2EY6A

Crystal structure of staphylococcal nuclease mutant t41v
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDVPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey6A00
3C1FA 1SNDA 5IODA 4HTHA 5E1FA 5EKLA 1SYGA 2F0KA 2PZUA 1A3VA 4K5VA 4F7XA 3TP5A 4DGZA 4ZQ3A 1NSNS 5C4HA 1ENCA 1STYA 2EYFA 5J1ZA 5EKKA 2PW5A 1SNCA 2PZWA 5I9OA 1SNPA 2F0OA 2F0IA 4J6HA 4K6DA 4KV6A 3NXWA 4KY6A 5C5LA 4E6IA 2SOBA 5J39A 1KABA 2F0UA 4G57A 3SK8A 5KGUA 2OXPA 2EY5A 5IGCA 2NUCA 3MHBA 4KY7A 2ENBA 2EYOA 2F0GA 4NDXA 2RDFA 4ZUIA 2EYHA 5C4ZA 5I6WA 5C5MA 5I6YA 4TRDA 5EGTA 1F2YA 3D6CA 3DHQA 3EROA 5JOBA 4ME5A 2F0HA 4K2LA 3SK5A 2OEOA 3U9OA 4F8MA 1SYBA 2F0WA 2PZTA 5C3XA 5IOCA 5IGBA 4KTAA 2F0EA 4EQNA 2OF1A 3HZXA 4KHVA 1SNQA 4N9PA 2F0MA 1IHZA 1A3TA 1KDAA 3QOJA 4LAAA 4B9WA 1AEXA 1SYFA 3NUCA 3RUZA 1KAAA 4EVOA 3TP8A 2EYJA 1TQOA 4KJOA 3HEJA 5M9OA 5KEEA 4IUNA 2RBMA 2SNMA 4NMZA 3S9WA 3BDCA 4K8IA 3TMEA 2F0DA 3H6MA 3P1HA 5KRUA 2EXZA 4K14A 3OMCA 5KYLA 1STNA 4HMJA 1EY7A 4K5WA 4KD3A 1KDCA 2EYLA 2LKVA 5CV4A 5HURA 4H7BA 4K5XA 4YIJA 3SK4A 3LX0A 4RKBA 1EY5A 1SYDA 2F0NA 2O4XA 3D4DA 4PMBA 3NK9A 4RKLA 1STGA 1TR5A 3MXPA 4K8JA 3QOLA 3C1EA 1SYEA 2PYKA 1EYAA 3QB3A 5F2DA 5HGTA 1JORA 5IGFA 4HMIA 1EY9A 3EJIA 4S3SA 4ZUJA 4KD4A 2QDBA 3P75A 4QF4A 5IIFA 4ID6A 5IGEA 3E5SA 3NQTA 5CV7A 5K5PA 4N9TA 1SYCA 4EQOA 5C6AA 1JOKA 2F0VA 1STBA 1SNOA 2F0LA 4KJNA 2KQ3A 4MIUA 5CV8A 5C3WA 4R8NA 2PQEA 3DMUA 5CGKA 3T16A 2WACA 1F2MA 4ODGA 3SR1A 4PMCA 2PW7A 1II3A 2EY1A 3EVQA 3R3OA 2F0QA 2HQEA 3VA5A 3D8GA 4IALA 4DF7A 5CV6A 4NKLA 5CV9A 5I9PA 5IGDA 1JOOA 3MVVA 3ITPA 3T13A 1KDBA 1EY8A 1STAA 4IZ8A 4B9XA 1ENAA 3ERQA 4PNYA 4WRDA 5E3FA 3TP6A 4K2KA 1SNMA 2F3VA 2EY2A 1EZ6A 4NP5A 5ISRA 5CV5A 1EY6A 2EYPA 3V2TA 1JOQA 2M00A 2KHSA 1RKNA 3SXHA 5IGGA 1STHA 2EYMA 3OMGA 1EY0A 2F0FA 3MEHA 1EYDA 1TT2A 4QB4A 3SK6A 3TP7A 3D4WA 4DU9A 1A2UA 1F2ZA 1EZ8A 2F0PA 3MZ5A 1EQVA 2EY6A 3NP8A 4I65A 4QMGA 5JAVA 5J22A 1A3UA 4KY5A 2F0SA 2F3WA 2F0JA 3NHHA 5CR3A 5NUCA 4OL7A 5KIXA 3SHLA 4EQPA 1U9RA 3PMFA 3BDLA 1EYCA 3OSOA 5DAUA 5CC4A 5DEHA 4J1MA 4DFAA 2F0TA 4WORA 1NUCA 1A2TA 1EY4A 2RKSA 3OWFA 5KYIA 2SNSA
chains in the Genus database with same CATH superfamily
3C1FA 3FRPB 3MWYW 3GTOB 2E74C 1BKBA 4PZ6A 4DV5Q 3NE5B 4JI6L 1VQOA 2C35B 4CKBA 3GQBA 3CC4A 4YWLA 4JI2L 4XQJA 3KBGA 4KY6A 1DD2A 1Z47A 1V1PA 5EKIA 3BS1A 2CW0C 1N32L 3I4NG 1F9SA 3F8TA 4BBSB 2PI2E 4X3TA 1XWEA 1HNZQ 1G291 3CC2A 4DPGA 2NVXB 4C1NK 4L63B 5IOCA 1SYBA 2OF1A 2QEXA 3PIPA 1SNQA 2I5LX 3KF8B 4UPAA 1XMOQ 2Q2UA 2KECA 3CCMA 1KAAA 1OXUA 4JI5Q 4CHTB 2JA7B 2ZM6Q 1MSHA 1JWUD 2YYZA 5COYA 4EX5A 4NMZA 4FF3A 1G6PA 5JEAG 1EY7A 1SE2A 3Q24A 4PG3A 1PYWD 5HGQA 2QDLA 5HURA 4RGTA 4JG2A 1LT3D 1PH4A 1DJRD 2F1MA 2HDLA 3QB3A 4KKTA 5HGTA 5IWAQ 4OO1G 5IGFA 3PSIA 1EIHA 1PFBA 1D8LA 1I4RA 2RCNA 3G6JB 1I3QH 3E5SA 3A7LA 4N9TA 3I7FA 1HNZL 2B63G 1NJIC 3JAMi 1HQMC 2K1BA 3J80L 3HKZG 2WACA 4OWXB 5ELEA 1JMCA 1XMOL 3WWVA 4CKCA 1ZEQX 1WTOA 1Q3LA 4JI5L 2D9UA 2ZM6L 3OTOQ 2GVBA 4KI0A 4G7ZC 2NB0A 1WVLA 5IE8A 2B2VC 1JR0D 3GV6A 4XQNA 1Q12A 2NVTH 5IYDG 1PH8A 1D1IA 3PMFA 4UHVA 2A69C 5DAUA 3MC0B 1ESFA 5CMDA 1TWCB 4MTNA 3STBC 4RHSA 3VR3A 3QWNA 1RCVD 5C4XB 4KN7C 1GUSA 5EJWA 3HOZB 4C2MB 3S2DB 3C3LA 4PQXA 2WINB 1TWFH 3S1QB 3HOUG 1ICFB 2G9HD 2Z0SA 5C4HA 5EAYA 4YCUA 1JC7A 1KNEA 2OCEA 2PZWA 4CJ0B 3DWAA 3TS0A 4K6DA 1N33Q 1MI2A 3PO3G 1YHBA 3OTOL 1H95A 2EIFA 5IGCA 2ZXPA 1VQPA 5FLXL 1E24A 2L11A 1KLGD 1BO0A 4JCVE 4F8MA 3PIOA 1NAPA 3H91A 4A3JG 2OWOA 3KBXA 4KHVA 1VS0A 2RHSB 3CP0A 1W3SA 3HEJA 2Z8LA 4A3CG 3S9WA 5IYBG 4A3EB 3I4NH 3HKSA 2EYLA 4BY7B 4H7BA 1HFGA 2WKDA 2Z6KA 5A35A 2AKWB 1B2TA 4A3FB 1UE7A 3A55A 1Q8KA 1TR5A 1EEID 3J81L 1N33L 1EU3A 3EFXD 1GUGA 3J81i 2MO1A 3PIP3 3GTKB 3S14B 1NR2A 1IL2A 4QJFA 1EWHA 1UWVA 5JEAH 1Q82C 1SRUA 3SE0A 1WTRA 1MIUA 1MBYA 1MKHA 4V0BA 1IW7D 3GV3A 5IGDA 4IPGA 2NWGA 3H94A 4OO1H 1X54A 4RHRA 4B9XA 4CDEC 3ERQA 2ICIA 1SMXA 1EZ6A 4A3LG 4ZAIA 3V2TA 2Q2HA 4OWTB 4HJ5A 2B63H 1TT2A 5J22A 2X69A 3K5OA 4HIDA 3JAME 4KY5A 1H9JA 2CVRA 3I91A 4P75A 4NXNQ 5JPMC 1LV9A 1FR3A 5EPLA 1EUJA 3PO2G 2F0TA 1A2TA 2FMCA 1D5MC 1TWAH 1VQ6A 4AYBG 1XPUA 2L55A 3ZJYC 3KJPA 1I4XA 5EKLA 2R61A 3VDYA 2TSSA 3FDTA 2NVTB 1BCPF 3L2PA 1ML0D 3DXJC 3I55A 1K0SA 2MFIA 1SNPA 1BBUA 2F0OA 3CKIB 2A73B 1X9NA 4E6IA 5IYDH 1UEBA 1YNNC 4L5RC 2OXPA 3VR6A 2NUCA 2D5DA 1PRTC 1SJHD 5C4ZA 4ABNA 2KEEA 1F2YA 4CDCC 4IN3A 3Q8DA 2I0QA 5EBCA 4XTCS 1H9KA 2NYZD 1TWFB 1KDAA 1K9MC 3U58A 3D4RA 4NXNL 4DR4Q 3VYRA 4APVA 1B9NA 4FF2A 1EQRA 3IL8A 5BN4A 1KHIA 4M1UB 1SE3A 2F0DA 2D62A 5KYLA 1SBBB 2B2YA 2LKVA 3QO2A 1A63A 3GTJH 2G5DA 3H0GG 1O7ZA 3GDEA 1STGA 3EIVA 1K73C 1WFQA 3QOLA 1AFPA 4A3JH 1EYAA 3OHXC 1TWHH 4KKSA 3HRZC 5FLXE 3PIO3 1AZPA 3V05A 2MUYA 2L4NA 4UP7A 5JPNC 4CKEA 1VQGA 1PH2A 4A3CH 1SN8A 5IYBH 4A3DG 5G3LD 5CV8A 3K59A 2PQEA 4GN4B 2MO0A 1JJCB 1Y1WB 3DEOA 3EQLC 3J7ZC 2I07B 3D8GA 4DAYB 4C3IG 4ALPA 4DR4L 4PMWA 4DV0Q 1YJ9A 5T1IA 2F4VQ 4JBKA 4PZ7A 2ZXRA 3OIPA 3MA2B 5C0XJ 3J81E 1EYDA 4JYAQ 1H9RA 1CQFA 2D2CC 4RGMA 1HZAA 3CRLC 5CC4A 1QVGA 4BBRG 1U4PA 1FGUA 4C56C 4WORA 3R93A 1YHQA 3RLNA 3NWSA 1SMYD 2FMMA 5IODA 4LUVA 1S72A 2VUMG 4POFA 3HKZB 1NSNS 3L9AX 4XYQA 2R93G 1TWGH 3CCRA 1AH9A 2PW5A 2OTLA 2Q8RE 1C48A 3TBIB 4DV0L 3CU7A 4P72A 2SDFA 4YY3Q 2F4VL 2BH8A 1CSQA 5LHY1 1HZBA 1TWAB 4LJZC 2ASBA 3PO2H 4FF1A 3M3YH 2D0PA 3E9HA 2CWAA 4B08A 1YITA 2E2JH 1X3FA 2K5WA 4RH6A 3A56A 3HG9A 3U9SA 5E4XA 4N9PA 1WD0A 5CBAE 1LTSD 3OWEB 1D5XC 4OELB 1PZKD 3T4AC 2M2LA 4IPDA 3E6ZX 1B4OA 1TS2A 4DV7Q 1PLFA 3AEVA 1B44D 2NZ1D 3AMUA 1W2BA 4YIJA 2BA1A 3J81j 3D4DA 3NK9A 4RGNA 4RWSC 4KKUA 1A15A 4DK6C 1JORA 2CWPA 4DV6Q 3HOUB 3J80c 4QY7A 4XT1B 4YY3L 1E3PA 3NQTA 3ULJA 3PO3B 3BVMA 1HA5A 4KJNA 1BBWA 1X3EA 3RZOH 4DR7Q 5FO9B 2BCOA 5CGKA 4XIGS 5BN5A 4QGUA 1R4QB 2OQKA 1HRJA 3H0GH 4R8IA 4O1NA 1TWHB 4DNTB 4NKLA 2XRSD 2XNAC 1OXSC 1STAA 2Q8IB 2Y0SE 1E7ZA 2EY2A 5ISRA 1EY6A 4DV7L 3RN2A 1XXGA 3NSWA 4RCNA 3PF5A 1T5XD 3PQIA 3KF6A 5LMUQ 4A3DH 1A8VA 3TP7A 4DR1Q 1KNAA 1M90C 2L5TA 1HCZA 1A3UA 2HUGA 2XN9C 2ZXOA 4DV6L 1NBWA 1YBYA 4C3IH 3A8JE 2JEBI 1LUZA 1PRTB 2JN4A 1Q81C 3LNNA 4DK0A 4DUYL 1HTLD 1SYGA 5FOBB 2F0KA 4DR7L 1D7QA 2KCCA 4GNXB 4P73A 3I4MG 3GTOH 3M4YA 1ENCA 1S3OA 4J6HA 4KV6A 3NXWA 3UDGA 5FLXc 5ELBA 2CH4A 2EDGA 4LFCQ 2RDFA 2VW9A 2MHVA 1IW7C 4BBRH 4KN4C 3CCLA 1PMRA 3ER0A 3HOVB 2CFMA 1YZ6A 4QIWB 1XTCD 2CH4W 4BY7G 2F0WA 1QWYA 4KTAA 4DR1L 2NVXH 3RR5A 4A3FG 3G4SA 4HAEA 4DXFA 3F2CA 1CKNA 2B2UA 2JXMB 4KJOA 2R93H 4I7ZC 3KOJA 4IUNA 2E76C 2Q2IA 2TMPA 5GROA 2BOSA 4O42A 3J7A5 1KRSA 2EXZA 3Q23A 2K28A 2K7VA 1E2VA 2FINB 1G91A 4AYBB 1ICWA 3J81c 1KTKA 2IX0A 4LF6Q 1RODA 1GD7A 4QF4A 3NBHA 1LTBD 4A93B 4KHPQ 4LFCL 4R4TA 3R2IA 3RNUA 1KAWA 1EU4A 4K6LA 5GADC 1SEBD 3DMUA 1QUQB 3T16A 1EL0A 2KVMA 5EBDA 1B70B 4PMCA 3MTSA 4LFAQ 4IALA 3GTQH 3T13A 2GVAA 4ME3A 4DAMA 2Z4HA 2BDNA 2OQ0A 3IKJA 1ZXTA 1V43A 2N55A 4P71A 3L7ZC 2B2TA 4B3TQ 1IKMA 5M5YH 4JBJA 2LY7A 4CGYB 2F0FA 2JA9A 5ELOA 4I65A 1DONA 3H0GB 4Y52H 1VF7A 5KIXA 1VQKA 4LF6L 3BDLA 4GKJQ 2K6AA 1E0BA 4DV2L 4KHPL 1NE3A 5KYIA 3J7AF 4YCWA 1J6QA 3BZDB 1VMPA 4X3UA 4FF4A 3MXNA 1EFID 1TWCH 1A3VA 4A3DB 3TP5A 1RHPA 4LFAL 1S5CD 4M8AA 5C4XH 1PV4A 1L0WA 3S2DH 1B3AA 5C0XG 3CXCA 2UUCQ 2SOBA 2IW3A 3KF8A 1QVFA 2F0GA 1G2SA 4EQ5A 1DOMA 1HJPA 1J5EQ 2IJ0A 4C3HG 4LUOA 2DNCA 4B3TL 1BXTA 3CCVA 3F1ZA 1WTHA 4KLKA 1FJGL 2K5VA 1CUKA 3CQZB 2ID0A 3NWTA 4B9WA 3I4MH 1SYFA 1QB5D 5EPJA 3GTPH 4GKJL 2RBMA 1YIJA 1W6JA 1F9QA 5LL6S 4BBRB 1Z9FA 4KD3A 1WI5A 1YNJD 3TDQA 5BN3A 3ERSX 1L1OC 1JJ2A 2ES2A 4K5XA 4TQUS 2EJFC 3U4VA 4B3SQ 5K36G 4MTKA 3BVZA 4A3EH 1UEAB 1LTLA 2VUMB 1Y1WG 4BY7H 1SMYC 3UE0A 4KHZA 1MD2D 4A3FH 1BBXC 4S3SA 2R7ZG 2R93B 2R6GA 4IFDI 4GLVB 3X3MA 3QJYA 3L0OA 5M5XH 1KD1C 4EQOA 1PH5A 1SE4A 1J5EL 2EE1A 3BG3A 2RA4A 3GTKH 2HDMA 3S14H 5DLQE 1QJOA 4DXGA 1MHWC 4DV5L 4H02A 2GN5A 3A74A 1PYSB 2K03A 5CV9A 1E1TA 2LSSA 3C46A 3TP6A 2WFWA 1N9WA 4DN4M 4DK3C 5HY6A 3TZDA 1X32A 3SEBA 3JAML 1V1OA 4B3SL 1NTGA 4DU9A 1HNXQ 1X3GA 1P16A 2B8GA 3SGIA 3J7AV 4IJHA 1LTID 3GTQB 2N49A 4IUVA 1I4PA 1EYCA 1HTPA 1PTOD 1L0XB 1V1PB 4KMUC 1YJNA 4DNIA 4FP5D 3CPWA 1VQEA 2A1AA 5ELDA 5M5YB 2PZUA 3K7AB 1VQNA 3PF4A 3S15H 4A3GG 1Q8IA 1VF5C 2IL8A 3W3AA 2AQ2B 5C5LA 2C5CA 2DGYA 2XWJB 4KK7A 3MHBA 4KY7A 4OGQC 2ENBA 5IWAL 1GKHA 1XX8A 2KUMA 3D31A 5FJ8G 1VMCA 1HNWQ 2F03A 4HSPA 4ME5A 1XYIA 1AW7A 2EOTA 2UXCQ 4CBVA 3R8BA 2LMCB 1ONLA 1HNXL 4OEMB 5ELNA 2RDHA 3ND9A 1STEA 1E1OA 1WTVA 3RUZA 3OW7A 2Q8TA 4EVOA 2RSOA 3TP8A 1B50A 4F88A 1IL8A 1AE3A 4HR7B 1RIPA 1I6HH 4V190 1B3QA 1VQIA 4K14A 3VYSA 3S1MH 1Y8OB 1GM5A 1CKOA 2WAQG 5CBEE 3EA6A 4CDDC 3OW2A 1VQ9A 4L8JA 2LS01 4C3HH 3E3XA 1C0AA 2O4XA 2O5JC 1SDFA 1KLUD 4A3IG 2JA5B 3I4MB 2VNUD 5F2DA 2A6HD 3GTPB 2ICEC 4ZUJA 1YVCA 5M3MG 2K75A 2R3ZA 1TY2A 2V4DA 2UUBQ 1WTWA 4DR3Q 2BE5D 1JOKA 1H9MA 1HNWL 2ZJPA 3NTHA 4R8NA 1GUOA 3S16B 1Q46A 1R4PB 1VQ4A 2UXCL 1O7YA 4TSSA 4CJ2C 4ODGA 3EVQA 4DA2A 2JE6I 5K36H 2NZOA 3DWPA 4OONA 1Y1WH 1JICA 4JI3Q 3K0YA 3KUPA 1TS3A 2KENA 2A5HA 5FK9C 2WB1B 4PNYA 5M5XB 2R7ZH 1UE1A 1XMQQ 1JOQA 2EYPA 4YCVA 2ZTDA 5IGGA 1Q90A 2L0CA 1SXTA 1JJGA 1PZID 3RMHA 1IZ6A 1CHQD 1V8QA 3H09A 3SHLA 4R1JA 1VQAA 1K8AC 2IY5B 5DEHA 1SFOH 2UUBL 1NY4A 1EY4A 4DR3L 1EEFD 3PGZA 1VQDA 2HHHQ 1RJTA 3HOVG 4ZQ3A 1OXXK 1B7YB 3ULPA 1WYDA 1S5FD 2QGQA 2AMCB 4JI3L 3RZDH 5J39A 3PUXA 1EIGA 3AB9A 4XYOA 3VR2A 3CRKC 3K8AA 4A3BB 1XMQL 1L1OB 1CM9A 1WJJA 5EGTA 3N52A 3SK5A 4WJWA 2AQ1B 4A3KG 4OX9Q 4ULLA 1K8GA 3OOCA 3S15B 4IPHA 1A3TA 5AFWA 1VQHA 2DJFC 4A4IA 3KLWA 4A3GH 5M3FG 2YTYA 1CI3M 5KEEA 3TREA 1LTRD 1Y1VG 3BDCA 1RF2D 3M4PA 4FVMA 5EPKA 3TMEA 4A93G 3I72A 1UNSA 3KLSA 5KRUA 2HHHL 3D6WA 1KL9A 2HQLA 1K0RA 5JJIA 1QNKA 4LW1A 4JI0Q 2X6LA 4O0AA 4A76A 4LF8Q 2I5HA 2JA8G 2PYKA 3AU7A 2NN6G 4OO1I 1I6HB 1K8MA 1LTTD 3HOUH 3S1MB 3DWQA 2IX1A 3BJUA 3PO3H 4C3HB 3DUZA 4OX9L 4QUCA 3R3OA 2ZTEA 1GVPA 5ELFA 3FPPA 3TZUA 2QCPX 5CV6A 4LK1C 1SSOA 2V1CC 5IYCG 2H5XA 1U5KA 2WKCA 5M3MH 2F3VA 2DN8A 3H3VC 3QIAA 4MN3A 2DY8A 4NPSA 3A8KE 3TSSA 4JI0L 4LWCA 3MEHA 4RG1A 4LF8L 1YNJC 2NTTA 4MNOA 1CA5A 1DOLA 4X66Q 3UE1A 2R7ZB 4HCEA 1XNRQ 1GUNA 3HOYG 2K52A 4GOPC 1KC8C 2A19A 3I8ZA 3P20A 4POGA 1NCVA 1S4ZA 5J3BA 3CCJA 3A7AB 1CQVA 3K6OA 2KCNA 2B29A 3HS0C 1FD7D 1SFOB 2PCFB 2EYOA 1RDPD 2EYHA 1XPOA 5C5MA 2A6ED 3BYYB 3W2DA 4TVAB 3D6CA 2F0HA 4F87A 3CAMA 1JWSD 3MXGA 1B8AA 4QUFA 5C44G 1PHJA 1A62A 1T9HA 3L3OC 3HOVH 1VQ5A 2CKZB 4A3LH 1SAPA 3HOXG 5JVG3 5E4WC 3RZDB 4PZ8A 4X66L 5GAEC 1U4LA 3MAQA 1LACA 1ASZA 3H3VH 1JQYD 3OMCA 1STNA 1XNRL 2HCIA 4K5WA 1XPRA 4IOCA 2YU9B 1WCMG 1XJVA 1PTOC 5D3DA 3C1EA 1EYGA 4A3KH 1SYEA 1I50H 3A5ZB 4JYAL 4A3GB 2IHFA 3A54A 1I4HA 2B3GA 3BZKA 2KHIA 2DUDA 4ZK9B 3PUZA 2J7ZA 3DEPA 2F0VA 5I2YA 4A93H 1BCPD 2CQAA 1LM0A 3TS2A 1LYLA 3LGJA 4AH6A 3SR1A 1YJWA 2OT2A 1WTPA 3C2PA 2JYOA 1J8IA 2QA4A 1NR4A 1NMFA 4XT3B 2JA8H 2RVLA 3MVVA 1GXDC 3FKIB 2I46A 2NN6H 4QQBX 2UXDQ 2PNRC 4P2CB 4IO9A 3ONAB 3JAMc 4DR6Q 1VQ7A 2KHSA 1Z7TA 2K33A 3K5LA 5JEAJ 1D6EC 1WTQA 5FO7B 1AZQA 2WAQB 1QZHA 5I9OA 1A2UA 1EZ8A 2B2TC 1MSGA 4B3MQ 1CZGA 5CR3A 4A3IB 4GNXA 3VA7A 4GN5A 5IT9E 1TS5A 3KDFA 1PZJD 5M3MB 5IYCH 2N78A 2YTVA 2A6HC 4X3KA 3FP9A 5C4JB 3X3NA 3U4ZA 4FNFA 3TQYA 2VQFQ 4DR2Q 2BE5C 1EWCA 2VXWA 2A68D 2ALYB 5J1ZA 4DV3Q 4HIKA 2F3IA 4IJLA 3WOEA 3I73A 3RN5A 1G51A 1WD1A 3K7UC 2UXDL 3QR8A 1P8LA 2FJ2A 2QKIC 1GUWA 1PRTF 5I6WA 4DR6L 1GHKA 4TRDA 3I70A 2H4OA 4JOIC 3U9OA 3HOYH 4EQNA 4B3ML 2R92G 3NUCA 1CT1D 2JA5G 3AYHB 2EZVA 2IPKD 2PMZB 3CQZH 3SVMA 1Q86C 1IYUA 1JB7A 4OXPA 3HOWB 1E2WA 4YWKA 3P1HA 3K57A 4CDFC 4I7AA 4BWGB 1DCZA 3T53B 1BF4A 2J4XA 3OYYA 2VQFL 1ASYA 4DR2L 2WIIB 5C44H 1PFNA 4QCLA 1X6OA 5A2QL 1IBKQ 5LMUL 4DV3L 1A0IA 2VUMH 4KD4A 1ENFA 2JK8A 3HOXH 3KFUA 5I2XA 3S1NH 5CV7A 5K5PA 5EQ0A 1D5ZC 1HH2P 1SYCA 2CQOA 2WB1G 4JBWA 5KNDA 4X65Q 1STBA 1ET9A 3MFGA 4DV4Q 3KYHC 3HKZE 4A3MG 1QCBD 3S17B 1OXVA 1WCMH 4DV1Q 1HZ9A 3KF6B 2VQEQ 1I50B 4A3KB 1R9TH 2JA6G 4L5SA 1B1ZA 5FLMG 1I6VC 3TEHB 2DJGC 2UXBQ 1F2LA 1JWMD 4CJ1B 1O7IA 5M3FB 2F4IA 4LNQA 4NP5A 1YEZA 1FNVA 1Y1VB 4X64Q 1C7YA 4GOPB 2A8VA 1VQ8A 4HCSA 2MGSA 3D4WA 2F0PA 4ZLTF 3CMAA 2O5IC 1GO3E 2VZAA 1QZGA 4U68A 1CK1A 4H13C 2F0JA 1IBKL 2PQAA 2EPBA 2JA8B 1HZCA 3KLRA 1PH3A 1QG7A 1H9SA 3NTKA 4X65L 2NVQH 3FEWX 5D3IB 4A3BG 4HSVA 4DV4L 1HR0Q 2B39A 5KNCA 3VYUA 1VQFA 4DV1L 5T1GA 4R9WA 3K7AH 2Z9HA 5EKKA 2VQEL 1F9PA 4DUZQ 3W1BA 1HR0W 2UXBL 4HJAA 2F0UA 4G57A 4H44C 1G8ZD 4X64L 1Q1BA 3DHQA 3D0FA 3EROA 4IQZA 3T1YQ 1PTOB 5C3XA 5IGBA 3HZXA 3CD6A 1IHZA 3QOJA 4JI1Q 2MNAA 1D1KA 1XNQQ 4JBMA 1HFNA 3E9IA 5M9OA 4FXGC 1EIFA 4BS9A 5DM63 1PYBA 2Q2TA 4DAPA 2NVYB 1TY0A 3PCOB 3NBHB 1ILQA 1EQTA 2HD3A 3E0EA 2LFNA 3K80C 1N8RC 1HR0L 1I4GA 1EFWA 3HOYB 2M9VA 1LTAD 3PUWA 1UUPA 2HCCA 2YV5A 2B2WA 4IOAA 4DUZL 4HMIA 3EJIA 3KJOA 2AWNA 3JC66 2JA5H 1V1QA 1EQQA 4BY1B 3G48A 4NW2A 4UP8A 4OHJA 1GOZA 4FXKC 1PA6A 4UAIA 4JW0A 1FVIA 1G6ZA 3T1YL 1C8CA 1X3PA 4WJ4A 3NEMA 2RQXA 1II3A 2EY1A 4RA8A 5E7NA 2A6EC 5C44B 2NTSA 4R4QA 3S16H 4JI1L 1XNQL 3ITPA 1ILPA 4GS3A 4IZ8A 3HOXB 2EQSA 2XIWA 2Y0SG 1Y14B 1G2TA 3S1NB 2Z6KC 2E2HH 1ZYRD 1K28A 2UUCL 5JJLA 3T1HQ 4QIWE 4AIMA 4UP9A 3M9BA 5A2QE 4DKAC 1HHVA 1EWIA 3SK6A 1Z6HA 1Y8PB 3IAYA 2A74C 2K05A 3ICEA 2EY6A 3MXNB 5JAVA 1WCMB 4GZYC 4A3MH 3G7LA 4O2DA 5NUCA 1R9TB 2AUKA 2VS1A 1YI2A 1S5BD 3O13A 5KNBA 1S5DD 1N36Q 2JA6H 2MJ8A 5FLMH 2FXQA 4PV1C 5D14A 2VB2X 2HT1A 2N88A 1W6KA 2NZHA 4AYBE 1DGSA 3GO5A 2GA4B 1HPCA 1SR3A 4C3JB 2E8GA 1BQQT 5D65A 1BCPC 4G4KA 3LWUA 4C1NI 2EY5A 2JSOA 4R4OA 1DZ1A 4H0LC 1MJEA 2NVQB 1SE8A 3T1HL 1HXYD 3CC7A 2K5DA 1EIYB 2OEOA 1ET6A 5C3EG 3S1RB 3J7YW 4A3BH 2Z4IA 2K4KA 3ND8A 2F0MA 5JJZA 2QILA 1UE6A 3CMEA 1AEXA 5FO8B 3K58A 3Q0AA 2L12A 3TN2A 3UI2A 1N36L 4ZYSA 2SNMA 4NXMQ 3PV0A 2C9OA 4K8IA 3H6MA 3J80i 1KRTA 3IFDA 3NTIA 4GKKQ 1KQSA 2PNHA 1SYDA 3RLOA 4RKLA 3BDOA 4FDBA 1OXTA 4K8JA 3I56A 2ZTCA 1S5ED 5CORA 2JEAI 3LWEA 2VB3X 1D2BA 5M5WB 3M4OH 1CHPD 3FKIG 3ULLA 2SEBD 1DOKA 2A68C 2K5NA 1IKLA 1PH7A 4GLXA 1K83H 3E0JA 4RAUC 5C0XH 1UAPA 1IBLQ 1J9OA 2E2IH 1F2MA 2PW7A 2AWOA 1WOCA 1FNUA 3A8IE 1AE2A 5JVH3 3CCUA 3GTGB 2R92B 1X3QA 1Y8NB 3DM1A 1EY8A 2B2YC 2R7DA 4NXML 5E3FA 1FL0A 2QF7A 4TKOB 2JQOA 1O78A 4EGVA 4NB3A 1SROA 2KCMA 5TSSA 3GTMB 1I4QA 3SXHA 1K3BC 4DNRB 4JI4Q 2CCZA 1NNXA 3OMGA 3HFZB 4GKKL 4AQYQ 4A75A 1IYVA 2H1EA 3IRBA 2CHBD 3CW2C 1S40A 4IURA 4X3SA 2K5QA 1OO9B 1LO5D 2E2HB 1E22A 1IYJB 3I2ZA 2KBNA 3HP3A 1IBLL 4LUZA 1MGSA 5H1SE 1L1OA 5G3LF 1VQMA 4A3MB 4Y7NH 5C0XI 2EVBA 3MXUA 1KABA 3UDXA 5KGUA 5GAHC 3F2DA 2JA6B 3F2UA 3I4OA 4LF5Q 3W1GA 5I6YA 2KEDA 3HOWG 1T5EA 5JOBA 4HIMA 4JI4L 4K2LA 3K81C 3TRZA 4AQYL 4IFDJ 3URYA 1TIID 3UDIA 3T56B 4XQQA 2VY3A 4RFBA 3V96A 2O2LD 1SJED 2KOLA 4HJ7A 4YHHQ 3NBIA 1DXMA 1WTXA 2EJMA 1BVSA 1LT4D 5CV4A 2K14A 3M7GA 1CZWA 1CSPA 3PUVA 1BR9A 1EY5A 1QE6A 2F0NA 3RD4A 2AHOB 2DY7A 1EOTA 5C3EH 1PVOA 4IPCA 1M8AA 1I3QB 2YU9H 1MJCA 1EY9A 5AJ3Q 3P75A 1YHAA 5IIFA 3NENA 4LF5L 4IUQA 5C6AA 1Y69U 1RD9D 4HIOA 1LLRD 2KQ3A 5C3WA 1B53A 1Q1EA 5LMNQ 3B6YA 3J80E 3D3RA 3UDFA 3VA5A 4IUTA 5FJ8H 2B2VA 1JOOA 1C4QA 1AN8A 1CKMA 3M4OB 5LMNW 1PH6A 3I3CA 4WRDA 1VQCA 5IY0A 1DYQA 2WV6D 1VCIA 4YHHL 1UE5A 2F52A 1K83B 3FKIH 1BDOA 4N8X1 2K32A 3S2HH 2EYMA 4DAYA 2FFKB 3CPFA 5DNFA 1F2ZA 2E2IB 4X6AH 2RF4A 1TVXA 1BCPB 3AFQA 5IT9L 4OL7A 1U9RA 5AJ3L 4MZ9A 4J1MA 3KK7A 2RKSA 3CCEA 4A3IH 4GNXC 1SNDA 4B3RQ 1U0LA 2X6GA 1JE5A 1PXUA 4HTHA 1CTMA 4K5VA 5LMNL 1BUVT 1C9OA 3FMCA 2MPMA 5C4JH 3WOFA 4XXEA 3FHWA 1SNCA 2UU9Q 4QL5A 2F0IA 3G71A 2KHJA 3GD7A 1F9RA 3QG1A 1PFSA 3SDZA 2Y0SB 3K5MA 1RTOA 1N34Q 4F7XA 4G7HC 3GP7A 3T51B 4HN7A 3VYTA 2ATWA 1VQJA 2F0EA 1ZYRC 5JJKA 1VQBA 1L0YB 4DK1A 3CCQA 3CF5A 2RCFA 2D0OA 4Y7NB 2EYJA 5BR8Q 1LT6D 3I4NB 2WB1E 4HJ8A 5L37A 4JI7Q 4FXDA 4RMFA 4FO2A 2IX3A 4BY1G 4JC0A 4HMJA 4B3RL 2K5HA 2Z6BA 3HOWH 4RKBA 3M7NA 2XSCA 2MQHA 2IT1A 2UU9L 2AQ3B 2HIVA 2N3SA 4ID6A 5IGEA 1U4MA 2JP1A 1X65A 1N34L 1X56A 3R2TA 1O7LA 3PUYA 3S24A 2B2UC 2CW0D 5C3EB 4FYDA 2I5MX 3DM3A 4ZKBB 2QEJC 1FNWA 2EXDA 3MEFA 4K0KQ 5I9PA 5BR8L 4BA2I 3S17H 4BBSG 1BOSA 4JI7L 4IUUA 2E5LQ 2B63B 4ILWA 1LABA 5I4DA 3G6EA 2M00A 1LT5D 5DM73 4JV5Q 2XRQD 3OPOA 1OTCA 5M3FH 1TS4A 3FVQA 1Y1VH 4QMGA 2ZJQA 1EQVA 2PO4A 4C3JG 2JA7G 2F3WA 4MHEA 1XTDA 1A6XA 4X62Q 3OSOA 3Q6SA 2SNSA 1PH9A 3S2HB 1ZKOA 1IXRA 1QOHA 1M1KC 2DNEA 4DGZA 3GTLH 4DR5Q 4LFBQ 2RSNA 2KCTA 2EYFA 4K0KL 2ZJRA 3M4QA 1GJXA 3H3VI 1JB3A 3SK8A 2E5LL 2LXJA 3NELA 3MFYA 1B9MA 1JCKB 2RDGA 4NDXA 4ZUIA 1AP0A 4WFN3 3K0XA 1GHJA 1KIXA 3NQIA 4JV5L 2KA7A 4RCOA 1M4VA 1K8OA 4N8FA 4IUPA 3Q22A 4LAAA 5CYUA 1PTOH 1HUMA 3ZYYX 2XWBB 2MP1A 1TQOA 3W5OA 4GLAC 5FKAC 3EBEA 4LMQD 4X62L 1DM0B 4DUYQ 4JPBW 3GTJB 1QILA 1GUTA 2E75C 1JT8A 2ZT9C 2L9HA 1QNUA 4Q5VA 3IFTA 4A3JB 1PH1A 2A69D 2NVYH 4DR5L 4LFBL 3MXPA 2PI2A 3STBD 5IP9G 2NN6I 2VL6A 1PFMA 2QW7A 4IFDG 1ESRA 1PDQA 4LF4Q 2BDOA 4BXXG 3EN2A 2B2WC 1BNZA 1U4RA 2XVSA 4GN3B 3WDNA 3I90A 5C4XG 3HOZG 5IP7G 1SNOA 4MIUA 5GAGC 2BA0A 4BY1H 2P5ZX 4J15A 2FHTA 2YTXA 1VQLA 4LF7Q 1Q7YC 3A5UA 3FPUB 2F0QA 1NMGA 2EJGC 4GOPA 1HUNA 2K50A 1FGBD 4UDUC 4RGOS 3F2BA 4LF9Q 1HQRD 4JI8Q 1QUQA 1SNMA 3A0JA 3VR5A 1YNXA 2BH2A 3P7JA 2IWHA 2XGTA 3KDFB 1O80A 1TU2B 1EY0A 4JVZA 4L5QA 1HA6A 4OIJA 2Z1CA 2XTIA 1JE4A 4ZCKA 4A3EG 4DFAA 4DAVA 3H15A 3OWFA 4LF4L 1I94Q 4BBSH 1KXLA 4BA1I 3BU2A 3BZCA 4UY8C 2L15A 4XDXA 5E1FA 1TWGB 3RLFA 4LF7L 1E2ZA 1STYA 2UUAQ 1QVCA 3NPPA 4C3JH 2JA7H 3PO2B 3CHBD 2LXKA 4LF9L 3M3YB 3K5NA 4Q0FA 4Z9CB 4JI8L 1RL2A 2E2JB 4YWMA 2IHEA 1L2FA 4G7OC 1TXYA 3AQQA 2L1BA 4L5TA 4P74A 2G9DA 2PZTA 1TKWB 3HGBA 4R4CA 3GTLB 1F77A 4DV2Q 2J0TD 3S1RH 1I5FA 5ELCA 1I94L 4ZRZA 1KDCA 2WAQE 1CKNB 3SK4A 3LX0A 4L6TB 1PTOF 4HEDA 4PMBA 2B8FA 3OIQA 1IBMQ 1LTGD 1EOVA 2UUAL 1RTNA 3DLLA 2K04A 2QDBA 3RZOB 1FJGQ 4WJ3M 2WP8J 4OIKA 2F0LA 4U673 5LL6X 5M5WH 2JJQA 2KJXA 4JI6Q 3CCSA 4ZKCB 2RHQB 3BVGA 1YNND 4HJ9A 2AUJD 4JI2Q 2HQEA 4JK1C 1PRTD 4R4IA 1K3RA 4DF7A 2OTJA 1CFMA 4J8QA 1KDBA 5IP9H 1N32Q 1VDZA 1ENAA 1SLJA 2PQAB 4K2KA 4IFDH 1V9PA 5CV5A 5GQOA 2R92H 3GTGH 3AFPA 4BXXH 2E2DC 1RKNA 1H9SB 3U50C 5IT9c 1STHA 3N6RA 1CA6A 2NBFA 3HOZH 5IP7H 2N8NA 2K01A 4QB4A 4C2MH 3M85A 1FYCA 3MZ5A 3NP8A 4C3IB 1IBML 3I4LA 3GTMH 3S1QH 4JOIA 3KLSX 2F0SA 2HIXA 3NHHA 2PMZE 2PPBC 4EQPA 1X55A 3VR4A 1NUCA 4OWWB 2R7FA 3BYTB
chains in the Genus database with same CATH topology
3C1FA 3FRPB 3MWYW 3GTOB 2E74C 3NE5B 4CKBA 3GQBA 4XQJA 3KBGA 4KY6A 1DD2A 1Z47A 1V1PA 5EKIA 3BS1A 2CW0C 1F9SA 4BBSB 4X3TA 1XWEA 1G291 2NVXB 4C1NK 4L63B 5IOCA 1SYBA 2OF1A 1SNQA 2KECA 1KAAA 1OXUA 4CHTB 2JA7B 1MSHA 1JWUD 2YYZA 5COYA 4NMZA 4FF3A 5JEAG 1EY7A 1SE2A 3Q24A 1PYWD 5HURA 4RGTA 1LT3D 1DJRD 2F1MA 2HDLA 3QB3A 4KKTA 5HGTA 4OO1G 5IGFA 1EIHA 1PFBA 1I4RA 3G6JB 3E5SA 3A7LA 4N9TA 1HQMC 2K1BA 3J80L 2WACA 5ELEA 4CKCA 1ZEQX 1WTOA 1Q3LA 2D9UA 4KI0A 4G7ZC 2NB0A 1WVLA 2B2VC 1JR0D 3GV6A 4XQNA 1Q12A 1D1IA 3PMFA 2A69C 5DAUA 3MC0B 1ESFA 5CMDA 1TWCB 4RHSA 3VR3A 3QWNA 1RCVD 5C4XB 4KN7C 1GUSA 5EJWA 3HOZB 4C2MB 3S2DB 3C3LA 4PQXA 2WINB 3S1QB 2G9HD 5C4HA 1JC7A 1KNEA 2PZWA 4CJ0B 3DWAA 4K6DA 1MI2A 5IGCA 2ZXPA 5FLXL 2L11A 1KLGD 1BO0A 4F8MA 1NAPA 3H91A 3KBXA 4KHVA 3HEJA 2Z8LA 3S9WA 4A3EB 2EYLA 4BY7B 4H7BA 1HFGA 2WKDA 5A35A 1B2TA 4A3FB 3A55A 1TR5A 1EEID 3J81L 1EU3A 3EFXD 1GUGA 3PIP3 3GTKB 3S14B 1NR2A 1EWHA 5JEAH 3SE0A 1WTRA 1MBYA 4V0BA 1IW7D 3GV3A 5IGDA 2NWGA 3H94A 4OO1H 4RHRA 4B9XA 3ERQA 2ICIA 1EZ6A 4ZAIA 3V2TA 1TT2A 5J22A 2X69A 3K5OA 3JAME 4KY5A 1H9JA 2CVRA 3I91A 5JPMC 1LV9A 1FR3A 5EPLA 2F0TA 1A2TA 2FMCA 1D5MC 2L55A 1I4XA 5EKLA 2R61A 2TSSA 3FDTA 2NVTB 1BCPF 1ML0D 3DXJC 1SNPA 2F0OA 3CKIB 2A73B 4E6IA 1YNNC 2OXPA 3VR6A 2NUCA 2D5DA 1PRTC 1SJHD 5C4ZA 4ABNA 2KEEA 1F2YA 4IN3A 5EBCA 4XTCS 1H9KA 2NYZD 1TWFB 1KDAA 3D4RA 3VYRA 1B9NA 4FF2A 3IL8A 5BN4A 4M1UB 1SE3A 2F0DA 2D62A 5KYLA 1SBBB 2B2YA 2LKVA 3QO2A 1O7ZA 1STGA 3QOLA 1AFPA 1EYAA 3OHXC 4KKSA 3HRZC 5FLXE 3PIO3 1AZPA 3V05A 2MUYA 2L4NA 5JPNC 4CKEA 5G3LD 5CV8A 3K59A 2PQEA 1Y1WB 3DEOA 3EQLC 2I07B 3D8GA 4C3IG 4PMWA 5T1IA 2ZXRA 3OIPA 3MA2B 5C0XJ 3J81E 1EYDA 1H9RA 1CQFA 2D2CC 4RGMA 3CRLC 5CC4A 1U4PA 4C56C 4WORA 3R93A 3NWSA 1SMYD 2FMMA 5IODA 3HKZB 1NSNS 3L9AX 4XYQA 2PW5A 2Q8RE 1C48A 3TBIB 3CU7A 2SDFA 5LHY1 1TWAB 4LJZC 4FF1A 4B08A 2K5WA 4RH6A 3A56A 3HG9A 3U9SA 5E4XA 4N9PA 1WD0A 5CBAE 1LTSD 3OWEB 1D5XC 1PZKD 3T4AC 2M2LA 3E6ZX 1B4OA 1TS2A 1PLFA 1B44D 2NZ1D 3AMUA 4YIJA 2BA1A 3D4DA 3NK9A 4RGNA 4RWSC 4KKUA 1A15A 1JORA 3HOUB 4XT1B 3NQTA 3PO3B 3BVMA 1HA5A 4KJNA 5FO9B 2BCOA 5CGKA 4XIGS 5BN5A 1R4QB 1HRJA 4R8IA 4O1NA 1TWHB 4DNTB 4NKLA 2XRSD 2XNAC 1OXSC 1STAA 2Q8IB 2EY2A 5ISRA 1EY6A 1XXGA 3NSWA 4RCNA 1T5XD 3TP7A 1KNAA 2L5TA 1HCZA 1A3UA 2HUGA 2XN9C 2ZXOA 3A8JE 2JEBI 1PRTB 3LNNA 4DK0A 1HTLD 1SYGA 5FOBB 2F0KA 2KCCA 3M4YA 1ENCA 4J6HA 4KV6A 3NXWA 5ELBA 2EDGA 2RDFA 2MHVA 1IW7C 4KN4C 3HOVB 1PMRA 4QIWB 1XTCD 2F0WA 1QWYA 4KTAA 4HAEA 4DXFA 2B2UA 2JXMB 4KJOA 4I7ZC 4IUNA 2E76C 2TMPA 2BOSA 4O42A 2EXZA 3Q23A 2K28A 2K7VA 1E2VA 2FINB 1G91A 4AYBB 1ICWA 1KTKA 2IX0A 1RODA 4QF4A 3NBHA 1LTBD 4A93B 3R2IA 1EU4A 4K6LA 1SEBD 3DMUA 3T16A 1EL0A 2KVMA 5EBDA 4PMCA 3MTSA 4IALA 3T13A 2Z4HA 2BDNA 3IKJA 1ZXTA 1V43A 2N55A 3L7ZC 2B2TA 1IKMA 2LY7A 4CGYB 2F0FA 4I65A 1DONA 3H0GB 1VF7A 5KIXA 3BDLA 2K6AA 1E0BA 5KYIA 3J7AF 3BZDB 1VMPA 4X3UA 4FF4A 3MXNA 1EFID 1A3VA 4A3DB 3TP5A 1RHPA 1S5CD 4M8AA 1B3AA 5C0XG 2SOBA 2IW3A 3KF8A 2F0GA 1G2SA 1DOMA 2IJ0A 4C3HG 2DNCA 1BXTA 3CQZB 2ID0A 3NWTA 4B9WA 1SYFA 1QB5D 5EPJA 2RBMA 1W6JA 1F9QA 5LL6S 4BBRB 4KD3A 1YNJD 3TDQA 5BN3A 4K5XA 4TQUS 2EJFC 5K36G 3BVZA 1UEAB 2VUMB 1SMYC 4KHZA 1MD2D 1BBXC 4S3SA 2R93B 2R6GA 4IFDI 3X3MA 3QJYA 4EQOA 1SE4A 2EE1A 3BG3A 2RA4A 2HDMA 1QJOA 4DXGA 2K03A 5CV9A 3C46A 3TP6A 4DN4M 3TZDA 1X32A 3SEBA 3JAML 1V1OA 4DU9A 2B8GA 3J7AV 1LTID 3GTQB 4IUVA 1I4PA 1EYCA 1HTPA 1PTOD 1L0XB 1V1PB 4KMUC 4FP5D 5ELDA 5M5YB 2PZUA 3K7AB 1Q8IA 1VF5C 2IL8A 3W3AA 2AQ2B 5C5LA 2C5CA 2XWJB 4KK7A 3MHBA 4KY7A 4OGQC 2ENBA 1XX8A 2KUMA 3D31A 1VMCA 2F03A 4HSPA 4ME5A 1XYIA 1AW7A 2EOTA 4CBVA 3R8BA 2LMCB 1ONLA 2RDHA 3ND9A 1STEA 1WTVA 3RUZA 3OW7A 2Q8TA 4EVOA 2RSOA 3TP8A 1B50A 4F88A 1IL8A 4HR7B 4V190 4K14A 3VYSA 1Y8OB 5CBEE 3EA6A 4L8JA 2LS01 2O4XA 2O5JC 1SDFA 1KLUD 2JA5B 3I4MB 2VNUD 5F2DA 2A6HD 3GTPB 2ICEC 4ZUJA 2R3ZA 1TY2A 2V4DA 1WTWA 2BE5D 1JOKA 1H9MA 3NTHA 4R8NA 1GUOA 3S16B 1R4PB 1O7YA 4TSSA 4CJ2C 4ODGA 3EVQA 4DA2A 2JE6I 5K36H 3DWPA 1JICA 3K0YA 3KUPA 1TS3A 2A5HA 5FK9C 2WB1B 4PNYA 5M5XB 1JOQA 2EYPA 5IGGA 1Q90A 2L0CA 1SXTA 1PZID 3RMHA 1CHQD 1V8QA 3H09A 3SHLA 5DEHA 1EY4A 1EEFD 1RJTA 4ZQ3A 1OXXK 1S5FD 5J39A 3PUXA 1EIGA 3AB9A 4XYOA 3VR2A 3CRKC 4A3BB 1CM9A 5EGTA 3N52A 3SK5A 4WJWA 2AQ1B 4ULLA 3OOCA 3S15B 1A3TA 5AFWA 1CI3M 5KEEA 1LTRD 3BDCA 1RF2D 3TMEA 4FVMA 5EPKA 3I72A 1UNSA 3KLSA 5KRUA 3D6WA 1QNKA 2X6LA 2PYKA 3AU7A 2NN6G 4OO1I 1I6HB 1K8MA 1LTTD 3S1MB 3DWQA 2IX1A 4C3HB 3DUZA 4QUCA 3R3OA 5ELFA 3FPPA 3TZUA 2QCPX 5CV6A 4LK1C 1SSOA 2WKCA 2F3VA 2DN8A 3H3VC 3QIAA 4MN3A 2DY8A 3A8KE 3TSSA 3MEHA 1YNJC 2NTTA 1CA5A 1DOLA 2R7ZB 4HCEA 1GUNA 3I8ZA 3P20A 1NCVA 1S4ZA 3A7AB 1CQVA 3K6OA 2KCNA 3HS0C 1FD7D 1SFOB 2PCFB 2EYOA 1RDPD 2EYHA 5C5MA 2A6ED 3BYYB 3W2DA 3D6CA 2F0HA 4F87A 1JWSD 3MXGA 4QUFA 3L3OC 1SAPA 5JVG3 3RZDB 5E4WC 1U4LA 3MAQA 1LACA 1JQYD 3OMCA 1STNA 2HCIA 4K5WA 2YU9B 1PTOC 5D3DA 3C1EA 1SYEA 4A3GB 3A54A 1I4HA 4ZK9B 3PUZA 2J7ZA 3DEPA 2F0VA 5I2YA 1BCPD 2CQAA 3SR1A 2OT2A 1WTPA 3C2PA 2JYOA 1J8IA 1NR4A 4XT3B 2RVLA 3MVVA 1GXDC 3FKIB 2I46A 2NN6H 2PNRC 4P2CB 3ONAB 2KHSA 1Z7TA 2K33A 3K5LA 5JEAJ 1D6EC 1WTQA 5FO7B 1AZQA 2WAQB 5I9OA 1A2UA 1EZ8A 2B2TC 1MSGA 1CZGA 5CR3A 4A3IB 3VA7A 5IT9E 1TS5A 1PZJD 5M3MB 2A6HC 4X3KA 5C4JB 3X3NA 4FNFA 2BE5C 1EWCA 2VXWA 2A68D 5J1ZA 3WOEA 3I73A 1WD1A 2QKIC 2FJ2A 1GUWA 1PRTF 5I6WA 1GHKA 4TRDA 3I70A 2H4OA 3U9OA 4EQNA 3NUCA 1CT1D 2EZVA 2IPKD 2PMZB 3SVMA 1IYUA 3HOWB 1E2WA 3P1HA 3K57A 4BWGB 1DCZA 3T53B 1BF4A 2J4XA 2WIIB 1PFNA 4QCLA 5A2QL 4KD4A 1ENFA 5I2XA 5CV7A 5K5PA 5EQ0A 1D5ZC 1SYCA 5KNDA 4JBWA 1STBA 1ET9A 3MFGA 1QCBD 3S17B 1OXVA 4A3KB 1I50B 1B1ZA 1I6VC 1F2LA 1JWMD 4CJ1B 5M3FB 2F4IA 4NP5A 1FNVA 1Y1VB 4HCSA 2MGSA 3D4WA 2F0PA 4ZLTF 2O5IC 4U68A 1CK1A 4H13C 2F0JA 2EPBA 2JA8B 3KLRA 1QG7A 1H9SA 3NTKA 3FEWX 5D3IB 4HSVA 2B39A 5KNCA 3VYUA 5T1GA 4R9WA 5EKKA 1F9PA 2F0UA 4G57A 4H44C 1G8ZD 1Q1BA 3DHQA 3EROA 4IQZA 1PTOB 5C3XA 5IGBA 3HZXA 1IHZA 3QOJA 1D1KA 1HFNA 5M9OA 4FXGC 4BS9A 5DM63 4DAPA 2NVYB 1TY0A 1ILQA 1EQTA 2LFNA 3HOYB 1I4GA 2M9VA 1LTAD 3PUWA 1UUPA 2HCCA 2B2WA 4HMIA 3EJIA 2AWNA 4BY1B 4NW2A 4OHJA 1GOZA 4FXKC 4UAIA 1G6ZA 1C8CA 1X3PA 2RQXA 1II3A 2EY1A 4RA8A 2A6EC 5C44B 2NTSA 3ITPA 1ILPA 4IZ8A 3HOXB 2XIWA 1G2TA 3S1NB 1ZYRD 5A2QE 1HHVA 3SK6A 1Z6HA 1Y8PB 3IAYA 2A74C 2K05A 2EY6A 5JAVA 1WCMB 4GZYC 3G7LA 5NUCA 1R9TB 2AUKA 1S5BD 3O13A 5KNBA 1S5DD 2MJ8A 4PV1C 5D14A 2VB2X 2N88A 1W6KA 3GO5A 2GA4B 1HPCA 4C3JB 1BQQT 5D65A 1BCPC 4G4KA 3LWUA 4C1NI 2EY5A 2JSOA 1DZ1A 4H0LC 2NVQB 1HXYD 2K5DA 2OEOA 1ET6A 3S1RB 3J7YW 2Z4IA 3ND8A 2F0MA 5JJZA 2QILA 1AEXA 5FO8B 3K58A 3Q0AA 2L12A 3TN2A 3UI2A 4ZYSA 2SNMA 3PV0A 2C9OA 4K8IA 3H6MA 3IFDA 3NTIA 1SYDA 4RKLA 3BDOA 1OXTA 4K8JA 1S5ED 5CORA 2JEAI 3LWEA 2VB3X 1D2BA 5M5WB 1CHPD 2SEBD 1DOKA 2A68C 1IKLA 3E0JA 4RAUC 5C0XH 1UAPA 1J9OA 1F2MA 2PW7A 2AWOA 3A8IE 1FNUA 5JVH3 3GTGB 2R92B 1X3QA 1Y8NB 3DM1A 1EY8A 2B2YC 5E3FA 2QF7A 4TKOB 1O78A 4EGVA 5TSSA 3GTMB 1I4QA 3SXHA 4DNRB 3OMGA 1IYVA 2H1EA 2CHBD 4IURA 4X3SA 2K5QA 1OO9B 1LO5D 2E2HB 3HP3A 1MGSA 5G3LF 4A3MB 5C0XI 2EVBA 3MXUA 1KABA 2JA6B 5KGUA 3F2UA 5I6YA 2KEDA 1T5EA 5JOBA 4K2LA 4IFDJ 3URYA 1TIID 3T56B 4XQQA 4RFBA 3V96A 2O2LD 1SJED 2KOLA 3NBIA 1DXMA 1WTXA 2EJMA 1LT4D 5CV4A 3M7GA 1CZWA 3PUVA 1BR9A 1EY5A 1QE6A 2F0NA 3RD4A 2DY7A 1EOTA 1M8AA 1I3QB 1EY9A 3P75A 5IIFA 4IUQA 5C6AA 1Y69U 1RD9D 1LLRD 2KQ3A 5C3WA 1B53A 1Q1EA 3J80E 3D3RA 3VA5A 4IUTA 2B2VA 1JOOA 1C4QA 1AN8A 3M4OB 3I3CA 4WRDA 1DYQA 2WV6D 1VCIA 1K83B 1BDOA 2K32A 2EYMA 4DAYA 2FFKB 5DNFA 1F2ZA 2E2IB 1TVXA 1BCPB 5IT9L 4OL7A 1U9RA 4J1MA 3KK7A 2RKSA 1SNDA 2X6GA 1PXUA 4HTHA 1CTMA 4K5VA 1BUVT 3FMCA 2MPMA 3WOFA 4XXEA 1SNCA 2F0IA 3GD7A 1F9RA 3QG1A 3SDZA 2Y0SB 3K5MA 1RTOA 4F7XA 4G7HC 3GP7A 3T51B 4HN7A 3VYTA 2F0EA 1ZYRC 1L0YB 4DK1A 4Y7NB 2EYJA 3I4NB 1LT6D 4FXDA 4FO2A 2IX3A 4HMJA 4RKBA 3M7NA 2XSCA 2IT1A 2AQ3B 4ID6A 5IGEA 1U4MA 2JP1A 3R2TA 1O7LA 3PUYA 2B2UC 2CW0D 5C3EB 4FYDA 4ZKBB 2QEJC 1FNWA 5I9PA 4BA2I 1BOSA 4IUUA 2B63B 4ILWA 1LABA 5I4DA 2M00A 1LT5D 5DM73 2XRQD 3OPOA 1TS4A 3FVQA 4QMGA 1EQVA 2PO4A 4C3JG 2F3WA 4MHEA 1A6XA 3OSOA 3Q6SA 2SNSA 3S2HB 1ZKOA 1QOHA 2DNEA 4DGZA 2RSNA 2EYFA 1GJXA 1JB3A 3SK8A 3MFYA 1B9MA 1JCKB 2RDGA 4NDXA 4ZUIA 1AP0A 4WFN3 1GHJA 3NQIA 2KA7A 4RCOA 1M4VA 1K8OA 4IUPA 3Q22A 4LAAA 5CYUA 1PTOH 1HUMA 3ZYYX 2XWBB 2MP1A 1TQOA 5FKAC 4LMQD 1DM0B 3GTJB 1QILA 1GUTA 2E75C 2L9HA 2ZT9C 1QNUA 4Q5VA 3IFTA 4A3JB 2A69D 3MXPA 2NN6I 1PFMA 4IFDG 1ESRA 1PDQA 2BDOA 2B2WC 1BNZA 1U4RA 2XVSA 3WDNA 3I90A 1SNOA 4MIUA 2BA0A 2FHTA 3FPUB 2F0QA 2EJGC 1HUNA 1FGBD 4UDUC 4RGOS 1HQRD 1SNMA 3VR5A 3P7JA 2IWHA 1O80A 1TU2B 1EY0A 1HA6A 4OIJA 2Z1CA 1JE4A 4DFAA 4DAVA 3OWFA 4BA1I 4XDXA 5E1FA 1TWGB 3RLFA 1E2ZA 1STYA 3NPPA 3PO2B 3CHBD 3M3YB 3K5NA 4Q0FA 4Z9CB 2E2JB 4G7OC 2L1BA 2G9DA 2PZTA 1TKWB 3HGBA 3GTLB 1F77A 2J0TD 5ELCA 4ZRZA 1KDCA 3SK4A 3LX0A 4L6TB 1PTOF 4HEDA 4PMBA 2B8FA 3OIQA 1LTGD 1RTNA 2K04A 2QDBA 3RZOB 2WP8J 4OIKA 2F0LA 4U673 5LL6X 2KJXA 4ZKCB 3BVGA 1YNND 2AUJD 2HQEA 4JK1C 1PRTD 4DF7A 1CFMA 4J8QA 1KDBA 1VDZA 1ENAA 4K2KA 4IFDH 5CV5A 2E2DC 1RKNA 1H9SB 1CA6A 1STHA 3N6RA 2NBFA 2K01A 4QB4A 3M85A 1FYCA 3MZ5A 3NP8A 4C3IB 3I4LA 3KLSX 2F0SA 3NHHA 2PPBC 4EQPA 3VR4A 1NUCA 3BYTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1F A;  1SND A;  5IOD A;  4HTH A;  5E1F A;  5EKL A;  1SYG A;  2F0K A;  2PZU A;  1A3V A;  4K5V A;  4F7X A;  3TP5 A;  4DGZ A;  4ZQ3 A;  1NSN S;  5C4H A;  1ENC A;  1STY A;  2EYF A;  5J1Z A;  5EKK A;  2PW5 A;  1SNC A;  2PZW A;  5I9O A;  1SNP A;  2F0O A;  2F0I A;  4J6H A;  4K6D A;  4KV6 A;  3NXW A;  4KY6 A;  5C5L A;  4E6I A;  2SOB A;  5J39 A;  1KAB A;  2F0U A;  4G57 A;  3SK8 A;  5KGU A;  2OXP A;  2EY5 A;  5IGC A;  2NUC A;  3MHB A;  4KY7 A;  2ENB A;  2EYO A;  2F0G A;  4NDX A;  2RDF A;  4ZUI A;  2EYH A;  5C4Z A;  5I6W A;  5C5M A;  5I6Y A;  4TRD A;  5EGT A;  1F2Y A;  3D6C A;  3DHQ A;  3ERO A;  5JOB A;  4ME5 A;  2F0H A;  4K2L A;  3SK5 A;  2OEO A;  3U9O A;  4F8M A;  1SYB A;  2F0W A;  2PZT A;  5C3X A;  5IOC A;  5IGB A;  4KTA A;  2F0E A;  4EQN A;  2OF1 A;  3HZX A;  4KHV A;  1SNQ A;  4N9P A;  2F0M A;  1IHZ A;  1A3T A;  1KDA A;  3QOJ A;  4LAA A;  4B9W A;  1AEX A;  1SYF A;  3NUC A;  3RUZ A;  1KAA A;  4EVO A;  3TP8 A;  2EYJ A;  1TQO A;  4KJO A;  3HEJ A;  5M9O A;  5KEE A;  4IUN A;  2RBM A;  2SNM A;  4NMZ A;  3S9W A;  3BDC A;  4K8I A;  3TME A;  2F0D A;  3H6M A;  3P1H A;  5KRU A;  2EXZ A;  4K14 A;  3OMC A;  5KYL A;  1STN A;  4HMJ A;  1EY7 A;  4K5W A;  4KD3 A;  1KDC A;  2EYL A;  2LKV A;  5CV4 A;  5HUR A;  4H7B A;  4K5X A;  4YIJ A;  3SK4 A;  3LX0 A;  4RKB A;  1EY5 A;  1SYD A;  2F0N A;  2O4X A;  3D4D A;  4PMB A;  3NK9 A;  4RKL A;  1STG A;  1TR5 A;  3MXP A;  4K8J A;  3QOL A;  3C1E A;  1SYE A;  2PYK A;  1EYA A;  3QB3 A;  5F2D A;  5HGT A;  1JOR A;  5IGF A;  4HMI A;  1EY9 A;  3EJI A;  4S3S A;  4ZUJ A;  4KD4 A;  2QDB A;  3P75 A;  4QF4 A;  5IIF A;  4ID6 A;  5IGE A;  3E5S A;  3NQT A;  5CV7 A;  5K5P A;  4N9T A;  1SYC A;  4EQO A;  5C6A A;  1JOK A;  2F0V A;  1STB A;  1SNO A;  2F0L A;  4KJN A;  2KQ3 A;  4MIU A;  5CV8 A;  5C3W A;  4R8N A;  2PQE A;  3DMU A;  5CGK A;  3T16 A;  2WAC A;  1F2M A;  4ODG A;  3SR1 A;  4PMC A;  2PW7 A;  1II3 A;  2EY1 A;  3EVQ A;  3R3O A;  2F0Q A;  2HQE A;  3VA5 A;  3D8G A;  4IAL A;  4DF7 A;  5CV6 A;  4NKL A;  5CV9 A;  5I9P A;  5IGD A;  1JOO A;  3MVV A;  3ITP A;  3T13 A;  1KDB A;  1EY8 A;  1STA A;  4IZ8 A;  4B9X A;  1ENA A;  3ERQ A;  4PNY A;  4WRD A;  5E3F A;  3TP6 A;  4K2K A;  1SNM A;  2F3V A;  2EY2 A;  1EZ6 A;  4NP5 A;  5ISR A;  5CV5 A;  1EY6 A;  2EYP A;  3V2T A;  1JOQ A;  2M00 A;  2KHS A;  1RKN A;  3SXH A;  5IGG A;  1STH A;  2EYM A;  3OMG A;  1EY0 A;  2F0F A;  3MEH A;  1EYD A;  1TT2 A;  4QB4 A;  3SK6 A;  3TP7 A;  3D4W A;  4DU9 A;  1A2U A;  1F2Z A;  1EZ8 A;  2F0P A;  3MZ5 A;  1EQV A;  2EY6 A;  3NP8 A;  4I65 A;  4QMG A;  5JAV A;  5J22 A;  1A3U A;  4KY5 A;  2F0S A;  2F3W A;  2F0J A;  3NHH A;  5CR3 A;  5NUC A;  4OL7 A;  5KIX A;  3SHL A;  4EQP A;  1U9R A;  3PMF A;  3BDL A;  1EYC A;  3OSO A;  5DAU A;  5CC4 A;  5DEH A;  4J1M A;  4DFA A;  2F0T A;  4WOR A;  1NUC A;  1A2T A;  1EY4 A;  2RKS A;  3OWF A;  5KYI A;  2SNS A; 
#chains in the Genus database with same CATH topology
 3C1F A;  3FRP B;  3MWY W;  3GTO B;  2E74 C;  1BKB A;  4PZ6 A;  4DV5 Q;  3NE5 B;  4JI6 L;  1VQO A;  2C35 B;  4CKB A;  3GQB A;  3CC4 A;  4YWL A;  4JI2 L;  4XQJ A;  3KBG A;  4KY6 A;  1DD2 A;  1Z47 A;  1V1P A;  5EKI A;  3BS1 A;  2CW0 C;  1N32 L;  3I4N G;  1F9S A;  3F8T A;  4BBS B;  2PI2 E;  4X3T A;  1XWE A;  1HNZ Q;  1G29 1;  3CC2 A;  4DPG A;  2NVX B;  4C1N K;  4L63 B;  5IOC A;  1SYB A;  2OF1 A;  2QEX A;  3PIP A;  1SNQ A;  2I5L X;  3KF8 B;  4UPA A;  1XMO Q;  2Q2U A;  2KEC A;  3CCM A;  1KAA A;  1OXU A;  4JI5 Q;  4CHT B;  2JA7 B;  2ZM6 Q;  1MSH A;  1JWU D;  2YYZ A;  5COY A;  4EX5 A;  4NMZ A;  4FF3 A;  1G6P A;  5JEA G;  1EY7 A;  1SE2 A;  3Q24 A;  4PG3 A;  1PYW D;  5HGQ A;  2QDL A;  5HUR A;  4RGT A;  4JG2 A;  1LT3 D;  1PH4 A;  1DJR D;  2F1M A;  2HDL A;  3QB3 A;  4KKT A;  5HGT A;  5IWA Q;  4OO1 G;  5IGF A;  3PSI A;  1EIH A;  1PFB A;  1D8L A;  1I4R A;  2RCN A;  3G6J B;  1I3Q H;  3E5S A;  3A7L A;  4N9T A;  3I7F A;  1HNZ L;  2B63 G;  1NJI C;  3JAM i;  1HQM C;  2K1B A;  3J80 L;  3HKZ G;  2WAC A;  4OWX B;  5ELE A;  1JMC A;  1XMO L;  3WWV A;  4CKC A;  1ZEQ X;  1WTO A;  1Q3L A;  4JI5 L;  2D9U A;  2ZM6 L;  3OTO Q;  2GVB A;  4KI0 A;  4G7Z C;  2NB0 A;  1WVL A;  5IE8 A;  2B2V C;  1JR0 D;  3GV6 A;  4XQN A;  1Q12 A;  2NVT H;  5IYD G;  1PH8 A;  1D1I A;  3PMF A;  4UHV A;  2A69 C;  5DAU A;  3MC0 B;  1ESF A;  5CMD A;  1TWC B;  4MTN A;  3STB C;  4RHS A;  3VR3 A;  3QWN A;  1RCV D;  5C4X B;  4KN7 C;  1GUS A;  5EJW A;  3HOZ B;  4C2M B;  3S2D B;  3C3L A;  4PQX A;  2WIN B;  1TWF H;  3S1Q B;  3HOU G;  1ICF B;  2G9H D;  2Z0S A;  5C4H A;  5EAY A;  4YCU A;  1JC7 A;  1KNE A;  2OCE A;  2PZW A;  4CJ0 B;  3DWA A;  3TS0 A;  4K6D A;  1N33 Q;  1MI2 A;  3PO3 G;  1YHB A;  3OTO L;  1H95 A;  2EIF A;  5IGC A;  2ZXP A;  1VQP A;  5FLX L;  1E24 A;  2L11 A;  1KLG D;  1BO0 A;  4JCV E;  4F8M A;  3PIO A;  1NAP A;  3H91 A;  4A3J G;  2OWO A;  3KBX A;  4KHV A;  1VS0 A;  2RHS B;  3CP0 A;  1W3S A;  3HEJ A;  2Z8L A;  4A3C G;  3S9W A;  5IYB G;  4A3E B;  3I4N H;  3HKS A;  2EYL A;  4BY7 B;  4H7B A;  1HFG A;  2WKD A;  2Z6K A;  5A35 A;  2AKW B;  1B2T A;  4A3F B;  1UE7 A;  3A55 A;  1Q8K A;  1TR5 A;  1EEI D;  3J81 L;  1N33 L;  1EU3 A;  3EFX D;  1GUG A;  3J81 i;  2MO1 A;  3PIP 3;  3GTK B;  3S14 B;  1NR2 A;  1IL2 A;  4QJF A;  1EWH A;  1UWV A;  5JEA H;  1Q82 C;  1SRU A;  3SE0 A;  1WTR A;  1MIU A;  1MBY A;  1MKH A;  4V0B A;  1IW7 D;  3GV3 A;  5IGD A;  4IPG A;  2NWG A;  3H94 A;  4OO1 H;  1X54 A;  4RHR A;  4B9X A;  4CDE C;  3ERQ A;  2ICI A;  1SMX A;  1EZ6 A;  4A3L G;  4ZAI A;  3V2T A;  2Q2H A;  4OWT B;  4HJ5 A;  2B63 H;  1TT2 A;  5J22 A;  2X69 A;  3K5O A;  4HID A;  3JAM E;  4KY5 A;  1H9J A;  2CVR A;  3I91 A;  4P75 A;  4NXN Q;  5JPM C;  1LV9 A;  1FR3 A;  5EPL A;  1EUJ A;  3PO2 G;  2F0T A;  1A2T A;  2FMC A;  1D5M C;  1TWA H;  1VQ6 A;  4AYB G;  1XPU A;  2L55 A;  3ZJY C;  3KJP A;  1I4X A;  5EKL A;  2R61 A;  3VDY A;  2TSS A;  3FDT A;  2NVT B;  1BCP F;  3L2P A;  1ML0 D;  3DXJ C;  3I55 A;  1K0S A;  2MFI A;  1SNP A;  1BBU A;  2F0O A;  3CKI B;  2A73 B;  1X9N A;  4E6I A;  5IYD H;  1UEB A;  1YNN C;  4L5R C;  2OXP A;  3VR6 A;  2NUC A;  2D5D A;  1PRT C;  1SJH D;  5C4Z A;  4ABN A;  2KEE A;  1F2Y A;  4CDC C;  4IN3 A;  3Q8D A;  2I0Q A;  5EBC A;  4XTC S;  1H9K A;  2NYZ D;  1TWF B;  1KDA A;  1K9M C;  3U58 A;  3D4R A;  4NXN L;  4DR4 Q;  3VYR A;  4APV A;  1B9N A;  4FF2 A;  1EQR A;  3IL8 A;  5BN4 A;  1KHI A;  4M1U B;  1SE3 A;  2F0D A;  2D62 A;  5KYL A;  1SBB B;  2B2Y A;  2LKV A;  3QO2 A;  1A63 A;  3GTJ H;  2G5D A;  3H0G G;  1O7Z A;  3GDE A;  1STG A;  3EIV A;  1K73 C;  1WFQ A;  3QOL A;  1AFP A;  4A3J H;  1EYA A;  3OHX C;  1TWH H;  4KKS A;  3HRZ C;  5FLX E;  3PIO 3;  1AZP A;  3V05 A;  2MUY A;  2L4N A;  4UP7 A;  5JPN C;  4CKE A;  1VQG A;  1PH2 A;  4A3C H;  1SN8 A;  5IYB H;  4A3D G;  5G3L D;  5CV8 A;  3K59 A;  2PQE A;  4GN4 B;  2MO0 A;  1JJC B;  1Y1W B;  3DEO A;  3EQL C;  3J7Z C;  2I07 B;  3D8G A;  4DAY B;  4C3I G;  4ALP A;  4DR4 L;  4PMW A;  4DV0 Q;  1YJ9 A;  5T1I A;  2F4V Q;  4JBK A;  4PZ7 A;  2ZXR A;  3OIP A;  3MA2 B;  5C0X J;  3J81 E;  1EYD A;  4JYA Q;  1H9R A;  1CQF A;  2D2C C;  4RGM A;  1HZA A;  3CRL C;  5CC4 A;  1QVG A;  4BBR G;  1U4P A;  1FGU A;  4C56 C;  4WOR A;  3R93 A;  1YHQ A;  3RLN A;  3NWS A;  1SMY D;  2FMM A;  5IOD A;  4LUV A;  1S72 A;  2VUM G;  4POF A;  3HKZ B;  1NSN S;  3L9A X;  4XYQ A;  2R93 G;  1TWG H;  3CCR A;  1AH9 A;  2PW5 A;  2OTL A;  2Q8R E;  1C48 A;  3TBI B;  4DV0 L;  3CU7 A;  4P72 A;  2SDF A;  4YY3 Q;  2F4V L;  2BH8 A;  1CSQ A;  5LHY 1;  1HZB A;  1TWA B;  4LJZ C;  2ASB A;  3PO2 H;  4FF1 A;  3M3Y H;  2D0P A;  3E9H A;  2CWA A;  4B08 A;  1YIT A;  2E2J H;  1X3F A;  2K5W A;  4RH6 A;  3A56 A;  3HG9 A;  3U9S A;  5E4X A;  4N9P A;  1WD0 A;  5CBA E;  1LTS D;  3OWE B;  1D5X C;  4OEL B;  1PZK D;  3T4A C;  2M2L A;  4IPD A;  3E6Z X;  1B4O A;  1TS2 A;  4DV7 Q;  1PLF A;  3AEV A;  1B44 D;  2NZ1 D;  3AMU A;  1W2B A;  4YIJ A;  2BA1 A;  3J81 j;  3D4D A;  3NK9 A;  4RGN A;  4RWS C;  4KKU A;  1A15 A;  4DK6 C;  1JOR A;  2CWP A;  4DV6 Q;  3HOU B;  3J80 c;  4QY7 A;  4XT1 B;  4YY3 L;  1E3P A;  3NQT A;  3ULJ A;  3PO3 B;  3BVM A;  1HA5 A;  4KJN A;  1BBW A;  1X3E A;  3RZO H;  4DR7 Q;  5FO9 B;  2BCO A;  5CGK A;  4XIG S;  5BN5 A;  4QGU A;  1R4Q B;  2OQK A;  1HRJ A;  3H0G H;  4R8I A;  4O1N A;  1TWH B;  4DNT B;  4NKL A;  2XRS D;  2XNA C;  1OXS C;  1STA A;  2Q8I B;  2Y0S E;  1E7Z A;  2EY2 A;  5ISR A;  1EY6 A;  4DV7 L;  3RN2 A;  1XXG A;  3NSW A;  4RCN A;  3PF5 A;  1T5X D;  3PQI A;  3KF6 A;  5LMU Q;  4A3D H;  1A8V A;  3TP7 A;  4DR1 Q;  1KNA A;  1M90 C;  2L5T A;  1HCZ A;  1A3U A;  2HUG A;  2XN9 C;  2ZXO A;  4DV6 L;  1NBW A;  1YBY A;  4C3I H;  3A8J E;  2JEB I;  1LUZ A;  1PRT B;  2JN4 A;  1Q81 C;  3LNN A;  4DK0 A;  4DUY L;  1HTL D;  1SYG A;  5FOB B;  2F0K A;  4DR7 L;  1D7Q A;  2KCC A;  4GNX B;  4P73 A;  3I4M G;  3GTO H;  3M4Y A;  1ENC A;  1S3O A;  4J6H A;  4KV6 A;  3NXW A;  3UDG A;  5FLX c;  5ELB A;  2CH4 A;  2EDG A;  4LFC Q;  2RDF A;  2VW9 A;  2MHV A;  1IW7 C;  4BBR H;  4KN4 C;  3CCL A;  1PMR A;  3ER0 A;  3HOV B;  2CFM A;  1YZ6 A;  4QIW B;  1XTC D;  2CH4 W;  4BY7 G;  2F0W A;  1QWY A;  4KTA A;  4DR1 L;  2NVX H;  3RR5 A;  4A3F G;  3G4S A;  4HAE A;  4DXF A;  3F2C A;  1CKN A;  2B2U A;  2JXM B;  4KJO A;  2R93 H;  4I7Z C;  3KOJ A;  4IUN A;  2E76 C;  2Q2I A;  2TMP A;  5GRO A;  2BOS A;  4O42 A;  3J7A 5;  1KRS A;  2EXZ A;  3Q23 A;  2K28 A;  2K7V A;  1E2V A;  2FIN B;  1G91 A;  4AYB B;  1ICW A;  3J81 c;  1KTK A;  2IX0 A;  4LF6 Q;  1ROD A;  1GD7 A;  4QF4 A;  3NBH A;  1LTB D;  4A93 B;  4KHP Q;  4LFC L;  4R4T A;  3R2I A;  3RNU A;  1KAW A;  1EU4 A;  4K6L A;  5GAD C;  1SEB D;  3DMU A;  1QUQ B;  3T16 A;  1EL0 A;  2KVM A;  5EBD A;  1B70 B;  4PMC A;  3MTS A;  4LFA Q;  4IAL A;  3GTQ H;  3T13 A;  2GVA A;  4ME3 A;  4DAM A;  2Z4H A;  2BDN A;  2OQ0 A;  3IKJ A;  1ZXT A;  1V43 A;  2N55 A;  4P71 A;  3L7Z C;  2B2T A;  4B3T Q;  1IKM A;  5M5Y H;  4JBJ A;  2LY7 A;  4CGY B;  2F0F A;  2JA9 A;  5ELO A;  4I65 A;  1DON A;  3H0G B;  4Y52 H;  1VF7 A;  5KIX A;  1VQK A;  4LF6 L;  3BDL A;  4GKJ Q;  2K6A A;  1E0B A;  4DV2 L;  4KHP L;  1NE3 A;  5KYI A;  3J7A F;  4YCW A;  1J6Q A;  3BZD B;  1VMP A;  4X3U A;  4FF4 A;  3MXN A;  1EFI D;  1TWC H;  1A3V A;  4A3D B;  3TP5 A;  1RHP A;  4LFA L;  1S5C D;  4M8A A;  5C4X H;  1PV4 A;  1L0W A;  3S2D H;  1B3A A;  5C0X G;  3CXC A;  2UUC Q;  2SOB A;  2IW3 A;  3KF8 A;  1QVF A;  2F0G A;  1G2S A;  4EQ5 A;  1DOM A;  1HJP A;  1J5E Q;  2IJ0 A;  4C3H G;  4LUO A;  2DNC A;  4B3T L;  1BXT A;  3CCV A;  3F1Z A;  1WTH A;  4KLK A;  1FJG L;  2K5V A;  1CUK A;  3CQZ B;  2ID0 A;  3NWT A;  4B9W A;  3I4M H;  1SYF A;  1QB5 D;  5EPJ A;  3GTP H;  4GKJ L;  2RBM A;  1YIJ A;  1W6J A;  1F9Q A;  5LL6 S;  4BBR B;  1Z9F A;  4KD3 A;  1WI5 A;  1YNJ D;  3TDQ A;  5BN3 A;  3ERS X;  1L1O C;  1JJ2 A;  2ES2 A;  4K5X A;  4TQU S;  2EJF C;  3U4V A;  4B3S Q;  5K36 G;  4MTK A;  3BVZ A;  4A3E H;  1UEA B;  1LTL A;  2VUM B;  1Y1W G;  4BY7 H;  1SMY C;  3UE0 A;  4KHZ A;  1MD2 D;  4A3F H;  1BBX C;  4S3S A;  2R7Z G;  2R93 B;  2R6G A;  4IFD I;  4GLV B;  3X3M A;  3QJY A;  3L0O A;  5M5X H;  1KD1 C;  4EQO A;  1PH5 A;  1SE4 A;  1J5E L;  2EE1 A;  3BG3 A;  2RA4 A;  3GTK H;  2HDM A;  3S14 H;  5DLQ E;  1QJO A;  4DXG A;  1MHW C;  4DV5 L;  4H02 A;  2GN5 A;  3A74 A;  1PYS B;  2K03 A;  5CV9 A;  1E1T A;  2LSS A;  3C46 A;  3TP6 A;  2WFW A;  1N9W A;  4DN4 M;  4DK3 C;  5HY6 A;  3TZD A;  1X32 A;  3SEB A;  3JAM L;  1V1O A;  4B3S L;  1NTG A;  4DU9 A;  1HNX Q;  1X3G A;  1P16 A;  2B8G A;  3SGI A;  3J7A V;  4IJH A;  1LTI D;  3GTQ B;  2N49 A;  4IUV A;  1I4P A;  1EYC A;  1HTP A;  1PTO D;  1L0X B;  1V1P B;  4KMU C;  1YJN A;  4DNI A;  4FP5 D;  3CPW A;  1VQE A;  2A1A A;  5ELD A;  5M5Y B;  2PZU A;  3K7A B;  1VQN A;  3PF4 A;  3S15 H;  4A3G G;  1Q8I A;  1VF5 C;  2IL8 A;  3W3A A;  2AQ2 B;  5C5L A;  2C5C A;  2DGY A;  2XWJ B;  4KK7 A;  3MHB A;  4KY7 A;  4OGQ C;  2ENB A;  5IWA L;  1GKH A;  1XX8 A;  2KUM A;  3D31 A;  5FJ8 G;  1VMC A;  1HNW Q;  2F03 A;  4HSP A;  4ME5 A;  1XYI A;  1AW7 A;  2EOT A;  2UXC Q;  4CBV A;  3R8B A;  2LMC B;  1ONL A;  1HNX L;  4OEM B;  5ELN A;  2RDH A;  3ND9 A;  1STE A;  1E1O A;  1WTV A;  3RUZ A;  3OW7 A;  2Q8T A;  4EVO A;  2RSO A;  3TP8 A;  1B50 A;  4F88 A;  1IL8 A;  1AE3 A;  4HR7 B;  1RIP A;  1I6H H;  4V19 0;  1B3Q A;  1VQI A;  4K14 A;  3VYS A;  3S1M H;  1Y8O B;  1GM5 A;  1CKO A;  2WAQ G;  5CBE E;  3EA6 A;  4CDD C;  3OW2 A;  1VQ9 A;  4L8J A;  2LS0 1;  4C3H H;  3E3X A;  1C0A A;  2O4X A;  2O5J C;  1SDF A;  1KLU D;  4A3I G;  2JA5 B;  3I4M B;  2VNU D;  5F2D A;  2A6H D;  3GTP B;  2ICE C;  4ZUJ A;  1YVC A;  5M3M G;  2K75 A;  2R3Z A;  1TY2 A;  2V4D A;  2UUB Q;  1WTW A;  4DR3 Q;  2BE5 D;  1JOK A;  1H9M A;  1HNW L;  2ZJP A;  3NTH A;  4R8N A;  1GUO A;  3S16 B;  1Q46 A;  1R4P B;  1VQ4 A;  2UXC L;  1O7Y A;  4TSS A;  4CJ2 C;  4ODG A;  3EVQ A;  4DA2 A;  2JE6 I;  5K36 H;  2NZO A;  3DWP A;  4OON A;  1Y1W H;  1JIC A;  4JI3 Q;  3K0Y A;  3KUP A;  1TS3 A;  2KEN A;  2A5H A;  5FK9 C;  2WB1 B;  4PNY A;  5M5X B;  2R7Z H;  1UE1 A;  1XMQ Q;  1JOQ A;  2EYP A;  4YCV A;  2ZTD A;  5IGG A;  1Q90 A;  2L0C A;  1SXT A;  1JJG A;  1PZI D;  3RMH A;  1IZ6 A;  1CHQ D;  1V8Q A;  3H09 A;  3SHL A;  4R1J A;  1VQA A;  1K8A C;  2IY5 B;  5DEH A;  1SFO H;  2UUB L;  1NY4 A;  1EY4 A;  4DR3 L;  1EEF D;  3PGZ A;  1VQD A;  2HHH Q;  1RJT A;  3HOV G;  4ZQ3 A;  1OXX K;  1B7Y B;  3ULP A;  1WYD A;  1S5F D;  2QGQ A;  2AMC B;  4JI3 L;  3RZD H;  5J39 A;  3PUX A;  1EIG A;  3AB9 A;  4XYO A;  3VR2 A;  3CRK C;  3K8A A;  4A3B B;  1XMQ L;  1L1O B;  1CM9 A;  1WJJ A;  5EGT A;  3N52 A;  3SK5 A;  4WJW A;  2AQ1 B;  4A3K G;  4OX9 Q;  4ULL A;  1K8G A;  3OOC A;  3S15 B;  4IPH A;  1A3T A;  5AFW A;  1VQH A;  2DJF C;  4A4I A;  3KLW A;  4A3G H;  5M3F G;  2YTY A;  1CI3 M;  5KEE A;  3TRE A;  1LTR D;  1Y1V G;  3BDC A;  1RF2 D;  3M4P A;  4FVM A;  5EPK A;  3TME A;  4A93 G;  3I72 A;  1UNS A;  3KLS A;  5KRU A;  2HHH L;  3D6W A;  1KL9 A;  2HQL A;  1K0R A;  5JJI A;  1QNK A;  4LW1 A;  4JI0 Q;  2X6L A;  4O0A A;  4A76 A;  4LF8 Q;  2I5H A;  2JA8 G;  2PYK A;  3AU7 A;  2NN6 G;  4OO1 I;  1I6H B;  1K8M A;  1LTT D;  3HOU H;  3S1M B;  3DWQ A;  2IX1 A;  3BJU A;  3PO3 H;  4C3H B;  3DUZ A;  4OX9 L;  4QUC A;  3R3O A;  2ZTE A;  1GVP A;  5ELF A;  3FPP A;  3TZU A;  2QCP X;  5CV6 A;  4LK1 C;  1SSO A;  2V1C C;  5IYC G;  2H5X A;  1U5K A;  2WKC A;  5M3M H;  2F3V A;  2DN8 A;  3H3V C;  3QIA A;  4MN3 A;  2DY8 A;  4NPS A;  3A8K E;  3TSS A;  4JI0 L;  4LWC A;  3MEH A;  4RG1 A;  4LF8 L;  1YNJ C;  2NTT A;  4MNO A;  1CA5 A;  1DOL A;  4X66 Q;  3UE1 A;  2R7Z B;  4HCE A;  1XNR Q;  1GUN A;  3HOY G;  2K52 A;  4GOP C;  1KC8 C;  2A19 A;  3I8Z A;  3P20 A;  4POG A;  1NCV A;  1S4Z A;  5J3B A;  3CCJ A;  3A7A B;  1CQV A;  3K6O A;  2KCN A;  2B29 A;  3HS0 C;  1FD7 D;  1SFO B;  2PCF B;  2EYO A;  1RDP D;  2EYH A;  1XPO A;  5C5M A;  2A6E D;  3BYY B;  3W2D A;  4TVA B;  3D6C A;  2F0H A;  4F87 A;  3CAM A;  1JWS D;  3MXG A;  1B8A A;  4QUF A;  5C44 G;  1PHJ A;  1A62 A;  1T9H A;  3L3O C;  3HOV H;  1VQ5 A;  2CKZ B;  4A3L H;  1SAP A;  3HOX G;  5JVG 3;  5E4W C;  3RZD B;  4PZ8 A;  4X66 L;  5GAE C;  1U4L A;  3MAQ A;  1LAC A;  1ASZ A;  3H3V H;  1JQY D;  3OMC A;  1STN A;  1XNR L;  2HCI A;  4K5W A;  1XPR A;  4IOC A;  2YU9 B;  1WCM G;  1XJV A;  1PTO C;  5D3D A;  3C1E A;  1EYG A;  4A3K H;  1SYE A;  1I50 H;  3A5Z B;  4JYA L;  4A3G B;  2IHF A;  3A54 A;  1I4H A;  2B3G A;  3BZK A;  2KHI A;  2DUD A;  4ZK9 B;  3PUZ A;  2J7Z A;  3DEP A;  2F0V A;  5I2Y A;  4A93 H;  1BCP D;  2CQA A;  1LM0 A;  3TS2 A;  1LYL A;  3LGJ A;  4AH6 A;  3SR1 A;  1YJW A;  2OT2 A;  1WTP A;  3C2P A;  2JYO A;  1J8I A;  2QA4 A;  1NR4 A;  1NMF A;  4XT3 B;  2JA8 H;  2RVL A;  3MVV A;  1GXD C;  3FKI B;  2I46 A;  2NN6 H;  4QQB X;  2UXD Q;  2PNR C;  4P2C B;  4IO9 A;  3ONA B;  3JAM c;  4DR6 Q;  1VQ7 A;  2KHS A;  1Z7T A;  2K33 A;  3K5L A;  5JEA J;  1D6E C;  1WTQ A;  5FO7 B;  1AZQ A;  2WAQ B;  1QZH A;  5I9O A;  1A2U A;  1EZ8 A;  2B2T C;  1MSG A;  4B3M Q;  1CZG A;  5CR3 A;  4A3I B;  4GNX A;  3VA7 A;  4GN5 A;  5IT9 E;  1TS5 A;  3KDF A;  1PZJ D;  5M3M B;  5IYC H;  2N78 A;  2YTV A;  2A6H C;  4X3K A;  3FP9 A;  5C4J B;  3X3N A;  3U4Z A;  4FNF A;  3TQY A;  2VQF Q;  4DR2 Q;  2BE5 C;  1EWC A;  2VXW A;  2A68 D;  2ALY B;  5J1Z A;  4DV3 Q;  4HIK A;  2F3I A;  4IJL A;  3WOE A;  3I73 A;  3RN5 A;  1G51 A;  1WD1 A;  3K7U C;  2UXD L;  3QR8 A;  1P8L A;  2FJ2 A;  2QKI C;  1GUW A;  1PRT F;  5I6W A;  4DR6 L;  1GHK A;  4TRD A;  3I70 A;  2H4O A;  4JOI C;  3U9O A;  3HOY H;  4EQN A;  4B3M L;  2R92 G;  3NUC A;  1CT1 D;  2JA5 G;  3AYH B;  2EZV A;  2IPK D;  2PMZ B;  3CQZ H;  3SVM A;  1Q86 C;  1IYU A;  1JB7 A;  4OXP A;  3HOW B;  1E2W A;  4YWK A;  3P1H A;  3K57 A;  4CDF C;  4I7A A;  4BWG B;  1DCZ A;  3T53 B;  1BF4 A;  2J4X A;  3OYY A;  2VQF L;  1ASY A;  4DR2 L;  2WII B;  5C44 H;  1PFN A;  4QCL A;  1X6O A;  5A2Q L;  1IBK Q;  5LMU L;  4DV3 L;  1A0I A;  2VUM H;  4KD4 A;  1ENF A;  2JK8 A;  3HOX H;  3KFU A;  5I2X A;  3S1N H;  5CV7 A;  5K5P A;  5EQ0 A;  1D5Z C;  1HH2 P;  1SYC A;  2CQO A;  2WB1 G;  4JBW A;  5KND A;  4X65 Q;  1STB A;  1ET9 A;  3MFG A;  4DV4 Q;  3KYH C;  3HKZ E;  4A3M G;  1QCB D;  3S17 B;  1OXV A;  1WCM H;  4DV1 Q;  1HZ9 A;  3KF6 B;  2VQE Q;  1I50 B;  4A3K B;  1R9T H;  2JA6 G;  4L5S A;  1B1Z A;  5FLM G;  1I6V C;  3TEH B;  2DJG C;  2UXB Q;  1F2L A;  1JWM D;  4CJ1 B;  1O7I A;  5M3F B;  2F4I A;  4LNQ A;  4NP5 A;  1YEZ A;  1FNV A;  1Y1V B;  4X64 Q;  1C7Y A;  4GOP B;  2A8V A;  1VQ8 A;  4HCS A;  2MGS A;  3D4W A;  2F0P A;  4ZLT F;  3CMA A;  2O5I C;  1GO3 E;  2VZA A;  1QZG A;  4U68 A;  1CK1 A;  4H13 C;  2F0J A;  1IBK L;  2PQA A;  2EPB A;  2JA8 B;  1HZC A;  3KLR A;  1PH3 A;  1QG7 A;  1H9S A;  3NTK A;  4X65 L;  2NVQ H;  3FEW X;  5D3I B;  4A3B G;  4HSV A;  4DV4 L;  1HR0 Q;  2B39 A;  5KNC A;  3VYU A;  1VQF A;  4DV1 L;  5T1G A;  4R9W A;  3K7A H;  2Z9H A;  5EKK A;  2VQE L;  1F9P A;  4DUZ Q;  3W1B A;  1HR0 W;  2UXB L;  4HJA A;  2F0U A;  4G57 A;  4H44 C;  1G8Z D;  4X64 L;  1Q1B A;  3DHQ A;  3D0F A;  3ERO A;  4IQZ A;  3T1Y Q;  1PTO B;  5C3X A;  5IGB A;  3HZX A;  3CD6 A;  1IHZ A;  3QOJ A;  4JI1 Q;  2MNA A;  1D1K A;  1XNQ Q;  4JBM A;  1HFN A;  3E9I A;  5M9O A;  4FXG C;  1EIF A;  4BS9 A;  5DM6 3;  1PYB A;  2Q2T A;  4DAP A;  2NVY B;  1TY0 A;  3PCO B;  3NBH B;  1ILQ A;  1EQT A;  2HD3 A;  3E0E A;  2LFN A;  3K80 C;  1N8R C;  1HR0 L;  1I4G A;  1EFW A;  3HOY B;  2M9V A;  1LTA D;  3PUW A;  1UUP A;  2HCC A;  2YV5 A;  2B2W A;  4IOA A;  4DUZ L;  4HMI A;  3EJI A;  3KJO A;  2AWN A;  3JC6 6;  2JA5 H;  1V1Q A;  1EQQ A;  4BY1 B;  3G48 A;  4NW2 A;  4UP8 A;  4OHJ A;  1GOZ A;  4FXK C;  1PA6 A;  4UAI A;  4JW0 A;  1FVI A;  1G6Z A;  3T1Y L;  1C8C A;  1X3P A;  4WJ4 A;  3NEM A;  2RQX A;  1II3 A;  2EY1 A;  4RA8 A;  5E7N A;  2A6E C;  5C44 B;  2NTS A;  4R4Q A;  3S16 H;  4JI1 L;  1XNQ L;  3ITP A;  1ILP A;  4GS3 A;  4IZ8 A;  3HOX B;  2EQS A;  2XIW A;  2Y0S G;  1Y14 B;  1G2T A;  3S1N B;  2Z6K C;  2E2H H;  1ZYR D;  1K28 A;  2UUC L;  5JJL A;  3T1H Q;  4QIW E;  4AIM A;  4UP9 A;  3M9B A;  5A2Q E;  4DKA C;  1HHV A;  1EWI A;  3SK6 A;  1Z6H A;  1Y8P B;  3IAY A;  2A74 C;  2K05 A;  3ICE A;  2EY6 A;  3MXN B;  5JAV A;  1WCM B;  4GZY C;  4A3M H;  3G7L A;  4O2D A;  5NUC A;  1R9T B;  2AUK A;  2VS1 A;  1YI2 A;  1S5B D;  3O13 A;  5KNB A;  1S5D D;  1N36 Q;  2JA6 H;  2MJ8 A;  5FLM H;  2FXQ A;  4PV1 C;  5D14 A;  2VB2 X;  2HT1 A;  2N88 A;  1W6K A;  2NZH A;  4AYB E;  1DGS A;  3GO5 A;  2GA4 B;  1HPC A;  1SR3 A;  4C3J B;  2E8G A;  1BQQ T;  5D65 A;  1BCP C;  4G4K A;  3LWU A;  4C1N I;  2EY5 A;  2JSO A;  4R4O A;  1DZ1 A;  4H0L C;  1MJE A;  2NVQ B;  1SE8 A;  3T1H L;  1HXY D;  3CC7 A;  2K5D A;  1EIY B;  2OEO A;  1ET6 A;  5C3E G;  3S1R B;  3J7Y W;  4A3B H;  2Z4I A;  2K4K A;  3ND8 A;  2F0M A;  5JJZ A;  2QIL A;  1UE6 A;  3CME A;  1AEX A;  5FO8 B;  3K58 A;  3Q0A A;  2L12 A;  3TN2 A;  3UI2 A;  1N36 L;  4ZYS A;  2SNM A;  4NXM Q;  3PV0 A;  2C9O A;  4K8I A;  3H6M A;  3J80 i;  1KRT A;  3IFD A;  3NTI A;  4GKK Q;  1KQS A;  2PNH A;  1SYD A;  3RLO A;  4RKL A;  3BDO A;  4FDB A;  1OXT A;  4K8J A;  3I56 A;  2ZTC A;  1S5E D;  5COR A;  2JEA I;  3LWE A;  2VB3 X;  1D2B A;  5M5W B;  3M4O H;  1CHP D;  3FKI G;  3ULL A;  2SEB D;  1DOK A;  2A68 C;  2K5N A;  1IKL A;  1PH7 A;  4GLX A;  1K83 H;  3E0J A;  4RAU C;  5C0X H;  1UAP A;  1IBL Q;  1J9O A;  2E2I H;  1F2M A;  2PW7 A;  2AWO A;  1WOC A;  1FNU A;  3A8I E;  1AE2 A;  5JVH 3;  3CCU A;  3GTG B;  2R92 B;  1X3Q A;  1Y8N B;  3DM1 A;  1EY8 A;  2B2Y C;  2R7D A;  4NXM L;  5E3F A;  1FL0 A;  2QF7 A;  4TKO B;  2JQO A;  1O78 A;  4EGV A;  4NB3 A;  1SRO A;  2KCM A;  5TSS A;  3GTM B;  1I4Q A;  3SXH A;  1K3B C;  4DNR B;  4JI4 Q;  2CCZ A;  1NNX A;  3OMG A;  3HFZ B;  4GKK L;  4AQY Q;  4A75 A;  1IYV A;  2H1E A;  3IRB A;  2CHB D;  3CW2 C;  1S40 A;  4IUR A;  4X3S A;  2K5Q A;  1OO9 B;  1LO5 D;  2E2H B;  1E22 A;  1IYJ B;  3I2Z A;  2KBN A;  3HP3 A;  1IBL L;  4LUZ A;  1MGS A;  5H1S E;  1L1O A;  5G3L F;  1VQM A;  4A3M B;  4Y7N H;  5C0X I;  2EVB A;  3MXU A;  1KAB A;  3UDX A;  5KGU A;  5GAH C;  3F2D A;  2JA6 B;  3F2U A;  3I4O A;  4LF5 Q;  3W1G A;  5I6Y A;  2KED A;  3HOW G;  1T5E A;  5JOB A;  4HIM A;  4JI4 L;  4K2L A;  3K81 C;  3TRZ A;  4AQY L;  4IFD J;  3URY A;  1TII D;  3UDI A;  3T56 B;  4XQQ A;  2VY3 A;  4RFB A;  3V96 A;  2O2L D;  1SJE D;  2KOL A;  4HJ7 A;  4YHH Q;  3NBI A;  1DXM A;  1WTX A;  2EJM A;  1BVS A;  1LT4 D;  5CV4 A;  2K14 A;  3M7G A;  1CZW A;  1CSP A;  3PUV A;  1BR9 A;  1EY5 A;  1QE6 A;  2F0N A;  3RD4 A;  2AHO B;  2DY7 A;  1EOT A;  5C3E H;  1PVO A;  4IPC A;  1M8A A;  1I3Q B;  2YU9 H;  1MJC A;  1EY9 A;  5AJ3 Q;  3P75 A;  1YHA A;  5IIF A;  3NEN A;  4LF5 L;  4IUQ A;  5C6A A;  1Y69 U;  1RD9 D;  4HIO A;  1LLR D;  2KQ3 A;  5C3W A;  1B53 A;  1Q1E A;  5LMN Q;  3B6Y A;  3J80 E;  3D3R A;  3UDF A;  3VA5 A;  4IUT A;  5FJ8 H;  2B2V A;  1JOO A;  1C4Q A;  1AN8 A;  1CKM A;  3M4O B;  5LMN W;  1PH6 A;  3I3C A;  4WRD A;  1VQC A;  5IY0 A;  1DYQ A;  2WV6 D;  1VCI A;  4YHH L;  1UE5 A;  2F52 A;  1K83 B;  3FKI H;  1BDO A;  4N8X 1;  2K32 A;  3S2H H;  2EYM A;  4DAY A;  2FFK B;  3CPF A;  5DNF A;  1F2Z A;  2E2I B;  4X6A H;  2RF4 A;  1TVX A;  1BCP B;  3AFQ A;  5IT9 L;  4OL7 A;  1U9R A;  5AJ3 L;  4MZ9 A;  4J1M A;  3KK7 A;  2RKS A;  3CCE A;  4A3I H;  4GNX C;  1SND A;  4B3R Q;  1U0L A;  2X6G A;  1JE5 A;  1PXU A;  4HTH A;  1CTM A;  4K5V A;  5LMN L;  1BUV T;  1C9O A;  3FMC A;  2MPM A;  5C4J H;  3WOF A;  4XXE A;  3FHW A;  1SNC A;  2UU9 Q;  4QL5 A;  2F0I A;  3G71 A;  2KHJ A;  3GD7 A;  1F9R A;  3QG1 A;  1PFS A;  3SDZ A;  2Y0S B;  3K5M A;  1RTO A;  1N34 Q;  4F7X A;  4G7H C;  3GP7 A;  3T51 B;  4HN7 A;  3VYT A;  2ATW A;  1VQJ A;  2F0E A;  1ZYR C;  5JJK A;  1VQB A;  1L0Y B;  4DK1 A;  3CCQ A;  3CF5 A;  2RCF A;  2D0O A;  4Y7N B;  2EYJ A;  5BR8 Q;  1LT6 D;  3I4N B;  2WB1 E;  4HJ8 A;  5L37 A;  4JI7 Q;  4FXD A;  4RMF A;  4FO2 A;  2IX3 A;  4BY1 G;  4JC0 A;  4HMJ A;  4B3R L;  2K5H A;  2Z6B A;  3HOW H;  4RKB A;  3M7N A;  2XSC A;  2MQH A;  2IT1 A;  2UU9 L;  2AQ3 B;  2HIV A;  2N3S A;  4ID6 A;  5IGE A;  1U4M A;  2JP1 A;  1X65 A;  1N34 L;  1X56 A;  3R2T A;  1O7L A;  3PUY A;  3S24 A;  2B2U C;  2CW0 D;  5C3E B;  4FYD A;  2I5M X;  3DM3 A;  4ZKB B;  2QEJ C;  1FNW A;  2EXD A;  3MEF A;  4K0K Q;  5I9P A;  5BR8 L;  4BA2 I;  3S17 H;  4BBS G;  1BOS A;  4JI7 L;  4IUU A;  2E5L Q;  2B63 B;  4ILW A;  1LAB A;  5I4D A;  3G6E A;  2M00 A;  1LT5 D;  5DM7 3;  4JV5 Q;  2XRQ D;  3OPO A;  1OTC A;  5M3F H;  1TS4 A;  3FVQ A;  1Y1V H;  4QMG A;  2ZJQ A;  1EQV A;  2PO4 A;  4C3J G;  2JA7 G;  2F3W A;  4MHE A;  1XTD A;  1A6X A;  4X62 Q;  3OSO A;  3Q6S A;  2SNS A;  1PH9 A;  3S2H B;  1ZKO A;  1IXR A;  1QOH A;  1M1K C;  2DNE A;  4DGZ A;  3GTL H;  4DR5 Q;  4LFB Q;  2RSN A;  2KCT A;  2EYF A;  4K0K L;  2ZJR A;  3M4Q A;  1GJX A;  3H3V I;  1JB3 A;  3SK8 A;  2E5L L;  2LXJ A;  3NEL A;  3MFY A;  1B9M A;  1JCK B;  2RDG A;  4NDX A;  4ZUI A;  1AP0 A;  4WFN 3;  3K0X A;  1GHJ A;  1KIX A;  3NQI A;  4JV5 L;  2KA7 A;  4RCO A;  1M4V A;  1K8O A;  4N8F A;  4IUP A;  3Q22 A;  4LAA A;  5CYU A;  1PTO H;  1HUM A;  3ZYY X;  2XWB B;  2MP1 A;  1TQO A;  3W5O A;  4GLA C;  5FKA C;  3EBE A;  4LMQ D;  4X62 L;  1DM0 B;  4DUY Q;  4JPB W;  3GTJ B;  1QIL A;  1GUT A;  2E75 C;  1JT8 A;  2ZT9 C;  2L9H A;  1QNU A;  4Q5V A;  3IFT A;  4A3J B;  1PH1 A;  2A69 D;  2NVY H;  4DR5 L;  4LFB L;  3MXP A;  2PI2 A;  3STB D;  5IP9 G;  2NN6 I;  2VL6 A;  1PFM A;  2QW7 A;  4IFD G;  1ESR A;  1PDQ A;  4LF4 Q;  2BDO A;  4BXX G;  3EN2 A;  2B2W C;  1BNZ A;  1U4R A;  2XVS A;  4GN3 B;  3WDN A;  3I90 A;  5C4X G;  3HOZ G;  5IP7 G;  1SNO A;  4MIU A;  5GAG C;  2BA0 A;  4BY1 H;  2P5Z X;  4J15 A;  2FHT A;  2YTX A;  1VQL A;  4LF7 Q;  1Q7Y C;  3A5U A;  3FPU B;  2F0Q A;  1NMG A;  2EJG C;  4GOP A;  1HUN A;  2K50 A;  1FGB D;  4UDU C;  4RGO S;  3F2B A;  4LF9 Q;  1HQR D;  4JI8 Q;  1QUQ A;  1SNM A;  3A0J A;  3VR5 A;  1YNX A;  2BH2 A;  3P7J A;  2IWH A;  2XGT A;  3KDF B;  1O80 A;  1TU2 B;  1EY0 A;  4JVZ A;  4L5Q A;  1HA6 A;  4OIJ A;  2Z1C A;  2XTI A;  1JE4 A;  4ZCK A;  4A3E G;  4DFA A;  4DAV A;  3H15 A;  3OWF A;  4LF4 L;  1I94 Q;  4BBS H;  1KXL A;  4BA1 I;  3BU2 A;  3BZC A;  4UY8 C;  2L15 A;  4XDX A;  5E1F A;  1TWG B;  3RLF A;  4LF7 L;  1E2Z A;  1STY A;  2UUA Q;  1QVC A;  3NPP A;  4C3J H;  2JA7 H;  3PO2 B;  3CHB D;  2LXK A;  4LF9 L;  3M3Y B;  3K5N A;  4Q0F A;  4Z9C B;  4JI8 L;  1RL2 A;  2E2J B;  4YWM A;  2IHE A;  1L2F A;  4G7O C;  1TXY A;  3AQQ A;  2L1B A;  4L5T A;  4P74 A;  2G9D A;  2PZT A;  1TKW B;  3HGB A;  4R4C A;  3GTL B;  1F77 A;  4DV2 Q;  2J0T D;  3S1R H;  1I5F A;  5ELC A;  1I94 L;  4ZRZ A;  1KDC A;  2WAQ E;  1CKN B;  3SK4 A;  3LX0 A;  4L6T B;  1PTO F;  4HED A;  4PMB A;  2B8F A;  3OIQ A;  1IBM Q;  1LTG D;  1EOV A;  2UUA L;  1RTN A;  3DLL A;  2K04 A;  2QDB A;  3RZO B;  1FJG Q;  4WJ3 M;  2WP8 J;  4OIK A;  2F0L A;  4U67 3;  5LL6 X;  5M5W H;  2JJQ A;  2KJX A;  4JI6 Q;  3CCS A;  4ZKC B;  2RHQ B;  3BVG A;  1YNN D;  4HJ9 A;  2AUJ D;  4JI2 Q;  2HQE A;  4JK1 C;  1PRT D;  4R4I A;  1K3R A;  4DF7 A;  2OTJ A;  1CFM A;  4J8Q A;  1KDB A;  5IP9 H;  1N32 Q;  1VDZ A;  1ENA A;  1SLJ A;  2PQA B;  4K2K A;  4IFD H;  1V9P A;  5CV5 A;  5GQO A;  2R92 H;  3GTG H;  3AFP A;  4BXX H;  2E2D C;  1RKN A;  1H9S B;  3U50 C;  5IT9 c;  1STH A;  3N6R A;  1CA6 A;  2NBF A;  3HOZ H;  5IP7 H;  2N8N A;  2K01 A;  4QB4 A;  4C2M H;  3M85 A;  1FYC A;  3MZ5 A;  3NP8 A;  4C3I B;  1IBM L;  3I4L A;  3GTM H;  3S1Q H;  4JOI A;  3KLS X;  2F0S A;  2HIX A;  3NHH A;  2PMZ E;  2PPB C;  4EQP A;  1X55 A;  3VR4 A;  1NUC A;  4OWW B;  2R7F A;  3BYT B; 
#chains in the Genus database with same CATH homology
 3C1F A;  3FRP B;  3MWY W;  3GTO B;  2E74 C;  3NE5 B;  4CKB A;  3GQB A;  4XQJ A;  3KBG A;  4KY6 A;  1DD2 A;  1Z47 A;  1V1P A;  5EKI A;  3BS1 A;  2CW0 C;  1F9S A;  4BBS B;  4X3T A;  1XWE A;  1G29 1;  2NVX B;  4C1N K;  4L63 B;  5IOC A;  1SYB A;  2OF1 A;  1SNQ A;  2KEC A;  1KAA A;  1OXU A;  4CHT B;  2JA7 B;  1MSH A;  1JWU D;  2YYZ A;  5COY A;  4NMZ A;  4FF3 A;  5JEA G;  1EY7 A;  1SE2 A;  3Q24 A;  1PYW D;  5HUR A;  4RGT A;  1LT3 D;  1DJR D;  2F1M A;  2HDL A;  3QB3 A;  4KKT A;  5HGT A;  4OO1 G;  5IGF A;  1EIH A;  1PFB A;  1I4R A;  3G6J B;  3E5S A;  3A7L A;  4N9T A;  1HQM C;  2K1B A;  3J80 L;  2WAC A;  5ELE A;  4CKC A;  1ZEQ X;  1WTO A;  1Q3L A;  2D9U A;  4KI0 A;  4G7Z C;  2NB0 A;  1WVL A;  2B2V C;  1JR0 D;  3GV6 A;  4XQN A;  1Q12 A;  1D1I A;  3PMF A;  2A69 C;  5DAU A;  3MC0 B;  1ESF A;  5CMD A;  1TWC B;  4RHS A;  3VR3 A;  3QWN A;  1RCV D;  5C4X B;  4KN7 C;  1GUS A;  5EJW A;  3HOZ B;  4C2M B;  3S2D B;  3C3L A;  4PQX A;  2WIN B;  3S1Q B;  2G9H D;  5C4H A;  1JC7 A;  1KNE A;  2PZW A;  4CJ0 B;  3DWA A;  4K6D A;  1MI2 A;  5IGC A;  2ZXP A;  5FLX L;  2L11 A;  1KLG D;  1BO0 A;  4F8M A;  1NAP A;  3H91 A;  3KBX A;  4KHV A;  3HEJ A;  2Z8L A;  3S9W A;  4A3E B;  2EYL A;  4BY7 B;  4H7B A;  1HFG A;  2WKD A;  5A35 A;  1B2T A;  4A3F B;  3A55 A;  1TR5 A;  1EEI D;  3J81 L;  1EU3 A;  3EFX D;  1GUG A;  3PIP 3;  3GTK B;  3S14 B;  1NR2 A;  1EWH A;  5JEA H;  3SE0 A;  1WTR A;  1MBY A;  4V0B A;  1IW7 D;  3GV3 A;  5IGD A;  2NWG A;  3H94 A;  4OO1 H;  4RHR A;  4B9X A;  3ERQ A;  2ICI A;  1EZ6 A;  4ZAI A;  3V2T A;  1TT2 A;  5J22 A;  2X69 A;  3K5O A;  3JAM E;  4KY5 A;  1H9J A;  2CVR A;  3I91 A;  5JPM C;  1LV9 A;  1FR3 A;  5EPL A;  2F0T A;  1A2T A;  2FMC A;  1D5M C;  2L55 A;  1I4X A;  5EKL A;  2R61 A;  2TSS A;  3FDT A;  2NVT B;  1BCP F;  1ML0 D;  3DXJ C;  1SNP A;  2F0O A;  3CKI B;  2A73 B;  4E6I A;  1YNN C;  2OXP A;  3VR6 A;  2NUC A;  2D5D A;  1PRT C;  1SJH D;  5C4Z A;  4ABN A;  2KEE A;  1F2Y A;  4IN3 A;  5EBC A;  4XTC S;  1H9K A;  2NYZ D;  1TWF B;  1KDA A;  3D4R A;  3VYR A;  1B9N A;  4FF2 A;  3IL8 A;  5BN4 A;  4M1U B;  1SE3 A;  2F0D A;  2D62 A;  5KYL A;  1SBB B;  2B2Y A;  2LKV A;  3QO2 A;  1O7Z A;  1STG A;  3QOL A;  1AFP A;  1EYA A;  3OHX C;  4KKS A;  3HRZ C;  5FLX E;  3PIO 3;  1AZP A;  3V05 A;  2MUY A;  2L4N A;  5JPN C;  4CKE A;  5G3L D;  5CV8 A;  3K59 A;  2PQE A;  1Y1W B;  3DEO A;  3EQL C;  2I07 B;  3D8G A;  4C3I G;  4PMW A;  5T1I A;  2ZXR A;  3OIP A;  3MA2 B;  5C0X J;  3J81 E;  1EYD A;  1H9R A;  1CQF A;  2D2C C;  4RGM A;  3CRL C;  5CC4 A;  1U4P A;  4C56 C;  4WOR A;  3R93 A;  3NWS A;  1SMY D;  2FMM A;  5IOD A;  3HKZ B;  1NSN S;  3L9A X;  4XYQ A;  2PW5 A;  2Q8R E;  1C48 A;  3TBI B;  3CU7 A;  2SDF A;  5LHY 1;  1TWA B;  4LJZ C;  4FF1 A;  4B08 A;  2K5W A;  4RH6 A;  3A56 A;  3HG9 A;  3U9S A;  5E4X A;  4N9P A;  1WD0 A;  5CBA E;  1LTS D;  3OWE B;  1D5X C;  1PZK D;  3T4A C;  2M2L A;  3E6Z X;  1B4O A;  1TS2 A;  1PLF A;  1B44 D;  2NZ1 D;  3AMU A;  4YIJ A;  2BA1 A;  3D4D A;  3NK9 A;  4RGN A;  4RWS C;  4KKU A;  1A15 A;  1JOR A;  3HOU B;  4XT1 B;  3NQT A;  3PO3 B;  3BVM A;  1HA5 A;  4KJN A;  5FO9 B;  2BCO A;  5CGK A;  4XIG S;  5BN5 A;  1R4Q B;  1HRJ A;  4R8I A;  4O1N A;  1TWH B;  4DNT B;  4NKL A;  2XRS D;  2XNA C;  1OXS C;  1STA A;  2Q8I B;  2EY2 A;  5ISR A;  1EY6 A;  1XXG A;  3NSW A;  4RCN A;  1T5X D;  3TP7 A;  1KNA A;  2L5T A;  1HCZ A;  1A3U A;  2HUG A;  2XN9 C;  2ZXO A;  3A8J E;  2JEB I;  1PRT B;  3LNN A;  4DK0 A;  1HTL D;  1SYG A;  5FOB B;  2F0K A;  2KCC A;  3M4Y A;  1ENC A;  4J6H A;  4KV6 A;  3NXW A;  5ELB A;  2EDG A;  2RDF A;  2MHV A;  1IW7 C;  4KN4 C;  3HOV B;  1PMR A;  4QIW B;  1XTC D;  2F0W A;  1QWY A;  4KTA A;  4HAE A;  4DXF A;  2B2U A;  2JXM B;  4KJO A;  4I7Z C;  4IUN A;  2E76 C;  2TMP A;  2BOS A;  4O42 A;  2EXZ A;  3Q23 A;  2K28 A;  2K7V A;  1E2V A;  2FIN B;  1G91 A;  4AYB B;  1ICW A;  1KTK A;  2IX0 A;  1ROD A;  4QF4 A;  3NBH A;  1LTB D;  4A93 B;  3R2I A;  1EU4 A;  4K6L A;  1SEB D;  3DMU A;  3T16 A;  1EL0 A;  2KVM A;  5EBD A;  4PMC A;  3MTS A;  4IAL A;  3T13 A;  2Z4H A;  2BDN A;  3IKJ A;  1ZXT A;  1V43 A;  2N55 A;  3L7Z C;  2B2T A;  1IKM A;  2LY7 A;  4CGY B;  2F0F A;  4I65 A;  1DON A;  3H0G B;  1VF7 A;  5KIX A;  3BDL A;  2K6A A;  1E0B A;  5KYI A;  3J7A F;  3BZD B;  1VMP A;  4X3U A;  4FF4 A;  3MXN A;  1EFI D;  1A3V A;  4A3D B;  3TP5 A;  1RHP A;  1S5C D;  4M8A A;  1B3A A;  5C0X G;  2SOB A;  2IW3 A;  3KF8 A;  2F0G A;  1G2S A;  1DOM A;  2IJ0 A;  4C3H G;  2DNC A;  1BXT A;  3CQZ B;  2ID0 A;  3NWT A;  4B9W A;  1SYF A;  1QB5 D;  5EPJ A;  2RBM A;  1W6J A;  1F9Q A;  5LL6 S;  4BBR B;  4KD3 A;  1YNJ D;  3TDQ A;  5BN3 A;  4K5X A;  4TQU S;  2EJF C;  5K36 G;  3BVZ A;  1UEA B;  2VUM B;  1SMY C;  4KHZ A;  1MD2 D;  1BBX C;  4S3S A;  2R93 B;  2R6G A;  4IFD I;  3X3M A;  3QJY A;  4EQO A;  1SE4 A;  2EE1 A;  3BG3 A;  2RA4 A;  2HDM A;  1QJO A;  4DXG A;  2K03 A;  5CV9 A;  3C46 A;  3TP6 A;  4DN4 M;  3TZD A;  1X32 A;  3SEB A;  3JAM L;  1V1O A;  4DU9 A;  2B8G A;  3J7A V;  1LTI D;  3GTQ B;  4IUV A;  1I4P A;  1EYC A;  1HTP A;  1PTO D;  1L0X B;  1V1P B;  4KMU C;  4FP5 D;  5ELD A;  5M5Y B;  2PZU A;  3K7A B;  1Q8I A;  1VF5 C;  2IL8 A;  3W3A A;  2AQ2 B;  5C5L A;  2C5C A;  2XWJ B;  4KK7 A;  3MHB A;  4KY7 A;  4OGQ C;  2ENB A;  1XX8 A;  2KUM A;  3D31 A;  1VMC A;  2F03 A;  4HSP A;  4ME5 A;  1XYI A;  1AW7 A;  2EOT A;  4CBV A;  3R8B A;  2LMC B;  1ONL A;  2RDH A;  3ND9 A;  1STE A;  1WTV A;  3RUZ A;  3OW7 A;  2Q8T A;  4EVO A;  2RSO A;  3TP8 A;  1B50 A;  4F88 A;  1IL8 A;  4HR7 B;  4V19 0;  4K14 A;  3VYS A;  1Y8O B;  5CBE E;  3EA6 A;  4L8J A;  2LS0 1;  2O4X A;  2O5J C;  1SDF A;  1KLU D;  2JA5 B;  3I4M B;  2VNU D;  5F2D A;  2A6H D;  3GTP B;  2ICE C;  4ZUJ A;  2R3Z A;  1TY2 A;  2V4D A;  1WTW A;  2BE5 D;  1JOK A;  1H9M A;  3NTH A;  4R8N A;  1GUO A;  3S16 B;  1R4P B;  1O7Y A;  4TSS A;  4CJ2 C;  4ODG A;  3EVQ A;  4DA2 A;  2JE6 I;  5K36 H;  3DWP A;  1JIC A;  3K0Y A;  3KUP A;  1TS3 A;  2A5H A;  5FK9 C;  2WB1 B;  4PNY A;  5M5X B;  1JOQ A;  2EYP A;  5IGG A;  1Q90 A;  2L0C A;  1SXT A;  1PZI D;  3RMH A;  1CHQ D;  1V8Q A;  3H09 A;  3SHL A;  5DEH A;  1EY4 A;  1EEF D;  1RJT A;  4ZQ3 A;  1OXX K;  1S5F D;  5J39 A;  3PUX A;  1EIG A;  3AB9 A;  4XYO A;  3VR2 A;  3CRK C;  4A3B B;  1CM9 A;  5EGT A;  3N52 A;  3SK5 A;  4WJW A;  2AQ1 B;  4ULL A;  3OOC A;  3S15 B;  1A3T A;  5AFW A;  1CI3 M;  5KEE A;  1LTR D;  3BDC A;  1RF2 D;  3TME A;  4FVM A;  5EPK A;  3I72 A;  1UNS A;  3KLS A;  5KRU A;  3D6W A;  1QNK A;  2X6L A;  2PYK A;  3AU7 A;  2NN6 G;  4OO1 I;  1I6H B;  1K8M A;  1LTT D;  3S1M B;  3DWQ A;  2IX1 A;  4C3H B;  3DUZ A;  4QUC A;  3R3O A;  5ELF A;  3FPP A;  3TZU A;  2QCP X;  5CV6 A;  4LK1 C;  1SSO A;  2WKC A;  2F3V A;  2DN8 A;  3H3V C;  3QIA A;  4MN3 A;  2DY8 A;  3A8K E;  3TSS A;  3MEH A;  1YNJ C;  2NTT A;  1CA5 A;  1DOL A;  2R7Z B;  4HCE A;  1GUN A;  3I8Z A;  3P20 A;  1NCV A;  1S4Z A;  3A7A B;  1CQV A;  3K6O A;  2KCN A;  3HS0 C;  1FD7 D;  1SFO B;  2PCF B;  2EYO A;  1RDP D;  2EYH A;  5C5M A;  2A6E D;  3BYY B;  3W2D A;  3D6C A;  2F0H A;  4F87 A;  1JWS D;  3MXG A;  4QUF A;  3L3O C;  1SAP A;  5JVG 3;  3RZD B;  5E4W C;  1U4L A;  3MAQ A;  1LAC A;  1JQY D;  3OMC A;  1STN A;  2HCI A;  4K5W A;  2YU9 B;  1PTO C;  5D3D A;  3C1E A;  1SYE A;  4A3G B;  3A54 A;  1I4H A;  4ZK9 B;  3PUZ A;  2J7Z A;  3DEP A;  2F0V A;  5I2Y A;  1BCP D;  2CQA A;  3SR1 A;  2OT2 A;  1WTP A;  3C2P A;  2JYO A;  1J8I A;  1NR4 A;  4XT3 B;  2RVL A;  3MVV A;  1GXD C;  3FKI B;  2I46 A;  2NN6 H;  2PNR C;  4P2C B;  3ONA B;  2KHS A;  1Z7T A;  2K33 A;  3K5L A;  5JEA J;  1D6E C;  1WTQ A;  5FO7 B;  1AZQ A;  2WAQ B;  5I9O A;  1A2U A;  1EZ8 A;  2B2T C;  1MSG A;  1CZG A;  5CR3 A;  4A3I B;  3VA7 A;  5IT9 E;  1TS5 A;  1PZJ D;  5M3M B;  2A6H C;  4X3K A;  5C4J B;  3X3N A;  4FNF A;  2BE5 C;  1EWC A;  2VXW A;  2A68 D;  5J1Z A;  3WOE A;  3I73 A;  1WD1 A;  2QKI C;  2FJ2 A;  1GUW A;  1PRT F;  5I6W A;  1GHK A;  4TRD A;  3I70 A;  2H4O A;  3U9O A;  4EQN A;  3NUC A;  1CT1 D;  2EZV A;  2IPK D;  2PMZ B;  3SVM A;  1IYU A;  3HOW B;  1E2W A;  3P1H A;  3K57 A;  4BWG B;  1DCZ A;  3T53 B;  1BF4 A;  2J4X A;  2WII B;  1PFN A;  4QCL A;  5A2Q L;  4KD4 A;  1ENF A;  5I2X A;  5CV7 A;  5K5P A;  5EQ0 A;  1D5Z C;  1SYC A;  5KND A;  4JBW A;  1STB A;  1ET9 A;  3MFG A;  1QCB D;  3S17 B;  1OXV A;  4A3K B;  1I50 B;  1B1Z A;  1I6V C;  1F2L A;  1JWM D;  4CJ1 B;  5M3F B;  2F4I A;  4NP5 A;  1FNV A;  1Y1V B;  4HCS A;  2MGS A;  3D4W A;  2F0P A;  4ZLT F;  2O5I C;  4U68 A;  1CK1 A;  4H13 C;  2F0J A;  2EPB A;  2JA8 B;  3KLR A;  1QG7 A;  1H9S A;  3NTK A;  3FEW X;  5D3I B;  4HSV A;  2B39 A;  5KNC A;  3VYU A;  5T1G A;  4R9W A;  5EKK A;  1F9P A;  2F0U A;  4G57 A;  4H44 C;  1G8Z D;  1Q1B A;  3DHQ A;  3ERO A;  4IQZ A;  1PTO B;  5C3X A;  5IGB A;  3HZX A;  1IHZ A;  3QOJ A;  1D1K A;  1HFN A;  5M9O A;  4FXG C;  4BS9 A;  5DM6 3;  4DAP A;  2NVY B;  1TY0 A;  1ILQ A;  1EQT A;  2LFN A;  3HOY B;  1I4G A;  2M9V A;  1LTA D;  3PUW A;  1UUP A;  2HCC A;  2B2W A;  4HMI A;  3EJI A;  2AWN A;  4BY1 B;  4NW2 A;  4OHJ A;  1GOZ A;  4FXK C;  4UAI A;  1G6Z A;  1C8C A;  1X3P A;  2RQX A;  1II3 A;  2EY1 A;  4RA8 A;  2A6E C;  5C44 B;  2NTS A;  3ITP A;  1ILP A;  4IZ8 A;  3HOX B;  2XIW A;  1G2T A;  3S1N B;  1ZYR D;  5A2Q E;  1HHV A;  3SK6 A;  1Z6H A;  1Y8P B;  3IAY A;  2A74 C;  2K05 A;  2EY6 A;  5JAV A;  1WCM B;  4GZY C;  3G7L A;  5NUC A;  1R9T B;  2AUK A;  1S5B D;  3O13 A;  5KNB A;  1S5D D;  2MJ8 A;  4PV1 C;  5D14 A;  2VB2 X;  2N88 A;  1W6K A;  3GO5 A;  2GA4 B;  1HPC A;  4C3J B;  1BQQ T;  5D65 A;  1BCP C;  4G4K A;  3LWU A;  4C1N I;  2EY5 A;  2JSO A;  1DZ1 A;  4H0L C;  2NVQ B;  1HXY D;  2K5D A;  2OEO A;  1ET6 A;  3S1R B;  3J7Y W;  2Z4I A;  3ND8 A;  2F0M A;  5JJZ A;  2QIL A;  1AEX A;  5FO8 B;  3K58 A;  3Q0A A;  2L12 A;  3TN2 A;  3UI2 A;  4ZYS A;  2SNM A;  3PV0 A;  2C9O A;  4K8I A;  3H6M A;  3IFD A;  3NTI A;  1SYD A;  4RKL A;  3BDO A;  1OXT A;  4K8J A;  1S5E D;  5COR A;  2JEA I;  3LWE A;  2VB3 X;  1D2B A;  5M5W B;  1CHP D;  2SEB D;  1DOK A;  2A68 C;  1IKL A;  3E0J A;  4RAU C;  5C0X H;  1UAP A;  1J9O A;  1F2M A;  2PW7 A;  2AWO A;  3A8I E;  1FNU A;  5JVH 3;  3GTG B;  2R92 B;  1X3Q A;  1Y8N B;  3DM1 A;  1EY8 A;  2B2Y C;  5E3F A;  2QF7 A;  4TKO B;  1O78 A;  4EGV A;  5TSS A;  3GTM B;  1I4Q A;  3SXH A;  4DNR B;  3OMG A;  1IYV A;  2H1E A;  2CHB D;  4IUR A;  4X3S A;  2K5Q A;  1OO9 B;  1LO5 D;  2E2H B;  3HP3 A;  1MGS A;  5G3L F;  4A3M B;  5C0X I;  2EVB A;  3MXU A;  1KAB A;  2JA6 B;  5KGU A;  3F2U A;  5I6Y A;  2KED A;  1T5E A;  5JOB A;  4K2L A;  4IFD J;  3URY A;  1TII D;  3T56 B;  4XQQ A;  4RFB A;  3V96 A;  2O2L D;  1SJE D;  2KOL A;  3NBI A;  1DXM A;  1WTX A;  2EJM A;  1LT4 D;  5CV4 A;  3M7G A;  1CZW A;  3PUV A;  1BR9 A;  1EY5 A;  1QE6 A;  2F0N A;  3RD4 A;  2DY7 A;  1EOT A;  1M8A A;  1I3Q B;  1EY9 A;  3P75 A;  5IIF A;  4IUQ A;  5C6A A;  1Y69 U;  1RD9 D;  1LLR D;  2KQ3 A;  5C3W A;  1B53 A;  1Q1E A;  3J80 E;  3D3R A;  3VA5 A;  4IUT A;  2B2V A;  1JOO A;  1C4Q A;  1AN8 A;  3M4O B;  3I3C A;  4WRD A;  1DYQ A;  2WV6 D;  1VCI A;  1K83 B;  1BDO A;  2K32 A;  2EYM A;  4DAY A;  2FFK B;  5DNF A;  1F2Z A;  2E2I B;  1TVX A;  1BCP B;  5IT9 L;  4OL7 A;  1U9R A;  4J1M A;  3KK7 A;  2RKS A;  1SND A;  2X6G A;  1PXU A;  4HTH A;  1CTM A;  4K5V A;  1BUV T;  3FMC A;  2MPM A;  3WOF A;  4XXE A;  1SNC A;  2F0I A;  3GD7 A;  1F9R A;  3QG1 A;  3SDZ A;  2Y0S B;  3K5M A;  1RTO A;  4F7X A;  4G7H C;  3GP7 A;  3T51 B;  4HN7 A;  3VYT A;  2F0E A;  1ZYR C;  1L0Y B;  4DK1 A;  4Y7N B;  2EYJ A;  3I4N B;  1LT6 D;  4FXD A;  4FO2 A;  2IX3 A;  4HMJ A;  4RKB A;  3M7N A;  2XSC A;  2IT1 A;  2AQ3 B;  4ID6 A;  5IGE A;  1U4M A;  2JP1 A;  3R2T A;  1O7L A;  3PUY A;  2B2U C;  2CW0 D;  5C3E B;  4FYD A;  4ZKB B;  2QEJ C;  1FNW A;  5I9P A;  4BA2 I;  1BOS A;  4IUU A;  2B63 B;  4ILW A;  1LAB A;  5I4D A;  2M00 A;  1LT5 D;  5DM7 3;  2XRQ D;  3OPO A;  1TS4 A;  3FVQ A;  4QMG A;  1EQV A;  2PO4 A;  4C3J G;  2F3W A;  4MHE A;  1A6X A;  3OSO A;  3Q6S A;  2SNS A;  3S2H B;  1ZKO A;  1QOH A;  2DNE A;  4DGZ A;  2RSN A;  2EYF A;  1GJX A;  1JB3 A;  3SK8 A;  3MFY A;  1B9M A;  1JCK B;  2RDG A;  4NDX A;  4ZUI A;  1AP0 A;  4WFN 3;  1GHJ A;  3NQI A;  2KA7 A;  4RCO A;  1M4V A;  1K8O A;  4IUP A;  3Q22 A;  4LAA A;  5CYU A;  1PTO H;  1HUM A;  3ZYY X;  2XWB B;  2MP1 A;  1TQO A;  5FKA C;  4LMQ D;  1DM0 B;  3GTJ B;  1QIL A;  1GUT A;  2E75 C;  2L9H A;  2ZT9 C;  1QNU A;  4Q5V A;  3IFT A;  4A3J B;  2A69 D;  3MXP A;  2NN6 I;  1PFM A;  4IFD G;  1ESR A;  1PDQ A;  2BDO A;  2B2W C;  1BNZ A;  1U4R A;  2XVS A;  3WDN A;  3I90 A;  1SNO A;  4MIU A;  2BA0 A;  2FHT A;  3FPU B;  2F0Q A;  2EJG C;  1HUN A;  1FGB D;  4UDU C;  4RGO S;  1HQR D;  1SNM A;  3VR5 A;  3P7J A;  2IWH A;  1O80 A;  1TU2 B;  1EY0 A;  1HA6 A;  4OIJ A;  2Z1C A;  1JE4 A;  4DFA A;  4DAV A;  3OWF A;  4BA1 I;  4XDX A;  5E1F A;  1TWG B;  3RLF A;  1E2Z A;  1STY A;  3NPP A;  3PO2 B;  3CHB D;  3M3Y B;  3K5N A;  4Q0F A;  4Z9C B;  2E2J B;  4G7O C;  2L1B A;  2G9D A;  2PZT A;  1TKW B;  3HGB A;  3GTL B;  1F77 A;  2J0T D;  5ELC A;  4ZRZ A;  1KDC A;  3SK4 A;  3LX0 A;  4L6T B;  1PTO F;  4HED A;  4PMB A;  2B8F A;  3OIQ A;  1LTG D;  1RTN A;  2K04 A;  2QDB A;  3RZO B;  2WP8 J;  4OIK A;  2F0L A;  4U67 3;  5LL6 X;  2KJX A;  4ZKC B;  3BVG A;  1YNN D;  2AUJ D;  2HQE A;  4JK1 C;  1PRT D;  4DF7 A;  1CFM A;  4J8Q A;  1KDB A;  1VDZ A;  1ENA A;  4K2K A;  4IFD H;  5CV5 A;  2E2D C;  1RKN A;  1H9S B;  1CA6 A;  1STH A;  3N6R A;  2NBF A;  2K01 A;  4QB4 A;  3M85 A;  1FYC A;  3MZ5 A;  3NP8 A;  4C3I B;  3I4L A;  3KLS X;  2F0S A;  3NHH A;  2PPB C;  4EQP A;  3VR4 A;  1NUC A;  3BYT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...