1G6PA

Solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the cold-shock protein from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics
molecule keywords COLD SHOCK PROTEIN TMCSP
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1g6pA00
2KCMA 1KQSA 4OX9L 3KF8B 2JEAI 3IRBA 4JI2L 5JJIA 2UU9L 4MZ9A 2NN6G 2NVTH 3OTOL 1WJJA 1Q46A 1P16A 1VS0A 1HNZQ 2CCZA 4BA1I 1Q1EA 1WYDA 1Q86C 2NVXH 2AKWB 2CWPA 2PI2E 4DR7Q 2B29A 1H95A 2D0OA 2OWOA 1CKNA 4O0AA 4HJAA 2NVYH 1XMQQ 2RF4A 3I2ZA 4GKJL 1L2FA 3E9IA 1KAWA 1TWFH 3NENA 4HJ8A 3HOWH 1CKNB 3PUWA 2HT1A 3JAMc 4BA2I 1KL9A 1VQAA 1QUQA 3T1YQ 3RZDH 2ES2A 1WFQA 4JCVE 2YU9H 1L1OA 5M5XH 3K8AA 4EQ5A 4LF7L 2LXKA 4UP7A 1EQRA 4DV1L 3HOVH 3HOXG 5AJ3L 2YYZA 1Q1BA 1Y1VH 1KXLA 2DUDA 5FJ8H 4LF6L 4GOPB 2PQAA 5EAYA 5C0XG 4GLVB 4X66Q 3F2BA 1OXXK 2VQEL 4DAYB 4IFDG 4A3FH 4JI7L 1E1OA 2LXJA 3HOUH 3GTJH 2AHOB 3W1GA 4XTCS 1QVGA 4Y7NH 5M5YH 4JI6L 1X3GA 2OQKA 2IT1A 2Z6KA 4BBRG 4HIDA 2AMCB 1PH6A 2C35B 2Q2HA 2VQEQ 4TVAB 4DR3L 2NVQH 4YCVA 4L5RC 2N3SA 3M4QA 3KDFB 4YCWA 1VQJA 5GROA 5GAGC 1PH3A 4X6AH 1CUKA 3B6YA 3GTGH 1FL0A 4JI2Q 4A3GG 3S2HH 3S1NH 5IWAQ 1TWAH 3CC2A 3CXCA 1D8LA 2NZHA 2JK8A 4DR5Q 4DR7L 4X62L 1M1KC 3F2DA 4A3GH 1PH2A 1VQBA 5IYDH 2ATWA 3I7FA 4UY8C 2KHJA 1X65A 2E5LQ 1M90C 2N49A 5JJKA 5IYCH 4DV5Q 1I94L 1FJGQ 2WB1G 3I4NG 4JI4L 1WOCA 1IBKL 4QJFA 1X55A 2RHQB 4OONA 2K14A 2RCNA 1QUQB 3HOXH 2D0PA 4DV4L 1Q82C 1VQ6A 3PO2H 3L2PA 1VQFA 2OTJA 1SRUA 3CPFA 2ZJPA 3GD7A 1KIXA 3ULPA 2JA5G 1UE1A 1PFSA 1PYSB 1Q12A 3J80c 3HOWG 1NBWA 1JJGA 1JB7A 4BY7H 4LF5L 4BBRH 4JI7Q 1VQNA 3PUXA 1QVCA 1VQOA 3J7A5 4DR4L 1B7YB 5M3FG 2JA9A 1B8AA 2JQOA 2WB1E 3CCRA 1HNXQ 2BH8A 4YWMA 4A3CH 3I56A 3HOYH 5BR8Q 1E22A 3S14H 4JI8Q 4GKJQ 3U50C 1K83H 5JEAJ 4HJ5A 3UDGA 4JV5Q 2UXBL 5FJ8G 4KHPQ 1XNRL 4DR3Q 3PUZA 1SR3A 1I3QH 4EX5A 3RLNA 3HFZB 4DPGA 5M3MH 4B3TL 3AQQA 1UWVA 2BA1A 3DM3A 3ULJA 2EXDA 2VL6A 3M4OH 1T9HA 5BR8L 3JC66 4A3EH 4TQUS 4DR5L 4JV5L 1OXTA 4OWXB 5LMNW 1NTGA 2ZJQA 1HJPA 2PNHA 3A5ZB 3M85A 1JMCA 2UXDQ 4AYBE 2MQHA 3CAMA 1Q81C 4LF4Q 1XNQL 4B3RQ 4X65L 2B63G 1A62A 4B3MQ 1I5FA 1UE7A 1QZHA 1E7ZA 1VQHA 3NELA 1FJGL 2YTVA 5IP7H 1Z9FA 3L7ZC 4DV5L 1I94Q 3VDYA 2UU9Q 2FXQA 4A4IA 4JOIA 2PI2A 1V1QA 3HKZE 3PGZA 1V43A 3S1RH 1G51A 3UE0A 5LMNQ 2K50A 4IOCA 1YI2A 1YHQA 1A0IA 3ER0A 2GN5A 1SFOH 4QIWE 1NMGA 1YIJA 5C0XI 1HZAA 3AEVA 1N33L 4YHHL 4GNXC 1X6OA 4YY3L 4A3KG 4C3IH 3H0GH 4DV2L 3CCQA 4POGA 2Q2UA 4C3HH 4DV3L 2CQOA 3KF6A 4A3IH 1EQQA 1KD1C 2UUBL 1PV4A 3HKSA 3I4OA 1FVIA 1RIPA 1XTDA 3S15H 1C7YA 4KHPL 5GAEC 1XMOL 5JJLA 3GTOH 3GO5A 4JI8L 3J80i 3J7ZC 1Z47A 2UUCQ 1CKOA 2D62A 5HGQA 4GOPA 2Y0SE 4LUZA 4DV4Q 2YV5A 4R4IA 4PZ8A 3U4ZA 1HZCA 2WAQE 1PH1A 1N36L 2JA6G 1OXUA 4GLAC 4JG2A 4A3FG 1IBMQ 3HOUG 4IO9A 3GTLH 4PZ6A 2WFWA 2K52A 4JC0A 2F4VL 1IBLL 3AYHB 2AWOA 3CC4A 3G71A 3I4MH 2Q2IA 3KJOA 2NN6I 4A3EG 1X3EA 2CWAA 5C0XJ 3T1HL 1VQ7A 4OWWB 1HNWQ 5C44G 2MFIA 2VS1A 1BBWA 5AJ3Q 4DR2L 3G6EA 4ALPA 5FLXc 2RHSB 1R9TH 4DK6C 3L0OA 3RR5A 4L5TA 1EOVA 3CW2C 2E5LL 1Y1VG 3U4VA 3W5OA 4LF8L 2I5MX 4IOAA 4HIKA 3CMEA 2K5HA 4LW1A 1VQMA 1J5EQ 2R92H 3S1MH 1L1OC 4UP9A 1JT8A 1PYBA 3M4PA 3ZJYC 3KLWA 3BZCA 5M3FH 5LMUL 1EYGA 1U0LA 1GD7A 4JI3Q 3CMAA 3UDXA 4IJLA 3TQYA 4XIGS 4R4CA 1VQLA 2WP8J 4OXPA 4DV3Q 2UUBQ 3TS2A 2KHIA 5HY6A 1OTCA 5FLMH 4HJ9A 3PIPA 3RZOH 1AE2A 3AFQA 4LFAQ 3W1BA 2E2HH 3J81c 1KC8C 1KRSA 2BH2A 2QGQA 4OO1G 1JE5A 4GN3B 2I0QA 2ZTCA 2UUAQ 1FGUA 1HR0Q 3KOJA 1C0AA 4GS3A 1PH5A 4R4OA 3S1QH 2JA7H 5GQOA 4A3BH 5IT9c 3M3YH 1L1OB 3FKIH 1VQ5A 4IPCA 4DV0L 1Y1WH 4GN4B 3KJPA 4DV1Q 2EIFA 3ERSX 4LFAL 4LFBL 1N32Q 4A3MG 1HZBA 4JBKA 2F4VQ 4QY7A 3TRZA 1HZ9A 4JI1L 1ASZA 2JA8G 2N8NA 2YTXA 3CCEA 4B3SL 1EIYB 1K9MC 1PH4A 1IXRA 4JI6Q 1VQKA 2HHHQ 1D7QA 5IYBH 2R92G 3PO3G 3E0EA 1VQCA 4LFBQ 1N32L 3PV0A 1PVOA 1YHBA 4C3JH 4LFCQ 4P74A 4DK3C 1IYJB 4PG3A 4DR1L 1WI5A 1J5EL 4LUVA 3UDIA 2B3GA 1YJNA 2IX1A 1I50H 4L5QA 3TREA 2VUMG 2VNUD 4RG1A 1E1TA 2GVBA 4X64Q 5J3BA 1S40A 1YITA 1XJVA 4A3CG 2Z0SA 3RNUA 1SROA 1VQ9A 3GTPH 1X3FA 4H02A 3STBC 4JI0L 1N8RC 4IFDI 1P8LA 1MJEA 4K0KQ 4GN5A 2KENA 2MO0A 5IP9H 1HR0W 2ASBA 4A3LG 5K36G 4BXXG 1XNQQ 3AFPA 4R1JA 1JJCB 2QEXA 3TEHB 2CFMA 2Q2TA 1KRTA 4LF6Q 2OTLA 4HJ7A 4A76A 2UXDL 4A3BG 3A5UA 2GVAA 4GOPC 4A93H 3H0GG 4RMFA 4DV6L 3F8TA 3A74A 2IHFA 2OQ0A 1CKMA 4NB3A 4OWTB 4DV2Q 3KYHC 4ME3A 1N34L 4FDBA 3RN5A 2R7ZG 3CCLA 4BBSG 3PIOA 4DV7Q 4POFA 2IX0A 1PH9A 2F3IA 1VCIA 4LWCA 5E7NA 1E24A 1S3OA 1Y14B 3CQZH 2UUCL 5IYDG 4NXML 3PUYA 4JI5L 1YBYA 3J81i 4A3JG 1PH7A 5ELOA 2PMZE 1V9PA 3CD6A 3S24A 1CSQA 1XPOA 3T1YL 4B3SQ 2AWNA 5GADC 3BJUA 2OCEA 4DV7L 1W2BA 3GTQH 2HQLA 2R7FA 4UPAA 3DLLA 2A8VA 3U58A 4DKAC 2A1AA 2UXBQ 2JA8H 2XGTA 3NBHB 1AH9A 2K75A 4UP8A 1AE3A 2WAQG 1N9WA 1UEBA 2NZOA 2R7DA 4YWKA 3A0JA 1QZGA 3JAMi 3G48A 2Y0SG 4DR2Q 3OW2A 3T1HQ 3I4MG 4BY7G 4A3LH 1GKHA 1YEZA 1SMXA 1U5KA 3EIVA 4NXNQ 2Z6KC 1L0WA 1Q8KA 2KBNA 1IL2A 1A8VA 3PO2G 2CKZB 5C3EG 4DR6Q 2EQSA 3HOYG 3RLOA 4BY1G 1C9OA 3UDFA 4JI0Q 3CCMA 2QA4A 4AYBG 3S17H 1GVPA 2JE6I 4Y52H 2I5HA 5ELNA 2JJQA 4B3ML 3H3VH 2F52A 4J15A 1YVCA 3HKZG 1OXSC 3KF6B 4X65Q 3E9HA 4A3DH 4KHZA 4X62Q 1J6QA 1EIFA 1MJCA 2K4KA 2KCTA 4P73A 2MNAA 4JI3L 1YHAA 4LUOA 4LF9Q 4DR1Q 1YJ9A 4DUYQ 2UXCL 2YTYA 4HIOA 2IHEA 4JBJA 1OXVA 1O7IA 3K80C 1HNWL 1G6PA 3STBD 1YJWA 4IFDJ 4WJ3M 1UE5A 4NPSA 4C2MH 1K8GA 1HNZL 4MTNA 1N34Q 1QVFA 3UE1A 3GTMH 4P72A 4YY3Q 4P71A 1N33Q 1XNRQ 3OTOQ 3G4SA 3M7NA 4GKKQ 5IYCG 4YCUA 2B63H 5JEAG 3CP0A 1TWHH 4DNIA 2XTIA 4HIMA 1VQ4A 4DUYL 1UE6A 1CSPA 1NJIC 1JJ2A 4JI5Q 1NE3A 1VQDA 1XMQL 2ZJRA 4NXMQ 3FHWA 1PHJA 1SN8A 4A75A 2R93G 4OO1I 1DGSA 1B70B 5M5WH 1TWCH 4DR4Q 4DUZL 2ZM6L 2LSSA 3D31A 1HNXL 1Y1WG 4WJ4A 2MO1A 3PF5A 1VQGA 3K7AH 1XPRA 1GM5A 4AH6A 4LF7Q 1NMFA 3WWVA 4A3JH 4IPHA 1TXYA 1W3SA 1K0RA 3K7UC 1SE8A 3LGJA 1S72A 4DR6L 2JA5H 3GTKH 1IBML 3PO3H 3OYYA 4APVA 3F2CA 1VQ8A 1K8AC 4X66L 5IY0A 3D0FA 3MEFA 5LMUQ 4PMWA 4LFCL 4IJHA 4GLXA 1HR0L 2HIXA 4KI0A 2K5NA 1YNXA 4JBMA 2R6GA 4R4QA 2VZAA 4AIMA 4QL5A 4DAMA 2VQFL 3S16H 4GNXB 1VQPA 1ASYA 1TWGH 4X64L 1E3PA 1BVSA 3FKIG 3PSIA 4IPGA 4YHHQ 3H15A 3HOVG 4QGUA 2BA0A 4LF8Q 4JYAL 2JA7G 3KDFA 4JI1Q 5IP9G 3HOZG 4A3KH 2R7ZH 4BBSH 1VQIA 4KLKA 5IWAL 3FP9A 4R4TA 4DV0Q 1X54A 2JEBI 4NXNL 4PZ7A 3K81C 3ULLA 1LUZA 4JYAQ 4A93G 3CCSA 3I55A 5LMNL 1X9NA 4LF5Q 2E8GA 3PUVA 4DV6Q 4O2DA 1NY4A 4GKKL 3BZKA 4AQYQ 1MKHA 1SLJA 3F1ZA 5IP7G 3CC7A 4DUZQ 1LTLA 2HIVA 1MIUA 5GAHC 1PA6A 4A3MH 1GO3E 4P75A 2ZM6Q 1X56A 1IBKQ 4QQBX 4JI4Q 2UXCQ 1XPUA 4LF9L 3J81j 2ID0A 2VUMH 3KFUA 3M9BA 2V1CC 4AQYL 1BBUA 3Q8DA 3RLFA 1EUJA 3CPWA 1XMOQ 2L15A 2R93H 2VY3A 3PF4A 1RL2A 3TS0A 3CCVA 5C44H 1N36Q 3I4NH 2H5XA 5IYBG 4LNQA 1K3RA 2E2IH 4B3RL 1I6HH 5FLMG 1LYLA 1VQEA 1YZ6A 2VQFQ 4GNXA 1WCMH 5C4XG 2HHHL 5H1SE 1K73C 2ALYB 5IE8A 4YWLA 1PH8A 4L5SA 3EN2A 5C4JH 3NEMA 3BU2A 4IPDA 1EFWA 4B3TQ 4BY1H 2PQAB 1WCMG 5C4XH 3GDEA 2A19A 5C3EH 2K5VA 1IBLQ 2JA6H 3CCUA 1KHIA 1BKBA 1A63A 5DLQE 4OX9Q 1IZ6A 5M3MG 4BXXH 4A3DG 3PCOB 2IY5B 1G291 3RN2A 2I5LX 4MNOA 3CF5A 1LM0A 4JOIC 3ICEA 3S2DH 2ZTDA 3CCJA 3K0XA 3HOZH 1EWIA 1HH2P 2N78A 3EBEA 1Q7YC 3MXNB 3SGIA 4A3IG 2VW9A 4LF4L 2E2JH 2UUAL 4K0KL 3H3VI 2ZTEA 2DGYA 4JBWA
chains in the Genus database with same CATH superfamily
1RODA 2JA8B 3DWQA 3IRBA 3G7LA 3OTOL 1Q1EA 1Q86C 4FVMA 2A6EC 2B29A 2D0OA 3TP5A 2CVRA 1H9JA 1STEA 2NVYH 1IYUA 2A68D 2RF4A 3K7AB 1I50B 3PUWA 3J7AF 4BA2I 1DM0B 2KUMA 4UHVA 1QUQA 3T1YQ 3RZDH 4JCVE 4EQ5A 3GTPB 1I4GA 5AJ3L 4I65A 4A3IB 2DUDA 2ICIA 5G3LF 4DN4M 3F2BA 1QCBD 4DAPA 3HOUH 2AQ1B 1E1OA 4BBRB 1II3A 4XTCS 1KNAA 2PCFB 2Z9HA 3V2TA 5I2XA 1DXMA 2AMCB 3I73A 2C35B 4DR3L 4L5RC 4YCWA 4NP5A 5GROA 3A8IE 2IX3A 2BE5D 4A3GG 3J81L 2E2HB 3PMFA 3P7JA 4RH6A 4K8JA 4XQJA 2JK8A 4X62L 3F2DA 2K1BA 1STHA 1VQBA 1KNEA 3VR4A 5K5PA 1GJXA 5IGFA 2FHTA 4N8X1 1Y8OB 2RDHA 3GTMB 4JK1C 3D3RA 4QJFA 3SXHA 1TWGB 2JN4A 2CH4A 2K14A 4RGTA 2D0PA 1GUOA 1LACA 4AYBB 2XNAC 5E1FA 1SRUA 4M1UB 1KIXA 1UE1A 3J80c 3HRZC 1NBWA 1V8QA 2IL8A 1JB7A 4LF5L 4CDEC 4IUQA 5M5YB 4DAVA 4A3CH 1R9TB 1F2YA 2F0PA 4JI8Q 4JVZA 1DOKA 3UDGA 4JV5Q 1C8CA 4KHPQ 2B2UC 1BO0A 1TIID 2F4IA 2K05A 4C56C 4IUTA 4FF3A 4JV5L 2FMMA 2EY5A 4O1NA 3I90A 5LMNW 2ZJQA 2L1BA 2VUMB 4FNFA 3M85A 5M5XB 3O13A 1Q81C 3Q6SA 4B3RQ 1GXDC 1VF7A 4X65L 1BQQT 2AUKA 2YTVA 1Z9FA 3L7ZC 1JR0D 4G57A 1V1QA 1G51A 3GTQB 3UE0A 3D4RA 2JA5B 5C4JB 2LS01 4QIWE 2H1EA 1HZAA 3AEVA 3ND8A 1X6OA 4GNXC 4A3KG 2XRSD 1KD1C 3HKSA 3I4OA 1RIPA 4KHPL 2ZXRA 5GAEC 3MXUA 2KOLA 3GO5A 5HGQA 4LUZA 1S5FD 2YV5A 4R4IA 5BN4A 1SBBB 3MHBA 2WAQE 2B2WC 3NBIA 1RKNA 5KYIA 3I3CA 4I7ZC 3HOUG 3TDQA 3VYRA 4KD4A 1RJTA 2WFWA 2K52A 2MPMA 1Y1WB 3AYHB 1UUPA 1AN8A 2D9UA 3KJOA 2VXWA 2NN6I 2EXZA 3NXWA 5CV8A 5AJ3Q 1JQYD 4K5WA 1R9TH 4DK6C 1F2ZA 5BN3A 5FO9B 3VA5A 1LLRD 1Y1VG 3I70A 4LF8L 5K36H 4HIKA 2EYOA 3CMEA 5CBAE 4K5VA 1Z7TA 3VR6A 1VQMA 1J5EQ 2Q8RE 3H94A 1DOLA 4Z9CB 1CHPD 1HA6A 2RQXA 3PO2B 4IJLA 4XIGS 1CA5A 4OHJA 1G2SA 2BDOA 2R61A 3TS2A 4BY7B 1GUNA 2NTTA 3PIPA 1AE2A 3AFQA 3J81c 5IOCA 5A35A 1SEBD 1PH5A 4RKLA 3HGBA 3HOZB 4A3BH 3SK6A 2JXMB 3S2DB 3HEJA 2O2LD 3A8KE 2BDNA 4LFBL 4LFAL 2FFKB 4JBKA 4KTAA 2F4VQ 4QY7A 3RD4A 4F7XA 3TRZA 1EY9A 3VYUA 1I4PA 4U68A 4B3SL 1PZID 2AQ2B 1PH4A 2NZ1D 4XT3B 5CV5A 4FXGC 1PVOA 1A6XA 1I4QA 3S15B 4DR1L 1WI5A 4JPBW 1TY2A 4LUVA 2B3GA 2IX1A 2OXPA 3IAYA 1EU4A 1YITA 2O4XA 3RNUA 5A2QE 2B2TC 1VQ9A 4DAYA 3GTPH 3E6ZX 4Q5VA 2F3VA 1SXTA 4IFDI 3M4YA 2KENA 2MO0A 5IP9H 1TS5A 4V190 3AFPA 5M3MB 3TEHB 1KRTA 1NAPA 4HJ7A 1HUNA 3F8TA 3I91A 3A74A 2IHFA 4NB3A 3N52A 4DV2Q 5C4XB 1L0XB 1N34L 2R7ZG 2CW0D 4QMGA 3RN5A 3CCLA 2IX0A 1O7ZA 1PH9A 1HTLD 1YNJD 5E7NA 2UUCL 4NXML 1PH7A 3S24A 1CSQA 2Q8TA 4B3SQ 2QEJC 5GADC 5D14A 3EFXD 2M9VA 3U58A 2XWJB 2A1AA 2NVTB 1AH9A 2K75A 4UP8A 2WAQG 1QZGA 2NZOA 1A15A 5IT9E 1SYGA 1R4QB 1Q8KA 1A8VA 4DR6Q 2EQSA 3HOYG 3UDFA 1C9OA 2L12A 1SE2A 3CCMA 1MI2A 4JI0Q 3S17H 2IW3A 4Y52H 3K5LA 1M8AA 2KA7A 4J15A 3A56A 1NNXA 3S16B 1MJCA 4K5XA 4P73A 2K03A 1PDQA 1YHAA 4LUOA 1CI3M 4LF9Q 3GTLB 1SNDA 4QIWB 4DUYQ 1KDAA 1R4PB 2IHEA 1G6PA 1OXVA 1O7IA 3STBD 1ZYRC 3TP8A 1W6KA 4NPSA 1EFID 2F0DA 2HUGA 4NMZA 1WTXA 3D6CA 2ICEC 3UE1A 4P72A 4GKKQ 5IYCG 4YCUA 2B63H 2XTIA 3IFDA 1NJIC 5EPLA 1U4MA 1PHJA 2E75C 4DR4Q 1GUTA 3K57A 4DUZL 3D31A 4WJ4A 1DCZA 4XXEA 2XWBB 3W2DA 3PF5A 1X3QA 5EPKA 3HS0C 3WWVA 3C46A 4A3JH 1Y8PB 2F0NA 2NB0A 1S72A 4DR6L 4ZQ3A 3GTKH 3NTKA 1VQ8A 1K8AC 3BYTB 4X66L 1LTBD 3A54A 5HURA 1EY7A 1PXUA 2MJ8A 5LMUQ 1STYA 4K2LA 3OIPA 4LFCL 3V96A 1HR0L 3OWFA 1SFOB 4DAMA 5JPNC 3K59A 1HPCA 1MSHA 1PRTB 1EY4A 1TWGH 3T53B 5ELCA 1A2UA 3E0JA 3FKIG 1QJOA 2JP1A 3DUZA 4KKUA 4DNTB 1TR5A 4A3KH 1G8ZD 4KLKA 2EJGC 5IWAL 2LFNA 4RCOA 4C3IG 3GTGB 4PZ7A 1LUZA 2PW7A 1EEID 2N55A 4DV6Q 3BDCA 4MN3A 3EVQA 4NKLA 3HOVB 4HAEA 3CC7A 4DUZQ 2AQ3B 1PA6A 4A3MH 1GO3E 1VMPA 2ZM6Q 3ZYYX 1XPUA 1UEAB 3J81j 2ID0A 4ZCKA 2TMPA 2QF7A 5E4XA 3CPWA 3H91A 1XMOQ 2R93H 2EZVA 3QO2A 1E2ZA 3R93A 2H5XA 4KN4C 1I4HA 1LYLA 1TWAB 1EEFD 5JVG3 3EJIA 5C4XG 2HHHL 3S9WA 2K5WA 1KLGD 1CM9A 4BY1H 3NP8A 5EPJA 4B3TQ 1SYBA 2FMCA 3GDEA 4QB4A 2XRQD 2K5VA 3BDOA 5I6WA 5C3EH 3CCUA 5M3MG 4DGZA 2IY5B 1LM0A 3FPPA 3CCJA 3PO3B 3OWEB 4JW0A 4LF4L 3EBEA 1Q7YC 3MXNB 2VW9A 3H3VI 1NR4A 1TQOA 5ISRA 5JJIA 2JEAI 4JI2L 2UU9L 3NQTA 2NN6G 1EZ6A 5CV7A 1VS0A 2CCZA 4BA1I 1WYDA 4MIUA 1J8IA 5JVH3 2CWPA 4LAAA 4CDFC 1CKNA 3H3VC 3L9AX 4O0AA 1WTOA 3I2ZA 4FO2A 1S5ED 1L2FA 3HP3A 2EDGA 4HJ8A 1ET9A 1JORA 1QNUA 5EKIA 1WFQA 2ES2A 1L1OA 1S4ZA 3GV3A 5M5XH 4LF7L 1KDBA 2F0TA 1LO5D 1Q1BA 1Y1VH 1QWYA 1EYAA 4ZYSA 3FMCA 4LF6L 4K8IA 2PQAA 2G9DA 4H7BA 4FXDA 2PPBC 4JI7L 3GTJH 2AHOB 3P20A 3W1GA 1SMYD 4Y7NH 3FPUB 2HDMA 4JI6L 2YU9B 2OQKA 4HIDA 1PH6A 2Q2HA 2NVQH 4TVAB 3K58A 3BDLA 1TWCB 4MTKA 2H4OA 3GTGH 3B6YA 1SNPA 3ERQA 3X3NA 4JI2Q 3S1NH 1TWAH 2OEOA 3CC2A 1I6HB 3T51B 3CXCA 1D8LA 1H9SA 2DJGC 4DR5Q 4DR7L 3GTJB 4PNYA 1XX8A 1PH2A 1IYVA 2AUJD 2ATWA 1CFMA 1X65A 4HSVA 1ESRA 1M90C 2E5LQ 2WB1G 4JI4L 3RZDB 1A3UA 3W3AA 3NTIA 2SEBD 2XSCA 2RHQB 1QUQB 2OTJA 4N8FA 4C3JB 3ULPA 2CH4W 2I07B 1O80A 4BBSB 3C3LA 4JI7Q 1QVCA 1VQOA 2JA9A 1RF2D 3CCRA 2BH8A 4CJ0B 5BR8Q 3S14H 2TSSA 5C6AA 4HJ5A 1KLUD 2UXBL 3SK4A 1SR3A 1I3QH 3MA2B 3RLNA 5IT9L 1BOSA 1UWVA 1EWHA 2EXDA 1W6JA 3L3OC 3UI2A 1T9HA 4FF2A 4TQUS 4DR5L 4OWXB 1HJPA 1JMCA 2I46A 4AYBE 4WORA 2UXDQ 3CAMA 2MGSA 2B63G 4IURA 1A62A 4B3MQ 1I5FA 1QZHA 4DFAA 1E7ZA 1VQHA 3AB9A 3NELA 3MFYA 2UU9Q 1IHZA 3HKZE 1V1PA 2F0JA 1B3AA 3M3YB 3OW7A 4XDXA 3NHHA 4IOCA 1YI2A 1TS3A 3ER0A 1YHQA 4IFDH 1JE4A 1SFOH 1YIJA 1GUWA 1DD2A 1N33L 3SHLA 1E2VA 2SNMA 3CCQA 4POGA 2Q2UA 2CQOA 1Q90A 1CK1A 2FJ2A 1PV4A 1FVIA 1XTDA 1C7YA 5I9OA 3BS1A 1Z47A 2UUCQ 4GOPA 4J8QA 3LWUA 3RZOB 1BR9A 2B2WA 3U4ZA 5T1IA 1BCPF 1IBMQ 4JC0A 1PYWD 4L63B 5F2DA 3CC4A 1MBYA 1HNWQ 3N6RA 4ALPA 5FLXc 1PTOB 2RHSB 3CRKC 3L0OA 5CV4A 1SE3A 3MEHA 4B08A 2RDGA 4B9XA 3PQIA 2F0GA 3U4VA 4IOAA 1D1KA 1H9MA 2I5MX 1SYDA 1CHQD 3KBXA 2NUCA 5DEHA 1A2TA 3A8JE 4X3KA 2Y0SB 1AZPA 1JT8A 1PYBA 5D3IB 3M4OB 4DF7A 2PNRC 4RFBA 3CMAA 3TQYA 5JOBA 3P1HA 1PMRA 2PZTA 1OTCA 4CJ2C 2EYHA 4LFAQ 2E2HH 1PLFA 2BH2A 1KRSA 2KECA 1JE5A 2D2CC 4GN3B 2ZTCA 1FGUA 3BG3A 3HOYB 3BVZA 4G4KA 4R4OA 4A3GB 3K5MA 1L1OB 3FKIH 1Q8IA 4FF4A 4U673 5M9OA 3E3XA 3ERSX 4A3MG 5KNCA 2N8NA 2YTXA 3MTSA 1JICA 1EIYB 1PTOF 1IXRA 1D7QA 4K14A 3PO3G 3E0EA 4G7ZC 4LFBQ 3NE5B 4C3JH 4LFCQ 1IYJB 5C5MA 5FOBB 4XYOA 1I50H 2VNUD 4RG1A 1MSGA 1VF5C 2OT2A 1B3QA 2GVBA 1S40A 1XJVA 1JOOA 3PIO3 4BS9A 1EQTA 1X3FA 2WV6D 2PQEA 1MJEA 4K0KQ 4GN5A 4A3LG 1HR0W 3I4NB 1V1OA 4BXXG 2QEXA 1I3QB 4EQOA 2CFMA 4LF6Q 2OTLA 4A76A 2GVAA 1SSOA 3H0GG 1XXGA 4B9WA 2A68C 1CKMA 1XTCD 1TY0A 2NVQB 3KYHC 4BBSG 4V0BA 2EOTA 4DV7Q 4LWCA 3CQZH 1ENCA 3PUYA 1Q3LA 5ELOA 1K8MA 2PW5A 5LL6X 4IALA 5E4WC 1XPOA 3T1YL 1QE6A 3NTHA 2AWNA 2C9OA 2OCEA 3BJUA 4DV7L 1W2BA 2E2JB 2HQLA 2R7FA 3J80E 1Y69U 4UPAA 5J22A 1Z6HA 3TBIB 3DHQA 2UXBQ 4EGVA 1N9WA 1UEBA 2R7DA 4IUPA 4YWKA 3A0JA 3CQZB 2Y0SG 3TZUA 2E2IB 4A3LH 4NXNQ 2WB1B 4XQNA 1QNKA 3NWTA 1SJED 5C3EG 3RLOA 3QJYA 3DWAA 4ODGA 5ELBA 4AYBG 3S1MB 1GVPA 2JA6B 5ELNA 2JJQA 4B3ML 3WOFA 4J1MA 4X65Q 3HKZG 1OXSC 3E9HA 3K6OA 4A3DH 1STBA 2RVLA 4JI3L 3S14B 3URYA 1PZKD 1QOHA 2YTYA 4HIOA 5IGBA 4QUFA 3SR1A 1UE5A 1K8GA 4C2MH 2CHBD 1HNZL 4XYQA 1N34Q 2VB2X 5EKLA 3HKZB 5IGEA 4YY3Q 3G4SA 2EYMA 4S3SA 3CP0A 1TWHH 1VQ4A 1DOMA 1WCMB 1AFPA 1CSPA 1JJ2A 4NXMQ 1NE3A 4ZUIA 1XMQL 4GZYC 1SN8A 4A75A 2R93G 5C3EB 1B70B 4ZKCB 2ZM6L 3GV6A 1EOTA 2L11A 2KHSA 1ZEQX 5M3FB 1WVLA 4APVA 3F2CA 1MHWC 2KEDA 5IY0A 1KTKA 5COYA 3MEFA 2F0WA 3K5NA 4IJHA 1LTID 1B53A 5CR3A 2K5NA 4C3HG 2R6GA 2VZAA 4AIMA 2B8GA 3Q23A 4GNXB 1VQPA 3HOUB 1EY0A 1ASYA 3U9OA 1E3PA 3PSIA 4IPGA 4I7AA 2R7ZH 3OHXC 3GTOB 4DA2A 4JYAQ 3CCSA 5LMNL 4LF5Q 2E8GA 3PUVA 5ELFA 2WINB 4O2DA 3NUCA 3BZKA 2F3WA 1TS2A 4K6LA 1DZ1A 1LTLA 1IBKQ 1LTTD 4P75A 5CV6A 1T5XD 1D5MC 1GHKA 3VA7A 2UXCQ 3KFUA 2B2YC 4AQYL 1NCVA 3RLFA 5L37A 2F0OA 2A74C 2F0HA 3PF4A 1WTPA 4RAUC 1B9MA 4C2MB 3I4NH 2IPKD 5KNDA 4LNQA 1NR2A 5IGCA 1VQEA 2Z4HA 1D5ZC 2XIWA 5IE8A 1PH8A 3NEMA 3BU2A 3FEWX 4IPDA 1EFWA 2E2DC 1WCMG 1PFMA 4DK0A 1KHIA 1BKBA 1JCKB 4HMIA 4DXFA 1XWEA 1C4QA 1A3VA 2I5LX 4KY7A 4JOIC 3ICEA 4ID6A 1ZKOA 3S1QB 1EWIA 1ET6A 4KY5A 1OO9B 2E2JH 4K0KL 2ZTEA 3L2PA 4JBWA 2EY6A 1ILQA 4IQZA 3KF8B 1I4RA 3GQBA 2HDLA 1DONA 3QR8A 1WTVA 1ENAA 2AKWB 2PI2E 3KK7A 2OWOA 2D5DA 1K83B 4GKJL 1GOZA 3G6JB 3DM1A 3NENA 4EVOA 4EQPA 1BXTA 4R9WA 3JAMc 1VQAA 5I9PA 2KCCA 3K8AA 4CJ1B 2DY7A 1CT1D 2YYZA 5EQ0A 4K6DA 4LK1C 4GOPB 1A3TA 1E2WA 5C0XG 2G5DA 2VQEL 2B2VA 4DAYB 2QKIC 1QVGA 1QG7A 1LTSD 2QCPX 1X3GA 4BBRG 2IT1A 2DY8A 2VQEQ 4YCVA 3M4QA 3KDFB 5GAGC 4X6AH 3S2HH 5IWAQ 4F87A 2NZHA 2F1MA 4P2CB 4X3UA 4A3GH 1EY5A 3EQLC 3I7FA 2KHJA 4KY6A 1AW7A 5JJKA 4OGQC 1L0YB 3I4LA 4DV5Q 1EY8A 3I4NG 2A6HC 4ILWA 1ENFA 1O78A 1X55A 1VQ6A 2RCNA 3HOXH 1Q82C 4DV4L 1VQFA 3CPFA 2ZJPA 3TN2A 4HEDA 4A3KB 1J9OA 2JA5G 1PFSA 1PYSB 2HCCA 2DJFC 3BYYB 3HOWG 2R7ZB 1JJGA 4BY7H 1VQNA 4DR4L 2WB1E 1B8AA 3SK8A 3SE0A 3MFGA 4YWMA 1SNOA 3I56A 1JC7A 1E22A 4GKJQ 3U50C 2Z6BA 1K83H 5FJ8G 4DR3Q 4KK7A 1RTNA 3MXGA 2NN6H 4A3MB 3AQQA 4ZRZA 5KNBA 1TWHB 2VL6A 3Q22A 5BR8L 3JC66 5HGTA 5CYUA 4A3EH 1D2BA 4RWSC 4L6TB 4KN7C 1FNVA 1NTGA 2PNHA 3GP7A 4LF4Q 3TP7A 2NYZD 2F0QA 5NUCA 3LX0A 4X3TA 1I94Q 3MXPA 2PI2A 3MVVA 3PGZA 3FKIB 1V43A 3SEBA 2A69C 5FO8B 5KRUA 3FDTA 2K50A 2MUYA 2B2TA 5FK9C 4IN3A 4G7HC 1SYCA 5JAVA 5FLXL 4YHHL 3LNNA 2K04A 4CGYB 4C3IH 4DV2L 1SE4A 4C3HH 4DV3L 2ZT9C 3KF6A 4A3IH 1EQQA 2UUBL 1HRJA 4NDXA 1WTQA 2E76C 5JJLA 3GTOH 2E74C 3GTMH 3J80i 1CKOA 2D62A 3MWYW 3DXJC 4PZ8A 4RGOS 3T13A 4OEMB 1HZCA 5FLXE 1CQFA 2JA6G 1OXUA 4GLAC 1O7LA 3GTLH 3KBGA 2AWOA 2KVMA 2G9HD 2CWAA 3T1HL 4A3EG 1VQ7A 1SYEA 1HFGA 2VS1A 4OELB 4DR2L 3G6EA 3S1RB 1H9SB 1TVXA 1SNQA 4IZ8A 3RR5A 4L5TA 2E5LL 4YIJA 2WIIB 3EROA 3W5OA 4LW1A 1EIHA 1Y8NB 2F0MA 2R92H 4UP9A 1WTWA 4HMJA 1EQVA 3M4PA 3ZJYC 3BZCA 5KIXA 5J39A 1EYGA 1LTRD 1TT2A 1U0LA 3I72A 3VYTA 2DNCA 4JI3Q 5DM63 3VYSA 1S5DD 2HCIA 4R4CA 4TKOB 1VQLA 4DV3Q 4OXPA 1UAPA 2UUBQ 1PRTF 2NBFA 4WJWA 2KHIA 5FLMH 3CU7A 4Q0FA 3RZOH 2QILA 5C5LA 1HR0Q 3KOJA 1C0AA 1SDFA 3S1QH 2JA7H 5GQOA 2B8FA 5IT9c 4K2KA 3K0YA 3V05A 4IPCA 4DV0L 1VQ5A 3T56B 3H6MA 1N32Q 1H9KA 4DXGA 4UAIA 1XYIA 3RUZA 1HZ9A 1ASZA 2JA8G 2PYKA 1MD2D 3CCEA 5A2QL 1AZQA 4G7OC 5C3WA 1VQKA 2HHHQ 2F0KA 5IYBH 2ZXOA 1RDPD 1VQCA 2M00A 2R3ZA 1YHBA 1IKMA 4PG3A 1J5EL 2EYFA 4ME5A 1AP0A 2VUMG 1LT3D 4X64Q 5J3BA 2WACA 1HUMA 3MXNA 1S5CD 1SROA 5C0XH 2F0LA 1CTMA 4H02A 2IWHA 1TKWB 3STBC 1P8LA 5I4DA 4JI0L 3F2UA 5K36G 4XT1B 1NUCA 1D6EC 1JJCB 2BOSA 1PTOD 1U9RA 2Q2TA 5JPMC 1VDZA 4H13C 4A93H 4KD3A 4A3EB 1K8OA 2OQ0A 3TZDA 2EJFC 4CBVA 4ME3A 4FDBA 3PIOA 2ZXPA 2XVSA 2F3IA 1VCIA 3H09A 1EWCA 1E24A 1S3OA 4FYDA 2P5ZX 5IYDG 3D8GA 4JI5L 1YBYA 2RA4A 3QB3A 3J81i 4A3JG 2PMZE 1V9PA 3CD6A 5C4ZA 5T1GA 3GTQH 3DLLA 4KJOA 3J7YW 2A8VA 3S17B 4DKAC 2JA8H 3NBHB 1AE3A 1SMYC 4CDCC 3JAMi 3G48A 4BY7G 1BCPC 1GKHA 1YNND 1SMXA 1U5KA 3EIVA 2JA7B 2Z6KC 2RCFA 3TP6A 1IL2A 3PO2G 2CKZB 2PO4A 2X6GA 1BBXC 2NVYB 2QA4A 2R92B 2JE6I 3H3VH 1JWSD 4R8NA 4RHSA 1YVCA 3KF6B 3DWPA 2L55A 5G3LD 1EIFA 2EVBA 2MNAA 3E5SA 4DR1Q 2UXCL 2M2LA 3K80C 1HFNA 3KLSA 2KCNA 4QF4A 2EE1A 1GUGA 4UDUC 4P71A 3M7NA 2JSOA 3OMCA 3OTOQ 1PTOH 1YJWA 4JI5Q 1G6ZA 4DU9A 3C2PA 3FHWA 1HHVA 1DGSA 5M5WH 1TWCH 3R2TA 1E0BA 4DK1A 1Y1WG 2MO1A 5CC4A 4CKEA 4ZLTF 1F2LA 1GHJA 1VQGA 2A6HD 1GM5A 4AH6A 4LF7Q 4RKBA 2B2YA 4WFN3 1TXYA 2A5HA 3K7UC 1SE8A 3LGJA 4WRDA 2JA5H 3PO3H 3OYYA 1RD9D 2PMZB 2SDFA 3FRPB 4GLXA 2WKDA 3DEPA 5EJWA 4JBMA 2VQFL 4PMBA 1HTPA 4A3FB 1PRTC 5CORA 4C3HB 1PZJD 1EYCA 3HOXB 3H15A 3HOVG 3BZDB 4YHHQ 4QGUA 2BA0A 4LF8Q 3KDFA 5IP9G 1EIGA 4BBSH 2Z1CA 3FVQA 4EQNA 2JEBI 3AU7A 1V1PB 4OO1H 3JAME 1DYQA 2V4DA 1NY4A 2EYLA 4AQYQ 1I4XA 1MKHA 1SLJA 3F1ZA 1MIUA 5JEAH 5GAHC 1O7YA 3IL8A 4LF9L 1SAPA 2MP1A 1WTRA 1BNZA 3M9BA 3Q8DA 3SK5A 1EUJA 4QCLA 2L15A 2VY3A 1IL8A 2EYJA 2LMCB 1RL2A 3SDZA 3CCVA 5C44H 1HA5A 2F0FA 3R2IA 4IUUA 1H9RA 1K3RA 2L4NA 4IUNA 1EZ8A 1EY6A 1ONLA 5AFWA 2VQFQ 2WKCA 4GNXA 2K5QA 4A93B 5H1SE 4LJZC 1JOKA 4DNRB 3IFTA 3DEOA 5C4XH 2A19A 1IBLQ 2FINB 1A63A 4HCEA 5DLQE 1PFBA 1IZ6A 2HQEA 3OIQA 3PCOB 4A3DG 3RN2A 2O5JC 3CF5A 4IUVA 3S2DH 3GTKB 3SGIA 2EPBA 2DGYA 1CA6A 2KCMA 1KQSA 1BCPB 4OX9L 4CKCA 4MZ9A 2NVTH 1G91A 1WJJA 1Q46A 1P16A 1CZWA 1HNZQ 1FYCA 2NVXH 4DR7Q 1H95A 5I2YA 1Y1VB 1FR3A 4HJAA 2DNEA 1XMQQ 2KQ3A 2N88A 3SVMA 2KJXA 3E9IA 2ENBA 2J4XA 1KAWA 1TWFH 5EBCA 5C3XA 4RHRA 3HOWH 1CKNB 2HT1A 1KL9A 4ZKBB 3A7LA 2YU9H 2LXKA 4UP7A 1EQRA 4DV1L 3HOVH 3HOXG 1KXLA 2DN8A 1STNA 4L8JA 5FJ8H 1QB5D 2WAQB 5EAYA 3QG1A 2IJ0A 4GLVB 4HSPA 4X66Q 1OXXK 3NBHA 3NPPA 3X3MA 1TWFB 4A3FH 4IFDG 2LXJA 1WTHA 2B2UA 4HTHA 5M5YH 2L9HA 2Z6KA 3VR2A 3TMEA 2N3SA 1BUVT 1VQJA 1PH3A 1CUKA 3VR3A 1FL0A 2F0SA 1FD7D 4R8IA 2K28A 5J1ZA 4XQQA 1ICWA 3HZXA 2KEEA 5ELDA 1M1KC 2QDLA 4C3JG 1RTOA 5IYDH 1B1ZA 4BY1B 4UY8C 1FNWA 2N49A 4FF1A 4N9PA 5IYCH 1I94L 4CHTB 1ICFB 4RCNA 5IODA 1FJGQ 3CRLC 5E3FA 2EJMA 1WOCA 3D6WA 3CKIB 1IBKL 4ABNA 3C1FA 4OONA 2R93B 2A69D 1ILPA 3GD7A 5FKAC 2K6AA 1Q12A 4E6IA 2BE5C 3K5OA 5KGUA 3R3OA 4BBRH 1ZXTA 3PUXA 1B7YB 2L0CA 2JQOA 5M3FG 1HNXQ 2NVXB 4H0LC 3HOYH 1KDCA 1BDOA 1IW7C 1K28A 5JEAJ 3NK9A 3OOCA 1XNRL 4TRDA 3PUZA 5ELEA 4EX5A 3HFZB 4H44C 4DPGA 5M3MH 4B3TL 2BA1A 3DM3A 3ULJA 1IW7D 3M4OH 1LTGD 1HCZA 1OXTA 4ZUJA 4HR7B 3A5ZB 3R8BA 2MHVA 2MQHA 2Z8LA 1XNQL 4MHEA 5TSSA 1UE7A 3ITPA 3KF8A 4ULLA 1FJGL 3EA6A 5IP7H 4DV5L 1F9PA 3VDYA 1CZGA 2FXQA 3MZ5A 4JOIA 4A4IA 3PIP3 3S1RH 1SJHD 1U4PA 4QUCA 5LMNQ 1GUSA 1A0IA 1G2TA 3J7AV 2GN5A 1NMGA 1WD0A 1T5EA 4KV6A 5I6YA 5C0XI 4N9TA 3TSSA 1UNSA 4YY3L 3H0GH 1LABA 5JJZA 3PO2H 4BWGB 3S15H 5IIFA 1XMOL 4OIKA 4JI8L 3J7ZC 2PZUA 4RGMA 2Y0SE 4HN7A 4DV4Q 2A6ED 1HQMC 1PH1A 1N36L 3Q24A 4JG2A 4A3FG 3WOEA 4IO9A 4PZ6A 3A7AB 5C4HA 2F4VL 2Z4IA 1IBLL 2LKVA 3P75A 1SNMA 3G71A 3I4MH 2BCOA 2Q2IA 1RHPA 1X3EA 5C0XJ 4OWWB 2X6LA 3QOLA 5C44G 5CBEE 2O5IC 2MFIA 1BBWA 2B63B 2XN9C 3D4WA 4KKSA 1EOVA 3CW2C 1STAA 5DM73 3QWNA 5M5WB 1B50A 2K5HA 1HQRD 1D1IA 2NTSA 5CGKA 3S1MH 3I4MB 1L1OC 3U9SA 3KLWA 5M3FH 4HCSA 1JWUD 5LMUL 1GD7A 3UDXA 2SOBA 2WP8J 1B9NA 4X3SA 1M4VA 3C1EA 5HY6A 4HJ9A 3W1BA 3MAQA 1KC8C 4LMQD 4OL7A 2QGQA 4OO1G 2I0QA 2UUAQ 3VR5A 4GS3A 3MC0B 3M3YH 1PRTD 1JOQA 1Y1WH 4GN4B 3QIAA 3KJPA 4DV1Q 2EIFA 2K33A 1TU2B 2RKSA 1HZBA 1KABA 4PQXA 4JI1L 4KMUC 4A3DB 1PTOC 1STGA 1FGBD 1K9MC 4FXKC 4JI6Q 4C3IB 2R92G 4F8MA 1C48A 1N32L 5LHY1 3PV0A 4P74A 4DK3C 1MGSA 3OMGA 1B2TA 3UDIA 1YJNA 1S5BD 4L5QA 3TREA 1E1TA 1BCPD 1YNNC 4A3CG 2Z0SA 3ONAB 1F9SA 4C1NI 2C5CA 1N8RC 2A73B 2K5DA 2ASBA 1KAAA 4RA8A 1WD1A 4R1JA 5LL6S 4FP5D 4A3JB 1LT6D 2UXDL 4A3BG 3A5UA 1LT5D 4GOPC 5DAUA 4RMFA 4DV6L 3M7GA 5IGGA 2PZWA 4OWTB 3KLSX 4O42A 4C1NK 2EY1A 5IGDA 4POFA 2RBMA 1EYDA 1VMCA 1Y14B 2EY2A 3BVMA 3S2HB 2JYOA 1PFNA 4KKTA 2QDBA 5FO7B 1LT4D 2L5TA 1HXYD 2XGTA 1FNUA 2RDFA 3IKJA 1AEXA 1NSNS 3CHBD 1JWMD 2SNSA 4DR2Q 2Q8IB 3OW2A 3T1HQ 3I4MG 1EU3A 1K0SA 1YEZA 3JAML 1ML0D 2X69A 1L0WA 2KBNA 1ESFA 4BY1G 1YNJC 3QOJA 2B39A 2I5HA 1B44D 2F52A 4KHZA 3HOWB 4X62Q 1J6QA 2K4KA 2KCTA 1JB3A 4F88A 1YJ9A 5EKKA 2F0EA 2F0UA 4JBJA 2J7ZA 5C44B 1HNWL 5D3DA 1D5XC 4IFDJ 4WJ3M 4MTNA 1QVFA 3Q0AA 1N33Q 1XNRQ 5JEAG 4DNIA 4M8AA 4HIMA 1X3PA 1UE6A 4DUYL 1VQDA 2ZJRA 1SYFA 4OO1I 5CMDA 2LSSA 1HNXL 3BVGA 1IKLA 3K7AH 1XPRA 3S1NB 2EYPA 1NMFA 2F0VA 5DNFA 2VB3X 4OIJA 4IPHA 1W3SA 1K0RA 1IBML 1ZYRD 2K32A 2RSNA 3D0FA 1F9QA 2F0IA 1F9RA 4PMWA 2HIXA 2QW7A 4KI0A 5EGTA 1LTAD 1YNXA 2OF1A 2LY7A 4R4QA 3OSOA 1QILA 4QL5A 3AMUA 3S16H 1CQVA 4A3BB 4X64L 1BVSA 2B2VC 4JYAL 4TSSA 5CV9A 1LV9A 3WDNA 2JA7G 4JI1Q 1BF4A 3J80L 3HOZG 2J0TD 1U4RA 1VQIA 4CDDC 3FP9A 4R4TA 4DV0Q 1X54A 1TS4A 3HG9A 4NXNL 3ULLA 3K81C 4A93G 1DJRD 1X9NA 5EBDA 3I55A 4J6HA 3NWSA 5KEEA 2K7VA 3DMUA 1K3BC 3T4AC 4GKKL 1U4LA 3I8ZA 2K01A 4KHVA 5D65A 5IP7G 2HIVA 4QQBX 1X56A 3LWEA 4NW2A 4JI4Q 4CKBA 4Y7NB 2VUMH 2CQAA 2RSOA 2V1CC 1BBUA 2F03A 2NWGA 3T16A 5KYLA 4ZK9B 3TS0A 1SNCA 1N36Q 3J81E 4RGNA 1B4OA 5IYBG 4B3RL 2E2IH 1I6HH 5FLMG 1RCVD 4PMCA 1YZ6A 3OPOA 1WCMH 4KJNA 1EL0A 1K73C 2CW0C 2ALYB 4YWLA 4L5SA 2GA4B 3D4DA 3EN2A 5C4JH 1F77A 4PV1C 3KLRA 2PQAB 2JA6H 5BN5A 4OX9Q 3RMHA 4BXXH 1G291 3ND9A 1F2MA 4ZAIA 4MNOA 2ZTDA 1X32A 2HD3A 3H0GB 3K0XA 1HH2P 2N78A 1XNQQ 3J7A5 3HOZH 3NSWA 4A3IG 3NQIA 3KUPA 2UUAL 1I6VC 3A55A
chains in the Genus database with same CATH topology
2KCMA 1KQSA 4OX9L 3KF8B 2JEAI 3IRBA 4JI2L 5JJIA 2UU9L 4MZ9A 2NN6G 2NVTH 3OTOL 1WJJA 1Q46A 1P16A 1VS0A 1HNZQ 2CCZA 4BA1I 1Q1EA 1WYDA 1Q86C 2NVXH 2AKWB 2CWPA 2PI2E 4DR7Q 2B29A 1H95A 2D0OA 2OWOA 1CKNA 4O0AA 4HJAA 2NVYH 1XMQQ 2RF4A 3I2ZA 4GKJL 1L2FA 3E9IA 1KAWA 1TWFH 3NENA 4HJ8A 3HOWH 1CKNB 3PUWA 2HT1A 3JAMc 4BA2I 1KL9A 1VQAA 1QUQA 3T1YQ 3RZDH 2ES2A 1WFQA 4JCVE 2YU9H 1L1OA 5M5XH 3K8AA 4EQ5A 4LF7L 2LXKA 4UP7A 1EQRA 4DV1L 3HOVH 3HOXG 5AJ3L 2YYZA 1Q1BA 1Y1VH 1KXLA 2DUDA 5FJ8H 4LF6L 4GOPB 2PQAA 5EAYA 5C0XG 4GLVB 4X66Q 3F2BA 1OXXK 2VQEL 4DAYB 4IFDG 4A3FH 4JI7L 1E1OA 2LXJA 3HOUH 3GTJH 2AHOB 3W1GA 4XTCS 1QVGA 4Y7NH 5M5YH 4JI6L 1X3GA 2OQKA 2IT1A 2Z6KA 4BBRG 4HIDA 2AMCB 1PH6A 2C35B 2Q2HA 2VQEQ 4TVAB 4DR3L 2NVQH 4YCVA 4L5RC 2N3SA 3M4QA 3KDFB 4YCWA 1VQJA 5GROA 5GAGC 1PH3A 4X6AH 1CUKA 3B6YA 3GTGH 1FL0A 4JI2Q 4A3GG 3S2HH 3S1NH 5IWAQ 1TWAH 3CC2A 3CXCA 1D8LA 2NZHA 2JK8A 4DR5Q 4DR7L 4X62L 1M1KC 3F2DA 4A3GH 1PH2A 1VQBA 5IYDH 2ATWA 3I7FA 4UY8C 2KHJA 1X65A 2E5LQ 1M90C 2N49A 5JJKA 5IYCH 4DV5Q 1I94L 1FJGQ 2WB1G 3I4NG 4JI4L 1WOCA 1IBKL 4QJFA 1X55A 2RHQB 4OONA 2K14A 2RCNA 1QUQB 3HOXH 2D0PA 4DV4L 1Q82C 1VQ6A 3PO2H 3L2PA 1VQFA 2OTJA 1SRUA 3CPFA 2ZJPA 3GD7A 1KIXA 3ULPA 2JA5G 1UE1A 1PFSA 1PYSB 1Q12A 3J80c 3HOWG 1NBWA 1JJGA 1JB7A 4BY7H 4LF5L 4BBRH 4JI7Q 1VQNA 3PUXA 1QVCA 1VQOA 3J7A5 4DR4L 1B7YB 5M3FG 2JA9A 1B8AA 2JQOA 2WB1E 3CCRA 1HNXQ 2BH8A 4YWMA 4A3CH 3I56A 3HOYH 5BR8Q 1E22A 3S14H 4JI8Q 4GKJQ 3U50C 1K83H 5JEAJ 4HJ5A 3UDGA 4JV5Q 2UXBL 5FJ8G 4KHPQ 1XNRL 4DR3Q 3PUZA 1SR3A 1I3QH 4EX5A 3RLNA 3HFZB 4DPGA 5M3MH 4B3TL 3AQQA 1UWVA 2BA1A 3DM3A 3ULJA 2EXDA 2VL6A 3M4OH 1T9HA 5BR8L 3JC66 4A3EH 4TQUS 4DR5L 4JV5L 1OXTA 4OWXB 5LMNW 1NTGA 2ZJQA 1HJPA 2PNHA 3A5ZB 3M85A 1JMCA 2UXDQ 4AYBE 2MQHA 3CAMA 1Q81C 4LF4Q 1XNQL 4B3RQ 4X65L 2B63G 1A62A 4B3MQ 1I5FA 1UE7A 1QZHA 1E7ZA 1VQHA 3NELA 1FJGL 2YTVA 5IP7H 1Z9FA 3L7ZC 4DV5L 1I94Q 3VDYA 2UU9Q 2FXQA 4A4IA 4JOIA 2PI2A 1V1QA 3HKZE 3PGZA 1V43A 3S1RH 1G51A 3UE0A 5LMNQ 2K50A 4IOCA 1YI2A 1YHQA 1A0IA 3ER0A 2GN5A 1SFOH 4QIWE 1NMGA 1YIJA 5C0XI 1HZAA 3AEVA 1N33L 4YHHL 4GNXC 1X6OA 4YY3L 4A3KG 4C3IH 3H0GH 4DV2L 3CCQA 4POGA 2Q2UA 4C3HH 4DV3L 2CQOA 3KF6A 4A3IH 1EQQA 1KD1C 2UUBL 1PV4A 3HKSA 3I4OA 1FVIA 1RIPA 1XTDA 3S15H 1C7YA 4KHPL 5GAEC 1XMOL 5JJLA 3GTOH 3GO5A 4JI8L 3J80i 3J7ZC 1Z47A 2UUCQ 1CKOA 2D62A 5HGQA 4GOPA 2Y0SE 4LUZA 4DV4Q 2YV5A 4R4IA 4PZ8A 3U4ZA 1HZCA 2WAQE 1PH1A 1N36L 2JA6G 1OXUA 4GLAC 4JG2A 4A3FG 1IBMQ 3HOUG 4IO9A 3GTLH 4PZ6A 2WFWA 2K52A 4JC0A 2F4VL 1IBLL 3AYHB 2AWOA 3CC4A 3G71A 3I4MH 2Q2IA 3KJOA 2NN6I 4A3EG 1X3EA 2CWAA 5C0XJ 3T1HL 1VQ7A 4OWWB 1HNWQ 5C44G 2MFIA 2VS1A 1BBWA 5AJ3Q 4DR2L 3G6EA 4ALPA 5FLXc 2RHSB 1R9TH 4DK6C 3L0OA 3RR5A 4L5TA 1EOVA 3CW2C 2E5LL 1Y1VG 3U4VA 3W5OA 4LF8L 2I5MX 4IOAA 4HIKA 3CMEA 2K5HA 4LW1A 1VQMA 1J5EQ 2R92H 3S1MH 1L1OC 4UP9A 1JT8A 1PYBA 3M4PA 3ZJYC 3KLWA 3BZCA 5M3FH 5LMUL 1EYGA 1U0LA 1GD7A 4JI3Q 3CMAA 3UDXA 4IJLA 3TQYA 4XIGS 4R4CA 1VQLA 2WP8J 4OXPA 4DV3Q 2UUBQ 3TS2A 2KHIA 5HY6A 1OTCA 5FLMH 4HJ9A 3PIPA 3RZOH 1AE2A 3AFQA 4LFAQ 3W1BA 2E2HH 3J81c 1KC8C 1KRSA 2BH2A 2QGQA 4OO1G 1JE5A 4GN3B 2I0QA 2ZTCA 2UUAQ 1FGUA 1HR0Q 3KOJA 1C0AA 4GS3A 1PH5A 4R4OA 3S1QH 2JA7H 5GQOA 4A3BH 5IT9c 3M3YH 1L1OB 3FKIH 1VQ5A 4IPCA 4DV0L 1Y1WH 4GN4B 3KJPA 4DV1Q 2EIFA 3ERSX 4LFAL 4LFBL 1N32Q 4A3MG 1HZBA 4JBKA 2F4VQ 4QY7A 3TRZA 1HZ9A 4JI1L 1ASZA 2JA8G 2N8NA 2YTXA 3CCEA 4B3SL 1EIYB 1K9MC 1PH4A 1IXRA 4JI6Q 1VQKA 2HHHQ 1D7QA 5IYBH 2R92G 3PO3G 3E0EA 1VQCA 4LFBQ 1N32L 3PV0A 1PVOA 1YHBA 4C3JH 4LFCQ 4P74A 4DK3C 1IYJB 4PG3A 4DR1L 1WI5A 1J5EL 4LUVA 3UDIA 2B3GA 1YJNA 2IX1A 1I50H 4L5QA 3TREA 2VUMG 2VNUD 4RG1A 1E1TA 2GVBA 4X64Q 5J3BA 1S40A 1YITA 1XJVA 4A3CG 2Z0SA 3RNUA 1SROA 1VQ9A 3GTPH 1X3FA 4H02A 3STBC 4JI0L 1N8RC 4IFDI 1P8LA 1MJEA 4K0KQ 4GN5A 2KENA 2MO0A 5IP9H 1HR0W 2ASBA 4A3LG 5K36G 4BXXG 1XNQQ 3AFPA 4R1JA 1JJCB 2QEXA 3TEHB 2CFMA 2Q2TA 1KRTA 4LF6Q 2OTLA 4HJ7A 4A76A 2UXDL 4A3BG 3A5UA 2GVAA 4GOPC 4A93H 3H0GG 4RMFA 4DV6L 3F8TA 3A74A 2IHFA 2OQ0A 1CKMA 4NB3A 4OWTB 4DV2Q 3KYHC 4ME3A 1N34L 4FDBA 3RN5A 2R7ZG 3CCLA 4BBSG 3PIOA 4DV7Q 4POFA 2IX0A 1PH9A 2F3IA 1VCIA 4LWCA 5E7NA 1E24A 1S3OA 1Y14B 3CQZH 2UUCL 5IYDG 4NXML 3PUYA 4JI5L 1YBYA 3J81i 4A3JG 1PH7A 5ELOA 2PMZE 1V9PA 3CD6A 3S24A 1CSQA 1XPOA 3T1YL 4B3SQ 2AWNA 5GADC 3BJUA 2OCEA 4DV7L 1W2BA 3GTQH 2HQLA 2R7FA 4UPAA 3DLLA 2A8VA 3U58A 4DKAC 2A1AA 2UXBQ 2JA8H 2XGTA 3NBHB 1AH9A 2K75A 4UP8A 1AE3A 2WAQG 1N9WA 1UEBA 2NZOA 2R7DA 4YWKA 3A0JA 1QZGA 3JAMi 3G48A 2Y0SG 4DR2Q 3OW2A 3T1HQ 3I4MG 4BY7G 4A3LH 1GKHA 1YEZA 1SMXA 1U5KA 3EIVA 4NXNQ 2Z6KC 1L0WA 1Q8KA 2KBNA 1IL2A 1A8VA 3PO2G 2CKZB 5C3EG 4DR6Q 2EQSA 3HOYG 3RLOA 4BY1G 1C9OA 3UDFA 4JI0Q 3CCMA 2QA4A 4AYBG 3S17H 1GVPA 2JE6I 4Y52H 2I5HA 5ELNA 2JJQA 4B3ML 3H3VH 2F52A 4J15A 1YVCA 3HKZG 1OXSC 3KF6B 4X65Q 3E9HA 4A3DH 4KHZA 4X62Q 1J6QA 1EIFA 1MJCA 2K4KA 2KCTA 4P73A 2MNAA 4JI3L 1YHAA 4LUOA 4LF9Q 4DR1Q 1YJ9A 4DUYQ 2UXCL 2YTYA 4HIOA 2IHEA 4JBJA 1OXVA 1O7IA 3K80C 1HNWL 1G6PA 3STBD 1YJWA 4IFDJ 4WJ3M 1UE5A 4NPSA 4C2MH 1K8GA 1HNZL 4MTNA 1N34Q 1QVFA 3UE1A 3GTMH 4P72A 4YY3Q 4P71A 1N33Q 1XNRQ 3OTOQ 3G4SA 3M7NA 4GKKQ 5IYCG 4YCUA 2B63H 5JEAG 3CP0A 1TWHH 4DNIA 2XTIA 4HIMA 1VQ4A 4DUYL 1UE6A 1CSPA 1NJIC 1JJ2A 4JI5Q 1NE3A 1VQDA 1XMQL 2ZJRA 4NXMQ 3FHWA 1PHJA 1SN8A 4A75A 2R93G 4OO1I 1DGSA 1B70B 5M5WH 1TWCH 4DR4Q 4DUZL 2ZM6L 2LSSA 3D31A 1HNXL 1Y1WG 4WJ4A 2MO1A 3PF5A 1VQGA 3K7AH 1XPRA 1GM5A 4AH6A 4LF7Q 1NMFA 3WWVA 4A3JH 4IPHA 1TXYA 1W3SA 1K0RA 3K7UC 1SE8A 3LGJA 1S72A 4DR6L 2JA5H 3GTKH 1IBML 3PO3H 3OYYA 4APVA 3F2CA 1VQ8A 1K8AC 4X66L 5IY0A 3D0FA 3MEFA 5LMUQ 4PMWA 4LFCL 4IJHA 4GLXA 1HR0L 2HIXA 4KI0A 2K5NA 1YNXA 4JBMA 2R6GA 4R4QA 2VZAA 4AIMA 4QL5A 4DAMA 2VQFL 3S16H 4GNXB 1VQPA 1ASYA 1TWGH 4X64L 1E3PA 1BVSA 3FKIG 3PSIA 4IPGA 4YHHQ 3H15A 3HOVG 4QGUA 2BA0A 4LF8Q 4JYAL 2JA7G 3KDFA 4JI1Q 5IP9G 3HOZG 4A3KH 2R7ZH 4BBSH 1VQIA 4KLKA 5IWAL 3FP9A 4R4TA 4DV0Q 1X54A 2JEBI 4NXNL 4PZ7A 3K81C 3ULLA 1LUZA 4JYAQ 4A93G 3CCSA 3I55A 5LMNL 1X9NA 4LF5Q 2E8GA 3PUVA 4DV6Q 4O2DA 1NY4A 4GKKL 3BZKA 4AQYQ 1MKHA 1SLJA 3F1ZA 5IP7G 3CC7A 4DUZQ 1LTLA 2HIVA 1MIUA 5GAHC 1PA6A 4A3MH 1GO3E 4P75A 2ZM6Q 1X56A 1IBKQ 4QQBX 4JI4Q 2UXCQ 1XPUA 4LF9L 3J81j 2ID0A 2VUMH 3KFUA 3M9BA 2V1CC 4AQYL 1BBUA 3Q8DA 3RLFA 1EUJA 3CPWA 1XMOQ 2L15A 2R93H 2VY3A 3PF4A 1RL2A 3TS0A 3CCVA 5C44H 1N36Q 3I4NH 2H5XA 5IYBG 4LNQA 1K3RA 2E2IH 4B3RL 1I6HH 5FLMG 1LYLA 1VQEA 1YZ6A 2VQFQ 4GNXA 1WCMH 5C4XG 2HHHL 5H1SE 1K73C 2ALYB 5IE8A 4YWLA 1PH8A 4L5SA 3EN2A 5C4JH 3NEMA 3BU2A 4IPDA 1EFWA 4B3TQ 4BY1H 2PQAB 1WCMG 5C4XH 3GDEA 2A19A 5C3EH 2K5VA 1IBLQ 2JA6H 3CCUA 1KHIA 1BKBA 1A63A 5DLQE 4OX9Q 1IZ6A 5M3MG 4BXXH 4A3DG 3PCOB 2IY5B 1G291 3RN2A 2I5LX 4MNOA 3CF5A 1LM0A 4JOIC 3ICEA 3S2DH 2ZTDA 3CCJA 3K0XA 3HOZH 1EWIA 1HH2P 2N78A 3EBEA 1Q7YC 3MXNB 3SGIA 4A3IG 2VW9A 4LF4L 2E2JH 2UUAL 4K0KL 3H3VI 2ZTEA 2DGYA 4JBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCM A;  1KQS A;  4OX9 L;  3KF8 B;  2JEA I;  3IRB A;  4JI2 L;  5JJI A;  2UU9 L;  4MZ9 A;  2NN6 G;  2NVT H;  3OTO L;  1WJJ A;  1Q46 A;  1P16 A;  1VS0 A;  1HNZ Q;  2CCZ A;  4BA1 I;  1Q1E A;  1WYD A;  1Q86 C;  2NVX H;  2AKW B;  2CWP A;  2PI2 E;  4DR7 Q;  2B29 A;  1H95 A;  2D0O A;  2OWO A;  1CKN A;  4O0A A;  4HJA A;  2NVY H;  1XMQ Q;  2RF4 A;  3I2Z A;  4GKJ L;  1L2F A;  3E9I A;  1KAW A;  1TWF H;  3NEN A;  4HJ8 A;  3HOW H;  1CKN B;  3PUW A;  2HT1 A;  3JAM c;  4BA2 I;  1KL9 A;  1VQA A;  1QUQ A;  3T1Y Q;  3RZD H;  2ES2 A;  1WFQ A;  4JCV E;  2YU9 H;  1L1O A;  5M5X H;  3K8A A;  4EQ5 A;  4LF7 L;  2LXK A;  4UP7 A;  1EQR A;  4DV1 L;  3HOV H;  3HOX G;  5AJ3 L;  2YYZ A;  1Q1B A;  1Y1V H;  1KXL A;  2DUD A;  5FJ8 H;  4LF6 L;  4GOP B;  2PQA A;  5EAY A;  5C0X G;  4GLV B;  4X66 Q;  3F2B A;  1OXX K;  2VQE L;  4DAY B;  4IFD G;  4A3F H;  4JI7 L;  1E1O A;  2LXJ A;  3HOU H;  3GTJ H;  2AHO B;  3W1G A;  4XTC S;  1QVG A;  4Y7N H;  5M5Y H;  4JI6 L;  1X3G A;  2OQK A;  2IT1 A;  2Z6K A;  4BBR G;  4HID A;  2AMC B;  1PH6 A;  2C35 B;  2Q2H A;  2VQE Q;  4TVA B;  4DR3 L;  2NVQ H;  4YCV A;  4L5R C;  2N3S A;  3M4Q A;  3KDF B;  4YCW A;  1VQJ A;  5GRO A;  5GAG C;  1PH3 A;  4X6A H;  1CUK A;  3B6Y A;  3GTG H;  1FL0 A;  4JI2 Q;  4A3G G;  3S2H H;  3S1N H;  5IWA Q;  1TWA H;  3CC2 A;  3CXC A;  1D8L A;  2NZH A;  2JK8 A;  4DR5 Q;  4DR7 L;  4X62 L;  1M1K C;  3F2D A;  4A3G H;  1PH2 A;  1VQB A;  5IYD H;  2ATW A;  3I7F A;  4UY8 C;  2KHJ A;  1X65 A;  2E5L Q;  1M90 C;  2N49 A;  5JJK A;  5IYC H;  4DV5 Q;  1I94 L;  1FJG Q;  2WB1 G;  3I4N G;  4JI4 L;  1WOC A;  1IBK L;  4QJF A;  1X55 A;  2RHQ B;  4OON A;  2K14 A;  2RCN A;  1QUQ B;  3HOX H;  2D0P A;  4DV4 L;  1Q82 C;  1VQ6 A;  3PO2 H;  3L2P A;  1VQF A;  2OTJ A;  1SRU A;  3CPF A;  2ZJP A;  3GD7 A;  1KIX A;  3ULP A;  2JA5 G;  1UE1 A;  1PFS A;  1PYS B;  1Q12 A;  3J80 c;  3HOW G;  1NBW A;  1JJG A;  1JB7 A;  4BY7 H;  4LF5 L;  4BBR H;  4JI7 Q;  1VQN A;  3PUX A;  1QVC A;  1VQO A;  3J7A 5;  4DR4 L;  1B7Y B;  5M3F G;  2JA9 A;  1B8A A;  2JQO A;  2WB1 E;  3CCR A;  1HNX Q;  2BH8 A;  4YWM A;  4A3C H;  3I56 A;  3HOY H;  5BR8 Q;  1E22 A;  3S14 H;  4JI8 Q;  4GKJ Q;  3U50 C;  1K83 H;  5JEA J;  4HJ5 A;  3UDG A;  4JV5 Q;  2UXB L;  5FJ8 G;  4KHP Q;  1XNR L;  4DR3 Q;  3PUZ A;  1SR3 A;  1I3Q H;  4EX5 A;  3RLN A;  3HFZ B;  4DPG A;  5M3M H;  4B3T L;  3AQQ A;  1UWV A;  2BA1 A;  3DM3 A;  3ULJ A;  2EXD A;  2VL6 A;  3M4O H;  1T9H A;  5BR8 L;  3JC6 6;  4A3E H;  4TQU S;  4DR5 L;  4JV5 L;  1OXT A;  4OWX B;  5LMN W;  1NTG A;  2ZJQ A;  1HJP A;  2PNH A;  3A5Z B;  3M85 A;  1JMC A;  2UXD Q;  4AYB E;  2MQH A;  3CAM A;  1Q81 C;  4LF4 Q;  1XNQ L;  4B3R Q;  4X65 L;  2B63 G;  1A62 A;  4B3M Q;  1I5F A;  1UE7 A;  1QZH A;  1E7Z A;  1VQH A;  3NEL A;  1FJG L;  2YTV A;  5IP7 H;  1Z9F A;  3L7Z C;  4DV5 L;  1I94 Q;  3VDY A;  2UU9 Q;  2FXQ A;  4A4I A;  4JOI A;  2PI2 A;  1V1Q A;  3HKZ E;  3PGZ A;  1V43 A;  3S1R H;  1G51 A;  3UE0 A;  5LMN Q;  2K50 A;  4IOC A;  1YI2 A;  1YHQ A;  1A0I A;  3ER0 A;  2GN5 A;  1SFO H;  4QIW E;  1NMG A;  1YIJ A;  5C0X I;  1HZA A;  3AEV A;  1N33 L;  4YHH L;  4GNX C;  1X6O A;  4YY3 L;  4A3K G;  4C3I H;  3H0G H;  4DV2 L;  3CCQ A;  4POG A;  2Q2U A;  4C3H H;  4DV3 L;  2CQO A;  3KF6 A;  4A3I H;  1EQQ A;  1KD1 C;  2UUB L;  1PV4 A;  3HKS A;  3I4O A;  1FVI A;  1RIP A;  1XTD A;  3S15 H;  1C7Y A;  4KHP L;  5GAE C;  1XMO L;  5JJL A;  3GTO H;  3GO5 A;  4JI8 L;  3J80 i;  3J7Z C;  1Z47 A;  2UUC Q;  1CKO A;  2D62 A;  5HGQ A;  4GOP A;  2Y0S E;  4LUZ A;  4DV4 Q;  2YV5 A;  4R4I A;  4PZ8 A;  3U4Z A;  1HZC A;  2WAQ E;  1PH1 A;  1N36 L;  2JA6 G;  1OXU A;  4GLA C;  4JG2 A;  4A3F G;  1IBM Q;  3HOU G;  4IO9 A;  3GTL H;  4PZ6 A;  2WFW A;  2K52 A;  4JC0 A;  2F4V L;  1IBL L;  3AYH B;  2AWO A;  3CC4 A;  3G71 A;  3I4M H;  2Q2I A;  3KJO A;  2NN6 I;  4A3E G;  1X3E A;  2CWA A;  5C0X J;  3T1H L;  1VQ7 A;  4OWW B;  1HNW Q;  5C44 G;  2MFI A;  2VS1 A;  1BBW A;  5AJ3 Q;  4DR2 L;  3G6E A;  4ALP A;  5FLX c;  2RHS B;  1R9T H;  4DK6 C;  3L0O A;  3RR5 A;  4L5T A;  1EOV A;  3CW2 C;  2E5L L;  1Y1V G;  3U4V A;  3W5O A;  4LF8 L;  2I5M X;  4IOA A;  4HIK A;  3CME A;  2K5H A;  4LW1 A;  1VQM A;  1J5E Q;  2R92 H;  3S1M H;  1L1O C;  4UP9 A;  1JT8 A;  1PYB A;  3M4P A;  3ZJY C;  3KLW A;  3BZC A;  5M3F H;  5LMU L;  1EYG A;  1U0L A;  1GD7 A;  4JI3 Q;  3CMA A;  3UDX A;  4IJL A;  3TQY A;  4XIG S;  4R4C A;  1VQL A;  2WP8 J;  4OXP A;  4DV3 Q;  2UUB Q;  3TS2 A;  2KHI A;  5HY6 A;  1OTC A;  5FLM H;  4HJ9 A;  3PIP A;  3RZO H;  1AE2 A;  3AFQ A;  4LFA Q;  3W1B A;  2E2H H;  3J81 c;  1KC8 C;  1KRS A;  2BH2 A;  2QGQ A;  4OO1 G;  1JE5 A;  4GN3 B;  2I0Q A;  2ZTC A;  2UUA Q;  1FGU A;  1HR0 Q;  3KOJ A;  1C0A A;  4GS3 A;  1PH5 A;  4R4O A;  3S1Q H;  2JA7 H;  5GQO A;  4A3B H;  5IT9 c;  3M3Y H;  1L1O B;  3FKI H;  1VQ5 A;  4IPC A;  4DV0 L;  1Y1W H;  4GN4 B;  3KJP A;  4DV1 Q;  2EIF A;  3ERS X;  4LFA L;  4LFB L;  1N32 Q;  4A3M G;  1HZB A;  4JBK A;  2F4V Q;  4QY7 A;  3TRZ A;  1HZ9 A;  4JI1 L;  1ASZ A;  2JA8 G;  2N8N A;  2YTX A;  3CCE A;  4B3S L;  1EIY B;  1K9M C;  1PH4 A;  1IXR A;  4JI6 Q;  1VQK A;  2HHH Q;  1D7Q A;  5IYB H;  2R92 G;  3PO3 G;  3E0E A;  1VQC A;  4LFB Q;  1N32 L;  3PV0 A;  1PVO A;  1YHB A;  4C3J H;  4LFC Q;  4P74 A;  4DK3 C;  1IYJ B;  4PG3 A;  4DR1 L;  1WI5 A;  1J5E L;  4LUV A;  3UDI A;  2B3G A;  1YJN A;  2IX1 A;  1I50 H;  4L5Q A;  3TRE A;  2VUM G;  2VNU D;  4RG1 A;  1E1T A;  2GVB A;  4X64 Q;  5J3B A;  1S40 A;  1YIT A;  1XJV A;  4A3C G;  2Z0S A;  3RNU A;  1SRO A;  1VQ9 A;  3GTP H;  1X3F A;  4H02 A;  3STB C;  4JI0 L;  1N8R C;  4IFD I;  1P8L A;  1MJE A;  4K0K Q;  4GN5 A;  2KEN A;  2MO0 A;  5IP9 H;  1HR0 W;  2ASB A;  4A3L G;  5K36 G;  4BXX G;  1XNQ Q;  3AFP A;  4R1J A;  1JJC B;  2QEX A;  3TEH B;  2CFM A;  2Q2T A;  1KRT A;  4LF6 Q;  2OTL A;  4HJ7 A;  4A76 A;  2UXD L;  4A3B G;  3A5U A;  2GVA A;  4GOP C;  4A93 H;  3H0G G;  4RMF A;  4DV6 L;  3F8T A;  3A74 A;  2IHF A;  2OQ0 A;  1CKM A;  4NB3 A;  4OWT B;  4DV2 Q;  3KYH C;  4ME3 A;  1N34 L;  4FDB A;  3RN5 A;  2R7Z G;  3CCL A;  4BBS G;  3PIO A;  4DV7 Q;  4POF A;  2IX0 A;  1PH9 A;  2F3I A;  1VCI A;  4LWC A;  5E7N A;  1E24 A;  1S3O A;  1Y14 B;  3CQZ H;  2UUC L;  5IYD G;  4NXM L;  3PUY A;  4JI5 L;  1YBY A;  3J81 i;  4A3J G;  1PH7 A;  5ELO A;  2PMZ E;  1V9P A;  3CD6 A;  3S24 A;  1CSQ A;  1XPO A;  3T1Y L;  4B3S Q;  2AWN A;  5GAD C;  3BJU A;  2OCE A;  4DV7 L;  1W2B A;  3GTQ H;  2HQL A;  2R7F A;  4UPA A;  3DLL A;  2A8V A;  3U58 A;  4DKA C;  2A1A A;  2UXB Q;  2JA8 H;  2XGT A;  3NBH B;  1AH9 A;  2K75 A;  4UP8 A;  1AE3 A;  2WAQ G;  1N9W A;  1UEB A;  2NZO A;  2R7D A;  4YWK A;  3A0J A;  1QZG A;  3JAM i;  3G48 A;  2Y0S G;  4DR2 Q;  3OW2 A;  3T1H Q;  3I4M G;  4BY7 G;  4A3L H;  1GKH A;  1YEZ A;  1SMX A;  1U5K A;  3EIV A;  4NXN Q;  2Z6K C;  1L0W A;  1Q8K A;  2KBN A;  1IL2 A;  1A8V A;  3PO2 G;  2CKZ B;  5C3E G;  4DR6 Q;  2EQS A;  3HOY G;  3RLO A;  4BY1 G;  1C9O A;  3UDF A;  4JI0 Q;  3CCM A;  2QA4 A;  4AYB G;  3S17 H;  1GVP A;  2JE6 I;  4Y52 H;  2I5H A;  5ELN A;  2JJQ A;  4B3M L;  3H3V H;  2F52 A;  4J15 A;  1YVC A;  3HKZ G;  1OXS C;  3KF6 B;  4X65 Q;  3E9H A;  4A3D H;  4KHZ A;  4X62 Q;  1J6Q A;  1EIF A;  1MJC A;  2K4K A;  2KCT A;  4P73 A;  2MNA A;  4JI3 L;  1YHA A;  4LUO A;  4LF9 Q;  4DR1 Q;  1YJ9 A;  4DUY Q;  2UXC L;  2YTY A;  4HIO A;  2IHE A;  4JBJ A;  1OXV A;  1O7I A;  3K80 C;  1HNW L;  1G6P A;  3STB D;  1YJW A;  4IFD J;  4WJ3 M;  1UE5 A;  4NPS A;  4C2M H;  1K8G A;  1HNZ L;  4MTN A;  1N34 Q;  1QVF A;  3UE1 A;  3GTM H;  4P72 A;  4YY3 Q;  4P71 A;  1N33 Q;  1XNR Q;  3OTO Q;  3G4S A;  3M7N A;  4GKK Q;  5IYC G;  4YCU A;  2B63 H;  5JEA G;  3CP0 A;  1TWH H;  4DNI A;  2XTI A;  4HIM A;  1VQ4 A;  4DUY L;  1UE6 A;  1CSP A;  1NJI C;  1JJ2 A;  4JI5 Q;  1NE3 A;  1VQD A;  1XMQ L;  2ZJR A;  4NXM Q;  3FHW A;  1PHJ A;  1SN8 A;  4A75 A;  2R93 G;  4OO1 I;  1DGS A;  1B70 B;  5M5W H;  1TWC H;  4DR4 Q;  4DUZ L;  2ZM6 L;  2LSS A;  3D31 A;  1HNX L;  1Y1W G;  4WJ4 A;  2MO1 A;  3PF5 A;  1VQG A;  3K7A H;  1XPR A;  1GM5 A;  4AH6 A;  4LF7 Q;  1NMF A;  3WWV A;  4A3J H;  4IPH A;  1TXY A;  1W3S A;  1K0R A;  3K7U C;  1SE8 A;  3LGJ A;  1S72 A;  4DR6 L;  2JA5 H;  3GTK H;  1IBM L;  3PO3 H;  3OYY A;  4APV A;  3F2C A;  1VQ8 A;  1K8A C;  4X66 L;  5IY0 A;  3D0F A;  3MEF A;  5LMU Q;  4PMW A;  4LFC L;  4IJH A;  4GLX A;  1HR0 L;  2HIX A;  4KI0 A;  2K5N A;  1YNX A;  4JBM A;  2R6G A;  4R4Q A;  2VZA A;  4AIM A;  4QL5 A;  4DAM A;  2VQF L;  3S16 H;  4GNX B;  1VQP A;  1ASY A;  1TWG H;  4X64 L;  1E3P A;  1BVS A;  3FKI G;  3PSI A;  4IPG A;  4YHH Q;  3H15 A;  3HOV G;  4QGU A;  2BA0 A;  4LF8 Q;  4JYA L;  2JA7 G;  3KDF A;  4JI1 Q;  5IP9 G;  3HOZ G;  4A3K H;  2R7Z H;  4BBS H;  1VQI A;  4KLK A;  5IWA L;  3FP9 A;  4R4T A;  4DV0 Q;  1X54 A;  2JEB I;  4NXN L;  4PZ7 A;  3K81 C;  3ULL A;  1LUZ A;  4JYA Q;  4A93 G;  3CCS A;  3I55 A;  5LMN L;  1X9N A;  4LF5 Q;  2E8G A;  3PUV A;  4DV6 Q;  4O2D A;  1NY4 A;  4GKK L;  3BZK A;  4AQY Q;  1MKH A;  1SLJ A;  3F1Z A;  5IP7 G;  3CC7 A;  4DUZ Q;  1LTL A;  2HIV A;  1MIU A;  5GAH C;  1PA6 A;  4A3M H;  1GO3 E;  4P75 A;  2ZM6 Q;  1X56 A;  1IBK Q;  4QQB X;  4JI4 Q;  2UXC Q;  1XPU A;  4LF9 L;  3J81 j;  2ID0 A;  2VUM H;  3KFU A;  3M9B A;  2V1C C;  4AQY L;  1BBU A;  3Q8D A;  3RLF A;  1EUJ A;  3CPW A;  1XMO Q;  2L15 A;  2R93 H;  2VY3 A;  3PF4 A;  1RL2 A;  3TS0 A;  3CCV A;  5C44 H;  1N36 Q;  3I4N H;  2H5X A;  5IYB G;  4LNQ A;  1K3R A;  2E2I H;  4B3R L;  1I6H H;  5FLM G;  1LYL A;  1VQE A;  1YZ6 A;  2VQF Q;  4GNX A;  1WCM H;  5C4X G;  2HHH L;  5H1S E;  1K73 C;  2ALY B;  5IE8 A;  4YWL A;  1PH8 A;  4L5S A;  3EN2 A;  5C4J H;  3NEM A;  3BU2 A;  4IPD A;  1EFW A;  4B3T Q;  4BY1 H;  2PQA B;  1WCM G;  5C4X H;  3GDE A;  2A19 A;  5C3E H;  2K5V A;  1IBL Q;  2JA6 H;  3CCU A;  1KHI A;  1BKB A;  1A63 A;  5DLQ E;  4OX9 Q;  1IZ6 A;  5M3M G;  4BXX H;  4A3D G;  3PCO B;  2IY5 B;  1G29 1;  3RN2 A;  2I5L X;  4MNO A;  3CF5 A;  1LM0 A;  4JOI C;  3ICE A;  3S2D H;  2ZTD A;  3CCJ A;  3K0X A;  3HOZ H;  1EWI A;  1HH2 P;  2N78 A;  3EBE A;  1Q7Y C;  3MXN B;  3SGI A;  4A3I G;  2VW9 A;  4LF4 L;  2E2J H;  2UUA L;  4K0K L;  3H3V I;  2ZTE A;  2DGY A;  4JBW A; 
#chains in the Genus database with same CATH topology
 1ROD A;  2JA8 B;  3DWQ A;  3IRB A;  3G7L A;  3OTO L;  1Q1E A;  1Q86 C;  4FVM A;  2A6E C;  2B29 A;  2D0O A;  3TP5 A;  2CVR A;  1H9J A;  1STE A;  2NVY H;  1IYU A;  2A68 D;  2RF4 A;  3K7A B;  1I50 B;  3PUW A;  3J7A F;  4BA2 I;  1DM0 B;  2KUM A;  4UHV A;  1QUQ A;  3T1Y Q;  3RZD H;  4JCV E;  4EQ5 A;  3GTP B;  1I4G A;  5AJ3 L;  4I65 A;  4A3I B;  2DUD A;  2ICI A;  5G3L F;  4DN4 M;  3F2B A;  1QCB D;  4DAP A;  3HOU H;  2AQ1 B;  1E1O A;  4BBR B;  1II3 A;  4XTC S;  1KNA A;  2PCF B;  2Z9H A;  3V2T A;  5I2X A;  1DXM A;  2AMC B;  3I73 A;  2C35 B;  4DR3 L;  4L5R C;  4YCW A;  4NP5 A;  5GRO A;  3A8I E;  2IX3 A;  2BE5 D;  4A3G G;  3J81 L;  2E2H B;  3PMF A;  3P7J A;  4RH6 A;  4K8J A;  4XQJ A;  2JK8 A;  4X62 L;  3F2D A;  2K1B A;  1STH A;  1VQB A;  1KNE A;  3VR4 A;  5K5P A;  1GJX A;  5IGF A;  2FHT A;  4N8X 1;  1Y8O B;  2RDH A;  3GTM B;  4JK1 C;  3D3R A;  4QJF A;  3SXH A;  1TWG B;  2JN4 A;  2CH4 A;  2K14 A;  4RGT A;  2D0P A;  1GUO A;  1LAC A;  4AYB B;  2XNA C;  5E1F A;  1SRU A;  4M1U B;  1KIX A;  1UE1 A;  3J80 c;  3HRZ C;  1NBW A;  1V8Q A;  2IL8 A;  1JB7 A;  4LF5 L;  4CDE C;  4IUQ A;  5M5Y B;  4DAV A;  4A3C H;  1R9T B;  1F2Y A;  2F0P A;  4JI8 Q;  4JVZ A;  1DOK A;  3UDG A;  4JV5 Q;  1C8C A;  4KHP Q;  2B2U C;  1BO0 A;  1TII D;  2F4I A;  2K05 A;  4C56 C;  4IUT A;  4FF3 A;  4JV5 L;  2FMM A;  2EY5 A;  4O1N A;  3I90 A;  5LMN W;  2ZJQ A;  2L1B A;  2VUM B;  4FNF A;  3M85 A;  5M5X B;  3O13 A;  1Q81 C;  3Q6S A;  4B3R Q;  1GXD C;  1VF7 A;  4X65 L;  1BQQ T;  2AUK A;  2YTV A;  1Z9F A;  3L7Z C;  1JR0 D;  4G57 A;  1V1Q A;  1G51 A;  3GTQ B;  3UE0 A;  3D4R A;  2JA5 B;  5C4J B;  2LS0 1;  4QIW E;  2H1E A;  1HZA A;  3AEV A;  3ND8 A;  1X6O A;  4GNX C;  4A3K G;  2XRS D;  1KD1 C;  3HKS A;  3I4O A;  1RIP A;  4KHP L;  2ZXR A;  5GAE C;  3MXU A;  2KOL A;  3GO5 A;  5HGQ A;  4LUZ A;  1S5F D;  2YV5 A;  4R4I A;  5BN4 A;  1SBB B;  3MHB A;  2WAQ E;  2B2W C;  3NBI A;  1RKN A;  5KYI A;  3I3C A;  4I7Z C;  3HOU G;  3TDQ A;  3VYR A;  4KD4 A;  1RJT A;  2WFW A;  2K52 A;  2MPM A;  1Y1W B;  3AYH B;  1UUP A;  1AN8 A;  2D9U A;  3KJO A;  2VXW A;  2NN6 I;  2EXZ A;  3NXW A;  5CV8 A;  5AJ3 Q;  1JQY D;  4K5W A;  1R9T H;  4DK6 C;  1F2Z A;  5BN3 A;  5FO9 B;  3VA5 A;  1LLR D;  1Y1V G;  3I70 A;  4LF8 L;  5K36 H;  4HIK A;  2EYO A;  3CME A;  5CBA E;  4K5V A;  1Z7T A;  3VR6 A;  1VQM A;  1J5E Q;  2Q8R E;  3H94 A;  1DOL A;  4Z9C B;  1CHP D;  1HA6 A;  2RQX A;  3PO2 B;  4IJL A;  4XIG S;  1CA5 A;  4OHJ A;  1G2S A;  2BDO A;  2R61 A;  3TS2 A;  4BY7 B;  1GUN A;  2NTT A;  3PIP A;  1AE2 A;  3AFQ A;  3J81 c;  5IOC A;  5A35 A;  1SEB D;  1PH5 A;  4RKL A;  3HGB A;  3HOZ B;  4A3B H;  3SK6 A;  2JXM B;  3S2D B;  3HEJ A;  2O2L D;  3A8K E;  2BDN A;  4LFB L;  4LFA L;  2FFK B;  4JBK A;  4KTA A;  2F4V Q;  4QY7 A;  3RD4 A;  4F7X A;  3TRZ A;  1EY9 A;  3VYU A;  1I4P A;  4U68 A;  4B3S L;  1PZI D;  2AQ2 B;  1PH4 A;  2NZ1 D;  4XT3 B;  5CV5 A;  4FXG C;  1PVO A;  1A6X A;  1I4Q A;  3S15 B;  4DR1 L;  1WI5 A;  4JPB W;  1TY2 A;  4LUV A;  2B3G A;  2IX1 A;  2OXP A;  3IAY A;  1EU4 A;  1YIT A;  2O4X A;  3RNU A;  5A2Q E;  2B2T C;  1VQ9 A;  4DAY A;  3GTP H;  3E6Z X;  4Q5V A;  2F3V A;  1SXT A;  4IFD I;  3M4Y A;  2KEN A;  2MO0 A;  5IP9 H;  1TS5 A;  4V19 0;  3AFP A;  5M3M B;  3TEH B;  1KRT A;  1NAP A;  4HJ7 A;  1HUN A;  3F8T A;  3I91 A;  3A74 A;  2IHF A;  4NB3 A;  3N52 A;  4DV2 Q;  5C4X B;  1L0X B;  1N34 L;  2R7Z G;  2CW0 D;  4QMG A;  3RN5 A;  3CCL A;  2IX0 A;  1O7Z A;  1PH9 A;  1HTL D;  1YNJ D;  5E7N A;  2UUC L;  4NXM L;  1PH7 A;  3S24 A;  1CSQ A;  2Q8T A;  4B3S Q;  2QEJ C;  5GAD C;  5D14 A;  3EFX D;  2M9V A;  3U58 A;  2XWJ B;  2A1A A;  2NVT B;  1AH9 A;  2K75 A;  4UP8 A;  2WAQ G;  1QZG A;  2NZO A;  1A15 A;  5IT9 E;  1SYG A;  1R4Q B;  1Q8K A;  1A8V A;  4DR6 Q;  2EQS A;  3HOY G;  3UDF A;  1C9O A;  2L12 A;  1SE2 A;  3CCM A;  1MI2 A;  4JI0 Q;  3S17 H;  2IW3 A;  4Y52 H;  3K5L A;  1M8A A;  2KA7 A;  4J15 A;  3A56 A;  1NNX A;  3S16 B;  1MJC A;  4K5X A;  4P73 A;  2K03 A;  1PDQ A;  1YHA A;  4LUO A;  1CI3 M;  4LF9 Q;  3GTL B;  1SND A;  4QIW B;  4DUY Q;  1KDA A;  1R4P B;  2IHE A;  1G6P A;  1OXV A;  1O7I A;  3STB D;  1ZYR C;  3TP8 A;  1W6K A;  4NPS A;  1EFI D;  2F0D A;  2HUG A;  4NMZ A;  1WTX A;  3D6C A;  2ICE C;  3UE1 A;  4P72 A;  4GKK Q;  5IYC G;  4YCU A;  2B63 H;  2XTI A;  3IFD A;  1NJI C;  5EPL A;  1U4M A;  1PHJ A;  2E75 C;  4DR4 Q;  1GUT A;  3K57 A;  4DUZ L;  3D31 A;  4WJ4 A;  1DCZ A;  4XXE A;  2XWB B;  3W2D A;  3PF5 A;  1X3Q A;  5EPK A;  3HS0 C;  3WWV A;  3C46 A;  4A3J H;  1Y8P B;  2F0N A;  2NB0 A;  1S72 A;  4DR6 L;  4ZQ3 A;  3GTK H;  3NTK A;  1VQ8 A;  1K8A C;  3BYT B;  4X66 L;  1LTB D;  3A54 A;  5HUR A;  1EY7 A;  1PXU A;  2MJ8 A;  5LMU Q;  1STY A;  4K2L A;  3OIP A;  4LFC L;  3V96 A;  1HR0 L;  3OWF A;  1SFO B;  4DAM A;  5JPN C;  3K59 A;  1HPC A;  1MSH A;  1PRT B;  1EY4 A;  1TWG H;  3T53 B;  5ELC A;  1A2U A;  3E0J A;  3FKI G;  1QJO A;  2JP1 A;  3DUZ A;  4KKU A;  4DNT B;  1TR5 A;  4A3K H;  1G8Z D;  4KLK A;  2EJG C;  5IWA L;  2LFN A;  4RCO A;  4C3I G;  3GTG B;  4PZ7 A;  1LUZ A;  2PW7 A;  1EEI D;  2N55 A;  4DV6 Q;  3BDC A;  4MN3 A;  3EVQ A;  4NKL A;  3HOV B;  4HAE A;  3CC7 A;  4DUZ Q;  2AQ3 B;  1PA6 A;  4A3M H;  1GO3 E;  1VMP A;  2ZM6 Q;  3ZYY X;  1XPU A;  1UEA B;  3J81 j;  2ID0 A;  4ZCK A;  2TMP A;  2QF7 A;  5E4X A;  3CPW A;  3H91 A;  1XMO Q;  2R93 H;  2EZV A;  3QO2 A;  1E2Z A;  3R93 A;  2H5X A;  4KN4 C;  1I4H A;  1LYL A;  1TWA B;  1EEF D;  5JVG 3;  3EJI A;  5C4X G;  2HHH L;  3S9W A;  2K5W A;  1KLG D;  1CM9 A;  4BY1 H;  3NP8 A;  5EPJ A;  4B3T Q;  1SYB A;  2FMC A;  3GDE A;  4QB4 A;  2XRQ D;  2K5V A;  3BDO A;  5I6W A;  5C3E H;  3CCU A;  5M3M G;  4DGZ A;  2IY5 B;  1LM0 A;  3FPP A;  3CCJ A;  3PO3 B;  3OWE B;  4JW0 A;  4LF4 L;  3EBE A;  1Q7Y C;  3MXN B;  2VW9 A;  3H3V I;  1NR4 A;  1TQO A;  5ISR A;  5JJI A;  2JEA I;  4JI2 L;  2UU9 L;  3NQT A;  2NN6 G;  1EZ6 A;  5CV7 A;  1VS0 A;  2CCZ A;  4BA1 I;  1WYD A;  4MIU A;  1J8I A;  5JVH 3;  2CWP A;  4LAA A;  4CDF C;  1CKN A;  3H3V C;  3L9A X;  4O0A A;  1WTO A;  3I2Z A;  4FO2 A;  1S5E D;  1L2F A;  3HP3 A;  2EDG A;  4HJ8 A;  1ET9 A;  1JOR A;  1QNU A;  5EKI A;  1WFQ A;  2ES2 A;  1L1O A;  1S4Z A;  3GV3 A;  5M5X H;  4LF7 L;  1KDB A;  2F0T A;  1LO5 D;  1Q1B A;  1Y1V H;  1QWY A;  1EYA A;  4ZYS A;  3FMC A;  4LF6 L;  4K8I A;  2PQA A;  2G9D A;  4H7B A;  4FXD A;  2PPB C;  4JI7 L;  3GTJ H;  2AHO B;  3P20 A;  3W1G A;  1SMY D;  4Y7N H;  3FPU B;  2HDM A;  4JI6 L;  2YU9 B;  2OQK A;  4HID A;  1PH6 A;  2Q2H A;  2NVQ H;  4TVA B;  3K58 A;  3BDL A;  1TWC B;  4MTK A;  2H4O A;  3GTG H;  3B6Y A;  1SNP A;  3ERQ A;  3X3N A;  4JI2 Q;  3S1N H;  1TWA H;  2OEO A;  3CC2 A;  1I6H B;  3T51 B;  3CXC A;  1D8L A;  1H9S A;  2DJG C;  4DR5 Q;  4DR7 L;  3GTJ B;  4PNY A;  1XX8 A;  1PH2 A;  1IYV A;  2AUJ D;  2ATW A;  1CFM A;  1X65 A;  4HSV A;  1ESR A;  1M90 C;  2E5L Q;  2WB1 G;  4JI4 L;  3RZD B;  1A3U A;  3W3A A;  3NTI A;  2SEB D;  2XSC A;  2RHQ B;  1QUQ B;  2OTJ A;  4N8F A;  4C3J B;  3ULP A;  2CH4 W;  2I07 B;  1O80 A;  4BBS B;  3C3L A;  4JI7 Q;  1QVC A;  1VQO A;  2JA9 A;  1RF2 D;  3CCR A;  2BH8 A;  4CJ0 B;  5BR8 Q;  3S14 H;  2TSS A;  5C6A A;  4HJ5 A;  1KLU D;  2UXB L;  3SK4 A;  1SR3 A;  1I3Q H;  3MA2 B;  3RLN A;  5IT9 L;  1BOS A;  1UWV A;  1EWH A;  2EXD A;  1W6J A;  3L3O C;  3UI2 A;  1T9H A;  4FF2 A;  4TQU S;  4DR5 L;  4OWX B;  1HJP A;  1JMC A;  2I46 A;  4AYB E;  4WOR A;  2UXD Q;  3CAM A;  2MGS A;  2B63 G;  4IUR A;  1A62 A;  4B3M Q;  1I5F A;  1QZH A;  4DFA A;  1E7Z A;  1VQH A;  3AB9 A;  3NEL A;  3MFY A;  2UU9 Q;  1IHZ A;  3HKZ E;  1V1P A;  2F0J A;  1B3A A;  3M3Y B;  3OW7 A;  4XDX A;  3NHH A;  4IOC A;  1YI2 A;  1TS3 A;  3ER0 A;  1YHQ A;  4IFD H;  1JE4 A;  1SFO H;  1YIJ A;  1GUW A;  1DD2 A;  1N33 L;  3SHL A;  1E2V A;  2SNM A;  3CCQ A;  4POG A;  2Q2U A;  2CQO A;  1Q90 A;  1CK1 A;  2FJ2 A;  1PV4 A;  1FVI A;  1XTD A;  1C7Y A;  5I9O A;  3BS1 A;  1Z47 A;  2UUC Q;  4GOP A;  4J8Q A;  3LWU A;  3RZO B;  1BR9 A;  2B2W A;  3U4Z A;  5T1I A;  1BCP F;  1IBM Q;  4JC0 A;  1PYW D;  4L63 B;  5F2D A;  3CC4 A;  1MBY A;  1HNW Q;  3N6R A;  4ALP A;  5FLX c;  1PTO B;  2RHS B;  3CRK C;  3L0O A;  5CV4 A;  1SE3 A;  3MEH A;  4B08 A;  2RDG A;  4B9X A;  3PQI A;  2F0G A;  3U4V A;  4IOA A;  1D1K A;  1H9M A;  2I5M X;  1SYD A;  1CHQ D;  3KBX A;  2NUC A;  5DEH A;  1A2T A;  3A8J E;  4X3K A;  2Y0S B;  1AZP A;  1JT8 A;  1PYB A;  5D3I B;  3M4O B;  4DF7 A;  2PNR C;  4RFB A;  3CMA A;  3TQY A;  5JOB A;  3P1H A;  1PMR A;  2PZT A;  1OTC A;  4CJ2 C;  2EYH A;  4LFA Q;  2E2H H;  1PLF A;  2BH2 A;  1KRS A;  2KEC A;  1JE5 A;  2D2C C;  4GN3 B;  2ZTC A;  1FGU A;  3BG3 A;  3HOY B;  3BVZ A;  4G4K A;  4R4O A;  4A3G B;  3K5M A;  1L1O B;  3FKI H;  1Q8I A;  4FF4 A;  4U67 3;  5M9O A;  3E3X A;  3ERS X;  4A3M G;  5KNC A;  2N8N A;  2YTX A;  3MTS A;  1JIC A;  1EIY B;  1PTO F;  1IXR A;  1D7Q A;  4K14 A;  3PO3 G;  3E0E A;  4G7Z C;  4LFB Q;  3NE5 B;  4C3J H;  4LFC Q;  1IYJ B;  5C5M A;  5FOB B;  4XYO A;  1I50 H;  2VNU D;  4RG1 A;  1MSG A;  1VF5 C;  2OT2 A;  1B3Q A;  2GVB A;  1S40 A;  1XJV A;  1JOO A;  3PIO 3;  4BS9 A;  1EQT A;  1X3F A;  2WV6 D;  2PQE A;  1MJE A;  4K0K Q;  4GN5 A;  4A3L G;  1HR0 W;  3I4N B;  1V1O A;  4BXX G;  2QEX A;  1I3Q B;  4EQO A;  2CFM A;  4LF6 Q;  2OTL A;  4A76 A;  2GVA A;  1SSO A;  3H0G G;  1XXG A;  4B9W A;  2A68 C;  1CKM A;  1XTC D;  1TY0 A;  2NVQ B;  3KYH C;  4BBS G;  4V0B A;  2EOT A;  4DV7 Q;  4LWC A;  3CQZ H;  1ENC A;  3PUY A;  1Q3L A;  5ELO A;  1K8M A;  2PW5 A;  5LL6 X;  4IAL A;  5E4W C;  1XPO A;  3T1Y L;  1QE6 A;  3NTH A;  2AWN A;  2C9O A;  2OCE A;  3BJU A;  4DV7 L;  1W2B A;  2E2J B;  2HQL A;  2R7F A;  3J80 E;  1Y69 U;  4UPA A;  5J22 A;  1Z6H A;  3TBI B;  3DHQ A;  2UXB Q;  4EGV A;  1N9W A;  1UEB A;  2R7D A;  4IUP A;  4YWK A;  3A0J A;  3CQZ B;  2Y0S G;  3TZU A;  2E2I B;  4A3L H;  4NXN Q;  2WB1 B;  4XQN A;  1QNK A;  3NWT A;  1SJE D;  5C3E G;  3RLO A;  3QJY A;  3DWA A;  4ODG A;  5ELB A;  4AYB G;  3S1M B;  1GVP A;  2JA6 B;  5ELN A;  2JJQ A;  4B3M L;  3WOF A;  4J1M A;  4X65 Q;  3HKZ G;  1OXS C;  3E9H A;  3K6O A;  4A3D H;  1STB A;  2RVL A;  4JI3 L;  3S14 B;  3URY A;  1PZK D;  1QOH A;  2YTY A;  4HIO A;  5IGB A;  4QUF A;  3SR1 A;  1UE5 A;  1K8G A;  4C2M H;  2CHB D;  1HNZ L;  4XYQ A;  1N34 Q;  2VB2 X;  5EKL A;  3HKZ B;  5IGE A;  4YY3 Q;  3G4S A;  2EYM A;  4S3S A;  3CP0 A;  1TWH H;  1VQ4 A;  1DOM A;  1WCM B;  1AFP A;  1CSP A;  1JJ2 A;  4NXM Q;  1NE3 A;  4ZUI A;  1XMQ L;  4GZY C;  1SN8 A;  4A75 A;  2R93 G;  5C3E B;  1B70 B;  4ZKC B;  2ZM6 L;  3GV6 A;  1EOT A;  2L11 A;  2KHS A;  1ZEQ X;  5M3F B;  1WVL A;  4APV A;  3F2C A;  1MHW C;  2KED A;  5IY0 A;  1KTK A;  5COY A;  3MEF A;  2F0W A;  3K5N A;  4IJH A;  1LTI D;  1B53 A;  5CR3 A;  2K5N A;  4C3H G;  2R6G A;  2VZA A;  4AIM A;  2B8G A;  3Q23 A;  4GNX B;  1VQP A;  3HOU B;  1EY0 A;  1ASY A;  3U9O A;  1E3P A;  3PSI A;  4IPG A;  4I7A A;  2R7Z H;  3OHX C;  3GTO B;  4DA2 A;  4JYA Q;  3CCS A;  5LMN L;  4LF5 Q;  2E8G A;  3PUV A;  5ELF A;  2WIN B;  4O2D A;  3NUC A;  3BZK A;  2F3W A;  1TS2 A;  4K6L A;  1DZ1 A;  1LTL A;  1IBK Q;  1LTT D;  4P75 A;  5CV6 A;  1T5X D;  1D5M C;  1GHK A;  3VA7 A;  2UXC Q;  3KFU A;  2B2Y C;  4AQY L;  1NCV A;  3RLF A;  5L37 A;  2F0O A;  2A74 C;  2F0H A;  3PF4 A;  1WTP A;  4RAU C;  1B9M A;  4C2M B;  3I4N H;  2IPK D;  5KND A;  4LNQ A;  1NR2 A;  5IGC A;  1VQE A;  2Z4H A;  1D5Z C;  2XIW A;  5IE8 A;  1PH8 A;  3NEM A;  3BU2 A;  3FEW X;  4IPD A;  1EFW A;  2E2D C;  1WCM G;  1PFM A;  4DK0 A;  1KHI A;  1BKB A;  1JCK B;  4HMI A;  4DXF A;  1XWE A;  1C4Q A;  1A3V A;  2I5L X;  4KY7 A;  4JOI C;  3ICE A;  4ID6 A;  1ZKO A;  3S1Q B;  1EWI A;  1ET6 A;  4KY5 A;  1OO9 B;  2E2J H;  4K0K L;  2ZTE A;  3L2P A;  4JBW A;  2EY6 A;  1ILQ A;  4IQZ A;  3KF8 B;  1I4R A;  3GQB A;  2HDL A;  1DON A;  3QR8 A;  1WTV A;  1ENA A;  2AKW B;  2PI2 E;  3KK7 A;  2OWO A;  2D5D A;  1K83 B;  4GKJ L;  1GOZ A;  3G6J B;  3DM1 A;  3NEN A;  4EVO A;  4EQP A;  1BXT A;  4R9W A;  3JAM c;  1VQA A;  5I9P A;  2KCC A;  3K8A A;  4CJ1 B;  2DY7 A;  1CT1 D;  2YYZ A;  5EQ0 A;  4K6D A;  4LK1 C;  4GOP B;  1A3T A;  1E2W A;  5C0X G;  2G5D A;  2VQE L;  2B2V A;  4DAY B;  2QKI C;  1QVG A;  1QG7 A;  1LTS D;  2QCP X;  1X3G A;  4BBR G;  2IT1 A;  2DY8 A;  2VQE Q;  4YCV A;  3M4Q A;  3KDF B;  5GAG C;  4X6A H;  3S2H H;  5IWA Q;  4F87 A;  2NZH A;  2F1M A;  4P2C B;  4X3U A;  4A3G H;  1EY5 A;  3EQL C;  3I7F A;  2KHJ A;  4KY6 A;  1AW7 A;  5JJK A;  4OGQ C;  1L0Y B;  3I4L A;  4DV5 Q;  1EY8 A;  3I4N G;  2A6H C;  4ILW A;  1ENF A;  1O78 A;  1X55 A;  1VQ6 A;  2RCN A;  3HOX H;  1Q82 C;  4DV4 L;  1VQF A;  3CPF A;  2ZJP A;  3TN2 A;  4HED A;  4A3K B;  1J9O A;  2JA5 G;  1PFS A;  1PYS B;  2HCC A;  2DJF C;  3BYY B;  3HOW G;  2R7Z B;  1JJG A;  4BY7 H;  1VQN A;  4DR4 L;  2WB1 E;  1B8A A;  3SK8 A;  3SE0 A;  3MFG A;  4YWM A;  1SNO A;  3I56 A;  1JC7 A;  1E22 A;  4GKJ Q;  3U50 C;  2Z6B A;  1K83 H;  5FJ8 G;  4DR3 Q;  4KK7 A;  1RTN A;  3MXG A;  2NN6 H;  4A3M B;  3AQQ A;  4ZRZ A;  5KNB A;  1TWH B;  2VL6 A;  3Q22 A;  5BR8 L;  3JC6 6;  5HGT A;  5CYU A;  4A3E H;  1D2B A;  4RWS C;  4L6T B;  4KN7 C;  1FNV A;  1NTG A;  2PNH A;  3GP7 A;  4LF4 Q;  3TP7 A;  2NYZ D;  2F0Q A;  5NUC A;  3LX0 A;  4X3T A;  1I94 Q;  3MXP A;  2PI2 A;  3MVV A;  3PGZ A;  3FKI B;  1V43 A;  3SEB A;  2A69 C;  5FO8 B;  5KRU A;  3FDT A;  2K50 A;  2MUY A;  2B2T A;  5FK9 C;  4IN3 A;  4G7H C;  1SYC A;  5JAV A;  5FLX L;  4YHH L;  3LNN A;  2K04 A;  4CGY B;  4C3I H;  4DV2 L;  1SE4 A;  4C3H H;  4DV3 L;  2ZT9 C;  3KF6 A;  4A3I H;  1EQQ A;  2UUB L;  1HRJ A;  4NDX A;  1WTQ A;  2E76 C;  5JJL A;  3GTO H;  2E74 C;  3GTM H;  3J80 i;  1CKO A;  2D62 A;  3MWY W;  3DXJ C;  4PZ8 A;  4RGO S;  3T13 A;  4OEM B;  1HZC A;  5FLX E;  1CQF A;  2JA6 G;  1OXU A;  4GLA C;  1O7L A;  3GTL H;  3KBG A;  2AWO A;  2KVM A;  2G9H D;  2CWA A;  3T1H L;  4A3E G;  1VQ7 A;  1SYE A;  1HFG A;  2VS1 A;  4OEL B;  4DR2 L;  3G6E A;  3S1R B;  1H9S B;  1TVX A;  1SNQ A;  4IZ8 A;  3RR5 A;  4L5T A;  2E5L L;  4YIJ A;  2WII B;  3ERO A;  3W5O A;  4LW1 A;  1EIH A;  1Y8N B;  2F0M A;  2R92 H;  4UP9 A;  1WTW A;  4HMJ A;  1EQV A;  3M4P A;  3ZJY C;  3BZC A;  5KIX A;  5J39 A;  1EYG A;  1LTR D;  1TT2 A;  1U0L A;  3I72 A;  3VYT A;  2DNC A;  4JI3 Q;  5DM6 3;  3VYS A;  1S5D D;  2HCI A;  4R4C A;  4TKO B;  1VQL A;  4DV3 Q;  4OXP A;  1UAP A;  2UUB Q;  1PRT F;  2NBF A;  4WJW A;  2KHI A;  5FLM H;  3CU7 A;  4Q0F A;  3RZO H;  2QIL A;  5C5L A;  1HR0 Q;  3KOJ A;  1C0A A;  1SDF A;  3S1Q H;  2JA7 H;  5GQO A;  2B8F A;  5IT9 c;  4K2K A;  3K0Y A;  3V05 A;  4IPC A;  4DV0 L;  1VQ5 A;  3T56 B;  3H6M A;  1N32 Q;  1H9K A;  4DXG A;  4UAI A;  1XYI A;  3RUZ A;  1HZ9 A;  1ASZ A;  2JA8 G;  2PYK A;  1MD2 D;  3CCE A;  5A2Q L;  1AZQ A;  4G7O C;  5C3W A;  1VQK A;  2HHH Q;  2F0K A;  5IYB H;  2ZXO A;  1RDP D;  1VQC A;  2M00 A;  2R3Z A;  1YHB A;  1IKM A;  4PG3 A;  1J5E L;  2EYF A;  4ME5 A;  1AP0 A;  2VUM G;  1LT3 D;  4X64 Q;  5J3B A;  2WAC A;  1HUM A;  3MXN A;  1S5C D;  1SRO A;  5C0X H;  2F0L A;  1CTM A;  4H02 A;  2IWH A;  1TKW B;  3STB C;  1P8L A;  5I4D A;  4JI0 L;  3F2U A;  5K36 G;  4XT1 B;  1NUC A;  1D6E C;  1JJC B;  2BOS A;  1PTO D;  1U9R A;  2Q2T A;  5JPM C;  1VDZ A;  4H13 C;  4A93 H;  4KD3 A;  4A3E B;  1K8O A;  2OQ0 A;  3TZD A;  2EJF C;  4CBV A;  4ME3 A;  4FDB A;  3PIO A;  2ZXP A;  2XVS A;  2F3I A;  1VCI A;  3H09 A;  1EWC A;  1E24 A;  1S3O A;  4FYD A;  2P5Z X;  5IYD G;  3D8G A;  4JI5 L;  1YBY A;  2RA4 A;  3QB3 A;  3J81 i;  4A3J G;  2PMZ E;  1V9P A;  3CD6 A;  5C4Z A;  5T1G A;  3GTQ H;  3DLL A;  4KJO A;  3J7Y W;  2A8V A;  3S17 B;  4DKA C;  2JA8 H;  3NBH B;  1AE3 A;  1SMY C;  4CDC C;  3JAM i;  3G48 A;  4BY7 G;  1BCP C;  1GKH A;  1YNN D;  1SMX A;  1U5K A;  3EIV A;  2JA7 B;  2Z6K C;  2RCF A;  3TP6 A;  1IL2 A;  3PO2 G;  2CKZ B;  2PO4 A;  2X6G A;  1BBX C;  2NVY B;  2QA4 A;  2R92 B;  2JE6 I;  3H3V H;  1JWS D;  4R8N A;  4RHS A;  1YVC A;  3KF6 B;  3DWP A;  2L55 A;  5G3L D;  1EIF A;  2EVB A;  2MNA A;  3E5S A;  4DR1 Q;  2UXC L;  2M2L A;  3K80 C;  1HFN A;  3KLS A;  2KCN A;  4QF4 A;  2EE1 A;  1GUG A;  4UDU C;  4P71 A;  3M7N A;  2JSO A;  3OMC A;  3OTO Q;  1PTO H;  1YJW A;  4JI5 Q;  1G6Z A;  4DU9 A;  3C2P A;  3FHW A;  1HHV A;  1DGS A;  5M5W H;  1TWC H;  3R2T A;  1E0B A;  4DK1 A;  1Y1W G;  2MO1 A;  5CC4 A;  4CKE A;  4ZLT F;  1F2L A;  1GHJ A;  1VQG A;  2A6H D;  1GM5 A;  4AH6 A;  4LF7 Q;  4RKB A;  2B2Y A;  4WFN 3;  1TXY A;  2A5H A;  3K7U C;  1SE8 A;  3LGJ A;  4WRD A;  2JA5 H;  3PO3 H;  3OYY A;  1RD9 D;  2PMZ B;  2SDF A;  3FRP B;  4GLX A;  2WKD A;  3DEP A;  5EJW A;  4JBM A;  2VQF L;  4PMB A;  1HTP A;  4A3F B;  1PRT C;  5COR A;  4C3H B;  1PZJ D;  1EYC A;  3HOX B;  3H15 A;  3HOV G;  3BZD B;  4YHH Q;  4QGU A;  2BA0 A;  4LF8 Q;  3KDF A;  5IP9 G;  1EIG A;  4BBS H;  2Z1C A;  3FVQ A;  4EQN A;  2JEB I;  3AU7 A;  1V1P B;  4OO1 H;  3JAM E;  1DYQ A;  2V4D A;  1NY4 A;  2EYL A;  4AQY Q;  1I4X A;  1MKH A;  1SLJ A;  3F1Z A;  1MIU A;  5JEA H;  5GAH C;  1O7Y A;  3IL8 A;  4LF9 L;  1SAP A;  2MP1 A;  1WTR A;  1BNZ A;  3M9B A;  3Q8D A;  3SK5 A;  1EUJ A;  4QCL A;  2L15 A;  2VY3 A;  1IL8 A;  2EYJ A;  2LMC B;  1RL2 A;  3SDZ A;  3CCV A;  5C44 H;  1HA5 A;  2F0F A;  3R2I A;  4IUU A;  1H9R A;  1K3R A;  2L4N A;  4IUN A;  1EZ8 A;  1EY6 A;  1ONL A;  5AFW A;  2VQF Q;  2WKC A;  4GNX A;  2K5Q A;  4A93 B;  5H1S E;  4LJZ C;  1JOK A;  4DNR B;  3IFT A;  3DEO A;  5C4X H;  2A19 A;  1IBL Q;  2FIN B;  1A63 A;  4HCE A;  5DLQ E;  1PFB A;  1IZ6 A;  2HQE A;  3OIQ A;  3PCO B;  4A3D G;  3RN2 A;  2O5J C;  3CF5 A;  4IUV A;  3S2D H;  3GTK B;  3SGI A;  2EPB A;  2DGY A;  1CA6 A;  2KCM A;  1KQS A;  1BCP B;  4OX9 L;  4CKC A;  4MZ9 A;  2NVT H;  1G91 A;  1WJJ A;  1Q46 A;  1P16 A;  1CZW A;  1HNZ Q;  1FYC A;  2NVX H;  4DR7 Q;  1H95 A;  5I2Y A;  1Y1V B;  1FR3 A;  4HJA A;  2DNE A;  1XMQ Q;  2KQ3 A;  2N88 A;  3SVM A;  2KJX A;  3E9I A;  2ENB A;  2J4X A;  1KAW A;  1TWF H;  5EBC A;  5C3X A;  4RHR A;  3HOW H;  1CKN B;  2HT1 A;  1KL9 A;  4ZKB B;  3A7L A;  2YU9 H;  2LXK A;  4UP7 A;  1EQR A;  4DV1 L;  3HOV H;  3HOX G;  1KXL A;  2DN8 A;  1STN A;  4L8J A;  5FJ8 H;  1QB5 D;  2WAQ B;  5EAY A;  3QG1 A;  2IJ0 A;  4GLV B;  4HSP A;  4X66 Q;  1OXX K;  3NBH A;  3NPP A;  3X3M A;  1TWF B;  4A3F H;  4IFD G;  2LXJ A;  1WTH A;  2B2U A;  4HTH A;  5M5Y H;  2L9H A;  2Z6K A;  3VR2 A;  3TME A;  2N3S A;  1BUV T;  1VQJ A;  1PH3 A;  1CUK A;  3VR3 A;  1FL0 A;  2F0S A;  1FD7 D;  4R8I A;  2K28 A;  5J1Z A;  4XQQ A;  1ICW A;  3HZX A;  2KEE A;  5ELD A;  1M1K C;  2QDL A;  4C3J G;  1RTO A;  5IYD H;  1B1Z A;  4BY1 B;  4UY8 C;  1FNW A;  2N49 A;  4FF1 A;  4N9P A;  5IYC H;  1I94 L;  4CHT B;  1ICF B;  4RCN A;  5IOD A;  1FJG Q;  3CRL C;  5E3F A;  2EJM A;  1WOC A;  3D6W A;  3CKI B;  1IBK L;  4ABN A;  3C1F A;  4OON A;  2R93 B;  2A69 D;  1ILP A;  3GD7 A;  5FKA C;  2K6A A;  1Q12 A;  4E6I A;  2BE5 C;  3K5O A;  5KGU A;  3R3O A;  4BBR H;  1ZXT A;  3PUX A;  1B7Y B;  2L0C A;  2JQO A;  5M3F G;  1HNX Q;  2NVX B;  4H0L C;  3HOY H;  1KDC A;  1BDO A;  1IW7 C;  1K28 A;  5JEA J;  3NK9 A;  3OOC A;  1XNR L;  4TRD A;  3PUZ A;  5ELE A;  4EX5 A;  3HFZ B;  4H44 C;  4DPG A;  5M3M H;  4B3T L;  2BA1 A;  3DM3 A;  3ULJ A;  1IW7 D;  3M4O H;  1LTG D;  1HCZ A;  1OXT A;  4ZUJ A;  4HR7 B;  3A5Z B;  3R8B A;  2MHV A;  2MQH A;  2Z8L A;  1XNQ L;  4MHE A;  5TSS A;  1UE7 A;  3ITP A;  3KF8 A;  4ULL A;  1FJG L;  3EA6 A;  5IP7 H;  4DV5 L;  1F9P A;  3VDY A;  1CZG A;  2FXQ A;  3MZ5 A;  4JOI A;  4A4I A;  3PIP 3;  3S1R H;  1SJH D;  1U4P A;  4QUC A;  5LMN Q;  1GUS A;  1A0I A;  1G2T A;  3J7A V;  2GN5 A;  1NMG A;  1WD0 A;  1T5E A;  4KV6 A;  5I6Y A;  5C0X I;  4N9T A;  3TSS A;  1UNS A;  4YY3 L;  3H0G H;  1LAB A;  5JJZ A;  3PO2 H;  4BWG B;  3S15 H;  5IIF A;  1XMO L;  4OIK A;  4JI8 L;  3J7Z C;  2PZU A;  4RGM A;  2Y0S E;  4HN7 A;  4DV4 Q;  2A6E D;  1HQM C;  1PH1 A;  1N36 L;  3Q24 A;  4JG2 A;  4A3F G;  3WOE A;  4IO9 A;  4PZ6 A;  3A7A B;  5C4H A;  2F4V L;  2Z4I A;  1IBL L;  2LKV A;  3P75 A;  1SNM A;  3G71 A;  3I4M H;  2BCO A;  2Q2I A;  1RHP A;  1X3E A;  5C0X J;  4OWW B;  2X6L A;  3QOL A;  5C44 G;  5CBE E;  2O5I C;  2MFI A;  1BBW A;  2B63 B;  2XN9 C;  3D4W A;  4KKS A;  1EOV A;  3CW2 C;  1STA A;  5DM7 3;  3QWN A;  5M5W B;  1B50 A;  2K5H A;  1HQR D;  1D1I A;  2NTS A;  5CGK A;  3S1M H;  3I4M B;  1L1O C;  3U9S A;  3KLW A;  5M3F H;  4HCS A;  1JWU D;  5LMU L;  1GD7 A;  3UDX A;  2SOB A;  2WP8 J;  1B9N A;  4X3S A;  1M4V A;  3C1E A;  5HY6 A;  4HJ9 A;  3W1B A;  3MAQ A;  1KC8 C;  4LMQ D;  4OL7 A;  2QGQ A;  4OO1 G;  2I0Q A;  2UUA Q;  3VR5 A;  4GS3 A;  3MC0 B;  3M3Y H;  1PRT D;  1JOQ A;  1Y1W H;  4GN4 B;  3QIA A;  3KJP A;  4DV1 Q;  2EIF A;  2K33 A;  1TU2 B;  2RKS A;  1HZB A;  1KAB A;  4PQX A;  4JI1 L;  4KMU C;  4A3D B;  1PTO C;  1STG A;  1FGB D;  1K9M C;  4FXK C;  4JI6 Q;  4C3I B;  2R92 G;  4F8M A;  1C48 A;  1N32 L;  5LHY 1;  3PV0 A;  4P74 A;  4DK3 C;  1MGS A;  3OMG A;  1B2T A;  3UDI A;  1YJN A;  1S5B D;  4L5Q A;  3TRE A;  1E1T A;  1BCP D;  1YNN C;  4A3C G;  2Z0S A;  3ONA B;  1F9S A;  4C1N I;  2C5C A;  1N8R C;  2A73 B;  2K5D A;  2ASB A;  1KAA A;  4RA8 A;  1WD1 A;  4R1J A;  5LL6 S;  4FP5 D;  4A3J B;  1LT6 D;  2UXD L;  4A3B G;  3A5U A;  1LT5 D;  4GOP C;  5DAU A;  4RMF A;  4DV6 L;  3M7G A;  5IGG A;  2PZW A;  4OWT B;  3KLS X;  4O42 A;  4C1N K;  2EY1 A;  5IGD A;  4POF A;  2RBM A;  1EYD A;  1VMC A;  1Y14 B;  2EY2 A;  3BVM A;  3S2H B;  2JYO A;  1PFN A;  4KKT A;  2QDB A;  5FO7 B;  1LT4 D;  2L5T A;  1HXY D;  2XGT A;  1FNU A;  2RDF A;  3IKJ A;  1AEX A;  1NSN S;  3CHB D;  1JWM D;  2SNS A;  4DR2 Q;  2Q8I B;  3OW2 A;  3T1H Q;  3I4M G;  1EU3 A;  1K0S A;  1YEZ A;  3JAM L;  1ML0 D;  2X69 A;  1L0W A;  2KBN A;  1ESF A;  4BY1 G;  1YNJ C;  3QOJ A;  2B39 A;  2I5H A;  1B44 D;  2F52 A;  4KHZ A;  3HOW B;  4X62 Q;  1J6Q A;  2K4K A;  2KCT A;  1JB3 A;  4F88 A;  1YJ9 A;  5EKK A;  2F0E A;  2F0U A;  4JBJ A;  2J7Z A;  5C44 B;  1HNW L;  5D3D A;  1D5X C;  4IFD J;  4WJ3 M;  4MTN A;  1QVF A;  3Q0A A;  1N33 Q;  1XNR Q;  5JEA G;  4DNI A;  4M8A A;  4HIM A;  1X3P A;  1UE6 A;  4DUY L;  1VQD A;  2ZJR A;  1SYF A;  4OO1 I;  5CMD A;  2LSS A;  1HNX L;  3BVG A;  1IKL A;  3K7A H;  1XPR A;  3S1N B;  2EYP A;  1NMF A;  2F0V A;  5DNF A;  2VB3 X;  4OIJ A;  4IPH A;  1W3S A;  1K0R A;  1IBM L;  1ZYR D;  2K32 A;  2RSN A;  3D0F A;  1F9Q A;  2F0I A;  1F9R A;  4PMW A;  2HIX A;  2QW7 A;  4KI0 A;  5EGT A;  1LTA D;  1YNX A;  2OF1 A;  2LY7 A;  4R4Q A;  3OSO A;  1QIL A;  4QL5 A;  3AMU A;  3S16 H;  1CQV A;  4A3B B;  4X64 L;  1BVS A;  2B2V C;  4JYA L;  4TSS A;  5CV9 A;  1LV9 A;  3WDN A;  2JA7 G;  4JI1 Q;  1BF4 A;  3J80 L;  3HOZ G;  2J0T D;  1U4R A;  1VQI A;  4CDD C;  3FP9 A;  4R4T A;  4DV0 Q;  1X54 A;  1TS4 A;  3HG9 A;  4NXN L;  3ULL A;  3K81 C;  4A93 G;  1DJR D;  1X9N A;  5EBD A;  3I55 A;  4J6H A;  3NWS A;  5KEE A;  2K7V A;  3DMU A;  1K3B C;  3T4A C;  4GKK L;  1U4L A;  3I8Z A;  2K01 A;  4KHV A;  5D65 A;  5IP7 G;  2HIV A;  4QQB X;  1X56 A;  3LWE A;  4NW2 A;  4JI4 Q;  4CKB A;  4Y7N B;  2VUM H;  2CQA A;  2RSO A;  2V1C C;  1BBU A;  2F03 A;  2NWG A;  3T16 A;  5KYL A;  4ZK9 B;  3TS0 A;  1SNC A;  1N36 Q;  3J81 E;  4RGN A;  1B4O A;  5IYB G;  4B3R L;  2E2I H;  1I6H H;  5FLM G;  1RCV D;  4PMC A;  1YZ6 A;  3OPO A;  1WCM H;  4KJN A;  1EL0 A;  1K73 C;  2CW0 C;  2ALY B;  4YWL A;  4L5S A;  2GA4 B;  3D4D A;  3EN2 A;  5C4J H;  1F77 A;  4PV1 C;  3KLR A;  2PQA B;  2JA6 H;  5BN5 A;  4OX9 Q;  3RMH A;  4BXX H;  1G29 1;  3ND9 A;  1F2M A;  4ZAI A;  4MNO A;  2ZTD A;  1X32 A;  2HD3 A;  3H0G B;  3K0X A;  1HH2 P;  2N78 A;  1XNQ Q;  3J7A 5;  3HOZ H;  3NSW A;  4A3I G;  3NQI A;  3KUP A;  2UUA L;  1I6V C;  3A55 A; 
#chains in the Genus database with same CATH homology
 2KCM A;  1KQS A;  4OX9 L;  3KF8 B;  2JEA I;  3IRB A;  4JI2 L;  5JJI A;  2UU9 L;  4MZ9 A;  2NN6 G;  2NVT H;  3OTO L;  1WJJ A;  1Q46 A;  1P16 A;  1VS0 A;  1HNZ Q;  2CCZ A;  4BA1 I;  1Q1E A;  1WYD A;  1Q86 C;  2NVX H;  2AKW B;  2CWP A;  2PI2 E;  4DR7 Q;  2B29 A;  1H95 A;  2D0O A;  2OWO A;  1CKN A;  4O0A A;  4HJA A;  2NVY H;  1XMQ Q;  2RF4 A;  3I2Z A;  4GKJ L;  1L2F A;  3E9I A;  1KAW A;  1TWF H;  3NEN A;  4HJ8 A;  3HOW H;  1CKN B;  3PUW A;  2HT1 A;  3JAM c;  4BA2 I;  1KL9 A;  1VQA A;  1QUQ A;  3T1Y Q;  3RZD H;  2ES2 A;  1WFQ A;  4JCV E;  2YU9 H;  1L1O A;  5M5X H;  3K8A A;  4EQ5 A;  4LF7 L;  2LXK A;  4UP7 A;  1EQR A;  4DV1 L;  3HOV H;  3HOX G;  5AJ3 L;  2YYZ A;  1Q1B A;  1Y1V H;  1KXL A;  2DUD A;  5FJ8 H;  4LF6 L;  4GOP B;  2PQA A;  5EAY A;  5C0X G;  4GLV B;  4X66 Q;  3F2B A;  1OXX K;  2VQE L;  4DAY B;  4IFD G;  4A3F H;  4JI7 L;  1E1O A;  2LXJ A;  3HOU H;  3GTJ H;  2AHO B;  3W1G A;  4XTC S;  1QVG A;  4Y7N H;  5M5Y H;  4JI6 L;  1X3G A;  2OQK A;  2IT1 A;  2Z6K A;  4BBR G;  4HID A;  2AMC B;  1PH6 A;  2C35 B;  2Q2H A;  2VQE Q;  4TVA B;  4DR3 L;  2NVQ H;  4YCV A;  4L5R C;  2N3S A;  3M4Q A;  3KDF B;  4YCW A;  1VQJ A;  5GRO A;  5GAG C;  1PH3 A;  4X6A H;  1CUK A;  3B6Y A;  3GTG H;  1FL0 A;  4JI2 Q;  4A3G G;  3S2H H;  3S1N H;  5IWA Q;  1TWA H;  3CC2 A;  3CXC A;  1D8L A;  2NZH A;  2JK8 A;  4DR5 Q;  4DR7 L;  4X62 L;  1M1K C;  3F2D A;  4A3G H;  1PH2 A;  1VQB A;  5IYD H;  2ATW A;  3I7F A;  4UY8 C;  2KHJ A;  1X65 A;  2E5L Q;  1M90 C;  2N49 A;  5JJK A;  5IYC H;  4DV5 Q;  1I94 L;  1FJG Q;  2WB1 G;  3I4N G;  4JI4 L;  1WOC A;  1IBK L;  4QJF A;  1X55 A;  2RHQ B;  4OON A;  2K14 A;  2RCN A;  1QUQ B;  3HOX H;  2D0P A;  4DV4 L;  1Q82 C;  1VQ6 A;  3PO2 H;  3L2P A;  1VQF A;  2OTJ A;  1SRU A;  3CPF A;  2ZJP A;  3GD7 A;  1KIX A;  3ULP A;  2JA5 G;  1UE1 A;  1PFS A;  1PYS B;  1Q12 A;  3J80 c;  3HOW G;  1NBW A;  1JJG A;  1JB7 A;  4BY7 H;  4LF5 L;  4BBR H;  4JI7 Q;  1VQN A;  3PUX A;  1QVC A;  1VQO A;  3J7A 5;  4DR4 L;  1B7Y B;  5M3F G;  2JA9 A;  1B8A A;  2JQO A;  2WB1 E;  3CCR A;  1HNX Q;  2BH8 A;  4YWM A;  4A3C H;  3I56 A;  3HOY H;  5BR8 Q;  1E22 A;  3S14 H;  4JI8 Q;  4GKJ Q;  3U50 C;  1K83 H;  5JEA J;  4HJ5 A;  3UDG A;  4JV5 Q;  2UXB L;  5FJ8 G;  4KHP Q;  1XNR L;  4DR3 Q;  3PUZ A;  1SR3 A;  1I3Q H;  4EX5 A;  3RLN A;  3HFZ B;  4DPG A;  5M3M H;  4B3T L;  3AQQ A;  1UWV A;  2BA1 A;  3DM3 A;  3ULJ A;  2EXD A;  2VL6 A;  3M4O H;  1T9H A;  5BR8 L;  3JC6 6;  4A3E H;  4TQU S;  4DR5 L;  4JV5 L;  1OXT A;  4OWX B;  5LMN W;  1NTG A;  2ZJQ A;  1HJP A;  2PNH A;  3A5Z B;  3M85 A;  1JMC A;  2UXD Q;  4AYB E;  2MQH A;  3CAM A;  1Q81 C;  4LF4 Q;  1XNQ L;  4B3R Q;  4X65 L;  2B63 G;  1A62 A;  4B3M Q;  1I5F A;  1UE7 A;  1QZH A;  1E7Z A;  1VQH A;  3NEL A;  1FJG L;  2YTV A;  5IP7 H;  1Z9F A;  3L7Z C;  4DV5 L;  1I94 Q;  3VDY A;  2UU9 Q;  2FXQ A;  4A4I A;  4JOI A;  2PI2 A;  1V1Q A;  3HKZ E;  3PGZ A;  1V43 A;  3S1R H;  1G51 A;  3UE0 A;  5LMN Q;  2K50 A;  4IOC A;  1YI2 A;  1YHQ A;  1A0I A;  3ER0 A;  2GN5 A;  1SFO H;  4QIW E;  1NMG A;  1YIJ A;  5C0X I;  1HZA A;  3AEV A;  1N33 L;  4YHH L;  4GNX C;  1X6O A;  4YY3 L;  4A3K G;  4C3I H;  3H0G H;  4DV2 L;  3CCQ A;  4POG A;  2Q2U A;  4C3H H;  4DV3 L;  2CQO A;  3KF6 A;  4A3I H;  1EQQ A;  1KD1 C;  2UUB L;  1PV4 A;  3HKS A;  3I4O A;  1FVI A;  1RIP A;  1XTD A;  3S15 H;  1C7Y A;  4KHP L;  5GAE C;  1XMO L;  5JJL A;  3GTO H;  3GO5 A;  4JI8 L;  3J80 i;  3J7Z C;  1Z47 A;  2UUC Q;  1CKO A;  2D62 A;  5HGQ A;  4GOP A;  2Y0S E;  4LUZ A;  4DV4 Q;  2YV5 A;  4R4I A;  4PZ8 A;  3U4Z A;  1HZC A;  2WAQ E;  1PH1 A;  1N36 L;  2JA6 G;  1OXU A;  4GLA C;  4JG2 A;  4A3F G;  1IBM Q;  3HOU G;  4IO9 A;  3GTL H;  4PZ6 A;  2WFW A;  2K52 A;  4JC0 A;  2F4V L;  1IBL L;  3AYH B;  2AWO A;  3CC4 A;  3G71 A;  3I4M H;  2Q2I A;  3KJO A;  2NN6 I;  4A3E G;  1X3E A;  2CWA A;  5C0X J;  3T1H L;  1VQ7 A;  4OWW B;  1HNW Q;  5C44 G;  2MFI A;  2VS1 A;  1BBW A;  5AJ3 Q;  4DR2 L;  3G6E A;  4ALP A;  5FLX c;  2RHS B;  1R9T H;  4DK6 C;  3L0O A;  3RR5 A;  4L5T A;  1EOV A;  3CW2 C;  2E5L L;  1Y1V G;  3U4V A;  3W5O A;  4LF8 L;  2I5M X;  4IOA A;  4HIK A;  3CME A;  2K5H A;  4LW1 A;  1VQM A;  1J5E Q;  2R92 H;  3S1M H;  1L1O C;  4UP9 A;  1JT8 A;  1PYB A;  3M4P A;  3ZJY C;  3KLW A;  3BZC A;  5M3F H;  5LMU L;  1EYG A;  1U0L A;  1GD7 A;  4JI3 Q;  3CMA A;  3UDX A;  4IJL A;  3TQY A;  4XIG S;  4R4C A;  1VQL A;  2WP8 J;  4OXP A;  4DV3 Q;  2UUB Q;  3TS2 A;  2KHI A;  5HY6 A;  1OTC A;  5FLM H;  4HJ9 A;  3PIP A;  3RZO H;  1AE2 A;  3AFQ A;  4LFA Q;  3W1B A;  2E2H H;  3J81 c;  1KC8 C;  1KRS A;  2BH2 A;  2QGQ A;  4OO1 G;  1JE5 A;  4GN3 B;  2I0Q A;  2ZTC A;  2UUA Q;  1FGU A;  1HR0 Q;  3KOJ A;  1C0A A;  4GS3 A;  1PH5 A;  4R4O A;  3S1Q H;  2JA7 H;  5GQO A;  4A3B H;  5IT9 c;  3M3Y H;  1L1O B;  3FKI H;  1VQ5 A;  4IPC A;  4DV0 L;  1Y1W H;  4GN4 B;  3KJP A;  4DV1 Q;  2EIF A;  3ERS X;  4LFA L;  4LFB L;  1N32 Q;  4A3M G;  1HZB A;  4JBK A;  2F4V Q;  4QY7 A;  3TRZ A;  1HZ9 A;  4JI1 L;  1ASZ A;  2JA8 G;  2N8N A;  2YTX A;  3CCE A;  4B3S L;  1EIY B;  1K9M C;  1PH4 A;  1IXR A;  4JI6 Q;  1VQK A;  2HHH Q;  1D7Q A;  5IYB H;  2R92 G;  3PO3 G;  3E0E A;  1VQC A;  4LFB Q;  1N32 L;  3PV0 A;  1PVO A;  1YHB A;  4C3J H;  4LFC Q;  4P74 A;  4DK3 C;  1IYJ B;  4PG3 A;  4DR1 L;  1WI5 A;  1J5E L;  4LUV A;  3UDI A;  2B3G A;  1YJN A;  2IX1 A;  1I50 H;  4L5Q A;  3TRE A;  2VUM G;  2VNU D;  4RG1 A;  1E1T A;  2GVB A;  4X64 Q;  5J3B A;  1S40 A;  1YIT A;  1XJV A;  4A3C G;  2Z0S A;  3RNU A;  1SRO A;  1VQ9 A;  3GTP H;  1X3F A;  4H02 A;  3STB C;  4JI0 L;  1N8R C;  4IFD I;  1P8L A;  1MJE A;  4K0K Q;  4GN5 A;  2KEN A;  2MO0 A;  5IP9 H;  1HR0 W;  2ASB A;  4A3L G;  5K36 G;  4BXX G;  1XNQ Q;  3AFP A;  4R1J A;  1JJC B;  2QEX A;  3TEH B;  2CFM A;  2Q2T A;  1KRT A;  4LF6 Q;  2OTL A;  4HJ7 A;  4A76 A;  2UXD L;  4A3B G;  3A5U A;  2GVA A;  4GOP C;  4A93 H;  3H0G G;  4RMF A;  4DV6 L;  3F8T A;  3A74 A;  2IHF A;  2OQ0 A;  1CKM A;  4NB3 A;  4OWT B;  4DV2 Q;  3KYH C;  4ME3 A;  1N34 L;  4FDB A;  3RN5 A;  2R7Z G;  3CCL A;  4BBS G;  3PIO A;  4DV7 Q;  4POF A;  2IX0 A;  1PH9 A;  2F3I A;  1VCI A;  4LWC A;  5E7N A;  1E24 A;  1S3O A;  1Y14 B;  3CQZ H;  2UUC L;  5IYD G;  4NXM L;  3PUY A;  4JI5 L;  1YBY A;  3J81 i;  4A3J G;  1PH7 A;  5ELO A;  2PMZ E;  1V9P A;  3CD6 A;  3S24 A;  1CSQ A;  1XPO A;  3T1Y L;  4B3S Q;  2AWN A;  5GAD C;  3BJU A;  2OCE A;  4DV7 L;  1W2B A;  3GTQ H;  2HQL A;  2R7F A;  4UPA A;  3DLL A;  2A8V A;  3U58 A;  4DKA C;  2A1A A;  2UXB Q;  2JA8 H;  2XGT A;  3NBH B;  1AH9 A;  2K75 A;  4UP8 A;  1AE3 A;  2WAQ G;  1N9W A;  1UEB A;  2NZO A;  2R7D A;  4YWK A;  3A0J A;  1QZG A;  3JAM i;  3G48 A;  2Y0S G;  4DR2 Q;  3OW2 A;  3T1H Q;  3I4M G;  4BY7 G;  4A3L H;  1GKH A;  1YEZ A;  1SMX A;  1U5K A;  3EIV A;  4NXN Q;  2Z6K C;  1L0W A;  1Q8K A;  2KBN A;  1IL2 A;  1A8V A;  3PO2 G;  2CKZ B;  5C3E G;  4DR6 Q;  2EQS A;  3HOY G;  3RLO A;  4BY1 G;  1C9O A;  3UDF A;  4JI0 Q;  3CCM A;  2QA4 A;  4AYB G;  3S17 H;  1GVP A;  2JE6 I;  4Y52 H;  2I5H A;  5ELN A;  2JJQ A;  4B3M L;  3H3V H;  2F52 A;  4J15 A;  1YVC A;  3HKZ G;  1OXS C;  3KF6 B;  4X65 Q;  3E9H A;  4A3D H;  4KHZ A;  4X62 Q;  1J6Q A;  1EIF A;  1MJC A;  2K4K A;  2KCT A;  4P73 A;  2MNA A;  4JI3 L;  1YHA A;  4LUO A;  4LF9 Q;  4DR1 Q;  1YJ9 A;  4DUY Q;  2UXC L;  2YTY A;  4HIO A;  2IHE A;  4JBJ A;  1OXV A;  1O7I A;  3K80 C;  1HNW L;  1G6P A;  3STB D;  1YJW A;  4IFD J;  4WJ3 M;  1UE5 A;  4NPS A;  4C2M H;  1K8G A;  1HNZ L;  4MTN A;  1N34 Q;  1QVF A;  3UE1 A;  3GTM H;  4P72 A;  4YY3 Q;  4P71 A;  1N33 Q;  1XNR Q;  3OTO Q;  3G4S A;  3M7N A;  4GKK Q;  5IYC G;  4YCU A;  2B63 H;  5JEA G;  3CP0 A;  1TWH H;  4DNI A;  2XTI A;  4HIM A;  1VQ4 A;  4DUY L;  1UE6 A;  1CSP A;  1NJI C;  1JJ2 A;  4JI5 Q;  1NE3 A;  1VQD A;  1XMQ L;  2ZJR A;  4NXM Q;  3FHW A;  1PHJ A;  1SN8 A;  4A75 A;  2R93 G;  4OO1 I;  1DGS A;  1B70 B;  5M5W H;  1TWC H;  4DR4 Q;  4DUZ L;  2ZM6 L;  2LSS A;  3D31 A;  1HNX L;  1Y1W G;  4WJ4 A;  2MO1 A;  3PF5 A;  1VQG A;  3K7A H;  1XPR A;  1GM5 A;  4AH6 A;  4LF7 Q;  1NMF A;  3WWV A;  4A3J H;  4IPH A;  1TXY A;  1W3S A;  1K0R A;  3K7U C;  1SE8 A;  3LGJ A;  1S72 A;  4DR6 L;  2JA5 H;  3GTK H;  1IBM L;  3PO3 H;  3OYY A;  4APV A;  3F2C A;  1VQ8 A;  1K8A C;  4X66 L;  5IY0 A;  3D0F A;  3MEF A;  5LMU Q;  4PMW A;  4LFC L;  4IJH A;  4GLX A;  1HR0 L;  2HIX A;  4KI0 A;  2K5N A;  1YNX A;  4JBM A;  2R6G A;  4R4Q A;  2VZA A;  4AIM A;  4QL5 A;  4DAM A;  2VQF L;  3S16 H;  4GNX B;  1VQP A;  1ASY A;  1TWG H;  4X64 L;  1E3P A;  1BVS A;  3FKI G;  3PSI A;  4IPG A;  4YHH Q;  3H15 A;  3HOV G;  4QGU A;  2BA0 A;  4LF8 Q;  4JYA L;  2JA7 G;  3KDF A;  4JI1 Q;  5IP9 G;  3HOZ G;  4A3K H;  2R7Z H;  4BBS H;  1VQI A;  4KLK A;  5IWA L;  3FP9 A;  4R4T A;  4DV0 Q;  1X54 A;  2JEB I;  4NXN L;  4PZ7 A;  3K81 C;  3ULL A;  1LUZ A;  4JYA Q;  4A93 G;  3CCS A;  3I55 A;  5LMN L;  1X9N A;  4LF5 Q;  2E8G A;  3PUV A;  4DV6 Q;  4O2D A;  1NY4 A;  4GKK L;  3BZK A;  4AQY Q;  1MKH A;  1SLJ A;  3F1Z A;  5IP7 G;  3CC7 A;  4DUZ Q;  1LTL A;  2HIV A;  1MIU A;  5GAH C;  1PA6 A;  4A3M H;  1GO3 E;  4P75 A;  2ZM6 Q;  1X56 A;  1IBK Q;  4QQB X;  4JI4 Q;  2UXC Q;  1XPU A;  4LF9 L;  3J81 j;  2ID0 A;  2VUM H;  3KFU A;  3M9B A;  2V1C C;  4AQY L;  1BBU A;  3Q8D A;  3RLF A;  1EUJ A;  3CPW A;  1XMO Q;  2L15 A;  2R93 H;  2VY3 A;  3PF4 A;  1RL2 A;  3TS0 A;  3CCV A;  5C44 H;  1N36 Q;  3I4N H;  2H5X A;  5IYB G;  4LNQ A;  1K3R A;  2E2I H;  4B3R L;  1I6H H;  5FLM G;  1LYL A;  1VQE A;  1YZ6 A;  2VQF Q;  4GNX A;  1WCM H;  5C4X G;  2HHH L;  5H1S E;  1K73 C;  2ALY B;  5IE8 A;  4YWL A;  1PH8 A;  4L5S A;  3EN2 A;  5C4J H;  3NEM A;  3BU2 A;  4IPD A;  1EFW A;  4B3T Q;  4BY1 H;  2PQA B;  1WCM G;  5C4X H;  3GDE A;  2A19 A;  5C3E H;  2K5V A;  1IBL Q;  2JA6 H;  3CCU A;  1KHI A;  1BKB A;  1A63 A;  5DLQ E;  4OX9 Q;  1IZ6 A;  5M3M G;  4BXX H;  4A3D G;  3PCO B;  2IY5 B;  1G29 1;  3RN2 A;  2I5L X;  4MNO A;  3CF5 A;  1LM0 A;  4JOI C;  3ICE A;  3S2D H;  2ZTD A;  3CCJ A;  3K0X A;  3HOZ H;  1EWI A;  1HH2 P;  2N78 A;  3EBE A;  1Q7Y C;  3MXN B;  3SGI A;  4A3I G;  2VW9 A;  4LF4 L;  2E2J H;  2UUA L;  4K0K L;  3H3V I;  2ZTE A;  2DGY A;  4JBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...