2JA8H

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja8H00
1V9PA 2K4KA 4GKJL 4DK3C 1VQDA 5IT9c 3GD7A 1PH3A 4GLVB 1DGSA 4JI0Q 3GTPH 3TQYA 3OTOL 4GOPA 4DR7Q 2B63H 3S1QH 2R93G 1VQIA 4GNXA 2N8NA 2PI2A 2E8GA 1B7YB 1A62A 2HHHL 4DV6L 2JA8H 1VQ6A 3OW2A 1EUJA 2OQ0A 4QJFA 3J80i 3CXCA 2R93H 1EOVA 2N78A 1XMQL 4X64L 3PUYA 1HH2P 1KD1C 3I4MG 4B3MQ 4DV7Q 4A3MH 3CMEA 2ES2A 5IYBG 1IBKQ 1S72A 4B3RQ 1N34Q 1PH8A 3DLLA 3CPFA 2WP8J 3CF5A 2NVXH 2R7FA 2Z6KA 1OXSC 3FKIH 1TWGH 4X6AH 1PH2A 3PUVA 3U58A 1B70B 1HR0L 4IOAA 4NXNL 4IJHA 4JOIA 4TQUS 2ZTDA 3HOXH 3ER0A 2D0PA 2K75A 1PYBA 4A3EH 4DV3L 2R92H 4JG2A 1M90C 3S16H 1SROA 4X65L 3KJPA 1EIYB 2VQFQ 2UXDL 2R7DA 4TVAB 4LF9Q 2A1AA 5JJLA 1I50H 2B29A 4OWXB 4X62Q 3HOZG 4LW1A 1WOCA 4LF4L 2VQEL 1UWVA 4A3FG 4MNOA 3TREA 2E2JH 4OX9L 2UU9Q 4RMFA 1SN8A 2YV5A 4C2MH 1TXYA 4AYBG 3CC2A 1CSPA 1Q7YC 2UXCL 1XMOQ 2CQOA 1PHJA 1IXRA 1VQ8A 4GNXC 4B3SQ 1VQGA 5JJIA 5C0XG 3CC7A 3DM3A 4A3KG 4LFAL 1PH7A 4A3LG 1NMFA 2K5VA 1YZ6A 2VL6A 2K5HA 3CP0A 3HFZB 5FJ8G 3JC66 2QA4A 4DUZQ 4DV0Q 3T1YQ 2ZTEA 4JV5L 4IPDA 5M3MH 5C44G 4UY8C 5EAYA 2F4VQ 4A3LH 1UE1A 3I7FA 2JA5G 1IBLL 1VQPA 1VQNA 3U4VA 1FL0A 1IL2A 5GADC 1EFWA 2R7ZG 1BKBA 5C44H 4NXML 4A3BG 4KLKA 4R4OA 1Y1VH 2KCMA 3CCVA 4OXPA 2RHSB 4IPCA 1FVIA 3S1RH 2PI2E 2JA5H 2Q2IA 3M85A 1C9OA 2UUBL 4JBMA 4JI6Q 1A0IA 4R1JA 5IYDG 4LF7L 3PIOA 2R7ZH 1YHAA 2EIFA 4IPGA 4LFCL 5JEAJ 4A3BH 1KRSA 3HOWG 4DNIA 4KI0A 1Q81C 2IY5B 2JE6I 2V1CC 3K80C 3E9IA 4BBRH 4QGUA 2FXQA 1E1TA 1KL9A 1C7YA 2ALYB 4B3TQ 3S2DH 1VQLA 1XNRL 3HOWH 4A3CG 3UE1A 1E22A 1HNZL 2NVTH 1K3RA 1P16A 5C3EH 2N3SA 2A8VA 2WB1G 2GN5A 4DR6L 1E1OA 3W5OA 3PO3G 1KQSA 3HKZE 4DR2L 2VS1A 1X9NA 3KOJA 4LNQA 5J3BA 1QVGA 3CPWA 4POGA 1XTDA 3F2DA 1TWCH 2VUMG 4LF6Q 4DPGA 3RLFA 1Q46A 3G6EA 1AE2A 2GVBA 3B6YA 3G48A 3GTQH 1JMCA 1BVSA 1JJ2A 3PIPA 1GM5A 4R4TA 4YWKA 4KHPL 1N8RC 1K83H 2KENA 5AJ3L 5IYCG 1HZCA 2Q2HA 4L5QA 4PZ8A 3JAMi 4HIKA 4HIOA 3M4QA 1VQEA 1WI5A 1PH6A 5IP7H 3AQQA 4JI2Q 4JYAL 1KHIA 2UXCQ 2I5MX 5C4JH 1W2BA 3KF6B 4IO9A 3M3YH 1ASYA 2YTVA 2CFMA 5H1SE 3TEHB 3GTMH 5IYCH 1L2FA 4DV2L 4JI7Q 2BH2A 4X66Q 4OO1G 4YCVA 1PYSB 4YY3L 4JI4L 4LF5L 4DV5Q 2A19A 2R92G 2I5LX 3J80c 3TS0A 3CC4A 2JA7H 3S17H 4YCUA 1L1OB 1NE3A 1Y1WG 4IJLA 1OXXK 2PNHA 4AQYL 3F8TA 3CCJA 1XNQQ 3CCQA 2UXBL 1TWHH 3M4PA 2E5LQ 3MXNB 2ZTCA 4A3MG 1K8AC 5IWAQ 2YTXA 3BJUA 4JI1L 4MTNA 5BR8L 3I56A 3RN5A 2NN6I 1YI2A 1K8GA 3KF6A 2CWPA 4X65Q 2VY3A 3S15H 1Y1WH 1NBWA 5LMUL 1VQHA 3FKIG 4LUVA 3HKZG 3GTGH 2UXDQ 4UP7A 2VNUD 5M5YH 3J81j 1GD7A 1G291 2EXDA 4XIGS 3PGZA 4LF8Q 1I94Q 1A8VA 1E3PA 3CAMA 4LF4Q 5M3FG 2VQEQ 3HOXG 3S1MH 1S3OA 1YITA 4BBSH 2MO1A 5FLMH 1L1OA 3ULPA 4A3EG 4JBKA 2ZJQA 3BZCA 3K7UC 3PF5A 4JC0A 3G4SA 4DUYQ 5M3FH 3HOVH 1LM0A 3PCOB 4JI5L 4ME3A 4LUZA 3I2ZA 1YEZA 2WAQE 1OXTA 4HJ7A 2DUDA 2QGQA 3U50C 1VS0A 1PH1A 5IP9G 1RIPA 1JT8A 3ULJA 2BH8A 3FHWA 3KLWA 4L5TA 3NENA 2JA6H 2ASBA 1PVOA 3RZOH 1N32Q 2IX1A 4ALPA 5GQOA 1HNXQ 1X54A 4POFA 1GO3E 1NY4A 2XGTA 2Y0SE 5IP9H 3J7ZC 5IE8A 4AIMA 4JI0L 2NZHA 2UUAQ 4DR7L 4A3JG 4GOPC 1MJEA 1LTLA 1EYGA 4P71A 4JCVE 5M3MG 4DV4Q 1QUQB 1Z9FA 1VQOA 4OX9Q 3L7ZC 2D62A 1V1QA 3PSIA 1PFSA 5GAGC 2NZOA 5E7NA 1CSQA 1KIXA 4QY7A 3H15A 2I5HA 4A3JH 1IZ6A 4LFBQ 1RL2A 4YHHQ 3A5UA 4DV1Q 4B3ML 1G51A 1K0RA 1MKHA 3A5ZB 4DV7L 4HIDA 1T9HA 4A3DH 1Y1VG 1N36Q 1IBKL 4B3RL 1N34L 4JI3Q 4IOCA 4QL5A 4DR1L 1OXVA 3M7NA 1L1OC 2OTLA 2Z6KC 1QVCA 1GKHA 1E24A 4DAYB 4DR6Q 1CUKA 1YHBA 4RG1A 1VQJA 3NBHB 1X6OA 2KHIA 4LF9L 1JJGA 1IBMQ 4JOIC 4PZ7A 4XTCS 5LMNQ 4BA2I 2UUCL 4WJ4A 4P74A 1KXLA 3PUXA 5M5WH 1SE8A 5ELNA 2DGYA 3U4ZA 4BBRG 4DR3Q 3E0EA 1SLJA 1U5KA 4UP9A 1J5EQ 1ASZA 2BA0A 3VDYA 2RCNA 2HHHQ 3A0JA 1JE5A 1HNWQ 3BU2A 2VQFL 1UE7A 3HOUH 3D31A 5C3EG 1W3SA 4C3HH 4DR5Q 4PG3A 2CCZA 2LXKA 4X62L 1I3QH 2VW9A 4GKKQ 3GO5A 3K81C 1KC8C 5DLQE 3CCLA 2Q2TA 3CCRA 3MEFA 1I5FA 4P73A 2AMCB 1UEBA 2VZAA 2GVAA 3IRBA 4EQ5A 4J15A 3S24A 4EX5A 4DR4Q 2K52A 3CMAA 3JAMc 5K36G 3F2BA 1XJVA 4GKJQ 2E2HH 2D0OA 1X65A 3AYHB 2JA8G 2NVYH 3EN2A 3OTOQ 3T1YL 4DV0L 5IP7G 2K5NA 4IFDJ 3CQZH 1VQ5A 1WCMH 1FJGL 4AH6A 1R9TH 1CKNB 1EIFA 1E7ZA 1MJCA 2F4VL 2NVQH 1KAWA 4JBJA 4DV6Q 1O7IA 3ERSX 1U0LA 4GN3B 5LMUQ 3TRZA 4P75A 2OCEA 1XMQQ 4L5SA 4X64Q 1HZ9A 4OWWB 1P8LA 2JA7G 4BXXH 3UDFA 3S1NH 3GTJH 2B3GA 1X3EA 1XPUA 2LXJA 2XTIA 3OYYA 3S14H 5HGQA 1N9WA 3K0XA 4QIWE 1Q1BA 1NMGA 3CCEA 1VQFA 2OQKA 2Z0SA 1YJNA 2N49A 1IYJB 1HR0Q 4P72A 4IPHA 2RF4A 4NXNQ 1CKNA 1JJCB 2CWAA 2IX0A 3NELA 1EQQA 4JI5Q 3K7AH 3I4OA 1PH9A 4GNXB 2AHOB 3E9HA 1UE5A 4DV3Q 3SGIA 4UPAA 3CCUA 4B3TL 5GROA 3J7A5 3AFPA 3CW2C 3I4NG 4BBSG 5FLMG 3I55A 2KCTA 3J81i 1SR3A 3T1HL 2YYZA 1CKOA 3PUWA 4GS3A 4GLXA 2JA9A 4WJ3M 3NEMA 4A75A 4PZ6A 3PF4A 3M4OH 3STBC 3HOVG 2L15A 2PMZE 4R4IA 3L2PA 4HIMA 4DAMA 2JEBI 3I4NH 4Y7NH 3HOZH 4K0KL 2HT1A 1BBWA 5LMNW 4LF6L 3HOYH 4IFDI 1Q8KA 3FP9A 3PO2H 2WFWA 3UDXA 1K73C 2MFIA 4AYBE 3L0OA 1X3FA 4NPSA 4UP8A 1Q82C 4LFAQ 1N33L 2JA6G 1TWFH 2I0QA 4JI2L 4JV5Q 4JI8L 1B8AA 1UE6A 4C3JH 1YBYA 2JEAI 1NTGA 2MNAA 4R4CA 4R4QA 1XPOA 3CD6A 5FLXc 4JBWA 1L0WA 1PH4A 1SMXA 2ZM6L 1QVFA 4OO1I 3STBD 3M9BA 4JI7L 4X66L 3KDFB 2ZJPA 3ICEA 3KFUA 4Y52H 2F3IA 1IBLQ 4DR1Q 1Q12A 4DV5L 2ZJRA 1YNXA 4BY1G 4HJ9A 1SRUA 1YVCA 4H02A 1VQCA 3I4MH 4NXMQ 2AKWB 4YWMA 5IYBH 2OTJA 1QZHA 2MO0A 2UUCQ 2C35B 4KHZA 2HIXA 1XNQL 3H3VH 2E5LL 2E2IH 2Q2UA 2BA1A 2UUBQ 2ATWA 1HZBA 1MIUA 1HJPA 4O0AA 5IWAL 3RN2A 4BY1H 3UDGA 4A3DG 3PUZA 3A74A 5C0XJ 1NJIC 1VCIA 4LF7Q 4LFCQ 1X3GA 4L5RC 1GVPA 4HJ5A 1FGUA 2IT1A 3GTOH 4OONA 1LUZA 1M1KC 3KDFA 3GDEA 5IY0A 4LUOA 1I94L 4LF8L 3Q8DA 2R6GA 1S40A 3H3VI 1XNRQ 1YIJA 1N33Q 4FDBA 1HNZQ 2JJQA 4BA1I 1PH5A 1WFQA 1YJWA 1YHQA 2IHEA 1H95A 1V43A 2PQAB 4DR2Q 1QUQA 3F2CA 4DUYL 2WB1E 2WAQG 4NB3A 3KJOA 1QZGA 4A3FH 1HR0W 3HOUG 3CCMA 1VQ7A 2JK8A 3RZDH 4A3IG 2MQHA 1SFOH 2CKZB 2KHJA 3PV0A 1JB7A 1VQKA 4A4IA 3ZJYC 4DK6C 1FJGQ 5C4XG 2YTYA 1J6QA 4KHPQ 3RNUA 5GAHC 1G6PA 4DKAC 4A3IH 3WWVA 5AJ3Q 1HZAA 1EQRA 4YCWA 2AWOA 4A3KH 2Y0SG 5FJ8H 1N32L 3KYHC 3TS2A 4JYAQ 1HNXL 3RR5A 5C4XH 1A63A 1PV4A 3CCSA 1YJ9A 2UU9L 2PQAA 2UUAL 3KF8B 1OXUA 1WCMG 2KBNA 4OWTB 3W1BA 3HKSA 2HQLA 3RLNA 4YY3Q 4DV2Q 4DV4L 2AWNA 1XMOL 4JI4Q 4LF5Q 4B3SL 5C0XI 3LGJA 2QEXA 5JEAG 2ID0A 4DUZL 4A76A 3GTKH 1CKMA 3W1GA 3K8AA 4LFBL 5HY6A 4AQYQ 3S2HH 1WJJA 4YHHL 1Z47A 1VQMA 4DV1L 2UXBQ 2K14A 4GLAC 3D0FA 4GN5A 4APVA 4GN4B 5BR8Q 2LSSA 4JI1Q 1N36L 4HJ8A 4BXXG 5IYDH 2HIVA 3AFQA 4JI3L 2NN6G 1AE3A 1KRTA 1PA6A 3T1HQ 1OTCA 2IHFA 1I6HH 3G71A 1K9MC 1D7QA 4C3IH 4A93G 2JQOA 2EQSA 1WYDA 4YWLA 4PMWA 1LYLA 1IBML 1AH9A 1TWAH 3BZKA 4O2DA 5LMNL 1EWIA 4BY7G 2F52A 1Q86C 4A3CH 4K0KQ 4QQBX 3H0GG 4DR3L 4JI6L 3EIVA 1X56A 1J5EL 4IFDG 3J81c 1C0AA 4A93H 3PO3H 1VQ4A 2OWOA 4A3GG 1HNWL 4GOPB 3EBEA 3F1ZA 4DR5L 5M5XH 4BY7H 3H0GH 2VUMH 3UE0A 3ULLA 1X55A 3AEVA 1D8LA 1VQAA 2K50A 4JI8Q 4GKKL 5GAEC 1XPRA 2YU9H 4A3GH 1Y14B 1BBUA 1Q1EA 3RLOA 4HJAA 1VQ9A 3HOYG 3PO2G 2RHQB 1VQBA 4LWCA 2ZM6Q 2B63G 3GTLH 2H5XA 4MZ9A 4DR4L 5JJKA 3UDIA 5ELOA
chains in the Genus database with same CATH superfamily
1SMYD 4GKJL 5BN5A 3GD7A 5FOBB 1K28A 3GTPH 3DHQA 4FP5D 2EY2A 4OO1H 3S1MB 2PYKA 2N8NA 4ZYSA 1BBXC 4J6HA 1F9PA 2EE1A 4DV6L 1VQ6A 2K03A 2OF1A 3J80i 2R93H 1EOVA 2N78A 3EA6A 4X64L 3PUYA 3I4MG 3DMUA 5IYBG 1N34Q 3CPFA 2IJ0A 3DEPA 1TWGH 4NKLA 4X6AH 1HR0L 3TN2A 1M8AA 2JA6B 2QW7A 2EJFC 2MGSA 4TQUS 5JPMC 3SVMA 4RWSC 3M4YA 3K5LA 3OIPA 2D0PA 2K75A 4K2KA 4JG2A 1R4QB 1U4PA 1M90C 3S16H 2HCIA 3KJPA 4QMGA 4RAUC 1XX8A 5JJLA 3MA2B 4OWXB 4LF4L 2VQEL 4A3JB 1UWVA 4A3FG 1Y8OB 2YV5A 3OOCA 1ENCA 3BG3A 3GV6A 1Q7YC 1PHJA 2KOLA 5KIXA 3J7YW 1GOZA 2DY7A 2WKCA 3HFZB 4ZK9B 1KLGD 3JC66 2XWJB 2ZTEA 4IPDA 4DAVA 2F0EA 2RSNA 5ISRA 5M3MH 3V05A 1SE2A 1GUWA 4A3LH 1UE1A 3D6CA 3I7FA 3HRZC 1EU3A 4KY6A 2F3WA 5GADC 5C44H 4NXML 1Y1VH 4XYQA 4PV1C 1FNUA 1HXYD 5KNBA 1C9OA 1A0IA 4R1JA 3SR1A 1YHAA 1KRSA 3HOWG 4RCNA 4DNIA 1FNWA 2V1CC 4C3IG 2KEDA 1JE4A 2NVYB 2A5HA 1HTLD 1XNRL 2JN4A 1K3RA 5C3EH 3MXGA 2A8VA 3W5OA 1EQVA 1KQSA 2FFKB 1WTQA 2DNCA 1LT5D 3S1NB 1AE2A 3J81E 5FO8B 1JMCA 1BVSA 3S14B 3SK6A 2R3ZA 1E2WA 1NR4A 2F0JA 4HIKA 1PLFA 5IYCG 1HZCA 1N33Q 1EZ6A 4L5QA 1PH6A 4HIOA 4ULLA 4JYAL 4UHVA 2I5MX 3KF6B 3E5SA 1IKLA 2YTVA 3TEHB 4OO1G 4JI7Q 2BH2A 4LF5L 2L1BA 1FYCA 2VB2X 2JA7H 1EWCA 1QILA 4AQYL 4G7ZC 1XNQQ 1TWHH 2E5LQ 1K8AC 2R92H 1HPCA 3I56A 3BJUA 4IALA 4MTNA 1NNXA 2EYOA 2NN6I 3S15H 1HFGA 2VY3A 1B3QA 1Y1WH 5LMUL 3GTGH 2UXDQ 4UP7A 2L12A 3PGZA 5CBEE 2A69C 3IKJA 4DK1A 1XWEA 2MO1A 2HCCA 2ZJQA 3K7UC 5DM63 1HQMC 4R8NA 2M9VA 3HOVH 5J39A 1LM0A 1I4HA 1TQOA 3Q24A 1YEZA 2WAQE 1CT1D 1OXTA 1K0SA 4QIWB 2IWHA 2EY1A 5IP9G 1RIPA 2A73B 3MTSA 2K6AA 4M1UB 4WORA 2PW7A 3D6WA 1PVOA 1F9SA 2IX1A 1W6KA 2XGTA 4JI0L 5IE8A 2P5ZX 4FF4A 2UUAQ 1LTLA 4P71A 4JCVE 5M3MG 4HMIA 1VQOA 1GUSA 1STNA 1PFSA 1CSQA 4KY5A 3HOZB 4PNYA 2VB3X 2ICEC 4U673 1RL2A 4XQQA 4YHHQ 3RZDB 4X3TA 1K0RA 4DV7L 3IAYA 3EQLC 1J8IA 1T9HA 3I72A 1Y1VG 1N36Q 1TY0A 4A3DH 4HSVA 1CQVA 1SYCA 4IOCA 1RTOA 2EOTA 2XVSA 3M7NA 1G2TA 4FVMA 1E24A 3JAML 1YHBA 2RDHA 3NBHB 2MHVA 1JJGA 5IGGA 4WJ4A 5LMNQ 4RCOA 3J7AF 3PUXA 5M5WH 2NTTA 2WACA 1UEAB 1SDFA 1SLJA 2RCNA 1BCPB 2VQFL 3D31A 5C3EG 1W3SA 4C3HH 1D6EC 1I3QH 4CDCC 3K81C 1KC8C 5CR3A 2F4IA 5DLQE 1EYDA 4N8X1 3NHHA 2K5DA 2GVAA 3LWUA 3J81L 1XJVA 2D0OA 3RD4A 3AYHB 4TSSA 3EN2A 2FMMA 1WCMH 1CQFA 2Z6BA 1HRJA 5A2QE 1F2MA 1MJCA 3PIP3 1GUTA 4OEMB 5I4DA 4JBJA 4HAEA 4A93B 1NSNS 1O7IA 3ERSX 2XIWA 3NTIA 4BY7B 1HZ9A 2JA7G 3MHBA 2VUMB 2QCPX 2KVMA 2LXJA 1E0BA 2XTIA 3BZDB 2CHBD 5HGQA 2Z4HA 1B2TA 2L55A 1VQFA 1ICFB 4P72A 4DF7A 3NELA 3VR2A 4H0LC 3OMGA 1U4LA 4RHSA 3I4OA 1BOSA 1ENAA 4GNXB 3E9HA 1UE5A 4U68A 3CW2C 4IURA 3J81i 4RGOS 2HDLA 1EY8A 4CDFC 4A75A 4PZ6A 3M4OH 3STBC 3RUZA 1E2VA 1MBYA 1RD9D 2F0FA 2L15A 2M2LA 2PMZE 1AEXA 4DNRB 4DAMA 2JEBI 2NUCA 3L2PA 1BBWA 4A3MB 3FP9A 4C3JG 4K6DA 4FF3A 3CHBD 3ND9A 1H9MA 4DNTB 5CORA 3FKIB 5D65A 3L0OA 2NWGA 3MZ5A 4UP8A 1Q82C 3ONAB 2K28A 1TWFH 3FPPA 4JI8L 1B8AA 1UE6A 1YNND 2JEAI 2UXCL 4R4CA 5G3LD 1PH4A 1GXDC 1SYBA 2Q8TA 1SMXA 4OO1I 4DU9A 4X66L 3KFUA 1KDCA 4WFN3 4DR1Q 1YNXA 4BY1G 4HJ9A 4H02A 4WJWA 4CBVA 3A8JE 1PTOH 2UUCQ 3T56B 2OXPA 1HZBA 1HJPA 4O0AA 3RN2A 4A3DG 3A74A 2NTSA 4HJ5A 1FGUA 3GTOH 2KCCA 4OONA 5D3IB 4DXFA 5IY0A 5CC4A 1ILQA 2R6GA 1S40A 2KQ3A 1FNVA 1FGBD 3V2TA 4HN7A 2K33A 4BA1I 1PH5A 4FXGC 1YHQA 1T5XD 1SJHD 5M9OA 2PQAB 5I6WA 4DR2Q 5CV8A 4J8QA 1VQ7A 5I6YA 3TP5A 1SFOH 4FYDA 2O5JC 5JVG3 3S1RB 2B2YA 1J6QA 4Q0FA 1SYGA 3QOJA 2Q8IB 4QCLA 4A3IH 4A3KH 3WWVA 1HZAA 1EQRA 2AWOA 3FDTA 3QWNA 4A3BB 2PNRC 1HNXL 4S3SA 5C4XH 1A63A 1YJ9A 4LAAA 2C9OA 1OXUA 1WCMG 3W1BA 4DV2Q 3GTMH 4DV4L 1VF7A 1BF4A 1KDBA 5A2QL 1CA5A 2A68C 4LFBL 3S2HH 1WJJA 1VQMA 1L0XB 1PRTD 1TWCB 3SK5A 4GLAC 4KMUC 4APVA 5BR8Q 4JI1Q 3T51B 3SHLA 5IYDH 1SE4A 4MN3A 3TDQA 3K6OA 4B9WA 3T1HQ 5IGBA 1PA6A 4IZ8A 3G71A 2DJFC 2F0SA 1D7QA 1S5CD 2CW0D 2JA8B 2AUKA 1AH9A 1ESRA 4MTKA 2F52A 1QJOA 1EWHA 3H0GG 3M3YB 1HCZA 1J5EL 3VYTA 4A3GG 1HNWL 3EBEA 1Y8PB 1IW7C 1F2YA 3UE0A 2K5QA 3ULLA 2F0MA 1LV9A 3FMCA 1VQAA 2K50A 2K32A 4UDUC 5I9PA 1EFID 1Y14B 3RLOA 1VQBA 5ELOA 2B63G 3GTLH 5JJKA 5DEHA 3T53B 1V9PA 2K4KA 4DK3C 1XYIA 3VYRA 5IT9E 5IT9c 1PH3A 5M5YB 4GLVB 3TQYA 3OTOL 4DR7Q 3S1QH 4BBSB 2K05A 2E8GA 3ERQA 3BVMA 2OQ0A 4QJFA 5E1FA 3CXCA 5M3FB 3QO2A 1B1ZA 1XMQL 2J7ZA 1HH2P 5E3FA 1IBKQ 1E2ZA 1VDZA 2K1BA 1PH8A 1AZPA 3CF5A 2NVXH 2R7FA 1PH2A 5TSSA 4NXNL 5J22A 3RZOB 2ZTDA 1ZYRC 3HOXH 1LO5D 2K7VA 1H9SB 1NCVA 1WTVA 1PYBA 4A3EH 3TBIB 2F0WA 4X65L 1SNCA 1KAAA 2FHTA 4HTHA 4TVAB 1LT6D 4LF9Q 1DOMA 1WOCA 5KNDA 1JR0D 3TREA 2E2JH 3MAQA 5C5MA 2UU9Q 4RMFA 1SN8A 4C2MH 1RJTA 4AYBG 1CSPA 1XMOQ 1VQ8A 1BQQT 1VQGA 2PO4A 5JJIA 3DM3A 4A3KG 1PH7A 1NMFA 2K5VA 2VL6A 3NSWA 2K5HA 4DUZQ 2QA4A 3T1YQ 4DV0Q 4C1NI 4G57A 4NW2A 1F2LA 3LNNA 5EAYA 1DYQA 1PRTC 1DD2A 5NUCA 2JA5G 1IBLL 2WAQB 1VQPA 3HOUB 2DNEA 3HEJA 1FL0A 1IL2A 2MUYA 3OWEB 2R7ZG 1BKBA 4KLKA 3CCVA 2IX3A 2CW0C 2KUMA 2RHSB 1FVIA 1CHQD 2PI2E 2Q8RE 1ZKOA 3M85A 1GUGA 2V4DA 4JI6Q 5D14A 5IYDG 4LF7L 3PIOA 4LFCL 2EIFA 5C6AA 2F0UA 5ELEA 2IY5B 2JE6I 4QGUA 1KL9A 3CQZB 2ALYB 3WDNA 2EZVA 3HOWH 1R9TB 3G6JB 1HNZL 2NVTH 1P16A 1I4XA 1EY6A 1UNSA 2WB1G 4DR6L 4M8AA 1E1OA 1SYEA 4EGVA 3HKZE 2VS1A 4LNQA 3KOJA 3C1FA 4ZUJA 4POGA 4RKLA 4ZQ3A 2EDGA 3ZYYX 1XTDA 3B6YA 2GVBA 3GTJB 3GTQH 4IQZA 5IGEA 4KHPL 3QIAA 4GZYC 1CTMA 5AJ3L 4JK1C 2Q2HA 1DONA 4DFAA 1WI5A 5IP7H 3AQQA 2XWBB 1W2BA 2B8FA 4HSPA 1S4ZA 4IUUA 1ASYA 2CFMA 5H1SE 5IYCH 1L2FA 4YY3L 4OGQC 4JI4L 4KJNA 3R93A 2A19A 3I8ZA 4DV5Q 3HOVG 2I5LX 3TS0A 5DM73 1SNQA 1L1OB 1EL0A 2TSSA 1QB5D 4IJLA 1OXXK 3I4NB 3F8TA 3CCJA 2UXBL 4Y7NB 3M4PA 3MXNB 2ZTCA 1TS2A 4CJ1B 1YI2A 1SBBB 3KF6A 3S9WA 1NBWA 2EPBA 4LUVA 1G291 3VA5A 1I94Q 3NPPA 4LF4Q 2VQEQ 3HOXG 2HUGA 3R2IA 3VA7A 3A7LA 5FLMH 4CJ0B 4A3EG 4ODGA 4CDDC 2LKVA 3PF5A 4JC0A 3G4SA 4V190 2ICIA 4JI5L 2BDNA 3I4MB 2RCFA 1HUMA 3VR3A 3GV3A 2DUDA 2QGQA 1Q90A 3U50C 1KNAA 5KYIA 2E2IB 1JT8A 4K5WA 1DM0B 1KLUD 2BH8A 3KLWA 4L5TA 2A69D 1O7YA 1FR3A 4POFA 3WOEA 1GO3E 3CRKC 4R8IA 5IP9H 2NZHA 4KN4C 4A3JG 4IUQA 5I2XA 4OX9Q 5F2DA 2H4OA 4RH6A 2NZOA 5E7NA 2PMZB 2DY8A 1KIXA 2F0KA 4A3FB 3KLSA 2KCNA 4HIDA 2L9HA 1FD7D 4OL7A 1N34L 4JI3Q 1T5EA 4QL5A 5IOCA 1L1OC 4X3SA 4RFBA 2OTLA 2CQAA 1SYFA 1B53A 1IBMQ 4PZ7A 4XTCS 4P74A 4NDXA 2DGYA 1ASZA 1EZ8A 4H13C 4UP9A 3VDYA 2LS01 1G6ZA 1UE7A 1ENFA 4DR5Q 4G7OC 2CCZA 3BDOA 5FO9B 2VW9A 4GKKQ 2RSOA 1RF2D 2I07B 2XRSD 3CCLA 3NBHA 1I5FA 2VZAA 5FKAC 1JWUD 4E6IA 4DR4Q 4EQ5A 4EX5A 3CMAA 3JAMc 4DAPA 5K36G 2E2HH 4C3IB 1STBA 1GJXA 2KJXA 5CV7A 5IP7G 2L5TA 1TWAB 4QUFA 1CKNB 1E7ZA 2SOBA 1AFPA 2NVQH 1JQYD 1C48A 1KAWA 1I4PA 2EYPA 2K01A 2QDBA 5DNFA 5LMUQ 4P75A 1A3TA 3VR5A 4OWWB 3K5OA 2B3GA 1X3EA 1XPUA 3OYYA 3R8BA 2YU9B 1EQTA 3NWTA 5IIFA 1YJNA 2Z0SA 5C3XA 1CZGA 2N49A 3IFTA 4IPHA 2EYLA 1LTID 3K7AH 1Y69U 5C5LA 2JYOA 3GTPB 4DV3Q 3CCUA 1DZ1A 1AP0A 3AFPA 2AUJD 5FLMG 1STHA 1CKOA 4GS3A 3QR8A 1LTTD 2F03A 2R93B 4R4IA 4HIMA 4OHJA 2J0TD 3HOYH 2TMPA 1F9QA 1Q8KA 2PPBC 3PO2H 3BS1A 2MFIA 4AYBE 1MD2D 4PMBA 1CI3M 5JOBA 1TWGB 4NPSA 4LFAQ 1N33L 1K8OA 1HFNA 2I0QA 4JV5Q 4C3JH 4R4QA 3V96A 3CD6A 1KNEA 5FLXc 1X3QA 1L0WA 3AB9A 5KYLA 3STBD 3M9BA 4JI7L 3KDFB 3ICEA 3S16B 4Y52H 4ZKBB 4XXEA 1Q12A 2HD3A 1SRUA 2WINB 5HURA 2XNAC 1PFBA 3QJYA 2G9DA 2AKWB 4YWMA 2OTJA 4PMCA 4KHZA 1XNQL 2HIXA 5CV5A 2E5LL 1A2TA 4LJZC 2UUBQ 4BY1H 3T16A 3UDGA 2B2TC 1A3UA 1BDOA 4X3KA 3SK4A 1STGA 2X69A 1WTXA 2IT1A 1M1KC 4LUOA 2A6EC 1TS4A 3NTKA 3H3VI 4OIJA 2SDFA 2FJ2A 5M3MB 3X3MA 1WFQA 1YJWA 3C2PA 2IHEA 1PTOF 1QZGA 2MJ8A 1QUQA 2KEEA 2WB1E 5J1ZA 1HR0W 1VF5C 2OEOA 2SNMA 1JORA 2CKZB 2KHJA 5C44B 1LLRD 1Y1VB 1JB7A 1VQKA 3ZJYC 4DK6C 3RNUA 3OW7A 4YCWA 2Y0SG 3Q22A 2BCOA 3TS2A 1EYCA 1S5BD 3RR5A 1ESFA 2PQAA 5HGTA 4XYOA 4RGTA 2UUAL 3VYSA 1LT4D 3BVGA 3RLNA 1BNZA 4B3SL 5C3EB 4B9XA 3H94A 3GTKH 4HEDA 4ZKCB 1G2SA 1SAPA 5HY6A 4YHHL 2G9HD 4GN5A 1F9RA 4GN4B 1N36L 3AFQA 5CMDA 1AN8A 4N9PA 1I6HH 4IUNA 4TKOB 1K9MC 4A93G 1NAPA 5EQ0A 4TRDA 4YWLA 1SSOA 5LMNL 4O2DA 4BY7G 3SDZA 4IFDG 4FF1A 2A68D 3PO3H 1JWMD 2OWOA 4GOPB 1MI2A 2NZ1D 5M5XH 3H0GH 2JA7B 1D8LA 4JI8Q 5GAEC 4CHTB 4A3GH 3HG9A 1TWHB 1Q1EA 3HOYG 2R92B 3PO2G 2X6GA 1IHZA 3S15B 5C4HA 1Y1WB 2PW5A 3GTGB 4CKCA 1QNUA 1VQDA 2JXMB 1DGSA 1W6JA 3W2DA 2B63H 2DJGC 1BCPC 1Q3LA 1IW7D 1KDAA 1TU2B 2IPKD 3RMHA 3HKZB 1B7YB 2B39A 2OT2A 2HHHL 4ILWA 2EYJA 1EUJA 3TP8A 3HOVB 4IUPA 4B3MQ 3EVQA 4UAIA 2ES2A 4B3RQ 3HP3A 3OIQA 2QDLA 2Z6KA 1OXSC 4IN3A 3TSSA 1ML0D 3U58A 1DOKA 3I70A 3ER0A 5LL6X 4CGYB 3PMFA 5CBAE 1AZQA 5JPNC 2A1AA 1I50H 5K5PA 2NYZD 3K5MA 1PZID 2B29A 4X62Q 1MSHA 1F77A 4A3DB 5EBDA 1TXYA 3CC2A 1Q8IA 1ZYRD 3ITPA 4V0BA 2CQOA 1IXRA 5T1IA 4GNXC 1PZJD 1TS5A 5C0XG 3CC7A 2E2DC 1YZ6A 1B9MA 1CHPD 3U9OA 2Z1CA 1YNJC 5M5WB 1I4GA 1V1OA 3K0YA 2F4VQ 5ELBA 1MSGA 2EYFA 1QWYA 1VQNA 3U4VA 4C3HB 1EFWA 1JWSD 4FF2A 4A3BG 4R4OA 5KEEA 2KCMA 4OXPA 1I3QB 2B8GA 2JA5H 1EY7A 5EPJA 5IGFA 3AEVA 2R7ZH 4IPGA 4KI0A 1Q81C 4FO2A 4BBRH 3J7AV 2AQ2B 1EEID 2FXQA 3S2DH 4B3TQ 1RDPD 1WCMB 1PMRA 3A56A 3DM1A 1PZKD 1Y8NB 3TMEA 1VQLA 3UE1A 1LTGD 2NB0A 3PO3G 1B9NA 4DR2L 1DCZA 2E75C 1X9NA 3TZDA 3E3XA 3F2DA 4XT3B 4LF6Q 4DPGA 3RLFA 4LMQD 1HHVA 4I7ZC 1D1IA 1GM5A 4PQXA 4R4TA 4YWKA 1J9OA 1K83H 1N8RC 2KENA 3N52A 3MXPA 3M4QA 1U4RA 4JI2Q 1QE6A 1MHWC 5C4JH 4L63B 3TP7A 4IO9A 2QF7A 2BDOA 4O1NA 3SXHA 4DV2L 3MC0B 3BVZA 1PYSB 1I4QA 2F3VA 3Q0AA 5JAVA 1WTHA 3J80c 3S17H 1NE3A 1Z7TA 3TP6A 3M4OB 2PNHA 3CCQA 1EEFD 4JI1L 5IWAQ 5BR8L 2MPMA 1CZWA 1KABA 1K8GA 2CWPA 3KLRA 4X65Q 2B2WA 2Z8LA 1LT3D 4DXGA 1VQHA 2VNUD 2J4XA 3LWEA 2BOSA 1TWFB 4LF8Q 3HS0C 5M3FG 1JCKB 3S1MH 1S3OA 1SEBD 1D5XC 2K04A 3ULPA 1L1OA 4JBKA 4XT1B 3BZCA 3MXNA 4XQJA 4DUYQ 2NBFA 3PCOB 2EXZA 1G91A 1JB3A 2CH4A 3I2ZA 4LUZA 4HJ7A 1PTOB 3SK8A 1PH1A 3A54A 3DEOA 1O7ZA 5IODA 3FHWA 2JA6H 1N32Q 4ALPA 5GQOA 1X54A 1NY4A 1TS3A 2Y0SE 4X3UA 3GTOB 4AIMA 1C4QA 4DR7L 1EYGA 1Z9FA 3L7ZC 3LX0A 3PSIA 1V1QA 2HDMA 2F0VA 2EJMA 4ZAIA 2I5HA 3H15A 4A3JH 1IZ6A 3L9AX 3MVVA 3A5UA 3HGBA 4DV1Q 1SFOB 1MKHA 3DUZA 2H1EA 1IBKL 4AYBB 1ET6A 5EPLA 2F0GA 2Z6KC 2XRQD 1GKHA 2EYMA 4DAYB 4A3IB 1CUKA 4A3KB 4DR6Q 4FXDA 3OMCA 1X6OA 2KHIA 4BA2I 5C4XB 1KXLA 3FVQA 4DR3Q 3U4ZA 4BBRG 3E0EA 1NR2A 3SE0A 1JE5A 3GTMB 3PIO3 3BU2A 3MEHA 2PQEA 1O7LA 4PG3A 1HQRD 2LXKA 3FRPB 3MWYW 4G4KA 3GO5A 5KRUA 3S2HB 3CCRA 3MEFA 2RVLA 3D4RA 2AMCB 3T4AC 1UEBA 4DGZA 3IRBA 3S24A 1X3PA 3VR6A 4GKJQ 4N8FA 2NVYH 3T1YL 4DV0L 2K5NA 1VQ5A 1FJGL 3NTHA 4RGMA 4AH6A 5K36H 2D2CC 1KTKA 2WB1B 5JEAH 2F0OA 1TIID 4DV6Q 2WIIB 4K5VA 1U0LA 1IL8A 2OCEA 4X64Q 1V8QA 3DXJC 3KBXA 3EFXD 5BN4A 5IT9L 3S1NH 1PFMA 5JVH3 3S14H 1ILPA 1NMGA 2WKDA 3CCEA 2B2VC 4K14A 1IYJB 4OIKA 1HR0Q 3GTLB 2RF4A 1U4MA 1CKNA 2CWAA 2IX0A 3O13A 5CV6A 1EOTA 4JI5Q 4DA2A 4KKSA 1PH9A 4YIJA 2B2TA 4UPAA 3S1QB 1ZEQX 3I4NG 1JOKA 3GQBA 4ZRZA 3D3RA 2YYZA 4GLXA 2JA9A 3NEMA 4QUCA 2O4XA 4K0KL 1B4OA 2FMCA 1B50A 1HA5A 2B2UA 1HUNA 1JOOA 1SNOA 3E6ZX 1K73C 4EVOA 2NVXB 1K8MA 3NXWA 1OO9B 2JA6G 3HOXB 1NTGA 2MNAA 4RGNA 1HA6A 4A3EB 4JBWA 2A74C 1O80A 2ZM6L 3MXUA 1GHJA 2ZJPA 4DV5L 2ZJRA 4RHRA 3NP8A 4NXMQ 4HCSA 5LHY1 1QZHA 2C35B 2E2JB 1BUVT 1G8ZD 4CJ2C 2BA1A 2ATWA 1MIUA 4C2MB 3PUZA 1NJIC 1X3GA 4L5RC 2B2WC 1D5ZC 4MIUA 1LUZA 2F0HA 3KDFA 3GDEA 1I94L 1UAPA 1TVXA 3AU7A 4K8JA 2ZXRA 4C56C 1XNRQ 2JJQA 1LTSD 2R61A 3KK7A 1V43A 3HOZH 1L0YB 4NB3A 3KJOA 3RZDH 2MQHA 3PV0A 4A4IA 2EVBA 2RQXA 3I73A 1STEA 1PFNA 2BE5C 1G6PA 2A6HD 2A6ED 3VYUA 2L0CA 4DKAC 5FJ8H 1X32A 2ZXPA 3KYHC 4JYAQ 4Q5VA 1D5MC 4JVZA 2PZTA 1PV4A 4I65A 2AQ1B 4G7HC 2F1MA 3KF8B 3KLSX 4EQNA 2KBNA 4OWTB 4L5SA 3HKSA 4OX9L 3HOWB 3JAME 2AWNA 4LF5Q 2NVTB 1GUNA 3MFYA 5JEAG 3OWFA 2ID0A 3H3VC 1S5ED 2L4NA 4WRDA 3P20A 4AQYQ 2K14A 4RKBA 3D0FA 4NP5A 5G3LF 2WV6D 3QOLA 3DWQA 3GTQB 2HIVA 2RDFA 4JI3L 2Z4IA 1QOHA 3A55A 1OTCA 3NUCA 4ABNA 1WTOA 1A3VA 5EBCA 2JQOA 1V1PB 2EQSA 4DN4M 1WYDA 1IBML 4O42A 3BZKA 1EWIA 4L6TB 3IFDA 1WTPA 4A3CH 1SMYC 3EIVA 3W3AA 1X56A 1EIHA 3Q23A 3J81c 4A93H 1H9KA 3NQIA 1VQ4A 4DR5L 3K57A 4BY7H 1UUPA 2SEBD 2VUMH 4KY7A 1VMCA 4IFDH 4GKKL 1B44D 2M00A 4HJAA 1VQ9A 4CDEC 1DXMA 3GP7A 4LWCA 3SEBA 4MZ9A 4DR4L 3UDIA 2I46A 1H9JA 4KKUA 1S5DD 4JI0Q 3KBGA 4GOPA 3FEWX 1TT2A 3MFGA 2R93G 1VQIA 4GNXA 2JP1A 2PI2A 3D4DA 1A62A 1SNPA 3OW2A 4BWGB 4F7XA 3QB3A 5FLXE 2LFNA 1KD1C 4DV7Q 1RCVD 4A3MH 4KN7C 3CMEA 2F0IA 1S72A 3DLLA 1SE3A 2WP8J 1RODA 3FKIH 2QILA 5KNCA 3PUVA 4IOAA 1B70B 1BCPD 4IJHA 4JOIA 3PQIA 4F8MA 3IL8A 1EYAA 4EQOA 4DV3L 1NUCA 3HZXA 1PRTF 2PZUA 1SROA 2FINB 1EIYB 1A15A 2VQFQ 2UXDL 2R7DA 1MGSA 2A6HC 2G5DA 3HOZG 4K6LA 4LW1A 4MNOA 2C5CA 1QG7A 3OSOA 1A2UA 1ET9A 2B2UC 4ZUIA 4JPBW 4F87A 4KHVA 5EKIA 4B3SQ 1IYVA 4A3LG 4LFAL 1R4PB 5FJ8G 1PXUA 3CP0A 4JV5L 2KA7A 3VR4A 4KK7A 5C44G 4UY8C 2QKIC 5C0XH 3URYA 4QB4A 4JW0A 1CFMA 2N55A 1WVLA 4IPCA 1SNMA 3L3OC 4KD4A 3R2TA 3S1RH 1EIGA 2Q2IA 2UUBL 4JBMA 1CK1A 3KUPA 2AQ3B 1PYWD 1EY5A 5JEAJ 2Y0SB 4A3BH 5FK9C 1YNJD 1RTNA 4J1MA 2E2HB 2XSCA 3K80C 3E9IA 1E1TA 1ONLA 4HMJA 1JOQA 1C7YA 2O5IC 1WTRA 4A3CG 1E22A 3TZUA 4L8JA 1TY2A 2N3SA 3U9SA 2NVQB 2GN5A 2EY5A 4KD3A 3Q6SA 1M4VA 5J3BA 1QVGA 1QNKA 3CPWA 4CKBA 2EY6A 1TWCH 2VUMG 1Q46A 3G6EA 1B3AA 3G48A 4K2LA 5CGKA 1JJ2A 3PIPA 1AW7A 1EY9A 5IGDA 2HHHQ 2Q2UA 3JAMi 4PZ8A 2JA8H 1BR9A 1VQEA 1KHIA 2UXCQ 5EPKA 1SXTA 3K7AB 3M3YH 2KHSA 4ID6A 2L11A 5FO7B 4H7BA 4X66Q 4YCVA 2R92G 3CC4A 2JSOA 3K58A 4YCUA 5KGUA 1Y1WG 4XDXA 5AFWA 3HOYB 4A3MG 2YTXA 3FPUB 3RN5A 5IGCA 3PO2B 5FLXL 3R3OA 5EKKA 3FKIG 3HKZG 3AMUA 2CVRA 1H9RA 5M5YH 3J81j 1GD7A 2EXDA 4XIGS 2IW3A 3A8IE 1LTRD 1A8VA 1E3PA 3CAMA 5A35A 3H91A 4C3JB 1YITA 4BBSH 4ME5A 1K3BC 3CRLC 2QEJC 1VMPA 5EGTA 5M3FH 4ME3A 3I91A 5I2YA 1BXTA 4NMZA 1VS0A 4XQNA 3P75A 5JJZA 3QG1A 4BY1B 2PZWA 3ULJA 5ELFA 3NENA 2ASBA 3RZOH 1II3A 1HNXQ 2X6LA 2GA4B 5L37A 3J7ZC 2F0DA 2VXWA 4GOPC 1MJEA 1H9SA 1D1KA 5CV9A 4DV4Q 1QUQB 1O78A 2EJGC 4IUTA 2D62A 5GAGC 5COYA 4QY7A 2PCFB 3I3CA 3NWSA 4LFBQ 4B3ML 1G51A 3BDCA 3A5ZB 4B3RL 2RBMA 4DR1L 1OXVA 5CYUA 4N9TA 1QVCA 4RG1A 1VQJA 3P1HA 4JOIC 5T1GA 1STYA 1PDQA 2UUCL 4C3HG 4HR7B 1SE8A 2B2VA 5ELNA 1U5KA 1J5EQ 2BA0A 3A0JA 3NBIA 1HNWQ 4EQPA 3HOUH 1Z6HA 2EYHA 1DJRD 4X62L 3K5NA 3GTKB 3X3NA 4DAYA 2Q2TA 3OPOA 4P73A 3NQTA 3CKIB 1SNDA 1XTCD 5EJWA 3K59A 4FXKC 3EJIA 4J15A 2K52A 3T13A 1I6HB 3F2BA 1X65A 2XN9C 1EY4A 2JA8G 1I6VC 3OTOQ 4KV6A 4IFDJ 3CQZH 4P2CB 3G7LA 3M7GA 1R9TH 4K5XA 1EIFA 2F4VL 2ZXOA 2ENBA 3PO3B 3BDLA 4KKTA 4GN3B 2SNSA 1A6XA 3TRZA 5M5XB 2O2LD 1XMQQ 1D2BA 1P8LA 3H0GB 4BXXH 3UDFA 3GTJH 3I4LA 1WTWA 2NN6H 3H09A 1N9WA 3K0XA 4QIWE 4A3GB 1WD1A 1Q1BA 1PTOD 3UI2A 3J80E 2OQKA 3C1EA 4NXNQ 1I4RA 1EQQA 1F2ZA 1JJCB 1IKMA 1TR5A 2AHOB 3C3LA 3SGIA 2B63B 4B3TL 5GROA 3J7A5 4BBSG 1YNNC 3I90A 5D3DA 4BS9A 2KCTA 3I55A 1SR3A 3T1HL 3F2UA 5E4XA 3PUWA 5EKLA 4WJ3M 3PF4A 1PRTB 2K5WA 4ZLTF 1IYUA 3BYYB 3I4NH 4Y7NH 2HT1A 5LMNW 4LF6L 4IFDI 4K8IA 2LY7A 2WFWA 3UDXA 3CU7A 2ZT9C 2RKSA 1LTAD 1X3FA 2N88A 1RHPA 5DAUA 1RKNA 4JI2L 4QF4A 1YBYA 4F88A 3P7JA 1XPOA 5ELCA 1SJED 1QVFA 1S5FD 1QCBD 4HCEA 4R9WA 1DOLA 2F3IA 1IBLQ 1BO0A 4KTAA 1YVCA 3A8KE 1LABA 1VQCA 2MP1A 3I4MH 1I50B 2D5DA 5IYBH 3A7AB 3NE5B 2MO0A 3H3VH 2E2IH 5IWAL 1LACA 5C0XJ 4LF7Q 3DWPA 1VCIA 4LFCQ 2KECA 5BN3A 1GVPA 3C46A 5LL6S 1LTBD 2DN8A 4Z9CB 4LF8L 2E76C 3Q8DA 3DWAA 2LMCB 1YIJA 4FDBA 1HNZQ 5E4WC 1STAA 5C3WA 4CKEA 4FNFA 1H95A 3EROA 3F2CA 2F0PA 1EY0A 2WAQG 3ND8A 4DUYL 4KJOA 4A3FH 3HOUG 3CCMA 2JK8A 1XXGA 4A3IG 2D9UA 3N6RA 1SYDA 4I7AA 5C4XG 1FJGQ 2JA5B 4MHEA 2YTYA 4KHPQ 3NK9A 5GAHC 4DK0A 4LF9L 5AJ3Q 4B08A 2R7ZB 1HTPA 4ZCKA 1N32L 3BYTB 2E74C 3CCSA 2UU9L 1GUOA 4BBRB 5C4ZA 1JC7A 3S2DB 1XMOL 2HQLA 4YY3Q 4IUVA 4JI4Q 3E0JA 5C0XI 3LGJA 2QEXA 1PTOC 3D8GA 4DUZL 4A76A 1CKMA 3W1GA 3K8AA 1CM9A 2BE5D 2Z9HA 2UXBQ 1Z47A 4DV1L 1WD0A 3H6MA 4BXXG 2LSSA 4HJ8A 1U9RA 1AE3A 2NN6G 1GHKA 1KRTA 5ELDA 4OELB 2IHFA 1ICWA 1K83B 3WOFA 3KF8A 4C3IH 5I9OA 3OHXC 4PMWA 1LYLA 2RDGA 3J80L 1TWAH 5C4JB 1BCPF 2CH4W 1Q86C 4K0KQ 4QQBX 4DR3L 4JI6L 1CA6A 4C1NK 1ZXTA 1C0AA 2F0NA 1C8CA 2B2YC 3F1ZA 4RA8A 3D4WA 2F0QA 1TKWB 3S17B 1X55A 1EU4A 2F0LA 1XPRA 2IL8A 2YU9H 2F0TA 1V1PA 1BBUA 2HQEA 1JICA 2RHQB 2ZM6Q 4H44C 2RA4A 4LK1C 2H5XA 5CV4A
chains in the Genus database with same CATH topology
1V9PA 2K4KA 4GKJL 4DK3C 1VQDA 5IT9c 3GD7A 1PH3A 4GLVB 1DGSA 4JI0Q 3GTPH 3TQYA 3OTOL 4GOPA 4DR7Q 2B63H 3S1QH 2R93G 1VQIA 4GNXA 2N8NA 2PI2A 2E8GA 1B7YB 1A62A 2HHHL 4DV6L 2JA8H 1VQ6A 3OW2A 1EUJA 2OQ0A 4QJFA 3J80i 3CXCA 2R93H 1EOVA 2N78A 1XMQL 4X64L 3PUYA 1HH2P 1KD1C 3I4MG 4B3MQ 4DV7Q 4A3MH 3CMEA 2ES2A 5IYBG 1IBKQ 1S72A 4B3RQ 1N34Q 1PH8A 3DLLA 3CPFA 2WP8J 3CF5A 2NVXH 2R7FA 2Z6KA 1OXSC 3FKIH 1TWGH 4X6AH 1PH2A 3PUVA 3U58A 1B70B 1HR0L 4IOAA 4NXNL 4IJHA 4JOIA 4TQUS 2ZTDA 3HOXH 3ER0A 2D0PA 2K75A 1PYBA 4A3EH 4DV3L 2R92H 4JG2A 1M90C 3S16H 1SROA 4X65L 3KJPA 1EIYB 2VQFQ 2UXDL 2R7DA 4TVAB 4LF9Q 2A1AA 5JJLA 1I50H 2B29A 4OWXB 4X62Q 3HOZG 4LW1A 1WOCA 4LF4L 2VQEL 1UWVA 4A3FG 4MNOA 3TREA 2E2JH 4OX9L 2UU9Q 4RMFA 1SN8A 2YV5A 4C2MH 1TXYA 4AYBG 3CC2A 1CSPA 1Q7YC 2UXCL 1XMOQ 2CQOA 1PHJA 1IXRA 1VQ8A 4GNXC 4B3SQ 1VQGA 5JJIA 5C0XG 3CC7A 3DM3A 4A3KG 4LFAL 1PH7A 4A3LG 1NMFA 2K5VA 1YZ6A 2VL6A 2K5HA 3CP0A 3HFZB 5FJ8G 3JC66 2QA4A 4DUZQ 4DV0Q 3T1YQ 2ZTEA 4JV5L 4IPDA 5M3MH 5C44G 4UY8C 5EAYA 2F4VQ 4A3LH 1UE1A 3I7FA 2JA5G 1IBLL 1VQPA 1VQNA 3U4VA 1FL0A 1IL2A 5GADC 1EFWA 2R7ZG 1BKBA 5C44H 4NXML 4A3BG 4KLKA 4R4OA 1Y1VH 2KCMA 3CCVA 4OXPA 2RHSB 4IPCA 1FVIA 3S1RH 2PI2E 2JA5H 2Q2IA 3M85A 1C9OA 2UUBL 4JBMA 4JI6Q 1A0IA 4R1JA 5IYDG 4LF7L 3PIOA 2R7ZH 1YHAA 2EIFA 4IPGA 4LFCL 5JEAJ 4A3BH 1KRSA 3HOWG 4DNIA 4KI0A 1Q81C 2IY5B 2JE6I 2V1CC 3K80C 3E9IA 4BBRH 4QGUA 2FXQA 1E1TA 1KL9A 1C7YA 2ALYB 4B3TQ 3S2DH 1VQLA 1XNRL 3HOWH 4A3CG 3UE1A 1E22A 1HNZL 2NVTH 1K3RA 1P16A 5C3EH 2N3SA 2A8VA 2WB1G 2GN5A 4DR6L 1E1OA 3W5OA 3PO3G 1KQSA 3HKZE 4DR2L 2VS1A 1X9NA 3KOJA 4LNQA 5J3BA 1QVGA 3CPWA 4POGA 1XTDA 3F2DA 1TWCH 2VUMG 4LF6Q 4DPGA 3RLFA 1Q46A 3G6EA 1AE2A 2GVBA 3B6YA 3G48A 3GTQH 1JMCA 1BVSA 1JJ2A 3PIPA 1GM5A 4R4TA 4YWKA 4KHPL 1N8RC 1K83H 2KENA 5AJ3L 5IYCG 1HZCA 2Q2HA 4L5QA 4PZ8A 3JAMi 4HIKA 4HIOA 3M4QA 1VQEA 1WI5A 1PH6A 5IP7H 3AQQA 4JI2Q 4JYAL 1KHIA 2UXCQ 2I5MX 5C4JH 1W2BA 3KF6B 4IO9A 3M3YH 1ASYA 2YTVA 2CFMA 5H1SE 3TEHB 3GTMH 5IYCH 1L2FA 4DV2L 4JI7Q 2BH2A 4X66Q 4OO1G 4YCVA 1PYSB 4YY3L 4JI4L 4LF5L 4DV5Q 2A19A 2R92G 2I5LX 3J80c 3TS0A 3CC4A 2JA7H 3S17H 4YCUA 1L1OB 1NE3A 1Y1WG 4IJLA 1OXXK 2PNHA 4AQYL 3F8TA 3CCJA 1XNQQ 3CCQA 2UXBL 1TWHH 3M4PA 2E5LQ 3MXNB 2ZTCA 4A3MG 1K8AC 5IWAQ 2YTXA 3BJUA 4JI1L 4MTNA 5BR8L 3I56A 3RN5A 2NN6I 1YI2A 1K8GA 3KF6A 2CWPA 4X65Q 2VY3A 3S15H 1Y1WH 1NBWA 5LMUL 1VQHA 3FKIG 4LUVA 3HKZG 3GTGH 2UXDQ 4UP7A 2VNUD 5M5YH 3J81j 1GD7A 1G291 2EXDA 4XIGS 3PGZA 4LF8Q 1I94Q 1A8VA 1E3PA 3CAMA 4LF4Q 5M3FG 2VQEQ 3HOXG 3S1MH 1S3OA 1YITA 4BBSH 2MO1A 5FLMH 1L1OA 3ULPA 4A3EG 4JBKA 2ZJQA 3BZCA 3K7UC 3PF5A 4JC0A 3G4SA 4DUYQ 5M3FH 3HOVH 1LM0A 3PCOB 4JI5L 4ME3A 4LUZA 3I2ZA 1YEZA 2WAQE 1OXTA 4HJ7A 2DUDA 2QGQA 3U50C 1VS0A 1PH1A 5IP9G 1RIPA 1JT8A 3ULJA 2BH8A 3FHWA 3KLWA 4L5TA 3NENA 2JA6H 2ASBA 1PVOA 3RZOH 1N32Q 2IX1A 4ALPA 5GQOA 1HNXQ 1X54A 4POFA 1GO3E 1NY4A 2XGTA 2Y0SE 5IP9H 3J7ZC 5IE8A 4AIMA 4JI0L 2NZHA 2UUAQ 4DR7L 4A3JG 4GOPC 1MJEA 1LTLA 1EYGA 4P71A 4JCVE 5M3MG 4DV4Q 1QUQB 1Z9FA 1VQOA 4OX9Q 3L7ZC 2D62A 1V1QA 3PSIA 1PFSA 5GAGC 2NZOA 5E7NA 1CSQA 1KIXA 4QY7A 3H15A 2I5HA 4A3JH 1IZ6A 4LFBQ 1RL2A 4YHHQ 3A5UA 4DV1Q 4B3ML 1G51A 1K0RA 1MKHA 3A5ZB 4DV7L 4HIDA 1T9HA 4A3DH 1Y1VG 1N36Q 1IBKL 4B3RL 1N34L 4JI3Q 4IOCA 4QL5A 4DR1L 1OXVA 3M7NA 1L1OC 2OTLA 2Z6KC 1QVCA 1GKHA 1E24A 4DAYB 4DR6Q 1CUKA 1YHBA 4RG1A 1VQJA 3NBHB 1X6OA 2KHIA 4LF9L 1JJGA 1IBMQ 4JOIC 4PZ7A 4XTCS 5LMNQ 4BA2I 2UUCL 4WJ4A 4P74A 1KXLA 3PUXA 5M5WH 1SE8A 5ELNA 2DGYA 3U4ZA 4BBRG 4DR3Q 3E0EA 1SLJA 1U5KA 4UP9A 1J5EQ 1ASZA 2BA0A 3VDYA 2RCNA 2HHHQ 3A0JA 1JE5A 1HNWQ 3BU2A 2VQFL 1UE7A 3HOUH 3D31A 5C3EG 1W3SA 4C3HH 4DR5Q 4PG3A 2CCZA 2LXKA 4X62L 1I3QH 2VW9A 4GKKQ 3GO5A 3K81C 1KC8C 5DLQE 3CCLA 2Q2TA 3CCRA 3MEFA 1I5FA 4P73A 2AMCB 1UEBA 2VZAA 2GVAA 3IRBA 4EQ5A 4J15A 3S24A 4EX5A 4DR4Q 2K52A 3CMAA 3JAMc 5K36G 3F2BA 1XJVA 4GKJQ 2E2HH 2D0OA 1X65A 3AYHB 2JA8G 2NVYH 3EN2A 3OTOQ 3T1YL 4DV0L 5IP7G 2K5NA 4IFDJ 3CQZH 1VQ5A 1WCMH 1FJGL 4AH6A 1R9TH 1CKNB 1EIFA 1E7ZA 1MJCA 2F4VL 2NVQH 1KAWA 4JBJA 4DV6Q 1O7IA 3ERSX 1U0LA 4GN3B 5LMUQ 3TRZA 4P75A 2OCEA 1XMQQ 4L5SA 4X64Q 1HZ9A 4OWWB 1P8LA 2JA7G 4BXXH 3UDFA 3S1NH 3GTJH 2B3GA 1X3EA 1XPUA 2LXJA 2XTIA 3OYYA 3S14H 5HGQA 1N9WA 3K0XA 4QIWE 1Q1BA 1NMGA 3CCEA 1VQFA 2OQKA 2Z0SA 1YJNA 2N49A 1IYJB 1HR0Q 4P72A 4IPHA 2RF4A 4NXNQ 1CKNA 1JJCB 2CWAA 2IX0A 3NELA 1EQQA 4JI5Q 3K7AH 3I4OA 1PH9A 4GNXB 2AHOB 3E9HA 1UE5A 4DV3Q 3SGIA 4UPAA 3CCUA 4B3TL 5GROA 3J7A5 3AFPA 3CW2C 3I4NG 4BBSG 5FLMG 3I55A 2KCTA 3J81i 1SR3A 3T1HL 2YYZA 1CKOA 3PUWA 4GS3A 4GLXA 2JA9A 4WJ3M 3NEMA 4A75A 4PZ6A 3PF4A 3M4OH 3STBC 3HOVG 2L15A 2PMZE 4R4IA 3L2PA 4HIMA 4DAMA 2JEBI 3I4NH 4Y7NH 3HOZH 4K0KL 2HT1A 1BBWA 5LMNW 4LF6L 3HOYH 4IFDI 1Q8KA 3FP9A 3PO2H 2WFWA 3UDXA 1K73C 2MFIA 4AYBE 3L0OA 1X3FA 4NPSA 4UP8A 1Q82C 4LFAQ 1N33L 2JA6G 1TWFH 2I0QA 4JI2L 4JV5Q 4JI8L 1B8AA 1UE6A 4C3JH 1YBYA 2JEAI 1NTGA 2MNAA 4R4CA 4R4QA 1XPOA 3CD6A 5FLXc 4JBWA 1L0WA 1PH4A 1SMXA 2ZM6L 1QVFA 4OO1I 3STBD 3M9BA 4JI7L 4X66L 3KDFB 2ZJPA 3ICEA 3KFUA 4Y52H 2F3IA 1IBLQ 4DR1Q 1Q12A 4DV5L 2ZJRA 1YNXA 4BY1G 4HJ9A 1SRUA 1YVCA 4H02A 1VQCA 3I4MH 4NXMQ 2AKWB 4YWMA 5IYBH 2OTJA 1QZHA 2MO0A 2UUCQ 2C35B 4KHZA 2HIXA 1XNQL 3H3VH 2E5LL 2E2IH 2Q2UA 2BA1A 2UUBQ 2ATWA 1HZBA 1MIUA 1HJPA 4O0AA 5IWAL 3RN2A 4BY1H 3UDGA 4A3DG 3PUZA 3A74A 5C0XJ 1NJIC 1VCIA 4LF7Q 4LFCQ 1X3GA 4L5RC 1GVPA 4HJ5A 1FGUA 2IT1A 3GTOH 4OONA 1LUZA 1M1KC 3KDFA 3GDEA 5IY0A 4LUOA 1I94L 4LF8L 3Q8DA 2R6GA 1S40A 3H3VI 1XNRQ 1YIJA 1N33Q 4FDBA 1HNZQ 2JJQA 4BA1I 1PH5A 1WFQA 1YJWA 1YHQA 2IHEA 1H95A 1V43A 2PQAB 4DR2Q 1QUQA 3F2CA 4DUYL 2WB1E 2WAQG 4NB3A 3KJOA 1QZGA 4A3FH 1HR0W 3HOUG 3CCMA 1VQ7A 2JK8A 3RZDH 4A3IG 2MQHA 1SFOH 2CKZB 2KHJA 3PV0A 1JB7A 1VQKA 4A4IA 3ZJYC 4DK6C 1FJGQ 5C4XG 2YTYA 1J6QA 4KHPQ 3RNUA 5GAHC 1G6PA 4DKAC 4A3IH 3WWVA 5AJ3Q 1HZAA 1EQRA 4YCWA 2AWOA 4A3KH 2Y0SG 5FJ8H 1N32L 3KYHC 3TS2A 4JYAQ 1HNXL 3RR5A 5C4XH 1A63A 1PV4A 3CCSA 1YJ9A 2UU9L 2PQAA 2UUAL 3KF8B 1OXUA 1WCMG 2KBNA 4OWTB 3W1BA 3HKSA 2HQLA 3RLNA 4YY3Q 4DV2Q 4DV4L 2AWNA 1XMOL 4JI4Q 4LF5Q 4B3SL 5C0XI 3LGJA 2QEXA 5JEAG 2ID0A 4DUZL 4A76A 3GTKH 1CKMA 3W1GA 3K8AA 4LFBL 5HY6A 4AQYQ 3S2HH 1WJJA 4YHHL 1Z47A 1VQMA 4DV1L 2UXBQ 2K14A 4GLAC 3D0FA 4GN5A 4APVA 4GN4B 5BR8Q 2LSSA 4JI1Q 1N36L 4HJ8A 4BXXG 5IYDH 2HIVA 3AFQA 4JI3L 2NN6G 1AE3A 1KRTA 1PA6A 3T1HQ 1OTCA 2IHFA 1I6HH 3G71A 1K9MC 1D7QA 4C3IH 4A93G 2JQOA 2EQSA 1WYDA 4YWLA 4PMWA 1LYLA 1IBML 1AH9A 1TWAH 3BZKA 4O2DA 5LMNL 1EWIA 4BY7G 2F52A 1Q86C 4A3CH 4K0KQ 4QQBX 3H0GG 4DR3L 4JI6L 3EIVA 1X56A 1J5EL 4IFDG 3J81c 1C0AA 4A93H 3PO3H 1VQ4A 2OWOA 4A3GG 1HNWL 4GOPB 3EBEA 3F1ZA 4DR5L 5M5XH 4BY7H 3H0GH 2VUMH 3UE0A 3ULLA 1X55A 3AEVA 1D8LA 1VQAA 2K50A 4JI8Q 4GKKL 5GAEC 1XPRA 2YU9H 4A3GH 1Y14B 1BBUA 1Q1EA 3RLOA 4HJAA 1VQ9A 3HOYG 3PO2G 2RHQB 1VQBA 4LWCA 2ZM6Q 2B63G 3GTLH 2H5XA 4MZ9A 4DR4L 5JJKA 3UDIA 5ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9P A;  2K4K A;  4GKJ L;  4DK3 C;  1VQD A;  5IT9 c;  3GD7 A;  1PH3 A;  4GLV B;  1DGS A;  4JI0 Q;  3GTP H;  3TQY A;  3OTO L;  4GOP A;  4DR7 Q;  2B63 H;  3S1Q H;  2R93 G;  1VQI A;  4GNX A;  2N8N A;  2PI2 A;  2E8G A;  1B7Y B;  1A62 A;  2HHH L;  4DV6 L;  2JA8 H;  1VQ6 A;  3OW2 A;  1EUJ A;  2OQ0 A;  4QJF A;  3J80 i;  3CXC A;  2R93 H;  1EOV A;  2N78 A;  1XMQ L;  4X64 L;  3PUY A;  1HH2 P;  1KD1 C;  3I4M G;  4B3M Q;  4DV7 Q;  4A3M H;  3CME A;  2ES2 A;  5IYB G;  1IBK Q;  1S72 A;  4B3R Q;  1N34 Q;  1PH8 A;  3DLL A;  3CPF A;  2WP8 J;  3CF5 A;  2NVX H;  2R7F A;  2Z6K A;  1OXS C;  3FKI H;  1TWG H;  4X6A H;  1PH2 A;  3PUV A;  3U58 A;  1B70 B;  1HR0 L;  4IOA A;  4NXN L;  4IJH A;  4JOI A;  4TQU S;  2ZTD A;  3HOX H;  3ER0 A;  2D0P A;  2K75 A;  1PYB A;  4A3E H;  4DV3 L;  2R92 H;  4JG2 A;  1M90 C;  3S16 H;  1SRO A;  4X65 L;  3KJP A;  1EIY B;  2VQF Q;  2UXD L;  2R7D A;  4TVA B;  4LF9 Q;  2A1A A;  5JJL A;  1I50 H;  2B29 A;  4OWX B;  4X62 Q;  3HOZ G;  4LW1 A;  1WOC A;  4LF4 L;  2VQE L;  1UWV A;  4A3F G;  4MNO A;  3TRE A;  2E2J H;  4OX9 L;  2UU9 Q;  4RMF A;  1SN8 A;  2YV5 A;  4C2M H;  1TXY A;  4AYB G;  3CC2 A;  1CSP A;  1Q7Y C;  2UXC L;  1XMO Q;  2CQO A;  1PHJ A;  1IXR A;  1VQ8 A;  4GNX C;  4B3S Q;  1VQG A;  5JJI A;  5C0X G;  3CC7 A;  3DM3 A;  4A3K G;  4LFA L;  1PH7 A;  4A3L G;  1NMF A;  2K5V A;  1YZ6 A;  2VL6 A;  2K5H A;  3CP0 A;  3HFZ B;  5FJ8 G;  3JC6 6;  2QA4 A;  4DUZ Q;  4DV0 Q;  3T1Y Q;  2ZTE A;  4JV5 L;  4IPD A;  5M3M H;  5C44 G;  4UY8 C;  5EAY A;  2F4V Q;  4A3L H;  1UE1 A;  3I7F A;  2JA5 G;  1IBL L;  1VQP A;  1VQN A;  3U4V A;  1FL0 A;  1IL2 A;  5GAD C;  1EFW A;  2R7Z G;  1BKB A;  5C44 H;  4NXM L;  4A3B G;  4KLK A;  4R4O A;  1Y1V H;  2KCM A;  3CCV A;  4OXP A;  2RHS B;  4IPC A;  1FVI A;  3S1R H;  2PI2 E;  2JA5 H;  2Q2I A;  3M85 A;  1C9O A;  2UUB L;  4JBM A;  4JI6 Q;  1A0I A;  4R1J A;  5IYD G;  4LF7 L;  3PIO A;  2R7Z H;  1YHA A;  2EIF A;  4IPG A;  4LFC L;  5JEA J;  4A3B H;  1KRS A;  3HOW G;  4DNI A;  4KI0 A;  1Q81 C;  2IY5 B;  2JE6 I;  2V1C C;  3K80 C;  3E9I A;  4BBR H;  4QGU A;  2FXQ A;  1E1T A;  1KL9 A;  1C7Y A;  2ALY B;  4B3T Q;  3S2D H;  1VQL A;  1XNR L;  3HOW H;  4A3C G;  3UE1 A;  1E22 A;  1HNZ L;  2NVT H;  1K3R A;  1P16 A;  5C3E H;  2N3S A;  2A8V A;  2WB1 G;  2GN5 A;  4DR6 L;  1E1O A;  3W5O A;  3PO3 G;  1KQS A;  3HKZ E;  4DR2 L;  2VS1 A;  1X9N A;  3KOJ A;  4LNQ A;  5J3B A;  1QVG A;  3CPW A;  4POG A;  1XTD A;  3F2D A;  1TWC H;  2VUM G;  4LF6 Q;  4DPG A;  3RLF A;  1Q46 A;  3G6E A;  1AE2 A;  2GVB A;  3B6Y A;  3G48 A;  3GTQ H;  1JMC A;  1BVS A;  1JJ2 A;  3PIP A;  1GM5 A;  4R4T A;  4YWK A;  4KHP L;  1N8R C;  1K83 H;  2KEN A;  5AJ3 L;  5IYC G;  1HZC A;  2Q2H A;  4L5Q A;  4PZ8 A;  3JAM i;  4HIK A;  4HIO A;  3M4Q A;  1VQE A;  1WI5 A;  1PH6 A;  5IP7 H;  3AQQ A;  4JI2 Q;  4JYA L;  1KHI A;  2UXC Q;  2I5M X;  5C4J H;  1W2B A;  3KF6 B;  4IO9 A;  3M3Y H;  1ASY A;  2YTV A;  2CFM A;  5H1S E;  3TEH B;  3GTM H;  5IYC H;  1L2F A;  4DV2 L;  4JI7 Q;  2BH2 A;  4X66 Q;  4OO1 G;  4YCV A;  1PYS B;  4YY3 L;  4JI4 L;  4LF5 L;  4DV5 Q;  2A19 A;  2R92 G;  2I5L X;  3J80 c;  3TS0 A;  3CC4 A;  2JA7 H;  3S17 H;  4YCU A;  1L1O B;  1NE3 A;  1Y1W G;  4IJL A;  1OXX K;  2PNH A;  4AQY L;  3F8T A;  3CCJ A;  1XNQ Q;  3CCQ A;  2UXB L;  1TWH H;  3M4P A;  2E5L Q;  3MXN B;  2ZTC A;  4A3M G;  1K8A C;  5IWA Q;  2YTX A;  3BJU A;  4JI1 L;  4MTN A;  5BR8 L;  3I56 A;  3RN5 A;  2NN6 I;  1YI2 A;  1K8G A;  3KF6 A;  2CWP A;  4X65 Q;  2VY3 A;  3S15 H;  1Y1W H;  1NBW A;  5LMU L;  1VQH A;  3FKI G;  4LUV A;  3HKZ G;  3GTG H;  2UXD Q;  4UP7 A;  2VNU D;  5M5Y H;  3J81 j;  1GD7 A;  1G29 1;  2EXD A;  4XIG S;  3PGZ A;  4LF8 Q;  1I94 Q;  1A8V A;  1E3P A;  3CAM A;  4LF4 Q;  5M3F G;  2VQE Q;  3HOX G;  3S1M H;  1S3O A;  1YIT A;  4BBS H;  2MO1 A;  5FLM H;  1L1O A;  3ULP A;  4A3E G;  4JBK A;  2ZJQ A;  3BZC A;  3K7U C;  3PF5 A;  4JC0 A;  3G4S A;  4DUY Q;  5M3F H;  3HOV H;  1LM0 A;  3PCO B;  4JI5 L;  4ME3 A;  4LUZ A;  3I2Z A;  1YEZ A;  2WAQ E;  1OXT A;  4HJ7 A;  2DUD A;  2QGQ A;  3U50 C;  1VS0 A;  1PH1 A;  5IP9 G;  1RIP A;  1JT8 A;  3ULJ A;  2BH8 A;  3FHW A;  3KLW A;  4L5T A;  3NEN A;  2JA6 H;  2ASB A;  1PVO A;  3RZO H;  1N32 Q;  2IX1 A;  4ALP A;  5GQO A;  1HNX Q;  1X54 A;  4POF A;  1GO3 E;  1NY4 A;  2XGT A;  2Y0S E;  5IP9 H;  3J7Z C;  5IE8 A;  4AIM A;  4JI0 L;  2NZH A;  2UUA Q;  4DR7 L;  4A3J G;  4GOP C;  1MJE A;  1LTL A;  1EYG A;  4P71 A;  4JCV E;  5M3M G;  4DV4 Q;  1QUQ B;  1Z9F A;  1VQO A;  4OX9 Q;  3L7Z C;  2D62 A;  1V1Q A;  3PSI A;  1PFS A;  5GAG C;  2NZO A;  5E7N A;  1CSQ A;  1KIX A;  4QY7 A;  3H15 A;  2I5H A;  4A3J H;  1IZ6 A;  4LFB Q;  1RL2 A;  4YHH Q;  3A5U A;  4DV1 Q;  4B3M L;  1G51 A;  1K0R A;  1MKH A;  3A5Z B;  4DV7 L;  4HID A;  1T9H A;  4A3D H;  1Y1V G;  1N36 Q;  1IBK L;  4B3R L;  1N34 L;  4JI3 Q;  4IOC A;  4QL5 A;  4DR1 L;  1OXV A;  3M7N A;  1L1O C;  2OTL A;  2Z6K C;  1QVC A;  1GKH A;  1E24 A;  4DAY B;  4DR6 Q;  1CUK A;  1YHB A;  4RG1 A;  1VQJ A;  3NBH B;  1X6O A;  2KHI A;  4LF9 L;  1JJG A;  1IBM Q;  4JOI C;  4PZ7 A;  4XTC S;  5LMN Q;  4BA2 I;  2UUC L;  4WJ4 A;  4P74 A;  1KXL A;  3PUX A;  5M5W H;  1SE8 A;  5ELN A;  2DGY A;  3U4Z A;  4BBR G;  4DR3 Q;  3E0E A;  1SLJ A;  1U5K A;  4UP9 A;  1J5E Q;  1ASZ A;  2BA0 A;  3VDY A;  2RCN A;  2HHH Q;  3A0J A;  1JE5 A;  1HNW Q;  3BU2 A;  2VQF L;  1UE7 A;  3HOU H;  3D31 A;  5C3E G;  1W3S A;  4C3H H;  4DR5 Q;  4PG3 A;  2CCZ A;  2LXK A;  4X62 L;  1I3Q H;  2VW9 A;  4GKK Q;  3GO5 A;  3K81 C;  1KC8 C;  5DLQ E;  3CCL A;  2Q2T A;  3CCR A;  3MEF A;  1I5F A;  4P73 A;  2AMC B;  1UEB A;  2VZA A;  2GVA A;  3IRB A;  4EQ5 A;  4J15 A;  3S24 A;  4EX5 A;  4DR4 Q;  2K52 A;  3CMA A;  3JAM c;  5K36 G;  3F2B A;  1XJV A;  4GKJ Q;  2E2H H;  2D0O A;  1X65 A;  3AYH B;  2JA8 G;  2NVY H;  3EN2 A;  3OTO Q;  3T1Y L;  4DV0 L;  5IP7 G;  2K5N A;  4IFD J;  3CQZ H;  1VQ5 A;  1WCM H;  1FJG L;  4AH6 A;  1R9T H;  1CKN B;  1EIF A;  1E7Z A;  1MJC A;  2F4V L;  2NVQ H;  1KAW A;  4JBJ A;  4DV6 Q;  1O7I A;  3ERS X;  1U0L A;  4GN3 B;  5LMU Q;  3TRZ A;  4P75 A;  2OCE A;  1XMQ Q;  4L5S A;  4X64 Q;  1HZ9 A;  4OWW B;  1P8L A;  2JA7 G;  4BXX H;  3UDF A;  3S1N H;  3GTJ H;  2B3G A;  1X3E A;  1XPU A;  2LXJ A;  2XTI A;  3OYY A;  3S14 H;  5HGQ A;  1N9W A;  3K0X A;  4QIW E;  1Q1B A;  1NMG A;  3CCE A;  1VQF A;  2OQK A;  2Z0S A;  1YJN A;  2N49 A;  1IYJ B;  1HR0 Q;  4P72 A;  4IPH A;  2RF4 A;  4NXN Q;  1CKN A;  1JJC B;  2CWA A;  2IX0 A;  3NEL A;  1EQQ A;  4JI5 Q;  3K7A H;  3I4O A;  1PH9 A;  4GNX B;  2AHO B;  3E9H A;  1UE5 A;  4DV3 Q;  3SGI A;  4UPA A;  3CCU A;  4B3T L;  5GRO A;  3J7A 5;  3AFP A;  3CW2 C;  3I4N G;  4BBS G;  5FLM G;  3I55 A;  2KCT A;  3J81 i;  1SR3 A;  3T1H L;  2YYZ A;  1CKO A;  3PUW A;  4GS3 A;  4GLX A;  2JA9 A;  4WJ3 M;  3NEM A;  4A75 A;  4PZ6 A;  3PF4 A;  3M4O H;  3STB C;  3HOV G;  2L15 A;  2PMZ E;  4R4I A;  3L2P A;  4HIM A;  4DAM A;  2JEB I;  3I4N H;  4Y7N H;  3HOZ H;  4K0K L;  2HT1 A;  1BBW A;  5LMN W;  4LF6 L;  3HOY H;  4IFD I;  1Q8K A;  3FP9 A;  3PO2 H;  2WFW A;  3UDX A;  1K73 C;  2MFI A;  4AYB E;  3L0O A;  1X3F A;  4NPS A;  4UP8 A;  1Q82 C;  4LFA Q;  1N33 L;  2JA6 G;  1TWF H;  2I0Q A;  4JI2 L;  4JV5 Q;  4JI8 L;  1B8A A;  1UE6 A;  4C3J H;  1YBY A;  2JEA I;  1NTG A;  2MNA A;  4R4C A;  4R4Q A;  1XPO A;  3CD6 A;  5FLX c;  4JBW A;  1L0W A;  1PH4 A;  1SMX A;  2ZM6 L;  1QVF A;  4OO1 I;  3STB D;  3M9B A;  4JI7 L;  4X66 L;  3KDF B;  2ZJP A;  3ICE A;  3KFU A;  4Y52 H;  2F3I A;  1IBL Q;  4DR1 Q;  1Q12 A;  4DV5 L;  2ZJR A;  1YNX A;  4BY1 G;  4HJ9 A;  1SRU A;  1YVC A;  4H02 A;  1VQC A;  3I4M H;  4NXM Q;  2AKW B;  4YWM A;  5IYB H;  2OTJ A;  1QZH A;  2MO0 A;  2UUC Q;  2C35 B;  4KHZ A;  2HIX A;  1XNQ L;  3H3V H;  2E5L L;  2E2I H;  2Q2U A;  2BA1 A;  2UUB Q;  2ATW A;  1HZB A;  1MIU A;  1HJP A;  4O0A A;  5IWA L;  3RN2 A;  4BY1 H;  3UDG A;  4A3D G;  3PUZ A;  3A74 A;  5C0X J;  1NJI C;  1VCI A;  4LF7 Q;  4LFC Q;  1X3G A;  4L5R C;  1GVP A;  4HJ5 A;  1FGU A;  2IT1 A;  3GTO H;  4OON A;  1LUZ A;  1M1K C;  3KDF A;  3GDE A;  5IY0 A;  4LUO A;  1I94 L;  4LF8 L;  3Q8D A;  2R6G A;  1S40 A;  3H3V I;  1XNR Q;  1YIJ A;  1N33 Q;  4FDB A;  1HNZ Q;  2JJQ A;  4BA1 I;  1PH5 A;  1WFQ A;  1YJW A;  1YHQ A;  2IHE A;  1H95 A;  1V43 A;  2PQA B;  4DR2 Q;  1QUQ A;  3F2C A;  4DUY L;  2WB1 E;  2WAQ G;  4NB3 A;  3KJO A;  1QZG A;  4A3F H;  1HR0 W;  3HOU G;  3CCM A;  1VQ7 A;  2JK8 A;  3RZD H;  4A3I G;  2MQH A;  1SFO H;  2CKZ B;  2KHJ A;  3PV0 A;  1JB7 A;  1VQK A;  4A4I A;  3ZJY C;  4DK6 C;  1FJG Q;  5C4X G;  2YTY A;  1J6Q A;  4KHP Q;  3RNU A;  5GAH C;  1G6P A;  4DKA C;  4A3I H;  3WWV A;  5AJ3 Q;  1HZA A;  1EQR A;  4YCW A;  2AWO A;  4A3K H;  2Y0S G;  5FJ8 H;  1N32 L;  3KYH C;  3TS2 A;  4JYA Q;  1HNX L;  3RR5 A;  5C4X H;  1A63 A;  1PV4 A;  3CCS A;  1YJ9 A;  2UU9 L;  2PQA A;  2UUA L;  3KF8 B;  1OXU A;  1WCM G;  2KBN A;  4OWT B;  3W1B A;  3HKS A;  2HQL A;  3RLN A;  4YY3 Q;  4DV2 Q;  4DV4 L;  2AWN A;  1XMO L;  4JI4 Q;  4LF5 Q;  4B3S L;  5C0X I;  3LGJ A;  2QEX A;  5JEA G;  2ID0 A;  4DUZ L;  4A76 A;  3GTK H;  1CKM A;  3W1G A;  3K8A A;  4LFB L;  5HY6 A;  4AQY Q;  3S2H H;  1WJJ A;  4YHH L;  1Z47 A;  1VQM A;  4DV1 L;  2UXB Q;  2K14 A;  4GLA C;  3D0F A;  4GN5 A;  4APV A;  4GN4 B;  5BR8 Q;  2LSS A;  4JI1 Q;  1N36 L;  4HJ8 A;  4BXX G;  5IYD H;  2HIV A;  3AFQ A;  4JI3 L;  2NN6 G;  1AE3 A;  1KRT A;  1PA6 A;  3T1H Q;  1OTC A;  2IHF A;  1I6H H;  3G71 A;  1K9M C;  1D7Q A;  4C3I H;  4A93 G;  2JQO A;  2EQS A;  1WYD A;  4YWL A;  4PMW A;  1LYL A;  1IBM L;  1AH9 A;  1TWA H;  3BZK A;  4O2D A;  5LMN L;  1EWI A;  4BY7 G;  2F52 A;  1Q86 C;  4A3C H;  4K0K Q;  4QQB X;  3H0G G;  4DR3 L;  4JI6 L;  3EIV A;  1X56 A;  1J5E L;  4IFD G;  3J81 c;  1C0A A;  4A93 H;  3PO3 H;  1VQ4 A;  2OWO A;  4A3G G;  1HNW L;  4GOP B;  3EBE A;  3F1Z A;  4DR5 L;  5M5X H;  4BY7 H;  3H0G H;  2VUM H;  3UE0 A;  3ULL A;  1X55 A;  3AEV A;  1D8L A;  1VQA A;  2K50 A;  4JI8 Q;  4GKK L;  5GAE C;  1XPR A;  2YU9 H;  4A3G H;  1Y14 B;  1BBU A;  1Q1E A;  3RLO A;  4HJA A;  1VQ9 A;  3HOY G;  3PO2 G;  2RHQ B;  1VQB A;  4LWC A;  2ZM6 Q;  2B63 G;  3GTL H;  2H5X A;  4MZ9 A;  4DR4 L;  5JJK A;  3UDI A;  5ELO A; 
#chains in the Genus database with same CATH topology
 1SMY D;  4GKJ L;  5BN5 A;  3GD7 A;  5FOB B;  1K28 A;  3GTP H;  3DHQ A;  4FP5 D;  2EY2 A;  4OO1 H;  3S1M B;  2PYK A;  2N8N A;  4ZYS A;  1BBX C;  4J6H A;  1F9P A;  2EE1 A;  4DV6 L;  1VQ6 A;  2K03 A;  2OF1 A;  3J80 i;  2R93 H;  1EOV A;  2N78 A;  3EA6 A;  4X64 L;  3PUY A;  3I4M G;  3DMU A;  5IYB G;  1N34 Q;  3CPF A;  2IJ0 A;  3DEP A;  1TWG H;  4NKL A;  4X6A H;  1HR0 L;  3TN2 A;  1M8A A;  2JA6 B;  2QW7 A;  2EJF C;  2MGS A;  4TQU S;  5JPM C;  3SVM A;  4RWS C;  3M4Y A;  3K5L A;  3OIP A;  2D0P A;  2K75 A;  4K2K A;  4JG2 A;  1R4Q B;  1U4P A;  1M90 C;  3S16 H;  2HCI A;  3KJP A;  4QMG A;  4RAU C;  1XX8 A;  5JJL A;  3MA2 B;  4OWX B;  4LF4 L;  2VQE L;  4A3J B;  1UWV A;  4A3F G;  1Y8O B;  2YV5 A;  3OOC A;  1ENC A;  3BG3 A;  3GV6 A;  1Q7Y C;  1PHJ A;  2KOL A;  5KIX A;  3J7Y W;  1GOZ A;  2DY7 A;  2WKC A;  3HFZ B;  4ZK9 B;  1KLG D;  3JC6 6;  2XWJ B;  2ZTE A;  4IPD A;  4DAV A;  2F0E A;  2RSN A;  5ISR A;  5M3M H;  3V05 A;  1SE2 A;  1GUW A;  4A3L H;  1UE1 A;  3D6C A;  3I7F A;  3HRZ C;  1EU3 A;  4KY6 A;  2F3W A;  5GAD C;  5C44 H;  4NXM L;  1Y1V H;  4XYQ A;  4PV1 C;  1FNU A;  1HXY D;  5KNB A;  1C9O A;  1A0I A;  4R1J A;  3SR1 A;  1YHA A;  1KRS A;  3HOW G;  4RCN A;  4DNI A;  1FNW A;  2V1C C;  4C3I G;  2KED A;  1JE4 A;  2NVY B;  2A5H A;  1HTL D;  1XNR L;  2JN4 A;  1K3R A;  5C3E H;  3MXG A;  2A8V A;  3W5O A;  1EQV A;  1KQS A;  2FFK B;  1WTQ A;  2DNC A;  1LT5 D;  3S1N B;  1AE2 A;  3J81 E;  5FO8 B;  1JMC A;  1BVS A;  3S14 B;  3SK6 A;  2R3Z A;  1E2W A;  1NR4 A;  2F0J A;  4HIK A;  1PLF A;  5IYC G;  1HZC A;  1N33 Q;  1EZ6 A;  4L5Q A;  1PH6 A;  4HIO A;  4ULL A;  4JYA L;  4UHV A;  2I5M X;  3KF6 B;  3E5S A;  1IKL A;  2YTV A;  3TEH B;  4OO1 G;  4JI7 Q;  2BH2 A;  4LF5 L;  2L1B A;  1FYC A;  2VB2 X;  2JA7 H;  1EWC A;  1QIL A;  4AQY L;  4G7Z C;  1XNQ Q;  1TWH H;  2E5L Q;  1K8A C;  2R92 H;  1HPC A;  3I56 A;  3BJU A;  4IAL A;  4MTN A;  1NNX A;  2EYO A;  2NN6 I;  3S15 H;  1HFG A;  2VY3 A;  1B3Q A;  1Y1W H;  5LMU L;  3GTG H;  2UXD Q;  4UP7 A;  2L12 A;  3PGZ A;  5CBE E;  2A69 C;  3IKJ A;  4DK1 A;  1XWE A;  2MO1 A;  2HCC A;  2ZJQ A;  3K7U C;  5DM6 3;  1HQM C;  4R8N A;  2M9V A;  3HOV H;  5J39 A;  1LM0 A;  1I4H A;  1TQO A;  3Q24 A;  1YEZ A;  2WAQ E;  1CT1 D;  1OXT A;  1K0S A;  4QIW B;  2IWH A;  2EY1 A;  5IP9 G;  1RIP A;  2A73 B;  3MTS A;  2K6A A;  4M1U B;  4WOR A;  2PW7 A;  3D6W A;  1PVO A;  1F9S A;  2IX1 A;  1W6K A;  2XGT A;  4JI0 L;  5IE8 A;  2P5Z X;  4FF4 A;  2UUA Q;  1LTL A;  4P71 A;  4JCV E;  5M3M G;  4HMI A;  1VQO A;  1GUS A;  1STN A;  1PFS A;  1CSQ A;  4KY5 A;  3HOZ B;  4PNY A;  2VB3 X;  2ICE C;  4U67 3;  1RL2 A;  4XQQ A;  4YHH Q;  3RZD B;  4X3T A;  1K0R A;  4DV7 L;  3IAY A;  3EQL C;  1J8I A;  1T9H A;  3I72 A;  1Y1V G;  1N36 Q;  1TY0 A;  4A3D H;  4HSV A;  1CQV A;  1SYC A;  4IOC A;  1RTO A;  2EOT A;  2XVS A;  3M7N A;  1G2T A;  4FVM A;  1E24 A;  3JAM L;  1YHB A;  2RDH A;  3NBH B;  2MHV A;  1JJG A;  5IGG A;  4WJ4 A;  5LMN Q;  4RCO A;  3J7A F;  3PUX A;  5M5W H;  2NTT A;  2WAC A;  1UEA B;  1SDF A;  1SLJ A;  2RCN A;  1BCP B;  2VQF L;  3D31 A;  5C3E G;  1W3S A;  4C3H H;  1D6E C;  1I3Q H;  4CDC C;  3K81 C;  1KC8 C;  5CR3 A;  2F4I A;  5DLQ E;  1EYD A;  4N8X 1;  3NHH A;  2K5D A;  2GVA A;  3LWU A;  3J81 L;  1XJV A;  2D0O A;  3RD4 A;  3AYH B;  4TSS A;  3EN2 A;  2FMM A;  1WCM H;  1CQF A;  2Z6B A;  1HRJ A;  5A2Q E;  1F2M A;  1MJC A;  3PIP 3;  1GUT A;  4OEM B;  5I4D A;  4JBJ A;  4HAE A;  4A93 B;  1NSN S;  1O7I A;  3ERS X;  2XIW A;  3NTI A;  4BY7 B;  1HZ9 A;  2JA7 G;  3MHB A;  2VUM B;  2QCP X;  2KVM A;  2LXJ A;  1E0B A;  2XTI A;  3BZD B;  2CHB D;  5HGQ A;  2Z4H A;  1B2T A;  2L55 A;  1VQF A;  1ICF B;  4P72 A;  4DF7 A;  3NEL A;  3VR2 A;  4H0L C;  3OMG A;  1U4L A;  4RHS A;  3I4O A;  1BOS A;  1ENA A;  4GNX B;  3E9H A;  1UE5 A;  4U68 A;  3CW2 C;  4IUR A;  3J81 i;  4RGO S;  2HDL A;  1EY8 A;  4CDF C;  4A75 A;  4PZ6 A;  3M4O H;  3STB C;  3RUZ A;  1E2V A;  1MBY A;  1RD9 D;  2F0F A;  2L15 A;  2M2L A;  2PMZ E;  1AEX A;  4DNR B;  4DAM A;  2JEB I;  2NUC A;  3L2P A;  1BBW A;  4A3M B;  3FP9 A;  4C3J G;  4K6D A;  4FF3 A;  3CHB D;  3ND9 A;  1H9M A;  4DNT B;  5COR A;  3FKI B;  5D65 A;  3L0O A;  2NWG A;  3MZ5 A;  4UP8 A;  1Q82 C;  3ONA B;  2K28 A;  1TWF H;  3FPP A;  4JI8 L;  1B8A A;  1UE6 A;  1YNN D;  2JEA I;  2UXC L;  4R4C A;  5G3L D;  1PH4 A;  1GXD C;  1SYB A;  2Q8T A;  1SMX A;  4OO1 I;  4DU9 A;  4X66 L;  3KFU A;  1KDC A;  4WFN 3;  4DR1 Q;  1YNX A;  4BY1 G;  4HJ9 A;  4H02 A;  4WJW A;  4CBV A;  3A8J E;  1PTO H;  2UUC Q;  3T56 B;  2OXP A;  1HZB A;  1HJP A;  4O0A A;  3RN2 A;  4A3D G;  3A74 A;  2NTS A;  4HJ5 A;  1FGU A;  3GTO H;  2KCC A;  4OON A;  5D3I B;  4DXF A;  5IY0 A;  5CC4 A;  1ILQ A;  2R6G A;  1S40 A;  2KQ3 A;  1FNV A;  1FGB D;  3V2T A;  4HN7 A;  2K33 A;  4BA1 I;  1PH5 A;  4FXG C;  1YHQ A;  1T5X D;  1SJH D;  5M9O A;  2PQA B;  5I6W A;  4DR2 Q;  5CV8 A;  4J8Q A;  1VQ7 A;  5I6Y A;  3TP5 A;  1SFO H;  4FYD A;  2O5J C;  5JVG 3;  3S1R B;  2B2Y A;  1J6Q A;  4Q0F A;  1SYG A;  3QOJ A;  2Q8I B;  4QCL A;  4A3I H;  4A3K H;  3WWV A;  1HZA A;  1EQR A;  2AWO A;  3FDT A;  3QWN A;  4A3B B;  2PNR C;  1HNX L;  4S3S A;  5C4X H;  1A63 A;  1YJ9 A;  4LAA A;  2C9O A;  1OXU A;  1WCM G;  3W1B A;  4DV2 Q;  3GTM H;  4DV4 L;  1VF7 A;  1BF4 A;  1KDB A;  5A2Q L;  1CA5 A;  2A68 C;  4LFB L;  3S2H H;  1WJJ A;  1VQM A;  1L0X B;  1PRT D;  1TWC B;  3SK5 A;  4GLA C;  4KMU C;  4APV A;  5BR8 Q;  4JI1 Q;  3T51 B;  3SHL A;  5IYD H;  1SE4 A;  4MN3 A;  3TDQ A;  3K6O A;  4B9W A;  3T1H Q;  5IGB A;  1PA6 A;  4IZ8 A;  3G71 A;  2DJF C;  2F0S A;  1D7Q A;  1S5C D;  2CW0 D;  2JA8 B;  2AUK A;  1AH9 A;  1ESR A;  4MTK A;  2F52 A;  1QJO A;  1EWH A;  3H0G G;  3M3Y B;  1HCZ A;  1J5E L;  3VYT A;  4A3G G;  1HNW L;  3EBE A;  1Y8P B;  1IW7 C;  1F2Y A;  3UE0 A;  2K5Q A;  3ULL A;  2F0M A;  1LV9 A;  3FMC A;  1VQA A;  2K50 A;  2K32 A;  4UDU C;  5I9P A;  1EFI D;  1Y14 B;  3RLO A;  1VQB A;  5ELO A;  2B63 G;  3GTL H;  5JJK A;  5DEH A;  3T53 B;  1V9P A;  2K4K A;  4DK3 C;  1XYI A;  3VYR A;  5IT9 E;  5IT9 c;  1PH3 A;  5M5Y B;  4GLV B;  3TQY A;  3OTO L;  4DR7 Q;  3S1Q H;  4BBS B;  2K05 A;  2E8G A;  3ERQ A;  3BVM A;  2OQ0 A;  4QJF A;  5E1F A;  3CXC A;  5M3F B;  3QO2 A;  1B1Z A;  1XMQ L;  2J7Z A;  1HH2 P;  5E3F A;  1IBK Q;  1E2Z A;  1VDZ A;  2K1B A;  1PH8 A;  1AZP A;  3CF5 A;  2NVX H;  2R7F A;  1PH2 A;  5TSS A;  4NXN L;  5J22 A;  3RZO B;  2ZTD A;  1ZYR C;  3HOX H;  1LO5 D;  2K7V A;  1H9S B;  1NCV A;  1WTV A;  1PYB A;  4A3E H;  3TBI B;  2F0W A;  4X65 L;  1SNC A;  1KAA A;  2FHT A;  4HTH A;  4TVA B;  1LT6 D;  4LF9 Q;  1DOM A;  1WOC A;  5KND A;  1JR0 D;  3TRE A;  2E2J H;  3MAQ A;  5C5M A;  2UU9 Q;  4RMF A;  1SN8 A;  4C2M H;  1RJT A;  4AYB G;  1CSP A;  1XMO Q;  1VQ8 A;  1BQQ T;  1VQG A;  2PO4 A;  5JJI A;  3DM3 A;  4A3K G;  1PH7 A;  1NMF A;  2K5V A;  2VL6 A;  3NSW A;  2K5H A;  4DUZ Q;  2QA4 A;  3T1Y Q;  4DV0 Q;  4C1N I;  4G57 A;  4NW2 A;  1F2L A;  3LNN A;  5EAY A;  1DYQ A;  1PRT C;  1DD2 A;  5NUC A;  2JA5 G;  1IBL L;  2WAQ B;  1VQP A;  3HOU B;  2DNE A;  3HEJ A;  1FL0 A;  1IL2 A;  2MUY A;  3OWE B;  2R7Z G;  1BKB A;  4KLK A;  3CCV A;  2IX3 A;  2CW0 C;  2KUM A;  2RHS B;  1FVI A;  1CHQ D;  2PI2 E;  2Q8R E;  1ZKO A;  3M85 A;  1GUG A;  2V4D A;  4JI6 Q;  5D14 A;  5IYD G;  4LF7 L;  3PIO A;  4LFC L;  2EIF A;  5C6A A;  2F0U A;  5ELE A;  2IY5 B;  2JE6 I;  4QGU A;  1KL9 A;  3CQZ B;  2ALY B;  3WDN A;  2EZV A;  3HOW H;  1R9T B;  3G6J B;  1HNZ L;  2NVT H;  1P16 A;  1I4X A;  1EY6 A;  1UNS A;  2WB1 G;  4DR6 L;  4M8A A;  1E1O A;  1SYE A;  4EGV A;  3HKZ E;  2VS1 A;  4LNQ A;  3KOJ A;  3C1F A;  4ZUJ A;  4POG A;  4RKL A;  4ZQ3 A;  2EDG A;  3ZYY X;  1XTD A;  3B6Y A;  2GVB A;  3GTJ B;  3GTQ H;  4IQZ A;  5IGE A;  4KHP L;  3QIA A;  4GZY C;  1CTM A;  5AJ3 L;  4JK1 C;  2Q2H A;  1DON A;  4DFA A;  1WI5 A;  5IP7 H;  3AQQ A;  2XWB B;  1W2B A;  2B8F A;  4HSP A;  1S4Z A;  4IUU A;  1ASY A;  2CFM A;  5H1S E;  5IYC H;  1L2F A;  4YY3 L;  4OGQ C;  4JI4 L;  4KJN A;  3R93 A;  2A19 A;  3I8Z A;  4DV5 Q;  3HOV G;  2I5L X;  3TS0 A;  5DM7 3;  1SNQ A;  1L1O B;  1EL0 A;  2TSS A;  1QB5 D;  4IJL A;  1OXX K;  3I4N B;  3F8T A;  3CCJ A;  2UXB L;  4Y7N B;  3M4P A;  3MXN B;  2ZTC A;  1TS2 A;  4CJ1 B;  1YI2 A;  1SBB B;  3KF6 A;  3S9W A;  1NBW A;  2EPB A;  4LUV A;  1G29 1;  3VA5 A;  1I94 Q;  3NPP A;  4LF4 Q;  2VQE Q;  3HOX G;  2HUG A;  3R2I A;  3VA7 A;  3A7L A;  5FLM H;  4CJ0 B;  4A3E G;  4ODG A;  4CDD C;  2LKV A;  3PF5 A;  4JC0 A;  3G4S A;  4V19 0;  2ICI A;  4JI5 L;  2BDN A;  3I4M B;  2RCF A;  1HUM A;  3VR3 A;  3GV3 A;  2DUD A;  2QGQ A;  1Q90 A;  3U50 C;  1KNA A;  5KYI A;  2E2I B;  1JT8 A;  4K5W A;  1DM0 B;  1KLU D;  2BH8 A;  3KLW A;  4L5T A;  2A69 D;  1O7Y A;  1FR3 A;  4POF A;  3WOE A;  1GO3 E;  3CRK C;  4R8I A;  5IP9 H;  2NZH A;  4KN4 C;  4A3J G;  4IUQ A;  5I2X A;  4OX9 Q;  5F2D A;  2H4O A;  4RH6 A;  2NZO A;  5E7N A;  2PMZ B;  2DY8 A;  1KIX A;  2F0K A;  4A3F B;  3KLS A;  2KCN A;  4HID A;  2L9H A;  1FD7 D;  4OL7 A;  1N34 L;  4JI3 Q;  1T5E A;  4QL5 A;  5IOC A;  1L1O C;  4X3S A;  4RFB A;  2OTL A;  2CQA A;  1SYF A;  1B53 A;  1IBM Q;  4PZ7 A;  4XTC S;  4P74 A;  4NDX A;  2DGY A;  1ASZ A;  1EZ8 A;  4H13 C;  4UP9 A;  3VDY A;  2LS0 1;  1G6Z A;  1UE7 A;  1ENF A;  4DR5 Q;  4G7O C;  2CCZ A;  3BDO A;  5FO9 B;  2VW9 A;  4GKK Q;  2RSO A;  1RF2 D;  2I07 B;  2XRS D;  3CCL A;  3NBH A;  1I5F A;  2VZA A;  5FKA C;  1JWU D;  4E6I A;  4DR4 Q;  4EQ5 A;  4EX5 A;  3CMA A;  3JAM c;  4DAP A;  5K36 G;  2E2H H;  4C3I B;  1STB A;  1GJX A;  2KJX A;  5CV7 A;  5IP7 G;  2L5T A;  1TWA B;  4QUF A;  1CKN B;  1E7Z A;  2SOB A;  1AFP A;  2NVQ H;  1JQY D;  1C48 A;  1KAW A;  1I4P A;  2EYP A;  2K01 A;  2QDB A;  5DNF A;  5LMU Q;  4P75 A;  1A3T A;  3VR5 A;  4OWW B;  3K5O A;  2B3G A;  1X3E A;  1XPU A;  3OYY A;  3R8B A;  2YU9 B;  1EQT A;  3NWT A;  5IIF A;  1YJN A;  2Z0S A;  5C3X A;  1CZG A;  2N49 A;  3IFT A;  4IPH A;  2EYL A;  1LTI D;  3K7A H;  1Y69 U;  5C5L A;  2JYO A;  3GTP B;  4DV3 Q;  3CCU A;  1DZ1 A;  1AP0 A;  3AFP A;  2AUJ D;  5FLM G;  1STH A;  1CKO A;  4GS3 A;  3QR8 A;  1LTT D;  2F03 A;  2R93 B;  4R4I A;  4HIM A;  4OHJ A;  2J0T D;  3HOY H;  2TMP A;  1F9Q A;  1Q8K A;  2PPB C;  3PO2 H;  3BS1 A;  2MFI A;  4AYB E;  1MD2 D;  4PMB A;  1CI3 M;  5JOB A;  1TWG B;  4NPS A;  4LFA Q;  1N33 L;  1K8O A;  1HFN A;  2I0Q A;  4JV5 Q;  4C3J H;  4R4Q A;  3V96 A;  3CD6 A;  1KNE A;  5FLX c;  1X3Q A;  1L0W A;  3AB9 A;  5KYL A;  3STB D;  3M9B A;  4JI7 L;  3KDF B;  3ICE A;  3S16 B;  4Y52 H;  4ZKB B;  4XXE A;  1Q12 A;  2HD3 A;  1SRU A;  2WIN B;  5HUR A;  2XNA C;  1PFB A;  3QJY A;  2G9D A;  2AKW B;  4YWM A;  2OTJ A;  4PMC A;  4KHZ A;  1XNQ L;  2HIX A;  5CV5 A;  2E5L L;  1A2T A;  4LJZ C;  2UUB Q;  4BY1 H;  3T16 A;  3UDG A;  2B2T C;  1A3U A;  1BDO A;  4X3K A;  3SK4 A;  1STG A;  2X69 A;  1WTX A;  2IT1 A;  1M1K C;  4LUO A;  2A6E C;  1TS4 A;  3NTK A;  3H3V I;  4OIJ A;  2SDF A;  2FJ2 A;  5M3M B;  3X3M A;  1WFQ A;  1YJW A;  3C2P A;  2IHE A;  1PTO F;  1QZG A;  2MJ8 A;  1QUQ A;  2KEE A;  2WB1 E;  5J1Z A;  1HR0 W;  1VF5 C;  2OEO A;  2SNM A;  1JOR A;  2CKZ B;  2KHJ A;  5C44 B;  1LLR D;  1Y1V B;  1JB7 A;  1VQK A;  3ZJY C;  4DK6 C;  3RNU A;  3OW7 A;  4YCW A;  2Y0S G;  3Q22 A;  2BCO A;  3TS2 A;  1EYC A;  1S5B D;  3RR5 A;  1ESF A;  2PQA A;  5HGT A;  4XYO A;  4RGT A;  2UUA L;  3VYS A;  1LT4 D;  3BVG A;  3RLN A;  1BNZ A;  4B3S L;  5C3E B;  4B9X A;  3H94 A;  3GTK H;  4HED A;  4ZKC B;  1G2S A;  1SAP A;  5HY6 A;  4YHH L;  2G9H D;  4GN5 A;  1F9R A;  4GN4 B;  1N36 L;  3AFQ A;  5CMD A;  1AN8 A;  4N9P A;  1I6H H;  4IUN A;  4TKO B;  1K9M C;  4A93 G;  1NAP A;  5EQ0 A;  4TRD A;  4YWL A;  1SSO A;  5LMN L;  4O2D A;  4BY7 G;  3SDZ A;  4IFD G;  4FF1 A;  2A68 D;  3PO3 H;  1JWM D;  2OWO A;  4GOP B;  1MI2 A;  2NZ1 D;  5M5X H;  3H0G H;  2JA7 B;  1D8L A;  4JI8 Q;  5GAE C;  4CHT B;  4A3G H;  3HG9 A;  1TWH B;  1Q1E A;  3HOY G;  2R92 B;  3PO2 G;  2X6G A;  1IHZ A;  3S15 B;  5C4H A;  1Y1W B;  2PW5 A;  3GTG B;  4CKC A;  1QNU A;  1VQD A;  2JXM B;  1DGS A;  1W6J A;  3W2D A;  2B63 H;  2DJG C;  1BCP C;  1Q3L A;  1IW7 D;  1KDA A;  1TU2 B;  2IPK D;  3RMH A;  3HKZ B;  1B7Y B;  2B39 A;  2OT2 A;  2HHH L;  4ILW A;  2EYJ A;  1EUJ A;  3TP8 A;  3HOV B;  4IUP A;  4B3M Q;  3EVQ A;  4UAI A;  2ES2 A;  4B3R Q;  3HP3 A;  3OIQ A;  2QDL A;  2Z6K A;  1OXS C;  4IN3 A;  3TSS A;  1ML0 D;  3U58 A;  1DOK A;  3I70 A;  3ER0 A;  5LL6 X;  4CGY B;  3PMF A;  5CBA E;  1AZQ A;  5JPN C;  2A1A A;  1I50 H;  5K5P A;  2NYZ D;  3K5M A;  1PZI D;  2B29 A;  4X62 Q;  1MSH A;  1F77 A;  4A3D B;  5EBD A;  1TXY A;  3CC2 A;  1Q8I A;  1ZYR D;  3ITP A;  4V0B A;  2CQO A;  1IXR A;  5T1I A;  4GNX C;  1PZJ D;  1TS5 A;  5C0X G;  3CC7 A;  2E2D C;  1YZ6 A;  1B9M A;  1CHP D;  3U9O A;  2Z1C A;  1YNJ C;  5M5W B;  1I4G A;  1V1O A;  3K0Y A;  2F4V Q;  5ELB A;  1MSG A;  2EYF A;  1QWY A;  1VQN A;  3U4V A;  4C3H B;  1EFW A;  1JWS D;  4FF2 A;  4A3B G;  4R4O A;  5KEE A;  2KCM A;  4OXP A;  1I3Q B;  2B8G A;  2JA5 H;  1EY7 A;  5EPJ A;  5IGF A;  3AEV A;  2R7Z H;  4IPG A;  4KI0 A;  1Q81 C;  4FO2 A;  4BBR H;  3J7A V;  2AQ2 B;  1EEI D;  2FXQ A;  3S2D H;  4B3T Q;  1RDP D;  1WCM B;  1PMR A;  3A56 A;  3DM1 A;  1PZK D;  1Y8N B;  3TME A;  1VQL A;  3UE1 A;  1LTG D;  2NB0 A;  3PO3 G;  1B9N A;  4DR2 L;  1DCZ A;  2E75 C;  1X9N A;  3TZD A;  3E3X A;  3F2D A;  4XT3 B;  4LF6 Q;  4DPG A;  3RLF A;  4LMQ D;  1HHV A;  4I7Z C;  1D1I A;  1GM5 A;  4PQX A;  4R4T A;  4YWK A;  1J9O A;  1K83 H;  1N8R C;  2KEN A;  3N52 A;  3MXP A;  3M4Q A;  1U4R A;  4JI2 Q;  1QE6 A;  1MHW C;  5C4J H;  4L63 B;  3TP7 A;  4IO9 A;  2QF7 A;  2BDO A;  4O1N A;  3SXH A;  4DV2 L;  3MC0 B;  3BVZ A;  1PYS B;  1I4Q A;  2F3V A;  3Q0A A;  5JAV A;  1WTH A;  3J80 c;  3S17 H;  1NE3 A;  1Z7T A;  3TP6 A;  3M4O B;  2PNH A;  3CCQ A;  1EEF D;  4JI1 L;  5IWA Q;  5BR8 L;  2MPM A;  1CZW A;  1KAB A;  1K8G A;  2CWP A;  3KLR A;  4X65 Q;  2B2W A;  2Z8L A;  1LT3 D;  4DXG A;  1VQH A;  2VNU D;  2J4X A;  3LWE A;  2BOS A;  1TWF B;  4LF8 Q;  3HS0 C;  5M3F G;  1JCK B;  3S1M H;  1S3O A;  1SEB D;  1D5X C;  2K04 A;  3ULP A;  1L1O A;  4JBK A;  4XT1 B;  3BZC A;  3MXN A;  4XQJ A;  4DUY Q;  2NBF A;  3PCO B;  2EXZ A;  1G91 A;  1JB3 A;  2CH4 A;  3I2Z A;  4LUZ A;  4HJ7 A;  1PTO B;  3SK8 A;  1PH1 A;  3A54 A;  3DEO A;  1O7Z A;  5IOD A;  3FHW A;  2JA6 H;  1N32 Q;  4ALP A;  5GQO A;  1X54 A;  1NY4 A;  1TS3 A;  2Y0S E;  4X3U A;  3GTO B;  4AIM A;  1C4Q A;  4DR7 L;  1EYG A;  1Z9F A;  3L7Z C;  3LX0 A;  3PSI A;  1V1Q A;  2HDM A;  2F0V A;  2EJM A;  4ZAI A;  2I5H A;  3H15 A;  4A3J H;  1IZ6 A;  3L9A X;  3MVV A;  3A5U A;  3HGB A;  4DV1 Q;  1SFO B;  1MKH A;  3DUZ A;  2H1E A;  1IBK L;  4AYB B;  1ET6 A;  5EPL A;  2F0G A;  2Z6K C;  2XRQ D;  1GKH A;  2EYM A;  4DAY B;  4A3I B;  1CUK A;  4A3K B;  4DR6 Q;  4FXD A;  3OMC A;  1X6O A;  2KHI A;  4BA2 I;  5C4X B;  1KXL A;  3FVQ A;  4DR3 Q;  3U4Z A;  4BBR G;  3E0E A;  1NR2 A;  3SE0 A;  1JE5 A;  3GTM B;  3PIO 3;  3BU2 A;  3MEH A;  2PQE A;  1O7L A;  4PG3 A;  1HQR D;  2LXK A;  3FRP B;  3MWY W;  4G4K A;  3GO5 A;  5KRU A;  3S2H B;  3CCR A;  3MEF A;  2RVL A;  3D4R A;  2AMC B;  3T4A C;  1UEB A;  4DGZ A;  3IRB A;  3S24 A;  1X3P A;  3VR6 A;  4GKJ Q;  4N8F A;  2NVY H;  3T1Y L;  4DV0 L;  2K5N A;  1VQ5 A;  1FJG L;  3NTH A;  4RGM A;  4AH6 A;  5K36 H;  2D2C C;  1KTK A;  2WB1 B;  5JEA H;  2F0O A;  1TII D;  4DV6 Q;  2WII B;  4K5V A;  1U0L A;  1IL8 A;  2OCE A;  4X64 Q;  1V8Q A;  3DXJ C;  3KBX A;  3EFX D;  5BN4 A;  5IT9 L;  3S1N H;  1PFM A;  5JVH 3;  3S14 H;  1ILP A;  1NMG A;  2WKD A;  3CCE A;  2B2V C;  4K14 A;  1IYJ B;  4OIK A;  1HR0 Q;  3GTL B;  2RF4 A;  1U4M A;  1CKN A;  2CWA A;  2IX0 A;  3O13 A;  5CV6 A;  1EOT A;  4JI5 Q;  4DA2 A;  4KKS A;  1PH9 A;  4YIJ A;  2B2T A;  4UPA A;  3S1Q B;  1ZEQ X;  3I4N G;  1JOK A;  3GQB A;  4ZRZ A;  3D3R A;  2YYZ A;  4GLX A;  2JA9 A;  3NEM A;  4QUC A;  2O4X A;  4K0K L;  1B4O A;  2FMC A;  1B50 A;  1HA5 A;  2B2U A;  1HUN A;  1JOO A;  1SNO A;  3E6Z X;  1K73 C;  4EVO A;  2NVX B;  1K8M A;  3NXW A;  1OO9 B;  2JA6 G;  3HOX B;  1NTG A;  2MNA A;  4RGN A;  1HA6 A;  4A3E B;  4JBW A;  2A74 C;  1O80 A;  2ZM6 L;  3MXU A;  1GHJ A;  2ZJP A;  4DV5 L;  2ZJR A;  4RHR A;  3NP8 A;  4NXM Q;  4HCS A;  5LHY 1;  1QZH A;  2C35 B;  2E2J B;  1BUV T;  1G8Z D;  4CJ2 C;  2BA1 A;  2ATW A;  1MIU A;  4C2M B;  3PUZ A;  1NJI C;  1X3G A;  4L5R C;  2B2W C;  1D5Z C;  4MIU A;  1LUZ A;  2F0H A;  3KDF A;  3GDE A;  1I94 L;  1UAP A;  1TVX A;  3AU7 A;  4K8J A;  2ZXR A;  4C56 C;  1XNR Q;  2JJQ A;  1LTS D;  2R61 A;  3KK7 A;  1V43 A;  3HOZ H;  1L0Y B;  4NB3 A;  3KJO A;  3RZD H;  2MQH A;  3PV0 A;  4A4I A;  2EVB A;  2RQX A;  3I73 A;  1STE A;  1PFN A;  2BE5 C;  1G6P A;  2A6H D;  2A6E D;  3VYU A;  2L0C A;  4DKA C;  5FJ8 H;  1X32 A;  2ZXP A;  3KYH C;  4JYA Q;  4Q5V A;  1D5M C;  4JVZ A;  2PZT A;  1PV4 A;  4I65 A;  2AQ1 B;  4G7H C;  2F1M A;  3KF8 B;  3KLS X;  4EQN A;  2KBN A;  4OWT B;  4L5S A;  3HKS A;  4OX9 L;  3HOW B;  3JAM E;  2AWN A;  4LF5 Q;  2NVT B;  1GUN A;  3MFY A;  5JEA G;  3OWF A;  2ID0 A;  3H3V C;  1S5E D;  2L4N A;  4WRD A;  3P20 A;  4AQY Q;  2K14 A;  4RKB A;  3D0F A;  4NP5 A;  5G3L F;  2WV6 D;  3QOL A;  3DWQ A;  3GTQ B;  2HIV A;  2RDF A;  4JI3 L;  2Z4I A;  1QOH A;  3A55 A;  1OTC A;  3NUC A;  4ABN A;  1WTO A;  1A3V A;  5EBC A;  2JQO A;  1V1P B;  2EQS A;  4DN4 M;  1WYD A;  1IBM L;  4O42 A;  3BZK A;  1EWI A;  4L6T B;  3IFD A;  1WTP A;  4A3C H;  1SMY C;  3EIV A;  3W3A A;  1X56 A;  1EIH A;  3Q23 A;  3J81 c;  4A93 H;  1H9K A;  3NQI A;  1VQ4 A;  4DR5 L;  3K57 A;  4BY7 H;  1UUP A;  2SEB D;  2VUM H;  4KY7 A;  1VMC A;  4IFD H;  4GKK L;  1B44 D;  2M00 A;  4HJA A;  1VQ9 A;  4CDE C;  1DXM A;  3GP7 A;  4LWC A;  3SEB A;  4MZ9 A;  4DR4 L;  3UDI A;  2I46 A;  1H9J A;  4KKU A;  1S5D D;  4JI0 Q;  3KBG A;  4GOP A;  3FEW X;  1TT2 A;  3MFG A;  2R93 G;  1VQI A;  4GNX A;  2JP1 A;  2PI2 A;  3D4D A;  1A62 A;  1SNP A;  3OW2 A;  4BWG B;  4F7X A;  3QB3 A;  5FLX E;  2LFN A;  1KD1 C;  4DV7 Q;  1RCV D;  4A3M H;  4KN7 C;  3CME A;  2F0I A;  1S72 A;  3DLL A;  1SE3 A;  2WP8 J;  1ROD A;  3FKI H;  2QIL A;  5KNC A;  3PUV A;  4IOA A;  1B70 B;  1BCP D;  4IJH A;  4JOI A;  3PQI A;  4F8M A;  3IL8 A;  1EYA A;  4EQO A;  4DV3 L;  1NUC A;  3HZX A;  1PRT F;  2PZU A;  1SRO A;  2FIN B;  1EIY B;  1A15 A;  2VQF Q;  2UXD L;  2R7D A;  1MGS A;  2A6H C;  2G5D A;  3HOZ G;  4K6L A;  4LW1 A;  4MNO A;  2C5C A;  1QG7 A;  3OSO A;  1A2U A;  1ET9 A;  2B2U C;  4ZUI A;  4JPB W;  4F87 A;  4KHV A;  5EKI A;  4B3S Q;  1IYV A;  4A3L G;  4LFA L;  1R4P B;  5FJ8 G;  1PXU A;  3CP0 A;  4JV5 L;  2KA7 A;  3VR4 A;  4KK7 A;  5C44 G;  4UY8 C;  2QKI C;  5C0X H;  3URY A;  4QB4 A;  4JW0 A;  1CFM A;  2N55 A;  1WVL A;  4IPC A;  1SNM A;  3L3O C;  4KD4 A;  3R2T A;  3S1R H;  1EIG A;  2Q2I A;  2UUB L;  4JBM A;  1CK1 A;  3KUP A;  2AQ3 B;  1PYW D;  1EY5 A;  5JEA J;  2Y0S B;  4A3B H;  5FK9 C;  1YNJ D;  1RTN A;  4J1M A;  2E2H B;  2XSC A;  3K80 C;  3E9I A;  1E1T A;  1ONL A;  4HMJ A;  1JOQ A;  1C7Y A;  2O5I C;  1WTR A;  4A3C G;  1E22 A;  3TZU A;  4L8J A;  1TY2 A;  2N3S A;  3U9S A;  2NVQ B;  2GN5 A;  2EY5 A;  4KD3 A;  3Q6S A;  1M4V A;  5J3B A;  1QVG A;  1QNK A;  3CPW A;  4CKB A;  2EY6 A;  1TWC H;  2VUM G;  1Q46 A;  3G6E A;  1B3A A;  3G48 A;  4K2L A;  5CGK A;  1JJ2 A;  3PIP A;  1AW7 A;  1EY9 A;  5IGD A;  2HHH Q;  2Q2U A;  3JAM i;  4PZ8 A;  2JA8 H;  1BR9 A;  1VQE A;  1KHI A;  2UXC Q;  5EPK A;  1SXT A;  3K7A B;  3M3Y H;  2KHS A;  4ID6 A;  2L11 A;  5FO7 B;  4H7B A;  4X66 Q;  4YCV A;  2R92 G;  3CC4 A;  2JSO A;  3K58 A;  4YCU A;  5KGU A;  1Y1W G;  4XDX A;  5AFW A;  3HOY B;  4A3M G;  2YTX A;  3FPU B;  3RN5 A;  5IGC A;  3PO2 B;  5FLX L;  3R3O A;  5EKK A;  3FKI G;  3HKZ G;  3AMU A;  2CVR A;  1H9R A;  5M5Y H;  3J81 j;  1GD7 A;  2EXD A;  4XIG S;  2IW3 A;  3A8I E;  1LTR D;  1A8V A;  1E3P A;  3CAM A;  5A35 A;  3H91 A;  4C3J B;  1YIT A;  4BBS H;  4ME5 A;  1K3B C;  3CRL C;  2QEJ C;  1VMP A;  5EGT A;  5M3F H;  4ME3 A;  3I91 A;  5I2Y A;  1BXT A;  4NMZ A;  1VS0 A;  4XQN A;  3P75 A;  5JJZ A;  3QG1 A;  4BY1 B;  2PZW A;  3ULJ A;  5ELF A;  3NEN A;  2ASB A;  3RZO H;  1II3 A;  1HNX Q;  2X6L A;  2GA4 B;  5L37 A;  3J7Z C;  2F0D A;  2VXW A;  4GOP C;  1MJE A;  1H9S A;  1D1K A;  5CV9 A;  4DV4 Q;  1QUQ B;  1O78 A;  2EJG C;  4IUT A;  2D62 A;  5GAG C;  5COY A;  4QY7 A;  2PCF B;  3I3C A;  3NWS A;  4LFB Q;  4B3M L;  1G51 A;  3BDC A;  3A5Z B;  4B3R L;  2RBM A;  4DR1 L;  1OXV A;  5CYU A;  4N9T A;  1QVC A;  4RG1 A;  1VQJ A;  3P1H A;  4JOI C;  5T1G A;  1STY A;  1PDQ A;  2UUC L;  4C3H G;  4HR7 B;  1SE8 A;  2B2V A;  5ELN A;  1U5K A;  1J5E Q;  2BA0 A;  3A0J A;  3NBI A;  1HNW Q;  4EQP A;  3HOU H;  1Z6H A;  2EYH A;  1DJR D;  4X62 L;  3K5N A;  3GTK B;  3X3N A;  4DAY A;  2Q2T A;  3OPO A;  4P73 A;  3NQT A;  3CKI B;  1SND A;  1XTC D;  5EJW A;  3K59 A;  4FXK C;  3EJI A;  4J15 A;  2K52 A;  3T13 A;  1I6H B;  3F2B A;  1X65 A;  2XN9 C;  1EY4 A;  2JA8 G;  1I6V C;  3OTO Q;  4KV6 A;  4IFD J;  3CQZ H;  4P2C B;  3G7L A;  3M7G A;  1R9T H;  4K5X A;  1EIF A;  2F4V L;  2ZXO A;  2ENB A;  3PO3 B;  3BDL A;  4KKT A;  4GN3 B;  2SNS A;  1A6X A;  3TRZ A;  5M5X B;  2O2L D;  1XMQ Q;  1D2B A;  1P8L A;  3H0G B;  4BXX H;  3UDF A;  3GTJ H;  3I4L A;  1WTW A;  2NN6 H;  3H09 A;  1N9W A;  3K0X A;  4QIW E;  4A3G B;  1WD1 A;  1Q1B A;  1PTO D;  3UI2 A;  3J80 E;  2OQK A;  3C1E A;  4NXN Q;  1I4R A;  1EQQ A;  1F2Z A;  1JJC B;  1IKM A;  1TR5 A;  2AHO B;  3C3L A;  3SGI A;  2B63 B;  4B3T L;  5GRO A;  3J7A 5;  4BBS G;  1YNN C;  3I90 A;  5D3D A;  4BS9 A;  2KCT A;  3I55 A;  1SR3 A;  3T1H L;  3F2U A;  5E4X A;  3PUW A;  5EKL A;  4WJ3 M;  3PF4 A;  1PRT B;  2K5W A;  4ZLT F;  1IYU A;  3BYY B;  3I4N H;  4Y7N H;  2HT1 A;  5LMN W;  4LF6 L;  4IFD I;  4K8I A;  2LY7 A;  2WFW A;  3UDX A;  3CU7 A;  2ZT9 C;  2RKS A;  1LTA D;  1X3F A;  2N88 A;  1RHP A;  5DAU A;  1RKN A;  4JI2 L;  4QF4 A;  1YBY A;  4F88 A;  3P7J A;  1XPO A;  5ELC A;  1SJE D;  1QVF A;  1S5F D;  1QCB D;  4HCE A;  4R9W A;  1DOL A;  2F3I A;  1IBL Q;  1BO0 A;  4KTA A;  1YVC A;  3A8K E;  1LAB A;  1VQC A;  2MP1 A;  3I4M H;  1I50 B;  2D5D A;  5IYB H;  3A7A B;  3NE5 B;  2MO0 A;  3H3V H;  2E2I H;  5IWA L;  1LAC A;  5C0X J;  4LF7 Q;  3DWP A;  1VCI A;  4LFC Q;  2KEC A;  5BN3 A;  1GVP A;  3C46 A;  5LL6 S;  1LTB D;  2DN8 A;  4Z9C B;  4LF8 L;  2E76 C;  3Q8D A;  3DWA A;  2LMC B;  1YIJ A;  4FDB A;  1HNZ Q;  5E4W C;  1STA A;  5C3W A;  4CKE A;  4FNF A;  1H95 A;  3ERO A;  3F2C A;  2F0P A;  1EY0 A;  2WAQ G;  3ND8 A;  4DUY L;  4KJO A;  4A3F H;  3HOU G;  3CCM A;  2JK8 A;  1XXG A;  4A3I G;  2D9U A;  3N6R A;  1SYD A;  4I7A A;  5C4X G;  1FJG Q;  2JA5 B;  4MHE A;  2YTY A;  4KHP Q;  3NK9 A;  5GAH C;  4DK0 A;  4LF9 L;  5AJ3 Q;  4B08 A;  2R7Z B;  1HTP A;  4ZCK A;  1N32 L;  3BYT B;  2E74 C;  3CCS A;  2UU9 L;  1GUO A;  4BBR B;  5C4Z A;  1JC7 A;  3S2D B;  1XMO L;  2HQL A;  4YY3 Q;  4IUV A;  4JI4 Q;  3E0J A;  5C0X I;  3LGJ A;  2QEX A;  1PTO C;  3D8G A;  4DUZ L;  4A76 A;  1CKM A;  3W1G A;  3K8A A;  1CM9 A;  2BE5 D;  2Z9H A;  2UXB Q;  1Z47 A;  4DV1 L;  1WD0 A;  3H6M A;  4BXX G;  2LSS A;  4HJ8 A;  1U9R A;  1AE3 A;  2NN6 G;  1GHK A;  1KRT A;  5ELD A;  4OEL B;  2IHF A;  1ICW A;  1K83 B;  3WOF A;  3KF8 A;  4C3I H;  5I9O A;  3OHX C;  4PMW A;  1LYL A;  2RDG A;  3J80 L;  1TWA H;  5C4J B;  1BCP F;  2CH4 W;  1Q86 C;  4K0K Q;  4QQB X;  4DR3 L;  4JI6 L;  1CA6 A;  4C1N K;  1ZXT A;  1C0A A;  2F0N A;  1C8C A;  2B2Y C;  3F1Z A;  4RA8 A;  3D4W A;  2F0Q A;  1TKW B;  3S17 B;  1X55 A;  1EU4 A;  2F0L A;  1XPR A;  2IL8 A;  2YU9 H;  2F0T A;  1V1P A;  1BBU A;  2HQE A;  1JIC A;  2RHQ B;  2ZM6 Q;  4H44 C;  2RA4 A;  4LK1 C;  2H5X A;  5CV4 A; 
#chains in the Genus database with same CATH homology
 1V9P A;  2K4K A;  4GKJ L;  4DK3 C;  1VQD A;  5IT9 c;  3GD7 A;  1PH3 A;  4GLV B;  1DGS A;  4JI0 Q;  3GTP H;  3TQY A;  3OTO L;  4GOP A;  4DR7 Q;  2B63 H;  3S1Q H;  2R93 G;  1VQI A;  4GNX A;  2N8N A;  2PI2 A;  2E8G A;  1B7Y B;  1A62 A;  2HHH L;  4DV6 L;  2JA8 H;  1VQ6 A;  3OW2 A;  1EUJ A;  2OQ0 A;  4QJF A;  3J80 i;  3CXC A;  2R93 H;  1EOV A;  2N78 A;  1XMQ L;  4X64 L;  3PUY A;  1HH2 P;  1KD1 C;  3I4M G;  4B3M Q;  4DV7 Q;  4A3M H;  3CME A;  2ES2 A;  5IYB G;  1IBK Q;  1S72 A;  4B3R Q;  1N34 Q;  1PH8 A;  3DLL A;  3CPF A;  2WP8 J;  3CF5 A;  2NVX H;  2R7F A;  2Z6K A;  1OXS C;  3FKI H;  1TWG H;  4X6A H;  1PH2 A;  3PUV A;  3U58 A;  1B70 B;  1HR0 L;  4IOA A;  4NXN L;  4IJH A;  4JOI A;  4TQU S;  2ZTD A;  3HOX H;  3ER0 A;  2D0P A;  2K75 A;  1PYB A;  4A3E H;  4DV3 L;  2R92 H;  4JG2 A;  1M90 C;  3S16 H;  1SRO A;  4X65 L;  3KJP A;  1EIY B;  2VQF Q;  2UXD L;  2R7D A;  4TVA B;  4LF9 Q;  2A1A A;  5JJL A;  1I50 H;  2B29 A;  4OWX B;  4X62 Q;  3HOZ G;  4LW1 A;  1WOC A;  4LF4 L;  2VQE L;  1UWV A;  4A3F G;  4MNO A;  3TRE A;  2E2J H;  4OX9 L;  2UU9 Q;  4RMF A;  1SN8 A;  2YV5 A;  4C2M H;  1TXY A;  4AYB G;  3CC2 A;  1CSP A;  1Q7Y C;  2UXC L;  1XMO Q;  2CQO A;  1PHJ A;  1IXR A;  1VQ8 A;  4GNX C;  4B3S Q;  1VQG A;  5JJI A;  5C0X G;  3CC7 A;  3DM3 A;  4A3K G;  4LFA L;  1PH7 A;  4A3L G;  1NMF A;  2K5V A;  1YZ6 A;  2VL6 A;  2K5H A;  3CP0 A;  3HFZ B;  5FJ8 G;  3JC6 6;  2QA4 A;  4DUZ Q;  4DV0 Q;  3T1Y Q;  2ZTE A;  4JV5 L;  4IPD A;  5M3M H;  5C44 G;  4UY8 C;  5EAY A;  2F4V Q;  4A3L H;  1UE1 A;  3I7F A;  2JA5 G;  1IBL L;  1VQP A;  1VQN A;  3U4V A;  1FL0 A;  1IL2 A;  5GAD C;  1EFW A;  2R7Z G;  1BKB A;  5C44 H;  4NXM L;  4A3B G;  4KLK A;  4R4O A;  1Y1V H;  2KCM A;  3CCV A;  4OXP A;  2RHS B;  4IPC A;  1FVI A;  3S1R H;  2PI2 E;  2JA5 H;  2Q2I A;  3M85 A;  1C9O A;  2UUB L;  4JBM A;  4JI6 Q;  1A0I A;  4R1J A;  5IYD G;  4LF7 L;  3PIO A;  2R7Z H;  1YHA A;  2EIF A;  4IPG A;  4LFC L;  5JEA J;  4A3B H;  1KRS A;  3HOW G;  4DNI A;  4KI0 A;  1Q81 C;  2IY5 B;  2JE6 I;  2V1C C;  3K80 C;  3E9I A;  4BBR H;  4QGU A;  2FXQ A;  1E1T A;  1KL9 A;  1C7Y A;  2ALY B;  4B3T Q;  3S2D H;  1VQL A;  1XNR L;  3HOW H;  4A3C G;  3UE1 A;  1E22 A;  1HNZ L;  2NVT H;  1K3R A;  1P16 A;  5C3E H;  2N3S A;  2A8V A;  2WB1 G;  2GN5 A;  4DR6 L;  1E1O A;  3W5O A;  3PO3 G;  1KQS A;  3HKZ E;  4DR2 L;  2VS1 A;  1X9N A;  3KOJ A;  4LNQ A;  5J3B A;  1QVG A;  3CPW A;  4POG A;  1XTD A;  3F2D A;  1TWC H;  2VUM G;  4LF6 Q;  4DPG A;  3RLF A;  1Q46 A;  3G6E A;  1AE2 A;  2GVB A;  3B6Y A;  3G48 A;  3GTQ H;  1JMC A;  1BVS A;  1JJ2 A;  3PIP A;  1GM5 A;  4R4T A;  4YWK A;  4KHP L;  1N8R C;  1K83 H;  2KEN A;  5AJ3 L;  5IYC G;  1HZC A;  2Q2H A;  4L5Q A;  4PZ8 A;  3JAM i;  4HIK A;  4HIO A;  3M4Q A;  1VQE A;  1WI5 A;  1PH6 A;  5IP7 H;  3AQQ A;  4JI2 Q;  4JYA L;  1KHI A;  2UXC Q;  2I5M X;  5C4J H;  1W2B A;  3KF6 B;  4IO9 A;  3M3Y H;  1ASY A;  2YTV A;  2CFM A;  5H1S E;  3TEH B;  3GTM H;  5IYC H;  1L2F A;  4DV2 L;  4JI7 Q;  2BH2 A;  4X66 Q;  4OO1 G;  4YCV A;  1PYS B;  4YY3 L;  4JI4 L;  4LF5 L;  4DV5 Q;  2A19 A;  2R92 G;  2I5L X;  3J80 c;  3TS0 A;  3CC4 A;  2JA7 H;  3S17 H;  4YCU A;  1L1O B;  1NE3 A;  1Y1W G;  4IJL A;  1OXX K;  2PNH A;  4AQY L;  3F8T A;  3CCJ A;  1XNQ Q;  3CCQ A;  2UXB L;  1TWH H;  3M4P A;  2E5L Q;  3MXN B;  2ZTC A;  4A3M G;  1K8A C;  5IWA Q;  2YTX A;  3BJU A;  4JI1 L;  4MTN A;  5BR8 L;  3I56 A;  3RN5 A;  2NN6 I;  1YI2 A;  1K8G A;  3KF6 A;  2CWP A;  4X65 Q;  2VY3 A;  3S15 H;  1Y1W H;  1NBW A;  5LMU L;  1VQH A;  3FKI G;  4LUV A;  3HKZ G;  3GTG H;  2UXD Q;  4UP7 A;  2VNU D;  5M5Y H;  3J81 j;  1GD7 A;  1G29 1;  2EXD A;  4XIG S;  3PGZ A;  4LF8 Q;  1I94 Q;  1A8V A;  1E3P A;  3CAM A;  4LF4 Q;  5M3F G;  2VQE Q;  3HOX G;  3S1M H;  1S3O A;  1YIT A;  4BBS H;  2MO1 A;  5FLM H;  1L1O A;  3ULP A;  4A3E G;  4JBK A;  2ZJQ A;  3BZC A;  3K7U C;  3PF5 A;  4JC0 A;  3G4S A;  4DUY Q;  5M3F H;  3HOV H;  1LM0 A;  3PCO B;  4JI5 L;  4ME3 A;  4LUZ A;  3I2Z A;  1YEZ A;  2WAQ E;  1OXT A;  4HJ7 A;  2DUD A;  2QGQ A;  3U50 C;  1VS0 A;  1PH1 A;  5IP9 G;  1RIP A;  1JT8 A;  3ULJ A;  2BH8 A;  3FHW A;  3KLW A;  4L5T A;  3NEN A;  2JA6 H;  2ASB A;  1PVO A;  3RZO H;  1N32 Q;  2IX1 A;  4ALP A;  5GQO A;  1HNX Q;  1X54 A;  4POF A;  1GO3 E;  1NY4 A;  2XGT A;  2Y0S E;  5IP9 H;  3J7Z C;  5IE8 A;  4AIM A;  4JI0 L;  2NZH A;  2UUA Q;  4DR7 L;  4A3J G;  4GOP C;  1MJE A;  1LTL A;  1EYG A;  4P71 A;  4JCV E;  5M3M G;  4DV4 Q;  1QUQ B;  1Z9F A;  1VQO A;  4OX9 Q;  3L7Z C;  2D62 A;  1V1Q A;  3PSI A;  1PFS A;  5GAG C;  2NZO A;  5E7N A;  1CSQ A;  1KIX A;  4QY7 A;  3H15 A;  2I5H A;  4A3J H;  1IZ6 A;  4LFB Q;  1RL2 A;  4YHH Q;  3A5U A;  4DV1 Q;  4B3M L;  1G51 A;  1K0R A;  1MKH A;  3A5Z B;  4DV7 L;  4HID A;  1T9H A;  4A3D H;  1Y1V G;  1N36 Q;  1IBK L;  4B3R L;  1N34 L;  4JI3 Q;  4IOC A;  4QL5 A;  4DR1 L;  1OXV A;  3M7N A;  1L1O C;  2OTL A;  2Z6K C;  1QVC A;  1GKH A;  1E24 A;  4DAY B;  4DR6 Q;  1CUK A;  1YHB A;  4RG1 A;  1VQJ A;  3NBH B;  1X6O A;  2KHI A;  4LF9 L;  1JJG A;  1IBM Q;  4JOI C;  4PZ7 A;  4XTC S;  5LMN Q;  4BA2 I;  2UUC L;  4WJ4 A;  4P74 A;  1KXL A;  3PUX A;  5M5W H;  1SE8 A;  5ELN A;  2DGY A;  3U4Z A;  4BBR G;  4DR3 Q;  3E0E A;  1SLJ A;  1U5K A;  4UP9 A;  1J5E Q;  1ASZ A;  2BA0 A;  3VDY A;  2RCN A;  2HHH Q;  3A0J A;  1JE5 A;  1HNW Q;  3BU2 A;  2VQF L;  1UE7 A;  3HOU H;  3D31 A;  5C3E G;  1W3S A;  4C3H H;  4DR5 Q;  4PG3 A;  2CCZ A;  2LXK A;  4X62 L;  1I3Q H;  2VW9 A;  4GKK Q;  3GO5 A;  3K81 C;  1KC8 C;  5DLQ E;  3CCL A;  2Q2T A;  3CCR A;  3MEF A;  1I5F A;  4P73 A;  2AMC B;  1UEB A;  2VZA A;  2GVA A;  3IRB A;  4EQ5 A;  4J15 A;  3S24 A;  4EX5 A;  4DR4 Q;  2K52 A;  3CMA A;  3JAM c;  5K36 G;  3F2B A;  1XJV A;  4GKJ Q;  2E2H H;  2D0O A;  1X65 A;  3AYH B;  2JA8 G;  2NVY H;  3EN2 A;  3OTO Q;  3T1Y L;  4DV0 L;  5IP7 G;  2K5N A;  4IFD J;  3CQZ H;  1VQ5 A;  1WCM H;  1FJG L;  4AH6 A;  1R9T H;  1CKN B;  1EIF A;  1E7Z A;  1MJC A;  2F4V L;  2NVQ H;  1KAW A;  4JBJ A;  4DV6 Q;  1O7I A;  3ERS X;  1U0L A;  4GN3 B;  5LMU Q;  3TRZ A;  4P75 A;  2OCE A;  1XMQ Q;  4L5S A;  4X64 Q;  1HZ9 A;  4OWW B;  1P8L A;  2JA7 G;  4BXX H;  3UDF A;  3S1N H;  3GTJ H;  2B3G A;  1X3E A;  1XPU A;  2LXJ A;  2XTI A;  3OYY A;  3S14 H;  5HGQ A;  1N9W A;  3K0X A;  4QIW E;  1Q1B A;  1NMG A;  3CCE A;  1VQF A;  2OQK A;  2Z0S A;  1YJN A;  2N49 A;  1IYJ B;  1HR0 Q;  4P72 A;  4IPH A;  2RF4 A;  4NXN Q;  1CKN A;  1JJC B;  2CWA A;  2IX0 A;  3NEL A;  1EQQ A;  4JI5 Q;  3K7A H;  3I4O A;  1PH9 A;  4GNX B;  2AHO B;  3E9H A;  1UE5 A;  4DV3 Q;  3SGI A;  4UPA A;  3CCU A;  4B3T L;  5GRO A;  3J7A 5;  3AFP A;  3CW2 C;  3I4N G;  4BBS G;  5FLM G;  3I55 A;  2KCT A;  3J81 i;  1SR3 A;  3T1H L;  2YYZ A;  1CKO A;  3PUW A;  4GS3 A;  4GLX A;  2JA9 A;  4WJ3 M;  3NEM A;  4A75 A;  4PZ6 A;  3PF4 A;  3M4O H;  3STB C;  3HOV G;  2L15 A;  2PMZ E;  4R4I A;  3L2P A;  4HIM A;  4DAM A;  2JEB I;  3I4N H;  4Y7N H;  3HOZ H;  4K0K L;  2HT1 A;  1BBW A;  5LMN W;  4LF6 L;  3HOY H;  4IFD I;  1Q8K A;  3FP9 A;  3PO2 H;  2WFW A;  3UDX A;  1K73 C;  2MFI A;  4AYB E;  3L0O A;  1X3F A;  4NPS A;  4UP8 A;  1Q82 C;  4LFA Q;  1N33 L;  2JA6 G;  1TWF H;  2I0Q A;  4JI2 L;  4JV5 Q;  4JI8 L;  1B8A A;  1UE6 A;  4C3J H;  1YBY A;  2JEA I;  1NTG A;  2MNA A;  4R4C A;  4R4Q A;  1XPO A;  3CD6 A;  5FLX c;  4JBW A;  1L0W A;  1PH4 A;  1SMX A;  2ZM6 L;  1QVF A;  4OO1 I;  3STB D;  3M9B A;  4JI7 L;  4X66 L;  3KDF B;  2ZJP A;  3ICE A;  3KFU A;  4Y52 H;  2F3I A;  1IBL Q;  4DR1 Q;  1Q12 A;  4DV5 L;  2ZJR A;  1YNX A;  4BY1 G;  4HJ9 A;  1SRU A;  1YVC A;  4H02 A;  1VQC A;  3I4M H;  4NXM Q;  2AKW B;  4YWM A;  5IYB H;  2OTJ A;  1QZH A;  2MO0 A;  2UUC Q;  2C35 B;  4KHZ A;  2HIX A;  1XNQ L;  3H3V H;  2E5L L;  2E2I H;  2Q2U A;  2BA1 A;  2UUB Q;  2ATW A;  1HZB A;  1MIU A;  1HJP A;  4O0A A;  5IWA L;  3RN2 A;  4BY1 H;  3UDG A;  4A3D G;  3PUZ A;  3A74 A;  5C0X J;  1NJI C;  1VCI A;  4LF7 Q;  4LFC Q;  1X3G A;  4L5R C;  1GVP A;  4HJ5 A;  1FGU A;  2IT1 A;  3GTO H;  4OON A;  1LUZ A;  1M1K C;  3KDF A;  3GDE A;  5IY0 A;  4LUO A;  1I94 L;  4LF8 L;  3Q8D A;  2R6G A;  1S40 A;  3H3V I;  1XNR Q;  1YIJ A;  1N33 Q;  4FDB A;  1HNZ Q;  2JJQ A;  4BA1 I;  1PH5 A;  1WFQ A;  1YJW A;  1YHQ A;  2IHE A;  1H95 A;  1V43 A;  2PQA B;  4DR2 Q;  1QUQ A;  3F2C A;  4DUY L;  2WB1 E;  2WAQ G;  4NB3 A;  3KJO A;  1QZG A;  4A3F H;  1HR0 W;  3HOU G;  3CCM A;  1VQ7 A;  2JK8 A;  3RZD H;  4A3I G;  2MQH A;  1SFO H;  2CKZ B;  2KHJ A;  3PV0 A;  1JB7 A;  1VQK A;  4A4I A;  3ZJY C;  4DK6 C;  1FJG Q;  5C4X G;  2YTY A;  1J6Q A;  4KHP Q;  3RNU A;  5GAH C;  1G6P A;  4DKA C;  4A3I H;  3WWV A;  5AJ3 Q;  1HZA A;  1EQR A;  4YCW A;  2AWO A;  4A3K H;  2Y0S G;  5FJ8 H;  1N32 L;  3KYH C;  3TS2 A;  4JYA Q;  1HNX L;  3RR5 A;  5C4X H;  1A63 A;  1PV4 A;  3CCS A;  1YJ9 A;  2UU9 L;  2PQA A;  2UUA L;  3KF8 B;  1OXU A;  1WCM G;  2KBN A;  4OWT B;  3W1B A;  3HKS A;  2HQL A;  3RLN A;  4YY3 Q;  4DV2 Q;  4DV4 L;  2AWN A;  1XMO L;  4JI4 Q;  4LF5 Q;  4B3S L;  5C0X I;  3LGJ A;  2QEX A;  5JEA G;  2ID0 A;  4DUZ L;  4A76 A;  3GTK H;  1CKM A;  3W1G A;  3K8A A;  4LFB L;  5HY6 A;  4AQY Q;  3S2H H;  1WJJ A;  4YHH L;  1Z47 A;  1VQM A;  4DV1 L;  2UXB Q;  2K14 A;  4GLA C;  3D0F A;  4GN5 A;  4APV A;  4GN4 B;  5BR8 Q;  2LSS A;  4JI1 Q;  1N36 L;  4HJ8 A;  4BXX G;  5IYD H;  2HIV A;  3AFQ A;  4JI3 L;  2NN6 G;  1AE3 A;  1KRT A;  1PA6 A;  3T1H Q;  1OTC A;  2IHF A;  1I6H H;  3G71 A;  1K9M C;  1D7Q A;  4C3I H;  4A93 G;  2JQO A;  2EQS A;  1WYD A;  4YWL A;  4PMW A;  1LYL A;  1IBM L;  1AH9 A;  1TWA H;  3BZK A;  4O2D A;  5LMN L;  1EWI A;  4BY7 G;  2F52 A;  1Q86 C;  4A3C H;  4K0K Q;  4QQB X;  3H0G G;  4DR3 L;  4JI6 L;  3EIV A;  1X56 A;  1J5E L;  4IFD G;  3J81 c;  1C0A A;  4A93 H;  3PO3 H;  1VQ4 A;  2OWO A;  4A3G G;  1HNW L;  4GOP B;  3EBE A;  3F1Z A;  4DR5 L;  5M5X H;  4BY7 H;  3H0G H;  2VUM H;  3UE0 A;  3ULL A;  1X55 A;  3AEV A;  1D8L A;  1VQA A;  2K50 A;  4JI8 Q;  4GKK L;  5GAE C;  1XPR A;  2YU9 H;  4A3G H;  1Y14 B;  1BBU A;  1Q1E A;  3RLO A;  4HJA A;  1VQ9 A;  3HOY G;  3PO2 G;  2RHQ B;  1VQB A;  4LWC A;  2ZM6 Q;  2B63 G;  3GTL H;  2H5X A;  4MZ9 A;  4DR4 L;  5JJK A;  3UDI A;  5ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...