4L5RC

Crystal structure of p202 hin1 in complex with 20-mer dsdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
198
Chain Sequence
b'TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 46
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5rC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5rC01
3PUVA 4GN3B 1WFQA 2VQEL 4HJ5A 3M85A 4HJ8A 1VCIA 4A3DG 3J7ZC 3GTOH 3HOUG 1EQQA 2PQAB 1KC8C 1K9MC 1YI2A 2KHJA 2JA7G 3F8TA 1VQ8A 1A8VA 5GROA 4MZ9A 3TS0A 5FJ8G 2F4VQ 1S3OA 2IHFA 4L5QA 3T1HQ 2LXJA 4X65L 3CC7A 3A74A 3ZJYC 5C0XG 4DR3Q 3GTGH 1TWFH 4YY3L 1VQ6A 4LFCL 4A3CG 4JYAQ 2CFMA 1L1OC 1YNXA 1WCMH 4IJLA 4LF7Q 2IX0A 2JJQA 1VQEA 1LM0A 3L7ZC 3CMAA 1KAWA 1X56A 2AWNA 1RL2A 1E22A 3UDIA 5IYBG 1IBML 4BY1H 2PI2A 1AH9A 3S1NH 4LF8Q 2JQOA 4P72A 5C44G 3CCQA 1PH6A 2GVBA 1SR3A 1HR0Q 4LF5Q 3W1BA 4FDBA 1KL9A 4NB3A 3L0OA 4A3FG 3OYYA 3J81j 3CCEA 1PH8A 2JA8G 1NJIC 4OX9L 4EQ5A 3RZDH 2ID0A 1CKMA 4APVA 1X3FA 1DGSA 2ATWA 3PCOB 1YHQA 2PNHA 2UU9L 4JI4Q 4DR1Q 2VQFL 4A3GH 2K5HA 1HNXQ 4HIKA 1WOCA 1VS0A 2BA0A 1NMGA 1WI5A 1XPRA 1YVCA 4LF4Q 4A3BG 1PH4A 3RLFA 1IBLL 3CF5A 4JI2L 1HZ9A 4JI6L 5IP9H 4AYBG 4ALPA 3T1YQ 1N32L 1VQLA 4X66Q 1X9NA 3GTLH 4Y7NH 2HHHQ 4A3JH 4PZ8A 4R4QA 2B63H 1P8LA 3RN5A 2ZJPA 3PF4A 3A5UA 3CW2C 1Q46A 1OXVA 2NZHA 1CKOA 4IPGA 3J80c 4DV4Q 1J5EL 1HZBA 1I94L 1VQKA 2UXCL 4BBRH 2D62A 1VQJA 2RF4A 1QZHA 2MO0A 2ZTDA 1L1OB 3TS2A 2HQLA 3F1ZA 3NENA 3S17H 4B3SL 5LMNW 1VQGA 3STBC 2RCNA 2VL6A 4B3TL 4C2MH 1PH7A 4K0KL 4PMWA 1HZAA 3K0XA 4RG1A 5IP7G 2R7FA 2Z0SA 1C7YA 2R6GA 3E9HA 3J81i 4OO1G 1N34Q 3PIPA 4A3EH 4JBMA 3M9BA 1KQSA 1PYSB 1I50H 3UE1A 4DV2Q 2E8GA 1PH9A 4LF5L 1YJWA 1IBKL 1JJ2A 2MNAA 4JV5L 4P75A 5FLXc 2VY3A 4YCVA 4GLAC 4C3HH 3HOWG 2A1AA 4DUZL 1UWVA 3JC66 1Y1WH 5IWAQ 2UXDQ 4R4OA 3A0JA 3OTOQ 1UE5A 1X65A 5JEAJ 3UE0A 5BR8L 5JJLA 2R93H 1XMQQ 3ICEA 2MQHA 2NZOA 4LUOA 3UDXA 1KXLA 1Q81C 2UUBL 5JJIA 4IFDI 1EWIA 3ULJA 4BY7G 5HGQA 4P73A 4GN4B 4KHZA 1VQ9A 1HZCA 1LTLA 1PH1A 2EXDA 2KCMA 3F2BA 1HR0W 3B6YA 3PO3G 4P71A 2BA1A 4A3IH 1AE2A 5IYDG 1G51A 1U0LA 1ASZA 3HOXG 3IRBA 4AH6A 2HHHL 3I4MH 1OXXK 3KDFA 4R4IA 2JEBI 3NBHB 1S72A 1XNQL 3TREA 5HY6A 4DV1Q 4B3MQ 3S24A 4C3IH 1K0RA 2KHIA 1E3PA 1U5KA 5IYCG 1OXUA 4DV4L 3M3YH 4IOAA 3PO2H 4A75A 1L1OA 3J7A5 1WJJA 5LMNQ 4JI7Q 1JT8A 1EQRA 1VQDA 2OCEA 2IHEA 3UDGA 1XMOL 1ASYA 1PVOA 1I3QH 5C0XJ 2L15A 2ZJRA 1K3RA 2GN5A 3GTQH 4JG2A 3CCRA 2WFWA 4DKAC 2R92G 1VQ4A 3M4QA 5M3FG 3K81C 1PV4A 1CSQA 1NY4A 2ES2A 4LFBQ 4GNXC 2OQKA 3BZKA 4BA1I 2LXKA 2H5XA 4OWXB 4WJ4A 3G71A 3CCLA 3RLNA 1PHJA 1GKHA 2F3IA 1FGUA 4YCUA 4QY7A 2OWOA 3VDYA 3HOZG 2JA6G 1GO3E 1TWAH 4OXPA 4A3MG 4DR6Q 3J80i 3GO5A 2Q2IA 3HOVG 3I4NG 5H1SE 3S2DH 2R7ZG 5C4XH 5IWAL 4BBSH 3I2ZA 4DV3L 1FL0A 2NVTH 5GAGC 2JEAI 4NXNL 5C3EH 2JA5H 3E0EA 2NVQH 2E2IH 4DR4Q 1XMQL 2ZTEA 1VQCA 2HIVA 3D31A 4L5TA 3PIOA 2A19A 4LF6Q 3OW2A 1HNWQ 4GLXA 3F2DA 4JI0Q 4JBKA 4LF9Q 5AJ3Q 1YJNA 3Q8DA 4JI5L 3S1MH 4GKJQ 2AWOA 2AMCB 4HIDA 4IJHA 1SROA 5J3BA 2JE6I 4A93G 1Q8KA 4JOIC 1N36L 2K4KA 3H3VH 3PUWA 3RLOA 4B3ML 4A3LG 2RHSB 1B70B 4PZ7A 2E2HH 3BJUA 3KF6A 1Z9FA 2DGYA 1YJ9A 1HNZL 3KJPA 4JI7L 1UE6A 4DV6Q 1K73C 2VUMG 1E7ZA 1CUKA 1E1OA 2QEXA 4GNXB 4BXXH 3FKIG 4R4TA 2YTYA 3HOYG 5C4JH 2N3SA 2N8NA 4GOPC 3KDFB 4DNIA 4O0AA 5M3MH 3H0GH 2F52A 4P74A 4X62Q 1YZ6A 2CKZB 2UUAQ 1MJEA 3G4SA 2VW9A 1I6HH 1IZ6A 2A8VA 1X6OA 3D0FA 4DV0Q 1Y1VG 1VQMA 1RIPA 2NN6I 1TWGH 4C3JH 2I0QA 3RNUA 4TVAB 1XPOA 1N33Q 1VQNA 3NELA 2F4VL 3T1HL 4DR2Q 3M4PA 3CP0A 4UP9A 4DR3L 1N9WA 5FLMG 4NXMQ 3H3VI 4A3KG 4X64Q 2CCZA 4A3DH 3HOUH 4JYAL 3W5OA 1FJGQ 2XGTA 4GKKQ 4H02A 1TWCH 3PUYA 3FHWA 4QJFA 1M1KC 5GAHC 4LF7L 4KHPQ 2JA7H 4DUYQ 1PA6A 5ELNA 3TQYA 3AFPA 5FJ8H 1SN8A 1SLJA 1X3EA 4HJ7A 2NVYH 4LF8L 3S14H 4HIMA 5M5YH 1HR0L 3ULPA 1QUQA 4JBWA 1Y14B 4POGA 3M4OH 4R1JA 4XIGS 4DAYB 4DR5Q 4JI1Q 4JI0L 4A3CH 5AJ3L 1D7QA 2DUDA 1VQPA 5LMUQ 4GKJL 4RMFA 2K5NA 3U4ZA 2C35B 2K5VA 1PH2A 2HT1A 1VQOA 5IYBH 1K83H 2VQEQ 4A76A 5C44H 3HKZE 3WWVA 3J81c 4DR1L 1HNXL 3PSIA 4JI4L 4X6AH 1YHBA 3CMEA 4A3FH 2FXQA 1WYDA 2JK8A 4JI8Q 1EIYB 5E7NA 2LSSA 2Z6KC 1WCMG 1XTDA 4LF4L 2JA8H 3KFUA 2PMZE 4GOPB 4IO9A 3MEFA 4DV6L 4GNXA 1X3GA 4BY1G 4DAMA 4UY8C 3T1YL 4LWCA 4JI3Q 1YBYA 4X66L 2K50A 1AE3A 2E5LQ 1LYLA 4LFCQ 1X54A 3CCUA 4HJ9A 1JJCB 4YWMA 4LFAQ 2MO1A 4A3BH 1SFOH 4MTNA 2OQ0A 2WB1E 4OWTB 1EYGA 2AHOB 4DR7Q 1V43A 4IPDA 1T9HA 3GD7A 2B3GA 4J15A 4NPSA 4X62L 1IBMQ 2UUAL 4MNOA 4L5SA 1Q12A 4A3GG 1X55A 3KF8B 3NEMA 4B3RQ 2EQSA 1BKBA 3KF6B 1CKNA 3K7UC 4DV0L 3LGJA 1B7YB 3CCVA 1Q82C 4DK6C 4OX9Q 2KCTA 4DR2L 4LUVA 2R7DA 1EUJA 1L2FA 1SE8A 3I7FA 4X64L 3ULLA 5IP9G 2UU9Q 1FJGL 3CPFA 5GQOA 1MKHA 2D0PA 3KOJA 4DPGA 2I5HA 1Q1EA 4A3JG 4DUYL 4DV7Q 1N8RC 1N34L 3HFZB 1H95A 1NTGA 4JOIA 4YHHQ 2B63G 3STBD 4DV2L 1K8AC 1HJPA 1IBLQ 2OTJA 3RZOH 4JI2Q 4DR5L 5IP7H 3CPWA 1B8AA 4DV5Q 4BBRG 4WJ3M 1N32Q 3JAMc 2IT1A 1XNRQ 2IX1A 4IFDG 2ZTCA 2UXDL 4PZ6A 3OTOL 5M5XH 3PF5A 1Q7YC 2UXBQ 2NVXH 1A0IA 4QL5A 1SRUA 1VQBA 3AYHB 3U50C 3U58A 1A63A 2K14A 2GVAA 1I94Q 2UXCQ 2WAQE 2ZM6Q 2Y0SE 1J5EQ 3S16H 1KHIA 3BU2A 3HOWH 4DK3C 4JI8L 3PUZA 4GOPA 3E9IA 2WP8J 1BVSA 5IT9c 3PV0A 1QUQB 1YIJA 4LNQA 3KYHC 3F2CA 4A3EG 4GN5A 4B3SQ 2IY5B 3K80C 4JI3L 1I5FA 1TXYA 3MXNB 2Q2TA 4B3TQ 4OWWB 2E5LL 4K0KQ 1Z47A 1KRTA 1JJGA 2MFIA 4L5RC 2YV5A 4DV1L 2YTXA 2D0OA 1E1TA 4LFAL 1Y1WG 4BY7H 4Y52H 3S2HH 2Q2HA 1VQFA 3I55A 4DR7L 1VQ5A 3S15H 4HJAA 3PO3H 4B3RL 3I56A 3PUXA 1BBUA 5IY0A 5LMNL 4OONA 2N49A 2R93G 5IYDH 3PGZA 2QGQA 3HOXH 1KRSA 1TWHH 2CWPA 1IBKQ 1UE7A 4JV5Q 2I5LX 4AQYQ 1O7IA 1Q86C 3EIVA 4DUZQ 4OO1I 2YU9H 1UE1A 3S1RH 3AFQA 4BA2I 2VNUD 5IYCH 4GS3A 5BR8Q 2BH2A 3W1GA 4JC0A 1VQHA 1JMCA 4A3IG 4XTCS 2Q2UA 4LFBL 1IYJB 2EIFA 2KBNA 4KLKA 1L0WA 1JB7A 3HKZG 1VQ7A 2UUBQ 1OXSC 1A62A 4DV7L 3I4MG 2K75A 2E2JH 3TRZA 4YHHL 1KD1C 3S1QH 4QQBX 3CXCA 2CQOA 4GLVB 4QGUA 5JJKA 2R92H 5M5WH 4UP8A 1KIXA 3GTMH 1CKNB 4DR6L 5M3FH 1G6PA 3FP9A 1M90C 2V1CC 2UUCQ 3PO2G 4DV5L 1NMFA 4TQUS 1XNRL 1NBWA 1VQIA 2I5MX 2Z6KA 1JE5A 4IPCA 1PH5A 2N78A 2PI2E 1XNQQ 3RR5A 1G291 2UXBL 3AQQA 4DR4L 3HOZH 3HKSA 1XJVA 2JA6H 4A3MH 1OTCA 2ALYB 4IOCA 1W2BA 2PQAA 1QZGA 2ZJQA 3HOVH 2ZM6L 2WB1G 3K8AA 1PH3A 1PYBA 3EBEA 3I4NH 2R7ZH 4LF6L 3CCMA 1HNWL 3GTKH 5ELOA 1XMOQ 4UPAA 1K8GA 3GTJH 4LF9L 4PG3A 2BH8A 3H15A 1BBWA 1YITA 3KJOA 3AEVA 4KI0A 1GM5A 3GDEA 1CSPA 2K52A 1VQAA 3CQZH 1PFSA 1UEBA 2YYZA 3KLWA 1GVPA 3CCJA 3DLLA 3JAMi 5IE8A 1C9OA 1J6QA 4JBJA 3UDFA 5C4XG 4BBSG 3K7AH 3ERSX 1D8LA 1NE3A 5GADC 5C3EG 4IPHA 2JA5G 1C0AA 3CD6A 4AYBE 4A93H 5GAEC 2CWAA 3BZCA 1HH2P 2QA4A 3M7NA 4HIOA 1R9TH 2KENA 4YWLA 3CAMA 1QVFA 1MJCA 4QIWE 4X65Q 4AQYL 4UP7A 2YTVA 3I4OA 4YY3Q 3U4VA 4A3LH 4ME3A 5DLQE 4AIMA 4DV3Q 1V1QA 2VS1A 2NN6G 4NXNQ 1IL2A 2XTIA 1S40A 3CC2A 1W3SA 3ER0A 5C0XI 2VUMH 4LUZA 4EX5A 2VZAA 3DM3A 4R4CA 3TEHB 3CCSA 3FKIH 4YWKA 3L2PA 2WAQG 2HIXA 2Y0SG 1EFWA 1XPUA 3HOYH 1IXRA 2JA9A 1Q1BA 5EAYA 1QVGA 4JI5Q 1MIUA 1N33L 3SGIA 4IFDJ 2UUCL 3GTPH 1YEZA 4A4IA 4NXML 1P16A 1N36Q 3A5ZB 4YCWA 2OTLA 2VQFQ 2ASBA 2AKWB 4GKKL 4BXXG 5JEAG 4KHPL 1GD7A 1Y1VH 1EIFA 2RHQB 4JCVE 1QVCA 1FVIA 5M3MG 3EN2A 3H0GG 5FLMH 3RN2A 1HNZQ 4A3KH 5K36G 1YHAA 4POFA 4JI6Q 4JI1L 1LUZA 1EOVA 4LW1A 3CC4A 1OXTA 3G6EA 3G48A 2B29A 5LMUL 1SMXA 1V9PA 1E24A 4O2DA
chains in the Genus database with same CATH superfamily
1EY0A 4UAIA 2Z9HA 4ZK9B 2H1EA 2AQ2B 2DNCA 1GUTA 1VCIA 1TR5A 1EQQA 1KC8C 1TS2A 2IX3A 4DK1A 1VQ8A 5C0XG 1Q90A 2EY5A 3GTGH 1TWFH 4YY3L 3VR3A 1JC7A 5CV7A 1LM0A 3L7ZC 3SE0A 3CMAA 4WFN3 3S2DB 1IBML 1H9MA 5KRUA 5C4XB 3MZ5A 3S1NH 4LF8Q 4BBSB 5KYLA 1YNJC 5C44G 3CCQA 4LF5Q 1AH9A 1EIHA 5M5XB 2NVTB 4FDBA 2QCPX 5D14A 3OYYA 2JA8G 1PTOC 1NJIC 3K6OA 2X6GA 2KCCA 2ATWA 1YHQA 1GUWA 3DWPA 3LWUA 1WOCA 2CW0C 1EIGA 2EDGA 2K5QA 2BA0A 3A8IE 1YVCA 3SHLA 1B50A 4K5XA 1HZ9A 3T1YQ 4X66Q 3GTLH 4CJ2C 2HHHQ 4X3UA 1RD9D 1W6JA 4A3JH 4PZ8A 2B63H 4MN3A 3A5UA 1K0SA 3TP5A 5A35A 3J7AF 4I7ZC 4DV4Q 1LT5D 1LTID 1HZBA 4BBRH 1SDFA 2MO0A 4IFDH 1AW7A 2ZTDA 2NB0A 5M3MB 1LTAD 2HQLA 1M8AA 3S17H 2F0GA 2WV6D 3BZDB 1JB3A 1SYEA 1VQGA 1STBA 2BE5C 4B3TL 4K6DA 2K01A 3K0XA 5FLXE 5IP7G 4KKUA 1VDZA 1C7YA 3GTMB 5M3FB 1YNNC 1DD2A 4A3EH 4JBMA 3M9BA 1PYSB 3UE1A 3SDZA 4LF5L 1BXTA 1UEAB 1IBKL 1JJ2A 3K5MA 3HOZB 2A1AA 1SYFA 3FMCA 1UWVA 3JC66 1JORA 2OF1A 4R4OA 2DNEA 5JEAJ 3I4NB 5JJLA 3NTHA 1XMQQ 2NZOA 3UDXA 3C3LA 2UUBL 2H4OA 3CQZB 4LMQD 5DNFA 1CZWA 1SNPA 2BA1A 4A3IH 3K7AB 1U0LA 2X6LA 3I4MH 2HHHL 4Z9CB 4R4IA 3NBHB 1XNQL 5HY6A 4B3MQ 4C3IH 1R9TB 4DV4L 1OXUA 3D8GA 4IOAA 1L1OA 1SYGA 5LMNQ 2RDFA 3DEPA 3UDGA 4CDFC 2DN8A 5C0XJ 4P2CB 1A6XA 1K3RA 3U9OA 3M7GA 5M3FG 5FO9B 2SEBD 3SK5A 3OMGA 2F0TA 2PNRC 5ELFA 2H5XA 1PHJA 2MHVA 1H9SA 3HOZG 1TWAH 4DR6Q 5L37A 1I4RA 1AN8A 3GO5A 3QIAA 3D6CA 1CQVA 3I4NG 5H1SE 1W6KA 3MXUA 4FF2A 3I2ZA 1XMQL 4O42A 5E3FA 1IHZA 3L9AX 3R93A 1TWCB 2HIVA 3VYUA 4BWGB 2EYOA 3PIOA 4LF6Q 1V1PB 4CKEA 1E2VA 5AJ3Q 4IUTA 5IIFA 1EY7A 2G9HD 2JE6I 1Q8KA 1HXYD 1RF2D 1JCKB 4B3ML 3SVMA 1B70B 1B9MA 1SNCA 3BJUA 1Z9FA 2NZ1D 4DV6Q 1K73C 4KKTA 1CUKA 5JEAH 2WKCA 4R4TA 1MSHA 4F87A 3N52A 1I4QA 3T16A 4QUFA 5DAUA 4K5VA 3KDFB 1JE4A 3QOJA 1PZID 4P74A 3P20A 1YZ6A 3BDLA 1J9OA 1GUGA 2CKZB 1MJEA 2L9HA 3G4SA 3C2PA 2VW9A 1M4VA 3OWFA 1VMCA 5D3IB 1I6HH 1LTRD 4HTHA 1MD2D 1TWGH 4B9WA 4TVAB 1VQNA 2F4VL 4DR2Q 4LAAA 5EPLA 1N9WA 2FINB 2CCZA 5KNBA 1FJGQ 3G7LA 3KLSA 4H02A 4QJFA 3E6ZX 3I3CA 2F1MA 1PTOB 1UNSA 1PA6A 3AFPA 4QUCA 1X3EA 4WORA 3S14H 4HIMA 4Y7NB 1SE2A 5C0XH 3ULPA 1EY5A 4JBWA 2QW7A 5JPMC 1ENFA 4DR5Q 1G2SA 5AJ3L 3ND9A 1EOTA 1VQPA 3MXPA 4XT3B 5LMUQ 2B2VA 1LT4D 1PH2A 1K83H 3K59A 3OW7A 5C44H 4A76A 4DR1L 4X6AH 4FVMA 3TZDA 3CMEA 4JI8Q 1EIYB 2LSSA 4CJ1B 2JA8H 3KFUA 3F2UA 4C2MB 2PMZE 1TY2A 4IO9A 3BVMA 3ND8A 4XYOA 4DV6L 4GNXA 3ONAB 4UY8C 4DFAA 1YBYA 2E5LQ 4LFCQ 4HAEA 1ICFB 2SNSA 2OQ0A 2I46A 2WB1E 2NBFA 2AHOB 4IPDA 2B2VC 3TP6A 1X55A 3NEMA 1I4GA 4U68A 1KABA 2E74C 3KF6B 1D5ZC 1HTPA 3LGJA 4HCSA 2WKDA 3T51B 2EJMA 3D6WA 2KCTA 4DR2L 4LUVA 2F0NA 1SE8A 1B2TA 1FJGL 1BUVT 3SK6A 3CPFA 2EYPA 4RCNA 1K28A 4DPGA 2I5HA 3DUZA 1Q1EA 3HFZB 1LLRD 1NTGA 4DAYA 3HKZB 1HJPA 1K8AC 2OTJA 1EY6A 3D3RA 4KY6A 5LL6S 4JI2Q 4DR5L 5IP7H 3OHXC 2IWHA 3OSOA 3DEOA 2UXDL 5M5XH 1O7ZA 1C48A 4QL5A 1SRUA 4NDXA 3S9WA 3AYHB 2K14A 3X3MA 2ICEC 1CA5A 4JI8L 2B2WA 4GOPA 2WP8J 5K5PA 4OELB 4RGOS 4B3SQ 3K80C 1TXYA 2E5LL 1RTNA 4K0KQ 1Z47A 4G4KA 1ICWA 4L5RC 4DV1L 1E1TA 4Y52H 1GJXA 2Q2HA 5EKIA 1VQ5A 2K05A 1TWFB 1MBYA 4LK1C 5E1FA 5KNCA 2NVQB 4NP5A 4JV5Q 2F0KA 2E2IB 2IL8A 1O80A 1UE1A 2D9UA 3QOLA 5C6AA 1WTXA 1K8MA 1V1OA 2A73B 2B2WC 4GS3A 1EZ6A 1GHJA 5IT9L 1VQHA 4MTKA 1C8CA 3EA6A 3C1EA 3S1MB 2EIFA 1CT1D 5E4XA 3HKZG 3T13A 2F0WA 2K75A 2L55A 5JJKA 3GTMH 1G6PA 5DM63 5M3FH 3CU7A 2V1CC 5I6YA 1BQQT 4FXKC 2K1BA 3HOZH 1DM0B 3HP3A 4OEMB 1QZGA 3EBEA 3I4NH 2QEJC 2L4NA 3X3NA 4UPAA 1XMOQ 1GM5A 4CDCC 1CSPA 1FD7D 1F2YA 4ID6A 3CQZH 1K8OA 4XQNA 4C3JB 5IE8A 2EY2A 3I72A 2IJ0A 3K7AH 1D8LA 1NE3A 5C3EG 2B2UC 5GAEC 1ZXTA 3BZCA 3M7NA 4HIOA 1R9TH 2EXZA 1MJCA 4UHVA 4X65Q 2HQEA 2YTVA 1UAPA 1LACA 2QF7A 2VS1A 2NN6G 3TN2A 2XTIA 3CC2A 2L5TA 1W3SA 1VF7A 4LUZA 4PMBA 3TBIB 2M00A 1FR3A 5AFWA 4CGYB 4EX5A 3CCSA 3TEHB 5FO8B 5HURA 1XX8A 1HPCA 1PRTB 3DM1A 2JA9A 5EAYA 1QVGA 4JI5Q 5CGKA 3SGIA 1CM9A 3RMHA 3IKJA 1BBXC 4KTAA 1JWMD 4IUVA 5DEHA 4HR7B 3JAME 3A7AB 2OTLA 2VQFQ 2BOSA 4GKKL 4BXXG 5FO7B 3SK8A 4JCVE 3E5SA 1JOOA 2M2LA 5K36G 2B8FA 5CV8A 1EOVA 3BDCA 3CC4A 1SFOB 3NPPA 1E2WA 1TWCH 1CFMA 1U9RA 4M1UB 4C3JG 3BYTB 2OT2A 4GN3B 5JAVA 1PFBA 3MA2B 2VB2X 4HJ5A 2B8GA 4HJ8A 3HEJA 3J7ZC 3GTOH 1K9MC 1YI2A 2KHJA 2WACA 3I4LA 4WRDA 1A8VA 5FJ8G 4X65L 3A74A 1SSOA 1GUNA 3RZOB 3QJYA 5JVH3 4DXGA 3I90A 1E22A 1EWCA 2CH4W 2JQOA 3J81L 4U673 1O7LA 1HR0Q 1KLUD 4A3FG 4K5WA 3CCEA 5G3LF 4OX9L 2A5HA 2ID0A 1GHKA 1X3FA 3NBHA 3J7AV 1EFID 2PNHA 4JI4Q 2VQFL 3NHHA 1F2LA 4HIKA 1S4ZA 1VS0A 1XPRA 4XT1B 4E6IA 4DU9A 1RTOA 4LF4Q 1EQVA 3TP7A 3H6MA 1IBLL 1PTOH 4RHSA 1N32L 1VQLA 3NTIA 1F9QA 4Y7NH 3AB9A 3PO3B 4DXFA 1P8LA 3RN5A 2ZJPA 3PF4A 1TWHB 1S5ED 2NZHA 5I6WA 1QG7A 1J5EL 1PYWD 1I94L 2IX1A 1VQKA 1VQJA 1A2UA 3TS2A 2HDMA 1BR9A 1LTSD 4IUPA 2RCNA 4C2MH 4PMWA 2R7FA 5M5WB 2R6GA 3J81i 1BCPF 4OO1G 1N34Q 3PIPA 1FNWA 4K8JA 4DV2Q 1V1PA 4HN7A 4A3MB 3J80L 1FNUA 3A0JA 1HTLD 2BDNA 4NW2A 2R7ZB 1SYCA 2F0MA 4ILWA 4LUOA 1KXLA 1Q81C 4IFDI 1QNKA 5HGQA 1Y69U 4P73A 5C44B 3CRKC 1HR0W 2F0SA 3B6YA 3PO3G 1Q8IA 4P71A 2LY7A 1AE2A 2F03A 5I4DA 1G51A 2F3WA 2LMCB 4AH6A 1OXXK 3KDFA 4DNRB 2XIWA 2KHIA 5IYCG 3BG3A 3C1FA 1VQDA 1ASYA 1DOLA 1B3AA 4KN4C 3GTQH 4JG2A 5J22A 2WFWA 1BO0A 1XXGA 1F9RA 2K6AA 4F8MA 1RJTA 4JW0A 2A68D 4DAPA 2ES2A 4LFBQ 4R8IA 4G7OC 2OQKA 1LO5D 1NNXA 4OWXB 1WTWA 3G71A 3CCLA 3RLNA 4WJ4A 1MGSA 1SYBA 4QY7A 4R9WA 4A3MG 3J80i 3HOVG 2F0LA 1II3A 2R7ZG 4ZUJA 1AFPA 3VR5A 1F9SA 2XWBB 4NXNL 5C3EH 2NVQH 3E0EA 4A3KB 2E2IH 3H3VC 4DR4Q 5BN4A 2EZVA 1VQCA 1EZ8A 4ZLTF 1JWUD 3OW2A 1HNWQ 4GLXA 2C5CA 4LF9Q 1BOSA 1YJNA 3S1MH 2F0HA 4GKJQ 2NN6H 4HIDA 1NSNS 1R4QB 5J3BA 4JOIC 1N36L 1WTPA 4KD4A 3PUWA 3RLOA 1STAA 1ML0D 2ZXOA 3BVGA 3VYTA 4PQXA 5CR3A 2LFNA 3KF6A 2DGYA 2XNAC 2QEXA 4BXXH 2YTYA 3DHQA 1EU4A 1WTHA 1B4OA 4DNIA 1SMYC 5K36H 3SXHA 1JR0D 4ULLA 2A8VA 1ESFA 3P75A 3IFTA 1VQMA 1RIPA 4C3JH 3OOCA 1D5XC 1HCZA 1C4QA 3PIP3 2EY1A 1V8QA 4A3KG 4X64Q 5BN5A 2E2DC 1HFNA 3W5OA 4DAVA 5GAHC 3R2TA 4C1NK 4PV1C 3MTSA 1SYDA 5FJ8H 1SN8A 1SLJA 4FXGC 4HJ7A 4LF8L 5M5YH 1Y14B 4POGA 3M4OH 4R1JA 1I6VC 1F77A 5D3DA 1OO9B 4GKJL 3R3OA 3IAYA 2VQEQ 4H0LC 2B2TC 1YHBA 4I65A 4A3FH 1WYDA 2JK8A 3GV6A 1EQTA 1SJED 1WCMG 1ET6A 1Q3LA 4RA8A 1X3GA 3K5LA 3T1YL 1STYA 2OEOA 4X66L 4HJ9A 1I50B 4XQQA 4YWMA 1I4PA 2AQ3B 4HSPA 4LFAQ 2MO1A 4L63B 1U4PA 1SFOH 4OWTB 4DR7Q 1DCZA 2B3GA 4J15A 4C3HB 4L5SA 1X3QA 4MNOA 4B3RQ 3MWYW 3KF8B 4K8IA 3T56B 1KAAA 4CKBA 3K7UC 4KY7A 1G6ZA 1B7YB 4TRDA 2L12A 1MHWC 1Q82C 2RDHA 3L3OC 2R7DA 1EUJA 3I7FA 4X64L 5CV5A 3ULLA 2UU9Q 2JXMB 3KOJA 1JOQA 1SNMA 4ABNA 4F88A 1N8RC 5G3LD 5TSSA 3STBD 2B2YC 3RZOH 2KOLA 1XNRQ 1Z6HA 2ZTCA 4OO1H 1ONLA 3T53B 2PMZB 3NE5B 5C5MA 2NVXH 1A0IA 3EVQA 1I3QB 5D65A 2UXCQ 5CV6A 2TSSA 2Y0SE 1L0YB 1KHIA 3BU2A 2EYFA 1HA6A 1BVSA 3NQTA 5IT9c 1EEFD 2WB1B 3KBGA 3KYHC 5EKLA 3GTOB 3RD4A 1LTGD 2YV5A 2PZWA 4ZRZA 4C3HG 2YTXA 2D0OA 4LFAL 2DJFC 4DR7L 3JAML 1X32A 2BCOA 4RKLA 3PO3H 4B3RL 3PUXA 1BBUA 5LMNL 3EQLC 3PGZA 2CHBD 1KRSA 1TWHH 4EVOA 2QKIC 1I4XA 4CBVA 4DUZQ 3AFQA 2IPKD 5IYCH 5BR8Q 1BCPD 3W1GA 4JC0A 4J1MA 2V4DA 4M8AA 4XTCS 2ENBA 3TP8A 1HQMC 2CQOA 3M4YA 5M5WH 4UP8A 4N8FA 4DR6L 1CKNB 1HUMA 2UUCQ 1IW7D 3QWNA 1XNRL 2MJ8A 2E2HB 1K3BC 2X69A 4ZAIA 1JE5A 1PRTC 4S3SA 4IZ8A 4A3MH 1OTCA 2ALYB 4IOCA 3HOVH 5IGEA 2WB1G 1PH3A 5C4JB 2R7ZH 4LF6L 2A68C 1PFMA 3GTKH 5ELOA 1K8GA 4PNYA 3H15A 1ENCA 3QB3A 3GDEA 1SEBD 4MHEA 3E3XA 3NWTA 1ILQA 1PFSA 1UEBA 3CCJA 1GVPA 1PZKD 5IGFA 3JAMi 4IUNA 3NP8A 3I70A 4KKSA 1Y8OB 5GADC 4A3DB 3DMUA 4AYBE 2KEDA 1HH2P 3CAMA 2JA7B 1TVXA 3I4OA 4HSVA 4ME3A 5DLQE 4DV3Q 1MSGA 1S40A 2C9OA 3ER0A 3W2DA 2VZAA 3DM3A 3WDNA 3L2PA 4EQPA 1XPUA 1IXRA 1F9PA 3OIQA 2UUCL 3I73A 3VYRA 2R3ZA 3A5ZB 2ASBA 4HEDA 2AKWB 1LABA 1AEXA 1GD7A 1SE4A 2RHQB 2IW3A 1PDQA 1SXTA 3EN2A 1HNZQ 3HS0C 4A3KH 4JI6Q 1GOZA 5C3XA 1LUZA 1OXTA 2D5DA 3G6EA 1SBBB 2Z1CA 3G48A 5LMUL 3WWVA 4O2DA 3J81c 3PUVA 3PQIA 5ELDA 4RAUC 2EPBA 1NR4A 4A3DG 2CQAA 4ZYSA 3GTQB 1KTKA 1PLFA 2R61A 2NWGA 2JA7G 5IGBA 4MZ9A 4FNFA 3T1HQ 2K32A 4DR3Q 2ZXPA 1EY8A 4Q0FA 4LFCL 1VQ6A 2Q8IB 3A8KE 4A3CG 4JYAQ 1F2MA 3Q24A 1WCMH 4K2LA 4LF7Q 2Z6BA 1VQEA 3N6RA 1X56A 2AWNA 1RL2A 3UDIA 1PMRA 2EYLA 5IYBG 2PI2A 2EOTA 4KV6A 4P72A 1PH6A 4XQJA 3W1BA 1KL9A 4NB3A 5C3EB 5CORA 4K2KA 3J81j 2L0CA 1PH8A 4IURA 3NWSA 4EGVA 1KDBA 3S16B 1O7YA 1CKMA 4APVA 3K5NA 2FJ2A 1HNXQ 2EJGC 1A15A 2XRSD 4X3TA 3FEWX 1NMGA 1IYVA 4A3BG 1STHA 4KY5A 3WOFA 1GUOA 1PH4A 2K04A 3CF5A 4JI2L 4JI6L 4ALPA 2N55A 3S2HB 1QILA 2B2UA 2KCNA 3S15B 3DXJC 3V05A 1ZYRD 3HOXB 1Q46A 1OXVA 4IPGA 1CKOA 3J80c 4FF4A 2D62A 3KLRA 3S1RB 1UUPA 2RF4A 1QZHA 3IFDA 1G91A 1L1OB 2A6ED 4ODGA 2Q8TA 3NENA 5EJWA 4B3SL 3STBC 3CKIB 2JP1A 4K0KL 2E2JB 4RG1A 2Z0SA 1DOMA 2PZTA 4G7ZC 3E9HA 3K0YA 5IOCA 1I50H 1SNOA 1YJWA 2EE1A 4JV5L 4P75A 4C3HH 2JA6B 5EBCA 2J7ZA 5IWAQ 1STNA 5JJZA 1UE5A 3OTOQ 2FHTA 1X65A 5M5YB 5EBDA 3M4OB 1YNJD 3GTJB 1QE6A 3ICEA 2MQHA 2KQ3A 5JJIA 4CDDC 3ULJA 1IYUA 4GN4B 4KHZA 1LTLA 2EXDA 2ZT9C 3TMEA 4A3FB 1EEID 3FPPA 3HOXG 2CW0D 2RCFA 3K58A 2N88A 3IL8A 4A93B 3S24A 2G5DA 2JSOA 1B9NA 3MFYA 4FP5D 5FLXL 4RKBA 1A3UA 1BCPC 1QJOA 1B53A 3J7A5 1JT8A 1EQRA 1XMOL 2IHEA 1PVOA 1I3QH 2GN5A 2FMMA 2O5IC 3CCRA 1E0BA 1LTTD 2CVRA 3QO2A 4BS9A 2SNMA 1TS4A 3VA5A 1PV4A 3HOYB 1CSQA 4QIWB 1NY4A 4DGZA 4OHJA 2Z4IA 2KUMA 2LXKA 3EROA 4KHVA 1GKHA 1FGUA 4YCUA 2JA6G 2NYZD 4JK1C 3TZUA 1ENAA 1VMPA 2DY8A 5IWAL 1FL0A 4RGNA 5GAGC 2QILA 2QDLA 5IGCA 3D31A 2A19A 1HRJA 1JICA 3F2DA 4JBKA 2NVXB 2E75C 3Q8DA 1T5EA 1GXDC 4JI5L 2AWOA 4IJHA 4OGQC 4A93G 2K4KA 1MI2A 3W3AA 3H3VH 1DJRD 4A3LG 4PZ7A 2XRQD 3KF8A 2E2HH 4DK0A 3KJPA 3NXWA 1UE6A 2L11A 1RCVD 1BF4A 2VUMG 1E7ZA 2TMPA 4RGTA 1STEA 1E1OA 4EQOA 4GNXB 3HOYG 2NTTA 5C4JH 3T4AC 2F3VA 3O13A 2G9DA 1CA6A 3RZDB 2SDFA 1S5DD 1E2ZA 2KA7A 3DWAA 4OL7A 4LJZC 3VYSA 4TSSA 1LT6D 2NN6I 3Q22A 4QB4A 2I0QA 1XPOA 3HG9A 1N33Q 1X3PA 4N9TA 3M4PA 2FMCA 3CP0A 4UP9A 4A3DH 4NXMQ 2I07B 3R8BA 2XGTA 2J0TD 3LNNA 1STGA 4KHPQ 3OWEB 2JA7H 1D6EC 4DUYQ 3TQYA 2NVYH 1HR0L 2NUCA 2K5DA 4DAYB 4A3CH 4JI1Q 5ISRA 4RMFA 1KNAA 3HOVB 1KLGD 3U4ZA 2C35B 1TQOA 2HT1A 1VQOA 5IYBH 3GTKB 4JI4L 5I2YA 3PMFA 4RCOA 1H9KA 2FXQA 2Z6KC 2HDLA 4LF4L 2A74C 5I9PA 4GOPB 4DAMA 4BY1G 3QG1A 4H44C 4JI3Q 2K50A 2K5WA 4A3BH 1QB5D 4MTNA 1EYGA 1T9HA 1IBMQ 5CV9A 1Y1WB 4A3GG 1F2ZA 2PO4A 1CK1A 1BKBA 1CKNA 1QWYA 2R93B 4DK6C 5JOBA 5IGGA 4H13C 4KJNA 1L2FA 3FVQA 2F4IA 5IP9G 1EY9A 1KDCA 3U9SA 1Y8NB 3CRLC 5JPNC 4DUYL 4DV7Q 1N34L 3AMUA 4JOIA 4YHHQ 4DV2L 4NMZA 2A69D 1B3QA 1HHVA 1TKWB 5DM73 4IQZA 4WJ3M 3JAMc 3P1HA 2KVMA 5KYIA 4IUQA 1EY4A 4PZ6A 3M3YB 1QCBD 3PO2B 2A6HD 2A6EC 3QR8A 3HRZC 3PF5A 1Q7YC 2XSCA 4QCLA 4PMCA 3U58A 3VR6A 2WAQE 2KECA 2PW7A 2ZM6Q 3S16H 4IUUA 1G2TA 2KHSA 3KK7A 3E9IA 1QUQB 5JVG3 3BDOA 4KK7A 4ZUIA 4JI3L 1BCPB 2MPMA 3MXNB 1PXUA 3SK4A 3H94A 5A2QE 4HCEA 4B3TQ 4OWWB 1KRTA 5NUCA 1A2TA 4FF3A 1Y1WG 4RGMA 3S2HH 1VQFA 3OIPA 3I55A 3S15H 4HJAA 1WTOA 5IY0A 2R93G 4OONA 2N49A 2E76C 1BNZA 2F0DA 1WCMB 3HOXH 1IBKQ 4CDEC 1XWEA 1SJHD 1UE7A 1AZPA 4FYDA 2JA5B 4AQYQ 4OO1I 3EIVA 2YU9H 1R4PB 4JVZA 3S1RH 4BA2I 4I7AA 4ZQ3A 2BH2A 2ICIA 2Q2UA 1RDPD 4LFBL 2KBNA 4KLKA 1JB7A 1VQ7A 2UUBQ 4DV7L 1A62A 2E2JH 1TIID 4YHHL 1KD1C 4QQBX 1TT2A 4GLVB 3SEBA 1KIXA 5C3WA 2B2TA 3P7JA 3A54A 1M90C 2Y0SB 3I8ZA 3PO2G 4TQUS 1NBWA 1VQIA 2I5MX 1HQRD 2RA4A 3A56A 2PI2E 2RSNA 3AU7A 3RR5A 2K7VA 1XNQQ 3ITPA 3AQQA 4DR4L 1XJVA 2JA6H 4C56C 1Z7TA 2EY6A 4UDUC 2ZM6L 2VB3X 3K8AA 3CCMA 1HNWL 1FGBD 4LF9L 3GTJH 1S5FD 4PG3A 1S5CD 2BH8A 4MIUA 1BBWA 3NUCA 4QMGA 3H0GB 3KJOA 1YITA 3WOEA 1JWSD 2AUJD 1VQAA 2K33A 2MGSA 5M9OA 1S5BD 5C4XG 4JBJA 1KNEA 4BBSG 4TKOB 1LTBD 4X3SA 5IGDA 4N8X1 2JA5G 1WVLA 4JPBW 3HOUB 2LKVA 4A93H 2CWAA 1AZQA 4H7BA 3Q23A 5EKKA 4AQYL 4UP7A 4DF7A 3VR4A 2F0VA 1RODA 4A3LH 2B2YA 1LT3D 4AIMA 1V1QA 2SOBA 3FRPB 2WIIB 3UI2A 5C0XI 2VUMH 4R4CA 4YWKA 3HOYH 2Y0SG 1L0XB 1HFGA 1MIUA 1YEZA 5LL6X 4V0BA 1CZGA 3J81E 5BN3A 1EWHA 4X3KA 1EIFA 2L1BA 5M3MG 3H0GG 1NR2A 1YHAA 3A8JE 1PTOF 2HD3A 2B29A 1EYAA 1V9PA 3KLSX 4AYBB 1WFQA 1ILPA 2M9VA 2VQEL 3M85A 4KN7C 3HOUG 2PQAB 2D2CC 2WINB 4KD3A 2EYMA 3D4WA 1HA5A 3F8TA 4Q5VA 5GROA 3TS0A 2F4VQ 4XXEA 1S3OA 2IHFA 4L5QA 2LXJA 3CC7A 3ZJYC 2CFMA 1KDAA 3ZYYX 1L1OC 1YNXA 4IJLA 2IX0A 2JJQA 1KAWA 2JN4A 1EL0A 4BY1H 2GVBA 1SR3A 2RKSA 3L0OA 3ERQA 4EQ5A 3E0JA 3RZDH 3BVZA 3HOWB 3V96A 1DGSA 3PCOB 2UU9L 4A3GH 4DR1Q 2K5HA 5ELEA 2HCCA 1D2BA 1RKNA 1WI5A 1EYDA 3RLFA 3J80E 2Q8RE 5IP9H 4BY7B 2P5ZX 4AYBG 3LX0A 1X9NA 3SR1A 2DJGC 3NK9A 4R4QA 1ZKOA 3CW2C 2UXCL 5C4ZA 5CBAE 1GUSA 4RH6A 1D5MC 3F1ZA 3MEHA 5LMNW 1CI3M 2VL6A 2Z4HA 2A69C 2QDBA 1PH7A 1HZAA 2PZUA 3S1QB 4HMJA 2R92B 5IODA 4R8NA 1WTVA 4B08A 2A6HC 3TSSA 1KQSA 1FNVA 5FOBB 2E8GA 1PH9A 3MHBA 2MNAA 3FPUB 5FLXc 3HOWG 2F0QA 2VY3A 4GLAC 2JYOA 4YCVA 4ZKBB 1IKMA 4DUZL 1Y1WH 2UXDQ 2O4XA 2NVYB 5HGTA 2HUGA 3UE0A 5BR8L 4B9XA 2R93H 1G8ZD 4IN3A 1EWIA 3NQIA 4BY7G 4ZCKA 5C4HA 2DY7A 2F0UA 1VQ9A 1HZCA 1PH1A 4OIJA 2KCMA 3F2BA 3HZXA 2RSOA 5IYDG 1ESRA 1ASZA 3IRBA 1SAPA 1TU2B 2JEBI 3KBXA 1S72A 3TREA 1RHPA 4DV1Q 3C46A 1WTRA 4XDXA 1K0RA 1E3PA 1U5KA 3M3YH 3PO2H 4A75A 1WJJA 4JI7Q 2OCEA 4A3BB 2ZXRA 4DNTB 2ZJRA 2L15A 2PYKA 2PPBC 5CYUA 4RFBA 4DKAC 4G7HC 2R92G 1VQ4A 3M4QA 3K81C 3FKIB 3VA7A 5CBEE 1B44D 4F7XA 3DWQA 2EVBA 1EYCA 2RBMA 4GNXC 1NUCA 2RVLA 3BZKA 4BA1I 4CHTB 3GTPB 2F3IA 2OWOA 3VDYA 1GO3E 4OXPA 2K03A 2Q2IA 2XN9C 3S2DH 1Y1VB 3NBIA 5EPJA 5C4XH 3PIO3 4BBSH 4OIKA 5LHY1 4DV3L 2NVTH 4XYQA 2JEAI 2K28A 1WTQA 2KJXA 1Y8PB 4QF4A 2JA5H 5J1ZA 2ZTEA 4L5TA 3V2TA 2O2LD 3H91A 4JI0Q 2XVSA 5EGTA 2F0OA 2AMCB 5CMDA 2B39A 1SROA 1U4RA 1DXMA 1EU3A 1PRTF 2RHSB 1DYQA 3GTGB 1TS3A 1YJ9A 1HNZL 3KUPA 3GV3A 4J8QA 4JI7L 3MFGA 1DOKA 3K5OA 3FKIG 2N3SA 3S1NB 2N8NA 1U4MA 4GOPC 4EQNA 5M3MH 4O0AA 3H0GH 2F52A 2CH4A 4X62Q 5F2DA 2UUAQ 2YU9B 1IZ6A 1X6OA 3D0FA 4DV0Q 1Y1VG 3CHBD 2VXWA 3OMCA 3A55A 3RNUA 1A3TA 3NELA 3T1HL 4DR3L 5FLMG 3H3VI 3FDTA 3GP7A 3Q6SA 3HOUH 4JYAL 2RQXA 4GKKQ 3PUYA 3FHWA 4LF7L 1M1KC 3MXGA 5A2QL 5ELNA 5KEEA 1I4HA 1SNDA 3GTLB 2HCIA 1H9SB 1QUQA 4A3JB 2B63B 4XIGS 4JI0L 4FXDA 3H09A 1D7QA 4FO2A 2DUDA 3G6JB 3MXNA 5KNDA 2K5NA 2K5VA 2J4XA 4BBRB 3HKZE 5FK9C 1HNXL 3PSIA 2F0JA 2EYHA 4C1NI 3S17B 1QNUA 5E7NA 1PTOD 5J39A 1XTDA 1O78A 4G57A 1NAPA 4RHRA 3Q0AA 4K14A 3MEFA 2OXPA 1T5XD 1HUNA 4LWCA 3GQBA 1AE3A 1LYLA 4A3EB 1X54A 3HGBA 3CCUA 1JJCB 1VF5C 1V43A 1B1ZA 3GD7A 4NPSA 4X62L 2UUAL 2GA4B 5EPKA 1Q12A 2EQSA 4NKLA 2Z8LA 4DV0L 1LV9A 3CCVA 2F0PA 2FFKB 4OX9Q 2VUMB 1SMYD 3LWEA 5KGUA 3MVVA 2F0FA 1IW7C 2AUKA 1MKHA 2D0PA 5GQOA 1TY0A 4A3JG 1H95A 2B63G 4A3IB 4V190 1NCVA 1H9RA 2BE5D 3I4MB 1IBLQ 2MP1A 4K6LA 3CPWA 1B8AA 4DV5Q 4N9PA 4BBRG 4C3IB 1N32Q 2IT1A 1J8IA 4RWSC 4IFDG 1YNND 3OTOL 5C5LA 4DN4M 2UXBQ 3BYYB 1VQBA 2EJFC 3U50C 2PCFB 2GVAA 1PZJD 1I94Q 4IALA 1J5EQ 1ET9A 3HOWH 4DK3C 5EQ0A 3OPOA 3PUZA 5ELCA 1YIJA 3PV0A 4LNQA 4L6TB 4WJWA 3F2CA 4A3EG 4GN5A 2IY5B 1IL8A 2Q2TA 1I5FA 2NTSA 3R2IA 1JJGA 2MFIA 4BY7H 1TWAB 1BDOA 1QOHA 4ME5A 3URYA 1CQFA 4O1NA 4GZYC 4ZKCB 3I56A 5IYDH 2KEEA 5I2XA 2QGQA 1SE3A 2CWPA 2I5LX 1O7IA 1Q86C 4BY1B 2BDOA 2VNUD 1JMCA 2O5JC 4A3IG 1SNQA 1IYJB 1L0WA 1A63A 3I4MG 1AP0A 1OXSC 5FKAC 3TRZA 4J6HA 3S1QH 3CXCA 4C3IG 4QGUA 2R92H 4A3GB 1CHQD 3EJIA 4KJOA 2MUYA 3FP9A 5CC4A 2WAQB 4DV5L 1NMFA 2Z6KA 2AQ1B 2LS01 5CV4A 2XWJB 4IPCA 2F0EA 2N78A 1PH5A 2UXBL 1G291 3HKSA 3BS1A 1U4LA 5E4WC 1W2BA 2PQAA 2ZJQA 1PYBA 2RDGA 1H9JA 1IKLA 1D1IA 3RUZA 1XTCD 3AEVA 4KI0A 1I6HB 2K52A 2YYZA 3KLWA 3I91A 3DLLA 1TWGB 4CKCA 1C9OA 1J6QA 4L8JA 3UDFA 1JOKA 3ERSX 4DA2A 4HMIA 4IPHA 3J7YW 1C0AA 3CD6A 3D4DA 2QA4A 2F0IA 2KENA 4YWLA 1QVFA 4FF1A 4QIWE 1JQYD 2PW5A 4YY3Q 3U4VA 1CTMA 2PQEA 3D4RA 3S14B 3EFXD 1TS5A 3A7LA 1IL2A 4NXNQ 3K57A 1WD1A 1PFNA 3FKIH 1A3VA 1DZ1A 2WAQG 1FYCA 2HIXA 5I9OA 1EFWA 4CJ0B 1K83B 1Q1BA 1N33L 4IFDJ 3NSWA 1XYIA 3VR2A 3GTPH 1DONA 4A4IA 5KIXA 4NXML 1P16A 2JA8B 1N36Q 4YCWA 2EYJA 5JEAG 4KHPL 3NTKA 4YIJA 1Y1VH 5T1GA 5COYA 1ZYRC 5T1IA 1QVCA 4KMUC 1FVIA 3RN2A 3TDQA 5FLMH 1D1KA 4POFA 1CHPD 4JI1L 4LW1A 3MC0B 3MAQA 1PRTD 5IT9E 1WD0A 5ELBA 1SMXA 1ZEQX 1E24A
chains in the Genus database with same CATH topology
3PUVA 4GN3B 1WFQA 2VQEL 4HJ5A 3M85A 4HJ8A 1VCIA 4A3DG 3J7ZC 3GTOH 3HOUG 1EQQA 2PQAB 1KC8C 1K9MC 1YI2A 2KHJA 2JA7G 3F8TA 1VQ8A 1A8VA 5GROA 4MZ9A 3TS0A 5FJ8G 2F4VQ 1S3OA 2IHFA 4L5QA 3T1HQ 2LXJA 4X65L 3CC7A 3A74A 3ZJYC 5C0XG 4DR3Q 3GTGH 1TWFH 4YY3L 1VQ6A 4LFCL 4A3CG 4JYAQ 2CFMA 1L1OC 1YNXA 1WCMH 4IJLA 4LF7Q 2IX0A 2JJQA 1VQEA 1LM0A 3L7ZC 3CMAA 1KAWA 1X56A 2AWNA 1RL2A 1E22A 3UDIA 5IYBG 1IBML 4BY1H 2PI2A 1AH9A 3S1NH 4LF8Q 2JQOA 4P72A 5C44G 3CCQA 1PH6A 2GVBA 1SR3A 1HR0Q 4LF5Q 3W1BA 4FDBA 1KL9A 4NB3A 3L0OA 4A3FG 3OYYA 3J81j 3CCEA 1PH8A 2JA8G 1NJIC 4OX9L 4EQ5A 3RZDH 2ID0A 1CKMA 4APVA 1X3FA 1DGSA 2ATWA 3PCOB 1YHQA 2PNHA 2UU9L 4JI4Q 4DR1Q 2VQFL 4A3GH 2K5HA 1HNXQ 4HIKA 1WOCA 1VS0A 2BA0A 1NMGA 1WI5A 1XPRA 1YVCA 4LF4Q 4A3BG 1PH4A 3RLFA 1IBLL 3CF5A 4JI2L 1HZ9A 4JI6L 5IP9H 4AYBG 4ALPA 3T1YQ 1N32L 1VQLA 4X66Q 1X9NA 3GTLH 4Y7NH 2HHHQ 4A3JH 4PZ8A 4R4QA 2B63H 1P8LA 3RN5A 2ZJPA 3PF4A 3A5UA 3CW2C 1Q46A 1OXVA 2NZHA 1CKOA 4IPGA 3J80c 4DV4Q 1J5EL 1HZBA 1I94L 1VQKA 2UXCL 4BBRH 2D62A 1VQJA 2RF4A 1QZHA 2MO0A 2ZTDA 1L1OB 3TS2A 2HQLA 3F1ZA 3NENA 3S17H 4B3SL 5LMNW 1VQGA 3STBC 2RCNA 2VL6A 4B3TL 4C2MH 1PH7A 4K0KL 4PMWA 1HZAA 3K0XA 4RG1A 5IP7G 2R7FA 2Z0SA 1C7YA 2R6GA 3E9HA 3J81i 4OO1G 1N34Q 3PIPA 4A3EH 4JBMA 3M9BA 1KQSA 1PYSB 1I50H 3UE1A 4DV2Q 2E8GA 1PH9A 4LF5L 1YJWA 1IBKL 1JJ2A 2MNAA 4JV5L 4P75A 5FLXc 2VY3A 4YCVA 4GLAC 4C3HH 3HOWG 2A1AA 4DUZL 1UWVA 3JC66 1Y1WH 5IWAQ 2UXDQ 4R4OA 3A0JA 3OTOQ 1UE5A 1X65A 5JEAJ 3UE0A 5BR8L 5JJLA 2R93H 1XMQQ 3ICEA 2MQHA 2NZOA 4LUOA 3UDXA 1KXLA 1Q81C 2UUBL 5JJIA 4IFDI 1EWIA 3ULJA 4BY7G 5HGQA 4P73A 4GN4B 4KHZA 1VQ9A 1HZCA 1LTLA 1PH1A 2EXDA 2KCMA 3F2BA 1HR0W 3B6YA 3PO3G 4P71A 2BA1A 4A3IH 1AE2A 5IYDG 1G51A 1U0LA 1ASZA 3HOXG 3IRBA 4AH6A 2HHHL 3I4MH 1OXXK 3KDFA 4R4IA 2JEBI 3NBHB 1S72A 1XNQL 3TREA 5HY6A 4DV1Q 4B3MQ 3S24A 4C3IH 1K0RA 2KHIA 1E3PA 1U5KA 5IYCG 1OXUA 4DV4L 3M3YH 4IOAA 3PO2H 4A75A 1L1OA 3J7A5 1WJJA 5LMNQ 4JI7Q 1JT8A 1EQRA 1VQDA 2OCEA 2IHEA 3UDGA 1XMOL 1ASYA 1PVOA 1I3QH 5C0XJ 2L15A 2ZJRA 1K3RA 2GN5A 3GTQH 4JG2A 3CCRA 2WFWA 4DKAC 2R92G 1VQ4A 3M4QA 5M3FG 3K81C 1PV4A 1CSQA 1NY4A 2ES2A 4LFBQ 4GNXC 2OQKA 3BZKA 4BA1I 2LXKA 2H5XA 4OWXB 4WJ4A 3G71A 3CCLA 3RLNA 1PHJA 1GKHA 2F3IA 1FGUA 4YCUA 4QY7A 2OWOA 3VDYA 3HOZG 2JA6G 1GO3E 1TWAH 4OXPA 4A3MG 4DR6Q 3J80i 3GO5A 2Q2IA 3HOVG 3I4NG 5H1SE 3S2DH 2R7ZG 5C4XH 5IWAL 4BBSH 3I2ZA 4DV3L 1FL0A 2NVTH 5GAGC 2JEAI 4NXNL 5C3EH 2JA5H 3E0EA 2NVQH 2E2IH 4DR4Q 1XMQL 2ZTEA 1VQCA 2HIVA 3D31A 4L5TA 3PIOA 2A19A 4LF6Q 3OW2A 1HNWQ 4GLXA 3F2DA 4JI0Q 4JBKA 4LF9Q 5AJ3Q 1YJNA 3Q8DA 4JI5L 3S1MH 4GKJQ 2AWOA 2AMCB 4HIDA 4IJHA 1SROA 5J3BA 2JE6I 4A93G 1Q8KA 4JOIC 1N36L 2K4KA 3H3VH 3PUWA 3RLOA 4B3ML 4A3LG 2RHSB 1B70B 4PZ7A 2E2HH 3BJUA 3KF6A 1Z9FA 2DGYA 1YJ9A 1HNZL 3KJPA 4JI7L 1UE6A 4DV6Q 1K73C 2VUMG 1E7ZA 1CUKA 1E1OA 2QEXA 4GNXB 4BXXH 3FKIG 4R4TA 2YTYA 3HOYG 5C4JH 2N3SA 2N8NA 4GOPC 3KDFB 4DNIA 4O0AA 5M3MH 3H0GH 2F52A 4P74A 4X62Q 1YZ6A 2CKZB 2UUAQ 1MJEA 3G4SA 2VW9A 1I6HH 1IZ6A 2A8VA 1X6OA 3D0FA 4DV0Q 1Y1VG 1VQMA 1RIPA 2NN6I 1TWGH 4C3JH 2I0QA 3RNUA 4TVAB 1XPOA 1N33Q 1VQNA 3NELA 2F4VL 3T1HL 4DR2Q 3M4PA 3CP0A 4UP9A 4DR3L 1N9WA 5FLMG 4NXMQ 3H3VI 4A3KG 4X64Q 2CCZA 4A3DH 3HOUH 4JYAL 3W5OA 1FJGQ 2XGTA 4GKKQ 4H02A 1TWCH 3PUYA 3FHWA 4QJFA 1M1KC 5GAHC 4LF7L 4KHPQ 2JA7H 4DUYQ 1PA6A 5ELNA 3TQYA 3AFPA 5FJ8H 1SN8A 1SLJA 1X3EA 4HJ7A 2NVYH 4LF8L 3S14H 4HIMA 5M5YH 1HR0L 3ULPA 1QUQA 4JBWA 1Y14B 4POGA 3M4OH 4R1JA 4XIGS 4DAYB 4DR5Q 4JI1Q 4JI0L 4A3CH 5AJ3L 1D7QA 2DUDA 1VQPA 5LMUQ 4GKJL 4RMFA 2K5NA 3U4ZA 2C35B 2K5VA 1PH2A 2HT1A 1VQOA 5IYBH 1K83H 2VQEQ 4A76A 5C44H 3HKZE 3WWVA 3J81c 4DR1L 1HNXL 3PSIA 4JI4L 4X6AH 1YHBA 3CMEA 4A3FH 2FXQA 1WYDA 2JK8A 4JI8Q 1EIYB 5E7NA 2LSSA 2Z6KC 1WCMG 1XTDA 4LF4L 2JA8H 3KFUA 2PMZE 4GOPB 4IO9A 3MEFA 4DV6L 4GNXA 1X3GA 4BY1G 4DAMA 4UY8C 3T1YL 4LWCA 4JI3Q 1YBYA 4X66L 2K50A 1AE3A 2E5LQ 1LYLA 4LFCQ 1X54A 3CCUA 4HJ9A 1JJCB 4YWMA 4LFAQ 2MO1A 4A3BH 1SFOH 4MTNA 2OQ0A 2WB1E 4OWTB 1EYGA 2AHOB 4DR7Q 1V43A 4IPDA 1T9HA 3GD7A 2B3GA 4J15A 4NPSA 4X62L 1IBMQ 2UUAL 4MNOA 4L5SA 1Q12A 4A3GG 1X55A 3KF8B 3NEMA 4B3RQ 2EQSA 1BKBA 3KF6B 1CKNA 3K7UC 4DV0L 3LGJA 1B7YB 3CCVA 1Q82C 4DK6C 4OX9Q 2KCTA 4DR2L 4LUVA 2R7DA 1EUJA 1L2FA 1SE8A 3I7FA 4X64L 3ULLA 5IP9G 2UU9Q 1FJGL 3CPFA 5GQOA 1MKHA 2D0PA 3KOJA 4DPGA 2I5HA 1Q1EA 4A3JG 4DUYL 4DV7Q 1N8RC 1N34L 3HFZB 1H95A 1NTGA 4JOIA 4YHHQ 2B63G 3STBD 4DV2L 1K8AC 1HJPA 1IBLQ 2OTJA 3RZOH 4JI2Q 4DR5L 5IP7H 3CPWA 1B8AA 4DV5Q 4BBRG 4WJ3M 1N32Q 3JAMc 2IT1A 1XNRQ 2IX1A 4IFDG 2ZTCA 2UXDL 4PZ6A 3OTOL 5M5XH 3PF5A 1Q7YC 2UXBQ 2NVXH 1A0IA 4QL5A 1SRUA 1VQBA 3AYHB 3U50C 3U58A 1A63A 2K14A 2GVAA 1I94Q 2UXCQ 2WAQE 2ZM6Q 2Y0SE 1J5EQ 3S16H 1KHIA 3BU2A 3HOWH 4DK3C 4JI8L 3PUZA 4GOPA 3E9IA 2WP8J 1BVSA 5IT9c 3PV0A 1QUQB 1YIJA 4LNQA 3KYHC 3F2CA 4A3EG 4GN5A 4B3SQ 2IY5B 3K80C 4JI3L 1I5FA 1TXYA 3MXNB 2Q2TA 4B3TQ 4OWWB 2E5LL 4K0KQ 1Z47A 1KRTA 1JJGA 2MFIA 4L5RC 2YV5A 4DV1L 2YTXA 2D0OA 1E1TA 4LFAL 1Y1WG 4BY7H 4Y52H 3S2HH 2Q2HA 1VQFA 3I55A 4DR7L 1VQ5A 3S15H 4HJAA 3PO3H 4B3RL 3I56A 3PUXA 1BBUA 5IY0A 5LMNL 4OONA 2N49A 2R93G 5IYDH 3PGZA 2QGQA 3HOXH 1KRSA 1TWHH 2CWPA 1IBKQ 1UE7A 4JV5Q 2I5LX 4AQYQ 1O7IA 1Q86C 3EIVA 4DUZQ 4OO1I 2YU9H 1UE1A 3S1RH 3AFQA 4BA2I 2VNUD 5IYCH 4GS3A 5BR8Q 2BH2A 3W1GA 4JC0A 1VQHA 1JMCA 4A3IG 4XTCS 2Q2UA 4LFBL 1IYJB 2EIFA 2KBNA 4KLKA 1L0WA 1JB7A 3HKZG 1VQ7A 2UUBQ 1OXSC 1A62A 4DV7L 3I4MG 2K75A 2E2JH 3TRZA 4YHHL 1KD1C 3S1QH 4QQBX 3CXCA 2CQOA 4GLVB 4QGUA 5JJKA 2R92H 5M5WH 4UP8A 1KIXA 3GTMH 1CKNB 4DR6L 5M3FH 1G6PA 3FP9A 1M90C 2V1CC 2UUCQ 3PO2G 4DV5L 1NMFA 4TQUS 1XNRL 1NBWA 1VQIA 2I5MX 2Z6KA 1JE5A 4IPCA 1PH5A 2N78A 2PI2E 1XNQQ 3RR5A 1G291 2UXBL 3AQQA 4DR4L 3HOZH 3HKSA 1XJVA 2JA6H 4A3MH 1OTCA 2ALYB 4IOCA 1W2BA 2PQAA 1QZGA 2ZJQA 3HOVH 2ZM6L 2WB1G 3K8AA 1PH3A 1PYBA 3EBEA 3I4NH 2R7ZH 4LF6L 3CCMA 1HNWL 3GTKH 5ELOA 1XMOQ 4UPAA 1K8GA 3GTJH 4LF9L 4PG3A 2BH8A 3H15A 1BBWA 1YITA 3KJOA 3AEVA 4KI0A 1GM5A 3GDEA 1CSPA 2K52A 1VQAA 3CQZH 1PFSA 1UEBA 2YYZA 3KLWA 1GVPA 3CCJA 3DLLA 3JAMi 5IE8A 1C9OA 1J6QA 4JBJA 3UDFA 5C4XG 4BBSG 3K7AH 3ERSX 1D8LA 1NE3A 5GADC 5C3EG 4IPHA 2JA5G 1C0AA 3CD6A 4AYBE 4A93H 5GAEC 2CWAA 3BZCA 1HH2P 2QA4A 3M7NA 4HIOA 1R9TH 2KENA 4YWLA 3CAMA 1QVFA 1MJCA 4QIWE 4X65Q 4AQYL 4UP7A 2YTVA 3I4OA 4YY3Q 3U4VA 4A3LH 4ME3A 5DLQE 4AIMA 4DV3Q 1V1QA 2VS1A 2NN6G 4NXNQ 1IL2A 2XTIA 1S40A 3CC2A 1W3SA 3ER0A 5C0XI 2VUMH 4LUZA 4EX5A 2VZAA 3DM3A 4R4CA 3TEHB 3CCSA 3FKIH 4YWKA 3L2PA 2WAQG 2HIXA 2Y0SG 1EFWA 1XPUA 3HOYH 1IXRA 2JA9A 1Q1BA 5EAYA 1QVGA 4JI5Q 1MIUA 1N33L 3SGIA 4IFDJ 2UUCL 3GTPH 1YEZA 4A4IA 4NXML 1P16A 1N36Q 3A5ZB 4YCWA 2OTLA 2VQFQ 2ASBA 2AKWB 4GKKL 4BXXG 5JEAG 4KHPL 1GD7A 1Y1VH 1EIFA 2RHQB 4JCVE 1QVCA 1FVIA 5M3MG 3EN2A 3H0GG 5FLMH 3RN2A 1HNZQ 4A3KH 5K36G 1YHAA 4POFA 4JI6Q 4JI1L 1LUZA 1EOVA 4LW1A 3CC4A 1OXTA 3G6EA 3G48A 2B29A 5LMUL 1SMXA 1V9PA 1E24A 4O2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  4GN3 B;  1WFQ A;  2VQE L;  4HJ5 A;  3M85 A;  4HJ8 A;  1VCI A;  4A3D G;  3J7Z C;  3GTO H;  3HOU G;  1EQQ A;  2PQA B;  1KC8 C;  1K9M C;  1YI2 A;  2KHJ A;  2JA7 G;  3F8T A;  1VQ8 A;  1A8V A;  5GRO A;  4MZ9 A;  3TS0 A;  5FJ8 G;  2F4V Q;  1S3O A;  2IHF A;  4L5Q A;  3T1H Q;  2LXJ A;  4X65 L;  3CC7 A;  3A74 A;  3ZJY C;  5C0X G;  4DR3 Q;  3GTG H;  1TWF H;  4YY3 L;  1VQ6 A;  4LFC L;  4A3C G;  4JYA Q;  2CFM A;  1L1O C;  1YNX A;  1WCM H;  4IJL A;  4LF7 Q;  2IX0 A;  2JJQ A;  1VQE A;  1LM0 A;  3L7Z C;  3CMA A;  1KAW A;  1X56 A;  2AWN A;  1RL2 A;  1E22 A;  3UDI A;  5IYB G;  1IBM L;  4BY1 H;  2PI2 A;  1AH9 A;  3S1N H;  4LF8 Q;  2JQO A;  4P72 A;  5C44 G;  3CCQ A;  1PH6 A;  2GVB A;  1SR3 A;  1HR0 Q;  4LF5 Q;  3W1B A;  4FDB A;  1KL9 A;  4NB3 A;  3L0O A;  4A3F G;  3OYY A;  3J81 j;  3CCE A;  1PH8 A;  2JA8 G;  1NJI C;  4OX9 L;  4EQ5 A;  3RZD H;  2ID0 A;  1CKM A;  4APV A;  1X3F A;  1DGS A;  2ATW A;  3PCO B;  1YHQ A;  2PNH A;  2UU9 L;  4JI4 Q;  4DR1 Q;  2VQF L;  4A3G H;  2K5H A;  1HNX Q;  4HIK A;  1WOC A;  1VS0 A;  2BA0 A;  1NMG A;  1WI5 A;  1XPR A;  1YVC A;  4LF4 Q;  4A3B G;  1PH4 A;  3RLF A;  1IBL L;  3CF5 A;  4JI2 L;  1HZ9 A;  4JI6 L;  5IP9 H;  4AYB G;  4ALP A;  3T1Y Q;  1N32 L;  1VQL A;  4X66 Q;  1X9N A;  3GTL H;  4Y7N H;  2HHH Q;  4A3J H;  4PZ8 A;  4R4Q A;  2B63 H;  1P8L A;  3RN5 A;  2ZJP A;  3PF4 A;  3A5U A;  3CW2 C;  1Q46 A;  1OXV A;  2NZH A;  1CKO A;  4IPG A;  3J80 c;  4DV4 Q;  1J5E L;  1HZB A;  1I94 L;  1VQK A;  2UXC L;  4BBR H;  2D62 A;  1VQJ A;  2RF4 A;  1QZH A;  2MO0 A;  2ZTD A;  1L1O B;  3TS2 A;  2HQL A;  3F1Z A;  3NEN A;  3S17 H;  4B3S L;  5LMN W;  1VQG A;  3STB C;  2RCN A;  2VL6 A;  4B3T L;  4C2M H;  1PH7 A;  4K0K L;  4PMW A;  1HZA A;  3K0X A;  4RG1 A;  5IP7 G;  2R7F A;  2Z0S A;  1C7Y A;  2R6G A;  3E9H A;  3J81 i;  4OO1 G;  1N34 Q;  3PIP A;  4A3E H;  4JBM A;  3M9B A;  1KQS A;  1PYS B;  1I50 H;  3UE1 A;  4DV2 Q;  2E8G A;  1PH9 A;  4LF5 L;  1YJW A;  1IBK L;  1JJ2 A;  2MNA A;  4JV5 L;  4P75 A;  5FLX c;  2VY3 A;  4YCV A;  4GLA C;  4C3H H;  3HOW G;  2A1A A;  4DUZ L;  1UWV A;  3JC6 6;  1Y1W H;  5IWA Q;  2UXD Q;  4R4O A;  3A0J A;  3OTO Q;  1UE5 A;  1X65 A;  5JEA J;  3UE0 A;  5BR8 L;  5JJL A;  2R93 H;  1XMQ Q;  3ICE A;  2MQH A;  2NZO A;  4LUO A;  3UDX A;  1KXL A;  1Q81 C;  2UUB L;  5JJI A;  4IFD I;  1EWI A;  3ULJ A;  4BY7 G;  5HGQ A;  4P73 A;  4GN4 B;  4KHZ A;  1VQ9 A;  1HZC A;  1LTL A;  1PH1 A;  2EXD A;  2KCM A;  3F2B A;  1HR0 W;  3B6Y A;  3PO3 G;  4P71 A;  2BA1 A;  4A3I H;  1AE2 A;  5IYD G;  1G51 A;  1U0L A;  1ASZ A;  3HOX G;  3IRB A;  4AH6 A;  2HHH L;  3I4M H;  1OXX K;  3KDF A;  4R4I A;  2JEB I;  3NBH B;  1S72 A;  1XNQ L;  3TRE A;  5HY6 A;  4DV1 Q;  4B3M Q;  3S24 A;  4C3I H;  1K0R A;  2KHI A;  1E3P A;  1U5K A;  5IYC G;  1OXU A;  4DV4 L;  3M3Y H;  4IOA A;  3PO2 H;  4A75 A;  1L1O A;  3J7A 5;  1WJJ A;  5LMN Q;  4JI7 Q;  1JT8 A;  1EQR A;  1VQD A;  2OCE A;  2IHE A;  3UDG A;  1XMO L;  1ASY A;  1PVO A;  1I3Q H;  5C0X J;  2L15 A;  2ZJR A;  1K3R A;  2GN5 A;  3GTQ H;  4JG2 A;  3CCR A;  2WFW A;  4DKA C;  2R92 G;  1VQ4 A;  3M4Q A;  5M3F G;  3K81 C;  1PV4 A;  1CSQ A;  1NY4 A;  2ES2 A;  4LFB Q;  4GNX C;  2OQK A;  3BZK A;  4BA1 I;  2LXK A;  2H5X A;  4OWX B;  4WJ4 A;  3G71 A;  3CCL A;  3RLN A;  1PHJ A;  1GKH A;  2F3I A;  1FGU A;  4YCU A;  4QY7 A;  2OWO A;  3VDY A;  3HOZ G;  2JA6 G;  1GO3 E;  1TWA H;  4OXP A;  4A3M G;  4DR6 Q;  3J80 i;  3GO5 A;  2Q2I A;  3HOV G;  3I4N G;  5H1S E;  3S2D H;  2R7Z G;  5C4X H;  5IWA L;  4BBS H;  3I2Z A;  4DV3 L;  1FL0 A;  2NVT H;  5GAG C;  2JEA I;  4NXN L;  5C3E H;  2JA5 H;  3E0E A;  2NVQ H;  2E2I H;  4DR4 Q;  1XMQ L;  2ZTE A;  1VQC A;  2HIV A;  3D31 A;  4L5T A;  3PIO A;  2A19 A;  4LF6 Q;  3OW2 A;  1HNW Q;  4GLX A;  3F2D A;  4JI0 Q;  4JBK A;  4LF9 Q;  5AJ3 Q;  1YJN A;  3Q8D A;  4JI5 L;  3S1M H;  4GKJ Q;  2AWO A;  2AMC B;  4HID A;  4IJH A;  1SRO A;  5J3B A;  2JE6 I;  4A93 G;  1Q8K A;  4JOI C;  1N36 L;  2K4K A;  3H3V H;  3PUW A;  3RLO A;  4B3M L;  4A3L G;  2RHS B;  1B70 B;  4PZ7 A;  2E2H H;  3BJU A;  3KF6 A;  1Z9F A;  2DGY A;  1YJ9 A;  1HNZ L;  3KJP A;  4JI7 L;  1UE6 A;  4DV6 Q;  1K73 C;  2VUM G;  1E7Z A;  1CUK A;  1E1O A;  2QEX A;  4GNX B;  4BXX H;  3FKI G;  4R4T A;  2YTY A;  3HOY G;  5C4J H;  2N3S A;  2N8N A;  4GOP C;  3KDF B;  4DNI A;  4O0A A;  5M3M H;  3H0G H;  2F52 A;  4P74 A;  4X62 Q;  1YZ6 A;  2CKZ B;  2UUA Q;  1MJE A;  3G4S A;  2VW9 A;  1I6H H;  1IZ6 A;  2A8V A;  1X6O A;  3D0F A;  4DV0 Q;  1Y1V G;  1VQM A;  1RIP A;  2NN6 I;  1TWG H;  4C3J H;  2I0Q A;  3RNU A;  4TVA B;  1XPO A;  1N33 Q;  1VQN A;  3NEL A;  2F4V L;  3T1H L;  4DR2 Q;  3M4P A;  3CP0 A;  4UP9 A;  4DR3 L;  1N9W A;  5FLM G;  4NXM Q;  3H3V I;  4A3K G;  4X64 Q;  2CCZ A;  4A3D H;  3HOU H;  4JYA L;  3W5O A;  1FJG Q;  2XGT A;  4GKK Q;  4H02 A;  1TWC H;  3PUY A;  3FHW A;  4QJF A;  1M1K C;  5GAH C;  4LF7 L;  4KHP Q;  2JA7 H;  4DUY Q;  1PA6 A;  5ELN A;  3TQY A;  3AFP A;  5FJ8 H;  1SN8 A;  1SLJ A;  1X3E A;  4HJ7 A;  2NVY H;  4LF8 L;  3S14 H;  4HIM A;  5M5Y H;  1HR0 L;  3ULP A;  1QUQ A;  4JBW A;  1Y14 B;  4POG A;  3M4O H;  4R1J A;  4XIG S;  4DAY B;  4DR5 Q;  4JI1 Q;  4JI0 L;  4A3C H;  5AJ3 L;  1D7Q A;  2DUD A;  1VQP A;  5LMU Q;  4GKJ L;  4RMF A;  2K5N A;  3U4Z A;  2C35 B;  2K5V A;  1PH2 A;  2HT1 A;  1VQO A;  5IYB H;  1K83 H;  2VQE Q;  4A76 A;  5C44 H;  3HKZ E;  3WWV A;  3J81 c;  4DR1 L;  1HNX L;  3PSI A;  4JI4 L;  4X6A H;  1YHB A;  3CME A;  4A3F H;  2FXQ A;  1WYD A;  2JK8 A;  4JI8 Q;  1EIY B;  5E7N A;  2LSS A;  2Z6K C;  1WCM G;  1XTD A;  4LF4 L;  2JA8 H;  3KFU A;  2PMZ E;  4GOP B;  4IO9 A;  3MEF A;  4DV6 L;  4GNX A;  1X3G A;  4BY1 G;  4DAM A;  4UY8 C;  3T1Y L;  4LWC A;  4JI3 Q;  1YBY A;  4X66 L;  2K50 A;  1AE3 A;  2E5L Q;  1LYL A;  4LFC Q;  1X54 A;  3CCU A;  4HJ9 A;  1JJC B;  4YWM A;  4LFA Q;  2MO1 A;  4A3B H;  1SFO H;  4MTN A;  2OQ0 A;  2WB1 E;  4OWT B;  1EYG A;  2AHO B;  4DR7 Q;  1V43 A;  4IPD A;  1T9H A;  3GD7 A;  2B3G A;  4J15 A;  4NPS A;  4X62 L;  1IBM Q;  2UUA L;  4MNO A;  4L5S A;  1Q12 A;  4A3G G;  1X55 A;  3KF8 B;  3NEM A;  4B3R Q;  2EQS A;  1BKB A;  3KF6 B;  1CKN A;  3K7U C;  4DV0 L;  3LGJ A;  1B7Y B;  3CCV A;  1Q82 C;  4DK6 C;  4OX9 Q;  2KCT A;  4DR2 L;  4LUV A;  2R7D A;  1EUJ A;  1L2F A;  1SE8 A;  3I7F A;  4X64 L;  3ULL A;  5IP9 G;  2UU9 Q;  1FJG L;  3CPF A;  5GQO A;  1MKH A;  2D0P A;  3KOJ A;  4DPG A;  2I5H A;  1Q1E A;  4A3J G;  4DUY L;  4DV7 Q;  1N8R C;  1N34 L;  3HFZ B;  1H95 A;  1NTG A;  4JOI A;  4YHH Q;  2B63 G;  3STB D;  4DV2 L;  1K8A C;  1HJP A;  1IBL Q;  2OTJ A;  3RZO H;  4JI2 Q;  4DR5 L;  5IP7 H;  3CPW A;  1B8A A;  4DV5 Q;  4BBR G;  4WJ3 M;  1N32 Q;  3JAM c;  2IT1 A;  1XNR Q;  2IX1 A;  4IFD G;  2ZTC A;  2UXD L;  4PZ6 A;  3OTO L;  5M5X H;  3PF5 A;  1Q7Y C;  2UXB Q;  2NVX H;  1A0I A;  4QL5 A;  1SRU A;  1VQB A;  3AYH B;  3U50 C;  3U58 A;  1A63 A;  2K14 A;  2GVA A;  1I94 Q;  2UXC Q;  2WAQ E;  2ZM6 Q;  2Y0S E;  1J5E Q;  3S16 H;  1KHI A;  3BU2 A;  3HOW H;  4DK3 C;  4JI8 L;  3PUZ A;  4GOP A;  3E9I A;  2WP8 J;  1BVS A;  5IT9 c;  3PV0 A;  1QUQ B;  1YIJ A;  4LNQ A;  3KYH C;  3F2C A;  4A3E G;  4GN5 A;  4B3S Q;  2IY5 B;  3K80 C;  4JI3 L;  1I5F A;  1TXY A;  3MXN B;  2Q2T A;  4B3T Q;  4OWW B;  2E5L L;  4K0K Q;  1Z47 A;  1KRT A;  1JJG A;  2MFI A;  4L5R C;  2YV5 A;  4DV1 L;  2YTX A;  2D0O A;  1E1T A;  4LFA L;  1Y1W G;  4BY7 H;  4Y52 H;  3S2H H;  2Q2H A;  1VQF A;  3I55 A;  4DR7 L;  1VQ5 A;  3S15 H;  4HJA A;  3PO3 H;  4B3R L;  3I56 A;  3PUX A;  1BBU A;  5IY0 A;  5LMN L;  4OON A;  2N49 A;  2R93 G;  5IYD H;  3PGZ A;  2QGQ A;  3HOX H;  1KRS A;  1TWH H;  2CWP A;  1IBK Q;  1UE7 A;  4JV5 Q;  2I5L X;  4AQY Q;  1O7I A;  1Q86 C;  3EIV A;  4DUZ Q;  4OO1 I;  2YU9 H;  1UE1 A;  3S1R H;  3AFQ A;  4BA2 I;  2VNU D;  5IYC H;  4GS3 A;  5BR8 Q;  2BH2 A;  3W1G A;  4JC0 A;  1VQH A;  1JMC A;  4A3I G;  4XTC S;  2Q2U A;  4LFB L;  1IYJ B;  2EIF A;  2KBN A;  4KLK A;  1L0W A;  1JB7 A;  3HKZ G;  1VQ7 A;  2UUB Q;  1OXS C;  1A62 A;  4DV7 L;  3I4M G;  2K75 A;  2E2J H;  3TRZ A;  4YHH L;  1KD1 C;  3S1Q H;  4QQB X;  3CXC A;  2CQO A;  4GLV B;  4QGU A;  5JJK A;  2R92 H;  5M5W H;  4UP8 A;  1KIX A;  3GTM H;  1CKN B;  4DR6 L;  5M3F H;  1G6P A;  3FP9 A;  1M90 C;  2V1C C;  2UUC Q;  3PO2 G;  4DV5 L;  1NMF A;  4TQU S;  1XNR L;  1NBW A;  1VQI A;  2I5M X;  2Z6K A;  1JE5 A;  4IPC A;  1PH5 A;  2N78 A;  2PI2 E;  1XNQ Q;  3RR5 A;  1G29 1;  2UXB L;  3AQQ A;  4DR4 L;  3HOZ H;  3HKS A;  1XJV A;  2JA6 H;  4A3M H;  1OTC A;  2ALY B;  4IOC A;  1W2B A;  2PQA A;  1QZG A;  2ZJQ A;  3HOV H;  2ZM6 L;  2WB1 G;  3K8A A;  1PH3 A;  1PYB A;  3EBE A;  3I4N H;  2R7Z H;  4LF6 L;  3CCM A;  1HNW L;  3GTK H;  5ELO A;  1XMO Q;  4UPA A;  1K8G A;  3GTJ H;  4LF9 L;  4PG3 A;  2BH8 A;  3H15 A;  1BBW A;  1YIT A;  3KJO A;  3AEV A;  4KI0 A;  1GM5 A;  3GDE A;  1CSP A;  2K52 A;  1VQA A;  3CQZ H;  1PFS A;  1UEB A;  2YYZ A;  3KLW A;  1GVP A;  3CCJ A;  3DLL A;  3JAM i;  5IE8 A;  1C9O A;  1J6Q A;  4JBJ A;  3UDF A;  5C4X G;  4BBS G;  3K7A H;  3ERS X;  1D8L A;  1NE3 A;  5GAD C;  5C3E G;  4IPH A;  2JA5 G;  1C0A A;  3CD6 A;  4AYB E;  4A93 H;  5GAE C;  2CWA A;  3BZC A;  1HH2 P;  2QA4 A;  3M7N A;  4HIO A;  1R9T H;  2KEN A;  4YWL A;  3CAM A;  1QVF A;  1MJC A;  4QIW E;  4X65 Q;  4AQY L;  4UP7 A;  2YTV A;  3I4O A;  4YY3 Q;  3U4V A;  4A3L H;  4ME3 A;  5DLQ E;  4AIM A;  4DV3 Q;  1V1Q A;  2VS1 A;  2NN6 G;  4NXN Q;  1IL2 A;  2XTI A;  1S40 A;  3CC2 A;  1W3S A;  3ER0 A;  5C0X I;  2VUM H;  4LUZ A;  4EX5 A;  2VZA A;  3DM3 A;  4R4C A;  3TEH B;  3CCS A;  3FKI H;  4YWK A;  3L2P A;  2WAQ G;  2HIX A;  2Y0S G;  1EFW A;  1XPU A;  3HOY H;  1IXR A;  2JA9 A;  1Q1B A;  5EAY A;  1QVG A;  4JI5 Q;  1MIU A;  1N33 L;  3SGI A;  4IFD J;  2UUC L;  3GTP H;  1YEZ A;  4A4I A;  4NXM L;  1P16 A;  1N36 Q;  3A5Z B;  4YCW A;  2OTL A;  2VQF Q;  2ASB A;  2AKW B;  4GKK L;  4BXX G;  5JEA G;  4KHP L;  1GD7 A;  1Y1V H;  1EIF A;  2RHQ B;  4JCV E;  1QVC A;  1FVI A;  5M3M G;  3EN2 A;  3H0G G;  5FLM H;  3RN2 A;  1HNZ Q;  4A3K H;  5K36 G;  1YHA A;  4POF A;  4JI6 Q;  4JI1 L;  1LUZ A;  1EOV A;  4LW1 A;  3CC4 A;  1OXT A;  3G6E A;  3G48 A;  2B29 A;  5LMU L;  1SMX A;  1V9P A;  1E24 A;  4O2D A; 
#chains in the Genus database with same CATH topology
 1EY0 A;  4UAI A;  2Z9H A;  4ZK9 B;  2H1E A;  2AQ2 B;  2DNC A;  1GUT A;  1VCI A;  1TR5 A;  1EQQ A;  1KC8 C;  1TS2 A;  2IX3 A;  4DK1 A;  1VQ8 A;  5C0X G;  1Q90 A;  2EY5 A;  3GTG H;  1TWF H;  4YY3 L;  3VR3 A;  1JC7 A;  5CV7 A;  1LM0 A;  3L7Z C;  3SE0 A;  3CMA A;  4WFN 3;  3S2D B;  1IBM L;  1H9M A;  5KRU A;  5C4X B;  3MZ5 A;  3S1N H;  4LF8 Q;  4BBS B;  5KYL A;  1YNJ C;  5C44 G;  3CCQ A;  4LF5 Q;  1AH9 A;  1EIH A;  5M5X B;  2NVT B;  4FDB A;  2QCP X;  5D14 A;  3OYY A;  2JA8 G;  1PTO C;  1NJI C;  3K6O A;  2X6G A;  2KCC A;  2ATW A;  1YHQ A;  1GUW A;  3DWP A;  3LWU A;  1WOC A;  2CW0 C;  1EIG A;  2EDG A;  2K5Q A;  2BA0 A;  3A8I E;  1YVC A;  3SHL A;  1B50 A;  4K5X A;  1HZ9 A;  3T1Y Q;  4X66 Q;  3GTL H;  4CJ2 C;  2HHH Q;  4X3U A;  1RD9 D;  1W6J A;  4A3J H;  4PZ8 A;  2B63 H;  4MN3 A;  3A5U A;  1K0S A;  3TP5 A;  5A35 A;  3J7A F;  4I7Z C;  4DV4 Q;  1LT5 D;  1LTI D;  1HZB A;  4BBR H;  1SDF A;  2MO0 A;  4IFD H;  1AW7 A;  2ZTD A;  2NB0 A;  5M3M B;  1LTA D;  2HQL A;  1M8A A;  3S17 H;  2F0G A;  2WV6 D;  3BZD B;  1JB3 A;  1SYE A;  1VQG A;  1STB A;  2BE5 C;  4B3T L;  4K6D A;  2K01 A;  3K0X A;  5FLX E;  5IP7 G;  4KKU A;  1VDZ A;  1C7Y A;  3GTM B;  5M3F B;  1YNN C;  1DD2 A;  4A3E H;  4JBM A;  3M9B A;  1PYS B;  3UE1 A;  3SDZ A;  4LF5 L;  1BXT A;  1UEA B;  1IBK L;  1JJ2 A;  3K5M A;  3HOZ B;  2A1A A;  1SYF A;  3FMC A;  1UWV A;  3JC6 6;  1JOR A;  2OF1 A;  4R4O A;  2DNE A;  5JEA J;  3I4N B;  5JJL A;  3NTH A;  1XMQ Q;  2NZO A;  3UDX A;  3C3L A;  2UUB L;  2H4O A;  3CQZ B;  4LMQ D;  5DNF A;  1CZW A;  1SNP A;  2BA1 A;  4A3I H;  3K7A B;  1U0L A;  2X6L A;  3I4M H;  2HHH L;  4Z9C B;  4R4I A;  3NBH B;  1XNQ L;  5HY6 A;  4B3M Q;  4C3I H;  1R9T B;  4DV4 L;  1OXU A;  3D8G A;  4IOA A;  1L1O A;  1SYG A;  5LMN Q;  2RDF A;  3DEP A;  3UDG A;  4CDF C;  2DN8 A;  5C0X J;  4P2C B;  1A6X A;  1K3R A;  3U9O A;  3M7G A;  5M3F G;  5FO9 B;  2SEB D;  3SK5 A;  3OMG A;  2F0T A;  2PNR C;  5ELF A;  2H5X A;  1PHJ A;  2MHV A;  1H9S A;  3HOZ G;  1TWA H;  4DR6 Q;  5L37 A;  1I4R A;  1AN8 A;  3GO5 A;  3QIA A;  3D6C A;  1CQV A;  3I4N G;  5H1S E;  1W6K A;  3MXU A;  4FF2 A;  3I2Z A;  1XMQ L;  4O42 A;  5E3F A;  1IHZ A;  3L9A X;  3R93 A;  1TWC B;  2HIV A;  3VYU A;  4BWG B;  2EYO A;  3PIO A;  4LF6 Q;  1V1P B;  4CKE A;  1E2V A;  5AJ3 Q;  4IUT A;  5IIF A;  1EY7 A;  2G9H D;  2JE6 I;  1Q8K A;  1HXY D;  1RF2 D;  1JCK B;  4B3M L;  3SVM A;  1B70 B;  1B9M A;  1SNC A;  3BJU A;  1Z9F A;  2NZ1 D;  4DV6 Q;  1K73 C;  4KKT A;  1CUK A;  5JEA H;  2WKC A;  4R4T A;  1MSH A;  4F87 A;  3N52 A;  1I4Q A;  3T16 A;  4QUF A;  5DAU A;  4K5V A;  3KDF B;  1JE4 A;  3QOJ A;  1PZI D;  4P74 A;  3P20 A;  1YZ6 A;  3BDL A;  1J9O A;  1GUG A;  2CKZ B;  1MJE A;  2L9H A;  3G4S A;  3C2P A;  2VW9 A;  1M4V A;  3OWF A;  1VMC A;  5D3I B;  1I6H H;  1LTR D;  4HTH A;  1MD2 D;  1TWG H;  4B9W A;  4TVA B;  1VQN A;  2F4V L;  4DR2 Q;  4LAA A;  5EPL A;  1N9W A;  2FIN B;  2CCZ A;  5KNB A;  1FJG Q;  3G7L A;  3KLS A;  4H02 A;  4QJF A;  3E6Z X;  3I3C A;  2F1M A;  1PTO B;  1UNS A;  1PA6 A;  3AFP A;  4QUC A;  1X3E A;  4WOR A;  3S14 H;  4HIM A;  4Y7N B;  1SE2 A;  5C0X H;  3ULP A;  1EY5 A;  4JBW A;  2QW7 A;  5JPM C;  1ENF A;  4DR5 Q;  1G2S A;  5AJ3 L;  3ND9 A;  1EOT A;  1VQP A;  3MXP A;  4XT3 B;  5LMU Q;  2B2V A;  1LT4 D;  1PH2 A;  1K83 H;  3K59 A;  3OW7 A;  5C44 H;  4A76 A;  4DR1 L;  4X6A H;  4FVM A;  3TZD A;  3CME A;  4JI8 Q;  1EIY B;  2LSS A;  4CJ1 B;  2JA8 H;  3KFU A;  3F2U A;  4C2M B;  2PMZ E;  1TY2 A;  4IO9 A;  3BVM A;  3ND8 A;  4XYO A;  4DV6 L;  4GNX A;  3ONA B;  4UY8 C;  4DFA A;  1YBY A;  2E5L Q;  4LFC Q;  4HAE A;  1ICF B;  2SNS A;  2OQ0 A;  2I46 A;  2WB1 E;  2NBF A;  2AHO B;  4IPD A;  2B2V C;  3TP6 A;  1X55 A;  3NEM A;  1I4G A;  4U68 A;  1KAB A;  2E74 C;  3KF6 B;  1D5Z C;  1HTP A;  3LGJ A;  4HCS A;  2WKD A;  3T51 B;  2EJM A;  3D6W A;  2KCT A;  4DR2 L;  4LUV A;  2F0N A;  1SE8 A;  1B2T A;  1FJG L;  1BUV T;  3SK6 A;  3CPF A;  2EYP A;  4RCN A;  1K28 A;  4DPG A;  2I5H A;  3DUZ A;  1Q1E A;  3HFZ B;  1LLR D;  1NTG A;  4DAY A;  3HKZ B;  1HJP A;  1K8A C;  2OTJ A;  1EY6 A;  3D3R A;  4KY6 A;  5LL6 S;  4JI2 Q;  4DR5 L;  5IP7 H;  3OHX C;  2IWH A;  3OSO A;  3DEO A;  2UXD L;  5M5X H;  1O7Z A;  1C48 A;  4QL5 A;  1SRU A;  4NDX A;  3S9W A;  3AYH B;  2K14 A;  3X3M A;  2ICE C;  1CA5 A;  4JI8 L;  2B2W A;  4GOP A;  2WP8 J;  5K5P A;  4OEL B;  4RGO S;  4B3S Q;  3K80 C;  1TXY A;  2E5L L;  1RTN A;  4K0K Q;  1Z47 A;  4G4K A;  1ICW A;  4L5R C;  4DV1 L;  1E1T A;  4Y52 H;  1GJX A;  2Q2H A;  5EKI A;  1VQ5 A;  2K05 A;  1TWF B;  1MBY A;  4LK1 C;  5E1F A;  5KNC A;  2NVQ B;  4NP5 A;  4JV5 Q;  2F0K A;  2E2I B;  2IL8 A;  1O80 A;  1UE1 A;  2D9U A;  3QOL A;  5C6A A;  1WTX A;  1K8M A;  1V1O A;  2A73 B;  2B2W C;  4GS3 A;  1EZ6 A;  1GHJ A;  5IT9 L;  1VQH A;  4MTK A;  1C8C A;  3EA6 A;  3C1E A;  3S1M B;  2EIF A;  1CT1 D;  5E4X A;  3HKZ G;  3T13 A;  2F0W A;  2K75 A;  2L55 A;  5JJK A;  3GTM H;  1G6P A;  5DM6 3;  5M3F H;  3CU7 A;  2V1C C;  5I6Y A;  1BQQ T;  4FXK C;  2K1B A;  3HOZ H;  1DM0 B;  3HP3 A;  4OEM B;  1QZG A;  3EBE A;  3I4N H;  2QEJ C;  2L4N A;  3X3N A;  4UPA A;  1XMO Q;  1GM5 A;  4CDC C;  1CSP A;  1FD7 D;  1F2Y A;  4ID6 A;  3CQZ H;  1K8O A;  4XQN A;  4C3J B;  5IE8 A;  2EY2 A;  3I72 A;  2IJ0 A;  3K7A H;  1D8L A;  1NE3 A;  5C3E G;  2B2U C;  5GAE C;  1ZXT A;  3BZC A;  3M7N A;  4HIO A;  1R9T H;  2EXZ A;  1MJC A;  4UHV A;  4X65 Q;  2HQE A;  2YTV A;  1UAP A;  1LAC A;  2QF7 A;  2VS1 A;  2NN6 G;  3TN2 A;  2XTI A;  3CC2 A;  2L5T A;  1W3S A;  1VF7 A;  4LUZ A;  4PMB A;  3TBI B;  2M00 A;  1FR3 A;  5AFW A;  4CGY B;  4EX5 A;  3CCS A;  3TEH B;  5FO8 B;  5HUR A;  1XX8 A;  1HPC A;  1PRT B;  3DM1 A;  2JA9 A;  5EAY A;  1QVG A;  4JI5 Q;  5CGK A;  3SGI A;  1CM9 A;  3RMH A;  3IKJ A;  1BBX C;  4KTA A;  1JWM D;  4IUV A;  5DEH A;  4HR7 B;  3JAM E;  3A7A B;  2OTL A;  2VQF Q;  2BOS A;  4GKK L;  4BXX G;  5FO7 B;  3SK8 A;  4JCV E;  3E5S A;  1JOO A;  2M2L A;  5K36 G;  2B8F A;  5CV8 A;  1EOV A;  3BDC A;  3CC4 A;  1SFO B;  3NPP A;  1E2W A;  1TWC H;  1CFM A;  1U9R A;  4M1U B;  4C3J G;  3BYT B;  2OT2 A;  4GN3 B;  5JAV A;  1PFB A;  3MA2 B;  2VB2 X;  4HJ5 A;  2B8G A;  4HJ8 A;  3HEJ A;  3J7Z C;  3GTO H;  1K9M C;  1YI2 A;  2KHJ A;  2WAC A;  3I4L A;  4WRD A;  1A8V A;  5FJ8 G;  4X65 L;  3A74 A;  1SSO A;  1GUN A;  3RZO B;  3QJY A;  5JVH 3;  4DXG A;  3I90 A;  1E22 A;  1EWC A;  2CH4 W;  2JQO A;  3J81 L;  4U67 3;  1O7L A;  1HR0 Q;  1KLU D;  4A3F G;  4K5W A;  3CCE A;  5G3L F;  4OX9 L;  2A5H A;  2ID0 A;  1GHK A;  1X3F A;  3NBH A;  3J7A V;  1EFI D;  2PNH A;  4JI4 Q;  2VQF L;  3NHH A;  1F2L A;  4HIK A;  1S4Z A;  1VS0 A;  1XPR A;  4XT1 B;  4E6I A;  4DU9 A;  1RTO A;  4LF4 Q;  1EQV A;  3TP7 A;  3H6M A;  1IBL L;  1PTO H;  4RHS A;  1N32 L;  1VQL A;  3NTI A;  1F9Q A;  4Y7N H;  3AB9 A;  3PO3 B;  4DXF A;  1P8L A;  3RN5 A;  2ZJP A;  3PF4 A;  1TWH B;  1S5E D;  2NZH A;  5I6W A;  1QG7 A;  1J5E L;  1PYW D;  1I94 L;  2IX1 A;  1VQK A;  1VQJ A;  1A2U A;  3TS2 A;  2HDM A;  1BR9 A;  1LTS D;  4IUP A;  2RCN A;  4C2M H;  4PMW A;  2R7F A;  5M5W B;  2R6G A;  3J81 i;  1BCP F;  4OO1 G;  1N34 Q;  3PIP A;  1FNW A;  4K8J A;  4DV2 Q;  1V1P A;  4HN7 A;  4A3M B;  3J80 L;  1FNU A;  3A0J A;  1HTL D;  2BDN A;  4NW2 A;  2R7Z B;  1SYC A;  2F0M A;  4ILW A;  4LUO A;  1KXL A;  1Q81 C;  4IFD I;  1QNK A;  5HGQ A;  1Y69 U;  4P73 A;  5C44 B;  3CRK C;  1HR0 W;  2F0S A;  3B6Y A;  3PO3 G;  1Q8I A;  4P71 A;  2LY7 A;  1AE2 A;  2F03 A;  5I4D A;  1G51 A;  2F3W A;  2LMC B;  4AH6 A;  1OXX K;  3KDF A;  4DNR B;  2XIW A;  2KHI A;  5IYC G;  3BG3 A;  3C1F A;  1VQD A;  1ASY A;  1DOL A;  1B3A A;  4KN4 C;  3GTQ H;  4JG2 A;  5J22 A;  2WFW A;  1BO0 A;  1XXG A;  1F9R A;  2K6A A;  4F8M A;  1RJT A;  4JW0 A;  2A68 D;  4DAP A;  2ES2 A;  4LFB Q;  4R8I A;  4G7O C;  2OQK A;  1LO5 D;  1NNX A;  4OWX B;  1WTW A;  3G71 A;  3CCL A;  3RLN A;  4WJ4 A;  1MGS A;  1SYB A;  4QY7 A;  4R9W A;  4A3M G;  3J80 i;  3HOV G;  2F0L A;  1II3 A;  2R7Z G;  4ZUJ A;  1AFP A;  3VR5 A;  1F9S A;  2XWB B;  4NXN L;  5C3E H;  2NVQ H;  3E0E A;  4A3K B;  2E2I H;  3H3V C;  4DR4 Q;  5BN4 A;  2EZV A;  1VQC A;  1EZ8 A;  4ZLT F;  1JWU D;  3OW2 A;  1HNW Q;  4GLX A;  2C5C A;  4LF9 Q;  1BOS A;  1YJN A;  3S1M H;  2F0H A;  4GKJ Q;  2NN6 H;  4HID A;  1NSN S;  1R4Q B;  5J3B A;  4JOI C;  1N36 L;  1WTP A;  4KD4 A;  3PUW A;  3RLO A;  1STA A;  1ML0 D;  2ZXO A;  3BVG A;  3VYT A;  4PQX A;  5CR3 A;  2LFN A;  3KF6 A;  2DGY A;  2XNA C;  2QEX A;  4BXX H;  2YTY A;  3DHQ A;  1EU4 A;  1WTH A;  1B4O A;  4DNI A;  1SMY C;  5K36 H;  3SXH A;  1JR0 D;  4ULL A;  2A8V A;  1ESF A;  3P75 A;  3IFT A;  1VQM A;  1RIP A;  4C3J H;  3OOC A;  1D5X C;  1HCZ A;  1C4Q A;  3PIP 3;  2EY1 A;  1V8Q A;  4A3K G;  4X64 Q;  5BN5 A;  2E2D C;  1HFN A;  3W5O A;  4DAV A;  5GAH C;  3R2T A;  4C1N K;  4PV1 C;  3MTS A;  1SYD A;  5FJ8 H;  1SN8 A;  1SLJ A;  4FXG C;  4HJ7 A;  4LF8 L;  5M5Y H;  1Y14 B;  4POG A;  3M4O H;  4R1J A;  1I6V C;  1F77 A;  5D3D A;  1OO9 B;  4GKJ L;  3R3O A;  3IAY A;  2VQE Q;  4H0L C;  2B2T C;  1YHB A;  4I65 A;  4A3F H;  1WYD A;  2JK8 A;  3GV6 A;  1EQT A;  1SJE D;  1WCM G;  1ET6 A;  1Q3L A;  4RA8 A;  1X3G A;  3K5L A;  3T1Y L;  1STY A;  2OEO A;  4X66 L;  4HJ9 A;  1I50 B;  4XQQ A;  4YWM A;  1I4P A;  2AQ3 B;  4HSP A;  4LFA Q;  2MO1 A;  4L63 B;  1U4P A;  1SFO H;  4OWT B;  4DR7 Q;  1DCZ A;  2B3G A;  4J15 A;  4C3H B;  4L5S A;  1X3Q A;  4MNO A;  4B3R Q;  3MWY W;  3KF8 B;  4K8I A;  3T56 B;  1KAA A;  4CKB A;  3K7U C;  4KY7 A;  1G6Z A;  1B7Y B;  4TRD A;  2L12 A;  1MHW C;  1Q82 C;  2RDH A;  3L3O C;  2R7D A;  1EUJ A;  3I7F A;  4X64 L;  5CV5 A;  3ULL A;  2UU9 Q;  2JXM B;  3KOJ A;  1JOQ A;  1SNM A;  4ABN A;  4F88 A;  1N8R C;  5G3L D;  5TSS A;  3STB D;  2B2Y C;  3RZO H;  2KOL A;  1XNR Q;  1Z6H A;  2ZTC A;  4OO1 H;  1ONL A;  3T53 B;  2PMZ B;  3NE5 B;  5C5M A;  2NVX H;  1A0I A;  3EVQ A;  1I3Q B;  5D65 A;  2UXC Q;  5CV6 A;  2TSS A;  2Y0S E;  1L0Y B;  1KHI A;  3BU2 A;  2EYF A;  1HA6 A;  1BVS A;  3NQT A;  5IT9 c;  1EEF D;  2WB1 B;  3KBG A;  3KYH C;  5EKL A;  3GTO B;  3RD4 A;  1LTG D;  2YV5 A;  2PZW A;  4ZRZ A;  4C3H G;  2YTX A;  2D0O A;  4LFA L;  2DJF C;  4DR7 L;  3JAM L;  1X32 A;  2BCO A;  4RKL A;  3PO3 H;  4B3R L;  3PUX A;  1BBU A;  5LMN L;  3EQL C;  3PGZ A;  2CHB D;  1KRS A;  1TWH H;  4EVO A;  2QKI C;  1I4X A;  4CBV A;  4DUZ Q;  3AFQ A;  2IPK D;  5IYC H;  5BR8 Q;  1BCP D;  3W1G A;  4JC0 A;  4J1M A;  2V4D A;  4M8A A;  4XTC S;  2ENB A;  3TP8 A;  1HQM C;  2CQO A;  3M4Y A;  5M5W H;  4UP8 A;  4N8F A;  4DR6 L;  1CKN B;  1HUM A;  2UUC Q;  1IW7 D;  3QWN A;  1XNR L;  2MJ8 A;  2E2H B;  1K3B C;  2X69 A;  4ZAI A;  1JE5 A;  1PRT C;  4S3S A;  4IZ8 A;  4A3M H;  1OTC A;  2ALY B;  4IOC A;  3HOV H;  5IGE A;  2WB1 G;  1PH3 A;  5C4J B;  2R7Z H;  4LF6 L;  2A68 C;  1PFM A;  3GTK H;  5ELO A;  1K8G A;  4PNY A;  3H15 A;  1ENC A;  3QB3 A;  3GDE A;  1SEB D;  4MHE A;  3E3X A;  3NWT A;  1ILQ A;  1PFS A;  1UEB A;  3CCJ A;  1GVP A;  1PZK D;  5IGF A;  3JAM i;  4IUN A;  3NP8 A;  3I70 A;  4KKS A;  1Y8O B;  5GAD C;  4A3D B;  3DMU A;  4AYB E;  2KED A;  1HH2 P;  3CAM A;  2JA7 B;  1TVX A;  3I4O A;  4HSV A;  4ME3 A;  5DLQ E;  4DV3 Q;  1MSG A;  1S40 A;  2C9O A;  3ER0 A;  3W2D A;  2VZA A;  3DM3 A;  3WDN A;  3L2P A;  4EQP A;  1XPU A;  1IXR A;  1F9P A;  3OIQ A;  2UUC L;  3I73 A;  3VYR A;  2R3Z A;  3A5Z B;  2ASB A;  4HED A;  2AKW B;  1LAB A;  1AEX A;  1GD7 A;  1SE4 A;  2RHQ B;  2IW3 A;  1PDQ A;  1SXT A;  3EN2 A;  1HNZ Q;  3HS0 C;  4A3K H;  4JI6 Q;  1GOZ A;  5C3X A;  1LUZ A;  1OXT A;  2D5D A;  3G6E A;  1SBB B;  2Z1C A;  3G48 A;  5LMU L;  3WWV A;  4O2D A;  3J81 c;  3PUV A;  3PQI A;  5ELD A;  4RAU C;  2EPB A;  1NR4 A;  4A3D G;  2CQA A;  4ZYS A;  3GTQ B;  1KTK A;  1PLF A;  2R61 A;  2NWG A;  2JA7 G;  5IGB A;  4MZ9 A;  4FNF A;  3T1H Q;  2K32 A;  4DR3 Q;  2ZXP A;  1EY8 A;  4Q0F A;  4LFC L;  1VQ6 A;  2Q8I B;  3A8K E;  4A3C G;  4JYA Q;  1F2M A;  3Q24 A;  1WCM H;  4K2L A;  4LF7 Q;  2Z6B A;  1VQE A;  3N6R A;  1X56 A;  2AWN A;  1RL2 A;  3UDI A;  1PMR A;  2EYL A;  5IYB G;  2PI2 A;  2EOT A;  4KV6 A;  4P72 A;  1PH6 A;  4XQJ A;  3W1B A;  1KL9 A;  4NB3 A;  5C3E B;  5COR A;  4K2K A;  3J81 j;  2L0C A;  1PH8 A;  4IUR A;  3NWS A;  4EGV A;  1KDB A;  3S16 B;  1O7Y A;  1CKM A;  4APV A;  3K5N A;  2FJ2 A;  1HNX Q;  2EJG C;  1A15 A;  2XRS D;  4X3T A;  3FEW X;  1NMG A;  1IYV A;  4A3B G;  1STH A;  4KY5 A;  3WOF A;  1GUO A;  1PH4 A;  2K04 A;  3CF5 A;  4JI2 L;  4JI6 L;  4ALP A;  2N55 A;  3S2H B;  1QIL A;  2B2U A;  2KCN A;  3S15 B;  3DXJ C;  3V05 A;  1ZYR D;  3HOX B;  1Q46 A;  1OXV A;  4IPG A;  1CKO A;  3J80 c;  4FF4 A;  2D62 A;  3KLR A;  3S1R B;  1UUP A;  2RF4 A;  1QZH A;  3IFD A;  1G91 A;  1L1O B;  2A6E D;  4ODG A;  2Q8T A;  3NEN A;  5EJW A;  4B3S L;  3STB C;  3CKI B;  2JP1 A;  4K0K L;  2E2J B;  4RG1 A;  2Z0S A;  1DOM A;  2PZT A;  4G7Z C;  3E9H A;  3K0Y A;  5IOC A;  1I50 H;  1SNO A;  1YJW A;  2EE1 A;  4JV5 L;  4P75 A;  4C3H H;  2JA6 B;  5EBC A;  2J7Z A;  5IWA Q;  1STN A;  5JJZ A;  1UE5 A;  3OTO Q;  2FHT A;  1X65 A;  5M5Y B;  5EBD A;  3M4O B;  1YNJ D;  3GTJ B;  1QE6 A;  3ICE A;  2MQH A;  2KQ3 A;  5JJI A;  4CDD C;  3ULJ A;  1IYU A;  4GN4 B;  4KHZ A;  1LTL A;  2EXD A;  2ZT9 C;  3TME A;  4A3F B;  1EEI D;  3FPP A;  3HOX G;  2CW0 D;  2RCF A;  3K58 A;  2N88 A;  3IL8 A;  4A93 B;  3S24 A;  2G5D A;  2JSO A;  1B9N A;  3MFY A;  4FP5 D;  5FLX L;  4RKB A;  1A3U A;  1BCP C;  1QJO A;  1B53 A;  3J7A 5;  1JT8 A;  1EQR A;  1XMO L;  2IHE A;  1PVO A;  1I3Q H;  2GN5 A;  2FMM A;  2O5I C;  3CCR A;  1E0B A;  1LTT D;  2CVR A;  3QO2 A;  4BS9 A;  2SNM A;  1TS4 A;  3VA5 A;  1PV4 A;  3HOY B;  1CSQ A;  4QIW B;  1NY4 A;  4DGZ A;  4OHJ A;  2Z4I A;  2KUM A;  2LXK A;  3ERO A;  4KHV A;  1GKH A;  1FGU A;  4YCU A;  2JA6 G;  2NYZ D;  4JK1 C;  3TZU A;  1ENA A;  1VMP A;  2DY8 A;  5IWA L;  1FL0 A;  4RGN A;  5GAG C;  2QIL A;  2QDL A;  5IGC A;  3D31 A;  2A19 A;  1HRJ A;  1JIC A;  3F2D A;  4JBK A;  2NVX B;  2E75 C;  3Q8D A;  1T5E A;  1GXD C;  4JI5 L;  2AWO A;  4IJH A;  4OGQ C;  4A93 G;  2K4K A;  1MI2 A;  3W3A A;  3H3V H;  1DJR D;  4A3L G;  4PZ7 A;  2XRQ D;  3KF8 A;  2E2H H;  4DK0 A;  3KJP A;  3NXW A;  1UE6 A;  2L11 A;  1RCV D;  1BF4 A;  2VUM G;  1E7Z A;  2TMP A;  4RGT A;  1STE A;  1E1O A;  4EQO A;  4GNX B;  3HOY G;  2NTT A;  5C4J H;  3T4A C;  2F3V A;  3O13 A;  2G9D A;  1CA6 A;  3RZD B;  2SDF A;  1S5D D;  1E2Z A;  2KA7 A;  3DWA A;  4OL7 A;  4LJZ C;  3VYS A;  4TSS A;  1LT6 D;  2NN6 I;  3Q22 A;  4QB4 A;  2I0Q A;  1XPO A;  3HG9 A;  1N33 Q;  1X3P A;  4N9T A;  3M4P A;  2FMC A;  3CP0 A;  4UP9 A;  4A3D H;  4NXM Q;  2I07 B;  3R8B A;  2XGT A;  2J0T D;  3LNN A;  1STG A;  4KHP Q;  3OWE B;  2JA7 H;  1D6E C;  4DUY Q;  3TQY A;  2NVY H;  1HR0 L;  2NUC A;  2K5D A;  4DAY B;  4A3C H;  4JI1 Q;  5ISR A;  4RMF A;  1KNA A;  3HOV B;  1KLG D;  3U4Z A;  2C35 B;  1TQO A;  2HT1 A;  1VQO A;  5IYB H;  3GTK B;  4JI4 L;  5I2Y A;  3PMF A;  4RCO A;  1H9K A;  2FXQ A;  2Z6K C;  2HDL A;  4LF4 L;  2A74 C;  5I9P A;  4GOP B;  4DAM A;  4BY1 G;  3QG1 A;  4H44 C;  4JI3 Q;  2K50 A;  2K5W A;  4A3B H;  1QB5 D;  4MTN A;  1EYG A;  1T9H A;  1IBM Q;  5CV9 A;  1Y1W B;  4A3G G;  1F2Z A;  2PO4 A;  1CK1 A;  1BKB A;  1CKN A;  1QWY A;  2R93 B;  4DK6 C;  5JOB A;  5IGG A;  4H13 C;  4KJN A;  1L2F A;  3FVQ A;  2F4I A;  5IP9 G;  1EY9 A;  1KDC A;  3U9S A;  1Y8N B;  3CRL C;  5JPN C;  4DUY L;  4DV7 Q;  1N34 L;  3AMU A;  4JOI A;  4YHH Q;  4DV2 L;  4NMZ A;  2A69 D;  1B3Q A;  1HHV A;  1TKW B;  5DM7 3;  4IQZ A;  4WJ3 M;  3JAM c;  3P1H A;  2KVM A;  5KYI A;  4IUQ A;  1EY4 A;  4PZ6 A;  3M3Y B;  1QCB D;  3PO2 B;  2A6H D;  2A6E C;  3QR8 A;  3HRZ C;  3PF5 A;  1Q7Y C;  2XSC A;  4QCL A;  4PMC A;  3U58 A;  3VR6 A;  2WAQ E;  2KEC A;  2PW7 A;  2ZM6 Q;  3S16 H;  4IUU A;  1G2T A;  2KHS A;  3KK7 A;  3E9I A;  1QUQ B;  5JVG 3;  3BDO A;  4KK7 A;  4ZUI A;  4JI3 L;  1BCP B;  2MPM A;  3MXN B;  1PXU A;  3SK4 A;  3H94 A;  5A2Q E;  4HCE A;  4B3T Q;  4OWW B;  1KRT A;  5NUC A;  1A2T A;  4FF3 A;  1Y1W G;  4RGM A;  3S2H H;  1VQF A;  3OIP A;  3I55 A;  3S15 H;  4HJA A;  1WTO A;  5IY0 A;  2R93 G;  4OON A;  2N49 A;  2E76 C;  1BNZ A;  2F0D A;  1WCM B;  3HOX H;  1IBK Q;  4CDE C;  1XWE A;  1SJH D;  1UE7 A;  1AZP A;  4FYD A;  2JA5 B;  4AQY Q;  4OO1 I;  3EIV A;  2YU9 H;  1R4P B;  4JVZ A;  3S1R H;  4BA2 I;  4I7A A;  4ZQ3 A;  2BH2 A;  2ICI A;  2Q2U A;  1RDP D;  4LFB L;  2KBN A;  4KLK A;  1JB7 A;  1VQ7 A;  2UUB Q;  4DV7 L;  1A62 A;  2E2J H;  1TII D;  4YHH L;  1KD1 C;  4QQB X;  1TT2 A;  4GLV B;  3SEB A;  1KIX A;  5C3W A;  2B2T A;  3P7J A;  3A54 A;  1M90 C;  2Y0S B;  3I8Z A;  3PO2 G;  4TQU S;  1NBW A;  1VQI A;  2I5M X;  1HQR D;  2RA4 A;  3A56 A;  2PI2 E;  2RSN A;  3AU7 A;  3RR5 A;  2K7V A;  1XNQ Q;  3ITP A;  3AQQ A;  4DR4 L;  1XJV A;  2JA6 H;  4C56 C;  1Z7T A;  2EY6 A;  4UDU C;  2ZM6 L;  2VB3 X;  3K8A A;  3CCM A;  1HNW L;  1FGB D;  4LF9 L;  3GTJ H;  1S5F D;  4PG3 A;  1S5C D;  2BH8 A;  4MIU A;  1BBW A;  3NUC A;  4QMG A;  3H0G B;  3KJO A;  1YIT A;  3WOE A;  1JWS D;  2AUJ D;  1VQA A;  2K33 A;  2MGS A;  5M9O A;  1S5B D;  5C4X G;  4JBJ A;  1KNE A;  4BBS G;  4TKO B;  1LTB D;  4X3S A;  5IGD A;  4N8X 1;  2JA5 G;  1WVL A;  4JPB W;  3HOU B;  2LKV A;  4A93 H;  2CWA A;  1AZQ A;  4H7B A;  3Q23 A;  5EKK A;  4AQY L;  4UP7 A;  4DF7 A;  3VR4 A;  2F0V A;  1ROD A;  4A3L H;  2B2Y A;  1LT3 D;  4AIM A;  1V1Q A;  2SOB A;  3FRP B;  2WII B;  3UI2 A;  5C0X I;  2VUM H;  4R4C A;  4YWK A;  3HOY H;  2Y0S G;  1L0X B;  1HFG A;  1MIU A;  1YEZ A;  5LL6 X;  4V0B A;  1CZG A;  3J81 E;  5BN3 A;  1EWH A;  4X3K A;  1EIF A;  2L1B A;  5M3M G;  3H0G G;  1NR2 A;  1YHA A;  3A8J E;  1PTO F;  2HD3 A;  2B29 A;  1EYA A;  1V9P A;  3KLS X;  4AYB B;  1WFQ A;  1ILP A;  2M9V A;  2VQE L;  3M85 A;  4KN7 C;  3HOU G;  2PQA B;  2D2C C;  2WIN B;  4KD3 A;  2EYM A;  3D4W A;  1HA5 A;  3F8T A;  4Q5V A;  5GRO A;  3TS0 A;  2F4V Q;  4XXE A;  1S3O A;  2IHF A;  4L5Q A;  2LXJ A;  3CC7 A;  3ZJY C;  2CFM A;  1KDA A;  3ZYY X;  1L1O C;  1YNX A;  4IJL A;  2IX0 A;  2JJQ A;  1KAW A;  2JN4 A;  1EL0 A;  4BY1 H;  2GVB A;  1SR3 A;  2RKS A;  3L0O A;  3ERQ A;  4EQ5 A;  3E0J A;  3RZD H;  3BVZ A;  3HOW B;  3V96 A;  1DGS A;  3PCO B;  2UU9 L;  4A3G H;  4DR1 Q;  2K5H A;  5ELE A;  2HCC A;  1D2B A;  1RKN A;  1WI5 A;  1EYD A;  3RLF A;  3J80 E;  2Q8R E;  5IP9 H;  4BY7 B;  2P5Z X;  4AYB G;  3LX0 A;  1X9N A;  3SR1 A;  2DJG C;  3NK9 A;  4R4Q A;  1ZKO A;  3CW2 C;  2UXC L;  5C4Z A;  5CBA E;  1GUS A;  4RH6 A;  1D5M C;  3F1Z A;  3MEH A;  5LMN W;  1CI3 M;  2VL6 A;  2Z4H A;  2A69 C;  2QDB A;  1PH7 A;  1HZA A;  2PZU A;  3S1Q B;  4HMJ A;  2R92 B;  5IOD A;  4R8N A;  1WTV A;  4B08 A;  2A6H C;  3TSS A;  1KQS A;  1FNV A;  5FOB B;  2E8G A;  1PH9 A;  3MHB A;  2MNA A;  3FPU B;  5FLX c;  3HOW G;  2F0Q A;  2VY3 A;  4GLA C;  2JYO A;  4YCV A;  4ZKB B;  1IKM A;  4DUZ L;  1Y1W H;  2UXD Q;  2O4X A;  2NVY B;  5HGT A;  2HUG A;  3UE0 A;  5BR8 L;  4B9X A;  2R93 H;  1G8Z D;  4IN3 A;  1EWI A;  3NQI A;  4BY7 G;  4ZCK A;  5C4H A;  2DY7 A;  2F0U A;  1VQ9 A;  1HZC A;  1PH1 A;  4OIJ A;  2KCM A;  3F2B A;  3HZX A;  2RSO A;  5IYD G;  1ESR A;  1ASZ A;  3IRB A;  1SAP A;  1TU2 B;  2JEB I;  3KBX A;  1S72 A;  3TRE A;  1RHP A;  4DV1 Q;  3C46 A;  1WTR A;  4XDX A;  1K0R A;  1E3P A;  1U5K A;  3M3Y H;  3PO2 H;  4A75 A;  1WJJ A;  4JI7 Q;  2OCE A;  4A3B B;  2ZXR A;  4DNT B;  2ZJR A;  2L15 A;  2PYK A;  2PPB C;  5CYU A;  4RFB A;  4DKA C;  4G7H C;  2R92 G;  1VQ4 A;  3M4Q A;  3K81 C;  3FKI B;  3VA7 A;  5CBE E;  1B44 D;  4F7X A;  3DWQ A;  2EVB A;  1EYC A;  2RBM A;  4GNX C;  1NUC A;  2RVL A;  3BZK A;  4BA1 I;  4CHT B;  3GTP B;  2F3I A;  2OWO A;  3VDY A;  1GO3 E;  4OXP A;  2K03 A;  2Q2I A;  2XN9 C;  3S2D H;  1Y1V B;  3NBI A;  5EPJ A;  5C4X H;  3PIO 3;  4BBS H;  4OIK A;  5LHY 1;  4DV3 L;  2NVT H;  4XYQ A;  2JEA I;  2K28 A;  1WTQ A;  2KJX A;  1Y8P B;  4QF4 A;  2JA5 H;  5J1Z A;  2ZTE A;  4L5T A;  3V2T A;  2O2L D;  3H91 A;  4JI0 Q;  2XVS A;  5EGT A;  2F0O A;  2AMC B;  5CMD A;  2B39 A;  1SRO A;  1U4R A;  1DXM A;  1EU3 A;  1PRT F;  2RHS B;  1DYQ A;  3GTG B;  1TS3 A;  1YJ9 A;  1HNZ L;  3KUP A;  3GV3 A;  4J8Q A;  4JI7 L;  3MFG A;  1DOK A;  3K5O A;  3FKI G;  2N3S A;  3S1N B;  2N8N A;  1U4M A;  4GOP C;  4EQN A;  5M3M H;  4O0A A;  3H0G H;  2F52 A;  2CH4 A;  4X62 Q;  5F2D A;  2UUA Q;  2YU9 B;  1IZ6 A;  1X6O A;  3D0F A;  4DV0 Q;  1Y1V G;  3CHB D;  2VXW A;  3OMC A;  3A55 A;  3RNU A;  1A3T A;  3NEL A;  3T1H L;  4DR3 L;  5FLM G;  3H3V I;  3FDT A;  3GP7 A;  3Q6S A;  3HOU H;  4JYA L;  2RQX A;  4GKK Q;  3PUY A;  3FHW A;  4LF7 L;  1M1K C;  3MXG A;  5A2Q L;  5ELN A;  5KEE A;  1I4H A;  1SND A;  3GTL B;  2HCI A;  1H9S B;  1QUQ A;  4A3J B;  2B63 B;  4XIG S;  4JI0 L;  4FXD A;  3H09 A;  1D7Q A;  4FO2 A;  2DUD A;  3G6J B;  3MXN A;  5KND A;  2K5N A;  2K5V A;  2J4X A;  4BBR B;  3HKZ E;  5FK9 C;  1HNX L;  3PSI A;  2F0J A;  2EYH A;  4C1N I;  3S17 B;  1QNU A;  5E7N A;  1PTO D;  5J39 A;  1XTD A;  1O78 A;  4G57 A;  1NAP A;  4RHR A;  3Q0A A;  4K14 A;  3MEF A;  2OXP A;  1T5X D;  1HUN A;  4LWC A;  3GQB A;  1AE3 A;  1LYL A;  4A3E B;  1X54 A;  3HGB A;  3CCU A;  1JJC B;  1VF5 C;  1V43 A;  1B1Z A;  3GD7 A;  4NPS A;  4X62 L;  2UUA L;  2GA4 B;  5EPK A;  1Q12 A;  2EQS A;  4NKL A;  2Z8L A;  4DV0 L;  1LV9 A;  3CCV A;  2F0P A;  2FFK B;  4OX9 Q;  2VUM B;  1SMY D;  3LWE A;  5KGU A;  3MVV A;  2F0F A;  1IW7 C;  2AUK A;  1MKH A;  2D0P A;  5GQO A;  1TY0 A;  4A3J G;  1H95 A;  2B63 G;  4A3I B;  4V19 0;  1NCV A;  1H9R A;  2BE5 D;  3I4M B;  1IBL Q;  2MP1 A;  4K6L A;  3CPW A;  1B8A A;  4DV5 Q;  4N9P A;  4BBR G;  4C3I B;  1N32 Q;  2IT1 A;  1J8I A;  4RWS C;  4IFD G;  1YNN D;  3OTO L;  5C5L A;  4DN4 M;  2UXB Q;  3BYY B;  1VQB A;  2EJF C;  3U50 C;  2PCF B;  2GVA A;  1PZJ D;  1I94 Q;  4IAL A;  1J5E Q;  1ET9 A;  3HOW H;  4DK3 C;  5EQ0 A;  3OPO A;  3PUZ A;  5ELC A;  1YIJ A;  3PV0 A;  4LNQ A;  4L6T B;  4WJW A;  3F2C A;  4A3E G;  4GN5 A;  2IY5 B;  1IL8 A;  2Q2T A;  1I5F A;  2NTS A;  3R2I A;  1JJG A;  2MFI A;  4BY7 H;  1TWA B;  1BDO A;  1QOH A;  4ME5 A;  3URY A;  1CQF A;  4O1N A;  4GZY C;  4ZKC B;  3I56 A;  5IYD H;  2KEE A;  5I2X A;  2QGQ A;  1SE3 A;  2CWP A;  2I5L X;  1O7I A;  1Q86 C;  4BY1 B;  2BDO A;  2VNU D;  1JMC A;  2O5J C;  4A3I G;  1SNQ A;  1IYJ B;  1L0W A;  1A63 A;  3I4M G;  1AP0 A;  1OXS C;  5FKA C;  3TRZ A;  4J6H A;  3S1Q H;  3CXC A;  4C3I G;  4QGU A;  2R92 H;  4A3G B;  1CHQ D;  3EJI A;  4KJO A;  2MUY A;  3FP9 A;  5CC4 A;  2WAQ B;  4DV5 L;  1NMF A;  2Z6K A;  2AQ1 B;  2LS0 1;  5CV4 A;  2XWJ B;  4IPC A;  2F0E A;  2N78 A;  1PH5 A;  2UXB L;  1G29 1;  3HKS A;  3BS1 A;  1U4L A;  5E4W C;  1W2B A;  2PQA A;  2ZJQ A;  1PYB A;  2RDG A;  1H9J A;  1IKL A;  1D1I A;  3RUZ A;  1XTC D;  3AEV A;  4KI0 A;  1I6H B;  2K52 A;  2YYZ A;  3KLW A;  3I91 A;  3DLL A;  1TWG B;  4CKC A;  1C9O A;  1J6Q A;  4L8J A;  3UDF A;  1JOK A;  3ERS X;  4DA2 A;  4HMI A;  4IPH A;  3J7Y W;  1C0A A;  3CD6 A;  3D4D A;  2QA4 A;  2F0I A;  2KEN A;  4YWL A;  1QVF A;  4FF1 A;  4QIW E;  1JQY D;  2PW5 A;  4YY3 Q;  3U4V A;  1CTM A;  2PQE A;  3D4R A;  3S14 B;  3EFX D;  1TS5 A;  3A7L A;  1IL2 A;  4NXN Q;  3K57 A;  1WD1 A;  1PFN A;  3FKI H;  1A3V A;  1DZ1 A;  2WAQ G;  1FYC A;  2HIX A;  5I9O A;  1EFW A;  4CJ0 B;  1K83 B;  1Q1B A;  1N33 L;  4IFD J;  3NSW A;  1XYI A;  3VR2 A;  3GTP H;  1DON A;  4A4I A;  5KIX A;  4NXM L;  1P16 A;  2JA8 B;  1N36 Q;  4YCW A;  2EYJ A;  5JEA G;  4KHP L;  3NTK A;  4YIJ A;  1Y1V H;  5T1G A;  5COY A;  1ZYR C;  5T1I A;  1QVC A;  4KMU C;  1FVI A;  3RN2 A;  3TDQ A;  5FLM H;  1D1K A;  4POF A;  1CHP D;  4JI1 L;  4LW1 A;  3MC0 B;  3MAQ A;  1PRT D;  5IT9 E;  1WD0 A;  5ELB A;  1SMX A;  1ZEQ X;  1E24 A; 
#chains in the Genus database with same CATH homology
 3PUV A;  4GN3 B;  1WFQ A;  2VQE L;  4HJ5 A;  3M85 A;  4HJ8 A;  1VCI A;  4A3D G;  3J7Z C;  3GTO H;  3HOU G;  1EQQ A;  2PQA B;  1KC8 C;  1K9M C;  1YI2 A;  2KHJ A;  2JA7 G;  3F8T A;  1VQ8 A;  1A8V A;  5GRO A;  4MZ9 A;  3TS0 A;  5FJ8 G;  2F4V Q;  1S3O A;  2IHF A;  4L5Q A;  3T1H Q;  2LXJ A;  4X65 L;  3CC7 A;  3A74 A;  3ZJY C;  5C0X G;  4DR3 Q;  3GTG H;  1TWF H;  4YY3 L;  1VQ6 A;  4LFC L;  4A3C G;  4JYA Q;  2CFM A;  1L1O C;  1YNX A;  1WCM H;  4IJL A;  4LF7 Q;  2IX0 A;  2JJQ A;  1VQE A;  1LM0 A;  3L7Z C;  3CMA A;  1KAW A;  1X56 A;  2AWN A;  1RL2 A;  1E22 A;  3UDI A;  5IYB G;  1IBM L;  4BY1 H;  2PI2 A;  1AH9 A;  3S1N H;  4LF8 Q;  2JQO A;  4P72 A;  5C44 G;  3CCQ A;  1PH6 A;  2GVB A;  1SR3 A;  1HR0 Q;  4LF5 Q;  3W1B A;  4FDB A;  1KL9 A;  4NB3 A;  3L0O A;  4A3F G;  3OYY A;  3J81 j;  3CCE A;  1PH8 A;  2JA8 G;  1NJI C;  4OX9 L;  4EQ5 A;  3RZD H;  2ID0 A;  1CKM A;  4APV A;  1X3F A;  1DGS A;  2ATW A;  3PCO B;  1YHQ A;  2PNH A;  2UU9 L;  4JI4 Q;  4DR1 Q;  2VQF L;  4A3G H;  2K5H A;  1HNX Q;  4HIK A;  1WOC A;  1VS0 A;  2BA0 A;  1NMG A;  1WI5 A;  1XPR A;  1YVC A;  4LF4 Q;  4A3B G;  1PH4 A;  3RLF A;  1IBL L;  3CF5 A;  4JI2 L;  1HZ9 A;  4JI6 L;  5IP9 H;  4AYB G;  4ALP A;  3T1Y Q;  1N32 L;  1VQL A;  4X66 Q;  1X9N A;  3GTL H;  4Y7N H;  2HHH Q;  4A3J H;  4PZ8 A;  4R4Q A;  2B63 H;  1P8L A;  3RN5 A;  2ZJP A;  3PF4 A;  3A5U A;  3CW2 C;  1Q46 A;  1OXV A;  2NZH A;  1CKO A;  4IPG A;  3J80 c;  4DV4 Q;  1J5E L;  1HZB A;  1I94 L;  1VQK A;  2UXC L;  4BBR H;  2D62 A;  1VQJ A;  2RF4 A;  1QZH A;  2MO0 A;  2ZTD A;  1L1O B;  3TS2 A;  2HQL A;  3F1Z A;  3NEN A;  3S17 H;  4B3S L;  5LMN W;  1VQG A;  3STB C;  2RCN A;  2VL6 A;  4B3T L;  4C2M H;  1PH7 A;  4K0K L;  4PMW A;  1HZA A;  3K0X A;  4RG1 A;  5IP7 G;  2R7F A;  2Z0S A;  1C7Y A;  2R6G A;  3E9H A;  3J81 i;  4OO1 G;  1N34 Q;  3PIP A;  4A3E H;  4JBM A;  3M9B A;  1KQS A;  1PYS B;  1I50 H;  3UE1 A;  4DV2 Q;  2E8G A;  1PH9 A;  4LF5 L;  1YJW A;  1IBK L;  1JJ2 A;  2MNA A;  4JV5 L;  4P75 A;  5FLX c;  2VY3 A;  4YCV A;  4GLA C;  4C3H H;  3HOW G;  2A1A A;  4DUZ L;  1UWV A;  3JC6 6;  1Y1W H;  5IWA Q;  2UXD Q;  4R4O A;  3A0J A;  3OTO Q;  1UE5 A;  1X65 A;  5JEA J;  3UE0 A;  5BR8 L;  5JJL A;  2R93 H;  1XMQ Q;  3ICE A;  2MQH A;  2NZO A;  4LUO A;  3UDX A;  1KXL A;  1Q81 C;  2UUB L;  5JJI A;  4IFD I;  1EWI A;  3ULJ A;  4BY7 G;  5HGQ A;  4P73 A;  4GN4 B;  4KHZ A;  1VQ9 A;  1HZC A;  1LTL A;  1PH1 A;  2EXD A;  2KCM A;  3F2B A;  1HR0 W;  3B6Y A;  3PO3 G;  4P71 A;  2BA1 A;  4A3I H;  1AE2 A;  5IYD G;  1G51 A;  1U0L A;  1ASZ A;  3HOX G;  3IRB A;  4AH6 A;  2HHH L;  3I4M H;  1OXX K;  3KDF A;  4R4I A;  2JEB I;  3NBH B;  1S72 A;  1XNQ L;  3TRE A;  5HY6 A;  4DV1 Q;  4B3M Q;  3S24 A;  4C3I H;  1K0R A;  2KHI A;  1E3P A;  1U5K A;  5IYC G;  1OXU A;  4DV4 L;  3M3Y H;  4IOA A;  3PO2 H;  4A75 A;  1L1O A;  3J7A 5;  1WJJ A;  5LMN Q;  4JI7 Q;  1JT8 A;  1EQR A;  1VQD A;  2OCE A;  2IHE A;  3UDG A;  1XMO L;  1ASY A;  1PVO A;  1I3Q H;  5C0X J;  2L15 A;  2ZJR A;  1K3R A;  2GN5 A;  3GTQ H;  4JG2 A;  3CCR A;  2WFW A;  4DKA C;  2R92 G;  1VQ4 A;  3M4Q A;  5M3F G;  3K81 C;  1PV4 A;  1CSQ A;  1NY4 A;  2ES2 A;  4LFB Q;  4GNX C;  2OQK A;  3BZK A;  4BA1 I;  2LXK A;  2H5X A;  4OWX B;  4WJ4 A;  3G71 A;  3CCL A;  3RLN A;  1PHJ A;  1GKH A;  2F3I A;  1FGU A;  4YCU A;  4QY7 A;  2OWO A;  3VDY A;  3HOZ G;  2JA6 G;  1GO3 E;  1TWA H;  4OXP A;  4A3M G;  4DR6 Q;  3J80 i;  3GO5 A;  2Q2I A;  3HOV G;  3I4N G;  5H1S E;  3S2D H;  2R7Z G;  5C4X H;  5IWA L;  4BBS H;  3I2Z A;  4DV3 L;  1FL0 A;  2NVT H;  5GAG C;  2JEA I;  4NXN L;  5C3E H;  2JA5 H;  3E0E A;  2NVQ H;  2E2I H;  4DR4 Q;  1XMQ L;  2ZTE A;  1VQC A;  2HIV A;  3D31 A;  4L5T A;  3PIO A;  2A19 A;  4LF6 Q;  3OW2 A;  1HNW Q;  4GLX A;  3F2D A;  4JI0 Q;  4JBK A;  4LF9 Q;  5AJ3 Q;  1YJN A;  3Q8D A;  4JI5 L;  3S1M H;  4GKJ Q;  2AWO A;  2AMC B;  4HID A;  4IJH A;  1SRO A;  5J3B A;  2JE6 I;  4A93 G;  1Q8K A;  4JOI C;  1N36 L;  2K4K A;  3H3V H;  3PUW A;  3RLO A;  4B3M L;  4A3L G;  2RHS B;  1B70 B;  4PZ7 A;  2E2H H;  3BJU A;  3KF6 A;  1Z9F A;  2DGY A;  1YJ9 A;  1HNZ L;  3KJP A;  4JI7 L;  1UE6 A;  4DV6 Q;  1K73 C;  2VUM G;  1E7Z A;  1CUK A;  1E1O A;  2QEX A;  4GNX B;  4BXX H;  3FKI G;  4R4T A;  2YTY A;  3HOY G;  5C4J H;  2N3S A;  2N8N A;  4GOP C;  3KDF B;  4DNI A;  4O0A A;  5M3M H;  3H0G H;  2F52 A;  4P74 A;  4X62 Q;  1YZ6 A;  2CKZ B;  2UUA Q;  1MJE A;  3G4S A;  2VW9 A;  1I6H H;  1IZ6 A;  2A8V A;  1X6O A;  3D0F A;  4DV0 Q;  1Y1V G;  1VQM A;  1RIP A;  2NN6 I;  1TWG H;  4C3J H;  2I0Q A;  3RNU A;  4TVA B;  1XPO A;  1N33 Q;  1VQN A;  3NEL A;  2F4V L;  3T1H L;  4DR2 Q;  3M4P A;  3CP0 A;  4UP9 A;  4DR3 L;  1N9W A;  5FLM G;  4NXM Q;  3H3V I;  4A3K G;  4X64 Q;  2CCZ A;  4A3D H;  3HOU H;  4JYA L;  3W5O A;  1FJG Q;  2XGT A;  4GKK Q;  4H02 A;  1TWC H;  3PUY A;  3FHW A;  4QJF A;  1M1K C;  5GAH C;  4LF7 L;  4KHP Q;  2JA7 H;  4DUY Q;  1PA6 A;  5ELN A;  3TQY A;  3AFP A;  5FJ8 H;  1SN8 A;  1SLJ A;  1X3E A;  4HJ7 A;  2NVY H;  4LF8 L;  3S14 H;  4HIM A;  5M5Y H;  1HR0 L;  3ULP A;  1QUQ A;  4JBW A;  1Y14 B;  4POG A;  3M4O H;  4R1J A;  4XIG S;  4DAY B;  4DR5 Q;  4JI1 Q;  4JI0 L;  4A3C H;  5AJ3 L;  1D7Q A;  2DUD A;  1VQP A;  5LMU Q;  4GKJ L;  4RMF A;  2K5N A;  3U4Z A;  2C35 B;  2K5V A;  1PH2 A;  2HT1 A;  1VQO A;  5IYB H;  1K83 H;  2VQE Q;  4A76 A;  5C44 H;  3HKZ E;  3WWV A;  3J81 c;  4DR1 L;  1HNX L;  3PSI A;  4JI4 L;  4X6A H;  1YHB A;  3CME A;  4A3F H;  2FXQ A;  1WYD A;  2JK8 A;  4JI8 Q;  1EIY B;  5E7N A;  2LSS A;  2Z6K C;  1WCM G;  1XTD A;  4LF4 L;  2JA8 H;  3KFU A;  2PMZ E;  4GOP B;  4IO9 A;  3MEF A;  4DV6 L;  4GNX A;  1X3G A;  4BY1 G;  4DAM A;  4UY8 C;  3T1Y L;  4LWC A;  4JI3 Q;  1YBY A;  4X66 L;  2K50 A;  1AE3 A;  2E5L Q;  1LYL A;  4LFC Q;  1X54 A;  3CCU A;  4HJ9 A;  1JJC B;  4YWM A;  4LFA Q;  2MO1 A;  4A3B H;  1SFO H;  4MTN A;  2OQ0 A;  2WB1 E;  4OWT B;  1EYG A;  2AHO B;  4DR7 Q;  1V43 A;  4IPD A;  1T9H A;  3GD7 A;  2B3G A;  4J15 A;  4NPS A;  4X62 L;  1IBM Q;  2UUA L;  4MNO A;  4L5S A;  1Q12 A;  4A3G G;  1X55 A;  3KF8 B;  3NEM A;  4B3R Q;  2EQS A;  1BKB A;  3KF6 B;  1CKN A;  3K7U C;  4DV0 L;  3LGJ A;  1B7Y B;  3CCV A;  1Q82 C;  4DK6 C;  4OX9 Q;  2KCT A;  4DR2 L;  4LUV A;  2R7D A;  1EUJ A;  1L2F A;  1SE8 A;  3I7F A;  4X64 L;  3ULL A;  5IP9 G;  2UU9 Q;  1FJG L;  3CPF A;  5GQO A;  1MKH A;  2D0P A;  3KOJ A;  4DPG A;  2I5H A;  1Q1E A;  4A3J G;  4DUY L;  4DV7 Q;  1N8R C;  1N34 L;  3HFZ B;  1H95 A;  1NTG A;  4JOI A;  4YHH Q;  2B63 G;  3STB D;  4DV2 L;  1K8A C;  1HJP A;  1IBL Q;  2OTJ A;  3RZO H;  4JI2 Q;  4DR5 L;  5IP7 H;  3CPW A;  1B8A A;  4DV5 Q;  4BBR G;  4WJ3 M;  1N32 Q;  3JAM c;  2IT1 A;  1XNR Q;  2IX1 A;  4IFD G;  2ZTC A;  2UXD L;  4PZ6 A;  3OTO L;  5M5X H;  3PF5 A;  1Q7Y C;  2UXB Q;  2NVX H;  1A0I A;  4QL5 A;  1SRU A;  1VQB A;  3AYH B;  3U50 C;  3U58 A;  1A63 A;  2K14 A;  2GVA A;  1I94 Q;  2UXC Q;  2WAQ E;  2ZM6 Q;  2Y0S E;  1J5E Q;  3S16 H;  1KHI A;  3BU2 A;  3HOW H;  4DK3 C;  4JI8 L;  3PUZ A;  4GOP A;  3E9I A;  2WP8 J;  1BVS A;  5IT9 c;  3PV0 A;  1QUQ B;  1YIJ A;  4LNQ A;  3KYH C;  3F2C A;  4A3E G;  4GN5 A;  4B3S Q;  2IY5 B;  3K80 C;  4JI3 L;  1I5F A;  1TXY A;  3MXN B;  2Q2T A;  4B3T Q;  4OWW B;  2E5L L;  4K0K Q;  1Z47 A;  1KRT A;  1JJG A;  2MFI A;  4L5R C;  2YV5 A;  4DV1 L;  2YTX A;  2D0O A;  1E1T A;  4LFA L;  1Y1W G;  4BY7 H;  4Y52 H;  3S2H H;  2Q2H A;  1VQF A;  3I55 A;  4DR7 L;  1VQ5 A;  3S15 H;  4HJA A;  3PO3 H;  4B3R L;  3I56 A;  3PUX A;  1BBU A;  5IY0 A;  5LMN L;  4OON A;  2N49 A;  2R93 G;  5IYD H;  3PGZ A;  2QGQ A;  3HOX H;  1KRS A;  1TWH H;  2CWP A;  1IBK Q;  1UE7 A;  4JV5 Q;  2I5L X;  4AQY Q;  1O7I A;  1Q86 C;  3EIV A;  4DUZ Q;  4OO1 I;  2YU9 H;  1UE1 A;  3S1R H;  3AFQ A;  4BA2 I;  2VNU D;  5IYC H;  4GS3 A;  5BR8 Q;  2BH2 A;  3W1G A;  4JC0 A;  1VQH A;  1JMC A;  4A3I G;  4XTC S;  2Q2U A;  4LFB L;  1IYJ B;  2EIF A;  2KBN A;  4KLK A;  1L0W A;  1JB7 A;  3HKZ G;  1VQ7 A;  2UUB Q;  1OXS C;  1A62 A;  4DV7 L;  3I4M G;  2K75 A;  2E2J H;  3TRZ A;  4YHH L;  1KD1 C;  3S1Q H;  4QQB X;  3CXC A;  2CQO A;  4GLV B;  4QGU A;  5JJK A;  2R92 H;  5M5W H;  4UP8 A;  1KIX A;  3GTM H;  1CKN B;  4DR6 L;  5M3F H;  1G6P A;  3FP9 A;  1M90 C;  2V1C C;  2UUC Q;  3PO2 G;  4DV5 L;  1NMF A;  4TQU S;  1XNR L;  1NBW A;  1VQI A;  2I5M X;  2Z6K A;  1JE5 A;  4IPC A;  1PH5 A;  2N78 A;  2PI2 E;  1XNQ Q;  3RR5 A;  1G29 1;  2UXB L;  3AQQ A;  4DR4 L;  3HOZ H;  3HKS A;  1XJV A;  2JA6 H;  4A3M H;  1OTC A;  2ALY B;  4IOC A;  1W2B A;  2PQA A;  1QZG A;  2ZJQ A;  3HOV H;  2ZM6 L;  2WB1 G;  3K8A A;  1PH3 A;  1PYB A;  3EBE A;  3I4N H;  2R7Z H;  4LF6 L;  3CCM A;  1HNW L;  3GTK H;  5ELO A;  1XMO Q;  4UPA A;  1K8G A;  3GTJ H;  4LF9 L;  4PG3 A;  2BH8 A;  3H15 A;  1BBW A;  1YIT A;  3KJO A;  3AEV A;  4KI0 A;  1GM5 A;  3GDE A;  1CSP A;  2K52 A;  1VQA A;  3CQZ H;  1PFS A;  1UEB A;  2YYZ A;  3KLW A;  1GVP A;  3CCJ A;  3DLL A;  3JAM i;  5IE8 A;  1C9O A;  1J6Q A;  4JBJ A;  3UDF A;  5C4X G;  4BBS G;  3K7A H;  3ERS X;  1D8L A;  1NE3 A;  5GAD C;  5C3E G;  4IPH A;  2JA5 G;  1C0A A;  3CD6 A;  4AYB E;  4A93 H;  5GAE C;  2CWA A;  3BZC A;  1HH2 P;  2QA4 A;  3M7N A;  4HIO A;  1R9T H;  2KEN A;  4YWL A;  3CAM A;  1QVF A;  1MJC A;  4QIW E;  4X65 Q;  4AQY L;  4UP7 A;  2YTV A;  3I4O A;  4YY3 Q;  3U4V A;  4A3L H;  4ME3 A;  5DLQ E;  4AIM A;  4DV3 Q;  1V1Q A;  2VS1 A;  2NN6 G;  4NXN Q;  1IL2 A;  2XTI A;  1S40 A;  3CC2 A;  1W3S A;  3ER0 A;  5C0X I;  2VUM H;  4LUZ A;  4EX5 A;  2VZA A;  3DM3 A;  4R4C A;  3TEH B;  3CCS A;  3FKI H;  4YWK A;  3L2P A;  2WAQ G;  2HIX A;  2Y0S G;  1EFW A;  1XPU A;  3HOY H;  1IXR A;  2JA9 A;  1Q1B A;  5EAY A;  1QVG A;  4JI5 Q;  1MIU A;  1N33 L;  3SGI A;  4IFD J;  2UUC L;  3GTP H;  1YEZ A;  4A4I A;  4NXM L;  1P16 A;  1N36 Q;  3A5Z B;  4YCW A;  2OTL A;  2VQF Q;  2ASB A;  2AKW B;  4GKK L;  4BXX G;  5JEA G;  4KHP L;  1GD7 A;  1Y1V H;  1EIF A;  2RHQ B;  4JCV E;  1QVC A;  1FVI A;  5M3M G;  3EN2 A;  3H0G G;  5FLM H;  3RN2 A;  1HNZ Q;  4A3K H;  5K36 G;  1YHA A;  4POF A;  4JI6 Q;  4JI1 L;  1LUZ A;  1EOV A;  4LW1 A;  3CC4 A;  1OXT A;  3G6E A;  3G48 A;  2B29 A;  5LMU L;  1SMX A;  1V9P A;  1E24 A;  4O2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...