4L5RC

Crystal structure of p202 hin1 in complex with 20-mer dsdna
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
198
structure length
198
Chain Sequence
TPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 198
sequence length 198
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5rC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5rC01
1X56A 3I4OA 4DUYL 1VQEA 4TVAB 3KF6B 1YZ6A 1H95A 4KHPL 1WOCA 1Y1VH 5HY6A 1OXVA 3EN2A 2ATWA 4DK3C 3I4NH 2JJQA 4IFDG 4LF6L 1E1OA 3M3YH 4BXXG 3GTPH 4FDBA 4DR5L 2RHSB 3E9IA 2V1CC 1KHIA 1L1OA 4A3FG 4XTCS 1A0IA 1YHAA 2NN6I 4DV7Q 1VQ5A 4JI7L 3M4OH 1X65A 4DR7Q 4BY7G 2EXDA 2R6GA 2VW9A 3FKIH 2WAQG 5IWAQ 2HHHQ 1PHJA 5C4XH 1N9WA 3HKZE 1PV4A 1FJGQ 2KHJA 5IYBG 1A8VA 2JA9A 3CF5A 3J81c 4DKAC 1VQ7A 3S2DH 2VNUD 1P8LA 2VQEQ 1HNZQ 1VQOA 4LFBQ 2OCEA 1NJIC 4AQYQ 2JA6H 2UXBL 2DUDA 5DLQE 1V9PA 1I94Q 1IBKQ 3KFUA 1EIYB 1AH9A 3I4MG 3HOYG 2I5LX 1Z9FA 2E8GA 3AQQA 1FL0A 1YHQA 2WP8J 3H0GH 5IP7H 4GNXA 3TS0A 1KXLA 4DR4L 1WFQA 4YHHQ 1VQ9A 3DLLA 4LFCQ 3BJUA 2ZJRA 4BBSH 2JK8A 3GTLH 4J15A 3J7ZC 2JA6G 1MKHA 3B6YA 2KHIA 4GNXB 2E2IH 1PH3A 3KJOA 3KOJA 2Q2UA 1T9HA 2NN6G 4PMWA 1G51A 1X54A 4BY1H 2C35B 1E3PA 4JG2A 1EFWA 1C9OA 2AWNA 2LXJA 1JJGA 3HOWG 1V43A 4QGUA 1VQCA 2PI2A 1X55A 3AFPA 5FJ8G 1YJNA 4JCVE 4A93H 1KIXA 2ZTEA 4AYBE 2VQEL 3GTQH 2H5XA 5AJ3L 2JA7H 2AMCB 1NE3A 1X6OA 2ID0A 1CKNA 2MFIA 2R92H 4B3RL 4JOIC 1VQJA 3NEMA 3OYYA 5M3FH 1N8RC 1HR0W 4L5RC 1HZAA 1CUKA 1HZBA 1IBMQ 4LW1A 4PZ6A 2NVTH 5BR8Q 4EQ5A 2EIFA 3T1YQ 3I4NG 1JMCA 1VS0A 2OQ0A 3MEFA 4IJHA 1CKNB 1VQ4A 3HOUH 2VY3A 4Y52H 1E22A 2PQAA 4ALPA 2XTIA 4DV3L 2ZJQA 1K83H 3PF4A 2QEXA 4JI8L 4POGA 1G291 2JE6I 2R7FA 1B7YB 1IBLQ 2UUCL 1RL2A 1VQBA 2AWOA 3F8TA 4A3MG 4IFDJ 3OW2A 2YTXA 4IO9A 4IOAA 4AH6A 1OTCA 2PQAB 5C4XG 1M90C 5IP9G 2CWPA 3GTGH 3LGJA 1YEZA 5LMNL 4LF8Q 4NPSA 5IT9c 4JI0Q 4OX9L 3W1GA 5JJLA 3NELA 4MNOA 3HFZB 1NMFA 4A3EG 1BBWA 1N33L 1N36Q 3NBHB 4GOPA 4B3MQ 1X3EA 4R1JA 3I55A 1SROA 3PO2H 5FLMH 3FHWA 4R4OA 2HQLA 3RN5A 4JBWA 4YY3Q 1QZGA 3CP0A 5IP7G 2MO0A 1C7YA 1CKOA 1OXSC 4X66L 3CCJA 4HIMA 1QVGA 4BBSG 4GOPB 4IJLA 2PNHA 4DUYQ 1GM5A 3S17H 1N34L 4DR3L 3D31A 4LWCA 4KHPQ 4GKJL 5M5WH 4A3KH 1Q81C 5IYCH 4OO1I 4LF6Q 2CFMA 3W1BA 1P16A 4DR5Q 1SFOH 3UE1A 3OTOQ 2CCZA 4A3DH 4MZ9A 5JEAJ 3GTKH 4A93G 4A3LG 2K4KA 4LF8L 2B63G 1VQ6A 4JI0L 4JI6Q 4IPGA 4P74A 3IRBA 2JA7G 1KRSA 2K14A 1EYGA 3A5UA 2R92G 2L15A 4A3JH 1IL2A 4APVA 4LFAQ 5IYDG 2JEAI 2K5HA 3L2PA 4A3IH 3M85A 2UXBQ 4ME3A 5M5YH 4GLAC 4NXML 1TXYA 1XMQL 1VQHA 1VQFA 2ES2A 2R93H 1JJ2A 3TS2A 3U4ZA 4DR4Q 4DUZQ 4TQUS 1EWIA 5H1SE 1S3OA 3F2DA 2PI2E 4X62Q 4UY8C 1E1TA 1J5EL 1GO3E 4X6AH 2WB1E 1PH4A 3BZCA 1PH7A 4LUVA 4X65L 3T1HL 1PFSA 2JEBI 3K8AA 4P73A 4DV1L 5C3EH 3HOZH 1YIJA 4OWXB 1W2BA 3OTOL 1IZ6A 3CPFA 2YU9H 1OXTA 5IY0A 2YV5A 4RMFA 1GVPA 3CPWA 3CCSA 1PH9A 5GAEC 4GKKQ 1I6HH 3GTMH 4YWLA 4WJ3M 4A3GG 2IX1A 5C0XI 4JI6L 1G6PA 4HIKA 2IX0A 1AE3A 4DV2L 1L1OB 2AHOB 1UE7A 1YHBA 3JAMi 1XPUA 1K3RA 4QIWE 2IY5B 4IPDA 1EUJA 4LFAL 3HKSA 3JC66 5AJ3Q 5C44H 3S15H 2Q2IA 1NY4A 2RHQB 4B3RQ 4JC0A 1PH2A 2N49A 3K0XA 4DUZL 3PUVA 4X64Q 2RF4A 1Q82C 4X62L 1CSQA 1WYDA 3UE0A 1XNRL 4DAMA 4DV3Q 2ZTDA 1VQMA 2Y0SG 3PIPA 3CCQA 1FGUA 3M7NA 4JI8Q 4OWWB 4DAYB 4A3DG 4IOCA 3M4PA 2UUCQ 5JEAG 1VQGA 2KBNA 3A5ZB 4JI2Q 2NVQH 3PGZA 4O0AA 1K0RA 3I2ZA 1XMOL 1L1OC 4GKKL 3M9BA 1Q7YC 1S40A 3U50C 5LMNQ 5C0XG 3KJPA 4A3JG 4OX9Q 3AYHB 2B3GA 3K7UC 1Q1BA 1N33Q 1TWCH 3JAMc 1TWGH 3STBC 1R9TH 3E9HA 3S24A 1HZCA 2K50A 3ULPA 3RN2A 3PF5A 3U4VA 4LNQA 1YVCA 1HNWL 4KLKA 1VQPA 4X66Q 1CKMA 3KF8B 3RZDH 1Y1VG 1NTGA 4X64L 1VQLA 1BVSA 1Q1EA 1YJWA 3E0EA 2QGQA 1Y1WH 3J81j 1N34Q 4DK6C 4YCVA 4GNXC 4DR3Q 5ELOA 2N3SA 1SLJA 4GKJQ 1K8GA 5M3MH 2JA5H 1I50H 2ZJPA 4HIDA 4JBKA 3AFQA 3GTOH 3RZOH 4DR1Q 3SGIA 2HIVA 4JI2L 4C3IH 1Q86C 2ASBA 4POFA 3FKIG 3HKZG 4JV5L 4QJFA 2UXDL 1RIPA 2R7DA 4R4QA 1LYLA 2K75A 1QUQA 1HZ9A 5GROA 5HGQA 5C44G 1J6QA 3CXCA 1VQAA 4B3SL 3S1MH 2OWOA 3S14H 2A8VA 2B29A 1Y14B 4LF4Q 1B8AA 2N78A 3H0GG 4BBRH 3CCVA 4NXMQ 4GLXA 1QUQB 5K36G 4L5SA 1XMQQ 2F3IA 3F1ZA 2NVYH 3UDFA 2GVBA 1E7ZA 4PZ8A 1EQQA 4WJ4A 3ER0A 4B3TL 1U5KA 2GVAA 1HH2P 2OQKA 3HOXH 4A3FH 1AE2A 3I7FA 4K0KL 2YTYA 4DR6L 1MJCA 1J5EQ 2JA8H 2K52A 1VQDA 4X65Q 3T1HQ 1KD1C 1NMGA 3PCOB 3CC7A 4DV1Q 4DR1L 2I5MX 4L5TA 3PIOA 1YITA 3CC2A 3UDXA 4BY1G 3WWVA 3ULJA 1LUZA 1MIUA 2WAQE 5IYBH 4OWTB 2F4VL 2KCTA 1WJJA 2VUMH 4XIGS 1CSPA 1LM0A 4IPCA 4AYBG 2XGTA 3H15A 4C3JH 4JI4L 4LF7L 3H3VH 3BZKA 1N32L 3ICEA 1Z47A 4DV2Q 3I4MH 4DV5L 2RCNA 1TWHH 5GADC 5C0XJ 2Q2HA 1UE5A 1SE8A 5M3FG 1Q46A 3PV0A 1XNQL 4H02A 2PMZE 4DR2Q 4LF4L 5LMUL 3PUWA 4DPGA 4GOPC 4JI3L 5FLXc 4LF9L 3CCEA 2IT1A 5JJKA 1L2FA 1X3GA 4R4IA 4HJ9A 1Y1WG 2Q2TA 4HJ5A 4C2MH 3HOUG 3S1NH 1XPRA 1LTLA 1VQNA 2Y0SE 2E2JH 1DGSA 2CKZB 2EQSA 4P75A 1KC8C 1ASZA 2BA1A 3Q8DA 1BBUA 2ZTCA 3J80i 1XNRQ 1HNXL 2N8NA 1HR0L 4LUZA 4A3BH 4OO1G 3L0OA 4QL5A 4JI5L 5FJ8H 2I0QA 2F52A 4DV0Q 2KENA 3KF6A 1XMOQ 3H3VI 1U0LA 4YCWA 1I3QH 1UEBA 2HIXA 1L0WA 1S72A 3K7AH 3PSIA 3PO2G 1YNXA 4IPHA 5FLMG 3RLNA 4A3CH 2MQHA 2ALYB 4BBRG 3EBEA 3A74A 4DR2L 3VDYA 4DV4L 5LMNW 4QY7A 2MNAA 2D0PA 3W5OA 1HNWQ 3S1QH 1VQIA 3ZJYC 3HOXG 2CQOA 1YBYA 2UXCL 2VS1A 4LF5L 4A3KG 2JA8G 1UE6A 1A62A 2D62A 2FXQA 3GO5A 4C3HH 5IYCG 3DM3A 4Y7NH 1VCIA 4A3MH 2HT1A 5EAYA 4NXNL 4OONA 2Z6KA 3RR5A 1TWFH 1MJEA 1KL9A 5IP9H 3NENA 2YTVA 2VL6A 3J80c 2E5LL 1B70B 2VUMG 4JOIA 1PYSB 1WI5A 1X9NA 4AIMA 4DV0L 4JI1L 4HJ8A 4JV5Q 2UXDQ 1SRUA 3UDIA 4A3EH 3KYHC 1JT8A 1E24A 3PUZA 1V1QA 5E7NA 4GN5A 5IE8A 4A3IG 3CCLA 2WFWA 4EX5A 3G6EA 3TEHB 2R7ZH 4B3SQ 2A1AA 3CQZH 3CCUA 3F2CA 2R93G 1JB7A 4QQBX 3CMEA 3K80C 1I5FA 3G4SA 3PO3H 3KDFA 1OXUA 4JBMA 2D0OA 2E2HH 4DV7L 2WB1G 4A4IA 1WCMH 3FP9A 4B3TQ 1IYJB 3HOVH 1GD7A 3S16H 4DR7L 4A3BG 2CWAA 3ERSX 5GQOA 5C3EG 3HOZG 1W3SA 4K0KQ 4DR6Q 5IWAL 4P71A 1M1KC 4DV6Q 2HHHL 2MO1A 1PVOA 1FJGL 2ZM6Q 1JE5A 3KDFB 1UWVA 4HIOA 2K5VA 3GDEA 3S1RH 3CC4A 2B63H 4A3LH 1N32Q 2Z6KC 5M5XH 1HNZL 2Z0SA 5J3BA 4LFBL 2VQFQ 4AQYL 2NZOA 3CW2C 1D8LA 2A19A 1I94L 1IBKL 2F4VQ 1Q8KA 1JJCB 1Q12A 5IYDH 3J7A5 2UUBQ 4JYAQ 4JI4Q 4A3CG 4LF7Q 2K5NA 3F2BA 1XTDA 2LXKA 1O7IA 3ULLA 2QA4A 4GN3B 3I56A 4DV5Q 3AEVA 4YHHL 4O2DA 3CCMA 4LFCL 1PYBA 4YCUA 1XNQQ 4PG3A 5LMUQ 4LF9Q 4JI3Q 4UP9A 1XJVA 1SN8A 1UE1A 4DNIA 1ASYA 1PH6A 3RLFA 3PUXA 4BXXH 3L7ZC 1IXRA 1TWAH 1PH8A 2YYZA 2UU9Q 3BU2A 1VQ8A 1D7QA 3CAMA 3RLOA 3EIVA 4DV6L 3RNUA 1HNXQ 1HR0Q 2ZM6L 3STBD 1VQKA 4BY7H 2OTLA 2OTJA 4UP8A 4MTNA 5GAGC 4A3GH 4JI5Q 4P72A 2KCMA 1SR3A 2VQFL 5GAHC 4LUOA 2LSSA 2VZAA 4YWKA 3D0FA 2UUAQ 1FVIA 4BA2I 1KQSA 1PH1A 2UUBL 4JYAL 2JQOA 3MXNB 1IBML 4RG1A 4GLVB 2R7ZG 2AKWB 5BR8L 1A63A 3U58A 2BH8A 1QVCA 3HOYH 3TREA 3T1YL 1C0AA 1X3FA 5C4JH 1KAWA 1EIFA 3TQYA 2NVXH 2DGYA 3G71A 4OXPA 4DV4Q 3CD6A 3PO3G 1KRTA 4R4CA 4IFDI 4R4TA 5JJIA 1YI2A 3UDGA 1PH5A 1WCMG 4L5QA 1IBLL 3HOVG 4KHZA 4UPAA 4HJAA 2UXCQ 1HJPA 3K81C 4GS3A 4JI7Q 4LF5Q 2IHEA 3KLWA 1SMXA 3GD7A 4UP7A 4KI0A 3M4QA 5M3MG 4PZ7A 2JA5G 2UU9L 4GN4B 2BH2A 1EOVA 1XPOA 3CMAA 4A75A 1QVFA 3J81i 3S2HH 3G48A 2GN5A 2I5HA 4NXNQ 1EQRA 1K9MC 1GKHA 1NBWA 1QZHA 4JBJA 1PA6A 3HOWH 3TRZA 5ELNA 3CCRA 1N36L 2E5LQ 4A76A 1YJ9A 4B3ML 4HJ7A 4JI1Q 2UUAL 4YY3L 1OXXK 4YWMA 3PUYA 1BKBA 3GTJH 1K73C 1K8AC 4BA1I 3A0JA 2IHFA 2NZHA 2BA0A 4NB3A
chains in the Genus database with same CATH superfamily
1X56A 2NTTA 4DUYL 1VQEA 2K32A 1DCZA 5CBAE 1ZYRD 3I4NH 4IFDG 4LF6L 2AQ3B 2BOSA 4DR5L 1KHIA 1L1OA 1SMYD 4XTCS 2NN6I 1X65A 3A54A 4BY7G 3PO2B 1N9WA 2KHJA 1A8VA 2JA9A 4BBRB 4DKAC 1JCKB 3KK7A 2VNUD 1ET9A 2F0FA 1NJIC 4LK1C 2I5LX 3AQQA 1BCPF 2WP8J 4MN3A 4XT1B 2JA8B 2HD3A 1WTHA 4GNXA 3OIQA 3VYRA 1Y8OB 2NUCA 4CDEC 2JK8A 1B1ZA 3GTKB 1STEA 4GNXB 2E2IH 3BDLA 1T9HA 4C3JB 2FJ2A 1BCPB 2LXJA 2NYZD 3HOWG 4QGUA 1X55A 5FJ8G 1F77A 4A93H 1EY6A 2DJFC 2VQEL 1ENAA 1F2YA 1TS3A 1PLFA 3S1NB 1X6OA 2ID0A 2G9HD 1CKNA 2R92H 3NEMA 4IQZA 1CUKA 1E2WA 1HZBA 1IBMQ 4PZ6A 2G9DA 2NVTH 4E6IA 5BR8Q 1RKNA 1E2ZA 3MEFA 1CKNB 4ALPA 1VF7A 4CKBA 1IBLQ 1RL2A 4IFDJ 5LL6S 4OO1H 1M90C 2R61A 3PIP3 1WTOA 1YEZA 5IT9c 3NELA 2RQXA 4RHSA 1HFGA 4R9WA 3HFZB 4TSSA 1N33L 2PQEA 4B3MQ 3I55A 1PFMA 3PO2H 1GUTA 3FHWA 2BDOA 3I91A 4YY3Q 1QZGA 1K3BC 1C7YA 4Y7NB 3JAME 1D1KA 1JWSD 4X3KA 1WTVA 4BBSG 4IJLA 1GM5A 5ELBA 3D31A 4KHPQ 1ENCA 3ND9A 2MJ8A 2OXPA 1Q81C 3W1BA 3LX0A 3Q23A 1BQQT 2B39A 2IJ0A 2G5DA 5JEAJ 3GTKH 4DF7A 2N88A 4JI6Q 4IPGA 4P74A 2JA7G 4DFAA 2X69A 5ISRA 2DJGC 4LFAQ 2JEAI 3OIPA 3M85A 2UXBQ 1STYA 3C1EA 4ZRZA 4GLAC 1LV9A 2PCFB 1TXYA 1VQFA 1LABA 5M3MB 1CI3M 4N9PA 3GTOB 4DR4Q 1EWIA 5H1SE 3J7YW 2PI2E 4X62Q 1J5EL 2KHSA 1X3PA 3BZCA 1PH4A 3K8AA 1M4VA 4DV1L 3NTIA 4XXEA 1IZ6A 3KBGA 1PH9A 5GAEC 4K14A 1G6PA 4PQXA 3OPOA 2EJMA 1YHBA 2CVRA 1K3RA 2IY5B 4IPDA 3HKSA 2AUJD 5AFWA 1I4RA 5D3IB 4A3FB 1K8MA 2EY2A 3KLRA 2N49A 4DAYA 3K0XA 4HN7A 3PUVA 5FLXE 4DUZL 2RF4A 1WYDA 4DV3Q 2F0UA 2ZTDA 3PIPA 3CCQA 2FINB 4DAYB 3J80L 4QF4A 2EOTA 2KBNA 3A5ZB 3QOLA 1L1OC 3M9BA 5LMNQ 5C0XG 3KJPA 5J39A 1Q1BA 2CH4A 3JAMc 1PYWD 2JA6B 4CGYB 3U4VA 5IGCA 1SXTA 1LO5D 3RMHA 4X66Q 3KF8B 1Y1VG 4H13C 4X64L 1VQLA 1BVSA 5LHY1 1YJWA 2QGQA 1N34Q 4DR3Q 4GNXC 1XTCD 5ELOA 2A5HA 2N3SA 4GKJQ 1D5MC 5M3MH 1K8GA 1STAA 3AFQA 3GTOH 2BE5C 1BCPC 3MXPA 1LT4D 2ASBA 1V1PA 4QJFA 3KLSX 1EY8A 2N55A 4F7XA 3FDTA 1LYLA 5HGQA 2F0IA 1FNUA 3NE5B 1V1PB 1ZXTA 2LMCB 2Z4IA 2A8VA 1B8AA 5K36G 4A3MB 4L5SA 4WRDA 1XMQQ 2GVBA 1E7ZA 4RA8A 1EQQA 5C4XB 5JPNC 1JB3A 1U5KA 2GVAA 5F2DA 2OF1A 4A3FH 4V0BA 4DR6L 1MJCA 3A7LA 2K52A 5L37A 1S4ZA 2IL8A 3T1HQ 1NMGA 4OO1I 3UDXA 1O78A 3ULJA 1LUZA 2WAQE 1MHWC 2F4VL 1WJJA 5IGEA 4K2LA 4AYBG 4JI4L 3H15A 1LTGD 4EVOA 4DV5L 5IGDA 5HGTA 4KTAA 5C0XJ 4ZQ3A 2M9VA 4H02A 2E2HB 1SNOA 5LMUL 3PUWA 2Z8LA 2F0LA 5FLXc 1JQYD 2IT1A 1X3GA 4FVMA 3FMCA 4R4IA 2Q2TA 5FKAC 1VQNA 3S1RB 1DGSA 1H9SA 2ICEC 2QEJC 1KC8C 1ASZA 2BA1A 1STHA 2A6EC 2ZTCA 3F2UA 1SYGA 1XNRQ 1HNXL 1TS5A 4CBVA 4A3BH 5NUCA 1JOOA 1WTQA 4JI5L 1H9SB 2I0QA 3IL8A 2MP1A 2F52A 1CT1D 3D4RA 4K5WA 3BVGA 1UEBA 1S72A 2EYJA 5FLMG 4CHTB 2MQHA 4NDXA 2ALYB 4DR2L 5ELFA 1TWAB 1SYBA 1TQOA 1HNWQ 1VQIA 3HOXG 5IIFA 1KDCA 2JXMB 2RCFA 3EQLC 4K8IA 2HDLA 1UE6A 2FXQA 2QILA 4A3GB 5LL6X 1STBA 2LY7A 1PTOF 4A3MH 2HT1A 1Q90A 1NSNS 2PO4A 1KL9A 2WKDA 3SDZA 2F0WA 4KY5A 2VUMG 4HJ8A 1MD2D 2MUYA 1GHKA 1V1QA 4UDUC 5E7NA 5JVH3 5IE8A 1EEID 4A3IG 3CCLA 2WFWA 3TEHB 2LKVA 2NBFA 3G4SA 1SAPA 1OXUA 4HSPA 2E2HH 4RCNA 5I6YA 2WB1G 4B3TQ 3HOVH 2CWAA 4KJNA 3IKJA 4A3JB 4K0KQ 2ZM6Q 3CC4A 1UWVA 4IUPA 3S1RH 1U4LA 2Z6KC 2Q8IB 3OSOA 4QB4A 2VQFQ 3HS0C 3DWPA 1Q12A 2ZT9C 4A3CG 2F4IA 3OW7A 3M3YB 1I4GA 3I56A 1J9OA 3GTPB 4DAVA 1PYBA 4YCUA 2ICIA 4LF9Q 3I8ZA 1SN8A 1UE1A 3FKIB 4HAEA 1PH6A 3C1FA 5I2XA 1DOLA 3L7ZC 1TWAH 2YYZA 4ODGA 5DAUA 2UU9Q 3QOJA 1O7ZA 3RNUA 1C4QA 5E4WC 5IT9L 1TKWB 3SXHA 4WORA 4MTNA 1TY2A 4A3GH 2ENBA 4P72A 4HEDA 3SEBA 3H0GB 2ZXPA 3TSSA 4CDCC 2UUAQ 1FVIA 1KQSA 3MXNB 1IBML 2R7ZG 2AKWB 5BR8L 4RHRA 2F0OA 3U58A 2BH8A 1A63A 3HOYH 1DOMA 1X3FA 2BE5D 1S5DD 1BCPD 2Z1CA 3CKIB 2PZWA 2HDMA 3SE0A 4OXPA 4B9WA 1YI2A 1IBLL 1WCMG 3DEPA 2RDHA 1QJOA 1H9KA 1V8QA 1GUOA 4KHZA 4UPAA 4HJAA 1D5ZC 3K81C 3KLWA 5CV8A 3GD7A 4C56C 4OIJA 2JA5G 2BH2A 4PZ7A 3GTQB 3I70A 1QVFA 5CC4A 2GN5A 1K9MC 1NBWA 4JBJA 1PA6A 4B3ML 1LTAD 4YY3L 1K73C 1BKBA 1Y1WB 4X3TA 1BOSA 3PMFA 3A0JA 2NZHA 3NP8A 2L4NA 4NB3A 3I4OA 3KF6B 1DJRD 4KHPL 1OXVA 3EN2A 3M3YH 3GTPH 4C1NK 3GTGB 2V1CC 4DNRB 1A15A 5EKKA 3Q0AA 1A0IA 1YHAA 3BYTB 4JI7L 5D65A 3VYTA 3ZYYX 2EXDA 2R6GA 2VW9A 3FKIH 4K8JA 3HKZE 1PV4A 5IYBG 2TSSA 3CF5A 1VQ7A 1LT5D 4NKLA 4PV1C 1HNZQ 1VQOA 5BN4A 1EWHA 5I9PA 2UXBL 4N8FA 1I94Q 4KMUC 3I4MG 2AUKA 1AN8A 3QIAA 5CV5A 4DXGA 2E8GA 5M5WB 1FL0A 2A6ED 3A56A 2HUGA 3H0GH 4ULLA 4DR4L 3BJUA 2ZJRA 2K05A 3J7ZC 2K5DA 1SE3A 1WTPA 2WINB 3FPPA 3P20A 4A3DG 3KJOA 4PMWA 1GXDC 1BUVT 1AP0A 1X54A 1E3PA 3AB9A 3K0YA 1PRTF 5CV9A 1V43A 3HZXA 1VQCA 2KCNA 1EY4A 2B2UA 1ENFA 4LJZC 1I6VC 2ZTEA 3GTQH 2H5XA 3JAML 4OEMB 1KLGD 2MFIA 1PTOC 2E2JB 4G57A 1HR0W 4IALA 2EYOA 4N8X1 4EQ5A 3T1YQ 3I4NG 2NZ1D 1JMCA 3HOZB 1EOTA 1VQ4A 2PQAA 2BDNA 3R2IA 4DV3L 2ZJQA 4WFN3 1DYQA 2EYHA 1G291 3UI2A 2AWOA 1G8ZD 3OW2A 1CA5A 3K7AB 2KEEA 4AH6A 1OTCA 3NBHA 2PQAB 1I4QA 3KLSA 5IP9G 3GTGH 5KYLA 5LMNL 4LF8Q 3W1GA 4FF3A 1GUWA 5CBEE 2KEDA 4A3EG 3S1QB 5C4ZA 3R3OA 3NBHB 5DM63 4JBWA 3BZDB 1OXSC 4X66L 4HIMA 1RHPA 1CM9A 2F3VA 2JP1A 1TWFB 1B9MA 3R93A 2PNHA 1N34L 4DR3L 4LWCA 2A69C 5M5WH 4GKJL 2CFMA 1MSHA 1FNVA 4KKUA 1P16A 1HCZA 3UE1A 1WTWA 4HR7B 2CHBD 4IN3A 1SEBD 4A93G 4HCEA 3MHBA 4A3LG 4DU9A 1BF4A 4JI0L 2F0JA 2CQAA 3TMEA 1O7LA 3Q24A 3A5UA 2EY5A 2R92G 4TRDA 3PO3B 5C4HA 4APVA 5IYDG 3RZDB 3L2PA 4ME3A 3U9OA 5FLXL 1AFPA 3M7GA 1XMQL 1VQHA 3S9WA 2ES2A 5C5MA 1IW7D 2O5IC 4UAIA 3MEHA 4TQUS 1QOHA 5DNFA 3K58A 1GO3E 1PH7A 4LUVA 3K5LA 3T1HL 4R8NA 4P73A 2FMMA 5CYUA 3HOZH 4KY7A 3OTOL 2YU9H 2IW3A 1IHZA 5IGBA 2IX1A 3S14B 4HIKA 1AE3A 2F0DA 1L1OB 2EY1A 4CJ2C 2LS01 4ID6A 3WOEA 5C44H 2CH4W 4OHJA 1NY4A 3R2TA 4BY7B 3FRPB 2J0TD 1CSQA 1G2TA 3SVMA 1XNRL 3A8KE 1RTNA 1F2LA 5KGUA 1VQMA 3P7JA 3EFXD 5JEAG 4JI2Q 5I2YA 3FEWX 3OWFA 4GKKL 1Q7YC 3FVQA 1T5XD 2PW7A 2EDGA 1QCBD 1TWCH 1HUMA 4IUUA 3NHHA 2K50A 4QCLA 3D6WA 1HNWL 4B9XA 1KLUD 3RZDH 1HA6A 4IUTA 3HOWB 4DK6C 4QUCA 2SOBA 4FP5D 1EQTA 1SLJA 1B3QA 2ZJPA 4HIDA 1CTMA 4JBKA 1I3QB 3BDOA 3MFGA 2EVBA 1RIPA 2E76C 3NUCA 2R7DA 4R4QA 1LTID 1QUQA 2VB3X 4KN4C 1QE6A 4XYQA 4ME5A 1R4QB 4MTKA 4BWGB 2A68C 2B2UC 4CJ1B 1U4PA 3S14H 4LF4Q 1PRTC 2QF7A 3VYSA 4BBRH 3CCVA 4NXMQ 4GLXA 1QUQB 5E4XA 2A73B 3OWEB 5KNCA 4V190 3ER0A 4B3TL 2OQKA 1RTOA 4ABNA 4K0KL 2JA8H 3MAQA 2QCPX 3PCOB 1PTOD 4DR1L 2I5MX 1YITA 4BY1G 1MIUA 1ZKOA 4OIKA 1EZ6A 2H4OA 2KCTA 2C9OA 5C6AA 1DM0B 4C3JH 4BBSB 1EY0A 1PZKD 1FR3A 3ICEA 4DV2Q 5GADC 1O7YA 2DY7A 2Q2HA 4KHVA 1UE5A 4L63B 5M3FG 3BYYB 3E5SA 5CV7A 5DEHA 5EPJA 4LF9L 1EZ8A 2H1EA 2SDFA 1IL8A 1L2FA 3S1NH 3HOUG 1KDBA 3I4LA 1XPRA 2EQSA 2CKZB 4N9TA 4P75A 5M5XB 4IZ8A 3IAYA 1BBUA 2JA7B 3J80i 1M8AA 1PMRA 2EPBA 5FJ8H 3VA5A 4DV0Q 1XMOQ 4DA2A 4YIJA 2D5DA 1I3QH 1ZEQX 1Y8PB 3EA6A 2A69D 2MPMA 4ZKBB 1MGSA 1SE2A 3BVMA 1YNXA 4IPHA 5CR3A 3EJIA 2SNSA 3EBEA 4FNFA 4L6TB 3VDYA 2XSCA 4C1NI 2MNAA 2F03A 2D0PA 1RODA 4IURA 4IUNA 4A3KG 2F0KA 1F9PA 1MSGA 5IYCG 4Y7NH 5FK9C 2F0SA 1LACA 4OONA 2Z6KA 3RR5A 2WACA 3NENA 3NK9A 1H9RA 1B70B 1STNA 1X9NA 1PYSB 1BDOA 4JV5Q 5IGGA 5C4JB 3KYHC 3X3NA 4CKCA 4KY6A 4ZYSA 4JK1C 3SK5A 4DGZA 1SFOB 3CCUA 1CQVA 5E1FA 2R93G 2EJGC 2PZUA 3K80C 1S5ED 4JBMA 5J1ZA 3DHQA 4A4IA 1GD7A 1VDZA 4A3BG 5C3EG 2FHTA 4P71A 4DV6Q 2MO1A 3AEVA 1JE5A 1IYVA 2K5VA 3GDEA 1I4HA 1SSOA 2EE1A 2PW5A 4K6DA 1I4PA 5M5XH 1HNZL 1SYCA 1ML0D 1NR2A 1Q8IA 2VXWA 1D8LA 4RCOA 3BDCA 1I94L 1U4MA 3J81E 3O13A 2UUBQ 1Y1VB 1LTSD 2LXKA 2XIWA 2I07B 3ULLA 5CV6A 4GN3B 3CCMA 1EQVA 1KNEA 1RDPD 3M4OB 3V05A 4JI3Q 3MXGA 5ELCA 4DNIA 1H9MA 3RLFA 3PUXA 4K6LA 4BXXH 1IXRA 3RD4A 1VQ8A 3S2DB 3CAMA 3RLOA 3S15B 1VQKA 5GAGC 2KCMA 4G4KA 3LWEA 2E74C 2QDBA 1LLRD 4YWKA 3TP8A 4JYAL 2K7VA 5C3WA 2F0NA 1GHJA 1QVCA 3T1YL 1DD2A 4I7AA 5C4JH 1KAWA 2D9UA 1RF2D 1D2BA 3TQYA 2DGYA 3SK8A 1NNXA 4DV4Q 3T13A 5IGFA 5JVG3 3CD6A 4IFDI 4R4CA 1PH5A 2KVMA 3RUZA 3HOVG 4IUVA 4O1NA 2JA6H 3LWUA 4UP7A 2K03A 4KI0A 4AYBB 1SNQA 3CMAA 2A68D 2I5HA 4NXNQ 4C3IG 1TU2B 1PRTD 3N52A 1RD9D 4J6HA 1QZHA 1ESFA 2E5LQ 2KA7A 1YJ9A 3KUPA 3VA7A 4HJ7A 2SEBD 1OO9B 3D4DA 4RFBA 3OHXC 4JI1Q 5CGKA 4EQNA 1K8AC 1WVLA 1Y8NB 2IHFA 2VB2X 1I50B 2BA0A 2X6GA 4TVAB 1YZ6A 1AZPA 3E3XA 1H95A 1Y1VH 5HY6A 2B2VC 5A2QE 4DK3C 1E1OA 5FOBB 3E9IA 1C8CA 3M4OH 2WV6D 1PXUA 2MGSA 2NB0A 3S1MB 2WAQG 2HHHQ 5C4XH 1FJGQ 4IUQA 3J81c 3S2DH 2VQEQ 4LFBQ 4KKTA 2OCEA 4RGMA 2DUDA 3MTSA 1WTRA 1IBKQ 1EIYB 1XWEA 3HOXB 3HOYG 4H0LC 1Z9FA 1WD1A 1YHQA 1DZ1A 2JN4A 3QWNA 5IP7H 1PTOB 4XQJA 3TS0A 1WFQA 1F2MA 3DLLA 3P75A 1TS4A 2XNAC 3GV3A 2M2LA 2VUMB 4RKBA 1PH3A 3KOJA 2NN6G 1W6KA 4M1UB 1TWHB 1BNZA 3FPUB 4A3IB 1YJNA 4JCVE 3PQIA 1KIXA 3LNNA 3E6ZX 1BBXC 1LT6D 1DXMA 3HGBA 2IX3A 1VQJA 3DUZA 1HQRD 4L5RC 4LW1A 2WB1B 1PDQA 2B8FA 3H91A 2EIFA 1VS0A 4IJHA 1DOKA 3PF4A 2QEXA 4POGA 3GTMB 2JE6I 2R7FA 1B7YB 4X3UA 4C3HG 1VQBA 3F8TA 2JYOA 2DY8A 2YTXA 4FYDA 4ZKCB 3A55A 2SNMA 2CWPA 3J7AV 1W6JA 2K28A 5EBCA 4NPSA 3CHBD 5JJLA 4EGVA 4TKOB 4XQNA 3Q6SA 1N36Q 1DONA 4GOPA 1HQMC 5JJZA 4S3SA 5FLMH 1CHQD 4H44C 2HQLA 2O5JC 2EYLA 3CP0A 1EY5A 2MO0A 1CKOA 1XX8A 1IYUA 4GOPB 5BN5A 2NVQB 1L0XB 2NWGA 3QJYA 1PTOH 2OEOA 4OELB 3T53B 4EQOA 2PZTA 2CCZA 4PMBA 1H9JA 1LTBD 4MZ9A 3BS1A 3K6OA 2R7ZB 2K4KA 2B63G 2PNRC 1TWGB 1R9TB 3DEOA 3IRBA 4UHVA 5FO9B 4O42A 1KRSA 2K14A 1EYGA 2L15A 4A3JH 1AW7A 4Q5VA 4CKEA 2QKIC 4A3IH 2ZXRA 1WCMB 1B50A 4NXML 1O80A 2EJFC 4RKLA 4I65A 1A2TA 1Z7TA 2EY6A 2F0EA 1QILA 1Y69U 1JJ2A 2JA5B 3U4ZA 4DUZQ 2J4XA 4H7BA 1S3OA 1EWCA 1E1TA 5M9OA 1PZJD 3E0JA 3X3MA 1PFSA 1YIJA 4OWXB 1L0YB 1CHPD 1B3AA 5IY0A 4RMFA 3CPWA 4DAPA 2KOLA 3GTMH 4YWLA 4WJ3M 3PIO3 4FF4A 5C0XI 3DXJC 1UAPA 4RH6A 1JR0D 2IX0A 4JI6L 4DV2L 2AHOB 3JAMi 1UE7A 1XPUA 5IODA 5J22A 1EUJA 4LFAL 5AJ3Q 2K01A 1IKLA 3SR1A 4B08A 4F8MA 3K59A 4B3RQ 1K0SA 1FD7D 1IKMA 1PH2A 1S5CD 4X64Q 3T16A 1Q82C 4X62L 2A74C 3V96A 5EKIA 4DAMA 5I4DA 2Y0SG 3M7NA 4JI8Q 2UUCQ 3M4PA 2NVQH 3PGZA 4O0AA 3I2ZA 1XMOL 3DWQA 3TZUA 3I4MB 4KJOA 2DNCA 3U50C 1SNDA 4Z9CB 4OX9Q 3AYHB 1F9QA 2O4XA 4K5VA 3K7UC 4C2MB 1E0BA 1TWGH 3STBC 3NPPA 1R9TH 2B2WA 3S24A 3ULPA 4LNQA 1E2VA 1VQPA 1CKMA 1NTGA 1PRTB 1Q1EA 3H94A 1Y1WH 3H3VC 1HUNA 2JA5H 3NQIA 1TIID 3GTJB 4LMQD 3SGIA 1SJHD 4ZK9B 1Q86C 2L1BA 3HKZG 4JV5L 3W3AA 5A35A 1BR9A 3G7LA 2K75A 2BCOA 1JOKA 4ZCKA 3I4NB 5C44G 1R4PB 1VQAA 1KNAA 3MVVA 1JORA 2F1MA 1NAPA 2N78A 3KBXA 3NBIA 5COYA 5E3FA 3UDFA 4PZ8A 2B2YA 1HH2P 2RVLA 1AE2A 3H6MA 3I7FA 1SNPA 2HQEA 1Z6HA 4X65Q 4A3EB 3CC7A 1HTPA 1CZGA 3PIOA 3CC2A 3WWVA 1J8IA 5IYBH 4OWTB 1A3VA 4M8AA 2FMCA 3CRLC 3CQZB 1CSPA 4IPCA 2DN8A 3BG3A 2XGTA 3TZDA 1I4XA 1Z47A 2K5QA 3I4MH 3DM1A 2X6LA 1Q46A 4DR2Q 5DM73 4GOPC 3S16B 4JI3L 3CCEA 4JVZA 4C2MH 1LTLA 1KTKA 2E2JH 4A93B 3Q8DA 1TVXA 4RWSC 1B9NA 3ND8A 1KABA 3A8IE 4LUZA 4OO1G 1FGBD 3L0OA 2R92B 4G7OC 4QL5A 1SBBB 3H3VI 3QO2A 5G3LF 1HA5A 1VF5C 4YCWA 1JC7A 2L0CA 3NTHA 2HIXA 1L0WA 3K7AH 1SJED 3PO2G 3RLNA 1EEFD 2TMPA 4BBRG 2A6HC 3TN2A 4DV4L 5LMNW 4QY7A 3EROA 4RGNA 1JWUD 3S1QH 2CQOA 4ZLTF 1YBYA 3C2PA 5JPMC 4HTHA 3CRKC 2JA8G 2D62A 3I72A 1JOQA 3K5MA 4NXNL 4K5XA 3IFDA 1TWFH 1MJEA 5IP9H 4HSVA 3J81L 2YTVA 2E5LL 5EKLA 2L12A 4JOIA 1BO0A 1WI5A 4OL7A 1SE4A 4AIMA 3TDQA 4JI1L 2UXDQ 4C3JG 4A3EH 2L55A 4MIUA 3NQTA 4PNYA 1BXTA 2Z9HA 3MWYW 3OMCA 5EQ0A 4G7ZC 4EX5A 1PFBA 1STGA 4B3SQ 3CQZH 1HHVA 1EU3A 2F0GA 1TT2A 4QQBX 3CMEA 3S2HB 1I5FA 3PO3H 3KDFA 3TP6A 3GV6A 1GUGA 3FP9A 1IYJB 3S16H 1ONLA 5GQOA 3ERSX 2J7ZA 2HHHL 2Z4HA 2ZXOA 1FJGL 3KDFB 1T5EA 1N32Q 2I46A 4A3LH 2Z0SA 4LFBL 1RJTA 3IFTA 1PFNA 2A19A 1IBKL 4QMGA 3VR3A 1Q8KA 5IYDH 3I73A 3C46A 4LF7Q 3H09A 3F2BA 1YNNC 3ONAB 1SNMA 2QA4A 1X32A 1XNQQ 1CZWA 1EFID 1EY7A 2AQ2B 4UP9A 2B2WC 4IFDH 1V1OA 2EYFA 2P5ZX 2NTSA 2K04A 3BU2A 2F0QA 3D6CA 4DN4M 2CW0C 3EIVA 5KNBA 1HR0Q 2ZM6L 3STBD 4BY7H 2OTJA 4KK7A 2OTLA 4ILWA 4UP8A 3D4WA 3NSWA 1SR3A 2VQFL 5GAHC 2VZAA 1JWMD 4BA2I 3VR6A 4RG1A 5A2QL 1VMCA 3GTLB 1JICA 2B2VA 3M4YA 5TSSA 3U9SA 2RDFA 3G71A 1KRTA 3K5OA 4BY1B 4PMCA 3UDGA 4DXFA 4L5QA 2F0PA 2UXCQ 4JI7Q 4GS3A 4LF5Q 2IHEA 5M3MG 1SMXA 2UU9L 3M4QA 5JEAH 3S2HH 1EOVA 1XPOA 4A75A 3CU7A 2B2YC 3G48A 4P2CB 3L3OC 3QB3A 5M3FB 3TRZA 3HOWH 2RSOA 5ELNA 3CCRA 1N36L 2E2DC 4XYOA 3OOCA 1II3A 2UUAL 1OXXK 1GOZA 3PUYA 3HOUB 4BA1I 3WOFA 3QR8A 1EIGA 1K83B 3N6RA 4R1JA 4HMJA 2KUMA 1WOCA 2ATWA 1A6XA 2OT2A 2PPBC 2JJQA 1SNCA 4BXXG 1MI2A 4FDBA 2RHSB 3BVZA 2KQ3A 4A3FG 1VQ5A 4DV7Q 1LTTD 4DR7Q 1HPCA 1WD0A 5IWAQ 4CJ0B 1PHJA 1G91A 4RGTA 1P8LA 4AQYQ 2WKCA 1V9PA 5DLQE 3C3LA 3KFUA 3S17B 1AH9A 2EXZA 1Q3LA 1ET6A 3ERQA 1AEXA 4A3KB 1A3UA 1KXLA 4YHHQ 1VQ9A 4CDDC 1UNSA 4LFCQ 2XRSD 1WTXA 4BBSH 2O2LD 3GTLH 4J15A 2JA6G 1MKHA 3B6YA 2KHIA 2V4DA 5I6WA 2Q2UA 1G51A 1NUCA 4BY1H 2C35B 4JG2A 1EFWA 1C9OA 2AWNA 2RBMA 1JJGA 2A6HD 2PI2A 3AFPA 5M5YB 3KF8A 4AYBE 5AJ3L 1YNJC 2JA7H 2AMCB 5D14A 1NE3A 2R93B 4B3RL 1CK1A 4JOIC 3OYYA 4EQPA 5M3FH 1N8RC 1HFNA 1HZAA 2KECA 4X3SA 4XT3B 4LAAA 4NP5A 4A3BB 5C3EB 2OQ0A 3HOUH 2VY3A 4Y52H 1E22A 2M00A 2XTIA 1K83H 5KYIA 5I9OA 1I6HB 4JI8L 1K8OA 2UUCL 2GA4B 3MXUA 3SHLA 4A3MG 1ESRA 2K1BA 4IO9A 4IOAA 5C4XG 3LGJA 4JI0Q 4OX9L 4MNOA 5FO8B 1CFMA 1A2UA 1NMFA 3MFYA 1BBWA 3GQBA 1X3EA 1SROA 5EPLA 2D2CC 4R4OA 3RN5A 3T56B 5IP7G 1B4OA 4JW0A 4CDFC 1CQFA 2EYMA 3EVQA 4QUFA 3CCJA 1QVGA 5BN3A 4DUYQ 3S17H 2K5WA 3DWAA 1FNWA 4A3KH 3SK6A 5IYCH 2R3ZA 4LF6Q 1VMPA 2LFNA 4DR5Q 2XN9C 4GZYC 1SFOH 3OTOQ 2FFKB 1YNND 3TP5A 3SK4A 1AZQA 4LF8L 1VQ6A 1EY9A 5CORA 1SYFA 5C0XH 3VR4A 1IL2A 2DNEA 2HCIA 2K5HA 2PYKA 1QNKA 1G2SA 5M5YH 3HOVB 1UUPA 5D3DA 5K5PA 3T4AC 3NWSA 2CW0D 2R93H 2Z6BA 3TS2A 3RZOB 4RGOS 4KD4A 4UY8C 3F2DA 3QG1A 4C3IB 4X6AH 1GJXA 2WB1E 1ILQA 5C5LA 4X65L 1PZID 2JEBI 5C3EH 1W2BA 4U68A 3CPFA 1OXTA 2YV5A 1D6EC 1GVPA 3CCSA 2QW7A 4GKKQ 1I6HH 3VR5A 1SYDA 4A3GG 3L9AX 1EYCA 4NW2A 3NTKA 4QIWE 3JC66 2NVYB 3S15H 4XQQA 2Q2IA 3WDNA 2RHQB 3GP7A 2Q8TA 2L9HA 4JC0A 1U4RA 5K36H 2MHVA 2WAQB 3UE0A 1KDAA 5CMDA 3G6JB 3J7AF 3AU7A 1EYDA 1FGUA 4OWWB 3D3RA 4IOCA 1VQGA 1XYIA 1K0RA 1LT3D 3HOYB 1C48A 4OGQC 1S40A 4KD3A 4A3JG 1S5FD 4JPBW 2B3GA 1N33Q 4KV6A 3E9HA 5EBDA 1HZCA 3PF5A 3RN2A 1YVCA 4KLKA 3NXWA 4XDXA 2F0TA 4L8JA 4U673 3E0EA 1B44D 3J81j 4YCVA 1XXGA 2XVSA 1I50H 1HTLD 4DR1Q 3RZOH 3T51B 4JI2L 2HIVA 2Q8RE 4RAUC 2RSNA 4C3IH 4POFA 3FKIG 4KN7C 1RCVD 2UXDL 1MBYA 4QIWB 3HG9A 3J80E 5T1IA 1JE4A 4FF1A 5G3LD 1HZ9A 5GROA 2K33A 1J6QA 3V2TA 3CXCA 5EPKA 1QNUA 4B3SL 3S1MH 2OWOA 2B29A 1B53A 1Y14B 2B2TA 4BS9A 5EGTA 3H0GG 4C3HB 3MC0B 1UEAB 2F3IA 3F1ZA 1S5BD 2NVYH 4WJ4A 1QG7A 3DMUA 1TR5A 3HOXH 1FYCA 2YTYA 1ICWA 1YNJD 1IW7C 1J5EQ 3HRZC 1NCVA 1VQDA 3MXNA 1KD1C 4DV1Q 1N32L 5ELEA 1EYAA 4L5TA 4K2KA 1ZYRC 2RDGA 2RKSA 2KJXA 3TBIB 2IPKD 2VUMH 1CA6A 4XIGS 1LM0A 1SMYC 3H3VH 4LF7L 3BZKA 1SDFA 4FXDA 2RCNA 1TWHH 4FO2A 1K28A 4MHEA 1SE8A 3PV0A 1XNQL 2PMZE 4J8QA 4LF4L 4WJWA 1B2TA 2WIIB 2B8GA 4DPGA 4KKSA 5JJKA 1Y1WG 4HJ9A 5KNDA 4HJ5A 1NR4A 2Y0SE 2B63B 3ITPA 4ZUIA 2NN6H 4ZUJA 5CV4A 1HR0L 2N8NA 1GUSA 5C3XA 2XWJB 5JOBA 1HXYD 2F0VA 2KENA 2C5CA 3KF6A 2L5TA 3Q22A 1U0LA 4NMZA 3A8JE 3R8BA 1HRJA 2IWHA 3PSIA 2EYPA 4A3CH 4FXKC 2JSOA 3A74A 1EIHA 2K6AA 3W5OA 3OMGA 4ZAIA 5ELDA 3ZJYC 1D5XC 3W2DA 2UXCL 2VS1A 4LF5L 1A62A 3GO5A 4C3HH 3DM3A 1VCIA 5EAYA 1TY0A 5EJWA 4F87A 1QB5D 2HCCA 4G7HC 2VL6A 3J80c 3TP7A 4DV0L 4J1MA 4HCSA 2XWBB 1SRUA 3UDIA 1JT8A 3I3CA 1E24A 3PUZA 1F2ZA 2PMZB 4DK1A 2NVXB 5JAVA 4GN5A 3G6EA 2KCCA 2R7ZH 2A1AA 2Y0SB 3F2CA 3HEJA 3K5NA 1JB7A 4A3DB 2AQ1B 2D0OA 4DV7L 2QDLA 2F0MA 5KEEA 1WCMH 4DR7L 3D8GA 4DK0A 1ILPA 3HOZG 1W3SA 4DR6Q 5IWAL 1M1KC 1PVOA 4HIOA 2B63H 1U9RA 5J3BA 4AQYL 1F9RA 2NZOA 3CW2C 2L11A 2F4VQ 1F9SA 1JJCB 3J7A5 4JYAQ 4JI4Q 2K5NA 1QWYA 1XTDA 1O7IA 4DV5Q 4YHHL 4O2DA 4LFCL 3URYA 4HMIA 2YU9B 4PG3A 4FXGC 5LMUQ 3K57A 1D1IA 1XJVA 4FF2A 1ASYA 3HP3A 3HKZB 1TS2A 1PH8A 1EU4A 1KAAA 1D7QA 1GUNA 4DV6L 5C44B 1HNXQ 4JI5Q 2F3WA 2XRQD 4LUOA 5FO7B 4Q0FA 4R8IA 2LSSA 3D0FA 1PH1A 2UUBL 2F0HA 2JQOA 4GLVB 3VR2A 3TREA 3MA2B 5IOCA 1C0AA 1X3QA 1EIFA 1G6ZA 2E2IB 3I90A 2NVXH 5KRUA 5HURA 3PO3G 1ICFB 3A7AB 2RA4A 4I7ZC 4R4TA 5JJIA 3AMUA 2B2TC 3P1HA 1HJPA 4A3DH 1SYEA 4GN4B 5T1GA 1TWCB 3J81i 1EQRA 1A3TA 1GKHA 3NWTA 5KIXA 1EL0A 4A76A 2NVTB 5IT9E 1LTRD 4YWMA 3GTJH 2EZVA 3MZ5A 2E75C 3VYUA 4F88A 4DNTB
chains in the Genus database with same CATH topology
1X56A 3I4OA 4DUYL 1VQEA 4TVAB 3KF6B 1YZ6A 1H95A 4KHPL 1WOCA 1Y1VH 5HY6A 1OXVA 3EN2A 2ATWA 4DK3C 3I4NH 2JJQA 4IFDG 4LF6L 1E1OA 3M3YH 4BXXG 3GTPH 4FDBA 4DR5L 2RHSB 3E9IA 2V1CC 1KHIA 1L1OA 4A3FG 4XTCS 1A0IA 1YHAA 2NN6I 4DV7Q 1VQ5A 4JI7L 3M4OH 1X65A 4DR7Q 4BY7G 2EXDA 2R6GA 2VW9A 3FKIH 2WAQG 5IWAQ 2HHHQ 1PHJA 5C4XH 1N9WA 3HKZE 1PV4A 1FJGQ 2KHJA 5IYBG 1A8VA 2JA9A 3CF5A 3J81c 4DKAC 1VQ7A 3S2DH 2VNUD 1P8LA 2VQEQ 1HNZQ 1VQOA 4LFBQ 2OCEA 1NJIC 4AQYQ 2JA6H 2UXBL 2DUDA 5DLQE 1V9PA 1I94Q 1IBKQ 3KFUA 1EIYB 1AH9A 3I4MG 3HOYG 2I5LX 1Z9FA 2E8GA 3AQQA 1FL0A 1YHQA 2WP8J 3H0GH 5IP7H 4GNXA 3TS0A 1KXLA 4DR4L 1WFQA 4YHHQ 1VQ9A 3DLLA 4LFCQ 3BJUA 2ZJRA 4BBSH 2JK8A 3GTLH 4J15A 3J7ZC 2JA6G 1MKHA 3B6YA 2KHIA 4GNXB 2E2IH 1PH3A 3KJOA 3KOJA 2Q2UA 1T9HA 2NN6G 4PMWA 1G51A 1X54A 4BY1H 2C35B 1E3PA 4JG2A 1EFWA 1C9OA 2AWNA 2LXJA 1JJGA 3HOWG 1V43A 4QGUA 1VQCA 2PI2A 1X55A 3AFPA 5FJ8G 1YJNA 4JCVE 4A93H 1KIXA 2ZTEA 4AYBE 2VQEL 3GTQH 2H5XA 5AJ3L 2JA7H 2AMCB 1NE3A 1X6OA 2ID0A 1CKNA 2MFIA 2R92H 4B3RL 4JOIC 1VQJA 3NEMA 3OYYA 5M3FH 1N8RC 1HR0W 4L5RC 1HZAA 1CUKA 1HZBA 1IBMQ 4LW1A 4PZ6A 2NVTH 5BR8Q 4EQ5A 2EIFA 3T1YQ 3I4NG 1JMCA 1VS0A 2OQ0A 3MEFA 4IJHA 1CKNB 1VQ4A 3HOUH 2VY3A 4Y52H 1E22A 2PQAA 4ALPA 2XTIA 4DV3L 2ZJQA 1K83H 3PF4A 2QEXA 4JI8L 4POGA 1G291 2JE6I 2R7FA 1B7YB 1IBLQ 2UUCL 1RL2A 1VQBA 2AWOA 3F8TA 4A3MG 4IFDJ 3OW2A 2YTXA 4IO9A 4IOAA 4AH6A 1OTCA 2PQAB 5C4XG 1M90C 5IP9G 2CWPA 3GTGH 3LGJA 1YEZA 5LMNL 4LF8Q 4NPSA 5IT9c 4JI0Q 4OX9L 3W1GA 5JJLA 3NELA 4MNOA 3HFZB 1NMFA 4A3EG 1BBWA 1N33L 1N36Q 3NBHB 4GOPA 4B3MQ 1X3EA 4R1JA 3I55A 1SROA 3PO2H 5FLMH 3FHWA 4R4OA 2HQLA 3RN5A 4JBWA 4YY3Q 1QZGA 3CP0A 5IP7G 2MO0A 1C7YA 1CKOA 1OXSC 4X66L 3CCJA 4HIMA 1QVGA 4BBSG 4GOPB 4IJLA 2PNHA 4DUYQ 1GM5A 3S17H 1N34L 4DR3L 3D31A 4LWCA 4KHPQ 4GKJL 5M5WH 4A3KH 1Q81C 5IYCH 4OO1I 4LF6Q 2CFMA 3W1BA 1P16A 4DR5Q 1SFOH 3UE1A 3OTOQ 2CCZA 4A3DH 4MZ9A 5JEAJ 3GTKH 4A93G 4A3LG 2K4KA 4LF8L 2B63G 1VQ6A 4JI0L 4JI6Q 4IPGA 4P74A 3IRBA 2JA7G 1KRSA 2K14A 1EYGA 3A5UA 2R92G 2L15A 4A3JH 1IL2A 4APVA 4LFAQ 5IYDG 2JEAI 2K5HA 3L2PA 4A3IH 3M85A 2UXBQ 4ME3A 5M5YH 4GLAC 4NXML 1TXYA 1XMQL 1VQHA 1VQFA 2ES2A 2R93H 1JJ2A 3TS2A 3U4ZA 4DR4Q 4DUZQ 4TQUS 1EWIA 5H1SE 1S3OA 3F2DA 2PI2E 4X62Q 4UY8C 1E1TA 1J5EL 1GO3E 4X6AH 2WB1E 1PH4A 3BZCA 1PH7A 4LUVA 4X65L 3T1HL 1PFSA 2JEBI 3K8AA 4P73A 4DV1L 5C3EH 3HOZH 1YIJA 4OWXB 1W2BA 3OTOL 1IZ6A 3CPFA 2YU9H 1OXTA 5IY0A 2YV5A 4RMFA 1GVPA 3CPWA 3CCSA 1PH9A 5GAEC 4GKKQ 1I6HH 3GTMH 4YWLA 4WJ3M 4A3GG 2IX1A 5C0XI 4JI6L 1G6PA 4HIKA 2IX0A 1AE3A 4DV2L 1L1OB 2AHOB 1UE7A 1YHBA 3JAMi 1XPUA 1K3RA 4QIWE 2IY5B 4IPDA 1EUJA 4LFAL 3HKSA 3JC66 5AJ3Q 5C44H 3S15H 2Q2IA 1NY4A 2RHQB 4B3RQ 4JC0A 1PH2A 2N49A 3K0XA 4DUZL 3PUVA 4X64Q 2RF4A 1Q82C 4X62L 1CSQA 1WYDA 3UE0A 1XNRL 4DAMA 4DV3Q 2ZTDA 1VQMA 2Y0SG 3PIPA 3CCQA 1FGUA 3M7NA 4JI8Q 4OWWB 4DAYB 4A3DG 4IOCA 3M4PA 2UUCQ 5JEAG 1VQGA 2KBNA 3A5ZB 4JI2Q 2NVQH 3PGZA 4O0AA 1K0RA 3I2ZA 1XMOL 1L1OC 4GKKL 3M9BA 1Q7YC 1S40A 3U50C 5LMNQ 5C0XG 3KJPA 4A3JG 4OX9Q 3AYHB 2B3GA 3K7UC 1Q1BA 1N33Q 1TWCH 3JAMc 1TWGH 3STBC 1R9TH 3E9HA 3S24A 1HZCA 2K50A 3ULPA 3RN2A 3PF5A 3U4VA 4LNQA 1YVCA 1HNWL 4KLKA 1VQPA 4X66Q 1CKMA 3KF8B 3RZDH 1Y1VG 1NTGA 4X64L 1VQLA 1BVSA 1Q1EA 1YJWA 3E0EA 2QGQA 1Y1WH 3J81j 1N34Q 4DK6C 4YCVA 4GNXC 4DR3Q 5ELOA 2N3SA 1SLJA 4GKJQ 1K8GA 5M3MH 2JA5H 1I50H 2ZJPA 4HIDA 4JBKA 3AFQA 3GTOH 3RZOH 4DR1Q 3SGIA 2HIVA 4JI2L 4C3IH 1Q86C 2ASBA 4POFA 3FKIG 3HKZG 4JV5L 4QJFA 2UXDL 1RIPA 2R7DA 4R4QA 1LYLA 2K75A 1QUQA 1HZ9A 5GROA 5HGQA 5C44G 1J6QA 3CXCA 1VQAA 4B3SL 3S1MH 2OWOA 3S14H 2A8VA 2B29A 1Y14B 4LF4Q 1B8AA 2N78A 3H0GG 4BBRH 3CCVA 4NXMQ 4GLXA 1QUQB 5K36G 4L5SA 1XMQQ 2F3IA 3F1ZA 2NVYH 3UDFA 2GVBA 1E7ZA 4PZ8A 1EQQA 4WJ4A 3ER0A 4B3TL 1U5KA 2GVAA 1HH2P 2OQKA 3HOXH 4A3FH 1AE2A 3I7FA 4K0KL 2YTYA 4DR6L 1MJCA 1J5EQ 2JA8H 2K52A 1VQDA 4X65Q 3T1HQ 1KD1C 1NMGA 3PCOB 3CC7A 4DV1Q 4DR1L 2I5MX 4L5TA 3PIOA 1YITA 3CC2A 3UDXA 4BY1G 3WWVA 3ULJA 1LUZA 1MIUA 2WAQE 5IYBH 4OWTB 2F4VL 2KCTA 1WJJA 2VUMH 4XIGS 1CSPA 1LM0A 4IPCA 4AYBG 2XGTA 3H15A 4C3JH 4JI4L 4LF7L 3H3VH 3BZKA 1N32L 3ICEA 1Z47A 4DV2Q 3I4MH 4DV5L 2RCNA 1TWHH 5GADC 5C0XJ 2Q2HA 1UE5A 1SE8A 5M3FG 1Q46A 3PV0A 1XNQL 4H02A 2PMZE 4DR2Q 4LF4L 5LMUL 3PUWA 4DPGA 4GOPC 4JI3L 5FLXc 4LF9L 3CCEA 2IT1A 5JJKA 1L2FA 1X3GA 4R4IA 4HJ9A 1Y1WG 2Q2TA 4HJ5A 4C2MH 3HOUG 3S1NH 1XPRA 1LTLA 1VQNA 2Y0SE 2E2JH 1DGSA 2CKZB 2EQSA 4P75A 1KC8C 1ASZA 2BA1A 3Q8DA 1BBUA 2ZTCA 3J80i 1XNRQ 1HNXL 2N8NA 1HR0L 4LUZA 4A3BH 4OO1G 3L0OA 4QL5A 4JI5L 5FJ8H 2I0QA 2F52A 4DV0Q 2KENA 3KF6A 1XMOQ 3H3VI 1U0LA 4YCWA 1I3QH 1UEBA 2HIXA 1L0WA 1S72A 3K7AH 3PSIA 3PO2G 1YNXA 4IPHA 5FLMG 3RLNA 4A3CH 2MQHA 2ALYB 4BBRG 3EBEA 3A74A 4DR2L 3VDYA 4DV4L 5LMNW 4QY7A 2MNAA 2D0PA 3W5OA 1HNWQ 3S1QH 1VQIA 3ZJYC 3HOXG 2CQOA 1YBYA 2UXCL 2VS1A 4LF5L 4A3KG 2JA8G 1UE6A 1A62A 2D62A 2FXQA 3GO5A 4C3HH 5IYCG 3DM3A 4Y7NH 1VCIA 4A3MH 2HT1A 5EAYA 4NXNL 4OONA 2Z6KA 3RR5A 1TWFH 1MJEA 1KL9A 5IP9H 3NENA 2YTVA 2VL6A 3J80c 2E5LL 1B70B 2VUMG 4JOIA 1PYSB 1WI5A 1X9NA 4AIMA 4DV0L 4JI1L 4HJ8A 4JV5Q 2UXDQ 1SRUA 3UDIA 4A3EH 3KYHC 1JT8A 1E24A 3PUZA 1V1QA 5E7NA 4GN5A 5IE8A 4A3IG 3CCLA 2WFWA 4EX5A 3G6EA 3TEHB 2R7ZH 4B3SQ 2A1AA 3CQZH 3CCUA 3F2CA 2R93G 1JB7A 4QQBX 3CMEA 3K80C 1I5FA 3G4SA 3PO3H 3KDFA 1OXUA 4JBMA 2D0OA 2E2HH 4DV7L 2WB1G 4A4IA 1WCMH 3FP9A 4B3TQ 1IYJB 3HOVH 1GD7A 3S16H 4DR7L 4A3BG 2CWAA 3ERSX 5GQOA 5C3EG 3HOZG 1W3SA 4K0KQ 4DR6Q 5IWAL 4P71A 1M1KC 4DV6Q 2HHHL 2MO1A 1PVOA 1FJGL 2ZM6Q 1JE5A 3KDFB 1UWVA 4HIOA 2K5VA 3GDEA 3S1RH 3CC4A 2B63H 4A3LH 1N32Q 2Z6KC 5M5XH 1HNZL 2Z0SA 5J3BA 4LFBL 2VQFQ 4AQYL 2NZOA 3CW2C 1D8LA 2A19A 1I94L 1IBKL 2F4VQ 1Q8KA 1JJCB 1Q12A 5IYDH 3J7A5 2UUBQ 4JYAQ 4JI4Q 4A3CG 4LF7Q 2K5NA 3F2BA 1XTDA 2LXKA 1O7IA 3ULLA 2QA4A 4GN3B 3I56A 4DV5Q 3AEVA 4YHHL 4O2DA 3CCMA 4LFCL 1PYBA 4YCUA 1XNQQ 4PG3A 5LMUQ 4LF9Q 4JI3Q 4UP9A 1XJVA 1SN8A 1UE1A 4DNIA 1ASYA 1PH6A 3RLFA 3PUXA 4BXXH 3L7ZC 1IXRA 1TWAH 1PH8A 2YYZA 2UU9Q 3BU2A 1VQ8A 1D7QA 3CAMA 3RLOA 3EIVA 4DV6L 3RNUA 1HNXQ 1HR0Q 2ZM6L 3STBD 1VQKA 4BY7H 2OTLA 2OTJA 4UP8A 4MTNA 5GAGC 4A3GH 4JI5Q 4P72A 2KCMA 1SR3A 2VQFL 5GAHC 4LUOA 2LSSA 2VZAA 4YWKA 3D0FA 2UUAQ 1FVIA 4BA2I 1KQSA 1PH1A 2UUBL 4JYAL 2JQOA 3MXNB 1IBML 4RG1A 4GLVB 2R7ZG 2AKWB 5BR8L 1A63A 3U58A 2BH8A 1QVCA 3HOYH 3TREA 3T1YL 1C0AA 1X3FA 5C4JH 1KAWA 1EIFA 3TQYA 2NVXH 2DGYA 3G71A 4OXPA 4DV4Q 3CD6A 3PO3G 1KRTA 4R4CA 4IFDI 4R4TA 5JJIA 1YI2A 3UDGA 1PH5A 1WCMG 4L5QA 1IBLL 3HOVG 4KHZA 4UPAA 4HJAA 2UXCQ 1HJPA 3K81C 4GS3A 4JI7Q 4LF5Q 2IHEA 3KLWA 1SMXA 3GD7A 4UP7A 4KI0A 3M4QA 5M3MG 4PZ7A 2JA5G 2UU9L 4GN4B 2BH2A 1EOVA 1XPOA 3CMAA 4A75A 1QVFA 3J81i 3S2HH 3G48A 2GN5A 2I5HA 4NXNQ 1EQRA 1K9MC 1GKHA 1NBWA 1QZHA 4JBJA 1PA6A 3HOWH 3TRZA 5ELNA 3CCRA 1N36L 2E5LQ 4A76A 1YJ9A 4B3ML 4HJ7A 4JI1Q 2UUAL 4YY3L 1OXXK 4YWMA 3PUYA 1BKBA 3GTJH 1K73C 1K8AC 4BA1I 3A0JA 2IHFA 2NZHA 2BA0A 4NB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X56 A;  3I4O A;  4DUY L;  1VQE A;  4TVA B;  3KF6 B;  1YZ6 A;  1H95 A;  4KHP L;  1WOC A;  1Y1V H;  5HY6 A;  1OXV A;  3EN2 A;  2ATW A;  4DK3 C;  3I4N H;  2JJQ A;  4IFD G;  4LF6 L;  1E1O A;  3M3Y H;  4BXX G;  3GTP H;  4FDB A;  4DR5 L;  2RHS B;  3E9I A;  2V1C C;  1KHI A;  1L1O A;  4A3F G;  4XTC S;  1A0I A;  1YHA A;  2NN6 I;  4DV7 Q;  1VQ5 A;  4JI7 L;  3M4O H;  1X65 A;  4DR7 Q;  4BY7 G;  2EXD A;  2R6G A;  2VW9 A;  3FKI H;  2WAQ G;  5IWA Q;  2HHH Q;  1PHJ A;  5C4X H;  1N9W A;  3HKZ E;  1PV4 A;  1FJG Q;  2KHJ A;  5IYB G;  1A8V A;  2JA9 A;  3CF5 A;  3J81 c;  4DKA C;  1VQ7 A;  3S2D H;  2VNU D;  1P8L A;  2VQE Q;  1HNZ Q;  1VQO A;  4LFB Q;  2OCE A;  1NJI C;  4AQY Q;  2JA6 H;  2UXB L;  2DUD A;  5DLQ E;  1V9P A;  1I94 Q;  1IBK Q;  3KFU A;  1EIY B;  1AH9 A;  3I4M G;  3HOY G;  2I5L X;  1Z9F A;  2E8G A;  3AQQ A;  1FL0 A;  1YHQ A;  2WP8 J;  3H0G H;  5IP7 H;  4GNX A;  3TS0 A;  1KXL A;  4DR4 L;  1WFQ A;  4YHH Q;  1VQ9 A;  3DLL A;  4LFC Q;  3BJU A;  2ZJR A;  4BBS H;  2JK8 A;  3GTL H;  4J15 A;  3J7Z C;  2JA6 G;  1MKH A;  3B6Y A;  2KHI A;  4GNX B;  2E2I H;  1PH3 A;  3KJO A;  3KOJ A;  2Q2U A;  1T9H A;  2NN6 G;  4PMW A;  1G51 A;  1X54 A;  4BY1 H;  2C35 B;  1E3P A;  4JG2 A;  1EFW A;  1C9O A;  2AWN A;  2LXJ A;  1JJG A;  3HOW G;  1V43 A;  4QGU A;  1VQC A;  2PI2 A;  1X55 A;  3AFP A;  5FJ8 G;  1YJN A;  4JCV E;  4A93 H;  1KIX A;  2ZTE A;  4AYB E;  2VQE L;  3GTQ H;  2H5X A;  5AJ3 L;  2JA7 H;  2AMC B;  1NE3 A;  1X6O A;  2ID0 A;  1CKN A;  2MFI A;  2R92 H;  4B3R L;  4JOI C;  1VQJ A;  3NEM A;  3OYY A;  5M3F H;  1N8R C;  1HR0 W;  4L5R C;  1HZA A;  1CUK A;  1HZB A;  1IBM Q;  4LW1 A;  4PZ6 A;  2NVT H;  5BR8 Q;  4EQ5 A;  2EIF A;  3T1Y Q;  3I4N G;  1JMC A;  1VS0 A;  2OQ0 A;  3MEF A;  4IJH A;  1CKN B;  1VQ4 A;  3HOU H;  2VY3 A;  4Y52 H;  1E22 A;  2PQA A;  4ALP A;  2XTI A;  4DV3 L;  2ZJQ A;  1K83 H;  3PF4 A;  2QEX A;  4JI8 L;  4POG A;  1G29 1;  2JE6 I;  2R7F A;  1B7Y B;  1IBL Q;  2UUC L;  1RL2 A;  1VQB A;  2AWO A;  3F8T A;  4A3M G;  4IFD J;  3OW2 A;  2YTX A;  4IO9 A;  4IOA A;  4AH6 A;  1OTC A;  2PQA B;  5C4X G;  1M90 C;  5IP9 G;  2CWP A;  3GTG H;  3LGJ A;  1YEZ A;  5LMN L;  4LF8 Q;  4NPS A;  5IT9 c;  4JI0 Q;  4OX9 L;  3W1G A;  5JJL A;  3NEL A;  4MNO A;  3HFZ B;  1NMF A;  4A3E G;  1BBW A;  1N33 L;  1N36 Q;  3NBH B;  4GOP A;  4B3M Q;  1X3E A;  4R1J A;  3I55 A;  1SRO A;  3PO2 H;  5FLM H;  3FHW A;  4R4O A;  2HQL A;  3RN5 A;  4JBW A;  4YY3 Q;  1QZG A;  3CP0 A;  5IP7 G;  2MO0 A;  1C7Y A;  1CKO A;  1OXS C;  4X66 L;  3CCJ A;  4HIM A;  1QVG A;  4BBS G;  4GOP B;  4IJL A;  2PNH A;  4DUY Q;  1GM5 A;  3S17 H;  1N34 L;  4DR3 L;  3D31 A;  4LWC A;  4KHP Q;  4GKJ L;  5M5W H;  4A3K H;  1Q81 C;  5IYC H;  4OO1 I;  4LF6 Q;  2CFM A;  3W1B A;  1P16 A;  4DR5 Q;  1SFO H;  3UE1 A;  3OTO Q;  2CCZ A;  4A3D H;  4MZ9 A;  5JEA J;  3GTK H;  4A93 G;  4A3L G;  2K4K A;  4LF8 L;  2B63 G;  1VQ6 A;  4JI0 L;  4JI6 Q;  4IPG A;  4P74 A;  3IRB A;  2JA7 G;  1KRS A;  2K14 A;  1EYG A;  3A5U A;  2R92 G;  2L15 A;  4A3J H;  1IL2 A;  4APV A;  4LFA Q;  5IYD G;  2JEA I;  2K5H A;  3L2P A;  4A3I H;  3M85 A;  2UXB Q;  4ME3 A;  5M5Y H;  4GLA C;  4NXM L;  1TXY A;  1XMQ L;  1VQH A;  1VQF A;  2ES2 A;  2R93 H;  1JJ2 A;  3TS2 A;  3U4Z A;  4DR4 Q;  4DUZ Q;  4TQU S;  1EWI A;  5H1S E;  1S3O A;  3F2D A;  2PI2 E;  4X62 Q;  4UY8 C;  1E1T A;  1J5E L;  1GO3 E;  4X6A H;  2WB1 E;  1PH4 A;  3BZC A;  1PH7 A;  4LUV A;  4X65 L;  3T1H L;  1PFS A;  2JEB I;  3K8A A;  4P73 A;  4DV1 L;  5C3E H;  3HOZ H;  1YIJ A;  4OWX B;  1W2B A;  3OTO L;  1IZ6 A;  3CPF A;  2YU9 H;  1OXT A;  5IY0 A;  2YV5 A;  4RMF A;  1GVP A;  3CPW A;  3CCS A;  1PH9 A;  5GAE C;  4GKK Q;  1I6H H;  3GTM H;  4YWL A;  4WJ3 M;  4A3G G;  2IX1 A;  5C0X I;  4JI6 L;  1G6P A;  4HIK A;  2IX0 A;  1AE3 A;  4DV2 L;  1L1O B;  2AHO B;  1UE7 A;  1YHB A;  3JAM i;  1XPU A;  1K3R A;  4QIW E;  2IY5 B;  4IPD A;  1EUJ A;  4LFA L;  3HKS A;  3JC6 6;  5AJ3 Q;  5C44 H;  3S15 H;  2Q2I A;  1NY4 A;  2RHQ B;  4B3R Q;  4JC0 A;  1PH2 A;  2N49 A;  3K0X A;  4DUZ L;  3PUV A;  4X64 Q;  2RF4 A;  1Q82 C;  4X62 L;  1CSQ A;  1WYD A;  3UE0 A;  1XNR L;  4DAM A;  4DV3 Q;  2ZTD A;  1VQM A;  2Y0S G;  3PIP A;  3CCQ A;  1FGU A;  3M7N A;  4JI8 Q;  4OWW B;  4DAY B;  4A3D G;  4IOC A;  3M4P A;  2UUC Q;  5JEA G;  1VQG A;  2KBN A;  3A5Z B;  4JI2 Q;  2NVQ H;  3PGZ A;  4O0A A;  1K0R A;  3I2Z A;  1XMO L;  1L1O C;  4GKK L;  3M9B A;  1Q7Y C;  1S40 A;  3U50 C;  5LMN Q;  5C0X G;  3KJP A;  4A3J G;  4OX9 Q;  3AYH B;  2B3G A;  3K7U C;  1Q1B A;  1N33 Q;  1TWC H;  3JAM c;  1TWG H;  3STB C;  1R9T H;  3E9H A;  3S24 A;  1HZC A;  2K50 A;  3ULP A;  3RN2 A;  3PF5 A;  3U4V A;  4LNQ A;  1YVC A;  1HNW L;  4KLK A;  1VQP A;  4X66 Q;  1CKM A;  3KF8 B;  3RZD H;  1Y1V G;  1NTG A;  4X64 L;  1VQL A;  1BVS A;  1Q1E A;  1YJW A;  3E0E A;  2QGQ A;  1Y1W H;  3J81 j;  1N34 Q;  4DK6 C;  4YCV A;  4GNX C;  4DR3 Q;  5ELO A;  2N3S A;  1SLJ A;  4GKJ Q;  1K8G A;  5M3M H;  2JA5 H;  1I50 H;  2ZJP A;  4HID A;  4JBK A;  3AFQ A;  3GTO H;  3RZO H;  4DR1 Q;  3SGI A;  2HIV A;  4JI2 L;  4C3I H;  1Q86 C;  2ASB A;  4POF A;  3FKI G;  3HKZ G;  4JV5 L;  4QJF A;  2UXD L;  1RIP A;  2R7D A;  4R4Q A;  1LYL A;  2K75 A;  1QUQ A;  1HZ9 A;  5GRO A;  5HGQ A;  5C44 G;  1J6Q A;  3CXC A;  1VQA A;  4B3S L;  3S1M H;  2OWO A;  3S14 H;  2A8V A;  2B29 A;  1Y14 B;  4LF4 Q;  1B8A A;  2N78 A;  3H0G G;  4BBR H;  3CCV A;  4NXM Q;  4GLX A;  1QUQ B;  5K36 G;  4L5S A;  1XMQ Q;  2F3I A;  3F1Z A;  2NVY H;  3UDF A;  2GVB A;  1E7Z A;  4PZ8 A;  1EQQ A;  4WJ4 A;  3ER0 A;  4B3T L;  1U5K A;  2GVA A;  1HH2 P;  2OQK A;  3HOX H;  4A3F H;  1AE2 A;  3I7F A;  4K0K L;  2YTY A;  4DR6 L;  1MJC A;  1J5E Q;  2JA8 H;  2K52 A;  1VQD A;  4X65 Q;  3T1H Q;  1KD1 C;  1NMG A;  3PCO B;  3CC7 A;  4DV1 Q;  4DR1 L;  2I5M X;  4L5T A;  3PIO A;  1YIT A;  3CC2 A;  3UDX A;  4BY1 G;  3WWV A;  3ULJ A;  1LUZ A;  1MIU A;  2WAQ E;  5IYB H;  4OWT B;  2F4V L;  2KCT A;  1WJJ A;  2VUM H;  4XIG S;  1CSP A;  1LM0 A;  4IPC A;  4AYB G;  2XGT A;  3H15 A;  4C3J H;  4JI4 L;  4LF7 L;  3H3V H;  3BZK A;  1N32 L;  3ICE A;  1Z47 A;  4DV2 Q;  3I4M H;  4DV5 L;  2RCN A;  1TWH H;  5GAD C;  5C0X J;  2Q2H A;  1UE5 A;  1SE8 A;  5M3F G;  1Q46 A;  3PV0 A;  1XNQ L;  4H02 A;  2PMZ E;  4DR2 Q;  4LF4 L;  5LMU L;  3PUW A;  4DPG A;  4GOP C;  4JI3 L;  5FLX c;  4LF9 L;  3CCE A;  2IT1 A;  5JJK A;  1L2F A;  1X3G A;  4R4I A;  4HJ9 A;  1Y1W G;  2Q2T A;  4HJ5 A;  4C2M H;  3HOU G;  3S1N H;  1XPR A;  1LTL A;  1VQN A;  2Y0S E;  2E2J H;  1DGS A;  2CKZ B;  2EQS A;  4P75 A;  1KC8 C;  1ASZ A;  2BA1 A;  3Q8D A;  1BBU A;  2ZTC A;  3J80 i;  1XNR Q;  1HNX L;  2N8N A;  1HR0 L;  4LUZ A;  4A3B H;  4OO1 G;  3L0O A;  4QL5 A;  4JI5 L;  5FJ8 H;  2I0Q A;  2F52 A;  4DV0 Q;  2KEN A;  3KF6 A;  1XMO Q;  3H3V I;  1U0L A;  4YCW A;  1I3Q H;  1UEB A;  2HIX A;  1L0W A;  1S72 A;  3K7A H;  3PSI A;  3PO2 G;  1YNX A;  4IPH A;  5FLM G;  3RLN A;  4A3C H;  2MQH A;  2ALY B;  4BBR G;  3EBE A;  3A74 A;  4DR2 L;  3VDY A;  4DV4 L;  5LMN W;  4QY7 A;  2MNA A;  2D0P A;  3W5O A;  1HNW Q;  3S1Q H;  1VQI A;  3ZJY C;  3HOX G;  2CQO A;  1YBY A;  2UXC L;  2VS1 A;  4LF5 L;  4A3K G;  2JA8 G;  1UE6 A;  1A62 A;  2D62 A;  2FXQ A;  3GO5 A;  4C3H H;  5IYC G;  3DM3 A;  4Y7N H;  1VCI A;  4A3M H;  2HT1 A;  5EAY A;  4NXN L;  4OON A;  2Z6K A;  3RR5 A;  1TWF H;  1MJE A;  1KL9 A;  5IP9 H;  3NEN A;  2YTV A;  2VL6 A;  3J80 c;  2E5L L;  1B70 B;  2VUM G;  4JOI A;  1PYS B;  1WI5 A;  1X9N A;  4AIM A;  4DV0 L;  4JI1 L;  4HJ8 A;  4JV5 Q;  2UXD Q;  1SRU A;  3UDI A;  4A3E H;  3KYH C;  1JT8 A;  1E24 A;  3PUZ A;  1V1Q A;  5E7N A;  4GN5 A;  5IE8 A;  4A3I G;  3CCL A;  2WFW A;  4EX5 A;  3G6E A;  3TEH B;  2R7Z H;  4B3S Q;  2A1A A;  3CQZ H;  3CCU A;  3F2C A;  2R93 G;  1JB7 A;  4QQB X;  3CME A;  3K80 C;  1I5F A;  3G4S A;  3PO3 H;  3KDF A;  1OXU A;  4JBM A;  2D0O A;  2E2H H;  4DV7 L;  2WB1 G;  4A4I A;  1WCM H;  3FP9 A;  4B3T Q;  1IYJ B;  3HOV H;  1GD7 A;  3S16 H;  4DR7 L;  4A3B G;  2CWA A;  3ERS X;  5GQO A;  5C3E G;  3HOZ G;  1W3S A;  4K0K Q;  4DR6 Q;  5IWA L;  4P71 A;  1M1K C;  4DV6 Q;  2HHH L;  2MO1 A;  1PVO A;  1FJG L;  2ZM6 Q;  1JE5 A;  3KDF B;  1UWV A;  4HIO A;  2K5V A;  3GDE A;  3S1R H;  3CC4 A;  2B63 H;  4A3L H;  1N32 Q;  2Z6K C;  5M5X H;  1HNZ L;  2Z0S A;  5J3B A;  4LFB L;  2VQF Q;  4AQY L;  2NZO A;  3CW2 C;  1D8L A;  2A19 A;  1I94 L;  1IBK L;  2F4V Q;  1Q8K A;  1JJC B;  1Q12 A;  5IYD H;  3J7A 5;  2UUB Q;  4JYA Q;  4JI4 Q;  4A3C G;  4LF7 Q;  2K5N A;  3F2B A;  1XTD A;  2LXK A;  1O7I A;  3ULL A;  2QA4 A;  4GN3 B;  3I56 A;  4DV5 Q;  3AEV A;  4YHH L;  4O2D A;  3CCM A;  4LFC L;  1PYB A;  4YCU A;  1XNQ Q;  4PG3 A;  5LMU Q;  4LF9 Q;  4JI3 Q;  4UP9 A;  1XJV A;  1SN8 A;  1UE1 A;  4DNI A;  1ASY A;  1PH6 A;  3RLF A;  3PUX A;  4BXX H;  3L7Z C;  1IXR A;  1TWA H;  1PH8 A;  2YYZ A;  2UU9 Q;  3BU2 A;  1VQ8 A;  1D7Q A;  3CAM A;  3RLO A;  3EIV A;  4DV6 L;  3RNU A;  1HNX Q;  1HR0 Q;  2ZM6 L;  3STB D;  1VQK A;  4BY7 H;  2OTL A;  2OTJ A;  4UP8 A;  4MTN A;  5GAG C;  4A3G H;  4JI5 Q;  4P72 A;  2KCM A;  1SR3 A;  2VQF L;  5GAH C;  4LUO A;  2LSS A;  2VZA A;  4YWK A;  3D0F A;  2UUA Q;  1FVI A;  4BA2 I;  1KQS A;  1PH1 A;  2UUB L;  4JYA L;  2JQO A;  3MXN B;  1IBM L;  4RG1 A;  4GLV B;  2R7Z G;  2AKW B;  5BR8 L;  1A63 A;  3U58 A;  2BH8 A;  1QVC A;  3HOY H;  3TRE A;  3T1Y L;  1C0A A;  1X3F A;  5C4J H;  1KAW A;  1EIF A;  3TQY A;  2NVX H;  2DGY A;  3G71 A;  4OXP A;  4DV4 Q;  3CD6 A;  3PO3 G;  1KRT A;  4R4C A;  4IFD I;  4R4T A;  5JJI A;  1YI2 A;  3UDG A;  1PH5 A;  1WCM G;  4L5Q A;  1IBL L;  3HOV G;  4KHZ A;  4UPA A;  4HJA A;  2UXC Q;  1HJP A;  3K81 C;  4GS3 A;  4JI7 Q;  4LF5 Q;  2IHE A;  3KLW A;  1SMX A;  3GD7 A;  4UP7 A;  4KI0 A;  3M4Q A;  5M3M G;  4PZ7 A;  2JA5 G;  2UU9 L;  4GN4 B;  2BH2 A;  1EOV A;  1XPO A;  3CMA A;  4A75 A;  1QVF A;  3J81 i;  3S2H H;  3G48 A;  2GN5 A;  2I5H A;  4NXN Q;  1EQR A;  1K9M C;  1GKH A;  1NBW A;  1QZH A;  4JBJ A;  1PA6 A;  3HOW H;  3TRZ A;  5ELN A;  3CCR A;  1N36 L;  2E5L Q;  4A76 A;  1YJ9 A;  4B3M L;  4HJ7 A;  4JI1 Q;  2UUA L;  4YY3 L;  1OXX K;  4YWM A;  3PUY A;  1BKB A;  3GTJ H;  1K73 C;  1K8A C;  4BA1 I;  3A0J A;  2IHF A;  2NZH A;  2BA0 A;  4NB3 A; 
#chains in the Genus database with same CATH topology
 1X56 A;  2NTT A;  4DUY L;  1VQE A;  2K32 A;  1DCZ A;  5CBA E;  1ZYR D;  3I4N H;  4IFD G;  4LF6 L;  2AQ3 B;  2BOS A;  4DR5 L;  1KHI A;  1L1O A;  1SMY D;  4XTC S;  2NN6 I;  1X65 A;  3A54 A;  4BY7 G;  3PO2 B;  1N9W A;  2KHJ A;  1A8V A;  2JA9 A;  4BBR B;  4DKA C;  1JCK B;  3KK7 A;  2VNU D;  1ET9 A;  2F0F A;  1NJI C;  4LK1 C;  2I5L X;  3AQQ A;  1BCP F;  2WP8 J;  4MN3 A;  4XT1 B;  2JA8 B;  2HD3 A;  1WTH A;  4GNX A;  3OIQ A;  3VYR A;  1Y8O B;  2NUC A;  4CDE C;  2JK8 A;  1B1Z A;  3GTK B;  1STE A;  4GNX B;  2E2I H;  3BDL A;  1T9H A;  4C3J B;  2FJ2 A;  1BCP B;  2LXJ A;  2NYZ D;  3HOW G;  4QGU A;  1X55 A;  5FJ8 G;  1F77 A;  4A93 H;  1EY6 A;  2DJF C;  2VQE L;  1ENA A;  1F2Y A;  1TS3 A;  1PLF A;  3S1N B;  1X6O A;  2ID0 A;  2G9H D;  1CKN A;  2R92 H;  3NEM A;  4IQZ A;  1CUK A;  1E2W A;  1HZB A;  1IBM Q;  4PZ6 A;  2G9D A;  2NVT H;  4E6I A;  5BR8 Q;  1RKN A;  1E2Z A;  3MEF A;  1CKN B;  4ALP A;  1VF7 A;  4CKB A;  1IBL Q;  1RL2 A;  4IFD J;  5LL6 S;  4OO1 H;  1M90 C;  2R61 A;  3PIP 3;  1WTO A;  1YEZ A;  5IT9 c;  3NEL A;  2RQX A;  4RHS A;  1HFG A;  4R9W A;  3HFZ B;  4TSS A;  1N33 L;  2PQE A;  4B3M Q;  3I55 A;  1PFM A;  3PO2 H;  1GUT A;  3FHW A;  2BDO A;  3I91 A;  4YY3 Q;  1QZG A;  1K3B C;  1C7Y A;  4Y7N B;  3JAM E;  1D1K A;  1JWS D;  4X3K A;  1WTV A;  4BBS G;  4IJL A;  1GM5 A;  5ELB A;  3D31 A;  4KHP Q;  1ENC A;  3ND9 A;  2MJ8 A;  2OXP A;  1Q81 C;  3W1B A;  3LX0 A;  3Q23 A;  1BQQ T;  2B39 A;  2IJ0 A;  2G5D A;  5JEA J;  3GTK H;  4DF7 A;  2N88 A;  4JI6 Q;  4IPG A;  4P74 A;  2JA7 G;  4DFA A;  2X69 A;  5ISR A;  2DJG C;  4LFA Q;  2JEA I;  3OIP A;  3M85 A;  2UXB Q;  1STY A;  3C1E A;  4ZRZ A;  4GLA C;  1LV9 A;  2PCF B;  1TXY A;  1VQF A;  1LAB A;  5M3M B;  1CI3 M;  4N9P A;  3GTO B;  4DR4 Q;  1EWI A;  5H1S E;  3J7Y W;  2PI2 E;  4X62 Q;  1J5E L;  2KHS A;  1X3P A;  3BZC A;  1PH4 A;  3K8A A;  1M4V A;  4DV1 L;  3NTI A;  4XXE A;  1IZ6 A;  3KBG A;  1PH9 A;  5GAE C;  4K14 A;  1G6P A;  4PQX A;  3OPO A;  2EJM A;  1YHB A;  2CVR A;  1K3R A;  2IY5 B;  4IPD A;  3HKS A;  2AUJ D;  5AFW A;  1I4R A;  5D3I B;  4A3F B;  1K8M A;  2EY2 A;  3KLR A;  2N49 A;  4DAY A;  3K0X A;  4HN7 A;  3PUV A;  5FLX E;  4DUZ L;  2RF4 A;  1WYD A;  4DV3 Q;  2F0U A;  2ZTD A;  3PIP A;  3CCQ A;  2FIN B;  4DAY B;  3J80 L;  4QF4 A;  2EOT A;  2KBN A;  3A5Z B;  3QOL A;  1L1O C;  3M9B A;  5LMN Q;  5C0X G;  3KJP A;  5J39 A;  1Q1B A;  2CH4 A;  3JAM c;  1PYW D;  2JA6 B;  4CGY B;  3U4V A;  5IGC A;  1SXT A;  1LO5 D;  3RMH A;  4X66 Q;  3KF8 B;  1Y1V G;  4H13 C;  4X64 L;  1VQL A;  1BVS A;  5LHY 1;  1YJW A;  2QGQ A;  1N34 Q;  4DR3 Q;  4GNX C;  1XTC D;  5ELO A;  2A5H A;  2N3S A;  4GKJ Q;  1D5M C;  5M3M H;  1K8G A;  1STA A;  3AFQ A;  3GTO H;  2BE5 C;  1BCP C;  3MXP A;  1LT4 D;  2ASB A;  1V1P A;  4QJF A;  3KLS X;  1EY8 A;  2N55 A;  4F7X A;  3FDT A;  1LYL A;  5HGQ A;  2F0I A;  1FNU A;  3NE5 B;  1V1P B;  1ZXT A;  2LMC B;  2Z4I A;  2A8V A;  1B8A A;  5K36 G;  4A3M B;  4L5S A;  4WRD A;  1XMQ Q;  2GVB A;  1E7Z A;  4RA8 A;  1EQQ A;  5C4X B;  5JPN C;  1JB3 A;  1U5K A;  2GVA A;  5F2D A;  2OF1 A;  4A3F H;  4V0B A;  4DR6 L;  1MJC A;  3A7L A;  2K52 A;  5L37 A;  1S4Z A;  2IL8 A;  3T1H Q;  1NMG A;  4OO1 I;  3UDX A;  1O78 A;  3ULJ A;  1LUZ A;  2WAQ E;  1MHW C;  2F4V L;  1WJJ A;  5IGE A;  4K2L A;  4AYB G;  4JI4 L;  3H15 A;  1LTG D;  4EVO A;  4DV5 L;  5IGD A;  5HGT A;  4KTA A;  5C0X J;  4ZQ3 A;  2M9V A;  4H02 A;  2E2H B;  1SNO A;  5LMU L;  3PUW A;  2Z8L A;  2F0L A;  5FLX c;  1JQY D;  2IT1 A;  1X3G A;  4FVM A;  3FMC A;  4R4I A;  2Q2T A;  5FKA C;  1VQN A;  3S1R B;  1DGS A;  1H9S A;  2ICE C;  2QEJ C;  1KC8 C;  1ASZ A;  2BA1 A;  1STH A;  2A6E C;  2ZTC A;  3F2U A;  1SYG A;  1XNR Q;  1HNX L;  1TS5 A;  4CBV A;  4A3B H;  5NUC A;  1JOO A;  1WTQ A;  4JI5 L;  1H9S B;  2I0Q A;  3IL8 A;  2MP1 A;  2F52 A;  1CT1 D;  3D4R A;  4K5W A;  3BVG A;  1UEB A;  1S72 A;  2EYJ A;  5FLM G;  4CHT B;  2MQH A;  4NDX A;  2ALY B;  4DR2 L;  5ELF A;  1TWA B;  1SYB A;  1TQO A;  1HNW Q;  1VQI A;  3HOX G;  5IIF A;  1KDC A;  2JXM B;  2RCF A;  3EQL C;  4K8I A;  2HDL A;  1UE6 A;  2FXQ A;  2QIL A;  4A3G B;  5LL6 X;  1STB A;  2LY7 A;  1PTO F;  4A3M H;  2HT1 A;  1Q90 A;  1NSN S;  2PO4 A;  1KL9 A;  2WKD A;  3SDZ A;  2F0W A;  4KY5 A;  2VUM G;  4HJ8 A;  1MD2 D;  2MUY A;  1GHK A;  1V1Q A;  4UDU C;  5E7N A;  5JVH 3;  5IE8 A;  1EEI D;  4A3I G;  3CCL A;  2WFW A;  3TEH B;  2LKV A;  2NBF A;  3G4S A;  1SAP A;  1OXU A;  4HSP A;  2E2H H;  4RCN A;  5I6Y A;  2WB1 G;  4B3T Q;  3HOV H;  2CWA A;  4KJN A;  3IKJ A;  4A3J B;  4K0K Q;  2ZM6 Q;  3CC4 A;  1UWV A;  4IUP A;  3S1R H;  1U4L A;  2Z6K C;  2Q8I B;  3OSO A;  4QB4 A;  2VQF Q;  3HS0 C;  3DWP A;  1Q12 A;  2ZT9 C;  4A3C G;  2F4I A;  3OW7 A;  3M3Y B;  1I4G A;  3I56 A;  1J9O A;  3GTP B;  4DAV A;  1PYB A;  4YCU A;  2ICI A;  4LF9 Q;  3I8Z A;  1SN8 A;  1UE1 A;  3FKI B;  4HAE A;  1PH6 A;  3C1F A;  5I2X A;  1DOL A;  3L7Z C;  1TWA H;  2YYZ A;  4ODG A;  5DAU A;  2UU9 Q;  3QOJ A;  1O7Z A;  3RNU A;  1C4Q A;  5E4W C;  5IT9 L;  1TKW B;  3SXH A;  4WOR A;  4MTN A;  1TY2 A;  4A3G H;  2ENB A;  4P72 A;  4HED A;  3SEB A;  3H0G B;  2ZXP A;  3TSS A;  4CDC C;  2UUA Q;  1FVI A;  1KQS A;  3MXN B;  1IBM L;  2R7Z G;  2AKW B;  5BR8 L;  4RHR A;  2F0O A;  3U58 A;  2BH8 A;  1A63 A;  3HOY H;  1DOM A;  1X3F A;  2BE5 D;  1S5D D;  1BCP D;  2Z1C A;  3CKI B;  2PZW A;  2HDM A;  3SE0 A;  4OXP A;  4B9W A;  1YI2 A;  1IBL L;  1WCM G;  3DEP A;  2RDH A;  1QJO A;  1H9K A;  1V8Q A;  1GUO A;  4KHZ A;  4UPA A;  4HJA A;  1D5Z C;  3K81 C;  3KLW A;  5CV8 A;  3GD7 A;  4C56 C;  4OIJ A;  2JA5 G;  2BH2 A;  4PZ7 A;  3GTQ B;  3I70 A;  1QVF A;  5CC4 A;  2GN5 A;  1K9M C;  1NBW A;  4JBJ A;  1PA6 A;  4B3M L;  1LTA D;  4YY3 L;  1K73 C;  1BKB A;  1Y1W B;  4X3T A;  1BOS A;  3PMF A;  3A0J A;  2NZH A;  3NP8 A;  2L4N A;  4NB3 A;  3I4O A;  3KF6 B;  1DJR D;  4KHP L;  1OXV A;  3EN2 A;  3M3Y H;  3GTP H;  4C1N K;  3GTG B;  2V1C C;  4DNR B;  1A15 A;  5EKK A;  3Q0A A;  1A0I A;  1YHA A;  3BYT B;  4JI7 L;  5D65 A;  3VYT A;  3ZYY X;  2EXD A;  2R6G A;  2VW9 A;  3FKI H;  4K8J A;  3HKZ E;  1PV4 A;  5IYB G;  2TSS A;  3CF5 A;  1VQ7 A;  1LT5 D;  4NKL A;  4PV1 C;  1HNZ Q;  1VQO A;  5BN4 A;  1EWH A;  5I9P A;  2UXB L;  4N8F A;  1I94 Q;  4KMU C;  3I4M G;  2AUK A;  1AN8 A;  3QIA A;  5CV5 A;  4DXG A;  2E8G A;  5M5W B;  1FL0 A;  2A6E D;  3A56 A;  2HUG A;  3H0G H;  4ULL A;  4DR4 L;  3BJU A;  2ZJR A;  2K05 A;  3J7Z C;  2K5D A;  1SE3 A;  1WTP A;  2WIN B;  3FPP A;  3P20 A;  4A3D G;  3KJO A;  4PMW A;  1GXD C;  1BUV T;  1AP0 A;  1X54 A;  1E3P A;  3AB9 A;  3K0Y A;  1PRT F;  5CV9 A;  1V43 A;  3HZX A;  1VQC A;  2KCN A;  1EY4 A;  2B2U A;  1ENF A;  4LJZ C;  1I6V C;  2ZTE A;  3GTQ H;  2H5X A;  3JAM L;  4OEM B;  1KLG D;  2MFI A;  1PTO C;  2E2J B;  4G57 A;  1HR0 W;  4IAL A;  2EYO A;  4N8X 1;  4EQ5 A;  3T1Y Q;  3I4N G;  2NZ1 D;  1JMC A;  3HOZ B;  1EOT A;  1VQ4 A;  2PQA A;  2BDN A;  3R2I A;  4DV3 L;  2ZJQ A;  4WFN 3;  1DYQ A;  2EYH A;  1G29 1;  3UI2 A;  2AWO A;  1G8Z D;  3OW2 A;  1CA5 A;  3K7A B;  2KEE A;  4AH6 A;  1OTC A;  3NBH A;  2PQA B;  1I4Q A;  3KLS A;  5IP9 G;  3GTG H;  5KYL A;  5LMN L;  4LF8 Q;  3W1G A;  4FF3 A;  1GUW A;  5CBE E;  2KED A;  4A3E G;  3S1Q B;  5C4Z A;  3R3O A;  3NBH B;  5DM6 3;  4JBW A;  3BZD B;  1OXS C;  4X66 L;  4HIM A;  1RHP A;  1CM9 A;  2F3V A;  2JP1 A;  1TWF B;  1B9M A;  3R93 A;  2PNH A;  1N34 L;  4DR3 L;  4LWC A;  2A69 C;  5M5W H;  4GKJ L;  2CFM A;  1MSH A;  1FNV A;  4KKU A;  1P16 A;  1HCZ A;  3UE1 A;  1WTW A;  4HR7 B;  2CHB D;  4IN3 A;  1SEB D;  4A93 G;  4HCE A;  3MHB A;  4A3L G;  4DU9 A;  1BF4 A;  4JI0 L;  2F0J A;  2CQA A;  3TME A;  1O7L A;  3Q24 A;  3A5U A;  2EY5 A;  2R92 G;  4TRD A;  3PO3 B;  5C4H A;  4APV A;  5IYD G;  3RZD B;  3L2P A;  4ME3 A;  3U9O A;  5FLX L;  1AFP A;  3M7G A;  1XMQ L;  1VQH A;  3S9W A;  2ES2 A;  5C5M A;  1IW7 D;  2O5I C;  4UAI A;  3MEH A;  4TQU S;  1QOH A;  5DNF A;  3K58 A;  1GO3 E;  1PH7 A;  4LUV A;  3K5L A;  3T1H L;  4R8N A;  4P73 A;  2FMM A;  5CYU A;  3HOZ H;  4KY7 A;  3OTO L;  2YU9 H;  2IW3 A;  1IHZ A;  5IGB A;  2IX1 A;  3S14 B;  4HIK A;  1AE3 A;  2F0D A;  1L1O B;  2EY1 A;  4CJ2 C;  2LS0 1;  4ID6 A;  3WOE A;  5C44 H;  2CH4 W;  4OHJ A;  1NY4 A;  3R2T A;  4BY7 B;  3FRP B;  2J0T D;  1CSQ A;  1G2T A;  3SVM A;  1XNR L;  3A8K E;  1RTN A;  1F2L A;  5KGU A;  1VQM A;  3P7J A;  3EFX D;  5JEA G;  4JI2 Q;  5I2Y A;  3FEW X;  3OWF A;  4GKK L;  1Q7Y C;  3FVQ A;  1T5X D;  2PW7 A;  2EDG A;  1QCB D;  1TWC H;  1HUM A;  4IUU A;  3NHH A;  2K50 A;  4QCL A;  3D6W A;  1HNW L;  4B9X A;  1KLU D;  3RZD H;  1HA6 A;  4IUT A;  3HOW B;  4DK6 C;  4QUC A;  2SOB A;  4FP5 D;  1EQT A;  1SLJ A;  1B3Q A;  2ZJP A;  4HID A;  1CTM A;  4JBK A;  1I3Q B;  3BDO A;  3MFG A;  2EVB A;  1RIP A;  2E76 C;  3NUC A;  2R7D A;  4R4Q A;  1LTI D;  1QUQ A;  2VB3 X;  4KN4 C;  1QE6 A;  4XYQ A;  4ME5 A;  1R4Q B;  4MTK A;  4BWG B;  2A68 C;  2B2U C;  4CJ1 B;  1U4P A;  3S14 H;  4LF4 Q;  1PRT C;  2QF7 A;  3VYS A;  4BBR H;  3CCV A;  4NXM Q;  4GLX A;  1QUQ B;  5E4X A;  2A73 B;  3OWE B;  5KNC A;  4V19 0;  3ER0 A;  4B3T L;  2OQK A;  1RTO A;  4ABN A;  4K0K L;  2JA8 H;  3MAQ A;  2QCP X;  3PCO B;  1PTO D;  4DR1 L;  2I5M X;  1YIT A;  4BY1 G;  1MIU A;  1ZKO A;  4OIK A;  1EZ6 A;  2H4O A;  2KCT A;  2C9O A;  5C6A A;  1DM0 B;  4C3J H;  4BBS B;  1EY0 A;  1PZK D;  1FR3 A;  3ICE A;  4DV2 Q;  5GAD C;  1O7Y A;  2DY7 A;  2Q2H A;  4KHV A;  1UE5 A;  4L63 B;  5M3F G;  3BYY B;  3E5S A;  5CV7 A;  5DEH A;  5EPJ A;  4LF9 L;  1EZ8 A;  2H1E A;  2SDF A;  1IL8 A;  1L2F A;  3S1N H;  3HOU G;  1KDB A;  3I4L A;  1XPR A;  2EQS A;  2CKZ B;  4N9T A;  4P75 A;  5M5X B;  4IZ8 A;  3IAY A;  1BBU A;  2JA7 B;  3J80 i;  1M8A A;  1PMR A;  2EPB A;  5FJ8 H;  3VA5 A;  4DV0 Q;  1XMO Q;  4DA2 A;  4YIJ A;  2D5D A;  1I3Q H;  1ZEQ X;  1Y8P B;  3EA6 A;  2A69 D;  2MPM A;  4ZKB B;  1MGS A;  1SE2 A;  3BVM A;  1YNX A;  4IPH A;  5CR3 A;  3EJI A;  2SNS A;  3EBE A;  4FNF A;  4L6T B;  3VDY A;  2XSC A;  4C1N I;  2MNA A;  2F03 A;  2D0P A;  1ROD A;  4IUR A;  4IUN A;  4A3K G;  2F0K A;  1F9P A;  1MSG A;  5IYC G;  4Y7N H;  5FK9 C;  2F0S A;  1LAC A;  4OON A;  2Z6K A;  3RR5 A;  2WAC A;  3NEN A;  3NK9 A;  1H9R A;  1B70 B;  1STN A;  1X9N A;  1PYS B;  1BDO A;  4JV5 Q;  5IGG A;  5C4J B;  3KYH C;  3X3N A;  4CKC A;  4KY6 A;  4ZYS A;  4JK1 C;  3SK5 A;  4DGZ A;  1SFO B;  3CCU A;  1CQV A;  5E1F A;  2R93 G;  2EJG C;  2PZU A;  3K80 C;  1S5E D;  4JBM A;  5J1Z A;  3DHQ A;  4A4I A;  1GD7 A;  1VDZ A;  4A3B G;  5C3E G;  2FHT A;  4P71 A;  4DV6 Q;  2MO1 A;  3AEV A;  1JE5 A;  1IYV A;  2K5V A;  3GDE A;  1I4H A;  1SSO A;  2EE1 A;  2PW5 A;  4K6D A;  1I4P A;  5M5X H;  1HNZ L;  1SYC A;  1ML0 D;  1NR2 A;  1Q8I A;  2VXW A;  1D8L A;  4RCO A;  3BDC A;  1I94 L;  1U4M A;  3J81 E;  3O13 A;  2UUB Q;  1Y1V B;  1LTS D;  2LXK A;  2XIW A;  2I07 B;  3ULL A;  5CV6 A;  4GN3 B;  3CCM A;  1EQV A;  1KNE A;  1RDP D;  3M4O B;  3V05 A;  4JI3 Q;  3MXG A;  5ELC A;  4DNI A;  1H9M A;  3RLF A;  3PUX A;  4K6L A;  4BXX H;  1IXR A;  3RD4 A;  1VQ8 A;  3S2D B;  3CAM A;  3RLO A;  3S15 B;  1VQK A;  5GAG C;  2KCM A;  4G4K A;  3LWE A;  2E74 C;  2QDB A;  1LLR D;  4YWK A;  3TP8 A;  4JYA L;  2K7V A;  5C3W A;  2F0N A;  1GHJ A;  1QVC A;  3T1Y L;  1DD2 A;  4I7A A;  5C4J H;  1KAW A;  2D9U A;  1RF2 D;  1D2B A;  3TQY A;  2DGY A;  3SK8 A;  1NNX A;  4DV4 Q;  3T13 A;  5IGF A;  5JVG 3;  3CD6 A;  4IFD I;  4R4C A;  1PH5 A;  2KVM A;  3RUZ A;  3HOV G;  4IUV A;  4O1N A;  2JA6 H;  3LWU A;  4UP7 A;  2K03 A;  4KI0 A;  4AYB B;  1SNQ A;  3CMA A;  2A68 D;  2I5H A;  4NXN Q;  4C3I G;  1TU2 B;  1PRT D;  3N52 A;  1RD9 D;  4J6H A;  1QZH A;  1ESF A;  2E5L Q;  2KA7 A;  1YJ9 A;  3KUP A;  3VA7 A;  4HJ7 A;  2SEB D;  1OO9 B;  3D4D A;  4RFB A;  3OHX C;  4JI1 Q;  5CGK A;  4EQN A;  1K8A C;  1WVL A;  1Y8N B;  2IHF A;  2VB2 X;  1I50 B;  2BA0 A;  2X6G A;  4TVA B;  1YZ6 A;  1AZP A;  3E3X A;  1H95 A;  1Y1V H;  5HY6 A;  2B2V C;  5A2Q E;  4DK3 C;  1E1O A;  5FOB B;  3E9I A;  1C8C A;  3M4O H;  2WV6 D;  1PXU A;  2MGS A;  2NB0 A;  3S1M B;  2WAQ G;  2HHH Q;  5C4X H;  1FJG Q;  4IUQ A;  3J81 c;  3S2D H;  2VQE Q;  4LFB Q;  4KKT A;  2OCE A;  4RGM A;  2DUD A;  3MTS A;  1WTR A;  1IBK Q;  1EIY B;  1XWE A;  3HOX B;  3HOY G;  4H0L C;  1Z9F A;  1WD1 A;  1YHQ A;  1DZ1 A;  2JN4 A;  3QWN A;  5IP7 H;  1PTO B;  4XQJ A;  3TS0 A;  1WFQ A;  1F2M A;  3DLL A;  3P75 A;  1TS4 A;  2XNA C;  3GV3 A;  2M2L A;  2VUM B;  4RKB A;  1PH3 A;  3KOJ A;  2NN6 G;  1W6K A;  4M1U B;  1TWH B;  1BNZ A;  3FPU B;  4A3I B;  1YJN A;  4JCV E;  3PQI A;  1KIX A;  3LNN A;  3E6Z X;  1BBX C;  1LT6 D;  1DXM A;  3HGB A;  2IX3 A;  1VQJ A;  3DUZ A;  1HQR D;  4L5R C;  4LW1 A;  2WB1 B;  1PDQ A;  2B8F A;  3H91 A;  2EIF A;  1VS0 A;  4IJH A;  1DOK A;  3PF4 A;  2QEX A;  4POG A;  3GTM B;  2JE6 I;  2R7F A;  1B7Y B;  4X3U A;  4C3H G;  1VQB A;  3F8T A;  2JYO A;  2DY8 A;  2YTX A;  4FYD A;  4ZKC B;  3A55 A;  2SNM A;  2CWP A;  3J7A V;  1W6J A;  2K28 A;  5EBC A;  4NPS A;  3CHB D;  5JJL A;  4EGV A;  4TKO B;  4XQN A;  3Q6S A;  1N36 Q;  1DON A;  4GOP A;  1HQM C;  5JJZ A;  4S3S A;  5FLM H;  1CHQ D;  4H44 C;  2HQL A;  2O5J C;  2EYL A;  3CP0 A;  1EY5 A;  2MO0 A;  1CKO A;  1XX8 A;  1IYU A;  4GOP B;  5BN5 A;  2NVQ B;  1L0X B;  2NWG A;  3QJY A;  1PTO H;  2OEO A;  4OEL B;  3T53 B;  4EQO A;  2PZT A;  2CCZ A;  4PMB A;  1H9J A;  1LTB D;  4MZ9 A;  3BS1 A;  3K6O A;  2R7Z B;  2K4K A;  2B63 G;  2PNR C;  1TWG B;  1R9T B;  3DEO A;  3IRB A;  4UHV A;  5FO9 B;  4O42 A;  1KRS A;  2K14 A;  1EYG A;  2L15 A;  4A3J H;  1AW7 A;  4Q5V A;  4CKE A;  2QKI C;  4A3I H;  2ZXR A;  1WCM B;  1B50 A;  4NXM L;  1O80 A;  2EJF C;  4RKL A;  4I65 A;  1A2T A;  1Z7T A;  2EY6 A;  2F0E A;  1QIL A;  1Y69 U;  1JJ2 A;  2JA5 B;  3U4Z A;  4DUZ Q;  2J4X A;  4H7B A;  1S3O A;  1EWC A;  1E1T A;  5M9O A;  1PZJ D;  3E0J A;  3X3M A;  1PFS A;  1YIJ A;  4OWX B;  1L0Y B;  1CHP D;  1B3A A;  5IY0 A;  4RMF A;  3CPW A;  4DAP A;  2KOL A;  3GTM H;  4YWL A;  4WJ3 M;  3PIO 3;  4FF4 A;  5C0X I;  3DXJ C;  1UAP A;  4RH6 A;  1JR0 D;  2IX0 A;  4JI6 L;  4DV2 L;  2AHO B;  3JAM i;  1UE7 A;  1XPU A;  5IOD A;  5J22 A;  1EUJ A;  4LFA L;  5AJ3 Q;  2K01 A;  1IKL A;  3SR1 A;  4B08 A;  4F8M A;  3K59 A;  4B3R Q;  1K0S A;  1FD7 D;  1IKM A;  1PH2 A;  1S5C D;  4X64 Q;  3T16 A;  1Q82 C;  4X62 L;  2A74 C;  3V96 A;  5EKI A;  4DAM A;  5I4D A;  2Y0S G;  3M7N A;  4JI8 Q;  2UUC Q;  3M4P A;  2NVQ H;  3PGZ A;  4O0A A;  3I2Z A;  1XMO L;  3DWQ A;  3TZU A;  3I4M B;  4KJO A;  2DNC A;  3U50 C;  1SND A;  4Z9C B;  4OX9 Q;  3AYH B;  1F9Q A;  2O4X A;  4K5V A;  3K7U C;  4C2M B;  1E0B A;  1TWG H;  3STB C;  3NPP A;  1R9T H;  2B2W A;  3S24 A;  3ULP A;  4LNQ A;  1E2V A;  1VQP A;  1CKM A;  1NTG A;  1PRT B;  1Q1E A;  3H94 A;  1Y1W H;  3H3V C;  1HUN A;  2JA5 H;  3NQI A;  1TII D;  3GTJ B;  4LMQ D;  3SGI A;  1SJH D;  4ZK9 B;  1Q86 C;  2L1B A;  3HKZ G;  4JV5 L;  3W3A A;  5A35 A;  1BR9 A;  3G7L A;  2K75 A;  2BCO A;  1JOK A;  4ZCK A;  3I4N B;  5C44 G;  1R4P B;  1VQA A;  1KNA A;  3MVV A;  1JOR A;  2F1M A;  1NAP A;  2N78 A;  3KBX A;  3NBI A;  5COY A;  5E3F A;  3UDF A;  4PZ8 A;  2B2Y A;  1HH2 P;  2RVL A;  1AE2 A;  3H6M A;  3I7F A;  1SNP A;  2HQE A;  1Z6H A;  4X65 Q;  4A3E B;  3CC7 A;  1HTP A;  1CZG A;  3PIO A;  3CC2 A;  3WWV A;  1J8I A;  5IYB H;  4OWT B;  1A3V A;  4M8A A;  2FMC A;  3CRL C;  3CQZ B;  1CSP A;  4IPC A;  2DN8 A;  3BG3 A;  2XGT A;  3TZD A;  1I4X A;  1Z47 A;  2K5Q A;  3I4M H;  3DM1 A;  2X6L A;  1Q46 A;  4DR2 Q;  5DM7 3;  4GOP C;  3S16 B;  4JI3 L;  3CCE A;  4JVZ A;  4C2M H;  1LTL A;  1KTK A;  2E2J H;  4A93 B;  3Q8D A;  1TVX A;  4RWS C;  1B9N A;  3ND8 A;  1KAB A;  3A8I E;  4LUZ A;  4OO1 G;  1FGB D;  3L0O A;  2R92 B;  4G7O C;  4QL5 A;  1SBB B;  3H3V I;  3QO2 A;  5G3L F;  1HA5 A;  1VF5 C;  4YCW A;  1JC7 A;  2L0C A;  3NTH A;  2HIX A;  1L0W A;  3K7A H;  1SJE D;  3PO2 G;  3RLN A;  1EEF D;  2TMP A;  4BBR G;  2A6H C;  3TN2 A;  4DV4 L;  5LMN W;  4QY7 A;  3ERO A;  4RGN A;  1JWU D;  3S1Q H;  2CQO A;  4ZLT F;  1YBY A;  3C2P A;  5JPM C;  4HTH A;  3CRK C;  2JA8 G;  2D62 A;  3I72 A;  1JOQ A;  3K5M A;  4NXN L;  4K5X A;  3IFD A;  1TWF H;  1MJE A;  5IP9 H;  4HSV A;  3J81 L;  2YTV A;  2E5L L;  5EKL A;  2L12 A;  4JOI A;  1BO0 A;  1WI5 A;  4OL7 A;  1SE4 A;  4AIM A;  3TDQ A;  4JI1 L;  2UXD Q;  4C3J G;  4A3E H;  2L55 A;  4MIU A;  3NQT A;  4PNY A;  1BXT A;  2Z9H A;  3MWY W;  3OMC A;  5EQ0 A;  4G7Z C;  4EX5 A;  1PFB A;  1STG A;  4B3S Q;  3CQZ H;  1HHV A;  1EU3 A;  2F0G A;  1TT2 A;  4QQB X;  3CME A;  3S2H B;  1I5F A;  3PO3 H;  3KDF A;  3TP6 A;  3GV6 A;  1GUG A;  3FP9 A;  1IYJ B;  3S16 H;  1ONL A;  5GQO A;  3ERS X;  2J7Z A;  2HHH L;  2Z4H A;  2ZXO A;  1FJG L;  3KDF B;  1T5E A;  1N32 Q;  2I46 A;  4A3L H;  2Z0S A;  4LFB L;  1RJT A;  3IFT A;  1PFN A;  2A19 A;  1IBK L;  4QMG A;  3VR3 A;  1Q8K A;  5IYD H;  3I73 A;  3C46 A;  4LF7 Q;  3H09 A;  3F2B A;  1YNN C;  3ONA B;  1SNM A;  2QA4 A;  1X32 A;  1XNQ Q;  1CZW A;  1EFI D;  1EY7 A;  2AQ2 B;  4UP9 A;  2B2W C;  4IFD H;  1V1O A;  2EYF A;  2P5Z X;  2NTS A;  2K04 A;  3BU2 A;  2F0Q A;  3D6C A;  4DN4 M;  2CW0 C;  3EIV A;  5KNB A;  1HR0 Q;  2ZM6 L;  3STB D;  4BY7 H;  2OTJ A;  4KK7 A;  2OTL A;  4ILW A;  4UP8 A;  3D4W A;  3NSW A;  1SR3 A;  2VQF L;  5GAH C;  2VZA A;  1JWM D;  4BA2 I;  3VR6 A;  4RG1 A;  5A2Q L;  1VMC A;  3GTL B;  1JIC A;  2B2V A;  3M4Y A;  5TSS A;  3U9S A;  2RDF A;  3G71 A;  1KRT A;  3K5O A;  4BY1 B;  4PMC A;  3UDG A;  4DXF A;  4L5Q A;  2F0P A;  2UXC Q;  4JI7 Q;  4GS3 A;  4LF5 Q;  2IHE A;  5M3M G;  1SMX A;  2UU9 L;  3M4Q A;  5JEA H;  3S2H H;  1EOV A;  1XPO A;  4A75 A;  3CU7 A;  2B2Y C;  3G48 A;  4P2C B;  3L3O C;  3QB3 A;  5M3F B;  3TRZ A;  3HOW H;  2RSO A;  5ELN A;  3CCR A;  1N36 L;  2E2D C;  4XYO A;  3OOC A;  1II3 A;  2UUA L;  1OXX K;  1GOZ A;  3PUY A;  3HOU B;  4BA1 I;  3WOF A;  3QR8 A;  1EIG A;  1K83 B;  3N6R A;  4R1J A;  4HMJ A;  2KUM A;  1WOC A;  2ATW A;  1A6X A;  2OT2 A;  2PPB C;  2JJQ A;  1SNC A;  4BXX G;  1MI2 A;  4FDB A;  2RHS B;  3BVZ A;  2KQ3 A;  4A3F G;  1VQ5 A;  4DV7 Q;  1LTT D;  4DR7 Q;  1HPC A;  1WD0 A;  5IWA Q;  4CJ0 B;  1PHJ A;  1G91 A;  4RGT A;  1P8L A;  4AQY Q;  2WKC A;  1V9P A;  5DLQ E;  3C3L A;  3KFU A;  3S17 B;  1AH9 A;  2EXZ A;  1Q3L A;  1ET6 A;  3ERQ A;  1AEX A;  4A3K B;  1A3U A;  1KXL A;  4YHH Q;  1VQ9 A;  4CDD C;  1UNS A;  4LFC Q;  2XRS D;  1WTX A;  4BBS H;  2O2L D;  3GTL H;  4J15 A;  2JA6 G;  1MKH A;  3B6Y A;  2KHI A;  2V4D A;  5I6W A;  2Q2U A;  1G51 A;  1NUC A;  4BY1 H;  2C35 B;  4JG2 A;  1EFW A;  1C9O A;  2AWN A;  2RBM A;  1JJG A;  2A6H D;  2PI2 A;  3AFP A;  5M5Y B;  3KF8 A;  4AYB E;  5AJ3 L;  1YNJ C;  2JA7 H;  2AMC B;  5D14 A;  1NE3 A;  2R93 B;  4B3R L;  1CK1 A;  4JOI C;  3OYY A;  4EQP A;  5M3F H;  1N8R C;  1HFN A;  1HZA A;  2KEC A;  4X3S A;  4XT3 B;  4LAA A;  4NP5 A;  4A3B B;  5C3E B;  2OQ0 A;  3HOU H;  2VY3 A;  4Y52 H;  1E22 A;  2M00 A;  2XTI A;  1K83 H;  5KYI A;  5I9O A;  1I6H B;  4JI8 L;  1K8O A;  2UUC L;  2GA4 B;  3MXU A;  3SHL A;  4A3M G;  1ESR A;  2K1B A;  4IO9 A;  4IOA A;  5C4X G;  3LGJ A;  4JI0 Q;  4OX9 L;  4MNO A;  5FO8 B;  1CFM A;  1A2U A;  1NMF A;  3MFY A;  1BBW A;  3GQB A;  1X3E A;  1SRO A;  5EPL A;  2D2C C;  4R4O A;  3RN5 A;  3T56 B;  5IP7 G;  1B4O A;  4JW0 A;  4CDF C;  1CQF A;  2EYM A;  3EVQ A;  4QUF A;  3CCJ A;  1QVG A;  5BN3 A;  4DUY Q;  3S17 H;  2K5W A;  3DWA A;  1FNW A;  4A3K H;  3SK6 A;  5IYC H;  2R3Z A;  4LF6 Q;  1VMP A;  2LFN A;  4DR5 Q;  2XN9 C;  4GZY C;  1SFO H;  3OTO Q;  2FFK B;  1YNN D;  3TP5 A;  3SK4 A;  1AZQ A;  4LF8 L;  1VQ6 A;  1EY9 A;  5COR A;  1SYF A;  5C0X H;  3VR4 A;  1IL2 A;  2DNE A;  2HCI A;  2K5H A;  2PYK A;  1QNK A;  1G2S A;  5M5Y H;  3HOV B;  1UUP A;  5D3D A;  5K5P A;  3T4A C;  3NWS A;  2CW0 D;  2R93 H;  2Z6B A;  3TS2 A;  3RZO B;  4RGO S;  4KD4 A;  4UY8 C;  3F2D A;  3QG1 A;  4C3I B;  4X6A H;  1GJX A;  2WB1 E;  1ILQ A;  5C5L A;  4X65 L;  1PZI D;  2JEB I;  5C3E H;  1W2B A;  4U68 A;  3CPF A;  1OXT A;  2YV5 A;  1D6E C;  1GVP A;  3CCS A;  2QW7 A;  4GKK Q;  1I6H H;  3VR5 A;  1SYD A;  4A3G G;  3L9A X;  1EYC A;  4NW2 A;  3NTK A;  4QIW E;  3JC6 6;  2NVY B;  3S15 H;  4XQQ A;  2Q2I A;  3WDN A;  2RHQ B;  3GP7 A;  2Q8T A;  2L9H A;  4JC0 A;  1U4R A;  5K36 H;  2MHV A;  2WAQ B;  3UE0 A;  1KDA A;  5CMD A;  3G6J B;  3J7A F;  3AU7 A;  1EYD A;  1FGU A;  4OWW B;  3D3R A;  4IOC A;  1VQG A;  1XYI A;  1K0R A;  1LT3 D;  3HOY B;  1C48 A;  4OGQ C;  1S40 A;  4KD3 A;  4A3J G;  1S5F D;  4JPB W;  2B3G A;  1N33 Q;  4KV6 A;  3E9H A;  5EBD A;  1HZC A;  3PF5 A;  3RN2 A;  1YVC A;  4KLK A;  3NXW A;  4XDX A;  2F0T A;  4L8J A;  4U67 3;  3E0E A;  1B44 D;  3J81 j;  4YCV A;  1XXG A;  2XVS A;  1I50 H;  1HTL D;  4DR1 Q;  3RZO H;  3T51 B;  4JI2 L;  2HIV A;  2Q8R E;  4RAU C;  2RSN A;  4C3I H;  4POF A;  3FKI G;  4KN7 C;  1RCV D;  2UXD L;  1MBY A;  4QIW B;  3HG9 A;  3J80 E;  5T1I A;  1JE4 A;  4FF1 A;  5G3L D;  1HZ9 A;  5GRO A;  2K33 A;  1J6Q A;  3V2T A;  3CXC A;  5EPK A;  1QNU A;  4B3S L;  3S1M H;  2OWO A;  2B29 A;  1B53 A;  1Y14 B;  2B2T A;  4BS9 A;  5EGT A;  3H0G G;  4C3H B;  3MC0 B;  1UEA B;  2F3I A;  3F1Z A;  1S5B D;  2NVY H;  4WJ4 A;  1QG7 A;  3DMU A;  1TR5 A;  3HOX H;  1FYC A;  2YTY A;  1ICW A;  1YNJ D;  1IW7 C;  1J5E Q;  3HRZ C;  1NCV A;  1VQD A;  3MXN A;  1KD1 C;  4DV1 Q;  1N32 L;  5ELE A;  1EYA A;  4L5T A;  4K2K A;  1ZYR C;  2RDG A;  2RKS A;  2KJX A;  3TBI B;  2IPK D;  2VUM H;  1CA6 A;  4XIG S;  1LM0 A;  1SMY C;  3H3V H;  4LF7 L;  3BZK A;  1SDF A;  4FXD A;  2RCN A;  1TWH H;  4FO2 A;  1K28 A;  4MHE A;  1SE8 A;  3PV0 A;  1XNQ L;  2PMZ E;  4J8Q A;  4LF4 L;  4WJW A;  1B2T A;  2WII B;  2B8G A;  4DPG A;  4KKS A;  5JJK A;  1Y1W G;  4HJ9 A;  5KND A;  4HJ5 A;  1NR4 A;  2Y0S E;  2B63 B;  3ITP A;  4ZUI A;  2NN6 H;  4ZUJ A;  5CV4 A;  1HR0 L;  2N8N A;  1GUS A;  5C3X A;  2XWJ B;  5JOB A;  1HXY D;  2F0V A;  2KEN A;  2C5C A;  3KF6 A;  2L5T A;  3Q22 A;  1U0L A;  4NMZ A;  3A8J E;  3R8B A;  1HRJ A;  2IWH A;  3PSI A;  2EYP A;  4A3C H;  4FXK C;  2JSO A;  3A74 A;  1EIH A;  2K6A A;  3W5O A;  3OMG A;  4ZAI A;  5ELD A;  3ZJY C;  1D5X C;  3W2D A;  2UXC L;  2VS1 A;  4LF5 L;  1A62 A;  3GO5 A;  4C3H H;  3DM3 A;  1VCI A;  5EAY A;  1TY0 A;  5EJW A;  4F87 A;  1QB5 D;  2HCC A;  4G7H C;  2VL6 A;  3J80 c;  3TP7 A;  4DV0 L;  4J1M A;  4HCS A;  2XWB B;  1SRU A;  3UDI A;  1JT8 A;  3I3C A;  1E24 A;  3PUZ A;  1F2Z A;  2PMZ B;  4DK1 A;  2NVX B;  5JAV A;  4GN5 A;  3G6E A;  2KCC A;  2R7Z H;  2A1A A;  2Y0S B;  3F2C A;  3HEJ A;  3K5N A;  1JB7 A;  4A3D B;  2AQ1 B;  2D0O A;  4DV7 L;  2QDL A;  2F0M A;  5KEE A;  1WCM H;  4DR7 L;  3D8G A;  4DK0 A;  1ILP A;  3HOZ G;  1W3S A;  4DR6 Q;  5IWA L;  1M1K C;  1PVO A;  4HIO A;  2B63 H;  1U9R A;  5J3B A;  4AQY L;  1F9R A;  2NZO A;  3CW2 C;  2L11 A;  2F4V Q;  1F9S A;  1JJC B;  3J7A 5;  4JYA Q;  4JI4 Q;  2K5N A;  1QWY A;  1XTD A;  1O7I A;  4DV5 Q;  4YHH L;  4O2D A;  4LFC L;  3URY A;  4HMI A;  2YU9 B;  4PG3 A;  4FXG C;  5LMU Q;  3K57 A;  1D1I A;  1XJV A;  4FF2 A;  1ASY A;  3HP3 A;  3HKZ B;  1TS2 A;  1PH8 A;  1EU4 A;  1KAA A;  1D7Q A;  1GUN A;  4DV6 L;  5C44 B;  1HNX Q;  4JI5 Q;  2F3W A;  2XRQ D;  4LUO A;  5FO7 B;  4Q0F A;  4R8I A;  2LSS A;  3D0F A;  1PH1 A;  2UUB L;  2F0H A;  2JQO A;  4GLV B;  3VR2 A;  3TRE A;  3MA2 B;  5IOC A;  1C0A A;  1X3Q A;  1EIF A;  1G6Z A;  2E2I B;  3I90 A;  2NVX H;  5KRU A;  5HUR A;  3PO3 G;  1ICF B;  3A7A B;  2RA4 A;  4I7Z C;  4R4T A;  5JJI A;  3AMU A;  2B2T C;  3P1H A;  1HJP A;  4A3D H;  1SYE A;  4GN4 B;  5T1G A;  1TWC B;  3J81 i;  1EQR A;  1A3T A;  1GKH A;  3NWT A;  5KIX A;  1EL0 A;  4A76 A;  2NVT B;  5IT9 E;  1LTR D;  4YWM A;  3GTJ H;  2EZV A;  3MZ5 A;  2E75 C;  3VYU A;  4F88 A;  4DNT B; 
#chains in the Genus database with same CATH homology
 1X56 A;  3I4O A;  4DUY L;  1VQE A;  4TVA B;  3KF6 B;  1YZ6 A;  1H95 A;  4KHP L;  1WOC A;  1Y1V H;  5HY6 A;  1OXV A;  3EN2 A;  2ATW A;  4DK3 C;  3I4N H;  2JJQ A;  4IFD G;  4LF6 L;  1E1O A;  3M3Y H;  4BXX G;  3GTP H;  4FDB A;  4DR5 L;  2RHS B;  3E9I A;  2V1C C;  1KHI A;  1L1O A;  4A3F G;  4XTC S;  1A0I A;  1YHA A;  2NN6 I;  4DV7 Q;  1VQ5 A;  4JI7 L;  3M4O H;  1X65 A;  4DR7 Q;  4BY7 G;  2EXD A;  2R6G A;  2VW9 A;  3FKI H;  2WAQ G;  5IWA Q;  2HHH Q;  1PHJ A;  5C4X H;  1N9W A;  3HKZ E;  1PV4 A;  1FJG Q;  2KHJ A;  5IYB G;  1A8V A;  2JA9 A;  3CF5 A;  3J81 c;  4DKA C;  1VQ7 A;  3S2D H;  2VNU D;  1P8L A;  2VQE Q;  1HNZ Q;  1VQO A;  4LFB Q;  2OCE A;  1NJI C;  4AQY Q;  2JA6 H;  2UXB L;  2DUD A;  5DLQ E;  1V9P A;  1I94 Q;  1IBK Q;  3KFU A;  1EIY B;  1AH9 A;  3I4M G;  3HOY G;  2I5L X;  1Z9F A;  2E8G A;  3AQQ A;  1FL0 A;  1YHQ A;  2WP8 J;  3H0G H;  5IP7 H;  4GNX A;  3TS0 A;  1KXL A;  4DR4 L;  1WFQ A;  4YHH Q;  1VQ9 A;  3DLL A;  4LFC Q;  3BJU A;  2ZJR A;  4BBS H;  2JK8 A;  3GTL H;  4J15 A;  3J7Z C;  2JA6 G;  1MKH A;  3B6Y A;  2KHI A;  4GNX B;  2E2I H;  1PH3 A;  3KJO A;  3KOJ A;  2Q2U A;  1T9H A;  2NN6 G;  4PMW A;  1G51 A;  1X54 A;  4BY1 H;  2C35 B;  1E3P A;  4JG2 A;  1EFW A;  1C9O A;  2AWN A;  2LXJ A;  1JJG A;  3HOW G;  1V43 A;  4QGU A;  1VQC A;  2PI2 A;  1X55 A;  3AFP A;  5FJ8 G;  1YJN A;  4JCV E;  4A93 H;  1KIX A;  2ZTE A;  4AYB E;  2VQE L;  3GTQ H;  2H5X A;  5AJ3 L;  2JA7 H;  2AMC B;  1NE3 A;  1X6O A;  2ID0 A;  1CKN A;  2MFI A;  2R92 H;  4B3R L;  4JOI C;  1VQJ A;  3NEM A;  3OYY A;  5M3F H;  1N8R C;  1HR0 W;  4L5R C;  1HZA A;  1CUK A;  1HZB A;  1IBM Q;  4LW1 A;  4PZ6 A;  2NVT H;  5BR8 Q;  4EQ5 A;  2EIF A;  3T1Y Q;  3I4N G;  1JMC A;  1VS0 A;  2OQ0 A;  3MEF A;  4IJH A;  1CKN B;  1VQ4 A;  3HOU H;  2VY3 A;  4Y52 H;  1E22 A;  2PQA A;  4ALP A;  2XTI A;  4DV3 L;  2ZJQ A;  1K83 H;  3PF4 A;  2QEX A;  4JI8 L;  4POG A;  1G29 1;  2JE6 I;  2R7F A;  1B7Y B;  1IBL Q;  2UUC L;  1RL2 A;  1VQB A;  2AWO A;  3F8T A;  4A3M G;  4IFD J;  3OW2 A;  2YTX A;  4IO9 A;  4IOA A;  4AH6 A;  1OTC A;  2PQA B;  5C4X G;  1M90 C;  5IP9 G;  2CWP A;  3GTG H;  3LGJ A;  1YEZ A;  5LMN L;  4LF8 Q;  4NPS A;  5IT9 c;  4JI0 Q;  4OX9 L;  3W1G A;  5JJL A;  3NEL A;  4MNO A;  3HFZ B;  1NMF A;  4A3E G;  1BBW A;  1N33 L;  1N36 Q;  3NBH B;  4GOP A;  4B3M Q;  1X3E A;  4R1J A;  3I55 A;  1SRO A;  3PO2 H;  5FLM H;  3FHW A;  4R4O A;  2HQL A;  3RN5 A;  4JBW A;  4YY3 Q;  1QZG A;  3CP0 A;  5IP7 G;  2MO0 A;  1C7Y A;  1CKO A;  1OXS C;  4X66 L;  3CCJ A;  4HIM A;  1QVG A;  4BBS G;  4GOP B;  4IJL A;  2PNH A;  4DUY Q;  1GM5 A;  3S17 H;  1N34 L;  4DR3 L;  3D31 A;  4LWC A;  4KHP Q;  4GKJ L;  5M5W H;  4A3K H;  1Q81 C;  5IYC H;  4OO1 I;  4LF6 Q;  2CFM A;  3W1B A;  1P16 A;  4DR5 Q;  1SFO H;  3UE1 A;  3OTO Q;  2CCZ A;  4A3D H;  4MZ9 A;  5JEA J;  3GTK H;  4A93 G;  4A3L G;  2K4K A;  4LF8 L;  2B63 G;  1VQ6 A;  4JI0 L;  4JI6 Q;  4IPG A;  4P74 A;  3IRB A;  2JA7 G;  1KRS A;  2K14 A;  1EYG A;  3A5U A;  2R92 G;  2L15 A;  4A3J H;  1IL2 A;  4APV A;  4LFA Q;  5IYD G;  2JEA I;  2K5H A;  3L2P A;  4A3I H;  3M85 A;  2UXB Q;  4ME3 A;  5M5Y H;  4GLA C;  4NXM L;  1TXY A;  1XMQ L;  1VQH A;  1VQF A;  2ES2 A;  2R93 H;  1JJ2 A;  3TS2 A;  3U4Z A;  4DR4 Q;  4DUZ Q;  4TQU S;  1EWI A;  5H1S E;  1S3O A;  3F2D A;  2PI2 E;  4X62 Q;  4UY8 C;  1E1T A;  1J5E L;  1GO3 E;  4X6A H;  2WB1 E;  1PH4 A;  3BZC A;  1PH7 A;  4LUV A;  4X65 L;  3T1H L;  1PFS A;  2JEB I;  3K8A A;  4P73 A;  4DV1 L;  5C3E H;  3HOZ H;  1YIJ A;  4OWX B;  1W2B A;  3OTO L;  1IZ6 A;  3CPF A;  2YU9 H;  1OXT A;  5IY0 A;  2YV5 A;  4RMF A;  1GVP A;  3CPW A;  3CCS A;  1PH9 A;  5GAE C;  4GKK Q;  1I6H H;  3GTM H;  4YWL A;  4WJ3 M;  4A3G G;  2IX1 A;  5C0X I;  4JI6 L;  1G6P A;  4HIK A;  2IX0 A;  1AE3 A;  4DV2 L;  1L1O B;  2AHO B;  1UE7 A;  1YHB A;  3JAM i;  1XPU A;  1K3R A;  4QIW E;  2IY5 B;  4IPD A;  1EUJ A;  4LFA L;  3HKS A;  3JC6 6;  5AJ3 Q;  5C44 H;  3S15 H;  2Q2I A;  1NY4 A;  2RHQ B;  4B3R Q;  4JC0 A;  1PH2 A;  2N49 A;  3K0X A;  4DUZ L;  3PUV A;  4X64 Q;  2RF4 A;  1Q82 C;  4X62 L;  1CSQ A;  1WYD A;  3UE0 A;  1XNR L;  4DAM A;  4DV3 Q;  2ZTD A;  1VQM A;  2Y0S G;  3PIP A;  3CCQ A;  1FGU A;  3M7N A;  4JI8 Q;  4OWW B;  4DAY B;  4A3D G;  4IOC A;  3M4P A;  2UUC Q;  5JEA G;  1VQG A;  2KBN A;  3A5Z B;  4JI2 Q;  2NVQ H;  3PGZ A;  4O0A A;  1K0R A;  3I2Z A;  1XMO L;  1L1O C;  4GKK L;  3M9B A;  1Q7Y C;  1S40 A;  3U50 C;  5LMN Q;  5C0X G;  3KJP A;  4A3J G;  4OX9 Q;  3AYH B;  2B3G A;  3K7U C;  1Q1B A;  1N33 Q;  1TWC H;  3JAM c;  1TWG H;  3STB C;  1R9T H;  3E9H A;  3S24 A;  1HZC A;  2K50 A;  3ULP A;  3RN2 A;  3PF5 A;  3U4V A;  4LNQ A;  1YVC A;  1HNW L;  4KLK A;  1VQP A;  4X66 Q;  1CKM A;  3KF8 B;  3RZD H;  1Y1V G;  1NTG A;  4X64 L;  1VQL A;  1BVS A;  1Q1E A;  1YJW A;  3E0E A;  2QGQ A;  1Y1W H;  3J81 j;  1N34 Q;  4DK6 C;  4YCV A;  4GNX C;  4DR3 Q;  5ELO A;  2N3S A;  1SLJ A;  4GKJ Q;  1K8G A;  5M3M H;  2JA5 H;  1I50 H;  2ZJP A;  4HID A;  4JBK A;  3AFQ A;  3GTO H;  3RZO H;  4DR1 Q;  3SGI A;  2HIV A;  4JI2 L;  4C3I H;  1Q86 C;  2ASB A;  4POF A;  3FKI G;  3HKZ G;  4JV5 L;  4QJF A;  2UXD L;  1RIP A;  2R7D A;  4R4Q A;  1LYL A;  2K75 A;  1QUQ A;  1HZ9 A;  5GRO A;  5HGQ A;  5C44 G;  1J6Q A;  3CXC A;  1VQA A;  4B3S L;  3S1M H;  2OWO A;  3S14 H;  2A8V A;  2B29 A;  1Y14 B;  4LF4 Q;  1B8A A;  2N78 A;  3H0G G;  4BBR H;  3CCV A;  4NXM Q;  4GLX A;  1QUQ B;  5K36 G;  4L5S A;  1XMQ Q;  2F3I A;  3F1Z A;  2NVY H;  3UDF A;  2GVB A;  1E7Z A;  4PZ8 A;  1EQQ A;  4WJ4 A;  3ER0 A;  4B3T L;  1U5K A;  2GVA A;  1HH2 P;  2OQK A;  3HOX H;  4A3F H;  1AE2 A;  3I7F A;  4K0K L;  2YTY A;  4DR6 L;  1MJC A;  1J5E Q;  2JA8 H;  2K52 A;  1VQD A;  4X65 Q;  3T1H Q;  1KD1 C;  1NMG A;  3PCO B;  3CC7 A;  4DV1 Q;  4DR1 L;  2I5M X;  4L5T A;  3PIO A;  1YIT A;  3CC2 A;  3UDX A;  4BY1 G;  3WWV A;  3ULJ A;  1LUZ A;  1MIU A;  2WAQ E;  5IYB H;  4OWT B;  2F4V L;  2KCT A;  1WJJ A;  2VUM H;  4XIG S;  1CSP A;  1LM0 A;  4IPC A;  4AYB G;  2XGT A;  3H15 A;  4C3J H;  4JI4 L;  4LF7 L;  3H3V H;  3BZK A;  1N32 L;  3ICE A;  1Z47 A;  4DV2 Q;  3I4M H;  4DV5 L;  2RCN A;  1TWH H;  5GAD C;  5C0X J;  2Q2H A;  1UE5 A;  1SE8 A;  5M3F G;  1Q46 A;  3PV0 A;  1XNQ L;  4H02 A;  2PMZ E;  4DR2 Q;  4LF4 L;  5LMU L;  3PUW A;  4DPG A;  4GOP C;  4JI3 L;  5FLX c;  4LF9 L;  3CCE A;  2IT1 A;  5JJK A;  1L2F A;  1X3G A;  4R4I A;  4HJ9 A;  1Y1W G;  2Q2T A;  4HJ5 A;  4C2M H;  3HOU G;  3S1N H;  1XPR A;  1LTL A;  1VQN A;  2Y0S E;  2E2J H;  1DGS A;  2CKZ B;  2EQS A;  4P75 A;  1KC8 C;  1ASZ A;  2BA1 A;  3Q8D A;  1BBU A;  2ZTC A;  3J80 i;  1XNR Q;  1HNX L;  2N8N A;  1HR0 L;  4LUZ A;  4A3B H;  4OO1 G;  3L0O A;  4QL5 A;  4JI5 L;  5FJ8 H;  2I0Q A;  2F52 A;  4DV0 Q;  2KEN A;  3KF6 A;  1XMO Q;  3H3V I;  1U0L A;  4YCW A;  1I3Q H;  1UEB A;  2HIX A;  1L0W A;  1S72 A;  3K7A H;  3PSI A;  3PO2 G;  1YNX A;  4IPH A;  5FLM G;  3RLN A;  4A3C H;  2MQH A;  2ALY B;  4BBR G;  3EBE A;  3A74 A;  4DR2 L;  3VDY A;  4DV4 L;  5LMN W;  4QY7 A;  2MNA A;  2D0P A;  3W5O A;  1HNW Q;  3S1Q H;  1VQI A;  3ZJY C;  3HOX G;  2CQO A;  1YBY A;  2UXC L;  2VS1 A;  4LF5 L;  4A3K G;  2JA8 G;  1UE6 A;  1A62 A;  2D62 A;  2FXQ A;  3GO5 A;  4C3H H;  5IYC G;  3DM3 A;  4Y7N H;  1VCI A;  4A3M H;  2HT1 A;  5EAY A;  4NXN L;  4OON A;  2Z6K A;  3RR5 A;  1TWF H;  1MJE A;  1KL9 A;  5IP9 H;  3NEN A;  2YTV A;  2VL6 A;  3J80 c;  2E5L L;  1B70 B;  2VUM G;  4JOI A;  1PYS B;  1WI5 A;  1X9N A;  4AIM A;  4DV0 L;  4JI1 L;  4HJ8 A;  4JV5 Q;  2UXD Q;  1SRU A;  3UDI A;  4A3E H;  3KYH C;  1JT8 A;  1E24 A;  3PUZ A;  1V1Q A;  5E7N A;  4GN5 A;  5IE8 A;  4A3I G;  3CCL A;  2WFW A;  4EX5 A;  3G6E A;  3TEH B;  2R7Z H;  4B3S Q;  2A1A A;  3CQZ H;  3CCU A;  3F2C A;  2R93 G;  1JB7 A;  4QQB X;  3CME A;  3K80 C;  1I5F A;  3G4S A;  3PO3 H;  3KDF A;  1OXU A;  4JBM A;  2D0O A;  2E2H H;  4DV7 L;  2WB1 G;  4A4I A;  1WCM H;  3FP9 A;  4B3T Q;  1IYJ B;  3HOV H;  1GD7 A;  3S16 H;  4DR7 L;  4A3B G;  2CWA A;  3ERS X;  5GQO A;  5C3E G;  3HOZ G;  1W3S A;  4K0K Q;  4DR6 Q;  5IWA L;  4P71 A;  1M1K C;  4DV6 Q;  2HHH L;  2MO1 A;  1PVO A;  1FJG L;  2ZM6 Q;  1JE5 A;  3KDF B;  1UWV A;  4HIO A;  2K5V A;  3GDE A;  3S1R H;  3CC4 A;  2B63 H;  4A3L H;  1N32 Q;  2Z6K C;  5M5X H;  1HNZ L;  2Z0S A;  5J3B A;  4LFB L;  2VQF Q;  4AQY L;  2NZO A;  3CW2 C;  1D8L A;  2A19 A;  1I94 L;  1IBK L;  2F4V Q;  1Q8K A;  1JJC B;  1Q12 A;  5IYD H;  3J7A 5;  2UUB Q;  4JYA Q;  4JI4 Q;  4A3C G;  4LF7 Q;  2K5N A;  3F2B A;  1XTD A;  2LXK A;  1O7I A;  3ULL A;  2QA4 A;  4GN3 B;  3I56 A;  4DV5 Q;  3AEV A;  4YHH L;  4O2D A;  3CCM A;  4LFC L;  1PYB A;  4YCU A;  1XNQ Q;  4PG3 A;  5LMU Q;  4LF9 Q;  4JI3 Q;  4UP9 A;  1XJV A;  1SN8 A;  1UE1 A;  4DNI A;  1ASY A;  1PH6 A;  3RLF A;  3PUX A;  4BXX H;  3L7Z C;  1IXR A;  1TWA H;  1PH8 A;  2YYZ A;  2UU9 Q;  3BU2 A;  1VQ8 A;  1D7Q A;  3CAM A;  3RLO A;  3EIV A;  4DV6 L;  3RNU A;  1HNX Q;  1HR0 Q;  2ZM6 L;  3STB D;  1VQK A;  4BY7 H;  2OTL A;  2OTJ A;  4UP8 A;  4MTN A;  5GAG C;  4A3G H;  4JI5 Q;  4P72 A;  2KCM A;  1SR3 A;  2VQF L;  5GAH C;  4LUO A;  2LSS A;  2VZA A;  4YWK A;  3D0F A;  2UUA Q;  1FVI A;  4BA2 I;  1KQS A;  1PH1 A;  2UUB L;  4JYA L;  2JQO A;  3MXN B;  1IBM L;  4RG1 A;  4GLV B;  2R7Z G;  2AKW B;  5BR8 L;  1A63 A;  3U58 A;  2BH8 A;  1QVC A;  3HOY H;  3TRE A;  3T1Y L;  1C0A A;  1X3F A;  5C4J H;  1KAW A;  1EIF A;  3TQY A;  2NVX H;  2DGY A;  3G71 A;  4OXP A;  4DV4 Q;  3CD6 A;  3PO3 G;  1KRT A;  4R4C A;  4IFD I;  4R4T A;  5JJI A;  1YI2 A;  3UDG A;  1PH5 A;  1WCM G;  4L5Q A;  1IBL L;  3HOV G;  4KHZ A;  4UPA A;  4HJA A;  2UXC Q;  1HJP A;  3K81 C;  4GS3 A;  4JI7 Q;  4LF5 Q;  2IHE A;  3KLW A;  1SMX A;  3GD7 A;  4UP7 A;  4KI0 A;  3M4Q A;  5M3M G;  4PZ7 A;  2JA5 G;  2UU9 L;  4GN4 B;  2BH2 A;  1EOV A;  1XPO A;  3CMA A;  4A75 A;  1QVF A;  3J81 i;  3S2H H;  3G48 A;  2GN5 A;  2I5H A;  4NXN Q;  1EQR A;  1K9M C;  1GKH A;  1NBW A;  1QZH A;  4JBJ A;  1PA6 A;  3HOW H;  3TRZ A;  5ELN A;  3CCR A;  1N36 L;  2E5L Q;  4A76 A;  1YJ9 A;  4B3M L;  4HJ7 A;  4JI1 Q;  2UUA L;  4YY3 L;  1OXX K;  4YWM A;  3PUY A;  1BKB A;  3GTJ H;  1K73 C;  1K8A C;  4BA1 I;  3A0J A;  2IHF A;  2NZH A;  2BA0 A;  4NB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...