2K5HA

Solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
molecule keywords Conserved protein
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2008-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5hA01
3ULLA 1D8LA 4HJ9A 2CCZA 3RNUA 4BBRG 2YTXA 1IZ6A 3STBD 1NE3A 1P16A 4LW1A 4P73A 1UEBA 4JI8Q 3L2PA 1JJCB 1N36L 3J7A5 3CCUA 1WI5A 3H0GH 2ALYB 5J3BA 1X55A 2KCMA 3I2ZA 1TWHH 3E0EA 3PUYA 5M3FG 3HOWH 1G51A 3ER0A 4UP7A 3EN2A 4EQ5A 5IYCG 3F2DA 4DUYQ 2AMCB 4P72A 4DV3Q 3L7ZC 5LMUL 1IXRA 4LNQA 3MXNB 1W2BA 1YBYA 4ME3A 1VQBA 5GADC 4DV1Q 1O7IA 2CWPA 3ICEA 1I94Q 2KCTA 4NXML 4LUVA 1L0WA 3JAMi 2ZM6Q 4WJ3M 1LUZA 1HZ9A 5IWAQ 1CKOA 2AWOA 4PZ6A 1OTCA 4A3CG 3TRZA 1LYLA 3CF5A 1CSPA 4DR3L 2HIVA 4DK3C 1N32L 1BBUA 5AJ3L 4KI0A 3UDGA 3HOXG 2CQOA 3CMAA 4X66L 2R7ZH 3SGIA 3TEHB 3U58A 2BA1A 2K5HA 4UP8A 1VQHA 2R92H 1U5KA 1FGUA 1VQGA 1N36Q 2Q2UA 4DUZQ 2UXCQ 2GN5A 1V9PA 1YI2A 4DV4L 3GTLH 4DR2Q 4LF7L 2F4VL 1HR0W 1HNZL 4LFAQ 2UXCL 1VS0A 3KFUA 2UUCQ 5IYDG 4DV6Q 4A76A 4DNIA 2YTVA 5LMUQ 3GTMH 4GOPC 2Y0SE 3KOJA 2ZJPA 3HOVG 3H15A 4PZ7A 4AH6A 1BBWA 4GLXA 1TXYA 1Y14B 3H0GG 4IJLA 4KLKA 3GTJH 2XTIA 1K8AC 1EOVA 2UUBQ 3HFZB 4BY7H 4DKAC 1NJIC 1WCMH 4JI5Q 4RG1A 4R4TA 5IWAL 5IP7G 4OX9L 4RMFA 1VQNA 2N8NA 3S2HH 4GLAC 4JBKA 4LF6L 2PMZE 4R4OA 4JI8L 1XMQQ 1PV4A 2YU9H 4C2MH 3HOYH 1VQFA 4MZ9A 3UDIA 1GD7A 1XTDA 2XGTA 4OWXB 1EQRA 4YWKA 1UE6A 1SFOH 2WFWA 2PNHA 1T9HA 3CXCA 2OTLA 2MFIA 4IPDA 4BXXH 4IFDG 4A3GG 3W5OA 3FKIG 2BH2A 1YEZA 2JA6H 3HOUH 1HH2P 3I55A 4B3ML 3CPWA 5ELNA 3T1HL 1N33Q 2PI2A 1Q8KA 1ASZA 4MTNA 1VQKA 1XNRL 1YZ6A 4LF7Q 1WOCA 2K14A 2L15A 1VQ4A 3EBEA 2UUAQ 1KD1C 3S1RH 4Y7NH 1NMFA 3S24A 1PVOA 3K81C 4DR4Q 4NXMQ 1I5FA 4AIMA 1PFSA 3K7AH 4GKKQ 3TS2A 4JV5Q 3NEMA 5FLMG 2EQSA 2JQOA 4A93G 4JYAL 1HNXL 1LTLA 1JJGA 2D0PA 3PUXA 4JI0Q 1VQIA 1IBKQ 1N9WA 2AHOB 1YIJA 2YV5A 1IBMQ 3HOYG 4X64Q 3CCLA 1Q86C 4L5TA 2Q2IA 1P8LA 3G4SA 4A3EG 1Y1WH 1L1OA 4NXNL 2JA5G 1SR3A 1EQQA 1QUQA 3OW2A 2UU9Q 4LF6Q 4X6AH 1AH9A 2CFMA 2ZTEA 1WCMG 2NVYH 5C3EG 2N3SA 2I5LX 2KHIA 5IE8A 1TWAH 5M3MH 4GNXC 4JBMA 2A19A 4DV7Q 3F8TA 5C3EH 4YY3Q 4JI1Q 3KF6A 3J7ZC 4DV0Q 1N34L 1PH6A 1M1KC 3K80C 1FJGQ 1E24A 4B3TQ 3HKSA 4B3SL 2JJQA 2K50A 4DV6L 1UE5A 1X3EA 4DV0L 1Z9FA 5JJKA 1A8VA 4JV5L 5C44H 3KF8B 1RIPA 2RHQB 4IFDI 5HGQA 1B7YB 1HNWL 4A3LG 2B29A 4DV5Q 1X3FA 5C44G 3I4MG 2R7FA 1VQOA 1QVCA 3OTOQ 4DAYB 2QEXA 1EUJA 4IPCA 5E7NA 4X64L 2R7DA 1WFQA 1YITA 1Y1WG 3PF5A 2UUBL 4GN3B 2JA8H 4QIWE 1G6PA 5ELOA 4C3JH 4QY7A 5AJ3Q 1QZGA 4EX5A 3G6EA 3CCMA 4YHHQ 3FKIH 4DV7L 3RN2A 4OWWB 4A93H 4GNXA 2H5XA 4JBJA 2R93G 4DV4Q 1HZCA 1VQ8A 3AFPA 4C3IH 1SRUA 4O2DA 3UE0A 4A4IA 4DUZL 4IOCA 2IX0A 1B70B 2KENA 2ID0A 3E9HA 3CCSA 1MJEA 3M85A 3CCVA 3L0OA 4OO1G 4B3MQ 4B3TL 3Q8DA 4DV2L 2UXDQ 4JI7Q 2Z6KA 2JA7G 4DUYL 1UWVA 3RR5A 4GOPA 4A3KH 1MIUA 3KDFA 2HHHQ 4P75A 4JC0A 4DR3Q 4LF5Q 4H02A 3OTOL 1HR0Q 4APVA 4DV5L 4GNXB 1D7QA 1X3GA 3RLOA 1XJVA 2EIFA 1KRSA 3E9IA 5FLMH 2MO1A 3AYHB 3ULJA 2UU9L 1QZHA 4DPGA 4A3JG 1RL2A 3A5ZB 4A3IG 2OQ0A 1YJNA 3G48A 5C0XI 2ZJRA 2E8GA 2R92G 4GOPB 2RF4A 3PSIA 3PUWA 4YY3L 1EIYB 3CQZH 1JT8A 1H95A 3LGJA 3I56A 4K0KL 3OYYA 2Y0SG 1ASYA 2DUDA 3A5UA 1QVGA 1NBWA 3J80i 1J5EQ 3PIOA 5LMNQ 3KYHC 1VQ9A 3I4MH 4J15A 4IOAA 4DR5Q 1HNWQ 3S17H 1OXUA 1G291 1XPRA 1GO3E 4HIMA 1JMCA 2GVAA 3GO5A 1Q7YC 1EFWA 1VQAA 1UE1A 2VQEL 3ERSX 2ZTCA 4JBWA 5C4XH 4JYAQ 2UXBQ 2OQKA 2CKZB 2AWNA 3U50C 4OONA 4HJ7A 1VQPA 4BY1H 2I0QA 4IPGA 4GS3A 1I3QH 3RLNA 3STBC 2VS1A 4HJAA 5JEAG 1Q81C 1M90C 4JI3L 3JAMc 2E5LL 4OX9Q 2JK8A 2C35B 1Q46A 5M3MG 2VW9A 4LFCL 1KQSA 1V43A 3T1HQ 5GAGC 2K4KA 4QL5A 2VY3A 3PV0A 1KIXA 3S15H 2FXQA 2VL6A 4JOIA 4ALPA 2JA8G 1FJGL 1E22A 1L1OB 4LF4L 2VZAA 4A3FH 1TWFH 5FLXc 1YHAA 1CUKA 1KRTA 2KBNA 1HNZQ 5C4XG 4TQUS 5EAYA 1FL0A 4DR4L 3VDYA 5LMNL 3TREA 1EIFA 4X62Q 4GKKL 2IHEA 1XNQQ 4AQYQ 1K83H 3S2DH 1GM5A 4LFBL 5C0XG 3I7FA 1HR0L 3PUZA 3M4OH 1XMOL 3GTPH 3D0FA 2LSSA 1I94L 1PYBA 2HHHL 4JI5L 3F2BA 1OXTA 2B3GA 4PG3A 3AQQA 4L5QA 1E3PA 2OTJA 1FVIA 5M5XH 2MQHA 2NZHA 3UDFA 1E7ZA 2LXJA 2BA0A 5M3FH 4A3LH 3CC7A 1IBLL 4LF8L 2ASBA 5M5WH 1EYGA 2F4VQ 3S1NH 1QVFA 3JC66 1K0RA 3PGZA 4BBRH 2JA5H 1C0AA 1IBLQ 4LF8Q 1A63A 3ULPA 4IPHA 4BY1G 3WWVA 1OXXK 3RN5A 4QGUA 3NENA 2HT1A 5IP7H 4GLVB 3I4NH 4O0AA 3CC2A 3J81i 4JG2A 1VQEA 1N8RC 3CCJA 2YTYA 3F2CA 1OXVA 3B6YA 4A3GH 4B3RQ 1XMOQ 1OXSC 4HIKA 1PYSB 4AYBG 1YJWA 1XMQL 3KJPA 5IYBH 1E1OA 2NN6I 4QJFA 3GDEA 1VQ5A 2ZM6L 1X56A 5IP9H 4R4CA 1HZAA 2WAQG 4DR1Q 4LUZA 2ATWA 5JEAJ 3U4ZA 5JJLA 5GAEC 5LMNW 2BH8A 4YCUA 3KJOA 4FDBA 3RZDH 4IFDJ 3GTOH 4LFAL 5IYDH 5IY0A 3HOZH 2AKWB 4BBSG 1EWIA 1MJCA 1IL2A 1XNQL 4PMWA 2KHJA 4XTCS 1KC8C 4A3BG 2HQLA 1JB7A 2DGYA 2D62A 1C9OA 1Y1VG 4JI2Q 2R93H 4BY7G 4HJ8A 3H3VH 1CKNB 4DR7Q 2F52A 4A3MG 1VQLA 1SMXA 2JE6I 2UXBL 2VQFQ 1IBML 2CWAA 1Q1BA 3FP9A 2IT1A 1A62A 4JI0L 4GN5A 4KHPL 3HOXH 1V1QA 2K5VA 1K9MC 5IP9G 3NBHB 4X65Q 1XPUA 3HKZG 5GROA 2IY5B 2A1AA 1HZBA 2E2IH 2ES2A 3M3YH 2WB1G 4IJHA 1CSQA 3K0XA 2E5LQ 1E1TA 1HJPA 1I6HH 1IYJB 5HY6A 1SROA 3W1BA 1L2FA 2RHSB 1YHBA 1YVCA 3UE1A 3D31A 3W1GA 3BZKA 4NXNQ 3DM3A 4B3SQ 2A8VA 3PO2H 3G71A 4DV3L 3I4OA 5FJ8H 4WJ4A 2PI2E 1YJ9A 2Z0SA 3CPFA 2NVQH 2B63G 3I4NG 4JI2L 4HJ5A 3CD6A 2V1CC 2N78A 1JE5A 3PF4A 3S1QH 1X65A 3CAMA 4DR7L 4UP9A 1Q82C 4GKJQ 4JI6L 3BZCA 4LFBQ 3CCQA 2JEBI 3DLLA 5BR8Q 1BVSA 3AFQA 4X62L 4POGA 1VQ6A 5GAHC 5H1SE 5DLQE 1PH5A 3FHWA 1K73C 1Q1EA 4HIOA 1S40A 4NB3A 1PH1A 1NMGA 4A3EH 4L5SA 4B3RL 4P71A 2NVTH 4OO1I 2IX1A 1SE8A 1I50H 1TWCH 4YWMA 3J81j 2VNUD 1UE7A 4UPAA 4A3CH 1B8AA 3K7UC 1KHIA 5FJ8G 3TQYA 1PH4A 1CKMA 3CP0A 4JI4L 4DR1L 4A3IH 1GKHA 2I5MX 4KHZA 1TWGH 2F3IA 4POFA 2E2HH 4A3DH 3S16H 3HOWG 1AE3A 1XNRQ 4HIDA 1DGSA 4JI4Q 3PUVA 3MEFA 3U4VA 4DK6C 4DAMA 5M5YH 4A3KG 1X54A 1XPOA 3GTGH 2N49A 4JOIC 5IYCH 2Z6KC 4PZ8A 1VQDA 2RCNA 3NELA 1PH7A 2B63H 4DR6Q 4JI7L 4Y52H 4AYBE 2JA9A 1X6OA 1KXLA 2JA6G 3HOUG 2I5HA 1HNXQ 3PO3G 2NZOA 3UDXA 1CKNA 3A0JA 4OXPA 3HOVH 4BXXG 1MKHA 2OCEA 4DR5L 2UUCL 4TVAB 2E2JH 1Z47A 3T1YQ 4QQBX 4A3MH 2PQAB 1LM0A 3RLFA 4BA2I 2YYZA 3CW2C 4LUOA 4MNOA 2MO0A 4A75A 3M4PA 5JJIA 3CMEA 4XIGS 3T1YL 4A3FG 3ZJYC 3HKZE 3HOZG 3GTQH 3A74A 1A0IA 1GVPA 1N34Q 1VQJA 4X66Q 3RZOH 5C0XJ 1PH2A 3M4QA 1W3SA 1PH8A 2PQAA 1BKBA 4JI1L 1YNXA 4R4QA 2OWOA 3IRBA 3EIVA 2Q2HA 4R1JA 4DR2L 2Q2TA 1VQCA 1PA6A 4JI6Q 1J6QA 1X9NA 1YHQA 2NVXH 4BA1I 4GKJL 4YCWA 4OWTB 4GN4B 2EXDA 4LF5L 1N33L 2NN6G 5GQOA 3PO2G 2VUMG 3GD7A 2LXKA 4DV1L 1K8GA 3S14H 3KDFB 3CCEA 1WJJA 2R6GA 1IBKL 2VQEQ 2R7ZG 4DV2Q 1S3OA 2VQFL 2WAQE 4NPSA 4IO9A 1R9TH 2ZJQA 4LF9Q 1N32Q 3M7NA 4C3HH 1NY4A 3PCOB 4R4IA 3J80c 4A3JH 3BJUA 1SN8A 2K5NA 4LFCQ 4BBSH 4JI3Q 1L1OC 1Q12A 2D0OA 3H3VI 1VCIA 1S72A 5IT9c 5IYBG 4YHHL 2QA4A 2K75A 2WB1E 4A3DG 2VUMH 3KF6B 3K8AA 1KAWA 3PIPA 3F1ZA 4DR6L 1PH9A 2HIXA 4LF4Q 4LWCA 1Y1VH 1NTGA 3TS0A 1SLJA 2JEAI 2UXDL 2IHFA 2WP8J 1VQ7A 4L5RC 3CC4A 2JA7H 3BU2A 1AE2A 4A3BH 3GTKH 1K3RA 4P74A 1QUQB 1J5EL 1PH3A 5BR8L 2MNAA 1PHJA 5C4JH 1JJ2A 3AEVA 4AQYL 4K0KQ 2UUAL 1WYDA 4YWLA 2K52A 4X65L 4UY8C 1C7YA 3J81c 1U0LA 1KL9A 3PO3H 4KHPQ 4YCVA 2QGQA 1VQMA 4LF9L 5K36G 3M9BA 3S1MH 2ZTDA 4JCVE 3CCRA 2GVBA 3KLWA
chains in the Genus database with same CATH superfamily
3RNUA 1Y1VB 1DCZA 1NE3A 4FNFA 2CW0C 4JI8Q 3L2PA 1BNZA 5E1FA 1U4RA 2F0TA 3PUYA 4UP7A 1SYBA 4DUYQ 3BZDB 5KRUA 2HQEA 3I3CA 2NTSA 4DV1Q 2WAQB 4NXML 4OIKA 2IWHA 5IWAQ 1OTCA 1MBYA 3OWFA 1BBUA 3CQZB 3H0GB 3NTKA 5AJ3L 4KI0A 1EY4A 5D65A 2CQOA 1KDBA 5DAUA 1F9PA 2QILA 1KLUD 2A6HC 2BA1A 4L63B 4BY1B 1LTRD 1N36Q 2Q2UA 4DUZQ 3U9SA 5CBAE 2X6LA 4DGZA 3BVZA 1HNZL 1ONLA 3X3NA 3KFUA 3S1NB 2O5JC 4DNIA 2NTTA 5LMUQ 3HOVG 3NTIA 3H15A 4PZ7A 2RDGA 4KLKA 4IJLA 1D1IA 4K6DA 4JI5Q 4RG1A 4R4TA 4K5XA 1B53A 2AUJD 1KNEA 4HN7A 3S2HH 1JICA 4GLAC 5CV8A 2PMZE 4R4OA 4JI8L 3HOYH 1B1ZA 4QF4A 1GD7A 4RKLA 2XGTA 2XIWA 2E76C 1BUVT 2WFWA 2OTLA 2MFIA 2AUKA 4ZKBB 1TT2A 4FXDA 4BBSB 4C3JB 3HOUH 4IUQA 3RD4A 5EPJA 5ELNA 3T1HL 3TMEA 3M4OB 1ASZA 4O42A 1DOLA 4LF7Q 1WOCA 2L15A 4A3EB 1KD1C 2UUAQ 4Y7NH 1D5MC 3K81C 1HXYD 4GKKQ 4CJ1B 3NEMA 1C8CA 1GJXA 2NVXB 4IN3A 3GQBA 1HRJA 2AHOB 4AYBB 1EWHA 3EJIA 4L5TA 4A3EG 1GUWA 2UU9Q 3OW2A 1AH9A 3SDZA 1WCMG 3MEHA 1QNKA 5IE8A 5A2QL 2A19A 5C3XA 4RGOS 4JI1Q 3GTMB 4DV0Q 5I9PA 1FJGQ 2K50A 4EQNA 1UE5A 4OEMB 1Z6HA 5JJKA 1ENFA 5EPKA 3KF8B 5FKAC 1F77A 4RHSA 2XN9C 5DM73 4CKCA 4I65A 2ICIA 5HGQA 3VR2A 1I3QB 5C44G 3IFTA 2R7FA 1VQOA 5EKKA 3TP8A 1WTXA 1EUJA 2K05A 3S17B 2R7DA 1WFQA 1AEXA 4FVMA 3Q0AA 1G6PA 4C3JH 3HOUB 2F0LA 3R93A 3SXHA 2NVTB 3RN2A 1EY7A 4NW2A 4GNXA 3T16A 1VMCA 2R93G 5KEEA 4Y7NB 1LTGD 4XYOA 1SRUA 4DUZL 1FR3A 3UE0A 4IOCA 1LTSD 1SFOB 5COYA 2J0TD 5M9OA 3CCVA 1SJHD 4KY7A 4DV2L 4JI7Q 2JA7G 3RR5A 4DR3Q 3OTOL 4FP5D 2SOBA 2PZWA 1HR0Q 4APVA 1JOOA 4GNXB 1XJVA 1S5CD 2BDOA 4HMJA 3E9IA 3ULJA 5CORA 1QZHA 2QF7A 1D1KA 1YJNA 2IJ0A 3CHBD 2RF4A 1WTQA 2JSOA 1BCPF 3CQZH 3LX0A 3SK5A 4K8JA 2HUGA 2NN6H 4K0KL 1VDZA 3A5UA 1NBWA 1EY0A 3KBGA 2SNSA 4WJWA 1RODA 4IQZA 1X3QA 4IOAA 3L9AX 3NQIA 2QDLA 2XRSD 3A55A 2GVAA 2RDFA 1Q7YC 1EFWA 1VQAA 2UXBQ 4Q5VA 4JYAQ 3OOCA 1ENAA 4HAEA 3I8ZA 1PZKD 4BY1H 1STNA 2B2WA 3STBC 4GS3A 3PO2B 3DXJC 5C6AA 1Q81C 4WORA 1M90C 3JAMc 1AZQA 2E5LL 1K28A 1KQSA 1V43A 3NE5B 3GV3A 2K4KA 4CGYB 4EGVA 1HTPA 1A2TA 3S15H 2FXQA 2JA8G 4LF4L 2L5TA 1TWFH 1HFGA 1RTOA 1FL0A 4FXKC 4DR4L 3QG1A 5LMNL 3HOZB 4XXEA 4LFBL 3D0FA 2R7ZB 3UI2A 3WOEA 1OXTA 2B3GA 2PO4A 4L5QA 1E3PA 3FMCA 5A2QE 1FNUA 1FVIA 3JAME 2NZHA 1EZ6A 3VR4A 3A56A 5KNCA 2KOLA 5D3DA 1ICFB 1V8QA 3CC7A 2ASBA 1F9QA 1EYGA 3K57A 1ENCA 3JC66 4PV1C 2JA5H 1C0AA 5FO9B 2PYKA 4IPHA 5C4ZA 1H9KA 3OSOA 1OXXK 4V0BA 1J9OA 5IP7H 4DK0A 1WCMB 1CTMA 1VQEA 2LS01 4HEDA 4JG2A 5DEHA 2KUMA 4C3HG 4A3JB 1N8RC 3B6YA 1T5XD 4B3RQ 4PQXA 1OXSC 4HIKA 5IODA 3VYRA 1ZYRD 4H0LC 3KJPA 2RQXA 1EEID 5IYBH 3GDEA 1VQ5A 2ZM6L 2EZVA 1X56A 4DR1Q 4N9PA 5JEAJ 2A69C 5JJLA 3A7LA 2MUYA 2BH8A 3DEPA 4OGQC 1MHWC 5EJWA 1KAAA 4FDBA 2A6HD 2Q8TA 3V2TA 4LFAL 3EQLC 4OO1H 5IY0A 5KYIA 1SDFA 1EWIA 1IL2A 4BBSG 2R92B 2DGYA 2D62A 1C9OA 4JI2Q 4HJ8A 1V1OA 4DR7Q 2F52A 1QNUA 1EEFD 3S1QB 1A62A 1PFNA 1V1QA 1XPUA 4X65Q 3MAQA 1HZBA 5JVG3 1D6EC 2E2IH 2ES2A 3GTOB 4IJHA 1CSQA 2E5LQ 1HJPA 2WV6D 3HOVH 2GA4B 3D4WA 3DM3A 3PO2H 2C5CA 4JI2L 1TS5A 3PF4A 3I70A 2V1CC 1W6KA 3CAMA 4DR7L 3T13A 4XQNA 4J6HA 1BVSA 4HSVA 2F0JA 4H44C 1EIGA 1MD2D 3FHWA 3WOFA 1YNJC 2F0FA 4KMUC 3I91A 4P71A 5IT9E 1I50H 1TWCH 3J81j 4B08A 4DNRB 3URYA 3HGBA 1B8AA 3R3OA 4C3IB 1Y69U 1CA6A 4DR1L 1Q90A 1TWGH 5F2DA 2E2HH 3FPUB 4A3DH 1AE3A 1JOQA 2R93B 2L9HA 4V190 3J80L 4DK6C 4IUVA 5M3FB 1AW7A 4JOIC 1PH7A 1E0BA 1VQDA 2RCNA 3NELA 4Y52H 3MXNA 4AYBE 2MHVA 5LHY1 3VYSA 3UDXA 1ESRA 2KCNA 1CKNA 3A0JA 4R8IA 4BXXG 1L0YB 1G91A 4DR5L 4XDXA 1SE4A 2UUCL 4TVAB 3MA2B 4KN4C 1Z47A 3T1YQ 1B9NA 5CBEE 3KUPA 4ZUJA 2Q8IB 3RLFA 3MFYA 3EFXD 1S5ED 2EYJA 4KKSA 2EYMA 1QCBD 4PMCA 4ZKCB 3HOZG 3HS0C 3A74A 1GVPA 4X66Q 1PH2A 4JI1L 1YNXA 4R4QA 3TP7A 2OWOA 2EYLA 4CDDC 1VQCA 1YHQA 3IL8A 4CKBA 1JR0D 3MC0B 3GTPB 4HMIA 4YCWA 4GKJL 2TSSA 4KHVA 2R6GA 2VQEQ 1S3OA 2KCCA 2WAQE 5C44H 4X3SA 1N32Q 3K59A 4R4IA 4A3JH 3D4DA 1SN8A 3R2TA 2B2UA 1L1OC 1J8IA 2F03A 3H3VI 1S72A 3D3RA 4B9WA 4A3DG 2VUMH 3KF6B 2B63B 1KAWA 3OMGA 1PH9A 1JE4A 2UXDL 1Y1VH 3ITPA 1SLJA 2F0MA 2JEAI 2IHFA 1VQ7A 3NTHA 1EY6A 1AE2A 2J4XA 1U4MA 4ZUIA 1PH3A 1JJ2A 3AEVA 1AZPA 1RJTA 2UUAL 5BN5A 2BE5D 2HD3A 3M9BA 3S2DB 3ULLA 4KJOA 5CR3A 2YTXA 3STBD 1P16A 4P73A 1UEBA 2AQ3B 2DJGC 1N36L 4U68A 1EOTA 1WI5A 3OHXC 3I2ZA 1TWHH 3E0EA 3GTQB 1SBBB 4EQ5A 2AMCB 4P72A 5LMUL 4XQJA 3MXNB 1YBYA 1OO9B 4M1UB 4DXFA 1O7IA 2CWPA 3JAMi 1L0WA 1CQFA 2ZM6Q 1WTWA 5EPLA 1RHPA 1DYQA 4A3CG 4PZ6A 5I9OA 1EYAA 1CM9A 1LYLA 4JK1C 3CF5A 1CSPA 4DR3L 1I4XA 1N32L 2B8FA 3UDGA 1HQRD 2EDGA 3U9OA 3SGIA 1O7ZA 1PRTD 5A35A 3H94A 4UP8A 1VQHA 4DA2A 1VQGA 1FGUA 2KA7A 1V9PA 3DMUA 1EFID 3R2IA 2F3WA 2F4VL 4LFAQ 5KYLA 5IYDG 2YTVA 4HCSA 3GTMH 4N8FA 2Y0SE 2K1BA 3KOJA 2VXWA 3D4RA 2Z4IA 2JN4A 1TXYA 1K8AC 2UUBQ 2WACA 2EJGC 2Z1CA 5IP7G 3K5NA 3TSSA 1PV4A 1XMQQ 5FO7B 1LTTD 1VQFA 1XTDA 2EY5A 1EQRA 4OWXB 4YWKA 2PNHA 1T9HA 4BXXH 5ELBA 4A3GG 4JVZA 3FKIG 3I55A 4B3ML 4MTNA 1YZ6A 1ZXTA 3S24A 1PVOA 2N55A 3TS2A 2VB3X 2ENBA 4R8NA 3EVQA 5CMDA 4A93G 3MFGA 1YNND 2YV5A 3S14B 5G3LF 4L6TB 1Q86C 2JA5G 1TU2B 1Y1WH 3KLSA 1SR3A 1EQQA 1QUQA 2B2TA 3NK9A 2N3SA 1K8OA 2KHIA 4JBMA 3Q23A 2SNMA 4JW0A 1I4QA 1N34L 3P20A 1PH6A 4IUNA 3A54A 3K80C 4QUFA 3AMUA 1X32A 3D6WA 3HKSA 1X3EA 2F3VA 3IFDA 4JV5L 2P5ZX 1RIPA 4TSSA 1B7YB 4A3LG 1TY2A 2B29A 3C3LA 1X3FA 3GTKB 4CJ0B 1EY9A 2EYHA 4X64L 1SEBD 2CVRA 2LFNA 1TWAB 2F0DA 2UUBL 1T5EA 1XX8A 1EY8A 2XNAC 3FPPA 4CBVA 2JA8H 1QZGA 2H1EA 1HHVA 3CCMA 4YHHQ 4DV7L 1STEA 4H13C 4TRDA 4JBJA 2B2UC 1VQ8A 5CV7A 5K5PA 4BWGB 2IX0A 1B70B 1H9SA 1D5XC 1NNXA 1SNOA 2B39A 2ID0A 4KY6A 3QO2A 2ZXRA 4C1NK 4OO1G 4B3TL 4KTAA 2UXDQ 4DUYL 1UWVA 4GOPA 1TKWB 1MIUA 4B9XA 1GHJA 2NWGA 4LF5Q 4H02A 2OXPA 1SNQA 1X3GA 3MXGA 3DWAA 1V1PB 2EIFA 2D2CC 4QB4A 2XSCA 2I07B 2Q8RE 1WTHA 4DAPA 4A3JG 3K5OA 3BDOA 1RL2A 3G48A 5C0XI 2ZJRA 3TZUA 4GOPB 3PUWA 1EIYB 1UNSA 4J1MA 2NVYB 1B50A 1C48A 4N8X1 4EVOA 1S4ZA 4A3IB 3J80i 1RD9D 4HCEA 3HZXA 3PQIA 3VA5A 2O5IC 3HKZB 1LO5D 4Z9CB 3NSWA 1JMCA 3GO5A 3D8GA 2VQEL 1KDAA 3ERSX 5C4XH 4JBWA 3NBHA 2OQKA 3BVMA 2AWNA 3U50C 4CKEA 4HJ7A 2DNCA 3NP8A 1PTOF 2R3ZA 1KIXA 5JEAG 2CW0D 1R9TB 4OX9Q 2JK8A 2MPMA 1Q46A 2F1MA 3BDLA 2BCOA 3T1HQ 5GAGC 4QL5A 4ME5A 2EPBA 4HTHA 2Y0SB 2VL6A 5I6YA 4JOIA 4ALPA 1FJGL 1L1OB 3OW7A 1ET9A 4A3FH 2A5HA 5FLXc 4OHJA 1Y8PB 4KKTA 5C4XG 1G2TA 3TREA 1EIFA 1RCVD 4LAAA 2IHEA 2DN8A 1GM5A 4KK7A 3M4OH 3PUZA 1PRTF 2LSSA 1BXTA 4KJNA 1A6XA 1U4LA 3A7AB 3UDFA 3EA6A 2LXJA 4DNTB 5M3FH 4I7AA 1IBLL 2F4VQ 3S1NH 3V05A 3TN2A 4H7BA 1IKLA 4IZ8A 2L0CA 4LF8Q 3WWVA 2F0HA 5FLXE 4GLVB 4DN4M 4O0AA 1GUGA 2V4DA 3CCJA 1OXVA 1GUTA 4RCNA 4G7ZC 1PYSB 3HOYB 4F88A 1KABA 5I4DA 5IP9H 2WAQG 4LUZA 3W3AA 2ATWA 4K14A 4EQPA 4O1NA 1VF7A 5AFWA 3VR5A 1II3A 2JYOA 3RZDH 3GTOH 1PRTC 2E2IB 1B9MA 1NCVA 4A3GB 3SR1A 1XNQL 2KHJA 1KC8C 2HQLA 2KECA 2R93H 3H3VH 5G3LD 4A3MG 1VQLA 1SMXA 3MXUA 2VQFQ 1IBML 1JWUD 2YU9B 4JI0L 2KEDA 4DFAA 2K5VA 1K9MC 5IIFA 3NBHB 1SJED 5GROA 2IY5B 3TZDA 2PPBC 3E3XA 2WB1G 1HA5A 3SK4A 2JA7B 1IYJB 1U4PA 3UE1A 4J8QA 2TMPA 3G71A 4DV3L 4EQOA 3NWSA 1PZJD 2B63G 4MHEA 1JE5A 1UAPA 2FJ2A 4GKJQ 3C1EA 4JI6L 4FF4A 5EKIA 3HP3A 3CCSA 4GZYC 4ZAIA 1SYEA 5DLQE 4YIJA 1PH5A 1K73C 2F0OA 4A3EH 4JPBW 2NVTH 4HSPA 4YWMA 1YNNC 5C3WA 1QOHA 1UE7A 5J22A 4UPAA 2F0SA 5CV6A 1LT4D 5FJ8G 1PH4A 3X3MA 2B2YC 1WTPA 4A3IH 2RSNA 2F3IA 2F4IA 3TDQA 4LMQD 4JI4Q 4C2MB 3VYTA 5M5YH 4A3KG 1X54A 1XPOA 5IYCH 2Z6KC 1FD7D 2B63H 4C1NI 4X3TA 1LTAD 1X6OA 3HOUG 2QCPX 2AQ1B 3AU7A 1F9SA 2OCEA 5DNFA 2E2JH 4IUPA 4DK1A 1K0SA 2QW7A 1QWYA 1SYCA 3CMEA 3T1YL 3Q6SA 4A3FG 3PO3B 3CRLC 3QOJA 3GTQH 2PZTA 3GTGB 2LMCB 4LK1C 1CI3M 1O7LA 2PQAA 1VF5C 4G7OC 4G4KA 3IRBA 4MIUA 3H91A 2Q2TA 1PA6A 4JI6Q 1J6QA 4BA1I 2K33A 2CH4A 1PTOD 1STGA 2NN6G 2F0NA 3KDFB 4IURA 2VQFL 4NPSA 4LF9Q 4X3UA 3PCOB 3J80c 3BJUA 2K5NA 4LFCQ 4XT1B 1VCIA 2K32A 1M4VA 4F8MA 1ET6A 4YHHL 4UHVA 2K75A 1UUPA 1B3AA 3K8AA 3K58A 2WKDA 3PIPA 3F1ZA 4LF4Q 3OIQA 2WP8J 3VYUA 2JA7H 3CC4A 4PNYA 4P74A 4UDUC 3WDNA 1QUQB 1A2UA 1J5EL 2MNAA 5EBDA 2M2LA 4AQYL 4K0KQ 2PW5A 1WYDA 2K52A 2X69A 4X65L 4UY8C 1U0LA 1CHQD 3PO3H 4KHPQ 2QGQA 1A15A 1VQMA 2ZTDA 2L11A 1LTBD 4RAUC 3CCRA 3VA7A 3LWUA 5IP9G 2QA4A 1D8LA 4HJ9A 2CCZA 1ILQA 1HA6A 4BBRG 1IZ6A 3A8JE 3BG3A 4F87A 3J7A5 3H0GH 2ALYB 4A3KB 2KCMA 4LJZC 1G51A 3ER0A 3F2DA 1GUOA 4K6LA 2PMZB 3L7ZC 3DHQA 1W2BA 1A3UA 4ME3A 5GADC 5EGTA 1HUMA 1I94Q 4ULLA 4LUVA 4WJ3M 1LUZA 2CQAA 2JP1A 1HZ9A 4IUUA 2E75C 2XRQD 1CKOA 2AWOA 3I4MB 2A69D 4DK3C 5M5WB 1CZGA 3HOXG 5BN4A 3CMAA 4X66L 2R7ZH 4WFN3 4C3HB 2K03A 3U58A 2K5HA 1UEAB 5C5MA 2R92H 1I6VC 1SE3A 2UXCQ 4DV4L 2K5DA 2DNEA 3GTLH 4DR2Q 1HR0W 1ZKOA 2UUCQ 4DV6Q 4A76A 4A3DB 4RKBA 5C3EB 3T4AC 1DOMA 2ZJPA 3KK7A 4GLXA 4AH6A 3GTJH 1Y14B 4BY7H 1HQMC 1EOVA 3FDTA 4DKAC 1NJIC 1WCMH 5JEAH 4OX9L 2F0WA 1IYUA 2N8NA 3MTSA 4JBKA 1JCKB 4LF6L 1U9RA 2YU9H 4C2MH 4MZ9A 3QR8A 1S5FD 1R4QB 1UE6A 1SFOH 4FXGC 4X3KA 4IFDG 3CXCA 1PXUA 2HCCA 4IPDA 2AQ2B 1EWCA 2M9VA 3W5OA 2BH2A 3VR6A 4M8AA 3C46A 1N33Q 2PI2A 4QUCA 1TS4A 3TP6A 1XNRL 3EBEA 3QB3A 3S1RH 2F0PA 1NMFA 1I4RA 4KD3A 4DR4Q 2L12A 4JYAL 1JJGA 1XYIA 4JI0Q 1B4OA 1IBKQ 1QJOA 5C44B 1YIJA 3HOYG 1HTLD 4KV6A 1M8AA 3ZYYX 3CCLA 3G4SA 2DJFC 3I4LA 2CFMA 1B44D 1JWMD 2NVYH 5C3EG 3S1MB 5J1ZA 3JAML 2NVQB 5M3MH 1JC7A 1FYCA 2IL8A 3F8TA 3IKJA 5C3EH 1FGBD 3KF6A 2MGSA 1M1KC 1E24A 4B3TQ 1D5ZC 1SNDA 3K6OA 1LT6D 2DY7A 3OMCA 1EY5A 3PIO3 5C0XH 4IFDI 5KNDA 1DZ1A 4DV5Q 3I4MG 2XWBB 3OTOQ 3KLRA 4DAYB 4IPCA 5E7NA 1YITA 1Y1WG 1B2TA 4QIWE 3S16B 5ELOA 5AJ3Q 4EX5A 1H9RA 1W6JA 3G6EA 3S2HB 3SEBA 4A93H 1KLGD 5IGEA 1HZCA 5ELDA 4O2DA 1E2ZA 4A4IA 2KENA 1QG7A 2F0EA 3E9HA 3M85A 1LTID 3E0JA 4OELB 3N52A 2MJ8A 3Q8DA 2Z6KA 1H9SB 1DM0B 4JC0A 3T51B 2ZXPA 5ISRA 1MJEA 2BOSA 1D7QA 3RLOA 2EVBA 1KRSA 4IALA 4ILWA 1K3BC 4NMZA 2MO1A 4DPGA 3NWTA 4A3IG 1MSGA 1SMYC 1ZEQX 2E8GA 2R92G 2NZ1D 4RHRA 4IFDH 3HG9A 1TIID 3PSIA 4YY3L 5T1IA 1JT8A 4ZRZA 1K8MA 3I56A 1BQQT 4ABNA 5FO8B 1ASYA 3PIOA 4NDXA 1VQ9A 1HNWQ 1PTOB 1OXUA 1PTOC 1XPRA 1I4GA 2EE1A 3GTLB 4OIJA 2ZTCA 3LNNA 4CDCC 1A3TA 4A93B 4IPGA 1I3QH 3RLNA 3RZDB 2ICEC 4JI3L 1EU4A 3J7AV 3CU7A 2L4NA 2ZXOA 3M4YA 3PV0A 2M00A 3J7AF 5C4JB 1O78A 2L1BA 2VZAA 1B3QA 4RWSC 1YHAA 1KRTA 2KBNA 5M3MB 4TQUS 5EAYA 3VDYA 2RKSA 4GKKL 4AQYQ 1K83H 3I72A 3I7FA 1XMOL 1BBXC 1I94L 2B2WC 1PYBA 1Y8OB 1I4HA 4KN7C 4PG3A 1XWEA 3AQQA 1GXDC 2E74C 2EY2A 5M5YB 1RDPD 4LF8L 4DAYA 4K2KA 5ELCA 4RA8A 1QILA 3PGZA 4BBRH 1IBLQ 1O7YA 3AB9A 3ULPA 4BY1G 3DWPA 3RN5A 3NENA 1WVLA 1RTNA 3V96A 3J81i 3K5LA 2D5DA 2YTYA 5IGDA 3F2CA 4MN3A 1BDOA 1XMOQ 1JWSD 1YJWA 1IKMA 1E1OA 1GUSA 2NN6I 4QJFA 2F0KA 1IYVA 5J39A 1HZAA 2KHSA 1STYA 1VMPA 1Q8IA 4A3BB 1SYFA 5BN3A 1IW7D 4C3JG 1STAA 2K5WA 4UAIA 2AKWB 1MJCA 4C3IG 1Y1VG 1BF4A 2WIIB 2JE6I 1Q1BA 2RA4A 2IT1A 4K5WA 5ELFA 4IUTA 4GN5A 3HOXH 2K5QA 3FVQA 1LT3D 1CK1A 2A1AA 3M3YH 2NYZD 1WTVA 2B2YA 3J7YW 3K0XA 1E1TA 4CHTB 1CA5A 1I6HH 1SROA 3W1BA 2RHSB 1YVCA 3W1GA 3D31A 1ESFA 4N9TA 4BS9A 3I4OA 5FJ8H 4S3SA 3SK6A 1F2LA 3I4NG 4HJ5A 2OF1A 1I4PA 2CH4W 3KBXA 2K01A 1X65A 5JAVA 3A8IE 4UP9A 2JA5B 3ONAB 5FK9C 3OWEB 4TKOB 3CCQA 3DLLA 3SHLA 1SSOA 5BR8Q 3AFQA 5JVH3 4POGA 1SYDA 5GAHC 3J80E 1TS3A 3MVVA 1S40A 4NB3A 1PH1A 4B3RL 1TR5A 1TQOA 1DOKA 3R8BA 3TBIB 2VUMB 1PTOH 2RBMA 2DY8A 4RCOA 4QMGA 4KKUA 3TQYA 3CP0A 1QB5D 3P7JA 4JI4L 5IT9L 1GKHA 2I5MX 4KHZA 4POFA 2QDBA 1Y8NB 3DUZA 3Q22A 2EXZA 1H9JA 4ID6A 4KD4A 4HIDA 1DGSA 3PUVA 3KLSX 3MEFA 1CT1D 3S9WA 2B2TC 4DAMA 2N49A 2RDHA 2OEOA 5TSSA 4DR6Q 2E2DC 2KEEA 2JA6G 1HNXQ 4BBRB 2NZOA 2A6ED 4OXPA 4WRDA 1MKHA 2FFKB 5L37A 4RGTA 2NUCA 1JQYD 4QQBX 4A3MH 2PQAB 2Z8LA 4BA2I 4A75A 1TWGB 3M4PA 2E2HB 5JJIA 4XIGS 1F9RA 2EY1A 3DEOA 2RVLA 4RGNA 3MHBA 1A0IA 1N34Q 3C2PA 3RZOH 5C0XJ 3M4QA 1HPCA 3EROA 1W3SA 5I2YA 3EIVA 2Q2HA 4R1JA 1MI2A 3K7AB 1X9NA 2O2LD 2B8GA 4OWTB 4GN4B 4LF5L 1N33L 1ML0D 4QIWB 5GQOA 3GV6A 3PO2G 3SVMA 4DV1L 2LXKA 1XTCD 5JPNC 1RF2D 3CCEA 1IBKL 1HCZA 3NUCA 1R9TH 4ODGA 3M7NA 1NY4A 4ZCKA 1EYCA 1Q12A 2SDFA 1GOZA 5DM63 5IYBG 2NBFA 2A74C 1ICWA 4FF2A 4DR6L 2HIXA 2G9DA 4LWCA 1NTGA 3TS0A 3BU2A 4P2CB 1JORA 2OT2A 4RH6A 2XVSA 3BS1A 5HURA 2K04A 1PHJA 5C4JH 5C4HA 2Z9HA 1S5DD 2EJFC 1V1PA 4YWLA 4A3FB 3OIPA 1KDCA 4YCVA 5KNBA 3QWNA 4LF9L 3S1MH 2GVBA 5FLMG 3KLWA 1SE2A 3GP7A 5C4XB 1WTRA 4LW1A 1JJCB 5D3IB 3CCUA 5M3FG 5J3BA 1X55A 3NBIA 3EN2A 5IYCG 5K36H 1C4QA 3W2DA 3TP5A 4DV3Q 1IXRA 4LNQA 3QIAA 1VQBA 5I6WA 4XYQA 3PIP3 1NUCA 4ZK9B 2KCTA 3ICEA 5CYUA 1EQVA 2EYFA 1SNPA 2K6AA 2A68D 3TRZA 5CV9A 2HIVA 5CGKA 1G8ZD 4K8IA 3TEHB 4HR7B 2NB0A 1U5KA 2XWJB 2GN5A 1YI2A 4LF7L 3RZOB 2UXCL 1VS0A 4DXGA 5KGUA 4GOPC 2B2VC 1SNCA 1G2SA 3OPOA 1BBWA 3H0GG 2RSOA 2XTIA 3T53B 3HFZB 3K0YA 2WKCA 1PFBA 5IWAL 1ZYRC 1VQNA 4RMFA 5EKLA 4R9WA 2E2JB 3NXWA 3UDIA 3ND9A 3NHHA 2PW7A 1DONA 3E5SA 1YEZA 2JA6H 5E4XA 1CQVA 1HH2P 5IGFA 3CPWA 2JXMB 1IW7C 2N88A 1Q8KA 1VQKA 2K14A 3MZ5A 1VQ4A 2K28A 1EQTA 3BYYB 4FF1A 2LY7A 4NXMQ 1I5FA 4AIMA 1PFSA 3K7AH 2KVMA 4JV5Q 5IOCA 3BDCA 2EQSA 2JQOA 5FLXL 1LTLA 1HNXL 1DXMA 1EU3A 2D0PA 3PUXA 1RKNA 1VQIA 2B2VA 1N9WA 1IBMQ 4X64Q 3LWEA 2D9UA 1P8LA 2H4OA 2Q2IA 3RUZA 1L0XB 1L1OA 4NXNL 1WD1A 4LF6Q 3HOWH 4X6AH 3QOLA 2ZTEA 4DF7A 2I5LX 1WTOA 4GNXC 1TWAH 4CJ2C 4DV7Q 4RGMA 1G6ZA 4YY3Q 3J7ZC 4G57A 1SXTA 2PQEA 2I46A 4B3SL 2JJQA 4NKLA 2X6GA 4DV6L 4DV0L 1Z9FA 3SE0A 1A8VA 2K7VA 3HRZC 4U673 2RHQB 1HNWL 1I50B 1TWCB 1CFMA 1BCPC 1QVCA 2QEXA 3I73A 1YNJD 3PF5A 5D14A 4GN3B 3QJYA 2JA6B 4QY7A 3FEWX 1R4PB 3FKIH 4OWWB 1EZ8A 4CDEC 3I4NB 2H5XA 1LABA 4DV4Q 4PMBA 4FO2A 5IGBA 3AFPA 4C3IH 1STHA 4I7ZC 3L0OA 5LL6S 3P1HA 4B3MQ 4K2LA 3H09A 1NR2A 4A3KH 3KDFA 3BVGA 1DD2A 2PZUA 2HHHQ 4P75A 2A6EC 1LT5D 4DV5L 1F2YA 3I90A 5FLMH 3AYHB 2UU9L 4DAVA 3A5ZB 2OQ0A 2A73B 2F0IA 2O4XA 3DM1A 1LLRD 4XT3B 3MWYW 1PFMA 1H95A 3LGJA 3OYYA 2Y0SG 2DUDA 3SK8A 1QVGA 1J5EQ 5LMNQ 1STBA 3KYHC 3HOXB 4K5VA 3VR3A 3I4MH 1PDQA 3DWQA 4J15A 4FYDA 1CHPD 4DR5Q 3S17H 2HDMA 1F2ZA 1F2MA 1G291 1GO3E 2F0GA 4HIMA 1UE1A 5CC4A 3KF8A 1AN8A 2G9HD 2EY6A 1I6HB 2CKZB 3N6RA 3K5MA 4OONA 1VQPA 2I0QA 5NUCA 1K83B 4HJAA 2VS1A 2EOTA 1E2VA 2C35B 3NPPA 3O13A 5M3MG 2VW9A 4LFCL 1ILPA 1BO0A 2KJXA 2F0VA 2VY3A 5E3FA 1BCPB 1EYDA 1JB3A 1E22A 3D6CA 5EQ0A 5KIXA 3GTJB 4L8JA 1CUKA 1HNZQ 4KY5A 4X62Q 1XNQQ 3S2DH 5IGCA 5C0XG 2ZT9C 1HR0L 2WINB 4C56C 1IL8A 3GTPH 2BE5C 4FF3A 2HHHL 4JI5L 5IGGA 3F2BA 2OTJA 5M5XH 2F0UA 2MQHA 3F2UA 1E7ZA 2BA0A 4A3LH 1GHKA 2EYPA 3A8KE 2Z4HA 5C5LA 1AP0A 5M5WH 5CV5A 1BOSA 1DJRD 1QVFA 1K0RA 2IX3A 1A63A 1IHZA 3HOWB 1HFNA 2F0QA 3M7GA 4QGUA 2C9OA 2HT1A 3I4NH 3CC2A 4G7HC 1TWHB 1TVXA 4A3GH 3L3OC 4MTKA 4AYBG 4NP5A 1XMQL 1KNAA 3ND8A 1PMRA 4OL7A 1TS2A 2A68C 4R4CA 3S15B 2IW3A 3CRKC 4ZLTF 2CHBD 3U4ZA 1LV9A 5GAEC 5LMNW 3P75A 4YCUA 1TWFB 3KJOA 5JJZA 1NAPA 4IFDJ 5JPMC 3M3YB 3J81L 3BYTB 1NR4A 5IYDH 3HOZH 1MSHA 2SEBD 4PMWA 4XTCS 4A3BG 2FMCA 4ZQ3A 1JB7A 3C1FA 4BY7G 3E6ZX 1CKNB 2PCFB 2UXBL 2R61A 2CWAA 3FP9A 1Y1WB 2BDNA 1S5BD 3S1RB 4KHPL 1PLFA 1H9MA 2LKVA 2EYOA 3HKZG 1PYWD 4BY7B 4A3MB 5ELEA 5LL6X 5HGTA 5HY6A 4NXNQ 1L2FA 1YHBA 3BZKA 4B3SQ 2A8VA 3H3VC 4XQQA 1SYGA 4WJ4A 3NQTA 2PI2E 2PNRC 1YJ9A 2Z0SA 3CPFA 1WD0A 2NVQH 3CKIB 3S1QH 3CD6A 2N78A 2QEJC 1Q82C 4QCLA 3BZCA 2J7ZA 4LFBQ 2JEBI 4X62L 1VQ6A 5H1SE 1Q1EA 4HIOA 4L5SA 1NMGA 4OO1I 1SAPA 2IX1A 1FNVA 1SE8A 2VNUD 3FRPB 1A3VA 4A3CH 5EBCA 3K7UC 1KHIA 1CKMA 2RCFA 3MXPA 3S16H 3HOWG 1XNRQ 2IPKD 5M5XB 4ZYSA 1PZID 3U4VA 3GTGH 4RFBA 3FKIB 4PZ8A 1AFPA 4JI7L 2JA9A 1KXLA 3RMHA 2I5HA 3PO3G 2WB1B 1FNWA 4Q0FA 3IAYA 1BR9A 2HCIA 5T1GA 1LM0A 2YYZA 3CW2C 4LUOA 4MNOA 1BCPD 2MO0A 2FINB 3HOVB 2HDLA 1XXGA 3G7LA 3ZJYC 4CDFC 1SMYD 3HKZE 1HUNA 5FOBB 1EL0A 1VQJA 3ERQA 4F7XA 2L55A 1PH8A 1BKBA 2JA8B 1O80A 3H6MA 1JOKA 4DR2L 2VB2X 1QE6A 1LACA 2NVXH 5JOBA 1TY0A 5CV4A 2EXDA 2FHTA 2G5DA 1MGSA 3GD7A 1K8GA 2VUMG 3S14H 4DU9A 4E6IA 1WJJA 2R7ZG 4DV2Q 4IO9A 2ZJQA 1KTKA 3J81E 1E2WA 2QKIC 4C3HH 1PRTB 4BBSH 4JI3Q 3PMFA 2Z6BA 2D0OA 5IT9c 1D2BA 2EJMA 3T56B 5I2XA 2WB1E 5E4WC 3HEJA 4L5RC 4A3BH 3GTKH 1EIHA 1K3RA 3Q24A 2MP1A 2KQ3A 5BR8L 1NSNS 2FMMA 1Q3LA 1SNMA 1GUNA 3G6JB 1C7YA 1CZWA 3J81c 1KL9A 1Z7TA 5K36G 4JCVE 1X3PA
chains in the Genus database with same CATH topology
3ULLA 1D8LA 4HJ9A 2CCZA 3RNUA 4BBRG 2YTXA 1IZ6A 3STBD 1NE3A 1P16A 4LW1A 4P73A 1UEBA 4JI8Q 3L2PA 1JJCB 1N36L 3J7A5 3CCUA 1WI5A 3H0GH 2ALYB 5J3BA 1X55A 2KCMA 3I2ZA 1TWHH 3E0EA 3PUYA 5M3FG 3HOWH 1G51A 3ER0A 4UP7A 3EN2A 4EQ5A 5IYCG 3F2DA 4DUYQ 2AMCB 4P72A 4DV3Q 3L7ZC 5LMUL 1IXRA 4LNQA 3MXNB 1W2BA 1YBYA 4ME3A 1VQBA 5GADC 4DV1Q 1O7IA 2CWPA 3ICEA 1I94Q 2KCTA 4NXML 4LUVA 1L0WA 3JAMi 2ZM6Q 4WJ3M 1LUZA 1HZ9A 5IWAQ 1CKOA 2AWOA 4PZ6A 1OTCA 4A3CG 3TRZA 1LYLA 3CF5A 1CSPA 4DR3L 2HIVA 4DK3C 1N32L 1BBUA 5AJ3L 4KI0A 3UDGA 3HOXG 2CQOA 3CMAA 4X66L 2R7ZH 3SGIA 3TEHB 3U58A 2BA1A 2K5HA 4UP8A 1VQHA 2R92H 1U5KA 1FGUA 1VQGA 1N36Q 2Q2UA 4DUZQ 2UXCQ 2GN5A 1V9PA 1YI2A 4DV4L 3GTLH 4DR2Q 4LF7L 2F4VL 1HR0W 1HNZL 4LFAQ 2UXCL 1VS0A 3KFUA 2UUCQ 5IYDG 4DV6Q 4A76A 4DNIA 2YTVA 5LMUQ 3GTMH 4GOPC 2Y0SE 3KOJA 2ZJPA 3HOVG 3H15A 4PZ7A 4AH6A 1BBWA 4GLXA 1TXYA 1Y14B 3H0GG 4IJLA 4KLKA 3GTJH 2XTIA 1K8AC 1EOVA 2UUBQ 3HFZB 4BY7H 4DKAC 1NJIC 1WCMH 4JI5Q 4RG1A 4R4TA 5IWAL 5IP7G 4OX9L 4RMFA 1VQNA 2N8NA 3S2HH 4GLAC 4JBKA 4LF6L 2PMZE 4R4OA 4JI8L 1XMQQ 1PV4A 2YU9H 4C2MH 3HOYH 1VQFA 4MZ9A 3UDIA 1GD7A 1XTDA 2XGTA 4OWXB 1EQRA 4YWKA 1UE6A 1SFOH 2WFWA 2PNHA 1T9HA 3CXCA 2OTLA 2MFIA 4IPDA 4BXXH 4IFDG 4A3GG 3W5OA 3FKIG 2BH2A 1YEZA 2JA6H 3HOUH 1HH2P 3I55A 4B3ML 3CPWA 5ELNA 3T1HL 1N33Q 2PI2A 1Q8KA 1ASZA 4MTNA 1VQKA 1XNRL 1YZ6A 4LF7Q 1WOCA 2K14A 2L15A 1VQ4A 3EBEA 2UUAQ 1KD1C 3S1RH 4Y7NH 1NMFA 3S24A 1PVOA 3K81C 4DR4Q 4NXMQ 1I5FA 4AIMA 1PFSA 3K7AH 4GKKQ 3TS2A 4JV5Q 3NEMA 5FLMG 2EQSA 2JQOA 4A93G 4JYAL 1HNXL 1LTLA 1JJGA 2D0PA 3PUXA 4JI0Q 1VQIA 1IBKQ 1N9WA 2AHOB 1YIJA 2YV5A 1IBMQ 3HOYG 4X64Q 3CCLA 1Q86C 4L5TA 2Q2IA 1P8LA 3G4SA 4A3EG 1Y1WH 1L1OA 4NXNL 2JA5G 1SR3A 1EQQA 1QUQA 3OW2A 2UU9Q 4LF6Q 4X6AH 1AH9A 2CFMA 2ZTEA 1WCMG 2NVYH 5C3EG 2N3SA 2I5LX 2KHIA 5IE8A 1TWAH 5M3MH 4GNXC 4JBMA 2A19A 4DV7Q 3F8TA 5C3EH 4YY3Q 4JI1Q 3KF6A 3J7ZC 4DV0Q 1N34L 1PH6A 1M1KC 3K80C 1FJGQ 1E24A 4B3TQ 3HKSA 4B3SL 2JJQA 2K50A 4DV6L 1UE5A 1X3EA 4DV0L 1Z9FA 5JJKA 1A8VA 4JV5L 5C44H 3KF8B 1RIPA 2RHQB 4IFDI 5HGQA 1B7YB 1HNWL 4A3LG 2B29A 4DV5Q 1X3FA 5C44G 3I4MG 2R7FA 1VQOA 1QVCA 3OTOQ 4DAYB 2QEXA 1EUJA 4IPCA 5E7NA 4X64L 2R7DA 1WFQA 1YITA 1Y1WG 3PF5A 2UUBL 4GN3B 2JA8H 4QIWE 1G6PA 5ELOA 4C3JH 4QY7A 5AJ3Q 1QZGA 4EX5A 3G6EA 3CCMA 4YHHQ 3FKIH 4DV7L 3RN2A 4OWWB 4A93H 4GNXA 2H5XA 4JBJA 2R93G 4DV4Q 1HZCA 1VQ8A 3AFPA 4C3IH 1SRUA 4O2DA 3UE0A 4A4IA 4DUZL 4IOCA 2IX0A 1B70B 2KENA 2ID0A 3E9HA 3CCSA 1MJEA 3M85A 3CCVA 3L0OA 4OO1G 4B3MQ 4B3TL 3Q8DA 4DV2L 2UXDQ 4JI7Q 2Z6KA 2JA7G 4DUYL 1UWVA 3RR5A 4GOPA 4A3KH 1MIUA 3KDFA 2HHHQ 4P75A 4JC0A 4DR3Q 4LF5Q 4H02A 3OTOL 1HR0Q 4APVA 4DV5L 4GNXB 1D7QA 1X3GA 3RLOA 1XJVA 2EIFA 1KRSA 3E9IA 5FLMH 2MO1A 3AYHB 3ULJA 2UU9L 1QZHA 4DPGA 4A3JG 1RL2A 3A5ZB 4A3IG 2OQ0A 1YJNA 3G48A 5C0XI 2ZJRA 2E8GA 2R92G 4GOPB 2RF4A 3PSIA 3PUWA 4YY3L 1EIYB 3CQZH 1JT8A 1H95A 3LGJA 3I56A 4K0KL 3OYYA 2Y0SG 1ASYA 2DUDA 3A5UA 1QVGA 1NBWA 3J80i 1J5EQ 3PIOA 5LMNQ 3KYHC 1VQ9A 3I4MH 4J15A 4IOAA 4DR5Q 1HNWQ 3S17H 1OXUA 1G291 1XPRA 1GO3E 4HIMA 1JMCA 2GVAA 3GO5A 1Q7YC 1EFWA 1VQAA 1UE1A 2VQEL 3ERSX 2ZTCA 4JBWA 5C4XH 4JYAQ 2UXBQ 2OQKA 2CKZB 2AWNA 3U50C 4OONA 4HJ7A 1VQPA 4BY1H 2I0QA 4IPGA 4GS3A 1I3QH 3RLNA 3STBC 2VS1A 4HJAA 5JEAG 1Q81C 1M90C 4JI3L 3JAMc 2E5LL 4OX9Q 2JK8A 2C35B 1Q46A 5M3MG 2VW9A 4LFCL 1KQSA 1V43A 3T1HQ 5GAGC 2K4KA 4QL5A 2VY3A 3PV0A 1KIXA 3S15H 2FXQA 2VL6A 4JOIA 4ALPA 2JA8G 1FJGL 1E22A 1L1OB 4LF4L 2VZAA 4A3FH 1TWFH 5FLXc 1YHAA 1CUKA 1KRTA 2KBNA 1HNZQ 5C4XG 4TQUS 5EAYA 1FL0A 4DR4L 3VDYA 5LMNL 3TREA 1EIFA 4X62Q 4GKKL 2IHEA 1XNQQ 4AQYQ 1K83H 3S2DH 1GM5A 4LFBL 5C0XG 3I7FA 1HR0L 3PUZA 3M4OH 1XMOL 3GTPH 3D0FA 2LSSA 1I94L 1PYBA 2HHHL 4JI5L 3F2BA 1OXTA 2B3GA 4PG3A 3AQQA 4L5QA 1E3PA 2OTJA 1FVIA 5M5XH 2MQHA 2NZHA 3UDFA 1E7ZA 2LXJA 2BA0A 5M3FH 4A3LH 3CC7A 1IBLL 4LF8L 2ASBA 5M5WH 1EYGA 2F4VQ 3S1NH 1QVFA 3JC66 1K0RA 3PGZA 4BBRH 2JA5H 1C0AA 1IBLQ 4LF8Q 1A63A 3ULPA 4IPHA 4BY1G 3WWVA 1OXXK 3RN5A 4QGUA 3NENA 2HT1A 5IP7H 4GLVB 3I4NH 4O0AA 3CC2A 3J81i 4JG2A 1VQEA 1N8RC 3CCJA 2YTYA 3F2CA 1OXVA 3B6YA 4A3GH 4B3RQ 1XMOQ 1OXSC 4HIKA 1PYSB 4AYBG 1YJWA 1XMQL 3KJPA 5IYBH 1E1OA 2NN6I 4QJFA 3GDEA 1VQ5A 2ZM6L 1X56A 5IP9H 4R4CA 1HZAA 2WAQG 4DR1Q 4LUZA 2ATWA 5JEAJ 3U4ZA 5JJLA 5GAEC 5LMNW 2BH8A 4YCUA 3KJOA 4FDBA 3RZDH 4IFDJ 3GTOH 4LFAL 5IYDH 5IY0A 3HOZH 2AKWB 4BBSG 1EWIA 1MJCA 1IL2A 1XNQL 4PMWA 2KHJA 4XTCS 1KC8C 4A3BG 2HQLA 1JB7A 2DGYA 2D62A 1C9OA 1Y1VG 4JI2Q 2R93H 4BY7G 4HJ8A 3H3VH 1CKNB 4DR7Q 2F52A 4A3MG 1VQLA 1SMXA 2JE6I 2UXBL 2VQFQ 1IBML 2CWAA 1Q1BA 3FP9A 2IT1A 1A62A 4JI0L 4GN5A 4KHPL 3HOXH 1V1QA 2K5VA 1K9MC 5IP9G 3NBHB 4X65Q 1XPUA 3HKZG 5GROA 2IY5B 2A1AA 1HZBA 2E2IH 2ES2A 3M3YH 2WB1G 4IJHA 1CSQA 3K0XA 2E5LQ 1E1TA 1HJPA 1I6HH 1IYJB 5HY6A 1SROA 3W1BA 1L2FA 2RHSB 1YHBA 1YVCA 3UE1A 3D31A 3W1GA 3BZKA 4NXNQ 3DM3A 4B3SQ 2A8VA 3PO2H 3G71A 4DV3L 3I4OA 5FJ8H 4WJ4A 2PI2E 1YJ9A 2Z0SA 3CPFA 2NVQH 2B63G 3I4NG 4JI2L 4HJ5A 3CD6A 2V1CC 2N78A 1JE5A 3PF4A 3S1QH 1X65A 3CAMA 4DR7L 4UP9A 1Q82C 4GKJQ 4JI6L 3BZCA 4LFBQ 3CCQA 2JEBI 3DLLA 5BR8Q 1BVSA 3AFQA 4X62L 4POGA 1VQ6A 5GAHC 5H1SE 5DLQE 1PH5A 3FHWA 1K73C 1Q1EA 4HIOA 1S40A 4NB3A 1PH1A 1NMGA 4A3EH 4L5SA 4B3RL 4P71A 2NVTH 4OO1I 2IX1A 1SE8A 1I50H 1TWCH 4YWMA 3J81j 2VNUD 1UE7A 4UPAA 4A3CH 1B8AA 3K7UC 1KHIA 5FJ8G 3TQYA 1PH4A 1CKMA 3CP0A 4JI4L 4DR1L 4A3IH 1GKHA 2I5MX 4KHZA 1TWGH 2F3IA 4POFA 2E2HH 4A3DH 3S16H 3HOWG 1AE3A 1XNRQ 4HIDA 1DGSA 4JI4Q 3PUVA 3MEFA 3U4VA 4DK6C 4DAMA 5M5YH 4A3KG 1X54A 1XPOA 3GTGH 2N49A 4JOIC 5IYCH 2Z6KC 4PZ8A 1VQDA 2RCNA 3NELA 1PH7A 2B63H 4DR6Q 4JI7L 4Y52H 4AYBE 2JA9A 1X6OA 1KXLA 2JA6G 3HOUG 2I5HA 1HNXQ 3PO3G 2NZOA 3UDXA 1CKNA 3A0JA 4OXPA 3HOVH 4BXXG 1MKHA 2OCEA 4DR5L 2UUCL 4TVAB 2E2JH 1Z47A 3T1YQ 4QQBX 4A3MH 2PQAB 1LM0A 3RLFA 4BA2I 2YYZA 3CW2C 4LUOA 4MNOA 2MO0A 4A75A 3M4PA 5JJIA 3CMEA 4XIGS 3T1YL 4A3FG 3ZJYC 3HKZE 3HOZG 3GTQH 3A74A 1A0IA 1GVPA 1N34Q 1VQJA 4X66Q 3RZOH 5C0XJ 1PH2A 3M4QA 1W3SA 1PH8A 2PQAA 1BKBA 4JI1L 1YNXA 4R4QA 2OWOA 3IRBA 3EIVA 2Q2HA 4R1JA 4DR2L 2Q2TA 1VQCA 1PA6A 4JI6Q 1J6QA 1X9NA 1YHQA 2NVXH 4BA1I 4GKJL 4YCWA 4OWTB 4GN4B 2EXDA 4LF5L 1N33L 2NN6G 5GQOA 3PO2G 2VUMG 3GD7A 2LXKA 4DV1L 1K8GA 3S14H 3KDFB 3CCEA 1WJJA 2R6GA 1IBKL 2VQEQ 2R7ZG 4DV2Q 1S3OA 2VQFL 2WAQE 4NPSA 4IO9A 1R9TH 2ZJQA 4LF9Q 1N32Q 3M7NA 4C3HH 1NY4A 3PCOB 4R4IA 3J80c 4A3JH 3BJUA 1SN8A 2K5NA 4LFCQ 4BBSH 4JI3Q 1L1OC 1Q12A 2D0OA 3H3VI 1VCIA 1S72A 5IT9c 5IYBG 4YHHL 2QA4A 2K75A 2WB1E 4A3DG 2VUMH 3KF6B 3K8AA 1KAWA 3PIPA 3F1ZA 4DR6L 1PH9A 2HIXA 4LF4Q 4LWCA 1Y1VH 1NTGA 3TS0A 1SLJA 2JEAI 2UXDL 2IHFA 2WP8J 1VQ7A 4L5RC 3CC4A 2JA7H 3BU2A 1AE2A 4A3BH 3GTKH 1K3RA 4P74A 1QUQB 1J5EL 1PH3A 5BR8L 2MNAA 1PHJA 5C4JH 1JJ2A 3AEVA 4AQYL 4K0KQ 2UUAL 1WYDA 4YWLA 2K52A 4X65L 4UY8C 1C7YA 3J81c 1U0LA 1KL9A 3PO3H 4KHPQ 4YCVA 2QGQA 1VQMA 4LF9L 5K36G 3M9BA 3S1MH 2ZTDA 4JCVE 3CCRA 2GVBA 3KLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULL A;  1D8L A;  4HJ9 A;  2CCZ A;  3RNU A;  4BBR G;  2YTX A;  1IZ6 A;  3STB D;  1NE3 A;  1P16 A;  4LW1 A;  4P73 A;  1UEB A;  4JI8 Q;  3L2P A;  1JJC B;  1N36 L;  3J7A 5;  3CCU A;  1WI5 A;  3H0G H;  2ALY B;  5J3B A;  1X55 A;  2KCM A;  3I2Z A;  1TWH H;  3E0E A;  3PUY A;  5M3F G;  3HOW H;  1G51 A;  3ER0 A;  4UP7 A;  3EN2 A;  4EQ5 A;  5IYC G;  3F2D A;  4DUY Q;  2AMC B;  4P72 A;  4DV3 Q;  3L7Z C;  5LMU L;  1IXR A;  4LNQ A;  3MXN B;  1W2B A;  1YBY A;  4ME3 A;  1VQB A;  5GAD C;  4DV1 Q;  1O7I A;  2CWP A;  3ICE A;  1I94 Q;  2KCT A;  4NXM L;  4LUV A;  1L0W A;  3JAM i;  2ZM6 Q;  4WJ3 M;  1LUZ A;  1HZ9 A;  5IWA Q;  1CKO A;  2AWO A;  4PZ6 A;  1OTC A;  4A3C G;  3TRZ A;  1LYL A;  3CF5 A;  1CSP A;  4DR3 L;  2HIV A;  4DK3 C;  1N32 L;  1BBU A;  5AJ3 L;  4KI0 A;  3UDG A;  3HOX G;  2CQO A;  3CMA A;  4X66 L;  2R7Z H;  3SGI A;  3TEH B;  3U58 A;  2BA1 A;  2K5H A;  4UP8 A;  1VQH A;  2R92 H;  1U5K A;  1FGU A;  1VQG A;  1N36 Q;  2Q2U A;  4DUZ Q;  2UXC Q;  2GN5 A;  1V9P A;  1YI2 A;  4DV4 L;  3GTL H;  4DR2 Q;  4LF7 L;  2F4V L;  1HR0 W;  1HNZ L;  4LFA Q;  2UXC L;  1VS0 A;  3KFU A;  2UUC Q;  5IYD G;  4DV6 Q;  4A76 A;  4DNI A;  2YTV A;  5LMU Q;  3GTM H;  4GOP C;  2Y0S E;  3KOJ A;  2ZJP A;  3HOV G;  3H15 A;  4PZ7 A;  4AH6 A;  1BBW A;  4GLX A;  1TXY A;  1Y14 B;  3H0G G;  4IJL A;  4KLK A;  3GTJ H;  2XTI A;  1K8A C;  1EOV A;  2UUB Q;  3HFZ B;  4BY7 H;  4DKA C;  1NJI C;  1WCM H;  4JI5 Q;  4RG1 A;  4R4T A;  5IWA L;  5IP7 G;  4OX9 L;  4RMF A;  1VQN A;  2N8N A;  3S2H H;  4GLA C;  4JBK A;  4LF6 L;  2PMZ E;  4R4O A;  4JI8 L;  1XMQ Q;  1PV4 A;  2YU9 H;  4C2M H;  3HOY H;  1VQF A;  4MZ9 A;  3UDI A;  1GD7 A;  1XTD A;  2XGT A;  4OWX B;  1EQR A;  4YWK A;  1UE6 A;  1SFO H;  2WFW A;  2PNH A;  1T9H A;  3CXC A;  2OTL A;  2MFI A;  4IPD A;  4BXX H;  4IFD G;  4A3G G;  3W5O A;  3FKI G;  2BH2 A;  1YEZ A;  2JA6 H;  3HOU H;  1HH2 P;  3I55 A;  4B3M L;  3CPW A;  5ELN A;  3T1H L;  1N33 Q;  2PI2 A;  1Q8K A;  1ASZ A;  4MTN A;  1VQK A;  1XNR L;  1YZ6 A;  4LF7 Q;  1WOC A;  2K14 A;  2L15 A;  1VQ4 A;  3EBE A;  2UUA Q;  1KD1 C;  3S1R H;  4Y7N H;  1NMF A;  3S24 A;  1PVO A;  3K81 C;  4DR4 Q;  4NXM Q;  1I5F A;  4AIM A;  1PFS A;  3K7A H;  4GKK Q;  3TS2 A;  4JV5 Q;  3NEM A;  5FLM G;  2EQS A;  2JQO A;  4A93 G;  4JYA L;  1HNX L;  1LTL A;  1JJG A;  2D0P A;  3PUX A;  4JI0 Q;  1VQI A;  1IBK Q;  1N9W A;  2AHO B;  1YIJ A;  2YV5 A;  1IBM Q;  3HOY G;  4X64 Q;  3CCL A;  1Q86 C;  4L5T A;  2Q2I A;  1P8L A;  3G4S A;  4A3E G;  1Y1W H;  1L1O A;  4NXN L;  2JA5 G;  1SR3 A;  1EQQ A;  1QUQ A;  3OW2 A;  2UU9 Q;  4LF6 Q;  4X6A H;  1AH9 A;  2CFM A;  2ZTE A;  1WCM G;  2NVY H;  5C3E G;  2N3S A;  2I5L X;  2KHI A;  5IE8 A;  1TWA H;  5M3M H;  4GNX C;  4JBM A;  2A19 A;  4DV7 Q;  3F8T A;  5C3E H;  4YY3 Q;  4JI1 Q;  3KF6 A;  3J7Z C;  4DV0 Q;  1N34 L;  1PH6 A;  1M1K C;  3K80 C;  1FJG Q;  1E24 A;  4B3T Q;  3HKS A;  4B3S L;  2JJQ A;  2K50 A;  4DV6 L;  1UE5 A;  1X3E A;  4DV0 L;  1Z9F A;  5JJK A;  1A8V A;  4JV5 L;  5C44 H;  3KF8 B;  1RIP A;  2RHQ B;  4IFD I;  5HGQ A;  1B7Y B;  1HNW L;  4A3L G;  2B29 A;  4DV5 Q;  1X3F A;  5C44 G;  3I4M G;  2R7F A;  1VQO A;  1QVC A;  3OTO Q;  4DAY B;  2QEX A;  1EUJ A;  4IPC A;  5E7N A;  4X64 L;  2R7D A;  1WFQ A;  1YIT A;  1Y1W G;  3PF5 A;  2UUB L;  4GN3 B;  2JA8 H;  4QIW E;  1G6P A;  5ELO A;  4C3J H;  4QY7 A;  5AJ3 Q;  1QZG A;  4EX5 A;  3G6E A;  3CCM A;  4YHH Q;  3FKI H;  4DV7 L;  3RN2 A;  4OWW B;  4A93 H;  4GNX A;  2H5X A;  4JBJ A;  2R93 G;  4DV4 Q;  1HZC A;  1VQ8 A;  3AFP A;  4C3I H;  1SRU A;  4O2D A;  3UE0 A;  4A4I A;  4DUZ L;  4IOC A;  2IX0 A;  1B70 B;  2KEN A;  2ID0 A;  3E9H A;  3CCS A;  1MJE A;  3M85 A;  3CCV A;  3L0O A;  4OO1 G;  4B3M Q;  4B3T L;  3Q8D A;  4DV2 L;  2UXD Q;  4JI7 Q;  2Z6K A;  2JA7 G;  4DUY L;  1UWV A;  3RR5 A;  4GOP A;  4A3K H;  1MIU A;  3KDF A;  2HHH Q;  4P75 A;  4JC0 A;  4DR3 Q;  4LF5 Q;  4H02 A;  3OTO L;  1HR0 Q;  4APV A;  4DV5 L;  4GNX B;  1D7Q A;  1X3G A;  3RLO A;  1XJV A;  2EIF A;  1KRS A;  3E9I A;  5FLM H;  2MO1 A;  3AYH B;  3ULJ A;  2UU9 L;  1QZH A;  4DPG A;  4A3J G;  1RL2 A;  3A5Z B;  4A3I G;  2OQ0 A;  1YJN A;  3G48 A;  5C0X I;  2ZJR A;  2E8G A;  2R92 G;  4GOP B;  2RF4 A;  3PSI A;  3PUW A;  4YY3 L;  1EIY B;  3CQZ H;  1JT8 A;  1H95 A;  3LGJ A;  3I56 A;  4K0K L;  3OYY A;  2Y0S G;  1ASY A;  2DUD A;  3A5U A;  1QVG A;  1NBW A;  3J80 i;  1J5E Q;  3PIO A;  5LMN Q;  3KYH C;  1VQ9 A;  3I4M H;  4J15 A;  4IOA A;  4DR5 Q;  1HNW Q;  3S17 H;  1OXU A;  1G29 1;  1XPR A;  1GO3 E;  4HIM A;  1JMC A;  2GVA A;  3GO5 A;  1Q7Y C;  1EFW A;  1VQA A;  1UE1 A;  2VQE L;  3ERS X;  2ZTC A;  4JBW A;  5C4X H;  4JYA Q;  2UXB Q;  2OQK A;  2CKZ B;  2AWN A;  3U50 C;  4OON A;  4HJ7 A;  1VQP A;  4BY1 H;  2I0Q A;  4IPG A;  4GS3 A;  1I3Q H;  3RLN A;  3STB C;  2VS1 A;  4HJA A;  5JEA G;  1Q81 C;  1M90 C;  4JI3 L;  3JAM c;  2E5L L;  4OX9 Q;  2JK8 A;  2C35 B;  1Q46 A;  5M3M G;  2VW9 A;  4LFC L;  1KQS A;  1V43 A;  3T1H Q;  5GAG C;  2K4K A;  4QL5 A;  2VY3 A;  3PV0 A;  1KIX A;  3S15 H;  2FXQ A;  2VL6 A;  4JOI A;  4ALP A;  2JA8 G;  1FJG L;  1E22 A;  1L1O B;  4LF4 L;  2VZA A;  4A3F H;  1TWF H;  5FLX c;  1YHA A;  1CUK A;  1KRT A;  2KBN A;  1HNZ Q;  5C4X G;  4TQU S;  5EAY A;  1FL0 A;  4DR4 L;  3VDY A;  5LMN L;  3TRE A;  1EIF A;  4X62 Q;  4GKK L;  2IHE A;  1XNQ Q;  4AQY Q;  1K83 H;  3S2D H;  1GM5 A;  4LFB L;  5C0X G;  3I7F A;  1HR0 L;  3PUZ A;  3M4O H;  1XMO L;  3GTP H;  3D0F A;  2LSS A;  1I94 L;  1PYB A;  2HHH L;  4JI5 L;  3F2B A;  1OXT A;  2B3G A;  4PG3 A;  3AQQ A;  4L5Q A;  1E3P A;  2OTJ A;  1FVI A;  5M5X H;  2MQH A;  2NZH A;  3UDF A;  1E7Z A;  2LXJ A;  2BA0 A;  5M3F H;  4A3L H;  3CC7 A;  1IBL L;  4LF8 L;  2ASB A;  5M5W H;  1EYG A;  2F4V Q;  3S1N H;  1QVF A;  3JC6 6;  1K0R A;  3PGZ A;  4BBR H;  2JA5 H;  1C0A A;  1IBL Q;  4LF8 Q;  1A63 A;  3ULP A;  4IPH A;  4BY1 G;  3WWV A;  1OXX K;  3RN5 A;  4QGU A;  3NEN A;  2HT1 A;  5IP7 H;  4GLV B;  3I4N H;  4O0A A;  3CC2 A;  3J81 i;  4JG2 A;  1VQE A;  1N8R C;  3CCJ A;  2YTY A;  3F2C A;  1OXV A;  3B6Y A;  4A3G H;  4B3R Q;  1XMO Q;  1OXS C;  4HIK A;  1PYS B;  4AYB G;  1YJW A;  1XMQ L;  3KJP A;  5IYB H;  1E1O A;  2NN6 I;  4QJF A;  3GDE A;  1VQ5 A;  2ZM6 L;  1X56 A;  5IP9 H;  4R4C A;  1HZA A;  2WAQ G;  4DR1 Q;  4LUZ A;  2ATW A;  5JEA J;  3U4Z A;  5JJL A;  5GAE C;  5LMN W;  2BH8 A;  4YCU A;  3KJO A;  4FDB A;  3RZD H;  4IFD J;  3GTO H;  4LFA L;  5IYD H;  5IY0 A;  3HOZ H;  2AKW B;  4BBS G;  1EWI A;  1MJC A;  1IL2 A;  1XNQ L;  4PMW A;  2KHJ A;  4XTC S;  1KC8 C;  4A3B G;  2HQL A;  1JB7 A;  2DGY A;  2D62 A;  1C9O A;  1Y1V G;  4JI2 Q;  2R93 H;  4BY7 G;  4HJ8 A;  3H3V H;  1CKN B;  4DR7 Q;  2F52 A;  4A3M G;  1VQL A;  1SMX A;  2JE6 I;  2UXB L;  2VQF Q;  1IBM L;  2CWA A;  1Q1B A;  3FP9 A;  2IT1 A;  1A62 A;  4JI0 L;  4GN5 A;  4KHP L;  3HOX H;  1V1Q A;  2K5V A;  1K9M C;  5IP9 G;  3NBH B;  4X65 Q;  1XPU A;  3HKZ G;  5GRO A;  2IY5 B;  2A1A A;  1HZB A;  2E2I H;  2ES2 A;  3M3Y H;  2WB1 G;  4IJH A;  1CSQ A;  3K0X A;  2E5L Q;  1E1T A;  1HJP A;  1I6H H;  1IYJ B;  5HY6 A;  1SRO A;  3W1B A;  1L2F A;  2RHS B;  1YHB A;  1YVC A;  3UE1 A;  3D31 A;  3W1G A;  3BZK A;  4NXN Q;  3DM3 A;  4B3S Q;  2A8V A;  3PO2 H;  3G71 A;  4DV3 L;  3I4O A;  5FJ8 H;  4WJ4 A;  2PI2 E;  1YJ9 A;  2Z0S A;  3CPF A;  2NVQ H;  2B63 G;  3I4N G;  4JI2 L;  4HJ5 A;  3CD6 A;  2V1C C;  2N78 A;  1JE5 A;  3PF4 A;  3S1Q H;  1X65 A;  3CAM A;  4DR7 L;  4UP9 A;  1Q82 C;  4GKJ Q;  4JI6 L;  3BZC A;  4LFB Q;  3CCQ A;  2JEB I;  3DLL A;  5BR8 Q;  1BVS A;  3AFQ A;  4X62 L;  4POG A;  1VQ6 A;  5GAH C;  5H1S E;  5DLQ E;  1PH5 A;  3FHW A;  1K73 C;  1Q1E A;  4HIO A;  1S40 A;  4NB3 A;  1PH1 A;  1NMG A;  4A3E H;  4L5S A;  4B3R L;  4P71 A;  2NVT H;  4OO1 I;  2IX1 A;  1SE8 A;  1I50 H;  1TWC H;  4YWM A;  3J81 j;  2VNU D;  1UE7 A;  4UPA A;  4A3C H;  1B8A A;  3K7U C;  1KHI A;  5FJ8 G;  3TQY A;  1PH4 A;  1CKM A;  3CP0 A;  4JI4 L;  4DR1 L;  4A3I H;  1GKH A;  2I5M X;  4KHZ A;  1TWG H;  2F3I A;  4POF A;  2E2H H;  4A3D H;  3S16 H;  3HOW G;  1AE3 A;  1XNR Q;  4HID A;  1DGS A;  4JI4 Q;  3PUV A;  3MEF A;  3U4V A;  4DK6 C;  4DAM A;  5M5Y H;  4A3K G;  1X54 A;  1XPO A;  3GTG H;  2N49 A;  4JOI C;  5IYC H;  2Z6K C;  4PZ8 A;  1VQD A;  2RCN A;  3NEL A;  1PH7 A;  2B63 H;  4DR6 Q;  4JI7 L;  4Y52 H;  4AYB E;  2JA9 A;  1X6O A;  1KXL A;  2JA6 G;  3HOU G;  2I5H A;  1HNX Q;  3PO3 G;  2NZO A;  3UDX A;  1CKN A;  3A0J A;  4OXP A;  3HOV H;  4BXX G;  1MKH A;  2OCE A;  4DR5 L;  2UUC L;  4TVA B;  2E2J H;  1Z47 A;  3T1Y Q;  4QQB X;  4A3M H;  2PQA B;  1LM0 A;  3RLF A;  4BA2 I;  2YYZ A;  3CW2 C;  4LUO A;  4MNO A;  2MO0 A;  4A75 A;  3M4P A;  5JJI A;  3CME A;  4XIG S;  3T1Y L;  4A3F G;  3ZJY C;  3HKZ E;  3HOZ G;  3GTQ H;  3A74 A;  1A0I A;  1GVP A;  1N34 Q;  1VQJ A;  4X66 Q;  3RZO H;  5C0X J;  1PH2 A;  3M4Q A;  1W3S A;  1PH8 A;  2PQA A;  1BKB A;  4JI1 L;  1YNX A;  4R4Q A;  2OWO A;  3IRB A;  3EIV A;  2Q2H A;  4R1J A;  4DR2 L;  2Q2T A;  1VQC A;  1PA6 A;  4JI6 Q;  1J6Q A;  1X9N A;  1YHQ A;  2NVX H;  4BA1 I;  4GKJ L;  4YCW A;  4OWT B;  4GN4 B;  2EXD A;  4LF5 L;  1N33 L;  2NN6 G;  5GQO A;  3PO2 G;  2VUM G;  3GD7 A;  2LXK A;  4DV1 L;  1K8G A;  3S14 H;  3KDF B;  3CCE A;  1WJJ A;  2R6G A;  1IBK L;  2VQE Q;  2R7Z G;  4DV2 Q;  1S3O A;  2VQF L;  2WAQ E;  4NPS A;  4IO9 A;  1R9T H;  2ZJQ A;  4LF9 Q;  1N32 Q;  3M7N A;  4C3H H;  1NY4 A;  3PCO B;  4R4I A;  3J80 c;  4A3J H;  3BJU A;  1SN8 A;  2K5N A;  4LFC Q;  4BBS H;  4JI3 Q;  1L1O C;  1Q12 A;  2D0O A;  3H3V I;  1VCI A;  1S72 A;  5IT9 c;  5IYB G;  4YHH L;  2QA4 A;  2K75 A;  2WB1 E;  4A3D G;  2VUM H;  3KF6 B;  3K8A A;  1KAW A;  3PIP A;  3F1Z A;  4DR6 L;  1PH9 A;  2HIX A;  4LF4 Q;  4LWC A;  1Y1V H;  1NTG A;  3TS0 A;  1SLJ A;  2JEA I;  2UXD L;  2IHF A;  2WP8 J;  1VQ7 A;  4L5R C;  3CC4 A;  2JA7 H;  3BU2 A;  1AE2 A;  4A3B H;  3GTK H;  1K3R A;  4P74 A;  1QUQ B;  1J5E L;  1PH3 A;  5BR8 L;  2MNA A;  1PHJ A;  5C4J H;  1JJ2 A;  3AEV A;  4AQY L;  4K0K Q;  2UUA L;  1WYD A;  4YWL A;  2K52 A;  4X65 L;  4UY8 C;  1C7Y A;  3J81 c;  1U0L A;  1KL9 A;  3PO3 H;  4KHP Q;  4YCV A;  2QGQ A;  1VQM A;  4LF9 L;  5K36 G;  3M9B A;  3S1M H;  2ZTD A;  4JCV E;  3CCR A;  2GVB A;  3KLW A; 
#chains in the Genus database with same CATH topology
 3RNU A;  1Y1V B;  1DCZ A;  1NE3 A;  4FNF A;  2CW0 C;  4JI8 Q;  3L2P A;  1BNZ A;  5E1F A;  1U4R A;  2F0T A;  3PUY A;  4UP7 A;  1SYB A;  4DUY Q;  3BZD B;  5KRU A;  2HQE A;  3I3C A;  2NTS A;  4DV1 Q;  2WAQ B;  4NXM L;  4OIK A;  2IWH A;  5IWA Q;  1OTC A;  1MBY A;  3OWF A;  1BBU A;  3CQZ B;  3H0G B;  3NTK A;  5AJ3 L;  4KI0 A;  1EY4 A;  5D65 A;  2CQO A;  1KDB A;  5DAU A;  1F9P A;  2QIL A;  1KLU D;  2A6H C;  2BA1 A;  4L63 B;  4BY1 B;  1LTR D;  1N36 Q;  2Q2U A;  4DUZ Q;  3U9S A;  5CBA E;  2X6L A;  4DGZ A;  3BVZ A;  1HNZ L;  1ONL A;  3X3N A;  3KFU A;  3S1N B;  2O5J C;  4DNI A;  2NTT A;  5LMU Q;  3HOV G;  3NTI A;  3H15 A;  4PZ7 A;  2RDG A;  4KLK A;  4IJL A;  1D1I A;  4K6D A;  4JI5 Q;  4RG1 A;  4R4T A;  4K5X A;  1B53 A;  2AUJ D;  1KNE A;  4HN7 A;  3S2H H;  1JIC A;  4GLA C;  5CV8 A;  2PMZ E;  4R4O A;  4JI8 L;  3HOY H;  1B1Z A;  4QF4 A;  1GD7 A;  4RKL A;  2XGT A;  2XIW A;  2E76 C;  1BUV T;  2WFW A;  2OTL A;  2MFI A;  2AUK A;  4ZKB B;  1TT2 A;  4FXD A;  4BBS B;  4C3J B;  3HOU H;  4IUQ A;  3RD4 A;  5EPJ A;  5ELN A;  3T1H L;  3TME A;  3M4O B;  1ASZ A;  4O42 A;  1DOL A;  4LF7 Q;  1WOC A;  2L15 A;  4A3E B;  1KD1 C;  2UUA Q;  4Y7N H;  1D5M C;  3K81 C;  1HXY D;  4GKK Q;  4CJ1 B;  3NEM A;  1C8C A;  1GJX A;  2NVX B;  4IN3 A;  3GQB A;  1HRJ A;  2AHO B;  4AYB B;  1EWH A;  3EJI A;  4L5T A;  4A3E G;  1GUW A;  2UU9 Q;  3OW2 A;  1AH9 A;  3SDZ A;  1WCM G;  3MEH A;  1QNK A;  5IE8 A;  5A2Q L;  2A19 A;  5C3X A;  4RGO S;  4JI1 Q;  3GTM B;  4DV0 Q;  5I9P A;  1FJG Q;  2K50 A;  4EQN A;  1UE5 A;  4OEM B;  1Z6H A;  5JJK A;  1ENF A;  5EPK A;  3KF8 B;  5FKA C;  1F77 A;  4RHS A;  2XN9 C;  5DM7 3;  4CKC A;  4I65 A;  2ICI A;  5HGQ A;  3VR2 A;  1I3Q B;  5C44 G;  3IFT A;  2R7F A;  1VQO A;  5EKK A;  3TP8 A;  1WTX A;  1EUJ A;  2K05 A;  3S17 B;  2R7D A;  1WFQ A;  1AEX A;  4FVM A;  3Q0A A;  1G6P A;  4C3J H;  3HOU B;  2F0L A;  3R93 A;  3SXH A;  2NVT B;  3RN2 A;  1EY7 A;  4NW2 A;  4GNX A;  3T16 A;  1VMC A;  2R93 G;  5KEE A;  4Y7N B;  1LTG D;  4XYO A;  1SRU A;  4DUZ L;  1FR3 A;  3UE0 A;  4IOC A;  1LTS D;  1SFO B;  5COY A;  2J0T D;  5M9O A;  3CCV A;  1SJH D;  4KY7 A;  4DV2 L;  4JI7 Q;  2JA7 G;  3RR5 A;  4DR3 Q;  3OTO L;  4FP5 D;  2SOB A;  2PZW A;  1HR0 Q;  4APV A;  1JOO A;  4GNX B;  1XJV A;  1S5C D;  2BDO A;  4HMJ A;  3E9I A;  3ULJ A;  5COR A;  1QZH A;  2QF7 A;  1D1K A;  1YJN A;  2IJ0 A;  3CHB D;  2RF4 A;  1WTQ A;  2JSO A;  1BCP F;  3CQZ H;  3LX0 A;  3SK5 A;  4K8J A;  2HUG A;  2NN6 H;  4K0K L;  1VDZ A;  3A5U A;  1NBW A;  1EY0 A;  3KBG A;  2SNS A;  4WJW A;  1ROD A;  4IQZ A;  1X3Q A;  4IOA A;  3L9A X;  3NQI A;  2QDL A;  2XRS D;  3A55 A;  2GVA A;  2RDF A;  1Q7Y C;  1EFW A;  1VQA A;  2UXB Q;  4Q5V A;  4JYA Q;  3OOC A;  1ENA A;  4HAE A;  3I8Z A;  1PZK D;  4BY1 H;  1STN A;  2B2W A;  3STB C;  4GS3 A;  3PO2 B;  3DXJ C;  5C6A A;  1Q81 C;  4WOR A;  1M90 C;  3JAM c;  1AZQ A;  2E5L L;  1K28 A;  1KQS A;  1V43 A;  3NE5 B;  3GV3 A;  2K4K A;  4CGY B;  4EGV A;  1HTP A;  1A2T A;  3S15 H;  2FXQ A;  2JA8 G;  4LF4 L;  2L5T A;  1TWF H;  1HFG A;  1RTO A;  1FL0 A;  4FXK C;  4DR4 L;  3QG1 A;  5LMN L;  3HOZ B;  4XXE A;  4LFB L;  3D0F A;  2R7Z B;  3UI2 A;  3WOE A;  1OXT A;  2B3G A;  2PO4 A;  4L5Q A;  1E3P A;  3FMC A;  5A2Q E;  1FNU A;  1FVI A;  3JAM E;  2NZH A;  1EZ6 A;  3VR4 A;  3A56 A;  5KNC A;  2KOL A;  5D3D A;  1ICF B;  1V8Q A;  3CC7 A;  2ASB A;  1F9Q A;  1EYG A;  3K57 A;  1ENC A;  3JC6 6;  4PV1 C;  2JA5 H;  1C0A A;  5FO9 B;  2PYK A;  4IPH A;  5C4Z A;  1H9K A;  3OSO A;  1OXX K;  4V0B A;  1J9O A;  5IP7 H;  4DK0 A;  1WCM B;  1CTM A;  1VQE A;  2LS0 1;  4HED A;  4JG2 A;  5DEH A;  2KUM A;  4C3H G;  4A3J B;  1N8R C;  3B6Y A;  1T5X D;  4B3R Q;  4PQX A;  1OXS C;  4HIK A;  5IOD A;  3VYR A;  1ZYR D;  4H0L C;  3KJP A;  2RQX A;  1EEI D;  5IYB H;  3GDE A;  1VQ5 A;  2ZM6 L;  2EZV A;  1X56 A;  4DR1 Q;  4N9P A;  5JEA J;  2A69 C;  5JJL A;  3A7L A;  2MUY A;  2BH8 A;  3DEP A;  4OGQ C;  1MHW C;  5EJW A;  1KAA A;  4FDB A;  2A6H D;  2Q8T A;  3V2T A;  4LFA L;  3EQL C;  4OO1 H;  5IY0 A;  5KYI A;  1SDF A;  1EWI A;  1IL2 A;  4BBS G;  2R92 B;  2DGY A;  2D62 A;  1C9O A;  4JI2 Q;  4HJ8 A;  1V1O A;  4DR7 Q;  2F52 A;  1QNU A;  1EEF D;  3S1Q B;  1A62 A;  1PFN A;  1V1Q A;  1XPU A;  4X65 Q;  3MAQ A;  1HZB A;  5JVG 3;  1D6E C;  2E2I H;  2ES2 A;  3GTO B;  4IJH A;  1CSQ A;  2E5L Q;  1HJP A;  2WV6 D;  3HOV H;  2GA4 B;  3D4W A;  3DM3 A;  3PO2 H;  2C5C A;  4JI2 L;  1TS5 A;  3PF4 A;  3I70 A;  2V1C C;  1W6K A;  3CAM A;  4DR7 L;  3T13 A;  4XQN A;  4J6H A;  1BVS A;  4HSV A;  2F0J A;  4H44 C;  1EIG A;  1MD2 D;  3FHW A;  3WOF A;  1YNJ C;  2F0F A;  4KMU C;  3I91 A;  4P71 A;  5IT9 E;  1I50 H;  1TWC H;  3J81 j;  4B08 A;  4DNR B;  3URY A;  3HGB A;  1B8A A;  3R3O A;  4C3I B;  1Y69 U;  1CA6 A;  4DR1 L;  1Q90 A;  1TWG H;  5F2D A;  2E2H H;  3FPU B;  4A3D H;  1AE3 A;  1JOQ A;  2R93 B;  2L9H A;  4V19 0;  3J80 L;  4DK6 C;  4IUV A;  5M3F B;  1AW7 A;  4JOI C;  1PH7 A;  1E0B A;  1VQD A;  2RCN A;  3NEL A;  4Y52 H;  3MXN A;  4AYB E;  2MHV A;  5LHY 1;  3VYS A;  3UDX A;  1ESR A;  2KCN A;  1CKN A;  3A0J A;  4R8I A;  4BXX G;  1L0Y B;  1G91 A;  4DR5 L;  4XDX A;  1SE4 A;  2UUC L;  4TVA B;  3MA2 B;  4KN4 C;  1Z47 A;  3T1Y Q;  1B9N A;  5CBE E;  3KUP A;  4ZUJ A;  2Q8I B;  3RLF A;  3MFY A;  3EFX D;  1S5E D;  2EYJ A;  4KKS A;  2EYM A;  1QCB D;  4PMC A;  4ZKC B;  3HOZ G;  3HS0 C;  3A74 A;  1GVP A;  4X66 Q;  1PH2 A;  4JI1 L;  1YNX A;  4R4Q A;  3TP7 A;  2OWO A;  2EYL A;  4CDD C;  1VQC A;  1YHQ A;  3IL8 A;  4CKB A;  1JR0 D;  3MC0 B;  3GTP B;  4HMI A;  4YCW A;  4GKJ L;  2TSS A;  4KHV A;  2R6G A;  2VQE Q;  1S3O A;  2KCC A;  2WAQ E;  5C44 H;  4X3S A;  1N32 Q;  3K59 A;  4R4I A;  4A3J H;  3D4D A;  1SN8 A;  3R2T A;  2B2U A;  1L1O C;  1J8I A;  2F03 A;  3H3V I;  1S72 A;  3D3R A;  4B9W A;  4A3D G;  2VUM H;  3KF6 B;  2B63 B;  1KAW A;  3OMG A;  1PH9 A;  1JE4 A;  2UXD L;  1Y1V H;  3ITP A;  1SLJ A;  2F0M A;  2JEA I;  2IHF A;  1VQ7 A;  3NTH A;  1EY6 A;  1AE2 A;  2J4X A;  1U4M A;  4ZUI A;  1PH3 A;  1JJ2 A;  3AEV A;  1AZP A;  1RJT A;  2UUA L;  5BN5 A;  2BE5 D;  2HD3 A;  3M9B A;  3S2D B;  3ULL A;  4KJO A;  5CR3 A;  2YTX A;  3STB D;  1P16 A;  4P73 A;  1UEB A;  2AQ3 B;  2DJG C;  1N36 L;  4U68 A;  1EOT A;  1WI5 A;  3OHX C;  3I2Z A;  1TWH H;  3E0E A;  3GTQ B;  1SBB B;  4EQ5 A;  2AMC B;  4P72 A;  5LMU L;  4XQJ A;  3MXN B;  1YBY A;  1OO9 B;  4M1U B;  4DXF A;  1O7I A;  2CWP A;  3JAM i;  1L0W A;  1CQF A;  2ZM6 Q;  1WTW A;  5EPL A;  1RHP A;  1DYQ A;  4A3C G;  4PZ6 A;  5I9O A;  1EYA A;  1CM9 A;  1LYL A;  4JK1 C;  3CF5 A;  1CSP A;  4DR3 L;  1I4X A;  1N32 L;  2B8F A;  3UDG A;  1HQR D;  2EDG A;  3U9O A;  3SGI A;  1O7Z A;  1PRT D;  5A35 A;  3H94 A;  4UP8 A;  1VQH A;  4DA2 A;  1VQG A;  1FGU A;  2KA7 A;  1V9P A;  3DMU A;  1EFI D;  3R2I A;  2F3W A;  2F4V L;  4LFA Q;  5KYL A;  5IYD G;  2YTV A;  4HCS A;  3GTM H;  4N8F A;  2Y0S E;  2K1B A;  3KOJ A;  2VXW A;  3D4R A;  2Z4I A;  2JN4 A;  1TXY A;  1K8A C;  2UUB Q;  2WAC A;  2EJG C;  2Z1C A;  5IP7 G;  3K5N A;  3TSS A;  1PV4 A;  1XMQ Q;  5FO7 B;  1LTT D;  1VQF A;  1XTD A;  2EY5 A;  1EQR A;  4OWX B;  4YWK A;  2PNH A;  1T9H A;  4BXX H;  5ELB A;  4A3G G;  4JVZ A;  3FKI G;  3I55 A;  4B3M L;  4MTN A;  1YZ6 A;  1ZXT A;  3S24 A;  1PVO A;  2N55 A;  3TS2 A;  2VB3 X;  2ENB A;  4R8N A;  3EVQ A;  5CMD A;  4A93 G;  3MFG A;  1YNN D;  2YV5 A;  3S14 B;  5G3L F;  4L6T B;  1Q86 C;  2JA5 G;  1TU2 B;  1Y1W H;  3KLS A;  1SR3 A;  1EQQ A;  1QUQ A;  2B2T A;  3NK9 A;  2N3S A;  1K8O A;  2KHI A;  4JBM A;  3Q23 A;  2SNM A;  4JW0 A;  1I4Q A;  1N34 L;  3P20 A;  1PH6 A;  4IUN A;  3A54 A;  3K80 C;  4QUF A;  3AMU A;  1X32 A;  3D6W A;  3HKS A;  1X3E A;  2F3V A;  3IFD A;  4JV5 L;  2P5Z X;  1RIP A;  4TSS A;  1B7Y B;  4A3L G;  1TY2 A;  2B29 A;  3C3L A;  1X3F A;  3GTK B;  4CJ0 B;  1EY9 A;  2EYH A;  4X64 L;  1SEB D;  2CVR A;  2LFN A;  1TWA B;  2F0D A;  2UUB L;  1T5E A;  1XX8 A;  1EY8 A;  2XNA C;  3FPP A;  4CBV A;  2JA8 H;  1QZG A;  2H1E A;  1HHV A;  3CCM A;  4YHH Q;  4DV7 L;  1STE A;  4H13 C;  4TRD A;  4JBJ A;  2B2U C;  1VQ8 A;  5CV7 A;  5K5P A;  4BWG B;  2IX0 A;  1B70 B;  1H9S A;  1D5X C;  1NNX A;  1SNO A;  2B39 A;  2ID0 A;  4KY6 A;  3QO2 A;  2ZXR A;  4C1N K;  4OO1 G;  4B3T L;  4KTA A;  2UXD Q;  4DUY L;  1UWV A;  4GOP A;  1TKW B;  1MIU A;  4B9X A;  1GHJ A;  2NWG A;  4LF5 Q;  4H02 A;  2OXP A;  1SNQ A;  1X3G A;  3MXG A;  3DWA A;  1V1P B;  2EIF A;  2D2C C;  4QB4 A;  2XSC A;  2I07 B;  2Q8R E;  1WTH A;  4DAP A;  4A3J G;  3K5O A;  3BDO A;  1RL2 A;  3G48 A;  5C0X I;  2ZJR A;  3TZU A;  4GOP B;  3PUW A;  1EIY B;  1UNS A;  4J1M A;  2NVY B;  1B50 A;  1C48 A;  4N8X 1;  4EVO A;  1S4Z A;  4A3I B;  3J80 i;  1RD9 D;  4HCE A;  3HZX A;  3PQI A;  3VA5 A;  2O5I C;  3HKZ B;  1LO5 D;  4Z9C B;  3NSW A;  1JMC A;  3GO5 A;  3D8G A;  2VQE L;  1KDA A;  3ERS X;  5C4X H;  4JBW A;  3NBH A;  2OQK A;  3BVM A;  2AWN A;  3U50 C;  4CKE A;  4HJ7 A;  2DNC A;  3NP8 A;  1PTO F;  2R3Z A;  1KIX A;  5JEA G;  2CW0 D;  1R9T B;  4OX9 Q;  2JK8 A;  2MPM A;  1Q46 A;  2F1M A;  3BDL A;  2BCO A;  3T1H Q;  5GAG C;  4QL5 A;  4ME5 A;  2EPB A;  4HTH A;  2Y0S B;  2VL6 A;  5I6Y A;  4JOI A;  4ALP A;  1FJG L;  1L1O B;  3OW7 A;  1ET9 A;  4A3F H;  2A5H A;  5FLX c;  4OHJ A;  1Y8P B;  4KKT A;  5C4X G;  1G2T A;  3TRE A;  1EIF A;  1RCV D;  4LAA A;  2IHE A;  2DN8 A;  1GM5 A;  4KK7 A;  3M4O H;  3PUZ A;  1PRT F;  2LSS A;  1BXT A;  4KJN A;  1A6X A;  1U4L A;  3A7A B;  3UDF A;  3EA6 A;  2LXJ A;  4DNT B;  5M3F H;  4I7A A;  1IBL L;  2F4V Q;  3S1N H;  3V05 A;  3TN2 A;  4H7B A;  1IKL A;  4IZ8 A;  2L0C A;  4LF8 Q;  3WWV A;  2F0H A;  5FLX E;  4GLV B;  4DN4 M;  4O0A A;  1GUG A;  2V4D A;  3CCJ A;  1OXV A;  1GUT A;  4RCN A;  4G7Z C;  1PYS B;  3HOY B;  4F88 A;  1KAB A;  5I4D A;  5IP9 H;  2WAQ G;  4LUZ A;  3W3A A;  2ATW A;  4K14 A;  4EQP A;  4O1N A;  1VF7 A;  5AFW A;  3VR5 A;  1II3 A;  2JYO A;  3RZD H;  3GTO H;  1PRT C;  2E2I B;  1B9M A;  1NCV A;  4A3G B;  3SR1 A;  1XNQ L;  2KHJ A;  1KC8 C;  2HQL A;  2KEC A;  2R93 H;  3H3V H;  5G3L D;  4A3M G;  1VQL A;  1SMX A;  3MXU A;  2VQF Q;  1IBM L;  1JWU D;  2YU9 B;  4JI0 L;  2KED A;  4DFA A;  2K5V A;  1K9M C;  5IIF A;  3NBH B;  1SJE D;  5GRO A;  2IY5 B;  3TZD A;  2PPB C;  3E3X A;  2WB1 G;  1HA5 A;  3SK4 A;  2JA7 B;  1IYJ B;  1U4P A;  3UE1 A;  4J8Q A;  2TMP A;  3G71 A;  4DV3 L;  4EQO A;  3NWS A;  1PZJ D;  2B63 G;  4MHE A;  1JE5 A;  1UAP A;  2FJ2 A;  4GKJ Q;  3C1E A;  4JI6 L;  4FF4 A;  5EKI A;  3HP3 A;  3CCS A;  4GZY C;  4ZAI A;  1SYE A;  5DLQ E;  4YIJ A;  1PH5 A;  1K73 C;  2F0O A;  4A3E H;  4JPB W;  2NVT H;  4HSP A;  4YWM A;  1YNN C;  5C3W A;  1QOH A;  1UE7 A;  5J22 A;  4UPA A;  2F0S A;  5CV6 A;  1LT4 D;  5FJ8 G;  1PH4 A;  3X3M A;  2B2Y C;  1WTP A;  4A3I H;  2RSN A;  2F3I A;  2F4I A;  3TDQ A;  4LMQ D;  4JI4 Q;  4C2M B;  3VYT A;  5M5Y H;  4A3K G;  1X54 A;  1XPO A;  5IYC H;  2Z6K C;  1FD7 D;  2B63 H;  4C1N I;  4X3T A;  1LTA D;  1X6O A;  3HOU G;  2QCP X;  2AQ1 B;  3AU7 A;  1F9S A;  2OCE A;  5DNF A;  2E2J H;  4IUP A;  4DK1 A;  1K0S A;  2QW7 A;  1QWY A;  1SYC A;  3CME A;  3T1Y L;  3Q6S A;  4A3F G;  3PO3 B;  3CRL C;  3QOJ A;  3GTQ H;  2PZT A;  3GTG B;  2LMC B;  4LK1 C;  1CI3 M;  1O7L A;  2PQA A;  1VF5 C;  4G7O C;  4G4K A;  3IRB A;  4MIU A;  3H91 A;  2Q2T A;  1PA6 A;  4JI6 Q;  1J6Q A;  4BA1 I;  2K33 A;  2CH4 A;  1PTO D;  1STG A;  2NN6 G;  2F0N A;  3KDF B;  4IUR A;  2VQF L;  4NPS A;  4LF9 Q;  4X3U A;  3PCO B;  3J80 c;  3BJU A;  2K5N A;  4LFC Q;  4XT1 B;  1VCI A;  2K32 A;  1M4V A;  4F8M A;  1ET6 A;  4YHH L;  4UHV A;  2K75 A;  1UUP A;  1B3A A;  3K8A A;  3K58 A;  2WKD A;  3PIP A;  3F1Z A;  4LF4 Q;  3OIQ A;  2WP8 J;  3VYU A;  2JA7 H;  3CC4 A;  4PNY A;  4P74 A;  4UDU C;  3WDN A;  1QUQ B;  1A2U A;  1J5E L;  2MNA A;  5EBD A;  2M2L A;  4AQY L;  4K0K Q;  2PW5 A;  1WYD A;  2K52 A;  2X69 A;  4X65 L;  4UY8 C;  1U0L A;  1CHQ D;  3PO3 H;  4KHP Q;  2QGQ A;  1A15 A;  1VQM A;  2ZTD A;  2L11 A;  1LTB D;  4RAU C;  3CCR A;  3VA7 A;  3LWU A;  5IP9 G;  2QA4 A;  1D8L A;  4HJ9 A;  2CCZ A;  1ILQ A;  1HA6 A;  4BBR G;  1IZ6 A;  3A8J E;  3BG3 A;  4F87 A;  3J7A 5;  3H0G H;  2ALY B;  4A3K B;  2KCM A;  4LJZ C;  1G51 A;  3ER0 A;  3F2D A;  1GUO A;  4K6L A;  2PMZ B;  3L7Z C;  3DHQ A;  1W2B A;  1A3U A;  4ME3 A;  5GAD C;  5EGT A;  1HUM A;  1I94 Q;  4ULL A;  4LUV A;  4WJ3 M;  1LUZ A;  2CQA A;  2JP1 A;  1HZ9 A;  4IUU A;  2E75 C;  2XRQ D;  1CKO A;  2AWO A;  3I4M B;  2A69 D;  4DK3 C;  5M5W B;  1CZG A;  3HOX G;  5BN4 A;  3CMA A;  4X66 L;  2R7Z H;  4WFN 3;  4C3H B;  2K03 A;  3U58 A;  2K5H A;  1UEA B;  5C5M A;  2R92 H;  1I6V C;  1SE3 A;  2UXC Q;  4DV4 L;  2K5D A;  2DNE A;  3GTL H;  4DR2 Q;  1HR0 W;  1ZKO A;  2UUC Q;  4DV6 Q;  4A76 A;  4A3D B;  4RKB A;  5C3E B;  3T4A C;  1DOM A;  2ZJP A;  3KK7 A;  4GLX A;  4AH6 A;  3GTJ H;  1Y14 B;  4BY7 H;  1HQM C;  1EOV A;  3FDT A;  4DKA C;  1NJI C;  1WCM H;  5JEA H;  4OX9 L;  2F0W A;  1IYU A;  2N8N A;  3MTS A;  4JBK A;  1JCK B;  4LF6 L;  1U9R A;  2YU9 H;  4C2M H;  4MZ9 A;  3QR8 A;  1S5F D;  1R4Q B;  1UE6 A;  1SFO H;  4FXG C;  4X3K A;  4IFD G;  3CXC A;  1PXU A;  2HCC A;  4IPD A;  2AQ2 B;  1EWC A;  2M9V A;  3W5O A;  2BH2 A;  3VR6 A;  4M8A A;  3C46 A;  1N33 Q;  2PI2 A;  4QUC A;  1TS4 A;  3TP6 A;  1XNR L;  3EBE A;  3QB3 A;  3S1R H;  2F0P A;  1NMF A;  1I4R A;  4KD3 A;  4DR4 Q;  2L12 A;  4JYA L;  1JJG A;  1XYI A;  4JI0 Q;  1B4O A;  1IBK Q;  1QJO A;  5C44 B;  1YIJ A;  3HOY G;  1HTL D;  4KV6 A;  1M8A A;  3ZYY X;  3CCL A;  3G4S A;  2DJF C;  3I4L A;  2CFM A;  1B44 D;  1JWM D;  2NVY H;  5C3E G;  3S1M B;  5J1Z A;  3JAM L;  2NVQ B;  5M3M H;  1JC7 A;  1FYC A;  2IL8 A;  3F8T A;  3IKJ A;  5C3E H;  1FGB D;  3KF6 A;  2MGS A;  1M1K C;  1E24 A;  4B3T Q;  1D5Z C;  1SND A;  3K6O A;  1LT6 D;  2DY7 A;  3OMC A;  1EY5 A;  3PIO 3;  5C0X H;  4IFD I;  5KND A;  1DZ1 A;  4DV5 Q;  3I4M G;  2XWB B;  3OTO Q;  3KLR A;  4DAY B;  4IPC A;  5E7N A;  1YIT A;  1Y1W G;  1B2T A;  4QIW E;  3S16 B;  5ELO A;  5AJ3 Q;  4EX5 A;  1H9R A;  1W6J A;  3G6E A;  3S2H B;  3SEB A;  4A93 H;  1KLG D;  5IGE A;  1HZC A;  5ELD A;  4O2D A;  1E2Z A;  4A4I A;  2KEN A;  1QG7 A;  2F0E A;  3E9H A;  3M85 A;  1LTI D;  3E0J A;  4OEL B;  3N52 A;  2MJ8 A;  3Q8D A;  2Z6K A;  1H9S B;  1DM0 B;  4JC0 A;  3T51 B;  2ZXP A;  5ISR A;  1MJE A;  2BOS A;  1D7Q A;  3RLO A;  2EVB A;  1KRS A;  4IAL A;  4ILW A;  1K3B C;  4NMZ A;  2MO1 A;  4DPG A;  3NWT A;  4A3I G;  1MSG A;  1SMY C;  1ZEQ X;  2E8G A;  2R92 G;  2NZ1 D;  4RHR A;  4IFD H;  3HG9 A;  1TII D;  3PSI A;  4YY3 L;  5T1I A;  1JT8 A;  4ZRZ A;  1K8M A;  3I56 A;  1BQQ T;  4ABN A;  5FO8 B;  1ASY A;  3PIO A;  4NDX A;  1VQ9 A;  1HNW Q;  1PTO B;  1OXU A;  1PTO C;  1XPR A;  1I4G A;  2EE1 A;  3GTL B;  4OIJ A;  2ZTC A;  3LNN A;  4CDC C;  1A3T A;  4A93 B;  4IPG A;  1I3Q H;  3RLN A;  3RZD B;  2ICE C;  4JI3 L;  1EU4 A;  3J7A V;  3CU7 A;  2L4N A;  2ZXO A;  3M4Y A;  3PV0 A;  2M00 A;  3J7A F;  5C4J B;  1O78 A;  2L1B A;  2VZA A;  1B3Q A;  4RWS C;  1YHA A;  1KRT A;  2KBN A;  5M3M B;  4TQU S;  5EAY A;  3VDY A;  2RKS A;  4GKK L;  4AQY Q;  1K83 H;  3I72 A;  3I7F A;  1XMO L;  1BBX C;  1I94 L;  2B2W C;  1PYB A;  1Y8O B;  1I4H A;  4KN7 C;  4PG3 A;  1XWE A;  3AQQ A;  1GXD C;  2E74 C;  2EY2 A;  5M5Y B;  1RDP D;  4LF8 L;  4DAY A;  4K2K A;  5ELC A;  4RA8 A;  1QIL A;  3PGZ A;  4BBR H;  1IBL Q;  1O7Y A;  3AB9 A;  3ULP A;  4BY1 G;  3DWP A;  3RN5 A;  3NEN A;  1WVL A;  1RTN A;  3V96 A;  3J81 i;  3K5L A;  2D5D A;  2YTY A;  5IGD A;  3F2C A;  4MN3 A;  1BDO A;  1XMO Q;  1JWS D;  1YJW A;  1IKM A;  1E1O A;  1GUS A;  2NN6 I;  4QJF A;  2F0K A;  1IYV A;  5J39 A;  1HZA A;  2KHS A;  1STY A;  1VMP A;  1Q8I A;  4A3B B;  1SYF A;  5BN3 A;  1IW7 D;  4C3J G;  1STA A;  2K5W A;  4UAI A;  2AKW B;  1MJC A;  4C3I G;  1Y1V G;  1BF4 A;  2WII B;  2JE6 I;  1Q1B A;  2RA4 A;  2IT1 A;  4K5W A;  5ELF A;  4IUT A;  4GN5 A;  3HOX H;  2K5Q A;  3FVQ A;  1LT3 D;  1CK1 A;  2A1A A;  3M3Y H;  2NYZ D;  1WTV A;  2B2Y A;  3J7Y W;  3K0X A;  1E1T A;  4CHT B;  1CA5 A;  1I6H H;  1SRO A;  3W1B A;  2RHS B;  1YVC A;  3W1G A;  3D31 A;  1ESF A;  4N9T A;  4BS9 A;  3I4O A;  5FJ8 H;  4S3S A;  3SK6 A;  1F2L A;  3I4N G;  4HJ5 A;  2OF1 A;  1I4P A;  2CH4 W;  3KBX A;  2K01 A;  1X65 A;  5JAV A;  3A8I E;  4UP9 A;  2JA5 B;  3ONA B;  5FK9 C;  3OWE B;  4TKO B;  3CCQ A;  3DLL A;  3SHL A;  1SSO A;  5BR8 Q;  3AFQ A;  5JVH 3;  4POG A;  1SYD A;  5GAH C;  3J80 E;  1TS3 A;  3MVV A;  1S40 A;  4NB3 A;  1PH1 A;  4B3R L;  1TR5 A;  1TQO A;  1DOK A;  3R8B A;  3TBI B;  2VUM B;  1PTO H;  2RBM A;  2DY8 A;  4RCO A;  4QMG A;  4KKU A;  3TQY A;  3CP0 A;  1QB5 D;  3P7J A;  4JI4 L;  5IT9 L;  1GKH A;  2I5M X;  4KHZ A;  4POF A;  2QDB A;  1Y8N B;  3DUZ A;  3Q22 A;  2EXZ A;  1H9J A;  4ID6 A;  4KD4 A;  4HID A;  1DGS A;  3PUV A;  3KLS X;  3MEF A;  1CT1 D;  3S9W A;  2B2T C;  4DAM A;  2N49 A;  2RDH A;  2OEO A;  5TSS A;  4DR6 Q;  2E2D C;  2KEE A;  2JA6 G;  1HNX Q;  4BBR B;  2NZO A;  2A6E D;  4OXP A;  4WRD A;  1MKH A;  2FFK B;  5L37 A;  4RGT A;  2NUC A;  1JQY D;  4QQB X;  4A3M H;  2PQA B;  2Z8L A;  4BA2 I;  4A75 A;  1TWG B;  3M4P A;  2E2H B;  5JJI A;  4XIG S;  1F9R A;  2EY1 A;  3DEO A;  2RVL A;  4RGN A;  3MHB A;  1A0I A;  1N34 Q;  3C2P A;  3RZO H;  5C0X J;  3M4Q A;  1HPC A;  3ERO A;  1W3S A;  5I2Y A;  3EIV A;  2Q2H A;  4R1J A;  1MI2 A;  3K7A B;  1X9N A;  2O2L D;  2B8G A;  4OWT B;  4GN4 B;  4LF5 L;  1N33 L;  1ML0 D;  4QIW B;  5GQO A;  3GV6 A;  3PO2 G;  3SVM A;  4DV1 L;  2LXK A;  1XTC D;  5JPN C;  1RF2 D;  3CCE A;  1IBK L;  1HCZ A;  3NUC A;  1R9T H;  4ODG A;  3M7N A;  1NY4 A;  4ZCK A;  1EYC A;  1Q12 A;  2SDF A;  1GOZ A;  5DM6 3;  5IYB G;  2NBF A;  2A74 C;  1ICW A;  4FF2 A;  4DR6 L;  2HIX A;  2G9D A;  4LWC A;  1NTG A;  3TS0 A;  3BU2 A;  4P2C B;  1JOR A;  2OT2 A;  4RH6 A;  2XVS A;  3BS1 A;  5HUR A;  2K04 A;  1PHJ A;  5C4J H;  5C4H A;  2Z9H A;  1S5D D;  2EJF C;  1V1P A;  4YWL A;  4A3F B;  3OIP A;  1KDC A;  4YCV A;  5KNB A;  3QWN A;  4LF9 L;  3S1M H;  2GVB A;  5FLM G;  3KLW A;  1SE2 A;  3GP7 A;  5C4X B;  1WTR A;  4LW1 A;  1JJC B;  5D3I B;  3CCU A;  5M3F G;  5J3B A;  1X55 A;  3NBI A;  3EN2 A;  5IYC G;  5K36 H;  1C4Q A;  3W2D A;  3TP5 A;  4DV3 Q;  1IXR A;  4LNQ A;  3QIA A;  1VQB A;  5I6W A;  4XYQ A;  3PIP 3;  1NUC A;  4ZK9 B;  2KCT A;  3ICE A;  5CYU A;  1EQV A;  2EYF A;  1SNP A;  2K6A A;  2A68 D;  3TRZ A;  5CV9 A;  2HIV A;  5CGK A;  1G8Z D;  4K8I A;  3TEH B;  4HR7 B;  2NB0 A;  1U5K A;  2XWJ B;  2GN5 A;  1YI2 A;  4LF7 L;  3RZO B;  2UXC L;  1VS0 A;  4DXG A;  5KGU A;  4GOP C;  2B2V C;  1SNC A;  1G2S A;  3OPO A;  1BBW A;  3H0G G;  2RSO A;  2XTI A;  3T53 B;  3HFZ B;  3K0Y A;  2WKC A;  1PFB A;  5IWA L;  1ZYR C;  1VQN A;  4RMF A;  5EKL A;  4R9W A;  2E2J B;  3NXW A;  3UDI A;  3ND9 A;  3NHH A;  2PW7 A;  1DON A;  3E5S A;  1YEZ A;  2JA6 H;  5E4X A;  1CQV A;  1HH2 P;  5IGF A;  3CPW A;  2JXM B;  1IW7 C;  2N88 A;  1Q8K A;  1VQK A;  2K14 A;  3MZ5 A;  1VQ4 A;  2K28 A;  1EQT A;  3BYY B;  4FF1 A;  2LY7 A;  4NXM Q;  1I5F A;  4AIM A;  1PFS A;  3K7A H;  2KVM A;  4JV5 Q;  5IOC A;  3BDC A;  2EQS A;  2JQO A;  5FLX L;  1LTL A;  1HNX L;  1DXM A;  1EU3 A;  2D0P A;  3PUX A;  1RKN A;  1VQI A;  2B2V A;  1N9W A;  1IBM Q;  4X64 Q;  3LWE A;  2D9U A;  1P8L A;  2H4O A;  2Q2I A;  3RUZ A;  1L0X B;  1L1O A;  4NXN L;  1WD1 A;  4LF6 Q;  3HOW H;  4X6A H;  3QOL A;  2ZTE A;  4DF7 A;  2I5L X;  1WTO A;  4GNX C;  1TWA H;  4CJ2 C;  4DV7 Q;  4RGM A;  1G6Z A;  4YY3 Q;  3J7Z C;  4G57 A;  1SXT A;  2PQE A;  2I46 A;  4B3S L;  2JJQ A;  4NKL A;  2X6G A;  4DV6 L;  4DV0 L;  1Z9F A;  3SE0 A;  1A8V A;  2K7V A;  3HRZ C;  4U67 3;  2RHQ B;  1HNW L;  1I50 B;  1TWC B;  1CFM A;  1BCP C;  1QVC A;  2QEX A;  3I73 A;  1YNJ D;  3PF5 A;  5D14 A;  4GN3 B;  3QJY A;  2JA6 B;  4QY7 A;  3FEW X;  1R4P B;  3FKI H;  4OWW B;  1EZ8 A;  4CDE C;  3I4N B;  2H5X A;  1LAB A;  4DV4 Q;  4PMB A;  4FO2 A;  5IGB A;  3AFP A;  4C3I H;  1STH A;  4I7Z C;  3L0O A;  5LL6 S;  3P1H A;  4B3M Q;  4K2L A;  3H09 A;  1NR2 A;  4A3K H;  3KDF A;  3BVG A;  1DD2 A;  2PZU A;  2HHH Q;  4P75 A;  2A6E C;  1LT5 D;  4DV5 L;  1F2Y A;  3I90 A;  5FLM H;  3AYH B;  2UU9 L;  4DAV A;  3A5Z B;  2OQ0 A;  2A73 B;  2F0I A;  2O4X A;  3DM1 A;  1LLR D;  4XT3 B;  3MWY W;  1PFM A;  1H95 A;  3LGJ A;  3OYY A;  2Y0S G;  2DUD A;  3SK8 A;  1QVG A;  1J5E Q;  5LMN Q;  1STB A;  3KYH C;  3HOX B;  4K5V A;  3VR3 A;  3I4M H;  1PDQ A;  3DWQ A;  4J15 A;  4FYD A;  1CHP D;  4DR5 Q;  3S17 H;  2HDM A;  1F2Z A;  1F2M A;  1G29 1;  1GO3 E;  2F0G A;  4HIM A;  1UE1 A;  5CC4 A;  3KF8 A;  1AN8 A;  2G9H D;  2EY6 A;  1I6H B;  2CKZ B;  3N6R A;  3K5M A;  4OON A;  1VQP A;  2I0Q A;  5NUC A;  1K83 B;  4HJA A;  2VS1 A;  2EOT A;  1E2V A;  2C35 B;  3NPP A;  3O13 A;  5M3M G;  2VW9 A;  4LFC L;  1ILP A;  1BO0 A;  2KJX A;  2F0V A;  2VY3 A;  5E3F A;  1BCP B;  1EYD A;  1JB3 A;  1E22 A;  3D6C A;  5EQ0 A;  5KIX A;  3GTJ B;  4L8J A;  1CUK A;  1HNZ Q;  4KY5 A;  4X62 Q;  1XNQ Q;  3S2D H;  5IGC A;  5C0X G;  2ZT9 C;  1HR0 L;  2WIN B;  4C56 C;  1IL8 A;  3GTP H;  2BE5 C;  4FF3 A;  2HHH L;  4JI5 L;  5IGG A;  3F2B A;  2OTJ A;  5M5X H;  2F0U A;  2MQH A;  3F2U A;  1E7Z A;  2BA0 A;  4A3L H;  1GHK A;  2EYP A;  3A8K E;  2Z4H A;  5C5L A;  1AP0 A;  5M5W H;  5CV5 A;  1BOS A;  1DJR D;  1QVF A;  1K0R A;  2IX3 A;  1A63 A;  1IHZ A;  3HOW B;  1HFN A;  2F0Q A;  3M7G A;  4QGU A;  2C9O A;  2HT1 A;  3I4N H;  3CC2 A;  4G7H C;  1TWH B;  1TVX A;  4A3G H;  3L3O C;  4MTK A;  4AYB G;  4NP5 A;  1XMQ L;  1KNA A;  3ND8 A;  1PMR A;  4OL7 A;  1TS2 A;  2A68 C;  4R4C A;  3S15 B;  2IW3 A;  3CRK C;  4ZLT F;  2CHB D;  3U4Z A;  1LV9 A;  5GAE C;  5LMN W;  3P75 A;  4YCU A;  1TWF B;  3KJO A;  5JJZ A;  1NAP A;  4IFD J;  5JPM C;  3M3Y B;  3J81 L;  3BYT B;  1NR4 A;  5IYD H;  3HOZ H;  1MSH A;  2SEB D;  4PMW A;  4XTC S;  4A3B G;  2FMC A;  4ZQ3 A;  1JB7 A;  3C1F A;  4BY7 G;  3E6Z X;  1CKN B;  2PCF B;  2UXB L;  2R61 A;  2CWA A;  3FP9 A;  1Y1W B;  2BDN A;  1S5B D;  3S1R B;  4KHP L;  1PLF A;  1H9M A;  2LKV A;  2EYO A;  3HKZ G;  1PYW D;  4BY7 B;  4A3M B;  5ELE A;  5LL6 X;  5HGT A;  5HY6 A;  4NXN Q;  1L2F A;  1YHB A;  3BZK A;  4B3S Q;  2A8V A;  3H3V C;  4XQQ A;  1SYG A;  4WJ4 A;  3NQT A;  2PI2 E;  2PNR C;  1YJ9 A;  2Z0S A;  3CPF A;  1WD0 A;  2NVQ H;  3CKI B;  3S1Q H;  3CD6 A;  2N78 A;  2QEJ C;  1Q82 C;  4QCL A;  3BZC A;  2J7Z A;  4LFB Q;  2JEB I;  4X62 L;  1VQ6 A;  5H1S E;  1Q1E A;  4HIO A;  4L5S A;  1NMG A;  4OO1 I;  1SAP A;  2IX1 A;  1FNV A;  1SE8 A;  2VNU D;  3FRP B;  1A3V A;  4A3C H;  5EBC A;  3K7U C;  1KHI A;  1CKM A;  2RCF A;  3MXP A;  3S16 H;  3HOW G;  1XNR Q;  2IPK D;  5M5X B;  4ZYS A;  1PZI D;  3U4V A;  3GTG H;  4RFB A;  3FKI B;  4PZ8 A;  1AFP A;  4JI7 L;  2JA9 A;  1KXL A;  3RMH A;  2I5H A;  3PO3 G;  2WB1 B;  1FNW A;  4Q0F A;  3IAY A;  1BR9 A;  2HCI A;  5T1G A;  1LM0 A;  2YYZ A;  3CW2 C;  4LUO A;  4MNO A;  1BCP D;  2MO0 A;  2FIN B;  3HOV B;  2HDL A;  1XXG A;  3G7L A;  3ZJY C;  4CDF C;  1SMY D;  3HKZ E;  1HUN A;  5FOB B;  1EL0 A;  1VQJ A;  3ERQ A;  4F7X A;  2L55 A;  1PH8 A;  1BKB A;  2JA8 B;  1O80 A;  3H6M A;  1JOK A;  4DR2 L;  2VB2 X;  1QE6 A;  1LAC A;  2NVX H;  5JOB A;  1TY0 A;  5CV4 A;  2EXD A;  2FHT A;  2G5D A;  1MGS A;  3GD7 A;  1K8G A;  2VUM G;  3S14 H;  4DU9 A;  4E6I A;  1WJJ A;  2R7Z G;  4DV2 Q;  4IO9 A;  2ZJQ A;  1KTK A;  3J81 E;  1E2W A;  2QKI C;  4C3H H;  1PRT B;  4BBS H;  4JI3 Q;  3PMF A;  2Z6B A;  2D0O A;  5IT9 c;  1D2B A;  2EJM A;  3T56 B;  5I2X A;  2WB1 E;  5E4W C;  3HEJ A;  4L5R C;  4A3B H;  3GTK H;  1EIH A;  1K3R A;  3Q24 A;  2MP1 A;  2KQ3 A;  5BR8 L;  1NSN S;  2FMM A;  1Q3L A;  1SNM A;  1GUN A;  3G6J B;  1C7Y A;  1CZW A;  3J81 c;  1KL9 A;  1Z7T A;  5K36 G;  4JCV E;  1X3P A; 
#chains in the Genus database with same CATH homology
 3ULL A;  1D8L A;  4HJ9 A;  2CCZ A;  3RNU A;  4BBR G;  2YTX A;  1IZ6 A;  3STB D;  1NE3 A;  1P16 A;  4LW1 A;  4P73 A;  1UEB A;  4JI8 Q;  3L2P A;  1JJC B;  1N36 L;  3J7A 5;  3CCU A;  1WI5 A;  3H0G H;  2ALY B;  5J3B A;  1X55 A;  2KCM A;  3I2Z A;  1TWH H;  3E0E A;  3PUY A;  5M3F G;  3HOW H;  1G51 A;  3ER0 A;  4UP7 A;  3EN2 A;  4EQ5 A;  5IYC G;  3F2D A;  4DUY Q;  2AMC B;  4P72 A;  4DV3 Q;  3L7Z C;  5LMU L;  1IXR A;  4LNQ A;  3MXN B;  1W2B A;  1YBY A;  4ME3 A;  1VQB A;  5GAD C;  4DV1 Q;  1O7I A;  2CWP A;  3ICE A;  1I94 Q;  2KCT A;  4NXM L;  4LUV A;  1L0W A;  3JAM i;  2ZM6 Q;  4WJ3 M;  1LUZ A;  1HZ9 A;  5IWA Q;  1CKO A;  2AWO A;  4PZ6 A;  1OTC A;  4A3C G;  3TRZ A;  1LYL A;  3CF5 A;  1CSP A;  4DR3 L;  2HIV A;  4DK3 C;  1N32 L;  1BBU A;  5AJ3 L;  4KI0 A;  3UDG A;  3HOX G;  2CQO A;  3CMA A;  4X66 L;  2R7Z H;  3SGI A;  3TEH B;  3U58 A;  2BA1 A;  2K5H A;  4UP8 A;  1VQH A;  2R92 H;  1U5K A;  1FGU A;  1VQG A;  1N36 Q;  2Q2U A;  4DUZ Q;  2UXC Q;  2GN5 A;  1V9P A;  1YI2 A;  4DV4 L;  3GTL H;  4DR2 Q;  4LF7 L;  2F4V L;  1HR0 W;  1HNZ L;  4LFA Q;  2UXC L;  1VS0 A;  3KFU A;  2UUC Q;  5IYD G;  4DV6 Q;  4A76 A;  4DNI A;  2YTV A;  5LMU Q;  3GTM H;  4GOP C;  2Y0S E;  3KOJ A;  2ZJP A;  3HOV G;  3H15 A;  4PZ7 A;  4AH6 A;  1BBW A;  4GLX A;  1TXY A;  1Y14 B;  3H0G G;  4IJL A;  4KLK A;  3GTJ H;  2XTI A;  1K8A C;  1EOV A;  2UUB Q;  3HFZ B;  4BY7 H;  4DKA C;  1NJI C;  1WCM H;  4JI5 Q;  4RG1 A;  4R4T A;  5IWA L;  5IP7 G;  4OX9 L;  4RMF A;  1VQN A;  2N8N A;  3S2H H;  4GLA C;  4JBK A;  4LF6 L;  2PMZ E;  4R4O A;  4JI8 L;  1XMQ Q;  1PV4 A;  2YU9 H;  4C2M H;  3HOY H;  1VQF A;  4MZ9 A;  3UDI A;  1GD7 A;  1XTD A;  2XGT A;  4OWX B;  1EQR A;  4YWK A;  1UE6 A;  1SFO H;  2WFW A;  2PNH A;  1T9H A;  3CXC A;  2OTL A;  2MFI A;  4IPD A;  4BXX H;  4IFD G;  4A3G G;  3W5O A;  3FKI G;  2BH2 A;  1YEZ A;  2JA6 H;  3HOU H;  1HH2 P;  3I55 A;  4B3M L;  3CPW A;  5ELN A;  3T1H L;  1N33 Q;  2PI2 A;  1Q8K A;  1ASZ A;  4MTN A;  1VQK A;  1XNR L;  1YZ6 A;  4LF7 Q;  1WOC A;  2K14 A;  2L15 A;  1VQ4 A;  3EBE A;  2UUA Q;  1KD1 C;  3S1R H;  4Y7N H;  1NMF A;  3S24 A;  1PVO A;  3K81 C;  4DR4 Q;  4NXM Q;  1I5F A;  4AIM A;  1PFS A;  3K7A H;  4GKK Q;  3TS2 A;  4JV5 Q;  3NEM A;  5FLM G;  2EQS A;  2JQO A;  4A93 G;  4JYA L;  1HNX L;  1LTL A;  1JJG A;  2D0P A;  3PUX A;  4JI0 Q;  1VQI A;  1IBK Q;  1N9W A;  2AHO B;  1YIJ A;  2YV5 A;  1IBM Q;  3HOY G;  4X64 Q;  3CCL A;  1Q86 C;  4L5T A;  2Q2I A;  1P8L A;  3G4S A;  4A3E G;  1Y1W H;  1L1O A;  4NXN L;  2JA5 G;  1SR3 A;  1EQQ A;  1QUQ A;  3OW2 A;  2UU9 Q;  4LF6 Q;  4X6A H;  1AH9 A;  2CFM A;  2ZTE A;  1WCM G;  2NVY H;  5C3E G;  2N3S A;  2I5L X;  2KHI A;  5IE8 A;  1TWA H;  5M3M H;  4GNX C;  4JBM A;  2A19 A;  4DV7 Q;  3F8T A;  5C3E H;  4YY3 Q;  4JI1 Q;  3KF6 A;  3J7Z C;  4DV0 Q;  1N34 L;  1PH6 A;  1M1K C;  3K80 C;  1FJG Q;  1E24 A;  4B3T Q;  3HKS A;  4B3S L;  2JJQ A;  2K50 A;  4DV6 L;  1UE5 A;  1X3E A;  4DV0 L;  1Z9F A;  5JJK A;  1A8V A;  4JV5 L;  5C44 H;  3KF8 B;  1RIP A;  2RHQ B;  4IFD I;  5HGQ A;  1B7Y B;  1HNW L;  4A3L G;  2B29 A;  4DV5 Q;  1X3F A;  5C44 G;  3I4M G;  2R7F A;  1VQO A;  1QVC A;  3OTO Q;  4DAY B;  2QEX A;  1EUJ A;  4IPC A;  5E7N A;  4X64 L;  2R7D A;  1WFQ A;  1YIT A;  1Y1W G;  3PF5 A;  2UUB L;  4GN3 B;  2JA8 H;  4QIW E;  1G6P A;  5ELO A;  4C3J H;  4QY7 A;  5AJ3 Q;  1QZG A;  4EX5 A;  3G6E A;  3CCM A;  4YHH Q;  3FKI H;  4DV7 L;  3RN2 A;  4OWW B;  4A93 H;  4GNX A;  2H5X A;  4JBJ A;  2R93 G;  4DV4 Q;  1HZC A;  1VQ8 A;  3AFP A;  4C3I H;  1SRU A;  4O2D A;  3UE0 A;  4A4I A;  4DUZ L;  4IOC A;  2IX0 A;  1B70 B;  2KEN A;  2ID0 A;  3E9H A;  3CCS A;  1MJE A;  3M85 A;  3CCV A;  3L0O A;  4OO1 G;  4B3M Q;  4B3T L;  3Q8D A;  4DV2 L;  2UXD Q;  4JI7 Q;  2Z6K A;  2JA7 G;  4DUY L;  1UWV A;  3RR5 A;  4GOP A;  4A3K H;  1MIU A;  3KDF A;  2HHH Q;  4P75 A;  4JC0 A;  4DR3 Q;  4LF5 Q;  4H02 A;  3OTO L;  1HR0 Q;  4APV A;  4DV5 L;  4GNX B;  1D7Q A;  1X3G A;  3RLO A;  1XJV A;  2EIF A;  1KRS A;  3E9I A;  5FLM H;  2MO1 A;  3AYH B;  3ULJ A;  2UU9 L;  1QZH A;  4DPG A;  4A3J G;  1RL2 A;  3A5Z B;  4A3I G;  2OQ0 A;  1YJN A;  3G48 A;  5C0X I;  2ZJR A;  2E8G A;  2R92 G;  4GOP B;  2RF4 A;  3PSI A;  3PUW A;  4YY3 L;  1EIY B;  3CQZ H;  1JT8 A;  1H95 A;  3LGJ A;  3I56 A;  4K0K L;  3OYY A;  2Y0S G;  1ASY A;  2DUD A;  3A5U A;  1QVG A;  1NBW A;  3J80 i;  1J5E Q;  3PIO A;  5LMN Q;  3KYH C;  1VQ9 A;  3I4M H;  4J15 A;  4IOA A;  4DR5 Q;  1HNW Q;  3S17 H;  1OXU A;  1G29 1;  1XPR A;  1GO3 E;  4HIM A;  1JMC A;  2GVA A;  3GO5 A;  1Q7Y C;  1EFW A;  1VQA A;  1UE1 A;  2VQE L;  3ERS X;  2ZTC A;  4JBW A;  5C4X H;  4JYA Q;  2UXB Q;  2OQK A;  2CKZ B;  2AWN A;  3U50 C;  4OON A;  4HJ7 A;  1VQP A;  4BY1 H;  2I0Q A;  4IPG A;  4GS3 A;  1I3Q H;  3RLN A;  3STB C;  2VS1 A;  4HJA A;  5JEA G;  1Q81 C;  1M90 C;  4JI3 L;  3JAM c;  2E5L L;  4OX9 Q;  2JK8 A;  2C35 B;  1Q46 A;  5M3M G;  2VW9 A;  4LFC L;  1KQS A;  1V43 A;  3T1H Q;  5GAG C;  2K4K A;  4QL5 A;  2VY3 A;  3PV0 A;  1KIX A;  3S15 H;  2FXQ A;  2VL6 A;  4JOI A;  4ALP A;  2JA8 G;  1FJG L;  1E22 A;  1L1O B;  4LF4 L;  2VZA A;  4A3F H;  1TWF H;  5FLX c;  1YHA A;  1CUK A;  1KRT A;  2KBN A;  1HNZ Q;  5C4X G;  4TQU S;  5EAY A;  1FL0 A;  4DR4 L;  3VDY A;  5LMN L;  3TRE A;  1EIF A;  4X62 Q;  4GKK L;  2IHE A;  1XNQ Q;  4AQY Q;  1K83 H;  3S2D H;  1GM5 A;  4LFB L;  5C0X G;  3I7F A;  1HR0 L;  3PUZ A;  3M4O H;  1XMO L;  3GTP H;  3D0F A;  2LSS A;  1I94 L;  1PYB A;  2HHH L;  4JI5 L;  3F2B A;  1OXT A;  2B3G A;  4PG3 A;  3AQQ A;  4L5Q A;  1E3P A;  2OTJ A;  1FVI A;  5M5X H;  2MQH A;  2NZH A;  3UDF A;  1E7Z A;  2LXJ A;  2BA0 A;  5M3F H;  4A3L H;  3CC7 A;  1IBL L;  4LF8 L;  2ASB A;  5M5W H;  1EYG A;  2F4V Q;  3S1N H;  1QVF A;  3JC6 6;  1K0R A;  3PGZ A;  4BBR H;  2JA5 H;  1C0A A;  1IBL Q;  4LF8 Q;  1A63 A;  3ULP A;  4IPH A;  4BY1 G;  3WWV A;  1OXX K;  3RN5 A;  4QGU A;  3NEN A;  2HT1 A;  5IP7 H;  4GLV B;  3I4N H;  4O0A A;  3CC2 A;  3J81 i;  4JG2 A;  1VQE A;  1N8R C;  3CCJ A;  2YTY A;  3F2C A;  1OXV A;  3B6Y A;  4A3G H;  4B3R Q;  1XMO Q;  1OXS C;  4HIK A;  1PYS B;  4AYB G;  1YJW A;  1XMQ L;  3KJP A;  5IYB H;  1E1O A;  2NN6 I;  4QJF A;  3GDE A;  1VQ5 A;  2ZM6 L;  1X56 A;  5IP9 H;  4R4C A;  1HZA A;  2WAQ G;  4DR1 Q;  4LUZ A;  2ATW A;  5JEA J;  3U4Z A;  5JJL A;  5GAE C;  5LMN W;  2BH8 A;  4YCU A;  3KJO A;  4FDB A;  3RZD H;  4IFD J;  3GTO H;  4LFA L;  5IYD H;  5IY0 A;  3HOZ H;  2AKW B;  4BBS G;  1EWI A;  1MJC A;  1IL2 A;  1XNQ L;  4PMW A;  2KHJ A;  4XTC S;  1KC8 C;  4A3B G;  2HQL A;  1JB7 A;  2DGY A;  2D62 A;  1C9O A;  1Y1V G;  4JI2 Q;  2R93 H;  4BY7 G;  4HJ8 A;  3H3V H;  1CKN B;  4DR7 Q;  2F52 A;  4A3M G;  1VQL A;  1SMX A;  2JE6 I;  2UXB L;  2VQF Q;  1IBM L;  2CWA A;  1Q1B A;  3FP9 A;  2IT1 A;  1A62 A;  4JI0 L;  4GN5 A;  4KHP L;  3HOX H;  1V1Q A;  2K5V A;  1K9M C;  5IP9 G;  3NBH B;  4X65 Q;  1XPU A;  3HKZ G;  5GRO A;  2IY5 B;  2A1A A;  1HZB A;  2E2I H;  2ES2 A;  3M3Y H;  2WB1 G;  4IJH A;  1CSQ A;  3K0X A;  2E5L Q;  1E1T A;  1HJP A;  1I6H H;  1IYJ B;  5HY6 A;  1SRO A;  3W1B A;  1L2F A;  2RHS B;  1YHB A;  1YVC A;  3UE1 A;  3D31 A;  3W1G A;  3BZK A;  4NXN Q;  3DM3 A;  4B3S Q;  2A8V A;  3PO2 H;  3G71 A;  4DV3 L;  3I4O A;  5FJ8 H;  4WJ4 A;  2PI2 E;  1YJ9 A;  2Z0S A;  3CPF A;  2NVQ H;  2B63 G;  3I4N G;  4JI2 L;  4HJ5 A;  3CD6 A;  2V1C C;  2N78 A;  1JE5 A;  3PF4 A;  3S1Q H;  1X65 A;  3CAM A;  4DR7 L;  4UP9 A;  1Q82 C;  4GKJ Q;  4JI6 L;  3BZC A;  4LFB Q;  3CCQ A;  2JEB I;  3DLL A;  5BR8 Q;  1BVS A;  3AFQ A;  4X62 L;  4POG A;  1VQ6 A;  5GAH C;  5H1S E;  5DLQ E;  1PH5 A;  3FHW A;  1K73 C;  1Q1E A;  4HIO A;  1S40 A;  4NB3 A;  1PH1 A;  1NMG A;  4A3E H;  4L5S A;  4B3R L;  4P71 A;  2NVT H;  4OO1 I;  2IX1 A;  1SE8 A;  1I50 H;  1TWC H;  4YWM A;  3J81 j;  2VNU D;  1UE7 A;  4UPA A;  4A3C H;  1B8A A;  3K7U C;  1KHI A;  5FJ8 G;  3TQY A;  1PH4 A;  1CKM A;  3CP0 A;  4JI4 L;  4DR1 L;  4A3I H;  1GKH A;  2I5M X;  4KHZ A;  1TWG H;  2F3I A;  4POF A;  2E2H H;  4A3D H;  3S16 H;  3HOW G;  1AE3 A;  1XNR Q;  4HID A;  1DGS A;  4JI4 Q;  3PUV A;  3MEF A;  3U4V A;  4DK6 C;  4DAM A;  5M5Y H;  4A3K G;  1X54 A;  1XPO A;  3GTG H;  2N49 A;  4JOI C;  5IYC H;  2Z6K C;  4PZ8 A;  1VQD A;  2RCN A;  3NEL A;  1PH7 A;  2B63 H;  4DR6 Q;  4JI7 L;  4Y52 H;  4AYB E;  2JA9 A;  1X6O A;  1KXL A;  2JA6 G;  3HOU G;  2I5H A;  1HNX Q;  3PO3 G;  2NZO A;  3UDX A;  1CKN A;  3A0J A;  4OXP A;  3HOV H;  4BXX G;  1MKH A;  2OCE A;  4DR5 L;  2UUC L;  4TVA B;  2E2J H;  1Z47 A;  3T1Y Q;  4QQB X;  4A3M H;  2PQA B;  1LM0 A;  3RLF A;  4BA2 I;  2YYZ A;  3CW2 C;  4LUO A;  4MNO A;  2MO0 A;  4A75 A;  3M4P A;  5JJI A;  3CME A;  4XIG S;  3T1Y L;  4A3F G;  3ZJY C;  3HKZ E;  3HOZ G;  3GTQ H;  3A74 A;  1A0I A;  1GVP A;  1N34 Q;  1VQJ A;  4X66 Q;  3RZO H;  5C0X J;  1PH2 A;  3M4Q A;  1W3S A;  1PH8 A;  2PQA A;  1BKB A;  4JI1 L;  1YNX A;  4R4Q A;  2OWO A;  3IRB A;  3EIV A;  2Q2H A;  4R1J A;  4DR2 L;  2Q2T A;  1VQC A;  1PA6 A;  4JI6 Q;  1J6Q A;  1X9N A;  1YHQ A;  2NVX H;  4BA1 I;  4GKJ L;  4YCW A;  4OWT B;  4GN4 B;  2EXD A;  4LF5 L;  1N33 L;  2NN6 G;  5GQO A;  3PO2 G;  2VUM G;  3GD7 A;  2LXK A;  4DV1 L;  1K8G A;  3S14 H;  3KDF B;  3CCE A;  1WJJ A;  2R6G A;  1IBK L;  2VQE Q;  2R7Z G;  4DV2 Q;  1S3O A;  2VQF L;  2WAQ E;  4NPS A;  4IO9 A;  1R9T H;  2ZJQ A;  4LF9 Q;  1N32 Q;  3M7N A;  4C3H H;  1NY4 A;  3PCO B;  4R4I A;  3J80 c;  4A3J H;  3BJU A;  1SN8 A;  2K5N A;  4LFC Q;  4BBS H;  4JI3 Q;  1L1O C;  1Q12 A;  2D0O A;  3H3V I;  1VCI A;  1S72 A;  5IT9 c;  5IYB G;  4YHH L;  2QA4 A;  2K75 A;  2WB1 E;  4A3D G;  2VUM H;  3KF6 B;  3K8A A;  1KAW A;  3PIP A;  3F1Z A;  4DR6 L;  1PH9 A;  2HIX A;  4LF4 Q;  4LWC A;  1Y1V H;  1NTG A;  3TS0 A;  1SLJ A;  2JEA I;  2UXD L;  2IHF A;  2WP8 J;  1VQ7 A;  4L5R C;  3CC4 A;  2JA7 H;  3BU2 A;  1AE2 A;  4A3B H;  3GTK H;  1K3R A;  4P74 A;  1QUQ B;  1J5E L;  1PH3 A;  5BR8 L;  2MNA A;  1PHJ A;  5C4J H;  1JJ2 A;  3AEV A;  4AQY L;  4K0K Q;  2UUA L;  1WYD A;  4YWL A;  2K52 A;  4X65 L;  4UY8 C;  1C7Y A;  3J81 c;  1U0L A;  1KL9 A;  3PO3 H;  4KHP Q;  4YCV A;  2QGQ A;  1VQM A;  4LF9 L;  5K36 G;  3M9B A;  3S1M H;  2ZTD A;  4JCV E;  3CCR A;  2GVB A;  3KLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...