  2QDB A;  1RD9 D;  3M4Q A;  1SMY C;  3TSS A;  1E1O A;  5CYU A;  2QEX A;  4LF8 L;  4AYB E;  1CKN A;  3T1Y L;  2F0I A;  1SYG A;  3R93 A;  2Z1C A;  1LT4 D;  3TP8 A;  1B50 A;  2ZTE A;  1G2S A;  3F2C A;  2WKD A;  3KLR A;  4OO1 H;  3I7F A;  3NWT A;  1PTO H;  3FVQ A;  1K8A C;  4M8A A;  2X6G A;  4KHP Q;  1JC7 A;  4NXN Q;  2KVM A;  1CKN B;  4DK1 A;  1Y69 U;  2B2V C;  4OO1 I;  2M2L A;  1CQF A;  1LYL A;  4V19 0;  3GTM B;  2JSO A;  1GUO A;  1X3Q A;  4MZ9 A;  2WAQ B;  5LHY 1;  2NZ1 D;  3QIA A;  2JEA I;  4BBS B;  1GHJ A;  4DAY A;  2WAC A;  2UXB L;  1MKH A;  1UE7 A;  3J80 i;  3UDF A;  3NP8 A;  3FPU B;  1XYI A;  3PIO 3;  2VUM H;  4OWT B;  1ET9 A;  2HDM A;  1ASY A;  1QVF A;  1PFS A;  3BDL A;  1O7Z A;  2DJG C;  1FYC A;  2VQE Q;  1YNJ D;  4DAY B;  3HRZ C;  3SVM A;  2HDL A;  5EPJ A;  1U9R A;  3E0J A;  2VW9 A;  1V1P A;  3FKI G;  3G48 A;  5JVG 3;  2C9O A;  3K0Y A;  3VR6 A;  1X56 A;  2RBM A;  2Y0S B;  4KY5 A;  4X64 Q;  5LMU L;  4C3J G;  4LF6 L;  1KIX A;  2A68 D;  4X6A H;  1K0S A;  3D6C A;  1SRU A;  3NTH A;  3KUP A;  2UUC Q;  1HR0 W;  3K7U C;  2CW0 C;  1V1P B;  4KJO A;  1BQQ T;  4MHE A;  3V96 A;  4B08 A;  4DV4 L;  3I70 A;  2A74 C;  1RTO A;  4OHJ A;  1JOQ A;  5AJ3 Q;  3SDZ A;  4A3I G;  1YHQ A;  5ISR A;  4JI0 L;  3NTK A;  2BH8 A;  3O13 A;  2R7Z G;  2EE1 A;  5DM6 3;  4IOC A;  4J6H A;  5H1S E;  5IP7 H;  1LO5 D;  5L37 A;  3I73 A;  4Z9C B;  1A62 A;  1TU2 B;  2GVB A;  1HA5 A;  4PG3 A;  4NXM Q;  5JEA H;  4DR6 L;  4DR2 Q;  5C4J H;  4H02 A;  1MBY A;  2LSS A;  4OX9 L;  3GTK B;  2EJF C;  4RMF A;  1HNZ L;  2JA7 B;  1K73 C;  4B3R Q;  2Z6B A;  1VCI A;  2PCF B;  4LAA A;  4A3I B;  3RZO H;  1DZ1 A;  3PO3 G;  2RHS B;  1SND A;  1G91 A;  5BR8 Q;  2Q2H A;  4LF9 L;  1VQK A;  3BZC A;  3MEF A;  3J7A 5;  1CK1 A;  1EQR A;  4N9T A;  1TWH B;  1NE3 A;  1TS4 A;  3NWS A;  5HUR A;  1CSQ A;  1VQ4 A;  2F0Q A;  1GOZ A;  4TVA B;  3R2I A;  4DV2 L;  2HD3 A;  2WB1 G;  5K36 G;  3HGB A;  2WP8 J;  4JI8 L;  1B7Y B;  2MFI A;  3I91 A;  1XTC D;  4DNI A;  5M5W H;  3F2B A;  1X3F A;  3BDO A;  3OTO L;  3K7A B;  3GTJ H;  5J1Z A;  5M3M G;  2NWG A;  4L5S A;  1V43 A;  2VB2 X;  4Q0F A;  3G7L A;  2OQK A;  5KYI A;  1SYF A;  5D14 A;  4YY3 Q;  2AUJ D;  4FP5 D;  1WTQ A;  1WTO A;  5GRO A;  3BS1 A;  1FVI A;  3A8J E;  5FJ8 H;  2RKS A;  4A76 A;  3BYT B;  2XRQ D;  3PMF A;  2SDF A;  1W3S A;  4N8X 1;  3STB D;  3BG3 A;  2DNC A;  3HOU H;  3S17 B;  5EKK A;  4ZKC B;  3KJO A;  2WB1 B;  1CQV A;  5ELD A;  1I6H H;  5M3F B;  2R92 B;  2CWP A;  1H95 A;  2QIL A;  1PH9 A;  5CV4 A;  4OWX B;  1LTL A;  2JQO A;  2DY7 A;  1VQO A;  3HOX B;  2IX0 A;  4N8F A;  3F8T A;  4A3E G;  1EY6 A;  5C6A A;  1Y1W H;  1HA6 A;  2XWB B;  2J4X A;  1AZQ A;  2E2H H;  1XJV A;  2KA7 A;  1B44 D;  2ZXP A;  2R61 A;  3DWQ A;  1VQB A;  2IHF A;  1PH2 A;  3LGJ A;  2UXC L;  1F9S A;  2BCO A;  4IUV A;  4FXD A;  1BCP D;  1BNZ A;  2RDH A;  3GDE A;  2E74 C;  1CHP D;  3NTI A;  3E3X A;  1VQM A;  4H44 C;  3X3N A;  2QCP X;  1YNN D;  5I9O A;  1HXY D;  2F3V A;  2MHV A;  1QE6 A;  5IYC G;  3H6M A;  4IUR A;  1JOR A;  4HJ5 A;  5C3E H;  1B3Q A;  2PQA A;  4K8I A;  2NVT B;  2J0T D;  3G6J B;  1SNC A;  2L55 A;  1IL8 A;  3I55 A;  3TS0 A;  1PYW D;  4LK1 C;  4P72 A;  2AQ1 B;  1Z7T A;  4HID A;  4CJ0 B;  1CZG A;  4IPD A;  4QJF A;  3VA7 A;  1G2T A;  4HJ8 A;  2PQA B;  2JA6 H;  3G71 A;  2PPB C;  3PIP 3;  2JXM B;  4DV3 Q;  2I5L X;  2LXK A;  3I90 A;  2AWO A;  5EGT A;  2QDL A;  3L7Z C;  3MVV A;  3OW7 A;  3OOC A;  4CDE C;  2HUG A;  4RGN A;  4ULL A;  2B2T A;  3GQB A;  4JI1 L;  1HZB A;  4CDC C;  4X65 L;  3DHQ A;  1C8C A;  4DV5 L;  4A3D B;  3S1Q B;  1GKH A;  1N34 Q;  2JA8 B;  3AQQ A;  1GHK A;  2OTL A;  2HT1 A;  4CDD C;  3PUW A;  3S1R B;  3GTG H;  4JI3 Q;  2E2J B;  4G7H C;  2GN5 A;  3H94 A;  4JI7 L;  5FLX E;  3ERO A;  3HS0 C;  1VQ9 A;  1GVP A;  1B3A A;  4LF4 Q;  1VQ5 A;  4PQX A;  1GJX A;  2L1B A;  4K5X A;  4KKS A;  4RA8 A;  4AQY L;  3I4N B;  4BY1 G;  4A3B G;  2RF4 A;  3MTS A;  3K58 A;  4A3K B;  1VQD A;  3UDI A;  3GD7 A;  4YCV A;  1S5B D;  2PW7 A;  5JEA J;  3EBE A;  4FF3 A;  4LFB L;  3VR2 A;  3VDY A;  3V05 A;  1IBM L;  5ELN A;  3FPP A;  1VDZ A;  3ULJ A;  1GUG A;  3C46 A;  5IGF A;  4JYA Q;  2K33 A;  1NJI C;  2B2Y C;  3HZX A;  2NVY H;  5C3X A;  4G57 A;  3BZK A;  3B6Y A;  1RF2 D;  1PTO B;  5FLX L;  1O7I A;  3RZD H;  3F1Z A;  2K52 A;  5C4Z A;  1Y8P B;  2OF1 A;  2QKI C;  4K6L A;  3D6W A;  1KDB A;  3DEO A;  4DA2 A;  2O5I C;  3QOL A;  5FLX c;  5JPM C;  2XIW A;  4B3S Q;  3CAM A;  3TEH B;  2VS1 A;  4KN4 C;  2SOB A;  3GTM H;  3IFT A;  3CRL C;  3HOW G;  1LTT D;  2ZM6 Q;  1QWY A;  4BBS H;  2VUM B;  2UU9 L;  1ZYR D;  1IYJ B;  1H9M A;  1HFN A;  1GXD C;  1IBL Q;  4PV1 C;  2EYH A;  1HHV A;  4ME3 A;  3CCL A;  3HOY B;  1SE2 A;  3HKS A;  4NMZ A;  5C3W A;  1TS2 A;  3NK9 A;  3PIP A;  1B9M A;  5D3I B;  4P71 A;  4BS9 A;  2K14 A;  3T4A C;  1VQ7 A;  3E9I A;  3LX0 A;  4HCE A;  4C3H H;  2D9U A;  5JEA G;  1I4G A;  1C0A A;  3M7G A;  3T13 A;  1MJC A;  2TMP A;  4IN3 A;  4BBR B;  3T53 B;  2N88 A;  2K1B A;  2F0K A;  4KD3 A;  4YWL A;  3GTL B;  1SNM A;  1EY5 A;  4A3J G;  4P2C B;  4F8M A;  4GKJ L;  2OQ0 A;  4GZY C;  3HOZ G;  1YJN A;  4K0K Q;  1ZEQ X;  3OW2 A;  3S2D H;  2CQA A;  5G3L F;  1HJP A;  4LNQ A;  3JAM c;  5C4J B;  2A73 B;  2K01 A;  1X54 A;  1X55 A;  1SXT A;  5KEE A;  3DLL A;  3CQZ B;  4IAL A;  2PZT A;  3CC7 A;  3GTK H;  2N8N A;  3MFG A;  4ODG A;  4PZ8 A;  3MEH A;  3RZO B;  2KEN A;  3G4S A;  2JA7 H;  4B3T L;  2I5H A;  3P1H A;  1HZC A;  5E7N A;  3S15 H;  4Q5V A;  2NZH A;  5IOD A;  1AFP A;  3EQL C;  2K75 A;  1ESR A;  2F4V Q;  3SK8 A;  4R9W A;  5FJ8 G;  2Q2U A;  4XXE A;  1TWC H;  4LFA Q;  4G7Z C;  2EXZ A;  1TWH H;  5BN3 A;  3HOU G;  1NSN S;  1VMC A;  2KCT A;  1X32 A;  1BXT A;  2BDO A;  4X3S A;  3M4O B;  1KLU D;  3CPF A;  2D2C C;  2I07 B;  2LS0 1;  2YTV A;  3GTJ B;  5C44 H;  1WD1 A;  5IWA L;  1CKM A;  3H91 A;  2L5T A;  3VYR A;  1F2Y A;  2ZJR A;  5BN5 A;  3K7A H;  4BA1 I;  1L1O C;  1XXG A;  1L0Y B;  3WWV A;  4DR7 Q;  3IRB A;  4DV0 Q;  4I65 A;  4Y7N H;  4A3C G;  3KOJ A;  3HOU B;  3OMG A;  1MJE A;  2NTS A;  2A69 C;  1S5F D;  4JI4 Q;  1C4Q A;  2ZTC A;  4RFB A;  2B63 H;  2VNU D;  3UE0 A;  2H1E A;  5IYD H;  4GOP A;  4CHT B;  2B8G A;  2R3Z A;  4F7X A;  5IT9 E;  4R8I A;  3W5O A;  1TT2 A;  1KRS A;  1ENC A;  5KIX A;  3ONA B;  1Y1W B;  1Q8I A;  1DJR D;  1UE1 A;  2EYL A;  1A3V A;  5E3F A;  3D4R A;  2E2H B;  3HOX H;  1S5D D;  4UAI A;  1PZK D;  2A6E D;  2JK8 A;  4R4O A;  4GOP B;  2TSS A;  4XQQ A;  4K8J A;  5FO9 B;  4LWC A;  3GTQ H;  2OWO A;  2NUC A;  3ERQ A;  4BY7 H;  2F4I A;  2JA6 G;  1QUQ A;  1HUN A;  1Q1B A;  4EX5 A;  4DV1 L;  4WJ3 M;  1DM0 B;  2BE5 D;  5C0X G;  4JCV E;  2F0D A;  1V9P A;  4RCO A;  3WDN A;  1PH7 A;  2F0L A;  4DXG A;  1K8M A;  1Q81 C;  5C3E B;  3M85 A;  4DR6 Q;  1PV4 A;  2UXD Q;  3FHW A;  4BA2 I;  3VA5 A;  2NYZ D;  3NUC A;  1C9O A;  5IT9 L;  3NSW A;  4HN7 A;  2NVT H;  2BA0 A;  2SNS A;  2PW5 A;  4LF7 Q;  4UPA A;  4POG A;  2YU9 H;  3T56 B;  2EYM A;  4HTH A;  5I2Y A;  4FF2 A;  5M9O A;  4CJ1 B;  2EXD A;  5I6W A;  3DM3 A;  1BF4 A;  4ZYS A;  3MXN A;  3AFP A;  5JPN C;  3EIV A;  2F3I A;  1IBK L;  1TWG B;  3D8G A;  1EL0 A;  3R3O A;  4RHS A;  3OTO Q;  5JJL A;  5C5M A;  2AQ3 B;  1TR5 A;  5EKL A;  2Q8T A;  2G5D A;  1VQL A;  1HZ9 A;  2MJ8 A;  5IYB H;  4A3G B;  1CFM A;  4CGY B;  1A15 A;  1FJG L;  2XRS D;  1OO9 B;  4DK3 C;  1HTL D;  4JI6 L;  1WTR A;  4JPB W;  4JVZ A;  4LF5 L;  5ELC A;  3I4N H;  1N36 Q;  4CKE A;  4CKC A;  2ZT9 C;  3SGI A;  4ZK9 B;  4UP7 A;  3SHL A;  3U9S A;  1F77 A;  1QNK A;  2R93 H;  4YCU A;  1I4X A;  5I4D A;  3Q23 A;  3LNN A;  4RGT A;  1T9H A;  2KBN A;  2MP1 A;  2WAQ G;  4WRD A;  1LV9 A;  3K57 A;  1IKM A;  4BBS G;  2F0N A;  5KRU A;  2NVY B;  5KGU A;  2AKW B;  1KNE A;  4JV5 Q;  1T5E A;  4PZ7 A;  4IJH A;  1OXU A;  3RZD B;  3D4W A;  3TDQ A;  1BBU A;  3V2T A;  2K03 A;  5EPK A;  3M9B A;  3X3M A;  3LWU A;  4DUY L;  5HGQ A;  3A74 A;  4ALP A;  3PUV A;  3S1N B;  1NAP A;  4JI5 L;  1SYC A;  2KED A;  1RL2 A;  4DR5 L;  4AH6 A;  1DON A;  1E7Z A;  2ENB A;  2IW3 A;  4DR4 Q;  4GN4 B;  5GAH C;  2WFW A;  1PYB A;  4GS3 A;  2Y0S G;  4JW0 A;  1G8Z D;  1VQE A;  1J5E Q;  5C4X H;  1SLJ A;  3IKJ A;  3QO2 A;  1YNX A;  3J81 i;  1LTR D;  4IFD H;  1EFW A;  1QG7 A;  2O5J C;  4YHH L;  2F0H A;  3J80 E;  1BBW A;  4QUF A;  1XMO Q;  1X9N A;  1LTI D;  2K5N A;  4O0A A;  3HOY H;  2MQH A;  3TZD A;  3CME A;  4QGU A;  1HCZ A;  4HMI A;  4C3H B;  3VYT A;  3HKZ E;  1O80 A;  1BCP F;  1PRT D;  4JI2 L;  2HHH Q;  1EIH A;  1I4Q A;  1WJJ A;  1A3T A;  1FNV A;  3ER0 A;  2HIV A;  4R4I A;  4DV7 Q;  3BZD B;  3I3C A;  4PNY A;  1EWC A;  1UWV A;  4KHV A;  1EIG A;  1PZI D;  1KLG D;  2JA7 G;  4GKK L;  4GOP C;  1H9J A;  1KRT A;  3SK6 A;  4BBR H;  1HR0 Q;  3GTL H;  3J81 L;  1DOM A;  3T1H Q;  3KFU A;  1MIU A;  3BVG A;  3TP6 A;  3J80 L;  3S16 H;  3S2D B;  4KK7 A;  4KJN A;  3E5S A;  4P73 A;  3CC4 A;  2E2D C;  1E2W A;  4BXX H;  1II3 A;  3S24 A;  5DEH A;  3J80 c;  5CV6 A;  2HQE A;  2EYP A;  4EQO A;  1HRJ A;  4HIO A;  1ZKO A;  3TBI B;  1DYQ A;  3HP3 A;  2B2Y A; 
#chains in the Genus database with same CATH homology
 2F1M A;  4ME5 A;  2JE6 I;  4EQP A;  3ND8 A;  4A93 B;  3S2H B;  1EEF D;  3S15 B;  2EY1 A;  3RUZ A;  5J22 A;  4XT1 B;  5KND A;  1NCV A;  5CGK A;  1UUP A;  3H09 A;  1TWC B;  5D65 A;  3DXJ C;  5A2Q E;  3QJY A;  4KTA A;  1KAB A;  2D5D A;  1ONL A;  1Q3L A;  2IL8 A;  2H4O A;  2IT1 A;  5C44 B;  3QG1 A;  2RSO A;  3RLF A;  1YNJ C;  2LKV A;  2B39 A;  3MXG A;  4K14 A;  1SBB B;  1PDQ A;  1ICW A;  1A2T A;  1KNA A;  2K32 A;  2LY7 A;  3SK5 A;  3KBX A;  3D4D A;  4IUQ A;  1RKN A;  4Y7N B;  3N6R A;  2A68 C;  1Q12 A;  4DNR B;  1ROD A;  4C3I B;  1TY2 A;  2B8F A;  5A2Q L;  1RTN A;  3HEJ A;  1QJO A;  4DFA A;  2B63 B;  1MI2 A;  2F3W A;  5COY A;  2F0U A;  2EOT A;  3ITP A;  5DNF A;  3NBI A;  3VR3 A;  1K8O A;  4IZ8 A;  4RKB A;  2PZU A;  3C1E A;  3GTQ B;  4QIW B;  1JR0 D;  4BY7 B;  2J7Z A;  2X69 A;  2B2W C;  2CVR A;  5CC4 A;  4E6I A;  1LTB D;  2O2L D;  3P20 A;  1SYB A;  4C56 C;  1ENF A;  4HSP A;  3SK4 A;  4EGV A;  1VMP A;  1ZXT A;  4IFD J;  4KY6 A;  2PMZ B;  2YU9 B;  1FGB D;  4RGM A;  2FJ2 A;  3VYS A;  1JWU D;  5ELF A;  3IL8 A;  4XT3 B;  1KDA A;  4S3S A;  2DY8 A;  3KLS X;  1G29 1;  1EYA A;  4KKU A;  4JBW A;  1LLR D;  4RHR A;  3WOE A;  1TS3 A;  4X3U A;  2JYO A;  2NVQ B;  3OPO A;  1EFI D;  5ELE A;  3DUZ A;  1EEI D;  2F0E A;  5C4H A;  5T1G A;  1SE4 A;  4XQJ A;  3HOV B;  1B4O A;  1BR9 A;  2ZXO A;  2Z4I A;  2EDG A;  2V4D A;  4IUN A;  3MAQ A;  3IAY A;  4QCL A;  3BVM A;  4ZKB B;  3MA2 B;  4OO1 G;  1AP0 A;  2NTT A;  5I2X A;  1J9O A;  1O78 A;  2C5C A;  2K28 A;  5CBE E;  3U9O A;  2E75 C;  3PO2 B;  2R93 B;  1IKL A;  4G4K A;  4KV6 A;  1XX8 A;  1BCP C;  3J7A V;  3K5L A;  1SNQ A;  2NN6 H;  3J7A F;  5JVH 3;  4NDX A;  2F0W A;  1D5X C;  1YNN C;  3F2U A;  2NN6 I;  1FNU A;  3L3O C;  4DK0 A;  4RGO S;  1STN A;  2BA1 A;  2PNR C;  2AUK A;  2WII B;  3A8K E;  1GUW A;  2F0F A;  3N52 A;  5A35 A;  1EY8 A;  1CA6 A;  4BWG B;  5C4X B;  4U68 A;  1LTA D;  1EZ6 A;  4FXG C;  1IW7 D;  1V1O A;  1VF5 C;  2EJM A;  1HUM A;  1W6K A;  3R2T A;  1EQV A;  3NQT A;  1CZW A;  2G9H D;  1IYU A;  4IUP A;  2QEJ C;  2BOS A;  3KBG A;  4X3K A;  4HCS A;  2DN8 A;  2Z8L A;  5IIF A;  1Y8O B;  3QB3 A;  3S16 B;  1H9S A;  1BDO A;  4KKT A;  2RA4 A;  5FOB B;  1B9N A;  2BDN A;  4K5W A;  3UI2 A;  3QOJ A;  1T5X D;  1I50 B;  2HCC A;  1H9S B;  1KAA A;  1LTS D;  1AN8 A;  4U67 3;  1BUV T;  3W2D A;  3L9A X;  1FNW A;  2HCI A;  1JIC A;  2IWH A;  3OMC A;  2X6L A;  4J8Q A;  2EZV A;  4CBV A;  3TP5 A;  4ABN A;  1PTO D;  5JAV A;  1ZYR C;  4A3F B;  1LT5 D;  1BBX C;  4F88 A;  3IFD A;  5F2D A;  1R9T B;  4FVM A;  1BOS A;  4HED A;  4FNF A;  4EVO A;  3P75 A;  4L8J A;  4KHZ A;  3HG9 A;  1FR3 A;  2ICI A;  1EWH A;  2SNM A;  2F0T A;  2EY5 A;  1STB A;  1E2V A;  5LL6 S;  5ELB A;  2IJ0 A;  1Q1E A;  1OXV A;  3I4M B;  3K5O A;  4DXF A;  3D31 A;  4ZAI A;  4RCN A;  1QIL A;  1TWF B;  1X3P A;  2MPM A;  1CTM A;  1GUT A;  1JE4 A;  2WKC A;  1WCM B;  3J7Y W;  4FF1 A;  5TSS A;  3W3A A;  1IYV A;  1H9R A;  2F0S A;  1Y1V B;  3H0G B;  3T51 B;  5NUC A;  1S5C D;  2I46 A;  4MN3 A;  3PUY A;  5K36 H;  4V0B A;  2Q8I B;  4AYB B;  2L12 A;  5E4W C;  5CV5 A;  4FXK C;  3BYY B;  2NVX B;  1PRT F;  1QB5 D;  2A6H D;  3S14 B;  2MGS A;  4IUU A;  1B2T A;  1SYE A;  1OXS C;  2YYZ A;  1SMY D;  1U4R A;  1TVX A;  4ZLT F;  2OT2 A;  3M7N A;  1ENA A;  2KQ3 A;  3DMU A;  3MFY A;  1TQO A;  4LJZ C;  1K83 B;  2NN6 G;  2FMM A;  5IOC A;  2K05 A;  1DOL A;  1AEX A;  1WTP A;  2Q8R E;  3GTO B;  3RMH A;  5DM7 3;  5CV7 A;  3OIP A;  1KTK A;  4KY7 A;  2GA4 B;  4L63 B;  2A6E C;  1A3U A;  1SAP A;  4DAV A;  1EU3 A;  1PFN A;  2F0O A;  2XSC A;  3C2P A;  5K5P A;  2BE5 C;  2JA5 B;  2B2W A;  4NP5 A;  3M3Y B;  4QB4 A;  2CW0 D;  1WTW A;  4IUT A;  1HPC A;  2EYJ A;  2ICE C;  1ET6 A;  4RAU C;  3I4L A;  3GO5 A;  1F2Z A;  4C3H G;  2G9D A;  2FIN B;  1WTX A;  4A3M B;  5EQ0 A;  3VR5 A;  3LWE A;  2KEE A;  3OWF A;  2PO4 A;  5IGC A;  1TY0 A;  1DOK A;  3K5N A;  3J81 E;  4ILW A;  3GTP B;  3EVQ A;  4K6D A;  1U4P A;  2RQX A;  2Z4H A;  4IFD I;  5I6Y A;  1OXT A;  1LT3 D;  5CV9 A;  1LT6 D;  1S4Z A;  5JJZ A;  1EY0 A;  3I72 A;  2EPB A;  2XWJ B;  5KNC A;  1EY7 A;  1M4V A;  3CHB D;  2WIN B;  3DWA A;  3CU7 A;  4QMG A;  3BDC A;  4CJ2 C;  5EBC A;  5FO8 B;  3EJI A;  5FO7 B;  1WD0 A;  5KNB A;  1JQY D;  4MIU A;  4DF7 A;  2OEO A;  3K6O A;  1F9R A;  1DXM A;  1QCB D;  4HSV A;  1EOT A;  3Q24 A;  4ID6 A;  4HR7 B;  2MUY A;  1NUC A;  4IQZ A;  4O42 A;  1RJT A;  2L4N A;  3FDT A;  1V8Q A;  2L11 A;  1UNS A;  2F0V A;  3S9W A;  1BCP B;  2E2I B;  1Z47 A;  2A5H A;  1PZJ D;  3SR1 A;  4B9W A;  1JOO A;  1SJH D;  3FKI B;  2FFK B;  1CA5 A;  2RVL A;  4WOR A;  3PV0 A;  4C3J B;  3CKI B;  1A6X A;  2DNE A;  4C3I G;  4WFN 3;  1CT1 D;  2WV6 D;  2KHS A;  3DEP A;  4RWS C;  1STY A;  5IGB A;  5I9P A;  1JOK A;  1MGS A;  5CV8 A;  5HGT A;  2K7V A;  2R7Z B;  3EA6 A;  3R8B A;  4DGZ A;  4C2M B;  2K5W A;  1BO0 A;  1PRT C;  3MXP A;  4ZQ3 A;  4XDX A;  2RDG A;  3E6Z X;  1PLF A;  3Q22 A;  2PYK A;  1I4P A;  3FEW X;  2KJX A;  3OSO A;  2K6A A;  1IHZ A;  1SE3 A;  1EZ8 A;  1RCV D;  2B2U C;  2JEB I;  2VXW A;  3RD4 A;  1STE A;  1VF7 A;  3PO3 B;  3A54 A;  4K5V A;  4NW2 A;  1STG A;  3TN2 A;  4NKL A;  1PXU A;  2L9H A;  2O4X A;  4FO2 A;  5EPL A;  1I3Q B;  3DWP A;  4TQU S;  3VR4 A;  3FRP B;  3NPP A;  5M3M B;  4FYD A;  4EQN A;  1O7L A;  4XQN A;  4L6T B;  2F0M A;  2EYF A;  1ILQ A;  2KOL A;  2EYO A;  3K5M A;  4K2K A;  3C3L A;  5E4X A;  3GV6 A;  3FMC A;  2F0P A;  1M8A A;  1SFO B;  3K59 A;  1HQR D;  1F9Q A;  3BVZ A;  4OGQ C;  1DD2 A;  4C1N K;  3KF8 A;  4A3E B;  1LTG D;  4N9P A;  1SYD A;  2AQ2 B;  2IPK D;  1QOH A;  1CI3 M;  3P7J A;  1CHQ D;  2OXP A;  4X3T A;  3T16 A;  3Q0A A;  5JOB A;  2FHT A;  4XYO A;  3AMU A;  5M5Y B;  5C0X H;  4M1U B;  1RHP A;  4PMB A;  3VYU A;  3NBH A;  1LAB A;  5C0X I;  4XYQ A;  1PTO F;  4OL7 A;  1D1K A;  5FK9 C;  2K5Q A;  3GP7 A;  3SEB A;  2K04 A;  1D1I A;  5IGG A;  1O7Y A;  5EKI A;  3C1F A;  4IFD G;  3A7A B;  4TSS A;  5COR A;  1MSH A;  4ZRZ A;  4JK1 C;  3S1M B;  1AZP A;  1C48 A;  1DCZ A;  3D3R A;  5T1I A;  4K2L A;  1NR2 A;  1STH A;  3SXH A;  4H7B A;  3TZU A;  3A8I E;  5CBA E;  1TKW B;  4BY1 B;  1F9P A;  4RKL A;  5E1F A;  5AFW A;  4A3B B;  2RSN A;  4J1M A;  1G6Z A;  1D5M C;  3EFX D;  3OHX C;  2FMC A;  1H9K A;  3AU7 A;  1PMR A;  4C1N I;  3I8Z A;  1D6E C;  3DM1 A;  2LMC B;  5IGD A;  5CMD A;  2IX3 A;  4WJW A;  1A2U A;  2KCC A;  1GUN A;  1L0X B;  4HAE A;  3JAM E;  1WTV A;  3OWE B;  4I7Z C;  1PFM A;  1E2Z A;  3MXU A;  4XTC S;  3MZ5 A;  1UAP A;  2NBF A;  3HOW B;  1EQT A;  3NXW A;  4DN4 M;  4KI0 A;  1HQM C;  1ILP A;  4ZUI A;  2A69 D;  2M00 A;  3QWN A;  3JAM L;  4PMW A;  2KEC A;  1U4L A;  1I4H A;  2EVB A;  4UDU C;  2EY6 A;  1CM9 A;  5IGE A;  4KN7 C;  3H3V C;  1TWA B;  1EY4 A;  2KCN A;  1D5Z C;  3PUZ A;  3TME A;  3NQI A;  4FF4 A;  1IW7 C;  1KDC A;  4ZUJ A;  4H13 C;  2M9V A;  2IX1 A;  2K5D A;  3Q6S A;  2CHB D;  1PFB A;  1GUS A;  4A3J B;  1F2L A;  1EYC A;  1R4P B;  3A55 A;  3HOZ B;  5BN4 A;  2B2V A;  4LMQ D;  3MC0 B;  4TRD A;  1SEB D;  1ESF A;  3SE0 A;  2EJG C;  5C0X J;  1R4Q B;  1EU4 A;  2XN9 C;  2KUM A;  2L0C A;  4PMC A;  3AB9 A;  4OIK A;  1Z6H A;  5M5W B;  3TP7 A;  1SNP A;  2VB3 X;  2F0G A;  1OXX K;  3KLS A;  3ZYY X;  1W6J A;  1ML0 D;  2JP1 A;  5C5L A;  1TII D;  2NB0 A;  1TS5 A;  1JWS D;  2B2T C;  3M4Y A;  1SSO A;  1XWE A;  1U4M A;  2ZXR A;  2N55 A;  5EJW A;  5KYL A;  5CR3 A;  1SNO A;  1STA A;  2LFN A;  3GV3 A;  1I6H B;  3A56 A;  2F03 A;  1WVL A;  4DAP A;  4QF4 A;  5M5X B;  4G7O C;  4H0L C;  3NE5 B;  2PZW A;  1EY9 A;  4YIJ A;  2SEB D;  2AWN A;  4HMJ A;  1PTO C;  2RDF A;  1B53 A;  1Q90 A;  1F2M A;  5EBD A;  1HFG A;  1Y8N B;  4QUC A;  3MWY W;  4KMU C;  3ND9 A;  1AW7 A;  1NR4 A;  1UEA B;  1J8I A;  2QF7 A;  5LL6 X;  4KD4 A;  4R8N A;  4DNT B;  1D2B A;  4OIJ A;  3WOF A;  2PQE A;  1JB3 A;  1I4R A;  4F87 A;  2JA6 B;  5G3L D;  3NHH A;  3KK7 A;  5D3D A;  3HKZ B;  1PRT B;  4RH6 A;  2B2U A;  4O1N A;  3URY A;  3OIQ A;  1SDF A;  3A7L A;  1HTP A;  2F0J A;  3GTG B;  2D62 A;  1FD7 D;  3CRK C;  2ID0 A;  4XIG S;  2XNA C;  1S5E D;  1I6V C;  1EYD A;  5FKA C;  3MHB A;  1MSG A;  3PUX A;  1SJE D;  1QNU A;  2R6G A;  4TKO B;  4CKB A;  1JCK B;  1RDP D;  1B1Z A;  1E0B A;  2EY2 A;  4DU9 A;  2A6H C;  1MD2 D;  5DAU A;  5J39 A;  1JWM D;  2XVS A;  2E76 C;  1LAC A;  4B9X A;  2QDB A;  1RD9 D;  1SMY C;  3TSS A;  5CYU A;  2F0I A;  1SYG A;  3R93 A;  2Z1C A;  1LT4 D;  3TP8 A;  1B50 A;  1G2S A;  2WKD A;  3KLR A;  4OO1 H;  3NWT A;  1PTO H;  3FVQ A;  4M8A A;  2X6G A;  1JC7 A;  2KVM A;  4DK1 A;  1Y69 U;  2B2V C;  4OO1 I;  2M2L A;  1CQF A;  4V19 0;  3GTM B;  2JSO A;  1GUO A;  1X3Q A;  2WAQ B;  5LHY 1;  2NZ1 D;  3QIA A;  2JEA I;  4BBS B;  1GHJ A;  4DAY A;  2WAC A;  3NP8 A;  3FPU B;  1XYI A;  3PIO 3;  1ET9 A;  2HDM A;  3BDL A;  1O7Z A;  1FYC A;  1YNJ D;  3HRZ C;  3SVM A;  2HDL A;  5EPJ A;  1U9R A;  3E0J A;  1V1P A;  5JVG 3;  2C9O A;  3K0Y A;  3VR6 A;  2Y0S B;  2RBM A;  4KY5 A;  4C3J G;  2A68 D;  3D6C A;  3NTH A;  3KUP A;  2CW0 C;  1V1P B;  4KJO A;  1BQQ T;  4MHE A;  3V96 A;  4B08 A;  3I70 A;  2A74 C;  1RTO A;  4OHJ A;  1JOQ A;  3SDZ A;  5ISR A;  3NTK A;  3O13 A;  2EE1 A;  5DM6 3;  4J6H A;  1LO5 D;  3I73 A;  4Z9C B;  1TU2 B;  1HA5 A;  5JEA H;  1MBY A;  3GTK B;  2EJF C;  2JA7 B;  1VCI A;  2PCF B;  4LAA A;  4A3I B;  1DZ1 A;  1SND A;  1G91 A;  1CK1 A;  4N9T A;  1TWH B;  1TS4 A;  3NWS A;  5HUR A;  2F0Q A;  1GOZ A;  3R2I A;  5K36 G;  3HGB A;  2WP8 J;  3I91 A;  1XTC D;  3BDO A;  3K7A B;  5J1Z A;  2NWG A;  1V43 A;  2VB2 X;  4Q0F A;  3G7L A;  5KYI A;  1SYF A;  5D14 A;  2AUJ D;  4FP5 D;  1WTQ A;  1WTO A;  3BS1 A;  3A8J E;  2RKS A;  3BYT B;  2XRQ D;  3PMF A;  2SDF A;  3BG3 A;  2DNC A;  3S17 B;  5EKK A;  4ZKC B;  2WB1 B;  1CQV A;  5ELD A;  5M3F B;  2R92 B;  2QIL A;  5CV4 A;  2DY7 A;  3HOX B;  2IX0 A;  1EY6 A;  5C6A A;  1HA6 A;  2XWB B;  2J4X A;  1AZQ A;  2KA7 A;  1B44 D;  2ZXP A;  2R61 A;  3DWQ A;  1F9S A;  2BCO A;  4IUV A;  4FXD A;  1BCP D;  1BNZ A;  2RDH A;  2E74 C;  1CHP D;  3NTI A;  4H44 C;  3X3N A;  2QCP X;  1YNN D;  5I9O A;  1HXY D;  2F3V A;  2MHV A;  1QE6 A;  3H6M A;  4IUR A;  1JOR A;  4K8I A;  2NVT B;  2J0T D;  3G6J B;  1SNC A;  2L55 A;  1IL8 A;  1PYW D;  4LK1 C;  2AQ1 B;  1Z7T A;  4CJ0 B;  1CZG A;  3VA7 A;  1G2T A;  2PPB C;  3PIP 3;  2JXM B;  3I90 A;  2AWO A;  5EGT A;  3L7Z C;  3MVV A;  3OW7 A;  3OOC A;  2HUG A;  4RGN A;  4ULL A;  2B2T A;  3GQB A;  3DHQ A;  1C8C A;  4A3D B;  3S1Q B;  2JA8 B;  1GHK A;  3S1R B;  3PUW A;  2E2J B;  4G7H C;  3H94 A;  5FLX E;  3ERO A;  3HS0 C;  1B3A A;  4PQX A;  1GJX A;  2L1B A;  4K5X A;  4KKS A;  4RA8 A;  3I4N B;  3MTS A;  3K58 A;  4A3K B;  3GD7 A;  1S5B D;  2PW7 A;  5JEA J;  4FF3 A;  3VR2 A;  3V05 A;  3FPP A;  1VDZ A;  1GUG A;  3C46 A;  5IGF A;  2K33 A;  2B2Y C;  3HZX A;  5C3X A;  4G57 A;  1RF2 D;  1PTO B;  5FLX L;  5C4Z A;  1Y8P B;  2OF1 A;  2QKI C;  4K6L A;  3D6W A;  1KDB A;  3DEO A;  4DA2 A;  2O5I C;  3QOL A;  5JPM C;  2XIW A;  4KN4 C;  2SOB A;  3IFT A;  3CRL C;  1LTT D;  1QWY A;  2VUM B;  1ZYR D;  1H9M A;  1HFN A;  1GXD C;  4PV1 C;  2EYH A;  1HHV A;  3HOY B;  1SE2 A;  4NMZ A;  5C3W A;  1TS2 A;  3NK9 A;  1B9M A;  5D3I B;  4BS9 A;  3T4A C;  3LX0 A;  4HCE A;  2D9U A;  5JEA G;  1I4G A;  3M7G A;  3T13 A;  2TMP A;  4IN3 A;  4BBR B;  3T53 B;  2N88 A;  2K1B A;  2F0K A;  4KD3 A;  3GTL B;  1SNM A;  1EY5 A;  4P2C B;  4F8M A;  4GZY C;  1ZEQ X;  2CQA A;  5G3L F;  5C4J B;  2A73 B;  2K01 A;  1SXT A;  5KEE A;  3CQZ B;  4IAL A;  2PZT A;  3MFG A;  4ODG A;  3MEH A;  3RZO B;  3P1H A;  4Q5V A;  5IOD A;  1AFP A;  3EQL C;  1ESR A;  3SK8 A;  4R9W A;  4XXE A;  4G7Z C;  2EXZ A;  5BN3 A;  1NSN S;  1VMC A;  1X32 A;  1BXT A;  2BDO A;  4X3S A;  3M4O B;  1KLU D;  2D2C C;  2I07 B;  2LS0 1;  3GTJ B;  1WD1 A;  3H91 A;  2L5T A;  3VYR A;  1F2Y A;  5BN5 A;  4BA1 I;  1XXG A;  1L0Y B;  4I65 A;  3HOU B;  3OMG A;  2NTS A;  2A69 C;  1S5F D;  1C4Q A;  2VNU D;  4RFB A;  2H1E A;  4CHT B;  2B8G A;  2R3Z A;  4F7X A;  5IT9 E;  4R8I A;  1TT2 A;  1ENC A;  5KIX A;  3ONA B;  1Y1W B;  1Q8I A;  1DJR D;  2EYL A;  5E3F A;  1A3V A;  3D4R A;  2E2H B;  1S5D D;  4UAI A;  1PZK D;  2A6E D;  2TSS A;  4XQQ A;  4K8J A;  5FO9 B;  2NUC A;  3ERQ A;  2F4I A;  1HUN A;  1Q1B A;  1DM0 B;  2BE5 D;  5C0X G;  2F0D A;  4RCO A;  3WDN A;  2F0L A;  4DXG A;  1K8M A;  5C3E B;  3M85 A;  4BA2 I;  3VA5 A;  2NYZ D;  3NUC A;  5IT9 L;  3NSW A;  4HN7 A;  2BA0 A;  2SNS A;  2PW5 A;  3T56 B;  2EYM A;  4HTH A;  5I2Y A;  4FF2 A;  5M9O A;  4CJ1 B;  5I6W A;  1BF4 A;  4ZYS A;  3MXN A;  5JPN C;  1TWG B;  3D8G A;  1EL0 A;  3R3O A;  4RHS A;  5C5M A;  2AQ3 B;  1TR5 A;  5EKL A;  2Q8T A;  2MJ8 A;  4A3G B;  1CFM A;  4CGY B;  1A15 A;  2XRS D;  1OO9 B;  1HTL D;  1WTR A;  5ELC A;  4CKE A;  4CKC A;  2ZT9 C;  4ZK9 B;  3SHL A;  3U9S A;  1F77 A;  1QNK A;  1I4X A;  5I4D A;  3Q23 A;  3LNN A;  4RGT A;  2MP1 A;  4WRD A;  1LV9 A;  3K57 A;  1IKM A;  2F0N A;  5KRU A;  2NVY B;  5KGU A;  1KNE A;  1T5E A;  1OXU A;  3RZD B;  3D4W A;  3TDQ A;  3V2T A;  2K03 A;  5EPK A;  3X3M A;  3LWU A;  3PUV A;  3S1N B;  1NAP A;  1SYC A;  2KED A;  1DON A;  2ENB A;  2IW3 A;  1G8Z D;  3IKJ A;  3QO2 A;  1LTR D;  4IFD H;  1QG7 A;  2O5J C;  2F0H A;  3J80 E;  4QUF A;  1LTI D;  3TZD A;  1HCZ A;  4HMI A;  4C3H B;  3VYT A;  1O80 A;  1BCP F;  1PRT D;  1EIH A;  1I4Q A;  1A3T A;  1FNV A;  3BZD B;  3I3C A;  4PNY A;  1EWC A;  4KHV A;  1EIG A;  1PZI D;  1KLG D;  1H9J A;  3SK6 A;  3J81 L;  1DOM A;  3BVG A;  3TP6 A;  3J80 L;  3S2D B;  4KK7 A;  4KJN A;  3E5S A;  2E2D C;  1E2W A;  1II3 A;  5DEH A;  5CV6 A;  2HQE A;  2EYP A;  4EQO A;  1HRJ A;  1ZKO A;  3TBI B;  1DYQ A;  3HP3 A;  2B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...