2EY6A

Crystal structure of staphylococcal nuclease mutant t41v
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDVPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey6A00
1SNPA 1SNMA 2F0WA 2EY1A 4OL7A 3TP8A 4B9WA 2SOBA 2EYLA 3D4WA 2LKVA 1JOOA 1STNA 2F0EA 3OSOA 3E5SA 4K6DA 4S3SA 3SXHA 1SYEA 3EROA 3OWFA 4E6IA 4ZQ3A 3OMGA 1KABA 4ME5A 2PYKA 5IGFA 3S9WA 1A2UA 1EY7A 4PMCA 5IGCA 1TQOA 2OF1A 1A2TA 3BDLA 2EY5A 3C1FA 1ENAA 5CV9A 1A3VA 5C5MA 5EKLA 1EZ8A 1A3TA 4KV6A 2F0OA 5CV6A 5CV5A 2F0DA 5HGTA 1TT2A 3DMUA 2F0SA 4PMBA 1AEXA 2F0PA 5E3FA 1SYFA 2EYJA 2SNSA 1SYCA 3NHHA 5JAVA 3QOJA 5IGEA 2PZUA 1JORA 5IGDA 3MZ5A 3NK9A 4K14A 2F3WA 3OMCA 4TRDA 5IODA 1SNOA 1F2YA 4ZUIA 4KD3A 4N9TA 3SHLA 5C4ZA 2F0UA 2F0VA 3MVVA 4RKBA 1RKNA 4HTHA 1II3A 4EVOA 5IGBA 2O4XA 5CV4A 1EY4A 1STGA 5ISRA 3QB3A 4I65A 1EY6A 2M00A 5HURA 5I9OA 3SR1A 1IHZA 4IZ8A 4K2LA 3TP6A 3VA5A 4EQOA 3D4DA 1EY5A 4ODGA 3TP5A 2EYFA 3R3OA 5NUCA 4F8MA 1F2ZA 5J1ZA 2PW5A 2PW7A 1EYAA 4K5VA 4K5WA 4NDXA 5I6YA 1TR5A 4F7XA 1SNQA 1EY0A 1EQVA 5J39A 4N9PA 3T13A 2F0HA 4HMIA 5KGUA 2RKSA 3NP8A 4KD4A 1SNDA 2KHSA 5C3XA 3ERQA 3NXWA 5E1FA 3HEJA 2NUCA 2EYHA 4KY7A 4KJOA 4R8NA 4DU9A 5M9OA 1NSNS 5IGGA 2HQEA 4WORA 3T16A 4DF7A 5KYIA 2ENBA 1KDBA 5K5PA 3C1EA 3ITPA 2EXZA 3BDCA 1JOQA 1EYDA 3D8GA 5DAUA 5EKKA 1KAAA 1U9RA 3MXPA 3SK6A 1SYDA 4KY6A 4QF4A 1SYBA 4B9XA 1STYA 3PMFA 4IALA 1EYCA 2F3VA 2EY2A 4RKLA 3SK5A 1F2MA 4EQNA 4G57A 2WACA 4J6HA 4K8JA 4KY5A 1A3UA 4NKLA 2EYOA 2F0FA 3MHBA 4QB4A 5CR3A 3H6MA 5KIXA 1KDAA 2OXPA 4H7BA 5C6AA 2F0MA 2KQ3A 3P75A 1SYGA 4HMJA 4KJNA 4PNYA 3EVQA 4NP5A 3V2TA 2RDFA 3U9OA 4DGZA 5CGKA 5IOCA 1STHA 3RUZA 5CC4A 2F0GA 1KDCA 5KYLA 2F0KA 2PZWA 1NUCA 5CV8A 5KEEA 1EY8A 2F0QA 1STBA 4K5XA 4WRDA 4DFAA 5KRUA 3SK4A 5EGTA 4KHVA 5I6WA 2EY6A 2F0TA 2OEOA 2F0NA 4KTAA 5F2DA 4K8IA 5IIFA 5J22A 2EYMA 2F0IA 1ENCA 2F0JA 4YIJA 4EQPA 2PZTA 3D6CA 4K2KA 3SK8A 3QOLA 4IUNA 4ZUJA 3P1HA 3TP7A 2EYPA 1STAA 3LX0A 5DEHA 3DHQA 3TMEA 4LAAA 2PQEA 4NMZA 5C3WA 2QDBA 4ID6A 1EY9A 2SNMA 3MEHA 5C5LA 2RBMA 4QMGA 5JOBA 4J1MA 5I9PA 3NUCA 1SNCA 2F0LA 1EZ6A 3HZXA 3EJIA 3NQTA 1JOKA 5C4HA 4MIUA 5CV7A
chains in the Genus database with same CATH superfamily
4A3JH 2EYLA 4CDDC 2K5WA 1E1OA 3D31A 1QZHA 1JJCB 3H0GH 1CKNB 4DXGA 4H44C 5D3IB 2L15A 1HZBA 1XPRA 2K1BA 1FNVA 4LF9Q 2XNAC 1QVGA 2E2IH 5M5WB 3KF8A 3BU2A 2XSCA 2WP8J 3HOZB 5IGDA 1IBLL 3M3YB 4DR5L 5FLXL 4LF8Q 4BBRG 1YI2A 1F2YA 3HOXG 1JB3A 1KHIA 4IN3A 3C46A 2LY7A 1VQGA 3NBHA 2HDMA 5EBDA 4JI3Q 2F4VQ 1RODA 1TXYA 2CW0C 2K03A 1V9PA 3FKIH 1FGUA 2ID0A 4DUZL 4CKBA 3U58A 1RF2D 1EFID 3DM1A 5JJZA 3M85A 3OOCA 4ZLTF 1G2TA 4NDXA 1I6HH 5COYA 3I55A 5C0XJ 1E0BA 3PUYA 1HQRD 1NAPA 4UAIA 4PZ6A 4YY3Q 2JA6B 3G6JB 4FXGC 3H3VC 5M3FG 3HOWH 2AMCB 1V8QA 4L6TB 2ALYB 1PRTC 4WORA 1HZCA 3I56A 5K5PA 3CW2C 3KFUA 1SFOB 2BDOA 2ZXRA 3U9SA 4JYAQ 3J81j 2Z0SA 2CWAA 1K73C 4RKLA 5IYCG 1HRJA 3WOEA 1FVIA 3PUVA 5LMUL 2JEBI 4A3IH 4A3LG 1G6ZA 2B63G 1CA5A 1B3AA 1Q46A 4OONA 2NVQH 3DUZA 3D3RA 4L5TA 2H4OA 1PYBA 3E0JA 3M7GA 4XQNA 2D9UA 2KEDA 1Z9FA 2JA5H 1VQLA 1GUWA 3ONAB 2UXDQ 4GLAC 1UUPA 5D3DA 4QGUA 1SJED 3I4NB 2MO0A 4V190 4Z9CB 3KF8B 4PG3A 4A3GG 5M5YH 3CMAA 1X9NA 2JP1A 4CGYB 2YTXA 3E5SA 4A3DG 2NVYB 3OMGA 4YY3L 2B2UA 2RCNA 2IT1A 1A2UA 1K8OA 1MIUA 1A2TA 4QIWB 1LT6D 1VQJA 3NBHB 1VMPA 2K75A 2PI2E 5CV5A 2F0DA 1N34L 2NBFA 4PMBA 4HJ5A 2PZUA 3MFGA 5A2QE 3MZ5A 4CKCA 1YITA 2I0QA 3HOYB 2X6GA 4LUZA 1S40A 3MXNA 1AFPA 4BBRB 3VDYA 5C4ZA 1VQAA 3HOXB 2B2UC 4OIJA 4KKSA 1LTRD 4DV0L 3NE5B 2Y0SG 4C3IH 3GTOB 5HURA 4PMWA 3T1HQ 2NVXH 4WJ3M 4OO1I 1BXTA 1B1ZA 5NUCA 5FK9C 1TWFH 3PF5A 4KHZA 1BCPC 3GTJH 2XRSD 2ZTDA 3LWUA 2K5NA 2UXDL 4KD4A 4IUVA 3R2TA 5M3FB 3ND8A 2PMZB 1K3RA 4KJOA 2A68C 1E2ZA 3W2DA 3KK7A 1BNZA 1FGBD 2AQ3B 1U9RA 1EL0A 1DONA 1TWGB 3OW7A 1HUNA 4DV1L 1TWAB 2KEEA 2RDGA 4A3BG 4XTCS 3MHBA 2FJ2A 5C6AA 2F0MA 1L1OA 2KQ3A 4AYBE 4XT3B 2B63B 1SYGA 3V96A 3S15H 4LFBQ 3EVQA 5LL6X 1C4QA 2MP1A 3G6EA 3S1MB 1S72A 4RGMA 1HNWQ 5KYLA 1ZEQX 2PNRC 3KBGA 1TY2A 4G4KA 1ASYA 4UDUC 1X3FA 1RD9D 4YIJA 5DM73 2F1MA 4K2KA 4AQYQ 3KJPA 4GKJQ 3MAQA 1IXRA 5AJ3L 3J81i 1L1OC 3DEOA 3G71A 1L0XB 4YWKA 2V4DA 4A3EG 4G7HC 3BYTB 1G51A 4XXEA 3PO3G 5FJ8G 1HTLD 2BOSA 2VUMH 1SJHD 2SOBA 4A3GB 2DJGC 3SXHA 1TWHH 2KHJA 2MJ8A 5D14A 4A3DB 3MXNB 3CF5A 1ILPA 1F9PA 4L8JA 5KNDA 1T9HA 3BVMA 1EZ8A 4KV6A 1HHVA 1WD0A 4WJ4A 4C56C 2WV6D 5E3FA 1U4MA 2EYJA 3S1NH 1SYCA 1XMQQ 1XWEA 2H5XA 4KKTA 3KLSA 2UU9Q 3K7AB 1TWCH 2AHOB 3GV3A 4KD3A 3K59A 3UE1A 1ESRA 2K33A 3MVVA 3VA7A 1V1OA 3K0YA 1VQ8A 4RWSC 4LFBL 4DV2L 4OXPA 5A2QL 2K04A 3GQBA 1STGA 3CHBD 4GLVB 2R3ZA 3QB3A 2XRQD 1WTVA 1ICWA 2QCPX 2VZAA 4B3SL 1X54A 3D4DA 4B3ML 2BE5C 1VCIA 5IYDH 1SE3A 2ATWA 3NQIA 1F2ZA 1VQKA 3CKIB 2Z4HA 4LMQD 4X6AH 1L0YB 3K5LA 1F9QA 5IT9E 4MZ9A 4WJWA 1L1OB 4P72A 3HEJA 4JW0A 4O0AA 4KY7A 1N36Q 3KYHC 4X3TA 2XWJB 3C1EA 3DWQA 1DJRD 1YZ6A 4BS9A 5LL6S 4DR7L 1JR0D 4B9XA 3EN2A 1JICA 1SRUA 4BXXH 2IX1A 2WACA 4A3BB 2MPMA 3F2BA 3K6OA 2DY8A 5GAEC 1K8AC 1I4GA 3HOVB 3V2TA 3ER0A 4QY7A 3IFDA 3PCOB 1H9RA 4DXFA 2F0KA 4LJZC 1AW7A 4RHRA 3NTHA 4LUOA 4PZ8A 5C3EH 1NR4A 4GN5A 2VW9A 5IIFA 1A62A 1B8AA 2CQAA 5DEHA 2AUKA 4A3FH 3PUXA 2QDBA 3S2DB 1SSOA 4JI0L 3CAMA 4C1NK 3E6ZX 4MNOA 4A3EB 5FLMG 1LT4D 3OHXC 2UUAQ 3PO3B 3CMEA 3D4WA 5GROA 4K6DA 1Y1WH 3EROA 2ZM6L 2R93G 1ZYRD 4ZQ3A 1P8LA 2PYKA 5IGFA 1HUMA 5IGCA 1TQOA 4XQJA 5K36G 3D0FA 1FJGQ 2WAQB 4X66L 4R8IA 2C35B 3TSSA 1DM0B 4DR4L 1OXTA 1N8RC 2B8FA 3BZCA 5C0XH 1R9TH 2WB1G 3BJUA 2NN6H 2DJFC 1ASZA 2DUDA 5D65A 1RKNA 4C2MB 3GTPH 2UXBQ 2O4XA 4GLXA 2BH8A 1BKBA 4HAEA 4I65A 3Q24A 1HR0W 2B2WA 4IZ8A 4EQ5A 3CCQA 4OWXB 1X32A 3H3VI 1PH6A 1K0SA 5IYBG 2PCFB 2JSOA 5G3LD 4A93G 1SNQA 4B3RQ 1EEID 2LFNA 5EKIA 1QVCA 1EWIA 4HCEA 2HHHQ 1SAPA 2FMCA 1D5MC 1QWYA 5EAYA 2ASBA 3ITPA 2I46A 1RIPA 4OX9L 1Y69U 3DEPA 1VQHA 3PMFA 4HSVA 2QF7A 1PTOB 3FP9A 4IALA 1VQDA 2HQLA 2BA1A 4NXNQ 4DR6Q 2ZTCA 5KIXA 2EJFC 4IURA 4JI1Q 3F2UA 4B3TQ 4NP5A 1C48A 3U9OA 5IOCA 1GUSA 4C3HG 3I90A 4YCVA 1EY8A 2F0QA 2Q2TA 4G7OC 3UDIA 3E3XA 4UP7A 3L0OA 5I6WA 1WOCA 4APVA 3CC2A 2H1EA 4LF6Q 1LTLA 1C7YA 4IUNA 3RZDH 2PQAA 5JJLA 3OYYA 4A3CH 1AZQA 5C3WA 4DR2L 4QUCA 2ZTEA 3W3AA 2F0LA 1XXGA 2HIVA 2B2TC 1NTGA 2D62A 5EQ0A 3IRBA 3CQZB 3GTLB 2F0EA 1Q90A 5CBEE 3TS2A 4E6IA 1RTNA 3S2HH 2R93B 4Y7NH 4QL5A 3URYA 3CCUA 1D6EC 1A3TA 3RZOH 2UUCQ 3H0GG 5HGTA 1VQNA 1PFNA 2JA7H 1TS4A 2RVLA 4DAPA 2UXCL 3M4OH 3J81E 1O7IA 2WB1B 5ELDA 3KDFA 3A7AB 1GHKA 1B7YB 4JC0A 4AIMA 4B08A 1MJCA 1KD1C 4FF1A 3MC0B 3ERSX 1II3A 4B3TL 4HIKA 3TS0A 1Q3LA 2ZT9C 1LTGD 5L37A 4L5QA 2V1CC 1EY6A 4BA2I 1NNXA 1Q8IA 4U673 4JI6L 1YJWA 2DY7A 2P5ZX 2K28A 2OWOA 1KLUD 1CKOA 5ELNA 3NWTA 3FKIG 4A93B 2VQFL 5J39A 2E2JH 3I4OA 4HIMA 1LTSD 1DZ1A 2A73B 2IX3A 3HP3A 3K5OA 2K52A 3EBEA 1B4OA 5C4XH 2EXZA 3BDCA 3KLSX 3HOWG 2YTVA 3JAMc 1RL2A 3T4AC 4HJ8A 4OWTB 4I7ZC 2A6HD 4LFCQ 5IE8A 4MN3A 1TVXA 4FO2A 1J5EL 2K50A 2KCTA 4HN7A 3I2ZA 1CQFA 1B44D 4MHEA 1K8GA 5BN4A 3J80c 2PQAB 4KN4C 4TVAB 4OO1H 3D6WA 1OXUA 1VQFA 5CGKA 4XQQA 1E3PA 4IPCA 2UUCL 3SEBA 5CBAE 2GN5A 4C3HB 2A74C 2KJXA 2TMPA 1Q81C 4X3UA 1E7ZA 2XIWA 3RLFA 3Q22A 5JEAG 1IBLQ 1GJXA 4DR5Q 3EQLC 1NY4A 4NMZA 5IP9H 3OPOA 2RHSB 1Y1VH 1KQSA 1VF7A 3RN5A 5CMDA 1JOKA 5C4HA 5CV9A 2R7ZH 1W3SA 3PIPA 3S14B 4DUZQ 4IOAA 1SR3A 5C44H 5LMNW 1B9MA 1HR0Q 3PGZA 1QOHA 3HG9A 3VYRA 4X3SA 3C1FA 3H09A 3NEMA 1KIXA 1Y14B 3H0GB 2F0PA 2SNSA 3QOJA 4RA8A 2QEXA 4N8X1 2A5HA 3EIVA 1WTWA 2WAQE 1QILA 1HNXL 1I94L 4N9TA 2E2IB 4TQUS 5IP7H 2F0VA 3G48A 5FLXc 5LMUQ 1PTOD 2L1BA 3S1RB 1IHZA 4PV1C 1VQ7A 1EY5A 3KBXA 1CA6A 2E76C 4GN4B 5T1GA 4C3IG 1Y8PB 2VS1A 3FKIB 1A8VA 3K7UC 1XX8A 5E1FA 3MA2B 4QUFA 5M3MH 3PIP3 2EZVA 2EQSA 4DU9A 2HDLA 1K9MC 3WOFA 5IGGA 3I4MG 1NJIC 1WCMB 1QCBD 1JOQA 2ES2A 3S16H 5EKKA 2KUMA 4CHTB 4GZYC 5GAHC 2F3VA 2N88A 4EQNA 2NVTB 3L2PA 2N3SA 5CORA 4A3KH 1DCZA 3U4ZA 1HR0L 3L9AX 2NB0A 1BBXC 4C1NI 2HT1A 3PUWA 1KXLA 4PNYA 2LXJA 2RDFA 1I4XA 3PQIA 2E2HH 2L11A 4FXDA 1KDCA 4HJ9A 3GTQB 1CM9A 4K5XA 1Q82C 1VMCA 3WWVA 1D1KA 3W5OA 3HS0C 3UDGA 4IUUA 1X3EA 4GKKL 2OEOA 1N34Q 1B53A 3HOUH 4ILWA 3M3YH 4H13C 1LO5D 1G8ZD 4ID6A 2CFMA 1SXTA 1IW7D 4ZK9B 1IBML 2A6ED 3KF6A 1Y8NB 1SNMA 2IPKD 1OXXK 1ZYRC 2F0WA 4DV7L 4KKUA 3AYHB 4IFDI 1DGSA 4DV0Q 1TY0A 2F03A 4S3SA 1LV9A 2YV5A 1TS3A 3R93A 1M90C 4M1UB 4CDEC 2VUMG 5M5YB 1KAWA 3CC4A 4IUQA 2Q2IA 5H1SE 3J7ZC 3DMUA 3SDZA 1NMFA 1BR9A 1CSQA 2G9HD 5GADC 3DWAA 2NYZD 1SLJA 4XYOA 3ULJA 1DYQA 4L5RC 2BCOA 3M4YA 4DV1Q 1KC8C 4HCSA 4TSSA 3NBIA 3AMUA 1WTQA 1EY4A 1HFNA 4DK1A 1CZWA 2WB1E 1H9SA 1UEBA 3ZYYX 1LTAD 1JE4A 4JG2A 1IBKL 2K01A 1WVLA 2XVSA 2OTJA 4RMFA 3TEHB 1NR2A 1JWMD 4DAMA 4BY7H 2QA4A 2UUBL 1EIYB 1EY0A 1J9OA 4C3IB 3GTKH 2NVXB 5IYDG 2RSOA 3NXWA 4RCOA 2NWGA 2Z8LA 4K0KL 1NCVA 3GTJB 4IFDJ 3FPUB 2N49A 2Z6KA 3I4MB 2J4XA 3I4NH 5AJ3Q 1ESFA 5DAUA 2PO4A 3IKJA 2FMMA 3AEVA 1E2VA 3NTIA 2NTSA 1LT5D 1IKLA 3A56A 4MTNA 3ULLA 2YTYA 5JJKA 1VQPA 4X65L 1GD7A 3PUZA 2VXWA 1D1IA 3P75A 1QUQA 4C3JH 2DNEA 4BXXG 3H3VH 3LNNA 4RCNA 2AQ1B 1X56A 1LACA 1X3PA 4X3KA 3S17H 2Z6KC 1R4PB 1MGSA 1UE7A 3KF6B 1N33L 1Z47A 4P75A 1Y8OB 4DAYA 3JAMi 1UEAB 4PQXA 2XWBB 1F77A 3D6CA 2C5CA 3HOYH 1QG7A 1EEFD 5C3EG 1LLRD 2CH4A 4A3MH 4QQBX 1EWCA 3Q8DA 4LAAA 1CZGA 3J80i 3RD4A 4RGNA 1DOMA 2JXMB 5C5LA 1XTDA 2OQ0A 5HY6A 3NELA 5LHY1 3UDFA 5CV7A 4A3FG 4DV2Q 1KLGD 1J6QA 3TP8A 3FMCA 2R6GA 3DLLA 3MTSA 5EBCA 1PYWD 1PMRA 4B3SQ 3OWFA 1Q86C 4B3MQ 2ZJQA 4KK7A 2CHBD 3T56B 2G9DA 1SBBB 1CQVA 4IO9A 2VUMB 1A3VA 4LF5L 2K5QA 1XNQQ 1TWHB 2F0OA 3K5NA 3VYUA 1HA6A 1CHPD 1SMYD 5M5XB 2F3IA 4DKAC 1XYIA 1H9SB 1MI2A 4HSPA 2B2YA 1VQ4A 2CWPA 1S4ZA 1Z6HA 1BF4A 1GO3E 3TQYA 1ZKOA 3LGJA 3MWYW 1G6PA 4DR7Q 1LYLA 3PV0A 1XPOA 1TWAH 2K5DA 5IYCH 4ZYSA 3DM3A 4BY1G 5C0XG 1Q12A 1XNRL 2R92G 3T1YL 3A5UA 3I7FA 2JQOA 2FXQA 4ME3A 5G3LF 2B63H 1Q1BA 1HNZL 3TP6A 4JI8L 5LMNL 5KNBA 3GO5A 3VYTA 4FNFA 1FD7D 4BBSH 2MO1A 4K5VA 1EIGA 3SE0A 1ILQA 4O2DA 4FP5D 3OWEB 5EJWA 1SE2A 2DNCA 4R4OA 1WTPA 3R2IA 2C9OA 1QUQB 3A8IE 4DK0A 4R8NA 4IUTA 4KHPL 2A6HC 2ENBA 1KDBA 3CCJA 4A75A 4RGOS 2WFWA 3WDNA 4JI0Q 3PO2H 2Y0SB 4DAYB 4H02A 3K58A 4LW1A 5KNCA 1I50B 1AE3A 4A3DH 2VNUD 2K32A 2ZM6Q 3OTOQ 1UE5A 1XNQL 2AQ2B 2NZ1D 3TREA 5KEEA 4EX5A 1LTTD 4LWCA 2HUGA 4X66Q 1FNUA 2A8VA 2EY6A 1AP0A 2NTTA 2F0NA 4DR3Q 3HGBA 4EQPA 4DR4Q 1FL0A 3K7AH 1RTOA 1YHQA 4H0LC 1C0AA 1PH8A 2KCCA 5C3EB 1VQ6A 1HPCA 5AFWA 1JE5A 2ZJPA 5I4DA 4IPGA 3HKZG 4MTKA 1SNCA 1EZ6A 2R61A 2F4IA 2QEJC 4NXML 4A3FB 4A3CG 4DV4L 1AH9A 4FF3A 1EQQA 3JC66 4PMCA 2VL6A 2EDGA 3UDXA 1IL8A 1YHBA 2MGSA 4OELB 2CW0D 2X6LA 4OWWB 3SGIA 1AEXA 3FEWX 2GVAA 2NZOA 2A1AA 4JPBW 2EOTA 2F3WA 1TS2A 4XT1B 4OX9Q 2RF4A 3CP0A 2JA7G 1Z7TA 1PTOC 3KUPA 1B70B 2LSSA 2VQEL 4BY1B 3QIAA 4A4IA 4QCLA 3OTOL 1E1TA 1S5DD 1R9TB 2R92B 4L63B 1PHJA 2CCZA 3HOVH 2Q8TA 5I9OA 1UNSA 1WTHA 2RDHA 3GTPB 2D0OA 5J1ZA 1BQQT 4GOPA 1VS0A 3GTGB 4DR3L 4F7XA 1S5BD 3S24A 1QJOA 2NZHA 4N9PA 3I3CA 4HMIA 4QIWE 1VF5C 1WFQA 1NSNS 2L55A 1PLFA 3AU7A 1NE3A 5JVG3 1WTXA 2QILA 4JVZA 5JPMC 3S2DH 1QZGA 1EYDA 5HGQA 2J0TD 3MXPA 3CC7A 4DR2Q 2QKIC 2A19A 4RAUC 3AQQA 1F2MA 3GTMH 2CH4W 5C4XG 1VQBA 1RHPA 4WFN3 4DV6L 1WJJA 1JMCA 2EYOA 5C4JB 4JI7Q 3H6MA 1K83H 3GP7A 1XMOL 4P74A 1BVSA 4L5SA 3KJOA 3FDTA 4BWGB 2N55A 1EUJA 3CCMA 2AWNA 4DFAA 3CU7A 5E4WC 1CI3M 2B2WC 2UXCQ 5IT9L 1L0WA 2A6EC 2PMZE 2PQEA 1N32L 1E2WA 3LWEA 4GS3A 2RCFA 3HKZB 3TZDA 3RLNA 5FO7B 4X64L 3RZDB 1SNPA 2N8NA 3J7A5 5IP9G 1Y1VG 1GUOA 1DOKA 1D8LA 1STNA 4JI6Q 2KCMA 4DV5L 3GD7A 1LTID 2RA4A 5TSSA 4JBKA 2B39A 1MHWC 3JAME 2JE6I 2VQFQ 3BG3A 3E0EA 5C44G 1X55A 1MKHA 1PH4A 3KOJA 2F0SA 1A63A 2KCNA 1WYDA 4P73A 3NHHA 5JAVA 3W1GA 2M2LA 1YEZA 2N78A 3NK9A 3J80E 1M8AA 4GOPB 4IJLA 2WKCA 3ICEA 4HJ7A 1I4HA 1PTOF 3K57A 2Q8IB 3NTKA 5IY0A 4JI7L 3SHLA 2JA7B 2F0UA 2OTLA 1S5FD 4IFDH 1I4RA 4J8QA 1J5EQ 1PZKD 3M4OB 1U5KA 5CV4A 2D2CC 3J7YW 1D7QA 4HR7B 2EXDA 4A3JG 2JA8H 1XTCD 4YWLA 3U50C 4ODGA 2VB3X 1SDFA 3A74A 5E4XA 1A15A 2E2DC 3NP8A 3TBIB 4UY8C 3STBD 5BR8L 5ELFA 1LT3D 2RQXA 2EYHA 3F2CA 4G7ZC 1I3QH 3C3LA 2E2JB 5E7NA 3RMHA 3PIOA 1PVOA 4DV3L 1QNKA 1FR3A 1TKWB 3GTLH 1C9OA 2TSSA 1DD2A 4FF2A 2EJGC 1KDAA 1IYJB 4JCVE 1R4QB 2K05A 5CC4A 4A3KG 1BO0A 2IHFA 2Y0SE 4WRDA 4LK1C 4OEMB 3TZUA 2MHVA 2M9VA 5ELOA 1AE2A 1BOSA 4KHVA 2YU9H 1IL2A 1GHJA 2D0PA 1SE8A 1ENCA 5JJIA 1PH7A 3SK8A 3FVQA 1A0IA 1STAA 3VR6A 2LMCB 2JJQA 1M4VA 3F2DA 1HNXQ 1I94Q 3HOUG 4Y52H 3IFTA 2R7DA 4OIKA 1PH9A 2EY1A 1X3QA 3R8BA 4FXKC 3EFXD 1RDPD 2A69D 4A3IG 4LF7Q 1Y1VB 1LTBD 1NBWA 4DR1L 4CDCC 3BDOA 1WTRA 1SMYC 2EIFA 3BDLA 1ENAA 1LUZA 3I73A 3S1QH 2JN4A 4OGQC 5EPJA 4LFAL 2RSNA 1KNEA 2JA5G 3M4QA 2IWHA 3JAML 3M7NA 3K81C 2K7VA 4JBJA 4CBVA 2BDNA 2FINB 3NPPA 1LABA 1GXDC 5FOBB 4DA2A 2O5IC 1TIID 1K8MA 3CD6A 4A3JB 3TP5A 5ELCA 1SE4A 1EYAA 4HJAA 1YVCA 3F8TA 2ICIA 1KTKA 2WKDA 1W6KA 3FHWA 3Q23A 3UE0A 2KHSA 5C3XA 3J7AF 4GKKQ 2SDFA 4BY7G 1P16A 4JK1C 2KVMA 4RHSA 1SROA 2QGQA 3J81L 1IBMQ 3KLRA 5C0XI 4LF7L 1PDQA 3I4NG 1B3QA 4DV7Q 3HRZC 1A3UA 3S16B 2MNAA 1J8IA 3D4RA 3A7LA 1Q7YC 4POFA 1CHQD 5FO9B 1V1PA 4IPDA 1O80A 4JOIA 4R4QA 3M4PA 1PXUA 4A3KB 4JV5L 1V43A 3QWNA 4IPHA 1LM0A 1RJTA 4C3JG 1I6HB 2E2HB 3AFPA 5J22A 5JVH3 2ZXOA 3HOWB 3QOLA 1QE6A 1ZXTA 1EY9A 2E5LL 2SNMA 3K80C 4QMGA 1F2LA 2ZXPA 3HOUB 3HOYG 4ABNA 4NPSA 3L7ZC 4JOIC 2KHIA 2D5DA 4A3MG 1GM5A 3S1RH 3OSOA 2LKVA 1JOOA 1EQTA 4FF4A 1K0RA 1O78A 4A3IB 3CCLA 4ME5A 3HKZE 1GUTA 5M5WH 3S9WA 1EOTA 1IBKQ 3BVZA 3HOZH 2NVQB 4O42A 5GAGC 1ONLA 2UUBQ 3CPFA 4K0KQ 3EA6A 1WCMH 4FVMA 2JA5B 1FYCA 4K14A 1QNUA 4TRDA 1VQ5A 4LF4Q 1KRTA 4LNQA 2NVTH 1JWSD 4ZUIA 1O7YA 4RKBA 4IUPA 4HTHA 3ND9A 1I4PA 4HIDA 1HA5A 4X65Q 1WD1A 1PYSB 2JA6H 3SR1A 2HCCA 3H91A 4EQOA 1YNND 3GTQH 3ULPA 3I4LA 4DNRB 4K5WA 2O2LD 1HCZA 1XPUA 3IAYA 1WI5A 1O7LA 1N33Q 2F0HA 5KGUA 3CCRA 1SFOH 4LF9L 5JEAH 1NMGA 4BBSG 1O7ZA 2HQEA 2OQKA 4ZKCB 4BY7B 4GN3B 1V1PB 4X62Q 2KA7A 1KAAA 3GTKB 4LF8L 4KY6A 4JI5Q 1SYBA 1VDZA 1EOVA 2JA9A 3HFZB 1GUGA 4HEDA 4JI3L 2F4VL 4N8FA 1F9RA 1KL9A 4UHVA 4JI4Q 4H7BA 2F52A 3PO2G 4I7AA 2BH2A 4DGZA 3GV6A 2F0GA 5KRUA 5BN5A 3I8ZA 1JJ2A 4LF5Q 1TWFB 3SK4A 5I2XA 4C3JB 2K6AA 1U4LA 3GDEA 3MFYA 4O1NA 3AFQA 1PRTB 4LF4L 3S17B 2FHTA 3H94A 4ZUJA 1I6VC 5IWAQ 1YNJD 2JK8A 3H15A 1XJVA 3X3MA 4JYAL 3MEHA 2G5DA 1HZ9A 3MXGA 2RBMA 1IKMA 1GVPA 2NVYH 3HZXA 3B6YA 3NQTA 4J15A 4MIUA 1XNRQ 3T1YQ 1QVFA 2E75C 2GVBA 4KN7C 3N52A 4OL7A 4A3MB 1HTPA 2GA4B 2CQOA 1HNZQ 1B9NA 4JI8Q 5LMNQ 3IL8A 3VR5A 4IQZA 2L4NA 1DXMA 3S15B 3N6RA 1MSGA 2OF1A 4Q0FA 2EE1A 2IJ0A 5EKLA 4DNTB 2K5HA 1U4PA 3CRLC 1ENFA 4V0BA 4X62L 4BBRH 3HOXH 3I4MH 4JI5L 1DOLA 4KHPQ 4R4TA 2YYZA 1M1KC 2JYOA 3VYSA 1PRTF 4PZ7A 1CFMA 4DK6C 2KECA 1SNOA 2JEAI 3GTOH 4JI4L 3J7AV 3BYYB 4EVOA 3FPPA 5A35A 1MD2D 5FKAC 1JJGA 1CK1A 1BBUA 4K6LA 5FO8B 1U4RA 1Y1WG 5M3FH 2EYFA 2PW5A 1H9KA 3STBC 2I5HA 4YHHQ 3HOVG 4EGVA 1D5ZC 1EQVA 3E9HA 1HFGA 3T13A 5IWAL 2K4KA 2Q8RE 3ERQA 3VR3A 1TWGH 3CPWA 2NUCA 1OTCA 4BBSB 2KBNA 3S1NB 2OT2A 3D8GA 3TDQA 2NN6G 4A3LH 1TWCB 2SEBD 4KLKA 3S1MH 3SK5A 4HIOA 2I5LX 4NXMQ 1IYVA 4DV4Q 4QB4A 1HZAA 2B2YC 2HCIA 1MSHA 3T1HL 4ULLA 3PO2B 1JCKB 4RH6A 3ZJYC 1EIFA 1UE1A 1BCPB 4Q5VA 3RLOA 1STBA 2DGYA 5M5XH 3F1ZA 2Q2HA 4P71A 2WAQG 1K3BC 1VQIA 3P1HA 1VQCA 2EYPA 1PH5A 3LX0A 1VQ9A 5J3BA 4A3GH 2FFKB 4YCWA 1X6OA 1PZID 3NUCA 1EYGA 2A69C 5BN3A 2CVRA 2XGTA 2VQEQ 1Q8KA 2EPBA 4B9WA 1BBWA 2LXKA 4YHHL 1SYEA 2I5MX 1HNWL 3MXUA 1PA6A 4ZRZA 2EY5A 3AB9A 2IY5B 5C5MA 1SMXA 1BCPF 4RG1A 3G4SA 2O5JC 1GKHA 1SYFA 4AQYL 1A6XA 4GKJL 1H9MA 2B2VA 2MQHA 1SEBD 4DAVA 2Z1CA 1L2FA 1D2BA 2MFIA 5T1IA 2EVBA 1C8CA 1I50H 3BVGA 5IGBA 5JPNC 4DV6Q 1UAPA 3I70A 1CTMA 1XMOQ 2M00A 3VA5A 4K2LA 4IFDG 1Y1WB 3PSIA 3R3OA 3E9IA 1D5XC 5DLQE 1YNXA 1TR5A 1CSPA 2B2VC 5DM63 4XIGS 2JA8G 5I2YA 2RKSA 1AZPA 1ET9A 3SVMA 3W1BA 3OIQA 1XMQL 4R4IA 3OIPA 4BA1I 3BS1A 4DNIA 2UU9L 4A3BH 1EU4A 1H9JA 2L12A 1N32Q 1IYUA 1PRTD 4JBWA 4UP9A 2K14A 1EYCA 1HJPA 4YCUA 4X64Q 1YHAA 5EPLA 4G57A 3I91A 4KY5A 4NKLA 3T51B 2L5TA 1STEA 1Q1EA 2LS01 1V1QA 3HKSA 1EIHA 2PNHA 4DV5Q 1STHA 4TKOB 3GTMB 1H95A 5ELEA 2PZWA 3I72A 1S5ED 1K83B 2AKWB 4ALPA 3A8KE 5EGTA 1X65A 4F88A 4ZKBB 2F0TA 4KI0A 1IZ6A 3NENA 4R4CA 1AN8A 2EYMA 2F0JA 3QR8A 1N36L 4A3EH 4RGTA 2VY3A 3U4VA 4GOPC 3PO3H 5FJ8H 2EJMA 3X3NA 2IL8A 4BY1H 4J1MA 5IT9c 3PF4A 1OXVA 3EJIA 2R92H 5JEAJ 1CUKA 4OO1G 3GTGH 1KABA 1YJNA 1G291 2HIXA 1EY7A 1S3OA 4FYDA 1W6JA 4DK3C 1GUNA 1IW7C 2WIIB 1TT2A 4M8AA 5BR8Q 3CCEA 4C2MH 5GQOA 1EQRA 1JORA 4U68A 2PI2A 3DXJC 1PFBA 1FNWA 2ICEC 3OMCA 3NWSA 3VR4A 3BZKA 4DV3Q 2HD3A 5C4JH 3G7LA 2XN9C 3QO2A 4AH6A 1YNNC 1W2BA 2R7ZG 2UUAL 2K5VA 1ML0D 4NW2A 4KMUC 4POGA 4DPGA 1JC7A 2Z6BA 4F8MA 3S2HB 3CCVA 2PW7A 3DWPA 1VQMA 1EU3A 3BZDB 1ICFB 4Y7NB 4JBMA 1FJGL 1RCVD 1E24A 1TS5A 3NSWA 2B2TA 2JA8B 4CJ2C 1JQYD 1SNDA 1BCPD 1PTOH 3RZOB 2L0CA 5M9OA 5KYIA 3T16A 4ZCKA 1YBYA 3RR5A 4AYBG 3KLWA 3Q6SA 4QF4A 1T5EA 3L3OC 4P2CB 1UE6A 1PFMA 2A68D 2KOLA 1I5FA 2EY2A 5IP7G 2UXBL 4R9WA 1U0LA 3O13A 4J6HA 4K8JA 1I3QB 2OXPA 4CKEA 3FRPB 3QG1A 1HXYD 3OW2A 2BA0A 2Z4IA 1QB5D 4GNXA 1BUVT 4DR1Q 3RUZA 1MBYA 2RHQB 3RNUA 1B50A 4B3RL 3P20A 4F87A 3C2PA 4IJHA 1YNJC 1WTOA 4KTAA 1SN8A 2E74C 2F0IA 4LFAQ 2PZTA 2HHHL 5M3MG 3MEFA 3TP7A 3TN2A 4DUYQ 5FLMH 1JWUD 4CDFC 1TU2B 2YU9B 5C4XB 3CQZH 5JOBA 5CYUA 5I9PA 4GNXC 2R93H 1BDOA 4NXNL 4DR6L 1PH1A 4ZAIA 5K36H 1E22A 4JI1L 3Q0AA 3A54A 4NB3A 2I07B 1F9SA 1MJEA 5FLXE 1B2TA 2L9HA 3M9BA 1VQEA 1JB7A 5CV6A 1HH2P 2B3GA 4LF6L 1VQOA 3HOZG 5IGEA 1PZJD 3K5MA 2QDLA 2Z9HA 4CJ0B 5IODA 3S1QB 1CKNA 3UI2A 3A5ZB 5EPKA 4YWMA 1WCMG 1EWHA 3CRKC 4UP8A 3P7JA 5IYBH 2XTIA 4JI2Q 2E8GA 5ISRA 2Q2UA 2OCEA 3PIO3 4A93H 2R7ZB 4XYQA 4UPAA 2B8GA 1PFSA 1CT1D 1GOZA 5I6YA 5C44B 4JV5Q 1OO9B 2X69A 2R7FA 2JA6G 2BE5D 3V05A 4QJFA 1YIJA 4DUYL 2CKZB 2J7ZA 4OHJA 5ELBA 4DF7A 3K0XA 3CXCA 4GNXB 1PV4A 2IX0A 3TMEA 4AYBB 2DN8A 3SK6A 1SYDA 2IW3A 2E5LQ 1STYA 1HQMC 2KENA 4R1JA 2QW7A 3J80L 2AWOA 3T53B 4A76A 4CJ1B 1K28A 1OXSC 3CCSA 4C3HH 2ZJRA 2F0FA 3J81c 5CR3A 1I4QA 3TRZA 1ET6A 1JT8A 4DN4M 2VB2X 1YJ9A 4HMJA 4KJNA 2AUJD 4XDXA 3RN2A 1EFWA 2PPBC 1KNAA 1NUCA 5CV8A 1PH2A 1G2SA 3A8JE 3KDFB 1UWVA 3A0JA 3A55A 5F2DA 4K8IA 1G91A 3K8AA 2IHEA 1KRSA 5M3MB 1CKMA 4LUVA 3DHQA 2B29A 2MUYA 4IOCA 1T5XD 1S5CD 3VR2A 1X3GA 3S14H 2NN6I 4FDBA 1N9WA 5DNFA 4JI2L 4LFCL 1PH3A 4RFBA 2WINB 3QJYA
chains in the Genus database with same CATH topology
2EYLA 2K5WA 3D31A 4DXGA 4H44C 5D3IB 2K1BA 1FNVA 2XNAC 5M5WB 3KF8A 2XSCA 2WP8J 3HOZB 5IGDA 3M3YB 5FLXL 1F2YA 1JB3A 4IN3A 3C46A 2LY7A 3NBHA 2HDMA 5EBDA 1RODA 2CW0C 2K03A 2ID0A 4CKBA 1RF2D 1EFID 3DM1A 5JJZA 3M85A 3OOCA 4ZLTF 1G2TA 4NDXA 5COYA 5C0XJ 1E0BA 3PUYA 1HQRD 1NAPA 4UAIA 2JA6B 3G6JB 4FXGC 3H3VC 1V8QA 4L6TB 1PRTC 4WORA 5K5PA 1SFOB 2BDOA 2ZXRA 3U9SA 4RKLA 1HRJA 3WOEA 3PUVA 2JEBI 1G6ZA 1CA5A 1B3AA 3DUZA 3D3RA 2H4OA 3E0JA 3M7GA 4XQNA 2D9UA 2KEDA 1GUWA 3ONAB 1UUPA 5D3DA 1SJED 3I4NB 4V190 4Z9CB 2JP1A 4CGYB 3E5SA 2NVYB 3OMGA 2B2UA 2IT1A 1A2UA 1K8OA 1A2TA 4QIWB 1LT6D 1VMPA 5CV5A 2F0DA 2NBFA 4PMBA 2PZUA 3MFGA 5A2QE 3MZ5A 4CKCA 3HOYB 2X6GA 3MXNA 1AFPA 4BBRB 5C4ZA 3HOXB 2B2UC 4OIJA 4KKSA 1LTRD 3NE5B 3GTOB 5HURA 4PMWA 4OO1I 1BXTA 1B1ZA 5NUCA 5FK9C 4KHZA 1BCPC 2XRSD 3LWUA 4KD4A 4IUVA 3R2TA 5M3FB 3ND8A 2PMZB 4KJOA 2A68C 1E2ZA 3W2DA 3KK7A 1BNZA 1FGBD 2AQ3B 1U9RA 1EL0A 1DONA 1TWGB 3OW7A 1HUNA 1TWAB 2KEEA 2RDGA 4XTCS 3MHBA 2FJ2A 5C6AA 2F0MA 2KQ3A 4XT3B 2B63B 1SYGA 3V96A 3EVQA 5LL6X 1C4QA 2MP1A 3S1MB 4RGMA 5KYLA 1ZEQX 2PNRC 3KBGA 1TY2A 4G4KA 4UDUC 1RD9D 4YIJA 5DM73 2F1MA 4K2KA 3MAQA 3DEOA 1L0XB 2V4DA 4G7HC 3BYTB 4XXEA 1HTLD 2BOSA 1SJHD 2SOBA 4A3GB 3SXHA 2MJ8A 5D14A 4A3DB 1ILPA 1F9PA 4L8JA 5KNDA 3BVMA 1EZ8A 4KV6A 1HHVA 1WD0A 4C56C 2WV6D 5E3FA 1U4MA 2EYJA 1SYCA 1XWEA 4KKTA 3KLSA 3K7AB 3GV3A 4KD3A 3K59A 1ESRA 2K33A 3MVVA 3VA7A 1V1OA 3K0YA 4RWSC 5A2QL 2K04A 3GQBA 1STGA 3CHBD 1WTVA 2R3ZA 3QB3A 2XRQD 1ICWA 2QCPX 3D4DA 2BE5C 1VCIA 1SE3A 3NQIA 1F2ZA 3CKIB 2Z4HA 4LMQD 1L0YB 3K5LA 1F9QA 5IT9E 4WJWA 3HEJA 4KY7A 4X3TA 2XWJB 3C1EA 3DWQA 1DJRD 4BS9A 5LL6S 1JR0D 4B9XA 1JICA 2IX1A 2WACA 4A3BB 2MPMA 3K6OA 2DY8A 1I4GA 3HOVB 3V2TA 3IFDA 1H9RA 4DXFA 2F0KA 4LJZC 1AW7A 4RHRA 3NTHA 1NR4A 5IIFA 2CQAA 5DEHA 2AUKA 3PUXA 2QDBA 3S2DB 1SSOA 4C1NK 3E6ZX 4A3EB 1LT4D 3OHXC 3PO3B 3D4WA 4K6DA 3EROA 1ZYRD 4ZQ3A 2PYKA 5IGFA 1HUMA 5IGCA 1TQOA 4XQJA 5K36G 2WAQB 4R8IA 3TSSA 1DM0B 1OXTA 2B8FA 5C0XH 2NN6H 5D65A 1RKNA 4C2MB 2O4XA 4HAEA 4I65A 3Q24A 2B2WA 4IZ8A 1X32A 2PCFB 2JSOA 5G3LD 1SNQA 1EEID 2LFNA 5EKIA 4HCEA 1SAPA 2FMCA 1D5MC 1QWYA 3ITPA 2I46A 1Y69U 3DEPA 3PMFA 4HSVA 2QF7A 1PTOB 4IALA 2BA1A 5KIXA 2EJFC 4IURA 3F2UA 4NP5A 1C48A 3U9OA 5IOCA 1GUSA 4C3HG 3I90A 1EY8A 2F0QA 4G7OC 5I6WA 2H1EA 4IUNA 1AZQA 5C3WA 4QUCA 3W3AA 2F0LA 1XXGA 2B2TC 2D62A 5EQ0A 3CQZB 3GTLB 2F0EA 1Q90A 5CBEE 4E6IA 1RTNA 2R93B 3URYA 1D6EC 1A3TA 5HGTA 1PFNA 1TS4A 2RVLA 4DAPA 3J81E 2WB1B 5ELDA 3A7AB 1GHKA 4B08A 4FF1A 3MC0B 1II3A 1Q3LA 2ZT9C 1LTGD 1EY6A 4BA2I 1Q8IA 4U673 2DY7A 2K28A 1KLUD 3NWTA 4A93B 5J39A 1DZ1A 1LTSD 2A73B 2IX3A 3HP3A 3K5OA 1B4OA 2EXZA 3BDCA 3KLSX 3T4AC 4I7ZC 2A6HD 4MN3A 1TVXA 4FO2A 4HN7A 1CQFA 1B44D 4MHEA 5BN4A 4KN4C 4OO1H 3D6WA 1OXUA 5CGKA 4XQQA 3SEBA 5CBAE 4C3HB 2A74C 2KJXA 2TMPA 4X3UA 2XIWA 3RLFA 3Q22A 5JEAG 1GJXA 3EQLC 4NMZA 3OPOA 1VF7A 5CMDA 1JOKA 5C4HA 5CV9A 3S14B 1B9MA 1QOHA 3HG9A 3VYRA 4X3SA 3C1FA 3H09A 3H0GB 2F0PA 2SNSA 3QOJA 4RA8A 2A5HA 1WTWA 1QILA 4N9TA 2E2IB 4TQUS 2F0VA 1PTOD 2L1BA 3S1RB 1IHZA 4PV1C 1EY5A 3KBXA 1CA6A 2E76C 5T1GA 4C3IG 1Y8PB 3FKIB 1XX8A 5E1FA 3MA2B 4QUFA 2EZVA 3PIP3 4DU9A 2HDLA 3WOFA 5IGGA 1WCMB 1QCBD 1JOQA 5EKKA 2KUMA 4CHTB 4GZYC 2F3VA 2N88A 4EQNA 2NVTB 5CORA 1DCZA 3L9AX 2NB0A 1BBXC 4C1NI 3PUWA 4PNYA 2RDFA 1I4XA 2L11A 4FXDA 1KDCA 3GTQB 1CM9A 4K5XA 1VMCA 1D1KA 3HS0C 4IUUA 2OEOA 1B53A 4ILWA 4H13C 1LO5D 1G8ZD 4ID6A 1SXTA 1IW7D 4ZK9B 2A6ED 1Y8NB 1SNMA 2IPKD 1OXXK 1ZYRC 2F0WA 4IFDI 4KKUA 1TY0A 2F03A 4S3SA 1LV9A 1TS3A 3R93A 4M1UB 5M5YB 4IUQA 3DMUA 3SDZA 1BR9A 2G9HD 3DWAA 2NYZD 4XYOA 1DYQA 2BCOA 3M4YA 4HCSA 4TSSA 3NBIA 3AMUA 1WTQA 1EY4A 1HFNA 4DK1A 1CZWA 1H9SA 3ZYYX 1LTAD 1JE4A 2K01A 1WVLA 2XVSA 1NR2A 1JWMD 1EY0A 1J9OA 4C3IB 2NVXB 2RSOA 3NXWA 4RCOA 2NWGA 2Z8LA 1NCVA 3GTJB 4IFDJ 3FPUB 3I4MB 2J4XA 1ESFA 5DAUA 2PO4A 3IKJA 2FMMA 1E2VA 3NTIA 2NTSA 1LT5D 1IKLA 3A56A 3PUZA 2VXWA 1D1IA 3P75A 2DNEA 3LNNA 4RCNA 2AQ1B 1LACA 1X3PA 4X3KA 1R4PB 1MGSA 1Z47A 1Y8OB 4DAYA 1UEAB 4PQXA 2XWBB 1F77A 3D6CA 2C5CA 1QG7A 1EEFD 1LLRD 1EWCA 4LAAA 1CZGA 3RD4A 4RGNA 1DOMA 2JXMB 5C5LA 5LHY1 5CV7A 1KLGD 3TP8A 3FMCA 2R6GA 3MTSA 5EBCA 1PYWD 1PMRA 3OWFA 4KK7A 2CHBD 3T56B 2G9DA 1SBBB 1CQVA 2VUMB 1A3VA 2K5QA 1TWHB 2F0OA 3K5NA 3VYUA 1HA6A 1CHPD 1SMYD 5M5XB 1XYIA 1H9SB 1MI2A 4HSPA 2B2YA 1S4ZA 1Z6HA 1BF4A 1ZKOA 3MWYW 3PV0A 2K5DA 4ZYSA 5C0XG 1Q12A 5G3LF 1Q1BA 3TP6A 5KNBA 3GO5A 3VYTA 4FNFA 1FD7D 4K5VA 1EIGA 3SE0A 1ILQA 4FP5D 3OWEB 5EJWA 1SE2A 2DNCA 1WTPA 3R2IA 2C9OA 3A8IE 4DK0A 4R8NA 4IUTA 2A6HC 2ENBA 1KDBA 4RGOS 3WDNA 2Y0SB 3K58A 5KNCA 1I50B 2VNUD 2K32A 2AQ2B 2NZ1D 5KEEA 1LTTD 2HUGA 1FNUA 2EY6A 1AP0A 2NTTA 2F0NA 3HGBA 4EQPA 1RTOA 4H0LC 2KCCA 5C3EB 1HPCA 5AFWA 5I4DA 1SNCA 1EZ6A 2R61A 2F4IA 2QEJC 4A3FB 4FF3A 4PMCA 2EDGA 1IL8A 2MGSA 2CW0D 2X6LA 1AEXA 3FEWX 2EOTA 2F3WA 1TS2A 4XT1B 1Z7TA 1PTOC 3KUPA 4BY1B 3QIAA 4QCLA 1S5DD 1R9TB 2R92B 4L63B 2Q8TA 5I9OA 1UNSA 2RDHA 3GTPB 5J1ZA 1BQQT 3GTGB 4F7XA 1S5BD 1QJOA 4N9PA 3I3CA 4HMIA 1VF5C 1NSNS 2L55A 1PLFA 3AU7A 5JVG3 1WTXA 2QILA 5JPMC 1EYDA 2J0TD 3MXPA 2QKIC 4RAUC 1F2MA 1RHPA 4WFN3 2EYOA 5C4JB 3H6MA 3GP7A 3FDTA 4BWGB 2N55A 2AWNA 4DFAA 3CU7A 5E4WC 1CI3M 2B2WC 5IT9L 2A6EC 2PQEA 1E2WA 3LWEA 3HKZB 3TZDA 5FO7B 3RZDB 1SNPA 1GUOA 1DOKA 1STNA 3GD7A 1LTID 2RA4A 5TSSA 2B39A 3JAME 2JE6I 3BG3A 2F0SA 2KCNA 3NHHA 5JAVA 2M2LA 3NK9A 3J80E 1M8AA 2WKCA 1I4HA 1PTOF 3K57A 2Q8IB 3NTKA 2JA7B 3SHLA 2F0UA 1S5FD 4IFDH 1I4RA 4J8QA 1PZKD 3M4OB 5CV4A 2D2CC 3J7YW 4HR7B 1XTCD 4ODGA 2VB3X 1SDFA 5E4XA 1A15A 2E2DC 3NP8A 3TBIB 5ELFA 1LT3D 2RQXA 2EYHA 4G7ZC 3C3LA 2E2JB 3RMHA 1QNKA 1FR3A 1TKWB 2TSSA 1DD2A 4FF2A 2EJGC 1KDAA 1R4QB 2K05A 5CC4A 1BO0A 4WRDA 4LK1C 3TZUA 2MHVA 2M9VA 1BOSA 4KHVA 1GHJA 1ENCA 3SK8A 3FVQA 1STAA 3VR6A 2LMCB 1M4VA 3IFTA 4OIKA 2EY1A 1X3QA 3R8BA 4FXKC 3EFXD 1RDPD 2A69D 1Y1VB 1LTBD 3BDOA 1WTRA 1SMYC 3BDLA 1ENAA 3I73A 4OGQC 5EPJA 2RSNA 1KNEA 2IWHA 3JAML 3M7NA 2K7VA 4CBVA 2BDNA 2FINB 3NPPA 1LABA 1GXDC 5FOBB 4DA2A 2O5IC 1TIID 1K8MA 4A3JB 3TP5A 5ELCA 1SE4A 1EYAA 2ICIA 1KTKA 2WKDA 1W6KA 3Q23A 5C3XA 2KHSA 3J7AF 2SDFA 4JK1C 2KVMA 4RHSA 3J81L 3KLRA 5C0XI 1PDQA 3HRZC 1A3UA 3S16B 1J8IA 3D4RA 3A7LA 1CHQD 5FO9B 1V1PA 1O80A 1PXUA 4A3KB 1V43A 3QWNA 1RJTA 4C3JG 1I6HB 2E2HB 5J22A 5JVH3 2ZXOA 3HOWB 3QOLA 1QE6A 1ZXTA 1EY9A 2SNMA 4QMGA 1F2LA 2ZXPA 3HOUB 4ABNA 3L7ZC 2D5DA 3OSOA 2LKVA 1JOOA 1EQTA 4FF4A 1O78A 4A3IB 4ME5A 1GUTA 3S9WA 1EOTA 3BVZA 2NVQB 4O42A 1ONLA 3EA6A 4FVMA 2JA5B 1FYCA 4K14A 1QNUA 4TRDA 1JWSD 4ZUIA 1O7YA 4RKBA 4IUPA 4HTHA 3ND9A 1I4PA 1HA5A 1WD1A 3SR1A 2HCCA 3H91A 4EQOA 1YNND 3I4LA 4DNRB 4K5WA 2O2LD 1HCZA 3IAYA 1O7LA 2F0HA 5KGUA 5JEAH 1O7ZA 2HQEA 4BY7B 4ZKCB 1V1PB 2KA7A 1KAAA 3GTKB 4KY6A 1SYBA 1VDZA 1GUGA 4HEDA 1F9RA 4H7BA 4DGZA 3GV6A 2F0GA 5KRUA 5BN5A 3I8ZA 1TWFB 3SK4A 5I2XA 4C3JB 2K6AA 1U4LA 3MFYA 4O1NA 1PRTB 3S17B 2FHTA 3H94A 4ZUJA 1I6VC 1YNJD 3X3MA 3MEHA 1IKMA 3MXGA 2RBMA 3HZXA 3NQTA 4MIUA 2E75C 4KN7C 4OL7A 3N52A 4A3MB 1HTPA 2GA4B 1B9NA 3IL8A 3VR5A 4IQZA 2L4NA 1DXMA 3S15B 3N6RA 1MSGA 2OF1A 4Q0FA 2EE1A 2IJ0A 5EKLA 4DNTB 4V0BA 1U4PA 3CRLC 1ENFA 1DOLA 2YYZA 2JYOA 3VYSA 1PRTF 1CFMA 2KECA 1SNOA 2JEAI 3J7AV 3BYYB 4EVOA 3FPPA 5A35A 1MD2D 5FKAC 1CK1A 4K6LA 5FO8B 1U4RA 2EYFA 2PW5A 1H9KA 4EGVA 1D5ZC 1EQVA 1HFGA 3T13A 2Q8RE 3ERQA 3VR3A 2NUCA 4BBSB 3S1NB 2OT2A 3D8GA 3TDQA 2NN6G 1TWCB 2SEBD 3SK5A 1IYVA 4QB4A 2B2YC 2HCIA 1MSHA 4ULLA 3PO2B 1JCKB 4RH6A 1BCPB 4Q5VA 1STBA 3P1HA 2EYPA 3LX0A 2FFKB 1PZID 3NUCA 2A69C 5BN3A 2CVRA 2EPBA 4B9WA 1SYEA 3MXUA 4ZRZA 2EY5A 3AB9A 5C5MA 1BCPF 2O5JC 1SYFA 1A6XA 1H9MA 2B2VA 4DAVA 1SEBD 2Z1CA 1D2BA 5T1IA 2EVBA 1C8CA 3BVGA 5IGBA 5JPNC 1UAPA 3I70A 1CTMA 2M00A 3VA5A 4K2LA 4IFDG 1Y1WB 3R3OA 1D5XC 1TR5A 2B2VC 5DM63 4XIGS 5I2YA 2RKSA 1AZPA 1ET9A 3SVMA 3OIQA 3OIPA 4BA1I 3BS1A 1EU4A 1H9JA 2L12A 1IYUA 1PRTD 4JBWA 1EYCA 5EPLA 4G57A 3I91A 4KY5A 4NKLA 3T51B 2L5TA 1STEA 1Q1EA 2LS01 1EIHA 1STHA 4TKOB 3GTMB 5ELEA 2PZWA 3I72A 1S5ED 1K83B 3A8KE 5EGTA 4F88A 4ZKBB 2F0TA 4KI0A 1AN8A 2EYMA 2F0JA 4RGTA 2EJMA 3X3NA 2IL8A 4J1MA 1OXVA 3EJIA 5JEAJ 4OO1G 1KABA 1G291 1EY7A 4FYDA 1W6JA 1GUNA 1IW7C 2WIIB 1TT2A 4M8AA 1JORA 4U68A 3DXJC 1PFBA 1FNWA 2ICEC 3OMCA 3NWSA 3VR4A 3G7LA 2XN9C 3QO2A 1YNNC 1ML0D 4NW2A 4KMUC 1JC7A 4F8MA 3S2HB 2PW7A 3DWPA 1EU3A 3BZDB 4Y7NB 1RCVD 1TS5A 3NSWA 2B2TA 2JA8B 4CJ2C 1JQYD 1SNDA 1BCPD 1PTOH 3RZOB 2L0CA 5M9OA 5KYIA 3T16A 3Q6SA 4QF4A 1T5EA 3L3OC 4P2CB 1PFMA 2A68D 2KOLA 2EY2A 4R9WA 3O13A 4J6HA 4K8JA 1I3QB 2OXPA 4CKEA 3FRPB 3QG1A 1HXYD 2BA0A 2Z4IA 1QB5D 1BUVT 3RUZA 1MBYA 1B50A 3P20A 4F87A 3C2PA 1YNJC 1WTOA 4KTAA 2E74C 2F0IA 2PZTA 3TP7A 3TN2A 1JWUD 1TU2B 2YU9B 5C4XB 5JOBA 5CYUA 5I9PA 1BDOA 4ZAIA 5K36H 3Q0AA 3A54A 2I07B 1F9SA 5FLXE 1B2TA 2L9HA 5CV6A 5IGEA 1PZJD 3K5MA 4CJ0B 5IODA 3S1QB 3UI2A 5EPKA 1EWHA 3CRKC 3P7JA 5ISRA 3PIO3 2R7ZB 4XYQA 2B8GA 1CT1D 5I6YA 1GOZA 5C44B 1OO9B 2X69A 2BE5D 3V05A 2J7ZA 4OHJA 5ELBA 4DF7A 2IX0A 3TMEA 4AYBB 2DN8A 3SK6A 1SYDA 2IW3A 1STYA 1HQMC 3J80L 2AWOA 3T53B 4CJ1B 1OXSC 2F0FA 5CR3A 1I4QA 1ET6A 4DN4M 2VB2X 4HMJA 4KJNA 2AUJD 4XDXA 2PPBC 1KNAA 1NUCA 5CV8A 1G2SA 3A8JE 3A55A 5F2DA 4K8IA 1G91A 5M3MB 3DHQA 2MUYA 1T5XD 1S5CD 3VR2A 2NN6I 5DNFA 4RFBA 2WINB 3QJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNP A;  1SNM A;  2F0W A;  2EY1 A;  4OL7 A;  3TP8 A;  4B9W A;  2SOB A;  2EYL A;  3D4W A;  2LKV A;  1JOO A;  1STN A;  2F0E A;  3OSO A;  3E5S A;  4K6D A;  4S3S A;  3SXH A;  1SYE A;  3ERO A;  3OWF A;  4E6I A;  4ZQ3 A;  3OMG A;  1KAB A;  4ME5 A;  2PYK A;  5IGF A;  3S9W A;  1A2U A;  1EY7 A;  4PMC A;  5IGC A;  1TQO A;  2OF1 A;  1A2T A;  3BDL A;  2EY5 A;  3C1F A;  1ENA A;  5CV9 A;  1A3V A;  5C5M A;  5EKL A;  1EZ8 A;  1A3T A;  4KV6 A;  2F0O A;  5CV6 A;  5CV5 A;  2F0D A;  5HGT A;  1TT2 A;  3DMU A;  2F0S A;  4PMB A;  1AEX A;  2F0P A;  5E3F A;  1SYF A;  2EYJ A;  2SNS A;  1SYC A;  3NHH A;  5JAV A;  3QOJ A;  5IGE A;  2PZU A;  1JOR A;  5IGD A;  3MZ5 A;  3NK9 A;  4K14 A;  2F3W A;  3OMC A;  4TRD A;  5IOD A;  1SNO A;  1F2Y A;  4ZUI A;  4KD3 A;  4N9T A;  3SHL A;  5C4Z A;  2F0U A;  2F0V A;  3MVV A;  4RKB A;  1RKN A;  4HTH A;  1II3 A;  4EVO A;  5IGB A;  2O4X A;  5CV4 A;  1EY4 A;  1STG A;  5ISR A;  3QB3 A;  4I65 A;  1EY6 A;  2M00 A;  5HUR A;  5I9O A;  3SR1 A;  1IHZ A;  4IZ8 A;  4K2L A;  3TP6 A;  3VA5 A;  4EQO A;  3D4D A;  1EY5 A;  4ODG A;  3TP5 A;  2EYF A;  3R3O A;  5NUC A;  4F8M A;  1F2Z A;  5J1Z A;  2PW5 A;  2PW7 A;  1EYA A;  4K5V A;  4K5W A;  4NDX A;  5I6Y A;  1TR5 A;  4F7X A;  1SNQ A;  1EY0 A;  1EQV A;  5J39 A;  4N9P A;  3T13 A;  2F0H A;  4HMI A;  5KGU A;  2RKS A;  3NP8 A;  4KD4 A;  1SND A;  2KHS A;  5C3X A;  3ERQ A;  3NXW A;  5E1F A;  3HEJ A;  2NUC A;  2EYH A;  4KY7 A;  4KJO A;  4R8N A;  4DU9 A;  5M9O A;  1NSN S;  5IGG A;  2HQE A;  4WOR A;  3T16 A;  4DF7 A;  5KYI A;  2ENB A;  1KDB A;  5K5P A;  3C1E A;  3ITP A;  2EXZ A;  3BDC A;  1JOQ A;  1EYD A;  3D8G A;  5DAU A;  5EKK A;  1KAA A;  1U9R A;  3MXP A;  3SK6 A;  1SYD A;  4KY6 A;  4QF4 A;  1SYB A;  4B9X A;  1STY A;  3PMF A;  4IAL A;  1EYC A;  2F3V A;  2EY2 A;  4RKL A;  3SK5 A;  1F2M A;  4EQN A;  4G57 A;  2WAC A;  4J6H A;  4K8J A;  4KY5 A;  1A3U A;  4NKL A;  2EYO A;  2F0F A;  3MHB A;  4QB4 A;  5CR3 A;  3H6M A;  5KIX A;  1KDA A;  2OXP A;  4H7B A;  5C6A A;  2F0M A;  2KQ3 A;  3P75 A;  1SYG A;  4HMJ A;  4KJN A;  4PNY A;  3EVQ A;  4NP5 A;  3V2T A;  2RDF A;  3U9O A;  4DGZ A;  5CGK A;  5IOC A;  1STH A;  3RUZ A;  5CC4 A;  2F0G A;  1KDC A;  5KYL A;  2F0K A;  2PZW A;  1NUC A;  5CV8 A;  5KEE A;  1EY8 A;  2F0Q A;  1STB A;  4K5X A;  4WRD A;  4DFA A;  5KRU A;  3SK4 A;  5EGT A;  4KHV A;  5I6W A;  2EY6 A;  2F0T A;  2OEO A;  2F0N A;  4KTA A;  5F2D A;  4K8I A;  5IIF A;  5J22 A;  2EYM A;  2F0I A;  1ENC A;  2F0J A;  4YIJ A;  4EQP A;  2PZT A;  3D6C A;  4K2K A;  3SK8 A;  3QOL A;  4IUN A;  4ZUJ A;  3P1H A;  3TP7 A;  2EYP A;  1STA A;  3LX0 A;  5DEH A;  3DHQ A;  3TME A;  4LAA A;  2PQE A;  4NMZ A;  5C3W A;  2QDB A;  4ID6 A;  1EY9 A;  2SNM A;  3MEH A;  5C5L A;  2RBM A;  4QMG A;  5JOB A;  4J1M A;  5I9P A;  3NUC A;  1SNC A;  2F0L A;  1EZ6 A;  3HZX A;  3EJI A;  3NQT A;  1JOK A;  5C4H A;  4MIU A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 4A3J H;  2EYL A;  4CDD C;  2K5W A;  1E1O A;  3D31 A;  1QZH A;  1JJC B;  3H0G H;  1CKN B;  4DXG A;  4H44 C;  5D3I B;  2L15 A;  1HZB A;  1XPR A;  2K1B A;  1FNV A;  4LF9 Q;  2XNA C;  1QVG A;  2E2I H;  5M5W B;  3KF8 A;  3BU2 A;  2XSC A;  2WP8 J;  3HOZ B;  5IGD A;  1IBL L;  3M3Y B;  4DR5 L;  5FLX L;  4LF8 Q;  4BBR G;  1YI2 A;  1F2Y A;  3HOX G;  1JB3 A;  1KHI A;  4IN3 A;  3C46 A;  2LY7 A;  1VQG A;  3NBH A;  2HDM A;  5EBD A;  4JI3 Q;  2F4V Q;  1ROD A;  1TXY A;  2CW0 C;  2K03 A;  1V9P A;  3FKI H;  1FGU A;  2ID0 A;  4DUZ L;  4CKB A;  3U58 A;  1RF2 D;  1EFI D;  3DM1 A;  5JJZ A;  3M85 A;  3OOC A;  4ZLT F;  1G2T A;  4NDX A;  1I6H H;  5COY A;  3I55 A;  5C0X J;  1E0B A;  3PUY A;  1HQR D;  1NAP A;  4UAI A;  4PZ6 A;  4YY3 Q;  2JA6 B;  3G6J B;  4FXG C;  3H3V C;  5M3F G;  3HOW H;  2AMC B;  1V8Q A;  4L6T B;  2ALY B;  1PRT C;  4WOR A;  1HZC A;  3I56 A;  5K5P A;  3CW2 C;  3KFU A;  1SFO B;  2BDO A;  2ZXR A;  3U9S A;  4JYA Q;  3J81 j;  2Z0S A;  2CWA A;  1K73 C;  4RKL A;  5IYC G;  1HRJ A;  3WOE A;  1FVI A;  3PUV A;  5LMU L;  2JEB I;  4A3I H;  4A3L G;  1G6Z A;  2B63 G;  1CA5 A;  1B3A A;  1Q46 A;  4OON A;  2NVQ H;  3DUZ A;  3D3R A;  4L5T A;  2H4O A;  1PYB A;  3E0J A;  3M7G A;  4XQN A;  2D9U A;  2KED A;  1Z9F A;  2JA5 H;  1VQL A;  1GUW A;  3ONA B;  2UXD Q;  4GLA C;  1UUP A;  5D3D A;  4QGU A;  1SJE D;  3I4N B;  2MO0 A;  4V19 0;  4Z9C B;  3KF8 B;  4PG3 A;  4A3G G;  5M5Y H;  3CMA A;  1X9N A;  2JP1 A;  4CGY B;  2YTX A;  3E5S A;  4A3D G;  2NVY B;  3OMG A;  4YY3 L;  2B2U A;  2RCN A;  2IT1 A;  1A2U A;  1K8O A;  1MIU A;  1A2T A;  4QIW B;  1LT6 D;  1VQJ A;  3NBH B;  1VMP A;  2K75 A;  2PI2 E;  5CV5 A;  2F0D A;  1N34 L;  2NBF A;  4PMB A;  4HJ5 A;  2PZU A;  3MFG A;  5A2Q E;  3MZ5 A;  4CKC A;  1YIT A;  2I0Q A;  3HOY B;  2X6G A;  4LUZ A;  1S40 A;  3MXN A;  1AFP A;  4BBR B;  3VDY A;  5C4Z A;  1VQA A;  3HOX B;  2B2U C;  4OIJ A;  4KKS A;  1LTR D;  4DV0 L;  3NE5 B;  2Y0S G;  4C3I H;  3GTO B;  5HUR A;  4PMW A;  3T1H Q;  2NVX H;  4WJ3 M;  4OO1 I;  1BXT A;  1B1Z A;  5NUC A;  5FK9 C;  1TWF H;  3PF5 A;  4KHZ A;  1BCP C;  3GTJ H;  2XRS D;  2ZTD A;  3LWU A;  2K5N A;  2UXD L;  4KD4 A;  4IUV A;  3R2T A;  5M3F B;  3ND8 A;  2PMZ B;  1K3R A;  4KJO A;  2A68 C;  1E2Z A;  3W2D A;  3KK7 A;  1BNZ A;  1FGB D;  2AQ3 B;  1U9R A;  1EL0 A;  1DON A;  1TWG B;  3OW7 A;  1HUN A;  4DV1 L;  1TWA B;  2KEE A;  2RDG A;  4A3B G;  4XTC S;  3MHB A;  2FJ2 A;  5C6A A;  2F0M A;  1L1O A;  2KQ3 A;  4AYB E;  4XT3 B;  2B63 B;  1SYG A;  3V96 A;  3S15 H;  4LFB Q;  3EVQ A;  5LL6 X;  1C4Q A;  2MP1 A;  3G6E A;  3S1M B;  1S72 A;  4RGM A;  1HNW Q;  5KYL A;  1ZEQ X;  2PNR C;  3KBG A;  1TY2 A;  4G4K A;  1ASY A;  4UDU C;  1X3F A;  1RD9 D;  4YIJ A;  5DM7 3;  2F1M A;  4K2K A;  4AQY Q;  3KJP A;  4GKJ Q;  3MAQ A;  1IXR A;  5AJ3 L;  3J81 i;  1L1O C;  3DEO A;  3G71 A;  1L0X B;  4YWK A;  2V4D A;  4A3E G;  4G7H C;  3BYT B;  1G51 A;  4XXE A;  3PO3 G;  5FJ8 G;  1HTL D;  2BOS A;  2VUM H;  1SJH D;  2SOB A;  4A3G B;  2DJG C;  3SXH A;  1TWH H;  2KHJ A;  2MJ8 A;  5D14 A;  4A3D B;  3MXN B;  3CF5 A;  1ILP A;  1F9P A;  4L8J A;  5KND A;  1T9H A;  3BVM A;  1EZ8 A;  4KV6 A;  1HHV A;  1WD0 A;  4WJ4 A;  4C56 C;  2WV6 D;  5E3F A;  1U4M A;  2EYJ A;  3S1N H;  1SYC A;  1XMQ Q;  1XWE A;  2H5X A;  4KKT A;  3KLS A;  2UU9 Q;  3K7A B;  1TWC H;  2AHO B;  3GV3 A;  4KD3 A;  3K59 A;  3UE1 A;  1ESR A;  2K33 A;  3MVV A;  3VA7 A;  1V1O A;  3K0Y A;  1VQ8 A;  4RWS C;  4LFB L;  4DV2 L;  4OXP A;  5A2Q L;  2K04 A;  3GQB A;  1STG A;  3CHB D;  4GLV B;  2R3Z A;  3QB3 A;  2XRQ D;  1WTV A;  1ICW A;  2QCP X;  2VZA A;  4B3S L;  1X54 A;  3D4D A;  4B3M L;  2BE5 C;  1VCI A;  5IYD H;  1SE3 A;  2ATW A;  3NQI A;  1F2Z A;  1VQK A;  3CKI B;  2Z4H A;  4LMQ D;  4X6A H;  1L0Y B;  3K5L A;  1F9Q A;  5IT9 E;  4MZ9 A;  4WJW A;  1L1O B;  4P72 A;  3HEJ A;  4JW0 A;  4O0A A;  4KY7 A;  1N36 Q;  3KYH C;  4X3T A;  2XWJ B;  3C1E A;  3DWQ A;  1DJR D;  1YZ6 A;  4BS9 A;  5LL6 S;  4DR7 L;  1JR0 D;  4B9X A;  3EN2 A;  1JIC A;  1SRU A;  4BXX H;  2IX1 A;  2WAC A;  4A3B B;  2MPM A;  3F2B A;  3K6O A;  2DY8 A;  5GAE C;  1K8A C;  1I4G A;  3HOV B;  3V2T A;  3ER0 A;  4QY7 A;  3IFD A;  3PCO B;  1H9R A;  4DXF A;  2F0K A;  4LJZ C;  1AW7 A;  4RHR A;  3NTH A;  4LUO A;  4PZ8 A;  5C3E H;  1NR4 A;  4GN5 A;  2VW9 A;  5IIF A;  1A62 A;  1B8A A;  2CQA A;  5DEH A;  2AUK A;  4A3F H;  3PUX A;  2QDB A;  3S2D B;  1SSO A;  4JI0 L;  3CAM A;  4C1N K;  3E6Z X;  4MNO A;  4A3E B;  5FLM G;  1LT4 D;  3OHX C;  2UUA Q;  3PO3 B;  3CME A;  3D4W A;  5GRO A;  4K6D A;  1Y1W H;  3ERO A;  2ZM6 L;  2R93 G;  1ZYR D;  4ZQ3 A;  1P8L A;  2PYK A;  5IGF A;  1HUM A;  5IGC A;  1TQO A;  4XQJ A;  5K36 G;  3D0F A;  1FJG Q;  2WAQ B;  4X66 L;  4R8I A;  2C35 B;  3TSS A;  1DM0 B;  4DR4 L;  1OXT A;  1N8R C;  2B8F A;  3BZC A;  5C0X H;  1R9T H;  2WB1 G;  3BJU A;  2NN6 H;  2DJF C;  1ASZ A;  2DUD A;  5D65 A;  1RKN A;  4C2M B;  3GTP H;  2UXB Q;  2O4X A;  4GLX A;  2BH8 A;  1BKB A;  4HAE A;  4I65 A;  3Q24 A;  1HR0 W;  2B2W A;  4IZ8 A;  4EQ5 A;  3CCQ A;  4OWX B;  1X32 A;  3H3V I;  1PH6 A;  1K0S A;  5IYB G;  2PCF B;  2JSO A;  5G3L D;  4A93 G;  1SNQ A;  4B3R Q;  1EEI D;  2LFN A;  5EKI A;  1QVC A;  1EWI A;  4HCE A;  2HHH Q;  1SAP A;  2FMC A;  1D5M C;  1QWY A;  5EAY A;  2ASB A;  3ITP A;  2I46 A;  1RIP A;  4OX9 L;  1Y69 U;  3DEP A;  1VQH A;  3PMF A;  4HSV A;  2QF7 A;  1PTO B;  3FP9 A;  4IAL A;  1VQD A;  2HQL A;  2BA1 A;  4NXN Q;  4DR6 Q;  2ZTC A;  5KIX A;  2EJF C;  4IUR A;  4JI1 Q;  3F2U A;  4B3T Q;  4NP5 A;  1C48 A;  3U9O A;  5IOC A;  1GUS A;  4C3H G;  3I90 A;  4YCV A;  1EY8 A;  2F0Q A;  2Q2T A;  4G7O C;  3UDI A;  3E3X A;  4UP7 A;  3L0O A;  5I6W A;  1WOC A;  4APV A;  3CC2 A;  2H1E A;  4LF6 Q;  1LTL A;  1C7Y A;  4IUN A;  3RZD H;  2PQA A;  5JJL A;  3OYY A;  4A3C H;  1AZQ A;  5C3W A;  4DR2 L;  4QUC A;  2ZTE A;  3W3A A;  2F0L A;  1XXG A;  2HIV A;  2B2T C;  1NTG A;  2D62 A;  5EQ0 A;  3IRB A;  3CQZ B;  3GTL B;  2F0E A;  1Q90 A;  5CBE E;  3TS2 A;  4E6I A;  1RTN A;  3S2H H;  2R93 B;  4Y7N H;  4QL5 A;  3URY A;  3CCU A;  1D6E C;  1A3T A;  3RZO H;  2UUC Q;  3H0G G;  5HGT A;  1VQN A;  1PFN A;  2JA7 H;  1TS4 A;  2RVL A;  4DAP A;  2UXC L;  3M4O H;  3J81 E;  1O7I A;  2WB1 B;  5ELD A;  3KDF A;  3A7A B;  1GHK A;  1B7Y B;  4JC0 A;  4AIM A;  4B08 A;  1MJC A;  1KD1 C;  4FF1 A;  3MC0 B;  3ERS X;  1II3 A;  4B3T L;  4HIK A;  3TS0 A;  1Q3L A;  2ZT9 C;  1LTG D;  5L37 A;  4L5Q A;  2V1C C;  1EY6 A;  4BA2 I;  1NNX A;  1Q8I A;  4U67 3;  4JI6 L;  1YJW A;  2DY7 A;  2P5Z X;  2K28 A;  2OWO A;  1KLU D;  1CKO A;  5ELN A;  3NWT A;  3FKI G;  4A93 B;  2VQF L;  5J39 A;  2E2J H;  3I4O A;  4HIM A;  1LTS D;  1DZ1 A;  2A73 B;  2IX3 A;  3HP3 A;  3K5O A;  2K52 A;  3EBE A;  1B4O A;  5C4X H;  2EXZ A;  3BDC A;  3KLS X;  3HOW G;  2YTV A;  3JAM c;  1RL2 A;  3T4A C;  4HJ8 A;  4OWT B;  4I7Z C;  2A6H D;  4LFC Q;  5IE8 A;  4MN3 A;  1TVX A;  4FO2 A;  1J5E L;  2K50 A;  2KCT A;  4HN7 A;  3I2Z A;  1CQF A;  1B44 D;  4MHE A;  1K8G A;  5BN4 A;  3J80 c;  2PQA B;  4KN4 C;  4TVA B;  4OO1 H;  3D6W A;  1OXU A;  1VQF A;  5CGK A;  4XQQ A;  1E3P A;  4IPC A;  2UUC L;  3SEB A;  5CBA E;  2GN5 A;  4C3H B;  2A74 C;  2KJX A;  2TMP A;  1Q81 C;  4X3U A;  1E7Z A;  2XIW A;  3RLF A;  3Q22 A;  5JEA G;  1IBL Q;  1GJX A;  4DR5 Q;  3EQL C;  1NY4 A;  4NMZ A;  5IP9 H;  3OPO A;  2RHS B;  1Y1V H;  1KQS A;  1VF7 A;  3RN5 A;  5CMD A;  1JOK A;  5C4H A;  5CV9 A;  2R7Z H;  1W3S A;  3PIP A;  3S14 B;  4DUZ Q;  4IOA A;  1SR3 A;  5C44 H;  5LMN W;  1B9M A;  1HR0 Q;  3PGZ A;  1QOH A;  3HG9 A;  3VYR A;  4X3S A;  3C1F A;  3H09 A;  3NEM A;  1KIX A;  1Y14 B;  3H0G B;  2F0P A;  2SNS A;  3QOJ A;  4RA8 A;  2QEX A;  4N8X 1;  2A5H A;  3EIV A;  1WTW A;  2WAQ E;  1QIL A;  1HNX L;  1I94 L;  4N9T A;  2E2I B;  4TQU S;  5IP7 H;  2F0V A;  3G48 A;  5FLX c;  5LMU Q;  1PTO D;  2L1B A;  3S1R B;  1IHZ A;  4PV1 C;  1VQ7 A;  1EY5 A;  3KBX A;  1CA6 A;  2E76 C;  4GN4 B;  5T1G A;  4C3I G;  1Y8P B;  2VS1 A;  3FKI B;  1A8V A;  3K7U C;  1XX8 A;  5E1F A;  3MA2 B;  4QUF A;  5M3M H;  3PIP 3;  2EZV A;  2EQS A;  4DU9 A;  2HDL A;  1K9M C;  3WOF A;  5IGG A;  3I4M G;  1NJI C;  1WCM B;  1QCB D;  1JOQ A;  2ES2 A;  3S16 H;  5EKK A;  2KUM A;  4CHT B;  4GZY C;  5GAH C;  2F3V A;  2N88 A;  4EQN A;  2NVT B;  3L2P A;  2N3S A;  5COR A;  4A3K H;  1DCZ A;  3U4Z A;  1HR0 L;  3L9A X;  2NB0 A;  1BBX C;  4C1N I;  2HT1 A;  3PUW A;  1KXL A;  4PNY A;  2LXJ A;  2RDF A;  1I4X A;  3PQI A;  2E2H H;  2L11 A;  4FXD A;  1KDC A;  4HJ9 A;  3GTQ B;  1CM9 A;  4K5X A;  1Q82 C;  1VMC A;  3WWV A;  1D1K A;  3W5O A;  3HS0 C;  3UDG A;  4IUU A;  1X3E A;  4GKK L;  2OEO A;  1N34 Q;  1B53 A;  3HOU H;  4ILW A;  3M3Y H;  4H13 C;  1LO5 D;  1G8Z D;  4ID6 A;  2CFM A;  1SXT A;  1IW7 D;  4ZK9 B;  1IBM L;  2A6E D;  3KF6 A;  1Y8N B;  1SNM A;  2IPK D;  1OXX K;  1ZYR C;  2F0W A;  4DV7 L;  4KKU A;  3AYH B;  4IFD I;  1DGS A;  4DV0 Q;  1TY0 A;  2F03 A;  4S3S A;  1LV9 A;  2YV5 A;  1TS3 A;  3R93 A;  1M90 C;  4M1U B;  4CDE C;  2VUM G;  5M5Y B;  1KAW A;  3CC4 A;  4IUQ A;  2Q2I A;  5H1S E;  3J7Z C;  3DMU A;  3SDZ A;  1NMF A;  1BR9 A;  1CSQ A;  2G9H D;  5GAD C;  3DWA A;  2NYZ D;  1SLJ A;  4XYO A;  3ULJ A;  1DYQ A;  4L5R C;  2BCO A;  3M4Y A;  4DV1 Q;  1KC8 C;  4HCS A;  4TSS A;  3NBI A;  3AMU A;  1WTQ A;  1EY4 A;  1HFN A;  4DK1 A;  1CZW A;  2WB1 E;  1H9S A;  1UEB A;  3ZYY X;  1LTA D;  1JE4 A;  4JG2 A;  1IBK L;  2K01 A;  1WVL A;  2XVS A;  2OTJ A;  4RMF A;  3TEH B;  1NR2 A;  1JWM D;  4DAM A;  4BY7 H;  2QA4 A;  2UUB L;  1EIY B;  1EY0 A;  1J9O A;  4C3I B;  3GTK H;  2NVX B;  5IYD G;  2RSO A;  3NXW A;  4RCO A;  2NWG A;  2Z8L A;  4K0K L;  1NCV A;  3GTJ B;  4IFD J;  3FPU B;  2N49 A;  2Z6K A;  3I4M B;  2J4X A;  3I4N H;  5AJ3 Q;  1ESF A;  5DAU A;  2PO4 A;  3IKJ A;  2FMM A;  3AEV A;  1E2V A;  3NTI A;  2NTS A;  1LT5 D;  1IKL A;  3A56 A;  4MTN A;  3ULL A;  2YTY A;  5JJK A;  1VQP A;  4X65 L;  1GD7 A;  3PUZ A;  2VXW A;  1D1I A;  3P75 A;  1QUQ A;  4C3J H;  2DNE A;  4BXX G;  3H3V H;  3LNN A;  4RCN A;  2AQ1 B;  1X56 A;  1LAC A;  1X3P A;  4X3K A;  3S17 H;  2Z6K C;  1R4P B;  1MGS A;  1UE7 A;  3KF6 B;  1N33 L;  1Z47 A;  4P75 A;  1Y8O B;  4DAY A;  3JAM i;  1UEA B;  4PQX A;  2XWB B;  1F77 A;  3D6C A;  2C5C A;  3HOY H;  1QG7 A;  1EEF D;  5C3E G;  1LLR D;  2CH4 A;  4A3M H;  4QQB X;  1EWC A;  3Q8D A;  4LAA A;  1CZG A;  3J80 i;  3RD4 A;  4RGN A;  1DOM A;  2JXM B;  5C5L A;  1XTD A;  2OQ0 A;  5HY6 A;  3NEL A;  5LHY 1;  3UDF A;  5CV7 A;  4A3F G;  4DV2 Q;  1KLG D;  1J6Q A;  3TP8 A;  3FMC A;  2R6G A;  3DLL A;  3MTS A;  5EBC A;  1PYW D;  1PMR A;  4B3S Q;  3OWF A;  1Q86 C;  4B3M Q;  2ZJQ A;  4KK7 A;  2CHB D;  3T56 B;  2G9D A;  1SBB B;  1CQV A;  4IO9 A;  2VUM B;  1A3V A;  4LF5 L;  2K5Q A;  1XNQ Q;  1TWH B;  2F0O A;  3K5N A;  3VYU A;  1HA6 A;  1CHP D;  1SMY D;  5M5X B;  2F3I A;  4DKA C;  1XYI A;  1H9S B;  1MI2 A;  4HSP A;  2B2Y A;  1VQ4 A;  2CWP A;  1S4Z A;  1Z6H A;  1BF4 A;  1GO3 E;  3TQY A;  1ZKO A;  3LGJ A;  3MWY W;  1G6P A;  4DR7 Q;  1LYL A;  3PV0 A;  1XPO A;  1TWA H;  2K5D A;  5IYC H;  4ZYS A;  3DM3 A;  4BY1 G;  5C0X G;  1Q12 A;  1XNR L;  2R92 G;  3T1Y L;  3A5U A;  3I7F A;  2JQO A;  2FXQ A;  4ME3 A;  5G3L F;  2B63 H;  1Q1B A;  1HNZ L;  3TP6 A;  4JI8 L;  5LMN L;  5KNB A;  3GO5 A;  3VYT A;  4FNF A;  1FD7 D;  4BBS H;  2MO1 A;  4K5V A;  1EIG A;  3SE0 A;  1ILQ A;  4O2D A;  4FP5 D;  3OWE B;  5EJW A;  1SE2 A;  2DNC A;  4R4O A;  1WTP A;  3R2I A;  2C9O A;  1QUQ B;  3A8I E;  4DK0 A;  4R8N A;  4IUT A;  4KHP L;  2A6H C;  2ENB A;  1KDB A;  3CCJ A;  4A75 A;  4RGO S;  2WFW A;  3WDN A;  4JI0 Q;  3PO2 H;  2Y0S B;  4DAY B;  4H02 A;  3K58 A;  4LW1 A;  5KNC A;  1I50 B;  1AE3 A;  4A3D H;  2VNU D;  2K32 A;  2ZM6 Q;  3OTO Q;  1UE5 A;  1XNQ L;  2AQ2 B;  2NZ1 D;  3TRE A;  5KEE A;  4EX5 A;  1LTT D;  4LWC A;  2HUG A;  4X66 Q;  1FNU A;  2A8V A;  2EY6 A;  1AP0 A;  2NTT A;  2F0N A;  4DR3 Q;  3HGB A;  4EQP A;  4DR4 Q;  1FL0 A;  3K7A H;  1RTO A;  1YHQ A;  4H0L C;  1C0A A;  1PH8 A;  2KCC A;  5C3E B;  1VQ6 A;  1HPC A;  5AFW A;  1JE5 A;  2ZJP A;  5I4D A;  4IPG A;  3HKZ G;  4MTK A;  1SNC A;  1EZ6 A;  2R61 A;  2F4I A;  2QEJ C;  4NXM L;  4A3F B;  4A3C G;  4DV4 L;  1AH9 A;  4FF3 A;  1EQQ A;  3JC6 6;  4PMC A;  2VL6 A;  2EDG A;  3UDX A;  1IL8 A;  1YHB A;  2MGS A;  4OEL B;  2CW0 D;  2X6L A;  4OWW B;  3SGI A;  1AEX A;  3FEW X;  2GVA A;  2NZO A;  2A1A A;  4JPB W;  2EOT A;  2F3W A;  1TS2 A;  4XT1 B;  4OX9 Q;  2RF4 A;  3CP0 A;  2JA7 G;  1Z7T A;  1PTO C;  3KUP A;  1B70 B;  2LSS A;  2VQE L;  4BY1 B;  3QIA A;  4A4I A;  4QCL A;  3OTO L;  1E1T A;  1S5D D;  1R9T B;  2R92 B;  4L63 B;  1PHJ A;  2CCZ A;  3HOV H;  2Q8T A;  5I9O A;  1UNS A;  1WTH A;  2RDH A;  3GTP B;  2D0O A;  5J1Z A;  1BQQ T;  4GOP A;  1VS0 A;  3GTG B;  4DR3 L;  4F7X A;  1S5B D;  3S24 A;  1QJO A;  2NZH A;  4N9P A;  3I3C A;  4HMI A;  4QIW E;  1VF5 C;  1WFQ A;  1NSN S;  2L55 A;  1PLF A;  3AU7 A;  1NE3 A;  5JVG 3;  1WTX A;  2QIL A;  4JVZ A;  5JPM C;  3S2D H;  1QZG A;  1EYD A;  5HGQ A;  2J0T D;  3MXP A;  3CC7 A;  4DR2 Q;  2QKI C;  2A19 A;  4RAU C;  3AQQ A;  1F2M A;  3GTM H;  2CH4 W;  5C4X G;  1VQB A;  1RHP A;  4WFN 3;  4DV6 L;  1WJJ A;  1JMC A;  2EYO A;  5C4J B;  4JI7 Q;  3H6M A;  1K83 H;  3GP7 A;  1XMO L;  4P74 A;  1BVS A;  4L5S A;  3KJO A;  3FDT A;  4BWG B;  2N55 A;  1EUJ A;  3CCM A;  2AWN A;  4DFA A;  3CU7 A;  5E4W C;  1CI3 M;  2B2W C;  2UXC Q;  5IT9 L;  1L0W A;  2A6E C;  2PMZ E;  2PQE A;  1N32 L;  1E2W A;  3LWE A;  4GS3 A;  2RCF A;  3HKZ B;  3TZD A;  3RLN A;  5FO7 B;  4X64 L;  3RZD B;  1SNP A;  2N8N A;  3J7A 5;  5IP9 G;  1Y1V G;  1GUO A;  1DOK A;  1D8L A;  1STN A;  4JI6 Q;  2KCM A;  4DV5 L;  3GD7 A;  1LTI D;  2RA4 A;  5TSS A;  4JBK A;  2B39 A;  1MHW C;  3JAM E;  2JE6 I;  2VQF Q;  3BG3 A;  3E0E A;  5C44 G;  1X55 A;  1MKH A;  1PH4 A;  3KOJ A;  2F0S A;  1A63 A;  2KCN A;  1WYD A;  4P73 A;  3NHH A;  5JAV A;  3W1G A;  2M2L A;  1YEZ A;  2N78 A;  3NK9 A;  3J80 E;  1M8A A;  4GOP B;  4IJL A;  2WKC A;  3ICE A;  4HJ7 A;  1I4H A;  1PTO F;  3K57 A;  2Q8I B;  3NTK A;  5IY0 A;  4JI7 L;  3SHL A;  2JA7 B;  2F0U A;  2OTL A;  1S5F D;  4IFD H;  1I4R A;  4J8Q A;  1J5E Q;  1PZK D;  3M4O B;  1U5K A;  5CV4 A;  2D2C C;  3J7Y W;  1D7Q A;  4HR7 B;  2EXD A;  4A3J G;  2JA8 H;  1XTC D;  4YWL A;  3U50 C;  4ODG A;  2VB3 X;  1SDF A;  3A74 A;  5E4X A;  1A15 A;  2E2D C;  3NP8 A;  3TBI B;  4UY8 C;  3STB D;  5BR8 L;  5ELF A;  1LT3 D;  2RQX A;  2EYH A;  3F2C A;  4G7Z C;  1I3Q H;  3C3L A;  2E2J B;  5E7N A;  3RMH A;  3PIO A;  1PVO A;  4DV3 L;  1QNK A;  1FR3 A;  1TKW B;  3GTL H;  1C9O A;  2TSS A;  1DD2 A;  4FF2 A;  2EJG C;  1KDA A;  1IYJ B;  4JCV E;  1R4Q B;  2K05 A;  5CC4 A;  4A3K G;  1BO0 A;  2IHF A;  2Y0S E;  4WRD A;  4LK1 C;  4OEM B;  3TZU A;  2MHV A;  2M9V A;  5ELO A;  1AE2 A;  1BOS A;  4KHV A;  2YU9 H;  1IL2 A;  1GHJ A;  2D0P A;  1SE8 A;  1ENC A;  5JJI A;  1PH7 A;  3SK8 A;  3FVQ A;  1A0I A;  1STA A;  3VR6 A;  2LMC B;  2JJQ A;  1M4V A;  3F2D A;  1HNX Q;  1I94 Q;  3HOU G;  4Y52 H;  3IFT A;  2R7D A;  4OIK A;  1PH9 A;  2EY1 A;  1X3Q A;  3R8B A;  4FXK C;  3EFX D;  1RDP D;  2A69 D;  4A3I G;  4LF7 Q;  1Y1V B;  1LTB D;  1NBW A;  4DR1 L;  4CDC C;  3BDO A;  1WTR A;  1SMY C;  2EIF A;  3BDL A;  1ENA A;  1LUZ A;  3I73 A;  3S1Q H;  2JN4 A;  4OGQ C;  5EPJ A;  4LFA L;  2RSN A;  1KNE A;  2JA5 G;  3M4Q A;  2IWH A;  3JAM L;  3M7N A;  3K81 C;  2K7V A;  4JBJ A;  4CBV A;  2BDN A;  2FIN B;  3NPP A;  1LAB A;  1GXD C;  5FOB B;  4DA2 A;  2O5I C;  1TII D;  1K8M A;  3CD6 A;  4A3J B;  3TP5 A;  5ELC A;  1SE4 A;  1EYA A;  4HJA A;  1YVC A;  3F8T A;  2ICI A;  1KTK A;  2WKD A;  1W6K A;  3FHW A;  3Q23 A;  3UE0 A;  2KHS A;  5C3X A;  3J7A F;  4GKK Q;  2SDF A;  4BY7 G;  1P16 A;  4JK1 C;  2KVM A;  4RHS A;  1SRO A;  2QGQ A;  3J81 L;  1IBM Q;  3KLR A;  5C0X I;  4LF7 L;  1PDQ A;  3I4N G;  1B3Q A;  4DV7 Q;  3HRZ C;  1A3U A;  3S16 B;  2MNA A;  1J8I A;  3D4R A;  3A7L A;  1Q7Y C;  4POF A;  1CHQ D;  5FO9 B;  1V1P A;  4IPD A;  1O80 A;  4JOI A;  4R4Q A;  3M4P A;  1PXU A;  4A3K B;  4JV5 L;  1V43 A;  3QWN A;  4IPH A;  1LM0 A;  1RJT A;  4C3J G;  1I6H B;  2E2H B;  3AFP A;  5J22 A;  5JVH 3;  2ZXO A;  3HOW B;  3QOL A;  1QE6 A;  1ZXT A;  1EY9 A;  2E5L L;  2SNM A;  3K80 C;  4QMG A;  1F2L A;  2ZXP A;  3HOU B;  3HOY G;  4ABN A;  4NPS A;  3L7Z C;  4JOI C;  2KHI A;  2D5D A;  4A3M G;  1GM5 A;  3S1R H;  3OSO A;  2LKV A;  1JOO A;  1EQT A;  4FF4 A;  1K0R A;  1O78 A;  4A3I B;  3CCL A;  4ME5 A;  3HKZ E;  1GUT A;  5M5W H;  3S9W A;  1EOT A;  1IBK Q;  3BVZ A;  3HOZ H;  2NVQ B;  4O42 A;  5GAG C;  1ONL A;  2UUB Q;  3CPF A;  4K0K Q;  3EA6 A;  1WCM H;  4FVM A;  2JA5 B;  1FYC A;  4K14 A;  1QNU A;  4TRD A;  1VQ5 A;  4LF4 Q;  1KRT A;  4LNQ A;  2NVT H;  1JWS D;  4ZUI A;  1O7Y A;  4RKB A;  4IUP A;  4HTH A;  3ND9 A;  1I4P A;  4HID A;  1HA5 A;  4X65 Q;  1WD1 A;  1PYS B;  2JA6 H;  3SR1 A;  2HCC A;  3H91 A;  4EQO A;  1YNN D;  3GTQ H;  3ULP A;  3I4L A;  4DNR B;  4K5W A;  2O2L D;  1HCZ A;  1XPU A;  3IAY A;  1WI5 A;  1O7L A;  1N33 Q;  2F0H A;  5KGU A;  3CCR A;  1SFO H;  4LF9 L;  5JEA H;  1NMG A;  4BBS G;  1O7Z A;  2HQE A;  2OQK A;  4ZKC B;  4BY7 B;  4GN3 B;  1V1P B;  4X62 Q;  2KA7 A;  1KAA A;  3GTK B;  4LF8 L;  4KY6 A;  4JI5 Q;  1SYB A;  1VDZ A;  1EOV A;  2JA9 A;  3HFZ B;  1GUG A;  4HED A;  4JI3 L;  2F4V L;  4N8F A;  1F9R A;  1KL9 A;  4UHV A;  4JI4 Q;  4H7B A;  2F52 A;  3PO2 G;  4I7A A;  2BH2 A;  4DGZ A;  3GV6 A;  2F0G A;  5KRU A;  5BN5 A;  3I8Z A;  1JJ2 A;  4LF5 Q;  1TWF B;  3SK4 A;  5I2X A;  4C3J B;  2K6A A;  1U4L A;  3GDE A;  3MFY A;  4O1N A;  3AFQ A;  1PRT B;  4LF4 L;  3S17 B;  2FHT A;  3H94 A;  4ZUJ A;  1I6V C;  5IWA Q;  1YNJ D;  2JK8 A;  3H15 A;  1XJV A;  3X3M A;  4JYA L;  3MEH A;  2G5D A;  1HZ9 A;  3MXG A;  2RBM A;  1IKM A;  1GVP A;  2NVY H;  3HZX A;  3B6Y A;  3NQT A;  4J15 A;  4MIU A;  1XNR Q;  3T1Y Q;  1QVF A;  2E75 C;  2GVB A;  4KN7 C;  3N52 A;  4OL7 A;  4A3M B;  1HTP A;  2GA4 B;  2CQO A;  1HNZ Q;  1B9N A;  4JI8 Q;  5LMN Q;  3IL8 A;  3VR5 A;  4IQZ A;  2L4N A;  1DXM A;  3S15 B;  3N6R A;  1MSG A;  2OF1 A;  4Q0F A;  2EE1 A;  2IJ0 A;  5EKL A;  4DNT B;  2K5H A;  1U4P A;  3CRL C;  1ENF A;  4V0B A;  4X62 L;  4BBR H;  3HOX H;  3I4M H;  4JI5 L;  1DOL A;  4KHP Q;  4R4T A;  2YYZ A;  1M1K C;  2JYO A;  3VYS A;  1PRT F;  4PZ7 A;  1CFM A;  4DK6 C;  2KEC A;  1SNO A;  2JEA I;  3GTO H;  4JI4 L;  3J7A V;  3BYY B;  4EVO A;  3FPP A;  5A35 A;  1MD2 D;  5FKA C;  1JJG A;  1CK1 A;  1BBU A;  4K6L A;  5FO8 B;  1U4R A;  1Y1W G;  5M3F H;  2EYF A;  2PW5 A;  1H9K A;  3STB C;  2I5H A;  4YHH Q;  3HOV G;  4EGV A;  1D5Z C;  1EQV A;  3E9H A;  1HFG A;  3T13 A;  5IWA L;  2K4K A;  2Q8R E;  3ERQ A;  3VR3 A;  1TWG H;  3CPW A;  2NUC A;  1OTC A;  4BBS B;  2KBN A;  3S1N B;  2OT2 A;  3D8G A;  3TDQ A;  2NN6 G;  4A3L H;  1TWC B;  2SEB D;  4KLK A;  3S1M H;  3SK5 A;  4HIO A;  2I5L X;  4NXM Q;  1IYV A;  4DV4 Q;  4QB4 A;  1HZA A;  2B2Y C;  2HCI A;  1MSH A;  3T1H L;  4ULL A;  3PO2 B;  1JCK B;  4RH6 A;  3ZJY C;  1EIF A;  1UE1 A;  1BCP B;  4Q5V A;  3RLO A;  1STB A;  2DGY A;  5M5X H;  3F1Z A;  2Q2H A;  4P71 A;  2WAQ G;  1K3B C;  1VQI A;  3P1H A;  1VQC A;  2EYP A;  1PH5 A;  3LX0 A;  1VQ9 A;  5J3B A;  4A3G H;  2FFK B;  4YCW A;  1X6O A;  1PZI D;  3NUC A;  1EYG A;  2A69 C;  5BN3 A;  2CVR A;  2XGT A;  2VQE Q;  1Q8K A;  2EPB A;  4B9W A;  1BBW A;  2LXK A;  4YHH L;  1SYE A;  2I5M X;  1HNW L;  3MXU A;  1PA6 A;  4ZRZ A;  2EY5 A;  3AB9 A;  2IY5 B;  5C5M A;  1SMX A;  1BCP F;  4RG1 A;  3G4S A;  2O5J C;  1GKH A;  1SYF A;  4AQY L;  1A6X A;  4GKJ L;  1H9M A;  2B2V A;  2MQH A;  1SEB D;  4DAV A;  2Z1C A;  1L2F A;  1D2B A;  2MFI A;  5T1I A;  2EVB A;  1C8C A;  1I50 H;  3BVG A;  5IGB A;  5JPN C;  4DV6 Q;  1UAP A;  3I70 A;  1CTM A;  1XMO Q;  2M00 A;  3VA5 A;  4K2L A;  4IFD G;  1Y1W B;  3PSI A;  3R3O A;  3E9I A;  1D5X C;  5DLQ E;  1YNX A;  1TR5 A;  1CSP A;  2B2V C;  5DM6 3;  4XIG S;  2JA8 G;  5I2Y A;  2RKS A;  1AZP A;  1ET9 A;  3SVM A;  3W1B A;  3OIQ A;  1XMQ L;  4R4I A;  3OIP A;  4BA1 I;  3BS1 A;  4DNI A;  2UU9 L;  4A3B H;  1EU4 A;  1H9J A;  2L12 A;  1N32 Q;  1IYU A;  1PRT D;  4JBW A;  4UP9 A;  2K14 A;  1EYC A;  1HJP A;  4YCU A;  4X64 Q;  1YHA A;  5EPL A;  4G57 A;  3I91 A;  4KY5 A;  4NKL A;  3T51 B;  2L5T A;  1STE A;  1Q1E A;  2LS0 1;  1V1Q A;  3HKS A;  1EIH A;  2PNH A;  4DV5 Q;  1STH A;  4TKO B;  3GTM B;  1H95 A;  5ELE A;  2PZW A;  3I72 A;  1S5E D;  1K83 B;  2AKW B;  4ALP A;  3A8K E;  5EGT A;  1X65 A;  4F88 A;  4ZKB B;  2F0T A;  4KI0 A;  1IZ6 A;  3NEN A;  4R4C A;  1AN8 A;  2EYM A;  2F0J A;  3QR8 A;  1N36 L;  4A3E H;  4RGT A;  2VY3 A;  3U4V A;  4GOP C;  3PO3 H;  5FJ8 H;  2EJM A;  3X3N A;  2IL8 A;  4BY1 H;  4J1M A;  5IT9 c;  3PF4 A;  1OXV A;  3EJI A;  2R92 H;  5JEA J;  1CUK A;  4OO1 G;  3GTG H;  1KAB A;  1YJN A;  1G29 1;  2HIX A;  1EY7 A;  1S3O A;  4FYD A;  1W6J A;  4DK3 C;  1GUN A;  1IW7 C;  2WII B;  1TT2 A;  4M8A A;  5BR8 Q;  3CCE A;  4C2M H;  5GQO A;  1EQR A;  1JOR A;  4U68 A;  2PI2 A;  3DXJ C;  1PFB A;  1FNW A;  2ICE C;  3OMC A;  3NWS A;  3VR4 A;  3BZK A;  4DV3 Q;  2HD3 A;  5C4J H;  3G7L A;  2XN9 C;  3QO2 A;  4AH6 A;  1YNN C;  1W2B A;  2R7Z G;  2UUA L;  2K5V A;  1ML0 D;  4NW2 A;  4KMU C;  4POG A;  4DPG A;  1JC7 A;  2Z6B A;  4F8M A;  3S2H B;  3CCV A;  2PW7 A;  3DWP A;  1VQM A;  1EU3 A;  3BZD B;  1ICF B;  4Y7N B;  4JBM A;  1FJG L;  1RCV D;  1E24 A;  1TS5 A;  3NSW A;  2B2T A;  2JA8 B;  4CJ2 C;  1JQY D;  1SND A;  1BCP D;  1PTO H;  3RZO B;  2L0C A;  5M9O A;  5KYI A;  3T16 A;  4ZCK A;  1YBY A;  3RR5 A;  4AYB G;  3KLW A;  3Q6S A;  4QF4 A;  1T5E A;  3L3O C;  4P2C B;  1UE6 A;  1PFM A;  2A68 D;  2KOL A;  1I5F A;  2EY2 A;  5IP7 G;  2UXB L;  4R9W A;  1U0L A;  3O13 A;  4J6H A;  4K8J A;  1I3Q B;  2OXP A;  4CKE A;  3FRP B;  3QG1 A;  1HXY D;  3OW2 A;  2BA0 A;  2Z4I A;  1QB5 D;  4GNX A;  1BUV T;  4DR1 Q;  3RUZ A;  1MBY A;  2RHQ B;  3RNU A;  1B50 A;  4B3R L;  3P20 A;  4F87 A;  3C2P A;  4IJH A;  1YNJ C;  1WTO A;  4KTA A;  1SN8 A;  2E74 C;  2F0I A;  4LFA Q;  2PZT A;  2HHH L;  5M3M G;  3MEF A;  3TP7 A;  3TN2 A;  4DUY Q;  5FLM H;  1JWU D;  4CDF C;  1TU2 B;  2YU9 B;  5C4X B;  3CQZ H;  5JOB A;  5CYU A;  5I9P A;  4GNX C;  2R93 H;  1BDO A;  4NXN L;  4DR6 L;  1PH1 A;  4ZAI A;  5K36 H;  1E22 A;  4JI1 L;  3Q0A A;  3A54 A;  4NB3 A;  2I07 B;  1F9S A;  1MJE A;  5FLX E;  1B2T A;  2L9H A;  3M9B A;  1VQE A;  1JB7 A;  5CV6 A;  1HH2 P;  2B3G A;  4LF6 L;  1VQO A;  3HOZ G;  5IGE A;  1PZJ D;  3K5M A;  2QDL A;  2Z9H A;  4CJ0 B;  5IOD A;  3S1Q B;  1CKN A;  3UI2 A;  3A5Z B;  5EPK A;  4YWM A;  1WCM G;  1EWH A;  3CRK C;  4UP8 A;  3P7J A;  5IYB H;  2XTI A;  4JI2 Q;  2E8G A;  5ISR A;  2Q2U A;  2OCE A;  3PIO 3;  4A93 H;  2R7Z B;  4XYQ A;  4UPA A;  2B8G A;  1PFS A;  1CT1 D;  1GOZ A;  5I6Y A;  5C44 B;  4JV5 Q;  1OO9 B;  2X69 A;  2R7F A;  2JA6 G;  2BE5 D;  3V05 A;  4QJF A;  1YIJ A;  4DUY L;  2CKZ B;  2J7Z A;  4OHJ A;  5ELB A;  4DF7 A;  3K0X A;  3CXC A;  4GNX B;  1PV4 A;  2IX0 A;  3TME A;  4AYB B;  2DN8 A;  3SK6 A;  1SYD A;  2IW3 A;  2E5L Q;  1STY A;  1HQM C;  2KEN A;  4R1J A;  2QW7 A;  3J80 L;  2AWO A;  3T53 B;  4A76 A;  4CJ1 B;  1K28 A;  1OXS C;  3CCS A;  4C3H H;  2ZJR A;  2F0F A;  3J81 c;  5CR3 A;  1I4Q A;  3TRZ A;  1ET6 A;  1JT8 A;  4DN4 M;  2VB2 X;  1YJ9 A;  4HMJ A;  4KJN A;  2AUJ D;  4XDX A;  3RN2 A;  1EFW A;  2PPB C;  1KNA A;  1NUC A;  5CV8 A;  1PH2 A;  1G2S A;  3A8J E;  3KDF B;  1UWV A;  3A0J A;  3A55 A;  5F2D A;  4K8I A;  1G91 A;  3K8A A;  2IHE A;  1KRS A;  5M3M B;  1CKM A;  4LUV A;  3DHQ A;  2B29 A;  2MUY A;  4IOC A;  1T5X D;  1S5C D;  3VR2 A;  1X3G A;  3S14 H;  2NN6 I;  4FDB A;  1N9W A;  5DNF A;  4JI2 L;  4LFC L;  1PH3 A;  4RFB A;  2WIN B;  3QJY A; 
#chains in the Genus database with same CATH homology
 2EYL A;  2K5W A;  3D31 A;  4DXG A;  4H44 C;  5D3I B;  2K1B A;  1FNV A;  2XNA C;  5M5W B;  3KF8 A;  2XSC A;  2WP8 J;  3HOZ B;  5IGD A;  3M3Y B;  5FLX L;  1F2Y A;  1JB3 A;  4IN3 A;  3C46 A;  2LY7 A;  3NBH A;  2HDM A;  5EBD A;  1ROD A;  2CW0 C;  2K03 A;  2ID0 A;  4CKB A;  1RF2 D;  1EFI D;  3DM1 A;  5JJZ A;  3M85 A;  3OOC A;  4ZLT F;  1G2T A;  4NDX A;  5COY A;  5C0X J;  1E0B A;  3PUY A;  1HQR D;  1NAP A;  4UAI A;  2JA6 B;  3G6J B;  4FXG C;  3H3V C;  1V8Q A;  4L6T B;  1PRT C;  4WOR A;  5K5P A;  1SFO B;  2BDO A;  2ZXR A;  3U9S A;  4RKL A;  1HRJ A;  3WOE A;  3PUV A;  2JEB I;  1G6Z A;  1CA5 A;  1B3A A;  3DUZ A;  3D3R A;  2H4O A;  3E0J A;  3M7G A;  4XQN A;  2D9U A;  2KED A;  1GUW A;  3ONA B;  1UUP A;  5D3D A;  1SJE D;  3I4N B;  4V19 0;  4Z9C B;  2JP1 A;  4CGY B;  3E5S A;  2NVY B;  3OMG A;  2B2U A;  2IT1 A;  1A2U A;  1K8O A;  1A2T A;  4QIW B;  1LT6 D;  1VMP A;  5CV5 A;  2F0D A;  2NBF A;  4PMB A;  2PZU A;  3MFG A;  5A2Q E;  3MZ5 A;  4CKC A;  3HOY B;  2X6G A;  3MXN A;  1AFP A;  4BBR B;  5C4Z A;  3HOX B;  2B2U C;  4OIJ A;  4KKS A;  1LTR D;  3NE5 B;  3GTO B;  5HUR A;  4PMW A;  4OO1 I;  1BXT A;  1B1Z A;  5NUC A;  5FK9 C;  4KHZ A;  1BCP C;  2XRS D;  3LWU A;  4KD4 A;  4IUV A;  3R2T A;  5M3F B;  3ND8 A;  2PMZ B;  4KJO A;  2A68 C;  1E2Z A;  3W2D A;  3KK7 A;  1BNZ A;  1FGB D;  2AQ3 B;  1U9R A;  1EL0 A;  1DON A;  1TWG B;  3OW7 A;  1HUN A;  1TWA B;  2KEE A;  2RDG A;  4XTC S;  3MHB A;  2FJ2 A;  5C6A A;  2F0M A;  2KQ3 A;  4XT3 B;  2B63 B;  1SYG A;  3V96 A;  3EVQ A;  5LL6 X;  1C4Q A;  2MP1 A;  3S1M B;  4RGM A;  5KYL A;  1ZEQ X;  2PNR C;  3KBG A;  1TY2 A;  4G4K A;  4UDU C;  1RD9 D;  4YIJ A;  5DM7 3;  2F1M A;  4K2K A;  3MAQ A;  3DEO A;  1L0X B;  2V4D A;  4G7H C;  3BYT B;  4XXE A;  1HTL D;  2BOS A;  1SJH D;  2SOB A;  4A3G B;  3SXH A;  2MJ8 A;  5D14 A;  4A3D B;  1ILP A;  1F9P A;  4L8J A;  5KND A;  3BVM A;  1EZ8 A;  4KV6 A;  1HHV A;  1WD0 A;  4C56 C;  2WV6 D;  5E3F A;  1U4M A;  2EYJ A;  1SYC A;  1XWE A;  4KKT A;  3KLS A;  3K7A B;  3GV3 A;  4KD3 A;  3K59 A;  1ESR A;  2K33 A;  3MVV A;  3VA7 A;  1V1O A;  3K0Y A;  4RWS C;  5A2Q L;  2K04 A;  3GQB A;  1STG A;  3CHB D;  1WTV A;  2R3Z A;  3QB3 A;  2XRQ D;  1ICW A;  2QCP X;  3D4D A;  2BE5 C;  1VCI A;  1SE3 A;  3NQI A;  1F2Z A;  3CKI B;  2Z4H A;  4LMQ D;  1L0Y B;  3K5L A;  1F9Q A;  5IT9 E;  4WJW A;  3HEJ A;  4KY7 A;  4X3T A;  2XWJ B;  3C1E A;  3DWQ A;  1DJR D;  4BS9 A;  5LL6 S;  1JR0 D;  4B9X A;  1JIC A;  2IX1 A;  2WAC A;  4A3B B;  2MPM A;  3K6O A;  2DY8 A;  1I4G A;  3HOV B;  3V2T A;  3IFD A;  1H9R A;  4DXF A;  2F0K A;  4LJZ C;  1AW7 A;  4RHR A;  3NTH A;  1NR4 A;  5IIF A;  2CQA A;  5DEH A;  2AUK A;  3PUX A;  2QDB A;  3S2D B;  1SSO A;  4C1N K;  3E6Z X;  4A3E B;  1LT4 D;  3OHX C;  3PO3 B;  3D4W A;  4K6D A;  3ERO A;  1ZYR D;  4ZQ3 A;  2PYK A;  5IGF A;  1HUM A;  5IGC A;  1TQO A;  4XQJ A;  5K36 G;  2WAQ B;  4R8I A;  3TSS A;  1DM0 B;  1OXT A;  2B8F A;  5C0X H;  2NN6 H;  5D65 A;  1RKN A;  4C2M B;  2O4X A;  4HAE A;  4I65 A;  3Q24 A;  2B2W A;  4IZ8 A;  1X32 A;  2PCF B;  2JSO A;  5G3L D;  1SNQ A;  1EEI D;  2LFN A;  5EKI A;  4HCE A;  1SAP A;  2FMC A;  1D5M C;  1QWY A;  3ITP A;  2I46 A;  1Y69 U;  3DEP A;  3PMF A;  4HSV A;  2QF7 A;  1PTO B;  4IAL A;  2BA1 A;  5KIX A;  2EJF C;  4IUR A;  3F2U A;  4NP5 A;  1C48 A;  3U9O A;  5IOC A;  1GUS A;  4C3H G;  3I90 A;  1EY8 A;  2F0Q A;  4G7O C;  5I6W A;  2H1E A;  4IUN A;  1AZQ A;  5C3W A;  4QUC A;  3W3A A;  2F0L A;  1XXG A;  2B2T C;  2D62 A;  5EQ0 A;  3CQZ B;  3GTL B;  2F0E A;  1Q90 A;  5CBE E;  4E6I A;  1RTN A;  2R93 B;  3URY A;  1D6E C;  1A3T A;  5HGT A;  1PFN A;  1TS4 A;  2RVL A;  4DAP A;  3J81 E;  2WB1 B;  5ELD A;  3A7A B;  1GHK A;  4B08 A;  4FF1 A;  3MC0 B;  1II3 A;  1Q3L A;  2ZT9 C;  1LTG D;  1EY6 A;  4BA2 I;  1Q8I A;  4U67 3;  2DY7 A;  2K28 A;  1KLU D;  3NWT A;  4A93 B;  5J39 A;  1DZ1 A;  1LTS D;  2A73 B;  2IX3 A;  3HP3 A;  3K5O A;  1B4O A;  2EXZ A;  3BDC A;  3KLS X;  3T4A C;  4I7Z C;  2A6H D;  4MN3 A;  1TVX A;  4FO2 A;  4HN7 A;  1CQF A;  1B44 D;  4MHE A;  5BN4 A;  4KN4 C;  4OO1 H;  3D6W A;  1OXU A;  5CGK A;  4XQQ A;  3SEB A;  5CBA E;  4C3H B;  2A74 C;  2KJX A;  2TMP A;  4X3U A;  2XIW A;  3RLF A;  3Q22 A;  5JEA G;  1GJX A;  3EQL C;  4NMZ A;  3OPO A;  1VF7 A;  5CMD A;  1JOK A;  5C4H A;  5CV9 A;  3S14 B;  1B9M A;  1QOH A;  3HG9 A;  3VYR A;  4X3S A;  3C1F A;  3H09 A;  3H0G B;  2F0P A;  2SNS A;  3QOJ A;  4RA8 A;  2A5H A;  1WTW A;  1QIL A;  4N9T A;  2E2I B;  4TQU S;  2F0V A;  1PTO D;  2L1B A;  3S1R B;  1IHZ A;  4PV1 C;  1EY5 A;  3KBX A;  1CA6 A;  2E76 C;  5T1G A;  4C3I G;  1Y8P B;  3FKI B;  1XX8 A;  5E1F A;  3MA2 B;  4QUF A;  2EZV A;  3PIP 3;  4DU9 A;  2HDL A;  3WOF A;  5IGG A;  1WCM B;  1QCB D;  1JOQ A;  5EKK A;  2KUM A;  4CHT B;  4GZY C;  2F3V A;  2N88 A;  4EQN A;  2NVT B;  5COR A;  1DCZ A;  3L9A X;  2NB0 A;  1BBX C;  4C1N I;  3PUW A;  4PNY A;  2RDF A;  1I4X A;  2L11 A;  4FXD A;  1KDC A;  3GTQ B;  1CM9 A;  4K5X A;  1VMC A;  1D1K A;  3HS0 C;  4IUU A;  2OEO A;  1B53 A;  4ILW A;  4H13 C;  1LO5 D;  1G8Z D;  4ID6 A;  1SXT A;  1IW7 D;  4ZK9 B;  2A6E D;  1Y8N B;  1SNM A;  2IPK D;  1OXX K;  1ZYR C;  2F0W A;  4IFD I;  4KKU A;  1TY0 A;  2F03 A;  4S3S A;  1LV9 A;  1TS3 A;  3R93 A;  4M1U B;  5M5Y B;  4IUQ A;  3DMU A;  3SDZ A;  1BR9 A;  2G9H D;  3DWA A;  2NYZ D;  4XYO A;  1DYQ A;  2BCO A;  3M4Y A;  4HCS A;  4TSS A;  3NBI A;  3AMU A;  1WTQ A;  1EY4 A;  1HFN A;  4DK1 A;  1CZW A;  1H9S A;  3ZYY X;  1LTA D;  1JE4 A;  2K01 A;  1WVL A;  2XVS A;  1NR2 A;  1JWM D;  1EY0 A;  1J9O A;  4C3I B;  2NVX B;  2RSO A;  3NXW A;  4RCO A;  2NWG A;  2Z8L A;  1NCV A;  3GTJ B;  4IFD J;  3FPU B;  3I4M B;  2J4X A;  1ESF A;  5DAU A;  2PO4 A;  3IKJ A;  2FMM A;  1E2V A;  3NTI A;  2NTS A;  1LT5 D;  1IKL A;  3A56 A;  3PUZ A;  2VXW A;  1D1I A;  3P75 A;  2DNE A;  3LNN A;  4RCN A;  2AQ1 B;  1LAC A;  1X3P A;  4X3K A;  1R4P B;  1MGS A;  1Z47 A;  1Y8O B;  4DAY A;  1UEA B;  4PQX A;  2XWB B;  1F77 A;  3D6C A;  2C5C A;  1QG7 A;  1EEF D;  1LLR D;  1EWC A;  4LAA A;  1CZG A;  3RD4 A;  4RGN A;  1DOM A;  2JXM B;  5C5L A;  5LHY 1;  5CV7 A;  1KLG D;  3TP8 A;  3FMC A;  2R6G A;  3MTS A;  5EBC A;  1PYW D;  1PMR A;  3OWF A;  4KK7 A;  2CHB D;  3T56 B;  2G9D A;  1SBB B;  1CQV A;  2VUM B;  1A3V A;  2K5Q A;  1TWH B;  2F0O A;  3K5N A;  3VYU A;  1HA6 A;  1CHP D;  1SMY D;  5M5X B;  1XYI A;  1H9S B;  1MI2 A;  4HSP A;  2B2Y A;  1S4Z A;  1Z6H A;  1BF4 A;  1ZKO A;  3MWY W;  3PV0 A;  2K5D A;  4ZYS A;  5C0X G;  1Q12 A;  5G3L F;  1Q1B A;  3TP6 A;  5KNB A;  3GO5 A;  3VYT A;  4FNF A;  1FD7 D;  4K5V A;  1EIG A;  3SE0 A;  1ILQ A;  4FP5 D;  3OWE B;  5EJW A;  1SE2 A;  2DNC A;  1WTP A;  3R2I A;  2C9O A;  3A8I E;  4DK0 A;  4R8N A;  4IUT A;  2A6H C;  2ENB A;  1KDB A;  4RGO S;  3WDN A;  2Y0S B;  3K58 A;  5KNC A;  1I50 B;  2VNU D;  2K32 A;  2AQ2 B;  2NZ1 D;  5KEE A;  1LTT D;  2HUG A;  1FNU A;  2EY6 A;  1AP0 A;  2NTT A;  2F0N A;  3HGB A;  4EQP A;  1RTO A;  4H0L C;  2KCC A;  5C3E B;  1HPC A;  5AFW A;  5I4D A;  1SNC A;  1EZ6 A;  2R61 A;  2F4I A;  2QEJ C;  4A3F B;  4FF3 A;  4PMC A;  2EDG A;  1IL8 A;  2MGS A;  2CW0 D;  2X6L A;  1AEX A;  3FEW X;  2EOT A;  2F3W A;  1TS2 A;  4XT1 B;  1Z7T A;  1PTO C;  3KUP A;  4BY1 B;  3QIA A;  4QCL A;  1S5D D;  1R9T B;  2R92 B;  4L63 B;  2Q8T A;  5I9O A;  1UNS A;  2RDH A;  3GTP B;  5J1Z A;  1BQQ T;  3GTG B;  4F7X A;  1S5B D;  1QJO A;  4N9P A;  3I3C A;  4HMI A;  1VF5 C;  1NSN S;  2L55 A;  1PLF A;  3AU7 A;  5JVG 3;  1WTX A;  2QIL A;  5JPM C;  1EYD A;  2J0T D;  3MXP A;  2QKI C;  4RAU C;  1F2M A;  1RHP A;  4WFN 3;  2EYO A;  5C4J B;  3H6M A;  3GP7 A;  3FDT A;  4BWG B;  2N55 A;  2AWN A;  4DFA A;  3CU7 A;  5E4W C;  1CI3 M;  2B2W C;  5IT9 L;  2A6E C;  2PQE A;  1E2W A;  3LWE A;  3HKZ B;  3TZD A;  5FO7 B;  3RZD B;  1SNP A;  1GUO A;  1DOK A;  1STN A;  3GD7 A;  1LTI D;  2RA4 A;  5TSS A;  2B39 A;  3JAM E;  2JE6 I;  3BG3 A;  2F0S A;  2KCN A;  3NHH A;  5JAV A;  2M2L A;  3NK9 A;  3J80 E;  1M8A A;  2WKC A;  1I4H A;  1PTO F;  3K57 A;  2Q8I B;  3NTK A;  2JA7 B;  3SHL A;  2F0U A;  1S5F D;  4IFD H;  1I4R A;  4J8Q A;  1PZK D;  3M4O B;  5CV4 A;  2D2C C;  3J7Y W;  4HR7 B;  1XTC D;  4ODG A;  2VB3 X;  1SDF A;  5E4X A;  1A15 A;  2E2D C;  3NP8 A;  3TBI B;  5ELF A;  1LT3 D;  2RQX A;  2EYH A;  4G7Z C;  3C3L A;  2E2J B;  3RMH A;  1QNK A;  1FR3 A;  1TKW B;  2TSS A;  1DD2 A;  4FF2 A;  2EJG C;  1KDA A;  1R4Q B;  2K05 A;  5CC4 A;  1BO0 A;  4WRD A;  4LK1 C;  3TZU A;  2MHV A;  2M9V A;  1BOS A;  4KHV A;  1GHJ A;  1ENC A;  3SK8 A;  3FVQ A;  1STA A;  3VR6 A;  2LMC B;  1M4V A;  3IFT A;  4OIK A;  2EY1 A;  1X3Q A;  3R8B A;  4FXK C;  3EFX D;  1RDP D;  2A69 D;  1Y1V B;  1LTB D;  3BDO A;  1WTR A;  1SMY C;  3BDL A;  1ENA A;  3I73 A;  4OGQ C;  5EPJ A;  2RSN A;  1KNE A;  2IWH A;  3JAM L;  3M7N A;  2K7V A;  4CBV A;  2BDN A;  2FIN B;  3NPP A;  1LAB A;  1GXD C;  5FOB B;  4DA2 A;  2O5I C;  1TII D;  1K8M A;  4A3J B;  3TP5 A;  5ELC A;  1SE4 A;  1EYA A;  2ICI A;  1KTK A;  2WKD A;  1W6K A;  3Q23 A;  5C3X A;  2KHS A;  3J7A F;  2SDF A;  4JK1 C;  2KVM A;  4RHS A;  3J81 L;  3KLR A;  5C0X I;  1PDQ A;  3HRZ C;  1A3U A;  3S16 B;  1J8I A;  3D4R A;  3A7L A;  1CHQ D;  5FO9 B;  1V1P A;  1O80 A;  1PXU A;  4A3K B;  1V43 A;  3QWN A;  1RJT A;  4C3J G;  1I6H B;  2E2H B;  5J22 A;  5JVH 3;  2ZXO A;  3HOW B;  3QOL A;  1QE6 A;  1ZXT A;  1EY9 A;  2SNM A;  4QMG A;  1F2L A;  2ZXP A;  3HOU B;  4ABN A;  3L7Z C;  2D5D A;  3OSO A;  2LKV A;  1JOO A;  1EQT A;  4FF4 A;  1O78 A;  4A3I B;  4ME5 A;  1GUT A;  3S9W A;  1EOT A;  3BVZ A;  2NVQ B;  4O42 A;  1ONL A;  3EA6 A;  4FVM A;  2JA5 B;  1FYC A;  4K14 A;  1QNU A;  4TRD A;  1JWS D;  4ZUI A;  1O7Y A;  4RKB A;  4IUP A;  4HTH A;  3ND9 A;  1I4P A;  1HA5 A;  1WD1 A;  3SR1 A;  2HCC A;  3H91 A;  4EQO A;  1YNN D;  3I4L A;  4DNR B;  4K5W A;  2O2L D;  1HCZ A;  3IAY A;  1O7L A;  2F0H A;  5KGU A;  5JEA H;  1O7Z A;  2HQE A;  4BY7 B;  4ZKC B;  1V1P B;  2KA7 A;  1KAA A;  3GTK B;  4KY6 A;  1SYB A;  1VDZ A;  1GUG A;  4HED A;  1F9R A;  4H7B A;  4DGZ A;  3GV6 A;  2F0G A;  5KRU A;  5BN5 A;  3I8Z A;  1TWF B;  3SK4 A;  5I2X A;  4C3J B;  2K6A A;  1U4L A;  3MFY A;  4O1N A;  1PRT B;  3S17 B;  2FHT A;  3H94 A;  4ZUJ A;  1I6V C;  1YNJ D;  3X3M A;  3MEH A;  1IKM A;  3MXG A;  2RBM A;  3HZX A;  3NQT A;  4MIU A;  2E75 C;  4KN7 C;  4OL7 A;  3N52 A;  4A3M B;  1HTP A;  2GA4 B;  1B9N A;  3IL8 A;  3VR5 A;  4IQZ A;  2L4N A;  1DXM A;  3S15 B;  3N6R A;  1MSG A;  2OF1 A;  4Q0F A;  2EE1 A;  2IJ0 A;  5EKL A;  4DNT B;  4V0B A;  1U4P A;  3CRL C;  1ENF A;  1DOL A;  2YYZ A;  2JYO A;  3VYS A;  1PRT F;  1CFM A;  2KEC A;  1SNO A;  2JEA I;  3J7A V;  3BYY B;  4EVO A;  3FPP A;  5A35 A;  1MD2 D;  5FKA C;  1CK1 A;  4K6L A;  5FO8 B;  1U4R A;  2EYF A;  2PW5 A;  1H9K A;  4EGV A;  1D5Z C;  1EQV A;  1HFG A;  3T13 A;  2Q8R E;  3ERQ A;  3VR3 A;  2NUC A;  4BBS B;  3S1N B;  2OT2 A;  3D8G A;  3TDQ A;  2NN6 G;  1TWC B;  2SEB D;  3SK5 A;  1IYV A;  4QB4 A;  2B2Y C;  2HCI A;  1MSH A;  4ULL A;  3PO2 B;  1JCK B;  4RH6 A;  1BCP B;  4Q5V A;  1STB A;  3P1H A;  2EYP A;  3LX0 A;  2FFK B;  1PZI D;  3NUC A;  2A69 C;  5BN3 A;  2CVR A;  2EPB A;  4B9W A;  1SYE A;  3MXU A;  4ZRZ A;  2EY5 A;  3AB9 A;  5C5M A;  1BCP F;  2O5J C;  1SYF A;  1A6X A;  1H9M A;  2B2V A;  4DAV A;  1SEB D;  2Z1C A;  1D2B A;  5T1I A;  2EVB A;  1C8C A;  3BVG A;  5IGB A;  5JPN C;  1UAP A;  3I70 A;  1CTM A;  2M00 A;  3VA5 A;  4K2L A;  4IFD G;  1Y1W B;  3R3O A;  1D5X C;  1TR5 A;  2B2V C;  5DM6 3;  4XIG S;  5I2Y A;  2RKS A;  1AZP A;  1ET9 A;  3SVM A;  3OIQ A;  3OIP A;  4BA1 I;  3BS1 A;  1EU4 A;  1H9J A;  2L12 A;  1IYU A;  1PRT D;  4JBW A;  1EYC A;  5EPL A;  4G57 A;  3I91 A;  4KY5 A;  4NKL A;  3T51 B;  2L5T A;  1STE A;  1Q1E A;  2LS0 1;  1EIH A;  1STH A;  4TKO B;  3GTM B;  5ELE A;  2PZW A;  3I72 A;  1S5E D;  1K83 B;  3A8K E;  5EGT A;  4F88 A;  4ZKB B;  2F0T A;  4KI0 A;  1AN8 A;  2EYM A;  2F0J A;  4RGT A;  2EJM A;  3X3N A;  2IL8 A;  4J1M A;  1OXV A;  3EJI A;  5JEA J;  4OO1 G;  1KAB A;  1G29 1;  1EY7 A;  4FYD A;  1W6J A;  1GUN A;  1IW7 C;  2WII B;  1TT2 A;  4M8A A;  1JOR A;  4U68 A;  3DXJ C;  1PFB A;  1FNW A;  2ICE C;  3OMC A;  3NWS A;  3VR4 A;  3G7L A;  2XN9 C;  3QO2 A;  1YNN C;  1ML0 D;  4NW2 A;  4KMU C;  1JC7 A;  4F8M A;  3S2H B;  2PW7 A;  3DWP A;  1EU3 A;  3BZD B;  4Y7N B;  1RCV D;  1TS5 A;  3NSW A;  2B2T A;  2JA8 B;  4CJ2 C;  1JQY D;  1SND A;  1BCP D;  1PTO H;  3RZO B;  2L0C A;  5M9O A;  5KYI A;  3T16 A;  3Q6S A;  4QF4 A;  1T5E A;  3L3O C;  4P2C B;  1PFM A;  2A68 D;  2KOL A;  2EY2 A;  4R9W A;  3O13 A;  4J6H A;  4K8J A;  1I3Q B;  2OXP A;  4CKE A;  3FRP B;  3QG1 A;  1HXY D;  2BA0 A;  2Z4I A;  1QB5 D;  1BUV T;  3RUZ A;  1MBY A;  1B50 A;  3P20 A;  4F87 A;  3C2P A;  1YNJ C;  1WTO A;  4KTA A;  2E74 C;  2F0I A;  2PZT A;  3TP7 A;  3TN2 A;  1JWU D;  1TU2 B;  2YU9 B;  5C4X B;  5JOB A;  5CYU A;  5I9P A;  1BDO A;  4ZAI A;  5K36 H;  3Q0A A;  3A54 A;  2I07 B;  1F9S A;  5FLX E;  1B2T A;  2L9H A;  5CV6 A;  5IGE A;  1PZJ D;  3K5M A;  4CJ0 B;  5IOD A;  3S1Q B;  3UI2 A;  5EPK A;  1EWH A;  3CRK C;  3P7J A;  5ISR A;  3PIO 3;  2R7Z B;  4XYQ A;  2B8G A;  1CT1 D;  5I6Y A;  1GOZ A;  5C44 B;  1OO9 B;  2X69 A;  2BE5 D;  3V05 A;  2J7Z A;  4OHJ A;  5ELB A;  4DF7 A;  2IX0 A;  3TME A;  4AYB B;  2DN8 A;  3SK6 A;  1SYD A;  2IW3 A;  1STY A;  1HQM C;  3J80 L;  2AWO A;  3T53 B;  4CJ1 B;  1OXS C;  2F0F A;  5CR3 A;  1I4Q A;  1ET6 A;  4DN4 M;  2VB2 X;  4HMJ A;  4KJN A;  2AUJ D;  4XDX A;  2PPB C;  1KNA A;  1NUC A;  5CV8 A;  1G2S A;  3A8J E;  3A55 A;  5F2D A;  4K8I A;  1G91 A;  5M3M B;  3DHQ A;  2MUY A;  1T5X D;  1S5C D;  3VR2 A;  2NN6 I;  5DNF A;  4RFB A;  2WIN B;  3QJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...