1G6PA

Solution nmr structure of the cold shock protein from the hyperthermophilic bacterium thermotoga maritima
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
66
structure length
66
Chain Sequence
b'MRGKVKWFDSKKGYGFITKDEGGDVFVHWSAIEMEGFKTLKEGQVVEFEIQEGKKGPQAAHVKVVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN TMCSP
publication title Solution NMR structure of the cold-shock protein from the hyperthermophilic bacterium Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics
total genus 6
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2000-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1g6pA00
3I55A 4GOPB 2KHJA 3RZDH 1Q12A 3J81c 5DLQE 3H3VI 4GKJL 1E1TA 2UXBQ 1VQNA 1I94Q 2A8VA 2ZTDA 2Y0SG 2BH2A 2UXDQ 2KBNA 2WB1E 1Q81C 1G291 4DV7L 1TWCH 1PFSA 1Z9FA 3FP9A 4HIDA 4DR1L 4A3CH 1EWIA 1FVIA 4PZ8A 4XIGS 3HOZG 1T9HA 1L1OA 4A3GH 3HKSA 3M4PA 4JI4L 3PO3H 1IBLQ 3Q8DA 2Z6KC 4HJAA 1CUKA 2NN6I 1X55A 4DR4L 3RN2A 1A63A 3U50C 2QGQA 4BBSH 1P16A 4DR2Q 5IT9c 1IZ6A 4QIWE 4OWWB 1VS0A 3I4NG 1VQJA 4C2MH 4JI3L 1C0AA 1G51A 5FLXc 1PH6A 3CW2C 1VQFA 1VQKA 5C4XG 1X6OA 5LMUL 1VQAA 3D0FA 3H0GG 3T1HL 1X3GA 4PZ7A 4UP8A 4XTCS 1CKNA 3T1YL 1S72A 1AE2A 1SROA 1Q1BA 1OXSC 3GTQH 1TWHH 4JI7Q 1Q8KA 2Q2IA 4DV3Q 2CQOA 4FDBA 2HHHL 1XNRL 3RLOA 3W1GA 3G48A 2AHOB 4DUZL 1NE3A 4GKKQ 1CSPA 2I5LX 3PUYA 1IBKL 2VL6A 1LM0A 1YIJA 1TWFH 1JMCA 5C44H 1X9NA 4L5TA 4DV1L 1KXLA 3J81i 1UE1A 1PH9A 3I4NH 2K75A 5IP7G 3CCRA 3L2PA 1X54A 5IWAL 5C4XH 1TXYA 3KF8B 1EQRA 2BA0A 4JBMA 4X62L 3GTPH 2EQSA 3CXCA 4LFCL 1E3PA 5HGQA 2JK8A 2IHFA 3KOJA 4QGUA 4GLXA 1YZ6A 2UUCL 5H1SE 4BXXH 4LUOA 1VQBA 1YJNA 2AWOA 2Q2TA 2JA6H 3TRZA 4DAMA 3CD6A 1YHBA 3GTOH 4IPGA 2B29A 3KLWA 4POFA 4BY1G 4GKJQ 4ALPA 1RIPA 3ULPA 2A19A 1BBWA 2AWNA 2ZM6L 1C9OA 4YWMA 3CCJA 2VQEL 2CKZB 2BH8A 5C4JH 4DV7Q 1K0RA 4DR1Q 2VUMH 3S2HH 4DK3C 2JA7H 3NEMA 5IP7H 1YNXA 1VQDA 4QL5A 1YEZA 4JI4Q 3I7FA 4HJ8A 3OYYA 3ULLA 3K0XA 1HNWL 3E9IA 1L1OB 5C3EG 4DV0L 1RL2A 3I56A 4OX9L 4QQBX 4DR4Q 1PVOA 3NENA 4L5SA 2PMZE 3CAMA 3TS0A 1N33L 4A3JG 2UXCL 3GTLH 4JYAL 5GAEC 4JI8L 1EUJA 2YYZA 4JI3Q 4H02A 4P72A 3WWVA 1VCIA 3DM3A 4TQUS 5LMUQ 2PNHA 3BZCA 4LW1A 5IY0A 2NZOA 3T1HQ 1PHJA 1VQ8A 3T1YQ 2UU9L 4A3MG 1XPOA 2NVXH 5JJKA 1OXVA 3GDEA 4UY8C 4JI0L 2HHHQ 2C35B 3A5ZB 2NN6G 4L5QA 3F2CA 4R1JA 4A4IA 4DUZQ 4C3IH 1EFWA 4ME3A 2E5LL 1IBKQ 4RG1A 1NTGA 4LF5L 5C3EH 3W5OA 3RLNA 5GAGC 3CCQA 1PA6A 4AYBE 2OQ0A 3ER0A 4EX5A 1IXRA 3GTMH 4YY3L 3PO2H 4A3JH 3TS2A 4DV1Q 4HIMA 1AH9A 1LTLA 5EAYA 3LGJA 1EQQA 5IYBG 5J3BA 1XPRA 2HQLA 1U5KA 3A5UA 4DPGA 4IO9A 3CP0A 1VQ7A 5IWAQ 4A3CG 3K8AA 3W1BA 4X62Q 1KIXA 4LFCQ 4GOPC 4A3GG 1VQCA 2K5NA 4A3MH 4EQ5A 1M1KC 3PO3G 1KC8C 1QVGA 4JOIC 2UUCQ 4KHPL 1HZ9A 2ALYB 3UDIA 2R93H 2WB1G 2KCMA 4DV4Q 4UPAA 1VQ5A 1LUZA 4A76A 1GD7A 4DR6L 3S1RH 2ZJRA 1X3EA 4P71A 2ID0A 1VQHA 1HR0L 4LFBL 5HY6A 1I6HH 1ASYA 3G4SA 2ZM6Q 1KL9A 2HIXA 2VQEQ 2WP8J 4LF9L 4BY7G 2KCTA 2R7FA 2FXQA 3L0OA 2B63G 1N36L 1N32L 5IYBH 2VNUD 3KYHC 3OTOL 5E7NA 2NVYH 3U4ZA 4NXML 3PSIA 4BBRG 4LUZA 1NY4A 1PH8A 2KENA 2VZAA 3AEVA 1HNWQ 4DV0Q 1KD1C 3JAMc 2ZTEA 4OX9Q 2IX0A 1KRSA 2Z0SA 1N33Q 2UXCQ 1W2BA 1GM5A 4R4QA 4JYAQ 4JI8Q 3G6EA 3HOXG 4A3LG 1NJIC 5C44G 4B3RL 1QVCA 1M90C 1SRUA 1KHIA 5AJ3L 1N9WA 2UU9Q 3F2BA 1GO3E 4X6AH 4DNIA 4Y52H 3HKZE 4BY7H 1OXTA 1V9PA 2XGTA 4LUVA 1Y1WG 1HNXL 4JI0Q 2B63H 3CPFA 3S24A 2R92H 3CCMA 4R4TA 4JCVE 4BBRH 4IPHA 3J7ZC 1D7QA 5M3MG 2E5LQ 4BXXG 4LF5Q 1XPUA 1CSQA 2GVBA 3K80C 4MNOA 3KJOA 2JA6G 3HOWG 4R4OA 1IL2A 3K7UC 2F4VL 1L2FA 1UE6A 4YY3Q 4DR3L 4KLKA 3L7ZC 2Y0SE 4A3KG 1Q82C 1OTCA 3GTGH 3HOXH 4A3LH 1PH2A 2XTIA 1JJ2A 1UE5A 3RN5A 1XTDA 5M3FG 4IPDA 1Z47A 2OQKA 2GVAA 4IJLA 4KHZA 2JA7G 2VUMG 1U0LA 3S2DH 2OTJA 2F3IA 1OXUA 3ULJA 3PCOB 4YCUA 4O2DA 1HZBA 3KF6A 1Y1WH 1EYGA 4KHPQ 1CKOA 2N8NA 1MIUA 5IP9H 2VQFL 4JBKA 3TQYA 1VQ4A 3JAMi 3EBEA 1VQLA 2IT1A 2WFWA 5M3MH 1K8AC 3CC2A 2K5VA 1I3QH 4A3IG 4A3BH 4DR6Q 4DV4L 4LFBQ 1SN8A 1HR0Q 2R7ZH 4MZ9A 3MXNB 3HOWH 3RNUA 2RF4A 1VQGA 3KJPA 3CCSA 4A3EH 1AE3A 2IX1A 4LF9Q 2JA5H 1IYJB 1L1OC 4A3KH 3ICEA 2YTYA 1N36Q 1GVPA 1N32Q 4BBSG 3CCUA 1XJVA 2R7DA 3OTOQ 4DR7L 3A74A 1B70B 2VY3A 4X64L 4NXMQ 4DV6L 5M3FH 4OWXB 4LF4L 2ASBA 3S15H 1HZAA 3PF4A 4NXNL 5BR8L 4GN3B 3RLFA 2Q2UA 1YHAA 2PI2E 4J15A 1N34L 1HR0W 2LXKA 3K81C 1XMOL 2B3GA 3I4OA 1PH5A 3CMEA 1K8GA 4LFAL 4TVAB 4B3RQ 2MFIA 1XMQL 3PO2G 2Q2HA 3J80i 4A3IH 2JEBI 2NZHA 5AJ3Q 5IYCG 2LSSA 4PMWA 3NBHB 3STBD 3E9HA 1E24A 3KDFA 3S17H 1D8LA 1BVSA 1HNXQ 4AYBG 4WJ3M 3PUWA 5GROA 4L5RC 4YCVA 2E8GA 2JA9A 2YTVA 1YI2A 1EIYB 5M5WH 2KHIA 4RMFA 1KRTA 2OTLA 1A8VA 1JJGA 2R93G 1NMGA 3FHWA 3JC66 1SLJA 3M9BA 5JEAJ 2QA4A 3CQZH 2UUAL 4K0KL 4GN4B 3GTJH 1BBUA 5JEAG 2F4VQ 3F1ZA 2H5XA 2R6GA 4DR3Q 1P8LA 4AQYL 1K73C 2UUBL 1GKHA 2WAQE 4LF6L 3J7A5 3AFPA 2QEXA 4LF8L 2MNAA 4DUYL 2A1AA 3E0EA 1K9MC 3HOYG 3CC4A 4IFDI 4C3HH 3UE0A 5IYCH 1QUQB 2AKWB 4OXPA 4AH6A 2Z6KA 1VQMA 5JJLA 2YV5A 5GAHC 2I5MX 2VS1A 4GS3A 4APVA 4A3DH 2VQFQ 1JB7A 1B8AA 2JEAI 3PIOA 1SR3A 2HT1A 3KF6B 5GADC 1HH2P 1WFQA 1Y1VH 1CKMA 4DAYB 2EIFA 2JA8G 3M3YH 5M5XH 4DR5L 2JE6I 3A0JA 3TREA 2CWAA 3J81j 4DR7Q 4DV5L 2GN5A 4P74A 3I4MG 4X64Q 2K14A 5FJ8H 3CCVA 4DV6Q 1KAWA 2YU9H 4LF4Q 4LF7L 1XNQL 2R92G 3HOYH 3S14H 3PUVA 4NXNQ 1X65A 4YWLA 5BR8Q 4JI2L 2ZJQA 4GNXB 1DGSA 3IRBA 1X56A 4IOCA 1N34Q 3F2DA 4X65L 4DKAC 1XMOQ 1BKBA 3S1NH 4IOAA 1NMFA 2D0PA 3ERSX 4LFAQ 3UDFA 4OO1G 1XMQQ 2RHQB 3BU2A 1TWAH 1V43A 4JI5L 2K4KA 2JA8H 4X66L 1H95A 2JQOA 2MQHA 3BJUA 4P73A 1E22A 3K7AH 4MTNA 4Y7NH 2ZJPA 2E2JH 1FJGL 1SE8A 2CFMA 3NELA 3KDFB 3S1QH 3FKIH 1S3OA 1Q7YC 3I4MH 3M4OH 3GO5A 5IP9G 4WJ4A 4NPSA 3U58A 1C7YA 2UUAQ 4K0KQ 1J6QA 1Q86C 4IPCA 3UE1A 3ZJYC 1YVCA 4A3BG 1W3SA 5JJIA 3CPWA 1HNZL 3VDYA 4AQYQ 2UUBQ 2R7ZG 3HOUH 1N8RC 3MEFA 4LF6Q 4A3EG 3J80c 1UWVA 1YHQA 2JA5G 4KI0A 4DUYQ 4LF8Q 3KFUA 2MO0A 1QUQA 1IBML 1FGUA 3GTKH 4JBWA 1VQ9A 1PYSB 1VQPA 1TWGH 4YHHL 5LMNL 2K50A 1K3RA 4JV5L 1YJ9A 2NVTH 1WCMG 3GD7A 1HZCA 1MJEA 1SFOH 4YCWA 2CWPA 1SMXA 4B3TL 4YWKA 4JG2A 1E7ZA 3CF5A 1A0IA 2I5HA 1QZGA 2CCZA 3S1MH 3HOZH 1LYLA 4IFDJ 1WYDA 1K83H 1I50H 1JE5A 4DR5Q 4UP9A 2LXJA 4IFDG 3SGIA 4HJ5A 3CC7A 3UDGA 2ES2A 4B3SL 4JI1L 4DV5Q 1WI5A 2OWOA 4OO1I 4OONA 4UP7A 2I0QA 1EIFA 4LF7Q 1XNQQ 4R4CA 4BA2I 3PV0A 2N49A 4IJHA 1J5EL 3HOVG 4GLVB 4JI2Q 4DV2L 4P75A 1KQSA 4GNXA 3M4QA 2PQAA 3H0GH 1WCMH 3EN2A 4X65Q 1MJCA 4A93G 1YBYA 4A75A 3BZKA 1VQOA 1YITA 3PUXA 1R9TH 4JI6L 3M7NA 2HIVA 4JI5Q 3CCEA 2RCNA 4GN5A 3PUZA 4X66Q 4HIOA 1E1OA 1S40A 1PV4A 2ZTCA 3U4VA 5FLMG 4GOPA 4B3ML 1PH1A 1FJGQ 1Q46A 4JOIA 1PH7A 2EXDA 1FL0A 5C0XJ 1V1QA 4HJ7A 2VW9A 2WAQG 4A3DG 5C0XG 2V1CC 1PH4A 4DK6C 2UXBL 3EIVA 2AMCB 5IYDG 1I94L 3HOVH 5K36G 1JJCB 3B6YA 2UXDL 4PG3A 3TEHB 1Y1VG 4GLAC 1HNZQ 4A93H 3OW2A 3G71A 1I5FA 4A3FG 2E2HH 1Q1EA 1UE7A 1IBLL 2DGYA 4HJ9A 1QVFA 3D31A 3DLLA 1IBMQ 3F8TA 1EOVA 5M5YH 2D0OA 5FJ8G 5FLMH 2D62A 2OCEA 2MO1A 4YHHQ 5LMNQ 4OWTB 4JV5Q 2DUDA 4BY1H 3CCLA 4DR2L 1ASZA 1Y14B 4POGA 1L0WA 3PIPA 2NVQH 3CMAA 4O0AA 3PF5A 2JJQA 4NB3A 5IYDH 4JC0A 4B3TQ 1CKNB 1XNRQ 5IE8A 4LWCA 5ELOA 1PH3A 2L15A 1QZHA 4LNQA 1WJJA 2ATWA 1G6PA 5GQOA 4JI7L 2IY5B 4DV3L 4PZ6A 3AYHB 2F52A 4GNXC 1VQIA 4JI1Q 1B7YB 4B3SQ 3H15A 4C3JH 5LMNW 3AQQA 4A3FH 4GKKL 2YTXA 1NBWA 3H3VH 1OXXK 1J5EQ 1PYBA 3PGZA 2PI2A 2K5HA 3FKIG 4DV2Q 3S16H 1O7IA 3HFZB 3I2ZA 2K52A 4BA1I 1YJWA 2E2IH 4AIMA 1X3FA 1VQ6A 1UEBA 1HJPA 3UDXA 1VQEA 2PQAB 1A62A 5C0XI 4JI6Q 1JT8A 3RR5A 1MKHA 4R4IA 3HKZG 4QY7A 3AFQA 1WOCA 4QJFA 3HOUG 3STBC 2N78A 4HIKA 3RZOH 2BA1A 2N3SA 2IHEA 4B3MQ 2RHSB 5ELNA 3M85A 4JBJA
chains in the Genus database with same CATH superfamily
1BCPB 3L9AX 5KGUA 2KHJA 2CW0C 3RZDH 1EIHA 1I94Q 3H91A 2BH2A 2UXDQ 2WB1E 2CQAA 3NE5B 4I7AA 3NQTA 1EWIA 3HOZG 2SEBD 1L1OA 4JI4L 1I4QA 3QO2A 1NNXA 1ZXTA 3LWEA 1F2ZA 1A6XA 1X55A 1RDPD 3QB3A 1D5XC 1F2MA 4U68A 1P16A 2O5JC 1VQJA 1GHKA 1X3PA 3AB9A 5C4XG 1VQAA 3T1HL 4PZ7A 1B9MA 1CKNA 1AE2A 1SROA 2L9HA 2NB0A 1J9OA 1STNA 4CDEC 2K05A 1XNRL 2K7VA 2CH4W 3W1GA 3G48A 1LTGD 2EDGA 5A2QE 1S5FD 4P2CB 5M9OA 4QF4A 1IBKL 2FJ2A 1YIJA 1V1PB 1X9NA 3GTOB 1ESFA 4DV1L 1KXLA 1YNJC 2K75A 2PCFB 2F0PA 1L0XB 1X54A 5BN5A 3OIPA 2HUGA 1PMRA 4UDUC 3HP3A 5H1SE 4BXXH 1PFNA 1VQBA 1JOKA 2AWOA 2PW7A 3GTOH 4POFA 2ENBA 5KNCA 1RIPA 4R8NA 3CCJA 3ND9A 2CKZB 4DK3C 2JA7H 4G4KA 2WINB 3NSWA 1VQDA 5IP7H 4QL5A 1YEZA 4JI4Q 2FFKB 5F2DA 3K0XA 4QMGA 2JYOA 3BZDB 2B2WC 3I73A 1HNWL 5EKLA 1NUCA 5C3EG 1RL2A 4C3JG 2ZXPA 1BF4A 3NENA 2PMZE 3EJIA 4KHVA 1B3AA 1IW7C 1PHJA 2PNHA 3T1HQ 5IY0A 2NZOA 2MUYA 4UY8C 2C35B 1HUNA 2NN6G 4A3MB 1PLFA 1QG7A 4XQQA 3J7YW 2E5LL 1IBKQ 4RG1A 4LF5L 2TMPA 3RLNA 3OWEB 5EBCA 2OQ0A 3D8GA 4EX5A 1IXRA 4DV1Q 1JCKB 1EOTA 1AH9A 3LGJA 5LL6X 1XPRA 1U5KA 3ZYYX 4DPGA 1AP0A 3TSSA 3K8AA 3SEBA 3WDNA 4GOPC 2K5NA 4A3MH 1M1KC 5DNFA 2EY2A 4JOIC 2PZWA 4L6TB 2C5CA 1VQ5A 1BOSA 3PO3B 4DR6L 4NW2A 1LTAD 2ID0A 2WB1B 4LFBL 1D6EC 1EEID 2KCTA 4CDCC 5DAUA 1N36L 3KYHC 3X3MA 3HEJA 4HMIA 1WVLA 1NY4A 1PH8A 1LTSD 4BY7B 4ZUJA 1HNWQ 2B63B 3MVVA 1FGBD 4BBRB 3R8BA 4J1MA 3G6EA 3HOXG 1NJIC 5C44G 2WKCA 1QVCA 2SNMA 3K6OA 2CHBD 2RDHA 4FXKC 4ZKCB 1TWFB 5ISRA 3GTGB 3HKZE 4BY7H 1OXTA 1Y1WG 4LUVA 2B63H 2R92H 3SXHA 4R4TA 3NHHA 2KHSA 4JCVE 5KRUA 4BBRH 4IPHA 3J7ZC 1D7QA 1TIID 2E5LQ 2B2TC 4LF5Q 1EYAA 4MNOA 1EWCA 1E2VA 4FVMA 4ODGA 4FF1A 4R4OA 3K7UC 2NWGA 4KLKA 3TBIB 4A3KG 3GTGH 4A3LH 1D1KA 4RWSC 1ENAA 5M3FG 1Z47A 3I70A 4KHZA 3S2DH 1XYIA 2OXPA 5DM63 3PCOB 4DA2A 1TS2A 1KDBA 1CKOA 5IP9H 2VQFL 4DAYA 2HDMA 1VQLA 4DR6Q 3BVGA 4CJ2C 4DF7A 4DV4L 4LFBQ 2D9UA 2E74C 2XWBB 1GHJA 2RF4A 3RNUA 1ZYRC 2K33A 2IX1A 1E2WA 1IYJB 2YTYA 1N36Q 3I72A 4JPBW 5IGFA 3SVMA 2VY3A 2ASBA 4OWXB 4F87A 1ICWA 2EY6A 4NXNL 2PMZB 3GV3A 5C5MA 3RLFA 5L37A 3VR4A 5IIFA 5EQ0A 1QB5D 1EY9A 3CQZB 3E3XA 4C3IB 3GTJB 2Q2HA 2F4IA 5DEHA 3V96A 2NZHA 4IFDH 5IYCG 4C56C 3KDFA 2F0OA 4ZCKA 1D8LA 3PIP3 4AYBG 4WJ3M 3GP7A 3NTHA 2E8GA 2V4DA 1EIYB 2CW0D 4HSPA 5ELCA 3JC66 1SLJA 4K0KL 3CQZH 2QILA 3GTJH 5JEAG 2R6GA 2R93B 1P8LA 2EPBA 3P1HA 1GKHA 2WAQE 3SR1A 3BDCA 4LF6L 1R4QB 5FLXE 1X3QA 4X3TA 4HAEA 3TZUA 4LF8L 2MNAA 4IUPA 3CRLC 1PRTD 3FRPB 2AKWB 1I6HB 4KV6A 4OXPA 2F0JA 2Z1CA 2I5MX 2VQFQ 4QUCA 3KF6B 2CH4A 1HH2P 1WFQA 3R93A 3I4LA 1CKMA 4S3SA 2EIFA 5IGEA 2JA8G 5FO8B 1LT5D 5KEEA 2JE6I 1EY6A 2AQ3B 2CWAA 4EQOA 4DV5L 2GN5A 3I4MG 2YU9H 1XNQL 5EGTA 1Q90A 2X6GA 4DU9A 4NXNQ 2JSOA 3S1QB 4IOCA 3OPOA 3F2UA 3C46A 2EYHA 1CHQD 4IOAA 1YNJD 1G8ZD 1SNPA 1HPCA 2RHQB 4RAUC 1V43A 2K4KA 2JQOA 2MQHA 1LT3D 2AUJD 3OSOA 1Z6HA 3SE0A 2MGSA 5ELBA 3S1QH 1TKWB 2M2LA 2E75C 2Q8TA 5KIXA 3P7JA 1C7YA 4K0KQ 4A3BG 1HNZL 2R7ZG 5C5LA 4LF6Q 4A3EG 1YHQA 1K83B 4KI0A 4F8MA 3M4YA 4LF8Q 3KFUA 1I3QB 1IBML 1FGUA 1FNUA 2O5IC 3GTKH 2EJGC 3QJYA 2JA5B 5LMNL 2NTSA 5C4HA 1DOMA 3ITPA 1IW7D 1HZCA 4ULLA 4V0BA 2PQEA 1MJEA 1K28A 4QUFA 3VYSA 5KNDA 4KK7A 1WYDA 1K83H 4CBVA 1PZKD 4UP9A 2LXJA 4DV5Q 4UP7A 2K03A 1XNQQ 4BA2I 4R4CA 2DNCA 2AQ2B 1HA5A 2F0QA 3M4QA 2A74C 2G5DA 3H0GH 1MJCA 4A93G 3HS0C 1STGA 3PUXA 3EQLC 1WTVA 3M7NA 2BE5D 1HTLD 2PYKA 1E1OA 4HIOA 2B39A 4GOPA 4B3ML 4G7OC 3SK8A 4C3HG 3QG1A 5EKIA 3V05A 5I2YA 4JOIA 2EXDA 1FL0A 4HJ7A 2VW9A 5C0XG 2UXBL 1RTOA 3JAME 4RGMA 2A6EC 1JJCB 3D4DA 2B2VC 2WAQB 1Y1VG 4GLAC 1HNZQ 1IYVA 1SYDA 5TSSA 5BN4A 1A3TA 2E2HH 4X3SA 1IBLL 5C3WA 4HJ9A 1QVFA 3D31A 3DLLA 1IBMQ 1RKNA 5M5YH 1LABA 5FJ8G 4A3FB 3NBIA 2K01A 5LMNQ 4HCEA 1PTOC 3CCLA 3OOCA 1L0WA 3PIPA 3PF5A 2FMMA 2JJQA 3TP7A 4JC0A 2E2IB 1CKNB 2LKVA 5IE8A 4G7ZC 1EYCA 1QCBD 4LNQA 1WJJA 1T5EA 4OELB 3CU7A 1VQIA 4KKTA 1B7YB 1U4RA 2OEOA 4A3FH 2QEJC 1TWAB 2EXZA 1A15A 3NTKA 3FKIG 2B2TA 1II3A 3HFZB 3K7AB 3I2ZA 2EOTA 1Q8IA 4BA1I 1YJWA 2DNEA 3A7AB 3KF8A 2E2IH 4AIMA 5EPKA 1UEBA 3BDLA 1CZGA 4K2KA 4OL7A 4CJ0B 4QJFA 3MWYW 3HOUG 4A3GB 2BA1A 4XT3B 4B3MQ 3M85A 3VR3A 2IW3A 2O2LD 3NWSA 5DLQE 3H3VI 1E1TA 2UXBQ 1C4QA 2ZTDA 4XYOA 2KCNA 2Y0SG 1B50A 4JVZA 1PYWD 1G291 2Z4IA 3FP9A 1KAAA 4DNTB 4DAPA 1T9HA 4A3GH 1HFNA 3HKSA 3M4PA 3I91A 4B9XA 3GTQB 2FHTA 1IBLQ 2Z6KC 2F0UA 5EPLA 2NN6I 2L4NA 2QGQA 4JI3L 1G51A 5FLXc 2NYZD 1VQFA 1VQKA 1K8MA 1X6OA 1B2TA 1WD1A 1X3GA 4F7XA 3I4NB 1Q1BA 3GTQH 1TWHH 2K6AA 3FDTA 2Q2IA 4FDBA 5FKAC 3OIQA 2AHOB 3K5MA 1CSPA 3PUYA 1LM0A 3CHBD 3H09A 4XDXA 1JB3A 3NQIA 4YIJA 3J81i 3I4NH 5JJZA 5IP7G 2PZUA 1CFMA 2Q8RE 3R3OA 2EQSA 4LFCL 2VUMB 5HGQA 2IHFA 3KOJA 1NAPA 4PMBA 5E3FA 2EYFA 4I65A 2JA6H 3S9WA 3D4RA 1QNUA 4ALPA 2A19A 4UHVA 2VQEL 2BH8A 4NMZA 2HCCA 1K0RA 4BY1B 2VUMH 1E0BA 4HJ8A 3ULLA 3I56A 4OX9L 4QQBX 4EGVA 2K5QA 4M8AA 1PVOA 2B8FA 2UXCL 2RCFA 5GAEC 4JI8L 4JI3Q 3PO2B 1A2UA 3DM1A 3CD6A 1CM9A 3W2DA 2UU9L 1EZ8A 2NUCA 1GUWA 4A3MG 1SMYD 1OXVA 1UUPA 4JI0L 2NZ1D 1U9RA 1D2BA 3EFXD 4A4IA 1XTCD 1KNAA 1QILA 3W5OA 5GAGC 5K5PA 1PA6A 3PO2H 1SJHD 4YY3L 3TS2A 2F0SA 3TP5A 3S1RB 3DXJC 4ZRZA 4HIMA 1J8IA 1EQQA 4KMUC 5J3BA 4IO9A 4A3CG 3JAML 1BCPC 4LFCQ 2IPKD 3PO3G 2ICEC 3HGBA 2WB1G 1LV9A 4UPAA 1LUZA 3MXNA 1LACA 3S1RH 2ZJRA 4P71A 3MFYA 1E2ZA 1VQHA 1ASYA 3G4SA 3U9OA 2VXWA 2VQEQ 2F0EA 4BY7G 3AMUA 2R7FA 2B63G 1N32L 5IYBH 2A73B 4NXML 3PSIA 4BBRG 4LUZA 2HCIA 2VZAA 5EPJA 1SAPA 4G7HC 3JAMc 2ZTEA 4OX9Q 4N8X1 2UXCQ 2M9VA 4JI8Q 4A3LG 1FYCA 5CV7A 1A3VA 1F2LA 3NP8A 1M90C 2SDFA 2UU9Q 4X6AH 3N52A 2XVSA 4JI0Q 1V9PA 2XGTA 1HNXL 3CCMA 1C8CA 1CQFA 5C3XA 1XPUA 5KNBA 3K80C 3GV6A 1H9MA 2RVLA 2A6ED 2F4VL 4YY3Q 5M3MB 4DR3L 1OTCA 2B2VA 2A68C 1V1OA 1PH2A 5ELFA 3HOWB 1JJ2A 3FVQA 4IPDA 1B44D 1PZJD 1PRTB 1MSGA 1OXUA 3TZDA 4YCUA 4O2DA 3Q24A 1HZBA 4GZYC 1MIUA 4JBKA 2JA7B 3TMEA 1F2YA 5E4WC 2B2YC 2EJMA 3MFGA 3EBEA 2WFWA 2PZTA 5M3MH 3CC2A 1BR9A 2F0GA 4KJNA 4KKSA 3HOWH 1I4HA 2KEDA 3DWPA 5CV8A 3CCSA 1AE3A 2LS01 2Z8LA 1O80A 4C1NI 4KD3A 1N32Q 3MA2B 4DR7L 2R7DA 3FMCA 4NXMQ 4X64L 4OIKA 3S17B 3Q23A 1HZAA 2B2UC 1JQYD 3PF4A 5BR8L 1GJXA 4C3IG 2Q2UA 1YHAA 2OT2A 1N34L 1TY0A 1XMOL 2B3GA 3I4OA 1PH5A 3C3LA 3CMEA 1SJED 4LK1C 1G2SA 1SYGA 4PMWA 3NBHB 4RHSA 4KN4C 3S17H 1BVSA 1HNXQ 4FYDA 3VR6A 1BBXC 4HCSA 1SYFA 4YCVA 2YTVA 2F03A 2R93G 5D14A 5JEAJ 2QA4A 1NR2A 4GN4B 3GQBA 5CV9A 3URYA 2F4VQ 3M7GA 4IUNA 1KDCA 4DR3Q 5IT9E 3J7A5 3MXUA 5M5XB 2A1AA 2SNSA 2Z9HA 3CC4A 1CHPD 3UE0A 5I6YA 1XXGA 1PTOF 4TKOB 2Z6KA 3K59A 4A3DH 4FNFA 3HOYB 3QR8A 3T56B 1B8AA 3S14B 5K36H 3PIOA 3DMUA 3MEHA 2HT1A 5GADC 1HFGA 3S1NB 5M5XH 1PZID 3TREA 4J8QA 5I9OA 4DR7Q 5J39A 4X64Q 4LF7L 1KAWA 4Y7NB 3HOYH 3S14H 3PUVA 1LTTD 1X65A 4YWLA 5BR8Q 2ZJQA 1DGSA 1N34Q 2R92B 1XMOQ 4N9PA 1GUTA 1U4MA 3S1NH 5JPMC 3UDFA 3K0YA 1ML0D 2MHVA 4JI5L 1SYCA 2G9DA 4MTNA 4C1NK 4Y7NH 1GUOA 4KJOA 2ZJPA 4BWGB 2DY8A 1Q7YC 1TWGB 3S2DB 2XWJB 3U58A 2L1BA 1J6QA 4KTAA 3QWNA 4PQXA 1YVCA 1SFOB 2B8GA 5JJIA 5E4XA 3CPWA 1N8RC 2JA5G 1SYBA 1QUQA 4CDDC 3BDOA 2ICIA 1VQPA 1TWGH 1K3RA 1WTRA 1T5XD 2X69A 3FPPA 4I7ZC 4R9WA 4YCWA 1SFOH 1V8QA 3C2PA 5G3LF 3CF5A 2CCZA 1WCMB 1RD9D 2L55A 2I5HA 2EZVA 3HOZH 4WFN3 1YNNC 4X3UA 5BN3A 1K8OA 3SGIA 1A2TA 3IKJA 3G7LA 3CC7A 1ENCA 1NSNS 1WI5A 2OWOA 4OO1I 2F0FA 4LF7Q 1JWMD 2Q8IB 3IL8A 4IJHA 1GUGA 4GNXA 1AEXA 3MC0B 2F0MA 1WCMH 3EN2A 1KABA 1MI2A 4XT1B 5A2QL 4JI5Q 3CCEA 1BCPD 3NWTA 4GN5A 1PV4A 1EY8A 4HMJA 1SXTA 3I8ZA 2Z4HA 1DJRD 1Q46A 5C0XJ 2WAQG 4QB4A 2V1CC 1PH4A 3EIVA 2AMCB 3N6RA 3FEWX 3U9SA 2BOSA 2J7ZA 1I4GA 1BXTA 1I5FA 4ILWA 4A3FG 1PDQA 1Q1EA 1UE7A 1CTMA 4O42A 2X6LA 4C3JB 1TR5A 2D62A 1TU2B 4OWTB 4XQJA 4DR2L 4POGA 1G2TA 3S16B 2YU9B 1HUMA 1RF2D 4NB3A 3X3NA 1RCVD 2L15A 2ZXOA 4JI7L 4DV3L 5COYA 1FR3A 2XSCA 4C3JH 5LMNW 1FNWA 4GKKL 1V1PA 3BG3A 1LT6D 3H3VH 1OXXK 3S16H 1O7IA 4HSVA 4DXFA 1EQVA 3E5SA 1X3FA 3OMCA 1BCPF 2A68D 4ABNA 4EQNA 3UDXA 2PQAB 1A62A 1JT8A 2P5ZX 1TWCB 2N78A 4HIKA 1X32A 2NN6H 5IT9L 5ELNA 3HKZB 3D6WA 2WKDA 1Q12A 2B2YA 3HG9A 1VQNA 5I2XA 1SEBD 1LO5D 3GTKB 1O78A 2KBNA 4C2MB 1Q81C 3G6JB 5EBDA 4O1NA 4DV7L 1TWCH 1LTBD 1Z9FA 4DR1L 4XIGS 3HRZC 1G6ZA 1WTXA 2KA7A 5FO9B 1F9RA 4FF3A 2B2UA 4DR4L 2F3WA 2BDOA 2F1MA 1CT1D 4DR2Q 5IT9c 4QIWE 4OWWB 3I4NG 1VS0A 2B2WA 4C2MH 1C0AA 1CK1A 3T51B 3CW2C 5EJWA 5LMUL 4UP8A 1Y8NB 4JI7Q 3H0GB 4DV3Q 2CQOA 2HHHL 1CA5A 3RLOA 4DUZL 1HTPA 4GKKQ 4RKLA 2XRSD 2F0WA 4RCOA 5C44H 4L5TA 5JAVA 1UE1A 1PH9A 3CCRA 5A35A 3C1FA 2LY7A 1EL0A 2MJ8A 2BA0A 5C4JB 1BQQT 1TVXA 5IGDA 1U4LA 2EVBA 4QGUA 4GLXA 2UUCL 3SK4A 5NUCA 2QKIC 1VDZA 3TRZA 1BO0A 4DAMA 1YHBA 1QJOA 1R4PB 2F0KA 4IPGA 2E2HB 3KLWA 2AQ1B 4BY1G 3GTLB 2ZM6L 5M5YB 5C4JH 1FD7D 4DV7Q 2EY1A 4DR1Q 3S2HH 1H9JA 1YNXA 1B9NA 3E9IA 1L1OB 4DV0L 2A5HA 5J22A 4DR4Q 3UI2A 3CAMA 3TS0A 1AFPA 3GTLH 2L5TA 5CORA 5D3IB 2YYZA 4P72A 1EY4A 3GTMB 1VCIA 4TQUS 5LMUQ 4A3JB 4KD4A 2JXMB 1XPOA 5JJKA 5ELDA 4FF2A 3TP8A 3WOFA 3H94A 4H13C 3QIAA 2HHHQ 1ET9A 4L5QA 4DUZQ 3J80E 3F2CA 4UAIA 4ME3A 1HXYD 1S4ZA 3CCQA 4IQZA 4IUQA 3GTMH 4A3JH 5IYBG 1GXDC 2HQLA 3CP0A 3W1BA 4EQ5A 1F9PA 1QVGA 1KC8C 2UUCQ 2ALYB 3EVQA 3UDIA 2F0TA 5JEAH 1X3EA 1Y69U 5FLXL 1HR0L 4L8JA 5HY6A 2ZM6Q 2L0CA 3D4WA 2HIXA 3KLRA 4XQNA 1YNND 2WP8J 4LF9L 5D3DA 1F9SA 2FXQA 3L0OA 2VNUD 4LMQD 2F0NA 5E7NA 1WTWA 2BCOA 3U4ZA 1SYEA 1ZYRD 2GA4B 2KENA 3C1EA 1GOZA 1KDAA 1JWSD 4DV0Q 2R3ZA 1KD1C 2IX0A 3IAYA 2RDGA 4QIWB 1TWHB 1W2BA 1GM5A 1SNMA 4H7BA 1AZPA 3ERQA 4K6LA 5AJ3L 3F2BA 1GO3E 4DNIA 4OGQC 4TRDA 4Y52H 2BDNA 3CPFA 5JPNC 2RQXA 5M3MG 4BXXG 1CQVA 2E76C 1CSQA 4OHJA 3HOWG 1L2FA 3BVZA 2H4OA 2RSOA 2Y0SE 1Q82C 1EEFD 2JA6B 2XTIA 4K8IA 5FOBB 1TQOA 1UE5A 3IFTA 3RN5A 2J0TD 1B1ZA 2OQKA 2GVAA 4IJLA 2JA7G 1PXUA 1U0LA 2F3IA 2A6HC 4XXEA 3KF6A 5E1FA 2N8NA 1IYUA 3TQYA 2IJ0A 2QW7A 1HRJA 1K8AC 3E6ZX 4A3BH 2K5VA 1I6VC 1SN8A 1HR0Q 2R7ZH 3QOLA 1VQGA 4A3EH 4LF9Q 2K28A 5AFWA 4A3IB 4KKUA 2JP1A 1GVPA 4DV6L 4LF4L 3K5OA 4U673 5CV6A 4GN3B 1W6JA 5M5WB 2EY5A 4WRDA 3K81C 2A69C 2ZXRA 1K8GA 3DWAA 2MFIA 1XMQL 3J81E 1W6KA 4OEMB 4A3IH 2JEBI 5AJ3Q 1H9SA 3Q22A 2LSSA 3L3OC 1RJTA 3PUWA 5GROA 2PNRC 4L5RC 2Z6BA 1O7YA 5M5WH 2KHIA 5CBAE 1A8VA 3HZXA 1TT2A 1NMGA 3FHWA 3M9BA 1STYA 2UUAL 4CKEA 1MD2D 2TSSA 4IUTA 1SSOA 4AQYL 2UUBL 3M3YB 3AFPA 2QEXA 4DUYL 3HOYG 3J7AV 4C3HH 1QUQB 4ME5A 3R2IA 5JJLA 5GAHC 3NK9A 2VS1A 1UEAB 4APVA 3K58A 1JB7A 2F0VA 3I3CA 1Y1VH 4DAYB 3M3YH 1EY0A 5IODA 1MSHA 1SE3A 4M1UB 1ICFB 3SK6A 4P74A 2FMCA 2KVMA 2K14A 5FJ8H 4DV6Q 4LF4Q 2R92G 3KLSX 3FPUB 5KYLA 3A8IE 4K5WA 4GNXB 2D2CC 1X56A 3D6CA 1WD0A 3A8JE 4ZK9B 4X65L 1M8AA 2AUKA 3J80L 4DK1A 3ERSX 2D0PA 1XMQQ 1HHVA 1QNKA 1K3BC 4X66L 1EWHA 5T1GA 3HOUB 3BJUA 1H9RA 1FJGL 3KDFB 3FKIH 1S3OA 1SBBB 2IX3A 4V190 2DN8A 3GO5A 5IP9G 2KOLA 3PQIA 4NPSA 2CVRA 2NVTB 3ONAB 1HA6A 2UUAQ 3J7AF 2WIIB 2XIWA 2Y0SB 4KN7C 1W3SA 1PRTC 3QOJA 4AQYQ 2UUBQ 3HOUH 3S1MB 3MEFA 4OO1H 2KJXA 3J80c 1UWVA 1I50B 4DUYQ 2XN9C 2MO0A 1GUNA 4JBWA 1DYQA 4YHHL 2K50A 1Z7TA 1YJ9A 4DN4M 1WCMG 2NVTH 1WTPA 3GD7A 2EJFC 3EA6A 4KY5A 3MXPA 4B3TL 1PTOD 3S1MH 4RCNA 1I50H 1O7LA 2DJGC 4MN3A 5JVG3 2QDLA 4IFDG 1DXMA 4HJ5A 3UDGA 4B3SL 2G9HD 4JI1L 1EYDA 1EIFA 4FXGC 2N49A 3SK5A 3A7LA 1J5EL 2LMCB 2NTTA 2QDBA 4GLVB 4P75A 3MHBA 1O7ZA 3MTSA 4X65Q 2VB2X 1YBYA 3OHXC 4DXGA 4A75A 1VQOA 4RGOS 3HOVB 1A3UA 4K6DA 3VA7A 3EROA 4JI6L 1STBA 1EIGA 3DEPA 4CJ1B 4X66Q 3MXGA 3U4VA 1PH1A 1FJGQ 1PH7A 3NXWA 3BS1A 1HCZA 1BNZA 1UAPA 1JR0D 5CC4A 4RGTA 3A56A 4DK6C 3HOVH 3CKIB 2HQEA 4A3DB 3K5NA 1ZEQX 2DGYA 4TSSA 1I4XA 5FK9C 3F8TA 4G57A 5FLMH 2OCEA 1JC7A 2MO1A 4YHHQ 1L0YB 4RA8A 3CMAA 2NBFA 5IYDH 4KY6A 4B3TQ 1XNRQ 4LWCA 5J1ZA 1QZHA 1ONLA 1G6PA 2ATWA 1JICA 2IY5B 4PZ6A 3AYHB 2F52A 4B3SQ 4JI1Q 3H15A 3J81L 1HQRD 1SNDA 3RZOB 5G3LD 2PPBC 1NBWA 1J5EQ 2PI2A 1KTKA 1XX8A 2BE5C 3K5LA 1DCZA 3BYYB 4EQPA 1VQ6A 2EYOA 1ET6A 5C0XI 4CKBA 4JI6Q 3RR5A 1MKHA 4R4IA 3HKZG 4QY7A 3AFQA 2QF7A 4IURA 3STBC 3RZOH 2A6HD 3VYTA 2IHEA 3LX0A 4BS9A 5IGCA 1TS4A 2KECA 3I55A 4GOPB 4IALA 3J81c 4GKJL 4BBSB 1LT4D 2A8VA 2EYPA 1B3QA 4HIDA 1PFSA 4A3CH 1FVIA 4PZ8A 1VMCA 2K5DA 2ZT9C 4E6IA 5HURA 2JN4A 3PO3H 5LHY1 3Q8DA 5DM73 1BDOA 4HJAA 3HOZB 1CUKA 1EU4A 3VA5A 1SE4A 3RN2A 1A63A 2HDLA 3U50C 4BBSH 5JVH3 1IZ6A 1SNCA 2A69D 1B53A 1PH6A 1EY5A 4N9TA 3D0FA 3H0GG 1MHWC 3VYRA 4XTCS 3T1YL 1S72A 1HQMC 3BYTB 4KY7A 1OXSC 3IFDA 4Z9CB 4L63B 5C4XB 1Q8KA 3GTPB 2N55A 1STEA 1NE3A 1Y8PB 3R2TA 3T16A 5CYUA 2I5LX 3A54A 2VL6A 1F9QA 1TWFH 1JMCA 1JE4A 4CGYB 2KQ3A 1QOHA 3L2PA 4JBMA 1XWEA 5C4XH 1TXYA 3KF8B 1EQRA 5I9PA 5IWAL 4X62L 3GTPH 4ZLTF 4B08A 3CXCA 2L11A 1E3PA 2JK8A 2MP1A 1YZ6A 3H6MA 3NPPA 3CRKC 1AW7A 2EYJA 5ELEA 2LFNA 3ND8A 4LUOA 1I4RA 1YJNA 2Q2TA 5EKKA 2B29A 1K0SA 1NCVA 1SNQA 4GKJQ 1LLRD 3ULPA 3KUPA 1BBWA 2AWNA 1C9OA 4YWMA 1RHPA 1H9KA 4IUVA 4H0LC 4Q5VA 3NEMA 3I7FA 2NVXB 3OYYA 1TY2A 3H3VC 4ZUIA 1TS3A 1IL8A 2RA4A 2K1BA 5T1IA 4L5SA 3E0JA 1N33L 4A3JG 4JYAL 2K5WA 1EUJA 5C3EB 4IUUA 4H02A 3WWVA 3DM3A 2K04A 3BZCA 4LW1A 1VQ8A 3T1YQ 2EE1A 2NVXH 1M4VA 1BUVT 3GDEA 3O13A 4CKCA 2OF1A 3A5ZB 4R1JA 1CI3M 4K14A 1KNEA 2KUMA 4C3IH 1EFWA 1NTGA 5C3EH 1ZKOA 4AYBE 5CGKA 2VB3X 3ER0A 1LTLA 5EAYA 3SDZA 4F88A 3A5UA 1G91A 1VQ7A 5IWAQ 4DGZA 4X62Q 3RUZA 1KIXA 3DUZA 3VR2A 5C6AA 1WTOA 4A3GG 1VQCA 3PMFA 2NVYB 1IHZA 3Q0AA 4KHPL 2E2DC 1HZ9A 1OO9B 2R93H 2KCMA 3DEOA 4DV4Q 1DOLA 4A76A 1DZ1A 1GD7A 5CR3A 1CA6A 3SHLA 1I6HH 1KL9A 2RBMA 2DY7A 3LNNA 3OTOL 3WOEA 4ZQ3A 2NVYH 1QWYA 3AEVA 2R61A 1VMPA 1VF5C 1JORA 1SDFA 2N88A 1B4OA 1KRSA 4FO2A 1ENFA 2Z0SA 1N33Q 2M00A 4JYAQ 4R4QA 4B9WA 2F0LA 3NBHA 4B3RL 1EZ6A 1SMYC 3TDQA 2EYMA 1SRUA 1H9SB 1KHIA 1N9WA 4RKBA 3HOXB 5CBEE 5C44B 1KLGD 5I4DA 3S24A 4MIUA 2MPMA 2IWHA 4PV1C 1Y1WB 3KJOA 2GVBA 4RGNA 2JA6G 1PRTF 1IL2A 1UE6A 1EU3A 4FXDA 3L7ZC 3HOXH 1D5ZC 3KBGA 1S5BD 5IGBA 1DD2A 1PFMA 5C4ZA 1XTDA 2VUMG 2OTJA 4K8JA 4A3KB 3ULJA 1UNSA 4K5XA 4CHTB 4KHPQ 2PW5A 1Y1WH 1EYGA 5IOCA 5M3FB 3S15B 1S5DD 3S2HB 3D3RA 1VQ4A 3JAMi 1S5ED 5JOBA 2IT1A 1I3QH 4A3IG 1U4PA 2EYLA 4HR7B 4ZKBB 4MZ9A 3MXNB 3AU7A 4LAAA 3KJPA 4PMCA 2JA5H 1L1OC 3KBXA 2F0IA 4A3KH 3ICEA 3CCUA 1XJVA 3OTOQ 3A74A 1B70B 5M3FH 3S15H 4HTHA 5LL6S 1FNVA 1STAA 2PI2E 4J15A 4RFBA 1HR0W 2LXKA 4EVOA 4LFAL 4TVAB 4B3RQ 3PO2G 3J80i 2F3VA 3STBD 4NKLA 3E9HA 1E24A 2KCCA 3MAQA 2JA9A 1YI2A 1WTHA 4RMFA 1KRTA 4OIJA 2OTLA 1JJGA 1ESRA 4AYBB 2I07B 1BBUA 1S5CD 3F1ZA 2H5XA 1CZWA 4RH6A 1K73C 5CV4A 3NUCA 4PNYA 2RDFA 5IGGA 1K9MC 3E0EA 3A8KE 4IFDI 5IYCH 2O4XA 1PFBA 4AH6A 4MHEA 1VQMA 2RSNA 2YV5A 4GS3A 2XRQD 1STHA 2JEAI 1SR3A 3T53B 5KYIA 1VF7A 1LTRD 4DK0A 1PTOB 3W3AA 4DR5L 1GUSA 3A0JA 4JW0A 4N8FA 3NTIA 3J81j 2JA8B 2F0HA 1D1IA 1AN8A 4IZ8A 3CCVA 2E2JB 2HD3A 2RKSA 4JI2L 1DOKA 3IRBA 5FO7B 3I4MB 3M4OB 1IKMA 3DWQA 4DNRB 3MZ5A 4R8IA 3F2DA 4DKAC 3KK7A 1PTOH 1BKBA 1NMFA 4LFAQ 4OO1G 1DM0B 1JOOA 2XNAC 3BU2A 1TWAH 3A55A 4K2LA 2D5DA 3OW7A 2JA8H 1MBYA 1H95A 4WORA 4P73A 3T13A 1E22A 3K7AH 4MTKA 3RD4A 2DJFC 2K32A 1EFID 2KEEA 2E2JH 1SE8A 2CFMA 3LWUA 4H44C 3NELA 3I4MH 3M4OH 2L12A 1KLUD 2QCPX 4WJ4A 5D65A 3OMGA 1Q86C 4IPCA 3RMHA 3UE1A 3ZJYC 3VDYA 4NP5A 3I90A 4A3BB 2R7ZB 4A3EB 3OWFA 1VQ9A 1PYSB 1RTNA 4JV5L 4HEDA 1Q3LA 4X3KA 4WJWA 3V2TA 2CWPA 2F0DA 1SMXA 4YWKA 4JG2A 1E7ZA 4DFAA 1A0IA 1QZGA 1JOQA 1LYLA 1EQTA 4IFDJ 1JE5A 1QE6A 4DR5Q 1R9TB 1EY7A 2ES2A 4OONA 1IKLA 2I0QA 2C9OA 3PV0A 3HOVG 1ILQA 4JI2Q 4DV2L 2WACA 4HN7A 1KQSA 2PQAA 4J6HA 1RODA 1C48A 3BZKA 2SOBA 1YITA 1R9TH 1Y8OB 4ZAIA 1DONA 1MGSA 2HIVA 2J4XA 2RCNA 4A93B 3PUZA 4NDXA 1S40A 2ZTCA 5FLMG 3TN2A 3T4AC 1TS5A 3TP6A 1V1QA 1SNOA 4A3DG 1NR4A 3KLSA 1WTQA 4C3HB 5IYDG 5K36G 1I94L 3B6YA 3Q6SA 2UXDL 2NVQB 4PG3A 3TEHB 5I6WA 4IN3A 2FINB 4JK1C 4A93H 3DHQA 3OW2A 4QCLA 3G71A 4CDFC 2WV6D 1Y1VB 3VYUA 2IL8A 4ZYSA 1EOVA 1SE2A 2D0OA 3P75A 1D5MC 4JV5Q 2DUDA 4BY1H 5CMDA 1ASZA 1Y14B 4Q0FA 2NVQH 1AZQA 4O0AA 5C0XH 5CV5A 5HGTA 2H1EA 3PIO3 3K57A 3BVMA 3VR5A 5ELOA 1PH3A 4FF4A 1I4PA 5GQOA 4ID6A 4GNXC 3AQQA 3P20A 4XYQA 2YTXA 1PYBA 3PGZA 2K5HA 4DV2Q 4K5VA 2K52A 4DAVA 3RZDB 2PO4A 1LTID 1ILPA 3FKIB 1HJPA 1VQEA 4FP5D 1F77A 1JWUD 2I46A 1WOCA 4RHRA 2N3SA 2RHSB 4BBSG 4LJZC 4JBJA
chains in the Genus database with same CATH topology
3I55A 4GOPB 2KHJA 3RZDH 1Q12A 3J81c 5DLQE 3H3VI 4GKJL 1E1TA 2UXBQ 1VQNA 1I94Q 2A8VA 2ZTDA 2Y0SG 2BH2A 2UXDQ 2KBNA 2WB1E 1Q81C 1G291 4DV7L 1TWCH 1PFSA 1Z9FA 3FP9A 4HIDA 4DR1L 4A3CH 1EWIA 1FVIA 4PZ8A 4XIGS 3HOZG 1T9HA 1L1OA 4A3GH 3HKSA 3M4PA 4JI4L 3PO3H 1IBLQ 3Q8DA 2Z6KC 4HJAA 1CUKA 2NN6I 1X55A 4DR4L 3RN2A 1A63A 3U50C 2QGQA 4BBSH 1P16A 4DR2Q 5IT9c 1IZ6A 4QIWE 4OWWB 1VS0A 3I4NG 1VQJA 4C2MH 4JI3L 1C0AA 1G51A 5FLXc 1PH6A 3CW2C 1VQFA 1VQKA 5C4XG 1X6OA 5LMUL 1VQAA 3D0FA 3H0GG 3T1HL 1X3GA 4PZ7A 4UP8A 4XTCS 1CKNA 3T1YL 1S72A 1AE2A 1SROA 1Q1BA 1OXSC 3GTQH 1TWHH 4JI7Q 1Q8KA 2Q2IA 4DV3Q 2CQOA 4FDBA 2HHHL 1XNRL 3RLOA 3W1GA 3G48A 2AHOB 4DUZL 1NE3A 4GKKQ 1CSPA 2I5LX 3PUYA 1IBKL 2VL6A 1LM0A 1YIJA 1TWFH 1JMCA 5C44H 1X9NA 4L5TA 4DV1L 1KXLA 3J81i 1UE1A 1PH9A 3I4NH 2K75A 5IP7G 3CCRA 3L2PA 1X54A 5IWAL 5C4XH 1TXYA 3KF8B 1EQRA 2BA0A 4JBMA 4X62L 3GTPH 2EQSA 3CXCA 4LFCL 1E3PA 5HGQA 2JK8A 2IHFA 3KOJA 4QGUA 4GLXA 1YZ6A 2UUCL 5H1SE 4BXXH 4LUOA 1VQBA 1YJNA 2AWOA 2Q2TA 2JA6H 3TRZA 4DAMA 3CD6A 1YHBA 3GTOH 4IPGA 2B29A 3KLWA 4POFA 4BY1G 4GKJQ 4ALPA 1RIPA 3ULPA 2A19A 1BBWA 2AWNA 2ZM6L 1C9OA 4YWMA 3CCJA 2VQEL 2CKZB 2BH8A 5C4JH 4DV7Q 1K0RA 4DR1Q 2VUMH 3S2HH 4DK3C 2JA7H 3NEMA 5IP7H 1YNXA 1VQDA 4QL5A 1YEZA 4JI4Q 3I7FA 4HJ8A 3OYYA 3ULLA 3K0XA 1HNWL 3E9IA 1L1OB 5C3EG 4DV0L 1RL2A 3I56A 4OX9L 4QQBX 4DR4Q 1PVOA 3NENA 4L5SA 2PMZE 3CAMA 3TS0A 1N33L 4A3JG 2UXCL 3GTLH 4JYAL 5GAEC 4JI8L 1EUJA 2YYZA 4JI3Q 4H02A 4P72A 3WWVA 1VCIA 3DM3A 4TQUS 5LMUQ 2PNHA 3BZCA 4LW1A 5IY0A 2NZOA 3T1HQ 1PHJA 1VQ8A 3T1YQ 2UU9L 4A3MG 1XPOA 2NVXH 5JJKA 1OXVA 3GDEA 4UY8C 4JI0L 2HHHQ 2C35B 3A5ZB 2NN6G 4L5QA 3F2CA 4R1JA 4A4IA 4DUZQ 4C3IH 1EFWA 4ME3A 2E5LL 1IBKQ 4RG1A 1NTGA 4LF5L 5C3EH 3W5OA 3RLNA 5GAGC 3CCQA 1PA6A 4AYBE 2OQ0A 3ER0A 4EX5A 1IXRA 3GTMH 4YY3L 3PO2H 4A3JH 3TS2A 4DV1Q 4HIMA 1AH9A 1LTLA 5EAYA 3LGJA 1EQQA 5IYBG 5J3BA 1XPRA 2HQLA 1U5KA 3A5UA 4DPGA 4IO9A 3CP0A 1VQ7A 5IWAQ 4A3CG 3K8AA 3W1BA 4X62Q 1KIXA 4LFCQ 4GOPC 4A3GG 1VQCA 2K5NA 4A3MH 4EQ5A 1M1KC 3PO3G 1KC8C 1QVGA 4JOIC 2UUCQ 4KHPL 1HZ9A 2ALYB 3UDIA 2R93H 2WB1G 2KCMA 4DV4Q 4UPAA 1VQ5A 1LUZA 4A76A 1GD7A 4DR6L 3S1RH 2ZJRA 1X3EA 4P71A 2ID0A 1VQHA 1HR0L 4LFBL 5HY6A 1I6HH 1ASYA 3G4SA 2ZM6Q 1KL9A 2HIXA 2VQEQ 2WP8J 4LF9L 4BY7G 2KCTA 2R7FA 2FXQA 3L0OA 2B63G 1N36L 1N32L 5IYBH 2VNUD 3KYHC 3OTOL 5E7NA 2NVYH 3U4ZA 4NXML 3PSIA 4BBRG 4LUZA 1NY4A 1PH8A 2KENA 2VZAA 3AEVA 1HNWQ 4DV0Q 1KD1C 3JAMc 2ZTEA 4OX9Q 2IX0A 1KRSA 2Z0SA 1N33Q 2UXCQ 1W2BA 1GM5A 4R4QA 4JYAQ 4JI8Q 3G6EA 3HOXG 4A3LG 1NJIC 5C44G 4B3RL 1QVCA 1M90C 1SRUA 1KHIA 5AJ3L 1N9WA 2UU9Q 3F2BA 1GO3E 4X6AH 4DNIA 4Y52H 3HKZE 4BY7H 1OXTA 1V9PA 2XGTA 4LUVA 1Y1WG 1HNXL 4JI0Q 2B63H 3CPFA 3S24A 2R92H 3CCMA 4R4TA 4JCVE 4BBRH 4IPHA 3J7ZC 1D7QA 5M3MG 2E5LQ 4BXXG 4LF5Q 1XPUA 1CSQA 2GVBA 3K80C 4MNOA 3KJOA 2JA6G 3HOWG 4R4OA 1IL2A 3K7UC 2F4VL 1L2FA 1UE6A 4YY3Q 4DR3L 4KLKA 3L7ZC 2Y0SE 4A3KG 1Q82C 1OTCA 3GTGH 3HOXH 4A3LH 1PH2A 2XTIA 1JJ2A 1UE5A 3RN5A 1XTDA 5M3FG 4IPDA 1Z47A 2OQKA 2GVAA 4IJLA 4KHZA 2JA7G 2VUMG 1U0LA 3S2DH 2OTJA 2F3IA 1OXUA 3ULJA 3PCOB 4YCUA 4O2DA 1HZBA 3KF6A 1Y1WH 1EYGA 4KHPQ 1CKOA 2N8NA 1MIUA 5IP9H 2VQFL 4JBKA 3TQYA 1VQ4A 3JAMi 3EBEA 1VQLA 2IT1A 2WFWA 5M3MH 1K8AC 3CC2A 2K5VA 1I3QH 4A3IG 4A3BH 4DR6Q 4DV4L 4LFBQ 1SN8A 1HR0Q 2R7ZH 4MZ9A 3MXNB 3HOWH 3RNUA 2RF4A 1VQGA 3KJPA 3CCSA 4A3EH 1AE3A 2IX1A 4LF9Q 2JA5H 1IYJB 1L1OC 4A3KH 3ICEA 2YTYA 1N36Q 1GVPA 1N32Q 4BBSG 3CCUA 1XJVA 2R7DA 3OTOQ 4DR7L 3A74A 1B70B 2VY3A 4X64L 4NXMQ 4DV6L 5M3FH 4OWXB 4LF4L 2ASBA 3S15H 1HZAA 3PF4A 4NXNL 5BR8L 4GN3B 3RLFA 2Q2UA 1YHAA 2PI2E 4J15A 1N34L 1HR0W 2LXKA 3K81C 1XMOL 2B3GA 3I4OA 1PH5A 3CMEA 1K8GA 4LFAL 4TVAB 4B3RQ 2MFIA 1XMQL 3PO2G 2Q2HA 3J80i 4A3IH 2JEBI 2NZHA 5AJ3Q 5IYCG 2LSSA 4PMWA 3NBHB 3STBD 3E9HA 1E24A 3KDFA 3S17H 1D8LA 1BVSA 1HNXQ 4AYBG 4WJ3M 3PUWA 5GROA 4L5RC 4YCVA 2E8GA 2JA9A 2YTVA 1YI2A 1EIYB 5M5WH 2KHIA 4RMFA 1KRTA 2OTLA 1A8VA 1JJGA 2R93G 1NMGA 3FHWA 3JC66 1SLJA 3M9BA 5JEAJ 2QA4A 3CQZH 2UUAL 4K0KL 4GN4B 3GTJH 1BBUA 5JEAG 2F4VQ 3F1ZA 2H5XA 2R6GA 4DR3Q 1P8LA 4AQYL 1K73C 2UUBL 1GKHA 2WAQE 4LF6L 3J7A5 3AFPA 2QEXA 4LF8L 2MNAA 4DUYL 2A1AA 3E0EA 1K9MC 3HOYG 3CC4A 4IFDI 4C3HH 3UE0A 5IYCH 1QUQB 2AKWB 4OXPA 4AH6A 2Z6KA 1VQMA 5JJLA 2YV5A 5GAHC 2I5MX 2VS1A 4GS3A 4APVA 4A3DH 2VQFQ 1JB7A 1B8AA 2JEAI 3PIOA 1SR3A 2HT1A 3KF6B 5GADC 1HH2P 1WFQA 1Y1VH 1CKMA 4DAYB 2EIFA 2JA8G 3M3YH 5M5XH 4DR5L 2JE6I 3A0JA 3TREA 2CWAA 3J81j 4DR7Q 4DV5L 2GN5A 4P74A 3I4MG 4X64Q 2K14A 5FJ8H 3CCVA 4DV6Q 1KAWA 2YU9H 4LF4Q 4LF7L 1XNQL 2R92G 3HOYH 3S14H 3PUVA 4NXNQ 1X65A 4YWLA 5BR8Q 4JI2L 2ZJQA 4GNXB 1DGSA 3IRBA 1X56A 4IOCA 1N34Q 3F2DA 4X65L 4DKAC 1XMOQ 1BKBA 3S1NH 4IOAA 1NMFA 2D0PA 3ERSX 4LFAQ 3UDFA 4OO1G 1XMQQ 2RHQB 3BU2A 1TWAH 1V43A 4JI5L 2K4KA 2JA8H 4X66L 1H95A 2JQOA 2MQHA 3BJUA 4P73A 1E22A 3K7AH 4MTNA 4Y7NH 2ZJPA 2E2JH 1FJGL 1SE8A 2CFMA 3NELA 3KDFB 3S1QH 3FKIH 1S3OA 1Q7YC 3I4MH 3M4OH 3GO5A 5IP9G 4WJ4A 4NPSA 3U58A 1C7YA 2UUAQ 4K0KQ 1J6QA 1Q86C 4IPCA 3UE1A 3ZJYC 1YVCA 4A3BG 1W3SA 5JJIA 3CPWA 1HNZL 3VDYA 4AQYQ 2UUBQ 2R7ZG 3HOUH 1N8RC 3MEFA 4LF6Q 4A3EG 3J80c 1UWVA 1YHQA 2JA5G 4KI0A 4DUYQ 4LF8Q 3KFUA 2MO0A 1QUQA 1IBML 1FGUA 3GTKH 4JBWA 1VQ9A 1PYSB 1VQPA 1TWGH 4YHHL 5LMNL 2K50A 1K3RA 4JV5L 1YJ9A 2NVTH 1WCMG 3GD7A 1HZCA 1MJEA 1SFOH 4YCWA 2CWPA 1SMXA 4B3TL 4YWKA 4JG2A 1E7ZA 3CF5A 1A0IA 2I5HA 1QZGA 2CCZA 3S1MH 3HOZH 1LYLA 4IFDJ 1WYDA 1K83H 1I50H 1JE5A 4DR5Q 4UP9A 2LXJA 4IFDG 3SGIA 4HJ5A 3CC7A 3UDGA 2ES2A 4B3SL 4JI1L 4DV5Q 1WI5A 2OWOA 4OO1I 4OONA 4UP7A 2I0QA 1EIFA 4LF7Q 1XNQQ 4R4CA 4BA2I 3PV0A 2N49A 4IJHA 1J5EL 3HOVG 4GLVB 4JI2Q 4DV2L 4P75A 1KQSA 4GNXA 3M4QA 2PQAA 3H0GH 1WCMH 3EN2A 4X65Q 1MJCA 4A93G 1YBYA 4A75A 3BZKA 1VQOA 1YITA 3PUXA 1R9TH 4JI6L 3M7NA 2HIVA 4JI5Q 3CCEA 2RCNA 4GN5A 3PUZA 4X66Q 4HIOA 1E1OA 1S40A 1PV4A 2ZTCA 3U4VA 5FLMG 4GOPA 4B3ML 1PH1A 1FJGQ 1Q46A 4JOIA 1PH7A 2EXDA 1FL0A 5C0XJ 1V1QA 4HJ7A 2VW9A 2WAQG 4A3DG 5C0XG 2V1CC 1PH4A 4DK6C 2UXBL 3EIVA 2AMCB 5IYDG 1I94L 3HOVH 5K36G 1JJCB 3B6YA 2UXDL 4PG3A 3TEHB 1Y1VG 4GLAC 1HNZQ 4A93H 3OW2A 3G71A 1I5FA 4A3FG 2E2HH 1Q1EA 1UE7A 1IBLL 2DGYA 4HJ9A 1QVFA 3D31A 3DLLA 1IBMQ 3F8TA 1EOVA 5M5YH 2D0OA 5FJ8G 5FLMH 2D62A 2OCEA 2MO1A 4YHHQ 5LMNQ 4OWTB 4JV5Q 2DUDA 4BY1H 3CCLA 4DR2L 1ASZA 1Y14B 4POGA 1L0WA 3PIPA 2NVQH 3CMAA 4O0AA 3PF5A 2JJQA 4NB3A 5IYDH 4JC0A 4B3TQ 1CKNB 1XNRQ 5IE8A 4LWCA 5ELOA 1PH3A 2L15A 1QZHA 4LNQA 1WJJA 2ATWA 1G6PA 5GQOA 4JI7L 2IY5B 4DV3L 4PZ6A 3AYHB 2F52A 4GNXC 1VQIA 4JI1Q 1B7YB 4B3SQ 3H15A 4C3JH 5LMNW 3AQQA 4A3FH 4GKKL 2YTXA 1NBWA 3H3VH 1OXXK 1J5EQ 1PYBA 3PGZA 2PI2A 2K5HA 3FKIG 4DV2Q 3S16H 1O7IA 3HFZB 3I2ZA 2K52A 4BA1I 1YJWA 2E2IH 4AIMA 1X3FA 1VQ6A 1UEBA 1HJPA 3UDXA 1VQEA 2PQAB 1A62A 5C0XI 4JI6Q 1JT8A 3RR5A 1MKHA 4R4IA 3HKZG 4QY7A 3AFQA 1WOCA 4QJFA 3HOUG 3STBC 2N78A 4HIKA 3RZOH 2BA1A 2N3SA 2IHEA 4B3MQ 2RHSB 5ELNA 3M85A 4JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 A;  4GOP B;  2KHJ A;  3RZD H;  1Q12 A;  3J81 c;  5DLQ E;  3H3V I;  4GKJ L;  1E1T A;  2UXB Q;  1VQN A;  1I94 Q;  2A8V A;  2ZTD A;  2Y0S G;  2BH2 A;  2UXD Q;  2KBN A;  2WB1 E;  1Q81 C;  1G29 1;  4DV7 L;  1TWC H;  1PFS A;  1Z9F A;  3FP9 A;  4HID A;  4DR1 L;  4A3C H;  1EWI A;  1FVI A;  4PZ8 A;  4XIG S;  3HOZ G;  1T9H A;  1L1O A;  4A3G H;  3HKS A;  3M4P A;  4JI4 L;  3PO3 H;  1IBL Q;  3Q8D A;  2Z6K C;  4HJA A;  1CUK A;  2NN6 I;  1X55 A;  4DR4 L;  3RN2 A;  1A63 A;  3U50 C;  2QGQ A;  4BBS H;  1P16 A;  4DR2 Q;  5IT9 c;  1IZ6 A;  4QIW E;  4OWW B;  1VS0 A;  3I4N G;  1VQJ A;  4C2M H;  4JI3 L;  1C0A A;  1G51 A;  5FLX c;  1PH6 A;  3CW2 C;  1VQF A;  1VQK A;  5C4X G;  1X6O A;  5LMU L;  1VQA A;  3D0F A;  3H0G G;  3T1H L;  1X3G A;  4PZ7 A;  4UP8 A;  4XTC S;  1CKN A;  3T1Y L;  1S72 A;  1AE2 A;  1SRO A;  1Q1B A;  1OXS C;  3GTQ H;  1TWH H;  4JI7 Q;  1Q8K A;  2Q2I A;  4DV3 Q;  2CQO A;  4FDB A;  2HHH L;  1XNR L;  3RLO A;  3W1G A;  3G48 A;  2AHO B;  4DUZ L;  1NE3 A;  4GKK Q;  1CSP A;  2I5L X;  3PUY A;  1IBK L;  2VL6 A;  1LM0 A;  1YIJ A;  1TWF H;  1JMC A;  5C44 H;  1X9N A;  4L5T A;  4DV1 L;  1KXL A;  3J81 i;  1UE1 A;  1PH9 A;  3I4N H;  2K75 A;  5IP7 G;  3CCR A;  3L2P A;  1X54 A;  5IWA L;  5C4X H;  1TXY A;  3KF8 B;  1EQR A;  2BA0 A;  4JBM A;  4X62 L;  3GTP H;  2EQS A;  3CXC A;  4LFC L;  1E3P A;  5HGQ A;  2JK8 A;  2IHF A;  3KOJ A;  4QGU A;  4GLX A;  1YZ6 A;  2UUC L;  5H1S E;  4BXX H;  4LUO A;  1VQB A;  1YJN A;  2AWO A;  2Q2T A;  2JA6 H;  3TRZ A;  4DAM A;  3CD6 A;  1YHB A;  3GTO H;  4IPG A;  2B29 A;  3KLW A;  4POF A;  4BY1 G;  4GKJ Q;  4ALP A;  1RIP A;  3ULP A;  2A19 A;  1BBW A;  2AWN A;  2ZM6 L;  1C9O A;  4YWM A;  3CCJ A;  2VQE L;  2CKZ B;  2BH8 A;  5C4J H;  4DV7 Q;  1K0R A;  4DR1 Q;  2VUM H;  3S2H H;  4DK3 C;  2JA7 H;  3NEM A;  5IP7 H;  1YNX A;  1VQD A;  4QL5 A;  1YEZ A;  4JI4 Q;  3I7F A;  4HJ8 A;  3OYY A;  3ULL A;  3K0X A;  1HNW L;  3E9I A;  1L1O B;  5C3E G;  4DV0 L;  1RL2 A;  3I56 A;  4OX9 L;  4QQB X;  4DR4 Q;  1PVO A;  3NEN A;  4L5S A;  2PMZ E;  3CAM A;  3TS0 A;  1N33 L;  4A3J G;  2UXC L;  3GTL H;  4JYA L;  5GAE C;  4JI8 L;  1EUJ A;  2YYZ A;  4JI3 Q;  4H02 A;  4P72 A;  3WWV A;  1VCI A;  3DM3 A;  4TQU S;  5LMU Q;  2PNH A;  3BZC A;  4LW1 A;  5IY0 A;  2NZO A;  3T1H Q;  1PHJ A;  1VQ8 A;  3T1Y Q;  2UU9 L;  4A3M G;  1XPO A;  2NVX H;  5JJK A;  1OXV A;  3GDE A;  4UY8 C;  4JI0 L;  2HHH Q;  2C35 B;  3A5Z B;  2NN6 G;  4L5Q A;  3F2C A;  4R1J A;  4A4I A;  4DUZ Q;  4C3I H;  1EFW A;  4ME3 A;  2E5L L;  1IBK Q;  4RG1 A;  1NTG A;  4LF5 L;  5C3E H;  3W5O A;  3RLN A;  5GAG C;  3CCQ A;  1PA6 A;  4AYB E;  2OQ0 A;  3ER0 A;  4EX5 A;  1IXR A;  3GTM H;  4YY3 L;  3PO2 H;  4A3J H;  3TS2 A;  4DV1 Q;  4HIM A;  1AH9 A;  1LTL A;  5EAY A;  3LGJ A;  1EQQ A;  5IYB G;  5J3B A;  1XPR A;  2HQL A;  1U5K A;  3A5U A;  4DPG A;  4IO9 A;  3CP0 A;  1VQ7 A;  5IWA Q;  4A3C G;  3K8A A;  3W1B A;  4X62 Q;  1KIX A;  4LFC Q;  4GOP C;  4A3G G;  1VQC A;  2K5N A;  4A3M H;  4EQ5 A;  1M1K C;  3PO3 G;  1KC8 C;  1QVG A;  4JOI C;  2UUC Q;  4KHP L;  1HZ9 A;  2ALY B;  3UDI A;  2R93 H;  2WB1 G;  2KCM A;  4DV4 Q;  4UPA A;  1VQ5 A;  1LUZ A;  4A76 A;  1GD7 A;  4DR6 L;  3S1R H;  2ZJR A;  1X3E A;  4P71 A;  2ID0 A;  1VQH A;  1HR0 L;  4LFB L;  5HY6 A;  1I6H H;  1ASY A;  3G4S A;  2ZM6 Q;  1KL9 A;  2HIX A;  2VQE Q;  2WP8 J;  4LF9 L;  4BY7 G;  2KCT A;  2R7F A;  2FXQ A;  3L0O A;  2B63 G;  1N36 L;  1N32 L;  5IYB H;  2VNU D;  3KYH C;  3OTO L;  5E7N A;  2NVY H;  3U4Z A;  4NXM L;  3PSI A;  4BBR G;  4LUZ A;  1NY4 A;  1PH8 A;  2KEN A;  2VZA A;  3AEV A;  1HNW Q;  4DV0 Q;  1KD1 C;  3JAM c;  2ZTE A;  4OX9 Q;  2IX0 A;  1KRS A;  2Z0S A;  1N33 Q;  2UXC Q;  1W2B A;  1GM5 A;  4R4Q A;  4JYA Q;  4JI8 Q;  3G6E A;  3HOX G;  4A3L G;  1NJI C;  5C44 G;  4B3R L;  1QVC A;  1M90 C;  1SRU A;  1KHI A;  5AJ3 L;  1N9W A;  2UU9 Q;  3F2B A;  1GO3 E;  4X6A H;  4DNI A;  4Y52 H;  3HKZ E;  4BY7 H;  1OXT A;  1V9P A;  2XGT A;  4LUV A;  1Y1W G;  1HNX L;  4JI0 Q;  2B63 H;  3CPF A;  3S24 A;  2R92 H;  3CCM A;  4R4T A;  4JCV E;  4BBR H;  4IPH A;  3J7Z C;  1D7Q A;  5M3M G;  2E5L Q;  4BXX G;  4LF5 Q;  1XPU A;  1CSQ A;  2GVB A;  3K80 C;  4MNO A;  3KJO A;  2JA6 G;  3HOW G;  4R4O A;  1IL2 A;  3K7U C;  2F4V L;  1L2F A;  1UE6 A;  4YY3 Q;  4DR3 L;  4KLK A;  3L7Z C;  2Y0S E;  4A3K G;  1Q82 C;  1OTC A;  3GTG H;  3HOX H;  4A3L H;  1PH2 A;  2XTI A;  1JJ2 A;  1UE5 A;  3RN5 A;  1XTD A;  5M3F G;  4IPD A;  1Z47 A;  2OQK A;  2GVA A;  4IJL A;  4KHZ A;  2JA7 G;  2VUM G;  1U0L A;  3S2D H;  2OTJ A;  2F3I A;  1OXU A;  3ULJ A;  3PCO B;  4YCU A;  4O2D A;  1HZB A;  3KF6 A;  1Y1W H;  1EYG A;  4KHP Q;  1CKO A;  2N8N A;  1MIU A;  5IP9 H;  2VQF L;  4JBK A;  3TQY A;  1VQ4 A;  3JAM i;  3EBE A;  1VQL A;  2IT1 A;  2WFW A;  5M3M H;  1K8A C;  3CC2 A;  2K5V A;  1I3Q H;  4A3I G;  4A3B H;  4DR6 Q;  4DV4 L;  4LFB Q;  1SN8 A;  1HR0 Q;  2R7Z H;  4MZ9 A;  3MXN B;  3HOW H;  3RNU A;  2RF4 A;  1VQG A;  3KJP A;  3CCS A;  4A3E H;  1AE3 A;  2IX1 A;  4LF9 Q;  2JA5 H;  1IYJ B;  1L1O C;  4A3K H;  3ICE A;  2YTY A;  1N36 Q;  1GVP A;  1N32 Q;  4BBS G;  3CCU A;  1XJV A;  2R7D A;  3OTO Q;  4DR7 L;  3A74 A;  1B70 B;  2VY3 A;  4X64 L;  4NXM Q;  4DV6 L;  5M3F H;  4OWX B;  4LF4 L;  2ASB A;  3S15 H;  1HZA A;  3PF4 A;  4NXN L;  5BR8 L;  4GN3 B;  3RLF A;  2Q2U A;  1YHA A;  2PI2 E;  4J15 A;  1N34 L;  1HR0 W;  2LXK A;  3K81 C;  1XMO L;  2B3G A;  3I4O A;  1PH5 A;  3CME A;  1K8G A;  4LFA L;  4TVA B;  4B3R Q;  2MFI A;  1XMQ L;  3PO2 G;  2Q2H A;  3J80 i;  4A3I H;  2JEB I;  2NZH A;  5AJ3 Q;  5IYC G;  2LSS A;  4PMW A;  3NBH B;  3STB D;  3E9H A;  1E24 A;  3KDF A;  3S17 H;  1D8L A;  1BVS A;  1HNX Q;  4AYB G;  4WJ3 M;  3PUW A;  5GRO A;  4L5R C;  4YCV A;  2E8G A;  2JA9 A;  2YTV A;  1YI2 A;  1EIY B;  5M5W H;  2KHI A;  4RMF A;  1KRT A;  2OTL A;  1A8V A;  1JJG A;  2R93 G;  1NMG A;  3FHW A;  3JC6 6;  1SLJ A;  3M9B A;  5JEA J;  2QA4 A;  3CQZ H;  2UUA L;  4K0K L;  4GN4 B;  3GTJ H;  1BBU A;  5JEA G;  2F4V Q;  3F1Z A;  2H5X A;  2R6G A;  4DR3 Q;  1P8L A;  4AQY L;  1K73 C;  2UUB L;  1GKH A;  2WAQ E;  4LF6 L;  3J7A 5;  3AFP A;  2QEX A;  4LF8 L;  2MNA A;  4DUY L;  2A1A A;  3E0E A;  1K9M C;  3HOY G;  3CC4 A;  4IFD I;  4C3H H;  3UE0 A;  5IYC H;  1QUQ B;  2AKW B;  4OXP A;  4AH6 A;  2Z6K A;  1VQM A;  5JJL A;  2YV5 A;  5GAH C;  2I5M X;  2VS1 A;  4GS3 A;  4APV A;  4A3D H;  2VQF Q;  1JB7 A;  1B8A A;  2JEA I;  3PIO A;  1SR3 A;  2HT1 A;  3KF6 B;  5GAD C;  1HH2 P;  1WFQ A;  1Y1V H;  1CKM A;  4DAY B;  2EIF A;  2JA8 G;  3M3Y H;  5M5X H;  4DR5 L;  2JE6 I;  3A0J A;  3TRE A;  2CWA A;  3J81 j;  4DR7 Q;  4DV5 L;  2GN5 A;  4P74 A;  3I4M G;  4X64 Q;  2K14 A;  5FJ8 H;  3CCV A;  4DV6 Q;  1KAW A;  2YU9 H;  4LF4 Q;  4LF7 L;  1XNQ L;  2R92 G;  3HOY H;  3S14 H;  3PUV A;  4NXN Q;  1X65 A;  4YWL A;  5BR8 Q;  4JI2 L;  2ZJQ A;  4GNX B;  1DGS A;  3IRB A;  1X56 A;  4IOC A;  1N34 Q;  3F2D A;  4X65 L;  4DKA C;  1XMO Q;  1BKB A;  3S1N H;  4IOA A;  1NMF A;  2D0P A;  3ERS X;  4LFA Q;  3UDF A;  4OO1 G;  1XMQ Q;  2RHQ B;  3BU2 A;  1TWA H;  1V43 A;  4JI5 L;  2K4K A;  2JA8 H;  4X66 L;  1H95 A;  2JQO A;  2MQH A;  3BJU A;  4P73 A;  1E22 A;  3K7A H;  4MTN A;  4Y7N H;  2ZJP A;  2E2J H;  1FJG L;  1SE8 A;  2CFM A;  3NEL A;  3KDF B;  3S1Q H;  3FKI H;  1S3O A;  1Q7Y C;  3I4M H;  3M4O H;  3GO5 A;  5IP9 G;  4WJ4 A;  4NPS A;  3U58 A;  1C7Y A;  2UUA Q;  4K0K Q;  1J6Q A;  1Q86 C;  4IPC A;  3UE1 A;  3ZJY C;  1YVC A;  4A3B G;  1W3S A;  5JJI A;  3CPW A;  1HNZ L;  3VDY A;  4AQY Q;  2UUB Q;  2R7Z G;  3HOU H;  1N8R C;  3MEF A;  4LF6 Q;  4A3E G;  3J80 c;  1UWV A;  1YHQ A;  2JA5 G;  4KI0 A;  4DUY Q;  4LF8 Q;  3KFU A;  2MO0 A;  1QUQ A;  1IBM L;  1FGU A;  3GTK H;  4JBW A;  1VQ9 A;  1PYS B;  1VQP A;  1TWG H;  4YHH L;  5LMN L;  2K50 A;  1K3R A;  4JV5 L;  1YJ9 A;  2NVT H;  1WCM G;  3GD7 A;  1HZC A;  1MJE A;  1SFO H;  4YCW A;  2CWP A;  1SMX A;  4B3T L;  4YWK A;  4JG2 A;  1E7Z A;  3CF5 A;  1A0I A;  2I5H A;  1QZG A;  2CCZ A;  3S1M H;  3HOZ H;  1LYL A;  4IFD J;  1WYD A;  1K83 H;  1I50 H;  1JE5 A;  4DR5 Q;  4UP9 A;  2LXJ A;  4IFD G;  3SGI A;  4HJ5 A;  3CC7 A;  3UDG A;  2ES2 A;  4B3S L;  4JI1 L;  4DV5 Q;  1WI5 A;  2OWO A;  4OO1 I;  4OON A;  4UP7 A;  2I0Q A;  1EIF A;  4LF7 Q;  1XNQ Q;  4R4C A;  4BA2 I;  3PV0 A;  2N49 A;  4IJH A;  1J5E L;  3HOV G;  4GLV B;  4JI2 Q;  4DV2 L;  4P75 A;  1KQS A;  4GNX A;  3M4Q A;  2PQA A;  3H0G H;  1WCM H;  3EN2 A;  4X65 Q;  1MJC A;  4A93 G;  1YBY A;  4A75 A;  3BZK A;  1VQO A;  1YIT A;  3PUX A;  1R9T H;  4JI6 L;  3M7N A;  2HIV A;  4JI5 Q;  3CCE A;  2RCN A;  4GN5 A;  3PUZ A;  4X66 Q;  4HIO A;  1E1O A;  1S40 A;  1PV4 A;  2ZTC A;  3U4V A;  5FLM G;  4GOP A;  4B3M L;  1PH1 A;  1FJG Q;  1Q46 A;  4JOI A;  1PH7 A;  2EXD A;  1FL0 A;  5C0X J;  1V1Q A;  4HJ7 A;  2VW9 A;  2WAQ G;  4A3D G;  5C0X G;  2V1C C;  1PH4 A;  4DK6 C;  2UXB L;  3EIV A;  2AMC B;  5IYD G;  1I94 L;  3HOV H;  5K36 G;  1JJC B;  3B6Y A;  2UXD L;  4PG3 A;  3TEH B;  1Y1V G;  4GLA C;  1HNZ Q;  4A93 H;  3OW2 A;  3G71 A;  1I5F A;  4A3F G;  2E2H H;  1Q1E A;  1UE7 A;  1IBL L;  2DGY A;  4HJ9 A;  1QVF A;  3D31 A;  3DLL A;  1IBM Q;  3F8T A;  1EOV A;  5M5Y H;  2D0O A;  5FJ8 G;  5FLM H;  2D62 A;  2OCE A;  2MO1 A;  4YHH Q;  5LMN Q;  4OWT B;  4JV5 Q;  2DUD A;  4BY1 H;  3CCL A;  4DR2 L;  1ASZ A;  1Y14 B;  4POG A;  1L0W A;  3PIP A;  2NVQ H;  3CMA A;  4O0A A;  3PF5 A;  2JJQ A;  4NB3 A;  5IYD H;  4JC0 A;  4B3T Q;  1CKN B;  1XNR Q;  5IE8 A;  4LWC A;  5ELO A;  1PH3 A;  2L15 A;  1QZH A;  4LNQ A;  1WJJ A;  2ATW A;  1G6P A;  5GQO A;  4JI7 L;  2IY5 B;  4DV3 L;  4PZ6 A;  3AYH B;  2F52 A;  4GNX C;  1VQI A;  4JI1 Q;  1B7Y B;  4B3S Q;  3H15 A;  4C3J H;  5LMN W;  3AQQ A;  4A3F H;  4GKK L;  2YTX A;  1NBW A;  3H3V H;  1OXX K;  1J5E Q;  1PYB A;  3PGZ A;  2PI2 A;  2K5H A;  3FKI G;  4DV2 Q;  3S16 H;  1O7I A;  3HFZ B;  3I2Z A;  2K52 A;  4BA1 I;  1YJW A;  2E2I H;  4AIM A;  1X3F A;  1VQ6 A;  1UEB A;  1HJP A;  3UDX A;  1VQE A;  2PQA B;  1A62 A;  5C0X I;  4JI6 Q;  1JT8 A;  3RR5 A;  1MKH A;  4R4I A;  3HKZ G;  4QY7 A;  3AFQ A;  1WOC A;  4QJF A;  3HOU G;  3STB C;  2N78 A;  4HIK A;  3RZO H;  2BA1 A;  2N3S A;  2IHE A;  4B3M Q;  2RHS B;  5ELN A;  3M85 A;  4JBJ A; 
#chains in the Genus database with same CATH topology
 1BCP B;  3L9A X;  5KGU A;  2KHJ A;  2CW0 C;  3RZD H;  1EIH A;  1I94 Q;  3H91 A;  2BH2 A;  2UXD Q;  2WB1 E;  2CQA A;  3NE5 B;  4I7A A;  3NQT A;  1EWI A;  3HOZ G;  2SEB D;  1L1O A;  4JI4 L;  1I4Q A;  3QO2 A;  1NNX A;  1ZXT A;  3LWE A;  1F2Z A;  1A6X A;  1X55 A;  1RDP D;  3QB3 A;  1D5X C;  1F2M A;  4U68 A;  1P16 A;  2O5J C;  1VQJ A;  1GHK A;  1X3P A;  3AB9 A;  5C4X G;  1VQA A;  3T1H L;  4PZ7 A;  1B9M A;  1CKN A;  1AE2 A;  1SRO A;  2L9H A;  2NB0 A;  1J9O A;  1STN A;  4CDE C;  2K05 A;  1XNR L;  2K7V A;  2CH4 W;  3W1G A;  3G48 A;  1LTG D;  2EDG A;  5A2Q E;  1S5F D;  4P2C B;  5M9O A;  4QF4 A;  1IBK L;  2FJ2 A;  1YIJ A;  1V1P B;  1X9N A;  3GTO B;  1ESF A;  4DV1 L;  1KXL A;  1YNJ C;  2K75 A;  2PCF B;  2F0P A;  1L0X B;  1X54 A;  5BN5 A;  3OIP A;  2HUG A;  1PMR A;  4UDU C;  3HP3 A;  5H1S E;  4BXX H;  1PFN A;  1VQB A;  1JOK A;  2AWO A;  2PW7 A;  3GTO H;  4POF A;  2ENB A;  5KNC A;  1RIP A;  4R8N A;  3CCJ A;  3ND9 A;  2CKZ B;  4DK3 C;  2JA7 H;  4G4K A;  2WIN B;  3NSW A;  1VQD A;  5IP7 H;  4QL5 A;  1YEZ A;  4JI4 Q;  2FFK B;  5F2D A;  3K0X A;  4QMG A;  2JYO A;  3BZD B;  2B2W C;  3I73 A;  1HNW L;  5EKL A;  1NUC A;  5C3E G;  1RL2 A;  4C3J G;  2ZXP A;  1BF4 A;  3NEN A;  2PMZ E;  3EJI A;  4KHV A;  1B3A A;  1IW7 C;  1PHJ A;  2PNH A;  3T1H Q;  5IY0 A;  2NZO A;  2MUY A;  4UY8 C;  2C35 B;  1HUN A;  2NN6 G;  4A3M B;  1PLF A;  1QG7 A;  4XQQ A;  3J7Y W;  2E5L L;  1IBK Q;  4RG1 A;  4LF5 L;  2TMP A;  3RLN A;  3OWE B;  5EBC A;  2OQ0 A;  3D8G A;  4EX5 A;  1IXR A;  4DV1 Q;  1JCK B;  1EOT A;  1AH9 A;  3LGJ A;  5LL6 X;  1XPR A;  1U5K A;  3ZYY X;  4DPG A;  1AP0 A;  3TSS A;  3K8A A;  3SEB A;  3WDN A;  4GOP C;  2K5N A;  4A3M H;  1M1K C;  5DNF A;  2EY2 A;  4JOI C;  2PZW A;  4L6T B;  2C5C A;  1VQ5 A;  1BOS A;  3PO3 B;  4DR6 L;  4NW2 A;  1LTA D;  2ID0 A;  2WB1 B;  4LFB L;  1D6E C;  1EEI D;  2KCT A;  4CDC C;  5DAU A;  1N36 L;  3KYH C;  3X3M A;  3HEJ A;  4HMI A;  1WVL A;  1NY4 A;  1PH8 A;  1LTS D;  4BY7 B;  4ZUJ A;  1HNW Q;  2B63 B;  3MVV A;  1FGB D;  4BBR B;  3R8B A;  4J1M A;  3G6E A;  3HOX G;  1NJI C;  5C44 G;  2WKC A;  1QVC A;  2SNM A;  3K6O A;  2CHB D;  2RDH A;  4FXK C;  4ZKC B;  1TWF B;  5ISR A;  3GTG B;  3HKZ E;  4BY7 H;  1OXT A;  1Y1W G;  4LUV A;  2B63 H;  2R92 H;  3SXH A;  4R4T A;  3NHH A;  2KHS A;  4JCV E;  5KRU A;  4BBR H;  4IPH A;  3J7Z C;  1D7Q A;  1TII D;  2E5L Q;  2B2T C;  4LF5 Q;  1EYA A;  4MNO A;  1EWC A;  1E2V A;  4FVM A;  4ODG A;  4FF1 A;  4R4O A;  3K7U C;  2NWG A;  4KLK A;  3TBI B;  4A3K G;  3GTG H;  4A3L H;  1D1K A;  4RWS C;  1ENA A;  5M3F G;  1Z47 A;  3I70 A;  4KHZ A;  3S2D H;  1XYI A;  2OXP A;  5DM6 3;  3PCO B;  4DA2 A;  1TS2 A;  1KDB A;  1CKO A;  5IP9 H;  2VQF L;  4DAY A;  2HDM A;  1VQL A;  4DR6 Q;  3BVG A;  4CJ2 C;  4DF7 A;  4DV4 L;  4LFB Q;  2D9U A;  2E74 C;  2XWB B;  1GHJ A;  2RF4 A;  3RNU A;  1ZYR C;  2K33 A;  2IX1 A;  1E2W A;  1IYJ B;  2YTY A;  1N36 Q;  3I72 A;  4JPB W;  5IGF A;  3SVM A;  2VY3 A;  2ASB A;  4OWX B;  4F87 A;  1ICW A;  2EY6 A;  4NXN L;  2PMZ B;  3GV3 A;  5C5M A;  3RLF A;  5L37 A;  3VR4 A;  5IIF A;  5EQ0 A;  1QB5 D;  1EY9 A;  3CQZ B;  3E3X A;  4C3I B;  3GTJ B;  2Q2H A;  2F4I A;  5DEH A;  3V96 A;  2NZH A;  4IFD H;  5IYC G;  4C56 C;  3KDF A;  2F0O A;  4ZCK A;  1D8L A;  3PIP 3;  4AYB G;  4WJ3 M;  3GP7 A;  3NTH A;  2E8G A;  2V4D A;  1EIY B;  2CW0 D;  4HSP A;  5ELC A;  3JC6 6;  1SLJ A;  4K0K L;  3CQZ H;  2QIL A;  3GTJ H;  5JEA G;  2R6G A;  2R93 B;  1P8L A;  2EPB A;  3P1H A;  1GKH A;  2WAQ E;  3SR1 A;  3BDC A;  4LF6 L;  1R4Q B;  5FLX E;  1X3Q A;  4X3T A;  4HAE A;  3TZU A;  4LF8 L;  2MNA A;  4IUP A;  3CRL C;  1PRT D;  3FRP B;  2AKW B;  1I6H B;  4KV6 A;  4OXP A;  2F0J A;  2Z1C A;  2I5M X;  2VQF Q;  4QUC A;  3KF6 B;  2CH4 A;  1HH2 P;  1WFQ A;  3R93 A;  3I4L A;  1CKM A;  4S3S A;  2EIF A;  5IGE A;  2JA8 G;  5FO8 B;  1LT5 D;  5KEE A;  2JE6 I;  1EY6 A;  2AQ3 B;  2CWA A;  4EQO A;  4DV5 L;  2GN5 A;  3I4M G;  2YU9 H;  1XNQ L;  5EGT A;  1Q90 A;  2X6G A;  4DU9 A;  4NXN Q;  2JSO A;  3S1Q B;  4IOC A;  3OPO A;  3F2U A;  3C46 A;  2EYH A;  1CHQ D;  4IOA A;  1YNJ D;  1G8Z D;  1SNP A;  1HPC A;  2RHQ B;  4RAU C;  1V43 A;  2K4K A;  2JQO A;  2MQH A;  1LT3 D;  2AUJ D;  3OSO A;  1Z6H A;  3SE0 A;  2MGS A;  5ELB A;  3S1Q H;  1TKW B;  2M2L A;  2E75 C;  2Q8T A;  5KIX A;  3P7J A;  1C7Y A;  4K0K Q;  4A3B G;  1HNZ L;  2R7Z G;  5C5L A;  4LF6 Q;  4A3E G;  1YHQ A;  1K83 B;  4KI0 A;  4F8M A;  3M4Y A;  4LF8 Q;  3KFU A;  1I3Q B;  1IBM L;  1FGU A;  1FNU A;  2O5I C;  3GTK H;  2EJG C;  3QJY A;  2JA5 B;  5LMN L;  2NTS A;  5C4H A;  1DOM A;  3ITP A;  1IW7 D;  1HZC A;  4ULL A;  4V0B A;  2PQE A;  1MJE A;  1K28 A;  4QUF A;  3VYS A;  5KND A;  4KK7 A;  1WYD A;  1K83 H;  4CBV A;  1PZK D;  4UP9 A;  2LXJ A;  4DV5 Q;  4UP7 A;  2K03 A;  1XNQ Q;  4BA2 I;  4R4C A;  2DNC A;  2AQ2 B;  1HA5 A;  2F0Q A;  3M4Q A;  2A74 C;  2G5D A;  3H0G H;  1MJC A;  4A93 G;  3HS0 C;  1STG A;  3PUX A;  3EQL C;  1WTV A;  3M7N A;  2BE5 D;  1HTL D;  2PYK A;  1E1O A;  4HIO A;  2B39 A;  4GOP A;  4B3M L;  4G7O C;  3SK8 A;  4C3H G;  3QG1 A;  5EKI A;  3V05 A;  5I2Y A;  4JOI A;  2EXD A;  1FL0 A;  4HJ7 A;  2VW9 A;  5C0X G;  2UXB L;  1RTO A;  3JAM E;  4RGM A;  2A6E C;  1JJC B;  3D4D A;  2B2V C;  2WAQ B;  1Y1V G;  4GLA C;  1HNZ Q;  1IYV A;  1SYD A;  5TSS A;  5BN4 A;  1A3T A;  2E2H H;  4X3S A;  1IBL L;  5C3W A;  4HJ9 A;  1QVF A;  3D31 A;  3DLL A;  1IBM Q;  1RKN A;  5M5Y H;  1LAB A;  5FJ8 G;  4A3F B;  3NBI A;  2K01 A;  5LMN Q;  4HCE A;  1PTO C;  3CCL A;  3OOC A;  1L0W A;  3PIP A;  3PF5 A;  2FMM A;  2JJQ A;  3TP7 A;  4JC0 A;  2E2I B;  1CKN B;  2LKV A;  5IE8 A;  4G7Z C;  1EYC A;  1QCB D;  4LNQ A;  1WJJ A;  1T5E A;  4OEL B;  3CU7 A;  1VQI A;  4KKT A;  1B7Y B;  1U4R A;  2OEO A;  4A3F H;  2QEJ C;  1TWA B;  2EXZ A;  1A15 A;  3NTK A;  3FKI G;  2B2T A;  1II3 A;  3HFZ B;  3K7A B;  3I2Z A;  2EOT A;  1Q8I A;  4BA1 I;  1YJW A;  2DNE A;  3A7A B;  3KF8 A;  2E2I H;  4AIM A;  5EPK A;  1UEB A;  3BDL A;  1CZG A;  4K2K A;  4OL7 A;  4CJ0 B;  4QJF A;  3MWY W;  3HOU G;  4A3G B;  2BA1 A;  4XT3 B;  4B3M Q;  3M85 A;  3VR3 A;  2IW3 A;  2O2L D;  3NWS A;  5DLQ E;  3H3V I;  1E1T A;  2UXB Q;  1C4Q A;  2ZTD A;  4XYO A;  2KCN A;  2Y0S G;  1B50 A;  4JVZ A;  1PYW D;  1G29 1;  2Z4I A;  3FP9 A;  1KAA A;  4DNT B;  4DAP A;  1T9H A;  4A3G H;  1HFN A;  3HKS A;  3M4P A;  3I91 A;  4B9X A;  3GTQ B;  2FHT A;  1IBL Q;  2Z6K C;  2F0U A;  5EPL A;  2NN6 I;  2L4N A;  2QGQ A;  4JI3 L;  1G51 A;  5FLX c;  2NYZ D;  1VQF A;  1VQK A;  1K8M A;  1X6O A;  1B2T A;  1WD1 A;  1X3G A;  4F7X A;  3I4N B;  1Q1B A;  3GTQ H;  1TWH H;  2K6A A;  3FDT A;  2Q2I A;  4FDB A;  5FKA C;  3OIQ A;  2AHO B;  3K5M A;  1CSP A;  3PUY A;  1LM0 A;  3CHB D;  3H09 A;  4XDX A;  1JB3 A;  3NQI A;  4YIJ A;  3J81 i;  3I4N H;  5JJZ A;  5IP7 G;  2PZU A;  1CFM A;  2Q8R E;  3R3O A;  2EQS A;  4LFC L;  2VUM B;  5HGQ A;  2IHF A;  3KOJ A;  1NAP A;  4PMB A;  5E3F A;  2EYF A;  4I65 A;  2JA6 H;  3S9W A;  3D4R A;  1QNU A;  4ALP A;  2A19 A;  4UHV A;  2VQE L;  2BH8 A;  4NMZ A;  2HCC A;  1K0R A;  4BY1 B;  2VUM H;  1E0B A;  4HJ8 A;  3ULL A;  3I56 A;  4OX9 L;  4QQB X;  4EGV A;  2K5Q A;  4M8A A;  1PVO A;  2B8F A;  2UXC L;  2RCF A;  5GAE C;  4JI8 L;  4JI3 Q;  3PO2 B;  1A2U A;  3DM1 A;  3CD6 A;  1CM9 A;  3W2D A;  2UU9 L;  1EZ8 A;  2NUC A;  1GUW A;  4A3M G;  1SMY D;  1OXV A;  1UUP A;  4JI0 L;  2NZ1 D;  1U9R A;  1D2B A;  3EFX D;  4A4I A;  1XTC D;  1KNA A;  1QIL A;  3W5O A;  5GAG C;  5K5P A;  1PA6 A;  3PO2 H;  1SJH D;  4YY3 L;  3TS2 A;  2F0S A;  3TP5 A;  3S1R B;  3DXJ C;  4ZRZ A;  4HIM A;  1J8I A;  1EQQ A;  4KMU C;  5J3B A;  4IO9 A;  4A3C G;  3JAM L;  1BCP C;  4LFC Q;  2IPK D;  3PO3 G;  2ICE C;  3HGB A;  2WB1 G;  1LV9 A;  4UPA A;  1LUZ A;  3MXN A;  1LAC A;  3S1R H;  2ZJR A;  4P71 A;  3MFY A;  1E2Z A;  1VQH A;  1ASY A;  3G4S A;  3U9O A;  2VXW A;  2VQE Q;  2F0E A;  4BY7 G;  3AMU A;  2R7F A;  2B63 G;  1N32 L;  5IYB H;  2A73 B;  4NXM L;  3PSI A;  4BBR G;  4LUZ A;  2HCI A;  2VZA A;  5EPJ A;  1SAP A;  4G7H C;  3JAM c;  2ZTE A;  4OX9 Q;  4N8X 1;  2UXC Q;  2M9V A;  4JI8 Q;  4A3L G;  1FYC A;  5CV7 A;  1A3V A;  1F2L A;  3NP8 A;  1M90 C;  2SDF A;  2UU9 Q;  4X6A H;  3N52 A;  2XVS A;  4JI0 Q;  1V9P A;  2XGT A;  1HNX L;  3CCM A;  1C8C A;  1CQF A;  5C3X A;  1XPU A;  5KNB A;  3K80 C;  3GV6 A;  1H9M A;  2RVL A;  2A6E D;  2F4V L;  4YY3 Q;  5M3M B;  4DR3 L;  1OTC A;  2B2V A;  2A68 C;  1V1O A;  1PH2 A;  5ELF A;  3HOW B;  1JJ2 A;  3FVQ A;  4IPD A;  1B44 D;  1PZJ D;  1PRT B;  1MSG A;  1OXU A;  3TZD A;  4YCU A;  4O2D A;  3Q24 A;  1HZB A;  4GZY C;  1MIU A;  4JBK A;  2JA7 B;  3TME A;  1F2Y A;  5E4W C;  2B2Y C;  2EJM A;  3MFG A;  3EBE A;  2WFW A;  2PZT A;  5M3M H;  3CC2 A;  1BR9 A;  2F0G A;  4KJN A;  4KKS A;  3HOW H;  1I4H A;  2KED A;  3DWP A;  5CV8 A;  3CCS A;  1AE3 A;  2LS0 1;  2Z8L A;  1O80 A;  4C1N I;  4KD3 A;  1N32 Q;  3MA2 B;  4DR7 L;  2R7D A;  3FMC A;  4NXM Q;  4X64 L;  4OIK A;  3S17 B;  3Q23 A;  1HZA A;  2B2U C;  1JQY D;  3PF4 A;  5BR8 L;  1GJX A;  4C3I G;  2Q2U A;  1YHA A;  2OT2 A;  1N34 L;  1TY0 A;  1XMO L;  2B3G A;  3I4O A;  1PH5 A;  3C3L A;  3CME A;  1SJE D;  4LK1 C;  1G2S A;  1SYG A;  4PMW A;  3NBH B;  4RHS A;  4KN4 C;  3S17 H;  1BVS A;  1HNX Q;  4FYD A;  3VR6 A;  1BBX C;  4HCS A;  1SYF A;  4YCV A;  2YTV A;  2F03 A;  2R93 G;  5D14 A;  5JEA J;  2QA4 A;  1NR2 A;  4GN4 B;  3GQB A;  5CV9 A;  3URY A;  2F4V Q;  3M7G A;  4IUN A;  1KDC A;  4DR3 Q;  5IT9 E;  3J7A 5;  3MXU A;  5M5X B;  2A1A A;  2SNS A;  2Z9H A;  3CC4 A;  1CHP D;  3UE0 A;  5I6Y A;  1XXG A;  1PTO F;  4TKO B;  2Z6K A;  3K59 A;  4A3D H;  4FNF A;  3HOY B;  3QR8 A;  3T56 B;  1B8A A;  3S14 B;  5K36 H;  3PIO A;  3DMU A;  3MEH A;  2HT1 A;  5GAD C;  1HFG A;  3S1N B;  5M5X H;  1PZI D;  3TRE A;  4J8Q A;  5I9O A;  4DR7 Q;  5J39 A;  4X64 Q;  4LF7 L;  1KAW A;  4Y7N B;  3HOY H;  3S14 H;  3PUV A;  1LTT D;  1X65 A;  4YWL A;  5BR8 Q;  2ZJQ A;  1DGS A;  1N34 Q;  2R92 B;  1XMO Q;  4N9P A;  1GUT A;  1U4M A;  3S1N H;  5JPM C;  3UDF A;  3K0Y A;  1ML0 D;  2MHV A;  4JI5 L;  1SYC A;  2G9D A;  4MTN A;  4C1N K;  4Y7N H;  1GUO A;  4KJO A;  2ZJP A;  4BWG B;  2DY8 A;  1Q7Y C;  1TWG B;  3S2D B;  2XWJ B;  3U58 A;  2L1B A;  1J6Q A;  4KTA A;  3QWN A;  4PQX A;  1YVC A;  1SFO B;  2B8G A;  5JJI A;  5E4X A;  3CPW A;  1N8R C;  2JA5 G;  1SYB A;  1QUQ A;  4CDD C;  3BDO A;  2ICI A;  1VQP A;  1TWG H;  1K3R A;  1WTR A;  1T5X D;  2X69 A;  3FPP A;  4I7Z C;  4R9W A;  4YCW A;  1SFO H;  1V8Q A;  3C2P A;  5G3L F;  3CF5 A;  2CCZ A;  1WCM B;  1RD9 D;  2L55 A;  2I5H A;  2EZV A;  3HOZ H;  4WFN 3;  1YNN C;  4X3U A;  5BN3 A;  1K8O A;  3SGI A;  1A2T A;  3IKJ A;  3G7L A;  3CC7 A;  1ENC A;  1NSN S;  1WI5 A;  2OWO A;  4OO1 I;  2F0F A;  4LF7 Q;  1JWM D;  2Q8I B;  3IL8 A;  4IJH A;  1GUG A;  4GNX A;  1AEX A;  3MC0 B;  2F0M A;  1WCM H;  3EN2 A;  1KAB A;  1MI2 A;  4XT1 B;  5A2Q L;  4JI5 Q;  3CCE A;  1BCP D;  3NWT A;  4GN5 A;  1PV4 A;  1EY8 A;  4HMJ A;  1SXT A;  3I8Z A;  2Z4H A;  1DJR D;  1Q46 A;  5C0X J;  2WAQ G;  4QB4 A;  2V1C C;  1PH4 A;  3EIV A;  2AMC B;  3N6R A;  3FEW X;  3U9S A;  2BOS A;  2J7Z A;  1I4G A;  1BXT A;  1I5F A;  4ILW A;  4A3F G;  1PDQ A;  1Q1E A;  1UE7 A;  1CTM A;  4O42 A;  2X6L A;  4C3J B;  1TR5 A;  2D62 A;  1TU2 B;  4OWT B;  4XQJ A;  4DR2 L;  4POG A;  1G2T A;  3S16 B;  2YU9 B;  1HUM A;  1RF2 D;  4NB3 A;  3X3N A;  1RCV D;  2L15 A;  2ZXO A;  4JI7 L;  4DV3 L;  5COY A;  1FR3 A;  2XSC A;  4C3J H;  5LMN W;  1FNW A;  4GKK L;  1V1P A;  3BG3 A;  1LT6 D;  3H3V H;  1OXX K;  3S16 H;  1O7I A;  4HSV A;  4DXF A;  1EQV A;  3E5S A;  1X3F A;  3OMC A;  1BCP F;  2A68 D;  4ABN A;  4EQN A;  3UDX A;  2PQA B;  1A62 A;  1JT8 A;  2P5Z X;  1TWC B;  2N78 A;  4HIK A;  1X32 A;  2NN6 H;  5IT9 L;  5ELN A;  3HKZ B;  3D6W A;  2WKD A;  1Q12 A;  2B2Y A;  3HG9 A;  1VQN A;  5I2X A;  1SEB D;  1LO5 D;  3GTK B;  1O78 A;  2KBN A;  4C2M B;  1Q81 C;  3G6J B;  5EBD A;  4O1N A;  4DV7 L;  1TWC H;  1LTB D;  1Z9F A;  4DR1 L;  4XIG S;  3HRZ C;  1G6Z A;  1WTX A;  2KA7 A;  5FO9 B;  1F9R A;  4FF3 A;  2B2U A;  4DR4 L;  2F3W A;  2BDO A;  2F1M A;  1CT1 D;  4DR2 Q;  5IT9 c;  4QIW E;  4OWW B;  3I4N G;  1VS0 A;  2B2W A;  4C2M H;  1C0A A;  1CK1 A;  3T51 B;  3CW2 C;  5EJW A;  5LMU L;  4UP8 A;  1Y8N B;  4JI7 Q;  3H0G B;  4DV3 Q;  2CQO A;  2HHH L;  1CA5 A;  3RLO A;  4DUZ L;  1HTP A;  4GKK Q;  4RKL A;  2XRS D;  2F0W A;  4RCO A;  5C44 H;  4L5T A;  5JAV A;  1UE1 A;  1PH9 A;  3CCR A;  5A35 A;  3C1F A;  2LY7 A;  1EL0 A;  2MJ8 A;  2BA0 A;  5C4J B;  1BQQ T;  1TVX A;  5IGD A;  1U4L A;  2EVB A;  4QGU A;  4GLX A;  2UUC L;  3SK4 A;  5NUC A;  2QKI C;  1VDZ A;  3TRZ A;  1BO0 A;  4DAM A;  1YHB A;  1QJO A;  1R4P B;  2F0K A;  4IPG A;  2E2H B;  3KLW A;  2AQ1 B;  4BY1 G;  3GTL B;  2ZM6 L;  5M5Y B;  5C4J H;  1FD7 D;  4DV7 Q;  2EY1 A;  4DR1 Q;  3S2H H;  1H9J A;  1YNX A;  1B9N A;  3E9I A;  1L1O B;  4DV0 L;  2A5H A;  5J22 A;  4DR4 Q;  3UI2 A;  3CAM A;  3TS0 A;  1AFP A;  3GTL H;  2L5T A;  5COR A;  5D3I B;  2YYZ A;  4P72 A;  1EY4 A;  3GTM B;  1VCI A;  4TQU S;  5LMU Q;  4A3J B;  4KD4 A;  2JXM B;  1XPO A;  5JJK A;  5ELD A;  4FF2 A;  3TP8 A;  3WOF A;  3H94 A;  4H13 C;  3QIA A;  2HHH Q;  1ET9 A;  4L5Q A;  4DUZ Q;  3J80 E;  3F2C A;  4UAI A;  4ME3 A;  1HXY D;  1S4Z A;  3CCQ A;  4IQZ A;  4IUQ A;  3GTM H;  4A3J H;  5IYB G;  1GXD C;  2HQL A;  3CP0 A;  3W1B A;  4EQ5 A;  1F9P A;  1QVG A;  1KC8 C;  2UUC Q;  2ALY B;  3EVQ A;  3UDI A;  2F0T A;  5JEA H;  1X3E A;  1Y69 U;  5FLX L;  1HR0 L;  4L8J A;  5HY6 A;  2ZM6 Q;  2L0C A;  3D4W A;  2HIX A;  3KLR A;  4XQN A;  1YNN D;  2WP8 J;  4LF9 L;  5D3D A;  1F9S A;  2FXQ A;  3L0O A;  2VNU D;  4LMQ D;  2F0N A;  5E7N A;  1WTW A;  2BCO A;  3U4Z A;  1SYE A;  1ZYR D;  2GA4 B;  2KEN A;  3C1E A;  1GOZ A;  1KDA A;  1JWS D;  4DV0 Q;  2R3Z A;  1KD1 C;  2IX0 A;  3IAY A;  2RDG A;  4QIW B;  1TWH B;  1W2B A;  1GM5 A;  1SNM A;  4H7B A;  1AZP A;  3ERQ A;  4K6L A;  5AJ3 L;  3F2B A;  1GO3 E;  4DNI A;  4OGQ C;  4TRD A;  4Y52 H;  2BDN A;  3CPF A;  5JPN C;  2RQX A;  5M3M G;  4BXX G;  1CQV A;  2E76 C;  1CSQ A;  4OHJ A;  3HOW G;  1L2F A;  3BVZ A;  2H4O A;  2RSO A;  2Y0S E;  1Q82 C;  1EEF D;  2JA6 B;  2XTI A;  4K8I A;  5FOB B;  1TQO A;  1UE5 A;  3IFT A;  3RN5 A;  2J0T D;  1B1Z A;  2OQK A;  2GVA A;  4IJL A;  2JA7 G;  1PXU A;  1U0L A;  2F3I A;  2A6H C;  4XXE A;  3KF6 A;  5E1F A;  2N8N A;  1IYU A;  3TQY A;  2IJ0 A;  2QW7 A;  1HRJ A;  1K8A C;  3E6Z X;  4A3B H;  2K5V A;  1I6V C;  1SN8 A;  1HR0 Q;  2R7Z H;  3QOL A;  1VQG A;  4A3E H;  4LF9 Q;  2K28 A;  5AFW A;  4A3I B;  4KKU A;  2JP1 A;  1GVP A;  4DV6 L;  4LF4 L;  3K5O A;  4U67 3;  5CV6 A;  4GN3 B;  1W6J A;  5M5W B;  2EY5 A;  4WRD A;  3K81 C;  2A69 C;  2ZXR A;  1K8G A;  3DWA A;  2MFI A;  1XMQ L;  3J81 E;  1W6K A;  4OEM B;  4A3I H;  2JEB I;  5AJ3 Q;  1H9S A;  3Q22 A;  2LSS A;  3L3O C;  1RJT A;  3PUW A;  5GRO A;  2PNR C;  4L5R C;  2Z6B A;  1O7Y A;  5M5W H;  2KHI A;  5CBA E;  1A8V A;  3HZX A;  1TT2 A;  1NMG A;  3FHW A;  3M9B A;  1STY A;  2UUA L;  4CKE A;  1MD2 D;  2TSS A;  4IUT A;  1SSO A;  4AQY L;  2UUB L;  3M3Y B;  3AFP A;  2QEX A;  4DUY L;  3HOY G;  3J7A V;  4C3H H;  1QUQ B;  4ME5 A;  3R2I A;  5JJL A;  5GAH C;  3NK9 A;  2VS1 A;  1UEA B;  4APV A;  3K58 A;  1JB7 A;  2F0V A;  3I3C A;  1Y1V H;  4DAY B;  3M3Y H;  1EY0 A;  5IOD A;  1MSH A;  1SE3 A;  4M1U B;  1ICF B;  3SK6 A;  4P74 A;  2FMC A;  2KVM A;  2K14 A;  5FJ8 H;  4DV6 Q;  4LF4 Q;  2R92 G;  3KLS X;  3FPU B;  5KYL A;  3A8I E;  4K5W A;  4GNX B;  2D2C C;  1X56 A;  3D6C A;  1WD0 A;  3A8J E;  4ZK9 B;  4X65 L;  1M8A A;  2AUK A;  3J80 L;  4DK1 A;  3ERS X;  2D0P A;  1XMQ Q;  1HHV A;  1QNK A;  1K3B C;  4X66 L;  1EWH A;  5T1G A;  3HOU B;  3BJU A;  1H9R A;  1FJG L;  3KDF B;  3FKI H;  1S3O A;  1SBB B;  2IX3 A;  4V19 0;  2DN8 A;  3GO5 A;  5IP9 G;  2KOL A;  3PQI A;  4NPS A;  2CVR A;  2NVT B;  3ONA B;  1HA6 A;  2UUA Q;  3J7A F;  2WII B;  2XIW A;  2Y0S B;  4KN7 C;  1W3S A;  1PRT C;  3QOJ A;  4AQY Q;  2UUB Q;  3HOU H;  3S1M B;  3MEF A;  4OO1 H;  2KJX A;  3J80 c;  1UWV A;  1I50 B;  4DUY Q;  2XN9 C;  2MO0 A;  1GUN A;  4JBW A;  1DYQ A;  4YHH L;  2K50 A;  1Z7T A;  1YJ9 A;  4DN4 M;  1WCM G;  2NVT H;  1WTP A;  3GD7 A;  2EJF C;  3EA6 A;  4KY5 A;  3MXP A;  4B3T L;  1PTO D;  3S1M H;  4RCN A;  1I50 H;  1O7L A;  2DJG C;  4MN3 A;  5JVG 3;  2QDL A;  4IFD G;  1DXM A;  4HJ5 A;  3UDG A;  4B3S L;  2G9H D;  4JI1 L;  1EYD A;  1EIF A;  4FXG C;  2N49 A;  3SK5 A;  3A7L A;  1J5E L;  2LMC B;  2NTT A;  2QDB A;  4GLV B;  4P75 A;  3MHB A;  1O7Z A;  3MTS A;  4X65 Q;  2VB2 X;  1YBY A;  3OHX C;  4DXG A;  4A75 A;  1VQO A;  4RGO S;  3HOV B;  1A3U A;  4K6D A;  3VA7 A;  3ERO A;  4JI6 L;  1STB A;  1EIG A;  3DEP A;  4CJ1 B;  4X66 Q;  3MXG A;  3U4V A;  1PH1 A;  1FJG Q;  1PH7 A;  3NXW A;  3BS1 A;  1HCZ A;  1BNZ A;  1UAP A;  1JR0 D;  5CC4 A;  4RGT A;  3A56 A;  4DK6 C;  3HOV H;  3CKI B;  2HQE A;  4A3D B;  3K5N A;  1ZEQ X;  2DGY A;  4TSS A;  1I4X A;  5FK9 C;  3F8T A;  4G57 A;  5FLM H;  2OCE A;  1JC7 A;  2MO1 A;  4YHH Q;  1L0Y B;  4RA8 A;  3CMA A;  2NBF A;  5IYD H;  4KY6 A;  4B3T Q;  1XNR Q;  4LWC A;  5J1Z A;  1QZH A;  1ONL A;  1G6P A;  2ATW A;  1JIC A;  2IY5 B;  4PZ6 A;  3AYH B;  2F52 A;  4B3S Q;  4JI1 Q;  3H15 A;  3J81 L;  1HQR D;  1SND A;  3RZO B;  5G3L D;  2PPB C;  1NBW A;  1J5E Q;  2PI2 A;  1KTK A;  1XX8 A;  2BE5 C;  3K5L A;  1DCZ A;  3BYY B;  4EQP A;  1VQ6 A;  2EYO A;  1ET6 A;  5C0X I;  4CKB A;  4JI6 Q;  3RR5 A;  1MKH A;  4R4I A;  3HKZ G;  4QY7 A;  3AFQ A;  2QF7 A;  4IUR A;  3STB C;  3RZO H;  2A6H D;  3VYT A;  2IHE A;  3LX0 A;  4BS9 A;  5IGC A;  1TS4 A;  2KEC A;  3I55 A;  4GOP B;  4IAL A;  3J81 c;  4GKJ L;  4BBS B;  1LT4 D;  2A8V A;  2EYP A;  1B3Q A;  4HID A;  1PFS A;  4A3C H;  1FVI A;  4PZ8 A;  1VMC A;  2K5D A;  2ZT9 C;  4E6I A;  5HUR A;  2JN4 A;  3PO3 H;  5LHY 1;  3Q8D A;  5DM7 3;  1BDO A;  4HJA A;  3HOZ B;  1CUK A;  1EU4 A;  3VA5 A;  1SE4 A;  3RN2 A;  1A63 A;  2HDL A;  3U50 C;  4BBS H;  5JVH 3;  1IZ6 A;  1SNC A;  2A69 D;  1B53 A;  1PH6 A;  1EY5 A;  4N9T A;  3D0F A;  3H0G G;  1MHW C;  3VYR A;  4XTC S;  3T1Y L;  1S72 A;  1HQM C;  3BYT B;  4KY7 A;  1OXS C;  3IFD A;  4Z9C B;  4L63 B;  5C4X B;  1Q8K A;  3GTP B;  2N55 A;  1STE A;  1NE3 A;  1Y8P B;  3R2T A;  3T16 A;  5CYU A;  2I5L X;  3A54 A;  2VL6 A;  1F9Q A;  1TWF H;  1JMC A;  1JE4 A;  4CGY B;  2KQ3 A;  1QOH A;  3L2P A;  4JBM A;  1XWE A;  5C4X H;  1TXY A;  3KF8 B;  1EQR A;  5I9P A;  5IWA L;  4X62 L;  3GTP H;  4ZLT F;  4B08 A;  3CXC A;  2L11 A;  1E3P A;  2JK8 A;  2MP1 A;  1YZ6 A;  3H6M A;  3NPP A;  3CRK C;  1AW7 A;  2EYJ A;  5ELE A;  2LFN A;  3ND8 A;  4LUO A;  1I4R A;  1YJN A;  2Q2T A;  5EKK A;  2B29 A;  1K0S A;  1NCV A;  1SNQ A;  4GKJ Q;  1LLR D;  3ULP A;  3KUP A;  1BBW A;  2AWN A;  1C9O A;  4YWM A;  1RHP A;  1H9K A;  4IUV A;  4H0L C;  4Q5V A;  3NEM A;  3I7F A;  2NVX B;  3OYY A;  1TY2 A;  3H3V C;  4ZUI A;  1TS3 A;  1IL8 A;  2RA4 A;  2K1B A;  5T1I A;  4L5S A;  3E0J A;  1N33 L;  4A3J G;  4JYA L;  2K5W A;  1EUJ A;  5C3E B;  4IUU A;  4H02 A;  3WWV A;  3DM3 A;  2K04 A;  3BZC A;  4LW1 A;  1VQ8 A;  3T1Y Q;  2EE1 A;  2NVX H;  1M4V A;  1BUV T;  3GDE A;  3O13 A;  4CKC A;  2OF1 A;  3A5Z B;  4R1J A;  1CI3 M;  4K14 A;  1KNE A;  2KUM A;  4C3I H;  1EFW A;  1NTG A;  5C3E H;  1ZKO A;  4AYB E;  5CGK A;  2VB3 X;  3ER0 A;  1LTL A;  5EAY A;  3SDZ A;  4F88 A;  3A5U A;  1G91 A;  1VQ7 A;  5IWA Q;  4DGZ A;  4X62 Q;  3RUZ A;  1KIX A;  3DUZ A;  3VR2 A;  5C6A A;  1WTO A;  4A3G G;  1VQC A;  3PMF A;  2NVY B;  1IHZ A;  3Q0A A;  4KHP L;  2E2D C;  1HZ9 A;  1OO9 B;  2R93 H;  2KCM A;  3DEO A;  4DV4 Q;  1DOL A;  4A76 A;  1DZ1 A;  1GD7 A;  5CR3 A;  1CA6 A;  3SHL A;  1I6H H;  1KL9 A;  2RBM A;  2DY7 A;  3LNN A;  3OTO L;  3WOE A;  4ZQ3 A;  2NVY H;  1QWY A;  3AEV A;  2R61 A;  1VMP A;  1VF5 C;  1JOR A;  1SDF A;  2N88 A;  1B4O A;  1KRS A;  4FO2 A;  1ENF A;  2Z0S A;  1N33 Q;  2M00 A;  4JYA Q;  4R4Q A;  4B9W A;  2F0L A;  3NBH A;  4B3R L;  1EZ6 A;  1SMY C;  3TDQ A;  2EYM A;  1SRU A;  1H9S B;  1KHI A;  1N9W A;  4RKB A;  3HOX B;  5CBE E;  5C44 B;  1KLG D;  5I4D A;  3S24 A;  4MIU A;  2MPM A;  2IWH A;  4PV1 C;  1Y1W B;  3KJO A;  2GVB A;  4RGN A;  2JA6 G;  1PRT F;  1IL2 A;  1UE6 A;  1EU3 A;  4FXD A;  3L7Z C;  3HOX H;  1D5Z C;  3KBG A;  1S5B D;  5IGB A;  1DD2 A;  1PFM A;  5C4Z A;  1XTD A;  2VUM G;  2OTJ A;  4K8J A;  4A3K B;  3ULJ A;  1UNS A;  4K5X A;  4CHT B;  4KHP Q;  2PW5 A;  1Y1W H;  1EYG A;  5IOC A;  5M3F B;  3S15 B;  1S5D D;  3S2H B;  3D3R A;  1VQ4 A;  3JAM i;  1S5E D;  5JOB A;  2IT1 A;  1I3Q H;  4A3I G;  1U4P A;  2EYL A;  4HR7 B;  4ZKB B;  4MZ9 A;  3MXN B;  3AU7 A;  4LAA A;  3KJP A;  4PMC A;  2JA5 H;  1L1O C;  3KBX A;  2F0I A;  4A3K H;  3ICE A;  3CCU A;  1XJV A;  3OTO Q;  3A74 A;  1B70 B;  5M3F H;  3S15 H;  4HTH A;  5LL6 S;  1FNV A;  1STA A;  2PI2 E;  4J15 A;  4RFB A;  1HR0 W;  2LXK A;  4EVO A;  4LFA L;  4TVA B;  4B3R Q;  3PO2 G;  3J80 i;  2F3V A;  3STB D;  4NKL A;  3E9H A;  1E24 A;  2KCC A;  3MAQ A;  2JA9 A;  1YI2 A;  1WTH A;  4RMF A;  1KRT A;  4OIJ A;  2OTL A;  1JJG A;  1ESR A;  4AYB B;  2I07 B;  1BBU A;  1S5C D;  3F1Z A;  2H5X A;  1CZW A;  4RH6 A;  1K73 C;  5CV4 A;  3NUC A;  4PNY A;  2RDF A;  5IGG A;  1K9M C;  3E0E A;  3A8K E;  4IFD I;  5IYC H;  2O4X A;  1PFB A;  4AH6 A;  4MHE A;  1VQM A;  2RSN A;  2YV5 A;  4GS3 A;  2XRQ D;  1STH A;  2JEA I;  1SR3 A;  3T53 B;  5KYI A;  1VF7 A;  1LTR D;  4DK0 A;  1PTO B;  3W3A A;  4DR5 L;  1GUS A;  3A0J A;  4JW0 A;  4N8F A;  3NTI A;  3J81 j;  2JA8 B;  2F0H A;  1D1I A;  1AN8 A;  4IZ8 A;  3CCV A;  2E2J B;  2HD3 A;  2RKS A;  4JI2 L;  1DOK A;  3IRB A;  5FO7 B;  3I4M B;  3M4O B;  1IKM A;  3DWQ A;  4DNR B;  3MZ5 A;  4R8I A;  3F2D A;  4DKA C;  3KK7 A;  1PTO H;  1BKB A;  1NMF A;  4LFA Q;  4OO1 G;  1DM0 B;  1JOO A;  2XNA C;  3BU2 A;  1TWA H;  3A55 A;  4K2L A;  2D5D A;  3OW7 A;  2JA8 H;  1MBY A;  1H95 A;  4WOR A;  4P73 A;  3T13 A;  1E22 A;  3K7A H;  4MTK A;  3RD4 A;  2DJF C;  2K32 A;  1EFI D;  2KEE A;  2E2J H;  1SE8 A;  2CFM A;  3LWU A;  4H44 C;  3NEL A;  3I4M H;  3M4O H;  2L12 A;  1KLU D;  2QCP X;  4WJ4 A;  5D65 A;  3OMG A;  1Q86 C;  4IPC A;  3RMH A;  3UE1 A;  3ZJY C;  3VDY A;  4NP5 A;  3I90 A;  4A3B B;  2R7Z B;  4A3E B;  3OWF A;  1VQ9 A;  1PYS B;  1RTN A;  4JV5 L;  4HED A;  1Q3L A;  4X3K A;  4WJW A;  3V2T A;  2CWP A;  2F0D A;  1SMX A;  4YWK A;  4JG2 A;  1E7Z A;  4DFA A;  1A0I A;  1QZG A;  1JOQ A;  1LYL A;  1EQT A;  4IFD J;  1JE5 A;  1QE6 A;  4DR5 Q;  1R9T B;  1EY7 A;  2ES2 A;  4OON A;  1IKL A;  2I0Q A;  2C9O A;  3PV0 A;  3HOV G;  1ILQ A;  4JI2 Q;  4DV2 L;  2WAC A;  4HN7 A;  1KQS A;  2PQA A;  4J6H A;  1ROD A;  1C48 A;  3BZK A;  2SOB A;  1YIT A;  1R9T H;  1Y8O B;  4ZAI A;  1DON A;  1MGS A;  2HIV A;  2J4X A;  2RCN A;  4A93 B;  3PUZ A;  4NDX A;  1S40 A;  2ZTC A;  5FLM G;  3TN2 A;  3T4A C;  1TS5 A;  3TP6 A;  1V1Q A;  1SNO A;  4A3D G;  1NR4 A;  3KLS A;  1WTQ A;  4C3H B;  5IYD G;  5K36 G;  1I94 L;  3B6Y A;  3Q6S A;  2UXD L;  2NVQ B;  4PG3 A;  3TEH B;  5I6W A;  4IN3 A;  2FIN B;  4JK1 C;  4A93 H;  3DHQ A;  3OW2 A;  4QCL A;  3G71 A;  4CDF C;  2WV6 D;  1Y1V B;  3VYU A;  2IL8 A;  4ZYS A;  1EOV A;  1SE2 A;  2D0O A;  3P75 A;  1D5M C;  4JV5 Q;  2DUD A;  4BY1 H;  5CMD A;  1ASZ A;  1Y14 B;  4Q0F A;  2NVQ H;  1AZQ A;  4O0A A;  5C0X H;  5CV5 A;  5HGT A;  2H1E A;  3PIO 3;  3K57 A;  3BVM A;  3VR5 A;  5ELO A;  1PH3 A;  4FF4 A;  1I4P A;  5GQO A;  4ID6 A;  4GNX C;  3AQQ A;  3P20 A;  4XYQ A;  2YTX A;  1PYB A;  3PGZ A;  2K5H A;  4DV2 Q;  4K5V A;  2K52 A;  4DAV A;  3RZD B;  2PO4 A;  1LTI D;  1ILP A;  3FKI B;  1HJP A;  1VQE A;  4FP5 D;  1F77 A;  1JWU D;  2I46 A;  1WOC A;  4RHR A;  2N3S A;  2RHS B;  4BBS G;  4LJZ C;  4JBJ A; 
#chains in the Genus database with same CATH homology
 3I55 A;  4GOP B;  2KHJ A;  3RZD H;  1Q12 A;  3J81 c;  5DLQ E;  3H3V I;  4GKJ L;  1E1T A;  2UXB Q;  1VQN A;  1I94 Q;  2A8V A;  2ZTD A;  2Y0S G;  2BH2 A;  2UXD Q;  2KBN A;  2WB1 E;  1Q81 C;  1G29 1;  4DV7 L;  1TWC H;  1PFS A;  1Z9F A;  3FP9 A;  4HID A;  4DR1 L;  4A3C H;  1EWI A;  1FVI A;  4PZ8 A;  4XIG S;  3HOZ G;  1T9H A;  1L1O A;  4A3G H;  3HKS A;  3M4P A;  4JI4 L;  3PO3 H;  1IBL Q;  3Q8D A;  2Z6K C;  4HJA A;  1CUK A;  2NN6 I;  1X55 A;  4DR4 L;  3RN2 A;  1A63 A;  3U50 C;  2QGQ A;  4BBS H;  1P16 A;  4DR2 Q;  5IT9 c;  1IZ6 A;  4QIW E;  4OWW B;  1VS0 A;  3I4N G;  1VQJ A;  4C2M H;  4JI3 L;  1C0A A;  1G51 A;  5FLX c;  1PH6 A;  3CW2 C;  1VQF A;  1VQK A;  5C4X G;  1X6O A;  5LMU L;  1VQA A;  3D0F A;  3H0G G;  3T1H L;  1X3G A;  4PZ7 A;  4UP8 A;  4XTC S;  1CKN A;  3T1Y L;  1S72 A;  1AE2 A;  1SRO A;  1Q1B A;  1OXS C;  3GTQ H;  1TWH H;  4JI7 Q;  1Q8K A;  2Q2I A;  4DV3 Q;  2CQO A;  4FDB A;  2HHH L;  1XNR L;  3RLO A;  3W1G A;  3G48 A;  2AHO B;  4DUZ L;  1NE3 A;  4GKK Q;  1CSP A;  2I5L X;  3PUY A;  1IBK L;  2VL6 A;  1LM0 A;  1YIJ A;  1TWF H;  1JMC A;  5C44 H;  1X9N A;  4L5T A;  4DV1 L;  1KXL A;  3J81 i;  1UE1 A;  1PH9 A;  3I4N H;  2K75 A;  5IP7 G;  3CCR A;  3L2P A;  1X54 A;  5IWA L;  5C4X H;  1TXY A;  3KF8 B;  1EQR A;  2BA0 A;  4JBM A;  4X62 L;  3GTP H;  2EQS A;  3CXC A;  4LFC L;  1E3P A;  5HGQ A;  2JK8 A;  2IHF A;  3KOJ A;  4QGU A;  4GLX A;  1YZ6 A;  2UUC L;  5H1S E;  4BXX H;  4LUO A;  1VQB A;  1YJN A;  2AWO A;  2Q2T A;  2JA6 H;  3TRZ A;  4DAM A;  3CD6 A;  1YHB A;  3GTO H;  4IPG A;  2B29 A;  3KLW A;  4POF A;  4BY1 G;  4GKJ Q;  4ALP A;  1RIP A;  3ULP A;  2A19 A;  1BBW A;  2AWN A;  2ZM6 L;  1C9O A;  4YWM A;  3CCJ A;  2VQE L;  2CKZ B;  2BH8 A;  5C4J H;  4DV7 Q;  1K0R A;  4DR1 Q;  2VUM H;  3S2H H;  4DK3 C;  2JA7 H;  3NEM A;  5IP7 H;  1YNX A;  1VQD A;  4QL5 A;  1YEZ A;  4JI4 Q;  3I7F A;  4HJ8 A;  3OYY A;  3ULL A;  3K0X A;  1HNW L;  3E9I A;  1L1O B;  5C3E G;  4DV0 L;  1RL2 A;  3I56 A;  4OX9 L;  4QQB X;  4DR4 Q;  1PVO A;  3NEN A;  4L5S A;  2PMZ E;  3CAM A;  3TS0 A;  1N33 L;  4A3J G;  2UXC L;  3GTL H;  4JYA L;  5GAE C;  4JI8 L;  1EUJ A;  2YYZ A;  4JI3 Q;  4H02 A;  4P72 A;  3WWV A;  1VCI A;  3DM3 A;  4TQU S;  5LMU Q;  2PNH A;  3BZC A;  4LW1 A;  5IY0 A;  2NZO A;  3T1H Q;  1PHJ A;  1VQ8 A;  3T1Y Q;  2UU9 L;  4A3M G;  1XPO A;  2NVX H;  5JJK A;  1OXV A;  3GDE A;  4UY8 C;  4JI0 L;  2HHH Q;  2C35 B;  3A5Z B;  2NN6 G;  4L5Q A;  3F2C A;  4R1J A;  4A4I A;  4DUZ Q;  4C3I H;  1EFW A;  4ME3 A;  2E5L L;  1IBK Q;  4RG1 A;  1NTG A;  4LF5 L;  5C3E H;  3W5O A;  3RLN A;  5GAG C;  3CCQ A;  1PA6 A;  4AYB E;  2OQ0 A;  3ER0 A;  4EX5 A;  1IXR A;  3GTM H;  4YY3 L;  3PO2 H;  4A3J H;  3TS2 A;  4DV1 Q;  4HIM A;  1AH9 A;  1LTL A;  5EAY A;  3LGJ A;  1EQQ A;  5IYB G;  5J3B A;  1XPR A;  2HQL A;  1U5K A;  3A5U A;  4DPG A;  4IO9 A;  3CP0 A;  1VQ7 A;  5IWA Q;  4A3C G;  3K8A A;  3W1B A;  4X62 Q;  1KIX A;  4LFC Q;  4GOP C;  4A3G G;  1VQC A;  2K5N A;  4A3M H;  4EQ5 A;  1M1K C;  3PO3 G;  1KC8 C;  1QVG A;  4JOI C;  2UUC Q;  4KHP L;  1HZ9 A;  2ALY B;  3UDI A;  2R93 H;  2WB1 G;  2KCM A;  4DV4 Q;  4UPA A;  1VQ5 A;  1LUZ A;  4A76 A;  1GD7 A;  4DR6 L;  3S1R H;  2ZJR A;  1X3E A;  4P71 A;  2ID0 A;  1VQH A;  1HR0 L;  4LFB L;  5HY6 A;  1I6H H;  1ASY A;  3G4S A;  2ZM6 Q;  1KL9 A;  2HIX A;  2VQE Q;  2WP8 J;  4LF9 L;  4BY7 G;  2KCT A;  2R7F A;  2FXQ A;  3L0O A;  2B63 G;  1N36 L;  1N32 L;  5IYB H;  2VNU D;  3KYH C;  3OTO L;  5E7N A;  2NVY H;  3U4Z A;  4NXM L;  3PSI A;  4BBR G;  4LUZ A;  1NY4 A;  1PH8 A;  2KEN A;  2VZA A;  3AEV A;  1HNW Q;  4DV0 Q;  1KD1 C;  3JAM c;  2ZTE A;  4OX9 Q;  2IX0 A;  1KRS A;  2Z0S A;  1N33 Q;  2UXC Q;  1W2B A;  1GM5 A;  4R4Q A;  4JYA Q;  4JI8 Q;  3G6E A;  3HOX G;  4A3L G;  1NJI C;  5C44 G;  4B3R L;  1QVC A;  1M90 C;  1SRU A;  1KHI A;  5AJ3 L;  1N9W A;  2UU9 Q;  3F2B A;  1GO3 E;  4X6A H;  4DNI A;  4Y52 H;  3HKZ E;  4BY7 H;  1OXT A;  1V9P A;  2XGT A;  4LUV A;  1Y1W G;  1HNX L;  4JI0 Q;  2B63 H;  3CPF A;  3S24 A;  2R92 H;  3CCM A;  4R4T A;  4JCV E;  4BBR H;  4IPH A;  3J7Z C;  1D7Q A;  5M3M G;  2E5L Q;  4BXX G;  4LF5 Q;  1XPU A;  1CSQ A;  2GVB A;  3K80 C;  4MNO A;  3KJO A;  2JA6 G;  3HOW G;  4R4O A;  1IL2 A;  3K7U C;  2F4V L;  1L2F A;  1UE6 A;  4YY3 Q;  4DR3 L;  4KLK A;  3L7Z C;  2Y0S E;  4A3K G;  1Q82 C;  1OTC A;  3GTG H;  3HOX H;  4A3L H;  1PH2 A;  2XTI A;  1JJ2 A;  1UE5 A;  3RN5 A;  1XTD A;  5M3F G;  4IPD A;  1Z47 A;  2OQK A;  2GVA A;  4IJL A;  4KHZ A;  2JA7 G;  2VUM G;  1U0L A;  3S2D H;  2OTJ A;  2F3I A;  1OXU A;  3ULJ A;  3PCO B;  4YCU A;  4O2D A;  1HZB A;  3KF6 A;  1Y1W H;  1EYG A;  4KHP Q;  1CKO A;  2N8N A;  1MIU A;  5IP9 H;  2VQF L;  4JBK A;  3TQY A;  1VQ4 A;  3JAM i;  3EBE A;  1VQL A;  2IT1 A;  2WFW A;  5M3M H;  1K8A C;  3CC2 A;  2K5V A;  1I3Q H;  4A3I G;  4A3B H;  4DR6 Q;  4DV4 L;  4LFB Q;  1SN8 A;  1HR0 Q;  2R7Z H;  4MZ9 A;  3MXN B;  3HOW H;  3RNU A;  2RF4 A;  1VQG A;  3KJP A;  3CCS A;  4A3E H;  1AE3 A;  2IX1 A;  4LF9 Q;  2JA5 H;  1IYJ B;  1L1O C;  4A3K H;  3ICE A;  2YTY A;  1N36 Q;  1GVP A;  1N32 Q;  4BBS G;  3CCU A;  1XJV A;  2R7D A;  3OTO Q;  4DR7 L;  3A74 A;  1B70 B;  2VY3 A;  4X64 L;  4NXM Q;  4DV6 L;  5M3F H;  4OWX B;  4LF4 L;  2ASB A;  3S15 H;  1HZA A;  3PF4 A;  4NXN L;  5BR8 L;  4GN3 B;  3RLF A;  2Q2U A;  1YHA A;  2PI2 E;  4J15 A;  1N34 L;  1HR0 W;  2LXK A;  3K81 C;  1XMO L;  2B3G A;  3I4O A;  1PH5 A;  3CME A;  1K8G A;  4LFA L;  4TVA B;  4B3R Q;  2MFI A;  1XMQ L;  3PO2 G;  2Q2H A;  3J80 i;  4A3I H;  2JEB I;  2NZH A;  5AJ3 Q;  5IYC G;  2LSS A;  4PMW A;  3NBH B;  3STB D;  3E9H A;  1E24 A;  3KDF A;  3S17 H;  1D8L A;  1BVS A;  1HNX Q;  4AYB G;  4WJ3 M;  3PUW A;  5GRO A;  4L5R C;  4YCV A;  2E8G A;  2JA9 A;  2YTV A;  1YI2 A;  1EIY B;  5M5W H;  2KHI A;  4RMF A;  1KRT A;  2OTL A;  1A8V A;  1JJG A;  2R93 G;  1NMG A;  3FHW A;  3JC6 6;  1SLJ A;  3M9B A;  5JEA J;  2QA4 A;  3CQZ H;  2UUA L;  4K0K L;  4GN4 B;  3GTJ H;  1BBU A;  5JEA G;  2F4V Q;  3F1Z A;  2H5X A;  2R6G A;  4DR3 Q;  1P8L A;  4AQY L;  1K73 C;  2UUB L;  1GKH A;  2WAQ E;  4LF6 L;  3J7A 5;  3AFP A;  2QEX A;  4LF8 L;  2MNA A;  4DUY L;  2A1A A;  3E0E A;  1K9M C;  3HOY G;  3CC4 A;  4IFD I;  4C3H H;  3UE0 A;  5IYC H;  1QUQ B;  2AKW B;  4OXP A;  4AH6 A;  2Z6K A;  1VQM A;  5JJL A;  2YV5 A;  5GAH C;  2I5M X;  2VS1 A;  4GS3 A;  4APV A;  4A3D H;  2VQF Q;  1JB7 A;  1B8A A;  2JEA I;  3PIO A;  1SR3 A;  2HT1 A;  3KF6 B;  5GAD C;  1HH2 P;  1WFQ A;  1Y1V H;  1CKM A;  4DAY B;  2EIF A;  2JA8 G;  3M3Y H;  5M5X H;  4DR5 L;  2JE6 I;  3A0J A;  3TRE A;  2CWA A;  3J81 j;  4DR7 Q;  4DV5 L;  2GN5 A;  4P74 A;  3I4M G;  4X64 Q;  2K14 A;  5FJ8 H;  3CCV A;  4DV6 Q;  1KAW A;  2YU9 H;  4LF4 Q;  4LF7 L;  1XNQ L;  2R92 G;  3HOY H;  3S14 H;  3PUV A;  4NXN Q;  1X65 A;  4YWL A;  5BR8 Q;  4JI2 L;  2ZJQ A;  4GNX B;  1DGS A;  3IRB A;  1X56 A;  4IOC A;  1N34 Q;  3F2D A;  4X65 L;  4DKA C;  1XMO Q;  1BKB A;  3S1N H;  4IOA A;  1NMF A;  2D0P A;  3ERS X;  4LFA Q;  3UDF A;  4OO1 G;  1XMQ Q;  2RHQ B;  3BU2 A;  1TWA H;  1V43 A;  4JI5 L;  2K4K A;  2JA8 H;  4X66 L;  1H95 A;  2JQO A;  2MQH A;  3BJU A;  4P73 A;  1E22 A;  3K7A H;  4MTN A;  4Y7N H;  2ZJP A;  2E2J H;  1FJG L;  1SE8 A;  2CFM A;  3NEL A;  3KDF B;  3S1Q H;  3FKI H;  1S3O A;  1Q7Y C;  3I4M H;  3M4O H;  3GO5 A;  5IP9 G;  4WJ4 A;  4NPS A;  3U58 A;  1C7Y A;  2UUA Q;  4K0K Q;  1J6Q A;  1Q86 C;  4IPC A;  3UE1 A;  3ZJY C;  1YVC A;  4A3B G;  1W3S A;  5JJI A;  3CPW A;  1HNZ L;  3VDY A;  4AQY Q;  2UUB Q;  2R7Z G;  3HOU H;  1N8R C;  3MEF A;  4LF6 Q;  4A3E G;  3J80 c;  1UWV A;  1YHQ A;  2JA5 G;  4KI0 A;  4DUY Q;  4LF8 Q;  3KFU A;  2MO0 A;  1QUQ A;  1IBM L;  1FGU A;  3GTK H;  4JBW A;  1VQ9 A;  1PYS B;  1VQP A;  1TWG H;  4YHH L;  5LMN L;  2K50 A;  1K3R A;  4JV5 L;  1YJ9 A;  2NVT H;  1WCM G;  3GD7 A;  1HZC A;  1MJE A;  1SFO H;  4YCW A;  2CWP A;  1SMX A;  4B3T L;  4YWK A;  4JG2 A;  1E7Z A;  3CF5 A;  1A0I A;  2I5H A;  1QZG A;  2CCZ A;  3S1M H;  3HOZ H;  1LYL A;  4IFD J;  1WYD A;  1K83 H;  1I50 H;  1JE5 A;  4DR5 Q;  4UP9 A;  2LXJ A;  4IFD G;  3SGI A;  4HJ5 A;  3CC7 A;  3UDG A;  2ES2 A;  4B3S L;  4JI1 L;  4DV5 Q;  1WI5 A;  2OWO A;  4OO1 I;  4OON A;  4UP7 A;  2I0Q A;  1EIF A;  4LF7 Q;  1XNQ Q;  4R4C A;  4BA2 I;  3PV0 A;  2N49 A;  4IJH A;  1J5E L;  3HOV G;  4GLV B;  4JI2 Q;  4DV2 L;  4P75 A;  1KQS A;  4GNX A;  3M4Q A;  2PQA A;  3H0G H;  1WCM H;  3EN2 A;  4X65 Q;  1MJC A;  4A93 G;  1YBY A;  4A75 A;  3BZK A;  1VQO A;  1YIT A;  3PUX A;  1R9T H;  4JI6 L;  3M7N A;  2HIV A;  4JI5 Q;  3CCE A;  2RCN A;  4GN5 A;  3PUZ A;  4X66 Q;  4HIO A;  1E1O A;  1S40 A;  1PV4 A;  2ZTC A;  3U4V A;  5FLM G;  4GOP A;  4B3M L;  1PH1 A;  1FJG Q;  1Q46 A;  4JOI A;  1PH7 A;  2EXD A;  1FL0 A;  5C0X J;  1V1Q A;  4HJ7 A;  2VW9 A;  2WAQ G;  4A3D G;  5C0X G;  2V1C C;  1PH4 A;  4DK6 C;  2UXB L;  3EIV A;  2AMC B;  5IYD G;  1I94 L;  3HOV H;  5K36 G;  1JJC B;  3B6Y A;  2UXD L;  4PG3 A;  3TEH B;  1Y1V G;  4GLA C;  1HNZ Q;  4A93 H;  3OW2 A;  3G71 A;  1I5F A;  4A3F G;  2E2H H;  1Q1E A;  1UE7 A;  1IBL L;  2DGY A;  4HJ9 A;  1QVF A;  3D31 A;  3DLL A;  1IBM Q;  3F8T A;  1EOV A;  5M5Y H;  2D0O A;  5FJ8 G;  5FLM H;  2D62 A;  2OCE A;  2MO1 A;  4YHH Q;  5LMN Q;  4OWT B;  4JV5 Q;  2DUD A;  4BY1 H;  3CCL A;  4DR2 L;  1ASZ A;  1Y14 B;  4POG A;  1L0W A;  3PIP A;  2NVQ H;  3CMA A;  4O0A A;  3PF5 A;  2JJQ A;  4NB3 A;  5IYD H;  4JC0 A;  4B3T Q;  1CKN B;  1XNR Q;  5IE8 A;  4LWC A;  5ELO A;  1PH3 A;  2L15 A;  1QZH A;  4LNQ A;  1WJJ A;  2ATW A;  1G6P A;  5GQO A;  4JI7 L;  2IY5 B;  4DV3 L;  4PZ6 A;  3AYH B;  2F52 A;  4GNX C;  1VQI A;  4JI1 Q;  1B7Y B;  4B3S Q;  3H15 A;  4C3J H;  5LMN W;  3AQQ A;  4A3F H;  4GKK L;  2YTX A;  1NBW A;  3H3V H;  1OXX K;  1J5E Q;  1PYB A;  3PGZ A;  2PI2 A;  2K5H A;  3FKI G;  4DV2 Q;  3S16 H;  1O7I A;  3HFZ B;  3I2Z A;  2K52 A;  4BA1 I;  1YJW A;  2E2I H;  4AIM A;  1X3F A;  1VQ6 A;  1UEB A;  1HJP A;  3UDX A;  1VQE A;  2PQA B;  1A62 A;  5C0X I;  4JI6 Q;  1JT8 A;  3RR5 A;  1MKH A;  4R4I A;  3HKZ G;  4QY7 A;  3AFQ A;  1WOC A;  4QJF A;  3HOU G;  3STB C;  2N78 A;  4HIK A;  3RZO H;  2BA1 A;  2N3S A;  2IHE A;  4B3M Q;  2RHS B;  5ELN A;  3M85 A;  4JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...