1G6PA

Solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the cold-shock protein from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics
molecule keywords COLD SHOCK PROTEIN TMCSP
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1g6pA00
4LF4Q 1N36L 2E2IH 4JC0A 1RL2A 1E1OA 2F52A 4X64L 2PI2A 3F2BA 4DPGA 5IWAL 1YJ9A 1XNRQ 1VQLA 4IFDI 3FHWA 4DKAC 4IJLA 5FLMH 2RCNA 3T1YQ 2YU9H 1KXLA 5C4XG 3RZOH 4OWTB 4GS3A 1YNXA 4NB3A 1XNQQ 2Q2TA 2JA5G 4A93G 5LMUQ 1HNWQ 1CKOA 4YCVA 1L1OA 2VW9A 4R4QA 1JMCA 3OW2A 4A3BH 3A5UA 4AYBE 1OXTA 1PH7A 3PUZA 2K50A 4DK6C 4BXXG 4L5RC 3M4QA 3RLFA 4AQYL 3U4VA 3F1ZA 3EN2A 3RN5A 1GO3E 4KI0A 2IX1A 4DR3L 4XIGS 2I5MX 3KLWA 1IXRA 2NVXH 3ICEA 4JI1L 3S15H 3KYHC 4AQYQ 3CMAA 2HIVA 5IP7H 4BY7H 1D8LA 1PHJA 4PZ8A 4DR6Q 4LUZA 3ZJYC 3PUVA 4GOPA 4DAMA 4LF7L 3J80i 4X62Q 4DV3L 2N3SA 3A5ZB 5BR8L 1VCIA 1GKHA 1QZGA 4JYAQ 3GTKH 2MFIA 3I4NH 1CKMA 1G51A 1KAWA 4TVAB 2JA5H 4DV0L 1YHQA 3B6YA 2JK8A 4PG3A 2KCMA 4A3EG 1K0RA 3K7UC 3S1RH 4JI6Q 3L7ZC 2RHQB 4A3IH 1IBLQ 1QVGA 1K83H 1N9WA 3G71A 1JT8A 2N49A 4BBRH 4YWLA 1NMFA 3PIOA 3G4SA 1I5FA 3OTOQ 2UUCL 2JA6H 3Q8DA 3KJOA 4YWMA 3PF5A 2JA7G 2IX0A 3SGIA 1L2FA 3AFPA 1SROA 5LMNW 2HT1A 2R7ZG 1YHBA 5EAYA 1PH6A 1AE3A 1Z9FA 1OTCA 2OTJA 3RR5A 2VL6A 1RIPA 3GDEA 3GTQH 2UUCQ 1VQEA 3I56A 2ATWA 1S3OA 1TWCH 4A3GG 3CPFA 3PUWA 1HR0L 2V1CC 4JI0Q 2I5HA 3KJPA 1CUKA 1X56A 4GOPB 1TXYA 1MKHA 3GTLH 4OWWB 1JB7A 1WCMG 4DR5L 3BJUA 4JI8Q 3LGJA 1FL0A 2EXDA 4BXXH 1UEBA 1WFQA 4RMFA 4A3JH 3TRZA 4JI5L 1C7YA 1GD7A 1HR0W 3CCMA 4DV2Q 2AHOB 4MNOA 1IBKL 1YBYA 1YEZA 4A93H 3PO2G 2DGYA 3STBD 3AFQA 3KDFA 3TEHB 3BZCA 3KF6B 5AJ3L 3J7ZC 1PV4A 1KQSA 1GM5A 4JI7Q 1HZBA 1N32L 3CCVA 1S72A 2Q2IA 4BBRG 1IBKQ 1JJGA 5C0XG 4QY7A 4DR2Q 4B3SQ 1VQNA 1HJPA 4A3JG 1N32Q 3K0XA 1X9NA 1IL2A 3ULPA 2ZM6Q 4O0AA 1Y1WH 1B8AA 2K14A 4GNXC 1Q1EA 4C3HH 4IPCA 3T1YL 3CF5A 2E5LL 1IZ6A 1VQ5A 5C3EH 4POGA 2JE6I 2WFWA 4DV1L 4JI6L 1E3PA 1I94Q 2YTVA 1KRSA 1Z47A 3S2HH 1L1OC 3MEFA 3TS2A 3KF8B 2VY3A 3S17H 1PYBA 1CKNB 4JI3Q 4JI4L 4NXML 4LFAL 3NEMA 3I4OA 1Q8KA 5GAHC 3U4ZA 4A3FH 4LFCQ 4YY3L 5FJ8G 4JI5Q 5M3FG 5IT9c 3D31A 2D0OA 2K52A 3IRBA 4FDBA 1X3FA 4GLXA 3I55A 1KD1C 1KC8C 1VQBA 5JJKA 4DUZQ 4JI3L 3RLOA 5HY6A 1YJNA 5C44G 4KHPL 4X65L 3E9HA 4R4OA 1IBMQ 2OTLA 3J7A5 4Y7NH 4XTCS 1HNZL 5FLMG 3K80C 4HIOA 2OWOA 2YV5A 4LF9Q 5IY0A 1MJEA 4AYBG 1L0WA 1EQRA 2N78A 5IP9H 4DV0Q 2YTXA 3S24A 1UE5A 5C0XI 4R4TA 3M7NA 3J81i 4LNQA 1FGUA 5H1SE 3GTMH 1Q46A 4WJ4A 2MQHA 1XMQL 2K4KA 4IFDG 5IYCH 2B63G 3T1HL 4GKKQ 4DV4Q 3HOUG 3JAMc 2NZOA 2B29A 2GN5A 4R4CA 2KBNA 2R6GA 4YCWA 2K5HA 3HKZG 5M3MH 4JBMA 3CC7A 2JA9A 1T9HA 2YYZA 2FXQA 4JYAL 1EYGA 4WJ3M 1QVCA 4LF5L 3KDFB 4YWKA 3HOZG 2H5XA 2NVQH 4A3CG 1JE5A 3CC2A 2XGTA 4K0KQ 1KRTA 3S1MH 2WP8J 4DV7L 2UUAL 4JG2A 1TWGH 4X64Q 3F2DA 2CFMA 1XNRL 1XMOL 1K3RA 3UDXA 2KHJA 3ERSX 1DGSA 3M4OH 1J5EQ 4BBSG 4X62L 3L0OA 1UE1A 2B3GA 2UUAQ 3PO3G 3G48A 5IYBG 3U58A 1AH9A 4P75A 2JEBI 4A3MG 4AH6A 1YJWA 2IY5B 3UDFA 2LXJA 3MXNB 4YY3Q 4HIDA 2R93H 1VQAA 5C44H 1J6QA 3GO5A 3CP0A 1HNWL 4DV6Q 4IPGA 4UP9A 4QL5A 3PCOB 2N8NA 4HIMA 1Y1VG 1EUJA 3H0GG 4DV3Q 4JI2L 2R7DA 3KF6A 1NMGA 3F8TA 1QUQB 4GN5A 5K36G 5GAGC 3GTPH 2BA0A 1CSQA 2CKZB 3CC4A 2EIFA 2AMCB 2Q2UA 3UDIA 5C3EG 4IFDJ 1E22A 2E5LQ 1VQDA 4IO9A 4JCVE 5LMUL 1HNXQ 3ULLA 3J81c 4QIWE 1HR0Q 4JI0L 5ELNA 2AKWB 4A3GH 2IHEA 1PH9A 5E7NA 1XTDA 3M9BA 3AQQA 5M5YH 1N33L 1X3EA 1CSPA 1VQGA 4K0KL 3GTGH 1YVCA 1AE2A 4OX9Q 1X55A 2ID0A 2JA8G 1WI5A 4X65Q 3HOVH 2CCZA 4DK3C 2ZM6L 5LMNQ 2UXBL 4NPSA 1E7ZA 4IJHA 2OQKA 4YHHQ 4L5QA 2E2JH 2PQAB 4OX9L 1HZCA 4A75A 3H3VH 4UPAA 4GN4B 3F2CA 2F3IA 4POFA 2A8VA 1K8GA 3CCJA 5FJ8H 1I3QH 2Z6KA 2ZJQA 4KHPQ 4UP7A 2CWAA 1E1TA 3BU2A 4P71A 5LMNL 4UP8A 1QUQA 4B3ML 3CCLA 2Y0SG 3PO2H 4JI2Q 3RLNA 3G6EA 3CD6A 1H95A 4DV7Q 1KHIA 3CMEA 3UE0A 4JV5Q 3PGZA 1XPRA 1I6HH 1NE3A 1SMXA 3CQZH 3I2ZA 4LFCL 1YITA 1M90C 4QQBX 3H15A 1NBWA 3E0EA 4B3TL 2JEAI 3FP9A 1LTLA 4A3KH 1MIUA 1PH2A 4A3DG 2JQOA 4J15A 4BA2I 4A3LH 2JJQA 4DUYL 2WB1G 1WOCA 4OWXB 1LUZA 1W2BA 2JA8H 4R4IA 1V9PA 1X54A 2BA1A 1OXVA 1XPUA 2AWOA 4BA1I 1N34L 3I4MH 4Y52H 1W3SA 1CKNA 1FJGL 4LFBL 1VQIA 2RHSB 2R7ZH 2NN6I 2QEXA 4A3EH 1QZHA 5IYDH 1P16A 1BBUA 1K9MC 3GTOH 4C2MH 2PNHA 2OCEA 1TWFH 2JA6G 4DUZL 5IE8A 4B3SL 1YIJA 1O7IA 1JJCB 1K8AC 5FLXc 4BY7G 3HOYH 2ALYB 4C3JH 1WJJA 1I50H 4APVA 4BY1H 3JC66 2B63H 2D0PA 1ASZA 3CPWA 3S2DH 3H0GH 4AIMA 4P74A 1YZ6A 1PFSA 1NTGA 3EIVA 3NELA 4PZ7A 3HOXG 1Q82C 1V43A 1BBWA 1UE6A 3CW2C 1C9OA 3KOJA 1EQQA 1QVFA 4DR4Q 2CQOA 5IYBH 3VDYA 4GKJQ 4EX5A 3UDGA 3PSIA 2VQFL 1J5EL 1U5KA 4JBKA 1XPOA 1PH3A 2R7FA 1VQFA 4BY1G 1S40A 3NENA 1SE8A 5DLQE 4HJ5A 3HKZE 5C4XH 2MNAA 5GAEC 3TS0A 3HOUH 1LM0A 2HQLA 3K8AA 2UXCL 1HH2P 1LYLA 3PUYA 3T1HQ 1IYJB 1VQCA 3D0FA 4QJFA 2CWPA 4A3FG 1E24A 2E2HH 2MO0A 4GNXA 4DR7L 3JAMi 1SRUA 1A0IA 5GADC 3BZKA 4LUVA 4JBJA 4JI4Q 2UUBQ 1SFOH 1JJ2A 3J80c 2NN6G 4OONA 5ELOA 1VQOA 3I4MG 2KENA 4B3RQ 2F4VQ 1XJVA 1PH5A 1X6OA 4MTNA 4LF8Q 4O2DA 4DNIA 3HKSA 4LF6Q 3K81C 1EIYB 4DR5Q 4LF4L 1D7QA 1XMQQ 4X6AH 1HNXL 1PH8A 4DV2L 1U0LA 2Z0SA 3CCEA 3PV0A 2RF4A 4IPDA 3UE1A 3RN2A 4LF8L 3DM3A 1N33Q 4A4IA 4LF5Q 4RG1A 2VQEL 4GLVB 4P73A 2VQFQ 2UXDQ 2GVAA 2ZTEA 1Y1VH 5M5WH 5IYDG 5M5XH 5M3MG 4L5SA 2EQSA 5BR8Q 1PVOA 4ME3A 2HHHQ 4LF7Q 5JEAJ 1WYDA 1ASYA 1HZ9A 1Y14B 5IP9G 1C0AA 1X3GA 4PMWA 3S1QH 3RZDH 4C3IH 3H3VI 1IBLL 2GVBA 4GN3B 3PIPA 2HHHL 4R1JA 1G291 2WAQG 1N36Q 4JOIA 1GVPA 1R9TH 3GTJH 4A3DH 5GROA 2YTYA 3HOWH 2PI2E 1VQMA 3M4PA 4LWCA 1VQPA 1I94L 4OO1I 4OXPA 4HIKA 2VS1A 4HJ7A 3W1BA 1B70B 5J3BA 1VQHA 4P72A 4LFAQ 2HIXA 5AJ3Q 1Q81C 1TWHH 3CCUA 3J81j 4PZ6A 4GOPC 1PA6A 4DR7Q 4DR6L 3CCSA 1YI2A 1Q86C 1N34Q 3AYHB 1EWIA 4DR2L 4B3RL 2BH2A 4GKKL 5IWAQ 1N8RC 2K5NA 1SN8A 2OQ0A 3CAMA 4H02A 2UXDL 3U50C 1K73C 2QA4A 2E8GA 4ALPA 3E9IA 3AEVA 4B3TQ 2IHFA 4KHZA 3FKIG 2Z6KC 2AWNA 2K75A 2ZTCA 1XNQL 1EOVA 2VZAA 1VQ6A 4DR4L 2K5VA 1A62A 2QGQA 4A3MH 4LF9L 3W1GA 2NZHA 1UWVA 3HFZB 4DV5L 1PH1A 4JV5L 2UU9L 1TWAH 2R92G 1VQ7A 1OXXK 2WB1E 2VNUD 4BBSH 2UUBL 1Y1WG 1PYSB 3S1NH 2VUMG 3EBEA 1SR3A 5C0XJ 4MZ9A 4NXMQ 4A3LG 2XTIA 2Y0SE 1FJGQ 3K7AH 1G6PA 1VQ8A 2L15A 2LXKA 1XMOQ 2UU9Q 2VQEQ 3OYYA 3HOYG 2A19A 3ULJA 4DV5Q 2ZTDA 4JBWA 4IPHA 3DLLA 1Q1BA 1BVSA 3A0JA 3FKIH 4LW1A 5HGQA 4JI8L 1VQKA 1P8LA 3NBHB 3KFUA 2UXBQ 1L1OB 2I5LX 2ES2A 1PH4A 3PF4A 3CCRA 1YHAA 1Q12A 4DV6L 1KL9A 4DAYB 4LF6L 2UXCQ 2BH8A 4HJAA 2NVYH 4JI1Q 5JEAG 5IYCG 1NJIC 1WCMH 4IOCA 1VQ4A 4DUYQ 1OXSC 2D62A 2NVTH 4LUOA 2KCTA 1OXUA 4A76A 4B3MQ 4A3KG 2VUMH 4OO1G 2ZJPA 1FVIA 4DR1Q 4HJ8A 3S16H 1KIXA 1VQ9A 3ER0A 2JA7H 4LFBQ 1A63A 2R92H 3HOWG 4X66Q 4JOIC 3M3YH 2PMZE 5IP7G 1M1KC 2C35B 3TREA 3CCQA 3A74A 1IBML 3HOZH 1HNZQ 4UY8C 4DR1L 3S14H 4JI7L 4DR3Q 4GLAC 1EIFA 1UE7A 4EQ5A 5JJIA 1BKBA 1MJCA 5JJLA 1Q7YC 3I4NG 1V1QA 3STBC 2R93G 2Q2HA 3CXCA 4A3CH 4X66L 2PQAA 3RNUA 2I0QA 5M3FH 2ASBA 4YCUA 4A3IG 3PO3H 4IOAA 3TQYA 1VS0A 4NXNL 4YHHL 4A3BG 4DV4L 4L5TA 1B7YB 1SLJA 3PUXA 4KLKA 4GNXB 3HOVG 5C4JH 1NY4A 2DUDA 1A8VA 2ZJRA 2LSSA 5GQOA 4GKJL 2MO1A 1HZAA 4QGUA 2IT1A 3GD7A 1VQJA 3I7FA 3OTOL 3WWVA 3M85A 2KHIA 4NXNQ 3L2PA 2A1AA 4DV1Q 3HOXH 1X65A 2F4VL 4TQUS 1EFWA 3W5OA 2WAQE 4HJ9A
chains in the Genus database with same CATH superfamily
4LF4Q 2E2IH 1Y8OB 1II3A 1RL2A 3F2BA 1XNRQ 1FNUA 4IFDI 3P7JA 3FHWA 4H7BA 1DM0B 2YU9H 1XWEA 4GS3A 1RDPD 4I7ZC 5LMUQ 3TDQA 3WOFA 4R4QA 3NTIA 1JMCA 5C5LA 3Q6SA 1O78A 3OW2A 1B3QA 1PH7A 1E0BA 4JVZA 2MP1A 3M4QA 4AQYL 3F1ZA 3EN2A 2PNRC 1GO3E 4KI0A 2I5MX 4FXKC 5KNCA 3I4MB 2K32A 4JI1L 3KYHC 4AQYQ 3S15H 1U4MA 3K5NA 4DR6Q 4LUZA 1LTSD 4DAMA 3J80i 4JYAQ 1GKHA 1TWFB 2FHTA 1KAWA 4NKLA 1TKWB 3K7UC 4U68A 4EQNA 4JI6Q 2RHQB 1I50B 1K83H 1JT8A 4OHJA 4EQPA 1I5FA 3OTOQ 3Q8DA 4IUPA 1SYCA 5FOBB 3VR5A 1PH6A 4HCSA 2OTJA 5J39A 1RIPA 3GTQH 1J9OA 2RSNA 2ATWA 4KJOA 4JI0Q 2RQXA 2KHSA 4GOPB 1MKHA 4OWWB 1EY7A 4DR5L 3DWAA 3LGJA 2EXDA 3OW7A 5JEAH 4BXXH 3TRZA 4C3IG 1GD7A 2OF1A 4DV2Q 2L12A 3V96A 1YBYA 3KF6B 1X3QA 5IT9L 2L1BA 3CCVA 2XVSA 4BBRG 1IBKQ 1BO0A 5ELFA 1TIID 4B3SQ 1VQNA 1LTBD 3W3AA 5AFWA 1Y1WH 1HTLD 3EA6A 3S2HB 4YIJA 3T1YL 2E5LL 1IZ6A 3SHLA 1H9SB 2WFWA 4CBVA 1S5BD 2A5HA 3PMFA 2F0HA 2NTSA 1Z47A 1Y1WB 2F0UA 3OMGA 3S2HH 5M5XB 2VY3A 5G3LF 2SNMA 1CKNB 4JI3Q 2KUMA 4JI4L 4NXML 1Z7TA 2HDMA 3NEMA 3K5MA 1XYIA 5GAHC 5CR3A 5M3FG 5IT9c 2RSOA 2K52A 3E0JA 1KC8C 4DUZQ 4RCOA 3OWFA 1JR0D 1SE3A 3O13A 5FLMG 3K80C 3KLSX 4DNRB 1M8AA 1PDQA 2PZWA 1UE5A 3M7NA 3A8JE 3TMEA 1HPCA 3GTMH 2MPMA 2G5DA 5E1FA 1XMQL 2K4KA 1STEA 4GKKQ 4DV4Q 1RODA 4R4CA 4QIWB 4YCWA 3EROA 3I90A 1BXTA 1KDBA 2K03A 5FO8B 3W2DA 2FXQA 3SK4A 1QVCA 2M2LA 4YWKA 4DAYA 3VYTA 4A3CG 1JE5A 1GUSA 2NYZD 4JG2A 4X64Q 3VYRA 1RCVD 3T53B 1PZID 1F2MA 1WCMB 4OO1H 3DUZA 1DGSA 1HXYD 1LTTD 1JWMD 1J5EQ 2A73B 3D3RA 4CKCA 1FYCA 2WAQB 4P75A 2LXJA 3MZ5A 4YY3Q 3QIAA 1VQAA 5C44H 4IPGA 2WV6D 3PCOB 2N8NA 4ZCKA 2PW7A 4JI2L 2F0OA 5GAGC 5ELDA 3GTPH 3C1FA 2CKZB 4OELB 3C2PA 5IGCA 4KV6A 2VUMB 1B44D 4IO9A 3ULLA 4QIWE 5EPJA 1YNNC 2VB3X 2ZXOA 2H4OA 4KHVA 3J7AF 1X3EA 2E2JB 3GTGH 3E3XA 4OX9Q 3AB9A 2ID0A 2PYKA 5CV7A 1WI5A 4DK3C 4LJZC 5ISRA 5LMNQ 4NPSA 3SK5A 2B2VA 3GV3A 4L5QA 2E2JH 4OX9L 2F3IA 1VF5C 4IUNA 4POFA 5KEEA 1K8GA 2A8VA 3CHBD 1I4PA 3K5LA 4KHPQ 5C4JB 1E1TA 1NCVA 2LMCB 1H95A 3RLNA 1HFGA 4DV7Q 3UE0A 3PGZA 1AW7A 1NE3A 1SMXA 3NE5B 2BE5D 1H9KA 1ENCA 4B3TL 3FP9A 5CV6A 3ND9A 2JJQA 1WOCA 4OWXB 2JA8H 3J80L 4Y52H 2FJ2A 2NN6H 1CKNA 4XDXA 4LFBL 1VQIA 3SE0A 4FF4A 5FKAC 2PNHA 3KLRA 3SK8A 4H0LC 1O7IA 1K8AC 5FLXc 3HOYH 4C3JH 3JC66 2B63H 1DD2A 2EE1A 1YZ6A 1PFSA 1NTGA 5C3XA 2PPBC 4C3JB 1Q82C 1UE6A 5FLXE 1C9OA 1BCPC 4L6TB 4DR4Q 4TKOB 3VDYA 3P20A 4QF4A 4BWGB 1U5KA 1XPOA 3BDCA 1CZGA 2MNAA 2DY7A 2RDHA 1I4RA 1HH2P 1NNXA 4R8NA 4QCLA 1KDCA 3D0FA 1H9MA 2X6LA 3JAMi 1SRUA 4LUVA 4ABNA 4KN4C 2F0WA 1LTID 2A68D 5ELOA 1VQOA 4B3RQ 2A74C 3IAYA 4DNIA 1ICFB 2FMMA 4LF4L 1D7QA 1SMYC 4DNTB 3G6JB 2Z0SA 1T5XD 4K2LA 2A69D 4IPDA 4A4IA 1RKNA 1TU2B 1KLUD 2X69A 2VQEL 3J80E 4RGNA 1BCPF 4CHTB 4DK0A 4P73A 1ENFA 2QF7A 5IYDG 2TMPA 1ESRA 1JB3A 4LF7Q 5JEAJ 4JK1C 4KTAA 1ICWA 3S1QH 3H3VI 4EGVA 1IKMA 2GVBA 3TP5A 3FDTA 1I4HA 2CQAA 4HSVA 2EY1A 3H3VC 3I8ZA 1GVPA 3KLSA 3S1QB 1GUWA 1TWHB 2PI2E 4KD3A 4OO1I 4OXPA 2LS01 4LMQD 1SJHD 4LFAQ 2EYPA 2WACA 1TWHH 3HZXA 3CCSA 1Z6HA 2EJFC 4DR2L 4ID6A 2BH2A 3KBGA 1S5CD 1N8RC 1K73C 1SYEA 2IHFA 4KHZA 1EOVA 2EJGC 4ZUIA 5ELBA 1A62A 2KCCA 4OIJA 4UDUC 4JV5L 2UU9L 2WB1E 3QB3A 2BOSA 1MI2A 1Y1WG 3C46A 3S1NH 5C4HA 2VUMG 3EBEA 1TWGB 4NXMQ 2D5DA 2K5QA 1LO5D 1BBXC 1XMOQ 2UU9Q 2VQEQ 3OYYA 4C3JG 3TZUA 1LTGD 2Y0SB 3S1NB 4QUFA 4FYDA 5KNDA 3BVGA 3ZYYX 2ES2A 1PLFA 2NVTB 4DV6L 4X3SA 4TSSA 2UXCQ 3S1MB 4HJAA 4HMIA 2NVYH 1PFNA 5C5MA 2FINB 3OIQA 4RGTA 4DUYQ 1OXSC 2HCCA 3VYUA 2NVTH 1T5EA 4LUOA 4B3MQ 1OXUA 5FO7B 4KK7A 3VA5A 4A3KG 2SEBD 4K6DA 3HRZC 2ZJPA 1PZKD 4HJ8A 1KIXA 4LFBQ 3ER0A 4U673 2JA7H 1A63A 2R92H 1PFMA 5IP7G 1M1KC 3HOZH 3A74A 5IGGA 4UY8C 4JI7L 4CDEC 1BKBA 3VYSA 2JA7B 3BVMA 3JAML 2I0QA 2ASBA 3HOZB 4A3IG 4IOAA 2R61A 4MIUA 4KLKA 5EKIA 1GXDC 1CA5A 5NUCA 3NWSA 2LSSA 2F0FA 5IGFA 4DAPA 3PO2B 1TR5A 3K58A 2IT1A 2WINB 3I7FA 1BCPB 5J1ZA 3OTOL 1QNUA 4NXNQ 2A1AA 4JW0A 5EGTA 4TQUS 1D5ZC 1G2TA 4B9XA 1B1ZA 2XRQD 4MTKA 4JC0A 1FD7D 5G3LD 1QCBD 4ZYSA 1I3QB 1D2BA 1VF7A 5FLMH 1EU3A 4J6HA 4OWTB 2TSSA 4NB3A 2Q2TA 1EIGA 3CQZB 1QG7A 2CW0D 2E75C 3A5UA 4AYBE 2F0SA 2SOBA 1B2TA 3DXJC 4G7HC 2K05A 4DR3L 5EBDA 1NUCA 3KLWA 3OHXC 3CMAA 4ME5A 5IP7H 1DOLA 4BY7H 5A35A 3GTOB 1F9SA 3A5ZB 5BR8L 4N8FA 3I4NH 1G51A 2JA5H 1YHQA 2JK8A 3S1RH 3IKJA 3L7ZC 4A3IH 1QVGA 5CV9A 1EYCA 4BBRH 1NMFA 2R3ZA 3I4NB 4YWMA 3S2DB 3SGIA 2L9HA 1SROA 2HT1A 2R7ZG 1YHBA 5EAYA 3SR1A 1Z9FA 1OTCA 1K28A 4A3IB 2AUKA 2VL6A 2BDNA 3GDEA 1VQEA 2F0QA 2WKCA 3I56A 3EJIA 1S3OA 5DAUA 4A3GG 3PUWA 3QO2A 1Q3LA 1CM9A 4IALA 3KJPA 1TXYA 1G8ZD 3U9SA 3BVZA 2JSOA 4JI5L 2ZXRA 3MC0B 3U9OA 1LV9A 4LK1C 3R2TA 3J81E 3STBD 4JI7Q 1SNMA 3J7ZC 1S72A 2Q2IA 1HJPA 2CH4A 3K0XA 1IL2A 3SVMA 2XWBB 4XT3B 1K3BC 3CF5A 3R93A 4POGA 4DV1L 4N8X1 4WFN3 1KRSA 5FLXL 1CFMA 1L1OC 3MEFA 2EYFA 1PFBA 3I3CA 3KK7A 2RBMA 4JI5Q 5CYUA 1QE6A 3IRBA 4GLXA 1KD1C 5JJKA 4JI3L 1R9TB 1PXUA 5CV8A 1YJNA 5C44G 4RGOS 4X65L 4Y7NH 3TSSA 3GQBA 5E4XA 4AYBG 4DV0Q 2YTXA 2F03A 3J81i 4LNQA 3MA2B 5H1SE 4Y7NB 2MQHA 5HGTA 3NXWA 1EEID 1B3AA 1BDOA 2NZOA 1DYQA 2B29A 2GN5A 1WTXA 2R6GA 4DK1A 1ESFA 1V1PA 5JVH3 2NVQB 3CC7A 2L0CA 1STGA 1KAAA 1T9HA 1EYGA 4UAIA 4WJ3M 4F87A 3KDFB 2WKDA 2A6EC 4IUUA 1ZXTA 2NVQH 3CC2A 4K5XA 1KRTA 1D1KA 2WP8J 3QR8A 4QUCA 1XMOL 2MJ8A 1K3RA 3UDXA 1EWCA 4BBSG 2F0DA 2QILA 1UE1A 3G48A 5IYBG 1PZJD 3QOJA 4X3TA 2IY5B 1YJWA 1M4VA 3UDFA 4FVMA 2VXWA 2R93H 5J22A 3GO5A 4UP9A 1ENAA 1EY5A 1EUJA 4DV3Q 1EY0A 4IUQA 3KF6A 5C3WA 1V8QA 1QUQB 4CDDC 5A2QL 5K36G 1CSQA 1FGBD 2XNAC 5M5YB 5FK9C 5C3EG 1E22A 1VQDA 1EZ8A 5LMUL 1ZKOA 1HNXQ 3J81c 4JI0L 3A7AB 2AKWB 1LTAD 4A3GH 2IHEA 5E7NA 5M5YH 1XXGA 1ML0D 3H09A 4IUVA 1VQGA 4ZKCB 2JA8G 4X65Q 2ZM6L 3H94A 1TVXA 1E7ZA 2OQKA 2EY6A 2PQAB 5CGKA 1NAPA 2A6HD 2G9DA 5K36H 1I6HB 1QJOA 5LMNL 3QWNA 5DNFA 4A3KB 2DN8A 4JV5Q 3K57A 1I6HH 1AH9A 1VMCA 4OEMB 4ZRZA 3H15A 4A3BB 3V05A 2E2IB 4A3KH 1PH2A 4J15A 1DCZA 4BA2I 4DUYL 2O4XA 4R9WA 2N55A 1V9PA 1OXVA 2YU9B 3URYA 4V190 5C0XH 1PTOB 1W3SA 1LTRD 2EYHA 1F77A 2AQ3B 2NN6I 1QZHA 5I6WA 1P16A 2OCEA 4DUZL 5IE8A 2ALYB 1WJJA 4BS9A 1ILQA 4K6LA 1ASZA 2JA6B 4AIMA 3S15B 4EVOA 2K04A 3EIVA 4PZ7A 1STBA 1V43A 1EQQA 5C4XB 5IYBH 3PSIA 2VQFL 1J5EL 1RTOA 3SDZA 4UHVA 5EBCA 2B2WC 2HD3A 2EY2A 3NENA 3J7YW 5DLQE 3HKZE 5C4XH 2NZ1D 1PMRA 1LYLA 5EJWA 4A3JB 1VQCA 2RVLA 4ULLA 5GADC 3BZKA 5I6YA 4MN3A 2UUBQ 4V0BA 2Q8TA 3FRPB 2NN6G 2XWJB 2KENA 1XJVA 1X6OA 4O2DA 3C1EA 3KUPA 2B2WA 2L5TA 2XSCA 4LF6Q 1EIYB 3MHBA 1XMQQ 1YNJC 2K33A 4CJ1B 2F0EA 1HTPA 1F2YA 1H9SA 2RF4A 1JC7A 3RN2A 3DM3A 3I72A 4LF5Q 4RG1A 2H1EA 2NUCA 4X3UA 2VQFQ 2GVAA 2ZTEA 1AEXA 2CHBD 1C0AA 1Y14B 5IP9G 2O5IC 4CKBA 5D65A 2CW0C 4GN3B 5E3FA 2HHHL 3HKZB 3NP8A 4HEDA 5D3IB 1N36Q 2B2UC 1NSNS 3GTJH 5GROA 2YTYA 3HOWH 1ZYRD 1DOMA 2VS1A 4FXGC 3A55A 1QOHA 3GTJB 1VQHA 2HIXA 1A15A 5CBAE 4ZKBB 3CCUA 3J81j 3WOEA 1YI2A 1EWIA 4A3MB 1UEAB 4B3RL 3BYTB 1K8OA 1EY8A 3CAMA 2UXDL 4K8IA 4ALPA 4B3TQ 4QQBX 1VQ6A 2AWNA 2K75A 4DR4L 3FEWX 2VZAA 2K5VA 4A3MH 2QW7A 3W1GA 1UWVA 3HFZB 4K5VA 4GZYC 2R92G 1JCKB 3GTMB 2UUBL 3ND8A 3FVQA 3FKIB 1SR3A 4RWSC 4MZ9A 4XQNA 1FJGQ 3K7AH 1G6PA 1VQ8A 2L15A 2LXKA 3HOYG 1SNOA 4DV5Q 4L8JA 3FKIH 2QKIC 4O1NA 2Z8LA 1P8LA 3K7AB 1QNKA 4HAEA 5JJZA 3DEPA 3NUCA 4DAYB 2BH8A 2F0TA 3NK9A 4JI1Q 4DA2A 5JEAG 5JAVA 5IYCG 1WCMH 1KABA 1VQ4A 1HFNA 2D62A 4DFAA 4I7AA 4DR1Q 2NWGA 1EL0A 3OSOA 1STNA 4B9WA 3MFYA 2FMCA 1JICA 3K6OA 5EKKA 3DWPA 3TREA 1I4GA 1JOKA 2OT2A 4XYQA 2IJ0A 4OL7A 2Z4IA 4DR3Q 4GLAC 4FXDA 4EQ5A 1UE7A 1SJED 3STBC 2R93G 3HOVB 3CXCA 3CRKC 1EIHA 2NBFA 3RNUA 1DOKA 5M3FH 2B8GA 1VS0A 2A6ED 3PUXA 2B39A 2KQ3A 1NY4A 1HQMC 3GD7A 4M1UB 3M85A 3GTGB 1H9JA 2F0GA 4DV1Q 2F3WA 3L3OC 3HOXH 2F4VL 1XX8A 3ERQA 1EFWA 2RDFA 4ZQ3A 4H13C 1L0XB 2WAQE 4KY5A 1XTCD 4CKEA 1G2SA 2PO4A 1N36L 1QB5D 2F52A 4X64L 2PI2A 1TY2A 5IWAL 3HOXB 1VQLA 4IJLA 1BOSA 2IWHA 2RCNA 5C4XG 2RDGA 1YNXA 1CKOA 4YCVA 4CJ2C 1L1OA 2VW9A 5DM73 3N52A 1OXTA 2K50A 4BXXG 1SBBB 4L5RC 4FF3A 3WDNA 2KOLA 2JA8B 3RN5A 3I91A 1U4PA 2IX1A 2WIIB 4XIGS 4F88A 1HHVA 3PIO3 4C1NK 2NVXH 3ICEA 3Q0AA 4KKTA 2EPBA 3A7LA 1D8LA 1PHJA 1JWUD 3E6ZX 2N88A 4GOPA 1LACA 4X62Q 4DV3L 2N3SA 1VCIA 3GTKH 1CKMA 2NVXB 3EFXD 4TVAB 2A69C 4DV0L 3B6YA 4A3EG 2KCMA 1K0RA 3H6MA 3HOYB 1B50A 3VR4A 1N9WA 2C9OA 2B63B 2N49A 1EEFD 4YWLA 3M4YA 3PIOA 2UUCL 4HJ9A 3HOUB 3GTKB 3PF5A 3VR3A 1AN8A 2IX0A 1L2FA 2UUCQ 1PRTC 4EQOA 5CV4A 1TS3A 3FPUB 4C1NI 3T4AC 3CPFA 3MAQA 4XXEA 2I5HA 1EWHA 1CUKA 2EYMA 1JB7A 3TBIB 4JI8Q 1UEBA 1WFQA 4RMFA 4OIKA 5KRUA 1TS2A 2WB1B 1KDAA 3S9WA 3CCMA 2AHOB 1IBKL 2A6HC 4CJ0B 1YEZA 3PO2G 3AFQA 1N32L 4L63B 5EQ0A 1Y1VB 2XIWA 5C0XG 3R3OA 4DR2Q 1CHPD 2AUJD 4ZUJA 1X9NA 1N32Q 3ULPA 4O0AA 1B8AA 2K14A 2F1MA 3HS0C 4GNXC 2KECA 5LL6S 1A3VA 2Z6BA 1B4OA 1I94Q 2YTVA 3TS2A 1SYBA 3OPOA 3S17H 1PYBA 4Q0FA 3LX0A 3I4OA 1S5ED 4LFCQ 4PMBA 2D0OA 4FDBA 1UAPA 2P5ZX 3GP7A 4LAAA 3I55A 3S17B 1VQBA 1UUPA 5C6AA 3T16A 3RLOA 5HY6A 5CBEE 3E9HA 1WD1A 1IBMQ 2OTLA 3J7A5 1MD2D 1HNZL 3Q22A 5KIXA 2YV5A 1L0WA 1ZEQX 1EQRA 3IFDA 5IP9H 3S24A 5C0XI 1TWAB 3MTSA 5M3MB 1Q46A 2DY8A 2HUGA 4KKUA 2OEOA 2G9HD 4JBMA 5M3MH 2Z1CA 2HDLA 2BDOA 2YYZA 4JYAL 5FO9B 1O7LA 3CRLC 3D8GA 3HOZG 2H5XA 2KVMA 5IOCA 4FO2A 5JPNC 5EKLA 5IT9E 3D4WA 4K0KQ 2B2YC 4DV7L 1TWGH 1XNRL 3M4OH 1PRTB 3L0OA 2B3GA 2JYOA 3U58A 2QDLA 3TP7A 4AH6A 3MXNB 3UI2A 4HIDA 3M3YB 1J6QA 3CP0A 5I4DA 3M4OB 1HNWL 3F2UA 4HIMA 1V1PB 4K5WA 3S14B 2R7DA 1BQQT 1NMGA 1R4PB 1MSGA 2M00A 4GN5A 1GUGA 2EIFA 4S3SA 1HQRD 3I73A 1W6JA 3A54A 5CC4A 1HR0Q 5ELNA 2K01A 3M9BA 1N33L 3AQQA 2XN9C 4K0KL 3PQIA 2M9VA 4C3HG 4FNFA 1AE2A 2NB0A 1X55A 2F0VA 2PCFB 1SDFA 2UXBL 3CKIB 4HR7B 4IJHA 1HA5A 3H3VH 1HZCA 4A75A 3AMUA 4GN4B 3MWYW 3HP3A 5KYLA 3CCJA 1EFID 2Z6KA 2CWAA 4J1MA 1ONLA 4UP8A 3PO2H 3CCLA 2Y0SG 4JI2Q 3CD6A 1KNEA 3CMEA 2L11A 1XPRA 3I2ZA 4LFCL 5KYIA 3OOCA 1YITA 2IW3A 4X3KA 1NBWA 1O7YA 4HTHA 1A2UA 1LTLA 5LHY1 2JQOA 4Z9CB 2FFKB 4CGYB 5DEHA 2WB1G 4A3EB 1W2BA 1LUZA 2KCNA 2ENBA 1A6XA 4PNYA 2BA1A 1XPUA 4BA1I 3I4MH 1CT1D 4K14A 2DJGC 1FJGL 4KMUC 2QEXA 4A3EH 1K9MC 4DXFA 2E76C 2BCOA 3BS1A 1TWFH 4I65A 2JA6G 2Z9HA 3NTHA 1GUNA 4TRDA 5D3DA 2VB2X 1I50H 4APVA 2NTTA 1K83B 2D0PA 2F0PA 1DONA 3MFGA 2V4DA 4ZLTF 4DN4M 3CPWA 3H0GH 4P74A 4F8MA 3DMUA 4BY7B 3GTQB 5TSSA 2CQOA 4GKJQ 1HRJA 3H0GB 1GHJA 2JA5B 4JBKA 2R7FA 1VQFA 4BY1G 1S40A 2PMZB 5COYA 4BBRB 1I4XA 5C4ZA 5KGUA 4RA8A 5GAEC 3TS0A 3K8AA 3T1HQ 3PUYA 1IYJB 4QJFA 1HUNA 4DR7L 2CWPA 1E24A 1WTOA 4FF2A 1K8MA 1WTRA 1SFOH 3OIPA 1JJ2A 1DZ1A 3J80c 1R4QB 3I4MG 2F4VQ 1PH5A 4MTNA 4LF8Q 1SYFA 3DEOA 4DR5Q 1SFOB 1YNND 1HNXL 4O42A 1PH8A 1CK1A 3FMCA 1SNDA 4RAUC 5BN5A 4DV2L 1SE4A 3UE1A 1N33Q 4IN3A 2E2DC 4R8IA 2RCFA 2LFNA 1GUOA 4Q5VA 4G7OC 1S5FD 5M5XH 5M3MG 1WTVA 4L5SA 4ME3A 1ASYA 1WYDA 3NBHA 1HZ9A 4PMWA 5JOBA 1B9MA 1WVLA 2ICEC 3PIPA 4KY7A 2F0MA 5I2XA 4R1JA 1WTWA 2WAQG 4JOIA 2B2TA 3MXGA 4LWCA 1AZQA 3LNNA 2CVRA 1B70B 4G4KA 1RJTA 1LT5D 2J4XA 4P72A 1HCZA 2O2LD 4PZ6A 5EPKA 3PIP3 4DR7Q 4DR6L 4ZAIA 1N34Q 1Y69U 5IWAQ 4XT1B 1PTOC 4H02A 4ZK9B 3RUZA 2E8GA 3E9IA 1PRTF 2Z6KC 3FKIG 2ZTCA 4LF9L 4DV5L 3NPPA 5BN4A 4KD4A 1VQ7A 1A3TA 5IGBA 5EPLA 1BNZA 4XQQA 5C0XJ 5L37A 1IW7C 3ULJA 1CZWA 3DLLA 2F0NA 1Q1BA 1EYDA 3V2TA 4JI8L 3I70A 2EDGA 3NBHB 1VQKA 3KFUA 1L1OB 1FNVA 5C44B 1JOOA 3PF4A 1Q12A 1Q8IA 1U4RA 1KL9A 4OGQC 4LF6L 1SYDA 5K5PA 3S16B 5CV5A 1O80A 4IOCA 3GTPB 1TS5A 2QEJC 1NR2A 2DJFC 1PYWD 2J0TD 2KJXA 2VUMH 3S16H 2R93B 3HOWG 2MHVA 4ODGA 2EYLA 2Q8IB 3CCQA 4MHEA 3ITPA 2EOTA 2O5JC 1EIFA 1MJCA 1TQOA 1Q7YC 3I4NG 1TS4A 3GV6A 4X66L 2PQAA 1A3UA 4CDFC 3M7GA 3PO3H 4YHHL 4DV4L 1STHA 1B7YB 1EZ6A 4GNXB 3HOVG 4A3GB 5C4JH 2DUDA 3A8KE 1A8VA 4N9PA 3SK6A 5GQOA 4XQJA 4GKJL 2B8FA 2MO1A 1HZAA 2IX3A 3PO3B 1VQJA 2KHIA 3L2PA 2MGSA 5DM63 1X65A 5CMDA 1SNPA 2PZTA 3W5OA 3RZOB 2AQ1B 4HSPA 1IW7D 4FP5D 2E74C 1E1OA 5LL6X 4DPGA 1YJ9A 3X3MA 4DKAC 4QB4A 1D5MC 1RF2D 3T1YQ 4IFDH 2L55A 1KXLA 3RZOH 1SEBD 1XNQQ 2JA5G 4A93G 3K5OA 1MSHA 1HNWQ 1ET6A 4E6IA 4M8AA 4IURA 1U9RA 4A3BH 5HURA 1STAA 1PTOD 1SXTA 1PTOF 3PUZA 4IQZA 4DK6C 3NHHA 3RLFA 1F2LA 1MHWC 2F0LA 1FNWA 3U4VA 1J8IA 3CU7A 1MBYA 2RKSA 1IXRA 1PTOH 2IPKD 2HIVA 3HGBA 3QG1A 3NWTA 1EY4A 4PZ8A 2D9UA 3ZJYC 3PUVA 4LF7L 1QZGA 1C4QA 2MFIA 4PG3A 1IBLQ 3C3LA 3G71A 3QJYA 3G4SA 2JA6H 3KJOA 2JA7G 3AFPA 5LMNW 3X3NA 1AE3A 3RR5A 4RH6A 5F2DA 4RKBA 1TWCH 1SAPA 3R8BA 1HR0L 2V1CC 1SNQA 1JQYD 1G91A 2EJMA 1X56A 3GTLH 1EQTA 3MXNA 1E2ZA 1WCMG 2EYJA 3BJUA 3DM1A 1FL0A 1TWCB 2F4IA 4A3JH 1C7YA 2B2TC 1K0SA 1HR0W 1CQVA 3FPPA 3EQLC 4MNOA 2K28A 4K2KA 1S5DD 3GTLB 4A93H 2DGYA 5AJ3L 3TEHB 3KDFA 1GM5A 3BZCA 1KQSA 1AZPA 1PV4A 1HZBA 5ELCA 2EVBA 1CTMA 2LY7A 1JJGA 3N6RA 2Z4HA 4QY7A 3K0YA 4DGZA 4A93B 4A3JG 2SDFA 3OMCA 2ZM6Q 1Q1EA 4C3HH 4IPCA 1VQ5A 5C3EH 2JE6I 3TN2A 3Q23A 1F2ZA 4JI6L 1E3PA 1IHZA 1UNSA 3KF8B 3NTKA 4C3HB 2K5DA 5I9PA 1IKLA 5C3EB 4LFAL 2K1BA 1Q8KA 3A56A 1TY0A 1RD9D 3U4ZA 1D1IA 4A3FH 4YY3L 5FJ8G 3D31A 1X3FA 5I9OA 2JN4A 1OO9B 2Q8RE 1KLGD 4JPBW 5BN3A 1PRTD 4A3FB 3HOWB 4KHPL 4R4OA 4XTCS 4HIOA 2OWOA 1JORA 4LF9Q 5IY0A 1MJEA 3DWQA 2N78A 1D6EC 4R4TA 1FGUA 4WJ4A 4IFDG 5IYCH 2B63G 3T1HL 1C48A 3J81L 3L9AX 3HOUG 3JAMc 1X3PA 3IL8A 1E2WA 2KBNA 2K5HA 3HKZG 1CI3M 2JA9A 4HN7A 4C56C 1D5XC 4H44C 4LF5L 3VR2A 1F9PA 1NR4A 4K8JA 2XGTA 1AFPA 3S1MH 2UUAL 2NVYB 3F2DA 2CFMA 2F3VA 2KHJA 3VR6A 3ERSX 1U4LA 4WRDA 4X62L 5I2YA 4NP5A 1DXMA 1LT3D 2UUAQ 3PO3G 3JAME 2JEBI 4A3MG 2R92B 2F0KA 2PW5A 4DV6Q 2PZUA 4QL5A 4RHRA 1Y1VG 3H0GG 1VMPA 1Y8PB 4NMZA 5IGDA 1FR3A 1GUTA 3F8TA 3D6WA 2BA0A 3T13A 3CC4A 2AMCB 3K59A 3D6CA 4RHSA 3UDIA 3Q24A 2Q2UA 4IFDJ 1BUVT 2C5CA 2E5LQ 1GJXA 4JCVE 2F0IA 2I46A 4P2CB 1B53A 4RCNA 1PH9A 1XTDA 1CSPA 2DNCA 2K5WA 4FF1A 1YVCA 1ZYRC 1X32A 3HOVH 2CCZA 4RFBA 1RHPA 5M3FB 3BDOA 4YHHQ 2ICIA 4N9TA 4UPAA 4RGMA 3F2CA 3G7LA 3VA7A 1GOZA 5T1IA 5FJ8H 1I3QH 2ZJQA 2QCPX 4UP7A 3BU2A 3MEHA 4P71A 3LWUA 4B3ML 1QUQA 2K6AA 1A2TA 2HQEA 3G6EA 1KHIA 1EOTA 4NW2A 1HA6A 3CQZH 1M90C 1GHKA 3E0EA 2JEAI 1ET9A 1MIUA 4A3DG 2XRSD 4A3LH 1SMYD 3ONAB 2JXMB 2R7ZB 2AQ2B 3BYYB 4R4IA 1X54A 1RTNA 2J7ZA 2AWOA 1F9RA 1EYAA 2EY5A 1N34L 2KA7A 2X6GA 5T1GA 1EU4A 4KJNA 1DJRD 2RHSB 2R7ZH 2PQEA 2I07B 5IYDH 1BBUA 3GTOH 4C2MH 1BF4A 2LKVA 1KNAA 3I4LA 3EVQA 4B3SL 1YIJA 1JJCB 3S1RB 4BY7G 4BY1H 5A2QE 3TP8A 4C2MB 1EY9A 3BDLA 3D4DA 4DU9A 3S2DH 3T56B 3NELA 3T51B 3HEJA 1CA6A 3OWEB 5ELEA 1IL8A 3HOXG 4PMCA 4PQXA 1BBWA 4BY1B 2HCIA 3CW2C 3KOJA 1QVFA 3P75A 1W6KA 1HUMA 4DF7A 4EX5A 3UDGA 5JVG3 1PH3A 3MVVA 4DAVA 1SE8A 4HJ5A 3TP6A 4CDCC 4IZ8A 3HOUH 1LM0A 2HQLA 2UXCL 3H91A 2SNSA 4F7XA 2E2HH 1AP0A 4A3FG 1CQFA 2MO0A 4GNXA 3BZDB 1A0IA 4WJWA 1I6VC 4JBJA 4JI4Q 2F0JA 5KNBA 4OONA 1F9QA 1V1OA 2E2HB 2RA4A 3IFTA 3R2IA 4NDXA 3HKSA 3NBIA 3K81C 2OXPA 4X6AH 3KBXA 3NQTA 3P1HA 1KTKA 3J7AV 1E2VA 5IIFA 1U0LA 2EZVA 3CCEA 3PV0A 1MGSA 1SYGA 1CHQD 1QWYA 4LF8L 1Y8NB 2IL8A 4AYBB 2ZXPA 4GLVB 1BR9A 2UXDQ 1Y1VH 5M5WH 2EQSA 5BR8Q 1PVOA 2HHHQ 1S4ZA 3HG9A 2QDBA 3LWEA 3SEBA 1X3GA 3RZDH 4C3IH 3SXHA 1IBLL 2B2VC 5M5WB 1I4QA 1G291 5IGEA 1R9TH 5M9OA 4A3DH 1H9RA 3RZDB 4C3IB 1BCPD 4IUTA 1VQMA 3M4PA 1VQPA 1I94L 4HIKA 4HJ7A 1SNCA 3W1BA 1Q90A 5J3BA 1LT4D 1B9NA 4A3DB 5AJ3Q 2KEDA 1Q81C 1PA6A 4GOPC 1Q86C 3TZDA 3AYHB 1WTQA 2MUYA 5CORA 4GKKL 2K5NA 1ILPA 1SN8A 2CH4W 2OQ0A 1C8CA 5IODA 3U50C 2QA4A 4G57A 4BBSB 3AEVA 3A8IE 1XNQL 2BE5C 3RD4A 4XYOA 2QGQA 2NZHA 1PH1A 5E4WC 1TWAH 5JPMC 1OXXK 4RKLA 2VNUD 2EYOA 4BBSH 1JE4A 1G6ZA 1PYSB 2D2CC 4A3LG 1WTPA 1IYUA 2XTIA 2Y0SE 3MXPA 4KKSA 2A19A 3KF8A 1LT6D 4JBWA 2B2YA 2ZTDA 4IPHA 3DHQA 4ILWA 1EY6A 1BVSA 1LABA 3A0JA 4LW1A 5HGQA 2JP1A 1STYA 4HCEA 2UXBQ 2I5LX 3E5SA 1EQVA 1PH4A 2EXZA 3NQIA 3CCRA 1YHAA 4PV1C 2GA4B 1JOQA 3RMHA 4DXGA 1NJIC 3AU7A 1WTHA 4QMGA 1QILA 2KCTA 4A76A 3D4RA 4KY6A 2L4NA 3MXUA 4J8QA 4OO1G 1FVIA 1VQ9A 3M3YH 4X66Q 4JOIC 2PMZE 4B08A 2C35B 2K7VA 1IBML 1L0YB 1YNJD 1HNZQ 3BG3A 4DR1L 3S14H 5JJIA 5JJLA 3NSWA 5D14A 1JWSD 1V1QA 1O7ZA 2Q2HA 1LLRD 4A3CH 4YCUA 1SSOA 3TQYA 4HMJA 4NXNL 4A3BG 4L5TA 2ZT9C 1SLJA 2DNEA 2A68C 4WORA 4KN7C 2ZJRA 4G7ZC 1TT2A 1IYVA 4QGUA 3WWVA 2B2UA 1SE2A 3QOLA 2KEEA 1WD0A 1VDZA
chains in the Genus database with same CATH topology
4LF4Q 1N36L 2E2IH 4JC0A 1RL2A 1E1OA 2F52A 4X64L 2PI2A 3F2BA 4DPGA 5IWAL 1YJ9A 1XNRQ 1VQLA 4IFDI 3FHWA 4DKAC 4IJLA 5FLMH 2RCNA 3T1YQ 2YU9H 1KXLA 5C4XG 3RZOH 4OWTB 4GS3A 1YNXA 4NB3A 1XNQQ 2Q2TA 2JA5G 4A93G 5LMUQ 1HNWQ 1CKOA 4YCVA 1L1OA 2VW9A 4R4QA 1JMCA 3OW2A 4A3BH 3A5UA 4AYBE 1OXTA 1PH7A 3PUZA 2K50A 4DK6C 4BXXG 4L5RC 3M4QA 3RLFA 4AQYL 3U4VA 3F1ZA 3EN2A 3RN5A 1GO3E 4KI0A 2IX1A 4DR3L 4XIGS 2I5MX 3KLWA 1IXRA 2NVXH 3ICEA 4JI1L 3S15H 3KYHC 4AQYQ 3CMAA 2HIVA 5IP7H 4BY7H 1D8LA 1PHJA 4PZ8A 4DR6Q 4LUZA 3ZJYC 3PUVA 4GOPA 4DAMA 4LF7L 3J80i 4X62Q 4DV3L 2N3SA 3A5ZB 5BR8L 1VCIA 1GKHA 1QZGA 4JYAQ 3GTKH 2MFIA 3I4NH 1CKMA 1G51A 1KAWA 4TVAB 2JA5H 4DV0L 1YHQA 3B6YA 2JK8A 4PG3A 2KCMA 4A3EG 1K0RA 3K7UC 3S1RH 4JI6Q 3L7ZC 2RHQB 4A3IH 1IBLQ 1QVGA 1K83H 1N9WA 3G71A 1JT8A 2N49A 4BBRH 4YWLA 1NMFA 3PIOA 3G4SA 1I5FA 3OTOQ 2UUCL 2JA6H 3Q8DA 3KJOA 4YWMA 3PF5A 2JA7G 2IX0A 3SGIA 1L2FA 3AFPA 1SROA 5LMNW 2HT1A 2R7ZG 1YHBA 5EAYA 1PH6A 1AE3A 1Z9FA 1OTCA 2OTJA 3RR5A 2VL6A 1RIPA 3GDEA 3GTQH 2UUCQ 1VQEA 3I56A 2ATWA 1S3OA 1TWCH 4A3GG 3CPFA 3PUWA 1HR0L 2V1CC 4JI0Q 2I5HA 3KJPA 1CUKA 1X56A 4GOPB 1TXYA 1MKHA 3GTLH 4OWWB 1JB7A 1WCMG 4DR5L 3BJUA 4JI8Q 3LGJA 1FL0A 2EXDA 4BXXH 1UEBA 1WFQA 4RMFA 4A3JH 3TRZA 4JI5L 1C7YA 1GD7A 1HR0W 3CCMA 4DV2Q 2AHOB 4MNOA 1IBKL 1YBYA 1YEZA 4A93H 3PO2G 2DGYA 3STBD 3AFQA 3KDFA 3TEHB 3BZCA 3KF6B 5AJ3L 3J7ZC 1PV4A 1KQSA 1GM5A 4JI7Q 1HZBA 1N32L 3CCVA 1S72A 2Q2IA 4BBRG 1IBKQ 1JJGA 5C0XG 4QY7A 4DR2Q 4B3SQ 1VQNA 1HJPA 4A3JG 1N32Q 3K0XA 1X9NA 1IL2A 3ULPA 2ZM6Q 4O0AA 1Y1WH 1B8AA 2K14A 4GNXC 1Q1EA 4C3HH 4IPCA 3T1YL 3CF5A 2E5LL 1IZ6A 1VQ5A 5C3EH 4POGA 2JE6I 2WFWA 4DV1L 4JI6L 1E3PA 1I94Q 2YTVA 1KRSA 1Z47A 3S2HH 1L1OC 3MEFA 3TS2A 3KF8B 2VY3A 3S17H 1PYBA 1CKNB 4JI3Q 4JI4L 4NXML 4LFAL 3NEMA 3I4OA 1Q8KA 5GAHC 3U4ZA 4A3FH 4LFCQ 4YY3L 5FJ8G 4JI5Q 5M3FG 5IT9c 3D31A 2D0OA 2K52A 3IRBA 4FDBA 1X3FA 4GLXA 3I55A 1KD1C 1KC8C 1VQBA 5JJKA 4DUZQ 4JI3L 3RLOA 5HY6A 1YJNA 5C44G 4KHPL 4X65L 3E9HA 4R4OA 1IBMQ 2OTLA 3J7A5 4Y7NH 4XTCS 1HNZL 5FLMG 3K80C 4HIOA 2OWOA 2YV5A 4LF9Q 5IY0A 1MJEA 4AYBG 1L0WA 1EQRA 2N78A 5IP9H 4DV0Q 2YTXA 3S24A 1UE5A 5C0XI 4R4TA 3M7NA 3J81i 4LNQA 1FGUA 5H1SE 3GTMH 1Q46A 4WJ4A 2MQHA 1XMQL 2K4KA 4IFDG 5IYCH 2B63G 3T1HL 4GKKQ 4DV4Q 3HOUG 3JAMc 2NZOA 2B29A 2GN5A 4R4CA 2KBNA 2R6GA 4YCWA 2K5HA 3HKZG 5M3MH 4JBMA 3CC7A 2JA9A 1T9HA 2YYZA 2FXQA 4JYAL 1EYGA 4WJ3M 1QVCA 4LF5L 3KDFB 4YWKA 3HOZG 2H5XA 2NVQH 4A3CG 1JE5A 3CC2A 2XGTA 4K0KQ 1KRTA 3S1MH 2WP8J 4DV7L 2UUAL 4JG2A 1TWGH 4X64Q 3F2DA 2CFMA 1XNRL 1XMOL 1K3RA 3UDXA 2KHJA 3ERSX 1DGSA 3M4OH 1J5EQ 4BBSG 4X62L 3L0OA 1UE1A 2B3GA 2UUAQ 3PO3G 3G48A 5IYBG 3U58A 1AH9A 4P75A 2JEBI 4A3MG 4AH6A 1YJWA 2IY5B 3UDFA 2LXJA 3MXNB 4YY3Q 4HIDA 2R93H 1VQAA 5C44H 1J6QA 3GO5A 3CP0A 1HNWL 4DV6Q 4IPGA 4UP9A 4QL5A 3PCOB 2N8NA 4HIMA 1Y1VG 1EUJA 3H0GG 4DV3Q 4JI2L 2R7DA 3KF6A 1NMGA 3F8TA 1QUQB 4GN5A 5K36G 5GAGC 3GTPH 2BA0A 1CSQA 2CKZB 3CC4A 2EIFA 2AMCB 2Q2UA 3UDIA 5C3EG 4IFDJ 1E22A 2E5LQ 1VQDA 4IO9A 4JCVE 5LMUL 1HNXQ 3ULLA 3J81c 4QIWE 1HR0Q 4JI0L 5ELNA 2AKWB 4A3GH 2IHEA 1PH9A 5E7NA 1XTDA 3M9BA 3AQQA 5M5YH 1N33L 1X3EA 1CSPA 1VQGA 4K0KL 3GTGH 1YVCA 1AE2A 4OX9Q 1X55A 2ID0A 2JA8G 1WI5A 4X65Q 3HOVH 2CCZA 4DK3C 2ZM6L 5LMNQ 2UXBL 4NPSA 1E7ZA 4IJHA 2OQKA 4YHHQ 4L5QA 2E2JH 2PQAB 4OX9L 1HZCA 4A75A 3H3VH 4UPAA 4GN4B 3F2CA 2F3IA 4POFA 2A8VA 1K8GA 3CCJA 5FJ8H 1I3QH 2Z6KA 2ZJQA 4KHPQ 4UP7A 2CWAA 1E1TA 3BU2A 4P71A 5LMNL 4UP8A 1QUQA 4B3ML 3CCLA 2Y0SG 3PO2H 4JI2Q 3RLNA 3G6EA 3CD6A 1H95A 4DV7Q 1KHIA 3CMEA 3UE0A 4JV5Q 3PGZA 1XPRA 1I6HH 1NE3A 1SMXA 3CQZH 3I2ZA 4LFCL 1YITA 1M90C 4QQBX 3H15A 1NBWA 3E0EA 4B3TL 2JEAI 3FP9A 1LTLA 4A3KH 1MIUA 1PH2A 4A3DG 2JQOA 4J15A 4BA2I 4A3LH 2JJQA 4DUYL 2WB1G 1WOCA 4OWXB 1LUZA 1W2BA 2JA8H 4R4IA 1V9PA 1X54A 2BA1A 1OXVA 1XPUA 2AWOA 4BA1I 1N34L 3I4MH 4Y52H 1W3SA 1CKNA 1FJGL 4LFBL 1VQIA 2RHSB 2R7ZH 2NN6I 2QEXA 4A3EH 1QZHA 5IYDH 1P16A 1BBUA 1K9MC 3GTOH 4C2MH 2PNHA 2OCEA 1TWFH 2JA6G 4DUZL 5IE8A 4B3SL 1YIJA 1O7IA 1JJCB 1K8AC 5FLXc 4BY7G 3HOYH 2ALYB 4C3JH 1WJJA 1I50H 4APVA 4BY1H 3JC66 2B63H 2D0PA 1ASZA 3CPWA 3S2DH 3H0GH 4AIMA 4P74A 1YZ6A 1PFSA 1NTGA 3EIVA 3NELA 4PZ7A 3HOXG 1Q82C 1V43A 1BBWA 1UE6A 3CW2C 1C9OA 3KOJA 1EQQA 1QVFA 4DR4Q 2CQOA 5IYBH 3VDYA 4GKJQ 4EX5A 3UDGA 3PSIA 2VQFL 1J5EL 1U5KA 4JBKA 1XPOA 1PH3A 2R7FA 1VQFA 4BY1G 1S40A 3NENA 1SE8A 5DLQE 4HJ5A 3HKZE 5C4XH 2MNAA 5GAEC 3TS0A 3HOUH 1LM0A 2HQLA 3K8AA 2UXCL 1HH2P 1LYLA 3PUYA 3T1HQ 1IYJB 1VQCA 3D0FA 4QJFA 2CWPA 4A3FG 1E24A 2E2HH 2MO0A 4GNXA 4DR7L 3JAMi 1SRUA 1A0IA 5GADC 3BZKA 4LUVA 4JBJA 4JI4Q 2UUBQ 1SFOH 1JJ2A 3J80c 2NN6G 4OONA 5ELOA 1VQOA 3I4MG 2KENA 4B3RQ 2F4VQ 1XJVA 1PH5A 1X6OA 4MTNA 4LF8Q 4O2DA 4DNIA 3HKSA 4LF6Q 3K81C 1EIYB 4DR5Q 4LF4L 1D7QA 1XMQQ 4X6AH 1HNXL 1PH8A 4DV2L 1U0LA 2Z0SA 3CCEA 3PV0A 2RF4A 4IPDA 3UE1A 3RN2A 4LF8L 3DM3A 1N33Q 4A4IA 4LF5Q 4RG1A 2VQEL 4GLVB 4P73A 2VQFQ 2UXDQ 2GVAA 2ZTEA 1Y1VH 5M5WH 5IYDG 5M5XH 5M3MG 4L5SA 2EQSA 5BR8Q 1PVOA 4ME3A 2HHHQ 4LF7Q 5JEAJ 1WYDA 1ASYA 1HZ9A 1Y14B 5IP9G 1C0AA 1X3GA 4PMWA 3S1QH 3RZDH 4C3IH 3H3VI 1IBLL 2GVBA 4GN3B 3PIPA 2HHHL 4R1JA 1G291 2WAQG 1N36Q 4JOIA 1GVPA 1R9TH 3GTJH 4A3DH 5GROA 2YTYA 3HOWH 2PI2E 1VQMA 3M4PA 4LWCA 1VQPA 1I94L 4OO1I 4OXPA 4HIKA 2VS1A 4HJ7A 3W1BA 1B70B 5J3BA 1VQHA 4P72A 4LFAQ 2HIXA 5AJ3Q 1Q81C 1TWHH 3CCUA 3J81j 4PZ6A 4GOPC 1PA6A 4DR7Q 4DR6L 3CCSA 1YI2A 1Q86C 1N34Q 3AYHB 1EWIA 4DR2L 4B3RL 2BH2A 4GKKL 5IWAQ 1N8RC 2K5NA 1SN8A 2OQ0A 3CAMA 4H02A 2UXDL 3U50C 1K73C 2QA4A 2E8GA 4ALPA 3E9IA 3AEVA 4B3TQ 2IHFA 4KHZA 3FKIG 2Z6KC 2AWNA 2K75A 2ZTCA 1XNQL 1EOVA 2VZAA 1VQ6A 4DR4L 2K5VA 1A62A 2QGQA 4A3MH 4LF9L 3W1GA 2NZHA 1UWVA 3HFZB 4DV5L 1PH1A 4JV5L 2UU9L 1TWAH 2R92G 1VQ7A 1OXXK 2WB1E 2VNUD 4BBSH 2UUBL 1Y1WG 1PYSB 3S1NH 2VUMG 3EBEA 1SR3A 5C0XJ 4MZ9A 4NXMQ 4A3LG 2XTIA 2Y0SE 1FJGQ 3K7AH 1G6PA 1VQ8A 2L15A 2LXKA 1XMOQ 2UU9Q 2VQEQ 3OYYA 3HOYG 2A19A 3ULJA 4DV5Q 2ZTDA 4JBWA 4IPHA 3DLLA 1Q1BA 1BVSA 3A0JA 3FKIH 4LW1A 5HGQA 4JI8L 1VQKA 1P8LA 3NBHB 3KFUA 2UXBQ 1L1OB 2I5LX 2ES2A 1PH4A 3PF4A 3CCRA 1YHAA 1Q12A 4DV6L 1KL9A 4DAYB 4LF6L 2UXCQ 2BH8A 4HJAA 2NVYH 4JI1Q 5JEAG 5IYCG 1NJIC 1WCMH 4IOCA 1VQ4A 4DUYQ 1OXSC 2D62A 2NVTH 4LUOA 2KCTA 1OXUA 4A76A 4B3MQ 4A3KG 2VUMH 4OO1G 2ZJPA 1FVIA 4DR1Q 4HJ8A 3S16H 1KIXA 1VQ9A 3ER0A 2JA7H 4LFBQ 1A63A 2R92H 3HOWG 4X66Q 4JOIC 3M3YH 2PMZE 5IP7G 1M1KC 2C35B 3TREA 3CCQA 3A74A 1IBML 3HOZH 1HNZQ 4UY8C 4DR1L 3S14H 4JI7L 4DR3Q 4GLAC 1EIFA 1UE7A 4EQ5A 5JJIA 1BKBA 1MJCA 5JJLA 1Q7YC 3I4NG 1V1QA 3STBC 2R93G 2Q2HA 3CXCA 4A3CH 4X66L 2PQAA 3RNUA 2I0QA 5M3FH 2ASBA 4YCUA 4A3IG 3PO3H 4IOAA 3TQYA 1VS0A 4NXNL 4YHHL 4A3BG 4DV4L 4L5TA 1B7YB 1SLJA 3PUXA 4KLKA 4GNXB 3HOVG 5C4JH 1NY4A 2DUDA 1A8VA 2ZJRA 2LSSA 5GQOA 4GKJL 2MO1A 1HZAA 4QGUA 2IT1A 3GD7A 1VQJA 3I7FA 3OTOL 3WWVA 3M85A 2KHIA 4NXNQ 3L2PA 2A1AA 4DV1Q 3HOXH 1X65A 2F4VL 4TQUS 1EFWA 3W5OA 2WAQE 4HJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 Q;  1N36 L;  2E2I H;  4JC0 A;  1RL2 A;  1E1O A;  2F52 A;  4X64 L;  2PI2 A;  3F2B A;  4DPG A;  5IWA L;  1YJ9 A;  1XNR Q;  1VQL A;  4IFD I;  3FHW A;  4DKA C;  4IJL A;  5FLM H;  2RCN A;  3T1Y Q;  2YU9 H;  1KXL A;  5C4X G;  3RZO H;  4OWT B;  4GS3 A;  1YNX A;  4NB3 A;  1XNQ Q;  2Q2T A;  2JA5 G;  4A93 G;  5LMU Q;  1HNW Q;  1CKO A;  4YCV A;  1L1O A;  2VW9 A;  4R4Q A;  1JMC A;  3OW2 A;  4A3B H;  3A5U A;  4AYB E;  1OXT A;  1PH7 A;  3PUZ A;  2K50 A;  4DK6 C;  4BXX G;  4L5R C;  3M4Q A;  3RLF A;  4AQY L;  3U4V A;  3F1Z A;  3EN2 A;  3RN5 A;  1GO3 E;  4KI0 A;  2IX1 A;  4DR3 L;  4XIG S;  2I5M X;  3KLW A;  1IXR A;  2NVX H;  3ICE A;  4JI1 L;  3S15 H;  3KYH C;  4AQY Q;  3CMA A;  2HIV A;  5IP7 H;  4BY7 H;  1D8L A;  1PHJ A;  4PZ8 A;  4DR6 Q;  4LUZ A;  3ZJY C;  3PUV A;  4GOP A;  4DAM A;  4LF7 L;  3J80 i;  4X62 Q;  4DV3 L;  2N3S A;  3A5Z B;  5BR8 L;  1VCI A;  1GKH A;  1QZG A;  4JYA Q;  3GTK H;  2MFI A;  3I4N H;  1CKM A;  1G51 A;  1KAW A;  4TVA B;  2JA5 H;  4DV0 L;  1YHQ A;  3B6Y A;  2JK8 A;  4PG3 A;  2KCM A;  4A3E G;  1K0R A;  3K7U C;  3S1R H;  4JI6 Q;  3L7Z C;  2RHQ B;  4A3I H;  1IBL Q;  1QVG A;  1K83 H;  1N9W A;  3G71 A;  1JT8 A;  2N49 A;  4BBR H;  4YWL A;  1NMF A;  3PIO A;  3G4S A;  1I5F A;  3OTO Q;  2UUC L;  2JA6 H;  3Q8D A;  3KJO A;  4YWM A;  3PF5 A;  2JA7 G;  2IX0 A;  3SGI A;  1L2F A;  3AFP A;  1SRO A;  5LMN W;  2HT1 A;  2R7Z G;  1YHB A;  5EAY A;  1PH6 A;  1AE3 A;  1Z9F A;  1OTC A;  2OTJ A;  3RR5 A;  2VL6 A;  1RIP A;  3GDE A;  3GTQ H;  2UUC Q;  1VQE A;  3I56 A;  2ATW A;  1S3O A;  1TWC H;  4A3G G;  3CPF A;  3PUW A;  1HR0 L;  2V1C C;  4JI0 Q;  2I5H A;  3KJP A;  1CUK A;  1X56 A;  4GOP B;  1TXY A;  1MKH A;  3GTL H;  4OWW B;  1JB7 A;  1WCM G;  4DR5 L;  3BJU A;  4JI8 Q;  3LGJ A;  1FL0 A;  2EXD A;  4BXX H;  1UEB A;  1WFQ A;  4RMF A;  4A3J H;  3TRZ A;  4JI5 L;  1C7Y A;  1GD7 A;  1HR0 W;  3CCM A;  4DV2 Q;  2AHO B;  4MNO A;  1IBK L;  1YBY A;  1YEZ A;  4A93 H;  3PO2 G;  2DGY A;  3STB D;  3AFQ A;  3KDF A;  3TEH B;  3BZC A;  3KF6 B;  5AJ3 L;  3J7Z C;  1PV4 A;  1KQS A;  1GM5 A;  4JI7 Q;  1HZB A;  1N32 L;  3CCV A;  1S72 A;  2Q2I A;  4BBR G;  1IBK Q;  1JJG A;  5C0X G;  4QY7 A;  4DR2 Q;  4B3S Q;  1VQN A;  1HJP A;  4A3J G;  1N32 Q;  3K0X A;  1X9N A;  1IL2 A;  3ULP A;  2ZM6 Q;  4O0A A;  1Y1W H;  1B8A A;  2K14 A;  4GNX C;  1Q1E A;  4C3H H;  4IPC A;  3T1Y L;  3CF5 A;  2E5L L;  1IZ6 A;  1VQ5 A;  5C3E H;  4POG A;  2JE6 I;  2WFW A;  4DV1 L;  4JI6 L;  1E3P A;  1I94 Q;  2YTV A;  1KRS A;  1Z47 A;  3S2H H;  1L1O C;  3MEF A;  3TS2 A;  3KF8 B;  2VY3 A;  3S17 H;  1PYB A;  1CKN B;  4JI3 Q;  4JI4 L;  4NXM L;  4LFA L;  3NEM A;  3I4O A;  1Q8K A;  5GAH C;  3U4Z A;  4A3F H;  4LFC Q;  4YY3 L;  5FJ8 G;  4JI5 Q;  5M3F G;  5IT9 c;  3D31 A;  2D0O A;  2K52 A;  3IRB A;  4FDB A;  1X3F A;  4GLX A;  3I55 A;  1KD1 C;  1KC8 C;  1VQB A;  5JJK A;  4DUZ Q;  4JI3 L;  3RLO A;  5HY6 A;  1YJN A;  5C44 G;  4KHP L;  4X65 L;  3E9H A;  4R4O A;  1IBM Q;  2OTL A;  3J7A 5;  4Y7N H;  4XTC S;  1HNZ L;  5FLM G;  3K80 C;  4HIO A;  2OWO A;  2YV5 A;  4LF9 Q;  5IY0 A;  1MJE A;  4AYB G;  1L0W A;  1EQR A;  2N78 A;  5IP9 H;  4DV0 Q;  2YTX A;  3S24 A;  1UE5 A;  5C0X I;  4R4T A;  3M7N A;  3J81 i;  4LNQ A;  1FGU A;  5H1S E;  3GTM H;  1Q46 A;  4WJ4 A;  2MQH A;  1XMQ L;  2K4K A;  4IFD G;  5IYC H;  2B63 G;  3T1H L;  4GKK Q;  4DV4 Q;  3HOU G;  3JAM c;  2NZO A;  2B29 A;  2GN5 A;  4R4C A;  2KBN A;  2R6G A;  4YCW A;  2K5H A;  3HKZ G;  5M3M H;  4JBM A;  3CC7 A;  2JA9 A;  1T9H A;  2YYZ A;  2FXQ A;  4JYA L;  1EYG A;  4WJ3 M;  1QVC A;  4LF5 L;  3KDF B;  4YWK A;  3HOZ G;  2H5X A;  2NVQ H;  4A3C G;  1JE5 A;  3CC2 A;  2XGT A;  4K0K Q;  1KRT A;  3S1M H;  2WP8 J;  4DV7 L;  2UUA L;  4JG2 A;  1TWG H;  4X64 Q;  3F2D A;  2CFM A;  1XNR L;  1XMO L;  1K3R A;  3UDX A;  2KHJ A;  3ERS X;  1DGS A;  3M4O H;  1J5E Q;  4BBS G;  4X62 L;  3L0O A;  1UE1 A;  2B3G A;  2UUA Q;  3PO3 G;  3G48 A;  5IYB G;  3U58 A;  1AH9 A;  4P75 A;  2JEB I;  4A3M G;  4AH6 A;  1YJW A;  2IY5 B;  3UDF A;  2LXJ A;  3MXN B;  4YY3 Q;  4HID A;  2R93 H;  1VQA A;  5C44 H;  1J6Q A;  3GO5 A;  3CP0 A;  1HNW L;  4DV6 Q;  4IPG A;  4UP9 A;  4QL5 A;  3PCO B;  2N8N A;  4HIM A;  1Y1V G;  1EUJ A;  3H0G G;  4DV3 Q;  4JI2 L;  2R7D A;  3KF6 A;  1NMG A;  3F8T A;  1QUQ B;  4GN5 A;  5K36 G;  5GAG C;  3GTP H;  2BA0 A;  1CSQ A;  2CKZ B;  3CC4 A;  2EIF A;  2AMC B;  2Q2U A;  3UDI A;  5C3E G;  4IFD J;  1E22 A;  2E5L Q;  1VQD A;  4IO9 A;  4JCV E;  5LMU L;  1HNX Q;  3ULL A;  3J81 c;  4QIW E;  1HR0 Q;  4JI0 L;  5ELN A;  2AKW B;  4A3G H;  2IHE A;  1PH9 A;  5E7N A;  1XTD A;  3M9B A;  3AQQ A;  5M5Y H;  1N33 L;  1X3E A;  1CSP A;  1VQG A;  4K0K L;  3GTG H;  1YVC A;  1AE2 A;  4OX9 Q;  1X55 A;  2ID0 A;  2JA8 G;  1WI5 A;  4X65 Q;  3HOV H;  2CCZ A;  4DK3 C;  2ZM6 L;  5LMN Q;  2UXB L;  4NPS A;  1E7Z A;  4IJH A;  2OQK A;  4YHH Q;  4L5Q A;  2E2J H;  2PQA B;  4OX9 L;  1HZC A;  4A75 A;  3H3V H;  4UPA A;  4GN4 B;  3F2C A;  2F3I A;  4POF A;  2A8V A;  1K8G A;  3CCJ A;  5FJ8 H;  1I3Q H;  2Z6K A;  2ZJQ A;  4KHP Q;  4UP7 A;  2CWA A;  1E1T A;  3BU2 A;  4P71 A;  5LMN L;  4UP8 A;  1QUQ A;  4B3M L;  3CCL A;  2Y0S G;  3PO2 H;  4JI2 Q;  3RLN A;  3G6E A;  3CD6 A;  1H95 A;  4DV7 Q;  1KHI A;  3CME A;  3UE0 A;  4JV5 Q;  3PGZ A;  1XPR A;  1I6H H;  1NE3 A;  1SMX A;  3CQZ H;  3I2Z A;  4LFC L;  1YIT A;  1M90 C;  4QQB X;  3H15 A;  1NBW A;  3E0E A;  4B3T L;  2JEA I;  3FP9 A;  1LTL A;  4A3K H;  1MIU A;  1PH2 A;  4A3D G;  2JQO A;  4J15 A;  4BA2 I;  4A3L H;  2JJQ A;  4DUY L;  2WB1 G;  1WOC A;  4OWX B;  1LUZ A;  1W2B A;  2JA8 H;  4R4I A;  1V9P A;  1X54 A;  2BA1 A;  1OXV A;  1XPU A;  2AWO A;  4BA1 I;  1N34 L;  3I4M H;  4Y52 H;  1W3S A;  1CKN A;  1FJG L;  4LFB L;  1VQI A;  2RHS B;  2R7Z H;  2NN6 I;  2QEX A;  4A3E H;  1QZH A;  5IYD H;  1P16 A;  1BBU A;  1K9M C;  3GTO H;  4C2M H;  2PNH A;  2OCE A;  1TWF H;  2JA6 G;  4DUZ L;  5IE8 A;  4B3S L;  1YIJ A;  1O7I A;  1JJC B;  1K8A C;  5FLX c;  4BY7 G;  3HOY H;  2ALY B;  4C3J H;  1WJJ A;  1I50 H;  4APV A;  4BY1 H;  3JC6 6;  2B63 H;  2D0P A;  1ASZ A;  3CPW A;  3S2D H;  3H0G H;  4AIM A;  4P74 A;  1YZ6 A;  1PFS A;  1NTG A;  3EIV A;  3NEL A;  4PZ7 A;  3HOX G;  1Q82 C;  1V43 A;  1BBW A;  1UE6 A;  3CW2 C;  1C9O A;  3KOJ A;  1EQQ A;  1QVF A;  4DR4 Q;  2CQO A;  5IYB H;  3VDY A;  4GKJ Q;  4EX5 A;  3UDG A;  3PSI A;  2VQF L;  1J5E L;  1U5K A;  4JBK A;  1XPO A;  1PH3 A;  2R7F A;  1VQF A;  4BY1 G;  1S40 A;  3NEN A;  1SE8 A;  5DLQ E;  4HJ5 A;  3HKZ E;  5C4X H;  2MNA A;  5GAE C;  3TS0 A;  3HOU H;  1LM0 A;  2HQL A;  3K8A A;  2UXC L;  1HH2 P;  1LYL A;  3PUY A;  3T1H Q;  1IYJ B;  1VQC A;  3D0F A;  4QJF A;  2CWP A;  4A3F G;  1E24 A;  2E2H H;  2MO0 A;  4GNX A;  4DR7 L;  3JAM i;  1SRU A;  1A0I A;  5GAD C;  3BZK A;  4LUV A;  4JBJ A;  4JI4 Q;  2UUB Q;  1SFO H;  1JJ2 A;  3J80 c;  2NN6 G;  4OON A;  5ELO A;  1VQO A;  3I4M G;  2KEN A;  4B3R Q;  2F4V Q;  1XJV A;  1PH5 A;  1X6O A;  4MTN A;  4LF8 Q;  4O2D A;  4DNI A;  3HKS A;  4LF6 Q;  3K81 C;  1EIY B;  4DR5 Q;  4LF4 L;  1D7Q A;  1XMQ Q;  4X6A H;  1HNX L;  1PH8 A;  4DV2 L;  1U0L A;  2Z0S A;  3CCE A;  3PV0 A;  2RF4 A;  4IPD A;  3UE1 A;  3RN2 A;  4LF8 L;  3DM3 A;  1N33 Q;  4A4I A;  4LF5 Q;  4RG1 A;  2VQE L;  4GLV B;  4P73 A;  2VQF Q;  2UXD Q;  2GVA A;  2ZTE A;  1Y1V H;  5M5W H;  5IYD G;  5M5X H;  5M3M G;  4L5S A;  2EQS A;  5BR8 Q;  1PVO A;  4ME3 A;  2HHH Q;  4LF7 Q;  5JEA J;  1WYD A;  1ASY A;  1HZ9 A;  1Y14 B;  5IP9 G;  1C0A A;  1X3G A;  4PMW A;  3S1Q H;  3RZD H;  4C3I H;  3H3V I;  1IBL L;  2GVB A;  4GN3 B;  3PIP A;  2HHH L;  4R1J A;  1G29 1;  2WAQ G;  1N36 Q;  4JOI A;  1GVP A;  1R9T H;  3GTJ H;  4A3D H;  5GRO A;  2YTY A;  3HOW H;  2PI2 E;  1VQM A;  3M4P A;  4LWC A;  1VQP A;  1I94 L;  4OO1 I;  4OXP A;  4HIK A;  2VS1 A;  4HJ7 A;  3W1B A;  1B70 B;  5J3B A;  1VQH A;  4P72 A;  4LFA Q;  2HIX A;  5AJ3 Q;  1Q81 C;  1TWH H;  3CCU A;  3J81 j;  4PZ6 A;  4GOP C;  1PA6 A;  4DR7 Q;  4DR6 L;  3CCS A;  1YI2 A;  1Q86 C;  1N34 Q;  3AYH B;  1EWI A;  4DR2 L;  4B3R L;  2BH2 A;  4GKK L;  5IWA Q;  1N8R C;  2K5N A;  1SN8 A;  2OQ0 A;  3CAM A;  4H02 A;  2UXD L;  3U50 C;  1K73 C;  2QA4 A;  2E8G A;  4ALP A;  3E9I A;  3AEV A;  4B3T Q;  2IHF A;  4KHZ A;  3FKI G;  2Z6K C;  2AWN A;  2K75 A;  2ZTC A;  1XNQ L;  1EOV A;  2VZA A;  1VQ6 A;  4DR4 L;  2K5V A;  1A62 A;  2QGQ A;  4A3M H;  4LF9 L;  3W1G A;  2NZH A;  1UWV A;  3HFZ B;  4DV5 L;  1PH1 A;  4JV5 L;  2UU9 L;  1TWA H;  2R92 G;  1VQ7 A;  1OXX K;  2WB1 E;  2VNU D;  4BBS H;  2UUB L;  1Y1W G;  1PYS B;  3S1N H;  2VUM G;  3EBE A;  1SR3 A;  5C0X J;  4MZ9 A;  4NXM Q;  4A3L G;  2XTI A;  2Y0S E;  1FJG Q;  3K7A H;  1G6P A;  1VQ8 A;  2L15 A;  2LXK A;  1XMO Q;  2UU9 Q;  2VQE Q;  3OYY A;  3HOY G;  2A19 A;  3ULJ A;  4DV5 Q;  2ZTD A;  4JBW A;  4IPH A;  3DLL A;  1Q1B A;  1BVS A;  3A0J A;  3FKI H;  4LW1 A;  5HGQ A;  4JI8 L;  1VQK A;  1P8L A;  3NBH B;  3KFU A;  2UXB Q;  1L1O B;  2I5L X;  2ES2 A;  1PH4 A;  3PF4 A;  3CCR A;  1YHA A;  1Q12 A;  4DV6 L;  1KL9 A;  4DAY B;  4LF6 L;  2UXC Q;  2BH8 A;  4HJA A;  2NVY H;  4JI1 Q;  5JEA G;  5IYC G;  1NJI C;  1WCM H;  4IOC A;  1VQ4 A;  4DUY Q;  1OXS C;  2D62 A;  2NVT H;  4LUO A;  2KCT A;  1OXU A;  4A76 A;  4B3M Q;  4A3K G;  2VUM H;  4OO1 G;  2ZJP A;  1FVI A;  4DR1 Q;  4HJ8 A;  3S16 H;  1KIX A;  1VQ9 A;  3ER0 A;  2JA7 H;  4LFB Q;  1A63 A;  2R92 H;  3HOW G;  4X66 Q;  4JOI C;  3M3Y H;  2PMZ E;  5IP7 G;  1M1K C;  2C35 B;  3TRE A;  3CCQ A;  3A74 A;  1IBM L;  3HOZ H;  1HNZ Q;  4UY8 C;  4DR1 L;  3S14 H;  4JI7 L;  4DR3 Q;  4GLA C;  1EIF A;  1UE7 A;  4EQ5 A;  5JJI A;  1BKB A;  1MJC A;  5JJL A;  1Q7Y C;  3I4N G;  1V1Q A;  3STB C;  2R93 G;  2Q2H A;  3CXC A;  4A3C H;  4X66 L;  2PQA A;  3RNU A;  2I0Q A;  5M3F H;  2ASB A;  4YCU A;  4A3I G;  3PO3 H;  4IOA A;  3TQY A;  1VS0 A;  4NXN L;  4YHH L;  4A3B G;  4DV4 L;  4L5T A;  1B7Y B;  1SLJ A;  3PUX A;  4KLK A;  4GNX B;  3HOV G;  5C4J H;  1NY4 A;  2DUD A;  1A8V A;  2ZJR A;  2LSS A;  5GQO A;  4GKJ L;  2MO1 A;  1HZA A;  4QGU A;  2IT1 A;  3GD7 A;  1VQJ A;  3I7F A;  3OTO L;  3WWV A;  3M85 A;  2KHI A;  4NXN Q;  3L2P A;  2A1A A;  4DV1 Q;  3HOX H;  1X65 A;  2F4V L;  4TQU S;  1EFW A;  3W5O A;  2WAQ E;  4HJ9 A; 
#chains in the Genus database with same CATH topology
 4LF4 Q;  2E2I H;  1Y8O B;  1II3 A;  1RL2 A;  3F2B A;  1XNR Q;  1FNU A;  4IFD I;  3P7J A;  3FHW A;  4H7B A;  1DM0 B;  2YU9 H;  1XWE A;  4GS3 A;  1RDP D;  4I7Z C;  5LMU Q;  3TDQ A;  3WOF A;  4R4Q A;  3NTI A;  1JMC A;  5C5L A;  3Q6S A;  1O78 A;  3OW2 A;  1B3Q A;  1PH7 A;  1E0B A;  4JVZ A;  2MP1 A;  3M4Q A;  4AQY L;  3F1Z A;  3EN2 A;  2PNR C;  1GO3 E;  4KI0 A;  2I5M X;  4FXK C;  5KNC A;  3I4M B;  2K32 A;  4JI1 L;  3KYH C;  4AQY Q;  3S15 H;  1U4M A;  3K5N A;  4DR6 Q;  4LUZ A;  1LTS D;  4DAM A;  3J80 i;  4JYA Q;  1GKH A;  1TWF B;  2FHT A;  1KAW A;  4NKL A;  1TKW B;  3K7U C;  4U68 A;  4EQN A;  4JI6 Q;  2RHQ B;  1I50 B;  1K83 H;  1JT8 A;  4OHJ A;  4EQP A;  1I5F A;  3OTO Q;  3Q8D A;  4IUP A;  1SYC A;  5FOB B;  3VR5 A;  1PH6 A;  4HCS A;  2OTJ A;  5J39 A;  1RIP A;  3GTQ H;  1J9O A;  2RSN A;  2ATW A;  4KJO A;  4JI0 Q;  2RQX A;  2KHS A;  4GOP B;  1MKH A;  4OWW B;  1EY7 A;  4DR5 L;  3DWA A;  3LGJ A;  2EXD A;  3OW7 A;  5JEA H;  4BXX H;  3TRZ A;  4C3I G;  1GD7 A;  2OF1 A;  4DV2 Q;  2L12 A;  3V96 A;  1YBY A;  3KF6 B;  1X3Q A;  5IT9 L;  2L1B A;  3CCV A;  2XVS A;  4BBR G;  1IBK Q;  1BO0 A;  5ELF A;  1TII D;  4B3S Q;  1VQN A;  1LTB D;  3W3A A;  5AFW A;  1Y1W H;  1HTL D;  3EA6 A;  3S2H B;  4YIJ A;  3T1Y L;  2E5L L;  1IZ6 A;  3SHL A;  1H9S B;  2WFW A;  4CBV A;  1S5B D;  2A5H A;  3PMF A;  2F0H A;  2NTS A;  1Z47 A;  1Y1W B;  2F0U A;  3OMG A;  3S2H H;  5M5X B;  2VY3 A;  5G3L F;  2SNM A;  1CKN B;  4JI3 Q;  2KUM A;  4JI4 L;  4NXM L;  1Z7T A;  2HDM A;  3NEM A;  3K5M A;  1XYI A;  5GAH C;  5CR3 A;  5M3F G;  5IT9 c;  2RSO A;  2K52 A;  3E0J A;  1KC8 C;  4DUZ Q;  4RCO A;  3OWF A;  1JR0 D;  1SE3 A;  3O13 A;  5FLM G;  3K80 C;  3KLS X;  4DNR B;  1M8A A;  1PDQ A;  2PZW A;  1UE5 A;  3M7N A;  3A8J E;  3TME A;  1HPC A;  3GTM H;  2MPM A;  2G5D A;  5E1F A;  1XMQ L;  2K4K A;  1STE A;  4GKK Q;  4DV4 Q;  1ROD A;  4R4C A;  4QIW B;  4YCW A;  3ERO A;  3I90 A;  1BXT A;  1KDB A;  2K03 A;  5FO8 B;  3W2D A;  2FXQ A;  3SK4 A;  1QVC A;  2M2L A;  4YWK A;  4DAY A;  3VYT A;  4A3C G;  1JE5 A;  1GUS A;  2NYZ D;  4JG2 A;  4X64 Q;  3VYR A;  1RCV D;  3T53 B;  1PZI D;  1F2M A;  1WCM B;  4OO1 H;  3DUZ A;  1DGS A;  1HXY D;  1LTT D;  1JWM D;  1J5E Q;  2A73 B;  3D3R A;  4CKC A;  1FYC A;  2WAQ B;  4P75 A;  2LXJ A;  3MZ5 A;  4YY3 Q;  3QIA A;  1VQA A;  5C44 H;  4IPG A;  2WV6 D;  3PCO B;  2N8N A;  4ZCK A;  2PW7 A;  4JI2 L;  2F0O A;  5GAG C;  5ELD A;  3GTP H;  3C1F A;  2CKZ B;  4OEL B;  3C2P A;  5IGC A;  4KV6 A;  2VUM B;  1B44 D;  4IO9 A;  3ULL A;  4QIW E;  5EPJ A;  1YNN C;  2VB3 X;  2ZXO A;  2H4O A;  4KHV A;  3J7A F;  1X3E A;  2E2J B;  3GTG H;  3E3X A;  4OX9 Q;  3AB9 A;  2ID0 A;  2PYK A;  5CV7 A;  1WI5 A;  4DK3 C;  4LJZ C;  5ISR A;  5LMN Q;  4NPS A;  3SK5 A;  2B2V A;  3GV3 A;  4L5Q A;  2E2J H;  4OX9 L;  2F3I A;  1VF5 C;  4IUN A;  4POF A;  5KEE A;  1K8G A;  2A8V A;  3CHB D;  1I4P A;  3K5L A;  4KHP Q;  5C4J B;  1E1T A;  1NCV A;  2LMC B;  1H95 A;  3RLN A;  1HFG A;  4DV7 Q;  3UE0 A;  3PGZ A;  1AW7 A;  1NE3 A;  1SMX A;  3NE5 B;  2BE5 D;  1H9K A;  1ENC A;  4B3T L;  3FP9 A;  5CV6 A;  3ND9 A;  2JJQ A;  1WOC A;  4OWX B;  2JA8 H;  3J80 L;  4Y52 H;  2FJ2 A;  2NN6 H;  1CKN A;  4XDX A;  4LFB L;  1VQI A;  3SE0 A;  4FF4 A;  5FKA C;  2PNH A;  3KLR A;  3SK8 A;  4H0L C;  1O7I A;  1K8A C;  5FLX c;  3HOY H;  4C3J H;  3JC6 6;  2B63 H;  1DD2 A;  2EE1 A;  1YZ6 A;  1PFS A;  1NTG A;  5C3X A;  2PPB C;  4C3J B;  1Q82 C;  1UE6 A;  5FLX E;  1C9O A;  1BCP C;  4L6T B;  4DR4 Q;  4TKO B;  3VDY A;  3P20 A;  4QF4 A;  4BWG B;  1U5K A;  1XPO A;  3BDC A;  1CZG A;  2MNA A;  2DY7 A;  2RDH A;  1I4R A;  1HH2 P;  1NNX A;  4R8N A;  4QCL A;  1KDC A;  3D0F A;  1H9M A;  2X6L A;  3JAM i;  1SRU A;  4LUV A;  4ABN A;  4KN4 C;  2F0W A;  1LTI D;  2A68 D;  5ELO A;  1VQO A;  4B3R Q;  2A74 C;  3IAY A;  4DNI A;  1ICF B;  2FMM A;  4LF4 L;  1D7Q A;  1SMY C;  4DNT B;  3G6J B;  2Z0S A;  1T5X D;  4K2L A;  2A69 D;  4IPD A;  4A4I A;  1RKN A;  1TU2 B;  1KLU D;  2X69 A;  2VQE L;  3J80 E;  4RGN A;  1BCP F;  4CHT B;  4DK0 A;  4P73 A;  1ENF A;  2QF7 A;  5IYD G;  2TMP A;  1ESR A;  1JB3 A;  4LF7 Q;  5JEA J;  4JK1 C;  4KTA A;  1ICW A;  3S1Q H;  3H3V I;  4EGV A;  1IKM A;  2GVB A;  3TP5 A;  3FDT A;  1I4H A;  2CQA A;  4HSV A;  2EY1 A;  3H3V C;  3I8Z A;  1GVP A;  3KLS A;  3S1Q B;  1GUW A;  1TWH B;  2PI2 E;  4KD3 A;  4OO1 I;  4OXP A;  2LS0 1;  4LMQ D;  1SJH D;  4LFA Q;  2EYP A;  2WAC A;  1TWH H;  3HZX A;  3CCS A;  1Z6H A;  2EJF C;  4DR2 L;  4ID6 A;  2BH2 A;  3KBG A;  1S5C D;  1N8R C;  1K73 C;  1SYE A;  2IHF A;  4KHZ A;  1EOV A;  2EJG C;  4ZUI A;  5ELB A;  1A62 A;  2KCC A;  4OIJ A;  4UDU C;  4JV5 L;  2UU9 L;  2WB1 E;  3QB3 A;  2BOS A;  1MI2 A;  1Y1W G;  3C46 A;  3S1N H;  5C4H A;  2VUM G;  3EBE A;  1TWG B;  4NXM Q;  2D5D A;  2K5Q A;  1LO5 D;  1BBX C;  1XMO Q;  2UU9 Q;  2VQE Q;  3OYY A;  4C3J G;  3TZU A;  1LTG D;  2Y0S B;  3S1N B;  4QUF A;  4FYD A;  5KND A;  3BVG A;  3ZYY X;  2ES2 A;  1PLF A;  2NVT B;  4DV6 L;  4X3S A;  4TSS A;  2UXC Q;  3S1M B;  4HJA A;  4HMI A;  2NVY H;  1PFN A;  5C5M A;  2FIN B;  3OIQ A;  4RGT A;  4DUY Q;  1OXS C;  2HCC A;  3VYU A;  2NVT H;  1T5E A;  4LUO A;  4B3M Q;  1OXU A;  5FO7 B;  4KK7 A;  3VA5 A;  4A3K G;  2SEB D;  4K6D A;  3HRZ C;  2ZJP A;  1PZK D;  4HJ8 A;  1KIX A;  4LFB Q;  3ER0 A;  4U67 3;  2JA7 H;  1A63 A;  2R92 H;  1PFM A;  5IP7 G;  1M1K C;  3HOZ H;  3A74 A;  5IGG A;  4UY8 C;  4JI7 L;  4CDE C;  1BKB A;  3VYS A;  2JA7 B;  3BVM A;  3JAM L;  2I0Q A;  2ASB A;  3HOZ B;  4A3I G;  4IOA A;  2R61 A;  4MIU A;  4KLK A;  5EKI A;  1GXD C;  1CA5 A;  5NUC A;  3NWS A;  2LSS A;  2F0F A;  5IGF A;  4DAP A;  3PO2 B;  1TR5 A;  3K58 A;  2IT1 A;  2WIN B;  3I7F A;  1BCP B;  5J1Z A;  3OTO L;  1QNU A;  4NXN Q;  2A1A A;  4JW0 A;  5EGT A;  4TQU S;  1D5Z C;  1G2T A;  4B9X A;  1B1Z A;  2XRQ D;  4MTK A;  4JC0 A;  1FD7 D;  5G3L D;  1QCB D;  4ZYS A;  1I3Q B;  1D2B A;  1VF7 A;  5FLM H;  1EU3 A;  4J6H A;  4OWT B;  2TSS A;  4NB3 A;  2Q2T A;  1EIG A;  3CQZ B;  1QG7 A;  2CW0 D;  2E75 C;  3A5U A;  4AYB E;  2F0S A;  2SOB A;  1B2T A;  3DXJ C;  4G7H C;  2K05 A;  4DR3 L;  5EBD A;  1NUC A;  3KLW A;  3OHX C;  3CMA A;  4ME5 A;  5IP7 H;  1DOL A;  4BY7 H;  5A35 A;  3GTO B;  1F9S A;  3A5Z B;  5BR8 L;  4N8F A;  3I4N H;  1G51 A;  2JA5 H;  1YHQ A;  2JK8 A;  3S1R H;  3IKJ A;  3L7Z C;  4A3I H;  1QVG A;  5CV9 A;  1EYC A;  4BBR H;  1NMF A;  2R3Z A;  3I4N B;  4YWM A;  3S2D B;  3SGI A;  2L9H A;  1SRO A;  2HT1 A;  2R7Z G;  1YHB A;  5EAY A;  3SR1 A;  1Z9F A;  1OTC A;  1K28 A;  4A3I B;  2AUK A;  2VL6 A;  2BDN A;  3GDE A;  1VQE A;  2F0Q A;  2WKC A;  3I56 A;  3EJI A;  1S3O A;  5DAU A;  4A3G G;  3PUW A;  3QO2 A;  1Q3L A;  1CM9 A;  4IAL A;  3KJP A;  1TXY A;  1G8Z D;  3U9S A;  3BVZ A;  2JSO A;  4JI5 L;  2ZXR A;  3MC0 B;  3U9O A;  1LV9 A;  4LK1 C;  3R2T A;  3J81 E;  3STB D;  4JI7 Q;  1SNM A;  3J7Z C;  1S72 A;  2Q2I A;  1HJP A;  2CH4 A;  3K0X A;  1IL2 A;  3SVM A;  2XWB B;  4XT3 B;  1K3B C;  3CF5 A;  3R93 A;  4POG A;  4DV1 L;  4N8X 1;  4WFN 3;  1KRS A;  5FLX L;  1CFM A;  1L1O C;  3MEF A;  2EYF A;  1PFB A;  3I3C A;  3KK7 A;  2RBM A;  4JI5 Q;  5CYU A;  1QE6 A;  3IRB A;  4GLX A;  1KD1 C;  5JJK A;  4JI3 L;  1R9T B;  1PXU A;  5CV8 A;  1YJN A;  5C44 G;  4RGO S;  4X65 L;  4Y7N H;  3TSS A;  3GQB A;  5E4X A;  4AYB G;  4DV0 Q;  2YTX A;  2F03 A;  3J81 i;  4LNQ A;  3MA2 B;  5H1S E;  4Y7N B;  2MQH A;  5HGT A;  3NXW A;  1EEI D;  1B3A A;  1BDO A;  2NZO A;  1DYQ A;  2B29 A;  2GN5 A;  1WTX A;  2R6G A;  4DK1 A;  1ESF A;  1V1P A;  5JVH 3;  2NVQ B;  3CC7 A;  2L0C A;  1STG A;  1KAA A;  1T9H A;  1EYG A;  4UAI A;  4WJ3 M;  4F87 A;  3KDF B;  2WKD A;  2A6E C;  4IUU A;  1ZXT A;  2NVQ H;  3CC2 A;  4K5X A;  1KRT A;  1D1K A;  2WP8 J;  3QR8 A;  4QUC A;  1XMO L;  2MJ8 A;  1K3R A;  3UDX A;  1EWC A;  4BBS G;  2F0D A;  2QIL A;  1UE1 A;  3G48 A;  5IYB G;  1PZJ D;  3QOJ A;  4X3T A;  2IY5 B;  1YJW A;  1M4V A;  3UDF A;  4FVM A;  2VXW A;  2R93 H;  5J22 A;  3GO5 A;  4UP9 A;  1ENA A;  1EY5 A;  1EUJ A;  4DV3 Q;  1EY0 A;  4IUQ A;  3KF6 A;  5C3W A;  1V8Q A;  1QUQ B;  4CDD C;  5A2Q L;  5K36 G;  1CSQ A;  1FGB D;  2XNA C;  5M5Y B;  5FK9 C;  5C3E G;  1E22 A;  1VQD A;  1EZ8 A;  5LMU L;  1ZKO A;  1HNX Q;  3J81 c;  4JI0 L;  3A7A B;  2AKW B;  1LTA D;  4A3G H;  2IHE A;  5E7N A;  5M5Y H;  1XXG A;  1ML0 D;  3H09 A;  4IUV A;  1VQG A;  4ZKC B;  2JA8 G;  4X65 Q;  2ZM6 L;  3H94 A;  1TVX A;  1E7Z A;  2OQK A;  2EY6 A;  2PQA B;  5CGK A;  1NAP A;  2A6H D;  2G9D A;  5K36 H;  1I6H B;  1QJO A;  5LMN L;  3QWN A;  5DNF A;  4A3K B;  2DN8 A;  4JV5 Q;  3K57 A;  1I6H H;  1AH9 A;  1VMC A;  4OEM B;  4ZRZ A;  3H15 A;  4A3B B;  3V05 A;  2E2I B;  4A3K H;  1PH2 A;  4J15 A;  1DCZ A;  4BA2 I;  4DUY L;  2O4X A;  4R9W A;  2N55 A;  1V9P A;  1OXV A;  2YU9 B;  3URY A;  4V19 0;  5C0X H;  1PTO B;  1W3S A;  1LTR D;  2EYH A;  1F77 A;  2AQ3 B;  2NN6 I;  1QZH A;  5I6W A;  1P16 A;  2OCE A;  4DUZ L;  5IE8 A;  2ALY B;  1WJJ A;  4BS9 A;  1ILQ A;  4K6L A;  1ASZ A;  2JA6 B;  4AIM A;  3S15 B;  4EVO A;  2K04 A;  3EIV A;  4PZ7 A;  1STB A;  1V43 A;  1EQQ A;  5C4X B;  5IYB H;  3PSI A;  2VQF L;  1J5E L;  1RTO A;  3SDZ A;  4UHV A;  5EBC A;  2B2W C;  2HD3 A;  2EY2 A;  3NEN A;  3J7Y W;  5DLQ E;  3HKZ E;  5C4X H;  2NZ1 D;  1PMR A;  1LYL A;  5EJW A;  4A3J B;  1VQC A;  2RVL A;  4ULL A;  5GAD C;  3BZK A;  5I6Y A;  4MN3 A;  2UUB Q;  4V0B A;  2Q8T A;  3FRP B;  2NN6 G;  2XWJ B;  2KEN A;  1XJV A;  1X6O A;  4O2D A;  3C1E A;  3KUP A;  2B2W A;  2L5T A;  2XSC A;  4LF6 Q;  1EIY B;  3MHB A;  1XMQ Q;  1YNJ C;  2K33 A;  4CJ1 B;  2F0E A;  1HTP A;  1F2Y A;  1H9S A;  2RF4 A;  1JC7 A;  3RN2 A;  3DM3 A;  3I72 A;  4LF5 Q;  4RG1 A;  2H1E A;  2NUC A;  4X3U A;  2VQF Q;  2GVA A;  2ZTE A;  1AEX A;  2CHB D;  1C0A A;  1Y14 B;  5IP9 G;  2O5I C;  4CKB A;  5D65 A;  2CW0 C;  4GN3 B;  5E3F A;  2HHH L;  3HKZ B;  3NP8 A;  4HED A;  5D3I B;  1N36 Q;  2B2U C;  1NSN S;  3GTJ H;  5GRO A;  2YTY A;  3HOW H;  1ZYR D;  1DOM A;  2VS1 A;  4FXG C;  3A55 A;  1QOH A;  3GTJ B;  1VQH A;  2HIX A;  1A15 A;  5CBA E;  4ZKB B;  3CCU A;  3J81 j;  3WOE A;  1YI2 A;  1EWI A;  4A3M B;  1UEA B;  4B3R L;  3BYT B;  1K8O A;  1EY8 A;  3CAM A;  2UXD L;  4K8I A;  4ALP A;  4B3T Q;  4QQB X;  1VQ6 A;  2AWN A;  2K75 A;  4DR4 L;  3FEW X;  2VZA A;  2K5V A;  4A3M H;  2QW7 A;  3W1G A;  1UWV A;  3HFZ B;  4K5V A;  4GZY C;  2R92 G;  1JCK B;  3GTM B;  2UUB L;  3ND8 A;  3FVQ A;  3FKI B;  1SR3 A;  4RWS C;  4MZ9 A;  4XQN A;  1FJG Q;  3K7A H;  1G6P A;  1VQ8 A;  2L15 A;  2LXK A;  3HOY G;  1SNO A;  4DV5 Q;  4L8J A;  3FKI H;  2QKI C;  4O1N A;  2Z8L A;  1P8L A;  3K7A B;  1QNK A;  4HAE A;  5JJZ A;  3DEP A;  3NUC A;  4DAY B;  2BH8 A;  2F0T A;  3NK9 A;  4JI1 Q;  4DA2 A;  5JEA G;  5JAV A;  5IYC G;  1WCM H;  1KAB A;  1VQ4 A;  1HFN A;  2D62 A;  4DFA A;  4I7A A;  4DR1 Q;  2NWG A;  1EL0 A;  3OSO A;  1STN A;  4B9W A;  3MFY A;  2FMC A;  1JIC A;  3K6O A;  5EKK A;  3DWP A;  3TRE A;  1I4G A;  1JOK A;  2OT2 A;  4XYQ A;  2IJ0 A;  4OL7 A;  2Z4I A;  4DR3 Q;  4GLA C;  4FXD A;  4EQ5 A;  1UE7 A;  1SJE D;  3STB C;  2R93 G;  3HOV B;  3CXC A;  3CRK C;  1EIH A;  2NBF A;  3RNU A;  1DOK A;  5M3F H;  2B8G A;  1VS0 A;  2A6E D;  3PUX A;  2B39 A;  2KQ3 A;  1NY4 A;  1HQM C;  3GD7 A;  4M1U B;  3M85 A;  3GTG B;  1H9J A;  2F0G A;  4DV1 Q;  2F3W A;  3L3O C;  3HOX H;  2F4V L;  1XX8 A;  3ERQ A;  1EFW A;  2RDF A;  4ZQ3 A;  4H13 C;  1L0X B;  2WAQ E;  4KY5 A;  1XTC D;  4CKE A;  1G2S A;  2PO4 A;  1N36 L;  1QB5 D;  2F52 A;  4X64 L;  2PI2 A;  1TY2 A;  5IWA L;  3HOX B;  1VQL A;  4IJL A;  1BOS A;  2IWH A;  2RCN A;  5C4X G;  2RDG A;  1YNX A;  1CKO A;  4YCV A;  4CJ2 C;  1L1O A;  2VW9 A;  5DM7 3;  3N52 A;  1OXT A;  2K50 A;  4BXX G;  1SBB B;  4L5R C;  4FF3 A;  3WDN A;  2KOL A;  2JA8 B;  3RN5 A;  3I91 A;  1U4P A;  2IX1 A;  2WII B;  4XIG S;  4F88 A;  1HHV A;  3PIO 3;  4C1N K;  2NVX H;  3ICE A;  3Q0A A;  4KKT A;  2EPB A;  3A7L A;  1D8L A;  1PHJ A;  1JWU D;  3E6Z X;  2N88 A;  4GOP A;  1LAC A;  4X62 Q;  4DV3 L;  2N3S A;  1VCI A;  3GTK H;  1CKM A;  2NVX B;  3EFX D;  4TVA B;  2A69 C;  4DV0 L;  3B6Y A;  4A3E G;  2KCM A;  1K0R A;  3H6M A;  3HOY B;  1B50 A;  3VR4 A;  1N9W A;  2C9O A;  2B63 B;  2N49 A;  1EEF D;  4YWL A;  3M4Y A;  3PIO A;  2UUC L;  4HJ9 A;  3HOU B;  3GTK B;  3PF5 A;  3VR3 A;  1AN8 A;  2IX0 A;  1L2F A;  2UUC Q;  1PRT C;  4EQO A;  5CV4 A;  1TS3 A;  3FPU B;  4C1N I;  3T4A C;  3CPF A;  3MAQ A;  4XXE A;  2I5H A;  1EWH A;  1CUK A;  2EYM A;  1JB7 A;  3TBI B;  4JI8 Q;  1UEB A;  1WFQ A;  4RMF A;  4OIK A;  5KRU A;  1TS2 A;  2WB1 B;  1KDA A;  3S9W A;  3CCM A;  2AHO B;  1IBK L;  2A6H C;  4CJ0 B;  1YEZ A;  3PO2 G;  3AFQ A;  1N32 L;  4L63 B;  5EQ0 A;  1Y1V B;  2XIW A;  5C0X G;  3R3O A;  4DR2 Q;  1CHP D;  2AUJ D;  4ZUJ A;  1X9N A;  1N32 Q;  3ULP A;  4O0A A;  1B8A A;  2K14 A;  2F1M A;  3HS0 C;  4GNX C;  2KEC A;  5LL6 S;  1A3V A;  2Z6B A;  1B4O A;  1I94 Q;  2YTV A;  3TS2 A;  1SYB A;  3OPO A;  3S17 H;  1PYB A;  4Q0F A;  3LX0 A;  3I4O A;  1S5E D;  4LFC Q;  4PMB A;  2D0O A;  4FDB A;  1UAP A;  2P5Z X;  3GP7 A;  4LAA A;  3I55 A;  3S17 B;  1VQB A;  1UUP A;  5C6A A;  3T16 A;  3RLO A;  5HY6 A;  5CBE E;  3E9H A;  1WD1 A;  1IBM Q;  2OTL A;  3J7A 5;  1MD2 D;  1HNZ L;  3Q22 A;  5KIX A;  2YV5 A;  1L0W A;  1ZEQ X;  1EQR A;  3IFD A;  5IP9 H;  3S24 A;  5C0X I;  1TWA B;  3MTS A;  5M3M B;  1Q46 A;  2DY8 A;  2HUG A;  4KKU A;  2OEO A;  2G9H D;  4JBM A;  5M3M H;  2Z1C A;  2HDL A;  2BDO A;  2YYZ A;  4JYA L;  5FO9 B;  1O7L A;  3CRL C;  3D8G A;  3HOZ G;  2H5X A;  2KVM A;  5IOC A;  4FO2 A;  5JPN C;  5EKL A;  5IT9 E;  3D4W A;  4K0K Q;  2B2Y C;  4DV7 L;  1TWG H;  1XNR L;  3M4O H;  1PRT B;  3L0O A;  2B3G A;  2JYO A;  3U58 A;  2QDL A;  3TP7 A;  4AH6 A;  3MXN B;  3UI2 A;  4HID A;  3M3Y B;  1J6Q A;  3CP0 A;  5I4D A;  3M4O B;  1HNW L;  3F2U A;  4HIM A;  1V1P B;  4K5W A;  3S14 B;  2R7D A;  1BQQ T;  1NMG A;  1R4P B;  1MSG A;  2M00 A;  4GN5 A;  1GUG A;  2EIF A;  4S3S A;  1HQR D;  3I73 A;  1W6J A;  3A54 A;  5CC4 A;  1HR0 Q;  5ELN A;  2K01 A;  3M9B A;  1N33 L;  3AQQ A;  2XN9 C;  4K0K L;  3PQI A;  2M9V A;  4C3H G;  4FNF A;  1AE2 A;  2NB0 A;  1X55 A;  2F0V A;  2PCF B;  1SDF A;  2UXB L;  3CKI B;  4HR7 B;  4IJH A;  1HA5 A;  3H3V H;  1HZC A;  4A75 A;  3AMU A;  4GN4 B;  3MWY W;  3HP3 A;  5KYL A;  3CCJ A;  1EFI D;  2Z6K A;  2CWA A;  4J1M A;  1ONL A;  4UP8 A;  3PO2 H;  3CCL A;  2Y0S G;  4JI2 Q;  3CD6 A;  1KNE A;  3CME A;  2L11 A;  1XPR A;  3I2Z A;  4LFC L;  5KYI A;  3OOC A;  1YIT A;  2IW3 A;  4X3K A;  1NBW A;  1O7Y A;  4HTH A;  1A2U A;  1LTL A;  5LHY 1;  2JQO A;  4Z9C B;  2FFK B;  4CGY B;  5DEH A;  2WB1 G;  4A3E B;  1W2B A;  1LUZ A;  2KCN A;  2ENB A;  1A6X A;  4PNY A;  2BA1 A;  1XPU A;  4BA1 I;  3I4M H;  1CT1 D;  4K14 A;  2DJG C;  1FJG L;  4KMU C;  2QEX A;  4A3E H;  1K9M C;  4DXF A;  2E76 C;  2BCO A;  3BS1 A;  1TWF H;  4I65 A;  2JA6 G;  2Z9H A;  3NTH A;  1GUN A;  4TRD A;  5D3D A;  2VB2 X;  1I50 H;  4APV A;  2NTT A;  1K83 B;  2D0P A;  2F0P A;  1DON A;  3MFG A;  2V4D A;  4ZLT F;  4DN4 M;  3CPW A;  3H0G H;  4P74 A;  4F8M A;  3DMU A;  4BY7 B;  3GTQ B;  5TSS A;  2CQO A;  4GKJ Q;  1HRJ A;  3H0G B;  1GHJ A;  2JA5 B;  4JBK A;  2R7F A;  1VQF A;  4BY1 G;  1S40 A;  2PMZ B;  5COY A;  4BBR B;  1I4X A;  5C4Z A;  5KGU A;  4RA8 A;  5GAE C;  3TS0 A;  3K8A A;  3T1H Q;  3PUY A;  1IYJ B;  4QJF A;  1HUN A;  4DR7 L;  2CWP A;  1E24 A;  1WTO A;  4FF2 A;  1K8M A;  1WTR A;  1SFO H;  3OIP A;  1JJ2 A;  1DZ1 A;  3J80 c;  1R4Q B;  3I4M G;  2F4V Q;  1PH5 A;  4MTN A;  4LF8 Q;  1SYF A;  3DEO A;  4DR5 Q;  1SFO B;  1YNN D;  1HNX L;  4O42 A;  1PH8 A;  1CK1 A;  3FMC A;  1SND A;  4RAU C;  5BN5 A;  4DV2 L;  1SE4 A;  3UE1 A;  1N33 Q;  4IN3 A;  2E2D C;  4R8I A;  2RCF A;  2LFN A;  1GUO A;  4Q5V A;  4G7O C;  1S5F D;  5M5X H;  5M3M G;  1WTV A;  4L5S A;  4ME3 A;  1ASY A;  1WYD A;  3NBH A;  1HZ9 A;  4PMW A;  5JOB A;  1B9M A;  1WVL A;  2ICE C;  3PIP A;  4KY7 A;  2F0M A;  5I2X A;  4R1J A;  1WTW A;  2WAQ G;  4JOI A;  2B2T A;  3MXG A;  4LWC A;  1AZQ A;  3LNN A;  2CVR A;  1B70 B;  4G4K A;  1RJT A;  1LT5 D;  2J4X A;  4P72 A;  1HCZ A;  2O2L D;  4PZ6 A;  5EPK A;  3PIP 3;  4DR7 Q;  4DR6 L;  4ZAI A;  1N34 Q;  1Y69 U;  5IWA Q;  4XT1 B;  1PTO C;  4H02 A;  4ZK9 B;  3RUZ A;  2E8G A;  3E9I A;  1PRT F;  2Z6K C;  3FKI G;  2ZTC A;  4LF9 L;  4DV5 L;  3NPP A;  5BN4 A;  4KD4 A;  1VQ7 A;  1A3T A;  5IGB A;  5EPL A;  1BNZ A;  4XQQ A;  5C0X J;  5L37 A;  1IW7 C;  3ULJ A;  1CZW A;  3DLL A;  2F0N A;  1Q1B A;  1EYD A;  3V2T A;  4JI8 L;  3I70 A;  2EDG A;  3NBH B;  1VQK A;  3KFU A;  1L1O B;  1FNV A;  5C44 B;  1JOO A;  3PF4 A;  1Q12 A;  1Q8I A;  1U4R A;  1KL9 A;  4OGQ C;  4LF6 L;  1SYD A;  5K5P A;  3S16 B;  5CV5 A;  1O80 A;  4IOC A;  3GTP B;  1TS5 A;  2QEJ C;  1NR2 A;  2DJF C;  1PYW D;  2J0T D;  2KJX A;  2VUM H;  3S16 H;  2R93 B;  3HOW G;  2MHV A;  4ODG A;  2EYL A;  2Q8I B;  3CCQ A;  4MHE A;  3ITP A;  2EOT A;  2O5J C;  1EIF A;  1MJC A;  1TQO A;  1Q7Y C;  3I4N G;  1TS4 A;  3GV6 A;  4X66 L;  2PQA A;  1A3U A;  4CDF C;  3M7G A;  3PO3 H;  4YHH L;  4DV4 L;  1STH A;  1B7Y B;  1EZ6 A;  4GNX B;  3HOV G;  4A3G B;  5C4J H;  2DUD A;  3A8K E;  1A8V A;  4N9P A;  3SK6 A;  5GQO A;  4XQJ A;  4GKJ L;  2B8F A;  2MO1 A;  1HZA A;  2IX3 A;  3PO3 B;  1VQJ A;  2KHI A;  3L2P A;  2MGS A;  5DM6 3;  1X65 A;  5CMD A;  1SNP A;  2PZT A;  3W5O A;  3RZO B;  2AQ1 B;  4HSP A;  1IW7 D;  4FP5 D;  2E74 C;  1E1O A;  5LL6 X;  4DPG A;  1YJ9 A;  3X3M A;  4DKA C;  4QB4 A;  1D5M C;  1RF2 D;  3T1Y Q;  4IFD H;  2L55 A;  1KXL A;  3RZO H;  1SEB D;  1XNQ Q;  2JA5 G;  4A93 G;  3K5O A;  1MSH A;  1HNW Q;  1ET6 A;  4E6I A;  4M8A A;  4IUR A;  1U9R A;  4A3B H;  5HUR A;  1STA A;  1PTO D;  1SXT A;  1PTO F;  3PUZ A;  4IQZ A;  4DK6 C;  3NHH A;  3RLF A;  1F2L A;  1MHW C;  2F0L A;  1FNW A;  3U4V A;  1J8I A;  3CU7 A;  1MBY A;  2RKS A;  1IXR A;  1PTO H;  2IPK D;  2HIV A;  3HGB A;  3QG1 A;  3NWT A;  1EY4 A;  4PZ8 A;  2D9U A;  3ZJY C;  3PUV A;  4LF7 L;  1QZG A;  1C4Q A;  2MFI A;  4PG3 A;  1IBL Q;  3C3L A;  3G71 A;  3QJY A;  3G4S A;  2JA6 H;  3KJO A;  2JA7 G;  3AFP A;  5LMN W;  3X3N A;  1AE3 A;  3RR5 A;  4RH6 A;  5F2D A;  4RKB A;  1TWC H;  1SAP A;  3R8B A;  1HR0 L;  2V1C C;  1SNQ A;  1JQY D;  1G91 A;  2EJM A;  1X56 A;  3GTL H;  1EQT A;  3MXN A;  1E2Z A;  1WCM G;  2EYJ A;  3BJU A;  3DM1 A;  1FL0 A;  1TWC B;  2F4I A;  4A3J H;  1C7Y A;  2B2T C;  1K0S A;  1HR0 W;  1CQV A;  3FPP A;  3EQL C;  4MNO A;  2K28 A;  4K2K A;  1S5D D;  3GTL B;  4A93 H;  2DGY A;  5AJ3 L;  3TEH B;  3KDF A;  1GM5 A;  3BZC A;  1KQS A;  1AZP A;  1PV4 A;  1HZB A;  5ELC A;  2EVB A;  1CTM A;  2LY7 A;  1JJG A;  3N6R A;  2Z4H A;  4QY7 A;  3K0Y A;  4DGZ A;  4A93 B;  4A3J G;  2SDF A;  3OMC A;  2ZM6 Q;  1Q1E A;  4C3H H;  4IPC A;  1VQ5 A;  5C3E H;  2JE6 I;  3TN2 A;  3Q23 A;  1F2Z A;  4JI6 L;  1E3P A;  1IHZ A;  1UNS A;  3KF8 B;  3NTK A;  4C3H B;  2K5D A;  5I9P A;  1IKL A;  5C3E B;  4LFA L;  2K1B A;  1Q8K A;  3A56 A;  1TY0 A;  1RD9 D;  3U4Z A;  1D1I A;  4A3F H;  4YY3 L;  5FJ8 G;  3D31 A;  1X3F A;  5I9O A;  2JN4 A;  1OO9 B;  2Q8R E;  1KLG D;  4JPB W;  5BN3 A;  1PRT D;  4A3F B;  3HOW B;  4KHP L;  4R4O A;  4XTC S;  4HIO A;  2OWO A;  1JOR A;  4LF9 Q;  5IY0 A;  1MJE A;  3DWQ A;  2N78 A;  1D6E C;  4R4T A;  1FGU A;  4WJ4 A;  4IFD G;  5IYC H;  2B63 G;  3T1H L;  1C48 A;  3J81 L;  3L9A X;  3HOU G;  3JAM c;  1X3P A;  3IL8 A;  1E2W A;  2KBN A;  2K5H A;  3HKZ G;  1CI3 M;  2JA9 A;  4HN7 A;  4C56 C;  1D5X C;  4H44 C;  4LF5 L;  3VR2 A;  1F9P A;  1NR4 A;  4K8J A;  2XGT A;  1AFP A;  3S1M H;  2UUA L;  2NVY B;  3F2D A;  2CFM A;  2F3V A;  2KHJ A;  3VR6 A;  3ERS X;  1U4L A;  4WRD A;  4X62 L;  5I2Y A;  4NP5 A;  1DXM A;  1LT3 D;  2UUA Q;  3PO3 G;  3JAM E;  2JEB I;  4A3M G;  2R92 B;  2F0K A;  2PW5 A;  4DV6 Q;  2PZU A;  4QL5 A;  4RHR A;  1Y1V G;  3H0G G;  1VMP A;  1Y8P B;  4NMZ A;  5IGD A;  1FR3 A;  1GUT A;  3F8T A;  3D6W A;  2BA0 A;  3T13 A;  3CC4 A;  2AMC B;  3K59 A;  3D6C A;  4RHS A;  3UDI A;  3Q24 A;  2Q2U A;  4IFD J;  1BUV T;  2C5C A;  2E5L Q;  1GJX A;  4JCV E;  2F0I A;  2I46 A;  4P2C B;  1B53 A;  4RCN A;  1PH9 A;  1XTD A;  1CSP A;  2DNC A;  2K5W A;  4FF1 A;  1YVC A;  1ZYR C;  1X32 A;  3HOV H;  2CCZ A;  4RFB A;  1RHP A;  5M3F B;  3BDO A;  4YHH Q;  2ICI A;  4N9T A;  4UPA A;  4RGM A;  3F2C A;  3G7L A;  3VA7 A;  1GOZ A;  5T1I A;  5FJ8 H;  1I3Q H;  2ZJQ A;  2QCP X;  4UP7 A;  3BU2 A;  3MEH A;  4P71 A;  3LWU A;  4B3M L;  1QUQ A;  2K6A A;  1A2T A;  2HQE A;  3G6E A;  1KHI A;  1EOT A;  4NW2 A;  1HA6 A;  3CQZ H;  1M90 C;  1GHK A;  3E0E A;  2JEA I;  1ET9 A;  1MIU A;  4A3D G;  2XRS D;  4A3L H;  1SMY D;  3ONA B;  2JXM B;  2R7Z B;  2AQ2 B;  3BYY B;  4R4I A;  1X54 A;  1RTN A;  2J7Z A;  2AWO A;  1F9R A;  1EYA A;  2EY5 A;  1N34 L;  2KA7 A;  2X6G A;  5T1G A;  1EU4 A;  4KJN A;  1DJR D;  2RHS B;  2R7Z H;  2PQE A;  2I07 B;  5IYD H;  1BBU A;  3GTO H;  4C2M H;  1BF4 A;  2LKV A;  1KNA A;  3I4L A;  3EVQ A;  4B3S L;  1YIJ A;  1JJC B;  3S1R B;  4BY7 G;  4BY1 H;  5A2Q E;  3TP8 A;  4C2M B;  1EY9 A;  3BDL A;  3D4D A;  4DU9 A;  3S2D H;  3T56 B;  3NEL A;  3T51 B;  3HEJ A;  1CA6 A;  3OWE B;  5ELE A;  1IL8 A;  3HOX G;  4PMC A;  4PQX A;  1BBW A;  4BY1 B;  2HCI A;  3CW2 C;  3KOJ A;  1QVF A;  3P75 A;  1W6K A;  1HUM A;  4DF7 A;  4EX5 A;  3UDG A;  5JVG 3;  1PH3 A;  3MVV A;  4DAV A;  1SE8 A;  4HJ5 A;  3TP6 A;  4CDC C;  4IZ8 A;  3HOU H;  1LM0 A;  2HQL A;  2UXC L;  3H91 A;  2SNS A;  4F7X A;  2E2H H;  1AP0 A;  4A3F G;  1CQF A;  2MO0 A;  4GNX A;  3BZD B;  1A0I A;  4WJW A;  1I6V C;  4JBJ A;  4JI4 Q;  2F0J A;  5KNB A;  4OON A;  1F9Q A;  1V1O A;  2E2H B;  2RA4 A;  3IFT A;  3R2I A;  4NDX A;  3HKS A;  3NBI A;  3K81 C;  2OXP A;  4X6A H;  3KBX A;  3NQT A;  3P1H A;  1KTK A;  3J7A V;  1E2V A;  5IIF A;  1U0L A;  2EZV A;  3CCE A;  3PV0 A;  1MGS A;  1SYG A;  1CHQ D;  1QWY A;  4LF8 L;  1Y8N B;  2IL8 A;  4AYB B;  2ZXP A;  4GLV B;  1BR9 A;  2UXD Q;  1Y1V H;  5M5W H;  2EQS A;  5BR8 Q;  1PVO A;  2HHH Q;  1S4Z A;  3HG9 A;  2QDB A;  3LWE A;  3SEB A;  1X3G A;  3RZD H;  4C3I H;  3SXH A;  1IBL L;  2B2V C;  5M5W B;  1I4Q A;  1G29 1;  5IGE A;  1R9T H;  5M9O A;  4A3D H;  1H9R A;  3RZD B;  4C3I B;  1BCP D;  4IUT A;  1VQM A;  3M4P A;  1VQP A;  1I94 L;  4HIK A;  4HJ7 A;  1SNC A;  3W1B A;  1Q90 A;  5J3B A;  1LT4 D;  1B9N A;  4A3D B;  5AJ3 Q;  2KED A;  1Q81 C;  1PA6 A;  4GOP C;  1Q86 C;  3TZD A;  3AYH B;  1WTQ A;  2MUY A;  5COR A;  4GKK L;  2K5N A;  1ILP A;  1SN8 A;  2CH4 W;  2OQ0 A;  1C8C A;  5IOD A;  3U50 C;  2QA4 A;  4G57 A;  4BBS B;  3AEV A;  3A8I E;  1XNQ L;  2BE5 C;  3RD4 A;  4XYO A;  2QGQ A;  2NZH A;  1PH1 A;  5E4W C;  1TWA H;  5JPM C;  1OXX K;  4RKL A;  2VNU D;  2EYO A;  4BBS H;  1JE4 A;  1G6Z A;  1PYS B;  2D2C C;  4A3L G;  1WTP A;  1IYU A;  2XTI A;  2Y0S E;  3MXP A;  4KKS A;  2A19 A;  3KF8 A;  1LT6 D;  4JBW A;  2B2Y A;  2ZTD A;  4IPH A;  3DHQ A;  4ILW A;  1EY6 A;  1BVS A;  1LAB A;  3A0J A;  4LW1 A;  5HGQ A;  2JP1 A;  1STY A;  4HCE A;  2UXB Q;  2I5L X;  3E5S A;  1EQV A;  1PH4 A;  2EXZ A;  3NQI A;  3CCR A;  1YHA A;  4PV1 C;  2GA4 B;  1JOQ A;  3RMH A;  4DXG A;  1NJI C;  3AU7 A;  1WTH A;  4QMG A;  1QIL A;  2KCT A;  4A76 A;  3D4R A;  4KY6 A;  2L4N A;  3MXU A;  4J8Q A;  4OO1 G;  1FVI A;  1VQ9 A;  3M3Y H;  4X66 Q;  4JOI C;  2PMZ E;  4B08 A;  2C35 B;  2K7V A;  1IBM L;  1L0Y B;  1YNJ D;  1HNZ Q;  3BG3 A;  4DR1 L;  3S14 H;  5JJI A;  5JJL A;  3NSW A;  5D14 A;  1JWS D;  1V1Q A;  1O7Z A;  2Q2H A;  1LLR D;  4A3C H;  4YCU A;  1SSO A;  3TQY A;  4HMJ A;  4NXN L;  4A3B G;  4L5T A;  2ZT9 C;  1SLJ A;  2DNE A;  2A68 C;  4WOR A;  4KN7 C;  2ZJR A;  4G7Z C;  1TT2 A;  1IYV A;  4QGU A;  3WWV A;  2B2U A;  1SE2 A;  3QOL A;  2KEE A;  1WD0 A;  1VDZ A; 
#chains in the Genus database with same CATH homology
 4LF4 Q;  1N36 L;  2E2I H;  4JC0 A;  1RL2 A;  1E1O A;  2F52 A;  4X64 L;  2PI2 A;  3F2B A;  4DPG A;  5IWA L;  1YJ9 A;  1XNR Q;  1VQL A;  4IFD I;  3FHW A;  4DKA C;  4IJL A;  5FLM H;  2RCN A;  3T1Y Q;  2YU9 H;  1KXL A;  5C4X G;  3RZO H;  4OWT B;  4GS3 A;  1YNX A;  4NB3 A;  1XNQ Q;  2Q2T A;  2JA5 G;  4A93 G;  5LMU Q;  1HNW Q;  1CKO A;  4YCV A;  1L1O A;  2VW9 A;  4R4Q A;  1JMC A;  3OW2 A;  4A3B H;  3A5U A;  4AYB E;  1OXT A;  1PH7 A;  3PUZ A;  2K50 A;  4DK6 C;  4BXX G;  4L5R C;  3M4Q A;  3RLF A;  4AQY L;  3U4V A;  3F1Z A;  3EN2 A;  3RN5 A;  1GO3 E;  4KI0 A;  2IX1 A;  4DR3 L;  4XIG S;  2I5M X;  3KLW A;  1IXR A;  2NVX H;  3ICE A;  4JI1 L;  3S15 H;  3KYH C;  4AQY Q;  3CMA A;  2HIV A;  5IP7 H;  4BY7 H;  1D8L A;  1PHJ A;  4PZ8 A;  4DR6 Q;  4LUZ A;  3ZJY C;  3PUV A;  4GOP A;  4DAM A;  4LF7 L;  3J80 i;  4X62 Q;  4DV3 L;  2N3S A;  3A5Z B;  5BR8 L;  1VCI A;  1GKH A;  1QZG A;  4JYA Q;  3GTK H;  2MFI A;  3I4N H;  1CKM A;  1G51 A;  1KAW A;  4TVA B;  2JA5 H;  4DV0 L;  1YHQ A;  3B6Y A;  2JK8 A;  4PG3 A;  2KCM A;  4A3E G;  1K0R A;  3K7U C;  3S1R H;  4JI6 Q;  3L7Z C;  2RHQ B;  4A3I H;  1IBL Q;  1QVG A;  1K83 H;  1N9W A;  3G71 A;  1JT8 A;  2N49 A;  4BBR H;  4YWL A;  1NMF A;  3PIO A;  3G4S A;  1I5F A;  3OTO Q;  2UUC L;  2JA6 H;  3Q8D A;  3KJO A;  4YWM A;  3PF5 A;  2JA7 G;  2IX0 A;  3SGI A;  1L2F A;  3AFP A;  1SRO A;  5LMN W;  2HT1 A;  2R7Z G;  1YHB A;  5EAY A;  1PH6 A;  1AE3 A;  1Z9F A;  1OTC A;  2OTJ A;  3RR5 A;  2VL6 A;  1RIP A;  3GDE A;  3GTQ H;  2UUC Q;  1VQE A;  3I56 A;  2ATW A;  1S3O A;  1TWC H;  4A3G G;  3CPF A;  3PUW A;  1HR0 L;  2V1C C;  4JI0 Q;  2I5H A;  3KJP A;  1CUK A;  1X56 A;  4GOP B;  1TXY A;  1MKH A;  3GTL H;  4OWW B;  1JB7 A;  1WCM G;  4DR5 L;  3BJU A;  4JI8 Q;  3LGJ A;  1FL0 A;  2EXD A;  4BXX H;  1UEB A;  1WFQ A;  4RMF A;  4A3J H;  3TRZ A;  4JI5 L;  1C7Y A;  1GD7 A;  1HR0 W;  3CCM A;  4DV2 Q;  2AHO B;  4MNO A;  1IBK L;  1YBY A;  1YEZ A;  4A93 H;  3PO2 G;  2DGY A;  3STB D;  3AFQ A;  3KDF A;  3TEH B;  3BZC A;  3KF6 B;  5AJ3 L;  3J7Z C;  1PV4 A;  1KQS A;  1GM5 A;  4JI7 Q;  1HZB A;  1N32 L;  3CCV A;  1S72 A;  2Q2I A;  4BBR G;  1IBK Q;  1JJG A;  5C0X G;  4QY7 A;  4DR2 Q;  4B3S Q;  1VQN A;  1HJP A;  4A3J G;  1N32 Q;  3K0X A;  1X9N A;  1IL2 A;  3ULP A;  2ZM6 Q;  4O0A A;  1Y1W H;  1B8A A;  2K14 A;  4GNX C;  1Q1E A;  4C3H H;  4IPC A;  3T1Y L;  3CF5 A;  2E5L L;  1IZ6 A;  1VQ5 A;  5C3E H;  4POG A;  2JE6 I;  2WFW A;  4DV1 L;  4JI6 L;  1E3P A;  1I94 Q;  2YTV A;  1KRS A;  1Z47 A;  3S2H H;  1L1O C;  3MEF A;  3TS2 A;  3KF8 B;  2VY3 A;  3S17 H;  1PYB A;  1CKN B;  4JI3 Q;  4JI4 L;  4NXM L;  4LFA L;  3NEM A;  3I4O A;  1Q8K A;  5GAH C;  3U4Z A;  4A3F H;  4LFC Q;  4YY3 L;  5FJ8 G;  4JI5 Q;  5M3F G;  5IT9 c;  3D31 A;  2D0O A;  2K52 A;  3IRB A;  4FDB A;  1X3F A;  4GLX A;  3I55 A;  1KD1 C;  1KC8 C;  1VQB A;  5JJK A;  4DUZ Q;  4JI3 L;  3RLO A;  5HY6 A;  1YJN A;  5C44 G;  4KHP L;  4X65 L;  3E9H A;  4R4O A;  1IBM Q;  2OTL A;  3J7A 5;  4Y7N H;  4XTC S;  1HNZ L;  5FLM G;  3K80 C;  4HIO A;  2OWO A;  2YV5 A;  4LF9 Q;  5IY0 A;  1MJE A;  4AYB G;  1L0W A;  1EQR A;  2N78 A;  5IP9 H;  4DV0 Q;  2YTX A;  3S24 A;  1UE5 A;  5C0X I;  4R4T A;  3M7N A;  3J81 i;  4LNQ A;  1FGU A;  5H1S E;  3GTM H;  1Q46 A;  4WJ4 A;  2MQH A;  1XMQ L;  2K4K A;  4IFD G;  5IYC H;  2B63 G;  3T1H L;  4GKK Q;  4DV4 Q;  3HOU G;  3JAM c;  2NZO A;  2B29 A;  2GN5 A;  4R4C A;  2KBN A;  2R6G A;  4YCW A;  2K5H A;  3HKZ G;  5M3M H;  4JBM A;  3CC7 A;  2JA9 A;  1T9H A;  2YYZ A;  2FXQ A;  4JYA L;  1EYG A;  4WJ3 M;  1QVC A;  4LF5 L;  3KDF B;  4YWK A;  3HOZ G;  2H5X A;  2NVQ H;  4A3C G;  1JE5 A;  3CC2 A;  2XGT A;  4K0K Q;  1KRT A;  3S1M H;  2WP8 J;  4DV7 L;  2UUA L;  4JG2 A;  1TWG H;  4X64 Q;  3F2D A;  2CFM A;  1XNR L;  1XMO L;  1K3R A;  3UDX A;  2KHJ A;  3ERS X;  1DGS A;  3M4O H;  1J5E Q;  4BBS G;  4X62 L;  3L0O A;  1UE1 A;  2B3G A;  2UUA Q;  3PO3 G;  3G48 A;  5IYB G;  3U58 A;  1AH9 A;  4P75 A;  2JEB I;  4A3M G;  4AH6 A;  1YJW A;  2IY5 B;  3UDF A;  2LXJ A;  3MXN B;  4YY3 Q;  4HID A;  2R93 H;  1VQA A;  5C44 H;  1J6Q A;  3GO5 A;  3CP0 A;  1HNW L;  4DV6 Q;  4IPG A;  4UP9 A;  4QL5 A;  3PCO B;  2N8N A;  4HIM A;  1Y1V G;  1EUJ A;  3H0G G;  4DV3 Q;  4JI2 L;  2R7D A;  3KF6 A;  1NMG A;  3F8T A;  1QUQ B;  4GN5 A;  5K36 G;  5GAG C;  3GTP H;  2BA0 A;  1CSQ A;  2CKZ B;  3CC4 A;  2EIF A;  2AMC B;  2Q2U A;  3UDI A;  5C3E G;  4IFD J;  1E22 A;  2E5L Q;  1VQD A;  4IO9 A;  4JCV E;  5LMU L;  1HNX Q;  3ULL A;  3J81 c;  4QIW E;  1HR0 Q;  4JI0 L;  5ELN A;  2AKW B;  4A3G H;  2IHE A;  1PH9 A;  5E7N A;  1XTD A;  3M9B A;  3AQQ A;  5M5Y H;  1N33 L;  1X3E A;  1CSP A;  1VQG A;  4K0K L;  3GTG H;  1YVC A;  1AE2 A;  4OX9 Q;  1X55 A;  2ID0 A;  2JA8 G;  1WI5 A;  4X65 Q;  3HOV H;  2CCZ A;  4DK3 C;  2ZM6 L;  5LMN Q;  2UXB L;  4NPS A;  1E7Z A;  4IJH A;  2OQK A;  4YHH Q;  4L5Q A;  2E2J H;  2PQA B;  4OX9 L;  1HZC A;  4A75 A;  3H3V H;  4UPA A;  4GN4 B;  3F2C A;  2F3I A;  4POF A;  2A8V A;  1K8G A;  3CCJ A;  5FJ8 H;  1I3Q H;  2Z6K A;  2ZJQ A;  4KHP Q;  4UP7 A;  2CWA A;  1E1T A;  3BU2 A;  4P71 A;  5LMN L;  4UP8 A;  1QUQ A;  4B3M L;  3CCL A;  2Y0S G;  3PO2 H;  4JI2 Q;  3RLN A;  3G6E A;  3CD6 A;  1H95 A;  4DV7 Q;  1KHI A;  3CME A;  3UE0 A;  4JV5 Q;  3PGZ A;  1XPR A;  1I6H H;  1NE3 A;  1SMX A;  3CQZ H;  3I2Z A;  4LFC L;  1YIT A;  1M90 C;  4QQB X;  3H15 A;  1NBW A;  3E0E A;  4B3T L;  2JEA I;  3FP9 A;  1LTL A;  4A3K H;  1MIU A;  1PH2 A;  4A3D G;  2JQO A;  4J15 A;  4BA2 I;  4A3L H;  2JJQ A;  4DUY L;  2WB1 G;  1WOC A;  4OWX B;  1LUZ A;  1W2B A;  2JA8 H;  4R4I A;  1V9P A;  1X54 A;  2BA1 A;  1OXV A;  1XPU A;  2AWO A;  4BA1 I;  1N34 L;  3I4M H;  4Y52 H;  1W3S A;  1CKN A;  1FJG L;  4LFB L;  1VQI A;  2RHS B;  2R7Z H;  2NN6 I;  2QEX A;  4A3E H;  1QZH A;  5IYD H;  1P16 A;  1BBU A;  1K9M C;  3GTO H;  4C2M H;  2PNH A;  2OCE A;  1TWF H;  2JA6 G;  4DUZ L;  5IE8 A;  4B3S L;  1YIJ A;  1O7I A;  1JJC B;  1K8A C;  5FLX c;  4BY7 G;  3HOY H;  2ALY B;  4C3J H;  1WJJ A;  1I50 H;  4APV A;  4BY1 H;  3JC6 6;  2B63 H;  2D0P A;  1ASZ A;  3CPW A;  3S2D H;  3H0G H;  4AIM A;  4P74 A;  1YZ6 A;  1PFS A;  1NTG A;  3EIV A;  3NEL A;  4PZ7 A;  3HOX G;  1Q82 C;  1V43 A;  1BBW A;  1UE6 A;  3CW2 C;  1C9O A;  3KOJ A;  1EQQ A;  1QVF A;  4DR4 Q;  2CQO A;  5IYB H;  3VDY A;  4GKJ Q;  4EX5 A;  3UDG A;  3PSI A;  2VQF L;  1J5E L;  1U5K A;  4JBK A;  1XPO A;  1PH3 A;  2R7F A;  1VQF A;  4BY1 G;  1S40 A;  3NEN A;  1SE8 A;  5DLQ E;  4HJ5 A;  3HKZ E;  5C4X H;  2MNA A;  5GAE C;  3TS0 A;  3HOU H;  1LM0 A;  2HQL A;  3K8A A;  2UXC L;  1HH2 P;  1LYL A;  3PUY A;  3T1H Q;  1IYJ B;  1VQC A;  3D0F A;  4QJF A;  2CWP A;  4A3F G;  1E24 A;  2E2H H;  2MO0 A;  4GNX A;  4DR7 L;  3JAM i;  1SRU A;  1A0I A;  5GAD C;  3BZK A;  4LUV A;  4JBJ A;  4JI4 Q;  2UUB Q;  1SFO H;  1JJ2 A;  3J80 c;  2NN6 G;  4OON A;  5ELO A;  1VQO A;  3I4M G;  2KEN A;  4B3R Q;  2F4V Q;  1XJV A;  1PH5 A;  1X6O A;  4MTN A;  4LF8 Q;  4O2D A;  4DNI A;  3HKS A;  4LF6 Q;  3K81 C;  1EIY B;  4DR5 Q;  4LF4 L;  1D7Q A;  1XMQ Q;  4X6A H;  1HNX L;  1PH8 A;  4DV2 L;  1U0L A;  2Z0S A;  3CCE A;  3PV0 A;  2RF4 A;  4IPD A;  3UE1 A;  3RN2 A;  4LF8 L;  3DM3 A;  1N33 Q;  4A4I A;  4LF5 Q;  4RG1 A;  2VQE L;  4GLV B;  4P73 A;  2VQF Q;  2UXD Q;  2GVA A;  2ZTE A;  1Y1V H;  5M5W H;  5IYD G;  5M5X H;  5M3M G;  4L5S A;  2EQS A;  5BR8 Q;  1PVO A;  4ME3 A;  2HHH Q;  4LF7 Q;  5JEA J;  1WYD A;  1ASY A;  1HZ9 A;  1Y14 B;  5IP9 G;  1C0A A;  1X3G A;  4PMW A;  3S1Q H;  3RZD H;  4C3I H;  3H3V I;  1IBL L;  2GVB A;  4GN3 B;  3PIP A;  2HHH L;  4R1J A;  1G29 1;  2WAQ G;  1N36 Q;  4JOI A;  1GVP A;  1R9T H;  3GTJ H;  4A3D H;  5GRO A;  2YTY A;  3HOW H;  2PI2 E;  1VQM A;  3M4P A;  4LWC A;  1VQP A;  1I94 L;  4OO1 I;  4OXP A;  4HIK A;  2VS1 A;  4HJ7 A;  3W1B A;  1B70 B;  5J3B A;  1VQH A;  4P72 A;  4LFA Q;  2HIX A;  5AJ3 Q;  1Q81 C;  1TWH H;  3CCU A;  3J81 j;  4PZ6 A;  4GOP C;  1PA6 A;  4DR7 Q;  4DR6 L;  3CCS A;  1YI2 A;  1Q86 C;  1N34 Q;  3AYH B;  1EWI A;  4DR2 L;  4B3R L;  2BH2 A;  4GKK L;  5IWA Q;  1N8R C;  2K5N A;  1SN8 A;  2OQ0 A;  3CAM A;  4H02 A;  2UXD L;  3U50 C;  1K73 C;  2QA4 A;  2E8G A;  4ALP A;  3E9I A;  3AEV A;  4B3T Q;  2IHF A;  4KHZ A;  3FKI G;  2Z6K C;  2AWN A;  2K75 A;  2ZTC A;  1XNQ L;  1EOV A;  2VZA A;  1VQ6 A;  4DR4 L;  2K5V A;  1A62 A;  2QGQ A;  4A3M H;  4LF9 L;  3W1G A;  2NZH A;  1UWV A;  3HFZ B;  4DV5 L;  1PH1 A;  4JV5 L;  2UU9 L;  1TWA H;  2R92 G;  1VQ7 A;  1OXX K;  2WB1 E;  2VNU D;  4BBS H;  2UUB L;  1Y1W G;  1PYS B;  3S1N H;  2VUM G;  3EBE A;  1SR3 A;  5C0X J;  4MZ9 A;  4NXM Q;  4A3L G;  2XTI A;  2Y0S E;  1FJG Q;  3K7A H;  1G6P A;  1VQ8 A;  2L15 A;  2LXK A;  1XMO Q;  2UU9 Q;  2VQE Q;  3OYY A;  3HOY G;  2A19 A;  3ULJ A;  4DV5 Q;  2ZTD A;  4JBW A;  4IPH A;  3DLL A;  1Q1B A;  1BVS A;  3A0J A;  3FKI H;  4LW1 A;  5HGQ A;  4JI8 L;  1VQK A;  1P8L A;  3NBH B;  3KFU A;  2UXB Q;  1L1O B;  2I5L X;  2ES2 A;  1PH4 A;  3PF4 A;  3CCR A;  1YHA A;  1Q12 A;  4DV6 L;  1KL9 A;  4DAY B;  4LF6 L;  2UXC Q;  2BH8 A;  4HJA A;  2NVY H;  4JI1 Q;  5JEA G;  5IYC G;  1NJI C;  1WCM H;  4IOC A;  1VQ4 A;  4DUY Q;  1OXS C;  2D62 A;  2NVT H;  4LUO A;  2KCT A;  1OXU A;  4A76 A;  4B3M Q;  4A3K G;  2VUM H;  4OO1 G;  2ZJP A;  1FVI A;  4DR1 Q;  4HJ8 A;  3S16 H;  1KIX A;  1VQ9 A;  3ER0 A;  2JA7 H;  4LFB Q;  1A63 A;  2R92 H;  3HOW G;  4X66 Q;  4JOI C;  3M3Y H;  2PMZ E;  5IP7 G;  1M1K C;  2C35 B;  3TRE A;  3CCQ A;  3A74 A;  1IBM L;  3HOZ H;  1HNZ Q;  4UY8 C;  4DR1 L;  3S14 H;  4JI7 L;  4DR3 Q;  4GLA C;  1EIF A;  1UE7 A;  4EQ5 A;  5JJI A;  1BKB A;  1MJC A;  5JJL A;  1Q7Y C;  3I4N G;  1V1Q A;  3STB C;  2R93 G;  2Q2H A;  3CXC A;  4A3C H;  4X66 L;  2PQA A;  3RNU A;  2I0Q A;  5M3F H;  2ASB A;  4YCU A;  4A3I G;  3PO3 H;  4IOA A;  3TQY A;  1VS0 A;  4NXN L;  4YHH L;  4A3B G;  4DV4 L;  4L5T A;  1B7Y B;  1SLJ A;  3PUX A;  4KLK A;  4GNX B;  3HOV G;  5C4J H;  1NY4 A;  2DUD A;  1A8V A;  2ZJR A;  2LSS A;  5GQO A;  4GKJ L;  2MO1 A;  1HZA A;  4QGU A;  2IT1 A;  3GD7 A;  1VQJ A;  3I7F A;  3OTO L;  3WWV A;  3M85 A;  2KHI A;  4NXN Q;  3L2P A;  2A1A A;  4DV1 Q;  3HOX H;  1X65 A;  2F4V L;  4TQU S;  1EFW A;  3W5O A;  2WAQ E;  4HJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...