2K5HA

Solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein
publication title Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2008-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5hA01
3AQQA 4QQBX 2UXCQ 1U0LA 2EQSA 2YYZA 3AFQA 2KHIA 3FP9A 3I55A 1A63A 1YEZA 2VL6A 1OXXK 4X66L 4YHHQ 4A75A 1KQSA 4BXXH 1I6HH 1VQ6A 4JCVE 1QVFA 2PNHA 4PG3A 4GNXC 4JI4Q 3T1HL 4LF6Q 4GN4B 1E3PA 1XNRQ 1N33L 4YCVA 4OO1G 5LMNW 2WB1E 4GKKQ 4B3TQ 1X56A 4R4IA 1N36L 1I50H 4B3SQ 3S2DH 2IX0A 1V1QA 1TWCH 4LFAL 4GKKL 4IFDJ 1WI5A 1PYSB 3UDGA 2MNAA 1VQOA 1U5KA 4JBJA 5JEAG 2ZJQA 2OQ0A 4B3SL 1HZCA 1S40A 2ATWA 4K0KL 2E2IH 2LXJA 5IYDH 2NZOA 4A3FG 4MTNA 4IPHA 1L1OB 2YU9H 4PMWA 4A3JG 2R7DA 5GQOA 4DK6C 2E8GA 1TWAH 4GOPA 1PFSA 4QY7A 1MKHA 2B63H 4LUOA 3HOVH 2ES2A 4HJ8A 3RLOA 1XMQQ 1Y1WH 3J81i 2KHJA 3T1YQ 3ULJA 2AKWB 4DV5Q 1XMQL 3W1GA 3T1YL 3I4MG 1O7IA 4GLXA 1S72A 1WOCA 4R4TA 4QGUA 1E1OA 4POFA 4JI7Q 4YY3Q 3EIVA 4EX5A 3UDXA 3CC7A 1SRUA 1VQPA 4LF5L 1YITA 1WYDA 2BA1A 5C0XJ 2UXBL 4DV3Q 4OWTB 3GTMH 3PF4A 3NEMA 1JJCB 1X3EA 4UPAA 1Q82C 3PO2G 4BA1I 4HIKA 3UE0A 1P8LA 1Y14B 2K14A 3KOJA 1LYLA 4DR4L 3ICEA 3GTOH 1VQ9A 2ASBA 2N78A 3PUWA 4LF4Q 1QVCA 1HNWQ 3CQZH 4NXNQ 3FKIG 1NTGA 1EQQA 1PH7A 3CAMA 3PUVA 1HNWL 4OX9L 3RR5A 1XPRA 4P71A 4GLVB 4JI5Q 1A62A 2EXDA 1HZBA 4BA2I 2E2HH 4HJ7A 1N32Q 3M4OH 1X54A 1LTLA 3PSIA 2D0PA 4A3FH 1SROA 4A3EG 4PZ8A 1VQBA 1N32L 1S3OA 4DR5Q 2MO0A 4A3JH 5DLQE 1VQLA 4JYAQ 4DR5L 4LF8Q 1JE5A 4JYAL 4DV2L 3TS0A 3KDFA 2KCTA 2F52A 2YV5A 2H5XA 1QZHA 2PI2A 2F3IA 3RZOH 2CFMA 1R9TH 3S15H 4HJAA 4IO9A 3DLLA 3CPWA 3NELA 3CP0A 1YJ9A 4JG2A 3S1QH 3EN2A 3K8AA 1KL9A 3D0FA 1QVGA 4TVAB 1VQEA 1PH4A 1SE8A 4BXXG 3GTJH 1HNZQ 2YTVA 1VQ5A 3ULLA 3BZKA 3PO2H 2N49A 1HNZL 1XPOA 2LSSA 2VY3A 1VQNA 3K0XA 4QIWE 3GDEA 4YWMA 1D7QA 1E22A 1G6PA 1K8AC 2UUBQ 4JI6L 5JEAJ 2AMCB 2UUBL 1KC8C 1JT8A 2R7FA 4WJ4A 3FKIH 5C4XG 2Z6KA 1TXYA 4OO1I 4DR1Q 4IPDA 4DV1L 4GN3B 1IYJB 1YJWA 3D31A 3PIPA 4LFCL 2NVQH 2ZTEA 3KDFB 4A3CG 1I94Q 3E9HA 3K7UC 3I56A 1MJCA 3PV0A 4A3EH 4XTCS 3OYYA 3HOZG 4A3LG 4P74A 5ELOA 3CCMA 1UWVA 1HH2P 1N9WA 1NBWA 4GOPC 3CCLA 1UE1A 2A8VA 2NVTH 1T9HA 3IRBA 2RHQB 3E9IA 4B3RQ 2A19A 2N3SA 3CMEA 1OTCA 1PH3A 2IX1A 3CCSA 2Q2UA 4X62Q 4B3RL 5FJ8G 3U58A 4X62L 4UP9A 4JBMA 1NE3A 3JAMi 4R4CA 3B6YA 1A8VA 4BBRG 2MQHA 2IY5B 1W2BA 5HGQA 4PZ7A 4P73A 4DR7Q 3M9BA 1EQRA 3PIOA 3F2DA 4DR7L 1UE7A 4P75A 2UXCL 1KAWA 1ASZA 4UP7A 2D0OA 1CSQA 4R4QA 3K81C 1WCMH 2N8NA 2WB1G 4C3HH 2UXDQ 1YHAA 4RG1A 1Y1VG 1V43A 4YHHL 2PMZE 5LMNQ 5M5WH 1AE3A 4ALPA 1IZ6A 1K0RA 4JI4L 4C3JH 1Q86C 5JJLA 4LF6L 1IBKQ 4OWWB 1XNRL 3CW2C 1YHBA 1PH8A 4JI3Q 1ASYA 2A1AA 4J15A 4B3TL 4JI3L 1VQJA 2NVYH 1VQ8A 2FXQA 2HIVA 1PVOA 5C4XH 3S17H 1Q1EA 3GD7A 3S24A 2XTIA 4C2MH 4L5TA 1OXUA 3G48A 3A5UA 3CCVA 2VQEQ 4NXMQ 3ZJYC 3PUZA 4DKAC 2VQEL 1X6OA 3AEVA 3GTLH 2ZJPA 1B70B 4A3BH 4A3CH 4X64Q 3U4ZA 5IYBH 1K83H 2K4KA 3UE1A 4HJ5A 5IWAQ 1IBLQ 3KLWA 2BH2A 1X3GA 3HOZH 1LUZA 4A3LH 1YIJA 5AJ3Q 3HOYG 5IWAL 1C7YA 2AWNA 4JV5Q 4MZ9A 3TREA 4AQYQ 4O0AA 5AJ3L 3GTKH 3DM3A 4LUZA 5H1SE 3TQYA 5FJ8H 3J81j 3GO5A 2GVBA 1VQ7A 3PO3H 4DV5L 4JOIA 4BBRH 1XMOQ 2Q2TA 3S1MH 1X65A 5E7NA 4JI7L 4HIDA 4KI0A 1YVCA 1XMOL 4DAMA 4YY3L 3STBC 1PH6A 4Y7NH 1YHQA 1MIUA 4YWKA 3RLFA 2ZTDA 3F2CA 2KBNA 1L0WA 3LGJA 4A4IA 4GKJQ 1NY4A 1WJJA 4DV3L 2ZTCA 1Y1VH 1EOVA 3F2BA 3RZDH 1HJPA 4X6AH 3KFUA 1Z47A 1VS0A 3STBD 3H15A 1A0IA 4HIMA 2CQOA 3ER0A 4JI1Q 1EIFA 3K80C 4DR2Q 2Z6KC 1VQIA 3RNUA 4LF4L 1SN8A 4JI1L 1TWGH 4ME3A 5M3MG 2K52A 3M4PA 4NXNL 4DK3C 3CCRA 4A3IG 1VQMA 1KIXA 2MO1A 5IE8A 3HFZB 4DR3Q 4R1JA 4JI5L 2E2JH 1CUKA 2PQAA 4DR3L 4LF7Q 3CPFA 1JJGA 3HOWH 4APVA 1KXLA 5M3FG 4AH6A 1GD7A 3KJPA 1HZ9A 1M90C 3HOYH 1L1OC 4L5RC 5LMUQ 4GNXA 4LF8L 1FL0A 1YJNA 1XPUA 4DAYB 2VQFQ 4OONA 3HKZE 1RL2A 1HNXQ 4JBKA 3M4QA 2AHOB 3S2HH 2VQFL 4WJ3M 2JEAI 3KF6A 4GS3A 2HHHQ 2KCMA 4IFDG 2JA5G 2YTYA 1G291 3L7ZC 4O2DA 3UDIA 1WFQA 1KRSA 1VQKA 1VCIA 1UEBA 3MEFA 4DNIA 1K73C 1V9PA 4DV0Q 4DR6Q 1WCMG 4FDBA 5GAHC 2R92G 3S1NH 4DV0L 1EUJA 1Q12A 1B8AA 2IHFA 3I2ZA 5IP9H 1K8GA 2RF4A 4LF9Q 3S1RH 4NPSA 5C44G 3G4SA 1L2FA 4LF9L 5GAGC 3ERSX 1EYGA 3UDFA 3E0EA 1D8LA 1PH9A 2PQAB 2JQOA 5M3MH 5M5YH 2JA6G 4KHZA 2JEBI 4DUZQ 1KHIA 4A3IH 1J5EQ 4JI0Q 3W5OA 1M1KC 3M3YH 3TEHB 4DR1L 3BJUA 1J5EL 4DV7Q 1C0AA 2F4VQ 3ULPA 3EBEA 4QL5A 4DV7L 4A3BG 2NN6I 4GNXB 5IYBG 5C0XG 2K5NA 3J7A5 1I94L 3PUYA 2BA0A 2K50A 5M3FH 2ZM6Q 1HR0W 4BY7G 1JMCA 4AYBE 3J80c 3OTOQ 2JA7G 3KF6B 4A93H 1IL2A 1K3RA 4H02A 3FHWA 2JA9A 1PHJA 1EWIA 4QJFA 1SFOH 1N8RC 3HOUH 3PO3G 1Q1BA 2K5HA 5BR8Q 1AE2A 1NJIC 1X55A 3CCJA 5C4JH 2UUCQ 1XNQQ 2JA5H 3GTGH 2V1CC 4A3MG 4A3GG 4A3DH 3PGZA 2CWAA 2VS1A 2WAQG 3CMAA 3CC4A 2AWOA 1EFWA 2GVAA 1TWFH 2E5LQ 2JA8H 4GLAC 1NMFA 4YCUA 2R92H 2RHSB 3BZCA 4L5SA 1W3SA 4JI2Q 1DGSA 2WAQE 4JI2L 1VQAA 1JJ2A 2XGTA 5C44H 5LMNL 3GTQH 2OQKA 5IP7H 1IBKL 3L0OA 2Q2IA 3W1BA 2UXDL 5JJKA 1J6QA 4DV6Q 1FVIA 2JA6H 2NN6G 3H3VH 2OCEA 2WP8J 4HJ9A 4LFBQ 4DR6L 1CKNA 4NXML 4YWLA 5JJIA 4LFBL 4X66Q 1SLJA 4UY8C 3HOWG 4IPGA 4DUYQ 1AH9A 4B3MQ 2I5MX 3WWVA 1K9MC 2NVXH 4DUYL 4X65Q 4X64L 1GM5A 1IBLL 2VW9A 2KENA 3T1HQ 4B3ML 4X65L 2OTLA 1N33Q 4BY7H 2Q2HA 4JBWA 4JC0A 4JV5L 4C3IH 2JA7H 2DUDA 5GADC 4AQYL 2K75A 1N36Q 1E7ZA 4LFAQ 4UP8A 2LXKA 5EAYA 2VNUD 1G51A 3RN5A 3CCUA 2R6GA 3S16H 4K0KQ 1OXTA 1SR3A 3J80i 2B29A 1UE5A 2QGQA 5IT9c 1HZAA 3KJOA 3F1ZA 2JE6I 1UE6A 1JB7A 4A3MH 3CD6A 4AIMA 3M7NA 4A3GH 5FLXc 1Q8KA 3PCOB 1C9OA 5C3EG 4IFDI 3AFPA 1MJEA 4BBSG 3HKSA 4L5QA 1EIYB 2OTJA 5IP9G 4IPCA 2QA4A 2HT1A 5HY6A 3GTPH 4GKJL 5IYCG 1CSPA 5GAEC 1E24A 1VQCA 2I0QA 3A5ZB 1IXRA 2VZAA 2IT1A 1I3QH 4Y52H 1CKNB 3MXNB 4A3KG 4DR2L 2ALYB 3CXCA 4TQUS 1QUQA 2ZJRA 3K7AH 4IOCA 3H0GG 2UXBQ 4IJLA 1VQGA 1YNXA 3PF5A 1VQ4A 4OWXB 4LF5Q 4JI8Q 1Q46A 1GKHA 1E1TA 2D62A 3Q8DA 3I4NG 3H3VI 1H95A 4JI8L 4LF7L 4A76A 2BH8A 3I7FA 4DPGA 4DR4Q 3HKZG 2JK8A 2L15A 3VDYA 2CCZA 1BBUA 1SMXA 2VUMG 4A93G 5C0XI 1OXSC 4RMFA 2CWPA 3A0JA 1GVPA 5LMUL 2UU9Q 1FJGQ 1B7YB 2R7ZG 2R93G 2UU9L 2ID0A 1FJGL 3HOUG 4OX9Q 4OXPA 1HNXL 1VQHA 3HOXG 1LM0A 1PV4A 4LNQA 1PYBA 3A74A 3BU2A 2HHHL 4A3DG 4HIOA 1KD1C 2HQLA 1BVSA 4GOPB 1BKBA 4BY1G 4IJHA 3RLNA 4LUVA 5C3EH 1X9NA 3RN2A 1Q7YC 4POGA 2JA8G 4BBSH 1Q81C 4IOAA 5GROA 2NZHA 4NB3A 1CKMA 3G6EA 4DV2Q 3JAMc 3U50C 5IYCH 4P72A 3NENA 2MFIA 3KYHC 1QUQB 1NMGA 5IP7G 1N34Q 2HIXA 1GO3E 1YZ6A 4YCWA 5ELNA 1P16A 5FLMG 3J7ZC 3CCEA 1XJVA 1N34L 3CC2A 3S14H 1RIPA 2Z0SA 3I4MH 2DGYA 4A3KH 1BBWA 3NBHB 4PZ6A 5K36G 1VQDA 4DUZL 4JI0L 3CCQA 3H0GH 4GN5A 1PA6A 2JJQA 3F8TA 3I4OA 3KF8B 3I4NH 4AYBG 1QZGA 2F4VL 1PH2A 2RCNA 3TS2A 2I5HA 1I5FA 1HR0Q 1FGUA 1HR0L 3G71A 1TWHH 1XTDA 5IY0A 2K5VA 2ZM6L 4KHPQ 3U4VA 1OXVA 2VUMH 3TRZA 4JI6Q 4KHPL 3OTOL 4XIGS 2B3GA 3L2PA 4R4OA 2R7ZH 2R93H 1YBYA 3M85A 2IHEA 2WFWA 4JOIC 3AYHB 4EQ5A 5M5XH 2OWOA 2C35B 4DV1Q 3HOXH 1CKOA 5BR8L 1X3FA 2UUCL 4LW1A 4LFCQ 1XNQL 1Z9FA 5IYDG 2Y0SG 4DV4Q 2PI2E 2QEXA 4MNOA 4BY1H 3J81c 4DV4L 2E5LL 3CF5A 3OW2A 1IBMQ 2UUAQ 2Y0SE 3HOVG 2CKZB 2B63G 1YI2A 2EIFA 1IBML 3SGIA 2UUAL 1L1OA 5J3BA 1Y1WG 2I5LX 3PUXA 2YTXA 5FLMH 3JC66 1VQFA 4LWCA 2GN5A 1PH5A 1PH1A 1KRTA 4KLKA 4DV6L
chains in the Genus database with same CATH superfamily
5I6YA 2F0NA 4NMZA 4M1UB 3HOVB 3TMEA 3DM1A 3I55A 3NUCA 2SEBD 1A63A 1VDZA 1OXXK 1PFMA 2JSOA 3R8BA 3OW7A 4GNXC 4XYOA 1E3PA 2AQ3B 5C4HA 5K5PA 1XNRQ 1N33L 4B3TQ 4KHVA 4K2LA 4IUNA 4B3SQ 4GKKL 1Q3LA 1TWCH 5CV4A 1BCPC 2OQ0A 1HZCA 2L0CA 1BBXC 2LXJA 5IGBA 5IYDH 1F2ZA 4IPHA 4PMWA 4A3JG 1GUOA 2Z4IA 1PTOH 4DK6C 1UUPA 4V190 4CKEA 3DWPA 2B63H 2ES2A 3RLOA 1ZYRD 4R4TA 1E1OA 4POFA 1B2TA 2WKCA 4EX5A 3CC7A 1WYDA 3CRKC 4ZUJA 2EVBA 3S14B 3SK5A 4BA1I 4K2KA 1Y14B 1NR2A 1K0SA 2MJ8A 2RCFA 1BXTA 2CH4A 3GTOH 4LF4Q 1A15A 4OO1H 1QVCA 3TP5A 2CH4W 3HS0C 1XPRA 1GHJA 1QCBD 1TWHB 4GLVB 4IZ8A 1D5XC 1XX8A 1N32Q 3M4OH 1X54A 1LTLA 4A3EG 1VQBA 2QEJC 4RGMA 2MO0A 1VQLA 5DLQE 1CK1A 4JYAQ 2XRSD 1JE5A 2FHTA 1D1KA 1A6XA 2F52A 2YV5A 1QZHA 1D2BA 1E2VA 5KEEA 1II3A 3DEOA 1IYUA 2F3IA 4A3EB 3RZOH 4DU9A 4HJAA 4IO9A 3SK4A 4KN4C 3CPWA 3NELA 3VR6A 4JG2A 3D0FA 4I7ZC 2J0TD 4ZCKA 1SE8A 1H9MA 3GTJH 3O13A 2YTVA 4N9PA 3ULLA 3BZKA 3PO2H 2LSSA 1SBBB 4IURA 4WRDA 1HUMA 2UUBQ 1AFPA 1T5EA 1E0BA 3FKIH 1DJRD 1SNCA 1TXYA 4OO1I 4DR1Q 3C1FA 1WTXA 4RGNA 2NVQH 2PW7A 4A3CG 1I94Q 3E9HA 4A3LG 3OYYA 2F03A 4G7ZC 1N9WA 1NBWA 2Q2UA 4X62Q 1G2SA 5FJ8G 5I4DA 3Q0AA 5J22A 1CQFA 4JBMA 3B6YA 4FVMA 1W2BA 4PZ7A 5KYLA 1HPCA 1EQRA 3M9BA 3PIOA 4DR7L 4ZLTF 1RKNA 1ASZA 5TSSA 3Q6SA 4C3HH 1J8IA 1YNJC 4KY7A 5DAUA 1Y1VG 1V43A 2PMZE 2K6AA 1ZEQX 4CJ0B 3PMFA 1K0RA 4JI4L 1Q86C 4LF6L 4OWWB 5IT9E 1PH8A 3GTMB 4HTHA 4JI3L 1VQJA 2NVYH 1PVOA 3S17H 5E4XA 4C2MH 4L5TA 3G48A 3A5UA 1AZQA 2VQEQ 3ZJYC 1Y69U 3MVVA 1SEBD 2NWGA 1X6OA 5JOBA 3X3MA 2ZJPA 4A3BH 1STGA 3U4ZA 4X64Q 1K83H 2K4KA 4XT1B 1X3GA 1LUZA 1YIJA 5AJ3Q 3HOYG 2RVLA 4AQYQ 4O0AA 2LMCB 1EU3A 4LUZA 3DEPA 3D8GA 4DV5L 1S4ZA 4JOIA 2ZT9C 3S1MH 4JI7L 2BCOA 1TQOA 5CBAE 4DAMA 4YY3L 1XMOL 4Y7NH 1YHQA 2Q8RE 3RLFA 1PTOC 1ILQA 4H0LC 1L0WA 2FMCA 1QE6A 4DV3L 2DY8A 3PIO3 1JWUD 4LMQD 3F2BA 4X6AH 1SYCA 1Z47A 2C5CA 3S1QB 1A0IA 4PQXA 4HIMA 2FJ2A 5M3MG 1TWGH 4ME3A 3S1NB 4DK3C 3VYTA 1VQMA 1KIXA 2MO1A 2XWBB 2E2JH 5DEHA 4DR3L 3CPFA 3V05A 2F0KA 3RMHA 5EJWA 1HZ9A 5M3MB 2AQ1B 1M90C 1LT3D 3KBXA 5C3XA 4GNXA 4LF8L 2A6HD 2DNCA 4DAYB 3HKZE 1RL2A 1HNXQ 4JBKA 5KNBA 2VQFL 4WJ3M 3KF6A 2JP1A 2YTYA 3WDNA 1WFQA 1KRSA 1VQKA 1UEBA 3MEFA 3L3OC 3D6WA 5CV6A 1B8AA 1DOMA 4QCLA 1LT4D 3DXJC 5C4JB 1L2FA 3LWUA 3E0EA 1D8LA 1U4MA 5E4WC 2PQAB 4PNYA 2L1BA 4KHZA 4DUZQ 1J5EQ 4A3IH 3W5OA 1F2MA 1F9SA 1I4QA 1JWSD 2G9HD 5I9PA 3ULPA 3EBEA 3MXUA 4PV1C 2IJ0A 4R8IA 1U4PA 5C4ZA 5C0XG 2ZM6Q 1TS5A 4BY7G 1JMCA 5C4XB 3J80c 2JN4A 2JA7G 4XQJA 4A93H 4CDCC 4N9TA 3FHWA 2JA9A 2DN8A 1PHJA 5EBDA 1H9KA 1EWIA 1EYAA 1KDAA 4OELB 1N8RC 2UUCQ 1Q8IA 2IW3A 1RJTA 2JA5H 3GTGH 4BY7B 2L55A 1Y8PB 2F4IA 2E2DC 2CWAA 3Q23A 3TZUA 1EFWA 4KTAA 2QDBA 1TWFH 2A74C 5M9OA 4YCUA 4L5SA 1W3SA 2OXPA 1B9MA 4JI2Q 2K32A 1Q90A 4DA2A 3L0OA 4X3TA 5CGKA 2AUJD 4DK1A 1QJOA 2RDFA 2F0JA 4Z9CB 2JA6H 1BUVT 3TN2A 5JJIA 5ELDA 3HOWG 5EPKA 1EZ8A 1NSNS 3WWVA 2NVXH 4B3ML 1IBLL 4DFAA 1N33Q 4ME5A 3E6ZX 4JBWA 5IODA 3N6RA 4UP8A 2LXKA 4CJ1B 3HOWB 3S16H 4LJZC 1MSGA 2B29A 1STBA 1UE5A 3KJOA 4DAPA 4DAYA 1UE6A 2QCPX 5FLXc 1Q8KA 3MWYW 5C3EG 3AFPA 1MJEA 2A6ED 4Q5VA 4L5QA 1EIYB 3S2HB 1CA5A 2BE5C 4GKJL 1MBYA 2KECA 5IYCG 5IGDA 1B44D 5IGCA 1E24A 5GAEC 4Y52H 3MXNB 2XWJB 1EQVA 1B3QA 4DR2L 2ALYB 3NHHA 1QUQA 1YNXA 3S1RB 3I4NG 3SXHA 4CKCA 4LF7L 2BH8A 3I7FA 3IAYA 2F0IA 3KF8A 2CCZA 1BBUA 2EE1A 1SMXA 3H91A 4KD3A 3M3YB 3FEWX 4RMFA 3E3XA 1GVPA 2R93G 4O1NA 3I4NB 2ID0A 1FJGL 3HOUG 2EYMA 3HOXG 3NWTA 3A74A 2PCFB 3I4LA 4CDEC 4GOPB 1BKBA 1RODA 2R93B 3HOUB 1EIGA 4IUUA 4U673 3JAMc 3HOXB 2E76C 1YNNC 1IL8A 3NQTA 5F2DA 1N34Q 1ENCA 2HIXA 1XJVA 5ELNA 3S14H 1RIPA 1GUWA 1TS3A 2DGYA 2D5DA 1BBWA 3P1HA 1I6VC 2EJGC 1VQDA 1V1PB 1PA6A 3I4OA 4AYBG 1QZGA 2F4VL 2I5HA 4MN3A 4OHJA 1TWHH 2XN9C 1SNDA 5IY0A 3U4VA 1OXVA 3TRZA 3VR3A 4H7BA 4R4OA 2R7ZH 4AYBB 1UEAB 2LFNA 3MZ5A 4EQ5A 2C35B 1I6HB 4XT3B 2ICEC 1JOOA 3HEJA 1Z9FA 5A2QE 2A68C 2PI2E 5CBEE 1ML0D 3T56B 2E5LL 2VXWA 2B2WC 3OW2A 2K03A 1IBMQ 4X3UA 1FR3A 1Y1WG 1F9PA 2I5LX 5FLMH 3EVQA 3JC66 1VQFA 2F0HA 3V96A 3CHBD 1HA6A 1KRTA 4KLKA 1PH7A 1TWAB 4UAIA 5CMDA 2KCNA 1U0LA 1CHPD 5A35A 3MXNA 2EQSA 2KHIA 1Y1WB 4R9WA 1LACA 2PYKA 1PRTC 1C48A 2EXZA 4JI4Q 1EIHA 3K7AB 3T1HL 4GN4B 4LF6Q 4KMUC 2L4NA 4YCVA 5LMNW 1WD1A 2WB1E 2R61A 1X56A 1N36L 2K7VA 4LFAL 2NUCA 3UDGA 2MNAA 1VQOA 1U5KA 2EY1A 2ATWA 4J6HA 2PO4A 4A3FG 4MTNA 4JW0A 1ZYRC 4ZYSA 1ET9A 1F77A 2R7DA 4GOPA 1MKHA 1SXTA 1XMQQ 3J81i 1F2LA 2B2UC 4FXGC 3ULJA 2AKWB 4DV5Q 4A3FB 3T1YL 4BBSB 4GLXA 1TS2A 1WOCA 1S72A 4QGUA 4JI7Q 4YY3Q 1FD7D 3EIVA 3AB9A 5D3IB 2UXBL 1YITA 2BA1A 4DV3Q 3GTMH 3PF4A 2A5HA 4DXFA 1Q82C 4HIKA 2K14A 1LYLA 3HZXA 3VA5A 2IX3A 1VQ9A 5AFWA 1SE4A 2ASBA 3L9AX 2SNMA 4V0BA 1EQQA 1HNWL 3CAMA 2EYPA 3H94A 2EXDA 2E74C 4I65A 3OMCA 4HJ7A 4H13C 4XYQA 2RBMA 1PYWD 2RSOA 4DR5L 1DYQA 2WV6D 4LF8Q 3ND8A 3QJYA 4DV2L 2HUGA 4RKBA 3HP3A 1HHVA 2PI2A 1A3TA 2EYLA 1DZ1A 2CFMA 1R9TH 4XXEA 4EQPA 3NBIA 4U68A 3A7AB 4RGTA 3S1QH 5LHY1 1QVGA 3MXGA 2F0SA 4BXXG 2NZ1D 1HNZQ 3W2DA 1DONA 2N49A 1STYA 5CR3A 1VQNA 4C3JG 1SE3A 3SVMA 4JI6L 1SMYC 4EGVA 4KV6A 2F0LA 1W6JA 1JC7A 1IKLA 4IPDA 4DV1L 5CYUA 2M2LA 4J1MA 4LFCL 5KIXA 3I56A 3HOZG 1HH2P 2A8VA 1SYGA 1UE1A 3K5LA 4B3RQ 3IRBA 3UI2A 3E9IA 2A19A 1XXGA 4LAAA 2IX1A 1KTKA 2CHBD 2D2CC 2K01A 2LKVA 3NSWA 1RF2D 4S3SA 2Z8LA 1WTVA 4UP9A 1LTAD 1S5FD 4BBRG 4F88A 5HGQA 3CKIB 3E5SA 1UE7A 3DWQA 2UXCL 1KAWA 3A55A 3CRLC 4UP7A 2N8NA 1JQYD 3DWAA 1E2WA 1TT2A 1JOKA 1AE3A 3P75A 4IALA 5EQ0A 3TDQA 1FYCA 4L8JA 1YHBA 3H3VC 2M00A 1VQ8A 1M4VA 2FXQA 3BDCA 1WTQA 5C4XH 2OTJA 2XTIA 4MTKA 2QKIC 1LT5D 4DKAC 1AW7A 2Q8TA 3GTLH 2F0QA 3UE1A 1IBLQ 2UXDQ 5IWAQ 3T4AC 1SNMA 4I7AA 1RTNA 2AWNA 3TREA 1Y8NB 3TQYA 2E2HB 1DXMA 1PMRA 2GVBA 2F3WA 4A3JB 2CW0C 1X65A 4HIDA 1GOZA 3TP8A 4ILWA 4HMIA 3BDLA 4GKJQ 1NY4A 1WJJA 3A8IE 2ZTCA 1EOVA 5C3WA 1QILA 3EJIA 2MPMA 1VS0A 3STBD 3MHBA 1WTPA 1PZID 1H9RA 3ER0A 4JI1Q 3RNUA 1EIFA 4K8JA 4DR2Q 2Z6KC 1VQIA 1SN8A 1G6PA 3GQBA 4NXNL 5IE8A 1EU4A 4K6LA 2HQEA 2Z4HA 4R1JA 4JI5L 2A6HC 3K5NA 4LF7Q 3HOWH 4APVA 3K6OA 3ITPA 5M3FG 4AH6A 1GD7A 3KJPA 1GJXA 1LV9A 5M5YB 1L1OC 1XPUA 2MGSA 3U9SA 2N55A 3HG9A 4JK1C 3M4QA 3S2HH 3M4YA 1MSHA 4RKLA 5M3FB 1EWCA 2K5WA 4O2DA 3L7ZC 3A56A 2P5ZX 4F7XA 1V9PA 2RSNA 4FDBA 1B1ZA 4DV0L 2IHFA 3I2ZA 1S5CD 3SEBA 4EQOA 2RF4A 4LF9Q 3S1RH 5C44G 1LTBD 3G4SA 1U4RA 3OWFA 3MFGA 3ERSX 3UDFA 4B9XA 1PH9A 2X69A 2XNAC 3A54A 1EY6A 2B2UA 5DM63 3K59A 1JR0D 3M3YH 1KLUD 3BJUA 5M5WB 2F4VQ 4DV7L 4GNXB 5IYBG 3J7A5 2K5NA 2O2LD 2QILA 2Z1CA 3QIAA 4DK0A 2F0WA 3KF6B 1BCPB 1PZJD 1SFOH 3HOUH 3PO3G 4R8NA 1CA6A 2K5HA 4O42A 1PFBA 4HEDA 4IFDH 3LNNA 2F3VA 4KN7C 4DN4M 4A3MG 4A3GG 3GTKB 1W6KA 2VS1A 3CMAA 2AWOA 4RHSA 2E5LQ 3C46A 3A8JE 2R92H 3PO3B 1O80A 1Z7TA 2RHSB 4DXGA 3OHXC 2B2TC 1DGSA 5LMNL 4A3MB 3MFYA 4A3GB 2OQKA 1EY0A 2KCCA 2PMZB 1IBKL 1SJHD 5JJKA 1NR4A 3J7AF 1Y1VB 3I70A 4LFBQ 3BG3A 4DR6L 4NXML 2A73B 4UY8C 2F0PA 4DUYQ 4KD4A 1K9MC 4X65Q 3T1HQ 2FFKB 2KENA 4X3SA 3D4DA 1KAAA 3FMCA 2BDNA 4JPBW 2OTLA 2Q2HA 2F0VA 4JC0A 4JV5L 4C3IH 3GV3A 1N36Q 1SJED 1WTHA 4KY5A 1X3PA 4LFAQ 1GUSA 3IKJA 3J80i 5IT9c 3HOYB 3OIPA 1JB7A 3PCOB 4F87A 1E2ZA 1BQQT 4IFDI 1IW7C 2VB3X 1BCPD 1WVLA 1CSPA 5IGFA 3I90A 1DD2A 4FF1A 1IXRA 1KNAA 3D4RA 1O7YA 4A3KG 4IOCA 1F9RA 2ZJRA 3K7AH 2UXBQ 1VQGA 4Q0FA 4F8MA 3R2IA 1GKHA 1LTRD 5CORA 3TP6A 4JI8L 1I4HA 4A76A 3KLRA 4DPGA 4A3KB 3HKZG 2JK8A 3VDYA 1G91A 1G2TA 2CWPA 5LMUL 1B7YB 5ELEA 2UU9L 4K6DA 4OXPA 2HD3A 5A2QL 4YIJA 1PV4A 3HKZB 2VB2X 2HHHL 4A3DG 4HIOA 2HCCA 1X9NA 1ET6A 4BY1G 1BDOA 3RLNA 4POGA 1EYCA 1LTTD 3RN2A 4BBSH 5GROA 1CKMA 3G6EA 4DV2Q 4G7HC 4P72A 5FKAC 2MFIA 2ICIA 3KYHC 1QUQB 1V8QA 1CTMA 1RDPD 1TIID 5IP7G 4A3DB 1GO3E 1P16A 4E6IA 5EKIA 2M9VA 4ZKCB 3NBHB 5K36G 3H0GH 5BN3A 4GN5A 3F8TA 3P20A 3KF8B 5JPNC 3GTQB 2IPKD 4FF2A 1PH2A 5JAVA 2MUYA 2RCNA 3TS2A 1FNWA 3V2TA 1ZXTA 1HR0L 1NNXA 1D6EC 1AZPA 4KHPQ 2VUMH 4JI6Q 3OTOL 4XIGS 2B3GA 4FXKC 4ZUIA 1YBYA 3M85A 2WINB 2OWOA 4DV1Q 1TKWB 1X3FA 5BR8L 4LFCQ 5IYDG 2JA7B 4DV4Q 1HQRD 2QEXA 5I6WA 1BNZA 1TWCB 3CF5A 5EPJA 1S5DD 2B63G 1YI2A 2UUAL 1L1OA 4FF3A 1HCZA 4OEMB 1LO5D 3X3NA 3U9OA 1A2UA 5JVG3 2GN5A 2WIIB 1VMCA 1PTOB 1PH5A 5ELBA 3RUZA 3GTPB 3AQQA 4QQBX 2UXCQ 2KQ3A 1VMPA 2YYZA 3AFQA 2PZWA 1YEZA 2VL6A 1I3QB 4BXXH 3D6CA 4JCVE 2PNHA 4PG3A 2PZTA 4B9WA 4OO1G 4GKKQ 4R4IA 1I50H 4ODGA 3S2DH 2IX0A 4IFDJ 1PYSB 4B3SL 1EYDA 4JBJA 4OL7A 5JEAG 2ZJQA 3H6MA 1S40A 4K0KL 2EDGA 1STNA 3GTOB 3ND9A 2WKDA 1SAPA 5BN4A 3CU7A 1EWHA 2PNRC 5I9OA 1HTLD 3HOVH 4LUOA 3BDOA 5FO7B 4HJ8A 3NTKA 1MD2D 2KHJA 3QWNA 5C6AA 5C3EB 3W1GA 3W3AA 1C8CA 2AQ2B 3DHQA 3SK8A 2H1EA 3FVQA 1SRUA 1VQPA 2F0DA 1IYVA 2EYOA 3NEMA 3NBHA 2NTTA 3NXWA 1JJCB 4UPAA 3GP7A 3PO2G 3RZOB 1ILPA 3UE0A 1EQTA 1P8LA 3I73A 4RCNA 4KKTA 2B2TA 1ESRA 5T1GA 4TSSA 2N78A 1TU2B 1PTOD 4L63B 1DCZA 2A69D 3VYRA 4NXNQ 3FKIG 3J81L 1NTGA 3PUVA 1PDQA 3PO2B 3BYTB 4JI5Q 4CBVA 2E2HH 5FO8B 3AMUA 3PSIA 2D0PA 2TMPA 4PZ8A 1N32L 1ONLA 4A3JH 3FKIB 4JYAL 3TS0A 3KDFA 2KCTA 2NVQB 4G57A 3VR4A 4FP5D 4L6TB 2KEEA 3DLLA 1KDCA 4BWGB 3NP8A 3EN2A 1S5BD 3K8AA 1VQEA 3P7JA 4C3HG 4HSVA 2EY6A 3J7AV 2BOSA 1XPOA 2VY3A 4QIWE 3GDEA 3KLSX 4YWMA 1D7QA 1E22A 5EKLA 2H4OA 3WOFA 3KBGA 3MA2B 2UUBL 5HGTA 4FNFA 4C3HB 1JT8A 2PW5A 1D1IA 2CVRA 2F1MA 1IYJB 1YJWA 4GZYC 3M7GA 2FMMA 2F0OA 4A3EH 2DNEA 4XTCS 1JOQA 3CCMA 3TP7A 1UWVA 2TSSA 3HGBA 2NVYB 3CMEA 1OTCA 1PH3A 4C2MB 1J9OA 2E2IB 2B2YC 3U58A 4X62L 1NE3A 2YU9B 5NUCA 4R4CA 1OO9B 2IL8A 2MQHA 2IY5B 4C1NI 4PMBA 5JPMC 4CHTB 4KKUA 4DR7Q 2EY2A 5E1FA 4QUCA 3NTHA 2KVMA 2PQEA 2SNSA 2D0OA 1CSQA 4R4QA 3K81C 2RKSA 2WB1G 1V1OA 4RG1A 4YHHL 4K5VA 5KNDA 1ENFA 3S1MB 5LMNQ 5M5WH 1PLFA 1SYBA 5JJLA 4KKSA 4PMCA 1IBKQ 4Y7NB 2EJFC 4JI3Q 1ASYA 5ELFA 4UHVA 3IFDA 2WB1B 3GD7A 3BVZA 4DR6Q 1OXUA 4NXMQ 2QDLA 4IUQA 1T5XD 3CCVA 1JE4A 2RA4A 2VQEL 4A3CH 4QMGA 1JCKB 5IYBH 1EEID 2N88A 1JWMD 2NB0A 3CQZB 4A3LH 3KLWA 3BYYB 1HRJA 1TWGB 1M8AA 4JV5Q 4MZ9A 1IKMA 5AJ3L 5CV9A 3GTKH 4RCOA 5H1SE 2E2JB 3MAQA 3MTSA 5FJ8H 3GO5A 1VQ7A 4XQQA 3PO3H 3QB3A 1XMOQ 2Q2TA 3MXPA 5E7NA 4C56C 1O7ZA 1PH6A 3STBC 2DJFC 4YWKA 2ZTDA 3F2CA 2I07B 5IGGA 3DUZA 3S15B 3FPUB 1Y1VH 1HJPA 3QO2A 3NTIA 3H15A 1H9JA 1GUTA 2CQOA 4JVZA 2ZXPA 2K52A 3M4PA 4A3IG 4ZAIA 3R3OA 2KUMA 1Y8OB 3T16A 3HFZB 4DR3Q 1TVXA 1JJGA 1KXLA 1F2YA 3FPPA 1WTRA 3HOYH 4A3IB 5K36H 4L5RC 5LMUQ 1O78A 2VQFQ 1PXUA 2AHOB 2JEAI 1R4QB 2HHHQ 1JB3A 2NVTB 2JA5G 4BS9A 4QUFA 1SYEA 1GUGA 1I4PA 3N52A 4N8FA 4DNIA 4KJOA 1K73C 1B53A 1WCMG 3S1NH 1EUJA 1EY9A 1K8GA 2JA5B 3C1EA 3GTGB 1STHA 5GAGC 1EYGA 1TWFB 2JQOA 1WCMB 1PZKD 5M3MH 2L11A 2JA6G 2JEBI 4RA8A 5L37A 3J81E 1J5EL 1SDFA 1PRTB 1C0AA 1YNND 4C3JB 4QL5A 3I3CA 2BA0A 1SYDA 2K50A 1TY2A 1HR0W 2JA6B 3OTOQ 1K3RA 2EYHA 1HFNA 3H09A 4UDUC 1Q1BA 5BR8Q 3HOZB 1AE2A 2NVXB 1X55A 3CCJA 5C4JH 5JJZA 3IL8A 2V1CC 5G3LD 4A3DH 2WAQG 4HCEA 2KEDA 4RGOS 2G9DA 1NMFA 3QG1A 3BZCA 3SE0A 2HCIA 4BBRB 2WAQE 4JI2L 1VQAA 3GTQH 3D4WA 2A68D 5IP7H 5ISRA 2WAQB 3NQIA 5J1ZA 2Q2IA 3W1BA 4IQZA 4ULLA 1J6QA 1KABA 2V4DA 1FNVA 4HN7A 1FVIA 2NN6G 2OCEA 2WP8J 4HJ9A 3RZDB 2XSCA 1CKNA 5J39A 1SLJA 4IPGA 3ZYYX 1AH9A 1AEXA 2I5MX 4B3MQ 1SNQA 5C0XH 2VW9A 1O7LA 4IUTA 3EROA 5D65A 4BY7H 1LLRD 2JA7H 1BCPF 2K75A 1VF7A 2L5TA 3G6JB 5FOBB 2VNUD 2R6GA 1PRTD 4K0KQ 1HZAA 2JE6I 3CD6A 3M7NA 4AIMA 2F0GA 2B8GA 5BN5A 5IP9G 4RH6A 4IPCA 2QA4A 5HY6A 1UNSA 3GTPH 1EY4A 1Z6HA 2B2WA 4J8QA 1VQCA 2I0QA 1EY8A 3NK9A 1HQMC 1I3QH 2ZXOA 2B2YA 1XTCD 1ZKOA 1EY5A 1HA5A 3CXCA 4DF7A 4IJLA 1VQ4A 4OWXB 3J80L 1Q46A 2D62A 1E1TA 3I72A 1H95A 4HSPA 3C2PA 4IUPA 5KNCA 2L15A 1GUNA 5EPLA 5C0XI 3KUPA 4TKOB 3OOCA 1FJGQ 2R7ZG 3I91A 1LTGD 4N8X1 3K0YA 1VQHA 2LS01 5JEAH 1PYBA 2RDHA 1KD1C 2HQLA 1BVSA 2K33A 5CV8A 5C3EH 2JA8G 2R7ZB 1Q81C 1G6ZA 4IOAA 2NZHA 2EOTA 2SOBA 3U50C 5IYCH 3NENA 1NMGA 2ZXRA 5FLMG 1N34L 2JA8B 1CZGA 1H9SA 1UAPA 4JI0L 3CCQA 2F0MA 4CDDC 5C44B 3I4NH 4TRDA 1STEA 2KOLA 1FGUA 4NKLA 1XTDA 2K5VA 3VYSA 5KRUA 4K5WA 1I4GA 3L2PA 1BO0A 2R93H 5FLXL 1AN8A 4K14A 1SSOA 4DNRB 3HOXH 3Q22A 1XNQL 1SYFA 3A8KE 2XRQD 4HR7B 1NUCA 1SMYD 2X6LA 5D14A 3FRPB 1EY7A 1TY0A 2O5IC 4CGYB 2CKZB 3EQLC 2EIFA 1IBML 3SGIA 1XWEA 1EL0A 3PUXA 1ENAA 3K5MA 2F0FA 3MEHA 4LWCA 3PQIA 1D5ZC 4DV6L 1WD0A 3KLSA 3FP9A 3S9WA 5I2XA 1WTOA 2K1BA 4FF4A 2K04A 4X66L 4YHHQ 3VYUA 4A75A 1KQSA 1I6HH 1VQ6A 3NE5B 1QVFA 1EOTA 2PPBC 2A6EC 1V1QA 2OF1A 1WI5A 1CT1D 3JAML 2E2IH 1CI3M 1ICWA 2NZOA 5HURA 1JORA 1L1OB 2YU9H 2EZVA 5GQOA 2E8GA 1TWAH 3IFTA 4KJNA 1PFSA 1S5ED 4QY7A 1Y1WH 1KNEA 3T1YQ 1XMQL 4EQNA 4WJWA 3I4MG 3AU7A 2QW7A 1O7IA 2EPBA 1MGSA 1PTOF 2Z9HA 3OMGA 1KLGD 3MC0B 3UDXA 5CV5A 4LF5L 5C0XJ 2A69C 4OWTB 2EYJA 1X3EA 3I4MB 1R9TB 2KHSA 2CW0D 3KOJA 4DR4L 1RCVD 3ICEA 5JVH3 3PUWA 1HNWQ 1K8OA 3CQZH 2K05A 2J7ZA 2X6GA 3HRZC 2F0UA 4M8AA 4OX9L 3RR5A 4P71A 1PFNA 1A62A 1HZBA 4BA2I 5D3DA 1QOHA 4A3FH 1SROA 1S3OA 4DR5Q 5M5XB 2CQAA 2BDOA 1I4RA 1STAA 2H5XA 2RDGA 4BY1B 5IIFA 3S15H 3T51B 3RD4A 1YJ9A 3CP0A 4IN3A 1XYIA 1KL9A 4RAUC 4TVAB 1R4PB 1PH4A 3J80E 1TR5A 1VQ5A 1KDBA 3ONAB 1HNZL 4RHRA 1X32A 3FDTA 3K0XA 1CZWA 1K8AC 5T1IA 5JEAJ 3J7YW 2AMCB 2C9OA 1KC8C 2J4XA 2R7FA 1ESFA 5C4XG 2Z6KA 4KK7A 4NW2A 1CM9A 3GV6A 4GN3B 1QNUA 3D31A 3PIPA 1B4OA 2ZTEA 3KDFB 1MI2A 3K7UC 1MJCA 2DY7A 3PV0A 1GHKA 4P74A 5ELOA 3CCLA 5I2YA 1F9QA 4GOPC 2NVTH 1T9HA 2RHQB 2N3SA 1ICFB 4B3RL 2GA4B 3CCSA 3URYA 4CDFC 2JYOA 1A3UA 1NCVA 3GTLB 3JAMi 1AP0A 3NWSA 1A8VA 3TZDA 1GXDC 4RWSC 4P73A 2B63B 3F2DA 4P75A 3SR1A 1WCMH 1YHAA 3OWEB 5E3FA 3VA7A 4ALPA 1IZ6A 4C3JH 1XNRL 3CW2C 2L9HA 2A1AA 4J15A 4B3TL 2L12A 1YNJD 2HIVA 5FLXE 1Q1EA 5COYA 1B3AA 3S24A 4IUVA 3VR2A 2I46A 3PUZA 3AEVA 4RFBA 1B70B 1BOSA 4HJ5A 3C3LA 3HOZH 2BH2A 2SDFA 3PIP3 2UXDL 5IWAL 1C7YA 3BVMA 3DM3A 4XQNA 2KA7A 1FNUA 4ID6A 3K58A 1WTWA 3J81j 3M4OB 1C4QA 4CKBA 4BBRH 4KI0A 1YVCA 3VR5A 1MIUA 2KJXA 5FK9C 2KBNA 3LGJA 2O5JC 4A4IA 4HCSA 1QNKA 4MHEA 2B2VC 2XVSA 1MHWC 2PZUA 3RZDH 3KFUA 1NAPA 1VF5C 4WJ4A 3K80C 4LF4L 1K28A 3D3RA 4JI1L 3CCRA 3GTJB 1IW7D 4QB4A 2NN6H 5CV7A 3BS1A 1CUKA 2PQAA 3SHLA 3JAME 3T53B 3K57A 5KGUA 4H44C 2FINB 2JXMB 2AUKA 4HAEA 1FL0A 1U9RA 2Q8IB 1YJNA 1RD9D 3NPPA 4OONA 4ABNA 3G7LA 4GS3A 2KCMA 4IFDG 5IOCA 1G291 3UDIA 5KYIA 2Z6BA 1RHPA 1VCIA 4MIUA 4DV0Q 4OIKA 5GAHC 4XDXA 1SFOB 2R92G 1Q12A 2B39A 5IP9H 3T13A 1TS4A 4NPSA 4LF9L 4G4KA 5C5LA 2OEOA 4QIWB 5DNFA 5M5YH 2R92B 5ELCA 4JI0Q 1KHIA 2HDLA 1SE2A 1M1KC 3TBIB 3TEHB 4DNTB 4DR1L 4DV7Q 1BR9A 2ENBA 3SK6A 4A3BG 2NN6I 2F0TA 5G3LF 1I94L 3PUYA 5M3FH 3E0JA 1HXYD 2EYFA 3S17B 2DJGC 3LWEA 4AYBE 4C3IG 1EEFD 1IL2A 4H02A 4QJFA 4A3BB 1K83B 1NJIC 4B08A 1XNQQ 3K5OA 1B9NA 4X3KA 3R93A 2EJMA 3PGZA 4C3IB 4DGZA 3CC4A 1D5MC 2GVAA 4FO2A 2JA8H 2OT2A 1RTOA 4GLAC 3OIQA 1HTPA 1A2TA 3BZDB 2EY5A 4HMJA 3TSSA 1JJ2A 4FXDA 3SDZA 2XGTA 5C44H 1X3QA 4DAVA 3F2UA 4K5XA 1EZ6A 4DV6Q 3H3VH 3A7LA 1K8MA 2D9UA 1PRTF 4P2CB 4YWLA 1I4XA 5EKKA 4LFBL 4X66Q 4OIJA 3QR8A 3OSOA 2F0EA 2O4XA 4DUYL 1DM0B 1GM5A 4X64L 3QOLA 3Q24A 4X65L 2G5DA 4C1NK 3KK7A 2DUDA 5GADC 4AQYL 1E7ZA 5EAYA 1U4LA 1G51A 3RN5A 3CCUA 1OXTA 1SR3A 5EBCA 2QGQA 1L0YB 1LTID 3F1ZA 3EA6A 4A3MH 4A3GH 3DMUA 1C9OA 4G7OC 4BBSG 3OPOA 3HKSA 2WACA 1B50A 4WFN3 2HT1A 4QF4A 2K5QA 3QOJA 1QB5D 3A5ZB 2VZAA 4ZRZA 2IT1A 4K8IA 1CKNB 4EVOA 4LK1C 2BE5D 4TQUS 3LX0A 1QG7A 1LTSD 3H0GG 4LF5Q 3PF5A 4JI8Q 3Q8DA 2E75C 3H3VI 2XIWA 1LT6D 1V1PA 4DR4Q 3I8ZA 4NP5A 5C5MA 1K3BC 2VUMG 4A93G 2NYZD 1OXSC 3H0GB 3A0JA 2UU9Q 5LL6S 1HFGA 2QF7A 1LABA 4OX9Q 1HNXL 1HUNA 5FO9B 1LM0A 3R2TA 4LNQA 3BU2A 1DOLA 4A93B 2VUMB 4IJHA 4LUVA 1Q7YC 4NDXA 4NB3A 2HDMA 1SNPA 5CC4A 1YZ6A 4YCWA 3CCEA 1EFID 3CC2A 5EGTA 3J7ZC 2Z0SA 1QWYA 2K28A 4A3KH 3I4MH 1SNOA 2RQXA 4CJ2C 4PZ6A 4DUZL 2JJQA 3EFXD 4KY6A 1DOKA 1I5FA 1HR0Q 1CFMA 1L0XB 3BVGA 3G71A 2K5DA 2MP1A 2ZM6L 1FGBD 2B2VA 5IT9L 4KHPL 4ZQ3A 4ZK9B 5LL6X 2IHEA 2WFWA 4JOIC 3AYHB 5M5XH 2IWHA 4OGQC 2MHVA 1CKOA 2UUCL 4LW1A 2LY7A 2Y0SG 3WOEA 5IGEA 1JICA 4MNOA 4BY1H 3J81c 4DV4L 1I50B 3S2DB 1CHQD 3S16B 2UUAQ 2Y0SE 3HOVG 1CQVA 1H9SB 5J3BA 2R3ZA 4ZKBB 2NBFA 2NTSA 2Y0SB 2YTXA 1BF4A 1G8ZD 1IHZA 4FYDA 2B8FA 5DM73 1PH1A 3ERQA 4WORA 1A3VA
chains in the Genus database with same CATH topology
3AQQA 4QQBX 2UXCQ 1U0LA 2EQSA 2YYZA 3AFQA 2KHIA 3FP9A 3I55A 1A63A 1YEZA 2VL6A 1OXXK 4X66L 4YHHQ 4A75A 1KQSA 4BXXH 1I6HH 1VQ6A 4JCVE 1QVFA 2PNHA 4PG3A 4GNXC 4JI4Q 3T1HL 4LF6Q 4GN4B 1E3PA 1XNRQ 1N33L 4YCVA 4OO1G 5LMNW 2WB1E 4GKKQ 4B3TQ 1X56A 4R4IA 1N36L 1I50H 4B3SQ 3S2DH 2IX0A 1V1QA 1TWCH 4LFAL 4GKKL 4IFDJ 1WI5A 1PYSB 3UDGA 2MNAA 1VQOA 1U5KA 4JBJA 5JEAG 2ZJQA 2OQ0A 4B3SL 1HZCA 1S40A 2ATWA 4K0KL 2E2IH 2LXJA 5IYDH 2NZOA 4A3FG 4MTNA 4IPHA 1L1OB 2YU9H 4PMWA 4A3JG 2R7DA 5GQOA 4DK6C 2E8GA 1TWAH 4GOPA 1PFSA 4QY7A 1MKHA 2B63H 4LUOA 3HOVH 2ES2A 4HJ8A 3RLOA 1XMQQ 1Y1WH 3J81i 2KHJA 3T1YQ 3ULJA 2AKWB 4DV5Q 1XMQL 3W1GA 3T1YL 3I4MG 1O7IA 4GLXA 1S72A 1WOCA 4R4TA 4QGUA 1E1OA 4POFA 4JI7Q 4YY3Q 3EIVA 4EX5A 3UDXA 3CC7A 1SRUA 1VQPA 4LF5L 1YITA 1WYDA 2BA1A 5C0XJ 2UXBL 4DV3Q 4OWTB 3GTMH 3PF4A 3NEMA 1JJCB 1X3EA 4UPAA 1Q82C 3PO2G 4BA1I 4HIKA 3UE0A 1P8LA 1Y14B 2K14A 3KOJA 1LYLA 4DR4L 3ICEA 3GTOH 1VQ9A 2ASBA 2N78A 3PUWA 4LF4Q 1QVCA 1HNWQ 3CQZH 4NXNQ 3FKIG 1NTGA 1EQQA 1PH7A 3CAMA 3PUVA 1HNWL 4OX9L 3RR5A 1XPRA 4P71A 4GLVB 4JI5Q 1A62A 2EXDA 1HZBA 4BA2I 2E2HH 4HJ7A 1N32Q 3M4OH 1X54A 1LTLA 3PSIA 2D0PA 4A3FH 1SROA 4A3EG 4PZ8A 1VQBA 1N32L 1S3OA 4DR5Q 2MO0A 4A3JH 5DLQE 1VQLA 4JYAQ 4DR5L 4LF8Q 1JE5A 4JYAL 4DV2L 3TS0A 3KDFA 2KCTA 2F52A 2YV5A 2H5XA 1QZHA 2PI2A 2F3IA 3RZOH 2CFMA 1R9TH 3S15H 4HJAA 4IO9A 3DLLA 3CPWA 3NELA 3CP0A 1YJ9A 4JG2A 3S1QH 3EN2A 3K8AA 1KL9A 3D0FA 1QVGA 4TVAB 1VQEA 1PH4A 1SE8A 4BXXG 3GTJH 1HNZQ 2YTVA 1VQ5A 3ULLA 3BZKA 3PO2H 2N49A 1HNZL 1XPOA 2LSSA 2VY3A 1VQNA 3K0XA 4QIWE 3GDEA 4YWMA 1D7QA 1E22A 1G6PA 1K8AC 2UUBQ 4JI6L 5JEAJ 2AMCB 2UUBL 1KC8C 1JT8A 2R7FA 4WJ4A 3FKIH 5C4XG 2Z6KA 1TXYA 4OO1I 4DR1Q 4IPDA 4DV1L 4GN3B 1IYJB 1YJWA 3D31A 3PIPA 4LFCL 2NVQH 2ZTEA 3KDFB 4A3CG 1I94Q 3E9HA 3K7UC 3I56A 1MJCA 3PV0A 4A3EH 4XTCS 3OYYA 3HOZG 4A3LG 4P74A 5ELOA 3CCMA 1UWVA 1HH2P 1N9WA 1NBWA 4GOPC 3CCLA 1UE1A 2A8VA 2NVTH 1T9HA 3IRBA 2RHQB 3E9IA 4B3RQ 2A19A 2N3SA 3CMEA 1OTCA 1PH3A 2IX1A 3CCSA 2Q2UA 4X62Q 4B3RL 5FJ8G 3U58A 4X62L 4UP9A 4JBMA 1NE3A 3JAMi 4R4CA 3B6YA 1A8VA 4BBRG 2MQHA 2IY5B 1W2BA 5HGQA 4PZ7A 4P73A 4DR7Q 3M9BA 1EQRA 3PIOA 3F2DA 4DR7L 1UE7A 4P75A 2UXCL 1KAWA 1ASZA 4UP7A 2D0OA 1CSQA 4R4QA 3K81C 1WCMH 2N8NA 2WB1G 4C3HH 2UXDQ 1YHAA 4RG1A 1Y1VG 1V43A 4YHHL 2PMZE 5LMNQ 5M5WH 1AE3A 4ALPA 1IZ6A 1K0RA 4JI4L 4C3JH 1Q86C 5JJLA 4LF6L 1IBKQ 4OWWB 1XNRL 3CW2C 1YHBA 1PH8A 4JI3Q 1ASYA 2A1AA 4J15A 4B3TL 4JI3L 1VQJA 2NVYH 1VQ8A 2FXQA 2HIVA 1PVOA 5C4XH 3S17H 1Q1EA 3GD7A 3S24A 2XTIA 4C2MH 4L5TA 1OXUA 3G48A 3A5UA 3CCVA 2VQEQ 4NXMQ 3ZJYC 3PUZA 4DKAC 2VQEL 1X6OA 3AEVA 3GTLH 2ZJPA 1B70B 4A3BH 4A3CH 4X64Q 3U4ZA 5IYBH 1K83H 2K4KA 3UE1A 4HJ5A 5IWAQ 1IBLQ 3KLWA 2BH2A 1X3GA 3HOZH 1LUZA 4A3LH 1YIJA 5AJ3Q 3HOYG 5IWAL 1C7YA 2AWNA 4JV5Q 4MZ9A 3TREA 4AQYQ 4O0AA 5AJ3L 3GTKH 3DM3A 4LUZA 5H1SE 3TQYA 5FJ8H 3J81j 3GO5A 2GVBA 1VQ7A 3PO3H 4DV5L 4JOIA 4BBRH 1XMOQ 2Q2TA 3S1MH 1X65A 5E7NA 4JI7L 4HIDA 4KI0A 1YVCA 1XMOL 4DAMA 4YY3L 3STBC 1PH6A 4Y7NH 1YHQA 1MIUA 4YWKA 3RLFA 2ZTDA 3F2CA 2KBNA 1L0WA 3LGJA 4A4IA 4GKJQ 1NY4A 1WJJA 4DV3L 2ZTCA 1Y1VH 1EOVA 3F2BA 3RZDH 1HJPA 4X6AH 3KFUA 1Z47A 1VS0A 3STBD 3H15A 1A0IA 4HIMA 2CQOA 3ER0A 4JI1Q 1EIFA 3K80C 4DR2Q 2Z6KC 1VQIA 3RNUA 4LF4L 1SN8A 4JI1L 1TWGH 4ME3A 5M3MG 2K52A 3M4PA 4NXNL 4DK3C 3CCRA 4A3IG 1VQMA 1KIXA 2MO1A 5IE8A 3HFZB 4DR3Q 4R1JA 4JI5L 2E2JH 1CUKA 2PQAA 4DR3L 4LF7Q 3CPFA 1JJGA 3HOWH 4APVA 1KXLA 5M3FG 4AH6A 1GD7A 3KJPA 1HZ9A 1M90C 3HOYH 1L1OC 4L5RC 5LMUQ 4GNXA 4LF8L 1FL0A 1YJNA 1XPUA 4DAYB 2VQFQ 4OONA 3HKZE 1RL2A 1HNXQ 4JBKA 3M4QA 2AHOB 3S2HH 2VQFL 4WJ3M 2JEAI 3KF6A 4GS3A 2HHHQ 2KCMA 4IFDG 2JA5G 2YTYA 1G291 3L7ZC 4O2DA 3UDIA 1WFQA 1KRSA 1VQKA 1VCIA 1UEBA 3MEFA 4DNIA 1K73C 1V9PA 4DV0Q 4DR6Q 1WCMG 4FDBA 5GAHC 2R92G 3S1NH 4DV0L 1EUJA 1Q12A 1B8AA 2IHFA 3I2ZA 5IP9H 1K8GA 2RF4A 4LF9Q 3S1RH 4NPSA 5C44G 3G4SA 1L2FA 4LF9L 5GAGC 3ERSX 1EYGA 3UDFA 3E0EA 1D8LA 1PH9A 2PQAB 2JQOA 5M3MH 5M5YH 2JA6G 4KHZA 2JEBI 4DUZQ 1KHIA 4A3IH 1J5EQ 4JI0Q 3W5OA 1M1KC 3M3YH 3TEHB 4DR1L 3BJUA 1J5EL 4DV7Q 1C0AA 2F4VQ 3ULPA 3EBEA 4QL5A 4DV7L 4A3BG 2NN6I 4GNXB 5IYBG 5C0XG 2K5NA 3J7A5 1I94L 3PUYA 2BA0A 2K50A 5M3FH 2ZM6Q 1HR0W 4BY7G 1JMCA 4AYBE 3J80c 3OTOQ 2JA7G 3KF6B 4A93H 1IL2A 1K3RA 4H02A 3FHWA 2JA9A 1PHJA 1EWIA 4QJFA 1SFOH 1N8RC 3HOUH 3PO3G 1Q1BA 2K5HA 5BR8Q 1AE2A 1NJIC 1X55A 3CCJA 5C4JH 2UUCQ 1XNQQ 2JA5H 3GTGH 2V1CC 4A3MG 4A3GG 4A3DH 3PGZA 2CWAA 2VS1A 2WAQG 3CMAA 3CC4A 2AWOA 1EFWA 2GVAA 1TWFH 2E5LQ 2JA8H 4GLAC 1NMFA 4YCUA 2R92H 2RHSB 3BZCA 4L5SA 1W3SA 4JI2Q 1DGSA 2WAQE 4JI2L 1VQAA 1JJ2A 2XGTA 5C44H 5LMNL 3GTQH 2OQKA 5IP7H 1IBKL 3L0OA 2Q2IA 3W1BA 2UXDL 5JJKA 1J6QA 4DV6Q 1FVIA 2JA6H 2NN6G 3H3VH 2OCEA 2WP8J 4HJ9A 4LFBQ 4DR6L 1CKNA 4NXML 4YWLA 5JJIA 4LFBL 4X66Q 1SLJA 4UY8C 3HOWG 4IPGA 4DUYQ 1AH9A 4B3MQ 2I5MX 3WWVA 1K9MC 2NVXH 4DUYL 4X65Q 4X64L 1GM5A 1IBLL 2VW9A 2KENA 3T1HQ 4B3ML 4X65L 2OTLA 1N33Q 4BY7H 2Q2HA 4JBWA 4JC0A 4JV5L 4C3IH 2JA7H 2DUDA 5GADC 4AQYL 2K75A 1N36Q 1E7ZA 4LFAQ 4UP8A 2LXKA 5EAYA 2VNUD 1G51A 3RN5A 3CCUA 2R6GA 3S16H 4K0KQ 1OXTA 1SR3A 3J80i 2B29A 1UE5A 2QGQA 5IT9c 1HZAA 3KJOA 3F1ZA 2JE6I 1UE6A 1JB7A 4A3MH 3CD6A 4AIMA 3M7NA 4A3GH 5FLXc 1Q8KA 3PCOB 1C9OA 5C3EG 4IFDI 3AFPA 1MJEA 4BBSG 3HKSA 4L5QA 1EIYB 2OTJA 5IP9G 4IPCA 2QA4A 2HT1A 5HY6A 3GTPH 4GKJL 5IYCG 1CSPA 5GAEC 1E24A 1VQCA 2I0QA 3A5ZB 1IXRA 2VZAA 2IT1A 1I3QH 4Y52H 1CKNB 3MXNB 4A3KG 4DR2L 2ALYB 3CXCA 4TQUS 1QUQA 2ZJRA 3K7AH 4IOCA 3H0GG 2UXBQ 4IJLA 1VQGA 1YNXA 3PF5A 1VQ4A 4OWXB 4LF5Q 4JI8Q 1Q46A 1GKHA 1E1TA 2D62A 3Q8DA 3I4NG 3H3VI 1H95A 4JI8L 4LF7L 4A76A 2BH8A 3I7FA 4DPGA 4DR4Q 3HKZG 2JK8A 2L15A 3VDYA 2CCZA 1BBUA 1SMXA 2VUMG 4A93G 5C0XI 1OXSC 4RMFA 2CWPA 3A0JA 1GVPA 5LMUL 2UU9Q 1FJGQ 1B7YB 2R7ZG 2R93G 2UU9L 2ID0A 1FJGL 3HOUG 4OX9Q 4OXPA 1HNXL 1VQHA 3HOXG 1LM0A 1PV4A 4LNQA 1PYBA 3A74A 3BU2A 2HHHL 4A3DG 4HIOA 1KD1C 2HQLA 1BVSA 4GOPB 1BKBA 4BY1G 4IJHA 3RLNA 4LUVA 5C3EH 1X9NA 3RN2A 1Q7YC 4POGA 2JA8G 4BBSH 1Q81C 4IOAA 5GROA 2NZHA 4NB3A 1CKMA 3G6EA 4DV2Q 3JAMc 3U50C 5IYCH 4P72A 3NENA 2MFIA 3KYHC 1QUQB 1NMGA 5IP7G 1N34Q 2HIXA 1GO3E 1YZ6A 4YCWA 5ELNA 1P16A 5FLMG 3J7ZC 3CCEA 1XJVA 1N34L 3CC2A 3S14H 1RIPA 2Z0SA 3I4MH 2DGYA 4A3KH 1BBWA 3NBHB 4PZ6A 5K36G 1VQDA 4DUZL 4JI0L 3CCQA 3H0GH 4GN5A 1PA6A 2JJQA 3F8TA 3I4OA 3KF8B 3I4NH 4AYBG 1QZGA 2F4VL 1PH2A 2RCNA 3TS2A 2I5HA 1I5FA 1HR0Q 1FGUA 1HR0L 3G71A 1TWHH 1XTDA 5IY0A 2K5VA 2ZM6L 4KHPQ 3U4VA 1OXVA 2VUMH 3TRZA 4JI6Q 4KHPL 3OTOL 4XIGS 2B3GA 3L2PA 4R4OA 2R7ZH 2R93H 1YBYA 3M85A 2IHEA 2WFWA 4JOIC 3AYHB 4EQ5A 5M5XH 2OWOA 2C35B 4DV1Q 3HOXH 1CKOA 5BR8L 1X3FA 2UUCL 4LW1A 4LFCQ 1XNQL 1Z9FA 5IYDG 2Y0SG 4DV4Q 2PI2E 2QEXA 4MNOA 4BY1H 3J81c 4DV4L 2E5LL 3CF5A 3OW2A 1IBMQ 2UUAQ 2Y0SE 3HOVG 2CKZB 2B63G 1YI2A 2EIFA 1IBML 3SGIA 2UUAL 1L1OA 5J3BA 1Y1WG 2I5LX 3PUXA 2YTXA 5FLMH 3JC66 1VQFA 4LWCA 2GN5A 1PH5A 1PH1A 1KRTA 4KLKA 4DV6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQQ A;  4QQB X;  2UXC Q;  1U0L A;  2EQS A;  2YYZ A;  3AFQ A;  2KHI A;  3FP9 A;  3I55 A;  1A63 A;  1YEZ A;  2VL6 A;  1OXX K;  4X66 L;  4YHH Q;  4A75 A;  1KQS A;  4BXX H;  1I6H H;  1VQ6 A;  4JCV E;  1QVF A;  2PNH A;  4PG3 A;  4GNX C;  4JI4 Q;  3T1H L;  4LF6 Q;  4GN4 B;  1E3P A;  1XNR Q;  1N33 L;  4YCV A;  4OO1 G;  5LMN W;  2WB1 E;  4GKK Q;  4B3T Q;  1X56 A;  4R4I A;  1N36 L;  1I50 H;  4B3S Q;  3S2D H;  2IX0 A;  1V1Q A;  1TWC H;  4LFA L;  4GKK L;  4IFD J;  1WI5 A;  1PYS B;  3UDG A;  2MNA A;  1VQO A;  1U5K A;  4JBJ A;  5JEA G;  2ZJQ A;  2OQ0 A;  4B3S L;  1HZC A;  1S40 A;  2ATW A;  4K0K L;  2E2I H;  2LXJ A;  5IYD H;  2NZO A;  4A3F G;  4MTN A;  4IPH A;  1L1O B;  2YU9 H;  4PMW A;  4A3J G;  2R7D A;  5GQO A;  4DK6 C;  2E8G A;  1TWA H;  4GOP A;  1PFS A;  4QY7 A;  1MKH A;  2B63 H;  4LUO A;  3HOV H;  2ES2 A;  4HJ8 A;  3RLO A;  1XMQ Q;  1Y1W H;  3J81 i;  2KHJ A;  3T1Y Q;  3ULJ A;  2AKW B;  4DV5 Q;  1XMQ L;  3W1G A;  3T1Y L;  3I4M G;  1O7I A;  4GLX A;  1S72 A;  1WOC A;  4R4T A;  4QGU A;  1E1O A;  4POF A;  4JI7 Q;  4YY3 Q;  3EIV A;  4EX5 A;  3UDX A;  3CC7 A;  1SRU A;  1VQP A;  4LF5 L;  1YIT A;  1WYD A;  2BA1 A;  5C0X J;  2UXB L;  4DV3 Q;  4OWT B;  3GTM H;  3PF4 A;  3NEM A;  1JJC B;  1X3E A;  4UPA A;  1Q82 C;  3PO2 G;  4BA1 I;  4HIK A;  3UE0 A;  1P8L A;  1Y14 B;  2K14 A;  3KOJ A;  1LYL A;  4DR4 L;  3ICE A;  3GTO H;  1VQ9 A;  2ASB A;  2N78 A;  3PUW A;  4LF4 Q;  1QVC A;  1HNW Q;  3CQZ H;  4NXN Q;  3FKI G;  1NTG A;  1EQQ A;  1PH7 A;  3CAM A;  3PUV A;  1HNW L;  4OX9 L;  3RR5 A;  1XPR A;  4P71 A;  4GLV B;  4JI5 Q;  1A62 A;  2EXD A;  1HZB A;  4BA2 I;  2E2H H;  4HJ7 A;  1N32 Q;  3M4O H;  1X54 A;  1LTL A;  3PSI A;  2D0P A;  4A3F H;  1SRO A;  4A3E G;  4PZ8 A;  1VQB A;  1N32 L;  1S3O A;  4DR5 Q;  2MO0 A;  4A3J H;  5DLQ E;  1VQL A;  4JYA Q;  4DR5 L;  4LF8 Q;  1JE5 A;  4JYA L;  4DV2 L;  3TS0 A;  3KDF A;  2KCT A;  2F52 A;  2YV5 A;  2H5X A;  1QZH A;  2PI2 A;  2F3I A;  3RZO H;  2CFM A;  1R9T H;  3S15 H;  4HJA A;  4IO9 A;  3DLL A;  3CPW A;  3NEL A;  3CP0 A;  1YJ9 A;  4JG2 A;  3S1Q H;  3EN2 A;  3K8A A;  1KL9 A;  3D0F A;  1QVG A;  4TVA B;  1VQE A;  1PH4 A;  1SE8 A;  4BXX G;  3GTJ H;  1HNZ Q;  2YTV A;  1VQ5 A;  3ULL A;  3BZK A;  3PO2 H;  2N49 A;  1HNZ L;  1XPO A;  2LSS A;  2VY3 A;  1VQN A;  3K0X A;  4QIW E;  3GDE A;  4YWM A;  1D7Q A;  1E22 A;  1G6P A;  1K8A C;  2UUB Q;  4JI6 L;  5JEA J;  2AMC B;  2UUB L;  1KC8 C;  1JT8 A;  2R7F A;  4WJ4 A;  3FKI H;  5C4X G;  2Z6K A;  1TXY A;  4OO1 I;  4DR1 Q;  4IPD A;  4DV1 L;  4GN3 B;  1IYJ B;  1YJW A;  3D31 A;  3PIP A;  4LFC L;  2NVQ H;  2ZTE A;  3KDF B;  4A3C G;  1I94 Q;  3E9H A;  3K7U C;  3I56 A;  1MJC A;  3PV0 A;  4A3E H;  4XTC S;  3OYY A;  3HOZ G;  4A3L G;  4P74 A;  5ELO A;  3CCM A;  1UWV A;  1HH2 P;  1N9W A;  1NBW A;  4GOP C;  3CCL A;  1UE1 A;  2A8V A;  2NVT H;  1T9H A;  3IRB A;  2RHQ B;  3E9I A;  4B3R Q;  2A19 A;  2N3S A;  3CME A;  1OTC A;  1PH3 A;  2IX1 A;  3CCS A;  2Q2U A;  4X62 Q;  4B3R L;  5FJ8 G;  3U58 A;  4X62 L;  4UP9 A;  4JBM A;  1NE3 A;  3JAM i;  4R4C A;  3B6Y A;  1A8V A;  4BBR G;  2MQH A;  2IY5 B;  1W2B A;  5HGQ A;  4PZ7 A;  4P73 A;  4DR7 Q;  3M9B A;  1EQR A;  3PIO A;  3F2D A;  4DR7 L;  1UE7 A;  4P75 A;  2UXC L;  1KAW A;  1ASZ A;  4UP7 A;  2D0O A;  1CSQ A;  4R4Q A;  3K81 C;  1WCM H;  2N8N A;  2WB1 G;  4C3H H;  2UXD Q;  1YHA A;  4RG1 A;  1Y1V G;  1V43 A;  4YHH L;  2PMZ E;  5LMN Q;  5M5W H;  1AE3 A;  4ALP A;  1IZ6 A;  1K0R A;  4JI4 L;  4C3J H;  1Q86 C;  5JJL A;  4LF6 L;  1IBK Q;  4OWW B;  1XNR L;  3CW2 C;  1YHB A;  1PH8 A;  4JI3 Q;  1ASY A;  2A1A A;  4J15 A;  4B3T L;  4JI3 L;  1VQJ A;  2NVY H;  1VQ8 A;  2FXQ A;  2HIV A;  1PVO A;  5C4X H;  3S17 H;  1Q1E A;  3GD7 A;  3S24 A;  2XTI A;  4C2M H;  4L5T A;  1OXU A;  3G48 A;  3A5U A;  3CCV A;  2VQE Q;  4NXM Q;  3ZJY C;  3PUZ A;  4DKA C;  2VQE L;  1X6O A;  3AEV A;  3GTL H;  2ZJP A;  1B70 B;  4A3B H;  4A3C H;  4X64 Q;  3U4Z A;  5IYB H;  1K83 H;  2K4K A;  3UE1 A;  4HJ5 A;  5IWA Q;  1IBL Q;  3KLW A;  2BH2 A;  1X3G A;  3HOZ H;  1LUZ A;  4A3L H;  1YIJ A;  5AJ3 Q;  3HOY G;  5IWA L;  1C7Y A;  2AWN A;  4JV5 Q;  4MZ9 A;  3TRE A;  4AQY Q;  4O0A A;  5AJ3 L;  3GTK H;  3DM3 A;  4LUZ A;  5H1S E;  3TQY A;  5FJ8 H;  3J81 j;  3GO5 A;  2GVB A;  1VQ7 A;  3PO3 H;  4DV5 L;  4JOI A;  4BBR H;  1XMO Q;  2Q2T A;  3S1M H;  1X65 A;  5E7N A;  4JI7 L;  4HID A;  4KI0 A;  1YVC A;  1XMO L;  4DAM A;  4YY3 L;  3STB C;  1PH6 A;  4Y7N H;  1YHQ A;  1MIU A;  4YWK A;  3RLF A;  2ZTD A;  3F2C A;  2KBN A;  1L0W A;  3LGJ A;  4A4I A;  4GKJ Q;  1NY4 A;  1WJJ A;  4DV3 L;  2ZTC A;  1Y1V H;  1EOV A;  3F2B A;  3RZD H;  1HJP A;  4X6A H;  3KFU A;  1Z47 A;  1VS0 A;  3STB D;  3H15 A;  1A0I A;  4HIM A;  2CQO A;  3ER0 A;  4JI1 Q;  1EIF A;  3K80 C;  4DR2 Q;  2Z6K C;  1VQI A;  3RNU A;  4LF4 L;  1SN8 A;  4JI1 L;  1TWG H;  4ME3 A;  5M3M G;  2K52 A;  3M4P A;  4NXN L;  4DK3 C;  3CCR A;  4A3I G;  1VQM A;  1KIX A;  2MO1 A;  5IE8 A;  3HFZ B;  4DR3 Q;  4R1J A;  4JI5 L;  2E2J H;  1CUK A;  2PQA A;  4DR3 L;  4LF7 Q;  3CPF A;  1JJG A;  3HOW H;  4APV A;  1KXL A;  5M3F G;  4AH6 A;  1GD7 A;  3KJP A;  1HZ9 A;  1M90 C;  3HOY H;  1L1O C;  4L5R C;  5LMU Q;  4GNX A;  4LF8 L;  1FL0 A;  1YJN A;  1XPU A;  4DAY B;  2VQF Q;  4OON A;  3HKZ E;  1RL2 A;  1HNX Q;  4JBK A;  3M4Q A;  2AHO B;  3S2H H;  2VQF L;  4WJ3 M;  2JEA I;  3KF6 A;  4GS3 A;  2HHH Q;  2KCM A;  4IFD G;  2JA5 G;  2YTY A;  1G29 1;  3L7Z C;  4O2D A;  3UDI A;  1WFQ A;  1KRS A;  1VQK A;  1VCI A;  1UEB A;  3MEF A;  4DNI A;  1K73 C;  1V9P A;  4DV0 Q;  4DR6 Q;  1WCM G;  4FDB A;  5GAH C;  2R92 G;  3S1N H;  4DV0 L;  1EUJ A;  1Q12 A;  1B8A A;  2IHF A;  3I2Z A;  5IP9 H;  1K8G A;  2RF4 A;  4LF9 Q;  3S1R H;  4NPS A;  5C44 G;  3G4S A;  1L2F A;  4LF9 L;  5GAG C;  3ERS X;  1EYG A;  3UDF A;  3E0E A;  1D8L A;  1PH9 A;  2PQA B;  2JQO A;  5M3M H;  5M5Y H;  2JA6 G;  4KHZ A;  2JEB I;  4DUZ Q;  1KHI A;  4A3I H;  1J5E Q;  4JI0 Q;  3W5O A;  1M1K C;  3M3Y H;  3TEH B;  4DR1 L;  3BJU A;  1J5E L;  4DV7 Q;  1C0A A;  2F4V Q;  3ULP A;  3EBE A;  4QL5 A;  4DV7 L;  4A3B G;  2NN6 I;  4GNX B;  5IYB G;  5C0X G;  2K5N A;  3J7A 5;  1I94 L;  3PUY A;  2BA0 A;  2K50 A;  5M3F H;  2ZM6 Q;  1HR0 W;  4BY7 G;  1JMC A;  4AYB E;  3J80 c;  3OTO Q;  2JA7 G;  3KF6 B;  4A93 H;  1IL2 A;  1K3R A;  4H02 A;  3FHW A;  2JA9 A;  1PHJ A;  1EWI A;  4QJF A;  1SFO H;  1N8R C;  3HOU H;  3PO3 G;  1Q1B A;  2K5H A;  5BR8 Q;  1AE2 A;  1NJI C;  1X55 A;  3CCJ A;  5C4J H;  2UUC Q;  1XNQ Q;  2JA5 H;  3GTG H;  2V1C C;  4A3M G;  4A3G G;  4A3D H;  3PGZ A;  2CWA A;  2VS1 A;  2WAQ G;  3CMA A;  3CC4 A;  2AWO A;  1EFW A;  2GVA A;  1TWF H;  2E5L Q;  2JA8 H;  4GLA C;  1NMF A;  4YCU A;  2R92 H;  2RHS B;  3BZC A;  4L5S A;  1W3S A;  4JI2 Q;  1DGS A;  2WAQ E;  4JI2 L;  1VQA A;  1JJ2 A;  2XGT A;  5C44 H;  5LMN L;  3GTQ H;  2OQK A;  5IP7 H;  1IBK L;  3L0O A;  2Q2I A;  3W1B A;  2UXD L;  5JJK A;  1J6Q A;  4DV6 Q;  1FVI A;  2JA6 H;  2NN6 G;  3H3V H;  2OCE A;  2WP8 J;  4HJ9 A;  4LFB Q;  4DR6 L;  1CKN A;  4NXM L;  4YWL A;  5JJI A;  4LFB L;  4X66 Q;  1SLJ A;  4UY8 C;  3HOW G;  4IPG A;  4DUY Q;  1AH9 A;  4B3M Q;  2I5M X;  3WWV A;  1K9M C;  2NVX H;  4DUY L;  4X65 Q;  4X64 L;  1GM5 A;  1IBL L;  2VW9 A;  2KEN A;  3T1H Q;  4B3M L;  4X65 L;  2OTL A;  1N33 Q;  4BY7 H;  2Q2H A;  4JBW A;  4JC0 A;  4JV5 L;  4C3I H;  2JA7 H;  2DUD A;  5GAD C;  4AQY L;  2K75 A;  1N36 Q;  1E7Z A;  4LFA Q;  4UP8 A;  2LXK A;  5EAY A;  2VNU D;  1G51 A;  3RN5 A;  3CCU A;  2R6G A;  3S16 H;  4K0K Q;  1OXT A;  1SR3 A;  3J80 i;  2B29 A;  1UE5 A;  2QGQ A;  5IT9 c;  1HZA A;  3KJO A;  3F1Z A;  2JE6 I;  1UE6 A;  1JB7 A;  4A3M H;  3CD6 A;  4AIM A;  3M7N A;  4A3G H;  5FLX c;  1Q8K A;  3PCO B;  1C9O A;  5C3E G;  4IFD I;  3AFP A;  1MJE A;  4BBS G;  3HKS A;  4L5Q A;  1EIY B;  2OTJ A;  5IP9 G;  4IPC A;  2QA4 A;  2HT1 A;  5HY6 A;  3GTP H;  4GKJ L;  5IYC G;  1CSP A;  5GAE C;  1E24 A;  1VQC A;  2I0Q A;  3A5Z B;  1IXR A;  2VZA A;  2IT1 A;  1I3Q H;  4Y52 H;  1CKN B;  3MXN B;  4A3K G;  4DR2 L;  2ALY B;  3CXC A;  4TQU S;  1QUQ A;  2ZJR A;  3K7A H;  4IOC A;  3H0G G;  2UXB Q;  4IJL A;  1VQG A;  1YNX A;  3PF5 A;  1VQ4 A;  4OWX B;  4LF5 Q;  4JI8 Q;  1Q46 A;  1GKH A;  1E1T A;  2D62 A;  3Q8D A;  3I4N G;  3H3V I;  1H95 A;  4JI8 L;  4LF7 L;  4A76 A;  2BH8 A;  3I7F A;  4DPG A;  4DR4 Q;  3HKZ G;  2JK8 A;  2L15 A;  3VDY A;  2CCZ A;  1BBU A;  1SMX A;  2VUM G;  4A93 G;  5C0X I;  1OXS C;  4RMF A;  2CWP A;  3A0J A;  1GVP A;  5LMU L;  2UU9 Q;  1FJG Q;  1B7Y B;  2R7Z G;  2R93 G;  2UU9 L;  2ID0 A;  1FJG L;  3HOU G;  4OX9 Q;  4OXP A;  1HNX L;  1VQH A;  3HOX G;  1LM0 A;  1PV4 A;  4LNQ A;  1PYB A;  3A74 A;  3BU2 A;  2HHH L;  4A3D G;  4HIO A;  1KD1 C;  2HQL A;  1BVS A;  4GOP B;  1BKB A;  4BY1 G;  4IJH A;  3RLN A;  4LUV A;  5C3E H;  1X9N A;  3RN2 A;  1Q7Y C;  4POG A;  2JA8 G;  4BBS H;  1Q81 C;  4IOA A;  5GRO A;  2NZH A;  4NB3 A;  1CKM A;  3G6E A;  4DV2 Q;  3JAM c;  3U50 C;  5IYC H;  4P72 A;  3NEN A;  2MFI A;  3KYH C;  1QUQ B;  1NMG A;  5IP7 G;  1N34 Q;  2HIX A;  1GO3 E;  1YZ6 A;  4YCW A;  5ELN A;  1P16 A;  5FLM G;  3J7Z C;  3CCE A;  1XJV A;  1N34 L;  3CC2 A;  3S14 H;  1RIP A;  2Z0S A;  3I4M H;  2DGY A;  4A3K H;  1BBW A;  3NBH B;  4PZ6 A;  5K36 G;  1VQD A;  4DUZ L;  4JI0 L;  3CCQ A;  3H0G H;  4GN5 A;  1PA6 A;  2JJQ A;  3F8T A;  3I4O A;  3KF8 B;  3I4N H;  4AYB G;  1QZG A;  2F4V L;  1PH2 A;  2RCN A;  3TS2 A;  2I5H A;  1I5F A;  1HR0 Q;  1FGU A;  1HR0 L;  3G71 A;  1TWH H;  1XTD A;  5IY0 A;  2K5V A;  2ZM6 L;  4KHP Q;  3U4V A;  1OXV A;  2VUM H;  3TRZ A;  4JI6 Q;  4KHP L;  3OTO L;  4XIG S;  2B3G A;  3L2P A;  4R4O A;  2R7Z H;  2R93 H;  1YBY A;  3M85 A;  2IHE A;  2WFW A;  4JOI C;  3AYH B;  4EQ5 A;  5M5X H;  2OWO A;  2C35 B;  4DV1 Q;  3HOX H;  1CKO A;  5BR8 L;  1X3F A;  2UUC L;  4LW1 A;  4LFC Q;  1XNQ L;  1Z9F A;  5IYD G;  2Y0S G;  4DV4 Q;  2PI2 E;  2QEX A;  4MNO A;  4BY1 H;  3J81 c;  4DV4 L;  2E5L L;  3CF5 A;  3OW2 A;  1IBM Q;  2UUA Q;  2Y0S E;  3HOV G;  2CKZ B;  2B63 G;  1YI2 A;  2EIF A;  1IBM L;  3SGI A;  2UUA L;  1L1O A;  5J3B A;  1Y1W G;  2I5L X;  3PUX A;  2YTX A;  5FLM H;  3JC6 6;  1VQF A;  4LWC A;  2GN5 A;  1PH5 A;  1PH1 A;  1KRT A;  4KLK A;  4DV6 L; 
#chains in the Genus database with same CATH topology
 5I6Y A;  2F0N A;  4NMZ A;  4M1U B;  3HOV B;  3TME A;  3DM1 A;  3I55 A;  3NUC A;  2SEB D;  1A63 A;  1VDZ A;  1OXX K;  1PFM A;  2JSO A;  3R8B A;  3OW7 A;  4GNX C;  4XYO A;  1E3P A;  2AQ3 B;  5C4H A;  5K5P A;  1XNR Q;  1N33 L;  4B3T Q;  4KHV A;  4K2L A;  4IUN A;  4B3S Q;  4GKK L;  1Q3L A;  1TWC H;  5CV4 A;  1BCP C;  2OQ0 A;  1HZC A;  2L0C A;  1BBX C;  2LXJ A;  5IGB A;  5IYD H;  1F2Z A;  4IPH A;  4PMW A;  4A3J G;  1GUO A;  2Z4I A;  1PTO H;  4DK6 C;  1UUP A;  4V19 0;  4CKE A;  3DWP A;  2B63 H;  2ES2 A;  3RLO A;  1ZYR D;  4R4T A;  1E1O A;  4POF A;  1B2T A;  2WKC A;  4EX5 A;  3CC7 A;  1WYD A;  3CRK C;  4ZUJ A;  2EVB A;  3S14 B;  3SK5 A;  4BA1 I;  4K2K A;  1Y14 B;  1NR2 A;  1K0S A;  2MJ8 A;  2RCF A;  1BXT A;  2CH4 A;  3GTO H;  4LF4 Q;  1A15 A;  4OO1 H;  1QVC A;  3TP5 A;  2CH4 W;  3HS0 C;  1XPR A;  1GHJ A;  1QCB D;  1TWH B;  4GLV B;  4IZ8 A;  1D5X C;  1XX8 A;  1N32 Q;  3M4O H;  1X54 A;  1LTL A;  4A3E G;  1VQB A;  2QEJ C;  4RGM A;  2MO0 A;  1VQL A;  5DLQ E;  1CK1 A;  4JYA Q;  2XRS D;  1JE5 A;  2FHT A;  1D1K A;  1A6X A;  2F52 A;  2YV5 A;  1QZH A;  1D2B A;  1E2V A;  5KEE A;  1II3 A;  3DEO A;  1IYU A;  2F3I A;  4A3E B;  3RZO H;  4DU9 A;  4HJA A;  4IO9 A;  3SK4 A;  4KN4 C;  3CPW A;  3NEL A;  3VR6 A;  4JG2 A;  3D0F A;  4I7Z C;  2J0T D;  4ZCK A;  1SE8 A;  1H9M A;  3GTJ H;  3O13 A;  2YTV A;  4N9P A;  3ULL A;  3BZK A;  3PO2 H;  2LSS A;  1SBB B;  4IUR A;  4WRD A;  1HUM A;  2UUB Q;  1AFP A;  1T5E A;  1E0B A;  3FKI H;  1DJR D;  1SNC A;  1TXY A;  4OO1 I;  4DR1 Q;  3C1F A;  1WTX A;  4RGN A;  2NVQ H;  2PW7 A;  4A3C G;  1I94 Q;  3E9H A;  4A3L G;  3OYY A;  2F03 A;  4G7Z C;  1N9W A;  1NBW A;  2Q2U A;  4X62 Q;  1G2S A;  5FJ8 G;  5I4D A;  3Q0A A;  5J22 A;  1CQF A;  4JBM A;  3B6Y A;  4FVM A;  1W2B A;  4PZ7 A;  5KYL A;  1HPC A;  1EQR A;  3M9B A;  3PIO A;  4DR7 L;  4ZLT F;  1RKN A;  1ASZ A;  5TSS A;  3Q6S A;  4C3H H;  1J8I A;  1YNJ C;  4KY7 A;  5DAU A;  1Y1V G;  1V43 A;  2PMZ E;  2K6A A;  1ZEQ X;  4CJ0 B;  3PMF A;  1K0R A;  4JI4 L;  1Q86 C;  4LF6 L;  4OWW B;  5IT9 E;  1PH8 A;  3GTM B;  4HTH A;  4JI3 L;  1VQJ A;  2NVY H;  1PVO A;  3S17 H;  5E4X A;  4C2M H;  4L5T A;  3G48 A;  3A5U A;  1AZQ A;  2VQE Q;  3ZJY C;  1Y69 U;  3MVV A;  1SEB D;  2NWG A;  1X6O A;  5JOB A;  3X3M A;  2ZJP A;  4A3B H;  1STG A;  3U4Z A;  4X64 Q;  1K83 H;  2K4K A;  4XT1 B;  1X3G A;  1LUZ A;  1YIJ A;  5AJ3 Q;  3HOY G;  2RVL A;  4AQY Q;  4O0A A;  2LMC B;  1EU3 A;  4LUZ A;  3DEP A;  3D8G A;  4DV5 L;  1S4Z A;  4JOI A;  2ZT9 C;  3S1M H;  4JI7 L;  2BCO A;  1TQO A;  5CBA E;  4DAM A;  4YY3 L;  1XMO L;  4Y7N H;  1YHQ A;  2Q8R E;  3RLF A;  1PTO C;  1ILQ A;  4H0L C;  1L0W A;  2FMC A;  1QE6 A;  4DV3 L;  2DY8 A;  3PIO 3;  1JWU D;  4LMQ D;  3F2B A;  4X6A H;  1SYC A;  1Z47 A;  2C5C A;  3S1Q B;  1A0I A;  4PQX A;  4HIM A;  2FJ2 A;  5M3M G;  1TWG H;  4ME3 A;  3S1N B;  4DK3 C;  3VYT A;  1VQM A;  1KIX A;  2MO1 A;  2XWB B;  2E2J H;  5DEH A;  4DR3 L;  3CPF A;  3V05 A;  2F0K A;  3RMH A;  5EJW A;  1HZ9 A;  5M3M B;  2AQ1 B;  1M90 C;  1LT3 D;  3KBX A;  5C3X A;  4GNX A;  4LF8 L;  2A6H D;  2DNC A;  4DAY B;  3HKZ E;  1RL2 A;  1HNX Q;  4JBK A;  5KNB A;  2VQF L;  4WJ3 M;  3KF6 A;  2JP1 A;  2YTY A;  3WDN A;  1WFQ A;  1KRS A;  1VQK A;  1UEB A;  3MEF A;  3L3O C;  3D6W A;  5CV6 A;  1B8A A;  1DOM A;  4QCL A;  1LT4 D;  3DXJ C;  5C4J B;  1L2F A;  3LWU A;  3E0E A;  1D8L A;  1U4M A;  5E4W C;  2PQA B;  4PNY A;  2L1B A;  4KHZ A;  4DUZ Q;  1J5E Q;  4A3I H;  3W5O A;  1F2M A;  1F9S A;  1I4Q A;  1JWS D;  2G9H D;  5I9P A;  3ULP A;  3EBE A;  3MXU A;  4PV1 C;  2IJ0 A;  4R8I A;  1U4P A;  5C4Z A;  5C0X G;  2ZM6 Q;  1TS5 A;  4BY7 G;  1JMC A;  5C4X B;  3J80 c;  2JN4 A;  2JA7 G;  4XQJ A;  4A93 H;  4CDC C;  4N9T A;  3FHW A;  2JA9 A;  2DN8 A;  1PHJ A;  5EBD A;  1H9K A;  1EWI A;  1EYA A;  1KDA A;  4OEL B;  1N8R C;  2UUC Q;  1Q8I A;  2IW3 A;  1RJT A;  2JA5 H;  3GTG H;  4BY7 B;  2L55 A;  1Y8P B;  2F4I A;  2E2D C;  2CWA A;  3Q23 A;  3TZU A;  1EFW A;  4KTA A;  2QDB A;  1TWF H;  2A74 C;  5M9O A;  4YCU A;  4L5S A;  1W3S A;  2OXP A;  1B9M A;  4JI2 Q;  2K32 A;  1Q90 A;  4DA2 A;  3L0O A;  4X3T A;  5CGK A;  2AUJ D;  4DK1 A;  1QJO A;  2RDF A;  2F0J A;  4Z9C B;  2JA6 H;  1BUV T;  3TN2 A;  5JJI A;  5ELD A;  3HOW G;  5EPK A;  1EZ8 A;  1NSN S;  3WWV A;  2NVX H;  4B3M L;  1IBL L;  4DFA A;  1N33 Q;  4ME5 A;  3E6Z X;  4JBW A;  5IOD A;  3N6R A;  4UP8 A;  2LXK A;  4CJ1 B;  3HOW B;  3S16 H;  4LJZ C;  1MSG A;  2B29 A;  1STB A;  1UE5 A;  3KJO A;  4DAP A;  4DAY A;  1UE6 A;  2QCP X;  5FLX c;  1Q8K A;  3MWY W;  5C3E G;  3AFP A;  1MJE A;  2A6E D;  4Q5V A;  4L5Q A;  1EIY B;  3S2H B;  1CA5 A;  2BE5 C;  4GKJ L;  1MBY A;  2KEC A;  5IYC G;  5IGD A;  1B44 D;  5IGC A;  1E24 A;  5GAE C;  4Y52 H;  3MXN B;  2XWJ B;  1EQV A;  1B3Q A;  4DR2 L;  2ALY B;  3NHH A;  1QUQ A;  1YNX A;  3S1R B;  3I4N G;  3SXH A;  4CKC A;  4LF7 L;  2BH8 A;  3I7F A;  3IAY A;  2F0I A;  3KF8 A;  2CCZ A;  1BBU A;  2EE1 A;  1SMX A;  3H91 A;  4KD3 A;  3M3Y B;  3FEW X;  4RMF A;  3E3X A;  1GVP A;  2R93 G;  4O1N A;  3I4N B;  2ID0 A;  1FJG L;  3HOU G;  2EYM A;  3HOX G;  3NWT A;  3A74 A;  2PCF B;  3I4L A;  4CDE C;  4GOP B;  1BKB A;  1ROD A;  2R93 B;  3HOU B;  1EIG A;  4IUU A;  4U67 3;  3JAM c;  3HOX B;  2E76 C;  1YNN C;  1IL8 A;  3NQT A;  5F2D A;  1N34 Q;  1ENC A;  2HIX A;  1XJV A;  5ELN A;  3S14 H;  1RIP A;  1GUW A;  1TS3 A;  2DGY A;  2D5D A;  1BBW A;  3P1H A;  1I6V C;  2EJG C;  1VQD A;  1V1P B;  1PA6 A;  3I4O A;  4AYB G;  1QZG A;  2F4V L;  2I5H A;  4MN3 A;  4OHJ A;  1TWH H;  2XN9 C;  1SND A;  5IY0 A;  3U4V A;  1OXV A;  3TRZ A;  3VR3 A;  4H7B A;  4R4O A;  2R7Z H;  4AYB B;  1UEA B;  2LFN A;  3MZ5 A;  4EQ5 A;  2C35 B;  1I6H B;  4XT3 B;  2ICE C;  1JOO A;  3HEJ A;  1Z9F A;  5A2Q E;  2A68 C;  2PI2 E;  5CBE E;  1ML0 D;  3T56 B;  2E5L L;  2VXW A;  2B2W C;  3OW2 A;  2K03 A;  1IBM Q;  4X3U A;  1FR3 A;  1Y1W G;  1F9P A;  2I5L X;  5FLM H;  3EVQ A;  3JC6 6;  1VQF A;  2F0H A;  3V96 A;  3CHB D;  1HA6 A;  1KRT A;  4KLK A;  1PH7 A;  1TWA B;  4UAI A;  5CMD A;  2KCN A;  1U0L A;  1CHP D;  5A35 A;  3MXN A;  2EQS A;  2KHI A;  1Y1W B;  4R9W A;  1LAC A;  2PYK A;  1PRT C;  1C48 A;  2EXZ A;  4JI4 Q;  1EIH A;  3K7A B;  3T1H L;  4GN4 B;  4LF6 Q;  4KMU C;  2L4N A;  4YCV A;  5LMN W;  1WD1 A;  2WB1 E;  2R61 A;  1X56 A;  1N36 L;  2K7V A;  4LFA L;  2NUC A;  3UDG A;  2MNA A;  1VQO A;  1U5K A;  2EY1 A;  2ATW A;  4J6H A;  2PO4 A;  4A3F G;  4MTN A;  4JW0 A;  1ZYR C;  4ZYS A;  1ET9 A;  1F77 A;  2R7D A;  4GOP A;  1MKH A;  1SXT A;  1XMQ Q;  3J81 i;  1F2L A;  2B2U C;  4FXG C;  3ULJ A;  2AKW B;  4DV5 Q;  4A3F B;  3T1Y L;  4BBS B;  4GLX A;  1TS2 A;  1WOC A;  1S72 A;  4QGU A;  4JI7 Q;  4YY3 Q;  1FD7 D;  3EIV A;  3AB9 A;  5D3I B;  2UXB L;  1YIT A;  2BA1 A;  4DV3 Q;  3GTM H;  3PF4 A;  2A5H A;  4DXF A;  1Q82 C;  4HIK A;  2K14 A;  1LYL A;  3HZX A;  3VA5 A;  2IX3 A;  1VQ9 A;  5AFW A;  1SE4 A;  2ASB A;  3L9A X;  2SNM A;  4V0B A;  1EQQ A;  1HNW L;  3CAM A;  2EYP A;  3H94 A;  2EXD A;  2E74 C;  4I65 A;  3OMC A;  4HJ7 A;  4H13 C;  4XYQ A;  2RBM A;  1PYW D;  2RSO A;  4DR5 L;  1DYQ A;  2WV6 D;  4LF8 Q;  3ND8 A;  3QJY A;  4DV2 L;  2HUG A;  4RKB A;  3HP3 A;  1HHV A;  2PI2 A;  1A3T A;  2EYL A;  1DZ1 A;  2CFM A;  1R9T H;  4XXE A;  4EQP A;  3NBI A;  4U68 A;  3A7A B;  4RGT A;  3S1Q H;  5LHY 1;  1QVG A;  3MXG A;  2F0S A;  4BXX G;  2NZ1 D;  1HNZ Q;  3W2D A;  1DON A;  2N49 A;  1STY A;  5CR3 A;  1VQN A;  4C3J G;  1SE3 A;  3SVM A;  4JI6 L;  1SMY C;  4EGV A;  4KV6 A;  2F0L A;  1W6J A;  1JC7 A;  1IKL A;  4IPD A;  4DV1 L;  5CYU A;  2M2L A;  4J1M A;  4LFC L;  5KIX A;  3I56 A;  3HOZ G;  1HH2 P;  2A8V A;  1SYG A;  1UE1 A;  3K5L A;  4B3R Q;  3IRB A;  3UI2 A;  3E9I A;  2A19 A;  1XXG A;  4LAA A;  2IX1 A;  1KTK A;  2CHB D;  2D2C C;  2K01 A;  2LKV A;  3NSW A;  1RF2 D;  4S3S A;  2Z8L A;  1WTV A;  4UP9 A;  1LTA D;  1S5F D;  4BBR G;  4F88 A;  5HGQ A;  3CKI B;  3E5S A;  1UE7 A;  3DWQ A;  2UXC L;  1KAW A;  3A55 A;  3CRL C;  4UP7 A;  2N8N A;  1JQY D;  3DWA A;  1E2W A;  1TT2 A;  1JOK A;  1AE3 A;  3P75 A;  4IAL A;  5EQ0 A;  3TDQ A;  1FYC A;  4L8J A;  1YHB A;  3H3V C;  2M00 A;  1VQ8 A;  1M4V A;  2FXQ A;  3BDC A;  1WTQ A;  5C4X H;  2OTJ A;  2XTI A;  4MTK A;  2QKI C;  1LT5 D;  4DKA C;  1AW7 A;  2Q8T A;  3GTL H;  2F0Q A;  3UE1 A;  1IBL Q;  2UXD Q;  5IWA Q;  3T4A C;  1SNM A;  4I7A A;  1RTN A;  2AWN A;  3TRE A;  1Y8N B;  3TQY A;  2E2H B;  1DXM A;  1PMR A;  2GVB A;  2F3W A;  4A3J B;  2CW0 C;  1X65 A;  4HID A;  1GOZ A;  3TP8 A;  4ILW A;  4HMI A;  3BDL A;  4GKJ Q;  1NY4 A;  1WJJ A;  3A8I E;  2ZTC A;  1EOV A;  5C3W A;  1QIL A;  3EJI A;  2MPM A;  1VS0 A;  3STB D;  3MHB A;  1WTP A;  1PZI D;  1H9R A;  3ER0 A;  4JI1 Q;  3RNU A;  1EIF A;  4K8J A;  4DR2 Q;  2Z6K C;  1VQI A;  1SN8 A;  1G6P A;  3GQB A;  4NXN L;  5IE8 A;  1EU4 A;  4K6L A;  2HQE A;  2Z4H A;  4R1J A;  4JI5 L;  2A6H C;  3K5N A;  4LF7 Q;  3HOW H;  4APV A;  3K6O A;  3ITP A;  5M3F G;  4AH6 A;  1GD7 A;  3KJP A;  1GJX A;  1LV9 A;  5M5Y B;  1L1O C;  1XPU A;  2MGS A;  3U9S A;  2N55 A;  3HG9 A;  4JK1 C;  3M4Q A;  3S2H H;  3M4Y A;  1MSH A;  4RKL A;  5M3F B;  1EWC A;  2K5W A;  4O2D A;  3L7Z C;  3A56 A;  2P5Z X;  4F7X A;  1V9P A;  2RSN A;  4FDB A;  1B1Z A;  4DV0 L;  2IHF A;  3I2Z A;  1S5C D;  3SEB A;  4EQO A;  2RF4 A;  4LF9 Q;  3S1R H;  5C44 G;  1LTB D;  3G4S A;  1U4R A;  3OWF A;  3MFG A;  3ERS X;  3UDF A;  4B9X A;  1PH9 A;  2X69 A;  2XNA C;  3A54 A;  1EY6 A;  2B2U A;  5DM6 3;  3K59 A;  1JR0 D;  3M3Y H;  1KLU D;  3BJU A;  5M5W B;  2F4V Q;  4DV7 L;  4GNX B;  5IYB G;  3J7A 5;  2K5N A;  2O2L D;  2QIL A;  2Z1C A;  3QIA A;  4DK0 A;  2F0W A;  3KF6 B;  1BCP B;  1PZJ D;  1SFO H;  3HOU H;  3PO3 G;  4R8N A;  1CA6 A;  2K5H A;  4O42 A;  1PFB A;  4HED A;  4IFD H;  3LNN A;  2F3V A;  4KN7 C;  4DN4 M;  4A3M G;  4A3G G;  3GTK B;  1W6K A;  2VS1 A;  3CMA A;  2AWO A;  4RHS A;  2E5L Q;  3C46 A;  3A8J E;  2R92 H;  3PO3 B;  1O80 A;  1Z7T A;  2RHS B;  4DXG A;  3OHX C;  2B2T C;  1DGS A;  5LMN L;  4A3M B;  3MFY A;  4A3G B;  2OQK A;  1EY0 A;  2KCC A;  2PMZ B;  1IBK L;  1SJH D;  5JJK A;  1NR4 A;  3J7A F;  1Y1V B;  3I70 A;  4LFB Q;  3BG3 A;  4DR6 L;  4NXM L;  2A73 B;  4UY8 C;  2F0P A;  4DUY Q;  4KD4 A;  1K9M C;  4X65 Q;  3T1H Q;  2FFK B;  2KEN A;  4X3S A;  3D4D A;  1KAA A;  3FMC A;  2BDN A;  4JPB W;  2OTL A;  2Q2H A;  2F0V A;  4JC0 A;  4JV5 L;  4C3I H;  3GV3 A;  1N36 Q;  1SJE D;  1WTH A;  4KY5 A;  1X3P A;  4LFA Q;  1GUS A;  3IKJ A;  3J80 i;  5IT9 c;  3HOY B;  3OIP A;  1JB7 A;  3PCO B;  4F87 A;  1E2Z A;  1BQQ T;  4IFD I;  1IW7 C;  2VB3 X;  1BCP D;  1WVL A;  1CSP A;  5IGF A;  3I90 A;  1DD2 A;  4FF1 A;  1IXR A;  1KNA A;  3D4R A;  1O7Y A;  4A3K G;  4IOC A;  1F9R A;  2ZJR A;  3K7A H;  2UXB Q;  1VQG A;  4Q0F A;  4F8M A;  3R2I A;  1GKH A;  1LTR D;  5COR A;  3TP6 A;  4JI8 L;  1I4H A;  4A76 A;  3KLR A;  4DPG A;  4A3K B;  3HKZ G;  2JK8 A;  3VDY A;  1G91 A;  1G2T A;  2CWP A;  5LMU L;  1B7Y B;  5ELE A;  2UU9 L;  4K6D A;  4OXP A;  2HD3 A;  5A2Q L;  4YIJ A;  1PV4 A;  3HKZ B;  2VB2 X;  2HHH L;  4A3D G;  4HIO A;  2HCC A;  1X9N A;  1ET6 A;  4BY1 G;  1BDO A;  3RLN A;  4POG A;  1EYC A;  1LTT D;  3RN2 A;  4BBS H;  5GRO A;  1CKM A;  3G6E A;  4DV2 Q;  4G7H C;  4P72 A;  5FKA C;  2MFI A;  2ICI A;  3KYH C;  1QUQ B;  1V8Q A;  1CTM A;  1RDP D;  1TII D;  5IP7 G;  4A3D B;  1GO3 E;  1P16 A;  4E6I A;  5EKI A;  2M9V A;  4ZKC B;  3NBH B;  5K36 G;  3H0G H;  5BN3 A;  4GN5 A;  3F8T A;  3P20 A;  3KF8 B;  5JPN C;  3GTQ B;  2IPK D;  4FF2 A;  1PH2 A;  5JAV A;  2MUY A;  2RCN A;  3TS2 A;  1FNW A;  3V2T A;  1ZXT A;  1HR0 L;  1NNX A;  1D6E C;  1AZP A;  4KHP Q;  2VUM H;  4JI6 Q;  3OTO L;  4XIG S;  2B3G A;  4FXK C;  4ZUI A;  1YBY A;  3M85 A;  2WIN B;  2OWO A;  4DV1 Q;  1TKW B;  1X3F A;  5BR8 L;  4LFC Q;  5IYD G;  2JA7 B;  4DV4 Q;  1HQR D;  2QEX A;  5I6W A;  1BNZ A;  1TWC B;  3CF5 A;  5EPJ A;  1S5D D;  2B63 G;  1YI2 A;  2UUA L;  1L1O A;  4FF3 A;  1HCZ A;  4OEM B;  1LO5 D;  3X3N A;  3U9O A;  1A2U A;  5JVG 3;  2GN5 A;  2WII B;  1VMC A;  1PTO B;  1PH5 A;  5ELB A;  3RUZ A;  3GTP B;  3AQQ A;  4QQB X;  2UXC Q;  2KQ3 A;  1VMP A;  2YYZ A;  3AFQ A;  2PZW A;  1YEZ A;  2VL6 A;  1I3Q B;  4BXX H;  3D6C A;  4JCV E;  2PNH A;  4PG3 A;  2PZT A;  4B9W A;  4OO1 G;  4GKK Q;  4R4I A;  1I50 H;  4ODG A;  3S2D H;  2IX0 A;  4IFD J;  1PYS B;  4B3S L;  1EYD A;  4JBJ A;  4OL7 A;  5JEA G;  2ZJQ A;  3H6M A;  1S40 A;  4K0K L;  2EDG A;  1STN A;  3GTO B;  3ND9 A;  2WKD A;  1SAP A;  5BN4 A;  3CU7 A;  1EWH A;  2PNR C;  5I9O A;  1HTL D;  3HOV H;  4LUO A;  3BDO A;  5FO7 B;  4HJ8 A;  3NTK A;  1MD2 D;  2KHJ A;  3QWN A;  5C6A A;  5C3E B;  3W1G A;  3W3A A;  1C8C A;  2AQ2 B;  3DHQ A;  3SK8 A;  2H1E A;  3FVQ A;  1SRU A;  1VQP A;  2F0D A;  1IYV A;  2EYO A;  3NEM A;  3NBH A;  2NTT A;  3NXW A;  1JJC B;  4UPA A;  3GP7 A;  3PO2 G;  3RZO B;  1ILP A;  3UE0 A;  1EQT A;  1P8L A;  3I73 A;  4RCN A;  4KKT A;  2B2T A;  1ESR A;  5T1G A;  4TSS A;  2N78 A;  1TU2 B;  1PTO D;  4L63 B;  1DCZ A;  2A69 D;  3VYR A;  4NXN Q;  3FKI G;  3J81 L;  1NTG A;  3PUV A;  1PDQ A;  3PO2 B;  3BYT B;  4JI5 Q;  4CBV A;  2E2H H;  5FO8 B;  3AMU A;  3PSI A;  2D0P A;  2TMP A;  4PZ8 A;  1N32 L;  1ONL A;  4A3J H;  3FKI B;  4JYA L;  3TS0 A;  3KDF A;  2KCT A;  2NVQ B;  4G57 A;  3VR4 A;  4FP5 D;  4L6T B;  2KEE A;  3DLL A;  1KDC A;  4BWG B;  3NP8 A;  3EN2 A;  1S5B D;  3K8A A;  1VQE A;  3P7J A;  4C3H G;  4HSV A;  2EY6 A;  3J7A V;  2BOS A;  1XPO A;  2VY3 A;  4QIW E;  3GDE A;  3KLS X;  4YWM A;  1D7Q A;  1E22 A;  5EKL A;  2H4O A;  3WOF A;  3KBG A;  3MA2 B;  2UUB L;  5HGT A;  4FNF A;  4C3H B;  1JT8 A;  2PW5 A;  1D1I A;  2CVR A;  2F1M A;  1IYJ B;  1YJW A;  4GZY C;  3M7G A;  2FMM A;  2F0O A;  4A3E H;  2DNE A;  4XTC S;  1JOQ A;  3CCM A;  3TP7 A;  1UWV A;  2TSS A;  3HGB A;  2NVY B;  3CME A;  1OTC A;  1PH3 A;  4C2M B;  1J9O A;  2E2I B;  2B2Y C;  3U58 A;  4X62 L;  1NE3 A;  2YU9 B;  5NUC A;  4R4C A;  1OO9 B;  2IL8 A;  2MQH A;  2IY5 B;  4C1N I;  4PMB A;  5JPM C;  4CHT B;  4KKU A;  4DR7 Q;  2EY2 A;  5E1F A;  4QUC A;  3NTH A;  2KVM A;  2PQE A;  2SNS A;  2D0O A;  1CSQ A;  4R4Q A;  3K81 C;  2RKS A;  2WB1 G;  1V1O A;  4RG1 A;  4YHH L;  4K5V A;  5KND A;  1ENF A;  3S1M B;  5LMN Q;  5M5W H;  1PLF A;  1SYB A;  5JJL A;  4KKS A;  4PMC A;  1IBK Q;  4Y7N B;  2EJF C;  4JI3 Q;  1ASY A;  5ELF A;  4UHV A;  3IFD A;  2WB1 B;  3GD7 A;  3BVZ A;  4DR6 Q;  1OXU A;  4NXM Q;  2QDL A;  4IUQ A;  1T5X D;  3CCV A;  1JE4 A;  2RA4 A;  2VQE L;  4A3C H;  4QMG A;  1JCK B;  5IYB H;  1EEI D;  2N88 A;  1JWM D;  2NB0 A;  3CQZ B;  4A3L H;  3KLW A;  3BYY B;  1HRJ A;  1TWG B;  1M8A A;  4JV5 Q;  4MZ9 A;  1IKM A;  5AJ3 L;  5CV9 A;  3GTK H;  4RCO A;  5H1S E;  2E2J B;  3MAQ A;  3MTS A;  5FJ8 H;  3GO5 A;  1VQ7 A;  4XQQ A;  3PO3 H;  3QB3 A;  1XMO Q;  2Q2T A;  3MXP A;  5E7N A;  4C56 C;  1O7Z A;  1PH6 A;  3STB C;  2DJF C;  4YWK A;  2ZTD A;  3F2C A;  2I07 B;  5IGG A;  3DUZ A;  3S15 B;  3FPU B;  1Y1V H;  1HJP A;  3QO2 A;  3NTI A;  3H15 A;  1H9J A;  1GUT A;  2CQO A;  4JVZ A;  2ZXP A;  2K52 A;  3M4P A;  4A3I G;  4ZAI A;  3R3O A;  2KUM A;  1Y8O B;  3T16 A;  3HFZ B;  4DR3 Q;  1TVX A;  1JJG A;  1KXL A;  1F2Y A;  3FPP A;  1WTR A;  3HOY H;  4A3I B;  5K36 H;  4L5R C;  5LMU Q;  1O78 A;  2VQF Q;  1PXU A;  2AHO B;  2JEA I;  1R4Q B;  2HHH Q;  1JB3 A;  2NVT B;  2JA5 G;  4BS9 A;  4QUF A;  1SYE A;  1GUG A;  1I4P A;  3N52 A;  4N8F A;  4DNI A;  4KJO A;  1K73 C;  1B53 A;  1WCM G;  3S1N H;  1EUJ A;  1EY9 A;  1K8G A;  2JA5 B;  3C1E A;  3GTG B;  1STH A;  5GAG C;  1EYG A;  1TWF B;  2JQO A;  1WCM B;  1PZK D;  5M3M H;  2L11 A;  2JA6 G;  2JEB I;  4RA8 A;  5L37 A;  3J81 E;  1J5E L;  1SDF A;  1PRT B;  1C0A A;  1YNN D;  4C3J B;  4QL5 A;  3I3C A;  2BA0 A;  1SYD A;  2K50 A;  1TY2 A;  1HR0 W;  2JA6 B;  3OTO Q;  1K3R A;  2EYH A;  1HFN A;  3H09 A;  4UDU C;  1Q1B A;  5BR8 Q;  3HOZ B;  1AE2 A;  2NVX B;  1X55 A;  3CCJ A;  5C4J H;  5JJZ A;  3IL8 A;  2V1C C;  5G3L D;  4A3D H;  2WAQ G;  4HCE A;  2KED A;  4RGO S;  2G9D A;  1NMF A;  3QG1 A;  3BZC A;  3SE0 A;  2HCI A;  4BBR B;  2WAQ E;  4JI2 L;  1VQA A;  3GTQ H;  3D4W A;  2A68 D;  5IP7 H;  5ISR A;  2WAQ B;  3NQI A;  5J1Z A;  2Q2I A;  3W1B A;  4IQZ A;  4ULL A;  1J6Q A;  1KAB A;  2V4D A;  1FNV A;  4HN7 A;  1FVI A;  2NN6 G;  2OCE A;  2WP8 J;  4HJ9 A;  3RZD B;  2XSC A;  1CKN A;  5J39 A;  1SLJ A;  4IPG A;  3ZYY X;  1AH9 A;  1AEX A;  2I5M X;  4B3M Q;  1SNQ A;  5C0X H;  2VW9 A;  1O7L A;  4IUT A;  3ERO A;  5D65 A;  4BY7 H;  1LLR D;  2JA7 H;  1BCP F;  2K75 A;  1VF7 A;  2L5T A;  3G6J B;  5FOB B;  2VNU D;  2R6G A;  1PRT D;  4K0K Q;  1HZA A;  2JE6 I;  3CD6 A;  3M7N A;  4AIM A;  2F0G A;  2B8G A;  5BN5 A;  5IP9 G;  4RH6 A;  4IPC A;  2QA4 A;  5HY6 A;  1UNS A;  3GTP H;  1EY4 A;  1Z6H A;  2B2W A;  4J8Q A;  1VQC A;  2I0Q A;  1EY8 A;  3NK9 A;  1HQM C;  1I3Q H;  2ZXO A;  2B2Y A;  1XTC D;  1ZKO A;  1EY5 A;  1HA5 A;  3CXC A;  4DF7 A;  4IJL A;  1VQ4 A;  4OWX B;  3J80 L;  1Q46 A;  2D62 A;  1E1T A;  3I72 A;  1H95 A;  4HSP A;  3C2P A;  4IUP A;  5KNC A;  2L15 A;  1GUN A;  5EPL A;  5C0X I;  3KUP A;  4TKO B;  3OOC A;  1FJG Q;  2R7Z G;  3I91 A;  1LTG D;  4N8X 1;  3K0Y A;  1VQH A;  2LS0 1;  5JEA H;  1PYB A;  2RDH A;  1KD1 C;  2HQL A;  1BVS A;  2K33 A;  5CV8 A;  5C3E H;  2JA8 G;  2R7Z B;  1Q81 C;  1G6Z A;  4IOA A;  2NZH A;  2EOT A;  2SOB A;  3U50 C;  5IYC H;  3NEN A;  1NMG A;  2ZXR A;  5FLM G;  1N34 L;  2JA8 B;  1CZG A;  1H9S A;  1UAP A;  4JI0 L;  3CCQ A;  2F0M A;  4CDD C;  5C44 B;  3I4N H;  4TRD A;  1STE A;  2KOL A;  1FGU A;  4NKL A;  1XTD A;  2K5V A;  3VYS A;  5KRU A;  4K5W A;  1I4G A;  3L2P A;  1BO0 A;  2R93 H;  5FLX L;  1AN8 A;  4K14 A;  1SSO A;  4DNR B;  3HOX H;  3Q22 A;  1XNQ L;  1SYF A;  3A8K E;  2XRQ D;  4HR7 B;  1NUC A;  1SMY D;  2X6L A;  5D14 A;  3FRP B;  1EY7 A;  1TY0 A;  2O5I C;  4CGY B;  2CKZ B;  3EQL C;  2EIF A;  1IBM L;  3SGI A;  1XWE A;  1EL0 A;  3PUX A;  1ENA A;  3K5M A;  2F0F A;  3MEH A;  4LWC A;  3PQI A;  1D5Z C;  4DV6 L;  1WD0 A;  3KLS A;  3FP9 A;  3S9W A;  5I2X A;  1WTO A;  2K1B A;  4FF4 A;  2K04 A;  4X66 L;  4YHH Q;  3VYU A;  4A75 A;  1KQS A;  1I6H H;  1VQ6 A;  3NE5 B;  1QVF A;  1EOT A;  2PPB C;  2A6E C;  1V1Q A;  2OF1 A;  1WI5 A;  1CT1 D;  3JAM L;  2E2I H;  1CI3 M;  1ICW A;  2NZO A;  5HUR A;  1JOR A;  1L1O B;  2YU9 H;  2EZV A;  5GQO A;  2E8G A;  1TWA H;  3IFT A;  4KJN A;  1PFS A;  1S5E D;  4QY7 A;  1Y1W H;  1KNE A;  3T1Y Q;  1XMQ L;  4EQN A;  4WJW A;  3I4M G;  3AU7 A;  2QW7 A;  1O7I A;  2EPB A;  1MGS A;  1PTO F;  2Z9H A;  3OMG A;  1KLG D;  3MC0 B;  3UDX A;  5CV5 A;  4LF5 L;  5C0X J;  2A69 C;  4OWT B;  2EYJ A;  1X3E A;  3I4M B;  1R9T B;  2KHS A;  2CW0 D;  3KOJ A;  4DR4 L;  1RCV D;  3ICE A;  5JVH 3;  3PUW A;  1HNW Q;  1K8O A;  3CQZ H;  2K05 A;  2J7Z A;  2X6G A;  3HRZ C;  2F0U A;  4M8A A;  4OX9 L;  3RR5 A;  4P71 A;  1PFN A;  1A62 A;  1HZB A;  4BA2 I;  5D3D A;  1QOH A;  4A3F H;  1SRO A;  1S3O A;  4DR5 Q;  5M5X B;  2CQA A;  2BDO A;  1I4R A;  1STA A;  2H5X A;  2RDG A;  4BY1 B;  5IIF A;  3S15 H;  3T51 B;  3RD4 A;  1YJ9 A;  3CP0 A;  4IN3 A;  1XYI A;  1KL9 A;  4RAU C;  4TVA B;  1R4P B;  1PH4 A;  3J80 E;  1TR5 A;  1VQ5 A;  1KDB A;  3ONA B;  1HNZ L;  4RHR A;  1X32 A;  3FDT A;  3K0X A;  1CZW A;  1K8A C;  5T1I A;  5JEA J;  3J7Y W;  2AMC B;  2C9O A;  1KC8 C;  2J4X A;  2R7F A;  1ESF A;  5C4X G;  2Z6K A;  4KK7 A;  4NW2 A;  1CM9 A;  3GV6 A;  4GN3 B;  1QNU A;  3D31 A;  3PIP A;  1B4O A;  2ZTE A;  3KDF B;  1MI2 A;  3K7U C;  1MJC A;  2DY7 A;  3PV0 A;  1GHK A;  4P74 A;  5ELO A;  3CCL A;  5I2Y A;  1F9Q A;  4GOP C;  2NVT H;  1T9H A;  2RHQ B;  2N3S A;  1ICF B;  4B3R L;  2GA4 B;  3CCS A;  3URY A;  4CDF C;  2JYO A;  1A3U A;  1NCV A;  3GTL B;  3JAM i;  1AP0 A;  3NWS A;  1A8V A;  3TZD A;  1GXD C;  4RWS C;  4P73 A;  2B63 B;  3F2D A;  4P75 A;  3SR1 A;  1WCM H;  1YHA A;  3OWE B;  5E3F A;  3VA7 A;  4ALP A;  1IZ6 A;  4C3J H;  1XNR L;  3CW2 C;  2L9H A;  2A1A A;  4J15 A;  4B3T L;  2L12 A;  1YNJ D;  2HIV A;  5FLX E;  1Q1E A;  5COY A;  1B3A A;  3S24 A;  4IUV A;  3VR2 A;  2I46 A;  3PUZ A;  3AEV A;  4RFB A;  1B70 B;  1BOS A;  4HJ5 A;  3C3L A;  3HOZ H;  2BH2 A;  2SDF A;  3PIP 3;  2UXD L;  5IWA L;  1C7Y A;  3BVM A;  3DM3 A;  4XQN A;  2KA7 A;  1FNU A;  4ID6 A;  3K58 A;  1WTW A;  3J81 j;  3M4O B;  1C4Q A;  4CKB A;  4BBR H;  4KI0 A;  1YVC A;  3VR5 A;  1MIU A;  2KJX A;  5FK9 C;  2KBN A;  3LGJ A;  2O5J C;  4A4I A;  4HCS A;  1QNK A;  4MHE A;  2B2V C;  2XVS A;  1MHW C;  2PZU A;  3RZD H;  3KFU A;  1NAP A;  1VF5 C;  4WJ4 A;  3K80 C;  4LF4 L;  1K28 A;  3D3R A;  4JI1 L;  3CCR A;  3GTJ B;  1IW7 D;  4QB4 A;  2NN6 H;  5CV7 A;  3BS1 A;  1CUK A;  2PQA A;  3SHL A;  3JAM E;  3T53 B;  3K57 A;  5KGU A;  4H44 C;  2FIN B;  2JXM B;  2AUK A;  4HAE A;  1FL0 A;  1U9R A;  2Q8I B;  1YJN A;  1RD9 D;  3NPP A;  4OON A;  4ABN A;  3G7L A;  4GS3 A;  2KCM A;  4IFD G;  5IOC A;  1G29 1;  3UDI A;  5KYI A;  2Z6B A;  1RHP A;  1VCI A;  4MIU A;  4DV0 Q;  4OIK A;  5GAH C;  4XDX A;  1SFO B;  2R92 G;  1Q12 A;  2B39 A;  5IP9 H;  3T13 A;  1TS4 A;  4NPS A;  4LF9 L;  4G4K A;  5C5L A;  2OEO A;  4QIW B;  5DNF A;  5M5Y H;  2R92 B;  5ELC A;  4JI0 Q;  1KHI A;  2HDL A;  1SE2 A;  1M1K C;  3TBI B;  3TEH B;  4DNT B;  4DR1 L;  4DV7 Q;  1BR9 A;  2ENB A;  3SK6 A;  4A3B G;  2NN6 I;  2F0T A;  5G3L F;  1I94 L;  3PUY A;  5M3F H;  3E0J A;  1HXY D;  2EYF A;  3S17 B;  2DJG C;  3LWE A;  4AYB E;  4C3I G;  1EEF D;  1IL2 A;  4H02 A;  4QJF A;  4A3B B;  1K83 B;  1NJI C;  4B08 A;  1XNQ Q;  3K5O A;  1B9N A;  4X3K A;  3R93 A;  2EJM A;  3PGZ A;  4C3I B;  4DGZ A;  3CC4 A;  1D5M C;  2GVA A;  4FO2 A;  2JA8 H;  2OT2 A;  1RTO A;  4GLA C;  3OIQ A;  1HTP A;  1A2T A;  3BZD B;  2EY5 A;  4HMJ A;  3TSS A;  1JJ2 A;  4FXD A;  3SDZ A;  2XGT A;  5C44 H;  1X3Q A;  4DAV A;  3F2U A;  4K5X A;  1EZ6 A;  4DV6 Q;  3H3V H;  3A7L A;  1K8M A;  2D9U A;  1PRT F;  4P2C B;  4YWL A;  1I4X A;  5EKK A;  4LFB L;  4X66 Q;  4OIJ A;  3QR8 A;  3OSO A;  2F0E A;  2O4X A;  4DUY L;  1DM0 B;  1GM5 A;  4X64 L;  3QOL A;  3Q24 A;  4X65 L;  2G5D A;  4C1N K;  3KK7 A;  2DUD A;  5GAD C;  4AQY L;  1E7Z A;  5EAY A;  1U4L A;  1G51 A;  3RN5 A;  3CCU A;  1OXT A;  1SR3 A;  5EBC A;  2QGQ A;  1L0Y B;  1LTI D;  3F1Z A;  3EA6 A;  4A3M H;  4A3G H;  3DMU A;  1C9O A;  4G7O C;  4BBS G;  3OPO A;  3HKS A;  2WAC A;  1B50 A;  4WFN 3;  2HT1 A;  4QF4 A;  2K5Q A;  3QOJ A;  1QB5 D;  3A5Z B;  2VZA A;  4ZRZ A;  2IT1 A;  4K8I A;  1CKN B;  4EVO A;  4LK1 C;  2BE5 D;  4TQU S;  3LX0 A;  1QG7 A;  1LTS D;  3H0G G;  4LF5 Q;  3PF5 A;  4JI8 Q;  3Q8D A;  2E75 C;  3H3V I;  2XIW A;  1LT6 D;  1V1P A;  4DR4 Q;  3I8Z A;  4NP5 A;  5C5M A;  1K3B C;  2VUM G;  4A93 G;  2NYZ D;  1OXS C;  3H0G B;  3A0J A;  2UU9 Q;  5LL6 S;  1HFG A;  2QF7 A;  1LAB A;  4OX9 Q;  1HNX L;  1HUN A;  5FO9 B;  1LM0 A;  3R2T A;  4LNQ A;  3BU2 A;  1DOL A;  4A93 B;  2VUM B;  4IJH A;  4LUV A;  1Q7Y C;  4NDX A;  4NB3 A;  2HDM A;  1SNP A;  5CC4 A;  1YZ6 A;  4YCW A;  3CCE A;  1EFI D;  3CC2 A;  5EGT A;  3J7Z C;  2Z0S A;  1QWY A;  2K28 A;  4A3K H;  3I4M H;  1SNO A;  2RQX A;  4CJ2 C;  4PZ6 A;  4DUZ L;  2JJQ A;  3EFX D;  4KY6 A;  1DOK A;  1I5F A;  1HR0 Q;  1CFM A;  1L0X B;  3BVG A;  3G71 A;  2K5D A;  2MP1 A;  2ZM6 L;  1FGB D;  2B2V A;  5IT9 L;  4KHP L;  4ZQ3 A;  4ZK9 B;  5LL6 X;  2IHE A;  2WFW A;  4JOI C;  3AYH B;  5M5X H;  2IWH A;  4OGQ C;  2MHV A;  1CKO A;  2UUC L;  4LW1 A;  2LY7 A;  2Y0S G;  3WOE A;  5IGE A;  1JIC A;  4MNO A;  4BY1 H;  3J81 c;  4DV4 L;  1I50 B;  3S2D B;  1CHQ D;  3S16 B;  2UUA Q;  2Y0S E;  3HOV G;  1CQV A;  1H9S B;  5J3B A;  2R3Z A;  4ZKB B;  2NBF A;  2NTS A;  2Y0S B;  2YTX A;  1BF4 A;  1G8Z D;  1IHZ A;  4FYD A;  2B8F A;  5DM7 3;  1PH1 A;  3ERQ A;  4WOR A;  1A3V A; 
#chains in the Genus database with same CATH homology
 3AQQ A;  4QQB X;  2UXC Q;  1U0L A;  2EQS A;  2YYZ A;  3AFQ A;  2KHI A;  3FP9 A;  3I55 A;  1A63 A;  1YEZ A;  2VL6 A;  1OXX K;  4X66 L;  4YHH Q;  4A75 A;  1KQS A;  4BXX H;  1I6H H;  1VQ6 A;  4JCV E;  1QVF A;  2PNH A;  4PG3 A;  4GNX C;  4JI4 Q;  3T1H L;  4LF6 Q;  4GN4 B;  1E3P A;  1XNR Q;  1N33 L;  4YCV A;  4OO1 G;  5LMN W;  2WB1 E;  4GKK Q;  4B3T Q;  1X56 A;  4R4I A;  1N36 L;  1I50 H;  4B3S Q;  3S2D H;  2IX0 A;  1V1Q A;  1TWC H;  4LFA L;  4GKK L;  4IFD J;  1WI5 A;  1PYS B;  3UDG A;  2MNA A;  1VQO A;  1U5K A;  4JBJ A;  5JEA G;  2ZJQ A;  2OQ0 A;  4B3S L;  1HZC A;  1S40 A;  2ATW A;  4K0K L;  2E2I H;  2LXJ A;  5IYD H;  2NZO A;  4A3F G;  4MTN A;  4IPH A;  1L1O B;  2YU9 H;  4PMW A;  4A3J G;  2R7D A;  5GQO A;  4DK6 C;  2E8G A;  1TWA H;  4GOP A;  1PFS A;  4QY7 A;  1MKH A;  2B63 H;  4LUO A;  3HOV H;  2ES2 A;  4HJ8 A;  3RLO A;  1XMQ Q;  1Y1W H;  3J81 i;  2KHJ A;  3T1Y Q;  3ULJ A;  2AKW B;  4DV5 Q;  1XMQ L;  3W1G A;  3T1Y L;  3I4M G;  1O7I A;  4GLX A;  1S72 A;  1WOC A;  4R4T A;  4QGU A;  1E1O A;  4POF A;  4JI7 Q;  4YY3 Q;  3EIV A;  4EX5 A;  3UDX A;  3CC7 A;  1SRU A;  1VQP A;  4LF5 L;  1YIT A;  1WYD A;  2BA1 A;  5C0X J;  2UXB L;  4DV3 Q;  4OWT B;  3GTM H;  3PF4 A;  3NEM A;  1JJC B;  1X3E A;  4UPA A;  1Q82 C;  3PO2 G;  4BA1 I;  4HIK A;  3UE0 A;  1P8L A;  1Y14 B;  2K14 A;  3KOJ A;  1LYL A;  4DR4 L;  3ICE A;  3GTO H;  1VQ9 A;  2ASB A;  2N78 A;  3PUW A;  4LF4 Q;  1QVC A;  1HNW Q;  3CQZ H;  4NXN Q;  3FKI G;  1NTG A;  1EQQ A;  1PH7 A;  3CAM A;  3PUV A;  1HNW L;  4OX9 L;  3RR5 A;  1XPR A;  4P71 A;  4GLV B;  4JI5 Q;  1A62 A;  2EXD A;  1HZB A;  4BA2 I;  2E2H H;  4HJ7 A;  1N32 Q;  3M4O H;  1X54 A;  1LTL A;  3PSI A;  2D0P A;  4A3F H;  1SRO A;  4A3E G;  4PZ8 A;  1VQB A;  1N32 L;  1S3O A;  4DR5 Q;  2MO0 A;  4A3J H;  5DLQ E;  1VQL A;  4JYA Q;  4DR5 L;  4LF8 Q;  1JE5 A;  4JYA L;  4DV2 L;  3TS0 A;  3KDF A;  2KCT A;  2F52 A;  2YV5 A;  2H5X A;  1QZH A;  2PI2 A;  2F3I A;  3RZO H;  2CFM A;  1R9T H;  3S15 H;  4HJA A;  4IO9 A;  3DLL A;  3CPW A;  3NEL A;  3CP0 A;  1YJ9 A;  4JG2 A;  3S1Q H;  3EN2 A;  3K8A A;  1KL9 A;  3D0F A;  1QVG A;  4TVA B;  1VQE A;  1PH4 A;  1SE8 A;  4BXX G;  3GTJ H;  1HNZ Q;  2YTV A;  1VQ5 A;  3ULL A;  3BZK A;  3PO2 H;  2N49 A;  1HNZ L;  1XPO A;  2LSS A;  2VY3 A;  1VQN A;  3K0X A;  4QIW E;  3GDE A;  4YWM A;  1D7Q A;  1E22 A;  1G6P A;  1K8A C;  2UUB Q;  4JI6 L;  5JEA J;  2AMC B;  2UUB L;  1KC8 C;  1JT8 A;  2R7F A;  4WJ4 A;  3FKI H;  5C4X G;  2Z6K A;  1TXY A;  4OO1 I;  4DR1 Q;  4IPD A;  4DV1 L;  4GN3 B;  1IYJ B;  1YJW A;  3D31 A;  3PIP A;  4LFC L;  2NVQ H;  2ZTE A;  3KDF B;  4A3C G;  1I94 Q;  3E9H A;  3K7U C;  3I56 A;  1MJC A;  3PV0 A;  4A3E H;  4XTC S;  3OYY A;  3HOZ G;  4A3L G;  4P74 A;  5ELO A;  3CCM A;  1UWV A;  1HH2 P;  1N9W A;  1NBW A;  4GOP C;  3CCL A;  1UE1 A;  2A8V A;  2NVT H;  1T9H A;  3IRB A;  2RHQ B;  3E9I A;  4B3R Q;  2A19 A;  2N3S A;  3CME A;  1OTC A;  1PH3 A;  2IX1 A;  3CCS A;  2Q2U A;  4X62 Q;  4B3R L;  5FJ8 G;  3U58 A;  4X62 L;  4UP9 A;  4JBM A;  1NE3 A;  3JAM i;  4R4C A;  3B6Y A;  1A8V A;  4BBR G;  2MQH A;  2IY5 B;  1W2B A;  5HGQ A;  4PZ7 A;  4P73 A;  4DR7 Q;  3M9B A;  1EQR A;  3PIO A;  3F2D A;  4DR7 L;  1UE7 A;  4P75 A;  2UXC L;  1KAW A;  1ASZ A;  4UP7 A;  2D0O A;  1CSQ A;  4R4Q A;  3K81 C;  1WCM H;  2N8N A;  2WB1 G;  4C3H H;  2UXD Q;  1YHA A;  4RG1 A;  1Y1V G;  1V43 A;  4YHH L;  2PMZ E;  5LMN Q;  5M5W H;  1AE3 A;  4ALP A;  1IZ6 A;  1K0R A;  4JI4 L;  4C3J H;  1Q86 C;  5JJL A;  4LF6 L;  1IBK Q;  4OWW B;  1XNR L;  3CW2 C;  1YHB A;  1PH8 A;  4JI3 Q;  1ASY A;  2A1A A;  4J15 A;  4B3T L;  4JI3 L;  1VQJ A;  2NVY H;  1VQ8 A;  2FXQ A;  2HIV A;  1PVO A;  5C4X H;  3S17 H;  1Q1E A;  3GD7 A;  3S24 A;  2XTI A;  4C2M H;  4L5T A;  1OXU A;  3G48 A;  3A5U A;  3CCV A;  2VQE Q;  4NXM Q;  3ZJY C;  3PUZ A;  4DKA C;  2VQE L;  1X6O A;  3AEV A;  3GTL H;  2ZJP A;  1B70 B;  4A3B H;  4A3C H;  4X64 Q;  3U4Z A;  5IYB H;  1K83 H;  2K4K A;  3UE1 A;  4HJ5 A;  5IWA Q;  1IBL Q;  3KLW A;  2BH2 A;  1X3G A;  3HOZ H;  1LUZ A;  4A3L H;  1YIJ A;  5AJ3 Q;  3HOY G;  5IWA L;  1C7Y A;  2AWN A;  4JV5 Q;  4MZ9 A;  3TRE A;  4AQY Q;  4O0A A;  5AJ3 L;  3GTK H;  3DM3 A;  4LUZ A;  5H1S E;  3TQY A;  5FJ8 H;  3J81 j;  3GO5 A;  2GVB A;  1VQ7 A;  3PO3 H;  4DV5 L;  4JOI A;  4BBR H;  1XMO Q;  2Q2T A;  3S1M H;  1X65 A;  5E7N A;  4JI7 L;  4HID A;  4KI0 A;  1YVC A;  1XMO L;  4DAM A;  4YY3 L;  3STB C;  1PH6 A;  4Y7N H;  1YHQ A;  1MIU A;  4YWK A;  3RLF A;  2ZTD A;  3F2C A;  2KBN A;  1L0W A;  3LGJ A;  4A4I A;  4GKJ Q;  1NY4 A;  1WJJ A;  4DV3 L;  2ZTC A;  1Y1V H;  1EOV A;  3F2B A;  3RZD H;  1HJP A;  4X6A H;  3KFU A;  1Z47 A;  1VS0 A;  3STB D;  3H15 A;  1A0I A;  4HIM A;  2CQO A;  3ER0 A;  4JI1 Q;  1EIF A;  3K80 C;  4DR2 Q;  2Z6K C;  1VQI A;  3RNU A;  4LF4 L;  1SN8 A;  4JI1 L;  1TWG H;  4ME3 A;  5M3M G;  2K52 A;  3M4P A;  4NXN L;  4DK3 C;  3CCR A;  4A3I G;  1VQM A;  1KIX A;  2MO1 A;  5IE8 A;  3HFZ B;  4DR3 Q;  4R1J A;  4JI5 L;  2E2J H;  1CUK A;  2PQA A;  4DR3 L;  4LF7 Q;  3CPF A;  1JJG A;  3HOW H;  4APV A;  1KXL A;  5M3F G;  4AH6 A;  1GD7 A;  3KJP A;  1HZ9 A;  1M90 C;  3HOY H;  1L1O C;  4L5R C;  5LMU Q;  4GNX A;  4LF8 L;  1FL0 A;  1YJN A;  1XPU A;  4DAY B;  2VQF Q;  4OON A;  3HKZ E;  1RL2 A;  1HNX Q;  4JBK A;  3M4Q A;  2AHO B;  3S2H H;  2VQF L;  4WJ3 M;  2JEA I;  3KF6 A;  4GS3 A;  2HHH Q;  2KCM A;  4IFD G;  2JA5 G;  2YTY A;  1G29 1;  3L7Z C;  4O2D A;  3UDI A;  1WFQ A;  1KRS A;  1VQK A;  1VCI A;  1UEB A;  3MEF A;  4DNI A;  1K73 C;  1V9P A;  4DV0 Q;  4DR6 Q;  1WCM G;  4FDB A;  5GAH C;  2R92 G;  3S1N H;  4DV0 L;  1EUJ A;  1Q12 A;  1B8A A;  2IHF A;  3I2Z A;  5IP9 H;  1K8G A;  2RF4 A;  4LF9 Q;  3S1R H;  4NPS A;  5C44 G;  3G4S A;  1L2F A;  4LF9 L;  5GAG C;  3ERS X;  1EYG A;  3UDF A;  3E0E A;  1D8L A;  1PH9 A;  2PQA B;  2JQO A;  5M3M H;  5M5Y H;  2JA6 G;  4KHZ A;  2JEB I;  4DUZ Q;  1KHI A;  4A3I H;  1J5E Q;  4JI0 Q;  3W5O A;  1M1K C;  3M3Y H;  3TEH B;  4DR1 L;  3BJU A;  1J5E L;  4DV7 Q;  1C0A A;  2F4V Q;  3ULP A;  3EBE A;  4QL5 A;  4DV7 L;  4A3B G;  2NN6 I;  4GNX B;  5IYB G;  5C0X G;  2K5N A;  3J7A 5;  1I94 L;  3PUY A;  2BA0 A;  2K50 A;  5M3F H;  2ZM6 Q;  1HR0 W;  4BY7 G;  1JMC A;  4AYB E;  3J80 c;  3OTO Q;  2JA7 G;  3KF6 B;  4A93 H;  1IL2 A;  1K3R A;  4H02 A;  3FHW A;  2JA9 A;  1PHJ A;  1EWI A;  4QJF A;  1SFO H;  1N8R C;  3HOU H;  3PO3 G;  1Q1B A;  2K5H A;  5BR8 Q;  1AE2 A;  1NJI C;  1X55 A;  3CCJ A;  5C4J H;  2UUC Q;  1XNQ Q;  2JA5 H;  3GTG H;  2V1C C;  4A3M G;  4A3G G;  4A3D H;  3PGZ A;  2CWA A;  2VS1 A;  2WAQ G;  3CMA A;  3CC4 A;  2AWO A;  1EFW A;  2GVA A;  1TWF H;  2E5L Q;  2JA8 H;  4GLA C;  1NMF A;  4YCU A;  2R92 H;  2RHS B;  3BZC A;  4L5S A;  1W3S A;  4JI2 Q;  1DGS A;  2WAQ E;  4JI2 L;  1VQA A;  1JJ2 A;  2XGT A;  5C44 H;  5LMN L;  3GTQ H;  2OQK A;  5IP7 H;  1IBK L;  3L0O A;  2Q2I A;  3W1B A;  2UXD L;  5JJK A;  1J6Q A;  4DV6 Q;  1FVI A;  2JA6 H;  2NN6 G;  3H3V H;  2OCE A;  2WP8 J;  4HJ9 A;  4LFB Q;  4DR6 L;  1CKN A;  4NXM L;  4YWL A;  5JJI A;  4LFB L;  4X66 Q;  1SLJ A;  4UY8 C;  3HOW G;  4IPG A;  4DUY Q;  1AH9 A;  4B3M Q;  2I5M X;  3WWV A;  1K9M C;  2NVX H;  4DUY L;  4X65 Q;  4X64 L;  1GM5 A;  1IBL L;  2VW9 A;  2KEN A;  3T1H Q;  4B3M L;  4X65 L;  2OTL A;  1N33 Q;  4BY7 H;  2Q2H A;  4JBW A;  4JC0 A;  4JV5 L;  4C3I H;  2JA7 H;  2DUD A;  5GAD C;  4AQY L;  2K75 A;  1N36 Q;  1E7Z A;  4LFA Q;  4UP8 A;  2LXK A;  5EAY A;  2VNU D;  1G51 A;  3RN5 A;  3CCU A;  2R6G A;  3S16 H;  4K0K Q;  1OXT A;  1SR3 A;  3J80 i;  2B29 A;  1UE5 A;  2QGQ A;  5IT9 c;  1HZA A;  3KJO A;  3F1Z A;  2JE6 I;  1UE6 A;  1JB7 A;  4A3M H;  3CD6 A;  4AIM A;  3M7N A;  4A3G H;  5FLX c;  1Q8K A;  3PCO B;  1C9O A;  5C3E G;  4IFD I;  3AFP A;  1MJE A;  4BBS G;  3HKS A;  4L5Q A;  1EIY B;  2OTJ A;  5IP9 G;  4IPC A;  2QA4 A;  2HT1 A;  5HY6 A;  3GTP H;  4GKJ L;  5IYC G;  1CSP A;  5GAE C;  1E24 A;  1VQC A;  2I0Q A;  3A5Z B;  1IXR A;  2VZA A;  2IT1 A;  1I3Q H;  4Y52 H;  1CKN B;  3MXN B;  4A3K G;  4DR2 L;  2ALY B;  3CXC A;  4TQU S;  1QUQ A;  2ZJR A;  3K7A H;  4IOC A;  3H0G G;  2UXB Q;  4IJL A;  1VQG A;  1YNX A;  3PF5 A;  1VQ4 A;  4OWX B;  4LF5 Q;  4JI8 Q;  1Q46 A;  1GKH A;  1E1T A;  2D62 A;  3Q8D A;  3I4N G;  3H3V I;  1H95 A;  4JI8 L;  4LF7 L;  4A76 A;  2BH8 A;  3I7F A;  4DPG A;  4DR4 Q;  3HKZ G;  2JK8 A;  2L15 A;  3VDY A;  2CCZ A;  1BBU A;  1SMX A;  2VUM G;  4A93 G;  5C0X I;  1OXS C;  4RMF A;  2CWP A;  3A0J A;  1GVP A;  5LMU L;  2UU9 Q;  1FJG Q;  1B7Y B;  2R7Z G;  2R93 G;  2UU9 L;  2ID0 A;  1FJG L;  3HOU G;  4OX9 Q;  4OXP A;  1HNX L;  1VQH A;  3HOX G;  1LM0 A;  1PV4 A;  4LNQ A;  1PYB A;  3A74 A;  3BU2 A;  2HHH L;  4A3D G;  4HIO A;  1KD1 C;  2HQL A;  1BVS A;  4GOP B;  1BKB A;  4BY1 G;  4IJH A;  3RLN A;  4LUV A;  5C3E H;  1X9N A;  3RN2 A;  1Q7Y C;  4POG A;  2JA8 G;  4BBS H;  1Q81 C;  4IOA A;  5GRO A;  2NZH A;  4NB3 A;  1CKM A;  3G6E A;  4DV2 Q;  3JAM c;  3U50 C;  5IYC H;  4P72 A;  3NEN A;  2MFI A;  3KYH C;  1QUQ B;  1NMG A;  5IP7 G;  1N34 Q;  2HIX A;  1GO3 E;  1YZ6 A;  4YCW A;  5ELN A;  1P16 A;  5FLM G;  3J7Z C;  3CCE A;  1XJV A;  1N34 L;  3CC2 A;  3S14 H;  1RIP A;  2Z0S A;  3I4M H;  2DGY A;  4A3K H;  1BBW A;  3NBH B;  4PZ6 A;  5K36 G;  1VQD A;  4DUZ L;  4JI0 L;  3CCQ A;  3H0G H;  4GN5 A;  1PA6 A;  2JJQ A;  3F8T A;  3I4O A;  3KF8 B;  3I4N H;  4AYB G;  1QZG A;  2F4V L;  1PH2 A;  2RCN A;  3TS2 A;  2I5H A;  1I5F A;  1HR0 Q;  1FGU A;  1HR0 L;  3G71 A;  1TWH H;  1XTD A;  5IY0 A;  2K5V A;  2ZM6 L;  4KHP Q;  3U4V A;  1OXV A;  2VUM H;  3TRZ A;  4JI6 Q;  4KHP L;  3OTO L;  4XIG S;  2B3G A;  3L2P A;  4R4O A;  2R7Z H;  2R93 H;  1YBY A;  3M85 A;  2IHE A;  2WFW A;  4JOI C;  3AYH B;  4EQ5 A;  5M5X H;  2OWO A;  2C35 B;  4DV1 Q;  3HOX H;  1CKO A;  5BR8 L;  1X3F A;  2UUC L;  4LW1 A;  4LFC Q;  1XNQ L;  1Z9F A;  5IYD G;  2Y0S G;  4DV4 Q;  2PI2 E;  2QEX A;  4MNO A;  4BY1 H;  3J81 c;  4DV4 L;  2E5L L;  3CF5 A;  3OW2 A;  1IBM Q;  2UUA Q;  2Y0S E;  3HOV G;  2CKZ B;  2B63 G;  1YI2 A;  2EIF A;  1IBM L;  3SGI A;  2UUA L;  1L1O A;  5J3B A;  1Y1W G;  2I5L X;  3PUX A;  2YTX A;  5FLM H;  3JC6 6;  1VQF A;  4LWC A;  2GN5 A;  1PH5 A;  1PH1 A;  1KRT A;  4KLK A;  4DV6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...