2SOBA

Sn-ob, ob-fold sub-domain of staphylococcal nuclease, nmr, 10 structures
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
103
structure length
103
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRVLAYIYADGKMVNEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of a stable "OB-fold" sub-domain isolated from staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 8
structure length 103
sequence length 103
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1995-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2sobA00
4WRDA 3SXHA 5ISRA 5JAVA 1EY6A 4HMJA 5HURA 5IGCA 4KHVA 5C4HA 4ZUJA 4OL7A 5CV7A 1EQVA 5CV5A 5E1FA 1SYFA 3HZXA 5NUCA 2LKVA 1KDAA 3ITPA 1SNPA 3SK4A 2PZWA 2PYKA 3MZ5A 1A3VA 1EY5A 3EROA 1IHZA 5DEHA 5E3FA 4MIUA 1JOOA 2EY6A 3D6CA 4HTHA 5F2DA 1KDBA 5C3XA 4KY6A 4LAAA 4EVOA 3SR1A 3QOLA 3DMUA 1A3UA 4PNYA 3BDLA 5CV4A 4DF7A 4K2LA 5I6YA 1SYEA 5CV6A 3U9OA 1AEXA 2RDFA 1F2ZA 2SOBA 5IGBA 2EYOA 4K5WA 4EQPA 1TR5A 3OSOA 2PQEA 3ERQA 2F0EA 2RBMA 1A2TA 1EY9A 4RKBA 5CV8A 1EZ8A 5J22A 1JOQA 5K5PA 3NQTA 5KEEA 2SNMA 2OEOA 5IGEA 3D8GA 3MXPA 5IIFA 1SNMA 1RKNA 1STAA 3D4WA 2EY2A 3R3OA 2QDBA 5CR3A 3OMGA 3S9WA 3V2TA 1JOKA 3BDCA 4ZQ3A 2F3WA 5J1ZA 1EY7A 4KTAA 5C5MA 3T16A 4DGZA 5KYIA 4NMZA 1SNCA 1EYCA 3SK8A 2M00A 1STBA 4ME5A 5C5LA 4F8MA 2OXPA 3T13A 2F0VA 4KJOA 1EY4A 2WACA 1STYA 2EYJA 1II3A 2ENBA 2PW5A 1KDCA 2EYMA 2SNSA 4R8NA 4K8JA 4WORA 3TP7A 4B9XA 1JORA 4QF4A 2F0JA 2F0SA 5DAUA 4QB4A 3TP5A 2O4XA 5C4ZA 3SK5A 5I9OA 5IGGA 1F2MA 3NUCA 1SYBA 2OF1A 3MHBA 4DFAA 2F0OA 4K5VA 3TMEA 1SYDA 5KIXA 1F2YA 2KQ3A 3LX0A 4E6IA 4KY7A 3EVQA 2EY5A 4J6HA 5KRUA 1A2UA 2F0LA 5IODA 4RKLA 3H6MA 4F7XA 2EYPA 5IOCA 5KYLA 3C1FA 1SYCA 4HMIA 2EXZA 4KD3A 1A3TA 4NP5A 5CV9A 1EY8A 2F0NA 3QOJA 4K2KA 2F0DA 2F0WA 4I65A 1SNDA 5C6AA 4EQNA 4KJNA 2F0QA 3NHHA 2F0UA 4ZUIA 2EYLA 2F0HA 2PW7A 5M9OA 4N9PA 2F0PA 3E5SA 5EKLA 5I9PA 3P75A 2KHSA 2F0MA 4QMGA 5C3WA 1NUCA 3D4DA 3HEJA 1ENCA 3PMFA 3QB3A 3C1EA 3MEHA 3OMCA 5HGTA 1KAAA 1U9RA 1STHA 3MVVA 3OWFA 3P1HA 2F0FA 3SHLA 3TP8A 5KGUA 5EGTA 4KY5A 4NDXA 1SNQA 1NSNS 3NP8A 5EKKA 5JOBA 4TRDA 4NKLA 4K5XA 4ODGA 4EQOA 1SNOA 2F3VA 4IUNA 3SK6A 5CC4A 1ENAA 2F0KA 3NK9A 1TQOA 4IALA 2NUCA 3RUZA 4PMBA 3VA5A 5J39A 1EYAA 4J1MA 4ID6A 4K6DA 3TP6A 2F0TA 2EY1A 5IGFA 4KV6A 4H7BA 5CGKA 1EYDA 4PMCA 5IGDA 3NXWA 2F0IA 2HQEA 1SYGA 3EJIA 4S3SA 4B9WA 4YIJA 4N9TA 5I6WA 2PZUA 2RKSA 4IZ8A 1EZ6A 1STNA 2PZTA 4KD4A 3DHQA 4DU9A 1TT2A 1EY0A 4G57A 4K14A 2EYFA 1KABA 1STGA 2EYHA 4K8IA 2F0GA
chains in the Genus database with same CATH superfamily
1IXRA 1K8MA 4A3BG 5EQ0A 4GKJL 4ZUJA 1FNUA 4LFBL 2YTXA 2PNRC 4OX9Q 4IOCA 4L63B 2PZWA 5E3FA 3EROA 1Y8OB 2J4XA 2Z6KC 4L5SA 4DAMA 3H3VI 1SJHD 3GTQB 1SBBB 2EJMA 3U9SA 4C3HB 1JC7A 3HKZB 3NTKA 4P72A 3HOXH 5EAYA 3TS0A 2JN4A 2RSOA 4UAIA 3X3MA 1EFID 1Q12A 5KNCA 3K8AA 3UDXA 2R92H 4BY7H 5COYA 3V2TA 1AN8A 2EDGA 3I91A 4PG3A 2OTLA 4HJ7A 1XTDA 1NTGA 2DJGC 2WACA 1II3A 2SNSA 3S2HH 1A63A 2B63B 3SVMA 3G48A 2MNAA 2JA7H 3K80C 5IWAQ 3SK5A 1Q86C 1K8OA 3NUCA 5IT9c 1IBKQ 3M4OH 2C5CA 3V05A 4K5VA 1KRSA 1QUQB 1F2YA 3LX0A 4FF4A 4LFBQ 1YJNA 4GNXC 4R4QA 2KHJA 4F7XA 2H4OA 3IRBA 1JICA 3N6RA 1ICFB 4LF8L 2JK8A 3UE1A 3GTMH 2K5QA 1XNRQ 3ULLA 1FNWA 1SMXA 4JV5Q 1PYSB 4N9PA 3E5SA 5I9PA 5C4XG 3STBC 4JI0Q 1A15A 2DNCA 5M5YB 1V1OA 5EPLA 3PIOA 1VQ9A 1I6VC 4A3IB 4NDXA 1PDQA 2Q2UA 5JOBA 3JAMc 3K5MA 1X3GA 1TS3A 5CBEE 3H0GB 3BVMA 4BY1B 1D8LA 5FLXc 2RHQB 2RDHA 4J1MA 3E6ZX 3A0JA 2DJFC 1JWSD 4FDBA 3R2IA 5CGKA 1Z6HA 2ICEC 1UE5A 1BBXC 2VUMB 4IPHA 1UE6A 4KD4A 2FINB 1WFQA 2EYHA 2RHSB 3MFYA 3GTOB 2JXMB 2A68C 1VQJA 1PTOB 4FXKC 1DM0B 1KDAA 1XWEA 4DV1L 4RHRA 1J5EL 4HTHA 3PUVA 1GUSA 4B3TQ 1VQNA 4K2LA 2CW0D 5K36H 3VR3A 1JWMD 3MA2B 3GTPH 2HHHQ 1BVSA 2RBMA 1HTLD 1HR0W 1DJRD 4JI4L 4R1JA 2IWHA 4K0KQ 3LWEA 2QF7A 2BH8A 1YIJA 4YCVA 4RGMA 4DGZA 3KOJA 1ENFA 3PUWA 2K28A 4XQNA 2M00A 1STBA 4IUUA 3T13A 3P7JA 5K36G 2KA7A 3MC0B 3NTHA 4UPAA 2NVQB 4RCNA 1SYDA 4JC0A 3TZDA 3OWEB 1PTOH 4QY7A 1P16A 3K81C 3PF5A 1Y1WB 3M4YA 1ZXTA 4DAVA 4KLKA 2M2LA 1QJOA 4K2KA 2B2YA 3Q23A 1LO5D 3RR5A 1RL2A 1AW7A 1NMGA 2VY3A 4QGUA 4OO1H 1NAPA 2E8GA 2PW7A 5M3MH 4C3IG 4JBKA 4YHHQ 1XMQQ 2NVTH 2BOSA 3I4NH 3PMFA 3WOFA 3P1HA 1JR0D 3SHLA 4GN3B 1X6OA 3M4PA 3BG3A 3H0GH 3HOUG 4DR6Q 1BNZA 4H0LC 1E24A 3FKIG 2XRQD 1CT1D 2Z1CA 3GTOH 2BA0A 3M4QA 2NWGA 4DUYQ 4GS3A 1N36Q 4IALA 1NCVA 4JI1Q 2JA8H 3I4MG 1WCMG 1EWHA 1DOKA 1HA6A 3CPWA 1SYGA 1JB7A 3D31A 3DUZA 4A3JB 2VQFL 2A69C 1K73C 2BH2A 3HOWH 4BXXH 1LM0A 1DGSA 3PGZA 5ELCA 4KD3A 5HGQA 3T1YQ 4DR7Q 1EU3A 3FDTA 5LMNQ 1XPRA 3VYUA 2NVYH 2EVBA 3A8KE 5E1FA 2EXDA 1PMRA 1IHZA 3QJYA 4CKBA 4X62L 4B3SQ 4UP8A 4MIUA 1VQFA 2N55A 2WFWA 4LF5L 3BDLA 5CV4A 2JA6H 2HT1A 4OWXB 3FMCA 4ZKBB 3GTMB 1TS4A 4GKJQ 4JI7Q 2N3SA 4RKBA 1X55A 2H5XA 1SE2A 2SNMA 2R92B 1UNSA 3A74A 1RJTA 2WKDA 4HR7B 2EY2A 1TWAH 5CR3A 4BXXG 2R3ZA 1DOMA 3CP0A 1UE1A 5C0XH 1R4PB 3T16A 2DY7A 1VQ8A 5JVG3 2OXPA 1EY4A 1WVLA 2EYJA 1E0BA 3TMEA 4A3FG 3IFTA 1HNWL 3GTQH 4BBSH 2F0JA 5C0XJ 2QEJC 5IT9E 4JYAL 2O5JC 2UXBQ 5C0XG 4CDCC 3J7AF 5FKAC 3DXJC 4J6HA 4KKSA 1B2TA 4OIJA 2ZM6L 2EXZA 3J81E 3U58A 2AUKA 4WFN3 2VQEQ 3GTKH 4LF5Q 3LWUA 3ULJA 2JP1A 4L6TB 5FJ8G 3HGBA 4DV5L 4KHPL 1F2LA 1NY4A 1KNEA 2K33A 5HGTA 4LK1C 4A3FH 2F0FA 5JPNC 2Z0SA 3GTJB 1SAPA 5EBCA 2PPBC 1SNQA 3NP8A 4LF6Q 2K5VA 4K5XA 4ZLTF 5FO7B 4IUNA 4A76A 1TQOA 4JOIC 3M7GA 5IYDH 1EYAA 5I2XA 1BOSA 5DM63 4R4TA 5C44G 4WJ3M 2SEBD 4PZ6A 2EY1A 3PUZA 5M5WB 1Q7YC 2B2TA 5M3MG 1BBWA 4DAPA 1ZYRD 4A3LG 3NBHB 3HKSA 1EIYB 1F9SA 4GNXB 5CV5A 4X66L 3GTJH 1TIID 5JEAG 4JI6Q 4BWGB 5FOBB 1EY5A 4FO2A 2DNEA 1GHKA 4BBRB 5IWAL 3IFDA 1C7YA 1IBKL 5C4JH 3OYYA 5L37A 4EQPA 3KFUA 5D14A 1OTCA 2F0EA 1SE3A 4PMWA 1ML0D 1K8AC 4DPGA 4JI1L 1TWFH 1N32L 1F9PA 3D4WA 1FGBD 3R3OA 1IL2A 3UDIA 1VF7A 5C4XH 3SK8A 1EOVA 2RQXA 4C3JG 1IW7C 2F0VA 1KC8C 1E2WA 2ENBA 4X3SA 3BS1A 1TWHB 1VQPA 3K57A 2AQ1B 1XYIA 2FMMA 1VQOA 1BCPC 4CKCA 4GN5A 3RLFA 5JPMC 4RMFA 2K05A 1TWFB 3H6MA 4RKLA 4Y7NH 2AMCB 1C0AA 2K75A 2G5DA 1SYCA 2YTVA 1QNUA 4FNFA 1MBYA 2D62A 2V4DA 4IUQA 2A19A 1N8RC 4KJNA 1KXLA 2E2DC 3KLRA 3S17H 4U68A 3VYSA 2B8GA 3HOVG 3RLOA 3E0EA 3TP8A 4X65L 5C44H 2HCCA 2KCNA 3CCMA 1QVGA 2G9HD 3A55A 4DV0Q 1SFOB 3CU7A 4KN4C 4ODGA 2XRSD 3RUZA 4RGOS 4ZAIA 4YY3Q 4RHSA 1VS0A 3NWTA 5E4XA 5IE8A 4FYDA 1K3RA 3J81j 4DR2L 4BA2I 2CWAA 4YIJA 5FLMG 3K58A 4DU9A 2PZTA 3HG9A 4GOPB 2UXCQ 1Y1WG 2UU9L 1STGA 1PH7A 4L5TA 1YBYA 1K8GA 1WTPA 1K0SA 3BJUA 1PZID 1RD9D 5E7NA 1ZKOA 2R93G 4G7OC 3KJPA 1I4HA 4BS9A 2ZT9C 1QE6A 2GN5A 3HZXA 5NUCA 1CKNA 1ZYRC 4J8QA 5IP9G 1PYBA 1CUKA 5FLXE 2EY6A 4RGTA 3ER0A 3E9IA 1PFMA 2NVTB 2VQFQ 1KIXA 3K0XA 1E1TA 4MNOA 2JA7G 4G7ZC 3HOYB 2FMCA 4UP9A 2UUCL 2R7ZH 3L7ZC 4RWSC 3HRZC 4IFDH 2D9UA 5LMNL 4IUTA 2HD3A 3GTKB 1R9TH 1JOQA 1PLFA 4MTNA 3T4AC 3Q0AA 2UXDL 3A56A 1W6KA 1Y1WH 4JG2A 2C9OA 1RCVD 2QDBA 3HOZB 1HFGA 3LNNA 1FJGQ 3PO3H 2KBNA 1BQQT 1U4RA 2KCCA 3GV3A 4NXNQ 1NMFA 3T53B 2LFNA 3FVQA 5JJKA 4DV5Q 4G4KA 4IUPA 2E2JH 1GVPA 1B9NA 4EX5A 4ME3A 1SYBA 4A3BB 3RLNA 4DUZL 4AYBG 1ZEQX 3CCLA 4GZYC 4PV1C 1ET9A 3J7A5 2JQOA 2O2LD 4HMIA 3K5LA 4IOAA 2CHBD 3AFPA 1JMCA 3HOVH 4NPSA 4LW1A 1I94L 3ULPA 3I8ZA 1AFPA 1XPUA 3J80i 4O42A 4OHJA 5M3FG 4A75A 4Y52H 1YNNC 4NB3A 2B3GA 2IT1A 3A8IE 3MVVA 1YVCA 1B7YB 1M90C 1S5BD 3I4MH 1JE5A 1CKOA 3KBGA 5CORA 1ICWA 4NKLA 1IL8A 2NB0A 2WAQB 4EQOA 1SNOA 4JBJA 4I7AA 3TBIB 4PMBA 2F52A 2HDLA 4FXGC 2UXBL 3PSIA 3I70A 3K7AB 3CAMA 4KV6A 4JCVE 4PQXA 2EPBA 2VB3X 2HQEA 2ES2A 3CW2C 4N9TA 4QL5A 1PTOD 4OGQC 4JI6L 2VQEL 2RSNA 2XGTA 1CKNB 1WYDA 1H9RA 5JJIA 2B29A 5CV7A 1B8AA 2LSSA 1WCMB 5EKIA 3I4MB 1KLGD 3J7YW 3MZ5A 1T5EA 2A8VA 2M9VA 2F3IA 3WOEA 2UUBL 1S5CD 4JYAQ 4P73A 3HOXG 3TN2A 1P8LA 2KEEA 4EVOA 4PNYA 4V190 4A3DH 3G4SA 1Y14B 5GROA 2ID0A 1G6ZA 1J5EQ 4KK7A 3QO2A 1F77A 3RNUA 3P20A 3B6YA 2ZM6Q 1B1ZA 2OEOA 2MGSA 3NBHA 4C2MH 5IIFA 2NZHA 1GUWA 1PFBA 1NR4A 3T1HL 3OMGA 3GQBA 1LTRD 4HJAA 4KTAA 3UDGA 4EQ5A 5FJ8H 4A3BH 1CFMA 1TS2A 5C5LA 1D2BA 5IOCA 4R8NA 4DV4Q 2PW5A 1HR0Q 4B9XA 2R61A 4RA8A 2B2VA 2E2JB 4QF4A 2B63H 2F0SA 2QILA 2N88A 5D3IB 4DV3L 1IZ6A 3M7NA 1FGUA 1D5XC 3J80E 4OELB 4FF3A 3LGJA 4CJ1B 2F4IA 1YITA 3U50C 1HUMA 4X64Q 1NE3A 3DWQA 2XN9C 2C35B 2RA4A 4GLXA 2F0NA 2MO1A 3QOJA 4HJ9A 4LUZA 2F0DA 4JI2Q 3GTPB 4LF4Q 1HQMC 3Q6SA 3FKIH 1SNDA 2LY7A 4HSVA 2NBFA 4IJLA 1HJPA 2F0HA 2IHFA 4RAUC 2Z6KA 4ZCKA 2AQ2B 2E2HB 3FRPB 2A6HC 1FL0A 4GLVB 3JAME 3DM1A 1DYQA 3VR6A 3A7AB 1SMYD 5LMUQ 5BN3A 3RZOB 1O7IA 2E2IB 2CQAA 2TSSA 3BZCA 2NUCA 1EIGA 3I3CA 5J39A 3MFGA 4QQBX 3PIP3 3G6EA 1V1PA 1HZBA 4UY8C 4Z9CB 2MQHA 1HNZL 5IGDA 3CCUA 1TY2A 4DK3C 3T51B 4AQYQ 2Q8IB 1IBLL 1XNRL 1O78A 2DUDA 4BY1H 4K14A 1GD7A 4EQNA 5AJ3L 1Q8KA 1X3FA 2XTIA 3SXHA 1K9MC 1WTOA 5C4HA 4GNXA 4C56C 3NPPA 2LKVA 4PZ7A 4JI5Q 3TSSA 3KUPA 2PYKA 1X3QA 3J7ZC 1GM5A 1Q46A 3R2TA 4GN4B 4X6AH 4C3JH 3DMUA 3UDFA 4OO1I 2R7FA 3TREA 4AYBB 1AEXA 1KTKA 4LJZC 3CMEA 3GTLH 4K5WA 1I4GA 4JPBW 4OIKA 4B3MQ 3SE0A 2ASBA 2L9HA 1B70B 2A73B 4AH6A 3S2DB 3U4VA 2I5MX 2QA4A 1PH2A 5KYIA 1PH4A 2IY5B 1HRJA 1YNJC 3F2CA 3ND9A 4DR1L 1YI2A 3ERSX 2OT2A 3RD4A 3KJOA 1TWHH 1EYGA 4CKEA 3Q8DA 2BDNA 2AHOB 4P2CB 4B3RQ 4XYQA 5M5XH 3G7LA 4DV0L 1I94Q 2KQ3A 2K04A 4KY7A 2TMPA 1Q90A 1BDOA 4XT3B 3F2DA 1V1QA 5KYLA 4U673 2EYPA 4LFAQ 4GKKL 2GA4B 2HDMA 3UI2A 3QIAA 2ZXOA 4OEMB 4ULLA 4IUVA 1C48A 5EJWA 4LNQA 3S1NH 3SEBA 4C3HH 1TXYA 2FJ2A 4A3CH 5C4JB 1LV9A 5FLMH 4IPCA 5IYBH 1ASYA 2KJXA 2IX3A 2B2UC 2QDLA 1T5XD 4QMGA 3HEJA 3KLSA 1CKMA 2QEXA 2H1EA 4CJ0B 4C3HG 3SGIA 4NXNL 1LTBD 3S1MB 5C3EH 4LF6L 1ENAA 3MWYW 3PF4A 4KHZA 2JEBI 4YCUA 4IQZA 1TWGB 4DR3Q 1BXTA 1LT5D 4A3GH 5I6WA 4JV5L 1V43A 1Q82C 2UXDQ 5BR8L 3HOVB 5IGBA 1HPCA 1B44D 2CKZB 3BZDB 4MN3A 1JJCB 3RZDB 2SDFA 1I4QA 4KI0A 4IPGA 1EQVA 1ESFA 4DV6Q 4A3FB 3S16H 1L2FA 3D6CA 1JOOA 4AIMA 2FXQA 4QCLA 5G3LD 3QOLA 1RTOA 1YJWA 1H9JA 2SOBA 1F9RA 2I5LX 3J80L 4R4IA 3J80c 1E2ZA 3Q24A 5IT9L 1AZPA 5J22A 3PO2H 3PO3B 1PV4A 3NQTA 1R4QB 2KEDA 2RCNA 1G8ZD 5KEEA 2JA5B 1N33L 1SLJA 4TVAB 2HQLA 2JA5H 4K0KL 1R9TB 2JSOA 5DLQE 2NZ1D 2EIFA 5M3FH 1SNCA 3DWPA 4DV3Q 4DV7L 1HZAA 1STYA 5IP7H 2HCIA 5G3LF 1JORA 1IYUA 1PVOA 2MPMA 3TP5A 3EQLC 3S16B 2L5TA 4X62Q 1HNXL 2F0OA 1PA6A 2EY5A 4JI2L 2YYZA 3OTOL 5IODA 1QWYA 2E5LL 3NE5B 2CH4A 4JI7L 5CV9A 3ZJYC 2OWOA 2Z9HA 3VDYA 1YHBA 4L8JA 2F0UA 1V9PA 2EYLA 2EJFC 5JEAJ 3FEWX 3A5UA 4AQYL 2KHSA 1X3EA 2L15A 1I50B 5C3WA 3D4DA 1FVIA 4BY7G 3C1EA 1I5FA 2B2VC 1AE3A 1YHQA 3EIVA 4RG1A 3H09A 1WTWA 3URYA 3HOUB 1SFOH 1H95A 2D5DA 2Z4HA 2FFKB 3AEVA 1JQYD 2R6GA 4K6DA 3TP6A 2UUAL 4CDFC 5IGFA 4PMCA 1QOHA 4JI3L 1Z9FA 2K4KA 1PRTB 2PI2A 1BO0A 3K0YA 4JVZA 5LMUL 1PH1A 2L1BA 3L3OC 4K8IA 3CC7A 5ISRA 4RGNA 3CD6A 1AE2A 4DR6L 3HFZB 4LFCL 1M1KC 1DZ1A 3I4NB 1KNAA 1WI5A 2LXJA 5C3XA 4LAAA 2LS01 3SR1A 1JWUD 1L0WA 1CM9A 3AQQA 3ERQA 1EY9A 3W1GA 4XQQA 3S2DH 2Z8LA 4DR5L 5IGEA 3MXPA 2CCZA 5KNBA 4NW2A 2QW7A 4QJFA 2BCOA 1EQRA 2ALYB 2BA1A 3BDOA 4HJ8A 2ZXPA 1WTHA 3CXCA 4UHVA 5FK9C 1GJXA 1DCZA 4BBRH 2PMZB 5IGGA 2O4XA 2ZJQA 1RIPA 4R9WA 1IW7D 4JI5L 2IL8A 2Y0SE 2Z6BA 1PZKD 1XX8A 4O2DA 1GUOA 1SROA 4TSSA 2WP8J 2L55A 1A3TA 2R7ZG 3J81c 2QGQA 1BF4A 3J81L 1O7LA 4A3GB 1LTAD 1I3QH 4XQJA 2K5NA 3D6WA 4WJWA 1TWGH 1T9HA 3CKIB 1SEBD 4XT1B 3VYRA 4DN4M 1VQ7A 1I6HB 5LHY1 1K83H 2L4NA 1S5FD 3F2UA 4F87A 5KGUA 5EGTA 2XVSA 3A8JE 1VQGA 2E2IH 3K7UC 4GLAC 3RZOH 1KLUD 1PHJA 1MGSA 3F1ZA 2VL6A 3CCVA 4DUYL 3VA5A 1W2BA 2E2HH 3AMUA 1V1PB 4ID6A 2VUMH 1JJ2A 3Q22A 1EYDA 3H3VC 1FNVA 1KQSA 3VR5A 2AWNA 1C8CA 1D5ZC 2A74C 1K3BC 1N34Q 1DXMA 4A93G 4DV2L 4O0AA 2VXWA 4QUCA 3QWNA 2WINB 3PQIA 4H02A 1WD0A 3VR4A 1CSPA 1S40A 1IBML 1X56A 4DXGA 1M8AA 2K14A 4DR7L 1TWCH 1WTQA 2R93B 1RODA 5DEHA 2K6AA 4CDDC 5F2DA 2K01A 1KDBA 3N52A 4CJ2C 2OTJA 5J3BA 4BBSB 4APVA 1A3UA 1QVCA 1J6QA 3GD7A 3I55A 5DM73 4DK0A 5LMNW 3K59A 1YNXA 2JA8G 1YNJD 1EEFD 3K5NA 1TWAB 2B8FA 3RN2A 3D8GA 1RKNA 4A3LH 1ILPA 2UXCL 1SXTA 1N32Q 5J1ZA 3HKZE 2WIIB 5IYBG 3M4OB 4F8MA 4KY6A 2GVBA 3C46A 2EYMA 2JA6B 1FR3A 4A3DB 2P5ZX 4A3MG 3I4LA 5D3DA 3CQZB 3OOCA 3NELA 1TWCB 2R93H 4MHEA 3EVQA 4LFCQ 2NVYB 1KD1C 1LTID 3MTSA 1A2UA 1WJJA 3R8BA 3DEOA 1JCKB 3OIPA 1PTOF 1VMCA 2K52A 5A2QL 4X3TA 3PIPA 1D1IA 2F0WA 1VQHA 1EUJA 2Y0SB 1TU2B 4ZK9B 5EKLA 3P75A 3K7AH 1LACA 2JA8B 4LF7Q 5IP7G 2NN6G 3I73A 4P74A 4KY5A 3DEPA 1F9QA 1QB5D 1U4LA 4Q0FA 4OWWB 4JBWA 2F03A 2ZXRA 2AKWB 5CC4A 3NK9A 4A3GG 4A3EB 4JI3Q 3I56A 3CCQA 2CWPA 1G51A 4FP5D 2CFMA 4ZYSA 4RFBA 1MJCA 4YY3L 1A6XA 1MSHA 5M3MB 5JVH3 3TEHB 1I3QB 3UE0A 4A3IG 4IZ8A 1B9MA 1TVXA 4C1NK 3CCEA 1TT2A 2A1AA 1N9WA 2R92G 4DR5Q 1YJ9A 2J7ZA 4RCOA 2KUMA 4WRDA 3OIQA 3AFQA 3H15A 4KHVA 4JOIA 2MFIA 5FLXL 1HA5A 2CQOA 1YZ6A 2BE5D 1SNPA 5EBDA 3E0JA 3ICEA 2NVQH 1OXVA 4B3TL 4DF7A 1L0XB 2B2TC 4YWKA 1VQ5A 1QUQA 1X54A 2EYOA 4CHTB 3NWSA 2PO4A 2G9DA 3WWVA 1W3SA 1M4VA 4KN7C 1XTCD 3I4NG 4IFDJ 2UU9Q 2K5HA 1NBWA 1X3PA 2IPKD 1CQVA 2K1BA 1MD2D 1UEBA 1HZ9A 2R7ZB 4M8AA 4A4IA 2ATWA 3H3VH 1H9SA 4DNRB 1SE8A 1QVFA 1CHPD 2D2CC 4K8JA 1Y1VB 3S1RH 4DNIA 3MAQA 4X3KA 5CMDA 2OF1A 2Q2TA 1K0RA 4DFAA 2I46A 3EN2A 2QCPX 1GHJA 2RVLA 1OXSC 4CBVA 3NEMA 4LUOA 3D0FA 1LYLA 1QNKA 1OO9B 3FP9A 5A2QE 1NJIC 1VF5C 2IJ0A 1I4PA 4IFDI 1QZHA 4JW0A 5IYCH 2F0QA 3GV6A 1HNXQ 2F0PA 1ASZA 3KBXA 2F0MA 3HP3A 3CC4A 1O7YA 1MHWC 4DAYB 5I2YA 1U9RA 4XTCS 1HUNA 1E22A 1Q1EA 2L11A 2ZTEA 1LLRD 2EJGC 5JJZA 4YWMA 4X3UA 4UDUC 2N8NA 2WKCA 2NVXB 5BN5A 4A3IH 2F0KA 2E74C 3SDZA 1Q3LA 4JK1C 2Q8RE 3L9AX 2JEAI 5KNDA 3IL8A 1CZWA 1UUPA 2F4VL 1SMYC 1G2SA 1NNXA 4YWLA 2WB1E 3MXNB 4HJ5A 5GADC 1L1OC 2PZUA 4LF4L 1Q1BA 3EBEA 1STNA 3DHQA 1I4XA 1YEZA 1JB3A 2WB1G 3GDEA 5JAVA 4F88A 4Y7NB 5HURA 4OX9L 4X65Q 1VDZA 3KF6A 1B50A 1A3VA 1HH2P 4A3DG 3CPFA 1SJED 1S5ED 3D4RA 5E4WC 1HZCA 2JA7B 2NZOA 2RCFA 1WTXA 2B2WA 2B2YC 1XJVA 2I5HA 4DNTB 4A3JG 2UUBQ 3S2HB 1GOZA 1X65A 3U9OA 1XMOL 5C3EG 5JEAH 5M3FB 1SN8A 4KKUA 1A2TA 1VQDA 3I72A 3BYYB 1EZ8A 1PH9A 4BY7B 2GVAA 1SRUA 2NN6I 1G91A 3HOZH 4H13C 3IAYA 1SSOA 1CQFA 5ELOA 4GOPA 3AU7A 1LT3D 3OW7A 1IBLQ 4A93H 3I7FA 3PO2B 2KHIA 3RN5A 1EY7A 1EWIA 2PNHA 3ND8A 1EYCA 4OONA 2MUYA 5IYCG 5EPJA 2YU9H 3S1RB 2V1CC 4QB4A 2YU9B 4DV7Q 1F2MA 2R7DA 2Z4IA 2VS1A 3VR2A 1TS5A 3W2DA 1EQTA 1LABA 1EFWA 3CHBD 2NTSA 1STEA 1VQLA 4A93B 2F0LA 3C1FA 3JAML 4QUFA 1J8IA 4X64L 1E7ZA 3CMAA 4HIKA 1LTSD 2VW9A 4YCWA 4L5RC 5M9OA 5M5WH 2I07B 2WAQE 3PUYA 4OXPA 1E3PA 1NUCA 2CH4W 2Q2HA 3QB3A 3CRKC 5FO8B 3PO3G 3VA7A 1EIHA 1KAAA 4V0BA 1KHIA 1H9SB 4H44C 1SDFA 3MXNA 4A3KB 2IW3A 5C3EB 1VCIA 4MZ9A 1N36L 4TRDA 2Q8TA 3S1MH 1QILA 2JA5G 5LL6S 4B3RL 1HFNA 4DR4L 2KCMA 5C44B 2KCTA 4B08A 1PRTF 4O1NA 1XXGA 3TDQA 2HHHL 1QZGA 1LTLA 2O5IC 2A6EC 1ET6A 4LF7L 3HOWG 2ZJRA 2F0IA 4K6LA 1DOLA 3DWAA 4I7ZC 4IURA 2RKSA 2EQSA 3AB9A 1EY0A 1CTMA 4R4OA 1KRTA 1GXDC 1MI2A 1EU4A 1O80A 4DXFA 3OPOA 1PH8A 2WB1B 5ELBA 4X66Q 1WOCA 1XPOA 1D1KA 2OQ0A 2K32A 1MKHA 1PXUA 5DNFA 3GP7A 5M5XB 2JA6G 2IX1A 3TS2A 1B3QA 2K5WA 2AWOA 3OW2A 1LT6D 3J81i 3NQIA 4BBRG 4HIOA 4DV4L 2MJ8A 3S1NB 5IY0A 1H9MA 1J9OA 1IBMQ 2OCEA 4LMQD 5CV8A 5D65A 1CA6A 3S15B 1L0YB 2CVRA 1D5MC 1STAA 4BY1G 1OXUA 1S4ZA 1W6JA 5AFWA 1AP0A 1UE7A 1WD1A 4NXML 2F3WA 3FPUB 3VYTA 1N33Q 4C3IH 3NSWA 2ZTCA 4KJOA 4XIGS 3CQZH 4CGYB 3DLLA 1Y1VH 1HR0L 4DR1Q 1TY0A 5EPKA 5I9OA 4QIWB 1X32A 4FVMA 2B63G 3EA6A 3DM3A 1VQCA 3CCSA 1D6EC 4HEDA 5ELDA 2OQKA 1DONA 1H9KA 2MO0A 1GKHA 1VQBA 2FHTA 4EGVA 1U0LA 3BVGA 3CCJA 1JJGA 3M9BA 1PH6A 1PH5A 3GTLB 1RHPA 2EE1A 2PI2E 3HKZG 2I0QA 2D0PA 3S14H 4R8IA 3PUXA 1EEID 4DA2A 2JE6I 1U4PA 1YHAA 4MTKA 1NSNS 3W3AA 4HCEA 2HUGA 3STBD 3I4OA 3X3NA 5AJ3Q 2F3VA 3A7LA 3KYHC 1WTVA 2K5DA 1EWCA 1HCZA 1WTRA 1UAPA 5TSSA 2UUCQ 2XWBB 2PQAA 3G6JB 3KK7A 2XIWA 2UUAQ 1BKBA 1MIUA 2XNAC 3J7AV 4B9WA 3FKIB 1CHQD 1EZ6A 2BE5C 3L2PA 1K28A 2HIXA 1I4RA 3KLSX 5IGCA 1Z47A 2CW0C 3AYHB 1SYFA 2VZAA 1K83B 1PTOC 3NBIA 1QCBD 2KOLA 4A3EG 1S5DD 1FYCA 2KVMA 1D7QA 3V96A 1VQIA 4DV6L 1EQQA 2A68D 1B4OA 1SYEA 2RDFA 2ICIA 2RDGA 1TR5A 2ZTDA 4JI8L 2JA9A 1LUZA 1IYVA 1PYWD 3BYTB 5K5PA 3JC66 2WAQG 4DK1A 3TQYA 1OXXK 2HIVA 3C2PA 1BCPB 4IFDG 4IN3A 2Y0SG 1JOKA 3BDCA 3RMHA 2AQ3B 4NMZA 5ELFA 1G2TA 1PRTD 3OHXC 4LUVA 1XMOQ 3TP7A 2D0OA 2E75C 1A8VA 2J0TD 3G71A 1DD2A 2QKIC 1SR3A 1BUVT 2AUJD 1UWVA 3I2ZA 2B2WC 1PFSA 2DN8A 4J15A 1GUGA 1B3AA 3KDFB 1WCMH 5H1SE 4C2MB 4DKAC 1AZQA 3OTOQ 1Q81C 4QIWE 4B3ML 2E5LQ 4KMUC 3HOWB 4A3JH 2A6HD 4DK6C 5C6AA 4KHPQ 1HHVA 1EOTA 1O7ZA 2K50A 4P75A 4N8FA 3ONAB 1STHA 4JBMA 2K7VA 3O13A 4NXMQ 3E3XA 3K5OA 2YTYA 3CCRA 3KDFA 5IP9H 1YNND 2X6GA 5GAGC 3W5OA 4LF9Q 2PQAB 3CC2A 2A69D 2JJQA 1C9OA 1Z7TA 4OO1G 1KAWA 2DY8A 4OWTB 4HIDA 1S72A 1ESRA 1A62A 3EFXD 3NXWA 4IPDA 3ZYYX 4S3SA 5IYDG 4JI0L 1OXTA 1ILQA 3PV0A 4G57A 2A5HA 2EYFA 4BA1I 4HAEA 2F0GA 2PCFB 1UEAB 1Y69U 3KF6B 1EY6A 5CBAE 3NENA 2XWJB 4OL7A 2KECA 2K03A 3ITPA 5GAEC 1I6HH 2MP1A 3D3RA 2DGYA 3FHWA 4ZRZA 2EZVA 5I6YA 4IJHA 5GQOA 2B2UA 1SE4A 4DR4Q 1EL0A 1E2VA 1HXYD 4LF9L 2JYOA 4LWCA 1SNMA 4CDEC 3S9WA 5BR8Q 1TKWB 4ZQ3A 4PZ8A 2F1MA 4HN7A 2IX0A 4G7HC 5GAHC 4ME5A 1PH3A 3HOYH 4KKTA 5DAUA 5C4ZA 4IO9A 2KENA 4TQUS 1LTTD 4XXEA 1BBUA 1PRTC 4E6IA 1L1OA 4GOPC 4Q5VA 5KRUA 4ABNA 5C0XI 2E76C 3L0OA 1RF2D 1MJEA 1ONLA 2ZJPA 1EY8A 1G6PA 1L1OB 4I65A 2B39A 1PFNA 4ZUIA 5T1GA 4XDXA 2N49A 4LF8Q 3E9HA 3K6OA 4DV1Q 2Q2IA 3PIO3 3HS0C 1CI3M 4A3CG 3T56B 4P71A 3CF5A 2IHEA 3RZDH 2A6ED 2NYZD 5FO9B 3KF8A 1XNQL 4ILWA 1EIFA 4C1NI 5BN4A 1Q8IA 3S1QH 1IKLA 2N78A 2NTTA 3PCOB 2RF4A 4A3MH 5M5YH 3CRLC 1GO3E 2F0TA 5T1IA 3S17B 1MSGA 3S14B 3KF8B 3R93A 3W1BA 1VQAA 4POFA 4A3KG 1VQ4A 3NTIA 2X6LA 1KABA 4WJ4A 3BVZA 4ALPA 2NVXH 3GO5A 4HIMA 3H94A 3HOZG 1X9NA 4HMJA 4XYOA 1RTNA 3H0GG 3HOUH 1LTGD 2NN6H 3GTGH 1VQ6A 1U4MA 4UP7A 3BZKA 3SK4A 2LXKA 2YV5A 1Y1VG 2X69A 4BBSG 3TRZA 5HY6A 1JT8A 3M85A 1U5KA 1I50H 2L0CA 3HOYG 4DUZQ 5ELNA 2LMCB 1C4QA 3C3LA 5CV6A 1F2ZA 2VB2X 3OSOA 2PQEA 3FPPA 1CZGA 1HNWQ 4LFAL 5C4XB 4C3IB 1E1OA 1XNQQ 1JE4A 1HQRD 1FJGL 3M3YB 1S3OA 3WDNA 3QG1A 1RDPD 1N34L 3T1YL 2PMZE 3M3YH 4RH6A 4AYBE 3H91A 4ZKCB 3S15H 3S24A 4DV2Q 4FXDA 5C5MA 3HOXB 1NR2A 3F2BA 3PO2G 5JJLA 2EOTA 1LT4D 4WORA 5LL6X 2BDOA 1KDCA 2WV6D 1CK1A 2MHVA 4HCSA 4FF1A 1VQMA 3MHBA 4HSPA 5CYUA 5KIXA 3GTGB 3TZUA 2VNUD 4GKKQ 1B53A 1BCPD 1QG7A 4NP5A 3U4ZA 1G291 3NHHA 1AH9A 4TKOB 3QR8A 4N8X1 1A0IA 1GUTA 3MXUA 4C3JB 2XSCA 1ENCA 4B3SL 1FD7D 3OMCA 3MEHA 4R4CA 4A3MB 3OWFA 1HTPA 3S1QB 3MXGA 3A5ZB 2L12A 5EKKA 1V8QA 1IYJB 4M1UB 5A35A 4POGA 1VMPA 4FF2A 1CSQA 1CA5A 3SK6A 4A3KH 4JI4Q 1PZJD 1BR9A 4DR2Q 5I4DA 1HNZQ 1VQEA 3I90A 4L5QA 3F8TA 4DR3L 4H7BA 3BU2A 1BCPF 3A54A 4JI8Q 2VUMG 2F4VQ 1Y8NB 3EJIA 3MEFA 4YHHL 4DAYA 1XMQL 3T1HQ 1VQKA 3IKJA 1KL9A 1Y8PB 3KLWA 3JAMi 4A3EH 1IKMA 5ELEA 1GUNA
chains in the Genus database with same CATH topology
1K8MA 5EQ0A 4ZUJA 1FNUA 2PNRC 4L63B 2PZWA 5E3FA 3EROA 1Y8OB 2J4XA 1SJHD 3GTQB 1SBBB 2EJMA 3U9SA 4C3HB 1JC7A 3HKZB 3NTKA 2RSOA 4UAIA 3X3MA 1EFID 1Q12A 5KNCA 5COYA 3V2TA 1AN8A 2EDGA 3I91A 2WACA 1II3A 2SNSA 2B63B 3SVMA 3SK5A 1K8OA 3NUCA 2C5CA 3V05A 4K5VA 1F2YA 3LX0A 4FF4A 4F7XA 2H4OA 1JICA 3N6RA 2K5QA 1FNWA 4N9PA 3E5SA 5I9PA 1A15A 2DNCA 5M5YB 1V1OA 5EPLA 1I6VC 4A3IB 4NDXA 1PDQA 5JOBA 3K5MA 1TS3A 5CBEE 3H0GB 3BVMA 4BY1B 2RDHA 4J1MA 3E6ZX 1JWSD 3R2IA 5CGKA 1Z6HA 2ICEC 1BBXC 2VUMB 4KD4A 2FINB 2EYHA 3MFYA 3GTOB 2JXMB 2A68C 1PTOB 4FXKC 1DM0B 1KDAA 1XWEA 4RHRA 4HTHA 3PUVA 1GUSA 4K2LA 2CW0D 5K36H 3VR3A 1JWMD 3MA2B 2RBMA 1HTLD 1DJRD 2IWHA 3LWEA 2QF7A 4RGMA 4DGZA 1ENFA 3PUWA 2K28A 4XQNA 2M00A 1STBA 4IUUA 3T13A 3P7JA 5K36G 2KA7A 3MC0B 3NTHA 2NVQB 4RCNA 1SYDA 3TZDA 3OWEB 1PTOH 1Y1WB 3M4YA 1ZXTA 4DAVA 2M2LA 1QJOA 4K2KA 2B2YA 3Q23A 1LO5D 1AW7A 4OO1H 1NAPA 2PW7A 4C3IG 2BOSA 3PMFA 3WOFA 3P1HA 1JR0D 3SHLA 3BG3A 1BNZA 4H0LC 2XRQD 1CT1D 2Z1CA 2BA0A 2NWGA 4IALA 1NCVA 1EWHA 1DOKA 1HA6A 1SYGA 3D31A 3DUZA 4A3JB 2A69C 5ELCA 4KD3A 1EU3A 3FDTA 3VYUA 2EVBA 3A8KE 5E1FA 1PMRA 1IHZA 3QJYA 4CKBA 4MIUA 2N55A 3BDLA 5CV4A 3FMCA 4ZKBB 3GTMB 1TS4A 4RKBA 1SE2A 2SNMA 2R92B 1UNSA 1RJTA 2WKDA 4HR7B 2EY2A 5CR3A 2R3ZA 1DOMA 5C0XH 1R4PB 3T16A 2DY7A 5JVG3 2OXPA 1EY4A 1WVLA 2EYJA 1E0BA 3TMEA 3IFTA 2F0JA 5C0XJ 2QEJC 5IT9E 2O5JC 5C0XG 3J7AF 5FKAC 3DXJC 4J6HA 4KKSA 1B2TA 4OIJA 2EXZA 3J81E 2AUKA 4WFN3 3LWUA 2JP1A 4L6TB 3HGBA 1F2LA 2K33A 1KNEA 5HGTA 4LK1C 2F0FA 5JPNC 3GTJB 1SAPA 5EBCA 2PPBC 1SNQA 3NP8A 4K5XA 4ZLTF 5FO7B 4IUNA 1TQOA 3M7GA 1EYAA 5I2XA 1BOSA 5DM63 2SEBD 2EY1A 3PUZA 5M5WB 2B2TA 4DAPA 1ZYRD 1F9SA 5CV5A 1TIID 5JEAG 4BWGB 5FOBB 1EY5A 4FO2A 2DNEA 1GHKA 4BBRB 3IFDA 4EQPA 5D14A 2F0EA 1SE3A 4PMWA 1ML0D 1F9PA 3D4WA 1FGBD 3R3OA 1VF7A 3SK8A 2RQXA 4C3JG 1IW7C 2F0VA 1E2WA 2ENBA 4X3SA 3BS1A 1TWHB 3K57A 2AQ1B 1XYIA 2FMMA 1BCPC 4CKCA 3RLFA 5JPMC 2K05A 1TWFB 3H6MA 4RKLA 1SYCA 1QNUA 4FNFA 1MBYA 2D62A 2V4DA 4IUQA 4KJNA 2E2DC 3KLRA 3VYSA 4U68A 2B8GA 3TP8A 2HCCA 2KCNA 2G9HD 3A55A 1SFOB 3CU7A 4KN4C 4ODGA 2XRSD 3RUZA 4RGOS 4ZAIA 4RHSA 3NWTA 5E4XA 4FYDA 4BA2I 4YIJA 3K58A 4DU9A 2PZTA 3HG9A 1STGA 1WTPA 1PZID 1RD9D 1ZKOA 4G7OC 1I4HA 4BS9A 2ZT9C 1QE6A 3HZXA 5NUCA 1ZYRC 4J8QA 5FLXE 2EY6A 4RGTA 1PFMA 2NVTB 4G7ZC 3HOYB 2FMCA 3L7ZC 4RWSC 3HRZC 4IFDH 2D9UA 4IUTA 3GTKB 1JOQA 1PLFA 3T4AC 3Q0AA 3A56A 1W6KA 2C9OA 1RCVD 2QDBA 3HOZB 1HFGA 3LNNA 1BQQT 1U4RA 2KCCA 3GV3A 3T53B 2LFNA 3FVQA 4G4KA 4IUPA 1B9NA 1SYBA 4A3BB 1ZEQX 4GZYC 4PV1C 1ET9A 2O2LD 4HMIA 3K5LA 2CHBD 3I8ZA 1AFPA 4O42A 4OHJA 1YNNC 2IT1A 3A8IE 3MVVA 1S5BD 3KBGA 5CORA 1ICWA 4NKLA 1IL8A 2NB0A 2WAQB 4EQOA 1SNOA 3TBIB 4PMBA 2HDLA 4FXGC 3I70A 3K7AB 4KV6A 4PQXA 2EPBA 2VB3X 2HQEA 4N9TA 1PTOD 4OGQC 2RSNA 1H9RA 5CV7A 1WCMB 5EKIA 3I4MB 1KLGD 3J7YW 3MZ5A 1T5EA 2M9VA 3WOEA 1S5CD 3TN2A 2KEEA 4EVOA 4PNYA 4V190 1G6ZA 2ID0A 4KK7A 3QO2A 1F77A 3P20A 1B1ZA 2OEOA 2MGSA 3NBHA 5IIFA 1GUWA 1PFBA 1NR4A 3OMGA 3GQBA 1LTRD 4KTAA 1CFMA 1TS2A 5C5LA 1D2BA 5IOCA 4R8NA 2PW5A 4B9XA 2R61A 4RA8A 2B2VA 2E2JB 4QF4A 2F0SA 2QILA 2N88A 5D3IB 3M7NA 1D5XC 3J80E 4FF3A 4CJ1B 2F4IA 1HUMA 3DWQA 2XN9C 2RA4A 2F0NA 3QOJA 2F0DA 3GTPB 1HQMC 3Q6SA 1SNDA 2LY7A 4HSVA 2NBFA 2F0HA 4RAUC 2AQ2B 2E2HB 3FRPB 2A6HC 3JAME 3DM1A 1DYQA 3VR6A 3A7AB 1SMYD 5BN3A 3RZOB 2E2IB 2CQAA 2TSSA 2NUCA 1EIGA 3I3CA 5J39A 3MFGA 3PIP3 1V1PA 4Z9CB 5IGDA 1TY2A 3T51B 2Q8IB 1O78A 4K14A 4EQNA 3SXHA 1WTOA 5C4HA 4C56C 3NPPA 2LKVA 3TSSA 3KUPA 2PYKA 1X3QA 3R2TA 3DMUA 4OO1I 4AYBB 1AEXA 1KTKA 4LJZC 4K5WA 1I4GA 4OIKA 3SE0A 2L9HA 2A73B 3S2DB 5KYIA 1HRJA 1YNJC 3ND9A 3RD4A 2OT2A 4CKEA 2BDNA 4P2CB 4XYQA 3G7LA 2KQ3A 2K04A 4KY7A 2TMPA 1Q90A 1BDOA 4XT3B 5KYLA 4U673 2EYPA 2GA4B 2HDMA 3UI2A 3QIAA 2ZXOA 4ULLA 4IUVA 1C48A 5EJWA 3SEBA 2FJ2A 5C4JB 1LV9A 2KJXA 2IX3A 2B2UC 1T5XD 4QMGA 3HEJA 3KLSA 2H1EA 4CJ0B 4C3HG 1LTBD 3S1MB 1ENAA 3MWYW 4KHZA 2JEBI 4IQZA 1TWGB 1BXTA 1LT5D 5I6WA 1V43A 3HOVB 5IGBA 1HPCA 1B44D 3BZDB 4MN3A 3RZDB 2SDFA 1I4QA 4KI0A 1EQVA 1ESFA 4A3FB 1JOOA 3D6CA 4QCLA 5G3LD 3QOLA 1RTOA 1H9JA 2SOBA 1F9RA 3J80L 1E2ZA 3Q24A 5IT9L 1AZPA 5J22A 3PO3B 2KEDA 1R4QB 3NQTA 2JA5B 1G8ZD 5KEEA 1R9TB 2JSOA 2NZ1D 1SNCA 3DWPA 1STYA 2HCIA 5G3LF 1JORA 1IYUA 2MPMA 3TP5A 3EQLC 3S16B 2L5TA 2F0OA 2EY5A 2YYZA 5IODA 1QWYA 3NE5B 5CV9A 4L8JA 2F0UA 2EYLA 2EJFC 5JEAJ 3FEWX 2KHSA 5C3WA 1I50B 3D4DA 3C1EA 2B2VC 3H09A 1WTWA 3URYA 3HOUB 2D5DA 2Z4HA 2FFKB 1JQYD 2R6GA 4K6DA 3TP6A 5IGFA 4PMCA 1QOHA 1PRTB 3K0YA 1BO0A 2L1BA 3L3OC 4K8IA 5ISRA 4RGNA 1DZ1A 3I4NB 1KNAA 5C3XA 4LAAA 2LS01 3SR1A 1JWUD 1CM9A 3ERQA 1EY9A 4XQQA 2Z8LA 5IGEA 3MXPA 5KNBA 4NW2A 2BCOA 2BA1A 3BDOA 2ZXPA 5FK9C 1GJXA 1DCZA 2PMZB 5IGGA 2O4XA 4R9WA 1IW7D 2IL8A 1PZKD 1XX8A 1GUOA 4TSSA 2WP8J 2L55A 1A3TA 1BF4A 3J81L 1O7LA 4A3GB 1LTAD 4XQJA 3D6WA 4WJWA 3CKIB 1SEBD 4XT1B 3VYRA 4DN4M 1I6HB 5LHY1 2L4NA 1S5FD 3F2UA 4F87A 5KGUA 5EGTA 2XVSA 3A8JE 1KLUD 1MGSA 3VA5A 3AMUA 1V1PB 4ID6A 3Q22A 1EYDA 3H3VC 1FNVA 3VR5A 2AWNA 1C8CA 1D5ZC 2A74C 1DXMA 2VXWA 4QUCA 3QWNA 2WINB 1WD0A 3VR4A 4DXGA 1M8AA 1WTQA 2R93B 1RODA 5DEHA 2K6AA 5F2DA 2K01A 1KDBA 3N52A 4CJ2C 4BBSB 1A3UA 3GD7A 5DM73 4DK0A 3K59A 1YNJD 1EEFD 3K5NA 1TWAB 2B8FA 3D8GA 1RKNA 1ILPA 1SXTA 5J1ZA 2WIIB 3M4OB 4F8MA 4KY6A 3C46A 2EYMA 2JA6B 1FR3A 4A3DB 3I4LA 5D3DA 3CQZB 3OOCA 1TWCB 4MHEA 3EVQA 2NVYB 1LTID 3MTSA 1A2UA 3R8BA 3DEOA 1JCKB 3OIPA 1PTOF 1VMCA 5A2QL 4X3TA 1D1IA 2F0WA 2Y0SB 1TU2B 4ZK9B 5EKLA 3P75A 1LACA 2JA8B 2NN6G 3I73A 4KY5A 3DEPA 1F9QA 1QB5D 1U4LA 4Q0FA 4JBWA 2F03A 2ZXRA 5CC4A 3NK9A 4A3EB 4FP5D 4ZYSA 4RFBA 1A6XA 1MSHA 5M3MB 5JVH3 1I3QB 4IZ8A 1TVXA 1B9MA 4C1NK 1TT2A 2J7ZA 4RCOA 2KUMA 4WRDA 3OIQA 4KHVA 5FLXL 1HA5A 2BE5D 1SNPA 5EBDA 3E0JA 1OXVA 4DF7A 1L0XB 2B2TC 2EYOA 4CHTB 3NWSA 2PO4A 2G9DA 1M4VA 4KN7C 1XTCD 4IFDJ 1X3PA 2IPKD 1CQVA 2K1BA 1MD2D 2R7ZB 4M8AA 1H9SA 4DNRB 1CHPD 2D2CC 4K8JA 1Y1VB 3MAQA 4X3KA 5CMDA 2OF1A 4DFAA 2I46A 2QCPX 1GHJA 2RVLA 1OXSC 4CBVA 1QNKA 1OO9B 5A2QE 1VF5C 2IJ0A 1I4PA 4IFDI 2F0QA 3GV6A 2F0PA 3KBXA 2F0MA 3HP3A 1O7YA 5I2YA 1HUNA 1U9RA 4XTCS 1Q1EA 2L11A 1LLRD 2EJGC 5JJZA 4X3UA 4UDUC 2WKCA 2NVXB 5BN5A 2F0KA 3SDZA 2E74C 1Q3LA 4JK1C 2Q8RE 3L9AX 2JEAI 5KNDA 3IL8A 1CZWA 1UUPA 1SMYC 1G2SA 2PZUA 1Q1BA 1STNA 3DHQA 1I4XA 1JB3A 5JAVA 4F88A 4Y7NB 5HURA 1VDZA 1B50A 1A3VA 1SJED 1S5ED 3D4RA 5E4WC 2JA7B 1WTXA 2B2WA 2B2YC 4DNTB 3S2HB 1GOZA 3U9OA 5JEAH 5M3FB 4KKUA 1A2TA 3I72A 3BYYB 1EZ8A 4BY7B 2NN6I 1G91A 4H13C 3IAYA 1SSOA 1CQFA 3AU7A 1LT3D 3OW7A 3PO2B 1EY7A 3ND8A 1EYCA 2MUYA 5EPJA 3S1RB 4QB4A 2YU9B 1F2MA 2Z4IA 3VR2A 1TS5A 3W2DA 1EQTA 1LABA 3CHBD 2NTSA 1STEA 4A93B 2F0LA 3C1FA 3JAML 4QUFA 1J8IA 1LTSD 5M9OA 2I07B 3PUYA 1NUCA 1EIHA 5FO8B 3QB3A 3CRKC 3VA7A 1KAAA 4V0BA 1H9SB 4H44C 1SDFA 3MXNA 4A3KB 2IW3A 5C3EB 1VCIA 4TRDA 2Q8TA 1QILA 5LL6S 1HFNA 5C44B 4B08A 1PRTF 4O1NA 1XXGA 3TDQA 2O5IC 2A6EC 1ET6A 2F0IA 4K6LA 1DOLA 3DWAA 4I7ZC 2RKSA 4IURA 3AB9A 1EY0A 1CTMA 1GXDC 1MI2A 1EU4A 1O80A 4DXFA 3OPOA 2WB1B 5ELBA 1D1KA 2K32A 5DNFA 1PXUA 5M5XB 3GP7A 2IX1A 2K5WA 2AWOA 1LT6D 3NQIA 2MJ8A 3S1NB 1H9MA 1J9OA 4LMQD 5CV8A 5D65A 1CA6A 3S15B 1L0YB 2CVRA 1D5MC 1STAA 1OXUA 1S4ZA 1W6JA 5AFWA 1AP0A 1WD1A 2F3WA 3FPUB 3VYTA 3NSWA 4KJOA 4XIGS 4CGYB 1TY0A 5EPKA 5I9OA 4QIWB 1X32A 4FVMA 3EA6A 1D6EC 4HEDA 5ELDA 1DONA 1H9KA 2FHTA 4EGVA 3BVGA 3GTLB 1RHPA 2EE1A 4R8IA 3PUXA 1EEID 4DA2A 2JE6I 1U4PA 1NSNS 3W3AA 4HCEA 2HUGA 3X3NA 2F3VA 3A7LA 1WTVA 2K5DA 1EWCA 1HCZA 1WTRA 1UAPA 5TSSA 2XWBB 3G6JB 3KK7A 2XIWA 2XNAC 3J7AV 4B9WA 3FKIB 1CHQD 1EZ6A 2BE5C 1I4RA 3KLSX 5IGCA 1Z47A 2CW0C 1SYFA 1K83B 1PTOC 3NBIA 1QCBD 2KOLA 1S5DD 1FYCA 2KVMA 3V96A 2A68D 1B4OA 1SYEA 2RDFA 2ICIA 2RDGA 1TR5A 1IYVA 1PYWD 3BYTB 5K5PA 4DK1A 1OXXK 3C2PA 4IFDG 1BCPB 4IN3A 1JOKA 3BDCA 3RMHA 2AQ3B 4NMZA 5ELFA 1G2TA 1PRTD 3OHXC 3TP7A 2E75C 2J0TD 1DD2A 2QKIC 1BUVT 2AUJD 2B2WC 2DN8A 1GUGA 1B3AA 4C2MB 1AZQA 4KMUC 3HOWB 2A6HD 5C6AA 1HHVA 1EOTA 1O7ZA 3ONAB 1STHA 2K7VA 3O13A 3K5OA 1YNND 2X6GA 2A69D 1Z7TA 4OO1G 2DY8A 1ESRA 3EFXD 3NXWA 3ZYYX 4S3SA 1OXTA 1ILQA 3PV0A 4G57A 2A5HA 2EYFA 4BA1I 4HAEA 2F0GA 2PCFB 1UEAB 1Y69U 1EY6A 5CBAE 2XWJB 4OL7A 2KECA 2K03A 3ITPA 2MP1A 3D3RA 4ZRZA 2EZVA 5I6YA 2B2UA 1SE4A 1EL0A 1E2VA 1HXYD 2JYOA 1SNMA 3S9WA 1TKWB 4ZQ3A 2F1MA 4HN7A 2IX0A 4G7HC 4ME5A 4KKTA 5DAUA 5C4ZA 4TQUS 1LTTD 4XXEA 1PRTC 4E6IA 4Q5VA 5KRUA 4ABNA 5C0XI 2E76C 1RF2D 1ONLA 1EY8A 4I65A 2B39A 1PFNA 4ZUIA 5T1GA 4XDXA 3K6OA 3PIO3 3HS0C 1CI3M 3T56B 2A6ED 2NYZD 5FO9B 3KF8A 4ILWA 4C1NI 5BN4A 1Q8IA 1IKLA 2NTTA 3CRLC 2F0TA 5T1IA 3S17B 1MSGA 3S14B 3R93A 3NTIA 2X6LA 1KABA 3BVZA 3GO5A 3H94A 4HMJA 4XYOA 1RTNA 1LTGD 2NN6H 1U4MA 3SK4A 2X69A 3M85A 2L0CA 2LMCB 1C4QA 3C3LA 5CV6A 1F2ZA 2VB2X 3OSOA 2PQEA 3FPPA 1CZGA 5C4XB 4C3IB 1JE4A 1HQRD 3M3YB 3WDNA 3QG1A 1RDPD 4RH6A 3H91A 4ZKCB 4FXDA 5C5MA 3HOXB 1NR2A 2EOTA 1LT4D 4WORA 5LL6X 2BDOA 1KDCA 2WV6D 1CK1A 2MHVA 4HCSA 4FF1A 3MHBA 4HSPA 5CYUA 5KIXA 3GTGB 3TZUA 2VNUD 1B53A 1BCPD 1QG7A 4NP5A 1G291 3NHHA 4TKOB 1GUTA 4C3JB 3MXUA 2XSCA 1ENCA 1FD7D 3OMCA 3MEHA 4A3MB 3OWFA 1HTPA 3S1QB 3MXGA 2L12A 5EKKA 1V8QA 4M1UB 5A35A 1VMPA 4FF2A 1CA5A 3SK6A 1PZJD 1BR9A 5I4DA 3I90A 4H7BA 1BCPF 3A54A 1Y8NB 3EJIA 4DAYA 3IKJA 1Y8PB 1IKMA 5ELEA 1GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WRD A;  3SXH A;  5ISR A;  5JAV A;  1EY6 A;  4HMJ A;  5HUR A;  5IGC A;  4KHV A;  5C4H A;  4ZUJ A;  4OL7 A;  5CV7 A;  1EQV A;  5CV5 A;  5E1F A;  1SYF A;  3HZX A;  5NUC A;  2LKV A;  1KDA A;  3ITP A;  1SNP A;  3SK4 A;  2PZW A;  2PYK A;  3MZ5 A;  1A3V A;  1EY5 A;  3ERO A;  1IHZ A;  5DEH A;  5E3F A;  4MIU A;  1JOO A;  2EY6 A;  3D6C A;  4HTH A;  5F2D A;  1KDB A;  5C3X A;  4KY6 A;  4LAA A;  4EVO A;  3SR1 A;  3QOL A;  3DMU A;  1A3U A;  4PNY A;  3BDL A;  5CV4 A;  4DF7 A;  4K2L A;  5I6Y A;  1SYE A;  5CV6 A;  3U9O A;  1AEX A;  2RDF A;  1F2Z A;  2SOB A;  5IGB A;  2EYO A;  4K5W A;  4EQP A;  1TR5 A;  3OSO A;  2PQE A;  3ERQ A;  2F0E A;  2RBM A;  1A2T A;  1EY9 A;  4RKB A;  5CV8 A;  1EZ8 A;  5J22 A;  1JOQ A;  5K5P A;  3NQT A;  5KEE A;  2SNM A;  2OEO A;  5IGE A;  3D8G A;  3MXP A;  5IIF A;  1SNM A;  1RKN A;  1STA A;  3D4W A;  2EY2 A;  3R3O A;  2QDB A;  5CR3 A;  3OMG A;  3S9W A;  3V2T A;  1JOK A;  3BDC A;  4ZQ3 A;  2F3W A;  5J1Z A;  1EY7 A;  4KTA A;  5C5M A;  3T16 A;  4DGZ A;  5KYI A;  4NMZ A;  1SNC A;  1EYC A;  3SK8 A;  2M00 A;  1STB A;  4ME5 A;  5C5L A;  4F8M A;  2OXP A;  3T13 A;  2F0V A;  4KJO A;  1EY4 A;  2WAC A;  1STY A;  2EYJ A;  1II3 A;  2ENB A;  2PW5 A;  1KDC A;  2EYM A;  2SNS A;  4R8N A;  4K8J A;  4WOR A;  3TP7 A;  4B9X A;  1JOR A;  4QF4 A;  2F0J A;  2F0S A;  5DAU A;  4QB4 A;  3TP5 A;  2O4X A;  5C4Z A;  3SK5 A;  5I9O A;  5IGG A;  1F2M A;  3NUC A;  1SYB A;  2OF1 A;  3MHB A;  4DFA A;  2F0O A;  4K5V A;  3TME A;  1SYD A;  5KIX A;  1F2Y A;  2KQ3 A;  3LX0 A;  4E6I A;  4KY7 A;  3EVQ A;  2EY5 A;  4J6H A;  5KRU A;  1A2U A;  2F0L A;  5IOD A;  4RKL A;  3H6M A;  4F7X A;  2EYP A;  5IOC A;  5KYL A;  3C1F A;  1SYC A;  4HMI A;  2EXZ A;  4KD3 A;  1A3T A;  4NP5 A;  5CV9 A;  1EY8 A;  2F0N A;  3QOJ A;  4K2K A;  2F0D A;  2F0W A;  4I65 A;  1SND A;  5C6A A;  4EQN A;  4KJN A;  2F0Q A;  3NHH A;  2F0U A;  4ZUI A;  2EYL A;  2F0H A;  2PW7 A;  5M9O A;  4N9P A;  2F0P A;  3E5S A;  5EKL A;  5I9P A;  3P75 A;  2KHS A;  2F0M A;  4QMG A;  5C3W A;  1NUC A;  3D4D A;  3HEJ A;  1ENC A;  3PMF A;  3QB3 A;  3C1E A;  3MEH A;  3OMC A;  5HGT A;  1KAA A;  1U9R A;  1STH A;  3MVV A;  3OWF A;  3P1H A;  2F0F A;  3SHL A;  3TP8 A;  5KGU A;  5EGT A;  4KY5 A;  4NDX A;  1SNQ A;  1NSN S;  3NP8 A;  5EKK A;  5JOB A;  4TRD A;  4NKL A;  4K5X A;  4ODG A;  4EQO A;  1SNO A;  2F3V A;  4IUN A;  3SK6 A;  5CC4 A;  1ENA A;  2F0K A;  3NK9 A;  1TQO A;  4IAL A;  2NUC A;  3RUZ A;  4PMB A;  3VA5 A;  5J39 A;  1EYA A;  4J1M A;  4ID6 A;  4K6D A;  3TP6 A;  2F0T A;  2EY1 A;  5IGF A;  4KV6 A;  4H7B A;  5CGK A;  1EYD A;  4PMC A;  5IGD A;  3NXW A;  2F0I A;  2HQE A;  1SYG A;  3EJI A;  4S3S A;  4B9W A;  4YIJ A;  4N9T A;  5I6W A;  2PZU A;  2RKS A;  4IZ8 A;  1EZ6 A;  1STN A;  2PZT A;  4KD4 A;  3DHQ A;  4DU9 A;  1TT2 A;  1EY0 A;  4G57 A;  4K14 A;  2EYF A;  1KAB A;  1STG A;  2EYH A;  4K8I A;  2F0G A; 
#chains in the Genus database with same CATH topology
 1IXR A;  1K8M A;  4A3B G;  5EQ0 A;  4GKJ L;  4ZUJ A;  1FNU A;  4LFB L;  2YTX A;  2PNR C;  4OX9 Q;  4IOC A;  4L63 B;  2PZW A;  5E3F A;  3ERO A;  1Y8O B;  2J4X A;  2Z6K C;  4L5S A;  4DAM A;  3H3V I;  1SJH D;  3GTQ B;  1SBB B;  2EJM A;  3U9S A;  4C3H B;  1JC7 A;  3HKZ B;  3NTK A;  4P72 A;  3HOX H;  5EAY A;  3TS0 A;  2JN4 A;  2RSO A;  4UAI A;  3X3M A;  1EFI D;  1Q12 A;  5KNC A;  3K8A A;  3UDX A;  2R92 H;  4BY7 H;  5COY A;  3V2T A;  1AN8 A;  2EDG A;  3I91 A;  4PG3 A;  2OTL A;  4HJ7 A;  1XTD A;  1NTG A;  2DJG C;  2WAC A;  1II3 A;  2SNS A;  3S2H H;  1A63 A;  2B63 B;  3SVM A;  3G48 A;  2MNA A;  2JA7 H;  3K80 C;  5IWA Q;  3SK5 A;  1Q86 C;  1K8O A;  3NUC A;  5IT9 c;  1IBK Q;  3M4O H;  2C5C A;  3V05 A;  4K5V A;  1KRS A;  1QUQ B;  1F2Y A;  3LX0 A;  4FF4 A;  4LFB Q;  1YJN A;  4GNX C;  4R4Q A;  2KHJ A;  4F7X A;  2H4O A;  3IRB A;  1JIC A;  3N6R A;  1ICF B;  4LF8 L;  2JK8 A;  3UE1 A;  3GTM H;  2K5Q A;  1XNR Q;  3ULL A;  1FNW A;  1SMX A;  4JV5 Q;  1PYS B;  4N9P A;  3E5S A;  5I9P A;  5C4X G;  3STB C;  4JI0 Q;  1A15 A;  2DNC A;  5M5Y B;  1V1O A;  5EPL A;  3PIO A;  1VQ9 A;  1I6V C;  4A3I B;  4NDX A;  1PDQ A;  2Q2U A;  5JOB A;  3JAM c;  3K5M A;  1X3G A;  1TS3 A;  5CBE E;  3H0G B;  3BVM A;  4BY1 B;  1D8L A;  5FLX c;  2RHQ B;  2RDH A;  4J1M A;  3E6Z X;  3A0J A;  2DJF C;  1JWS D;  4FDB A;  3R2I A;  5CGK A;  1Z6H A;  2ICE C;  1UE5 A;  1BBX C;  2VUM B;  4IPH A;  1UE6 A;  4KD4 A;  2FIN B;  1WFQ A;  2EYH A;  2RHS B;  3MFY A;  3GTO B;  2JXM B;  2A68 C;  1VQJ A;  1PTO B;  4FXK C;  1DM0 B;  1KDA A;  1XWE A;  4DV1 L;  4RHR A;  1J5E L;  4HTH A;  3PUV A;  1GUS A;  4B3T Q;  1VQN A;  4K2L A;  2CW0 D;  5K36 H;  3VR3 A;  1JWM D;  3MA2 B;  3GTP H;  2HHH Q;  1BVS A;  2RBM A;  1HTL D;  1HR0 W;  1DJR D;  4JI4 L;  4R1J A;  2IWH A;  4K0K Q;  3LWE A;  2QF7 A;  2BH8 A;  1YIJ A;  4YCV A;  4RGM A;  4DGZ A;  3KOJ A;  1ENF A;  3PUW A;  2K28 A;  4XQN A;  2M00 A;  1STB A;  4IUU A;  3T13 A;  3P7J A;  5K36 G;  2KA7 A;  3MC0 B;  3NTH A;  4UPA A;  2NVQ B;  4RCN A;  1SYD A;  4JC0 A;  3TZD A;  3OWE B;  1PTO H;  4QY7 A;  1P16 A;  3K81 C;  3PF5 A;  1Y1W B;  3M4Y A;  1ZXT A;  4DAV A;  4KLK A;  2M2L A;  1QJO A;  4K2K A;  2B2Y A;  3Q23 A;  1LO5 D;  3RR5 A;  1RL2 A;  1AW7 A;  1NMG A;  2VY3 A;  4QGU A;  4OO1 H;  1NAP A;  2E8G A;  2PW7 A;  5M3M H;  4C3I G;  4JBK A;  4YHH Q;  1XMQ Q;  2NVT H;  2BOS A;  3I4N H;  3PMF A;  3WOF A;  3P1H A;  1JR0 D;  3SHL A;  4GN3 B;  1X6O A;  3M4P A;  3BG3 A;  3H0G H;  3HOU G;  4DR6 Q;  1BNZ A;  4H0L C;  1E24 A;  3FKI G;  2XRQ D;  1CT1 D;  2Z1C A;  3GTO H;  2BA0 A;  3M4Q A;  2NWG A;  4DUY Q;  4GS3 A;  1N36 Q;  4IAL A;  1NCV A;  4JI1 Q;  2JA8 H;  3I4M G;  1WCM G;  1EWH A;  1DOK A;  1HA6 A;  3CPW A;  1SYG A;  1JB7 A;  3D31 A;  3DUZ A;  4A3J B;  2VQF L;  2A69 C;  1K73 C;  2BH2 A;  3HOW H;  4BXX H;  1LM0 A;  1DGS A;  3PGZ A;  5ELC A;  4KD3 A;  5HGQ A;  3T1Y Q;  4DR7 Q;  1EU3 A;  3FDT A;  5LMN Q;  1XPR A;  3VYU A;  2NVY H;  2EVB A;  3A8K E;  5E1F A;  2EXD A;  1PMR A;  1IHZ A;  3QJY A;  4CKB A;  4X62 L;  4B3S Q;  4UP8 A;  4MIU A;  1VQF A;  2N55 A;  2WFW A;  4LF5 L;  3BDL A;  5CV4 A;  2JA6 H;  2HT1 A;  4OWX B;  3FMC A;  4ZKB B;  3GTM B;  1TS4 A;  4GKJ Q;  4JI7 Q;  2N3S A;  4RKB A;  1X55 A;  2H5X A;  1SE2 A;  2SNM A;  2R92 B;  1UNS A;  3A74 A;  1RJT A;  2WKD A;  4HR7 B;  2EY2 A;  1TWA H;  5CR3 A;  4BXX G;  2R3Z A;  1DOM A;  3CP0 A;  1UE1 A;  5C0X H;  1R4P B;  3T16 A;  2DY7 A;  1VQ8 A;  5JVG 3;  2OXP A;  1EY4 A;  1WVL A;  2EYJ A;  1E0B A;  3TME A;  4A3F G;  3IFT A;  1HNW L;  3GTQ H;  4BBS H;  2F0J A;  5C0X J;  2QEJ C;  5IT9 E;  4JYA L;  2O5J C;  2UXB Q;  5C0X G;  4CDC C;  3J7A F;  5FKA C;  3DXJ C;  4J6H A;  4KKS A;  1B2T A;  4OIJ A;  2ZM6 L;  2EXZ A;  3J81 E;  3U58 A;  2AUK A;  4WFN 3;  2VQE Q;  3GTK H;  4LF5 Q;  3LWU A;  3ULJ A;  2JP1 A;  4L6T B;  5FJ8 G;  3HGB A;  4DV5 L;  4KHP L;  1F2L A;  1NY4 A;  1KNE A;  2K33 A;  5HGT A;  4LK1 C;  4A3F H;  2F0F A;  5JPN C;  2Z0S A;  3GTJ B;  1SAP A;  5EBC A;  2PPB C;  1SNQ A;  3NP8 A;  4LF6 Q;  2K5V A;  4K5X A;  4ZLT F;  5FO7 B;  4IUN A;  4A76 A;  1TQO A;  4JOI C;  3M7G A;  5IYD H;  1EYA A;  5I2X A;  1BOS A;  5DM6 3;  4R4T A;  5C44 G;  4WJ3 M;  2SEB D;  4PZ6 A;  2EY1 A;  3PUZ A;  5M5W B;  1Q7Y C;  2B2T A;  5M3M G;  1BBW A;  4DAP A;  1ZYR D;  4A3L G;  3NBH B;  3HKS A;  1EIY B;  1F9S A;  4GNX B;  5CV5 A;  4X66 L;  3GTJ H;  1TII D;  5JEA G;  4JI6 Q;  4BWG B;  5FOB B;  1EY5 A;  4FO2 A;  2DNE A;  1GHK A;  4BBR B;  5IWA L;  3IFD A;  1C7Y A;  1IBK L;  5C4J H;  3OYY A;  5L37 A;  4EQP A;  3KFU A;  5D14 A;  1OTC A;  2F0E A;  1SE3 A;  4PMW A;  1ML0 D;  1K8A C;  4DPG A;  4JI1 L;  1TWF H;  1N32 L;  1F9P A;  3D4W A;  1FGB D;  3R3O A;  1IL2 A;  3UDI A;  1VF7 A;  5C4X H;  3SK8 A;  1EOV A;  2RQX A;  4C3J G;  1IW7 C;  2F0V A;  1KC8 C;  1E2W A;  2ENB A;  4X3S A;  3BS1 A;  1TWH B;  1VQP A;  3K57 A;  2AQ1 B;  1XYI A;  2FMM A;  1VQO A;  1BCP C;  4CKC A;  4GN5 A;  3RLF A;  5JPM C;  4RMF A;  2K05 A;  1TWF B;  3H6M A;  4RKL A;  4Y7N H;  2AMC B;  1C0A A;  2K75 A;  2G5D A;  1SYC A;  2YTV A;  1QNU A;  4FNF A;  1MBY A;  2D62 A;  2V4D A;  4IUQ A;  2A19 A;  1N8R C;  4KJN A;  1KXL A;  2E2D C;  3KLR A;  3S17 H;  4U68 A;  3VYS A;  2B8G A;  3HOV G;  3RLO A;  3E0E A;  3TP8 A;  4X65 L;  5C44 H;  2HCC A;  2KCN A;  3CCM A;  1QVG A;  2G9H D;  3A55 A;  4DV0 Q;  1SFO B;  3CU7 A;  4KN4 C;  4ODG A;  2XRS D;  3RUZ A;  4RGO S;  4ZAI A;  4YY3 Q;  4RHS A;  1VS0 A;  3NWT A;  5E4X A;  5IE8 A;  4FYD A;  1K3R A;  3J81 j;  4DR2 L;  4BA2 I;  2CWA A;  4YIJ A;  5FLM G;  3K58 A;  4DU9 A;  2PZT A;  3HG9 A;  4GOP B;  2UXC Q;  1Y1W G;  2UU9 L;  1STG A;  1PH7 A;  4L5T A;  1YBY A;  1K8G A;  1WTP A;  1K0S A;  3BJU A;  1PZI D;  1RD9 D;  5E7N A;  1ZKO A;  2R93 G;  4G7O C;  3KJP A;  1I4H A;  4BS9 A;  2ZT9 C;  1QE6 A;  2GN5 A;  3HZX A;  5NUC A;  1CKN A;  1ZYR C;  4J8Q A;  5IP9 G;  1PYB A;  1CUK A;  5FLX E;  2EY6 A;  4RGT A;  3ER0 A;  3E9I A;  1PFM A;  2NVT B;  2VQF Q;  1KIX A;  3K0X A;  1E1T A;  4MNO A;  2JA7 G;  4G7Z C;  3HOY B;  2FMC A;  4UP9 A;  2UUC L;  2R7Z H;  3L7Z C;  4RWS C;  3HRZ C;  4IFD H;  2D9U A;  5LMN L;  4IUT A;  2HD3 A;  3GTK B;  1R9T H;  1JOQ A;  1PLF A;  4MTN A;  3T4A C;  3Q0A A;  2UXD L;  3A56 A;  1W6K A;  1Y1W H;  4JG2 A;  2C9O A;  1RCV D;  2QDB A;  3HOZ B;  1HFG A;  3LNN A;  1FJG Q;  3PO3 H;  2KBN A;  1BQQ T;  1U4R A;  2KCC A;  3GV3 A;  4NXN Q;  1NMF A;  3T53 B;  2LFN A;  3FVQ A;  5JJK A;  4DV5 Q;  4G4K A;  4IUP A;  2E2J H;  1GVP A;  1B9N A;  4EX5 A;  4ME3 A;  1SYB A;  4A3B B;  3RLN A;  4DUZ L;  4AYB G;  1ZEQ X;  3CCL A;  4GZY C;  4PV1 C;  1ET9 A;  3J7A 5;  2JQO A;  2O2L D;  4HMI A;  3K5L A;  4IOA A;  2CHB D;  3AFP A;  1JMC A;  3HOV H;  4NPS A;  4LW1 A;  1I94 L;  3ULP A;  3I8Z A;  1AFP A;  1XPU A;  3J80 i;  4O42 A;  4OHJ A;  5M3F G;  4A75 A;  4Y52 H;  1YNN C;  4NB3 A;  2B3G A;  2IT1 A;  3A8I E;  3MVV A;  1YVC A;  1B7Y B;  1M90 C;  1S5B D;  3I4M H;  1JE5 A;  1CKO A;  3KBG A;  5COR A;  1ICW A;  4NKL A;  1IL8 A;  2NB0 A;  2WAQ B;  4EQO A;  1SNO A;  4JBJ A;  4I7A A;  3TBI B;  4PMB A;  2F52 A;  2HDL A;  4FXG C;  2UXB L;  3PSI A;  3I70 A;  3K7A B;  3CAM A;  4KV6 A;  4JCV E;  4PQX A;  2EPB A;  2VB3 X;  2HQE A;  2ES2 A;  3CW2 C;  4N9T A;  4QL5 A;  1PTO D;  4OGQ C;  4JI6 L;  2VQE L;  2RSN A;  2XGT A;  1CKN B;  1WYD A;  1H9R A;  5JJI A;  2B29 A;  5CV7 A;  1B8A A;  2LSS A;  1WCM B;  5EKI A;  3I4M B;  1KLG D;  3J7Y W;  3MZ5 A;  1T5E A;  2A8V A;  2M9V A;  2F3I A;  3WOE A;  2UUB L;  1S5C D;  4JYA Q;  4P73 A;  3HOX G;  3TN2 A;  1P8L A;  2KEE A;  4EVO A;  4PNY A;  4V19 0;  4A3D H;  3G4S A;  1Y14 B;  5GRO A;  2ID0 A;  1G6Z A;  1J5E Q;  4KK7 A;  3QO2 A;  1F77 A;  3RNU A;  3P20 A;  3B6Y A;  2ZM6 Q;  1B1Z A;  2OEO A;  2MGS A;  3NBH A;  4C2M H;  5IIF A;  2NZH A;  1GUW A;  1PFB A;  1NR4 A;  3T1H L;  3OMG A;  3GQB A;  1LTR D;  4HJA A;  4KTA A;  3UDG A;  4EQ5 A;  5FJ8 H;  4A3B H;  1CFM A;  1TS2 A;  5C5L A;  1D2B A;  5IOC A;  4R8N A;  4DV4 Q;  2PW5 A;  1HR0 Q;  4B9X A;  2R61 A;  4RA8 A;  2B2V A;  2E2J B;  4QF4 A;  2B63 H;  2F0S A;  2QIL A;  2N88 A;  5D3I B;  4DV3 L;  1IZ6 A;  3M7N A;  1FGU A;  1D5X C;  3J80 E;  4OEL B;  4FF3 A;  3LGJ A;  4CJ1 B;  2F4I A;  1YIT A;  3U50 C;  1HUM A;  4X64 Q;  1NE3 A;  3DWQ A;  2XN9 C;  2C35 B;  2RA4 A;  4GLX A;  2F0N A;  2MO1 A;  3QOJ A;  4HJ9 A;  4LUZ A;  2F0D A;  4JI2 Q;  3GTP B;  4LF4 Q;  1HQM C;  3Q6S A;  3FKI H;  1SND A;  2LY7 A;  4HSV A;  2NBF A;  4IJL A;  1HJP A;  2F0H A;  2IHF A;  4RAU C;  2Z6K A;  4ZCK A;  2AQ2 B;  2E2H B;  3FRP B;  2A6H C;  1FL0 A;  4GLV B;  3JAM E;  3DM1 A;  1DYQ A;  3VR6 A;  3A7A B;  1SMY D;  5LMU Q;  5BN3 A;  3RZO B;  1O7I A;  2E2I B;  2CQA A;  2TSS A;  3BZC A;  2NUC A;  1EIG A;  3I3C A;  5J39 A;  3MFG A;  4QQB X;  3PIP 3;  3G6E A;  1V1P A;  1HZB A;  4UY8 C;  4Z9C B;  2MQH A;  1HNZ L;  5IGD A;  3CCU A;  1TY2 A;  4DK3 C;  3T51 B;  4AQY Q;  2Q8I B;  1IBL L;  1XNR L;  1O78 A;  2DUD A;  4BY1 H;  4K14 A;  1GD7 A;  4EQN A;  5AJ3 L;  1Q8K A;  1X3F A;  2XTI A;  3SXH A;  1K9M C;  1WTO A;  5C4H A;  4GNX A;  4C56 C;  3NPP A;  2LKV A;  4PZ7 A;  4JI5 Q;  3TSS A;  3KUP A;  2PYK A;  1X3Q A;  3J7Z C;  1GM5 A;  1Q46 A;  3R2T A;  4GN4 B;  4X6A H;  4C3J H;  3DMU A;  3UDF A;  4OO1 I;  2R7F A;  3TRE A;  4AYB B;  1AEX A;  1KTK A;  4LJZ C;  3CME A;  3GTL H;  4K5W A;  1I4G A;  4JPB W;  4OIK A;  4B3M Q;  3SE0 A;  2ASB A;  2L9H A;  1B70 B;  2A73 B;  4AH6 A;  3S2D B;  3U4V A;  2I5M X;  2QA4 A;  1PH2 A;  5KYI A;  1PH4 A;  2IY5 B;  1HRJ A;  1YNJ C;  3F2C A;  3ND9 A;  4DR1 L;  1YI2 A;  3ERS X;  2OT2 A;  3RD4 A;  3KJO A;  1TWH H;  1EYG A;  4CKE A;  3Q8D A;  2BDN A;  2AHO B;  4P2C B;  4B3R Q;  4XYQ A;  5M5X H;  3G7L A;  4DV0 L;  1I94 Q;  2KQ3 A;  2K04 A;  4KY7 A;  2TMP A;  1Q90 A;  1BDO A;  4XT3 B;  3F2D A;  1V1Q A;  5KYL A;  4U67 3;  2EYP A;  4LFA Q;  4GKK L;  2GA4 B;  2HDM A;  3UI2 A;  3QIA A;  2ZXO A;  4OEM B;  4ULL A;  4IUV A;  1C48 A;  5EJW A;  4LNQ A;  3S1N H;  3SEB A;  4C3H H;  1TXY A;  2FJ2 A;  4A3C H;  5C4J B;  1LV9 A;  5FLM H;  4IPC A;  5IYB H;  1ASY A;  2KJX A;  2IX3 A;  2B2U C;  2QDL A;  1T5X D;  4QMG A;  3HEJ A;  3KLS A;  1CKM A;  2QEX A;  2H1E A;  4CJ0 B;  4C3H G;  3SGI A;  4NXN L;  1LTB D;  3S1M B;  5C3E H;  4LF6 L;  1ENA A;  3MWY W;  3PF4 A;  4KHZ A;  2JEB I;  4YCU A;  4IQZ A;  1TWG B;  4DR3 Q;  1BXT A;  1LT5 D;  4A3G H;  5I6W A;  4JV5 L;  1V43 A;  1Q82 C;  2UXD Q;  5BR8 L;  3HOV B;  5IGB A;  1HPC A;  1B44 D;  2CKZ B;  3BZD B;  4MN3 A;  1JJC B;  3RZD B;  2SDF A;  1I4Q A;  4KI0 A;  4IPG A;  1EQV A;  1ESF A;  4DV6 Q;  4A3F B;  3S16 H;  1L2F A;  3D6C A;  1JOO A;  4AIM A;  2FXQ A;  4QCL A;  5G3L D;  3QOL A;  1RTO A;  1YJW A;  1H9J A;  2SOB A;  1F9R A;  2I5L X;  3J80 L;  4R4I A;  3J80 c;  1E2Z A;  3Q24 A;  5IT9 L;  1AZP A;  5J22 A;  3PO2 H;  3PO3 B;  1PV4 A;  3NQT A;  1R4Q B;  2KED A;  2RCN A;  1G8Z D;  5KEE A;  2JA5 B;  1N33 L;  1SLJ A;  4TVA B;  2HQL A;  2JA5 H;  4K0K L;  1R9T B;  2JSO A;  5DLQ E;  2NZ1 D;  2EIF A;  5M3F H;  1SNC A;  3DWP A;  4DV3 Q;  4DV7 L;  1HZA A;  1STY A;  5IP7 H;  2HCI A;  5G3L F;  1JOR A;  1IYU A;  1PVO A;  2MPM A;  3TP5 A;  3EQL C;  3S16 B;  2L5T A;  4X62 Q;  1HNX L;  2F0O A;  1PA6 A;  2EY5 A;  4JI2 L;  2YYZ A;  3OTO L;  5IOD A;  1QWY A;  2E5L L;  3NE5 B;  2CH4 A;  4JI7 L;  5CV9 A;  3ZJY C;  2OWO A;  2Z9H A;  3VDY A;  1YHB A;  4L8J A;  2F0U A;  1V9P A;  2EYL A;  2EJF C;  5JEA J;  3FEW X;  3A5U A;  4AQY L;  2KHS A;  1X3E A;  2L15 A;  1I50 B;  5C3W A;  3D4D A;  1FVI A;  4BY7 G;  3C1E A;  1I5F A;  2B2V C;  1AE3 A;  1YHQ A;  3EIV A;  4RG1 A;  3H09 A;  1WTW A;  3URY A;  3HOU B;  1SFO H;  1H95 A;  2D5D A;  2Z4H A;  2FFK B;  3AEV A;  1JQY D;  2R6G A;  4K6D A;  3TP6 A;  2UUA L;  4CDF C;  5IGF A;  4PMC A;  1QOH A;  4JI3 L;  1Z9F A;  2K4K A;  1PRT B;  2PI2 A;  1BO0 A;  3K0Y A;  4JVZ A;  5LMU L;  1PH1 A;  2L1B A;  3L3O C;  4K8I A;  3CC7 A;  5ISR A;  4RGN A;  3CD6 A;  1AE2 A;  4DR6 L;  3HFZ B;  4LFC L;  1M1K C;  1DZ1 A;  3I4N B;  1KNA A;  1WI5 A;  2LXJ A;  5C3X A;  4LAA A;  2LS0 1;  3SR1 A;  1JWU D;  1L0W A;  1CM9 A;  3AQQ A;  3ERQ A;  1EY9 A;  3W1G A;  4XQQ A;  3S2D H;  2Z8L A;  4DR5 L;  5IGE A;  3MXP A;  2CCZ A;  5KNB A;  4NW2 A;  2QW7 A;  4QJF A;  2BCO A;  1EQR A;  2ALY B;  2BA1 A;  3BDO A;  4HJ8 A;  2ZXP A;  1WTH A;  3CXC A;  4UHV A;  5FK9 C;  1GJX A;  1DCZ A;  4BBR H;  2PMZ B;  5IGG A;  2O4X A;  2ZJQ A;  1RIP A;  4R9W A;  1IW7 D;  4JI5 L;  2IL8 A;  2Y0S E;  2Z6B A;  1PZK D;  1XX8 A;  4O2D A;  1GUO A;  1SRO A;  4TSS A;  2WP8 J;  2L55 A;  1A3T A;  2R7Z G;  3J81 c;  2QGQ A;  1BF4 A;  3J81 L;  1O7L A;  4A3G B;  1LTA D;  1I3Q H;  4XQJ A;  2K5N A;  3D6W A;  4WJW A;  1TWG H;  1T9H A;  3CKI B;  1SEB D;  4XT1 B;  3VYR A;  4DN4 M;  1VQ7 A;  1I6H B;  5LHY 1;  1K83 H;  2L4N A;  1S5F D;  3F2U A;  4F87 A;  5KGU A;  5EGT A;  2XVS A;  3A8J E;  1VQG A;  2E2I H;  3K7U C;  4GLA C;  3RZO H;  1KLU D;  1PHJ A;  1MGS A;  3F1Z A;  2VL6 A;  3CCV A;  4DUY L;  3VA5 A;  1W2B A;  2E2H H;  3AMU A;  1V1P B;  4ID6 A;  2VUM H;  1JJ2 A;  3Q22 A;  1EYD A;  3H3V C;  1FNV A;  1KQS A;  3VR5 A;  2AWN A;  1C8C A;  1D5Z C;  2A74 C;  1K3B C;  1N34 Q;  1DXM A;  4A93 G;  4DV2 L;  4O0A A;  2VXW A;  4QUC A;  3QWN A;  2WIN B;  3PQI A;  4H02 A;  1WD0 A;  3VR4 A;  1CSP A;  1S40 A;  1IBM L;  1X56 A;  4DXG A;  1M8A A;  2K14 A;  4DR7 L;  1TWC H;  1WTQ A;  2R93 B;  1ROD A;  5DEH A;  2K6A A;  4CDD C;  5F2D A;  2K01 A;  1KDB A;  3N52 A;  4CJ2 C;  2OTJ A;  5J3B A;  4BBS B;  4APV A;  1A3U A;  1QVC A;  1J6Q A;  3GD7 A;  3I55 A;  5DM7 3;  4DK0 A;  5LMN W;  3K59 A;  1YNX A;  2JA8 G;  1YNJ D;  1EEF D;  3K5N A;  1TWA B;  2B8F A;  3RN2 A;  3D8G A;  1RKN A;  4A3L H;  1ILP A;  2UXC L;  1SXT A;  1N32 Q;  5J1Z A;  3HKZ E;  2WII B;  5IYB G;  3M4O B;  4F8M A;  4KY6 A;  2GVB A;  3C46 A;  2EYM A;  2JA6 B;  1FR3 A;  4A3D B;  2P5Z X;  4A3M G;  3I4L A;  5D3D A;  3CQZ B;  3OOC A;  3NEL A;  1TWC B;  2R93 H;  4MHE A;  3EVQ A;  4LFC Q;  2NVY B;  1KD1 C;  1LTI D;  3MTS A;  1A2U A;  1WJJ A;  3R8B A;  3DEO A;  1JCK B;  3OIP A;  1PTO F;  1VMC A;  2K52 A;  5A2Q L;  4X3T A;  3PIP A;  1D1I A;  2F0W A;  1VQH A;  1EUJ A;  2Y0S B;  1TU2 B;  4ZK9 B;  5EKL A;  3P75 A;  3K7A H;  1LAC A;  2JA8 B;  4LF7 Q;  5IP7 G;  2NN6 G;  3I73 A;  4P74 A;  4KY5 A;  3DEP A;  1F9Q A;  1QB5 D;  1U4L A;  4Q0F A;  4OWW B;  4JBW A;  2F03 A;  2ZXR A;  2AKW B;  5CC4 A;  3NK9 A;  4A3G G;  4A3E B;  4JI3 Q;  3I56 A;  3CCQ A;  2CWP A;  1G51 A;  4FP5 D;  2CFM A;  4ZYS A;  4RFB A;  1MJC A;  4YY3 L;  1A6X A;  1MSH A;  5M3M B;  5JVH 3;  3TEH B;  1I3Q B;  3UE0 A;  4A3I G;  4IZ8 A;  1B9M A;  1TVX A;  4C1N K;  3CCE A;  1TT2 A;  2A1A A;  1N9W A;  2R92 G;  4DR5 Q;  1YJ9 A;  2J7Z A;  4RCO A;  2KUM A;  4WRD A;  3OIQ A;  3AFQ A;  3H15 A;  4KHV A;  4JOI A;  2MFI A;  5FLX L;  1HA5 A;  2CQO A;  1YZ6 A;  2BE5 D;  1SNP A;  5EBD A;  3E0J A;  3ICE A;  2NVQ H;  1OXV A;  4B3T L;  4DF7 A;  1L0X B;  2B2T C;  4YWK A;  1VQ5 A;  1QUQ A;  1X54 A;  2EYO A;  4CHT B;  3NWS A;  2PO4 A;  2G9D A;  3WWV A;  1W3S A;  1M4V A;  4KN7 C;  1XTC D;  3I4N G;  4IFD J;  2UU9 Q;  2K5H A;  1NBW A;  1X3P A;  2IPK D;  1CQV A;  2K1B A;  1MD2 D;  1UEB A;  1HZ9 A;  2R7Z B;  4M8A A;  4A4I A;  2ATW A;  3H3V H;  1H9S A;  4DNR B;  1SE8 A;  1QVF A;  1CHP D;  2D2C C;  4K8J A;  1Y1V B;  3S1R H;  4DNI A;  3MAQ A;  4X3K A;  5CMD A;  2OF1 A;  2Q2T A;  1K0R A;  4DFA A;  2I46 A;  3EN2 A;  2QCP X;  1GHJ A;  2RVL A;  1OXS C;  4CBV A;  3NEM A;  4LUO A;  3D0F A;  1LYL A;  1QNK A;  1OO9 B;  3FP9 A;  5A2Q E;  1NJI C;  1VF5 C;  2IJ0 A;  1I4P A;  4IFD I;  1QZH A;  4JW0 A;  5IYC H;  2F0Q A;  3GV6 A;  1HNX Q;  2F0P A;  1ASZ A;  3KBX A;  2F0M A;  3HP3 A;  3CC4 A;  1O7Y A;  1MHW C;  4DAY B;  5I2Y A;  1U9R A;  4XTC S;  1HUN A;  1E22 A;  1Q1E A;  2L11 A;  2ZTE A;  1LLR D;  2EJG C;  5JJZ A;  4YWM A;  4X3U A;  4UDU C;  2N8N A;  2WKC A;  2NVX B;  5BN5 A;  4A3I H;  2F0K A;  2E74 C;  3SDZ A;  1Q3L A;  4JK1 C;  2Q8R E;  3L9A X;  2JEA I;  5KND A;  3IL8 A;  1CZW A;  1UUP A;  2F4V L;  1SMY C;  1G2S A;  1NNX A;  4YWL A;  2WB1 E;  3MXN B;  4HJ5 A;  5GAD C;  1L1O C;  2PZU A;  4LF4 L;  1Q1B A;  3EBE A;  1STN A;  3DHQ A;  1I4X A;  1YEZ A;  1JB3 A;  2WB1 G;  3GDE A;  5JAV A;  4F88 A;  4Y7N B;  5HUR A;  4OX9 L;  4X65 Q;  1VDZ A;  3KF6 A;  1B50 A;  1A3V A;  1HH2 P;  4A3D G;  3CPF A;  1SJE D;  1S5E D;  3D4R A;  5E4W C;  1HZC A;  2JA7 B;  2NZO A;  2RCF A;  1WTX A;  2B2W A;  2B2Y C;  1XJV A;  2I5H A;  4DNT B;  4A3J G;  2UUB Q;  3S2H B;  1GOZ A;  1X65 A;  3U9O A;  1XMO L;  5C3E G;  5JEA H;  5M3F B;  1SN8 A;  4KKU A;  1A2T A;  1VQD A;  3I72 A;  3BYY B;  1EZ8 A;  1PH9 A;  4BY7 B;  2GVA A;  1SRU A;  2NN6 I;  1G91 A;  3HOZ H;  4H13 C;  3IAY A;  1SSO A;  1CQF A;  5ELO A;  4GOP A;  3AU7 A;  1LT3 D;  3OW7 A;  1IBL Q;  4A93 H;  3I7F A;  3PO2 B;  2KHI A;  3RN5 A;  1EY7 A;  1EWI A;  2PNH A;  3ND8 A;  1EYC A;  4OON A;  2MUY A;  5IYC G;  5EPJ A;  2YU9 H;  3S1R B;  2V1C C;  4QB4 A;  2YU9 B;  4DV7 Q;  1F2M A;  2R7D A;  2Z4I A;  2VS1 A;  3VR2 A;  1TS5 A;  3W2D A;  1EQT A;  1LAB A;  1EFW A;  3CHB D;  2NTS A;  1STE A;  1VQL A;  4A93 B;  2F0L A;  3C1F A;  3JAM L;  4QUF A;  1J8I A;  4X64 L;  1E7Z A;  3CMA A;  4HIK A;  1LTS D;  2VW9 A;  4YCW A;  4L5R C;  5M9O A;  5M5W H;  2I07 B;  2WAQ E;  3PUY A;  4OXP A;  1E3P A;  1NUC A;  2CH4 W;  2Q2H A;  3QB3 A;  3CRK C;  5FO8 B;  3PO3 G;  3VA7 A;  1EIH A;  1KAA A;  4V0B A;  1KHI A;  1H9S B;  4H44 C;  1SDF A;  3MXN A;  4A3K B;  2IW3 A;  5C3E B;  1VCI A;  4MZ9 A;  1N36 L;  4TRD A;  2Q8T A;  3S1M H;  1QIL A;  2JA5 G;  5LL6 S;  4B3R L;  1HFN A;  4DR4 L;  2KCM A;  5C44 B;  2KCT A;  4B08 A;  1PRT F;  4O1N A;  1XXG A;  3TDQ A;  2HHH L;  1QZG A;  1LTL A;  2O5I C;  2A6E C;  1ET6 A;  4LF7 L;  3HOW G;  2ZJR A;  2F0I A;  4K6L A;  1DOL A;  3DWA A;  4I7Z C;  4IUR A;  2RKS A;  2EQS A;  3AB9 A;  1EY0 A;  1CTM A;  4R4O A;  1KRT A;  1GXD C;  1MI2 A;  1EU4 A;  1O80 A;  4DXF A;  3OPO A;  1PH8 A;  2WB1 B;  5ELB A;  4X66 Q;  1WOC A;  1XPO A;  1D1K A;  2OQ0 A;  2K32 A;  1MKH A;  1PXU A;  5DNF A;  3GP7 A;  5M5X B;  2JA6 G;  2IX1 A;  3TS2 A;  1B3Q A;  2K5W A;  2AWO A;  3OW2 A;  1LT6 D;  3J81 i;  3NQI A;  4BBR G;  4HIO A;  4DV4 L;  2MJ8 A;  3S1N B;  5IY0 A;  1H9M A;  1J9O A;  1IBM Q;  2OCE A;  4LMQ D;  5CV8 A;  5D65 A;  1CA6 A;  3S15 B;  1L0Y B;  2CVR A;  1D5M C;  1STA A;  4BY1 G;  1OXU A;  1S4Z A;  1W6J A;  5AFW A;  1AP0 A;  1UE7 A;  1WD1 A;  4NXM L;  2F3W A;  3FPU B;  3VYT A;  1N33 Q;  4C3I H;  3NSW A;  2ZTC A;  4KJO A;  4XIG S;  3CQZ H;  4CGY B;  3DLL A;  1Y1V H;  1HR0 L;  4DR1 Q;  1TY0 A;  5EPK A;  5I9O A;  4QIW B;  1X32 A;  4FVM A;  2B63 G;  3EA6 A;  3DM3 A;  1VQC A;  3CCS A;  1D6E C;  4HED A;  5ELD A;  2OQK A;  1DON A;  1H9K A;  2MO0 A;  1GKH A;  1VQB A;  2FHT A;  4EGV A;  1U0L A;  3BVG A;  3CCJ A;  1JJG A;  3M9B A;  1PH6 A;  1PH5 A;  3GTL B;  1RHP A;  2EE1 A;  2PI2 E;  3HKZ G;  2I0Q A;  2D0P A;  3S14 H;  4R8I A;  3PUX A;  1EEI D;  4DA2 A;  2JE6 I;  1U4P A;  1YHA A;  4MTK A;  1NSN S;  3W3A A;  4HCE A;  2HUG A;  3STB D;  3I4O A;  3X3N A;  5AJ3 Q;  2F3V A;  3A7L A;  3KYH C;  1WTV A;  2K5D A;  1EWC A;  1HCZ A;  1WTR A;  1UAP A;  5TSS A;  2UUC Q;  2XWB B;  2PQA A;  3G6J B;  3KK7 A;  2XIW A;  2UUA Q;  1BKB A;  1MIU A;  2XNA C;  3J7A V;  4B9W A;  3FKI B;  1CHQ D;  1EZ6 A;  2BE5 C;  3L2P A;  1K28 A;  2HIX A;  1I4R A;  3KLS X;  5IGC A;  1Z47 A;  2CW0 C;  3AYH B;  1SYF A;  2VZA A;  1K83 B;  1PTO C;  3NBI A;  1QCB D;  2KOL A;  4A3E G;  1S5D D;  1FYC A;  2KVM A;  1D7Q A;  3V96 A;  1VQI A;  4DV6 L;  1EQQ A;  2A68 D;  1B4O A;  1SYE A;  2RDF A;  2ICI A;  2RDG A;  1TR5 A;  2ZTD A;  4JI8 L;  2JA9 A;  1LUZ A;  1IYV A;  1PYW D;  3BYT B;  5K5P A;  3JC6 6;  2WAQ G;  4DK1 A;  3TQY A;  1OXX K;  2HIV A;  3C2P A;  1BCP B;  4IFD G;  4IN3 A;  2Y0S G;  1JOK A;  3BDC A;  3RMH A;  2AQ3 B;  4NMZ A;  5ELF A;  1G2T A;  1PRT D;  3OHX C;  4LUV A;  1XMO Q;  3TP7 A;  2D0O A;  2E75 C;  1A8V A;  2J0T D;  3G71 A;  1DD2 A;  2QKI C;  1SR3 A;  1BUV T;  2AUJ D;  1UWV A;  3I2Z A;  2B2W C;  1PFS A;  2DN8 A;  4J15 A;  1GUG A;  1B3A A;  3KDF B;  1WCM H;  5H1S E;  4C2M B;  4DKA C;  1AZQ A;  3OTO Q;  1Q81 C;  4QIW E;  4B3M L;  2E5L Q;  4KMU C;  3HOW B;  4A3J H;  2A6H D;  4DK6 C;  5C6A A;  4KHP Q;  1HHV A;  1EOT A;  1O7Z A;  2K50 A;  4P75 A;  4N8F A;  3ONA B;  1STH A;  4JBM A;  2K7V A;  3O13 A;  4NXM Q;  3E3X A;  3K5O A;  2YTY A;  3CCR A;  3KDF A;  5IP9 H;  1YNN D;  2X6G A;  5GAG C;  3W5O A;  4LF9 Q;  2PQA B;  3CC2 A;  2A69 D;  2JJQ A;  1C9O A;  1Z7T A;  4OO1 G;  1KAW A;  2DY8 A;  4OWT B;  4HID A;  1S72 A;  1ESR A;  1A62 A;  3EFX D;  3NXW A;  4IPD A;  3ZYY X;  4S3S A;  5IYD G;  4JI0 L;  1OXT A;  1ILQ A;  3PV0 A;  4G57 A;  2A5H A;  2EYF A;  4BA1 I;  4HAE A;  2F0G A;  2PCF B;  1UEA B;  1Y69 U;  3KF6 B;  1EY6 A;  5CBA E;  3NEN A;  2XWJ B;  4OL7 A;  2KEC A;  2K03 A;  3ITP A;  5GAE C;  1I6H H;  2MP1 A;  3D3R A;  2DGY A;  3FHW A;  4ZRZ A;  2EZV A;  5I6Y A;  4IJH A;  5GQO A;  2B2U A;  1SE4 A;  4DR4 Q;  1EL0 A;  1E2V A;  1HXY D;  4LF9 L;  2JYO A;  4LWC A;  1SNM A;  4CDE C;  3S9W A;  5BR8 Q;  1TKW B;  4ZQ3 A;  4PZ8 A;  2F1M A;  4HN7 A;  2IX0 A;  4G7H C;  5GAH C;  4ME5 A;  1PH3 A;  3HOY H;  4KKT A;  5DAU A;  5C4Z A;  4IO9 A;  2KEN A;  4TQU S;  1LTT D;  4XXE A;  1BBU A;  1PRT C;  4E6I A;  1L1O A;  4GOP C;  4Q5V A;  5KRU A;  4ABN A;  5C0X I;  2E76 C;  3L0O A;  1RF2 D;  1MJE A;  1ONL A;  2ZJP A;  1EY8 A;  1G6P A;  1L1O B;  4I65 A;  2B39 A;  1PFN A;  4ZUI A;  5T1G A;  4XDX A;  2N49 A;  4LF8 Q;  3E9H A;  3K6O A;  4DV1 Q;  2Q2I A;  3PIO 3;  3HS0 C;  1CI3 M;  4A3C G;  3T56 B;  4P71 A;  3CF5 A;  2IHE A;  3RZD H;  2A6E D;  2NYZ D;  5FO9 B;  3KF8 A;  1XNQ L;  4ILW A;  1EIF A;  4C1N I;  5BN4 A;  1Q8I A;  3S1Q H;  1IKL A;  2N78 A;  2NTT A;  3PCO B;  2RF4 A;  4A3M H;  5M5Y H;  3CRL C;  1GO3 E;  2F0T A;  5T1I A;  3S17 B;  1MSG A;  3S14 B;  3KF8 B;  3R93 A;  3W1B A;  1VQA A;  4POF A;  4A3K G;  1VQ4 A;  3NTI A;  2X6L A;  1KAB A;  4WJ4 A;  3BVZ A;  4ALP A;  2NVX H;  3GO5 A;  4HIM A;  3H94 A;  3HOZ G;  1X9N A;  4HMJ A;  4XYO A;  1RTN A;  3H0G G;  3HOU H;  1LTG D;  2NN6 H;  3GTG H;  1VQ6 A;  1U4M A;  4UP7 A;  3BZK A;  3SK4 A;  2LXK A;  2YV5 A;  1Y1V G;  2X69 A;  4BBS G;  3TRZ A;  5HY6 A;  1JT8 A;  3M85 A;  1U5K A;  1I50 H;  2L0C A;  3HOY G;  4DUZ Q;  5ELN A;  2LMC B;  1C4Q A;  3C3L A;  5CV6 A;  1F2Z A;  2VB2 X;  3OSO A;  2PQE A;  3FPP A;  1CZG A;  1HNW Q;  4LFA L;  5C4X B;  4C3I B;  1E1O A;  1XNQ Q;  1JE4 A;  1HQR D;  1FJG L;  3M3Y B;  1S3O A;  3WDN A;  3QG1 A;  1RDP D;  1N34 L;  3T1Y L;  2PMZ E;  3M3Y H;  4RH6 A;  4AYB E;  3H91 A;  4ZKC B;  3S15 H;  3S24 A;  4DV2 Q;  4FXD A;  5C5M A;  3HOX B;  1NR2 A;  3F2B A;  3PO2 G;  5JJL A;  2EOT A;  1LT4 D;  4WOR A;  5LL6 X;  2BDO A;  1KDC A;  2WV6 D;  1CK1 A;  2MHV A;  4HCS A;  4FF1 A;  1VQM A;  3MHB A;  4HSP A;  5CYU A;  5KIX A;  3GTG B;  3TZU A;  2VNU D;  4GKK Q;  1B53 A;  1BCP D;  1QG7 A;  4NP5 A;  3U4Z A;  1G29 1;  3NHH A;  1AH9 A;  4TKO B;  3QR8 A;  4N8X 1;  1A0I A;  1GUT A;  3MXU A;  4C3J B;  2XSC A;  1ENC A;  4B3S L;  1FD7 D;  3OMC A;  3MEH A;  4R4C A;  4A3M B;  3OWF A;  1HTP A;  3S1Q B;  3MXG A;  3A5Z B;  2L12 A;  5EKK A;  1V8Q A;  1IYJ B;  4M1U B;  5A35 A;  4POG A;  1VMP A;  4FF2 A;  1CSQ A;  1CA5 A;  3SK6 A;  4A3K H;  4JI4 Q;  1PZJ D;  1BR9 A;  4DR2 Q;  5I4D A;  1HNZ Q;  1VQE A;  3I90 A;  4L5Q A;  3F8T A;  4DR3 L;  4H7B A;  3BU2 A;  1BCP F;  3A54 A;  4JI8 Q;  2VUM G;  2F4V Q;  1Y8N B;  3EJI A;  3MEF A;  4YHH L;  4DAY A;  1XMQ L;  3T1H Q;  1VQK A;  3IKJ A;  1KL9 A;  1Y8P B;  3KLW A;  3JAM i;  4A3E H;  1IKM A;  5ELE A;  1GUN A; 
#chains in the Genus database with same CATH homology
 1K8M A;  5EQ0 A;  4ZUJ A;  1FNU A;  2PNR C;  4L63 B;  2PZW A;  5E3F A;  3ERO A;  1Y8O B;  2J4X A;  1SJH D;  3GTQ B;  1SBB B;  2EJM A;  3U9S A;  4C3H B;  1JC7 A;  3HKZ B;  3NTK A;  2RSO A;  4UAI A;  3X3M A;  1EFI D;  1Q12 A;  5KNC A;  5COY A;  3V2T A;  1AN8 A;  2EDG A;  3I91 A;  2WAC A;  1II3 A;  2SNS A;  2B63 B;  3SVM A;  3SK5 A;  1K8O A;  3NUC A;  2C5C A;  3V05 A;  4K5V A;  1F2Y A;  3LX0 A;  4FF4 A;  4F7X A;  2H4O A;  1JIC A;  3N6R A;  2K5Q A;  1FNW A;  4N9P A;  3E5S A;  5I9P A;  1A15 A;  2DNC A;  5M5Y B;  1V1O A;  5EPL A;  1I6V C;  4A3I B;  4NDX A;  1PDQ A;  5JOB A;  3K5M A;  1TS3 A;  5CBE E;  3H0G B;  3BVM A;  4BY1 B;  2RDH A;  4J1M A;  3E6Z X;  1JWS D;  3R2I A;  5CGK A;  1Z6H A;  2ICE C;  1BBX C;  2VUM B;  4KD4 A;  2FIN B;  2EYH A;  3MFY A;  3GTO B;  2JXM B;  2A68 C;  1PTO B;  4FXK C;  1DM0 B;  1KDA A;  1XWE A;  4RHR A;  4HTH A;  3PUV A;  1GUS A;  4K2L A;  2CW0 D;  5K36 H;  3VR3 A;  1JWM D;  3MA2 B;  2RBM A;  1HTL D;  1DJR D;  2IWH A;  3LWE A;  2QF7 A;  4RGM A;  4DGZ A;  1ENF A;  3PUW A;  2K28 A;  4XQN A;  2M00 A;  1STB A;  4IUU A;  3T13 A;  3P7J A;  5K36 G;  2KA7 A;  3MC0 B;  3NTH A;  2NVQ B;  4RCN A;  1SYD A;  3TZD A;  3OWE B;  1PTO H;  1Y1W B;  3M4Y A;  1ZXT A;  4DAV A;  2M2L A;  1QJO A;  4K2K A;  2B2Y A;  3Q23 A;  1LO5 D;  1AW7 A;  4OO1 H;  1NAP A;  2PW7 A;  4C3I G;  2BOS A;  3PMF A;  3WOF A;  3P1H A;  1JR0 D;  3SHL A;  3BG3 A;  1BNZ A;  4H0L C;  2XRQ D;  1CT1 D;  2Z1C A;  2BA0 A;  2NWG A;  4IAL A;  1NCV A;  1EWH A;  1DOK A;  1HA6 A;  1SYG A;  3D31 A;  3DUZ A;  4A3J B;  2A69 C;  5ELC A;  4KD3 A;  1EU3 A;  3FDT A;  3VYU A;  2EVB A;  3A8K E;  5E1F A;  1PMR A;  1IHZ A;  3QJY A;  4CKB A;  4MIU A;  2N55 A;  3BDL A;  5CV4 A;  3FMC A;  4ZKB B;  3GTM B;  1TS4 A;  4RKB A;  1SE2 A;  2SNM A;  2R92 B;  1UNS A;  1RJT A;  2WKD A;  4HR7 B;  2EY2 A;  5CR3 A;  2R3Z A;  1DOM A;  5C0X H;  1R4P B;  3T16 A;  2DY7 A;  5JVG 3;  2OXP A;  1EY4 A;  1WVL A;  2EYJ A;  1E0B A;  3TME A;  3IFT A;  2F0J A;  5C0X J;  2QEJ C;  5IT9 E;  2O5J C;  5C0X G;  3J7A F;  5FKA C;  3DXJ C;  4J6H A;  4KKS A;  1B2T A;  4OIJ A;  2EXZ A;  3J81 E;  2AUK A;  4WFN 3;  3LWU A;  2JP1 A;  4L6T B;  3HGB A;  1F2L A;  2K33 A;  1KNE A;  5HGT A;  4LK1 C;  2F0F A;  5JPN C;  3GTJ B;  1SAP A;  5EBC A;  2PPB C;  1SNQ A;  3NP8 A;  4K5X A;  4ZLT F;  5FO7 B;  4IUN A;  1TQO A;  3M7G A;  1EYA A;  5I2X A;  1BOS A;  5DM6 3;  2SEB D;  2EY1 A;  3PUZ A;  5M5W B;  2B2T A;  4DAP A;  1ZYR D;  1F9S A;  5CV5 A;  1TII D;  5JEA G;  4BWG B;  5FOB B;  1EY5 A;  4FO2 A;  2DNE A;  1GHK A;  4BBR B;  3IFD A;  4EQP A;  5D14 A;  2F0E A;  1SE3 A;  4PMW A;  1ML0 D;  1F9P A;  3D4W A;  1FGB D;  3R3O A;  1VF7 A;  3SK8 A;  2RQX A;  4C3J G;  1IW7 C;  2F0V A;  1E2W A;  2ENB A;  4X3S A;  3BS1 A;  1TWH B;  3K57 A;  2AQ1 B;  1XYI A;  2FMM A;  1BCP C;  4CKC A;  3RLF A;  5JPM C;  2K05 A;  1TWF B;  3H6M A;  4RKL A;  1SYC A;  1QNU A;  4FNF A;  1MBY A;  2D62 A;  2V4D A;  4IUQ A;  4KJN A;  2E2D C;  3KLR A;  3VYS A;  4U68 A;  2B8G A;  3TP8 A;  2HCC A;  2KCN A;  2G9H D;  3A55 A;  1SFO B;  3CU7 A;  4KN4 C;  4ODG A;  2XRS D;  3RUZ A;  4RGO S;  4ZAI A;  4RHS A;  3NWT A;  5E4X A;  4FYD A;  4BA2 I;  4YIJ A;  3K58 A;  4DU9 A;  2PZT A;  3HG9 A;  1STG A;  1WTP A;  1PZI D;  1RD9 D;  1ZKO A;  4G7O C;  1I4H A;  4BS9 A;  2ZT9 C;  1QE6 A;  3HZX A;  5NUC A;  1ZYR C;  4J8Q A;  5FLX E;  2EY6 A;  4RGT A;  1PFM A;  2NVT B;  4G7Z C;  3HOY B;  2FMC A;  3L7Z C;  4RWS C;  3HRZ C;  4IFD H;  2D9U A;  4IUT A;  3GTK B;  1JOQ A;  1PLF A;  3T4A C;  3Q0A A;  3A56 A;  1W6K A;  2C9O A;  1RCV D;  2QDB A;  3HOZ B;  1HFG A;  3LNN A;  1BQQ T;  1U4R A;  2KCC A;  3GV3 A;  3T53 B;  2LFN A;  3FVQ A;  4G4K A;  4IUP A;  1B9N A;  1SYB A;  4A3B B;  1ZEQ X;  4GZY C;  4PV1 C;  1ET9 A;  2O2L D;  4HMI A;  3K5L A;  2CHB D;  3I8Z A;  1AFP A;  4O42 A;  4OHJ A;  1YNN C;  2IT1 A;  3A8I E;  3MVV A;  1S5B D;  3KBG A;  5COR A;  1ICW A;  4NKL A;  1IL8 A;  2NB0 A;  2WAQ B;  4EQO A;  1SNO A;  3TBI B;  4PMB A;  2HDL A;  4FXG C;  3I70 A;  3K7A B;  4KV6 A;  4PQX A;  2EPB A;  2VB3 X;  2HQE A;  4N9T A;  1PTO D;  4OGQ C;  2RSN A;  1H9R A;  5CV7 A;  1WCM B;  5EKI A;  3I4M B;  1KLG D;  3J7Y W;  3MZ5 A;  1T5E A;  2M9V A;  3WOE A;  1S5C D;  3TN2 A;  2KEE A;  4EVO A;  4PNY A;  4V19 0;  1G6Z A;  2ID0 A;  4KK7 A;  3QO2 A;  1F77 A;  3P20 A;  1B1Z A;  2OEO A;  2MGS A;  3NBH A;  5IIF A;  1GUW A;  1PFB A;  1NR4 A;  3OMG A;  3GQB A;  1LTR D;  4KTA A;  1CFM A;  1TS2 A;  5C5L A;  1D2B A;  5IOC A;  4R8N A;  2PW5 A;  4B9X A;  2R61 A;  4RA8 A;  2B2V A;  2E2J B;  4QF4 A;  2F0S A;  2QIL A;  2N88 A;  5D3I B;  3M7N A;  1D5X C;  3J80 E;  4FF3 A;  4CJ1 B;  2F4I A;  1HUM A;  3DWQ A;  2XN9 C;  2RA4 A;  2F0N A;  3QOJ A;  2F0D A;  3GTP B;  1HQM C;  3Q6S A;  1SND A;  2LY7 A;  4HSV A;  2NBF A;  2F0H A;  4RAU C;  2AQ2 B;  2E2H B;  3FRP B;  2A6H C;  3JAM E;  3DM1 A;  1DYQ A;  3VR6 A;  3A7A B;  1SMY D;  5BN3 A;  3RZO B;  2E2I B;  2CQA A;  2TSS A;  2NUC A;  1EIG A;  3I3C A;  5J39 A;  3MFG A;  3PIP 3;  1V1P A;  4Z9C B;  5IGD A;  1TY2 A;  3T51 B;  2Q8I B;  1O78 A;  4K14 A;  4EQN A;  3SXH A;  1WTO A;  5C4H A;  4C56 C;  3NPP A;  2LKV A;  3TSS A;  3KUP A;  2PYK A;  1X3Q A;  3R2T A;  3DMU A;  4OO1 I;  4AYB B;  1AEX A;  1KTK A;  4LJZ C;  4K5W A;  1I4G A;  4OIK A;  3SE0 A;  2L9H A;  2A73 B;  3S2D B;  5KYI A;  1HRJ A;  1YNJ C;  3ND9 A;  3RD4 A;  2OT2 A;  4CKE A;  2BDN A;  4P2C B;  4XYQ A;  3G7L A;  2KQ3 A;  2K04 A;  4KY7 A;  2TMP A;  1Q90 A;  1BDO A;  4XT3 B;  5KYL A;  4U67 3;  2EYP A;  2GA4 B;  2HDM A;  3UI2 A;  3QIA A;  2ZXO A;  4ULL A;  4IUV A;  1C48 A;  5EJW A;  3SEB A;  2FJ2 A;  5C4J B;  1LV9 A;  2KJX A;  2IX3 A;  2B2U C;  1T5X D;  4QMG A;  3HEJ A;  3KLS A;  2H1E A;  4CJ0 B;  4C3H G;  1LTB D;  3S1M B;  1ENA A;  3MWY W;  4KHZ A;  2JEB I;  4IQZ A;  1TWG B;  1BXT A;  1LT5 D;  5I6W A;  1V43 A;  3HOV B;  5IGB A;  1HPC A;  1B44 D;  3BZD B;  4MN3 A;  3RZD B;  2SDF A;  1I4Q A;  4KI0 A;  1EQV A;  1ESF A;  4A3F B;  1JOO A;  3D6C A;  4QCL A;  5G3L D;  3QOL A;  1RTO A;  1H9J A;  2SOB A;  1F9R A;  3J80 L;  1E2Z A;  3Q24 A;  5IT9 L;  1AZP A;  5J22 A;  3PO3 B;  2KED A;  1R4Q B;  3NQT A;  2JA5 B;  1G8Z D;  5KEE A;  1R9T B;  2JSO A;  2NZ1 D;  1SNC A;  3DWP A;  1STY A;  2HCI A;  5G3L F;  1JOR A;  1IYU A;  2MPM A;  3TP5 A;  3EQL C;  3S16 B;  2L5T A;  2F0O A;  2EY5 A;  2YYZ A;  5IOD A;  1QWY A;  3NE5 B;  5CV9 A;  4L8J A;  2F0U A;  2EYL A;  2EJF C;  5JEA J;  3FEW X;  2KHS A;  5C3W A;  1I50 B;  3D4D A;  3C1E A;  2B2V C;  3H09 A;  1WTW A;  3URY A;  3HOU B;  2D5D A;  2Z4H A;  2FFK B;  1JQY D;  2R6G A;  4K6D A;  3TP6 A;  5IGF A;  4PMC A;  1QOH A;  1PRT B;  3K0Y A;  1BO0 A;  2L1B A;  3L3O C;  4K8I A;  5ISR A;  4RGN A;  1DZ1 A;  3I4N B;  1KNA A;  5C3X A;  4LAA A;  2LS0 1;  3SR1 A;  1JWU D;  1CM9 A;  3ERQ A;  1EY9 A;  4XQQ A;  2Z8L A;  5IGE A;  3MXP A;  5KNB A;  4NW2 A;  2BCO A;  2BA1 A;  3BDO A;  2ZXP A;  5FK9 C;  1GJX A;  1DCZ A;  2PMZ B;  5IGG A;  2O4X A;  4R9W A;  1IW7 D;  2IL8 A;  1PZK D;  1XX8 A;  1GUO A;  4TSS A;  2WP8 J;  2L55 A;  1A3T A;  1BF4 A;  3J81 L;  1O7L A;  4A3G B;  1LTA D;  4XQJ A;  3D6W A;  4WJW A;  3CKI B;  1SEB D;  4XT1 B;  3VYR A;  4DN4 M;  1I6H B;  5LHY 1;  2L4N A;  1S5F D;  3F2U A;  4F87 A;  5KGU A;  5EGT A;  2XVS A;  3A8J E;  1KLU D;  1MGS A;  3VA5 A;  3AMU A;  1V1P B;  4ID6 A;  3Q22 A;  1EYD A;  3H3V C;  1FNV A;  3VR5 A;  2AWN A;  1C8C A;  1D5Z C;  2A74 C;  1DXM A;  2VXW A;  4QUC A;  3QWN A;  2WIN B;  1WD0 A;  3VR4 A;  4DXG A;  1M8A A;  1WTQ A;  2R93 B;  1ROD A;  5DEH A;  2K6A A;  5F2D A;  2K01 A;  1KDB A;  3N52 A;  4CJ2 C;  4BBS B;  1A3U A;  3GD7 A;  5DM7 3;  4DK0 A;  3K59 A;  1YNJ D;  1EEF D;  3K5N A;  1TWA B;  2B8F A;  3D8G A;  1RKN A;  1ILP A;  1SXT A;  5J1Z A;  2WII B;  3M4O B;  4F8M A;  4KY6 A;  3C46 A;  2EYM A;  2JA6 B;  1FR3 A;  4A3D B;  3I4L A;  5D3D A;  3CQZ B;  3OOC A;  1TWC B;  4MHE A;  3EVQ A;  2NVY B;  1LTI D;  3MTS A;  1A2U A;  3R8B A;  3DEO A;  1JCK B;  3OIP A;  1PTO F;  1VMC A;  5A2Q L;  4X3T A;  1D1I A;  2F0W A;  2Y0S B;  1TU2 B;  4ZK9 B;  5EKL A;  3P75 A;  1LAC A;  2JA8 B;  2NN6 G;  3I73 A;  4KY5 A;  3DEP A;  1F9Q A;  1QB5 D;  1U4L A;  4Q0F A;  4JBW A;  2F03 A;  2ZXR A;  5CC4 A;  3NK9 A;  4A3E B;  4FP5 D;  4ZYS A;  4RFB A;  1A6X A;  1MSH A;  5M3M B;  5JVH 3;  1I3Q B;  4IZ8 A;  1TVX A;  1B9M A;  4C1N K;  1TT2 A;  2J7Z A;  4RCO A;  2KUM A;  4WRD A;  3OIQ A;  4KHV A;  5FLX L;  1HA5 A;  2BE5 D;  1SNP A;  5EBD A;  3E0J A;  1OXV A;  4DF7 A;  1L0X B;  2B2T C;  2EYO A;  4CHT B;  3NWS A;  2PO4 A;  2G9D A;  1M4V A;  4KN7 C;  1XTC D;  4IFD J;  1X3P A;  2IPK D;  1CQV A;  2K1B A;  1MD2 D;  2R7Z B;  4M8A A;  1H9S A;  4DNR B;  1CHP D;  2D2C C;  4K8J A;  1Y1V B;  3MAQ A;  4X3K A;  5CMD A;  2OF1 A;  4DFA A;  2I46 A;  2QCP X;  1GHJ A;  2RVL A;  1OXS C;  4CBV A;  1QNK A;  1OO9 B;  5A2Q E;  1VF5 C;  2IJ0 A;  1I4P A;  4IFD I;  2F0Q A;  3GV6 A;  2F0P A;  3KBX A;  2F0M A;  3HP3 A;  1O7Y A;  5I2Y A;  1HUN A;  1U9R A;  4XTC S;  1Q1E A;  2L11 A;  1LLR D;  2EJG C;  5JJZ A;  4X3U A;  4UDU C;  2WKC A;  2NVX B;  5BN5 A;  2F0K A;  3SDZ A;  2E74 C;  1Q3L A;  4JK1 C;  2Q8R E;  3L9A X;  2JEA I;  5KND A;  3IL8 A;  1CZW A;  1UUP A;  1SMY C;  1G2S A;  2PZU A;  1Q1B A;  1STN A;  3DHQ A;  1I4X A;  1JB3 A;  5JAV A;  4F88 A;  4Y7N B;  5HUR A;  1VDZ A;  1B50 A;  1A3V A;  1SJE D;  1S5E D;  3D4R A;  5E4W C;  2JA7 B;  1WTX A;  2B2W A;  2B2Y C;  4DNT B;  3S2H B;  1GOZ A;  3U9O A;  5JEA H;  5M3F B;  4KKU A;  1A2T A;  3I72 A;  3BYY B;  1EZ8 A;  4BY7 B;  2NN6 I;  1G91 A;  4H13 C;  3IAY A;  1SSO A;  1CQF A;  3AU7 A;  1LT3 D;  3OW7 A;  3PO2 B;  1EY7 A;  3ND8 A;  1EYC A;  2MUY A;  5EPJ A;  3S1R B;  4QB4 A;  2YU9 B;  1F2M A;  2Z4I A;  3VR2 A;  1TS5 A;  3W2D A;  1EQT A;  1LAB A;  3CHB D;  2NTS A;  1STE A;  4A93 B;  2F0L A;  3C1F A;  3JAM L;  4QUF A;  1J8I A;  1LTS D;  5M9O A;  2I07 B;  3PUY A;  1NUC A;  1EIH A;  5FO8 B;  3QB3 A;  3CRK C;  3VA7 A;  1KAA A;  4V0B A;  1H9S B;  4H44 C;  1SDF A;  3MXN A;  4A3K B;  2IW3 A;  5C3E B;  1VCI A;  4TRD A;  2Q8T A;  1QIL A;  5LL6 S;  1HFN A;  5C44 B;  4B08 A;  1PRT F;  4O1N A;  1XXG A;  3TDQ A;  2O5I C;  2A6E C;  1ET6 A;  2F0I A;  4K6L A;  1DOL A;  3DWA A;  4I7Z C;  2RKS A;  4IUR A;  3AB9 A;  1EY0 A;  1CTM A;  1GXD C;  1MI2 A;  1EU4 A;  1O80 A;  4DXF A;  3OPO A;  2WB1 B;  5ELB A;  1D1K A;  2K32 A;  5DNF A;  1PXU A;  5M5X B;  3GP7 A;  2IX1 A;  2K5W A;  2AWO A;  1LT6 D;  3NQI A;  2MJ8 A;  3S1N B;  1H9M A;  1J9O A;  4LMQ D;  5CV8 A;  5D65 A;  1CA6 A;  3S15 B;  1L0Y B;  2CVR A;  1D5M C;  1STA A;  1OXU A;  1S4Z A;  1W6J A;  5AFW A;  1AP0 A;  1WD1 A;  2F3W A;  3FPU B;  3VYT A;  3NSW A;  4KJO A;  4XIG S;  4CGY B;  1TY0 A;  5EPK A;  5I9O A;  4QIW B;  1X32 A;  4FVM A;  3EA6 A;  1D6E C;  4HED A;  5ELD A;  1DON A;  1H9K A;  2FHT A;  4EGV A;  3BVG A;  3GTL B;  1RHP A;  2EE1 A;  4R8I A;  3PUX A;  1EEI D;  4DA2 A;  2JE6 I;  1U4P A;  1NSN S;  3W3A A;  4HCE A;  2HUG A;  3X3N A;  2F3V A;  3A7L A;  1WTV A;  2K5D A;  1EWC A;  1HCZ A;  1WTR A;  1UAP A;  5TSS A;  2XWB B;  3G6J B;  3KK7 A;  2XIW A;  2XNA C;  3J7A V;  4B9W A;  3FKI B;  1CHQ D;  1EZ6 A;  2BE5 C;  1I4R A;  3KLS X;  5IGC A;  1Z47 A;  2CW0 C;  1SYF A;  1K83 B;  1PTO C;  3NBI A;  1QCB D;  2KOL A;  1S5D D;  1FYC A;  2KVM A;  3V96 A;  2A68 D;  1B4O A;  1SYE A;  2RDF A;  2ICI A;  2RDG A;  1TR5 A;  1IYV A;  1PYW D;  3BYT B;  5K5P A;  4DK1 A;  1OXX K;  3C2P A;  4IFD G;  1BCP B;  4IN3 A;  1JOK A;  3BDC A;  3RMH A;  2AQ3 B;  4NMZ A;  5ELF A;  1G2T A;  1PRT D;  3OHX C;  3TP7 A;  2E75 C;  2J0T D;  1DD2 A;  2QKI C;  1BUV T;  2AUJ D;  2B2W C;  2DN8 A;  1GUG A;  1B3A A;  4C2M B;  1AZQ A;  4KMU C;  3HOW B;  2A6H D;  5C6A A;  1HHV A;  1EOT A;  1O7Z A;  3ONA B;  1STH A;  2K7V A;  3O13 A;  3K5O A;  1YNN D;  2X6G A;  2A69 D;  1Z7T A;  4OO1 G;  2DY8 A;  1ESR A;  3EFX D;  3NXW A;  3ZYY X;  4S3S A;  1OXT A;  1ILQ A;  3PV0 A;  4G57 A;  2A5H A;  2EYF A;  4BA1 I;  4HAE A;  2F0G A;  2PCF B;  1UEA B;  1Y69 U;  1EY6 A;  5CBA E;  2XWJ B;  4OL7 A;  2KEC A;  2K03 A;  3ITP A;  2MP1 A;  3D3R A;  4ZRZ A;  2EZV A;  5I6Y A;  2B2U A;  1SE4 A;  1EL0 A;  1E2V A;  1HXY D;  2JYO A;  1SNM A;  3S9W A;  1TKW B;  4ZQ3 A;  2F1M A;  4HN7 A;  2IX0 A;  4G7H C;  4ME5 A;  4KKT A;  5DAU A;  5C4Z A;  4TQU S;  1LTT D;  4XXE A;  1PRT C;  4E6I A;  4Q5V A;  5KRU A;  4ABN A;  5C0X I;  2E76 C;  1RF2 D;  1ONL A;  1EY8 A;  4I65 A;  2B39 A;  1PFN A;  4ZUI A;  5T1G A;  4XDX A;  3K6O A;  3PIO 3;  3HS0 C;  1CI3 M;  3T56 B;  2A6E D;  2NYZ D;  5FO9 B;  3KF8 A;  4ILW A;  4C1N I;  5BN4 A;  1Q8I A;  1IKL A;  2NTT A;  3CRL C;  2F0T A;  5T1I A;  3S17 B;  1MSG A;  3S14 B;  3R93 A;  3NTI A;  2X6L A;  1KAB A;  3BVZ A;  3GO5 A;  3H94 A;  4HMJ A;  4XYO A;  1RTN A;  1LTG D;  2NN6 H;  1U4M A;  3SK4 A;  2X69 A;  3M85 A;  2L0C A;  2LMC B;  1C4Q A;  3C3L A;  5CV6 A;  1F2Z A;  2VB2 X;  3OSO A;  2PQE A;  3FPP A;  1CZG A;  5C4X B;  4C3I B;  1JE4 A;  1HQR D;  3M3Y B;  3WDN A;  3QG1 A;  1RDP D;  4RH6 A;  3H91 A;  4ZKC B;  4FXD A;  5C5M A;  3HOX B;  1NR2 A;  2EOT A;  1LT4 D;  4WOR A;  5LL6 X;  2BDO A;  1KDC A;  2WV6 D;  1CK1 A;  2MHV A;  4HCS A;  4FF1 A;  3MHB A;  4HSP A;  5CYU A;  5KIX A;  3GTG B;  3TZU A;  2VNU D;  1B53 A;  1BCP D;  1QG7 A;  4NP5 A;  1G29 1;  3NHH A;  4TKO B;  1GUT A;  4C3J B;  3MXU A;  2XSC A;  1ENC A;  1FD7 D;  3OMC A;  3MEH A;  4A3M B;  3OWF A;  1HTP A;  3S1Q B;  3MXG A;  2L12 A;  5EKK A;  1V8Q A;  4M1U B;  5A35 A;  1VMP A;  4FF2 A;  1CA5 A;  3SK6 A;  1PZJ D;  1BR9 A;  5I4D A;  3I90 A;  4H7B A;  1BCP F;  3A54 A;  1Y8N B;  3EJI A;  4DAY A;  3IKJ A;  1Y8P B;  1IKM A;  5ELE A;  1GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...