4DU9A

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v74a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEAEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4du9A00
3D8GA 2F0DA 1JOKA 2F0EA 2PW7A 4K2KA 4LAAA 4KTAA 4I65A 3SK4A 5KYIA 1A3VA 5CV4A 4PNYA 1A2UA 4ZUJA 5C4ZA 2EYFA 5J39A 2EXZA 3TP7A 4DGZA 5KEEA 4K6DA 2WACA 2OEOA 3QB3A 5EKLA 2RKSA 4QMGA 1EY0A 5CGKA 4EQPA 1STNA 1EY8A 2KQ3A 5CV5A 3OMCA 2F0FA 4KY7A 4ME5A 3U9OA 2F0UA 3NHHA 4K5VA 2EYMA 1ENCA 5C4HA 5IGBA 4IZ8A 5C5MA 1SNMA 2PQEA 4KHVA 2SNSA 3MVVA 4HTHA 4K8IA 5JOBA 4B9XA 1F2MA 5K5PA 5ISRA 1EZ6A 3SXHA 1F2ZA 1EY5A 2F0WA 1TQOA 5E3FA 2F0VA 5IGDA 3SK5A 4KJNA 3DMUA 4H7BA 5F2DA 4PMBA 2EYPA 3RUZA 5KRUA 3MHBA 5KIXA 5IIFA 3HZXA 5J1ZA 4E6IA 1ENAA 2PZTA 1SNOA 1SYGA 1EY6A 1EYDA 1EQVA 2LKVA 2F0GA 3ERQA 3NP8A 2SNMA 3MZ5A 3P1HA 4ID6A 5IGEA 5CC4A 3VA5A 5C3XA 1NUCA 2EY2A 4IALA 4EQNA 5J22A 2F0HA 2EY6A 4QB4A 4F7XA 3LX0A 4KY6A 3QOLA 3R3OA 3P75A 3SHLA 3SK8A 3D6CA 4K5WA 1STHA 3C1FA 3ITPA 3OWFA 4KD3A 4QF4A 2EYOA 4WRDA 5IGCA 2NUCA 1TT2A 4EVOA 5JAVA 5C3WA 2OXPA 4K5XA 3V2TA 4J1MA 1A2TA 5KYLA 3SR1A 2PZWA 4KJOA 3MEHA 2F0SA 5E1FA 4MIUA 4RKLA 3T16A 5IOCA 3EVQA 1STAA 1EY7A 4NKLA 4RKBA 2PZUA 1KDCA 1STYA 2F0IA 1KAAA 2QDBA 1EYCA 5I6WA 4R8NA 4OL7A 1A3TA 1NSNS 2F0TA 4S3SA 5CV7A 1STGA 2M00A 5NUCA 1EY4A 3NXWA 4J6HA 1TR5A 4KD4A 5CV8A 5DEHA 4EQOA 2F0LA 1EY9A 1SYDA 2F0QA 2PW5A 1II3A 4N9TA 5HGTA 5I9OA 3H6MA 1SYBA 2RBMA 1KDAA 2SOBA 3S9WA 5M9OA 1AEXA 1SYCA 3MXPA 5EGTA 4KV6A 3QOJA 4K2LA 2PYKA 5C5LA 1JOOA 3DHQA 4IUNA 1SYEA 2EY5A 3TP8A 4DF7A 5C6AA 1KABA 1IHZA 3D4WA 1SNCA 2EY1A 3EROA 3TMEA 1F2YA 3NUCA 1RKNA 5I6YA 4WORA 4KY5A 2F0MA 2F0JA 4F8MA 3EJIA 1SYFA 2F0NA 3NK9A 1A3UA 1EZ8A 2RDFA 3OSOA 4ODGA 5IODA 2HQEA 1KDBA 5DAUA 4TRDA 5CV9A 1JORA 4HMIA 4NMZA 1STBA 3C1EA 3NQTA 2F0OA 3BDLA 4NP5A 5EKKA 5KGUA 1JOQA 3BDCA 2F3WA 2OF1A 2EYJA 5IGGA 3SK6A 4NDXA 1SNDA 2EYLA 3D4DA 2ENBA 2F3VA 4PMCA 1U9RA 2KHSA 4K14A 5CR3A 4YIJA 2O4XA 5CV6A 5IGFA 4ZQ3A 1EYAA 4DU9A 3E5SA 1SNPA 4G57A 3TP5A 4B9WA 2F0KA 5I9PA 5HURA 3OMGA 4ZUIA 4N9PA 3TP6A 1SNQA 4K8JA 3T13A 4HMJA 4DFAA 3HEJA 2EYHA 3PMFA 2F0PA
chains in the Genus database with same CATH superfamily
3FDTA 2R93H 3K0XA 3Q24A 3BS1A 1JOKA 1VDZA 5IYCG 2UU9Q 4YCVA 2RA4A 2NWGA 1VCIA 1KQSA 2EXZA 1HNXL 3PUYA 4ZK9B 1SBBB 2DJFC 4A3KG 1K28A 2G9HD 1XYIA 1PH5A 3M7NA 2LXKA 1DOKA 1YNJC 3MFYA 4FF3A 1EWCA 3J81i 1OXXK 1TWAB 3LNNA 4JI2L 4IFDG 4PMBA 1F9SA 2AMCB 1IBMQ 5CORA 1EQTA 1P16A 1RIPA 1SNOA 1YIJA 2Q2TA 3H91A 1R4PB 3CCSA 5C3XA 1UNSA 4EQNA 2JA9A 4F7XA 1EWIA 3FPUB 1LTBD 1BCPD 2EXDA 2MJ8A 3SHLA 5IWAL 1GHKA 3OIPA 1KRTA 1OXTA 1SMXA 1X9NA 3ITPA 3OWFA 4QF4A 1UEAB 4DR5Q 2OXPA 3MXGA 3ER0A 1BBXC 3I4MG 1VMCA 1I4GA 3OYYA 5FK9C 3PCOB 4KN7C 5T1GA 4DAPA 3D0FA 1STYA 1TKWB 3KK7A 4AYBE 3M4YA 2CWPA 2FJ2A 2XSCA 1ESFA 2Z4IA 1II3A 1EUJA 3HKZG 2CQOA 5FKAC 2KEDA 4X62Q 2HIXA 1PZJD 2DJGC 2KJXA 1HZBA 3E3XA 1RKNA 1MGSA 4X6AH 4KKUA 5GQOA 3DM3A 1X3PA 4B3RQ 4A3MB 4RHRA 3S1MH 2I5MX 1DXMA 1G6ZA 1HUMA 3NE5B 4MZ9A 4HJ7A 2K32A 5C4JH 3W2DA 2OQ0A 2K4KA 2L12A 2ZJRA 4ZQ3A 3WDNA 4DAVA 4ZKCB 2UXCQ 4RMFA 2EIFA 1V1PA 3OTOL 1X6OA 3D8GA 1RJTA 2K75A 5JJKA 5FLMG 2YYZA 2B2WC 4QY7A 3JAML 4ZUJA 5C4ZA 3GTQB 1B50A 1IBKL 4XTCS 1VQEA 1Q46A 1CHPD 1YI2A 4V190 4GNXB 2PI2E 5CV5A 1BDOA 3OMCA 2PPBC 2B63H 2BH2A 1VQDA 3GTQH 2CWAA 4BA1I 1S5FD 2PNRC 1X3GA 2R92B 1EZ6A 2OTLA 3EBEA 1K83H 3T1HL 2N78A 4IOCA 4GN4B 4A76A 2Q8TA 5G3LF 1DOMA 1HZAA 2NVTH 2RHSB 3DXJC 3KLWA 4QL5A 1SMYC 2X6GA 3MZ5A 2RSNA 4HIOA 5C0XG 2R7FA 3LX0A 4OIJA 3I4LA 1KXLA 3QOLA 3P75A 1ILPA 4DUZL 3KJPA 1CKNA 4LNQA 3U4VA 4EVOA 1LT6D 2UXDL 3OW2A 3MXNA 2HDLA 3HOXB 2WB1E 1G2SA 1HCZA 1E24A 3CCMA 1UE1A 5M5YH 2G5DA 5NUCA 4GOPB 1G2TA 2XWBB 1TVXA 2F0QA 2JA7H 5C4XG 3D4RA 1YNJD 5LHY1 2VUMH 1XPOA 3MXPA 1JWUD 5I4DA 2GVBA 4BBSB 1ZYRC 2HHHQ 3PGZA 4A3DH 5FLXc 3QJYA 5D65A 1WTPA 2BH8A 2VQFQ 3OWEB 4JI0L 4WJ3M 3K8AA 2AQ2B 4FF2A 4H0LC 1L1OA 4A3IB 1Y1VG 1DONA 4H13C 4KI0A 3BDLA 4RCOA 3DEPA 1U5KA 4CDEC 1XJVA 4DV6L 4GNXC 1B8AA 5DM73 3D4DA 3DEOA 2B29A 2C5CA 2OQKA 4GLVB 1JMCA 3TP6A 1HA6A 1BBUA 1WTQA 5LMNW 2HIVA 3HOYH 2A5HA 1Z47A 2DY7A 5A2QL 1HFGA 2EJMA 5C3EG 3PUZA 4I65A 3SK4A 5M3MG 2QGQA 4LW1A 4JI7Q 4A3KB 2F1MA 5BN3A 2Q2HA 2RKSA 1EY0A 4LFCL 4JW0A 3H3VC 1R9TB 4OEMB 4HJ5A 2M9VA 1VQHA 3OPOA 4R8IA 3MVVA 4HTHA 4GN3B 2F0VA 1BKBA 4KJNA 2CH4A 3N6RA 1JJGA 4HSVA 1EIYB 3ICEA 2PZTA 5EPKA 1ZEQX 4GOPC 1S5BD 4JVZA 3GTOH 2KECA 2F0HA 1Y1WH 2MUYA 1IBKQ 4UAIA 3KLSA 1LACA 5JVG3 3FMCA 3CU7A 3FKIG 2PZWA 3MC0B 5E1FA 3A0JA 2B39A 3PUXA 1YVCA 1SFOB 2L55A 1B70B 1VF7A 2P5ZX 5GAGC 1PYBA 1BNZA 4TQUS 3HKZB 3I8ZA 1EQQA 1MIUA 1PTOB 3TEHB 3L7ZC 1EY9A 1H9SA 3CCVA 2BOSA 3NTHA 3EIVA 4WFN3 3CQZB 1RTNA 4DV2L 4PZ7A 4IFDJ 1LTID 2OT2A 3HOWG 1PRTB 1JCKB 1PMRA 2GVAA 2XNAC 2MFIA 4HAEA 1Y14B 1F2YA 1CA6A 1L0YB 2E2IB 1XNQL 3CQZH 3AMUA 2PQAA 4ODGA 2OTJA 1SMYD 2FMMA 5EQ0A 2Z4HA 4JI6L 5CV9A 5I2XA 4A3BB 4JOIA 2R3ZA 3NQTA 5JEAJ 1NMFA 5H1SE 1XMQQ 2EDGA 1O78A 3J7ZC 1KTKA 2CH4W 4A3BH 2QA4A 1JT8A 4DR7L 1EYAA 1SNPA 3I72A 3I73A 2F0KA 4C3JB 5I9PA 4L6TB 2BCOA 4DV0Q 4BXXG 1N33Q 3CF5A 2SEBD 4OX9L 4YHHQ 3IL8A 3KOJA 4QGUA 2Q8IB 3S15H 4C3JH 5CV4A 4A4IA 2WINB 1JWSD 4JI0Q 5CGKA 4JPBW 5CBAE 4YWLA 4A3CG 1UE6A 1F9QA 1S5ED 3CXCA 1ZYRD 2QDLA 5AJ3L 3AFQA 1TWGH 2CFMA 4ME5A 1KLUD 4U68A 2K6AA 5IT9c 4FNFA 1XMOL 3HOZG 1GUTA 3PIO3 3PO3H 5IT9E 3IAYA 2RSOA 4FDBA 1F2MA 2QW7A 4JI4Q 1F2ZA 1J9OA 1H9JA 2L0CA 5LMUL 1B44D 1WVLA 4P72A 1CZGA 3T4AC 4A75A 4FXDA 1VQFA 4A3FG 3HGBA 3ERQA 1B9MA 2RVLA 3P1HA 4EGVA 1PTOC 4F88A 1W6KA 2IY5B 2JP1A 1MSHA 3A7AB 1XPRA 3RZDB 3W3AA 1KC8C 1PRTC 3KF8A 3GP7A 1A2TA 2LSSA 3SR1A 1EIHA 1BCPB 3PIOA 1NR2A 1TWFB 3DUZA 1STAA 3K7UC 3AEVA 2PZUA 3NEMA 4LWCA 2E5LL 1U4MA 5C4XB 3JAMi 4OL7A 4NXNL 3EFXD 2F0LA 1LV9A 1TWFH 1LT3D 1I6VC 4IPCA 4HSPA 4OELB 1QVFA 1SYCA 4BY7H 4DF7A 4IUVA 3Q0AA 3TBIB 4BBRH 1F77A 4P73A 1IHZA 4B3SQ 3TZDA 1N36Q 3K81C 2IJ0A 4WORA 1Y1VB 3MXNB 4KY5A 4GLAC 5M5XB 1X55A 3M9BA 1MJEA 1UEBA 3R93A 1YHQA 2B2VC 2JK8A 1HZ9A 2K04A 3UDFA 2AWNA 2QEJC 2ZTDA 4MNOA 1Q1BA 2OF1A 3CCLA 1JE5A 1AE2A 2KCMA 2F3VA 4X3KA 3RN5A 1QNKA 1E7ZA 4CDDC 4R4IA 2ZXOA 4DK6C 1JICA 1Y8NB 2FXQA 4K8JA 1VQ9A 4AH6A 3P20A 2Z6BA 3W5OA 5C3EB 1PHJA 1ZXTA 3RNUA 4MTNA 1PDQA 2K5HA 5M3MB 3MTSA 1D5MC 3K7AH 1NJIC 5TSSA 1M4VA 2ZM6Q 1NE3A 4IUQA 3A55A 2KBNA 4DGZA 3M3YB 4POFA 4B3MQ 3A56A 3CCUA 5EKIA 4GLXA 1B3AA 1SNMA 1BR9A 4P75A 4CDFC 3F2DA 1IBML 1OXSC 5ISRA 1WJJA 1EY5A 3KLSX 3V05A 4H7BA 2EYPA 5KRUA 3K0YA 2E76C 4YWMA 1N9WA 2GN5A 4BY1G 1EYDA 3PO2H 4BWGB 1TXYA 4DR3Q 4DR5L 1CT1D 1PH8A 2A68C 1QVGA 2VY3A 4A3GG 3FKIB 5ELFA 3G7LA 2NZOA 1HRJA 2ALYB 2RQXA 1YNXA 1C4QA 4A3JG 1IYJB 2K5NA 1C9OA 5M3FH 2UUCQ 2JA8G 1V43A 3CCJA 1X56A 4QIWB 1Q90A 3BZDB 5IOCA 1M1KC 3KF6A 2UUAQ 1K3RA 1NSNS 1EY4A 3NXWA 3I55A 1D6EC 4X62L 3HOWB 5EJWA 2R7ZH 1W6JA 2VL6A 1AZPA 2LY7A 1OTCA 1KABA 4XYOA 1I94Q 2EY1A 3H0GG 5E4XA 4KK7A 4C3HG 1LTSD 3HFZB 4B3RL 2K33A 3EJIA 1ASYA 3HOVG 3CRLC 2D5DA 2JA6B 1QVCA 3GDEA 4JBJA 1PTOD 4GN5A 4IO9A 1PZID 3D6WA 5C0XI 2UUBQ 2IW3A 1VQPA 1PRTD 2JA6H 1IKMA 1SROA 1JJCB 1SNDA 3IRBA 3SK6A 2UXCL 2ES2A 4K14A 3K58A 3M85A 3VR6A 1DM0B 1Q12A 2BA1A 5FLXL 4IPHA 1Q81C 1GUGA 1I50H 2K05A 2PMZE 3H15A 5JPNC 4DFAA 5C44B 2F0PA 2Z6KC 2JJQA 2XVSA 2A6HD 2J7ZA 2PO4A 1PH6A 4IOAA 5COYA 1LT4D 5C44H 1K0RA 3HOUG 2CCZA 4FP5D 1LTGD 1PH3A 1Q7YC 4KKSA 3VR2A 5BN5A 5GADC 2KQ3A 4CHTB 1B1ZA 2JA5G 2XRQD 1VQ4A 1U4RA 2HCCA 4K5VA 1KL9A 3NBHA 4LF5Q 1TS4A 1Q8IA 2RDGA 2L11A 2WIIB 3LWUA 2DUDA 1D2BA 3CHBD 2F0WA 1N8RC 1QOHA 1RTOA 2NVQH 3J81c 4C2MB 3S14H 1CQVA 2WB1G 2L5TA 4HN7A 4IURA 3I56A 1SYGA 3J81E 4QUFA 1AW7A 2NN6G 3RZOH 1CUKA 3MFGA 1VQKA 4FXKC 3SGIA 3U58A 4HR7B 1GJXA 4C2MH 5FJ8H 4ZCKA 1I6HB 3K57A 4YCUA 3PIP3 4JI3Q 4UP9A 4LF8Q 3C46A 2MPMA 1J5EQ 3WOEA 3VR4A 1KAWA 1KDCA 2F0TA 4RFBA 4DR6Q 1EEID 1TWAH 1CQFA 1YHAA 3IFTA 4EQOA 1LTLA 4N9TA 1N34Q 3I70A 4DAYA 1FYCA 5JEAG 4DKAC 2HHHL 4K2LA 2VQFL 3A7LA 3J7YW 2NVYB 5JPMC 3KF8B 1EFWA 1JC7A 2KVMA 2N88A 1NCVA 2F0MA 4K6LA 1EOTA 3VYRA 1DOLA 2X6LA 1WTRA 1KDBA 3CMEA 4GKJQ 3X3MA 2A68D 1JOQA 2JQOA 2DN8A 4OO1G 2TMPA 2I07B 4OXPA 2Y0SE 1HR0W 4XIGS 3TP7A 5IYBH 1PYSB 4YIJA 1L2FA 5IGFA 4B9WA 4C3IG 4KKTA 1IYUA 1D1KA 5IP7H 4HCEA 4JI7L 4LF7L 3HG9A 2WP8J 2PW7A 4CJ1B 1T9HA 5KYIA 1VQNA 3O13A 4R4CA 2HT1A 3QO2A 2B3GA 1WTWA 3FPPA 1H9KA 3I91A 2E2DC 2K7VA 3NWTA 4L5RC 4Y52H 1TU2B 4OGQC 1O7YA 2F0UA 4A3MH 1SSOA 3M4QA 5IP9H 2EYMA 1ENCA 3K5NA 3S2HB 1ILQA 2E75C 3CAMA 5JOBA 4NB3A 4A3EG 2ZTEA 4BY1B 4UP7A 3CMAA 4DV5Q 3DMUA 1HR0Q 3KDFA 1K8GA 4AYBB 2WAQG 4X64Q 5ELNA 3BZKA 3S2HH 1EY6A 1MKHA 1EEFD 5IYDG 3T1YQ 4A3GB 2NTTA 1HTPA 4WJWA 5FO7B 2HCIA 3GV6A 4A3JB 1SLJA 2JE6I 3SK8A 4XQQA 2JA8B 2E2HB 2Z8LA 2NUCA 1S72A 4KJOA 1EIGA 2KA7A 3EVQA 2D62A 1EY7A 2K14A 1TWCB 4APVA 4KMUC 4KLKA 1A3TA 4PQXA 2R92H 5GAHC 5HGTA 1BOSA 1VQLA 3H0GB 1TWHB 4KV6A 3CRKC 4U673 4R4TA 3QOJA 3DHQA 1CA5A 2H4OA 1MSGA 1HQMC 3I4NG 3HOVB 2J4XA 3BG3A 1AZQA 3H3VH 4DAMA 1SYFA 3NK9A 4DUYQ 1GM5A 2CKZB 4RG1A 4QQBX 1BBWA 1CHQD 1XMQL 2MO1A 3ONAB 1I4PA 2IL8A 3S1RB 2VS1A 3UI2A 4GS3A 2EYJA 4P71A 4FXGC 3HOXH 4DV0L 1N33L 2KHSA 1Z6HA 4YHHL 2B2UA 1F9RA 1NNXA 3KUPA 3T13A 4DR4Q 3HEJA 2KCTA 4JYAQ 1VQ7A 4ZLTF 3UDIA 4EQ5A 3HOUB 2KCCA 3T56B 5K36H 3A5ZB 2EJFC 3QG1A 4BBSH 1VMPA 1K8AC 5CBEE 1HQRD 2JA5B 1QCBD 4JI8Q 4KHZA 4A3LH 2F0FA 4A3IH 3CCQA 4JI4L 1S5DD 2MNAA 2A73B 1QNUA 3J80L 4R4OA 3E0JA 2WB1B 4IUUA 4G7ZC 4XXEA 4DN4M 3PV0A 5F2DA 4YCWA 1YJNA 1WTOA 1K73C 4E6IA 4IPGA 3PQIA 2A74C 3TQYA 2F0GA 5IYCH 4LF7Q 3VA5A 3TN2A 3BVMA 2Z9HA 3PF4A 2EYOA 4A3KH 3GTKB 2ICIA 1LTAD 2F4IA 1WFQA 2EOTA 4RA8A 4MIUA 3N52A 4J15A 1R9TH 1OO9B 1NBWA 4RKBA 4IFDH 2AHOB 2F0IA 1LTTD 1XNRQ 3MXUA 5GAEC 3L9AX 1XX8A 3VYUA 2B2TC 2K28A 4DV4L 4B3SL 2QILA 5EGTA 1LYLA 1N36L 5LMNQ 3PF5A 4DXFA 1JOOA 3I4MB 5C6AA 1SE2A 3FP9A 1QZHA 1U4LA 1UE5A 1ET6A 4NW2A 4O42A 5EPJA 2LFNA 2QKIC 3ULPA 3CC2A 4F8MA 3NENA 1RF2D 2PNHA 3I4MH 2WAQE 2XGTA 3A8JE 1JORA 1E3PA 3S2DB 2BA0A 4NMZA 5KGUA 1PA6A 1JWMD 3DWQA 1SDFA 3STBC 2NZ1D 4LUVA 5ELBA 4C3IB 5C5LA 1SFOH 3E9IA 3J81j 1VQMA 5JJZA 4BA2I 5CMDA 1PH7A 3UE1A 2VXWA 1SNQA 1CSQA 1PTOH 2CVRA 3K80C 2NB0A 2ZM6L 4IUTA 3S24A 4ILWA 1Q8KA 4JK1C 1W3SA 4L5QA 3K5LA 3SE0A 4OHJA 1NY4A 4B3ML 1HTLD 3CW2C 2I46A 1C7YA 2E2IH 1FJGQ 1A8VA 1IL2A 3Q8DA 2BDNA 1DZ1A 3H3VI 3SVMA 4Y7NB 1SRUA 4A3EB 3NHHA 4GKKQ 2R61A 2JYOA 5C5MA 2QF7A 5ELOA 2SNSA 2A69C 2MO0A 4LMQD 1WCMG 5IGDA 3MA2B 4Y7NH 4A93G 4DR3L 1LTRD 2IX0A 5I2YA 1YITA 2DNCA 2WV6D 1JQYD 4ID6A 3J7AF 4HIDA 5FLMH 1DD2A 1QUQA 1S4ZA 4WJ4A 1YNNC 3R3OA 2UUCL 2Z1CA 4K5WA 1O7LA 2OCEA 1L0WA 4RH6A 2O2LD 2UUAL 2F0SA 1V1PB 4POGA 1PTOF 1A15A 4DV1Q 1HNWQ 1H95A 1KAAA 4CJ0B 2UXBQ 4R8NA 3AB9A 4JI5Q 5CV7A 1D7QA 2M00A 1PRTF 3NTIA 5CV8A 1MI2A 1MD2D 2YU9B 3CCRA 2I0QA 1TY2A 2NYZD 3S9WA 5ELEA 4PMWA 1I94L 1N32Q 3JAME 3D3RA 3I4NB 2PYKA 4P2CB 5C0XH 1O7ZA 3UE0A 1D5XC 2R93G 1XPUA 3EROA 1HNZL 1Q1EA 2KCNA 3TMEA 3NUCA 4IJHA 4CJ2C 3SDZA 2UUBL 3RLFA 2F0NA 3I3CA 3A74A 2B2WA 2NN6I 3RZDH 5DAUA 3A8KE 4JI1Q 2RDHA 5LL6S 3C1EA 3LWEA 3BYTB 1ASZA 2A6HC 4Q0FA 2VQEQ 4Z9CB 5BR8L 1VF5C 2XIWA 2XRSD 1K9MC 5C4XH 4DV3Q 4IFDI 4HJ8A 3E5SA 3TP5A 3RMHA 1Q3LA 4HJ9A 3PUVA 2Q2IA 4ZUIA 1CKNB 1KHIA 4DV4Q 4AQYL 2EYHA 3NSWA 3GTGB 1VQ8A 2LS01 4K2KA 3IFDA 3ZYYX 2N8NA 4PNYA 4OWWB 4LF4Q 4TVAB 1HUNA 4DNRB 5D14A 1SEBD 1EWHA 1X3QA 3GTGH 5EKLA 1PFNA 1DCZA 1Y1VH 4CKCA 5M5XH 4XQNA 4LF5L 4K0KQ 3NELA 5D3IB 4KHVA 1CKOA 2K52A 3A8IE 3M4OB 3RD4A 3F2BA 2FHTA 1YZ6A 1R4QB 3R2IA 2F3IA 3STBD 1WTXA 3RLNA 1ESRA 3BJUA 1H9MA 2KHJA 1L1OB 1HHVA 1B4OA 5C3EH 3F2CA 3TRZA 3VR3A 5M3MH 2EY2A 2HUGA 5J22A 1PV4A 3A54A 1BCPF 4JI3L 4XT1B 3D6CA 1WD0A 4LF8L 4J8QA 1STHA 4X3SA 1J5EL 4V0BA 1VQGA 3S16B 3M3YH 1QWYA 1S5CD 3L3OC 1IYVA 5FO9B 4FF1A 4DR6L 4YY3Q 4O1NA 1E2ZA 1PFMA 1LM0A 4LFBQ 3BZCA 2K5DA 3S16H 3L2PA 1N34L 1PYWD 2N49A 1G8ZD 3CC4A 1STGA 2AQ3B 5DEHA 5I9OA 3J7AV 5A2QE 3UDXA 2Y0SG 4IPDA 5M9OA 2A69D 1ZKOA 3GTPB 4DK0A 1PH4A 1I3QB 1SYEA 2EY5A 2EQSA 3GQBA 4RWSC 2DGYA 3J80i 1JJ2A 2LXJA 2N3SA 3WWVA 1SAPA 4ABNA 4GKJL 1AN8A 1BQQT 1EZ8A 4CKBA 2RDFA 2XN9C 1I4XA 3FKIH 3G71A 1Q86C 4HMIA 2QCPX 2KEEA 1YNND 1BO0A 2B63G 2D0OA 2K5WA 4UDUC 1L0XB 2F3WA 4N8FA 1AP0A 3ZJYC 3SXHA 2ENBA 4EX5A 3NQIA 3WOFA 4LJZC 2RHQB 2K50A 5CV6A 4RCNA 5EPLA 4LF9Q 2A1AA 2VZAA 1PFBA 3DWPA 2JN4A 4LFAQ 2ZJPA 3R2TA 4LF6Q 3HOWH 2V4DA 3CPWA 4I7AA 2PI2A 1HNZQ 3CKIB 4GOPA 2JEBI 1Q82C 1L1OC 3L0OA 5J39A 2C35B 4DR2Q 2WACA 5FOBB 3E6ZX 1VQCA 3Q23A 1EY8A 1H9SB 2K5VA 4X66Q 1CM9A 4DNTB 4R1JA 4DV5L 2AWOA 1HR0L 1PFSA 1CZWA 4DR1Q 5BR8Q 4A93B 4X64L 3MAQA 5K5PA 1RODA 1TQOA 2EZVA 4BXXH 2FFKB 3TS0A 2PQAB 2LMCB 3T1YL 4MN3A 4AQYQ 2JA7G 1ICWA 2LKVA 2VUMG 4B08A 3NP8A 5CC4A 3I4OA 3GTJB 3HOZB 1KNAA 4DV7Q 1W2BA 1IBLQ 4A3DG 1RL2A 4WRDA 3GTMB 4HCSA 4A3CH 1TT2A 4B3TQ 5HGQA 3NPPA 4J1MA 2JXMB 3U50C 4UPAA 3HOZH 4O2DA 2D2CC 1HA5A 5JJLA 4A3FB 4FYDA 3GTMH 2EVBA 2O5IC 1FR3A 4ZYSA 3KJOA 3AFPA 2IHEA 5AFWA 2RF4A 4OWTB 4A3FH 1MHWC 2R93B 5KNDA 4DA2A 2PMZB 2DY8A 2ZJQA 3TP8A 1P8LA 4DUYL 3HOYG 3G6JB 1SJHD 3HP3A 4L5SA 1D1IA 1I6HH 1I5FA 3OSOA 1TS2A 2EE1A 4NP5A 4ZAIA 1SR3A 5EKKA 5ELDA 1JR0D 3K6OA 3ND9A 1U9RA 4FF4A 1UAPA 3TREA 4DR4L 4JYAL 3FHWA 4LUOA 1F9PA 2NTSA 4KHPQ 1X32A 1U4PA 4IJLA 2D9UA 3PIPA 2F0DA 5D3DA 1A0IA 2C9OA 4KTAA 4JI8L 5E4WC 3BYYB 2NVYH 1XXGA 4RHSA 4K6DA 1YJWA 1Y1WG 1ML0D 4JOIC 4QMGA 2IPKD 1STNA 2AKWB 4C1NK 1S40A 1EYGA 4C56C 3Q22A 4L8JA 1HJPA 1NMGA 5GROA 5BN4A 1YEZA 3GV3A 1QZGA 3QR8A 3SK5A 3RUZA 2B8GA 2R6GA 5J1ZA 5KNCA 1CI3M 4JG2A 1PVOA 1FGBD 5L37A 1IL8A 1EIFA 4IN3A 2K03A 4KY6A 2F4VQ 2VB3X 3C1FA 3ULJA 3W1BA 2L9HA 5IGCA 1X3FA 5JAVA 3S1MB 5HY6A 1PLFA 3S1NB 2HD3A 1XNRL 3UDGA 1C0AA 1XTCD 5C4JB 3T16A 3D31A 2B2VA 3E9HA 1GVPA 5I6WA 3BVGA 2Y0SB 3S1NH 5LMNL 3DWAA 4BY1H 4A3BG 5IT9L 3H6MA 4C1NI 4ZRZA 2YV5A 2AUJD 4QCLA 3I90A 1XWEA 3F2UA 4A3GH 3MWYW 4C3JG 4A3JH 1V1OA 2F0JA 2A8VA 1A3UA 2JA8H 1A6XA 3DM1A 2E2HH 2B63B 3TDQA 3U9SA 2RCNA 4G7OC 3NWSA 4RAUC 4JCVE 3RLOA 3BDCA 1S3OA 3IKJA 1K83B 2EYLA 1WI5A 3PO3G 3ULLA 4MHEA 1TWCH 4QJFA 5ELCA 1MBYA 2I5LX 2BE5C 5DLQE 3OMGA 4C3HB 4IQZA 4XYQA 1ONLA 2NVTB 4HMJA 2IWHA 3VYSA 3PMFA 1BUVT 1NAPA 3H0GH 1TWHH 4GZYC 4X65Q 2Q2UA 4LAAA 1WYDA 1U0LA 3MEFA 1KD1C 4NXMQ 4C3HH 2KENA 1A2UA 1FJGL 3S17B 1C48A 3HOVH 1SE8A 3KF6B 2Q8RE 1HXYD 3PSIA 2A6EC 1E22A 2K5QA 4GKKL 4HIKA 3VA7A 2M2LA 4RGNA 4KY7A 5FO8B 1YJ9A 1HNXQ 2L1BA 3S17H 5EBDA 3F1ZA 1GHJA 2H5XA 2PQEA 3S1RH 1OXUA 5M5YB 4UP8A 2KOLA 2ZXPA 5E3FA 5EBCA 2JA7B 1E2WA 1GXDC 3KFUA 2IHFA 2NZHA 2VUMB 4JI2Q 4O0AA 1M8AA 1ENAA 3KYHC 3FVQA 1ICFB 2B2YA 4UHVA 4BY7G 4A3DB 1NUCA 4BBRG 1QILA 2XTIA 3HOUH 1CTMA 3FEWX 1J6QA 2CW0C 1K3BC 1B3QA 2R7DA 1IKLA 2IT1A 2RCFA 2FINB 3Q6SA 2JA5H 4DV1L 5IWAQ 1HNWL 2VB2X 1V8QA 1JB3A 2UXBL 2G9DA 2KUMA 3EQLC 4JI5L 1HH2P 5FLXE 2YTYA 4NKLA 1LABA 1I4QA 1D5ZC 1EYCA 1N32L 2E8GA 5M5WB 3C2PA 1NR4A 4J6HA 2GA4B 1AH9A 4ULLA 1B53A 2RBMA 3G6EA 2TSSA 3HOYB 2NN6H 4H44C 3R8BA 1RD9D 4IUNA 3CC7A 2L4NA 5M5WH 3M4PA 1KLGD 3D4WA 1JE4A 1G51A 2Z6KA 3NBHB 3M7GA 4HIMA 4NPSA 4QUCA 1O7IA 4JI1L 2X69A 3S1QB 5J3BA 2VQEL 1BXTA 4TRDA 1KIXA 4JBKA 2F52A 4F87A 3GTKH 1E1TA 2KHIA 1VQIA 4DV3L 1D8LA 3S1QH 1EL0A 4NDXA 3HKZE 3LGJA 2H1EA 3PUWA 4FO2A 4G57A 4PZ8A 5HURA 5JEAH 1IW7C 1K8MA 3FRPB 3JC66 1EOVA 4LF4L 1FNWA 1C8CA 3GTOB 1YHBA 1LT5D 3NTKA 3PO2G 1Y1WB 1GUSA 2F0EA 3OTOQ 2OWOA 4ZKBB 3K5OA 2N55A 3KBXA 3OOCA 2EYFA 5KEEA 3GO5A 3QB3A 4K0KL 1G291 4M1UB 2JSOA 2J0TD 4OO1H 5M3FG 3U9OA 4DAYB 3S2DH 3VYTA 3EN2A 1DJRD 5C4HA 4IZ8A 1V1QA 4ALPA 4B9XA 3GD7A 2CHBD 3OHXC 4C3IH 1M90C 2NBFA 5KIXA 3HKSA 3HZXA 3HS0C 1BF4A 4BS9A 3T1HQ 1EQVA 1Z7TA 2WFWA 5E7NA 2MHVA 2R7ZG 4IALA 2BE5D 1FVIA 1E2VA 4QB4A 1X54A 3I7FA 1H9RA 4CBVA 4X3TA 3VDYA 4YY3L 5C3WA 3B6YA 4L5TA 4LFBL 5CYUA 1VQAA 1GD7A 1VQBA 2MGSA 4DUZQ 2WAQB 2ASBA 2PCFB 1G91A 4RKLA 1QG7A 4DXGA 1PZKD 2UXDQ 3TS2A 1SN8A 1SXTA 2A6ED 4A3EH 4HJAA 5JJIA 5G3LD 2VW9A 1PH2A 2JA6G 3I2ZA 1EU4A 5IGGA 1PXUA 1ET9A 1SYDA 3U4ZA 5IYDH 1SYBA 1KDAA 2SOBA 2VNUD 4G4KA 1E0BA 1JB7A 1EFID 3S15B 4JBWA 3W1GA 1I4RA 4LK1C 3J81L 1T5XD 1EQRA 3J7A5 1NTGA 1HFNA 1SJED 1GUWA 3OIQA 2NVXB 4CDCC 5C44G 2HQEA 1TWGB 3KDFB 5KNBA 4CKEA 2YTVA 1E1OA 2CQAA 2F0OA 3PO3B 4PG3A 2CW0D 3C3LA 1LLRD 3JAMc 2NVXH 4MTKA 3CP0A 3P7JA 1GOZA 2IX1A 3URYA 4LF9L 4R9WA 4LFAL 2O4XA 3VR5A 2A19A 4LF6L 4DU9A 1B9NA 4DV6Q 4XDXA 4TSSA 1DYQA 4N9PA 1PH1A 2YU9H 1RDPD 3RR5A 1Z9FA 1QB5D 1I4HA 1X65A 4DR2L 3I4NH 3EA6A 1FL0A 2ZT9C 2L15A 1ENFA 5FJ8G 1KNEA 3T51B 4X66L 1MJCA 5LL6X 3CD6A 4RGOS 4L63B 4DR1L 1K8OA 3QWNA 2BDOA 4LFCQ 4N8X1 1XTDA 5IGBA 4K8IA 1QJOA 4OWXB 1WD1A 4AIMA 1BVSA 2DNEA 2HDMA 4FVMA 4TKOB 3MHBA 5IIFA 4XQJA 2EJGC 4BY7B 4BBRB 2ICEC 3G48A 4DV7L 2SNMA 1RCVD 1WTHA 1IBLL 4JV5L 2B8FA 3GTLB 4B3TL 1IW7D 2IX3A 1CK1A 3BVZA 4X3UA 3RN2A 4KD3A 2HQLA 1J8IA 3CPFA 2EPBA 4K5XA 1Y8OB 3GTLH 1EU3A 5A35A 4OONA 3KLRA 4JC0A 5C0XJ 4OO1I 5IYBG 2AUKA 4PV1C 3M4OH 3OW7A 1TR5A 1V9PA 1FD7D 3TSSA 4CGYB 3K7AB 1YBYA 1VQJA 3HRZC 5IP7G 3F8TA 1UE7A 4P74A 2UU9L 4I7ZC 4DV2Q 3J80c 3AQQA 4UY8C 3SEBA 1QE6A 2QEXA 4QIWE 3J80E 4LUZA 1TY0A 1XNQQ 3NBIA 4G7HC 2JEAI 2FMCA 1SE3A 4DNIA 4DK1A 2F03A 4XT3B 4JI6Q 4GNXA 4KHPL 4IUPA 4A3MG 1FNUA 5IP9G 1GO3E 4RGMA 4PMCA 1STEA 1A62A 1IXRA 1DGSA 5DM63 3K59A 2ATWA 1BCPC 2WKCA 3PO2B 1AFPA 4DR7Q 1F2LA 2E2JB 1UUPA 3GTPH 1GKHA 1I3QH 4Q5VA 4OX9Q 1A3VA 1CFMA 3H94A 4AYBG 1HZCA 2SDFA 4DPGA 2OEOA 3BDOA 5M3FB 1VQ6A 2E2JH 1TS5A 2AQ1B 4EQPA 3AU7A 3DLLA 1KRSA 2E74C 5IY0A 5T1IA 3H09A 1IZ6A 4KN4C 2B2UC 5AJ3Q 3K5MA 1XMOQ 3A5UA 2Z0SA 2MP1A 1A63A 4RGTA 1RHPA 1HPCA 1VS0A 1AE3A 1Y8PB 1TS3A 2R92G 2R7ZB 1SE4A 2B2TA 3T53B 2F4VL 3E0EA 4PZ6A 1X3EA 2ID0A 1LUZA 5IGEA 5LMUQ 1K0SA 4M8AA 2B2YC 2EY6A 2ZXRA 3TZUA 4R4QA 1FNVA 2O5JC 2K01A 2I5HA 1WCMB 3V2TA 5KYLA 3ERSX 3MEHA 1UWVA 1VQ5A 3X3NA 3V96A 2WKDA 1WCMH 2QDBA 4S3SA 4A93H 3HOXG 1G6PA 1I50B 4HEDA 4KD4A 2E5LQ 2PW5A 3KBGA 3QIAA 1WTVA 4NXNQ 2YTXA 1AEXA 3G4SA 1TIID 1O80A 1B2TA 2ZTCA 1T5EA 2V1CC 5EAYA 4OIKA 4JV5Q 3BU2A 1CKMA 1SNCA 2MQHA 1CSPA 5DNFA 1LO5D 1Y69U 5K36G 1B7YB 5I6YA 1VQOA 3GTJH 5IE8A 4BBSG 3AYHB 5IODA 1GUOA 1WOCA 1GUNA 3ND8A 4DK3C 4A3LG 1STBA 4A3IG 2K1BA 4ME3A 2D0PA 4YWKA 4JBMA 2NVQB 5CR3A 1QUQB 3S14B 1FGUA 4H02A 1OXVA 4X65L 1PH9A 5JVH3 2XWJB 4NXML 3RZOB 3CCEA
chains in the Genus database with same CATH topology
3FDTA 3Q24A 3BS1A 1JOKA 1VDZA 2RA4A 2NWGA 1VCIA 2EXZA 3PUYA 4ZK9B 1SBBB 2G9HD 1XYIA 3M7NA 1DOKA 1YNJC 3MFYA 4FF3A 1EWCA 1OXXK 1TWAB 3LNNA 4IFDG 4PMBA 1F9SA 5CORA 1EQTA 1SNOA 3H91A 1R4PB 5C3XA 1UNSA 4EQNA 4F7XA 3FPUB 1LTBD 1BCPD 2MJ8A 3SHLA 1GHKA 3OIPA 1OXTA 3ITPA 3OWFA 4QF4A 1UEAB 2OXPA 3MXGA 1BBXC 1VMCA 1I4GA 5FK9C 4KN7C 5T1GA 4DAPA 1STYA 1TKWB 3KK7A 3M4YA 2FJ2A 2XSCA 1ESFA 2Z4IA 1II3A 5FKAC 2KEDA 1PZJD 2KJXA 1RKNA 1MGSA 4KKUA 1X3PA 4A3MB 4RHRA 1DXMA 1G6ZA 1HUMA 3NE5B 2K32A 3W2DA 2L12A 4ZQ3A 3WDNA 4DAVA 4ZKCB 1V1PA 3D8GA 1RJTA 2YYZA 2B2WC 3JAML 3GTQB 4ZUJA 5C4ZA 1B50A 4XTCS 1CHPD 4V190 5CV5A 1BDOA 3OMCA 2PPBC 4BA1I 1S5FD 2PNRC 2R92B 1EZ6A 2Q8TA 5G3LF 1DOMA 3DXJC 1SMYC 2X6GA 3MZ5A 2RSNA 5C0XG 3LX0A 4OIJA 3I4LA 3QOLA 3P75A 1ILPA 4EVOA 1LT6D 3MXNA 2HDLA 3HOXB 1G2SA 1HCZA 5NUCA 1G2TA 2XWBB 1TVXA 2F0QA 3D4RA 1YNJD 5LHY1 3MXPA 1JWUD 5I4DA 4BBSB 1ZYRC 3QJYA 5D65A 1WTPA 3OWEB 2AQ2B 4FF2A 4H0LC 4A3IB 1DONA 4H13C 4KI0A 3BDLA 4RCOA 3DEPA 5DM73 3D4DA 3DEOA 2C5CA 3TP6A 1HA6A 1WTQA 2A5HA 1Z47A 2DY7A 5A2QL 1HFGA 2EJMA 3PUZA 4I65A 3SK4A 4A3KB 2F1MA 5BN3A 2RKSA 1EY0A 3H3VC 1R9TB 2M9VA 3OPOA 4R8IA 3MVVA 4HTHA 2F0VA 4KJNA 3N6RA 4HSVA 2PZTA 5EPKA 1ZEQX 1S5BD 2KECA 2F0HA 2MUYA 4UAIA 3KLSA 1LACA 5JVG3 3FMCA 3CU7A 2PZWA 3MC0B 5E1FA 2B39A 3PUXA 1SFOB 2L55A 1VF7A 1BNZA 4TQUS 3HKZB 3I8ZA 1PTOB 3L7ZC 1EY9A 1H9SA 2BOSA 3NTHA 4WFN3 3CQZB 1RTNA 4IFDJ 1LTID 2OT2A 1PRTB 1JCKB 1PMRA 2XNAC 4HAEA 1F2YA 1CA6A 1L0YB 2E2IB 3AMUA 4ODGA 1SMYD 2FMMA 5EQ0A 2Z4HA 5CV9A 5I2XA 4A3BB 2R3ZA 3NQTA 5JEAJ 2EDGA 1O78A 1KTKA 1EYAA 1SNPA 3I72A 3I73A 2F0KA 4C3JB 5I9PA 4L6TB 2BCOA 2SEBD 3IL8A 2Q8IB 5CV4A 2WINB 1JWSD 5CGKA 5CBAE 1F9QA 1S5ED 1ZYRD 4ME5A 4U68A 1KLUD 2K6AA 4FNFA 1GUTA 3PIO3 5IT9E 3IAYA 2RSOA 1F2MA 1F2ZA 1J9OA 1H9JA 2L0CA 1B44D 1WVLA 1CZGA 3T4AC 4FXDA 3HGBA 3ERQA 1B9MA 2RVLA 3P1HA 4EGVA 1PTOC 4F88A 1W6KA 2JP1A 1MSHA 3A7AB 3RZDB 3W3AA 1PRTC 3KF8A 3GP7A 1A2TA 3SR1A 1EIHA 1BCPB 1NR2A 1TWFB 3DUZA 1STAA 2PZUA 1U4MA 5C4XB 4OL7A 3EFXD 2F0LA 1LV9A 1LT3D 1I6VC 4HSPA 1SYCA 4DF7A 4IUVA 3Q0AA 3TBIB 1F77A 1IHZA 3TZDA 2IJ0A 4WORA 1Y1VB 4KY5A 5M5XB 3R93A 2B2VC 2K04A 2AWNA 2QEJC 1Q1BA 2OF1A 4X3KA 2F3VA 1QNKA 2ZXOA 1JICA 1Y8NB 4K8JA 3P20A 5C3EB 1ZXTA 1PDQA 5M3MB 3MTSA 1D5MC 5TSSA 1M4VA 4IUQA 3A55A 4DGZA 3M3YB 3A56A 5EKIA 1B3AA 1SNMA 1BR9A 1OXSC 5ISRA 1EY5A 3KLSX 3V05A 4H7BA 2EYPA 5KRUA 3K0YA 2E76C 1EYDA 4BWGB 1CT1D 2A68C 3FKIB 5ELFA 3G7LA 1HRJA 2RQXA 1C4QA 1V43A 4QIWB 1Q90A 3BZDB 5IOCA 1NSNS 1EY4A 3NXWA 1D6EC 3HOWB 5EJWA 1W6JA 1AZPA 2LY7A 1KABA 4XYOA 2EY1A 5E4XA 4KK7A 4C3HG 1LTSD 2K33A 3EJIA 3CRLC 2D5DA 2JA6B 1PTOD 1PZID 3D6WA 5C0XI 2IW3A 1PRTD 1IKMA 3SK6A 1SNDA 4K14A 3K58A 3M85A 3VR6A 1DM0B 1Q12A 2BA1A 5FLXL 1GUGA 2K05A 5JPNC 4DFAA 5C44B 2F0PA 2XVSA 2A6HD 2J7ZA 2PO4A 5COYA 1LT4D 4FP5D 1LTGD 4KKSA 3VR2A 5BN5A 2KQ3A 4CHTB 1B1ZA 2XRQD 1U4RA 2HCCA 4K5VA 3NBHA 1TS4A 1Q8IA 2RDGA 2L11A 2WIIB 3LWUA 1D2BA 3CHBD 2F0WA 1QOHA 1RTOA 4C2MB 1CQVA 4HN7A 2L5TA 4IURA 1SYGA 3J81E 4QUFA 1AW7A 2NN6G 3MFGA 4FXKC 4HR7B 1GJXA 1I6HB 3K57A 3PIP3 3C46A 2MPMA 3WOEA 3VR4A 1KDCA 2F0TA 4RFBA 1EEID 1CQFA 3IFTA 4EQOA 4N9TA 3I70A 4DAYA 1FYCA 5JEAG 4K2LA 3A7LA 3J7YW 2NVYB 5JPMC 1JC7A 2KVMA 2N88A 1NCVA 2F0MA 4K6LA 1EOTA 3VYRA 1DOLA 2X6LA 1WTRA 1KDBA 3X3MA 2A68D 1JOQA 2DN8A 4OO1G 2TMPA 2I07B 4XIGS 3TP7A 4YIJA 5IGFA 4B9WA 4C3IG 4KKTA 1IYUA 1D1KA 4HCEA 3HG9A 2WP8J 2PW7A 4CJ1B 5KYIA 3O13A 3QO2A 1WTWA 3FPPA 1H9KA 3I91A 2E2DC 2K7VA 3NWTA 1TU2B 4OGQC 1O7YA 2F0UA 1SSOA 2EYMA 1ENCA 3K5NA 3S2HB 1ILQA 2E75C 5JOBA 4BY1B 3DMUA 4AYBB 1EY6A 1EEFD 4A3GB 2NTTA 1HTPA 4WJWA 5FO7B 2HCIA 3GV6A 4A3JB 2JE6I 3SK8A 4XQQA 2JA8B 2E2HB 2Z8LA 2NUCA 4KJOA 1EIGA 2KA7A 3EVQA 2D62A 1EY7A 1TWCB 4KMUC 1A3TA 4PQXA 5HGTA 1BOSA 3H0GB 1TWHB 4KV6A 3CRKC 4U673 3QOJA 3DHQA 1CA5A 2H4OA 1MSGA 1HQMC 3HOVB 2J4XA 3BG3A 1AZQA 1SYFA 3NK9A 1CHQD 3ONAB 1I4PA 2IL8A 3S1RB 3UI2A 2EYJA 4FXGC 2KHSA 1Z6HA 2B2UA 1F9RA 3KUPA 3T13A 3HEJA 4ZLTF 3HOUB 2KCCA 3T56B 5K36H 2EJFC 3QG1A 1VMPA 5CBEE 1HQRD 2JA5B 1QCBD 4KHZA 2F0FA 1S5DD 2A73B 1QNUA 3J80L 3E0JA 2WB1B 4IUUA 4G7ZC 4XXEA 4DN4M 3PV0A 5F2DA 1WTOA 4E6IA 2A74C 2F0GA 3VA5A 3TN2A 3BVMA 2EYOA 3GTKB 2ICIA 1LTAD 2F4IA 2EOTA 4RA8A 4MIUA 3N52A 1OO9B 4RKBA 4IFDH 2F0IA 1LTTD 3MXUA 3L9AX 1XX8A 3VYUA 2B2TC 2K28A 2QILA 5EGTA 4DXFA 1JOOA 3I4MB 5C6AA 1SE2A 1U4LA 1ET6A 4NW2A 5EPJA 4O42A 2LFNA 2QKIC 4F8MA 1RF2D 3A8JE 1JORA 3S2DB 2BA0A 4NMZA 5KGUA 1JWMD 3DWQA 1SDFA 2NZ1D 5ELBA 4C3IB 5C5LA 5JJZA 4BA2I 5CMDA 2VXWA 1SNQA 2CVRA 1PTOH 2NB0A 4IUTA 4ILWA 4JK1C 3K5LA 3SE0A 4OHJA 1HTLD 2I46A 2BDNA 1DZ1A 3SVMA 4Y7NB 4A3EB 3NHHA 2R61A 2JYOA 5C5MA 2QF7A 2SNSA 2A69C 4LMQD 5IGDA 3MA2B 1LTRD 2IX0A 5I2YA 2DNCA 2WV6D 1JQYD 4ID6A 3J7AF 1DD2A 1S4ZA 1YNNC 3R3OA 2Z1CA 4K5WA 1O7LA 4RH6A 2O2LD 2F0SA 1V1PB 1PTOF 1A15A 1KAAA 4CJ0B 4R8NA 3AB9A 5CV7A 2M00A 1PRTF 3NTIA 5CV8A 1MI2A 1MD2D 2YU9B 1TY2A 2NYZD 3S9WA 5ELEA 4PMWA 3JAME 3D3RA 3I4NB 2PYKA 4P2CB 5C0XH 1O7ZA 1D5XC 3EROA 1Q1EA 2KCNA 3TMEA 3NUCA 4CJ2C 3SDZA 3RLFA 2F0NA 3I3CA 2B2WA 2NN6I 5DAUA 3A8KE 2RDHA 5LL6S 3C1EA 3LWEA 3BYTB 2A6HC 4Q0FA 4Z9CB 1VF5C 2XIWA 2XRSD 4IFDI 3E5SA 3TP5A 3RMHA 1Q3LA 3PUVA 4ZUIA 2EYHA 3NSWA 3GTGB 2LS01 4K2KA 3IFDA 3ZYYX 4PNYA 1HUNA 4DNRB 5D14A 1SEBD 1EWHA 1X3QA 5EKLA 1PFNA 1DCZA 4CKCA 4XQNA 5D3IB 4KHVA 3A8IE 3M4OB 3RD4A 2FHTA 1R4QB 3R2IA 1WTXA 1ESRA 1H9MA 1HHVA 1B4OA 3VR3A 2EY2A 2HUGA 5J22A 3A54A 1BCPF 4XT1B 3D6CA 1WD0A 4J8QA 1STHA 4X3SA 4V0BA 3S16B 1QWYA 1S5CD 3L3OC 1IYVA 5FO9B 4FF1A 4O1NA 1E2ZA 1PFMA 2K5DA 1PYWD 1G8ZD 1STGA 2AQ3B 5DEHA 5I9OA 3J7AV 5A2QE 5M9OA 2A69D 1ZKOA 3GTPB 4DK0A 1I3QB 1SYEA 2EY5A 4RWSC 3GQBA 1SAPA 4ABNA 1AN8A 1BQQT 1EZ8A 4CKBA 2RDFA 2XN9C 1I4XA 4HMIA 2QCPX 2KEEA 1YNND 1BO0A 2K5WA 4UDUC 1L0XB 2F3WA 1AP0A 3SXHA 2ENBA 3NQIA 3WOFA 4LJZC 5CV6A 4RCNA 5EPLA 1PFBA 3DWPA 3R2TA 2V4DA 3CKIB 2JEBI 5J39A 2WACA 5FOBB 3E6ZX 3Q23A 1EY8A 1H9SB 1CM9A 4DNTB 2AWOA 1CZWA 4A93B 3MAQA 5K5PA 1RODA 1TQOA 2EZVA 2FFKB 2LMCB 4MN3A 1ICWA 2LKVA 4B08A 3NP8A 5CC4A 3GTJB 3HOZB 1KNAA 4WRDA 3GTMB 4HCSA 1TT2A 3NPPA 4J1MA 2JXMB 2D2CC 1HA5A 4A3FB 4FYDA 2EVBA 2O5IC 1FR3A 4ZYSA 5AFWA 2R93B 5KNDA 4DA2A 2PMZB 2DY8A 3TP8A 3G6JB 1SJHD 3HP3A 1D1IA 3OSOA 1TS2A 2EE1A 4NP5A 4ZAIA 5EKKA 5ELDA 1JR0D 3K6OA 3ND9A 1U9RA 4FF4A 1UAPA 1F9PA 2NTSA 1X32A 1U4PA 2D9UA 2F0DA 5D3DA 2C9OA 4KTAA 5E4WC 3BYYB 1XXGA 4RHSA 4K6DA 1ML0D 4QMGA 2IPKD 1STNA 4C1NK 4C56C 3Q22A 4L8JA 5BN4A 3GV3A 3SK5A 3RUZA 2B8GA 2R6GA 5J1ZA 5KNCA 1CI3M 1FGBD 1IL8A 4IN3A 2K03A 4KY6A 2VB3X 3C1FA 2L9HA 5IGCA 5JAVA 3S1MB 1PLFA 3S1NB 1XTCD 5C4JB 3T16A 3D31A 2B2VA 5I6WA 3BVGA 2Y0SB 3DWAA 5IT9L 3H6MA 4C1NI 4ZRZA 2AUJD 4QCLA 3I90A 1XWEA 3F2UA 3MWYW 4C3JG 1V1OA 2F0JA 1A3UA 1A6XA 3DM1A 2B63B 3TDQA 3U9SA 4G7OC 3NWSA 4RAUC 3BDCA 3IKJA 1K83B 2EYLA 4MHEA 5ELCA 1MBYA 2BE5C 3OMGA 4C3HB 4IQZA 4XYQA 1ONLA 2NVTB 4HMJA 2IWHA 3VYSA 3PMFA 1BUVT 1NAPA 4GZYC 4LAAA 1A2UA 3S17B 1C48A 2Q8RE 1HXYD 2A6EC 2K5QA 3VA7A 2M2LA 4RGNA 4KY7A 5FO8B 2L1BA 5EBDA 1GHJA 2PQEA 1OXUA 5M5YB 2KOLA 2ZXPA 5E3FA 5EBCA 2JA7B 1E2WA 1GXDC 2VUMB 1M8AA 1ENAA 3FVQA 2B2YA 4A3DB 1NUCA 1QILA 1CTMA 3FEWX 2CW0C 1IKLA 2IT1A 2FINB 3Q6SA 2VB2X 1V8QA 1JB3A 2G9DA 2KUMA 3EQLC 5FLXE 4NKLA 1LABA 1I4QA 1D5ZC 1EYCA 5M5WB 3C2PA 1NR4A 4J6HA 2GA4B 4ULLA 1B53A 2RBMA 2TSSA 3HOYB 2NN6H 4H44C 3R8BA 1RD9D 4IUNA 2L4NA 1KLGD 3D4WA 1JE4A 3M7GA 4QUCA 2X69A 3S1QB 1BXTA 4TRDA 4F87A 1EL0A 4NDXA 2H1EA 3PUWA 4FO2A 4G57A 5HURA 5JEAH 1IW7C 1K8MA 3FRPB 1FNWA 1C8CA 3GTOB 1LT5D 3NTKA 1Y1WB 1GUSA 2F0EA 4ZKBB 3K5OA 2N55A 3KBXA 3OOCA 2EYFA 5KEEA 3GO5A 3QB3A 1G291 4M1UB 2JSOA 2J0TD 4OO1H 3U9OA 3VYTA 1DJRD 5C4HA 4IZ8A 4B9XA 3GD7A 2CHBD 3OHXC 2NBFA 5KIXA 3HZXA 3HS0C 1BF4A 4BS9A 1EQVA 1Z7TA 2MHVA 4IALA 2BE5D 1E2VA 4QB4A 1H9RA 4CBVA 4X3TA 5C3WA 5CYUA 2MGSA 2WAQB 2PCFB 1G91A 4RKLA 1QG7A 4DXGA 1PZKD 1SXTA 2A6ED 5G3LD 1EU4A 5IGGA 1PXUA 1ET9A 1SYDA 1SYBA 1KDAA 2SOBA 2VNUD 4G4KA 1E0BA 1EFID 3S15B 4JBWA 1I4RA 4LK1C 3J81L 1T5XD 1HFNA 1SJED 1GUWA 3OIQA 2NVXB 2HQEA 1TWGB 5KNBA 4CKEA 2F0OA 2CQAA 3PO3B 2CW0D 3C3LA 1LLRD 3P7JA 1GOZA 2IX1A 3URYA 4R9WA 2O4XA 3VR5A 4DU9A 1B9NA 4XDXA 4TSSA 1DYQA 4N9PA 1RDPD 1QB5D 1I4HA 3EA6A 2ZT9C 1ENFA 1KNEA 3T51B 5LL6X 4RGOS 4L63B 1K8OA 3QWNA 2BDOA 5IGBA 4K8IA 1QJOA 1WD1A 2DNEA 2HDMA 4FVMA 4TKOB 3MHBA 5IIFA 4XQJA 2EJGC 4BY7B 4BBRB 2ICEC 2SNMA 1RCVD 2B8FA 3GTLB 1IW7D 2IX3A 1CK1A 3BVZA 4X3UA 4KD3A 1J8IA 2EPBA 4K5XA 1Y8OB 1EU3A 5A35A 3KLRA 5C0XJ 4OO1I 2AUKA 4PV1C 3OW7A 1TR5A 1FD7D 3TSSA 4CGYB 3K7AB 3HRZC 4I7ZC 3SEBA 1QE6A 3J80E 1TY0A 3NBIA 4G7HC 2JEAI 2FMCA 1SE3A 4DK1A 2F03A 4XT3B 4IUPA 1FNUA 4RGMA 4PMCA 1STEA 5DM63 3K59A 1BCPC 2WKCA 3PO2B 1AFPA 1F2LA 2E2JB 1UUPA 4Q5VA 1A3VA 1CFMA 3H94A 2SDFA 2OEOA 3BDOA 5M3FB 1TS5A 2AQ1B 4EQPA 3AU7A 2E74C 5T1IA 3H09A 4KN4C 2B2UC 3K5MA 2MP1A 4RGTA 1RHPA 1HPCA 1Y8PB 1TS3A 2R7ZB 1SE4A 2B2TA 3T53B 2ID0A 5IGEA 4M8AA 2B2YC 2EY6A 2ZXRA 3TZUA 1FNVA 2O5JC 2K01A 1WCMB 3V2TA 5KYLA 3MEHA 3X3NA 3V96A 2WKDA 2QDBA 4S3SA 1I50B 4HEDA 4KD4A 2PW5A 3KBGA 3QIAA 1WTVA 1AEXA 1TIID 1O80A 1B2TA 1T5EA 4OIKA 1SNCA 5DNFA 1LO5D 1Y69U 5K36G 5I6YA 5IODA 1GUOA 1GUNA 3ND8A 1STBA 2K1BA 2NVQB 5CR3A 3S14B 1OXVA 5JVH3 2XWJB 3RZOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8G A;  2F0D A;  1JOK A;  2F0E A;  2PW7 A;  4K2K A;  4LAA A;  4KTA A;  4I65 A;  3SK4 A;  5KYI A;  1A3V A;  5CV4 A;  4PNY A;  1A2U A;  4ZUJ A;  5C4Z A;  2EYF A;  5J39 A;  2EXZ A;  3TP7 A;  4DGZ A;  5KEE A;  4K6D A;  2WAC A;  2OEO A;  3QB3 A;  5EKL A;  2RKS A;  4QMG A;  1EY0 A;  5CGK A;  4EQP A;  1STN A;  1EY8 A;  2KQ3 A;  5CV5 A;  3OMC A;  2F0F A;  4KY7 A;  4ME5 A;  3U9O A;  2F0U A;  3NHH A;  4K5V A;  2EYM A;  1ENC A;  5C4H A;  5IGB A;  4IZ8 A;  5C5M A;  1SNM A;  2PQE A;  4KHV A;  2SNS A;  3MVV A;  4HTH A;  4K8I A;  5JOB A;  4B9X A;  1F2M A;  5K5P A;  5ISR A;  1EZ6 A;  3SXH A;  1F2Z A;  1EY5 A;  2F0W A;  1TQO A;  5E3F A;  2F0V A;  5IGD A;  3SK5 A;  4KJN A;  3DMU A;  4H7B A;  5F2D A;  4PMB A;  2EYP A;  3RUZ A;  5KRU A;  3MHB A;  5KIX A;  5IIF A;  3HZX A;  5J1Z A;  4E6I A;  1ENA A;  2PZT A;  1SNO A;  1SYG A;  1EY6 A;  1EYD A;  1EQV A;  2LKV A;  2F0G A;  3ERQ A;  3NP8 A;  2SNM A;  3MZ5 A;  3P1H A;  4ID6 A;  5IGE A;  5CC4 A;  3VA5 A;  5C3X A;  1NUC A;  2EY2 A;  4IAL A;  4EQN A;  5J22 A;  2F0H A;  2EY6 A;  4QB4 A;  4F7X A;  3LX0 A;  4KY6 A;  3QOL A;  3R3O A;  3P75 A;  3SHL A;  3SK8 A;  3D6C A;  4K5W A;  1STH A;  3C1F A;  3ITP A;  3OWF A;  4KD3 A;  4QF4 A;  2EYO A;  4WRD A;  5IGC A;  2NUC A;  1TT2 A;  4EVO A;  5JAV A;  5C3W A;  2OXP A;  4K5X A;  3V2T A;  4J1M A;  1A2T A;  5KYL A;  3SR1 A;  2PZW A;  4KJO A;  3MEH A;  2F0S A;  5E1F A;  4MIU A;  4RKL A;  3T16 A;  5IOC A;  3EVQ A;  1STA A;  1EY7 A;  4NKL A;  4RKB A;  2PZU A;  1KDC A;  1STY A;  2F0I A;  1KAA A;  2QDB A;  1EYC A;  5I6W A;  4R8N A;  4OL7 A;  1A3T A;  1NSN S;  2F0T A;  4S3S A;  5CV7 A;  1STG A;  2M00 A;  5NUC A;  1EY4 A;  3NXW A;  4J6H A;  1TR5 A;  4KD4 A;  5CV8 A;  5DEH A;  4EQO A;  2F0L A;  1EY9 A;  1SYD A;  2F0Q A;  2PW5 A;  1II3 A;  4N9T A;  5HGT A;  5I9O A;  3H6M A;  1SYB A;  2RBM A;  1KDA A;  2SOB A;  3S9W A;  5M9O A;  1AEX A;  1SYC A;  3MXP A;  5EGT A;  4KV6 A;  3QOJ A;  4K2L A;  2PYK A;  5C5L A;  1JOO A;  3DHQ A;  4IUN A;  1SYE A;  2EY5 A;  3TP8 A;  4DF7 A;  5C6A A;  1KAB A;  1IHZ A;  3D4W A;  1SNC A;  2EY1 A;  3ERO A;  3TME A;  1F2Y A;  3NUC A;  1RKN A;  5I6Y A;  4WOR A;  4KY5 A;  2F0M A;  2F0J A;  4F8M A;  3EJI A;  1SYF A;  2F0N A;  3NK9 A;  1A3U A;  1EZ8 A;  2RDF A;  3OSO A;  4ODG A;  5IOD A;  2HQE A;  1KDB A;  5DAU A;  4TRD A;  5CV9 A;  1JOR A;  4HMI A;  4NMZ A;  1STB A;  3C1E A;  3NQT A;  2F0O A;  3BDL A;  4NP5 A;  5EKK A;  5KGU A;  1JOQ A;  3BDC A;  2F3W A;  2OF1 A;  2EYJ A;  5IGG A;  3SK6 A;  4NDX A;  1SND A;  2EYL A;  3D4D A;  2ENB A;  2F3V A;  4PMC A;  1U9R A;  2KHS A;  4K14 A;  5CR3 A;  4YIJ A;  2O4X A;  5CV6 A;  5IGF A;  4ZQ3 A;  1EYA A;  4DU9 A;  3E5S A;  1SNP A;  4G57 A;  3TP5 A;  4B9W A;  2F0K A;  5I9P A;  5HUR A;  3OMG A;  4ZUI A;  4N9P A;  3TP6 A;  1SNQ A;  4K8J A;  3T13 A;  4HMJ A;  4DFA A;  3HEJ A;  2EYH A;  3PMF A;  2F0P A; 
#chains in the Genus database with same CATH topology
 3FDT A;  2R93 H;  3K0X A;  3Q24 A;  3BS1 A;  1JOK A;  1VDZ A;  5IYC G;  2UU9 Q;  4YCV A;  2RA4 A;  2NWG A;  1VCI A;  1KQS A;  2EXZ A;  1HNX L;  3PUY A;  4ZK9 B;  1SBB B;  2DJF C;  4A3K G;  1K28 A;  2G9H D;  1XYI A;  1PH5 A;  3M7N A;  2LXK A;  1DOK A;  1YNJ C;  3MFY A;  4FF3 A;  1EWC A;  3J81 i;  1OXX K;  1TWA B;  3LNN A;  4JI2 L;  4IFD G;  4PMB A;  1F9S A;  2AMC B;  1IBM Q;  5COR A;  1EQT A;  1P16 A;  1RIP A;  1SNO A;  1YIJ A;  2Q2T A;  3H91 A;  1R4P B;  3CCS A;  5C3X A;  1UNS A;  4EQN A;  2JA9 A;  4F7X A;  1EWI A;  3FPU B;  1LTB D;  1BCP D;  2EXD A;  2MJ8 A;  3SHL A;  5IWA L;  1GHK A;  3OIP A;  1KRT A;  1OXT A;  1SMX A;  1X9N A;  3ITP A;  3OWF A;  4QF4 A;  1UEA B;  4DR5 Q;  2OXP A;  3MXG A;  3ER0 A;  1BBX C;  3I4M G;  1VMC A;  1I4G A;  3OYY A;  5FK9 C;  3PCO B;  4KN7 C;  5T1G A;  4DAP A;  3D0F A;  1STY A;  1TKW B;  3KK7 A;  4AYB E;  3M4Y A;  2CWP A;  2FJ2 A;  2XSC A;  1ESF A;  2Z4I A;  1II3 A;  1EUJ A;  3HKZ G;  2CQO A;  5FKA C;  2KED A;  4X62 Q;  2HIX A;  1PZJ D;  2DJG C;  2KJX A;  1HZB A;  3E3X A;  1RKN A;  1MGS A;  4X6A H;  4KKU A;  5GQO A;  3DM3 A;  1X3P A;  4B3R Q;  4A3M B;  4RHR A;  3S1M H;  2I5M X;  1DXM A;  1G6Z A;  1HUM A;  3NE5 B;  4MZ9 A;  4HJ7 A;  2K32 A;  5C4J H;  3W2D A;  2OQ0 A;  2K4K A;  2L12 A;  2ZJR A;  4ZQ3 A;  3WDN A;  4DAV A;  4ZKC B;  2UXC Q;  4RMF A;  2EIF A;  1V1P A;  3OTO L;  1X6O A;  3D8G A;  1RJT A;  2K75 A;  5JJK A;  5FLM G;  2YYZ A;  2B2W C;  4QY7 A;  3JAM L;  4ZUJ A;  5C4Z A;  3GTQ B;  1B50 A;  1IBK L;  4XTC S;  1VQE A;  1Q46 A;  1CHP D;  1YI2 A;  4V19 0;  4GNX B;  2PI2 E;  5CV5 A;  1BDO A;  3OMC A;  2PPB C;  2B63 H;  2BH2 A;  1VQD A;  3GTQ H;  2CWA A;  4BA1 I;  1S5F D;  2PNR C;  1X3G A;  2R92 B;  1EZ6 A;  2OTL A;  3EBE A;  1K83 H;  3T1H L;  2N78 A;  4IOC A;  4GN4 B;  4A76 A;  2Q8T A;  5G3L F;  1DOM A;  1HZA A;  2NVT H;  2RHS B;  3DXJ C;  3KLW A;  4QL5 A;  1SMY C;  2X6G A;  3MZ5 A;  2RSN A;  4HIO A;  5C0X G;  2R7F A;  3LX0 A;  4OIJ A;  3I4L A;  1KXL A;  3QOL A;  3P75 A;  1ILP A;  4DUZ L;  3KJP A;  1CKN A;  4LNQ A;  3U4V A;  4EVO A;  1LT6 D;  2UXD L;  3OW2 A;  3MXN A;  2HDL A;  3HOX B;  2WB1 E;  1G2S A;  1HCZ A;  1E24 A;  3CCM A;  1UE1 A;  5M5Y H;  2G5D A;  5NUC A;  4GOP B;  1G2T A;  2XWB B;  1TVX A;  2F0Q A;  2JA7 H;  5C4X G;  3D4R A;  1YNJ D;  5LHY 1;  2VUM H;  1XPO A;  3MXP A;  1JWU D;  5I4D A;  2GVB A;  4BBS B;  1ZYR C;  2HHH Q;  3PGZ A;  4A3D H;  5FLX c;  3QJY A;  5D65 A;  1WTP A;  2BH8 A;  2VQF Q;  3OWE B;  4JI0 L;  4WJ3 M;  3K8A A;  2AQ2 B;  4FF2 A;  4H0L C;  1L1O A;  4A3I B;  1Y1V G;  1DON A;  4H13 C;  4KI0 A;  3BDL A;  4RCO A;  3DEP A;  1U5K A;  4CDE C;  1XJV A;  4DV6 L;  4GNX C;  1B8A A;  5DM7 3;  3D4D A;  3DEO A;  2B29 A;  2C5C A;  2OQK A;  4GLV B;  1JMC A;  3TP6 A;  1HA6 A;  1BBU A;  1WTQ A;  5LMN W;  2HIV A;  3HOY H;  2A5H A;  1Z47 A;  2DY7 A;  5A2Q L;  1HFG A;  2EJM A;  5C3E G;  3PUZ A;  4I65 A;  3SK4 A;  5M3M G;  2QGQ A;  4LW1 A;  4JI7 Q;  4A3K B;  2F1M A;  5BN3 A;  2Q2H A;  2RKS A;  1EY0 A;  4LFC L;  4JW0 A;  3H3V C;  1R9T B;  4OEM B;  4HJ5 A;  2M9V A;  1VQH A;  3OPO A;  4R8I A;  3MVV A;  4HTH A;  4GN3 B;  2F0V A;  1BKB A;  4KJN A;  2CH4 A;  3N6R A;  1JJG A;  4HSV A;  1EIY B;  3ICE A;  2PZT A;  5EPK A;  1ZEQ X;  4GOP C;  1S5B D;  4JVZ A;  3GTO H;  2KEC A;  2F0H A;  1Y1W H;  2MUY A;  1IBK Q;  4UAI A;  3KLS A;  1LAC A;  5JVG 3;  3FMC A;  3CU7 A;  3FKI G;  2PZW A;  3MC0 B;  5E1F A;  3A0J A;  2B39 A;  3PUX A;  1YVC A;  1SFO B;  2L55 A;  1B70 B;  1VF7 A;  2P5Z X;  5GAG C;  1PYB A;  1BNZ A;  4TQU S;  3HKZ B;  3I8Z A;  1EQQ A;  1MIU A;  1PTO B;  3TEH B;  3L7Z C;  1EY9 A;  1H9S A;  3CCV A;  2BOS A;  3NTH A;  3EIV A;  4WFN 3;  3CQZ B;  1RTN A;  4DV2 L;  4PZ7 A;  4IFD J;  1LTI D;  2OT2 A;  3HOW G;  1PRT B;  1JCK B;  1PMR A;  2GVA A;  2XNA C;  2MFI A;  4HAE A;  1Y14 B;  1F2Y A;  1CA6 A;  1L0Y B;  2E2I B;  1XNQ L;  3CQZ H;  3AMU A;  2PQA A;  4ODG A;  2OTJ A;  1SMY D;  2FMM A;  5EQ0 A;  2Z4H A;  4JI6 L;  5CV9 A;  5I2X A;  4A3B B;  4JOI A;  2R3Z A;  3NQT A;  5JEA J;  1NMF A;  5H1S E;  1XMQ Q;  2EDG A;  1O78 A;  3J7Z C;  1KTK A;  2CH4 W;  4A3B H;  2QA4 A;  1JT8 A;  4DR7 L;  1EYA A;  1SNP A;  3I72 A;  3I73 A;  2F0K A;  4C3J B;  5I9P A;  4L6T B;  2BCO A;  4DV0 Q;  4BXX G;  1N33 Q;  3CF5 A;  2SEB D;  4OX9 L;  4YHH Q;  3IL8 A;  3KOJ A;  4QGU A;  2Q8I B;  3S15 H;  4C3J H;  5CV4 A;  4A4I A;  2WIN B;  1JWS D;  4JI0 Q;  5CGK A;  4JPB W;  5CBA E;  4YWL A;  4A3C G;  1UE6 A;  1F9Q A;  1S5E D;  3CXC A;  1ZYR D;  2QDL A;  5AJ3 L;  3AFQ A;  1TWG H;  2CFM A;  4ME5 A;  1KLU D;  4U68 A;  2K6A A;  5IT9 c;  4FNF A;  1XMO L;  3HOZ G;  1GUT A;  3PIO 3;  3PO3 H;  5IT9 E;  3IAY A;  2RSO A;  4FDB A;  1F2M A;  2QW7 A;  4JI4 Q;  1F2Z A;  1J9O A;  1H9J A;  2L0C A;  5LMU L;  1B44 D;  1WVL A;  4P72 A;  1CZG A;  3T4A C;  4A75 A;  4FXD A;  1VQF A;  4A3F G;  3HGB A;  3ERQ A;  1B9M A;  2RVL A;  3P1H A;  4EGV A;  1PTO C;  4F88 A;  1W6K A;  2IY5 B;  2JP1 A;  1MSH A;  3A7A B;  1XPR A;  3RZD B;  3W3A A;  1KC8 C;  1PRT C;  3KF8 A;  3GP7 A;  1A2T A;  2LSS A;  3SR1 A;  1EIH A;  1BCP B;  3PIO A;  1NR2 A;  1TWF B;  3DUZ A;  1STA A;  3K7U C;  3AEV A;  2PZU A;  3NEM A;  4LWC A;  2E5L L;  1U4M A;  5C4X B;  3JAM i;  4OL7 A;  4NXN L;  3EFX D;  2F0L A;  1LV9 A;  1TWF H;  1LT3 D;  1I6V C;  4IPC A;  4HSP A;  4OEL B;  1QVF A;  1SYC A;  4BY7 H;  4DF7 A;  4IUV A;  3Q0A A;  3TBI B;  4BBR H;  1F77 A;  4P73 A;  1IHZ A;  4B3S Q;  3TZD A;  1N36 Q;  3K81 C;  2IJ0 A;  4WOR A;  1Y1V B;  3MXN B;  4KY5 A;  4GLA C;  5M5X B;  1X55 A;  3M9B A;  1MJE A;  1UEB A;  3R93 A;  1YHQ A;  2B2V C;  2JK8 A;  1HZ9 A;  2K04 A;  3UDF A;  2AWN A;  2QEJ C;  2ZTD A;  4MNO A;  1Q1B A;  2OF1 A;  3CCL A;  1JE5 A;  1AE2 A;  2KCM A;  2F3V A;  4X3K A;  3RN5 A;  1QNK A;  1E7Z A;  4CDD C;  4R4I A;  2ZXO A;  4DK6 C;  1JIC A;  1Y8N B;  2FXQ A;  4K8J A;  1VQ9 A;  4AH6 A;  3P20 A;  2Z6B A;  3W5O A;  5C3E B;  1PHJ A;  1ZXT A;  3RNU A;  4MTN A;  1PDQ A;  2K5H A;  5M3M B;  3MTS A;  1D5M C;  3K7A H;  1NJI C;  5TSS A;  1M4V A;  2ZM6 Q;  1NE3 A;  4IUQ A;  3A55 A;  2KBN A;  4DGZ A;  3M3Y B;  4POF A;  4B3M Q;  3A56 A;  3CCU A;  5EKI A;  4GLX A;  1B3A A;  1SNM A;  1BR9 A;  4P75 A;  4CDF C;  3F2D A;  1IBM L;  1OXS C;  5ISR A;  1WJJ A;  1EY5 A;  3KLS X;  3V05 A;  4H7B A;  2EYP A;  5KRU A;  3K0Y A;  2E76 C;  4YWM A;  1N9W A;  2GN5 A;  4BY1 G;  1EYD A;  3PO2 H;  4BWG B;  1TXY A;  4DR3 Q;  4DR5 L;  1CT1 D;  1PH8 A;  2A68 C;  1QVG A;  2VY3 A;  4A3G G;  3FKI B;  5ELF A;  3G7L A;  2NZO A;  1HRJ A;  2ALY B;  2RQX A;  1YNX A;  1C4Q A;  4A3J G;  1IYJ B;  2K5N A;  1C9O A;  5M3F H;  2UUC Q;  2JA8 G;  1V43 A;  3CCJ A;  1X56 A;  4QIW B;  1Q90 A;  3BZD B;  5IOC A;  1M1K C;  3KF6 A;  2UUA Q;  1K3R A;  1NSN S;  1EY4 A;  3NXW A;  3I55 A;  1D6E C;  4X62 L;  3HOW B;  5EJW A;  2R7Z H;  1W6J A;  2VL6 A;  1AZP A;  2LY7 A;  1OTC A;  1KAB A;  4XYO A;  1I94 Q;  2EY1 A;  3H0G G;  5E4X A;  4KK7 A;  4C3H G;  1LTS D;  3HFZ B;  4B3R L;  2K33 A;  3EJI A;  1ASY A;  3HOV G;  3CRL C;  2D5D A;  2JA6 B;  1QVC A;  3GDE A;  4JBJ A;  1PTO D;  4GN5 A;  4IO9 A;  1PZI D;  3D6W A;  5C0X I;  2UUB Q;  2IW3 A;  1VQP A;  1PRT D;  2JA6 H;  1IKM A;  1SRO A;  1JJC B;  1SND A;  3IRB A;  3SK6 A;  2UXC L;  2ES2 A;  4K14 A;  3K58 A;  3M85 A;  3VR6 A;  1DM0 B;  1Q12 A;  2BA1 A;  5FLX L;  4IPH A;  1Q81 C;  1GUG A;  1I50 H;  2K05 A;  2PMZ E;  3H15 A;  5JPN C;  4DFA A;  5C44 B;  2F0P A;  2Z6K C;  2JJQ A;  2XVS A;  2A6H D;  2J7Z A;  2PO4 A;  1PH6 A;  4IOA A;  5COY A;  1LT4 D;  5C44 H;  1K0R A;  3HOU G;  2CCZ A;  4FP5 D;  1LTG D;  1PH3 A;  1Q7Y C;  4KKS A;  3VR2 A;  5BN5 A;  5GAD C;  2KQ3 A;  4CHT B;  1B1Z A;  2JA5 G;  2XRQ D;  1VQ4 A;  1U4R A;  2HCC A;  4K5V A;  1KL9 A;  3NBH A;  4LF5 Q;  1TS4 A;  1Q8I A;  2RDG A;  2L11 A;  2WII B;  3LWU A;  2DUD A;  1D2B A;  3CHB D;  2F0W A;  1N8R C;  1QOH A;  1RTO A;  2NVQ H;  3J81 c;  4C2M B;  3S14 H;  1CQV A;  2WB1 G;  2L5T A;  4HN7 A;  4IUR A;  3I56 A;  1SYG A;  3J81 E;  4QUF A;  1AW7 A;  2NN6 G;  3RZO H;  1CUK A;  3MFG A;  1VQK A;  4FXK C;  3SGI A;  3U58 A;  4HR7 B;  1GJX A;  4C2M H;  5FJ8 H;  4ZCK A;  1I6H B;  3K57 A;  4YCU A;  3PIP 3;  4JI3 Q;  4UP9 A;  4LF8 Q;  3C46 A;  2MPM A;  1J5E Q;  3WOE A;  3VR4 A;  1KAW A;  1KDC A;  2F0T A;  4RFB A;  4DR6 Q;  1EEI D;  1TWA H;  1CQF A;  1YHA A;  3IFT A;  4EQO A;  1LTL A;  4N9T A;  1N34 Q;  3I70 A;  4DAY A;  1FYC A;  5JEA G;  4DKA C;  2HHH L;  4K2L A;  2VQF L;  3A7L A;  3J7Y W;  2NVY B;  5JPM C;  3KF8 B;  1EFW A;  1JC7 A;  2KVM A;  2N88 A;  1NCV A;  2F0M A;  4K6L A;  1EOT A;  3VYR A;  1DOL A;  2X6L A;  1WTR A;  1KDB A;  3CME A;  4GKJ Q;  3X3M A;  2A68 D;  1JOQ A;  2JQO A;  2DN8 A;  4OO1 G;  2TMP A;  2I07 B;  4OXP A;  2Y0S E;  1HR0 W;  4XIG S;  3TP7 A;  5IYB H;  1PYS B;  4YIJ A;  1L2F A;  5IGF A;  4B9W A;  4C3I G;  4KKT A;  1IYU A;  1D1K A;  5IP7 H;  4HCE A;  4JI7 L;  4LF7 L;  3HG9 A;  2WP8 J;  2PW7 A;  4CJ1 B;  1T9H A;  5KYI A;  1VQN A;  3O13 A;  4R4C A;  2HT1 A;  3QO2 A;  2B3G A;  1WTW A;  3FPP A;  1H9K A;  3I91 A;  2E2D C;  2K7V A;  3NWT A;  4L5R C;  4Y52 H;  1TU2 B;  4OGQ C;  1O7Y A;  2F0U A;  4A3M H;  1SSO A;  3M4Q A;  5IP9 H;  2EYM A;  1ENC A;  3K5N A;  3S2H B;  1ILQ A;  2E75 C;  3CAM A;  5JOB A;  4NB3 A;  4A3E G;  2ZTE A;  4BY1 B;  4UP7 A;  3CMA A;  4DV5 Q;  3DMU A;  1HR0 Q;  3KDF A;  1K8G A;  4AYB B;  2WAQ G;  4X64 Q;  5ELN A;  3BZK A;  3S2H H;  1EY6 A;  1MKH A;  1EEF D;  5IYD G;  3T1Y Q;  4A3G B;  2NTT A;  1HTP A;  4WJW A;  5FO7 B;  2HCI A;  3GV6 A;  4A3J B;  1SLJ A;  2JE6 I;  3SK8 A;  4XQQ A;  2JA8 B;  2E2H B;  2Z8L A;  2NUC A;  1S72 A;  4KJO A;  1EIG A;  2KA7 A;  3EVQ A;  2D62 A;  1EY7 A;  2K14 A;  1TWC B;  4APV A;  4KMU C;  4KLK A;  1A3T A;  4PQX A;  2R92 H;  5GAH C;  5HGT A;  1BOS A;  1VQL A;  3H0G B;  1TWH B;  4KV6 A;  3CRK C;  4U67 3;  4R4T A;  3QOJ A;  3DHQ A;  1CA5 A;  2H4O A;  1MSG A;  1HQM C;  3I4N G;  3HOV B;  2J4X A;  3BG3 A;  1AZQ A;  3H3V H;  4DAM A;  1SYF A;  3NK9 A;  4DUY Q;  1GM5 A;  2CKZ B;  4RG1 A;  4QQB X;  1BBW A;  1CHQ D;  1XMQ L;  2MO1 A;  3ONA B;  1I4P A;  2IL8 A;  3S1R B;  2VS1 A;  3UI2 A;  4GS3 A;  2EYJ A;  4P71 A;  4FXG C;  3HOX H;  4DV0 L;  1N33 L;  2KHS A;  1Z6H A;  4YHH L;  2B2U A;  1F9R A;  1NNX A;  3KUP A;  3T13 A;  4DR4 Q;  3HEJ A;  2KCT A;  4JYA Q;  1VQ7 A;  4ZLT F;  3UDI A;  4EQ5 A;  3HOU B;  2KCC A;  3T56 B;  5K36 H;  3A5Z B;  2EJF C;  3QG1 A;  4BBS H;  1VMP A;  1K8A C;  5CBE E;  1HQR D;  2JA5 B;  1QCB D;  4JI8 Q;  4KHZ A;  4A3L H;  2F0F A;  4A3I H;  3CCQ A;  4JI4 L;  1S5D D;  2MNA A;  2A73 B;  1QNU A;  3J80 L;  4R4O A;  3E0J A;  2WB1 B;  4IUU A;  4G7Z C;  4XXE A;  4DN4 M;  3PV0 A;  5F2D A;  4YCW A;  1YJN A;  1WTO A;  1K73 C;  4E6I A;  4IPG A;  3PQI A;  2A74 C;  3TQY A;  2F0G A;  5IYC H;  4LF7 Q;  3VA5 A;  3TN2 A;  3BVM A;  2Z9H A;  3PF4 A;  2EYO A;  4A3K H;  3GTK B;  2ICI A;  1LTA D;  2F4I A;  1WFQ A;  2EOT A;  4RA8 A;  4MIU A;  3N52 A;  4J15 A;  1R9T H;  1OO9 B;  1NBW A;  4RKB A;  4IFD H;  2AHO B;  2F0I A;  1LTT D;  1XNR Q;  3MXU A;  5GAE C;  3L9A X;  1XX8 A;  3VYU A;  2B2T C;  2K28 A;  4DV4 L;  4B3S L;  2QIL A;  5EGT A;  1LYL A;  1N36 L;  5LMN Q;  3PF5 A;  4DXF A;  1JOO A;  3I4M B;  5C6A A;  1SE2 A;  3FP9 A;  1QZH A;  1U4L A;  1UE5 A;  1ET6 A;  4NW2 A;  4O42 A;  5EPJ A;  2LFN A;  2QKI C;  3ULP A;  3CC2 A;  4F8M A;  3NEN A;  1RF2 D;  2PNH A;  3I4M H;  2WAQ E;  2XGT A;  3A8J E;  1JOR A;  1E3P A;  3S2D B;  2BA0 A;  4NMZ A;  5KGU A;  1PA6 A;  1JWM D;  3DWQ A;  1SDF A;  3STB C;  2NZ1 D;  4LUV A;  5ELB A;  4C3I B;  5C5L A;  1SFO H;  3E9I A;  3J81 j;  1VQM A;  5JJZ A;  4BA2 I;  5CMD A;  1PH7 A;  3UE1 A;  2VXW A;  1SNQ A;  1CSQ A;  1PTO H;  2CVR A;  3K80 C;  2NB0 A;  2ZM6 L;  4IUT A;  3S24 A;  4ILW A;  1Q8K A;  4JK1 C;  1W3S A;  4L5Q A;  3K5L A;  3SE0 A;  4OHJ A;  1NY4 A;  4B3M L;  1HTL D;  3CW2 C;  2I46 A;  1C7Y A;  2E2I H;  1FJG Q;  1A8V A;  1IL2 A;  3Q8D A;  2BDN A;  1DZ1 A;  3H3V I;  3SVM A;  4Y7N B;  1SRU A;  4A3E B;  3NHH A;  4GKK Q;  2R61 A;  2JYO A;  5C5M A;  2QF7 A;  5ELO A;  2SNS A;  2A69 C;  2MO0 A;  4LMQ D;  1WCM G;  5IGD A;  3MA2 B;  4Y7N H;  4A93 G;  4DR3 L;  1LTR D;  2IX0 A;  5I2Y A;  1YIT A;  2DNC A;  2WV6 D;  1JQY D;  4ID6 A;  3J7A F;  4HID A;  5FLM H;  1DD2 A;  1QUQ A;  1S4Z A;  4WJ4 A;  1YNN C;  3R3O A;  2UUC L;  2Z1C A;  4K5W A;  1O7L A;  2OCE A;  1L0W A;  4RH6 A;  2O2L D;  2UUA L;  2F0S A;  1V1P B;  4POG A;  1PTO F;  1A15 A;  4DV1 Q;  1HNW Q;  1H95 A;  1KAA A;  4CJ0 B;  2UXB Q;  4R8N A;  3AB9 A;  4JI5 Q;  5CV7 A;  1D7Q A;  2M00 A;  1PRT F;  3NTI A;  5CV8 A;  1MI2 A;  1MD2 D;  2YU9 B;  3CCR A;  2I0Q A;  1TY2 A;  2NYZ D;  3S9W A;  5ELE A;  4PMW A;  1I94 L;  1N32 Q;  3JAM E;  3D3R A;  3I4N B;  2PYK A;  4P2C B;  5C0X H;  1O7Z A;  3UE0 A;  1D5X C;  2R93 G;  1XPU A;  3ERO A;  1HNZ L;  1Q1E A;  2KCN A;  3TME A;  3NUC A;  4IJH A;  4CJ2 C;  3SDZ A;  2UUB L;  3RLF A;  2F0N A;  3I3C A;  3A74 A;  2B2W A;  2NN6 I;  3RZD H;  5DAU A;  3A8K E;  4JI1 Q;  2RDH A;  5LL6 S;  3C1E A;  3LWE A;  3BYT B;  1ASZ A;  2A6H C;  4Q0F A;  2VQE Q;  4Z9C B;  5BR8 L;  1VF5 C;  2XIW A;  2XRS D;  1K9M C;  5C4X H;  4DV3 Q;  4IFD I;  4HJ8 A;  3E5S A;  3TP5 A;  3RMH A;  1Q3L A;  4HJ9 A;  3PUV A;  2Q2I A;  4ZUI A;  1CKN B;  1KHI A;  4DV4 Q;  4AQY L;  2EYH A;  3NSW A;  3GTG B;  1VQ8 A;  2LS0 1;  4K2K A;  3IFD A;  3ZYY X;  2N8N A;  4PNY A;  4OWW B;  4LF4 Q;  4TVA B;  1HUN A;  4DNR B;  5D14 A;  1SEB D;  1EWH A;  1X3Q A;  3GTG H;  5EKL A;  1PFN A;  1DCZ A;  1Y1V H;  4CKC A;  5M5X H;  4XQN A;  4LF5 L;  4K0K Q;  3NEL A;  5D3I B;  4KHV A;  1CKO A;  2K52 A;  3A8I E;  3M4O B;  3RD4 A;  3F2B A;  2FHT A;  1YZ6 A;  1R4Q B;  3R2I A;  2F3I A;  3STB D;  1WTX A;  3RLN A;  1ESR A;  3BJU A;  1H9M A;  2KHJ A;  1L1O B;  1HHV A;  1B4O A;  5C3E H;  3F2C A;  3TRZ A;  3VR3 A;  5M3M H;  2EY2 A;  2HUG A;  5J22 A;  1PV4 A;  3A54 A;  1BCP F;  4JI3 L;  4XT1 B;  3D6C A;  1WD0 A;  4LF8 L;  4J8Q A;  1STH A;  4X3S A;  1J5E L;  4V0B A;  1VQG A;  3S16 B;  3M3Y H;  1QWY A;  1S5C D;  3L3O C;  1IYV A;  5FO9 B;  4FF1 A;  4DR6 L;  4YY3 Q;  4O1N A;  1E2Z A;  1PFM A;  1LM0 A;  4LFB Q;  3BZC A;  2K5D A;  3S16 H;  3L2P A;  1N34 L;  1PYW D;  2N49 A;  1G8Z D;  3CC4 A;  1STG A;  2AQ3 B;  5DEH A;  5I9O A;  3J7A V;  5A2Q E;  3UDX A;  2Y0S G;  4IPD A;  5M9O A;  2A69 D;  1ZKO A;  3GTP B;  4DK0 A;  1PH4 A;  1I3Q B;  1SYE A;  2EY5 A;  2EQS A;  3GQB A;  4RWS C;  2DGY A;  3J80 i;  1JJ2 A;  2LXJ A;  2N3S A;  3WWV A;  1SAP A;  4ABN A;  4GKJ L;  1AN8 A;  1BQQ T;  1EZ8 A;  4CKB A;  2RDF A;  2XN9 C;  1I4X A;  3FKI H;  3G71 A;  1Q86 C;  4HMI A;  2QCP X;  2KEE A;  1YNN D;  1BO0 A;  2B63 G;  2D0O A;  2K5W A;  4UDU C;  1L0X B;  2F3W A;  4N8F A;  1AP0 A;  3ZJY C;  3SXH A;  2ENB A;  4EX5 A;  3NQI A;  3WOF A;  4LJZ C;  2RHQ B;  2K50 A;  5CV6 A;  4RCN A;  5EPL A;  4LF9 Q;  2A1A A;  2VZA A;  1PFB A;  3DWP A;  2JN4 A;  4LFA Q;  2ZJP A;  3R2T A;  4LF6 Q;  3HOW H;  2V4D A;  3CPW A;  4I7A A;  2PI2 A;  1HNZ Q;  3CKI B;  4GOP A;  2JEB I;  1Q82 C;  1L1O C;  3L0O A;  5J39 A;  2C35 B;  4DR2 Q;  2WAC A;  5FOB B;  3E6Z X;  1VQC A;  3Q23 A;  1EY8 A;  1H9S B;  2K5V A;  4X66 Q;  1CM9 A;  4DNT B;  4R1J A;  4DV5 L;  2AWO A;  1HR0 L;  1PFS A;  1CZW A;  4DR1 Q;  5BR8 Q;  4A93 B;  4X64 L;  3MAQ A;  5K5P A;  1ROD A;  1TQO A;  2EZV A;  4BXX H;  2FFK B;  3TS0 A;  2PQA B;  2LMC B;  3T1Y L;  4MN3 A;  4AQY Q;  2JA7 G;  1ICW A;  2LKV A;  2VUM G;  4B08 A;  3NP8 A;  5CC4 A;  3I4O A;  3GTJ B;  3HOZ B;  1KNA A;  4DV7 Q;  1W2B A;  1IBL Q;  4A3D G;  1RL2 A;  4WRD A;  3GTM B;  4HCS A;  4A3C H;  1TT2 A;  4B3T Q;  5HGQ A;  3NPP A;  4J1M A;  2JXM B;  3U50 C;  4UPA A;  3HOZ H;  4O2D A;  2D2C C;  1HA5 A;  5JJL A;  4A3F B;  4FYD A;  3GTM H;  2EVB A;  2O5I C;  1FR3 A;  4ZYS A;  3KJO A;  3AFP A;  2IHE A;  5AFW A;  2RF4 A;  4OWT B;  4A3F H;  1MHW C;  2R93 B;  5KND A;  4DA2 A;  2PMZ B;  2DY8 A;  2ZJQ A;  3TP8 A;  1P8L A;  4DUY L;  3HOY G;  3G6J B;  1SJH D;  3HP3 A;  4L5S A;  1D1I A;  1I6H H;  1I5F A;  3OSO A;  1TS2 A;  2EE1 A;  4NP5 A;  4ZAI A;  1SR3 A;  5EKK A;  5ELD A;  1JR0 D;  3K6O A;  3ND9 A;  1U9R A;  4FF4 A;  1UAP A;  3TRE A;  4DR4 L;  4JYA L;  3FHW A;  4LUO A;  1F9P A;  2NTS A;  4KHP Q;  1X32 A;  1U4P A;  4IJL A;  2D9U A;  3PIP A;  2F0D A;  5D3D A;  1A0I A;  2C9O A;  4KTA A;  4JI8 L;  5E4W C;  3BYY B;  2NVY H;  1XXG A;  4RHS A;  4K6D A;  1YJW A;  1Y1W G;  1ML0 D;  4JOI C;  4QMG A;  2IPK D;  1STN A;  2AKW B;  4C1N K;  1S40 A;  1EYG A;  4C56 C;  3Q22 A;  4L8J A;  1HJP A;  1NMG A;  5GRO A;  5BN4 A;  1YEZ A;  3GV3 A;  1QZG A;  3QR8 A;  3SK5 A;  3RUZ A;  2B8G A;  2R6G A;  5J1Z A;  5KNC A;  1CI3 M;  4JG2 A;  1PVO A;  1FGB D;  5L37 A;  1IL8 A;  1EIF A;  4IN3 A;  2K03 A;  4KY6 A;  2F4V Q;  2VB3 X;  3C1F A;  3ULJ A;  3W1B A;  2L9H A;  5IGC A;  1X3F A;  5JAV A;  3S1M B;  5HY6 A;  1PLF A;  3S1N B;  2HD3 A;  1XNR L;  3UDG A;  1C0A A;  1XTC D;  5C4J B;  3T16 A;  3D31 A;  2B2V A;  3E9H A;  1GVP A;  5I6W A;  3BVG A;  2Y0S B;  3S1N H;  5LMN L;  3DWA A;  4BY1 H;  4A3B G;  5IT9 L;  3H6M A;  4C1N I;  4ZRZ A;  2YV5 A;  2AUJ D;  4QCL A;  3I90 A;  1XWE A;  3F2U A;  4A3G H;  3MWY W;  4C3J G;  4A3J H;  1V1O A;  2F0J A;  2A8V A;  1A3U A;  2JA8 H;  1A6X A;  3DM1 A;  2E2H H;  2B63 B;  3TDQ A;  3U9S A;  2RCN A;  4G7O C;  3NWS A;  4RAU C;  4JCV E;  3RLO A;  3BDC A;  1S3O A;  3IKJ A;  1K83 B;  2EYL A;  1WI5 A;  3PO3 G;  3ULL A;  4MHE A;  1TWC H;  4QJF A;  5ELC A;  1MBY A;  2I5L X;  2BE5 C;  5DLQ E;  3OMG A;  4C3H B;  4IQZ A;  4XYQ A;  1ONL A;  2NVT B;  4HMJ A;  2IWH A;  3VYS A;  3PMF A;  1BUV T;  1NAP A;  3H0G H;  1TWH H;  4GZY C;  4X65 Q;  2Q2U A;  4LAA A;  1WYD A;  1U0L A;  3MEF A;  1KD1 C;  4NXM Q;  4C3H H;  2KEN A;  1A2U A;  1FJG L;  3S17 B;  1C48 A;  3HOV H;  1SE8 A;  3KF6 B;  2Q8R E;  1HXY D;  3PSI A;  2A6E C;  1E22 A;  2K5Q A;  4GKK L;  4HIK A;  3VA7 A;  2M2L A;  4RGN A;  4KY7 A;  5FO8 B;  1YJ9 A;  1HNX Q;  2L1B A;  3S17 H;  5EBD A;  3F1Z A;  1GHJ A;  2H5X A;  2PQE A;  3S1R H;  1OXU A;  5M5Y B;  4UP8 A;  2KOL A;  2ZXP A;  5E3F A;  5EBC A;  2JA7 B;  1E2W A;  1GXD C;  3KFU A;  2IHF A;  2NZH A;  2VUM B;  4JI2 Q;  4O0A A;  1M8A A;  1ENA A;  3KYH C;  3FVQ A;  1ICF B;  2B2Y A;  4UHV A;  4BY7 G;  4A3D B;  1NUC A;  4BBR G;  1QIL A;  2XTI A;  3HOU H;  1CTM A;  3FEW X;  1J6Q A;  2CW0 C;  1K3B C;  1B3Q A;  2R7D A;  1IKL A;  2IT1 A;  2RCF A;  2FIN B;  3Q6S A;  2JA5 H;  4DV1 L;  5IWA Q;  1HNW L;  2VB2 X;  1V8Q A;  1JB3 A;  2UXB L;  2G9D A;  2KUM A;  3EQL C;  4JI5 L;  1HH2 P;  5FLX E;  2YTY A;  4NKL A;  1LAB A;  1I4Q A;  1D5Z C;  1EYC A;  1N32 L;  2E8G A;  5M5W B;  3C2P A;  1NR4 A;  4J6H A;  2GA4 B;  1AH9 A;  4ULL A;  1B53 A;  2RBM A;  3G6E A;  2TSS A;  3HOY B;  2NN6 H;  4H44 C;  3R8B A;  1RD9 D;  4IUN A;  3CC7 A;  2L4N A;  5M5W H;  3M4P A;  1KLG D;  3D4W A;  1JE4 A;  1G51 A;  2Z6K A;  3NBH B;  3M7G A;  4HIM A;  4NPS A;  4QUC A;  1O7I A;  4JI1 L;  2X69 A;  3S1Q B;  5J3B A;  2VQE L;  1BXT A;  4TRD A;  1KIX A;  4JBK A;  2F52 A;  4F87 A;  3GTK H;  1E1T A;  2KHI A;  1VQI A;  4DV3 L;  1D8L A;  3S1Q H;  1EL0 A;  4NDX A;  3HKZ E;  3LGJ A;  2H1E A;  3PUW A;  4FO2 A;  4G57 A;  4PZ8 A;  5HUR A;  5JEA H;  1IW7 C;  1K8M A;  3FRP B;  3JC6 6;  1EOV A;  4LF4 L;  1FNW A;  1C8C A;  3GTO B;  1YHB A;  1LT5 D;  3NTK A;  3PO2 G;  1Y1W B;  1GUS A;  2F0E A;  3OTO Q;  2OWO A;  4ZKB B;  3K5O A;  2N55 A;  3KBX A;  3OOC A;  2EYF A;  5KEE A;  3GO5 A;  3QB3 A;  4K0K L;  1G29 1;  4M1U B;  2JSO A;  2J0T D;  4OO1 H;  5M3F G;  3U9O A;  4DAY B;  3S2D H;  3VYT A;  3EN2 A;  1DJR D;  5C4H A;  4IZ8 A;  1V1Q A;  4ALP A;  4B9X A;  3GD7 A;  2CHB D;  3OHX C;  4C3I H;  1M90 C;  2NBF A;  5KIX A;  3HKS A;  3HZX A;  3HS0 C;  1BF4 A;  4BS9 A;  3T1H Q;  1EQV A;  1Z7T A;  2WFW A;  5E7N A;  2MHV A;  2R7Z G;  4IAL A;  2BE5 D;  1FVI A;  1E2V A;  4QB4 A;  1X54 A;  3I7F A;  1H9R A;  4CBV A;  4X3T A;  3VDY A;  4YY3 L;  5C3W A;  3B6Y A;  4L5T A;  4LFB L;  5CYU A;  1VQA A;  1GD7 A;  1VQB A;  2MGS A;  4DUZ Q;  2WAQ B;  2ASB A;  2PCF B;  1G91 A;  4RKL A;  1QG7 A;  4DXG A;  1PZK D;  2UXD Q;  3TS2 A;  1SN8 A;  1SXT A;  2A6E D;  4A3E H;  4HJA A;  5JJI A;  5G3L D;  2VW9 A;  1PH2 A;  2JA6 G;  3I2Z A;  1EU4 A;  5IGG A;  1PXU A;  1ET9 A;  1SYD A;  3U4Z A;  5IYD H;  1SYB A;  1KDA A;  2SOB A;  2VNU D;  4G4K A;  1E0B A;  1JB7 A;  1EFI D;  3S15 B;  4JBW A;  3W1G A;  1I4R A;  4LK1 C;  3J81 L;  1T5X D;  1EQR A;  3J7A 5;  1NTG A;  1HFN A;  1SJE D;  1GUW A;  3OIQ A;  2NVX B;  4CDC C;  5C44 G;  2HQE A;  1TWG B;  3KDF B;  5KNB A;  4CKE A;  2YTV A;  1E1O A;  2CQA A;  2F0O A;  3PO3 B;  4PG3 A;  2CW0 D;  3C3L A;  1LLR D;  3JAM c;  2NVX H;  4MTK A;  3CP0 A;  3P7J A;  1GOZ A;  2IX1 A;  3URY A;  4LF9 L;  4R9W A;  4LFA L;  2O4X A;  3VR5 A;  2A19 A;  4LF6 L;  4DU9 A;  1B9N A;  4DV6 Q;  4XDX A;  4TSS A;  1DYQ A;  4N9P A;  1PH1 A;  2YU9 H;  1RDP D;  3RR5 A;  1Z9F A;  1QB5 D;  1I4H A;  1X65 A;  4DR2 L;  3I4N H;  3EA6 A;  1FL0 A;  2ZT9 C;  2L15 A;  1ENF A;  5FJ8 G;  1KNE A;  3T51 B;  4X66 L;  1MJC A;  5LL6 X;  3CD6 A;  4RGO S;  4L63 B;  4DR1 L;  1K8O A;  3QWN A;  2BDO A;  4LFC Q;  4N8X 1;  1XTD A;  5IGB A;  4K8I A;  1QJO A;  4OWX B;  1WD1 A;  4AIM A;  1BVS A;  2DNE A;  2HDM A;  4FVM A;  4TKO B;  3MHB A;  5IIF A;  4XQJ A;  2EJG C;  4BY7 B;  4BBR B;  2ICE C;  3G48 A;  4DV7 L;  2SNM A;  1RCV D;  1WTH A;  1IBL L;  4JV5 L;  2B8F A;  3GTL B;  4B3T L;  1IW7 D;  2IX3 A;  1CK1 A;  3BVZ A;  4X3U A;  3RN2 A;  4KD3 A;  2HQL A;  1J8I A;  3CPF A;  2EPB A;  4K5X A;  1Y8O B;  3GTL H;  1EU3 A;  5A35 A;  4OON A;  3KLR A;  4JC0 A;  5C0X J;  4OO1 I;  5IYB G;  2AUK A;  4PV1 C;  3M4O H;  3OW7 A;  1TR5 A;  1V9P A;  1FD7 D;  3TSS A;  4CGY B;  3K7A B;  1YBY A;  1VQJ A;  3HRZ C;  5IP7 G;  3F8T A;  1UE7 A;  4P74 A;  2UU9 L;  4I7Z C;  4DV2 Q;  3J80 c;  3AQQ A;  4UY8 C;  3SEB A;  1QE6 A;  2QEX A;  4QIW E;  3J80 E;  4LUZ A;  1TY0 A;  1XNQ Q;  3NBI A;  4G7H C;  2JEA I;  2FMC A;  1SE3 A;  4DNI A;  4DK1 A;  2F03 A;  4XT3 B;  4JI6 Q;  4GNX A;  4KHP L;  4IUP A;  4A3M G;  1FNU A;  5IP9 G;  1GO3 E;  4RGM A;  4PMC A;  1STE A;  1A62 A;  1IXR A;  1DGS A;  5DM6 3;  3K59 A;  2ATW A;  1BCP C;  2WKC A;  3PO2 B;  1AFP A;  4DR7 Q;  1F2L A;  2E2J B;  1UUP A;  3GTP H;  1GKH A;  1I3Q H;  4Q5V A;  4OX9 Q;  1A3V A;  1CFM A;  3H94 A;  4AYB G;  1HZC A;  2SDF A;  4DPG A;  2OEO A;  3BDO A;  5M3F B;  1VQ6 A;  2E2J H;  1TS5 A;  2AQ1 B;  4EQP A;  3AU7 A;  3DLL A;  1KRS A;  2E74 C;  5IY0 A;  5T1I A;  3H09 A;  1IZ6 A;  4KN4 C;  2B2U C;  5AJ3 Q;  3K5M A;  1XMO Q;  3A5U A;  2Z0S A;  2MP1 A;  1A63 A;  4RGT A;  1RHP A;  1HPC A;  1VS0 A;  1AE3 A;  1Y8P B;  1TS3 A;  2R92 G;  2R7Z B;  1SE4 A;  2B2T A;  3T53 B;  2F4V L;  3E0E A;  4PZ6 A;  1X3E A;  2ID0 A;  1LUZ A;  5IGE A;  5LMU Q;  1K0S A;  4M8A A;  2B2Y C;  2EY6 A;  2ZXR A;  3TZU A;  4R4Q A;  1FNV A;  2O5J C;  2K01 A;  2I5H A;  1WCM B;  3V2T A;  5KYL A;  3ERS X;  3MEH A;  1UWV A;  1VQ5 A;  3X3N A;  3V96 A;  2WKD A;  1WCM H;  2QDB A;  4S3S A;  4A93 H;  3HOX G;  1G6P A;  1I50 B;  4HED A;  4KD4 A;  2E5L Q;  2PW5 A;  3KBG A;  3QIA A;  1WTV A;  4NXN Q;  2YTX A;  1AEX A;  3G4S A;  1TII D;  1O80 A;  1B2T A;  2ZTC A;  1T5E A;  2V1C C;  5EAY A;  4OIK A;  4JV5 Q;  3BU2 A;  1CKM A;  1SNC A;  2MQH A;  1CSP A;  5DNF A;  1LO5 D;  1Y69 U;  5K36 G;  1B7Y B;  5I6Y A;  1VQO A;  3GTJ H;  5IE8 A;  4BBS G;  3AYH B;  5IOD A;  1GUO A;  1WOC A;  1GUN A;  3ND8 A;  4DK3 C;  4A3L G;  1STB A;  4A3I G;  2K1B A;  4ME3 A;  2D0P A;  4YWK A;  4JBM A;  2NVQ B;  5CR3 A;  1QUQ B;  3S14 B;  1FGU A;  4H02 A;  1OXV A;  4X65 L;  1PH9 A;  5JVH 3;  2XWJ B;  4NXM L;  3RZO B;  3CCE A; 
#chains in the Genus database with same CATH homology
 3FDT A;  3Q24 A;  3BS1 A;  1JOK A;  1VDZ A;  2RA4 A;  2NWG A;  1VCI A;  2EXZ A;  3PUY A;  4ZK9 B;  1SBB B;  2G9H D;  1XYI A;  3M7N A;  1DOK A;  1YNJ C;  3MFY A;  4FF3 A;  1EWC A;  1OXX K;  1TWA B;  3LNN A;  4IFD G;  4PMB A;  1F9S A;  5COR A;  1EQT A;  1SNO A;  3H91 A;  1R4P B;  5C3X A;  1UNS A;  4EQN A;  4F7X A;  3FPU B;  1LTB D;  1BCP D;  2MJ8 A;  3SHL A;  1GHK A;  3OIP A;  1OXT A;  3ITP A;  3OWF A;  4QF4 A;  1UEA B;  2OXP A;  3MXG A;  1BBX C;  1VMC A;  1I4G A;  5FK9 C;  4KN7 C;  5T1G A;  4DAP A;  1STY A;  1TKW B;  3KK7 A;  3M4Y A;  2FJ2 A;  2XSC A;  1ESF A;  2Z4I A;  1II3 A;  5FKA C;  2KED A;  1PZJ D;  2KJX A;  1RKN A;  1MGS A;  4KKU A;  1X3P A;  4A3M B;  4RHR A;  1DXM A;  1G6Z A;  1HUM A;  3NE5 B;  2K32 A;  3W2D A;  2L12 A;  4ZQ3 A;  3WDN A;  4DAV A;  4ZKC B;  1V1P A;  3D8G A;  1RJT A;  2YYZ A;  2B2W C;  3JAM L;  3GTQ B;  4ZUJ A;  5C4Z A;  1B50 A;  4XTC S;  1CHP D;  4V19 0;  5CV5 A;  1BDO A;  3OMC A;  2PPB C;  4BA1 I;  1S5F D;  2PNR C;  2R92 B;  1EZ6 A;  2Q8T A;  5G3L F;  1DOM A;  3DXJ C;  1SMY C;  2X6G A;  3MZ5 A;  2RSN A;  5C0X G;  3LX0 A;  4OIJ A;  3I4L A;  3QOL A;  3P75 A;  1ILP A;  4EVO A;  1LT6 D;  3MXN A;  2HDL A;  3HOX B;  1G2S A;  1HCZ A;  5NUC A;  1G2T A;  2XWB B;  1TVX A;  2F0Q A;  3D4R A;  1YNJ D;  5LHY 1;  3MXP A;  1JWU D;  5I4D A;  4BBS B;  1ZYR C;  3QJY A;  5D65 A;  1WTP A;  3OWE B;  2AQ2 B;  4FF2 A;  4H0L C;  4A3I B;  1DON A;  4H13 C;  4KI0 A;  3BDL A;  4RCO A;  3DEP A;  5DM7 3;  3D4D A;  3DEO A;  2C5C A;  3TP6 A;  1HA6 A;  1WTQ A;  2A5H A;  1Z47 A;  2DY7 A;  5A2Q L;  1HFG A;  2EJM A;  3PUZ A;  4I65 A;  3SK4 A;  4A3K B;  2F1M A;  5BN3 A;  2RKS A;  1EY0 A;  3H3V C;  1R9T B;  2M9V A;  3OPO A;  4R8I A;  3MVV A;  4HTH A;  2F0V A;  4KJN A;  3N6R A;  4HSV A;  2PZT A;  5EPK A;  1ZEQ X;  1S5B D;  2KEC A;  2F0H A;  2MUY A;  4UAI A;  3KLS A;  1LAC A;  5JVG 3;  3FMC A;  3CU7 A;  2PZW A;  3MC0 B;  5E1F A;  2B39 A;  3PUX A;  1SFO B;  2L55 A;  1VF7 A;  1BNZ A;  4TQU S;  3HKZ B;  3I8Z A;  1PTO B;  3L7Z C;  1EY9 A;  1H9S A;  2BOS A;  3NTH A;  4WFN 3;  3CQZ B;  1RTN A;  4IFD J;  1LTI D;  2OT2 A;  1PRT B;  1JCK B;  1PMR A;  2XNA C;  4HAE A;  1F2Y A;  1CA6 A;  1L0Y B;  2E2I B;  3AMU A;  4ODG A;  1SMY D;  2FMM A;  5EQ0 A;  2Z4H A;  5CV9 A;  5I2X A;  4A3B B;  2R3Z A;  3NQT A;  5JEA J;  2EDG A;  1O78 A;  1KTK A;  1EYA A;  1SNP A;  3I72 A;  3I73 A;  2F0K A;  4C3J B;  5I9P A;  4L6T B;  2BCO A;  2SEB D;  3IL8 A;  2Q8I B;  5CV4 A;  2WIN B;  1JWS D;  5CGK A;  5CBA E;  1F9Q A;  1S5E D;  1ZYR D;  4ME5 A;  4U68 A;  1KLU D;  2K6A A;  4FNF A;  1GUT A;  3PIO 3;  5IT9 E;  3IAY A;  2RSO A;  1F2M A;  1F2Z A;  1J9O A;  1H9J A;  2L0C A;  1B44 D;  1WVL A;  1CZG A;  3T4A C;  4FXD A;  3HGB A;  3ERQ A;  1B9M A;  2RVL A;  3P1H A;  4EGV A;  1PTO C;  4F88 A;  1W6K A;  2JP1 A;  1MSH A;  3A7A B;  3RZD B;  3W3A A;  1PRT C;  3KF8 A;  3GP7 A;  1A2T A;  3SR1 A;  1EIH A;  1BCP B;  1NR2 A;  1TWF B;  3DUZ A;  1STA A;  2PZU A;  1U4M A;  5C4X B;  4OL7 A;  3EFX D;  2F0L A;  1LV9 A;  1LT3 D;  1I6V C;  4HSP A;  1SYC A;  4DF7 A;  4IUV A;  3Q0A A;  3TBI B;  1F77 A;  1IHZ A;  3TZD A;  2IJ0 A;  4WOR A;  1Y1V B;  4KY5 A;  5M5X B;  3R93 A;  2B2V C;  2K04 A;  2AWN A;  2QEJ C;  1Q1B A;  2OF1 A;  4X3K A;  2F3V A;  1QNK A;  2ZXO A;  1JIC A;  1Y8N B;  4K8J A;  3P20 A;  5C3E B;  1ZXT A;  1PDQ A;  5M3M B;  3MTS A;  1D5M C;  5TSS A;  1M4V A;  4IUQ A;  3A55 A;  4DGZ A;  3M3Y B;  3A56 A;  5EKI A;  1B3A A;  1SNM A;  1BR9 A;  1OXS C;  5ISR A;  1EY5 A;  3KLS X;  3V05 A;  4H7B A;  2EYP A;  5KRU A;  3K0Y A;  2E76 C;  1EYD A;  4BWG B;  1CT1 D;  2A68 C;  3FKI B;  5ELF A;  3G7L A;  1HRJ A;  2RQX A;  1C4Q A;  1V43 A;  4QIW B;  1Q90 A;  3BZD B;  5IOC A;  1NSN S;  1EY4 A;  3NXW A;  1D6E C;  3HOW B;  5EJW A;  1W6J A;  1AZP A;  2LY7 A;  1KAB A;  4XYO A;  2EY1 A;  5E4X A;  4KK7 A;  4C3H G;  1LTS D;  2K33 A;  3EJI A;  3CRL C;  2D5D A;  2JA6 B;  1PTO D;  1PZI D;  3D6W A;  5C0X I;  2IW3 A;  1PRT D;  1IKM A;  3SK6 A;  1SND A;  4K14 A;  3K58 A;  3M85 A;  3VR6 A;  1DM0 B;  1Q12 A;  2BA1 A;  5FLX L;  1GUG A;  2K05 A;  5JPN C;  4DFA A;  5C44 B;  2F0P A;  2XVS A;  2A6H D;  2J7Z A;  2PO4 A;  5COY A;  1LT4 D;  4FP5 D;  1LTG D;  4KKS A;  3VR2 A;  5BN5 A;  2KQ3 A;  4CHT B;  1B1Z A;  2XRQ D;  1U4R A;  2HCC A;  4K5V A;  3NBH A;  1TS4 A;  1Q8I A;  2RDG A;  2L11 A;  2WII B;  3LWU A;  1D2B A;  3CHB D;  2F0W A;  1QOH A;  1RTO A;  4C2M B;  1CQV A;  4HN7 A;  2L5T A;  4IUR A;  1SYG A;  3J81 E;  4QUF A;  1AW7 A;  2NN6 G;  3MFG A;  4FXK C;  4HR7 B;  1GJX A;  1I6H B;  3K57 A;  3PIP 3;  3C46 A;  2MPM A;  3WOE A;  3VR4 A;  1KDC A;  2F0T A;  4RFB A;  1EEI D;  1CQF A;  3IFT A;  4EQO A;  4N9T A;  3I70 A;  4DAY A;  1FYC A;  5JEA G;  4K2L A;  3A7L A;  3J7Y W;  2NVY B;  5JPM C;  1JC7 A;  2KVM A;  2N88 A;  1NCV A;  2F0M A;  4K6L A;  1EOT A;  3VYR A;  1DOL A;  2X6L A;  1WTR A;  1KDB A;  3X3M A;  2A68 D;  1JOQ A;  2DN8 A;  4OO1 G;  2TMP A;  2I07 B;  4XIG S;  3TP7 A;  4YIJ A;  5IGF A;  4B9W A;  4C3I G;  4KKT A;  1IYU A;  1D1K A;  4HCE A;  3HG9 A;  2WP8 J;  2PW7 A;  4CJ1 B;  5KYI A;  3O13 A;  3QO2 A;  1WTW A;  3FPP A;  1H9K A;  3I91 A;  2E2D C;  2K7V A;  3NWT A;  1TU2 B;  4OGQ C;  1O7Y A;  2F0U A;  1SSO A;  2EYM A;  1ENC A;  3K5N A;  3S2H B;  1ILQ A;  2E75 C;  5JOB A;  4BY1 B;  3DMU A;  4AYB B;  1EY6 A;  1EEF D;  4A3G B;  2NTT A;  1HTP A;  4WJW A;  5FO7 B;  2HCI A;  3GV6 A;  4A3J B;  2JE6 I;  3SK8 A;  4XQQ A;  2JA8 B;  2E2H B;  2Z8L A;  2NUC A;  4KJO A;  1EIG A;  2KA7 A;  3EVQ A;  2D62 A;  1EY7 A;  1TWC B;  4KMU C;  1A3T A;  4PQX A;  5HGT A;  1BOS A;  3H0G B;  1TWH B;  4KV6 A;  3CRK C;  4U67 3;  3QOJ A;  3DHQ A;  1CA5 A;  2H4O A;  1MSG A;  1HQM C;  3HOV B;  2J4X A;  3BG3 A;  1AZQ A;  1SYF A;  3NK9 A;  1CHQ D;  3ONA B;  1I4P A;  2IL8 A;  3S1R B;  3UI2 A;  2EYJ A;  4FXG C;  2KHS A;  1Z6H A;  2B2U A;  1F9R A;  3KUP A;  3T13 A;  3HEJ A;  4ZLT F;  3HOU B;  2KCC A;  3T56 B;  5K36 H;  2EJF C;  3QG1 A;  1VMP A;  5CBE E;  1HQR D;  2JA5 B;  1QCB D;  4KHZ A;  2F0F A;  1S5D D;  2A73 B;  1QNU A;  3J80 L;  3E0J A;  2WB1 B;  4IUU A;  4G7Z C;  4XXE A;  4DN4 M;  3PV0 A;  5F2D A;  1WTO A;  4E6I A;  2A74 C;  2F0G A;  3VA5 A;  3TN2 A;  3BVM A;  2EYO A;  3GTK B;  2ICI A;  1LTA D;  2F4I A;  2EOT A;  4RA8 A;  4MIU A;  3N52 A;  1OO9 B;  4RKB A;  4IFD H;  2F0I A;  1LTT D;  3MXU A;  3L9A X;  1XX8 A;  3VYU A;  2B2T C;  2K28 A;  2QIL A;  5EGT A;  4DXF A;  1JOO A;  3I4M B;  5C6A A;  1SE2 A;  1U4L A;  1ET6 A;  4NW2 A;  5EPJ A;  4O42 A;  2LFN A;  2QKI C;  4F8M A;  1RF2 D;  3A8J E;  1JOR A;  3S2D B;  2BA0 A;  4NMZ A;  5KGU A;  1JWM D;  3DWQ A;  1SDF A;  2NZ1 D;  5ELB A;  4C3I B;  5C5L A;  5JJZ A;  4BA2 I;  5CMD A;  2VXW A;  1SNQ A;  2CVR A;  1PTO H;  2NB0 A;  4IUT A;  4ILW A;  4JK1 C;  3K5L A;  3SE0 A;  4OHJ A;  1HTL D;  2I46 A;  2BDN A;  1DZ1 A;  3SVM A;  4Y7N B;  4A3E B;  3NHH A;  2R61 A;  2JYO A;  5C5M A;  2QF7 A;  2SNS A;  2A69 C;  4LMQ D;  5IGD A;  3MA2 B;  1LTR D;  2IX0 A;  5I2Y A;  2DNC A;  2WV6 D;  1JQY D;  4ID6 A;  3J7A F;  1DD2 A;  1S4Z A;  1YNN C;  3R3O A;  2Z1C A;  4K5W A;  1O7L A;  4RH6 A;  2O2L D;  2F0S A;  1V1P B;  1PTO F;  1A15 A;  1KAA A;  4CJ0 B;  4R8N A;  3AB9 A;  5CV7 A;  2M00 A;  1PRT F;  3NTI A;  5CV8 A;  1MI2 A;  1MD2 D;  2YU9 B;  1TY2 A;  2NYZ D;  3S9W A;  5ELE A;  4PMW A;  3JAM E;  3D3R A;  3I4N B;  2PYK A;  4P2C B;  5C0X H;  1O7Z A;  1D5X C;  3ERO A;  1Q1E A;  2KCN A;  3TME A;  3NUC A;  4CJ2 C;  3SDZ A;  3RLF A;  2F0N A;  3I3C A;  2B2W A;  2NN6 I;  5DAU A;  3A8K E;  2RDH A;  5LL6 S;  3C1E A;  3LWE A;  3BYT B;  2A6H C;  4Q0F A;  4Z9C B;  1VF5 C;  2XIW A;  2XRS D;  4IFD I;  3E5S A;  3TP5 A;  3RMH A;  1Q3L A;  3PUV A;  4ZUI A;  2EYH A;  3NSW A;  3GTG B;  2LS0 1;  4K2K A;  3IFD A;  3ZYY X;  4PNY A;  1HUN A;  4DNR B;  5D14 A;  1SEB D;  1EWH A;  1X3Q A;  5EKL A;  1PFN A;  1DCZ A;  4CKC A;  4XQN A;  5D3I B;  4KHV A;  3A8I E;  3M4O B;  3RD4 A;  2FHT A;  1R4Q B;  3R2I A;  1WTX A;  1ESR A;  1H9M A;  1HHV A;  1B4O A;  3VR3 A;  2EY2 A;  2HUG A;  5J22 A;  3A54 A;  1BCP F;  4XT1 B;  3D6C A;  1WD0 A;  4J8Q A;  1STH A;  4X3S A;  4V0B A;  3S16 B;  1QWY A;  1S5C D;  3L3O C;  1IYV A;  5FO9 B;  4FF1 A;  4O1N A;  1E2Z A;  1PFM A;  2K5D A;  1PYW D;  1G8Z D;  1STG A;  2AQ3 B;  5DEH A;  5I9O A;  3J7A V;  5A2Q E;  5M9O A;  2A69 D;  1ZKO A;  3GTP B;  4DK0 A;  1I3Q B;  1SYE A;  2EY5 A;  4RWS C;  3GQB A;  1SAP A;  4ABN A;  1AN8 A;  1BQQ T;  1EZ8 A;  4CKB A;  2RDF A;  2XN9 C;  1I4X A;  4HMI A;  2QCP X;  2KEE A;  1YNN D;  1BO0 A;  2K5W A;  4UDU C;  1L0X B;  2F3W A;  1AP0 A;  3SXH A;  2ENB A;  3NQI A;  3WOF A;  4LJZ C;  5CV6 A;  4RCN A;  5EPL A;  1PFB A;  3DWP A;  3R2T A;  2V4D A;  3CKI B;  2JEB I;  5J39 A;  2WAC A;  5FOB B;  3E6Z X;  3Q23 A;  1EY8 A;  1H9S B;  1CM9 A;  4DNT B;  2AWO A;  1CZW A;  4A93 B;  3MAQ A;  5K5P A;  1ROD A;  1TQO A;  2EZV A;  2FFK B;  2LMC B;  4MN3 A;  1ICW A;  2LKV A;  4B08 A;  3NP8 A;  5CC4 A;  3GTJ B;  3HOZ B;  1KNA A;  4WRD A;  3GTM B;  4HCS A;  1TT2 A;  3NPP A;  4J1M A;  2JXM B;  2D2C C;  1HA5 A;  4A3F B;  4FYD A;  2EVB A;  2O5I C;  1FR3 A;  4ZYS A;  5AFW A;  2R93 B;  5KND A;  4DA2 A;  2PMZ B;  2DY8 A;  3TP8 A;  3G6J B;  1SJH D;  3HP3 A;  1D1I A;  3OSO A;  1TS2 A;  2EE1 A;  4NP5 A;  4ZAI A;  5EKK A;  5ELD A;  1JR0 D;  3K6O A;  3ND9 A;  1U9R A;  4FF4 A;  1UAP A;  1F9P A;  2NTS A;  1X32 A;  1U4P A;  2D9U A;  2F0D A;  5D3D A;  2C9O A;  4KTA A;  5E4W C;  3BYY B;  1XXG A;  4RHS A;  4K6D A;  1ML0 D;  4QMG A;  2IPK D;  1STN A;  4C1N K;  4C56 C;  3Q22 A;  4L8J A;  5BN4 A;  3GV3 A;  3SK5 A;  3RUZ A;  2B8G A;  2R6G A;  5J1Z A;  5KNC A;  1CI3 M;  1FGB D;  1IL8 A;  4IN3 A;  2K03 A;  4KY6 A;  2VB3 X;  3C1F A;  2L9H A;  5IGC A;  5JAV A;  3S1M B;  1PLF A;  3S1N B;  1XTC D;  5C4J B;  3T16 A;  3D31 A;  2B2V A;  5I6W A;  3BVG A;  2Y0S B;  3DWA A;  5IT9 L;  3H6M A;  4C1N I;  4ZRZ A;  2AUJ D;  4QCL A;  3I90 A;  1XWE A;  3F2U A;  3MWY W;  4C3J G;  1V1O A;  2F0J A;  1A3U A;  1A6X A;  3DM1 A;  2B63 B;  3TDQ A;  3U9S A;  4G7O C;  3NWS A;  4RAU C;  3BDC A;  3IKJ A;  1K83 B;  2EYL A;  4MHE A;  5ELC A;  1MBY A;  2BE5 C;  3OMG A;  4C3H B;  4IQZ A;  4XYQ A;  1ONL A;  2NVT B;  4HMJ A;  2IWH A;  3VYS A;  3PMF A;  1BUV T;  1NAP A;  4GZY C;  4LAA A;  1A2U A;  3S17 B;  1C48 A;  2Q8R E;  1HXY D;  2A6E C;  2K5Q A;  3VA7 A;  2M2L A;  4RGN A;  4KY7 A;  5FO8 B;  2L1B A;  5EBD A;  1GHJ A;  2PQE A;  1OXU A;  5M5Y B;  2KOL A;  2ZXP A;  5E3F A;  5EBC A;  2JA7 B;  1E2W A;  1GXD C;  2VUM B;  1M8A A;  1ENA A;  3FVQ A;  2B2Y A;  4A3D B;  1NUC A;  1QIL A;  1CTM A;  3FEW X;  2CW0 C;  1IKL A;  2IT1 A;  2FIN B;  3Q6S A;  2VB2 X;  1V8Q A;  1JB3 A;  2G9D A;  2KUM A;  3EQL C;  5FLX E;  4NKL A;  1LAB A;  1I4Q A;  1D5Z C;  1EYC A;  5M5W B;  3C2P A;  1NR4 A;  4J6H A;  2GA4 B;  4ULL A;  1B53 A;  2RBM A;  2TSS A;  3HOY B;  2NN6 H;  4H44 C;  3R8B A;  1RD9 D;  4IUN A;  2L4N A;  1KLG D;  3D4W A;  1JE4 A;  3M7G A;  4QUC A;  2X69 A;  3S1Q B;  1BXT A;  4TRD A;  4F87 A;  1EL0 A;  4NDX A;  2H1E A;  3PUW A;  4FO2 A;  4G57 A;  5HUR A;  5JEA H;  1IW7 C;  1K8M A;  3FRP B;  1FNW A;  1C8C A;  3GTO B;  1LT5 D;  3NTK A;  1Y1W B;  1GUS A;  2F0E A;  4ZKB B;  3K5O A;  2N55 A;  3KBX A;  3OOC A;  2EYF A;  5KEE A;  3GO5 A;  3QB3 A;  1G29 1;  4M1U B;  2JSO A;  2J0T D;  4OO1 H;  3U9O A;  3VYT A;  1DJR D;  5C4H A;  4IZ8 A;  4B9X A;  3GD7 A;  2CHB D;  3OHX C;  2NBF A;  5KIX A;  3HZX A;  3HS0 C;  1BF4 A;  4BS9 A;  1EQV A;  1Z7T A;  2MHV A;  4IAL A;  2BE5 D;  1E2V A;  4QB4 A;  1H9R A;  4CBV A;  4X3T A;  5C3W A;  5CYU A;  2MGS A;  2WAQ B;  2PCF B;  1G91 A;  4RKL A;  1QG7 A;  4DXG A;  1PZK D;  1SXT A;  2A6E D;  5G3L D;  1EU4 A;  5IGG A;  1PXU A;  1ET9 A;  1SYD A;  1SYB A;  1KDA A;  2SOB A;  2VNU D;  4G4K A;  1E0B A;  1EFI D;  3S15 B;  4JBW A;  1I4R A;  4LK1 C;  3J81 L;  1T5X D;  1HFN A;  1SJE D;  1GUW A;  3OIQ A;  2NVX B;  2HQE A;  1TWG B;  5KNB A;  4CKE A;  2F0O A;  2CQA A;  3PO3 B;  2CW0 D;  3C3L A;  1LLR D;  3P7J A;  1GOZ A;  2IX1 A;  3URY A;  4R9W A;  2O4X A;  3VR5 A;  4DU9 A;  1B9N A;  4XDX A;  4TSS A;  1DYQ A;  4N9P A;  1RDP D;  1QB5 D;  1I4H A;  3EA6 A;  2ZT9 C;  1ENF A;  1KNE A;  3T51 B;  5LL6 X;  4RGO S;  4L63 B;  1K8O A;  3QWN A;  2BDO A;  5IGB A;  4K8I A;  1QJO A;  1WD1 A;  2DNE A;  2HDM A;  4FVM A;  4TKO B;  3MHB A;  5IIF A;  4XQJ A;  2EJG C;  4BY7 B;  4BBR B;  2ICE C;  2SNM A;  1RCV D;  2B8F A;  3GTL B;  1IW7 D;  2IX3 A;  1CK1 A;  3BVZ A;  4X3U A;  4KD3 A;  1J8I A;  2EPB A;  4K5X A;  1Y8O B;  1EU3 A;  5A35 A;  3KLR A;  5C0X J;  4OO1 I;  2AUK A;  4PV1 C;  3OW7 A;  1TR5 A;  1FD7 D;  3TSS A;  4CGY B;  3K7A B;  3HRZ C;  4I7Z C;  3SEB A;  1QE6 A;  3J80 E;  1TY0 A;  3NBI A;  4G7H C;  2JEA I;  2FMC A;  1SE3 A;  4DK1 A;  2F03 A;  4XT3 B;  4IUP A;  1FNU A;  4RGM A;  4PMC A;  1STE A;  5DM6 3;  3K59 A;  1BCP C;  2WKC A;  3PO2 B;  1AFP A;  1F2L A;  2E2J B;  1UUP A;  4Q5V A;  1A3V A;  1CFM A;  3H94 A;  2SDF A;  2OEO A;  3BDO A;  5M3F B;  1TS5 A;  2AQ1 B;  4EQP A;  3AU7 A;  2E74 C;  5T1I A;  3H09 A;  4KN4 C;  2B2U C;  3K5M A;  2MP1 A;  4RGT A;  1RHP A;  1HPC A;  1Y8P B;  1TS3 A;  2R7Z B;  1SE4 A;  2B2T A;  3T53 B;  2ID0 A;  5IGE A;  4M8A A;  2B2Y C;  2EY6 A;  2ZXR A;  3TZU A;  1FNV A;  2O5J C;  2K01 A;  1WCM B;  3V2T A;  5KYL A;  3MEH A;  3X3N A;  3V96 A;  2WKD A;  2QDB A;  4S3S A;  1I50 B;  4HED A;  4KD4 A;  2PW5 A;  3KBG A;  3QIA A;  1WTV A;  1AEX A;  1TII D;  1O80 A;  1B2T A;  1T5E A;  4OIK A;  1SNC A;  5DNF A;  1LO5 D;  1Y69 U;  5K36 G;  5I6Y A;  5IOD A;  1GUO A;  1GUN A;  3ND8 A;  1STB A;  2K1B A;  2NVQ B;  5CR3 A;  3S14 B;  1OXV A;  5JVH 3;  2XWJ B;  3RZO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...