4DV7Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g, bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv7Q00
3ERSX 1E24A 1E1TA 3KJOA 3GTOH 1TXYA 1I50H 2OQKA 4A3FH 5ELNA 3HOXG 5M5WH 4TVAB 1XMQL 2IT1A 2XTIA 1PH7A 3IRBA 1S40A 1SE8A 2OTLA 3F2CA 1H95A 1VQFA 4DR3Q 1VQIA 2UXBL 3K80C 3U4VA 4O2DA 4A3JH 2PI2E 4AQYL 3NELA 1XPUA 2JJQA 1VCIA 2ZJRA 2BA1A 3CP0A 1PYSB 1Y1WG 1MIUA 1E3PA 1O7IA 3K7AH 4JI6Q 1Q12A 2JA9A 3HOXH 5E7NA 5FJ8G 4IOAA 4K0KQ 4JI1L 1QUQB 4JI0Q 2DUDA 4LWCA 2NVTH 3M9BA 4JI5L 3CCEA 2WB1E 5M5XH 4IJHA 5FLXc 4IPCA 4IPDA 1HZAA 4HJAA 3UDIA 1QUQA 3PUZA 4DR1L 4H02A 1HR0Q 1SROA 1Q81C 1Q8KA 2LSSA 4HIKA 1Y1WH 3NENA 3A0JA 4C3JH 4JI0L 1SRUA 4OO1I 4BA1I 2UUBQ 4LNQA 1KXLA 4HIDA 4DV1Q 3UE1A 4L5SA 1CKMA 3CW2C 3TQYA 4LF4L 1FGUA 1BVSA 2A1AA 2JA6G 5GADC 2PMZE 1SFOH 4NXMQ 3S24A 4A3EG 1VQEA 2VS1A 4R4QA 3GTKH 2K5HA 1VQJA 1IZ6A 4DR5Q 1OXVA 1JT8A 4B3TQ 3SGIA 1UEBA 5DLQE 5C0XI 2E5LL 4JI2L 1MJEA 4DR2Q 3JAMi 2E2JH 1IXRA 4J15A 4P71A 5C3EG 3T1YQ 1K8AC 1TWHH 2Z6KA 3GTJH 2WAQG 1Q1BA 4A3BG 1I3QH 2YU9H 5C44G 2JA6H 5LMNL 2PI2A 4A3EH 2VL6A 4JOIA 1IBKL 4X65Q 1HNZQ 1OXSC 2HIXA 4DAMA 2JA7G 3G48A 1VQ5A 1A62A 2HHHL 1MJCA 4KHZA 1K8GA 4HIMA 4IFDJ 1YVCA 1GO3E 1YBYA 2PQAB 1HZCA 3K0XA 1HNWQ 2K52A 5C4XG 4DR6Q 3CAMA 3CD6A 4X66Q 4JCVE 1XNQL 5EAYA 2RF4A 2NZHA 4AH6A 1I6HH 4A3BH 1WOCA 3RR5A 3CMAA 4DV3Q 2PQAA 4DV2Q 1G291 2R7FA 2WFWA 3RZDH 3S14H 2ZJPA 5LMUQ 4A93G 1Z47A 1NTGA 1CUKA 1N34Q 4GN5A 4OX9Q 1VQ6A 1D8LA 3W1BA 2JA7H 3W5OA 3E9IA 1PH9A 2OWOA 4DR6L 4DR7L 2F52A 3WWVA 3CCQA 2AWOA 5C4XH 2GN5A 1OXXK 1VQ9A 4JV5Q 1HJPA 1A8VA 3JAMc 3CCUA 3H15A 1A0IA 1WFQA 4UP9A 3L0OA 4A93H 1FL0A 3KOJA 3AQQA 4UPAA 2CKZB 2UXDQ 1Q86C 3MEFA 2YYZA 1KRTA 4POFA 4R4CA 3BZCA 1IBLL 4YWMA 2L15A 4AYBG 4BBSH 4LF8Q 2XGTA 4A4IA 4DV6L 3PUYA 3FHWA 3E9HA 4LFAQ 4C3IH 4DUZL 1HNXL 3ICEA 2N49A 1BKBA 1YJNA 3UDGA 4LF5Q 4LF6L 1B70B 1R9TH 4PZ8A 2ZTCA 1K73C 1Z9FA 2VQEL 3PO2G 2F3IA 3I55A 3I4NG 3G71A 4LF8L 4QJFA 2C35B 4NXNQ 4DPGA 2ATWA 1X56A 3I4MG 1WI5A 5HY6A 1W3SA 2UUAQ 1NE3A 1K83H 4DKAC 4UP7A 2VY3A 4LF9Q 3MXNB 1QVFA 3ULJA 1XNRQ 4YY3L 4IOCA 4P73A 1VQMA 2N78A 2KHJA 1PYBA 2R7DA 3B6YA 1AH9A 5JJIA 1X3GA 4BXXG 1VQOA 5GAEC 3ER0A 4MZ9A 5JJKA 3PO2H 3DM3A 5IT9c 2I0QA 3I4NH 1X65A 5AJ3Q 1QZGA 4GS3A 3F2DA 2F4VQ 3PUVA 4QIWE 3CXCA 3I4MH 1BBUA 1XMOQ 4TQUS 1CSQA 1EIFA 1YHAA 2UU9Q 4MTNA 2K50A 3RLOA 2OQ0A 3PV0A 4JI4Q 1IBMQ 3M3YH 3KFUA 2CCZA 2FXQA 1LM0A 4JG2A 1QVCA 4DV5Q 1YITA 1QZHA 3HOYG 3S17H 2YV5A 4GKJQ 4BXXH 1EFWA 4GN3B 4DUYQ 2UXCQ 4LUOA 4JBMA 3RN2A 2HT1A 4DR3L 2WB1G 2K14A 3GDEA 3TS2A 3PGZA 3S1MH 1JE5A 3G4SA 4JI7Q 4PZ6A 4DNIA 2JK8A 4R4IA 4DV5L 1EIYB 2MO0A 2MO1A 2R6GA 2V1CC 4LFBQ 2JA5G 4C2MH 4UY8C 5J3BA 3S16H 4IFDG 1U0LA 3HOWH 3GTMH 1K0RA 4HJ8A 3K8AA 1VQLA 4X62Q 4JI6L 1JB7A 4P72A 3HOYH 2VUMG 4A3DG 4KHPQ 4K0KL 4OWXB 2Q2IA 1NMGA 5IY0A 3AFPA 1J6QA 3U50C 5FJ8H 4A3KG 2VW9A 1I94Q 1LYLA 3HOVG 1Q46A 1HH2P 1TWCH 5C0XJ 1VQGA 3NEMA 2B29A 2CWAA 1JJ2A 1YZ6A 4GLXA 2ZM6Q 2IY5B 1HR0L 2JA5H 5IYBG 2RHQB 4DR4Q 3CCRA 1LUZA 1VQ7A 3S2DH 1I5FA 4GOPC 2IHFA 2JEAI 1CKOA 2OTJA 4A3DH 5IP9G 2NZOA 3M85A 2LXJA 3RZOH 2VUMH 2UUBL 1N32Q 1YNXA 5IYDG 5LMNW 4OWTB 1E7ZA 4DV1L 3CF5A 4KI0A 5GROA 1X3EA 4A3KH 3GTGH 4B3RQ 2GVAA 3STBD 3OTOQ 1YI2A 1FJGQ 3AEVA 2YTXA 3HOVH 2DGYA 4BBRG 4YWLA 1PH1A 4EX5A 2BA0A 3PIOA 3RNUA 4NXML 3T1HQ 3BJUA 5IYBH 1YEZA 2VQFQ 1FVIA 3NBHB 4LF7Q 4DR5L 1SMXA 4B3TL 3OW2A 2NVYH 5IP9H 3I56A 3EN2A 2R92G 4R4TA 4DV7Q 4HIOA 3J80i 5IYDH 4DR2L 1TWGH 3VDYA 3PIPA 4YCVA 3A5UA 1RIPA 3H0GG 4JC0A 4XTCS 4YCWA 4DAYB 3T1YL 4BBRH 3ZJYC 3HKZE 3UE0A 2H5XA 4P74A 3GTQH 3S1RH 5C3EH 1L1OC 2KCMA 3KF8B 4GNXC 2VZAA 4DV7L 1KL9A 1XTDA 4RG1A 4X65L 3I4OA 5C44H 1HNZL 3RLNA 2GVBA 3TS0A 1V43A 2KENA 3CPFA 2R92H 1NY4A 1HNWL 3AFQA 4ALPA 2E2IH 4LUVA 4DV4Q 2CFMA 3H0GH 4APVA 2EQSA 1BBWA 1E22A 4X66L 2AWNA 1UE1A 3CC7A 4JBJA 2JE6I 1KC8C 4QGUA 4DV3L 1KHIA 1PH5A 4DV2L 4IPGA 5C4JH 2RHSB 3F8TA 3PCOB 1G51A 3OYYA 3J81j 5LMUL 1N34L 4OX9L 1NBWA 4DK6C 4QQBX 1K3RA 1YJ9A 2ZTEA 4X6AH 1HZBA 2WP8J 1PH6A 4IO9A 3K7UC 1XPRA 2R93G 3J80c 1PH4A 4JV5L 2BH2A 1PFSA 3CPWA 3RLFA 3Q8DA 1NJIC 5M3MG 4B3SQ 4POGA 2JEBI 4OO1G 3TEHB 3BZKA 3L7ZC 5BR8Q 4YHHQ 4JI3Q 4A3CG 2Q2HA 4A3IG 4BA2I 2UXDL 4C3HH 4GOPA 4ME3A 4RMFA 1Q7YC 1J5EQ 2MFIA 3TREA 5IE8A 1RL2A 3CMEA 2N8NA 4MNOA 1XPOA 3STBC 1JJGA 1AE2A 2A19A 2R93H 4LFAL 1EUJA 3AYHB 2R7ZG 2K75A 2Z0SA 4LW1A 4L5TA 2B63G 5K36G 2E8GA 4LF5L 1N8RC 3U4ZA 2K5NA 1OXUA 5M3MH 3EBEA 3KF6B 3D31A 3I2ZA 5GAGC 4A3CH 5C0XG 1X55A 1WCMG 2RCNA 3UDXA 3PF4A 4A3IH 5IWAQ 4IPHA 4NXNL 4LFCQ 4GKKQ 5ELOA 4JI8Q 5FLMG 2MNAA 2IX1A 4X64Q 2UUAL 4DV0Q 2KHIA 1KAWA 3KF6A 1KIXA 2AKWB 4LF9L 3GTPH 3H3VI 1A63A 1VQBA 3S1NH 1XNRL 1GD7A 4JYAQ 4WJ3M 3HKSA 2R7ZH 5JJLA 2B63H 1VQHA 5JEAJ 1OTCA 5H1SE 4B3MQ 1XMQQ 2QGQA 1L2FA 2IX0A 1PH3A 2YTYA 1WCMH 4R1JA 5AJ3L 4P75A 2E2HH 2Z6KC 3CCVA 4Y7NH 1Q1EA 4LUZA 3ULPA 2F4VL 4A3MG 2UXBQ 3M4QA 2VNUD 5FLMH 1XMOL 2HQLA 1LTLA 4AQYQ 3CQZH 2UU9L 4PZ7A 4JOIC 1SR3A 1VQDA 1VQCA 4YCUA 4B3ML 4JI4L 1IBML 2NVXH 1UE7A 3S2HH 3A74A 3EIVA 4UP8A 2CQOA 2I5HA 4DUYL 4GKJL 2UXCL 1VQAA 4JI1Q 1HR0W 3W1GA 2K5VA 2I5MX 3J81i 4JI5Q 4QY7A 1JMCA 2AHOB 4A3MH 2Y0SG 1TWFH 2N3SA 3LGJA 1VQ4A 1IL2A 3FKIG 4GLVB 1P16A 1C7YA 4JI7L 1OXTA 5IYCG 4XIGS 1EQRA 4LFBL 2AMCB 1YJWA 1S3OA 4DR1Q 5IP7G 2JA8G 3K81C 2Y0SE 1DGSA 2A8VA 3M7NA 4X62L 3G6EA 4KHPL 3PUWA 3CCMA 3CCLA 3HOZG 1C9OA 1SLJA 4JBKA 1I94L 1C0AA 1VQKA 3CC2A 3PSIA 1X6OA 5GAHC 4LF4Q 2NVQH 1NMFA 2ZJQA 3FKIH 1YHBA 1YHQA 1KQSA 5IYCH 4JYAL 2ZM6L 1P8LA 5IP7H 3I7FA 2CWPA 2IHEA 1X9NA 1Y1VG 2JA8H 4DR4L 1L0WA 5M3FG 4PMWA 3J7ZC 1N32L 1TWAH 1CKNB 3UDFA 1X3FA 4OWWB 4GN4B 4A76A 4O0AA 4AIMA 2E5LQ 3HOZH 3PO3G 4JI2Q 3PF5A 1G6PA 1EWIA 4B3RL 3HKZG 3OTOL 1FJGL 1KRSA 3HOUG 3PUXA 2QA4A 1E1OA 3J81c 2YTVA 2B3GA 1CKNA 4OXPA 3DLLA 2K4KA 3JC66 5LMNQ 3T1HL 4NB3A 2Q2UA 2VQFL 1Y1VH 2NN6I 1IBKQ 4LF7L 5M3FH 4L5QA 4HJ9A 1T9HA 1SN8A 4FDBA 1IYJB 2HIVA 3D0FA 1N9WA 2HHHQ 2EIFA 1YIJA 1V1QA 3PO3H 3KJPA 3L2PA 4PG3A 2KCTA 1VS0A 1VQNA 3HOUH 4BY1G 3GTLH 2QEXA 4EQ5A 1XNQQ 3CC4A 2ZTDA 3KYHC 2WAQE 4HJ7A 4WJ4A 2JQOA 1Y14B 1JJCB 4BY7G 2UUCQ 3KDFB 1B8AA 1XJVA 1PVOA 3H3VH 2Q2TA 4DR7Q 3J7A5 3BU2A 3TRZA 1WJJA 5M5YH 3CCJA 3S1QH 2D62A 4Y52H 2LXKA 5JEAG 4L5RC 3S15H 3CCSA 2KBNA 4DV4L 1EOVA 4QL5A 1MKHA 1ASYA 2ASBA 1QVGA 3KDFA 3M4PA 5GQOA 1VQ8A 4BY1H 4GOPB 1PH8A 4NPSA 2UUCL 4IFDI 1PA6A 4BBSG 1WYDA 4A75A 1GVPA 4BY7H 4DK3C 4A3LG 2MQHA 1IBLQ 3GD7A 1W2BA 3FP9A 4DV6Q 1N36Q 1PV4A 4DUZQ 4IJLA 1HNXQ 2D0PA 4KLKA 2EXDA 1Q82C 2I5LX 3KLWA 1PHJA 1M90C 3GO5A 3ULLA 1N33Q 4LF6Q 4B3SL 2ID0A 4OONA 5BR8L 4YHHL 4JI3L 3U58A 2VQEQ 3HOWG 1M1KC 1B7YB 1N36L 3RN5A 1J5EL 4A3LH 4A3GG 1X54A 4R4OA 3F2BA 1PH2A 2ES2A 1ASZA 4AYBE 1KD1C 1D7QA 4JBWA 1K9MC 3HFZB 1EYGA 1N33L 4YWKA 4YY3Q 1L1OB 1S72A 1VQPA 3M4OH 1UWVA 4GNXB 4A3FG 2D0OA 2PNHA 2BH8A 1UE5A 1CSPA 2ALYB 3F1ZA 4LFCL 5HGQA 1U5KA 3E0EA 5IWAL 4HJ5A 1AE3A 1L1OA 1UE6A 4JI8L 1GM5A 1HZ9A 4GKKL 2OCEA 4GLAC 4GNXA 1GKHA 4X64L 1V9PA 4A3JG 4A3GH 4DV0L 3A5ZB 1EQQA 2NN6G
chains in the Genus database with same CATH superfamily
1E24A 3I4LA 1AZPA 2KECA 4H44C 1SMYC 1YNND 3MTSA 3F2CA 1VQIA 2GA4B 2L12A 2RQXA 4AQYL 4C3IB 1MSGA 2JJQA 2ZJRA 3S9WA 4C3JG 1O7IA 3ND8A 4V0BA 2VXWA 1Q12A 5E7NA 5FJ8G 3K6OA 4JI1L 2DUDA 3M9BA 4JI5L 3Q22A 3ONAB 2WB1E 5HGTA 4IJHA 5FLXc 1HZAA 4ZYSA 3PUZA 4DR1L 3OWFA 1SROA 4PQXA 4CGYB 3E5SA 4JI0L 3PMFA 5M5WB 4LNQA 4HIDA 5EPJA 2RA4A 4DV1Q 3UE1A 3TQYA 3IAYA 2F0FA 1SJHD 2PW5A 1BVSA 1XXGA 1J8IA 1SFOH 1HUMA 1VQEA 4R4QA 5BN3A 3S17B 3RD4A 2QKIC 4B3TQ 3NTKA 1NNXA 4I7AA 1EYAA 2HDLA 5C3XA 3QG1A 3S1MB 3KUPA 2E2JH 1IXRA 2A68C 5C3EG 3T1YQ 2Z6KA 3GTJH 2WAQG 5M5XB 3NUCA 5LMNL 1B1ZA 4Z9CB 2VL6A 1OXSC 4ZUJA 1VQ5A 5IGEA 4KHZA 1F9SA 1K8GA 3NBHA 2WB1B 4HIMA 1GO3E 1YBYA 2PQAB 3D4WA 2K52A 4XYOA 4ZQ3A 2EYOA 1XNQL 5EAYA 5I9PA 1GUNA 4V190 3O13A 4DV3Q 1F2ZA 3D4DA 2FFKB 3S14H 3S2DB 3RZDH 5ELCA 1Z47A 1F2MA 2FMMA 3NP8A 1VQ6A 1D8LA 5IT9L 2NB0A 3W5OA 1PH9A 2RDHA 3WWVA 3SVMA 1K8MA 4K2KA 3CCQA 2EJGC 2GN5A 1OXXK 1CK1A 1CZWA 3BS1A 1Q3LA 3OSOA 1WFQA 1R4QB 2JA6B 3KOJA 2UXDQ 3D6WA 1Q86C 2B2VC 1KNAA 1STAA 2QDBA 4LF8Q 5EGTA 4DA2A 2EYFA 1PRTB 1I6VC 3BZDB 3FHWA 4C3IH 4J1MA 2OEOA 1BKBA 2H4OA 3J7YW 3UDGA 1ET9A 4HTHA 4LF6L 4RHSA 1B70B 2K01A 4PZ8A 4A3BB 1Z9FA 5ELBA 2ATWA 2ZXPA 2WKCA 5HY6A 1W3SA 2JA7B 5FOBB 2VY3A 3ULJA 1XNRQ 4P73A 1QJOA 2I46A 1O7YA 1GXDC 5F2DA 3K5NA 1X3GA 1VQOA 5GAEC 3PO2H 3I4NH 1EU3A 3CRLC 3CXCA 1TS5A 5D14A 3VYTA 4QF4A 1CSQA 1YHAA 2UU9Q 4MTNA 2K04A 2OQ0A 3PV0A 4JI4Q 4FF1A 3KFUA 3HZXA 4DV5Q 2EYHA 3S17H 5EPKA 4NMZA 4GKJQ 2UXCQ 4C1NI 4ABNA 4LUOA 4JBMA 3RN2A 1GUTA 4ZAIA 5JOBA 2WV6D 3TS2A 3S1MH 3J81L 1SNDA 1BR9A 4DNIA 1K83B 1JCKB 3G7LA 4UY8C 1JWUD 5KYLA 1K0RA 3K8AA 2L55A 4P72A 3VR2A 3NPPA 3OMGA 4RKBA 1NMGA 4OWXB 4KJNA 1KDBA 1J6QA 4A3KG 3HOVG 1Q46A 3GTPB 3I4MB 1LTRD 1JJ2A 3NSWA 5EJWA 2B63B 4ZUIA 1S5ED 1SE2A 3RUZA 3RMHA 4KJOA 3TP7A 1QB5D 1I5FA 3EQLC 3S2DH 4HCEA 1CKOA 1B2TA 2VUMH 1YNXA 4DV1L 1STNA 4QUFA 4KI0A 5GROA 5M9OA 4B3RQ 2YTXA 2OF1A 3PIOA 5I6WA 2B2YA 3NXWA 3T1HQ 5IYBH 1YEZA 2VQFQ 2F0IA 4FXKC 3WDNA 4LF7Q 4Q5VA 4B3TL 4K5WA 1LTGD 4DV7Q 4HMJA 4YCVA 1RIPA 1BNZA 4YCWA 5CV9A 3T1YL 1H9RA 4P74A 5EKIA 1L1OC 1KL9A 4DAVA 3I4OA 4DAYA 1CA6A 3CPFA 1W6KA 4J8QA 4DV4Q 4APVA 1QCBD 3H0GH 2EQSA 1E0BA 1E22A 3T13A 4QGUA 4K14A 4DV3L 1HTPA 4RCOA 2D9UA 4IPGA 5C4JH 2ZXRA 3F8TA 1G51A 4C3HG 1NBWA 1TWAB 4DK6C 3A55A 2I07B 1YJ9A 2ZTEA 4F8MA 4X6AH 2OXPA 1XPRA 3K59A 5IT9E 1TWGB 3J80c 2BH2A 3CPWA 3RLFA 3Q8DA 4DXGA 1NJIC 3M7GA 2JEBI 4OO1G 3DWPA 2A6HC 4A3CG 3L7ZC 1NCVA 5LL6X 4N8X1 3S1RB 5M3FB 4BA2I 2UXDL 3A7AB 1GOZA 3GV3A 1RL2A 3CMEA 2N8NA 2HD3A 1CM9A 1EUJA 3AYHB 2R7ZG 2K75A 2Z0SA 1QWYA 5K36G 2E8GA 4CBVA 1ESFA 5EQ0A 5E1FA 5C0XG 3UDXA 4LFCQ 3S1QB 4GKKQ 5M5YB 5FLMG 5FLXL 2MNAA 4X64Q 4DV0Q 2KHIA 1KIXA 2DJFC 3GTPH 4JYAQ 1XNRL 1GD7A 5E3FA 5JJLA 2B63H 1VQHA 1OTCA 5H1SE 4B3MQ 4XQQA 1QE6A 1ENAA 1BOSA 4X3UA 3GP7A 3TP5A 3M4QA 2UU9L 1FR3A 4K8JA 1F2LA 4Q0FA 1VQDA 4JI4L 4NP5A 2R93B 3NWTA 1HA5A 4GKJL 1QILA 2CQOA 5M3MB 2UXCL 3OWEB 3W1GA 2K5VA 1PFNA 3X3MA 3J81i 1IYVA 4CJ2C 3LGJA 3FKIG 4GLVB 1P16A 1C7YA 1D6EC 4OGQC 5NUCA 1YJWA 3J81E 1OO9B 3S1NB 3K81C 2Y0SE 3Q23A 2F4IA 4S3SA 3M7NA 1WTWA 2DN8A 1EZ6A 1C9OA 1WCMB 2E2HB 5CBAE 1YHQA 1YHBA 5EBDA 5IYCH 3GTOB 5IP7H 2IHEA 5C5LA 2JXMB 4DNRB 1L0WA 2L5TA 1TWAH 4GN4B 2E5LQ 1A3VA 5EPLA 3PF5A 5CV8A 4B3RL 3HKZG 1KRSA 4KD4A 1HRJA 4G7OC 2YTVA 2B3GA 1CKNA 2AUJD 1RTOA 1ZEQX 2K4KA 3T1HL 4IALA 2VQFL 4NW2A 4LF7L 3A7LA 2TMPA 5M3FH 4K8IA 2HIVA 1N9WA 1V1PB 1AP0A 1YIJA 3PO3H 1YNJD 2FJ2A 2F0KA 2VB2X 4PG3A 2KCTA 1VQNA 1B44D 2BCOA 2Y0SB 4EVOA 2WAQE 4HJ7A 2MPMA 2XRQD 1EYCA 4OEMB 3NK9A 3A54A 3BU2A 3J7A5 5M5YH 3S1QH 3CCJA 1LT3D 4DV4L 4QL5A 1MKHA 3M4PA 4BY1H 5JPNC 1VQ8A 1F9QA 2Z4HA 5T1GA 4IFDI 1PA6A 1WYDA 4BY7H 2MQHA 3P20A 1IBLQ 2KCNA 4DV6Q 2MP1A 2K5DA 4DUZQ 5DEHA 4IJLA 2F0MA 1Q82C 2I5LX 2BOSA 1H9SB 3HOUB 2EJFC 2ID0A 1M1KC 1N36L 4A3LH 3F2BA 2Q8TA 4XYQA 2RDGA 2EY6A 4JBWA 1N33L 4YY3Q 1L1OB 1QNKA 2WAQB 1I6HB 3M4OH 1LABA 1PLFA 3R3OA 2ALYB 2B2WA 5HGQA 4XQJA 2B2UC 4LFCL 1VQMA 1AE3A 4GKKL 2OCEA 4GNXA 1GKHA 4X64L 4A3GH 4LMQD 4DV0L 2M00A 1EQQA 4JYAL 2AQ2B 5DM73 5FLXE 4DFAA 3KJOA 3GTOH 1TXYA 2JN4A 3NHHA 4A3FH 4TVAB 4DK1A 1PH7A 1H95A 1DJRD 1VQFA 4BBSB 3K80C 4A3JH 2PI2E 3F2UA 2BA1A 1Y1WG 1KABA 3K7AH 1HQMC 1FGBD 2AUKA 4JI6Q 2WACA 2LMCB 5CGKA 4GZYC 1QUQB 4JI0Q 2NVTH 4DK0A 1ENCA 4LAAA 1B4OA 2F0SA 1I4QA 1Q8KA 2Q8RE 3MVVA 4HIKA 3NENA 3NTIA 3CHBD 4C3JH 1PTOF 1SRUA 5KNBA 1TQOA 4BA1I 1KXLA 1O7ZA 4EGVA 4R8IA 1BCPD 5I6YA 1DONA 4OHJA 2F1MA 4A3EG 1TU2B 2VS1A 4G7ZC 1VQJA 2F0DA 1L0XB 3MXUA 4UHVA 2E5LL 4DR2Q 3J80L 4P71A 1HFGA 1K8AC 2NTSA 3L3OC 5C44G 1II3A 3K5MA 1WD0A 5IGBA 4JOIA 1I4PA 1WTOA 4X65Q 1HNZQ 3EFXD 4DAMA 3G48A 1A62A 3UI2A 1MJCA 1YVCA 3K0XA 4L63B 1HNWQ 5C4XG 3T4AC 1TWCB 3LWUA 3SK8A 3CAMA 2K5QA 2RF4A 3TDQA 1I6HH 1WOCA 3RR5A 4A93G 1G291 2WFWA 4R9WA 5COYA 1SFOB 1NTGA 1N34Q 3A8KE 4GN5A 4OX9Q 3W1BA 1CFMA 3C2PA 3DWQA 2F52A 2E2DC 1LTBD 2AWOA 1IHZA 3JAMc 1UUPA 1UNSA 3H15A 3GTJB 4UP9A 4H13C 4CDDC 3EJIA 4ZKCB 3L0OA 5BN4A 3I72A 3HG9A 2CKZB 2YYZA 1KRTA 4POFA 4R4CA 3BZCA 1IBLL 4YWMA 4AYBG 4BBSH 1GUOA 4A4IA 4DV6L 1PTOH 3E9HA 4DUZL 4IUUA 1YJNA 3GTQB 4LF5Q 2F0WA 1R9TH 2WINB 2NTTA 4I65A 2ZTCA 1K0SA 3KBGA 3S14B 1IKLA 1JWSD 2F0PA 1GHKA 2UUAQ 2MUYA 1K28A 3MXNB 1QVFA 4FYDA 4YY3L 3GQBA 4IOCA 2L9HA 1H9JA 1DM0B 2R7DA 4QMGA 3KLRA 5AFWA 4BXXG 3OMCA 3VR4A 3ER0A 1M4VA 4KKUA 2I0QA 3HGBA 1QZGA 2XWBB 5KYIA 3PUVA 1XMOQ 2PNRC 4CDFC 1SYGA 1EIFA 1EYDA 2CHBD 2F0EA 1SNPA 5JPMC 2FXQA 1LM0A 4JG2A 1U9RA 3HOYG 2YV5A 4IZ8A 1IW7D 4C3HB 4ZKBB 2HT1A 5ELFA 1VMCA 2WIIB 3NWSA 4RFBA 3G4SA 4J6HA 2R6GA 2MO1A 2V1CC 1LO5D 4C2MH 4IUVA 5J3BA 4K6LA 1U0LA 4NKLA 1W6JA 4A3DG 4JI6L 2EXZA 4KKTA 3MXPA 2Q2IA 4OIKA 5IY0A 1ENFA 3U50C 3PO2B 2R3ZA 3I4NB 1TWCH 5C0XJ 4N8FA 3ITPA 2CWAA 1Y69U 1A2TA 1JB3A 3VR3A 2ZM6Q 2IY5B 5LL6S 1T5EA 4DR4Q 1BXTA 1LUZA 3SE0A 1BUVT 4RH6A 4GOPC 2PYKA 2A6EC 5IP9G 4DNTB 2LXJA 3C1FA 1GUSA 5IYDG 5LMNW 1SE4A 1LT6D 1E7ZA 3K0YA 4X3TA 2RSNA 4A3KH 1YI2A 1FJGQ 3AEVA 3HOVH 2KOLA 3CQZB 4P2CB 2PZTA 2DGYA 4BBRG 1WTQA 3C1EA 1PH1A 2AQ1B 3OW7A 4EX5A 3RNUA 5CV7A 2B39A 3BJUA 2F0VA 1A3UA 4IUTA 3MZ5A 2EY1A 3OW2A 3R93A 2R92G 3J80i 3CKIB 4DR2L 3SXHA 3PIPA 2PO4A 4U673 3HKZE 2H5XA 3GTQH 3J80E 1TY0A 1CHPD 2TSSA 5ELDA 2VZAA 4RG1A 1XTDA 4X65L 1HNZL 2HCCA 3OOCA 2VUMB 1HNWL 3KF8A 2E2IH 4LUVA 2NVQB 2CFMA 2X6GA 4JK1C 2AWNA 4ID6A 3CC7A 4JBJA 1KHIA 1XTCD 2ZT9C 3PCOB 5IOCA 4OX9L 1N34L 4QQBX 1K3RA 1IKMA 1HZBA 1CT1D 1VF5C 2WP8J 3E6ZX 1PH6A 5C4HA 1HHVA 2LFNA 3TSSA 4B3SQ 3BZKA 5BR8Q 1NSNS 2QCPX 1G91A 4A3IG 1B50A 4C3HH 4CJ1B 2O2LD 2MFIA 2XNAC 4R8NA 1XPOA 1HTLD 3STBC 1JJGA 2A19A 2QILA 4B9WA 4JW0A 4LF5L 3H0GB 1RHPA 1N8RC 3U4ZA 1D1KA 1OXUA 2B2TA 4UAIA 3KF6B 2HUGA 3D31A 3I2ZA 4ZCKA 4OO1H 4A3CH 1GJXA 1X55A 1MI2A 4F7XA 1H9KA 5C4JB 4IPHA 3EVQA 2UUAL 1A63A 3H3VI 5DNFA 2NBFA 4WJ3M 2ICEC 1PRTD 1JR0D 2R7ZH 5K36H 2MHVA 2K33A 1XMQQ 1L2FA 5C0XH 4R1JA 1ONLA 2Z6KC 4LUZA 5G3LD 3ULPA 4A3MG 4TSSA 5FLMH 1XMOL 1AEXA 3CQZH 2XWJB 1F9PA 2NVXH 4FNFA 1EY6A 3WOFA 1JE4A 2I5HA 5G3LF 5KEEA 2PQEA 4QY7A 4CJ0B 4KK7A 2AMCB 1LTTD 2JA8G 3E3XA 3HS0C 2A8VA 1RD9D 3G6EA 1GHJA 1U4PA 3PUWA 5IODA 3HOZG 3P75A 2A69D 3ERQA 3PSIA 2NVQH 3U9OA 3FKIH 1EY4A 2ZM6L 4EQOA 1SE3A 1B9NA 3I7FA 2CWPA 4DR4L 1ZYRD 1Y1VG 1T5XD 4JI2Q 2Z9HA 2HCIA 1FJGL 3BG3A 1D5XC 3JAML 2QA4A 4RWSC 2SNSA 5DM63 1EWHA 4ZK9B 1BO0A 2SEBD 3GV6A 3JC66 5CV5A 1IBKQ 3DXJC 4L5QA 4HJ9A 1T9HA 1SN8A 2FMCA 2HHHQ 3L2PA 2A74C 2J0TD 2ZTDA 1Y1WB 1WTPA 4KMUC 1Y14B 2SNMA 4HMIA 1AFPA 1XJVA 1WJJA 1S4ZA 1TT2A 2FINB 3CCSA 3S15H 3KDFA 1PTOC 4GOPB 1PH8A 2UUCL 4HR7B 3ND9A 4A75A 3DUZA 5KRUA 1D1IA 4X3KA 3WOEA 1HCZA 1N36Q 1SNMA 2K05A 5TSSA 3PO3B 3H94A 1HFNA 3GO5A 1N33Q 4B3SL 1HPCA 5BR8L 3NQTA 1X54A 4R4OA 1PH2A 1ASZA 4AYBE 2QDLA 1SNCA 1WTHA 4YWKA 3I73A 4RCNA 2BDNA 3HEJA 4BY1B 1U5KA 3E0EA 2E76C 1UE6A 3TZDA 4BY7B 2B2YC 2A68D 5HURA 2RCFA 1E1TA 2IL8A 3QR8A 1STEA 1I50H 4EQPA 5ELNA 3HOXG 1XMQL 1EIGA 3IRBA 1S40A 1SE8A 2OTLA 2PPBC 3U4VA 2ICIA 2PCFB 4O2DA 4MTKA 1XPUA 2IX3A 1A3TA 3CP0A 2G5DA 4FO2A 3C46A 3M4OB 2D2CC 5A2QL 4LWCA 3A8IE 3CCEA 5JVH3 4IPCA 4A3GB 5EBCA 4HJAA 1PDQA 3UDIA 3U9SA 2J7ZA 1HR0Q 4B9XA 1Q81C 1Y1WH 3IFDA 4FVMA 1RF2D 2CW0C 1Q8IA 4RGNA 4A3FB 2UUBQ 2O5JC 3X3NA 1B3AA 2QEJC 3NTHA 5CORA 4L5SA 2P5ZX 1PYWD 1HA6A 1FGUA 4A3JB 2EDGA 2JA6G 3M3YB 5GADC 4PNYA 3S24A 4CDCC 4IURA 3GTKH 5C3WA 1JT8A 3K7AB 3MXGA 5L37A 1UEBA 1MHWC 4MHEA 3R2IA 1PZKD 4I7ZC 4C1NK 4JI2L 1RKNA 5IGGA 3JAMi 2NVTB 2IJ0A 3AB9A 3VA7A 1JOOA 3T56B 1I3QH 4A3BG 4QCLA 1EEFD 3JAME 4A3EH 4KTAA 3HP3A 4RGOS 1YNNC 1IBKL 4CKEA 4OIJA 1S5DD 1G8ZD 2M9VA 4C3JB 5I2YA 2JA7G 2HHHL 2XSCA 4G7HC 1HZCA 2NWGA 1CHQD 1XWEA 3CD6A 4X66Q 4JCVE 1LT4D 2EYJA 3CMAA 2PQAA 1ICFB 3D3RA 2ZJPA 2F0JA 5LMUQ 3QOJA 1G2TA 1CUKA 2KCCA 3E9IA 2OWOA 4DR6L 1O7LA 1RDPD 3GTGB 2D5DA 1AW7A 5C4XH 2NUCA 1VQ9A 1HJPA 3CCUA 1A0IA 4A93H 1FL0A 2IWHA 1SYEA 3AQQA 2NVYB 3MEFA 4RA8A 5KNCA 3PUYA 1AZQA 4LFAQ 3V05A 2F0UA 1VDZA 5J22A 1KLUD 5CV4A 5C3EB 2JP1A 3QO2A 2EVBA 3G71A 2C35B 2Q8IB 4NXNQ 1X56A 3I4MG 1WI5A 1PXUA 1NE3A 4DKAC 1EZ8A 2CH4W 3DEPA 4UP7A 1FNUA 3NE5B 3R8BA 3I8ZA 2KHJA 1PYBA 3B6YA 3FMCA 5JJIA 1D2BA 2EE1A 2F3VA 4MZ9A 3DM3A 5IT9c 5JJKA 1X65A 2EOTA 4K5VA 4GS3A 4CKCA 1NUCA 1DOKA 4CHTB 2K50A 1PTOB 1CA5A 3M3YH 3IFTA 2CCZA 1YITA 1QZHA 2NN6H 4CDEC 3K5OA 4BXXH 1JICA 1EFWA 4GN3B 1R9TB 4ME5A 1LV9A 2K14A 1E2ZA 3PGZA 2M2LA 1EY5A 2DJGC 4PZ6A 4LFBQ 2JA5G 1F9RA 1EIHA 2IPKD 1XYIA 3S16H 4IFDG 1I4XA 4N9PA 1EY9A 3GTMH 3HOYH 4HJ8A 4X62Q 1JB7A 1KNEA 3H6MA 4A3IB 3AFPA 4RGTA 3TP6A 1EY8A 5FJ8H 2VW9A 5I9OA 3I91A 1O78A 1VQGA 2LY7A 3NEMA 4GLXA 1LTID 1B3QA 2XIWA 1HR0L 2RHQB 1TVXA 2OTJA 1SYDA 2HDMA 4A3DH 2NZOA 3M85A 2G9HD 1N32Q 2UUBL 4OWTB 3IL8A 1STGA 5D3DA 5FK9C 3GTGH 2GVAA 2IW3A 1SBBB 4XT3B 1BCPF 4WORA 3PQIA 2DNCA 1NAPA 3FRPB 3L9AX 3S2HB 1FVIA 2N88A 4C2MB 2EJMA 2PZUA 1WVLA 2NVYH 5IP9H 4R4TA 5IYDH 2O5IC 3A5UA 4XTCS 4DAYB 4BBRH 3OPOA 1ESRA 2LS01 2F0LA 2B2WC 5C3EH 5FO7B 4GNXC 1Q90A 1PFBA 3RLNA 1UEAB 2K1BA 1V43A 1JOQA 2R92H 1EY0A 3EROA 1NY4A 4ZLTF 3AFQA 1FYCA 4ALPA 4X66L 1BBWA 4A3KB 1UE1A 3HOVB 4ZRZA 2JE6I 1MGSA 3VYSA 1PH5A 4KY7A 4HN7A 4LJZC 5LMUL 3OYYA 2SDFA 3J81j 4G57A 3HOZB 3PIO3 4XDXA 2N55A 1G6ZA 1Y8PB 2EY5A 2L1BA 3K7UC 3HRZC 1DCZA 2R93G 1TS3A 2CQAA 1PH4A 1K8OA 2QW7A 1MBYA 5M3MG 1Y1VB 3TEHB 2A69C 4GOPA 4RMFA 1Q7YC 1J5EQ 3TREA 5IE8A 1AE2A 5JJZA 4LFAL 3GTLB 2E2IB 1RODA 2K5NA 3K58A 1D5ZC 4K6DA 1WCMG 2QF7A 4A3IH 1KAAA 4NXNL 1ILPA 1DYQA 2X6LA 5FO9B 4K5XA 1KAWA 3Q24A 4DAPA 2AKWB 4M1UB 4HAEA 5I2XA 4U68A 4QUCA 3HKSA 3T51B 1BDOA 2IX0A 3QJYA 4P75A 3CCVA 4Y7NH 1Q1EA 2UXBQ 3N52A 3SDZA 1LTLA 4PZ7A 4JOIC 1VQCA 4YCUA 1Z6HA 5JAVA 1U4MA 2KVMA 3S2HH 1CQVA 3A74A 3EIVA 3IKJA 2V4DA 5D3IB 1PMRA 2XRSD 1F77A 2AHOB 3Q6SA 1E2WA 1H9MA 1TWFH 2Y0SG 4A3MH 1IL2A 2B2VA 4LFBL 1S3OA 1UAPA 4L6TB 2J4XA 1DGSA 1WTRA 2R7ZB 1A6XA 2KA7A 2EYMA 4X62L 3LX0A 3CCLA 3W2DA 1SLJA 4JBKA 1VQKA 2JYOA 5GAHC 3D6CA 3AU7A 4LF4Q 1NMFA 2ZJQA 1P8LA 3DEOA 3FVQA 1X9NA 2JA8H 1DOMA 3BVMA 2NVXB 1QNUA 4PMWA 1C8CA 1EL0A 1N32L 3MHBA 4L8JA 1CKNB 3UDFA 1X3FA 3HOZH 4A76A 4O0AA 4AIMA 1WD1A 3TMEA 3HOUG 1E1OA 4H0LC 4OXPA 3NBIA 1WTXA 2Q2UA 3MA2B 1C4QA 1Y1VH 4RAUC 5FO8B 3HOXB 4O1NA 4FDBA 1IYJB 3D0FA 5E4WC 3KJPA 1SJED 1Y8NB 1VS0A 3GTLH 2QEXA 1U4RA 1RCVD 5KGUA 3KYHC 3FKIB 1M8AA 1V1PA 4F87A 1RTNA 2E74C 4H7BA 4TRDA 2KQ3A 3E0JA 3MFGA 5IGCA 2UUCQ 1PVOA 3H3VH 4DR7Q 1A15A 1G6PA 3TRZA 4K2LA 4Y52H 3K5LA 1XX8A 2LXKA 5JEAG 4L5RC 3FDTA 1ASYA 1QVGA 2DY8A 1SXTA 2F0NA 4IQZA 4NPSA 4BBSG 1O80A 2EYPA 4WJWA 2F0OA 4DK3C 3C3LA 3VYRA 4EQNA 1JC7A 1W2BA 3FP9A 5T1IA 5ISRA 1HNXQ 4UDUC 1TWHB 4KLKA 3HKZB 2YU9B 3DHQA 1D5MC 2KEEA 4OONA 3U58A 2VQEQ 2Z1CA 3HOWG 3H91A 1X3QA 3KLSA 3KLSX 1J5EL 4IUPA 1H9SA 2ES2A 3URYA 1DXMA 1KD1C 2HQEA 1K9MC 3HFZB 4MN3A 1EYGA 3S15B 1S72A 5CYUA 4GNXB 2F03A 3FPPA 1JOKA 4BS9A 2D0OA 1KTKA 2PNHA 4MIUA 1ET6A 2BH8A 1UE5A 2BE5D 4PMCA 3F1ZA 2C5CA 3DMUA 4HJ5A 1STHA 1L1OA 1GM5A 1HZ9A 1YNJC 3A5ZB 3V2TA 2F0QA 1JORA 1B9MA 3ERSX 1PRTF 2OQKA 3MC0B 5M5WH 2IT1A 1Z7TA 2XTIA 4DR3Q 2OT2A 3VR5A 5IGDA 2UXBL 3T53B 3NELA 1VCIA 3BVGA 1PYSB 4FP5D 5E4XA 1MIUA 1E3PA 3TN2A 2JA9A 3HOXH 4IOAA 4K0KQ 2KEDA 4E6IA 1PFMA 5M5XH 4IPDA 3QWNA 1SYBA 4HSPA 2CVRA 1QUQA 2RSOA 4H02A 3SEBA 4IUQA 2LSSA 3A0JA 1I50B 4OO1I 2PZWA 1S5CD 1WTVA 1BF4A 1CZGA 1CKMA 3MAQA 3CW2C 3G6JB 4LF4L 5BN5A 2Z6BA 1FNVA 2L4NA 2A1AA 2PMZE 4KN4C 4NXMQ 1TY2A 2K5HA 1IZ6A 4DR5Q 1OXVA 1G2SA 1X32A 3SGIA 5DLQE 5DAUA 4YIJA 5C0XI 1MJEA 1LACA 2B2TC 4J15A 5JVG3 2RVLA 1TS2A 4X3SA 1TWHH 1GUGA 1Q1BA 3TBIB 2YU9H 1TIID 2JA6H 1SDFA 2PI2A 5EKKA 1SNQA 1DZ1A 2R61A 4KY5A 2BDOA 2HIXA 3FPUB 2X69A 1SMYD 4IFDJ 1DOLA 5CBEE 4ULLA 2B8FA 4ILWA 4DR6Q 1I4GA 4ODGA 1SEBD 5D65A 1CTMA 3K57A 2NZHA 4AH6A 4A3BH 2JA5B 4DV2Q 2R7FA 2O4XA 3MWYW 3I90A 3RZOB 1Y8OB 3GTKB 5C6AA 4DR7L 2JA7H 1K3BC 2KHSA 3QOLA 1I4HA 1TR5A 1STYA 4C3IG 2ZXOA 3SK4A 4JV5Q 2EPBA 2PMZB 1A8VA 4PMBA 1I3QB 3LWEA 1ILQA 4N9TA 1C48A 4UPAA 1LTAD 4A3EB 4KHVA 3H09A 4NDXA 3QIAA 2L15A 2H1EA 3TP8A 2XGTA 3BYTB 3FEWX 1BCPC 1HNXL 3ICEA 2N49A 3VYUA 4M8AA 1EQVA 1K73C 1E2VA 4KKSA 2VQEL 5C44B 2F3IA 3I55A 3I4NG 3PO2G 2A6ED 4LF8L 4QJFA 4DPGA 3BDOA 4DU9A 1K83H 2RKSA 1JQYD 4KN7C 4LF9Q 3MFYA 5C4XB 2N78A 4F88A 1AH9A 3LNNA 1IYUA 3MXNA 1BQQT 4QB4A 5AJ3Q 1LLRD 4A93B 3A56A 3F2DA 4QIWE 2EZVA 2F4VQ 4WRDA 1BBUA 3I4MH 4TQUS 3RLOA 2KUMA 2PW7A 1PZJD 1IBMQ 1I4RA 1QVCA 1EY7A 1A2UA 2RDFA 1U4LA 4DUYQ 4FF4A 5LHY1 4DR3L 3BDLA 2WB1G 4KD3A 3GDEA 4RGMA 3T16A 1TKWB 1JE5A 3M4YA 1KDCA 4AYBB 4G4KA 4JI7Q 2B8GA 2JK8A 4R4IA 4DV5L 1EIYB 2MO0A 5CV6A 2E75C 1HXYD 2SOBA 3W3AA 1VQLA 1ZKOA 4KHPQ 2VUMG 4K0KL 4LK1C 1ML0D 3V96A 3D8GA 1I94Q 1LYLA 2C9OA 3P1HA 1HH2P 2B29A 3CU7A 1YZ6A 5I4DA 2JA5H 5IYBG 4FXGC 3CCRA 4IFDH 4XT1B 1VQ7A 2JEAI 2IHFA 4RKLA 3RZOH 4QIWB 3CF5A 4C56C 3SR1A 1X3EA 3OTOQ 3STBD 2B2UA 4YWLA 1L0YB 4KV6A 2BA0A 2LKVA 2F0HA 4NXML 1EEID 2F3WA 3QB3A 3NBHB 3S16B 4DR5L 1SMXA 2MGSA 3I56A 3GTMB 1R4PB 3EN2A 3HOYB 4HIOA 4DN4M 1TS4A 1TWGH 3VDYA 1QG7A 1CQFA 3H0GG 4JC0A 1V8QA 1MSHA 3H3VC 1J9OA 5EKLA 3ZJYC 3UE0A 1MD2D 3SHLA 2A73B 3N6RA 2CH4A 3S1RH 2KCMA 3KF8B 1IW7C 1STBA 4O42A 4DV7L 3DM1A 2K7VA 5C44H 2GVBA 3TS0A 2KENA 4A3DB 5IIFA 4OL7A 5CC4A 5ELEA 2NZ1D 3J7AF 4XQNA 2K03A 4DXFA 2RBMA 1KC8C 4DF7A 4DV2L 4JPBW 1PZID 2RHSB 4IN3A 1EU4A 5IGFA 5KIXA 1EFID 3OHXC 3CRKC 4IO9A 4PV1C 3ZYYX 1SYFA 3I3CA 5A35A 1NR2A 4JV5L 2VB3X 1PFSA 2K5WA 2JSOA 4BBRB 2G9DA 4POGA 5CMDA 3PIP3 4YHHQ 4JI3Q 2Q2HA 4ME3A 1KDAA 4WFN3 4MNOA 2R92B 1CI3M 2R93H 2B63G 4LW1A 4L5TA 1JWMD 1S5BD 3BYYB 2Z4IA 5M3MH 3EBEA 5GAGC 2RCNA 3PF4A 1HUNA 5IWAQ 3KBXA 2FHTA 5ELOA 4JI8Q 3OIPA 3R2TA 2IX1A 3OIQA 1FNWA 3KF6A 1EQTA 3MEHA 4LF9L 4CKBA 1VQBA 3S1NH 1AN8A 5JEAJ 5KNDA 3J7AV 2QGQA 2F0TA 4TKOB 1PH3A 2YTYA 1WCMH 5AJ3L 2E2HH 1SSOA 3D4RA 1EWCA 2F4VL 2VNUD 2AQ3B 2HQLA 3SK6A 4AQYQ 4FXDA 2A5HA 1SR3A 3VR6A 4B3ML 4HEDA 1IBML 3I70A 4BWGB 1UE7A 2XN9C 4UP8A 4DUYL 1F2YA 3BVZA 1VQAA 4JI1Q 1HR0W 1ICWA 2I5MX 2Z8LA 4JI5Q 1BCPB 5K5PA 4FF2A 1JMCA 2N3SA 4HCSA 1VQ4A 4JI7L 5A2QE 1OXTA 2F0GA 5IYCG 4XIGS 1EQRA 3P7JA 4DR1Q 5IP7G 1PTOD 3EA6A 1LTSD 2WKDA 4KHPL 3CCMA 3HOWB 2A6HD 2DY7A 1SAPA 1I94L 1C0AA 3BDCA 4Y7NB 3CC2A 1X6OA 1IL8A 2K28A 5C4ZA 1KQSA 1LT5D 2MJ8A 3Q0AA 3NQIA 3J7ZC 5M3FG 5J1ZA 4OWWB 3PO3G 4DGZA 1EWIA 1EOTA 3OTOL 4RHRA 3A8JE 1HQRD 3PUXA 3KK7A 3J81c 1PRTC 4A3MB 1TWFB 1ZXTA 3DLLA 2BE5C 5LMNQ 4NB3A 2ENBA 4HSVA 2NN6I 2DNEA 1QOHA 1SYCA 2NYZD 2EIFA 1V1QA 5CR3A 3HOUH 4BY1G 4EQ5A 1XNQQ 3CC4A 4WJ4A 2JQOA 1JJCB 2JA8B 4BY7G 4IUNA 1V1OA 3KDFB 1B8AA 3TZUA 2Q2TA 2XVSA 1DD2A 2D62A 1GUWA 2EYLA 2KBNA 1EOVA 2ASBA 5GQOA 4FF3A 3DWAA 5FKAC 1GVPA 4A3LG 4B08A 3GD7A 2L0CA 2E2JB 5JEAH 1PV4A 2L11A 4JVZA 4XXEA 2D0PA 2EXDA 3KLWA 1PHJA 1M90C 3ULLA 4LF6Q 1ZYRC 1VF7A 1BBXC 1RJTA 1X3PA 4JI3L 4YHHL 3AMUA 2CW0D 1B7YB 3RN5A 4A3GG 2K6AA 1SNOA 1D7QA 1FD7D 1NR4A 1VQPA 1UWVA 4A3FG 1S5FD 1VMPA 4KY6A 4OELB 5C5MA 3RZDB 1B53A 2EY2A 3HOWH 1CSPA 5IWAL 5J39A 4JI8L 4GLAC 1V9PA 2K32A 4A3JG 1KLGD 3SK5A 2KJXA 2NN6G 3VA5A
chains in the Genus database with same CATH topology
3ERSX 1E24A 1E1TA 3KJOA 3GTOH 1TXYA 1I50H 2OQKA 4A3FH 5ELNA 3HOXG 5M5WH 4TVAB 1XMQL 2IT1A 2XTIA 1PH7A 3IRBA 1S40A 1SE8A 2OTLA 3F2CA 1H95A 1VQFA 4DR3Q 1VQIA 2UXBL 3K80C 3U4VA 4O2DA 4A3JH 2PI2E 4AQYL 3NELA 1XPUA 2JJQA 1VCIA 2ZJRA 2BA1A 3CP0A 1PYSB 1Y1WG 1MIUA 1E3PA 1O7IA 3K7AH 4JI6Q 1Q12A 2JA9A 3HOXH 5E7NA 5FJ8G 4IOAA 4K0KQ 4JI1L 1QUQB 4JI0Q 2DUDA 4LWCA 2NVTH 3M9BA 4JI5L 3CCEA 2WB1E 5M5XH 4IJHA 5FLXc 4IPCA 4IPDA 1HZAA 4HJAA 3UDIA 1QUQA 3PUZA 4DR1L 4H02A 1HR0Q 1SROA 1Q81C 1Q8KA 2LSSA 4HIKA 1Y1WH 3NENA 3A0JA 4C3JH 4JI0L 1SRUA 4OO1I 4BA1I 2UUBQ 4LNQA 1KXLA 4HIDA 4DV1Q 3UE1A 4L5SA 1CKMA 3CW2C 3TQYA 4LF4L 1FGUA 1BVSA 2A1AA 2JA6G 5GADC 2PMZE 1SFOH 4NXMQ 3S24A 4A3EG 1VQEA 2VS1A 4R4QA 3GTKH 2K5HA 1VQJA 1IZ6A 4DR5Q 1OXVA 1JT8A 4B3TQ 3SGIA 1UEBA 5DLQE 5C0XI 2E5LL 4JI2L 1MJEA 4DR2Q 3JAMi 2E2JH 1IXRA 4J15A 4P71A 5C3EG 3T1YQ 1K8AC 1TWHH 2Z6KA 3GTJH 2WAQG 1Q1BA 4A3BG 1I3QH 2YU9H 5C44G 2JA6H 5LMNL 2PI2A 4A3EH 2VL6A 4JOIA 1IBKL 4X65Q 1HNZQ 1OXSC 2HIXA 4DAMA 2JA7G 3G48A 1VQ5A 1A62A 2HHHL 1MJCA 4KHZA 1K8GA 4HIMA 4IFDJ 1YVCA 1GO3E 1YBYA 2PQAB 1HZCA 3K0XA 1HNWQ 2K52A 5C4XG 4DR6Q 3CAMA 3CD6A 4X66Q 4JCVE 1XNQL 5EAYA 2RF4A 2NZHA 4AH6A 1I6HH 4A3BH 1WOCA 3RR5A 3CMAA 4DV3Q 2PQAA 4DV2Q 1G291 2R7FA 2WFWA 3RZDH 3S14H 2ZJPA 5LMUQ 4A93G 1Z47A 1NTGA 1CUKA 1N34Q 4GN5A 4OX9Q 1VQ6A 1D8LA 3W1BA 2JA7H 3W5OA 3E9IA 1PH9A 2OWOA 4DR6L 4DR7L 2F52A 3WWVA 3CCQA 2AWOA 5C4XH 2GN5A 1OXXK 1VQ9A 4JV5Q 1HJPA 1A8VA 3JAMc 3CCUA 3H15A 1A0IA 1WFQA 4UP9A 3L0OA 4A93H 1FL0A 3KOJA 3AQQA 4UPAA 2CKZB 2UXDQ 1Q86C 3MEFA 2YYZA 1KRTA 4POFA 4R4CA 3BZCA 1IBLL 4YWMA 2L15A 4AYBG 4BBSH 4LF8Q 2XGTA 4A4IA 4DV6L 3PUYA 3FHWA 3E9HA 4LFAQ 4C3IH 4DUZL 1HNXL 3ICEA 2N49A 1BKBA 1YJNA 3UDGA 4LF5Q 4LF6L 1B70B 1R9TH 4PZ8A 2ZTCA 1K73C 1Z9FA 2VQEL 3PO2G 2F3IA 3I55A 3I4NG 3G71A 4LF8L 4QJFA 2C35B 4NXNQ 4DPGA 2ATWA 1X56A 3I4MG 1WI5A 5HY6A 1W3SA 2UUAQ 1NE3A 1K83H 4DKAC 4UP7A 2VY3A 4LF9Q 3MXNB 1QVFA 3ULJA 1XNRQ 4YY3L 4IOCA 4P73A 1VQMA 2N78A 2KHJA 1PYBA 2R7DA 3B6YA 1AH9A 5JJIA 1X3GA 4BXXG 1VQOA 5GAEC 3ER0A 4MZ9A 5JJKA 3PO2H 3DM3A 5IT9c 2I0QA 3I4NH 1X65A 5AJ3Q 1QZGA 4GS3A 3F2DA 2F4VQ 3PUVA 4QIWE 3CXCA 3I4MH 1BBUA 1XMOQ 4TQUS 1CSQA 1EIFA 1YHAA 2UU9Q 4MTNA 2K50A 3RLOA 2OQ0A 3PV0A 4JI4Q 1IBMQ 3M3YH 3KFUA 2CCZA 2FXQA 1LM0A 4JG2A 1QVCA 4DV5Q 1YITA 1QZHA 3HOYG 3S17H 2YV5A 4GKJQ 4BXXH 1EFWA 4GN3B 4DUYQ 2UXCQ 4LUOA 4JBMA 3RN2A 2HT1A 4DR3L 2WB1G 2K14A 3GDEA 3TS2A 3PGZA 3S1MH 1JE5A 3G4SA 4JI7Q 4PZ6A 4DNIA 2JK8A 4R4IA 4DV5L 1EIYB 2MO0A 2MO1A 2R6GA 2V1CC 4LFBQ 2JA5G 4C2MH 4UY8C 5J3BA 3S16H 4IFDG 1U0LA 3HOWH 3GTMH 1K0RA 4HJ8A 3K8AA 1VQLA 4X62Q 4JI6L 1JB7A 4P72A 3HOYH 2VUMG 4A3DG 4KHPQ 4K0KL 4OWXB 2Q2IA 1NMGA 5IY0A 3AFPA 1J6QA 3U50C 5FJ8H 4A3KG 2VW9A 1I94Q 1LYLA 3HOVG 1Q46A 1HH2P 1TWCH 5C0XJ 1VQGA 3NEMA 2B29A 2CWAA 1JJ2A 1YZ6A 4GLXA 2ZM6Q 2IY5B 1HR0L 2JA5H 5IYBG 2RHQB 4DR4Q 3CCRA 1LUZA 1VQ7A 3S2DH 1I5FA 4GOPC 2IHFA 2JEAI 1CKOA 2OTJA 4A3DH 5IP9G 2NZOA 3M85A 2LXJA 3RZOH 2VUMH 2UUBL 1N32Q 1YNXA 5IYDG 5LMNW 4OWTB 1E7ZA 4DV1L 3CF5A 4KI0A 5GROA 1X3EA 4A3KH 3GTGH 4B3RQ 2GVAA 3STBD 3OTOQ 1YI2A 1FJGQ 3AEVA 2YTXA 3HOVH 2DGYA 4BBRG 4YWLA 1PH1A 4EX5A 2BA0A 3PIOA 3RNUA 4NXML 3T1HQ 3BJUA 5IYBH 1YEZA 2VQFQ 1FVIA 3NBHB 4LF7Q 4DR5L 1SMXA 4B3TL 3OW2A 2NVYH 5IP9H 3I56A 3EN2A 2R92G 4R4TA 4DV7Q 4HIOA 3J80i 5IYDH 4DR2L 1TWGH 3VDYA 3PIPA 4YCVA 3A5UA 1RIPA 3H0GG 4JC0A 4XTCS 4YCWA 4DAYB 3T1YL 4BBRH 3ZJYC 3HKZE 3UE0A 2H5XA 4P74A 3GTQH 3S1RH 5C3EH 1L1OC 2KCMA 3KF8B 4GNXC 2VZAA 4DV7L 1KL9A 1XTDA 4RG1A 4X65L 3I4OA 5C44H 1HNZL 3RLNA 2GVBA 3TS0A 1V43A 2KENA 3CPFA 2R92H 1NY4A 1HNWL 3AFQA 4ALPA 2E2IH 4LUVA 4DV4Q 2CFMA 3H0GH 4APVA 2EQSA 1BBWA 1E22A 4X66L 2AWNA 1UE1A 3CC7A 4JBJA 2JE6I 1KC8C 4QGUA 4DV3L 1KHIA 1PH5A 4DV2L 4IPGA 5C4JH 2RHSB 3F8TA 3PCOB 1G51A 3OYYA 3J81j 5LMUL 1N34L 4OX9L 1NBWA 4DK6C 4QQBX 1K3RA 1YJ9A 2ZTEA 4X6AH 1HZBA 2WP8J 1PH6A 4IO9A 3K7UC 1XPRA 2R93G 3J80c 1PH4A 4JV5L 2BH2A 1PFSA 3CPWA 3RLFA 3Q8DA 1NJIC 5M3MG 4B3SQ 4POGA 2JEBI 4OO1G 3TEHB 3BZKA 3L7ZC 5BR8Q 4YHHQ 4JI3Q 4A3CG 2Q2HA 4A3IG 4BA2I 2UXDL 4C3HH 4GOPA 4ME3A 4RMFA 1Q7YC 1J5EQ 2MFIA 3TREA 5IE8A 1RL2A 3CMEA 2N8NA 4MNOA 1XPOA 3STBC 1JJGA 1AE2A 2A19A 2R93H 4LFAL 1EUJA 3AYHB 2R7ZG 2K75A 2Z0SA 4LW1A 4L5TA 2B63G 5K36G 2E8GA 4LF5L 1N8RC 3U4ZA 2K5NA 1OXUA 5M3MH 3EBEA 3KF6B 3D31A 3I2ZA 5GAGC 4A3CH 5C0XG 1X55A 1WCMG 2RCNA 3UDXA 3PF4A 4A3IH 5IWAQ 4IPHA 4NXNL 4LFCQ 4GKKQ 5ELOA 4JI8Q 5FLMG 2MNAA 2IX1A 4X64Q 2UUAL 4DV0Q 2KHIA 1KAWA 3KF6A 1KIXA 2AKWB 4LF9L 3GTPH 3H3VI 1A63A 1VQBA 3S1NH 1XNRL 1GD7A 4JYAQ 4WJ3M 3HKSA 2R7ZH 5JJLA 2B63H 1VQHA 5JEAJ 1OTCA 5H1SE 4B3MQ 1XMQQ 2QGQA 1L2FA 2IX0A 1PH3A 2YTYA 1WCMH 4R1JA 5AJ3L 4P75A 2E2HH 2Z6KC 3CCVA 4Y7NH 1Q1EA 4LUZA 3ULPA 2F4VL 4A3MG 2UXBQ 3M4QA 2VNUD 5FLMH 1XMOL 2HQLA 1LTLA 4AQYQ 3CQZH 2UU9L 4PZ7A 4JOIC 1SR3A 1VQDA 1VQCA 4YCUA 4B3ML 4JI4L 1IBML 2NVXH 1UE7A 3S2HH 3A74A 3EIVA 4UP8A 2CQOA 2I5HA 4DUYL 4GKJL 2UXCL 1VQAA 4JI1Q 1HR0W 3W1GA 2K5VA 2I5MX 3J81i 4JI5Q 4QY7A 1JMCA 2AHOB 4A3MH 2Y0SG 1TWFH 2N3SA 3LGJA 1VQ4A 1IL2A 3FKIG 4GLVB 1P16A 1C7YA 4JI7L 1OXTA 5IYCG 4XIGS 1EQRA 4LFBL 2AMCB 1YJWA 1S3OA 4DR1Q 5IP7G 2JA8G 3K81C 2Y0SE 1DGSA 2A8VA 3M7NA 4X62L 3G6EA 4KHPL 3PUWA 3CCMA 3CCLA 3HOZG 1C9OA 1SLJA 4JBKA 1I94L 1C0AA 1VQKA 3CC2A 3PSIA 1X6OA 5GAHC 4LF4Q 2NVQH 1NMFA 2ZJQA 3FKIH 1YHBA 1YHQA 1KQSA 5IYCH 4JYAL 2ZM6L 1P8LA 5IP7H 3I7FA 2CWPA 2IHEA 1X9NA 1Y1VG 2JA8H 4DR4L 1L0WA 5M3FG 4PMWA 3J7ZC 1N32L 1TWAH 1CKNB 3UDFA 1X3FA 4OWWB 4GN4B 4A76A 4O0AA 4AIMA 2E5LQ 3HOZH 3PO3G 4JI2Q 3PF5A 1G6PA 1EWIA 4B3RL 3HKZG 3OTOL 1FJGL 1KRSA 3HOUG 3PUXA 2QA4A 1E1OA 3J81c 2YTVA 2B3GA 1CKNA 4OXPA 3DLLA 2K4KA 3JC66 5LMNQ 3T1HL 4NB3A 2Q2UA 2VQFL 1Y1VH 2NN6I 1IBKQ 4LF7L 5M3FH 4L5QA 4HJ9A 1T9HA 1SN8A 4FDBA 1IYJB 2HIVA 3D0FA 1N9WA 2HHHQ 2EIFA 1YIJA 1V1QA 3PO3H 3KJPA 3L2PA 4PG3A 2KCTA 1VS0A 1VQNA 3HOUH 4BY1G 3GTLH 2QEXA 4EQ5A 1XNQQ 3CC4A 2ZTDA 3KYHC 2WAQE 4HJ7A 4WJ4A 2JQOA 1Y14B 1JJCB 4BY7G 2UUCQ 3KDFB 1B8AA 1XJVA 1PVOA 3H3VH 2Q2TA 4DR7Q 3J7A5 3BU2A 3TRZA 1WJJA 5M5YH 3CCJA 3S1QH 2D62A 4Y52H 2LXKA 5JEAG 4L5RC 3S15H 3CCSA 2KBNA 4DV4L 1EOVA 4QL5A 1MKHA 1ASYA 2ASBA 1QVGA 3KDFA 3M4PA 5GQOA 1VQ8A 4BY1H 4GOPB 1PH8A 4NPSA 2UUCL 4IFDI 1PA6A 4BBSG 1WYDA 4A75A 1GVPA 4BY7H 4DK3C 4A3LG 2MQHA 1IBLQ 3GD7A 1W2BA 3FP9A 4DV6Q 1N36Q 1PV4A 4DUZQ 4IJLA 1HNXQ 2D0PA 4KLKA 2EXDA 1Q82C 2I5LX 3KLWA 1PHJA 1M90C 3GO5A 3ULLA 1N33Q 4LF6Q 4B3SL 2ID0A 4OONA 5BR8L 4YHHL 4JI3L 3U58A 2VQEQ 3HOWG 1M1KC 1B7YB 1N36L 3RN5A 1J5EL 4A3LH 4A3GG 1X54A 4R4OA 3F2BA 1PH2A 2ES2A 1ASZA 4AYBE 1KD1C 1D7QA 4JBWA 1K9MC 3HFZB 1EYGA 1N33L 4YWKA 4YY3Q 1L1OB 1S72A 1VQPA 3M4OH 1UWVA 4GNXB 4A3FG 2D0OA 2PNHA 2BH8A 1UE5A 1CSPA 2ALYB 3F1ZA 4LFCL 5HGQA 1U5KA 3E0EA 5IWAL 4HJ5A 1AE3A 1L1OA 1UE6A 4JI8L 1GM5A 1HZ9A 4GKKL 2OCEA 4GLAC 4GNXA 1GKHA 4X64L 1V9PA 4A3JG 4A3GH 4DV0L 3A5ZB 1EQQA 2NN6G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERS X;  1E24 A;  1E1T A;  3KJO A;  3GTO H;  1TXY A;  1I50 H;  2OQK A;  4A3F H;  5ELN A;  3HOX G;  5M5W H;  4TVA B;  1XMQ L;  2IT1 A;  2XTI A;  1PH7 A;  3IRB A;  1S40 A;  1SE8 A;  2OTL A;  3F2C A;  1H95 A;  1VQF A;  4DR3 Q;  1VQI A;  2UXB L;  3K80 C;  3U4V A;  4O2D A;  4A3J H;  2PI2 E;  4AQY L;  3NEL A;  1XPU A;  2JJQ A;  1VCI A;  2ZJR A;  2BA1 A;  3CP0 A;  1PYS B;  1Y1W G;  1MIU A;  1E3P A;  1O7I A;  3K7A H;  4JI6 Q;  1Q12 A;  2JA9 A;  3HOX H;  5E7N A;  5FJ8 G;  4IOA A;  4K0K Q;  4JI1 L;  1QUQ B;  4JI0 Q;  2DUD A;  4LWC A;  2NVT H;  3M9B A;  4JI5 L;  3CCE A;  2WB1 E;  5M5X H;  4IJH A;  5FLX c;  4IPC A;  4IPD A;  1HZA A;  4HJA A;  3UDI A;  1QUQ A;  3PUZ A;  4DR1 L;  4H02 A;  1HR0 Q;  1SRO A;  1Q81 C;  1Q8K A;  2LSS A;  4HIK A;  1Y1W H;  3NEN A;  3A0J A;  4C3J H;  4JI0 L;  1SRU A;  4OO1 I;  4BA1 I;  2UUB Q;  4LNQ A;  1KXL A;  4HID A;  4DV1 Q;  3UE1 A;  4L5S A;  1CKM A;  3CW2 C;  3TQY A;  4LF4 L;  1FGU A;  1BVS A;  2A1A A;  2JA6 G;  5GAD C;  2PMZ E;  1SFO H;  4NXM Q;  3S24 A;  4A3E G;  1VQE A;  2VS1 A;  4R4Q A;  3GTK H;  2K5H A;  1VQJ A;  1IZ6 A;  4DR5 Q;  1OXV A;  1JT8 A;  4B3T Q;  3SGI A;  1UEB A;  5DLQ E;  5C0X I;  2E5L L;  4JI2 L;  1MJE A;  4DR2 Q;  3JAM i;  2E2J H;  1IXR A;  4J15 A;  4P71 A;  5C3E G;  3T1Y Q;  1K8A C;  1TWH H;  2Z6K A;  3GTJ H;  2WAQ G;  1Q1B A;  4A3B G;  1I3Q H;  2YU9 H;  5C44 G;  2JA6 H;  5LMN L;  2PI2 A;  4A3E H;  2VL6 A;  4JOI A;  1IBK L;  4X65 Q;  1HNZ Q;  1OXS C;  2HIX A;  4DAM A;  2JA7 G;  3G48 A;  1VQ5 A;  1A62 A;  2HHH L;  1MJC A;  4KHZ A;  1K8G A;  4HIM A;  4IFD J;  1YVC A;  1GO3 E;  1YBY A;  2PQA B;  1HZC A;  3K0X A;  1HNW Q;  2K52 A;  5C4X G;  4DR6 Q;  3CAM A;  3CD6 A;  4X66 Q;  4JCV E;  1XNQ L;  5EAY A;  2RF4 A;  2NZH A;  4AH6 A;  1I6H H;  4A3B H;  1WOC A;  3RR5 A;  3CMA A;  4DV3 Q;  2PQA A;  4DV2 Q;  1G29 1;  2R7F A;  2WFW A;  3RZD H;  3S14 H;  2ZJP A;  5LMU Q;  4A93 G;  1Z47 A;  1NTG A;  1CUK A;  1N34 Q;  4GN5 A;  4OX9 Q;  1VQ6 A;  1D8L A;  3W1B A;  2JA7 H;  3W5O A;  3E9I A;  1PH9 A;  2OWO A;  4DR6 L;  4DR7 L;  2F52 A;  3WWV A;  3CCQ A;  2AWO A;  5C4X H;  2GN5 A;  1OXX K;  1VQ9 A;  4JV5 Q;  1HJP A;  1A8V A;  3JAM c;  3CCU A;  3H15 A;  1A0I A;  1WFQ A;  4UP9 A;  3L0O A;  4A93 H;  1FL0 A;  3KOJ A;  3AQQ A;  4UPA A;  2CKZ B;  2UXD Q;  1Q86 C;  3MEF A;  2YYZ A;  1KRT A;  4POF A;  4R4C A;  3BZC A;  1IBL L;  4YWM A;  2L15 A;  4AYB G;  4BBS H;  4LF8 Q;  2XGT A;  4A4I A;  4DV6 L;  3PUY A;  3FHW A;  3E9H A;  4LFA Q;  4C3I H;  4DUZ L;  1HNX L;  3ICE A;  2N49 A;  1BKB A;  1YJN A;  3UDG A;  4LF5 Q;  4LF6 L;  1B70 B;  1R9T H;  4PZ8 A;  2ZTC A;  1K73 C;  1Z9F A;  2VQE L;  3PO2 G;  2F3I A;  3I55 A;  3I4N G;  3G71 A;  4LF8 L;  4QJF A;  2C35 B;  4NXN Q;  4DPG A;  2ATW A;  1X56 A;  3I4M G;  1WI5 A;  5HY6 A;  1W3S A;  2UUA Q;  1NE3 A;  1K83 H;  4DKA C;  4UP7 A;  2VY3 A;  4LF9 Q;  3MXN B;  1QVF A;  3ULJ A;  1XNR Q;  4YY3 L;  4IOC A;  4P73 A;  1VQM A;  2N78 A;  2KHJ A;  1PYB A;  2R7D A;  3B6Y A;  1AH9 A;  5JJI A;  1X3G A;  4BXX G;  1VQO A;  5GAE C;  3ER0 A;  4MZ9 A;  5JJK A;  3PO2 H;  3DM3 A;  5IT9 c;  2I0Q A;  3I4N H;  1X65 A;  5AJ3 Q;  1QZG A;  4GS3 A;  3F2D A;  2F4V Q;  3PUV A;  4QIW E;  3CXC A;  3I4M H;  1BBU A;  1XMO Q;  4TQU S;  1CSQ A;  1EIF A;  1YHA A;  2UU9 Q;  4MTN A;  2K50 A;  3RLO A;  2OQ0 A;  3PV0 A;  4JI4 Q;  1IBM Q;  3M3Y H;  3KFU A;  2CCZ A;  2FXQ A;  1LM0 A;  4JG2 A;  1QVC A;  4DV5 Q;  1YIT A;  1QZH A;  3HOY G;  3S17 H;  2YV5 A;  4GKJ Q;  4BXX H;  1EFW A;  4GN3 B;  4DUY Q;  2UXC Q;  4LUO A;  4JBM A;  3RN2 A;  2HT1 A;  4DR3 L;  2WB1 G;  2K14 A;  3GDE A;  3TS2 A;  3PGZ A;  3S1M H;  1JE5 A;  3G4S A;  4JI7 Q;  4PZ6 A;  4DNI A;  2JK8 A;  4R4I A;  4DV5 L;  1EIY B;  2MO0 A;  2MO1 A;  2R6G A;  2V1C C;  4LFB Q;  2JA5 G;  4C2M H;  4UY8 C;  5J3B A;  3S16 H;  4IFD G;  1U0L A;  3HOW H;  3GTM H;  1K0R A;  4HJ8 A;  3K8A A;  1VQL A;  4X62 Q;  4JI6 L;  1JB7 A;  4P72 A;  3HOY H;  2VUM G;  4A3D G;  4KHP Q;  4K0K L;  4OWX B;  2Q2I A;  1NMG A;  5IY0 A;  3AFP A;  1J6Q A;  3U50 C;  5FJ8 H;  4A3K G;  2VW9 A;  1I94 Q;  1LYL A;  3HOV G;  1Q46 A;  1HH2 P;  1TWC H;  5C0X J;  1VQG A;  3NEM A;  2B29 A;  2CWA A;  1JJ2 A;  1YZ6 A;  4GLX A;  2ZM6 Q;  2IY5 B;  1HR0 L;  2JA5 H;  5IYB G;  2RHQ B;  4DR4 Q;  3CCR A;  1LUZ A;  1VQ7 A;  3S2D H;  1I5F A;  4GOP C;  2IHF A;  2JEA I;  1CKO A;  2OTJ A;  4A3D H;  5IP9 G;  2NZO A;  3M85 A;  2LXJ A;  3RZO H;  2VUM H;  2UUB L;  1N32 Q;  1YNX A;  5IYD G;  5LMN W;  4OWT B;  1E7Z A;  4DV1 L;  3CF5 A;  4KI0 A;  5GRO A;  1X3E A;  4A3K H;  3GTG H;  4B3R Q;  2GVA A;  3STB D;  3OTO Q;  1YI2 A;  1FJG Q;  3AEV A;  2YTX A;  3HOV H;  2DGY A;  4BBR G;  4YWL A;  1PH1 A;  4EX5 A;  2BA0 A;  3PIO A;  3RNU A;  4NXM L;  3T1H Q;  3BJU A;  5IYB H;  1YEZ A;  2VQF Q;  1FVI A;  3NBH B;  4LF7 Q;  4DR5 L;  1SMX A;  4B3T L;  3OW2 A;  2NVY H;  5IP9 H;  3I56 A;  3EN2 A;  2R92 G;  4R4T A;  4DV7 Q;  4HIO A;  3J80 i;  5IYD H;  4DR2 L;  1TWG H;  3VDY A;  3PIP A;  4YCV A;  3A5U A;  1RIP A;  3H0G G;  4JC0 A;  4XTC S;  4YCW A;  4DAY B;  3T1Y L;  4BBR H;  3ZJY C;  3HKZ E;  3UE0 A;  2H5X A;  4P74 A;  3GTQ H;  3S1R H;  5C3E H;  1L1O C;  2KCM A;  3KF8 B;  4GNX C;  2VZA A;  4DV7 L;  1KL9 A;  1XTD A;  4RG1 A;  4X65 L;  3I4O A;  5C44 H;  1HNZ L;  3RLN A;  2GVB A;  3TS0 A;  1V43 A;  2KEN A;  3CPF A;  2R92 H;  1NY4 A;  1HNW L;  3AFQ A;  4ALP A;  2E2I H;  4LUV A;  4DV4 Q;  2CFM A;  3H0G H;  4APV A;  2EQS A;  1BBW A;  1E22 A;  4X66 L;  2AWN A;  1UE1 A;  3CC7 A;  4JBJ A;  2JE6 I;  1KC8 C;  4QGU A;  4DV3 L;  1KHI A;  1PH5 A;  4DV2 L;  4IPG A;  5C4J H;  2RHS B;  3F8T A;  3PCO B;  1G51 A;  3OYY A;  3J81 j;  5LMU L;  1N34 L;  4OX9 L;  1NBW A;  4DK6 C;  4QQB X;  1K3R A;  1YJ9 A;  2ZTE A;  4X6A H;  1HZB A;  2WP8 J;  1PH6 A;  4IO9 A;  3K7U C;  1XPR A;  2R93 G;  3J80 c;  1PH4 A;  4JV5 L;  2BH2 A;  1PFS A;  3CPW A;  3RLF A;  3Q8D A;  1NJI C;  5M3M G;  4B3S Q;  4POG A;  2JEB I;  4OO1 G;  3TEH B;  3BZK A;  3L7Z C;  5BR8 Q;  4YHH Q;  4JI3 Q;  4A3C G;  2Q2H A;  4A3I G;  4BA2 I;  2UXD L;  4C3H H;  4GOP A;  4ME3 A;  4RMF A;  1Q7Y C;  1J5E Q;  2MFI A;  3TRE A;  5IE8 A;  1RL2 A;  3CME A;  2N8N A;  4MNO A;  1XPO A;  3STB C;  1JJG A;  1AE2 A;  2A19 A;  2R93 H;  4LFA L;  1EUJ A;  3AYH B;  2R7Z G;  2K75 A;  2Z0S A;  4LW1 A;  4L5T A;  2B63 G;  5K36 G;  2E8G A;  4LF5 L;  1N8R C;  3U4Z A;  2K5N A;  1OXU A;  5M3M H;  3EBE A;  3KF6 B;  3D31 A;  3I2Z A;  5GAG C;  4A3C H;  5C0X G;  1X55 A;  1WCM G;  2RCN A;  3UDX A;  3PF4 A;  4A3I H;  5IWA Q;  4IPH A;  4NXN L;  4LFC Q;  4GKK Q;  5ELO A;  4JI8 Q;  5FLM G;  2MNA A;  2IX1 A;  4X64 Q;  2UUA L;  4DV0 Q;  2KHI A;  1KAW A;  3KF6 A;  1KIX A;  2AKW B;  4LF9 L;  3GTP H;  3H3V I;  1A63 A;  1VQB A;  3S1N H;  1XNR L;  1GD7 A;  4JYA Q;  4WJ3 M;  3HKS A;  2R7Z H;  5JJL A;  2B63 H;  1VQH A;  5JEA J;  1OTC A;  5H1S E;  4B3M Q;  1XMQ Q;  2QGQ A;  1L2F A;  2IX0 A;  1PH3 A;  2YTY A;  1WCM H;  4R1J A;  5AJ3 L;  4P75 A;  2E2H H;  2Z6K C;  3CCV A;  4Y7N H;  1Q1E A;  4LUZ A;  3ULP A;  2F4V L;  4A3M G;  2UXB Q;  3M4Q A;  2VNU D;  5FLM H;  1XMO L;  2HQL A;  1LTL A;  4AQY Q;  3CQZ H;  2UU9 L;  4PZ7 A;  4JOI C;  1SR3 A;  1VQD A;  1VQC A;  4YCU A;  4B3M L;  4JI4 L;  1IBM L;  2NVX H;  1UE7 A;  3S2H H;  3A74 A;  3EIV A;  4UP8 A;  2CQO A;  2I5H A;  4DUY L;  4GKJ L;  2UXC L;  1VQA A;  4JI1 Q;  1HR0 W;  3W1G A;  2K5V A;  2I5M X;  3J81 i;  4JI5 Q;  4QY7 A;  1JMC A;  2AHO B;  4A3M H;  2Y0S G;  1TWF H;  2N3S A;  3LGJ A;  1VQ4 A;  1IL2 A;  3FKI G;  4GLV B;  1P16 A;  1C7Y A;  4JI7 L;  1OXT A;  5IYC G;  4XIG S;  1EQR A;  4LFB L;  2AMC B;  1YJW A;  1S3O A;  4DR1 Q;  5IP7 G;  2JA8 G;  3K81 C;  2Y0S E;  1DGS A;  2A8V A;  3M7N A;  4X62 L;  3G6E A;  4KHP L;  3PUW A;  3CCM A;  3CCL A;  3HOZ G;  1C9O A;  1SLJ A;  4JBK A;  1I94 L;  1C0A A;  1VQK A;  3CC2 A;  3PSI A;  1X6O A;  5GAH C;  4LF4 Q;  2NVQ H;  1NMF A;  2ZJQ A;  3FKI H;  1YHB A;  1YHQ A;  1KQS A;  5IYC H;  4JYA L;  2ZM6 L;  1P8L A;  5IP7 H;  3I7F A;  2CWP A;  2IHE A;  1X9N A;  1Y1V G;  2JA8 H;  4DR4 L;  1L0W A;  5M3F G;  4PMW A;  3J7Z C;  1N32 L;  1TWA H;  1CKN B;  3UDF A;  1X3F A;  4OWW B;  4GN4 B;  4A76 A;  4O0A A;  4AIM A;  2E5L Q;  3HOZ H;  3PO3 G;  4JI2 Q;  3PF5 A;  1G6P A;  1EWI A;  4B3R L;  3HKZ G;  3OTO L;  1FJG L;  1KRS A;  3HOU G;  3PUX A;  2QA4 A;  1E1O A;  3J81 c;  2YTV A;  2B3G A;  1CKN A;  4OXP A;  3DLL A;  2K4K A;  3JC6 6;  5LMN Q;  3T1H L;  4NB3 A;  2Q2U A;  2VQF L;  1Y1V H;  2NN6 I;  1IBK Q;  4LF7 L;  5M3F H;  4L5Q A;  4HJ9 A;  1T9H A;  1SN8 A;  4FDB A;  1IYJ B;  2HIV A;  3D0F A;  1N9W A;  2HHH Q;  2EIF A;  1YIJ A;  1V1Q A;  3PO3 H;  3KJP A;  3L2P A;  4PG3 A;  2KCT A;  1VS0 A;  1VQN A;  3HOU H;  4BY1 G;  3GTL H;  2QEX A;  4EQ5 A;  1XNQ Q;  3CC4 A;  2ZTD A;  3KYH C;  2WAQ E;  4HJ7 A;  4WJ4 A;  2JQO A;  1Y14 B;  1JJC B;  4BY7 G;  2UUC Q;  3KDF B;  1B8A A;  1XJV A;  1PVO A;  3H3V H;  2Q2T A;  4DR7 Q;  3J7A 5;  3BU2 A;  3TRZ A;  1WJJ A;  5M5Y H;  3CCJ A;  3S1Q H;  2D62 A;  4Y52 H;  2LXK A;  5JEA G;  4L5R C;  3S15 H;  3CCS A;  2KBN A;  4DV4 L;  1EOV A;  4QL5 A;  1MKH A;  1ASY A;  2ASB A;  1QVG A;  3KDF A;  3M4P A;  5GQO A;  1VQ8 A;  4BY1 H;  4GOP B;  1PH8 A;  4NPS A;  2UUC L;  4IFD I;  1PA6 A;  4BBS G;  1WYD A;  4A75 A;  1GVP A;  4BY7 H;  4DK3 C;  4A3L G;  2MQH A;  1IBL Q;  3GD7 A;  1W2B A;  3FP9 A;  4DV6 Q;  1N36 Q;  1PV4 A;  4DUZ Q;  4IJL A;  1HNX Q;  2D0P A;  4KLK A;  2EXD A;  1Q82 C;  2I5L X;  3KLW A;  1PHJ A;  1M90 C;  3GO5 A;  3ULL A;  1N33 Q;  4LF6 Q;  4B3S L;  2ID0 A;  4OON A;  5BR8 L;  4YHH L;  4JI3 L;  3U58 A;  2VQE Q;  3HOW G;  1M1K C;  1B7Y B;  1N36 L;  3RN5 A;  1J5E L;  4A3L H;  4A3G G;  1X54 A;  4R4O A;  3F2B A;  1PH2 A;  2ES2 A;  1ASZ A;  4AYB E;  1KD1 C;  1D7Q A;  4JBW A;  1K9M C;  3HFZ B;  1EYG A;  1N33 L;  4YWK A;  4YY3 Q;  1L1O B;  1S72 A;  1VQP A;  3M4O H;  1UWV A;  4GNX B;  4A3F G;  2D0O A;  2PNH A;  2BH8 A;  1UE5 A;  1CSP A;  2ALY B;  3F1Z A;  4LFC L;  5HGQ A;  1U5K A;  3E0E A;  5IWA L;  4HJ5 A;  1AE3 A;  1L1O A;  1UE6 A;  4JI8 L;  1GM5 A;  1HZ9 A;  4GKK L;  2OCE A;  4GLA C;  4GNX A;  1GKH A;  4X64 L;  1V9P A;  4A3J G;  4A3G H;  4DV0 L;  3A5Z B;  1EQQ A;  2NN6 G; 
#chains in the Genus database with same CATH topology
 1E24 A;  3I4L A;  1AZP A;  2KEC A;  4H44 C;  1SMY C;  1YNN D;  3MTS A;  3F2C A;  1VQI A;  2GA4 B;  2L12 A;  2RQX A;  4AQY L;  4C3I B;  1MSG A;  2JJQ A;  2ZJR A;  3S9W A;  4C3J G;  1O7I A;  3ND8 A;  4V0B A;  2VXW A;  1Q12 A;  5E7N A;  5FJ8 G;  3K6O A;  4JI1 L;  2DUD A;  3M9B A;  4JI5 L;  3Q22 A;  3ONA B;  2WB1 E;  5HGT A;  4IJH A;  5FLX c;  1HZA A;  4ZYS A;  3PUZ A;  4DR1 L;  3OWF A;  1SRO A;  4PQX A;  4CGY B;  3E5S A;  4JI0 L;  3PMF A;  5M5W B;  4LNQ A;  4HID A;  5EPJ A;  2RA4 A;  4DV1 Q;  3UE1 A;  3TQY A;  3IAY A;  2F0F A;  1SJH D;  2PW5 A;  1BVS A;  1XXG A;  1J8I A;  1SFO H;  1HUM A;  1VQE A;  4R4Q A;  5BN3 A;  3S17 B;  3RD4 A;  2QKI C;  4B3T Q;  3NTK A;  1NNX A;  4I7A A;  1EYA A;  2HDL A;  5C3X A;  3QG1 A;  3S1M B;  3KUP A;  2E2J H;  1IXR A;  2A68 C;  5C3E G;  3T1Y Q;  2Z6K A;  3GTJ H;  2WAQ G;  5M5X B;  3NUC A;  5LMN L;  1B1Z A;  4Z9C B;  2VL6 A;  1OXS C;  4ZUJ A;  1VQ5 A;  5IGE A;  4KHZ A;  1F9S A;  1K8G A;  3NBH A;  2WB1 B;  4HIM A;  1GO3 E;  1YBY A;  2PQA B;  3D4W A;  2K52 A;  4XYO A;  4ZQ3 A;  2EYO A;  1XNQ L;  5EAY A;  5I9P A;  1GUN A;  4V19 0;  3O13 A;  4DV3 Q;  1F2Z A;  3D4D A;  2FFK B;  3S14 H;  3S2D B;  3RZD H;  5ELC A;  1Z47 A;  1F2M A;  2FMM A;  3NP8 A;  1VQ6 A;  1D8L A;  5IT9 L;  2NB0 A;  3W5O A;  1PH9 A;  2RDH A;  3WWV A;  3SVM A;  1K8M A;  4K2K A;  3CCQ A;  2EJG C;  2GN5 A;  1OXX K;  1CK1 A;  1CZW A;  3BS1 A;  1Q3L A;  3OSO A;  1WFQ A;  1R4Q B;  2JA6 B;  3KOJ A;  2UXD Q;  3D6W A;  1Q86 C;  2B2V C;  1KNA A;  1STA A;  2QDB A;  4LF8 Q;  5EGT A;  4DA2 A;  2EYF A;  1PRT B;  1I6V C;  3BZD B;  3FHW A;  4C3I H;  4J1M A;  2OEO A;  1BKB A;  2H4O A;  3J7Y W;  3UDG A;  1ET9 A;  4HTH A;  4LF6 L;  4RHS A;  1B70 B;  2K01 A;  4PZ8 A;  4A3B B;  1Z9F A;  5ELB A;  2ATW A;  2ZXP A;  2WKC A;  5HY6 A;  1W3S A;  2JA7 B;  5FOB B;  2VY3 A;  3ULJ A;  1XNR Q;  4P73 A;  1QJO A;  2I46 A;  1O7Y A;  1GXD C;  5F2D A;  3K5N A;  1X3G A;  1VQO A;  5GAE C;  3PO2 H;  3I4N H;  1EU3 A;  3CRL C;  3CXC A;  1TS5 A;  5D14 A;  3VYT A;  4QF4 A;  1CSQ A;  1YHA A;  2UU9 Q;  4MTN A;  2K04 A;  2OQ0 A;  3PV0 A;  4JI4 Q;  4FF1 A;  3KFU A;  3HZX A;  4DV5 Q;  2EYH A;  3S17 H;  5EPK A;  4NMZ A;  4GKJ Q;  2UXC Q;  4C1N I;  4ABN A;  4LUO A;  4JBM A;  3RN2 A;  1GUT A;  4ZAI A;  5JOB A;  2WV6 D;  3TS2 A;  3S1M H;  3J81 L;  1SND A;  1BR9 A;  4DNI A;  1K83 B;  1JCK B;  3G7L A;  4UY8 C;  1JWU D;  5KYL A;  1K0R A;  3K8A A;  2L55 A;  4P72 A;  3VR2 A;  3NPP A;  3OMG A;  4RKB A;  1NMG A;  4OWX B;  4KJN A;  1KDB A;  1J6Q A;  4A3K G;  3HOV G;  1Q46 A;  3GTP B;  3I4M B;  1LTR D;  1JJ2 A;  3NSW A;  5EJW A;  2B63 B;  4ZUI A;  1S5E D;  1SE2 A;  3RUZ A;  3RMH A;  4KJO A;  3TP7 A;  1QB5 D;  1I5F A;  3EQL C;  3S2D H;  4HCE A;  1CKO A;  1B2T A;  2VUM H;  1YNX A;  4DV1 L;  1STN A;  4QUF A;  4KI0 A;  5GRO A;  5M9O A;  4B3R Q;  2YTX A;  2OF1 A;  3PIO A;  5I6W A;  2B2Y A;  3NXW A;  3T1H Q;  5IYB H;  1YEZ A;  2VQF Q;  2F0I A;  4FXK C;  3WDN A;  4LF7 Q;  4Q5V A;  4B3T L;  4K5W A;  1LTG D;  4DV7 Q;  4HMJ A;  4YCV A;  1RIP A;  1BNZ A;  4YCW A;  5CV9 A;  3T1Y L;  1H9R A;  4P74 A;  5EKI A;  1L1O C;  1KL9 A;  4DAV A;  3I4O A;  4DAY A;  1CA6 A;  3CPF A;  1W6K A;  4J8Q A;  4DV4 Q;  4APV A;  1QCB D;  3H0G H;  2EQS A;  1E0B A;  1E22 A;  3T13 A;  4QGU A;  4K14 A;  4DV3 L;  1HTP A;  4RCO A;  2D9U A;  4IPG A;  5C4J H;  2ZXR A;  3F8T A;  1G51 A;  4C3H G;  1NBW A;  1TWA B;  4DK6 C;  3A55 A;  2I07 B;  1YJ9 A;  2ZTE A;  4F8M A;  4X6A H;  2OXP A;  1XPR A;  3K59 A;  5IT9 E;  1TWG B;  3J80 c;  2BH2 A;  3CPW A;  3RLF A;  3Q8D A;  4DXG A;  1NJI C;  3M7G A;  2JEB I;  4OO1 G;  3DWP A;  2A6H C;  4A3C G;  3L7Z C;  1NCV A;  5LL6 X;  4N8X 1;  3S1R B;  5M3F B;  4BA2 I;  2UXD L;  3A7A B;  1GOZ A;  3GV3 A;  1RL2 A;  3CME A;  2N8N A;  2HD3 A;  1CM9 A;  1EUJ A;  3AYH B;  2R7Z G;  2K75 A;  2Z0S A;  1QWY A;  5K36 G;  2E8G A;  4CBV A;  1ESF A;  5EQ0 A;  5E1F A;  5C0X G;  3UDX A;  4LFC Q;  3S1Q B;  4GKK Q;  5M5Y B;  5FLM G;  5FLX L;  2MNA A;  4X64 Q;  4DV0 Q;  2KHI A;  1KIX A;  2DJF C;  3GTP H;  4JYA Q;  1XNR L;  1GD7 A;  5E3F A;  5JJL A;  2B63 H;  1VQH A;  1OTC A;  5H1S E;  4B3M Q;  4XQQ A;  1QE6 A;  1ENA A;  1BOS A;  4X3U A;  3GP7 A;  3TP5 A;  3M4Q A;  2UU9 L;  1FR3 A;  4K8J A;  1F2L A;  4Q0F A;  1VQD A;  4JI4 L;  4NP5 A;  2R93 B;  3NWT A;  1HA5 A;  4GKJ L;  1QIL A;  2CQO A;  5M3M B;  2UXC L;  3OWE B;  3W1G A;  2K5V A;  1PFN A;  3X3M A;  3J81 i;  1IYV A;  4CJ2 C;  3LGJ A;  3FKI G;  4GLV B;  1P16 A;  1C7Y A;  1D6E C;  4OGQ C;  5NUC A;  1YJW A;  3J81 E;  1OO9 B;  3S1N B;  3K81 C;  2Y0S E;  3Q23 A;  2F4I A;  4S3S A;  3M7N A;  1WTW A;  2DN8 A;  1EZ6 A;  1C9O A;  1WCM B;  2E2H B;  5CBA E;  1YHQ A;  1YHB A;  5EBD A;  5IYC H;  3GTO B;  5IP7 H;  2IHE A;  5C5L A;  2JXM B;  4DNR B;  1L0W A;  2L5T A;  1TWA H;  4GN4 B;  2E5L Q;  1A3V A;  5EPL A;  3PF5 A;  5CV8 A;  4B3R L;  3HKZ G;  1KRS A;  4KD4 A;  1HRJ A;  4G7O C;  2YTV A;  2B3G A;  1CKN A;  2AUJ D;  1RTO A;  1ZEQ X;  2K4K A;  3T1H L;  4IAL A;  2VQF L;  4NW2 A;  4LF7 L;  3A7L A;  2TMP A;  5M3F H;  4K8I A;  2HIV A;  1N9W A;  1V1P B;  1AP0 A;  1YIJ A;  3PO3 H;  1YNJ D;  2FJ2 A;  2F0K A;  2VB2 X;  4PG3 A;  2KCT A;  1VQN A;  1B44 D;  2BCO A;  2Y0S B;  4EVO A;  2WAQ E;  4HJ7 A;  2MPM A;  2XRQ D;  1EYC A;  4OEM B;  3NK9 A;  3A54 A;  3BU2 A;  3J7A 5;  5M5Y H;  3S1Q H;  3CCJ A;  1LT3 D;  4DV4 L;  4QL5 A;  1MKH A;  3M4P A;  4BY1 H;  5JPN C;  1VQ8 A;  1F9Q A;  2Z4H A;  5T1G A;  4IFD I;  1PA6 A;  1WYD A;  4BY7 H;  2MQH A;  3P20 A;  1IBL Q;  2KCN A;  4DV6 Q;  2MP1 A;  2K5D A;  4DUZ Q;  5DEH A;  4IJL A;  2F0M A;  1Q82 C;  2I5L X;  2BOS A;  1H9S B;  3HOU B;  2EJF C;  2ID0 A;  1M1K C;  1N36 L;  4A3L H;  3F2B A;  2Q8T A;  4XYQ A;  2RDG A;  2EY6 A;  4JBW A;  1N33 L;  4YY3 Q;  1L1O B;  1QNK A;  2WAQ B;  1I6H B;  3M4O H;  1LAB A;  1PLF A;  3R3O A;  2ALY B;  2B2W A;  5HGQ A;  4XQJ A;  2B2U C;  4LFC L;  1VQM A;  1AE3 A;  4GKK L;  2OCE A;  4GNX A;  1GKH A;  4X64 L;  4A3G H;  4LMQ D;  4DV0 L;  2M00 A;  1EQQ A;  4JYA L;  2AQ2 B;  5DM7 3;  5FLX E;  4DFA A;  3KJO A;  3GTO H;  1TXY A;  2JN4 A;  3NHH A;  4A3F H;  4TVA B;  4DK1 A;  1PH7 A;  1H95 A;  1DJR D;  1VQF A;  4BBS B;  3K80 C;  4A3J H;  2PI2 E;  3F2U A;  2BA1 A;  1Y1W G;  1KAB A;  3K7A H;  1HQM C;  1FGB D;  2AUK A;  4JI6 Q;  2WAC A;  2LMC B;  5CGK A;  4GZY C;  1QUQ B;  4JI0 Q;  2NVT H;  4DK0 A;  1ENC A;  4LAA A;  1B4O A;  2F0S A;  1I4Q A;  1Q8K A;  2Q8R E;  3MVV A;  4HIK A;  3NEN A;  3NTI A;  3CHB D;  4C3J H;  1PTO F;  1SRU A;  5KNB A;  1TQO A;  4BA1 I;  1KXL A;  1O7Z A;  4EGV A;  4R8I A;  1BCP D;  5I6Y A;  1DON A;  4OHJ A;  2F1M A;  4A3E G;  1TU2 B;  2VS1 A;  4G7Z C;  1VQJ A;  2F0D A;  1L0X B;  3MXU A;  4UHV A;  2E5L L;  4DR2 Q;  3J80 L;  4P71 A;  1HFG A;  1K8A C;  2NTS A;  3L3O C;  5C44 G;  1II3 A;  3K5M A;  1WD0 A;  5IGB A;  4JOI A;  1I4P A;  1WTO A;  4X65 Q;  1HNZ Q;  3EFX D;  4DAM A;  3G48 A;  1A62 A;  3UI2 A;  1MJC A;  1YVC A;  3K0X A;  4L63 B;  1HNW Q;  5C4X G;  3T4A C;  1TWC B;  3LWU A;  3SK8 A;  3CAM A;  2K5Q A;  2RF4 A;  3TDQ A;  1I6H H;  1WOC A;  3RR5 A;  4A93 G;  1G29 1;  2WFW A;  4R9W A;  5COY A;  1SFO B;  1NTG A;  1N34 Q;  3A8K E;  4GN5 A;  4OX9 Q;  3W1B A;  1CFM A;  3C2P A;  3DWQ A;  2F52 A;  2E2D C;  1LTB D;  2AWO A;  1IHZ A;  3JAM c;  1UUP A;  1UNS A;  3H15 A;  3GTJ B;  4UP9 A;  4H13 C;  4CDD C;  3EJI A;  4ZKC B;  3L0O A;  5BN4 A;  3I72 A;  3HG9 A;  2CKZ B;  2YYZ A;  1KRT A;  4POF A;  4R4C A;  3BZC A;  1IBL L;  4YWM A;  4AYB G;  4BBS H;  1GUO A;  4A4I A;  4DV6 L;  1PTO H;  3E9H A;  4DUZ L;  4IUU A;  1YJN A;  3GTQ B;  4LF5 Q;  2F0W A;  1R9T H;  2WIN B;  2NTT A;  4I65 A;  2ZTC A;  1K0S A;  3KBG A;  3S14 B;  1IKL A;  1JWS D;  2F0P A;  1GHK A;  2UUA Q;  2MUY A;  1K28 A;  3MXN B;  1QVF A;  4FYD A;  4YY3 L;  3GQB A;  4IOC A;  2L9H A;  1H9J A;  1DM0 B;  2R7D A;  4QMG A;  3KLR A;  5AFW A;  4BXX G;  3OMC A;  3VR4 A;  3ER0 A;  1M4V A;  4KKU A;  2I0Q A;  3HGB A;  1QZG A;  2XWB B;  5KYI A;  3PUV A;  1XMO Q;  2PNR C;  4CDF C;  1SYG A;  1EIF A;  1EYD A;  2CHB D;  2F0E A;  1SNP A;  5JPM C;  2FXQ A;  1LM0 A;  4JG2 A;  1U9R A;  3HOY G;  2YV5 A;  4IZ8 A;  1IW7 D;  4C3H B;  4ZKB B;  2HT1 A;  5ELF A;  1VMC A;  2WII B;  3NWS A;  4RFB A;  3G4S A;  4J6H A;  2R6G A;  2MO1 A;  2V1C C;  1LO5 D;  4C2M H;  4IUV A;  5J3B A;  4K6L A;  1U0L A;  4NKL A;  1W6J A;  4A3D G;  4JI6 L;  2EXZ A;  4KKT A;  3MXP A;  2Q2I A;  4OIK A;  5IY0 A;  1ENF A;  3U50 C;  3PO2 B;  2R3Z A;  3I4N B;  1TWC H;  5C0X J;  4N8F A;  3ITP A;  2CWA A;  1Y69 U;  1A2T A;  1JB3 A;  3VR3 A;  2ZM6 Q;  2IY5 B;  5LL6 S;  1T5E A;  4DR4 Q;  1BXT A;  1LUZ A;  3SE0 A;  1BUV T;  4RH6 A;  4GOP C;  2PYK A;  2A6E C;  5IP9 G;  4DNT B;  2LXJ A;  3C1F A;  1GUS A;  5IYD G;  5LMN W;  1SE4 A;  1LT6 D;  1E7Z A;  3K0Y A;  4X3T A;  2RSN A;  4A3K H;  1YI2 A;  1FJG Q;  3AEV A;  3HOV H;  2KOL A;  3CQZ B;  4P2C B;  2PZT A;  2DGY A;  4BBR G;  1WTQ A;  3C1E A;  1PH1 A;  2AQ1 B;  3OW7 A;  4EX5 A;  3RNU A;  5CV7 A;  2B39 A;  3BJU A;  2F0V A;  1A3U A;  4IUT A;  3MZ5 A;  2EY1 A;  3OW2 A;  3R93 A;  2R92 G;  3J80 i;  3CKI B;  4DR2 L;  3SXH A;  3PIP A;  2PO4 A;  4U67 3;  3HKZ E;  2H5X A;  3GTQ H;  3J80 E;  1TY0 A;  1CHP D;  2TSS A;  5ELD A;  2VZA A;  4RG1 A;  1XTD A;  4X65 L;  1HNZ L;  2HCC A;  3OOC A;  2VUM B;  1HNW L;  3KF8 A;  2E2I H;  4LUV A;  2NVQ B;  2CFM A;  2X6G A;  4JK1 C;  2AWN A;  4ID6 A;  3CC7 A;  4JBJ A;  1KHI A;  1XTC D;  2ZT9 C;  3PCO B;  5IOC A;  4OX9 L;  1N34 L;  4QQB X;  1K3R A;  1IKM A;  1HZB A;  1CT1 D;  1VF5 C;  2WP8 J;  3E6Z X;  1PH6 A;  5C4H A;  1HHV A;  2LFN A;  3TSS A;  4B3S Q;  3BZK A;  5BR8 Q;  1NSN S;  2QCP X;  1G91 A;  4A3I G;  1B50 A;  4C3H H;  4CJ1 B;  2O2L D;  2MFI A;  2XNA C;  4R8N A;  1XPO A;  1HTL D;  3STB C;  1JJG A;  2A19 A;  2QIL A;  4B9W A;  4JW0 A;  4LF5 L;  3H0G B;  1RHP A;  1N8R C;  3U4Z A;  1D1K A;  1OXU A;  2B2T A;  4UAI A;  3KF6 B;  2HUG A;  3D31 A;  3I2Z A;  4ZCK A;  4OO1 H;  4A3C H;  1GJX A;  1X55 A;  1MI2 A;  4F7X A;  1H9K A;  5C4J B;  4IPH A;  3EVQ A;  2UUA L;  1A63 A;  3H3V I;  5DNF A;  2NBF A;  4WJ3 M;  2ICE C;  1PRT D;  1JR0 D;  2R7Z H;  5K36 H;  2MHV A;  2K33 A;  1XMQ Q;  1L2F A;  5C0X H;  4R1J A;  1ONL A;  2Z6K C;  4LUZ A;  5G3L D;  3ULP A;  4A3M G;  4TSS A;  5FLM H;  1XMO L;  1AEX A;  3CQZ H;  2XWJ B;  1F9P A;  2NVX H;  4FNF A;  1EY6 A;  3WOF A;  1JE4 A;  2I5H A;  5G3L F;  5KEE A;  2PQE A;  4QY7 A;  4CJ0 B;  4KK7 A;  2AMC B;  1LTT D;  2JA8 G;  3E3X A;  3HS0 C;  2A8V A;  1RD9 D;  3G6E A;  1GHJ A;  1U4P A;  3PUW A;  5IOD A;  3HOZ G;  3P75 A;  2A69 D;  3ERQ A;  3PSI A;  2NVQ H;  3U9O A;  3FKI H;  1EY4 A;  2ZM6 L;  4EQO A;  1SE3 A;  1B9N A;  3I7F A;  2CWP A;  4DR4 L;  1ZYR D;  1Y1V G;  1T5X D;  4JI2 Q;  2Z9H A;  2HCI A;  1FJG L;  3BG3 A;  1D5X C;  3JAM L;  2QA4 A;  4RWS C;  2SNS A;  5DM6 3;  1EWH A;  4ZK9 B;  1BO0 A;  2SEB D;  3GV6 A;  3JC6 6;  5CV5 A;  1IBK Q;  3DXJ C;  4L5Q A;  4HJ9 A;  1T9H A;  1SN8 A;  2FMC A;  2HHH Q;  3L2P A;  2A74 C;  2J0T D;  2ZTD A;  1Y1W B;  1WTP A;  4KMU C;  1Y14 B;  2SNM A;  4HMI A;  1AFP A;  1XJV A;  1WJJ A;  1S4Z A;  1TT2 A;  2FIN B;  3CCS A;  3S15 H;  3KDF A;  1PTO C;  4GOP B;  1PH8 A;  2UUC L;  4HR7 B;  3ND9 A;  4A75 A;  3DUZ A;  5KRU A;  1D1I A;  4X3K A;  3WOE A;  1HCZ A;  1N36 Q;  1SNM A;  2K05 A;  5TSS A;  3PO3 B;  3H94 A;  1HFN A;  3GO5 A;  1N33 Q;  4B3S L;  1HPC A;  5BR8 L;  3NQT A;  1X54 A;  4R4O A;  1PH2 A;  1ASZ A;  4AYB E;  2QDL A;  1SNC A;  1WTH A;  4YWK A;  3I73 A;  4RCN A;  2BDN A;  3HEJ A;  4BY1 B;  1U5K A;  3E0E A;  2E76 C;  1UE6 A;  3TZD A;  4BY7 B;  2B2Y C;  2A68 D;  5HUR A;  2RCF A;  1E1T A;  2IL8 A;  3QR8 A;  1STE A;  1I50 H;  4EQP A;  5ELN A;  3HOX G;  1XMQ L;  1EIG A;  3IRB A;  1S40 A;  1SE8 A;  2OTL A;  2PPB C;  3U4V A;  2ICI A;  2PCF B;  4O2D A;  4MTK A;  1XPU A;  2IX3 A;  1A3T A;  3CP0 A;  2G5D A;  4FO2 A;  3C46 A;  3M4O B;  2D2C C;  5A2Q L;  4LWC A;  3A8I E;  3CCE A;  5JVH 3;  4IPC A;  4A3G B;  5EBC A;  4HJA A;  1PDQ A;  3UDI A;  3U9S A;  2J7Z A;  1HR0 Q;  4B9X A;  1Q81 C;  1Y1W H;  3IFD A;  4FVM A;  1RF2 D;  2CW0 C;  1Q8I A;  4RGN A;  4A3F B;  2UUB Q;  2O5J C;  3X3N A;  1B3A A;  2QEJ C;  3NTH A;  5COR A;  4L5S A;  2P5Z X;  1PYW D;  1HA6 A;  1FGU A;  4A3J B;  2EDG A;  2JA6 G;  3M3Y B;  5GAD C;  4PNY A;  3S24 A;  4CDC C;  4IUR A;  3GTK H;  5C3W A;  1JT8 A;  3K7A B;  3MXG A;  5L37 A;  1UEB A;  1MHW C;  4MHE A;  3R2I A;  1PZK D;  4I7Z C;  4C1N K;  4JI2 L;  1RKN A;  5IGG A;  3JAM i;  2NVT B;  2IJ0 A;  3AB9 A;  3VA7 A;  1JOO A;  3T56 B;  1I3Q H;  4A3B G;  4QCL A;  1EEF D;  3JAM E;  4A3E H;  4KTA A;  3HP3 A;  4RGO S;  1YNN C;  1IBK L;  4CKE A;  4OIJ A;  1S5D D;  1G8Z D;  2M9V A;  4C3J B;  5I2Y A;  2JA7 G;  2HHH L;  2XSC A;  4G7H C;  1HZC A;  2NWG A;  1CHQ D;  1XWE A;  3CD6 A;  4X66 Q;  4JCV E;  1LT4 D;  2EYJ A;  3CMA A;  2PQA A;  1ICF B;  3D3R A;  2ZJP A;  2F0J A;  5LMU Q;  3QOJ A;  1G2T A;  1CUK A;  2KCC A;  3E9I A;  2OWO A;  4DR6 L;  1O7L A;  1RDP D;  3GTG B;  2D5D A;  1AW7 A;  5C4X H;  2NUC A;  1VQ9 A;  1HJP A;  3CCU A;  1A0I A;  4A93 H;  1FL0 A;  2IWH A;  1SYE A;  3AQQ A;  2NVY B;  3MEF A;  4RA8 A;  5KNC A;  3PUY A;  1AZQ A;  4LFA Q;  3V05 A;  2F0U A;  1VDZ A;  5J22 A;  1KLU D;  5CV4 A;  5C3E B;  2JP1 A;  3QO2 A;  2EVB A;  3G71 A;  2C35 B;  2Q8I B;  4NXN Q;  1X56 A;  3I4M G;  1WI5 A;  1PXU A;  1NE3 A;  4DKA C;  1EZ8 A;  2CH4 W;  3DEP A;  4UP7 A;  1FNU A;  3NE5 B;  3R8B A;  3I8Z A;  2KHJ A;  1PYB A;  3B6Y A;  3FMC A;  5JJI A;  1D2B A;  2EE1 A;  2F3V A;  4MZ9 A;  3DM3 A;  5IT9 c;  5JJK A;  1X65 A;  2EOT A;  4K5V A;  4GS3 A;  4CKC A;  1NUC A;  1DOK A;  4CHT B;  2K50 A;  1PTO B;  1CA5 A;  3M3Y H;  3IFT A;  2CCZ A;  1YIT A;  1QZH A;  2NN6 H;  4CDE C;  3K5O A;  4BXX H;  1JIC A;  1EFW A;  4GN3 B;  1R9T B;  4ME5 A;  1LV9 A;  2K14 A;  1E2Z A;  3PGZ A;  2M2L A;  1EY5 A;  2DJG C;  4PZ6 A;  4LFB Q;  2JA5 G;  1F9R A;  1EIH A;  2IPK D;  1XYI A;  3S16 H;  4IFD G;  1I4X A;  4N9P A;  1EY9 A;  3GTM H;  3HOY H;  4HJ8 A;  4X62 Q;  1JB7 A;  1KNE A;  3H6M A;  4A3I B;  3AFP A;  4RGT A;  3TP6 A;  1EY8 A;  5FJ8 H;  2VW9 A;  5I9O A;  3I91 A;  1O78 A;  1VQG A;  2LY7 A;  3NEM A;  4GLX A;  1LTI D;  1B3Q A;  2XIW A;  1HR0 L;  2RHQ B;  1TVX A;  2OTJ A;  1SYD A;  2HDM A;  4A3D H;  2NZO A;  3M85 A;  2G9H D;  1N32 Q;  2UUB L;  4OWT B;  3IL8 A;  1STG A;  5D3D A;  5FK9 C;  3GTG H;  2GVA A;  2IW3 A;  1SBB B;  4XT3 B;  1BCP F;  4WOR A;  3PQI A;  2DNC A;  1NAP A;  3FRP B;  3L9A X;  3S2H B;  1FVI A;  2N88 A;  4C2M B;  2EJM A;  2PZU A;  1WVL A;  2NVY H;  5IP9 H;  4R4T A;  5IYD H;  2O5I C;  3A5U A;  4XTC S;  4DAY B;  4BBR H;  3OPO A;  1ESR A;  2LS0 1;  2F0L A;  2B2W C;  5C3E H;  5FO7 B;  4GNX C;  1Q90 A;  1PFB A;  3RLN A;  1UEA B;  2K1B A;  1V43 A;  1JOQ A;  2R92 H;  1EY0 A;  3ERO A;  1NY4 A;  4ZLT F;  3AFQ A;  1FYC A;  4ALP A;  4X66 L;  1BBW A;  4A3K B;  1UE1 A;  3HOV B;  4ZRZ A;  2JE6 I;  1MGS A;  3VYS A;  1PH5 A;  4KY7 A;  4HN7 A;  4LJZ C;  5LMU L;  3OYY A;  2SDF A;  3J81 j;  4G57 A;  3HOZ B;  3PIO 3;  4XDX A;  2N55 A;  1G6Z A;  1Y8P B;  2EY5 A;  2L1B A;  3K7U C;  3HRZ C;  1DCZ A;  2R93 G;  1TS3 A;  2CQA A;  1PH4 A;  1K8O A;  2QW7 A;  1MBY A;  5M3M G;  1Y1V B;  3TEH B;  2A69 C;  4GOP A;  4RMF A;  1Q7Y C;  1J5E Q;  3TRE A;  5IE8 A;  1AE2 A;  5JJZ A;  4LFA L;  3GTL B;  2E2I B;  1ROD A;  2K5N A;  3K58 A;  1D5Z C;  4K6D A;  1WCM G;  2QF7 A;  4A3I H;  1KAA A;  4NXN L;  1ILP A;  1DYQ A;  2X6L A;  5FO9 B;  4K5X A;  1KAW A;  3Q24 A;  4DAP A;  2AKW B;  4M1U B;  4HAE A;  5I2X A;  4U68 A;  4QUC A;  3HKS A;  3T51 B;  1BDO A;  2IX0 A;  3QJY A;  4P75 A;  3CCV A;  4Y7N H;  1Q1E A;  2UXB Q;  3N52 A;  3SDZ A;  1LTL A;  4PZ7 A;  4JOI C;  1VQC A;  4YCU A;  1Z6H A;  5JAV A;  1U4M A;  2KVM A;  3S2H H;  1CQV A;  3A74 A;  3EIV A;  3IKJ A;  2V4D A;  5D3I B;  1PMR A;  2XRS D;  1F77 A;  2AHO B;  3Q6S A;  1E2W A;  1H9M A;  1TWF H;  2Y0S G;  4A3M H;  1IL2 A;  2B2V A;  4LFB L;  1S3O A;  1UAP A;  4L6T B;  2J4X A;  1DGS A;  1WTR A;  2R7Z B;  1A6X A;  2KA7 A;  2EYM A;  4X62 L;  3LX0 A;  3CCL A;  3W2D A;  1SLJ A;  4JBK A;  1VQK A;  2JYO A;  5GAH C;  3D6C A;  3AU7 A;  4LF4 Q;  1NMF A;  2ZJQ A;  1P8L A;  3DEO A;  3FVQ A;  1X9N A;  2JA8 H;  1DOM A;  3BVM A;  2NVX B;  1QNU A;  4PMW A;  1C8C A;  1EL0 A;  1N32 L;  3MHB A;  4L8J A;  1CKN B;  3UDF A;  1X3F A;  3HOZ H;  4A76 A;  4O0A A;  4AIM A;  1WD1 A;  3TME A;  3HOU G;  1E1O A;  4H0L C;  4OXP A;  3NBI A;  1WTX A;  2Q2U A;  3MA2 B;  1C4Q A;  1Y1V H;  4RAU C;  5FO8 B;  3HOX B;  4O1N A;  4FDB A;  1IYJ B;  3D0F A;  5E4W C;  3KJP A;  1SJE D;  1Y8N B;  1VS0 A;  3GTL H;  2QEX A;  1U4R A;  1RCV D;  5KGU A;  3KYH C;  3FKI B;  1M8A A;  1V1P A;  4F87 A;  1RTN A;  2E74 C;  4H7B A;  4TRD A;  2KQ3 A;  3E0J A;  3MFG A;  5IGC A;  2UUC Q;  1PVO A;  3H3V H;  4DR7 Q;  1A15 A;  1G6P A;  3TRZ A;  4K2L A;  4Y52 H;  3K5L A;  1XX8 A;  2LXK A;  5JEA G;  4L5R C;  3FDT A;  1ASY A;  1QVG A;  2DY8 A;  1SXT A;  2F0N A;  4IQZ A;  4NPS A;  4BBS G;  1O80 A;  2EYP A;  4WJW A;  2F0O A;  4DK3 C;  3C3L A;  3VYR A;  4EQN A;  1JC7 A;  1W2B A;  3FP9 A;  5T1I A;  5ISR A;  1HNX Q;  4UDU C;  1TWH B;  4KLK A;  3HKZ B;  2YU9 B;  3DHQ A;  1D5M C;  2KEE A;  4OON A;  3U58 A;  2VQE Q;  2Z1C A;  3HOW G;  3H91 A;  1X3Q A;  3KLS A;  3KLS X;  1J5E L;  4IUP A;  1H9S A;  2ES2 A;  3URY A;  1DXM A;  1KD1 C;  2HQE A;  1K9M C;  3HFZ B;  4MN3 A;  1EYG A;  3S15 B;  1S72 A;  5CYU A;  4GNX B;  2F03 A;  3FPP A;  1JOK A;  4BS9 A;  2D0O A;  1KTK A;  2PNH A;  4MIU A;  1ET6 A;  2BH8 A;  1UE5 A;  2BE5 D;  4PMC A;  3F1Z A;  2C5C A;  3DMU A;  4HJ5 A;  1STH A;  1L1O A;  1GM5 A;  1HZ9 A;  1YNJ C;  3A5Z B;  3V2T A;  2F0Q A;  1JOR A;  1B9M A;  3ERS X;  1PRT F;  2OQK A;  3MC0 B;  5M5W H;  2IT1 A;  1Z7T A;  2XTI A;  4DR3 Q;  2OT2 A;  3VR5 A;  5IGD A;  2UXB L;  3T53 B;  3NEL A;  1VCI A;  3BVG A;  1PYS B;  4FP5 D;  5E4X A;  1MIU A;  1E3P A;  3TN2 A;  2JA9 A;  3HOX H;  4IOA A;  4K0K Q;  2KED A;  4E6I A;  1PFM A;  5M5X H;  4IPD A;  3QWN A;  1SYB A;  4HSP A;  2CVR A;  1QUQ A;  2RSO A;  4H02 A;  3SEB A;  4IUQ A;  2LSS A;  3A0J A;  1I50 B;  4OO1 I;  2PZW A;  1S5C D;  1WTV A;  1BF4 A;  1CZG A;  1CKM A;  3MAQ A;  3CW2 C;  3G6J B;  4LF4 L;  5BN5 A;  2Z6B A;  1FNV A;  2L4N A;  2A1A A;  2PMZ E;  4KN4 C;  4NXM Q;  1TY2 A;  2K5H A;  1IZ6 A;  4DR5 Q;  1OXV A;  1G2S A;  1X32 A;  3SGI A;  5DLQ E;  5DAU A;  4YIJ A;  5C0X I;  1MJE A;  1LAC A;  2B2T C;  4J15 A;  5JVG 3;  2RVL A;  1TS2 A;  4X3S A;  1TWH H;  1GUG A;  1Q1B A;  3TBI B;  2YU9 H;  1TII D;  2JA6 H;  1SDF A;  2PI2 A;  5EKK A;  1SNQ A;  1DZ1 A;  2R61 A;  4KY5 A;  2BDO A;  2HIX A;  3FPU B;  2X69 A;  1SMY D;  4IFD J;  1DOL A;  5CBE E;  4ULL A;  2B8F A;  4ILW A;  4DR6 Q;  1I4G A;  4ODG A;  1SEB D;  5D65 A;  1CTM A;  3K57 A;  2NZH A;  4AH6 A;  4A3B H;  2JA5 B;  4DV2 Q;  2R7F A;  2O4X A;  3MWY W;  3I90 A;  3RZO B;  1Y8O B;  3GTK B;  5C6A A;  4DR7 L;  2JA7 H;  1K3B C;  2KHS A;  3QOL A;  1I4H A;  1TR5 A;  1STY A;  4C3I G;  2ZXO A;  3SK4 A;  4JV5 Q;  2EPB A;  2PMZ B;  1A8V A;  4PMB A;  1I3Q B;  3LWE A;  1ILQ A;  4N9T A;  1C48 A;  4UPA A;  1LTA D;  4A3E B;  4KHV A;  3H09 A;  4NDX A;  3QIA A;  2L15 A;  2H1E A;  3TP8 A;  2XGT A;  3BYT B;  3FEW X;  1BCP C;  1HNX L;  3ICE A;  2N49 A;  3VYU A;  4M8A A;  1EQV A;  1K73 C;  1E2V A;  4KKS A;  2VQE L;  5C44 B;  2F3I A;  3I55 A;  3I4N G;  3PO2 G;  2A6E D;  4LF8 L;  4QJF A;  4DPG A;  3BDO A;  4DU9 A;  1K83 H;  2RKS A;  1JQY D;  4KN7 C;  4LF9 Q;  3MFY A;  5C4X B;  2N78 A;  4F88 A;  1AH9 A;  3LNN A;  1IYU A;  3MXN A;  1BQQ T;  4QB4 A;  5AJ3 Q;  1LLR D;  4A93 B;  3A56 A;  3F2D A;  4QIW E;  2EZV A;  2F4V Q;  4WRD A;  1BBU A;  3I4M H;  4TQU S;  3RLO A;  2KUM A;  2PW7 A;  1PZJ D;  1IBM Q;  1I4R A;  1QVC A;  1EY7 A;  1A2U A;  2RDF A;  1U4L A;  4DUY Q;  4FF4 A;  5LHY 1;  4DR3 L;  3BDL A;  2WB1 G;  4KD3 A;  3GDE A;  4RGM A;  3T16 A;  1TKW B;  1JE5 A;  3M4Y A;  1KDC A;  4AYB B;  4G4K A;  4JI7 Q;  2B8G A;  2JK8 A;  4R4I A;  4DV5 L;  1EIY B;  2MO0 A;  5CV6 A;  2E75 C;  1HXY D;  2SOB A;  3W3A A;  1VQL A;  1ZKO A;  4KHP Q;  2VUM G;  4K0K L;  4LK1 C;  1ML0 D;  3V96 A;  3D8G A;  1I94 Q;  1LYL A;  2C9O A;  3P1H A;  1HH2 P;  2B29 A;  3CU7 A;  1YZ6 A;  5I4D A;  2JA5 H;  5IYB G;  4FXG C;  3CCR A;  4IFD H;  4XT1 B;  1VQ7 A;  2JEA I;  2IHF A;  4RKL A;  3RZO H;  4QIW B;  3CF5 A;  4C56 C;  3SR1 A;  1X3E A;  3OTO Q;  3STB D;  2B2U A;  4YWL A;  1L0Y B;  4KV6 A;  2BA0 A;  2LKV A;  2F0H A;  4NXM L;  1EEI D;  2F3W A;  3QB3 A;  3NBH B;  3S16 B;  4DR5 L;  1SMX A;  2MGS A;  3I56 A;  3GTM B;  1R4P B;  3EN2 A;  3HOY B;  4HIO A;  4DN4 M;  1TS4 A;  1TWG H;  3VDY A;  1QG7 A;  1CQF A;  3H0G G;  4JC0 A;  1V8Q A;  1MSH A;  3H3V C;  1J9O A;  5EKL A;  3ZJY C;  3UE0 A;  1MD2 D;  3SHL A;  2A73 B;  3N6R A;  2CH4 A;  3S1R H;  2KCM A;  3KF8 B;  1IW7 C;  1STB A;  4O42 A;  4DV7 L;  3DM1 A;  2K7V A;  5C44 H;  2GVB A;  3TS0 A;  2KEN A;  4A3D B;  5IIF A;  4OL7 A;  5CC4 A;  5ELE A;  2NZ1 D;  3J7A F;  4XQN A;  2K03 A;  4DXF A;  2RBM A;  1KC8 C;  4DF7 A;  4DV2 L;  4JPB W;  1PZI D;  2RHS B;  4IN3 A;  1EU4 A;  5IGF A;  5KIX A;  1EFI D;  3OHX C;  3CRK C;  4IO9 A;  4PV1 C;  3ZYY X;  1SYF A;  3I3C A;  5A35 A;  1NR2 A;  4JV5 L;  2VB3 X;  1PFS A;  2K5W A;  2JSO A;  4BBR B;  2G9D A;  4POG A;  5CMD A;  3PIP 3;  4YHH Q;  4JI3 Q;  2Q2H A;  4ME3 A;  1KDA A;  4WFN 3;  4MNO A;  2R92 B;  1CI3 M;  2R93 H;  2B63 G;  4LW1 A;  4L5T A;  1JWM D;  1S5B D;  3BYY B;  2Z4I A;  5M3M H;  3EBE A;  5GAG C;  2RCN A;  3PF4 A;  1HUN A;  5IWA Q;  3KBX A;  2FHT A;  5ELO A;  4JI8 Q;  3OIP A;  3R2T A;  2IX1 A;  3OIQ A;  1FNW A;  3KF6 A;  1EQT A;  3MEH A;  4LF9 L;  4CKB A;  1VQB A;  3S1N H;  1AN8 A;  5JEA J;  5KND A;  3J7A V;  2QGQ A;  2F0T A;  4TKO B;  1PH3 A;  2YTY A;  1WCM H;  5AJ3 L;  2E2H H;  1SSO A;  3D4R A;  1EWC A;  2F4V L;  2VNU D;  2AQ3 B;  2HQL A;  3SK6 A;  4AQY Q;  4FXD A;  2A5H A;  1SR3 A;  3VR6 A;  4B3M L;  4HED A;  1IBM L;  3I70 A;  4BWG B;  1UE7 A;  2XN9 C;  4UP8 A;  4DUY L;  1F2Y A;  3BVZ A;  1VQA A;  4JI1 Q;  1HR0 W;  1ICW A;  2I5M X;  2Z8L A;  4JI5 Q;  1BCP B;  5K5P A;  4FF2 A;  1JMC A;  2N3S A;  4HCS A;  1VQ4 A;  4JI7 L;  5A2Q E;  1OXT A;  2F0G A;  5IYC G;  4XIG S;  1EQR A;  3P7J A;  4DR1 Q;  5IP7 G;  1PTO D;  3EA6 A;  1LTS D;  2WKD A;  4KHP L;  3CCM A;  3HOW B;  2A6H D;  2DY7 A;  1SAP A;  1I94 L;  1C0A A;  3BDC A;  4Y7N B;  3CC2 A;  1X6O A;  1IL8 A;  2K28 A;  5C4Z A;  1KQS A;  1LT5 D;  2MJ8 A;  3Q0A A;  3NQI A;  3J7Z C;  5M3F G;  5J1Z A;  4OWW B;  3PO3 G;  4DGZ A;  1EWI A;  1EOT A;  3OTO L;  4RHR A;  3A8J E;  1HQR D;  3PUX A;  3KK7 A;  3J81 c;  1PRT C;  4A3M B;  1TWF B;  1ZXT A;  3DLL A;  2BE5 C;  5LMN Q;  4NB3 A;  2ENB A;  4HSV A;  2NN6 I;  2DNE A;  1QOH A;  1SYC A;  2NYZ D;  2EIF A;  1V1Q A;  5CR3 A;  3HOU H;  4BY1 G;  4EQ5 A;  1XNQ Q;  3CC4 A;  4WJ4 A;  2JQO A;  1JJC B;  2JA8 B;  4BY7 G;  4IUN A;  1V1O A;  3KDF B;  1B8A A;  3TZU A;  2Q2T A;  2XVS A;  1DD2 A;  2D62 A;  1GUW A;  2EYL A;  2KBN A;  1EOV A;  2ASB A;  5GQO A;  4FF3 A;  3DWA A;  5FKA C;  1GVP A;  4A3L G;  4B08 A;  3GD7 A;  2L0C A;  2E2J B;  5JEA H;  1PV4 A;  2L11 A;  4JVZ A;  4XXE A;  2D0P A;  2EXD A;  3KLW A;  1PHJ A;  1M90 C;  3ULL A;  4LF6 Q;  1ZYR C;  1VF7 A;  1BBX C;  1RJT A;  1X3P A;  4JI3 L;  4YHH L;  3AMU A;  2CW0 D;  1B7Y B;  3RN5 A;  4A3G G;  2K6A A;  1SNO A;  1D7Q A;  1FD7 D;  1NR4 A;  1VQP A;  1UWV A;  4A3F G;  1S5F D;  1VMP A;  4KY6 A;  4OEL B;  5C5M A;  3RZD B;  1B53 A;  2EY2 A;  3HOW H;  1CSP A;  5IWA L;  5J39 A;  4JI8 L;  4GLA C;  1V9P A;  2K32 A;  4A3J G;  1KLG D;  3SK5 A;  2KJX A;  2NN6 G;  3VA5 A; 
#chains in the Genus database with same CATH homology
 3ERS X;  1E24 A;  1E1T A;  3KJO A;  3GTO H;  1TXY A;  1I50 H;  2OQK A;  4A3F H;  5ELN A;  3HOX G;  5M5W H;  4TVA B;  1XMQ L;  2IT1 A;  2XTI A;  1PH7 A;  3IRB A;  1S40 A;  1SE8 A;  2OTL A;  3F2C A;  1H95 A;  1VQF A;  4DR3 Q;  1VQI A;  2UXB L;  3K80 C;  3U4V A;  4O2D A;  4A3J H;  2PI2 E;  4AQY L;  3NEL A;  1XPU A;  2JJQ A;  1VCI A;  2ZJR A;  2BA1 A;  3CP0 A;  1PYS B;  1Y1W G;  1MIU A;  1E3P A;  1O7I A;  3K7A H;  4JI6 Q;  1Q12 A;  2JA9 A;  3HOX H;  5E7N A;  5FJ8 G;  4IOA A;  4K0K Q;  4JI1 L;  1QUQ B;  4JI0 Q;  2DUD A;  4LWC A;  2NVT H;  3M9B A;  4JI5 L;  3CCE A;  2WB1 E;  5M5X H;  4IJH A;  5FLX c;  4IPC A;  4IPD A;  1HZA A;  4HJA A;  3UDI A;  1QUQ A;  3PUZ A;  4DR1 L;  4H02 A;  1HR0 Q;  1SRO A;  1Q81 C;  1Q8K A;  2LSS A;  4HIK A;  1Y1W H;  3NEN A;  3A0J A;  4C3J H;  4JI0 L;  1SRU A;  4OO1 I;  4BA1 I;  2UUB Q;  4LNQ A;  1KXL A;  4HID A;  4DV1 Q;  3UE1 A;  4L5S A;  1CKM A;  3CW2 C;  3TQY A;  4LF4 L;  1FGU A;  1BVS A;  2A1A A;  2JA6 G;  5GAD C;  2PMZ E;  1SFO H;  4NXM Q;  3S24 A;  4A3E G;  1VQE A;  2VS1 A;  4R4Q A;  3GTK H;  2K5H A;  1VQJ A;  1IZ6 A;  4DR5 Q;  1OXV A;  1JT8 A;  4B3T Q;  3SGI A;  1UEB A;  5DLQ E;  5C0X I;  2E5L L;  4JI2 L;  1MJE A;  4DR2 Q;  3JAM i;  2E2J H;  1IXR A;  4J15 A;  4P71 A;  5C3E G;  3T1Y Q;  1K8A C;  1TWH H;  2Z6K A;  3GTJ H;  2WAQ G;  1Q1B A;  4A3B G;  1I3Q H;  2YU9 H;  5C44 G;  2JA6 H;  5LMN L;  2PI2 A;  4A3E H;  2VL6 A;  4JOI A;  1IBK L;  4X65 Q;  1HNZ Q;  1OXS C;  2HIX A;  4DAM A;  2JA7 G;  3G48 A;  1VQ5 A;  1A62 A;  2HHH L;  1MJC A;  4KHZ A;  1K8G A;  4HIM A;  4IFD J;  1YVC A;  1GO3 E;  1YBY A;  2PQA B;  1HZC A;  3K0X A;  1HNW Q;  2K52 A;  5C4X G;  4DR6 Q;  3CAM A;  3CD6 A;  4X66 Q;  4JCV E;  1XNQ L;  5EAY A;  2RF4 A;  2NZH A;  4AH6 A;  1I6H H;  4A3B H;  1WOC A;  3RR5 A;  3CMA A;  4DV3 Q;  2PQA A;  4DV2 Q;  1G29 1;  2R7F A;  2WFW A;  3RZD H;  3S14 H;  2ZJP A;  5LMU Q;  4A93 G;  1Z47 A;  1NTG A;  1CUK A;  1N34 Q;  4GN5 A;  4OX9 Q;  1VQ6 A;  1D8L A;  3W1B A;  2JA7 H;  3W5O A;  3E9I A;  1PH9 A;  2OWO A;  4DR6 L;  4DR7 L;  2F52 A;  3WWV A;  3CCQ A;  2AWO A;  5C4X H;  2GN5 A;  1OXX K;  1VQ9 A;  4JV5 Q;  1HJP A;  1A8V A;  3JAM c;  3CCU A;  3H15 A;  1A0I A;  1WFQ A;  4UP9 A;  3L0O A;  4A93 H;  1FL0 A;  3KOJ A;  3AQQ A;  4UPA A;  2CKZ B;  2UXD Q;  1Q86 C;  3MEF A;  2YYZ A;  1KRT A;  4POF A;  4R4C A;  3BZC A;  1IBL L;  4YWM A;  2L15 A;  4AYB G;  4BBS H;  4LF8 Q;  2XGT A;  4A4I A;  4DV6 L;  3PUY A;  3FHW A;  3E9H A;  4LFA Q;  4C3I H;  4DUZ L;  1HNX L;  3ICE A;  2N49 A;  1BKB A;  1YJN A;  3UDG A;  4LF5 Q;  4LF6 L;  1B70 B;  1R9T H;  4PZ8 A;  2ZTC A;  1K73 C;  1Z9F A;  2VQE L;  3PO2 G;  2F3I A;  3I55 A;  3I4N G;  3G71 A;  4LF8 L;  4QJF A;  2C35 B;  4NXN Q;  4DPG A;  2ATW A;  1X56 A;  3I4M G;  1WI5 A;  5HY6 A;  1W3S A;  2UUA Q;  1NE3 A;  1K83 H;  4DKA C;  4UP7 A;  2VY3 A;  4LF9 Q;  3MXN B;  1QVF A;  3ULJ A;  1XNR Q;  4YY3 L;  4IOC A;  4P73 A;  1VQM A;  2N78 A;  2KHJ A;  1PYB A;  2R7D A;  3B6Y A;  1AH9 A;  5JJI A;  1X3G A;  4BXX G;  1VQO A;  5GAE C;  3ER0 A;  4MZ9 A;  5JJK A;  3PO2 H;  3DM3 A;  5IT9 c;  2I0Q A;  3I4N H;  1X65 A;  5AJ3 Q;  1QZG A;  4GS3 A;  3F2D A;  2F4V Q;  3PUV A;  4QIW E;  3CXC A;  3I4M H;  1BBU A;  1XMO Q;  4TQU S;  1CSQ A;  1EIF A;  1YHA A;  2UU9 Q;  4MTN A;  2K50 A;  3RLO A;  2OQ0 A;  3PV0 A;  4JI4 Q;  1IBM Q;  3M3Y H;  3KFU A;  2CCZ A;  2FXQ A;  1LM0 A;  4JG2 A;  1QVC A;  4DV5 Q;  1YIT A;  1QZH A;  3HOY G;  3S17 H;  2YV5 A;  4GKJ Q;  4BXX H;  1EFW A;  4GN3 B;  4DUY Q;  2UXC Q;  4LUO A;  4JBM A;  3RN2 A;  2HT1 A;  4DR3 L;  2WB1 G;  2K14 A;  3GDE A;  3TS2 A;  3PGZ A;  3S1M H;  1JE5 A;  3G4S A;  4JI7 Q;  4PZ6 A;  4DNI A;  2JK8 A;  4R4I A;  4DV5 L;  1EIY B;  2MO0 A;  2MO1 A;  2R6G A;  2V1C C;  4LFB Q;  2JA5 G;  4C2M H;  4UY8 C;  5J3B A;  3S16 H;  4IFD G;  1U0L A;  3HOW H;  3GTM H;  1K0R A;  4HJ8 A;  3K8A A;  1VQL A;  4X62 Q;  4JI6 L;  1JB7 A;  4P72 A;  3HOY H;  2VUM G;  4A3D G;  4KHP Q;  4K0K L;  4OWX B;  2Q2I A;  1NMG A;  5IY0 A;  3AFP A;  1J6Q A;  3U50 C;  5FJ8 H;  4A3K G;  2VW9 A;  1I94 Q;  1LYL A;  3HOV G;  1Q46 A;  1HH2 P;  1TWC H;  5C0X J;  1VQG A;  3NEM A;  2B29 A;  2CWA A;  1JJ2 A;  1YZ6 A;  4GLX A;  2ZM6 Q;  2IY5 B;  1HR0 L;  2JA5 H;  5IYB G;  2RHQ B;  4DR4 Q;  3CCR A;  1LUZ A;  1VQ7 A;  3S2D H;  1I5F A;  4GOP C;  2IHF A;  2JEA I;  1CKO A;  2OTJ A;  4A3D H;  5IP9 G;  2NZO A;  3M85 A;  2LXJ A;  3RZO H;  2VUM H;  2UUB L;  1N32 Q;  1YNX A;  5IYD G;  5LMN W;  4OWT B;  1E7Z A;  4DV1 L;  3CF5 A;  4KI0 A;  5GRO A;  1X3E A;  4A3K H;  3GTG H;  4B3R Q;  2GVA A;  3STB D;  3OTO Q;  1YI2 A;  1FJG Q;  3AEV A;  2YTX A;  3HOV H;  2DGY A;  4BBR G;  4YWL A;  1PH1 A;  4EX5 A;  2BA0 A;  3PIO A;  3RNU A;  4NXM L;  3T1H Q;  3BJU A;  5IYB H;  1YEZ A;  2VQF Q;  1FVI A;  3NBH B;  4LF7 Q;  4DR5 L;  1SMX A;  4B3T L;  3OW2 A;  2NVY H;  5IP9 H;  3I56 A;  3EN2 A;  2R92 G;  4R4T A;  4DV7 Q;  4HIO A;  3J80 i;  5IYD H;  4DR2 L;  1TWG H;  3VDY A;  3PIP A;  4YCV A;  3A5U A;  1RIP A;  3H0G G;  4JC0 A;  4XTC S;  4YCW A;  4DAY B;  3T1Y L;  4BBR H;  3ZJY C;  3HKZ E;  3UE0 A;  2H5X A;  4P74 A;  3GTQ H;  3S1R H;  5C3E H;  1L1O C;  2KCM A;  3KF8 B;  4GNX C;  2VZA A;  4DV7 L;  1KL9 A;  1XTD A;  4RG1 A;  4X65 L;  3I4O A;  5C44 H;  1HNZ L;  3RLN A;  2GVB A;  3TS0 A;  1V43 A;  2KEN A;  3CPF A;  2R92 H;  1NY4 A;  1HNW L;  3AFQ A;  4ALP A;  2E2I H;  4LUV A;  4DV4 Q;  2CFM A;  3H0G H;  4APV A;  2EQS A;  1BBW A;  1E22 A;  4X66 L;  2AWN A;  1UE1 A;  3CC7 A;  4JBJ A;  2JE6 I;  1KC8 C;  4QGU A;  4DV3 L;  1KHI A;  1PH5 A;  4DV2 L;  4IPG A;  5C4J H;  2RHS B;  3F8T A;  3PCO B;  1G51 A;  3OYY A;  3J81 j;  5LMU L;  1N34 L;  4OX9 L;  1NBW A;  4DK6 C;  4QQB X;  1K3R A;  1YJ9 A;  2ZTE A;  4X6A H;  1HZB A;  2WP8 J;  1PH6 A;  4IO9 A;  3K7U C;  1XPR A;  2R93 G;  3J80 c;  1PH4 A;  4JV5 L;  2BH2 A;  1PFS A;  3CPW A;  3RLF A;  3Q8D A;  1NJI C;  5M3M G;  4B3S Q;  4POG A;  2JEB I;  4OO1 G;  3TEH B;  3BZK A;  3L7Z C;  5BR8 Q;  4YHH Q;  4JI3 Q;  4A3C G;  2Q2H A;  4A3I G;  4BA2 I;  2UXD L;  4C3H H;  4GOP A;  4ME3 A;  4RMF A;  1Q7Y C;  1J5E Q;  2MFI A;  3TRE A;  5IE8 A;  1RL2 A;  3CME A;  2N8N A;  4MNO A;  1XPO A;  3STB C;  1JJG A;  1AE2 A;  2A19 A;  2R93 H;  4LFA L;  1EUJ A;  3AYH B;  2R7Z G;  2K75 A;  2Z0S A;  4LW1 A;  4L5T A;  2B63 G;  5K36 G;  2E8G A;  4LF5 L;  1N8R C;  3U4Z A;  2K5N A;  1OXU A;  5M3M H;  3EBE A;  3KF6 B;  3D31 A;  3I2Z A;  5GAG C;  4A3C H;  5C0X G;  1X55 A;  1WCM G;  2RCN A;  3UDX A;  3PF4 A;  4A3I H;  5IWA Q;  4IPH A;  4NXN L;  4LFC Q;  4GKK Q;  5ELO A;  4JI8 Q;  5FLM G;  2MNA A;  2IX1 A;  4X64 Q;  2UUA L;  4DV0 Q;  2KHI A;  1KAW A;  3KF6 A;  1KIX A;  2AKW B;  4LF9 L;  3GTP H;  3H3V I;  1A63 A;  1VQB A;  3S1N H;  1XNR L;  1GD7 A;  4JYA Q;  4WJ3 M;  3HKS A;  2R7Z H;  5JJL A;  2B63 H;  1VQH A;  5JEA J;  1OTC A;  5H1S E;  4B3M Q;  1XMQ Q;  2QGQ A;  1L2F A;  2IX0 A;  1PH3 A;  2YTY A;  1WCM H;  4R1J A;  5AJ3 L;  4P75 A;  2E2H H;  2Z6K C;  3CCV A;  4Y7N H;  1Q1E A;  4LUZ A;  3ULP A;  2F4V L;  4A3M G;  2UXB Q;  3M4Q A;  2VNU D;  5FLM H;  1XMO L;  2HQL A;  1LTL A;  4AQY Q;  3CQZ H;  2UU9 L;  4PZ7 A;  4JOI C;  1SR3 A;  1VQD A;  1VQC A;  4YCU A;  4B3M L;  4JI4 L;  1IBM L;  2NVX H;  1UE7 A;  3S2H H;  3A74 A;  3EIV A;  4UP8 A;  2CQO A;  2I5H A;  4DUY L;  4GKJ L;  2UXC L;  1VQA A;  4JI1 Q;  1HR0 W;  3W1G A;  2K5V A;  2I5M X;  3J81 i;  4JI5 Q;  4QY7 A;  1JMC A;  2AHO B;  4A3M H;  2Y0S G;  1TWF H;  2N3S A;  3LGJ A;  1VQ4 A;  1IL2 A;  3FKI G;  4GLV B;  1P16 A;  1C7Y A;  4JI7 L;  1OXT A;  5IYC G;  4XIG S;  1EQR A;  4LFB L;  2AMC B;  1YJW A;  1S3O A;  4DR1 Q;  5IP7 G;  2JA8 G;  3K81 C;  2Y0S E;  1DGS A;  2A8V A;  3M7N A;  4X62 L;  3G6E A;  4KHP L;  3PUW A;  3CCM A;  3CCL A;  3HOZ G;  1C9O A;  1SLJ A;  4JBK A;  1I94 L;  1C0A A;  1VQK A;  3CC2 A;  3PSI A;  1X6O A;  5GAH C;  4LF4 Q;  2NVQ H;  1NMF A;  2ZJQ A;  3FKI H;  1YHB A;  1YHQ A;  1KQS A;  5IYC H;  4JYA L;  2ZM6 L;  1P8L A;  5IP7 H;  3I7F A;  2CWP A;  2IHE A;  1X9N A;  1Y1V G;  2JA8 H;  4DR4 L;  1L0W A;  5M3F G;  4PMW A;  3J7Z C;  1N32 L;  1TWA H;  1CKN B;  3UDF A;  1X3F A;  4OWW B;  4GN4 B;  4A76 A;  4O0A A;  4AIM A;  2E5L Q;  3HOZ H;  3PO3 G;  4JI2 Q;  3PF5 A;  1G6P A;  1EWI A;  4B3R L;  3HKZ G;  3OTO L;  1FJG L;  1KRS A;  3HOU G;  3PUX A;  2QA4 A;  1E1O A;  3J81 c;  2YTV A;  2B3G A;  1CKN A;  4OXP A;  3DLL A;  2K4K A;  3JC6 6;  5LMN Q;  3T1H L;  4NB3 A;  2Q2U A;  2VQF L;  1Y1V H;  2NN6 I;  1IBK Q;  4LF7 L;  5M3F H;  4L5Q A;  4HJ9 A;  1T9H A;  1SN8 A;  4FDB A;  1IYJ B;  2HIV A;  3D0F A;  1N9W A;  2HHH Q;  2EIF A;  1YIJ A;  1V1Q A;  3PO3 H;  3KJP A;  3L2P A;  4PG3 A;  2KCT A;  1VS0 A;  1VQN A;  3HOU H;  4BY1 G;  3GTL H;  2QEX A;  4EQ5 A;  1XNQ Q;  3CC4 A;  2ZTD A;  3KYH C;  2WAQ E;  4HJ7 A;  4WJ4 A;  2JQO A;  1Y14 B;  1JJC B;  4BY7 G;  2UUC Q;  3KDF B;  1B8A A;  1XJV A;  1PVO A;  3H3V H;  2Q2T A;  4DR7 Q;  3J7A 5;  3BU2 A;  3TRZ A;  1WJJ A;  5M5Y H;  3CCJ A;  3S1Q H;  2D62 A;  4Y52 H;  2LXK A;  5JEA G;  4L5R C;  3S15 H;  3CCS A;  2KBN A;  4DV4 L;  1EOV A;  4QL5 A;  1MKH A;  1ASY A;  2ASB A;  1QVG A;  3KDF A;  3M4P A;  5GQO A;  1VQ8 A;  4BY1 H;  4GOP B;  1PH8 A;  4NPS A;  2UUC L;  4IFD I;  1PA6 A;  4BBS G;  1WYD A;  4A75 A;  1GVP A;  4BY7 H;  4DK3 C;  4A3L G;  2MQH A;  1IBL Q;  3GD7 A;  1W2B A;  3FP9 A;  4DV6 Q;  1N36 Q;  1PV4 A;  4DUZ Q;  4IJL A;  1HNX Q;  2D0P A;  4KLK A;  2EXD A;  1Q82 C;  2I5L X;  3KLW A;  1PHJ A;  1M90 C;  3GO5 A;  3ULL A;  1N33 Q;  4LF6 Q;  4B3S L;  2ID0 A;  4OON A;  5BR8 L;  4YHH L;  4JI3 L;  3U58 A;  2VQE Q;  3HOW G;  1M1K C;  1B7Y B;  1N36 L;  3RN5 A;  1J5E L;  4A3L H;  4A3G G;  1X54 A;  4R4O A;  3F2B A;  1PH2 A;  2ES2 A;  1ASZ A;  4AYB E;  1KD1 C;  1D7Q A;  4JBW A;  1K9M C;  3HFZ B;  1EYG A;  1N33 L;  4YWK A;  4YY3 Q;  1L1O B;  1S72 A;  1VQP A;  3M4O H;  1UWV A;  4GNX B;  4A3F G;  2D0O A;  2PNH A;  2BH8 A;  1UE5 A;  1CSP A;  2ALY B;  3F1Z A;  4LFC L;  5HGQ A;  1U5K A;  3E0E A;  5IWA L;  4HJ5 A;  1AE3 A;  1L1O A;  1UE6 A;  4JI8 L;  1GM5 A;  1HZ9 A;  4GKK L;  2OCE A;  4GLA C;  4GNX A;  1GKH A;  4X64 L;  1V9P A;  4A3J G;  4A3G H;  4DV0 L;  3A5Z B;  1EQQ A;  2NN6 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...