2K5HA

Solution nmr structure of protein encoded by mth693 from methanobacterium thermoautotrophicum: northeast structural genomics consortium target tt824a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
101
structure length
101
Chain Sequence
MGSSHHHHHHSSGRENLYFQGHMAARITGEPSKKAVSDRLIGRKGVVMEAISPQNSGLVKVDGETWRATSGTVLDVGEEVSVKAIEGVKLVVEKLEEQKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved protein
publication title Solution NMR structure of protein encoded by MTH693 from Methanobacterium thermoautotrophicum: Northeast Structural Genomics Consortium target tt824a
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Structural genomics, unknown function
total genus 10
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2008-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2k5hA01
1K8GA 1BKBA 4AQYL 1MJEA 4DR2Q 4DR4L 1X56A 3S14H 2XTIA 2PNHA 4P74A 2JA9A 3W1BA 2Z0SA 5AJ3Q 3HOWG 4IOCA 1YBYA 5FJ8H 1X9NA 1N36L 1IL2A 2B63G 2K75A 4DR3L 5M3FH 1CKNA 4C3IH 4A3JH 4BY1H 1I94Q 4JI4L 1VQGA 4BBSH 4YWMA 1N33L 4OWTB 1OXSC 4DV5L 5GROA 2UUAL 4A3MG 3AEVA 1XTDA 3PUYA 1PH9A 2UXDQ 4LFAQ 4GS3A 5JJIA 4BA1I 3I2ZA 1Q81C 3ZJYC 4X64L 1XMOQ 3S1NH 2K5VA 1HNXQ 2MNAA 1WYDA 4A3LG 1WOCA 2RF4A 4C3JH 3AYHB 4AQYQ 1E22A 1N34L 3PUWA 1VQBA 3ULPA 4JBWA 1BBUA 2GVAA 4LW1A 4YY3L 2QA4A 2AHOB 4DUZQ 2GN5A 4GN3B 1YJ9A 2JQOA 1Q46A 4DR3Q 1SRUA 2K52A 3WWVA 4A93G 4LUVA 4PZ6A 1WCMG 3I4NH 2NZHA 3J80c 1N33Q 3M85A 1N8RC 4DV6Q 3KF6B 1KXLA 2D0OA 3I4OA 2UUAQ 4B3RL 2UUBQ 3CC2A 3KF8B 4L5SA 2JA8H 2R93G 4X66Q 3AQQA 4GNXC 2QEXA 1J5EL 1GM5A 2YTVA 2OTLA 4A3EH 1PH7A 1B8AA 2OCEA 1H95A 4JBJA 2VQFL 2E2IH 3CCRA 3CQZH 1E24A 5LMNW 4BXXH 1D7QA 5GAHC 1OTCA 4AYBG 1SE8A 4UY8C 2I5HA 4DV1L 4R4TA 4A3GG 4IJLA 1Z9FA 1P16A 2R7DA 1X6OA 3A74A 3CCEA 1IXRA 1KD1C 2JA6G 3NENA 2OQ0A 3S1MH 3D31A 2WFWA 3BJUA 3FHWA 3I7FA 5M5WH 2ZJRA 4IOAA 2ZTDA 3HOUH 2UUCL 1JJCB 3M9BA 4QIWE 3G48A 4JI7L 3K8AA 3K7AH 4UP8A 4JI6Q 2JEBI 3HOWH 3S24A 4GKJL 4KHZA 2B63H 2PMZE 3A0JA 4HJ5A 1HNWL 1Y1WG 3EN2A 1MJCA 3I4MG 4JI5Q 4GKKQ 2HIVA 4DV3Q 4JOIC 4DNIA 1VQFA 2K4KA 5J3BA 4A3MH 1G6PA 1OXUA 2YU9H 4DPGA 1SN8A 4NXNL 3KOJA 2R7ZG 1AE3A 1UE6A 1PV4A 3PUVA 4DR7L 1HR0Q 1L2FA 4OO1G 5K36G 1JT8A 4YCWA 4A3LH 2WAQE 3UDFA 2UUCQ 1BBWA 3T1YQ 2R92G 4A3DG 4JBKA 1PHJA 1N9WA 4GN4B 4JI8L 4YHHQ 2ZM6Q 3ER0A 4GKJQ 4IPCA 2YYZA 2NZOA 1IZ6A 5IYBG 1HJPA 3J7ZC 1T9HA 2IX1A 1NBWA 1NY4A 5FLXc 4A93H 3PGZA 1QVGA 4LNQA 1WCMH 1TWHH 1JMCA 1PFSA 1QUQB 2Y0SE 1EIFA 3CAMA 4DV4L 4LF5L 2EQSA 2R93H 4DR7Q 1KRTA 4QGUA 5LMUL 1X55A 4DR2L 1EYGA 1Q82C 1CKMA 5AJ3L 3OW2A 1TWFH 3KYHC 2E2HH 1VQIA 1YHBA 5IWAQ 2WAQG 4PZ8A 5GAEC 3K81C 4HJ9A 4Y7NH 1JJGA 4JG2A 3M4QA 3G4SA 4MZ9A 1PH6A 1I94L 4A3GH 4DK3C 2K14A 2JA6H 4APVA 2JA5G 3M4OH 3CC7A 4LFAL 2A1AA 1XNRL 1X3FA 2NN6I 1SROA 3CXCA 2NVTH 3FKIG 1VQLA 2A8VA 1XMOL 2Y0SG 3KJOA 2YTXA 4LF5Q 2ZJQA 2CKZB 3U4VA 4LF9Q 5LMUQ 4IJHA 1Y1WH 4OWWB 2L15A 1A0IA 1C9OA 4DUZL 1W2BA 1VQJA 1N32Q 1PYBA 2QGQA 1YJWA 5EAYA 4RMFA 2ES2A 1U5KA 3H15A 2A19A 4GOPB 1QVCA 4AIMA 1A8VA 4B3TQ 1VQCA 4DV6L 2R7ZH 3NBHB 3RN5A 2VY3A 2UUBL 1FJGL 1UEBA 3DM3A 4JCVE 4LUOA 4X66L 1XNRQ 4BY7G 5IYDG 2Z6KA 3GTJH 1P8LA 2HQLA 2YTYA 2OTJA 2WP8J 3FP9A 4DK6C 3CF5A 4A3DH 4HIKA 2AMCB 3RLNA 3TEHB 5IYBH 2F3IA 1PH3A 1VQDA 1I5FA 4DV0Q 1X3EA 3F2CA 2Q2IA 4JI1Q 3PSIA 4PG3A 1TWAH 3K80C 5IT9c 4A3BG 3TREA 1DGSA 3L0OA 3S2DH 1VQMA 2ID0A 3KF6A 1NJIC 2JA7H 4QY7A 3GTOH 4A3CG 1OXVA 2IY5B 3E9IA 4IFDG 4X65Q 3CCJA 1IYJB 3MXNB 5ELNA 5C0XG 4IO9A 1IBML 3Q8DA 4B3MQ 1EWIA 1FJGQ 4R1JA 4JI6L 4WJ4A 4LF6Q 1O7IA 2DUDA 4LFBQ 1UE7A 3E0EA 1SMXA 1UE1A 2D0PA 4A3IG 2NVQH 1YHQA 4JI5L 1V9PA 3J80i 3AFPA 1ASZA 3GTMH 4GKKL 4DV3L 1HZBA 5C3EG 2OQKA 5C44G 4R4IA 3PF4A 3J7A5 3OTOQ 3STBD 1U0LA 4O2DA 1LUZA 1YIJA 4RG1A 2JA5H 1I50H 5JJKA 3HOXG 5E7NA 4MNOA 2VUMG 2VL6A 1SR3A 3FKIH 1CUKA 1HR0L 3NELA 1V1QA 1TWGH 2K50A 3UDGA 5FLMG 1AH9A 3CPWA 3EBEA 3T1YL 2MO0A 1AE2A 2RCNA 4A4IA 3I56A 1RL2A 3T1HL 1IBMQ 5IP9G 3W5OA 3ICEA 3RNUA 4YHHL 2ZM6L 4X6AH 2PI2A 3HOVG 4XTCS 2ALYB 1A63A 5LMNQ 1IBKL 5JEAG 4UP7A 3CCUA 1VQ9A 3G71A 1SLJA 4IFDJ 2HT1A 2VZAA 1KQSA 1MIUA 5C0XJ 2B3GA 3PIPA 1L1OB 1EIYB 5IYCG 4P71A 5M5XH 3KFUA 3GO5A 4DV7L 2Q2TA 2VS1A 4BY7H 1V43A 1HR0W 3CC4A 4OO1I 2PI2E 1KC8C 3M3YH 2CWAA 5C4XG 2WB1E 3RLFA 5IWAL 1E3PA 2MO1A 2N78A 5IY0A 1VQHA 1G51A 2NVYH 3T1HQ 1ASYA 3GTKH 1X3GA 1Y1VG 1TWCH 1NMFA 1XJVA 1IBLQ 2KBNA 1I6HH 1NMGA 1XMQQ 4OX9L 3H3VH 4A3BH 4OXPA 1VQ5A 1QUQA 1PH8A 1IBKQ 2IT1A 5M3FG 1EQRA 4A3JG 4GLVB 3KJPA 1E1TA 1Q7YC 4A3CH 4BBSG 2YV5A 5ELOA 3TQYA 3CCVA 1QZGA 3PO2G 1B7YB 3PV0A 1FL0A 4DV7Q 4H02A 3HOYG 4TQUS 1HZCA 1YEZA 1XPOA 4LF9L 3CCMA 4KI0A 3RZDH 4DAMA 1VQNA 4JI0L 1PH4A 4A3IH 5JEAJ 4A3KG 2JK8A 3A5ZB 4EQ5A 3H0GG 1OXTA 2BA1A 2GVBA 2KHIA 1N32L 2VNUD 1SFOH 3STBC 5C3EH 5C44H 1Q12A 4JI3L 3JAMc 1PH1A 3W1GA 1S40A 3F2BA 4POGA 3PO3G 1E7ZA 4GNXA 3CD6A 4DKAC 3BU2A 4B3TL 3AFQA 3PCOB 4OX9Q 2VUMH 3CCLA 4LF4Q 2I5MX 4GNXB 2CQOA 5FLMH 4EX5A 4J15A 3UDIA 3M7NA 1WJJA 3S15H 1PA6A 1OXXK 2C35B 4FDBA 3JAMi 1HNZL 1C0AA 5IP7G 4JV5Q 1WFQA 5IP9H 4P75A 2F4VL 3PF5A 2AWOA 1KHIA 1LYLA 4HIOA 4K0KQ 3GDEA 5HY6A 4JI0Q 3HOVH 1GKHA 4MTNA 1BVSA 4ME3A 4DV0L 3I4MH 1Q1EA 4A76A 4JI1L 1VQKA 5C4JH 2JE6I 4C3HH 4GOPA 3GTQH 2JJQA 4JI3Q 4HIMA 5IYCH 4LFCQ 3CMAA 3CP0A 4YCUA 1YITA 1LM0A 4JYAQ 4A3FG 1LTLA 4X65L 3A5UA 4HJ8A 1PH5A 2NVXH 2IX0A 3RLOA 2B29A 4DR6Q 4B3ML 4HJAA 2FXQA 4XIGS 5C4XH 5JJLA 4LF6L 4LFBL 3JC66 1YZ6A 2E5LQ 3CMEA 2UXCL 4LWCA 2R92H 5HGQA 3TS0A 2R7FA 1R9TH 1HNZQ 2OWOA 2JEAI 4Y52H 4TVAB 3S1RH 1Y1VH 2N3SA 3BZKA 2UXBL 3KLWA 3B6YA 4R4QA 2MFIA 3UDXA 1MKHA 2F4VQ 4WJ3M 1Q1BA 2BA0A 4X62L 3S2HH 3OTOL 4DV2Q 3HOZG 2KCMA 2I5LX 2PQAA 3UE1A 5M3MG 4LF8Q 2BH2A 1VQAA 1EUJA 5DLQE 3L7ZC 1K73C 4C2MH 1HZAA 5H1SE 3K0XA 4LF7L 2PQAB 1YNXA 4POFA 3H3VI 1PVOA 1CKNB 2ASBA 3PO2H 4O0AA 4JI2L 2KENA 3HOYH 3TRZA 4R4OA 3U4ZA 1Z47A 1FVIA 2CWPA 3F8TA 1GO3E 3HFZB 4IFDI 2ZTEA 4NXMQ 5C0XI 2I0QA 2HHHQ 2IHEA 4YWLA 2LXJA 4A3KH 4JBMA 2RHQB 3I55A 1VS0A 4JC0A 1KAWA 1CSQA 3H0GH 2UXCQ 3ERSX 3UE0A 5LMNL 4B3SL 1K8AC 1PYSB 4DR4Q 4AYBE 3J81c 3HKSA 2LSSA 2UXBQ 4L5QA 4KHPL 4ALPA 3PO3H 1M90C 3GD7A 4YWKA 3DLLA 4X62Q 1NE3A 1N36Q 1YVCA 2HIXA 4DR1L 1VQ4A 4L5TA 4JI4Q 4PZ7A 2KHJA 4LF7Q 1UE5A 4UPAA 3J81i 2AWNA 3J81j 5IP7H 4JI2Q 4DV5Q 2R6GA 2ZJPA 4QJFA 2ZTCA 3RN2A 2CFMA 1M1KC 4L5RC 4X64Q 1IBLL 4GN5A 1XNQL 1Y14B 4IPHA 1XMQL 3L2PA 3G6EA 1TXYA 1QVFA 2VQEL 4B3SQ 1JJ2A 1EQQA 3GTPH 1N34Q 1L1OA 3CW2C 3CCQA 3F1ZA 1Q86C 4KHPQ 1HH2P 4A3FH 4YY3Q 5GQOA 4YCVA 1RIPA 4P72A 4BBRG 1KRSA 5IE8A 3LGJA 5M5YH 4DR1Q 5BR8L 4DR5L 4NPSA 1VQEA 4UP9A 2CCZA 2EIFA 3U50C 3HOUG 4HJ7A 3U58A 4OWXB 5IYDH 4DAYB 1S3OA 4GOPC 2DGYA 4B3RQ 2JA8G 5GAGC 1CSPA 2VW9A 1VQPA 1S72A 1UWVA 4PMWA 1J5EQ 3HOZH 1L0WA 5M3MH 2VQFQ 1WI5A 2E8GA 1XNQQ 1KL9A 5FJ8G 2N8NA 4P73A 4A75A 2VQEQ 2Z6KC 4LF4L 1D8LA 3EIVA 1K83H 4BY1G 4DV1Q 4GLXA 1VQ6A 2H5XA 2ATWA 1VQ7A 1J6QA 4QL5A 2RHSB 1EFWA 2K5HA 2K5NA 4JV5L 3CPFA 3PUXA 5BR8Q 4DR5Q 2UU9L 2Q2HA 1EOVA 4AH6A 4K0KL 2AKWB 2XGTA 3OYYA 5GADC 1C7YA 3S16H 3GTLH 4JI7Q 1HZ9A 2WB1G 1YI2A 4KLKA 1K9MC 1G291 3GTGH 3S1QH 3HKZE 2Q2UA 4OONA 1B70B 1NTGA 1GD7A 4LUZA 1HNWQ 4LFCL 1JB7A 3E9HA 1KIXA 4JYAL 3RZOH 1K0RA 1VCIA 2V1CC 3CCSA 3HOXH 3IRBA 4DR6L 1CKOA 2EXDA 2LXKA 4IPGA 3ULLA 1XPRA 4HIDA 2E2JH 2JA7G 1GVPA 3ULJA 3SGIA 2E5LL 3K7UC 3I4NG 4DUYL 1VQ8A 1VQOA 1E1OA 4NXNQ 2KCTA 3D0FA 1X65A 3PUZA 3NEMA 2F52A 2UU9Q 1FGUA 3PIOA 1JE5A 1YJNA 1PH2A 3M4PA 4QQBX 1K3RA 3MEFA 4DV2L 4A3EG 3S17H 4LF8L 2N49A 4JI8Q 2BH8A 2MQHA 4BXXG 3KDFA 1XPUA 1Q8KA 3TS2A 3HKZG 4NB3A 4BBRH 2IHFA 1W3SA 1X54A 2UXDL 3KDFB 4BA2I 4R4CA 2NN6G 1A62A 1QZHA 4NXML 2HHHL 3F2DA 3BZCA 1YHAA 2D62A 4GLAC 4IPDA 3VDYA 4DV4Q 1HNXL 3RR5A 1I3QH 4JOIA 1L1OC 4DUYQ
chains in the Genus database with same CATH superfamily
3T56B 1K8GA 1BKBA 1MJEA 4IQZA 1DD2A 2JA9A 5AJ3Q 2CQAA 1YBYA 5FJ8H 3D6WA 1K3BC 3BDCA 2K75A 2IW3A 1PFBA 5HURA 3ND9A 5M3FH 3RZDB 2A6EC 2RBMA 4BY1H 4YWMA 3EJIA 4OEMB 1N33L 4OWTB 1OXSC 2UUAL 4Y7NB 4DNTB 1SFOB 2UXDQ 2B2UC 4GS3A 5JJIA 3C46A 3I2ZA 1Q81C 3ZJYC 2K5VA 1WOCA 3DEOA 3AYHB 1N34L 2EY6A 1CHQD 1VQBA 1BBUA 4YY3L 1HUMA 2JXMB 4DUZQ 4CJ2C 2K52A 4RCNA 2OF1A 2OEOA 5JJZA 3HOVB 4A93G 1WCMG 2FMMA 5IODA 3I4MB 3J80c 1GUGA 5C4JB 3K0YA 1F9SA 1M4VA 3U9OA 3E0JA 3KF8B 2JA8H 3FDTA 4X66Q 3H09A 1PH7A 2OCEA 2XN9C 1H95A 2RDHA 1SYEA 4Q5VA 3CCRA 1S5DD 3CQZH 5LMNW 4BXXH 1IKMA 5GAHC 1MBYA 5KNBA 2L9HA 3S1RB 1KD1C 1X6OA 2NN6H 1IXRA 2F0TA 2OQ0A 1H9RA 3BJUA 2PMZB 4IOAA 3D3RA 4PV1C 3SEBA 3HOUH 2F0FA 3M9BA 3HG9A 4C2MB 3D4DA 3K7AH 1A15A 1EYCA 1SNMA 3CKIB 4MTKA 1EY4A 2B63H 2PMZE 5CV8A 1HTLD 2IJ0A 2A5HA 5D65A 5CC4A 4JI5Q 3PMFA 1GUWA 4XQQA 2C5CA 2KCCA 1TY0A 4DNIA 1VQFA 2K4KA 3H0GB 5J3BA 3Q22A 1GXDC 1G6PA 2YU9H 1SN8A 3HRZC 1SJHD 4OO1G 5K36G 1PV4A 1L2FA 1JT8A 4YCWA 2R3ZA 2BE5C 3RD4A 3UDFA 2K6AA 2VXWA 3T13A 1BBXC 2R92G 2K1BA 2NZOA 1IZ6A 5KIXA 1QNUA 3PGZA 4LNQA 3MWYW 1JOKA 1PFSA 1QUQB 1EIFA 4LF5L 2EQSA 1TS4A 4DK1A 4DR7Q 1KRTA 4KHVA 4QGUA 1DM0B 4FF2A 1VQIA 1XX8A 5IWAQ 2WAQG 3K81C 2MUYA 4KTAA 3M4QA 1L0YB 1Q8IA 5E4XA 3KBXA 1O78A 1STHA 2NVYB 2NTTA 1KLUD 2A1AA 2XWJB 1SROA 2NVTH 5C4ZA 5FO8B 1XMOL 2Y0SG 3A55A 1VMCA 3KJOA 2ZJQA 1K83B 2RSNA 4K6DA 1SJED 1C9OA 1U5KA 4AIMA 3VYUA 2R7ZH 3S1QB 3RN5A 2UUBL 1UEBA 3DM3A 2L4NA 2N88A 1CI3M 5IGDA 2G9DA 2H1EA 2YTYA 3VR5A 3FP9A 3CF5A 4HIKA 3Q24A 5KNDA 1RKNA 3TEHB 5IYBH 2F3IA 1OO9B 3I73A 1VQDA 4IN3A 1X3EA 3S9WA 3KLSX 4QUFA 3K80C 3TREA 1DGSA 2E75C 4F8MA 5D3IB 2IY5B 3R8BA 4A3CG 2F0VA 3KF8A 3E9IA 4X65Q 5C0XG 4IO9A 5EQ0A 2F0LA 2DUDA 4LFBQ 2D0PA 4K2LA 4A3IG 3EQLC 5C5MA 1BXTA 4DV3L 5A2QL 3ERQA 1I3QB 5C3EG 1G2TA 3PF4A 1SNCA 2EYFA 2KHSA 1BCPD 1I50H 5E7NA 2VUMG 1HR0L 1PRTD 1DONA 5M3FB 4BY1B 1FNVA 2RCNA 2HUGA 3R93A 4A4IA 3ICEA 1D5ZC 1T5XD 4J6HA 4CKBA 1JWSD 5G3LD 5JEAG 4U673 4IFDJ 2VZAA 2L5TA 1SE4A 2B3GA 5AFWA 3DXJC 4DV7L 5D3DA 2PNRC 4BY7H 1V43A 5DAUA 2PI2E 1BR9A 2A69C 1O7ZA 2MO1A 5IY0A 1FR3A 1VQHA 1G51A 3T1HQ 1X3GA 1XJVA 1NMFA 1IBLQ 3WDNA 1I6HH 2BOSA 2JA8B 1QUQA 3PIP3 1PH8A 1IBKQ 4GLVB 3KJPA 5ELCA 3CCVA 3W3AA 3PO2G 3A56A 1ENAA 1B7YB 1LT5D 1C4QA 1SSOA 5DNFA 1HZCA 1YEZA 1SYBA 4UDUC 4A3KG 2Z4IA 2VNUD 1SE2A 3HOUB 3WOEA 3WOFA 3W1GA 4POGA 3PO3G 1F9RA 4GNXA 3OPOA 3BU2A 1UUPA 2XNAC 2JN4A 2B63B 1KDBA 4ULLA 4XQNA 3UDIA 1PTOH 1OXXK 4FDBA 1C0AA 5IP9H 5CV5A 1LTGD 2EYJA 1LYLA 2YU9B 3NBIA 1PLFA 4CKEA 1K8OA 5I4DA 2JJQA 4JI3Q 1CFMA 5IYCH 1LTLA 3A5UA 2IX0A 1BUVT 1IHZA 2B29A 4B3ML 1B3QA 1LACA 2X6GA 5JJLA 5C4XH 4LF6L 1YZ6A 3QWNA 1H9SB 1TQOA 3A54A 4LAAA 2JEAI 3DWQA 2ENBA 3BZKA 3NTKA 2F0HA 1QOHA 1ICWA 3B6YA 3FRPB 5CORA 3UDXA 5F2DA 1Q1BA 5JOBA 2PPBC 3HOZG 2PQAA 1EUJA 5DLQE 4NDXA 2F0MA 4ZRZA 4LF7L 1YNXA 4LK1C 1Z7TA 3S17B 3TRZA 1Z47A 3F8TA 3HFZB 5G3LF 4XXEA 5J39A 3T4AC 2HHHQ 5KRUA 2LXJA 1A2UA 1CSQA 2UXCQ 3ERSX 4NMZA 4B3SL 1K8AC 2NVTB 2LSSA 1G6ZA 4L5QA 4KHPL 4ALPA 3GD7A 1ONLA 1WTQA 3DLLA 5CR3A 2HIXA 3C2PA 4JI4Q 3G6JB 2A68D 4DV5Q 2R6GA 4L5RC 2K7VA 1BOSA 2R7ZB 2DJFC 3TZUA 2HDLA 3L2PA 3G6EA 3MFGA 1HRJA 2VQEL 1EQQA 3CW2C 3CCQA 5IGCA 3I70A 2XVSA 4EQNA 5IE8A 2BDNA 1X32A 5M5YH 4DR1Q 4BS9A 1ESFA 1F2ZA 2EIFA 3U50C 4HJ7A 4OWXB 4Q0FA 1D1KA 3RUZA 1NR4A 1F2YA 1VQPA 1CSPA 2M2LA 1S72A 2Z4HA 4X3SA 1SYCA 3J7AF 5M3MH 2VQFQ 1STBA 3NSWA 3HZXA 3K6OA 1LTAD 5CGKA 3CHBD 5JVG3 5EPKA 3EIVA 2KVMA 4GLXA 1EIGA 1U4RA 2G5DA 2A6ED 3T51B 3X3MA 1VQ7A 2EJFC 4JV5L 1B9NA 1EU3A 3TSSA 4KK7A 5DEHA 4DR5Q 2UU9L 5KNCA 1EOVA 1LT6D 4AH6A 4K0KL 2AKWB 4RA8A 3C3LA 1I50B 1LLRD 2WB1G 1D5MC 3GTGH 4C3JG 4IUUA 4WORA 4K8JA 4CGYB 4OONA 1NSNS 2O5IC 1JE4A 3E9HA 4JYAL 3RZOH 1VCIA 2SDFA 3HOXH 3IRBA 2E2DC 2E2JH 2E5LL 3K7UC 4HCEA 1R4PB 1XTCD 4FXGC 4HN7A 4NXNQ 3SK5A 1SYDA 1X65A 3PUZA 2F52A 3U9SA 1FGUA 3K5NA 1GUOA 1U9RA 3MEFA 4K8IA 2EYHA 4LF8L 4HMJA 2MP1A 5ELEA 2O4XA 3TS2A 4BBRH 4HCSA 3NTIA 1W3SA 2UXDL 2L0CA 1H9SA 1SNOA 5C5LA 1I6HB 3BZCA 1JQYD 1YHAA 1NAPA 1B53A 1CK1A 2GA4B 4DV4Q 5EKKA 3VDYA 4KJOA 3D31A 5GAEC 4DUYQ 4IUNA 4DR4L 4DR2Q 1X56A 3S14H 3IKJA 4IOCA 1X9NA 1WTVA 1QILA 5JPMC 4H0LC 1I94Q 3BVGA 4H13C 1EEID 4DXFA 3K58A 2RA4A 3PQIA 4A3LG 2RF4A 2BE5D 1CM9A 1EQVA 1PTOB 4RWSC 1QWYA 2GVAA 1AFPA 4V190 2F3WA 1GOZA 4ZYSA 1YJ9A 4IUPA 3WWVA 4HTHA 1GUSA 3I4NH 2NZHA 3TBIB 3M85A 1N8RC 1KXLA 1S5FD 3CC2A 1S4ZA 1E2VA 2R93G 3AQQA 5E1FA 1J5EL 3NP8A 5IT9L 4A3EH 1EZ8A 1B8AA 3UI2A 2E2IH 5C4XB 1E24A 1I4PA 4AYBG 1SE8A 2I5HA 4R8IA 4IJLA 1Z9FA 1P16A 2MHVA 2JA6G 1VDZA 3JAME 2ZJRA 4HMIA 1U4MA 4JI7L 4UP8A 1ZKOA 4JI6Q 2JEBI 4IUTA 2OXPA 5FO7B 3S24A 1M8AA 4X3TA 3A0JA 3EN2A 5EGTA 3HGBA 2I07B 3I4MG 2AQ1B 2VB3X 1JC7A 4OIJA 4GKKQ 2RQXA 4G7HC 1PMRA 5IOCA 5EBDA 1OXUA 4DR7L 1UE6A 1LV9A 1EWHA 2JSOA 3C1FA 1ENFA 3CRKC 1A2TA 4JI8L 2ZM6Q 4NP5A 5DM63 3J7ZC 4RH6A 1GHJA 3TDQA 4A93H 1WCMH 2A68C 1JWMD 2V4DA 3SE0A 3I90A 5K5PA 2A6HC 4Z9CB 4OL7A 1EYGA 4FF4A 3E6ZX 5FO9B 3OW2A 1TR5A 1TWFH 2E2HH 5M5YB 2L11A 1PZKD 2Z8LA 2KQ3A 2BCOA 3QG1A 4XQJA 1PH6A 3G4SA 4DK3C 2TSSA 3IL8A 3J81E 4LFAL 3KLSA 5M3MB 1VF7A 1X3FA 1STGA 2NN6I 1VQLA 5JPNC 3BVMA 2RCFA 4ILWA 1SMYC 3U4VA 4LF9Q 5LMUQ 2HCIA 3VYTA 4FXKC 1W2BA 1VQJA 1PYBA 4WRDA 3H15A 4FP5D 1RJTA 3SK8A 3O13A 4DV6L 1B9MA 5JVH3 3GTGB 4OO1H 5K36H 5BN4A 4LUOA 1XNRQ 4CDFC 3EVQA 5IYDG 2Z6KA 3GTJH 1P8LA 3RZOB 2OTJA 1TT2A 1EZ6A 3HOXB 1JOOA 3T53B 2AMCB 2E2JB 2A69D 2XIWA 1EQTA 1I5FA 2HD3A 4ZUJA 3F2CA 2Q2IA 1JORA 2EJMA 1E2ZA 4A3BG 1VQMA 1NJIC 2JA7H 4QY7A 1B44D 3X3NA 4IFDG 2F03A 4L63B 3MXNB 4BBRB 4K5XA 3A7AB 3OIQA 4FF1A 4HSVA 1DOKA 1V9PA 3J80i 2SOBA 3GTMH 3AB9A 5C44G 4R4IA 3OTOQ 4O2DA 1LUZA 3S14B 2F0DA 2WV6D 4MNOA 1HHVA 3SHLA 1CUKA 1TWGH 1CT1D 3QOLA 2Q8RE 1PYWD 1AH9A 3T1YL 4DU9A 1IBMQ 3I56A 3T1HL 3W5OA 4KY5A 4YHHL 2SNMA 3OIPA 4LMQD 2ALYB 1AN8A 2BDOA 5LMNQ 1IBKL 3G71A 4ODGA 2X6LA 1SLJA 4C3HG 2F0SA 2I46A 1EIYB 5M5XH 2Q2TA 2VS1A 4I7ZC 3I8ZA 3AMUA 1EYAA 2X69A 1IKLA 3GTKH 3I4NB 1Y1VG 2XRQD 2B2YA 1J9OA 2QCPX 2KBNA 1BF4A 1NMGA 1XMQQ 1VQ5A 5M3FG 4A3CH 1E1TA 4A3EB 1Q7YC 2EYOA 1PTOC 3LWUA 2E2IB 2YV5A 5ELOA 2VB2X 3TQYA 5C0XH 3PV0A 3HKZB 4DFAA 3HOYG 3T16A 1B3AA 1VQNA 1XYIA 1PH4A 4A3IH 5M9OA 2JK8A 1HFNA 3A5ZB 4XYQA 4FXDA 1CQVA 2KHIA 1N32L 5C3EH 4JI3L 1JCKB 4B3TL 3AFQA 3PCOB 4OX9Q 2VUMH 1MSGA 4LF4Q 2I5MX 4GNXB 3M7NA 1PA6A 5IP7G 2F0WA 3NK9A 2B39A 3PF5A 1KHIA 5HY6A 4MTNA 4DV0L 1BVSA 4ME3A 4N9PA 4B9XA 5JEAH 3Q0AA 4A76A 2IPKD 2PZWA 2LKVA 4LJZC 4JI1L 4FNFA 2JE6I 1CA5A 1FNWA 2EY1A 3H94A 3I91A 3CMAA 3FVQA 4YCUA 4LFCQ 4A3FG 4IALA 1PH5A 4DR6Q 3M7GA 2CH4W 1A6XA 2IX3A 1O7YA 2EY2A 2UXCL 4LWCA 4A93B 1WCMB 2R7FA 1R9TH 4Y52H 1SBBB 1WTRA 1HPCA 2N3SA 2MFIA 1MKHA 4WJ3M 2BA0A 1NR2A 2KCMA 2I5LX 5EBCA 1VQAA 3L7ZC 1K73C 1V1PB 1O7LA 2K33A 5H1SE 1RTOA 1TWFB 1PVOA 2PQAB 2E2HB 3MXNA 1HA5A 2ASBA 3PO2H 2KENA 1FVIA 5DM73 2KEEA 4NXMQ 4K2KA 2Z6BA 4YWLA 4A3KH 4JBMA 3BDOA 2RHQB 3I55A 1VS0A 4JC0A 3DMUA 3Q6SA 1KAWA 2A74C 5ISRA 5CV6A 3J7AV 1PYSB 1WD0A 3HKSA 1TS2A 3MXPA 3PO3H 4R9WA 3NXWA 4YWKA 4X62Q 1HQMC 2F4IA 1NUCA 4OIKA 4DR1L 3HS0C 1I4QA 5FLXE 1UE5A 2FINB 4UPAA 3J81j 4JI2Q 4OELB 2MJ8A 4TKOB 3D8GA 3SR1A 2ZTCA 3RN2A 2CFMA 3OOCA 1M1KC 2QILA 5I2YA 3TMEA 4IPHA 3DWAA 1II3A 1TXYA 4DXGA 1JJ2A 3J80L 3GTPH 3GTJB 1DYQA 1N34Q 4CHTB 1Q86C 5C3WA 4YY3Q 1KDAA 1TIID 4DK0A 4P72A 2Q8TA 4DR5L 4RGNA 1X3QA 1BO0A 3U58A 2H4OA 4MIUA 4DAYB 1B2TA 1S5BD 1IYVA 4CDEC 2JA7B 1B50A 2VW9A 1IL8A 3EROA 3LWEA 4M8AA 1L0WA 5IGGA 3HOZH 4WFN3 3Q23A 1JICA 4O42A 1XNQQ 4TSSA 4RAUC 4A75A 1Q90A 3D4RA 1UEAB 2WAQB 1D8LA 4C3IG 2H5XA 2ATWA 4ZUIA 3GTMB 1A3UA 2D9UA 2K5NA 3CQZB 4O1NA 1HA6A 4J8QA 2K28A 2Z9HA 1HZ9A 1G291 1JB3A 1TWGB 3GV6A 1B70B 1V1OA 4XDXA 1C8CA 1JB7A 1KIXA 3K7AB 3A7LA 3H6MA 5CMDA 3VYSA 1CKOA 2LXKA 3ULLA 3V2TA 4HIDA 1ZXTA 2WKDA 5BN3A 4DGZA 4DUYL 2NTSA 3NEMA 5M5XB 3PIOA 1YJNA 3M4PA 3GV3A 3BVZA 5CBAE 4DV2L 3ONAB 4JPBW 2C9OA 1E0BA 1HTPA 1LTSD 2BH8A 4HR7B 4K14A 2IWHA 1XPUA 1WVLA 2IHFA 1X54A 5LL6X 3GTKB 4PMBA 1A62A 1QZHA 3AU7A 4HSPA 1PZJD 3RR5A 4KD4A 3OMGA 2XSCA 1BCPF 1CHPD 1F77A 2PNHA 2XTIA 4NW2A 3HOWG 3W1BA 1RTNA 1BDOA 1SAPA 1PRTF 1V1PA 1N36L 5I6YA 1LTTD 4CJ0B 4A3JH 4RHRA 4A3IB 2PW7A 1VQGA 4BBSH 5GROA 4A3MG 1CZGA 1SYGA 3PUYA 5C3EB 1PH9A 3AEVA 4BA1I 4F7XA 1KABA 2KECA 4X64L 1XMOQ 2VUMB 2MNAA 3IFTA 1EYDA 4C3JH 2E74C 4AQYQ 1E22A 4M1UB 3PUWA 4JBWA 3MZ5A 1ILQA 4LW1A 5IGFA 2AHOB 2GN5A 4GN3B 3VYRA 1WD1A 1Q46A 4DR3Q 2EPBA 2AQ3B 4LUVA 4PZ6A 1HXYD 1LT3D 1G91A 4B3RL 2UUBQ 4L5SA 2A6HD 2D5DA 2QEXA 4K5VA 4QMGA 4WJWA 4GNXC 1GM5A 2OTLA 3R2TA 1EY7A 4MHEA 4JBJA 1E2WA 4QF4A 1D7QA 2FJ2A 1BQQT 2AQ2B 1EOTA 4DV1L 4UY8C 1R9TB 4A3GG 3CCEA 4ZLTF 1GJXA 3S1MH 3NENA 5L37A 2FHTA 1STYA 4DAYA 2WFWA 3D6CA 4TRDA 4JK1C 3G48A 4J1MA 3K8AA 2EE1A 3H91A 2CW0C 1SMYD 4HJ5A 1HNWL 1KNEA 1Y1WG 2M9VA 4XT3B 1MJCA 4CKCA 3DM1A 4A3KB 4V0BA 2HIVA 4DV3Q 3MC0B 1LTID 2RSOA 1UNSA 3EA6A 1HQRD 3KOJA 4CDDC 3PO3B 3PUVA 1HR0Q 3P20A 4A3LH 2UUCQ 3MAQA 1BBWA 1W6JA 4A3DG 4CJ1B 1Y8PB 1N9WA 3ER0A 4GKJQ 4IPCA 1T9HA 2IX1A 1NBWA 1RHPA 1S5CD 4HAEA 3BZDB 3VA7A 3GTPB 2B2WA 2R93H 3GP7A 5LMUL 1X55A 2EDGA 1Q82C 5AJ3L 3KYHC 4PZ8A 4BY7B 4Y7NH 2DJGC 4JG2A 4MZ9A 3OSOA 1K28A 2K14A 4G7ZC 2JA6H 1FD7D 2JA5G 3M4OH 3HOZB 1XNRL 2DNEA 3CXCA 3FKIG 2AUKA 1K8MA 2B8FA 2CKZB 3D4WA 3QB3A 4IJHA 1MD2D 3DWPA 4OWWB 1GHKA 2L15A 1A0IA 3FPUB 4DUZL 3NTHA 1DOLA 2QGQA 4RMFA 2ES2A 4GZYC 2A19A 1EY8A 3MVVA 3NHHA 1A8VA 1VQCA 4KY7A 2VY3A 5KYLA 4JCVE 4X66L 4C56C 3LNNA 2HQLA 3URYA 1I4GA 4DK6C 4I7AA 1S5ED 1XWEA 3RLNA 2F0IA 1PH3A 4PG3A 5CV9A 3S2DH 1KLGD 1DZ1A 3GTOH 3VR6A 1PTOD 3CCJA 1IYJB 1IBML 4B3MQ 3Q8DA 1EWIA 1FJGQ 4R1JA 1H9KA 4WJ4A 4XYOA 4LF6Q 1O7IA 3SK6A 2A73B 1HCZA 2PCFB 1AEXA 5CV4A 1YHQA 4JI5L 1A3TA 3AFPA 4FVMA 4UAIA 1HZBA 2B2WC 3J7A5 3R2IA 4RG1A 3FPPA 5JJKA 3HOXG 3NELA 1V1QA 5FLMG 3QOJA 3CPWA 4A3JB 4R8NA 2QW7A 2LS01 3TP7A 1AE2A 4BBSB 2PO4A 3OMCA 2KUMA 4DAVA 3VR3A 3HOVG 1RDPD 4XTCS 1A63A 4UP7A 3CCUA 4N9TA 1VQ9A 2HT1A 1TS3A 1QB5D 2WB1B 1MIUA 1MI2A 4C3JB 1L1OB 1EY6A 4P71A 3CU7A 3GO5A 5ELBA 1MHWC 4OO1I 3M3YH 2CWAA 1UAPA 2K5WA 2WB1E 3RLFA 5IWAL 3A8IE 1SDFA 4U68A 3A8JE 2NVYH 2R61A 4KKUA 2EXZA 1ASYA 4IURA 1TWCH 3KLRA 3V96A 4IZ8A 2MGSA 4A3BH 4OX9L 3H3VH 4OXPA 1QJOA 4KMUC 2IT1A 1JOQA 1EQRA 2DY7A 3P75A 2LY7A 4L6TB 3LX0A 4IFDH 1I4RA 4G4KA 4HEDA 1FL0A 4H02A 4TQUS 5ELDA 3CCMA 1VMPA 2K01A 1QE6A 5A2QE 1TVXA 3SVMA 3S1MB 2QKIC 3EFXD 1FGBD 3I4LA 4EQ5A 1WTWA 3H0GG 1OXTA 2GVBA 4L8JA 3STBC 4B08A 1Q12A 5C44H 3JAMc 1PH1A 3OW7A 3ND8A 1E7ZA 3CD6A 1CZWA 3J7YW 4EQPA 1SEBD 5LL6S 2CQOA 1KAAA 1EEFD 4KN4C 1WJJA 2LMCB 3S15H 2C35B 3JAMi 4JV5Q 2B8GA 2ZT9C 4P75A 4K0KQ 4JI0Q 1GKHA 2CHBD 1LO5D 1VQKA 2EYMA 5HGTA 4C3HH 2DY8A 3GTQH 3CP0A 1YITA 4JYAQ 4X65L 2NVXH 3RLOA 4HJAA 1RF2D 1RCVD 2PW5A 4XIGS 4LFBL 3E5SA 4P2CB 2E5LQ 1Y8OB 2WKCA 2KOLA 2R92H 5HGQA 2F0PA 1ET9A 1HNZQ 4E6IA 1TS5A 2OWOA 1Y1VH 2EVBA 3L3OC 2F4VQ 4ZQ3A 5BN5A 4X62L 3S2HH 2R93B 3NE5B 3UE1A 2BH2A 4LF8Q 5EKIA 1HZAA 4RCOA 1MSHA 4POFA 1CKNB 1AP0A 3OWFA 4JI2L 4IUQA 3HOYH 4AYBB 5C0XI 1AZPA 2I0QA 2JA6B 2Z1CA 2QEJC 3M4OB 4DR4Q 4AYBE 3J81c 2UXBQ 1M90C 1YVCA 4JVZA 2E76C 4L5TA 2O2LD 3J81i 1VF5C 5IP7H 2ZJPA 4QJFA 5LHY1 3FMCA 2NWGA 1IBLL 4GN5A 2LFNA 1SNDA 1XNQL 2EOTA 1TU2B 2K04A 1H9JA 1L1OA 3G7LA 3F1ZA 4A3FH 2EJGC 2Q8IB 4YCVA 3LGJA 4NPSA 1VQEA 2F0NA 3C1EA 3VR4A 2K5DA 1QCBD 3S2DB 1G2SA 1BNZA 3GTOB 2RKSA 4DNRB 1PXUA 1J5EQ 2J4XA 5KEEA 1X3PA 1WI5A 2E8GA 5FJ8G 2Z6KC 4B9WA 4BY1G 1VQ6A 4RFBA 1J6QA 4QL5A 2RHSB 1EFWA 2J7ZA 1V8QA 4QCLA 3CPFA 5BR8Q 1EY5A 2Q2HA 1D5XC 2XGTA 3OYYA 1C7YA 3S16H 3GTLH 4OHJA 5JAVA 4JI7Q 2QDLA 1WTXA 3HKZE 1Q3LA 2DN8A 4CDCC 2EY5A 1K0RA 2V1CC 1STNA 1XPRA 4IPGA 2NYZD 2JA7G 5NUCA 3ULJA 2QDBA 5C6AA 1VQ8A 1VQOA 4KN7C 3DUZA 3KBGA 4N8FA 2JA8G 1I4HA 1K3RA 3S17H 3TP5A 4EGVA 4JI8Q 1SNQA 3M3YB 4BXXG 3KDFA 1Q8KA 3W2DA 1A3VA 2F0GA 4BA2I 2B2VA 3HEJA 2NN6G 1ZYRC 1TWCB 2HHHL 3F2DA 4GLAC 2D62A 4A3BB 1RODA 3TP6A 2PZUA 1EY9A 4JOIA 1L1OC 3JAML 3HOUG 3PIO3 5A35A 4AQYL 4ME5A 3MXGA 4P74A 1IW7C 2Z0SA 1IL2A 2B63G 2CW0D 4DR3L 4RGMA 1CKNA 4C3IH 4JW0A 1YNJC 4JI4L 1EU4A 2HQEA 5C4HA 3QJYA 4PQXA 4DV5L 1XTDA 5C44B 4LFAQ 2B2YC 4K5WA 3S1NH 5TSSA 1HNXQ 1WYDA 1F2MA 3ULPA 2K32A 2SEBD 3S15B 2QA4A 1EFID 2OT2A 1JR0D 4DN4M 2JQOA 1SRUA 1YNNC 3QR8A 1STEA 1N33Q 2NUCA 4DV6Q 3KF6B 1Y8NB 2D0OA 3I4OA 4C3HB 1D2BA 2UUAQ 2FMCA 3GTQB 1B1ZA 1BCPB 2KCNA 2YTVA 2NVXB 3RMHA 1T5EA 2VQFL 1LTBD 1PRTB 4K6LA 3VR2A 1PFNA 1OTCA 2R92B 4QIWB 1LABA 4R4TA 1ML0D 2R7DA 3A74A 1Y1VB 5IGBA 5ELFA 2L1BA 4RKBA 3FHWA 3I7FA 3N6RA 3NQIA 5M5WH 2ZTDA 2AUJD 5EKLA 5T1IA 3J81L 2UUCL 4RKLA 1JJCB 4QIWE 1LTRD 3HOWH 4GKJL 4KHZA 2B2VC 3HOYB 5IGEA 4H7BA 2D2CC 4JOIC 4CBVA 3ZYYX 2L12A 1ENCA 4A3MH 5KGUA 2K5QA 3MFYA 4DPGA 4NXNL 2R7ZG 2F0EA 1AE3A 3DHQA 1D6EC 4KD3A 1KNAA 2WAQE 3T1YQ 2NZ1D 4JBKA 3MXUA 1PHJA 1AZQA 3L9AX 4GN4B 1SE3A 2Y0SB 4YHHQ 3K57A 2YYZA 5IYBG 1HJPA 5FLXc 1NY4A 5EPJA 2B2TA 1QVGA 1ICFB 5E4WC 1ILPA 1TWHH 2F1MA 1JMCA 2Y0SE 5FK9C 3CAMA 1CQFA 4DV4L 5IT9E 1U4LA 4DR2L 4A3FB 1CKMA 2P5ZX 1YHBA 2K03A 4HJ9A 2JYOA 1JJGA 1RD9D 1I94L 3MA2B 4A3GH 1J8IA 5D14A 1PZID 4APVA 3CC7A 4DA2A 1DXMA 5FOBB 2A8VA 2N55A 2YTXA 4LF5Q 3E3XA 1C48A 1Y1WH 4MN3A 3IAYA 2F0OA 3SDZA 3IFDA 1DOMA 1N32Q 1YJWA 2K05A 5EAYA 3S16B 3GTLB 3A8KE 4GOPB 1QVCA 4B3TQ 4H44C 3NBHB 1FJGL 2CVRA 1I4XA 1L0XB 4BY7G 2WP8J 4A3DH 4G57A 2M00A 4S3SA 5EPLA 4KJNA 4DV0Q 4YIJA 2JP1A 4JI1Q 3PSIA 2PQEA 1TWAH 3KK7A 4X3UA 5IT9c 3L0OA 2ID0A 3KF6A 2NB0A 1OXVA 4F87A 1FYCA 3BYYB 5ELNA 3TN2A 4JI6L 1EL0A 1UE7A 3E0EA 1SMXA 2J0TD 1UE1A 2B2TC 2NBFA 2RDGA 3BDLA 2HCCA 2NVQH 3GQBA 1ASZA 1K0SA 1QNKA 4GKKL 2OQKA 1NCVA 3TP8A 3STBD 1U0LA 2KJXA 1PFMA 1YIJA 2JA5H 3HP3A 2VL6A 1SR3A 2DNCA 2L55A 3FKIH 3I72A 3MEHA 4DF7A 2K50A 3UDGA 3R3OA 5J1ZA 1WTHA 3EBEA 1HFGA 3SK4A 4C3IB 2MO0A 3BYTB 1RL2A 3DEPA 5IP9G 3RNUA 4G7OC 2ZM6L 3PO2B 2WIIB 3V05A 2O5JC 4X6AH 3H3VC 2PI2A 1H9MA 3S1NB 4FF3A 3P1HA 1KQSA 5C0XJ 3PIPA 5IYCG 1EWCA 3OHXC 3KFUA 1R4QB 4N8X1 4QB4A 1HR0W 3CC4A 1KC8C 2RDFA 1O80A 5C4XG 1AW7A 4ZKBB 1E3PA 2N78A 5CBEE 5J22A 2EZVA 5T1GA 4EVOA 4ZCKA 4A3JG 4BBSG 1F9QA 1G8ZD 2QF7A 1NNXA 2IL8A 1QZGA 3K5LA 4KKSA 4DV7Q 2ICIA 3NWTA 1XPOA 1KTKA 3NQTA 4LF9L 4KI0A 5KYIA 4DAMA 1EY0A 3RZDH 1SYFA 4JI0L 5JEAJ 1LT4D 1I6VC 2BA1A 5CV7A 5M5WB 1SFOH 1DJRD 1BCPC 1TKWB 2TMPA 1S40A 3NWSA 3F2BA 1TY2A 4DKAC 5IIFA 1QG7A 3HOWB 1PRTC 3CCLA 4PNYA 5FLMH 4EX5A 4J15A 1EIHA 4RGOS 1HNZL 3K59A 1WFQA 5FLXL 2F4VL 2AWOA 1F2LA 4HIOA 4A3MB 3GDEA 4X3KA 3HOVH 2KA7A 2F0UA 3I4MH 1Q1EA 4ZKCB 5C4JH 4GOPA 1ESRA 4OGQC 4HIMA 3NBHA 1LM0A 4HJ8A 3ITPA 2FXQA 3BG3A 1CA6A 2XRSD 3JC66 2EYPA 3VA5A 3CMEA 5I9PA 3TS0A 2HDMA 1TWHB 2G9HD 4TVAB 3S1RH 2UXBL 3I3CA 3KLWA 4R4QA 3P7JA 3OTOL 4DV2Q 4KY6A 5M3MG 3NPPA 3TZDA 4C2MH 3K0XA 3H3VI 2F0JA 4O0AA 2MPMA 1XXGA 2CH4A 4R4OA 3U4ZA 2CWPA 4IFDI 1GO3E 1F9PA 4A3GB 2ZTEA 1SXTA 4XT1B 5I9OA 2IHEA 1FNUA 4KV6A 1IYUA 3H0GH 3UE0A 1W6KA 5LMNL 2PYKA 4ABNA 2PZTA 4ZK9B 1N36Q 1NE3A 2F0KA 1PDQA 4C1NI 1VQ4A 1Y1WB 3MTSA 3NUCA 1STAA 4PZ7A 2KHJA 5E3FA 4LF7Q 4C1NK 2AWNA 4ID6A 2SNSA 2ZXPA 1WTOA 4RGTA 1ZEQX 2XWBB 4X64Q 4NKLA 1Y14B 2ICEC 4FO2A 1XMQL 1QVFA 4UHVA 4B3SQ 3FEWX 3OWEB 4KHPQ 1HH2P 4A3DB 4IUVA 5GQOA 1RIPA 3QIAA 4BBRG 1KRSA 5I2XA 5BR8L 4UP9A 2CCZA 5IYDH 1ZYRD 1S3OA 1TWAB 2DGYA 4GOPC 1HUNA 4RHSA 4B3RQ 4ZAIA 1GUNA 5GAGC 5COYA 1UWVA 4PMWA 1Y69U 2B2UA 1ET6A 3CRLC 2WACA 3N52A 1KL9A 1IW7D 2N8NA 4KKTA 4P73A 2VQEQ 4LF4L 4DAPA 5C3XA 1K83H 4QUCA 4DV1Q 1KDCA 1YNJD 2NVQB 3QO2A 2K5HA 3PUXA 1Z6HA 1B4OA 1WTPA 4BWGB 5GADC 3KUPA 2JA5B 2ZXOA 3FKIB 3MHBA 1YI2A 1DCZA 3K5OA 4KLKA 1K9MC 3S1QH 2Q2UA 1NTGA 1GD7A 2EYLA 4LUZA 1HNWQ 1SNPA 4LFCL 3CCSA 2F3VA 4DR6L 3M4YA 2EXDA 1GVPA 1YNND 3SGIA 3I4NG 2WINB 4EQOA 1E1OA 2KCTA 3D0FA 1CTMA 1GUTA 4I65A 2KEDA 5FKAC 3J80E 2UU9Q 3F2UA 4FYDA 1PH2A 1JE5A 4QQBX 3S2HB 4A3EG 5EJWA 1PTOF 2N49A 5I6WA 2FFKB 2MQHA 3K5MA 1D1IA 1MGSA 3HKZG 4NB3A 5CYUA 4PMCA 3KDFB 1U4PA 4R4CA 4F88A 1JWUD 4NXML 2RVLA 2F0QA 4IPDA 2ZXRA 1HNXL 1I3QH 3SXHA 3BS1A
chains in the Genus database with same CATH topology
1K8GA 1BKBA 4AQYL 1MJEA 4DR2Q 4DR4L 1X56A 3S14H 2XTIA 2PNHA 4P74A 2JA9A 3W1BA 2Z0SA 5AJ3Q 3HOWG 4IOCA 1YBYA 5FJ8H 1X9NA 1N36L 1IL2A 2B63G 2K75A 4DR3L 5M3FH 1CKNA 4C3IH 4A3JH 4BY1H 1I94Q 4JI4L 1VQGA 4BBSH 4YWMA 1N33L 4OWTB 1OXSC 4DV5L 5GROA 2UUAL 4A3MG 3AEVA 1XTDA 3PUYA 1PH9A 2UXDQ 4LFAQ 4GS3A 5JJIA 4BA1I 3I2ZA 1Q81C 3ZJYC 4X64L 1XMOQ 3S1NH 2K5VA 1HNXQ 2MNAA 1WYDA 4A3LG 1WOCA 2RF4A 4C3JH 3AYHB 4AQYQ 1E22A 1N34L 3PUWA 1VQBA 3ULPA 4JBWA 1BBUA 2GVAA 4LW1A 4YY3L 2QA4A 2AHOB 4DUZQ 2GN5A 4GN3B 1YJ9A 2JQOA 1Q46A 4DR3Q 1SRUA 2K52A 3WWVA 4A93G 4LUVA 4PZ6A 1WCMG 3I4NH 2NZHA 3J80c 1N33Q 3M85A 1N8RC 4DV6Q 3KF6B 1KXLA 2D0OA 3I4OA 2UUAQ 4B3RL 2UUBQ 3CC2A 3KF8B 4L5SA 2JA8H 2R93G 4X66Q 3AQQA 4GNXC 2QEXA 1J5EL 1GM5A 2YTVA 2OTLA 4A3EH 1PH7A 1B8AA 2OCEA 1H95A 4JBJA 2VQFL 2E2IH 3CCRA 3CQZH 1E24A 5LMNW 4BXXH 1D7QA 5GAHC 1OTCA 4AYBG 1SE8A 4UY8C 2I5HA 4DV1L 4R4TA 4A3GG 4IJLA 1Z9FA 1P16A 2R7DA 1X6OA 3A74A 3CCEA 1IXRA 1KD1C 2JA6G 3NENA 2OQ0A 3S1MH 3D31A 2WFWA 3BJUA 3FHWA 3I7FA 5M5WH 2ZJRA 4IOAA 2ZTDA 3HOUH 2UUCL 1JJCB 3M9BA 4QIWE 3G48A 4JI7L 3K8AA 3K7AH 4UP8A 4JI6Q 2JEBI 3HOWH 3S24A 4GKJL 4KHZA 2B63H 2PMZE 3A0JA 4HJ5A 1HNWL 1Y1WG 3EN2A 1MJCA 3I4MG 4JI5Q 4GKKQ 2HIVA 4DV3Q 4JOIC 4DNIA 1VQFA 2K4KA 5J3BA 4A3MH 1G6PA 1OXUA 2YU9H 4DPGA 1SN8A 4NXNL 3KOJA 2R7ZG 1AE3A 1UE6A 1PV4A 3PUVA 4DR7L 1HR0Q 1L2FA 4OO1G 5K36G 1JT8A 4YCWA 4A3LH 2WAQE 3UDFA 2UUCQ 1BBWA 3T1YQ 2R92G 4A3DG 4JBKA 1PHJA 1N9WA 4GN4B 4JI8L 4YHHQ 2ZM6Q 3ER0A 4GKJQ 4IPCA 2YYZA 2NZOA 1IZ6A 5IYBG 1HJPA 3J7ZC 1T9HA 2IX1A 1NBWA 1NY4A 5FLXc 4A93H 3PGZA 1QVGA 4LNQA 1WCMH 1TWHH 1JMCA 1PFSA 1QUQB 2Y0SE 1EIFA 3CAMA 4DV4L 4LF5L 2EQSA 2R93H 4DR7Q 1KRTA 4QGUA 5LMUL 1X55A 4DR2L 1EYGA 1Q82C 1CKMA 5AJ3L 3OW2A 1TWFH 3KYHC 2E2HH 1VQIA 1YHBA 5IWAQ 2WAQG 4PZ8A 5GAEC 3K81C 4HJ9A 4Y7NH 1JJGA 4JG2A 3M4QA 3G4SA 4MZ9A 1PH6A 1I94L 4A3GH 4DK3C 2K14A 2JA6H 4APVA 2JA5G 3M4OH 3CC7A 4LFAL 2A1AA 1XNRL 1X3FA 2NN6I 1SROA 3CXCA 2NVTH 3FKIG 1VQLA 2A8VA 1XMOL 2Y0SG 3KJOA 2YTXA 4LF5Q 2ZJQA 2CKZB 3U4VA 4LF9Q 5LMUQ 4IJHA 1Y1WH 4OWWB 2L15A 1A0IA 1C9OA 4DUZL 1W2BA 1VQJA 1N32Q 1PYBA 2QGQA 1YJWA 5EAYA 4RMFA 2ES2A 1U5KA 3H15A 2A19A 4GOPB 1QVCA 4AIMA 1A8VA 4B3TQ 1VQCA 4DV6L 2R7ZH 3NBHB 3RN5A 2VY3A 2UUBL 1FJGL 1UEBA 3DM3A 4JCVE 4LUOA 4X66L 1XNRQ 4BY7G 5IYDG 2Z6KA 3GTJH 1P8LA 2HQLA 2YTYA 2OTJA 2WP8J 3FP9A 4DK6C 3CF5A 4A3DH 4HIKA 2AMCB 3RLNA 3TEHB 5IYBH 2F3IA 1PH3A 1VQDA 1I5FA 4DV0Q 1X3EA 3F2CA 2Q2IA 4JI1Q 3PSIA 4PG3A 1TWAH 3K80C 5IT9c 4A3BG 3TREA 1DGSA 3L0OA 3S2DH 1VQMA 2ID0A 3KF6A 1NJIC 2JA7H 4QY7A 3GTOH 4A3CG 1OXVA 2IY5B 3E9IA 4IFDG 4X65Q 3CCJA 1IYJB 3MXNB 5ELNA 5C0XG 4IO9A 1IBML 3Q8DA 4B3MQ 1EWIA 1FJGQ 4R1JA 4JI6L 4WJ4A 4LF6Q 1O7IA 2DUDA 4LFBQ 1UE7A 3E0EA 1SMXA 1UE1A 2D0PA 4A3IG 2NVQH 1YHQA 4JI5L 1V9PA 3J80i 3AFPA 1ASZA 3GTMH 4GKKL 4DV3L 1HZBA 5C3EG 2OQKA 5C44G 4R4IA 3PF4A 3J7A5 3OTOQ 3STBD 1U0LA 4O2DA 1LUZA 1YIJA 4RG1A 2JA5H 1I50H 5JJKA 3HOXG 5E7NA 4MNOA 2VUMG 2VL6A 1SR3A 3FKIH 1CUKA 1HR0L 3NELA 1V1QA 1TWGH 2K50A 3UDGA 5FLMG 1AH9A 3CPWA 3EBEA 3T1YL 2MO0A 1AE2A 2RCNA 4A4IA 3I56A 1RL2A 3T1HL 1IBMQ 5IP9G 3W5OA 3ICEA 3RNUA 4YHHL 2ZM6L 4X6AH 2PI2A 3HOVG 4XTCS 2ALYB 1A63A 5LMNQ 1IBKL 5JEAG 4UP7A 3CCUA 1VQ9A 3G71A 1SLJA 4IFDJ 2HT1A 2VZAA 1KQSA 1MIUA 5C0XJ 2B3GA 3PIPA 1L1OB 1EIYB 5IYCG 4P71A 5M5XH 3KFUA 3GO5A 4DV7L 2Q2TA 2VS1A 4BY7H 1V43A 1HR0W 3CC4A 4OO1I 2PI2E 1KC8C 3M3YH 2CWAA 5C4XG 2WB1E 3RLFA 5IWAL 1E3PA 2MO1A 2N78A 5IY0A 1VQHA 1G51A 2NVYH 3T1HQ 1ASYA 3GTKH 1X3GA 1Y1VG 1TWCH 1NMFA 1XJVA 1IBLQ 2KBNA 1I6HH 1NMGA 1XMQQ 4OX9L 3H3VH 4A3BH 4OXPA 1VQ5A 1QUQA 1PH8A 1IBKQ 2IT1A 5M3FG 1EQRA 4A3JG 4GLVB 3KJPA 1E1TA 1Q7YC 4A3CH 4BBSG 2YV5A 5ELOA 3TQYA 3CCVA 1QZGA 3PO2G 1B7YB 3PV0A 1FL0A 4DV7Q 4H02A 3HOYG 4TQUS 1HZCA 1YEZA 1XPOA 4LF9L 3CCMA 4KI0A 3RZDH 4DAMA 1VQNA 4JI0L 1PH4A 4A3IH 5JEAJ 4A3KG 2JK8A 3A5ZB 4EQ5A 3H0GG 1OXTA 2BA1A 2GVBA 2KHIA 1N32L 2VNUD 1SFOH 3STBC 5C3EH 5C44H 1Q12A 4JI3L 3JAMc 1PH1A 3W1GA 1S40A 3F2BA 4POGA 3PO3G 1E7ZA 4GNXA 3CD6A 4DKAC 3BU2A 4B3TL 3AFQA 3PCOB 4OX9Q 2VUMH 3CCLA 4LF4Q 2I5MX 4GNXB 2CQOA 5FLMH 4EX5A 4J15A 3UDIA 3M7NA 1WJJA 3S15H 1PA6A 1OXXK 2C35B 4FDBA 3JAMi 1HNZL 1C0AA 5IP7G 4JV5Q 1WFQA 5IP9H 4P75A 2F4VL 3PF5A 2AWOA 1KHIA 1LYLA 4HIOA 4K0KQ 3GDEA 5HY6A 4JI0Q 3HOVH 1GKHA 4MTNA 1BVSA 4ME3A 4DV0L 3I4MH 1Q1EA 4A76A 4JI1L 1VQKA 5C4JH 2JE6I 4C3HH 4GOPA 3GTQH 2JJQA 4JI3Q 4HIMA 5IYCH 4LFCQ 3CMAA 3CP0A 4YCUA 1YITA 1LM0A 4JYAQ 4A3FG 1LTLA 4X65L 3A5UA 4HJ8A 1PH5A 2NVXH 2IX0A 3RLOA 2B29A 4DR6Q 4B3ML 4HJAA 2FXQA 4XIGS 5C4XH 5JJLA 4LF6L 4LFBL 3JC66 1YZ6A 2E5LQ 3CMEA 2UXCL 4LWCA 2R92H 5HGQA 3TS0A 2R7FA 1R9TH 1HNZQ 2OWOA 2JEAI 4Y52H 4TVAB 3S1RH 1Y1VH 2N3SA 3BZKA 2UXBL 3KLWA 3B6YA 4R4QA 2MFIA 3UDXA 1MKHA 2F4VQ 4WJ3M 1Q1BA 2BA0A 4X62L 3S2HH 3OTOL 4DV2Q 3HOZG 2KCMA 2I5LX 2PQAA 3UE1A 5M3MG 4LF8Q 2BH2A 1VQAA 1EUJA 5DLQE 3L7ZC 1K73C 4C2MH 1HZAA 5H1SE 3K0XA 4LF7L 2PQAB 1YNXA 4POFA 3H3VI 1PVOA 1CKNB 2ASBA 3PO2H 4O0AA 4JI2L 2KENA 3HOYH 3TRZA 4R4OA 3U4ZA 1Z47A 1FVIA 2CWPA 3F8TA 1GO3E 3HFZB 4IFDI 2ZTEA 4NXMQ 5C0XI 2I0QA 2HHHQ 2IHEA 4YWLA 2LXJA 4A3KH 4JBMA 2RHQB 3I55A 1VS0A 4JC0A 1KAWA 1CSQA 3H0GH 2UXCQ 3ERSX 3UE0A 5LMNL 4B3SL 1K8AC 1PYSB 4DR4Q 4AYBE 3J81c 3HKSA 2LSSA 2UXBQ 4L5QA 4KHPL 4ALPA 3PO3H 1M90C 3GD7A 4YWKA 3DLLA 4X62Q 1NE3A 1N36Q 1YVCA 2HIXA 4DR1L 1VQ4A 4L5TA 4JI4Q 4PZ7A 2KHJA 4LF7Q 1UE5A 4UPAA 3J81i 2AWNA 3J81j 5IP7H 4JI2Q 4DV5Q 2R6GA 2ZJPA 4QJFA 2ZTCA 3RN2A 2CFMA 1M1KC 4L5RC 4X64Q 1IBLL 4GN5A 1XNQL 1Y14B 4IPHA 1XMQL 3L2PA 3G6EA 1TXYA 1QVFA 2VQEL 4B3SQ 1JJ2A 1EQQA 3GTPH 1N34Q 1L1OA 3CW2C 3CCQA 3F1ZA 1Q86C 4KHPQ 1HH2P 4A3FH 4YY3Q 5GQOA 4YCVA 1RIPA 4P72A 4BBRG 1KRSA 5IE8A 3LGJA 5M5YH 4DR1Q 5BR8L 4DR5L 4NPSA 1VQEA 4UP9A 2CCZA 2EIFA 3U50C 3HOUG 4HJ7A 3U58A 4OWXB 5IYDH 4DAYB 1S3OA 4GOPC 2DGYA 4B3RQ 2JA8G 5GAGC 1CSPA 2VW9A 1VQPA 1S72A 1UWVA 4PMWA 1J5EQ 3HOZH 1L0WA 5M3MH 2VQFQ 1WI5A 2E8GA 1XNQQ 1KL9A 5FJ8G 2N8NA 4P73A 4A75A 2VQEQ 2Z6KC 4LF4L 1D8LA 3EIVA 1K83H 4BY1G 4DV1Q 4GLXA 1VQ6A 2H5XA 2ATWA 1VQ7A 1J6QA 4QL5A 2RHSB 1EFWA 2K5HA 2K5NA 4JV5L 3CPFA 3PUXA 5BR8Q 4DR5Q 2UU9L 2Q2HA 1EOVA 4AH6A 4K0KL 2AKWB 2XGTA 3OYYA 5GADC 1C7YA 3S16H 3GTLH 4JI7Q 1HZ9A 2WB1G 1YI2A 4KLKA 1K9MC 1G291 3GTGH 3S1QH 3HKZE 2Q2UA 4OONA 1B70B 1NTGA 1GD7A 4LUZA 1HNWQ 4LFCL 1JB7A 3E9HA 1KIXA 4JYAL 3RZOH 1K0RA 1VCIA 2V1CC 3CCSA 3HOXH 3IRBA 4DR6L 1CKOA 2EXDA 2LXKA 4IPGA 3ULLA 1XPRA 4HIDA 2E2JH 2JA7G 1GVPA 3ULJA 3SGIA 2E5LL 3K7UC 3I4NG 4DUYL 1VQ8A 1VQOA 1E1OA 4NXNQ 2KCTA 3D0FA 1X65A 3PUZA 3NEMA 2F52A 2UU9Q 1FGUA 3PIOA 1JE5A 1YJNA 1PH2A 3M4PA 4QQBX 1K3RA 3MEFA 4DV2L 4A3EG 3S17H 4LF8L 2N49A 4JI8Q 2BH8A 2MQHA 4BXXG 3KDFA 1XPUA 1Q8KA 3TS2A 3HKZG 4NB3A 4BBRH 2IHFA 1W3SA 1X54A 2UXDL 3KDFB 4BA2I 4R4CA 2NN6G 1A62A 1QZHA 4NXML 2HHHL 3F2DA 3BZCA 1YHAA 2D62A 4GLAC 4IPDA 3VDYA 4DV4Q 1HNXL 3RR5A 1I3QH 4JOIA 1L1OC 4DUYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8G A;  1BKB A;  4AQY L;  1MJE A;  4DR2 Q;  4DR4 L;  1X56 A;  3S14 H;  2XTI A;  2PNH A;  4P74 A;  2JA9 A;  3W1B A;  2Z0S A;  5AJ3 Q;  3HOW G;  4IOC A;  1YBY A;  5FJ8 H;  1X9N A;  1N36 L;  1IL2 A;  2B63 G;  2K75 A;  4DR3 L;  5M3F H;  1CKN A;  4C3I H;  4A3J H;  4BY1 H;  1I94 Q;  4JI4 L;  1VQG A;  4BBS H;  4YWM A;  1N33 L;  4OWT B;  1OXS C;  4DV5 L;  5GRO A;  2UUA L;  4A3M G;  3AEV A;  1XTD A;  3PUY A;  1PH9 A;  2UXD Q;  4LFA Q;  4GS3 A;  5JJI A;  4BA1 I;  3I2Z A;  1Q81 C;  3ZJY C;  4X64 L;  1XMO Q;  3S1N H;  2K5V A;  1HNX Q;  2MNA A;  1WYD A;  4A3L G;  1WOC A;  2RF4 A;  4C3J H;  3AYH B;  4AQY Q;  1E22 A;  1N34 L;  3PUW A;  1VQB A;  3ULP A;  4JBW A;  1BBU A;  2GVA A;  4LW1 A;  4YY3 L;  2QA4 A;  2AHO B;  4DUZ Q;  2GN5 A;  4GN3 B;  1YJ9 A;  2JQO A;  1Q46 A;  4DR3 Q;  1SRU A;  2K52 A;  3WWV A;  4A93 G;  4LUV A;  4PZ6 A;  1WCM G;  3I4N H;  2NZH A;  3J80 c;  1N33 Q;  3M85 A;  1N8R C;  4DV6 Q;  3KF6 B;  1KXL A;  2D0O A;  3I4O A;  2UUA Q;  4B3R L;  2UUB Q;  3CC2 A;  3KF8 B;  4L5S A;  2JA8 H;  2R93 G;  4X66 Q;  3AQQ A;  4GNX C;  2QEX A;  1J5E L;  1GM5 A;  2YTV A;  2OTL A;  4A3E H;  1PH7 A;  1B8A A;  2OCE A;  1H95 A;  4JBJ A;  2VQF L;  2E2I H;  3CCR A;  3CQZ H;  1E24 A;  5LMN W;  4BXX H;  1D7Q A;  5GAH C;  1OTC A;  4AYB G;  1SE8 A;  4UY8 C;  2I5H A;  4DV1 L;  4R4T A;  4A3G G;  4IJL A;  1Z9F A;  1P16 A;  2R7D A;  1X6O A;  3A74 A;  3CCE A;  1IXR A;  1KD1 C;  2JA6 G;  3NEN A;  2OQ0 A;  3S1M H;  3D31 A;  2WFW A;  3BJU A;  3FHW A;  3I7F A;  5M5W H;  2ZJR A;  4IOA A;  2ZTD A;  3HOU H;  2UUC L;  1JJC B;  3M9B A;  4QIW E;  3G48 A;  4JI7 L;  3K8A A;  3K7A H;  4UP8 A;  4JI6 Q;  2JEB I;  3HOW H;  3S24 A;  4GKJ L;  4KHZ A;  2B63 H;  2PMZ E;  3A0J A;  4HJ5 A;  1HNW L;  1Y1W G;  3EN2 A;  1MJC A;  3I4M G;  4JI5 Q;  4GKK Q;  2HIV A;  4DV3 Q;  4JOI C;  4DNI A;  1VQF A;  2K4K A;  5J3B A;  4A3M H;  1G6P A;  1OXU A;  2YU9 H;  4DPG A;  1SN8 A;  4NXN L;  3KOJ A;  2R7Z G;  1AE3 A;  1UE6 A;  1PV4 A;  3PUV A;  4DR7 L;  1HR0 Q;  1L2F A;  4OO1 G;  5K36 G;  1JT8 A;  4YCW A;  4A3L H;  2WAQ E;  3UDF A;  2UUC Q;  1BBW A;  3T1Y Q;  2R92 G;  4A3D G;  4JBK A;  1PHJ A;  1N9W A;  4GN4 B;  4JI8 L;  4YHH Q;  2ZM6 Q;  3ER0 A;  4GKJ Q;  4IPC A;  2YYZ A;  2NZO A;  1IZ6 A;  5IYB G;  1HJP A;  3J7Z C;  1T9H A;  2IX1 A;  1NBW A;  1NY4 A;  5FLX c;  4A93 H;  3PGZ A;  1QVG A;  4LNQ A;  1WCM H;  1TWH H;  1JMC A;  1PFS A;  1QUQ B;  2Y0S E;  1EIF A;  3CAM A;  4DV4 L;  4LF5 L;  2EQS A;  2R93 H;  4DR7 Q;  1KRT A;  4QGU A;  5LMU L;  1X55 A;  4DR2 L;  1EYG A;  1Q82 C;  1CKM A;  5AJ3 L;  3OW2 A;  1TWF H;  3KYH C;  2E2H H;  1VQI A;  1YHB A;  5IWA Q;  2WAQ G;  4PZ8 A;  5GAE C;  3K81 C;  4HJ9 A;  4Y7N H;  1JJG A;  4JG2 A;  3M4Q A;  3G4S A;  4MZ9 A;  1PH6 A;  1I94 L;  4A3G H;  4DK3 C;  2K14 A;  2JA6 H;  4APV A;  2JA5 G;  3M4O H;  3CC7 A;  4LFA L;  2A1A A;  1XNR L;  1X3F A;  2NN6 I;  1SRO A;  3CXC A;  2NVT H;  3FKI G;  1VQL A;  2A8V A;  1XMO L;  2Y0S G;  3KJO A;  2YTX A;  4LF5 Q;  2ZJQ A;  2CKZ B;  3U4V A;  4LF9 Q;  5LMU Q;  4IJH A;  1Y1W H;  4OWW B;  2L15 A;  1A0I A;  1C9O A;  4DUZ L;  1W2B A;  1VQJ A;  1N32 Q;  1PYB A;  2QGQ A;  1YJW A;  5EAY A;  4RMF A;  2ES2 A;  1U5K A;  3H15 A;  2A19 A;  4GOP B;  1QVC A;  4AIM A;  1A8V A;  4B3T Q;  1VQC A;  4DV6 L;  2R7Z H;  3NBH B;  3RN5 A;  2VY3 A;  2UUB L;  1FJG L;  1UEB A;  3DM3 A;  4JCV E;  4LUO A;  4X66 L;  1XNR Q;  4BY7 G;  5IYD G;  2Z6K A;  3GTJ H;  1P8L A;  2HQL A;  2YTY A;  2OTJ A;  2WP8 J;  3FP9 A;  4DK6 C;  3CF5 A;  4A3D H;  4HIK A;  2AMC B;  3RLN A;  3TEH B;  5IYB H;  2F3I A;  1PH3 A;  1VQD A;  1I5F A;  4DV0 Q;  1X3E A;  3F2C A;  2Q2I A;  4JI1 Q;  3PSI A;  4PG3 A;  1TWA H;  3K80 C;  5IT9 c;  4A3B G;  3TRE A;  1DGS A;  3L0O A;  3S2D H;  1VQM A;  2ID0 A;  3KF6 A;  1NJI C;  2JA7 H;  4QY7 A;  3GTO H;  4A3C G;  1OXV A;  2IY5 B;  3E9I A;  4IFD G;  4X65 Q;  3CCJ A;  1IYJ B;  3MXN B;  5ELN A;  5C0X G;  4IO9 A;  1IBM L;  3Q8D A;  4B3M Q;  1EWI A;  1FJG Q;  4R1J A;  4JI6 L;  4WJ4 A;  4LF6 Q;  1O7I A;  2DUD A;  4LFB Q;  1UE7 A;  3E0E A;  1SMX A;  1UE1 A;  2D0P A;  4A3I G;  2NVQ H;  1YHQ A;  4JI5 L;  1V9P A;  3J80 i;  3AFP A;  1ASZ A;  3GTM H;  4GKK L;  4DV3 L;  1HZB A;  5C3E G;  2OQK A;  5C44 G;  4R4I A;  3PF4 A;  3J7A 5;  3OTO Q;  3STB D;  1U0L A;  4O2D A;  1LUZ A;  1YIJ A;  4RG1 A;  2JA5 H;  1I50 H;  5JJK A;  3HOX G;  5E7N A;  4MNO A;  2VUM G;  2VL6 A;  1SR3 A;  3FKI H;  1CUK A;  1HR0 L;  3NEL A;  1V1Q A;  1TWG H;  2K50 A;  3UDG A;  5FLM G;  1AH9 A;  3CPW A;  3EBE A;  3T1Y L;  2MO0 A;  1AE2 A;  2RCN A;  4A4I A;  3I56 A;  1RL2 A;  3T1H L;  1IBM Q;  5IP9 G;  3W5O A;  3ICE A;  3RNU A;  4YHH L;  2ZM6 L;  4X6A H;  2PI2 A;  3HOV G;  4XTC S;  2ALY B;  1A63 A;  5LMN Q;  1IBK L;  5JEA G;  4UP7 A;  3CCU A;  1VQ9 A;  3G71 A;  1SLJ A;  4IFD J;  2HT1 A;  2VZA A;  1KQS A;  1MIU A;  5C0X J;  2B3G A;  3PIP A;  1L1O B;  1EIY B;  5IYC G;  4P71 A;  5M5X H;  3KFU A;  3GO5 A;  4DV7 L;  2Q2T A;  2VS1 A;  4BY7 H;  1V43 A;  1HR0 W;  3CC4 A;  4OO1 I;  2PI2 E;  1KC8 C;  3M3Y H;  2CWA A;  5C4X G;  2WB1 E;  3RLF A;  5IWA L;  1E3P A;  2MO1 A;  2N78 A;  5IY0 A;  1VQH A;  1G51 A;  2NVY H;  3T1H Q;  1ASY A;  3GTK H;  1X3G A;  1Y1V G;  1TWC H;  1NMF A;  1XJV A;  1IBL Q;  2KBN A;  1I6H H;  1NMG A;  1XMQ Q;  4OX9 L;  3H3V H;  4A3B H;  4OXP A;  1VQ5 A;  1QUQ A;  1PH8 A;  1IBK Q;  2IT1 A;  5M3F G;  1EQR A;  4A3J G;  4GLV B;  3KJP A;  1E1T A;  1Q7Y C;  4A3C H;  4BBS G;  2YV5 A;  5ELO A;  3TQY A;  3CCV A;  1QZG A;  3PO2 G;  1B7Y B;  3PV0 A;  1FL0 A;  4DV7 Q;  4H02 A;  3HOY G;  4TQU S;  1HZC A;  1YEZ A;  1XPO A;  4LF9 L;  3CCM A;  4KI0 A;  3RZD H;  4DAM A;  1VQN A;  4JI0 L;  1PH4 A;  4A3I H;  5JEA J;  4A3K G;  2JK8 A;  3A5Z B;  4EQ5 A;  3H0G G;  1OXT A;  2BA1 A;  2GVB A;  2KHI A;  1N32 L;  2VNU D;  1SFO H;  3STB C;  5C3E H;  5C44 H;  1Q12 A;  4JI3 L;  3JAM c;  1PH1 A;  3W1G A;  1S40 A;  3F2B A;  4POG A;  3PO3 G;  1E7Z A;  4GNX A;  3CD6 A;  4DKA C;  3BU2 A;  4B3T L;  3AFQ A;  3PCO B;  4OX9 Q;  2VUM H;  3CCL A;  4LF4 Q;  2I5M X;  4GNX B;  2CQO A;  5FLM H;  4EX5 A;  4J15 A;  3UDI A;  3M7N A;  1WJJ A;  3S15 H;  1PA6 A;  1OXX K;  2C35 B;  4FDB A;  3JAM i;  1HNZ L;  1C0A A;  5IP7 G;  4JV5 Q;  1WFQ A;  5IP9 H;  4P75 A;  2F4V L;  3PF5 A;  2AWO A;  1KHI A;  1LYL A;  4HIO A;  4K0K Q;  3GDE A;  5HY6 A;  4JI0 Q;  3HOV H;  1GKH A;  4MTN A;  1BVS A;  4ME3 A;  4DV0 L;  3I4M H;  1Q1E A;  4A76 A;  4JI1 L;  1VQK A;  5C4J H;  2JE6 I;  4C3H H;  4GOP A;  3GTQ H;  2JJQ A;  4JI3 Q;  4HIM A;  5IYC H;  4LFC Q;  3CMA A;  3CP0 A;  4YCU A;  1YIT A;  1LM0 A;  4JYA Q;  4A3F G;  1LTL A;  4X65 L;  3A5U A;  4HJ8 A;  1PH5 A;  2NVX H;  2IX0 A;  3RLO A;  2B29 A;  4DR6 Q;  4B3M L;  4HJA A;  2FXQ A;  4XIG S;  5C4X H;  5JJL A;  4LF6 L;  4LFB L;  3JC6 6;  1YZ6 A;  2E5L Q;  3CME A;  2UXC L;  4LWC A;  2R92 H;  5HGQ A;  3TS0 A;  2R7F A;  1R9T H;  1HNZ Q;  2OWO A;  2JEA I;  4Y52 H;  4TVA B;  3S1R H;  1Y1V H;  2N3S A;  3BZK A;  2UXB L;  3KLW A;  3B6Y A;  4R4Q A;  2MFI A;  3UDX A;  1MKH A;  2F4V Q;  4WJ3 M;  1Q1B A;  2BA0 A;  4X62 L;  3S2H H;  3OTO L;  4DV2 Q;  3HOZ G;  2KCM A;  2I5L X;  2PQA A;  3UE1 A;  5M3M G;  4LF8 Q;  2BH2 A;  1VQA A;  1EUJ A;  5DLQ E;  3L7Z C;  1K73 C;  4C2M H;  1HZA A;  5H1S E;  3K0X A;  4LF7 L;  2PQA B;  1YNX A;  4POF A;  3H3V I;  1PVO A;  1CKN B;  2ASB A;  3PO2 H;  4O0A A;  4JI2 L;  2KEN A;  3HOY H;  3TRZ A;  4R4O A;  3U4Z A;  1Z47 A;  1FVI A;  2CWP A;  3F8T A;  1GO3 E;  3HFZ B;  4IFD I;  2ZTE A;  4NXM Q;  5C0X I;  2I0Q A;  2HHH Q;  2IHE A;  4YWL A;  2LXJ A;  4A3K H;  4JBM A;  2RHQ B;  3I55 A;  1VS0 A;  4JC0 A;  1KAW A;  1CSQ A;  3H0G H;  2UXC Q;  3ERS X;  3UE0 A;  5LMN L;  4B3S L;  1K8A C;  1PYS B;  4DR4 Q;  4AYB E;  3J81 c;  3HKS A;  2LSS A;  2UXB Q;  4L5Q A;  4KHP L;  4ALP A;  3PO3 H;  1M90 C;  3GD7 A;  4YWK A;  3DLL A;  4X62 Q;  1NE3 A;  1N36 Q;  1YVC A;  2HIX A;  4DR1 L;  1VQ4 A;  4L5T A;  4JI4 Q;  4PZ7 A;  2KHJ A;  4LF7 Q;  1UE5 A;  4UPA A;  3J81 i;  2AWN A;  3J81 j;  5IP7 H;  4JI2 Q;  4DV5 Q;  2R6G A;  2ZJP A;  4QJF A;  2ZTC A;  3RN2 A;  2CFM A;  1M1K C;  4L5R C;  4X64 Q;  1IBL L;  4GN5 A;  1XNQ L;  1Y14 B;  4IPH A;  1XMQ L;  3L2P A;  3G6E A;  1TXY A;  1QVF A;  2VQE L;  4B3S Q;  1JJ2 A;  1EQQ A;  3GTP H;  1N34 Q;  1L1O A;  3CW2 C;  3CCQ A;  3F1Z A;  1Q86 C;  4KHP Q;  1HH2 P;  4A3F H;  4YY3 Q;  5GQO A;  4YCV A;  1RIP A;  4P72 A;  4BBR G;  1KRS A;  5IE8 A;  3LGJ A;  5M5Y H;  4DR1 Q;  5BR8 L;  4DR5 L;  4NPS A;  1VQE A;  4UP9 A;  2CCZ A;  2EIF A;  3U50 C;  3HOU G;  4HJ7 A;  3U58 A;  4OWX B;  5IYD H;  4DAY B;  1S3O A;  4GOP C;  2DGY A;  4B3R Q;  2JA8 G;  5GAG C;  1CSP A;  2VW9 A;  1VQP A;  1S72 A;  1UWV A;  4PMW A;  1J5E Q;  3HOZ H;  1L0W A;  5M3M H;  2VQF Q;  1WI5 A;  2E8G A;  1XNQ Q;  1KL9 A;  5FJ8 G;  2N8N A;  4P73 A;  4A75 A;  2VQE Q;  2Z6K C;  4LF4 L;  1D8L A;  3EIV A;  1K83 H;  4BY1 G;  4DV1 Q;  4GLX A;  1VQ6 A;  2H5X A;  2ATW A;  1VQ7 A;  1J6Q A;  4QL5 A;  2RHS B;  1EFW A;  2K5H A;  2K5N A;  4JV5 L;  3CPF A;  3PUX A;  5BR8 Q;  4DR5 Q;  2UU9 L;  2Q2H A;  1EOV A;  4AH6 A;  4K0K L;  2AKW B;  2XGT A;  3OYY A;  5GAD C;  1C7Y A;  3S16 H;  3GTL H;  4JI7 Q;  1HZ9 A;  2WB1 G;  1YI2 A;  4KLK A;  1K9M C;  1G29 1;  3GTG H;  3S1Q H;  3HKZ E;  2Q2U A;  4OON A;  1B70 B;  1NTG A;  1GD7 A;  4LUZ A;  1HNW Q;  4LFC L;  1JB7 A;  3E9H A;  1KIX A;  4JYA L;  3RZO H;  1K0R A;  1VCI A;  2V1C C;  3CCS A;  3HOX H;  3IRB A;  4DR6 L;  1CKO A;  2EXD A;  2LXK A;  4IPG A;  3ULL A;  1XPR A;  4HID A;  2E2J H;  2JA7 G;  1GVP A;  3ULJ A;  3SGI A;  2E5L L;  3K7U C;  3I4N G;  4DUY L;  1VQ8 A;  1VQO A;  1E1O A;  4NXN Q;  2KCT A;  3D0F A;  1X65 A;  3PUZ A;  3NEM A;  2F52 A;  2UU9 Q;  1FGU A;  3PIO A;  1JE5 A;  1YJN A;  1PH2 A;  3M4P A;  4QQB X;  1K3R A;  3MEF A;  4DV2 L;  4A3E G;  3S17 H;  4LF8 L;  2N49 A;  4JI8 Q;  2BH8 A;  2MQH A;  4BXX G;  3KDF A;  1XPU A;  1Q8K A;  3TS2 A;  3HKZ G;  4NB3 A;  4BBR H;  2IHF A;  1W3S A;  1X54 A;  2UXD L;  3KDF B;  4BA2 I;  4R4C A;  2NN6 G;  1A62 A;  1QZH A;  4NXM L;  2HHH L;  3F2D A;  3BZC A;  1YHA A;  2D62 A;  4GLA C;  4IPD A;  3VDY A;  4DV4 Q;  1HNX L;  3RR5 A;  1I3Q H;  4JOI A;  1L1O C;  4DUY Q; 
#chains in the Genus database with same CATH topology
 3T56 B;  1K8G A;  1BKB A;  1MJE A;  4IQZ A;  1DD2 A;  2JA9 A;  5AJ3 Q;  2CQA A;  1YBY A;  5FJ8 H;  3D6W A;  1K3B C;  3BDC A;  2K75 A;  2IW3 A;  1PFB A;  5HUR A;  3ND9 A;  5M3F H;  3RZD B;  2A6E C;  2RBM A;  4BY1 H;  4YWM A;  3EJI A;  4OEM B;  1N33 L;  4OWT B;  1OXS C;  2UUA L;  4Y7N B;  4DNT B;  1SFO B;  2UXD Q;  2B2U C;  4GS3 A;  5JJI A;  3C46 A;  3I2Z A;  1Q81 C;  3ZJY C;  2K5V A;  1WOC A;  3DEO A;  3AYH B;  1N34 L;  2EY6 A;  1CHQ D;  1VQB A;  1BBU A;  4YY3 L;  1HUM A;  2JXM B;  4DUZ Q;  4CJ2 C;  2K52 A;  4RCN A;  2OF1 A;  2OEO A;  5JJZ A;  3HOV B;  4A93 G;  1WCM G;  2FMM A;  5IOD A;  3I4M B;  3J80 c;  1GUG A;  5C4J B;  3K0Y A;  1F9S A;  1M4V A;  3U9O A;  3E0J A;  3KF8 B;  2JA8 H;  3FDT A;  4X66 Q;  3H09 A;  1PH7 A;  2OCE A;  2XN9 C;  1H95 A;  2RDH A;  1SYE A;  4Q5V A;  3CCR A;  1S5D D;  3CQZ H;  5LMN W;  4BXX H;  1IKM A;  5GAH C;  1MBY A;  5KNB A;  2L9H A;  3S1R B;  1KD1 C;  1X6O A;  2NN6 H;  1IXR A;  2F0T A;  2OQ0 A;  1H9R A;  3BJU A;  2PMZ B;  4IOA A;  3D3R A;  4PV1 C;  3SEB A;  3HOU H;  2F0F A;  3M9B A;  3HG9 A;  4C2M B;  3D4D A;  3K7A H;  1A15 A;  1EYC A;  1SNM A;  3CKI B;  4MTK A;  1EY4 A;  2B63 H;  2PMZ E;  5CV8 A;  1HTL D;  2IJ0 A;  2A5H A;  5D65 A;  5CC4 A;  4JI5 Q;  3PMF A;  1GUW A;  4XQQ A;  2C5C A;  2KCC A;  1TY0 A;  4DNI A;  1VQF A;  2K4K A;  3H0G B;  5J3B A;  3Q22 A;  1GXD C;  1G6P A;  2YU9 H;  1SN8 A;  3HRZ C;  1SJH D;  4OO1 G;  5K36 G;  1PV4 A;  1L2F A;  1JT8 A;  4YCW A;  2R3Z A;  2BE5 C;  3RD4 A;  3UDF A;  2K6A A;  2VXW A;  3T13 A;  1BBX C;  2R92 G;  2K1B A;  2NZO A;  1IZ6 A;  5KIX A;  1QNU A;  3PGZ A;  4LNQ A;  3MWY W;  1JOK A;  1PFS A;  1QUQ B;  1EIF A;  4LF5 L;  2EQS A;  1TS4 A;  4DK1 A;  4DR7 Q;  1KRT A;  4KHV A;  4QGU A;  1DM0 B;  4FF2 A;  1VQI A;  1XX8 A;  5IWA Q;  2WAQ G;  3K81 C;  2MUY A;  4KTA A;  3M4Q A;  1L0Y B;  1Q8I A;  5E4X A;  3KBX A;  1O78 A;  1STH A;  2NVY B;  2NTT A;  1KLU D;  2A1A A;  2XWJ B;  1SRO A;  2NVT H;  5C4Z A;  5FO8 B;  1XMO L;  2Y0S G;  3A55 A;  1VMC A;  3KJO A;  2ZJQ A;  1K83 B;  2RSN A;  4K6D A;  1SJE D;  1C9O A;  1U5K A;  4AIM A;  3VYU A;  2R7Z H;  3S1Q B;  3RN5 A;  2UUB L;  1UEB A;  3DM3 A;  2L4N A;  2N88 A;  1CI3 M;  5IGD A;  2G9D A;  2H1E A;  2YTY A;  3VR5 A;  3FP9 A;  3CF5 A;  4HIK A;  3Q24 A;  5KND A;  1RKN A;  3TEH B;  5IYB H;  2F3I A;  1OO9 B;  3I73 A;  1VQD A;  4IN3 A;  1X3E A;  3S9W A;  3KLS X;  4QUF A;  3K80 C;  3TRE A;  1DGS A;  2E75 C;  4F8M A;  5D3I B;  2IY5 B;  3R8B A;  4A3C G;  2F0V A;  3KF8 A;  3E9I A;  4X65 Q;  5C0X G;  4IO9 A;  5EQ0 A;  2F0L A;  2DUD A;  4LFB Q;  2D0P A;  4K2L A;  4A3I G;  3EQL C;  5C5M A;  1BXT A;  4DV3 L;  5A2Q L;  3ERQ A;  1I3Q B;  5C3E G;  1G2T A;  3PF4 A;  1SNC A;  2EYF A;  2KHS A;  1BCP D;  1I50 H;  5E7N A;  2VUM G;  1HR0 L;  1PRT D;  1DON A;  5M3F B;  4BY1 B;  1FNV A;  2RCN A;  2HUG A;  3R93 A;  4A4I A;  3ICE A;  1D5Z C;  1T5X D;  4J6H A;  4CKB A;  1JWS D;  5G3L D;  5JEA G;  4U67 3;  4IFD J;  2VZA A;  2L5T A;  1SE4 A;  2B3G A;  5AFW A;  3DXJ C;  4DV7 L;  5D3D A;  2PNR C;  4BY7 H;  1V43 A;  5DAU A;  2PI2 E;  1BR9 A;  2A69 C;  1O7Z A;  2MO1 A;  5IY0 A;  1FR3 A;  1VQH A;  1G51 A;  3T1H Q;  1X3G A;  1XJV A;  1NMF A;  1IBL Q;  3WDN A;  1I6H H;  2BOS A;  2JA8 B;  1QUQ A;  3PIP 3;  1PH8 A;  1IBK Q;  4GLV B;  3KJP A;  5ELC A;  3CCV A;  3W3A A;  3PO2 G;  3A56 A;  1ENA A;  1B7Y B;  1LT5 D;  1C4Q A;  1SSO A;  5DNF A;  1HZC A;  1YEZ A;  1SYB A;  4UDU C;  4A3K G;  2Z4I A;  2VNU D;  1SE2 A;  3HOU B;  3WOE A;  3WOF A;  3W1G A;  4POG A;  3PO3 G;  1F9R A;  4GNX A;  3OPO A;  3BU2 A;  1UUP A;  2XNA C;  2JN4 A;  2B63 B;  1KDB A;  4ULL A;  4XQN A;  3UDI A;  1PTO H;  1OXX K;  4FDB A;  1C0A A;  5IP9 H;  5CV5 A;  1LTG D;  2EYJ A;  1LYL A;  2YU9 B;  3NBI A;  1PLF A;  4CKE A;  1K8O A;  5I4D A;  2JJQ A;  4JI3 Q;  1CFM A;  5IYC H;  1LTL A;  3A5U A;  2IX0 A;  1BUV T;  1IHZ A;  2B29 A;  4B3M L;  1B3Q A;  1LAC A;  2X6G A;  5JJL A;  5C4X H;  4LF6 L;  1YZ6 A;  3QWN A;  1H9S B;  1TQO A;  3A54 A;  4LAA A;  2JEA I;  3DWQ A;  2ENB A;  3BZK A;  3NTK A;  2F0H A;  1QOH A;  1ICW A;  3B6Y A;  3FRP B;  5COR A;  3UDX A;  5F2D A;  1Q1B A;  5JOB A;  2PPB C;  3HOZ G;  2PQA A;  1EUJ A;  5DLQ E;  4NDX A;  2F0M A;  4ZRZ A;  4LF7 L;  1YNX A;  4LK1 C;  1Z7T A;  3S17 B;  3TRZ A;  1Z47 A;  3F8T A;  3HFZ B;  5G3L F;  4XXE A;  5J39 A;  3T4A C;  2HHH Q;  5KRU A;  2LXJ A;  1A2U A;  1CSQ A;  2UXC Q;  3ERS X;  4NMZ A;  4B3S L;  1K8A C;  2NVT B;  2LSS A;  1G6Z A;  4L5Q A;  4KHP L;  4ALP A;  3GD7 A;  1ONL A;  1WTQ A;  3DLL A;  5CR3 A;  2HIX A;  3C2P A;  4JI4 Q;  3G6J B;  2A68 D;  4DV5 Q;  2R6G A;  4L5R C;  2K7V A;  1BOS A;  2R7Z B;  2DJF C;  3TZU A;  2HDL A;  3L2P A;  3G6E A;  3MFG A;  1HRJ A;  2VQE L;  1EQQ A;  3CW2 C;  3CCQ A;  5IGC A;  3I70 A;  2XVS A;  4EQN A;  5IE8 A;  2BDN A;  1X32 A;  5M5Y H;  4DR1 Q;  4BS9 A;  1ESF A;  1F2Z A;  2EIF A;  3U50 C;  4HJ7 A;  4OWX B;  4Q0F A;  1D1K A;  3RUZ A;  1NR4 A;  1F2Y A;  1VQP A;  1CSP A;  2M2L A;  1S72 A;  2Z4H A;  4X3S A;  1SYC A;  3J7A F;  5M3M H;  2VQF Q;  1STB A;  3NSW A;  3HZX A;  3K6O A;  1LTA D;  5CGK A;  3CHB D;  5JVG 3;  5EPK A;  3EIV A;  2KVM A;  4GLX A;  1EIG A;  1U4R A;  2G5D A;  2A6E D;  3T51 B;  3X3M A;  1VQ7 A;  2EJF C;  4JV5 L;  1B9N A;  1EU3 A;  3TSS A;  4KK7 A;  5DEH A;  4DR5 Q;  2UU9 L;  5KNC A;  1EOV A;  1LT6 D;  4AH6 A;  4K0K L;  2AKW B;  4RA8 A;  3C3L A;  1I50 B;  1LLR D;  2WB1 G;  1D5M C;  3GTG H;  4C3J G;  4IUU A;  4WOR A;  4K8J A;  4CGY B;  4OON A;  1NSN S;  2O5I C;  1JE4 A;  3E9H A;  4JYA L;  3RZO H;  1VCI A;  2SDF A;  3HOX H;  3IRB A;  2E2D C;  2E2J H;  2E5L L;  3K7U C;  4HCE A;  1R4P B;  1XTC D;  4FXG C;  4HN7 A;  4NXN Q;  3SK5 A;  1SYD A;  1X65 A;  3PUZ A;  2F52 A;  3U9S A;  1FGU A;  3K5N A;  1GUO A;  1U9R A;  3MEF A;  4K8I A;  2EYH A;  4LF8 L;  4HMJ A;  2MP1 A;  5ELE A;  2O4X A;  3TS2 A;  4BBR H;  4HCS A;  3NTI A;  1W3S A;  2UXD L;  2L0C A;  1H9S A;  1SNO A;  5C5L A;  1I6H B;  3BZC A;  1JQY D;  1YHA A;  1NAP A;  1B53 A;  1CK1 A;  2GA4 B;  4DV4 Q;  5EKK A;  3VDY A;  4KJO A;  3D31 A;  5GAE C;  4DUY Q;  4IUN A;  4DR4 L;  4DR2 Q;  1X56 A;  3S14 H;  3IKJ A;  4IOC A;  1X9N A;  1WTV A;  1QIL A;  5JPM C;  4H0L C;  1I94 Q;  3BVG A;  4H13 C;  1EEI D;  4DXF A;  3K58 A;  2RA4 A;  3PQI A;  4A3L G;  2RF4 A;  2BE5 D;  1CM9 A;  1EQV A;  1PTO B;  4RWS C;  1QWY A;  2GVA A;  1AFP A;  4V19 0;  2F3W A;  1GOZ A;  4ZYS A;  1YJ9 A;  4IUP A;  3WWV A;  4HTH A;  1GUS A;  3I4N H;  2NZH A;  3TBI B;  3M85 A;  1N8R C;  1KXL A;  1S5F D;  3CC2 A;  1S4Z A;  1E2V A;  2R93 G;  3AQQ A;  5E1F A;  1J5E L;  3NP8 A;  5IT9 L;  4A3E H;  1EZ8 A;  1B8A A;  3UI2 A;  2E2I H;  5C4X B;  1E24 A;  1I4P A;  4AYB G;  1SE8 A;  2I5H A;  4R8I A;  4IJL A;  1Z9F A;  1P16 A;  2MHV A;  2JA6 G;  1VDZ A;  3JAM E;  2ZJR A;  4HMI A;  1U4M A;  4JI7 L;  4UP8 A;  1ZKO A;  4JI6 Q;  2JEB I;  4IUT A;  2OXP A;  5FO7 B;  3S24 A;  1M8A A;  4X3T A;  3A0J A;  3EN2 A;  5EGT A;  3HGB A;  2I07 B;  3I4M G;  2AQ1 B;  2VB3 X;  1JC7 A;  4OIJ A;  4GKK Q;  2RQX A;  4G7H C;  1PMR A;  5IOC A;  5EBD A;  1OXU A;  4DR7 L;  1UE6 A;  1LV9 A;  1EWH A;  2JSO A;  3C1F A;  1ENF A;  3CRK C;  1A2T A;  4JI8 L;  2ZM6 Q;  4NP5 A;  5DM6 3;  3J7Z C;  4RH6 A;  1GHJ A;  3TDQ A;  4A93 H;  1WCM H;  2A68 C;  1JWM D;  2V4D A;  3SE0 A;  3I90 A;  5K5P A;  2A6H C;  4Z9C B;  4OL7 A;  1EYG A;  4FF4 A;  3E6Z X;  5FO9 B;  3OW2 A;  1TR5 A;  1TWF H;  2E2H H;  5M5Y B;  2L11 A;  1PZK D;  2Z8L A;  2KQ3 A;  2BCO A;  3QG1 A;  4XQJ A;  1PH6 A;  3G4S A;  4DK3 C;  2TSS A;  3IL8 A;  3J81 E;  4LFA L;  3KLS A;  5M3M B;  1VF7 A;  1X3F A;  1STG A;  2NN6 I;  1VQL A;  5JPN C;  3BVM A;  2RCF A;  4ILW A;  1SMY C;  3U4V A;  4LF9 Q;  5LMU Q;  2HCI A;  3VYT A;  4FXK C;  1W2B A;  1VQJ A;  1PYB A;  4WRD A;  3H15 A;  4FP5 D;  1RJT A;  3SK8 A;  3O13 A;  4DV6 L;  1B9M A;  5JVH 3;  3GTG B;  4OO1 H;  5K36 H;  5BN4 A;  4LUO A;  1XNR Q;  4CDF C;  3EVQ A;  5IYD G;  2Z6K A;  3GTJ H;  1P8L A;  3RZO B;  2OTJ A;  1TT2 A;  1EZ6 A;  3HOX B;  1JOO A;  3T53 B;  2AMC B;  2E2J B;  2A69 D;  2XIW A;  1EQT A;  1I5F A;  2HD3 A;  4ZUJ A;  3F2C A;  2Q2I A;  1JOR A;  2EJM A;  1E2Z A;  4A3B G;  1VQM A;  1NJI C;  2JA7 H;  4QY7 A;  1B44 D;  3X3N A;  4IFD G;  2F03 A;  4L63 B;  3MXN B;  4BBR B;  4K5X A;  3A7A B;  3OIQ A;  4FF1 A;  4HSV A;  1DOK A;  1V9P A;  3J80 i;  2SOB A;  3GTM H;  3AB9 A;  5C44 G;  4R4I A;  3OTO Q;  4O2D A;  1LUZ A;  3S14 B;  2F0D A;  2WV6 D;  4MNO A;  1HHV A;  3SHL A;  1CUK A;  1TWG H;  1CT1 D;  3QOL A;  2Q8R E;  1PYW D;  1AH9 A;  3T1Y L;  4DU9 A;  1IBM Q;  3I56 A;  3T1H L;  3W5O A;  4KY5 A;  4YHH L;  2SNM A;  3OIP A;  4LMQ D;  2ALY B;  1AN8 A;  2BDO A;  5LMN Q;  1IBK L;  3G71 A;  4ODG A;  2X6L A;  1SLJ A;  4C3H G;  2F0S A;  2I46 A;  1EIY B;  5M5X H;  2Q2T A;  2VS1 A;  4I7Z C;  3I8Z A;  3AMU A;  1EYA A;  2X69 A;  1IKL A;  3GTK H;  3I4N B;  1Y1V G;  2XRQ D;  2B2Y A;  1J9O A;  2QCP X;  2KBN A;  1BF4 A;  1NMG A;  1XMQ Q;  1VQ5 A;  5M3F G;  4A3C H;  1E1T A;  4A3E B;  1Q7Y C;  2EYO A;  1PTO C;  3LWU A;  2E2I B;  2YV5 A;  5ELO A;  2VB2 X;  3TQY A;  5C0X H;  3PV0 A;  3HKZ B;  4DFA A;  3HOY G;  3T16 A;  1B3A A;  1VQN A;  1XYI A;  1PH4 A;  4A3I H;  5M9O A;  2JK8 A;  1HFN A;  3A5Z B;  4XYQ A;  4FXD A;  1CQV A;  2KHI A;  1N32 L;  5C3E H;  4JI3 L;  1JCK B;  4B3T L;  3AFQ A;  3PCO B;  4OX9 Q;  2VUM H;  1MSG A;  4LF4 Q;  2I5M X;  4GNX B;  3M7N A;  1PA6 A;  5IP7 G;  2F0W A;  3NK9 A;  2B39 A;  3PF5 A;  1KHI A;  5HY6 A;  4MTN A;  4DV0 L;  1BVS A;  4ME3 A;  4N9P A;  4B9X A;  5JEA H;  3Q0A A;  4A76 A;  2IPK D;  2PZW A;  2LKV A;  4LJZ C;  4JI1 L;  4FNF A;  2JE6 I;  1CA5 A;  1FNW A;  2EY1 A;  3H94 A;  3I91 A;  3CMA A;  3FVQ A;  4YCU A;  4LFC Q;  4A3F G;  4IAL A;  1PH5 A;  4DR6 Q;  3M7G A;  2CH4 W;  1A6X A;  2IX3 A;  1O7Y A;  2EY2 A;  2UXC L;  4LWC A;  4A93 B;  1WCM B;  2R7F A;  1R9T H;  4Y52 H;  1SBB B;  1WTR A;  1HPC A;  2N3S A;  2MFI A;  1MKH A;  4WJ3 M;  2BA0 A;  1NR2 A;  2KCM A;  2I5L X;  5EBC A;  1VQA A;  3L7Z C;  1K73 C;  1V1P B;  1O7L A;  2K33 A;  5H1S E;  1RTO A;  1TWF B;  1PVO A;  2PQA B;  2E2H B;  3MXN A;  1HA5 A;  2ASB A;  3PO2 H;  2KEN A;  1FVI A;  5DM7 3;  2KEE A;  4NXM Q;  4K2K A;  2Z6B A;  4YWL A;  4A3K H;  4JBM A;  3BDO A;  2RHQ B;  3I55 A;  1VS0 A;  4JC0 A;  3DMU A;  3Q6S A;  1KAW A;  2A74 C;  5ISR A;  5CV6 A;  3J7A V;  1PYS B;  1WD0 A;  3HKS A;  1TS2 A;  3MXP A;  3PO3 H;  4R9W A;  3NXW A;  4YWK A;  4X62 Q;  1HQM C;  2F4I A;  1NUC A;  4OIK A;  4DR1 L;  3HS0 C;  1I4Q A;  5FLX E;  1UE5 A;  2FIN B;  4UPA A;  3J81 j;  4JI2 Q;  4OEL B;  2MJ8 A;  4TKO B;  3D8G A;  3SR1 A;  2ZTC A;  3RN2 A;  2CFM A;  3OOC A;  1M1K C;  2QIL A;  5I2Y A;  3TME A;  4IPH A;  3DWA A;  1II3 A;  1TXY A;  4DXG A;  1JJ2 A;  3J80 L;  3GTP H;  3GTJ B;  1DYQ A;  1N34 Q;  4CHT B;  1Q86 C;  5C3W A;  4YY3 Q;  1KDA A;  1TII D;  4DK0 A;  4P72 A;  2Q8T A;  4DR5 L;  4RGN A;  1X3Q A;  1BO0 A;  3U58 A;  2H4O A;  4MIU A;  4DAY B;  1B2T A;  1S5B D;  1IYV A;  4CDE C;  2JA7 B;  1B50 A;  2VW9 A;  1IL8 A;  3ERO A;  3LWE A;  4M8A A;  1L0W A;  5IGG A;  3HOZ H;  4WFN 3;  3Q23 A;  1JIC A;  4O42 A;  1XNQ Q;  4TSS A;  4RAU C;  4A75 A;  1Q90 A;  3D4R A;  1UEA B;  2WAQ B;  1D8L A;  4C3I G;  2H5X A;  2ATW A;  4ZUI A;  3GTM B;  1A3U A;  2D9U A;  2K5N A;  3CQZ B;  4O1N A;  1HA6 A;  4J8Q A;  2K28 A;  2Z9H A;  1HZ9 A;  1G29 1;  1JB3 A;  1TWG B;  3GV6 A;  1B70 B;  1V1O A;  4XDX A;  1C8C A;  1JB7 A;  1KIX A;  3K7A B;  3A7L A;  3H6M A;  5CMD A;  3VYS A;  1CKO A;  2LXK A;  3ULL A;  3V2T A;  4HID A;  1ZXT A;  2WKD A;  5BN3 A;  4DGZ A;  4DUY L;  2NTS A;  3NEM A;  5M5X B;  3PIO A;  1YJN A;  3M4P A;  3GV3 A;  3BVZ A;  5CBA E;  4DV2 L;  3ONA B;  4JPB W;  2C9O A;  1E0B A;  1HTP A;  1LTS D;  2BH8 A;  4HR7 B;  4K14 A;  2IWH A;  1XPU A;  1WVL A;  2IHF A;  1X54 A;  5LL6 X;  3GTK B;  4PMB A;  1A62 A;  1QZH A;  3AU7 A;  4HSP A;  1PZJ D;  3RR5 A;  4KD4 A;  3OMG A;  2XSC A;  1BCP F;  1CHP D;  1F77 A;  2PNH A;  2XTI A;  4NW2 A;  3HOW G;  3W1B A;  1RTN A;  1BDO A;  1SAP A;  1PRT F;  1V1P A;  1N36 L;  5I6Y A;  1LTT D;  4CJ0 B;  4A3J H;  4RHR A;  4A3I B;  2PW7 A;  1VQG A;  4BBS H;  5GRO A;  4A3M G;  1CZG A;  1SYG A;  3PUY A;  5C3E B;  1PH9 A;  3AEV A;  4BA1 I;  4F7X A;  1KAB A;  2KEC A;  4X64 L;  1XMO Q;  2VUM B;  2MNA A;  3IFT A;  1EYD A;  4C3J H;  2E74 C;  4AQY Q;  1E22 A;  4M1U B;  3PUW A;  4JBW A;  3MZ5 A;  1ILQ A;  4LW1 A;  5IGF A;  2AHO B;  2GN5 A;  4GN3 B;  3VYR A;  1WD1 A;  1Q46 A;  4DR3 Q;  2EPB A;  2AQ3 B;  4LUV A;  4PZ6 A;  1HXY D;  1LT3 D;  1G91 A;  4B3R L;  2UUB Q;  4L5S A;  2A6H D;  2D5D A;  2QEX A;  4K5V A;  4QMG A;  4WJW A;  4GNX C;  1GM5 A;  2OTL A;  3R2T A;  1EY7 A;  4MHE A;  4JBJ A;  1E2W A;  4QF4 A;  1D7Q A;  2FJ2 A;  1BQQ T;  2AQ2 B;  1EOT A;  4DV1 L;  4UY8 C;  1R9T B;  4A3G G;  3CCE A;  4ZLT F;  1GJX A;  3S1M H;  3NEN A;  5L37 A;  2FHT A;  1STY A;  4DAY A;  2WFW A;  3D6C A;  4TRD A;  4JK1 C;  3G48 A;  4J1M A;  3K8A A;  2EE1 A;  3H91 A;  2CW0 C;  1SMY D;  4HJ5 A;  1HNW L;  1KNE A;  1Y1W G;  2M9V A;  4XT3 B;  1MJC A;  4CKC A;  3DM1 A;  4A3K B;  4V0B A;  2HIV A;  4DV3 Q;  3MC0 B;  1LTI D;  2RSO A;  1UNS A;  3EA6 A;  1HQR D;  3KOJ A;  4CDD C;  3PO3 B;  3PUV A;  1HR0 Q;  3P20 A;  4A3L H;  2UUC Q;  3MAQ A;  1BBW A;  1W6J A;  4A3D G;  4CJ1 B;  1Y8P B;  1N9W A;  3ER0 A;  4GKJ Q;  4IPC A;  1T9H A;  2IX1 A;  1NBW A;  1RHP A;  1S5C D;  4HAE A;  3BZD B;  3VA7 A;  3GTP B;  2B2W A;  2R93 H;  3GP7 A;  5LMU L;  1X55 A;  2EDG A;  1Q82 C;  5AJ3 L;  3KYH C;  4PZ8 A;  4BY7 B;  4Y7N H;  2DJG C;  4JG2 A;  4MZ9 A;  3OSO A;  1K28 A;  2K14 A;  4G7Z C;  2JA6 H;  1FD7 D;  2JA5 G;  3M4O H;  3HOZ B;  1XNR L;  2DNE A;  3CXC A;  3FKI G;  2AUK A;  1K8M A;  2B8F A;  2CKZ B;  3D4W A;  3QB3 A;  4IJH A;  1MD2 D;  3DWP A;  4OWW B;  1GHK A;  2L15 A;  1A0I A;  3FPU B;  4DUZ L;  3NTH A;  1DOL A;  2QGQ A;  4RMF A;  2ES2 A;  4GZY C;  2A19 A;  1EY8 A;  3MVV A;  3NHH A;  1A8V A;  1VQC A;  4KY7 A;  2VY3 A;  5KYL A;  4JCV E;  4X66 L;  4C56 C;  3LNN A;  2HQL A;  3URY A;  1I4G A;  4DK6 C;  4I7A A;  1S5E D;  1XWE A;  3RLN A;  2F0I A;  1PH3 A;  4PG3 A;  5CV9 A;  3S2D H;  1KLG D;  1DZ1 A;  3GTO H;  3VR6 A;  1PTO D;  3CCJ A;  1IYJ B;  1IBM L;  4B3M Q;  3Q8D A;  1EWI A;  1FJG Q;  4R1J A;  1H9K A;  4WJ4 A;  4XYO A;  4LF6 Q;  1O7I A;  3SK6 A;  2A73 B;  1HCZ A;  2PCF B;  1AEX A;  5CV4 A;  1YHQ A;  4JI5 L;  1A3T A;  3AFP A;  4FVM A;  4UAI A;  1HZB A;  2B2W C;  3J7A 5;  3R2I A;  4RG1 A;  3FPP A;  5JJK A;  3HOX G;  3NEL A;  1V1Q A;  5FLM G;  3QOJ A;  3CPW A;  4A3J B;  4R8N A;  2QW7 A;  2LS0 1;  3TP7 A;  1AE2 A;  4BBS B;  2PO4 A;  3OMC A;  2KUM A;  4DAV A;  3VR3 A;  3HOV G;  1RDP D;  4XTC S;  1A63 A;  4UP7 A;  3CCU A;  4N9T A;  1VQ9 A;  2HT1 A;  1TS3 A;  1QB5 D;  2WB1 B;  1MIU A;  1MI2 A;  4C3J B;  1L1O B;  1EY6 A;  4P71 A;  3CU7 A;  3GO5 A;  5ELB A;  1MHW C;  4OO1 I;  3M3Y H;  2CWA A;  1UAP A;  2K5W A;  2WB1 E;  3RLF A;  5IWA L;  3A8I E;  1SDF A;  4U68 A;  3A8J E;  2NVY H;  2R61 A;  4KKU A;  2EXZ A;  1ASY A;  4IUR A;  1TWC H;  3KLR A;  3V96 A;  4IZ8 A;  2MGS A;  4A3B H;  4OX9 L;  3H3V H;  4OXP A;  1QJO A;  4KMU C;  2IT1 A;  1JOQ A;  1EQR A;  2DY7 A;  3P75 A;  2LY7 A;  4L6T B;  3LX0 A;  4IFD H;  1I4R A;  4G4K A;  4HED A;  1FL0 A;  4H02 A;  4TQU S;  5ELD A;  3CCM A;  1VMP A;  2K01 A;  1QE6 A;  5A2Q E;  1TVX A;  3SVM A;  3S1M B;  2QKI C;  3EFX D;  1FGB D;  3I4L A;  4EQ5 A;  1WTW A;  3H0G G;  1OXT A;  2GVB A;  4L8J A;  3STB C;  4B08 A;  1Q12 A;  5C44 H;  3JAM c;  1PH1 A;  3OW7 A;  3ND8 A;  1E7Z A;  3CD6 A;  1CZW A;  3J7Y W;  4EQP A;  1SEB D;  5LL6 S;  2CQO A;  1KAA A;  1EEF D;  4KN4 C;  1WJJ A;  2LMC B;  3S15 H;  2C35 B;  3JAM i;  4JV5 Q;  2B8G A;  2ZT9 C;  4P75 A;  4K0K Q;  4JI0 Q;  1GKH A;  2CHB D;  1LO5 D;  1VQK A;  2EYM A;  5HGT A;  4C3H H;  2DY8 A;  3GTQ H;  3CP0 A;  1YIT A;  4JYA Q;  4X65 L;  2NVX H;  3RLO A;  4HJA A;  1RF2 D;  1RCV D;  2PW5 A;  4XIG S;  4LFB L;  3E5S A;  4P2C B;  2E5L Q;  1Y8O B;  2WKC A;  2KOL A;  2R92 H;  5HGQ A;  2F0P A;  1ET9 A;  1HNZ Q;  4E6I A;  1TS5 A;  2OWO A;  1Y1V H;  2EVB A;  3L3O C;  2F4V Q;  4ZQ3 A;  5BN5 A;  4X62 L;  3S2H H;  2R93 B;  3NE5 B;  3UE1 A;  2BH2 A;  4LF8 Q;  5EKI A;  1HZA A;  4RCO A;  1MSH A;  4POF A;  1CKN B;  1AP0 A;  3OWF A;  4JI2 L;  4IUQ A;  3HOY H;  4AYB B;  5C0X I;  1AZP A;  2I0Q A;  2JA6 B;  2Z1C A;  2QEJ C;  3M4O B;  4DR4 Q;  4AYB E;  3J81 c;  2UXB Q;  1M90 C;  1YVC A;  4JVZ A;  2E76 C;  4L5T A;  2O2L D;  3J81 i;  1VF5 C;  5IP7 H;  2ZJP A;  4QJF A;  5LHY 1;  3FMC A;  2NWG A;  1IBL L;  4GN5 A;  2LFN A;  1SND A;  1XNQ L;  2EOT A;  1TU2 B;  2K04 A;  1H9J A;  1L1O A;  3G7L A;  3F1Z A;  4A3F H;  2EJG C;  2Q8I B;  4YCV A;  3LGJ A;  4NPS A;  1VQE A;  2F0N A;  3C1E A;  3VR4 A;  2K5D A;  1QCB D;  3S2D B;  1G2S A;  1BNZ A;  3GTO B;  2RKS A;  4DNR B;  1PXU A;  1J5E Q;  2J4X A;  5KEE A;  1X3P A;  1WI5 A;  2E8G A;  5FJ8 G;  2Z6K C;  4B9W A;  4BY1 G;  1VQ6 A;  4RFB A;  1J6Q A;  4QL5 A;  2RHS B;  1EFW A;  2J7Z A;  1V8Q A;  4QCL A;  3CPF A;  5BR8 Q;  1EY5 A;  2Q2H A;  1D5X C;  2XGT A;  3OYY A;  1C7Y A;  3S16 H;  3GTL H;  4OHJ A;  5JAV A;  4JI7 Q;  2QDL A;  1WTX A;  3HKZ E;  1Q3L A;  2DN8 A;  4CDC C;  2EY5 A;  1K0R A;  2V1C C;  1STN A;  1XPR A;  4IPG A;  2NYZ D;  2JA7 G;  5NUC A;  3ULJ A;  2QDB A;  5C6A A;  1VQ8 A;  1VQO A;  4KN7 C;  3DUZ A;  3KBG A;  4N8F A;  2JA8 G;  1I4H A;  1K3R A;  3S17 H;  3TP5 A;  4EGV A;  4JI8 Q;  1SNQ A;  3M3Y B;  4BXX G;  3KDF A;  1Q8K A;  3W2D A;  1A3V A;  2F0G A;  4BA2 I;  2B2V A;  3HEJ A;  2NN6 G;  1ZYR C;  1TWC B;  2HHH L;  3F2D A;  4GLA C;  2D62 A;  4A3B B;  1ROD A;  3TP6 A;  2PZU A;  1EY9 A;  4JOI A;  1L1O C;  3JAM L;  3HOU G;  3PIO 3;  5A35 A;  4AQY L;  4ME5 A;  3MXG A;  4P74 A;  1IW7 C;  2Z0S A;  1IL2 A;  2B63 G;  2CW0 D;  4DR3 L;  4RGM A;  1CKN A;  4C3I H;  4JW0 A;  1YNJ C;  4JI4 L;  1EU4 A;  2HQE A;  5C4H A;  3QJY A;  4PQX A;  4DV5 L;  1XTD A;  5C44 B;  4LFA Q;  2B2Y C;  4K5W A;  3S1N H;  5TSS A;  1HNX Q;  1WYD A;  1F2M A;  3ULP A;  2K32 A;  2SEB D;  3S15 B;  2QA4 A;  1EFI D;  2OT2 A;  1JR0 D;  4DN4 M;  2JQO A;  1SRU A;  1YNN C;  3QR8 A;  1STE A;  1N33 Q;  2NUC A;  4DV6 Q;  3KF6 B;  1Y8N B;  2D0O A;  3I4O A;  4C3H B;  1D2B A;  2UUA Q;  2FMC A;  3GTQ B;  1B1Z A;  1BCP B;  2KCN A;  2YTV A;  2NVX B;  3RMH A;  1T5E A;  2VQF L;  1LTB D;  1PRT B;  4K6L A;  3VR2 A;  1PFN A;  1OTC A;  2R92 B;  4QIW B;  1LAB A;  4R4T A;  1ML0 D;  2R7D A;  3A74 A;  1Y1V B;  5IGB A;  5ELF A;  2L1B A;  4RKB A;  3FHW A;  3I7F A;  3N6R A;  3NQI A;  5M5W H;  2ZTD A;  2AUJ D;  5EKL A;  5T1I A;  3J81 L;  2UUC L;  4RKL A;  1JJC B;  4QIW E;  1LTR D;  3HOW H;  4GKJ L;  4KHZ A;  2B2V C;  3HOY B;  5IGE A;  4H7B A;  2D2C C;  4JOI C;  4CBV A;  3ZYY X;  2L12 A;  1ENC A;  4A3M H;  5KGU A;  2K5Q A;  3MFY A;  4DPG A;  4NXN L;  2R7Z G;  2F0E A;  1AE3 A;  3DHQ A;  1D6E C;  4KD3 A;  1KNA A;  2WAQ E;  3T1Y Q;  2NZ1 D;  4JBK A;  3MXU A;  1PHJ A;  1AZQ A;  3L9A X;  4GN4 B;  1SE3 A;  2Y0S B;  4YHH Q;  3K57 A;  2YYZ A;  5IYB G;  1HJP A;  5FLX c;  1NY4 A;  5EPJ A;  2B2T A;  1QVG A;  1ICF B;  5E4W C;  1ILP A;  1TWH H;  2F1M A;  1JMC A;  2Y0S E;  5FK9 C;  3CAM A;  1CQF A;  4DV4 L;  5IT9 E;  1U4L A;  4DR2 L;  4A3F B;  1CKM A;  2P5Z X;  1YHB A;  2K03 A;  4HJ9 A;  2JYO A;  1JJG A;  1RD9 D;  1I94 L;  3MA2 B;  4A3G H;  1J8I A;  5D14 A;  1PZI D;  4APV A;  3CC7 A;  4DA2 A;  1DXM A;  5FOB B;  2A8V A;  2N55 A;  2YTX A;  4LF5 Q;  3E3X A;  1C48 A;  1Y1W H;  4MN3 A;  3IAY A;  2F0O A;  3SDZ A;  3IFD A;  1DOM A;  1N32 Q;  1YJW A;  2K05 A;  5EAY A;  3S16 B;  3GTL B;  3A8K E;  4GOP B;  1QVC A;  4B3T Q;  4H44 C;  3NBH B;  1FJG L;  2CVR A;  1I4X A;  1L0X B;  4BY7 G;  2WP8 J;  4A3D H;  4G57 A;  2M00 A;  4S3S A;  5EPL A;  4KJN A;  4DV0 Q;  4YIJ A;  2JP1 A;  4JI1 Q;  3PSI A;  2PQE A;  1TWA H;  3KK7 A;  4X3U A;  5IT9 c;  3L0O A;  2ID0 A;  3KF6 A;  2NB0 A;  1OXV A;  4F87 A;  1FYC A;  3BYY B;  5ELN A;  3TN2 A;  4JI6 L;  1EL0 A;  1UE7 A;  3E0E A;  1SMX A;  2J0T D;  1UE1 A;  2B2T C;  2NBF A;  2RDG A;  3BDL A;  2HCC A;  2NVQ H;  3GQB A;  1ASZ A;  1K0S A;  1QNK A;  4GKK L;  2OQK A;  1NCV A;  3TP8 A;  3STB D;  1U0L A;  2KJX A;  1PFM A;  1YIJ A;  2JA5 H;  3HP3 A;  2VL6 A;  1SR3 A;  2DNC A;  2L55 A;  3FKI H;  3I72 A;  3MEH A;  4DF7 A;  2K50 A;  3UDG A;  3R3O A;  5J1Z A;  1WTH A;  3EBE A;  1HFG A;  3SK4 A;  4C3I B;  2MO0 A;  3BYT B;  1RL2 A;  3DEP A;  5IP9 G;  3RNU A;  4G7O C;  2ZM6 L;  3PO2 B;  2WII B;  3V05 A;  2O5J C;  4X6A H;  3H3V C;  2PI2 A;  1H9M A;  3S1N B;  4FF3 A;  3P1H A;  1KQS A;  5C0X J;  3PIP A;  5IYC G;  1EWC A;  3OHX C;  3KFU A;  1R4Q B;  4N8X 1;  4QB4 A;  1HR0 W;  3CC4 A;  1KC8 C;  2RDF A;  1O80 A;  5C4X G;  1AW7 A;  4ZKB B;  1E3P A;  2N78 A;  5CBE E;  5J22 A;  2EZV A;  5T1G A;  4EVO A;  4ZCK A;  4A3J G;  4BBS G;  1F9Q A;  1G8Z D;  2QF7 A;  1NNX A;  2IL8 A;  1QZG A;  3K5L A;  4KKS A;  4DV7 Q;  2ICI A;  3NWT A;  1XPO A;  1KTK A;  3NQT A;  4LF9 L;  4KI0 A;  5KYI A;  4DAM A;  1EY0 A;  3RZD H;  1SYF A;  4JI0 L;  5JEA J;  1LT4 D;  1I6V C;  2BA1 A;  5CV7 A;  5M5W B;  1SFO H;  1DJR D;  1BCP C;  1TKW B;  2TMP A;  1S40 A;  3NWS A;  3F2B A;  1TY2 A;  4DKA C;  5IIF A;  1QG7 A;  3HOW B;  1PRT C;  3CCL A;  4PNY A;  5FLM H;  4EX5 A;  4J15 A;  1EIH A;  4RGO S;  1HNZ L;  3K59 A;  1WFQ A;  5FLX L;  2F4V L;  2AWO A;  1F2L A;  4HIO A;  4A3M B;  3GDE A;  4X3K A;  3HOV H;  2KA7 A;  2F0U A;  3I4M H;  1Q1E A;  4ZKC B;  5C4J H;  4GOP A;  1ESR A;  4OGQ C;  4HIM A;  3NBH A;  1LM0 A;  4HJ8 A;  3ITP A;  2FXQ A;  3BG3 A;  1CA6 A;  2XRS D;  3JC6 6;  2EYP A;  3VA5 A;  3CME A;  5I9P A;  3TS0 A;  2HDM A;  1TWH B;  2G9H D;  4TVA B;  3S1R H;  2UXB L;  3I3C A;  3KLW A;  4R4Q A;  3P7J A;  3OTO L;  4DV2 Q;  4KY6 A;  5M3M G;  3NPP A;  3TZD A;  4C2M H;  3K0X A;  3H3V I;  2F0J A;  4O0A A;  2MPM A;  1XXG A;  2CH4 A;  4R4O A;  3U4Z A;  2CWP A;  4IFD I;  1GO3 E;  1F9P A;  4A3G B;  2ZTE A;  1SXT A;  4XT1 B;  5I9O A;  2IHE A;  1FNU A;  4KV6 A;  1IYU A;  3H0G H;  3UE0 A;  1W6K A;  5LMN L;  2PYK A;  4ABN A;  2PZT A;  4ZK9 B;  1N36 Q;  1NE3 A;  2F0K A;  1PDQ A;  4C1N I;  1VQ4 A;  1Y1W B;  3MTS A;  3NUC A;  1STA A;  4PZ7 A;  2KHJ A;  5E3F A;  4LF7 Q;  4C1N K;  2AWN A;  4ID6 A;  2SNS A;  2ZXP A;  1WTO A;  4RGT A;  1ZEQ X;  2XWB B;  4X64 Q;  4NKL A;  1Y14 B;  2ICE C;  4FO2 A;  1XMQ L;  1QVF A;  4UHV A;  4B3S Q;  3FEW X;  3OWE B;  4KHP Q;  1HH2 P;  4A3D B;  4IUV A;  5GQO A;  1RIP A;  3QIA A;  4BBR G;  1KRS A;  5I2X A;  5BR8 L;  4UP9 A;  2CCZ A;  5IYD H;  1ZYR D;  1S3O A;  1TWA B;  2DGY A;  4GOP C;  1HUN A;  4RHS A;  4B3R Q;  4ZAI A;  1GUN A;  5GAG C;  5COY A;  1UWV A;  4PMW A;  1Y69 U;  2B2U A;  1ET6 A;  3CRL C;  2WAC A;  3N52 A;  1KL9 A;  1IW7 D;  2N8N A;  4KKT A;  4P73 A;  2VQE Q;  4LF4 L;  4DAP A;  5C3X A;  1K83 H;  4QUC A;  4DV1 Q;  1KDC A;  1YNJ D;  2NVQ B;  3QO2 A;  2K5H A;  3PUX A;  1Z6H A;  1B4O A;  1WTP A;  4BWG B;  5GAD C;  3KUP A;  2JA5 B;  2ZXO A;  3FKI B;  3MHB A;  1YI2 A;  1DCZ A;  3K5O A;  4KLK A;  1K9M C;  3S1Q H;  2Q2U A;  1NTG A;  1GD7 A;  2EYL A;  4LUZ A;  1HNW Q;  1SNP A;  4LFC L;  3CCS A;  2F3V A;  4DR6 L;  3M4Y A;  2EXD A;  1GVP A;  1YNN D;  3SGI A;  3I4N G;  2WIN B;  4EQO A;  1E1O A;  2KCT A;  3D0F A;  1CTM A;  1GUT A;  4I65 A;  2KED A;  5FKA C;  3J80 E;  2UU9 Q;  3F2U A;  4FYD A;  1PH2 A;  1JE5 A;  4QQB X;  3S2H B;  4A3E G;  5EJW A;  1PTO F;  2N49 A;  5I6W A;  2FFK B;  2MQH A;  3K5M A;  1D1I A;  1MGS A;  3HKZ G;  4NB3 A;  5CYU A;  4PMC A;  3KDF B;  1U4P A;  4R4C A;  4F88 A;  1JWU D;  4NXM L;  2RVL A;  2F0Q A;  4IPD A;  2ZXR A;  1HNX L;  1I3Q H;  3SXH A;  3BS1 A; 
#chains in the Genus database with same CATH homology
 1K8G A;  1BKB A;  4AQY L;  1MJE A;  4DR2 Q;  4DR4 L;  1X56 A;  3S14 H;  2XTI A;  2PNH A;  4P74 A;  2JA9 A;  3W1B A;  2Z0S A;  5AJ3 Q;  3HOW G;  4IOC A;  1YBY A;  5FJ8 H;  1X9N A;  1N36 L;  1IL2 A;  2B63 G;  2K75 A;  4DR3 L;  5M3F H;  1CKN A;  4C3I H;  4A3J H;  4BY1 H;  1I94 Q;  4JI4 L;  1VQG A;  4BBS H;  4YWM A;  1N33 L;  4OWT B;  1OXS C;  4DV5 L;  5GRO A;  2UUA L;  4A3M G;  3AEV A;  1XTD A;  3PUY A;  1PH9 A;  2UXD Q;  4LFA Q;  4GS3 A;  5JJI A;  4BA1 I;  3I2Z A;  1Q81 C;  3ZJY C;  4X64 L;  1XMO Q;  3S1N H;  2K5V A;  1HNX Q;  2MNA A;  1WYD A;  4A3L G;  1WOC A;  2RF4 A;  4C3J H;  3AYH B;  4AQY Q;  1E22 A;  1N34 L;  3PUW A;  1VQB A;  3ULP A;  4JBW A;  1BBU A;  2GVA A;  4LW1 A;  4YY3 L;  2QA4 A;  2AHO B;  4DUZ Q;  2GN5 A;  4GN3 B;  1YJ9 A;  2JQO A;  1Q46 A;  4DR3 Q;  1SRU A;  2K52 A;  3WWV A;  4A93 G;  4LUV A;  4PZ6 A;  1WCM G;  3I4N H;  2NZH A;  3J80 c;  1N33 Q;  3M85 A;  1N8R C;  4DV6 Q;  3KF6 B;  1KXL A;  2D0O A;  3I4O A;  2UUA Q;  4B3R L;  2UUB Q;  3CC2 A;  3KF8 B;  4L5S A;  2JA8 H;  2R93 G;  4X66 Q;  3AQQ A;  4GNX C;  2QEX A;  1J5E L;  1GM5 A;  2YTV A;  2OTL A;  4A3E H;  1PH7 A;  1B8A A;  2OCE A;  1H95 A;  4JBJ A;  2VQF L;  2E2I H;  3CCR A;  3CQZ H;  1E24 A;  5LMN W;  4BXX H;  1D7Q A;  5GAH C;  1OTC A;  4AYB G;  1SE8 A;  4UY8 C;  2I5H A;  4DV1 L;  4R4T A;  4A3G G;  4IJL A;  1Z9F A;  1P16 A;  2R7D A;  1X6O A;  3A74 A;  3CCE A;  1IXR A;  1KD1 C;  2JA6 G;  3NEN A;  2OQ0 A;  3S1M H;  3D31 A;  2WFW A;  3BJU A;  3FHW A;  3I7F A;  5M5W H;  2ZJR A;  4IOA A;  2ZTD A;  3HOU H;  2UUC L;  1JJC B;  3M9B A;  4QIW E;  3G48 A;  4JI7 L;  3K8A A;  3K7A H;  4UP8 A;  4JI6 Q;  2JEB I;  3HOW H;  3S24 A;  4GKJ L;  4KHZ A;  2B63 H;  2PMZ E;  3A0J A;  4HJ5 A;  1HNW L;  1Y1W G;  3EN2 A;  1MJC A;  3I4M G;  4JI5 Q;  4GKK Q;  2HIV A;  4DV3 Q;  4JOI C;  4DNI A;  1VQF A;  2K4K A;  5J3B A;  4A3M H;  1G6P A;  1OXU A;  2YU9 H;  4DPG A;  1SN8 A;  4NXN L;  3KOJ A;  2R7Z G;  1AE3 A;  1UE6 A;  1PV4 A;  3PUV A;  4DR7 L;  1HR0 Q;  1L2F A;  4OO1 G;  5K36 G;  1JT8 A;  4YCW A;  4A3L H;  2WAQ E;  3UDF A;  2UUC Q;  1BBW A;  3T1Y Q;  2R92 G;  4A3D G;  4JBK A;  1PHJ A;  1N9W A;  4GN4 B;  4JI8 L;  4YHH Q;  2ZM6 Q;  3ER0 A;  4GKJ Q;  4IPC A;  2YYZ A;  2NZO A;  1IZ6 A;  5IYB G;  1HJP A;  3J7Z C;  1T9H A;  2IX1 A;  1NBW A;  1NY4 A;  5FLX c;  4A93 H;  3PGZ A;  1QVG A;  4LNQ A;  1WCM H;  1TWH H;  1JMC A;  1PFS A;  1QUQ B;  2Y0S E;  1EIF A;  3CAM A;  4DV4 L;  4LF5 L;  2EQS A;  2R93 H;  4DR7 Q;  1KRT A;  4QGU A;  5LMU L;  1X55 A;  4DR2 L;  1EYG A;  1Q82 C;  1CKM A;  5AJ3 L;  3OW2 A;  1TWF H;  3KYH C;  2E2H H;  1VQI A;  1YHB A;  5IWA Q;  2WAQ G;  4PZ8 A;  5GAE C;  3K81 C;  4HJ9 A;  4Y7N H;  1JJG A;  4JG2 A;  3M4Q A;  3G4S A;  4MZ9 A;  1PH6 A;  1I94 L;  4A3G H;  4DK3 C;  2K14 A;  2JA6 H;  4APV A;  2JA5 G;  3M4O H;  3CC7 A;  4LFA L;  2A1A A;  1XNR L;  1X3F A;  2NN6 I;  1SRO A;  3CXC A;  2NVT H;  3FKI G;  1VQL A;  2A8V A;  1XMO L;  2Y0S G;  3KJO A;  2YTX A;  4LF5 Q;  2ZJQ A;  2CKZ B;  3U4V A;  4LF9 Q;  5LMU Q;  4IJH A;  1Y1W H;  4OWW B;  2L15 A;  1A0I A;  1C9O A;  4DUZ L;  1W2B A;  1VQJ A;  1N32 Q;  1PYB A;  2QGQ A;  1YJW A;  5EAY A;  4RMF A;  2ES2 A;  1U5K A;  3H15 A;  2A19 A;  4GOP B;  1QVC A;  4AIM A;  1A8V A;  4B3T Q;  1VQC A;  4DV6 L;  2R7Z H;  3NBH B;  3RN5 A;  2VY3 A;  2UUB L;  1FJG L;  1UEB A;  3DM3 A;  4JCV E;  4LUO A;  4X66 L;  1XNR Q;  4BY7 G;  5IYD G;  2Z6K A;  3GTJ H;  1P8L A;  2HQL A;  2YTY A;  2OTJ A;  2WP8 J;  3FP9 A;  4DK6 C;  3CF5 A;  4A3D H;  4HIK A;  2AMC B;  3RLN A;  3TEH B;  5IYB H;  2F3I A;  1PH3 A;  1VQD A;  1I5F A;  4DV0 Q;  1X3E A;  3F2C A;  2Q2I A;  4JI1 Q;  3PSI A;  4PG3 A;  1TWA H;  3K80 C;  5IT9 c;  4A3B G;  3TRE A;  1DGS A;  3L0O A;  3S2D H;  1VQM A;  2ID0 A;  3KF6 A;  1NJI C;  2JA7 H;  4QY7 A;  3GTO H;  4A3C G;  1OXV A;  2IY5 B;  3E9I A;  4IFD G;  4X65 Q;  3CCJ A;  1IYJ B;  3MXN B;  5ELN A;  5C0X G;  4IO9 A;  1IBM L;  3Q8D A;  4B3M Q;  1EWI A;  1FJG Q;  4R1J A;  4JI6 L;  4WJ4 A;  4LF6 Q;  1O7I A;  2DUD A;  4LFB Q;  1UE7 A;  3E0E A;  1SMX A;  1UE1 A;  2D0P A;  4A3I G;  2NVQ H;  1YHQ A;  4JI5 L;  1V9P A;  3J80 i;  3AFP A;  1ASZ A;  3GTM H;  4GKK L;  4DV3 L;  1HZB A;  5C3E G;  2OQK A;  5C44 G;  4R4I A;  3PF4 A;  3J7A 5;  3OTO Q;  3STB D;  1U0L A;  4O2D A;  1LUZ A;  1YIJ A;  4RG1 A;  2JA5 H;  1I50 H;  5JJK A;  3HOX G;  5E7N A;  4MNO A;  2VUM G;  2VL6 A;  1SR3 A;  3FKI H;  1CUK A;  1HR0 L;  3NEL A;  1V1Q A;  1TWG H;  2K50 A;  3UDG A;  5FLM G;  1AH9 A;  3CPW A;  3EBE A;  3T1Y L;  2MO0 A;  1AE2 A;  2RCN A;  4A4I A;  3I56 A;  1RL2 A;  3T1H L;  1IBM Q;  5IP9 G;  3W5O A;  3ICE A;  3RNU A;  4YHH L;  2ZM6 L;  4X6A H;  2PI2 A;  3HOV G;  4XTC S;  2ALY B;  1A63 A;  5LMN Q;  1IBK L;  5JEA G;  4UP7 A;  3CCU A;  1VQ9 A;  3G71 A;  1SLJ A;  4IFD J;  2HT1 A;  2VZA A;  1KQS A;  1MIU A;  5C0X J;  2B3G A;  3PIP A;  1L1O B;  1EIY B;  5IYC G;  4P71 A;  5M5X H;  3KFU A;  3GO5 A;  4DV7 L;  2Q2T A;  2VS1 A;  4BY7 H;  1V43 A;  1HR0 W;  3CC4 A;  4OO1 I;  2PI2 E;  1KC8 C;  3M3Y H;  2CWA A;  5C4X G;  2WB1 E;  3RLF A;  5IWA L;  1E3P A;  2MO1 A;  2N78 A;  5IY0 A;  1VQH A;  1G51 A;  2NVY H;  3T1H Q;  1ASY A;  3GTK H;  1X3G A;  1Y1V G;  1TWC H;  1NMF A;  1XJV A;  1IBL Q;  2KBN A;  1I6H H;  1NMG A;  1XMQ Q;  4OX9 L;  3H3V H;  4A3B H;  4OXP A;  1VQ5 A;  1QUQ A;  1PH8 A;  1IBK Q;  2IT1 A;  5M3F G;  1EQR A;  4A3J G;  4GLV B;  3KJP A;  1E1T A;  1Q7Y C;  4A3C H;  4BBS G;  2YV5 A;  5ELO A;  3TQY A;  3CCV A;  1QZG A;  3PO2 G;  1B7Y B;  3PV0 A;  1FL0 A;  4DV7 Q;  4H02 A;  3HOY G;  4TQU S;  1HZC A;  1YEZ A;  1XPO A;  4LF9 L;  3CCM A;  4KI0 A;  3RZD H;  4DAM A;  1VQN A;  4JI0 L;  1PH4 A;  4A3I H;  5JEA J;  4A3K G;  2JK8 A;  3A5Z B;  4EQ5 A;  3H0G G;  1OXT A;  2BA1 A;  2GVB A;  2KHI A;  1N32 L;  2VNU D;  1SFO H;  3STB C;  5C3E H;  5C44 H;  1Q12 A;  4JI3 L;  3JAM c;  1PH1 A;  3W1G A;  1S40 A;  3F2B A;  4POG A;  3PO3 G;  1E7Z A;  4GNX A;  3CD6 A;  4DKA C;  3BU2 A;  4B3T L;  3AFQ A;  3PCO B;  4OX9 Q;  2VUM H;  3CCL A;  4LF4 Q;  2I5M X;  4GNX B;  2CQO A;  5FLM H;  4EX5 A;  4J15 A;  3UDI A;  3M7N A;  1WJJ A;  3S15 H;  1PA6 A;  1OXX K;  2C35 B;  4FDB A;  3JAM i;  1HNZ L;  1C0A A;  5IP7 G;  4JV5 Q;  1WFQ A;  5IP9 H;  4P75 A;  2F4V L;  3PF5 A;  2AWO A;  1KHI A;  1LYL A;  4HIO A;  4K0K Q;  3GDE A;  5HY6 A;  4JI0 Q;  3HOV H;  1GKH A;  4MTN A;  1BVS A;  4ME3 A;  4DV0 L;  3I4M H;  1Q1E A;  4A76 A;  4JI1 L;  1VQK A;  5C4J H;  2JE6 I;  4C3H H;  4GOP A;  3GTQ H;  2JJQ A;  4JI3 Q;  4HIM A;  5IYC H;  4LFC Q;  3CMA A;  3CP0 A;  4YCU A;  1YIT A;  1LM0 A;  4JYA Q;  4A3F G;  1LTL A;  4X65 L;  3A5U A;  4HJ8 A;  1PH5 A;  2NVX H;  2IX0 A;  3RLO A;  2B29 A;  4DR6 Q;  4B3M L;  4HJA A;  2FXQ A;  4XIG S;  5C4X H;  5JJL A;  4LF6 L;  4LFB L;  3JC6 6;  1YZ6 A;  2E5L Q;  3CME A;  2UXC L;  4LWC A;  2R92 H;  5HGQ A;  3TS0 A;  2R7F A;  1R9T H;  1HNZ Q;  2OWO A;  2JEA I;  4Y52 H;  4TVA B;  3S1R H;  1Y1V H;  2N3S A;  3BZK A;  2UXB L;  3KLW A;  3B6Y A;  4R4Q A;  2MFI A;  3UDX A;  1MKH A;  2F4V Q;  4WJ3 M;  1Q1B A;  2BA0 A;  4X62 L;  3S2H H;  3OTO L;  4DV2 Q;  3HOZ G;  2KCM A;  2I5L X;  2PQA A;  3UE1 A;  5M3M G;  4LF8 Q;  2BH2 A;  1VQA A;  1EUJ A;  5DLQ E;  3L7Z C;  1K73 C;  4C2M H;  1HZA A;  5H1S E;  3K0X A;  4LF7 L;  2PQA B;  1YNX A;  4POF A;  3H3V I;  1PVO A;  1CKN B;  2ASB A;  3PO2 H;  4O0A A;  4JI2 L;  2KEN A;  3HOY H;  3TRZ A;  4R4O A;  3U4Z A;  1Z47 A;  1FVI A;  2CWP A;  3F8T A;  1GO3 E;  3HFZ B;  4IFD I;  2ZTE A;  4NXM Q;  5C0X I;  2I0Q A;  2HHH Q;  2IHE A;  4YWL A;  2LXJ A;  4A3K H;  4JBM A;  2RHQ B;  3I55 A;  1VS0 A;  4JC0 A;  1KAW A;  1CSQ A;  3H0G H;  2UXC Q;  3ERS X;  3UE0 A;  5LMN L;  4B3S L;  1K8A C;  1PYS B;  4DR4 Q;  4AYB E;  3J81 c;  3HKS A;  2LSS A;  2UXB Q;  4L5Q A;  4KHP L;  4ALP A;  3PO3 H;  1M90 C;  3GD7 A;  4YWK A;  3DLL A;  4X62 Q;  1NE3 A;  1N36 Q;  1YVC A;  2HIX A;  4DR1 L;  1VQ4 A;  4L5T A;  4JI4 Q;  4PZ7 A;  2KHJ A;  4LF7 Q;  1UE5 A;  4UPA A;  3J81 i;  2AWN A;  3J81 j;  5IP7 H;  4JI2 Q;  4DV5 Q;  2R6G A;  2ZJP A;  4QJF A;  2ZTC A;  3RN2 A;  2CFM A;  1M1K C;  4L5R C;  4X64 Q;  1IBL L;  4GN5 A;  1XNQ L;  1Y14 B;  4IPH A;  1XMQ L;  3L2P A;  3G6E A;  1TXY A;  1QVF A;  2VQE L;  4B3S Q;  1JJ2 A;  1EQQ A;  3GTP H;  1N34 Q;  1L1O A;  3CW2 C;  3CCQ A;  3F1Z A;  1Q86 C;  4KHP Q;  1HH2 P;  4A3F H;  4YY3 Q;  5GQO A;  4YCV A;  1RIP A;  4P72 A;  4BBR G;  1KRS A;  5IE8 A;  3LGJ A;  5M5Y H;  4DR1 Q;  5BR8 L;  4DR5 L;  4NPS A;  1VQE A;  4UP9 A;  2CCZ A;  2EIF A;  3U50 C;  3HOU G;  4HJ7 A;  3U58 A;  4OWX B;  5IYD H;  4DAY B;  1S3O A;  4GOP C;  2DGY A;  4B3R Q;  2JA8 G;  5GAG C;  1CSP A;  2VW9 A;  1VQP A;  1S72 A;  1UWV A;  4PMW A;  1J5E Q;  3HOZ H;  1L0W A;  5M3M H;  2VQF Q;  1WI5 A;  2E8G A;  1XNQ Q;  1KL9 A;  5FJ8 G;  2N8N A;  4P73 A;  4A75 A;  2VQE Q;  2Z6K C;  4LF4 L;  1D8L A;  3EIV A;  1K83 H;  4BY1 G;  4DV1 Q;  4GLX A;  1VQ6 A;  2H5X A;  2ATW A;  1VQ7 A;  1J6Q A;  4QL5 A;  2RHS B;  1EFW A;  2K5H A;  2K5N A;  4JV5 L;  3CPF A;  3PUX A;  5BR8 Q;  4DR5 Q;  2UU9 L;  2Q2H A;  1EOV A;  4AH6 A;  4K0K L;  2AKW B;  2XGT A;  3OYY A;  5GAD C;  1C7Y A;  3S16 H;  3GTL H;  4JI7 Q;  1HZ9 A;  2WB1 G;  1YI2 A;  4KLK A;  1K9M C;  1G29 1;  3GTG H;  3S1Q H;  3HKZ E;  2Q2U A;  4OON A;  1B70 B;  1NTG A;  1GD7 A;  4LUZ A;  1HNW Q;  4LFC L;  1JB7 A;  3E9H A;  1KIX A;  4JYA L;  3RZO H;  1K0R A;  1VCI A;  2V1C C;  3CCS A;  3HOX H;  3IRB A;  4DR6 L;  1CKO A;  2EXD A;  2LXK A;  4IPG A;  3ULL A;  1XPR A;  4HID A;  2E2J H;  2JA7 G;  1GVP A;  3ULJ A;  3SGI A;  2E5L L;  3K7U C;  3I4N G;  4DUY L;  1VQ8 A;  1VQO A;  1E1O A;  4NXN Q;  2KCT A;  3D0F A;  1X65 A;  3PUZ A;  3NEM A;  2F52 A;  2UU9 Q;  1FGU A;  3PIO A;  1JE5 A;  1YJN A;  1PH2 A;  3M4P A;  4QQB X;  1K3R A;  3MEF A;  4DV2 L;  4A3E G;  3S17 H;  4LF8 L;  2N49 A;  4JI8 Q;  2BH8 A;  2MQH A;  4BXX G;  3KDF A;  1XPU A;  1Q8K A;  3TS2 A;  3HKZ G;  4NB3 A;  4BBR H;  2IHF A;  1W3S A;  1X54 A;  2UXD L;  3KDF B;  4BA2 I;  4R4C A;  2NN6 G;  1A62 A;  1QZH A;  4NXM L;  2HHH L;  3F2D A;  3BZC A;  1YHA A;  2D62 A;  4GLA C;  4IPD A;  3VDY A;  4DV4 Q;  1HNX L;  3RR5 A;  1I3Q H;  4JOI A;  1L1O C;  4DUY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...