2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transcription
molecule keywords Bacterial RNA polymerase inhibitor
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
2A68D 3N6RA 3QG1A 3QJYA 2NN6G 2D2CC 3ND9A 3A7LA 1E2ZA 1ZKOA 1G291 1I6VC 3FPPA 5BN5A 2O5IC 4OO1G 1CI3M 1TKWB 5C0XG 1BDOA 1A6XA 2V4DA 3KLRA 2PCFB 1T5EA 4BA2I 2EVBA 5K36H 1Y8PB 4KN7C 2QF7A 3PUVA 1K8MA 2BE5D 3DXJC 1GJXA 4PV1C 4G7OC 3EQLC 4LJZC 4GZYC 1HPCA 3T53B 3A8KE 4KN4C 3CRLC 1ONLA 1HQMC 1IW7D 4DK0A 2PNRC 1YNJC 1E2VA 3WDNA 2K33A 5JEAH 1Q12A 1HCZA 3D31A 2PPBC 2A68C 2LMCB 3AB9A 2DNCA 2B8GA 4G7ZC 2E74C 2DN8A 2A6ED 1GHKA 1H9JA 3A7AB 3SDZA 1VCIA 4IFDG 3I4LA 1LABA 2YYZA 2BA0A 1FR3A 4KI0A 1DCZA 1HTPA 2ZT9C 3I72A 2NN6H 4L8JA 5KNBA 5KNCA 2O5JC 3ND8A 1Y69U 4XIGS 2AUKA 5KNDA 5C0XH 2Q8IB 1GUGA 3SE0A 3VR5A 2B8FA 2DNEA 1DXMA 4JK1C 2AUJD 3QIAA 1OXVA 5A35A 1TU2B 2BE5C 3MXUA 3IKJA 3FMCA 4BA1I 2JE6I 1FYCA 1GHJA 2BDOA 3HGBA 4OGQC 2A6EC 3PUZA 1SMYC 4KHZA 4XTCS 4KKSA 1V43A 1YNNC 3A8JE 1CTMA 3GD7A 3GQBA 1Y8OB 3VR4A 5BN4A 3RLFA 1K8OA 1GUOA 1VDZA 3VR2A 4RCNA 2NN6I 4DNTB 3LWUA 4LK1C 3BDOA 4G7HC 2A69D 1GUNA 2E75C 2IT1A 1GUSA 2R6GA 4KKUA 4JBWA 3VR3A 1CFMA 2EJMA 1V8QA 3M85A 1OXUA 3L7ZC 1E2WA 3CRKC 1Z6HA 2A6HD 4IFDH 3M4YA 1OXSC 1IYUA 4DK1A 3PUXA 2K7VA 1LACA 1VF5C 1IYVA 3A8IE 1OXXK 4TQUS 3M7NA 3LNNA 4KMUC 3VA7A 4HR7B 3D4RA 2KCCA 3MFYA 1Y8NB 1H9SB 4H13C 3OOCA 1OXTA 1Q1EA 2BA1A 2D5DA 3IFTA 1EWHA 5JEAG 1B9NA 3TZUA 3PUYA 2JEBI 2JXMB 3BG3A 2K32A 1VF7A 3I73A 4TKOB 3T51B 2A6HC 1H9KA 1H9MA 2AWOA 2D62A 1Q1BA 2F1MA 3PUWA 4I7ZC 1H9RA 3OW7A 3U9SA 3VR6A 1ZYRC 2KA7A 5BN3A 4OO1H 4DNRB 2CW0C 3P20A 1Z7TA 1DD2A 2EJFC 1O78A 2EJGC 1H9SA 2JEAI 1Q90A 3H94A 3PV0A 5K36G 1PMRA 2L5TA 4KKTA 2E76C 1QJOA 4H44C 1IW7C 4H0LC 2EDGA 1O7LA 3W3AA 1GUTA 1B9MA 4IQZA 3NE5B 3T56B 3OPOA 2A69C
chains in the Genus database with same CATH superfamily
4X62L 5KRUA 2PMZB 3NK9A 3J7ZC 5I6WA 5JJIA 4R4OA 2PCFB 2EVBA 5HGQA 4DV4L 4KJOA 2KHIA 3MXGA 4KN7C 1K28A 1GJXA 2E2HB 4NPSA 3MTSA 1HPCA 3FKIH 1STEA 3A8KE 5AFWA 4A3MH 4LF9Q 1JOQA 1HZ9A 4QF4A 5EBCA 5FO8B 5D65A 4DN4M 1WTXA 1EY5A 4OEMB 5C0XJ 3Q8DA 1YHBA 4YHHL 2E74C 2A6ED 1TWHH 2RDFA 2K28A 2WIIB 2SDFA 3R2IA 2UXBQ 5T1GA 3OYYA 3HG9A 1JJCB 5GAGC 1JOKA 2VUMH 1KNEA 2VXWA 2QDLA 4HMJA 4CHTB 2F0HA 4DAVA 3BS1A 2BE5C 4IO9A 1UE1A 3VYSA 1AE3A 1B7YB 3FEWX 3SGIA 2FHTA 1KHIA 4BY7B 3RR5A 3S15B 4N8X1 1Q86C 3S2DB 3NTHA 2ZM6Q 5LL6S 2YTXA 4LFAQ 1YZ6A 3QWNA 4GNXA 1V1PB 4G7HC 1HA6A 3EROA 1GUSA 1LT4D 1VQPA 3GTLH 3HOWH 3HOXB 2GVAA 5AJ3L 4A3CG 3HFZB 1Z6HA 3M7GA 2QDBA 3K7UC 4IFDH 1OXSC 1IYUA 4DR3L 2DGYA 3NHHA 1IBKQ 1EYCA 4RKBA 1LTID 1PRTB 2HIVA 1SDFA 4TQUS 2OF1A 1I5FA 5EPJA 3T1YQ 1YEZA 4A3LH 1HXYD 3CF5A 2Z6BA 1VQKA 4RA8A 1L2FA 4DR4Q 2D62A 2Q8RE 2AWNA 2CW0D 1A15A 4KY7A 2IWHA 3VR6A 1EIYB 1XXGA 1YJWA 1SNPA 1TWFH 2CW0C 2QGQA 2RDGA 1PZKD 2PZUA 3KDFA 2EDGA 5H1SE 1O7LA 4TSSA 2AMCB 3TREA 2FXQA 2Q2TA 2UXCQ 4DR4L 1IXRA 5D3DA 3N6RA 1PZID 2NN6G 2D2CC 4A3JG 1D2BA 1STHA 2PYKA 3FPPA 1I94Q 5C4XB 1N32L 1AH9A 2JA5B 3SEBA 4PV1C 4GZYC 3T53B 4C3HB 2FJ2A 1TWAB 1FNVA 2F4VL 1WCMH 2PZTA 2Z4HA 2CH4W 4JV5L 2FMCA 4N9TA 3K7AH 1V9PA 1S40A 4A75A 2ICIA 2IW3A 4JG2A 5CR3A 4BBRG 3Q0AA 2B8GA 4LF5Q 3TEHB 4HAEA 1KLUD 1PHJA 3I4NH 4OWWB 1RF2D 4CJ0B 1YNND 3S24A 4B3RQ 4OWTB 3KLWA 4QCLA 2KHJA 1PLFA 4L5QA 1HFGA 3S17B 2WAQB 2F0VA 3KF6B 4IUTA 3G7LA 1VQGA 4ZAIA 1DGSA 3ZJYC 1OXVA 4BY1H 1NCVA 2Y0SB 2F0SA 2AQ3B 4PG3A 1ENFA 4V0BA 2B63G 3K5MA 2F3IA 2I5MX 4LMQD 5FO9B 3S1QH 1Q81C 1STGA 1W3SA 1LT3D 4GKKQ 2R6GA 2KBNA 4FO2A 2AQ2B 2RCNA 2NZ1D 1VQFA 3NPPA 4LF5L 3DWPA 1RL2A 4JW0A 1A63A 4HTHA 4ME3A 5FLMG 4ID6A 4IUNA 2QA4A 2LSSA 3CCMA 5C4XG 1Y8NB 1H9SB 1L1OC 2BA1A 4CKCA 1EWHA 4OHJA 2ID0A 4TKOB 3CAMA 3NWSA 3V2TA 2JYOA 4FF1A 1Q1BA 1X3GA 2QEJC 1ZYRC 4C3IB 1AZQA 2NVTH 4H02A 3HOZG 1IKLA 1N33L 3A5ZB 3ERSX 4BS9A 4IALA 1G91A 3TRZA 3F8TA 3S1NB 3NBHB 2EXZA 1SNCA 3DM1A 5GADC 1R9TH 3CCJA 2IHFA 2M2LA 2VUMB 2A69C 2F0DA 2GA4B 2Q8TA 3TMEA 4DR5Q 1YVCA 1BCPD 2IX1A 1XJVA 1TIID 1Y8PB 4HIKA 1SJHD 1XPRA 4A3DG 4KY6A 1CHPD 3K8AA 2VL6A 5HY6A 4JPBW 4DPGA 1M8AA 1N34L 5E7NA 4A93H 2ZTDA 1FNWA 1WTRA 4JCVE 1QNKA 4YCUA 3WDNA 5FLXc 1LLRD 4K5VA 1IHZA 4EQ5A 3DHQA 4KHPL 2R7ZH 3GTKH 1SSOA 2K5QA 2UUCQ 2Q2UA 3KF6A 1SYFA 1C9OA 3A56A 4PMWA 1VCIA 2EYHA 4LFAL 5IYBG 1LTBD 2L15A 2B2VA 2DNEA 4NXNL 1XTCD 1TU2B 3HZXA 4A3CH 3F2CA 4X62Q 1E7ZA 4IFDJ 3C1EA 2PQAA 1Y1VB 2DY8A 4X65L 4NW2A 5JJLA 2OQ0A 4KKSA 3PO2G 1KRTA 2EYPA 4XXEA 3GTMB 3W5OA 1HTLD 4CJ2C 4JYAQ 5E4XA 1HNWQ 1Q8IA 2FMMA 4YCWA 2WV6D 3S1RB 4A3GH 4RGMA 2IPKD 5C6AA 1BR9A 3M4YA 2I5LX 2NVYH 3BJUA 1JC7A 3J81i 4ALPA 2BH8A 1EQRA 5M3MB 4JVZA 3K80C 2R92G 3D4RA 4K6DA 1N34Q 4H13C 1OXTA 1SE8A 1WTWA 3PUYA 3I73A 1JORA 5J1ZA 4AYBB 4ZKBB 1U4LA 3AFPA 1EQVA 2YV5A 4U68A 4A3BB 4A3KH 1DD2A 2J7ZA 3VA5A 1LO5D 4KTAA 1PTOH 2DJFC 1PVOA 1V1OA 1JB7A 4GN3B 4IQZA 1NMFA 5FOBB 4MIUA 1PXUA 4XYOA 3LWEA 4RHRA 4C3JB 3M3YB 3ND9A 1E24A 4LNQA 4DR7Q 2QKIC 1CI3M 1CKNB 5GQOA 4BA2I 2KEDA 3CCSA 4BY7G 4BXXG 1TY0A 3GO5A 5KGUA 3K57A 1SE4A 1HZCA 2A1AA 1XNQQ 4JI5L 3S1QB 2F3VA 2WB1G 2JJQA 1DOLA 1HCZA 2EY5A 4WRDA 2EE1A 4A3MG 2NTTA 3PO2B 2L12A 1YI2A 4JI0Q 5CBAE 2F0WA 3V96A 3Q6SA 2RCFA 2KVMA 4A4IA 3I4LA 2Q2IA 1LT6D 2BA0A 2KENA 4GKKL 4G57A 5CMDA 4YY3L 1J5EQ 1W2BA 4BY7H 4H7BA 2L11A 4LFCQ 3KLSA 2O4XA 5C5LA 1SXTA 3MXNB 2R92B 3M4OH 1M1KC 4GS3A 3NELA 1K8GA 4J6HA 3GQBA 3RLFA 2WAQE 4FXKC 1MSGA 4A3JB 1PH5A 1BVSA 4BBSB 3H3VC 1U4PA 3S1NH 5IGBA 2VB3X 1JR0D 3KOJA 1R9TB 2CVRA 1WOCA 4LF7Q 1DYQA 2LY7A 4R4QA 4I65A 3J7AV 3I4OA 4DU9A 4DUZL 1ASZA 4DV5Q 1IBMQ 4YHHQ 2WINB 1S5FD 3S14B 3H0GH 3H3VI 2XRQD 2F4VQ 1PH7A 2VNUD 3WOEA 5E1FA 1ZXTA 5CV7A 5C44B 5LMUL 1T9HA 1K8AC 3T51B 4NDXA 2RSOA 1KRSA 4A3FB 1PFNA 1JE5A 1VQDA 3NQIA 5K36G 3I70A 2EY2A 2F4IA 1QZHA 2LFNA 5CORA 4LWCA 3ULLA 4R8NA 4WJ4A 1YBYA 1JMCA 3TN2A 2Y0SG 2FINB 4A3KG 2NBFA 1I94L 1X55A 1WTQA 2K03A 1PH2A 1ZKOA 1XWEA 2E5LL 2B2UC 1MIUA 4A76A 3E5SA 1MGSA 1I4QA 1F77A 2RDHA 4FF3A 3J7YW 1D6EC 2JP1A 3HKSA 3GTGB 4G7OC 4DUZQ 2NVQB 4LJZC 2UUAQ 3BVMA 4KN4C 3I55A 1IL8A 1ICFB 3GTMH 1QVCA 1E2VA 1UEBA 4DNIA 4K0KL 2LMCB 4A3EB 3L0OA 4O2DA 4G7ZC 2IL8A 4CJ1B 4DR5L 3E6ZX 5C4JH 1N32Q 2CKZB 5NUCA 1EY9A 1ESFA 3G48A 4K5XA 5HURA 3I4MG 1X56A 2I46A 1TS5A 3I4NG 3NENA 5EPLA 4DA2A 1BCPF 3ER0A 1UE7A 5C3WA 4MTNA 1KDAA 4DAPA 4L5TA 4DR6L 3CXCA 3OSOA 3QIAA 1F2LA 5IWAL 5M5WB 1D5ZC 1FYCA 1K83H 2HHHL 4NMZA 1PYSB 3HGBA 1EOVA 4KHZA 2Y0SE 1PTOD 1V43A 4BBRB 5C44G 3ULJA 1P16A 2L55A 1K8OA 1VDZA 1EYGA 3NWTA 5ELDA 1BCPB 4KJNA 4OO1I 3RZOH 1TWGB 3AU7A 3U58A 3OTOL 2VS1A 3FRPB 2F03A 1TWHB 3K58A 1SYGA 3EJIA 3CRKC 2EXDA 3NTKA 1IZ6A 4EX5A 2QCPX 1PDQA 3NXWA 2Z9HA 2IY5B 2CH4A 5DAUA 1X6OA 2NVXH 2B63B 1J8IA 2QEXA 3GTJH 3MVVA 1DM0B 1MJCA 1SBBB 3KDFB 3NTIA 1F2ZA 1Z9FA 3I2ZA 4LUVA 4IOAA 1K0SA 2IX0A 1QUQB 3JC66 2KA7A 1NAPA 5G3LF 5K5PA 3S15H 2JEAI 1FL0A 1WJJA 2PNHA 2L4NA 2JA7B 1EQQA 1ILPA 3HRZC 4IJHA 4JI2Q 3W3AA 4DV3Q 4A93B 1B44D 2B2YC 3P75A 3ICEA 4BY1G 3AMUA 3OIQA 4IUPA 4NKLA 2O2LD 3KF8A 2BE5D 4QB4A 4N9PA 1VQ8A 1G2TA 2F0PA 4IZ8A 4A3LG 3KLSX 4IURA 2A8VA 3C2PA 1W6KA 1B3QA 4X3TA 1MHWC 1HNWL 4ODGA 2PO4A 4DV0Q 3J81L 4LUOA 1IBML 4DV1Q 1GD7A 2F0OA 3A74A 1PRTD 3GV6A 1WCMG 2NUCA 4EQPA 5BR8Q 1HHVA 2O5JC 5KNCA 1B8AA 4B3SL 2UXDL 4AYBG 4FXDA 5M3FG 3SE0A 2RBMA 1CM9A 4JK1C 2RHQB 4A3BG 4GN5A 1QOHA 1ZYRD 1E22A 3FMCA 4GNXB 5E3FA 5IYBH 2HDMA 1QCBD 3CW2C 2HHHQ 3PO3G 4A3GB 1QG7A 1F2MA 1FJGL 2F0UA 1F2YA 3T1YL 1KAWA 1S3OA 4DNTB 1IL2A 2CCZA 2B29A 2A69D 4KKUA 3SK8A 1CZGA 5ELEA 2X6LA 3CU7A 4JBWA 5IP7H 5IGGA 1BBWA 1E1OA 1BQQT 1TQOA 1K9MC 2RKSA 3PUXA 4MZ9A 1VQNA 4A93G 4OONA 2K6AA 1OXXK 3GTLB 3GTGH 3LNNA 1WTPA 2K52A 1PRTF 2H5XA 1UNSA 1JT8A 2LKVA 3S1RH 1EZ6A 2KOLA 3OMCA 1DZ1A 1H9KA 3OTOQ 1UWVA 1SNQA 5DNFA 4DAMA 1HNZQ 1X3EA 1H9RA 3VYRA 1Z47A 2MNAA 1A0IA 1JJ2A 4KK7A 4Z9CB 1BKBA 2EJFC 1PH9A 1IYJB 3UE1A 2V1CC 3H94A 4QUCA 1D1KA 4KKTA 3NQTA 4DXFA 2PMZE 5ELNA 4IN3A 4TVAB 1PH8A 5J22A 1TWAH 4FNFA 1WCMB 1E2ZA 1SN8A 4FF2A 4CDDC 3DM3A 1TKWB 4ZYSA 1BDOA 5C0XG 1HNXQ 3RUZA 5M9OA 4C2MB 1SMXA 2UXBL 3PO2H 2XWJB 4JI4Q 3CRLC 5L37A 2EOTA 5LMUQ 4AH6A 2NWGA 2UU9L 3J7A5 1RHPA 5IGFA 1VQAA 3U4ZA 2R3ZA 3J80i 4OX9Q 4JI7Q 1LTTD 4IFDI 4A3DH 3J80c 5IGEA 3A7AB 4JI4L 3JAML 2KCMA 1IBLL 2R93B 3MHBA 1EY8A 4JV5Q 3M4OB 2ENBA 4L8JA 4LF4L 1EU3A 5KNDA 3I7FA 1X3FA 2E5LQ 1VQEA 3WOFA 1Q7YC 4LF8Q 2A6EC 4OELB 4YWMA 2XGTA 5I9OA 3L3OC 1EFID 2OT2A 3VR2A 4DV2L 1WD0A 3KJPA 1CSQA 1R4QB 3DEOA 4LFBQ 1AN8A 4ULLA 3MFGA 1VQIA 1Q3LA 1G2SA 1VQ9A 4QGUA 1WVLA 4K14A 3A55A 2Z1CA 3RLNA 2A6HD 2UUCL 4DK1A 4DXGA 3K5NA 2LXJA 4RFBA 1U5KA 5I2YA 3GTPH 1BXTA 2K14A 3PMFA 4IOCA 1K3RA 2JA8B 1SAPA 4L6TB 3K6OA 4B3TL 1EY0A 4GLVB 1Q1EA 5A2QE 2NYZD 1B9NA 4PMCA 5IOCA 3BG3A 2ZJRA 2N8NA 4FF4A 2WAQG 1V1QA 4FDBA 3KJOA 4DNRB 2EZVA 2E76C 5C44H 1SNDA 4CGYB 3GTQH 2HUGA 2N3SA 1EYAA 2A68D 2NB0A 4LFCL 3D4DA 5C3EB 1C0AA 2O5IC 2JA6B 1WD1A 4DUYQ 4A3IG 1JWMD 1IBKL 3QOJA 3EQLC 4Y7NH 5IYDH 1M4VA 2VZAA 2A5HA 4LF6Q 1HZAA 5JJKA 4P75A 1YJNA 1Y1VG 1A2UA 3W2DA 2DNCA 4K8JA 3URYA 4JBMA 4ILWA 2WKDA 1E0BA 5IT9L 5ELFA 4GLXA 1B4OA 1LABA 3S1MB 4C3IG 3CMAA 1XMOQ 2IJ0A 3BVZA 1DCZA 1RDPD 2PQAB 3BVGA 5LL6X 2OEOA 2EPBA 2KQ3A 4BBRH 3GTKB 3ND8A 2Z6KA 4HIMA 1ESRA 1OO9B 2D0OA 3HOYB 1LUZA 1STBA 1KLGD 2KCNA 1B1ZA 2HQLA 3R3OA 4JI8L 2BDOA 1KQSA 4DV7Q 1CA6A 1EIHA 1YNNC 3CPFA 4K6LA 4UAIA 4OWXB 1YNJD 5CGKA 3TP8A 4RCNA 3CQZB 1Q82C 1K83B 4L5RC 3EBEA 3I4NB 5ISRA 3OWFA 1A8VA 3K0XA 3RD4A 4U673 2K50A 2XVSA 4FVMA 3PSIA 2B3GA 3J80L 1BBXC 1EWIA 4ZCKA 1VF5C 2F0FA 4KHPQ 3V05A 3MFYA 3MXPA 4X3KA 1CHQD 3H6MA 1RD9D 4CBVA 4DV6Q 3OW7A 1SYEA 1VMPA 2ATWA 3M3YH 4YWLA 1C8CA 4PZ8A 3BZKA 5C4JB 4FYDA 4H44C 1XPUA 1IW7C 4OL7A 1PH1A 3RMHA 4X64Q 2UXCL 4RKLA 3EVQA 2AHOB 5C4HA 2B2TA 3DLLA 5EAYA 4POGA 3E9IA 1PH6A 1AFPA 1WYDA 4HJAA 4OO1G 2KHSA 1LT5D 4R4CA 4R4TA 3HOVB 1KC8C 1SYBA 3PO3H 2RA4A 2CQOA 5EGTA 5IP9H 3KUPA 1HQMC 3PCOB 3I56A 2E2IB 3IL8A 4DK0A 1ENCA 2K33A 2JA7G 4DV6L 1VS0A 1NUCA 2HCIA 1MSHA 4YIJA 1PV4A 5DLQE 1CK1A 2UUAL 5M5XB 4GN4B 2OQKA 4LF9L 4PZ7A 3TS0A 1AZPA 1Y1WH 1I50H 4KI0A 1HTPA 1Y14B 4E6IA 5ELBA 5IYCG 4F8MA 1GUGA 4DK3C 2B63H 2BH2A 1NJIC 4XDXA 2NVXB 1XNRQ 3IFDA 1ICWA 1KL9A 1UE6A 2B39A 2JE6I 4LF8L 4PZ6A 2HCCA 1SFOH 3FKIG 5JPMC 3AQQA 2XN9C 3A8JE 5C0XI 4JBKA 1PH4A 1GUOA 3Q23A 5FLXE 2Z0SA 2E75C 4A3EH 3TP6A 4DV1L 1XPOA 2R92H 4RAUC 3FHWA 4MTKA 2H4OA 1WTOA 4PMBA 5HGTA 3OMGA 2VW9A 4BBSH 3BYTB 3A8IE 1QUQA 1TWCH 2WB1E 1YITA 1NSNS 5CV6A 5JVH3 3O13A 5DM73 3HKZE 1VMCA 2PQEA 3IFTA 2D5DA 2R61A 3HOVG 1Q46A 1J9OA 4ZUIA 4JYAL 3EA6A 2B2TC 3BZDB 3CCVA 3CCUA 5EKIA 2XNAC 1SMYD 1Y1VH 3PIPA 3J7AF 1EL0A 4KD3A 3DEPA 1XYIA 5GAEC 2WP8J 1HR0W 4CDEC 1DONA 3LGJA 4X3UA 1QJOA 4C2MH 1BNZA 3CCRA 5IYDG 1GUTA 1KAAA 4ME5A 1B9MA 2OXPA 2UUBL 3I3CA 1UE5A 3T56B 1YIJA 5F2DA 5BN5A 1EEID 1I6VC 2G9HD 4GKJQ 3I4MB 1T5EA 3KBGA 1XMQL 1C7YA 2MO0A 1PYBA 1EU4A 1TXYA 4XQJA 1EIFA 5JJZA 1XX8A 5LMNW 1RODA 4LF6L 2RSNA 1QVGA 1KTKA 1CZWA 4P71A 5JEAH 2BDNA 2IX3A 4ZQ3A 2K04A 5M3MG 4DR3Q 4DK6C 3K5LA 2OTLA 5IY0A 1SEBD 1SJED 4HEDA 1F9PA 4A3FG 5ELOA 4JI1Q 2K1BA 3R8BA 5KNBA 1B2TA 1I3QH 1HRJA 3Q22A 1JOOA 4DUYL 1I4XA 1T5XD 3BU2A 4GNXC 2AUJD 3BDCA 3T13A 2B2WA 4BA1I 2K4KA 5GROA 4HSVA 3HOUB 4TRDA 4X6AH 3E3XA 4XTCS 1K73C 1TY2A 5JVG3 2ZJPA 4HCEA 3TBIB 2F0IA 2JA6G 3U50C 5IIFA 2KUMA 4HJ8A 3I91A 1GUWA 5M5WH 1KIXA 1Q8KA 4RGTA 2C5CA 5T1IA 3VR3A 4F87A 2EJMA 4S3SA 3E0JA 4POFA 1X65A 4UHVA 1D1IA 4N8FA 4A3EG 1VQ4A 2E2JB 3HOVH 4B08A 3VYUA 1XNQL 1CT1D 4HR7B 5E4WC 5IP9G 3OOCA 3RN2A 2JEBI 3J81c 1VQ6A 3HEJA 3M4PA 3W1GA 2C35B 1H9MA 1AEXA 1SYCA 4IUVA 4C3HG 3SVMA 3U9SA 4OO1H 4APVA 1O80A 3CKIB 5D14A 5C3EH 2J4XA 1B3AA 2JA6H 2JA8H 1PTOF 2KECA 4RG1A 1FD7D 1L0WA 1JJGA 5M5XH 3HOYG 2I5HA 3G6JB 4B3SQ 2UXDQ 4Y7NB 2Z4IA 3PIO3 3QG1A 2OTJA 3A7LA 1XNRL 2EYJA 2RHSB 5IT9E 3GTOH 2V4DA 2JA9A 5EQ0A 3HOXG 3WWVA 1HR0Q 3RN5A 1EWCA 3DXJC 3H0GB 2XRSD 5DEHA 3F2BA 1F9RA 4DV5L 1EYDA 2MJ8A 2PNRC 5EKKA 3T1HQ 1X3QA 3S2DH 3SK5A 4YY3Q 3D31A 3DWQA 4NXML 1KDCA 3UDIA 1L0XB 2DN8A 1S5BD 3F2DA 1GHKA 1I4HA 5G3LD 2DUDA 4KHVA 4DV7L 2YYZA 2EYLA 2XWBB 2F0TA 4LUZA 1NY4A 2DY7A 2Q2HA 3QO2A 2AUKA 2K5DA 3CD6A 2MHVA 1NBWA 2C9OA 2GN5A 1DXMA 3CQZH 4GOPA 3CC2A 2D9UA 5A35A 1JQYD 2F52A 1PRTC 2YU9H 2CHBD 1PA6A 4BWGB 5C3XA 3HOWG 3TDQA 2WACA 1N36Q 1L0YB 3MEFA 4YCVA 1MBYA 2MUYA 1MD2D 1WI5A 3MWYW 2VY3A 1HQRD 3LWUA 4RGNA 2UUBQ 1LTAD 2PW5A 1EFWA 4HIDA 1HH2P 3AFQA 1L1OA 3R93A 1TS2A 4DR6Q 5FK9C 1I6HH 4J8QA 1LTSD 5EJWA 2JK8A 3H3VH 1BBUA 4UP7A 3GDEA 1S5ED 2P5ZX 2E2DC 4ZK9B 2VUMG 1HA5A 2BOSA 4O0AA 2VB2X 2A19A 1SLJA 3ITPA 4C1NK 5JPNC 3SK4A 1K0RA 3KFUA 2K32A 2MP1A 2AWOA 4AYBE 2F1MA 1MJEA 2ZTEA 5C4ZA 4JBJA 5M3FB 3NBIA 2SOBA 1O78A 5IWAQ 1Q90A 2QILA 2NZHA 4OXPA 4HIOA 5FO7B 4QQBX 1A3UA 2X6GA 3HKZB 1TWGH 1JCKB 1PFSA 3CHBD 4NB3A 5BR8L 3PO3B 1JWUD 4B9XA 2CWAA 2Z6KC 3ULPA 5M5YH 4HJ9A 1STNA 1QILA 2G5DA 3HOYH 2F0EA 4UDUC 1ENAA 3HS0C 1S72A 3GTPB 2QF7A 1WTHA 1KXLA 2I0QA 5KYLA 3CP0A 4P73A 3GTJB 3KK7A 1LM0A 4I7AA 5EBDA 3D8GA 1GVPA 1OTCA 2L1BA 4X66Q 3M9BA 4JC0A 1G8ZD 4RMFA 1HR0L 3L2PA 2R7ZG 2F0MA 1HZBA 3EN2A 2UU9Q 4JI2L 1F9SA 3D6WA 4L5SA 4R8IA 1BUVT 2Q8IB 4WFN3 2Z8LA 4HSPA 4JOIA 5CV5A 3OIPA 4LF7L 4NXNQ 1VQBA 3MXUA 4OIKA 1N9WA 1S4ZA 2JA8G 4IJLA 3C3LA 1II3A 4C3IH 3GD7A 1N8RC 1HJPA 1SNOA 1Y8OB 1XMOL 3VDYA 1YHQA 1J5EL 1VQ7A 4PQXA 1PFMA 4GOPC 5LMNQ 3M4QA 5JAVA 3CCEA 1UUPA 2F0LA 1RJTA 1CQFA 1OXUA 3BZCA 1MKHA 2ES2A 4L63B 2SNSA 2XTIA 1TS3A 4JI0L 1VQ5A 1S5DD 4UPAA 3J80E 4C3JG 1IYVA 1RTOA 1JICA 3HOZH 4C56C 3FKIB 4A3IB 2K01A 1R4PB 2K05A 2F0NA 5TSSA 5JEAG 4J1MA 1BCPC 2A6HC 1G6ZA 1XMQQ 3GTQB 4HCSA 1B50A 3TSSA 2VQFQ 4M8AA 1FJGQ 3PV0A 3TQYA 4ABNA 3A5UA 3MZ5A 1PYWD 4AQYQ 4B3MQ 3U4VA 5IYCH 3QR8A 4XQQA 1S5CD 1BF4A 1K3BC 3K5OA 2K5NA 1CQVA 4WJWA 4GKJL 2K5VA 5CYUA 3FP9A 4XT1B 4ZRZA 5I9PA 3S2HB 1SE2A 1BO0A 5K36H 1ET6A 3RNUA 5KIXA 1K8MA 1IKMA 3SXHA 2PI2E 4B9WA 2DJGC 3D0FA 1FNUA 1YNJC 3S1MH 1F9QA 4NXMQ 3NP8A 3G6EA 1P8LA 3ONAB 2TSSA 3UE0A 4Y52H 2JA5H 2XIWA 3S17H 2LS01 1VQJA 2E8GA 4BBSG 1H9JA 4BY1B 3RLOA 4F88A 4IFDG 2G9DA 4UY8C 1FR3A 2ZM6L 1SRUA 1SE3A 5M3MH 3OHXC 2JA5G 2KJXA 3E0EA 2RQXA 4XIGS 1HUNA 3KBXA 3VR5A 4EVOA 1G6PA 1O7ZA 1D5XC 5CV8A 3H09A 3CCLA 1LTLA 1EY4A 2HQEA 2ICEC 3DWAA 3FDTA 3JAMc 4JI8Q 3BYYB 5M3FH 4AQYL 2E2IH 2CWPA 2K5HA 1CTMA 3DUZA 2SNMA 3EIVA 1JWSD 1A3VA 1PTOB 3K81C 2ZXRA 5J39A 1CUKA 1GUNA 4IPGA 4V190 4IUQA 3HOUH 4A3DB 2XSCA 3H0GG 2PI2A 4C3JH 1LV9A 4JI7L 2K5WA 4XT3B 3I4MH 2R93H 5C4XH 1V1PA 2K7VA 2F0JA 3RZDB 4MNOA 5I6YA 1RTNA 3L9AX 3M7NA 4KMUC 3CC7A 4DF7A 4JI3Q 1JB3A 1E3PA 4YWKA 4UP9A 2M00A 4F7XA 4A3GG 1E1TA 1EEFD 1C48A 1I4PA 1DOMA 3TZUA 1M90C 4P74A 1VF7A 2EQSA 4G4KA 3G71A 1SR3A 1LTRD 1C4QA 3STBD 1SROA 5BN3A 3FPUB 1QNUA 3P20A 3TP7A 5CC4A 1H9SA 3PF4A 4DR2Q 1GOZA 4LFBL 2ZTCA 4J15A 1YJ9A 4B3ML 2VQEQ 3QJYA 3QOLA 1VQMA 1G291 5JEAJ 1EY6A 3KLRA 1X9NA 1RKNA 1QZGA 2VQFL 4RHSA 3J81j 1J6QA 2EYOA 1BOSA 1ONLA 2EYFA 1A2TA 2RVLA 5FJ8G 1Q12A 1EUJA 1Y1WB 1UAPA 2B2UA 1EZ8A 3KF8B 3C46A 1KABA 1WTVA 2E2HH 3HP3A 2EYMA 5FKAC 3H91A 5A2QL 4DR7L 2M9VA 5COYA 4MN3A 1N36L 4HMIA 4R9WA 5FJ8H 3UDGA 1AW7A 1SFOB 3KYHC 1STAA 2ZT9C 2F0KA 4P72A 1Y69U 2B2YA 1I4RA 4O1NA 2B8FA 3DMUA 1ET9A 4DKAC 4RCOA 1PZJD 3TS2A 1I50B 4QY7A 1B70B 4OGQC 2SEBD 4DR2L 3AEVA 3A54A 1SMYC 3PUZA 1HNXL 2NVTB 3K0YA 3D6CA 3IAYA 3F2UA 2N78A 4HJ5A 5C3EG 1TS4A 2NN6I 3B6YA 5CBEE 3JAMi 2YU9B 3BDOA 2IT1A 2PW7A 1WFQA 2R93G 2MGSA 1AP0A 4M1UB 1V8QA 3M85A 3GP7A 3L7ZC 4ZUJA 3ERQA 1X54A 1H95A 2R7FA 2YTVA 1U4MA 1VQLA 1U9RA 4X66L 2WB1B 3H15A 2YTYA 4QUFA 4QMGA 4KV6A 4B3RL 1TWFB 3HOWB 2F0QA 3HOXH 3VA7A 1NE3A 4LW1A 2KCCA 5EKLA 2LXKA 4QJFA 1LTGD 4PNYA 4KLKA 2JXMB 2K75A 3P1HA 2NVYB 3U9OA 4CKEA 3PF5A 1FVIA 2EY1A 3UI2A 2ALYB 3TZDA 1TWCB 1Z7TA 3PGZA 2EJGC 1MI2A 5LHY1 1NR2A 5IODA 4RH6A 2X69A 3LX0A 2NTSA 3PIP3 2MQHA 1TR5A 3S16H 1TT2A 5KEEA 4JI6L 1HNZL 2N88A 4A3BH 3OW2A 4IPDA 4ZLTF 3FVQA 1A6XA 3NUCA 3K7AB 3ZYYX 4EQNA 4DFAA 3NBHA 5IGDA 2I07B 1NNXA 2BCOA 4Q5VA 3I90A 4B3TQ 1NTGA 1X32A 2MO1A 4JI1L 4JI3L 5M5YB 3K59A 4QIWB 4NP5A 4Q0FA 1RIPA 1KNAA 2ZXPA 2EIFA 3W1BA 3EFXD 3HOUG 2PPBC 2A68C 1ASYA 3HKZG 1D8LA 1DJRD 4UP8A 2JSOA 1D7QA 1GXDC 3F1ZA 2R7DA 3MAQA 3E9HA 2B2WC 1O7IA 1PTOC 1SNMA 4GOPB 3SDZA 3T16A 1B53A 2MFIA 4K2LA 2L0CA 4X64L 4DV2Q 2ZXOA 2QW7A 2A74C 4DR1L 1FGUA 3PQIA 3T4AC 2VQEL 5C0XH 1EIGA 4LAAA 3UDFA 3GTOB 4A3JH 1STYA 2N49A 1NR4A 3I8ZA 1ZEQX 4CKBA 1U4RA 3PIOA 2TMPA 1L1OB 4A3MB 1I3QB 2L9HA 2NZOA 3VR4A 3SHLA 4DR1Q 4A3KB 4LF4Q 2AKWB 1JE4A 3UDXA 4XQNA 3CC4A 1FGBD 4LK1C 2E2JH 4KY5A 5IE8A 2R7ZB 3MXNA 3HOZB 4IPHA 3VYTA 3SR1A 1CFMA 2WFWA 4DV0L 2ZJQA 1HUMA 3NSWA 3TP5A 3BDLA 5FLMH 1E2WA 1AE2A 3IRBA 5ELCA 1QVFA 1U0LA 2KEEA 1LACA 3D4WA 1LYLA 3T1HL 4QL5A 3R2TA 1PH3A 1YHAA 2CQAA 5I4DA 3PUWA 3C1FA 5D3IB 4I7ZC 4WORA 4HJ7A 4DAYB 1GKHA 4GLAC 2IHEA 1TVXA 2N55A 4CDCC 4P2CB 4BXXH 2OCEA 1SYDA 2NVQH 1RCVD 1HFNA 5FLXL 3OPOA 1UEAB 2FFKB 1QE6A 4A3FH 4JOIC 5DM63 3D3RA 4O42A 4C1NI 5IT9c 4WJ3M 3AYHB 2HT1A 4K8IA 1ML0D 3GV3A 4RGOS 5IGCA 3PUVA 3X3MA 1EQTA 3MC0B 4K2KA 3A0JA 5I2XA 1D5MC 1EOTA 3S9WA 1IW7D 1O7YA 1CKOA 1CKNA 5EPKA 3X3NA 1GM5A 3SK6A 1W6JA 1YNXA 2RF4A 3AB9A 3MEHA 5KYIA 3P7JA 4IPCA 4DV4Q 4RWSC 4EQOA 4X65Q 4HN7A 2GVBA 4MHEA 1G51A 4ZKCB 2KCTA 1VQCA 3I72A 2NN6H 3CCQA 3S14H 1I4GA 4A3IH 1X3PA 3OWEB 1PFBA 1A3TA 3RZOB 3J81E 3IKJA 1NMGA 3STBC 2D0PA 1GHJA 1GO3E 4KD4A 4C3HH 4K5WA 5BN4A 4JI6Q 2HD3A 1CA5A 3CPWA 1A62A 2B2VC 2PZWA 4FP5D 3RZDH 4AIMA 2AQ1B 1ILQA 4FXGC 1KD1C 5GAHC 3S16B 4XYQA 4K0KQ 1EY7A 1VQOA 5JOBA 1XTDA 1QWYA 2F0GA 3S2HH 1KDBA 2EY6A 5CV4A 4DGZA 4EGVA 1IBLQ 3NEMA 1QB5D 2OWOA 1Y1WG 4DAYA 4JI5Q 1DOKA 2CFMA 5IP7G 3JAME 2JQOA 4OX9L 2JA7H 4R4IA 1I6HB 3Q24A 5LMNL 2WKCA 3G4SA 1VQHA 2HIXA 5AJ3Q 2JN4A 4R1JA 1CSPA 4X3SA 4OIJA 4IUUA 2HDLA 4CDFC 1PMRA 1N33Q 2L5TA 5C5MA 3N52A 2H1EA 4H0LC 4DV3L 1CKMA 2MPMA 5J3BA 2ASBA 5CV9A 2F3WA 2J0TD 3MA2B 2A73B 3NE5B 3CMEA 3QB3A 4QIWE
chains in the Genus database with same CATH topology
5KRUA 2PMZB 3NK9A 5I6WA 2PCFB 2EVBA 4KJOA 3MXGA 4KN7C 1GJXA 2E2HB 3MTSA 1HPCA 5AFWA 1STEA 3A8KE 1JOQA 4QF4A 5EBCA 5FO8B 5D65A 4DN4M 1WTXA 1EY5A 5C0XJ 2E74C 2A6ED 2RDFA 2K28A 2WIIB 2SDFA 3R2IA 5T1GA 3HG9A 1JOKA 1KNEA 2VXWA 4HMJA 4CHTB 2F0HA 4DAVA 3BS1A 2BE5C 3VYSA 3FEWX 2FHTA 4BY7B 3S15B 3S2DB 3NTHA 5LL6S 3QWNA 4G7HC 1V1PB 1HA6A 3EROA 1GUSA 1LT4D 3HOXB 1Z6HA 3M7GA 2QDBA 4IFDH 1OXSC 1IYUA 3NHHA 1EYCA 4RKBA 1LTID 1PRTB 1SDFA 4TQUS 2OF1A 5EPJA 1HXYD 4RA8A 2D62A 2Q8RE 2AWNA 2CW0D 1A15A 4KY7A 2IWHA 3VR6A 1XXGA 1SNPA 2CW0C 2RDGA 1PZKD 2PZUA 2EDGA 1O7LA 4TSSA 5D3DA 3N6RA 1PZID 2NN6G 2D2CC 1D2BA 1STHA 2PYKA 3FPPA 5C4XB 2JA5B 3SEBA 4PV1C 4GZYC 3T53B 4C3HB 2FJ2A 1TWAB 1FNVA 2PZTA 2Z4HA 2FMCA 4N9TA 2ICIA 2IW3A 5CR3A 3Q0AA 2B8GA 4HAEA 1KLUD 1RF2D 4CJ0B 1YNND 4QCLA 1PLFA 1HFGA 3S17B 2WAQB 2F0VA 4IUTA 3G7LA 4ZAIA 1OXVA 1NCVA 2Y0SB 2F0SA 2AQ3B 1ENFA 4V0BA 3K5MA 4LMQD 5FO9B 1STGA 1LT3D 2R6GA 4FO2A 2AQ2B 2NZ1D 3NPPA 3DWPA 4HTHA 4ID6A 4IUNA 1Y8NB 1H9SB 2BA1A 4CKCA 1EWHA 4OHJA 2ID0A 4TKOB 3NWSA 3V2TA 2JYOA 4FF1A 1Q1BA 2QEJC 1ZYRC 4C3IB 1AZQA 1IKLA 4BS9A 4IALA 1G91A 3S1NB 2EXZA 1SNCA 3DM1A 2M2LA 2VUMB 2A69C 2F0DA 2GA4B 2Q8TA 3TMEA 1BCPD 2IX1A 1TIID 1Y8PB 1SJHD 4KY6A 1CHPD 1M8AA 1FNWA 1WTRA 1QNKA 3WDNA 1LLRD 4K5VA 1IHZA 3DHQA 1SSOA 2K5QA 1SYFA 3A56A 4PMWA 1VCIA 2EYHA 1LTBD 2B2VA 2DNEA 1XTCD 1TU2B 3HZXA 4IFDJ 3C1EA 1Y1VB 2DY8A 4NW2A 4KKSA 2EYPA 4XXEA 3GTMB 1HTLD 4CJ2C 5E4XA 1Q8IA 2FMMA 2WV6D 3S1RB 4RGMA 2IPKD 5C6AA 1BR9A 3M4YA 1JC7A 5M3MB 3D4RA 4K6DA 4H13C 1OXTA 1WTWA 3PUYA 3I73A 1JORA 5J1ZA 4AYBB 4ZKBB 1U4LA 1EQVA 4U68A 1DD2A 4A3BB 2J7ZA 3VA5A 1LO5D 4KTAA 1PTOH 1V1OA 4IQZA 5FOBB 1PXUA 4MIUA 4XYOA 3LWEA 4RHRA 4C3JB 3M3YB 3ND9A 2QKIC 1CI3M 4BA2I 2KEDA 1TY0A 3GO5A 5KGUA 3K57A 1SE4A 3S1QB 2F3VA 1DOLA 1HCZA 2EY5A 4WRDA 2EE1A 2NTTA 3PO2B 2L12A 5CBAE 2F0WA 3V96A 3Q6SA 2KVMA 3I4LA 1LT6D 2BA0A 4G57A 5CMDA 4H7BA 2L11A 3KLSA 2O4XA 5C5LA 1SXTA 2R92B 4J6HA 3GQBA 3RLFA 4FXKC 1MSGA 4A3JB 4BBSB 3H3VC 1U4PA 5IGBA 2VB3X 1JR0D 1R9TB 2CVRA 1DYQA 2LY7A 4I65A 3J7AV 4DU9A 2WINB 1S5FD 3S14B 2XRQD 2VNUD 3WOEA 5E1FA 1ZXTA 5CV7A 5C44B 3T51B 4NDXA 2RSOA 4A3FB 1PFNA 5K36G 3NQIA 3I70A 2EY2A 2F4IA 2LFNA 5CORA 4R8NA 3TN2A 2FINB 2NBFA 1WTQA 2K03A 1ZKOA 1XWEA 2B2UC 3E5SA 1MGSA 1I4QA 1F77A 2RDHA 4FF3A 3J7YW 1D6EC 2JP1A 3GTGB 4G7OC 2NVQB 4LJZC 3BVMA 4KN4C 1IL8A 1E2VA 2LMCB 4A3EB 4G7ZC 2IL8A 4CJ1B 3E6ZX 5NUCA 1EY9A 1ESFA 4K5XA 5HURA 2I46A 1TS5A 5EPLA 4DA2A 1BCPF 5C3WA 1KDAA 4DAPA 3OSOA 3QIAA 1F2LA 5M5WB 1D5ZC 1FYCA 4NMZA 3HGBA 4KHZA 4BBRB 1PTOD 1V43A 1K8OA 2L55A 1VDZA 3NWTA 5ELDA 1BCPB 4KJNA 4OO1I 1TWGB 3AU7A 3FRPB 2F03A 1TWHB 3K58A 1SYGA 3EJIA 3CRKC 3NTKA 2QCPX 1PDQA 3NXWA 5DAUA 2B63B 1J8IA 3MVVA 1DM0B 1SBBB 3NTIA 1F2ZA 2IX0A 2KA7A 1NAPA 5G3LF 5K5PA 2JEAI 2L4NA 2JA7B 1ILPA 3HRZC 3W3AA 4A93B 1B44D 2B2YC 3P75A 3AMUA 3OIQA 4IUPA 4NKLA 2O2LD 3KF8A 2BE5D 4QB4A 4N9PA 1G2TA 2F0PA 4IZ8A 3KLSX 4IURA 3C2PA 1W6KA 4X3TA 4ODGA 2PO4A 3J81L 2F0OA 1PRTD 3GV6A 4EQPA 2NUCA 1HHVA 2O5JC 5KNCA 4FXDA 3SE0A 2RBMA 1CM9A 4JK1C 1QOHA 1ZYRD 3FMCA 5E3FA 2HDMA 1QCBD 4A3GB 1QG7A 1F2MA 2F0UA 1F2YA 4DNTB 2A69D 4KKUA 3SK8A 1CZGA 5ELEA 2X6LA 3CU7A 4JBWA 5IGGA 1BQQT 1TQOA 2RKSA 3PUXA 2K6AA 1OXXK 3GTLB 3LNNA 1WTPA 1PRTF 1UNSA 2LKVA 1EZ6A 2KOLA 3OMCA 1DZ1A 1H9KA 1SNQA 5DNFA 1H9RA 3VYRA 1Z47A 4KK7A 4Z9CB 2EJFC 3H94A 4QUCA 1D1KA 4KKTA 3NQTA 4DXFA 4IN3A 5J22A 4FNFA 1WCMB 1E2ZA 4FF2A 4ZYSA 1TKWB 5C0XG 1BDOA 3RUZA 5M9OA 4C2MB 2XWJB 3CRLC 2EOTA 2NWGA 1RHPA 5IGFA 2R3ZA 1LTTD 4IFDI 5IGEA 3A7AB 3JAML 2R93B 3MHBA 1EY8A 3M4OB 2ENBA 4L8JA 1EU3A 5KNDA 3WOFA 2A6EC 5I9OA 3L3OC 1EFID 2OT2A 3VR2A 1WD0A 1R4QB 3DEOA 1AN8A 4ULLA 3MFGA 1Q3LA 1G2SA 1WVLA 4K14A 3A55A 2Z1CA 2A6HD 4DK1A 4DXGA 3K5NA 4RFBA 5I2YA 1BXTA 3PMFA 2JA8B 1SAPA 4L6TB 3K6OA 1EY0A 1Q1EA 5A2QE 2NYZD 1B9NA 4PMCA 5IOCA 3BG3A 4FF4A 4DNRB 2EZVA 2E76C 1SNDA 4CGYB 2HUGA 1EYAA 2A68D 2NB0A 3D4DA 5C3EB 2O5IC 2JA6B 1WD1A 1JWMD 3QOJA 3EQLC 1M4VA 2A5HA 1A2UA 3W2DA 2DNCA 4K8JA 3URYA 4ILWA 2WKDA 1E0BA 5IT9L 5ELFA 1B4OA 1LABA 3S1MB 4C3IG 2IJ0A 3BVZA 1DCZA 1RDPD 3BVGA 5LL6X 2OEOA 2EPBA 2KQ3A 3GTKB 3ND8A 1ESRA 1OO9B 3HOYB 1STBA 1KLGD 2KCNA 1B1ZA 3R3OA 2BDOA 1CA6A 1EIHA 1YNNC 4K6LA 4UAIA 1YNJD 5CGKA 3TP8A 4RCNA 3CQZB 1K83B 3I4NB 5ISRA 3OWFA 3RD4A 4U673 2XVSA 4FVMA 3J80L 1BBXC 1VF5C 2F0FA 3V05A 3MFYA 3MXPA 4X3KA 1CHQD 3H6MA 1RD9D 4CBVA 3OW7A 1SYEA 1VMPA 1C8CA 5C4JB 4FYDA 4H44C 1IW7C 4OL7A 3RMHA 4RKLA 3EVQA 5C4HA 2B2TA 1AFPA 4OO1G 2KHSA 1LT5D 3HOVB 1SYBA 2RA4A 5EGTA 3KUPA 1HQMC 2E2IB 3IL8A 4DK0A 1ENCA 2K33A 1NUCA 2HCIA 1MSHA 4YIJA 1CK1A 5M5XB 1AZPA 4KI0A 1HTPA 4E6IA 5ELBA 4F8MA 1GUGA 2NVXB 4XDXA 3IFDA 1ICWA 2B39A 2JE6I 2HCCA 5JPMC 2XN9C 3A8JE 5C0XI 1GUOA 3Q23A 5FLXE 2E75C 3TP6A 4RAUC 2H4OA 1WTOA 4PMBA 5HGTA 3OMGA 3BYTB 3A8IE 1NSNS 5CV6A 5JVH3 3O13A 5DM73 1VMCA 2PQEA 3IFTA 2D5DA 2R61A 4ZUIA 1J9OA 3EA6A 2B2TC 3BZDB 5EKIA 2XNAC 1SMYD 3J7AF 1EL0A 4KD3A 3DEPA 1XYIA 2WP8J 1DONA 4X3UA 1QJOA 1BNZA 1GUTA 1KAAA 4ME5A 1B9MA 2OXPA 3I3CA 3T56B 5F2DA 5BN5A 1EEID 1I6VC 2G9HD 3I4MB 1T5EA 3KBGA 1EU4A 4XQJA 5JJZA 1XX8A 1RODA 2RSNA 1KTKA 1CZWA 5JEAH 2BDNA 2IX3A 4ZQ3A 2K04A 3K5LA 1SEBD 1SJED 4HEDA 1F9PA 2K1BA 3R8BA 5KNBA 1B2TA 1HRJA 3Q22A 1JOOA 1I4XA 1T5XD 2AUJD 3BDCA 3T13A 2B2WA 4BA1I 4HSVA 3HOUB 4TRDA 4XTCS 1TY2A 5JVG3 4HCEA 3TBIB 2F0IA 5IIFA 2KUMA 3I91A 1GUWA 4RGTA 2C5CA 5T1IA 3VR3A 4F87A 2EJMA 4S3SA 3E0JA 1D1IA 2E2JB 4B08A 3VYUA 1CT1D 4HR7B 5E4WC 3OOCA 2JEBI 3HEJA 1H9MA 1AEXA 1SYCA 4IUVA 4C3HG 3SVMA 3U9SA 4OO1H 1O80A 3CKIB 5D14A 2J4XA 1B3AA 1PTOF 2KECA 1FD7D 3G6JB 4Y7NB 2Z4IA 3PIO3 3QG1A 3A7LA 2EYJA 5IT9E 2V4DA 5EQ0A 1EWCA 3DXJC 3H0GB 2XRSD 5DEHA 1F9RA 1EYDA 2MJ8A 2PNRC 5EKKA 1X3QA 3SK5A 3D31A 3DWQA 1KDCA 1L0XB 2DN8A 1S5BD 1GHKA 1I4HA 5G3LD 4KHVA 2YYZA 2EYLA 2XWBB 2F0TA 2DY7A 3QO2A 2AUKA 2K5DA 2MHVA 2C9OA 1DXMA 2D9UA 5A35A 1JQYD 1PRTC 2CHBD 4BWGB 5C3XA 3TDQA 2WACA 1L0YB 1MBYA 2MUYA 1MD2D 3MWYW 1HQRD 3LWUA 4RGNA 1LTAD 2PW5A 3R93A 1TS2A 5FK9C 4J8QA 1LTSD 5EJWA 1S5ED 2E2DC 4ZK9B 1HA5A 2BOSA 2VB2X 3ITPA 4C1NK 5JPNC 3SK4A 2K32A 2MP1A 2AWOA 2F1MA 5C4ZA 5M3FB 3NBIA 2SOBA 1O78A 1Q90A 2QILA 5FO7B 1A3UA 2X6GA 3HKZB 1JCKB 3CHBD 3PO3B 1JWUD 4B9XA 1STNA 1QILA 2F0EA 4UDUC 1ENAA 3HS0C 3GTPB 2QF7A 5KYLA 3GTJB 3KK7A 5EBDA 3D8GA 2L1BA 1G8ZD 2F0MA 1F9SA 3D6WA 4R8IA 1BUVT 2Q8IB 4WFN3 2Z8LA 4HSPA 5CV5A 3OIPA 3MXUA 4OIKA 1S4ZA 3C3LA 1II3A 3GD7A 1SNOA 1Y8OB 4PQXA 1PFMA 5JAVA 1UUPA 2F0LA 1RJTA 1CQFA 1OXUA 4L63B 2SNSA 1TS3A 1S5DD 3J80E 4C3JG 1IYVA 1RTOA 1JICA 4C56C 3FKIB 4A3IB 2K01A 1R4PB 2K05A 2F0NA 5TSSA 5JEAG 4J1MA 1BCPC 2A6HC 1G6ZA 3GTQB 4HCSA 1B50A 3TSSA 4M8AA 3PV0A 4ABNA 3MZ5A 1PYWD 4XQQA 1S5CD 1BF4A 3K5OA 1CQVA 4WJWA 5CYUA 4XT1B 4ZRZA 5I9PA 3S2HB 1SE2A 1BO0A 5K36H 1ET6A 5KIXA 1K8MA 1IKMA 3SXHA 4B9WA 1FNUA 1YNJC 1F9QA 3NP8A 3ONAB 2TSSA 2XIWA 2LS01 1H9JA 4BY1B 4F88A 4IFDG 2G9DA 1FR3A 1SE3A 3OHXC 2KJXA 4XIGS 2RQXA 1HUNA 3KBXA 3VR5A 4EVOA 1O7ZA 1D5XC 5CV8A 3H09A 1EY4A 2HQEA 2ICEC 3DWAA 3FDTA 3BYYB 1CTMA 3DUZA 2SNMA 1JWSD 1A3VA 1PTOB 5J39A 2ZXRA 1GUNA 4V190 4IUQA 4A3DB 2XSCA 1LV9A 2K5WA 4XT3B 1V1PA 2K7VA 2F0JA 3RZDB 5I6YA 1RTNA 3L9AX 3M7NA 4KMUC 4DF7A 1JB3A 2M00A 4F7XA 1EEFD 1C48A 1I4PA 1DOMA 3TZUA 1VF7A 4G4KA 1LTRD 1C4QA 5BN3A 3FPUB 1QNUA 3P20A 3TP7A 5CC4A 1H9SA 1GOZA 3QJYA 3QOLA 1G291 5JEAJ 1EY6A 3KLRA 1RKNA 4RHSA 2EYOA 1BOSA 1ONLA 2EYFA 1A2TA 2RVLA 1Q12A 1Y1WB 1UAPA 2B2UA 1EZ8A 3C46A 1KABA 1WTVA 3HP3A 2EYMA 5FKAC 3H91A 5A2QL 2M9VA 5COYA 4MN3A 4HMIA 4R9WA 1AW7A 1SFOB 1STAA 2ZT9C 2F0KA 1Y69U 2B2YA 1I4RA 4O1NA 2B8FA 3DMUA 1ET9A 4RCOA 1PZJD 1I50B 4OGQC 2SEBD 3A54A 1SMYC 3PUZA 2NVTB 3K0YA 3D6CA 3IAYA 3F2UA 1TS4A 2NN6I 5CBEE 2YU9B 3BDOA 2IT1A 2PW7A 2MGSA 1AP0A 4M1UB 1V8QA 3M85A 3GP7A 3L7ZC 4ZUJA 3ERQA 1U4MA 1U9RA 2WB1B 4QUFA 4QMGA 4KV6A 1TWFB 3HOWB 2F0QA 3VA7A 2KCCA 5EKLA 1LTGD 4PNYA 2JXMB 3P1HA 2NVYB 3U9OA 4CKEA 2EY1A 3UI2A 3TZDA 1TWCB 1Z7TA 2EJGC 1MI2A 5LHY1 1NR2A 5IODA 4RH6A 2X69A 3LX0A 2NTSA 3PIP3 1TR5A 1TT2A 5KEEA 2N88A 4ZLTF 3FVQA 1A6XA 3NUCA 3K7AB 3ZYYX 4EQNA 4DFAA 3NBHA 5IGDA 2I07B 2BCOA 4Q5VA 3I90A 1X32A 5M5YB 3K59A 4QIWB 4NP5A 4Q0FA 1KNAA 2ZXPA 3EFXD 2PPBC 2A68C 1DJRD 2JSOA 1GXDC 3MAQA 2B2WC 1PTOC 1SNMA 3SDZA 3T16A 1B53A 4K2LA 2L0CA 2ZXOA 2A74C 3T4AC 5C0XH 1EIGA 4LAAA 3GTOB 1STYA 1NR4A 3I8ZA 1ZEQX 4CKBA 1U4RA 2TMPA 4A3MB 1I3QB 2L9HA 3VR4A 3SHLA 4A3KB 1JE4A 4XQNA 1FGBD 4LK1C 4KY5A 2R7ZB 3MXNA 3HOZB 3VYTA 3SR1A 1CFMA 1HUMA 3NSWA 3TP5A 3BDLA 1E2WA 5ELCA 2KEEA 1LACA 3D4WA 3R2TA 2CQAA 5I4DA 3PUWA 3C1FA 5D3IB 4I7ZC 4WORA 1TVXA 2N55A 4P2CB 1SYDA 1RCVD 1HFNA 5FLXL 3OPOA 1UEAB 2FFKB 1QE6A 5DM63 3D3RA 4O42A 4C1NI 4K8IA 1ML0D 3GV3A 4RGOS 5IGCA 3PUVA 3X3MA 1EQTA 3MC0B 4K2KA 5I2XA 1D5MC 1EOTA 3S9WA 1IW7D 1O7YA 5EPKA 3X3NA 3SK6A 1W6JA 3AB9A 3MEHA 5KYIA 3P7JA 4RWSC 4EQOA 4HN7A 4MHEA 4ZKCB 3I72A 2NN6H 1I4GA 1X3PA 3OWEB 1PFBA 1A3TA 3RZOB 3J81E 3IKJA 1GHJA 4KD4A 4K5WA 5BN4A 1CA5A 2B2VC 2PZWA 4FP5D 2AQ1B 1ILQA 4FXGC 3S16B 4XYQA 1EY7A 5JOBA 1QWYA 2F0GA 1KDBA 2EY6A 5CV4A 4DGZA 4EGVA 1QB5D 4DAYA 1DOKA 3JAME 1I6HB 3Q24A 2WKCA 4X3SA 4OIJA 4IUUA 2HDLA 1PMRA 2L5TA 5C5MA 3N52A 2H1EA 4H0LC 2MPMA 5CV9A 2F3WA 2J0TD 3MA2B 2A73B 3NE5B 3QB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 D;  3N6R A;  3QG1 A;  3QJY A;  2NN6 G;  2D2C C;  3ND9 A;  3A7L A;  1E2Z A;  1ZKO A;  1G29 1;  1I6V C;  3FPP A;  5BN5 A;  2O5I C;  4OO1 G;  1CI3 M;  1TKW B;  5C0X G;  1BDO A;  1A6X A;  2V4D A;  3KLR A;  2PCF B;  1T5E A;  4BA2 I;  2EVB A;  5K36 H;  1Y8P B;  4KN7 C;  2QF7 A;  3PUV A;  1K8M A;  2BE5 D;  3DXJ C;  1GJX A;  4PV1 C;  4G7O C;  3EQL C;  4LJZ C;  4GZY C;  1HPC A;  3T53 B;  3A8K E;  4KN4 C;  3CRL C;  1ONL A;  1HQM C;  1IW7 D;  4DK0 A;  2PNR C;  1YNJ C;  1E2V A;  3WDN A;  2K33 A;  5JEA H;  1Q12 A;  1HCZ A;  3D31 A;  2PPB C;  2A68 C;  2LMC B;  3AB9 A;  2DNC A;  2B8G A;  4G7Z C;  2E74 C;  2DN8 A;  2A6E D;  1GHK A;  1H9J A;  3A7A B;  3SDZ A;  1VCI A;  4IFD G;  3I4L A;  1LAB A;  2YYZ A;  2BA0 A;  1FR3 A;  4KI0 A;  1DCZ A;  1HTP A;  2ZT9 C;  3I72 A;  2NN6 H;  4L8J A;  5KNB A;  5KNC A;  2O5J C;  3ND8 A;  1Y69 U;  4XIG S;  2AUK A;  5KND A;  5C0X H;  2Q8I B;  1GUG A;  3SE0 A;  3VR5 A;  2B8F A;  2DNE A;  1DXM A;  4JK1 C;  2AUJ D;  3QIA A;  1OXV A;  5A35 A;  1TU2 B;  2BE5 C;  3MXU A;  3IKJ A;  3FMC A;  4BA1 I;  2JE6 I;  1FYC A;  1GHJ A;  2BDO A;  3HGB A;  4OGQ C;  2A6E C;  3PUZ A;  1SMY C;  4KHZ A;  4XTC S;  4KKS A;  1V43 A;  1YNN C;  3A8J E;  1CTM A;  3GD7 A;  3GQB A;  1Y8O B;  3VR4 A;  5BN4 A;  3RLF A;  1K8O A;  1GUO A;  1VDZ A;  3VR2 A;  4RCN A;  2NN6 I;  4DNT B;  3LWU A;  4LK1 C;  3BDO A;  4G7H C;  2A69 D;  1GUN A;  2E75 C;  2IT1 A;  1GUS A;  2R6G A;  4KKU A;  4JBW A;  3VR3 A;  1CFM A;  2EJM A;  1V8Q A;  3M85 A;  1OXU A;  3L7Z C;  1E2W A;  3CRK C;  1Z6H A;  2A6H D;  4IFD H;  3M4Y A;  1OXS C;  1IYU A;  4DK1 A;  3PUX A;  2K7V A;  1LAC A;  1VF5 C;  1IYV A;  3A8I E;  1OXX K;  4TQU S;  3M7N A;  3LNN A;  4KMU C;  3VA7 A;  4HR7 B;  3D4R A;  2KCC A;  3MFY A;  1Y8N B;  1H9S B;  4H13 C;  3OOC A;  1OXT A;  1Q1E A;  2BA1 A;  2D5D A;  3IFT A;  1EWH A;  5JEA G;  1B9N A;  3TZU A;  3PUY A;  2JEB I;  2JXM B;  3BG3 A;  2K32 A;  1VF7 A;  3I73 A;  4TKO B;  3T51 B;  2A6H C;  1H9K A;  1H9M A;  2AWO A;  2D62 A;  1Q1B A;  2F1M A;  3PUW A;  4I7Z C;  1H9R A;  3OW7 A;  3U9S A;  3VR6 A;  1ZYR C;  2KA7 A;  5BN3 A;  4OO1 H;  4DNR B;  2CW0 C;  3P20 A;  1Z7T A;  1DD2 A;  2EJF C;  1O78 A;  2EJG C;  1H9S A;  2JEA I;  1Q90 A;  3H94 A;  3PV0 A;  5K36 G;  1PMR A;  2L5T A;  4KKT A;  2E76 C;  1QJO A;  4H44 C;  1IW7 C;  4H0L C;  2EDG A;  1O7L A;  3W3A A;  1GUT A;  1B9M A;  4IQZ A;  3NE5 B;  3T56 B;  3OPO A;  2A69 C; 
#chains in the Genus database with same CATH topology
 4X62 L;  5KRU A;  2PMZ B;  3NK9 A;  3J7Z C;  5I6W A;  5JJI A;  4R4O A;  2PCF B;  2EVB A;  5HGQ A;  4DV4 L;  4KJO A;  2KHI A;  3MXG A;  4KN7 C;  1K28 A;  1GJX A;  2E2H B;  4NPS A;  3MTS A;  1HPC A;  3FKI H;  1STE A;  3A8K E;  5AFW A;  4A3M H;  4LF9 Q;  1JOQ A;  1HZ9 A;  4QF4 A;  5EBC A;  5FO8 B;  5D65 A;  4DN4 M;  1WTX A;  1EY5 A;  4OEM B;  5C0X J;  3Q8D A;  1YHB A;  4YHH L;  2E74 C;  2A6E D;  1TWH H;  2RDF A;  2K28 A;  2WII B;  2SDF A;  3R2I A;  2UXB Q;  5T1G A;  3OYY A;  3HG9 A;  1JJC B;  5GAG C;  1JOK A;  2VUM H;  1KNE A;  2VXW A;  2QDL A;  4HMJ A;  4CHT B;  2F0H A;  4DAV A;  3BS1 A;  2BE5 C;  4IO9 A;  1UE1 A;  3VYS A;  1AE3 A;  1B7Y B;  3FEW X;  3SGI A;  2FHT A;  1KHI A;  4BY7 B;  3RR5 A;  3S15 B;  4N8X 1;  1Q86 C;  3S2D B;  3NTH A;  2ZM6 Q;  5LL6 S;  2YTX A;  4LFA Q;  1YZ6 A;  3QWN A;  4GNX A;  1V1P B;  4G7H C;  1HA6 A;  3ERO A;  1GUS A;  1LT4 D;  1VQP A;  3GTL H;  3HOW H;  3HOX B;  2GVA A;  5AJ3 L;  4A3C G;  3HFZ B;  1Z6H A;  3M7G A;  2QDB A;  3K7U C;  4IFD H;  1OXS C;  1IYU A;  4DR3 L;  2DGY A;  3NHH A;  1IBK Q;  1EYC A;  4RKB A;  1LTI D;  1PRT B;  2HIV A;  1SDF A;  4TQU S;  2OF1 A;  1I5F A;  5EPJ A;  3T1Y Q;  1YEZ A;  4A3L H;  1HXY D;  3CF5 A;  2Z6B A;  1VQK A;  4RA8 A;  1L2F A;  4DR4 Q;  2D62 A;  2Q8R E;  2AWN A;  2CW0 D;  1A15 A;  4KY7 A;  2IWH A;  3VR6 A;  1EIY B;  1XXG A;  1YJW A;  1SNP A;  1TWF H;  2CW0 C;  2QGQ A;  2RDG A;  1PZK D;  2PZU A;  3KDF A;  2EDG A;  5H1S E;  1O7L A;  4TSS A;  2AMC B;  3TRE A;  2FXQ A;  2Q2T A;  2UXC Q;  4DR4 L;  1IXR A;  5D3D A;  3N6R A;  1PZI D;  2NN6 G;  2D2C C;  4A3J G;  1D2B A;  1STH A;  2PYK A;  3FPP A;  1I94 Q;  5C4X B;  1N32 L;  1AH9 A;  2JA5 B;  3SEB A;  4PV1 C;  4GZY C;  3T53 B;  4C3H B;  2FJ2 A;  1TWA B;  1FNV A;  2F4V L;  1WCM H;  2PZT A;  2Z4H A;  2CH4 W;  4JV5 L;  2FMC A;  4N9T A;  3K7A H;  1V9P A;  1S40 A;  4A75 A;  2ICI A;  2IW3 A;  4JG2 A;  5CR3 A;  4BBR G;  3Q0A A;  2B8G A;  4LF5 Q;  3TEH B;  4HAE A;  1KLU D;  1PHJ A;  3I4N H;  4OWW B;  1RF2 D;  4CJ0 B;  1YNN D;  3S24 A;  4B3R Q;  4OWT B;  3KLW A;  4QCL A;  2KHJ A;  1PLF A;  4L5Q A;  1HFG A;  3S17 B;  2WAQ B;  2F0V A;  3KF6 B;  4IUT A;  3G7L A;  1VQG A;  4ZAI A;  1DGS A;  3ZJY C;  1OXV A;  4BY1 H;  1NCV A;  2Y0S B;  2F0S A;  2AQ3 B;  4PG3 A;  1ENF A;  4V0B A;  2B63 G;  3K5M A;  2F3I A;  2I5M X;  4LMQ D;  5FO9 B;  3S1Q H;  1Q81 C;  1STG A;  1W3S A;  1LT3 D;  4GKK Q;  2R6G A;  2KBN A;  4FO2 A;  2AQ2 B;  2RCN A;  2NZ1 D;  1VQF A;  3NPP A;  4LF5 L;  3DWP A;  1RL2 A;  4JW0 A;  1A63 A;  4HTH A;  4ME3 A;  5FLM G;  4ID6 A;  4IUN A;  2QA4 A;  2LSS A;  3CCM A;  5C4X G;  1Y8N B;  1H9S B;  1L1O C;  2BA1 A;  4CKC A;  1EWH A;  4OHJ A;  2ID0 A;  4TKO B;  3CAM A;  3NWS A;  3V2T A;  2JYO A;  4FF1 A;  1Q1B A;  1X3G A;  2QEJ C;  1ZYR C;  4C3I B;  1AZQ A;  2NVT H;  4H02 A;  3HOZ G;  1IKL A;  1N33 L;  3A5Z B;  3ERS X;  4BS9 A;  4IAL A;  1G91 A;  3TRZ A;  3F8T A;  3S1N B;  3NBH B;  2EXZ A;  1SNC A;  3DM1 A;  5GAD C;  1R9T H;  3CCJ A;  2IHF A;  2M2L A;  2VUM B;  2A69 C;  2F0D A;  2GA4 B;  2Q8T A;  3TME A;  4DR5 Q;  1YVC A;  1BCP D;  2IX1 A;  1XJV A;  1TII D;  1Y8P B;  4HIK A;  1SJH D;  1XPR A;  4A3D G;  4KY6 A;  1CHP D;  3K8A A;  2VL6 A;  5HY6 A;  4JPB W;  4DPG A;  1M8A A;  1N34 L;  5E7N A;  4A93 H;  2ZTD A;  1FNW A;  1WTR A;  4JCV E;  1QNK A;  4YCU A;  3WDN A;  5FLX c;  1LLR D;  4K5V A;  1IHZ A;  4EQ5 A;  3DHQ A;  4KHP L;  2R7Z H;  3GTK H;  1SSO A;  2K5Q A;  2UUC Q;  2Q2U A;  3KF6 A;  1SYF A;  1C9O A;  3A56 A;  4PMW A;  1VCI A;  2EYH A;  4LFA L;  5IYB G;  1LTB D;  2L15 A;  2B2V A;  2DNE A;  4NXN L;  1XTC D;  1TU2 B;  3HZX A;  4A3C H;  3F2C A;  4X62 Q;  1E7Z A;  4IFD J;  3C1E A;  2PQA A;  1Y1V B;  2DY8 A;  4X65 L;  4NW2 A;  5JJL A;  2OQ0 A;  4KKS A;  3PO2 G;  1KRT A;  2EYP A;  4XXE A;  3GTM B;  3W5O A;  1HTL D;  4CJ2 C;  4JYA Q;  5E4X A;  1HNW Q;  1Q8I A;  2FMM A;  4YCW A;  2WV6 D;  3S1R B;  4A3G H;  4RGM A;  2IPK D;  5C6A A;  1BR9 A;  3M4Y A;  2I5L X;  2NVY H;  3BJU A;  1JC7 A;  3J81 i;  4ALP A;  2BH8 A;  1EQR A;  5M3M B;  4JVZ A;  3K80 C;  2R92 G;  3D4R A;  4K6D A;  1N34 Q;  4H13 C;  1OXT A;  1SE8 A;  1WTW A;  3PUY A;  3I73 A;  1JOR A;  5J1Z A;  4AYB B;  4ZKB B;  1U4L A;  3AFP A;  1EQV A;  2YV5 A;  4U68 A;  4A3B B;  4A3K H;  1DD2 A;  2J7Z A;  3VA5 A;  1LO5 D;  4KTA A;  1PTO H;  2DJF C;  1PVO A;  1V1O A;  1JB7 A;  4GN3 B;  4IQZ A;  1NMF A;  5FOB B;  4MIU A;  1PXU A;  4XYO A;  3LWE A;  4RHR A;  4C3J B;  3M3Y B;  3ND9 A;  1E24 A;  4LNQ A;  4DR7 Q;  2QKI C;  1CI3 M;  1CKN B;  5GQO A;  4BA2 I;  2KED A;  3CCS A;  4BY7 G;  4BXX G;  1TY0 A;  3GO5 A;  5KGU A;  3K57 A;  1SE4 A;  1HZC A;  2A1A A;  1XNQ Q;  4JI5 L;  3S1Q B;  2F3V A;  2WB1 G;  2JJQ A;  1DOL A;  1HCZ A;  2EY5 A;  4WRD A;  2EE1 A;  4A3M G;  2NTT A;  3PO2 B;  2L12 A;  1YI2 A;  4JI0 Q;  5CBA E;  2F0W A;  3V96 A;  3Q6S A;  2RCF A;  2KVM A;  4A4I A;  3I4L A;  2Q2I A;  1LT6 D;  2BA0 A;  2KEN A;  4GKK L;  4G57 A;  5CMD A;  4YY3 L;  1J5E Q;  1W2B A;  4BY7 H;  4H7B A;  2L11 A;  4LFC Q;  3KLS A;  2O4X A;  5C5L A;  1SXT A;  3MXN B;  2R92 B;  3M4O H;  1M1K C;  4GS3 A;  3NEL A;  1K8G A;  4J6H A;  3GQB A;  3RLF A;  2WAQ E;  4FXK C;  1MSG A;  4A3J B;  1PH5 A;  1BVS A;  4BBS B;  3H3V C;  1U4P A;  3S1N H;  5IGB A;  2VB3 X;  1JR0 D;  3KOJ A;  1R9T B;  2CVR A;  1WOC A;  4LF7 Q;  1DYQ A;  2LY7 A;  4R4Q A;  4I65 A;  3J7A V;  3I4O A;  4DU9 A;  4DUZ L;  1ASZ A;  4DV5 Q;  1IBM Q;  4YHH Q;  2WIN B;  1S5F D;  3S14 B;  3H0G H;  3H3V I;  2XRQ D;  2F4V Q;  1PH7 A;  2VNU D;  3WOE A;  5E1F A;  1ZXT A;  5CV7 A;  5C44 B;  5LMU L;  1T9H A;  1K8A C;  3T51 B;  4NDX A;  2RSO A;  1KRS A;  4A3F B;  1PFN A;  1JE5 A;  1VQD A;  3NQI A;  5K36 G;  3I70 A;  2EY2 A;  2F4I A;  1QZH A;  2LFN A;  5COR A;  4LWC A;  3ULL A;  4R8N A;  4WJ4 A;  1YBY A;  1JMC A;  3TN2 A;  2Y0S G;  2FIN B;  4A3K G;  2NBF A;  1I94 L;  1X55 A;  1WTQ A;  2K03 A;  1PH2 A;  1ZKO A;  1XWE A;  2E5L L;  2B2U C;  1MIU A;  4A76 A;  3E5S A;  1MGS A;  1I4Q A;  1F77 A;  2RDH A;  4FF3 A;  3J7Y W;  1D6E C;  2JP1 A;  3HKS A;  3GTG B;  4G7O C;  4DUZ Q;  2NVQ B;  4LJZ C;  2UUA Q;  3BVM A;  4KN4 C;  3I55 A;  1IL8 A;  1ICF B;  3GTM H;  1QVC A;  1E2V A;  1UEB A;  4DNI A;  4K0K L;  2LMC B;  4A3E B;  3L0O A;  4O2D A;  4G7Z C;  2IL8 A;  4CJ1 B;  4DR5 L;  3E6Z X;  5C4J H;  1N32 Q;  2CKZ B;  5NUC A;  1EY9 A;  1ESF A;  3G48 A;  4K5X A;  5HUR A;  3I4M G;  1X56 A;  2I46 A;  1TS5 A;  3I4N G;  3NEN A;  5EPL A;  4DA2 A;  1BCP F;  3ER0 A;  1UE7 A;  5C3W A;  4MTN A;  1KDA A;  4DAP A;  4L5T A;  4DR6 L;  3CXC A;  3OSO A;  3QIA A;  1F2L A;  5IWA L;  5M5W B;  1D5Z C;  1FYC A;  1K83 H;  2HHH L;  4NMZ A;  1PYS B;  3HGB A;  1EOV A;  4KHZ A;  2Y0S E;  1PTO D;  1V43 A;  4BBR B;  5C44 G;  3ULJ A;  1P16 A;  2L55 A;  1K8O A;  1VDZ A;  1EYG A;  3NWT A;  5ELD A;  1BCP B;  4KJN A;  4OO1 I;  3RZO H;  1TWG B;  3AU7 A;  3U58 A;  3OTO L;  2VS1 A;  3FRP B;  2F03 A;  1TWH B;  3K58 A;  1SYG A;  3EJI A;  3CRK C;  2EXD A;  3NTK A;  1IZ6 A;  4EX5 A;  2QCP X;  1PDQ A;  3NXW A;  2Z9H A;  2IY5 B;  2CH4 A;  5DAU A;  1X6O A;  2NVX H;  2B63 B;  1J8I A;  2QEX A;  3GTJ H;  3MVV A;  1DM0 B;  1MJC A;  1SBB B;  3KDF B;  3NTI A;  1F2Z A;  1Z9F A;  3I2Z A;  4LUV A;  4IOA A;  1K0S A;  2IX0 A;  1QUQ B;  3JC6 6;  2KA7 A;  1NAP A;  5G3L F;  5K5P A;  3S15 H;  2JEA I;  1FL0 A;  1WJJ A;  2PNH A;  2L4N A;  2JA7 B;  1EQQ A;  1ILP A;  3HRZ C;  4IJH A;  4JI2 Q;  3W3A A;  4DV3 Q;  4A93 B;  1B44 D;  2B2Y C;  3P75 A;  3ICE A;  4BY1 G;  3AMU A;  3OIQ A;  4IUP A;  4NKL A;  2O2L D;  3KF8 A;  2BE5 D;  4QB4 A;  4N9P A;  1VQ8 A;  1G2T A;  2F0P A;  4IZ8 A;  4A3L G;  3KLS X;  4IUR A;  2A8V A;  3C2P A;  1W6K A;  1B3Q A;  4X3T A;  1MHW C;  1HNW L;  4ODG A;  2PO4 A;  4DV0 Q;  3J81 L;  4LUO A;  1IBM L;  4DV1 Q;  1GD7 A;  2F0O A;  3A74 A;  1PRT D;  3GV6 A;  1WCM G;  2NUC A;  4EQP A;  5BR8 Q;  1HHV A;  2O5J C;  5KNC A;  1B8A A;  4B3S L;  2UXD L;  4AYB G;  4FXD A;  5M3F G;  3SE0 A;  2RBM A;  1CM9 A;  4JK1 C;  2RHQ B;  4A3B G;  4GN5 A;  1QOH A;  1ZYR D;  1E22 A;  3FMC A;  4GNX B;  5E3F A;  5IYB H;  2HDM A;  1QCB D;  3CW2 C;  2HHH Q;  3PO3 G;  4A3G B;  1QG7 A;  1F2M A;  1FJG L;  2F0U A;  1F2Y A;  3T1Y L;  1KAW A;  1S3O A;  4DNT B;  1IL2 A;  2CCZ A;  2B29 A;  2A69 D;  4KKU A;  3SK8 A;  1CZG A;  5ELE A;  2X6L A;  3CU7 A;  4JBW A;  5IP7 H;  5IGG A;  1BBW A;  1E1O A;  1BQQ T;  1TQO A;  1K9M C;  2RKS A;  3PUX A;  4MZ9 A;  1VQN A;  4A93 G;  4OON A;  2K6A A;  1OXX K;  3GTL B;  3GTG H;  3LNN A;  1WTP A;  2K52 A;  1PRT F;  2H5X A;  1UNS A;  1JT8 A;  2LKV A;  3S1R H;  1EZ6 A;  2KOL A;  3OMC A;  1DZ1 A;  1H9K A;  3OTO Q;  1UWV A;  1SNQ A;  5DNF A;  4DAM A;  1HNZ Q;  1X3E A;  1H9R A;  3VYR A;  1Z47 A;  2MNA A;  1A0I A;  1JJ2 A;  4KK7 A;  4Z9C B;  1BKB A;  2EJF C;  1PH9 A;  1IYJ B;  3UE1 A;  2V1C C;  3H94 A;  4QUC A;  1D1K A;  4KKT A;  3NQT A;  4DXF A;  2PMZ E;  5ELN A;  4IN3 A;  4TVA B;  1PH8 A;  5J22 A;  1TWA H;  4FNF A;  1WCM B;  1E2Z A;  1SN8 A;  4FF2 A;  4CDD C;  3DM3 A;  1TKW B;  4ZYS A;  1BDO A;  5C0X G;  1HNX Q;  3RUZ A;  5M9O A;  4C2M B;  1SMX A;  2UXB L;  3PO2 H;  2XWJ B;  4JI4 Q;  3CRL C;  5L37 A;  2EOT A;  5LMU Q;  4AH6 A;  2NWG A;  2UU9 L;  3J7A 5;  1RHP A;  5IGF A;  1VQA A;  3U4Z A;  2R3Z A;  3J80 i;  4OX9 Q;  4JI7 Q;  1LTT D;  4IFD I;  4A3D H;  3J80 c;  5IGE A;  3A7A B;  4JI4 L;  3JAM L;  2KCM A;  1IBL L;  2R93 B;  3MHB A;  1EY8 A;  4JV5 Q;  3M4O B;  2ENB A;  4L8J A;  4LF4 L;  1EU3 A;  5KND A;  3I7F A;  1X3F A;  2E5L Q;  1VQE A;  3WOF A;  1Q7Y C;  4LF8 Q;  2A6E C;  4OEL B;  4YWM A;  2XGT A;  5I9O A;  3L3O C;  1EFI D;  2OT2 A;  3VR2 A;  4DV2 L;  1WD0 A;  3KJP A;  1CSQ A;  1R4Q B;  3DEO A;  4LFB Q;  1AN8 A;  4ULL A;  3MFG A;  1VQI A;  1Q3L A;  1G2S A;  1VQ9 A;  4QGU A;  1WVL A;  4K14 A;  3A55 A;  2Z1C A;  3RLN A;  2A6H D;  2UUC L;  4DK1 A;  4DXG A;  3K5N A;  2LXJ A;  4RFB A;  1U5K A;  5I2Y A;  3GTP H;  1BXT A;  2K14 A;  3PMF A;  4IOC A;  1K3R A;  2JA8 B;  1SAP A;  4L6T B;  3K6O A;  4B3T L;  1EY0 A;  4GLV B;  1Q1E A;  5A2Q E;  2NYZ D;  1B9N A;  4PMC A;  5IOC A;  3BG3 A;  2ZJR A;  2N8N A;  4FF4 A;  2WAQ G;  1V1Q A;  4FDB A;  3KJO A;  4DNR B;  2EZV A;  2E76 C;  5C44 H;  1SND A;  4CGY B;  3GTQ H;  2HUG A;  2N3S A;  1EYA A;  2A68 D;  2NB0 A;  4LFC L;  3D4D A;  5C3E B;  1C0A A;  2O5I C;  2JA6 B;  1WD1 A;  4DUY Q;  4A3I G;  1JWM D;  1IBK L;  3QOJ A;  3EQL C;  4Y7N H;  5IYD H;  1M4V A;  2VZA A;  2A5H A;  4LF6 Q;  1HZA A;  5JJK A;  4P75 A;  1YJN A;  1Y1V G;  1A2U A;  3W2D A;  2DNC A;  4K8J A;  3URY A;  4JBM A;  4ILW A;  2WKD A;  1E0B A;  5IT9 L;  5ELF A;  4GLX A;  1B4O A;  1LAB A;  3S1M B;  4C3I G;  3CMA A;  1XMO Q;  2IJ0 A;  3BVZ A;  1DCZ A;  1RDP D;  2PQA B;  3BVG A;  5LL6 X;  2OEO A;  2EPB A;  2KQ3 A;  4BBR H;  3GTK B;  3ND8 A;  2Z6K A;  4HIM A;  1ESR A;  1OO9 B;  2D0O A;  3HOY B;  1LUZ A;  1STB A;  1KLG D;  2KCN A;  1B1Z A;  2HQL A;  3R3O A;  4JI8 L;  2BDO A;  1KQS A;  4DV7 Q;  1CA6 A;  1EIH A;  1YNN C;  3CPF A;  4K6L A;  4UAI A;  4OWX B;  1YNJ D;  5CGK A;  3TP8 A;  4RCN A;  3CQZ B;  1Q82 C;  1K83 B;  4L5R C;  3EBE A;  3I4N B;  5ISR A;  3OWF A;  1A8V A;  3K0X A;  3RD4 A;  4U67 3;  2K50 A;  2XVS A;  4FVM A;  3PSI A;  2B3G A;  3J80 L;  1BBX C;  1EWI A;  4ZCK A;  1VF5 C;  2F0F A;  4KHP Q;  3V05 A;  3MFY A;  3MXP A;  4X3K A;  1CHQ D;  3H6M A;  1RD9 D;  4CBV A;  4DV6 Q;  3OW7 A;  1SYE A;  1VMP A;  2ATW A;  3M3Y H;  4YWL A;  1C8C A;  4PZ8 A;  3BZK A;  5C4J B;  4FYD A;  4H44 C;  1XPU A;  1IW7 C;  4OL7 A;  1PH1 A;  3RMH A;  4X64 Q;  2UXC L;  4RKL A;  3EVQ A;  2AHO B;  5C4H A;  2B2T A;  3DLL A;  5EAY A;  4POG A;  3E9I A;  1PH6 A;  1AFP A;  1WYD A;  4HJA A;  4OO1 G;  2KHS A;  1LT5 D;  4R4C A;  4R4T A;  3HOV B;  1KC8 C;  1SYB A;  3PO3 H;  2RA4 A;  2CQO A;  5EGT A;  5IP9 H;  3KUP A;  1HQM C;  3PCO B;  3I56 A;  2E2I B;  3IL8 A;  4DK0 A;  1ENC A;  2K33 A;  2JA7 G;  4DV6 L;  1VS0 A;  1NUC A;  2HCI A;  1MSH A;  4YIJ A;  1PV4 A;  5DLQ E;  1CK1 A;  2UUA L;  5M5X B;  4GN4 B;  2OQK A;  4LF9 L;  4PZ7 A;  3TS0 A;  1AZP A;  1Y1W H;  1I50 H;  4KI0 A;  1HTP A;  1Y14 B;  4E6I A;  5ELB A;  5IYC G;  4F8M A;  1GUG A;  4DK3 C;  2B63 H;  2BH2 A;  1NJI C;  4XDX A;  2NVX B;  1XNR Q;  3IFD A;  1ICW A;  1KL9 A;  1UE6 A;  2B39 A;  2JE6 I;  4LF8 L;  4PZ6 A;  2HCC A;  1SFO H;  3FKI G;  5JPM C;  3AQQ A;  2XN9 C;  3A8J E;  5C0X I;  4JBK A;  1PH4 A;  1GUO A;  3Q23 A;  5FLX E;  2Z0S A;  2E75 C;  4A3E H;  3TP6 A;  4DV1 L;  1XPO A;  2R92 H;  4RAU C;  3FHW A;  4MTK A;  2H4O A;  1WTO A;  4PMB A;  5HGT A;  3OMG A;  2VW9 A;  4BBS H;  3BYT B;  3A8I E;  1QUQ A;  1TWC H;  2WB1 E;  1YIT A;  1NSN S;  5CV6 A;  5JVH 3;  3O13 A;  5DM7 3;  3HKZ E;  1VMC A;  2PQE A;  3IFT A;  2D5D A;  2R61 A;  3HOV G;  1Q46 A;  1J9O A;  4ZUI A;  4JYA L;  3EA6 A;  2B2T C;  3BZD B;  3CCV A;  3CCU A;  5EKI A;  2XNA C;  1SMY D;  1Y1V H;  3PIP A;  3J7A F;  1EL0 A;  4KD3 A;  3DEP A;  1XYI A;  5GAE C;  2WP8 J;  1HR0 W;  4CDE C;  1DON A;  3LGJ A;  4X3U A;  1QJO A;  4C2M H;  1BNZ A;  3CCR A;  5IYD G;  1GUT A;  1KAA A;  4ME5 A;  1B9M A;  2OXP A;  2UUB L;  3I3C A;  1UE5 A;  3T56 B;  1YIJ A;  5F2D A;  5BN5 A;  1EEI D;  1I6V C;  2G9H D;  4GKJ Q;  3I4M B;  1T5E A;  3KBG A;  1XMQ L;  1C7Y A;  2MO0 A;  1PYB A;  1EU4 A;  1TXY A;  4XQJ A;  1EIF A;  5JJZ A;  1XX8 A;  5LMN W;  1ROD A;  4LF6 L;  2RSN A;  1QVG A;  1KTK A;  1CZW A;  4P71 A;  5JEA H;  2BDN A;  2IX3 A;  4ZQ3 A;  2K04 A;  5M3M G;  4DR3 Q;  4DK6 C;  3K5L A;  2OTL A;  5IY0 A;  1SEB D;  1SJE D;  4HED A;  1F9P A;  4A3F G;  5ELO A;  4JI1 Q;  2K1B A;  3R8B A;  5KNB A;  1B2T A;  1I3Q H;  1HRJ A;  3Q22 A;  1JOO A;  4DUY L;  1I4X A;  1T5X D;  3BU2 A;  4GNX C;  2AUJ D;  3BDC A;  3T13 A;  2B2W A;  4BA1 I;  2K4K A;  5GRO A;  4HSV A;  3HOU B;  4TRD A;  4X6A H;  3E3X A;  4XTC S;  1K73 C;  1TY2 A;  5JVG 3;  2ZJP A;  4HCE A;  3TBI B;  2F0I A;  2JA6 G;  3U50 C;  5IIF A;  2KUM A;  4HJ8 A;  3I91 A;  1GUW A;  5M5W H;  1KIX A;  1Q8K A;  4RGT A;  2C5C A;  5T1I A;  3VR3 A;  4F87 A;  2EJM A;  4S3S A;  3E0J A;  4POF A;  1X65 A;  4UHV A;  1D1I A;  4N8F A;  4A3E G;  1VQ4 A;  2E2J B;  3HOV H;  4B08 A;  3VYU A;  1XNQ L;  1CT1 D;  4HR7 B;  5E4W C;  5IP9 G;  3OOC A;  3RN2 A;  2JEB I;  3J81 c;  1VQ6 A;  3HEJ A;  3M4P A;  3W1G A;  2C35 B;  1H9M A;  1AEX A;  1SYC A;  4IUV A;  4C3H G;  3SVM A;  3U9S A;  4OO1 H;  4APV A;  1O80 A;  3CKI B;  5D14 A;  5C3E H;  2J4X A;  1B3A A;  2JA6 H;  2JA8 H;  1PTO F;  2KEC A;  4RG1 A;  1FD7 D;  1L0W A;  1JJG A;  5M5X H;  3HOY G;  2I5H A;  3G6J B;  4B3S Q;  2UXD Q;  4Y7N B;  2Z4I A;  3PIO 3;  3QG1 A;  2OTJ A;  3A7L A;  1XNR L;  2EYJ A;  2RHS B;  5IT9 E;  3GTO H;  2V4D A;  2JA9 A;  5EQ0 A;  3HOX G;  3WWV A;  1HR0 Q;  3RN5 A;  1EWC A;  3DXJ C;  3H0G B;  2XRS D;  5DEH A;  3F2B A;  1F9R A;  4DV5 L;  1EYD A;  2MJ8 A;  2PNR C;  5EKK A;  3T1H Q;  1X3Q A;  3S2D H;  3SK5 A;  4YY3 Q;  3D31 A;  3DWQ A;  4NXM L;  1KDC A;  3UDI A;  1L0X B;  2DN8 A;  1S5B D;  3F2D A;  1GHK A;  1I4H A;  5G3L D;  2DUD A;  4KHV A;  4DV7 L;  2YYZ A;  2EYL A;  2XWB B;  2F0T A;  4LUZ A;  1NY4 A;  2DY7 A;  2Q2H A;  3QO2 A;  2AUK A;  2K5D A;  3CD6 A;  2MHV A;  1NBW A;  2C9O A;  2GN5 A;  1DXM A;  3CQZ H;  4GOP A;  3CC2 A;  2D9U A;  5A35 A;  1JQY D;  2F52 A;  1PRT C;  2YU9 H;  2CHB D;  1PA6 A;  4BWG B;  5C3X A;  3HOW G;  3TDQ A;  2WAC A;  1N36 Q;  1L0Y B;  3MEF A;  4YCV A;  1MBY A;  2MUY A;  1MD2 D;  1WI5 A;  3MWY W;  2VY3 A;  1HQR D;  3LWU A;  4RGN A;  2UUB Q;  1LTA D;  2PW5 A;  1EFW A;  4HID A;  1HH2 P;  3AFQ A;  1L1O A;  3R93 A;  1TS2 A;  4DR6 Q;  5FK9 C;  1I6H H;  4J8Q A;  1LTS D;  5EJW A;  2JK8 A;  3H3V H;  1BBU A;  4UP7 A;  3GDE A;  1S5E D;  2P5Z X;  2E2D C;  4ZK9 B;  2VUM G;  1HA5 A;  2BOS A;  4O0A A;  2VB2 X;  2A19 A;  1SLJ A;  3ITP A;  4C1N K;  5JPN C;  3SK4 A;  1K0R A;  3KFU A;  2K32 A;  2MP1 A;  2AWO A;  4AYB E;  2F1M A;  1MJE A;  2ZTE A;  5C4Z A;  4JBJ A;  5M3F B;  3NBI A;  2SOB A;  1O78 A;  5IWA Q;  1Q90 A;  2QIL A;  2NZH A;  4OXP A;  4HIO A;  5FO7 B;  4QQB X;  1A3U A;  2X6G A;  3HKZ B;  1TWG H;  1JCK B;  1PFS A;  3CHB D;  4NB3 A;  5BR8 L;  3PO3 B;  1JWU D;  4B9X A;  2CWA A;  2Z6K C;  3ULP A;  5M5Y H;  4HJ9 A;  1STN A;  1QIL A;  2G5D A;  3HOY H;  2F0E A;  4UDU C;  1ENA A;  3HS0 C;  1S72 A;  3GTP B;  2QF7 A;  1WTH A;  1KXL A;  2I0Q A;  5KYL A;  3CP0 A;  4P73 A;  3GTJ B;  3KK7 A;  1LM0 A;  4I7A A;  5EBD A;  3D8G A;  1GVP A;  1OTC A;  2L1B A;  4X66 Q;  3M9B A;  4JC0 A;  1G8Z D;  4RMF A;  1HR0 L;  3L2P A;  2R7Z G;  2F0M A;  1HZB A;  3EN2 A;  2UU9 Q;  4JI2 L;  1F9S A;  3D6W A;  4L5S A;  4R8I A;  1BUV T;  2Q8I B;  4WFN 3;  2Z8L A;  4HSP A;  4JOI A;  5CV5 A;  3OIP A;  4LF7 L;  4NXN Q;  1VQB A;  3MXU A;  4OIK A;  1N9W A;  1S4Z A;  2JA8 G;  4IJL A;  3C3L A;  1II3 A;  4C3I H;  3GD7 A;  1N8R C;  1HJP A;  1SNO A;  1Y8O B;  1XMO L;  3VDY A;  1YHQ A;  1J5E L;  1VQ7 A;  4PQX A;  1PFM A;  4GOP C;  5LMN Q;  3M4Q A;  5JAV A;  3CCE A;  1UUP A;  2F0L A;  1RJT A;  1CQF A;  1OXU A;  3BZC A;  1MKH A;  2ES2 A;  4L63 B;  2SNS A;  2XTI A;  1TS3 A;  4JI0 L;  1VQ5 A;  1S5D D;  4UPA A;  3J80 E;  4C3J G;  1IYV A;  1RTO A;  1JIC A;  3HOZ H;  4C56 C;  3FKI B;  4A3I B;  2K01 A;  1R4P B;  2K05 A;  2F0N A;  5TSS A;  5JEA G;  4J1M A;  1BCP C;  2A6H C;  1G6Z A;  1XMQ Q;  3GTQ B;  4HCS A;  1B50 A;  3TSS A;  2VQF Q;  4M8A A;  1FJG Q;  3PV0 A;  3TQY A;  4ABN A;  3A5U A;  3MZ5 A;  1PYW D;  4AQY Q;  4B3M Q;  3U4V A;  5IYC H;  3QR8 A;  4XQQ A;  1S5C D;  1BF4 A;  1K3B C;  3K5O A;  2K5N A;  1CQV A;  4WJW A;  4GKJ L;  2K5V A;  5CYU A;  3FP9 A;  4XT1 B;  4ZRZ A;  5I9P A;  3S2H B;  1SE2 A;  1BO0 A;  5K36 H;  1ET6 A;  3RNU A;  5KIX A;  1K8M A;  1IKM A;  3SXH A;  2PI2 E;  4B9W A;  2DJG C;  3D0F A;  1FNU A;  1YNJ C;  3S1M H;  1F9Q A;  4NXM Q;  3NP8 A;  3G6E A;  1P8L A;  3ONA B;  2TSS A;  3UE0 A;  4Y52 H;  2JA5 H;  2XIW A;  3S17 H;  2LS0 1;  1VQJ A;  2E8G A;  4BBS G;  1H9J A;  4BY1 B;  3RLO A;  4F88 A;  4IFD G;  2G9D A;  4UY8 C;  1FR3 A;  2ZM6 L;  1SRU A;  1SE3 A;  5M3M H;  3OHX C;  2JA5 G;  2KJX A;  3E0E A;  2RQX A;  4XIG S;  1HUN A;  3KBX A;  3VR5 A;  4EVO A;  1G6P A;  1O7Z A;  1D5X C;  5CV8 A;  3H09 A;  3CCL A;  1LTL A;  1EY4 A;  2HQE A;  2ICE C;  3DWA A;  3FDT A;  3JAM c;  4JI8 Q;  3BYY B;  5M3F H;  4AQY L;  2E2I H;  2CWP A;  2K5H A;  1CTM A;  3DUZ A;  2SNM A;  3EIV A;  1JWS D;  1A3V A;  1PTO B;  3K81 C;  2ZXR A;  5J39 A;  1CUK A;  1GUN A;  4IPG A;  4V19 0;  4IUQ A;  3HOU H;  4A3D B;  2XSC A;  3H0G G;  2PI2 A;  4C3J H;  1LV9 A;  4JI7 L;  2K5W A;  4XT3 B;  3I4M H;  2R93 H;  5C4X H;  1V1P A;  2K7V A;  2F0J A;  3RZD B;  4MNO A;  5I6Y A;  1RTN A;  3L9A X;  3M7N A;  4KMU C;  3CC7 A;  4DF7 A;  4JI3 Q;  1JB3 A;  1E3P A;  4YWK A;  4UP9 A;  2M00 A;  4F7X A;  4A3G G;  1E1T A;  1EEF D;  1C48 A;  1I4P A;  1DOM A;  3TZU A;  1M90 C;  4P74 A;  1VF7 A;  2EQS A;  4G4K A;  3G71 A;  1SR3 A;  1LTR D;  1C4Q A;  3STB D;  1SRO A;  5BN3 A;  3FPU B;  1QNU A;  3P20 A;  3TP7 A;  5CC4 A;  1H9S A;  3PF4 A;  4DR2 Q;  1GOZ A;  4LFB L;  2ZTC A;  4J15 A;  1YJ9 A;  4B3M L;  2VQE Q;  3QJY A;  3QOL A;  1VQM A;  1G29 1;  5JEA J;  1EY6 A;  3KLR A;  1X9N A;  1RKN A;  1QZG A;  2VQF L;  4RHS A;  3J81 j;  1J6Q A;  2EYO A;  1BOS A;  1ONL A;  2EYF A;  1A2T A;  2RVL A;  5FJ8 G;  1Q12 A;  1EUJ A;  1Y1W B;  1UAP A;  2B2U A;  1EZ8 A;  3KF8 B;  3C46 A;  1KAB A;  1WTV A;  2E2H H;  3HP3 A;  2EYM A;  5FKA C;  3H91 A;  5A2Q L;  4DR7 L;  2M9V A;  5COY A;  4MN3 A;  1N36 L;  4HMI A;  4R9W A;  5FJ8 H;  3UDG A;  1AW7 A;  1SFO B;  3KYH C;  1STA A;  2ZT9 C;  2F0K A;  4P72 A;  1Y69 U;  2B2Y A;  1I4R A;  4O1N A;  2B8F A;  3DMU A;  1ET9 A;  4DKA C;  4RCO A;  1PZJ D;  3TS2 A;  1I50 B;  4QY7 A;  1B70 B;  4OGQ C;  2SEB D;  4DR2 L;  3AEV A;  3A54 A;  1SMY C;  3PUZ A;  1HNX L;  2NVT B;  3K0Y A;  3D6C A;  3IAY A;  3F2U A;  2N78 A;  4HJ5 A;  5C3E G;  1TS4 A;  2NN6 I;  3B6Y A;  5CBE E;  3JAM i;  2YU9 B;  3BDO A;  2IT1 A;  2PW7 A;  1WFQ A;  2R93 G;  2MGS A;  1AP0 A;  4M1U B;  1V8Q A;  3M85 A;  3GP7 A;  3L7Z C;  4ZUJ A;  3ERQ A;  1X54 A;  1H95 A;  2R7F A;  2YTV A;  1U4M A;  1VQL A;  1U9R A;  4X66 L;  2WB1 B;  3H15 A;  2YTY A;  4QUF A;  4QMG A;  4KV6 A;  4B3R L;  1TWF B;  3HOW B;  2F0Q A;  3HOX H;  3VA7 A;  1NE3 A;  4LW1 A;  2KCC A;  5EKL A;  2LXK A;  4QJF A;  1LTG D;  4PNY A;  4KLK A;  2JXM B;  2K75 A;  3P1H A;  2NVY B;  3U9O A;  4CKE A;  3PF5 A;  1FVI A;  2EY1 A;  3UI2 A;  2ALY B;  3TZD A;  1TWC B;  1Z7T A;  3PGZ A;  2EJG C;  1MI2 A;  5LHY 1;  1NR2 A;  5IOD A;  4RH6 A;  2X69 A;  3LX0 A;  2NTS A;  3PIP 3;  2MQH A;  1TR5 A;  3S16 H;  1TT2 A;  5KEE A;  4JI6 L;  1HNZ L;  2N88 A;  4A3B H;  3OW2 A;  4IPD A;  4ZLT F;  3FVQ A;  1A6X A;  3NUC A;  3K7A B;  3ZYY X;  4EQN A;  4DFA A;  3NBH A;  5IGD A;  2I07 B;  1NNX A;  2BCO A;  4Q5V A;  3I90 A;  4B3T Q;  1NTG A;  1X32 A;  2MO1 A;  4JI1 L;  4JI3 L;  5M5Y B;  3K59 A;  4QIW B;  4NP5 A;  4Q0F A;  1RIP A;  1KNA A;  2ZXP A;  2EIF A;  3W1B A;  3EFX D;  3HOU G;  2PPB C;  2A68 C;  1ASY A;  3HKZ G;  1D8L A;  1DJR D;  4UP8 A;  2JSO A;  1D7Q A;  1GXD C;  3F1Z A;  2R7D A;  3MAQ A;  3E9H A;  2B2W C;  1O7I A;  1PTO C;  1SNM A;  4GOP B;  3SDZ A;  3T16 A;  1B53 A;  2MFI A;  4K2L A;  2L0C A;  4X64 L;  4DV2 Q;  2ZXO A;  2QW7 A;  2A74 C;  4DR1 L;  1FGU A;  3PQI A;  3T4A C;  2VQE L;  5C0X H;  1EIG A;  4LAA A;  3UDF A;  3GTO B;  4A3J H;  1STY A;  2N49 A;  1NR4 A;  3I8Z A;  1ZEQ X;  4CKB A;  1U4R A;  3PIO A;  2TMP A;  1L1O B;  4A3M B;  1I3Q B;  2L9H A;  2NZO A;  3VR4 A;  3SHL A;  4DR1 Q;  4A3K B;  4LF4 Q;  2AKW B;  1JE4 A;  3UDX A;  4XQN A;  3CC4 A;  1FGB D;  4LK1 C;  2E2J H;  4KY5 A;  5IE8 A;  2R7Z B;  3MXN A;  3HOZ B;  4IPH A;  3VYT A;  3SR1 A;  1CFM A;  2WFW A;  4DV0 L;  2ZJQ A;  1HUM A;  3NSW A;  3TP5 A;  3BDL A;  5FLM H;  1E2W A;  1AE2 A;  3IRB A;  5ELC A;  1QVF A;  1U0L A;  2KEE A;  1LAC A;  3D4W A;  1LYL A;  3T1H L;  4QL5 A;  3R2T A;  1PH3 A;  1YHA A;  2CQA A;  5I4D A;  3PUW A;  3C1F A;  5D3I B;  4I7Z C;  4WOR A;  4HJ7 A;  4DAY B;  1GKH A;  4GLA C;  2IHE A;  1TVX A;  2N55 A;  4CDC C;  4P2C B;  4BXX H;  2OCE A;  1SYD A;  2NVQ H;  1RCV D;  1HFN A;  5FLX L;  3OPO A;  1UEA B;  2FFK B;  1QE6 A;  4A3F H;  4JOI C;  5DM6 3;  3D3R A;  4O42 A;  4C1N I;  5IT9 c;  4WJ3 M;  3AYH B;  2HT1 A;  4K8I A;  1ML0 D;  3GV3 A;  4RGO S;  5IGC A;  3PUV A;  3X3M A;  1EQT A;  3MC0 B;  4K2K A;  3A0J A;  5I2X A;  1D5M C;  1EOT A;  3S9W A;  1IW7 D;  1O7Y A;  1CKO A;  1CKN A;  5EPK A;  3X3N A;  1GM5 A;  3SK6 A;  1W6J A;  1YNX A;  2RF4 A;  3AB9 A;  3MEH A;  5KYI A;  3P7J A;  4IPC A;  4DV4 Q;  4RWS C;  4EQO A;  4X65 Q;  4HN7 A;  2GVB A;  4MHE A;  1G51 A;  4ZKC B;  2KCT A;  1VQC A;  3I72 A;  2NN6 H;  3CCQ A;  3S14 H;  1I4G A;  4A3I H;  1X3P A;  3OWE B;  1PFB A;  1A3T A;  3RZO B;  3J81 E;  3IKJ A;  1NMG A;  3STB C;  2D0P A;  1GHJ A;  1GO3 E;  4KD4 A;  4C3H H;  4K5W A;  5BN4 A;  4JI6 Q;  2HD3 A;  1CA5 A;  3CPW A;  1A62 A;  2B2V C;  2PZW A;  4FP5 D;  3RZD H;  4AIM A;  2AQ1 B;  1ILQ A;  4FXG C;  1KD1 C;  5GAH C;  3S16 B;  4XYQ A;  4K0K Q;  1EY7 A;  1VQO A;  5JOB A;  1XTD A;  1QWY A;  2F0G A;  3S2H H;  1KDB A;  2EY6 A;  5CV4 A;  4DGZ A;  4EGV A;  1IBL Q;  3NEM A;  1QB5 D;  2OWO A;  1Y1W G;  4DAY A;  4JI5 Q;  1DOK A;  2CFM A;  5IP7 G;  3JAM E;  2JQO A;  4OX9 L;  2JA7 H;  4R4I A;  1I6H B;  3Q24 A;  5LMN L;  2WKC A;  3G4S A;  1VQH A;  2HIX A;  5AJ3 Q;  2JN4 A;  4R1J A;  1CSP A;  4X3S A;  4OIJ A;  4IUU A;  2HDL A;  4CDF C;  1PMR A;  1N33 Q;  2L5T A;  5C5M A;  3N52 A;  2H1E A;  4H0L C;  4DV3 L;  1CKM A;  2MPM A;  5J3B A;  2ASB A;  5CV9 A;  2F3W A;  2J0T D;  3MA2 B;  2A73 B;  3NE5 B;  3CME A;  3QB3 A;  4QIW E; 
#chains in the Genus database with same CATH homology
 5KRU A;  2PMZ B;  3NK9 A;  5I6W A;  2PCF B;  2EVB A;  4KJO A;  3MXG A;  4KN7 C;  1GJX A;  2E2H B;  3MTS A;  1HPC A;  5AFW A;  1STE A;  3A8K E;  1JOQ A;  4QF4 A;  5EBC A;  5FO8 B;  5D65 A;  4DN4 M;  1WTX A;  1EY5 A;  5C0X J;  2E74 C;  2A6E D;  2RDF A;  2K28 A;  2WII B;  2SDF A;  3R2I A;  5T1G A;  3HG9 A;  1JOK A;  1KNE A;  2VXW A;  4HMJ A;  4CHT B;  2F0H A;  4DAV A;  3BS1 A;  2BE5 C;  3VYS A;  3FEW X;  2FHT A;  4BY7 B;  3S15 B;  3S2D B;  3NTH A;  5LL6 S;  3QWN A;  4G7H C;  1V1P B;  1HA6 A;  3ERO A;  1GUS A;  1LT4 D;  3HOX B;  1Z6H A;  3M7G A;  2QDB A;  4IFD H;  1OXS C;  1IYU A;  3NHH A;  1EYC A;  4RKB A;  1LTI D;  1PRT B;  1SDF A;  4TQU S;  2OF1 A;  5EPJ A;  1HXY D;  4RA8 A;  2D62 A;  2Q8R E;  2AWN A;  2CW0 D;  1A15 A;  4KY7 A;  2IWH A;  3VR6 A;  1XXG A;  1SNP A;  2CW0 C;  2RDG A;  1PZK D;  2PZU A;  2EDG A;  1O7L A;  4TSS A;  5D3D A;  3N6R A;  1PZI D;  2NN6 G;  2D2C C;  1D2B A;  1STH A;  2PYK A;  3FPP A;  5C4X B;  2JA5 B;  3SEB A;  4PV1 C;  4GZY C;  3T53 B;  4C3H B;  2FJ2 A;  1TWA B;  1FNV A;  2PZT A;  2Z4H A;  2FMC A;  4N9T A;  2ICI A;  2IW3 A;  5CR3 A;  3Q0A A;  2B8G A;  4HAE A;  1KLU D;  1RF2 D;  4CJ0 B;  1YNN D;  4QCL A;  1PLF A;  1HFG A;  3S17 B;  2WAQ B;  2F0V A;  4IUT A;  3G7L A;  4ZAI A;  1OXV A;  1NCV A;  2Y0S B;  2F0S A;  2AQ3 B;  1ENF A;  4V0B A;  3K5M A;  4LMQ D;  5FO9 B;  1STG A;  1LT3 D;  2R6G A;  4FO2 A;  2AQ2 B;  2NZ1 D;  3NPP A;  3DWP A;  4HTH A;  4ID6 A;  4IUN A;  1Y8N B;  1H9S B;  2BA1 A;  4CKC A;  1EWH A;  4OHJ A;  2ID0 A;  4TKO B;  3NWS A;  3V2T A;  2JYO A;  4FF1 A;  1Q1B A;  2QEJ C;  1ZYR C;  4C3I B;  1AZQ A;  1IKL A;  4BS9 A;  4IAL A;  1G91 A;  3S1N B;  2EXZ A;  1SNC A;  3DM1 A;  2M2L A;  2VUM B;  2A69 C;  2F0D A;  2GA4 B;  2Q8T A;  3TME A;  1BCP D;  2IX1 A;  1TII D;  1Y8P B;  1SJH D;  4KY6 A;  1CHP D;  1M8A A;  1FNW A;  1WTR A;  1QNK A;  3WDN A;  1LLR D;  4K5V A;  1IHZ A;  3DHQ A;  1SSO A;  2K5Q A;  1SYF A;  3A56 A;  4PMW A;  1VCI A;  2EYH A;  1LTB D;  2B2V A;  2DNE A;  1XTC D;  1TU2 B;  3HZX A;  4IFD J;  3C1E A;  1Y1V B;  2DY8 A;  4NW2 A;  4KKS A;  2EYP A;  4XXE A;  3GTM B;  1HTL D;  4CJ2 C;  5E4X A;  1Q8I A;  2FMM A;  2WV6 D;  3S1R B;  4RGM A;  2IPK D;  5C6A A;  1BR9 A;  3M4Y A;  1JC7 A;  5M3M B;  3D4R A;  4K6D A;  4H13 C;  1OXT A;  1WTW A;  3PUY A;  3I73 A;  1JOR A;  5J1Z A;  4AYB B;  4ZKB B;  1U4L A;  1EQV A;  4U68 A;  1DD2 A;  4A3B B;  2J7Z A;  3VA5 A;  1LO5 D;  4KTA A;  1PTO H;  1V1O A;  4IQZ A;  5FOB B;  1PXU A;  4MIU A;  4XYO A;  3LWE A;  4RHR A;  4C3J B;  3M3Y B;  3ND9 A;  2QKI C;  1CI3 M;  4BA2 I;  2KED A;  1TY0 A;  3GO5 A;  5KGU A;  3K57 A;  1SE4 A;  3S1Q B;  2F3V A;  1DOL A;  1HCZ A;  2EY5 A;  4WRD A;  2EE1 A;  2NTT A;  3PO2 B;  2L12 A;  5CBA E;  2F0W A;  3V96 A;  3Q6S A;  2KVM A;  3I4L A;  1LT6 D;  2BA0 A;  4G57 A;  5CMD A;  4H7B A;  2L11 A;  3KLS A;  2O4X A;  5C5L A;  1SXT A;  2R92 B;  4J6H A;  3GQB A;  3RLF A;  4FXK C;  1MSG A;  4A3J B;  4BBS B;  3H3V C;  1U4P A;  5IGB A;  2VB3 X;  1JR0 D;  1R9T B;  2CVR A;  1DYQ A;  2LY7 A;  4I65 A;  3J7A V;  4DU9 A;  2WIN B;  1S5F D;  3S14 B;  2XRQ D;  2VNU D;  3WOE A;  5E1F A;  1ZXT A;  5CV7 A;  5C44 B;  3T51 B;  4NDX A;  2RSO A;  4A3F B;  1PFN A;  5K36 G;  3NQI A;  3I70 A;  2EY2 A;  2F4I A;  2LFN A;  5COR A;  4R8N A;  3TN2 A;  2FIN B;  2NBF A;  1WTQ A;  2K03 A;  1ZKO A;  1XWE A;  2B2U C;  3E5S A;  1MGS A;  1I4Q A;  1F77 A;  2RDH A;  4FF3 A;  3J7Y W;  1D6E C;  2JP1 A;  3GTG B;  4G7O C;  2NVQ B;  4LJZ C;  3BVM A;  4KN4 C;  1IL8 A;  1E2V A;  2LMC B;  4A3E B;  4G7Z C;  2IL8 A;  4CJ1 B;  3E6Z X;  5NUC A;  1EY9 A;  1ESF A;  4K5X A;  5HUR A;  2I46 A;  1TS5 A;  5EPL A;  4DA2 A;  1BCP F;  5C3W A;  1KDA A;  4DAP A;  3OSO A;  3QIA A;  1F2L A;  5M5W B;  1D5Z C;  1FYC A;  4NMZ A;  3HGB A;  4KHZ A;  4BBR B;  1PTO D;  1V43 A;  1K8O A;  2L55 A;  1VDZ A;  3NWT A;  5ELD A;  1BCP B;  4KJN A;  4OO1 I;  1TWG B;  3AU7 A;  3FRP B;  2F03 A;  1TWH B;  3K58 A;  1SYG A;  3EJI A;  3CRK C;  3NTK A;  2QCP X;  1PDQ A;  3NXW A;  5DAU A;  2B63 B;  1J8I A;  3MVV A;  1DM0 B;  1SBB B;  3NTI A;  1F2Z A;  2IX0 A;  2KA7 A;  1NAP A;  5G3L F;  5K5P A;  2JEA I;  2L4N A;  2JA7 B;  1ILP A;  3HRZ C;  3W3A A;  4A93 B;  1B44 D;  2B2Y C;  3P75 A;  3AMU A;  3OIQ A;  4IUP A;  4NKL A;  2O2L D;  3KF8 A;  2BE5 D;  4QB4 A;  4N9P A;  1G2T A;  2F0P A;  4IZ8 A;  3KLS X;  4IUR A;  3C2P A;  1W6K A;  4X3T A;  4ODG A;  2PO4 A;  3J81 L;  2F0O A;  1PRT D;  3GV6 A;  4EQP A;  2NUC A;  1HHV A;  2O5J C;  5KNC A;  4FXD A;  3SE0 A;  2RBM A;  1CM9 A;  4JK1 C;  1QOH A;  1ZYR D;  3FMC A;  5E3F A;  2HDM A;  1QCB D;  4A3G B;  1QG7 A;  1F2M A;  2F0U A;  1F2Y A;  4DNT B;  2A69 D;  4KKU A;  3SK8 A;  1CZG A;  5ELE A;  2X6L A;  3CU7 A;  4JBW A;  5IGG A;  1BQQ T;  1TQO A;  2RKS A;  3PUX A;  2K6A A;  1OXX K;  3GTL B;  3LNN A;  1WTP A;  1PRT F;  1UNS A;  2LKV A;  1EZ6 A;  2KOL A;  3OMC A;  1DZ1 A;  1H9K A;  1SNQ A;  5DNF A;  1H9R A;  3VYR A;  1Z47 A;  4KK7 A;  4Z9C B;  2EJF C;  3H94 A;  4QUC A;  1D1K A;  4KKT A;  3NQT A;  4DXF A;  4IN3 A;  5J22 A;  4FNF A;  1WCM B;  1E2Z A;  4FF2 A;  4ZYS A;  1TKW B;  5C0X G;  1BDO A;  3RUZ A;  5M9O A;  4C2M B;  2XWJ B;  3CRL C;  2EOT A;  2NWG A;  1RHP A;  5IGF A;  2R3Z A;  1LTT D;  4IFD I;  5IGE A;  3A7A B;  3JAM L;  2R93 B;  3MHB A;  1EY8 A;  3M4O B;  2ENB A;  4L8J A;  1EU3 A;  5KND A;  3WOF A;  2A6E C;  5I9O A;  3L3O C;  1EFI D;  2OT2 A;  3VR2 A;  1WD0 A;  1R4Q B;  3DEO A;  1AN8 A;  4ULL A;  3MFG A;  1Q3L A;  1G2S A;  1WVL A;  4K14 A;  3A55 A;  2Z1C A;  2A6H D;  4DK1 A;  4DXG A;  3K5N A;  4RFB A;  5I2Y A;  1BXT A;  3PMF A;  2JA8 B;  1SAP A;  4L6T B;  3K6O A;  1EY0 A;  1Q1E A;  5A2Q E;  2NYZ D;  1B9N A;  4PMC A;  5IOC A;  3BG3 A;  4FF4 A;  4DNR B;  2EZV A;  2E76 C;  1SND A;  4CGY B;  2HUG A;  1EYA A;  2A68 D;  2NB0 A;  3D4D A;  5C3E B;  2O5I C;  2JA6 B;  1WD1 A;  1JWM D;  3QOJ A;  3EQL C;  1M4V A;  2A5H A;  1A2U A;  3W2D A;  2DNC A;  4K8J A;  3URY A;  4ILW A;  2WKD A;  1E0B A;  5IT9 L;  5ELF A;  1B4O A;  1LAB A;  3S1M B;  4C3I G;  2IJ0 A;  3BVZ A;  1DCZ A;  1RDP D;  3BVG A;  5LL6 X;  2OEO A;  2EPB A;  2KQ3 A;  3GTK B;  3ND8 A;  1ESR A;  1OO9 B;  3HOY B;  1STB A;  1KLG D;  2KCN A;  1B1Z A;  3R3O A;  2BDO A;  1CA6 A;  1EIH A;  1YNN C;  4K6L A;  4UAI A;  1YNJ D;  5CGK A;  3TP8 A;  4RCN A;  3CQZ B;  1K83 B;  3I4N B;  5ISR A;  3OWF A;  3RD4 A;  4U67 3;  2XVS A;  4FVM A;  3J80 L;  1BBX C;  1VF5 C;  2F0F A;  3V05 A;  3MFY A;  3MXP A;  4X3K A;  1CHQ D;  3H6M A;  1RD9 D;  4CBV A;  3OW7 A;  1SYE A;  1VMP A;  1C8C A;  5C4J B;  4FYD A;  4H44 C;  1IW7 C;  4OL7 A;  3RMH A;  4RKL A;  3EVQ A;  5C4H A;  2B2T A;  1AFP A;  4OO1 G;  2KHS A;  1LT5 D;  3HOV B;  1SYB A;  2RA4 A;  5EGT A;  3KUP A;  1HQM C;  2E2I B;  3IL8 A;  4DK0 A;  1ENC A;  2K33 A;  1NUC A;  2HCI A;  1MSH A;  4YIJ A;  1CK1 A;  5M5X B;  1AZP A;  4KI0 A;  1HTP A;  4E6I A;  5ELB A;  4F8M A;  1GUG A;  2NVX B;  4XDX A;  3IFD A;  1ICW A;  2B39 A;  2JE6 I;  2HCC A;  5JPM C;  2XN9 C;  3A8J E;  5C0X I;  1GUO A;  3Q23 A;  5FLX E;  2E75 C;  3TP6 A;  4RAU C;  2H4O A;  1WTO A;  4PMB A;  5HGT A;  3OMG A;  3BYT B;  3A8I E;  1NSN S;  5CV6 A;  5JVH 3;  3O13 A;  5DM7 3;  1VMC A;  2PQE A;  3IFT A;  2D5D A;  2R61 A;  4ZUI A;  1J9O A;  3EA6 A;  2B2T C;  3BZD B;  5EKI A;  2XNA C;  1SMY D;  3J7A F;  1EL0 A;  4KD3 A;  3DEP A;  1XYI A;  2WP8 J;  1DON A;  4X3U A;  1QJO A;  1BNZ A;  1GUT A;  1KAA A;  4ME5 A;  1B9M A;  2OXP A;  3I3C A;  3T56 B;  5F2D A;  5BN5 A;  1EEI D;  1I6V C;  2G9H D;  3I4M B;  1T5E A;  3KBG A;  1EU4 A;  4XQJ A;  5JJZ A;  1XX8 A;  1ROD A;  2RSN A;  1KTK A;  1CZW A;  5JEA H;  2BDN A;  2IX3 A;  4ZQ3 A;  2K04 A;  3K5L A;  1SEB D;  1SJE D;  4HED A;  1F9P A;  2K1B A;  3R8B A;  5KNB A;  1B2T A;  1HRJ A;  3Q22 A;  1JOO A;  1I4X A;  1T5X D;  2AUJ D;  3BDC A;  3T13 A;  2B2W A;  4BA1 I;  4HSV A;  3HOU B;  4TRD A;  4XTC S;  1TY2 A;  5JVG 3;  4HCE A;  3TBI B;  2F0I A;  5IIF A;  2KUM A;  3I91 A;  1GUW A;  4RGT A;  2C5C A;  5T1I A;  3VR3 A;  4F87 A;  2EJM A;  4S3S A;  3E0J A;  1D1I A;  2E2J B;  4B08 A;  3VYU A;  1CT1 D;  4HR7 B;  5E4W C;  3OOC A;  2JEB I;  3HEJ A;  1H9M A;  1AEX A;  1SYC A;  4IUV A;  4C3H G;  3SVM A;  3U9S A;  4OO1 H;  1O80 A;  3CKI B;  5D14 A;  2J4X A;  1B3A A;  1PTO F;  2KEC A;  1FD7 D;  3G6J B;  4Y7N B;  2Z4I A;  3PIO 3;  3QG1 A;  3A7L A;  2EYJ A;  5IT9 E;  2V4D A;  5EQ0 A;  1EWC A;  3DXJ C;  3H0G B;  2XRS D;  5DEH A;  1F9R A;  1EYD A;  2MJ8 A;  2PNR C;  5EKK A;  1X3Q A;  3SK5 A;  3D31 A;  3DWQ A;  1KDC A;  1L0X B;  2DN8 A;  1S5B D;  1GHK A;  1I4H A;  5G3L D;  4KHV A;  2YYZ A;  2EYL A;  2XWB B;  2F0T A;  2DY7 A;  3QO2 A;  2AUK A;  2K5D A;  2MHV A;  2C9O A;  1DXM A;  2D9U A;  5A35 A;  1JQY D;  1PRT C;  2CHB D;  4BWG B;  5C3X A;  3TDQ A;  2WAC A;  1L0Y B;  1MBY A;  2MUY A;  1MD2 D;  3MWY W;  1HQR D;  3LWU A;  4RGN A;  1LTA D;  2PW5 A;  3R93 A;  1TS2 A;  5FK9 C;  4J8Q A;  1LTS D;  5EJW A;  1S5E D;  2E2D C;  4ZK9 B;  1HA5 A;  2BOS A;  2VB2 X;  3ITP A;  4C1N K;  5JPN C;  3SK4 A;  2K32 A;  2MP1 A;  2AWO A;  2F1M A;  5C4Z A;  5M3F B;  3NBI A;  2SOB A;  1O78 A;  1Q90 A;  2QIL A;  5FO7 B;  1A3U A;  2X6G A;  3HKZ B;  1JCK B;  3CHB D;  3PO3 B;  1JWU D;  4B9X A;  1STN A;  1QIL A;  2F0E A;  4UDU C;  1ENA A;  3HS0 C;  3GTP B;  2QF7 A;  5KYL A;  3GTJ B;  3KK7 A;  5EBD A;  3D8G A;  2L1B A;  1G8Z D;  2F0M A;  1F9S A;  3D6W A;  4R8I A;  1BUV T;  2Q8I B;  4WFN 3;  2Z8L A;  4HSP A;  5CV5 A;  3OIP A;  3MXU A;  4OIK A;  1S4Z A;  3C3L A;  1II3 A;  3GD7 A;  1SNO A;  1Y8O B;  4PQX A;  1PFM A;  5JAV A;  1UUP A;  2F0L A;  1RJT A;  1CQF A;  1OXU A;  4L63 B;  2SNS A;  1TS3 A;  1S5D D;  3J80 E;  4C3J G;  1IYV A;  1RTO A;  1JIC A;  4C56 C;  3FKI B;  4A3I B;  2K01 A;  1R4P B;  2K05 A;  2F0N A;  5TSS A;  5JEA G;  4J1M A;  1BCP C;  2A6H C;  1G6Z A;  3GTQ B;  4HCS A;  1B50 A;  3TSS A;  4M8A A;  3PV0 A;  4ABN A;  3MZ5 A;  1PYW D;  4XQQ A;  1S5C D;  1BF4 A;  3K5O A;  1CQV A;  4WJW A;  5CYU A;  4XT1 B;  4ZRZ A;  5I9P A;  3S2H B;  1SE2 A;  1BO0 A;  5K36 H;  1ET6 A;  5KIX A;  1K8M A;  1IKM A;  3SXH A;  4B9W A;  1FNU A;  1YNJ C;  1F9Q A;  3NP8 A;  3ONA B;  2TSS A;  2XIW A;  2LS0 1;  1H9J A;  4BY1 B;  4F88 A;  4IFD G;  2G9D A;  1FR3 A;  1SE3 A;  3OHX C;  2KJX A;  4XIG S;  2RQX A;  1HUN A;  3KBX A;  3VR5 A;  4EVO A;  1O7Z A;  1D5X C;  5CV8 A;  3H09 A;  1EY4 A;  2HQE A;  2ICE C;  3DWA A;  3FDT A;  3BYY B;  1CTM A;  3DUZ A;  2SNM A;  1JWS D;  1A3V A;  1PTO B;  5J39 A;  2ZXR A;  1GUN A;  4V19 0;  4IUQ A;  4A3D B;  2XSC A;  1LV9 A;  2K5W A;  4XT3 B;  1V1P A;  2K7V A;  2F0J A;  3RZD B;  5I6Y A;  1RTN A;  3L9A X;  3M7N A;  4KMU C;  4DF7 A;  1JB3 A;  2M00 A;  4F7X A;  1EEF D;  1C48 A;  1I4P A;  1DOM A;  3TZU A;  1VF7 A;  4G4K A;  1LTR D;  1C4Q A;  5BN3 A;  3FPU B;  1QNU A;  3P20 A;  3TP7 A;  5CC4 A;  1H9S A;  1GOZ A;  3QJY A;  3QOL A;  1G29 1;  5JEA J;  1EY6 A;  3KLR A;  1RKN A;  4RHS A;  2EYO A;  1BOS A;  1ONL A;  2EYF A;  1A2T A;  2RVL A;  1Q12 A;  1Y1W B;  1UAP A;  2B2U A;  1EZ8 A;  3C46 A;  1KAB A;  1WTV A;  3HP3 A;  2EYM A;  5FKA C;  3H91 A;  5A2Q L;  2M9V A;  5COY A;  4MN3 A;  4HMI A;  4R9W A;  1AW7 A;  1SFO B;  1STA A;  2ZT9 C;  2F0K A;  1Y69 U;  2B2Y A;  1I4R A;  4O1N A;  2B8F A;  3DMU A;  1ET9 A;  4RCO A;  1PZJ D;  1I50 B;  4OGQ C;  2SEB D;  3A54 A;  1SMY C;  3PUZ A;  2NVT B;  3K0Y A;  3D6C A;  3IAY A;  3F2U A;  1TS4 A;  2NN6 I;  5CBE E;  2YU9 B;  3BDO A;  2IT1 A;  2PW7 A;  2MGS A;  1AP0 A;  4M1U B;  1V8Q A;  3M85 A;  3GP7 A;  3L7Z C;  4ZUJ A;  3ERQ A;  1U4M A;  1U9R A;  2WB1 B;  4QUF A;  4QMG A;  4KV6 A;  1TWF B;  3HOW B;  2F0Q A;  3VA7 A;  2KCC A;  5EKL A;  1LTG D;  4PNY A;  2JXM B;  3P1H A;  2NVY B;  3U9O A;  4CKE A;  2EY1 A;  3UI2 A;  3TZD A;  1TWC B;  1Z7T A;  2EJG C;  1MI2 A;  5LHY 1;  1NR2 A;  5IOD A;  4RH6 A;  2X69 A;  3LX0 A;  2NTS A;  3PIP 3;  1TR5 A;  1TT2 A;  5KEE A;  2N88 A;  4ZLT F;  3FVQ A;  1A6X A;  3NUC A;  3K7A B;  3ZYY X;  4EQN A;  4DFA A;  3NBH A;  5IGD A;  2I07 B;  2BCO A;  4Q5V A;  3I90 A;  1X32 A;  5M5Y B;  3K59 A;  4QIW B;  4NP5 A;  4Q0F A;  1KNA A;  2ZXP A;  3EFX D;  2PPB C;  2A68 C;  1DJR D;  2JSO A;  1GXD C;  3MAQ A;  2B2W C;  1PTO C;  1SNM A;  3SDZ A;  3T16 A;  1B53 A;  4K2L A;  2L0C A;  2ZXO A;  2A74 C;  3T4A C;  5C0X H;  1EIG A;  4LAA A;  3GTO B;  1STY A;  1NR4 A;  3I8Z A;  1ZEQ X;  4CKB A;  1U4R A;  2TMP A;  4A3M B;  1I3Q B;  2L9H A;  3VR4 A;  3SHL A;  4A3K B;  1JE4 A;  4XQN A;  1FGB D;  4LK1 C;  4KY5 A;  2R7Z B;  3MXN A;  3HOZ B;  3VYT A;  3SR1 A;  1CFM A;  1HUM A;  3NSW A;  3TP5 A;  3BDL A;  1E2W A;  5ELC A;  2KEE A;  1LAC A;  3D4W A;  3R2T A;  2CQA A;  5I4D A;  3PUW A;  3C1F A;  5D3I B;  4I7Z C;  4WOR A;  1TVX A;  2N55 A;  4P2C B;  1SYD A;  1RCV D;  1HFN A;  5FLX L;  3OPO A;  1UEA B;  2FFK B;  1QE6 A;  5DM6 3;  3D3R A;  4O42 A;  4C1N I;  4K8I A;  1ML0 D;  3GV3 A;  4RGO S;  5IGC A;  3PUV A;  3X3M A;  1EQT A;  3MC0 B;  4K2K A;  5I2X A;  1D5M C;  1EOT A;  3S9W A;  1IW7 D;  1O7Y A;  5EPK A;  3X3N A;  3SK6 A;  1W6J A;  3AB9 A;  3MEH A;  5KYI A;  3P7J A;  4RWS C;  4EQO A;  4HN7 A;  4MHE A;  4ZKC B;  3I72 A;  2NN6 H;  1I4G A;  1X3P A;  3OWE B;  1PFB A;  1A3T A;  3RZO B;  3J81 E;  3IKJ A;  1GHJ A;  4KD4 A;  4K5W A;  5BN4 A;  1CA5 A;  2B2V C;  2PZW A;  4FP5 D;  2AQ1 B;  1ILQ A;  4FXG C;  3S16 B;  4XYQ A;  1EY7 A;  5JOB A;  1QWY A;  2F0G A;  1KDB A;  2EY6 A;  5CV4 A;  4DGZ A;  4EGV A;  1QB5 D;  4DAY A;  1DOK A;  3JAM E;  1I6H B;  3Q24 A;  2WKC A;  4X3S A;  4OIJ A;  4IUU A;  2HDL A;  1PMR A;  2L5T A;  5C5M A;  3N52 A;  2H1E A;  4H0L C;  2MPM A;  5CV9 A;  2F3W A;  2J0T D;  3MA2 B;  2A73 B;  3NE5 B;  3QB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...