1G6PA

Solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN TMCSP
publication title Solution NMR structure of the cold-shock protein from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1g6pA00
2N49A 3H3VI 3S24A 1SFOH 4JOIA 1Q7YC 2F3IA 1E7ZA 2KBNA 2LXKA 2AKWB 1S40A 3HOWG 4A3DH 1AH9A 1YBYA 4YY3Q 1P8LA 3ULJA 3EN2A 4JI3L 1HNXQ 4LF9L 3S16H 1SE8A 4LFAQ 2EQSA 1QUQB 2D0PA 2R7FA 5AJ3L 1Q81C 1XNQQ 5IYDH 1VS0A 1D7QA 1I94Q 2HT1A 2AMCB 1V43A 3GTPH 3HOYG 3L2PA 1VQFA 4DUYQ 4XTCS 3CCQA 1AE2A 4YCUA 3G71A 1PV4A 1OXSC 2L15A 2OWOA 2VQFQ 1KRSA 2NZOA 2K4KA 4LW1A 4JI7Q 4A93H 2CKZB 4JYAL 5IP9G 4DR1L 2Z6KA 3KYHC 4X66Q 3CCEA 3CCMA 1VQMA 1YZ6A 1HZ9A 1V9PA 3PUWA 5C4JH 4DV3L 2I5LX 1XNRL 1N34L 4HIKA 1N8RC 4B3TQ 4DPGA 2JQOA 1EIFA 1N9WA 1X56A 1WJJA 2PQAA 3IRBA 3STBC 2UUAQ 4DUZL 1X3EA 1PH8A 4GLXA 1PA6A 4JI2L 3F2DA 4DV0Q 4LF6L 1P16A 3TQYA 4QJFA 4IJLA 5FLMH 4MTNA 1XPUA 3K80C 2KENA 2B63H 1I3QH 2JA5G 5IWAL 1W2BA 4BY7G 2D0OA 2F4VQ 5EAYA 4C3IH 3KF6B 2UXDQ 4JI0L 1J6QA 3RZDH 1FVIA 3NELA 3LGJA 1VQLA 5C3EG 4O0AA 1C7YA 2R93H 3NBHB 1YIJA 4GKJQ 3U50C 4KHPQ 4O2DA 4A3FH 1VQ6A 4BBRG 1VQDA 2VQEL 2MO1A 1JJCB 3I7FA 4KI0A 3F1ZA 5M5XH 2WP8J 4A3LG 4UP7A 3HOVH 1YHBA 5FJ8G 2R92H 2ES2A 1YVCA 2NVXH 1KXLA 1PH7A 4DR7Q 2R7ZG 5GADC 3M85A 1HNWL 1X55A 3K81C 3RN5A 2VZAA 4HJ7A 2HHHL 3J80i 4BY1H 4QQBX 1LTLA 2UUBQ 2AHOB 2R6GA 3CAMA 4QGUA 3T1HQ 4A3DG 5JJKA 3I4OA 3B6YA 1KRTA 4IPCA 1Y14B 3PUXA 1OXUA 2UXCQ 4P75A 4B3RQ 3UDXA 3F2BA 3H15A 5IYDG 1TWFH 1X65A 3DM3A 1MKHA 1IBKL 2MO0A 4IPGA 1VQOA 1G6PA 4A76A 3ZJYC 2RF4A 4UY8C 1FJGQ 4KLKA 3CP0A 2NVTH 4JI4L 3L7ZC 4LF7Q 3CQZH 3HKZG 5JEAJ 1OXTA 1YITA 4MNOA 1B8AA 4APVA 2K5VA 1NJIC 5IY0A 5ELOA 3J81j 1HNZL 1AE3A 2Q2HA 4A93G 4JBKA 1NBWA 3AEVA 3CC2A 1KC8C 3BJUA 3F8TA 1XMQQ 5IT9c 1EWIA 5LMNW 4AIMA 1VQAA 3PO3H 2R7DA 1IBMQ 1PFSA 3J80c 1E24A 1EYGA 3KJOA 3T1YQ 4LUOA 4R4OA 2Q2TA 3CCVA 2Z0SA 4A4IA 1T9HA 1HNXL 1H95A 5FLMG 1XNQL 1VCIA 2Q2IA 2XTIA 4LFAL 4JC0A 2B63G 2KHIA 1QVGA 5J3BA 3PUZA 1OXXK 4MZ9A 4OXPA 1SLJA 4P71A 1R9TH 1I94L 2Z6KC 4POGA 1Z9FA 2ZM6Q 3S2HH 2KCTA 3ER0A 3KLWA 4PMWA 1SMXA 5M5WH 4DUYL 2CFMA 1S72A 1NE3A 4JI5Q 1JT8A 2Y0SE 5M3MH 1YEZA 1CSQA 3CXCA 1VQGA 2VQFL 3S1RH 1OXVA 1Q82C 4JI7L 3AYHB 4OX9Q 3CF5A 4LUZA 2R92G 3HOVG 4JI6Q 3CD6A 4GLVB 4JBJA 3J7ZC 1JMCA 2ATWA 3HOZH 1FL0A 4GN3B 4BY1G 2HIVA 2K75A 4DR2Q 2AWOA 4B3TL 2E8GA 5M5YH 3CC7A 2R7ZH 3JC66 5JEAG 2UUAL 4PZ8A 2I5HA 3BZKA 3FHWA 4NXMQ 2K14A 5DLQE 4AYBG 2ASBA 4XIGS 3I4NH 4GN5A 1SRUA 1O7IA 4P72A 3CCSA 4LUVA 4DV0L 3EBEA 1CKNB 2VNUD 1IZ6A 4PZ6A 3KJPA 4NXNQ 4IFDG 4B3MQ 2JA6H 2JA8H 4LF8Q 3A74A 2F4VL 2UXDL 1BVSA 1X3GA 2N3SA 1VQ5A 1Q86C 3PUYA 5IYCH 5GROA 3WWVA 3MEFA 2UUCQ 2VUMH 4IFDI 4A3GH 1K73C 4GKJL 1L0WA 3ERSX 4KHPL 1EIYB 1M1KC 3NENA 2EIFA 2MNAA 3OTOL 2AWNA 4K0KL 3HFZB 4GN4B 4R1JA 3VDYA 1N32Q 3ULLA 4PZ7A 4DR4Q 2VW9A 3PO3G 4JV5Q 1KL9A 1JE5A 2UUBL 4HIMA 4GLAC 3HKZE 1PH2A 2QEXA 1WYDA 2PI2E 3CC4A 3T1HL 3M4OH 2JA9A 1NTGA 5IYBH 4LFCQ 2UXCL 4UPAA 4B3RL 3L0OA 1YHAA 2JA6G 2JA7H 2GVBA 5LMNQ 1VQNA 2K50A 1W3SA 3GD7A 4LF5Q 3E0EA 1JB7A 2E2HH 1VQCA 4IJHA 4Y7NH 3TEHB 3TS2A 3UDGA 1C9OA 4LF7L 2B3GA 3S1NH 5M3MG 4R4CA 3KF6A 3CMAA 1PH3A 1KHIA 1TWCH 3PUVA 2A8VA 3GTLH 1I50H 1EQRA 4JI1Q 2PQAB 5K36G 3PSIA 2UXBL 1Q46A 2V1CC 3H0GH 3KDFA 1XMQL 4A3JH 4GKKQ 3D0FA 3HOZG 1X3FA 3S1MH 4LFBQ 2ALYB 4C2MH 1PYBA 3GTKH 2BH2A 4P74A 4DV2Q 1IBML 3F2CA 3RZOH 1VQ7A 1HZCA 3PV0A 1Q1EA 3CPFA 3T1YL 1LM0A 2F52A 4L5TA 2RCNA 1L1OA 5HGQA 1ASZA 3PF5A 3I4NG 3AFPA 4NPSA 4NB3A 1QZHA 2ZJRA 2YTYA 1I6HH 3UDIA 1IL2A 4RG1A 4DAMA 1YJWA 3I55A 2JA8G 4BXXH 3PCOB 1LUZA 3U58A 4L5RC 2JE6I 1A0IA 5IYCG 4HJ8A 2VUMG 2VS1A 1TWAH 2ZM6L 4X62Q 4A3IH 1V1QA 4A3GG 4DV1L 2GN5A 1YHQA 1PH6A 4AYBE 4IOCA 4JI5L 1GO3E 4GNXA 2RHQB 1NY4A 3GTOH 3CCLA 3PO2H 3W1BA 4OX9L 1TWHH 4GOPA 4JOIC 1M90C 1XNRQ 4IPHA 1EQQA 2IX1A 4YHHQ 1HZBA 2CWAA 4QY7A 3W1GA 4DV6Q 1VQPA 1Q8KA 4IFDJ 1U0LA 1QVCA 4DR2L 3RLOA 2YTXA 4BBSH 2QGQA 2KHJA 4A3CH 3GDEA 4YCVA 4LF4L 1BKBA 1XMOQ 4OWXB 5IYBG 2E5LQ 3S15H 3ULPA 2CWPA 3S2DH 1WCMG 3ICEA 4DR5Q 2JA7G 2YU9H 1N33Q 4X65Q 4NXNL 1YJ9A 4YY3L 4B3ML 4B3SQ 5BR8Q 4DR6Q 2A19A 5GAHC 4DV5Q 4DV7Q 4LF8L 1HR0W 1ASYA 1Y1WH 1XPOA 4C3JH 3PIOA 1YJNA 4DKAC 4HJ5A 2UUCL 2NN6G 3FKIH 2ZTCA 4BA1I 1VQ9A 1CKOA 3NEMA 1VQIA 2OQ0A 1HJPA 3K8AA 3OYYA 4X64Q 5LMUQ 3RR5A 2BA0A 1KAWA 1DGSA 3H0GG 1SN8A 4A3JG 4TQUS 2NN6I 1N32L 1Z47A 1PYSB 2H5XA 4DR4L 1K83H 2ID0A 4OWWB 4JV5L 3KF8B 4X66L 2D62A 4R4IA 2B29A 1E22A 1VQ8A 5IE8A 3SGIA 1X9NA 3K7AH 1EUJA 2BH8A 2JJQA 2K5NA 1BBUA 1UE6A 2BA1A 2JEBI 1PHJA 3S17H 3I4MH 4A3EH 1FGUA 3E9IA 1JJGA 2UU9Q 5LMNL 4BXXG 2IY5B 4ME3A 4H02A 3J7A5 4LF5L 2I0QA 2IHFA 3CCRA 3CW2C 4C3HH 4A3IG 3HOUH 1CKNA 3E9HA 3A5ZB 4FDBA 4ALPA 1J5EQ 1XPRA 2HQLA 3PO2G 1QUQA 2N8NA 5HY6A 5C0XG 2YV5A 1I5FA 4JI1L 5FLXc 2PMZE 4QL5A 4HJ9A 4AQYQ 4A3BH 1L1OC 4Y52H 1G291 1LYLA 5JJIA 4DR3Q 3W5OA 1QZGA 4GKKL 2N78A 5GQOA 3J81c 4LFBL 2K5HA 1L2FA 2IT1A 4UP8A 5C0XI 3S1QH 2XGTA 4DV2L 3GTMH 4DR7L 4BBSG 4LNQA 4A3CG 2FXQA 3G4SA 3MXNB 5C4XG 1Y1VH 3JAMc 3CCJA 2JK8A 5M3FH 1CKMA 3I56A 4TVAB 4GNXC 2LXJA 3STBD 1WCMH 5IP7H 3M4PA 1Y1WG 4GOPC 2WAQG 1RL2A 4R4QA 4X62L 4JBMA 1K8AC 3FKIG 1VQEA 2WB1G 3HOXG 1N36Q 2C35B 4KHZA 3GTGH 2E2IH 1FJGL 4OWTB 1KD1C 3GO5A 4JBWA 1HZAA 4DV4Q 3M3YH 3RNUA 2CCZA 3TREA 1GM5A 1YNXA 1VQKA 1HR0Q 3PF4A 2ZJQA 2VY3A 4A3MH 2MFIA 4YHHL 2ZJPA 3A5UA 1XTDA 4JI8Q 1SROA 1UWVA 4DV6L 1IBLQ 4OO1G 1EFWA 4EX5A 3DLLA 2YTVA 3EIVA 5C44H 1XMOL 5ELNA 1A62A 2Y0SG 1E3PA 4AH6A 2E5LL 3M9BA 3RLFA 3M7NA 4A3KH 3TS0A 4OO1I 3I4MG 4A3EG 4DR5L 4DK3C 2DGYA 2A1AA 2LSSA 4X65L 3CPWA 4JI3Q 1N33L 2DUDA 1K8GA 4LF9Q 1HH2P 4LWCA 4B3SL 5BR8L 1A63A 4OONA 4YWMA 5AJ3Q 1U5KA 1PH1A 1SR3A 4DV5L 4DV7L 4DR6L 3HOUG 1X6OA 1EOVA 4YWLA 4YWKA 5GAEC 2QA4A 4IOAA 3BZCA 1MJEA 3KDFB 4DK6C 1C0AA 1QVFA 2MQHA 2OQKA 3OTOQ 1Q12A 4K0KQ 4X64L 2NVQH 1PVOA 2OCEA 4IPDA 3U4VA 1E1TA 5LMUL 4A3BG 1X54A 2NZHA 5E7NA 4JYAQ 2OTJA 5H1SE 1L1OB 3H3VH 3AFQA 4DR1Q 3UE1A 3KFUA 1WOCA 1XJVA 4RMFA 4X6AH 4DV3Q 3A0JA 3KOJA 1JJ2A 4JI6L 2VL6A 1N34Q 3G48A 4DNIA 4L5QA 1YI2A 3K0XA 3S14H 1Q1BA 1Y1VG 4R4TA 4DUZQ 5M3FG 3RN2A 1UE1A 1NMGA 1BBWA 4JI2Q 3HOWH 2GVAA 1G51A 4P73A 5C4XH 4NXML 2PNHA 4LF6Q 2UU9L 1OTCA 4WJ4A 4IO9A 5IP7G 2ZTDA 5C0XJ 3I2ZA 1GKHA 4GNXB 2YYZA 5IWAQ 1K0RA 4JI0Q 1MJCA 4GOPB 2PI2A 4HJAA 1J5EL 1MIUA 2K52A 5JJLA 4DAYB 2I5MX 3HOYH 1TXYA 3K7UC 2VQEQ 3HOXH 2UXBQ 4AQYL 3UE0A 1PH4A 1TWGH 5GAGC 4DR3L 4A3MG 4L5SA 2NVYH 4UP9A 1UE5A 1E1OA 2IHEA 2WAQE 5IP9H 4JCVE 1VQJA 3BU2A 1HNWQ 2KCMA 3J81i 1IYJB 2WB1E 2HHHQ 2JEAI 4PG3A 1B70B 5C44G 2ZTEA 1S3OA 4JG2A 1PH9A 3PGZA 3G6EA 2WFWA 4A3KG 4POFA 1IXRA 1B7YB 1CUKA 1UEBA 2CQOA 2HIXA 3FP9A 3UDFA 3JAMi 2Q2UA 1UE7A 2IX0A 3GTQH 2E2JH 1WI5A 4WJ3M 1CSPA 4LFCL 1KIXA 4YCWA 1RIPA 1NMFA 2OTLA 2R93G 4HIDA 1IBKQ 2JA5H 4BY7H 4DV1Q 4A3FG 1D8LA 3HKSA 4BA2I 3RLNA 1N36L 3AQQA 3OW2A 4EQ5A 5C3EH 4JI4Q 1VQ4A 1WFQA 3D31A 1PH5A 1VQHA 3Q8DA 4QIWE 4J15A 4DV4L 4BBRH 1KQSA 1HNZQ 1GD7A 2EXDA 3PIPA 3U4ZA 4HIOA 3CCUA 1K3RA 4A75A 1K9MC 1HR0L 4A3LH 4GS3A 5FJ8H 3M4QA 4JI8L 1A8VA 3CMEA 3GTJH 1IBLL 3TRZA 1VQBA 2RHSB 4LF4Q 1GVPA
chains in the Genus database with same CATH superfamily
1SFOH 1VMCA 3RMHA 1TS4A 4A3DH 1S40A 1YBYA 3BVMA 4CDCC 3EN2A 4LF9L 5AJ3L 4LFAQ 5IYDH 1ET6A 1SNPA 2EE1A 4TRDA 4RCOA 5IODA 1V8QA 1VS0A 1I94Q 1TU2B 2E75C 1AE2A 4KKUA 5AFWA 1OXSC 2EPBA 2OWOA 5C4XB 2K4KA 4LW1A 5C3XA 3OIPA 4A93H 4JYAL 3M4YA 3FPPA 3CCEA 1TKWB 5C4JH 2I5LX 1DD2A 4HAEA 5J39A 4HIKA 3C3LA 4DPGA 1X56A 3HOYB 1PA6A 3F2DA 4LF6L 2XWJB 4IJLA 5DEHA 5CV6A 5IWAL 1W2BA 5M9OA 3KF6B 1RKNA 5FO9B 4JI0L 3A7LA 1VQLA 4KHVA 5C3EG 1LABA 1TT2A 4KHPQ 4A3FH 2VQEL 2K05A 3BG3A 4KI0A 4R8NA 3SK5A 2Y0SB 4A3LG 4OHJA 4UP7A 3HOVH 1YVCA 2NVXH 1EQVA 2K5DA 4DR7Q 2R3ZA 3K81C 2HHHL 4QQBX 2N88A 2VB2X 2RA4A 2FMMA 3HOUB 3Q6SA 1CZGA 1AFPA 1KRTA 4IPCA 1OXUA 4P75A 2F4IA 4FVMA 2QKIC 1IBKL 4X3SA 1JORA 1ICWA 2K03A 3SK6A 1G6PA 2XVSA 1FJGQ 2NVTH 3J7AV 3L7ZC 4A3DB 5CBAE 2MHVA 1SYCA 2K5VA 3J81j 1LT6D 2N55A 1NBWA 1YNND 3AEVA 3CC2A 3SHLA 3BJUA 1ILQA 4AIMA 1UAPA 3PO3H 4V0BA 1XXGA 1HQMC 3R2TA 1I6VC 3CCVA 1U4PA 1NAPA 1EFID 5DAUA 1UNSA 4A93B 1F77A 4LFAL 2B63G 4JC0A 4KY5A 5J3BA 3PUZA 1TY0A 1D2BA 1RD9D 4MZ9A 5C4JB 1I94L 3EVQA 2Z6KC 3EA6A 2A68D 3ER0A 1RF2D 1STAA 2JP1A 1VQGA 2E2DC 2F3VA 3CF5A 4A3KB 1PTOF 3CD6A 3J7ZC 1JMCA 1FL0A 3NWSA 4KJOA 3JC66 2I5HA 4A3FB 4QCLA 1B3AA 4NXMQ 2ASBA 5DLQE 3QJYA 4AYBG 4GN5A 3CCSA 1X32A 1CKNB 3HP3A 1IZ6A 4PZ6A 5I2YA 3KJPA 3HOVB 4B3MQ 2NVXB 4LF8Q 2A74C 2HUGA 1Q86C 5IYCH 5GROA 4CKCA 1MGSA 5EGTA 4KHPL 1EIYB 1PZJD 4HEDA 2NZ1D 1DOLA 4GN4B 4UHVA 1RTOA 3I8ZA 2IW3A 5FLXE 2J7ZA 1JCKB 1SYEA 3J81E 4HIMA 1CHQD 1PRTC 1BCPB 1SYFA 3MVVA 1GUWA 4LFCQ 3TDQA 3L0OA 3CHBD 1V1PA 2JA6G 3GV3A 2GVBA 3V05A 1JOQA 3KLSX 2F0FA 5F2DA 2K50A 3GD7A 3E0EA 1E2WA 4ILWA 1CA5A 1IKMA 3PO3B 1SNMA 2KOLA 1JB3A 2B3GA 3K5OA 2IWHA 1BDOA 1STNA 5J22A 1GUNA 1KHIA 2A8VA 2PQAB 5K36G 3BYTB 2UXBL 1Q46A 1LTGD 3CRKC 4CHTB 5EJWA 4GKKQ 4C2MH 2MJ8A 2EJFC 4DV2Q 2FINB 2IX3A 4KV6A 1VQ7A 3RZOH 4ODGA 1LM0A 4S3SA 2MGSA 1I4PA 3A54A 3FDTA 1L0XB 5CGKA 2JA8G 4RG1A 4DAMA 3SE0A 3I55A 3PCOB 4QUFA 2JE6I 4IFDH 2EYMA 2DJGC 4A3IH 2F0SA 4A3GG 4DV1L 1YHQA 1PH6A 4AYBE 2PQEA 4IOCA 1FNUA 1CQVA 1WTHA 3J7AF 3WDNA 1TWHH 1XNRQ 1MBYA 3T56B 4IUNA 4RWSC 3RLOA 2YTXA 4KJNA 4A3CH 1BKBA 2EZVA 5JPNC 2CWPA 1WCMG 3TP8A 2PPBC 4FF1A 4YY3L 4B3ML 3MXPA 1PYWD 4DR6Q 2WACA 1PDQA 1I4XA 3DHQA 5G3LD 4LF8L 2NTTA 3D4DA 1XPOA 2RDGA 2AQ3B 3I4LA 4HJ5A 2NN6G 3C46A 1D5MC 1CKOA 3HS0C 3K6OA 5CBEE 1VQIA 3OYYA 3VA7A 2CW0D 1ZKOA 4IQZA 1QOHA 1TY2A 3KF8B 4X66L 3NQTA 1EU4A 2I46A 3MAQA 1H9JA 3J80E 5COYA 2JJQA 5T1IA 1EQTA 3NSWA 2A6HC 4GZYC 1FGUA 1LV9A 3C1FA 2EYLA 5E4XA 3FVQA 2F0EA 3CW2C 3E9HA 1CQFA 1TQOA 3RZOB 4FO2A 2HQLA 5HY6A 5FLXc 2RKSA 4QL5A 2BDOA 4A3BH 1L1OC 5JJIA 3W5OA 4GKKL 1SNDA 5GQOA 1O7ZA 1T5EA 3J81c 1Y69U 4DV2L 3LNNA 3GTMH 4HN7A 4A3IB 1KTKA 5C4XG 2MUYA 1CKMA 5DNFA 2KJXA 1TWHB 1NCVA 1CZWA 1G8ZD 3I72A 4FP5D 2BOSA 4WFN3 2E2IH 2R61A 2X6GA 5I4DA 2QDLA 3PF4A 2D2CC 2ZJQA 2TMPA 3I73A 1I4QA 1U4LA 3FEWX 4JI8Q 1AZPA 1IBLQ 4C56C 1EFWA 1WTOA 2JXMB 3MC0B 3NUCA 3EIVA 1JR0D 5ELNA 2Y0SG 2C5CA 3RLFA 3IFTA 3M7NA 4OO1I 3TS0A 1A3VA 4CKBA 1VDZA 4JI3Q 1K8GA 4DR6L 2Z4HA 1TIID 4C3HG 3HOUG 1X6OA 1EOVA 4YWLA 4YWKA 3JAML 3K59A 4DF7A 1CHPD 5ELDA 1Q12A 5L37A 4IPDA 1LACA 3U4VA 1X54A 3K57A 4QIWB 5H1SE 5C0XH 3NTHA 1WOCA 2F0JA 2DY8A 3KOJA 4JI6L 2G9HD 2VL6A 4UDUC 1N34Q 1Y1VG 3LX0A 1UE1A 1NMGA 1BBWA 4IN3A 4L63B 3H3VC 2G5DA 4A3BB 4KD3A 5IP7G 1GKHA 1IHZA 2AQ2B 2EY5A 1S5BD 3DEOA 4GNXB 3HEJA 1WTQA 3SEBA 3F2UA 1GJXA 2PI2A 4XDXA 1MIUA 3TSSA 3K7UC 2A73B 1TWGH 4A3MG 5IGGA 4G7ZC 1UE5A 1FD7D 2RSNA 2KCMA 3J81i 1B2TA 4Q5VA 3EFXD 1B70B 1PH9A 2KHSA 2E2IB 3G6EA 2WFWA 1WTXA 4A3KG 4QMGA 4FXDA 1UEBA 4K14A 2Z1CA 2E2JH 5D65A 1NMFA 1L0YB 2WKDA 2JA5H 4BY7H 1QB5D 3A55A 4A3FG 1NUCA 3OOCA 1VQ4A 1WFQA 3D31A 1VQHA 1EYDA 4BBRH 2EXDA 4HIOA 1SYDA 1K9MC 4GS3A 3M7GA 5KRUA 2F0QA 1EY8A 4JI8L 1A8VA 1IBLL 3GTJH 2N49A 3H3VI 3S24A 3T16A 1FNWA 1ENAA 2B39A 2AKWB 3HOWG 2L1BA 1A3UA 1SAPA 1P8LA 4JI3L 1VMPA 1W6KA 3OPOA 1SE8A 1PRTD 2X6LA 1Q81C 4I65A 4G7OC 1KLGD 4U68A 4XTCS 4DUYQ 5I2XA 4YCUA 2VQFQ 3K0YA 2NZOA 5FKAC 4JI7Q 1SE2A 3TP6A 1VQMA 3CCMA 1HZ9A 1BQQT 2A69D 1N34L 5E4WC 5IGEA 1N8RC 2JQOA 1EIFA 2PQAA 3STBC 1V1PB 1WJJA 1EY5A 1LTSD 1PH8A 4ZAIA 1JICA 4DV0Q 3J81L 2SDFA 1P16A 1TWGB 3E0JA 3K80C 2KENA 3K5LA 1EOTA 5JJZA 3QOJA 2D0OA 4C3IH 1FVIA 5K5PA 1YIJA 3U50C 3SR1A 1H9KA 4G4KA 2E2JB 5M5XH 1YHBA 2R92H 1TR5A 3OIQA 3E3XA 1X55A 2LS01 4WORA 2JA5B 4BY7B 2VZAA 3J80i 2MP1A 2UUBQ 4IUQA 4K8IA 3L3OC 1HCZA 3CAMA 3T1HQ 1ONLA 3PUXA 4DA2A 4BBRB 2UXCQ 3QOLA 4B3RQ 1SSOA 1V1OA 2QW7A 2B2UA 3DM3A 1HRJA 3PQIA 1B3QA 1VQOA 2SEBD 3GTJB 4A76A 2HCCA 2RF4A 1OXTA 4APVA 5EBDA 2C9OA 2WKCA 3A7AB 1NJIC 1KC8C 2RDHA 1K3BC 1IW7C 1VQAA 1LT4D 2R7DA 1IBMQ 1E24A 1EYGA 4EQPA 4LUOA 2Q2TA 3LWEA 4WJWA 1SE4A 1PFBA 1CTMA 4L6TB 4A4IA 5FLMG 2XTIA 1LTRD 1F9SA 4OXPA 1SLJA 1R9TH 2A6HD 1Z9FA 2ZM6Q 3S2HH 2KCTA 4PMWA 4DUYL 4J8QA 2XNAC 1NE3A 1YEZA 1KDBA 2VQFL 4RKBA 4JI7L 4LUZA 2EYPA 4MTKA 5C5MA 4JBJA 2L0CA 3A8IE 2ATWA 3HOZH 4BY1G 4C3IB 4TKOB 3NXWA 2KCNA 2WINB 2AWOA 3CC7A 5JEAG 3DUZA 4IUVA 1II3A 3I4NH 1EZ8A 2HQEA 1JE4A 4DV0L 4LUVA 4OIKA 3EBEA 5M5XB 2LY7A 4IFDG 3J80L 2KEDA 2R92B 1FYCA 5EKLA 5EKIA 1VQ5A 4RGMA 3GQBA 2UUCQ 1K73C 1M1KC 3NENA 1EWHA 3Q0AA 2AWNA 5D3IB 4R1JA 3ULLA 1ESFA 1ML0D 2UUBL 4F7XA 3T1HL 3M4OH 1Y8NB 2J0TD 3VYTA 2F0HA 3N52A 1BCPF 2UXCL 4B3RL 2B2VA 3JAME 1BO0A 2JA7H 2KECA 5LMNQ 1F9RA 1VQNA 3K58A 4LF5Q 4DAVA 2LMCB 1VQCA 2F3WA 3P20A 1EY6A 4IJHA 4Y7NH 3BVZA 5M3MG 2PZWA 3E5SA 3NTIA 1PH3A 1TWCH 4DNRB 3GTLH 4JI1Q 1LTBD 3H0GH 3D0FA 1Y8OB 1X3FA 4LK1C 3S1MH 1PYBA 3GTKH 4ZQ3A 2BH2A 4P74A 1EWCA 1R9TB 1IBML 2HDLA 3S2HB 2ZXRA 4DAPA 4ABNA 3BVGA 1BBXC 5HGQA 3AFPA 2YTYA 5C5LA 1I6HH 1PFMA 1YJWA 4BXXH 1LUZA 3HOZB 1MD2D 4HJ8A 2VUMG 2ZM6L 3R3OA 4IZ8A 2RDFA 3HGBA 1AP0A 1W6JA 5IGBA 1SFOB 4GNXA 1NY4A 3CCLA 3I4NB 3W1BA 1M90C 4IPHA 4LJZC 3KK7A 3OSOA 4MHEA 1R4PB 4BBSH 3GDEA 5LHY1 4LF4L 1XMOQ 2CH4W 5IYBG 2E5LQ 3S15H 3ULPA 1N33Q 4X65Q 3HKZB 5BR8Q 5GAHC 4DV7Q 1HR0W 1ASYA 5JPMC 1Y1WH 3PIOA 2UUCL 5ELBA 3KUPA 3SK4A 3FKIH 4XXEA 2VXWA 3M4OB 3NEMA 1QE6A 1RDPD 5LMUQ 3FPUB 1DGSA 3T51B 2JA7B 1SN8A 4HSPA 4TQUS 2NN6I 4A3JG 1Z47A 1PYSB 2H5XA 3SK8A 2PW7A 2NUCA 1CI3M 1VQ8A 5IE8A 2F0GA 2BH8A 5DM63 3IKJA 1PHJA 3GTLB 2H1EA 3I4MH 1JJGA 2UU9Q 5LMNL 3H0GB 4KN4C 4ME3A 4H02A 3J7A5 1ZEQX 4LF5L 2I0QA 3S1MB 3GTKB 2IHFA 3CCRA 1K8MA 5CV4A 4CGYB 3MA2B 3PO2G 2N8NA 5C0XG 2YV5A 4JI1L 4IURA 3NK9A 2PMZE 3NP8A 1G291 1LYLA 1I6HB 2NBFA 2K5HA 1F2YA 3BDOA 1C4QA 5KIXA 3G7LA 2EJMA 4DR7L 4LNQA 2EY2A 3VR3A 4Z9CB 4K6LA 1X3PA 2NVTB 3JAMc 5M3FH 4ULLA 4XYQA 2DN8A 3STBD 2F0DA 2EYOA 3M4PA 4GOPC 4C3JG 4R4QA 4JBMA 1K8AC 3J7YW 4BBSB 2C35B 1FJGL 4OWTB 1A3TA 4JBWA 3M3YH 4DV4Q 2CH4A 2TSSA 2CCZA 2A69C 3DWPA 1YNXA 4XQNA 2B2WA 5CV8A 4C1NK 3A5UA 1XTDA 2EXZA 1C48A 2HD3A 2F03A 4KKSA 2DNEA 4EX5A 3PIP3 3DLLA 4ZYSA 2YTVA 2WB1B 1SBBB 3BZDB 5C44H 1XMOL 1A62A 4AH6A 4ME5A 1E0BA 2E5LL 2VNUD 4A3EG 1N33L 4X65L 3DWAA 4ZK9B 1M8AA 1HFGA 5BR8L 1U5KA 1SR3A 4DV7L 4KK7A 3BZCA 1QILA 1IYUA 2MQHA 3OTOQ 4K0KQ 3V2TA 4EVOA 2OCEA 5LMUL 4RCNA 3I4MB 2NZHA 4L8JA 3H3VH 1L1OB 4DR1Q 2SNSA 4RMFA 3A0JA 3CKIB 1S5FD 2EVBA 5FO8B 2KVMA 3S14H 4QF4A 4R4TA 1HFNA 3VYSA 3RN2A 1BXTA 4JI2Q 1IW7D 2F0KA 2GVAA 1NR2A 4NXML 3OWEB 2PNHA 2UU9L 3QO2A 4OEMB 3BDCA 3I3CA 4HTHA 3DMUA 1DJRD 3DM1A 1K0RA 1BOSA 2O5IC 2D9UA 2PCFB 2MPMA 2VB3X 5M3FB 2F0UA 3HRZC 1QNUA 3A8KE 1E1OA 2EJGC 5I6WA 1HNWQ 2IPKD 3FRPB 3OMCA 5C6AA 1UEAB 1S3OA 1U4MA 4POFA 1B7YB 1IXRA 1CUKA 2CQOA 3TBIB 3JAMi 3M3YB 2OT2A 3TP7A 3GTQH 2IX0A 3VR4A 5I6YA 4LFCL 1RIPA 1HA6A 1CFMA 4H44C 4DGZA 4ZUJA 4BA2I 4C2MB 4HCEA 5CV7A 2B2TC 2Q8TA 3RLNA 3W2DA 4EQ5A 5C3EH 4JI4Q 1DONA 4O1NA 3Q8DA 4R8IA 2IJ0A 4DV4L 1KQSA 3PIPA 2K6AA 1I4RA 1K3RA 4KY6A 4A3LH 3MWYW 3CMEA 3SVMA 3ERQA 4EQNA 1Q7YC 4ZKCB 2LXKA 2KBNA 3TN2A 3BS1A 4K5VA 1AH9A 3ULJA 1HNXQ 1XNQQ 2R7FA 1PZKD 1ZYRC 4O42A 2HT1A 1SJED 2F0TA 3S14B 3HOYG 1KABA 4LMQD 4HR7B 1ILPA 1KRSA 1J8IA 4DFAA 2CKZB 5IP9G 4DR1L 2Z6KA 1A2TA 3PUWA 1XNRL 2OXPA 4KN7C 4B3TQ 3IL8A 3URYA 1N9WA 1QJOA 3IRBA 2UUAQ 3K5MA 2B2YC 2SNMA 2EYJA 5G3LF 1KNEA 4GLXA 4JI2L 4PMBA 1GUSA 4QJFA 2B63H 1I3QH 4IUTA 5EAYA 4N9PA 3RZDH 3NELA 3LGJA 5JOBA 1C7YA 4O0AA 2R93H 2ICIA 5DM73 4GKJQ 3O13A 4RGOS 2NYZD 2XIWA 1VQDA 1PTOC 2I07B 3GTQB 3I7FA 3F1ZA 5FJ8G 2ES2A 2Q8RE 1HNWL 3M85A 4HJ7A 4DK0A 1STEA 1KAAA 5C3EB 1G2SA 4NMZA 4QGUA 4A3DG 1G91A 3B6YA 5BN3A 1CM9A 3SDZA 3H15A 5IYDG 1TWFH 2ICEC 1I4GA 1X65A 1MKHA 5JAVA 4QUCA 2F1MA 1WVLA 3ZJYC 4UY8C 4K8JA 3EQLC 4KLKA 4XQQA 5CV5A 4JI4L 1PMRA 3GTMB 4LF7Q 5JEAJ 3HKZG 1A6XA 1YITA 4MNOA 1B8AA 3LWUA 1DXMA 5IY0A 4H13C 4A93G 1HQRD 1STYA 3GP7A 4K5XA 1SJHD 2L55A 1Z6HA 3MZ5A 4X3UA 1WTVA 1PFSA 1YNJC 5LL6S 3P7JA 3J80c 3T1YQ 1Q3LA 1EEID 3OMGA 1LTTD 4I7AA 1HNXL 1H95A 1XNQL 2JA6H 2Q2IA 2KHIA 3KLSA 4POGA 1SMXA 1B53A 5M5WH 2CFMA 1EIHA 2Y0SE 5KEEA 1B9NA 3S1RH 4ZRZA 4OX9Q 3HOVG 1B4OA 5K36H 1SYGA 1M4VA 2RQXA 2B63B 4V190 1S5CD 2HIVA 2F0WA 2K75A 3RZDB 4DR2Q 3WOFA 4B3TL 2E8GA 5M5YH 2R93B 2R7ZH 3NQIA 2UUAL 1KDCA 4PZ8A 1EEFD 3BZKA 5IT9L 2K14A 4KY7A 1LTAD 1SRUA 1O7IA 4P72A 3QR8A 4RGTA 4NXNQ 1SNQA 4K6DA 1HPCA 2JA8H 1BVSA 4RH6A 2KCCA 3PUYA 1STBA 4IFDI 1BNZA 3T13A 4A3GH 4GKJL 1L0WA 3ERSX 3VA5A 2EIFA 4AYBB 3HFZB 1LT3D 1D5ZC 1GOZA 5IOCA 1TWFB 2GA4B 4P2CB 4PZ7A 3PO3G 4BWGB 2F0LA 1JE5A 4GLAC 3HKZE 1PH2A 2QEXA 1WYDA 2PI2E 2JA9A 1YHAA 3T4AC 2SOBA 1B50A 4N8X1 2ZXOA 2FMCA 5IGDA 5KYIA 2E2HH 4JVZA 1KDAA 2L11A 4DNTB 1U9RA 3TEHB 1AN8A 3UDGA 1C9OA 4LF7L 3S1NH 2NN6H 1D1IA 3MEHA 4R4CA 4FNFA 4LAAA 1F2LA 1I50H 2AUJD 2JA6B 4LFBQ 2ALYB 2XRQD 5E3FA 2DY7A 3VYRA 1HZCA 3PV0A 1Q1EA 3T1YL 4L5TA 5M5WB 1H9SB 2RCNA 1UUPA 1L1OA 4NW2A 3PF5A 3S9WA 4NB3A 3S1RB 1QZHA 4YIJA 1STGA 3U58A 4L5RC 1B44D 4JK1C 5IYCG 2O4XA 2AQ1B 1TWAH 4RGNA 4X62Q 1HUNA 5M5YB 4G57A 4FF2A 2R7ZB 3PMFA 1G2TA 1DM0B 1SXTA 5D14A 3BDLA 5IGCA 5CV9A 3C2PA 4OX9L 3AMUA 4JOIC 3E6ZX 2A6EC 2JA8B 4YHHQ 4QY7A 2KQ3A 4DV6Q 1VQPA 1Q8KA 1F2MA 1U0LA 1QVCA 5J1ZA 4DR2L 1LO5D 1TS3A 2QGQA 2KHJA 4A3GB 2XSCA 2HDMA 4B9XA 1PRTF 3ICEA 4DR5Q 3QIAA 1QNKA 1JWUD 4NXNL 1YJ9A 2A19A 2QDBA 4DV5Q 3IAYA 1T5XD 2EYHA 2M9VA 1R4QB 1YJNA 4EQOA 1HA5A 1STHA 4RAUC 2ZTCA 5I9PA 4QB4A 1VQ9A 3KLRA 3C1EA 2OQ0A 4X64Q 2NTSA 2BA0A 1KAWA 1WD1A 1GXDC 4BS9A 1LTID 3NPPA 3MTSA 2ID0A 2O5JC 3TMEA 4F87A 4R4IA 5T1GA 1E22A 1B1ZA 4PQXA 3SGIA 3X3NA 1X9NA 2K5NA 5EPLA 3S1NB 2K5WA 1QWYA 1C8CA 1HHVA 1UE6A 3AB9A 3D8GA 1I50B 5EBCA 3S17H 4Q0FA 2IY5B 2L5TA 3SXHA 2PO4A 3HOUH 4C3HH 4A3IG 3A5ZB 5HURA 1J5EQ 3A56A 4HCSA 1XPRA 4KTAA 5CORA 1ZYRD 4DU9A 1RTNA 1I5FA 2K33A 4AQYQ 4JPBW 2B8GA 1QZGA 3PIO3 5FOBB 4LFBL 1L2FA 2IT1A 4UP8A 5C0XI 3S1QH 2XGTA 1ESRA 1TWAB 4A3CG 2FXQA 1Z7TA 2CHBD 3MXNB 5CYUA 1Y1VH 5A2QE 2JK8A 4TVAB 2LXJA 5IP7H 3I70A 2RSOA 2ZXPA 4DXGA 4OELB 4N8FA 1RL2A 5EPJA 4X62L 5CMDA 1SNCA 3UI2A 3K5NA 4IUPA 1D6EC 3GO5A 3RNUA 1XTCD 1K0SA 3TREA 1GHJA 1IKLA 4CJ1B 1GUOA 2VY3A 4A3MH 2MFIA 5ELFA 4YHHL 1EY7A 4CDDC 4DV6L 1WTWA 1SROA 1SEBD 2XRSD 4B08A 1WTRA 1MSGA 2LFNA 1PTOD 2X69A 1MHWC 2EY6A 4CJ0B 3KBGA 1E3PA 2WV6D 3M9BA 4A3KH 4DR5L 4DK3C 2LSSA 2EDGA 4ID6A 1HH2P 1A63A 1PH1A 2FJ2A 4DV5L 3MFGA 2NB0A 2ZT9C 2WIIB 3HG9A 4M1UB 5GAEC 2QA4A 3KDFB 2JN4A 1C0AA 2K7VA 1QVFA 2OQKA 5KGUA 4X64L 2NVQH 1PVOA 1O78A 1EZ6A 5EKKA 2Z6BA 4A3BG 3S17B 5E7NA 2PW5A 3AFQA 3KFUA 2EOTA 1XJVA 4DV3Q 1JJ2A 4C3HB 4H0LC 4L5QA 1D1KA 3K0XA 1JWSD 1Q1BA 5C4ZA 4DUZQ 2RCFA 3HOWH 1G51A 1KLUD 1PRTB 1EL0A 4KMUC 3ZYYX 1OTCA 1YNJD 4IO9A 2ZTDA 3N6RA 2Z9HA 3S1QB 4WRDA 2DJFC 4GOPB 4HJAA 1J5EL 3TZDA 2K52A 1BF4A 4DAYB 2I5MX 1Y1VB 2L12A 1SE3A 2DNCA 3HOXH 2UXBQ 4AQYL 1PFNA 5NUCA 2PZTA 4L5SA 2NVYH 3H94A 1RCVD 2IHEA 4C1NI 2JYOA 1VQJA 3BU2A 3D6CA 2D5DA 2F0NA 1IYJB 5IT9E 4NKLA 4PG3A 5A35A 1HUMA 4OO1H 3PGZA 3ND8A 4Y7NB 2Q2UA 3UDFA 1UE7A 2PNRC 1CSPA 1KIXA 4YCWA 1TWCB 4A3MB 2OTLA 2R93G 2E76C 2K32A 1DCZA 4DV1Q 1DYQA 3AU7A 1Q8IA 1D8LA 4RHSA 3OW2A 4DK1A 1PH5A 4QIWE 4J15A 1E2ZA 1HNZQ 3MHBA 4JW0A 1TVXA 1NR4A 3QB3A 1JOOA 2BCOA 1KNAA 4CDEC 2RHSB 1GVPA 1SMYC 4JOIA 4HMIA 3G6JB 2F3IA 1E7ZA 2NVQB 4YY3Q 1TS5A 3S16H 2EQSA 1QUQB 2D0PA 3HZXA 2BDNA 1D7QA 1D5XC 2AMCB 1V43A 1GUGA 1G6ZA 2PYKA 3L2PA 1VQFA 4FYDA 3CCQA 1AEXA 3G71A 1PV4A 2L15A 3HOWB 2K04A 1FR3A 4B9WA 3S15B 4EGVA 5IGFA 3KYHC 2NWGA 4X66Q 1YZ6A 1V9PA 4DV3L 2CVRA 3CRLC 4IUUA 3D4WA 1DOMA 3Q24A 2BE5C 1Y1WB 2O2LD 2WAQB 4DUZL 1X3EA 1F2ZA 3FKIB 3HOXB 2QF7A 3P75A 1PTOH 4XT1B 3TQYA 5KNDA 5FLMH 4MTNA 2NVYB 1XPUA 4FF4A 1GHKA 5JVG3 2JA5G 4BY7G 1H9SA 5HGTA 2F4VQ 2UXDQ 1J6QA 4G7HC 4RFBA 3NBHB 4O2DA 1VQ6A 2EY1A 1TS2A 4BBRG 3MXUA 2KUMA 3TZUA 2MO1A 1JJCB 3DWQA 2WP8J 4XYOA 1KXLA 3TP5A 1PH7A 2R7ZG 5GADC 3OWFA 3RN5A 1BUVT 4BY1H 1LTLA 2AHOB 2R6GA 3P1HA 3VYUA 5JEAH 2A6ED 5JJKA 3I4OA 1Y14B 1U4RA 3UDXA 1EYCA 4N9TA 1O7YA 3V96A 4PMCA 3F2BA 1X3QA 2MO0A 4IPGA 2M00A 4DN4M 3L9AX 3QG1A 3CP0A 5FO7B 1ZXTA 5TSSA 3CQZH 2J4XA 4XQJA 4FXGC 4DXFA 4OGQC 3R93A 1HNZL 5ELOA 1AE3A 2Q2HA 4JBKA 3S16B 3U9SA 3F8TA 1XMQQ 1LLRD 5IT9c 1EWIA 5LMNW 3VR2A 5D3DA 4KD4A 3T53B 1BCPC 3KJOA 4R4OA 3IFDA 2Z0SA 4ZLTF 3RUZA 2L9HA 1T9HA 1VCIA 5BN4A 1QVGA 1EY4A 4C3IG 1OXXK 1EY9A 4P71A 3KLWA 1S72A 3MXGA 1WD0A 2KA7A 2FHTA 1JQYD 2PZUA 4JI5Q 1JT8A 5M3MH 1CSQA 3CXCA 2G9DA 5C44B 1OXVA 1PTOB 1Q82C 3AYHB 1O7LA 2R92G 3QWNA 4ZKBB 1IL8A 4JI6Q 1A15A 4GLVB 2RVLA 2Z4IA 4GN3B 1XWEA 3VR5A 3FHWA 3D4RA 4XIGS 3NTKA 1GUTA 1PZID 3MXNA 3A74A 2F4VL 2UXDL 1X3GA 2N3SA 4BY1B 3WWVA 2LKVA 3MEFA 3ND9A 2VUMH 1DZ1A 4NP5A 2MNAA 3OTOL 4K0KL 3VDYA 4XT3B 1N32Q 2P5ZX 1HTLD 2V4DA 3DEPA 4DR4Q 2VW9A 4M8AA 4JV5Q 1KL9A 2B2UC 5ELCA 4CBVA 2KEEA 3CC4A 5EPKA 3CQZB 1SYBA 3H6MA 1NTGA 5IYBH 4UPAA 3I90A 3ONAB 4MN3A 1W3SA 5A2QL 2Z8LA 3Q22A 1JB7A 1ICFB 4NDXA 2K1BA 1S5DD 5CC4A 3TS2A 2L4NA 3KF6A 1AZQA 4HMJA 3CMAA 4CKEA 2B8FA 3PUVA 4RA8A 1EQRA 3PSIA 1SDFA 2V1CC 3KDFA 1XMQL 4A3JH 2FFKB 2IL8A 3HOZG 4FXKC 5I9OA 3F2CA 3H91A 3CPFA 2F0OA 2F52A 1ASZA 5M3MB 3I4NG 3NE5B 5IIFA 1QCBD 4NPSA 2ZJRA 3UDIA 1IL2A 2XN9C 1Q90A 1XX8A 1HTPA 1A0IA 2OF1A 2VS1A 1V1QA 1RODA 2GN5A 3FMCA 1DOKA 4JI5L 1GO3E 2RHQB 3GTOH 3PO2H 1H9RA 1B9MA 4GOPA 4PV1C 1EQQA 2IX1A 2PMZB 1HZBA 2CWAA 4DAYA 3W1GA 3WOEA 4IFDJ 3RD4A 3R8BA 2VUMB 1HXYD 1NSNS 4RKLA 4YCVA 5KNCA 2RBMA 4OWXB 4IALA 3S2DH 4FF3A 2H4OA 2JA7G 2YU9H 4B3SQ 3ITPA 1FGBD 1NNXA 4PNYA 4C3JH 1YNNC 1S4ZA 4DKAC 1LT5D 1IYVA 4BA1I 3NWTA 4HSVA 1HJPA 3K8AA 5E1FA 3RR5A 3H0GG 3A8JE 1N32L 2QILA 1S5ED 2B2VC 4DR4L 1K83H 2A5HA 4KKTA 4OWWB 4JV5L 2D62A 1I3QB 1VF7A 2B29A 3D3RA 1RHPA 4F88A 2XWBB 3K7AH 1EUJA 3BYYB 1BBUA 2BA1A 3I91A 2JEBI 4UAIA 4A3EH 2A68C 3E9IA 3W3AA 4BXXG 1SMYD 4A3JB 5KYLA 1WTPA 3CU7A 1CKNA 4K2KA 4FDBA 4ALPA 4X3KA 1MI2A 1PXUA 1JWMD 2QEJC 3R2IA 1QUQA 1CK1A 2CQAA 4Y52H 4HJ9A 4DR3Q 4R9WA 2N78A 1EY0A 4K2LA 4BBSG 2F0PA 5ELEA 3G4SA 3Q23A 4ZCKA 1QG7A 2QCPX 4TSSA 3CCJA 3X3MA 3GTOB 1F9QA 3PO2B 3I56A 4J6HA 5BN5A 4GNXC 3GV6A 2BE5D 1WCMH 1Y1WG 2WAQG 1PLFA 2Q8IB 3FKIG 1VQEA 2WB1G 5KNBA 3HOXG 4KHZA 1N36Q 3GTGH 3MFYA 1BR9A 1KD1C 3S2DB 4RHRA 1HZAA 2YU9B 1GM5A 1EIGA 1EU3A 1VQKA 3DXJC 1HR0Q 4X3TA 2JSOA 1K8OA 3NBHA 2ZJPA 2B2TA 1A2UA 4OO1G 1VF5C 1UWVA 2F0VA 4C3JB 5ISRA 5FLXL 1CA6A 4E6IA 4H7BA 1OO9B 3I4MG 3CPWA 2DGYA 2A1AA 3GTPH 2DUDA 4LF9Q 1ENCA 4LWCA 4B3SL 4K5WA 4OONA 4YWMA 5AJ3Q 5JVH3 1K83B 3OW7A 1ET9A 4IOAA 3KBXA 1MJEA 4DK6C 5C3WA 3K7AB 3EROA 4CDFC 1E2VA 2ENBA 4CJ2C 1I4HA 1E1TA 5C4HA 4A3EB 2F0IA 4J1MA 4JYAQ 2OTJA 1Y8PB 3EJIA 1K28A 4X6AH 3UE1A 3OHXC 4F8MA 2EYFA 1SNOA 4U673 3G48A 4DNIA 1YI2A 3VR6A 5M3FG 3NHHA 3NBIA 1MSHA 4P73A 5C4XH 1EYAA 1F9PA 4LF6Q 4WJ4A 5C0XJ 1BCPD 3I2ZA 1JC7A 5FK9C 2YYZA 1J9OA 5IWAQ 5CR3A 4JI0Q 1MJCA 2B2YA 5JJLA 1JOKA 4OIJA 3HOYH 1TXYA 2K01A 4OL7A 4MIUA 2VQEQ 3UE0A 1H9MA 1PH4A 5GAGC 4DR3L 4UP9A 2WAQE 3H09A 1FNVA 1WCMB 5IP9H 2K5QA 4JCVE 2E74C 3D6WA 2WB1E 1RJTA 2HHHQ 2JEAI 4ZUIA 2OEOA 5C44G 2E2HB 2ZTEA 4JG2A 1XYIA 3GTGB 3KF8A 2AUKA 2HIXA 3FP9A 1AW7A 4WJ3M 1WI5A 1CT1D 2M2LA 4HIDA 1IBKQ 5EQ0A 2K28A 2B2WC 2CW0C 3HKSA 4I7ZC 1N36L 3AQQA 1ENFA 3GTPB 1GD7A 2F0MA 3U9OA 3U4ZA 3CCUA 4A75A 1HR0L 2HCIA 5LL6X 5FJ8H 3M4QA 1O80A 3TRZA 1VQBA 4LF4Q
chains in the Genus database with same CATH topology
2N49A 3H3VI 3S24A 1SFOH 4JOIA 1Q7YC 2F3IA 1E7ZA 2KBNA 2LXKA 2AKWB 1S40A 3HOWG 4A3DH 1AH9A 1YBYA 4YY3Q 1P8LA 3ULJA 3EN2A 4JI3L 1HNXQ 4LF9L 3S16H 1SE8A 4LFAQ 2EQSA 1QUQB 2D0PA 2R7FA 5AJ3L 1Q81C 1XNQQ 5IYDH 1VS0A 1D7QA 1I94Q 2HT1A 2AMCB 1V43A 3GTPH 3HOYG 3L2PA 1VQFA 4DUYQ 4XTCS 3CCQA 1AE2A 4YCUA 3G71A 1PV4A 1OXSC 2L15A 2OWOA 2VQFQ 1KRSA 2NZOA 2K4KA 4LW1A 4JI7Q 4A93H 2CKZB 4JYAL 5IP9G 4DR1L 2Z6KA 3KYHC 4X66Q 3CCEA 3CCMA 1VQMA 1YZ6A 1HZ9A 1V9PA 3PUWA 5C4JH 4DV3L 2I5LX 1XNRL 1N34L 4HIKA 1N8RC 4B3TQ 4DPGA 2JQOA 1EIFA 1N9WA 1X56A 1WJJA 2PQAA 3IRBA 3STBC 2UUAQ 4DUZL 1X3EA 1PH8A 4GLXA 1PA6A 4JI2L 3F2DA 4DV0Q 4LF6L 1P16A 3TQYA 4QJFA 4IJLA 5FLMH 4MTNA 1XPUA 3K80C 2KENA 2B63H 1I3QH 2JA5G 5IWAL 1W2BA 4BY7G 2D0OA 2F4VQ 5EAYA 4C3IH 3KF6B 2UXDQ 4JI0L 1J6QA 3RZDH 1FVIA 3NELA 3LGJA 1VQLA 5C3EG 4O0AA 1C7YA 2R93H 3NBHB 1YIJA 4GKJQ 3U50C 4KHPQ 4O2DA 4A3FH 1VQ6A 4BBRG 1VQDA 2VQEL 2MO1A 1JJCB 3I7FA 4KI0A 3F1ZA 5M5XH 2WP8J 4A3LG 4UP7A 3HOVH 1YHBA 5FJ8G 2R92H 2ES2A 1YVCA 2NVXH 1KXLA 1PH7A 4DR7Q 2R7ZG 5GADC 3M85A 1HNWL 1X55A 3K81C 3RN5A 2VZAA 4HJ7A 2HHHL 3J80i 4BY1H 4QQBX 1LTLA 2UUBQ 2AHOB 2R6GA 3CAMA 4QGUA 3T1HQ 4A3DG 5JJKA 3I4OA 3B6YA 1KRTA 4IPCA 1Y14B 3PUXA 1OXUA 2UXCQ 4P75A 4B3RQ 3UDXA 3F2BA 3H15A 5IYDG 1TWFH 1X65A 3DM3A 1MKHA 1IBKL 2MO0A 4IPGA 1VQOA 1G6PA 4A76A 3ZJYC 2RF4A 4UY8C 1FJGQ 4KLKA 3CP0A 2NVTH 4JI4L 3L7ZC 4LF7Q 3CQZH 3HKZG 5JEAJ 1OXTA 1YITA 4MNOA 1B8AA 4APVA 2K5VA 1NJIC 5IY0A 5ELOA 3J81j 1HNZL 1AE3A 2Q2HA 4A93G 4JBKA 1NBWA 3AEVA 3CC2A 1KC8C 3BJUA 3F8TA 1XMQQ 5IT9c 1EWIA 5LMNW 4AIMA 1VQAA 3PO3H 2R7DA 1IBMQ 1PFSA 3J80c 1E24A 1EYGA 3KJOA 3T1YQ 4LUOA 4R4OA 2Q2TA 3CCVA 2Z0SA 4A4IA 1T9HA 1HNXL 1H95A 5FLMG 1XNQL 1VCIA 2Q2IA 2XTIA 4LFAL 4JC0A 2B63G 2KHIA 1QVGA 5J3BA 3PUZA 1OXXK 4MZ9A 4OXPA 1SLJA 4P71A 1R9TH 1I94L 2Z6KC 4POGA 1Z9FA 2ZM6Q 3S2HH 2KCTA 3ER0A 3KLWA 4PMWA 1SMXA 5M5WH 4DUYL 2CFMA 1S72A 1NE3A 4JI5Q 1JT8A 2Y0SE 5M3MH 1YEZA 1CSQA 3CXCA 1VQGA 2VQFL 3S1RH 1OXVA 1Q82C 4JI7L 3AYHB 4OX9Q 3CF5A 4LUZA 2R92G 3HOVG 4JI6Q 3CD6A 4GLVB 4JBJA 3J7ZC 1JMCA 2ATWA 3HOZH 1FL0A 4GN3B 4BY1G 2HIVA 2K75A 4DR2Q 2AWOA 4B3TL 2E8GA 5M5YH 3CC7A 2R7ZH 3JC66 5JEAG 2UUAL 4PZ8A 2I5HA 3BZKA 3FHWA 4NXMQ 2K14A 5DLQE 4AYBG 2ASBA 4XIGS 3I4NH 4GN5A 1SRUA 1O7IA 4P72A 3CCSA 4LUVA 4DV0L 3EBEA 1CKNB 2VNUD 1IZ6A 4PZ6A 3KJPA 4NXNQ 4IFDG 4B3MQ 2JA6H 2JA8H 4LF8Q 3A74A 2F4VL 2UXDL 1BVSA 1X3GA 2N3SA 1VQ5A 1Q86C 3PUYA 5IYCH 5GROA 3WWVA 3MEFA 2UUCQ 2VUMH 4IFDI 4A3GH 1K73C 4GKJL 1L0WA 3ERSX 4KHPL 1EIYB 1M1KC 3NENA 2EIFA 2MNAA 3OTOL 2AWNA 4K0KL 3HFZB 4GN4B 4R1JA 3VDYA 1N32Q 3ULLA 4PZ7A 4DR4Q 2VW9A 3PO3G 4JV5Q 1KL9A 1JE5A 2UUBL 4HIMA 4GLAC 3HKZE 1PH2A 2QEXA 1WYDA 2PI2E 3CC4A 3T1HL 3M4OH 2JA9A 1NTGA 5IYBH 4LFCQ 2UXCL 4UPAA 4B3RL 3L0OA 1YHAA 2JA6G 2JA7H 2GVBA 5LMNQ 1VQNA 2K50A 1W3SA 3GD7A 4LF5Q 3E0EA 1JB7A 2E2HH 1VQCA 4IJHA 4Y7NH 3TEHB 3TS2A 3UDGA 1C9OA 4LF7L 2B3GA 3S1NH 5M3MG 4R4CA 3KF6A 3CMAA 1PH3A 1KHIA 1TWCH 3PUVA 2A8VA 3GTLH 1I50H 1EQRA 4JI1Q 2PQAB 5K36G 3PSIA 2UXBL 1Q46A 2V1CC 3H0GH 3KDFA 1XMQL 4A3JH 4GKKQ 3D0FA 3HOZG 1X3FA 3S1MH 4LFBQ 2ALYB 4C2MH 1PYBA 3GTKH 2BH2A 4P74A 4DV2Q 1IBML 3F2CA 3RZOH 1VQ7A 1HZCA 3PV0A 1Q1EA 3CPFA 3T1YL 1LM0A 2F52A 4L5TA 2RCNA 1L1OA 5HGQA 1ASZA 3PF5A 3I4NG 3AFPA 4NPSA 4NB3A 1QZHA 2ZJRA 2YTYA 1I6HH 3UDIA 1IL2A 4RG1A 4DAMA 1YJWA 3I55A 2JA8G 4BXXH 3PCOB 1LUZA 3U58A 4L5RC 2JE6I 1A0IA 5IYCG 4HJ8A 2VUMG 2VS1A 1TWAH 2ZM6L 4X62Q 4A3IH 1V1QA 4A3GG 4DV1L 2GN5A 1YHQA 1PH6A 4AYBE 4IOCA 4JI5L 1GO3E 4GNXA 2RHQB 1NY4A 3GTOH 3CCLA 3PO2H 3W1BA 4OX9L 1TWHH 4GOPA 4JOIC 1M90C 1XNRQ 4IPHA 1EQQA 2IX1A 4YHHQ 1HZBA 2CWAA 4QY7A 3W1GA 4DV6Q 1VQPA 1Q8KA 4IFDJ 1U0LA 1QVCA 4DR2L 3RLOA 2YTXA 4BBSH 2QGQA 2KHJA 4A3CH 3GDEA 4YCVA 4LF4L 1BKBA 1XMOQ 4OWXB 5IYBG 2E5LQ 3S15H 3ULPA 2CWPA 3S2DH 1WCMG 3ICEA 4DR5Q 2JA7G 2YU9H 1N33Q 4X65Q 4NXNL 1YJ9A 4YY3L 4B3ML 4B3SQ 5BR8Q 4DR6Q 2A19A 5GAHC 4DV5Q 4DV7Q 4LF8L 1HR0W 1ASYA 1Y1WH 1XPOA 4C3JH 3PIOA 1YJNA 4DKAC 4HJ5A 2UUCL 2NN6G 3FKIH 2ZTCA 4BA1I 1VQ9A 1CKOA 3NEMA 1VQIA 2OQ0A 1HJPA 3K8AA 3OYYA 4X64Q 5LMUQ 3RR5A 2BA0A 1KAWA 1DGSA 3H0GG 1SN8A 4A3JG 4TQUS 2NN6I 1N32L 1Z47A 1PYSB 2H5XA 4DR4L 1K83H 2ID0A 4OWWB 4JV5L 3KF8B 4X66L 2D62A 4R4IA 2B29A 1E22A 1VQ8A 5IE8A 3SGIA 1X9NA 3K7AH 1EUJA 2BH8A 2JJQA 2K5NA 1BBUA 1UE6A 2BA1A 2JEBI 1PHJA 3S17H 3I4MH 4A3EH 1FGUA 3E9IA 1JJGA 2UU9Q 5LMNL 4BXXG 2IY5B 4ME3A 4H02A 3J7A5 4LF5L 2I0QA 2IHFA 3CCRA 3CW2C 4C3HH 4A3IG 3HOUH 1CKNA 3E9HA 3A5ZB 4FDBA 4ALPA 1J5EQ 1XPRA 2HQLA 3PO2G 1QUQA 2N8NA 5HY6A 5C0XG 2YV5A 1I5FA 4JI1L 5FLXc 2PMZE 4QL5A 4HJ9A 4AQYQ 4A3BH 1L1OC 4Y52H 1G291 1LYLA 5JJIA 4DR3Q 3W5OA 1QZGA 4GKKL 2N78A 5GQOA 3J81c 4LFBL 2K5HA 1L2FA 2IT1A 4UP8A 5C0XI 3S1QH 2XGTA 4DV2L 3GTMH 4DR7L 4BBSG 4LNQA 4A3CG 2FXQA 3G4SA 3MXNB 5C4XG 1Y1VH 3JAMc 3CCJA 2JK8A 5M3FH 1CKMA 3I56A 4TVAB 4GNXC 2LXJA 3STBD 1WCMH 5IP7H 3M4PA 1Y1WG 4GOPC 2WAQG 1RL2A 4R4QA 4X62L 4JBMA 1K8AC 3FKIG 1VQEA 2WB1G 3HOXG 1N36Q 2C35B 4KHZA 3GTGH 2E2IH 1FJGL 4OWTB 1KD1C 3GO5A 4JBWA 1HZAA 4DV4Q 3M3YH 3RNUA 2CCZA 3TREA 1GM5A 1YNXA 1VQKA 1HR0Q 3PF4A 2ZJQA 2VY3A 4A3MH 2MFIA 4YHHL 2ZJPA 3A5UA 1XTDA 4JI8Q 1SROA 1UWVA 4DV6L 1IBLQ 4OO1G 1EFWA 4EX5A 3DLLA 2YTVA 3EIVA 5C44H 1XMOL 5ELNA 1A62A 2Y0SG 1E3PA 4AH6A 2E5LL 3M9BA 3RLFA 3M7NA 4A3KH 3TS0A 4OO1I 3I4MG 4A3EG 4DR5L 4DK3C 2DGYA 2A1AA 2LSSA 4X65L 3CPWA 4JI3Q 1N33L 2DUDA 1K8GA 4LF9Q 1HH2P 4LWCA 4B3SL 5BR8L 1A63A 4OONA 4YWMA 5AJ3Q 1U5KA 1PH1A 1SR3A 4DV5L 4DV7L 4DR6L 3HOUG 1X6OA 1EOVA 4YWLA 4YWKA 5GAEC 2QA4A 4IOAA 3BZCA 1MJEA 3KDFB 4DK6C 1C0AA 1QVFA 2MQHA 2OQKA 3OTOQ 1Q12A 4K0KQ 4X64L 2NVQH 1PVOA 2OCEA 4IPDA 3U4VA 1E1TA 5LMUL 4A3BG 1X54A 2NZHA 5E7NA 4JYAQ 2OTJA 5H1SE 1L1OB 3H3VH 3AFQA 4DR1Q 3UE1A 3KFUA 1WOCA 1XJVA 4RMFA 4X6AH 4DV3Q 3A0JA 3KOJA 1JJ2A 4JI6L 2VL6A 1N34Q 3G48A 4DNIA 4L5QA 1YI2A 3K0XA 3S14H 1Q1BA 1Y1VG 4R4TA 4DUZQ 5M3FG 3RN2A 1UE1A 1NMGA 1BBWA 4JI2Q 3HOWH 2GVAA 1G51A 4P73A 5C4XH 4NXML 2PNHA 4LF6Q 2UU9L 1OTCA 4WJ4A 4IO9A 5IP7G 2ZTDA 5C0XJ 3I2ZA 1GKHA 4GNXB 2YYZA 5IWAQ 1K0RA 4JI0Q 1MJCA 4GOPB 2PI2A 4HJAA 1J5EL 1MIUA 2K52A 5JJLA 4DAYB 2I5MX 3HOYH 1TXYA 3K7UC 2VQEQ 3HOXH 2UXBQ 4AQYL 3UE0A 1PH4A 1TWGH 5GAGC 4DR3L 4A3MG 4L5SA 2NVYH 4UP9A 1UE5A 1E1OA 2IHEA 2WAQE 5IP9H 4JCVE 1VQJA 3BU2A 1HNWQ 2KCMA 3J81i 1IYJB 2WB1E 2HHHQ 2JEAI 4PG3A 1B70B 5C44G 2ZTEA 1S3OA 4JG2A 1PH9A 3PGZA 3G6EA 2WFWA 4A3KG 4POFA 1IXRA 1B7YB 1CUKA 1UEBA 2CQOA 2HIXA 3FP9A 3UDFA 3JAMi 2Q2UA 1UE7A 2IX0A 3GTQH 2E2JH 1WI5A 4WJ3M 1CSPA 4LFCL 1KIXA 4YCWA 1RIPA 1NMFA 2OTLA 2R93G 4HIDA 1IBKQ 2JA5H 4BY7H 4DV1Q 4A3FG 1D8LA 3HKSA 4BA2I 3RLNA 1N36L 3AQQA 3OW2A 4EQ5A 5C3EH 4JI4Q 1VQ4A 1WFQA 3D31A 1PH5A 1VQHA 3Q8DA 4QIWE 4J15A 4DV4L 4BBRH 1KQSA 1HNZQ 1GD7A 2EXDA 3PIPA 3U4ZA 4HIOA 3CCUA 1K3RA 4A75A 1K9MC 1HR0L 4A3LH 4GS3A 5FJ8H 3M4QA 4JI8L 1A8VA 3CMEA 3GTJH 1IBLL 3TRZA 1VQBA 2RHSB 4LF4Q 1GVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N49 A;  3H3V I;  3S24 A;  1SFO H;  4JOI A;  1Q7Y C;  2F3I A;  1E7Z A;  2KBN A;  2LXK A;  2AKW B;  1S40 A;  3HOW G;  4A3D H;  1AH9 A;  1YBY A;  4YY3 Q;  1P8L A;  3ULJ A;  3EN2 A;  4JI3 L;  1HNX Q;  4LF9 L;  3S16 H;  1SE8 A;  4LFA Q;  2EQS A;  1QUQ B;  2D0P A;  2R7F A;  5AJ3 L;  1Q81 C;  1XNQ Q;  5IYD H;  1VS0 A;  1D7Q A;  1I94 Q;  2HT1 A;  2AMC B;  1V43 A;  3GTP H;  3HOY G;  3L2P A;  1VQF A;  4DUY Q;  4XTC S;  3CCQ A;  1AE2 A;  4YCU A;  3G71 A;  1PV4 A;  1OXS C;  2L15 A;  2OWO A;  2VQF Q;  1KRS A;  2NZO A;  2K4K A;  4LW1 A;  4JI7 Q;  4A93 H;  2CKZ B;  4JYA L;  5IP9 G;  4DR1 L;  2Z6K A;  3KYH C;  4X66 Q;  3CCE A;  3CCM A;  1VQM A;  1YZ6 A;  1HZ9 A;  1V9P A;  3PUW A;  5C4J H;  4DV3 L;  2I5L X;  1XNR L;  1N34 L;  4HIK A;  1N8R C;  4B3T Q;  4DPG A;  2JQO A;  1EIF A;  1N9W A;  1X56 A;  1WJJ A;  2PQA A;  3IRB A;  3STB C;  2UUA Q;  4DUZ L;  1X3E A;  1PH8 A;  4GLX A;  1PA6 A;  4JI2 L;  3F2D A;  4DV0 Q;  4LF6 L;  1P16 A;  3TQY A;  4QJF A;  4IJL A;  5FLM H;  4MTN A;  1XPU A;  3K80 C;  2KEN A;  2B63 H;  1I3Q H;  2JA5 G;  5IWA L;  1W2B A;  4BY7 G;  2D0O A;  2F4V Q;  5EAY A;  4C3I H;  3KF6 B;  2UXD Q;  4JI0 L;  1J6Q A;  3RZD H;  1FVI A;  3NEL A;  3LGJ A;  1VQL A;  5C3E G;  4O0A A;  1C7Y A;  2R93 H;  3NBH B;  1YIJ A;  4GKJ Q;  3U50 C;  4KHP Q;  4O2D A;  4A3F H;  1VQ6 A;  4BBR G;  1VQD A;  2VQE L;  2MO1 A;  1JJC B;  3I7F A;  4KI0 A;  3F1Z A;  5M5X H;  2WP8 J;  4A3L G;  4UP7 A;  3HOV H;  1YHB A;  5FJ8 G;  2R92 H;  2ES2 A;  1YVC A;  2NVX H;  1KXL A;  1PH7 A;  4DR7 Q;  2R7Z G;  5GAD C;  3M85 A;  1HNW L;  1X55 A;  3K81 C;  3RN5 A;  2VZA A;  4HJ7 A;  2HHH L;  3J80 i;  4BY1 H;  4QQB X;  1LTL A;  2UUB Q;  2AHO B;  2R6G A;  3CAM A;  4QGU A;  3T1H Q;  4A3D G;  5JJK A;  3I4O A;  3B6Y A;  1KRT A;  4IPC A;  1Y14 B;  3PUX A;  1OXU A;  2UXC Q;  4P75 A;  4B3R Q;  3UDX A;  3F2B A;  3H15 A;  5IYD G;  1TWF H;  1X65 A;  3DM3 A;  1MKH A;  1IBK L;  2MO0 A;  4IPG A;  1VQO A;  1G6P A;  4A76 A;  3ZJY C;  2RF4 A;  4UY8 C;  1FJG Q;  4KLK A;  3CP0 A;  2NVT H;  4JI4 L;  3L7Z C;  4LF7 Q;  3CQZ H;  3HKZ G;  5JEA J;  1OXT A;  1YIT A;  4MNO A;  1B8A A;  4APV A;  2K5V A;  1NJI C;  5IY0 A;  5ELO A;  3J81 j;  1HNZ L;  1AE3 A;  2Q2H A;  4A93 G;  4JBK A;  1NBW A;  3AEV A;  3CC2 A;  1KC8 C;  3BJU A;  3F8T A;  1XMQ Q;  5IT9 c;  1EWI A;  5LMN W;  4AIM A;  1VQA A;  3PO3 H;  2R7D A;  1IBM Q;  1PFS A;  3J80 c;  1E24 A;  1EYG A;  3KJO A;  3T1Y Q;  4LUO A;  4R4O A;  2Q2T A;  3CCV A;  2Z0S A;  4A4I A;  1T9H A;  1HNX L;  1H95 A;  5FLM G;  1XNQ L;  1VCI A;  2Q2I A;  2XTI A;  4LFA L;  4JC0 A;  2B63 G;  2KHI A;  1QVG A;  5J3B A;  3PUZ A;  1OXX K;  4MZ9 A;  4OXP A;  1SLJ A;  4P71 A;  1R9T H;  1I94 L;  2Z6K C;  4POG A;  1Z9F A;  2ZM6 Q;  3S2H H;  2KCT A;  3ER0 A;  3KLW A;  4PMW A;  1SMX A;  5M5W H;  4DUY L;  2CFM A;  1S72 A;  1NE3 A;  4JI5 Q;  1JT8 A;  2Y0S E;  5M3M H;  1YEZ A;  1CSQ A;  3CXC A;  1VQG A;  2VQF L;  3S1R H;  1OXV A;  1Q82 C;  4JI7 L;  3AYH B;  4OX9 Q;  3CF5 A;  4LUZ A;  2R92 G;  3HOV G;  4JI6 Q;  3CD6 A;  4GLV B;  4JBJ A;  3J7Z C;  1JMC A;  2ATW A;  3HOZ H;  1FL0 A;  4GN3 B;  4BY1 G;  2HIV A;  2K75 A;  4DR2 Q;  2AWO A;  4B3T L;  2E8G A;  5M5Y H;  3CC7 A;  2R7Z H;  3JC6 6;  5JEA G;  2UUA L;  4PZ8 A;  2I5H A;  3BZK A;  3FHW A;  4NXM Q;  2K14 A;  5DLQ E;  4AYB G;  2ASB A;  4XIG S;  3I4N H;  4GN5 A;  1SRU A;  1O7I A;  4P72 A;  3CCS A;  4LUV A;  4DV0 L;  3EBE A;  1CKN B;  2VNU D;  1IZ6 A;  4PZ6 A;  3KJP A;  4NXN Q;  4IFD G;  4B3M Q;  2JA6 H;  2JA8 H;  4LF8 Q;  3A74 A;  2F4V L;  2UXD L;  1BVS A;  1X3G A;  2N3S A;  1VQ5 A;  1Q86 C;  3PUY A;  5IYC H;  5GRO A;  3WWV A;  3MEF A;  2UUC Q;  2VUM H;  4IFD I;  4A3G H;  1K73 C;  4GKJ L;  1L0W A;  3ERS X;  4KHP L;  1EIY B;  1M1K C;  3NEN A;  2EIF A;  2MNA A;  3OTO L;  2AWN A;  4K0K L;  3HFZ B;  4GN4 B;  4R1J A;  3VDY A;  1N32 Q;  3ULL A;  4PZ7 A;  4DR4 Q;  2VW9 A;  3PO3 G;  4JV5 Q;  1KL9 A;  1JE5 A;  2UUB L;  4HIM A;  4GLA C;  3HKZ E;  1PH2 A;  2QEX A;  1WYD A;  2PI2 E;  3CC4 A;  3T1H L;  3M4O H;  2JA9 A;  1NTG A;  5IYB H;  4LFC Q;  2UXC L;  4UPA A;  4B3R L;  3L0O A;  1YHA A;  2JA6 G;  2JA7 H;  2GVB A;  5LMN Q;  1VQN A;  2K50 A;  1W3S A;  3GD7 A;  4LF5 Q;  3E0E A;  1JB7 A;  2E2H H;  1VQC A;  4IJH A;  4Y7N H;  3TEH B;  3TS2 A;  3UDG A;  1C9O A;  4LF7 L;  2B3G A;  3S1N H;  5M3M G;  4R4C A;  3KF6 A;  3CMA A;  1PH3 A;  1KHI A;  1TWC H;  3PUV A;  2A8V A;  3GTL H;  1I50 H;  1EQR A;  4JI1 Q;  2PQA B;  5K36 G;  3PSI A;  2UXB L;  1Q46 A;  2V1C C;  3H0G H;  3KDF A;  1XMQ L;  4A3J H;  4GKK Q;  3D0F A;  3HOZ G;  1X3F A;  3S1M H;  4LFB Q;  2ALY B;  4C2M H;  1PYB A;  3GTK H;  2BH2 A;  4P74 A;  4DV2 Q;  1IBM L;  3F2C A;  3RZO H;  1VQ7 A;  1HZC A;  3PV0 A;  1Q1E A;  3CPF A;  3T1Y L;  1LM0 A;  2F52 A;  4L5T A;  2RCN A;  1L1O A;  5HGQ A;  1ASZ A;  3PF5 A;  3I4N G;  3AFP A;  4NPS A;  4NB3 A;  1QZH A;  2ZJR A;  2YTY A;  1I6H H;  3UDI A;  1IL2 A;  4RG1 A;  4DAM A;  1YJW A;  3I55 A;  2JA8 G;  4BXX H;  3PCO B;  1LUZ A;  3U58 A;  4L5R C;  2JE6 I;  1A0I A;  5IYC G;  4HJ8 A;  2VUM G;  2VS1 A;  1TWA H;  2ZM6 L;  4X62 Q;  4A3I H;  1V1Q A;  4A3G G;  4DV1 L;  2GN5 A;  1YHQ A;  1PH6 A;  4AYB E;  4IOC A;  4JI5 L;  1GO3 E;  4GNX A;  2RHQ B;  1NY4 A;  3GTO H;  3CCL A;  3PO2 H;  3W1B A;  4OX9 L;  1TWH H;  4GOP A;  4JOI C;  1M90 C;  1XNR Q;  4IPH A;  1EQQ A;  2IX1 A;  4YHH Q;  1HZB A;  2CWA A;  4QY7 A;  3W1G A;  4DV6 Q;  1VQP A;  1Q8K A;  4IFD J;  1U0L A;  1QVC A;  4DR2 L;  3RLO A;  2YTX A;  4BBS H;  2QGQ A;  2KHJ A;  4A3C H;  3GDE A;  4YCV A;  4LF4 L;  1BKB A;  1XMO Q;  4OWX B;  5IYB G;  2E5L Q;  3S15 H;  3ULP A;  2CWP A;  3S2D H;  1WCM G;  3ICE A;  4DR5 Q;  2JA7 G;  2YU9 H;  1N33 Q;  4X65 Q;  4NXN L;  1YJ9 A;  4YY3 L;  4B3M L;  4B3S Q;  5BR8 Q;  4DR6 Q;  2A19 A;  5GAH C;  4DV5 Q;  4DV7 Q;  4LF8 L;  1HR0 W;  1ASY A;  1Y1W H;  1XPO A;  4C3J H;  3PIO A;  1YJN A;  4DKA C;  4HJ5 A;  2UUC L;  2NN6 G;  3FKI H;  2ZTC A;  4BA1 I;  1VQ9 A;  1CKO A;  3NEM A;  1VQI A;  2OQ0 A;  1HJP A;  3K8A A;  3OYY A;  4X64 Q;  5LMU Q;  3RR5 A;  2BA0 A;  1KAW A;  1DGS A;  3H0G G;  1SN8 A;  4A3J G;  4TQU S;  2NN6 I;  1N32 L;  1Z47 A;  1PYS B;  2H5X A;  4DR4 L;  1K83 H;  2ID0 A;  4OWW B;  4JV5 L;  3KF8 B;  4X66 L;  2D62 A;  4R4I A;  2B29 A;  1E22 A;  1VQ8 A;  5IE8 A;  3SGI A;  1X9N A;  3K7A H;  1EUJ A;  2BH8 A;  2JJQ A;  2K5N A;  1BBU A;  1UE6 A;  2BA1 A;  2JEB I;  1PHJ A;  3S17 H;  3I4M H;  4A3E H;  1FGU A;  3E9I A;  1JJG A;  2UU9 Q;  5LMN L;  4BXX G;  2IY5 B;  4ME3 A;  4H02 A;  3J7A 5;  4LF5 L;  2I0Q A;  2IHF A;  3CCR A;  3CW2 C;  4C3H H;  4A3I G;  3HOU H;  1CKN A;  3E9H A;  3A5Z B;  4FDB A;  4ALP A;  1J5E Q;  1XPR A;  2HQL A;  3PO2 G;  1QUQ A;  2N8N A;  5HY6 A;  5C0X G;  2YV5 A;  1I5F A;  4JI1 L;  5FLX c;  2PMZ E;  4QL5 A;  4HJ9 A;  4AQY Q;  4A3B H;  1L1O C;  4Y52 H;  1G29 1;  1LYL A;  5JJI A;  4DR3 Q;  3W5O A;  1QZG A;  4GKK L;  2N78 A;  5GQO A;  3J81 c;  4LFB L;  2K5H A;  1L2F A;  2IT1 A;  4UP8 A;  5C0X I;  3S1Q H;  2XGT A;  4DV2 L;  3GTM H;  4DR7 L;  4BBS G;  4LNQ A;  4A3C G;  2FXQ A;  3G4S A;  3MXN B;  5C4X G;  1Y1V H;  3JAM c;  3CCJ A;  2JK8 A;  5M3F H;  1CKM A;  3I56 A;  4TVA B;  4GNX C;  2LXJ A;  3STB D;  1WCM H;  5IP7 H;  3M4P A;  1Y1W G;  4GOP C;  2WAQ G;  1RL2 A;  4R4Q A;  4X62 L;  4JBM A;  1K8A C;  3FKI G;  1VQE A;  2WB1 G;  3HOX G;  1N36 Q;  2C35 B;  4KHZ A;  3GTG H;  2E2I H;  1FJG L;  4OWT B;  1KD1 C;  3GO5 A;  4JBW A;  1HZA A;  4DV4 Q;  3M3Y H;  3RNU A;  2CCZ A;  3TRE A;  1GM5 A;  1YNX A;  1VQK A;  1HR0 Q;  3PF4 A;  2ZJQ A;  2VY3 A;  4A3M H;  2MFI A;  4YHH L;  2ZJP A;  3A5U A;  1XTD A;  4JI8 Q;  1SRO A;  1UWV A;  4DV6 L;  1IBL Q;  4OO1 G;  1EFW A;  4EX5 A;  3DLL A;  2YTV A;  3EIV A;  5C44 H;  1XMO L;  5ELN A;  1A62 A;  2Y0S G;  1E3P A;  4AH6 A;  2E5L L;  3M9B A;  3RLF A;  3M7N A;  4A3K H;  3TS0 A;  4OO1 I;  3I4M G;  4A3E G;  4DR5 L;  4DK3 C;  2DGY A;  2A1A A;  2LSS A;  4X65 L;  3CPW A;  4JI3 Q;  1N33 L;  2DUD A;  1K8G A;  4LF9 Q;  1HH2 P;  4LWC A;  4B3S L;  5BR8 L;  1A63 A;  4OON A;  4YWM A;  5AJ3 Q;  1U5K A;  1PH1 A;  1SR3 A;  4DV5 L;  4DV7 L;  4DR6 L;  3HOU G;  1X6O A;  1EOV A;  4YWL A;  4YWK A;  5GAE C;  2QA4 A;  4IOA A;  3BZC A;  1MJE A;  3KDF B;  4DK6 C;  1C0A A;  1QVF A;  2MQH A;  2OQK A;  3OTO Q;  1Q12 A;  4K0K Q;  4X64 L;  2NVQ H;  1PVO A;  2OCE A;  4IPD A;  3U4V A;  1E1T A;  5LMU L;  4A3B G;  1X54 A;  2NZH A;  5E7N A;  4JYA Q;  2OTJ A;  5H1S E;  1L1O B;  3H3V H;  3AFQ A;  4DR1 Q;  3UE1 A;  3KFU A;  1WOC A;  1XJV A;  4RMF A;  4X6A H;  4DV3 Q;  3A0J A;  3KOJ A;  1JJ2 A;  4JI6 L;  2VL6 A;  1N34 Q;  3G48 A;  4DNI A;  4L5Q A;  1YI2 A;  3K0X A;  3S14 H;  1Q1B A;  1Y1V G;  4R4T A;  4DUZ Q;  5M3F G;  3RN2 A;  1UE1 A;  1NMG A;  1BBW A;  4JI2 Q;  3HOW H;  2GVA A;  1G51 A;  4P73 A;  5C4X H;  4NXM L;  2PNH A;  4LF6 Q;  2UU9 L;  1OTC A;  4WJ4 A;  4IO9 A;  5IP7 G;  2ZTD A;  5C0X J;  3I2Z A;  1GKH A;  4GNX B;  2YYZ A;  5IWA Q;  1K0R A;  4JI0 Q;  1MJC A;  4GOP B;  2PI2 A;  4HJA A;  1J5E L;  1MIU A;  2K52 A;  5JJL A;  4DAY B;  2I5M X;  3HOY H;  1TXY A;  3K7U C;  2VQE Q;  3HOX H;  2UXB Q;  4AQY L;  3UE0 A;  1PH4 A;  1TWG H;  5GAG C;  4DR3 L;  4A3M G;  4L5S A;  2NVY H;  4UP9 A;  1UE5 A;  1E1O A;  2IHE A;  2WAQ E;  5IP9 H;  4JCV E;  1VQJ A;  3BU2 A;  1HNW Q;  2KCM A;  3J81 i;  1IYJ B;  2WB1 E;  2HHH Q;  2JEA I;  4PG3 A;  1B70 B;  5C44 G;  2ZTE A;  1S3O A;  4JG2 A;  1PH9 A;  3PGZ A;  3G6E A;  2WFW A;  4A3K G;  4POF A;  1IXR A;  1B7Y B;  1CUK A;  1UEB A;  2CQO A;  2HIX A;  3FP9 A;  3UDF A;  3JAM i;  2Q2U A;  1UE7 A;  2IX0 A;  3GTQ H;  2E2J H;  1WI5 A;  4WJ3 M;  1CSP A;  4LFC L;  1KIX A;  4YCW A;  1RIP A;  1NMF A;  2OTL A;  2R93 G;  4HID A;  1IBK Q;  2JA5 H;  4BY7 H;  4DV1 Q;  4A3F G;  1D8L A;  3HKS A;  4BA2 I;  3RLN A;  1N36 L;  3AQQ A;  3OW2 A;  4EQ5 A;  5C3E H;  4JI4 Q;  1VQ4 A;  1WFQ A;  3D31 A;  1PH5 A;  1VQH A;  3Q8D A;  4QIW E;  4J15 A;  4DV4 L;  4BBR H;  1KQS A;  1HNZ Q;  1GD7 A;  2EXD A;  3PIP A;  3U4Z A;  4HIO A;  3CCU A;  1K3R A;  4A75 A;  1K9M C;  1HR0 L;  4A3L H;  4GS3 A;  5FJ8 H;  3M4Q A;  4JI8 L;  1A8V A;  3CME A;  3GTJ H;  1IBL L;  3TRZ A;  1VQB A;  2RHS B;  4LF4 Q;  1GVP A; 
#chains in the Genus database with same CATH topology
 1SFO H;  1VMC A;  3RMH A;  1TS4 A;  4A3D H;  1S40 A;  1YBY A;  3BVM A;  4CDC C;  3EN2 A;  4LF9 L;  5AJ3 L;  4LFA Q;  5IYD H;  1ET6 A;  1SNP A;  2EE1 A;  4TRD A;  4RCO A;  5IOD A;  1V8Q A;  1VS0 A;  1I94 Q;  1TU2 B;  2E75 C;  1AE2 A;  4KKU A;  5AFW A;  1OXS C;  2EPB A;  2OWO A;  5C4X B;  2K4K A;  4LW1 A;  5C3X A;  3OIP A;  4A93 H;  4JYA L;  3M4Y A;  3FPP A;  3CCE A;  1TKW B;  5C4J H;  2I5L X;  1DD2 A;  4HAE A;  5J39 A;  4HIK A;  3C3L A;  4DPG A;  1X56 A;  3HOY B;  1PA6 A;  3F2D A;  4LF6 L;  2XWJ B;  4IJL A;  5DEH A;  5CV6 A;  5IWA L;  1W2B A;  5M9O A;  3KF6 B;  1RKN A;  5FO9 B;  4JI0 L;  3A7L A;  1VQL A;  4KHV A;  5C3E G;  1LAB A;  1TT2 A;  4KHP Q;  4A3F H;  2VQE L;  2K05 A;  3BG3 A;  4KI0 A;  4R8N A;  3SK5 A;  2Y0S B;  4A3L G;  4OHJ A;  4UP7 A;  3HOV H;  1YVC A;  2NVX H;  1EQV A;  2K5D A;  4DR7 Q;  2R3Z A;  3K81 C;  2HHH L;  4QQB X;  2N88 A;  2VB2 X;  2RA4 A;  2FMM A;  3HOU B;  3Q6S A;  1CZG A;  1AFP A;  1KRT A;  4IPC A;  1OXU A;  4P75 A;  2F4I A;  4FVM A;  2QKI C;  1IBK L;  4X3S A;  1JOR A;  1ICW A;  2K03 A;  3SK6 A;  1G6P A;  2XVS A;  1FJG Q;  2NVT H;  3J7A V;  3L7Z C;  4A3D B;  5CBA E;  2MHV A;  1SYC A;  2K5V A;  3J81 j;  1LT6 D;  2N55 A;  1NBW A;  1YNN D;  3AEV A;  3CC2 A;  3SHL A;  3BJU A;  1ILQ A;  4AIM A;  1UAP A;  3PO3 H;  4V0B A;  1XXG A;  1HQM C;  3R2T A;  1I6V C;  3CCV A;  1U4P A;  1NAP A;  1EFI D;  5DAU A;  1UNS A;  4A93 B;  1F77 A;  4LFA L;  2B63 G;  4JC0 A;  4KY5 A;  5J3B A;  3PUZ A;  1TY0 A;  1D2B A;  1RD9 D;  4MZ9 A;  5C4J B;  1I94 L;  3EVQ A;  2Z6K C;  3EA6 A;  2A68 D;  3ER0 A;  1RF2 D;  1STA A;  2JP1 A;  1VQG A;  2E2D C;  2F3V A;  3CF5 A;  4A3K B;  1PTO F;  3CD6 A;  3J7Z C;  1JMC A;  1FL0 A;  3NWS A;  4KJO A;  3JC6 6;  2I5H A;  4A3F B;  4QCL A;  1B3A A;  4NXM Q;  2ASB A;  5DLQ E;  3QJY A;  4AYB G;  4GN5 A;  3CCS A;  1X32 A;  1CKN B;  3HP3 A;  1IZ6 A;  4PZ6 A;  5I2Y A;  3KJP A;  3HOV B;  4B3M Q;  2NVX B;  4LF8 Q;  2A74 C;  2HUG A;  1Q86 C;  5IYC H;  5GRO A;  4CKC A;  1MGS A;  5EGT A;  4KHP L;  1EIY B;  1PZJ D;  4HED A;  2NZ1 D;  1DOL A;  4GN4 B;  4UHV A;  1RTO A;  3I8Z A;  2IW3 A;  5FLX E;  2J7Z A;  1JCK B;  1SYE A;  3J81 E;  4HIM A;  1CHQ D;  1PRT C;  1BCP B;  1SYF A;  3MVV A;  1GUW A;  4LFC Q;  3TDQ A;  3L0O A;  3CHB D;  1V1P A;  2JA6 G;  3GV3 A;  2GVB A;  3V05 A;  1JOQ A;  3KLS X;  2F0F A;  5F2D A;  2K50 A;  3GD7 A;  3E0E A;  1E2W A;  4ILW A;  1CA5 A;  1IKM A;  3PO3 B;  1SNM A;  2KOL A;  1JB3 A;  2B3G A;  3K5O A;  2IWH A;  1BDO A;  1STN A;  5J22 A;  1GUN A;  1KHI A;  2A8V A;  2PQA B;  5K36 G;  3BYT B;  2UXB L;  1Q46 A;  1LTG D;  3CRK C;  4CHT B;  5EJW A;  4GKK Q;  4C2M H;  2MJ8 A;  2EJF C;  4DV2 Q;  2FIN B;  2IX3 A;  4KV6 A;  1VQ7 A;  3RZO H;  4ODG A;  1LM0 A;  4S3S A;  2MGS A;  1I4P A;  3A54 A;  3FDT A;  1L0X B;  5CGK A;  2JA8 G;  4RG1 A;  4DAM A;  3SE0 A;  3I55 A;  3PCO B;  4QUF A;  2JE6 I;  4IFD H;  2EYM A;  2DJG C;  4A3I H;  2F0S A;  4A3G G;  4DV1 L;  1YHQ A;  1PH6 A;  4AYB E;  2PQE A;  4IOC A;  1FNU A;  1CQV A;  1WTH A;  3J7A F;  3WDN A;  1TWH H;  1XNR Q;  1MBY A;  3T56 B;  4IUN A;  4RWS C;  3RLO A;  2YTX A;  4KJN A;  4A3C H;  1BKB A;  2EZV A;  5JPN C;  2CWP A;  1WCM G;  3TP8 A;  2PPB C;  4FF1 A;  4YY3 L;  4B3M L;  3MXP A;  1PYW D;  4DR6 Q;  2WAC A;  1PDQ A;  1I4X A;  3DHQ A;  5G3L D;  4LF8 L;  2NTT A;  3D4D A;  1XPO A;  2RDG A;  2AQ3 B;  3I4L A;  4HJ5 A;  2NN6 G;  3C46 A;  1D5M C;  1CKO A;  3HS0 C;  3K6O A;  5CBE E;  1VQI A;  3OYY A;  3VA7 A;  2CW0 D;  1ZKO A;  4IQZ A;  1QOH A;  1TY2 A;  3KF8 B;  4X66 L;  3NQT A;  1EU4 A;  2I46 A;  3MAQ A;  1H9J A;  3J80 E;  5COY A;  2JJQ A;  5T1I A;  1EQT A;  3NSW A;  2A6H C;  4GZY C;  1FGU A;  1LV9 A;  3C1F A;  2EYL A;  5E4X A;  3FVQ A;  2F0E A;  3CW2 C;  3E9H A;  1CQF A;  1TQO A;  3RZO B;  4FO2 A;  2HQL A;  5HY6 A;  5FLX c;  2RKS A;  4QL5 A;  2BDO A;  4A3B H;  1L1O C;  5JJI A;  3W5O A;  4GKK L;  1SND A;  5GQO A;  1O7Z A;  1T5E A;  3J81 c;  1Y69 U;  4DV2 L;  3LNN A;  3GTM H;  4HN7 A;  4A3I B;  1KTK A;  5C4X G;  2MUY A;  1CKM A;  5DNF A;  2KJX A;  1TWH B;  1NCV A;  1CZW A;  1G8Z D;  3I72 A;  4FP5 D;  2BOS A;  4WFN 3;  2E2I H;  2R61 A;  2X6G A;  5I4D A;  2QDL A;  3PF4 A;  2D2C C;  2ZJQ A;  2TMP A;  3I73 A;  1I4Q A;  1U4L A;  3FEW X;  4JI8 Q;  1AZP A;  1IBL Q;  4C56 C;  1EFW A;  1WTO A;  2JXM B;  3MC0 B;  3NUC A;  3EIV A;  1JR0 D;  5ELN A;  2Y0S G;  2C5C A;  3RLF A;  3IFT A;  3M7N A;  4OO1 I;  3TS0 A;  1A3V A;  4CKB A;  1VDZ A;  4JI3 Q;  1K8G A;  4DR6 L;  2Z4H A;  1TII D;  4C3H G;  3HOU G;  1X6O A;  1EOV A;  4YWL A;  4YWK A;  3JAM L;  3K59 A;  4DF7 A;  1CHP D;  5ELD A;  1Q12 A;  5L37 A;  4IPD A;  1LAC A;  3U4V A;  1X54 A;  3K57 A;  4QIW B;  5H1S E;  5C0X H;  3NTH A;  1WOC A;  2F0J A;  2DY8 A;  3KOJ A;  4JI6 L;  2G9H D;  2VL6 A;  4UDU C;  1N34 Q;  1Y1V G;  3LX0 A;  1UE1 A;  1NMG A;  1BBW A;  4IN3 A;  4L63 B;  3H3V C;  2G5D A;  4A3B B;  4KD3 A;  5IP7 G;  1GKH A;  1IHZ A;  2AQ2 B;  2EY5 A;  1S5B D;  3DEO A;  4GNX B;  3HEJ A;  1WTQ A;  3SEB A;  3F2U A;  1GJX A;  2PI2 A;  4XDX A;  1MIU A;  3TSS A;  3K7U C;  2A73 B;  1TWG H;  4A3M G;  5IGG A;  4G7Z C;  1UE5 A;  1FD7 D;  2RSN A;  2KCM A;  3J81 i;  1B2T A;  4Q5V A;  3EFX D;  1B70 B;  1PH9 A;  2KHS A;  2E2I B;  3G6E A;  2WFW A;  1WTX A;  4A3K G;  4QMG A;  4FXD A;  1UEB A;  4K14 A;  2Z1C A;  2E2J H;  5D65 A;  1NMF A;  1L0Y B;  2WKD A;  2JA5 H;  4BY7 H;  1QB5 D;  3A55 A;  4A3F G;  1NUC A;  3OOC A;  1VQ4 A;  1WFQ A;  3D31 A;  1VQH A;  1EYD A;  4BBR H;  2EXD A;  4HIO A;  1SYD A;  1K9M C;  4GS3 A;  3M7G A;  5KRU A;  2F0Q A;  1EY8 A;  4JI8 L;  1A8V A;  1IBL L;  3GTJ H;  2N49 A;  3H3V I;  3S24 A;  3T16 A;  1FNW A;  1ENA A;  2B39 A;  2AKW B;  3HOW G;  2L1B A;  1A3U A;  1SAP A;  1P8L A;  4JI3 L;  1VMP A;  1W6K A;  3OPO A;  1SE8 A;  1PRT D;  2X6L A;  1Q81 C;  4I65 A;  4G7O C;  1KLG D;  4U68 A;  4XTC S;  4DUY Q;  5I2X A;  4YCU A;  2VQF Q;  3K0Y A;  2NZO A;  5FKA C;  4JI7 Q;  1SE2 A;  3TP6 A;  1VQM A;  3CCM A;  1HZ9 A;  1BQQ T;  2A69 D;  1N34 L;  5E4W C;  5IGE A;  1N8R C;  2JQO A;  1EIF A;  2PQA A;  3STB C;  1V1P B;  1WJJ A;  1EY5 A;  1LTS D;  1PH8 A;  4ZAI A;  1JIC A;  4DV0 Q;  3J81 L;  2SDF A;  1P16 A;  1TWG B;  3E0J A;  3K80 C;  2KEN A;  3K5L A;  1EOT A;  5JJZ A;  3QOJ A;  2D0O A;  4C3I H;  1FVI A;  5K5P A;  1YIJ A;  3U50 C;  3SR1 A;  1H9K A;  4G4K A;  2E2J B;  5M5X H;  1YHB A;  2R92 H;  1TR5 A;  3OIQ A;  3E3X A;  1X55 A;  2LS0 1;  4WOR A;  2JA5 B;  4BY7 B;  2VZA A;  3J80 i;  2MP1 A;  2UUB Q;  4IUQ A;  4K8I A;  3L3O C;  1HCZ A;  3CAM A;  3T1H Q;  1ONL A;  3PUX A;  4DA2 A;  4BBR B;  2UXC Q;  3QOL A;  4B3R Q;  1SSO A;  1V1O A;  2QW7 A;  2B2U A;  3DM3 A;  1HRJ A;  3PQI A;  1B3Q A;  1VQO A;  2SEB D;  3GTJ B;  4A76 A;  2HCC A;  2RF4 A;  1OXT A;  4APV A;  5EBD A;  2C9O A;  2WKC A;  3A7A B;  1NJI C;  1KC8 C;  2RDH A;  1K3B C;  1IW7 C;  1VQA A;  1LT4 D;  2R7D A;  1IBM Q;  1E24 A;  1EYG A;  4EQP A;  4LUO A;  2Q2T A;  3LWE A;  4WJW A;  1SE4 A;  1PFB A;  1CTM A;  4L6T B;  4A4I A;  5FLM G;  2XTI A;  1LTR D;  1F9S A;  4OXP A;  1SLJ A;  1R9T H;  2A6H D;  1Z9F A;  2ZM6 Q;  3S2H H;  2KCT A;  4PMW A;  4DUY L;  4J8Q A;  2XNA C;  1NE3 A;  1YEZ A;  1KDB A;  2VQF L;  4RKB A;  4JI7 L;  4LUZ A;  2EYP A;  4MTK A;  5C5M A;  4JBJ A;  2L0C A;  3A8I E;  2ATW A;  3HOZ H;  4BY1 G;  4C3I B;  4TKO B;  3NXW A;  2KCN A;  2WIN B;  2AWO A;  3CC7 A;  5JEA G;  3DUZ A;  4IUV A;  1II3 A;  3I4N H;  1EZ8 A;  2HQE A;  1JE4 A;  4DV0 L;  4LUV A;  4OIK A;  3EBE A;  5M5X B;  2LY7 A;  4IFD G;  3J80 L;  2KED A;  2R92 B;  1FYC A;  5EKL A;  5EKI A;  1VQ5 A;  4RGM A;  3GQB A;  2UUC Q;  1K73 C;  1M1K C;  3NEN A;  1EWH A;  3Q0A A;  2AWN A;  5D3I B;  4R1J A;  3ULL A;  1ESF A;  1ML0 D;  2UUB L;  4F7X A;  3T1H L;  3M4O H;  1Y8N B;  2J0T D;  3VYT A;  2F0H A;  3N52 A;  1BCP F;  2UXC L;  4B3R L;  2B2V A;  3JAM E;  1BO0 A;  2JA7 H;  2KEC A;  5LMN Q;  1F9R A;  1VQN A;  3K58 A;  4LF5 Q;  4DAV A;  2LMC B;  1VQC A;  2F3W A;  3P20 A;  1EY6 A;  4IJH A;  4Y7N H;  3BVZ A;  5M3M G;  2PZW A;  3E5S A;  3NTI A;  1PH3 A;  1TWC H;  4DNR B;  3GTL H;  4JI1 Q;  1LTB D;  3H0G H;  3D0F A;  1Y8O B;  1X3F A;  4LK1 C;  3S1M H;  1PYB A;  3GTK H;  4ZQ3 A;  2BH2 A;  4P74 A;  1EWC A;  1R9T B;  1IBM L;  2HDL A;  3S2H B;  2ZXR A;  4DAP A;  4ABN A;  3BVG A;  1BBX C;  5HGQ A;  3AFP A;  2YTY A;  5C5L A;  1I6H H;  1PFM A;  1YJW A;  4BXX H;  1LUZ A;  3HOZ B;  1MD2 D;  4HJ8 A;  2VUM G;  2ZM6 L;  3R3O A;  4IZ8 A;  2RDF A;  3HGB A;  1AP0 A;  1W6J A;  5IGB A;  1SFO B;  4GNX A;  1NY4 A;  3CCL A;  3I4N B;  3W1B A;  1M90 C;  4IPH A;  4LJZ C;  3KK7 A;  3OSO A;  4MHE A;  1R4P B;  4BBS H;  3GDE A;  5LHY 1;  4LF4 L;  1XMO Q;  2CH4 W;  5IYB G;  2E5L Q;  3S15 H;  3ULP A;  1N33 Q;  4X65 Q;  3HKZ B;  5BR8 Q;  5GAH C;  4DV7 Q;  1HR0 W;  1ASY A;  5JPM C;  1Y1W H;  3PIO A;  2UUC L;  5ELB A;  3KUP A;  3SK4 A;  3FKI H;  4XXE A;  2VXW A;  3M4O B;  3NEM A;  1QE6 A;  1RDP D;  5LMU Q;  3FPU B;  1DGS A;  3T51 B;  2JA7 B;  1SN8 A;  4HSP A;  4TQU S;  2NN6 I;  4A3J G;  1Z47 A;  1PYS B;  2H5X A;  3SK8 A;  2PW7 A;  2NUC A;  1CI3 M;  1VQ8 A;  5IE8 A;  2F0G A;  2BH8 A;  5DM6 3;  3IKJ A;  1PHJ A;  3GTL B;  2H1E A;  3I4M H;  1JJG A;  2UU9 Q;  5LMN L;  3H0G B;  4KN4 C;  4ME3 A;  4H02 A;  3J7A 5;  1ZEQ X;  4LF5 L;  2I0Q A;  3S1M B;  3GTK B;  2IHF A;  3CCR A;  1K8M A;  5CV4 A;  4CGY B;  3MA2 B;  3PO2 G;  2N8N A;  5C0X G;  2YV5 A;  4JI1 L;  4IUR A;  3NK9 A;  2PMZ E;  3NP8 A;  1G29 1;  1LYL A;  1I6H B;  2NBF A;  2K5H A;  1F2Y A;  3BDO A;  1C4Q A;  5KIX A;  3G7L A;  2EJM A;  4DR7 L;  4LNQ A;  2EY2 A;  3VR3 A;  4Z9C B;  4K6L A;  1X3P A;  2NVT B;  3JAM c;  5M3F H;  4ULL A;  4XYQ A;  2DN8 A;  3STB D;  2F0D A;  2EYO A;  3M4P A;  4GOP C;  4C3J G;  4R4Q A;  4JBM A;  1K8A C;  3J7Y W;  4BBS B;  2C35 B;  1FJG L;  4OWT B;  1A3T A;  4JBW A;  3M3Y H;  4DV4 Q;  2CH4 A;  2TSS A;  2CCZ A;  2A69 C;  3DWP A;  1YNX A;  4XQN A;  2B2W A;  5CV8 A;  4C1N K;  3A5U A;  1XTD A;  2EXZ A;  1C48 A;  2HD3 A;  2F03 A;  4KKS A;  2DNE A;  4EX5 A;  3PIP 3;  3DLL A;  4ZYS A;  2YTV A;  2WB1 B;  1SBB B;  3BZD B;  5C44 H;  1XMO L;  1A62 A;  4AH6 A;  4ME5 A;  1E0B A;  2E5L L;  2VNU D;  4A3E G;  1N33 L;  4X65 L;  3DWA A;  4ZK9 B;  1M8A A;  1HFG A;  5BR8 L;  1U5K A;  1SR3 A;  4DV7 L;  4KK7 A;  3BZC A;  1QIL A;  1IYU A;  2MQH A;  3OTO Q;  4K0K Q;  3V2T A;  4EVO A;  2OCE A;  5LMU L;  4RCN A;  3I4M B;  2NZH A;  4L8J A;  3H3V H;  1L1O B;  4DR1 Q;  2SNS A;  4RMF A;  3A0J A;  3CKI B;  1S5F D;  2EVB A;  5FO8 B;  2KVM A;  3S14 H;  4QF4 A;  4R4T A;  1HFN A;  3VYS A;  3RN2 A;  1BXT A;  4JI2 Q;  1IW7 D;  2F0K A;  2GVA A;  1NR2 A;  4NXM L;  3OWE B;  2PNH A;  2UU9 L;  3QO2 A;  4OEM B;  3BDC A;  3I3C A;  4HTH A;  3DMU A;  1DJR D;  3DM1 A;  1K0R A;  1BOS A;  2O5I C;  2D9U A;  2PCF B;  2MPM A;  2VB3 X;  5M3F B;  2F0U A;  3HRZ C;  1QNU A;  3A8K E;  1E1O A;  2EJG C;  5I6W A;  1HNW Q;  2IPK D;  3FRP B;  3OMC A;  5C6A A;  1UEA B;  1S3O A;  1U4M A;  4POF A;  1B7Y B;  1IXR A;  1CUK A;  2CQO A;  3TBI B;  3JAM i;  3M3Y B;  2OT2 A;  3TP7 A;  3GTQ H;  2IX0 A;  3VR4 A;  5I6Y A;  4LFC L;  1RIP A;  1HA6 A;  1CFM A;  4H44 C;  4DGZ A;  4ZUJ A;  4BA2 I;  4C2M B;  4HCE A;  5CV7 A;  2B2T C;  2Q8T A;  3RLN A;  3W2D A;  4EQ5 A;  5C3E H;  4JI4 Q;  1DON A;  4O1N A;  3Q8D A;  4R8I A;  2IJ0 A;  4DV4 L;  1KQS A;  3PIP A;  2K6A A;  1I4R A;  1K3R A;  4KY6 A;  4A3L H;  3MWY W;  3CME A;  3SVM A;  3ERQ A;  4EQN A;  1Q7Y C;  4ZKC B;  2LXK A;  2KBN A;  3TN2 A;  3BS1 A;  4K5V A;  1AH9 A;  3ULJ A;  1HNX Q;  1XNQ Q;  2R7F A;  1PZK D;  1ZYR C;  4O42 A;  2HT1 A;  1SJE D;  2F0T A;  3S14 B;  3HOY G;  1KAB A;  4LMQ D;  4HR7 B;  1ILP A;  1KRS A;  1J8I A;  4DFA A;  2CKZ B;  5IP9 G;  4DR1 L;  2Z6K A;  1A2T A;  3PUW A;  1XNR L;  2OXP A;  4KN7 C;  4B3T Q;  3IL8 A;  3URY A;  1N9W A;  1QJO A;  3IRB A;  2UUA Q;  3K5M A;  2B2Y C;  2SNM A;  2EYJ A;  5G3L F;  1KNE A;  4GLX A;  4JI2 L;  4PMB A;  1GUS A;  4QJF A;  2B63 H;  1I3Q H;  4IUT A;  5EAY A;  4N9P A;  3RZD H;  3NEL A;  3LGJ A;  5JOB A;  1C7Y A;  4O0A A;  2R93 H;  2ICI A;  5DM7 3;  4GKJ Q;  3O13 A;  4RGO S;  2NYZ D;  2XIW A;  1VQD A;  1PTO C;  2I07 B;  3GTQ B;  3I7F A;  3F1Z A;  5FJ8 G;  2ES2 A;  2Q8R E;  1HNW L;  3M85 A;  4HJ7 A;  4DK0 A;  1STE A;  1KAA A;  5C3E B;  1G2S A;  4NMZ A;  4QGU A;  4A3D G;  1G91 A;  3B6Y A;  5BN3 A;  1CM9 A;  3SDZ A;  3H15 A;  5IYD G;  1TWF H;  2ICE C;  1I4G A;  1X65 A;  1MKH A;  5JAV A;  4QUC A;  2F1M A;  1WVL A;  3ZJY C;  4UY8 C;  4K8J A;  3EQL C;  4KLK A;  4XQQ A;  5CV5 A;  4JI4 L;  1PMR A;  3GTM B;  4LF7 Q;  5JEA J;  3HKZ G;  1A6X A;  1YIT A;  4MNO A;  1B8A A;  3LWU A;  1DXM A;  5IY0 A;  4H13 C;  4A93 G;  1HQR D;  1STY A;  3GP7 A;  4K5X A;  1SJH D;  2L55 A;  1Z6H A;  3MZ5 A;  4X3U A;  1WTV A;  1PFS A;  1YNJ C;  5LL6 S;  3P7J A;  3J80 c;  3T1Y Q;  1Q3L A;  1EEI D;  3OMG A;  1LTT D;  4I7A A;  1HNX L;  1H95 A;  1XNQ L;  2JA6 H;  2Q2I A;  2KHI A;  3KLS A;  4POG A;  1SMX A;  1B53 A;  5M5W H;  2CFM A;  1EIH A;  2Y0S E;  5KEE A;  1B9N A;  3S1R H;  4ZRZ A;  4OX9 Q;  3HOV G;  1B4O A;  5K36 H;  1SYG A;  1M4V A;  2RQX A;  2B63 B;  4V19 0;  1S5C D;  2HIV A;  2F0W A;  2K75 A;  3RZD B;  4DR2 Q;  3WOF A;  4B3T L;  2E8G A;  5M5Y H;  2R93 B;  2R7Z H;  3NQI A;  2UUA L;  1KDC A;  4PZ8 A;  1EEF D;  3BZK A;  5IT9 L;  2K14 A;  4KY7 A;  1LTA D;  1SRU A;  1O7I A;  4P72 A;  3QR8 A;  4RGT A;  4NXN Q;  1SNQ A;  4K6D A;  1HPC A;  2JA8 H;  1BVS A;  4RH6 A;  2KCC A;  3PUY A;  1STB A;  4IFD I;  1BNZ A;  3T13 A;  4A3G H;  4GKJ L;  1L0W A;  3ERS X;  3VA5 A;  2EIF A;  4AYB B;  3HFZ B;  1LT3 D;  1D5Z C;  1GOZ A;  5IOC A;  1TWF B;  2GA4 B;  4P2C B;  4PZ7 A;  3PO3 G;  4BWG B;  2F0L A;  1JE5 A;  4GLA C;  3HKZ E;  1PH2 A;  2QEX A;  1WYD A;  2PI2 E;  2JA9 A;  1YHA A;  3T4A C;  2SOB A;  1B50 A;  4N8X 1;  2ZXO A;  2FMC A;  5IGD A;  5KYI A;  2E2H H;  4JVZ A;  1KDA A;  2L11 A;  4DNT B;  1U9R A;  3TEH B;  1AN8 A;  3UDG A;  1C9O A;  4LF7 L;  3S1N H;  2NN6 H;  1D1I A;  3MEH A;  4R4C A;  4FNF A;  4LAA A;  1F2L A;  1I50 H;  2AUJ D;  2JA6 B;  4LFB Q;  2ALY B;  2XRQ D;  5E3F A;  2DY7 A;  3VYR A;  1HZC A;  3PV0 A;  1Q1E A;  3T1Y L;  4L5T A;  5M5W B;  1H9S B;  2RCN A;  1UUP A;  1L1O A;  4NW2 A;  3PF5 A;  3S9W A;  4NB3 A;  3S1R B;  1QZH A;  4YIJ A;  1STG A;  3U58 A;  4L5R C;  1B44 D;  4JK1 C;  5IYC G;  2O4X A;  2AQ1 B;  1TWA H;  4RGN A;  4X62 Q;  1HUN A;  5M5Y B;  4G57 A;  4FF2 A;  2R7Z B;  3PMF A;  1G2T A;  1DM0 B;  1SXT A;  5D14 A;  3BDL A;  5IGC A;  5CV9 A;  3C2P A;  4OX9 L;  3AMU A;  4JOI C;  3E6Z X;  2A6E C;  2JA8 B;  4YHH Q;  4QY7 A;  2KQ3 A;  4DV6 Q;  1VQP A;  1Q8K A;  1F2M A;  1U0L A;  1QVC A;  5J1Z A;  4DR2 L;  1LO5 D;  1TS3 A;  2QGQ A;  2KHJ A;  4A3G B;  2XSC A;  2HDM A;  4B9X A;  1PRT F;  3ICE A;  4DR5 Q;  3QIA A;  1QNK A;  1JWU D;  4NXN L;  1YJ9 A;  2A19 A;  2QDB A;  4DV5 Q;  3IAY A;  1T5X D;  2EYH A;  2M9V A;  1R4Q B;  1YJN A;  4EQO A;  1HA5 A;  1STH A;  4RAU C;  2ZTC A;  5I9P A;  4QB4 A;  1VQ9 A;  3KLR A;  3C1E A;  2OQ0 A;  4X64 Q;  2NTS A;  2BA0 A;  1KAW A;  1WD1 A;  1GXD C;  4BS9 A;  1LTI D;  3NPP A;  3MTS A;  2ID0 A;  2O5J C;  3TME A;  4F87 A;  4R4I A;  5T1G A;  1E22 A;  1B1Z A;  4PQX A;  3SGI A;  3X3N A;  1X9N A;  2K5N A;  5EPL A;  3S1N B;  2K5W A;  1QWY A;  1C8C A;  1HHV A;  1UE6 A;  3AB9 A;  3D8G A;  1I50 B;  5EBC A;  3S17 H;  4Q0F A;  2IY5 B;  2L5T A;  3SXH A;  2PO4 A;  3HOU H;  4C3H H;  4A3I G;  3A5Z B;  5HUR A;  1J5E Q;  3A56 A;  4HCS A;  1XPR A;  4KTA A;  5COR A;  1ZYR D;  4DU9 A;  1RTN A;  1I5F A;  2K33 A;  4AQY Q;  4JPB W;  2B8G A;  1QZG A;  3PIO 3;  5FOB B;  4LFB L;  1L2F A;  2IT1 A;  4UP8 A;  5C0X I;  3S1Q H;  2XGT A;  1ESR A;  1TWA B;  4A3C G;  2FXQ A;  1Z7T A;  2CHB D;  3MXN B;  5CYU A;  1Y1V H;  5A2Q E;  2JK8 A;  4TVA B;  2LXJ A;  5IP7 H;  3I70 A;  2RSO A;  2ZXP A;  4DXG A;  4OEL B;  4N8F A;  1RL2 A;  5EPJ A;  4X62 L;  5CMD A;  1SNC A;  3UI2 A;  3K5N A;  4IUP A;  1D6E C;  3GO5 A;  3RNU A;  1XTC D;  1K0S A;  3TRE A;  1GHJ A;  1IKL A;  4CJ1 B;  1GUO A;  2VY3 A;  4A3M H;  2MFI A;  5ELF A;  4YHH L;  1EY7 A;  4CDD C;  4DV6 L;  1WTW A;  1SRO A;  1SEB D;  2XRS D;  4B08 A;  1WTR A;  1MSG A;  2LFN A;  1PTO D;  2X69 A;  1MHW C;  2EY6 A;  4CJ0 B;  3KBG A;  1E3P A;  2WV6 D;  3M9B A;  4A3K H;  4DR5 L;  4DK3 C;  2LSS A;  2EDG A;  4ID6 A;  1HH2 P;  1A63 A;  1PH1 A;  2FJ2 A;  4DV5 L;  3MFG A;  2NB0 A;  2ZT9 C;  2WII B;  3HG9 A;  4M1U B;  5GAE C;  2QA4 A;  3KDF B;  2JN4 A;  1C0A A;  2K7V A;  1QVF A;  2OQK A;  5KGU A;  4X64 L;  2NVQ H;  1PVO A;  1O78 A;  1EZ6 A;  5EKK A;  2Z6B A;  4A3B G;  3S17 B;  5E7N A;  2PW5 A;  3AFQ A;  3KFU A;  2EOT A;  1XJV A;  4DV3 Q;  1JJ2 A;  4C3H B;  4H0L C;  4L5Q A;  1D1K A;  3K0X A;  1JWS D;  1Q1B A;  5C4Z A;  4DUZ Q;  2RCF A;  3HOW H;  1G51 A;  1KLU D;  1PRT B;  1EL0 A;  4KMU C;  3ZYY X;  1OTC A;  1YNJ D;  4IO9 A;  2ZTD A;  3N6R A;  2Z9H A;  3S1Q B;  4WRD A;  2DJF C;  4GOP B;  4HJA A;  1J5E L;  3TZD A;  2K52 A;  1BF4 A;  4DAY B;  2I5M X;  1Y1V B;  2L12 A;  1SE3 A;  2DNC A;  3HOX H;  2UXB Q;  4AQY L;  1PFN A;  5NUC A;  2PZT A;  4L5S A;  2NVY H;  3H94 A;  1RCV D;  2IHE A;  4C1N I;  2JYO A;  1VQJ A;  3BU2 A;  3D6C A;  2D5D A;  2F0N A;  1IYJ B;  5IT9 E;  4NKL A;  4PG3 A;  5A35 A;  1HUM A;  4OO1 H;  3PGZ A;  3ND8 A;  4Y7N B;  2Q2U A;  3UDF A;  1UE7 A;  2PNR C;  1CSP A;  1KIX A;  4YCW A;  1TWC B;  4A3M B;  2OTL A;  2R93 G;  2E76 C;  2K32 A;  1DCZ A;  4DV1 Q;  1DYQ A;  3AU7 A;  1Q8I A;  1D8L A;  4RHS A;  3OW2 A;  4DK1 A;  1PH5 A;  4QIW E;  4J15 A;  1E2Z A;  1HNZ Q;  3MHB A;  4JW0 A;  1TVX A;  1NR4 A;  3QB3 A;  1JOO A;  2BCO A;  1KNA A;  4CDE C;  2RHS B;  1GVP A;  1SMY C;  4JOI A;  4HMI A;  3G6J B;  2F3I A;  1E7Z A;  2NVQ B;  4YY3 Q;  1TS5 A;  3S16 H;  2EQS A;  1QUQ B;  2D0P A;  3HZX A;  2BDN A;  1D7Q A;  1D5X C;  2AMC B;  1V43 A;  1GUG A;  1G6Z A;  2PYK A;  3L2P A;  1VQF A;  4FYD A;  3CCQ A;  1AEX A;  3G71 A;  1PV4 A;  2L15 A;  3HOW B;  2K04 A;  1FR3 A;  4B9W A;  3S15 B;  4EGV A;  5IGF A;  3KYH C;  2NWG A;  4X66 Q;  1YZ6 A;  1V9P A;  4DV3 L;  2CVR A;  3CRL C;  4IUU A;  3D4W A;  1DOM A;  3Q24 A;  2BE5 C;  1Y1W B;  2O2L D;  2WAQ B;  4DUZ L;  1X3E A;  1F2Z A;  3FKI B;  3HOX B;  2QF7 A;  3P75 A;  1PTO H;  4XT1 B;  3TQY A;  5KND A;  5FLM H;  4MTN A;  2NVY B;  1XPU A;  4FF4 A;  1GHK A;  5JVG 3;  2JA5 G;  4BY7 G;  1H9S A;  5HGT A;  2F4V Q;  2UXD Q;  1J6Q A;  4G7H C;  4RFB A;  3NBH B;  4O2D A;  1VQ6 A;  2EY1 A;  1TS2 A;  4BBR G;  3MXU A;  2KUM A;  3TZU A;  2MO1 A;  1JJC B;  3DWQ A;  2WP8 J;  4XYO A;  1KXL A;  3TP5 A;  1PH7 A;  2R7Z G;  5GAD C;  3OWF A;  3RN5 A;  1BUV T;  4BY1 H;  1LTL A;  2AHO B;  2R6G A;  3P1H A;  3VYU A;  5JEA H;  2A6E D;  5JJK A;  3I4O A;  1Y14 B;  1U4R A;  3UDX A;  1EYC A;  4N9T A;  1O7Y A;  3V96 A;  4PMC A;  3F2B A;  1X3Q A;  2MO0 A;  4IPG A;  2M00 A;  4DN4 M;  3L9A X;  3QG1 A;  3CP0 A;  5FO7 B;  1ZXT A;  5TSS A;  3CQZ H;  2J4X A;  4XQJ A;  4FXG C;  4DXF A;  4OGQ C;  3R93 A;  1HNZ L;  5ELO A;  1AE3 A;  2Q2H A;  4JBK A;  3S16 B;  3U9S A;  3F8T A;  1XMQ Q;  1LLR D;  5IT9 c;  1EWI A;  5LMN W;  3VR2 A;  5D3D A;  4KD4 A;  3T53 B;  1BCP C;  3KJO A;  4R4O A;  3IFD A;  2Z0S A;  4ZLT F;  3RUZ A;  2L9H A;  1T9H A;  1VCI A;  5BN4 A;  1QVG A;  1EY4 A;  4C3I G;  1OXX K;  1EY9 A;  4P71 A;  3KLW A;  1S72 A;  3MXG A;  1WD0 A;  2KA7 A;  2FHT A;  1JQY D;  2PZU A;  4JI5 Q;  1JT8 A;  5M3M H;  1CSQ A;  3CXC A;  2G9D A;  5C44 B;  1OXV A;  1PTO B;  1Q82 C;  3AYH B;  1O7L A;  2R92 G;  3QWN A;  4ZKB B;  1IL8 A;  4JI6 Q;  1A15 A;  4GLV B;  2RVL A;  2Z4I A;  4GN3 B;  1XWE A;  3VR5 A;  3FHW A;  3D4R A;  4XIG S;  3NTK A;  1GUT A;  1PZI D;  3MXN A;  3A74 A;  2F4V L;  2UXD L;  1X3G A;  2N3S A;  4BY1 B;  3WWV A;  2LKV A;  3MEF A;  3ND9 A;  2VUM H;  1DZ1 A;  4NP5 A;  2MNA A;  3OTO L;  4K0K L;  3VDY A;  4XT3 B;  1N32 Q;  2P5Z X;  1HTL D;  2V4D A;  3DEP A;  4DR4 Q;  2VW9 A;  4M8A A;  4JV5 Q;  1KL9 A;  2B2U C;  5ELC A;  4CBV A;  2KEE A;  3CC4 A;  5EPK A;  3CQZ B;  1SYB A;  3H6M A;  1NTG A;  5IYB H;  4UPA A;  3I90 A;  3ONA B;  4MN3 A;  1W3S A;  5A2Q L;  2Z8L A;  3Q22 A;  1JB7 A;  1ICF B;  4NDX A;  2K1B A;  1S5D D;  5CC4 A;  3TS2 A;  2L4N A;  3KF6 A;  1AZQ A;  4HMJ A;  3CMA A;  4CKE A;  2B8F A;  3PUV A;  4RA8 A;  1EQR A;  3PSI A;  1SDF A;  2V1C C;  3KDF A;  1XMQ L;  4A3J H;  2FFK B;  2IL8 A;  3HOZ G;  4FXK C;  5I9O A;  3F2C A;  3H91 A;  3CPF A;  2F0O A;  2F52 A;  1ASZ A;  5M3M B;  3I4N G;  3NE5 B;  5IIF A;  1QCB D;  4NPS A;  2ZJR A;  3UDI A;  1IL2 A;  2XN9 C;  1Q90 A;  1XX8 A;  1HTP A;  1A0I A;  2OF1 A;  2VS1 A;  1V1Q A;  1ROD A;  2GN5 A;  3FMC A;  1DOK A;  4JI5 L;  1GO3 E;  2RHQ B;  3GTO H;  3PO2 H;  1H9R A;  1B9M A;  4GOP A;  4PV1 C;  1EQQ A;  2IX1 A;  2PMZ B;  1HZB A;  2CWA A;  4DAY A;  3W1G A;  3WOE A;  4IFD J;  3RD4 A;  3R8B A;  2VUM B;  1HXY D;  1NSN S;  4RKL A;  4YCV A;  5KNC A;  2RBM A;  4OWX B;  4IAL A;  3S2D H;  4FF3 A;  2H4O A;  2JA7 G;  2YU9 H;  4B3S Q;  3ITP A;  1FGB D;  1NNX A;  4PNY A;  4C3J H;  1YNN C;  1S4Z A;  4DKA C;  1LT5 D;  1IYV A;  4BA1 I;  3NWT A;  4HSV A;  1HJP A;  3K8A A;  5E1F A;  3RR5 A;  3H0G G;  3A8J E;  1N32 L;  2QIL A;  1S5E D;  2B2V C;  4DR4 L;  1K83 H;  2A5H A;  4KKT A;  4OWW B;  4JV5 L;  2D62 A;  1I3Q B;  1VF7 A;  2B29 A;  3D3R A;  1RHP A;  4F88 A;  2XWB B;  3K7A H;  1EUJ A;  3BYY B;  1BBU A;  2BA1 A;  3I91 A;  2JEB I;  4UAI A;  4A3E H;  2A68 C;  3E9I A;  3W3A A;  4BXX G;  1SMY D;  4A3J B;  5KYL A;  1WTP A;  3CU7 A;  1CKN A;  4K2K A;  4FDB A;  4ALP A;  4X3K A;  1MI2 A;  1PXU A;  1JWM D;  2QEJ C;  3R2I A;  1QUQ A;  1CK1 A;  2CQA A;  4Y52 H;  4HJ9 A;  4DR3 Q;  4R9W A;  2N78 A;  1EY0 A;  4K2L A;  4BBS G;  2F0P A;  5ELE A;  3G4S A;  3Q23 A;  4ZCK A;  1QG7 A;  2QCP X;  4TSS A;  3CCJ A;  3X3M A;  3GTO B;  1F9Q A;  3PO2 B;  3I56 A;  4J6H A;  5BN5 A;  4GNX C;  3GV6 A;  2BE5 D;  1WCM H;  1Y1W G;  2WAQ G;  1PLF A;  2Q8I B;  3FKI G;  1VQE A;  2WB1 G;  5KNB A;  3HOX G;  4KHZ A;  1N36 Q;  3GTG H;  3MFY A;  1BR9 A;  1KD1 C;  3S2D B;  4RHR A;  1HZA A;  2YU9 B;  1GM5 A;  1EIG A;  1EU3 A;  1VQK A;  3DXJ C;  1HR0 Q;  4X3T A;  2JSO A;  1K8O A;  3NBH A;  2ZJP A;  2B2T A;  1A2U A;  4OO1 G;  1VF5 C;  1UWV A;  2F0V A;  4C3J B;  5ISR A;  5FLX L;  1CA6 A;  4E6I A;  4H7B A;  1OO9 B;  3I4M G;  3CPW A;  2DGY A;  2A1A A;  3GTP H;  2DUD A;  4LF9 Q;  1ENC A;  4LWC A;  4B3S L;  4K5W A;  4OON A;  4YWM A;  5AJ3 Q;  5JVH 3;  1K83 B;  3OW7 A;  1ET9 A;  4IOA A;  3KBX A;  1MJE A;  4DK6 C;  5C3W A;  3K7A B;  3ERO A;  4CDF C;  1E2V A;  2ENB A;  4CJ2 C;  1I4H A;  1E1T A;  5C4H A;  4A3E B;  2F0I A;  4J1M A;  4JYA Q;  2OTJ A;  1Y8P B;  3EJI A;  1K28 A;  4X6A H;  3UE1 A;  3OHX C;  4F8M A;  2EYF A;  1SNO A;  4U67 3;  3G48 A;  4DNI A;  1YI2 A;  3VR6 A;  5M3F G;  3NHH A;  3NBI A;  1MSH A;  4P73 A;  5C4X H;  1EYA A;  1F9P A;  4LF6 Q;  4WJ4 A;  5C0X J;  1BCP D;  3I2Z A;  1JC7 A;  5FK9 C;  2YYZ A;  1J9O A;  5IWA Q;  5CR3 A;  4JI0 Q;  1MJC A;  2B2Y A;  5JJL A;  1JOK A;  4OIJ A;  3HOY H;  1TXY A;  2K01 A;  4OL7 A;  4MIU A;  2VQE Q;  3UE0 A;  1H9M A;  1PH4 A;  5GAG C;  4DR3 L;  4UP9 A;  2WAQ E;  3H09 A;  1FNV A;  1WCM B;  5IP9 H;  2K5Q A;  4JCV E;  2E74 C;  3D6W A;  2WB1 E;  1RJT A;  2HHH Q;  2JEA I;  4ZUI A;  2OEO A;  5C44 G;  2E2H B;  2ZTE A;  4JG2 A;  1XYI A;  3GTG B;  3KF8 A;  2AUK A;  2HIX A;  3FP9 A;  1AW7 A;  4WJ3 M;  1WI5 A;  1CT1 D;  2M2L A;  4HID A;  1IBK Q;  5EQ0 A;  2K28 A;  2B2W C;  2CW0 C;  3HKS A;  4I7Z C;  1N36 L;  3AQQ A;  1ENF A;  3GTP B;  1GD7 A;  2F0M A;  3U9O A;  3U4Z A;  3CCU A;  4A75 A;  1HR0 L;  2HCI A;  5LL6 X;  5FJ8 H;  3M4Q A;  1O80 A;  3TRZ A;  1VQB A;  4LF4 Q; 
#chains in the Genus database with same CATH homology
 2N49 A;  3H3V I;  3S24 A;  1SFO H;  4JOI A;  1Q7Y C;  2F3I A;  1E7Z A;  2KBN A;  2LXK A;  2AKW B;  1S40 A;  3HOW G;  4A3D H;  1AH9 A;  1YBY A;  4YY3 Q;  1P8L A;  3ULJ A;  3EN2 A;  4JI3 L;  1HNX Q;  4LF9 L;  3S16 H;  1SE8 A;  4LFA Q;  2EQS A;  1QUQ B;  2D0P A;  2R7F A;  5AJ3 L;  1Q81 C;  1XNQ Q;  5IYD H;  1VS0 A;  1D7Q A;  1I94 Q;  2HT1 A;  2AMC B;  1V43 A;  3GTP H;  3HOY G;  3L2P A;  1VQF A;  4DUY Q;  4XTC S;  3CCQ A;  1AE2 A;  4YCU A;  3G71 A;  1PV4 A;  1OXS C;  2L15 A;  2OWO A;  2VQF Q;  1KRS A;  2NZO A;  2K4K A;  4LW1 A;  4JI7 Q;  4A93 H;  2CKZ B;  4JYA L;  5IP9 G;  4DR1 L;  2Z6K A;  3KYH C;  4X66 Q;  3CCE A;  3CCM A;  1VQM A;  1YZ6 A;  1HZ9 A;  1V9P A;  3PUW A;  5C4J H;  4DV3 L;  2I5L X;  1XNR L;  1N34 L;  4HIK A;  1N8R C;  4B3T Q;  4DPG A;  2JQO A;  1EIF A;  1N9W A;  1X56 A;  1WJJ A;  2PQA A;  3IRB A;  3STB C;  2UUA Q;  4DUZ L;  1X3E A;  1PH8 A;  4GLX A;  1PA6 A;  4JI2 L;  3F2D A;  4DV0 Q;  4LF6 L;  1P16 A;  3TQY A;  4QJF A;  4IJL A;  5FLM H;  4MTN A;  1XPU A;  3K80 C;  2KEN A;  2B63 H;  1I3Q H;  2JA5 G;  5IWA L;  1W2B A;  4BY7 G;  2D0O A;  2F4V Q;  5EAY A;  4C3I H;  3KF6 B;  2UXD Q;  4JI0 L;  1J6Q A;  3RZD H;  1FVI A;  3NEL A;  3LGJ A;  1VQL A;  5C3E G;  4O0A A;  1C7Y A;  2R93 H;  3NBH B;  1YIJ A;  4GKJ Q;  3U50 C;  4KHP Q;  4O2D A;  4A3F H;  1VQ6 A;  4BBR G;  1VQD A;  2VQE L;  2MO1 A;  1JJC B;  3I7F A;  4KI0 A;  3F1Z A;  5M5X H;  2WP8 J;  4A3L G;  4UP7 A;  3HOV H;  1YHB A;  5FJ8 G;  2R92 H;  2ES2 A;  1YVC A;  2NVX H;  1KXL A;  1PH7 A;  4DR7 Q;  2R7Z G;  5GAD C;  3M85 A;  1HNW L;  1X55 A;  3K81 C;  3RN5 A;  2VZA A;  4HJ7 A;  2HHH L;  3J80 i;  4BY1 H;  4QQB X;  1LTL A;  2UUB Q;  2AHO B;  2R6G A;  3CAM A;  4QGU A;  3T1H Q;  4A3D G;  5JJK A;  3I4O A;  3B6Y A;  1KRT A;  4IPC A;  1Y14 B;  3PUX A;  1OXU A;  2UXC Q;  4P75 A;  4B3R Q;  3UDX A;  3F2B A;  3H15 A;  5IYD G;  1TWF H;  1X65 A;  3DM3 A;  1MKH A;  1IBK L;  2MO0 A;  4IPG A;  1VQO A;  1G6P A;  4A76 A;  3ZJY C;  2RF4 A;  4UY8 C;  1FJG Q;  4KLK A;  3CP0 A;  2NVT H;  4JI4 L;  3L7Z C;  4LF7 Q;  3CQZ H;  3HKZ G;  5JEA J;  1OXT A;  1YIT A;  4MNO A;  1B8A A;  4APV A;  2K5V A;  1NJI C;  5IY0 A;  5ELO A;  3J81 j;  1HNZ L;  1AE3 A;  2Q2H A;  4A93 G;  4JBK A;  1NBW A;  3AEV A;  3CC2 A;  1KC8 C;  3BJU A;  3F8T A;  1XMQ Q;  5IT9 c;  1EWI A;  5LMN W;  4AIM A;  1VQA A;  3PO3 H;  2R7D A;  1IBM Q;  1PFS A;  3J80 c;  1E24 A;  1EYG A;  3KJO A;  3T1Y Q;  4LUO A;  4R4O A;  2Q2T A;  3CCV A;  2Z0S A;  4A4I A;  1T9H A;  1HNX L;  1H95 A;  5FLM G;  1XNQ L;  1VCI A;  2Q2I A;  2XTI A;  4LFA L;  4JC0 A;  2B63 G;  2KHI A;  1QVG A;  5J3B A;  3PUZ A;  1OXX K;  4MZ9 A;  4OXP A;  1SLJ A;  4P71 A;  1R9T H;  1I94 L;  2Z6K C;  4POG A;  1Z9F A;  2ZM6 Q;  3S2H H;  2KCT A;  3ER0 A;  3KLW A;  4PMW A;  1SMX A;  5M5W H;  4DUY L;  2CFM A;  1S72 A;  1NE3 A;  4JI5 Q;  1JT8 A;  2Y0S E;  5M3M H;  1YEZ A;  1CSQ A;  3CXC A;  1VQG A;  2VQF L;  3S1R H;  1OXV A;  1Q82 C;  4JI7 L;  3AYH B;  4OX9 Q;  3CF5 A;  4LUZ A;  2R92 G;  3HOV G;  4JI6 Q;  3CD6 A;  4GLV B;  4JBJ A;  3J7Z C;  1JMC A;  2ATW A;  3HOZ H;  1FL0 A;  4GN3 B;  4BY1 G;  2HIV A;  2K75 A;  4DR2 Q;  2AWO A;  4B3T L;  2E8G A;  5M5Y H;  3CC7 A;  2R7Z H;  3JC6 6;  5JEA G;  2UUA L;  4PZ8 A;  2I5H A;  3BZK A;  3FHW A;  4NXM Q;  2K14 A;  5DLQ E;  4AYB G;  2ASB A;  4XIG S;  3I4N H;  4GN5 A;  1SRU A;  1O7I A;  4P72 A;  3CCS A;  4LUV A;  4DV0 L;  3EBE A;  1CKN B;  2VNU D;  1IZ6 A;  4PZ6 A;  3KJP A;  4NXN Q;  4IFD G;  4B3M Q;  2JA6 H;  2JA8 H;  4LF8 Q;  3A74 A;  2F4V L;  2UXD L;  1BVS A;  1X3G A;  2N3S A;  1VQ5 A;  1Q86 C;  3PUY A;  5IYC H;  5GRO A;  3WWV A;  3MEF A;  2UUC Q;  2VUM H;  4IFD I;  4A3G H;  1K73 C;  4GKJ L;  1L0W A;  3ERS X;  4KHP L;  1EIY B;  1M1K C;  3NEN A;  2EIF A;  2MNA A;  3OTO L;  2AWN A;  4K0K L;  3HFZ B;  4GN4 B;  4R1J A;  3VDY A;  1N32 Q;  3ULL A;  4PZ7 A;  4DR4 Q;  2VW9 A;  3PO3 G;  4JV5 Q;  1KL9 A;  1JE5 A;  2UUB L;  4HIM A;  4GLA C;  3HKZ E;  1PH2 A;  2QEX A;  1WYD A;  2PI2 E;  3CC4 A;  3T1H L;  3M4O H;  2JA9 A;  1NTG A;  5IYB H;  4LFC Q;  2UXC L;  4UPA A;  4B3R L;  3L0O A;  1YHA A;  2JA6 G;  2JA7 H;  2GVB A;  5LMN Q;  1VQN A;  2K50 A;  1W3S A;  3GD7 A;  4LF5 Q;  3E0E A;  1JB7 A;  2E2H H;  1VQC A;  4IJH A;  4Y7N H;  3TEH B;  3TS2 A;  3UDG A;  1C9O A;  4LF7 L;  2B3G A;  3S1N H;  5M3M G;  4R4C A;  3KF6 A;  3CMA A;  1PH3 A;  1KHI A;  1TWC H;  3PUV A;  2A8V A;  3GTL H;  1I50 H;  1EQR A;  4JI1 Q;  2PQA B;  5K36 G;  3PSI A;  2UXB L;  1Q46 A;  2V1C C;  3H0G H;  3KDF A;  1XMQ L;  4A3J H;  4GKK Q;  3D0F A;  3HOZ G;  1X3F A;  3S1M H;  4LFB Q;  2ALY B;  4C2M H;  1PYB A;  3GTK H;  2BH2 A;  4P74 A;  4DV2 Q;  1IBM L;  3F2C A;  3RZO H;  1VQ7 A;  1HZC A;  3PV0 A;  1Q1E A;  3CPF A;  3T1Y L;  1LM0 A;  2F52 A;  4L5T A;  2RCN A;  1L1O A;  5HGQ A;  1ASZ A;  3PF5 A;  3I4N G;  3AFP A;  4NPS A;  4NB3 A;  1QZH A;  2ZJR A;  2YTY A;  1I6H H;  3UDI A;  1IL2 A;  4RG1 A;  4DAM A;  1YJW A;  3I55 A;  2JA8 G;  4BXX H;  3PCO B;  1LUZ A;  3U58 A;  4L5R C;  2JE6 I;  1A0I A;  5IYC G;  4HJ8 A;  2VUM G;  2VS1 A;  1TWA H;  2ZM6 L;  4X62 Q;  4A3I H;  1V1Q A;  4A3G G;  4DV1 L;  2GN5 A;  1YHQ A;  1PH6 A;  4AYB E;  4IOC A;  4JI5 L;  1GO3 E;  4GNX A;  2RHQ B;  1NY4 A;  3GTO H;  3CCL A;  3PO2 H;  3W1B A;  4OX9 L;  1TWH H;  4GOP A;  4JOI C;  1M90 C;  1XNR Q;  4IPH A;  1EQQ A;  2IX1 A;  4YHH Q;  1HZB A;  2CWA A;  4QY7 A;  3W1G A;  4DV6 Q;  1VQP A;  1Q8K A;  4IFD J;  1U0L A;  1QVC A;  4DR2 L;  3RLO A;  2YTX A;  4BBS H;  2QGQ A;  2KHJ A;  4A3C H;  3GDE A;  4YCV A;  4LF4 L;  1BKB A;  1XMO Q;  4OWX B;  5IYB G;  2E5L Q;  3S15 H;  3ULP A;  2CWP A;  3S2D H;  1WCM G;  3ICE A;  4DR5 Q;  2JA7 G;  2YU9 H;  1N33 Q;  4X65 Q;  4NXN L;  1YJ9 A;  4YY3 L;  4B3M L;  4B3S Q;  5BR8 Q;  4DR6 Q;  2A19 A;  5GAH C;  4DV5 Q;  4DV7 Q;  4LF8 L;  1HR0 W;  1ASY A;  1Y1W H;  1XPO A;  4C3J H;  3PIO A;  1YJN A;  4DKA C;  4HJ5 A;  2UUC L;  2NN6 G;  3FKI H;  2ZTC A;  4BA1 I;  1VQ9 A;  1CKO A;  3NEM A;  1VQI A;  2OQ0 A;  1HJP A;  3K8A A;  3OYY A;  4X64 Q;  5LMU Q;  3RR5 A;  2BA0 A;  1KAW A;  1DGS A;  3H0G G;  1SN8 A;  4A3J G;  4TQU S;  2NN6 I;  1N32 L;  1Z47 A;  1PYS B;  2H5X A;  4DR4 L;  1K83 H;  2ID0 A;  4OWW B;  4JV5 L;  3KF8 B;  4X66 L;  2D62 A;  4R4I A;  2B29 A;  1E22 A;  1VQ8 A;  5IE8 A;  3SGI A;  1X9N A;  3K7A H;  1EUJ A;  2BH8 A;  2JJQ A;  2K5N A;  1BBU A;  1UE6 A;  2BA1 A;  2JEB I;  1PHJ A;  3S17 H;  3I4M H;  4A3E H;  1FGU A;  3E9I A;  1JJG A;  2UU9 Q;  5LMN L;  4BXX G;  2IY5 B;  4ME3 A;  4H02 A;  3J7A 5;  4LF5 L;  2I0Q A;  2IHF A;  3CCR A;  3CW2 C;  4C3H H;  4A3I G;  3HOU H;  1CKN A;  3E9H A;  3A5Z B;  4FDB A;  4ALP A;  1J5E Q;  1XPR A;  2HQL A;  3PO2 G;  1QUQ A;  2N8N A;  5HY6 A;  5C0X G;  2YV5 A;  1I5F A;  4JI1 L;  5FLX c;  2PMZ E;  4QL5 A;  4HJ9 A;  4AQY Q;  4A3B H;  1L1O C;  4Y52 H;  1G29 1;  1LYL A;  5JJI A;  4DR3 Q;  3W5O A;  1QZG A;  4GKK L;  2N78 A;  5GQO A;  3J81 c;  4LFB L;  2K5H A;  1L2F A;  2IT1 A;  4UP8 A;  5C0X I;  3S1Q H;  2XGT A;  4DV2 L;  3GTM H;  4DR7 L;  4BBS G;  4LNQ A;  4A3C G;  2FXQ A;  3G4S A;  3MXN B;  5C4X G;  1Y1V H;  3JAM c;  3CCJ A;  2JK8 A;  5M3F H;  1CKM A;  3I56 A;  4TVA B;  4GNX C;  2LXJ A;  3STB D;  1WCM H;  5IP7 H;  3M4P A;  1Y1W G;  4GOP C;  2WAQ G;  1RL2 A;  4R4Q A;  4X62 L;  4JBM A;  1K8A C;  3FKI G;  1VQE A;  2WB1 G;  3HOX G;  1N36 Q;  2C35 B;  4KHZ A;  3GTG H;  2E2I H;  1FJG L;  4OWT B;  1KD1 C;  3GO5 A;  4JBW A;  1HZA A;  4DV4 Q;  3M3Y H;  3RNU A;  2CCZ A;  3TRE A;  1GM5 A;  1YNX A;  1VQK A;  1HR0 Q;  3PF4 A;  2ZJQ A;  2VY3 A;  4A3M H;  2MFI A;  4YHH L;  2ZJP A;  3A5U A;  1XTD A;  4JI8 Q;  1SRO A;  1UWV A;  4DV6 L;  1IBL Q;  4OO1 G;  1EFW A;  4EX5 A;  3DLL A;  2YTV A;  3EIV A;  5C44 H;  1XMO L;  5ELN A;  1A62 A;  2Y0S G;  1E3P A;  4AH6 A;  2E5L L;  3M9B A;  3RLF A;  3M7N A;  4A3K H;  3TS0 A;  4OO1 I;  3I4M G;  4A3E G;  4DR5 L;  4DK3 C;  2DGY A;  2A1A A;  2LSS A;  4X65 L;  3CPW A;  4JI3 Q;  1N33 L;  2DUD A;  1K8G A;  4LF9 Q;  1HH2 P;  4LWC A;  4B3S L;  5BR8 L;  1A63 A;  4OON A;  4YWM A;  5AJ3 Q;  1U5K A;  1PH1 A;  1SR3 A;  4DV5 L;  4DV7 L;  4DR6 L;  3HOU G;  1X6O A;  1EOV A;  4YWL A;  4YWK A;  5GAE C;  2QA4 A;  4IOA A;  3BZC A;  1MJE A;  3KDF B;  4DK6 C;  1C0A A;  1QVF A;  2MQH A;  2OQK A;  3OTO Q;  1Q12 A;  4K0K Q;  4X64 L;  2NVQ H;  1PVO A;  2OCE A;  4IPD A;  3U4V A;  1E1T A;  5LMU L;  4A3B G;  1X54 A;  2NZH A;  5E7N A;  4JYA Q;  2OTJ A;  5H1S E;  1L1O B;  3H3V H;  3AFQ A;  4DR1 Q;  3UE1 A;  3KFU A;  1WOC A;  1XJV A;  4RMF A;  4X6A H;  4DV3 Q;  3A0J A;  3KOJ A;  1JJ2 A;  4JI6 L;  2VL6 A;  1N34 Q;  3G48 A;  4DNI A;  4L5Q A;  1YI2 A;  3K0X A;  3S14 H;  1Q1B A;  1Y1V G;  4R4T A;  4DUZ Q;  5M3F G;  3RN2 A;  1UE1 A;  1NMG A;  1BBW A;  4JI2 Q;  3HOW H;  2GVA A;  1G51 A;  4P73 A;  5C4X H;  4NXM L;  2PNH A;  4LF6 Q;  2UU9 L;  1OTC A;  4WJ4 A;  4IO9 A;  5IP7 G;  2ZTD A;  5C0X J;  3I2Z A;  1GKH A;  4GNX B;  2YYZ A;  5IWA Q;  1K0R A;  4JI0 Q;  1MJC A;  4GOP B;  2PI2 A;  4HJA A;  1J5E L;  1MIU A;  2K52 A;  5JJL A;  4DAY B;  2I5M X;  3HOY H;  1TXY A;  3K7U C;  2VQE Q;  3HOX H;  2UXB Q;  4AQY L;  3UE0 A;  1PH4 A;  1TWG H;  5GAG C;  4DR3 L;  4A3M G;  4L5S A;  2NVY H;  4UP9 A;  1UE5 A;  1E1O A;  2IHE A;  2WAQ E;  5IP9 H;  4JCV E;  1VQJ A;  3BU2 A;  1HNW Q;  2KCM A;  3J81 i;  1IYJ B;  2WB1 E;  2HHH Q;  2JEA I;  4PG3 A;  1B70 B;  5C44 G;  2ZTE A;  1S3O A;  4JG2 A;  1PH9 A;  3PGZ A;  3G6E A;  2WFW A;  4A3K G;  4POF A;  1IXR A;  1B7Y B;  1CUK A;  1UEB A;  2CQO A;  2HIX A;  3FP9 A;  3UDF A;  3JAM i;  2Q2U A;  1UE7 A;  2IX0 A;  3GTQ H;  2E2J H;  1WI5 A;  4WJ3 M;  1CSP A;  4LFC L;  1KIX A;  4YCW A;  1RIP A;  1NMF A;  2OTL A;  2R93 G;  4HID A;  1IBK Q;  2JA5 H;  4BY7 H;  4DV1 Q;  4A3F G;  1D8L A;  3HKS A;  4BA2 I;  3RLN A;  1N36 L;  3AQQ A;  3OW2 A;  4EQ5 A;  5C3E H;  4JI4 Q;  1VQ4 A;  1WFQ A;  3D31 A;  1PH5 A;  1VQH A;  3Q8D A;  4QIW E;  4J15 A;  4DV4 L;  4BBR H;  1KQS A;  1HNZ Q;  1GD7 A;  2EXD A;  3PIP A;  3U4Z A;  4HIO A;  3CCU A;  1K3R A;  4A75 A;  1K9M C;  1HR0 L;  4A3L H;  4GS3 A;  5FJ8 H;  3M4Q A;  4JI8 L;  1A8V A;  3CME A;  3GTJ H;  1IBL L;  3TRZ A;  1VQB A;  2RHS B;  4LF4 Q;  1GVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...