4DU9A

Crystal structure of staphylococcal nuclease variant delta+phs i92a/v74a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEAEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4du9A00
5CV6A 1KAAA 5CV4A 4R8NA 4RKBA 4K2KA 1II3A 2F0OA 3VA5A 3SK6A 3S9WA 2NUCA 3DMUA 4I65A 4K5WA 4KHVA 5M9OA 3BDCA 4F8MA 4DU9A 5CV5A 4ME5A 5E1FA 3RUZA 1TR5A 2F0MA 5DEHA 5NUCA 3MXPA 5C4ZA 5HURA 4ODGA 1EY7A 2F0HA 3HEJA 4N9TA 5J1ZA 4OL7A 5J39A 4PMBA 2F0DA 5KRUA 1STGA 2F0PA 4KY5A 5CC4A 2F3VA 4KJOA 1KABA 4NP5A 4ZUIA 5C6AA 5I9PA 2KHSA 3T13A 2SOBA 3OWFA 4YIJA 4DFAA 5IGDA 2PW7A 4EQOA 2EYPA 1TT2A 3SXHA 5E3FA 1EYAA 1SNCA 3E5SA 3NK9A 5K5PA 3T16A 4DF7A 2F0FA 3SK4A 1SNDA 3MEHA 3U9OA 4B9WA 2O4XA 2PZUA 1A3VA 2F0IA 5C3XA 1SYCA 1ENCA 2EYOA 3HZXA 3BDLA 3P1HA 4MIUA 2EYJA 3EROA 2RBMA 3EVQA 5HGTA 5IGGA 4K6DA 5KIXA 3OMCA 1NSNS 2HQEA 2M00A 3DHQA 3MHBA 2SNMA 3OMGA 1F2MA 1NUCA 4B9XA 2LKVA 5CR3A 1SYEA 1SYDA 5CGKA 5I6WA 1EY6A 3TP8A 5CV9A 5CV7A 2PZWA 2F0EA 1SYFA 3QB3A 4NDXA 4PMCA 4EQNA 1A3UA 4DGZA 4EQPA 2EYHA 2EYLA 5IGFA 3NP8A 1STYA 4PNYA 5DAUA 2F0KA 2OXPA 2F0QA 4WRDA 5I6YA 2F0VA 4IZ8A 1A3TA 3NXWA 4K5XA 2F0WA 3TP7A 5I9OA 4ID6A 2PYKA 4HMIA 4KD3A 2F0UA 3SHLA 2PQEA 4J1MA 4NMZA 3EJIA 5EKKA 4K8IA 2F0NA 3ITPA 4KD4A 1SNMA 3PMFA 1EQVA 4IALA 2RKSA 4ZQ3A 3TP5A 4ZUJA 5C4HA 2WACA 4K5VA 3SK5A 5EKLA 3V2TA 5JAVA 3LX0A 3QOJA 4K8JA 2F0LA 4K14A 1KDBA 5KGUA 2F0GA 2EY6A 2EXZA 1EY0A 1EY8A 3C1EA 5J22A 5KEEA 3OSOA 3D8GA 2EY5A 4S3SA 2SNSA 4QMGA 2EY1A 2KQ3A 3NUCA 1EZ8A 4KY6A 1JOOA 2OEOA 1EZ6A 1U9RA 4LAAA 4TRDA 4KY7A 3SR1A 1KDAA 3NQTA 5IGEA 1TQOA 1STHA 5C3WA 5ISRA 4EVOA 3D4WA 4IUNA 4NKLA 4HTHA 1EYCA 1JORA 1EY5A 4QB4A 5CV8A 2EYFA 2F0TA 4E6IA 4QF4A 2ENBA 4HMJA 1SNPA 3D4DA 3TP6A 1STBA 5KYIA 1SNOA 3D6CA 4F7XA 5C5MA 3ERQA 4KTAA 5IGBA 1ENAA 4K2LA 2PW5A 1STAA 1EYDA 3NHHA 4WORA 1EY4A 2EY2A 1JOQA 3SK8A 1F2YA 1SYGA 4N9PA 5JOBA 3MVVA 3MZ5A 5IOCA 1AEXA 1A2TA 3R3OA 1F2ZA 4H7BA 5IODA 2F0JA 1SYBA 5IGCA 1EY9A 4KJNA 2PZTA 1A2UA 1KDCA 5IIFA 3TMEA 1IHZA 1RKNA 5F2DA 2F3WA 1STNA 2EYMA 3P75A 3H6MA 1JOKA 1SNQA 2OF1A 4KV6A 4G57A 4RKLA 5KYLA 4J6HA 5EGTA 5C5LA 2QDBA 2F0SA 2RDFA 3QOLA 3C1FA
chains in the Genus database with same CATH superfamily
1DM0B 1UE6A 1U4RA 2NTSA 1VS0A 1PH5A 4POFA 4OEMB 2K5QA 4LWCA 4F8MA 1UWVA 3NBHB 4C1NI 4DU9A 3RUZA 2WB1G 4DXFA 4C3JB 1XNQL 1XNQQ 1RCVD 1N9WA 3PO2B 4KY5A 1PYBA 2YTVA 1KABA 1G2SA 4H13C 3JC66 4KKTA 2D2CC 2RHSB 1LT3D 3J81c 3PIPA 1F9SA 1S72A 2K03A 2NVYH 2PZUA 1ML0D 2CQOA 3DUZA 2Z0SA 5M5WH 3HOVB 3P1HA 1X9NA 4XXEA 4A3EB 3S16H 3F1ZA 5CGKA 3JAMi 2KBNA 2EJGC 2B29A 1H9JA 4HIMA 3S17H 2VW9A 4DV3L 4GNXB 1KXLA 1MHWC 1Y69U 5ELFA 5KNBA 3MFYA 4UP7A 2DUDA 2WP8J 2LY7A 1HH2P 1XPRA 1IBLL 4WRDA 1PFBA 1A3TA 1SXTA 3PF5A 4RGNA 3NWSA 3G71A 4N8FA 4QUFA 3RR5A 3ITPA 4L5QA 1HZ9A 1QWYA 1R9TH 4JI0L 2FMMA 1YIJA 1Y8OB 5COYA 1PFMA 1STEA 4DR7Q 3F8TA 2E74C 2N8NA 3QR8A 3UDIA 3S2HH 1Q8IA 2PO4A 3D8GA 4IFDI 2SNSA 1K3RA 2YTYA 1S5BD 2JA8G 5C4JH 3NQTA 2XWBB 3KJPA 4IO9A 4LF9L 1B9MA 3J80c 5CV8A 4GOPC 1YNXA 3PCOB 2MNAA 1B53A 2XRQD 5C44G 2ZM6L 3D4DA 3DM3A 4QUCA 2YU9H 2ZM6Q 1VCIA 2N3SA 4POGA 2JA8B 3KF8B 2I5HA 1CQVA 5IT9E 5JOBA 2GA4B 1F2LA 1OXXK 1RJTA 4DXGA 3GTJH 4LF4L 5DM63 4P75A 1S5CD 4RKLA 3WDNA 3FMCA 4XYQA 3M4OB 1IW7D 1TIID 3C1FA 1KTKA 3K7AB 1WOCA 2L4NA 1II3A 3BYTB 4RKBA 4ZLTF 3AU7A 2NVXH 2F3IA 3CPWA 1DOLA 2AWOA 1XPOA 2ICIA 1PVOA 4HIDA 1EQTA 1GO3E 3ULJA 5LMUL 4DR3L 5LL6X 4IJLA 2F3VA 1B1ZA 4DR3Q 1CK1A 3H3VI 1I3QH 1GKHA 2N78A 3PV0A 3BYYB 4DK1A 3SXHA 1SRUA 2RA4A 5IP7H 3NK9A 4XIGS 4MHEA 2AQ3B 2QCPX 1KLGD 3BVMA 4KLKA 2N88A 1LM0A 3VR5A 1A3VA 2EJMA 4BBSH 2YYZA 4UY8C 3GTGH 1Q86C 4DV5L 4X3UA 4DV5Q 3OMGA 3PO3G 3BZKA 4A93B 1NUCA 2Z1CA 1I6HB 4LUZA 1XMOL 1D6EC 4FF4A 1K83B 1XMOQ 2K75A 2WFWA 3QB3A 2LXJA 3A7LA 4EQNA 5AFWA 3GTLB 4EQPA 4PNYA 4JI6L 2VZAA 2RF4A 5FK9C 2WAQB 2OT2A 4JI2Q 1IL8A 4IZ8A 3S14B 1WD0A 1L2FA 2BCOA 4CDCC 4NMZA 4G7ZC 4FVMA 2J0TD 1SSOA 3O13A 3B6YA 1IW7C 2K04A 2C9OA 3P7JA 4ZUJA 1T5EA 1EWIA 2ZTDA 2R93H 4RGOS 4OWTB 4QQBX 1HA5A 1KQSA 4C3HH 2G5DA 1VQHA 1X54A 4A3BH 2GN5A 2JYOA 3KDFA 4QMGA 4YCVA 4CKEA 5IGEA 3CRLC 4B3TQ 2PMZB 2ES2A 4IPHA 4LF5L 1G91A 4LF5Q 2HCIA 2VB2X 4QIWB 1A0IA 5EBCA 3OIPA 2X6LA 1EQQA 1K8OA 3H0GH 3D6WA 3HOUG 1F2YA 2WB1E 3MZ5A 2HHHL 1A2TA 1LABA 2R7ZG 1SYBA 3KLSA 4A3IG 2PNHA 1S5ED 2IX1A 2Q2HA 4CKCA 3IFDA 5GADC 1GUNA 2Z6BA 3DXJC 2QDBA 5M9OA 3NWTA 1S5DD 1QNUA 2PNRC 5M3MB 1I4QA 3PUVA 2XIWA 4RMFA 2ATWA 1FVIA 2D5DA 4YY3L 4YY3Q 1HUMA 1VQPA 4JBJA 4PZ6A 5M3FB 1VQNA 4HIOA 1DXMA 1O80A 1BO0A 1TWCB 1KNAA 1QG7A 4C3IH 4G7HC 1XXGA 2VQFQ 3MEFA 5G3LD 2CW0C 3HOYB 1HZBA 3BDLA 2HCCA 2RDHA 2KA7A 1Y1WB 5M5XH 4LFAL 4RCNA 4CJ1B 1MSGA 4LFAQ 3IFTA 5CV7A 2Q2UA 3HOVH 1HQRD 4TQUS 2ZJQA 1EFWA 1TWAB 2HD3A 4A3EH 1U4PA 1JB3A 1O7YA 1I4HA 1HUNA 2NWGA 4KMUC 3J81i 1GJXA 1ET9A 4IUQA 1O7ZA 4XQNA 1EWHA 4N8X1 3HOXH 1PH3A 1Z6HA 1XJVA 3UDFA 5TSSA 1H9SA 4K5VA 5JAVA 1IBML 4BXXH 1J5EQ 3HKZG 1IZ6A 2Z6KA 4DR2L 4DR2Q 3Q6SA 4JBMA 3PUZA 3A8KE 3K57A 1HNXQ 5IY0A 5GAEC 3NTHA 5D65A 3J7A5 1EFID 1EY5A 4C2MB 1C7YA 1YJ9A 1MD2D 1SNPA 1B2TA 1QOHA 1SNOA 1K0RA 2TMPA 2LFNA 3BJUA 3RN2A 3I90A 3VYTA 1JB7A 2R3ZA 5LMNW 5IOCA 4DUYQ 1BCPD 3A54A 2IW3A 3I4NH 3GD7A 1OXVA 5IIFA 1FD7D 1FR3A 2F52A 1IYUA 4R8IA 1XMQQ 1NMFA 3N6RA 1GUSA 3PF4A 2HIVA 5LMNL 1PA6A 5LMNQ 5CV6A 1KAAA 4GN3B 4ZK9B 2XRSD 1C0AA 2NUCA 5CYUA 1X32A 1CSQA 4MNOA 3M4OH 1UE7A 3FPUB 3MXGA 3NBIA 4DR4Q 1QCBD 2VQEL 2VQEQ 2RQXA 4JI4L 4A3CG 2XN9C 4JI4Q 4PZ8A 5ELCA 4X65L 2C5CA 1GUWA 1OO9B 1TY0A 3EROA 1QZGA 2NTTA 4OO1G 4HEDA 2R92H 4DV0Q 2SNMA 2L1BA 4XT1B 1K8AC 4LFBQ 3JAMc 1P16A 3AYHB 1WYDA 3I7FA 3CCUA 2NVYB 2EYHA 1GUTA 5M5WB 1DYQA 1BCPC 4JI1L 4ZAIA 1KIXA 1I6HH 1SN8A 4RHRA 1JWMD 1SROA 1QVCA 4ZCKA 1SR3A 2EE1A 1WCMG 3KBGA 3QWNA 1K3BC 2QEXA 4KD3A 4CHTB 3AFPA 3CCSA 2K4KA 2MJ8A 3EA6A 2F0NA 3GTLH 3S17B 1ONLA 5FJ8H 2PQAB 1GHJA 1SJHD 2WACA 3CCEA 4R4CA 3S14H 3DWPA 4K14A 1KRTA 1NNXA 1S40A 1BNZA 4R9WA 2F4IA 1U9RA 1V9PA 5ISRA 2VS1A 4EVOA 4GLAC 1R9TB 4ABNA 1AP0A 2RHQB 4HMJA 5EKIA 3FDTA 4DV1Q 1NY4A 4F7XA 1I4XA 1VQCA 2B3GA 1PDQA 1TWHH 1WTOA 3OPOA 5IP9H 3S2HB 3G4SA 5E4XA 4A3KH 2EY2A 3SK8A 5C4JB 3DWAA 4RH6A 3NSWA 1AEXA 1X3EA 3H09A 3CXCA 3I72A 5IWAL 3LNNA 5IWAQ 2YU9B 1D1IA 1RL2A 1MIUA 1MSHA 3CC4A 2F3WA 5C0XJ 4NW2A 2QEJC 2H1EA 2KENA 3E9HA 3I8ZA 4JC0A 1XYIA 2DY8A 4R8NA 2MP1A 4UP9A 5EBDA 3GTJB 3HGBA 4A3LG 4X62L 3EQLC 4ZKCB 2V1CC 1HCZA 1TKWB 2Q8RE 5EAYA 1PFNA 4OL7A 5J39A 4B08A 4HCEA 1AE3A 1Y1VG 5I9PA 1QUQA 2F1MA 4BY7B 1EL0A 5IGDA 1X3PA 2JA5H 2NVXB 2ZTEA 3F2DA 1HRJA 5C4XB 1TWGH 1EYAA 1AZPA 1NR2A 1ENCA 4JBWA 5FOBB 5HGTA 1WD1A 4NXML 3MHBA 5JJLA 1I3QB 5EJWA 1WTPA 1HZAA 5BR8L 4AYBG 1JE5A 1ET6A 3HOYH 4YWKA 3MC0B 4IUVA 3HKZE 4M1UB 2MGSA 4IPGA 4UHVA 3X3MA 4DGZA 4I7ZC 4CDEC 3IAYA 1M90C 3K0YA 4BBSB 2KEDA 4WFN3 4QGUA 3GTGB 5CBAE 3K6OA 4JI3Q 2HDLA 3T56B 4L6TB 1D5MC 5I6YA 2F0VA 4JW0A 4X64L 1VQGA 1O7IA 2Y0SG 1G291 3CMEA 2K28A 1CHQD 3LWUA 4A3JH 1ZYRD 2EOTA 2Z9HA 1EQVA 3M4QA 2FXQA 1PTOD 3TREA 1H9MA 1LYLA 2Z6KC 5KGUA 2JA7H 2R93G 3RZOH 3OSOA 4C3HG 1MI2A 2X6GA 4A3BG 3QO2A 1GUGA 4DAMA 1PLFA 5GAHC 4A3GH 1EU4A 5M5YH 4CGYB 1PH4A 2NB0A 4JG2A 3H91A 1EYCA 3T1HL 2Z4HA 3T1HQ 2R93B 4IJHA 2VNUD 3LWEA 1VQDA 4KTAA 4C3HB 5FLXE 1JR0D 2QGQA 1X6OA 2Q8IB 1HXYD 3WWVA 5C0XG 1JT8A 2ZJRA 4HJ7A 1EY9A 3AFQA 4JYAQ 1CZWA 1A2UA 1KDCA 1SEBD 5F2DA 2NZHA 1PTOF 4AH6A 1IKLA 3H0GB 4OO1I 1NMGA 5JVG3 1HA6A 4K2KA 1KL9A 4RWSC 1KHIA 3KK7A 1CHPD 5E1FA 5C4ZA 1ZYRC 2B2WA 3NTIA 5IT9L 1PTOC 4PMBA 2WV6D 4DK3C 1C48A 4KJOA 1T9HA 1HR0W 4LK1C 3R2IA 5JJZA 3MXNB 1ICWA 1SNDA 1VF7A 1LT6D 4XDXA 1Y8NB 5ELEA 2BA0A 4LJZC 3HZXA 4PMWA 3OTOL 3PO2G 3OTOQ 5JPMC 2CCZA 1L1OA 1Q81C 3DHQA 3EN2A 1IL2A 4YCWA 4C3IB 5I2YA 1YHAA 2I0QA 3HOWH 2GVBA 4JI8L 4JI8Q 1LUZA 1SDFA 3HOVG 1A3UA 1X55A 1JMCA 2UXBL 1MKHA 2UXBQ 3KUPA 1STYA 4A3EG 1LT5D 3W1BA 5M5XB 1GUOA 4DK6C 1S3OA 4K5XA 2NVTB 5ELNA 1WJJA 1NR4A 4GKKL 1ASZA 1S5FD 2DGYA 3D0FA 4GKKQ 1A6XA 4JPBW 1DONA 2A8VA 1JE4A 1KDBA 1YVCA 3F2UA 4DV3Q 1E3PA 1MBYA 2EY1A 3NUCA 2B63H 1VF5C 1TXYA 3SR1A 3HOXB 5A2QE 1OXSC 2A1AA 1MJCA 2E2DC 2IX0A 4DK0A 4KKSA 4DV7L 3CCLA 4DV7Q 4BA2I 1IBLQ 1EIGA 5KNDA 2XTIA 3TP6A 1IKMA 3CF5A 3K7UC 5GROA 4KN4C 4A4IA 5T1GA 3CCRA 2K5DA 1PV4A 2DN8A 3CCJA 4WORA 3Q8DA 1EY4A 1JOQA 4JI0Q 1O7LA 1LTAD 3MVVA 4G4KA 3E3XA 4L63B 3FP9A 2E75C 3I55A 4PV1C 5E7NA 5IGCA 2DJFC 2LS01 1L0WA 3CMAA 1E1OA 2K5NA 3TMEA 4JOIA 2Z4IA 1J8IA 1FJGL 2BDNA 4OX9L 4LF9Q 2RDFA 2KOLA 1ZKOA 2FHTA 1RF2D 4DR6L 2K33A 4KHVA 4DR6Q 1FL0A 2I46A 1G8ZD 3I4NB 3G6JB 3KOJA 2D0OA 2ASBA 1FNVA 4AYBE 3GTPH 3HEJA 4HJ8A 3M3YB 3UI2A 5CC4A 2QW7A 4LF4Q 1G2TA 3S15H 4LMQD 3SEBA 4EQ5A 1EOVA 4DAYA 4HJ9A 1WTHA 4YHHL 5I2XA 4OWXB 2Y0SE 2F0IA 1OXUA 1SYCA 3S1MB 4BY7H 4XT3B 2Q8TA 4A3MH 2XNAC 5C4XH 2Q2TA 1V1OA 3M9BA 2R92G 1CT1D 3T53B 4FNFA 5I6WA 1LACA 1ASYA 2K14A 3AB9A 1BOSA 4PMCA 4IN3A 5LMUQ 3NP8A 2NBFA 3K59A 4A93G 4H44C 1KAWA 2R92B 4Y52H 1B70B 4MZ9A 5IYCH 1F77A 2BH8A 4X66L 3LGJA 3ND8A 3I56A 3DWQA 3T51B 5C4HA 1CKNB 1ZEQX 2G9HD 1VQJA 5C0XI 3CCQA 4O1NA 2WAQG 4IQZA 1V1PA 1D7QA 4GLXA 1EU3A 4IFDH 2KQ3A 2ALYB 5JVH3 1PH1A 1STHA 3SVMA 2NZOA 4JI6Q 3J7ZC 1JCKB 4GKJL 4LFCL 3KLSX 4X6AH 3C2PA 3NENA 5KYIA 4LFCQ 2ZTCA 1PFSA 4CJ0B 4OGQC 3AEVA 5L37A 2E2IH 3NHHA 3ICEA 5E4WC 1PH2A 4H7BA 5IYDH 1H9RA 1EIFA 4GN4B 3J80E 2ZXOA 2AKWB 3P75A 1TWHB 1G51A 3V96A 4OXPA 4C56C 1JJGA 3KF6B 2CW0D 4A3KB 3A5ZB 4DUZL 2B8GA 1QVGA 1WTVA 4BBRH 2F0OA 4DAPA 3DMUA 4RCOA 2B2WC 2ZXPA 5CV5A 5DEHA 3NELA 3NBHA 1HQMC 2K01A 2VUMB 1QILA 2J4XA 3AQQA 4DV4L 1N36L 3K81C 3GTMH 3KYHC 2EZVA 2HHHQ 1G6PA 1STGA 5M3MG 4O42A 1BQQT 3H3VH 1EIYB 4DFAA 3EBEA 3ZJYC 2IPKD 3D3RA 3KFUA 5HY6A 1PZKD 3G7LA 3T16A 2O4XA 5KNCA 1VQOA 5M3FG 4P72A 1E1TA 4V0BA 2JA5B 1S4ZA 4QY7A 3VR2A 1TWGB 1VQKA 1N8RC 2A5HA 2JP1A 3HOYG 4GNXA 2QILA 4WJWA 2EJFC 1B4OA 2K6AA 4X3TA 2RCFA 1Y1WG 1V1QA 1UE5A 4FXDA 2JQOA 1LO5D 4JK1C 1KC8C 2B2TA 2F0UA 2R7DA 3RMHA 1DGSA 2TSSA 4IUPA 3W1GA 4RHSA 4A3FH 3I2ZA 2RKSA 1AH9A 3SK5A 2XGTA 3A8IE 3BVGA 2NVTH 3GTOH 2DY7A 2NN6G 3D31A 1PRTF 5FLMG 4A3JB 1TQOA 1BR9A 4B3SL 1D1KA 1X56A 2CFMA 3S1RH 3SGIA 2ENBA 4R4IA 4GOPB 2JA7B 1I4GA 1BKBA 1SE2A 4KHZA 1ENFA 3GQBA 3RZOB 3HG9A 3W5OA 4DNRB 1D2BA 4A3GB 1YI2A 5M5YB 1I6VC 3KF8A 1IBMQ 4DNTB 1BUVT 2Q2IA 4JOIC 3S2DH 4IOCA 1K28A 4G7OC 1Q8KA 1IHZA 3U9SA 5AJ3L 1RKNA 4I7AA 1NCVA 1VDZA 2WKDA 1XWEA 5ELOA 1WTWA 4H0LC 4R4TA 3K5OA 1ESRA 3ULPA 1C9OA 4UPAA 3DEPA 1W2BA 5JJKA 3SK6A 4LNQA 1RODA 4WJ4A 3MXPA 4IUTA 2SEBD 2H5XA 1JJ2A 4O0AA 4OIJA 1QNKA 2IHEA 5J1ZA 2C35B 1OXTA 5CMDA 2QF7A 3T13A 3VYUA 4EQOA 2FINB 2H4OA 3KJOA 1EOTA 3M3YH 3I4MB 3CD6A 1E24A 1SAPA 4RG1A 3G48A 3GTQB 3EVQA 5JEAH 5KIXA 3M4PA 1D5ZC 3A7AB 1VQ5A 1F2MA 4A3DB 1WI5A 3HFZB 5CR3A 1SYEA 2WAQE 1EY6A 2CKZB 2PZWA 1U4MA 1R4QB 3S1MH 4QL5A 1QVFA 2JA9A 4HSVA 3J7AF 1I5FA 2B39A 3MA2B 2MO1A 5FO8B 2OXPA 4LF6L 4LUOA 5C44H 2A6ED 1EWCA 1TU2B 4NXNL 4X65Q 4ID6A 3S1QH 3EJIA 5EKKA 3HOWB 3HRZC 3I3CA 4ME3A 4KI0A 4DV6L 3E6ZX 1WVLA 4DV6Q 4JVZA 4CJ2C 1TWFH 5K36H 3Q23A 1N32L 1N32Q 2PMZE 4X3SA 1V8QA 2EY6A 2EXZA 3C1EA 4FF2A 4QIWE 4ULLA 4P73A 3V05A 3NTKA 1UAPA 4RFBA 4KY7A 2FFKB 4XQQA 2JA6B 4JI1Q 4NKLA 1K9MC 5A35A 3VR4A 1STBA 1VQ7A 3BZCA 5C5MA 1BBXC 1VMCA 2B63B 1Z9FA 1LTLA 1SYGA 4YWLA 2F4VL 1UEAB 4IPCA 2K5HA 4KJNA 1ICFB 4DPGA 4ZRZA 1XX8A 1CFMA 4KV6A 1ESFA 2P5ZX 2JXMB 2M2LA 4OONA 1Q12A 1PTOH 3OIQA 4BWGB 4DA2A 2A6EC 3GV3A 3TS0A 1AW7A 3PO3H 3CCVA 3CP0A 2L11A 3H94A 1HTPA 5NUCA 2UUAL 1PMRA 3A5UA 5FLXL 2UUAQ 1CA5A 1AE2A 5D3DA 1T5XD 4EX5A 2SDFA 4ZUIA 3N52A 1B7YB 3OW7A 3FHWA 1V43A 4TVAB 2VUMH 2B2YA 2EIFA 4DF7A 2KHJA 4JV5L 4JV5Q 5T1IA 3K80C 3W2DA 3GTPB 5J22A 1HTLD 2EYJA 3ZYYX 1FGUA 2K5VA 3IL8A 1EEID 2N49A 3L9AX 4BY7G 3CC2A 3CCMA 4B9XA 2LKVA 3RLOA 4JBKA 5C4XG 3S15B 2NN6I 4LW1A 1VQMA 1K8GA 4X62Q 1HFNA 2L55A 3G6EA 3PUWA 3UDGA 2BH2A 4TSSA 3T1YL 1N33L 1FGBD 2F0KA 5DAUA 4HJAA 3K58A 4A3MB 2RVLA 5IP7G 5I9OA 3DM1A 1LT4D 3JAME 1KRSA 3HOUH 4BBSG 4IALA 3TP5A 5D14A 3CHBD 1NBWA 4NXMQ 1HHVA 4KKUA 3QOJA 4BS9A 1LTTD 5BR8Q 4A3IH 1K0SA 2OQKA 4DNIA 4S3SA 3STBC 1PH6A 2DJGC 3RN5A 4EGVA 5C3WA 2D0PA 4H02A 3GP7A 4APVA 3CRKC 4X64Q 3TQYA 3ERQA 4GN5A 2K5WA 3MAQA 2B8FA 1C8CA 1GHKA 1DJRD 4L5TA 3VYSA 2RSOA 5EPKA 1BVSA 1Y14B 1I4PA 2UUCL 3A74A 2UUCQ 2Z8LA 3WOFA 2PZTA 1AFPA 1HPCA 5JPNC 1LTRD 1U0LA 3L7ZC 1VMPA 3DLLA 1STNA 1N34L 3R93A 2JK8A 1N34Q 3R8BA 3E9IA 5KYLA 2E2IB 1FYCA 5A2QL 4U68A 4HSPA 2MHVA 2RSNA 2KEEA 2AUKA 3VA5A 4C1NK 1CZGA 3BDCA 4ME5A 3T4AC 4DR5L 4ZKBB 3PQIA 3KLRA 4ZYSA 3H0GG 2CVRA 2JEBI 5KRUA 4BY1H 2NVQB 2L5TA 1EYGA 2SOBA 4BBRB 2QKIC 2PW7A 2EYPA 3J81j 4XTCS 2QA4A 2RDGA 3SK4A 4MN3A 4FXGC 4IOAA 1B9NA 2MO0A 1AZQA 2EYOA 2X69A 5IGGA 1VQLA 3GTMB 2ID0A 2K50A 5GAGC 2K05A 1HNWL 1HNWQ 3I4MH 4V190 4OIKA 1SYFA 4NPSA 3GTQH 1PZID 2NZ1D 3M85A 2UU9L 1Q82C 1VQFA 4A3DH 4L5SA 3MTSA 1BCPB 1AN8A 1NJIC 5DM73 1KNEA 4C3IG 4PG3A 3ER0A 3RD4A 2PQEA 2UUBL 5EPLA 1UEBA 1OTCA 2CWAA 2A74C 4A3FG 1HR0L 3PUXA 1YBYA 1HJPA 4X3KA 1ZXTA 1HR0Q 2PQAA 4K8JA 2D9UA 2IY5B 2ICEC 3KDFB 3GTKH 1TS5A 2I5LX 4Y7NB 5KEEA 5IT9c 1ILQA 1TS4A 1U4LA 2LMCB 3OOCA 2F03A 1EZ6A 3NE5B 1KDAA 3J81L 1PYWD 4A3FB 4KHPL 3OHXC 4F87A 3DEOA 4HTHA 4KHPQ 4WJ3M 2KVMA 3GTOB 2E76C 1PH9A 1YZ6A 1RTOA 2PI2A 4IURA 3HS0C 2JA6H 1H95A 3HOXG 4PQXA 4DN4M 5ELBA 3SDZA 3I91A 4BA1I 5C3EB 5DNFA 1Q7YC 4BXXG 1UE1A 1DOKA 4HCSA 4A3CH 3S1RB 2L0CA 1K8MA 2WB1B 1JOKA 2EDGA 4R1JA 2CH4A 5I4DA 2OTLA 1EIHA 5EQ0A 5CORA 5EGTA 3PUYA 4DKAC 5IYBH 3RNUA 2PPBC 4OO1H 3NQIA 1B8AA 2JEAI 2LSSA 4FF3A 3S2DB 3S9WA 1SJED 4K5WA 3U4ZA 4DAVA 3GDEA 3K0XA 5H1SE 3UDXA 1CSPA 3HP3A 1M8AA 1IYVA 3PIO3 2B2YC 3OW2A 1H9KA 1RTNA 3CAMA 1WCMH 3I4NG 3J80L 5E3FA 5CBEE 5K5PA 1LV9A 1PYSB 3U9OA 1FJGQ 4IUUA 4OX9Q 1JICA 4K6DA 4DR7L 5JEAG 5CV9A 1QJOA 2BE5D 1M4VA 1WTQA 3K5NA 1L0XB 3IKJA 3IRBA 5FO9B 2E2HH 1Z7TA 2I07B 1BBWA 2F0QA 2M9VA 5BN3A 1B3AA 2MQHA 4YHHQ 1GXDC 4KD4A 5J3BA 3HOZH 1SMXA 1H9SB 3PMFA 1B44D 4CKBA 4RGMA 3V2TA 4UDUC 3I4LA 5K36G 2AMCB 3NPPA 2F0GA 5C44B 1PHJA 1EY8A 1C4QA 3J81E 3S1QB 1I50H 2OEOA 5HGQA 1CKMA 1TWFB 2MUYA 1R4PB 1TVXA 2L9HA 4FO2A 3TN2A 2XWJB 3CU7A 4A3LH 4X66Q 1STAA 2KCTA 1F9QA 3TSSA 3VR6A 5FJ8G 2BDOA 4LF7L 2KECA 3OYYA 2DNCA 4LF7Q 3W3AA 1Y1VH 5IODA 4P71A 2F0JA 4KK7A 2BE5C 2OQ0A 2RCNA 3ND9A 1BXTA 4XQJA 3CQZH 4J6HA 2V4DA 3VDYA 1WTXA 3K8AA 3QOLA 4GKJQ 3KBXA 1BF4A 2KCNA 1EUJA 2E2JH 1YNND 4O2DA 2MPMA 1EEFD 1GOZA 2B2UA 2L15A 5IP9G 3Q22A 4A3KG 3UE1A 4Q5VA 2R7FA 2O2LD 3J7AV 1PTOB 1SMYD 5C6AA 5ELDA 2KHSA 1YHBA 3OWFA 1Q3LA 3PO3B 4P74A 4R4QA 4JI2L 1TT2A 2KHIA 4PZ7A 4GS3A 2F0FA 4B9WA 2VUMG 1CKOA 3OWEB 2A6HD 3QIAA 3MXNA 4MTKA 1JQYD 2VB3X 2NVQH 3I70A 4DUZQ 3RZDH 1FNUA 1NSNS 1A8VA 3S24A 3PIOA 1XTDA 2L12A 1I94L 4TKOB 1SYDA 1I94Q 4F88A 2UXDL 2UXDQ 2R61A 4DV4Q 1N36Q 3URYA 4HIKA 2EYLA 5IGFA 2IX3A 1MJEA 4B3TL 1LTSD 4OWWB 1RIPA 3BDOA 3F2BA 2FJ2A 2JA5G 3NXWA 2WKCA 4HMIA 4FYDA 1L1OC 1E2WA 4OHJA 1SNMA 1PRTD 1TY2A 5C0XH 4A75A 3LX0A 3TBIB 1YNNC 3CC7A 4DR1L 3QJYA 4DR1Q 3FKIH 1VQAA 1EY0A 2I5MX 4UP8A 1W6KA 2IJ0A 3NEMA 3F2CA 4KY6A 1SFOH 1X3QA 4CDFC 4LAAA 2AUJD 1W3SA 1SMYC 3SE0A 3HOUB 1JJCB 3PGZA 2E8GA 1G6ZA 1JORA 3FPPA 4FDBA 2F0TA 4Y7NH 2R7ZB 4CDDC 4K0KL 3D6CA 3VYRA 2PCFB 4A3IB 4K0KQ 2A6HC 1PH7A 2AQ2B 1XPUA 4A3JG 3MFGA 4N9PA 5IE8A 1CQFA 4K6LA 4DV2L 4GZYC 4DV2Q 3BG3A 3E0EA 2JA7G 1CI3M 1DOMA 4C3JH 4XYOA 3M7GA 2VQFL 1GM5A 2ZXRA 4A3GG 5C3EH 3PO2H 4B3SQ 2A68D 4QCLA 3QG1A 2UXCL 1Z47A 2UXCQ 4LUVA 5HURA 4L8JA 1PRTC 2XSCA 4RAUC 3CKIB 2O5JC 1M1KC 1QUQB 2F0PA 2IWHA 2HQLA 4NP5A 1PH8A 4L5RC 4BY1G 4YIJA 1P8LA 1XTCD 3TRZA 2XVSA 2ZT9C 5AJ3Q 4J8QA 3ERSX 1DZ1A 3U4VA 2HIXA 2JE6I 1SBBB 1SE4A 2IT1A 3BU2A 3CW2C 2CQAA 2RBMA 2ZJPA 1CTMA 2CWPA 2HQEA 2M00A 4BY1B 2NYZD 4A76A 1J5EL 4OELB 1YJNA 1XNRL 4QJFA 4JI5L 5G3LF 2QDLA 1XNRQ 2HT1A 4JI5Q 3I4MG 2A69D 1U5KA 1HNXL 3M4YA 3VR3A 2K1BA 3FRPB 4A3DG 4P2CB 2OCEA 1KLUD 2F0WA 3TP7A 3C3LA 3HKZB 2JSOA 2JJQA 1JWSD 1TS3A 2PYKA 3GV6A 2A68C 4KN7C 1IBKL 3I73A 1IBKQ 3L0OA 2LXKA 4RGTA 1I4RA 5EKLA 4DUYL 1WTRA 4B3ML 1CKNA 3E0JA 2FMCA 4B3MQ 3RLFA 1BDOA 3HOWG 2EY5A 2JA8H 2GVAA 1EZ8A 1XMQL 2KUMA 2VL6A 3A0JA 3H15A 3J80i 4LF6Q 4QB4A 4NXNQ 1J9OA 3HKSA 3GTKB 1ENAA 1RDPD 2EVBA 1EYDA 2KCMA 1Y8PB 3J7YW 2OWOA 3JAML 4JI7L 4JI7Q 2JA6G 4HR7B 3S1NB 4FXKC 2WINB 3K7AH 4DR4L 2B2VA 1YHQA 1YEZA 1D8LA 1PXUA 2MFIA 2AWNA 1CA6A 4RA8A 3BVZA 1E0BA 1Q1BA 2EYMA 3MXUA 2A69C 2OF1A 3PSIA 4YCUA 2B63G 1YNJD 1MGSA 3A8JE 4FP5D 2R6GA 1X3GA 2AHOB 3KF6A 1VQ6A 1BCPF 5IYBG 1QE6A 5CV4A 5JJIA 4IFDJ 3BZDB 2YTXA 4DV0L 2B2UC 3H3VC 2AQ1B 1YITA 4LFBL 4HAEA 2WIIB 2F0MA 3ONAB 3K5LA 5LL6S 4IPDA 4ODGA 4N9TA 3P20A 5LHY1 2F4VQ 3GO5A 1K73C 4A93H 2JN4A 1K83H 3E5SA 3S16B 3WOEA 2EQSA 3R2TA 3D4RA 5FKAC 1GVPA 4UAIA 2KCCA 1L1OB 2IHFA 1CM9A 5FO7B 1SE3A 1IXRA 2VXWA 3EFXD 1GD7A 1WCMB 1HNZL 1HNZQ 3STBD 4HJ5A 4NDXA 1JWUD 2N55A 4AQYL 4AQYQ 1B50A 1F9RA 3UE0A 3A56A 2A19A 4DV1L 2EPBA 3SHLA 1YNJC 3EIVA 2J7ZA 3HOZG 3L3OC 4ZQ3A 2E2HB 2K52A 4A3MG 2F0LA 2E5LL 5FLXc 2A73B 4Z9CB 4GNXC 2E5LQ 1WFQA 1IYJB 1X3FA 3KLWA 3Q0AA 1Q1EA 1VQ4A 1O78A 4GLVB 1JOOA 4JCVE 4TRDA 3HOZB 2B2TC 4ILWA 4IUNA 3T1YQ 4HN7A 1N33Q 1ILPA 4FF1A 1SLJA 2EYFA 4E6IA 4QF4A 1TS2A 2G9DA 4GOPA 5IYCG 2PW5A 4LF8L 1F9PA 4LF8Q 4R4OA 3ULLA 5DLQE 4CBVA 1I50B 1A15A 5EPJA 4U673 1PRTB 5GQOA 1VQ8A 3R3OA 5M3MH 2R7ZH 1DD2A 1F2ZA 3RLNA 4M8AA 1E2ZA 4IFDG 3TZUA 3H6MA 1SNQA 4J15A 1X65A 2CH4W 4G57A 5M3FH 3VA7A 2VY3A 1KD1C 2IL8A 1TWCH 1HFGA 1CUKA 1EQRA 1Y1VB 2KJXA 1NE3A 4I65A 3U50C 3PIP3 1TR5A 2HDMA 3TDQA 1EY7A 2F0HA 2HUGA 3CQZB 2K32A 5BN4A 1QZHA 3M7NA 1LTID 5D3IB 2F0DA 1Y1WH 3K5MA 3Q24A 1RHPA 1FNWA 1QB5D 5IYDG 4JI3L 1E2VA 3I4OA 3MWYW 4DAYB 2E2JB 1SNCA 4AYBB 3TEHB 4AIMA 1UUPA 3MEHA 1TWAH 3A55A 5C3XA 4YWMA 4MIUA 2K7VA 1HZCA 3AMUA 3OMCA 4NB3A 4BBRG 1J6QA 2NN6H 1Q90A 4DR5Q 2Y0SB 3TP8A 2F0EA 5FLMH 1VQBA 3TZDA 4Q0FA 1E7ZA 3FVQA 1W6JA 3RZDB 3U58A 1D5XC 1DCZA 1RD9D 2CHBD 4J1MA 1VQ9A 4K8IA 1NTGA 4A3BB 1LTGD 1SE8A 1V1PB 3TS2A 4C2MH 1A62A 1E22A 1Q46A 1PZJD 1B3QA 4JYAL 1YJWA 3FKIG 1NAPA 1VQEA 5JEAJ 2UU9Q 3D4WA 1A63A 1VQIA 4ALPA 4MTNA 3FKIB 3X3NA 3CPFA 5IGBA 3L2PA 4K2LA 5BN5A 1L0YB 2UUBQ 2B2VC 2BA1A 1SFOB 1BBUA 2OTJA 2YV5A 2O5IC 3FEWX 2EXDA 2D62A 1LLRD 2PI2E 4B3RL 4B3RQ 2DNEA 3S1NH 1JC7A 4C3JG 1UNSA 3BS1A 1LTBD 2BOSA 5C5LA 3C46A 2F0SA 5C3EG
chains in the Genus database with same CATH topology
1DM0B 1U4RA 2NTSA 2K5QA 4F8MA 4DU9A 4C1NI 3RUZA 4DXFA 4C3JB 1RCVD 3PO2B 4KY5A 1KABA 1G2SA 4H13C 4KKTA 2D2CC 1LT3D 1F9SA 2K03A 2PZUA 1ML0D 3DUZA 3HOVB 3P1HA 4XXEA 4A3EB 5CGKA 2EJGC 1H9JA 1Y69U 5ELFA 5KNBA 3MFYA 2WP8J 2LY7A 4WRDA 1PFBA 1A3TA 1SXTA 4RGNA 3NWSA 4QUFA 3ITPA 1QWYA 2FMMA 1Y8OB 5COYA 1PFMA 1STEA 2E74C 1Q8IA 2PO4A 3D8GA 4IFDI 2SNSA 1S5BD 3NQTA 2XWBB 1B9MA 5CV8A 1B53A 2XRQD 3D4DA 4QUCA 1VCIA 2JA8B 1CQVA 5IT9E 5JOBA 2GA4B 1F2LA 1OXXK 1RJTA 4DXGA 5DM63 1S5CD 4RKLA 3WDNA 3FMCA 4XYQA 3M4OB 1IW7D 1TIID 3C1FA 1KTKA 3K7AB 2L4NA 4RKBA 1II3A 3BYTB 4ZLTF 3AU7A 1DOLA 2AWOA 2ICIA 1EQTA 5LL6X 2F3VA 1B1ZA 1CK1A 3PV0A 3BYYB 4DK1A 3SXHA 2RA4A 3NK9A 4XIGS 4MHEA 2AQ3B 2QCPX 1KLGD 3BVMA 2N88A 3VR5A 1A3VA 2EJMA 2YYZA 4X3UA 3OMGA 4A93B 1NUCA 2Z1CA 1I6HB 1D6EC 4FF4A 1K83B 3QB3A 3A7LA 4EQNA 5AFWA 3GTLB 4EQPA 4PNYA 5FK9C 2WAQB 2OT2A 1IL8A 4IZ8A 3S14B 1WD0A 2BCOA 4NMZA 4G7ZC 4FVMA 2J0TD 1SSOA 3O13A 1IW7C 2K04A 2C9OA 3P7JA 4ZUJA 1T5EA 4RGOS 1HA5A 2JYOA 4QMGA 4CKEA 5IGEA 3CRLC 2PMZB 1G91A 2HCIA 2VB2X 4QIWB 5EBCA 3OIPA 2X6LA 1K8OA 3D6WA 1F2YA 3MZ5A 1A2TA 1LABA 1SYBA 3KLSA 1S5ED 2IX1A 4CKCA 3IFDA 1GUNA 3DXJC 2QDBA 5M9OA 3NWTA 1S5DD 1QNUA 2PNRC 5M3MB 1I4QA 3PUVA 2XIWA 2D5DA 1HUMA 5M3FB 1DXMA 1O80A 1BO0A 1TWCB 1KNAA 1QG7A 4G7HC 1XXGA 5G3LD 2CW0C 3HOYB 3BDLA 2HCCA 2RDHA 2KA7A 1Y1WB 4RCNA 4CJ1B 1MSGA 3IFTA 5CV7A 1HQRD 4TQUS 1TWAB 1U4PA 1JB3A 1O7YA 1I4HA 1HUNA 2NWGA 4KMUC 1GJXA 1ET9A 4IUQA 1O7ZA 4XQNA 1EWHA 1Z6HA 5TSSA 1H9SA 4K5VA 5JAVA 3Q6SA 3PUZA 3A8KE 3K57A 3NTHA 5D65A 1EFID 1EY5A 4C2MB 1MD2D 1SNPA 1B2TA 1QOHA 1SNOA 2TMPA 2LFNA 3I90A 3VYTA 2R3ZA 5IOCA 1BCPD 3A54A 2IW3A 3GD7A 1OXVA 5IIFA 1FD7D 1FR3A 1IYUA 4R8IA 3N6RA 1GUSA 5CV6A 1KAAA 4ZK9B 2XRSD 2NUCA 5CYUA 1X32A 3FPUB 3MXGA 3NBIA 1QCBD 2RQXA 2XN9C 5ELCA 2C5CA 1GUWA 1OO9B 1TY0A 3EROA 4OO1G 2NTTA 4HEDA 2SNMA 2L1BA 4XT1B 2NVYB 2EYHA 1GUTA 5M5WB 1DYQA 1BCPC 4ZAIA 4RHRA 1JWMD 2EE1A 3KBGA 3QWNA 4KD3A 4CHTB 3S17B 2MJ8A 3EA6A 2F0NA 1ONLA 1GHJA 1SJHD 2WACA 3DWPA 4K14A 1BNZA 4R9WA 2F4IA 1U9RA 5ISRA 4EVOA 1R9TB 4ABNA 1AP0A 4HMJA 5EKIA 3FDTA 4F7XA 1I4XA 1PDQA 1WTOA 3OPOA 3S2HB 5E4XA 2EY2A 3SK8A 5C4JB 3DWAA 4RH6A 3NSWA 1AEXA 3H09A 3I72A 3LNNA 2YU9B 1D1IA 1MSHA 2F3WA 5C0XJ 4NW2A 2QEJC 2H1EA 3I8ZA 1XYIA 2DY8A 4R8NA 2MP1A 5EBDA 3GTJB 3HGBA 3EQLC 4ZKCB 1HCZA 1TKWB 2Q8RE 1PFNA 4OL7A 5J39A 4B08A 4HCEA 5I9PA 2F1MA 4BY7B 1EL0A 5IGDA 1X3PA 2NVXB 1HRJA 5C4XB 1EYAA 1AZPA 1NR2A 1ENCA 4JBWA 5FOBB 5HGTA 1WD1A 3MHBA 1I3QB 5EJWA 1WTPA 1ET6A 3MC0B 4IUVA 4M1UB 2MGSA 3X3MA 4DGZA 4I7ZC 3IAYA 4BBSB 3K0YA 2KEDA 4WFN3 3GTGB 5CBAE 3K6OA 2HDLA 3T56B 4L6TB 1D5MC 5I6YA 2F0VA 1G291 2K28A 1CHQD 3LWUA 1ZYRD 2EOTA 1EQVA 1PTOD 1H9MA 5KGUA 4C3HG 3OSOA 1MI2A 2X6GA 3QO2A 1GUGA 1PLFA 1EU4A 4CGYB 2NB0A 3H91A 1EYCA 2Z4HA 2R93B 2VNUD 3LWEA 4KTAA 4C3HB 5FLXE 1JR0D 2Q8IB 1HXYD 5C0XG 1EY9A 1CZWA 1A2UA 1KDCA 1SEBD 5F2DA 1PTOF 1IKLA 3H0GB 4OO1I 5JVG3 1HA6A 4K2KA 4RWSC 3KK7A 1CHPD 5E1FA 5C4ZA 1ZYRC 2B2WA 3NTIA 5IT9L 1PTOC 4PMBA 2WV6D 1C48A 4KJOA 4LK1C 3R2IA 5JJZA 1ICWA 1SNDA 1VF7A 1LT6D 4XDXA 1Y8NB 5ELEA 2BA0A 4LJZC 3HZXA 4PMWA 5JPMC 3DHQA 4C3IB 5I2YA 1SDFA 1A3UA 3KUPA 1STYA 1LT5D 5M5XB 1GUOA 4K5XA 2NVTB 1NR4A 1S5FD 1A6XA 1DONA 1JE4A 1KDBA 3F2UA 1MBYA 2EY1A 3NUCA 1VF5C 3SR1A 3HOXB 5A2QE 1OXSC 2E2DC 2IX0A 4DK0A 4KKSA 4BA2I 1EIGA 5KNDA 3TP6A 1IKMA 4KN4C 5T1GA 2K5DA 2DN8A 4WORA 1EY4A 1JOQA 1O7LA 1LTAD 3MVVA 4G4KA 4L63B 2E75C 4PV1C 5IGCA 2LS01 3TMEA 2Z4IA 1J8IA 2BDNA 2RDFA 2KOLA 1ZKOA 2FHTA 1RF2D 2K33A 4KHVA 2I46A 1G8ZD 3I4NB 3G6JB 1FNVA 3HEJA 3M3YB 3UI2A 5CC4A 1G2TA 4LMQD 3SEBA 4DAYA 5I2XA 2F0IA 1OXUA 1SYCA 3S1MB 4XT3B 2Q8TA 2XNAC 1V1OA 1CT1D 3T53B 4FNFA 5I6WA 1LACA 3AB9A 1BOSA 4PMCA 4IN3A 3NP8A 2NBFA 3K59A 4H44C 2R92B 1F77A 3ND8A 3DWQA 3T51B 5C4HA 1ZEQX 2G9HD 5C0XI 4O1NA 4IQZA 1V1PA 1EU3A 4IFDH 2KQ3A 5JVH3 1STHA 3SVMA 1JCKB 3KLSX 3C2PA 5KYIA 4CJ0B 4OGQC 3NHHA 5E4WC 4H7BA 1H9RA 3J80E 2ZXOA 3P75A 1TWHB 3V96A 4C56C 2CW0D 4A3KB 2B8GA 1WTVA 2F0OA 4DAPA 3DMUA 4RCOA 2B2WC 2ZXPA 5CV5A 5DEHA 3NBHA 1HQMC 2K01A 2VUMB 1QILA 2J4XA 2EZVA 1STGA 4O42A 1BQQT 4DFAA 2IPKD 3D3RA 1PZKD 3G7LA 3T16A 2O4XA 5KNCA 4V0BA 2JA5B 1S4ZA 3VR2A 1TWGB 2A5HA 2JP1A 2QILA 4WJWA 2EJFC 1B4OA 2K6AA 4X3TA 4FXDA 1LO5D 4JK1C 2B2TA 2F0UA 3RMHA 2TSSA 4IUPA 4RHSA 2RKSA 3SK5A 3BVGA 3A8IE 2DY7A 2NN6G 3D31A 1PRTF 4A3JB 1TQOA 1BR9A 1D1KA 2ENBA 2JA7B 1I4GA 1SE2A 4KHZA 1ENFA 3GQBA 3RZOB 3HG9A 4DNRB 1D2BA 4A3GB 5M5YB 1I6VC 3KF8A 4DNTB 1BUVT 4G7OC 1IHZA 3U9SA 1RKNA 1NCVA 1VDZA 2WKDA 1XWEA 1WTWA 4H0LC 3K5OA 1ESRA 3DEPA 3SK6A 1RODA 3MXPA 4IUTA 2SEBD 4OIJA 1QNKA 5J1ZA 1OXTA 5CMDA 2QF7A 3T13A 3VYUA 4EQOA 2FINB 2H4OA 1EOTA 3I4MB 1SAPA 3GTQB 3EVQA 5JEAH 5KIXA 1D5ZC 3A7AB 1F2MA 4A3DB 5CR3A 1SYEA 1EY6A 2PZWA 1U4MA 1R4QB 4HSVA 3J7AF 2B39A 3MA2B 5FO8B 2OXPA 2A6ED 1EWCA 1TU2B 4ID6A 3EJIA 5EKKA 3HOWB 3HRZC 3I3CA 4KI0A 3E6ZX 1WVLA 4CJ2C 5K36H 3Q23A 4X3SA 1V8QA 2EY6A 2EXZA 3C1EA 4FF2A 4ULLA 3V05A 3NTKA 1UAPA 4RFBA 4KY7A 2FFKB 4XQQA 2JA6B 4NKLA 5A35A 3VR4A 1STBA 5C5MA 1BBXC 1VMCA 2B63B 1SYGA 1UEAB 4KJNA 4ZRZA 1XX8A 1CFMA 4KV6A 1ESFA 2JXMB 2M2LA 1Q12A 1PTOH 3OIQA 4BWGB 4DA2A 2A6EC 3GV3A 1AW7A 2L11A 3H94A 1HTPA 5NUCA 1PMRA 5FLXL 1CA5A 5D3DA 1T5XD 2SDFA 4ZUIA 3N52A 3OW7A 1V43A 2B2YA 4DF7A 5T1IA 3W2DA 3GTPB 5J22A 1HTLD 2EYJA 3ZYYX 3IL8A 1EEID 3L9AX 4B9XA 2LKVA 3S15B 2NN6I 1HFNA 2L55A 3PUWA 4TSSA 1FGBD 2F0KA 5DAUA 3K58A 4A3MB 2RVLA 5I9OA 3DM1A 1LT4D 3JAME 4IALA 3TP5A 5D14A 3CHBD 1HHVA 4KKUA 3QOJA 4BS9A 1LTTD 4S3SA 4EGVA 5C3WA 3GP7A 3CRKC 3ERQA 2K5WA 3MAQA 2B8FA 1C8CA 1GHKA 1DJRD 3VYSA 2RSOA 5EPKA 1I4PA 2Z8LA 3WOFA 2PZTA 1AFPA 1HPCA 5JPNC 1LTRD 3L7ZC 1VMPA 1STNA 3R93A 3R8BA 2E2IB 5KYLA 1FYCA 5A2QL 4U68A 4HSPA 2MHVA 2RSNA 2KEEA 2AUKA 3VA5A 4C1NK 1CZGA 3BDCA 4ME5A 3T4AC 4ZKBB 3KLRA 4ZYSA 2CVRA 2JEBI 5KRUA 2NVQB 2L5TA 2SOBA 4BBRB 2QKIC 2PW7A 2EYPA 4XTCS 2RDGA 3SK4A 4MN3A 4FXGC 1B9NA 1AZQA 2EYOA 2X69A 5IGGA 3GTMB 2ID0A 2K05A 4V190 4OIKA 1SYFA 1PZID 2NZ1D 3M85A 3MTSA 1BCPB 1AN8A 5DM73 1KNEA 4C3IG 3RD4A 2PQEA 5EPLA 2A74C 3PUXA 4X3KA 1ZXTA 4K8JA 2D9UA 2ICEC 1TS5A 4Y7NB 5KEEA 1ILQA 1TS4A 1U4LA 2LMCB 3OOCA 2F03A 1EZ6A 3NE5B 1KDAA 3J81L 1PYWD 4A3FB 3OHXC 4F87A 3DEOA 4HTHA 2KVMA 3GTOB 2E76C 1RTOA 4IURA 3HS0C 4PQXA 4DN4M 5ELBA 3SDZA 3I91A 4BA1I 5C3EB 5DNFA 1DOKA 4HCSA 3S1RB 2L0CA 1K8MA 2WB1B 1JOKA 2EDGA 5I4DA 1EIHA 5EQ0A 5CORA 5EGTA 3PUYA 2PPBC 4OO1H 3NQIA 2JEAI 4FF3A 3S2DB 3S9WA 1SJED 4K5WA 4DAVA 3HP3A 1M8AA 1IYVA 3PIO3 2B2YC 1H9KA 1RTNA 3J80L 5E3FA 5CBEE 5K5PA 1LV9A 3U9OA 4IUUA 1JICA 4K6DA 5JEAG 5CV9A 1QJOA 2BE5D 1M4VA 1WTQA 3K5NA 1L0XB 3IKJA 5FO9B 1Z7TA 2I07B 2F0QA 2M9VA 5BN3A 1B3AA 1GXDC 4KD4A 1H9SB 3PMFA 1B44D 4CKBA 4RGMA 3V2TA 4UDUC 3I4LA 5K36G 3NPPA 2F0GA 5C44B 1EY8A 1C4QA 3J81E 3S1QB 2OEOA 1TWFB 2MUYA 1R4PB 1TVXA 2L9HA 4FO2A 3TN2A 2XWJB 3CU7A 1STAA 1F9QA 3TSSA 3VR6A 2BDOA 2KECA 2DNCA 3W3AA 5IODA 2F0JA 4KK7A 2BE5C 3ND9A 1BXTA 4XQJA 4J6HA 2V4DA 1WTXA 3QOLA 3KBXA 1BF4A 2KCNA 1YNND 2MPMA 1EEFD 1GOZA 2B2UA 3Q22A 4Q5VA 2O2LD 3J7AV 1PTOB 1SMYD 5C6AA 5ELDA 2KHSA 3OWFA 1Q3LA 3PO3B 1TT2A 2F0FA 4B9WA 3OWEB 2A6HD 3QIAA 3MXNA 1JQYD 2VB3X 3I70A 1FNUA 1NSNS 2L12A 4TKOB 1SYDA 4F88A 2R61A 3URYA 2EYLA 5IGFA 2IX3A 1LTSD 3BDOA 2FJ2A 3NXWA 2WKCA 4HMIA 4FYDA 1E2WA 4OHJA 1SNMA 1PRTD 1TY2A 5C0XH 3LX0A 3TBIB 1YNNC 3QJYA 1EY0A 1W6KA 2IJ0A 4KY6A 1X3QA 4LAAA 2AUJD 1SMYC 3SE0A 3HOUB 1G6ZA 1JORA 3FPPA 2F0TA 2R7ZB 3D6CA 3VYRA 2PCFB 4A3IB 2A6HC 2AQ2B 3MFGA 4N9PA 1CQFA 4K6LA 4GZYC 3BG3A 1CI3M 1DOMA 4XYOA 3M7GA 2ZXRA 2A68D 4QCLA 3QG1A 1Z47A 5HURA 4L8JA 1PRTC 2XSCA 4RAUC 3CKIB 2O5JC 2F0PA 2IWHA 4NP5A 4YIJA 1XTCD 2XVSA 2ZT9C 4J8QA 1DZ1A 2JE6I 1SBBB 1SE4A 2IT1A 2CQAA 2RBMA 1CTMA 2HQEA 2M00A 4BY1B 2NYZD 5G3LF 2A69D 3M4YA 3VR3A 2K1BA 3FRPB 4P2CB 1KLUD 2F0WA 3TP7A 3C3LA 3HKZB 2JSOA 1JWSD 1TS3A 2PYKA 3GV6A 2A68C 4KN7C 3I73A 4RGTA 1I4RA 5EKLA 1WTRA 3E0JA 2FMCA 3RLFA 1BDOA 2EY5A 1EZ8A 2KUMA 4QB4A 1J9OA 3GTKB 1ENAA 1RDPD 2EVBA 1EYDA 1Y8PB 3J7YW 3JAML 4HR7B 3S1NB 4FXKC 2WINB 2B2VA 1PXUA 2AWNA 1CA6A 4RA8A 3BVZA 1E0BA 1Q1BA 2EYMA 3MXUA 2A69C 2OF1A 1YNJD 1MGSA 3A8JE 4FP5D 2R6GA 1BCPF 1QE6A 5CV4A 4IFDJ 3BZDB 3H3VC 2B2UC 2AQ1B 4HAEA 2WIIB 2F0MA 3ONAB 3K5LA 5LL6S 4ODGA 4N9TA 3P20A 5LHY1 3GO5A 3E5SA 3S16B 3WOEA 3R2TA 3D4RA 5FKAC 4UAIA 2KCCA 1CM9A 5FO7B 1SE3A 2VXWA 3EFXD 1WCMB 4NDXA 1JWUD 2N55A 1B50A 1F9RA 3A56A 2EPBA 3SHLA 1YNJC 2J7ZA 3L3OC 4ZQ3A 2E2HB 2F0LA 2A73B 4Z9CB 3Q0AA 1Q1EA 1O78A 1JOOA 4TRDA 3HOZB 2B2TC 4ILWA 4IUNA 4HN7A 1ILPA 4FF1A 2EYFA 4E6IA 4QF4A 1TS2A 2G9DA 2PW5A 1F9PA 4CBVA 1I50B 1A15A 5EPJA 4U673 1PRTB 3R3OA 1DD2A 1F2ZA 4M8AA 1E2ZA 4IFDG 3TZUA 3H6MA 1SNQA 4G57A 3VA7A 2IL8A 1HFGA 1Y1VB 2KJXA 4I65A 3PIP3 1TR5A 2HDMA 3TDQA 1EY7A 2F0HA 2HUGA 3CQZB 2K32A 5BN4A 3M7NA 1LTID 5D3IB 2F0DA 3K5MA 3Q24A 1RHPA 1FNWA 1QB5D 1E2VA 3MWYW 2E2JB 1SNCA 4AYBB 1UUPA 3MEHA 3A55A 5C3XA 4MIUA 2K7VA 3AMUA 3OMCA 2NN6H 1Q90A 2Y0SB 3TP8A 2F0EA 3TZDA 4Q0FA 3FVQA 1W6JA 3RZDB 1D5XC 1DCZA 1RD9D 2CHBD 4J1MA 4K8IA 4A3BB 1LTGD 1V1PB 1PZJD 1NAPA 5JEAJ 3D4WA 3FKIB 3X3NA 5IGBA 4K2LA 5BN5A 1L0YB 2B2VC 2BA1A 1SFOB 2O5IC 3FEWX 2D62A 1LLRD 2DNEA 1JC7A 4C3JG 1UNSA 3BS1A 1LTBD 2BOSA 5C5LA 3C46A 2F0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV6 A;  1KAA A;  5CV4 A;  4R8N A;  4RKB A;  4K2K A;  1II3 A;  2F0O A;  3VA5 A;  3SK6 A;  3S9W A;  2NUC A;  3DMU A;  4I65 A;  4K5W A;  4KHV A;  5M9O A;  3BDC A;  4F8M A;  4DU9 A;  5CV5 A;  4ME5 A;  5E1F A;  3RUZ A;  1TR5 A;  2F0M A;  5DEH A;  5NUC A;  3MXP A;  5C4Z A;  5HUR A;  4ODG A;  1EY7 A;  2F0H A;  3HEJ A;  4N9T A;  5J1Z A;  4OL7 A;  5J39 A;  4PMB A;  2F0D A;  5KRU A;  1STG A;  2F0P A;  4KY5 A;  5CC4 A;  2F3V A;  4KJO A;  1KAB A;  4NP5 A;  4ZUI A;  5C6A A;  5I9P A;  2KHS A;  3T13 A;  2SOB A;  3OWF A;  4YIJ A;  4DFA A;  5IGD A;  2PW7 A;  4EQO A;  2EYP A;  1TT2 A;  3SXH A;  5E3F A;  1EYA A;  1SNC A;  3E5S A;  3NK9 A;  5K5P A;  3T16 A;  4DF7 A;  2F0F A;  3SK4 A;  1SND A;  3MEH A;  3U9O A;  4B9W A;  2O4X A;  2PZU A;  1A3V A;  2F0I A;  5C3X A;  1SYC A;  1ENC A;  2EYO A;  3HZX A;  3BDL A;  3P1H A;  4MIU A;  2EYJ A;  3ERO A;  2RBM A;  3EVQ A;  5HGT A;  5IGG A;  4K6D A;  5KIX A;  3OMC A;  1NSN S;  2HQE A;  2M00 A;  3DHQ A;  3MHB A;  2SNM A;  3OMG A;  1F2M A;  1NUC A;  4B9X A;  2LKV A;  5CR3 A;  1SYE A;  1SYD A;  5CGK A;  5I6W A;  1EY6 A;  3TP8 A;  5CV9 A;  5CV7 A;  2PZW A;  2F0E A;  1SYF A;  3QB3 A;  4NDX A;  4PMC A;  4EQN A;  1A3U A;  4DGZ A;  4EQP A;  2EYH A;  2EYL A;  5IGF A;  3NP8 A;  1STY A;  4PNY A;  5DAU A;  2F0K A;  2OXP A;  2F0Q A;  4WRD A;  5I6Y A;  2F0V A;  4IZ8 A;  1A3T A;  3NXW A;  4K5X A;  2F0W A;  3TP7 A;  5I9O A;  4ID6 A;  2PYK A;  4HMI A;  4KD3 A;  2F0U A;  3SHL A;  2PQE A;  4J1M A;  4NMZ A;  3EJI A;  5EKK A;  4K8I A;  2F0N A;  3ITP A;  4KD4 A;  1SNM A;  3PMF A;  1EQV A;  4IAL A;  2RKS A;  4ZQ3 A;  3TP5 A;  4ZUJ A;  5C4H A;  2WAC A;  4K5V A;  3SK5 A;  5EKL A;  3V2T A;  5JAV A;  3LX0 A;  3QOJ A;  4K8J A;  2F0L A;  4K14 A;  1KDB A;  5KGU A;  2F0G A;  2EY6 A;  2EXZ A;  1EY0 A;  1EY8 A;  3C1E A;  5J22 A;  5KEE A;  3OSO A;  3D8G A;  2EY5 A;  4S3S A;  2SNS A;  4QMG A;  2EY1 A;  2KQ3 A;  3NUC A;  1EZ8 A;  4KY6 A;  1JOO A;  2OEO A;  1EZ6 A;  1U9R A;  4LAA A;  4TRD A;  4KY7 A;  3SR1 A;  1KDA A;  3NQT A;  5IGE A;  1TQO A;  1STH A;  5C3W A;  5ISR A;  4EVO A;  3D4W A;  4IUN A;  4NKL A;  4HTH A;  1EYC A;  1JOR A;  1EY5 A;  4QB4 A;  5CV8 A;  2EYF A;  2F0T A;  4E6I A;  4QF4 A;  2ENB A;  4HMJ A;  1SNP A;  3D4D A;  3TP6 A;  1STB A;  5KYI A;  1SNO A;  3D6C A;  4F7X A;  5C5M A;  3ERQ A;  4KTA A;  5IGB A;  1ENA A;  4K2L A;  2PW5 A;  1STA A;  1EYD A;  3NHH A;  4WOR A;  1EY4 A;  2EY2 A;  1JOQ A;  3SK8 A;  1F2Y A;  1SYG A;  4N9P A;  5JOB A;  3MVV A;  3MZ5 A;  5IOC A;  1AEX A;  1A2T A;  3R3O A;  1F2Z A;  4H7B A;  5IOD A;  2F0J A;  1SYB A;  5IGC A;  1EY9 A;  4KJN A;  2PZT A;  1A2U A;  1KDC A;  5IIF A;  3TME A;  1IHZ A;  1RKN A;  5F2D A;  2F3W A;  1STN A;  2EYM A;  3P75 A;  3H6M A;  1JOK A;  1SNQ A;  2OF1 A;  4KV6 A;  4G57 A;  4RKL A;  5KYL A;  4J6H A;  5EGT A;  5C5L A;  2QDB A;  2F0S A;  2RDF A;  3QOL A;  3C1F A; 
#chains in the Genus database with same CATH topology
 1DM0 B;  1UE6 A;  1U4R A;  2NTS A;  1VS0 A;  1PH5 A;  4POF A;  4OEM B;  2K5Q A;  4LWC A;  4F8M A;  1UWV A;  3NBH B;  4C1N I;  4DU9 A;  3RUZ A;  2WB1 G;  4DXF A;  4C3J B;  1XNQ L;  1XNQ Q;  1RCV D;  1N9W A;  3PO2 B;  4KY5 A;  1PYB A;  2YTV A;  1KAB A;  1G2S A;  4H13 C;  3JC6 6;  4KKT A;  2D2C C;  2RHS B;  1LT3 D;  3J81 c;  3PIP A;  1F9S A;  1S72 A;  2K03 A;  2NVY H;  2PZU A;  1ML0 D;  2CQO A;  3DUZ A;  2Z0S A;  5M5W H;  3HOV B;  3P1H A;  1X9N A;  4XXE A;  4A3E B;  3S16 H;  3F1Z A;  5CGK A;  3JAM i;  2KBN A;  2EJG C;  2B29 A;  1H9J A;  4HIM A;  3S17 H;  2VW9 A;  4DV3 L;  4GNX B;  1KXL A;  1MHW C;  1Y69 U;  5ELF A;  5KNB A;  3MFY A;  4UP7 A;  2DUD A;  2WP8 J;  2LY7 A;  1HH2 P;  1XPR A;  1IBL L;  4WRD A;  1PFB A;  1A3T A;  1SXT A;  3PF5 A;  4RGN A;  3NWS A;  3G71 A;  4N8F A;  4QUF A;  3RR5 A;  3ITP A;  4L5Q A;  1HZ9 A;  1QWY A;  1R9T H;  4JI0 L;  2FMM A;  1YIJ A;  1Y8O B;  5COY A;  1PFM A;  1STE A;  4DR7 Q;  3F8T A;  2E74 C;  2N8N A;  3QR8 A;  3UDI A;  3S2H H;  1Q8I A;  2PO4 A;  3D8G A;  4IFD I;  2SNS A;  1K3R A;  2YTY A;  1S5B D;  2JA8 G;  5C4J H;  3NQT A;  2XWB B;  3KJP A;  4IO9 A;  4LF9 L;  1B9M A;  3J80 c;  5CV8 A;  4GOP C;  1YNX A;  3PCO B;  2MNA A;  1B53 A;  2XRQ D;  5C44 G;  2ZM6 L;  3D4D A;  3DM3 A;  4QUC A;  2YU9 H;  2ZM6 Q;  1VCI A;  2N3S A;  4POG A;  2JA8 B;  3KF8 B;  2I5H A;  1CQV A;  5IT9 E;  5JOB A;  2GA4 B;  1F2L A;  1OXX K;  1RJT A;  4DXG A;  3GTJ H;  4LF4 L;  5DM6 3;  4P75 A;  1S5C D;  4RKL A;  3WDN A;  3FMC A;  4XYQ A;  3M4O B;  1IW7 D;  1TII D;  3C1F A;  1KTK A;  3K7A B;  1WOC A;  2L4N A;  1II3 A;  3BYT B;  4RKB A;  4ZLT F;  3AU7 A;  2NVX H;  2F3I A;  3CPW A;  1DOL A;  2AWO A;  1XPO A;  2ICI A;  1PVO A;  4HID A;  1EQT A;  1GO3 E;  3ULJ A;  5LMU L;  4DR3 L;  5LL6 X;  4IJL A;  2F3V A;  1B1Z A;  4DR3 Q;  1CK1 A;  3H3V I;  1I3Q H;  1GKH A;  2N78 A;  3PV0 A;  3BYY B;  4DK1 A;  3SXH A;  1SRU A;  2RA4 A;  5IP7 H;  3NK9 A;  4XIG S;  4MHE A;  2AQ3 B;  2QCP X;  1KLG D;  3BVM A;  4KLK A;  2N88 A;  1LM0 A;  3VR5 A;  1A3V A;  2EJM A;  4BBS H;  2YYZ A;  4UY8 C;  3GTG H;  1Q86 C;  4DV5 L;  4X3U A;  4DV5 Q;  3OMG A;  3PO3 G;  3BZK A;  4A93 B;  1NUC A;  2Z1C A;  1I6H B;  4LUZ A;  1XMO L;  1D6E C;  4FF4 A;  1K83 B;  1XMO Q;  2K75 A;  2WFW A;  3QB3 A;  2LXJ A;  3A7L A;  4EQN A;  5AFW A;  3GTL B;  4EQP A;  4PNY A;  4JI6 L;  2VZA A;  2RF4 A;  5FK9 C;  2WAQ B;  2OT2 A;  4JI2 Q;  1IL8 A;  4IZ8 A;  3S14 B;  1WD0 A;  1L2F A;  2BCO A;  4CDC C;  4NMZ A;  4G7Z C;  4FVM A;  2J0T D;  1SSO A;  3O13 A;  3B6Y A;  1IW7 C;  2K04 A;  2C9O A;  3P7J A;  4ZUJ A;  1T5E A;  1EWI A;  2ZTD A;  2R93 H;  4RGO S;  4OWT B;  4QQB X;  1HA5 A;  1KQS A;  4C3H H;  2G5D A;  1VQH A;  1X54 A;  4A3B H;  2GN5 A;  2JYO A;  3KDF A;  4QMG A;  4YCV A;  4CKE A;  5IGE A;  3CRL C;  4B3T Q;  2PMZ B;  2ES2 A;  4IPH A;  4LF5 L;  1G91 A;  4LF5 Q;  2HCI A;  2VB2 X;  4QIW B;  1A0I A;  5EBC A;  3OIP A;  2X6L A;  1EQQ A;  1K8O A;  3H0G H;  3D6W A;  3HOU G;  1F2Y A;  2WB1 E;  3MZ5 A;  2HHH L;  1A2T A;  1LAB A;  2R7Z G;  1SYB A;  3KLS A;  4A3I G;  2PNH A;  1S5E D;  2IX1 A;  2Q2H A;  4CKC A;  3IFD A;  5GAD C;  1GUN A;  2Z6B A;  3DXJ C;  2QDB A;  5M9O A;  3NWT A;  1S5D D;  1QNU A;  2PNR C;  5M3M B;  1I4Q A;  3PUV A;  2XIW A;  4RMF A;  2ATW A;  1FVI A;  2D5D A;  4YY3 L;  4YY3 Q;  1HUM A;  1VQP A;  4JBJ A;  4PZ6 A;  5M3F B;  1VQN A;  4HIO A;  1DXM A;  1O80 A;  1BO0 A;  1TWC B;  1KNA A;  1QG7 A;  4C3I H;  4G7H C;  1XXG A;  2VQF Q;  3MEF A;  5G3L D;  2CW0 C;  3HOY B;  1HZB A;  3BDL A;  2HCC A;  2RDH A;  2KA7 A;  1Y1W B;  5M5X H;  4LFA L;  4RCN A;  4CJ1 B;  1MSG A;  4LFA Q;  3IFT A;  5CV7 A;  2Q2U A;  3HOV H;  1HQR D;  4TQU S;  2ZJQ A;  1EFW A;  1TWA B;  2HD3 A;  4A3E H;  1U4P A;  1JB3 A;  1O7Y A;  1I4H A;  1HUN A;  2NWG A;  4KMU C;  3J81 i;  1GJX A;  1ET9 A;  4IUQ A;  1O7Z A;  4XQN A;  1EWH A;  4N8X 1;  3HOX H;  1PH3 A;  1Z6H A;  1XJV A;  3UDF A;  5TSS A;  1H9S A;  4K5V A;  5JAV A;  1IBM L;  4BXX H;  1J5E Q;  3HKZ G;  1IZ6 A;  2Z6K A;  4DR2 L;  4DR2 Q;  3Q6S A;  4JBM A;  3PUZ A;  3A8K E;  3K57 A;  1HNX Q;  5IY0 A;  5GAE C;  3NTH A;  5D65 A;  3J7A 5;  1EFI D;  1EY5 A;  4C2M B;  1C7Y A;  1YJ9 A;  1MD2 D;  1SNP A;  1B2T A;  1QOH A;  1SNO A;  1K0R A;  2TMP A;  2LFN A;  3BJU A;  3RN2 A;  3I90 A;  3VYT A;  1JB7 A;  2R3Z A;  5LMN W;  5IOC A;  4DUY Q;  1BCP D;  3A54 A;  2IW3 A;  3I4N H;  3GD7 A;  1OXV A;  5IIF A;  1FD7 D;  1FR3 A;  2F52 A;  1IYU A;  4R8I A;  1XMQ Q;  1NMF A;  3N6R A;  1GUS A;  3PF4 A;  2HIV A;  5LMN L;  1PA6 A;  5LMN Q;  5CV6 A;  1KAA A;  4GN3 B;  4ZK9 B;  2XRS D;  1C0A A;  2NUC A;  5CYU A;  1X32 A;  1CSQ A;  4MNO A;  3M4O H;  1UE7 A;  3FPU B;  3MXG A;  3NBI A;  4DR4 Q;  1QCB D;  2VQE L;  2VQE Q;  2RQX A;  4JI4 L;  4A3C G;  2XN9 C;  4JI4 Q;  4PZ8 A;  5ELC A;  4X65 L;  2C5C A;  1GUW A;  1OO9 B;  1TY0 A;  3ERO A;  1QZG A;  2NTT A;  4OO1 G;  4HED A;  2R92 H;  4DV0 Q;  2SNM A;  2L1B A;  4XT1 B;  1K8A C;  4LFB Q;  3JAM c;  1P16 A;  3AYH B;  1WYD A;  3I7F A;  3CCU A;  2NVY B;  2EYH A;  1GUT A;  5M5W B;  1DYQ A;  1BCP C;  4JI1 L;  4ZAI A;  1KIX A;  1I6H H;  1SN8 A;  4RHR A;  1JWM D;  1SRO A;  1QVC A;  4ZCK A;  1SR3 A;  2EE1 A;  1WCM G;  3KBG A;  3QWN A;  1K3B C;  2QEX A;  4KD3 A;  4CHT B;  3AFP A;  3CCS A;  2K4K A;  2MJ8 A;  3EA6 A;  2F0N A;  3GTL H;  3S17 B;  1ONL A;  5FJ8 H;  2PQA B;  1GHJ A;  1SJH D;  2WAC A;  3CCE A;  4R4C A;  3S14 H;  3DWP A;  4K14 A;  1KRT A;  1NNX A;  1S40 A;  1BNZ A;  4R9W A;  2F4I A;  1U9R A;  1V9P A;  5ISR A;  2VS1 A;  4EVO A;  4GLA C;  1R9T B;  4ABN A;  1AP0 A;  2RHQ B;  4HMJ A;  5EKI A;  3FDT A;  4DV1 Q;  1NY4 A;  4F7X A;  1I4X A;  1VQC A;  2B3G A;  1PDQ A;  1TWH H;  1WTO A;  3OPO A;  5IP9 H;  3S2H B;  3G4S A;  5E4X A;  4A3K H;  2EY2 A;  3SK8 A;  5C4J B;  3DWA A;  4RH6 A;  3NSW A;  1AEX A;  1X3E A;  3H09 A;  3CXC A;  3I72 A;  5IWA L;  3LNN A;  5IWA Q;  2YU9 B;  1D1I A;  1RL2 A;  1MIU A;  1MSH A;  3CC4 A;  2F3W A;  5C0X J;  4NW2 A;  2QEJ C;  2H1E A;  2KEN A;  3E9H A;  3I8Z A;  4JC0 A;  1XYI A;  2DY8 A;  4R8N A;  2MP1 A;  4UP9 A;  5EBD A;  3GTJ B;  3HGB A;  4A3L G;  4X62 L;  3EQL C;  4ZKC B;  2V1C C;  1HCZ A;  1TKW B;  2Q8R E;  5EAY A;  1PFN A;  4OL7 A;  5J39 A;  4B08 A;  4HCE A;  1AE3 A;  1Y1V G;  5I9P A;  1QUQ A;  2F1M A;  4BY7 B;  1EL0 A;  5IGD A;  1X3P A;  2JA5 H;  2NVX B;  2ZTE A;  3F2D A;  1HRJ A;  5C4X B;  1TWG H;  1EYA A;  1AZP A;  1NR2 A;  1ENC A;  4JBW A;  5FOB B;  5HGT A;  1WD1 A;  4NXM L;  3MHB A;  5JJL A;  1I3Q B;  5EJW A;  1WTP A;  1HZA A;  5BR8 L;  4AYB G;  1JE5 A;  1ET6 A;  3HOY H;  4YWK A;  3MC0 B;  4IUV A;  3HKZ E;  4M1U B;  2MGS A;  4IPG A;  4UHV A;  3X3M A;  4DGZ A;  4I7Z C;  4CDE C;  3IAY A;  1M90 C;  3K0Y A;  4BBS B;  2KED A;  4WFN 3;  4QGU A;  3GTG B;  5CBA E;  3K6O A;  4JI3 Q;  2HDL A;  3T56 B;  4L6T B;  1D5M C;  5I6Y A;  2F0V A;  4JW0 A;  4X64 L;  1VQG A;  1O7I A;  2Y0S G;  1G29 1;  3CME A;  2K28 A;  1CHQ D;  3LWU A;  4A3J H;  1ZYR D;  2EOT A;  2Z9H A;  1EQV A;  3M4Q A;  2FXQ A;  1PTO D;  3TRE A;  1H9M A;  1LYL A;  2Z6K C;  5KGU A;  2JA7 H;  2R93 G;  3RZO H;  3OSO A;  4C3H G;  1MI2 A;  2X6G A;  4A3B G;  3QO2 A;  1GUG A;  4DAM A;  1PLF A;  5GAH C;  4A3G H;  1EU4 A;  5M5Y H;  4CGY B;  1PH4 A;  2NB0 A;  4JG2 A;  3H91 A;  1EYC A;  3T1H L;  2Z4H A;  3T1H Q;  2R93 B;  4IJH A;  2VNU D;  3LWE A;  1VQD A;  4KTA A;  4C3H B;  5FLX E;  1JR0 D;  2QGQ A;  1X6O A;  2Q8I B;  1HXY D;  3WWV A;  5C0X G;  1JT8 A;  2ZJR A;  4HJ7 A;  1EY9 A;  3AFQ A;  4JYA Q;  1CZW A;  1A2U A;  1KDC A;  1SEB D;  5F2D A;  2NZH A;  1PTO F;  4AH6 A;  1IKL A;  3H0G B;  4OO1 I;  1NMG A;  5JVG 3;  1HA6 A;  4K2K A;  1KL9 A;  4RWS C;  1KHI A;  3KK7 A;  1CHP D;  5E1F A;  5C4Z A;  1ZYR C;  2B2W A;  3NTI A;  5IT9 L;  1PTO C;  4PMB A;  2WV6 D;  4DK3 C;  1C48 A;  4KJO A;  1T9H A;  1HR0 W;  4LK1 C;  3R2I A;  5JJZ A;  3MXN B;  1ICW A;  1SND A;  1VF7 A;  1LT6 D;  4XDX A;  1Y8N B;  5ELE A;  2BA0 A;  4LJZ C;  3HZX A;  4PMW A;  3OTO L;  3PO2 G;  3OTO Q;  5JPM C;  2CCZ A;  1L1O A;  1Q81 C;  3DHQ A;  3EN2 A;  1IL2 A;  4YCW A;  4C3I B;  5I2Y A;  1YHA A;  2I0Q A;  3HOW H;  2GVB A;  4JI8 L;  4JI8 Q;  1LUZ A;  1SDF A;  3HOV G;  1A3U A;  1X55 A;  1JMC A;  2UXB L;  1MKH A;  2UXB Q;  3KUP A;  1STY A;  4A3E G;  1LT5 D;  3W1B A;  5M5X B;  1GUO A;  4DK6 C;  1S3O A;  4K5X A;  2NVT B;  5ELN A;  1WJJ A;  1NR4 A;  4GKK L;  1ASZ A;  1S5F D;  2DGY A;  3D0F A;  4GKK Q;  1A6X A;  4JPB W;  1DON A;  2A8V A;  1JE4 A;  1KDB A;  1YVC A;  3F2U A;  4DV3 Q;  1E3P A;  1MBY A;  2EY1 A;  3NUC A;  2B63 H;  1VF5 C;  1TXY A;  3SR1 A;  3HOX B;  5A2Q E;  1OXS C;  2A1A A;  1MJC A;  2E2D C;  2IX0 A;  4DK0 A;  4KKS A;  4DV7 L;  3CCL A;  4DV7 Q;  4BA2 I;  1IBL Q;  1EIG A;  5KND A;  2XTI A;  3TP6 A;  1IKM A;  3CF5 A;  3K7U C;  5GRO A;  4KN4 C;  4A4I A;  5T1G A;  3CCR A;  2K5D A;  1PV4 A;  2DN8 A;  3CCJ A;  4WOR A;  3Q8D A;  1EY4 A;  1JOQ A;  4JI0 Q;  1O7L A;  1LTA D;  3MVV A;  4G4K A;  3E3X A;  4L63 B;  3FP9 A;  2E75 C;  3I55 A;  4PV1 C;  5E7N A;  5IGC A;  2DJF C;  2LS0 1;  1L0W A;  3CMA A;  1E1O A;  2K5N A;  3TME A;  4JOI A;  2Z4I A;  1J8I A;  1FJG L;  2BDN A;  4OX9 L;  4LF9 Q;  2RDF A;  2KOL A;  1ZKO A;  2FHT A;  1RF2 D;  4DR6 L;  2K33 A;  4KHV A;  4DR6 Q;  1FL0 A;  2I46 A;  1G8Z D;  3I4N B;  3G6J B;  3KOJ A;  2D0O A;  2ASB A;  1FNV A;  4AYB E;  3GTP H;  3HEJ A;  4HJ8 A;  3M3Y B;  3UI2 A;  5CC4 A;  2QW7 A;  4LF4 Q;  1G2T A;  3S15 H;  4LMQ D;  3SEB A;  4EQ5 A;  1EOV A;  4DAY A;  4HJ9 A;  1WTH A;  4YHH L;  5I2X A;  4OWX B;  2Y0S E;  2F0I A;  1OXU A;  1SYC A;  3S1M B;  4BY7 H;  4XT3 B;  2Q8T A;  4A3M H;  2XNA C;  5C4X H;  2Q2T A;  1V1O A;  3M9B A;  2R92 G;  1CT1 D;  3T53 B;  4FNF A;  5I6W A;  1LAC A;  1ASY A;  2K14 A;  3AB9 A;  1BOS A;  4PMC A;  4IN3 A;  5LMU Q;  3NP8 A;  2NBF A;  3K59 A;  4A93 G;  4H44 C;  1KAW A;  2R92 B;  4Y52 H;  1B70 B;  4MZ9 A;  5IYC H;  1F77 A;  2BH8 A;  4X66 L;  3LGJ A;  3ND8 A;  3I56 A;  3DWQ A;  3T51 B;  5C4H A;  1CKN B;  1ZEQ X;  2G9H D;  1VQJ A;  5C0X I;  3CCQ A;  4O1N A;  2WAQ G;  4IQZ A;  1V1P A;  1D7Q A;  4GLX A;  1EU3 A;  4IFD H;  2KQ3 A;  2ALY B;  5JVH 3;  1PH1 A;  1STH A;  3SVM A;  2NZO A;  4JI6 Q;  3J7Z C;  1JCK B;  4GKJ L;  4LFC L;  3KLS X;  4X6A H;  3C2P A;  3NEN A;  5KYI A;  4LFC Q;  2ZTC A;  1PFS A;  4CJ0 B;  4OGQ C;  3AEV A;  5L37 A;  2E2I H;  3NHH A;  3ICE A;  5E4W C;  1PH2 A;  4H7B A;  5IYD H;  1H9R A;  1EIF A;  4GN4 B;  3J80 E;  2ZXO A;  2AKW B;  3P75 A;  1TWH B;  1G51 A;  3V96 A;  4OXP A;  4C56 C;  1JJG A;  3KF6 B;  2CW0 D;  4A3K B;  3A5Z B;  4DUZ L;  2B8G A;  1QVG A;  1WTV A;  4BBR H;  2F0O A;  4DAP A;  3DMU A;  4RCO A;  2B2W C;  2ZXP A;  5CV5 A;  5DEH A;  3NEL A;  3NBH A;  1HQM C;  2K01 A;  2VUM B;  1QIL A;  2J4X A;  3AQQ A;  4DV4 L;  1N36 L;  3K81 C;  3GTM H;  3KYH C;  2EZV A;  2HHH Q;  1G6P A;  1STG A;  5M3M G;  4O42 A;  1BQQ T;  3H3V H;  1EIY B;  4DFA A;  3EBE A;  3ZJY C;  2IPK D;  3D3R A;  3KFU A;  5HY6 A;  1PZK D;  3G7L A;  3T16 A;  2O4X A;  5KNC A;  1VQO A;  5M3F G;  4P72 A;  1E1T A;  4V0B A;  2JA5 B;  1S4Z A;  4QY7 A;  3VR2 A;  1TWG B;  1VQK A;  1N8R C;  2A5H A;  2JP1 A;  3HOY G;  4GNX A;  2QIL A;  4WJW A;  2EJF C;  1B4O A;  2K6A A;  4X3T A;  2RCF A;  1Y1W G;  1V1Q A;  1UE5 A;  4FXD A;  2JQO A;  1LO5 D;  4JK1 C;  1KC8 C;  2B2T A;  2F0U A;  2R7D A;  3RMH A;  1DGS A;  2TSS A;  4IUP A;  3W1G A;  4RHS A;  4A3F H;  3I2Z A;  2RKS A;  1AH9 A;  3SK5 A;  2XGT A;  3A8I E;  3BVG A;  2NVT H;  3GTO H;  2DY7 A;  2NN6 G;  3D31 A;  1PRT F;  5FLM G;  4A3J B;  1TQO A;  1BR9 A;  4B3S L;  1D1K A;  1X56 A;  2CFM A;  3S1R H;  3SGI A;  2ENB A;  4R4I A;  4GOP B;  2JA7 B;  1I4G A;  1BKB A;  1SE2 A;  4KHZ A;  1ENF A;  3GQB A;  3RZO B;  3HG9 A;  3W5O A;  4DNR B;  1D2B A;  4A3G B;  1YI2 A;  5M5Y B;  1I6V C;  3KF8 A;  1IBM Q;  4DNT B;  1BUV T;  2Q2I A;  4JOI C;  3S2D H;  4IOC A;  1K28 A;  4G7O C;  1Q8K A;  1IHZ A;  3U9S A;  5AJ3 L;  1RKN A;  4I7A A;  1NCV A;  1VDZ A;  2WKD A;  1XWE A;  5ELO A;  1WTW A;  4H0L C;  4R4T A;  3K5O A;  1ESR A;  3ULP A;  1C9O A;  4UPA A;  3DEP A;  1W2B A;  5JJK A;  3SK6 A;  4LNQ A;  1ROD A;  4WJ4 A;  3MXP A;  4IUT A;  2SEB D;  2H5X A;  1JJ2 A;  4O0A A;  4OIJ A;  1QNK A;  2IHE A;  5J1Z A;  2C35 B;  1OXT A;  5CMD A;  2QF7 A;  3T13 A;  3VYU A;  4EQO A;  2FIN B;  2H4O A;  3KJO A;  1EOT A;  3M3Y H;  3I4M B;  3CD6 A;  1E24 A;  1SAP A;  4RG1 A;  3G48 A;  3GTQ B;  3EVQ A;  5JEA H;  5KIX A;  3M4P A;  1D5Z C;  3A7A B;  1VQ5 A;  1F2M A;  4A3D B;  1WI5 A;  3HFZ B;  5CR3 A;  1SYE A;  2WAQ E;  1EY6 A;  2CKZ B;  2PZW A;  1U4M A;  1R4Q B;  3S1M H;  4QL5 A;  1QVF A;  2JA9 A;  4HSV A;  3J7A F;  1I5F A;  2B39 A;  3MA2 B;  2MO1 A;  5FO8 B;  2OXP A;  4LF6 L;  4LUO A;  5C44 H;  2A6E D;  1EWC A;  1TU2 B;  4NXN L;  4X65 Q;  4ID6 A;  3S1Q H;  3EJI A;  5EKK A;  3HOW B;  3HRZ C;  3I3C A;  4ME3 A;  4KI0 A;  4DV6 L;  3E6Z X;  1WVL A;  4DV6 Q;  4JVZ A;  4CJ2 C;  1TWF H;  5K36 H;  3Q23 A;  1N32 L;  1N32 Q;  2PMZ E;  4X3S A;  1V8Q A;  2EY6 A;  2EXZ A;  3C1E A;  4FF2 A;  4QIW E;  4ULL A;  4P73 A;  3V05 A;  3NTK A;  1UAP A;  4RFB A;  4KY7 A;  2FFK B;  4XQQ A;  2JA6 B;  4JI1 Q;  4NKL A;  1K9M C;  5A35 A;  3VR4 A;  1STB A;  1VQ7 A;  3BZC A;  5C5M A;  1BBX C;  1VMC A;  2B63 B;  1Z9F A;  1LTL A;  1SYG A;  4YWL A;  2F4V L;  1UEA B;  4IPC A;  2K5H A;  4KJN A;  1ICF B;  4DPG A;  4ZRZ A;  1XX8 A;  1CFM A;  4KV6 A;  1ESF A;  2P5Z X;  2JXM B;  2M2L A;  4OON A;  1Q12 A;  1PTO H;  3OIQ A;  4BWG B;  4DA2 A;  2A6E C;  3GV3 A;  3TS0 A;  1AW7 A;  3PO3 H;  3CCV A;  3CP0 A;  2L11 A;  3H94 A;  1HTP A;  5NUC A;  2UUA L;  1PMR A;  3A5U A;  5FLX L;  2UUA Q;  1CA5 A;  1AE2 A;  5D3D A;  1T5X D;  4EX5 A;  2SDF A;  4ZUI A;  3N52 A;  1B7Y B;  3OW7 A;  3FHW A;  1V43 A;  4TVA B;  2VUM H;  2B2Y A;  2EIF A;  4DF7 A;  2KHJ A;  4JV5 L;  4JV5 Q;  5T1I A;  3K80 C;  3W2D A;  3GTP B;  5J22 A;  1HTL D;  2EYJ A;  3ZYY X;  1FGU A;  2K5V A;  3IL8 A;  1EEI D;  2N49 A;  3L9A X;  4BY7 G;  3CC2 A;  3CCM A;  4B9X A;  2LKV A;  3RLO A;  4JBK A;  5C4X G;  3S15 B;  2NN6 I;  4LW1 A;  1VQM A;  1K8G A;  4X62 Q;  1HFN A;  2L55 A;  3G6E A;  3PUW A;  3UDG A;  2BH2 A;  4TSS A;  3T1Y L;  1N33 L;  1FGB D;  2F0K A;  5DAU A;  4HJA A;  3K58 A;  4A3M B;  2RVL A;  5IP7 G;  5I9O A;  3DM1 A;  1LT4 D;  3JAM E;  1KRS A;  3HOU H;  4BBS G;  4IAL A;  3TP5 A;  5D14 A;  3CHB D;  1NBW A;  4NXM Q;  1HHV A;  4KKU A;  3QOJ A;  4BS9 A;  1LTT D;  5BR8 Q;  4A3I H;  1K0S A;  2OQK A;  4DNI A;  4S3S A;  3STB C;  1PH6 A;  2DJG C;  3RN5 A;  4EGV A;  5C3W A;  2D0P A;  4H02 A;  3GP7 A;  4APV A;  3CRK C;  4X64 Q;  3TQY A;  3ERQ A;  4GN5 A;  2K5W A;  3MAQ A;  2B8F A;  1C8C A;  1GHK A;  1DJR D;  4L5T A;  3VYS A;  2RSO A;  5EPK A;  1BVS A;  1Y14 B;  1I4P A;  2UUC L;  3A74 A;  2UUC Q;  2Z8L A;  3WOF A;  2PZT A;  1AFP A;  1HPC A;  5JPN C;  1LTR D;  1U0L A;  3L7Z C;  1VMP A;  3DLL A;  1STN A;  1N34 L;  3R93 A;  2JK8 A;  1N34 Q;  3R8B A;  3E9I A;  5KYL A;  2E2I B;  1FYC A;  5A2Q L;  4U68 A;  4HSP A;  2MHV A;  2RSN A;  2KEE A;  2AUK A;  3VA5 A;  4C1N K;  1CZG A;  3BDC A;  4ME5 A;  3T4A C;  4DR5 L;  4ZKB B;  3PQI A;  3KLR A;  4ZYS A;  3H0G G;  2CVR A;  2JEB I;  5KRU A;  4BY1 H;  2NVQ B;  2L5T A;  1EYG A;  2SOB A;  4BBR B;  2QKI C;  2PW7 A;  2EYP A;  3J81 j;  4XTC S;  2QA4 A;  2RDG A;  3SK4 A;  4MN3 A;  4FXG C;  4IOA A;  1B9N A;  2MO0 A;  1AZQ A;  2EYO A;  2X69 A;  5IGG A;  1VQL A;  3GTM B;  2ID0 A;  2K50 A;  5GAG C;  2K05 A;  1HNW L;  1HNW Q;  3I4M H;  4V19 0;  4OIK A;  1SYF A;  4NPS A;  3GTQ H;  1PZI D;  2NZ1 D;  3M85 A;  2UU9 L;  1Q82 C;  1VQF A;  4A3D H;  4L5S A;  3MTS A;  1BCP B;  1AN8 A;  1NJI C;  5DM7 3;  1KNE A;  4C3I G;  4PG3 A;  3ER0 A;  3RD4 A;  2PQE A;  2UUB L;  5EPL A;  1UEB A;  1OTC A;  2CWA A;  2A74 C;  4A3F G;  1HR0 L;  3PUX A;  1YBY A;  1HJP A;  4X3K A;  1ZXT A;  1HR0 Q;  2PQA A;  4K8J A;  2D9U A;  2IY5 B;  2ICE C;  3KDF B;  3GTK H;  1TS5 A;  2I5L X;  4Y7N B;  5KEE A;  5IT9 c;  1ILQ A;  1TS4 A;  1U4L A;  2LMC B;  3OOC A;  2F03 A;  1EZ6 A;  3NE5 B;  1KDA A;  3J81 L;  1PYW D;  4A3F B;  4KHP L;  3OHX C;  4F87 A;  3DEO A;  4HTH A;  4KHP Q;  4WJ3 M;  2KVM A;  3GTO B;  2E76 C;  1PH9 A;  1YZ6 A;  1RTO A;  2PI2 A;  4IUR A;  3HS0 C;  2JA6 H;  1H95 A;  3HOX G;  4PQX A;  4DN4 M;  5ELB A;  3SDZ A;  3I91 A;  4BA1 I;  5C3E B;  5DNF A;  1Q7Y C;  4BXX G;  1UE1 A;  1DOK A;  4HCS A;  4A3C H;  3S1R B;  2L0C A;  1K8M A;  2WB1 B;  1JOK A;  2EDG A;  4R1J A;  2CH4 A;  5I4D A;  2OTL A;  1EIH A;  5EQ0 A;  5COR A;  5EGT A;  3PUY A;  4DKA C;  5IYB H;  3RNU A;  2PPB C;  4OO1 H;  3NQI A;  1B8A A;  2JEA I;  2LSS A;  4FF3 A;  3S2D B;  3S9W A;  1SJE D;  4K5W A;  3U4Z A;  4DAV A;  3GDE A;  3K0X A;  5H1S E;  3UDX A;  1CSP A;  3HP3 A;  1M8A A;  1IYV A;  3PIO 3;  2B2Y C;  3OW2 A;  1H9K A;  1RTN A;  3CAM A;  1WCM H;  3I4N G;  3J80 L;  5E3F A;  5CBE E;  5K5P A;  1LV9 A;  1PYS B;  3U9O A;  1FJG Q;  4IUU A;  4OX9 Q;  1JIC A;  4K6D A;  4DR7 L;  5JEA G;  5CV9 A;  1QJO A;  2BE5 D;  1M4V A;  1WTQ A;  3K5N A;  1L0X B;  3IKJ A;  3IRB A;  5FO9 B;  2E2H H;  1Z7T A;  2I07 B;  1BBW A;  2F0Q A;  2M9V A;  5BN3 A;  1B3A A;  2MQH A;  4YHH Q;  1GXD C;  4KD4 A;  5J3B A;  3HOZ H;  1SMX A;  1H9S B;  3PMF A;  1B44 D;  4CKB A;  4RGM A;  3V2T A;  4UDU C;  3I4L A;  5K36 G;  2AMC B;  3NPP A;  2F0G A;  5C44 B;  1PHJ A;  1EY8 A;  1C4Q A;  3J81 E;  3S1Q B;  1I50 H;  2OEO A;  5HGQ A;  1CKM A;  1TWF B;  2MUY A;  1R4P B;  1TVX A;  2L9H A;  4FO2 A;  3TN2 A;  2XWJ B;  3CU7 A;  4A3L H;  4X66 Q;  1STA A;  2KCT A;  1F9Q A;  3TSS A;  3VR6 A;  5FJ8 G;  2BDO A;  4LF7 L;  2KEC A;  3OYY A;  2DNC A;  4LF7 Q;  3W3A A;  1Y1V H;  5IOD A;  4P71 A;  2F0J A;  4KK7 A;  2BE5 C;  2OQ0 A;  2RCN A;  3ND9 A;  1BXT A;  4XQJ A;  3CQZ H;  4J6H A;  2V4D A;  3VDY A;  1WTX A;  3K8A A;  3QOL A;  4GKJ Q;  3KBX A;  1BF4 A;  2KCN A;  1EUJ A;  2E2J H;  1YNN D;  4O2D A;  2MPM A;  1EEF D;  1GOZ A;  2B2U A;  2L15 A;  5IP9 G;  3Q22 A;  4A3K G;  3UE1 A;  4Q5V A;  2R7F A;  2O2L D;  3J7A V;  1PTO B;  1SMY D;  5C6A A;  5ELD A;  2KHS A;  1YHB A;  3OWF A;  1Q3L A;  3PO3 B;  4P74 A;  4R4Q A;  4JI2 L;  1TT2 A;  2KHI A;  4PZ7 A;  4GS3 A;  2F0F A;  4B9W A;  2VUM G;  1CKO A;  3OWE B;  2A6H D;  3QIA A;  3MXN A;  4MTK A;  1JQY D;  2VB3 X;  2NVQ H;  3I70 A;  4DUZ Q;  3RZD H;  1FNU A;  1NSN S;  1A8V A;  3S24 A;  3PIO A;  1XTD A;  2L12 A;  1I94 L;  4TKO B;  1SYD A;  1I94 Q;  4F88 A;  2UXD L;  2UXD Q;  2R61 A;  4DV4 Q;  1N36 Q;  3URY A;  4HIK A;  2EYL A;  5IGF A;  2IX3 A;  1MJE A;  4B3T L;  1LTS D;  4OWW B;  1RIP A;  3BDO A;  3F2B A;  2FJ2 A;  2JA5 G;  3NXW A;  2WKC A;  4HMI A;  4FYD A;  1L1O C;  1E2W A;  4OHJ A;  1SNM A;  1PRT D;  1TY2 A;  5C0X H;  4A75 A;  3LX0 A;  3TBI B;  1YNN C;  3CC7 A;  4DR1 L;  3QJY A;  4DR1 Q;  3FKI H;  1VQA A;  1EY0 A;  2I5M X;  4UP8 A;  1W6K A;  2IJ0 A;  3NEM A;  3F2C A;  4KY6 A;  1SFO H;  1X3Q A;  4CDF C;  4LAA A;  2AUJ D;  1W3S A;  1SMY C;  3SE0 A;  3HOU B;  1JJC B;  3PGZ A;  2E8G A;  1G6Z A;  1JOR A;  3FPP A;  4FDB A;  2F0T A;  4Y7N H;  2R7Z B;  4CDD C;  4K0K L;  3D6C A;  3VYR A;  2PCF B;  4A3I B;  4K0K Q;  2A6H C;  1PH7 A;  2AQ2 B;  1XPU A;  4A3J G;  3MFG A;  4N9P A;  5IE8 A;  1CQF A;  4K6L A;  4DV2 L;  4GZY C;  4DV2 Q;  3BG3 A;  3E0E A;  2JA7 G;  1CI3 M;  1DOM A;  4C3J H;  4XYO A;  3M7G A;  2VQF L;  1GM5 A;  2ZXR A;  4A3G G;  5C3E H;  3PO2 H;  4B3S Q;  2A68 D;  4QCL A;  3QG1 A;  2UXC L;  1Z47 A;  2UXC Q;  4LUV A;  5HUR A;  4L8J A;  1PRT C;  2XSC A;  4RAU C;  3CKI B;  2O5J C;  1M1K C;  1QUQ B;  2F0P A;  2IWH A;  2HQL A;  4NP5 A;  1PH8 A;  4L5R C;  4BY1 G;  4YIJ A;  1P8L A;  1XTC D;  3TRZ A;  2XVS A;  2ZT9 C;  5AJ3 Q;  4J8Q A;  3ERS X;  1DZ1 A;  3U4V A;  2HIX A;  2JE6 I;  1SBB B;  1SE4 A;  2IT1 A;  3BU2 A;  3CW2 C;  2CQA A;  2RBM A;  2ZJP A;  1CTM A;  2CWP A;  2HQE A;  2M00 A;  4BY1 B;  2NYZ D;  4A76 A;  1J5E L;  4OEL B;  1YJN A;  1XNR L;  4QJF A;  4JI5 L;  5G3L F;  2QDL A;  1XNR Q;  2HT1 A;  4JI5 Q;  3I4M G;  2A69 D;  1U5K A;  1HNX L;  3M4Y A;  3VR3 A;  2K1B A;  3FRP B;  4A3D G;  4P2C B;  2OCE A;  1KLU D;  2F0W A;  3TP7 A;  3C3L A;  3HKZ B;  2JSO A;  2JJQ A;  1JWS D;  1TS3 A;  2PYK A;  3GV6 A;  2A68 C;  4KN7 C;  1IBK L;  3I73 A;  1IBK Q;  3L0O A;  2LXK A;  4RGT A;  1I4R A;  5EKL A;  4DUY L;  1WTR A;  4B3M L;  1CKN A;  3E0J A;  2FMC A;  4B3M Q;  3RLF A;  1BDO A;  3HOW G;  2EY5 A;  2JA8 H;  2GVA A;  1EZ8 A;  1XMQ L;  2KUM A;  2VL6 A;  3A0J A;  3H15 A;  3J80 i;  4LF6 Q;  4QB4 A;  4NXN Q;  1J9O A;  3HKS A;  3GTK B;  1ENA A;  1RDP D;  2EVB A;  1EYD A;  2KCM A;  1Y8P B;  3J7Y W;  2OWO A;  3JAM L;  4JI7 L;  4JI7 Q;  2JA6 G;  4HR7 B;  3S1N B;  4FXK C;  2WIN B;  3K7A H;  4DR4 L;  2B2V A;  1YHQ A;  1YEZ A;  1D8L A;  1PXU A;  2MFI A;  2AWN A;  1CA6 A;  4RA8 A;  3BVZ A;  1E0B A;  1Q1B A;  2EYM A;  3MXU A;  2A69 C;  2OF1 A;  3PSI A;  4YCU A;  2B63 G;  1YNJ D;  1MGS A;  3A8J E;  4FP5 D;  2R6G A;  1X3G A;  2AHO B;  3KF6 A;  1VQ6 A;  1BCP F;  5IYB G;  1QE6 A;  5CV4 A;  5JJI A;  4IFD J;  3BZD B;  2YTX A;  4DV0 L;  2B2U C;  3H3V C;  2AQ1 B;  1YIT A;  4LFB L;  4HAE A;  2WII B;  2F0M A;  3ONA B;  3K5L A;  5LL6 S;  4IPD A;  4ODG A;  4N9T A;  3P20 A;  5LHY 1;  2F4V Q;  3GO5 A;  1K73 C;  4A93 H;  2JN4 A;  1K83 H;  3E5S A;  3S16 B;  3WOE A;  2EQS A;  3R2T A;  3D4R A;  5FKA C;  1GVP A;  4UAI A;  2KCC A;  1L1O B;  2IHF A;  1CM9 A;  5FO7 B;  1SE3 A;  1IXR A;  2VXW A;  3EFX D;  1GD7 A;  1WCM B;  1HNZ L;  1HNZ Q;  3STB D;  4HJ5 A;  4NDX A;  1JWU D;  2N55 A;  4AQY L;  4AQY Q;  1B50 A;  1F9R A;  3UE0 A;  3A56 A;  2A19 A;  4DV1 L;  2EPB A;  3SHL A;  1YNJ C;  3EIV A;  2J7Z A;  3HOZ G;  3L3O C;  4ZQ3 A;  2E2H B;  2K52 A;  4A3M G;  2F0L A;  2E5L L;  5FLX c;  2A73 B;  4Z9C B;  4GNX C;  2E5L Q;  1WFQ A;  1IYJ B;  1X3F A;  3KLW A;  3Q0A A;  1Q1E A;  1VQ4 A;  1O78 A;  4GLV B;  1JOO A;  4JCV E;  4TRD A;  3HOZ B;  2B2T C;  4ILW A;  4IUN A;  3T1Y Q;  4HN7 A;  1N33 Q;  1ILP A;  4FF1 A;  1SLJ A;  2EYF A;  4E6I A;  4QF4 A;  1TS2 A;  2G9D A;  4GOP A;  5IYC G;  2PW5 A;  4LF8 L;  1F9P A;  4LF8 Q;  4R4O A;  3ULL A;  5DLQ E;  4CBV A;  1I50 B;  1A15 A;  5EPJ A;  4U67 3;  1PRT B;  5GQO A;  1VQ8 A;  3R3O A;  5M3M H;  2R7Z H;  1DD2 A;  1F2Z A;  3RLN A;  4M8A A;  1E2Z A;  4IFD G;  3TZU A;  3H6M A;  1SNQ A;  4J15 A;  1X65 A;  2CH4 W;  4G57 A;  5M3F H;  3VA7 A;  2VY3 A;  1KD1 C;  2IL8 A;  1TWC H;  1HFG A;  1CUK A;  1EQR A;  1Y1V B;  2KJX A;  1NE3 A;  4I65 A;  3U50 C;  3PIP 3;  1TR5 A;  2HDM A;  3TDQ A;  1EY7 A;  2F0H A;  2HUG A;  3CQZ B;  2K32 A;  5BN4 A;  1QZH A;  3M7N A;  1LTI D;  5D3I B;  2F0D A;  1Y1W H;  3K5M A;  3Q24 A;  1RHP A;  1FNW A;  1QB5 D;  5IYD G;  4JI3 L;  1E2V A;  3I4O A;  3MWY W;  4DAY B;  2E2J B;  1SNC A;  4AYB B;  3TEH B;  4AIM A;  1UUP A;  3MEH A;  1TWA H;  3A55 A;  5C3X A;  4YWM A;  4MIU A;  2K7V A;  1HZC A;  3AMU A;  3OMC A;  4NB3 A;  4BBR G;  1J6Q A;  2NN6 H;  1Q90 A;  4DR5 Q;  2Y0S B;  3TP8 A;  2F0E A;  5FLM H;  1VQB A;  3TZD A;  4Q0F A;  1E7Z A;  3FVQ A;  1W6J A;  3RZD B;  3U58 A;  1D5X C;  1DCZ A;  1RD9 D;  2CHB D;  4J1M A;  1VQ9 A;  4K8I A;  1NTG A;  4A3B B;  1LTG D;  1SE8 A;  1V1P B;  3TS2 A;  4C2M H;  1A62 A;  1E22 A;  1Q46 A;  1PZJ D;  1B3Q A;  4JYA L;  1YJW A;  3FKI G;  1NAP A;  1VQE A;  5JEA J;  2UU9 Q;  3D4W A;  1A63 A;  1VQI A;  4ALP A;  4MTN A;  3FKI B;  3X3N A;  3CPF A;  5IGB A;  3L2P A;  4K2L A;  5BN5 A;  1L0Y B;  2UUB Q;  2B2V C;  2BA1 A;  1SFO B;  1BBU A;  2OTJ A;  2YV5 A;  2O5I C;  3FEW X;  2EXD A;  2D62 A;  1LLR D;  2PI2 E;  4B3R L;  4B3R Q;  2DNE A;  3S1N H;  1JC7 A;  4C3J G;  1UNS A;  3BS1 A;  1LTB D;  2BOS A;  5C5L A;  3C46 A;  2F0S A;  5C3E G; 
#chains in the Genus database with same CATH homology
 1DM0 B;  1U4R A;  2NTS A;  2K5Q A;  4F8M A;  4DU9 A;  4C1N I;  3RUZ A;  4DXF A;  4C3J B;  1RCV D;  3PO2 B;  4KY5 A;  1KAB A;  1G2S A;  4H13 C;  4KKT A;  2D2C C;  1LT3 D;  1F9S A;  2K03 A;  2PZU A;  1ML0 D;  3DUZ A;  3HOV B;  3P1H A;  4XXE A;  4A3E B;  5CGK A;  2EJG C;  1H9J A;  1Y69 U;  5ELF A;  5KNB A;  3MFY A;  2WP8 J;  2LY7 A;  4WRD A;  1PFB A;  1A3T A;  1SXT A;  4RGN A;  3NWS A;  4QUF A;  3ITP A;  1QWY A;  2FMM A;  1Y8O B;  5COY A;  1PFM A;  1STE A;  2E74 C;  1Q8I A;  2PO4 A;  3D8G A;  4IFD I;  2SNS A;  1S5B D;  3NQT A;  2XWB B;  1B9M A;  5CV8 A;  1B53 A;  2XRQ D;  3D4D A;  4QUC A;  1VCI A;  2JA8 B;  1CQV A;  5IT9 E;  5JOB A;  2GA4 B;  1F2L A;  1OXX K;  1RJT A;  4DXG A;  5DM6 3;  1S5C D;  4RKL A;  3WDN A;  3FMC A;  4XYQ A;  3M4O B;  1IW7 D;  1TII D;  3C1F A;  1KTK A;  3K7A B;  2L4N A;  4RKB A;  1II3 A;  3BYT B;  4ZLT F;  3AU7 A;  1DOL A;  2AWO A;  2ICI A;  1EQT A;  5LL6 X;  2F3V A;  1B1Z A;  1CK1 A;  3PV0 A;  3BYY B;  4DK1 A;  3SXH A;  2RA4 A;  3NK9 A;  4XIG S;  4MHE A;  2AQ3 B;  2QCP X;  1KLG D;  3BVM A;  2N88 A;  3VR5 A;  1A3V A;  2EJM A;  2YYZ A;  4X3U A;  3OMG A;  4A93 B;  1NUC A;  2Z1C A;  1I6H B;  1D6E C;  4FF4 A;  1K83 B;  3QB3 A;  3A7L A;  4EQN A;  5AFW A;  3GTL B;  4EQP A;  4PNY A;  5FK9 C;  2WAQ B;  2OT2 A;  1IL8 A;  4IZ8 A;  3S14 B;  1WD0 A;  2BCO A;  4NMZ A;  4G7Z C;  4FVM A;  2J0T D;  1SSO A;  3O13 A;  1IW7 C;  2K04 A;  2C9O A;  3P7J A;  4ZUJ A;  1T5E A;  4RGO S;  1HA5 A;  2JYO A;  4QMG A;  4CKE A;  5IGE A;  3CRL C;  2PMZ B;  1G91 A;  2HCI A;  2VB2 X;  4QIW B;  5EBC A;  3OIP A;  2X6L A;  1K8O A;  3D6W A;  1F2Y A;  3MZ5 A;  1A2T A;  1LAB A;  1SYB A;  3KLS A;  1S5E D;  2IX1 A;  4CKC A;  3IFD A;  1GUN A;  3DXJ C;  2QDB A;  5M9O A;  3NWT A;  1S5D D;  1QNU A;  2PNR C;  5M3M B;  1I4Q A;  3PUV A;  2XIW A;  2D5D A;  1HUM A;  5M3F B;  1DXM A;  1O80 A;  1BO0 A;  1TWC B;  1KNA A;  1QG7 A;  4G7H C;  1XXG A;  5G3L D;  2CW0 C;  3HOY B;  3BDL A;  2HCC A;  2RDH A;  2KA7 A;  1Y1W B;  4RCN A;  4CJ1 B;  1MSG A;  3IFT A;  5CV7 A;  1HQR D;  4TQU S;  1TWA B;  1U4P A;  1JB3 A;  1O7Y A;  1I4H A;  1HUN A;  2NWG A;  4KMU C;  1GJX A;  1ET9 A;  4IUQ A;  1O7Z A;  4XQN A;  1EWH A;  1Z6H A;  5TSS A;  1H9S A;  4K5V A;  5JAV A;  3Q6S A;  3PUZ A;  3A8K E;  3K57 A;  3NTH A;  5D65 A;  1EFI D;  1EY5 A;  4C2M B;  1MD2 D;  1SNP A;  1B2T A;  1QOH A;  1SNO A;  2TMP A;  2LFN A;  3I90 A;  3VYT A;  2R3Z A;  5IOC A;  1BCP D;  3A54 A;  2IW3 A;  3GD7 A;  1OXV A;  5IIF A;  1FD7 D;  1FR3 A;  1IYU A;  4R8I A;  3N6R A;  1GUS A;  5CV6 A;  1KAA A;  4ZK9 B;  2XRS D;  2NUC A;  5CYU A;  1X32 A;  3FPU B;  3MXG A;  3NBI A;  1QCB D;  2RQX A;  2XN9 C;  5ELC A;  2C5C A;  1GUW A;  1OO9 B;  1TY0 A;  3ERO A;  4OO1 G;  2NTT A;  4HED A;  2SNM A;  2L1B A;  4XT1 B;  2NVY B;  2EYH A;  1GUT A;  5M5W B;  1DYQ A;  1BCP C;  4ZAI A;  4RHR A;  1JWM D;  2EE1 A;  3KBG A;  3QWN A;  4KD3 A;  4CHT B;  3S17 B;  2MJ8 A;  3EA6 A;  2F0N A;  1ONL A;  1GHJ A;  1SJH D;  2WAC A;  3DWP A;  4K14 A;  1BNZ A;  4R9W A;  2F4I A;  1U9R A;  5ISR A;  4EVO A;  1R9T B;  4ABN A;  1AP0 A;  4HMJ A;  5EKI A;  3FDT A;  4F7X A;  1I4X A;  1PDQ A;  1WTO A;  3OPO A;  3S2H B;  5E4X A;  2EY2 A;  3SK8 A;  5C4J B;  3DWA A;  4RH6 A;  3NSW A;  1AEX A;  3H09 A;  3I72 A;  3LNN A;  2YU9 B;  1D1I A;  1MSH A;  2F3W A;  5C0X J;  4NW2 A;  2QEJ C;  2H1E A;  3I8Z A;  1XYI A;  2DY8 A;  4R8N A;  2MP1 A;  5EBD A;  3GTJ B;  3HGB A;  3EQL C;  4ZKC B;  1HCZ A;  1TKW B;  2Q8R E;  1PFN A;  4OL7 A;  5J39 A;  4B08 A;  4HCE A;  5I9P A;  2F1M A;  4BY7 B;  1EL0 A;  5IGD A;  1X3P A;  2NVX B;  1HRJ A;  5C4X B;  1EYA A;  1AZP A;  1NR2 A;  1ENC A;  4JBW A;  5FOB B;  5HGT A;  1WD1 A;  3MHB A;  1I3Q B;  5EJW A;  1WTP A;  1ET6 A;  3MC0 B;  4IUV A;  4M1U B;  2MGS A;  3X3M A;  4DGZ A;  4I7Z C;  3IAY A;  4BBS B;  3K0Y A;  2KED A;  4WFN 3;  3GTG B;  5CBA E;  3K6O A;  2HDL A;  3T56 B;  4L6T B;  1D5M C;  5I6Y A;  2F0V A;  1G29 1;  2K28 A;  1CHQ D;  3LWU A;  1ZYR D;  2EOT A;  1EQV A;  1PTO D;  1H9M A;  5KGU A;  4C3H G;  3OSO A;  1MI2 A;  2X6G A;  3QO2 A;  1GUG A;  1PLF A;  1EU4 A;  4CGY B;  2NB0 A;  3H91 A;  1EYC A;  2Z4H A;  2R93 B;  2VNU D;  3LWE A;  4KTA A;  4C3H B;  5FLX E;  1JR0 D;  2Q8I B;  1HXY D;  5C0X G;  1EY9 A;  1CZW A;  1A2U A;  1KDC A;  1SEB D;  5F2D A;  1PTO F;  1IKL A;  3H0G B;  4OO1 I;  5JVG 3;  1HA6 A;  4K2K A;  4RWS C;  3KK7 A;  1CHP D;  5E1F A;  5C4Z A;  1ZYR C;  2B2W A;  3NTI A;  5IT9 L;  1PTO C;  4PMB A;  2WV6 D;  1C48 A;  4KJO A;  4LK1 C;  3R2I A;  5JJZ A;  1ICW A;  1SND A;  1VF7 A;  1LT6 D;  4XDX A;  1Y8N B;  5ELE A;  2BA0 A;  4LJZ C;  3HZX A;  4PMW A;  5JPM C;  3DHQ A;  4C3I B;  5I2Y A;  1SDF A;  1A3U A;  3KUP A;  1STY A;  1LT5 D;  5M5X B;  1GUO A;  4K5X A;  2NVT B;  1NR4 A;  1S5F D;  1A6X A;  1DON A;  1JE4 A;  1KDB A;  3F2U A;  1MBY A;  2EY1 A;  3NUC A;  1VF5 C;  3SR1 A;  3HOX B;  5A2Q E;  1OXS C;  2E2D C;  2IX0 A;  4DK0 A;  4KKS A;  4BA2 I;  1EIG A;  5KND A;  3TP6 A;  1IKM A;  4KN4 C;  5T1G A;  2K5D A;  2DN8 A;  4WOR A;  1EY4 A;  1JOQ A;  1O7L A;  1LTA D;  3MVV A;  4G4K A;  4L63 B;  2E75 C;  4PV1 C;  5IGC A;  2LS0 1;  3TME A;  2Z4I A;  1J8I A;  2BDN A;  2RDF A;  2KOL A;  1ZKO A;  2FHT A;  1RF2 D;  2K33 A;  4KHV A;  2I46 A;  1G8Z D;  3I4N B;  3G6J B;  1FNV A;  3HEJ A;  3M3Y B;  3UI2 A;  5CC4 A;  1G2T A;  4LMQ D;  3SEB A;  4DAY A;  5I2X A;  2F0I A;  1OXU A;  1SYC A;  3S1M B;  4XT3 B;  2Q8T A;  2XNA C;  1V1O A;  1CT1 D;  3T53 B;  4FNF A;  5I6W A;  1LAC A;  3AB9 A;  1BOS A;  4PMC A;  4IN3 A;  3NP8 A;  2NBF A;  3K59 A;  4H44 C;  2R92 B;  1F77 A;  3ND8 A;  3DWQ A;  3T51 B;  5C4H A;  1ZEQ X;  2G9H D;  5C0X I;  4O1N A;  4IQZ A;  1V1P A;  1EU3 A;  4IFD H;  2KQ3 A;  5JVH 3;  1STH A;  3SVM A;  1JCK B;  3KLS X;  3C2P A;  5KYI A;  4CJ0 B;  4OGQ C;  3NHH A;  5E4W C;  4H7B A;  1H9R A;  3J80 E;  2ZXO A;  3P75 A;  1TWH B;  3V96 A;  4C56 C;  2CW0 D;  4A3K B;  2B8G A;  1WTV A;  2F0O A;  4DAP A;  3DMU A;  4RCO A;  2B2W C;  2ZXP A;  5CV5 A;  5DEH A;  3NBH A;  1HQM C;  2K01 A;  2VUM B;  1QIL A;  2J4X A;  2EZV A;  1STG A;  4O42 A;  1BQQ T;  4DFA A;  2IPK D;  3D3R A;  1PZK D;  3G7L A;  3T16 A;  2O4X A;  5KNC A;  4V0B A;  2JA5 B;  1S4Z A;  3VR2 A;  1TWG B;  2A5H A;  2JP1 A;  2QIL A;  4WJW A;  2EJF C;  1B4O A;  2K6A A;  4X3T A;  4FXD A;  1LO5 D;  4JK1 C;  2B2T A;  2F0U A;  3RMH A;  2TSS A;  4IUP A;  4RHS A;  2RKS A;  3SK5 A;  3BVG A;  3A8I E;  2DY7 A;  2NN6 G;  3D31 A;  1PRT F;  4A3J B;  1TQO A;  1BR9 A;  1D1K A;  2ENB A;  2JA7 B;  1I4G A;  1SE2 A;  4KHZ A;  1ENF A;  3GQB A;  3RZO B;  3HG9 A;  4DNR B;  1D2B A;  4A3G B;  5M5Y B;  1I6V C;  3KF8 A;  4DNT B;  1BUV T;  4G7O C;  1IHZ A;  3U9S A;  1RKN A;  1NCV A;  1VDZ A;  2WKD A;  1XWE A;  1WTW A;  4H0L C;  3K5O A;  1ESR A;  3DEP A;  3SK6 A;  1ROD A;  3MXP A;  4IUT A;  2SEB D;  4OIJ A;  1QNK A;  5J1Z A;  1OXT A;  5CMD A;  2QF7 A;  3T13 A;  3VYU A;  4EQO A;  2FIN B;  2H4O A;  1EOT A;  3I4M B;  1SAP A;  3GTQ B;  3EVQ A;  5JEA H;  5KIX A;  1D5Z C;  3A7A B;  1F2M A;  4A3D B;  5CR3 A;  1SYE A;  1EY6 A;  2PZW A;  1U4M A;  1R4Q B;  4HSV A;  3J7A F;  2B39 A;  3MA2 B;  5FO8 B;  2OXP A;  2A6E D;  1EWC A;  1TU2 B;  4ID6 A;  3EJI A;  5EKK A;  3HOW B;  3HRZ C;  3I3C A;  4KI0 A;  3E6Z X;  1WVL A;  4CJ2 C;  5K36 H;  3Q23 A;  4X3S A;  1V8Q A;  2EY6 A;  2EXZ A;  3C1E A;  4FF2 A;  4ULL A;  3V05 A;  3NTK A;  1UAP A;  4RFB A;  4KY7 A;  2FFK B;  4XQQ A;  2JA6 B;  4NKL A;  5A35 A;  3VR4 A;  1STB A;  5C5M A;  1BBX C;  1VMC A;  2B63 B;  1SYG A;  1UEA B;  4KJN A;  4ZRZ A;  1XX8 A;  1CFM A;  4KV6 A;  1ESF A;  2JXM B;  2M2L A;  1Q12 A;  1PTO H;  3OIQ A;  4BWG B;  4DA2 A;  2A6E C;  3GV3 A;  1AW7 A;  2L11 A;  3H94 A;  1HTP A;  5NUC A;  1PMR A;  5FLX L;  1CA5 A;  5D3D A;  1T5X D;  2SDF A;  4ZUI A;  3N52 A;  3OW7 A;  1V43 A;  2B2Y A;  4DF7 A;  5T1I A;  3W2D A;  3GTP B;  5J22 A;  1HTL D;  2EYJ A;  3ZYY X;  3IL8 A;  1EEI D;  3L9A X;  4B9X A;  2LKV A;  3S15 B;  2NN6 I;  1HFN A;  2L55 A;  3PUW A;  4TSS A;  1FGB D;  2F0K A;  5DAU A;  3K58 A;  4A3M B;  2RVL A;  5I9O A;  3DM1 A;  1LT4 D;  3JAM E;  4IAL A;  3TP5 A;  5D14 A;  3CHB D;  1HHV A;  4KKU A;  3QOJ A;  4BS9 A;  1LTT D;  4S3S A;  4EGV A;  5C3W A;  3GP7 A;  3CRK C;  3ERQ A;  2K5W A;  3MAQ A;  2B8F A;  1C8C A;  1GHK A;  1DJR D;  3VYS A;  2RSO A;  5EPK A;  1I4P A;  2Z8L A;  3WOF A;  2PZT A;  1AFP A;  1HPC A;  5JPN C;  1LTR D;  3L7Z C;  1VMP A;  1STN A;  3R93 A;  3R8B A;  2E2I B;  5KYL A;  1FYC A;  5A2Q L;  4U68 A;  4HSP A;  2MHV A;  2RSN A;  2KEE A;  2AUK A;  3VA5 A;  4C1N K;  1CZG A;  3BDC A;  4ME5 A;  3T4A C;  4ZKB B;  3KLR A;  4ZYS A;  2CVR A;  2JEB I;  5KRU A;  2NVQ B;  2L5T A;  2SOB A;  4BBR B;  2QKI C;  2PW7 A;  2EYP A;  4XTC S;  2RDG A;  3SK4 A;  4MN3 A;  4FXG C;  1B9N A;  1AZQ A;  2EYO A;  2X69 A;  5IGG A;  3GTM B;  2ID0 A;  2K05 A;  4V19 0;  4OIK A;  1SYF A;  1PZI D;  2NZ1 D;  3M85 A;  3MTS A;  1BCP B;  1AN8 A;  5DM7 3;  1KNE A;  4C3I G;  3RD4 A;  2PQE A;  5EPL A;  2A74 C;  3PUX A;  4X3K A;  1ZXT A;  4K8J A;  2D9U A;  2ICE C;  1TS5 A;  4Y7N B;  5KEE A;  1ILQ A;  1TS4 A;  1U4L A;  2LMC B;  3OOC A;  2F03 A;  1EZ6 A;  3NE5 B;  1KDA A;  3J81 L;  1PYW D;  4A3F B;  3OHX C;  4F87 A;  3DEO A;  4HTH A;  2KVM A;  3GTO B;  2E76 C;  1RTO A;  4IUR A;  3HS0 C;  4PQX A;  4DN4 M;  5ELB A;  3SDZ A;  3I91 A;  4BA1 I;  5C3E B;  5DNF A;  1DOK A;  4HCS A;  3S1R B;  2L0C A;  1K8M A;  2WB1 B;  1JOK A;  2EDG A;  5I4D A;  1EIH A;  5EQ0 A;  5COR A;  5EGT A;  3PUY A;  2PPB C;  4OO1 H;  3NQI A;  2JEA I;  4FF3 A;  3S2D B;  3S9W A;  1SJE D;  4K5W A;  4DAV A;  3HP3 A;  1M8A A;  1IYV A;  3PIO 3;  2B2Y C;  1H9K A;  1RTN A;  3J80 L;  5E3F A;  5CBE E;  5K5P A;  1LV9 A;  3U9O A;  4IUU A;  1JIC A;  4K6D A;  5JEA G;  5CV9 A;  1QJO A;  2BE5 D;  1M4V A;  1WTQ A;  3K5N A;  1L0X B;  3IKJ A;  5FO9 B;  1Z7T A;  2I07 B;  2F0Q A;  2M9V A;  5BN3 A;  1B3A A;  1GXD C;  4KD4 A;  1H9S B;  3PMF A;  1B44 D;  4CKB A;  4RGM A;  3V2T A;  4UDU C;  3I4L A;  5K36 G;  3NPP A;  2F0G A;  5C44 B;  1EY8 A;  1C4Q A;  3J81 E;  3S1Q B;  2OEO A;  1TWF B;  2MUY A;  1R4P B;  1TVX A;  2L9H A;  4FO2 A;  3TN2 A;  2XWJ B;  3CU7 A;  1STA A;  1F9Q A;  3TSS A;  3VR6 A;  2BDO A;  2KEC A;  2DNC A;  3W3A A;  5IOD A;  2F0J A;  4KK7 A;  2BE5 C;  3ND9 A;  1BXT A;  4XQJ A;  4J6H A;  2V4D A;  1WTX A;  3QOL A;  3KBX A;  1BF4 A;  2KCN A;  1YNN D;  2MPM A;  1EEF D;  1GOZ A;  2B2U A;  3Q22 A;  4Q5V A;  2O2L D;  3J7A V;  1PTO B;  1SMY D;  5C6A A;  5ELD A;  2KHS A;  3OWF A;  1Q3L A;  3PO3 B;  1TT2 A;  2F0F A;  4B9W A;  3OWE B;  2A6H D;  3QIA A;  3MXN A;  1JQY D;  2VB3 X;  3I70 A;  1FNU A;  1NSN S;  2L12 A;  4TKO B;  1SYD A;  4F88 A;  2R61 A;  3URY A;  2EYL A;  5IGF A;  2IX3 A;  1LTS D;  3BDO A;  2FJ2 A;  3NXW A;  2WKC A;  4HMI A;  4FYD A;  1E2W A;  4OHJ A;  1SNM A;  1PRT D;  1TY2 A;  5C0X H;  3LX0 A;  3TBI B;  1YNN C;  3QJY A;  1EY0 A;  1W6K A;  2IJ0 A;  4KY6 A;  1X3Q A;  4LAA A;  2AUJ D;  1SMY C;  3SE0 A;  3HOU B;  1G6Z A;  1JOR A;  3FPP A;  2F0T A;  2R7Z B;  3D6C A;  3VYR A;  2PCF B;  4A3I B;  2A6H C;  2AQ2 B;  3MFG A;  4N9P A;  1CQF A;  4K6L A;  4GZY C;  3BG3 A;  1CI3 M;  1DOM A;  4XYO A;  3M7G A;  2ZXR A;  2A68 D;  4QCL A;  3QG1 A;  1Z47 A;  5HUR A;  4L8J A;  1PRT C;  2XSC A;  4RAU C;  3CKI B;  2O5J C;  2F0P A;  2IWH A;  4NP5 A;  4YIJ A;  1XTC D;  2XVS A;  2ZT9 C;  4J8Q A;  1DZ1 A;  2JE6 I;  1SBB B;  1SE4 A;  2IT1 A;  2CQA A;  2RBM A;  1CTM A;  2HQE A;  2M00 A;  4BY1 B;  2NYZ D;  5G3L F;  2A69 D;  3M4Y A;  3VR3 A;  2K1B A;  3FRP B;  4P2C B;  1KLU D;  2F0W A;  3TP7 A;  3C3L A;  3HKZ B;  2JSO A;  1JWS D;  1TS3 A;  2PYK A;  3GV6 A;  2A68 C;  4KN7 C;  3I73 A;  4RGT A;  1I4R A;  5EKL A;  1WTR A;  3E0J A;  2FMC A;  3RLF A;  1BDO A;  2EY5 A;  1EZ8 A;  2KUM A;  4QB4 A;  1J9O A;  3GTK B;  1ENA A;  1RDP D;  2EVB A;  1EYD A;  1Y8P B;  3J7Y W;  3JAM L;  4HR7 B;  3S1N B;  4FXK C;  2WIN B;  2B2V A;  1PXU A;  2AWN A;  1CA6 A;  4RA8 A;  3BVZ A;  1E0B A;  1Q1B A;  2EYM A;  3MXU A;  2A69 C;  2OF1 A;  1YNJ D;  1MGS A;  3A8J E;  4FP5 D;  2R6G A;  1BCP F;  1QE6 A;  5CV4 A;  4IFD J;  3BZD B;  3H3V C;  2B2U C;  2AQ1 B;  4HAE A;  2WII B;  2F0M A;  3ONA B;  3K5L A;  5LL6 S;  4ODG A;  4N9T A;  3P20 A;  5LHY 1;  3GO5 A;  3E5S A;  3S16 B;  3WOE A;  3R2T A;  3D4R A;  5FKA C;  4UAI A;  2KCC A;  1CM9 A;  5FO7 B;  1SE3 A;  2VXW A;  3EFX D;  1WCM B;  4NDX A;  1JWU D;  2N55 A;  1B50 A;  1F9R A;  3A56 A;  2EPB A;  3SHL A;  1YNJ C;  2J7Z A;  3L3O C;  4ZQ3 A;  2E2H B;  2F0L A;  2A73 B;  4Z9C B;  3Q0A A;  1Q1E A;  1O78 A;  1JOO A;  4TRD A;  3HOZ B;  2B2T C;  4ILW A;  4IUN A;  4HN7 A;  1ILP A;  4FF1 A;  2EYF A;  4E6I A;  4QF4 A;  1TS2 A;  2G9D A;  2PW5 A;  1F9P A;  4CBV A;  1I50 B;  1A15 A;  5EPJ A;  4U67 3;  1PRT B;  3R3O A;  1DD2 A;  1F2Z A;  4M8A A;  1E2Z A;  4IFD G;  3TZU A;  3H6M A;  1SNQ A;  4G57 A;  3VA7 A;  2IL8 A;  1HFG A;  1Y1V B;  2KJX A;  4I65 A;  3PIP 3;  1TR5 A;  2HDM A;  3TDQ A;  1EY7 A;  2F0H A;  2HUG A;  3CQZ B;  2K32 A;  5BN4 A;  3M7N A;  1LTI D;  5D3I B;  2F0D A;  3K5M A;  3Q24 A;  1RHP A;  1FNW A;  1QB5 D;  1E2V A;  3MWY W;  2E2J B;  1SNC A;  4AYB B;  1UUP A;  3MEH A;  3A55 A;  5C3X A;  4MIU A;  2K7V A;  3AMU A;  3OMC A;  2NN6 H;  1Q90 A;  2Y0S B;  3TP8 A;  2F0E A;  3TZD A;  4Q0F A;  3FVQ A;  1W6J A;  3RZD B;  1D5X C;  1DCZ A;  1RD9 D;  2CHB D;  4J1M A;  4K8I A;  4A3B B;  1LTG D;  1V1P B;  1PZJ D;  1NAP A;  5JEA J;  3D4W A;  3FKI B;  3X3N A;  5IGB A;  4K2L A;  5BN5 A;  1L0Y B;  2B2V C;  2BA1 A;  1SFO B;  2O5I C;  3FEW X;  2D62 A;  1LLR D;  2DNE A;  1JC7 A;  4C3J G;  1UNS A;  3BS1 A;  1LTB D;  2BOS A;  5C5L A;  3C46 A;  2F0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...