2JA8H

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 16
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja8H00
4DR6L 1CKMA 4JI6Q 2Z0SA 2OCEA 3FP9A 4L5QA 4OWTB 4TQUS 3I56A 2HHHL 3J80i 3HOXH 1QZGA 4BY7G 1NJIC 4GKJQ 3MXNB 4A3CG 4DUZL 3I4MG 3S1QH 5JJKA 5LMNW 1KD1C 1AE2A 2C35B 4QIWE 1N34Q 2I5HA 2ZTCA 4IPGA 4JBMA 2UXDQ 4GNXA 4A3EH 1EFWA 5IYCH 4QY7A 2V1CC 3I7FA 4PZ6A 2NVQH 1IBLQ 4A3DG 4JI6L 1OTCA 4A3LH 4A76A 2GVBA 1IBMQ 2UXCL 4DK3C 4BA2I 2OTLA 4DV4Q 3KDFA 3BZCA 4P75A 4LFBQ 1WFQA 3OTOQ 4LF4Q 4LF9L 1H95A 2UXCQ 4BY7H 5LMNQ 1Q1EA 5C44G 1PH4A 4A3CH 2JA8H 4A3MG 1N34L 1FJGQ 3L2PA 1XMQL 1K9MC 2JA6H 2UXDL 3M4OH 1BBUA 3GO5A 4B3RL 4GOPB 1HZ9A 4R4TA 4GOPC 1HR0Q 4A3BG 1C7YA 4HJ5A 3AFPA 3BU2A 1IBLL 2VUMH 4A3DH 2PMZE 5C0XI 2PI2A 1IBML 1VQOA 4X62Q 5DLQE 4DV4L 2HQLA 4AQYQ 2UU9Q 4LFBL 4DR2Q 3T1YQ 3OTOL 4IFDI 1LTLA 5LMNL 1PH1A 2ZJPA 3PV0A 5ELNA 1CKOA 3HOVH 4R4OA 3S16H 4PG3A 4DPGA 5HY6A 2E2IH 4HIMA 2VW9A 3RN5A 4JI3Q 5E7NA 3HKZE 1YITA 3A5ZB 2EIFA 1MIUA 2F52A 2K50A 1C9OA 3G48A 5IYDG 1XPUA 1G6PA 3NELA 3J7ZC 4GOPA 4NXMQ 1U0LA 1VS0A 4X62L 4AQYL 3F2CA 4DV3Q 4GN5A 4DR2L 3CQZH 3CPWA 1HJPA 3T1YL 2GN5A 4XTCS 3M9BA 4C3HH 1FGUA 3D31A 2JJQA 1XPRA 3HKZG 2ZTEA 1E22A 3A5UA 4UPAA 1K3RA 3J80c 1VCIA 1GKHA 2WP8J 2NN6G 5H1SE 3VDYA 1Y1WH 4JI3L 1N32Q 1UEBA 2BA0A 4K0KQ 2D62A 1KQSA 4OWWB 4KHPQ 3M4QA 3K8AA 2ZM6L 1VQBA 4NXML 1EOVA 4DV3L 2YYZA 4POGA 3DLLA 1P16A 5GADC 3J81i 1YJ9A 4AYBE 1SFOH 1KL9A 5GAEC 1JB7A 1E3PA 1SMXA 3OW2A 3AQQA 5FLMG 1VQLA 4A93H 1L2FA 2GVAA 5JEAJ 1PH5A 4BY1H 3GTLH 1YJNA 1N32L 5M5XH 2KENA 2H5XA 5C3EG 4K0KL 2F4VQ 1HNZQ 5M5YH 4KHPL 3CCSA 1T9HA 4P73A 4A3JG 4R4IA 3RLOA 3U50C 4B3SQ 3GDEA 4JBKA 1QVFA 1GO3E 1IL2A 3UDXA 4AYBG 1XNQL 2LXJA 3BJUA 4DV0Q 1A8VA 3EN2A 4DV2Q 4QQBX 2JK8A 1JJCB 3TS0A 1Y14B 1VQEA 1YHBA 2JE6I 4LF8Q 4APVA 1IBKQ 1NMFA 3PF5A 4C2MH 5FLXc 3F2BA 1Z47A 2OTJA 1PA6A 1V9PA 1I5FA 4P72A 4TVAB 5FLMH 1W2BA 1AH9A 1UWVA 4IO9A 5GAHC 3L0OA 1PV4A 1UE5A 1PH2A 2F4VL 1XTDA 1Y1VH 4B3SL 3A0JA 2R7DA 4IPHA 3UDIA 3SGIA 3KF6B 4ALPA 1Q7YC 3E9HA 5IYBG 2N8NA 5IWAQ 4DUYQ 4R1JA 4DV0L 4DV2L 2UXBQ 3I4NG 4POFA 2AKWB 1GVPA 2R7FA 5IP7H 5IP9G 4BXXG 3NEMA 4LF8L 4X64Q 4LWCA 3NBHB 2ZTDA 2PI2E 1N36Q 4WJ4A 4X66L 4H02A 1WCMG 4YCVA 4YWLA 2WB1G 4MZ9A 1X54A 2K5NA 2KCTA 2NN6I 1SN8A 4J15A 4JOIA 5M3FG 3T1HQ 2DUDA 2K5VA 1ASZA 3L7ZC 3CCEA 3S15H 4DKAC 2ZJQA 2RHSB 4DUYL 5IWAL 2UXBL 1X56A 5IYBH 4BBSH 4MNOA 4YY3Q 1VQKA 1M90C 1K8GA 1G291 4UP9A 2QA4A 1OXTA 5BR8Q 4X64L 2E2JH 1V43A 3KF6A 4DR1Q 1BVSA 3ULPA 5JEAG 1N36L 3Q8DA 2XGTA 1EIFA 3CD6A 3HOWG 1OXUA 4BBRG 1J5EQ 3J81c 1SR3A 3F1ZA 3K7UC 2WAQG 1A0IA 4DNIA 1MJEA 1FL0A 2XTIA 3S14H 4DR7Q 4DV6Q 2CFMA 1HZBA 4UP8A 1HR0W 2JA5G 2WFWA 4JV5Q 2VZAA 1TWHH 3E9IA 2ZJRA 1YBYA 4YY3L 4GLAC 3ULLA 3GTJH 1E1TA 1VQ4A 2IY5B 1I94Q 4NPSA 3HKSA 1U5KA 3TREA 3CCUA 3S2HH 1SROA 2ASBA 2CWPA 4GKJL 1VQHA 3EIVA 1XMOQ 3HOWH 1YIJA 3CAMA 3I4MH 1XNRQ 3JAMi 1LYLA 1TXYA 4DR7L 4LF6Q 3CPFA 4JV5L 3K81C 3S2DH 5C4XG 4XIGS 2CCZA 2A8VA 1X9NA 3CC7A 2B63G 1FVIA 4A3GG 1Q82C 1SLJA 2N3SA 1Q8KA 4HIKA 1I94L 2BH2A 4DV7Q 1JMCA 3GTOH 2CQOA 1QUQB 1JT8A 4LFAQ 2RF4A 2OQKA 4LF4L 4JYAQ 2EXDA 2HIXA 1WJJA 2F3IA 2IHFA 4EQ5A 2K75A 4YHHQ 4HJ7A 4IPCA 3RN2A 2ID0A 1XMOL 4LNQA 3PF4A 4RG1A 3U4VA 1FJGL 5C44H 5HGQA 1EWIA 3ERSX 1D8LA 4A3MH 1PH8A 2N49A 4DAMA 3STBD 4LF6L 1HR0L 1RIPA 1WI5A 2VQEQ 4JBJA 4AIMA 1XPOA 1I6HH 1CSQA 4A3BH 1KRTA 2Z6KA 1Q86C 2R93G 1QVCA 2B3GA 4KHZA 3I4NH 1YVCA 4LF7Q 2L15A 2B63H 3TQYA 4DV7L 2UU9L 4A3GH 3W5OA 2A19A 4FDBA 1YHQA 2N78A 4LFAL 4JYAL 4GN4B 2I0QA 3KOJA 4JBWA 4JI1Q 1ASYA 4C3IH 4A3FG 1QUQA 4R4CA 1PYSB 4JI2Q 4JG2A 4O2DA 3J7A5 4L5RC 2PQAB 2JA7G 1VQFA 3M3YH 2AHOB 2DGYA 4NB3A 4OONA 4LF7L 5IYDH 5K36G 5JJIA 2KHIA 1J6QA 1KXLA 1L0WA 1Q46A 4ME3A 4HJ8A 1NY4A 4JC0A 4JI1L 4L5SA 5C0XJ 4LF5Q 1X65A 1EIYB 2QEXA 5IT9c 1TWFH 1PVOA 1JE5A 3CCJA 3M85A 4JI2L 4DK6C 3OYYA 4X6AH 3S1MH 4IOCA 5GQOA 2ALYB 3B6YA 1E1OA 2BA1A 3H0GG 1XJVA 1HNXQ 4X65Q 1C0AA 4IOAA 2JQOA 2YV5A 2B29A 2IX1A 2PQAA 4UP7A 4QGUA 2R92G 4Y52H 2KHJA 3CMEA 3RLNA 1B70B 1VQDA 4LF5L 1EQRA 3KF8B 4JOIC 1N33Q 1EUJA 3I4OA 3H3VH 3S1NH 3GTPH 3PO3G 3W1GA 2NVTH 3GD7A 1PH7A 1HNZL 1YEZA 5C3EH 4L5TA 1W3SA 2R6GA 3PUXA 3S24A 4B3TQ 3PO2G 1CKNA 4OXPA 1AE3A 4LUVA 4X65L 4A3JH 1HNXL 3H0GH 2JA7H 1L1OA 4DR4Q 4JI5Q 2D0OA 2E8GA 2Q2HA 3F8TA 2ES2A 3KJPA 2MNAA 1X6OA 4HJAA 1X55A 1VQ7A 4B3MQ 1IBKL 3RZOH 1RL2A 4RMFA 3PIPA 3G4SA 1N33L 2HT1A 3AFQA 5AJ3Q 2VNUD 4O0AA 3CXCA 4OO1G 1D7QA 1QZHA 1VQ5A 3KJOA 3HOZG 4B3TL 1NMGA 3LGJA 4PMWA 2K4KA 5M3MG 1VQ6A 1TWCH 4DR4L 2IX0A 4DV1Q 1X3EA 4A3IG 3JC66 1JJ2A 1VQAA 2JA9A 1OXVA 1WYDA 1OXSC 2PNHA 1TWAH 3D0FA 3K0XA 2MO1A 4YCUA 5IP9H 5C0XG 3CCQA 1DGSA 3GTGH 1VQCA 2VQFQ 4DR6Q 4GS3A 1PH9A 4BXXH 3HOXG 2E5LQ 3H3VI 1KAWA 2Y0SE 2HHHQ 2KBNA 2LSSA 2JEBI 2OWOA 3T1HL 1WCMH 3M7NA 4QJFA 1VQJA 2AMCB 5M3FH 1KRSA 1HZCA 3HOZH 1MJCA 3AYHB 3RZDH 3UDGA 1YHAA 5M3MH 4DV1L 1SRUA 1VQMA 3K80C 1EQQA 5BR8L 3I55A 1IXRA 1N8RC 1B7YB 4GN3B 1YNXA 4DR1L 1PH3A 2VQFL 5LMUQ 1VQ8A 4A75A 3PUWA 3CMAA 1PYBA 2E5LL 2IHEA 1Z9FA 1YI2A 4YWMA 1J5EL 5M5WH 3ZJYC 4OWXB 4BBRH 4YCWA 4DAYB 4LF9Q 1UE7A 2Z6KC 3F2DA 1NTGA 2Q2TA 2JA8G 1KIXA 1PH6A 4JI0Q 2JA6G 5FJ8G 4DV6L 3A74A 2FXQA 2KCMA 1XMQQ 4JI4Q 1LM0A 4B3RQ 1K8AC 2AWOA 2JA5H 2AWNA 4DR3Q 2VUMG 3PGZA 5IE8A 3TS2A 3CCRA 4JI7Q 1VQGA 5LMUL 1N9WA 4PZ7A 1GM5A 1A63A 2RCNA 4NXNQ 4OX9Q 1YJWA 4LFCQ 1E24A 1O7IA 3MEFA 1XNRL 4OO1I 2MFIA 3HOVG 4JI0L 2I5LX 4A3KG 1VQPA 4DV5Q 5FJ8H 4JI4L 4UY8C 1S72A 2E2HH 4Y7NH 1BBWA 3CF5A 3H15A 5C4XH 2NVXH 3WWVA 4DR3L 5EAYA 4JI7L 1Q1BA 1S3OA 1BKBA 5C4JH 4LUOA 5GAGC 4LUZA 4NXNL 4YHHL 4P74A 3UDFA 5IY0A 4OX9L 3GTKH 3HOYG 4LFCL 3HOUG 2ATWA 3STBC 4DR5Q 1X3GA 3EBEA 2UUAQ 3CC4A 2K5HA 3UE0A 3PUVA 1V1QA 3J81j 1GD7A 4DV5L 3GTQH 4GLVB 2YU9H 3DM3A 2VQEL 3FKIG 4A3KH 1Y1WG 3ICEA 3TEHB 3GTMH 3HFZB 3CCLA 5JJLA 3U58A 2R93H 1JJGA 3CCMA 1X3FA 4A4IA 3M4PA 2EQSA 4YWKA 4AH6A 2ZM6Q 3TRZA 4EX5A 1I50H 2RHQB 4IJHA 2K14A 3FHWA 4JCVE 3W1BA 1HZAA 3RNUA 1EYGA 3HOUH 3HOYH 2MQHA 4DR5L 4A93G 1P8LA 1PFSA 1CKNB 2UUAL 4BY1G 4A3FH 2JEAI 4IFDJ 3PUZA 3S17H 3CW2C 2VS1A 3FKIH 3U4ZA 1B8AA 3JAMc 5J3BA 3K7AH 3IRBA 3CP0A 3G6EA 3KFUA 1XNQQ 2K52A 4GKKQ 1LUZA 2NZOA 5GROA 3ULJA 1S40A 3E0EA 1UE1A 4GLXA 1CUKA 1CSPA 2Q2IA 2Q2UA 4JI8Q 4QL5A 1NE3A 1HNWQ 1IYJB 1VQIA 1A62A 1QVGA 4WJ3M 1Y1VG 1UE6A 3G71A 1PHJA 2CKZB 1Q12A 2QGQA 3ER0A 2YTXA 3PUYA 4P71A 2HIVA 1SE8A 3PIOA 5IP7G 3CCVA 1G51A 1K0RA 3S1RH 4GKKL 2R92H 4KI0A 3KYHC 2CWAA 4HIDA 1M1KC 2UUCQ 2R7ZG 1E7ZA 2UUBQ 4JI8L 3CC2A 4C3JH 1HNWL 2VY3A 1I3QH 4IPDA 3PO3H 4X66Q 1K73C 2LXKA 2A1AA 4LW1A 1VQNA 1OXXK 1L1OB 1K83H 1L1OC 4KLKA 2BH8A 3PO2H 1R9TH 4JI5L 3UE1A 3I2ZA 1VQ9A 1HH2P 2WB1E 1KC8C 4BBSG 4B3ML 3NENA 4IJLA 1Q81C 4MTNA 2UUCL 3KLWA 3PCOB 3RLFA 1KHIA 1IZ6A 2UUBL 3AEVA 5AJ3L 3RR5A 2R7ZH 2NZHA 2YTYA 3PSIA 4IFDG 4GNXB 4GNXC 2I5MX 2IT1A 1YZ6A 4DUZQ 2YTVA 4BA1I 4HIOA 2MO0A 2NVYH 2OQ0A 4HJ9A 4A3EG 1NBWA 1TWGH 5IYCG 4PZ8A 1MKHA 1WOCA 3BZKA 4A3IH 2VL6A 2Y0SG 3KDFB 2WAQE 5ELOA 4A3LG 2D0PA 4R4QA
chains in the Genus database with same CATH superfamily
1PTOC 4JI6Q 4MHEA 1STNA 4JW0A 1WCMB 4OWTB 4TQUS 3T16A 5HURA 1QZGA 1EFID 3S14B 5M3FB 1NJIC 1MHWC 5FLXE 5LMNW 3J7AF 1AE2A 3NP8A 2PW7A 4JBMA 1Q90A 2PYKA 4HR7B 5G3LF 4A3DG 3VR3A 4E6IA 1QNUA 1OTCA 4A3LH 1NNXA 4BA2I 1DXMA 3Q6SA 1Q1EA 1PH4A 2JA8H 4A3MG 2HD3A 1N34L 1FJGQ 3L2PA 2JA6H 3GO5A 1HZ9A 2K32A 2EDGA 4A3BG 4HJ5A 3AFPA 2VUMH 1IBML 4X62Q 5DLQE 4DR2Q 1TU2B 3OTOL 2HUGA 5LMNL 2RCFA 3PV0A 3HEJA 3HOVH 2XSCA 4PG3A 1SMYC 2F0QA 1TS4A 3NK9A 4ZKBB 4A3GB 1YITA 4U68A 3QR8A 1MIUA 2K50A 4DK1A 5FO8B 3J7ZC 1II3A 1VS0A 4DV3Q 4GN5A 3CQZH 1FGUA 1TT2A 3GTQB 3HKZG 2ZTEA 3M3YB 5KGUA 4MIUA 2R93B 1IW7D 2WP8J 3VYUA 2NN6G 3SXHA 1N32Q 1UEBA 2K1BA 3NXWA 3M4QA 1VQBA 4ABNA 1EOVA 5CMDA 3HKZB 4Q0FA 2NZ1D 1QNKA 3EVQA 1YJ9A 2NWGA 4A93H 1VQLA 3AQQA 5FLMG 3EROA 3PIO3 2DJFC 5KEEA 1E2VA 2H5XA 3TBIB 3TP6A 3CCSA 4A3JG 4V190 4R4IA 1QVFA 4KJNA 4RH6A 2G9HD 2LXJA 4OL7A 1A8VA 4QQBX 2LS01 2MP1A 1GOZA 2F0WA 1YHBA 1VQEA 2JE6I 4LF8Q 3F2BA 1KTKA 5CV5A 1PA6A 4TVAB 1Q3LA 1ET9A 2CH4A 3S1RB 3A0JA 4CDFC 3KUPA 3KF6B 2RDHA 3KLRA 1LLRD 4DUYQ 2NTTA 4R1JA 1HFNA 5IP7H 5A2QE 2RA4A 1LT5D 3Q0AA 4X3KA 4X64Q 3FPPA 3CKIB 3NBHB 2ZTDA 1N36Q 4WJ4A 4ZYSA 1K83B 1BXTA 4YCVA 4YWLA 2WB1G 4MZ9A 4JOIA 4UDUC 2DUDA 1O78A 1C8CA 1TY0A 3C2PA 3CCEA 3S15H 2ZJQA 4BWGB 2RHSB 1X56A 5AFWA 1ONLA 1D1IA 1M90C 5E4WC 2B2WA 4UP9A 3D3RA 3OMGA 1EEFD 4DR1Q 2L12A 3VYSA 3Q8DA 1OXUA 1TWGB 2NYZD 4DNIA 1A0IA 2SOBA 4K8JA 1HZBA 2JA5G 2M2LA 3U9SA 1WTPA 2VZAA 1Q8IA 3C1FA 1SYGA 5M5WB 1E1TA 1HTLD 1VQ4A 3M7GA 4FVMA 4DN4M 3TREA 3CCUA 3S2HH 1SROA 2ASBA 3DHQA 3EIVA 3IL8A 3BVMA 1XMOQ 3HOWH 3CAMA 1SNMA 3A54A 5KYLA 2KQ3A 1LYLA 4JV5L 3S2DH 2CCZA 2A8VA 5JVG3 1BUVT 2AQ2B 2N3SA 2CQAA 5K5PA 2EXDA 2JA8B 1ML0D 4LNQA 4IPCA 2BCOA 2ID0A 3PF4A 3BYTB 2L1BA 2EYMA 3ERSX 3HP3A 1PH8A 2N49A 3STBD 3RUZA 2VUMB 1RIPA 1WI5A 1KRTA 1F9RA 2AQ3B 3D4RA 2B3GA 4PQXA 1ZYRC 4LF7Q 2UU9L 1YHQA 4LFAL 1LV9A 3MZ5A 3HOVB 3KOJA 2YU9B 3NSWA 5CV7A 3GTMB 5J22A 1QUQA 4JI2Q 4CDDC 4OHJA 4ZK9B 2PQAB 4KJOA 3OWFA 2PZWA 2DGYA 2LMCB 1VMCA 3HOUB 1J6QA 3OW7A 2LY7A 1IKMA 3EA6A 3KBXA 4ME3A 4HJ8A 4CKEA 4JC0A 1EY4A 1IYVA 5C0XJ 1X65A 4FF3A 1RJTA 3CCJA 3S1MH 2ALYB 3MWYW 2A6HD 2L11A 3B6YA 1LTAD 4IN3A 3K5MA 1C0AA 2L0CA 2EYPA 4IOAA 2JQOA 2YV5A 4QGUA 2WINB 4A93B 4ZCKA 1B70B 1A6XA 1BDOA 3X3NA 1HCZA 4JOIC 2QEJC 2F0HA 1N33Q 2OT2A 1EUJA 3H3VH 2F1MA 1K0SA 3O13A 1YEZA 2XN9C 4K2KA 4L5TA 1HNXL 3FDTA 4DR4Q 4PMCA 1Z6HA 1RKNA 3KJPA 4C3JB 5ELBA 1VQ7A 1L0YB 2WACA 1FNWA 2VNUD 1G8ZD 3C1EA 2AUKA 4O0AA 2A69D 1CTMA 1VQ5A 3KF8A 3QO2A 2L5TA 3J7AV 1VQ6A 4XYOA 3JC66 1STYA 1XX8A 3I4NH 1OXSC 2BDNA 3K0XA 5IP9H 5C0XG 4GS3A 1LTBD 3HOXG 3H3VI 1NCVA 4KY7A 2KBNA 4CDCC 2PPBC 1EYCA 3S15B 3NQTA 2JN4A 5IODA 3H09A 5E3FA 2PZUA 2EXZA 5M3MH 4DV1L 5EGTA 4QCLA 5BR8L 1N8RC 1IXRA 1AFPA 1B3AA 1DD2A 3S1QB 1SNOA 1PYBA 2E5LL 1SBBB 2IHEA 1Z9FA 5JEAH 1J5EL 4I7AA 3ZJYC 4DAYB 4A3EB 1Y69U 4MTKA 1QB5D 3A74A 3SR1A 2RBMA 2Y0SB 3K5OA 4H44C 2A68D 3S2HB 5IE8A 1TS5A 1N9WA 4NXNQ 2O5JC 3NWTA 4CKCA 1SJHD 3TMEA 2QF7A 4A3KG 5ELDA 4DA2A 5C4XH 3OSOA 2A5HA 1IYUA 2RQXA 5C4JH 1FNVA 5GAGC 5CORA 4YHHL 4IUUA 3GTKH 3S16B 3IKJA 1PRTF 4LFCL 2O5IC 3HOYG 3MXGA 2WV6D 4DR5Q 3EBEA 4N8X1 3I4LA 3UE0A 4XXEA 4DV5L 3ICEA 1Y1WG 4NDXA 3HFZB 3CCLA 1SYDA 4ME5A 4G4KA 1HA5A 3HG9A 3FHWA 2F0OA 2MQHA 1YNJC 2PQEA 2JEAI 4IFDJ 4I7ZC 4FNFA 2X6GA 3FKIH 5J3BA 3FEWX 1UEAB 5K36H 4HN7A 2K52A 2J4XA 3CRLC 1LUZA 4RAUC 5GROA 2SDFA 1U4RA 2Z6BA 3ULJA 1CI3M 2F0MA 2IW3A 2IJ0A 2PZTA 2G5DA 1VQIA 1WTHA 1BBXC 2ENBA 1Y8PB 2YTXA 4LJZC 4GKKL 5JJLA 2R92H 3I72A 4HIDA 1M1KC 2UUCQ 3K5LA 2UUBQ 5IOCA 2F3VA 3CC2A 1HNWL 4TKOB 3OIPA 1I3QH 1X32A 3PO3H 2ICEC 4LW1A 3NTHA 1TVXA 1B9NA 4JI5L 2KECA 1MGSA 1LT4D 4IUVA 1H9SA 2WB1E 4BBSG 2Z4HA 1DYQA 1JWUD 1IZ6A 5LL6X 4HMIA 5AJ3L 4BS9A 2NZHA 4IFDG 3DWAA 2KEDA 2HCIA 2CH4W 4OO1H 2A6ED 3WOEA 2OQ0A 3VR4A 4RWSC 5IYCG 3I4NB 1I4RA 4PZ8A 1MKHA 5G3LD 2PNRC 5ELOA 4RFBA 2D0PA 3IFTA 1CKMA 1YNNC 4ID6A 2Z0SA 2OCEA 1SYBA 3I56A 3J80i 4BY7G 2Q8IB 1STGA 2VB3X 4C56C 5JJKA 1KD1C 3T51B 5A35A 4GNXA 3MXUA 4EQNA 2V1CC 4PZ6A 2NVQH 1IBLQ 3VA7A 2K04A 4EVOA 2EYHA 4A76A 4DK3C 1VMPA 2OTLA 4DV4Q 3KDFA 3BZCA 5F2DA 5FK9C 5C44G 1JOKA 2J7ZA 1XMQL 1K9MC 2UXDL 2DNCA 4B3RL 3TZUA 1C7YA 5FKAC 1B53A 4QIWB 4A3DH 3URYA 2PI2A 2F0FA 2UU9Q 1T5EA 4LFBL 3SK6A 1CA6A 2M00A 3QB3A 1CM9A 4C3IG 5ELNA 5C4XB 2EY5A 2B63B 2K05A 3A5ZB 2EIFA 4H13C 1WD0A 1NSNS 1XYIA 1C9OA 3GTKB 3NELA 1GUTA 4NXMQ 1U0LA 4AQYL 1NR4A 3F2CA 3CPWA 3T1YL 1HJPA 2GN5A 3M9BA 4XQJA 1E22A 2KCNA 4UHVA 4UPAA 1K3RA 4F87A 3VDYA 4JI3L 4GZYC 1B3QA 4CJ1B 1F9SA 1RHPA 4JPBW 4S3SA 1TR5A 4FXKC 1TY2A 3ND9A 3J81i 4AYBE 1E3PA 1CZWA 4LK1C 3D6CA 1PH5A 2K5WA 2RSNA 5E1FA 1AW7A 4BY1H 1U9RA 2K28A 1YJNA 1H9SB 4I65A 3BVZA 4K0KL 2NN6H 2F4VQ 4CJ2C 3KBGA 4KHPL 1BCPD 2JA7G 4B3SQ 3ND8A 3GDEA 1IL2A 1ZXTA 4XT1B 3S1NB 3TS0A 1Y14B 3JAML 4TSSA 4C2MH 1Z47A 1V9PA 1I5FA 1AH9A 5FLMH 1BCPB 1UWVA 3H0GB 1PV4A 3L0OA 4RGNA 4HCSA 1PH2A 5I6YA 1DOLA 1KDBA 2CW0C 3EJIA 1Q7YC 4DV0L 5IYBG 2N8NA 2NBFA 5IWAQ 4DV2L 5IIFA 4RHRA 1HHVA 1FD7D 4BXXG 1PLFA 3PO3B 1GJXA 2K5QA 1WCMG 1X54A 2K5NA 2KCTA 2NN6I 4KY5A 5M3FG 1JCKB 1ASZA 2UXBL 1AEXA 4MNOA 4YY3Q 1VQKA 2KCCA 1K8GA 5BR8Q 3KF6A 4NMZA 3HOZB 4IZ8A 1J5EQ 4XQQA 3RZDB 2F4IA 4K5VA 3DWQA 2F0TA 2IPKD 3NBHA 1AZQA 1EY0A 1FL0A 2XTIA 1EU3A 2QILA 4UP8A 1HR0W 3E9IA 1YBYA 4FF2A 4QB4A 2Q8TA 2ZXPA 4NPSA 3C3LA 1HUNA 5J39A 2CWPA 2F0GA 4KY6A 1DJRD 1VQHA 1DZ1A 4KHVA 1B9MA 3I4MH 1TXYA 5DEHA 5C6AA 4DR7L 3OOCA 2FFKB 4LF6Q 4DXGA 4XIGS 4A3GG 1FVIA 1Q82C 1I94L 1SNDA 1Q8KA 2BH2A 3GTOH 4DV7Q 3D6WA 2CQOA 1VF7A 2OQKA 4EQ5A 1WJJA 4YHHQ 2K75A 4M8AA 2Q8RE 3U4VA 4MN3A 1D8LA 3NQIA 1EOTA 4DAMA 1HR0L 4JBJA 1B50A 1F2YA 1XPOA 1S4ZA 3SK4A 2R93G 1C48A 2Z6KA 1YVCA 4Z9CB 1S5ED 3TQYA 2A19A 4FDBA 2N78A 2MGSA 3K58A 4JYAL 2ICIA 2I0QA 1CQFA 4C1NI 2PCFB 4JBWA 4JI1Q 1EZ8A 1ASYA 2E2DC 3VYTA 1PYSB 2I07B 3HGBA 4O2DA 3J7A5 1EWHA 1B4OA 3BG3A 1F2MA 5IYDH 4NB3A 5JJIA 1EL0A 1JR0D 4J8QA 4HCEA 2SNMA 1EIGA 2D2CC 1KDCA 1IW7C 4PMBA 4LF5Q 1EIYB 2QEXA 1TWFH 1PVOA 3K7AB 4DNTB 1DONA 3OYYA 3G7LA 3V2TA 4IOCA 2IWHA 2EY2A 1J8IA 1C4QA 3D4DA 4IURA 2B29A 1KNAA 2PQAA 3KLSX 4L6TB 3J80L 4X3UA 2KHJA 1VQDA 4BY1B 1EQRA 3EFXD 1V1PB 1VF5C 2NVTH 2A73B 5C3EH 1W3SA 1EQTA 2R6GA 4QUFA 4OXPA 3HZXA 4X65L 3RD4A 3N6RA 5KYIA 4JI5Q 2MNAA 2P5ZX 4C2MB 3SVMA 1IBKL 3RZOH 2KVMA 1L0XB 2R3ZA 3PIPA 3G4SA 2HT1A 3AFQA 2L9HA 5AJ3Q 4NP5A 2OEOA 4WJWA 1RD9D 4B3TL 2O2LD 5DAUA 1X3EA 1D2BA 2R7ZB 1WYDA 2PNHA 1PFNA 2XWJB 4KK7A 1VQCA 2VQFQ 4XDXA 1DOMA 2JEBI 2F0JA 1O7ZA 2WIIB 1MJCA 1JWSD 3UDGA 1UUPA 1IKLA 1HTPA 2QDBA 1ZEQX 1CHQD 5IGDA 3I55A 4RCOA 3NE5B 4RCNA 1PH3A 5LMUQ 1WD1A 1A2UA 4K8IA 3P20A 1YI2A 1S5CD 1EYAA 1NUCA 1PTOF 3FVQA 4BBRH 4YCWA 1BNZA 3F2DA 2Z6KC 1NTGA 2JA8G 1KIXA 4JI0Q 2JA6G 5FJ8G 2FXQA 1XMQQ 4IUTA 2BE5D 4B3RQ 1K8AC 2AWNA 4P2CB 2VUMG 3PGZA 3NPPA 5C3WA 4JI7Q 2EYOA 4PZ7A 3I4MB 1PRTD 4OX9Q 2JA6B 3QWNA 1MD2D 1XNRL 5IGCA 3HOVG 4K6LA 4JI4L 4UY8C 1S72A 4DAYA 1DCZA 3T13A 4DR3L 1EY7A 5EAYA 1PRTB 5JPNC 1ENAA 4LUOA 2F0KA 2K01A 3UDFA 1SNCA 5IY0A 3HOUG 1X3PA 4KV6A 2Z8LA 3STBC 1A15A 2EY1A 2UUAQ 2A74C 2K5HA 1TS3A 1JOOA 3J81j 1WTWA 4HTHA 3CHBD 2VQEL 4A3KH 3CQZB 1X3FA 5HGTA 4YWKA 1GUGA 2K14A 3W1BA 3RNUA 3HOYH 4A93G 1PFSA 1K28A 2WKCA 4A3FH 1LACA 1D6EC 3S17H 3CW2C 2L4NA 2VS1A 3JAMc 1PZKD 3CP0A 2H1EA 2F0UA 4KKTA 3R2TA 3U9OA 1TWFB 1A3UA 2KJXA 1UE1A 3E0EA 4GLXA 4OEMB 1SYFA 2Q2IA 4C3JG 2F0SA 2A6HC 4JI8Q 4O1NA 4QL5A 1NE3A 1A2TA 1A62A 1PXUA 1QVGA 4WJ3M 2F0NA 4CDEC 3PIP3 1SXTA 1PHJA 3K57A 5IT9L 1GUOA 3CCVA 1SE8A 5IP7G 5FO7B 2NB0A 3FMCA 4KI0A 2CWAA 2NVTB 1E7ZA 5C3EB 4IPDA 1JE4A 1OXXK 1L1OB 1L1OC 4KLKA 3PO2H 1R9TH 1VQ9A 1D5MC 3RZOB 1HH2P 5EKKA 5DM63 4B3ML 5BN5A 1Q81C 4MTNA 2A69C 4IALA 1QE6A 1Y8NB 1LTTD 2NVYH 5ELCA 4A3EG 2F0VA 2D9UA 3PMFA 3A55A 3BZKA 4A3IH 2VL6A 2Y0SG 4R4QA 4DR6L 2F0LA 3FP9A 4KN7C 2HHHL 2VXWA 1HPCA 4F7XA 3MXNB 2B8FA 4A3CG 4DUZL 4PNYA 2C35B 1N34Q 2DN8A 2I5HA 2ZTCA 4IPGA 1O80A 1EFWA 5IYCH 3I7FA 4JI6L 1H9JA 2GVBA 1IBMQ 1BF4A 3V05A 4BBRB 3HOWB 2WAQB 1WFQA 3OTOQ 4WORA 4C1NK 4BY7H 1CT1D 5LMNQ 1EU4A 2A68C 3S2DB 1MSHA 4RGOS 2EOTA 5C3XA 1BBUA 1TIID 4R4TA 1MI2A 1SE4A 4GOPB 4GOPC 2CVRA 1HR0Q 3BU2A 5C4HA 1EYDA 1M4VA 4RGMA 1WTXA 1B1ZA 1IHZA 3R2IA 1VQOA 4ZRZA 2HQLA 4IFDI 1LTLA 4IUQA 2ZJPA 1CKOA 4R4OA 3MEHA 2HQEA 5HY6A 2E2IH 2VW9A 1LABA 3RN5A 3HKZE 2F52A 1CHPD 2E76C 2V4DA 3G48A 4DAPA 3MAQA 1EY5A 4X62L 1STHA 4DR2L 1RODA 1EWCA 5I9OA 4C3HH 3K59A 2F0PA 2PW5A 3MTSA 1CZGA 3CRKC 3J80c 1VCIA 1GKHA 1PFMA 4OWWB 2ZM6L 3K8AA 1ENCA 1VDZA 3C46A 4DV3L 5EBCA 1G91A 2YYZA 5JPMC 3DLLA 1SNQA 5GADC 4A3FB 2KUMA 1E2WA 1SFOH 1KL9A 3S1MB 5GAEC 5JEAJ 2GVAA 1N32L 1HXYD 5M5XH 5CR3A 1TS2A 1Z7TA 1T9HA 3QOJA 4P73A 2R61A 3DEPA 3R8BA 5I4DA 3UDXA 5IGEA 2D5DA 3BJUA 2O4XA 2JK8A 3H3VC 1JJCB 1RDPD 3MXPA 5EBDA 2B39A 5KRUA 1IBKQ 2OTJA 3I73A 1LTSD 3QOLA 2XRQD 1UAPA 1JICA 1UE5A 4J6HA 1Y1VH 2B8GA 2R7DA 5CV8A 4IUNA 3UDIA 1QILA 2EYJA 3SGIA 4ALPA 1JQYD 3I4NG 1G2TA 1GVPA 3T4AC 3BVGA 5IP9G 3NEMA 4LF8L 1KABA 2DJGC 2WKDA 4KKSA 4LWCA 5CYUA 2DNEA 1DOKA 5D65A 1BR9A 4FYDA 2KEEA 1EEID 4X66L 4H02A 3PO2B 1R9TB 1W6JA 2JXMB 4N9PA 3NTKA 3I91A 1LT6D 4JK1C 3L7ZC 1H9RA 4LAAA 4DKAC 4DUYL 3LWUA 1KLUD 5IYBH 3A7LA 4N8FA 4FP5D 4B08A 4QUCA 4X64L 2K5DA 1V43A 5JVH3 2A6EC 5JEAG 1N36L 1WVLA 2XGTA 1PTOH 1EIFA 3CD6A 3J81c 3K7UC 3F1ZA 5M3MB 1SNPA 1MJEA 4A3IB 2HCCA 1WTOA 3S14H 2FINB 4JV5Q 2WFWA 3BDCA 1TWHH 2QCPX 2ZJRA 5EQ0A 3GTJH 2JP1A 2MPMA 1PDQA 2EVBA 4GKJL 1F9QA 4CBVA 1GHKA 1YIJA 1XNRQ 4HSVA 3CPFA 5C4XG 1X9NA 3CC7A 2ZT9C 2B63G 2QKIC 2F03A 3DMUA 3H6MA 4LFAQ 2RF4A 4LF4L 1PZJD 1KLGD 2HIXA 2UXCL 2IHFA 2F3WA 1XMOL 4RG1A 1LTID 5CBAE 2TMPA 1EWIA 3D8GA 5FOBB 4A3MH 3OIQA 2VQEQ 5C4JB 4FF4A 1I6HH 4A3BH 1GUWA 1QOHA 1QVCA 2L15A 4A3GH 3W5OA 1GUNA 3NBIA 2E2IB 5J1ZA 1EY6A 4K5XA 1ESFA 3D4WA 1RTNA 4L5RC 1FR3A 3M3YH 1EQVA 2AHOB 2MUYA 4OONA 4LF7L 5K36G 4C3HB 2KHIA 1L0WA 1Q46A 1NY4A 4RKBA 3PQIA 4L5SA 3QJYA 4HAEA 2VB2X 4F88A 3FKIB 5IT9c 1F2LA 1JORA 4JI2L 3M85A 4JVZA 4X6AH 1HQRD 3QIAA 3VR6A 1E1OA 4WFN3 1AN8A 1AP0A 2BA1A 3H0GG 1HNXQ 1A3TA 2KA7A 4Q5VA 4G7ZC 1EY8A 1SFOB 2IX1A 4UP7A 2R92G 1WTVA 3CMEA 3RLNA 1GUSA 2EJFC 3I4OA 1BCPC 3GTPH 1LTGD 3PO3G 3W1GA 5I9PA 3GD7A 3BYYB 1HNZL 2QW7A 3S24A 1CKNA 1E0BA 4A3JH 4LUVA 2R92B 2EY6A 2D0OA 3F8TA 3NTIA 2EJMA 4HJAA 5D14A 1CQVA 1XXGA 4B3MQ 1I3QB 4ULLA 4RMFA 1BOSA 1N33L 2EYLA 1Y1VB 4OO1G 1TQOA 3KJOA 1K8OA 3HOZG 1F9PA 1V1PA 1NMGA 1SYCA 3LGJA 4PMWA 1TWCH 2HDMA 4DR4L 2MHVA 2N88A 3E0JA 3JAME 5FLXL 4DV1Q 2K7VA 4DFAA 4Y7NH 3MFYA 2MO1A 3GTGH 3CCQA 4DR6Q 1DGSA 1STAA 3P1HA 1PZID 1D1KA 2E5LQ 2Y0SE 4V0BA 4CGYB 1PTOD 2HHHQ 3T1HL 3M7NA 1VQJA 1KRSA 1HZCA 4XT3B 5ELFA 3AYHB 3OWEB 1VQMA 1S5DD 1EQQA 1B44D 1GHJA 1B7YB 1PTOB 3PUWA 5I2XA 3RMHA 4YWMA 5M5WH 3MA2B 3F2UA 2Q2TA 5CV4A 2NVQB 4DV6L 1TWHB 5IGBA 1LT3D 3K5NA 1LM0A 3GTJB 1QG7A 2JA5H 4LMQD 3G6JB 4L8JA 4HSPA 1A63A 4R8IA 2NUCA 4OIKA 1O7YA 4LFCQ 1E24A 2MFIA 5EPLA 3ZYYX 4DV5Q 3FRPB 4A3DB 3OPOA 5FJ8H 2LFNA 2E2HH 2NVXH 3CF5A 3H15A 3WWVA 1SMYD 1TKWB 1A3VA 1S3OA 2H4OA 4NXNL 3E3XA 4K2LA 4ZUIA 3VA5A 2XWBB 4A3MB 2ATWA 1X3GA 1I6HB 4A3BB 1GD7A 2YU9H 3GTMH 4RA8A 1JOQA 3A56A 3A8JE 3M4PA 2EQSA 3R93A 1D5ZC 4ZUJA 3WOFA 4EX5A 1I50H 2RHQB 2ZM6Q 1K8MA 4JCVE 3Q23A 3DXJC 3QG1A 1HZAA 1EYGA 3HOUH 2B2VA 5ELEA 2XRSD 4DR5L 1P8LA 1CKNB 4BY1G 1K3BC 2MJ8A 5ISRA 1S5FD 3DM1A 3PUZA 3MC0B 3TP5A 2XNAC 3G6EA 2AQ1B 3KLSA 1KDAA 2Z4IA 4GKKQ 2NZOA 5IGGA 1S40A 1NR2A 2Q2UA 4FXDA 1HNWQ 5A2QL 3P7JA 3LNNA 1MSGA 3G71A 4IUPA 2CKZB 2QGQA 3ER0A 1F77A 1RCVD 3PUYA 4K5WA 1G51A 1K0RA 4DNRB 3DWPA 5CC4A 3KYHC 3OMCA 3GTPB 2R7ZG 1KAAA 3HRZC 4C3JH 1ICWA 2VY3A 3KK7A 4A3JB 1AZPA 4X66Q 2LXKA 3TDQA 2EE1A 3J80E 1R4PB 2JYOA 3BDOA 2BH8A 2F0DA 3K0YA 3ITPA 1BCPF 2XIWA 3NENA 1LTRD 4IJLA 1JB3A 5CV6A 3KLWA 2UUCL 3RLFA 1KHIA 3AEVA 2UUBL 1GXDC 2CHBD 3RR5A 2YTYA 3P75A 2I5MX 5JAVA 1TWCB 5TSSA 4BA1I 4HMJA 3DEOA 2MO0A 1NBWA 4Y7NB 2FMMA 3GTGB 4A3LG 1L1OA 5T1GA 5C0XH 1I4PA 4L5QA 3HOXH 2N55A 2WB1B 3OHXC 4K14A 4GKJQ 3I4MG 3S1QH 3TP8A 3I3CA 4QIWE 2UXDQ 4A3EH 5T1IA 1NAPA 4QY7A 2SNSA 2ZXOA 3ERQA 1BO0A 5JOBA 4UAIA 3J81L 1KNEA 4ZAIA 1SDFA 1V1OA 4OGQC 2LKVA 4P75A 2B2TA 4LFBQ 4LF4Q 1JC7A 4LF9L 1H95A 2UXCQ 2BE5C 4L63B 3GP7A 2FJ2A 4A3CH 2JA5B 3M4OH 5FO9B 3MXNA 3GTOB 1I4HA 1IBLL 1PFBA 1PRTC 4CHTB 2B2VC 2PMZE 5C0XI 1I4QA 2M9VA 5C4ZA 4DV4L 4AQYQ 3T1YQ 2IL8A 1ZYRD 1OO9B 4CJ0B 3NHHA 1PH1A 5LHY1 2I46A 2E2HB 2NVXB 3S16H 4DPGA 3J81E 3VR2A 4HIMA 2K6AA 4JI3Q 5E7NA 5IYDG 4J1MA 1XPUA 1G6PA 1G6ZA 5L37A 1HUMA 4GOPA 3A8IE 4XTCS 3D31A 2JJQA 1XPRA 4K6DA 5EJWA 3A5UA 5D3DA 5H1SE 1Y1WH 3HS0C 5DM73 2BA0A 2RSOA 2IX3A 2D62A 4K0KQ 1KQSA 1I50B 4KHPQ 1WTRA 3WDNA 4NXML 2L55A 4POGA 1P16A 2RKSA 3W3AA 3MVVA 3LX0A 4OELB 1JB7A 3OW2A 1SMXA 4FO2A 1L2FA 4H7BA 3GTLH 2KENA 4G7OC 5C3EG 1HNZQ 5M5YH 4JBKA 3U50C 4QF4A 3RLOA 1GO3E 1XNQL 4AYBG 4DV0Q 3EN2A 4DV2Q 2C5CA 4APVA 1NMFA 4B9XA 3PF5A 5FLXc 4B9WA 3ONAB 4P72A 3AU7A 1W2BA 1I4GA 2SEBD 4IO9A 5GAHC 4AYBB 2F4VL 1XTDA 4B3SL 4DF7A 4IPHA 4KD4A 2B2WC 3L9AX 3E9HA 2UXBQ 5EKIA 4POFA 2AKWB 2R7FA 3CU7A 1HQMC 2Z9HA 5E4XA 1I4XA 2PI2E 5COYA 5CGKA 3IAYA 3T56B 3V96A 5IT9E 1U4MA 3E6ZX 4J15A 1SN8A 3T1HQ 1ICFB 2K5VA 2HDLA 4ODGA 5IWAL 2B2TC 1FGBD 4DK0A 3NWSA 4BBSH 1G291 2QA4A 1OXTA 2E2JH 1BVSA 3ULPA 1WTQA 3MFGA 3HOWG 4IFDH 4BBRG 2RVLA 1SR3A 3SK5A 2WAQG 2BOSA 1LO5D 4CKBA 4DR7Q 4DV6Q 2CFMA 2KOLA 4ILWA 3X3MA 4YY3L 4GLAC 3ULLA 3HOXB 4OIJA 1HRJA 1I94Q 4EGVA 3HKSA 1U5KA 1CK1A 1JWMD 3I8ZA 4DXFA 3JAMi 4NKLA 4KMUC 1EIHA 3K81C 3J7YW 5NUCA 5C5LA 4NW2A 1SLJA 4HIKA 1JT8A 1JMCA 1QUQB 3K6OA 4JYAQ 2F3IA 4HJ7A 4RKLA 3RN2A 5LL6S 3BDLA 1QJOA 3M4OB 2AUJD 1FJGL 5C44H 5HGQA 1M8AA 2F0IA 4LF6L 4AIMA 1CSQA 1Q86C 3MHBA 4KHZA 4DGZA 2B63H 4DV7L 1RTOA 4GN4B 4XYQA 4A3KB 3TN2A 4C3IH 4A3FG 4R4CA 2PO4A 5KIXA 4JG2A 1ILQA 1YNJD 4R8NA 1VQFA 3SDZA 1B2TA 1I6VC 4X3TA 3HOYB 2TSSA 1UNSA 1KXLA 1STEA 4JI1L 4RGTA 1IL8A 3SHLA 3FPUB 3S17B 2RDGA 1Y1WB 1JE5A 4KD3A 4DK6C 1X3QA 5GQOA 1DM0B 1ET6A 5EPKA 1XJVA 3TSSA 5BN3A 4X65Q 4WRDA 5I2YA 3S9WA 4N9TA 1Y8OB 4R9WA 4Y52H 4LF5L 3Q24A 3GTLB 3KF8B 4M1UB 3NUCA 1QWYA 3BS1A 5M5YB 3S1NH 1STBA 1PH7A 1HFGA 2EZVA 3PUXA 1W6KA 4B3TQ 3PO2G 2JA7H 1AE3A 1SE3A 1FYCA 3H0GH 2E8GA 2Q2HA 2ES2A 1J9OA 1X6OA 2JSOA 1X55A 4G57A 4ZQ3A 1EY9A 2DY8A 1RL2A 1G2SA 3CXCA 1D7QA 1QZHA 1RF2D 3DUZA 5M3MG 2K4KA 2G9DA 4DU9A 3Q22A 5M9OA 4YIJA 2IX0A 2X6LA 4A3IG 1JJ2A 1E2ZA 1BQQT 1VQAA 1OXVA 2GA4B 2JA9A 3D0FA 1TWAH 4YCUA 4BXXH 1PH9A 1KAWA 2NVYB 5DNFA 1YNND 2LSSA 2OWOA 1WCMH 1ENFA 4QJFA 2AMCB 2K03A 5M3FH 3HOZH 1SJED 4BBSB 1CA5A 3RZDH 1YHAA 2B2YA 1SRUA 2F0EA 2OF1A 2E2JB 2X69A 3K80C 2B2UA 1ESRA 4GN3B 1YNXA 4DR1L 2VQFL 4KTAA 4A75A 1VQ8A 3CMAA 2EPBA 4OWXB 1QCBD 3SEBA 1O7LA 3TP7A 4LF9Q 1UE7A 3SK8A 1F2ZA 3T53B 1PH6A 1SYEA 2KCMA 4G7HC 4JI4Q 4EQOA 2AWOA 3R3OA 5KNCA 4DR3Q 3TS2A 3CCRA 1VQGA 5LMUL 4BY7B 1PYWD 3IFDA 4RHSA 1GM5A 2RCNA 4IQZA 2NTSA 1YJWA 1U4LA 2RDFA 4TRDA 1O7IA 3MEFA 4O42A 4OO1I 3AB9A 4DAVA 4JI0L 4X3SA 2I5LX 5D3IB 4HEDA 3TZDA 1VQPA 1BBWA 3GQBA 5KNDA 2EYFA 4JI7L 1Q1BA 1BKBA 1ILPA 1R4QB 4LUZA 4P74A 4OX9L 5EPJA 5CBEE 5C44B 4C3HG 4FF1A 4H0LC 2EJGC 5BN4A 4QMGA 3CC4A 3PUVA 1V1QA 3GTQH 4GLVB 3SE0A 3DM3A 5KNBA 3FKIG 3TEHB 1H9KA 3U58A 2R93H 1JJGA 3E5SA 3CCMA 4A4IA 4AH6A 3I70A 4KN4C 4F8MA 4U673 3TRZA 2E74C 1HA6A 4C3IB 4IJHA 3H94A 3H91A 1EZ6A 1U4PA 4XQNA 3BZDB 2PMZB 3UI2A 2UUAL 2DY7A 2ZXRA 3I90A 3VYRA 2J0TD 5CV9A 3U4ZA 1B8AA 2FMCA 3K7AH 3IRBA 4ZKCB 3KFUA 3L3OC 2E75C 1XNQQ 3W2DA 1PMRA 3M4YA 1SE2A 3LWEA 1CUKA 2FHTA 1CSPA 5M5XB 1SSOA 3A8KE 1CFMA 1IYJB 4ZLTF 2XVSA 1T5XD 1Y1VG 1UE6A 3EQLC 2OXPA 1SEBD 1Q12A 4P71A 3PIOA 2HIVA 3S1RH 2BDOA 2CW0D 1H9MA 2K33A 1SAPA 5EKLA 5C5MA 3VR5A 4JI8L 4KKUA 5JJZA 1ZKOA 2B2YC 3GV6A 5I6WA 2JA7B 2Z1CA 1XTCD 2B2UC 1XWEA 2A1AA 1K73C 1VQNA 1K83H 3UE1A 1S5BD 1V8QA 3I2ZA 1D5XC 1KC8C 3A7AB 5IGFA 3N52A 2C9OA 1MBYA 3PCOB 3GV3A 2QDLA 2R7ZH 3AMUA 3PSIA 4GNXB 4GNXC 2IT1A 1YZ6A 1FNUA 4DUZQ 2YTVA 4HIOA 4EQPA 4HJ9A 2KHSA 1TWGH 1TWAB 4FXGC 1WOCA 3KDFB 4PV1C 2WAQE 2IY5B
chains in the Genus database with same CATH topology
4DR6L 1CKMA 4JI6Q 2Z0SA 2OCEA 3FP9A 4L5QA 4OWTB 4TQUS 3I56A 2HHHL 3J80i 3HOXH 1QZGA 4BY7G 1NJIC 4GKJQ 3MXNB 4A3CG 4DUZL 3I4MG 3S1QH 5JJKA 5LMNW 1KD1C 1AE2A 2C35B 4QIWE 1N34Q 2I5HA 2ZTCA 4IPGA 4JBMA 2UXDQ 4GNXA 4A3EH 1EFWA 5IYCH 4QY7A 2V1CC 3I7FA 4PZ6A 2NVQH 1IBLQ 4A3DG 4JI6L 1OTCA 4A3LH 4A76A 2GVBA 1IBMQ 2UXCL 4DK3C 4BA2I 2OTLA 4DV4Q 3KDFA 3BZCA 4P75A 4LFBQ 1WFQA 3OTOQ 4LF4Q 4LF9L 1H95A 2UXCQ 4BY7H 5LMNQ 1Q1EA 5C44G 1PH4A 4A3CH 2JA8H 4A3MG 1N34L 1FJGQ 3L2PA 1XMQL 1K9MC 2JA6H 2UXDL 3M4OH 1BBUA 3GO5A 4B3RL 4GOPB 1HZ9A 4R4TA 4GOPC 1HR0Q 4A3BG 1C7YA 4HJ5A 3AFPA 3BU2A 1IBLL 2VUMH 4A3DH 2PMZE 5C0XI 2PI2A 1IBML 1VQOA 4X62Q 5DLQE 4DV4L 2HQLA 4AQYQ 2UU9Q 4LFBL 4DR2Q 3T1YQ 3OTOL 4IFDI 1LTLA 5LMNL 1PH1A 2ZJPA 3PV0A 5ELNA 1CKOA 3HOVH 4R4OA 3S16H 4PG3A 4DPGA 5HY6A 2E2IH 4HIMA 2VW9A 3RN5A 4JI3Q 5E7NA 3HKZE 1YITA 3A5ZB 2EIFA 1MIUA 2F52A 2K50A 1C9OA 3G48A 5IYDG 1XPUA 1G6PA 3NELA 3J7ZC 4GOPA 4NXMQ 1U0LA 1VS0A 4X62L 4AQYL 3F2CA 4DV3Q 4GN5A 4DR2L 3CQZH 3CPWA 1HJPA 3T1YL 2GN5A 4XTCS 3M9BA 4C3HH 1FGUA 3D31A 2JJQA 1XPRA 3HKZG 2ZTEA 1E22A 3A5UA 4UPAA 1K3RA 3J80c 1VCIA 1GKHA 2WP8J 2NN6G 5H1SE 3VDYA 1Y1WH 4JI3L 1N32Q 1UEBA 2BA0A 4K0KQ 2D62A 1KQSA 4OWWB 4KHPQ 3M4QA 3K8AA 2ZM6L 1VQBA 4NXML 1EOVA 4DV3L 2YYZA 4POGA 3DLLA 1P16A 5GADC 3J81i 1YJ9A 4AYBE 1SFOH 1KL9A 5GAEC 1JB7A 1E3PA 1SMXA 3OW2A 3AQQA 5FLMG 1VQLA 4A93H 1L2FA 2GVAA 5JEAJ 1PH5A 4BY1H 3GTLH 1YJNA 1N32L 5M5XH 2KENA 2H5XA 5C3EG 4K0KL 2F4VQ 1HNZQ 5M5YH 4KHPL 3CCSA 1T9HA 4P73A 4A3JG 4R4IA 3RLOA 3U50C 4B3SQ 3GDEA 4JBKA 1QVFA 1GO3E 1IL2A 3UDXA 4AYBG 1XNQL 2LXJA 3BJUA 4DV0Q 1A8VA 3EN2A 4DV2Q 4QQBX 2JK8A 1JJCB 3TS0A 1Y14B 1VQEA 1YHBA 2JE6I 4LF8Q 4APVA 1IBKQ 1NMFA 3PF5A 4C2MH 5FLXc 3F2BA 1Z47A 2OTJA 1PA6A 1V9PA 1I5FA 4P72A 4TVAB 5FLMH 1W2BA 1AH9A 1UWVA 4IO9A 5GAHC 3L0OA 1PV4A 1UE5A 1PH2A 2F4VL 1XTDA 1Y1VH 4B3SL 3A0JA 2R7DA 4IPHA 3UDIA 3SGIA 3KF6B 4ALPA 1Q7YC 3E9HA 5IYBG 2N8NA 5IWAQ 4DUYQ 4R1JA 4DV0L 4DV2L 2UXBQ 3I4NG 4POFA 2AKWB 1GVPA 2R7FA 5IP7H 5IP9G 4BXXG 3NEMA 4LF8L 4X64Q 4LWCA 3NBHB 2ZTDA 2PI2E 1N36Q 4WJ4A 4X66L 4H02A 1WCMG 4YCVA 4YWLA 2WB1G 4MZ9A 1X54A 2K5NA 2KCTA 2NN6I 1SN8A 4J15A 4JOIA 5M3FG 3T1HQ 2DUDA 2K5VA 1ASZA 3L7ZC 3CCEA 3S15H 4DKAC 2ZJQA 2RHSB 4DUYL 5IWAL 2UXBL 1X56A 5IYBH 4BBSH 4MNOA 4YY3Q 1VQKA 1M90C 1K8GA 1G291 4UP9A 2QA4A 1OXTA 5BR8Q 4X64L 2E2JH 1V43A 3KF6A 4DR1Q 1BVSA 3ULPA 5JEAG 1N36L 3Q8DA 2XGTA 1EIFA 3CD6A 3HOWG 1OXUA 4BBRG 1J5EQ 3J81c 1SR3A 3F1ZA 3K7UC 2WAQG 1A0IA 4DNIA 1MJEA 1FL0A 2XTIA 3S14H 4DR7Q 4DV6Q 2CFMA 1HZBA 4UP8A 1HR0W 2JA5G 2WFWA 4JV5Q 2VZAA 1TWHH 3E9IA 2ZJRA 1YBYA 4YY3L 4GLAC 3ULLA 3GTJH 1E1TA 1VQ4A 2IY5B 1I94Q 4NPSA 3HKSA 1U5KA 3TREA 3CCUA 3S2HH 1SROA 2ASBA 2CWPA 4GKJL 1VQHA 3EIVA 1XMOQ 3HOWH 1YIJA 3CAMA 3I4MH 1XNRQ 3JAMi 1LYLA 1TXYA 4DR7L 4LF6Q 3CPFA 4JV5L 3K81C 3S2DH 5C4XG 4XIGS 2CCZA 2A8VA 1X9NA 3CC7A 2B63G 1FVIA 4A3GG 1Q82C 1SLJA 2N3SA 1Q8KA 4HIKA 1I94L 2BH2A 4DV7Q 1JMCA 3GTOH 2CQOA 1QUQB 1JT8A 4LFAQ 2RF4A 2OQKA 4LF4L 4JYAQ 2EXDA 2HIXA 1WJJA 2F3IA 2IHFA 4EQ5A 2K75A 4YHHQ 4HJ7A 4IPCA 3RN2A 2ID0A 1XMOL 4LNQA 3PF4A 4RG1A 3U4VA 1FJGL 5C44H 5HGQA 1EWIA 3ERSX 1D8LA 4A3MH 1PH8A 2N49A 4DAMA 3STBD 4LF6L 1HR0L 1RIPA 1WI5A 2VQEQ 4JBJA 4AIMA 1XPOA 1I6HH 1CSQA 4A3BH 1KRTA 2Z6KA 1Q86C 2R93G 1QVCA 2B3GA 4KHZA 3I4NH 1YVCA 4LF7Q 2L15A 2B63H 3TQYA 4DV7L 2UU9L 4A3GH 3W5OA 2A19A 4FDBA 1YHQA 2N78A 4LFAL 4JYAL 4GN4B 2I0QA 3KOJA 4JBWA 4JI1Q 1ASYA 4C3IH 4A3FG 1QUQA 4R4CA 1PYSB 4JI2Q 4JG2A 4O2DA 3J7A5 4L5RC 2PQAB 2JA7G 1VQFA 3M3YH 2AHOB 2DGYA 4NB3A 4OONA 4LF7L 5IYDH 5K36G 5JJIA 2KHIA 1J6QA 1KXLA 1L0WA 1Q46A 4ME3A 4HJ8A 1NY4A 4JC0A 4JI1L 4L5SA 5C0XJ 4LF5Q 1X65A 1EIYB 2QEXA 5IT9c 1TWFH 1PVOA 1JE5A 3CCJA 3M85A 4JI2L 4DK6C 3OYYA 4X6AH 3S1MH 4IOCA 5GQOA 2ALYB 3B6YA 1E1OA 2BA1A 3H0GG 1XJVA 1HNXQ 4X65Q 1C0AA 4IOAA 2JQOA 2YV5A 2B29A 2IX1A 2PQAA 4UP7A 4QGUA 2R92G 4Y52H 2KHJA 3CMEA 3RLNA 1B70B 1VQDA 4LF5L 1EQRA 3KF8B 4JOIC 1N33Q 1EUJA 3I4OA 3H3VH 3S1NH 3GTPH 3PO3G 3W1GA 2NVTH 3GD7A 1PH7A 1HNZL 1YEZA 5C3EH 4L5TA 1W3SA 2R6GA 3PUXA 3S24A 4B3TQ 3PO2G 1CKNA 4OXPA 1AE3A 4LUVA 4X65L 4A3JH 1HNXL 3H0GH 2JA7H 1L1OA 4DR4Q 4JI5Q 2D0OA 2E8GA 2Q2HA 3F8TA 2ES2A 3KJPA 2MNAA 1X6OA 4HJAA 1X55A 1VQ7A 4B3MQ 1IBKL 3RZOH 1RL2A 4RMFA 3PIPA 3G4SA 1N33L 2HT1A 3AFQA 5AJ3Q 2VNUD 4O0AA 3CXCA 4OO1G 1D7QA 1QZHA 1VQ5A 3KJOA 3HOZG 4B3TL 1NMGA 3LGJA 4PMWA 2K4KA 5M3MG 1VQ6A 1TWCH 4DR4L 2IX0A 4DV1Q 1X3EA 4A3IG 3JC66 1JJ2A 1VQAA 2JA9A 1OXVA 1WYDA 1OXSC 2PNHA 1TWAH 3D0FA 3K0XA 2MO1A 4YCUA 5IP9H 5C0XG 3CCQA 1DGSA 3GTGH 1VQCA 2VQFQ 4DR6Q 4GS3A 1PH9A 4BXXH 3HOXG 2E5LQ 3H3VI 1KAWA 2Y0SE 2HHHQ 2KBNA 2LSSA 2JEBI 2OWOA 3T1HL 1WCMH 3M7NA 4QJFA 1VQJA 2AMCB 5M3FH 1KRSA 1HZCA 3HOZH 1MJCA 3AYHB 3RZDH 3UDGA 1YHAA 5M3MH 4DV1L 1SRUA 1VQMA 3K80C 1EQQA 5BR8L 3I55A 1IXRA 1N8RC 1B7YB 4GN3B 1YNXA 4DR1L 1PH3A 2VQFL 5LMUQ 1VQ8A 4A75A 3PUWA 3CMAA 1PYBA 2E5LL 2IHEA 1Z9FA 1YI2A 4YWMA 1J5EL 5M5WH 3ZJYC 4OWXB 4BBRH 4YCWA 4DAYB 4LF9Q 1UE7A 2Z6KC 3F2DA 1NTGA 2Q2TA 2JA8G 1KIXA 1PH6A 4JI0Q 2JA6G 5FJ8G 4DV6L 3A74A 2FXQA 2KCMA 1XMQQ 4JI4Q 1LM0A 4B3RQ 1K8AC 2AWOA 2JA5H 2AWNA 4DR3Q 2VUMG 3PGZA 5IE8A 3TS2A 3CCRA 4JI7Q 1VQGA 5LMUL 1N9WA 4PZ7A 1GM5A 1A63A 2RCNA 4NXNQ 4OX9Q 1YJWA 4LFCQ 1E24A 1O7IA 3MEFA 1XNRL 4OO1I 2MFIA 3HOVG 4JI0L 2I5LX 4A3KG 1VQPA 4DV5Q 5FJ8H 4JI4L 4UY8C 1S72A 2E2HH 4Y7NH 1BBWA 3CF5A 3H15A 5C4XH 2NVXH 3WWVA 4DR3L 5EAYA 4JI7L 1Q1BA 1S3OA 1BKBA 5C4JH 4LUOA 5GAGC 4LUZA 4NXNL 4YHHL 4P74A 3UDFA 5IY0A 4OX9L 3GTKH 3HOYG 4LFCL 3HOUG 2ATWA 3STBC 4DR5Q 1X3GA 3EBEA 2UUAQ 3CC4A 2K5HA 3UE0A 3PUVA 1V1QA 3J81j 1GD7A 4DV5L 3GTQH 4GLVB 2YU9H 3DM3A 2VQEL 3FKIG 4A3KH 1Y1WG 3ICEA 3TEHB 3GTMH 3HFZB 3CCLA 5JJLA 3U58A 2R93H 1JJGA 3CCMA 1X3FA 4A4IA 3M4PA 2EQSA 4YWKA 4AH6A 2ZM6Q 3TRZA 4EX5A 1I50H 2RHQB 4IJHA 2K14A 3FHWA 4JCVE 3W1BA 1HZAA 3RNUA 1EYGA 3HOUH 3HOYH 2MQHA 4DR5L 4A93G 1P8LA 1PFSA 1CKNB 2UUAL 4BY1G 4A3FH 2JEAI 4IFDJ 3PUZA 3S17H 3CW2C 2VS1A 3FKIH 3U4ZA 1B8AA 3JAMc 5J3BA 3K7AH 3IRBA 3CP0A 3G6EA 3KFUA 1XNQQ 2K52A 4GKKQ 1LUZA 2NZOA 5GROA 3ULJA 1S40A 3E0EA 1UE1A 4GLXA 1CUKA 1CSPA 2Q2IA 2Q2UA 4JI8Q 4QL5A 1NE3A 1HNWQ 1IYJB 1VQIA 1A62A 1QVGA 4WJ3M 1Y1VG 1UE6A 3G71A 1PHJA 2CKZB 1Q12A 2QGQA 3ER0A 2YTXA 3PUYA 4P71A 2HIVA 1SE8A 3PIOA 5IP7G 3CCVA 1G51A 1K0RA 3S1RH 4GKKL 2R92H 4KI0A 3KYHC 2CWAA 4HIDA 1M1KC 2UUCQ 2R7ZG 1E7ZA 2UUBQ 4JI8L 3CC2A 4C3JH 1HNWL 2VY3A 1I3QH 4IPDA 3PO3H 4X66Q 1K73C 2LXKA 2A1AA 4LW1A 1VQNA 1OXXK 1L1OB 1K83H 1L1OC 4KLKA 2BH8A 3PO2H 1R9TH 4JI5L 3UE1A 3I2ZA 1VQ9A 1HH2P 2WB1E 1KC8C 4BBSG 4B3ML 3NENA 4IJLA 1Q81C 4MTNA 2UUCL 3KLWA 3PCOB 3RLFA 1KHIA 1IZ6A 2UUBL 3AEVA 5AJ3L 3RR5A 2R7ZH 2NZHA 2YTYA 3PSIA 4IFDG 4GNXB 4GNXC 2I5MX 2IT1A 1YZ6A 4DUZQ 2YTVA 4BA1I 4HIOA 2MO0A 2NVYH 2OQ0A 4HJ9A 4A3EG 1NBWA 1TWGH 5IYCG 4PZ8A 1MKHA 1WOCA 3BZKA 4A3IH 2VL6A 2Y0SG 3KDFB 2WAQE 5ELOA 4A3LG 2D0PA 4R4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 L;  1CKM A;  4JI6 Q;  2Z0S A;  2OCE A;  3FP9 A;  4L5Q A;  4OWT B;  4TQU S;  3I56 A;  2HHH L;  3J80 i;  3HOX H;  1QZG A;  4BY7 G;  1NJI C;  4GKJ Q;  3MXN B;  4A3C G;  4DUZ L;  3I4M G;  3S1Q H;  5JJK A;  5LMN W;  1KD1 C;  1AE2 A;  2C35 B;  4QIW E;  1N34 Q;  2I5H A;  2ZTC A;  4IPG A;  4JBM A;  2UXD Q;  4GNX A;  4A3E H;  1EFW A;  5IYC H;  4QY7 A;  2V1C C;  3I7F A;  4PZ6 A;  2NVQ H;  1IBL Q;  4A3D G;  4JI6 L;  1OTC A;  4A3L H;  4A76 A;  2GVB A;  1IBM Q;  2UXC L;  4DK3 C;  4BA2 I;  2OTL A;  4DV4 Q;  3KDF A;  3BZC A;  4P75 A;  4LFB Q;  1WFQ A;  3OTO Q;  4LF4 Q;  4LF9 L;  1H95 A;  2UXC Q;  4BY7 H;  5LMN Q;  1Q1E A;  5C44 G;  1PH4 A;  4A3C H;  2JA8 H;  4A3M G;  1N34 L;  1FJG Q;  3L2P A;  1XMQ L;  1K9M C;  2JA6 H;  2UXD L;  3M4O H;  1BBU A;  3GO5 A;  4B3R L;  4GOP B;  1HZ9 A;  4R4T A;  4GOP C;  1HR0 Q;  4A3B G;  1C7Y A;  4HJ5 A;  3AFP A;  3BU2 A;  1IBL L;  2VUM H;  4A3D H;  2PMZ E;  5C0X I;  2PI2 A;  1IBM L;  1VQO A;  4X62 Q;  5DLQ E;  4DV4 L;  2HQL A;  4AQY Q;  2UU9 Q;  4LFB L;  4DR2 Q;  3T1Y Q;  3OTO L;  4IFD I;  1LTL A;  5LMN L;  1PH1 A;  2ZJP A;  3PV0 A;  5ELN A;  1CKO A;  3HOV H;  4R4O A;  3S16 H;  4PG3 A;  4DPG A;  5HY6 A;  2E2I H;  4HIM A;  2VW9 A;  3RN5 A;  4JI3 Q;  5E7N A;  3HKZ E;  1YIT A;  3A5Z B;  2EIF A;  1MIU A;  2F52 A;  2K50 A;  1C9O A;  3G48 A;  5IYD G;  1XPU A;  1G6P A;  3NEL A;  3J7Z C;  4GOP A;  4NXM Q;  1U0L A;  1VS0 A;  4X62 L;  4AQY L;  3F2C A;  4DV3 Q;  4GN5 A;  4DR2 L;  3CQZ H;  3CPW A;  1HJP A;  3T1Y L;  2GN5 A;  4XTC S;  3M9B A;  4C3H H;  1FGU A;  3D31 A;  2JJQ A;  1XPR A;  3HKZ G;  2ZTE A;  1E22 A;  3A5U A;  4UPA A;  1K3R A;  3J80 c;  1VCI A;  1GKH A;  2WP8 J;  2NN6 G;  5H1S E;  3VDY A;  1Y1W H;  4JI3 L;  1N32 Q;  1UEB A;  2BA0 A;  4K0K Q;  2D62 A;  1KQS A;  4OWW B;  4KHP Q;  3M4Q A;  3K8A A;  2ZM6 L;  1VQB A;  4NXM L;  1EOV A;  4DV3 L;  2YYZ A;  4POG A;  3DLL A;  1P16 A;  5GAD C;  3J81 i;  1YJ9 A;  4AYB E;  1SFO H;  1KL9 A;  5GAE C;  1JB7 A;  1E3P A;  1SMX A;  3OW2 A;  3AQQ A;  5FLM G;  1VQL A;  4A93 H;  1L2F A;  2GVA A;  5JEA J;  1PH5 A;  4BY1 H;  3GTL H;  1YJN A;  1N32 L;  5M5X H;  2KEN A;  2H5X A;  5C3E G;  4K0K L;  2F4V Q;  1HNZ Q;  5M5Y H;  4KHP L;  3CCS A;  1T9H A;  4P73 A;  4A3J G;  4R4I A;  3RLO A;  3U50 C;  4B3S Q;  3GDE A;  4JBK A;  1QVF A;  1GO3 E;  1IL2 A;  3UDX A;  4AYB G;  1XNQ L;  2LXJ A;  3BJU A;  4DV0 Q;  1A8V A;  3EN2 A;  4DV2 Q;  4QQB X;  2JK8 A;  1JJC B;  3TS0 A;  1Y14 B;  1VQE A;  1YHB A;  2JE6 I;  4LF8 Q;  4APV A;  1IBK Q;  1NMF A;  3PF5 A;  4C2M H;  5FLX c;  3F2B A;  1Z47 A;  2OTJ A;  1PA6 A;  1V9P A;  1I5F A;  4P72 A;  4TVA B;  5FLM H;  1W2B A;  1AH9 A;  1UWV A;  4IO9 A;  5GAH C;  3L0O A;  1PV4 A;  1UE5 A;  1PH2 A;  2F4V L;  1XTD A;  1Y1V H;  4B3S L;  3A0J A;  2R7D A;  4IPH A;  3UDI A;  3SGI A;  3KF6 B;  4ALP A;  1Q7Y C;  3E9H A;  5IYB G;  2N8N A;  5IWA Q;  4DUY Q;  4R1J A;  4DV0 L;  4DV2 L;  2UXB Q;  3I4N G;  4POF A;  2AKW B;  1GVP A;  2R7F A;  5IP7 H;  5IP9 G;  4BXX G;  3NEM A;  4LF8 L;  4X64 Q;  4LWC A;  3NBH B;  2ZTD A;  2PI2 E;  1N36 Q;  4WJ4 A;  4X66 L;  4H02 A;  1WCM G;  4YCV A;  4YWL A;  2WB1 G;  4MZ9 A;  1X54 A;  2K5N A;  2KCT A;  2NN6 I;  1SN8 A;  4J15 A;  4JOI A;  5M3F G;  3T1H Q;  2DUD A;  2K5V A;  1ASZ A;  3L7Z C;  3CCE A;  3S15 H;  4DKA C;  2ZJQ A;  2RHS B;  4DUY L;  5IWA L;  2UXB L;  1X56 A;  5IYB H;  4BBS H;  4MNO A;  4YY3 Q;  1VQK A;  1M90 C;  1K8G A;  1G29 1;  4UP9 A;  2QA4 A;  1OXT A;  5BR8 Q;  4X64 L;  2E2J H;  1V43 A;  3KF6 A;  4DR1 Q;  1BVS A;  3ULP A;  5JEA G;  1N36 L;  3Q8D A;  2XGT A;  1EIF A;  3CD6 A;  3HOW G;  1OXU A;  4BBR G;  1J5E Q;  3J81 c;  1SR3 A;  3F1Z A;  3K7U C;  2WAQ G;  1A0I A;  4DNI A;  1MJE A;  1FL0 A;  2XTI A;  3S14 H;  4DR7 Q;  4DV6 Q;  2CFM A;  1HZB A;  4UP8 A;  1HR0 W;  2JA5 G;  2WFW A;  4JV5 Q;  2VZA A;  1TWH H;  3E9I A;  2ZJR A;  1YBY A;  4YY3 L;  4GLA C;  3ULL A;  3GTJ H;  1E1T A;  1VQ4 A;  2IY5 B;  1I94 Q;  4NPS A;  3HKS A;  1U5K A;  3TRE A;  3CCU A;  3S2H H;  1SRO A;  2ASB A;  2CWP A;  4GKJ L;  1VQH A;  3EIV A;  1XMO Q;  3HOW H;  1YIJ A;  3CAM A;  3I4M H;  1XNR Q;  3JAM i;  1LYL A;  1TXY A;  4DR7 L;  4LF6 Q;  3CPF A;  4JV5 L;  3K81 C;  3S2D H;  5C4X G;  4XIG S;  2CCZ A;  2A8V A;  1X9N A;  3CC7 A;  2B63 G;  1FVI A;  4A3G G;  1Q82 C;  1SLJ A;  2N3S A;  1Q8K A;  4HIK A;  1I94 L;  2BH2 A;  4DV7 Q;  1JMC A;  3GTO H;  2CQO A;  1QUQ B;  1JT8 A;  4LFA Q;  2RF4 A;  2OQK A;  4LF4 L;  4JYA Q;  2EXD A;  2HIX A;  1WJJ A;  2F3I A;  2IHF A;  4EQ5 A;  2K75 A;  4YHH Q;  4HJ7 A;  4IPC A;  3RN2 A;  2ID0 A;  1XMO L;  4LNQ A;  3PF4 A;  4RG1 A;  3U4V A;  1FJG L;  5C44 H;  5HGQ A;  1EWI A;  3ERS X;  1D8L A;  4A3M H;  1PH8 A;  2N49 A;  4DAM A;  3STB D;  4LF6 L;  1HR0 L;  1RIP A;  1WI5 A;  2VQE Q;  4JBJ A;  4AIM A;  1XPO A;  1I6H H;  1CSQ A;  4A3B H;  1KRT A;  2Z6K A;  1Q86 C;  2R93 G;  1QVC A;  2B3G A;  4KHZ A;  3I4N H;  1YVC A;  4LF7 Q;  2L15 A;  2B63 H;  3TQY A;  4DV7 L;  2UU9 L;  4A3G H;  3W5O A;  2A19 A;  4FDB A;  1YHQ A;  2N78 A;  4LFA L;  4JYA L;  4GN4 B;  2I0Q A;  3KOJ A;  4JBW A;  4JI1 Q;  1ASY A;  4C3I H;  4A3F G;  1QUQ A;  4R4C A;  1PYS B;  4JI2 Q;  4JG2 A;  4O2D A;  3J7A 5;  4L5R C;  2PQA B;  2JA7 G;  1VQF A;  3M3Y H;  2AHO B;  2DGY A;  4NB3 A;  4OON A;  4LF7 L;  5IYD H;  5K36 G;  5JJI A;  2KHI A;  1J6Q A;  1KXL A;  1L0W A;  1Q46 A;  4ME3 A;  4HJ8 A;  1NY4 A;  4JC0 A;  4JI1 L;  4L5S A;  5C0X J;  4LF5 Q;  1X65 A;  1EIY B;  2QEX A;  5IT9 c;  1TWF H;  1PVO A;  1JE5 A;  3CCJ A;  3M85 A;  4JI2 L;  4DK6 C;  3OYY A;  4X6A H;  3S1M H;  4IOC A;  5GQO A;  2ALY B;  3B6Y A;  1E1O A;  2BA1 A;  3H0G G;  1XJV A;  1HNX Q;  4X65 Q;  1C0A A;  4IOA A;  2JQO A;  2YV5 A;  2B29 A;  2IX1 A;  2PQA A;  4UP7 A;  4QGU A;  2R92 G;  4Y52 H;  2KHJ A;  3CME A;  3RLN A;  1B70 B;  1VQD A;  4LF5 L;  1EQR A;  3KF8 B;  4JOI C;  1N33 Q;  1EUJ A;  3I4O A;  3H3V H;  3S1N H;  3GTP H;  3PO3 G;  3W1G A;  2NVT H;  3GD7 A;  1PH7 A;  1HNZ L;  1YEZ A;  5C3E H;  4L5T A;  1W3S A;  2R6G A;  3PUX A;  3S24 A;  4B3T Q;  3PO2 G;  1CKN A;  4OXP A;  1AE3 A;  4LUV A;  4X65 L;  4A3J H;  1HNX L;  3H0G H;  2JA7 H;  1L1O A;  4DR4 Q;  4JI5 Q;  2D0O A;  2E8G A;  2Q2H A;  3F8T A;  2ES2 A;  3KJP A;  2MNA A;  1X6O A;  4HJA A;  1X55 A;  1VQ7 A;  4B3M Q;  1IBK L;  3RZO H;  1RL2 A;  4RMF A;  3PIP A;  3G4S A;  1N33 L;  2HT1 A;  3AFQ A;  5AJ3 Q;  2VNU D;  4O0A A;  3CXC A;  4OO1 G;  1D7Q A;  1QZH A;  1VQ5 A;  3KJO A;  3HOZ G;  4B3T L;  1NMG A;  3LGJ A;  4PMW A;  2K4K A;  5M3M G;  1VQ6 A;  1TWC H;  4DR4 L;  2IX0 A;  4DV1 Q;  1X3E A;  4A3I G;  3JC6 6;  1JJ2 A;  1VQA A;  2JA9 A;  1OXV A;  1WYD A;  1OXS C;  2PNH A;  1TWA H;  3D0F A;  3K0X A;  2MO1 A;  4YCU A;  5IP9 H;  5C0X G;  3CCQ A;  1DGS A;  3GTG H;  1VQC A;  2VQF Q;  4DR6 Q;  4GS3 A;  1PH9 A;  4BXX H;  3HOX G;  2E5L Q;  3H3V I;  1KAW A;  2Y0S E;  2HHH Q;  2KBN A;  2LSS A;  2JEB I;  2OWO A;  3T1H L;  1WCM H;  3M7N A;  4QJF A;  1VQJ A;  2AMC B;  5M3F H;  1KRS A;  1HZC A;  3HOZ H;  1MJC A;  3AYH B;  3RZD H;  3UDG A;  1YHA A;  5M3M H;  4DV1 L;  1SRU A;  1VQM A;  3K80 C;  1EQQ A;  5BR8 L;  3I55 A;  1IXR A;  1N8R C;  1B7Y B;  4GN3 B;  1YNX A;  4DR1 L;  1PH3 A;  2VQF L;  5LMU Q;  1VQ8 A;  4A75 A;  3PUW A;  3CMA A;  1PYB A;  2E5L L;  2IHE A;  1Z9F A;  1YI2 A;  4YWM A;  1J5E L;  5M5W H;  3ZJY C;  4OWX B;  4BBR H;  4YCW A;  4DAY B;  4LF9 Q;  1UE7 A;  2Z6K C;  3F2D A;  1NTG A;  2Q2T A;  2JA8 G;  1KIX A;  1PH6 A;  4JI0 Q;  2JA6 G;  5FJ8 G;  4DV6 L;  3A74 A;  2FXQ A;  2KCM A;  1XMQ Q;  4JI4 Q;  1LM0 A;  4B3R Q;  1K8A C;  2AWO A;  2JA5 H;  2AWN A;  4DR3 Q;  2VUM G;  3PGZ A;  5IE8 A;  3TS2 A;  3CCR A;  4JI7 Q;  1VQG A;  5LMU L;  1N9W A;  4PZ7 A;  1GM5 A;  1A63 A;  2RCN A;  4NXN Q;  4OX9 Q;  1YJW A;  4LFC Q;  1E24 A;  1O7I A;  3MEF A;  1XNR L;  4OO1 I;  2MFI A;  3HOV G;  4JI0 L;  2I5L X;  4A3K G;  1VQP A;  4DV5 Q;  5FJ8 H;  4JI4 L;  4UY8 C;  1S72 A;  2E2H H;  4Y7N H;  1BBW A;  3CF5 A;  3H15 A;  5C4X H;  2NVX H;  3WWV A;  4DR3 L;  5EAY A;  4JI7 L;  1Q1B A;  1S3O A;  1BKB A;  5C4J H;  4LUO A;  5GAG C;  4LUZ A;  4NXN L;  4YHH L;  4P74 A;  3UDF A;  5IY0 A;  4OX9 L;  3GTK H;  3HOY G;  4LFC L;  3HOU G;  2ATW A;  3STB C;  4DR5 Q;  1X3G A;  3EBE A;  2UUA Q;  3CC4 A;  2K5H A;  3UE0 A;  3PUV A;  1V1Q A;  3J81 j;  1GD7 A;  4DV5 L;  3GTQ H;  4GLV B;  2YU9 H;  3DM3 A;  2VQE L;  3FKI G;  4A3K H;  1Y1W G;  3ICE A;  3TEH B;  3GTM H;  3HFZ B;  3CCL A;  5JJL A;  3U58 A;  2R93 H;  1JJG A;  3CCM A;  1X3F A;  4A4I A;  3M4P A;  2EQS A;  4YWK A;  4AH6 A;  2ZM6 Q;  3TRZ A;  4EX5 A;  1I50 H;  2RHQ B;  4IJH A;  2K14 A;  3FHW A;  4JCV E;  3W1B A;  1HZA A;  3RNU A;  1EYG A;  3HOU H;  3HOY H;  2MQH A;  4DR5 L;  4A93 G;  1P8L A;  1PFS A;  1CKN B;  2UUA L;  4BY1 G;  4A3F H;  2JEA I;  4IFD J;  3PUZ A;  3S17 H;  3CW2 C;  2VS1 A;  3FKI H;  3U4Z A;  1B8A A;  3JAM c;  5J3B A;  3K7A H;  3IRB A;  3CP0 A;  3G6E A;  3KFU A;  1XNQ Q;  2K52 A;  4GKK Q;  1LUZ A;  2NZO A;  5GRO A;  3ULJ A;  1S40 A;  3E0E A;  1UE1 A;  4GLX A;  1CUK A;  1CSP A;  2Q2I A;  2Q2U A;  4JI8 Q;  4QL5 A;  1NE3 A;  1HNW Q;  1IYJ B;  1VQI A;  1A62 A;  1QVG A;  4WJ3 M;  1Y1V G;  1UE6 A;  3G71 A;  1PHJ A;  2CKZ B;  1Q12 A;  2QGQ A;  3ER0 A;  2YTX A;  3PUY A;  4P71 A;  2HIV A;  1SE8 A;  3PIO A;  5IP7 G;  3CCV A;  1G51 A;  1K0R A;  3S1R H;  4GKK L;  2R92 H;  4KI0 A;  3KYH C;  2CWA A;  4HID A;  1M1K C;  2UUC Q;  2R7Z G;  1E7Z A;  2UUB Q;  4JI8 L;  3CC2 A;  4C3J H;  1HNW L;  2VY3 A;  1I3Q H;  4IPD A;  3PO3 H;  4X66 Q;  1K73 C;  2LXK A;  2A1A A;  4LW1 A;  1VQN A;  1OXX K;  1L1O B;  1K83 H;  1L1O C;  4KLK A;  2BH8 A;  3PO2 H;  1R9T H;  4JI5 L;  3UE1 A;  3I2Z A;  1VQ9 A;  1HH2 P;  2WB1 E;  1KC8 C;  4BBS G;  4B3M L;  3NEN A;  4IJL A;  1Q81 C;  4MTN A;  2UUC L;  3KLW A;  3PCO B;  3RLF A;  1KHI A;  1IZ6 A;  2UUB L;  3AEV A;  5AJ3 L;  3RR5 A;  2R7Z H;  2NZH A;  2YTY A;  3PSI A;  4IFD G;  4GNX B;  4GNX C;  2I5M X;  2IT1 A;  1YZ6 A;  4DUZ Q;  2YTV A;  4BA1 I;  4HIO A;  2MO0 A;  2NVY H;  2OQ0 A;  4HJ9 A;  4A3E G;  1NBW A;  1TWG H;  5IYC G;  4PZ8 A;  1MKH A;  1WOC A;  3BZK A;  4A3I H;  2VL6 A;  2Y0S G;  3KDF B;  2WAQ E;  5ELO A;  4A3L G;  2D0P A;  4R4Q A; 
#chains in the Genus database with same CATH topology
 1PTO C;  4JI6 Q;  4MHE A;  1STN A;  4JW0 A;  1WCM B;  4OWT B;  4TQU S;  3T16 A;  5HUR A;  1QZG A;  1EFI D;  3S14 B;  5M3F B;  1NJI C;  1MHW C;  5FLX E;  5LMN W;  3J7A F;  1AE2 A;  3NP8 A;  2PW7 A;  4JBM A;  1Q90 A;  2PYK A;  4HR7 B;  5G3L F;  4A3D G;  3VR3 A;  4E6I A;  1QNU A;  1OTC A;  4A3L H;  1NNX A;  4BA2 I;  1DXM A;  3Q6S A;  1Q1E A;  1PH4 A;  2JA8 H;  4A3M G;  2HD3 A;  1N34 L;  1FJG Q;  3L2P A;  2JA6 H;  3GO5 A;  1HZ9 A;  2K32 A;  2EDG A;  4A3B G;  4HJ5 A;  3AFP A;  2VUM H;  1IBM L;  4X62 Q;  5DLQ E;  4DR2 Q;  1TU2 B;  3OTO L;  2HUG A;  5LMN L;  2RCF A;  3PV0 A;  3HEJ A;  3HOV H;  2XSC A;  4PG3 A;  1SMY C;  2F0Q A;  1TS4 A;  3NK9 A;  4ZKB B;  4A3G B;  1YIT A;  4U68 A;  3QR8 A;  1MIU A;  2K50 A;  4DK1 A;  5FO8 B;  3J7Z C;  1II3 A;  1VS0 A;  4DV3 Q;  4GN5 A;  3CQZ H;  1FGU A;  1TT2 A;  3GTQ B;  3HKZ G;  2ZTE A;  3M3Y B;  5KGU A;  4MIU A;  2R93 B;  1IW7 D;  2WP8 J;  3VYU A;  2NN6 G;  3SXH A;  1N32 Q;  1UEB A;  2K1B A;  3NXW A;  3M4Q A;  1VQB A;  4ABN A;  1EOV A;  5CMD A;  3HKZ B;  4Q0F A;  2NZ1 D;  1QNK A;  3EVQ A;  1YJ9 A;  2NWG A;  4A93 H;  1VQL A;  3AQQ A;  5FLM G;  3ERO A;  3PIO 3;  2DJF C;  5KEE A;  1E2V A;  2H5X A;  3TBI B;  3TP6 A;  3CCS A;  4A3J G;  4V19 0;  4R4I A;  1QVF A;  4KJN A;  4RH6 A;  2G9H D;  2LXJ A;  4OL7 A;  1A8V A;  4QQB X;  2LS0 1;  2MP1 A;  1GOZ A;  2F0W A;  1YHB A;  1VQE A;  2JE6 I;  4LF8 Q;  3F2B A;  1KTK A;  5CV5 A;  1PA6 A;  4TVA B;  1Q3L A;  1ET9 A;  2CH4 A;  3S1R B;  3A0J A;  4CDF C;  3KUP A;  3KF6 B;  2RDH A;  3KLR A;  1LLR D;  4DUY Q;  2NTT A;  4R1J A;  1HFN A;  5IP7 H;  5A2Q E;  2RA4 A;  1LT5 D;  3Q0A A;  4X3K A;  4X64 Q;  3FPP A;  3CKI B;  3NBH B;  2ZTD A;  1N36 Q;  4WJ4 A;  4ZYS A;  1K83 B;  1BXT A;  4YCV A;  4YWL A;  2WB1 G;  4MZ9 A;  4JOI A;  4UDU C;  2DUD A;  1O78 A;  1C8C A;  1TY0 A;  3C2P A;  3CCE A;  3S15 H;  2ZJQ A;  4BWG B;  2RHS B;  1X56 A;  5AFW A;  1ONL A;  1D1I A;  1M90 C;  5E4W C;  2B2W A;  4UP9 A;  3D3R A;  3OMG A;  1EEF D;  4DR1 Q;  2L12 A;  3VYS A;  3Q8D A;  1OXU A;  1TWG B;  2NYZ D;  4DNI A;  1A0I A;  2SOB A;  4K8J A;  1HZB A;  2JA5 G;  2M2L A;  3U9S A;  1WTP A;  2VZA A;  1Q8I A;  3C1F A;  1SYG A;  5M5W B;  1E1T A;  1HTL D;  1VQ4 A;  3M7G A;  4FVM A;  4DN4 M;  3TRE A;  3CCU A;  3S2H H;  1SRO A;  2ASB A;  3DHQ A;  3EIV A;  3IL8 A;  3BVM A;  1XMO Q;  3HOW H;  3CAM A;  1SNM A;  3A54 A;  5KYL A;  2KQ3 A;  1LYL A;  4JV5 L;  3S2D H;  2CCZ A;  2A8V A;  5JVG 3;  1BUV T;  2AQ2 B;  2N3S A;  2CQA A;  5K5P A;  2EXD A;  2JA8 B;  1ML0 D;  4LNQ A;  4IPC A;  2BCO A;  2ID0 A;  3PF4 A;  3BYT B;  2L1B A;  2EYM A;  3ERS X;  3HP3 A;  1PH8 A;  2N49 A;  3STB D;  3RUZ A;  2VUM B;  1RIP A;  1WI5 A;  1KRT A;  1F9R A;  2AQ3 B;  3D4R A;  2B3G A;  4PQX A;  1ZYR C;  4LF7 Q;  2UU9 L;  1YHQ A;  4LFA L;  1LV9 A;  3MZ5 A;  3HOV B;  3KOJ A;  2YU9 B;  3NSW A;  5CV7 A;  3GTM B;  5J22 A;  1QUQ A;  4JI2 Q;  4CDD C;  4OHJ A;  4ZK9 B;  2PQA B;  4KJO A;  3OWF A;  2PZW A;  2DGY A;  2LMC B;  1VMC A;  3HOU B;  1J6Q A;  3OW7 A;  2LY7 A;  1IKM A;  3EA6 A;  3KBX A;  4ME3 A;  4HJ8 A;  4CKE A;  4JC0 A;  1EY4 A;  1IYV A;  5C0X J;  1X65 A;  4FF3 A;  1RJT A;  3CCJ A;  3S1M H;  2ALY B;  3MWY W;  2A6H D;  2L11 A;  3B6Y A;  1LTA D;  4IN3 A;  3K5M A;  1C0A A;  2L0C A;  2EYP A;  4IOA A;  2JQO A;  2YV5 A;  4QGU A;  2WIN B;  4A93 B;  4ZCK A;  1B70 B;  1A6X A;  1BDO A;  3X3N A;  1HCZ A;  4JOI C;  2QEJ C;  2F0H A;  1N33 Q;  2OT2 A;  1EUJ A;  3H3V H;  2F1M A;  1K0S A;  3O13 A;  1YEZ A;  2XN9 C;  4K2K A;  4L5T A;  1HNX L;  3FDT A;  4DR4 Q;  4PMC A;  1Z6H A;  1RKN A;  3KJP A;  4C3J B;  5ELB A;  1VQ7 A;  1L0Y B;  2WAC A;  1FNW A;  2VNU D;  1G8Z D;  3C1E A;  2AUK A;  4O0A A;  2A69 D;  1CTM A;  1VQ5 A;  3KF8 A;  3QO2 A;  2L5T A;  3J7A V;  1VQ6 A;  4XYO A;  3JC6 6;  1STY A;  1XX8 A;  3I4N H;  1OXS C;  2BDN A;  3K0X A;  5IP9 H;  5C0X G;  4GS3 A;  1LTB D;  3HOX G;  3H3V I;  1NCV A;  4KY7 A;  2KBN A;  4CDC C;  2PPB C;  1EYC A;  3S15 B;  3NQT A;  2JN4 A;  5IOD A;  3H09 A;  5E3F A;  2PZU A;  2EXZ A;  5M3M H;  4DV1 L;  5EGT A;  4QCL A;  5BR8 L;  1N8R C;  1IXR A;  1AFP A;  1B3A A;  1DD2 A;  3S1Q B;  1SNO A;  1PYB A;  2E5L L;  1SBB B;  2IHE A;  1Z9F A;  5JEA H;  1J5E L;  4I7A A;  3ZJY C;  4DAY B;  4A3E B;  1Y69 U;  4MTK A;  1QB5 D;  3A74 A;  3SR1 A;  2RBM A;  2Y0S B;  3K5O A;  4H44 C;  2A68 D;  3S2H B;  5IE8 A;  1TS5 A;  1N9W A;  4NXN Q;  2O5J C;  3NWT A;  4CKC A;  1SJH D;  3TME A;  2QF7 A;  4A3K G;  5ELD A;  4DA2 A;  5C4X H;  3OSO A;  2A5H A;  1IYU A;  2RQX A;  5C4J H;  1FNV A;  5GAG C;  5COR A;  4YHH L;  4IUU A;  3GTK H;  3S16 B;  3IKJ A;  1PRT F;  4LFC L;  2O5I C;  3HOY G;  3MXG A;  2WV6 D;  4DR5 Q;  3EBE A;  4N8X 1;  3I4L A;  3UE0 A;  4XXE A;  4DV5 L;  3ICE A;  1Y1W G;  4NDX A;  3HFZ B;  3CCL A;  1SYD A;  4ME5 A;  4G4K A;  1HA5 A;  3HG9 A;  3FHW A;  2F0O A;  2MQH A;  1YNJ C;  2PQE A;  2JEA I;  4IFD J;  4I7Z C;  4FNF A;  2X6G A;  3FKI H;  5J3B A;  3FEW X;  1UEA B;  5K36 H;  4HN7 A;  2K52 A;  2J4X A;  3CRL C;  1LUZ A;  4RAU C;  5GRO A;  2SDF A;  1U4R A;  2Z6B A;  3ULJ A;  1CI3 M;  2F0M A;  2IW3 A;  2IJ0 A;  2PZT A;  2G5D A;  1VQI A;  1WTH A;  1BBX C;  2ENB A;  1Y8P B;  2YTX A;  4LJZ C;  4GKK L;  5JJL A;  2R92 H;  3I72 A;  4HID A;  1M1K C;  2UUC Q;  3K5L A;  2UUB Q;  5IOC A;  2F3V A;  3CC2 A;  1HNW L;  4TKO B;  3OIP A;  1I3Q H;  1X32 A;  3PO3 H;  2ICE C;  4LW1 A;  3NTH A;  1TVX A;  1B9N A;  4JI5 L;  2KEC A;  1MGS A;  1LT4 D;  4IUV A;  1H9S A;  2WB1 E;  4BBS G;  2Z4H A;  1DYQ A;  1JWU D;  1IZ6 A;  5LL6 X;  4HMI A;  5AJ3 L;  4BS9 A;  2NZH A;  4IFD G;  3DWA A;  2KED A;  2HCI A;  2CH4 W;  4OO1 H;  2A6E D;  3WOE A;  2OQ0 A;  3VR4 A;  4RWS C;  5IYC G;  3I4N B;  1I4R A;  4PZ8 A;  1MKH A;  5G3L D;  2PNR C;  5ELO A;  4RFB A;  2D0P A;  3IFT A;  1CKM A;  1YNN C;  4ID6 A;  2Z0S A;  2OCE A;  1SYB A;  3I56 A;  3J80 i;  4BY7 G;  2Q8I B;  1STG A;  2VB3 X;  4C56 C;  5JJK A;  1KD1 C;  3T51 B;  5A35 A;  4GNX A;  3MXU A;  4EQN A;  2V1C C;  4PZ6 A;  2NVQ H;  1IBL Q;  3VA7 A;  2K04 A;  4EVO A;  2EYH A;  4A76 A;  4DK3 C;  1VMP A;  2OTL A;  4DV4 Q;  3KDF A;  3BZC A;  5F2D A;  5FK9 C;  5C44 G;  1JOK A;  2J7Z A;  1XMQ L;  1K9M C;  2UXD L;  2DNC A;  4B3R L;  3TZU A;  1C7Y A;  5FKA C;  1B53 A;  4QIW B;  4A3D H;  3URY A;  2PI2 A;  2F0F A;  2UU9 Q;  1T5E A;  4LFB L;  3SK6 A;  1CA6 A;  2M00 A;  3QB3 A;  1CM9 A;  4C3I G;  5ELN A;  5C4X B;  2EY5 A;  2B63 B;  2K05 A;  3A5Z B;  2EIF A;  4H13 C;  1WD0 A;  1NSN S;  1XYI A;  1C9O A;  3GTK B;  3NEL A;  1GUT A;  4NXM Q;  1U0L A;  4AQY L;  1NR4 A;  3F2C A;  3CPW A;  3T1Y L;  1HJP A;  2GN5 A;  3M9B A;  4XQJ A;  1E22 A;  2KCN A;  4UHV A;  4UPA A;  1K3R A;  4F87 A;  3VDY A;  4JI3 L;  4GZY C;  1B3Q A;  4CJ1 B;  1F9S A;  1RHP A;  4JPB W;  4S3S A;  1TR5 A;  4FXK C;  1TY2 A;  3ND9 A;  3J81 i;  4AYB E;  1E3P A;  1CZW A;  4LK1 C;  3D6C A;  1PH5 A;  2K5W A;  2RSN A;  5E1F A;  1AW7 A;  4BY1 H;  1U9R A;  2K28 A;  1YJN A;  1H9S B;  4I65 A;  3BVZ A;  4K0K L;  2NN6 H;  2F4V Q;  4CJ2 C;  3KBG A;  4KHP L;  1BCP D;  2JA7 G;  4B3S Q;  3ND8 A;  3GDE A;  1IL2 A;  1ZXT A;  4XT1 B;  3S1N B;  3TS0 A;  1Y14 B;  3JAM L;  4TSS A;  4C2M H;  1Z47 A;  1V9P A;  1I5F A;  1AH9 A;  5FLM H;  1BCP B;  1UWV A;  3H0G B;  1PV4 A;  3L0O A;  4RGN A;  4HCS A;  1PH2 A;  5I6Y A;  1DOL A;  1KDB A;  2CW0 C;  3EJI A;  1Q7Y C;  4DV0 L;  5IYB G;  2N8N A;  2NBF A;  5IWA Q;  4DV2 L;  5IIF A;  4RHR A;  1HHV A;  1FD7 D;  4BXX G;  1PLF A;  3PO3 B;  1GJX A;  2K5Q A;  1WCM G;  1X54 A;  2K5N A;  2KCT A;  2NN6 I;  4KY5 A;  5M3F G;  1JCK B;  1ASZ A;  2UXB L;  1AEX A;  4MNO A;  4YY3 Q;  1VQK A;  2KCC A;  1K8G A;  5BR8 Q;  3KF6 A;  4NMZ A;  3HOZ B;  4IZ8 A;  1J5E Q;  4XQQ A;  3RZD B;  2F4I A;  4K5V A;  3DWQ A;  2F0T A;  2IPK D;  3NBH A;  1AZQ A;  1EY0 A;  1FL0 A;  2XTI A;  1EU3 A;  2QIL A;  4UP8 A;  1HR0 W;  3E9I A;  1YBY A;  4FF2 A;  4QB4 A;  2Q8T A;  2ZXP A;  4NPS A;  3C3L A;  1HUN A;  5J39 A;  2CWP A;  2F0G A;  4KY6 A;  1DJR D;  1VQH A;  1DZ1 A;  4KHV A;  1B9M A;  3I4M H;  1TXY A;  5DEH A;  5C6A A;  4DR7 L;  3OOC A;  2FFK B;  4LF6 Q;  4DXG A;  4XIG S;  4A3G G;  1FVI A;  1Q82 C;  1I94 L;  1SND A;  1Q8K A;  2BH2 A;  3GTO H;  4DV7 Q;  3D6W A;  2CQO A;  1VF7 A;  2OQK A;  4EQ5 A;  1WJJ A;  4YHH Q;  2K75 A;  4M8A A;  2Q8R E;  3U4V A;  4MN3 A;  1D8L A;  3NQI A;  1EOT A;  4DAM A;  1HR0 L;  4JBJ A;  1B50 A;  1F2Y A;  1XPO A;  1S4Z A;  3SK4 A;  2R93 G;  1C48 A;  2Z6K A;  1YVC A;  4Z9C B;  1S5E D;  3TQY A;  2A19 A;  4FDB A;  2N78 A;  2MGS A;  3K58 A;  4JYA L;  2ICI A;  2I0Q A;  1CQF A;  4C1N I;  2PCF B;  4JBW A;  4JI1 Q;  1EZ8 A;  1ASY A;  2E2D C;  3VYT A;  1PYS B;  2I07 B;  3HGB A;  4O2D A;  3J7A 5;  1EWH A;  1B4O A;  3BG3 A;  1F2M A;  5IYD H;  4NB3 A;  5JJI A;  1EL0 A;  1JR0 D;  4J8Q A;  4HCE A;  2SNM A;  1EIG A;  2D2C C;  1KDC A;  1IW7 C;  4PMB A;  4LF5 Q;  1EIY B;  2QEX A;  1TWF H;  1PVO A;  3K7A B;  4DNT B;  1DON A;  3OYY A;  3G7L A;  3V2T A;  4IOC A;  2IWH A;  2EY2 A;  1J8I A;  1C4Q A;  3D4D A;  4IUR A;  2B29 A;  1KNA A;  2PQA A;  3KLS X;  4L6T B;  3J80 L;  4X3U A;  2KHJ A;  1VQD A;  4BY1 B;  1EQR A;  3EFX D;  1V1P B;  1VF5 C;  2NVT H;  2A73 B;  5C3E H;  1W3S A;  1EQT A;  2R6G A;  4QUF A;  4OXP A;  3HZX A;  4X65 L;  3RD4 A;  3N6R A;  5KYI A;  4JI5 Q;  2MNA A;  2P5Z X;  4C2M B;  3SVM A;  1IBK L;  3RZO H;  2KVM A;  1L0X B;  2R3Z A;  3PIP A;  3G4S A;  2HT1 A;  3AFQ A;  2L9H A;  5AJ3 Q;  4NP5 A;  2OEO A;  4WJW A;  1RD9 D;  4B3T L;  2O2L D;  5DAU A;  1X3E A;  1D2B A;  2R7Z B;  1WYD A;  2PNH A;  1PFN A;  2XWJ B;  4KK7 A;  1VQC A;  2VQF Q;  4XDX A;  1DOM A;  2JEB I;  2F0J A;  1O7Z A;  2WII B;  1MJC A;  1JWS D;  3UDG A;  1UUP A;  1IKL A;  1HTP A;  2QDB A;  1ZEQ X;  1CHQ D;  5IGD A;  3I55 A;  4RCO A;  3NE5 B;  4RCN A;  1PH3 A;  5LMU Q;  1WD1 A;  1A2U A;  4K8I A;  3P20 A;  1YI2 A;  1S5C D;  1EYA A;  1NUC A;  1PTO F;  3FVQ A;  4BBR H;  4YCW A;  1BNZ A;  3F2D A;  2Z6K C;  1NTG A;  2JA8 G;  1KIX A;  4JI0 Q;  2JA6 G;  5FJ8 G;  2FXQ A;  1XMQ Q;  4IUT A;  2BE5 D;  4B3R Q;  1K8A C;  2AWN A;  4P2C B;  2VUM G;  3PGZ A;  3NPP A;  5C3W A;  4JI7 Q;  2EYO A;  4PZ7 A;  3I4M B;  1PRT D;  4OX9 Q;  2JA6 B;  3QWN A;  1MD2 D;  1XNR L;  5IGC A;  3HOV G;  4K6L A;  4JI4 L;  4UY8 C;  1S72 A;  4DAY A;  1DCZ A;  3T13 A;  4DR3 L;  1EY7 A;  5EAY A;  1PRT B;  5JPN C;  1ENA A;  4LUO A;  2F0K A;  2K01 A;  3UDF A;  1SNC A;  5IY0 A;  3HOU G;  1X3P A;  4KV6 A;  2Z8L A;  3STB C;  1A15 A;  2EY1 A;  2UUA Q;  2A74 C;  2K5H A;  1TS3 A;  1JOO A;  3J81 j;  1WTW A;  4HTH A;  3CHB D;  2VQE L;  4A3K H;  3CQZ B;  1X3F A;  5HGT A;  4YWK A;  1GUG A;  2K14 A;  3W1B A;  3RNU A;  3HOY H;  4A93 G;  1PFS A;  1K28 A;  2WKC A;  4A3F H;  1LAC A;  1D6E C;  3S17 H;  3CW2 C;  2L4N A;  2VS1 A;  3JAM c;  1PZK D;  3CP0 A;  2H1E A;  2F0U A;  4KKT A;  3R2T A;  3U9O A;  1TWF B;  1A3U A;  2KJX A;  1UE1 A;  3E0E A;  4GLX A;  4OEM B;  1SYF A;  2Q2I A;  4C3J G;  2F0S A;  2A6H C;  4JI8 Q;  4O1N A;  4QL5 A;  1NE3 A;  1A2T A;  1A62 A;  1PXU A;  1QVG A;  4WJ3 M;  2F0N A;  4CDE C;  3PIP 3;  1SXT A;  1PHJ A;  3K57 A;  5IT9 L;  1GUO A;  3CCV A;  1SE8 A;  5IP7 G;  5FO7 B;  2NB0 A;  3FMC A;  4KI0 A;  2CWA A;  2NVT B;  1E7Z A;  5C3E B;  4IPD A;  1JE4 A;  1OXX K;  1L1O B;  1L1O C;  4KLK A;  3PO2 H;  1R9T H;  1VQ9 A;  1D5M C;  3RZO B;  1HH2 P;  5EKK A;  5DM6 3;  4B3M L;  5BN5 A;  1Q81 C;  4MTN A;  2A69 C;  4IAL A;  1QE6 A;  1Y8N B;  1LTT D;  2NVY H;  5ELC A;  4A3E G;  2F0V A;  2D9U A;  3PMF A;  3A55 A;  3BZK A;  4A3I H;  2VL6 A;  2Y0S G;  4R4Q A;  4DR6 L;  2F0L A;  3FP9 A;  4KN7 C;  2HHH L;  2VXW A;  1HPC A;  4F7X A;  3MXN B;  2B8F A;  4A3C G;  4DUZ L;  4PNY A;  2C35 B;  1N34 Q;  2DN8 A;  2I5H A;  2ZTC A;  4IPG A;  1O80 A;  1EFW A;  5IYC H;  3I7F A;  4JI6 L;  1H9J A;  2GVB A;  1IBM Q;  1BF4 A;  3V05 A;  4BBR B;  3HOW B;  2WAQ B;  1WFQ A;  3OTO Q;  4WOR A;  4C1N K;  4BY7 H;  1CT1 D;  5LMN Q;  1EU4 A;  2A68 C;  3S2D B;  1MSH A;  4RGO S;  2EOT A;  5C3X A;  1BBU A;  1TII D;  4R4T A;  1MI2 A;  1SE4 A;  4GOP B;  4GOP C;  2CVR A;  1HR0 Q;  3BU2 A;  5C4H A;  1EYD A;  1M4V A;  4RGM A;  1WTX A;  1B1Z A;  1IHZ A;  3R2I A;  1VQO A;  4ZRZ A;  2HQL A;  4IFD I;  1LTL A;  4IUQ A;  2ZJP A;  1CKO A;  4R4O A;  3MEH A;  2HQE A;  5HY6 A;  2E2I H;  2VW9 A;  1LAB A;  3RN5 A;  3HKZ E;  2F52 A;  1CHP D;  2E76 C;  2V4D A;  3G48 A;  4DAP A;  3MAQ A;  1EY5 A;  4X62 L;  1STH A;  4DR2 L;  1ROD A;  1EWC A;  5I9O A;  4C3H H;  3K59 A;  2F0P A;  2PW5 A;  3MTS A;  1CZG A;  3CRK C;  3J80 c;  1VCI A;  1GKH A;  1PFM A;  4OWW B;  2ZM6 L;  3K8A A;  1ENC A;  1VDZ A;  3C46 A;  4DV3 L;  5EBC A;  1G91 A;  2YYZ A;  5JPM C;  3DLL A;  1SNQ A;  5GAD C;  4A3F B;  2KUM A;  1E2W A;  1SFO H;  1KL9 A;  3S1M B;  5GAE C;  5JEA J;  2GVA A;  1N32 L;  1HXY D;  5M5X H;  5CR3 A;  1TS2 A;  1Z7T A;  1T9H A;  3QOJ A;  4P73 A;  2R61 A;  3DEP A;  3R8B A;  5I4D A;  3UDX A;  5IGE A;  2D5D A;  3BJU A;  2O4X A;  2JK8 A;  3H3V C;  1JJC B;  1RDP D;  3MXP A;  5EBD A;  2B39 A;  5KRU A;  1IBK Q;  2OTJ A;  3I73 A;  1LTS D;  3QOL A;  2XRQ D;  1UAP A;  1JIC A;  1UE5 A;  4J6H A;  1Y1V H;  2B8G A;  2R7D A;  5CV8 A;  4IUN A;  3UDI A;  1QIL A;  2EYJ A;  3SGI A;  4ALP A;  1JQY D;  3I4N G;  1G2T A;  1GVP A;  3T4A C;  3BVG A;  5IP9 G;  3NEM A;  4LF8 L;  1KAB A;  2DJG C;  2WKD A;  4KKS A;  4LWC A;  5CYU A;  2DNE A;  1DOK A;  5D65 A;  1BR9 A;  4FYD A;  2KEE A;  1EEI D;  4X66 L;  4H02 A;  3PO2 B;  1R9T B;  1W6J A;  2JXM B;  4N9P A;  3NTK A;  3I91 A;  1LT6 D;  4JK1 C;  3L7Z C;  1H9R A;  4LAA A;  4DKA C;  4DUY L;  3LWU A;  1KLU D;  5IYB H;  3A7L A;  4N8F A;  4FP5 D;  4B08 A;  4QUC A;  4X64 L;  2K5D A;  1V43 A;  5JVH 3;  2A6E C;  5JEA G;  1N36 L;  1WVL A;  2XGT A;  1PTO H;  1EIF A;  3CD6 A;  3J81 c;  3K7U C;  3F1Z A;  5M3M B;  1SNP A;  1MJE A;  4A3I B;  2HCC A;  1WTO A;  3S14 H;  2FIN B;  4JV5 Q;  2WFW A;  3BDC A;  1TWH H;  2QCP X;  2ZJR A;  5EQ0 A;  3GTJ H;  2JP1 A;  2MPM A;  1PDQ A;  2EVB A;  4GKJ L;  1F9Q A;  4CBV A;  1GHK A;  1YIJ A;  1XNR Q;  4HSV A;  3CPF A;  5C4X G;  1X9N A;  3CC7 A;  2ZT9 C;  2B63 G;  2QKI C;  2F03 A;  3DMU A;  3H6M A;  4LFA Q;  2RF4 A;  4LF4 L;  1PZJ D;  1KLG D;  2HIX A;  2UXC L;  2IHF A;  2F3W A;  1XMO L;  4RG1 A;  1LTI D;  5CBA E;  2TMP A;  1EWI A;  3D8G A;  5FOB B;  4A3M H;  3OIQ A;  2VQE Q;  5C4J B;  4FF4 A;  1I6H H;  4A3B H;  1GUW A;  1QOH A;  1QVC A;  2L15 A;  4A3G H;  3W5O A;  1GUN A;  3NBI A;  2E2I B;  5J1Z A;  1EY6 A;  4K5X A;  1ESF A;  3D4W A;  1RTN A;  4L5R C;  1FR3 A;  3M3Y H;  1EQV A;  2AHO B;  2MUY A;  4OON A;  4LF7 L;  5K36 G;  4C3H B;  2KHI A;  1L0W A;  1Q46 A;  1NY4 A;  4RKB A;  3PQI A;  4L5S A;  3QJY A;  4HAE A;  2VB2 X;  4F88 A;  3FKI B;  5IT9 c;  1F2L A;  1JOR A;  4JI2 L;  3M85 A;  4JVZ A;  4X6A H;  1HQR D;  3QIA A;  3VR6 A;  1E1O A;  4WFN 3;  1AN8 A;  1AP0 A;  2BA1 A;  3H0G G;  1HNX Q;  1A3T A;  2KA7 A;  4Q5V A;  4G7Z C;  1EY8 A;  1SFO B;  2IX1 A;  4UP7 A;  2R92 G;  1WTV A;  3CME A;  3RLN A;  1GUS A;  2EJF C;  3I4O A;  1BCP C;  3GTP H;  1LTG D;  3PO3 G;  3W1G A;  5I9P A;  3GD7 A;  3BYY B;  1HNZ L;  2QW7 A;  3S24 A;  1CKN A;  1E0B A;  4A3J H;  4LUV A;  2R92 B;  2EY6 A;  2D0O A;  3F8T A;  3NTI A;  2EJM A;  4HJA A;  5D14 A;  1CQV A;  1XXG A;  4B3M Q;  1I3Q B;  4ULL A;  4RMF A;  1BOS A;  1N33 L;  2EYL A;  1Y1V B;  4OO1 G;  1TQO A;  3KJO A;  1K8O A;  3HOZ G;  1F9P A;  1V1P A;  1NMG A;  1SYC A;  3LGJ A;  4PMW A;  1TWC H;  2HDM A;  4DR4 L;  2MHV A;  2N88 A;  3E0J A;  3JAM E;  5FLX L;  4DV1 Q;  2K7V A;  4DFA A;  4Y7N H;  3MFY A;  2MO1 A;  3GTG H;  3CCQ A;  4DR6 Q;  1DGS A;  1STA A;  3P1H A;  1PZI D;  1D1K A;  2E5L Q;  2Y0S E;  4V0B A;  4CGY B;  1PTO D;  2HHH Q;  3T1H L;  3M7N A;  1VQJ A;  1KRS A;  1HZC A;  4XT3 B;  5ELF A;  3AYH B;  3OWE B;  1VQM A;  1S5D D;  1EQQ A;  1B44 D;  1GHJ A;  1B7Y B;  1PTO B;  3PUW A;  5I2X A;  3RMH A;  4YWM A;  5M5W H;  3MA2 B;  3F2U A;  2Q2T A;  5CV4 A;  2NVQ B;  4DV6 L;  1TWH B;  5IGB A;  1LT3 D;  3K5N A;  1LM0 A;  3GTJ B;  1QG7 A;  2JA5 H;  4LMQ D;  3G6J B;  4L8J A;  4HSP A;  1A63 A;  4R8I A;  2NUC A;  4OIK A;  1O7Y A;  4LFC Q;  1E24 A;  2MFI A;  5EPL A;  3ZYY X;  4DV5 Q;  3FRP B;  4A3D B;  3OPO A;  5FJ8 H;  2LFN A;  2E2H H;  2NVX H;  3CF5 A;  3H15 A;  3WWV A;  1SMY D;  1TKW B;  1A3V A;  1S3O A;  2H4O A;  4NXN L;  3E3X A;  4K2L A;  4ZUI A;  3VA5 A;  2XWB B;  4A3M B;  2ATW A;  1X3G A;  1I6H B;  4A3B B;  1GD7 A;  2YU9 H;  3GTM H;  4RA8 A;  1JOQ A;  3A56 A;  3A8J E;  3M4P A;  2EQS A;  3R93 A;  1D5Z C;  4ZUJ A;  3WOF A;  4EX5 A;  1I50 H;  2RHQ B;  2ZM6 Q;  1K8M A;  4JCV E;  3Q23 A;  3DXJ C;  3QG1 A;  1HZA A;  1EYG A;  3HOU H;  2B2V A;  5ELE A;  2XRS D;  4DR5 L;  1P8L A;  1CKN B;  4BY1 G;  1K3B C;  2MJ8 A;  5ISR A;  1S5F D;  3DM1 A;  3PUZ A;  3MC0 B;  3TP5 A;  2XNA C;  3G6E A;  2AQ1 B;  3KLS A;  1KDA A;  2Z4I A;  4GKK Q;  2NZO A;  5IGG A;  1S40 A;  1NR2 A;  2Q2U A;  4FXD A;  1HNW Q;  5A2Q L;  3P7J A;  3LNN A;  1MSG A;  3G71 A;  4IUP A;  2CKZ B;  2QGQ A;  3ER0 A;  1F77 A;  1RCV D;  3PUY A;  4K5W A;  1G51 A;  1K0R A;  4DNR B;  3DWP A;  5CC4 A;  3KYH C;  3OMC A;  3GTP B;  2R7Z G;  1KAA A;  3HRZ C;  4C3J H;  1ICW A;  2VY3 A;  3KK7 A;  4A3J B;  1AZP A;  4X66 Q;  2LXK A;  3TDQ A;  2EE1 A;  3J80 E;  1R4P B;  2JYO A;  3BDO A;  2BH8 A;  2F0D A;  3K0Y A;  3ITP A;  1BCP F;  2XIW A;  3NEN A;  1LTR D;  4IJL A;  1JB3 A;  5CV6 A;  3KLW A;  2UUC L;  3RLF A;  1KHI A;  3AEV A;  2UUB L;  1GXD C;  2CHB D;  3RR5 A;  2YTY A;  3P75 A;  2I5M X;  5JAV A;  1TWC B;  5TSS A;  4BA1 I;  4HMJ A;  3DEO A;  2MO0 A;  1NBW A;  4Y7N B;  2FMM A;  3GTG B;  4A3L G;  1L1O A;  5T1G A;  5C0X H;  1I4P A;  4L5Q A;  3HOX H;  2N55 A;  2WB1 B;  3OHX C;  4K14 A;  4GKJ Q;  3I4M G;  3S1Q H;  3TP8 A;  3I3C A;  4QIW E;  2UXD Q;  4A3E H;  5T1I A;  1NAP A;  4QY7 A;  2SNS A;  2ZXO A;  3ERQ A;  1BO0 A;  5JOB A;  4UAI A;  3J81 L;  1KNE A;  4ZAI A;  1SDF A;  1V1O A;  4OGQ C;  2LKV A;  4P75 A;  2B2T A;  4LFB Q;  4LF4 Q;  1JC7 A;  4LF9 L;  1H95 A;  2UXC Q;  2BE5 C;  4L63 B;  3GP7 A;  2FJ2 A;  4A3C H;  2JA5 B;  3M4O H;  5FO9 B;  3MXN A;  3GTO B;  1I4H A;  1IBL L;  1PFB A;  1PRT C;  4CHT B;  2B2V C;  2PMZ E;  5C0X I;  1I4Q A;  2M9V A;  5C4Z A;  4DV4 L;  4AQY Q;  3T1Y Q;  2IL8 A;  1ZYR D;  1OO9 B;  4CJ0 B;  3NHH A;  1PH1 A;  5LHY 1;  2I46 A;  2E2H B;  2NVX B;  3S16 H;  4DPG A;  3J81 E;  3VR2 A;  4HIM A;  2K6A A;  4JI3 Q;  5E7N A;  5IYD G;  4J1M A;  1XPU A;  1G6P A;  1G6Z A;  5L37 A;  1HUM A;  4GOP A;  3A8I E;  4XTC S;  3D31 A;  2JJQ A;  1XPR A;  4K6D A;  5EJW A;  3A5U A;  5D3D A;  5H1S E;  1Y1W H;  3HS0 C;  5DM7 3;  2BA0 A;  2RSO A;  2IX3 A;  2D62 A;  4K0K Q;  1KQS A;  1I50 B;  4KHP Q;  1WTR A;  3WDN A;  4NXM L;  2L55 A;  4POG A;  1P16 A;  2RKS A;  3W3A A;  3MVV A;  3LX0 A;  4OEL B;  1JB7 A;  3OW2 A;  1SMX A;  4FO2 A;  1L2F A;  4H7B A;  3GTL H;  2KEN A;  4G7O C;  5C3E G;  1HNZ Q;  5M5Y H;  4JBK A;  3U50 C;  4QF4 A;  3RLO A;  1GO3 E;  1XNQ L;  4AYB G;  4DV0 Q;  3EN2 A;  4DV2 Q;  2C5C A;  4APV A;  1NMF A;  4B9X A;  3PF5 A;  5FLX c;  4B9W A;  3ONA B;  4P72 A;  3AU7 A;  1W2B A;  1I4G A;  2SEB D;  4IO9 A;  5GAH C;  4AYB B;  2F4V L;  1XTD A;  4B3S L;  4DF7 A;  4IPH A;  4KD4 A;  2B2W C;  3L9A X;  3E9H A;  2UXB Q;  5EKI A;  4POF A;  2AKW B;  2R7F A;  3CU7 A;  1HQM C;  2Z9H A;  5E4X A;  1I4X A;  2PI2 E;  5COY A;  5CGK A;  3IAY A;  3T56 B;  3V96 A;  5IT9 E;  1U4M A;  3E6Z X;  4J15 A;  1SN8 A;  3T1H Q;  1ICF B;  2K5V A;  2HDL A;  4ODG A;  5IWA L;  2B2T C;  1FGB D;  4DK0 A;  3NWS A;  4BBS H;  1G29 1;  2QA4 A;  1OXT A;  2E2J H;  1BVS A;  3ULP A;  1WTQ A;  3MFG A;  3HOW G;  4IFD H;  4BBR G;  2RVL A;  1SR3 A;  3SK5 A;  2WAQ G;  2BOS A;  1LO5 D;  4CKB A;  4DR7 Q;  4DV6 Q;  2CFM A;  2KOL A;  4ILW A;  3X3M A;  4YY3 L;  4GLA C;  3ULL A;  3HOX B;  4OIJ A;  1HRJ A;  1I94 Q;  4EGV A;  3HKS A;  1U5K A;  1CK1 A;  1JWM D;  3I8Z A;  4DXF A;  3JAM i;  4NKL A;  4KMU C;  1EIH A;  3K81 C;  3J7Y W;  5NUC A;  5C5L A;  4NW2 A;  1SLJ A;  4HIK A;  1JT8 A;  1JMC A;  1QUQ B;  3K6O A;  4JYA Q;  2F3I A;  4HJ7 A;  4RKL A;  3RN2 A;  5LL6 S;  3BDL A;  1QJO A;  3M4O B;  2AUJ D;  1FJG L;  5C44 H;  5HGQ A;  1M8A A;  2F0I A;  4LF6 L;  4AIM A;  1CSQ A;  1Q86 C;  3MHB A;  4KHZ A;  4DGZ A;  2B63 H;  4DV7 L;  1RTO A;  4GN4 B;  4XYQ A;  4A3K B;  3TN2 A;  4C3I H;  4A3F G;  4R4C A;  2PO4 A;  5KIX A;  4JG2 A;  1ILQ A;  1YNJ D;  4R8N A;  1VQF A;  3SDZ A;  1B2T A;  1I6V C;  4X3T A;  3HOY B;  2TSS A;  1UNS A;  1KXL A;  1STE A;  4JI1 L;  4RGT A;  1IL8 A;  3SHL A;  3FPU B;  3S17 B;  2RDG A;  1Y1W B;  1JE5 A;  4KD3 A;  4DK6 C;  1X3Q A;  5GQO A;  1DM0 B;  1ET6 A;  5EPK A;  1XJV A;  3TSS A;  5BN3 A;  4X65 Q;  4WRD A;  5I2Y A;  3S9W A;  4N9T A;  1Y8O B;  4R9W A;  4Y52 H;  4LF5 L;  3Q24 A;  3GTL B;  3KF8 B;  4M1U B;  3NUC A;  1QWY A;  3BS1 A;  5M5Y B;  3S1N H;  1STB A;  1PH7 A;  1HFG A;  2EZV A;  3PUX A;  1W6K A;  4B3T Q;  3PO2 G;  2JA7 H;  1AE3 A;  1SE3 A;  1FYC A;  3H0G H;  2E8G A;  2Q2H A;  2ES2 A;  1J9O A;  1X6O A;  2JSO A;  1X55 A;  4G57 A;  4ZQ3 A;  1EY9 A;  2DY8 A;  1RL2 A;  1G2S A;  3CXC A;  1D7Q A;  1QZH A;  1RF2 D;  3DUZ A;  5M3M G;  2K4K A;  2G9D A;  4DU9 A;  3Q22 A;  5M9O A;  4YIJ A;  2IX0 A;  2X6L A;  4A3I G;  1JJ2 A;  1E2Z A;  1BQQ T;  1VQA A;  1OXV A;  2GA4 B;  2JA9 A;  3D0F A;  1TWA H;  4YCU A;  4BXX H;  1PH9 A;  1KAW A;  2NVY B;  5DNF A;  1YNN D;  2LSS A;  2OWO A;  1WCM H;  1ENF A;  4QJF A;  2AMC B;  2K03 A;  5M3F H;  3HOZ H;  1SJE D;  4BBS B;  1CA5 A;  3RZD H;  1YHA A;  2B2Y A;  1SRU A;  2F0E A;  2OF1 A;  2E2J B;  2X69 A;  3K80 C;  2B2U A;  1ESR A;  4GN3 B;  1YNX A;  4DR1 L;  2VQF L;  4KTA A;  4A75 A;  1VQ8 A;  3CMA A;  2EPB A;  4OWX B;  1QCB D;  3SEB A;  1O7L A;  3TP7 A;  4LF9 Q;  1UE7 A;  3SK8 A;  1F2Z A;  3T53 B;  1PH6 A;  1SYE A;  2KCM A;  4G7H C;  4JI4 Q;  4EQO A;  2AWO A;  3R3O A;  5KNC A;  4DR3 Q;  3TS2 A;  3CCR A;  1VQG A;  5LMU L;  4BY7 B;  1PYW D;  3IFD A;  4RHS A;  1GM5 A;  2RCN A;  4IQZ A;  2NTS A;  1YJW A;  1U4L A;  2RDF A;  4TRD A;  1O7I A;  3MEF A;  4O42 A;  4OO1 I;  3AB9 A;  4DAV A;  4JI0 L;  4X3S A;  2I5L X;  5D3I B;  4HED A;  3TZD A;  1VQP A;  1BBW A;  3GQB A;  5KND A;  2EYF A;  4JI7 L;  1Q1B A;  1BKB A;  1ILP A;  1R4Q B;  4LUZ A;  4P74 A;  4OX9 L;  5EPJ A;  5CBE E;  5C44 B;  4C3H G;  4FF1 A;  4H0L C;  2EJG C;  5BN4 A;  4QMG A;  3CC4 A;  3PUV A;  1V1Q A;  3GTQ H;  4GLV B;  3SE0 A;  3DM3 A;  5KNB A;  3FKI G;  3TEH B;  1H9K A;  3U58 A;  2R93 H;  1JJG A;  3E5S A;  3CCM A;  4A4I A;  4AH6 A;  3I70 A;  4KN4 C;  4F8M A;  4U67 3;  3TRZ A;  2E74 C;  1HA6 A;  4C3I B;  4IJH A;  3H94 A;  3H91 A;  1EZ6 A;  1U4P A;  4XQN A;  3BZD B;  2PMZ B;  3UI2 A;  2UUA L;  2DY7 A;  2ZXR A;  3I90 A;  3VYR A;  2J0T D;  5CV9 A;  3U4Z A;  1B8A A;  2FMC A;  3K7A H;  3IRB A;  4ZKC B;  3KFU A;  3L3O C;  2E75 C;  1XNQ Q;  3W2D A;  1PMR A;  3M4Y A;  1SE2 A;  3LWE A;  1CUK A;  2FHT A;  1CSP A;  5M5X B;  1SSO A;  3A8K E;  1CFM A;  1IYJ B;  4ZLT F;  2XVS A;  1T5X D;  1Y1V G;  1UE6 A;  3EQL C;  2OXP A;  1SEB D;  1Q12 A;  4P71 A;  3PIO A;  2HIV A;  3S1R H;  2BDO A;  2CW0 D;  1H9M A;  2K33 A;  1SAP A;  5EKL A;  5C5M A;  3VR5 A;  4JI8 L;  4KKU A;  5JJZ A;  1ZKO A;  2B2Y C;  3GV6 A;  5I6W A;  2JA7 B;  2Z1C A;  1XTC D;  2B2U C;  1XWE A;  2A1A A;  1K73 C;  1VQN A;  1K83 H;  3UE1 A;  1S5B D;  1V8Q A;  3I2Z A;  1D5X C;  1KC8 C;  3A7A B;  5IGF A;  3N52 A;  2C9O A;  1MBY A;  3PCO B;  3GV3 A;  2QDL A;  2R7Z H;  3AMU A;  3PSI A;  4GNX B;  4GNX C;  2IT1 A;  1YZ6 A;  1FNU A;  4DUZ Q;  2YTV A;  4HIO A;  4EQP A;  4HJ9 A;  2KHS A;  1TWG H;  1TWA B;  4FXG C;  1WOC A;  3KDF B;  4PV1 C;  2WAQ E;  2IY5 B; 
#chains in the Genus database with same CATH homology
 4DR6 L;  1CKM A;  4JI6 Q;  2Z0S A;  2OCE A;  3FP9 A;  4L5Q A;  4OWT B;  4TQU S;  3I56 A;  2HHH L;  3J80 i;  3HOX H;  1QZG A;  4BY7 G;  1NJI C;  4GKJ Q;  3MXN B;  4A3C G;  4DUZ L;  3I4M G;  3S1Q H;  5JJK A;  5LMN W;  1KD1 C;  1AE2 A;  2C35 B;  4QIW E;  1N34 Q;  2I5H A;  2ZTC A;  4IPG A;  4JBM A;  2UXD Q;  4GNX A;  4A3E H;  1EFW A;  5IYC H;  4QY7 A;  2V1C C;  3I7F A;  4PZ6 A;  2NVQ H;  1IBL Q;  4A3D G;  4JI6 L;  1OTC A;  4A3L H;  4A76 A;  2GVB A;  1IBM Q;  2UXC L;  4DK3 C;  4BA2 I;  2OTL A;  4DV4 Q;  3KDF A;  3BZC A;  4P75 A;  4LFB Q;  1WFQ A;  3OTO Q;  4LF4 Q;  4LF9 L;  1H95 A;  2UXC Q;  4BY7 H;  5LMN Q;  1Q1E A;  5C44 G;  1PH4 A;  4A3C H;  2JA8 H;  4A3M G;  1N34 L;  1FJG Q;  3L2P A;  1XMQ L;  1K9M C;  2JA6 H;  2UXD L;  3M4O H;  1BBU A;  3GO5 A;  4B3R L;  4GOP B;  1HZ9 A;  4R4T A;  4GOP C;  1HR0 Q;  4A3B G;  1C7Y A;  4HJ5 A;  3AFP A;  3BU2 A;  1IBL L;  2VUM H;  4A3D H;  2PMZ E;  5C0X I;  2PI2 A;  1IBM L;  1VQO A;  4X62 Q;  5DLQ E;  4DV4 L;  2HQL A;  4AQY Q;  2UU9 Q;  4LFB L;  4DR2 Q;  3T1Y Q;  3OTO L;  4IFD I;  1LTL A;  5LMN L;  1PH1 A;  2ZJP A;  3PV0 A;  5ELN A;  1CKO A;  3HOV H;  4R4O A;  3S16 H;  4PG3 A;  4DPG A;  5HY6 A;  2E2I H;  4HIM A;  2VW9 A;  3RN5 A;  4JI3 Q;  5E7N A;  3HKZ E;  1YIT A;  3A5Z B;  2EIF A;  1MIU A;  2F52 A;  2K50 A;  1C9O A;  3G48 A;  5IYD G;  1XPU A;  1G6P A;  3NEL A;  3J7Z C;  4GOP A;  4NXM Q;  1U0L A;  1VS0 A;  4X62 L;  4AQY L;  3F2C A;  4DV3 Q;  4GN5 A;  4DR2 L;  3CQZ H;  3CPW A;  1HJP A;  3T1Y L;  2GN5 A;  4XTC S;  3M9B A;  4C3H H;  1FGU A;  3D31 A;  2JJQ A;  1XPR A;  3HKZ G;  2ZTE A;  1E22 A;  3A5U A;  4UPA A;  1K3R A;  3J80 c;  1VCI A;  1GKH A;  2WP8 J;  2NN6 G;  5H1S E;  3VDY A;  1Y1W H;  4JI3 L;  1N32 Q;  1UEB A;  2BA0 A;  4K0K Q;  2D62 A;  1KQS A;  4OWW B;  4KHP Q;  3M4Q A;  3K8A A;  2ZM6 L;  1VQB A;  4NXM L;  1EOV A;  4DV3 L;  2YYZ A;  4POG A;  3DLL A;  1P16 A;  5GAD C;  3J81 i;  1YJ9 A;  4AYB E;  1SFO H;  1KL9 A;  5GAE C;  1JB7 A;  1E3P A;  1SMX A;  3OW2 A;  3AQQ A;  5FLM G;  1VQL A;  4A93 H;  1L2F A;  2GVA A;  5JEA J;  1PH5 A;  4BY1 H;  3GTL H;  1YJN A;  1N32 L;  5M5X H;  2KEN A;  2H5X A;  5C3E G;  4K0K L;  2F4V Q;  1HNZ Q;  5M5Y H;  4KHP L;  3CCS A;  1T9H A;  4P73 A;  4A3J G;  4R4I A;  3RLO A;  3U50 C;  4B3S Q;  3GDE A;  4JBK A;  1QVF A;  1GO3 E;  1IL2 A;  3UDX A;  4AYB G;  1XNQ L;  2LXJ A;  3BJU A;  4DV0 Q;  1A8V A;  3EN2 A;  4DV2 Q;  4QQB X;  2JK8 A;  1JJC B;  3TS0 A;  1Y14 B;  1VQE A;  1YHB A;  2JE6 I;  4LF8 Q;  4APV A;  1IBK Q;  1NMF A;  3PF5 A;  4C2M H;  5FLX c;  3F2B A;  1Z47 A;  2OTJ A;  1PA6 A;  1V9P A;  1I5F A;  4P72 A;  4TVA B;  5FLM H;  1W2B A;  1AH9 A;  1UWV A;  4IO9 A;  5GAH C;  3L0O A;  1PV4 A;  1UE5 A;  1PH2 A;  2F4V L;  1XTD A;  1Y1V H;  4B3S L;  3A0J A;  2R7D A;  4IPH A;  3UDI A;  3SGI A;  3KF6 B;  4ALP A;  1Q7Y C;  3E9H A;  5IYB G;  2N8N A;  5IWA Q;  4DUY Q;  4R1J A;  4DV0 L;  4DV2 L;  2UXB Q;  3I4N G;  4POF A;  2AKW B;  1GVP A;  2R7F A;  5IP7 H;  5IP9 G;  4BXX G;  3NEM A;  4LF8 L;  4X64 Q;  4LWC A;  3NBH B;  2ZTD A;  2PI2 E;  1N36 Q;  4WJ4 A;  4X66 L;  4H02 A;  1WCM G;  4YCV A;  4YWL A;  2WB1 G;  4MZ9 A;  1X54 A;  2K5N A;  2KCT A;  2NN6 I;  1SN8 A;  4J15 A;  4JOI A;  5M3F G;  3T1H Q;  2DUD A;  2K5V A;  1ASZ A;  3L7Z C;  3CCE A;  3S15 H;  4DKA C;  2ZJQ A;  2RHS B;  4DUY L;  5IWA L;  2UXB L;  1X56 A;  5IYB H;  4BBS H;  4MNO A;  4YY3 Q;  1VQK A;  1M90 C;  1K8G A;  1G29 1;  4UP9 A;  2QA4 A;  1OXT A;  5BR8 Q;  4X64 L;  2E2J H;  1V43 A;  3KF6 A;  4DR1 Q;  1BVS A;  3ULP A;  5JEA G;  1N36 L;  3Q8D A;  2XGT A;  1EIF A;  3CD6 A;  3HOW G;  1OXU A;  4BBR G;  1J5E Q;  3J81 c;  1SR3 A;  3F1Z A;  3K7U C;  2WAQ G;  1A0I A;  4DNI A;  1MJE A;  1FL0 A;  2XTI A;  3S14 H;  4DR7 Q;  4DV6 Q;  2CFM A;  1HZB A;  4UP8 A;  1HR0 W;  2JA5 G;  2WFW A;  4JV5 Q;  2VZA A;  1TWH H;  3E9I A;  2ZJR A;  1YBY A;  4YY3 L;  4GLA C;  3ULL A;  3GTJ H;  1E1T A;  1VQ4 A;  2IY5 B;  1I94 Q;  4NPS A;  3HKS A;  1U5K A;  3TRE A;  3CCU A;  3S2H H;  1SRO A;  2ASB A;  2CWP A;  4GKJ L;  1VQH A;  3EIV A;  1XMO Q;  3HOW H;  1YIJ A;  3CAM A;  3I4M H;  1XNR Q;  3JAM i;  1LYL A;  1TXY A;  4DR7 L;  4LF6 Q;  3CPF A;  4JV5 L;  3K81 C;  3S2D H;  5C4X G;  4XIG S;  2CCZ A;  2A8V A;  1X9N A;  3CC7 A;  2B63 G;  1FVI A;  4A3G G;  1Q82 C;  1SLJ A;  2N3S A;  1Q8K A;  4HIK A;  1I94 L;  2BH2 A;  4DV7 Q;  1JMC A;  3GTO H;  2CQO A;  1QUQ B;  1JT8 A;  4LFA Q;  2RF4 A;  2OQK A;  4LF4 L;  4JYA Q;  2EXD A;  2HIX A;  1WJJ A;  2F3I A;  2IHF A;  4EQ5 A;  2K75 A;  4YHH Q;  4HJ7 A;  4IPC A;  3RN2 A;  2ID0 A;  1XMO L;  4LNQ A;  3PF4 A;  4RG1 A;  3U4V A;  1FJG L;  5C44 H;  5HGQ A;  1EWI A;  3ERS X;  1D8L A;  4A3M H;  1PH8 A;  2N49 A;  4DAM A;  3STB D;  4LF6 L;  1HR0 L;  1RIP A;  1WI5 A;  2VQE Q;  4JBJ A;  4AIM A;  1XPO A;  1I6H H;  1CSQ A;  4A3B H;  1KRT A;  2Z6K A;  1Q86 C;  2R93 G;  1QVC A;  2B3G A;  4KHZ A;  3I4N H;  1YVC A;  4LF7 Q;  2L15 A;  2B63 H;  3TQY A;  4DV7 L;  2UU9 L;  4A3G H;  3W5O A;  2A19 A;  4FDB A;  1YHQ A;  2N78 A;  4LFA L;  4JYA L;  4GN4 B;  2I0Q A;  3KOJ A;  4JBW A;  4JI1 Q;  1ASY A;  4C3I H;  4A3F G;  1QUQ A;  4R4C A;  1PYS B;  4JI2 Q;  4JG2 A;  4O2D A;  3J7A 5;  4L5R C;  2PQA B;  2JA7 G;  1VQF A;  3M3Y H;  2AHO B;  2DGY A;  4NB3 A;  4OON A;  4LF7 L;  5IYD H;  5K36 G;  5JJI A;  2KHI A;  1J6Q A;  1KXL A;  1L0W A;  1Q46 A;  4ME3 A;  4HJ8 A;  1NY4 A;  4JC0 A;  4JI1 L;  4L5S A;  5C0X J;  4LF5 Q;  1X65 A;  1EIY B;  2QEX A;  5IT9 c;  1TWF H;  1PVO A;  1JE5 A;  3CCJ A;  3M85 A;  4JI2 L;  4DK6 C;  3OYY A;  4X6A H;  3S1M H;  4IOC A;  5GQO A;  2ALY B;  3B6Y A;  1E1O A;  2BA1 A;  3H0G G;  1XJV A;  1HNX Q;  4X65 Q;  1C0A A;  4IOA A;  2JQO A;  2YV5 A;  2B29 A;  2IX1 A;  2PQA A;  4UP7 A;  4QGU A;  2R92 G;  4Y52 H;  2KHJ A;  3CME A;  3RLN A;  1B70 B;  1VQD A;  4LF5 L;  1EQR A;  3KF8 B;  4JOI C;  1N33 Q;  1EUJ A;  3I4O A;  3H3V H;  3S1N H;  3GTP H;  3PO3 G;  3W1G A;  2NVT H;  3GD7 A;  1PH7 A;  1HNZ L;  1YEZ A;  5C3E H;  4L5T A;  1W3S A;  2R6G A;  3PUX A;  3S24 A;  4B3T Q;  3PO2 G;  1CKN A;  4OXP A;  1AE3 A;  4LUV A;  4X65 L;  4A3J H;  1HNX L;  3H0G H;  2JA7 H;  1L1O A;  4DR4 Q;  4JI5 Q;  2D0O A;  2E8G A;  2Q2H A;  3F8T A;  2ES2 A;  3KJP A;  2MNA A;  1X6O A;  4HJA A;  1X55 A;  1VQ7 A;  4B3M Q;  1IBK L;  3RZO H;  1RL2 A;  4RMF A;  3PIP A;  3G4S A;  1N33 L;  2HT1 A;  3AFQ A;  5AJ3 Q;  2VNU D;  4O0A A;  3CXC A;  4OO1 G;  1D7Q A;  1QZH A;  1VQ5 A;  3KJO A;  3HOZ G;  4B3T L;  1NMG A;  3LGJ A;  4PMW A;  2K4K A;  5M3M G;  1VQ6 A;  1TWC H;  4DR4 L;  2IX0 A;  4DV1 Q;  1X3E A;  4A3I G;  3JC6 6;  1JJ2 A;  1VQA A;  2JA9 A;  1OXV A;  1WYD A;  1OXS C;  2PNH A;  1TWA H;  3D0F A;  3K0X A;  2MO1 A;  4YCU A;  5IP9 H;  5C0X G;  3CCQ A;  1DGS A;  3GTG H;  1VQC A;  2VQF Q;  4DR6 Q;  4GS3 A;  1PH9 A;  4BXX H;  3HOX G;  2E5L Q;  3H3V I;  1KAW A;  2Y0S E;  2HHH Q;  2KBN A;  2LSS A;  2JEB I;  2OWO A;  3T1H L;  1WCM H;  3M7N A;  4QJF A;  1VQJ A;  2AMC B;  5M3F H;  1KRS A;  1HZC A;  3HOZ H;  1MJC A;  3AYH B;  3RZD H;  3UDG A;  1YHA A;  5M3M H;  4DV1 L;  1SRU A;  1VQM A;  3K80 C;  1EQQ A;  5BR8 L;  3I55 A;  1IXR A;  1N8R C;  1B7Y B;  4GN3 B;  1YNX A;  4DR1 L;  1PH3 A;  2VQF L;  5LMU Q;  1VQ8 A;  4A75 A;  3PUW A;  3CMA A;  1PYB A;  2E5L L;  2IHE A;  1Z9F A;  1YI2 A;  4YWM A;  1J5E L;  5M5W H;  3ZJY C;  4OWX B;  4BBR H;  4YCW A;  4DAY B;  4LF9 Q;  1UE7 A;  2Z6K C;  3F2D A;  1NTG A;  2Q2T A;  2JA8 G;  1KIX A;  1PH6 A;  4JI0 Q;  2JA6 G;  5FJ8 G;  4DV6 L;  3A74 A;  2FXQ A;  2KCM A;  1XMQ Q;  4JI4 Q;  1LM0 A;  4B3R Q;  1K8A C;  2AWO A;  2JA5 H;  2AWN A;  4DR3 Q;  2VUM G;  3PGZ A;  5IE8 A;  3TS2 A;  3CCR A;  4JI7 Q;  1VQG A;  5LMU L;  1N9W A;  4PZ7 A;  1GM5 A;  1A63 A;  2RCN A;  4NXN Q;  4OX9 Q;  1YJW A;  4LFC Q;  1E24 A;  1O7I A;  3MEF A;  1XNR L;  4OO1 I;  2MFI A;  3HOV G;  4JI0 L;  2I5L X;  4A3K G;  1VQP A;  4DV5 Q;  5FJ8 H;  4JI4 L;  4UY8 C;  1S72 A;  2E2H H;  4Y7N H;  1BBW A;  3CF5 A;  3H15 A;  5C4X H;  2NVX H;  3WWV A;  4DR3 L;  5EAY A;  4JI7 L;  1Q1B A;  1S3O A;  1BKB A;  5C4J H;  4LUO A;  5GAG C;  4LUZ A;  4NXN L;  4YHH L;  4P74 A;  3UDF A;  5IY0 A;  4OX9 L;  3GTK H;  3HOY G;  4LFC L;  3HOU G;  2ATW A;  3STB C;  4DR5 Q;  1X3G A;  3EBE A;  2UUA Q;  3CC4 A;  2K5H A;  3UE0 A;  3PUV A;  1V1Q A;  3J81 j;  1GD7 A;  4DV5 L;  3GTQ H;  4GLV B;  2YU9 H;  3DM3 A;  2VQE L;  3FKI G;  4A3K H;  1Y1W G;  3ICE A;  3TEH B;  3GTM H;  3HFZ B;  3CCL A;  5JJL A;  3U58 A;  2R93 H;  1JJG A;  3CCM A;  1X3F A;  4A4I A;  3M4P A;  2EQS A;  4YWK A;  4AH6 A;  2ZM6 Q;  3TRZ A;  4EX5 A;  1I50 H;  2RHQ B;  4IJH A;  2K14 A;  3FHW A;  4JCV E;  3W1B A;  1HZA A;  3RNU A;  1EYG A;  3HOU H;  3HOY H;  2MQH A;  4DR5 L;  4A93 G;  1P8L A;  1PFS A;  1CKN B;  2UUA L;  4BY1 G;  4A3F H;  2JEA I;  4IFD J;  3PUZ A;  3S17 H;  3CW2 C;  2VS1 A;  3FKI H;  3U4Z A;  1B8A A;  3JAM c;  5J3B A;  3K7A H;  3IRB A;  3CP0 A;  3G6E A;  3KFU A;  1XNQ Q;  2K52 A;  4GKK Q;  1LUZ A;  2NZO A;  5GRO A;  3ULJ A;  1S40 A;  3E0E A;  1UE1 A;  4GLX A;  1CUK A;  1CSP A;  2Q2I A;  2Q2U A;  4JI8 Q;  4QL5 A;  1NE3 A;  1HNW Q;  1IYJ B;  1VQI A;  1A62 A;  1QVG A;  4WJ3 M;  1Y1V G;  1UE6 A;  3G71 A;  1PHJ A;  2CKZ B;  1Q12 A;  2QGQ A;  3ER0 A;  2YTX A;  3PUY A;  4P71 A;  2HIV A;  1SE8 A;  3PIO A;  5IP7 G;  3CCV A;  1G51 A;  1K0R A;  3S1R H;  4GKK L;  2R92 H;  4KI0 A;  3KYH C;  2CWA A;  4HID A;  1M1K C;  2UUC Q;  2R7Z G;  1E7Z A;  2UUB Q;  4JI8 L;  3CC2 A;  4C3J H;  1HNW L;  2VY3 A;  1I3Q H;  4IPD A;  3PO3 H;  4X66 Q;  1K73 C;  2LXK A;  2A1A A;  4LW1 A;  1VQN A;  1OXX K;  1L1O B;  1K83 H;  1L1O C;  4KLK A;  2BH8 A;  3PO2 H;  1R9T H;  4JI5 L;  3UE1 A;  3I2Z A;  1VQ9 A;  1HH2 P;  2WB1 E;  1KC8 C;  4BBS G;  4B3M L;  3NEN A;  4IJL A;  1Q81 C;  4MTN A;  2UUC L;  3KLW A;  3PCO B;  3RLF A;  1KHI A;  1IZ6 A;  2UUB L;  3AEV A;  5AJ3 L;  3RR5 A;  2R7Z H;  2NZH A;  2YTY A;  3PSI A;  4IFD G;  4GNX B;  4GNX C;  2I5M X;  2IT1 A;  1YZ6 A;  4DUZ Q;  2YTV A;  4BA1 I;  4HIO A;  2MO0 A;  2NVY H;  2OQ0 A;  4HJ9 A;  4A3E G;  1NBW A;  1TWG H;  5IYC G;  4PZ8 A;  1MKH A;  1WOC A;  3BZK A;  4A3I H;  2VL6 A;  2Y0S G;  3KDF B;  2WAQ E;  5ELO A;  4A3L G;  2D0P A;  4R4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...