2EY6A

Crystal structure of staphylococcal nuclease mutant t41v
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDVPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey6A00
4DF7A 4QF4A 4HMIA 4NDXA 4QMGA 1IHZA 2F0KA 3NQTA 4F8MA 3MXPA 5IGBA 4IZ8A 4S3SA 3RUZA 2PW7A 2EY1A 4NMZA 2EYFA 1TT2A 3SK6A 5C3XA 3SHLA 1NSNS 2F0OA 3S9WA 2F0UA 3TMEA 4B9XA 3P1HA 2F3WA 4HTHA 3T13A 2F0LA 2NUCA 3C1EA 2F0VA 3HEJA 1F2ZA 4PMCA 4RKBA 3DMUA 2F0JA 5CV4A 1EY9A 5EGTA 4TRDA 1A3TA 5CV8A 4DGZA 5CC4A 5I9PA 4KY6A 5J39A 2M00A 4J1MA 4R8NA 2F0HA 1TQOA 2OF1A 4K2LA 1F2YA 1EY4A 5KGUA 2OEOA 3H6MA 2F0QA 3NP8A 1ENCA 2SOBA 2PZWA 3BDLA 3C1FA 5K5PA 1SNDA 5KYLA 1SYBA 3D4DA 4KD4A 1EYAA 4YIJA 3D6CA 1EY0A 5KIXA 2EYHA 2EYLA 1SYGA 2EY2A 4KD3A 1EYCA 4LAAA 1A3VA 3BDCA 1U9RA 3TP6A 3VA5A 4EVOA 1KAAA 5C4ZA 3PMFA 4IALA 4QB4A 3U9OA 4J6HA 5CV5A 1NUCA 3R3OA 5CV7A 4ZUIA 4PMBA 4K5XA 3QOJA 5C3WA 5J22A 1EY5A 1KABA 1JOOA 3QB3A 4K6DA 4N9PA 1EQVA 5JOBA 1A3UA 5IODA 5ISRA 4DFAA 2EY5A 1EY6A 1KDBA 3NUCA 1STGA 4B9WA 3OWFA 1II3A 2F0FA 2HQEA 5CV9A 5M9OA 2WACA 4K5VA 2SNSA 4K5WA 3NXWA 3SK4A 3TP5A 4ID6A 2PZUA 1ENAA 1SYEA 1JORA 2OXPA 4K8JA 2RKSA 1A2TA 2EYMA 2LKVA 3TP8A 2PYKA 5C5MA 5NUCA 1F2MA 4NKLA 4PNYA 5HURA 4KY5A 5IGCA 3TP7A 1KDCA 5I6WA 2EY6A 4KTAA 4KJNA 5IIFA 2KHSA 3MEHA 1KDAA 5CR3A 4E6IA 1RKNA 1EYDA 3QOLA 5KEEA 4KV6A 3SK5A 5KRUA 5EKKA 2PW5A 3EVQA 1SYDA 5I6YA 1JOKA 4OL7A 5KYIA 4IUNA 1SNOA 1A2UA 4ZQ3A 1STHA 5HGTA 5C6AA 2ENBA 5CV6A 5C5LA 4K2KA 2F0TA 5IOCA 1SYFA 3NK9A 1SNPA 5DEHA 1EZ8A 4N9TA 3T16A 4F7XA 4NP5A 2O4XA 2EYJA 3SXHA 5IGFA 5E1FA 3MHBA 5IGEA 5I9OA 5EKLA 3ITPA 5IGDA 1EY7A 1STBA 3OMCA 3OMGA 2PQEA 2F0GA 3EROA 2EXZA 2F3VA 4WRDA 2QDBA 2SNMA 3D8GA 3P75A 4G57A 4EQOA 2EYPA 3MVVA 2F0DA 3LX0A 3NHHA 4EQNA 1SNQA 2KQ3A 1STAA 2RDFA 3D4WA 3HZXA 3OSOA 5J1ZA 3V2TA 2F0WA 4DU9A 5E3FA 2F0NA 2EYOA 2F0IA 2RBMA 5C4HA 5F2DA 4ZUJA 1SNMA 4I65A 1EY8A 1EZ6A 1STNA 1SYCA 4K8IA 4KHVA 4WORA 2F0PA 2F0EA 3ERQA 4RKLA 4ODGA 5DAUA 1STYA 5IGGA 1JOQA 2F0MA 4EQPA 4KY7A 4HMJA 2F0SA 4K14A 1TR5A 3E5SA 3SK8A 4MIUA 1AEXA 3DHQA 3MZ5A 2PZTA 1SNCA 3EJIA 4KJOA 4H7BA 4ME5A 3SR1A 5CGKA 5JAVA
chains in the Genus database with same CATH superfamily
4QF4A 2CQOA 4RGOS 2K5WA 5EBDA 3G7LA 3CCJA 1BCPF 3J80L 3I2ZA 2QW7A 2D2CC 5FLXL 1YNND 4RKBA 1EY9A 4OX9Q 4TRDA 1ZYRC 2VQEL 1WTXA 1DZ1A 5FO8B 3QR8A 4O42A 1X65A 1XNQQ 2B2YA 1QZHA 4IO9A 4N8X1 2EJFC 1SYBA 4DV4L 4YIJA 3B6YA 1X56A 2EY2A 4YWLA 2BA0A 1YNXA 4CGYB 3M85A 5C3WA 2K04A 3PIPA 1GUOA 1LT6D 2KCCA 3HP3A 3GTGB 2A69C 1PTOD 2SEBD 1F9QA 1B9MA 2B2TA 1B1ZA 1CKOA 4IUTA 4IURA 2OTJA 4H02A 1F2MA 4FF4A 1BDOA 1RIPA 1FJGL 1JT8A 2JXMB 5I6WA 2BDOA 2R6GA 1BUVT 1QE6A 3EIVA 3QOLA 3FVQA 2WIIB 1RJTA 4L5SA 2ZTEA 1STHA 4X6AH 1PRTF 3OTOL 2VUMB 1I6VC 1STEA 5E7NA 1WI5A 2EYJA 5EAYA 1IKLA 1FJGQ 1WTHA 3MAQA 2EPBA 2F3VA 4X65L 4JOIC 1I4RA 5KNBA 2RDFA 3M3YH 3QG1A 3VYUA 2F0IA 4DR4L 3MTSA 4WORA 1SYCA 3ULJA 3ERQA 2K75A 1S4ZA 3RZOH 4BY7B 4K14A 1NAPA 3PGZA 3UDGA 3I4LA 1X54A 1A63A 2E2JB 1JORA 4DA2A 1S3OA 4BA2I 5LMNW 5JVG3 1CSQA 3M4QA 5GQOA 1GO3E 2N78A 2HT1A 1O7IA 2HD3A 5JJKA 4PV1C 4C3JG 2FJ2A 1PYWD 1EWIA 1UE7A 5CV8A 3U4ZA 4KY6A 1D8LA 4WFN3 2ZXRA 5IT9L 1D1IA 1YBYA 3GTJB 2AUJD 2K05A 3OYYA 1TY0A 4A3EG 3RZOB 3VR2A 1VQ5A 3JAME 4YCUA 4BA1I 2K52A 1U4LA 5M5WB 1SROA 2NN6H 4F87A 2ES2A 3KK7A 2AWNA 1Q3LA 3BU2A 4JPBW 3GTQB 2B2WC 2K1BA 5DNFA 1EYGA 2R7FA 2NYZD 3EQLC 1KDBA 1DM0B 1B7YB 2A68C 2F0FA 1DONA 4NXMQ 2UUCQ 1YVCA 2HQLA 3HFZB 2G5DA 3T1HQ 3H15A 2UUBL 3C46A 1SJED 1KDCA 1PMRA 2A6HC 4OONA 5CR3A 4E6IA 2N88A 2CCZA 1IYUA 3STBD 4OIJA 2B8FA 1CHPD 2DJGC 1LABA 1XTCD 4A93G 2YU9H 1PH1A 2UU9L 1SNPA 3QWNA 1IBMQ 4X3UA 4AH6A 2O4XA 5IGFA 1FNWA 4DV6L 3MXNB 3HOVB 1LM0A 1NR2A 1Z9FA 3TDQA 2N49A 3TZDA 3G4SA 3NHHA 3UI2A 1VQ6A 1JB3A 3VR4A 3W1BA 3KJPA 1IBKL 1KAWA 1PH3A 1YJNA 4FNFA 3L3OC 1U4PA 3W2DA 4BY1G 2AWOA 4EQPA 4RMFA 1KC8C 2XVSA 3F8TA 1SNCA 3S17B 2I0QA 4V190 4R4OA 4HCEA 3NTKA 1IHZA 4F8MA 3MXPA 1PH4A 4EGVA 4JYAL 1CK1A 4MTKA 3T51B 2KCTA 4EX5A 1F2ZA 1Z47A 3Q22A 1B3AA 5AFWA 3PIP3 1GHJA 1S5DD 2K5QA 1R9TH 1Y8NB 2Q8IB 4A3CG 1HZCA 1WTOA 4PQXA 3J81E 5KGUA 4DV7L 1A8VA 1SE3A 1FD7D 2LXJA 4UP9A 3VYSA 1YJWA 5C4XG 1MSHA 5GROA 5EKIA 4CKBA 2E2IH 4A3DB 3KBGA 1L1OA 3GD7A 3KUPA 2EY5A 1EY6A 1TS3A 1FYCA 3NUCA 4ZCKA 4BS9A 2B2TC 1PH2A 1YNJD 5CBAE 3TP5A 2EJMA 1K8AC 1EIGA 1BOSA 4QL5A 3GTMH 2MPMA 4PNYA 4AYBB 3TP7A 2NVYB 1W6JA 3KLSX 2KEDA 1S5BD 3EA6A 2MUYA 1L0YB 1OXSC 2KJXA 4AIMA 3AFQA 4A3DH 3IKJA 2PW5A 4C3HB 3SVMA 2UUAQ 1FGBD 1I50H 4HCSA 1TWFB 3NEMA 3M4YA 3PO3G 1AZQA 4JI1L 4MN3A 2JK8A 4IFDJ 1HCZA 1W3SA 1VQFA 1QILA 3X3MA 5E1FA 1VQIA 3FKIB 1HPCA 2PQEA 1EIHA 2F0GA 2EZVA 3MXUA 5IP9G 4A3BB 2XRSD 4CDDC 3V2TA 1UE5A 4LF9Q 5E3FA 2K7VA 2Q2HA 3W5OA 4K8IA 2R92H 1J8IA 4OWTB 2D5DA 2F0PA 4RKLA 4JI1Q 4FF2A 2ATWA 2F0MA 2KCNA 1NCVA 4JI8Q 4HMJA 1EIYB 4MHEA 4KKUA 3L9AX 2JEBI 2WB1B 4FO2A 4KLKA 1EQTA 3RZDB 1XX8A 2Z6KC 3KLSA 4KJOA 1TWAB 3HOUH 4KN7C 3KF6A 4DF7A 1S5FD 4NDXA 3M9BA 4X65Q 1EQQA 2R7ZH 3I4MG 1CZWA 4U673 1XMOL 4DAYB 1NNXA 2VQFQ 1H95A 2F0OA 4DR3Q 1NMFA 5JJIA 5EBCA 3PO2B 2F0VA 3HEJA 3SHLA 4TVAB 1Y69U 5C3EH 2R93H 1QNKA 3AFPA 1TQOA 3CKIB 3KLWA 3V05A 4CDEC 2E2JH 3I4OA 3F1ZA 3HRZC 1LTBD 1V1PB 5LL6S 3BDLA 4QCLA 1QG7A 3J80i 3D6CA 5KIXA 2EYHA 2EVBA 4HJ8A 1K9MC 1Y1WB 2IX0A 3VA5A 5IT9E 3CHBD 3PMFA 4UAIA 3RLFA 3NBIA 1BCPD 5JVH3 4IPGA 1VQ7A 2JA5B 2ZXPA 3NSWA 5GAEC 5ISRA 4RG1A 1JOOA 1Y1VH 1HJPA 3U9SA 2WKDA 4BXXH 3K57A 2YV5A 3URYA 2BE5C 1AH9A 1NJIC 2YYZA 3MEFA 4JBKA 3M4PA 3NXWA 4K8JA 4FXKC 1A2TA 4H44C 4NPSA 1JICA 5IWAQ 1S5CD 1GM5A 2ZTDA 2F3IA 2VB3X 3NQIA 4JI4L 3GTOB 5GADC 1VQLA 3T1YL 4R4QA 5KEEA 1PH7A 1PH5A 3CF5A 3TQYA 1JOKA 4IFDG 2V1CC 4BBRH 1QVCA 2HCIA 3PIOA 3CQZH 5C5LA 2LY7A 2KVMA 1MI2A 2RVLA 3VYTA 4JI5Q 2CWPA 2HDLA 2L55A 1K8OA 3K6OA 1HH2P 4P74A 4DAYA 2QDBA 4QY7A 2F0DA 4RGNA 4C3IB 3MA2B 2F0WA 4YHHQ 1E7ZA 1YEZA 4C1NK 1VQ4A 4RCNA 5BN3A 2QCPX 1XJVA 4ILWA 4LUZA 1MIUA 3K58A 3J7AF 3SK8A 1CTMA 2PMZB 4JI2Q 2B29A 2UXBL 4RFBA 3VDYA 3EJIA 4HSVA 3RLOA 1J9OA 1FNVA 1LTTD 3ONAB 1KL9A 1T5EA 3D31A 3D6WA 4JI0L 3BYTB 1BBWA 2E76C 2MO1A 3R93A 3TS2A 2TSSA 3T56B 4DUYL 2H4OA 2IX3A 2F3WA 3BVZA 2F0LA 1KNEA 5IYCG 5D3DA 1H9JA 5K36G 3E0EA 1HNZL 2X69A 1PH8A 1O78A 3A5ZB 4R4CA 1EY4A 3ND8A 2XTIA 2HHHL 3SDZA 1G51A 4LF7L 2PI2A 5K5PA 3HOZH 1SE2A 1X3EA 4KD4A 3HOUG 3D0FA 5M3FB 2CFMA 1TS4A 4CJ0B 1EYCA 3BDCA 1SFOB 4LF6L 1D6EC 1C0AA 3J81i 3R3OA 5JJZA 2CH4A 4LW1A 1RTNA 2VZAA 4N9PA 1YI2A 4DUZL 4XIGS 2K32A 1AFPA 4B9WA 3F2BA 5FKAC 1YHAA 4JI3Q 1YHBA 2F1MA 5LL6X 4K5WA 2SNSA 1V1QA 2NVTB 2QA4A 3HOVH 1YZ6A 2EIFA 4K0KL 1CT1D 4A3EH 4X3SA 3UDIA 3TREA 4A3LG 2JA5H 2AQ1B 4HEDA 3CCLA 4GKKL 2HIVA 1TWCH 3ZYYX 2ZJQA 2Q2UA 1A2UA 3J81j 1PTOC 4WJ3M 3QIAA 2LS01 1SYFA 3QO2A 1I3QB 3P7JA 4BBSB 4N9TA 1MD2D 3GTGH 2OT2A 3OMGA 3S2DB 5IYDG 4DR1L 3AMUA 1K8MA 4GN5A 1HNXL 1SNQA 1ZEQX 1PTOB 3STBC 4DR5L 3PUXA 1EZ6A 1SR3A 1KRSA 5IGGA 1Q81C 1O7YA 4CDCC 2YTVA 1I4HA 2V4DA 2I5HA 4Q5VA 1CKNB 3HKZB 4LF5L 1UWVA 4DXFA 2LXKA 4B9XA 1PDQA 5C3EB 3Q23A 1L1OC 5JEAJ 2Z9HA 1VF5C 3A8KE 4DR1Q 1R4QB 4FXDA 5FJ8H 3I3CA 1PHJA 2A1AA 5M5XB 2JA8B 2A19A 4OO1H 1N34L 3T13A 2AQ2B 2Q2TA 3E0JA 4G7OC 4LFBL 1PXUA 3DEOA 4DR7Q 4J1MA 1VDZA 2EJGC 2F0HA 3MWYW 2Q8RE 3GO5A 2OEOA 1L2FA 3H6MA 4L5TA 3NP8A 4POGA 1E1OA 4MNOA 1QUQB 2N3SA 1EYAA 1QCBD 4IQZA 3H91A 4DPGA 3PF5A 1LV9A 3VR5A 2MQHA 3UE1A 2A74C 4BBSG 2WV6D 3QB3A 4DR7L 4A4IA 2Q8TA 3HOWG 3IFTA 4IUQA 1K3BC 4X66L 4DV3Q 1WCMG 3NELA 1Y1WG 3PUZA 2NVXB 1EIFA 1E2WA 3VR3A 5FLXc 4UP8A 4XQJA 4XQQA 1HZ9A 1K0RA 4NKLA 3H0GG 4B3TQ 5A2QE 2QGQA 1AE3A 1JWSD 3LWEA 3RN5A 4DAPA 4GZYC 1KXLA 4ZRZA 2YTXA 1SJHD 2WFWA 3OIPA 3I4NB 4G4KA 1XPOA 1XPRA 2IWHA 2MO0A 5FO9B 3CXCA 2ZM6L 1X3GA 2M2LA 2IW3A 2F0TA 1TY2A 1H9KA 2C5CA 1HQRD 3CCMA 3S16B 4CJ1B 1DOMA 4PG3A 1GXDC 4B3TL 5G3LD 4ZK9B 1STBA 4KKTA 1Y8OB 3X3NA 4QUFA 4A3EB 2PPBC 2SNMA 4YWMA 5GAHC 2P5ZX 1HUNA 1JJCB 1TWCB 2KA7A 1BBXC 2EYOA 1EQRA 3RLNA 2UXDQ 4OX9L 2B63G 5C44B 3NE5B 1DYQA 2ZM6Q 3I4NH 2WAQB 1KLGD 3BDOA 4JI5L 3WOFA 3GTQH 1XNRQ 3EBEA 4UY8C 4B08A 5I2XA 5JAVA 5C0XG 2YU9B 1BXTA 3OW2A 4IOCA 3NQTA 1HFNA 2WB1G 2XWBB 4ME3A 4S3SA 3RUZA 3TEHB 1MGSA 1CSPA 2AQ3B 5BN4A 3S2HH 5CV4A 2NUCA 3EFXD 1L0XB 5I9PA 1OXTA 4A3FG 4YY3Q 4LF8L 3KLRA 1SBBB 3T4AC 4NB3A 1F9RA 1IL2A 1PTOF 4UDUC 4APVA 2PZWA 3OWEB 4JK1C 4OWWB 3ND9A 4DV1Q 1TU2B 4JI0Q 1Q12A 3UDFA 1H9MA 2K6AA 1LO5D 1A3VA 1S72A 4R4TA 3UDXA 4DV2L 4OO1G 4J6HA 4JVZA 1O80A 4XXEA 1VQAA 1I4GA 1C8CA 2AMCB 4YY3L 3TZUA 1KABA 1HNZQ 4DN4M 2K5VA 1CHQD 1YJ9A 1HUMA 2RCFA 1NTGA 1A0IA 1II3A 1AZPA 4LUVA 4K5VA 1GJXA 1C4QA 4A3IG 2KOLA 1H9SB 4A3BH 4OO1I 3GQBA 1WJJA 3R2IA 4TKOB 4Q0FA 3HKSA 5C5MA 1QUQA 4IPCA 5C44G 3L0OA 1ICWA 4KTAA 3FRPB 3AU7A 1XMQQ 4R4IA 3WWVA 1V8QA 4BBSH 1VQPA 1NBWA 2CHBD 3P20A 4HJ7A 4OL7A 4FVMA 5LMUL 1LLRD 2Z4IA 1PFBA 3VYRA 2L9HA 2PO4A 4F7XA 3BZCA 1GHKA 5EKLA 4POFA 1EY7A 1QWYA 1LTSD 3G71A 2I5LX 1I4QA 3Q6SA 3EROA 4G57A 3J7A5 5AJ3L 3DXJC 2VUMH 4EQNA 1T9HA 2E8GA 2ZXOA 2Z4HA 2F0NA 5IYCH 4L5RC 1E22A 1K8GA 4JBMA 4ODGA 2E74C 5IYBH 4PZ8A 4WJ4A 4XT3B 5KNCA 2MNAA 1N33Q 1Y1WH 3K7UC 4L8JA 2VB2X 3K7AB 1E24A 4LJZC 4IFDH 1FGUA 1QOHA 1ASYA 1EEID 1SFOH 1EOVA 1X3PA 2Z8LA 5JPNC 1HNXQ 4GOPA 2FINB 3S9WA 2HCCA 3M7NA 3ERSX 4EQ5A 5M5WH 4DR5Q 4AYBG 1AE2A 1KTKA 3EN2A 1A3TA 3NPPA 3FP9A 1FVIA 2JA6B 1K73C 2NVQB 4R1JA 4LF5Q 2N55A 4FF1A 2SOBA 3RN2A 2GN5A 1FL0A 4G7ZC 3CPFA 1OXXK 1EY0A 2HUGA 1X32A 1J6QA 1LTLA 3TN2A 5CBEE 1WTVA 2D9UA 1N34Q 1KRTA 4GKJL 3UE0A 4GLXA 4HIMA 3HOUB 4Z9CB 3E6ZX 2K5HA 4QIWE 4LFBQ 1KHIA 4JBJA 3A5UA 1JWUD 2B39A 2O5IC 1K83B 2MFIA 1EU4A 4N8FA 1JJGA 1VCIA 1HNWL 2K03A 1PH9A 1I4PA 5NUCA 4KY5A 4OXPA 3SE0A 3ZJYC 3KJOA 4JI7L 4XTCS 2GVBA 5E4WC 3Q24A 3KDFA 2F52A 3FMCA 2E2IB 1PLFA 1EYDA 2DGYA 5BR8L 2OTLA 1WVLA 4RAUC 3EVQA 5M5YB 2IHEA 3K59A 5G3LF 3H0GB 2R7ZB 5A2QL 2LFNA 1DJRD 1ET6A 1GUGA 2K5NA 2L0CA 1B8AA 1TIID 3ICEA 1F9PA 1AW7A 2FFKB 2PI2E 1N36L 1HNWQ 3S1QH 1K83H 3TRZA 3G6EA 2BDNA 1QJOA 5I9OA 1SXTA 3J7YW 4JI7Q 4RGTA 3OW7A 2RCNA 1SEBD 1UEBA 1BVSA 2R61A 1VF7A 1BKBA 1HR0L 2EYPA 2FMCA 4DK3C 2OQKA 2AUKA 1L1OB 5HGTA 3HOYB 1PZID 2DN8A 1N36Q 3E3XA 3OPOA 1IL8A 3HS0C 1JJ2A 3BJUA 1VQCA 1CM9A 5LHY1 1N32L 1KIXA 1Y1VG 2DNEA 4ALPA 1VQMA 3H09A 4BY7G 1LTGD 4BY1B 2EY1A 2BH8A 2H5XA 3KFUA 3GTPB 2IT1A 3PF4A 5J39A 3C1EA 3S17H 3A7LA 1I94Q 2WB1E 1ESRA 5HGQA 1WTPA 1QVGA 2O2LD 5ELDA 1GVPA 1LACA 3S24A 4NXNL 1B9NA 1X6OA 1SNDA 1WTWA 4V0BA 1XXGA 3BVMA 4KD3A 2D0PA 1U9RA 1LTID 4A3JG 1B3QA 2C35B 4PMWA 3K5NA 2JN4A 2E75C 1I94L 2B63H 4LF8Q 2NVYH 1LTRD 1RF2D 2WP8J 1G91A 1V1OA 1AN8A 2PNHA 5C4XB 2K33A 4R9WA 5CV9A 2HQEA 4NXNQ 5M5XH 2QEXA 4GNXC 3JAMc 1KD1C 1JR0D 4A3DG 4A3MH 2A73B 4C3JH 1PYSB 4DV4Q 2PYKA 2F4IA 1RD9D 1QB5D 3N6RA 1PRTB 4JI6L 2JEAI 4DV2Q 1Q8IA 4AYBE 1GOZA 1PFMA 1UAPA 2XGTA 3R2TA 5KRUA 1C7YA 2B2WA 3GTMB 1SYDA 4LF9L 2NN6G 3BVGA 4L6TB 2RDGA 1EFID 1IBLQ 1CKMA 1GUSA 5CV6A 1RCVD 3IAYA 1C48A 4DXGA 3M4OH 5IOCA 5ELFA 1TWGH 4I7AA 1KNAA 4GOPC 2JE6I 2RHQB 2FHTA 5IY0A 2KECA 3OMCA 1Q1EA 1I5FA 2HIXA 1XMQL 3P75A 2JA7B 3HG9A 2CKZB 3LX0A 5I4DA 1STAA 3HZXA 4DU9A 1VQBA 1HRJA 3T53B 4LK1C 1SNMA 1B2TA 3H0GH 1YITA 5ELNA 1KLUD 3H94A 1ILPA 4IJHA 3BG3A 2KUMA 3FHWA 4X64Q 5DM63 2VY3A 2RDHA 2XNAC 1QNUA 3CW2C 3V96A 3J7AV 4HMIA 5AJ3Q 1IW7C 1SDFA 5EJWA 4HR7B 2NVQH 2EYFA 2E2HH 4MZ9A 5C0XJ 1WTQA 3OIQA 3CC7A 4PMCA 1TWAH 3WDNA 3M7GA 1N33L 5BN5A 2NB0A 4X64L 1PZKD 2PQAA 4HSPA 4NW2A 4ZLTF 4NXML 1VMPA 1SE4A 5HY6A 2L5TA 3PUYA 4A75A 5IWAL 1JCKB 2Q2IA 2VUMG 3JC66 1U5KA 4LAAA 5C4ZA 1KAAA 1ASZA 2R93G 1TWHB 2KCMA 2KEEA 2PQAB 3MFGA 4IALA 5H1SE 4DR6L 2IJ0A 1NUCA 3S1MH 3NTIA 4HAEA 3T1YQ 1MJCA 2KENA 1A3UA 4DFAA 4TQUS 1G6PA 4KK7A 3MXNA 2KHJA 1E0BA 3A54A 5M3MH 1I6HB 4A3KH 4A3GB 1PTOH 3D3RA 3KDFB 1D1KA 3F2DA 2UU9Q 5D3IB 2ALYB 3GTLB 2RHSB 5IGCA 4RHSA 1S40A 2EY6A 4C1NI 1ILQA 1BCPC 4FYDA 3CAMA 4GN4B 4YHHL 4YCWA 2ZTCA 4DK6C 1SNOA 3PCOB 1JB7A 2L4NA 2JA8G 4JV5L 5FJ8G 4C3IH 2ENBA 1OXVA 4C3JB 3F2UA 3O13A 1D7QA 5DEHA 1EZ8A 4P75A 4X3TA 1SMXA 2XRQD 3H3VH 3PUWA 1SMYC 3I91A 3GTLH 5GAGC 2EXZA 4O2DA 3D8GA 4BBRG 3GDEA 3J80c 4HJAA 3A55A 3U4VA 1D5XC 1Q82C 2CWAA 1D5ZC 2K01A 2VS1A 4PZ7A 2XIWA 2JA6H 1JOQA 1MSGA 4XDXA 4IUPA 4DK0A 2R93B 4C2MB 3FPPA 5JJLA 1GKHA 1ML0D 2UXCL 2PZTA 2IHFA 2RSNA 1ESFA 1TXYA 4A3MG 1VQNA 3DUZA 1VQGA 4B3MQ 1YHQA 2F0KA 2NVXH 2RSOA 3I56A 1NE3A 5C3XA 5M3MG 3TMEA 3S15B 2AHOB 4HIDA 5EGTA 5EQ0A 3I4MB 1LT4D 4DUZQ 1Y1VB 3KBXA 5KNDA 2F4VL 3AYHB 4K2LA 4MTNA 2BE5D 4BY7H 1IW7D 1BQQT 4DV0Q 2UXCQ 2F03A 1IYVA 2F0QA 1HZAA 4LFAQ 1WFQA 5FLXE 4OHJA 4AQYL 4J8QA 2ID0A 2WINB 2EYLA 2PCFB 3K5OA 4A76A 3S14H 2QILA 3K5LA 1VQOA 4K0KQ 4FXGC 2ZJPA 4CBVA 2EOTA 3DLLA 1HTLD 2VL6A 4RHRA 3GTOH 1GUNA 3HOVG 4K5XA 5J22A 2CVRA 4L5QA 1VQ9A 3I8ZA 4OIKA 5JOBA 1EQVA 2VQEQ 2UUAL 1OTCA 1XNQL 3I4MH 1EWHA 3LGJA 2ICEC 4DV7Q 2JA5G 3SK4A 4RWSC 1DXMA 3VR6A 5ELCA 3CPWA 4CDFC 1EL0A 2EYMA 1IXRA 1F77A 1PFNA 5HURA 1O7LA 2ICIA 4B3SL 1IYJB 4O0AA 1B70B 3MEHA 1VQKA 3M4OB 4ZYSA 5ELBA 5JPMC 3S1RB 4DV5L 4LF4Q 4KV6A 1Y14B 4A3MB 2L11A 1Q90A 1EU3A 4UHVA 5DM73 2NN6I 4P73A 3G48A 1VQHA 1ZXTA 3JAML 1PFSA 4FDBA 3ITPA 1W2BA 2NTSA 2DUDA 1WTRA 3R8BA 3PO2H 4EQOA 1CZGA 4KI0A 1Q7YC 4DR3L 3A74A 1MKHA 5C4HA 4I65A 3OTOQ 3E9IA 3CCEA 2F0EA 1IBLL 1XWEA 1QVFA 1B44D 1K28A 2Y0SG 1E1TA 4P71A 3CMEA 2MHVA 3CD6A 4A3KG 4Y7NB 1CFMA 4H0LC 1SMYD 4XYOA 1EOTA 2PNRC 2NZ1D 2CH4W 4JW0A 4GNXA 1VQDA 4XYQA 3RNUA 2VNUD 1ONLA 2M00A 4M1UB 4R8NA 4JI8L 3H3VI 1N8RC 5C44H 2XN9C 4JG2A 2R92B 4C2MH 3C2PA 1TWHH 4HN7A 4XQNA 5FOBB 2ZT9C 5IE8A 3L2PA 3MXGA 3HOWH 2D62A 1Z7TA 1SYGA 2K5DA 2B2VC 1LYLA 1LT3D 5C4JB 2VQFL 3DWQA 4QB4A 3U9OA 3K7AH 3MC0B 4HIOA 2MGSA 1R9TB 4KMUC 2J4XA 1M4VA 3PIO3 2A6HD 1U0LA 2WACA 2D0OA 2Z6BA 3KOJA 2I5MX 2OXPA 1JE5A 2LKVA 2NZOA 5CMDA 2I46A 4FP5D 3FDTA 2NTTA 2A5HA 2G9HD 4C3HG 5IYBG 4UPAA 4L63B 1WCMB 3A7AB 1DGSA 3CRLC 2H1EA 5C4JH 2FMMA 2RQXA 1JE4A 4ZQ3A 1OXUA 3FKIG 4G7HC 4Y52H 1HZBA 2SDFA 3T1HL 3SXHA 5LMNL 3D4RA 2LMCB 2UUBQ 2B3GA 4U68A 4CKCA 5IGDA 4JI2L 1CQVA 2JA6G 2JJQA 4ABNA 4OEMB 4JI4Q 1HA5A 3MVVA 1XTDA 5J1ZA 2FXQA 1I50B 1UNSA 2EE1A 5C0XH 2GA4B 3CC2A 3PQIA 2QF7A 3K81C 2QDLA 4KY7A 4CHTB 4YCVA 1IBML 1JWMD 4DV6Q 4H13C 2HHHQ 1RHPA 3DHQA 3KF8A 3PSIA 4LFCL 3W1GA 4LF7Q 2NWGA 1HR0W 4LWCA 1DCZA 1IKMA 4DV1L 5IP9H 1MHWC 3DEPA 1S5ED 1CUKA 2F0UA 1E2VA 1IBKQ 2QEJC 1C9OA 2F0JA 3J80E 4DNIA 2DY8A 4F88A 3DM1A 3PO3H 2DNCA 4RA8A 1ENCA 1RDPD 3I55A 3N52A 3M3YB 1M8AA 5L37A 3D4DA 5M5YH 4B3ML 3NBHA 2BA1A 2VW9A 2MP1A 3L7ZC 1Q1BA 2Y0SE 4KHPQ 4GN3B 4JYAQ 3DM3A 3ULLA 4A3IH 3K80C 3W3AA 4PMBA 2PMZE 4LUOA 4IUUA 1PRTC 4X62L 3H3VC 1ZYRD 1ZKOA 3HKZG 1WYDA 1E3PA 1HTPA 3G6JB 4DV0L 4C3IG 5M9OA 1LUZA 2JA9A 4DNRB 2AKWB 4LFAL 1Q8KA 1ENAA 3DWPA 2VXWA 3HOWB 4AQYQ 3TP8A 1P8LA 3IRBA 3HOYG 5CYUA 3IL8A 4KHPL 1TWFH 1LTAD 3TS0A 4OELB 4LF6Q 4A3GG 3K8AA 4XT1B 1X9NA 4IN3A 4DR2Q 4X62Q 3SK5A 1WD0A 3MFYA 4B3RL 2A69D 3E9HA 4IUNA 2OWOA 1TS5A 5COYA 1Z6HA 1BNZA 4BY1H 1ENFA 2N8NA 1SLJA 3T16A 4NP5A 5IGEA 4B3SQ 5C4XH 1NY4A 2RF4A 1D2BA 1BBUA 2A8VA 2B2UA 1WCMH 2NZHA 5FO7B 1Q46A 3K0XA 2DY7A 4ZAIA 4DR2L 4DV5Q 4LF4L 4TSSA 3D4WA 4B3RQ 5M3FG 2R3ZA 5T1IA 1YNNC 4Y7NH 4BBRB 1EFWA 1UEAB 3TBIB 1P16A 5FLMH 1TR5A 3PO2G 1AEXA 3A0JA 3MZ5A 4LNQA 2J0TD 2B63B 4J15A 3SR1A 4I7ZC 3I70A 3GP7A 4IZ8A 5ELOA 2PW7A 3SK6A 1TT2A 4YWKA 3P1HA 4GKJQ 2JQOA 4RGMA 4BWGB 1PZJD 4X3KA 1X3QA 4IUVA 2IX1A 5IP7H 2K14A 4GS3A 2OF1A 2A68D 4DV3L 4A3FB 3C1FA 1O7ZA 4BXXG 2O5JC 1VQ8A 1A62A 2CW0D 4EVOA 1VS0A 1XMOQ 4GLAC 1A6XA 3NWSA 4JBWA 1HQMC 3NWTA 5CV7A 4ZUIA 3A8IE 1DOLA 1EY5A 3HOXH 1FR3A 1R4PB 5J3BA 2MJ8A 5IODA 2E2HB 2EDGA 3NBHB 1HFGA 1J5EL 3J81c 5IYDH 5JEAH 2JA7H 1M1KC 3J7ZC 1I4XA 3U50C 3HOZB 4ID6A 3LNNA 1SYEA 2RKSA 3K0YA 2EXDA 3FEWX 5I2YA 4A3FH 2B2YC 2BOSA 3LWUA 1BO0A 4A3JH 4IJLA 5EPLA 2QKIC 4OGQC 3CP0A 2K28A 1HR0Q 5C3EG 3BYYB 1HA6A 4IFDI 5DLQE 3GTKB 3BS1A 1G2TA 3A56A 1J5EQ 4X66Q 1X3FA 3S14B 3GV3A 2NVTH 4ZKBB 2BH2A 3KF8B 4K2KA 3NK9A 4K6LA 1KQSA 2NBFA 1EEFD 5ELEA 1RTOA 1G6ZA 1TVXA 2XSCA 4A3GH 4WRDA 4KKSA 2R7ZG 3S2HB 2I07B 1EWCA 1NMGA 1VMCA 3CC4A 1H9RA 5E4XA 1B4OA 3CQZB 1RODA 3JAMi 4PZ6A 4IOAA 5F2DA 4ZUJA 3RD4A 2Z6KA 1Y8PB 1FNUA 5EPKA 3C3LA 2A6EC 3K5MA 1H9SA 2F0SA 1CQFA 3F2CA 5LMNQ 1QZGA 4RCOA 1VQJA 4H7BA 1AP0A 1T5XD 4QJFA 4CKEA 5FK9C 2L12A 3S1NB 4O1NA 3HOYH 2Y0SB 4QMGA 5IGBA 5D65A 3PO3B 1EUJA 1NSNS 4A3KB 4P2CB 1RL2A 3HOZG 4HTHA 4WJWA 1M90C 1TS2A 3DMUA 2E5LL 1E2ZA 2UXDL 3KYHC 1PRTD 2HDMA 1UUPA 3I90A 1U4MA 3FKIH 3SGIA 4JCVE 4QQBX 1TKWB 1F2YA 1CA5A 3CCUA 5A35A 2UXBQ 1YNJC 1XNRL 2ZJRA 4LFCQ 4KHZA 3Q8DA 3J81L 5CORA 1MBYA 2C9OA 2R92G 2TMPA 2IY5B 2Z0SA 4C3HH 1CA6A 1PV4A 4JI6Q 1Q86C 4DUYQ 2X6LA 1ICFB 4A93H 5CV5A 1SSOA 4GLVB 2L1BA 4ZKCB 2E5LQ 2G9DA 4K6DA 1A15A 5IP7G 1HHVA 2WAQE 4HIKA 3OWFA 3S15H 1CI3M 1XYIA 3OHXC 1PYBA 1F2LA 4OWXB 1DD2A 2JSOA 2WKCA 1JMCA 2EQSA 3IFDA 1LT5D 1DOKA 4DAMA 5IT9c 3I4NG 1TWGB 3CCRA 4M8AA 1L0WA 2KHSA 3RR5A 4C56C 1KDAA 4GNXB 2BCOA 4HJ5A 1I3QH 2LSSA 4IPDA 3CCQA 3PUVA 1GUTA 5I6YA 5KYIA 1MJEA 4DR4Q 4JI3L 2B8GA 2R7DA 5C6AA 1G291 5M3MB 1I6HH 2IPKD 2E2DC 1UE1A 2RA4A 3NENA 3TSSA 2B2UC 2DJFC 3A8JE 1W6KA 2XWJB 1V9PA 4ULLA 2Z1CA 2KQ3A 3GTPH 4GKKQ 1F9SA 3OSOA 1D5MC 5LMUQ 1EY8A 1STNA 4KHVA 5DAUA 3S1RH 3HOXG 1YIJA 1STYA 1NR4A 1U4RA 2ASBA 4QUCA 2JP1A 3S2DH 4CJ2C 3E5SA 5JEAG 4MIUA 4DKAC 3FPUB 4P72A 4UP7A 5M3FH 5CGKA 1K0SA 5EPJA 3HGBA 4R8IA 1UE6A 1B53A 4A3IB 4A3LH 3PV0A 4NMZA 2IL8A 3CMAA 5C0XI 1K3RA 5FLMG 4DR6Q 4KN4C 1PVOA 4DGZA 5CC4A 4JOIA 2A6ED 1V43A 2CW0C 1GUWA 3S1MB 1JQYD 1G2SA 1PA6A 3BZKA 4QGUA 2GVAA 2KBNA 5KYLA 4JC0A 3WOEA 2UUCL 3ULPA 4LMQD 2JYOA 3TP6A 3GTJH 1X55A 3RZDH 2X6GA 1WD1A 3I72A 3HKZE 3QOJA 4DNTB 1SN8A 5BR8Q 2CQAA 1STGA 2B2VA 2OQ0A 1CKNA 3I73A 4JV5Q 2K4KA 3VA7A 4DK1A 2PZUA 2OCEA 5D14A 2YTYA 3GTKH 3SEBA 3AEVA 5K36H 1WOCA 3NTHA 2L15A 1GD7A 1SRUA 3U58A 3HOXB 4KJNA 1JC7A 3ER0A 5IIFA 4A93B 4IPHA 1RKNA 3QJYA 3S16H 5EKKA 1B50A 1BF4A 1SE8A 3RMHA 1HXYD 3CCSA 3Q0AA 1V1PA 1BR9A 5TSSA 1XPUA 4A3JB 2K50A 3AQQA 4A3BG 4QIWB 1N9WA 3MHBA 3OOCA 3CRKC 3I7FA 1IZ6A 4HJ9A 1N32Q 2WAQG 3CU7A 3DWAA 3CCVA 4GOPB 1PH6A 1SAPA 3BZDB 3AB9A 2JA8H 1VQEA 2RBMA 3KF6B 4RH6A 3S1NH 2JA7G 1ET9A 1BCPB 2J7ZA 3GV6A 4FF3A 2F4VQ 2M9VA 4DAVA 1G8ZD 5T1GA 1OO9B 4ME5A 4A3CH 3S1QB 2KHIA
chains in the Genus database with same CATH topology
4QF4A 4RGOS 2K5WA 5EBDA 3G7LA 1BCPF 3J80L 2D2CC 5FLXL 1YNND 4RKBA 1EY9A 4TRDA 1ZYRC 1WTXA 1DZ1A 5FO8B 4O42A 2B2YA 2EJFC 1SYBA 4YIJA 2EY2A 2BA0A 4CGYB 3M85A 5C3WA 2K04A 1GUOA 1LT6D 2KCCA 3HP3A 3GTGB 2A69C 1PTOD 2SEBD 1F9QA 1B9MA 2B2TA 1B1ZA 4IUTA 4IURA 1F2MA 4FF4A 1BDOA 2JXMB 5I6WA 2BDOA 2R6GA 1BUVT 1QE6A 3QOLA 3FVQA 2WIIB 1RJTA 1STHA 1PRTF 2VUMB 1I6VC 1STEA 2EYJA 1IKLA 3MAQA 2EPBA 2F3VA 1I4RA 5KNBA 2RDFA 3QG1A 3VYUA 2F0IA 3MTSA 4WORA 1SYCA 3ERQA 1S4ZA 4BY7B 4K14A 1NAPA 3I4LA 2E2JB 1JORA 4DA2A 4BA2I 5JVG3 4PV1C 4C3JG 2FJ2A 1PYWD 5CV8A 4KY6A 4WFN3 2ZXRA 5IT9L 1D1IA 3GTJB 2AUJD 2K05A 1TY0A 3RZOB 3VR2A 3JAME 4BA1I 1U4LA 5M5WB 2NN6H 4F87A 3KK7A 2AWNA 1Q3LA 3GTQB 2B2WC 2K1BA 5DNFA 2NYZD 3EQLC 1KDBA 1DM0B 2A68C 2F0FA 1DONA 3C46A 1SJED 1KDCA 1PMRA 2A6HC 5CR3A 4E6IA 2N88A 1IYUA 4OIJA 2B8FA 1CHPD 1LABA 1XTCD 1SNPA 3QWNA 4X3UA 2O4XA 5IGFA 1FNWA 3HOVB 1NR2A 3TDQA 3TZDA 3NHHA 3UI2A 1JB3A 3VR4A 4FNFA 3L3OC 1U4PA 3W2DA 2AWOA 4EQPA 2XVSA 1SNCA 3S17B 4V190 4HCEA 3NTKA 1IHZA 4F8MA 3MXPA 4EGVA 1CK1A 3T51B 1F2ZA 3Q22A 1Z47A 1B3AA 5AFWA 3PIP3 1GHJA 1S5DD 2K5QA 1Y8NB 2Q8IB 1WTOA 4PQXA 3J81E 5KGUA 1SE3A 1FD7D 3VYSA 1MSHA 5EKIA 4CKBA 4A3DB 3KBGA 3GD7A 3KUPA 2EY5A 1EY6A 1TS3A 1FYCA 3NUCA 4BS9A 2B2TC 1YNJD 5CBAE 3TP5A 2EJMA 1EIGA 1BOSA 2MPMA 4PNYA 4AYBB 3TP7A 2NVYB 1W6JA 3KLSX 2KEDA 1S5BD 3EA6A 2MUYA 1L0YB 1OXSC 2KJXA 3IKJA 2PW5A 4C3HB 3SVMA 1FGBD 4HCSA 1TWFB 3M4YA 1AZQA 4MN3A 4IFDJ 1HCZA 1QILA 3X3MA 5E1FA 3FKIB 1HPCA 2PQEA 1EIHA 2F0GA 2EZVA 3MXUA 4A3BB 2XRSD 3V2TA 5E3FA 2K7VA 4K8IA 1J8IA 2D5DA 2F0PA 4RKLA 4FF2A 2F0MA 2KCNA 1NCVA 4HMJA 4MHEA 4KKUA 3L9AX 2JEBI 2WB1B 4FO2A 1EQTA 3RZDB 1XX8A 3KLSA 4KJOA 1TWAB 4KN7C 4DF7A 1S5FD 4NDXA 1CZWA 4U673 2F0OA 5EBCA 3PO2B 2F0VA 3HEJA 3SHLA 1Y69U 1QNKA 3V05A 1TQOA 3CKIB 3HRZC 1LTBD 1V1PB 5LL6S 3BDLA 4QCLA 1QG7A 3D6CA 5KIXA 2EYHA 2EVBA 1Y1WB 2IX0A 3VA5A 5IT9E 3CHBD 3PMFA 4UAIA 3RLFA 3NBIA 1BCPD 5JVH3 2JA5B 2ZXPA 3NSWA 5ISRA 1JOOA 3U9SA 2WKDA 3K57A 3URYA 2BE5C 2YYZA 3NXWA 4K8JA 4FXKC 1A2TA 4H44C 1JICA 1S5CD 2VB3X 3NQIA 3GTOB 5KEEA 1JOKA 4IFDG 2HCIA 5C5LA 2LY7A 2KVMA 1MI2A 2RVLA 3VYTA 2HDLA 2L55A 1K8OA 3K6OA 4DAYA 2QDBA 2F0DA 4RGNA 4C3IB 3MA2B 2F0WA 4C1NK 4RCNA 5BN3A 2QCPX 4ILWA 3K58A 3J7AF 3SK8A 1CTMA 2PMZB 4RFBA 3EJIA 4HSVA 1J9OA 1FNVA 1LTTD 3ONAB 1T5EA 3D31A 3D6WA 3BYTB 2E76C 3R93A 2TSSA 3T56B 2H4OA 2IX3A 2F3WA 3BVZA 2F0LA 1KNEA 5D3DA 1H9JA 5K36G 2X69A 1O78A 1EY4A 3ND8A 3SDZA 5K5PA 1SE2A 4KD4A 5M3FB 4CJ0B 1TS4A 1EYCA 3BDCA 1SFOB 1D6EC 3R3OA 5JJZA 1RTNA 4N9PA 4XIGS 2K32A 1AFPA 4B9WA 5FKAC 2F1MA 5LL6X 4K5WA 2SNSA 2NVTB 1CT1D 4X3SA 2AQ1B 4HEDA 3ZYYX 1A2UA 1PTOC 3QIAA 2LS01 1SYFA 3QO2A 1I3QB 3P7JA 4BBSB 4N9TA 1MD2D 2OT2A 3OMGA 3S2DB 3AMUA 1K8MA 1SNQA 1ZEQX 1PTOB 3PUXA 1EZ6A 5IGGA 1O7YA 1I4HA 2V4DA 4Q5VA 3HKZB 4DXFA 4B9XA 1PDQA 5C3EB 3Q23A 5JEAJ 3A8KE 1VF5C 1R4QB 4FXDA 3I3CA 5M5XB 2JA8B 4OO1H 3T13A 2AQ2B 3E0JA 4G7OC 1PXUA 3DEOA 4J1MA 1VDZA 2EJGC 2F0HA 3MWYW 2Q8RE 3GO5A 2OEOA 3H6MA 3NP8A 1EYAA 1QCBD 4IQZA 3H91A 1LV9A 3VR5A 2A74C 2WV6D 3QB3A 2Q8TA 3IFTA 4IUQA 2NVXB 3PUZA 1E2WA 3VR3A 4XQJA 4XQQA 4NKLA 5A2QE 1JWSD 3LWEA 4DAPA 4GZYC 4ZRZA 1SJHD 3OIPA 3I4NB 4G4KA 2IWHA 5FO9B 2M2LA 2IW3A 2F0TA 1TY2A 1H9KA 2C5CA 1HQRD 3S16B 4CJ1B 1DOMA 1GXDC 5G3LD 4ZK9B 1STBA 4KKTA 1Y8OB 3X3NA 4QUFA 4A3EB 2PPBC 2SNMA 1HUNA 1TWCB 2KA7A 1BBXC 2EYOA 5C44B 3NE5B 1DYQA 2WAQB 1KLGD 3BDOA 3WOFA 4B08A 5I2XA 5JAVA 5C0XG 2YU9B 1BXTA 1HFNA 3NQTA 2XWBB 4S3SA 3RUZA 1MGSA 2AQ3B 5BN4A 5CV4A 2NUCA 3EFXD 1L0XB 5I9PA 1OXTA 3KLRA 1SBBB 3T4AC 1F9RA 1PTOF 4UDUC 2PZWA 3OWEB 4JK1C 3ND9A 1TU2B 1Q12A 1H9MA 2K6AA 1LO5D 1A3VA 4OO1G 4J6HA 1O80A 4XXEA 1I4GA 1C8CA 3TZUA 1KABA 4DN4M 1CHQD 1HUMA 1II3A 1AZPA 4K5VA 1GJXA 1C4QA 2KOLA 1H9SB 4OO1I 3GQBA 3R2IA 4TKOB 4Q0FA 5C5MA 1ICWA 4KTAA 3FRPB 3AU7A 1V8QA 2CHBD 3P20A 4OL7A 4FVMA 1LLRD 2Z4IA 1PFBA 3VYRA 2L9HA 2PO4A 4F7XA 1GHKA 5EKLA 1EY7A 1QWYA 1LTSD 1I4QA 3Q6SA 3EROA 4G57A 3DXJC 4EQNA 2ZXOA 2Z4HA 2F0NA 4ODGA 2E74C 4XT3B 5KNCA 4L8JA 2VB2X 3K7AB 4LJZC 4IFDH 1QOHA 1EEID 1X3PA 2Z8LA 5JPNC 2FINB 3S9WA 2HCCA 3M7NA 1KTKA 1A3TA 3NPPA 2JA6B 2NVQB 2N55A 4FF1A 2SOBA 4G7ZC 1OXXK 1EY0A 2HUGA 1X32A 1WTVA 3TN2A 5CBEE 2D9UA 3HOUB 4Z9CB 3E6ZX 1JWUD 2B39A 2O5IC 1K83B 1EU4A 1VCIA 2K03A 1I4PA 5NUCA 4KY5A 3SE0A 4XTCS 5E4WC 3Q24A 3FMCA 2E2IB 1PLFA 1EYDA 1WVLA 4RAUC 3EVQA 5M5YB 3K59A 5G3LF 3H0GB 2R7ZB 5A2QL 2LFNA 1DJRD 1ET6A 1GUGA 2L0CA 1TIID 1F9PA 1AW7A 2FFKB 2BDNA 1QJOA 5I9OA 1SXTA 3J7YW 4RGTA 3OW7A 1SEBD 2R61A 1VF7A 2EYPA 2FMCA 2AUKA 5HGTA 3HOYB 1PZID 2DN8A 3OPOA 1IL8A 3HS0C 1CM9A 5LHY1 2DNEA 3H09A 1LTGD 4BY1B 2EY1A 3GTPB 2IT1A 5J39A 3C1EA 3A7LA 1ESRA 1WTPA 2O2LD 5ELDA 1LACA 1B9NA 1SNDA 1WTWA 4V0BA 1XXGA 3BVMA 4KD3A 1U9RA 1LTID 4PMWA 3K5NA 2E75C 1LTRD 1RF2D 2WP8J 1G91A 1V1OA 1AN8A 5C4XB 2K33A 4R9WA 5CV9A 2HQEA 1JR0D 2A73B 2PYKA 2F4IA 1RD9D 1QB5D 3N6RA 1PRTB 2JEAI 1Q8IA 1GOZA 1PFMA 1UAPA 3R2TA 5KRUA 2B2WA 3GTMB 1SYDA 2NN6G 3BVGA 4L6TB 2RDGA 1EFID 1GUSA 3IAYA 5CV6A 1RCVD 1C48A 4DXGA 5IOCA 5ELFA 1KNAA 2JE6I 2FHTA 2KECA 3OMCA 1Q1EA 3P75A 2JA7B 3HG9A 3LX0A 5I4DA 1STAA 3HZXA 4DU9A 1HRJA 3T53B 4LK1C 1SNMA 1B2TA 1KLUD 3H94A 1ILPA 3BG3A 2KUMA 5DM63 2RDHA 2XNAC 1QNUA 3V96A 3J7AV 4HMIA 1IW7C 1SDFA 5EJWA 4HR7B 2EYFA 5C0XJ 1WTQA 3OIQA 4PMCA 3WDNA 3M7GA 5BN5A 2NB0A 1PZKD 4HSPA 4NW2A 4ZLTF 1VMPA 1SE4A 2L5TA 3PUYA 1JCKB 4LAAA 5C4ZA 1KAAA 1TWHB 2KEEA 3MFGA 4IALA 2IJ0A 1NUCA 3NTIA 4HAEA 1A3UA 4DFAA 4TQUS 4KK7A 3MXNA 1E0BA 3A54A 1I6HB 4A3GB 1PTOH 3D3RA 1D1KA 5D3IB 3GTLB 5IGCA 4RHSA 2EY6A 4C1NI 1ILQA 1BCPC 4FYDA 1SNOA 2L4NA 2ENBA 1OXVA 4C3JB 3F2UA 3O13A 5DEHA 1EZ8A 4X3TA 2XRQD 3PUWA 1SMYC 3I91A 2EXZA 3D8GA 3A55A 1D5XC 1D5ZC 2K01A 2XIWA 1JOQA 1MSGA 4XDXA 4IUPA 4DK0A 2R93B 4C2MB 3FPPA 1ML0D 2PZTA 2RSNA 1ESFA 3DUZA 2F0KA 2RSOA 5C3XA 3TMEA 3S15B 5EGTA 5EQ0A 3I4MB 1LT4D 1Y1VB 3KBXA 5KNDA 4K2LA 2BE5D 1IW7D 1BQQT 2F03A 1IYVA 2F0QA 5FLXE 4OHJA 4J8QA 2ID0A 2WINB 2EYLA 2PCFB 3K5OA 2QILA 3K5LA 4FXGC 4CBVA 2EOTA 1HTLD 4RHRA 1GUNA 4K5XA 5J22A 2CVRA 3I8ZA 4OIKA 5JOBA 1EQVA 1EWHA 2ICEC 3SK4A 4RWSC 1DXMA 3VR6A 5ELCA 1EL0A 2EYMA 1F77A 1PFNA 5HURA 1O7LA 2ICIA 3MEHA 3M4OB 4ZYSA 5ELBA 5JPMC 3S1RB 4KV6A 4A3MB 2L11A 1Q90A 1EU3A 5DM73 2NN6I 1ZXTA 3JAML 3ITPA 2NTSA 1WTRA 3R8BA 4EQOA 1CZGA 4KI0A 5C4HA 4I65A 2F0EA 1XWEA 1B44D 2MHVA 4Y7NB 1CFMA 4H0LC 1SMYD 4XYOA 1EOTA 2PNRC 2NZ1D 4XYQA 2VNUD 1ONLA 2M00A 4M1UB 4R8NA 2XN9C 2R92B 3C2PA 4HN7A 4XQNA 5FOBB 2ZT9C 3MXGA 2D62A 1Z7TA 1SYGA 2K5DA 2B2VC 1LT3D 5C4JB 3DWQA 4QB4A 3U9OA 3MC0B 2MGSA 1R9TB 4KMUC 2J4XA 1M4VA 3PIO3 2A6HD 2WACA 2OXPA 2LKVA 5CMDA 2I46A 4FP5D 3FDTA 2NTTA 2A5HA 2G9HD 4C3HG 4L63B 1WCMB 3A7AB 3CRLC 2H1EA 2FMMA 2RQXA 1JE4A 4ZQ3A 1OXUA 4G7HC 2SDFA 3SXHA 3D4RA 2LMCB 4U68A 4CKCA 5IGDA 1CQVA 4ABNA 1HA5A 3MVVA 5J1ZA 1I50B 1UNSA 2EE1A 5C0XH 2GA4B 2QF7A 4KY7A 4CHTB 1JWMD 4H13C 1RHPA 3DHQA 3KF8A 2NWGA 1DCZA 1IKMA 3DEPA 1S5ED 2F0UA 1E2VA 2QEJC 2F0JA 3J80E 2DY8A 4F88A 3DM1A 2DNCA 4RA8A 1ENCA 1RDPD 3N52A 3M3YB 1M8AA 3D4DA 3NBHA 2BA1A 2MP1A 3L7ZC 1Q1BA 3W3AA 4PMBA 4IUUA 1PRTC 3H3VC 1ZYRD 1ZKOA 1HTPA 3G6JB 4C3IG 5M9OA 4DNRB 1ENAA 3DWPA 2VXWA 3HOWB 3TP8A 5CYUA 3IL8A 1LTAD 4XT1B 4IN3A 3SK5A 1WD0A 3MFYA 2A69D 4IUNA 1TS5A 5COYA 1Z6HA 1BNZA 1ENFA 3T16A 4NP5A 5IGEA 1D2BA 2B2UA 5FO7B 2DY7A 4ZAIA 4TSSA 3D4WA 2R3ZA 5T1IA 1YNNC 4BBRB 1UEAB 3TBIB 1TR5A 1AEXA 3MZ5A 2J0TD 2B63B 3SR1A 4I7ZC 3I70A 3GP7A 4IZ8A 2PW7A 3SK6A 1TT2A 3P1HA 4RGMA 4BWGB 1PZJD 4X3KA 1X3QA 4IUVA 2IX1A 2OF1A 2A68D 4A3FB 3C1FA 1O7ZA 2O5JC 2CW0D 4EVOA 1A6XA 3NWSA 4JBWA 1HQMC 3NWTA 5CV7A 4ZUIA 3A8IE 1DOLA 1EY5A 1FR3A 1R4PB 5IODA 2MJ8A 2E2HB 2EDGA 1HFGA 5JEAH 1I4XA 3HOZB 4ID6A 1SYEA 3LNNA 2RKSA 3K0YA 3FEWX 5I2YA 2B2YC 2BOSA 3LWUA 1BO0A 5EPLA 2QKIC 4OGQC 2K28A 3BYYB 1HA6A 4IFDI 3GTKB 3BS1A 1G2TA 3A56A 3S14B 3GV3A 4ZKBB 4K2KA 3NK9A 4K6LA 2NBFA 1EEFD 5ELEA 1RTOA 1G6ZA 1TVXA 2XSCA 4WRDA 4KKSA 3S2HB 2I07B 1EWCA 1VMCA 1H9RA 5E4XA 1B4OA 3CQZB 1RODA 5F2DA 4ZUJA 3RD4A 1Y8PB 1FNUA 5EPKA 3C3LA 2A6EC 3K5MA 1H9SA 2F0SA 1CQFA 4RCOA 4H7BA 1AP0A 1T5XD 4CKEA 5FK9C 2L12A 3S1NB 4O1NA 2Y0SB 4QMGA 5IGBA 5D65A 3PO3B 1NSNS 4A3KB 4P2CB 4HTHA 4WJWA 1TS2A 3DMUA 1E2ZA 1PRTD 2HDMA 1UUPA 3I90A 1U4MA 1TKWB 1F2YA 1CA5A 5A35A 1YNJC 4KHZA 3J81L 5CORA 1MBYA 2C9OA 2TMPA 1CA6A 2X6LA 5CV5A 1SSOA 2L1BA 4ZKCB 2G9DA 4K6DA 1A15A 1HHVA 3OWFA 1CI3M 1XYIA 3OHXC 1F2LA 1DD2A 2JSOA 2WKCA 3IFDA 1LT5D 1DOKA 1TWGB 4M8AA 2KHSA 4C56C 1KDAA 2BCOA 3PUVA 1GUTA 5I6YA 5KYIA 2B8GA 5C6AA 1G291 5M3MB 2IPKD 2E2DC 2RA4A 3TSSA 2B2UC 3A8JE 1W6KA 2XWJB 4ULLA 2Z1CA 2KQ3A 1F9SA 3OSOA 1D5MC 1EY8A 1STNA 4KHVA 5DAUA 1STYA 1NR4A 1U4RA 4QUCA 2JP1A 4CJ2C 3E5SA 5JEAG 4MIUA 3FPUB 5CGKA 5EPJA 3HGBA 4R8IA 1B53A 4A3IB 3PV0A 4NMZA 2IL8A 5C0XI 4KN4C 4DGZA 5CC4A 2A6ED 1V43A 2CW0C 1GUWA 3S1MB 1JQYD 1G2SA 5KYLA 3WOEA 4LMQD 2JYOA 3TP6A 2X6GA 1WD1A 3I72A 3QOJA 4DNTB 2CQAA 1STGA 2B2VA 3I73A 3VA7A 4DK1A 2PZUA 5D14A 3SEBA 5K36H 3NTHA 3HOXB 4KJNA 1JC7A 5IIFA 4A93B 1RKNA 3QJYA 5EKKA 1B50A 1BF4A 3RMHA 1HXYD 3Q0AA 1V1PA 1BR9A 5TSSA 4A3JB 4QIWB 3MHBA 3OOCA 3CRKC 3CU7A 3DWAA 1SAPA 3BZDB 3AB9A 2RBMA 4RH6A 1ET9A 1BCPB 2J7ZA 3GV6A 4FF3A 2M9VA 4DAVA 1G8ZD 5T1GA 1OO9B 4ME5A 3S1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF7 A;  4QF4 A;  4HMI A;  4NDX A;  4QMG A;  1IHZ A;  2F0K A;  3NQT A;  4F8M A;  3MXP A;  5IGB A;  4IZ8 A;  4S3S A;  3RUZ A;  2PW7 A;  2EY1 A;  4NMZ A;  2EYF A;  1TT2 A;  3SK6 A;  5C3X A;  3SHL A;  1NSN S;  2F0O A;  3S9W A;  2F0U A;  3TME A;  4B9X A;  3P1H A;  2F3W A;  4HTH A;  3T13 A;  2F0L A;  2NUC A;  3C1E A;  2F0V A;  3HEJ A;  1F2Z A;  4PMC A;  4RKB A;  3DMU A;  2F0J A;  5CV4 A;  1EY9 A;  5EGT A;  4TRD A;  1A3T A;  5CV8 A;  4DGZ A;  5CC4 A;  5I9P A;  4KY6 A;  5J39 A;  2M00 A;  4J1M A;  4R8N A;  2F0H A;  1TQO A;  2OF1 A;  4K2L A;  1F2Y A;  1EY4 A;  5KGU A;  2OEO A;  3H6M A;  2F0Q A;  3NP8 A;  1ENC A;  2SOB A;  2PZW A;  3BDL A;  3C1F A;  5K5P A;  1SND A;  5KYL A;  1SYB A;  3D4D A;  4KD4 A;  1EYA A;  4YIJ A;  3D6C A;  1EY0 A;  5KIX A;  2EYH A;  2EYL A;  1SYG A;  2EY2 A;  4KD3 A;  1EYC A;  4LAA A;  1A3V A;  3BDC A;  1U9R A;  3TP6 A;  3VA5 A;  4EVO A;  1KAA A;  5C4Z A;  3PMF A;  4IAL A;  4QB4 A;  3U9O A;  4J6H A;  5CV5 A;  1NUC A;  3R3O A;  5CV7 A;  4ZUI A;  4PMB A;  4K5X A;  3QOJ A;  5C3W A;  5J22 A;  1EY5 A;  1KAB A;  1JOO A;  3QB3 A;  4K6D A;  4N9P A;  1EQV A;  5JOB A;  1A3U A;  5IOD A;  5ISR A;  4DFA A;  2EY5 A;  1EY6 A;  1KDB A;  3NUC A;  1STG A;  4B9W A;  3OWF A;  1II3 A;  2F0F A;  2HQE A;  5CV9 A;  5M9O A;  2WAC A;  4K5V A;  2SNS A;  4K5W A;  3NXW A;  3SK4 A;  3TP5 A;  4ID6 A;  2PZU A;  1ENA A;  1SYE A;  1JOR A;  2OXP A;  4K8J A;  2RKS A;  1A2T A;  2EYM A;  2LKV A;  3TP8 A;  2PYK A;  5C5M A;  5NUC A;  1F2M A;  4NKL A;  4PNY A;  5HUR A;  4KY5 A;  5IGC A;  3TP7 A;  1KDC A;  5I6W A;  2EY6 A;  4KTA A;  4KJN A;  5IIF A;  2KHS A;  3MEH A;  1KDA A;  5CR3 A;  4E6I A;  1RKN A;  1EYD A;  3QOL A;  5KEE A;  4KV6 A;  3SK5 A;  5KRU A;  5EKK A;  2PW5 A;  3EVQ A;  1SYD A;  5I6Y A;  1JOK A;  4OL7 A;  5KYI A;  4IUN A;  1SNO A;  1A2U A;  4ZQ3 A;  1STH A;  5HGT A;  5C6A A;  2ENB A;  5CV6 A;  5C5L A;  4K2K A;  2F0T A;  5IOC A;  1SYF A;  3NK9 A;  1SNP A;  5DEH A;  1EZ8 A;  4N9T A;  3T16 A;  4F7X A;  4NP5 A;  2O4X A;  2EYJ A;  3SXH A;  5IGF A;  5E1F A;  3MHB A;  5IGE A;  5I9O A;  5EKL A;  3ITP A;  5IGD A;  1EY7 A;  1STB A;  3OMC A;  3OMG A;  2PQE A;  2F0G A;  3ERO A;  2EXZ A;  2F3V A;  4WRD A;  2QDB A;  2SNM A;  3D8G A;  3P75 A;  4G57 A;  4EQO A;  2EYP A;  3MVV A;  2F0D A;  3LX0 A;  3NHH A;  4EQN A;  1SNQ A;  2KQ3 A;  1STA A;  2RDF A;  3D4W A;  3HZX A;  3OSO A;  5J1Z A;  3V2T A;  2F0W A;  4DU9 A;  5E3F A;  2F0N A;  2EYO A;  2F0I A;  2RBM A;  5C4H A;  5F2D A;  4ZUJ A;  1SNM A;  4I65 A;  1EY8 A;  1EZ6 A;  1STN A;  1SYC A;  4K8I A;  4KHV A;  4WOR A;  2F0P A;  2F0E A;  3ERQ A;  4RKL A;  4ODG A;  5DAU A;  1STY A;  5IGG A;  1JOQ A;  2F0M A;  4EQP A;  4KY7 A;  4HMJ A;  2F0S A;  4K14 A;  1TR5 A;  3E5S A;  3SK8 A;  4MIU A;  1AEX A;  3DHQ A;  3MZ5 A;  2PZT A;  1SNC A;  3EJI A;  4KJO A;  4H7B A;  4ME5 A;  3SR1 A;  5CGK A;  5JAV A; 
#chains in the Genus database with same CATH topology
 4QF4 A;  2CQO A;  4RGO S;  2K5W A;  5EBD A;  3G7L A;  3CCJ A;  1BCP F;  3J80 L;  3I2Z A;  2QW7 A;  2D2C C;  5FLX L;  1YNN D;  4RKB A;  1EY9 A;  4OX9 Q;  4TRD A;  1ZYR C;  2VQE L;  1WTX A;  1DZ1 A;  5FO8 B;  3QR8 A;  4O42 A;  1X65 A;  1XNQ Q;  2B2Y A;  1QZH A;  4IO9 A;  4N8X 1;  2EJF C;  1SYB A;  4DV4 L;  4YIJ A;  3B6Y A;  1X56 A;  2EY2 A;  4YWL A;  2BA0 A;  1YNX A;  4CGY B;  3M85 A;  5C3W A;  2K04 A;  3PIP A;  1GUO A;  1LT6 D;  2KCC A;  3HP3 A;  3GTG B;  2A69 C;  1PTO D;  2SEB D;  1F9Q A;  1B9M A;  2B2T A;  1B1Z A;  1CKO A;  4IUT A;  4IUR A;  2OTJ A;  4H02 A;  1F2M A;  4FF4 A;  1BDO A;  1RIP A;  1FJG L;  1JT8 A;  2JXM B;  5I6W A;  2BDO A;  2R6G A;  1BUV T;  1QE6 A;  3EIV A;  3QOL A;  3FVQ A;  2WII B;  1RJT A;  4L5S A;  2ZTE A;  1STH A;  4X6A H;  1PRT F;  3OTO L;  2VUM B;  1I6V C;  1STE A;  5E7N A;  1WI5 A;  2EYJ A;  5EAY A;  1IKL A;  1FJG Q;  1WTH A;  3MAQ A;  2EPB A;  2F3V A;  4X65 L;  4JOI C;  1I4R A;  5KNB A;  2RDF A;  3M3Y H;  3QG1 A;  3VYU A;  2F0I A;  4DR4 L;  3MTS A;  4WOR A;  1SYC A;  3ULJ A;  3ERQ A;  2K75 A;  1S4Z A;  3RZO H;  4BY7 B;  4K14 A;  1NAP A;  3PGZ A;  3UDG A;  3I4L A;  1X54 A;  1A63 A;  2E2J B;  1JOR A;  4DA2 A;  1S3O A;  4BA2 I;  5LMN W;  5JVG 3;  1CSQ A;  3M4Q A;  5GQO A;  1GO3 E;  2N78 A;  2HT1 A;  1O7I A;  2HD3 A;  5JJK A;  4PV1 C;  4C3J G;  2FJ2 A;  1PYW D;  1EWI A;  1UE7 A;  5CV8 A;  3U4Z A;  4KY6 A;  1D8L A;  4WFN 3;  2ZXR A;  5IT9 L;  1D1I A;  1YBY A;  3GTJ B;  2AUJ D;  2K05 A;  3OYY A;  1TY0 A;  4A3E G;  3RZO B;  3VR2 A;  1VQ5 A;  3JAM E;  4YCU A;  4BA1 I;  2K52 A;  1U4L A;  5M5W B;  1SRO A;  2NN6 H;  4F87 A;  2ES2 A;  3KK7 A;  2AWN A;  1Q3L A;  3BU2 A;  4JPB W;  3GTQ B;  2B2W C;  2K1B A;  5DNF A;  1EYG A;  2R7F A;  2NYZ D;  3EQL C;  1KDB A;  1DM0 B;  1B7Y B;  2A68 C;  2F0F A;  1DON A;  4NXM Q;  2UUC Q;  1YVC A;  2HQL A;  3HFZ B;  2G5D A;  3T1H Q;  3H15 A;  2UUB L;  3C46 A;  1SJE D;  1KDC A;  1PMR A;  2A6H C;  4OON A;  5CR3 A;  4E6I A;  2N88 A;  2CCZ A;  1IYU A;  3STB D;  4OIJ A;  2B8F A;  1CHP D;  2DJG C;  1LAB A;  1XTC D;  4A93 G;  2YU9 H;  1PH1 A;  2UU9 L;  1SNP A;  3QWN A;  1IBM Q;  4X3U A;  4AH6 A;  2O4X A;  5IGF A;  1FNW A;  4DV6 L;  3MXN B;  3HOV B;  1LM0 A;  1NR2 A;  1Z9F A;  3TDQ A;  2N49 A;  3TZD A;  3G4S A;  3NHH A;  3UI2 A;  1VQ6 A;  1JB3 A;  3VR4 A;  3W1B A;  3KJP A;  1IBK L;  1KAW A;  1PH3 A;  1YJN A;  4FNF A;  3L3O C;  1U4P A;  3W2D A;  4BY1 G;  2AWO A;  4EQP A;  4RMF A;  1KC8 C;  2XVS A;  3F8T A;  1SNC A;  3S17 B;  2I0Q A;  4V19 0;  4R4O A;  4HCE A;  3NTK A;  1IHZ A;  4F8M A;  3MXP A;  1PH4 A;  4EGV A;  4JYA L;  1CK1 A;  4MTK A;  3T51 B;  2KCT A;  4EX5 A;  1F2Z A;  1Z47 A;  3Q22 A;  1B3A A;  5AFW A;  3PIP 3;  1GHJ A;  1S5D D;  2K5Q A;  1R9T H;  1Y8N B;  2Q8I B;  4A3C G;  1HZC A;  1WTO A;  4PQX A;  3J81 E;  5KGU A;  4DV7 L;  1A8V A;  1SE3 A;  1FD7 D;  2LXJ A;  4UP9 A;  3VYS A;  1YJW A;  5C4X G;  1MSH A;  5GRO A;  5EKI A;  4CKB A;  2E2I H;  4A3D B;  3KBG A;  1L1O A;  3GD7 A;  3KUP A;  2EY5 A;  1EY6 A;  1TS3 A;  1FYC A;  3NUC A;  4ZCK A;  4BS9 A;  2B2T C;  1PH2 A;  1YNJ D;  5CBA E;  3TP5 A;  2EJM A;  1K8A C;  1EIG A;  1BOS A;  4QL5 A;  3GTM H;  2MPM A;  4PNY A;  4AYB B;  3TP7 A;  2NVY B;  1W6J A;  3KLS X;  2KED A;  1S5B D;  3EA6 A;  2MUY A;  1L0Y B;  1OXS C;  2KJX A;  4AIM A;  3AFQ A;  4A3D H;  3IKJ A;  2PW5 A;  4C3H B;  3SVM A;  2UUA Q;  1FGB D;  1I50 H;  4HCS A;  1TWF B;  3NEM A;  3M4Y A;  3PO3 G;  1AZQ A;  4JI1 L;  4MN3 A;  2JK8 A;  4IFD J;  1HCZ A;  1W3S A;  1VQF A;  1QIL A;  3X3M A;  5E1F A;  1VQI A;  3FKI B;  1HPC A;  2PQE A;  1EIH A;  2F0G A;  2EZV A;  3MXU A;  5IP9 G;  4A3B B;  2XRS D;  4CDD C;  3V2T A;  1UE5 A;  4LF9 Q;  5E3F A;  2K7V A;  2Q2H A;  3W5O A;  4K8I A;  2R92 H;  1J8I A;  4OWT B;  2D5D A;  2F0P A;  4RKL A;  4JI1 Q;  4FF2 A;  2ATW A;  2F0M A;  2KCN A;  1NCV A;  4JI8 Q;  4HMJ A;  1EIY B;  4MHE A;  4KKU A;  3L9A X;  2JEB I;  2WB1 B;  4FO2 A;  4KLK A;  1EQT A;  3RZD B;  1XX8 A;  2Z6K C;  3KLS A;  4KJO A;  1TWA B;  3HOU H;  4KN7 C;  3KF6 A;  4DF7 A;  1S5F D;  4NDX A;  3M9B A;  4X65 Q;  1EQQ A;  2R7Z H;  3I4M G;  1CZW A;  4U67 3;  1XMO L;  4DAY B;  1NNX A;  2VQF Q;  1H95 A;  2F0O A;  4DR3 Q;  1NMF A;  5JJI A;  5EBC A;  3PO2 B;  2F0V A;  3HEJ A;  3SHL A;  4TVA B;  1Y69 U;  5C3E H;  2R93 H;  1QNK A;  3AFP A;  1TQO A;  3CKI B;  3KLW A;  3V05 A;  4CDE C;  2E2J H;  3I4O A;  3F1Z A;  3HRZ C;  1LTB D;  1V1P B;  5LL6 S;  3BDL A;  4QCL A;  1QG7 A;  3J80 i;  3D6C A;  5KIX A;  2EYH A;  2EVB A;  4HJ8 A;  1K9M C;  1Y1W B;  2IX0 A;  3VA5 A;  5IT9 E;  3CHB D;  3PMF A;  4UAI A;  3RLF A;  3NBI A;  1BCP D;  5JVH 3;  4IPG A;  1VQ7 A;  2JA5 B;  2ZXP A;  3NSW A;  5GAE C;  5ISR A;  4RG1 A;  1JOO A;  1Y1V H;  1HJP A;  3U9S A;  2WKD A;  4BXX H;  3K57 A;  2YV5 A;  3URY A;  2BE5 C;  1AH9 A;  1NJI C;  2YYZ A;  3MEF A;  4JBK A;  3M4P A;  3NXW A;  4K8J A;  4FXK C;  1A2T A;  4H44 C;  4NPS A;  1JIC A;  5IWA Q;  1S5C D;  1GM5 A;  2ZTD A;  2F3I A;  2VB3 X;  3NQI A;  4JI4 L;  3GTO B;  5GAD C;  1VQL A;  3T1Y L;  4R4Q A;  5KEE A;  1PH7 A;  1PH5 A;  3CF5 A;  3TQY A;  1JOK A;  4IFD G;  2V1C C;  4BBR H;  1QVC A;  2HCI A;  3PIO A;  3CQZ H;  5C5L A;  2LY7 A;  2KVM A;  1MI2 A;  2RVL A;  3VYT A;  4JI5 Q;  2CWP A;  2HDL A;  2L55 A;  1K8O A;  3K6O A;  1HH2 P;  4P74 A;  4DAY A;  2QDB A;  4QY7 A;  2F0D A;  4RGN A;  4C3I B;  3MA2 B;  2F0W A;  4YHH Q;  1E7Z A;  1YEZ A;  4C1N K;  1VQ4 A;  4RCN A;  5BN3 A;  2QCP X;  1XJV A;  4ILW A;  4LUZ A;  1MIU A;  3K58 A;  3J7A F;  3SK8 A;  1CTM A;  2PMZ B;  4JI2 Q;  2B29 A;  2UXB L;  4RFB A;  3VDY A;  3EJI A;  4HSV A;  3RLO A;  1J9O A;  1FNV A;  1LTT D;  3ONA B;  1KL9 A;  1T5E A;  3D31 A;  3D6W A;  4JI0 L;  3BYT B;  1BBW A;  2E76 C;  2MO1 A;  3R93 A;  3TS2 A;  2TSS A;  3T56 B;  4DUY L;  2H4O A;  2IX3 A;  2F3W A;  3BVZ A;  2F0L A;  1KNE A;  5IYC G;  5D3D A;  1H9J A;  5K36 G;  3E0E A;  1HNZ L;  2X69 A;  1PH8 A;  1O78 A;  3A5Z B;  4R4C A;  1EY4 A;  3ND8 A;  2XTI A;  2HHH L;  3SDZ A;  1G51 A;  4LF7 L;  2PI2 A;  5K5P A;  3HOZ H;  1SE2 A;  1X3E A;  4KD4 A;  3HOU G;  3D0F A;  5M3F B;  2CFM A;  1TS4 A;  4CJ0 B;  1EYC A;  3BDC A;  1SFO B;  4LF6 L;  1D6E C;  1C0A A;  3J81 i;  3R3O A;  5JJZ A;  2CH4 A;  4LW1 A;  1RTN A;  2VZA A;  4N9P A;  1YI2 A;  4DUZ L;  4XIG S;  2K32 A;  1AFP A;  4B9W A;  3F2B A;  5FKA C;  1YHA A;  4JI3 Q;  1YHB A;  2F1M A;  5LL6 X;  4K5W A;  2SNS A;  1V1Q A;  2NVT B;  2QA4 A;  3HOV H;  1YZ6 A;  2EIF A;  4K0K L;  1CT1 D;  4A3E H;  4X3S A;  3UDI A;  3TRE A;  4A3L G;  2JA5 H;  2AQ1 B;  4HED A;  3CCL A;  4GKK L;  2HIV A;  1TWC H;  3ZYY X;  2ZJQ A;  2Q2U A;  1A2U A;  3J81 j;  1PTO C;  4WJ3 M;  3QIA A;  2LS0 1;  1SYF A;  3QO2 A;  1I3Q B;  3P7J A;  4BBS B;  4N9T A;  1MD2 D;  3GTG H;  2OT2 A;  3OMG A;  3S2D B;  5IYD G;  4DR1 L;  3AMU A;  1K8M A;  4GN5 A;  1HNX L;  1SNQ A;  1ZEQ X;  1PTO B;  3STB C;  4DR5 L;  3PUX A;  1EZ6 A;  1SR3 A;  1KRS A;  5IGG A;  1Q81 C;  1O7Y A;  4CDC C;  2YTV A;  1I4H A;  2V4D A;  2I5H A;  4Q5V A;  1CKN B;  3HKZ B;  4LF5 L;  1UWV A;  4DXF A;  2LXK A;  4B9X A;  1PDQ A;  5C3E B;  3Q23 A;  1L1O C;  5JEA J;  2Z9H A;  1VF5 C;  3A8K E;  4DR1 Q;  1R4Q B;  4FXD A;  5FJ8 H;  3I3C A;  1PHJ A;  2A1A A;  5M5X B;  2JA8 B;  2A19 A;  4OO1 H;  1N34 L;  3T13 A;  2AQ2 B;  2Q2T A;  3E0J A;  4G7O C;  4LFB L;  1PXU A;  3DEO A;  4DR7 Q;  4J1M A;  1VDZ A;  2EJG C;  2F0H A;  3MWY W;  2Q8R E;  3GO5 A;  2OEO A;  1L2F A;  3H6M A;  4L5T A;  3NP8 A;  4POG A;  1E1O A;  4MNO A;  1QUQ B;  2N3S A;  1EYA A;  1QCB D;  4IQZ A;  3H91 A;  4DPG A;  3PF5 A;  1LV9 A;  3VR5 A;  2MQH A;  3UE1 A;  2A74 C;  4BBS G;  2WV6 D;  3QB3 A;  4DR7 L;  4A4I A;  2Q8T A;  3HOW G;  3IFT A;  4IUQ A;  1K3B C;  4X66 L;  4DV3 Q;  1WCM G;  3NEL A;  1Y1W G;  3PUZ A;  2NVX B;  1EIF A;  1E2W A;  3VR3 A;  5FLX c;  4UP8 A;  4XQJ A;  4XQQ A;  1HZ9 A;  1K0R A;  4NKL A;  3H0G G;  4B3T Q;  5A2Q E;  2QGQ A;  1AE3 A;  1JWS D;  3LWE A;  3RN5 A;  4DAP A;  4GZY C;  1KXL A;  4ZRZ A;  2YTX A;  1SJH D;  2WFW A;  3OIP A;  3I4N B;  4G4K A;  1XPO A;  1XPR A;  2IWH A;  2MO0 A;  5FO9 B;  3CXC A;  2ZM6 L;  1X3G A;  2M2L A;  2IW3 A;  2F0T A;  1TY2 A;  1H9K A;  2C5C A;  1HQR D;  3CCM A;  3S16 B;  4CJ1 B;  1DOM A;  4PG3 A;  1GXD C;  4B3T L;  5G3L D;  4ZK9 B;  1STB A;  4KKT A;  1Y8O B;  3X3N A;  4QUF A;  4A3E B;  2PPB C;  2SNM A;  4YWM A;  5GAH C;  2P5Z X;  1HUN A;  1JJC B;  1TWC B;  2KA7 A;  1BBX C;  2EYO A;  1EQR A;  3RLN A;  2UXD Q;  4OX9 L;  2B63 G;  5C44 B;  3NE5 B;  1DYQ A;  2ZM6 Q;  3I4N H;  2WAQ B;  1KLG D;  3BDO A;  4JI5 L;  3WOF A;  3GTQ H;  1XNR Q;  3EBE A;  4UY8 C;  4B08 A;  5I2X A;  5JAV A;  5C0X G;  2YU9 B;  1BXT A;  3OW2 A;  4IOC A;  3NQT A;  1HFN A;  2WB1 G;  2XWB B;  4ME3 A;  4S3S A;  3RUZ A;  3TEH B;  1MGS A;  1CSP A;  2AQ3 B;  5BN4 A;  3S2H H;  5CV4 A;  2NUC A;  3EFX D;  1L0X B;  5I9P A;  1OXT A;  4A3F G;  4YY3 Q;  4LF8 L;  3KLR A;  1SBB B;  3T4A C;  4NB3 A;  1F9R A;  1IL2 A;  1PTO F;  4UDU C;  4APV A;  2PZW A;  3OWE B;  4JK1 C;  4OWW B;  3ND9 A;  4DV1 Q;  1TU2 B;  4JI0 Q;  1Q12 A;  3UDF A;  1H9M A;  2K6A A;  1LO5 D;  1A3V A;  1S72 A;  4R4T A;  3UDX A;  4DV2 L;  4OO1 G;  4J6H A;  4JVZ A;  1O80 A;  4XXE A;  1VQA A;  1I4G A;  1C8C A;  2AMC B;  4YY3 L;  3TZU A;  1KAB A;  1HNZ Q;  4DN4 M;  2K5V A;  1CHQ D;  1YJ9 A;  1HUM A;  2RCF A;  1NTG A;  1A0I A;  1II3 A;  1AZP A;  4LUV A;  4K5V A;  1GJX A;  1C4Q A;  4A3I G;  2KOL A;  1H9S B;  4A3B H;  4OO1 I;  3GQB A;  1WJJ A;  3R2I A;  4TKO B;  4Q0F A;  3HKS A;  5C5M A;  1QUQ A;  4IPC A;  5C44 G;  3L0O A;  1ICW A;  4KTA A;  3FRP B;  3AU7 A;  1XMQ Q;  4R4I A;  3WWV A;  1V8Q A;  4BBS H;  1VQP A;  1NBW A;  2CHB D;  3P20 A;  4HJ7 A;  4OL7 A;  4FVM A;  5LMU L;  1LLR D;  2Z4I A;  1PFB A;  3VYR A;  2L9H A;  2PO4 A;  4F7X A;  3BZC A;  1GHK A;  5EKL A;  4POF A;  1EY7 A;  1QWY A;  1LTS D;  3G71 A;  2I5L X;  1I4Q A;  3Q6S A;  3ERO A;  4G57 A;  3J7A 5;  5AJ3 L;  3DXJ C;  2VUM H;  4EQN A;  1T9H A;  2E8G A;  2ZXO A;  2Z4H A;  2F0N A;  5IYC H;  4L5R C;  1E22 A;  1K8G A;  4JBM A;  4ODG A;  2E74 C;  5IYB H;  4PZ8 A;  4WJ4 A;  4XT3 B;  5KNC A;  2MNA A;  1N33 Q;  1Y1W H;  3K7U C;  4L8J A;  2VB2 X;  3K7A B;  1E24 A;  4LJZ C;  4IFD H;  1FGU A;  1QOH A;  1ASY A;  1EEI D;  1SFO H;  1EOV A;  1X3P A;  2Z8L A;  5JPN C;  1HNX Q;  4GOP A;  2FIN B;  3S9W A;  2HCC A;  3M7N A;  3ERS X;  4EQ5 A;  5M5W H;  4DR5 Q;  4AYB G;  1AE2 A;  1KTK A;  3EN2 A;  1A3T A;  3NPP A;  3FP9 A;  1FVI A;  2JA6 B;  1K73 C;  2NVQ B;  4R1J A;  4LF5 Q;  2N55 A;  4FF1 A;  2SOB A;  3RN2 A;  2GN5 A;  1FL0 A;  4G7Z C;  3CPF A;  1OXX K;  1EY0 A;  2HUG A;  1X32 A;  1J6Q A;  1LTL A;  3TN2 A;  5CBE E;  1WTV A;  2D9U A;  1N34 Q;  1KRT A;  4GKJ L;  3UE0 A;  4GLX A;  4HIM A;  3HOU B;  4Z9C B;  3E6Z X;  2K5H A;  4QIW E;  4LFB Q;  1KHI A;  4JBJ A;  3A5U A;  1JWU D;  2B39 A;  2O5I C;  1K83 B;  2MFI A;  1EU4 A;  4N8F A;  1JJG A;  1VCI A;  1HNW L;  2K03 A;  1PH9 A;  1I4P A;  5NUC A;  4KY5 A;  4OXP A;  3SE0 A;  3ZJY C;  3KJO A;  4JI7 L;  4XTC S;  2GVB A;  5E4W C;  3Q24 A;  3KDF A;  2F52 A;  3FMC A;  2E2I B;  1PLF A;  1EYD A;  2DGY A;  5BR8 L;  2OTL A;  1WVL A;  4RAU C;  3EVQ A;  5M5Y B;  2IHE A;  3K59 A;  5G3L F;  3H0G B;  2R7Z B;  5A2Q L;  2LFN A;  1DJR D;  1ET6 A;  1GUG A;  2K5N A;  2L0C A;  1B8A A;  1TII D;  3ICE A;  1F9P A;  1AW7 A;  2FFK B;  2PI2 E;  1N36 L;  1HNW Q;  3S1Q H;  1K83 H;  3TRZ A;  3G6E A;  2BDN A;  1QJO A;  5I9O A;  1SXT A;  3J7Y W;  4JI7 Q;  4RGT A;  3OW7 A;  2RCN A;  1SEB D;  1UEB A;  1BVS A;  2R61 A;  1VF7 A;  1BKB A;  1HR0 L;  2EYP A;  2FMC A;  4DK3 C;  2OQK A;  2AUK A;  1L1O B;  5HGT A;  3HOY B;  1PZI D;  2DN8 A;  1N36 Q;  3E3X A;  3OPO A;  1IL8 A;  3HS0 C;  1JJ2 A;  3BJU A;  1VQC A;  1CM9 A;  5LHY 1;  1N32 L;  1KIX A;  1Y1V G;  2DNE A;  4ALP A;  1VQM A;  3H09 A;  4BY7 G;  1LTG D;  4BY1 B;  2EY1 A;  2BH8 A;  2H5X A;  3KFU A;  3GTP B;  2IT1 A;  3PF4 A;  5J39 A;  3C1E A;  3S17 H;  3A7L A;  1I94 Q;  2WB1 E;  1ESR A;  5HGQ A;  1WTP A;  1QVG A;  2O2L D;  5ELD A;  1GVP A;  1LAC A;  3S24 A;  4NXN L;  1B9N A;  1X6O A;  1SND A;  1WTW A;  4V0B A;  1XXG A;  3BVM A;  4KD3 A;  2D0P A;  1U9R A;  1LTI D;  4A3J G;  1B3Q A;  2C35 B;  4PMW A;  3K5N A;  2JN4 A;  2E75 C;  1I94 L;  2B63 H;  4LF8 Q;  2NVY H;  1LTR D;  1RF2 D;  2WP8 J;  1G91 A;  1V1O A;  1AN8 A;  2PNH A;  5C4X B;  2K33 A;  4R9W A;  5CV9 A;  2HQE A;  4NXN Q;  5M5X H;  2QEX A;  4GNX C;  3JAM c;  1KD1 C;  1JR0 D;  4A3D G;  4A3M H;  2A73 B;  4C3J H;  1PYS B;  4DV4 Q;  2PYK A;  2F4I A;  1RD9 D;  1QB5 D;  3N6R A;  1PRT B;  4JI6 L;  2JEA I;  4DV2 Q;  1Q8I A;  4AYB E;  1GOZ A;  1PFM A;  1UAP A;  2XGT A;  3R2T A;  5KRU A;  1C7Y A;  2B2W A;  3GTM B;  1SYD A;  4LF9 L;  2NN6 G;  3BVG A;  4L6T B;  2RDG A;  1EFI D;  1IBL Q;  1CKM A;  1GUS A;  5CV6 A;  1RCV D;  3IAY A;  1C48 A;  4DXG A;  3M4O H;  5IOC A;  5ELF A;  1TWG H;  4I7A A;  1KNA A;  4GOP C;  2JE6 I;  2RHQ B;  2FHT A;  5IY0 A;  2KEC A;  3OMC A;  1Q1E A;  1I5F A;  2HIX A;  1XMQ L;  3P75 A;  2JA7 B;  3HG9 A;  2CKZ B;  3LX0 A;  5I4D A;  1STA A;  3HZX A;  4DU9 A;  1VQB A;  1HRJ A;  3T53 B;  4LK1 C;  1SNM A;  1B2T A;  3H0G H;  1YIT A;  5ELN A;  1KLU D;  3H94 A;  1ILP A;  4IJH A;  3BG3 A;  2KUM A;  3FHW A;  4X64 Q;  5DM6 3;  2VY3 A;  2RDH A;  2XNA C;  1QNU A;  3CW2 C;  3V96 A;  3J7A V;  4HMI A;  5AJ3 Q;  1IW7 C;  1SDF A;  5EJW A;  4HR7 B;  2NVQ H;  2EYF A;  2E2H H;  4MZ9 A;  5C0X J;  1WTQ A;  3OIQ A;  3CC7 A;  4PMC A;  1TWA H;  3WDN A;  3M7G A;  1N33 L;  5BN5 A;  2NB0 A;  4X64 L;  1PZK D;  2PQA A;  4HSP A;  4NW2 A;  4ZLT F;  4NXM L;  1VMP A;  1SE4 A;  5HY6 A;  2L5T A;  3PUY A;  4A75 A;  5IWA L;  1JCK B;  2Q2I A;  2VUM G;  3JC6 6;  1U5K A;  4LAA A;  5C4Z A;  1KAA A;  1ASZ A;  2R93 G;  1TWH B;  2KCM A;  2KEE A;  2PQA B;  3MFG A;  4IAL A;  5H1S E;  4DR6 L;  2IJ0 A;  1NUC A;  3S1M H;  3NTI A;  4HAE A;  3T1Y Q;  1MJC A;  2KEN A;  1A3U A;  4DFA A;  4TQU S;  1G6P A;  4KK7 A;  3MXN A;  2KHJ A;  1E0B A;  3A54 A;  5M3M H;  1I6H B;  4A3K H;  4A3G B;  1PTO H;  3D3R A;  3KDF B;  1D1K A;  3F2D A;  2UU9 Q;  5D3I B;  2ALY B;  3GTL B;  2RHS B;  5IGC A;  4RHS A;  1S40 A;  2EY6 A;  4C1N I;  1ILQ A;  1BCP C;  4FYD A;  3CAM A;  4GN4 B;  4YHH L;  4YCW A;  2ZTC A;  4DK6 C;  1SNO A;  3PCO B;  1JB7 A;  2L4N A;  2JA8 G;  4JV5 L;  5FJ8 G;  4C3I H;  2ENB A;  1OXV A;  4C3J B;  3F2U A;  3O13 A;  1D7Q A;  5DEH A;  1EZ8 A;  4P75 A;  4X3T A;  1SMX A;  2XRQ D;  3H3V H;  3PUW A;  1SMY C;  3I91 A;  3GTL H;  5GAG C;  2EXZ A;  4O2D A;  3D8G A;  4BBR G;  3GDE A;  3J80 c;  4HJA A;  3A55 A;  3U4V A;  1D5X C;  1Q82 C;  2CWA A;  1D5Z C;  2K01 A;  2VS1 A;  4PZ7 A;  2XIW A;  2JA6 H;  1JOQ A;  1MSG A;  4XDX A;  4IUP A;  4DK0 A;  2R93 B;  4C2M B;  3FPP A;  5JJL A;  1GKH A;  1ML0 D;  2UXC L;  2PZT A;  2IHF A;  2RSN A;  1ESF A;  1TXY A;  4A3M G;  1VQN A;  3DUZ A;  1VQG A;  4B3M Q;  1YHQ A;  2F0K A;  2NVX H;  2RSO A;  3I56 A;  1NE3 A;  5C3X A;  5M3M G;  3TME A;  3S15 B;  2AHO B;  4HID A;  5EGT A;  5EQ0 A;  3I4M B;  1LT4 D;  4DUZ Q;  1Y1V B;  3KBX A;  5KND A;  2F4V L;  3AYH B;  4K2L A;  4MTN A;  2BE5 D;  4BY7 H;  1IW7 D;  1BQQ T;  4DV0 Q;  2UXC Q;  2F03 A;  1IYV A;  2F0Q A;  1HZA A;  4LFA Q;  1WFQ A;  5FLX E;  4OHJ A;  4AQY L;  4J8Q A;  2ID0 A;  2WIN B;  2EYL A;  2PCF B;  3K5O A;  4A76 A;  3S14 H;  2QIL A;  3K5L A;  1VQO A;  4K0K Q;  4FXG C;  2ZJP A;  4CBV A;  2EOT A;  3DLL A;  1HTL D;  2VL6 A;  4RHR A;  3GTO H;  1GUN A;  3HOV G;  4K5X A;  5J22 A;  2CVR A;  4L5Q A;  1VQ9 A;  3I8Z A;  4OIK A;  5JOB A;  1EQV A;  2VQE Q;  2UUA L;  1OTC A;  1XNQ L;  3I4M H;  1EWH A;  3LGJ A;  2ICE C;  4DV7 Q;  2JA5 G;  3SK4 A;  4RWS C;  1DXM A;  3VR6 A;  5ELC A;  3CPW A;  4CDF C;  1EL0 A;  2EYM A;  1IXR A;  1F77 A;  1PFN A;  5HUR A;  1O7L A;  2ICI A;  4B3S L;  1IYJ B;  4O0A A;  1B70 B;  3MEH A;  1VQK A;  3M4O B;  4ZYS A;  5ELB A;  5JPM C;  3S1R B;  4DV5 L;  4LF4 Q;  4KV6 A;  1Y14 B;  4A3M B;  2L11 A;  1Q90 A;  1EU3 A;  4UHV A;  5DM7 3;  2NN6 I;  4P73 A;  3G48 A;  1VQH A;  1ZXT A;  3JAM L;  1PFS A;  4FDB A;  3ITP A;  1W2B A;  2NTS A;  2DUD A;  1WTR A;  3R8B A;  3PO2 H;  4EQO A;  1CZG A;  4KI0 A;  1Q7Y C;  4DR3 L;  3A74 A;  1MKH A;  5C4H A;  4I65 A;  3OTO Q;  3E9I A;  3CCE A;  2F0E A;  1IBL L;  1XWE A;  1QVF A;  1B44 D;  1K28 A;  2Y0S G;  1E1T A;  4P71 A;  3CME A;  2MHV A;  3CD6 A;  4A3K G;  4Y7N B;  1CFM A;  4H0L C;  1SMY D;  4XYO A;  1EOT A;  2PNR C;  2NZ1 D;  2CH4 W;  4JW0 A;  4GNX A;  1VQD A;  4XYQ A;  3RNU A;  2VNU D;  1ONL A;  2M00 A;  4M1U B;  4R8N A;  4JI8 L;  3H3V I;  1N8R C;  5C44 H;  2XN9 C;  4JG2 A;  2R92 B;  4C2M H;  3C2P A;  1TWH H;  4HN7 A;  4XQN A;  5FOB B;  2ZT9 C;  5IE8 A;  3L2P A;  3MXG A;  3HOW H;  2D62 A;  1Z7T A;  1SYG A;  2K5D A;  2B2V C;  1LYL A;  1LT3 D;  5C4J B;  2VQF L;  3DWQ A;  4QB4 A;  3U9O A;  3K7A H;  3MC0 B;  4HIO A;  2MGS A;  1R9T B;  4KMU C;  2J4X A;  1M4V A;  3PIO 3;  2A6H D;  1U0L A;  2WAC A;  2D0O A;  2Z6B A;  3KOJ A;  2I5M X;  2OXP A;  1JE5 A;  2LKV A;  2NZO A;  5CMD A;  2I46 A;  4FP5 D;  3FDT A;  2NTT A;  2A5H A;  2G9H D;  4C3H G;  5IYB G;  4UPA A;  4L63 B;  1WCM B;  3A7A B;  1DGS A;  3CRL C;  2H1E A;  5C4J H;  2FMM A;  2RQX A;  1JE4 A;  4ZQ3 A;  1OXU A;  3FKI G;  4G7H C;  4Y52 H;  1HZB A;  2SDF A;  3T1H L;  3SXH A;  5LMN L;  3D4R A;  2LMC B;  2UUB Q;  2B3G A;  4U68 A;  4CKC A;  5IGD A;  4JI2 L;  1CQV A;  2JA6 G;  2JJQ A;  4ABN A;  4OEM B;  4JI4 Q;  1HA5 A;  3MVV A;  1XTD A;  5J1Z A;  2FXQ A;  1I50 B;  1UNS A;  2EE1 A;  5C0X H;  2GA4 B;  3CC2 A;  3PQI A;  2QF7 A;  3K81 C;  2QDL A;  4KY7 A;  4CHT B;  4YCV A;  1IBM L;  1JWM D;  4DV6 Q;  4H13 C;  2HHH Q;  1RHP A;  3DHQ A;  3KF8 A;  3PSI A;  4LFC L;  3W1G A;  4LF7 Q;  2NWG A;  1HR0 W;  4LWC A;  1DCZ A;  1IKM A;  4DV1 L;  5IP9 H;  1MHW C;  3DEP A;  1S5E D;  1CUK A;  2F0U A;  1E2V A;  1IBK Q;  2QEJ C;  1C9O A;  2F0J A;  3J80 E;  4DNI A;  2DY8 A;  4F88 A;  3DM1 A;  3PO3 H;  2DNC A;  4RA8 A;  1ENC A;  1RDP D;  3I55 A;  3N52 A;  3M3Y B;  1M8A A;  5L37 A;  3D4D A;  5M5Y H;  4B3M L;  3NBH A;  2BA1 A;  2VW9 A;  2MP1 A;  3L7Z C;  1Q1B A;  2Y0S E;  4KHP Q;  4GN3 B;  4JYA Q;  3DM3 A;  3ULL A;  4A3I H;  3K80 C;  3W3A A;  4PMB A;  2PMZ E;  4LUO A;  4IUU A;  1PRT C;  4X62 L;  3H3V C;  1ZYR D;  1ZKO A;  3HKZ G;  1WYD A;  1E3P A;  1HTP A;  3G6J B;  4DV0 L;  4C3I G;  5M9O A;  1LUZ A;  2JA9 A;  4DNR B;  2AKW B;  4LFA L;  1Q8K A;  1ENA A;  3DWP A;  2VXW A;  3HOW B;  4AQY Q;  3TP8 A;  1P8L A;  3IRB A;  3HOY G;  5CYU A;  3IL8 A;  4KHP L;  1TWF H;  1LTA D;  3TS0 A;  4OEL B;  4LF6 Q;  4A3G G;  3K8A A;  4XT1 B;  1X9N A;  4IN3 A;  4DR2 Q;  4X62 Q;  3SK5 A;  1WD0 A;  3MFY A;  4B3R L;  2A69 D;  3E9H A;  4IUN A;  2OWO A;  1TS5 A;  5COY A;  1Z6H A;  1BNZ A;  4BY1 H;  1ENF A;  2N8N A;  1SLJ A;  3T16 A;  4NP5 A;  5IGE A;  4B3S Q;  5C4X H;  1NY4 A;  2RF4 A;  1D2B A;  1BBU A;  2A8V A;  2B2U A;  1WCM H;  2NZH A;  5FO7 B;  1Q46 A;  3K0X A;  2DY7 A;  4ZAI A;  4DR2 L;  4DV5 Q;  4LF4 L;  4TSS A;  3D4W A;  4B3R Q;  5M3F G;  2R3Z A;  5T1I A;  1YNN C;  4Y7N H;  4BBR B;  1EFW A;  1UEA B;  3TBI B;  1P16 A;  5FLM H;  1TR5 A;  3PO2 G;  1AEX A;  3A0J A;  3MZ5 A;  4LNQ A;  2J0T D;  2B63 B;  4J15 A;  3SR1 A;  4I7Z C;  3I70 A;  3GP7 A;  4IZ8 A;  5ELO A;  2PW7 A;  3SK6 A;  1TT2 A;  4YWK A;  3P1H A;  4GKJ Q;  2JQO A;  4RGM A;  4BWG B;  1PZJ D;  4X3K A;  1X3Q A;  4IUV A;  2IX1 A;  5IP7 H;  2K14 A;  4GS3 A;  2OF1 A;  2A68 D;  4DV3 L;  4A3F B;  3C1F A;  1O7Z A;  4BXX G;  2O5J C;  1VQ8 A;  1A62 A;  2CW0 D;  4EVO A;  1VS0 A;  1XMO Q;  4GLA C;  1A6X A;  3NWS A;  4JBW A;  1HQM C;  3NWT A;  5CV7 A;  4ZUI A;  3A8I E;  1DOL A;  1EY5 A;  3HOX H;  1FR3 A;  1R4P B;  5J3B A;  2MJ8 A;  5IOD A;  2E2H B;  2EDG A;  3NBH B;  1HFG A;  1J5E L;  3J81 c;  5IYD H;  5JEA H;  2JA7 H;  1M1K C;  3J7Z C;  1I4X A;  3U50 C;  3HOZ B;  4ID6 A;  3LNN A;  1SYE A;  2RKS A;  3K0Y A;  2EXD A;  3FEW X;  5I2Y A;  4A3F H;  2B2Y C;  2BOS A;  3LWU A;  1BO0 A;  4A3J H;  4IJL A;  5EPL A;  2QKI C;  4OGQ C;  3CP0 A;  2K28 A;  1HR0 Q;  5C3E G;  3BYY B;  1HA6 A;  4IFD I;  5DLQ E;  3GTK B;  3BS1 A;  1G2T A;  3A56 A;  1J5E Q;  4X66 Q;  1X3F A;  3S14 B;  3GV3 A;  2NVT H;  4ZKB B;  2BH2 A;  3KF8 B;  4K2K A;  3NK9 A;  4K6L A;  1KQS A;  2NBF A;  1EEF D;  5ELE A;  1RTO A;  1G6Z A;  1TVX A;  2XSC A;  4A3G H;  4WRD A;  4KKS A;  2R7Z G;  3S2H B;  2I07 B;  1EWC A;  1NMG A;  1VMC A;  3CC4 A;  1H9R A;  5E4X A;  1B4O A;  3CQZ B;  1ROD A;  3JAM i;  4PZ6 A;  4IOA A;  5F2D A;  4ZUJ A;  3RD4 A;  2Z6K A;  1Y8P B;  1FNU A;  5EPK A;  3C3L A;  2A6E C;  3K5M A;  1H9S A;  2F0S A;  1CQF A;  3F2C A;  5LMN Q;  1QZG A;  4RCO A;  1VQJ A;  4H7B A;  1AP0 A;  1T5X D;  4QJF A;  4CKE A;  5FK9 C;  2L12 A;  3S1N B;  4O1N A;  3HOY H;  2Y0S B;  4QMG A;  5IGB A;  5D65 A;  3PO3 B;  1EUJ A;  1NSN S;  4A3K B;  4P2C B;  1RL2 A;  3HOZ G;  4HTH A;  4WJW A;  1M90 C;  1TS2 A;  3DMU A;  2E5L L;  1E2Z A;  2UXD L;  3KYH C;  1PRT D;  2HDM A;  1UUP A;  3I90 A;  1U4M A;  3FKI H;  3SGI A;  4JCV E;  4QQB X;  1TKW B;  1F2Y A;  1CA5 A;  3CCU A;  5A35 A;  2UXB Q;  1YNJ C;  1XNR L;  2ZJR A;  4LFC Q;  4KHZ A;  3Q8D A;  3J81 L;  5COR A;  1MBY A;  2C9O A;  2R92 G;  2TMP A;  2IY5 B;  2Z0S A;  4C3H H;  1CA6 A;  1PV4 A;  4JI6 Q;  1Q86 C;  4DUY Q;  2X6L A;  1ICF B;  4A93 H;  5CV5 A;  1SSO A;  4GLV B;  2L1B A;  4ZKC B;  2E5L Q;  2G9D A;  4K6D A;  1A15 A;  5IP7 G;  1HHV A;  2WAQ E;  4HIK A;  3OWF A;  3S15 H;  1CI3 M;  1XYI A;  3OHX C;  1PYB A;  1F2L A;  4OWX B;  1DD2 A;  2JSO A;  2WKC A;  1JMC A;  2EQS A;  3IFD A;  1LT5 D;  1DOK A;  4DAM A;  5IT9 c;  3I4N G;  1TWG B;  3CCR A;  4M8A A;  1L0W A;  2KHS A;  3RR5 A;  4C56 C;  1KDA A;  4GNX B;  2BCO A;  4HJ5 A;  1I3Q H;  2LSS A;  4IPD A;  3CCQ A;  3PUV A;  1GUT A;  5I6Y A;  5KYI A;  1MJE A;  4DR4 Q;  4JI3 L;  2B8G A;  2R7D A;  5C6A A;  1G29 1;  5M3M B;  1I6H H;  2IPK D;  2E2D C;  1UE1 A;  2RA4 A;  3NEN A;  3TSS A;  2B2U C;  2DJF C;  3A8J E;  1W6K A;  2XWJ B;  1V9P A;  4ULL A;  2Z1C A;  2KQ3 A;  3GTP H;  4GKK Q;  1F9S A;  3OSO A;  1D5M C;  5LMU Q;  1EY8 A;  1STN A;  4KHV A;  5DAU A;  3S1R H;  3HOX G;  1YIJ A;  1STY A;  1NR4 A;  1U4R A;  2ASB A;  4QUC A;  2JP1 A;  3S2D H;  4CJ2 C;  3E5S A;  5JEA G;  4MIU A;  4DKA C;  3FPU B;  4P72 A;  4UP7 A;  5M3F H;  5CGK A;  1K0S A;  5EPJ A;  3HGB A;  4R8I A;  1UE6 A;  1B53 A;  4A3I B;  4A3L H;  3PV0 A;  4NMZ A;  2IL8 A;  3CMA A;  5C0X I;  1K3R A;  5FLM G;  4DR6 Q;  4KN4 C;  1PVO A;  4DGZ A;  5CC4 A;  4JOI A;  2A6E D;  1V43 A;  2CW0 C;  1GUW A;  3S1M B;  1JQY D;  1G2S A;  1PA6 A;  3BZK A;  4QGU A;  2GVA A;  2KBN A;  5KYL A;  4JC0 A;  3WOE A;  2UUC L;  3ULP A;  4LMQ D;  2JYO A;  3TP6 A;  3GTJ H;  1X55 A;  3RZD H;  2X6G A;  1WD1 A;  3I72 A;  3HKZ E;  3QOJ A;  4DNT B;  1SN8 A;  5BR8 Q;  2CQA A;  1STG A;  2B2V A;  2OQ0 A;  1CKN A;  3I73 A;  4JV5 Q;  2K4K A;  3VA7 A;  4DK1 A;  2PZU A;  2OCE A;  5D14 A;  2YTY A;  3GTK H;  3SEB A;  3AEV A;  5K36 H;  1WOC A;  3NTH A;  2L15 A;  1GD7 A;  1SRU A;  3U58 A;  3HOX B;  4KJN A;  1JC7 A;  3ER0 A;  5IIF A;  4A93 B;  4IPH A;  1RKN A;  3QJY A;  3S16 H;  5EKK A;  1B50 A;  1BF4 A;  1SE8 A;  3RMH A;  1HXY D;  3CCS A;  3Q0A A;  1V1P A;  1BR9 A;  5TSS A;  1XPU A;  4A3J B;  2K50 A;  3AQQ A;  4A3B G;  4QIW B;  1N9W A;  3MHB A;  3OOC A;  3CRK C;  3I7F A;  1IZ6 A;  4HJ9 A;  1N32 Q;  2WAQ G;  3CU7 A;  3DWA A;  3CCV A;  4GOP B;  1PH6 A;  1SAP A;  3BZD B;  3AB9 A;  2JA8 H;  1VQE A;  2RBM A;  3KF6 B;  4RH6 A;  3S1N H;  2JA7 G;  1ET9 A;  1BCP B;  2J7Z A;  3GV6 A;  4FF3 A;  2F4V Q;  2M9V A;  4DAV A;  1G8Z D;  5T1G A;  1OO9 B;  4ME5 A;  4A3C H;  3S1Q B;  2KHI A; 
#chains in the Genus database with same CATH homology
 4QF4 A;  4RGO S;  2K5W A;  5EBD A;  3G7L A;  1BCP F;  3J80 L;  2D2C C;  5FLX L;  1YNN D;  4RKB A;  1EY9 A;  4TRD A;  1ZYR C;  1WTX A;  1DZ1 A;  5FO8 B;  4O42 A;  2B2Y A;  2EJF C;  1SYB A;  4YIJ A;  2EY2 A;  2BA0 A;  4CGY B;  3M85 A;  5C3W A;  2K04 A;  1GUO A;  1LT6 D;  2KCC A;  3HP3 A;  3GTG B;  2A69 C;  1PTO D;  2SEB D;  1F9Q A;  1B9M A;  2B2T A;  1B1Z A;  4IUT A;  4IUR A;  1F2M A;  4FF4 A;  1BDO A;  2JXM B;  5I6W A;  2BDO A;  2R6G A;  1BUV T;  1QE6 A;  3QOL A;  3FVQ A;  2WII B;  1RJT A;  1STH A;  1PRT F;  2VUM B;  1I6V C;  1STE A;  2EYJ A;  1IKL A;  3MAQ A;  2EPB A;  2F3V A;  1I4R A;  5KNB A;  2RDF A;  3QG1 A;  3VYU A;  2F0I A;  3MTS A;  4WOR A;  1SYC A;  3ERQ A;  1S4Z A;  4BY7 B;  4K14 A;  1NAP A;  3I4L A;  2E2J B;  1JOR A;  4DA2 A;  4BA2 I;  5JVG 3;  4PV1 C;  4C3J G;  2FJ2 A;  1PYW D;  5CV8 A;  4KY6 A;  4WFN 3;  2ZXR A;  5IT9 L;  1D1I A;  3GTJ B;  2AUJ D;  2K05 A;  1TY0 A;  3RZO B;  3VR2 A;  3JAM E;  4BA1 I;  1U4L A;  5M5W B;  2NN6 H;  4F87 A;  3KK7 A;  2AWN A;  1Q3L A;  3GTQ B;  2B2W C;  2K1B A;  5DNF A;  2NYZ D;  3EQL C;  1KDB A;  1DM0 B;  2A68 C;  2F0F A;  1DON A;  3C46 A;  1SJE D;  1KDC A;  1PMR A;  2A6H C;  5CR3 A;  4E6I A;  2N88 A;  1IYU A;  4OIJ A;  2B8F A;  1CHP D;  1LAB A;  1XTC D;  1SNP A;  3QWN A;  4X3U A;  2O4X A;  5IGF A;  1FNW A;  3HOV B;  1NR2 A;  3TDQ A;  3TZD A;  3NHH A;  3UI2 A;  1JB3 A;  3VR4 A;  4FNF A;  3L3O C;  1U4P A;  3W2D A;  2AWO A;  4EQP A;  2XVS A;  1SNC A;  3S17 B;  4V19 0;  4HCE A;  3NTK A;  1IHZ A;  4F8M A;  3MXP A;  4EGV A;  1CK1 A;  3T51 B;  1F2Z A;  3Q22 A;  1Z47 A;  1B3A A;  5AFW A;  3PIP 3;  1GHJ A;  1S5D D;  2K5Q A;  1Y8N B;  2Q8I B;  1WTO A;  4PQX A;  3J81 E;  5KGU A;  1SE3 A;  1FD7 D;  3VYS A;  1MSH A;  5EKI A;  4CKB A;  4A3D B;  3KBG A;  3GD7 A;  3KUP A;  2EY5 A;  1EY6 A;  1TS3 A;  1FYC A;  3NUC A;  4BS9 A;  2B2T C;  1YNJ D;  5CBA E;  3TP5 A;  2EJM A;  1EIG A;  1BOS A;  2MPM A;  4PNY A;  4AYB B;  3TP7 A;  2NVY B;  1W6J A;  3KLS X;  2KED A;  1S5B D;  3EA6 A;  2MUY A;  1L0Y B;  1OXS C;  2KJX A;  3IKJ A;  2PW5 A;  4C3H B;  3SVM A;  1FGB D;  4HCS A;  1TWF B;  3M4Y A;  1AZQ A;  4MN3 A;  4IFD J;  1HCZ A;  1QIL A;  3X3M A;  5E1F A;  3FKI B;  1HPC A;  2PQE A;  1EIH A;  2F0G A;  2EZV A;  3MXU A;  4A3B B;  2XRS D;  3V2T A;  5E3F A;  2K7V A;  4K8I A;  1J8I A;  2D5D A;  2F0P A;  4RKL A;  4FF2 A;  2F0M A;  2KCN A;  1NCV A;  4HMJ A;  4MHE A;  4KKU A;  3L9A X;  2JEB I;  2WB1 B;  4FO2 A;  1EQT A;  3RZD B;  1XX8 A;  3KLS A;  4KJO A;  1TWA B;  4KN7 C;  4DF7 A;  1S5F D;  4NDX A;  1CZW A;  4U67 3;  2F0O A;  5EBC A;  3PO2 B;  2F0V A;  3HEJ A;  3SHL A;  1Y69 U;  1QNK A;  3V05 A;  1TQO A;  3CKI B;  3HRZ C;  1LTB D;  1V1P B;  5LL6 S;  3BDL A;  4QCL A;  1QG7 A;  3D6C A;  5KIX A;  2EYH A;  2EVB A;  1Y1W B;  2IX0 A;  3VA5 A;  5IT9 E;  3CHB D;  3PMF A;  4UAI A;  3RLF A;  3NBI A;  1BCP D;  5JVH 3;  2JA5 B;  2ZXP A;  3NSW A;  5ISR A;  1JOO A;  3U9S A;  2WKD A;  3K57 A;  3URY A;  2BE5 C;  2YYZ A;  3NXW A;  4K8J A;  4FXK C;  1A2T A;  4H44 C;  1JIC A;  1S5C D;  2VB3 X;  3NQI A;  3GTO B;  5KEE A;  1JOK A;  4IFD G;  2HCI A;  5C5L A;  2LY7 A;  2KVM A;  1MI2 A;  2RVL A;  3VYT A;  2HDL A;  2L55 A;  1K8O A;  3K6O A;  4DAY A;  2QDB A;  2F0D A;  4RGN A;  4C3I B;  3MA2 B;  2F0W A;  4C1N K;  4RCN A;  5BN3 A;  2QCP X;  4ILW A;  3K58 A;  3J7A F;  3SK8 A;  1CTM A;  2PMZ B;  4RFB A;  3EJI A;  4HSV A;  1J9O A;  1FNV A;  1LTT D;  3ONA B;  1T5E A;  3D31 A;  3D6W A;  3BYT B;  2E76 C;  3R93 A;  2TSS A;  3T56 B;  2H4O A;  2IX3 A;  2F3W A;  3BVZ A;  2F0L A;  1KNE A;  5D3D A;  1H9J A;  5K36 G;  2X69 A;  1O78 A;  1EY4 A;  3ND8 A;  3SDZ A;  5K5P A;  1SE2 A;  4KD4 A;  5M3F B;  4CJ0 B;  1TS4 A;  1EYC A;  3BDC A;  1SFO B;  1D6E C;  3R3O A;  5JJZ A;  1RTN A;  4N9P A;  4XIG S;  2K32 A;  1AFP A;  4B9W A;  5FKA C;  2F1M A;  5LL6 X;  4K5W A;  2SNS A;  2NVT B;  1CT1 D;  4X3S A;  2AQ1 B;  4HED A;  3ZYY X;  1A2U A;  1PTO C;  3QIA A;  2LS0 1;  1SYF A;  3QO2 A;  1I3Q B;  3P7J A;  4BBS B;  4N9T A;  1MD2 D;  2OT2 A;  3OMG A;  3S2D B;  3AMU A;  1K8M A;  1SNQ A;  1ZEQ X;  1PTO B;  3PUX A;  1EZ6 A;  5IGG A;  1O7Y A;  1I4H A;  2V4D A;  4Q5V A;  3HKZ B;  4DXF A;  4B9X A;  1PDQ A;  5C3E B;  3Q23 A;  5JEA J;  3A8K E;  1VF5 C;  1R4Q B;  4FXD A;  3I3C A;  5M5X B;  2JA8 B;  4OO1 H;  3T13 A;  2AQ2 B;  3E0J A;  4G7O C;  1PXU A;  3DEO A;  4J1M A;  1VDZ A;  2EJG C;  2F0H A;  3MWY W;  2Q8R E;  3GO5 A;  2OEO A;  3H6M A;  3NP8 A;  1EYA A;  1QCB D;  4IQZ A;  3H91 A;  1LV9 A;  3VR5 A;  2A74 C;  2WV6 D;  3QB3 A;  2Q8T A;  3IFT A;  4IUQ A;  2NVX B;  3PUZ A;  1E2W A;  3VR3 A;  4XQJ A;  4XQQ A;  4NKL A;  5A2Q E;  1JWS D;  3LWE A;  4DAP A;  4GZY C;  4ZRZ A;  1SJH D;  3OIP A;  3I4N B;  4G4K A;  2IWH A;  5FO9 B;  2M2L A;  2IW3 A;  2F0T A;  1TY2 A;  1H9K A;  2C5C A;  1HQR D;  3S16 B;  4CJ1 B;  1DOM A;  1GXD C;  5G3L D;  4ZK9 B;  1STB A;  4KKT A;  1Y8O B;  3X3N A;  4QUF A;  4A3E B;  2PPB C;  2SNM A;  1HUN A;  1TWC B;  2KA7 A;  1BBX C;  2EYO A;  5C44 B;  3NE5 B;  1DYQ A;  2WAQ B;  1KLG D;  3BDO A;  3WOF A;  4B08 A;  5I2X A;  5JAV A;  5C0X G;  2YU9 B;  1BXT A;  1HFN A;  3NQT A;  2XWB B;  4S3S A;  3RUZ A;  1MGS A;  2AQ3 B;  5BN4 A;  5CV4 A;  2NUC A;  3EFX D;  1L0X B;  5I9P A;  1OXT A;  3KLR A;  1SBB B;  3T4A C;  1F9R A;  1PTO F;  4UDU C;  2PZW A;  3OWE B;  4JK1 C;  3ND9 A;  1TU2 B;  1Q12 A;  1H9M A;  2K6A A;  1LO5 D;  1A3V A;  4OO1 G;  4J6H A;  1O80 A;  4XXE A;  1I4G A;  1C8C A;  3TZU A;  1KAB A;  4DN4 M;  1CHQ D;  1HUM A;  1II3 A;  1AZP A;  4K5V A;  1GJX A;  1C4Q A;  2KOL A;  1H9S B;  4OO1 I;  3GQB A;  3R2I A;  4TKO B;  4Q0F A;  5C5M A;  1ICW A;  4KTA A;  3FRP B;  3AU7 A;  1V8Q A;  2CHB D;  3P20 A;  4OL7 A;  4FVM A;  1LLR D;  2Z4I A;  1PFB A;  3VYR A;  2L9H A;  2PO4 A;  4F7X A;  1GHK A;  5EKL A;  1EY7 A;  1QWY A;  1LTS D;  1I4Q A;  3Q6S A;  3ERO A;  4G57 A;  3DXJ C;  4EQN A;  2ZXO A;  2Z4H A;  2F0N A;  4ODG A;  2E74 C;  4XT3 B;  5KNC A;  4L8J A;  2VB2 X;  3K7A B;  4LJZ C;  4IFD H;  1QOH A;  1EEI D;  1X3P A;  2Z8L A;  5JPN C;  2FIN B;  3S9W A;  2HCC A;  3M7N A;  1KTK A;  1A3T A;  3NPP A;  2JA6 B;  2NVQ B;  2N55 A;  4FF1 A;  2SOB A;  4G7Z C;  1OXX K;  1EY0 A;  2HUG A;  1X32 A;  1WTV A;  3TN2 A;  5CBE E;  2D9U A;  3HOU B;  4Z9C B;  3E6Z X;  1JWU D;  2B39 A;  2O5I C;  1K83 B;  1EU4 A;  1VCI A;  2K03 A;  1I4P A;  5NUC A;  4KY5 A;  3SE0 A;  4XTC S;  5E4W C;  3Q24 A;  3FMC A;  2E2I B;  1PLF A;  1EYD A;  1WVL A;  4RAU C;  3EVQ A;  5M5Y B;  3K59 A;  5G3L F;  3H0G B;  2R7Z B;  5A2Q L;  2LFN A;  1DJR D;  1ET6 A;  1GUG A;  2L0C A;  1TII D;  1F9P A;  1AW7 A;  2FFK B;  2BDN A;  1QJO A;  5I9O A;  1SXT A;  3J7Y W;  4RGT A;  3OW7 A;  1SEB D;  2R61 A;  1VF7 A;  2EYP A;  2FMC A;  2AUK A;  5HGT A;  3HOY B;  1PZI D;  2DN8 A;  3OPO A;  1IL8 A;  3HS0 C;  1CM9 A;  5LHY 1;  2DNE A;  3H09 A;  1LTG D;  4BY1 B;  2EY1 A;  3GTP B;  2IT1 A;  5J39 A;  3C1E A;  3A7L A;  1ESR A;  1WTP A;  2O2L D;  5ELD A;  1LAC A;  1B9N A;  1SND A;  1WTW A;  4V0B A;  1XXG A;  3BVM A;  4KD3 A;  1U9R A;  1LTI D;  4PMW A;  3K5N A;  2E75 C;  1LTR D;  1RF2 D;  2WP8 J;  1G91 A;  1V1O A;  1AN8 A;  5C4X B;  2K33 A;  4R9W A;  5CV9 A;  2HQE A;  1JR0 D;  2A73 B;  2PYK A;  2F4I A;  1RD9 D;  1QB5 D;  3N6R A;  1PRT B;  2JEA I;  1Q8I A;  1GOZ A;  1PFM A;  1UAP A;  3R2T A;  5KRU A;  2B2W A;  3GTM B;  1SYD A;  2NN6 G;  3BVG A;  4L6T B;  2RDG A;  1EFI D;  1GUS A;  3IAY A;  5CV6 A;  1RCV D;  1C48 A;  4DXG A;  5IOC A;  5ELF A;  1KNA A;  2JE6 I;  2FHT A;  2KEC A;  3OMC A;  1Q1E A;  3P75 A;  2JA7 B;  3HG9 A;  3LX0 A;  5I4D A;  1STA A;  3HZX A;  4DU9 A;  1HRJ A;  3T53 B;  4LK1 C;  1SNM A;  1B2T A;  1KLU D;  3H94 A;  1ILP A;  3BG3 A;  2KUM A;  5DM6 3;  2RDH A;  2XNA C;  1QNU A;  3V96 A;  3J7A V;  4HMI A;  1IW7 C;  1SDF A;  5EJW A;  4HR7 B;  2EYF A;  5C0X J;  1WTQ A;  3OIQ A;  4PMC A;  3WDN A;  3M7G A;  5BN5 A;  2NB0 A;  1PZK D;  4HSP A;  4NW2 A;  4ZLT F;  1VMP A;  1SE4 A;  2L5T A;  3PUY A;  1JCK B;  4LAA A;  5C4Z A;  1KAA A;  1TWH B;  2KEE A;  3MFG A;  4IAL A;  2IJ0 A;  1NUC A;  3NTI A;  4HAE A;  1A3U A;  4DFA A;  4TQU S;  4KK7 A;  3MXN A;  1E0B A;  3A54 A;  1I6H B;  4A3G B;  1PTO H;  3D3R A;  1D1K A;  5D3I B;  3GTL B;  5IGC A;  4RHS A;  2EY6 A;  4C1N I;  1ILQ A;  1BCP C;  4FYD A;  1SNO A;  2L4N A;  2ENB A;  1OXV A;  4C3J B;  3F2U A;  3O13 A;  5DEH A;  1EZ8 A;  4X3T A;  2XRQ D;  3PUW A;  1SMY C;  3I91 A;  2EXZ A;  3D8G A;  3A55 A;  1D5X C;  1D5Z C;  2K01 A;  2XIW A;  1JOQ A;  1MSG A;  4XDX A;  4IUP A;  4DK0 A;  2R93 B;  4C2M B;  3FPP A;  1ML0 D;  2PZT A;  2RSN A;  1ESF A;  3DUZ A;  2F0K A;  2RSO A;  5C3X A;  3TME A;  3S15 B;  5EGT A;  5EQ0 A;  3I4M B;  1LT4 D;  1Y1V B;  3KBX A;  5KND A;  4K2L A;  2BE5 D;  1IW7 D;  1BQQ T;  2F03 A;  1IYV A;  2F0Q A;  5FLX E;  4OHJ A;  4J8Q A;  2ID0 A;  2WIN B;  2EYL A;  2PCF B;  3K5O A;  2QIL A;  3K5L A;  4FXG C;  4CBV A;  2EOT A;  1HTL D;  4RHR A;  1GUN A;  4K5X A;  5J22 A;  2CVR A;  3I8Z A;  4OIK A;  5JOB A;  1EQV A;  1EWH A;  2ICE C;  3SK4 A;  4RWS C;  1DXM A;  3VR6 A;  5ELC A;  1EL0 A;  2EYM A;  1F77 A;  1PFN A;  5HUR A;  1O7L A;  2ICI A;  3MEH A;  3M4O B;  4ZYS A;  5ELB A;  5JPM C;  3S1R B;  4KV6 A;  4A3M B;  2L11 A;  1Q90 A;  1EU3 A;  5DM7 3;  2NN6 I;  1ZXT A;  3JAM L;  3ITP A;  2NTS A;  1WTR A;  3R8B A;  4EQO A;  1CZG A;  4KI0 A;  5C4H A;  4I65 A;  2F0E A;  1XWE A;  1B44 D;  2MHV A;  4Y7N B;  1CFM A;  4H0L C;  1SMY D;  4XYO A;  1EOT A;  2PNR C;  2NZ1 D;  4XYQ A;  2VNU D;  1ONL A;  2M00 A;  4M1U B;  4R8N A;  2XN9 C;  2R92 B;  3C2P A;  4HN7 A;  4XQN A;  5FOB B;  2ZT9 C;  3MXG A;  2D62 A;  1Z7T A;  1SYG A;  2K5D A;  2B2V C;  1LT3 D;  5C4J B;  3DWQ A;  4QB4 A;  3U9O A;  3MC0 B;  2MGS A;  1R9T B;  4KMU C;  2J4X A;  1M4V A;  3PIO 3;  2A6H D;  2WAC A;  2OXP A;  2LKV A;  5CMD A;  2I46 A;  4FP5 D;  3FDT A;  2NTT A;  2A5H A;  2G9H D;  4C3H G;  4L63 B;  1WCM B;  3A7A B;  3CRL C;  2H1E A;  2FMM A;  2RQX A;  1JE4 A;  4ZQ3 A;  1OXU A;  4G7H C;  2SDF A;  3SXH A;  3D4R A;  2LMC B;  4U68 A;  4CKC A;  5IGD A;  1CQV A;  4ABN A;  1HA5 A;  3MVV A;  5J1Z A;  1I50 B;  1UNS A;  2EE1 A;  5C0X H;  2GA4 B;  2QF7 A;  4KY7 A;  4CHT B;  1JWM D;  4H13 C;  1RHP A;  3DHQ A;  3KF8 A;  2NWG A;  1DCZ A;  1IKM A;  3DEP A;  1S5E D;  2F0U A;  1E2V A;  2QEJ C;  2F0J A;  3J80 E;  2DY8 A;  4F88 A;  3DM1 A;  2DNC A;  4RA8 A;  1ENC A;  1RDP D;  3N52 A;  3M3Y B;  1M8A A;  3D4D A;  3NBH A;  2BA1 A;  2MP1 A;  3L7Z C;  1Q1B A;  3W3A A;  4PMB A;  4IUU A;  1PRT C;  3H3V C;  1ZYR D;  1ZKO A;  1HTP A;  3G6J B;  4C3I G;  5M9O A;  4DNR B;  1ENA A;  3DWP A;  2VXW A;  3HOW B;  3TP8 A;  5CYU A;  3IL8 A;  1LTA D;  4XT1 B;  4IN3 A;  3SK5 A;  1WD0 A;  3MFY A;  2A69 D;  4IUN A;  1TS5 A;  5COY A;  1Z6H A;  1BNZ A;  1ENF A;  3T16 A;  4NP5 A;  5IGE A;  1D2B A;  2B2U A;  5FO7 B;  2DY7 A;  4ZAI A;  4TSS A;  3D4W A;  2R3Z A;  5T1I A;  1YNN C;  4BBR B;  1UEA B;  3TBI B;  1TR5 A;  1AEX A;  3MZ5 A;  2J0T D;  2B63 B;  3SR1 A;  4I7Z C;  3I70 A;  3GP7 A;  4IZ8 A;  2PW7 A;  3SK6 A;  1TT2 A;  3P1H A;  4RGM A;  4BWG B;  1PZJ D;  4X3K A;  1X3Q A;  4IUV A;  2IX1 A;  2OF1 A;  2A68 D;  4A3F B;  3C1F A;  1O7Z A;  2O5J C;  2CW0 D;  4EVO A;  1A6X A;  3NWS A;  4JBW A;  1HQM C;  3NWT A;  5CV7 A;  4ZUI A;  3A8I E;  1DOL A;  1EY5 A;  1FR3 A;  1R4P B;  5IOD A;  2MJ8 A;  2E2H B;  2EDG A;  1HFG A;  5JEA H;  1I4X A;  3HOZ B;  4ID6 A;  1SYE A;  3LNN A;  2RKS A;  3K0Y A;  3FEW X;  5I2Y A;  2B2Y C;  2BOS A;  3LWU A;  1BO0 A;  5EPL A;  2QKI C;  4OGQ C;  2K28 A;  3BYY B;  1HA6 A;  4IFD I;  3GTK B;  3BS1 A;  1G2T A;  3A56 A;  3S14 B;  3GV3 A;  4ZKB B;  4K2K A;  3NK9 A;  4K6L A;  2NBF A;  1EEF D;  5ELE A;  1RTO A;  1G6Z A;  1TVX A;  2XSC A;  4WRD A;  4KKS A;  3S2H B;  2I07 B;  1EWC A;  1VMC A;  1H9R A;  5E4X A;  1B4O A;  3CQZ B;  1ROD A;  5F2D A;  4ZUJ A;  3RD4 A;  1Y8P B;  1FNU A;  5EPK A;  3C3L A;  2A6E C;  3K5M A;  1H9S A;  2F0S A;  1CQF A;  4RCO A;  4H7B A;  1AP0 A;  1T5X D;  4CKE A;  5FK9 C;  2L12 A;  3S1N B;  4O1N A;  2Y0S B;  4QMG A;  5IGB A;  5D65 A;  3PO3 B;  1NSN S;  4A3K B;  4P2C B;  4HTH A;  4WJW A;  1TS2 A;  3DMU A;  1E2Z A;  1PRT D;  2HDM A;  1UUP A;  3I90 A;  1U4M A;  1TKW B;  1F2Y A;  1CA5 A;  5A35 A;  1YNJ C;  4KHZ A;  3J81 L;  5COR A;  1MBY A;  2C9O A;  2TMP A;  1CA6 A;  2X6L A;  5CV5 A;  1SSO A;  2L1B A;  4ZKC B;  2G9D A;  4K6D A;  1A15 A;  1HHV A;  3OWF A;  1CI3 M;  1XYI A;  3OHX C;  1F2L A;  1DD2 A;  2JSO A;  2WKC A;  3IFD A;  1LT5 D;  1DOK A;  1TWG B;  4M8A A;  2KHS A;  4C56 C;  1KDA A;  2BCO A;  3PUV A;  1GUT A;  5I6Y A;  5KYI A;  2B8G A;  5C6A A;  1G29 1;  5M3M B;  2IPK D;  2E2D C;  2RA4 A;  3TSS A;  2B2U C;  3A8J E;  1W6K A;  2XWJ B;  4ULL A;  2Z1C A;  2KQ3 A;  1F9S A;  3OSO A;  1D5M C;  1EY8 A;  1STN A;  4KHV A;  5DAU A;  1STY A;  1NR4 A;  1U4R A;  4QUC A;  2JP1 A;  4CJ2 C;  3E5S A;  5JEA G;  4MIU A;  3FPU B;  5CGK A;  5EPJ A;  3HGB A;  4R8I A;  1B53 A;  4A3I B;  3PV0 A;  4NMZ A;  2IL8 A;  5C0X I;  4KN4 C;  4DGZ A;  5CC4 A;  2A6E D;  1V43 A;  2CW0 C;  1GUW A;  3S1M B;  1JQY D;  1G2S A;  5KYL A;  3WOE A;  4LMQ D;  2JYO A;  3TP6 A;  2X6G A;  1WD1 A;  3I72 A;  3QOJ A;  4DNT B;  2CQA A;  1STG A;  2B2V A;  3I73 A;  3VA7 A;  4DK1 A;  2PZU A;  5D14 A;  3SEB A;  5K36 H;  3NTH A;  3HOX B;  4KJN A;  1JC7 A;  5IIF A;  4A93 B;  1RKN A;  3QJY A;  5EKK A;  1B50 A;  1BF4 A;  3RMH A;  1HXY D;  3Q0A A;  1V1P A;  1BR9 A;  5TSS A;  4A3J B;  4QIW B;  3MHB A;  3OOC A;  3CRK C;  3CU7 A;  3DWA A;  1SAP A;  3BZD B;  3AB9 A;  2RBM A;  4RH6 A;  1ET9 A;  1BCP B;  2J7Z A;  3GV6 A;  4FF3 A;  2M9V A;  4DAV A;  1G8Z D;  5T1G A;  1OO9 B;  4ME5 A;  3S1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...