2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial RNA polymerase inhibitor
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transcription
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
2EVBA 1FYCA 1LABA 2PNRC 2CW0C 1E2WA 2AWOA 1V8QA 4KKSA 3MFYA 3PUYA 1GHJA 4DNRB 3PUWA 3CRKC 3A8KE 2K33A 3WDNA 2E75C 3KLRA 1HPCA 4H0LC 2KCCA 1E2VA 4BA2I 1LACA 2O5IC 1BDOA 2AUKA 4DNTB 1TU2B 4BA1I 4G7HC 2JEBI 4TQUS 1I6VC 1Q90A 1ZYRC 3FPPA 4I7ZC 5C0XH 1YNJC 2DNEA 3IFTA 2K32A 1Y69U 3GQBA 1Q12A 3M85A 1OXTA 2EJMA 1H9KA 2A69C 2PPBC 2NN6I 3P20A 4PV1C 1IW7D 2JEAI 2L5TA 1DXMA 2A6EC 1FR3A 2EJGC 3ND8A 4KKUA 1GUTA 1IYVA 1Z7TA 2JE6I 1B9MA 2K7VA 1GUNA 3NE5B 3PUXA 3PUZA 2YYZA 1OXUA 2PCFB 3PUVA 1CI3M 4OO1G 3LWUA 3VR6A 1DCZA 1E2ZA 1SMYC 2BE5D 4LJZC 1A6XA 3A7LA 3VR3A 1Y8OB 4XIGS 4H44C 3RLFA 5JEAG 2NN6G 4HR7B 3TZUA 1PMRA 4TKOB 2BDOA 3VR4A 4DK0A 3I72A 2BA0A 3SDZA 3PV0A 1G291 1H9SA 1GJXA 4JK1C 4KN7C 5K36G 1HCZA 2A6HC 2JXMB 1DD2A 1OXVA 1OXSC 4DK1A 3A7AB 3GD7A 3U9SA 2EDGA 1CTMA 1QJOA 4KKTA 4L8JA 1HQMC 4KI0A 3T56B 5KNBA 3M7NA 2A69D 1O78A 3IKJA 3DXJC 3I73A 2A68C 1V43A 1GHKA 3AB9A 2A6ED 1O7LA 2KA7A 3L7ZC 3QG1A 4XTCS 5A35A 5KNCA 2EJFC 2V4DA 1VF7A 1T5EA 2IT1A 3A8JE 3OW7A 4KMUC 1Q1EA 1VF5C 4IQZA 1K8MA 2E74C 4IFDG 3EQLC 2D2CC 2DNCA 1K8OA 3OOCA 4KHZA 3VR5A 4RCNA 4LK1C 3BDOA 1H9RA 2LMCB 1H9SB 5BN5A 1B9NA 3T51B 3LNNA 3MXUA 3QJYA 2QF7A 5C0XG 1GUSA 3FMCA 1YNNC 1ZKOA 5KNDA 5JEAH 3VA7A 3I4LA 4G7ZC 3BG3A 2NN6H 3N6RA 3M4YA 3HGBA 2D62A 3SE0A 1H9MA 3H94A 5BN3A 2O5JC 1Y8PB 2A68D 5K36H 2BA1A 4OGQC 1CFMA 3ND9A 1TKWB 3D4RA 1GUOA 1IW7C 1VCIA 1IYUA 2B8GA 4JBWA 1Q1BA 3A8IE 2AUJD 3D31A 1EWHA 2F1MA 3CRLC 4KN4C 2Q8IB 1Y8NB 4OO1H 2DN8A 1OXXK 2B8FA 2E76C 1H9JA 2BE5C 1GUGA 1ONLA 3W3AA 4H13C 3VR2A 3QIAA 3OPOA 3T53B 5BN4A 4GZYC 4G7OC 1HTPA 1VDZA 4IFDH 2D5DA 2R6GA 1Z6HA 2A6HD 2ZT9C
chains in the Genus database with same CATH superfamily
1WCMB 3N52A 3OIQA 3RMHA 1SNQA 5GADC 2Z6KC 4Q0FA 1I4HA 2JA6G 1EEFD 2RDHA 1EY4A 2AUKA 1G2SA 3KBXA 1IBLQ 4B3MQ 4OEMB 2PI2E 1D5MC 3FPPA 2DNEA 2YTXA 1U5KA 2ENBA 1IYJB 3DWAA 5FOBB 5I2XA 5F2DA 2ZJQA 1JICA 4NKLA 2EJGC 5FLXE 4BY1G 3K59A 4BY7G 3ULPA 1MI2A 1VQEA 2KECA 2YYZA 3S2HH 4DV3L 2R7FA 4R4CA 5IGEA 2JQOA 4YCVA 3K58A 2EZVA 4OIKA 3I56A 1VQ4A 3S2DH 4LF6L 3TEHB 3RLFA 3K81C 2D9UA 1XMQQ 4ZLTF 3VR4A 4HMJA 5M3MG 4GNXB 3PV0A 2EYPA 2FXQA 4KK7A 2F0HA 2RHQB 1RKNA 5TSSA 2F0TA 3M7NA 2QKIC 3NK9A 1O78A 3TP5A 1JB7A 3EN2A 3DXJC 3ZYYX 1FNUA 4LW1A 2RDFA 3H6MA 5DEHA 1K83B 3HOZB 1WCMH 2DNCA 4JI1Q 4XXEA 4A3KG 1BNZA 1RDPD 3IRBA 3CMEA 3M4QA 4C1NI 3TN2A 1TT2A 2B39A 4V0BA 2PNHA 2YV5A 3GTKB 3F1ZA 4F8MA 1NE3A 2F52A 4B3TL 4NP5A 4F7XA 3D3RA 1FJGL 4IUUA 2YU9B 1DOKA 3MXUA 1EIHA 2QF7A 4KV6A 3H3VC 2F0MA 3GTJB 1K73C 2UXBL 4U68A 3K57A 1Q7YC 1NR2A 1F2YA 3EROA 1EFWA 2O5JC 1Y8PB 2OF1A 4DV2L 2F0LA 4ALPA 1M1KC 1FNWA 3HFZB 4OX9Q 1VCIA 1LM0A 2X6GA 3S17B 1CZWA 1UAPA 1WOCA 1JE4A 1STGA 1F2LA 4KD3A 1D8LA 4YIJA 1H9JA 4BBSH 3U4ZA 5CV8A 3T16A 3T53B 4PMWA 1Y1VB 1RTNA 3Q24A 1SRUA 1AZPA 3Q0AA 1A3TA 1G51A 2WV6D 1E2WA 1NMFA 3PMFA 5LL6S 1TWAH 3KLRA 3HZXA 2KCCA 4JPBW 3OSOA 3SK4A 1FGUA 4GNXA 1K83H 3HOZH 1ZYRC 5EGTA 5CORA 5J3BA 4P74A 1YHQA 2OEOA 5FKAC 1SNPA 1GUTA 1WJJA 2LS01 1MJCA 1F9RA 3E9IA 1X32A 4IOCA 2MP1A 1RHPA 2BE5D 4LJZC 1WTOA 2LY7A 3GTJH 1CKMA 4LFAL 2PZTA 1D7QA 1O80A 4K5WA 2JYOA 5CGKA 1BBXC 2NZHA 5FLMH 1CHQD 4QUCA 4RHRA 1NJIC 4AH6A 4R4QA 4APVA 2BA0A 3STBD 3HOUG 1XYIA 5IE8A 4X3KA 1G291 1TWCH 4JK1C 5D3DA 5EKIA 1IZ6A 3H0GH 3RZDH 2F0OA 4DV3Q 1MSGA 3J80E 1HZAA 2AWNA 1GVPA 4LF6Q 1S40A 3AB9A 4RHSA 1LV9A 4XT1B 1DZ1A 2EJFC 1Q81C 3TREA 3HOXB 3OW7A 2X6LA 2K05A 2GA4B 2K4KA 1VQ8A 4MTKA 2NTSA 1H9SB 4IJHA 4JYAL 5D65A 1UEBA 4QB4A 4PZ7A 1M90C 4CDEC 3RD4A 4YY3L 4DR5L 1XXGA 2L55A 1XNQL 5IT9c 1ASYA 3EFXD 3AFPA 1QNUA 2HD3A 3KF8B 5AJ3Q 4FNFA 5K36H 1N36Q 4ULLA 1IBKL 4B3TQ 5D14A 2VNUD 4N8X1 2HHHQ 1VQLA 1EWHA 4QIWE 3KJOA 3RN5A 3H3VI 1VQNA 1XPRA 2BE5C 1ONLA 4FP5D 2CQOA 2R6GA 1QOHA 4YCWA 4DV2Q 1STHA 3PIO3 1J9OA 2UUBQ 3STBC 1W3SA 4DGZA 2K14A 4IPCA 3UE0A 2JA7B 3SR1A 3FKIG 1QVFA 5J22A 4BA1I 1MJEA 4JI7L 1SNCA 2R93H 2L15A 1Y69U 2NVYB 4RCOA 1Q12A 2MUYA 1JE5A 3IAYA 4X3UA 1XTCD 3DM3A 2DUDA 2YTVA 2WINB 1TWGB 4C3JG 4ZUIA 5C4XB 2ID0A 1G91A 2XWJB 3A7LA 3K5NA 1S3OA 1M8AA 4DR1L 1JWSD 2F0VA 4O0AA 4XIGS 4ODGA 2Y0SE 5ELCA 1LTTD 1SE3A 2K1BA 1C7YA 3PSIA 3ULLA 4QUFA 5KGUA 1F9SA 1H9SA 1VMCA 3CQZH 3D0FA 3S15B 3GTPB 3NQTA 4CDDC 3CAMA 1BOSA 2CQAA 1ESFA 3S1QH 1SXTA 3E3XA 1V43A 2LXJA 1HRJA 4CHTB 4A3GB 3HP3A 3QG1A 2E2HB 3S9WA 4LFBL 1KRSA 2RSOA 1O7IA 4EVOA 1I6HB 1VQAA 1HA6A 3G6EA 5IIFA 5C4JB 3OOCA 4KHZA 3KJPA 2R7ZB 1N8RC 2EXZA 1ILQA 2PO4A 2UXCQ 1TWFB 2VQEL 4O42A 1FL0A 4BBRG 3KOJA 4CJ2C 4Y52H 4DK6C 1L2FA 4K6LA 2NB0A 2NVYH 2JA5B 1EIFA 1SYGA 1KLGD 4GKKL 3Q22A 1CSQA 1H9MA 3H94A 4A3CH 5LMUL 4A3IH 4AYBE 2EIFA 4OGQC 5C4XH 1S5ED 3HOYB 4JYAQ 1TKWB 3C1EA 3U50C 1YZ6A 4YWKA 2TMPA 1G6ZA 1F9QA 1DJRD 3J81c 1RCVD 2E5LL 3AYHB 2XRQD 4DR5Q 2HIXA 2M2LA 3PO2B 1TS4A 1PYWD 1KC8C 1XNQQ 2B8FA 1R9TB 5I6YA 2F0JA 3S15H 1HQRD 4GZYC 3GTPH 1PFSA 4N9PA 1VQ7A 3S1NB 2AHOB 2F03A 2QGQA 4IPDA 1GHJA 3KLSX 1SEBD 4A3GH 4H0LC 5IT9E 1QG7A 4DR3Q 1JWUD 5IGBA 4X64Q 1EY0A 5C0XH 1I6HH 3BZDB 1LT6D 4P75A 1HZBA 3MZ5A 3UDGA 4PMCA 1EWCA 1HNXL 2VUMG 2R7ZH 1KD1C 1Y14B 1PRTF 1X9NA 4DV4Q 4A3MG 2XSCA 2JA5H 4C2MB 4QGUA 3RN2A 2WB1E 2X69A 1KRTA 3K6OA 4Y7NH 3HOWH 1LTGD 3FP9A 4X3SA 4P71A 3SK5A 4P2CB 1X56A 1X55A 3HEJA 4NMZA 2B2UA 1GJXA 1Q8KA 3HOYH 2N78A 1B7YB 1LT5D 3GO5A 2EYJA 3RZOB 1W2BA 4HSPA 4ZCKA 3U9SA 2UUAQ 1KAWA 3PQIA 3CC2A 2F0FA 4KI0A 4JI5L 5GAHC 4A93G 1R9TH 5M9OA 3L7ZC 5ELOA 4IUPA 1TY2A 2IT1A 4NXNL 2I46A 3MTSA 5G3LD 2F3WA 2E8GA 2BOSA 2K50A 1RJTA 2PYKA 1IBMQ 3VR5A 3CPFA 1PRTC 4GS3A 3LX0A 3KDFB 3T51B 3VYSA 3CXCA 2E2DC 2R7DA 3MVVA 4F87A 4LFBQ 1EZ6A 2FHTA 5JEAH 3VA7A 4CDFC 3GDEA 3I55A 5CV5A 1WFQA 2B63H 3SE0A 3J7YW 2O2LD 3CD6A 2R92B 5C0XJ 2CVRA 3K5OA 1PVOA 2VQEQ 1SAPA 5DLQE 3W1BA 5IOCA 1J6QA 2UUCL 2Q2TA 3PIP3 1XWEA 3CRLC 5IYCH 4C3IB 3GTGB 5CV4A 3IL8A 4OWXB 3QIAA 3JAMc 4FXDA 2EVBA 3M9BA 4K2LA 4YHHL 4WRDA 1XMOQ 3I70A 4DR6Q 2B2YA 1PYSB 1HZ9A 1TQOA 2EY5A 5JVG3 4KJOA 1MHWC 3I4MG 4I65A 3MXPA 5EAYA 1VQKA 1UE7A 4GNXC 3GQBA 4AIMA 1EQQA 4PZ8A 1LTSD 3FRPB 2NN6I 3P20A 4C3HG 2PZUA 1IBLL 4B3ML 1FR3A 1XPOA 4IO9A 1AH9A 4GLAC 3J81E 2VB2X 1OXUA 3QB3A 1DCZA 1TWHB 5M5YB 1A3UA 2EXDA 3FEWX 1DGSA 1AFPA 5EPLA 1Q3LA 1RIPA 1RL2A 1HNXQ 1EYCA 2XN9C 3FHWA 2R92H 4DK0A 3DWPA 4K8IA 2G9HD 2AQ1B 2RCFA 3KDFA 1YJ9A 1HCZA 3A54A 4UDUC 2WIIB 2SEBD 1JORA 3M4OB 2N88A 2KEEA 4KKTA 4XDXA 1AP0A 3GTGH 3IKJA 1NY4A 3I73A 4R8IA 4FO2A 3UDFA 1X3QA 5I4DA 4A3EH 4P73A 1HXYD 1HNWL 2GVAA 2RVLA 4KLKA 1ICFB 2BCOA 1EQRA 2RF4A 1EY6A 1KHIA 3P1HA 1N32L 2I5LX 2LMCB 4JI5Q 3TBIB 4ILWA 1EIGA 1X3FA 2E2JH 4JI1L 5JPNC 3P7JA 2EYLA 3QJYA 1A2UA 3KBGA 1AZQA 1GUSA 2HCIA 2Z8LA 3V96A 2HQEA 4JI8L 4GOPA 1A15A 3HKZB 4A3BG 4DV0Q 1I3QB 5A2QL 1L0XB 3MEFA 1LTAD 5BN3A 1EWIA 2A68D 2GVBA 3DEOA 3RLOA 4XYQA 2H5XA 2H1EA 1B1ZA 3D31A 1WCMG 5FK9C 1FGBD 4FF3A 4WORA 1Y8NB 5DM73 4J15A 4CBVA 4LF7Q 3S2HB 5IYDH 5C44B 1HTPA 5T1GA 4UAIA 4HIOA 1HUMA 3M4OH 2UUCQ 1LUZA 1U4MA 2CH4W 2SOBA 3CRKC 3CCRA 4RGMA 4XQQA 5IGCA 2VB3X 1KL9A 3L0OA 1LACA 1PRTB 1OO9B 4Q5VA 1PZJD 2RA4A 1DXMA 3TP6A 1WTWA 4TRDA 4LUZA 5CV9A 1EEID 1MD2D 2I5MX 5IGGA 1EIYB 3NENA 2IHFA 3EIVA 3JAME 2RKSA 3TZDA 4PG3A 1I3QH 4XQNA 4JI2L 1LO5D 1VQBA 4HR7B 2BDOA 1LT4D 1STYA 3CCSA 3J80c 3M7GA 3E5SA 2SNSA 1JB3A 4FDBA 3KFUA 3A7AB 1BBUA 4QY7A 3T56B 4BXXH 1DOMA 1HUNA 4LF9Q 2A68C 1Y1WB 1TS5A 1HR0Q 2A19A 5C44H 1STBA 3DM1A 1PDQA 2E74C 4RH6A 5FO7B 3MC0B 3WOFA 1VQ6A 1V1PB 2EE1A 1JOOA 2ZXPA 2K5VA 2C35B 5C3EH 5FO9B 5FLMG 5FJ8G 4LNQA 4BBSB 3KUPA 3TS0A 2IPKD 2QILA 1ZYRD 4DV7L 1ZEQX 1HNWQ 1ZKOA 2PMZE 4RWSC 1TWAB 4A3DH 3GTQH 3M4YA 4ME5A 2D62A 5EQ0A 2OTJA 1U0LA 3CW2C 4JBMA 5LL6X 1GKHA 3PF5A 1N32Q 1E1OA 1CFMA 3ND9A 1EOTA 1CQVA 2HDMA 1PH4A 2HDLA 1Y1VG 4V190 5AJ3L 1PA6A 2K5DA 1BKBA 1N36L 4FF2A 5E7NA 4JI8Q 2B29A 4MZ9A 5M5WH 1EFID 3QOJA 2HHHL 2VQFL 5IGDA 4IFDH 2D5DA 1PH8A 1XNRQ 4WJ3M 3A5UA 4HIMA 1PFNA 1V8QA 4NB3A 3PUYA 3A8KE 1L1OB 1Y1WH 1DYQA 3M4PA 4TVAB 4ZKBB 1TWCB 3HOVH 2UUBL 4OWTB 3H0GB 3RZDB 2K52A 2F3IA 2ZXOA 1OXTA 1EYDA 1H9KA 1SNOA 3OTOQ 3SHLA 5CMDA 4PNYA 2K7VA 2DJFC 2TSSA 2PCFB 3Q6SA 2QEJC 1E2ZA 5M5XH 5IYBH 3F2UA 4JCVE 1D6EC 2CHBD 3U4VA 3P75A 2CW0D 1V1PA 1PMRA 2F0SA 5E1FA 3DHQA 3W1GA 1CM9A 4IN3A 2MNAA 4R4IA 2B2UC 2DY7A 3HOXG 5JAVA 1PLFA 2EDGA 3R2IA 4LF4Q 1TXYA 2KHIA 4XQJA 4DAPA 4JI2Q 2JJQA 1ESRA 2MJ8A 4R4OA 1YJWA 3F2BA 3ITPA 4IQZA 3H09A 3L3OC 1ZXTA 5C4ZA 5CBAE 4K8JA 4BY7H 1WVLA 3G6JB 2Z6BA 1H9RA 3I4NB 5HURA 1NR4A 3HS0C 4IFDJ 1CZGA 2N3SA 4HJ5A 1YHAA 3LNNA 5I2YA 1WTQA 1EYGA 2MHVA 1GO3E 4DXGA 1PH7A 2UXCL 5C3XA 1JCKB 4OWWB 1X3GA 4BWGB 3CCMA 2RSNA 1L1OA 3RLNA 4DV1Q 4B9WA 1QB5D 2EYOA 2R93B 2NWGA 3CCLA 3GP7A 4ZKCB 1PH9A 4DV7Q 1NNXA 2PQAB 2JA7G 2F0UA 4LAAA 1CQFA 1SROA 1Z47A 2Z1CA 3SGIA 4A3KH 1B44D 2CW0C 2XNAC 3KK7A 1QVCA 1SMXA 2WFWA 5IP9G 3WDNA 2E75C 3VYRA 1HPCA 1SE8A 1EQVA 4DR2L 1HHVA 2B2YC 3CQZB 4DU9A 2VS1A 2PI2A 5IWAQ 1QE6A 3EA6A 4HJ8A 3BYTB 2VQFQ 5C4XG 3BS1A 3S1QB 3VYTA 4A76A 4DR3L 3CP0A 3CCUA 3I4NH 4X64L 3C1FA 4M8AA 1SDFA 1K3BC 2IL8A 3LWUA 3CCEA 1NAPA 2IX3A 2JN4A 1EY7A 3MHBA 1KLUD 4GN4B 4DK3C 4DV4L 4HEDA 2WAQE 1GD7A 1KXLA 2M00A 1ILPA 2KJXA 4A3GG 4ZYSA 2F3VA 2FMMA 5JVH3 2BDNA 4R1JA 4IURA 1AEXA 2ICEC 2ZXRA 2YTYA 3SK6A 4JV5Q 1YNJD 2CCZA 1SLJA 1CUKA 2ZTEA 1SFOB 3A55A 4OIJA 4RA8A 2R7ZG 4A3IB 2Z0SA 1B4OA 1ET6A 4DNIA 2UUAL 4KJNA 5C0XI 1VS0A 4KMUC 2XGTA 3A56A 1HNZL 5JJLA 2JA5G 4K0KL 1F77A 2IWHA 3OHXC 1NMGA 4LK1C 5I6WA 4FXKC 2PQAA 4JOIA 1HTLD 3M3YH 1K9MC 4WJWA 3GV6A 3B6YA 3NHHA 4H7BA 2BH8A 1IBML 4DUZQ 2Z9HA 1CSPA 3HOYG 3OW2A 4GLXA 3I4LA 2WAQG 3R93A 1DONA 2L9HA 5HGQA 3HOUH 3HGBA 4GOPC 3PO2G 5JJKA 4N8FA 5CV6A 2ZM6Q 1HJPA 1LTBD 4JI3Q 5IP7H 3TMEA 2KEDA 4JI6L 4X6AH 2QDBA 4KHPL 4QL5A 3J81L 2FINB 1V9PA 2Z4IA 3E0EA 1NCVA 3W3AA 3AEVA 4LWCA 4J8QA 1YVCA 1I94L 2F0NA 1UE6A 4K14A 2I07B 2PNRC 1SFOH 1JQYD 3HOWB 4Y7NB 3MFYA 3S1RH 1I5FA 4EQNA 1SE4A 1BO0A 2EY6A 2F4IA 1E2VA 1F9PA 2O5IC 1F2ZA 1SYCA 3T4AC 1SYBA 4TQUS 2Q8TA 3K7AH 1XMOL 1YNJC 1B2TA 1JOQA 4DR6L 4DPGA 3J81i 3BJUA 1UUPA 2LKVA 4JG2A 4PV1C 2JEAI 1NUCA 1R4PB 4X65Q 3I91A 1PRTD 1B9MA 1BXTA 5GAGC 5GROA 3E0JA 3PUVA 4DR2Q 2OQ0A 1KQSA 2XVSA 4K5XA 1IKLA 3G4SA 1CA6A 1D2BA 5JJIA 4IUNA 4B08A 1KNAA 4TKOB 2HCCA 2F0GA 2B2WA 4UPAA 3NTKA 2NBFA 4KN7C 3KLSA 2XTIA 4A3FB 2NVQB 2WACA 3C46A 5C5MA 2KQ3A 3OMCA 1EL0A 2B63B 3RUZA 3O13A 3ERSX 4MNOA 1SYDA 1TS2A 1C8CA 1A3VA 2V4DA 4H02A 1VF7A 4FF1A 1BCPB 4LF5L 4IJLA 3BYYB 1YBYA 1Q1EA 2F0WA 3NWSA 3PIOA 3ULJA 2Y0SB 4RG1A 5C5LA 1Z9FA 2VXWA 2LXKA 2QA4A 2EOTA 4FYDA 3A5ZB 5K5PA 4C3JH 3S1MH 4G4KA 2R92G 3U9OA 4O1NA 2UXDQ 1X54A 4IOAA 3NTHA 4IPGA 2KHSA 3J7AF 2F0DA 4LMQD 3K8AA 1HNZQ 1EQTA 4RKBA 3K80C 3K5LA 4K0KQ 1E1TA 3BDCA 1JOKA 4CKBA 4C3IG 2L1BA 1QCBD 4QQBX 4KY6A 5KYLA 1SYFA 5CBEE 1VQHA 4DV0L 2L12A 1EUJA 1ASZA 5BR8Q 3D8GA 2IX1A 2F1MA 1RTOA 1U4PA 1HR0W 4LFCQ 5ELBA 2FJ2A 1QNKA 1LYLA 4F88A 2A8VA 2Q2HA 4A3FH 3I7FA 2NVQH 1X3PA 1PZID 1SBBB 3JAML 4EQPA 1MSHA 3NTIA 5CC4A 2KUMA 4LF7L 2E2IH 4JI6Q 1EU3A 1YNND 3S24A 1X3EA 4AYBB 4BBRH 2PW5A 4HCSA 4KHPQ 2RQXA 2ZJPA 4G7HC 2M9VA 4A3MB 5IY0A 1VQCA 3IFTA 1J8IA 3PCOB 3M85A 1E24A 1HFNA 1MGSA 1I94Q 5FLXL 1X65A 5ELEA 3NUCA 4DAYB 1E22A 3I4OA 1ICWA 4A3EB 3D4WA 4YCUA 3JAMi 2OTLA 3TDQA 5C3WA 4GOPB 4B3RL 2Z4HA 3SVMA 1JJ2A 2NZOA 2ZTDA 2F0KA 1PFBA 2NN6G 3TZUA 3I72A 5I9PA 3NEMA 1PZKD 2E2JB 2VL6A 1I4XA 4A3JB 1OXSC 4UHVA 4DK1A 1NSNS 1RF2D 3D4DA 3F2DA 1CTMA 5KNBA 2MO1A 1GXDC 1MBYA 2A6ED 3IFDA 5A35A 1CKNB 3K7UC 1Q86C 2WB1B 1TVXA 1K8MA 4IUVA 2VW9A 3EQLC 4LF9L 2VUMH 2MPMA 4DUYL 1I50H 1HR0L 1IXRA 4JC0A 1HFGA 2K5WA 3BDOA 3HKZG 4AQYQ 4A3MH 5ELNA 4G57A 1B9NA 4XT3B 2JA8B 5HY6A 4ME3A 2IY5B 3BVMA 3I90A 1YNNC 4LF5Q 1KDCA 3EJIA 2KVMA 2ATWA 3MFGA 1GOZA 1V1OA 5EBCA 5T1IA 3GTOH 1L1OC 4S3SA 1L0YB 4HJ7A 1CT1D 1GUOA 5C44G 2UU9Q 5COYA 4YWLA 3NPPA 4A93H 5ISRA 4RGTA 4B3SQ 5J1ZA 1EY8A 2K5HA 3TQYA 3CKIB 4DAYA 4HTHA 1GUGA 4H13C 1KNEA 4CJ0B 4A3JH 2N49A 4NW2A 3UDXA 1PH5A 3PO3B 3MAQA 3F8TA 5CV7A 1KDBA 2D0PA 3AMUA 1PH6A 4KTAA 4I7AA 2R3ZA 5GQOA 2HQLA 1XNRL 5M3FB 4EGVA 3EVQA 1Q90A 1FNVA 4DXFA 2K32A 1OTCA 4IZ8A 4K2KA 4JVZA 1IW7D 2L5TA 2DJGC 2A6EC 3E9HA 5E3FA 1X6OA 2JA8H 1K8GA 3OTOL 1YNXA 1CKNA 2PZWA 2XRSD 3NSWA 3VR6A 2B2VA 3TP8A 1IKMA 1EYAA 1GUWA 3VA5A 3CC4A 2L4NA 4LF8L 5EPKA 2EY2A 5C3EB 4DR7Q 4ZK9B 1Y1WG 4IFDI 1PFMA 3J80L 2AKWB 1YEZA 3PIPA 4NXML 4J6HA 1HQMC 4B3RQ 2H4OA 3GTQB 4A3DB 3J7ZC 3I4MH 1K3RA 1O7LA 1WTHA 5KNCA 4XTCS 3DUZA 5JJZA 4OL7A 3GTLH 2HT1A 1K28A 4LF4L 1B3QA 1WTVA 4BBSG 3S14B 1QUQB 5KEEA 5LHY1 3J7AV 3PO3H 1SN8A 1RODA 4IPHA 1HZCA 4C1NK 1B53A 2EYHA 1A0IA 3MEHA 5GAEC 4U673 5M5WB 4DAVA 3J80i 5M3FH 4CGYB 2JK8A 1PXUA 2P5ZX 4JOIC 3HRZC 1STEA 2VZAA 4O2DA 4LUVA 3V2TA 3HOZG 2MGSA 2GN5A 4G7ZC 2WKCA 3BG3A 3T13A 3L2PA 1B70B 4A3LH 1N33L 4DUYQ 1S5FD 3HOVB 1A8VA 2BA1A 1B8AA 1VQ5A 5LMNQ 1IW7C 3F2CA 3UI2A 4DV1L 3A8IE 3OWEB 2LSSA 3H15A 4OO1H 4L5TA 2N8NA 2E76C 1IHZA 1V1QA 3VR2A 1LLRD 5M5XB 1U9RA 3CCQA 2OQKA 1PH2A 3H0GG 1D5XC 2F0PA 1I4RA 2AWOA 1LTRD 1B3AA 1JWMD 4ID6A 2C5CA 1ML0D 3CCJA 3TRZA 1N34Q 4BA2I 3H91A 4RAUC 3MWYW 2JEBI 3L9AX 1IL2A 3S14H 1M4VA 1SNMA 2RDGA 2NUCA 4A3BH 2JA6B 2V1CC 3DMUA 5IWAL 3QR8A 2RHSB 3G48A 4KKUA 1IYVA 4HSVA 4J1MA 4BS9A 2HUGA 4L5RC 2KENA 2K6AA 5HGTA 3KYHC 1QUQA 5I9OA 1Y8OB 3MA2B 4A4IA 3CF5A 2A74C 4P72A 1YIJA 1VQJA 4MHEA 4BY1B 4BY7B 2CKZB 3AQQA 4GLVB 3E6ZX 4LUOA 3T1HQ 4JW0A 2K03A 2KOLA 1PV4A 2G5DA 2B2WC 5K36G 2A6HC 1Q8IA 1FD7D 3Q23A 4L8JA 1T9HA 1LT3D 1SNDA 5M3MB 1A62A 4KHVA 2A69D 2VY3A 3WWVA 1GHKA 1U4LA 1KIXA 4PQXA 2KA7A 3DWQA 4LF8Q 4OONA 3I4NG 4C56C 4KY5A 4JV5L 2EYMA 2Q2UA 1STAA 5C6AA 1UE1A 4X3TA 3LWEA 2QW7A 1BCPD 4NXMQ 4JBKA 4HCEA 1YI2A 1AE3A 5E4XA 3FVQA 4HAEA 4DR4Q 4A3KB 1H95A 2R93G 2JA6H 1W6KA 3N6RA 5CYUA 1O7YA 4DUZL 4DFAA 5A2QE 1BVSA 3QOLA 2CWPA 2K5QA 4EQOA 1G2TA 2ZJRA 4BY1H 2NTTA 1LTID 2IJ0A 2AUJD 1BCPF 4KN4C 3WOEA 1A63A 5ELFA 2Q8IB 2ZM6L 4JI3L 1XX8A 3KF6B 3GTKH 1LTLA 3D6CA 2XWBB 3ERQA 1N33Q 2PW7A 1K8AC 1JMCA 2YU9H 1VDZA 1PTOB 2PMZB 4FXGC 4HN7A 5M3MH 2FMCA 5IT9L 3PUWA 2B3GA 1JJCB 5FJ8H 5NUCA 4QF4A 2A1AA 4UY8C 4I7ZC 2EY1A 4K5VA 2A69C 3TSSA 4ZRZA 5IP7G 5JPMC 3S17H 2A73B 1DM0B 1PH3A 3S16B 1EU4A 1Z7TA 2B2TA 3NE5B 3PUXA 1G6PA 3HG9A 4ZUJA 1Y1VH 4X65L 1A6XA 2OXPA 1EY5A 2KHJA 2JSOA 1BCPC 3VR3A 4H44C 4X66L 3V05A 1II3A 4OHJA 3M3YB 3CU7A 4RGOS 5J39A 1BF4A 4A3CG 4A3IG 1C9OA 3OYYA 1JR0D 3BVGA 3GD7A 1TR5A 2R61A 3BDLA 3I2ZA 3I3CA 3HOUB 4FF4A 3J7A5 3CHBD 2EQSA 3R2TA 1AN8A 1Q82C 1PTOH 3A8JE 4JI0L 4UP8A 3OIPA 1P16A 1QZHA 2D2CC 1FJGQ 3SEBA 1SMYD 1IL8A 2IHEA 1L0WA 4HIDA 3ONAB 2UXBQ 3KF6A 5EKLA 4L6TB 3CC7A 3CCVA 2C9OA 1RD9D 4QMGA 5C0XG 3FMCA 3S1RB 4DAMA 1NBWA 2UXDL 3S16H 1VQOA 3K7AB 3RR5A 3HOXH 2IX0A 3GTMB 5AFWA 5EPJA 4TSSA 1I4QA 3HKSA 2DN8A 2F0QA 3HOWG 1OXXK 4ZQ3A 1SR3A 2KCTA 1U4RA 3R8BA 5BR8L 4KD4A 1UNSA 1QWYA 4LFCL 1FVIA 2SDFA 4EQ5A 2Z6KA 1LABA 1VQGA 1JJGA 2J0TD 4M1UB 4EX5A 1VQMA 4R4TA 1C0AA 1KDAA 1BDOA 2RBMA 2CWAA 2EYFA 3OWFA 3NELA 2PPBC 2F0IA 1WD1A 1SJHD 3FPUB 2K01A 4LFAQ 3FKIB 2JE6I 3SXHA 2G9DA 3LGJA 4NPSA 3KF8A 5KYIA 1SMYC 2F4VL 3A0JA 1K0RA 3MXGA 4A3FG 2B2VC 4IALA 1P8LA 5JEAG 2JA7H 5ELDA 2ASBA 2B63G 2AQ3B 4C3JB 3S1MB 2OT2A 4DV5L 2ICIA 1GM5A 1JT8A 2KCNA 2CFMA 3GTMH 5KRUA 5H1SE 1DD2A 1OXVA 4OELB 4QIWB 4DA2A 5EKKA 5IP9H 2L11A 2Y0SG 3ER0A 5IYCG 4WFN3 3H3VH 4QJFA 4X66Q 1C4QA 4MTNA 1T5EA 3DLLA 1WTRA 5DAUA 1TWGH 3UDIA 4HJ9A 3X3MA 1S72A 2K5NA 3BZCA 3G7LA 2WAQB 2K04A 4R8NA 4HMIA 4RCNA 4MN3A 4YY3Q 3BZKA 2F0EA 5BN5A 1WTXA 2NVXB 5DNFA 4CKEA 4YWMA 2BH2A 1B50A 2ES2A 4AQYL 3T1YL 4JI0Q 2E2IB 2J4XA 3UE1A 3G71A 1IBKQ 3SK8A 3C2PA 3FKIH 3BU2A 4BBRB 3C3LA 2E2HH 3URYA 1VQFA 3D4RA 4GN5A 4QCLA 4FVMA 1JC7A 1MIUA 5DM63 5C4JH 1SYEA 2DGYA 3CMAA 2MQHA 1S4ZA 5CR3A 3QWNA 1E0BA 1TWFH 4R9WA 4ZAIA 4HIKA 2DY8A 2JA9A 4AYBG 2UU9L 1DOLA 2NVTB 3W5OA 1QILA 4B3SL 1T5XD 4L5SA 1FYCA 3NXWA 1K0SA 4K6DA 2LFNA 4X62L 1S5CD 4KKSA 4JI7Q 1YJNA 2OWOA 2K33A 1QZGA 4RMFA 2NZ1D 1VQPA 1BQQT 3NWTA 4A3EG 1I6VC 4A75A 1S5BD 2JP1A 5D3IB 4PMBA 3ND8A 2HIVA 3PO2H 1YHBA 4DV6L 1BBWA 5LMNW 4DR1Q 4UP9A 4IUQA 1CI3M 2NVXH 1VMPA 3NBIA 2VUMB 3KLWA 3S1NH 4A3JG 1KABA 1I50B 3K0YA 4POGA 2I5HA 1A2TA 3MXNB 1SJED 1CA5A 1I4PA 1XJVA 3W2DA 4WJ4A 4Z9CB 3D6WA 4GKJL 1CHPD 4DR7L 1TY0A 2WB1G 2F4VQ 3VDYA 3ZJYC 1C48A 1PYBA 1I4GA 3HKZE 1E3PA 1VQ9A 3GTOB 2RCNA 2CH4A 2WKDA 2NVTH 5IYDG 4DV5Q 4C2MH 1VF5C 4CJ1B 2JA8G 5JOBA 5G3LF 5C4HA 2EPBA 1Q46A 4OXPA 4POFA 4A93B 1K8OA 4RGNA 1VQIA 2KCMA 1AW7A 4KY7A 1ET9A 3NP8A 1YITA 4GKKQ 1BR9A 1J5EL 1KAAA 1EY9A 3RZOH 5LMUQ 1WD0A 2IW3A 3ICEA 5IGFA 4JI4L 1WYDA 2K28A 2WP8J 1D1KA 1O7ZA 2E5LQ 1G8ZD 5EBDA 1UE5A 3AU7A 1SE2A 3X3NA 1IYUA 5FLXc 2Q8RE 1Q1BA 2KBNA 3PO3G 1S5DD 2QCPX 3T1YQ 4CKCA 5LMNL 4XYOA 5IODA 1TIID 4L5QA 3OPOA 5BN4A 4G7OC 1UWVA 2FFKB 4ABNA 5M3FG 1Z6HA 2QDLA 4N9TA 1F2MA 4B9XA 4DNRB 3MXNA 4BXXG 1PTOD 1D1IA 3TS2A 2MFIA 3CPWA 4DNTB 4A3LG 1TU2B 3K5MA 3OMGA 5JEAJ 2EJMA 1XMQL 3TP7A 2L0CA 3FDTA 1EOVA 1N34L 2N55A 3NBHB 1D5ZC 2OCEA 3I4MB 4C3IH 4X62Q 3J81j 1NTGA 4CDCC 1GUNA 3PUZA 5C3EG 3GTLB 4OO1G 1STNA 2B2TC 3PF4A 1HA5A 4IUTA 4DN4M 1ENCA 2ZTCA 4C3HB 1PHJA 1PH1A 3DEPA 1WI5A 2AMCB 2SNMA 1PTOF 3I8ZA 4RKLA 1QVGA 4OO1I 1ENFA 4A3DG 4NDXA 3SDZA 4HJAA 4GN3B 4DV6Q 2I0QA 4L63B 2JXMB 2QEXA 4E6IA 3K0XA 1CK1A 3T1HL 4JBJA 3AFQA 3R3OA 4DF7A 1QJOA 2PQEA 3GV3A 4NXNQ 5FO8B 1ENAA 3PGZA 2A5HA 2J7ZA 1TWHH 4IFDG 5M5YH 2D0OA 4DKAC 1AE2A 5L37A 2XIWA 4GKJQ 1MKHA 3JC66 3VYUA 3A74A 4OX9L 1XTDA 3HOVG 3QO2A 1WTPA 1VQDA 1KTKA 2NYZD 2O4XA 5KNDA 5E4WC 2K75A 2NN6H 1PTOC 3S2DB 3Q8DA 1E7ZA 1XPUA 1EZ8A 4DR4L 1R4QB 3RNUA 1HH2P 5EJWA 4RFBA 1BUVT 1SSOA 2ALYB 1N9WA 3BVZA 4C3HH 3EBEA 2B8GA 4UP7A 5IYBG 4JBWA 4A3BB 4PZ6A 1J5EQ 2Q2IA 1CKOA 3U58A 2AQ2B 3NBHA 4JI4Q 4MIUA 3NQIA 1W6JA 4YHHQ 1TS3A 1UEAB 2MO0A 2A6HD 5KIXA 2ZT9C
chains in the Genus database with same CATH topology
1WCMB 3N52A 3OIQA 3RMHA 1SNQA 4Q0FA 1I4HA 1EEFD 2RDHA 1EY4A 2AUKA 1G2SA 3KBXA 1D5MC 3FPPA 2DNEA 2ENBA 3DWAA 5FOBB 5I2XA 5F2DA 1JICA 4NKLA 2EJGC 5FLXE 3K59A 1MI2A 2KECA 2YYZA 5IGEA 3K58A 2EZVA 4OIKA 3RLFA 2D9UA 4ZLTF 3VR4A 4HMJA 3PV0A 2EYPA 4KK7A 2F0HA 1RKNA 5TSSA 2F0TA 3M7NA 2QKIC 3NK9A 1O78A 3TP5A 3DXJC 3ZYYX 1FNUA 2RDFA 3H6MA 5DEHA 1K83B 3HOZB 2DNCA 4XXEA 1BNZA 1RDPD 4C1NI 3TN2A 1TT2A 2B39A 4V0BA 3GTKB 4F8MA 4NP5A 4F7XA 3D3RA 4IUUA 2YU9B 1DOKA 3MXUA 1EIHA 2QF7A 4KV6A 3H3VC 2F0MA 3GTJB 4U68A 3K57A 1NR2A 1F2YA 3EROA 2O5JC 1Y8PB 2OF1A 2F0LA 1FNWA 1VCIA 2X6GA 3S17B 1CZWA 1UAPA 1JE4A 1STGA 1F2LA 4KD3A 4YIJA 1H9JA 5CV8A 3T16A 3T53B 4PMWA 1Y1VB 1RTNA 3Q24A 1AZPA 3Q0AA 1A3TA 2WV6D 1E2WA 3PMFA 5LL6S 3KLRA 3HZXA 2KCCA 3OSOA 3SK4A 1ZYRC 5EGTA 5CORA 2OEOA 5FKAC 1SNPA 1GUTA 2LS01 1F9RA 1X32A 2MP1A 1RHPA 2BE5D 4LJZC 1WTOA 2LY7A 2PZTA 1O80A 4K5WA 2JYOA 5CGKA 1BBXC 1CHQD 4QUCA 4RHRA 2BA0A 1XYIA 4X3KA 1G291 4JK1C 5D3DA 5EKIA 2F0OA 1MSGA 3J80E 2AWNA 3AB9A 4RHSA 1LV9A 4XT1B 1DZ1A 2EJFC 3HOXB 3OW7A 2X6LA 2K05A 2GA4B 2NTSA 1H9SB 5D65A 4QB4A 3RD4A 1XXGA 2L55A 3EFXD 1QNUA 4FNFA 5K36H 4ULLA 5D14A 2VNUD 1EWHA 2BE5C 1ONLA 4FP5D 2R6GA 1QOHA 1STHA 3PIO3 1J9OA 4DGZA 2JA7B 3SR1A 5J22A 4BA1I 1SNCA 1Y69U 2NVYB 4RCOA 1Q12A 2MUYA 3IAYA 4X3UA 1XTCD 2WINB 1TWGB 4C3JG 4ZUIA 5C4XB 2ID0A 1G91A 2XWJB 3A7LA 3K5NA 1M8AA 1JWSD 2F0VA 4XIGS 4ODGA 5ELCA 1LTTD 1SE3A 2K1BA 4QUFA 5KGUA 1F9SA 1H9SA 1VMCA 3S15B 3GTPB 3NQTA 1BOSA 2CQAA 1ESFA 1SXTA 1V43A 1HRJA 4CHTB 4A3GB 3HP3A 3QG1A 2E2HB 3S9WA 2RSOA 4EVOA 1I6HB 1HA6A 5IIFA 5C4JB 3OOCA 4KHZA 2R7ZB 2EXZA 1ILQA 2PO4A 1TWFB 4O42A 4CJ2C 4K6LA 2NB0A 2JA5B 1SYGA 1KLGD 3Q22A 1H9MA 3H94A 4OGQC 1S5ED 3HOYB 1TKWB 3C1EA 2TMPA 1G6ZA 1F9QA 1DJRD 1RCVD 2XRQD 2M2LA 3PO2B 1TS4A 1PYWD 2B8FA 1R9TB 5I6YA 2F0JA 1HQRD 4GZYC 4N9PA 3S1NB 2F03A 1GHJA 3KLSX 1SEBD 4H0LC 5IT9E 1QG7A 1JWUD 5IGBA 1EY0A 5C0XH 3BZDB 1LT6D 3MZ5A 4PMCA 1EWCA 1PRTF 2XSCA 4C2MB 2X69A 3K6OA 1LTGD 4X3SA 3SK5A 4P2CB 3HEJA 4NMZA 2B2UA 1GJXA 1LT5D 3GO5A 2EYJA 3RZOB 4HSPA 3U9SA 2F0FA 4KI0A 5M9OA 3L7ZC 4IUPA 1TY2A 2IT1A 2I46A 3MTSA 5G3LD 2F3WA 2BOSA 1RJTA 2PYKA 3VR5A 1PRTC 3LX0A 3T51B 3VYSA 2E2DC 3MVVA 4F87A 1EZ6A 2FHTA 5JEAH 3VA7A 5CV5A 3SE0A 3J7YW 2O2LD 2R92B 5C0XJ 2CVRA 3K5OA 1SAPA 5IOCA 3PIP3 1XWEA 3CRLC 4C3IB 3GTGB 5CV4A 3IL8A 3QIAA 4FXDA 2EVBA 4K2LA 4WRDA 3I70A 2B2YA 1TQOA 2EY5A 5JVG3 4KJOA 4I65A 3MXPA 3GQBA 1LTSD 3FRPB 2NN6I 3P20A 4C3HG 2PZUA 1FR3A 3J81E 2VB2X 1OXUA 3QB3A 1DCZA 1TWHB 5M5YB 1A3UA 3FEWX 1AFPA 5EPLA 1Q3LA 1EYCA 2XN9C 4DK0A 3DWPA 4K8IA 2G9HD 2AQ1B 1HCZA 3A54A 4UDUC 2WIIB 2SEBD 1JORA 3M4OB 2N88A 2KEEA 4KKTA 4XDXA 1AP0A 3IKJA 3I73A 4R8IA 4FO2A 1X3QA 5I4DA 1HXYD 2RVLA 2BCOA 1EY6A 3P1HA 2LMCB 3TBIB 4ILWA 1EIGA 5JPNC 3P7JA 2EYLA 3QJYA 1A2UA 3KBGA 1AZQA 1GUSA 2HCIA 2Z8LA 3V96A 2HQEA 1A15A 3HKZB 1I3QB 5A2QL 1L0XB 1LTAD 5BN3A 2A68D 3DEOA 4XYQA 2H1EA 1B1ZA 3D31A 5FK9C 1FGBD 4FF3A 4WORA 1Y8NB 5DM73 4CBVA 3S2HB 5C44B 1HTPA 5T1GA 4UAIA 1HUMA 1U4MA 2SOBA 3CRKC 4RGMA 4XQQA 5IGCA 2VB3X 1LACA 1PRTB 1OO9B 4Q5VA 1PZJD 2RA4A 1DXMA 3TP6A 1WTWA 4TRDA 5CV9A 1EEID 1MD2D 5IGGA 3JAME 2RKSA 3TZDA 4XQNA 1LO5D 4HR7B 2BDOA 1LT4D 1STYA 3M7GA 3E5SA 2SNSA 1JB3A 3A7AB 3T56B 1DOMA 1HUNA 2A68C 1Y1WB 1TS5A 1STBA 3DM1A 1PDQA 2E74C 4RH6A 5FO7B 3MC0B 3WOFA 1V1PB 2EE1A 1JOOA 2ZXPA 5FO9B 4BBSB 3KUPA 2IPKD 2QILA 1ZYRD 1ZEQX 1ZKOA 4RWSC 1TWAB 3M4YA 4ME5A 2D62A 5EQ0A 5LL6X 1CFMA 3ND9A 1EOTA 1CQVA 2HDMA 2HDLA 4V190 2K5DA 4FF2A 1EFID 3QOJA 5IGDA 4IFDH 2D5DA 1PFNA 1V8QA 3PUYA 3A8KE 1DYQA 4ZKBB 1TWCB 3H0GB 3RZDB 2ZXOA 1OXTA 1EYDA 1H9KA 1SNOA 3SHLA 5CMDA 4PNYA 2K7VA 2TSSA 2PCFB 3Q6SA 2QEJC 1E2ZA 3F2UA 1D6EC 2CHBD 3P75A 2CW0D 1V1PA 1PMRA 2F0SA 5E1FA 3DHQA 1CM9A 4IN3A 2B2UC 2DY7A 5JAVA 1PLFA 2EDGA 3R2IA 4XQJA 4DAPA 1ESRA 2MJ8A 3ITPA 4IQZA 3H09A 3L3OC 1ZXTA 5C4ZA 5CBAE 4K8JA 1WVLA 3G6JB 1H9RA 3I4NB 5HURA 1NR4A 3HS0C 4IFDJ 1CZGA 3LNNA 5I2YA 1WTQA 2MHVA 4DXGA 5C3XA 1JCKB 4BWGB 2RSNA 4B9WA 1QB5D 2EYOA 2R93B 2NWGA 3GP7A 4ZKCB 2F0UA 4LAAA 1CQFA 1Z47A 2Z1CA 1B44D 2CW0C 2XNAC 3KK7A 3WDNA 2E75C 3VYRA 1HPCA 1EQVA 1HHVA 2B2YC 3CQZB 4DU9A 1QE6A 3EA6A 3BYTB 3BS1A 3S1QB 3VYTA 3C1FA 4M8AA 1SDFA 2IL8A 3LWUA 1NAPA 2IX3A 1EY7A 3MHBA 1KLUD 4HEDA 2M00A 1ILPA 2KJXA 4ZYSA 2F3VA 2FMMA 5JVH3 2BDNA 4IURA 1AEXA 2ICEC 2ZXRA 3SK6A 1YNJD 1SFOB 3A55A 4OIJA 4RA8A 4A3IB 1B4OA 1ET6A 4KJNA 5C0XI 4KMUC 3A56A 1F77A 2IWHA 3OHXC 4LK1C 5I6WA 4FXKC 1HTLD 4WJWA 3GV6A 3NHHA 4H7BA 3I4LA 3R93A 1DONA 2L9HA 3HGBA 5CV6A 1LTBD 3TMEA 2KEDA 2QDBA 3J81L 2FINB 2Z4IA 1NCVA 3W3AA 4J8QA 2F0NA 4K14A 2I07B 2PNRC 1JQYD 3HOWB 4Y7NB 3MFYA 4EQNA 1SE4A 1BO0A 2EY6A 2F4IA 1E2VA 1F9PA 2O5IC 1F2ZA 1SYCA 3T4AC 1SYBA 4TQUS 2Q8TA 1YNJC 1B2TA 1JOQA 1UUPA 2LKVA 4PV1C 2JEAI 1NUCA 1R4PB 3I91A 1PRTD 1B9MA 1BXTA 3E0JA 3PUVA 2XVSA 4K5XA 1IKLA 1CA6A 1D2BA 4IUNA 4B08A 1KNAA 4TKOB 2HCCA 2F0GA 2B2WA 3NTKA 2NBFA 4KN7C 3KLSA 4A3FB 2NVQB 2WACA 3C46A 5C5MA 2KQ3A 3OMCA 1EL0A 2B63B 3RUZA 3O13A 1SYDA 1TS2A 1C8CA 1A3VA 2V4DA 1VF7A 4FF1A 1BCPB 3BYYB 1Q1EA 2F0WA 3NWSA 2Y0SB 5C5LA 2VXWA 2EOTA 4FYDA 5K5PA 4G4KA 3U9OA 4O1NA 3NTHA 2KHSA 3J7AF 2F0DA 4LMQD 1EQTA 4RKBA 3K5LA 3BDCA 1JOKA 4CKBA 4C3IG 2L1BA 1QCBD 4KY6A 5KYLA 1SYFA 5CBEE 2L12A 3D8GA 2IX1A 2F1MA 1RTOA 1U4PA 5ELBA 2FJ2A 1QNKA 4F88A 1X3PA 1SBBB 1PZID 3JAML 4EQPA 1MSHA 3NTIA 5CC4A 2KUMA 1EU3A 1YNND 4AYBB 2PW5A 4HCSA 2RQXA 4G7HC 4A3MB 2M9VA 3IFTA 1J8IA 3M85A 1HFNA 1MGSA 5FLXL 5ELEA 3NUCA 1ICWA 4A3EB 3D4WA 3TDQA 5C3WA 2Z4HA 3SVMA 2F0KA 1PFBA 2NN6G 3TZUA 3I72A 5I9PA 1PZKD 2E2JB 1I4XA 4A3JB 1OXSC 4DK1A 1NSNS 1RF2D 3D4DA 1CTMA 5KNBA 1GXDC 1MBYA 2A6ED 3IFDA 5A35A 2WB1B 1TVXA 1K8MA 4IUVA 3EQLC 2MPMA 1HFGA 2K5WA 3BDOA 4G57A 1B9NA 4XT3B 2JA8B 3BVMA 3I90A 1YNNC 1KDCA 3EJIA 2KVMA 3MFGA 1GOZA 1V1OA 5EBCA 5T1IA 4S3SA 1L0YB 1CT1D 1GUOA 5COYA 3NPPA 5ISRA 4RGTA 5J1ZA 1EY8A 3CKIB 4DAYA 4HTHA 1GUGA 4H13C 1KNEA 4CJ0B 4NW2A 3PO3B 3MAQA 5CV7A 1KDBA 3AMUA 4KTAA 2R3ZA 5M3FB 4EGVA 3EVQA 1Q90A 1FNVA 4DXFA 2K32A 4IZ8A 4K2KA 1IW7D 2L5TA 2A6EC 5E3FA 2XRSD 3NSWA 2PZWA 3VR6A 2B2VA 3TP8A 1IKMA 1EYAA 1GUWA 3VA5A 2L4NA 5EPKA 2EY2A 5C3EB 4ZK9B 4IFDI 1PFMA 3J80L 4J6HA 1HQMC 4A3DB 2H4OA 3GTQB 1O7LA 5KNCA 4XTCS 3DUZA 5JJZA 4OL7A 1WTVA 3S14B 5KEEA 5LHY1 3J7AV 1RODA 4C1NK 1B53A 2EYHA 3MEHA 4U673 5M5WB 4DAVA 4CGYB 1PXUA 3HRZC 1STEA 3V2TA 2MGSA 4G7ZC 2WKCA 3BG3A 3T13A 1S5FD 3HOVB 2BA1A 1IW7C 3UI2A 3A8IE 3OWEB 4OO1H 2E76C 1IHZA 3VR2A 1LLRD 5M5XB 1U9RA 1D5XC 2F0PA 1I4RA 2AWOA 1LTRD 1B3AA 1JWMD 4ID6A 2C5CA 1ML0D 4BA2I 3H91A 4RAUC 3MWYW 2JEBI 3L9AX 1M4VA 1SNMA 2RDGA 2NUCA 2JA6B 3DMUA 4KKUA 1IYVA 4HSVA 4J1MA 4BS9A 2HUGA 2K6AA 5HGTA 5I9OA 1Y8OB 3MA2B 2A74C 4MHEA 4BY1B 4BY7B 3E6ZX 2K03A 2KOLA 2B2WC 5K36G 2A6HC 1Q8IA 1FD7D 3Q23A 4L8JA 1LT3D 1SNDA 5M3MB 4KHVA 2A69D 1GHKA 1U4LA 4PQXA 2KA7A 3DWQA 4C56C 4KY5A 2EYMA 1STAA 5C6AA 4X3TA 3LWEA 1BCPD 4HCEA 5E4XA 3FVQA 4HAEA 4A3KB 1W6KA 3N6RA 5CYUA 1O7YA 4DFAA 5A2QE 3QOLA 2K5QA 4EQOA 1G2TA 3WOEA 2NTTA 1LTID 2IJ0A 1BCPF 2AUJD 4KN4C 5ELFA 2Q8IB 1XX8A 3D6CA 2XWBB 3ERQA 2PW7A 1VDZA 1PTOB 2PMZB 4FXGC 4HN7A 2FMCA 5IT9L 3PUWA 5NUCA 4QF4A 4I7ZC 2EY1A 4K5VA 2A69C 3TSSA 4ZRZA 5JPMC 2A73B 1DM0B 3S16B 1EU4A 1Z7TA 2B2TA 3NE5B 3PUXA 3HG9A 4ZUJA 1A6XA 2OXPA 1EY5A 3VR3A 2JSOA 1BCPC 4H44C 3V05A 1II3A 4OHJA 3M3YB 3CU7A 4RGOS 5J39A 1BF4A 1JR0D 3BVGA 3GD7A 1TR5A 2R61A 3BDLA 3I3CA 3HOUB 4FF4A 3CHBD 3R2TA 1AN8A 1PTOH 3A8JE 3OIPA 2D2CC 3SEBA 1SMYD 1IL8A 3ONAB 5EKLA 4L6TB 2C9OA 1RD9D 4QMGA 5C0XG 3FMCA 3S1RB 3K7AB 2IX0A 3GTMB 5AFWA 5EPJA 4TSSA 1I4QA 2DN8A 2F0QA 1OXXK 4ZQ3A 1U4RA 3R8BA 4KD4A 1UNSA 1QWYA 2SDFA 1LABA 2J0TD 4M1UB 1KDAA 1BDOA 2RBMA 2EYFA 3OWFA 2PPBC 2F0IA 1WD1A 1SJHD 3FPUB 2K01A 3FKIB 2JE6I 3SXHA 2G9DA 3KF8A 5KYIA 1SMYC 3MXGA 2B2VC 4IALA 5JEAG 5ELDA 2AQ3B 4C3JB 3S1MB 2OT2A 2ICIA 2KCNA 5KRUA 1DD2A 1OXVA 4QIWB 4DA2A 5EKKA 2L11A 4WFN3 1C4QA 1T5EA 1WTRA 5DAUA 3X3MA 3G7LA 2WAQB 2K04A 4R8NA 4HMIA 4RCNA 4MN3A 2F0EA 5BN5A 1WTXA 2NVXB 5DNFA 4CKEA 1B50A 2E2IB 2J4XA 3SK8A 3C2PA 4BBRB 3C3LA 3URYA 3D4RA 4QCLA 4FVMA 1JC7A 5DM63 1SYEA 1S4ZA 5CR3A 3QWNA 1E0BA 4R9WA 4ZAIA 2DY8A 1DOLA 2NVTB 1QILA 1T5XD 1FYCA 3NXWA 4K6DA 2LFNA 1S5CD 4KKSA 2K33A 2NZ1D 1BQQT 3NWTA 1I6VC 1S5BD 2JP1A 5D3IB 4PMBA 3ND8A 4IUQA 1CI3M 1VMPA 3NBIA 2VUMB 1KABA 1I50B 3K0YA 1A2TA 1SJED 1CA5A 1I4PA 3W2DA 4Z9CB 3D6WA 1CHPD 1TY0A 1C48A 1I4GA 3GTOB 2WKDA 1VF5C 4CJ1B 5JOBA 5G3LF 5C4HA 2EPBA 4A93B 1K8OA 4RGNA 4KY7A 1AW7A 1ET9A 3NP8A 1BR9A 1KAAA 1EY9A 1WD0A 2IW3A 5IGFA 2K28A 2WP8J 1D1KA 1O7ZA 1G8ZD 5EBDA 3AU7A 1SE2A 3X3NA 1IYUA 2Q8RE 1Q1BA 1S5DD 2QCPX 4CKCA 4XYOA 5IODA 1TIID 3OPOA 5BN4A 4G7OC 2FFKB 4ABNA 1Z6HA 4N9TA 1F2MA 4B9XA 4DNRB 3MXNA 1PTOD 1D1IA 4DNTB 1TU2B 3K5MA 3OMGA 5JEAJ 2EJMA 3TP7A 2L0CA 3FDTA 2N55A 1D5ZC 3I4MB 1GUNA 3PUZA 3GTLB 4OO1G 1STNA 2B2TC 1HA5A 4IUTA 4DN4M 1ENCA 4C3HB 3DEPA 2SNMA 1PTOF 3I8ZA 4RKLA 4OO1I 1ENFA 4NDXA 3SDZA 4L63B 2JXMB 4E6IA 1CK1A 3R3OA 4DF7A 1QJOA 2PQEA 3GV3A 5FO8B 1ENAA 2A5HA 2J7ZA 4IFDG 2XIWA 3VYUA 3QO2A 1WTPA 1KTKA 2NYZD 2O4XA 5KNDA 5E4WC 2NN6H 1PTOC 3S2DB 1EZ8A 1R4QB 5EJWA 4RFBA 1BUVT 1SSOA 3BVZA 2B8GA 4JBWA 4A3BB 2AQ2B 3NBHA 4MIUA 3NQIA 1W6JA 1TS3A 1UEAB 2A6HD 5KIXA 2ZT9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EVB A;  1FYC A;  1LAB A;  2PNR C;  2CW0 C;  1E2W A;  2AWO A;  1V8Q A;  4KKS A;  3MFY A;  3PUY A;  1GHJ A;  4DNR B;  3PUW A;  3CRK C;  3A8K E;  2K33 A;  3WDN A;  2E75 C;  3KLR A;  1HPC A;  4H0L C;  2KCC A;  1E2V A;  4BA2 I;  1LAC A;  2O5I C;  1BDO A;  2AUK A;  4DNT B;  1TU2 B;  4BA1 I;  4G7H C;  2JEB I;  4TQU S;  1I6V C;  1Q90 A;  1ZYR C;  3FPP A;  4I7Z C;  5C0X H;  1YNJ C;  2DNE A;  3IFT A;  2K32 A;  1Y69 U;  3GQB A;  1Q12 A;  3M85 A;  1OXT A;  2EJM A;  1H9K A;  2A69 C;  2PPB C;  2NN6 I;  3P20 A;  4PV1 C;  1IW7 D;  2JEA I;  2L5T A;  1DXM A;  2A6E C;  1FR3 A;  2EJG C;  3ND8 A;  4KKU A;  1GUT A;  1IYV A;  1Z7T A;  2JE6 I;  1B9M A;  2K7V A;  1GUN A;  3NE5 B;  3PUX A;  3PUZ A;  2YYZ A;  1OXU A;  2PCF B;  3PUV A;  1CI3 M;  4OO1 G;  3LWU A;  3VR6 A;  1DCZ A;  1E2Z A;  1SMY C;  2BE5 D;  4LJZ C;  1A6X A;  3A7L A;  3VR3 A;  1Y8O B;  4XIG S;  4H44 C;  3RLF A;  5JEA G;  2NN6 G;  4HR7 B;  3TZU A;  1PMR A;  4TKO B;  2BDO A;  3VR4 A;  4DK0 A;  3I72 A;  2BA0 A;  3SDZ A;  3PV0 A;  1G29 1;  1H9S A;  1GJX A;  4JK1 C;  4KN7 C;  5K36 G;  1HCZ A;  2A6H C;  2JXM B;  1DD2 A;  1OXV A;  1OXS C;  4DK1 A;  3A7A B;  3GD7 A;  3U9S A;  2EDG A;  1CTM A;  1QJO A;  4KKT A;  4L8J A;  1HQM C;  4KI0 A;  3T56 B;  5KNB A;  3M7N A;  2A69 D;  1O78 A;  3IKJ A;  3DXJ C;  3I73 A;  2A68 C;  1V43 A;  1GHK A;  3AB9 A;  2A6E D;  1O7L A;  2KA7 A;  3L7Z C;  3QG1 A;  4XTC S;  5A35 A;  5KNC A;  2EJF C;  2V4D A;  1VF7 A;  1T5E A;  2IT1 A;  3A8J E;  3OW7 A;  4KMU C;  1Q1E A;  1VF5 C;  4IQZ A;  1K8M A;  2E74 C;  4IFD G;  3EQL C;  2D2C C;  2DNC A;  1K8O A;  3OOC A;  4KHZ A;  3VR5 A;  4RCN A;  4LK1 C;  3BDO A;  1H9R A;  2LMC B;  1H9S B;  5BN5 A;  1B9N A;  3T51 B;  3LNN A;  3MXU A;  3QJY A;  2QF7 A;  5C0X G;  1GUS A;  3FMC A;  1YNN C;  1ZKO A;  5KND A;  5JEA H;  3VA7 A;  3I4L A;  4G7Z C;  3BG3 A;  2NN6 H;  3N6R A;  3M4Y A;  3HGB A;  2D62 A;  3SE0 A;  1H9M A;  3H94 A;  5BN3 A;  2O5J C;  1Y8P B;  2A68 D;  5K36 H;  2BA1 A;  4OGQ C;  1CFM A;  3ND9 A;  1TKW B;  3D4R A;  1GUO A;  1IW7 C;  1VCI A;  1IYU A;  2B8G A;  4JBW A;  1Q1B A;  3A8I E;  2AUJ D;  3D31 A;  1EWH A;  2F1M A;  3CRL C;  4KN4 C;  2Q8I B;  1Y8N B;  4OO1 H;  2DN8 A;  1OXX K;  2B8F A;  2E76 C;  1H9J A;  2BE5 C;  1GUG A;  1ONL A;  3W3A A;  4H13 C;  3VR2 A;  3QIA A;  3OPO A;  3T53 B;  5BN4 A;  4GZY C;  4G7O C;  1HTP A;  1VDZ A;  4IFD H;  2D5D A;  2R6G A;  1Z6H A;  2A6H D;  2ZT9 C; 
#chains in the Genus database with same CATH topology
 1WCM B;  3N52 A;  3OIQ A;  3RMH A;  1SNQ A;  5GAD C;  2Z6K C;  4Q0F A;  1I4H A;  2JA6 G;  1EEF D;  2RDH A;  1EY4 A;  2AUK A;  1G2S A;  3KBX A;  1IBL Q;  4B3M Q;  4OEM B;  2PI2 E;  1D5M C;  3FPP A;  2DNE A;  2YTX A;  1U5K A;  2ENB A;  1IYJ B;  3DWA A;  5FOB B;  5I2X A;  5F2D A;  2ZJQ A;  1JIC A;  4NKL A;  2EJG C;  5FLX E;  4BY1 G;  3K59 A;  4BY7 G;  3ULP A;  1MI2 A;  1VQE A;  2KEC A;  2YYZ A;  3S2H H;  4DV3 L;  2R7F A;  4R4C A;  5IGE A;  2JQO A;  4YCV A;  3K58 A;  2EZV A;  4OIK A;  3I56 A;  1VQ4 A;  3S2D H;  4LF6 L;  3TEH B;  3RLF A;  3K81 C;  2D9U A;  1XMQ Q;  4ZLT F;  3VR4 A;  4HMJ A;  5M3M G;  4GNX B;  3PV0 A;  2EYP A;  2FXQ A;  4KK7 A;  2F0H A;  2RHQ B;  1RKN A;  5TSS A;  2F0T A;  3M7N A;  2QKI C;  3NK9 A;  1O78 A;  3TP5 A;  1JB7 A;  3EN2 A;  3DXJ C;  3ZYY X;  1FNU A;  4LW1 A;  2RDF A;  3H6M A;  5DEH A;  1K83 B;  3HOZ B;  1WCM H;  2DNC A;  4JI1 Q;  4XXE A;  4A3K G;  1BNZ A;  1RDP D;  3IRB A;  3CME A;  3M4Q A;  4C1N I;  3TN2 A;  1TT2 A;  2B39 A;  4V0B A;  2PNH A;  2YV5 A;  3GTK B;  3F1Z A;  4F8M A;  1NE3 A;  2F52 A;  4B3T L;  4NP5 A;  4F7X A;  3D3R A;  1FJG L;  4IUU A;  2YU9 B;  1DOK A;  3MXU A;  1EIH A;  2QF7 A;  4KV6 A;  3H3V C;  2F0M A;  3GTJ B;  1K73 C;  2UXB L;  4U68 A;  3K57 A;  1Q7Y C;  1NR2 A;  1F2Y A;  3ERO A;  1EFW A;  2O5J C;  1Y8P B;  2OF1 A;  4DV2 L;  2F0L A;  4ALP A;  1M1K C;  1FNW A;  3HFZ B;  4OX9 Q;  1VCI A;  1LM0 A;  2X6G A;  3S17 B;  1CZW A;  1UAP A;  1WOC A;  1JE4 A;  1STG A;  1F2L A;  4KD3 A;  1D8L A;  4YIJ A;  1H9J A;  4BBS H;  3U4Z A;  5CV8 A;  3T16 A;  3T53 B;  4PMW A;  1Y1V B;  1RTN A;  3Q24 A;  1SRU A;  1AZP A;  3Q0A A;  1A3T A;  1G51 A;  2WV6 D;  1E2W A;  1NMF A;  3PMF A;  5LL6 S;  1TWA H;  3KLR A;  3HZX A;  2KCC A;  4JPB W;  3OSO A;  3SK4 A;  1FGU A;  4GNX A;  1K83 H;  3HOZ H;  1ZYR C;  5EGT A;  5COR A;  5J3B A;  4P74 A;  1YHQ A;  2OEO A;  5FKA C;  1SNP A;  1GUT A;  1WJJ A;  2LS0 1;  1MJC A;  1F9R A;  3E9I A;  1X32 A;  4IOC A;  2MP1 A;  1RHP A;  2BE5 D;  4LJZ C;  1WTO A;  2LY7 A;  3GTJ H;  1CKM A;  4LFA L;  2PZT A;  1D7Q A;  1O80 A;  4K5W A;  2JYO A;  5CGK A;  1BBX C;  2NZH A;  5FLM H;  1CHQ D;  4QUC A;  4RHR A;  1NJI C;  4AH6 A;  4R4Q A;  4APV A;  2BA0 A;  3STB D;  3HOU G;  1XYI A;  5IE8 A;  4X3K A;  1G29 1;  1TWC H;  4JK1 C;  5D3D A;  5EKI A;  1IZ6 A;  3H0G H;  3RZD H;  2F0O A;  4DV3 Q;  1MSG A;  3J80 E;  1HZA A;  2AWN A;  1GVP A;  4LF6 Q;  1S40 A;  3AB9 A;  4RHS A;  1LV9 A;  4XT1 B;  1DZ1 A;  2EJF C;  1Q81 C;  3TRE A;  3HOX B;  3OW7 A;  2X6L A;  2K05 A;  2GA4 B;  2K4K A;  1VQ8 A;  4MTK A;  2NTS A;  1H9S B;  4IJH A;  4JYA L;  5D65 A;  1UEB A;  4QB4 A;  4PZ7 A;  1M90 C;  4CDE C;  3RD4 A;  4YY3 L;  4DR5 L;  1XXG A;  2L55 A;  1XNQ L;  5IT9 c;  1ASY A;  3EFX D;  3AFP A;  1QNU A;  2HD3 A;  3KF8 B;  5AJ3 Q;  4FNF A;  5K36 H;  1N36 Q;  4ULL A;  1IBK L;  4B3T Q;  5D14 A;  2VNU D;  4N8X 1;  2HHH Q;  1VQL A;  1EWH A;  4QIW E;  3KJO A;  3RN5 A;  3H3V I;  1VQN A;  1XPR A;  2BE5 C;  1ONL A;  4FP5 D;  2CQO A;  2R6G A;  1QOH A;  4YCW A;  4DV2 Q;  1STH A;  3PIO 3;  1J9O A;  2UUB Q;  3STB C;  1W3S A;  4DGZ A;  2K14 A;  4IPC A;  3UE0 A;  2JA7 B;  3SR1 A;  3FKI G;  1QVF A;  5J22 A;  4BA1 I;  1MJE A;  4JI7 L;  1SNC A;  2R93 H;  2L15 A;  1Y69 U;  2NVY B;  4RCO A;  1Q12 A;  2MUY A;  1JE5 A;  3IAY A;  4X3U A;  1XTC D;  3DM3 A;  2DUD A;  2YTV A;  2WIN B;  1TWG B;  4C3J G;  4ZUI A;  5C4X B;  2ID0 A;  1G91 A;  2XWJ B;  3A7L A;  3K5N A;  1S3O A;  1M8A A;  4DR1 L;  1JWS D;  2F0V A;  4O0A A;  4XIG S;  4ODG A;  2Y0S E;  5ELC A;  1LTT D;  1SE3 A;  2K1B A;  1C7Y A;  3PSI A;  3ULL A;  4QUF A;  5KGU A;  1F9S A;  1H9S A;  1VMC A;  3CQZ H;  3D0F A;  3S15 B;  3GTP B;  3NQT A;  4CDD C;  3CAM A;  1BOS A;  2CQA A;  1ESF A;  3S1Q H;  1SXT A;  3E3X A;  1V43 A;  2LXJ A;  1HRJ A;  4CHT B;  4A3G B;  3HP3 A;  3QG1 A;  2E2H B;  3S9W A;  4LFB L;  1KRS A;  2RSO A;  1O7I A;  4EVO A;  1I6H B;  1VQA A;  1HA6 A;  3G6E A;  5IIF A;  5C4J B;  3OOC A;  4KHZ A;  3KJP A;  2R7Z B;  1N8R C;  2EXZ A;  1ILQ A;  2PO4 A;  2UXC Q;  1TWF B;  2VQE L;  4O42 A;  1FL0 A;  4BBR G;  3KOJ A;  4CJ2 C;  4Y52 H;  4DK6 C;  1L2F A;  4K6L A;  2NB0 A;  2NVY H;  2JA5 B;  1EIF A;  1SYG A;  1KLG D;  4GKK L;  3Q22 A;  1CSQ A;  1H9M A;  3H94 A;  4A3C H;  5LMU L;  4A3I H;  4AYB E;  2EIF A;  4OGQ C;  5C4X H;  1S5E D;  3HOY B;  4JYA Q;  1TKW B;  3C1E A;  3U50 C;  1YZ6 A;  4YWK A;  2TMP A;  1G6Z A;  1F9Q A;  1DJR D;  3J81 c;  1RCV D;  2E5L L;  3AYH B;  2XRQ D;  4DR5 Q;  2HIX A;  2M2L A;  3PO2 B;  1TS4 A;  1PYW D;  1KC8 C;  1XNQ Q;  2B8F A;  1R9T B;  5I6Y A;  2F0J A;  3S15 H;  1HQR D;  4GZY C;  3GTP H;  1PFS A;  4N9P A;  1VQ7 A;  3S1N B;  2AHO B;  2F03 A;  2QGQ A;  4IPD A;  1GHJ A;  3KLS X;  1SEB D;  4A3G H;  4H0L C;  5IT9 E;  1QG7 A;  4DR3 Q;  1JWU D;  5IGB A;  4X64 Q;  1EY0 A;  5C0X H;  1I6H H;  3BZD B;  1LT6 D;  4P75 A;  1HZB A;  3MZ5 A;  3UDG A;  4PMC A;  1EWC A;  1HNX L;  2VUM G;  2R7Z H;  1KD1 C;  1Y14 B;  1PRT F;  1X9N A;  4DV4 Q;  4A3M G;  2XSC A;  2JA5 H;  4C2M B;  4QGU A;  3RN2 A;  2WB1 E;  2X69 A;  1KRT A;  3K6O A;  4Y7N H;  3HOW H;  1LTG D;  3FP9 A;  4X3S A;  4P71 A;  3SK5 A;  4P2C B;  1X56 A;  1X55 A;  3HEJ A;  4NMZ A;  2B2U A;  1GJX A;  1Q8K A;  3HOY H;  2N78 A;  1B7Y B;  1LT5 D;  3GO5 A;  2EYJ A;  3RZO B;  1W2B A;  4HSP A;  4ZCK A;  3U9S A;  2UUA Q;  1KAW A;  3PQI A;  3CC2 A;  2F0F A;  4KI0 A;  4JI5 L;  5GAH C;  4A93 G;  1R9T H;  5M9O A;  3L7Z C;  5ELO A;  4IUP A;  1TY2 A;  2IT1 A;  4NXN L;  2I46 A;  3MTS A;  5G3L D;  2F3W A;  2E8G A;  2BOS A;  2K50 A;  1RJT A;  2PYK A;  1IBM Q;  3VR5 A;  3CPF A;  1PRT C;  4GS3 A;  3LX0 A;  3KDF B;  3T51 B;  3VYS A;  3CXC A;  2E2D C;  2R7D A;  3MVV A;  4F87 A;  4LFB Q;  1EZ6 A;  2FHT A;  5JEA H;  3VA7 A;  4CDF C;  3GDE A;  3I55 A;  5CV5 A;  1WFQ A;  2B63 H;  3SE0 A;  3J7Y W;  2O2L D;  3CD6 A;  2R92 B;  5C0X J;  2CVR A;  3K5O A;  1PVO A;  2VQE Q;  1SAP A;  5DLQ E;  3W1B A;  5IOC A;  1J6Q A;  2UUC L;  2Q2T A;  3PIP 3;  1XWE A;  3CRL C;  5IYC H;  4C3I B;  3GTG B;  5CV4 A;  3IL8 A;  4OWX B;  3QIA A;  3JAM c;  4FXD A;  2EVB A;  3M9B A;  4K2L A;  4YHH L;  4WRD A;  1XMO Q;  3I70 A;  4DR6 Q;  2B2Y A;  1PYS B;  1HZ9 A;  1TQO A;  2EY5 A;  5JVG 3;  4KJO A;  1MHW C;  3I4M G;  4I65 A;  3MXP A;  5EAY A;  1VQK A;  1UE7 A;  4GNX C;  3GQB A;  4AIM A;  1EQQ A;  4PZ8 A;  1LTS D;  3FRP B;  2NN6 I;  3P20 A;  4C3H G;  2PZU A;  1IBL L;  4B3M L;  1FR3 A;  1XPO A;  4IO9 A;  1AH9 A;  4GLA C;  3J81 E;  2VB2 X;  1OXU A;  3QB3 A;  1DCZ A;  1TWH B;  5M5Y B;  1A3U A;  2EXD A;  3FEW X;  1DGS A;  1AFP A;  5EPL A;  1Q3L A;  1RIP A;  1RL2 A;  1HNX Q;  1EYC A;  2XN9 C;  3FHW A;  2R92 H;  4DK0 A;  3DWP A;  4K8I A;  2G9H D;  2AQ1 B;  2RCF A;  3KDF A;  1YJ9 A;  1HCZ A;  3A54 A;  4UDU C;  2WII B;  2SEB D;  1JOR A;  3M4O B;  2N88 A;  2KEE A;  4KKT A;  4XDX A;  1AP0 A;  3GTG H;  3IKJ A;  1NY4 A;  3I73 A;  4R8I A;  4FO2 A;  3UDF A;  1X3Q A;  5I4D A;  4A3E H;  4P73 A;  1HXY D;  1HNW L;  2GVA A;  2RVL A;  4KLK A;  1ICF B;  2BCO A;  1EQR A;  2RF4 A;  1EY6 A;  1KHI A;  3P1H A;  1N32 L;  2I5L X;  2LMC B;  4JI5 Q;  3TBI B;  4ILW A;  1EIG A;  1X3F A;  2E2J H;  4JI1 L;  5JPN C;  3P7J A;  2EYL A;  3QJY A;  1A2U A;  3KBG A;  1AZQ A;  1GUS A;  2HCI A;  2Z8L A;  3V96 A;  2HQE A;  4JI8 L;  4GOP A;  1A15 A;  3HKZ B;  4A3B G;  4DV0 Q;  1I3Q B;  5A2Q L;  1L0X B;  3MEF A;  1LTA D;  5BN3 A;  1EWI A;  2A68 D;  2GVB A;  3DEO A;  3RLO A;  4XYQ A;  2H5X A;  2H1E A;  1B1Z A;  3D31 A;  1WCM G;  5FK9 C;  1FGB D;  4FF3 A;  4WOR A;  1Y8N B;  5DM7 3;  4J15 A;  4CBV A;  4LF7 Q;  3S2H B;  5IYD H;  5C44 B;  1HTP A;  5T1G A;  4UAI A;  4HIO A;  1HUM A;  3M4O H;  2UUC Q;  1LUZ A;  1U4M A;  2CH4 W;  2SOB A;  3CRK C;  3CCR A;  4RGM A;  4XQQ A;  5IGC A;  2VB3 X;  1KL9 A;  3L0O A;  1LAC A;  1PRT B;  1OO9 B;  4Q5V A;  1PZJ D;  2RA4 A;  1DXM A;  3TP6 A;  1WTW A;  4TRD A;  4LUZ A;  5CV9 A;  1EEI D;  1MD2 D;  2I5M X;  5IGG A;  1EIY B;  3NEN A;  2IHF A;  3EIV A;  3JAM E;  2RKS A;  3TZD A;  4PG3 A;  1I3Q H;  4XQN A;  4JI2 L;  1LO5 D;  1VQB A;  4HR7 B;  2BDO A;  1LT4 D;  1STY A;  3CCS A;  3J80 c;  3M7G A;  3E5S A;  2SNS A;  1JB3 A;  4FDB A;  3KFU A;  3A7A B;  1BBU A;  4QY7 A;  3T56 B;  4BXX H;  1DOM A;  1HUN A;  4LF9 Q;  2A68 C;  1Y1W B;  1TS5 A;  1HR0 Q;  2A19 A;  5C44 H;  1STB A;  3DM1 A;  1PDQ A;  2E74 C;  4RH6 A;  5FO7 B;  3MC0 B;  3WOF A;  1VQ6 A;  1V1P B;  2EE1 A;  1JOO A;  2ZXP A;  2K5V A;  2C35 B;  5C3E H;  5FO9 B;  5FLM G;  5FJ8 G;  4LNQ A;  4BBS B;  3KUP A;  3TS0 A;  2IPK D;  2QIL A;  1ZYR D;  4DV7 L;  1ZEQ X;  1HNW Q;  1ZKO A;  2PMZ E;  4RWS C;  1TWA B;  4A3D H;  3GTQ H;  3M4Y A;  4ME5 A;  2D62 A;  5EQ0 A;  2OTJ A;  1U0L A;  3CW2 C;  4JBM A;  5LL6 X;  1GKH A;  3PF5 A;  1N32 Q;  1E1O A;  1CFM A;  3ND9 A;  1EOT A;  1CQV A;  2HDM A;  1PH4 A;  2HDL A;  1Y1V G;  4V19 0;  5AJ3 L;  1PA6 A;  2K5D A;  1BKB A;  1N36 L;  4FF2 A;  5E7N A;  4JI8 Q;  2B29 A;  4MZ9 A;  5M5W H;  1EFI D;  3QOJ A;  2HHH L;  2VQF L;  5IGD A;  4IFD H;  2D5D A;  1PH8 A;  1XNR Q;  4WJ3 M;  3A5U A;  4HIM A;  1PFN A;  1V8Q A;  4NB3 A;  3PUY A;  3A8K E;  1L1O B;  1Y1W H;  1DYQ A;  3M4P A;  4TVA B;  4ZKB B;  1TWC B;  3HOV H;  2UUB L;  4OWT B;  3H0G B;  3RZD B;  2K52 A;  2F3I A;  2ZXO A;  1OXT A;  1EYD A;  1H9K A;  1SNO A;  3OTO Q;  3SHL A;  5CMD A;  4PNY A;  2K7V A;  2DJF C;  2TSS A;  2PCF B;  3Q6S A;  2QEJ C;  1E2Z A;  5M5X H;  5IYB H;  3F2U A;  4JCV E;  1D6E C;  2CHB D;  3U4V A;  3P75 A;  2CW0 D;  1V1P A;  1PMR A;  2F0S A;  5E1F A;  3DHQ A;  3W1G A;  1CM9 A;  4IN3 A;  2MNA A;  4R4I A;  2B2U C;  2DY7 A;  3HOX G;  5JAV A;  1PLF A;  2EDG A;  3R2I A;  4LF4 Q;  1TXY A;  2KHI A;  4XQJ A;  4DAP A;  4JI2 Q;  2JJQ A;  1ESR A;  2MJ8 A;  4R4O A;  1YJW A;  3F2B A;  3ITP A;  4IQZ A;  3H09 A;  3L3O C;  1ZXT A;  5C4Z A;  5CBA E;  4K8J A;  4BY7 H;  1WVL A;  3G6J B;  2Z6B A;  1H9R A;  3I4N B;  5HUR A;  1NR4 A;  3HS0 C;  4IFD J;  1CZG A;  2N3S A;  4HJ5 A;  1YHA A;  3LNN A;  5I2Y A;  1WTQ A;  1EYG A;  2MHV A;  1GO3 E;  4DXG A;  1PH7 A;  2UXC L;  5C3X A;  1JCK B;  4OWW B;  1X3G A;  4BWG B;  3CCM A;  2RSN A;  1L1O A;  3RLN A;  4DV1 Q;  4B9W A;  1QB5 D;  2EYO A;  2R93 B;  2NWG A;  3CCL A;  3GP7 A;  4ZKC B;  1PH9 A;  4DV7 Q;  1NNX A;  2PQA B;  2JA7 G;  2F0U A;  4LAA A;  1CQF A;  1SRO A;  1Z47 A;  2Z1C A;  3SGI A;  4A3K H;  1B44 D;  2CW0 C;  2XNA C;  3KK7 A;  1QVC A;  1SMX A;  2WFW A;  5IP9 G;  3WDN A;  2E75 C;  3VYR A;  1HPC A;  1SE8 A;  1EQV A;  4DR2 L;  1HHV A;  2B2Y C;  3CQZ B;  4DU9 A;  2VS1 A;  2PI2 A;  5IWA Q;  1QE6 A;  3EA6 A;  4HJ8 A;  3BYT B;  2VQF Q;  5C4X G;  3BS1 A;  3S1Q B;  3VYT A;  4A76 A;  4DR3 L;  3CP0 A;  3CCU A;  3I4N H;  4X64 L;  3C1F A;  4M8A A;  1SDF A;  1K3B C;  2IL8 A;  3LWU A;  3CCE A;  1NAP A;  2IX3 A;  2JN4 A;  1EY7 A;  3MHB A;  1KLU D;  4GN4 B;  4DK3 C;  4DV4 L;  4HED A;  2WAQ E;  1GD7 A;  1KXL A;  2M00 A;  1ILP A;  2KJX A;  4A3G G;  4ZYS A;  2F3V A;  2FMM A;  5JVH 3;  2BDN A;  4R1J A;  4IUR A;  1AEX A;  2ICE C;  2ZXR A;  2YTY A;  3SK6 A;  4JV5 Q;  1YNJ D;  2CCZ A;  1SLJ A;  1CUK A;  2ZTE A;  1SFO B;  3A55 A;  4OIJ A;  4RA8 A;  2R7Z G;  4A3I B;  2Z0S A;  1B4O A;  1ET6 A;  4DNI A;  2UUA L;  4KJN A;  5C0X I;  1VS0 A;  4KMU C;  2XGT A;  3A56 A;  1HNZ L;  5JJL A;  2JA5 G;  4K0K L;  1F77 A;  2IWH A;  3OHX C;  1NMG A;  4LK1 C;  5I6W A;  4FXK C;  2PQA A;  4JOI A;  1HTL D;  3M3Y H;  1K9M C;  4WJW A;  3GV6 A;  3B6Y A;  3NHH A;  4H7B A;  2BH8 A;  1IBM L;  4DUZ Q;  2Z9H A;  1CSP A;  3HOY G;  3OW2 A;  4GLX A;  3I4L A;  2WAQ G;  3R93 A;  1DON A;  2L9H A;  5HGQ A;  3HOU H;  3HGB A;  4GOP C;  3PO2 G;  5JJK A;  4N8F A;  5CV6 A;  2ZM6 Q;  1HJP A;  1LTB D;  4JI3 Q;  5IP7 H;  3TME A;  2KED A;  4JI6 L;  4X6A H;  2QDB A;  4KHP L;  4QL5 A;  3J81 L;  2FIN B;  1V9P A;  2Z4I A;  3E0E A;  1NCV A;  3W3A A;  3AEV A;  4LWC A;  4J8Q A;  1YVC A;  1I94 L;  2F0N A;  1UE6 A;  4K14 A;  2I07 B;  2PNR C;  1SFO H;  1JQY D;  3HOW B;  4Y7N B;  3MFY A;  3S1R H;  1I5F A;  4EQN A;  1SE4 A;  1BO0 A;  2EY6 A;  2F4I A;  1E2V A;  1F9P A;  2O5I C;  1F2Z A;  1SYC A;  3T4A C;  1SYB A;  4TQU S;  2Q8T A;  3K7A H;  1XMO L;  1YNJ C;  1B2T A;  1JOQ A;  4DR6 L;  4DPG A;  3J81 i;  3BJU A;  1UUP A;  2LKV A;  4JG2 A;  4PV1 C;  2JEA I;  1NUC A;  1R4P B;  4X65 Q;  3I91 A;  1PRT D;  1B9M A;  1BXT A;  5GAG C;  5GRO A;  3E0J A;  3PUV A;  4DR2 Q;  2OQ0 A;  1KQS A;  2XVS A;  4K5X A;  1IKL A;  3G4S A;  1CA6 A;  1D2B A;  5JJI A;  4IUN A;  4B08 A;  1KNA A;  4TKO B;  2HCC A;  2F0G A;  2B2W A;  4UPA A;  3NTK A;  2NBF A;  4KN7 C;  3KLS A;  2XTI A;  4A3F B;  2NVQ B;  2WAC A;  3C46 A;  5C5M A;  2KQ3 A;  3OMC A;  1EL0 A;  2B63 B;  3RUZ A;  3O13 A;  3ERS X;  4MNO A;  1SYD A;  1TS2 A;  1C8C A;  1A3V A;  2V4D A;  4H02 A;  1VF7 A;  4FF1 A;  1BCP B;  4LF5 L;  4IJL A;  3BYY B;  1YBY A;  1Q1E A;  2F0W A;  3NWS A;  3PIO A;  3ULJ A;  2Y0S B;  4RG1 A;  5C5L A;  1Z9F A;  2VXW A;  2LXK A;  2QA4 A;  2EOT A;  4FYD A;  3A5Z B;  5K5P A;  4C3J H;  3S1M H;  4G4K A;  2R92 G;  3U9O A;  4O1N A;  2UXD Q;  1X54 A;  4IOA A;  3NTH A;  4IPG A;  2KHS A;  3J7A F;  2F0D A;  4LMQ D;  3K8A A;  1HNZ Q;  1EQT A;  4RKB A;  3K80 C;  3K5L A;  4K0K Q;  1E1T A;  3BDC A;  1JOK A;  4CKB A;  4C3I G;  2L1B A;  1QCB D;  4QQB X;  4KY6 A;  5KYL A;  1SYF A;  5CBE E;  1VQH A;  4DV0 L;  2L12 A;  1EUJ A;  1ASZ A;  5BR8 Q;  3D8G A;  2IX1 A;  2F1M A;  1RTO A;  1U4P A;  1HR0 W;  4LFC Q;  5ELB A;  2FJ2 A;  1QNK A;  1LYL A;  4F88 A;  2A8V A;  2Q2H A;  4A3F H;  3I7F A;  2NVQ H;  1X3P A;  1PZI D;  1SBB B;  3JAM L;  4EQP A;  1MSH A;  3NTI A;  5CC4 A;  2KUM A;  4LF7 L;  2E2I H;  4JI6 Q;  1EU3 A;  1YNN D;  3S24 A;  1X3E A;  4AYB B;  4BBR H;  2PW5 A;  4HCS A;  4KHP Q;  2RQX A;  2ZJP A;  4G7H C;  2M9V A;  4A3M B;  5IY0 A;  1VQC A;  3IFT A;  1J8I A;  3PCO B;  3M85 A;  1E24 A;  1HFN A;  1MGS A;  1I94 Q;  5FLX L;  1X65 A;  5ELE A;  3NUC A;  4DAY B;  1E22 A;  3I4O A;  1ICW A;  4A3E B;  3D4W A;  4YCU A;  3JAM i;  2OTL A;  3TDQ A;  5C3W A;  4GOP B;  4B3R L;  2Z4H A;  3SVM A;  1JJ2 A;  2NZO A;  2ZTD A;  2F0K A;  1PFB A;  2NN6 G;  3TZU A;  3I72 A;  5I9P A;  3NEM A;  1PZK D;  2E2J B;  2VL6 A;  1I4X A;  4A3J B;  1OXS C;  4UHV A;  4DK1 A;  1NSN S;  1RF2 D;  3D4D A;  3F2D A;  1CTM A;  5KNB A;  2MO1 A;  1GXD C;  1MBY A;  2A6E D;  3IFD A;  5A35 A;  1CKN B;  3K7U C;  1Q86 C;  2WB1 B;  1TVX A;  1K8M A;  4IUV A;  2VW9 A;  3EQL C;  4LF9 L;  2VUM H;  2MPM A;  4DUY L;  1I50 H;  1HR0 L;  1IXR A;  4JC0 A;  1HFG A;  2K5W A;  3BDO A;  3HKZ G;  4AQY Q;  4A3M H;  5ELN A;  4G57 A;  1B9N A;  4XT3 B;  2JA8 B;  5HY6 A;  4ME3 A;  2IY5 B;  3BVM A;  3I90 A;  1YNN C;  4LF5 Q;  1KDC A;  3EJI A;  2KVM A;  2ATW A;  3MFG A;  1GOZ A;  1V1O A;  5EBC A;  5T1I A;  3GTO H;  1L1O C;  4S3S A;  1L0Y B;  4HJ7 A;  1CT1 D;  1GUO A;  5C44 G;  2UU9 Q;  5COY A;  4YWL A;  3NPP A;  4A93 H;  5ISR A;  4RGT A;  4B3S Q;  5J1Z A;  1EY8 A;  2K5H A;  3TQY A;  3CKI B;  4DAY A;  4HTH A;  1GUG A;  4H13 C;  1KNE A;  4CJ0 B;  4A3J H;  2N49 A;  4NW2 A;  3UDX A;  1PH5 A;  3PO3 B;  3MAQ A;  3F8T A;  5CV7 A;  1KDB A;  2D0P A;  3AMU A;  1PH6 A;  4KTA A;  4I7A A;  2R3Z A;  5GQO A;  2HQL A;  1XNR L;  5M3F B;  4EGV A;  3EVQ A;  1Q90 A;  1FNV A;  4DXF A;  2K32 A;  1OTC A;  4IZ8 A;  4K2K A;  4JVZ A;  1IW7 D;  2L5T A;  2DJG C;  2A6E C;  3E9H A;  5E3F A;  1X6O A;  2JA8 H;  1K8G A;  3OTO L;  1YNX A;  1CKN A;  2PZW A;  2XRS D;  3NSW A;  3VR6 A;  2B2V A;  3TP8 A;  1IKM A;  1EYA A;  1GUW A;  3VA5 A;  3CC4 A;  2L4N A;  4LF8 L;  5EPK A;  2EY2 A;  5C3E B;  4DR7 Q;  4ZK9 B;  1Y1W G;  4IFD I;  1PFM A;  3J80 L;  2AKW B;  1YEZ A;  3PIP A;  4NXM L;  4J6H A;  1HQM C;  4B3R Q;  2H4O A;  3GTQ B;  4A3D B;  3J7Z C;  3I4M H;  1K3R A;  1O7L A;  1WTH A;  5KNC A;  4XTC S;  3DUZ A;  5JJZ A;  4OL7 A;  3GTL H;  2HT1 A;  1K28 A;  4LF4 L;  1B3Q A;  1WTV A;  4BBS G;  3S14 B;  1QUQ B;  5KEE A;  5LHY 1;  3J7A V;  3PO3 H;  1SN8 A;  1ROD A;  4IPH A;  1HZC A;  4C1N K;  1B53 A;  2EYH A;  1A0I A;  3MEH A;  5GAE C;  4U67 3;  5M5W B;  4DAV A;  3J80 i;  5M3F H;  4CGY B;  2JK8 A;  1PXU A;  2P5Z X;  4JOI C;  3HRZ C;  1STE A;  2VZA A;  4O2D A;  4LUV A;  3V2T A;  3HOZ G;  2MGS A;  2GN5 A;  4G7Z C;  2WKC A;  3BG3 A;  3T13 A;  3L2P A;  1B70 B;  4A3L H;  1N33 L;  4DUY Q;  1S5F D;  3HOV B;  1A8V A;  2BA1 A;  1B8A A;  1VQ5 A;  5LMN Q;  1IW7 C;  3F2C A;  3UI2 A;  4DV1 L;  3A8I E;  3OWE B;  2LSS A;  3H15 A;  4OO1 H;  4L5T A;  2N8N A;  2E76 C;  1IHZ A;  1V1Q A;  3VR2 A;  1LLR D;  5M5X B;  1U9R A;  3CCQ A;  2OQK A;  1PH2 A;  3H0G G;  1D5X C;  2F0P A;  1I4R A;  2AWO A;  1LTR D;  1B3A A;  1JWM D;  4ID6 A;  2C5C A;  1ML0 D;  3CCJ A;  3TRZ A;  1N34 Q;  4BA2 I;  3H91 A;  4RAU C;  3MWY W;  2JEB I;  3L9A X;  1IL2 A;  3S14 H;  1M4V A;  1SNM A;  2RDG A;  2NUC A;  4A3B H;  2JA6 B;  2V1C C;  3DMU A;  5IWA L;  3QR8 A;  2RHS B;  3G48 A;  4KKU A;  1IYV A;  4HSV A;  4J1M A;  4BS9 A;  2HUG A;  4L5R C;  2KEN A;  2K6A A;  5HGT A;  3KYH C;  1QUQ A;  5I9O A;  1Y8O B;  3MA2 B;  4A4I A;  3CF5 A;  2A74 C;  4P72 A;  1YIJ A;  1VQJ A;  4MHE A;  4BY1 B;  4BY7 B;  2CKZ B;  3AQQ A;  4GLV B;  3E6Z X;  4LUO A;  3T1H Q;  4JW0 A;  2K03 A;  2KOL A;  1PV4 A;  2G5D A;  2B2W C;  5K36 G;  2A6H C;  1Q8I A;  1FD7 D;  3Q23 A;  4L8J A;  1T9H A;  1LT3 D;  1SND A;  5M3M B;  1A62 A;  4KHV A;  2A69 D;  2VY3 A;  3WWV A;  1GHK A;  1U4L A;  1KIX A;  4PQX A;  2KA7 A;  3DWQ A;  4LF8 Q;  4OON A;  3I4N G;  4C56 C;  4KY5 A;  4JV5 L;  2EYM A;  2Q2U A;  1STA A;  5C6A A;  1UE1 A;  4X3T A;  3LWE A;  2QW7 A;  1BCP D;  4NXM Q;  4JBK A;  4HCE A;  1YI2 A;  1AE3 A;  5E4X A;  3FVQ A;  4HAE A;  4DR4 Q;  4A3K B;  1H95 A;  2R93 G;  2JA6 H;  1W6K A;  3N6R A;  5CYU A;  1O7Y A;  4DUZ L;  4DFA A;  5A2Q E;  1BVS A;  3QOL A;  2CWP A;  2K5Q A;  4EQO A;  1G2T A;  2ZJR A;  4BY1 H;  2NTT A;  1LTI D;  2IJ0 A;  2AUJ D;  1BCP F;  4KN4 C;  3WOE A;  1A63 A;  5ELF A;  2Q8I B;  2ZM6 L;  4JI3 L;  1XX8 A;  3KF6 B;  3GTK H;  1LTL A;  3D6C A;  2XWB B;  3ERQ A;  1N33 Q;  2PW7 A;  1K8A C;  1JMC A;  2YU9 H;  1VDZ A;  1PTO B;  2PMZ B;  4FXG C;  4HN7 A;  5M3M H;  2FMC A;  5IT9 L;  3PUW A;  2B3G A;  1JJC B;  5FJ8 H;  5NUC A;  4QF4 A;  2A1A A;  4UY8 C;  4I7Z C;  2EY1 A;  4K5V A;  2A69 C;  3TSS A;  4ZRZ A;  5IP7 G;  5JPM C;  3S17 H;  2A73 B;  1DM0 B;  1PH3 A;  3S16 B;  1EU4 A;  1Z7T A;  2B2T A;  3NE5 B;  3PUX A;  1G6P A;  3HG9 A;  4ZUJ A;  1Y1V H;  4X65 L;  1A6X A;  2OXP A;  1EY5 A;  2KHJ A;  2JSO A;  1BCP C;  3VR3 A;  4H44 C;  4X66 L;  3V05 A;  1II3 A;  4OHJ A;  3M3Y B;  3CU7 A;  4RGO S;  5J39 A;  1BF4 A;  4A3C G;  4A3I G;  1C9O A;  3OYY A;  1JR0 D;  3BVG A;  3GD7 A;  1TR5 A;  2R61 A;  3BDL A;  3I2Z A;  3I3C A;  3HOU B;  4FF4 A;  3J7A 5;  3CHB D;  2EQS A;  3R2T A;  1AN8 A;  1Q82 C;  1PTO H;  3A8J E;  4JI0 L;  4UP8 A;  3OIP A;  1P16 A;  1QZH A;  2D2C C;  1FJG Q;  3SEB A;  1SMY D;  1IL8 A;  2IHE A;  1L0W A;  4HID A;  3ONA B;  2UXB Q;  3KF6 A;  5EKL A;  4L6T B;  3CC7 A;  3CCV A;  2C9O A;  1RD9 D;  4QMG A;  5C0X G;  3FMC A;  3S1R B;  4DAM A;  1NBW A;  2UXD L;  3S16 H;  1VQO A;  3K7A B;  3RR5 A;  3HOX H;  2IX0 A;  3GTM B;  5AFW A;  5EPJ A;  4TSS A;  1I4Q A;  3HKS A;  2DN8 A;  2F0Q A;  3HOW G;  1OXX K;  4ZQ3 A;  1SR3 A;  2KCT A;  1U4R A;  3R8B A;  5BR8 L;  4KD4 A;  1UNS A;  1QWY A;  4LFC L;  1FVI A;  2SDF A;  4EQ5 A;  2Z6K A;  1LAB A;  1VQG A;  1JJG A;  2J0T D;  4M1U B;  4EX5 A;  1VQM A;  4R4T A;  1C0A A;  1KDA A;  1BDO A;  2RBM A;  2CWA A;  2EYF A;  3OWF A;  3NEL A;  2PPB C;  2F0I A;  1WD1 A;  1SJH D;  3FPU B;  2K01 A;  4LFA Q;  3FKI B;  2JE6 I;  3SXH A;  2G9D A;  3LGJ A;  4NPS A;  3KF8 A;  5KYI A;  1SMY C;  2F4V L;  3A0J A;  1K0R A;  3MXG A;  4A3F G;  2B2V C;  4IAL A;  1P8L A;  5JEA G;  2JA7 H;  5ELD A;  2ASB A;  2B63 G;  2AQ3 B;  4C3J B;  3S1M B;  2OT2 A;  4DV5 L;  2ICI A;  1GM5 A;  1JT8 A;  2KCN A;  2CFM A;  3GTM H;  5KRU A;  5H1S E;  1DD2 A;  1OXV A;  4OEL B;  4QIW B;  4DA2 A;  5EKK A;  5IP9 H;  2L11 A;  2Y0S G;  3ER0 A;  5IYC G;  4WFN 3;  3H3V H;  4QJF A;  4X66 Q;  1C4Q A;  4MTN A;  1T5E A;  3DLL A;  1WTR A;  5DAU A;  1TWG H;  3UDI A;  4HJ9 A;  3X3M A;  1S72 A;  2K5N A;  3BZC A;  3G7L A;  2WAQ B;  2K04 A;  4R8N A;  4HMI A;  4RCN A;  4MN3 A;  4YY3 Q;  3BZK A;  2F0E A;  5BN5 A;  1WTX A;  2NVX B;  5DNF A;  4CKE A;  4YWM A;  2BH2 A;  1B50 A;  2ES2 A;  4AQY L;  3T1Y L;  4JI0 Q;  2E2I B;  2J4X A;  3UE1 A;  3G71 A;  1IBK Q;  3SK8 A;  3C2P A;  3FKI H;  3BU2 A;  4BBR B;  3C3L A;  2E2H H;  3URY A;  1VQF A;  3D4R A;  4GN5 A;  4QCL A;  4FVM A;  1JC7 A;  1MIU A;  5DM6 3;  5C4J H;  1SYE A;  2DGY A;  3CMA A;  2MQH A;  1S4Z A;  5CR3 A;  3QWN A;  1E0B A;  1TWF H;  4R9W A;  4ZAI A;  4HIK A;  2DY8 A;  2JA9 A;  4AYB G;  2UU9 L;  1DOL A;  2NVT B;  3W5O A;  1QIL A;  4B3S L;  1T5X D;  4L5S A;  1FYC A;  3NXW A;  1K0S A;  4K6D A;  2LFN A;  4X62 L;  1S5C D;  4KKS A;  4JI7 Q;  1YJN A;  2OWO A;  2K33 A;  1QZG A;  4RMF A;  2NZ1 D;  1VQP A;  1BQQ T;  3NWT A;  4A3E G;  1I6V C;  4A75 A;  1S5B D;  2JP1 A;  5D3I B;  4PMB A;  3ND8 A;  2HIV A;  3PO2 H;  1YHB A;  4DV6 L;  1BBW A;  5LMN W;  4DR1 Q;  4UP9 A;  4IUQ A;  1CI3 M;  2NVX H;  1VMP A;  3NBI A;  2VUM B;  3KLW A;  3S1N H;  4A3J G;  1KAB A;  1I50 B;  3K0Y A;  4POG A;  2I5H A;  1A2T A;  3MXN B;  1SJE D;  1CA5 A;  1I4P A;  1XJV A;  3W2D A;  4WJ4 A;  4Z9C B;  3D6W A;  4GKJ L;  1CHP D;  4DR7 L;  1TY0 A;  2WB1 G;  2F4V Q;  3VDY A;  3ZJY C;  1C48 A;  1PYB A;  1I4G A;  3HKZ E;  1E3P A;  1VQ9 A;  3GTO B;  2RCN A;  2CH4 A;  2WKD A;  2NVT H;  5IYD G;  4DV5 Q;  4C2M H;  1VF5 C;  4CJ1 B;  2JA8 G;  5JOB A;  5G3L F;  5C4H A;  2EPB A;  1Q46 A;  4OXP A;  4POF A;  4A93 B;  1K8O A;  4RGN A;  1VQI A;  2KCM A;  1AW7 A;  4KY7 A;  1ET9 A;  3NP8 A;  1YIT A;  4GKK Q;  1BR9 A;  1J5E L;  1KAA A;  1EY9 A;  3RZO H;  5LMU Q;  1WD0 A;  2IW3 A;  3ICE A;  5IGF A;  4JI4 L;  1WYD A;  2K28 A;  2WP8 J;  1D1K A;  1O7Z A;  2E5L Q;  1G8Z D;  5EBD A;  1UE5 A;  3AU7 A;  1SE2 A;  3X3N A;  1IYU A;  5FLX c;  2Q8R E;  1Q1B A;  2KBN A;  3PO3 G;  1S5D D;  2QCP X;  3T1Y Q;  4CKC A;  5LMN L;  4XYO A;  5IOD A;  1TII D;  4L5Q A;  3OPO A;  5BN4 A;  4G7O C;  1UWV A;  2FFK B;  4ABN A;  5M3F G;  1Z6H A;  2QDL A;  4N9T A;  1F2M A;  4B9X A;  4DNR B;  3MXN A;  4BXX G;  1PTO D;  1D1I A;  3TS2 A;  2MFI A;  3CPW A;  4DNT B;  4A3L G;  1TU2 B;  3K5M A;  3OMG A;  5JEA J;  2EJM A;  1XMQ L;  3TP7 A;  2L0C A;  3FDT A;  1EOV A;  1N34 L;  2N55 A;  3NBH B;  1D5Z C;  2OCE A;  3I4M B;  4C3I H;  4X62 Q;  3J81 j;  1NTG A;  4CDC C;  1GUN A;  3PUZ A;  5C3E G;  3GTL B;  4OO1 G;  1STN A;  2B2T C;  3PF4 A;  1HA5 A;  4IUT A;  4DN4 M;  1ENC A;  2ZTC A;  4C3H B;  1PHJ A;  1PH1 A;  3DEP A;  1WI5 A;  2AMC B;  2SNM A;  1PTO F;  3I8Z A;  4RKL A;  1QVG A;  4OO1 I;  1ENF A;  4A3D G;  4NDX A;  3SDZ A;  4HJA A;  4GN3 B;  4DV6 Q;  2I0Q A;  4L63 B;  2JXM B;  2QEX A;  4E6I A;  3K0X A;  1CK1 A;  3T1H L;  4JBJ A;  3AFQ A;  3R3O A;  4DF7 A;  1QJO A;  2PQE A;  3GV3 A;  4NXN Q;  5FO8 B;  1ENA A;  3PGZ A;  2A5H A;  2J7Z A;  1TWH H;  4IFD G;  5M5Y H;  2D0O A;  4DKA C;  1AE2 A;  5L37 A;  2XIW A;  4GKJ Q;  1MKH A;  3JC6 6;  3VYU A;  3A74 A;  4OX9 L;  1XTD A;  3HOV G;  3QO2 A;  1WTP A;  1VQD A;  1KTK A;  2NYZ D;  2O4X A;  5KND A;  5E4W C;  2K75 A;  2NN6 H;  1PTO C;  3S2D B;  3Q8D A;  1E7Z A;  1XPU A;  1EZ8 A;  4DR4 L;  1R4Q B;  3RNU A;  1HH2 P;  5EJW A;  4RFB A;  1BUV T;  1SSO A;  2ALY B;  1N9W A;  3BVZ A;  4C3H H;  3EBE A;  2B8G A;  4UP7 A;  5IYB G;  4JBW A;  4A3B B;  4PZ6 A;  1J5E Q;  2Q2I A;  1CKO A;  3U58 A;  2AQ2 B;  3NBH A;  4JI4 Q;  4MIU A;  3NQI A;  1W6J A;  4YHH Q;  1TS3 A;  1UEA B;  2MO0 A;  2A6H D;  5KIX A;  2ZT9 C; 
#chains in the Genus database with same CATH homology
 1WCM B;  3N52 A;  3OIQ A;  3RMH A;  1SNQ A;  4Q0F A;  1I4H A;  1EEF D;  2RDH A;  1EY4 A;  2AUK A;  1G2S A;  3KBX A;  1D5M C;  3FPP A;  2DNE A;  2ENB A;  3DWA A;  5FOB B;  5I2X A;  5F2D A;  1JIC A;  4NKL A;  2EJG C;  5FLX E;  3K59 A;  1MI2 A;  2KEC A;  2YYZ A;  5IGE A;  3K58 A;  2EZV A;  4OIK A;  3RLF A;  2D9U A;  4ZLT F;  3VR4 A;  4HMJ A;  3PV0 A;  2EYP A;  4KK7 A;  2F0H A;  1RKN A;  5TSS A;  2F0T A;  3M7N A;  2QKI C;  3NK9 A;  1O78 A;  3TP5 A;  3DXJ C;  3ZYY X;  1FNU A;  2RDF A;  3H6M A;  5DEH A;  1K83 B;  3HOZ B;  2DNC A;  4XXE A;  1BNZ A;  1RDP D;  4C1N I;  3TN2 A;  1TT2 A;  2B39 A;  4V0B A;  3GTK B;  4F8M A;  4NP5 A;  4F7X A;  3D3R A;  4IUU A;  2YU9 B;  1DOK A;  3MXU A;  1EIH A;  2QF7 A;  4KV6 A;  3H3V C;  2F0M A;  3GTJ B;  4U68 A;  3K57 A;  1NR2 A;  1F2Y A;  3ERO A;  2O5J C;  1Y8P B;  2OF1 A;  2F0L A;  1FNW A;  1VCI A;  2X6G A;  3S17 B;  1CZW A;  1UAP A;  1JE4 A;  1STG A;  1F2L A;  4KD3 A;  4YIJ A;  1H9J A;  5CV8 A;  3T16 A;  3T53 B;  4PMW A;  1Y1V B;  1RTN A;  3Q24 A;  1AZP A;  3Q0A A;  1A3T A;  2WV6 D;  1E2W A;  3PMF A;  5LL6 S;  3KLR A;  3HZX A;  2KCC A;  3OSO A;  3SK4 A;  1ZYR C;  5EGT A;  5COR A;  2OEO A;  5FKA C;  1SNP A;  1GUT A;  2LS0 1;  1F9R A;  1X32 A;  2MP1 A;  1RHP A;  2BE5 D;  4LJZ C;  1WTO A;  2LY7 A;  2PZT A;  1O80 A;  4K5W A;  2JYO A;  5CGK A;  1BBX C;  1CHQ D;  4QUC A;  4RHR A;  2BA0 A;  1XYI A;  4X3K A;  1G29 1;  4JK1 C;  5D3D A;  5EKI A;  2F0O A;  1MSG A;  3J80 E;  2AWN A;  3AB9 A;  4RHS A;  1LV9 A;  4XT1 B;  1DZ1 A;  2EJF C;  3HOX B;  3OW7 A;  2X6L A;  2K05 A;  2GA4 B;  2NTS A;  1H9S B;  5D65 A;  4QB4 A;  3RD4 A;  1XXG A;  2L55 A;  3EFX D;  1QNU A;  4FNF A;  5K36 H;  4ULL A;  5D14 A;  2VNU D;  1EWH A;  2BE5 C;  1ONL A;  4FP5 D;  2R6G A;  1QOH A;  1STH A;  3PIO 3;  1J9O A;  4DGZ A;  2JA7 B;  3SR1 A;  5J22 A;  4BA1 I;  1SNC A;  1Y69 U;  2NVY B;  4RCO A;  1Q12 A;  2MUY A;  3IAY A;  4X3U A;  1XTC D;  2WIN B;  1TWG B;  4C3J G;  4ZUI A;  5C4X B;  2ID0 A;  1G91 A;  2XWJ B;  3A7L A;  3K5N A;  1M8A A;  1JWS D;  2F0V A;  4XIG S;  4ODG A;  5ELC A;  1LTT D;  1SE3 A;  2K1B A;  4QUF A;  5KGU A;  1F9S A;  1H9S A;  1VMC A;  3S15 B;  3GTP B;  3NQT A;  1BOS A;  2CQA A;  1ESF A;  1SXT A;  1V43 A;  1HRJ A;  4CHT B;  4A3G B;  3HP3 A;  3QG1 A;  2E2H B;  3S9W A;  2RSO A;  4EVO A;  1I6H B;  1HA6 A;  5IIF A;  5C4J B;  3OOC A;  4KHZ A;  2R7Z B;  2EXZ A;  1ILQ A;  2PO4 A;  1TWF B;  4O42 A;  4CJ2 C;  4K6L A;  2NB0 A;  2JA5 B;  1SYG A;  1KLG D;  3Q22 A;  1H9M A;  3H94 A;  4OGQ C;  1S5E D;  3HOY B;  1TKW B;  3C1E A;  2TMP A;  1G6Z A;  1F9Q A;  1DJR D;  1RCV D;  2XRQ D;  2M2L A;  3PO2 B;  1TS4 A;  1PYW D;  2B8F A;  1R9T B;  5I6Y A;  2F0J A;  1HQR D;  4GZY C;  4N9P A;  3S1N B;  2F03 A;  1GHJ A;  3KLS X;  1SEB D;  4H0L C;  5IT9 E;  1QG7 A;  1JWU D;  5IGB A;  1EY0 A;  5C0X H;  3BZD B;  1LT6 D;  3MZ5 A;  4PMC A;  1EWC A;  1PRT F;  2XSC A;  4C2M B;  2X69 A;  3K6O A;  1LTG D;  4X3S A;  3SK5 A;  4P2C B;  3HEJ A;  4NMZ A;  2B2U A;  1GJX A;  1LT5 D;  3GO5 A;  2EYJ A;  3RZO B;  4HSP A;  3U9S A;  2F0F A;  4KI0 A;  5M9O A;  3L7Z C;  4IUP A;  1TY2 A;  2IT1 A;  2I46 A;  3MTS A;  5G3L D;  2F3W A;  2BOS A;  1RJT A;  2PYK A;  3VR5 A;  1PRT C;  3LX0 A;  3T51 B;  3VYS A;  2E2D C;  3MVV A;  4F87 A;  1EZ6 A;  2FHT A;  5JEA H;  3VA7 A;  5CV5 A;  3SE0 A;  3J7Y W;  2O2L D;  2R92 B;  5C0X J;  2CVR A;  3K5O A;  1SAP A;  5IOC A;  3PIP 3;  1XWE A;  3CRL C;  4C3I B;  3GTG B;  5CV4 A;  3IL8 A;  3QIA A;  4FXD A;  2EVB A;  4K2L A;  4WRD A;  3I70 A;  2B2Y A;  1TQO A;  2EY5 A;  5JVG 3;  4KJO A;  4I65 A;  3MXP A;  3GQB A;  1LTS D;  3FRP B;  2NN6 I;  3P20 A;  4C3H G;  2PZU A;  1FR3 A;  3J81 E;  2VB2 X;  1OXU A;  3QB3 A;  1DCZ A;  1TWH B;  5M5Y B;  1A3U A;  3FEW X;  1AFP A;  5EPL A;  1Q3L A;  1EYC A;  2XN9 C;  4DK0 A;  3DWP A;  4K8I A;  2G9H D;  2AQ1 B;  1HCZ A;  3A54 A;  4UDU C;  2WII B;  2SEB D;  1JOR A;  3M4O B;  2N88 A;  2KEE A;  4KKT A;  4XDX A;  1AP0 A;  3IKJ A;  3I73 A;  4R8I A;  4FO2 A;  1X3Q A;  5I4D A;  1HXY D;  2RVL A;  2BCO A;  1EY6 A;  3P1H A;  2LMC B;  3TBI B;  4ILW A;  1EIG A;  5JPN C;  3P7J A;  2EYL A;  3QJY A;  1A2U A;  3KBG A;  1AZQ A;  1GUS A;  2HCI A;  2Z8L A;  3V96 A;  2HQE A;  1A15 A;  3HKZ B;  1I3Q B;  5A2Q L;  1L0X B;  1LTA D;  5BN3 A;  2A68 D;  3DEO A;  4XYQ A;  2H1E A;  1B1Z A;  3D31 A;  5FK9 C;  1FGB D;  4FF3 A;  4WOR A;  1Y8N B;  5DM7 3;  4CBV A;  3S2H B;  5C44 B;  1HTP A;  5T1G A;  4UAI A;  1HUM A;  1U4M A;  2SOB A;  3CRK C;  4RGM A;  4XQQ A;  5IGC A;  2VB3 X;  1LAC A;  1PRT B;  1OO9 B;  4Q5V A;  1PZJ D;  2RA4 A;  1DXM A;  3TP6 A;  1WTW A;  4TRD A;  5CV9 A;  1EEI D;  1MD2 D;  5IGG A;  3JAM E;  2RKS A;  3TZD A;  4XQN A;  1LO5 D;  4HR7 B;  2BDO A;  1LT4 D;  1STY A;  3M7G A;  3E5S A;  2SNS A;  1JB3 A;  3A7A B;  3T56 B;  1DOM A;  1HUN A;  2A68 C;  1Y1W B;  1TS5 A;  1STB A;  3DM1 A;  1PDQ A;  2E74 C;  4RH6 A;  5FO7 B;  3MC0 B;  3WOF A;  1V1P B;  2EE1 A;  1JOO A;  2ZXP A;  5FO9 B;  4BBS B;  3KUP A;  2IPK D;  2QIL A;  1ZYR D;  1ZEQ X;  1ZKO A;  4RWS C;  1TWA B;  3M4Y A;  4ME5 A;  2D62 A;  5EQ0 A;  5LL6 X;  1CFM A;  3ND9 A;  1EOT A;  1CQV A;  2HDM A;  2HDL A;  4V19 0;  2K5D A;  4FF2 A;  1EFI D;  3QOJ A;  5IGD A;  4IFD H;  2D5D A;  1PFN A;  1V8Q A;  3PUY A;  3A8K E;  1DYQ A;  4ZKB B;  1TWC B;  3H0G B;  3RZD B;  2ZXO A;  1OXT A;  1EYD A;  1H9K A;  1SNO A;  3SHL A;  5CMD A;  4PNY A;  2K7V A;  2TSS A;  2PCF B;  3Q6S A;  2QEJ C;  1E2Z A;  3F2U A;  1D6E C;  2CHB D;  3P75 A;  2CW0 D;  1V1P A;  1PMR A;  2F0S A;  5E1F A;  3DHQ A;  1CM9 A;  4IN3 A;  2B2U C;  2DY7 A;  5JAV A;  1PLF A;  2EDG A;  3R2I A;  4XQJ A;  4DAP A;  1ESR A;  2MJ8 A;  3ITP A;  4IQZ A;  3H09 A;  3L3O C;  1ZXT A;  5C4Z A;  5CBA E;  4K8J A;  1WVL A;  3G6J B;  1H9R A;  3I4N B;  5HUR A;  1NR4 A;  3HS0 C;  4IFD J;  1CZG A;  3LNN A;  5I2Y A;  1WTQ A;  2MHV A;  4DXG A;  5C3X A;  1JCK B;  4BWG B;  2RSN A;  4B9W A;  1QB5 D;  2EYO A;  2R93 B;  2NWG A;  3GP7 A;  4ZKC B;  2F0U A;  4LAA A;  1CQF A;  1Z47 A;  2Z1C A;  1B44 D;  2CW0 C;  2XNA C;  3KK7 A;  3WDN A;  2E75 C;  3VYR A;  1HPC A;  1EQV A;  1HHV A;  2B2Y C;  3CQZ B;  4DU9 A;  1QE6 A;  3EA6 A;  3BYT B;  3BS1 A;  3S1Q B;  3VYT A;  3C1F A;  4M8A A;  1SDF A;  2IL8 A;  3LWU A;  1NAP A;  2IX3 A;  1EY7 A;  3MHB A;  1KLU D;  4HED A;  2M00 A;  1ILP A;  2KJX A;  4ZYS A;  2F3V A;  2FMM A;  5JVH 3;  2BDN A;  4IUR A;  1AEX A;  2ICE C;  2ZXR A;  3SK6 A;  1YNJ D;  1SFO B;  3A55 A;  4OIJ A;  4RA8 A;  4A3I B;  1B4O A;  1ET6 A;  4KJN A;  5C0X I;  4KMU C;  3A56 A;  1F77 A;  2IWH A;  3OHX C;  4LK1 C;  5I6W A;  4FXK C;  1HTL D;  4WJW A;  3GV6 A;  3NHH A;  4H7B A;  3I4L A;  3R93 A;  1DON A;  2L9H A;  3HGB A;  5CV6 A;  1LTB D;  3TME A;  2KED A;  2QDB A;  3J81 L;  2FIN B;  2Z4I A;  1NCV A;  3W3A A;  4J8Q A;  2F0N A;  4K14 A;  2I07 B;  2PNR C;  1JQY D;  3HOW B;  4Y7N B;  3MFY A;  4EQN A;  1SE4 A;  1BO0 A;  2EY6 A;  2F4I A;  1E2V A;  1F9P A;  2O5I C;  1F2Z A;  1SYC A;  3T4A C;  1SYB A;  4TQU S;  2Q8T A;  1YNJ C;  1B2T A;  1JOQ A;  1UUP A;  2LKV A;  4PV1 C;  2JEA I;  1NUC A;  1R4P B;  3I91 A;  1PRT D;  1B9M A;  1BXT A;  3E0J A;  3PUV A;  2XVS A;  4K5X A;  1IKL A;  1CA6 A;  1D2B A;  4IUN A;  4B08 A;  1KNA A;  4TKO B;  2HCC A;  2F0G A;  2B2W A;  3NTK A;  2NBF A;  4KN7 C;  3KLS A;  4A3F B;  2NVQ B;  2WAC A;  3C46 A;  5C5M A;  2KQ3 A;  3OMC A;  1EL0 A;  2B63 B;  3RUZ A;  3O13 A;  1SYD A;  1TS2 A;  1C8C A;  1A3V A;  2V4D A;  1VF7 A;  4FF1 A;  1BCP B;  3BYY B;  1Q1E A;  2F0W A;  3NWS A;  2Y0S B;  5C5L A;  2VXW A;  2EOT A;  4FYD A;  5K5P A;  4G4K A;  3U9O A;  4O1N A;  3NTH A;  2KHS A;  3J7A F;  2F0D A;  4LMQ D;  1EQT A;  4RKB A;  3K5L A;  3BDC A;  1JOK A;  4CKB A;  4C3I G;  2L1B A;  1QCB D;  4KY6 A;  5KYL A;  1SYF A;  5CBE E;  2L12 A;  3D8G A;  2IX1 A;  2F1M A;  1RTO A;  1U4P A;  5ELB A;  2FJ2 A;  1QNK A;  4F88 A;  1X3P A;  1SBB B;  1PZI D;  3JAM L;  4EQP A;  1MSH A;  3NTI A;  5CC4 A;  2KUM A;  1EU3 A;  1YNN D;  4AYB B;  2PW5 A;  4HCS A;  2RQX A;  4G7H C;  4A3M B;  2M9V A;  3IFT A;  1J8I A;  3M85 A;  1HFN A;  1MGS A;  5FLX L;  5ELE A;  3NUC A;  1ICW A;  4A3E B;  3D4W A;  3TDQ A;  5C3W A;  2Z4H A;  3SVM A;  2F0K A;  1PFB A;  2NN6 G;  3TZU A;  3I72 A;  5I9P A;  1PZK D;  2E2J B;  1I4X A;  4A3J B;  1OXS C;  4DK1 A;  1NSN S;  1RF2 D;  3D4D A;  1CTM A;  5KNB A;  1GXD C;  1MBY A;  2A6E D;  3IFD A;  5A35 A;  2WB1 B;  1TVX A;  1K8M A;  4IUV A;  3EQL C;  2MPM A;  1HFG A;  2K5W A;  3BDO A;  4G57 A;  1B9N A;  4XT3 B;  2JA8 B;  3BVM A;  3I90 A;  1YNN C;  1KDC A;  3EJI A;  2KVM A;  3MFG A;  1GOZ A;  1V1O A;  5EBC A;  5T1I A;  4S3S A;  1L0Y B;  1CT1 D;  1GUO A;  5COY A;  3NPP A;  5ISR A;  4RGT A;  5J1Z A;  1EY8 A;  3CKI B;  4DAY A;  4HTH A;  1GUG A;  4H13 C;  1KNE A;  4CJ0 B;  4NW2 A;  3PO3 B;  3MAQ A;  5CV7 A;  1KDB A;  3AMU A;  4KTA A;  2R3Z A;  5M3F B;  4EGV A;  3EVQ A;  1Q90 A;  1FNV A;  4DXF A;  2K32 A;  4IZ8 A;  4K2K A;  1IW7 D;  2L5T A;  2A6E C;  5E3F A;  2XRS D;  3NSW A;  2PZW A;  3VR6 A;  2B2V A;  3TP8 A;  1IKM A;  1EYA A;  1GUW A;  3VA5 A;  2L4N A;  5EPK A;  2EY2 A;  5C3E B;  4ZK9 B;  4IFD I;  1PFM A;  3J80 L;  4J6H A;  1HQM C;  4A3D B;  2H4O A;  3GTQ B;  1O7L A;  5KNC A;  4XTC S;  3DUZ A;  5JJZ A;  4OL7 A;  1WTV A;  3S14 B;  5KEE A;  5LHY 1;  3J7A V;  1ROD A;  4C1N K;  1B53 A;  2EYH A;  3MEH A;  4U67 3;  5M5W B;  4DAV A;  4CGY B;  1PXU A;  3HRZ C;  1STE A;  3V2T A;  2MGS A;  4G7Z C;  2WKC A;  3BG3 A;  3T13 A;  1S5F D;  3HOV B;  2BA1 A;  1IW7 C;  3UI2 A;  3A8I E;  3OWE B;  4OO1 H;  2E76 C;  1IHZ A;  3VR2 A;  1LLR D;  5M5X B;  1U9R A;  1D5X C;  2F0P A;  1I4R A;  2AWO A;  1LTR D;  1B3A A;  1JWM D;  4ID6 A;  2C5C A;  1ML0 D;  4BA2 I;  3H91 A;  4RAU C;  3MWY W;  2JEB I;  3L9A X;  1M4V A;  1SNM A;  2RDG A;  2NUC A;  2JA6 B;  3DMU A;  4KKU A;  1IYV A;  4HSV A;  4J1M A;  4BS9 A;  2HUG A;  2K6A A;  5HGT A;  5I9O A;  1Y8O B;  3MA2 B;  2A74 C;  4MHE A;  4BY1 B;  4BY7 B;  3E6Z X;  2K03 A;  2KOL A;  2B2W C;  5K36 G;  2A6H C;  1Q8I A;  1FD7 D;  3Q23 A;  4L8J A;  1LT3 D;  1SND A;  5M3M B;  4KHV A;  2A69 D;  1GHK A;  1U4L A;  4PQX A;  2KA7 A;  3DWQ A;  4C56 C;  4KY5 A;  2EYM A;  1STA A;  5C6A A;  4X3T A;  3LWE A;  1BCP D;  4HCE A;  5E4X A;  3FVQ A;  4HAE A;  4A3K B;  1W6K A;  3N6R A;  5CYU A;  1O7Y A;  4DFA A;  5A2Q E;  3QOL A;  2K5Q A;  4EQO A;  1G2T A;  3WOE A;  2NTT A;  1LTI D;  2IJ0 A;  1BCP F;  2AUJ D;  4KN4 C;  5ELF A;  2Q8I B;  1XX8 A;  3D6C A;  2XWB B;  3ERQ A;  2PW7 A;  1VDZ A;  1PTO B;  2PMZ B;  4FXG C;  4HN7 A;  2FMC A;  5IT9 L;  3PUW A;  5NUC A;  4QF4 A;  4I7Z C;  2EY1 A;  4K5V A;  2A69 C;  3TSS A;  4ZRZ A;  5JPM C;  2A73 B;  1DM0 B;  3S16 B;  1EU4 A;  1Z7T A;  2B2T A;  3NE5 B;  3PUX A;  3HG9 A;  4ZUJ A;  1A6X A;  2OXP A;  1EY5 A;  3VR3 A;  2JSO A;  1BCP C;  4H44 C;  3V05 A;  1II3 A;  4OHJ A;  3M3Y B;  3CU7 A;  4RGO S;  5J39 A;  1BF4 A;  1JR0 D;  3BVG A;  3GD7 A;  1TR5 A;  2R61 A;  3BDL A;  3I3C A;  3HOU B;  4FF4 A;  3CHB D;  3R2T A;  1AN8 A;  1PTO H;  3A8J E;  3OIP A;  2D2C C;  3SEB A;  1SMY D;  1IL8 A;  3ONA B;  5EKL A;  4L6T B;  2C9O A;  1RD9 D;  4QMG A;  5C0X G;  3FMC A;  3S1R B;  3K7A B;  2IX0 A;  3GTM B;  5AFW A;  5EPJ A;  4TSS A;  1I4Q A;  2DN8 A;  2F0Q A;  1OXX K;  4ZQ3 A;  1U4R A;  3R8B A;  4KD4 A;  1UNS A;  1QWY A;  2SDF A;  1LAB A;  2J0T D;  4M1U B;  1KDA A;  1BDO A;  2RBM A;  2EYF A;  3OWF A;  2PPB C;  2F0I A;  1WD1 A;  1SJH D;  3FPU B;  2K01 A;  3FKI B;  2JE6 I;  3SXH A;  2G9D A;  3KF8 A;  5KYI A;  1SMY C;  3MXG A;  2B2V C;  4IAL A;  5JEA G;  5ELD A;  2AQ3 B;  4C3J B;  3S1M B;  2OT2 A;  2ICI A;  2KCN A;  5KRU A;  1DD2 A;  1OXV A;  4QIW B;  4DA2 A;  5EKK A;  2L11 A;  4WFN 3;  1C4Q A;  1T5E A;  1WTR A;  5DAU A;  3X3M A;  3G7L A;  2WAQ B;  2K04 A;  4R8N A;  4HMI A;  4RCN A;  4MN3 A;  2F0E A;  5BN5 A;  1WTX A;  2NVX B;  5DNF A;  4CKE A;  1B50 A;  2E2I B;  2J4X A;  3SK8 A;  3C2P A;  4BBR B;  3C3L A;  3URY A;  3D4R A;  4QCL A;  4FVM A;  1JC7 A;  5DM6 3;  1SYE A;  1S4Z A;  5CR3 A;  3QWN A;  1E0B A;  4R9W A;  4ZAI A;  2DY8 A;  1DOL A;  2NVT B;  1QIL A;  1T5X D;  1FYC A;  3NXW A;  4K6D A;  2LFN A;  1S5C D;  4KKS A;  2K33 A;  2NZ1 D;  1BQQ T;  3NWT A;  1I6V C;  1S5B D;  2JP1 A;  5D3I B;  4PMB A;  3ND8 A;  4IUQ A;  1CI3 M;  1VMP A;  3NBI A;  2VUM B;  1KAB A;  1I50 B;  3K0Y A;  1A2T A;  1SJE D;  1CA5 A;  1I4P A;  3W2D A;  4Z9C B;  3D6W A;  1CHP D;  1TY0 A;  1C48 A;  1I4G A;  3GTO B;  2WKD A;  1VF5 C;  4CJ1 B;  5JOB A;  5G3L F;  5C4H A;  2EPB A;  4A93 B;  1K8O A;  4RGN A;  4KY7 A;  1AW7 A;  1ET9 A;  3NP8 A;  1BR9 A;  1KAA A;  1EY9 A;  1WD0 A;  2IW3 A;  5IGF A;  2K28 A;  2WP8 J;  1D1K A;  1O7Z A;  1G8Z D;  5EBD A;  3AU7 A;  1SE2 A;  3X3N A;  1IYU A;  2Q8R E;  1Q1B A;  1S5D D;  2QCP X;  4CKC A;  4XYO A;  5IOD A;  1TII D;  3OPO A;  5BN4 A;  4G7O C;  2FFK B;  4ABN A;  1Z6H A;  4N9T A;  1F2M A;  4B9X A;  4DNR B;  3MXN A;  1PTO D;  1D1I A;  4DNT B;  1TU2 B;  3K5M A;  3OMG A;  5JEA J;  2EJM A;  3TP7 A;  2L0C A;  3FDT A;  2N55 A;  1D5Z C;  3I4M B;  1GUN A;  3PUZ A;  3GTL B;  4OO1 G;  1STN A;  2B2T C;  1HA5 A;  4IUT A;  4DN4 M;  1ENC A;  4C3H B;  3DEP A;  2SNM A;  1PTO F;  3I8Z A;  4RKL A;  4OO1 I;  1ENF A;  4NDX A;  3SDZ A;  4L63 B;  2JXM B;  4E6I A;  1CK1 A;  3R3O A;  4DF7 A;  1QJO A;  2PQE A;  3GV3 A;  5FO8 B;  1ENA A;  2A5H A;  2J7Z A;  4IFD G;  2XIW A;  3VYU A;  3QO2 A;  1WTP A;  1KTK A;  2NYZ D;  2O4X A;  5KND A;  5E4W C;  2NN6 H;  1PTO C;  3S2D B;  1EZ8 A;  1R4Q B;  5EJW A;  4RFB A;  1BUV T;  1SSO A;  3BVZ A;  2B8G A;  4JBW A;  4A3B B;  2AQ2 B;  3NBH A;  4MIU A;  3NQI A;  1W6J A;  1TS3 A;  1UEA B;  2A6H D;  5KIX A;  2ZT9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...