4DV7Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv7Q00
1UEBA 4A3IH 4YWKA 4X62L 3I2ZA 1EIFA 4J15A 4L5TA 2JA7H 2CWPA 2NZOA 1VQMA 4QGUA 4LFAL 1PH7A 1HZAA 2LXKA 1XPRA 2Y0SE 1C9OA 4UY8C 1I3QH 2R92H 3S1MH 4HIDA 1C0AA 5ELOA 1CKNA 4L5SA 2N3SA 1R9TH 2QEXA 4GLAC 1VQ8A 4GLVB 4DR6L 2PI2E 2NVTH 2R93H 2K52A 2K75A 4JI1L 2UU9Q 3CCRA 4DK3C 1V43A 3A74A 3UE0A 3E0EA 1JE5A 3CD6A 5ELNA 1T9HA 4BBSG 3GTQH 2VUMG 1QVCA 1HNXQ 2Z0SA 4UP8A 5FLMH 1Q8KA 4X66Q 3FP9A 3KF8B 5H1SE 3HOWH 4P71A 3DM3A 1KD1C 4JI4L 3K8AA 4LF8Q 1SE8A 1Z47A 2AWNA 3RLNA 1X54A 3KFUA 4A93G 5JJIA 5GADC 4BA1I 1VQBA 1CKOA 3PUVA 3U50C 1IL2A 4NPSA 2VZAA 4OWWB 1I50H 4DV7L 1A0IA 4AIMA 3KLWA 3PUZA 1SLJA 4JI4Q 1B70B 4NB3A 3RZOH 1WOCA 4YWMA 1IBML 3H15A 1E3PA 2HT1A 3ERSX 4UP7A 3AEVA 2IY5B 2NVYH 3A5UA 1QZGA 4A3IG 4B3TL 1NMFA 4IFDG 1PYSB 2NN6G 1L1OA 2K4KA 3AQQA 2BA1A 3S1QH 1YHAA 4Y7NH 4A76A 4JYAL 2HIXA 4OX9L 2B3GA 3L2PA 3UDIA 3I4NH 2WP8J 5GAHC 4GNXB 4A3DG 4JI5Q 2ZM6Q 4IPDA 4JYAQ 4O2DA 2UUCL 4BY1H 1GVPA 1YNXA 3RZDH 3NBHB 3S2HH 4KHPQ 2K50A 3HOXH 4NXML 1E1OA 4HIMA 1RL2A 4BBRH 1RIPA 1YZ6A 4LF6Q 2NVXH 2L15A 3J7ZC 4A3MH 1EOVA 2D62A 3GO5A 2ALYB 3H0GH 3K81C 4DV6Q 1PH8A 4A3BG 2VNUD 4BXXH 4DV4Q 3CC2A 2ZJQA 4PZ7A 1HH2P 2YTYA 2VS1A 3JAMi 3CMAA 4DUZL 3BJUA 3S2DH 4IJLA 2EIFA 3K0XA 1TWAH 2VQFQ 1XMOQ 1XMQL 3L0OA 4NXNL 2UXCQ 2IX0A 1VCIA 3GD7A 4LUVA 1NBWA 2BA0A 1HZCA 4MZ9A 3K80C 4R4TA 1Q46A 1QUQA 2K5VA 3I7FA 1YITA 1NTGA 3EIVA 4RG1A 1YJWA 1KQSA 4B3RQ 2UUAQ 4JI6Q 1XPUA 4AQYQ 1LTLA 4L5QA 2QA4A 3M4OH 5C0XJ 1G6PA 1KL9A 4KHZA 4DV0Q 2KCTA 4DAYB 1XNQL 1FL0A 2VY3A 4IPHA 4NXNQ 1VQ7A 1Q1EA 4HIOA 1LYLA 1HNXL 5IWAQ 5IY0A 1OXSC 3KJPA 3I56A 1HZBA 1SFOH 2R93G 4DV6L 1B8AA 1Q7YC 4LF9Q 4ME3A 4HJ9A 4UP9A 2DGYA 2CWAA 2BH2A 1Q1BA 1K3RA 5GROA 2ZTEA 3GTKH 1JMCA 2Z6KC 2KCMA 3PO3G 1EQRA 1L2FA 2VUMH 2K14A 4A3KH 3PF4A 4A3LH 4MNOA 4JI2L 4DK6C 1Y1WH 4JG2A 1XNRQ 3OW2A 3S15H 4IOCA 5IYDG 1SMXA 1V9PA 3BZCA 1Y1VG 2KHIA 3D31A 3E9HA 3PSIA 4DV1Q 1K8GA 4R4OA 2VW9A 1VQ6A 1CSQA 4BY7G 1WI5A 2D0PA 3U4ZA 2UUBL 5IYCG 1X55A 1U5KA 1VQIA 3KJOA 3CCSA 4AYBG 1FGUA 4GOPA 4A3FH 1Y1WG 1VQKA 2OTLA 2Q2UA 3HOYH 3W1BA 5IP9H 3CCLA 2PNHA 4B3SQ 1YEZA 1EIYB 4DV5L 3M4PA 3TREA 2K5HA 4GKKL 2YYZA 1X6OA 2BH8A 3M85A 2E2JH 5JJLA 2JA5H 3CF5A 3T1HL 3PF5A 3BU2A 4LFBQ 4L5RC 1A8VA 2OCEA 1S40A 1PH5A 4XTCS 1XJVA 4GKJQ 4LUOA 4OO1G 1YJNA 4DR4Q 4JBKA 1NE3A 4JC0A 2UUAL 4DR5Q 4JI6L 4DV3Q 3KF6B 3PGZA 3CCMA 4GN5A 4JV5Q 3F8TA 3T1HQ 1KXLA 1WFQA 3LGJA 5C4JH 1IZ6A 1WYDA 3G71A 4C3HH 1WCMG 2LXJA 3UDFA 4EX5A 1KRSA 2KENA 4GOPB 2LSSA 4GOPC 3FKIH 1TWFH 3M9BA 3S24A 5M5WH 2AWOA 4X65L 4LNQA 2I5MX 1UE6A 4DKAC 1C7YA 1JB7A 2MFIA 1PH3A 3BZKA 3MXNB 3JC66 3H0GG 4JI1Q 1VQJA 3RNUA 4A3LG 2EQSA 2FXQA 1OXUA 3GTOH 3I4MH 1D7QA 1VQNA 4A3GH 1XNRL 2XTIA 4YY3Q 4A3CG 3EBEA 4IPGA 2B29A 3CPWA 5GAGC 1K9MC 1M1KC 2UUCQ 2NVQH 2I5LX 5AJ3L 5BR8Q 4POGA 1QVFA 3I4MG 5C4XH 3KOJA 4GNXC 2JEBI 1KIXA 3G6EA 2Q2TA 3HOVH 3A5ZB 4X62Q 4OWTB 4KLKA 4JI3L 3HOUH 1CKMA 2VQEL 5FJ8H 1G291 1HR0Q 1HJPA 1HNZL 1N36L 2E5LL 3HOZH 1YI2A 5C44G 1UE7A 2JE6I 2ES2A 1N9WA 3PIPA 1EUJA 3HOUG 4APVA 2UXBQ 3S16H 2E8GA 4DV7Q 4JV5L 2JA8H 1QUQB 4YHHQ 3HOZG 3CW2C 4YCUA 3ULJA 3RLFA 4AQYL 1PH4A 1FJGQ 4RMFA 4BA2I 2RHQB 3F2DA 1A63A 2N8NA 4ALPA 2AHOB 1CUKA 3OTOL 1K8AC 3HKZE 1IYJB 1CSPA 4UPAA 3W1GA 4POFA 4BBSH 5IYBH 4QY7A 1PH9A 2JA6H 4GS3A 5FLMG 4QJFA 2F3IA 2F4VL 3NENA 1X3EA 1KC8C 3HOWG 2UXCL 3HFZB 5GAEC 4PG3A 4C2MH 3GTJH 1ASZA 4JI0Q 3H3VH 3G48A 2JA7G 3KDFA 1SN8A 2N49A 1H95A 4YCWA 2AMCB 3HOYG 1PH6A 4DPGA 4A3GG 2UXDL 4R4CA 3VDYA 1N32L 3KYHC 1YHBA 3U58A 1VQDA 1GD7A 4C3JH 2ASBA 4KHPL 4XIGS 1HR0W 1VS0A 3CCEA 1VQAA 2UUBQ 4R1JA 5M3FG 4WJ3M 1JJGA 3S1RH 4DR6Q 5C4XG 5BR8L 2IHEA 4YY3L 4IPCA 4DR7Q 5E7NA 1JJ2A 4H02A 3CPFA 4KI0A 1OTCA 5M3FH 3CCVA 3CC4A 1KHIA 2PMZE 2Q2HA 2JEAI 3PUXA 2UXDQ 3KF6A 1Z9FA 2WB1G 1IXRA 2R6GA 1LM0A 2ZJPA 4BY1G 5C0XG 1NJIC 4JI0L 1QVGA 4HJ5A 1Y14B 4LF4L 3PO2H 2KHJA 1WCMH 2WAQG 4DV2L 4IFDI 3PO3H 5GQOA 5EAYA 4B3TQ 1DGSA 4P72A 3Q8DA 5HGQA 4A3JG 2Q2IA 2YU9H 4HJAA 1BBUA 5C3EG 4DR2L 4DUYQ 4HIKA 3CAMA 4A4IA 4DR5L 3B6YA 3GDEA 2PQAB 5LMUQ 2CKZB 2HQLA 2RF4A 4P73A 3STBC 3W5OA 1X9NA 3A0JA 1N8RC 2JA6G 5C3EH 4DUYL 4R4IA 4LF5L 4R4QA 2DUDA 4DR4L 4GNXA 2R92G 1I6HH 2RHSB 4A75A 2ZJRA 4JI7L 4LF8L 3K7AH 1N36Q 1X3GA 3TEHB 3CXCA 2K5NA 1O7IA 2A1AA 1MKHA 3ER0A 4DV2Q 3CCUA 2JA5G 1AE3A 3JAMc 4A3FG 3S14H 1VQHA 2B63G 1SR3A 1BVSA 4JBMA 2YV5A 4LF4Q 1G51A 4JOIC 3CMEA 1MIUA 3L7ZC 1YJ9A 1NY4A 1AE2A 1VQGA 1EYGA 3H3VI 1J5EL 1N34L 3K7UC 3CC7A 3J81c 1E22A 4X64Q 3CQZH 2JK8A 4PZ6A 4YWLA 5AJ3Q 1S72A 1N33L 4EQ5A 2WFWA 1YVCA 1HNWQ 1E1TA 3STBD 4FDBA 2A8VA 1P16A 1N34Q 2E2HH 1JT8A 3J81i 1P8LA 3U4VA 2IX1A 1OXTA 5K36G 5JJKA 1J5EQ 1YIJA 1N32Q 3ICEA 1HZ9A 1V1QA 1UWVA 3I4OA 1PH2A 2CCZA 1MJCA 5IWAL 1EQQA 1PA6A 2I5HA 4A3KG 2H5XA 1IBMQ 1W3SA 4AH6A 4BXXG 2V1CC 4P74A 4JOIA 2CQOA 1NMGA 3PUWA 3J7A5 2AKWB 5M3MG 2N78A 2Z6KA 3KDFB 1Y1VH 3M4QA 3UDGA 5HY6A 4JI8Q 4LF6L 3TS2A 1VQEA 2I0QA 1S3OA 3GTPH 1SRUA 3PCOB 4LF5Q 3OTOQ 1PV4A 3F2CA 3PUYA 4JCVE 4B3RL 4OWXB 4YHHL 4DV3L 4JI8L 4WJ4A 2NN6I 1VQ4A 1Q81C 2ID0A 3TRZA 3RN2A 1W2BA 1TWCH 4X66L 1Q12A 2OQKA 1A62A 4MTNA 4PZ8A 3RLOA 3S1NH 2R7DA 2JJQA 1IBLQ 4DV5Q 1VQOA 4IO9A 4QIWE 1XMQQ 1TWGH 2E2IH 3MEFA 4HJ8A 3SGIA 4DUZQ 2ATWA 4A93H 3EN2A 2RCNA 2XGTA 1U0LA 1JJCB 3CP0A 3I55A 5LMNW 4A3EG 1PH1A 2UU9L 4A3DH 2WAQE 4C3IH 1ASYA 2Y0SG 3AFPA 3M7NA 3J80i 1N33Q 1Q86C 1I94L 4X6AH 1GM5A 1BKBA 2EXDA 4X64L 1UE1A 2ZM6L 5LMNL 2JA8G 3DLLA 3F1ZA 3FHWA 3J80c 2GVBA 1VQPA 4DR7L 4P75A 1J6QA 2ZTCA 4GLXA 1KAWA 4LUZA 1EWIA 4IOAA 4LFAQ 5IYDH 3NELA 2PI2A 3T1YQ 1M90C 1GO3E 2ZTDA 2WB1E 5IYBG 4AYBE 4LFCQ 1AH9A 2MNAA 4X65Q 4K0KQ 1E24A 1PVOA 3RR5A 1KRTA 2MQHA 3ULPA 1SROA 2HHHL 5M3MH 2JQOA 4DR1Q 1E7ZA 4B3ML 5DLQE 4JI7Q 4LF7L 2F4VQ 1CKNB 4DV0L 4IJHA 3WWVA 1D8LA 1XNQQ 1PYBA 5C44H 5LMUL 1X65A 2YTVA 2F52A 3CCQA 4OXPA 4BBRG 4DAMA 2C35B 3RN5A 1TWHH 4GN3B 4A3BH 1GKHA 1I5FA 5IE8A 3GTGH 4GKJL 1YBYA 4LF7Q 5M5XH 1L0WA 4LFBL 4DR2Q 1OXVA 3PO2G 1VQ5A 2HIVA 3HOXG 1HNZQ 4JBJA 5JEAJ 1UE5A 4A3EH 1XMOL 4B3SL 4IFDJ 2E5LQ 4LFCL 2IT1A 2GN5A 4A3MG 4DNIA 4GN4B 1HR0L 5IP7G 2QGQA 4NXMQ 5FLXc 1MJEA 4QQBX 3G4SA 4DV1L 4OO1I 1PFSA 1K83H 1X56A 3OYYA 5IT9c 3M3YH 5C0XI 2R7FA 3S17H 4BY7H 4JI2Q 5IYCH 2CFMA 1I94Q 3CCJA 1XTDA 1HNWL 4JI5L 5LMNQ 4A3CH 3AFQA 4JBWA 3ULLA 3ZJYC 3AYHB 4OX9Q 4OONA 4HJ7A 2NZHA 3F2BA 1L1OB 3HKSA 1X3FA 4TQUS 3PIOA 4LF9L 2B63H 1K73C 2R7ZH 1LUZA 3GTMH 3J81j 1TXYA 1PHJA 4YCVA 2D0OA 2OQ0A 3UDXA 4DR3L 4K0KL 4LWCA 4Y52H 3I4NG 1VQCA 3GTLH 4O0AA 5FJ8G 1IBKL 3FKIG 2R7ZG 1VQFA 2PQAA 4QL5A 1IBLL 1QZHA 2VL6A 2MO0A 2OWOA 1L1OC 3NEMA 4A3JH 3E9IA 3IRBA 3TQYA 3HKZG 3PV0A 1XPOA 1VQLA 3HOVG 2JA9A 4PMWA 2YTXA 1OXXK 2KBNA 3UE1A 5M5YH 1Q82C 1B7YB 1FJGL 1WJJA 1YHQA 2UXBL 2IHFA 2A19A 1IBKQ 4GKKQ 2VQFL 4DR1L 1VQ9A 4B3MQ 4TVAB 2MO1A 3TS0A 1FVIA 4LW1A 5J3BA 4DV4L 3D0FA 5IP7H 2VQEQ 2OTJA 4JI3Q 1K0RA 1EFWA 5JEAG 2HHHQ 3T1YL 1BBWA 2GVAA 4DR3Q 5IP9G
chains in the Genus database with same CATH superfamily
4A3IH 4A93B 1RF2D 1HPCA 4J15A 2XRSD 2NBFA 2CWPA 2DJFC 1HZAA 2LXKA 2Y0SE 3G7LA 2VB3X 4L5SA 5CV7A 5EGTA 2PI2E 4QIWB 5ELCA 2K52A 4IUQA 2UU9Q 4RFBA 3VR3A 1V43A 3UE0A 1JE4A 1D1IA 2EE1A 2FMMA 4EQPA 3GP7A 4BBSG 1SNQA 1QVCA 2XVSA 1HNXQ 4R8NA 2CQAA 3KF8B 1PTOF 1ICWA 4P71A 4U673 4RGTA 4A93G 3RLNA 1X54A 2RQXA 4L8JA 1AW7A 5GADC 1DXMA 4NPSA 1X3QA 2PMZB 1I50H 4DV7L 5M5YB 3PUZA 1QOHA 4CJ1B 3BYTB 5IT9E 3H15A 1E3PA 4KJOA 3AEVA 5A2QL 5ISRA 1PYSB 5J1ZA 2NN6G 3AQQA 4X3SA 1YHAA 4A76A 2HIXA 3RMHA 1QCBD 1K3BC 4CKBA 1BF4A 4N8X1 4GNXB 2F0MA 2FHTA 1LV9A 4KHPQ 3S1QB 3RZDH 1CZWA 4X3UA 2C9OA 4BBRH 4LF6Q 2NVXH 3TP7A 1DONA 3J7ZC 2D62A 2RVLA 3K81C 4HCEA 3G6JB 4NKLA 2ZJQA 1HH2P 2VS1A 3CMAA 2A68D 3BJUA 4IJLA 3TZDA 3S2DH 3K0YA 1XMOQ 2EY2A 1XMQL 2K01A 1SEBD 4LUVA 1D5XC 4UHVA 1F9RA 3EROA 1YITA 3EIVA 3BVGA 1CI3M 4JI6Q 3GTGB 2CW0D 3CRLC 5FKAC 2B2WC 4RCOA 4B08A 4DAYB 1XNQL 1FL0A 4IPHA 1TWGB 2EOTA 1Q1EA 2F3VA 1LYLA 5IWAQ 1Z7TA 1OXSC 1HZBA 5C4JB 1Q7YC 4HJ9A 2JP1A 1AZPA 3FRPB 5I2XA 2B2TA 2EY1A 2KCMA 1EQRA 2K14A 4A3KH 4TRDA 3OW2A 1BOSA 3BZCA 3E9HA 2B2WA 2VW9A 5D3DA 1CSQA 1TR5A 2D0PA 3U4ZA 3D6CA 4GOPA 4A3FH 2XRQD 3T16A 3CCLA 2JA8B 4MIUA 3S16B 1SYDA 3TREA 2BH8A 1X3PA 3HZXA 5JJLA 2A69C 2JA5H 2E2IB 2K1BA 4L5RC 1TIID 2OCEA 3FKIB 1S40A 4XTCS 1Y69U 1CA6A 4LUOA 4OO1G 4KTAA 4DR4Q 1RCVD 1ENAA 3WOEA 4ZAIA 4JK1C 5EBDA 3GV6A 5K5PA 3MFGA 1WTPA 3T1HQ 1I4GA 3LGJA 3BDOA 3DUZA 2IW3A 1IZ6A 3G71A 5J22A 2A6HD 4C3HH 1R9TB 2LXJA 2LSSA 4GOPC 5M5WH 3N52A 4X65L 4LNQA 2I5MX 2AUJD 2MFIA 3BZKA 2EJFC 5EKIA 2B2YC 3JC66 3NUCA 4A3LG 2EQSA 4K8IA 3GTOH 3VA5A 1VQNA 3I4MH 1D7QA 1XNRL 3RD4A 2F3WA 1JQYD 4YY3Q 4DAPA 4IPGA 4WRDA 2JN4A 5AJ3L 4DNTB 3I4MG 3S2DB 3PO2B 4IN3A 1SNCA 3KOJA 1U4MA 2AUKA 2JEBI 1G2TA 1KIXA 3G6EA 3A5ZB 2MHVA 4X62Q 2NVXB 4KLKA 1WVLA 3HOUH 4ZK9B 4BBRB 1HR0Q 1G291 3KLSA 3SXHA 1HNZL 3K6OA 3RZDB 1N36L 1B9MA 2ES2A 3HOUG 3PIPA 1KTKA 4JV5L 2JA8H 3ULJA 2B63B 5JOBA 2K5QA 4AQYL 1FJGQ 4KMUC 2HDLA 3QB3A 3F2DA 1JWSD 2AHOB 2I46A 1K8AC 4UPAA 1CSPA 3M4OB 1TY2A 1WTRA 1LTSD 2EYFA 2MP1A 4GS3A 3H6MA 5FO9B 3BG3A 5DEHA 3HFZB 5GAEC 4DA2A 2HCIA 4EGVA 3KDFA 1SN8A 2N49A 1H95A 4YCWA 2UXDL 3VDYA 1IKLA 1VQDA 1GD7A 5EPKA 4C3JH 1A15A 3CCEA 1RHPA 5ELEA 3S1RH 5E4WC 4DFAA 4DR6Q 3OMCA 4DR7Q 1Y8PB 1JJ2A 3S2HB 2B2VA 3CPFA 3CC4A 2JEAI 5CV4A 2Q2HA 1FD7D 3PUXA 5L37A 1Z9FA 2R6GA 1JB3A 1QVGA 4LF4L 3LWUA 3PO2H 4M8AA 4IFDI 1JWMD 3V96A 4DV2L 5EAYA 1Z6HA 1DGSA 5HGQA 2YU9H 5M3MB 4F88A 3T56B 1F2MA 4HIKA 3TN2A 3CAMA 2Z9HA 1EY6A 1V1OA 1BCPC 2EJGC 2MJ8A 2F0FA 3JAML 5E3FA 3NQIA 4K14A 4KY6A 1CA5A 1X9NA 1B53A 3W2DA 2JA6G 2PZWA 4LF5L 3HOWB 4DR4L 2F0HA 2Z4HA 4GNXA 2AQ2B 1I6HH 2EYMA 2RHSB 3URYA 3J80E 5KEEA 4JI7L 3K7AH 1II3A 4DGZA 3TEHB 2K5NA 4RKLA 1EU4A 1FGBD 3ER0A 1UUPA 2DJGC 4KKSA 3H3VC 1AE3A 2F0EA 1STYA 2OF1A 3S14H 1BVSA 1G51A 1SE4A 3CMEA 2EYLA 3TSSA 1VQGA 1F2YA 1J5EL 3K7UC 5KNBA 4FF1A 4MN3A 5CGKA 1LTRD 1EY5A 4PZ6A 1GUTA 1HNWQ 1E1TA 5ELDA 3I3CA 4XQNA 2E2HH 4E6IA 3J81i 2IX1A 3U4VA 4CKEA 1I4PA 2R92B 1E2ZA 5JJKA 1D1KA 3GTPB 1I4RA 4S3SA 1SNPA 2D9UA 4RWSC 3I4OA 1J9OA 1I6HB 2I5HA 4FXGC 4AH6A 2SNSA 2A69D 2V1CC 3PUWA 5LHY1 4ZRZA 2AKWB 5M3MG 2N78A 2Z6KA 3M4QA 4IFDH 1LACA 3GTPH 3A7AB 1MGSA 4LF5Q 3OTOQ 3PUYA 4JCVE 4B3RL 4WJ4A 2NN6I 3TRZA 2WB1B 1WCMB 3RN2A 1PFMA 1W2BA 4PZ8A 4KKTA 2R7DA 2JJQA 3MAQA 4XQQA 4DV5Q 1VQOA 3SGIA 4DUZQ 4TKOB 2RCNA 3EN2A 5M3FB 4WJ3M 1PH1A 2UU9L 2K33A 1JORA 4C3IH 2Y0SG 5FOBB 3M7NA 2PO4A 3HOYB 3S17B 2A6ED 1I94L 3K57A 1EYAA 1XWEA 4X6AH 3L3OC 5LMNL 5K36H 4A3LH 3HEJA 3NPPA 4DR7L 3J80c 3OOCA 1VQPA 5G3LF 1J6QA 1KAWA 2EVBA 4BY7B 3NELA 2K03A 1UNSA 4AYBE 2MNAA 1ICFB 4X65Q 2MQHA 4JW0A 1SROA 2HHHL 3KUPA 1WTVA 4DR1Q 1TS2A 3DXJC 4R9WA 3WWVA 2XNAC 1K8MA 1PYBA 3I72A 4OXPA 4DAMA 2KECA 1H9SB 1TWHH 1CTMA 4GKJL 1YBYA 4DR2Q 2B39A 5JEAJ 3M3YB 4B3SL 2IT1A 5IOCA 1SDFA 3TBIB 1HR0L 2O2LD 4NXMQ 3OIPA 3QR8A 3KBXA 3G4SA 4PMCA 4FF2A 1LTGD 4OO1I 1QWYA 3S17H 4JI2Q 1PZKD 5IYCH 1XTDA 1HNWL 4JI5L 4K2LA 3PQIA 5LMNQ 5KYIA 3IL8A 4M1UB 5IGDA 3I8ZA 5FLXL 3U9SA 3F2BA 2B63H 2R7ZH 1E2WA 3GTMH 1TXYA 4YCVA 4A3DB 4LWCA 5LL6X 4P2CB 1VQCA 4O0AA 3FKIG 1HA5A 2R7ZG 1KDAA 2F0KA 2PQAA 1WD0A 1IBLL 1QZHA 4N8FA 2MO0A 1D6EC 2OWOA 4OELB 4LJZC 3HOVG 3J80L 1MSGA 3EFXD 2RDHA 4B3MQ 4JPBW 5J3BA 4JVZA 3T1YL 1BBWA 4N9PA 1UEBA 1JWUD 1SE2A 3I2ZA 2NZOA 1VQMA 4QGUA 1C9OA 1C0AA 1I3QH 1ET9A 2R93B 4C3HB 2QEXA 1R9TH 4FF4A 5KYLA 4H44C 4DR6L 2NVTH 2QW7A 2H4OA 4JI1L 4IQZA 3CQZB 4PV1C 4QB4A 3A74A 5KRUA 3E0EA 1JE5A 4K8JA 2OXPA 2VUMG 2Z0SA 4X66Q 5HGTA 3SK4A 4H0LC 4L63B 3DM3A 1KD1C 3K8AA 5JJIA 1Z47A 4BA1I 1VQBA 3PUVA 1PRTD 4J6HA 2WV6D 1A0IA 2K04A 1ILQA 4NB3A 3QJYA 4O42A 2NVYH 3A5UA 1QZGA 1NMFA 2QDLA 1HRJA 1L1OA 1HUMA 2K4KA 3S1QH 1GUGA 3TDQA 2B3GA 4YIJA 1HTPA 3UDIA 2FMCA 3QOLA 3NTKA 2WP8J 4J1MA 1PLFA 4QUFA 1TU2B 2F03A 4JI5Q 1W6KA 4BY1H 3NBHA 1GVPA 3HOXH 1SYCA 4KK7A 2L15A 4A3MH 3GO5A 4DV6Q 4A3BG 2VNUD 1PH8A 4ZYSA 3ERQA 4BXXH 3CC2A 2YTYA 4DUZL 2EIFA 3K0XA 1TWAH 3X3MA 5J39A 2NTTA 2IX0A 2NTSA 2NYZD 5M9OA 1ZYRD 1NBWA 1HZCA 1Q46A 3I7FA 1NTGA 4RG1A 1BUVT 3DM1A 1M4VA 4HN7A 1XPUA 3FVQA 4L5QA 3MC0B 4BBSB 5C0XJ 4KHZA 2KCTA 1ZXTA 4NXNQ 1VQ7A 4HIOA 3S1RB 4HSPA 3I56A 1TWCB 3S1NB 2QF7A 2R93G 3K5NA 5KGUA 2PPBC 5IGFA 2BH2A 1K3RA 1FNVA 3D6WA 5GROA 4XQJA 3GTKH 3D4RA 1ML0D 4XYOA 1JMCA 3PO3G 1L2FA 1EY7A 4KV6A 4JI2L 1BCPD 2CW0C 4JG2A 1S4ZA 1XXGA 4ZLTF 1SMXA 1V9PA 2A74C 4IOCA 3HRZC 1U4RA 1VQ6A 3ZYYX 2UUBL 5IYCG 3BDCA 3CCSA 2OTLA 1STGA 3C2PA 2Q2UA 1B4OA 3W1BA 2D2CC 4LMQD 4B3SQ 3HOVB 1YEZA 4I65A 2K7VA 4V190 2PZUA 2EYJA 2EJMA 1TS4A 4ULLA 2K5HA 4IUNA 2YYZA 3M85A 2E75C 5JEAH 3PF5A 4LFBQ 1A8VA 5FO7B 1EYCA 1NR2A 1XJVA 1PH5A 3A7LA 2KCCA 1PTOH 1YNJD 4JC0A 4DV3Q 3KF6B 3PGZA 4DN4M 3CCMA 3F8TA 4QCLA 3WOFA 1SFOB 1BBXC 1CFMA 1KRSA 5I9PA 4GOPB 2IJ0A 3AMUA 2EXZA 3VR6A 1C7YA 3VYRA 1HFGA 2E2JB 2ZXOA 1YNNC 3H0GG 3U9OA 3FPUB 2C5CA 1XTCD 2FJ2A 1OXUA 5JAVA 4A3KB 2O4XA 2NVQH 2B29A 1K9MC 1M1KC 1KLUD 1RKNA 1KAAA 3KLRA 4DK1A 4POGA 1L0YB 2H1EA 3DEPA 1QVFA 1KDBA 5CYUA 2L4NA 1L0XB 4GNXC 1ENCA 1SYFA 2Q2TA 3N6RA 2CH4W 4OWTB 2RDFA 4JI3L 1SYBA 2VQEL 1DZ1A 1GXDC 3ND9A 2JE6I 2Z8LA 1R4QB 1MI2A 2F0VA 1S5CD 3OWEB 1EUJA 4F87A 4G7HC 1HQRD 4PMBA 4DF7A 3S16H 1ZYRC 4DV7Q 3J81L 2KUMA 1JC7A 1I6VC 4YCUA 1K0SA 1PH4A 1RJTA 4A3FB 3P75A 2N8NA 5EKKA 1CUKA 4PNYA 3J7YW 1SYEA 1IYJB 1TS5A 4BBSH 2EDGA 1PH9A 2KVMA 4CGYB 2JA6H 1BDOA 3NENA 1EIHA 1X3EA 1EY0A 2WKDA 1K83B 4C2MH 3RZOB 5CV8A 2QEJC 3JAME 4DU9A 2J7ZA 4ME5A 3HOYG 4DPGA 4A3GG 1N32L 2FINB 1YHBA 3A56A 3U58A 1CZGA 1ET6A 5M3FG 4FVMA 2K6AA 4C1NI 1IYUA 3DEOA 5BR8L 2IHEA 3K58A 1EY8A 1IL8A 5E7NA 4H02A 2TSSA 2KQ3A 1OTCA 5M3FH 1TT2A 2WB1G 4MTKA 1LM0A 2NVYB 4BY1G 1NJIC 1Y14B 1DOLA 5C4XB 3I4LA 1WCMH 1T5EA 2XN9C 1QNKA 3Q8DA 4EVOA 3TMEA 4HJAA 1STBA 4DR2L 2RSNA 5D14A 3S1MB 4A3GB 2JA7B 2RF4A 3W5OA 2PW7A 3C3LA 4R4IA 4R4QA 2R92G 1HQMC 2ZJRA 1WTXA 1X3GA 3SEBA 4G7OC 3PMFA 3KF8A 2K28A 1E0BA 2JYOA 3VYTA 5CBAE 2JA5G 1VQHA 1CT1D 3HOZB 2YV5A 1YJ9A 1MIUA 2EYPA 3P20A 1G6ZA 5F2DA 3CC7A 1E22A 4X64Q 2RBMA 1PTOD 4C3IG 5AJ3Q 1AP0A 2WFWA 1YVCA 4WJWA 2BDNA 3GTLB 1JT8A 4K5WA 5K36G 3SK8A 4ABNA 1I3QB 2D5DA 1J5EQ 5DM73 3H94A 4K5VA 1LT5D 1V1QA 5IODA 2CCZA 5CV6A 1MJCA 1WD1A 4A3KG 1IBMQ 1SNMA 2R61A 4BXXG 2CQOA 2SNMA 3J7A5 3KDFB 2CH4A 3ND8A 3TS2A 1VQEA 2JSOA 4K6DA 1PV4A 5IGBA 4OWXB 4DV3L 2N88A 2PYKA 1KDCA 3D3RA 2BCOA 2OQKA 1DOMA 2F0SA 1SBBB 1QE6A 1IBLQ 1XMQQ 3WDNA 4A93H 1U0LA 3CP0A 3BZDB 2WAQE 3CRKC 5JPMC 3J80i 1Q86C 2EXDA 4X64L 1UE1A 2HUGA 1O7YA 4OEMB 3DLLA 4P75A 2ZTCA 1GO3E 2J4XA 4ILWA 5IYBG 4HMIA 1E24A 1SE3A 2JQOA 5KNCA 1E7ZA 5DLQE 5DM63 2F4VQ 1CKNB 4DV0L 3R3OA 2R3ZA 1XNQQ 3FEWX 1RD9D 1T5XD 2F52A 3CCQA 1EZ6A 1RODA 4BBRG 1LLRD 5EPLA 3RN5A 1STNA 5IE8A 2M9VA 1L0WA 1OXVA 3PO2G 4RAUC 1HNZQ 1UE5A 4NW2A 4A3EH 1XMOL 1DYQA 1AEXA 2GN5A 4GN4B 2QGQA 4ZUJA 2IPKD 1CHPD 1X56A 1ZKOA 2G9HD 3OYYA 3QG1A 3IAYA 1IW7D 2CFMA 4WFN3 3CCJA 1O7LA 1DCZA 1K8OA 3J7AV 2NZHA 5DNFA 3HKSA 5M5WB 5C4ZA 1O80A 3DHQA 5D65A 2OQ0A 5A2QE 4DR3L 4IALA 3GTLH 1VQFA 3F2UA 4QL5A 3ITPA 1S5FD 4CDFC 3FDTA 2NWGA 1RDPD 4ZKBB 3IRBA 1F9PA 1XPOA 3UE1A 4PMWA 2KBNA 3R93A 1YHQA 2IHFA 1C4QA 2A19A 1B2TA 1JOQA 4X3KA 1FVIA 4LW1A 3D0FA 4JI3Q 4ID6A 1BNZA 2EY6A 5IP9G 1Q3LA 4K0KQ 2Q8IB 4IZ8A 2GA4B 5I6YA 2KCNA 1XPRA 3S1MH 3IFTA 5ELOA 3E5SA 3VYUA 4KY5A 5CR3A 2F0UA 4KHVA 1PDQA 2K75A 5EJWA 4DK3C 1S5BD 3CD6A 1T9HA 2K5WA 3QWNA 3K7AB 3GTQH 5FLMH 1Q8KA 2WINB 3FP9A 5H1SE 3HOWH 3I70A 3KFUA 2L5TA 2PZTA 3DMUA 5CMDA 1CKOA 3U50C 2XWJB 4AIMA 4JI4Q 1SLJA 2IL8A 1B70B 1STHA 3Q0AA 2B2TC 3RZOH 1ENFA 4FYDA 1WOCA 1ZEQX 3LWEA 2RA4A 1H9MA 4EQNA 1SNDA 2F1MA 4IFDG 2BA1A 2Q8RE 1D2BA 3NK9A 3GTMB 2R7ZB 1PXUA 1SNOA 3MA2B 3I4NH 3MXGA 4OL7A 4ZKCB 5GAHC 3NHHA 1NAPA 2ZM6Q 1F9QA 2UUCL 2K50A 3OW7A 4NXML 1E1OA 1RIPA 1YZ6A 4CHTB 1YNND 1KABA 3R2TA 2EYHA 4X3TA 4RCNA 4DV4Q 4RA8A 1CHQD 3W3AA 4PZ7A 4KY7A 2ENBA 2VQFQ 3L0OA 4NXNL 3TP6A 1VCIA 2BA0A 3K80C 4R4TA 1KQSA 4CDCC 4B3RQ 4QUCA 4AQYQ 3KBGA 4H7BA 2QA4A 3M4OH 4DV0Q 1SMYC 4DAYA 2X6GA 3SE0A 3KJPA 4BS9A 1SFOH 3SK5A 2F0TA 4LF9Q 1TVXA 1EU3A 4UP9A 2DGYA 2CWAA 2F0OA 1Q1BA 4HSVA 2Z6KC 2KEEA 5LL6S 5ELFA 2VXWA 3A8IE 1EWCA 4G7ZC 4LAAA 1OO9B 4DK6C 2F0WA 1XNRQ 5E4XA 1K8GA 1Y1VG 3D31A 3PSIA 3NTHA 3Q6SA 3VA7A 4R4OA 4DV1Q 1WI5A 3NSWA 3KJOA 1U5KA 2QDBA 2MGSA 2NZ1D 1FGUA 3CHBD 4AYBG 1PFNA 3D4DA 2PNHA 1TQOA 1TS3A 3Q23A 1AFPA 3M4PA 2I07B 3OWFA 1EZ8A 1X6OA 2Y0SB 2E2JH 1VF7A 2WACA 2DNCA 3BU2A 5BN3A 4GKJQ 5KNDA 5JJZA 4JI6L 3EVQA 4NP5A 2L55A 1WFQA 2E76C 4KN4C 1WYDA 3FMCA 1GUOA 3UDFA 2KENA 3FKIH 3M9BA 2K05A 1JB7A 1PH3A 1HUNA 3MXNB 3MXNA 1KNEA 2F0PA 4JI1Q 3RNUA 2FXQA 4OIJA 4IUUA 5NUCA 4A3GH 5C6AA 3GV3A 2XTIA 2IX3A 3EBEA 3CPWA 5TSSA 1EY4A 4RGOS 1TWAB 2E2HB 2AQ3B 1LO5D 4IUPA 3BVMA 1CKMA 1HJPA 2RSOA 3HOZH 3O13A 5C44G 1U4LA 1UE7A 2F0JA 2HQEA 4KJNA 2E2DC 2E8GA 1QUQB 4YHHQ 3HOZG 1PTOC 3RLFA 4BA2I 1STAA 2RHQB 1A63A 4RHRA 2B2YA 4FP5D 4ALPA 1ONLA 3HKZE 1W6JA 4POFA 2K5DA 3Q22A 1HHVA 4K6LA 4OGQC 4FO2A 4QJFA 2F3IA 4J8QA 1KLGD 4EQOA 3NTIA 2UXCL 3AB9A 1ASZA 3G48A 2JA7G 1EOTA 1PH6A 3HP3A 4R4CA 5IGGA 3KYHC 1TY0A 2KEDA 5I4DA 1ESFA 4PQXA 4XIGS 1HR0W 2UUBQ 1JJGA 2QKIC 5C4XG 4YY3L 2JXMB 1QG7A 3V05A 1A2TA 4Y7NB 4BY1B 2QILA 3QIAA 1V1PA 4KKUA 4KI0A 1D5ZC 3CCVA 1KHIA 1LT3D 3KF6A 3S9WA 2SEBD 3A54A 4HJ5A 1VDZA 3OIQA 1DM0B 3PIO3 1ILPA 2WAQG 3A55A 3PO3H 1S5ED 5GQOA 4P72A 5CORA 4A3JG 3NXWA 2Q2IA 4C2MB 4RKBA 1BBUA 5C3EG 1GJXA 4DUYQ 2LFNA 4A4IA 4FXDA 4DR5L 3B6YA 3DWAA 3GDEA 3P7JA 3BS1A 2CKZB 2CHBD 3A0JA 5C5MA 5C5LA 5C3EH 5JVG3 4DUYL 2DUDA 1I4XA 4UAIA 4HEDA 4KD3A 4A75A 4LF8L 3E3XA 1B44D 5CV9A 4DV2Q 3CCUA 4A3FG 1GOZA 1GHKA 4JBMA 4LF4Q 3L7ZC 1O78A 2IWHA 3HG9A 4C1NK 1EYGA 4ODGA 1QB5D 2QCPX 4XT3B 5BN5A 4RHSA 1U4PA 5A35A 1GUNA 1MSHA 3CQZH 4YWLA 4EQ5A 4OO1H 3EA6A 2A8VA 1P16A 1N34Q 1CK1A 1UAPA 2DY8A 1NUCA 1P8LA 1OXTA 3IFDA 3ONAB 1YIJA 1LTBD 1N32Q 3ICEA 2NB0A 1BXTA 1A2UA 5IWAL 1PA6A 2J0TD 1W3SA 4JOIA 1NMGA 5C3EB 2I0QA 2N55A 3OMGA 3F2CA 2MPMA 3MVVA 4YHHL 2A73B 1VQ4A 1Q81C 2KA7A 5KIXA 1PMRA 4X66L 3S1NH 4MTNA 1PTOB 4Z9CB 2B2UA 3MEFA 4HJ8A 2ATWA 4DXGA 5EQ0A 4LF6L 2XGTA 4A3EG 3I55A 1XYIA 4A3DH 4BWGB 1ASYA 4H13C 1RTOA 2KJXA 3DWPA 3NWSA 4DNRB 1BKBA 1NNXA 2JA8G 3FHWA 5I9OA 1BR9A 4GLXA 4LUZA 4FNFA 3GTJB 2PI2A 3T1YQ 3VR4A 1M90C 2AQ1B 2SOBA 3RR5A 1PVOA 2WIIB 1SJHD 3PO3B 3TZUA 1GUWA 1H9JA 4IJHA 2XWBB 1YNJC 5C44H 4DK0A 4HMJA 5I2YA 3LNNA 4O1NA 1PZID 4A3BH 1GKHA 3M4YA 1WTOA 2OT2A 4LF7Q 5M5XH 2DNEA 1F77A 4LFBL 1DJRD 2HIVA 4JBJA 1D5MC 1BO0A 3NWTA 4IFDJ 3SVMA 2E5LQ 3BVZA 1G2SA 4DNIA 4I7AA 3FPPA 3R8BA 4F7XA 1MJEA 1JOOA 1PFSA 1K83H 2WKCA 5IT9c 5C0XI 1CM9A 4BY7H 2X6LA 3Q24A 1I94Q 5JVH3 3D4WA 3E6ZX 5HURA 4A3BB 3K5LA 4JBWA 3AYHB 2ZXRA 3T53B 4HJ7A 1MD2D 1LABA 4TQUS 1A3VA 1LUZA 3J81j 1EIGA 3I73A 1PHJA 3UDXA 2D0OA 3H09A 1Y8OB 2ZXPA 4NDXA 1GUSA 4ZQ3A 2Q8TA 4RGNA 3EQLC 2VB2X 1PYWD 4RGMA 1L1OC 5EBCA 3NEMA 4A3JH 1DD2A 3TQYA 4HCSA 1VQLA 1OXXK 5M5YH 1Q82C 1FJGL 2RCFA 1B7YB 1E2VA 1WJJA 3S14B 2OEOA 4AYBB 1IBKQ 4GKKQ 2VQFL 3MFYA 1VQ9A 2NVQB 1Y1VB 5IP7H 2VQEQ 2O5JC 1K0RA 1EFWA 5JEAG 2HHHQ 4V0BA 2GVAA 1G8ZD 4FF3A 4YWKA 4X62L 1EIFA 4L5TA 2JA7H 2PCFB 4LFAL 1A3UA 1PH7A 4UY8C 2R92H 2VUMB 4HIDA 2NUCA 1CKNA 2N3SA 2PQEA 1VQ8A 4GLAC 2SDFA 1EQTA 3HGBA 3VR2A 1STEA 4GLVB 5ELBA 1SMYD 2R93H 1VF5C 1JR0D 1TKWB 3CCRA 1B3QA 2MUYA 2M00A 5ELNA 4C3HG 3MTSA 3MHBA 1WTQA 4UP8A 1B50A 4JI4L 4LF8Q 1SE8A 1C48A 2AWNA 5DAUA 2LKVA 5IT9L 4I7ZC 1IL2A 4C3JB 3NQTA 2VZAA 4OWWB 4G4KA 1BCPF 4XXEA 2TMPA 2B2VC 3KLWA 3T4AC 5T1GA 2BDOA 4YWMA 1IBML 2HT1A 3ERSX 4UP7A 2IY5B 5JPNC 1EL0A 4B3TL 3HKZB 3NBIA 4A3IG 3LX0A 2XIWA 5C4HA 4CJ0B 2PW5A 1I4QA 4Y7NH 1MBYA 4HTHA 3MZ5A 4JYAL 4OX9L 3L2PA 5T1IA 3GQBA 3I4NB 4CDDC 4A3DG 3EJIA 1PRTB 4IPDA 4JYAQ 4O2DA 5C0XH 3S2HH 1YNXA 3NBHB 5COYA 4HIMA 1RL2A 1I4HA 4U68A 1EOVA 3H0GH 2ALYB 1AN8A 1NCVA 3JAMi 2UXCQ 3GD7A 4MZ9A 1QUQA 2K5VA 1YJWA 1BCPB 1PFBA 2RDGA 2UUAQ 4A3MB 1LTLA 3UI2A 5EPJA 2L9HA 1G6PA 1KL9A 3HOXB 1ESRA 1IKMA 5C3WA 5CBEE 5IGCA 2VY3A 1QJOA 1M8AA 1HNXL 5IY0A 3BDLA 4DV6L 1B8AA 4ME3A 4KN7C 2Z4IA 4UDUC 1EY9A 3A8JE 4IUTA 1EEID 2ZTEA 2ICIA 2VUMH 3PF4A 1G91A 4MNOA 2O5IC 3K5MA 1Y1WH 3S15H 4R8IA 5IYDG 2KHIA 1LT6D 3D8GA 3NP8A 4BY7G 3HOVH 1X55A 1FNWA 1VQIA 1VQKA 1Y1WG 3HOYH 5IP9H 4LK1C 1SJED 1EIYB 3MXUA 2BE5D 4DV5L 3I90A 1PRTC 4GKKL 1X32A 1KNAA 3CF5A 3GTQB 1GHJA 1LTAD 3T1HL 1TWFB 4IURA 2Z1CA 1SXTA 1SAPA 1YJNA 3GTKB 4JBKA 2A6EC 1EWHA 1NE3A 4DAVA 2UUAL 3X3NA 4DR5Q 4NMZA 4GN5A 4JV5Q 2L12A 2P5ZX 1QILA 5BN4A 1KXLA 5C4JH 1WCMG 4EX5A 2E74C 3SK6A 3K5OA 1TWFH 3S24A 2AWOA 4XDXA 1UE6A 4DKAC 3SDZA 5FK9C 3KLSX 2L0CA 1B1ZA 3TP5A 1VQJA 3SR1A 5C3XA 4ZUIA 1SYGA 4A3CG 3AU7A 2UUCQ 5GAGC 2I5LX 5BR8Q 1J8IA 5C4XH 3L9AX 1LT4D 1EQVA 3H91A 2KOLA 2BOSA 2DY7A 1FR3A 3PIP3 5FJ8H 5M5XB 2E5LL 1YI2A 1N9WA 4APVA 2UXBQ 1QNUA 1IHZA 3OSOA 4K2KA 2HCCA 1AZQA 3CW2C 1FNUA 4RMFA 2G5DA 1V1PB 3OTOL 3W1GA 3MXPA 5IYBH 4QY7A 3RUZA 1WTHA 5FLMG 4HR7B 2F4VL 3HOWG 1KC8C 1HXYD 5IGEA 2JA6B 4PG3A 3GTJH 4JI0Q 3H3VH 2XSCA 2G9DA 1V8QA 2AMCB 2F0GA 4N9TA 3QOJA 2L1BA 2ASBA 4KHPL 1VS0A 4A3EB 1VQAA 4R1JA 3J81E 1VMCA 4IPCA 3HS0C 1TWHB 1HA6A 2PMZE 1A3TA 1CQFA 3R2IA 2UXDQ 1IXRA 1JICA 3CKIB 2ZJPA 4B9WA 5C0XG 4JI0L 3VYSA 1IYVA 2KHJA 3CU7A 4HAEA 2F0IA 4B3TQ 3K59A 3IKJA 5I6WA 4RH6A 2EZVA 4QF4A 1VMPA 4TSSA 2PQAB 1PRTF 5LMUQ 5AFWA 2HQLA 4P73A 5G3LD 3STBC 2A5HA 1N8RC 4CJ2C 3BYYB 3TP8A 4Q5VA 1I50B 1XX8A 3QO2A 4CBVA 1N36Q 5CC4A 2NN6H 3CXCA 1O7IA 2A1AA 4Q0FA 1MKHA 2HDMA 4GZYC 4C3IB 2F4IA 3JAMc 1PZJD 2B63G 1SR3A 2ICEC 3OHXC 2LMCB 4JOIC 1NY4A 1AE2A 3H3VI 1N34L 3HOUB 1EFID 1FYCA 3J81c 4OIKA 4CDEC 2PNRC 2JK8A 2JA5B 1S72A 1MHWC 1N33L 1IW7C 3STBD 4FDBA 4FXKC 4CKCA 1JCKB 4K5XA 2EYOA 3I91A 2Z6BA 3GTOB 3I4MB 3OPOA 5D3IB 1R4PB 1HZ9A 1UWVA 1EYDA 1O7ZA 1PH2A 4ZCKA 5IIFA 1EQQA 2H5XA 4P74A 3UDGA 1Y1VH 4A3JB 1UEAB 5HY6A 4JI8Q 1S3OA 2WAQB 1C8CA 1SRUA 4G57A 3PCOB 1JOKA 1SSOA 4JI8L 4C56C 2ID0A 2F0NA 4F8MA 1TWCH 2LS01 1Q12A 1A62A 3RLOA 2K32A 1F2ZA 1HFNA 4IO9A 4QIWE 1K28A 1TWGH 1Y8NB 3DWQA 3MEHA 4MHEA 2E2IH 5LMNW 1JJCB 1Q8IA 4L6TB 3C46A 3AFPA 1N33Q 2DN8A 1GM5A 2ZM6L 3F1ZA 2GVBA 1F2LA 1H9SA 2LY7A 3C1FA 1Y1WB 2RKSA 3S15B 1EWIA 4IOAA 3P1HA 4LFAQ 5IYDH 1H9RA 2WB1E 2ZTDA 4LFCQ 1AH9A 1DOKA 5E1FA 4XT1B 1LTID 2M2LA 2HD3A 4WORA 1KRTA 3ULPA 5M3MH 2YU9B 3J7AF 4B3ML 4OHJA 4JI7Q 4LF7L 1HCZA 1CQVA 4B9XA 3NE5B 2F0DA 1A6XA 1RTNA 4DXFA 1D8LA 1NSNS 5C44B 5EKLA 3MWYW 2B2UC 5LMUL 1X65A 2YTVA 2F0QA 3VR5A 2C35B 3T51B 3V2TA 4GN3B 3A8KE 1WTWA 1I5FA 2EY5A 3GTGH 1VQ5A 1EEFD 5FO8B 3HOXG 4LFCL 1NR4A 4A3MG 4IUVA 5IP7G 2ZT9C 5FLXc 4QQBX 2EPBA 2V4DA 5CV5A 4DV1L 3H0GB 1Q90A 3M3YH 2L11A 5FLXE 2R7FA 4A3CH 3AFQA 1H9KA 3ULLA 3ZJYC 4OX9Q 1B9NA 4OONA 1L1OB 3PIOA 1X3FA 4LF9L 1K73C 4K0KL 4Y52H 2NVTB 3I4NG 5FJ8G 1IBKL 3SHLA 4QMGA 1HTLD 2VL6A 2BE5C 2B8FA 1B3AA 1F9SA 3E0JA 3E9IA 3HKZG 3PV0A 4A3IB 3M7GA 2JA9A 2YTXA 2CVRA 1LTTD 2UXBL 4KD4A 3T13A 1S5DD 2A68C 2B8GA 2X69A 4DR1L 1BQQT 2A6HC 3C1EA 4TVAB 2MO1A 3TS0A 2FFKB 2F0LA 4DV4L 2KHSA 2OTJA 1U9RA 3KK7A 4XYQA 4C3JG 4DR3Q
chains in the Genus database with same CATH topology
1UEBA 4A3IH 4YWKA 4X62L 3I2ZA 1EIFA 4J15A 4L5TA 2JA7H 2CWPA 2NZOA 1VQMA 4QGUA 4LFAL 1PH7A 1HZAA 2LXKA 1XPRA 2Y0SE 1C9OA 4UY8C 1I3QH 2R92H 3S1MH 4HIDA 1C0AA 5ELOA 1CKNA 4L5SA 2N3SA 1R9TH 2QEXA 4GLAC 1VQ8A 4GLVB 4DR6L 2PI2E 2NVTH 2R93H 2K52A 2K75A 4JI1L 2UU9Q 3CCRA 4DK3C 1V43A 3A74A 3UE0A 3E0EA 1JE5A 3CD6A 5ELNA 1T9HA 4BBSG 3GTQH 2VUMG 1QVCA 1HNXQ 2Z0SA 4UP8A 5FLMH 1Q8KA 4X66Q 3FP9A 3KF8B 5H1SE 3HOWH 4P71A 3DM3A 1KD1C 4JI4L 3K8AA 4LF8Q 1SE8A 1Z47A 2AWNA 3RLNA 1X54A 3KFUA 4A93G 5JJIA 5GADC 4BA1I 1VQBA 1CKOA 3PUVA 3U50C 1IL2A 4NPSA 2VZAA 4OWWB 1I50H 4DV7L 1A0IA 4AIMA 3KLWA 3PUZA 1SLJA 4JI4Q 1B70B 4NB3A 3RZOH 1WOCA 4YWMA 1IBML 3H15A 1E3PA 2HT1A 3ERSX 4UP7A 3AEVA 2IY5B 2NVYH 3A5UA 1QZGA 4A3IG 4B3TL 1NMFA 4IFDG 1PYSB 2NN6G 1L1OA 2K4KA 3AQQA 2BA1A 3S1QH 1YHAA 4Y7NH 4A76A 4JYAL 2HIXA 4OX9L 2B3GA 3L2PA 3UDIA 3I4NH 2WP8J 5GAHC 4GNXB 4A3DG 4JI5Q 2ZM6Q 4IPDA 4JYAQ 4O2DA 2UUCL 4BY1H 1GVPA 1YNXA 3RZDH 3NBHB 3S2HH 4KHPQ 2K50A 3HOXH 4NXML 1E1OA 4HIMA 1RL2A 4BBRH 1RIPA 1YZ6A 4LF6Q 2NVXH 2L15A 3J7ZC 4A3MH 1EOVA 2D62A 3GO5A 2ALYB 3H0GH 3K81C 4DV6Q 1PH8A 4A3BG 2VNUD 4BXXH 4DV4Q 3CC2A 2ZJQA 4PZ7A 1HH2P 2YTYA 2VS1A 3JAMi 3CMAA 4DUZL 3BJUA 3S2DH 4IJLA 2EIFA 3K0XA 1TWAH 2VQFQ 1XMOQ 1XMQL 3L0OA 4NXNL 2UXCQ 2IX0A 1VCIA 3GD7A 4LUVA 1NBWA 2BA0A 1HZCA 4MZ9A 3K80C 4R4TA 1Q46A 1QUQA 2K5VA 3I7FA 1YITA 1NTGA 3EIVA 4RG1A 1YJWA 1KQSA 4B3RQ 2UUAQ 4JI6Q 1XPUA 4AQYQ 1LTLA 4L5QA 2QA4A 3M4OH 5C0XJ 1G6PA 1KL9A 4KHZA 4DV0Q 2KCTA 4DAYB 1XNQL 1FL0A 2VY3A 4IPHA 4NXNQ 1VQ7A 1Q1EA 4HIOA 1LYLA 1HNXL 5IWAQ 5IY0A 1OXSC 3KJPA 3I56A 1HZBA 1SFOH 2R93G 4DV6L 1B8AA 1Q7YC 4LF9Q 4ME3A 4HJ9A 4UP9A 2DGYA 2CWAA 2BH2A 1Q1BA 1K3RA 5GROA 2ZTEA 3GTKH 1JMCA 2Z6KC 2KCMA 3PO3G 1EQRA 1L2FA 2VUMH 2K14A 4A3KH 3PF4A 4A3LH 4MNOA 4JI2L 4DK6C 1Y1WH 4JG2A 1XNRQ 3OW2A 3S15H 4IOCA 5IYDG 1SMXA 1V9PA 3BZCA 1Y1VG 2KHIA 3D31A 3E9HA 3PSIA 4DV1Q 1K8GA 4R4OA 2VW9A 1VQ6A 1CSQA 4BY7G 1WI5A 2D0PA 3U4ZA 2UUBL 5IYCG 1X55A 1U5KA 1VQIA 3KJOA 3CCSA 4AYBG 1FGUA 4GOPA 4A3FH 1Y1WG 1VQKA 2OTLA 2Q2UA 3HOYH 3W1BA 5IP9H 3CCLA 2PNHA 4B3SQ 1YEZA 1EIYB 4DV5L 3M4PA 3TREA 2K5HA 4GKKL 2YYZA 1X6OA 2BH8A 3M85A 2E2JH 5JJLA 2JA5H 3CF5A 3T1HL 3PF5A 3BU2A 4LFBQ 4L5RC 1A8VA 2OCEA 1S40A 1PH5A 4XTCS 1XJVA 4GKJQ 4LUOA 4OO1G 1YJNA 4DR4Q 4JBKA 1NE3A 4JC0A 2UUAL 4DR5Q 4JI6L 4DV3Q 3KF6B 3PGZA 3CCMA 4GN5A 4JV5Q 3F8TA 3T1HQ 1KXLA 1WFQA 3LGJA 5C4JH 1IZ6A 1WYDA 3G71A 4C3HH 1WCMG 2LXJA 3UDFA 4EX5A 1KRSA 2KENA 4GOPB 2LSSA 4GOPC 3FKIH 1TWFH 3M9BA 3S24A 5M5WH 2AWOA 4X65L 4LNQA 2I5MX 1UE6A 4DKAC 1C7YA 1JB7A 2MFIA 1PH3A 3BZKA 3MXNB 3JC66 3H0GG 4JI1Q 1VQJA 3RNUA 4A3LG 2EQSA 2FXQA 1OXUA 3GTOH 3I4MH 1D7QA 1VQNA 4A3GH 1XNRL 2XTIA 4YY3Q 4A3CG 3EBEA 4IPGA 2B29A 3CPWA 5GAGC 1K9MC 1M1KC 2UUCQ 2NVQH 2I5LX 5AJ3L 5BR8Q 4POGA 1QVFA 3I4MG 5C4XH 3KOJA 4GNXC 2JEBI 1KIXA 3G6EA 2Q2TA 3HOVH 3A5ZB 4X62Q 4OWTB 4KLKA 4JI3L 3HOUH 1CKMA 2VQEL 5FJ8H 1G291 1HR0Q 1HJPA 1HNZL 1N36L 2E5LL 3HOZH 1YI2A 5C44G 1UE7A 2JE6I 2ES2A 1N9WA 3PIPA 1EUJA 3HOUG 4APVA 2UXBQ 3S16H 2E8GA 4DV7Q 4JV5L 2JA8H 1QUQB 4YHHQ 3HOZG 3CW2C 4YCUA 3ULJA 3RLFA 4AQYL 1PH4A 1FJGQ 4RMFA 4BA2I 2RHQB 3F2DA 1A63A 2N8NA 4ALPA 2AHOB 1CUKA 3OTOL 1K8AC 3HKZE 1IYJB 1CSPA 4UPAA 3W1GA 4POFA 4BBSH 5IYBH 4QY7A 1PH9A 2JA6H 4GS3A 5FLMG 4QJFA 2F3IA 2F4VL 3NENA 1X3EA 1KC8C 3HOWG 2UXCL 3HFZB 5GAEC 4PG3A 4C2MH 3GTJH 1ASZA 4JI0Q 3H3VH 3G48A 2JA7G 3KDFA 1SN8A 2N49A 1H95A 4YCWA 2AMCB 3HOYG 1PH6A 4DPGA 4A3GG 2UXDL 4R4CA 3VDYA 1N32L 3KYHC 1YHBA 3U58A 1VQDA 1GD7A 4C3JH 2ASBA 4KHPL 4XIGS 1HR0W 1VS0A 3CCEA 1VQAA 2UUBQ 4R1JA 5M3FG 4WJ3M 1JJGA 3S1RH 4DR6Q 5C4XG 5BR8L 2IHEA 4YY3L 4IPCA 4DR7Q 5E7NA 1JJ2A 4H02A 3CPFA 4KI0A 1OTCA 5M3FH 3CCVA 3CC4A 1KHIA 2PMZE 2Q2HA 2JEAI 3PUXA 2UXDQ 3KF6A 1Z9FA 2WB1G 1IXRA 2R6GA 1LM0A 2ZJPA 4BY1G 5C0XG 1NJIC 4JI0L 1QVGA 4HJ5A 1Y14B 4LF4L 3PO2H 2KHJA 1WCMH 2WAQG 4DV2L 4IFDI 3PO3H 5GQOA 5EAYA 4B3TQ 1DGSA 4P72A 3Q8DA 5HGQA 4A3JG 2Q2IA 2YU9H 4HJAA 1BBUA 5C3EG 4DR2L 4DUYQ 4HIKA 3CAMA 4A4IA 4DR5L 3B6YA 3GDEA 2PQAB 5LMUQ 2CKZB 2HQLA 2RF4A 4P73A 3STBC 3W5OA 1X9NA 3A0JA 1N8RC 2JA6G 5C3EH 4DUYL 4R4IA 4LF5L 4R4QA 2DUDA 4DR4L 4GNXA 2R92G 1I6HH 2RHSB 4A75A 2ZJRA 4JI7L 4LF8L 3K7AH 1N36Q 1X3GA 3TEHB 3CXCA 2K5NA 1O7IA 2A1AA 1MKHA 3ER0A 4DV2Q 3CCUA 2JA5G 1AE3A 3JAMc 4A3FG 3S14H 1VQHA 2B63G 1SR3A 1BVSA 4JBMA 2YV5A 4LF4Q 1G51A 4JOIC 3CMEA 1MIUA 3L7ZC 1YJ9A 1NY4A 1AE2A 1VQGA 1EYGA 3H3VI 1J5EL 1N34L 3K7UC 3CC7A 3J81c 1E22A 4X64Q 3CQZH 2JK8A 4PZ6A 4YWLA 5AJ3Q 1S72A 1N33L 4EQ5A 2WFWA 1YVCA 1HNWQ 1E1TA 3STBD 4FDBA 2A8VA 1P16A 1N34Q 2E2HH 1JT8A 3J81i 1P8LA 3U4VA 2IX1A 1OXTA 5K36G 5JJKA 1J5EQ 1YIJA 1N32Q 3ICEA 1HZ9A 1V1QA 1UWVA 3I4OA 1PH2A 2CCZA 1MJCA 5IWAL 1EQQA 1PA6A 2I5HA 4A3KG 2H5XA 1IBMQ 1W3SA 4AH6A 4BXXG 2V1CC 4P74A 4JOIA 2CQOA 1NMGA 3PUWA 3J7A5 2AKWB 5M3MG 2N78A 2Z6KA 3KDFB 1Y1VH 3M4QA 3UDGA 5HY6A 4JI8Q 4LF6L 3TS2A 1VQEA 2I0QA 1S3OA 3GTPH 1SRUA 3PCOB 4LF5Q 3OTOQ 1PV4A 3F2CA 3PUYA 4JCVE 4B3RL 4OWXB 4YHHL 4DV3L 4JI8L 4WJ4A 2NN6I 1VQ4A 1Q81C 2ID0A 3TRZA 3RN2A 1W2BA 1TWCH 4X66L 1Q12A 2OQKA 1A62A 4MTNA 4PZ8A 3RLOA 3S1NH 2R7DA 2JJQA 1IBLQ 4DV5Q 1VQOA 4IO9A 4QIWE 1XMQQ 1TWGH 2E2IH 3MEFA 4HJ8A 3SGIA 4DUZQ 2ATWA 4A93H 3EN2A 2RCNA 2XGTA 1U0LA 1JJCB 3CP0A 3I55A 5LMNW 4A3EG 1PH1A 2UU9L 4A3DH 2WAQE 4C3IH 1ASYA 2Y0SG 3AFPA 3M7NA 3J80i 1N33Q 1Q86C 1I94L 4X6AH 1GM5A 1BKBA 2EXDA 4X64L 1UE1A 2ZM6L 5LMNL 2JA8G 3DLLA 3F1ZA 3FHWA 3J80c 2GVBA 1VQPA 4DR7L 4P75A 1J6QA 2ZTCA 4GLXA 1KAWA 4LUZA 1EWIA 4IOAA 4LFAQ 5IYDH 3NELA 2PI2A 3T1YQ 1M90C 1GO3E 2ZTDA 2WB1E 5IYBG 4AYBE 4LFCQ 1AH9A 2MNAA 4X65Q 4K0KQ 1E24A 1PVOA 3RR5A 1KRTA 2MQHA 3ULPA 1SROA 2HHHL 5M3MH 2JQOA 4DR1Q 1E7ZA 4B3ML 5DLQE 4JI7Q 4LF7L 2F4VQ 1CKNB 4DV0L 4IJHA 3WWVA 1D8LA 1XNQQ 1PYBA 5C44H 5LMUL 1X65A 2YTVA 2F52A 3CCQA 4OXPA 4BBRG 4DAMA 2C35B 3RN5A 1TWHH 4GN3B 4A3BH 1GKHA 1I5FA 5IE8A 3GTGH 4GKJL 1YBYA 4LF7Q 5M5XH 1L0WA 4LFBL 4DR2Q 1OXVA 3PO2G 1VQ5A 2HIVA 3HOXG 1HNZQ 4JBJA 5JEAJ 1UE5A 4A3EH 1XMOL 4B3SL 4IFDJ 2E5LQ 4LFCL 2IT1A 2GN5A 4A3MG 4DNIA 4GN4B 1HR0L 5IP7G 2QGQA 4NXMQ 5FLXc 1MJEA 4QQBX 3G4SA 4DV1L 4OO1I 1PFSA 1K83H 1X56A 3OYYA 5IT9c 3M3YH 5C0XI 2R7FA 3S17H 4BY7H 4JI2Q 5IYCH 2CFMA 1I94Q 3CCJA 1XTDA 1HNWL 4JI5L 5LMNQ 4A3CH 3AFQA 4JBWA 3ULLA 3ZJYC 3AYHB 4OX9Q 4OONA 4HJ7A 2NZHA 3F2BA 1L1OB 3HKSA 1X3FA 4TQUS 3PIOA 4LF9L 2B63H 1K73C 2R7ZH 1LUZA 3GTMH 3J81j 1TXYA 1PHJA 4YCVA 2D0OA 2OQ0A 3UDXA 4DR3L 4K0KL 4LWCA 4Y52H 3I4NG 1VQCA 3GTLH 4O0AA 5FJ8G 1IBKL 3FKIG 2R7ZG 1VQFA 2PQAA 4QL5A 1IBLL 1QZHA 2VL6A 2MO0A 2OWOA 1L1OC 3NEMA 4A3JH 3E9IA 3IRBA 3TQYA 3HKZG 3PV0A 1XPOA 1VQLA 3HOVG 2JA9A 4PMWA 2YTXA 1OXXK 2KBNA 3UE1A 5M5YH 1Q82C 1B7YB 1FJGL 1WJJA 1YHQA 2UXBL 2IHFA 2A19A 1IBKQ 4GKKQ 2VQFL 4DR1L 1VQ9A 4B3MQ 4TVAB 2MO1A 3TS0A 1FVIA 4LW1A 5J3BA 4DV4L 3D0FA 5IP7H 2VQEQ 2OTJA 4JI3Q 1K0RA 1EFWA 5JEAG 2HHHQ 3T1YL 1BBWA 2GVAA 4DR3Q 5IP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEB A;  4A3I H;  4YWK A;  4X62 L;  3I2Z A;  1EIF A;  4J15 A;  4L5T A;  2JA7 H;  2CWP A;  2NZO A;  1VQM A;  4QGU A;  4LFA L;  1PH7 A;  1HZA A;  2LXK A;  1XPR A;  2Y0S E;  1C9O A;  4UY8 C;  1I3Q H;  2R92 H;  3S1M H;  4HID A;  1C0A A;  5ELO A;  1CKN A;  4L5S A;  2N3S A;  1R9T H;  2QEX A;  4GLA C;  1VQ8 A;  4GLV B;  4DR6 L;  2PI2 E;  2NVT H;  2R93 H;  2K52 A;  2K75 A;  4JI1 L;  2UU9 Q;  3CCR A;  4DK3 C;  1V43 A;  3A74 A;  3UE0 A;  3E0E A;  1JE5 A;  3CD6 A;  5ELN A;  1T9H A;  4BBS G;  3GTQ H;  2VUM G;  1QVC A;  1HNX Q;  2Z0S A;  4UP8 A;  5FLM H;  1Q8K A;  4X66 Q;  3FP9 A;  3KF8 B;  5H1S E;  3HOW H;  4P71 A;  3DM3 A;  1KD1 C;  4JI4 L;  3K8A A;  4LF8 Q;  1SE8 A;  1Z47 A;  2AWN A;  3RLN A;  1X54 A;  3KFU A;  4A93 G;  5JJI A;  5GAD C;  4BA1 I;  1VQB A;  1CKO A;  3PUV A;  3U50 C;  1IL2 A;  4NPS A;  2VZA A;  4OWW B;  1I50 H;  4DV7 L;  1A0I A;  4AIM A;  3KLW A;  3PUZ A;  1SLJ A;  4JI4 Q;  1B70 B;  4NB3 A;  3RZO H;  1WOC A;  4YWM A;  1IBM L;  3H15 A;  1E3P A;  2HT1 A;  3ERS X;  4UP7 A;  3AEV A;  2IY5 B;  2NVY H;  3A5U A;  1QZG A;  4A3I G;  4B3T L;  1NMF A;  4IFD G;  1PYS B;  2NN6 G;  1L1O A;  2K4K A;  3AQQ A;  2BA1 A;  3S1Q H;  1YHA A;  4Y7N H;  4A76 A;  4JYA L;  2HIX A;  4OX9 L;  2B3G A;  3L2P A;  3UDI A;  3I4N H;  2WP8 J;  5GAH C;  4GNX B;  4A3D G;  4JI5 Q;  2ZM6 Q;  4IPD A;  4JYA Q;  4O2D A;  2UUC L;  4BY1 H;  1GVP A;  1YNX A;  3RZD H;  3NBH B;  3S2H H;  4KHP Q;  2K50 A;  3HOX H;  4NXM L;  1E1O A;  4HIM A;  1RL2 A;  4BBR H;  1RIP A;  1YZ6 A;  4LF6 Q;  2NVX H;  2L15 A;  3J7Z C;  4A3M H;  1EOV A;  2D62 A;  3GO5 A;  2ALY B;  3H0G H;  3K81 C;  4DV6 Q;  1PH8 A;  4A3B G;  2VNU D;  4BXX H;  4DV4 Q;  3CC2 A;  2ZJQ A;  4PZ7 A;  1HH2 P;  2YTY A;  2VS1 A;  3JAM i;  3CMA A;  4DUZ L;  3BJU A;  3S2D H;  4IJL A;  2EIF A;  3K0X A;  1TWA H;  2VQF Q;  1XMO Q;  1XMQ L;  3L0O A;  4NXN L;  2UXC Q;  2IX0 A;  1VCI A;  3GD7 A;  4LUV A;  1NBW A;  2BA0 A;  1HZC A;  4MZ9 A;  3K80 C;  4R4T A;  1Q46 A;  1QUQ A;  2K5V A;  3I7F A;  1YIT A;  1NTG A;  3EIV A;  4RG1 A;  1YJW A;  1KQS A;  4B3R Q;  2UUA Q;  4JI6 Q;  1XPU A;  4AQY Q;  1LTL A;  4L5Q A;  2QA4 A;  3M4O H;  5C0X J;  1G6P A;  1KL9 A;  4KHZ A;  4DV0 Q;  2KCT A;  4DAY B;  1XNQ L;  1FL0 A;  2VY3 A;  4IPH A;  4NXN Q;  1VQ7 A;  1Q1E A;  4HIO A;  1LYL A;  1HNX L;  5IWA Q;  5IY0 A;  1OXS C;  3KJP A;  3I56 A;  1HZB A;  1SFO H;  2R93 G;  4DV6 L;  1B8A A;  1Q7Y C;  4LF9 Q;  4ME3 A;  4HJ9 A;  4UP9 A;  2DGY A;  2CWA A;  2BH2 A;  1Q1B A;  1K3R A;  5GRO A;  2ZTE A;  3GTK H;  1JMC A;  2Z6K C;  2KCM A;  3PO3 G;  1EQR A;  1L2F A;  2VUM H;  2K14 A;  4A3K H;  3PF4 A;  4A3L H;  4MNO A;  4JI2 L;  4DK6 C;  1Y1W H;  4JG2 A;  1XNR Q;  3OW2 A;  3S15 H;  4IOC A;  5IYD G;  1SMX A;  1V9P A;  3BZC A;  1Y1V G;  2KHI A;  3D31 A;  3E9H A;  3PSI A;  4DV1 Q;  1K8G A;  4R4O A;  2VW9 A;  1VQ6 A;  1CSQ A;  4BY7 G;  1WI5 A;  2D0P A;  3U4Z A;  2UUB L;  5IYC G;  1X55 A;  1U5K A;  1VQI A;  3KJO A;  3CCS A;  4AYB G;  1FGU A;  4GOP A;  4A3F H;  1Y1W G;  1VQK A;  2OTL A;  2Q2U A;  3HOY H;  3W1B A;  5IP9 H;  3CCL A;  2PNH A;  4B3S Q;  1YEZ A;  1EIY B;  4DV5 L;  3M4P A;  3TRE A;  2K5H A;  4GKK L;  2YYZ A;  1X6O A;  2BH8 A;  3M85 A;  2E2J H;  5JJL A;  2JA5 H;  3CF5 A;  3T1H L;  3PF5 A;  3BU2 A;  4LFB Q;  4L5R C;  1A8V A;  2OCE A;  1S40 A;  1PH5 A;  4XTC S;  1XJV A;  4GKJ Q;  4LUO A;  4OO1 G;  1YJN A;  4DR4 Q;  4JBK A;  1NE3 A;  4JC0 A;  2UUA L;  4DR5 Q;  4JI6 L;  4DV3 Q;  3KF6 B;  3PGZ A;  3CCM A;  4GN5 A;  4JV5 Q;  3F8T A;  3T1H Q;  1KXL A;  1WFQ A;  3LGJ A;  5C4J H;  1IZ6 A;  1WYD A;  3G71 A;  4C3H H;  1WCM G;  2LXJ A;  3UDF A;  4EX5 A;  1KRS A;  2KEN A;  4GOP B;  2LSS A;  4GOP C;  3FKI H;  1TWF H;  3M9B A;  3S24 A;  5M5W H;  2AWO A;  4X65 L;  4LNQ A;  2I5M X;  1UE6 A;  4DKA C;  1C7Y A;  1JB7 A;  2MFI A;  1PH3 A;  3BZK A;  3MXN B;  3JC6 6;  3H0G G;  4JI1 Q;  1VQJ A;  3RNU A;  4A3L G;  2EQS A;  2FXQ A;  1OXU A;  3GTO H;  3I4M H;  1D7Q A;  1VQN A;  4A3G H;  1XNR L;  2XTI A;  4YY3 Q;  4A3C G;  3EBE A;  4IPG A;  2B29 A;  3CPW A;  5GAG C;  1K9M C;  1M1K C;  2UUC Q;  2NVQ H;  2I5L X;  5AJ3 L;  5BR8 Q;  4POG A;  1QVF A;  3I4M G;  5C4X H;  3KOJ A;  4GNX C;  2JEB I;  1KIX A;  3G6E A;  2Q2T A;  3HOV H;  3A5Z B;  4X62 Q;  4OWT B;  4KLK A;  4JI3 L;  3HOU H;  1CKM A;  2VQE L;  5FJ8 H;  1G29 1;  1HR0 Q;  1HJP A;  1HNZ L;  1N36 L;  2E5L L;  3HOZ H;  1YI2 A;  5C44 G;  1UE7 A;  2JE6 I;  2ES2 A;  1N9W A;  3PIP A;  1EUJ A;  3HOU G;  4APV A;  2UXB Q;  3S16 H;  2E8G A;  4DV7 Q;  4JV5 L;  2JA8 H;  1QUQ B;  4YHH Q;  3HOZ G;  3CW2 C;  4YCU A;  3ULJ A;  3RLF A;  4AQY L;  1PH4 A;  1FJG Q;  4RMF A;  4BA2 I;  2RHQ B;  3F2D A;  1A63 A;  2N8N A;  4ALP A;  2AHO B;  1CUK A;  3OTO L;  1K8A C;  3HKZ E;  1IYJ B;  1CSP A;  4UPA A;  3W1G A;  4POF A;  4BBS H;  5IYB H;  4QY7 A;  1PH9 A;  2JA6 H;  4GS3 A;  5FLM G;  4QJF A;  2F3I A;  2F4V L;  3NEN A;  1X3E A;  1KC8 C;  3HOW G;  2UXC L;  3HFZ B;  5GAE C;  4PG3 A;  4C2M H;  3GTJ H;  1ASZ A;  4JI0 Q;  3H3V H;  3G48 A;  2JA7 G;  3KDF A;  1SN8 A;  2N49 A;  1H95 A;  4YCW A;  2AMC B;  3HOY G;  1PH6 A;  4DPG A;  4A3G G;  2UXD L;  4R4C A;  3VDY A;  1N32 L;  3KYH C;  1YHB A;  3U58 A;  1VQD A;  1GD7 A;  4C3J H;  2ASB A;  4KHP L;  4XIG S;  1HR0 W;  1VS0 A;  3CCE A;  1VQA A;  2UUB Q;  4R1J A;  5M3F G;  4WJ3 M;  1JJG A;  3S1R H;  4DR6 Q;  5C4X G;  5BR8 L;  2IHE A;  4YY3 L;  4IPC A;  4DR7 Q;  5E7N A;  1JJ2 A;  4H02 A;  3CPF A;  4KI0 A;  1OTC A;  5M3F H;  3CCV A;  3CC4 A;  1KHI A;  2PMZ E;  2Q2H A;  2JEA I;  3PUX A;  2UXD Q;  3KF6 A;  1Z9F A;  2WB1 G;  1IXR A;  2R6G A;  1LM0 A;  2ZJP A;  4BY1 G;  5C0X G;  1NJI C;  4JI0 L;  1QVG A;  4HJ5 A;  1Y14 B;  4LF4 L;  3PO2 H;  2KHJ A;  1WCM H;  2WAQ G;  4DV2 L;  4IFD I;  3PO3 H;  5GQO A;  5EAY A;  4B3T Q;  1DGS A;  4P72 A;  3Q8D A;  5HGQ A;  4A3J G;  2Q2I A;  2YU9 H;  4HJA A;  1BBU A;  5C3E G;  4DR2 L;  4DUY Q;  4HIK A;  3CAM A;  4A4I A;  4DR5 L;  3B6Y A;  3GDE A;  2PQA B;  5LMU Q;  2CKZ B;  2HQL A;  2RF4 A;  4P73 A;  3STB C;  3W5O A;  1X9N A;  3A0J A;  1N8R C;  2JA6 G;  5C3E H;  4DUY L;  4R4I A;  4LF5 L;  4R4Q A;  2DUD A;  4DR4 L;  4GNX A;  2R92 G;  1I6H H;  2RHS B;  4A75 A;  2ZJR A;  4JI7 L;  4LF8 L;  3K7A H;  1N36 Q;  1X3G A;  3TEH B;  3CXC A;  2K5N A;  1O7I A;  2A1A A;  1MKH A;  3ER0 A;  4DV2 Q;  3CCU A;  2JA5 G;  1AE3 A;  3JAM c;  4A3F G;  3S14 H;  1VQH A;  2B63 G;  1SR3 A;  1BVS A;  4JBM A;  2YV5 A;  4LF4 Q;  1G51 A;  4JOI C;  3CME A;  1MIU A;  3L7Z C;  1YJ9 A;  1NY4 A;  1AE2 A;  1VQG A;  1EYG A;  3H3V I;  1J5E L;  1N34 L;  3K7U C;  3CC7 A;  3J81 c;  1E22 A;  4X64 Q;  3CQZ H;  2JK8 A;  4PZ6 A;  4YWL A;  5AJ3 Q;  1S72 A;  1N33 L;  4EQ5 A;  2WFW A;  1YVC A;  1HNW Q;  1E1T A;  3STB D;  4FDB A;  2A8V A;  1P16 A;  1N34 Q;  2E2H H;  1JT8 A;  3J81 i;  1P8L A;  3U4V A;  2IX1 A;  1OXT A;  5K36 G;  5JJK A;  1J5E Q;  1YIJ A;  1N32 Q;  3ICE A;  1HZ9 A;  1V1Q A;  1UWV A;  3I4O A;  1PH2 A;  2CCZ A;  1MJC A;  5IWA L;  1EQQ A;  1PA6 A;  2I5H A;  4A3K G;  2H5X A;  1IBM Q;  1W3S A;  4AH6 A;  4BXX G;  2V1C C;  4P74 A;  4JOI A;  2CQO A;  1NMG A;  3PUW A;  3J7A 5;  2AKW B;  5M3M G;  2N78 A;  2Z6K A;  3KDF B;  1Y1V H;  3M4Q A;  3UDG A;  5HY6 A;  4JI8 Q;  4LF6 L;  3TS2 A;  1VQE A;  2I0Q A;  1S3O A;  3GTP H;  1SRU A;  3PCO B;  4LF5 Q;  3OTO Q;  1PV4 A;  3F2C A;  3PUY A;  4JCV E;  4B3R L;  4OWX B;  4YHH L;  4DV3 L;  4JI8 L;  4WJ4 A;  2NN6 I;  1VQ4 A;  1Q81 C;  2ID0 A;  3TRZ A;  3RN2 A;  1W2B A;  1TWC H;  4X66 L;  1Q12 A;  2OQK A;  1A62 A;  4MTN A;  4PZ8 A;  3RLO A;  3S1N H;  2R7D A;  2JJQ A;  1IBL Q;  4DV5 Q;  1VQO A;  4IO9 A;  4QIW E;  1XMQ Q;  1TWG H;  2E2I H;  3MEF A;  4HJ8 A;  3SGI A;  4DUZ Q;  2ATW A;  4A93 H;  3EN2 A;  2RCN A;  2XGT A;  1U0L A;  1JJC B;  3CP0 A;  3I55 A;  5LMN W;  4A3E G;  1PH1 A;  2UU9 L;  4A3D H;  2WAQ E;  4C3I H;  1ASY A;  2Y0S G;  3AFP A;  3M7N A;  3J80 i;  1N33 Q;  1Q86 C;  1I94 L;  4X6A H;  1GM5 A;  1BKB A;  2EXD A;  4X64 L;  1UE1 A;  2ZM6 L;  5LMN L;  2JA8 G;  3DLL A;  3F1Z A;  3FHW A;  3J80 c;  2GVB A;  1VQP A;  4DR7 L;  4P75 A;  1J6Q A;  2ZTC A;  4GLX A;  1KAW A;  4LUZ A;  1EWI A;  4IOA A;  4LFA Q;  5IYD H;  3NEL A;  2PI2 A;  3T1Y Q;  1M90 C;  1GO3 E;  2ZTD A;  2WB1 E;  5IYB G;  4AYB E;  4LFC Q;  1AH9 A;  2MNA A;  4X65 Q;  4K0K Q;  1E24 A;  1PVO A;  3RR5 A;  1KRT A;  2MQH A;  3ULP A;  1SRO A;  2HHH L;  5M3M H;  2JQO A;  4DR1 Q;  1E7Z A;  4B3M L;  5DLQ E;  4JI7 Q;  4LF7 L;  2F4V Q;  1CKN B;  4DV0 L;  4IJH A;  3WWV A;  1D8L A;  1XNQ Q;  1PYB A;  5C44 H;  5LMU L;  1X65 A;  2YTV A;  2F52 A;  3CCQ A;  4OXP A;  4BBR G;  4DAM A;  2C35 B;  3RN5 A;  1TWH H;  4GN3 B;  4A3B H;  1GKH A;  1I5F A;  5IE8 A;  3GTG H;  4GKJ L;  1YBY A;  4LF7 Q;  5M5X H;  1L0W A;  4LFB L;  4DR2 Q;  1OXV A;  3PO2 G;  1VQ5 A;  2HIV A;  3HOX G;  1HNZ Q;  4JBJ A;  5JEA J;  1UE5 A;  4A3E H;  1XMO L;  4B3S L;  4IFD J;  2E5L Q;  4LFC L;  2IT1 A;  2GN5 A;  4A3M G;  4DNI A;  4GN4 B;  1HR0 L;  5IP7 G;  2QGQ A;  4NXM Q;  5FLX c;  1MJE A;  4QQB X;  3G4S A;  4DV1 L;  4OO1 I;  1PFS A;  1K83 H;  1X56 A;  3OYY A;  5IT9 c;  3M3Y H;  5C0X I;  2R7F A;  3S17 H;  4BY7 H;  4JI2 Q;  5IYC H;  2CFM A;  1I94 Q;  3CCJ A;  1XTD A;  1HNW L;  4JI5 L;  5LMN Q;  4A3C H;  3AFQ A;  4JBW A;  3ULL A;  3ZJY C;  3AYH B;  4OX9 Q;  4OON A;  4HJ7 A;  2NZH A;  3F2B A;  1L1O B;  3HKS A;  1X3F A;  4TQU S;  3PIO A;  4LF9 L;  2B63 H;  1K73 C;  2R7Z H;  1LUZ A;  3GTM H;  3J81 j;  1TXY A;  1PHJ A;  4YCV A;  2D0O A;  2OQ0 A;  3UDX A;  4DR3 L;  4K0K L;  4LWC A;  4Y52 H;  3I4N G;  1VQC A;  3GTL H;  4O0A A;  5FJ8 G;  1IBK L;  3FKI G;  2R7Z G;  1VQF A;  2PQA A;  4QL5 A;  1IBL L;  1QZH A;  2VL6 A;  2MO0 A;  2OWO A;  1L1O C;  3NEM A;  4A3J H;  3E9I A;  3IRB A;  3TQY A;  3HKZ G;  3PV0 A;  1XPO A;  1VQL A;  3HOV G;  2JA9 A;  4PMW A;  2YTX A;  1OXX K;  2KBN A;  3UE1 A;  5M5Y H;  1Q82 C;  1B7Y B;  1FJG L;  1WJJ A;  1YHQ A;  2UXB L;  2IHF A;  2A19 A;  1IBK Q;  4GKK Q;  2VQF L;  4DR1 L;  1VQ9 A;  4B3M Q;  4TVA B;  2MO1 A;  3TS0 A;  1FVI A;  4LW1 A;  5J3B A;  4DV4 L;  3D0F A;  5IP7 H;  2VQE Q;  2OTJ A;  4JI3 Q;  1K0R A;  1EFW A;  5JEA G;  2HHH Q;  3T1Y L;  1BBW A;  2GVA A;  4DR3 Q;  5IP9 G; 
#chains in the Genus database with same CATH topology
 4A3I H;  4A93 B;  1RF2 D;  1HPC A;  4J15 A;  2XRS D;  2NBF A;  2CWP A;  2DJF C;  1HZA A;  2LXK A;  2Y0S E;  3G7L A;  2VB3 X;  4L5S A;  5CV7 A;  5EGT A;  2PI2 E;  4QIW B;  5ELC A;  2K52 A;  4IUQ A;  2UU9 Q;  4RFB A;  3VR3 A;  1V43 A;  3UE0 A;  1JE4 A;  1D1I A;  2EE1 A;  2FMM A;  4EQP A;  3GP7 A;  4BBS G;  1SNQ A;  1QVC A;  2XVS A;  1HNX Q;  4R8N A;  2CQA A;  3KF8 B;  1PTO F;  1ICW A;  4P71 A;  4U67 3;  4RGT A;  4A93 G;  3RLN A;  1X54 A;  2RQX A;  4L8J A;  1AW7 A;  5GAD C;  1DXM A;  4NPS A;  1X3Q A;  2PMZ B;  1I50 H;  4DV7 L;  5M5Y B;  3PUZ A;  1QOH A;  4CJ1 B;  3BYT B;  5IT9 E;  3H15 A;  1E3P A;  4KJO A;  3AEV A;  5A2Q L;  5ISR A;  1PYS B;  5J1Z A;  2NN6 G;  3AQQ A;  4X3S A;  1YHA A;  4A76 A;  2HIX A;  3RMH A;  1QCB D;  1K3B C;  4CKB A;  1BF4 A;  4N8X 1;  4GNX B;  2F0M A;  2FHT A;  1LV9 A;  4KHP Q;  3S1Q B;  3RZD H;  1CZW A;  4X3U A;  2C9O A;  4BBR H;  4LF6 Q;  2NVX H;  3TP7 A;  1DON A;  3J7Z C;  2D62 A;  2RVL A;  3K81 C;  4HCE A;  3G6J B;  4NKL A;  2ZJQ A;  1HH2 P;  2VS1 A;  3CMA A;  2A68 D;  3BJU A;  4IJL A;  3TZD A;  3S2D H;  3K0Y A;  1XMO Q;  2EY2 A;  1XMQ L;  2K01 A;  1SEB D;  4LUV A;  1D5X C;  4UHV A;  1F9R A;  3ERO A;  1YIT A;  3EIV A;  3BVG A;  1CI3 M;  4JI6 Q;  3GTG B;  2CW0 D;  3CRL C;  5FKA C;  2B2W C;  4RCO A;  4B08 A;  4DAY B;  1XNQ L;  1FL0 A;  4IPH A;  1TWG B;  2EOT A;  1Q1E A;  2F3V A;  1LYL A;  5IWA Q;  1Z7T A;  1OXS C;  1HZB A;  5C4J B;  1Q7Y C;  4HJ9 A;  2JP1 A;  1AZP A;  3FRP B;  5I2X A;  2B2T A;  2EY1 A;  2KCM A;  1EQR A;  2K14 A;  4A3K H;  4TRD A;  3OW2 A;  1BOS A;  3BZC A;  3E9H A;  2B2W A;  2VW9 A;  5D3D A;  1CSQ A;  1TR5 A;  2D0P A;  3U4Z A;  3D6C A;  4GOP A;  4A3F H;  2XRQ D;  3T16 A;  3CCL A;  2JA8 B;  4MIU A;  3S16 B;  1SYD A;  3TRE A;  2BH8 A;  1X3P A;  3HZX A;  5JJL A;  2A69 C;  2JA5 H;  2E2I B;  2K1B A;  4L5R C;  1TII D;  2OCE A;  3FKI B;  1S40 A;  4XTC S;  1Y69 U;  1CA6 A;  4LUO A;  4OO1 G;  4KTA A;  4DR4 Q;  1RCV D;  1ENA A;  3WOE A;  4ZAI A;  4JK1 C;  5EBD A;  3GV6 A;  5K5P A;  3MFG A;  1WTP A;  3T1H Q;  1I4G A;  3LGJ A;  3BDO A;  3DUZ A;  2IW3 A;  1IZ6 A;  3G71 A;  5J22 A;  2A6H D;  4C3H H;  1R9T B;  2LXJ A;  2LSS A;  4GOP C;  5M5W H;  3N52 A;  4X65 L;  4LNQ A;  2I5M X;  2AUJ D;  2MFI A;  3BZK A;  2EJF C;  5EKI A;  2B2Y C;  3JC6 6;  3NUC A;  4A3L G;  2EQS A;  4K8I A;  3GTO H;  3VA5 A;  1VQN A;  3I4M H;  1D7Q A;  1XNR L;  3RD4 A;  2F3W A;  1JQY D;  4YY3 Q;  4DAP A;  4IPG A;  4WRD A;  2JN4 A;  5AJ3 L;  4DNT B;  3I4M G;  3S2D B;  3PO2 B;  4IN3 A;  1SNC A;  3KOJ A;  1U4M A;  2AUK A;  2JEB I;  1G2T A;  1KIX A;  3G6E A;  3A5Z B;  2MHV A;  4X62 Q;  2NVX B;  4KLK A;  1WVL A;  3HOU H;  4ZK9 B;  4BBR B;  1HR0 Q;  1G29 1;  3KLS A;  3SXH A;  1HNZ L;  3K6O A;  3RZD B;  1N36 L;  1B9M A;  2ES2 A;  3HOU G;  3PIP A;  1KTK A;  4JV5 L;  2JA8 H;  3ULJ A;  2B63 B;  5JOB A;  2K5Q A;  4AQY L;  1FJG Q;  4KMU C;  2HDL A;  3QB3 A;  3F2D A;  1JWS D;  2AHO B;  2I46 A;  1K8A C;  4UPA A;  1CSP A;  3M4O B;  1TY2 A;  1WTR A;  1LTS D;  2EYF A;  2MP1 A;  4GS3 A;  3H6M A;  5FO9 B;  3BG3 A;  5DEH A;  3HFZ B;  5GAE C;  4DA2 A;  2HCI A;  4EGV A;  3KDF A;  1SN8 A;  2N49 A;  1H95 A;  4YCW A;  2UXD L;  3VDY A;  1IKL A;  1VQD A;  1GD7 A;  5EPK A;  4C3J H;  1A15 A;  3CCE A;  1RHP A;  5ELE A;  3S1R H;  5E4W C;  4DFA A;  4DR6 Q;  3OMC A;  4DR7 Q;  1Y8P B;  1JJ2 A;  3S2H B;  2B2V A;  3CPF A;  3CC4 A;  2JEA I;  5CV4 A;  2Q2H A;  1FD7 D;  3PUX A;  5L37 A;  1Z9F A;  2R6G A;  1JB3 A;  1QVG A;  4LF4 L;  3LWU A;  3PO2 H;  4M8A A;  4IFD I;  1JWM D;  3V96 A;  4DV2 L;  5EAY A;  1Z6H A;  1DGS A;  5HGQ A;  2YU9 H;  5M3M B;  4F88 A;  3T56 B;  1F2M A;  4HIK A;  3TN2 A;  3CAM A;  2Z9H A;  1EY6 A;  1V1O A;  1BCP C;  2EJG C;  2MJ8 A;  2F0F A;  3JAM L;  5E3F A;  3NQI A;  4K14 A;  4KY6 A;  1CA5 A;  1X9N A;  1B53 A;  3W2D A;  2JA6 G;  2PZW A;  4LF5 L;  3HOW B;  4DR4 L;  2F0H A;  2Z4H A;  4GNX A;  2AQ2 B;  1I6H H;  2EYM A;  2RHS B;  3URY A;  3J80 E;  5KEE A;  4JI7 L;  3K7A H;  1II3 A;  4DGZ A;  3TEH B;  2K5N A;  4RKL A;  1EU4 A;  1FGB D;  3ER0 A;  1UUP A;  2DJG C;  4KKS A;  3H3V C;  1AE3 A;  2F0E A;  1STY A;  2OF1 A;  3S14 H;  1BVS A;  1G51 A;  1SE4 A;  3CME A;  2EYL A;  3TSS A;  1VQG A;  1F2Y A;  1J5E L;  3K7U C;  5KNB A;  4FF1 A;  4MN3 A;  5CGK A;  1LTR D;  1EY5 A;  4PZ6 A;  1GUT A;  1HNW Q;  1E1T A;  5ELD A;  3I3C A;  4XQN A;  2E2H H;  4E6I A;  3J81 i;  2IX1 A;  3U4V A;  4CKE A;  1I4P A;  2R92 B;  1E2Z A;  5JJK A;  1D1K A;  3GTP B;  1I4R A;  4S3S A;  1SNP A;  2D9U A;  4RWS C;  3I4O A;  1J9O A;  1I6H B;  2I5H A;  4FXG C;  4AH6 A;  2SNS A;  2A69 D;  2V1C C;  3PUW A;  5LHY 1;  4ZRZ A;  2AKW B;  5M3M G;  2N78 A;  2Z6K A;  3M4Q A;  4IFD H;  1LAC A;  3GTP H;  3A7A B;  1MGS A;  4LF5 Q;  3OTO Q;  3PUY A;  4JCV E;  4B3R L;  4WJ4 A;  2NN6 I;  3TRZ A;  2WB1 B;  1WCM B;  3RN2 A;  1PFM A;  1W2B A;  4PZ8 A;  4KKT A;  2R7D A;  2JJQ A;  3MAQ A;  4XQQ A;  4DV5 Q;  1VQO A;  3SGI A;  4DUZ Q;  4TKO B;  2RCN A;  3EN2 A;  5M3F B;  4WJ3 M;  1PH1 A;  2UU9 L;  2K33 A;  1JOR A;  4C3I H;  2Y0S G;  5FOB B;  3M7N A;  2PO4 A;  3HOY B;  3S17 B;  2A6E D;  1I94 L;  3K57 A;  1EYA A;  1XWE A;  4X6A H;  3L3O C;  5LMN L;  5K36 H;  4A3L H;  3HEJ A;  3NPP A;  4DR7 L;  3J80 c;  3OOC A;  1VQP A;  5G3L F;  1J6Q A;  1KAW A;  2EVB A;  4BY7 B;  3NEL A;  2K03 A;  1UNS A;  4AYB E;  2MNA A;  1ICF B;  4X65 Q;  2MQH A;  4JW0 A;  1SRO A;  2HHH L;  3KUP A;  1WTV A;  4DR1 Q;  1TS2 A;  3DXJ C;  4R9W A;  3WWV A;  2XNA C;  1K8M A;  1PYB A;  3I72 A;  4OXP A;  4DAM A;  2KEC A;  1H9S B;  1TWH H;  1CTM A;  4GKJ L;  1YBY A;  4DR2 Q;  2B39 A;  5JEA J;  3M3Y B;  4B3S L;  2IT1 A;  5IOC A;  1SDF A;  3TBI B;  1HR0 L;  2O2L D;  4NXM Q;  3OIP A;  3QR8 A;  3KBX A;  3G4S A;  4PMC A;  4FF2 A;  1LTG D;  4OO1 I;  1QWY A;  3S17 H;  4JI2 Q;  1PZK D;  5IYC H;  1XTD A;  1HNW L;  4JI5 L;  4K2L A;  3PQI A;  5LMN Q;  5KYI A;  3IL8 A;  4M1U B;  5IGD A;  3I8Z A;  5FLX L;  3U9S A;  3F2B A;  2B63 H;  2R7Z H;  1E2W A;  3GTM H;  1TXY A;  4YCV A;  4A3D B;  4LWC A;  5LL6 X;  4P2C B;  1VQC A;  4O0A A;  3FKI G;  1HA5 A;  2R7Z G;  1KDA A;  2F0K A;  2PQA A;  1WD0 A;  1IBL L;  1QZH A;  4N8F A;  2MO0 A;  1D6E C;  2OWO A;  4OEL B;  4LJZ C;  3HOV G;  3J80 L;  1MSG A;  3EFX D;  2RDH A;  4B3M Q;  4JPB W;  5J3B A;  4JVZ A;  3T1Y L;  1BBW A;  4N9P A;  1UEB A;  1JWU D;  1SE2 A;  3I2Z A;  2NZO A;  1VQM A;  4QGU A;  1C9O A;  1C0A A;  1I3Q H;  1ET9 A;  2R93 B;  4C3H B;  2QEX A;  1R9T H;  4FF4 A;  5KYL A;  4H44 C;  4DR6 L;  2NVT H;  2QW7 A;  2H4O A;  4JI1 L;  4IQZ A;  3CQZ B;  4PV1 C;  4QB4 A;  3A74 A;  5KRU A;  3E0E A;  1JE5 A;  4K8J A;  2OXP A;  2VUM G;  2Z0S A;  4X66 Q;  5HGT A;  3SK4 A;  4H0L C;  4L63 B;  3DM3 A;  1KD1 C;  3K8A A;  5JJI A;  1Z47 A;  4BA1 I;  1VQB A;  3PUV A;  1PRT D;  4J6H A;  2WV6 D;  1A0I A;  2K04 A;  1ILQ A;  4NB3 A;  3QJY A;  4O42 A;  2NVY H;  3A5U A;  1QZG A;  1NMF A;  2QDL A;  1HRJ A;  1L1O A;  1HUM A;  2K4K A;  3S1Q H;  1GUG A;  3TDQ A;  2B3G A;  4YIJ A;  1HTP A;  3UDI A;  2FMC A;  3QOL A;  3NTK A;  2WP8 J;  4J1M A;  1PLF A;  4QUF A;  1TU2 B;  2F03 A;  4JI5 Q;  1W6K A;  4BY1 H;  3NBH A;  1GVP A;  3HOX H;  1SYC A;  4KK7 A;  2L15 A;  4A3M H;  3GO5 A;  4DV6 Q;  4A3B G;  2VNU D;  1PH8 A;  4ZYS A;  3ERQ A;  4BXX H;  3CC2 A;  2YTY A;  4DUZ L;  2EIF A;  3K0X A;  1TWA H;  3X3M A;  5J39 A;  2NTT A;  2IX0 A;  2NTS A;  2NYZ D;  5M9O A;  1ZYR D;  1NBW A;  1HZC A;  1Q46 A;  3I7F A;  1NTG A;  4RG1 A;  1BUV T;  3DM1 A;  1M4V A;  4HN7 A;  1XPU A;  3FVQ A;  4L5Q A;  3MC0 B;  4BBS B;  5C0X J;  4KHZ A;  2KCT A;  1ZXT A;  4NXN Q;  1VQ7 A;  4HIO A;  3S1R B;  4HSP A;  3I56 A;  1TWC B;  3S1N B;  2QF7 A;  2R93 G;  3K5N A;  5KGU A;  2PPB C;  5IGF A;  2BH2 A;  1K3R A;  1FNV A;  3D6W A;  5GRO A;  4XQJ A;  3GTK H;  3D4R A;  1ML0 D;  4XYO A;  1JMC A;  3PO3 G;  1L2F A;  1EY7 A;  4KV6 A;  4JI2 L;  1BCP D;  2CW0 C;  4JG2 A;  1S4Z A;  1XXG A;  4ZLT F;  1SMX A;  1V9P A;  2A74 C;  4IOC A;  3HRZ C;  1U4R A;  1VQ6 A;  3ZYY X;  2UUB L;  5IYC G;  3BDC A;  3CCS A;  2OTL A;  1STG A;  3C2P A;  2Q2U A;  1B4O A;  3W1B A;  2D2C C;  4LMQ D;  4B3S Q;  3HOV B;  1YEZ A;  4I65 A;  2K7V A;  4V19 0;  2PZU A;  2EYJ A;  2EJM A;  1TS4 A;  4ULL A;  2K5H A;  4IUN A;  2YYZ A;  3M85 A;  2E75 C;  5JEA H;  3PF5 A;  4LFB Q;  1A8V A;  5FO7 B;  1EYC A;  1NR2 A;  1XJV A;  1PH5 A;  3A7L A;  2KCC A;  1PTO H;  1YNJ D;  4JC0 A;  4DV3 Q;  3KF6 B;  3PGZ A;  4DN4 M;  3CCM A;  3F8T A;  4QCL A;  3WOF A;  1SFO B;  1BBX C;  1CFM A;  1KRS A;  5I9P A;  4GOP B;  2IJ0 A;  3AMU A;  2EXZ A;  3VR6 A;  1C7Y A;  3VYR A;  1HFG A;  2E2J B;  2ZXO A;  1YNN C;  3H0G G;  3U9O A;  3FPU B;  2C5C A;  1XTC D;  2FJ2 A;  1OXU A;  5JAV A;  4A3K B;  2O4X A;  2NVQ H;  2B29 A;  1K9M C;  1M1K C;  1KLU D;  1RKN A;  1KAA A;  3KLR A;  4DK1 A;  4POG A;  1L0Y B;  2H1E A;  3DEP A;  1QVF A;  1KDB A;  5CYU A;  2L4N A;  1L0X B;  4GNX C;  1ENC A;  1SYF A;  2Q2T A;  3N6R A;  2CH4 W;  4OWT B;  2RDF A;  4JI3 L;  1SYB A;  2VQE L;  1DZ1 A;  1GXD C;  3ND9 A;  2JE6 I;  2Z8L A;  1R4Q B;  1MI2 A;  2F0V A;  1S5C D;  3OWE B;  1EUJ A;  4F87 A;  4G7H C;  1HQR D;  4PMB A;  4DF7 A;  3S16 H;  1ZYR C;  4DV7 Q;  3J81 L;  2KUM A;  1JC7 A;  1I6V C;  4YCU A;  1K0S A;  1PH4 A;  1RJT A;  4A3F B;  3P75 A;  2N8N A;  5EKK A;  1CUK A;  4PNY A;  3J7Y W;  1SYE A;  1IYJ B;  1TS5 A;  4BBS H;  2EDG A;  1PH9 A;  2KVM A;  4CGY B;  2JA6 H;  1BDO A;  3NEN A;  1EIH A;  1X3E A;  1EY0 A;  2WKD A;  1K83 B;  4C2M H;  3RZO B;  5CV8 A;  2QEJ C;  3JAM E;  4DU9 A;  2J7Z A;  4ME5 A;  3HOY G;  4DPG A;  4A3G G;  1N32 L;  2FIN B;  1YHB A;  3A56 A;  3U58 A;  1CZG A;  1ET6 A;  5M3F G;  4FVM A;  2K6A A;  4C1N I;  1IYU A;  3DEO A;  5BR8 L;  2IHE A;  3K58 A;  1EY8 A;  1IL8 A;  5E7N A;  4H02 A;  2TSS A;  2KQ3 A;  1OTC A;  5M3F H;  1TT2 A;  2WB1 G;  4MTK A;  1LM0 A;  2NVY B;  4BY1 G;  1NJI C;  1Y14 B;  1DOL A;  5C4X B;  3I4L A;  1WCM H;  1T5E A;  2XN9 C;  1QNK A;  3Q8D A;  4EVO A;  3TME A;  4HJA A;  1STB A;  4DR2 L;  2RSN A;  5D14 A;  3S1M B;  4A3G B;  2JA7 B;  2RF4 A;  3W5O A;  2PW7 A;  3C3L A;  4R4I A;  4R4Q A;  2R92 G;  1HQM C;  2ZJR A;  1WTX A;  1X3G A;  3SEB A;  4G7O C;  3PMF A;  3KF8 A;  2K28 A;  1E0B A;  2JYO A;  3VYT A;  5CBA E;  2JA5 G;  1VQH A;  1CT1 D;  3HOZ B;  2YV5 A;  1YJ9 A;  1MIU A;  2EYP A;  3P20 A;  1G6Z A;  5F2D A;  3CC7 A;  1E22 A;  4X64 Q;  2RBM A;  1PTO D;  4C3I G;  5AJ3 Q;  1AP0 A;  2WFW A;  1YVC A;  4WJW A;  2BDN A;  3GTL B;  1JT8 A;  4K5W A;  5K36 G;  3SK8 A;  4ABN A;  1I3Q B;  2D5D A;  1J5E Q;  5DM7 3;  3H94 A;  4K5V A;  1LT5 D;  1V1Q A;  5IOD A;  2CCZ A;  5CV6 A;  1MJC A;  1WD1 A;  4A3K G;  1IBM Q;  1SNM A;  2R61 A;  4BXX G;  2CQO A;  2SNM A;  3J7A 5;  3KDF B;  2CH4 A;  3ND8 A;  3TS2 A;  1VQE A;  2JSO A;  4K6D A;  1PV4 A;  5IGB A;  4OWX B;  4DV3 L;  2N88 A;  2PYK A;  1KDC A;  3D3R A;  2BCO A;  2OQK A;  1DOM A;  2F0S A;  1SBB B;  1QE6 A;  1IBL Q;  1XMQ Q;  3WDN A;  4A93 H;  1U0L A;  3CP0 A;  3BZD B;  2WAQ E;  3CRK C;  5JPM C;  3J80 i;  1Q86 C;  2EXD A;  4X64 L;  1UE1 A;  2HUG A;  1O7Y A;  4OEM B;  3DLL A;  4P75 A;  2ZTC A;  1GO3 E;  2J4X A;  4ILW A;  5IYB G;  4HMI A;  1E24 A;  1SE3 A;  2JQO A;  5KNC A;  1E7Z A;  5DLQ E;  5DM6 3;  2F4V Q;  1CKN B;  4DV0 L;  3R3O A;  2R3Z A;  1XNQ Q;  3FEW X;  1RD9 D;  1T5X D;  2F52 A;  3CCQ A;  1EZ6 A;  1ROD A;  4BBR G;  1LLR D;  5EPL A;  3RN5 A;  1STN A;  5IE8 A;  2M9V A;  1L0W A;  1OXV A;  3PO2 G;  4RAU C;  1HNZ Q;  1UE5 A;  4NW2 A;  4A3E H;  1XMO L;  1DYQ A;  1AEX A;  2GN5 A;  4GN4 B;  2QGQ A;  4ZUJ A;  2IPK D;  1CHP D;  1X56 A;  1ZKO A;  2G9H D;  3OYY A;  3QG1 A;  3IAY A;  1IW7 D;  2CFM A;  4WFN 3;  3CCJ A;  1O7L A;  1DCZ A;  1K8O A;  3J7A V;  2NZH A;  5DNF A;  3HKS A;  5M5W B;  5C4Z A;  1O80 A;  3DHQ A;  5D65 A;  2OQ0 A;  5A2Q E;  4DR3 L;  4IAL A;  3GTL H;  1VQF A;  3F2U A;  4QL5 A;  3ITP A;  1S5F D;  4CDF C;  3FDT A;  2NWG A;  1RDP D;  4ZKB B;  3IRB A;  1F9P A;  1XPO A;  3UE1 A;  4PMW A;  2KBN A;  3R93 A;  1YHQ A;  2IHF A;  1C4Q A;  2A19 A;  1B2T A;  1JOQ A;  4X3K A;  1FVI A;  4LW1 A;  3D0F A;  4JI3 Q;  4ID6 A;  1BNZ A;  2EY6 A;  5IP9 G;  1Q3L A;  4K0K Q;  2Q8I B;  4IZ8 A;  2GA4 B;  5I6Y A;  2KCN A;  1XPR A;  3S1M H;  3IFT A;  5ELO A;  3E5S A;  3VYU A;  4KY5 A;  5CR3 A;  2F0U A;  4KHV A;  1PDQ A;  2K75 A;  5EJW A;  4DK3 C;  1S5B D;  3CD6 A;  1T9H A;  2K5W A;  3QWN A;  3K7A B;  3GTQ H;  5FLM H;  1Q8K A;  2WIN B;  3FP9 A;  5H1S E;  3HOW H;  3I70 A;  3KFU A;  2L5T A;  2PZT A;  3DMU A;  5CMD A;  1CKO A;  3U50 C;  2XWJ B;  4AIM A;  4JI4 Q;  1SLJ A;  2IL8 A;  1B70 B;  1STH A;  3Q0A A;  2B2T C;  3RZO H;  1ENF A;  4FYD A;  1WOC A;  1ZEQ X;  3LWE A;  2RA4 A;  1H9M A;  4EQN A;  1SND A;  2F1M A;  4IFD G;  2BA1 A;  2Q8R E;  1D2B A;  3NK9 A;  3GTM B;  2R7Z B;  1PXU A;  1SNO A;  3MA2 B;  3I4N H;  3MXG A;  4OL7 A;  4ZKC B;  5GAH C;  3NHH A;  1NAP A;  2ZM6 Q;  1F9Q A;  2UUC L;  2K50 A;  3OW7 A;  4NXM L;  1E1O A;  1RIP A;  1YZ6 A;  4CHT B;  1YNN D;  1KAB A;  3R2T A;  2EYH A;  4X3T A;  4RCN A;  4DV4 Q;  4RA8 A;  1CHQ D;  3W3A A;  4PZ7 A;  4KY7 A;  2ENB A;  2VQF Q;  3L0O A;  4NXN L;  3TP6 A;  1VCI A;  2BA0 A;  3K80 C;  4R4T A;  1KQS A;  4CDC C;  4B3R Q;  4QUC A;  4AQY Q;  3KBG A;  4H7B A;  2QA4 A;  3M4O H;  4DV0 Q;  1SMY C;  4DAY A;  2X6G A;  3SE0 A;  3KJP A;  4BS9 A;  1SFO H;  3SK5 A;  2F0T A;  4LF9 Q;  1TVX A;  1EU3 A;  4UP9 A;  2DGY A;  2CWA A;  2F0O A;  1Q1B A;  4HSV A;  2Z6K C;  2KEE A;  5LL6 S;  5ELF A;  2VXW A;  3A8I E;  1EWC A;  4G7Z C;  4LAA A;  1OO9 B;  4DK6 C;  2F0W A;  1XNR Q;  5E4X A;  1K8G A;  1Y1V G;  3D31 A;  3PSI A;  3NTH A;  3Q6S A;  3VA7 A;  4R4O A;  4DV1 Q;  1WI5 A;  3NSW A;  3KJO A;  1U5K A;  2QDB A;  2MGS A;  2NZ1 D;  1FGU A;  3CHB D;  4AYB G;  1PFN A;  3D4D A;  2PNH A;  1TQO A;  1TS3 A;  3Q23 A;  1AFP A;  3M4P A;  2I07 B;  3OWF A;  1EZ8 A;  1X6O A;  2Y0S B;  2E2J H;  1VF7 A;  2WAC A;  2DNC A;  3BU2 A;  5BN3 A;  4GKJ Q;  5KND A;  5JJZ A;  4JI6 L;  3EVQ A;  4NP5 A;  2L55 A;  1WFQ A;  2E76 C;  4KN4 C;  1WYD A;  3FMC A;  1GUO A;  3UDF A;  2KEN A;  3FKI H;  3M9B A;  2K05 A;  1JB7 A;  1PH3 A;  1HUN A;  3MXN B;  3MXN A;  1KNE A;  2F0P A;  4JI1 Q;  3RNU A;  2FXQ A;  4OIJ A;  4IUU A;  5NUC A;  4A3G H;  5C6A A;  3GV3 A;  2XTI A;  2IX3 A;  3EBE A;  3CPW A;  5TSS A;  1EY4 A;  4RGO S;  1TWA B;  2E2H B;  2AQ3 B;  1LO5 D;  4IUP A;  3BVM A;  1CKM A;  1HJP A;  2RSO A;  3HOZ H;  3O13 A;  5C44 G;  1U4L A;  1UE7 A;  2F0J A;  2HQE A;  4KJN A;  2E2D C;  2E8G A;  1QUQ B;  4YHH Q;  3HOZ G;  1PTO C;  3RLF A;  4BA2 I;  1STA A;  2RHQ B;  1A63 A;  4RHR A;  2B2Y A;  4FP5 D;  4ALP A;  1ONL A;  3HKZ E;  1W6J A;  4POF A;  2K5D A;  3Q22 A;  1HHV A;  4K6L A;  4OGQ C;  4FO2 A;  4QJF A;  2F3I A;  4J8Q A;  1KLG D;  4EQO A;  3NTI A;  2UXC L;  3AB9 A;  1ASZ A;  3G48 A;  2JA7 G;  1EOT A;  1PH6 A;  3HP3 A;  4R4C A;  5IGG A;  3KYH C;  1TY0 A;  2KED A;  5I4D A;  1ESF A;  4PQX A;  4XIG S;  1HR0 W;  2UUB Q;  1JJG A;  2QKI C;  5C4X G;  4YY3 L;  2JXM B;  1QG7 A;  3V05 A;  1A2T A;  4Y7N B;  4BY1 B;  2QIL A;  3QIA A;  1V1P A;  4KKU A;  4KI0 A;  1D5Z C;  3CCV A;  1KHI A;  1LT3 D;  3KF6 A;  3S9W A;  2SEB D;  3A54 A;  4HJ5 A;  1VDZ A;  3OIQ A;  1DM0 B;  3PIO 3;  1ILP A;  2WAQ G;  3A55 A;  3PO3 H;  1S5E D;  5GQO A;  4P72 A;  5COR A;  4A3J G;  3NXW A;  2Q2I A;  4C2M B;  4RKB A;  1BBU A;  5C3E G;  1GJX A;  4DUY Q;  2LFN A;  4A4I A;  4FXD A;  4DR5 L;  3B6Y A;  3DWA A;  3GDE A;  3P7J A;  3BS1 A;  2CKZ B;  2CHB D;  3A0J A;  5C5M A;  5C5L A;  5C3E H;  5JVG 3;  4DUY L;  2DUD A;  1I4X A;  4UAI A;  4HED A;  4KD3 A;  4A75 A;  4LF8 L;  3E3X A;  1B44 D;  5CV9 A;  4DV2 Q;  3CCU A;  4A3F G;  1GOZ A;  1GHK A;  4JBM A;  4LF4 Q;  3L7Z C;  1O78 A;  2IWH A;  3HG9 A;  4C1N K;  1EYG A;  4ODG A;  1QB5 D;  2QCP X;  4XT3 B;  5BN5 A;  4RHS A;  1U4P A;  5A35 A;  1GUN A;  1MSH A;  3CQZ H;  4YWL A;  4EQ5 A;  4OO1 H;  3EA6 A;  2A8V A;  1P16 A;  1N34 Q;  1CK1 A;  1UAP A;  2DY8 A;  1NUC A;  1P8L A;  1OXT A;  3IFD A;  3ONA B;  1YIJ A;  1LTB D;  1N32 Q;  3ICE A;  2NB0 A;  1BXT A;  1A2U A;  5IWA L;  1PA6 A;  2J0T D;  1W3S A;  4JOI A;  1NMG A;  5C3E B;  2I0Q A;  2N55 A;  3OMG A;  3F2C A;  2MPM A;  3MVV A;  4YHH L;  2A73 B;  1VQ4 A;  1Q81 C;  2KA7 A;  5KIX A;  1PMR A;  4X66 L;  3S1N H;  4MTN A;  1PTO B;  4Z9C B;  2B2U A;  3MEF A;  4HJ8 A;  2ATW A;  4DXG A;  5EQ0 A;  4LF6 L;  2XGT A;  4A3E G;  3I55 A;  1XYI A;  4A3D H;  4BWG B;  1ASY A;  4H13 C;  1RTO A;  2KJX A;  3DWP A;  3NWS A;  4DNR B;  1BKB A;  1NNX A;  2JA8 G;  3FHW A;  5I9O A;  1BR9 A;  4GLX A;  4LUZ A;  4FNF A;  3GTJ B;  2PI2 A;  3T1Y Q;  3VR4 A;  1M90 C;  2AQ1 B;  2SOB A;  3RR5 A;  1PVO A;  2WII B;  1SJH D;  3PO3 B;  3TZU A;  1GUW A;  1H9J A;  4IJH A;  2XWB B;  1YNJ C;  5C44 H;  4DK0 A;  4HMJ A;  5I2Y A;  3LNN A;  4O1N A;  1PZI D;  4A3B H;  1GKH A;  3M4Y A;  1WTO A;  2OT2 A;  4LF7 Q;  5M5X H;  2DNE A;  1F77 A;  4LFB L;  1DJR D;  2HIV A;  4JBJ A;  1D5M C;  1BO0 A;  3NWT A;  4IFD J;  3SVM A;  2E5L Q;  3BVZ A;  1G2S A;  4DNI A;  4I7A A;  3FPP A;  3R8B A;  4F7X A;  1MJE A;  1JOO A;  1PFS A;  1K83 H;  2WKC A;  5IT9 c;  5C0X I;  1CM9 A;  4BY7 H;  2X6L A;  3Q24 A;  1I94 Q;  5JVH 3;  3D4W A;  3E6Z X;  5HUR A;  4A3B B;  3K5L A;  4JBW A;  3AYH B;  2ZXR A;  3T53 B;  4HJ7 A;  1MD2 D;  1LAB A;  4TQU S;  1A3V A;  1LUZ A;  3J81 j;  1EIG A;  3I73 A;  1PHJ A;  3UDX A;  2D0O A;  3H09 A;  1Y8O B;  2ZXP A;  4NDX A;  1GUS A;  4ZQ3 A;  2Q8T A;  4RGN A;  3EQL C;  2VB2 X;  1PYW D;  4RGM A;  1L1O C;  5EBC A;  3NEM A;  4A3J H;  1DD2 A;  3TQY A;  4HCS A;  1VQL A;  1OXX K;  5M5Y H;  1Q82 C;  1FJG L;  2RCF A;  1B7Y B;  1E2V A;  1WJJ A;  3S14 B;  2OEO A;  4AYB B;  1IBK Q;  4GKK Q;  2VQF L;  3MFY A;  1VQ9 A;  2NVQ B;  1Y1V B;  5IP7 H;  2VQE Q;  2O5J C;  1K0R A;  1EFW A;  5JEA G;  2HHH Q;  4V0B A;  2GVA A;  1G8Z D;  4FF3 A;  4YWK A;  4X62 L;  1EIF A;  4L5T A;  2JA7 H;  2PCF B;  4LFA L;  1A3U A;  1PH7 A;  4UY8 C;  2R92 H;  2VUM B;  4HID A;  2NUC A;  1CKN A;  2N3S A;  2PQE A;  1VQ8 A;  4GLA C;  2SDF A;  1EQT A;  3HGB A;  3VR2 A;  1STE A;  4GLV B;  5ELB A;  1SMY D;  2R93 H;  1VF5 C;  1JR0 D;  1TKW B;  3CCR A;  1B3Q A;  2MUY A;  2M00 A;  5ELN A;  4C3H G;  3MTS A;  3MHB A;  1WTQ A;  4UP8 A;  1B50 A;  4JI4 L;  4LF8 Q;  1SE8 A;  1C48 A;  2AWN A;  5DAU A;  2LKV A;  5IT9 L;  4I7Z C;  1IL2 A;  4C3J B;  3NQT A;  2VZA A;  4OWW B;  4G4K A;  1BCP F;  4XXE A;  2TMP A;  2B2V C;  3KLW A;  3T4A C;  5T1G A;  2BDO A;  4YWM A;  1IBM L;  2HT1 A;  3ERS X;  4UP7 A;  2IY5 B;  5JPN C;  1EL0 A;  4B3T L;  3HKZ B;  3NBI A;  4A3I G;  3LX0 A;  2XIW A;  5C4H A;  4CJ0 B;  2PW5 A;  1I4Q A;  4Y7N H;  1MBY A;  4HTH A;  3MZ5 A;  4JYA L;  4OX9 L;  3L2P A;  5T1I A;  3GQB A;  3I4N B;  4CDD C;  4A3D G;  3EJI A;  1PRT B;  4IPD A;  4JYA Q;  4O2D A;  5C0X H;  3S2H H;  1YNX A;  3NBH B;  5COY A;  4HIM A;  1RL2 A;  1I4H A;  4U68 A;  1EOV A;  3H0G H;  2ALY B;  1AN8 A;  1NCV A;  3JAM i;  2UXC Q;  3GD7 A;  4MZ9 A;  1QUQ A;  2K5V A;  1YJW A;  1BCP B;  1PFB A;  2RDG A;  2UUA Q;  4A3M B;  1LTL A;  3UI2 A;  5EPJ A;  2L9H A;  1G6P A;  1KL9 A;  3HOX B;  1ESR A;  1IKM A;  5C3W A;  5CBE E;  5IGC A;  2VY3 A;  1QJO A;  1M8A A;  1HNX L;  5IY0 A;  3BDL A;  4DV6 L;  1B8A A;  4ME3 A;  4KN7 C;  2Z4I A;  4UDU C;  1EY9 A;  3A8J E;  4IUT A;  1EEI D;  2ZTE A;  2ICI A;  2VUM H;  3PF4 A;  1G91 A;  4MNO A;  2O5I C;  3K5M A;  1Y1W H;  3S15 H;  4R8I A;  5IYD G;  2KHI A;  1LT6 D;  3D8G A;  3NP8 A;  4BY7 G;  3HOV H;  1X55 A;  1FNW A;  1VQI A;  1VQK A;  1Y1W G;  3HOY H;  5IP9 H;  4LK1 C;  1SJE D;  1EIY B;  3MXU A;  2BE5 D;  4DV5 L;  3I90 A;  1PRT C;  4GKK L;  1X32 A;  1KNA A;  3CF5 A;  3GTQ B;  1GHJ A;  1LTA D;  3T1H L;  1TWF B;  4IUR A;  2Z1C A;  1SXT A;  1SAP A;  1YJN A;  3GTK B;  4JBK A;  2A6E C;  1EWH A;  1NE3 A;  4DAV A;  2UUA L;  3X3N A;  4DR5 Q;  4NMZ A;  4GN5 A;  4JV5 Q;  2L12 A;  2P5Z X;  1QIL A;  5BN4 A;  1KXL A;  5C4J H;  1WCM G;  4EX5 A;  2E74 C;  3SK6 A;  3K5O A;  1TWF H;  3S24 A;  2AWO A;  4XDX A;  1UE6 A;  4DKA C;  3SDZ A;  5FK9 C;  3KLS X;  2L0C A;  1B1Z A;  3TP5 A;  1VQJ A;  3SR1 A;  5C3X A;  4ZUI A;  1SYG A;  4A3C G;  3AU7 A;  2UUC Q;  5GAG C;  2I5L X;  5BR8 Q;  1J8I A;  5C4X H;  3L9A X;  1LT4 D;  1EQV A;  3H91 A;  2KOL A;  2BOS A;  2DY7 A;  1FR3 A;  3PIP 3;  5FJ8 H;  5M5X B;  2E5L L;  1YI2 A;  1N9W A;  4APV A;  2UXB Q;  1QNU A;  1IHZ A;  3OSO A;  4K2K A;  2HCC A;  1AZQ A;  3CW2 C;  1FNU A;  4RMF A;  2G5D A;  1V1P B;  3OTO L;  3W1G A;  3MXP A;  5IYB H;  4QY7 A;  3RUZ A;  1WTH A;  5FLM G;  4HR7 B;  2F4V L;  3HOW G;  1KC8 C;  1HXY D;  5IGE A;  2JA6 B;  4PG3 A;  3GTJ H;  4JI0 Q;  3H3V H;  2XSC A;  2G9D A;  1V8Q A;  2AMC B;  2F0G A;  4N9T A;  3QOJ A;  2L1B A;  2ASB A;  4KHP L;  1VS0 A;  4A3E B;  1VQA A;  4R1J A;  3J81 E;  1VMC A;  4IPC A;  3HS0 C;  1TWH B;  1HA6 A;  2PMZ E;  1A3T A;  1CQF A;  3R2I A;  2UXD Q;  1IXR A;  1JIC A;  3CKI B;  2ZJP A;  4B9W A;  5C0X G;  4JI0 L;  3VYS A;  1IYV A;  2KHJ A;  3CU7 A;  4HAE A;  2F0I A;  4B3T Q;  3K59 A;  3IKJ A;  5I6W A;  4RH6 A;  2EZV A;  4QF4 A;  1VMP A;  4TSS A;  2PQA B;  1PRT F;  5LMU Q;  5AFW A;  2HQL A;  4P73 A;  5G3L D;  3STB C;  2A5H A;  1N8R C;  4CJ2 C;  3BYY B;  3TP8 A;  4Q5V A;  1I50 B;  1XX8 A;  3QO2 A;  4CBV A;  1N36 Q;  5CC4 A;  2NN6 H;  3CXC A;  1O7I A;  2A1A A;  4Q0F A;  1MKH A;  2HDM A;  4GZY C;  4C3I B;  2F4I A;  3JAM c;  1PZJ D;  2B63 G;  1SR3 A;  2ICE C;  3OHX C;  2LMC B;  4JOI C;  1NY4 A;  1AE2 A;  3H3V I;  1N34 L;  3HOU B;  1EFI D;  1FYC A;  3J81 c;  4OIK A;  4CDE C;  2PNR C;  2JK8 A;  2JA5 B;  1S72 A;  1MHW C;  1N33 L;  1IW7 C;  3STB D;  4FDB A;  4FXK C;  4CKC A;  1JCK B;  4K5X A;  2EYO A;  3I91 A;  2Z6B A;  3GTO B;  3I4M B;  3OPO A;  5D3I B;  1R4P B;  1HZ9 A;  1UWV A;  1EYD A;  1O7Z A;  1PH2 A;  4ZCK A;  5IIF A;  1EQQ A;  2H5X A;  4P74 A;  3UDG A;  1Y1V H;  4A3J B;  1UEA B;  5HY6 A;  4JI8 Q;  1S3O A;  2WAQ B;  1C8C A;  1SRU A;  4G57 A;  3PCO B;  1JOK A;  1SSO A;  4JI8 L;  4C56 C;  2ID0 A;  2F0N A;  4F8M A;  1TWC H;  2LS0 1;  1Q12 A;  1A62 A;  3RLO A;  2K32 A;  1F2Z A;  1HFN A;  4IO9 A;  4QIW E;  1K28 A;  1TWG H;  1Y8N B;  3DWQ A;  3MEH A;  4MHE A;  2E2I H;  5LMN W;  1JJC B;  1Q8I A;  4L6T B;  3C46 A;  3AFP A;  1N33 Q;  2DN8 A;  1GM5 A;  2ZM6 L;  3F1Z A;  2GVB A;  1F2L A;  1H9S A;  2LY7 A;  3C1F A;  1Y1W B;  2RKS A;  3S15 B;  1EWI A;  4IOA A;  3P1H A;  4LFA Q;  5IYD H;  1H9R A;  2WB1 E;  2ZTD A;  4LFC Q;  1AH9 A;  1DOK A;  5E1F A;  4XT1 B;  1LTI D;  2M2L A;  2HD3 A;  4WOR A;  1KRT A;  3ULP A;  5M3M H;  2YU9 B;  3J7A F;  4B3M L;  4OHJ A;  4JI7 Q;  4LF7 L;  1HCZ A;  1CQV A;  4B9X A;  3NE5 B;  2F0D A;  1A6X A;  1RTN A;  4DXF A;  1D8L A;  1NSN S;  5C44 B;  5EKL A;  3MWY W;  2B2U C;  5LMU L;  1X65 A;  2YTV A;  2F0Q A;  3VR5 A;  2C35 B;  3T51 B;  3V2T A;  4GN3 B;  3A8K E;  1WTW A;  1I5F A;  2EY5 A;  3GTG H;  1VQ5 A;  1EEF D;  5FO8 B;  3HOX G;  4LFC L;  1NR4 A;  4A3M G;  4IUV A;  5IP7 G;  2ZT9 C;  5FLX c;  4QQB X;  2EPB A;  2V4D A;  5CV5 A;  4DV1 L;  3H0G B;  1Q90 A;  3M3Y H;  2L11 A;  5FLX E;  2R7F A;  4A3C H;  3AFQ A;  1H9K A;  3ULL A;  3ZJY C;  4OX9 Q;  1B9N A;  4OON A;  1L1O B;  3PIO A;  1X3F A;  4LF9 L;  1K73 C;  4K0K L;  4Y52 H;  2NVT B;  3I4N G;  5FJ8 G;  1IBK L;  3SHL A;  4QMG A;  1HTL D;  2VL6 A;  2BE5 C;  2B8F A;  1B3A A;  1F9S A;  3E0J A;  3E9I A;  3HKZ G;  3PV0 A;  4A3I B;  3M7G A;  2JA9 A;  2YTX A;  2CVR A;  1LTT D;  2UXB L;  4KD4 A;  3T13 A;  1S5D D;  2A68 C;  2B8G A;  2X69 A;  4DR1 L;  1BQQ T;  2A6H C;  3C1E A;  4TVA B;  2MO1 A;  3TS0 A;  2FFK B;  2F0L A;  4DV4 L;  2KHS A;  2OTJ A;  1U9R A;  3KK7 A;  4XYQ A;  4C3J G;  4DR3 Q; 
#chains in the Genus database with same CATH homology
 1UEB A;  4A3I H;  4YWK A;  4X62 L;  3I2Z A;  1EIF A;  4J15 A;  4L5T A;  2JA7 H;  2CWP A;  2NZO A;  1VQM A;  4QGU A;  4LFA L;  1PH7 A;  1HZA A;  2LXK A;  1XPR A;  2Y0S E;  1C9O A;  4UY8 C;  1I3Q H;  2R92 H;  3S1M H;  4HID A;  1C0A A;  5ELO A;  1CKN A;  4L5S A;  2N3S A;  1R9T H;  2QEX A;  4GLA C;  1VQ8 A;  4GLV B;  4DR6 L;  2PI2 E;  2NVT H;  2R93 H;  2K52 A;  2K75 A;  4JI1 L;  2UU9 Q;  3CCR A;  4DK3 C;  1V43 A;  3A74 A;  3UE0 A;  3E0E A;  1JE5 A;  3CD6 A;  5ELN A;  1T9H A;  4BBS G;  3GTQ H;  2VUM G;  1QVC A;  1HNX Q;  2Z0S A;  4UP8 A;  5FLM H;  1Q8K A;  4X66 Q;  3FP9 A;  3KF8 B;  5H1S E;  3HOW H;  4P71 A;  3DM3 A;  1KD1 C;  4JI4 L;  3K8A A;  4LF8 Q;  1SE8 A;  1Z47 A;  2AWN A;  3RLN A;  1X54 A;  3KFU A;  4A93 G;  5JJI A;  5GAD C;  4BA1 I;  1VQB A;  1CKO A;  3PUV A;  3U50 C;  1IL2 A;  4NPS A;  2VZA A;  4OWW B;  1I50 H;  4DV7 L;  1A0I A;  4AIM A;  3KLW A;  3PUZ A;  1SLJ A;  4JI4 Q;  1B70 B;  4NB3 A;  3RZO H;  1WOC A;  4YWM A;  1IBM L;  3H15 A;  1E3P A;  2HT1 A;  3ERS X;  4UP7 A;  3AEV A;  2IY5 B;  2NVY H;  3A5U A;  1QZG A;  4A3I G;  4B3T L;  1NMF A;  4IFD G;  1PYS B;  2NN6 G;  1L1O A;  2K4K A;  3AQQ A;  2BA1 A;  3S1Q H;  1YHA A;  4Y7N H;  4A76 A;  4JYA L;  2HIX A;  4OX9 L;  2B3G A;  3L2P A;  3UDI A;  3I4N H;  2WP8 J;  5GAH C;  4GNX B;  4A3D G;  4JI5 Q;  2ZM6 Q;  4IPD A;  4JYA Q;  4O2D A;  2UUC L;  4BY1 H;  1GVP A;  1YNX A;  3RZD H;  3NBH B;  3S2H H;  4KHP Q;  2K50 A;  3HOX H;  4NXM L;  1E1O A;  4HIM A;  1RL2 A;  4BBR H;  1RIP A;  1YZ6 A;  4LF6 Q;  2NVX H;  2L15 A;  3J7Z C;  4A3M H;  1EOV A;  2D62 A;  3GO5 A;  2ALY B;  3H0G H;  3K81 C;  4DV6 Q;  1PH8 A;  4A3B G;  2VNU D;  4BXX H;  4DV4 Q;  3CC2 A;  2ZJQ A;  4PZ7 A;  1HH2 P;  2YTY A;  2VS1 A;  3JAM i;  3CMA A;  4DUZ L;  3BJU A;  3S2D H;  4IJL A;  2EIF A;  3K0X A;  1TWA H;  2VQF Q;  1XMO Q;  1XMQ L;  3L0O A;  4NXN L;  2UXC Q;  2IX0 A;  1VCI A;  3GD7 A;  4LUV A;  1NBW A;  2BA0 A;  1HZC A;  4MZ9 A;  3K80 C;  4R4T A;  1Q46 A;  1QUQ A;  2K5V A;  3I7F A;  1YIT A;  1NTG A;  3EIV A;  4RG1 A;  1YJW A;  1KQS A;  4B3R Q;  2UUA Q;  4JI6 Q;  1XPU A;  4AQY Q;  1LTL A;  4L5Q A;  2QA4 A;  3M4O H;  5C0X J;  1G6P A;  1KL9 A;  4KHZ A;  4DV0 Q;  2KCT A;  4DAY B;  1XNQ L;  1FL0 A;  2VY3 A;  4IPH A;  4NXN Q;  1VQ7 A;  1Q1E A;  4HIO A;  1LYL A;  1HNX L;  5IWA Q;  5IY0 A;  1OXS C;  3KJP A;  3I56 A;  1HZB A;  1SFO H;  2R93 G;  4DV6 L;  1B8A A;  1Q7Y C;  4LF9 Q;  4ME3 A;  4HJ9 A;  4UP9 A;  2DGY A;  2CWA A;  2BH2 A;  1Q1B A;  1K3R A;  5GRO A;  2ZTE A;  3GTK H;  1JMC A;  2Z6K C;  2KCM A;  3PO3 G;  1EQR A;  1L2F A;  2VUM H;  2K14 A;  4A3K H;  3PF4 A;  4A3L H;  4MNO A;  4JI2 L;  4DK6 C;  1Y1W H;  4JG2 A;  1XNR Q;  3OW2 A;  3S15 H;  4IOC A;  5IYD G;  1SMX A;  1V9P A;  3BZC A;  1Y1V G;  2KHI A;  3D31 A;  3E9H A;  3PSI A;  4DV1 Q;  1K8G A;  4R4O A;  2VW9 A;  1VQ6 A;  1CSQ A;  4BY7 G;  1WI5 A;  2D0P A;  3U4Z A;  2UUB L;  5IYC G;  1X55 A;  1U5K A;  1VQI A;  3KJO A;  3CCS A;  4AYB G;  1FGU A;  4GOP A;  4A3F H;  1Y1W G;  1VQK A;  2OTL A;  2Q2U A;  3HOY H;  3W1B A;  5IP9 H;  3CCL A;  2PNH A;  4B3S Q;  1YEZ A;  1EIY B;  4DV5 L;  3M4P A;  3TRE A;  2K5H A;  4GKK L;  2YYZ A;  1X6O A;  2BH8 A;  3M85 A;  2E2J H;  5JJL A;  2JA5 H;  3CF5 A;  3T1H L;  3PF5 A;  3BU2 A;  4LFB Q;  4L5R C;  1A8V A;  2OCE A;  1S40 A;  1PH5 A;  4XTC S;  1XJV A;  4GKJ Q;  4LUO A;  4OO1 G;  1YJN A;  4DR4 Q;  4JBK A;  1NE3 A;  4JC0 A;  2UUA L;  4DR5 Q;  4JI6 L;  4DV3 Q;  3KF6 B;  3PGZ A;  3CCM A;  4GN5 A;  4JV5 Q;  3F8T A;  3T1H Q;  1KXL A;  1WFQ A;  3LGJ A;  5C4J H;  1IZ6 A;  1WYD A;  3G71 A;  4C3H H;  1WCM G;  2LXJ A;  3UDF A;  4EX5 A;  1KRS A;  2KEN A;  4GOP B;  2LSS A;  4GOP C;  3FKI H;  1TWF H;  3M9B A;  3S24 A;  5M5W H;  2AWO A;  4X65 L;  4LNQ A;  2I5M X;  1UE6 A;  4DKA C;  1C7Y A;  1JB7 A;  2MFI A;  1PH3 A;  3BZK A;  3MXN B;  3JC6 6;  3H0G G;  4JI1 Q;  1VQJ A;  3RNU A;  4A3L G;  2EQS A;  2FXQ A;  1OXU A;  3GTO H;  3I4M H;  1D7Q A;  1VQN A;  4A3G H;  1XNR L;  2XTI A;  4YY3 Q;  4A3C G;  3EBE A;  4IPG A;  2B29 A;  3CPW A;  5GAG C;  1K9M C;  1M1K C;  2UUC Q;  2NVQ H;  2I5L X;  5AJ3 L;  5BR8 Q;  4POG A;  1QVF A;  3I4M G;  5C4X H;  3KOJ A;  4GNX C;  2JEB I;  1KIX A;  3G6E A;  2Q2T A;  3HOV H;  3A5Z B;  4X62 Q;  4OWT B;  4KLK A;  4JI3 L;  3HOU H;  1CKM A;  2VQE L;  5FJ8 H;  1G29 1;  1HR0 Q;  1HJP A;  1HNZ L;  1N36 L;  2E5L L;  3HOZ H;  1YI2 A;  5C44 G;  1UE7 A;  2JE6 I;  2ES2 A;  1N9W A;  3PIP A;  1EUJ A;  3HOU G;  4APV A;  2UXB Q;  3S16 H;  2E8G A;  4DV7 Q;  4JV5 L;  2JA8 H;  1QUQ B;  4YHH Q;  3HOZ G;  3CW2 C;  4YCU A;  3ULJ A;  3RLF A;  4AQY L;  1PH4 A;  1FJG Q;  4RMF A;  4BA2 I;  2RHQ B;  3F2D A;  1A63 A;  2N8N A;  4ALP A;  2AHO B;  1CUK A;  3OTO L;  1K8A C;  3HKZ E;  1IYJ B;  1CSP A;  4UPA A;  3W1G A;  4POF A;  4BBS H;  5IYB H;  4QY7 A;  1PH9 A;  2JA6 H;  4GS3 A;  5FLM G;  4QJF A;  2F3I A;  2F4V L;  3NEN A;  1X3E A;  1KC8 C;  3HOW G;  2UXC L;  3HFZ B;  5GAE C;  4PG3 A;  4C2M H;  3GTJ H;  1ASZ A;  4JI0 Q;  3H3V H;  3G48 A;  2JA7 G;  3KDF A;  1SN8 A;  2N49 A;  1H95 A;  4YCW A;  2AMC B;  3HOY G;  1PH6 A;  4DPG A;  4A3G G;  2UXD L;  4R4C A;  3VDY A;  1N32 L;  3KYH C;  1YHB A;  3U58 A;  1VQD A;  1GD7 A;  4C3J H;  2ASB A;  4KHP L;  4XIG S;  1HR0 W;  1VS0 A;  3CCE A;  1VQA A;  2UUB Q;  4R1J A;  5M3F G;  4WJ3 M;  1JJG A;  3S1R H;  4DR6 Q;  5C4X G;  5BR8 L;  2IHE A;  4YY3 L;  4IPC A;  4DR7 Q;  5E7N A;  1JJ2 A;  4H02 A;  3CPF A;  4KI0 A;  1OTC A;  5M3F H;  3CCV A;  3CC4 A;  1KHI A;  2PMZ E;  2Q2H A;  2JEA I;  3PUX A;  2UXD Q;  3KF6 A;  1Z9F A;  2WB1 G;  1IXR A;  2R6G A;  1LM0 A;  2ZJP A;  4BY1 G;  5C0X G;  1NJI C;  4JI0 L;  1QVG A;  4HJ5 A;  1Y14 B;  4LF4 L;  3PO2 H;  2KHJ A;  1WCM H;  2WAQ G;  4DV2 L;  4IFD I;  3PO3 H;  5GQO A;  5EAY A;  4B3T Q;  1DGS A;  4P72 A;  3Q8D A;  5HGQ A;  4A3J G;  2Q2I A;  2YU9 H;  4HJA A;  1BBU A;  5C3E G;  4DR2 L;  4DUY Q;  4HIK A;  3CAM A;  4A4I A;  4DR5 L;  3B6Y A;  3GDE A;  2PQA B;  5LMU Q;  2CKZ B;  2HQL A;  2RF4 A;  4P73 A;  3STB C;  3W5O A;  1X9N A;  3A0J A;  1N8R C;  2JA6 G;  5C3E H;  4DUY L;  4R4I A;  4LF5 L;  4R4Q A;  2DUD A;  4DR4 L;  4GNX A;  2R92 G;  1I6H H;  2RHS B;  4A75 A;  2ZJR A;  4JI7 L;  4LF8 L;  3K7A H;  1N36 Q;  1X3G A;  3TEH B;  3CXC A;  2K5N A;  1O7I A;  2A1A A;  1MKH A;  3ER0 A;  4DV2 Q;  3CCU A;  2JA5 G;  1AE3 A;  3JAM c;  4A3F G;  3S14 H;  1VQH A;  2B63 G;  1SR3 A;  1BVS A;  4JBM A;  2YV5 A;  4LF4 Q;  1G51 A;  4JOI C;  3CME A;  1MIU A;  3L7Z C;  1YJ9 A;  1NY4 A;  1AE2 A;  1VQG A;  1EYG A;  3H3V I;  1J5E L;  1N34 L;  3K7U C;  3CC7 A;  3J81 c;  1E22 A;  4X64 Q;  3CQZ H;  2JK8 A;  4PZ6 A;  4YWL A;  5AJ3 Q;  1S72 A;  1N33 L;  4EQ5 A;  2WFW A;  1YVC A;  1HNW Q;  1E1T A;  3STB D;  4FDB A;  2A8V A;  1P16 A;  1N34 Q;  2E2H H;  1JT8 A;  3J81 i;  1P8L A;  3U4V A;  2IX1 A;  1OXT A;  5K36 G;  5JJK A;  1J5E Q;  1YIJ A;  1N32 Q;  3ICE A;  1HZ9 A;  1V1Q A;  1UWV A;  3I4O A;  1PH2 A;  2CCZ A;  1MJC A;  5IWA L;  1EQQ A;  1PA6 A;  2I5H A;  4A3K G;  2H5X A;  1IBM Q;  1W3S A;  4AH6 A;  4BXX G;  2V1C C;  4P74 A;  4JOI A;  2CQO A;  1NMG A;  3PUW A;  3J7A 5;  2AKW B;  5M3M G;  2N78 A;  2Z6K A;  3KDF B;  1Y1V H;  3M4Q A;  3UDG A;  5HY6 A;  4JI8 Q;  4LF6 L;  3TS2 A;  1VQE A;  2I0Q A;  1S3O A;  3GTP H;  1SRU A;  3PCO B;  4LF5 Q;  3OTO Q;  1PV4 A;  3F2C A;  3PUY A;  4JCV E;  4B3R L;  4OWX B;  4YHH L;  4DV3 L;  4JI8 L;  4WJ4 A;  2NN6 I;  1VQ4 A;  1Q81 C;  2ID0 A;  3TRZ A;  3RN2 A;  1W2B A;  1TWC H;  4X66 L;  1Q12 A;  2OQK A;  1A62 A;  4MTN A;  4PZ8 A;  3RLO A;  3S1N H;  2R7D A;  2JJQ A;  1IBL Q;  4DV5 Q;  1VQO A;  4IO9 A;  4QIW E;  1XMQ Q;  1TWG H;  2E2I H;  3MEF A;  4HJ8 A;  3SGI A;  4DUZ Q;  2ATW A;  4A93 H;  3EN2 A;  2RCN A;  2XGT A;  1U0L A;  1JJC B;  3CP0 A;  3I55 A;  5LMN W;  4A3E G;  1PH1 A;  2UU9 L;  4A3D H;  2WAQ E;  4C3I H;  1ASY A;  2Y0S G;  3AFP A;  3M7N A;  3J80 i;  1N33 Q;  1Q86 C;  1I94 L;  4X6A H;  1GM5 A;  1BKB A;  2EXD A;  4X64 L;  1UE1 A;  2ZM6 L;  5LMN L;  2JA8 G;  3DLL A;  3F1Z A;  3FHW A;  3J80 c;  2GVB A;  1VQP A;  4DR7 L;  4P75 A;  1J6Q A;  2ZTC A;  4GLX A;  1KAW A;  4LUZ A;  1EWI A;  4IOA A;  4LFA Q;  5IYD H;  3NEL A;  2PI2 A;  3T1Y Q;  1M90 C;  1GO3 E;  2ZTD A;  2WB1 E;  5IYB G;  4AYB E;  4LFC Q;  1AH9 A;  2MNA A;  4X65 Q;  4K0K Q;  1E24 A;  1PVO A;  3RR5 A;  1KRT A;  2MQH A;  3ULP A;  1SRO A;  2HHH L;  5M3M H;  2JQO A;  4DR1 Q;  1E7Z A;  4B3M L;  5DLQ E;  4JI7 Q;  4LF7 L;  2F4V Q;  1CKN B;  4DV0 L;  4IJH A;  3WWV A;  1D8L A;  1XNQ Q;  1PYB A;  5C44 H;  5LMU L;  1X65 A;  2YTV A;  2F52 A;  3CCQ A;  4OXP A;  4BBR G;  4DAM A;  2C35 B;  3RN5 A;  1TWH H;  4GN3 B;  4A3B H;  1GKH A;  1I5F A;  5IE8 A;  3GTG H;  4GKJ L;  1YBY A;  4LF7 Q;  5M5X H;  1L0W A;  4LFB L;  4DR2 Q;  1OXV A;  3PO2 G;  1VQ5 A;  2HIV A;  3HOX G;  1HNZ Q;  4JBJ A;  5JEA J;  1UE5 A;  4A3E H;  1XMO L;  4B3S L;  4IFD J;  2E5L Q;  4LFC L;  2IT1 A;  2GN5 A;  4A3M G;  4DNI A;  4GN4 B;  1HR0 L;  5IP7 G;  2QGQ A;  4NXM Q;  5FLX c;  1MJE A;  4QQB X;  3G4S A;  4DV1 L;  4OO1 I;  1PFS A;  1K83 H;  1X56 A;  3OYY A;  5IT9 c;  3M3Y H;  5C0X I;  2R7F A;  3S17 H;  4BY7 H;  4JI2 Q;  5IYC H;  2CFM A;  1I94 Q;  3CCJ A;  1XTD A;  1HNW L;  4JI5 L;  5LMN Q;  4A3C H;  3AFQ A;  4JBW A;  3ULL A;  3ZJY C;  3AYH B;  4OX9 Q;  4OON A;  4HJ7 A;  2NZH A;  3F2B A;  1L1O B;  3HKS A;  1X3F A;  4TQU S;  3PIO A;  4LF9 L;  2B63 H;  1K73 C;  2R7Z H;  1LUZ A;  3GTM H;  3J81 j;  1TXY A;  1PHJ A;  4YCV A;  2D0O A;  2OQ0 A;  3UDX A;  4DR3 L;  4K0K L;  4LWC A;  4Y52 H;  3I4N G;  1VQC A;  3GTL H;  4O0A A;  5FJ8 G;  1IBK L;  3FKI G;  2R7Z G;  1VQF A;  2PQA A;  4QL5 A;  1IBL L;  1QZH A;  2VL6 A;  2MO0 A;  2OWO A;  1L1O C;  3NEM A;  4A3J H;  3E9I A;  3IRB A;  3TQY A;  3HKZ G;  3PV0 A;  1XPO A;  1VQL A;  3HOV G;  2JA9 A;  4PMW A;  2YTX A;  1OXX K;  2KBN A;  3UE1 A;  5M5Y H;  1Q82 C;  1B7Y B;  1FJG L;  1WJJ A;  1YHQ A;  2UXB L;  2IHF A;  2A19 A;  1IBK Q;  4GKK Q;  2VQF L;  4DR1 L;  1VQ9 A;  4B3M Q;  4TVA B;  2MO1 A;  3TS0 A;  1FVI A;  4LW1 A;  5J3B A;  4DV4 L;  3D0F A;  5IP7 H;  2VQE Q;  2OTJ A;  4JI3 Q;  1K0R A;  1EFW A;  5JEA G;  2HHH Q;  3T1Y L;  1BBW A;  2GVA A;  4DR3 Q;  5IP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...