2K5HA

Solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
b'MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2008-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5hA01
1SROA 1U0LA 1HZAA 1Q8KA 3PCOB 1IBLL 4A3FH 2JA6H 3KF6A 1SMXA 3K7AH 3CC4A 4A3CH 1NE3A 1KD1C 1GD7A 2Q2IA 2R7FA 5IYCH 4X62L 4BY7G 3TS0A 1HR0W 1QVGA 1YBYA 5C4JH 1DGSA 1P16A 3J80c 3GTJH 1K8GA 5JJLA 4IPCA 5JEAJ 3NELA 2WAQG 4DR1L 2CQOA 2HIVA 4BBSH 5C44H 2A1AA 3KDFA 1I94Q 1HZCA 3FP9A 2QEXA 4OONA 2LSSA 3CPWA 2UU9Q 2N3SA 1M1KC 3PUYA 4KHPQ 1I3QH 4EQ5A 1HR0L 1PH7A 3CF5A 1WJJA 5DLQE 4YY3L 4KLKA 1PH8A 1I50H 1NTGA 2CWAA 4DR3L 2K5NA 1YHQA 4H02A 4DR7Q 5C3EH 2KHIA 3I4NH 2UXBQ 1Q7YC 1J5EL 3HOZG 2OCEA 5LMNQ 4A3GG 1YI2A 4LF5L 3KJPA 1OXXK 3DM3A 2ES2A 4NB3A 1UE1A 2IX0A 3A0JA 1NY4A 3CCMA 4DV6L 1YJ9A 2HHHL 5FLXc 2K5HA 4JI4L 4A3IG 1UWVA 1XNQQ 1Q46A 3I4MH 1IZ6A 3G71A 5JJIA 2ZTDA 1XMQQ 4A4IA 1N36Q 3CC2A 4A75A 1L1OA 3PO3H 5IYBG 2NVQH 5J3BA 5IWAQ 3CCUA 3S14H 1BBUA 2JK8A 3KF6B 1VQNA 1YJNA 1CSQA 1K9MC 2NVTH 2R7ZH 4GKKL 5M3MG 2QGQA 2YU9H 2PNHA 4UPAA 1PA6A 4DAYB 1G51A 1Q81C 4UY8C 2ASBA 4JI0L 2JJQA 2PMZE 4HJAA 5LMUL 2UUCL 4OX9L 3UE0A 4YCWA 1KL9A 1LUZA 1WCMH 2CCZA 4OWWB 3U58A 4A3EG 2LXKA 1VQKA 1YHAA 1K0RA 1Q1BA 1IBML 3HOYH 1MIUA 1WOCA 3GTQH 5IYDH 1V43A 3E0EA 3KDFB 4GOPC 4A3JG 4DV5Q 4JI7Q 1PYBA 4UP7A 3KLWA 4LF7Q 4HJ9A 1AH9A 1IBLQ 4L5RC 1NBWA 4J15A 1IBKL 3GTOH 4YWLA 1YZ6A 4JI3L 2K52A 3CCLA 3BU2A 4B3ML 4DPGA 1N34L 2UU9L 1V9PA 4X62Q 3K0XA 1EIFA 4GLXA 3CPFA 4DUZQ 1WI5A 3F2BA 4QQBX 1PFSA 2CKZB 3TRZA 3TREA 1JJ2A 2JEAI 4LFAQ 1YIJA 1VQAA 1B8AA 1AE2A 4DR1Q 1Q82C 3CCVA 4DR2Q 1QZGA 3ERSX 3M7NA 2HT1A 4LW1A 1HNWL 4XTCS 3TEHB 1FVIA 4IPHA 3Q8DA 4YCUA 4MZ9A 2D0PA 4A3DG 3W1GA 3ULJA 1HR0Q 3OTOQ 1L1OB 2HQLA 4DV1L 4IFDG 1Y1VH 3KYHC 3AQQA 4WJ4A 3OW2A 1S3OA 4DR4Q 4IJHA 1K8AC 3HOUH 4JOIC 2AWOA 2JE6I 4X6AH 4GN5A 1SN8A 1TWHH 3J81j 1J5EQ 4GLAC 3S17H 3PO2G 3E9IA 3K7UC 4YHHL 4GKJL 3GTGH 1VQPA 3M85A 4HIOA 4DV6Q 4PG3A 2Z6KC 2JA5G 5JJKA 1KQSA 1JB7A 2GVAA 4JI4Q 2R93H 1TWGH 4DV7L 5M5YH 2E2HH 2CWPA 3PUWA 3G4SA 4LF9L 1BKBA 1VQOA 5HGQA 2VS1A 1JJCB 3HKZE 4HJ8A 2N78A 4B3SL 1VQ7A 5K36G 1X9NA 4P71A 2AMCB 1E24A 1CKNA 4BA2I 3L2PA 4JG2A 2YTYA 4BY7H 1X56A 2IT1A 2B63H 2Q2TA 1E22A 2VW9A 3VDYA 2JQOA 2UUAQ 4JI7L 3W1BA 2JEBI 4YWKA 3W5OA 2UXDL 4A3LH 2NN6I 5E7NA 5IE8A 4DV4L 4R4CA 2WB1E 4P72A 4JI0Q 4OX9Q 3I4OA 1RL2A 2RF4A 2Z0SA 3CP0A 5LMUQ 3G6EA 1PH5A 3OYYA 2UUCQ 1G6PA 4A76A 2OQKA 3F2DA 1W2BA 1UEBA 3CCJA 4DUZL 1IBMQ 1K73C 2ATWA 3H3VH 1E1OA 2Q2HA 3CCRA 3H0GG 2WAQE 2R92H 4LFAL 3I56A 1SLJA 3RN5A 4C3JH 4FDBA 1GO3E 4R4TA 3TQYA 4AYBE 5FJ8G 4DNIA 4DR2L 1NJIC 1IBKQ 2HIXA 4P75A 4JI3Q 3HOVG 5M3FG 3AFPA 2VQFL 3J7ZC 4B3MQ 2B3GA 4A3MH 2RCNA 1EQRA 1N34Q 4HIDA 1C7YA 2NN6G 1VCIA 1VQ5A 1JE5A 1D8LA 2EIFA 3MEFA 3OTOL 1PVOA 4B3TL 4GN4B 4DR4L 1PH2A 2NZOA 1CSPA 3M4PA 4BA1I 1ASYA 1C9OA 4AQYL 1VQJA 1VQEA 3NBHB 1JJGA 1Z47A 4QGUA 4BBRH 3AYHB 1VQCA 2R6GA 1UE6A 4LNQA 2JA6G 4A3CG 3K80C 4KI0A 4X66L 5C4XH 1HNWQ 1P8LA 3GD7A 2IY5B 5IYCG 2N49A 2Y0SG 1HZ9A 2H5XA 4DUYQ 4OWXB 2F4VL 3TS2A 1D7QA 3RNUA 4DV1Q 1A62A 1KXLA 1GKHA 3PGZA 3A74A 4JC0A 3JC66 4R4IA 1CKNB 2MQHA 1L0WA 1PYSB 5M3MH 3RZDH 4JI2L 2ID0A 1EFWA 1OXUA 4OWTB 4DV2L 2NVXH 4BBSG 4C3IH 1YNXA 3WWVA 5C44G 3HOXH 3B6YA 3HOWH 4YHHQ 4A93H 4GKJQ 4GNXA 2EXDA 1HZBA 1LM0A 1LTLA 1S72A 2UUAL 2JA7G 2VUMH 4O2DA 4B3RL 1MJCA 4DV7Q 1CKOA 5H1SE 1FJGL 2IHFA 1IL2A 4JI5L 3JAMi 4LF9Q 4LFCQ 3KFUA 4IOCA 3UDFA 1VQBA 3FHWA 5C3EG 1X65A 3CCEA 4B3SQ 3I4NG 3U50C 2OQ0A 3GTPH 1GVPA 1N33Q 3U4VA 1N8RC 1PH6A 1FL0A 4A3BH 3CQZH 2OWOA 3K8AA 3STBD 4JYAL 1QZHA 1KC8C 2VNUD 4IO9A 2I0QA 2UXDQ 1HH2P 2UXCL 2VL6A 5GQOA 1Z9FA 3S24A 4IPGA 3STBC 3T1YL 4DV4Q 4R1JA 1Y1WG 5GAHC 2Q2UA 4YWMA 2VQEL 1B70B 4HIMA 1SFOH 3J81i 4IFDI 3EN2A 4APVA 5EAYA 2WP8J 3I55A 4DKAC 2ZM6L 1E3PA 3PO3G 1CUKA 4JI8Q 3ULLA 1VQ6A 3PUVA 4UP9A 1XMOQ 2K4KA 4KHZA 4DV3L 2R7ZG 2KHJA 2K14A 1MKHA 3PIOA 1YVCA 2ZTEA 3FKIH 1PH1A 4PZ8A 4LUVA 2VQFQ 1VQLA 1YHBA 1WCMG 3CCQA 4POFA 3PO2H 4DUYL 3DLLA 4BXXH 2B29A 3HOYG 1A0IA 1X54A 1Q1EA 5IYDG 4NXNL 4GNXB 3AFQA 5GAEC 1EIYB 5FLMH 4AQYQ 4PZ7A 2MO0A 2F52A 1XPRA 2IX1A 1BBWA 2K5VA 4L5QA 4BY1H 2N8NA 2YTVA 4DV0Q 1I5FA 2JA8H 3M4OH 2CFMA 4X66Q 4NXML 5IP7H 3A5UA 5IP9H 4LF8L 3F8TA 2R7DA 2BH8A 2F4VQ 4JI1Q 3J7A5 4O0AA 3PF5A 4RG1A 2GVBA 4LFCL 1XNRL 2OTJA 3T1HL 4JI2Q 4DV2Q 2KBNA 4GOPA 4X64L 4A3KG 1N33L 1VQHA 2LXJA 4LUZA 3D31A 4POGA 3S1QH 1O7IA 3NENA 3UDIA 4RMFA 2WFWA 4C2MH 4DK3C 1PHJA 2NZHA 3AEVA 1L2FA 4B3RQ 2K50A 4JBJA 1Y1VG 1JMCA 1E1TA 1FJGQ 4JI5Q 3I2ZA 1MJEA 4QJFA 2ZJRA 3EIVA 1JT8A 4JBMA 1OXSC 1K3RA 4JI8L 3F1ZA 1SE8A 4MTNA 3CD6A 2UUBL 3GO5A 1VQ8A 4OO1G 1XTDA 1XMOL 4JYAQ 2AWNA 1KRTA 4AH6A 1K83H 1T9HA 1L1OC 1ASZA 3ER0A 4HJ5A 2UXCQ 2R93G 3T1YQ 4B3TQ 5GAGC 4DR6L 4HIKA 2VQEQ 2OTLA 5C0XI 4LF4L 1XPOA 1Y14B 3HOZH 1VQGA 2ZM6Q 2ALYB 3CMEA 2MO1A 4A3GH 2GN5A 1UE5A 2VZAA 2WB1G 4JOIA 2A8VA 4TVAB 2V1CC 3D0FA 4GLVB 2B63G 1EWIA 4DR5L 2RHSB 3PUXA 2E2JH 3H15A 4DV3Q 3GDEA 1X3FA 4GS3A 3UDXA 4A3IH 4K0KL 2PI2E 4A3LG 3RLOA 4Y7NH 4A3FG 4DV0L 4NPSA 3ZJYC 4TQUS 2Z6KA 4MNOA 4Y52H 1HNXL 4XIGS 4AYBG 2E2IH 1KIXA 2Y0SE 3K81C 2KCMA 5IYBH 4X65L 4JI1L 1TWCH 3ICEA 1EOVA 4GOPB 5C0XG 1FGUA 1QVFA 1YJWA 4NXNQ 2JA7H 2R92G 3GTKH 3HFZB 4LF6Q 1TWAH 3G48A 2PQAA 1GM5A 1Q12A 2EQSA 1BVSA 2BA1A 1KHIA 3HKSA 3KOJA 2I5HA 1EQQA 1CKMA 2KCTA 3PV0A 5ELOA 4AIMA 1M90C 1X55A 3U4ZA 1B7YB 4A3EH 2MFIA 3BJUA 3UE1A 4A3MG 4NXMQ 4LFBL 1J6QA 3ULPA 4JI6L 4LF8Q 1A63A 1N32L 5AJ3L 1S40A 2L15A 4ALPA 1U5KA 4ME3A 4A3JH 3GTMH 3CXCA 3S15H 3PUZA 2FXQA 2K75A 1XNRQ 3I7FA 3T1HQ 1A8VA 1VQDA 1WYDA 3S16H 3EBEA 1SR3A 3PIPA 4OXPA 1Y1WH 4IFDJ 4X64Q 5M5XH 4BBRG 4GN3B 5JEAG 2A19A 2BH2A 1QVCA 5C4XG 4JBWA 4IPDA 2E5LL 4JV5L 4IOAA 1KRSA 3A5ZB 4P74A 2IHEA 2ZJQA 4JCVE 4QL5A 1HNZL 3I4MG 2XTIA 3F2CA 3S2DH 4LF7L 5BR8Q 2QA4A 3MXNB 3HOXG 1VQIA 4PMWA 3HOWG 1NMGA 4A93G 4DK6C 3UDGA 1EUJA 3M9BA 1VQFA 2AKWB 2UUBQ 1H95A 1HJPA 3CCSA 2C35B 4A3DH 3RN2A 4QIWE 2NVYH 2VUMG 2MNAA 3BZCA 1XPUA 3S1MH 2DGYA 3PF4A 4DR6Q 3JAMc 4WJ3M 2I5LX 2RHQB 4JBKA 2I5MX 4LF4Q 4EX5A 5LMNW 1PH3A 1W3SA 3CMAA 1Q86C 1YITA 1R9TH 1QUQA 1IXRA 1AE3A 2PQAB 1I94L 3NEMA 3SGIA 1VQ9A 4LUOA 1V1QA 3RLNA 4A3BG 4L5TA 2VY3A 4KHPL 3PSIA 4DR5Q 3CC7A 2JA5H 4LF6L 3IRBA 3L0OA 5IY0A 1EYGA 4K0KQ 1X6OA 2BA0A 1G291 1E7ZA 3GTLH 4DR7L 3KF8B 2PI2A 3J81c 3L7ZC 1IYJB 1PH9A 1HNXQ 2YTXA 2UXBL 4LWCA 5GROA 1VQ4A 4A3KH 3E9HA 4X65Q 5LMNL 1SRUA 1X3GA 2AHOB 3BZKA 3S1NH 4HJ7A 2E8GA 5HY6A 5IT9c 4DAMA 3S1RH 1OXTA 2YYZA 3KJOA 3M4QA 4OO1I 2XGTA 4P73A 1XNQL 4YY3Q 1I6HH 4PZ6A 1LYLA 3RLFA 3RR5A 2ZTCA 3FKIG 4DR3Q 1XMQL 1N36L 3CAMA 3S2HH 4LFBQ 1C0AA 4C3HH 2D62A 4JI6Q 1KAWA 4BXXG 2YV5A 5IWAL 4LF5Q 2KENA 1N32Q 3J80i 1UE7A 1NMFA 3H0GH 1YEZA 5GADC 1X3EA 5AJ3Q 5M5WH 1WFQA 3RZOH 1PV4A 4YCVA 2HHHQ 3HOUG 5FLMG 3M3YH 5FJ8H 5BR8L 1VS0A 2JA9A 1TXYA 3LGJA 4L5SA 3HOVH 5M3FH 4BY1G 5C0XJ 1PH4A 2JA8G 1N9WA 4R4OA 4QY7A 1RIPA 3HKZG 5ELNA 1OTCA 5IP7G 1OXVA 2E5LQ 2F3IA 4IJLA 4UP8A 5IP9G 2DUDA 4JV5Q 4R4QA 1VQMA 1QUQB 1TWFH 3CW2C 1HNZQ 4DV5L 1XJVA 4GNXC 3H3VI 2D0OA 4GKKQ 2ZJPA
chains in the Genus database with same CATH superfamily
1SROA 4U68A 1K83B 1Q8KA 1WTRA 1BCPC 1SMXA 4A3CH 2JN4A 4CGYB 3WDNA 4FVMA 1AEXA 2IL8A 1BF4A 4DXFA 1XYIA 3NELA 3Q23A 4DR1L 1S5FD 2CQOA 2HIVA 4A3IB 5C44H 2IX3A 3KDFA 1H9RA 1I94Q 2RDGA 3TN2A 1PFMA 1PZID 1DOMA 1QCBD 1I50H 1NTGA 2CWAA 4BWGB 5D3IB 5HURA 4DR7Q 1I3QB 5C6AA 5C3EH 3I4NH 1TWAB 1SYEA 4LF5L 4K14A 1OXXK 2EYOA 4PV1C 2ES2A 4NB3A 4ZLTF 1NY4A 2K1BA 4FXKC 5FLXc 2K5HA 5KNDA 4A3IG 2G9DA 1BNZA 1XNQQ 1S5DD 4A3JB 3G71A 4A4IA 1L1OA 3PO3H 5IGDA 2I07B 3CCUA 3S14H 1VQNA 1CSQA 1K9MC 1KDAA 3QOJA 4NDXA 4IUQA 2DY7A 5M3MG 2R7ZH 2QGQA 1TT2A 2WKCA 4JI0L 2PMZE 4HJAA 3NE5B 1A3UA 3U58A 2QILA 4LJZC 5CV5A 1VQKA 3HOYH 3ZYYX 1STHA 1WOCA 5IYDH 4NKLA 1V43A 3E0EA 3KDFB 4GOPC 4A3JG 4JI7Q 1SSOA 2O2LD 4UP7A 4HJ9A 1JICA 2XN9C 3GTOH 3IFTA 4IN3A 4IUUA 3BU2A 3H91A 4X62Q 3K0XA 2L1BA 3VR6A 1FNWA 2CKZB 1SYFA 1EY7A 3TRZA 3TREA 1FR3A 1YIJA 1S5ED 1AE2A 3CCVA 1QZGA 3ERSX 3Q8DA 4DAPA 4MZ9A 1OO9B 2D0PA 1J9OA 1LTSD 3W1GA 4XT1B 4ODGA 1L1OB 4IFDG 4QB4A 1S3OA 3QJYA 3NQTA 3CKIB 1TWHH 4LK1C 2K5WA 3J81j 3DWPA 4GLAC 1TU2B 3PO2G 1I6HB 4F8MA 1EOTA 3NBHA 4HIOA 1KNAA 3UI2A 1XX8A 2LFNA 1KQSA 4JI4Q 1TWGH 4KMUC 1D5MC 4K2KA 2E2HH 3PUWA 3G4SA 3GTGB 5KYLA 4LF9L 1BKBA 1PXUA 4CBVA 1VQOA 5HGQA 1IKMA 3HKZE 3MFYA 3X3MA 1VQ7A 4OIJA 2BOSA 4JG2A 4BY7H 1SYGA 2Q2TA 3A54A 2VW9A 2JQOA 2UUAQ 4JI7L 4ZKCB 4YWKA 2PZWA 2Z1CA 4A3LH 2NN6I 2N88A 5E7NA 2L4NA 2WB1E 3GV6A 3I4OA 1BCPF 2RF4A 1WTPA 3CQZB 2WIIB 2MP1A 2OQKA 3OWEB 1K73C 1IBMQ 3H3VH 5I4DA 1ZKOA 3CCRA 3I56A 3C1EA 1SLJA 4FDBA 1GO3E 4R4TA 3A8IE 1G2SA 4X3KA 1MSHA 5HGTA 1NJIC 4JI3Q 4P75A 3H09A 5M3FG 1HPCA 3VA7A 1IL8A 2RCNA 4C3JB 5DM63 3OOCA 2OXPA 1VCIA 4N8FA 5C44B 1JE5A 5E3FA 2EIFA 1LLRD 1UUPA 2MHVA 3BYYB 1WD0A 4MTKA 2B2TA 3M4YA 2XRQD 3NK9A 4CDCC 3M4PA 4K5XA 1EY9A 4AQYL 2L9HA 3NBHB 1JJGA 4KK7A 2NWGA 1Z47A 4QGUA 1WTXA 2VB3X 4A3CG 3K80C 1QWYA 1I50B 4X66L 1I6VC 1D1KA 2AQ2B 1HZ9A 1D7QA 2F0DA 4ZQ3A 1F2LA 3OPOA 1A62A 3KLSX 4KD4A 3PGZA 3DHQA 3JC66 4R4IA 3MC0B 5F2DA 2A6EC 4OWTB 4DV2L 4C3IH 3WWVA 5C44G 3HOXH 1C4QA 4OL7A 4GKJQ 2NBFA 2WACA 1S72A 2UUAL 2JA7G 3PO3B 3BZDB 2VUMH 2PMZB 1MJCA 4HTHA 3N52A 1G2TA 1HA5A 3FHWA 5C3EG 3I4NG 4ZYSA 3JAML 1GVPA 1LABA 1N33Q 1UNSA 2JYOA 4A3BH 2OWOA 4JYAL 1SEBD 2GA4B 4BS9A 3QB3A 5GQOA 1Y1WG 4B3TL 1EYDA 4R1JA 3DWQA 4IFDI 4HIMA 1B70B 2DJFC 4X3UA 3J81i 1SMYC 3EN2A 1SFOH 4IUTA 2WP8J 1WVLA 1E3PA 3PO3G 5I2YA 3Q24A 3GTOB 2WINB 1TS5A 5FO7B 1VQ6A 4KHZA 2R7ZG 2KHJA 3C3LA 1NR2A 1QE6A 1PH1A 4PZ8A 4XYOA 4POFA 1EIHA 1I4XA 1I4GA 3DUZA 3HOYG 2PO4A 5IYDG 1R4PB 3IFDA 5GAEC 1EIYB 4CHTB 1PRTC 4PZ7A 2F52A 1XPRA 1B44D 1BBWA 5T1GA 4V0BA 4KY5A 4FXGC 4OGQC 3T56B 5JJZA 2Q8RE 2EDGA 2JA8H 3URYA 4NXML 1TWHB 2SNMA 3A5UA 2R7DA 2BH8A 2EJMA 2H4OA 2FHTA 3MZ5A 4ABNA 5KEEA 3J7A5 3HKZB 4O0AA 2BCOA 1XNRL 3IKJA 5J1ZA 1QJOA 4JI2Q 1FYCA 2KBNA 1N33L 2EZVA 2E2HB 2LXJA 4FXDA 1ILPA 2LMCB 4IUPA 3NENA 2WFWA 1CHQD 2NZHA 3D3RA 2WB1B 2K50A 1E1TA 4BY7B 1DOKA 3VYSA 3ERQA 4C2MB 2F0HA 1OXSC 4Q0FA 1AP0A 3E5SA 1JQYD 1SE8A 4MTNA 3KLSA 3VA5A 1EL0A 2DN8A 2F0FA 1O7ZA 1VQ8A 1XTDA 1G8ZD 1KRTA 1STGA 1T9HA 4R8NA 3X3NA 3GP7A 1ASZA 2NZ1D 3T1YQ 4LF4L 3C46A 5EPLA 3HOZH 1BR9A 1A2TA 3F2UA 2WB1G 4JOIA 4RH6A 1B1ZA 1GUTA 2QCPX 3WOEA 2K33A 2B2YC 4B08A 5T1IA 3SK6A 1X3FA 1YNNC 5JAVA 2PI2E 1CM9A 4A3LG 2OF1A 4OELB 5FLXL 4Y52H 1GUSA 1HNXL 1F9RA 4XIGS 2Y0SE 4FF2A 1PMRA 1PTOC 4I65A 1TWCH 1EOVA 1HUMA 1V1OA 4EGVA 1YJWA 4NXNQ 3GTKH 4N8X1 2HUGA 4LF6Q 3G48A 1Q12A 3KOJA 1EQQA 1CKMA 5ELCA 5CORA 3U4ZA 3BJUA 3UE1A 2RA4A 4JI6L 3ULPA 4LF8Q 1A63A 4C3IB 2BDOA 1FGBD 3D6WA 4DNTB 3HOXB 3KF8A 5AJ3L 3GTMH 1U5KA 4ME3A 5DM73 1A8VA 1VQDA 4K2LA 1V8QA 4OXPA 4DU9A 3H3VC 4X64Q 4IFDJ 4GN3B 1ZYRC 3ND8A 1EY8A 1QVCA 4IPDA 3K5OA 2IHEA 2ZJQA 3VYRA 4QL5A 1HNZL 2DY8A 2HDMA 2A74C 4LF7L 3DMUA 2PYKA 3PIP3 4C3IG 1PLFA 4HMIA 5IODA 3HOXG 3RUZA 3S2DB 2AKWB 2UUBQ 1HJPA 3CCSA 1IYUA 2SNSA 2HQEA 2ENBA 2VUMG 3K5MA 1K0SA 3PF4A 2A69D 2QDBA 1CK1A 3NTHA 2Q8TA 2B2WA 2I5LX 3KUPA 2L5TA 1PH3A 5C5MA 5J39A 1QUQA 1JE4A 1IXRA 1H9SA 3KK7A 1VMCA 3NEMA 3SGIA 3L9AX 4A3BG 3AU7A 2VY3A 4L5TA 4KHPL 2JA5H 5CR3A 3NQIA 4LF6L 1EYGA 1X6OA 1PRTF 3GTLH 1E7ZA 4RKBA 3KF8B 2PI2A 3K57A 2YTXA 4C1NK 4LWCA 5K36H 3MFGA 1VQ4A 4A3KH 3S1NH 3FPUB 3BZKA 4DA2A 2E8GA 2JA8B 2ZXOA 1IW7D 3J7YW 2A68D 1LYLA 3RR5A 3S1RB 1XMQL 3OIQA 3MXUA 4K6LA 3S2HH 2TMPA 4JPBW 2EXZA 5IWAL 4N9TA 3J80i 3RZOH 1X3EA 3OIPA 4RA8A 3HOUG 4JK1C 5FJ8H 4DXGA 4FP5D 2QEJC 3CHBD 4ZUJA 5A2QL 4L5SA 3HOVH 3BG3A 1N9WA 2JA8G 1RIPA 2EYJA 5ELNA 1OTCA 3M3YB 2E5LQ 4IJLA 4UP8A 4JV5Q 1QUQB 5CC4A 1H9SB 4HMJA 3H3VI 1A2UA 2F0OA 1IBLL 4A3FH 3MXGA 3KF6A 1TQOA 1TWFB 1GHKA 1NE3A 1D1IA 1GD7A 2R7FA 3TS0A 1EIGA 4DAYA 1QVGA 1K8GA 3J7AV 4DN4M 5FO8B 1EWCA 5JEAJ 2WAQG 2Y0SB 1STBA 1A3TA 1GHJA 4BBSH 2A1AA 2QEXA 4H13C 4OONA 2N3SA 3NWSA 5LL6X 5CV4A 1I3QH 2XSCA 4EQ5A 5EGTA 5IGGA 1PH7A 2DNCA 5DLQE 3SDZA 2F0PA 4KLKA 2WKDA 3A8KE 3QIAA 1SNMA 1YHQA 2KHIA 2UXBQ 1DXMA 1J5EL 3HOZG 3S9WA 2F0IA 1CHPD 1SYDA 3I3CA 3KJPA 1YJ9A 4CKCA 4DV6L 2EY5A 1RJTA 1UWVA 4QUCA 1Q46A 2F0MA 3U9OA 3I4MH 4DAVA 3FRPB 3CRKC 1STNA 1N36Q 2EPBA 4A75A 2L0CA 2B2VC 2PNRC 2HDLA 5J3BA 3KF6B 1YJNA 5IGEA 1K28A 2NVQB 2CW0C 3TDQA 1D5XC 4DAYB 1Q81C 5DAUA 2EYMA 2ASBA 4OX9L 5LMUL 3G6JB 1NCVA 3UE0A 2CCZA 2F0NA 2F0GA 2XWBB 2XIWA 1YHAA 3HS0C 2B2UA 2PW5A 3Q0AA 3R2IA 4L5RC 3Q6SA 1NBWA 4J15A 1A3VA 5I2XA 4RGMA 2K52A 4B3ML 4DPGA 2PZUA 1EIFA 3V96A 5C3WA 4DUZQ 4QQBX 4KV6A 1VQAA 1B8AA 4DR1Q 2JA5B 1Q82C 1F9QA 1ZXTA 4DR2Q 3M7NA 4ULLA 3GTLB 3KBXA 1HNWL 4XTCS 3TEHB 1FVIA 3FVQA 4YCUA 3W2DA 3PQIA 3HZXA 2ZXPA 4PQXA 3TZUA 4A3KB 3ULJA 3OTOQ 2LY7A 1Y1VH 4WJ4A 5KGUA 2JE6I 4ZRZA 1SN8A 1GUWA 3S17H 4IALA 4ZCKA 4YHHL 4CDFC 1TIID 4EQPA 4C1NI 3VR3A 1VQPA 3M85A 1BO0A 3GTGH 4PG3A 2Z6KC 2JA5G 1JB7A 2GVAA 2HCIA 4JVZA 3E6ZX 1JJCB 4B3SL 5K36G 2CHBD 3K6OA 1SYCA 4P71A 4OIKA 2IT1A 2KQ3A 2B63H 3VDYA 1CZWA 1H9JA 4RCOA 4DV4L 4JI0Q 1QOHA 1PH5A 2Z0SA 3OYYA 3T53B 3QR8A 1GJXA 4DUZL 1V1PA 4IURA 4A3FB 2ATWA 2FMMA 2D5DA 2KA7A 4C3JH 5FJ8G 4DNIA 4DR2L 3HOVG 4HCEA 4BBSB 2NN6G 1D8LA 3OTOL 4RGNA 4BA1I 2PCFB 3D6CA 2K32A 1LTAD 2KOLA 3D4WA 2R6GA 5JEAH 4KI0A 3EQLC 1P8LA 1DZ1A 2H5XA 4PMCA 3RNUA 2KEEA 5TSSA 3BDOA 5CYUA 1GKHA 3A74A 4JC0A 1Q3LA 2CQAA 5DNFA 3RZDH 1LO5D 1EFWA 2NVXH 4BBSG 3B6YA 3I4MB 2RSNA 4GNXA 2KUMA 2KEDA 3N6RA 3HOWB 1ESFA 4B3RL 1V1PB 4IUVA 1FJGL 2R61A 3OHXC 4JI5L 3JAMi 3K5LA 3NTKA 3UDFA 4LF9Q 1VQBA 3CCEA 2AUKA 3FPPA 2Z6BA 3NPPA 3K8AA 1M4VA 2Z4HA 3GTPB 4IO9A 2I0QA 1A15A 1HH2P 3S24A 3G7LA 4IPGA 5GAHC 2VQEL 5EJWA 1SE3A 2E2DC 4APVA 5EAYA 3I55A 4ME5A 1RF2D 2KCNA 5CV7A 5IGFA 2F0WA 2KCCA 3PUVA 5IT9E 1E2ZA 2H1EA 1YVCA 4K8JA 2K04A 3DLLA 3FKIB 4XQJA 5CGKA 1A0IA 3NWTA 1X54A 1Q1EA 4GNXB 4AQYQ 3OMCA 1HTPA 2MO0A 3NTIA 2K6AA 1DYQA 1Y1VB 1WTVA 2N8NA 3AMUA 1I5FA 2CFMA 4X66Q 2TSSA 2F1MA 5IP7H 3F8TA 1VMPA 3S17B 1IHZA 1C48A 3M4OB 2L11A 3T1HL 4DV2Q 5KYIA 4LUZA 4POGA 4C2MH 4DK3C 3AEVA 2B8FA 1GOZA 2F03A 4JBJA 1Y1VG 1JMCA 3BVZA 3EVQA 2B63B 3I2ZA 1MJEA 4QJFA 1C8CA 3EIVA 1JT8A 1I4QA 1K3RA 5JVG3 4XYQA 1ZEQX 3CD6A 3MEHA 4JYAQ 1G6ZA 1ENAA 1L1OC 4HJ5A 1HTLD 4B3TQ 5GAGC 1XPOA 1Y14B 1VQGA 4RCNA 3V2TA 4TVAB 2J0TD 2WV6D 3D0FA 4GLVB 1E2VA 3NSWA 1EWIA 2O4XA 3K0YA 4KHVA 5EPJA 3PUXA 4DR5L 2B63G 3MXNA 4A3GB 4E6IA 3MVVA 4GS3A 4XQQA 3RLOA 4NPSA 1LT5D 4MNOA 5L37A 3VR5A 2E2JB 2E2IH 3VR4A 2FJ2A 3K81C 2KCMA 2F0TA 2F0JA 2OEOA 1FGUA 1LTBD 2MUYA 1PDQA 4C3JG 3HKSA 2AUJD 5IGCA 3U9SA 3PV0A 5ELOA 3I91A 3TZDA 4NXMQ 4A3EH 4LFBL 3RZDB 2NVXB 1KABA 4G7HC 3IL8A 1SE2A 3NBIA 3KLRA 2HCCA 4ZK9B 3CXCA 1XTCD 2FXQA 2J4XA 3I7FA 1XNRQ 3EBEA 3BS1A 3R3OA 5JEAG 4JBWA 3S16B 2RDFA 4RWSC 3OW7A 3QG1A 3R8BA 1KLUD 3OMGA 1EY6A 4XT3B 4ZAIA 3S2DH 5BR8Q 1SE4A 3TP6A 1S5BD 3MXNB 1VQIA 1I4HA 4A3DH 3RN2A 3A8JE 4NW2A 4QIWE 2P5ZX 3BZCA 1HA6A 1CTMA 2G5DA 4U673 4TKOB 5G3LD 2E75C 2RHQB 4LF4Q 4EX5A 5LMNW 3S1MB 1W3SA 1Z6HA 1Q86C 1R9TH 4R8IA 1VQ9A 1STEA 4LUOA 2PW7A 2KJXA 1SNQA 3PSIA 3CC7A 5IY0A 2V4DA 1GUGA 2BA0A 1BDOA 2EY1A 1PH9A 1HNXQ 4WRDA 4RGTA 1CQVA 5LMNL 1SRUA 1X3GA 2AHOB 5KNCA 5IT9c 4DAMA 5CV6A 3S1RH 1OXTA 2YYZA 5CV8A 3KJOA 2XGTA 4YY3Q 1AW7A 4PZ6A 4KTAA 3SVMA 4DR3Q 2B2TC 1BXTA 1C0AA 4C3HH 3BDCA 4JI6Q 1MHWC 2A6HD 2YV5A 1KAAA 3J7AF 2O5JC 1PFNA 3H0GH 5AJ3Q 1WFQA 1PV4A 4NP5A 4ZKBB 2HHHQ 3M3YH 4C56C 5BR8L 1LT4D 4LMQD 2JA9A 3LGJA 5EKIA 3AB9A 4QY7A 3HKZG 4G57A 5IP7G 2F3IA 2DUDA 1EY4A 1TWFH 3CW2C 1HNZQ 4DV5L 3MAQA 2ZJPA 4LF7Q 4GZYC 1U0LA 1HZAA 3PCOB 4KY7A 3SK5A 3W3AA 3CC4A 1KD1C 4BY7G 4KD3A 1HR0W 2X6GA 1LV9A 5C4JH 1P16A 3K7AB 3J80c 4PMBA 4O42A 1FNUA 1KNEA 2VXWA 3FP9A 2LSSA 3CPWA 2UU9Q 3P1HA 1M1KC 3PUYA 4KHPQ 3E0JA 2MJ8A 1SNCA 2E2IB 4HCSA 1HR0L 2MPMA 3I73A 4YY3L 4DR3L 4MIUA 2F0VA 4UAIA 4RHRA 1LT6D 4F7XA 1YI2A 2F0UA 3DM3A 1IKLA 4XXEA 1UE1A 2IX0A 4A3EB 3CCMA 2HHHL 4HR7B 1IZ6A 1LT3D 2ZTDA 1XMQQ 3CC2A 1CT1D 1CZGA 1L0XB 2NVQH 5IWAQ 1DOLA 1BBUA 4QF4A 1PZJD 2NVTH 1Y8NB 1HRJA 2YU9H 2PNHA 4UPAA 1PA6A 3TSSA 1G51A 2JJQA 2UUCL 4YCWA 1KL9A 4QIWB 4A3EG 2ZT9C 5COYA 1F2ZA 1Q1BA 1MIUA 4FNFA 3GTQH 3P75A 1PYBA 4A3DB 2A69C 2RCFA 1IBLQ 1IBKL 4YWLA 3CCLA 5G3LF 1ONLA 1N34L 2UU9L 4CKBA 3CPFA 1WI5A 2I46A 1R9TB 1PFSA 4QCLA 1B50A 1JJ2A 2JEAI 4LFAQ 3LNNA 4X3TA 1SYBA 1Y8OB 4LW1A 3V05A 4A3DG 4DV1L 5I9PA 3KYHC 1IW7C 3AQQA 4DK1A 2ICIA 4JOIC 4X6AH 2A68C 1J5EQ 2XNAC 3E9IA 3K7UC 1VF7A 1DONA 4DV6Q 2NTTA 4C3HB 5JJKA 4DV7L 4K6DA 1I4RA 3H0GB 4HJ8A 2N78A 2R93B 1R4QB 1X9NA 4MN3A 4UDUC 2AMCB 4BA2I 3DEPA 1Y8PB 2YTYA 3W5OA 2UXDL 1II3A 2EJGC 3MWYW 5IE8A 2R3ZA 4OX9Q 5LMUQ 1RL2A 3CP0A 1AZQA 1G6PA 2F0LA 4RGOS 1WD1A 4A76A 3LWEA 3F2DA 1W2BA 1UEBA 3CCJA 2QF7A 4H0LC 4N9PA 1E1OA 1W6KA 2EYHA 3H0GG 2R92H 4LFAL 5KIXA 1U9RA 3RN5A 3TQYA 4FYDA 4AYBE 1U4LA 5C4JB 2VQFL 4B3MQ 1EQRA 2KECA 3D4RA 3FEWX 2FFKB 1TKWB 1BOSA 1PH2A 1CSPA 4B9WA 5JPMC 4S3SA 2N55A 1ENCA 4IZ8A 1ICFB 4LNQA 3AYHB 3EJIA 3O13A 1HNWQ 3EROA 4FF1A 1B9NA 1EFID 2Y0SG 2B2WC 4WORA 2F4VL 4BBRB 1KXLA 1F2MA 5C4XB 3A55A 4XQNA 4L6TB 1EQTA 1PYSB 1L0WA 1RTNA 5M3MH 2ID0A 3VR2A 3NUCA 1YNXA 3HOWH 4YHHQ 4WJWA 1HZBA 4O2DA 5CBAE 5BN3A 4A93B 1STYA 1YNJD 5NUCA 1CKOA 2IHFA 1IL2A 3KFUA 4LFCQ 2NVTB 3HEJA 4B3SQ 3U50C 2OQ0A 5BN5A 5I9OA 2YU9B 3GTPH 3U4VA 1N8RC 1PH6A 1HHVA 1SNPA 3KBGA 3C1FA 1QZHA 1KC8C 2VNUD 1ENFA 2UXCL 2VL6A 4RKLA 1Z9FA 3GTQB 1GXDC 4EQOA 4DV4Q 1JOKA 2B39A 4YWMA 5IGBA 3J81E 4DKAC 2ZM6L 3T4AC 3SK8A 2K05A 4JI8Q 3ULLA 2VB2X 3K5NA 1XMOQ 4DV3L 1SNOA 1SXTA 1Y69U 5IT9L 5ISRA 1MKHA 5FKAC 2QW7A 3FKIH 5AFWA 1YHBA 1UAPA 1L0YB 3CCQA 3PO2H 2B29A 1XWEA 5FLMH 1X32A 2IX1A 1SDFA 4CJ2C 1BCPB 4L5QA 4BY1H 2YTVA 4DV0Q 3M4OH 2RKSA 2EY2A 5C3XA 1B53A 5FOBB 5IP9H 1U4PA 5CV9A 4JI1Q 1S4ZA 2Q8IB 4CKEA 2GVBA 4LFCL 2OTJA 2BE5D 1JB3A 2PZTA 2Z4IA 4GOPA 4A3KG 4XDXA 5FK9C 1ESRA 1VQHA 1H9KA 4QMGA 5IIFA 3C2PA 3I70A 1K3BC 5JOBA 1O7IA 4RMFA 2K03A 4B3RQ 3P7JA 3NP8A 3S1QB 1FJGQ 4JI5Q 2ZJRA 2EY6A 2RSOA 4JI8L 3F1ZA 2Z9HA 5C4ZA 4AYBB 1TY0A 4RAUC 1XMOL 2AWNA 4AH6A 2NUCA 3ER0A 4M1UB 4DR6L 2R92B 1BCPD 4HIKA 4FF4A 2VQEQ 1CQFA 2K7VA 5C0XI 1TY2A 3T16A 1HUNA 4A3GH 2ICEC 2GN5A 1D6EC 1UE5A 1EY0A 2VZAA 2EE1A 3GQBA 1RD9D 2RHSB 2E2JH 3A7LA 3GV3A 1U4RA 3H15A 3GDEA 2AQ1B 3UDXA 4K0KL 4M8AA 3PMFA 4A3FG 4DV0L 2XVSA 4TQUS 2B2UC 4AYBG 1KIXA 3T51B 1HFNA 4X65L 5IYBH 4JI1L 4Y7NB 4F88A 4GOPB 3LWUA 2R92G 2JA7H 3HFZB 4X3SA 1QNKA 5D65A 2PQAA 5D14A 1EYAA 5ELFA 2I5HA 2EYFA 2SEBD 1X55A 2PQEA 2MGSA 5M3MB 3DEOA 1J6QA 4KY6A 1N32L 1ET6A 1S40A 2L15A 3PUZA 2RDHA 2IJ0A 3T1HQ 3S16H 1WYDA 1SR3A 3PIPA 1Y1WH 1O7LA 5M5XH 1CA5A 4IQZA 4V190 3S15B 3CU7A 4MHEA 2BH2A 3M7GA 2CH4A 3A5ZB 1PFBA 1EEFD 4CJ1B 3I4MG 4J6HA 2XTIA 5JVH3 2K5QA 1E2WA 2QA4A 1B4OA 1JWSD 2EYLA 3HOWG 4PMWA 3M9BA 3NHHA 1H95A 4DGZA 3QWNA 3S1MH 1XPUA 2DGYA 3TBIB 4WJ3M 2IPKD 4ILWA 2I5MX 2NVYB 2IW3A 3CMAA 3SK4A 1I94L 1AE3A 2PQAB 1K8MA 1V1QA 3RLNA 4KJNA 2K5DA 4DR5Q 1X3PA 3IRBA 2IWHA 1WTQA 3PO2B 2C5CA 4EQNA 3PIO3 3H94A 3SHLA 3K58A 4DR7L 3J81c 3L7ZC 1IYJB 1JOOA 5GROA 3E9HA 3R93A 1FD7D 4HJ7A 4BY1B 4KN4C 1RODA 2K28A 1JWMD 1CFMA 1XNQL 1SBBB 1MSGA 3RLFA 2ZTCA 2OT2A 3FKIG 4LFBQ 4P2CB 1JR0D 3SR1A 1H9MA 1STAA 1X3QA 1UE7A 3J80E 1YEZA 3MHBA 4I7AA 2F3WA 2QKIC 3IAYA 1NNXA 5FLMG 1VS0A 1PTOH 2F0QA 4ZUIA 1TXYA 1PH4A 4BY1G 5C0XJ 5M5WB 2F4IA 5C5LA 2E76C 1OXVA 2C9OA 5IP9G 5M3FB 4O1NA 1VQMA 2J7ZA 1XJVA 4GNXC 4HSVA 2D0OA 4GKKQ 2B8GA 4G7ZC 1CA6A 2JA6H 4FO2A 2KHSA 3K7AH 3FMCA 4NMZA 1ILQA 2Q2IA 5IYCH 4X62L 4I7ZC 2M00A 1LTTD 3A7AB 4WFN3 1YBYA 5JJLA 1DGSA 3GTJH 4IPCA 5EPKA 1CI3M 3LX0A 3MTSA 4L63B 1JC7A 1HZCA 1LACA 4G7OC 1G91A 2RBMA 1EY5A 3CF5A 1WJJA 1PH8A 2JA7B 2K5NA 4H02A 1AN8A 1MD2D 3DWAA 3MXPA 1Q7YC 5I6WA 2OCEA 5LMNQ 4A3GG 1VF5C 3FDTA 1AFPA 4YIJA 1LTID 5C3EB 3I4NB 3A0JA 2K01A 4JI4L 1KTKA 2A6ED 4HSPA 1W6JA 2F0SA 5JJIA 2NB0A 2DJGC 2NTSA 5IYBG 1Y1WB 5M5XB 2JK8A 1QG7A 1PRTB 3HG9A 1JORA 4GKKL 3S14B 5EBDA 2A73B 3TP5A 4UY8C 2B2YA 1LUZA 1WCMH 2R7ZB 4OWWB 2LXKA 1K8OA 1KDCA 1K0RA 1IBML 1Q8IA 1U4MA 5KNBA 4DV5Q 3SEBA 3KLWA 3HOYB 1SMYD 1AH9A 1O78A 1YZ6A 4JI3L 1B3QA 1JOQA 1V9PA 1LTGD 3R2TA 4GLXA 1F2YA 3K59A 3F2BA 3I90A 5DEHA 2RVLA 2JP1A 2HD3A 2HT1A 2X69A 5D3DA 4IPHA 2EJFC 1HR0Q 5ELDA 2HQLA 1PRTD 3EFXD 3VYUA 1BUVT 3OW2A 4DR4Q 2M9VA 4IJHA 4QUFA 1K8AC 3HOUH 1HFGA 2AWOA 1HXYD 4GN5A 2XRSD 3RD4A 4GKJL 4KN7C 4B9XA 1VDZA 4OO1H 2A6HC 1ET9A 2R93H 2BDNA 3BVMA 4HEDA 5M5YH 2CWPA 1RCVD 2VS1A 4IUNA 5LL6S 3ONAB 1TWGB 1PTOB 1E24A 1CKNA 5CMDA 1T5XD 3L2PA 2QDLA 1X56A 1E22A 3EA6A 4F87A 5KRUA 3W1BA 2JEBI 2DNEA 1ICWA 2KVMA 3DM1A 4R4CA 4OHJA 4P72A 2PPBC 2UUCQ 1QB5D 3G6EA 4G4KA 1EZ8A 2JA6B 2JSOA 5E4WC 2Q2HA 5C0XH 2WAQE 4OEMB 4HN7A 3TMEA 1IBKQ 3GTJB 1B3AA 2NYZD 2HIXA 3AFPA 3J7ZC 2B3GA 5A35A 3D4DA 4A3MH 1N34Q 2JXMB 4HIDA 1C7YA 1VQ5A 1PVOA 3MEFA 3SE0A 1YNND 1DCZA 4GN4B 4DR4L 1TS4A 5JPNC 2NZOA 1NAPA 1ASYA 1C9OA 1VQJA 1VQEA 4BBRH 2JA6G 1VQCA 1UE6A 1PTOD 3TP7A 4DFAA 5C4XH 4Q5VA 3RMHA 3GD7A 2IY5B 5IYCG 2N49A 1RKNA 1DM0B 4DUYQ 3TS2A 4OWXB 1ML0D 4DV1Q 1M8AA 1HQRD 1CKNB 2MQHA 1DD2A 4JI2L 1OXUA 3ITPA 2AQ3B 4A93H 1O80A 2M2LA 2EXDA 3Q22A 1LM0A 1LTLA 3HRZC 3A56A 4KJOA 4DV7Q 2RQXA 1RHPA 5H1SE 1LTRD 1EQVA 3JAME 4IOCA 2VUMB 1X65A 1ZYRD 2X6LA 1EZ6A 1FL0A 4DNRB 1F9SA 3I4LA 5FO9B 3QO2A 1WCMB 3STBD 1E0BA 3VYTA 2UXDQ 3ND9A 3HP3A 1NSNS 2Q2UA 3STBC 3T1YL 4A3BB 1TVXA 2E74C 1BBXC 2A5HA 4R9WA 1D2BA 4EVOA 1XXGA 4K5VA 3J81L 1CUKA 3OSOA 1KDBA 4TRDA 1SFOB 4UP9A 2K4KA 5I6YA 2K14A 3PIOA 2ZTEA 5K5PA 4LUVA 2VQFQ 1VQLA 1WCMG 1T5EA 1F9PA 4DUYL 1QILA 4BXXH 1SJED 1UEAB 4DF7A 4NXNL 3AFQA 2B2VA 2Z8LA 1I4PA 1BQQT 2K5VA 1JWUD 3HOUB 2CH4W 4FF3A 4LF8L 3BVGA 4J1MA 2F4VQ 2LS01 1B2TA 3NXWA 3PF5A 4RG1A 4RFBA 5ELBA 4X64L 4CDDC 5M5YB 3D31A 3S1QH 3UDIA 4Z9CB 1PHJA 1L2FA 1NUCA 4L8JA 5E1FA 3P20A 2D9UA 4JBMA 3QOLA 3OWFA 3TP8A 4C3HG 2EVBA 2WAQB 2SDFA 1QNUA 1TR5A 1WTOA 3GO5A 2UUBL 2NN6H 4OO1G 1GUNA 3L3OC 3D8GA 1K83H 2F0EA 2UXCQ 2R93G 1SNDA 2OTLA 1EU3A 5EBCA 5EKLA 2ZM6Q 2ALYB 3CMEA 2MO1A 2ZXRA 2EOTA 2A8VA 2V1CC 2F0KA 4A3MB 3HOZB 1Q90A 3SXHA 4DV3Q 5FLXE 4A3IH 1WTHA 4Y7NH 1EEID 3ZJYC 2Z6KA 1NR4A 1EYCA 3ICEA 1PTOF 5C0XG 1QVFA 5LHY1 5M9OA 1TWAH 1GM5A 2EQSA 1BVSA 1TWCB 1KHIA 2BA1A 1A6XA 2FMCA 5EQ0A 4DK0A 1F77A 2KCTA 5BN4A 3GTKB 4AIMA 1M90C 1B7YB 2MFIA 1SJHD 4A3MG 1HCZA 1PYWD 3I72A 4JW0A 1FNVA 4ALPA 4A3JH 2G9HD 3S15H 1TS3A 2K75A 1YNJC 3BYTB 1AZPA 3GTMB 4K5WA 4BBRG 1EWHA 2FINB 1MI2A 1D5ZC 2A19A 5C4XG 5IOCA 2E5LL 1RDPD 4JV5L 4IOAA 1KRSA 4P74A 1HQMC 1MGSA 2CW0D 4JCVE 3BDLA 4CDEC 4H44C 3F2CA 5CBEE 4RHSA 4K8IA 4KKUA 4A93G 1NMGA 1TS2A 5E4XA 4DK6C 5J22A 3UDGA 1EUJA 1VQFA 2C35B 2NVYH 2MNAA 4IFDH 5C4HA 2XWJB 4DR6Q 3JAMc 4JBKA 1YITA 1PZKD 3L0OA 4K0KQ 1Z7TA 1G291 2UXBL 3CRLC 4J8QA 4X65Q 4CJ0B 4H7BA 4HAEA 2D2CC 1SAPA 5HY6A 4KKSA 1GUOA 3S1NB 2LKVA 3M4QA 1WTWA 4OO1I 4P73A 1I6HH 1DJRD 1O7YA 2SOBA 4LAAA 2BE5C 1IYVA 1N36L 3I8ZA 3CAMA 2F3VA 2D62A 3DXJC 1KAWA 4BXXG 4LF5Q 2KENA 2L12A 1N32Q 1NMFA 5GADC 5M5WH 3S2HB 1EU4A 4YCVA 3MA2B 5A2QE 3J80L 1J8IA 1MBYA 2EYPA 4UHVA 1JCKB 3E3XA 5M3FH 3RZOB 4R4OA 1KLGD 2CVRA 5ELEA 4ID6A 5EKKA 3T13A 2L55A 3HOVB 4R4QA 3H6MA 1S5CD 3WOFA 2O5IC 4PNYA 1RTOA 1B9MA 4KKTA 4TSSA 3CQZH 3HGBA
chains in the Genus database with same CATH topology
1SROA 1U0LA 1HZAA 1Q8KA 3PCOB 1IBLL 4A3FH 2JA6H 3KF6A 1SMXA 3K7AH 3CC4A 4A3CH 1NE3A 1KD1C 1GD7A 2Q2IA 2R7FA 5IYCH 4X62L 4BY7G 3TS0A 1HR0W 1QVGA 1YBYA 5C4JH 1DGSA 1P16A 3J80c 3GTJH 1K8GA 5JJLA 4IPCA 5JEAJ 3NELA 2WAQG 4DR1L 2CQOA 2HIVA 4BBSH 5C44H 2A1AA 3KDFA 1I94Q 1HZCA 3FP9A 2QEXA 4OONA 2LSSA 3CPWA 2UU9Q 2N3SA 1M1KC 3PUYA 4KHPQ 1I3QH 4EQ5A 1HR0L 1PH7A 3CF5A 1WJJA 5DLQE 4YY3L 4KLKA 1PH8A 1I50H 1NTGA 2CWAA 4DR3L 2K5NA 1YHQA 4H02A 4DR7Q 5C3EH 2KHIA 3I4NH 2UXBQ 1Q7YC 1J5EL 3HOZG 2OCEA 5LMNQ 4A3GG 1YI2A 4LF5L 3KJPA 1OXXK 3DM3A 2ES2A 4NB3A 1UE1A 2IX0A 3A0JA 1NY4A 3CCMA 4DV6L 1YJ9A 2HHHL 5FLXc 2K5HA 4JI4L 4A3IG 1UWVA 1XNQQ 1Q46A 3I4MH 1IZ6A 3G71A 5JJIA 2ZTDA 1XMQQ 4A4IA 1N36Q 3CC2A 4A75A 1L1OA 3PO3H 5IYBG 2NVQH 5J3BA 5IWAQ 3CCUA 3S14H 1BBUA 2JK8A 3KF6B 1VQNA 1YJNA 1CSQA 1K9MC 2NVTH 2R7ZH 4GKKL 5M3MG 2QGQA 2YU9H 2PNHA 4UPAA 1PA6A 4DAYB 1G51A 1Q81C 4UY8C 2ASBA 4JI0L 2JJQA 2PMZE 4HJAA 5LMUL 2UUCL 4OX9L 3UE0A 4YCWA 1KL9A 1LUZA 1WCMH 2CCZA 4OWWB 3U58A 4A3EG 2LXKA 1VQKA 1YHAA 1K0RA 1Q1BA 1IBML 3HOYH 1MIUA 1WOCA 3GTQH 5IYDH 1V43A 3E0EA 3KDFB 4GOPC 4A3JG 4DV5Q 4JI7Q 1PYBA 4UP7A 3KLWA 4LF7Q 4HJ9A 1AH9A 1IBLQ 4L5RC 1NBWA 4J15A 1IBKL 3GTOH 4YWLA 1YZ6A 4JI3L 2K52A 3CCLA 3BU2A 4B3ML 4DPGA 1N34L 2UU9L 1V9PA 4X62Q 3K0XA 1EIFA 4GLXA 3CPFA 4DUZQ 1WI5A 3F2BA 4QQBX 1PFSA 2CKZB 3TRZA 3TREA 1JJ2A 2JEAI 4LFAQ 1YIJA 1VQAA 1B8AA 1AE2A 4DR1Q 1Q82C 3CCVA 4DR2Q 1QZGA 3ERSX 3M7NA 2HT1A 4LW1A 1HNWL 4XTCS 3TEHB 1FVIA 4IPHA 3Q8DA 4YCUA 4MZ9A 2D0PA 4A3DG 3W1GA 3ULJA 1HR0Q 3OTOQ 1L1OB 2HQLA 4DV1L 4IFDG 1Y1VH 3KYHC 3AQQA 4WJ4A 3OW2A 1S3OA 4DR4Q 4IJHA 1K8AC 3HOUH 4JOIC 2AWOA 2JE6I 4X6AH 4GN5A 1SN8A 1TWHH 3J81j 1J5EQ 4GLAC 3S17H 3PO2G 3E9IA 3K7UC 4YHHL 4GKJL 3GTGH 1VQPA 3M85A 4HIOA 4DV6Q 4PG3A 2Z6KC 2JA5G 5JJKA 1KQSA 1JB7A 2GVAA 4JI4Q 2R93H 1TWGH 4DV7L 5M5YH 2E2HH 2CWPA 3PUWA 3G4SA 4LF9L 1BKBA 1VQOA 5HGQA 2VS1A 1JJCB 3HKZE 4HJ8A 2N78A 4B3SL 1VQ7A 5K36G 1X9NA 4P71A 2AMCB 1E24A 1CKNA 4BA2I 3L2PA 4JG2A 2YTYA 4BY7H 1X56A 2IT1A 2B63H 2Q2TA 1E22A 2VW9A 3VDYA 2JQOA 2UUAQ 4JI7L 3W1BA 2JEBI 4YWKA 3W5OA 2UXDL 4A3LH 2NN6I 5E7NA 5IE8A 4DV4L 4R4CA 2WB1E 4P72A 4JI0Q 4OX9Q 3I4OA 1RL2A 2RF4A 2Z0SA 3CP0A 5LMUQ 3G6EA 1PH5A 3OYYA 2UUCQ 1G6PA 4A76A 2OQKA 3F2DA 1W2BA 1UEBA 3CCJA 4DUZL 1IBMQ 1K73C 2ATWA 3H3VH 1E1OA 2Q2HA 3CCRA 3H0GG 2WAQE 2R92H 4LFAL 3I56A 1SLJA 3RN5A 4C3JH 4FDBA 1GO3E 4R4TA 3TQYA 4AYBE 5FJ8G 4DNIA 4DR2L 1NJIC 1IBKQ 2HIXA 4P75A 4JI3Q 3HOVG 5M3FG 3AFPA 2VQFL 3J7ZC 4B3MQ 2B3GA 4A3MH 2RCNA 1EQRA 1N34Q 4HIDA 1C7YA 2NN6G 1VCIA 1VQ5A 1JE5A 1D8LA 2EIFA 3MEFA 3OTOL 1PVOA 4B3TL 4GN4B 4DR4L 1PH2A 2NZOA 1CSPA 3M4PA 4BA1I 1ASYA 1C9OA 4AQYL 1VQJA 1VQEA 3NBHB 1JJGA 1Z47A 4QGUA 4BBRH 3AYHB 1VQCA 2R6GA 1UE6A 4LNQA 2JA6G 4A3CG 3K80C 4KI0A 4X66L 5C4XH 1HNWQ 1P8LA 3GD7A 2IY5B 5IYCG 2N49A 2Y0SG 1HZ9A 2H5XA 4DUYQ 4OWXB 2F4VL 3TS2A 1D7QA 3RNUA 4DV1Q 1A62A 1KXLA 1GKHA 3PGZA 3A74A 4JC0A 3JC66 4R4IA 1CKNB 2MQHA 1L0WA 1PYSB 5M3MH 3RZDH 4JI2L 2ID0A 1EFWA 1OXUA 4OWTB 4DV2L 2NVXH 4BBSG 4C3IH 1YNXA 3WWVA 5C44G 3HOXH 3B6YA 3HOWH 4YHHQ 4A93H 4GKJQ 4GNXA 2EXDA 1HZBA 1LM0A 1LTLA 1S72A 2UUAL 2JA7G 2VUMH 4O2DA 4B3RL 1MJCA 4DV7Q 1CKOA 5H1SE 1FJGL 2IHFA 1IL2A 4JI5L 3JAMi 4LF9Q 4LFCQ 3KFUA 4IOCA 3UDFA 1VQBA 3FHWA 5C3EG 1X65A 3CCEA 4B3SQ 3I4NG 3U50C 2OQ0A 3GTPH 1GVPA 1N33Q 3U4VA 1N8RC 1PH6A 1FL0A 4A3BH 3CQZH 2OWOA 3K8AA 3STBD 4JYAL 1QZHA 1KC8C 2VNUD 4IO9A 2I0QA 2UXDQ 1HH2P 2UXCL 2VL6A 5GQOA 1Z9FA 3S24A 4IPGA 3STBC 3T1YL 4DV4Q 4R1JA 1Y1WG 5GAHC 2Q2UA 4YWMA 2VQEL 1B70B 4HIMA 1SFOH 3J81i 4IFDI 3EN2A 4APVA 5EAYA 2WP8J 3I55A 4DKAC 2ZM6L 1E3PA 3PO3G 1CUKA 4JI8Q 3ULLA 1VQ6A 3PUVA 4UP9A 1XMOQ 2K4KA 4KHZA 4DV3L 2R7ZG 2KHJA 2K14A 1MKHA 3PIOA 1YVCA 2ZTEA 3FKIH 1PH1A 4PZ8A 4LUVA 2VQFQ 1VQLA 1YHBA 1WCMG 3CCQA 4POFA 3PO2H 4DUYL 3DLLA 4BXXH 2B29A 3HOYG 1A0IA 1X54A 1Q1EA 5IYDG 4NXNL 4GNXB 3AFQA 5GAEC 1EIYB 5FLMH 4AQYQ 4PZ7A 2MO0A 2F52A 1XPRA 2IX1A 1BBWA 2K5VA 4L5QA 4BY1H 2N8NA 2YTVA 4DV0Q 1I5FA 2JA8H 3M4OH 2CFMA 4X66Q 4NXML 5IP7H 3A5UA 5IP9H 4LF8L 3F8TA 2R7DA 2BH8A 2F4VQ 4JI1Q 3J7A5 4O0AA 3PF5A 4RG1A 2GVBA 4LFCL 1XNRL 2OTJA 3T1HL 4JI2Q 4DV2Q 2KBNA 4GOPA 4X64L 4A3KG 1N33L 1VQHA 2LXJA 4LUZA 3D31A 4POGA 3S1QH 1O7IA 3NENA 3UDIA 4RMFA 2WFWA 4C2MH 4DK3C 1PHJA 2NZHA 3AEVA 1L2FA 4B3RQ 2K50A 4JBJA 1Y1VG 1JMCA 1E1TA 1FJGQ 4JI5Q 3I2ZA 1MJEA 4QJFA 2ZJRA 3EIVA 1JT8A 4JBMA 1OXSC 1K3RA 4JI8L 3F1ZA 1SE8A 4MTNA 3CD6A 2UUBL 3GO5A 1VQ8A 4OO1G 1XTDA 1XMOL 4JYAQ 2AWNA 1KRTA 4AH6A 1K83H 1T9HA 1L1OC 1ASZA 3ER0A 4HJ5A 2UXCQ 2R93G 3T1YQ 4B3TQ 5GAGC 4DR6L 4HIKA 2VQEQ 2OTLA 5C0XI 4LF4L 1XPOA 1Y14B 3HOZH 1VQGA 2ZM6Q 2ALYB 3CMEA 2MO1A 4A3GH 2GN5A 1UE5A 2VZAA 2WB1G 4JOIA 2A8VA 4TVAB 2V1CC 3D0FA 4GLVB 2B63G 1EWIA 4DR5L 2RHSB 3PUXA 2E2JH 3H15A 4DV3Q 3GDEA 1X3FA 4GS3A 3UDXA 4A3IH 4K0KL 2PI2E 4A3LG 3RLOA 4Y7NH 4A3FG 4DV0L 4NPSA 3ZJYC 4TQUS 2Z6KA 4MNOA 4Y52H 1HNXL 4XIGS 4AYBG 2E2IH 1KIXA 2Y0SE 3K81C 2KCMA 5IYBH 4X65L 4JI1L 1TWCH 3ICEA 1EOVA 4GOPB 5C0XG 1FGUA 1QVFA 1YJWA 4NXNQ 2JA7H 2R92G 3GTKH 3HFZB 4LF6Q 1TWAH 3G48A 2PQAA 1GM5A 1Q12A 2EQSA 1BVSA 2BA1A 1KHIA 3HKSA 3KOJA 2I5HA 1EQQA 1CKMA 2KCTA 3PV0A 5ELOA 4AIMA 1M90C 1X55A 3U4ZA 1B7YB 4A3EH 2MFIA 3BJUA 3UE1A 4A3MG 4NXMQ 4LFBL 1J6QA 3ULPA 4JI6L 4LF8Q 1A63A 1N32L 5AJ3L 1S40A 2L15A 4ALPA 1U5KA 4ME3A 4A3JH 3GTMH 3CXCA 3S15H 3PUZA 2FXQA 2K75A 1XNRQ 3I7FA 3T1HQ 1A8VA 1VQDA 1WYDA 3S16H 3EBEA 1SR3A 3PIPA 4OXPA 1Y1WH 4IFDJ 4X64Q 5M5XH 4BBRG 4GN3B 5JEAG 2A19A 2BH2A 1QVCA 5C4XG 4JBWA 4IPDA 2E5LL 4JV5L 4IOAA 1KRSA 3A5ZB 4P74A 2IHEA 2ZJQA 4JCVE 4QL5A 1HNZL 3I4MG 2XTIA 3F2CA 3S2DH 4LF7L 5BR8Q 2QA4A 3MXNB 3HOXG 1VQIA 4PMWA 3HOWG 1NMGA 4A93G 4DK6C 3UDGA 1EUJA 3M9BA 1VQFA 2AKWB 2UUBQ 1H95A 1HJPA 3CCSA 2C35B 4A3DH 3RN2A 4QIWE 2NVYH 2VUMG 2MNAA 3BZCA 1XPUA 3S1MH 2DGYA 3PF4A 4DR6Q 3JAMc 4WJ3M 2I5LX 2RHQB 4JBKA 2I5MX 4LF4Q 4EX5A 5LMNW 1PH3A 1W3SA 3CMAA 1Q86C 1YITA 1R9TH 1QUQA 1IXRA 1AE3A 2PQAB 1I94L 3NEMA 3SGIA 1VQ9A 4LUOA 1V1QA 3RLNA 4A3BG 4L5TA 2VY3A 4KHPL 3PSIA 4DR5Q 3CC7A 2JA5H 4LF6L 3IRBA 3L0OA 5IY0A 1EYGA 4K0KQ 1X6OA 2BA0A 1G291 1E7ZA 3GTLH 4DR7L 3KF8B 2PI2A 3J81c 3L7ZC 1IYJB 1PH9A 1HNXQ 2YTXA 2UXBL 4LWCA 5GROA 1VQ4A 4A3KH 3E9HA 4X65Q 5LMNL 1SRUA 1X3GA 2AHOB 3BZKA 3S1NH 4HJ7A 2E8GA 5HY6A 5IT9c 4DAMA 3S1RH 1OXTA 2YYZA 3KJOA 3M4QA 4OO1I 2XGTA 4P73A 1XNQL 4YY3Q 1I6HH 4PZ6A 1LYLA 3RLFA 3RR5A 2ZTCA 3FKIG 4DR3Q 1XMQL 1N36L 3CAMA 3S2HH 4LFBQ 1C0AA 4C3HH 2D62A 4JI6Q 1KAWA 4BXXG 2YV5A 5IWAL 4LF5Q 2KENA 1N32Q 3J80i 1UE7A 1NMFA 3H0GH 1YEZA 5GADC 1X3EA 5AJ3Q 5M5WH 1WFQA 3RZOH 1PV4A 4YCVA 2HHHQ 3HOUG 5FLMG 3M3YH 5FJ8H 5BR8L 1VS0A 2JA9A 1TXYA 3LGJA 4L5SA 3HOVH 5M3FH 4BY1G 5C0XJ 1PH4A 2JA8G 1N9WA 4R4OA 4QY7A 1RIPA 3HKZG 5ELNA 1OTCA 5IP7G 1OXVA 2E5LQ 2F3IA 4IJLA 4UP8A 5IP9G 2DUDA 4JV5Q 4R4QA 1VQMA 1QUQB 1TWFH 3CW2C 1HNZQ 4DV5L 1XJVA 4GNXC 3H3VI 2D0OA 4GKKQ 2ZJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRO A;  1U0L A;  1HZA A;  1Q8K A;  3PCO B;  1IBL L;  4A3F H;  2JA6 H;  3KF6 A;  1SMX A;  3K7A H;  3CC4 A;  4A3C H;  1NE3 A;  1KD1 C;  1GD7 A;  2Q2I A;  2R7F A;  5IYC H;  4X62 L;  4BY7 G;  3TS0 A;  1HR0 W;  1QVG A;  1YBY A;  5C4J H;  1DGS A;  1P16 A;  3J80 c;  3GTJ H;  1K8G A;  5JJL A;  4IPC A;  5JEA J;  3NEL A;  2WAQ G;  4DR1 L;  2CQO A;  2HIV A;  4BBS H;  5C44 H;  2A1A A;  3KDF A;  1I94 Q;  1HZC A;  3FP9 A;  2QEX A;  4OON A;  2LSS A;  3CPW A;  2UU9 Q;  2N3S A;  1M1K C;  3PUY A;  4KHP Q;  1I3Q H;  4EQ5 A;  1HR0 L;  1PH7 A;  3CF5 A;  1WJJ A;  5DLQ E;  4YY3 L;  4KLK A;  1PH8 A;  1I50 H;  1NTG A;  2CWA A;  4DR3 L;  2K5N A;  1YHQ A;  4H02 A;  4DR7 Q;  5C3E H;  2KHI A;  3I4N H;  2UXB Q;  1Q7Y C;  1J5E L;  3HOZ G;  2OCE A;  5LMN Q;  4A3G G;  1YI2 A;  4LF5 L;  3KJP A;  1OXX K;  3DM3 A;  2ES2 A;  4NB3 A;  1UE1 A;  2IX0 A;  3A0J A;  1NY4 A;  3CCM A;  4DV6 L;  1YJ9 A;  2HHH L;  5FLX c;  2K5H A;  4JI4 L;  4A3I G;  1UWV A;  1XNQ Q;  1Q46 A;  3I4M H;  1IZ6 A;  3G71 A;  5JJI A;  2ZTD A;  1XMQ Q;  4A4I A;  1N36 Q;  3CC2 A;  4A75 A;  1L1O A;  3PO3 H;  5IYB G;  2NVQ H;  5J3B A;  5IWA Q;  3CCU A;  3S14 H;  1BBU A;  2JK8 A;  3KF6 B;  1VQN A;  1YJN A;  1CSQ A;  1K9M C;  2NVT H;  2R7Z H;  4GKK L;  5M3M G;  2QGQ A;  2YU9 H;  2PNH A;  4UPA A;  1PA6 A;  4DAY B;  1G51 A;  1Q81 C;  4UY8 C;  2ASB A;  4JI0 L;  2JJQ A;  2PMZ E;  4HJA A;  5LMU L;  2UUC L;  4OX9 L;  3UE0 A;  4YCW A;  1KL9 A;  1LUZ A;  1WCM H;  2CCZ A;  4OWW B;  3U58 A;  4A3E G;  2LXK A;  1VQK A;  1YHA A;  1K0R A;  1Q1B A;  1IBM L;  3HOY H;  1MIU A;  1WOC A;  3GTQ H;  5IYD H;  1V43 A;  3E0E A;  3KDF B;  4GOP C;  4A3J G;  4DV5 Q;  4JI7 Q;  1PYB A;  4UP7 A;  3KLW A;  4LF7 Q;  4HJ9 A;  1AH9 A;  1IBL Q;  4L5R C;  1NBW A;  4J15 A;  1IBK L;  3GTO H;  4YWL A;  1YZ6 A;  4JI3 L;  2K52 A;  3CCL A;  3BU2 A;  4B3M L;  4DPG A;  1N34 L;  2UU9 L;  1V9P A;  4X62 Q;  3K0X A;  1EIF A;  4GLX A;  3CPF A;  4DUZ Q;  1WI5 A;  3F2B A;  4QQB X;  1PFS A;  2CKZ B;  3TRZ A;  3TRE A;  1JJ2 A;  2JEA I;  4LFA Q;  1YIJ A;  1VQA A;  1B8A A;  1AE2 A;  4DR1 Q;  1Q82 C;  3CCV A;  4DR2 Q;  1QZG A;  3ERS X;  3M7N A;  2HT1 A;  4LW1 A;  1HNW L;  4XTC S;  3TEH B;  1FVI A;  4IPH A;  3Q8D A;  4YCU A;  4MZ9 A;  2D0P A;  4A3D G;  3W1G A;  3ULJ A;  1HR0 Q;  3OTO Q;  1L1O B;  2HQL A;  4DV1 L;  4IFD G;  1Y1V H;  3KYH C;  3AQQ A;  4WJ4 A;  3OW2 A;  1S3O A;  4DR4 Q;  4IJH A;  1K8A C;  3HOU H;  4JOI C;  2AWO A;  2JE6 I;  4X6A H;  4GN5 A;  1SN8 A;  1TWH H;  3J81 j;  1J5E Q;  4GLA C;  3S17 H;  3PO2 G;  3E9I A;  3K7U C;  4YHH L;  4GKJ L;  3GTG H;  1VQP A;  3M85 A;  4HIO A;  4DV6 Q;  4PG3 A;  2Z6K C;  2JA5 G;  5JJK A;  1KQS A;  1JB7 A;  2GVA A;  4JI4 Q;  2R93 H;  1TWG H;  4DV7 L;  5M5Y H;  2E2H H;  2CWP A;  3PUW A;  3G4S A;  4LF9 L;  1BKB A;  1VQO A;  5HGQ A;  2VS1 A;  1JJC B;  3HKZ E;  4HJ8 A;  2N78 A;  4B3S L;  1VQ7 A;  5K36 G;  1X9N A;  4P71 A;  2AMC B;  1E24 A;  1CKN A;  4BA2 I;  3L2P A;  4JG2 A;  2YTY A;  4BY7 H;  1X56 A;  2IT1 A;  2B63 H;  2Q2T A;  1E22 A;  2VW9 A;  3VDY A;  2JQO A;  2UUA Q;  4JI7 L;  3W1B A;  2JEB I;  4YWK A;  3W5O A;  2UXD L;  4A3L H;  2NN6 I;  5E7N A;  5IE8 A;  4DV4 L;  4R4C A;  2WB1 E;  4P72 A;  4JI0 Q;  4OX9 Q;  3I4O A;  1RL2 A;  2RF4 A;  2Z0S A;  3CP0 A;  5LMU Q;  3G6E A;  1PH5 A;  3OYY A;  2UUC Q;  1G6P A;  4A76 A;  2OQK A;  3F2D A;  1W2B A;  1UEB A;  3CCJ A;  4DUZ L;  1IBM Q;  1K73 C;  2ATW A;  3H3V H;  1E1O A;  2Q2H A;  3CCR A;  3H0G G;  2WAQ E;  2R92 H;  4LFA L;  3I56 A;  1SLJ A;  3RN5 A;  4C3J H;  4FDB A;  1GO3 E;  4R4T A;  3TQY A;  4AYB E;  5FJ8 G;  4DNI A;  4DR2 L;  1NJI C;  1IBK Q;  2HIX A;  4P75 A;  4JI3 Q;  3HOV G;  5M3F G;  3AFP A;  2VQF L;  3J7Z C;  4B3M Q;  2B3G A;  4A3M H;  2RCN A;  1EQR A;  1N34 Q;  4HID A;  1C7Y A;  2NN6 G;  1VCI A;  1VQ5 A;  1JE5 A;  1D8L A;  2EIF A;  3MEF A;  3OTO L;  1PVO A;  4B3T L;  4GN4 B;  4DR4 L;  1PH2 A;  2NZO A;  1CSP A;  3M4P A;  4BA1 I;  1ASY A;  1C9O A;  4AQY L;  1VQJ A;  1VQE A;  3NBH B;  1JJG A;  1Z47 A;  4QGU A;  4BBR H;  3AYH B;  1VQC A;  2R6G A;  1UE6 A;  4LNQ A;  2JA6 G;  4A3C G;  3K80 C;  4KI0 A;  4X66 L;  5C4X H;  1HNW Q;  1P8L A;  3GD7 A;  2IY5 B;  5IYC G;  2N49 A;  2Y0S G;  1HZ9 A;  2H5X A;  4DUY Q;  4OWX B;  2F4V L;  3TS2 A;  1D7Q A;  3RNU A;  4DV1 Q;  1A62 A;  1KXL A;  1GKH A;  3PGZ A;  3A74 A;  4JC0 A;  3JC6 6;  4R4I A;  1CKN B;  2MQH A;  1L0W A;  1PYS B;  5M3M H;  3RZD H;  4JI2 L;  2ID0 A;  1EFW A;  1OXU A;  4OWT B;  4DV2 L;  2NVX H;  4BBS G;  4C3I H;  1YNX A;  3WWV A;  5C44 G;  3HOX H;  3B6Y A;  3HOW H;  4YHH Q;  4A93 H;  4GKJ Q;  4GNX A;  2EXD A;  1HZB A;  1LM0 A;  1LTL A;  1S72 A;  2UUA L;  2JA7 G;  2VUM H;  4O2D A;  4B3R L;  1MJC A;  4DV7 Q;  1CKO A;  5H1S E;  1FJG L;  2IHF A;  1IL2 A;  4JI5 L;  3JAM i;  4LF9 Q;  4LFC Q;  3KFU A;  4IOC A;  3UDF A;  1VQB A;  3FHW A;  5C3E G;  1X65 A;  3CCE A;  4B3S Q;  3I4N G;  3U50 C;  2OQ0 A;  3GTP H;  1GVP A;  1N33 Q;  3U4V A;  1N8R C;  1PH6 A;  1FL0 A;  4A3B H;  3CQZ H;  2OWO A;  3K8A A;  3STB D;  4JYA L;  1QZH A;  1KC8 C;  2VNU D;  4IO9 A;  2I0Q A;  2UXD Q;  1HH2 P;  2UXC L;  2VL6 A;  5GQO A;  1Z9F A;  3S24 A;  4IPG A;  3STB C;  3T1Y L;  4DV4 Q;  4R1J A;  1Y1W G;  5GAH C;  2Q2U A;  4YWM A;  2VQE L;  1B70 B;  4HIM A;  1SFO H;  3J81 i;  4IFD I;  3EN2 A;  4APV A;  5EAY A;  2WP8 J;  3I55 A;  4DKA C;  2ZM6 L;  1E3P A;  3PO3 G;  1CUK A;  4JI8 Q;  3ULL A;  1VQ6 A;  3PUV A;  4UP9 A;  1XMO Q;  2K4K A;  4KHZ A;  4DV3 L;  2R7Z G;  2KHJ A;  2K14 A;  1MKH A;  3PIO A;  1YVC A;  2ZTE A;  3FKI H;  1PH1 A;  4PZ8 A;  4LUV A;  2VQF Q;  1VQL A;  1YHB A;  1WCM G;  3CCQ A;  4POF A;  3PO2 H;  4DUY L;  3DLL A;  4BXX H;  2B29 A;  3HOY G;  1A0I A;  1X54 A;  1Q1E A;  5IYD G;  4NXN L;  4GNX B;  3AFQ A;  5GAE C;  1EIY B;  5FLM H;  4AQY Q;  4PZ7 A;  2MO0 A;  2F52 A;  1XPR A;  2IX1 A;  1BBW A;  2K5V A;  4L5Q A;  4BY1 H;  2N8N A;  2YTV A;  4DV0 Q;  1I5F A;  2JA8 H;  3M4O H;  2CFM A;  4X66 Q;  4NXM L;  5IP7 H;  3A5U A;  5IP9 H;  4LF8 L;  3F8T A;  2R7D A;  2BH8 A;  2F4V Q;  4JI1 Q;  3J7A 5;  4O0A A;  3PF5 A;  4RG1 A;  2GVB A;  4LFC L;  1XNR L;  2OTJ A;  3T1H L;  4JI2 Q;  4DV2 Q;  2KBN A;  4GOP A;  4X64 L;  4A3K G;  1N33 L;  1VQH A;  2LXJ A;  4LUZ A;  3D31 A;  4POG A;  3S1Q H;  1O7I A;  3NEN A;  3UDI A;  4RMF A;  2WFW A;  4C2M H;  4DK3 C;  1PHJ A;  2NZH A;  3AEV A;  1L2F A;  4B3R Q;  2K50 A;  4JBJ A;  1Y1V G;  1JMC A;  1E1T A;  1FJG Q;  4JI5 Q;  3I2Z A;  1MJE A;  4QJF A;  2ZJR A;  3EIV A;  1JT8 A;  4JBM A;  1OXS C;  1K3R A;  4JI8 L;  3F1Z A;  1SE8 A;  4MTN A;  3CD6 A;  2UUB L;  3GO5 A;  1VQ8 A;  4OO1 G;  1XTD A;  1XMO L;  4JYA Q;  2AWN A;  1KRT A;  4AH6 A;  1K83 H;  1T9H A;  1L1O C;  1ASZ A;  3ER0 A;  4HJ5 A;  2UXC Q;  2R93 G;  3T1Y Q;  4B3T Q;  5GAG C;  4DR6 L;  4HIK A;  2VQE Q;  2OTL A;  5C0X I;  4LF4 L;  1XPO A;  1Y14 B;  3HOZ H;  1VQG A;  2ZM6 Q;  2ALY B;  3CME A;  2MO1 A;  4A3G H;  2GN5 A;  1UE5 A;  2VZA A;  2WB1 G;  4JOI A;  2A8V A;  4TVA B;  2V1C C;  3D0F A;  4GLV B;  2B63 G;  1EWI A;  4DR5 L;  2RHS B;  3PUX A;  2E2J H;  3H15 A;  4DV3 Q;  3GDE A;  1X3F A;  4GS3 A;  3UDX A;  4A3I H;  4K0K L;  2PI2 E;  4A3L G;  3RLO A;  4Y7N H;  4A3F G;  4DV0 L;  4NPS A;  3ZJY C;  4TQU S;  2Z6K A;  4MNO A;  4Y52 H;  1HNX L;  4XIG S;  4AYB G;  2E2I H;  1KIX A;  2Y0S E;  3K81 C;  2KCM A;  5IYB H;  4X65 L;  4JI1 L;  1TWC H;  3ICE A;  1EOV A;  4GOP B;  5C0X G;  1FGU A;  1QVF A;  1YJW A;  4NXN Q;  2JA7 H;  2R92 G;  3GTK H;  3HFZ B;  4LF6 Q;  1TWA H;  3G48 A;  2PQA A;  1GM5 A;  1Q12 A;  2EQS A;  1BVS A;  2BA1 A;  1KHI A;  3HKS A;  3KOJ A;  2I5H A;  1EQQ A;  1CKM A;  2KCT A;  3PV0 A;  5ELO A;  4AIM A;  1M90 C;  1X55 A;  3U4Z A;  1B7Y B;  4A3E H;  2MFI A;  3BJU A;  3UE1 A;  4A3M G;  4NXM Q;  4LFB L;  1J6Q A;  3ULP A;  4JI6 L;  4LF8 Q;  1A63 A;  1N32 L;  5AJ3 L;  1S40 A;  2L15 A;  4ALP A;  1U5K A;  4ME3 A;  4A3J H;  3GTM H;  3CXC A;  3S15 H;  3PUZ A;  2FXQ A;  2K75 A;  1XNR Q;  3I7F A;  3T1H Q;  1A8V A;  1VQD A;  1WYD A;  3S16 H;  3EBE A;  1SR3 A;  3PIP A;  4OXP A;  1Y1W H;  4IFD J;  4X64 Q;  5M5X H;  4BBR G;  4GN3 B;  5JEA G;  2A19 A;  2BH2 A;  1QVC A;  5C4X G;  4JBW A;  4IPD A;  2E5L L;  4JV5 L;  4IOA A;  1KRS A;  3A5Z B;  4P74 A;  2IHE A;  2ZJQ A;  4JCV E;  4QL5 A;  1HNZ L;  3I4M G;  2XTI A;  3F2C A;  3S2D H;  4LF7 L;  5BR8 Q;  2QA4 A;  3MXN B;  3HOX G;  1VQI A;  4PMW A;  3HOW G;  1NMG A;  4A93 G;  4DK6 C;  3UDG A;  1EUJ A;  3M9B A;  1VQF A;  2AKW B;  2UUB Q;  1H95 A;  1HJP A;  3CCS A;  2C35 B;  4A3D H;  3RN2 A;  4QIW E;  2NVY H;  2VUM G;  2MNA A;  3BZC A;  1XPU A;  3S1M H;  2DGY A;  3PF4 A;  4DR6 Q;  3JAM c;  4WJ3 M;  2I5L X;  2RHQ B;  4JBK A;  2I5M X;  4LF4 Q;  4EX5 A;  5LMN W;  1PH3 A;  1W3S A;  3CMA A;  1Q86 C;  1YIT A;  1R9T H;  1QUQ A;  1IXR A;  1AE3 A;  2PQA B;  1I94 L;  3NEM A;  3SGI A;  1VQ9 A;  4LUO A;  1V1Q A;  3RLN A;  4A3B G;  4L5T A;  2VY3 A;  4KHP L;  3PSI A;  4DR5 Q;  3CC7 A;  2JA5 H;  4LF6 L;  3IRB A;  3L0O A;  5IY0 A;  1EYG A;  4K0K Q;  1X6O A;  2BA0 A;  1G29 1;  1E7Z A;  3GTL H;  4DR7 L;  3KF8 B;  2PI2 A;  3J81 c;  3L7Z C;  1IYJ B;  1PH9 A;  1HNX Q;  2YTX A;  2UXB L;  4LWC A;  5GRO A;  1VQ4 A;  4A3K H;  3E9H A;  4X65 Q;  5LMN L;  1SRU A;  1X3G A;  2AHO B;  3BZK A;  3S1N H;  4HJ7 A;  2E8G A;  5HY6 A;  5IT9 c;  4DAM A;  3S1R H;  1OXT A;  2YYZ A;  3KJO A;  3M4Q A;  4OO1 I;  2XGT A;  4P73 A;  1XNQ L;  4YY3 Q;  1I6H H;  4PZ6 A;  1LYL A;  3RLF A;  3RR5 A;  2ZTC A;  3FKI G;  4DR3 Q;  1XMQ L;  1N36 L;  3CAM A;  3S2H H;  4LFB Q;  1C0A A;  4C3H H;  2D62 A;  4JI6 Q;  1KAW A;  4BXX G;  2YV5 A;  5IWA L;  4LF5 Q;  2KEN A;  1N32 Q;  3J80 i;  1UE7 A;  1NMF A;  3H0G H;  1YEZ A;  5GAD C;  1X3E A;  5AJ3 Q;  5M5W H;  1WFQ A;  3RZO H;  1PV4 A;  4YCV A;  2HHH Q;  3HOU G;  5FLM G;  3M3Y H;  5FJ8 H;  5BR8 L;  1VS0 A;  2JA9 A;  1TXY A;  3LGJ A;  4L5S A;  3HOV H;  5M3F H;  4BY1 G;  5C0X J;  1PH4 A;  2JA8 G;  1N9W A;  4R4O A;  4QY7 A;  1RIP A;  3HKZ G;  5ELN A;  1OTC A;  5IP7 G;  1OXV A;  2E5L Q;  2F3I A;  4IJL A;  4UP8 A;  5IP9 G;  2DUD A;  4JV5 Q;  4R4Q A;  1VQM A;  1QUQ B;  1TWF H;  3CW2 C;  1HNZ Q;  4DV5 L;  1XJV A;  4GNX C;  3H3V I;  2D0O A;  4GKK Q;  2ZJP A; 
#chains in the Genus database with same CATH topology
 1SRO A;  4U68 A;  1K83 B;  1Q8K A;  1WTR A;  1BCP C;  1SMX A;  4A3C H;  2JN4 A;  4CGY B;  3WDN A;  4FVM A;  1AEX A;  2IL8 A;  1BF4 A;  4DXF A;  1XYI A;  3NEL A;  3Q23 A;  4DR1 L;  1S5F D;  2CQO A;  2HIV A;  4A3I B;  5C44 H;  2IX3 A;  3KDF A;  1H9R A;  1I94 Q;  2RDG A;  3TN2 A;  1PFM A;  1PZI D;  1DOM A;  1QCB D;  1I50 H;  1NTG A;  2CWA A;  4BWG B;  5D3I B;  5HUR A;  4DR7 Q;  1I3Q B;  5C6A A;  5C3E H;  3I4N H;  1TWA B;  1SYE A;  4LF5 L;  4K14 A;  1OXX K;  2EYO A;  4PV1 C;  2ES2 A;  4NB3 A;  4ZLT F;  1NY4 A;  2K1B A;  4FXK C;  5FLX c;  2K5H A;  5KND A;  4A3I G;  2G9D A;  1BNZ A;  1XNQ Q;  1S5D D;  4A3J B;  3G71 A;  4A4I A;  1L1O A;  3PO3 H;  5IGD A;  2I07 B;  3CCU A;  3S14 H;  1VQN A;  1CSQ A;  1K9M C;  1KDA A;  3QOJ A;  4NDX A;  4IUQ A;  2DY7 A;  5M3M G;  2R7Z H;  2QGQ A;  1TT2 A;  2WKC A;  4JI0 L;  2PMZ E;  4HJA A;  3NE5 B;  1A3U A;  3U58 A;  2QIL A;  4LJZ C;  5CV5 A;  1VQK A;  3HOY H;  3ZYY X;  1STH A;  1WOC A;  5IYD H;  4NKL A;  1V43 A;  3E0E A;  3KDF B;  4GOP C;  4A3J G;  4JI7 Q;  1SSO A;  2O2L D;  4UP7 A;  4HJ9 A;  1JIC A;  2XN9 C;  3GTO H;  3IFT A;  4IN3 A;  4IUU A;  3BU2 A;  3H91 A;  4X62 Q;  3K0X A;  2L1B A;  3VR6 A;  1FNW A;  2CKZ B;  1SYF A;  1EY7 A;  3TRZ A;  3TRE A;  1FR3 A;  1YIJ A;  1S5E D;  1AE2 A;  3CCV A;  1QZG A;  3ERS X;  3Q8D A;  4DAP A;  4MZ9 A;  1OO9 B;  2D0P A;  1J9O A;  1LTS D;  3W1G A;  4XT1 B;  4ODG A;  1L1O B;  4IFD G;  4QB4 A;  1S3O A;  3QJY A;  3NQT A;  3CKI B;  1TWH H;  4LK1 C;  2K5W A;  3J81 j;  3DWP A;  4GLA C;  1TU2 B;  3PO2 G;  1I6H B;  4F8M A;  1EOT A;  3NBH A;  4HIO A;  1KNA A;  3UI2 A;  1XX8 A;  2LFN A;  1KQS A;  4JI4 Q;  1TWG H;  4KMU C;  1D5M C;  4K2K A;  2E2H H;  3PUW A;  3G4S A;  3GTG B;  5KYL A;  4LF9 L;  1BKB A;  1PXU A;  4CBV A;  1VQO A;  5HGQ A;  1IKM A;  3HKZ E;  3MFY A;  3X3M A;  1VQ7 A;  4OIJ A;  2BOS A;  4JG2 A;  4BY7 H;  1SYG A;  2Q2T A;  3A54 A;  2VW9 A;  2JQO A;  2UUA Q;  4JI7 L;  4ZKC B;  4YWK A;  2PZW A;  2Z1C A;  4A3L H;  2NN6 I;  2N88 A;  5E7N A;  2L4N A;  2WB1 E;  3GV6 A;  3I4O A;  1BCP F;  2RF4 A;  1WTP A;  3CQZ B;  2WII B;  2MP1 A;  2OQK A;  3OWE B;  1K73 C;  1IBM Q;  3H3V H;  5I4D A;  1ZKO A;  3CCR A;  3I56 A;  3C1E A;  1SLJ A;  4FDB A;  1GO3 E;  4R4T A;  3A8I E;  1G2S A;  4X3K A;  1MSH A;  5HGT A;  1NJI C;  4JI3 Q;  4P75 A;  3H09 A;  5M3F G;  1HPC A;  3VA7 A;  1IL8 A;  2RCN A;  4C3J B;  5DM6 3;  3OOC A;  2OXP A;  1VCI A;  4N8F A;  5C44 B;  1JE5 A;  5E3F A;  2EIF A;  1LLR D;  1UUP A;  2MHV A;  3BYY B;  1WD0 A;  4MTK A;  2B2T A;  3M4Y A;  2XRQ D;  3NK9 A;  4CDC C;  3M4P A;  4K5X A;  1EY9 A;  4AQY L;  2L9H A;  3NBH B;  1JJG A;  4KK7 A;  2NWG A;  1Z47 A;  4QGU A;  1WTX A;  2VB3 X;  4A3C G;  3K80 C;  1QWY A;  1I50 B;  4X66 L;  1I6V C;  1D1K A;  2AQ2 B;  1HZ9 A;  1D7Q A;  2F0D A;  4ZQ3 A;  1F2L A;  3OPO A;  1A62 A;  3KLS X;  4KD4 A;  3PGZ A;  3DHQ A;  3JC6 6;  4R4I A;  3MC0 B;  5F2D A;  2A6E C;  4OWT B;  4DV2 L;  4C3I H;  3WWV A;  5C44 G;  3HOX H;  1C4Q A;  4OL7 A;  4GKJ Q;  2NBF A;  2WAC A;  1S72 A;  2UUA L;  2JA7 G;  3PO3 B;  3BZD B;  2VUM H;  2PMZ B;  1MJC A;  4HTH A;  3N52 A;  1G2T A;  1HA5 A;  3FHW A;  5C3E G;  3I4N G;  4ZYS A;  3JAM L;  1GVP A;  1LAB A;  1N33 Q;  1UNS A;  2JYO A;  4A3B H;  2OWO A;  4JYA L;  1SEB D;  2GA4 B;  4BS9 A;  3QB3 A;  5GQO A;  1Y1W G;  4B3T L;  1EYD A;  4R1J A;  3DWQ A;  4IFD I;  4HIM A;  1B70 B;  2DJF C;  4X3U A;  3J81 i;  1SMY C;  3EN2 A;  1SFO H;  4IUT A;  2WP8 J;  1WVL A;  1E3P A;  3PO3 G;  5I2Y A;  3Q24 A;  3GTO B;  2WIN B;  1TS5 A;  5FO7 B;  1VQ6 A;  4KHZ A;  2R7Z G;  2KHJ A;  3C3L A;  1NR2 A;  1QE6 A;  1PH1 A;  4PZ8 A;  4XYO A;  4POF A;  1EIH A;  1I4X A;  1I4G A;  3DUZ A;  3HOY G;  2PO4 A;  5IYD G;  1R4P B;  3IFD A;  5GAE C;  1EIY B;  4CHT B;  1PRT C;  4PZ7 A;  2F52 A;  1XPR A;  1B44 D;  1BBW A;  5T1G A;  4V0B A;  4KY5 A;  4FXG C;  4OGQ C;  3T56 B;  5JJZ A;  2Q8R E;  2EDG A;  2JA8 H;  3URY A;  4NXM L;  1TWH B;  2SNM A;  3A5U A;  2R7D A;  2BH8 A;  2EJM A;  2H4O A;  2FHT A;  3MZ5 A;  4ABN A;  5KEE A;  3J7A 5;  3HKZ B;  4O0A A;  2BCO A;  1XNR L;  3IKJ A;  5J1Z A;  1QJO A;  4JI2 Q;  1FYC A;  2KBN A;  1N33 L;  2EZV A;  2E2H B;  2LXJ A;  4FXD A;  1ILP A;  2LMC B;  4IUP A;  3NEN A;  2WFW A;  1CHQ D;  2NZH A;  3D3R A;  2WB1 B;  2K50 A;  1E1T A;  4BY7 B;  1DOK A;  3VYS A;  3ERQ A;  4C2M B;  2F0H A;  1OXS C;  4Q0F A;  1AP0 A;  3E5S A;  1JQY D;  1SE8 A;  4MTN A;  3KLS A;  3VA5 A;  1EL0 A;  2DN8 A;  2F0F A;  1O7Z A;  1VQ8 A;  1XTD A;  1G8Z D;  1KRT A;  1STG A;  1T9H A;  4R8N A;  3X3N A;  3GP7 A;  1ASZ A;  2NZ1 D;  3T1Y Q;  4LF4 L;  3C46 A;  5EPL A;  3HOZ H;  1BR9 A;  1A2T A;  3F2U A;  2WB1 G;  4JOI A;  4RH6 A;  1B1Z A;  1GUT A;  2QCP X;  3WOE A;  2K33 A;  2B2Y C;  4B08 A;  5T1I A;  3SK6 A;  1X3F A;  1YNN C;  5JAV A;  2PI2 E;  1CM9 A;  4A3L G;  2OF1 A;  4OEL B;  5FLX L;  4Y52 H;  1GUS A;  1HNX L;  1F9R A;  4XIG S;  2Y0S E;  4FF2 A;  1PMR A;  1PTO C;  4I65 A;  1TWC H;  1EOV A;  1HUM A;  1V1O A;  4EGV A;  1YJW A;  4NXN Q;  3GTK H;  4N8X 1;  2HUG A;  4LF6 Q;  3G48 A;  1Q12 A;  3KOJ A;  1EQQ A;  1CKM A;  5ELC A;  5COR A;  3U4Z A;  3BJU A;  3UE1 A;  2RA4 A;  4JI6 L;  3ULP A;  4LF8 Q;  1A63 A;  4C3I B;  2BDO A;  1FGB D;  3D6W A;  4DNT B;  3HOX B;  3KF8 A;  5AJ3 L;  3GTM H;  1U5K A;  4ME3 A;  5DM7 3;  1A8V A;  1VQD A;  4K2L A;  1V8Q A;  4OXP A;  4DU9 A;  3H3V C;  4X64 Q;  4IFD J;  4GN3 B;  1ZYR C;  3ND8 A;  1EY8 A;  1QVC A;  4IPD A;  3K5O A;  2IHE A;  2ZJQ A;  3VYR A;  4QL5 A;  1HNZ L;  2DY8 A;  2HDM A;  2A74 C;  4LF7 L;  3DMU A;  2PYK A;  3PIP 3;  4C3I G;  1PLF A;  4HMI A;  5IOD A;  3HOX G;  3RUZ A;  3S2D B;  2AKW B;  2UUB Q;  1HJP A;  3CCS A;  1IYU A;  2SNS A;  2HQE A;  2ENB A;  2VUM G;  3K5M A;  1K0S A;  3PF4 A;  2A69 D;  2QDB A;  1CK1 A;  3NTH A;  2Q8T A;  2B2W A;  2I5L X;  3KUP A;  2L5T A;  1PH3 A;  5C5M A;  5J39 A;  1QUQ A;  1JE4 A;  1IXR A;  1H9S A;  3KK7 A;  1VMC A;  3NEM A;  3SGI A;  3L9A X;  4A3B G;  3AU7 A;  2VY3 A;  4L5T A;  4KHP L;  2JA5 H;  5CR3 A;  3NQI A;  4LF6 L;  1EYG A;  1X6O A;  1PRT F;  3GTL H;  1E7Z A;  4RKB A;  3KF8 B;  2PI2 A;  3K57 A;  2YTX A;  4C1N K;  4LWC A;  5K36 H;  3MFG A;  1VQ4 A;  4A3K H;  3S1N H;  3FPU B;  3BZK A;  4DA2 A;  2E8G A;  2JA8 B;  2ZXO A;  1IW7 D;  3J7Y W;  2A68 D;  1LYL A;  3RR5 A;  3S1R B;  1XMQ L;  3OIQ A;  3MXU A;  4K6L A;  3S2H H;  2TMP A;  4JPB W;  2EXZ A;  5IWA L;  4N9T A;  3J80 i;  3RZO H;  1X3E A;  3OIP A;  4RA8 A;  3HOU G;  4JK1 C;  5FJ8 H;  4DXG A;  4FP5 D;  2QEJ C;  3CHB D;  4ZUJ A;  5A2Q L;  4L5S A;  3HOV H;  3BG3 A;  1N9W A;  2JA8 G;  1RIP A;  2EYJ A;  5ELN A;  1OTC A;  3M3Y B;  2E5L Q;  4IJL A;  4UP8 A;  4JV5 Q;  1QUQ B;  5CC4 A;  1H9S B;  4HMJ A;  3H3V I;  1A2U A;  2F0O A;  1IBL L;  4A3F H;  3MXG A;  3KF6 A;  1TQO A;  1TWF B;  1GHK A;  1NE3 A;  1D1I A;  1GD7 A;  2R7F A;  3TS0 A;  1EIG A;  4DAY A;  1QVG A;  1K8G A;  3J7A V;  4DN4 M;  5FO8 B;  1EWC A;  5JEA J;  2WAQ G;  2Y0S B;  1STB A;  1A3T A;  1GHJ A;  4BBS H;  2A1A A;  2QEX A;  4H13 C;  4OON A;  2N3S A;  3NWS A;  5LL6 X;  5CV4 A;  1I3Q H;  2XSC A;  4EQ5 A;  5EGT A;  5IGG A;  1PH7 A;  2DNC A;  5DLQ E;  3SDZ A;  2F0P A;  4KLK A;  2WKD A;  3A8K E;  3QIA A;  1SNM A;  1YHQ A;  2KHI A;  2UXB Q;  1DXM A;  1J5E L;  3HOZ G;  3S9W A;  2F0I A;  1CHP D;  1SYD A;  3I3C A;  3KJP A;  1YJ9 A;  4CKC A;  4DV6 L;  2EY5 A;  1RJT A;  1UWV A;  4QUC A;  1Q46 A;  2F0M A;  3U9O A;  3I4M H;  4DAV A;  3FRP B;  3CRK C;  1STN A;  1N36 Q;  2EPB A;  4A75 A;  2L0C A;  2B2V C;  2PNR C;  2HDL A;  5J3B A;  3KF6 B;  1YJN A;  5IGE A;  1K28 A;  2NVQ B;  2CW0 C;  3TDQ A;  1D5X C;  4DAY B;  1Q81 C;  5DAU A;  2EYM A;  2ASB A;  4OX9 L;  5LMU L;  3G6J B;  1NCV A;  3UE0 A;  2CCZ A;  2F0N A;  2F0G A;  2XWB B;  2XIW A;  1YHA A;  3HS0 C;  2B2U A;  2PW5 A;  3Q0A A;  3R2I A;  4L5R C;  3Q6S A;  1NBW A;  4J15 A;  1A3V A;  5I2X A;  4RGM A;  2K52 A;  4B3M L;  4DPG A;  2PZU A;  1EIF A;  3V96 A;  5C3W A;  4DUZ Q;  4QQB X;  4KV6 A;  1VQA A;  1B8A A;  4DR1 Q;  2JA5 B;  1Q82 C;  1F9Q A;  1ZXT A;  4DR2 Q;  3M7N A;  4ULL A;  3GTL B;  3KBX A;  1HNW L;  4XTC S;  3TEH B;  1FVI A;  3FVQ A;  4YCU A;  3W2D A;  3PQI A;  3HZX A;  2ZXP A;  4PQX A;  3TZU A;  4A3K B;  3ULJ A;  3OTO Q;  2LY7 A;  1Y1V H;  4WJ4 A;  5KGU A;  2JE6 I;  4ZRZ A;  1SN8 A;  1GUW A;  3S17 H;  4IAL A;  4ZCK A;  4YHH L;  4CDF C;  1TII D;  4EQP A;  4C1N I;  3VR3 A;  1VQP A;  3M85 A;  1BO0 A;  3GTG H;  4PG3 A;  2Z6K C;  2JA5 G;  1JB7 A;  2GVA A;  2HCI A;  4JVZ A;  3E6Z X;  1JJC B;  4B3S L;  5K36 G;  2CHB D;  3K6O A;  1SYC A;  4P71 A;  4OIK A;  2IT1 A;  2KQ3 A;  2B63 H;  3VDY A;  1CZW A;  1H9J A;  4RCO A;  4DV4 L;  4JI0 Q;  1QOH A;  1PH5 A;  2Z0S A;  3OYY A;  3T53 B;  3QR8 A;  1GJX A;  4DUZ L;  1V1P A;  4IUR A;  4A3F B;  2ATW A;  2FMM A;  2D5D A;  2KA7 A;  4C3J H;  5FJ8 G;  4DNI A;  4DR2 L;  3HOV G;  4HCE A;  4BBS B;  2NN6 G;  1D8L A;  3OTO L;  4RGN A;  4BA1 I;  2PCF B;  3D6C A;  2K32 A;  1LTA D;  2KOL A;  3D4W A;  2R6G A;  5JEA H;  4KI0 A;  3EQL C;  1P8L A;  1DZ1 A;  2H5X A;  4PMC A;  3RNU A;  2KEE A;  5TSS A;  3BDO A;  5CYU A;  1GKH A;  3A74 A;  4JC0 A;  1Q3L A;  2CQA A;  5DNF A;  3RZD H;  1LO5 D;  1EFW A;  2NVX H;  4BBS G;  3B6Y A;  3I4M B;  2RSN A;  4GNX A;  2KUM A;  2KED A;  3N6R A;  3HOW B;  1ESF A;  4B3R L;  1V1P B;  4IUV A;  1FJG L;  2R61 A;  3OHX C;  4JI5 L;  3JAM i;  3K5L A;  3NTK A;  3UDF A;  4LF9 Q;  1VQB A;  3CCE A;  2AUK A;  3FPP A;  2Z6B A;  3NPP A;  3K8A A;  1M4V A;  2Z4H A;  3GTP B;  4IO9 A;  2I0Q A;  1A15 A;  1HH2 P;  3S24 A;  3G7L A;  4IPG A;  5GAH C;  2VQE L;  5EJW A;  1SE3 A;  2E2D C;  4APV A;  5EAY A;  3I55 A;  4ME5 A;  1RF2 D;  2KCN A;  5CV7 A;  5IGF A;  2F0W A;  2KCC A;  3PUV A;  5IT9 E;  1E2Z A;  2H1E A;  1YVC A;  4K8J A;  2K04 A;  3DLL A;  3FKI B;  4XQJ A;  5CGK A;  1A0I A;  3NWT A;  1X54 A;  1Q1E A;  4GNX B;  4AQY Q;  3OMC A;  1HTP A;  2MO0 A;  3NTI A;  2K6A A;  1DYQ A;  1Y1V B;  1WTV A;  2N8N A;  3AMU A;  1I5F A;  2CFM A;  4X66 Q;  2TSS A;  2F1M A;  5IP7 H;  3F8T A;  1VMP A;  3S17 B;  1IHZ A;  1C48 A;  3M4O B;  2L11 A;  3T1H L;  4DV2 Q;  5KYI A;  4LUZ A;  4POG A;  4C2M H;  4DK3 C;  3AEV A;  2B8F A;  1GOZ A;  2F03 A;  4JBJ A;  1Y1V G;  1JMC A;  3BVZ A;  3EVQ A;  2B63 B;  3I2Z A;  1MJE A;  4QJF A;  1C8C A;  3EIV A;  1JT8 A;  1I4Q A;  1K3R A;  5JVG 3;  4XYQ A;  1ZEQ X;  3CD6 A;  3MEH A;  4JYA Q;  1G6Z A;  1ENA A;  1L1O C;  4HJ5 A;  1HTL D;  4B3T Q;  5GAG C;  1XPO A;  1Y14 B;  1VQG A;  4RCN A;  3V2T A;  4TVA B;  2J0T D;  2WV6 D;  3D0F A;  4GLV B;  1E2V A;  3NSW A;  1EWI A;  2O4X A;  3K0Y A;  4KHV A;  5EPJ A;  3PUX A;  4DR5 L;  2B63 G;  3MXN A;  4A3G B;  4E6I A;  3MVV A;  4GS3 A;  4XQQ A;  3RLO A;  4NPS A;  1LT5 D;  4MNO A;  5L37 A;  3VR5 A;  2E2J B;  2E2I H;  3VR4 A;  2FJ2 A;  3K81 C;  2KCM A;  2F0T A;  2F0J A;  2OEO A;  1FGU A;  1LTB D;  2MUY A;  1PDQ A;  4C3J G;  3HKS A;  2AUJ D;  5IGC A;  3U9S A;  3PV0 A;  5ELO A;  3I91 A;  3TZD A;  4NXM Q;  4A3E H;  4LFB L;  3RZD B;  2NVX B;  1KAB A;  4G7H C;  3IL8 A;  1SE2 A;  3NBI A;  3KLR A;  2HCC A;  4ZK9 B;  3CXC A;  1XTC D;  2FXQ A;  2J4X A;  3I7F A;  1XNR Q;  3EBE A;  3BS1 A;  3R3O A;  5JEA G;  4JBW A;  3S16 B;  2RDF A;  4RWS C;  3OW7 A;  3QG1 A;  3R8B A;  1KLU D;  3OMG A;  1EY6 A;  4XT3 B;  4ZAI A;  3S2D H;  5BR8 Q;  1SE4 A;  3TP6 A;  1S5B D;  3MXN B;  1VQI A;  1I4H A;  4A3D H;  3RN2 A;  3A8J E;  4NW2 A;  4QIW E;  2P5Z X;  3BZC A;  1HA6 A;  1CTM A;  2G5D A;  4U67 3;  4TKO B;  5G3L D;  2E75 C;  2RHQ B;  4LF4 Q;  4EX5 A;  5LMN W;  3S1M B;  1W3S A;  1Z6H A;  1Q86 C;  1R9T H;  4R8I A;  1VQ9 A;  1STE A;  4LUO A;  2PW7 A;  2KJX A;  1SNQ A;  3PSI A;  3CC7 A;  5IY0 A;  2V4D A;  1GUG A;  2BA0 A;  1BDO A;  2EY1 A;  1PH9 A;  1HNX Q;  4WRD A;  4RGT A;  1CQV A;  5LMN L;  1SRU A;  1X3G A;  2AHO B;  5KNC A;  5IT9 c;  4DAM A;  5CV6 A;  3S1R H;  1OXT A;  2YYZ A;  5CV8 A;  3KJO A;  2XGT A;  4YY3 Q;  1AW7 A;  4PZ6 A;  4KTA A;  3SVM A;  4DR3 Q;  2B2T C;  1BXT A;  1C0A A;  4C3H H;  3BDC A;  4JI6 Q;  1MHW C;  2A6H D;  2YV5 A;  1KAA A;  3J7A F;  2O5J C;  1PFN A;  3H0G H;  5AJ3 Q;  1WFQ A;  1PV4 A;  4NP5 A;  4ZKB B;  2HHH Q;  3M3Y H;  4C56 C;  5BR8 L;  1LT4 D;  4LMQ D;  2JA9 A;  3LGJ A;  5EKI A;  3AB9 A;  4QY7 A;  3HKZ G;  4G57 A;  5IP7 G;  2F3I A;  2DUD A;  1EY4 A;  1TWF H;  3CW2 C;  1HNZ Q;  4DV5 L;  3MAQ A;  2ZJP A;  4LF7 Q;  4GZY C;  1U0L A;  1HZA A;  3PCO B;  4KY7 A;  3SK5 A;  3W3A A;  3CC4 A;  1KD1 C;  4BY7 G;  4KD3 A;  1HR0 W;  2X6G A;  1LV9 A;  5C4J H;  1P16 A;  3K7A B;  3J80 c;  4PMB A;  4O42 A;  1FNU A;  1KNE A;  2VXW A;  3FP9 A;  2LSS A;  3CPW A;  2UU9 Q;  3P1H A;  1M1K C;  3PUY A;  4KHP Q;  3E0J A;  2MJ8 A;  1SNC A;  2E2I B;  4HCS A;  1HR0 L;  2MPM A;  3I73 A;  4YY3 L;  4DR3 L;  4MIU A;  2F0V A;  4UAI A;  4RHR A;  1LT6 D;  4F7X A;  1YI2 A;  2F0U A;  3DM3 A;  1IKL A;  4XXE A;  1UE1 A;  2IX0 A;  4A3E B;  3CCM A;  2HHH L;  4HR7 B;  1IZ6 A;  1LT3 D;  2ZTD A;  1XMQ Q;  3CC2 A;  1CT1 D;  1CZG A;  1L0X B;  2NVQ H;  5IWA Q;  1DOL A;  1BBU A;  4QF4 A;  1PZJ D;  2NVT H;  1Y8N B;  1HRJ A;  2YU9 H;  2PNH A;  4UPA A;  1PA6 A;  3TSS A;  1G51 A;  2JJQ A;  2UUC L;  4YCW A;  1KL9 A;  4QIW B;  4A3E G;  2ZT9 C;  5COY A;  1F2Z A;  1Q1B A;  1MIU A;  4FNF A;  3GTQ H;  3P75 A;  1PYB A;  4A3D B;  2A69 C;  2RCF A;  1IBL Q;  1IBK L;  4YWL A;  3CCL A;  5G3L F;  1ONL A;  1N34 L;  2UU9 L;  4CKB A;  3CPF A;  1WI5 A;  2I46 A;  1R9T B;  1PFS A;  4QCL A;  1B50 A;  1JJ2 A;  2JEA I;  4LFA Q;  3LNN A;  4X3T A;  1SYB A;  1Y8O B;  4LW1 A;  3V05 A;  4A3D G;  4DV1 L;  5I9P A;  3KYH C;  1IW7 C;  3AQQ A;  4DK1 A;  2ICI A;  4JOI C;  4X6A H;  2A68 C;  1J5E Q;  2XNA C;  3E9I A;  3K7U C;  1VF7 A;  1DON A;  4DV6 Q;  2NTT A;  4C3H B;  5JJK A;  4DV7 L;  4K6D A;  1I4R A;  3H0G B;  4HJ8 A;  2N78 A;  2R93 B;  1R4Q B;  1X9N A;  4MN3 A;  4UDU C;  2AMC B;  4BA2 I;  3DEP A;  1Y8P B;  2YTY A;  3W5O A;  2UXD L;  1II3 A;  2EJG C;  3MWY W;  5IE8 A;  2R3Z A;  4OX9 Q;  5LMU Q;  1RL2 A;  3CP0 A;  1AZQ A;  1G6P A;  2F0L A;  4RGO S;  1WD1 A;  4A76 A;  3LWE A;  3F2D A;  1W2B A;  1UEB A;  3CCJ A;  2QF7 A;  4H0L C;  4N9P A;  1E1O A;  1W6K A;  2EYH A;  3H0G G;  2R92 H;  4LFA L;  5KIX A;  1U9R A;  3RN5 A;  3TQY A;  4FYD A;  4AYB E;  1U4L A;  5C4J B;  2VQF L;  4B3M Q;  1EQR A;  2KEC A;  3D4R A;  3FEW X;  2FFK B;  1TKW B;  1BOS A;  1PH2 A;  1CSP A;  4B9W A;  5JPM C;  4S3S A;  2N55 A;  1ENC A;  4IZ8 A;  1ICF B;  4LNQ A;  3AYH B;  3EJI A;  3O13 A;  1HNW Q;  3ERO A;  4FF1 A;  1B9N A;  1EFI D;  2Y0S G;  2B2W C;  4WOR A;  2F4V L;  4BBR B;  1KXL A;  1F2M A;  5C4X B;  3A55 A;  4XQN A;  4L6T B;  1EQT A;  1PYS B;  1L0W A;  1RTN A;  5M3M H;  2ID0 A;  3VR2 A;  3NUC A;  1YNX A;  3HOW H;  4YHH Q;  4WJW A;  1HZB A;  4O2D A;  5CBA E;  5BN3 A;  4A93 B;  1STY A;  1YNJ D;  5NUC A;  1CKO A;  2IHF A;  1IL2 A;  3KFU A;  4LFC Q;  2NVT B;  3HEJ A;  4B3S Q;  3U50 C;  2OQ0 A;  5BN5 A;  5I9O A;  2YU9 B;  3GTP H;  3U4V A;  1N8R C;  1PH6 A;  1HHV A;  1SNP A;  3KBG A;  3C1F A;  1QZH A;  1KC8 C;  2VNU D;  1ENF A;  2UXC L;  2VL6 A;  4RKL A;  1Z9F A;  3GTQ B;  1GXD C;  4EQO A;  4DV4 Q;  1JOK A;  2B39 A;  4YWM A;  5IGB A;  3J81 E;  4DKA C;  2ZM6 L;  3T4A C;  3SK8 A;  2K05 A;  4JI8 Q;  3ULL A;  2VB2 X;  3K5N A;  1XMO Q;  4DV3 L;  1SNO A;  1SXT A;  1Y69 U;  5IT9 L;  5ISR A;  1MKH A;  5FKA C;  2QW7 A;  3FKI H;  5AFW A;  1YHB A;  1UAP A;  1L0Y B;  3CCQ A;  3PO2 H;  2B29 A;  1XWE A;  5FLM H;  1X32 A;  2IX1 A;  1SDF A;  4CJ2 C;  1BCP B;  4L5Q A;  4BY1 H;  2YTV A;  4DV0 Q;  3M4O H;  2RKS A;  2EY2 A;  5C3X A;  1B53 A;  5FOB B;  5IP9 H;  1U4P A;  5CV9 A;  4JI1 Q;  1S4Z A;  2Q8I B;  4CKE A;  2GVB A;  4LFC L;  2OTJ A;  2BE5 D;  1JB3 A;  2PZT A;  2Z4I A;  4GOP A;  4A3K G;  4XDX A;  5FK9 C;  1ESR A;  1VQH A;  1H9K A;  4QMG A;  5IIF A;  3C2P A;  3I70 A;  1K3B C;  5JOB A;  1O7I A;  4RMF A;  2K03 A;  4B3R Q;  3P7J A;  3NP8 A;  3S1Q B;  1FJG Q;  4JI5 Q;  2ZJR A;  2EY6 A;  2RSO A;  4JI8 L;  3F1Z A;  2Z9H A;  5C4Z A;  4AYB B;  1TY0 A;  4RAU C;  1XMO L;  2AWN A;  4AH6 A;  2NUC A;  3ER0 A;  4M1U B;  4DR6 L;  2R92 B;  1BCP D;  4HIK A;  4FF4 A;  2VQE Q;  1CQF A;  2K7V A;  5C0X I;  1TY2 A;  3T16 A;  1HUN A;  4A3G H;  2ICE C;  2GN5 A;  1D6E C;  1UE5 A;  1EY0 A;  2VZA A;  2EE1 A;  3GQB A;  1RD9 D;  2RHS B;  2E2J H;  3A7L A;  3GV3 A;  1U4R A;  3H15 A;  3GDE A;  2AQ1 B;  3UDX A;  4K0K L;  4M8A A;  3PMF A;  4A3F G;  4DV0 L;  2XVS A;  4TQU S;  2B2U C;  4AYB G;  1KIX A;  3T51 B;  1HFN A;  4X65 L;  5IYB H;  4JI1 L;  4Y7N B;  4F88 A;  4GOP B;  3LWU A;  2R92 G;  2JA7 H;  3HFZ B;  4X3S A;  1QNK A;  5D65 A;  2PQA A;  5D14 A;  1EYA A;  5ELF A;  2I5H A;  2EYF A;  2SEB D;  1X55 A;  2PQE A;  2MGS A;  5M3M B;  3DEO A;  1J6Q A;  4KY6 A;  1N32 L;  1ET6 A;  1S40 A;  2L15 A;  3PUZ A;  2RDH A;  2IJ0 A;  3T1H Q;  3S16 H;  1WYD A;  1SR3 A;  3PIP A;  1Y1W H;  1O7L A;  5M5X H;  1CA5 A;  4IQZ A;  4V19 0;  3S15 B;  3CU7 A;  4MHE A;  2BH2 A;  3M7G A;  2CH4 A;  3A5Z B;  1PFB A;  1EEF D;  4CJ1 B;  3I4M G;  4J6H A;  2XTI A;  5JVH 3;  2K5Q A;  1E2W A;  2QA4 A;  1B4O A;  1JWS D;  2EYL A;  3HOW G;  4PMW A;  3M9B A;  3NHH A;  1H95 A;  4DGZ A;  3QWN A;  3S1M H;  1XPU A;  2DGY A;  3TBI B;  4WJ3 M;  2IPK D;  4ILW A;  2I5M X;  2NVY B;  2IW3 A;  3CMA A;  3SK4 A;  1I94 L;  1AE3 A;  2PQA B;  1K8M A;  1V1Q A;  3RLN A;  4KJN A;  2K5D A;  4DR5 Q;  1X3P A;  3IRB A;  2IWH A;  1WTQ A;  3PO2 B;  2C5C A;  4EQN A;  3PIO 3;  3H94 A;  3SHL A;  3K58 A;  4DR7 L;  3J81 c;  3L7Z C;  1IYJ B;  1JOO A;  5GRO A;  3E9H A;  3R93 A;  1FD7 D;  4HJ7 A;  4BY1 B;  4KN4 C;  1ROD A;  2K28 A;  1JWM D;  1CFM A;  1XNQ L;  1SBB B;  1MSG A;  3RLF A;  2ZTC A;  2OT2 A;  3FKI G;  4LFB Q;  4P2C B;  1JR0 D;  3SR1 A;  1H9M A;  1STA A;  1X3Q A;  1UE7 A;  3J80 E;  1YEZ A;  3MHB A;  4I7A A;  2F3W A;  2QKI C;  3IAY A;  1NNX A;  5FLM G;  1VS0 A;  1PTO H;  2F0Q A;  4ZUI A;  1TXY A;  1PH4 A;  4BY1 G;  5C0X J;  5M5W B;  2F4I A;  5C5L A;  2E76 C;  1OXV A;  2C9O A;  5IP9 G;  5M3F B;  4O1N A;  1VQM A;  2J7Z A;  1XJV A;  4GNX C;  4HSV A;  2D0O A;  4GKK Q;  2B8G A;  4G7Z C;  1CA6 A;  2JA6 H;  4FO2 A;  2KHS A;  3K7A H;  3FMC A;  4NMZ A;  1ILQ A;  2Q2I A;  5IYC H;  4X62 L;  4I7Z C;  2M00 A;  1LTT D;  3A7A B;  4WFN 3;  1YBY A;  5JJL A;  1DGS A;  3GTJ H;  4IPC A;  5EPK A;  1CI3 M;  3LX0 A;  3MTS A;  4L63 B;  1JC7 A;  1HZC A;  1LAC A;  4G7O C;  1G91 A;  2RBM A;  1EY5 A;  3CF5 A;  1WJJ A;  1PH8 A;  2JA7 B;  2K5N A;  4H02 A;  1AN8 A;  1MD2 D;  3DWA A;  3MXP A;  1Q7Y C;  5I6W A;  2OCE A;  5LMN Q;  4A3G G;  1VF5 C;  3FDT A;  1AFP A;  4YIJ A;  1LTI D;  5C3E B;  3I4N B;  3A0J A;  2K01 A;  4JI4 L;  1KTK A;  2A6E D;  4HSP A;  1W6J A;  2F0S A;  5JJI A;  2NB0 A;  2DJG C;  2NTS A;  5IYB G;  1Y1W B;  5M5X B;  2JK8 A;  1QG7 A;  1PRT B;  3HG9 A;  1JOR A;  4GKK L;  3S14 B;  5EBD A;  2A73 B;  3TP5 A;  4UY8 C;  2B2Y A;  1LUZ A;  1WCM H;  2R7Z B;  4OWW B;  2LXK A;  1K8O A;  1KDC A;  1K0R A;  1IBM L;  1Q8I A;  1U4M A;  5KNB A;  4DV5 Q;  3SEB A;  3KLW A;  3HOY B;  1SMY D;  1AH9 A;  1O78 A;  1YZ6 A;  4JI3 L;  1B3Q A;  1JOQ A;  1V9P A;  1LTG D;  3R2T A;  4GLX A;  1F2Y A;  3K59 A;  3F2B A;  3I90 A;  5DEH A;  2RVL A;  2JP1 A;  2HD3 A;  2HT1 A;  2X69 A;  5D3D A;  4IPH A;  2EJF C;  1HR0 Q;  5ELD A;  2HQL A;  1PRT D;  3EFX D;  3VYU A;  1BUV T;  3OW2 A;  4DR4 Q;  2M9V A;  4IJH A;  4QUF A;  1K8A C;  3HOU H;  1HFG A;  2AWO A;  1HXY D;  4GN5 A;  2XRS D;  3RD4 A;  4GKJ L;  4KN7 C;  4B9X A;  1VDZ A;  4OO1 H;  2A6H C;  1ET9 A;  2R93 H;  2BDN A;  3BVM A;  4HED A;  5M5Y H;  2CWP A;  1RCV D;  2VS1 A;  4IUN A;  5LL6 S;  3ONA B;  1TWG B;  1PTO B;  1E24 A;  1CKN A;  5CMD A;  1T5X D;  3L2P A;  2QDL A;  1X56 A;  1E22 A;  3EA6 A;  4F87 A;  5KRU A;  3W1B A;  2JEB I;  2DNE A;  1ICW A;  2KVM A;  3DM1 A;  4R4C A;  4OHJ A;  4P72 A;  2PPB C;  2UUC Q;  1QB5 D;  3G6E A;  4G4K A;  1EZ8 A;  2JA6 B;  2JSO A;  5E4W C;  2Q2H A;  5C0X H;  2WAQ E;  4OEM B;  4HN7 A;  3TME A;  1IBK Q;  3GTJ B;  1B3A A;  2NYZ D;  2HIX A;  3AFP A;  3J7Z C;  2B3G A;  5A35 A;  3D4D A;  4A3M H;  1N34 Q;  2JXM B;  4HID A;  1C7Y A;  1VQ5 A;  1PVO A;  3MEF A;  3SE0 A;  1YNN D;  1DCZ A;  4GN4 B;  4DR4 L;  1TS4 A;  5JPN C;  2NZO A;  1NAP A;  1ASY A;  1C9O A;  1VQJ A;  1VQE A;  4BBR H;  2JA6 G;  1VQC A;  1UE6 A;  1PTO D;  3TP7 A;  4DFA A;  5C4X H;  4Q5V A;  3RMH A;  3GD7 A;  2IY5 B;  5IYC G;  2N49 A;  1RKN A;  1DM0 B;  4DUY Q;  3TS2 A;  4OWX B;  1ML0 D;  4DV1 Q;  1M8A A;  1HQR D;  1CKN B;  2MQH A;  1DD2 A;  4JI2 L;  1OXU A;  3ITP A;  2AQ3 B;  4A93 H;  1O80 A;  2M2L A;  2EXD A;  3Q22 A;  1LM0 A;  1LTL A;  3HRZ C;  3A56 A;  4KJO A;  4DV7 Q;  2RQX A;  1RHP A;  5H1S E;  1LTR D;  1EQV A;  3JAM E;  4IOC A;  2VUM B;  1X65 A;  1ZYR D;  2X6L A;  1EZ6 A;  1FL0 A;  4DNR B;  1F9S A;  3I4L A;  5FO9 B;  3QO2 A;  1WCM B;  3STB D;  1E0B A;  3VYT A;  2UXD Q;  3ND9 A;  3HP3 A;  1NSN S;  2Q2U A;  3STB C;  3T1Y L;  4A3B B;  1TVX A;  2E74 C;  1BBX C;  2A5H A;  4R9W A;  1D2B A;  4EVO A;  1XXG A;  4K5V A;  3J81 L;  1CUK A;  3OSO A;  1KDB A;  4TRD A;  1SFO B;  4UP9 A;  2K4K A;  5I6Y A;  2K14 A;  3PIO A;  2ZTE A;  5K5P A;  4LUV A;  2VQF Q;  1VQL A;  1WCM G;  1T5E A;  1F9P A;  4DUY L;  1QIL A;  4BXX H;  1SJE D;  1UEA B;  4DF7 A;  4NXN L;  3AFQ A;  2B2V A;  2Z8L A;  1I4P A;  1BQQ T;  2K5V A;  1JWU D;  3HOU B;  2CH4 W;  4FF3 A;  4LF8 L;  3BVG A;  4J1M A;  2F4V Q;  2LS0 1;  1B2T A;  3NXW A;  3PF5 A;  4RG1 A;  4RFB A;  5ELB A;  4X64 L;  4CDD C;  5M5Y B;  3D31 A;  3S1Q H;  3UDI A;  4Z9C B;  1PHJ A;  1L2F A;  1NUC A;  4L8J A;  5E1F A;  3P20 A;  2D9U A;  4JBM A;  3QOL A;  3OWF A;  3TP8 A;  4C3H G;  2EVB A;  2WAQ B;  2SDF A;  1QNU A;  1TR5 A;  1WTO A;  3GO5 A;  2UUB L;  2NN6 H;  4OO1 G;  1GUN A;  3L3O C;  3D8G A;  1K83 H;  2F0E A;  2UXC Q;  2R93 G;  1SND A;  2OTL A;  1EU3 A;  5EBC A;  5EKL A;  2ZM6 Q;  2ALY B;  3CME A;  2MO1 A;  2ZXR A;  2EOT A;  2A8V A;  2V1C C;  2F0K A;  4A3M B;  3HOZ B;  1Q90 A;  3SXH A;  4DV3 Q;  5FLX E;  4A3I H;  1WTH A;  4Y7N H;  1EEI D;  3ZJY C;  2Z6K A;  1NR4 A;  1EYC A;  3ICE A;  1PTO F;  5C0X G;  1QVF A;  5LHY 1;  5M9O A;  1TWA H;  1GM5 A;  2EQS A;  1BVS A;  1TWC B;  1KHI A;  2BA1 A;  1A6X A;  2FMC A;  5EQ0 A;  4DK0 A;  1F77 A;  2KCT A;  5BN4 A;  3GTK B;  4AIM A;  1M90 C;  1B7Y B;  2MFI A;  1SJH D;  4A3M G;  1HCZ A;  1PYW D;  3I72 A;  4JW0 A;  1FNV A;  4ALP A;  4A3J H;  2G9H D;  3S15 H;  1TS3 A;  2K75 A;  1YNJ C;  3BYT B;  1AZP A;  3GTM B;  4K5W A;  4BBR G;  1EWH A;  2FIN B;  1MI2 A;  1D5Z C;  2A19 A;  5C4X G;  5IOC A;  2E5L L;  1RDP D;  4JV5 L;  4IOA A;  1KRS A;  4P74 A;  1HQM C;  1MGS A;  2CW0 D;  4JCV E;  3BDL A;  4CDE C;  4H44 C;  3F2C A;  5CBE E;  4RHS A;  4K8I A;  4KKU A;  4A93 G;  1NMG A;  1TS2 A;  5E4X A;  4DK6 C;  5J22 A;  3UDG A;  1EUJ A;  1VQF A;  2C35 B;  2NVY H;  2MNA A;  4IFD H;  5C4H A;  2XWJ B;  4DR6 Q;  3JAM c;  4JBK A;  1YIT A;  1PZK D;  3L0O A;  4K0K Q;  1Z7T A;  1G29 1;  2UXB L;  3CRL C;  4J8Q A;  4X65 Q;  4CJ0 B;  4H7B A;  4HAE A;  2D2C C;  1SAP A;  5HY6 A;  4KKS A;  1GUO A;  3S1N B;  2LKV A;  3M4Q A;  1WTW A;  4OO1 I;  4P73 A;  1I6H H;  1DJR D;  1O7Y A;  2SOB A;  4LAA A;  2BE5 C;  1IYV A;  1N36 L;  3I8Z A;  3CAM A;  2F3V A;  2D62 A;  3DXJ C;  1KAW A;  4BXX G;  4LF5 Q;  2KEN A;  2L12 A;  1N32 Q;  1NMF A;  5GAD C;  5M5W H;  3S2H B;  1EU4 A;  4YCV A;  3MA2 B;  5A2Q E;  3J80 L;  1J8I A;  1MBY A;  2EYP A;  4UHV A;  1JCK B;  3E3X A;  5M3F H;  3RZO B;  4R4O A;  1KLG D;  2CVR A;  5ELE A;  4ID6 A;  5EKK A;  3T13 A;  2L55 A;  3HOV B;  4R4Q A;  3H6M A;  1S5C D;  3WOF A;  2O5I C;  4PNY A;  1RTO A;  1B9M A;  4KKT A;  4TSS A;  3CQZ H;  3HGB A; 
#chains in the Genus database with same CATH homology
 1SRO A;  1U0L A;  1HZA A;  1Q8K A;  3PCO B;  1IBL L;  4A3F H;  2JA6 H;  3KF6 A;  1SMX A;  3K7A H;  3CC4 A;  4A3C H;  1NE3 A;  1KD1 C;  1GD7 A;  2Q2I A;  2R7F A;  5IYC H;  4X62 L;  4BY7 G;  3TS0 A;  1HR0 W;  1QVG A;  1YBY A;  5C4J H;  1DGS A;  1P16 A;  3J80 c;  3GTJ H;  1K8G A;  5JJL A;  4IPC A;  5JEA J;  3NEL A;  2WAQ G;  4DR1 L;  2CQO A;  2HIV A;  4BBS H;  5C44 H;  2A1A A;  3KDF A;  1I94 Q;  1HZC A;  3FP9 A;  2QEX A;  4OON A;  2LSS A;  3CPW A;  2UU9 Q;  2N3S A;  1M1K C;  3PUY A;  4KHP Q;  1I3Q H;  4EQ5 A;  1HR0 L;  1PH7 A;  3CF5 A;  1WJJ A;  5DLQ E;  4YY3 L;  4KLK A;  1PH8 A;  1I50 H;  1NTG A;  2CWA A;  4DR3 L;  2K5N A;  1YHQ A;  4H02 A;  4DR7 Q;  5C3E H;  2KHI A;  3I4N H;  2UXB Q;  1Q7Y C;  1J5E L;  3HOZ G;  2OCE A;  5LMN Q;  4A3G G;  1YI2 A;  4LF5 L;  3KJP A;  1OXX K;  3DM3 A;  2ES2 A;  4NB3 A;  1UE1 A;  2IX0 A;  3A0J A;  1NY4 A;  3CCM A;  4DV6 L;  1YJ9 A;  2HHH L;  5FLX c;  2K5H A;  4JI4 L;  4A3I G;  1UWV A;  1XNQ Q;  1Q46 A;  3I4M H;  1IZ6 A;  3G71 A;  5JJI A;  2ZTD A;  1XMQ Q;  4A4I A;  1N36 Q;  3CC2 A;  4A75 A;  1L1O A;  3PO3 H;  5IYB G;  2NVQ H;  5J3B A;  5IWA Q;  3CCU A;  3S14 H;  1BBU A;  2JK8 A;  3KF6 B;  1VQN A;  1YJN A;  1CSQ A;  1K9M C;  2NVT H;  2R7Z H;  4GKK L;  5M3M G;  2QGQ A;  2YU9 H;  2PNH A;  4UPA A;  1PA6 A;  4DAY B;  1G51 A;  1Q81 C;  4UY8 C;  2ASB A;  4JI0 L;  2JJQ A;  2PMZ E;  4HJA A;  5LMU L;  2UUC L;  4OX9 L;  3UE0 A;  4YCW A;  1KL9 A;  1LUZ A;  1WCM H;  2CCZ A;  4OWW B;  3U58 A;  4A3E G;  2LXK A;  1VQK A;  1YHA A;  1K0R A;  1Q1B A;  1IBM L;  3HOY H;  1MIU A;  1WOC A;  3GTQ H;  5IYD H;  1V43 A;  3E0E A;  3KDF B;  4GOP C;  4A3J G;  4DV5 Q;  4JI7 Q;  1PYB A;  4UP7 A;  3KLW A;  4LF7 Q;  4HJ9 A;  1AH9 A;  1IBL Q;  4L5R C;  1NBW A;  4J15 A;  1IBK L;  3GTO H;  4YWL A;  1YZ6 A;  4JI3 L;  2K52 A;  3CCL A;  3BU2 A;  4B3M L;  4DPG A;  1N34 L;  2UU9 L;  1V9P A;  4X62 Q;  3K0X A;  1EIF A;  4GLX A;  3CPF A;  4DUZ Q;  1WI5 A;  3F2B A;  4QQB X;  1PFS A;  2CKZ B;  3TRZ A;  3TRE A;  1JJ2 A;  2JEA I;  4LFA Q;  1YIJ A;  1VQA A;  1B8A A;  1AE2 A;  4DR1 Q;  1Q82 C;  3CCV A;  4DR2 Q;  1QZG A;  3ERS X;  3M7N A;  2HT1 A;  4LW1 A;  1HNW L;  4XTC S;  3TEH B;  1FVI A;  4IPH A;  3Q8D A;  4YCU A;  4MZ9 A;  2D0P A;  4A3D G;  3W1G A;  3ULJ A;  1HR0 Q;  3OTO Q;  1L1O B;  2HQL A;  4DV1 L;  4IFD G;  1Y1V H;  3KYH C;  3AQQ A;  4WJ4 A;  3OW2 A;  1S3O A;  4DR4 Q;  4IJH A;  1K8A C;  3HOU H;  4JOI C;  2AWO A;  2JE6 I;  4X6A H;  4GN5 A;  1SN8 A;  1TWH H;  3J81 j;  1J5E Q;  4GLA C;  3S17 H;  3PO2 G;  3E9I A;  3K7U C;  4YHH L;  4GKJ L;  3GTG H;  1VQP A;  3M85 A;  4HIO A;  4DV6 Q;  4PG3 A;  2Z6K C;  2JA5 G;  5JJK A;  1KQS A;  1JB7 A;  2GVA A;  4JI4 Q;  2R93 H;  1TWG H;  4DV7 L;  5M5Y H;  2E2H H;  2CWP A;  3PUW A;  3G4S A;  4LF9 L;  1BKB A;  1VQO A;  5HGQ A;  2VS1 A;  1JJC B;  3HKZ E;  4HJ8 A;  2N78 A;  4B3S L;  1VQ7 A;  5K36 G;  1X9N A;  4P71 A;  2AMC B;  1E24 A;  1CKN A;  4BA2 I;  3L2P A;  4JG2 A;  2YTY A;  4BY7 H;  1X56 A;  2IT1 A;  2B63 H;  2Q2T A;  1E22 A;  2VW9 A;  3VDY A;  2JQO A;  2UUA Q;  4JI7 L;  3W1B A;  2JEB I;  4YWK A;  3W5O A;  2UXD L;  4A3L H;  2NN6 I;  5E7N A;  5IE8 A;  4DV4 L;  4R4C A;  2WB1 E;  4P72 A;  4JI0 Q;  4OX9 Q;  3I4O A;  1RL2 A;  2RF4 A;  2Z0S A;  3CP0 A;  5LMU Q;  3G6E A;  1PH5 A;  3OYY A;  2UUC Q;  1G6P A;  4A76 A;  2OQK A;  3F2D A;  1W2B A;  1UEB A;  3CCJ A;  4DUZ L;  1IBM Q;  1K73 C;  2ATW A;  3H3V H;  1E1O A;  2Q2H A;  3CCR A;  3H0G G;  2WAQ E;  2R92 H;  4LFA L;  3I56 A;  1SLJ A;  3RN5 A;  4C3J H;  4FDB A;  1GO3 E;  4R4T A;  3TQY A;  4AYB E;  5FJ8 G;  4DNI A;  4DR2 L;  1NJI C;  1IBK Q;  2HIX A;  4P75 A;  4JI3 Q;  3HOV G;  5M3F G;  3AFP A;  2VQF L;  3J7Z C;  4B3M Q;  2B3G A;  4A3M H;  2RCN A;  1EQR A;  1N34 Q;  4HID A;  1C7Y A;  2NN6 G;  1VCI A;  1VQ5 A;  1JE5 A;  1D8L A;  2EIF A;  3MEF A;  3OTO L;  1PVO A;  4B3T L;  4GN4 B;  4DR4 L;  1PH2 A;  2NZO A;  1CSP A;  3M4P A;  4BA1 I;  1ASY A;  1C9O A;  4AQY L;  1VQJ A;  1VQE A;  3NBH B;  1JJG A;  1Z47 A;  4QGU A;  4BBR H;  3AYH B;  1VQC A;  2R6G A;  1UE6 A;  4LNQ A;  2JA6 G;  4A3C G;  3K80 C;  4KI0 A;  4X66 L;  5C4X H;  1HNW Q;  1P8L A;  3GD7 A;  2IY5 B;  5IYC G;  2N49 A;  2Y0S G;  1HZ9 A;  2H5X A;  4DUY Q;  4OWX B;  2F4V L;  3TS2 A;  1D7Q A;  3RNU A;  4DV1 Q;  1A62 A;  1KXL A;  1GKH A;  3PGZ A;  3A74 A;  4JC0 A;  3JC6 6;  4R4I A;  1CKN B;  2MQH A;  1L0W A;  1PYS B;  5M3M H;  3RZD H;  4JI2 L;  2ID0 A;  1EFW A;  1OXU A;  4OWT B;  4DV2 L;  2NVX H;  4BBS G;  4C3I H;  1YNX A;  3WWV A;  5C44 G;  3HOX H;  3B6Y A;  3HOW H;  4YHH Q;  4A93 H;  4GKJ Q;  4GNX A;  2EXD A;  1HZB A;  1LM0 A;  1LTL A;  1S72 A;  2UUA L;  2JA7 G;  2VUM H;  4O2D A;  4B3R L;  1MJC A;  4DV7 Q;  1CKO A;  5H1S E;  1FJG L;  2IHF A;  1IL2 A;  4JI5 L;  3JAM i;  4LF9 Q;  4LFC Q;  3KFU A;  4IOC A;  3UDF A;  1VQB A;  3FHW A;  5C3E G;  1X65 A;  3CCE A;  4B3S Q;  3I4N G;  3U50 C;  2OQ0 A;  3GTP H;  1GVP A;  1N33 Q;  3U4V A;  1N8R C;  1PH6 A;  1FL0 A;  4A3B H;  3CQZ H;  2OWO A;  3K8A A;  3STB D;  4JYA L;  1QZH A;  1KC8 C;  2VNU D;  4IO9 A;  2I0Q A;  2UXD Q;  1HH2 P;  2UXC L;  2VL6 A;  5GQO A;  1Z9F A;  3S24 A;  4IPG A;  3STB C;  3T1Y L;  4DV4 Q;  4R1J A;  1Y1W G;  5GAH C;  2Q2U A;  4YWM A;  2VQE L;  1B70 B;  4HIM A;  1SFO H;  3J81 i;  4IFD I;  3EN2 A;  4APV A;  5EAY A;  2WP8 J;  3I55 A;  4DKA C;  2ZM6 L;  1E3P A;  3PO3 G;  1CUK A;  4JI8 Q;  3ULL A;  1VQ6 A;  3PUV A;  4UP9 A;  1XMO Q;  2K4K A;  4KHZ A;  4DV3 L;  2R7Z G;  2KHJ A;  2K14 A;  1MKH A;  3PIO A;  1YVC A;  2ZTE A;  3FKI H;  1PH1 A;  4PZ8 A;  4LUV A;  2VQF Q;  1VQL A;  1YHB A;  1WCM G;  3CCQ A;  4POF A;  3PO2 H;  4DUY L;  3DLL A;  4BXX H;  2B29 A;  3HOY G;  1A0I A;  1X54 A;  1Q1E A;  5IYD G;  4NXN L;  4GNX B;  3AFQ A;  5GAE C;  1EIY B;  5FLM H;  4AQY Q;  4PZ7 A;  2MO0 A;  2F52 A;  1XPR A;  2IX1 A;  1BBW A;  2K5V A;  4L5Q A;  4BY1 H;  2N8N A;  2YTV A;  4DV0 Q;  1I5F A;  2JA8 H;  3M4O H;  2CFM A;  4X66 Q;  4NXM L;  5IP7 H;  3A5U A;  5IP9 H;  4LF8 L;  3F8T A;  2R7D A;  2BH8 A;  2F4V Q;  4JI1 Q;  3J7A 5;  4O0A A;  3PF5 A;  4RG1 A;  2GVB A;  4LFC L;  1XNR L;  2OTJ A;  3T1H L;  4JI2 Q;  4DV2 Q;  2KBN A;  4GOP A;  4X64 L;  4A3K G;  1N33 L;  1VQH A;  2LXJ A;  4LUZ A;  3D31 A;  4POG A;  3S1Q H;  1O7I A;  3NEN A;  3UDI A;  4RMF A;  2WFW A;  4C2M H;  4DK3 C;  1PHJ A;  2NZH A;  3AEV A;  1L2F A;  4B3R Q;  2K50 A;  4JBJ A;  1Y1V G;  1JMC A;  1E1T A;  1FJG Q;  4JI5 Q;  3I2Z A;  1MJE A;  4QJF A;  2ZJR A;  3EIV A;  1JT8 A;  4JBM A;  1OXS C;  1K3R A;  4JI8 L;  3F1Z A;  1SE8 A;  4MTN A;  3CD6 A;  2UUB L;  3GO5 A;  1VQ8 A;  4OO1 G;  1XTD A;  1XMO L;  4JYA Q;  2AWN A;  1KRT A;  4AH6 A;  1K83 H;  1T9H A;  1L1O C;  1ASZ A;  3ER0 A;  4HJ5 A;  2UXC Q;  2R93 G;  3T1Y Q;  4B3T Q;  5GAG C;  4DR6 L;  4HIK A;  2VQE Q;  2OTL A;  5C0X I;  4LF4 L;  1XPO A;  1Y14 B;  3HOZ H;  1VQG A;  2ZM6 Q;  2ALY B;  3CME A;  2MO1 A;  4A3G H;  2GN5 A;  1UE5 A;  2VZA A;  2WB1 G;  4JOI A;  2A8V A;  4TVA B;  2V1C C;  3D0F A;  4GLV B;  2B63 G;  1EWI A;  4DR5 L;  2RHS B;  3PUX A;  2E2J H;  3H15 A;  4DV3 Q;  3GDE A;  1X3F A;  4GS3 A;  3UDX A;  4A3I H;  4K0K L;  2PI2 E;  4A3L G;  3RLO A;  4Y7N H;  4A3F G;  4DV0 L;  4NPS A;  3ZJY C;  4TQU S;  2Z6K A;  4MNO A;  4Y52 H;  1HNX L;  4XIG S;  4AYB G;  2E2I H;  1KIX A;  2Y0S E;  3K81 C;  2KCM A;  5IYB H;  4X65 L;  4JI1 L;  1TWC H;  3ICE A;  1EOV A;  4GOP B;  5C0X G;  1FGU A;  1QVF A;  1YJW A;  4NXN Q;  2JA7 H;  2R92 G;  3GTK H;  3HFZ B;  4LF6 Q;  1TWA H;  3G48 A;  2PQA A;  1GM5 A;  1Q12 A;  2EQS A;  1BVS A;  2BA1 A;  1KHI A;  3HKS A;  3KOJ A;  2I5H A;  1EQQ A;  1CKM A;  2KCT A;  3PV0 A;  5ELO A;  4AIM A;  1M90 C;  1X55 A;  3U4Z A;  1B7Y B;  4A3E H;  2MFI A;  3BJU A;  3UE1 A;  4A3M G;  4NXM Q;  4LFB L;  1J6Q A;  3ULP A;  4JI6 L;  4LF8 Q;  1A63 A;  1N32 L;  5AJ3 L;  1S40 A;  2L15 A;  4ALP A;  1U5K A;  4ME3 A;  4A3J H;  3GTM H;  3CXC A;  3S15 H;  3PUZ A;  2FXQ A;  2K75 A;  1XNR Q;  3I7F A;  3T1H Q;  1A8V A;  1VQD A;  1WYD A;  3S16 H;  3EBE A;  1SR3 A;  3PIP A;  4OXP A;  1Y1W H;  4IFD J;  4X64 Q;  5M5X H;  4BBR G;  4GN3 B;  5JEA G;  2A19 A;  2BH2 A;  1QVC A;  5C4X G;  4JBW A;  4IPD A;  2E5L L;  4JV5 L;  4IOA A;  1KRS A;  3A5Z B;  4P74 A;  2IHE A;  2ZJQ A;  4JCV E;  4QL5 A;  1HNZ L;  3I4M G;  2XTI A;  3F2C A;  3S2D H;  4LF7 L;  5BR8 Q;  2QA4 A;  3MXN B;  3HOX G;  1VQI A;  4PMW A;  3HOW G;  1NMG A;  4A93 G;  4DK6 C;  3UDG A;  1EUJ A;  3M9B A;  1VQF A;  2AKW B;  2UUB Q;  1H95 A;  1HJP A;  3CCS A;  2C35 B;  4A3D H;  3RN2 A;  4QIW E;  2NVY H;  2VUM G;  2MNA A;  3BZC A;  1XPU A;  3S1M H;  2DGY A;  3PF4 A;  4DR6 Q;  3JAM c;  4WJ3 M;  2I5L X;  2RHQ B;  4JBK A;  2I5M X;  4LF4 Q;  4EX5 A;  5LMN W;  1PH3 A;  1W3S A;  3CMA A;  1Q86 C;  1YIT A;  1R9T H;  1QUQ A;  1IXR A;  1AE3 A;  2PQA B;  1I94 L;  3NEM A;  3SGI A;  1VQ9 A;  4LUO A;  1V1Q A;  3RLN A;  4A3B G;  4L5T A;  2VY3 A;  4KHP L;  3PSI A;  4DR5 Q;  3CC7 A;  2JA5 H;  4LF6 L;  3IRB A;  3L0O A;  5IY0 A;  1EYG A;  4K0K Q;  1X6O A;  2BA0 A;  1G29 1;  1E7Z A;  3GTL H;  4DR7 L;  3KF8 B;  2PI2 A;  3J81 c;  3L7Z C;  1IYJ B;  1PH9 A;  1HNX Q;  2YTX A;  2UXB L;  4LWC A;  5GRO A;  1VQ4 A;  4A3K H;  3E9H A;  4X65 Q;  5LMN L;  1SRU A;  1X3G A;  2AHO B;  3BZK A;  3S1N H;  4HJ7 A;  2E8G A;  5HY6 A;  5IT9 c;  4DAM A;  3S1R H;  1OXT A;  2YYZ A;  3KJO A;  3M4Q A;  4OO1 I;  2XGT A;  4P73 A;  1XNQ L;  4YY3 Q;  1I6H H;  4PZ6 A;  1LYL A;  3RLF A;  3RR5 A;  2ZTC A;  3FKI G;  4DR3 Q;  1XMQ L;  1N36 L;  3CAM A;  3S2H H;  4LFB Q;  1C0A A;  4C3H H;  2D62 A;  4JI6 Q;  1KAW A;  4BXX G;  2YV5 A;  5IWA L;  4LF5 Q;  2KEN A;  1N32 Q;  3J80 i;  1UE7 A;  1NMF A;  3H0G H;  1YEZ A;  5GAD C;  1X3E A;  5AJ3 Q;  5M5W H;  1WFQ A;  3RZO H;  1PV4 A;  4YCV A;  2HHH Q;  3HOU G;  5FLM G;  3M3Y H;  5FJ8 H;  5BR8 L;  1VS0 A;  2JA9 A;  1TXY A;  3LGJ A;  4L5S A;  3HOV H;  5M3F H;  4BY1 G;  5C0X J;  1PH4 A;  2JA8 G;  1N9W A;  4R4O A;  4QY7 A;  1RIP A;  3HKZ G;  5ELN A;  1OTC A;  5IP7 G;  1OXV A;  2E5L Q;  2F3I A;  4IJL A;  4UP8 A;  5IP9 G;  2DUD A;  4JV5 Q;  4R4Q A;  1VQM A;  1QUQ B;  1TWF H;  3CW2 C;  1HNZ Q;  4DV5 L;  1XJV A;  4GNX C;  3H3V I;  2D0O A;  4GKK Q;  2ZJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...