2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transcription
molecule keywords Bacterial RNA polymerase inhibitor
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
4L8JA 1Y8OB 1TKWB 2A6HC 1H9SA 3GD7A 1Q90A 3N6RA 3IKJA 1OXVA 3PUYA 3PUVA 3IFTA 1QJOA 4G7HC 2A68D 3W3AA 1H9SB 4HR7B 1Y69U 4OGQC 3RLFA 3VR2A 2EJGC 1OXUA 2EVBA 1E2VA 1OXSC 2BE5D 2PNRC 2QF7A 2A69C 1EWHA 2B8FA 2NN6H 4KHZA 1B9MA 1Y8PB 1I6VC 3A8IE 4LK1C 1Z6HA 3P20A 3AB9A 2K7VA 3PUXA 3D31A 4BA2I 3ND8A 1G291 3D4RA 1Q1BA 4XIGS 2DN8A 5KNCA 1H9JA 1GUTA 4KN7C 2E76C 5K36H 1A6XA 2KCCA 2BE5C 3DXJC 3M85A 5JEAG 5C0XG 3FMCA 2BDOA 4OO1H 1DCZA 3LWUA 2L5TA 1YNNC 1OXXK 2EJMA 2A6EC 1IW7C 3EQLC 2KA7A 2R6GA 1YNJC 4DNTB 4IFDG 2O5JC 3TZUA 4GZYC 1CTMA 1VF7A 2K33A 4TQUS 3VR6A 1BDOA 4OO1G 3QJYA 4XTCS 1K8MA 1Q1EA 1HCZA 2DNEA 3PUWA 1HTPA 1ONLA 3A7LA 1H9MA 1HPCA 4BA1I 5A35A 5KNDA 1GHKA 3MXUA 1GUGA 1O7LA 1DXMA 2DNCA 4PV1C 3BDOA 4JBWA 1CFMA 2D2CC 2IT1A 3QIAA 1CI3M 1ZKOA 1H9KA 4G7ZC 2LMCB 2PPBC 2B8GA 3LNNA 4H13C 4I7ZC 4KN4C 2EJFC 1PMRA 2E74C 2JEAI 2O5IC 2AUJD 3SDZA 3ND9A 5BN3A 1IW7D 1GHJA 2A6ED 1FYCA 2BA1A 1FR3A 3A8KE 3CRKC 2D5DA 4DNRB 1Z7TA 1SMYC 2JEBI 3BG3A 4KI0A 2A6HD 4KKTA 4JK1C 4TKOB 2AWOA 5BN5A 3U9SA 4RCNA 3VR4A 2ZT9C 1LACA 3OPOA 4IQZA 3OW7A 4LJZC 1GUSA 3FPPA 5JEAH 2EDGA 2A68C 4DK1A 5C0XH 3M7NA 5KNBA 2BA0A 3M4YA 1ZYRC 1GUNA 1VDZA 3I73A 3VR3A 3I4LA 4IFDH 1LABA 3OOCA 1HQMC 3PV0A 3H94A 1V43A 2NN6I 1VCIA 1O78A 1B9NA 1H9RA 4KMUC 4DK0A 3CRLC 3QG1A 3SE0A 2Q8IB 3NE5B 1GUOA 2E75C 1VF5C 4H44C 1E2ZA 4KKUA 1TU2B 3T56B 3VA7A 5K36G 1E2WA 1GJXA 2JXMB 3A8JE 2AUKA 1IYVA 4H0LC 1DD2A 3KLRA 3T53B 5BN4A 1V8QA 1IYUA 1OXTA 2CW0C 2F1MA 2YYZA 3L7ZC 3MFYA 2JE6I 3PUZA 3HGBA 3WDNA 4KKSA 3VR5A 2PCFB 2D62A 1K8OA 3T51B 1T5EA 4G7OC 2A69D 2NN6G 3GQBA 1Q12A 2K32A 3I72A 2V4DA 1Y8NB 3A7AB
chains in the Genus database with same CATH superfamily
2NZOA 3FP9A 1NE3A 3N6RA 3K6OA 4A76A 3I4NG 5JEAJ 2KECA 3UE1A 3JAMi 1JMCA 1I6HH 1ML0D 1Q8KA 1OXUA 3K7UC 2IJ0A 5C3EG 3L3OC 2IW3A 1Y1WH 5BR8L 1VMCA 4QGUA 1HNZL 2B2UA 4GNXC 2B63B 3K57A 3OTOQ 5IYDH 2VUMG 1SNQA 5C3WA 2H5XA 1Q1BA 3NBHA 1CQVA 5AJ3L 4JV5Q 2AMCB 3K59A 3GTQH 3E9HA 5CV6A 4GKJQ 3I2ZA 4XQJA 4MTKA 1EIGA 2BDOA 2G9DA 2HHHQ 3HOZH 5IP7H 3K5NA 1YEZA 4CHTB 1WTQA 1WCMH 1XMQL 1IW7C 2E5LQ 5GADC 1X3FA 4DR2L 3OSOA 1B50A 5ELCA 4PMBA 2DNEA 4AIMA 1HTPA 2H4OA 4CDEC 3A55A 3D4WA 2KHIA 2DNCA 1RCVD 1X6OA 3M4QA 5IT9E 2NBFA 2BDNA 3ONAB 4RH6A 4C3JB 3F2CA 4DV7Q 2UUBL 2EY2A 4G57A 5C5LA 5DM63 5IGCA 1MSGA 4BBRH 1I5FA 5HGQA 1I4XA 5IGFA 2TMPA 2QA4A 4DR2Q 2QCPX 3FEWX 1Q3LA 5J22A 3OWEB 4FVMA 2A68C 1TS4A 4IUTA 3VDYA 3I73A 3BU2A 1ICWA 4R1JA 4XDXA 4EQ5A 4N9PA 3WWVA 1XTDA 4OEMB 1X9NA 3S15H 1B9NA 4JV5L 1IBLQ 2MHVA 5AJ3Q 5I9PA 1I4PA 3D6WA 1W6KA 3OTOL 3NQTA 2RVLA 4IUUA 2VUMH 2JA8B 2NVTB 4LF9Q 4A3IH 1EQQA 3S17H 2EY6A 4KHVA 3E5SA 4BBRB 2Z1CA 1E22A 1PHJA 4HCEA 4FXGC 2YTVA 5FJ8H 4ZRZA 3WOFA 2A74C 1ESRA 1VQ4A 1TWCB 1A15A 2A6HC 4HIMA 3GTGB 2BH2A 4ID6A 1JJGA 1BUVT 4LAAA 2HDMA 1L0YB 3KFUA 4ZUJA 1NR2A 1UEAB 5EBDA 5IE8A 4CJ0B 2VQEL 1B9MA 2ZTCA 2WFWA 5CORA 3HFZB 1KAWA 2K7VA 3AB9A 4X3KA 4JI8L 2JA8G 3I3CA 4IO9A 4DR7Q 2WACA 4POFA 4JBKA 1A6XA 4DGZA 5JEAG 2ZXRA 1SSOA 1PZKD 4LF7L 2VB3X 1M90C 2K52A 1KLUD 3VR6A 3G6JB 2F52A 1HPCA 1I6HB 4RHSA 3GTGH 5ELEA 3I4NH 1GUGA 4RGTA 3P7JA 1F9RA 1HQRD 3D3RA 4DV0L 1BF4A 3GTMH 4A3DG 4IPCA 4AQYL 5A2QE 1K0SA 3SDZA 2RDHA 4GLAC 2F0KA 1IBML 3HOWG 2EQSA 4ZK9B 5DEHA 1D1KA 2VNUD 2QEJC 3AFPA 2A6HD 4NPSA 2CWAA 3ITPA 2AWNA 2F0OA 4DAYB 4KV6A 2QKIC 4IURA 5KNBA 3KDFB 4HCSA 1NY4A 1TWHB 2IHEA 2WB1B 1B3QA 5I2XA 3MHBA 5CV5A 4KMUC 4FF1A 3CRLC 3QG1A 1Y1VH 2PI2E 2Q8IB 5HY6A 5EKIA 4JI0Q 1FVIA 1LTBD 3T56B 1M1KC 1E2WA 4HIDA 1ASYA 1JB3A 2BCOA 1QZGA 1PXUA 4A3GG 2PMZB 3RLNA 3GTJH 3GTLH 1HTLD 1EIHA 2K5VA 3A54A 1WTOA 2DJGC 1X3GA 4F8MA 4BY7G 3FDTA 4K5WA 3UE0A 4FF2A 4I7AA 1NCVA 5E4XA 1I4HA 1XNQL 4K14A 1PTOB 4DR3Q 1ENCA 4P72A 1IL2A 4FYDA 1DOKA 2A69C 2NN6H 1PFSA 5IIFA 1HNXL 5I9OA 1LM0A 3T4AC 3BS1A 1RTOA 3P1HA 2CVRA 2Y0SG 5M3FB 4KHPL 1VQHA 3HKZB 4C1NI 2Q2IA 1HNXQ 5IGEA 1SYFA 2VZAA 3PF5A 1X3EA 1FJGQ 2F0VA 2F0WA 4EQPA 1QZHA 3S16B 3QO2A 2RCFA 4KD3A 1GVPA 4YHHQ 3L0OA 3IFDA 2Z8LA 1XNQQ 4BWGB 5FLXE 3PO3G 1K8MA 2D9UA 1JWMD 4X62L 3JC66 1GHKA 2O2LD 4X3TA 4HEDA 1VQAA 4XQQA 3EVQA 3ZYYX 2VS1A 1SYDA 2IT1A 2K5NA 1KHIA 3GTPH 2N8NA 2I5MX 1F2MA 3OIQA 5FLMG 4A3MH 3HG9A 5M5YH 2F0SA 2O5IC 2Q2HA 2OCEA 5JPMC 2MFIA 4RGMA 4K8IA 1JJ2A 2Q2UA 1LT3D 1TQOA 1FYCA 4QUCA 2D5DA 4EVOA 3URYA 3BG3A 4KI0A 4NXML 4DR4Q 1D8LA 2WKDA 3ER0A 4JI1Q 4DK1A 2B2WA 5JEAH 1D1IA 2Z6KA 4P2CB 2LXJA 1QE6A 4LWCA 1JOOA 2UXDL 1TY2A 1NUCA 2R7DA 5EPKA 3KJOA 1PA6A 3F1ZA 1IBMQ 1E1TA 5IYDG 2K5WA 2HQLA 2IX3A 3PIP3 1GJXA 4YY3Q 4HAEA 3JAME 1IYVA 2PZTA 1OXTA 2IWHA 2B29A 3HGBA 4K0KQ 4GOPC 3CPFA 2RQXA 4B3RQ 1VQGA 1B53A 4PZ8A 4J15A 3I72A 4A3IB 3S17B 1Y8OB 5T1GA 2M9VA 4LF7Q 1O80A 5LL6X 4BS9A 2PYKA 1YITA 4HR7B 2K14A 3DUZA 4F7XA 1L1OC 1RD9D 4A75A 3NWTA 4S3SA 3KF8B 4DR7L 3OHXC 4ZCKA 1TS2A 1B8AA 5TSSA 2M00A 4JI6L 3S16H 5JVG3 3I4OA 5T1IA 2ZJQA 5EPJA 3ULPA 1H9JA 4DV5Q 4LF8L 5M5WH 5FO8B 3R2IA 2ENBA 3LWUA 2L5TA 1VQ8A 2KHSA 3TP5A 1HXYD 1N36Q 1LTAD 3VYRA 5KIXA 1EZ8A 2KA7A 2XN9C 4K5VA 1YNJC 1VQIA 3A56A 2K33A 3TBIB 1VQ5A 4ZYSA 3NHHA 4BXXH 4DN4M 4BY7H 3M7GA 2ID0A 5K5PA 2EOTA 2Z4HA 1TWGH 2YU9B 2D0PA 1STEA 1U9RA 4UP8A 4G7ZC 1B2TA 5M9OA 3S2DH 2EJFC 1MKHA 2E74C 2L1BA 4DU9A 1QVFA 4HMJA 1LV9A 2BA1A 3GTJB 3GTLB 2HDLA 3EIVA 2DY7A 1S5FD 3K8AA 5G3LD 2CWPA 4KKTA 1B7YB 2KENA 5FJ8G 5BN5A 3VR4A 4C3HB 5I2YA 1GXDC 2EDGA 4J8QA 2JA5H 3SVMA 1EOVA 4HJAA 4PMCA 2PW5A 1WD1A 2L4NA 1STYA 3B6YA 1HNWL 4HJ5A 4YWLA 1Y1WB 1I94L 1EEFD 3EJIA 2K04A 3FVQA 4HMIA 3K7AH 1TY0A 1LT4D 2KOLA 4DV7L 4HSVA 1AZQA 2EY5A 2Q2TA 2CW0C 1BO0A 1PTOF 3HOXB 5D3IB 1SNMA 1VQBA 1U4RA 2HIVA 4LUZA 1NSNS 2BOSA 1L0WA 2OXPA 1A62A 4L8JA 1LT6D 2IX0A 5LMUQ 4DR5Q 2E5LL 5C6AA 1SNOA 4OWXB 1BBWA 2FMMA 3VR2A 2LSSA 2K03A 3RUZA 1RJTA 2N78A 5CMDA 3D6CA 3H3VI 4L6TB 4LF5Q 2WAQB 5LMNW 3KLSX 4OO1I 3S24A 3FHWA 5FKAC 5LMNL 3RZDB 4NXNL 4X3SA 1UWVA 2B2VC 3OWFA 2HCCA 5KNCA 2JA9A 3W1BA 1Q7YC 5BR8Q 4ZAIA 3CQZH 1EIYB 1G2TA 1ZYRD 3MXNB 3CCJA 2A6EC 4DV1L 1A2UA 2MPMA 4QQBX 1VF7A 4IOAA 2NVQH 1E3PA 5ISRA 3X3MA 1QVGA 2XVSA 1LTSD 2WP8J 1JWSD 1K83H 2I5LX 1KL9A 2NZ1D 5FO9B 2PO4A 4QUFA 1K8AC 4KN4C 1W3SA 2CQAA 3C1FA 2EPBA 2ZM6Q 4A3BG 1Z47A 1NNXA 1YNND 3DM1A 5M5XB 3A8KE 1KIXA 1Z7TA 4JI7Q 4RCNA 1SMXA 4ZKCB 4YWKA 2KCTA 2QGQA 4DR1Q 2G9HD 4YCVA 1ASZA 3KK7A 4V190 2NTTA 1SJED 3CU7A 2CFMA 3BDLA 4UAIA 4NXNQ 3S1MH 3PCOB 2B63G 5LMNQ 3OIPA 1ILPA 5C4ZA 3S1QB 3HOVB 2KCNA 2YTXA 1I4QA 4B08A 4C3JH 1WTXA 5BN4A 5J3BA 4GN5A 4AH6A 4EX5A 1XMOL 1IZ6A 1ICFB 3NTHA 1T5EA 1YBYA 3SXHA 3AYHB 2NVXB 2M2LA 3TMEA 3TRZA 1OXVA 5C3EB 4GNXB 1I4GA 1WCMB 1W2BA 1PRTD 2EJGC 3K81C 5M5YB 1WTHA 1B3AA 3CCMA 4B3MQ 3A74A 1OO9B 1QUQB 4NW2A 3Q0AA 4KD4A 3D4RA 2VW9A 1I94Q 1PH2A 2E2JH 1HNWQ 2JP1A 4FXDA 3TN2A 5C0XG 3DLLA 3DWPA 2F0TA 3SK4A 3UDIA 4OWTB 2UU9Q 1KLGD 3TZUA 4RA8A 1CKMA 5FO7B 3OW2A 1S5CD 4BA1I 5KNDA 3A7LA 1IL8A 3HZXA 1S4ZA 4QIWB 3KYHC 5EKKA 3TQYA 1YJWA 4UPAA 3G4SA 3S14H 4A93H 2Q8RE 5I4DA 4A3BB 5GAEC 2EYMA 2YTYA 2HIXA 1E1OA 1VQ7A 3NTKA 4DV2L 4B3SQ 2IHFA 2WIIB 2RF4A 5JJLA 3BVZA 1U4LA 1VQNA 2I0QA 3HOUG 1S5ED 2B2TA 4IQZA 1TWAB 2F0LA 4DV4Q 1GUSA 1N36L 1HR0W 1RHPA 2I07B 5D14A 3M4YA 3I4LA 4A3FG 2EXZA 3K80C 3OMCA 1SYEA 1J8IA 1D5XC 2FJ2A 2NN6I 2A1AA 3CCEA 2VY3A 4A3IG 3HOZB 1QWYA 1NMGA 3H0GB 1R9TH 1DM0B 5M3MB 3GTQB 2K6AA 3S2HB 5M5WB 2VL6A 3Q6SA 4TSSA 5D3DA 1MIUA 2EYFA 3GV3A 4KKSA 4C3IG 2KJXA 1PLFA 5IYBH 1HUNA 1EIFA 1K8OA 4R8NA 4G7OC 1STGA 2RHSB 2WINB 3I90A 3V96A 4GN3B 2F03A 4B3RL 2F0UA 4K0KL 4N9TA 4GLVB 4A93B 1H9SB 1DOMA 4TVAB 3M4OH 4LF6Q 2JA5B 3F2DA 3A5ZB 5I6YA 1WTRA 2B8FA 3CF5A 2RSOA 3PQIA 2LFNA 5IP9H 1GD7A 4C3HH 1S40A 1C9OA 1Y1VB 2K4KA 3SHLA 3E6ZX 3K5OA 3I4NB 4IFDJ 1BQQT 5M3FG 4IJLA 3PO3H 1G291 1S5BD 2NVYB 1DYQA 1X3QA 1L1OA 2QDLA 3UDFA 1EY7A 2OEOA 4LF6L 1WTWA 3E3XA 3LX0A 1N8RC 2R92B 1CKNA 5C4XH 2F3VA 2ALYB 4M1UB 3CP0A 2YU9H 2O5JC 2PQAB 2B2TC 3AQQA 4A3DH 1PH6A 2LY7A 4P71A 1DXMA 1PFMA 4A3CG 3BDOA 2L12A 1F9QA 1DJRD 4MZ9A 1ZKOA 1DGSA 2LMCB 5EAYA 1HZAA 3LNNA 1KABA 1WTPA 4I7ZC 4BY1B 1A63A 1IKMA 2HCIA 5CV4A 2AQ1B 2R61A 2AUJD 2F0FA 1PTOC 4J6HA 4H7BA 2HD3A 1TIID 3CRKC 2IY5B 4R4CA 3TP8A 3IRBA 4X62Q 1SMYC 1XPUA 1XYIA 4LFAQ 1CT1D 2HUGA 3KJPA 4A3MG 4LJZC 4YHHL 2Z6BA 4HJ8A 4LUOA 3NBIA 4DK3C 1BCPF 5CV7A 5D65A 4K5XA 1VDZA 3RR5A 3MTSA 1JC7A 3CMAA 1SE3A 4DV4L 4K2KA 3CC2A 4LF4Q 3H09A 2Z9HA 4DK0A 1XX8A 3H15A 4DV2Q 2CH4A 4DUZQ 1CA6A 3CCQA 5GAHC 2IPKD 5CC4A 5AFWA 2JXMB 2MQHA 4A3FB 2E2IH 1XTCD 2F1MA 4E6IA 1Y14B 1PYBA 1GM5A 2JE6I 3Q8DA 4DA2A 2PQAA 4RKLA 1PFNA 2D62A 1T5XD 1QG7A 1M8AA 2K32A 3M4PA 1AP0A 1MJEA 1SNPA 2D0OA 3NEMA 1C7YA 3KF6B 3HOWB 2MGSA 2R3ZA 4G7HC 2UUAQ 2QEXA 1PTOH 4KK7A 2J4XA 2QW7A 4O1NA 2Y0SE 1Y69U 2EVBA 1VQLA 2KQ3A 3K5MA 2OQKA 1CK1A 2K75A 3J7ZC 4O42A 1SR3A 1RKNA 1FL0A 3GO5A 4OELB 2XSCA 4EQOA 1YIJA 4A3EH 3BYTB 2F0EA 2OTLA 1BCPB 1EY0A 2F0DA 4P75A 4IOCA 5C4HA 4N8FA 2EXDA 3VYSA 3PIOA 3L2PA 4WJ3M 1LTRD 1NR4A 1CSQA 3G71A 3SGIA 5EJWA 3A0JA 1PYSB 2DJFC 1C4QA 4UHVA 1DOLA 3FRPB 2KHJA 1XMOQ 1HJPA 1EY6A 3QIAA 4HIKA 1CI3M 3RZOH 2F0HA 4B9WA 2R7FA 4DV0Q 4H13C 4FF3A 2XTIA 5JOBA 2JEAI 4BBSB 1FGBD 2CHBD 1YI2A 5E7NA 1LTID 1TS3A 3LWEA 4AYBB 1B1ZA 3GTKB 4DNRB 1VQCA 1KDAA 5KYIA 4WORA 1RTNA 3CCUA 2ZJPA 1UEBA 3EA6A 1ESFA 5IP7G 5JJKA 4FF4A 4DR1L 1WOCA 1R4PB 1AE2A 4JI4Q 3STBC 5FLXL 3D0FA 3PV0A 2IX1A 3IL8A 5G3LF 5CBEE 2L15A 1F9PA 3H3VH 3VYUA 4ZQ3A 4XYQA 1K83B 1HR0L 4JI8Q 4KY7A 1U4MA 2JA6H 1VF5C 2Z0SA 3VA7A 3S1RH 3G48A 4LFCL 2ZM6L 4NB3A 3ULLA 1TWFH 3GP7A 3RNUA 2MP1A 3J81E 4A3BH 2EZVA 4PNYA 4P74A 3S2HH 2NN6G 4B9XA 1BVSA 4GKKQ 3C46A 1JT8A 3PUVA 4NMZA 1XPRA 2A5HA 1G91A 5E4WC 2BE5D 1TWGB 5CYUA 2UXBQ 1EWHA 4LF9L 5ELBA 4IUQA 1Y8PB 1E24A 3KBXA 4OXPA 1WVLA 1Z6HA 3P20A 5DLQE 3Q23A 2ZXOA 2V1CC 3RN5A 3KBGA 1N34L 3ICEA 5EKLA 2RA4A 4LF5L 4QY7A 1YZ6A 2PI2A 2NVTH 2RHQB 4C3JG 3M85A 2XWBB 2J0TD 4DAVA 4QJFA 1VQ6A 1B4OA 3DEPA 1OXXK 1X32A 2N88A 2EJMA 5EGTA 3EQLC 1ENFA 2K01A 4IFDG 4GN4B 3C3LA 1CTMA 1J9OA 5IT9c 1EY4A 4DR5L 2SNSA 2N49A 3QJYA 4PQXA 4Z9CB 1SLJA 1STHA 3MA2B 3PUWA 3T1HL 1OTCA 1VQEA 1FD7D 1SMYD 1BXTA 2UUBQ 4JYAL 1Q82C 2OWOA 3HOVG 2GA4B 3SK5A 1SE4A 2E2JB 4IUPA 4JYAQ 1I3QB 4R4QA 2KCMA 4F87A 2F0MA 3PGZA 1PH5A 1IW7D 2DUDA 2A6ED 2WKCA 4ZUIA 3H91A 2JA7G 4J1MA 1KNAA 4IFDI 5KEEA 3S1QH 1VQFA 1V1PA 4DF7A 1G2SA 1PRTF 4QF4A 3RMHA 3OW7A 1XMQQ 2X69A 1QVCA 4L5RC 4FNFA 4JOIC 4BBSG 2XNAC 1HFNA 2HHHL 2HT1A 3R2TA 4C2MB 3S2DB 5ELFA 1BBUA 1M4VA 3SE0A 2XIWA 3BJUA 2R93G 4Y52H 2WB1E 2NZHA 1YNXA 4KKUA 2L0CA 1UAPA 1IYUA 2YYZA 4A3DB 2B2YA 4DNIA 3MWYW 4Q5VA 4R8IA 1CZWA 3C2PA 3HOUB 4X64L 1RIPA 1BKBA 1G6ZA 1VQDA 2NTSA 1NBWA 1A8VA 1Q90A 2ASBA 3AEVA 3CCLA 1SE8A 4YWMA 4F88A 4C56C 5IGGA 3J81j 3HRZC 5DAUA 3IFTA 4DV6Q 1QJOA 2B2WC 4ME3A 5C44H 4ULLA 3U4ZA 3BVMA 2NVYH 2QF7A 4LF8Q 2EE1A 4LFCQ 3PSIA 4JI2L 1HUMA 1EWCA 4LK1C 3CC4A 1HR0Q 4Y7NB 4MTNA 1PH1A 1YHBA 1CHPD 5CV9A 4YCWA 2DY8A 3FKIH 1G51A 1K3BC 1WYDA 4OO1H 2E2HH 2TSSA 3MZ5A 1STAA 4JI5L 1X3PA 4APVA 1BNZA 1SDFA 1VMPA 5FOBB 2AHOB 4RGNA 3PO2H 2JN4A 1S5DD 1V9PA 1A3UA 3KDFA 5C5MA 1J6QA 5A35A 1TT2A 1A3VA 4OONA 1EQVA 2C5CA 1HRJA 3L9AX 2D2CC 1SROA 3SR1A 3W2DA 5CGKA 5IGBA 1XJVA 2B8GA 1D5MC 5IODA 2R7ZH 1X55A 4JOIA 4L5SA 3TDQA 1UUPA 1FR3A 1D5ZC 1E0BA 3HP3A 1CKOA 3RZDH 4FDBA 4TKOB 4RWSC 2UXDQ 2E2HB 3CPWA 4QCLA 1EY5A 4IALA 4DR6Q 2BA0A 1V1OA 4H02A 4JI1L 2E8GA 1TS5A 1YNJD 2F4IA 1C8CA 4BY1H 1IYJB 4GNXA 4NXMQ 1H9RA 5KGUA 1O7YA 4C3IH 5JPNC 3MC0B 2R93B 2XRSD 1MSHA 1JB7A 3S14B 1QB5D 1EQRA 3A8JE 4RCOA 3Q22A 1ZXTA 1DD2A 2F0IA 3KLRA 1KDBA 4JVZA 4TRDA 4DXFA 4RFBA 2B63H 3WDNA 3R93A 2UUAL 4X66Q 1XNRL 1K0RA 4N8X1 3VR5A 1FGUA 4RMFA 4OIKA 3CKIB 1KRTA 3DM3A 1Q12A 5GQOA 4ODGA 5IP9G 4KLKA 3U9OA 1H9SA 2XGTA 3K5LA 3DWQA 3PMFA 3IKJA 4BY7B 3PUYA 3BZDB 2A68D 5IYBG 3W3AA 3QWNA 2NYZD 5LL6S 1KTKA 1PH4A 1OXSC 4G4KA 1F77A 4NDXA 1S72A 1FJGL 2EYPA 2RSNA 5GAGC 3F8TA 4IPHA 3HOYB 5HURA 2OT2A 3HKZG 4DUZL 3PUXA 3QOLA 1EFID 2JYOA 5FLXc 2R93H 4A3KG 3GDEA 3KLSA 2Y0SB 3KF6A 2MNAA 4KN7C 1D6EC 2E76C 2GN5A 1PRTC 1I4RA 3M3YB 4UY8C 2F3IA 2L55A 1SFOH 3MXGA 3A5UA 1RDPD 4PMWA 4DUYL 5EPLA 2B2UC 4A3JB 2JA7B 4DXGA 3EROA 3TZDA 1Q8IA 5DM73 3CXCA 3MXUA 1SYBA 2K5HA 1Y1VG 1HZ9A 4M8AA 3H0GH 3STBD 2EIFA 1PRTB 3MVVA 2KEEA 3R8BA 3VA5A 2R7ZB 3NSWA 1CM9A 3MXNA 3O13A 4R9WA 3PIO3 1D2BA 4DFAA 5BN3A 1GHJA 2F0QA 3CHBD 4JI0L 2FHTA 1YHAA 1CSPA 2YV5A 4XXEA 5F2DA 3I7FA 3NP8A 4A3FH 2E2IB 3PO2B 3CQZB 2ZT9C 2ES2A 4CBVA 3HOXG 2FFKB 3M7NA 5DNFA 1GUNA 3OMGA 1FNWA 3I4MG 4DKAC 2AQ2B 3QB3A 2UXCL 1W6JA 4NKLA 2Z6KC 1O78A 2CQOA 5M3MG 2H1EA 3NK9A 4CJ1B 2ICIA 1LT5D 3I70A 2JJQA 1ZEQX 4JCVE 2E75C 4MHEA 1E2ZA 1RODA 1IHZA 1S3OA 2JSOA 4IUVA 4GOPA 3H3VC 2I46A 1EWIA 4I65A 1CUKA 3BYYB 3T51B 1WCMG 4R4OA 1EQTA 2A69D 4DAYA 3HOUH 1TXYA 4A3JH 2IL8A 1Y8NB 3A7AB 1VQPA 4AYBG 4X3UA 5C0XI 3KUPA 2JA5G 1N33Q 1AFPA 1LTGD 3K0YA 5L37A 3T1YL 3D8GA 3NPPA 3E0EA 5NUCA 4OGQC 2JA6B 4K6DA 2PNRC 2ZTEA 2RBMA 1B44D 4ABNA 3HOVH 2F3WA 3J7YW 1PZJD 2RDFA 5H1SE 2MO0A 4BA2I 4YCUA 1EY8A 4JI2Q 2VQEQ 3ZJYC 4C2MH 3TP7A 3M9BA 2NVXH 3GTOB 4X65L 1EFWA 1DCZA 3SK8A 2ICEC 4JW0A 4YIJA 4DV6L 3MAQA 4JI3Q 1K28A 3M4OB 1STNA 1EYDA 4DNTB 1MBYA 4ALPA 3RLOA 3ERSX 1G6PA 3BZKA 4A3EG 1HCZA 3MEFA 4X64Q 2J7ZA 5C4XG 3U58A 1CFMA 1PH8A 5EBCA 1QUQA 3DHQA 4WFN3 4A4IA 1XWEA 3NBHB 1AH9A 4EQNA 5JJIA 3ND9A 1Q81C 5M3FH 3J80c 1Q86C 3UI2A 1PV4A 1MD2D 4CJ2C 4A3KH 1IBLL 2G5DA 2UU9L 3OPOA 1A2TA 4GS3A 3NTIA 2JK8A 2JA7H 1HH2P 1HA5A 3I4MB 4R4TA 2MO1A 4L5QA 1PTOD 5LHY1 1BCPC 3J7AV 2VQFL 1K9MC 4DK6C 1I50B 3NE5B 4JG2A 1F2ZA 2K1BA 3PF4A 5HGTA 4JBMA 5K36G 4B3ML 3VYTA 1CKNB 2A8VA 2P5ZX 1A0IA 2NVQB 5CR3A 1K73C 3GV6A 1V8QA 3MFYA 1WFQA 2R92G 3PUZA 3R3OA 4IJHA 1JICA 1SJHD 2PQEA 1KC8C 1FNVA 1PDQA 2MJ8A 3T1HQ 1HZBA 2ATWA 4LMQD 2PZUA 5C0XJ 5C44B 3TREA 1VQOA 4A3LH 1GO3E 2SNMA 2K5DA 4RGOS 2F4VQ 4GKJL 3JAMc 3A8IE 1SBBB 5A2QL 4Y7NH 1YJ9A 4B3TL 5JJZA 1N34Q 1SNCA 2SDFA 4K2LA 5J39A 1H95A 2DN8A 3J80i 3FKIB 3AFQA 1GUTA 1EYGA 1WJJA 2B2VA 1HNZQ 3QR8A 1L0XB 1N32Q 2UXBL 2RDGA 2WAQE 4U673 5IWAL 4O0AA 2SOBA 2F0PA 2B2YC 1U5KA 2RKSA 3X3NA 4JC0A 4GKKL 4POGA 1BDOA 1AN8A 4IN3A 1UNSA 2UUCL 1Q1EA 3LGJA 4DV3Q 1D7QA 1LTTD 3SK6A 4JBWA 1SNDA 1JWUD 1EYAA 1B70B 3H6MA 3FPUB 4CGYB 3RZOB 1PMRA 4OHJA 1J5EQ 3NELA 1LO5D 4PG3A 1MJCA 2CH4W 4OL7A 3TS2A 2JA8H 2VUMB 3NENA 3NWSA 4FP5D 4UDUC 5C4XB 2EYOA 2JEBI 3UDXA 3AU7A 1F2LA 5C3XA 1II3A 1JQYD 5IGDA 4LNQA 2CW0D 4C3IB 4DV1Q 1XPOA 1PFBA 1YVCA 3DEOA 5IWAQ 1EUJA 1EYCA 2A73B 3VR3A 1R4QB 1UE1A 1KRSA 5C3EH 4JI4L 3OOCA 1HQMC 2GVBA 1LTLA 3H94A 2PNHA 1N32L 3MFGA 1QNUA 1SEBD 5IY0A 1MHWC 2KUMA 4HIOA 3P75A 4CKBA 4QB4A 1JR0D 4B3TQ 2SEBD 4K8JA 4L63B 5C4JH 2F4VL 2XRQD 2Z4IA 3AMUA 3T53B 1IBKQ 2JA6G 4FO2A 1PH3A 3E9IA 4FXKC 2OQ0A 1QILA 2UUCQ 1P8LA 2ZJRA 5LMUL 2VB2X 5FK9C 2XWJB 1Y1WG 2QILA 2K28A 4ILWA 1KQSA 3CCSA 1EY9A 3RLFA 1CZGA 2GVAA 4L5TA 4CDFC 3BDCA 4HJ9A 4C1NK 1Z9FA 1AZPA 1KD1C 3RD4A 3HOZG 3ND8A 1PYWD 2C9OA 2VQFQ 1TWHH 4XIGS 1JOKA 1SRUA 1STBA 5I6WA 3U4VA 4A3GB 3J80E 2QDBA 3DXJC 3J81L 2L9HA 5EQ0A 1KNEA 3ULJA 1YNNC 1V1PB 1QCBD 1U0LA 2E2DC 4OX9L 1F2YA 2LXKA 1TR5A 2KVMA 4XTCS 2AKWB 4A3MB 1ONLA 5ELDA 3F2BA 1O7LA 2I5HA 2MUYA 2NUCA 2WB1G 3TEHB 2NB0A 4GOPB 4WJWA 2O4XA 2F0GA 3KOJA 2PPBC 4C3HG 4HJ7A 1P16A 2F0JA 1XXGA 4BXXG 4IUNA 4HSPA 1I3QH 3MEHA 3HOXH 3J81i 1JORA 1VQKA 2CKZB 2F0NA 4JK1C 4LF4L 2LS01 3ERQA 4R4IA 1K8GA 2FXQA 3M3YH 4JI3L 1ZYRC 3CC7A 3TS0A 4IFDH 2PZWA 1LABA 4PZ6A 1VQMA 4X65Q 1KXLA 4DV5L 1VCIA 4LFAL 2EYHA 4K6LA 1KDCA 1JE5A 3HOYH 1EEID 2PW7A 4A3CH 3G6EA 4JI6Q 1RF2D 1JJCB 3I91A 2K5QA 3WOEA 4H0LC 4EGVA 4BY1G 3BVGA 4RAUC 1SAPA 1MI2A 2B3GA 1CHQD 3T1YQ 4CDDC 3TSSA 1N33L 1IKLA 3T13A 2DGYA 4HN7A 3PO2G 3SEBA 2V4DA 3J7A5 1SXTA 1MGSA 1SYGA 1TVXA 1PVOA 4JBJA 5E1FA 2FINB 1DONA 1R9TB 1FNUA 4U68A 1YJNA 4LFBL 4IZ8A 3I4MH 2R7ZG 4OIJA 4LW1A 2B39A 5GROA 4YY3L 2ZTDA 1SE2A 3KLWA 4A93G 1Q46A 1SYCA 1U4PA 3V05A 1VQJA 1C48A 5M3MH 5C44G 3S15B 4QMGA 4DPGA 2OTJA 4A3KB 1F9SA 3K0XA 3S1RB 1WTVA 3BZCA 2RCNA 3C1EA 2UXCQ 4DAMA 2A19A 3CD6A 1RL2A 1JCKB 3FMCA 4LFBQ 5CBAE 1TWAH 3EFXD 1CA5A 2X6LA 2LKVA 5J1ZA 4MNOA 4CKEA 1WI5A 5IYCG 1DZ1A 2CCZA 3FKIG 3CW2C 4TQUS 4IPDA 4DR4L 4OO1G 4A3JG 4KY5A 1H9MA 2C35B 3Q24A 4BBRG 3T16A 3HOYG 2N55A 1UE5A 3J81c 3HOWH 1ET6A 1BR9A 1JE4A 2Q8TA 3K58A 3CCRA 3S1NB 3JAML 1AW7A 2PMZE 4HTHA 1BCPD 5CV8A 3GTOH 4BBSH 1TWFB 2K05A 4KJOA 2EY1A 1AEXA 1ET9A 3NUCA 1O7IA 5KYLA 4UP9A 2N3SA 2AWOA 3W1GA 3U9SA 5FLMH 4XYOA 4DUYQ 1HA6A 1LACA 3V2TA 1A3TA 3FPPA 5C0XH 4ZKBB 3I56A 1JOQA 4OWWB 3E0JA 4WJ4A 2VXWA 3TP6A 1KAAA 3EN2A 1V43A 1BOSA 3MXPA 4MIUA 4XT1B 3F2UA 3GTMB 4DAPA 1NMFA 1UE6A 1QNKA 4KHPQ 4B3SL 2KEDA 2WV6D 2X6GA 4WRDA 2BH8A 2R92H 4P73A 4A3EB 2K50A 5ELNA 4H44C 1VS0A 5COYA 1TU2B 1V1QA 1HFGA 1QOHA 1GOZA 2AUKA 3W5OA 1GKHA 1TWCH 3DMUA 4LUVA 3L7ZC 3RN2A 5KRUA 3S1NH 1HHVA 3HEJA 4XQNA 4DR3L 2PCFB 3U50C 3GTPB 1IXRA 3GQBA 3UDGA 1UE7A 3CCVA 4UP7A 4A3GH 1TKWB 2ZXPA 3EBEA 3GD7A 1AE3A 4OX9Q 5M5XH 1YHQA 4X66L 1XNRQ 2KBNA 3HKZE 4KJNA 1E2VA 1K3RA 3KF8A 1SN8A 4KHZA 2FMCA 4O2DA 1WD0A 1I6VC 1LYLA 3J80L 3HKSA 4RG1A 3PIPA 3D31A 4A3LG 2WAQG 3S1MB 1NAPA 4RKBA 1CQFA 2NWGA 3QOJA 1L2FA 5K36H 1HZCA 1NJIC 1O7ZA 2KCCA 2BE5C 1N9WA 4NP5A 4DR6L 4XT3B 4MN3A 1LUZA 3S9WA 2R6GA 2EYLA 5IT9L 3H0GG 2JQOA 4GZYC 1LLRD 1X56A 5C4JB 3IAYA 3NQIA 4PV1C 3G7LA 4Q0FA 4AQYQ 1IBKL 4QL5A 1H9KA 3HS0C 1C0AA 3CMEA 2EYJA 4QIWE 4ZLTF 1EOTA 5E3FA 3I55A 1X65A 2AQ3B 1EZ6A 5JVH3 4GLXA 2L11A 4IPGA 4ME5A 4KTAA 1GUWA 1VQ9A 1ILQA 1EU3A 4JI5Q 4V0BA 3CAMA 1X54A 3N52A 3NXWA 1SFOB 4KY6A 5IYCH 1G8ZD 1BBXC 1EL0A 1I50H 4JI7L 4RHRA 1NTGA 4PZ7A 1T9HA 3J7AF 5ELOA 2HQEA 1GUOA 4CKCA 3K7AB 1PH7A 4CDCC 1J5EL 1PZID 3D4DA 3PO3B 2OF1A 5IOCA 3OYYA 3DWAA 1ENAA 5JAVA 1EU4A 4AYBE 1L1OB 4X6AH 1PH9A 3I8ZA 1E7ZA 4DV3L 3GTKH 4JPBW
chains in the Genus database with same CATH topology
3N6RA 3K6OA 5JEAJ 2KECA 1ML0D 1OXUA 2IJ0A 3L3OC 2IW3A 1VMCA 2B2UA 2B63B 3K57A 1SNQA 5C3WA 1Q1BA 3NBHA 1CQVA 3K59A 5CV6A 4XQJA 1EIGA 2BDOA 2G9DA 3K5NA 4CHTB 1WTQA 1IW7C 3OSOA 1B50A 5ELCA 4PMBA 2DNEA 1HTPA 2H4OA 3A55A 3D4WA 2DNCA 1RCVD 5IT9E 2NBFA 2BDNA 3ONAB 4RH6A 4C3JB 2EY2A 4G57A 5C5LA 5DM63 5IGCA 1MSGA 1I4XA 5IGFA 2TMPA 2QCPX 3FEWX 1Q3LA 5J22A 3OWEB 4FVMA 2A68C 1TS4A 4IUTA 3I73A 1ICWA 4XDXA 4N9PA 1B9NA 2MHVA 5I9PA 1I4PA 3D6WA 1W6KA 3NQTA 2RVLA 4IUUA 2JA8B 2NVTB 2EY6A 4KHVA 3E5SA 4BBRB 2Z1CA 4HCEA 4FXGC 4ZRZA 3WOFA 2A74C 1ESRA 1TWCB 1A15A 2A6HC 3GTGB 4ID6A 1BUVT 4LAAA 2HDMA 1L0YB 4ZUJA 1NR2A 1UEAB 5EBDA 4CJ0B 1B9MA 5CORA 3AB9A 2K7VA 4X3KA 3I3CA 2WACA 1A6XA 4DGZA 5JEAG 2ZXRA 1SSOA 1PZKD 2VB3X 1KLUD 3VR6A 3G6JB 1HPCA 1I6HB 4RHSA 5ELEA 1GUGA 4RGTA 3P7JA 1F9RA 1HQRD 3D3RA 1BF4A 5A2QE 3SDZA 2RDHA 2F0KA 4ZK9B 5DEHA 1D1KA 2VNUD 2QEJC 2A6HD 3ITPA 2AWNA 2F0OA 4KV6A 2QKIC 4IURA 5KNBA 4HCSA 1TWHB 2WB1B 5I2XA 3MHBA 5CV5A 4FF1A 4KMUC 3CRLC 3QG1A 2Q8IB 5EKIA 1LTBD 3T56B 1E2WA 1JB3A 2BCOA 1PXUA 2PMZB 1HTLD 1EIHA 3A54A 1WTOA 4F8MA 3FDTA 4K5WA 4FF2A 5E4XA 1NCVA 1I4HA 4K14A 1PTOB 1ENCA 4FYDA 1DOKA 2A69C 2NN6H 5IIFA 5I9OA 3T4AC 3BS1A 1RTOA 3P1HA 2CVRA 5M3FB 3HKZB 4C1NI 5IGEA 1SYFA 2F0VA 2F0WA 4EQPA 3S16B 3QO2A 4KD3A 3IFDA 2Z8LA 4BWGB 5FLXE 1K8MA 2D9UA 1JWMD 1GHKA 2O2LD 4X3TA 4HEDA 4XQQA 3EVQA 3ZYYX 1SYDA 2IT1A 3OIQA 1F2MA 3HG9A 2O5IC 2F0SA 5JPMC 4RGMA 4K8IA 1LT3D 1TQOA 1FYCA 4QUCA 2D5DA 4EVOA 3URYA 3BG3A 4KI0A 2WKDA 5JEAH 4DK1A 2B2WA 1D1IA 4P2CB 1QE6A 1JOOA 1TY2A 1NUCA 5EPKA 2K5WA 2IX3A 3PIP3 1GJXA 4HAEA 3JAME 1IYVA 2PZTA 1OXTA 2IWHA 3HGBA 2RQXA 1B53A 3I72A 4A3IB 3S17B 1Y8OB 5T1GA 2M9VA 1O80A 5LL6X 4BS9A 2PYKA 4HR7B 3DUZA 4F7XA 1RD9D 3NWTA 4S3SA 3OHXC 5TSSA 1TS2A 2M00A 5JVG3 5T1IA 5EPJA 1H9JA 5FO8B 3R2IA 2ENBA 3LWUA 2L5TA 2KHSA 3TP5A 1HXYD 1LTAD 3VYRA 5KIXA 1EZ8A 2KA7A 4K5VA 1YNJC 2XN9C 3A56A 2K33A 3TBIB 4ZYSA 3NHHA 4DN4M 3M7GA 2ID0A 5K5PA 2EOTA 2Z4HA 2YU9B 1STEA 1U9RA 4G7ZC 1B2TA 5M9OA 2EJFC 2E74C 2L1BA 4DU9A 4HMJA 1LV9A 2BA1A 3GTLB 3GTJB 2HDLA 2DY7A 1S5FD 5G3LD 4KKTA 5BN5A 3VR4A 4C3HB 5I2YA 1GXDC 2EDGA 4J8QA 3SVMA 4PMCA 2PW5A 1WD1A 2L4NA 1STYA 1Y1WB 1EEFD 3EJIA 2K04A 3FVQA 4HMIA 1TY0A 1LT4D 2KOLA 4HSVA 1AZQA 2EY5A 2CW0C 1BO0A 1PTOF 3HOXB 5D3IB 1SNMA 1U4RA 1NSNS 2BOSA 2OXPA 4L8JA 1LT6D 2IX0A 5C6AA 1SNOA 2FMMA 3VR2A 2K03A 3RUZA 1RJTA 5CMDA 3D6CA 4L6TB 2WAQB 3KLSX 4OO1I 5FKAC 3RZDB 4X3SA 2B2VC 3OWFA 2HCCA 5KNCA 4ZAIA 1G2TA 1ZYRD 2A6EC 1A2UA 2MPMA 1VF7A 5ISRA 3X3MA 2XVSA 1LTSD 2WP8J 1JWSD 2NZ1D 5FO9B 2PO4A 4QUFA 4KN4C 2CQAA 3C1FA 2EPBA 1Z47A 1YNND 3DM1A 5M5XB 3A8KE 1Z7TA 4RCNA 4ZKCB 2G9HD 3KK7A 4V190 2NTTA 1SJED 3CU7A 3BDLA 4UAIA 3OIPA 1ILPA 5C4ZA 3S1QB 3HOVB 2KCNA 4B08A 1I4QA 1WTXA 5BN4A 3NTHA 1T5EA 3SXHA 2NVXB 2M2LA 3TMEA 1OXVA 5C3EB 1I4GA 1WCMB 1PRTD 2EJGC 5M5YB 1B3AA 1OO9B 4NW2A 3Q0AA 4KD4A 3D4RA 2JP1A 4FXDA 3TN2A 5C0XG 3DWPA 2F0TA 3SK4A 1KLGD 3TZUA 4RA8A 5FO7B 1S5CD 4BA1I 5KNDA 3A7LA 1IL8A 3HZXA 1S4ZA 4QIWB 5EKKA 2Q8RE 5I4DA 4A3BB 2EYMA 3NTKA 2WIIB 3BVZA 1U4LA 1S5ED 2B2TA 4IQZA 1TWAB 2F0LA 1GUSA 1RHPA 2I07B 5D14A 3M4YA 3I4LA 2EXZA 3OMCA 1SYEA 1J8IA 1D5XC 2FJ2A 2NN6I 3HOZB 1QWYA 3H0GB 1DM0B 5M3MB 3GTQB 2K6AA 3S2HB 5M5WB 3Q6SA 4TSSA 5D3DA 2EYFA 3GV3A 4KKSA 4C3IG 2KJXA 1PLFA 1HUNA 1K8OA 4R8NA 4G7OC 1STGA 2WINB 3I90A 3V96A 2F03A 2F0UA 4N9TA 4A93B 1H9SB 1DOMA 2JA5B 5I6YA 1WTRA 2B8FA 2RSOA 2LFNA 1Y1VB 3SHLA 3E6ZX 3K5OA 3I4NB 4IFDJ 1BQQT 1G291 1S5BD 2NVYB 1DYQA 1X3QA 1EY7A 2OEOA 1WTWA 3LX0A 2R92B 2F3VA 4M1UB 2O5JC 2B2TC 2LY7A 1DXMA 1PFMA 3BDOA 2L12A 1F9QA 1DJRD 1ZKOA 2LMCB 1WTPA 3LNNA 4BY1B 1KABA 4I7ZC 1IKMA 2HCIA 5CV4A 2AQ1B 2R61A 2AUJD 2F0FA 1PTOC 4J6HA 4H7BA 1TIID 3CRKC 3TP8A 1SMYC 1XYIA 1CT1D 2HUGA 4LJZC 3NBIA 1BCPF 5CV7A 5D65A 4K5XA 1VDZA 3MTSA 1JC7A 1SE3A 4K2KA 3H09A 4DK0A 1XX8A 1CA6A 2IPKD 5CC4A 5AFWA 2JXMB 4A3FB 1XTCD 2F1MA 4E6IA 2JE6I 4DA2A 4RKLA 1PFNA 2D62A 1T5XD 1QG7A 1M8AA 2K32A 1AP0A 1SNPA 3HOWB 2MGSA 2R3ZA 4G7HC 1PTOH 4KK7A 2J4XA 4O1NA 1Y69U 2EVBA 2KQ3A 3K5MA 1CK1A 4O42A 1RKNA 3GO5A 2XSCA 4EQOA 3BYTB 2F0EA 1BCPB 1EY0A 2F0DA 5C4HA 3VYSA 1LTRD 1NR4A 5EJWA 1C4QA 1DOLA 3FRPB 1EY6A 3QIAA 1CI3M 2F0HA 4B9WA 4H13C 4FF3A 5JOBA 2JEAI 4BBSB 1FGBD 2CHBD 1LTID 1TS3A 3LWEA 4AYBB 1B1ZA 3GTKB 4DNRB 5KYIA 1KDAA 4WORA 1RTNA 3EA6A 1ESFA 4FF4A 1R4PB 5FLXL 3PV0A 2IX1A 3IL8A 5G3LF 5CBEE 1F9PA 3VYUA 4ZQ3A 4XYQA 1K83B 4KY7A 1U4MA 1VF5C 3VA7A 3GP7A 2MP1A 3J81E 2EZVA 4PNYA 2NN6G 4B9XA 3C46A 3PUVA 4NMZA 2A5HA 1G91A 5E4WC 2BE5D 1TWGB 5CYUA 1EWHA 5ELBA 4IUQA 1Y8PB 3KBXA 1WVLA 1Z6HA 3P20A 3Q23A 2ZXOA 3KBGA 5EKLA 2RA4A 4C3JG 3M85A 2XWBB 2J0TD 4DAVA 1B4OA 3DEPA 1OXXK 1X32A 2N88A 2EJMA 5EGTA 3EQLC 1ENFA 2K01A 4IFDG 3C3LA 1CTMA 1J9OA 1EY4A 2SNSA 3QJYA 4PQXA 4Z9CB 1STHA 3MA2B 3PUWA 1FD7D 1SMYD 1BXTA 2GA4B 3SK5A 1SE4A 2E2JB 4IUPA 1I3QB 4F87A 2F0MA 1IW7D 2A6ED 2WKCA 4ZUIA 3H91A 4J1MA 1KNAA 4IFDI 5KEEA 1V1PA 4DF7A 1G2SA 1PRTF 4QF4A 3RMHA 3OW7A 2X69A 4FNFA 2XNAC 1HFNA 3R2TA 4C2MB 3S2DB 5ELFA 1M4VA 3SE0A 2XIWA 4KKUA 2L0CA 1UAPA 1IYUA 2YYZA 4A3DB 2B2YA 3MWYW 4Q5VA 4R8IA 1CZWA 3C2PA 3HOUB 1G6ZA 2NTSA 1Q90A 4F88A 4C56C 5IGGA 3HRZC 5DAUA 3IFTA 1QJOA 2B2WC 4ULLA 3BVMA 2QF7A 2EE1A 1HUMA 1EWCA 4LK1C 4Y7NB 1CHPD 5CV9A 2DY8A 4OO1H 2TSSA 3MZ5A 1STAA 1X3PA 1BNZA 1SDFA 1VMPA 5FOBB 4RGNA 1S5DD 1A3UA 5C5MA 5A35A 1TT2A 1A3VA 1EQVA 2C5CA 1HRJA 3L9AX 2D2CC 3SR1A 3W2DA 5CGKA 5IGBA 2B8GA 1D5MC 5IODA 3TDQA 1UUPA 1FR3A 1D5ZC 1E0BA 3HP3A 4TKOB 4RWSC 2E2HB 4QCLA 1EY5A 4IALA 2BA0A 1V1OA 1TS5A 1YNJD 2F4IA 1C8CA 1H9RA 5KGUA 1O7YA 5JPNC 3MC0B 2R93B 2XRSD 1MSHA 3S14B 1QB5D 3Q22A 3A8JE 4RCOA 1ZXTA 1DD2A 2F0IA 3KLRA 1KDBA 4TRDA 4DXFA 4RFBA 3WDNA 3R93A 3VR5A 4OIKA 3CKIB 1Q12A 4ODGA 3U9OA 1H9SA 3K5LA 3DWQA 3PMFA 3IKJA 4BY7B 3PUYA 3BZDB 2A68D 3W3AA 3QWNA 2NYZD 5LL6S 1KTKA 1OXSC 4G4KA 1F77A 4NDXA 2EYPA 2RSNA 3HOYB 5HURA 2OT2A 3PUXA 3QOLA 1EFID 2JYOA 3KLSA 2Y0SB 4KN7C 1D6EC 2E76C 1PRTC 1I4RA 3M3YB 2L55A 3MXGA 1RDPD 4PMWA 5EPLA 2B2UC 4A3JB 2JA7B 4DXGA 3EROA 3TZDA 1Q8IA 5DM73 3MXUA 1SYBA 4M8AA 1PRTB 2KEEA 3MVVA 3R8BA 3VA5A 2R7ZB 3NSWA 1CM9A 3MXNA 3O13A 4R9WA 3PIO3 1D2BA 4DFAA 5BN3A 1GHJA 2F0QA 3CHBD 2FHTA 4XXEA 5F2DA 2E2IB 3NP8A 3PO2B 3CQZB 2ZT9C 4CBVA 2FFKB 3M7NA 5DNFA 1GUNA 3OMGA 1FNWA 2AQ2B 3QB3A 1W6JA 4NKLA 1O78A 2H1EA 3NK9A 4CJ1B 2ICIA 1LT5D 3I70A 1ZEQX 2E75C 4MHEA 1E2ZA 1RODA 1IHZA 2JSOA 4IUVA 3H3VC 2I46A 4I65A 3BYYB 3T51B 1EQTA 2A69D 4DAYA 2IL8A 1Y8NB 3A7AB 4X3UA 5C0XI 3KUPA 1AFPA 1LTGD 3K0YA 3D8GA 3NPPA 5NUCA 4OGQC 2JA6B 4K6DA 2PNRC 2RBMA 1B44D 4ABNA 2F3WA 3J7YW 1PZJD 2RDFA 4BA2I 1EY8A 3TP7A 3GTOB 1DCZA 3SK8A 2ICEC 4YIJA 3MAQA 3M4OB 1STNA 1EYDA 4DNTB 1MBYA 1HCZA 2J7ZA 1CFMA 5EBCA 3DHQA 4WFN3 1XWEA 4EQNA 3ND9A 3UI2A 1MD2D 4CJ2C 3OPOA 1A2TA 3NTIA 1HA5A 3I4MB 1PTOD 5LHY1 1BCPC 3J7AV 1I50B 3NE5B 1F2ZA 2K1BA 5HGTA 5K36G 3VYTA 2NVQB 5CR3A 3GV6A 1V8QA 3MFYA 3PUZA 3R3OA 1JICA 1SJHD 2PQEA 1FNVA 1PDQA 2MJ8A 4LMQD 2PZUA 5C0XJ 5C44B 2SNMA 2K5DA 4RGOS 3A8IE 1SBBB 5A2QL 5JJZA 1SNCA 2SDFA 4K2LA 5J39A 2DN8A 3FKIB 1GUTA 2B2VA 1L0XB 2RDGA 4U673 2SOBA 2F0PA 2B2YC 2RKSA 3X3NA 1BDOA 1AN8A 4IN3A 1UNSA 1Q1EA 1LTTD 3SK6A 4JBWA 1SNDA 1JWUD 1EYAA 3H6MA 3FPUB 4CGYB 3RZOB 1PMRA 4OHJA 1LO5D 4OL7A 2VUMB 4UDUC 3NWSA 4FP5D 5C4XB 2EYOA 2JEBI 3AU7A 1F2LA 5C3XA 1II3A 1JQYD 5IGDA 2CW0D 4C3IB 1PFBA 3DEOA 2A73B 1EYCA 3VR3A 1R4QB 3OOCA 1HQMC 3H94A 3MFGA 1QNUA 1SEBD 2KUMA 3P75A 4CKBA 4QB4A 1JR0D 2SEBD 4K8JA 4L63B 2XRQD 2Z4IA 3AMUA 3T53B 4FO2A 4FXKC 1QILA 2VB2X 5FK9C 2XWJB 2QILA 2K28A 4ILWA 1EY9A 3RLFA 1CZGA 3BDCA 4C1NK 1AZPA 3RD4A 3ND8A 1PYWD 2C9OA 4XIGS 1JOKA 1STBA 5I6WA 4A3GB 3J80E 2QDBA 3DXJC 3J81L 2L9HA 5EQ0A 1KNEA 1YNNC 1V1PB 1QCBD 2E2DC 1F2YA 1TR5A 2KVMA 4XTCS 4A3MB 1ONLA 5ELDA 1O7LA 2MUYA 2NUCA 2NB0A 4WJWA 2O4XA 2F0GA 2PPBC 4C3HG 2F0JA 1XXGA 4IUNA 4HSPA 3MEHA 1JORA 2F0NA 4JK1C 2LS01 3ERQA 1ZYRC 4IFDH 2PZWA 1LABA 1VCIA 2EYHA 4K6LA 1KDCA 1EEID 2PW7A 1RF2D 3I91A 2K5QA 3WOEA 4H0LC 4EGVA 3BVGA 4RAUC 1SAPA 1MI2A 1CHQD 3TSSA 1IKLA 3T13A 4HN7A 3SEBA 2V4DA 1SXTA 1MGSA 1SYGA 1TVXA 5E1FA 2FINB 1DONA 1R9TB 1FNUA 4U68A 4IZ8A 4OIJA 2B39A 1SE2A 1SYCA 1U4PA 3V05A 1C48A 3S15B 4QMGA 4A3KB 1F9SA 3S1RB 1WTVA 3C1EA 1JCKB 3FMCA 5CBAE 3EFXD 1CA5A 2X6LA 2LKVA 5J1ZA 4CKEA 1DZ1A 4TQUS 4OO1G 4KY5A 1H9MA 3Q24A 3T16A 2N55A 1ET6A 1BR9A 1JE4A 2Q8TA 3K58A 3S1NB 3JAML 1AW7A 4HTHA 1BCPD 5CV8A 1TWFB 2K05A 4KJOA 2EY1A 1AEXA 1ET9A 3NUCA 5KYLA 1HA6A 2AWOA 3U9SA 4XYOA 1LACA 3V2TA 1A3TA 3FPPA 5C0XH 4ZKBB 1JOQA 3E0JA 2VXWA 3TP6A 1KAAA 1V43A 1BOSA 3MXPA 4MIUA 4XT1B 3F2UA 3GTMB 4DAPA 1QNKA 2KEDA 2WV6D 2X6GA 4WRDA 4A3EB 4H44C 5COYA 1TU2B 1HFGA 1QOHA 1GOZA 2AUKA 3DMUA 3L7ZC 5KRUA 1HHVA 3HEJA 4XQNA 2PCFB 3GTPB 3GQBA 1TKWB 2ZXPA 3GD7A 4KJNA 1E2VA 3KF8A 4KHZA 2FMCA 1WD0A 1I6VC 3J80L 3D31A 3S1MB 1NAPA 4RKBA 1CQFA 2NWGA 3QOJA 5K36H 1O7ZA 2KCCA 2BE5C 4NP5A 4XT3B 4MN3A 3S9WA 2R6GA 2EYLA 5IT9L 4GZYC 1LLRD 5C4JB 3IAYA 3NQIA 4PV1C 3G7LA 4Q0FA 1H9KA 3HS0C 2EYJA 4ZLTF 1EOTA 5E3FA 2AQ3B 1EZ6A 5JVH3 2L11A 4ME5A 4KTAA 1GUWA 1ILQA 1EU3A 4V0BA 3N52A 3NXWA 1SFOB 4KY6A 1G8ZD 1BBXC 1EL0A 4RHRA 3J7AF 2HQEA 1GUOA 4CKCA 3K7AB 1PZID 3D4DA 3PO3B 2OF1A 5IOCA 3DWAA 1ENAA 5JAVA 1EU4A 3I8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8J A;  1Y8O B;  1TKW B;  2A6H C;  1H9S A;  3GD7 A;  1Q90 A;  3N6R A;  3IKJ A;  1OXV A;  3PUY A;  3PUV A;  3IFT A;  1QJO A;  4G7H C;  2A68 D;  3W3A A;  1H9S B;  4HR7 B;  1Y69 U;  4OGQ C;  3RLF A;  3VR2 A;  2EJG C;  1OXU A;  2EVB A;  1E2V A;  1OXS C;  2BE5 D;  2PNR C;  2QF7 A;  2A69 C;  1EWH A;  2B8F A;  2NN6 H;  4KHZ A;  1B9M A;  1Y8P B;  1I6V C;  3A8I E;  4LK1 C;  1Z6H A;  3P20 A;  3AB9 A;  2K7V A;  3PUX A;  3D31 A;  4BA2 I;  3ND8 A;  1G29 1;  3D4R A;  1Q1B A;  4XIG S;  2DN8 A;  5KNC A;  1H9J A;  1GUT A;  4KN7 C;  2E76 C;  5K36 H;  1A6X A;  2KCC A;  2BE5 C;  3DXJ C;  3M85 A;  5JEA G;  5C0X G;  3FMC A;  2BDO A;  4OO1 H;  1DCZ A;  3LWU A;  2L5T A;  1YNN C;  1OXX K;  2EJM A;  2A6E C;  1IW7 C;  3EQL C;  2KA7 A;  2R6G A;  1YNJ C;  4DNT B;  4IFD G;  2O5J C;  3TZU A;  4GZY C;  1CTM A;  1VF7 A;  2K33 A;  4TQU S;  3VR6 A;  1BDO A;  4OO1 G;  3QJY A;  4XTC S;  1K8M A;  1Q1E A;  1HCZ A;  2DNE A;  3PUW A;  1HTP A;  1ONL A;  3A7L A;  1H9M A;  1HPC A;  4BA1 I;  5A35 A;  5KND A;  1GHK A;  3MXU A;  1GUG A;  1O7L A;  1DXM A;  2DNC A;  4PV1 C;  3BDO A;  4JBW A;  1CFM A;  2D2C C;  2IT1 A;  3QIA A;  1CI3 M;  1ZKO A;  1H9K A;  4G7Z C;  2LMC B;  2PPB C;  2B8G A;  3LNN A;  4H13 C;  4I7Z C;  4KN4 C;  2EJF C;  1PMR A;  2E74 C;  2JEA I;  2O5I C;  2AUJ D;  3SDZ A;  3ND9 A;  5BN3 A;  1IW7 D;  1GHJ A;  2A6E D;  1FYC A;  2BA1 A;  1FR3 A;  3A8K E;  3CRK C;  2D5D A;  4DNR B;  1Z7T A;  1SMY C;  2JEB I;  3BG3 A;  4KI0 A;  2A6H D;  4KKT A;  4JK1 C;  4TKO B;  2AWO A;  5BN5 A;  3U9S A;  4RCN A;  3VR4 A;  2ZT9 C;  1LAC A;  3OPO A;  4IQZ A;  3OW7 A;  4LJZ C;  1GUS A;  3FPP A;  5JEA H;  2EDG A;  2A68 C;  4DK1 A;  5C0X H;  3M7N A;  5KNB A;  2BA0 A;  3M4Y A;  1ZYR C;  1GUN A;  1VDZ A;  3I73 A;  3VR3 A;  3I4L A;  4IFD H;  1LAB A;  3OOC A;  1HQM C;  3PV0 A;  3H94 A;  1V43 A;  2NN6 I;  1VCI A;  1O78 A;  1B9N A;  1H9R A;  4KMU C;  4DK0 A;  3CRL C;  3QG1 A;  3SE0 A;  2Q8I B;  3NE5 B;  1GUO A;  2E75 C;  1VF5 C;  4H44 C;  1E2Z A;  4KKU A;  1TU2 B;  3T56 B;  3VA7 A;  5K36 G;  1E2W A;  1GJX A;  2JXM B;  3A8J E;  2AUK A;  1IYV A;  4H0L C;  1DD2 A;  3KLR A;  3T53 B;  5BN4 A;  1V8Q A;  1IYU A;  1OXT A;  2CW0 C;  2F1M A;  2YYZ A;  3L7Z C;  3MFY A;  2JE6 I;  3PUZ A;  3HGB A;  3WDN A;  4KKS A;  3VR5 A;  2PCF B;  2D62 A;  1K8O A;  3T51 B;  1T5E A;  4G7O C;  2A69 D;  2NN6 G;  3GQB A;  1Q12 A;  2K32 A;  3I72 A;  2V4D A;  1Y8N B;  3A7A B; 
#chains in the Genus database with same CATH topology
 2NZO A;  3FP9 A;  1NE3 A;  3N6R A;  3K6O A;  4A76 A;  3I4N G;  5JEA J;  2KEC A;  3UE1 A;  3JAM i;  1JMC A;  1I6H H;  1ML0 D;  1Q8K A;  1OXU A;  3K7U C;  2IJ0 A;  5C3E G;  3L3O C;  2IW3 A;  1Y1W H;  5BR8 L;  1VMC A;  4QGU A;  1HNZ L;  2B2U A;  4GNX C;  2B63 B;  3K57 A;  3OTO Q;  5IYD H;  2VUM G;  1SNQ A;  5C3W A;  2H5X A;  1Q1B A;  3NBH A;  1CQV A;  5AJ3 L;  4JV5 Q;  2AMC B;  3K59 A;  3GTQ H;  3E9H A;  5CV6 A;  4GKJ Q;  3I2Z A;  4XQJ A;  4MTK A;  1EIG A;  2BDO A;  2G9D A;  2HHH Q;  3HOZ H;  5IP7 H;  3K5N A;  1YEZ A;  4CHT B;  1WTQ A;  1WCM H;  1XMQ L;  1IW7 C;  2E5L Q;  5GAD C;  1X3F A;  4DR2 L;  3OSO A;  1B50 A;  5ELC A;  4PMB A;  2DNE A;  4AIM A;  1HTP A;  2H4O A;  4CDE C;  3A55 A;  3D4W A;  2KHI A;  2DNC A;  1RCV D;  1X6O A;  3M4Q A;  5IT9 E;  2NBF A;  2BDN A;  3ONA B;  4RH6 A;  4C3J B;  3F2C A;  4DV7 Q;  2UUB L;  2EY2 A;  4G57 A;  5C5L A;  5DM6 3;  5IGC A;  1MSG A;  4BBR H;  1I5F A;  5HGQ A;  1I4X A;  5IGF A;  2TMP A;  2QA4 A;  4DR2 Q;  2QCP X;  3FEW X;  1Q3L A;  5J22 A;  3OWE B;  4FVM A;  2A68 C;  1TS4 A;  4IUT A;  3VDY A;  3I73 A;  3BU2 A;  1ICW A;  4R1J A;  4XDX A;  4EQ5 A;  4N9P A;  3WWV A;  1XTD A;  4OEM B;  1X9N A;  3S15 H;  1B9N A;  4JV5 L;  1IBL Q;  2MHV A;  5AJ3 Q;  5I9P A;  1I4P A;  3D6W A;  1W6K A;  3OTO L;  3NQT A;  2RVL A;  4IUU A;  2VUM H;  2JA8 B;  2NVT B;  4LF9 Q;  4A3I H;  1EQQ A;  3S17 H;  2EY6 A;  4KHV A;  3E5S A;  4BBR B;  2Z1C A;  1E22 A;  1PHJ A;  4HCE A;  4FXG C;  2YTV A;  5FJ8 H;  4ZRZ A;  3WOF A;  2A74 C;  1ESR A;  1VQ4 A;  1TWC B;  1A15 A;  2A6H C;  4HIM A;  3GTG B;  2BH2 A;  4ID6 A;  1JJG A;  1BUV T;  4LAA A;  2HDM A;  1L0Y B;  3KFU A;  4ZUJ A;  1NR2 A;  1UEA B;  5EBD A;  5IE8 A;  4CJ0 B;  2VQE L;  1B9M A;  2ZTC A;  2WFW A;  5COR A;  3HFZ B;  1KAW A;  2K7V A;  3AB9 A;  4X3K A;  4JI8 L;  2JA8 G;  3I3C A;  4IO9 A;  4DR7 Q;  2WAC A;  4POF A;  4JBK A;  1A6X A;  4DGZ A;  5JEA G;  2ZXR A;  1SSO A;  1PZK D;  4LF7 L;  2VB3 X;  1M90 C;  2K52 A;  1KLU D;  3VR6 A;  3G6J B;  2F52 A;  1HPC A;  1I6H B;  4RHS A;  3GTG H;  5ELE A;  3I4N H;  1GUG A;  4RGT A;  3P7J A;  1F9R A;  1HQR D;  3D3R A;  4DV0 L;  1BF4 A;  3GTM H;  4A3D G;  4IPC A;  4AQY L;  5A2Q E;  1K0S A;  3SDZ A;  2RDH A;  4GLA C;  2F0K A;  1IBM L;  3HOW G;  2EQS A;  4ZK9 B;  5DEH A;  1D1K A;  2VNU D;  2QEJ C;  3AFP A;  2A6H D;  4NPS A;  2CWA A;  3ITP A;  2AWN A;  2F0O A;  4DAY B;  4KV6 A;  2QKI C;  4IUR A;  5KNB A;  3KDF B;  4HCS A;  1NY4 A;  1TWH B;  2IHE A;  2WB1 B;  1B3Q A;  5I2X A;  3MHB A;  5CV5 A;  4KMU C;  4FF1 A;  3CRL C;  3QG1 A;  1Y1V H;  2PI2 E;  2Q8I B;  5HY6 A;  5EKI A;  4JI0 Q;  1FVI A;  1LTB D;  3T56 B;  1M1K C;  1E2W A;  4HID A;  1ASY A;  1JB3 A;  2BCO A;  1QZG A;  1PXU A;  4A3G G;  2PMZ B;  3RLN A;  3GTJ H;  3GTL H;  1HTL D;  1EIH A;  2K5V A;  3A54 A;  1WTO A;  2DJG C;  1X3G A;  4F8M A;  4BY7 G;  3FDT A;  4K5W A;  3UE0 A;  4FF2 A;  4I7A A;  1NCV A;  5E4X A;  1I4H A;  1XNQ L;  4K14 A;  1PTO B;  4DR3 Q;  1ENC A;  4P72 A;  1IL2 A;  4FYD A;  1DOK A;  2A69 C;  2NN6 H;  1PFS A;  5IIF A;  1HNX L;  5I9O A;  1LM0 A;  3T4A C;  3BS1 A;  1RTO A;  3P1H A;  2CVR A;  2Y0S G;  5M3F B;  4KHP L;  1VQH A;  3HKZ B;  4C1N I;  2Q2I A;  1HNX Q;  5IGE A;  1SYF A;  2VZA A;  3PF5 A;  1X3E A;  1FJG Q;  2F0V A;  2F0W A;  4EQP A;  1QZH A;  3S16 B;  3QO2 A;  2RCF A;  4KD3 A;  1GVP A;  4YHH Q;  3L0O A;  3IFD A;  2Z8L A;  1XNQ Q;  4BWG B;  5FLX E;  3PO3 G;  1K8M A;  2D9U A;  1JWM D;  4X62 L;  3JC6 6;  1GHK A;  2O2L D;  4X3T A;  4HED A;  1VQA A;  4XQQ A;  3EVQ A;  3ZYY X;  2VS1 A;  1SYD A;  2IT1 A;  2K5N A;  1KHI A;  3GTP H;  2N8N A;  2I5M X;  1F2M A;  3OIQ A;  5FLM G;  4A3M H;  3HG9 A;  5M5Y H;  2F0S A;  2O5I C;  2Q2H A;  2OCE A;  5JPM C;  2MFI A;  4RGM A;  4K8I A;  1JJ2 A;  2Q2U A;  1LT3 D;  1TQO A;  1FYC A;  4QUC A;  2D5D A;  4EVO A;  3URY A;  3BG3 A;  4KI0 A;  4NXM L;  4DR4 Q;  1D8L A;  2WKD A;  3ER0 A;  4JI1 Q;  4DK1 A;  2B2W A;  5JEA H;  1D1I A;  2Z6K A;  4P2C B;  2LXJ A;  1QE6 A;  4LWC A;  1JOO A;  2UXD L;  1TY2 A;  1NUC A;  2R7D A;  5EPK A;  3KJO A;  1PA6 A;  3F1Z A;  1IBM Q;  1E1T A;  5IYD G;  2K5W A;  2HQL A;  2IX3 A;  3PIP 3;  1GJX A;  4YY3 Q;  4HAE A;  3JAM E;  1IYV A;  2PZT A;  1OXT A;  2IWH A;  2B29 A;  3HGB A;  4K0K Q;  4GOP C;  3CPF A;  2RQX A;  4B3R Q;  1VQG A;  1B53 A;  4PZ8 A;  4J15 A;  3I72 A;  4A3I B;  3S17 B;  1Y8O B;  5T1G A;  2M9V A;  4LF7 Q;  1O80 A;  5LL6 X;  4BS9 A;  2PYK A;  1YIT A;  4HR7 B;  2K14 A;  3DUZ A;  4F7X A;  1L1O C;  1RD9 D;  4A75 A;  3NWT A;  4S3S A;  3KF8 B;  4DR7 L;  3OHX C;  4ZCK A;  1TS2 A;  1B8A A;  5TSS A;  2M00 A;  4JI6 L;  3S16 H;  5JVG 3;  3I4O A;  5T1I A;  2ZJQ A;  5EPJ A;  3ULP A;  1H9J A;  4DV5 Q;  4LF8 L;  5M5W H;  5FO8 B;  3R2I A;  2ENB A;  3LWU A;  2L5T A;  1VQ8 A;  2KHS A;  3TP5 A;  1HXY D;  1N36 Q;  1LTA D;  3VYR A;  5KIX A;  1EZ8 A;  2KA7 A;  2XN9 C;  4K5V A;  1YNJ C;  1VQI A;  3A56 A;  2K33 A;  3TBI B;  1VQ5 A;  4ZYS A;  3NHH A;  4BXX H;  4DN4 M;  4BY7 H;  3M7G A;  2ID0 A;  5K5P A;  2EOT A;  2Z4H A;  1TWG H;  2YU9 B;  2D0P A;  1STE A;  1U9R A;  4UP8 A;  4G7Z C;  1B2T A;  5M9O A;  3S2D H;  2EJF C;  1MKH A;  2E74 C;  2L1B A;  4DU9 A;  1QVF A;  4HMJ A;  1LV9 A;  2BA1 A;  3GTJ B;  3GTL B;  2HDL A;  3EIV A;  2DY7 A;  1S5F D;  3K8A A;  5G3L D;  2CWP A;  4KKT A;  1B7Y B;  2KEN A;  5FJ8 G;  5BN5 A;  3VR4 A;  4C3H B;  5I2Y A;  1GXD C;  2EDG A;  4J8Q A;  2JA5 H;  3SVM A;  1EOV A;  4HJA A;  4PMC A;  2PW5 A;  1WD1 A;  2L4N A;  1STY A;  3B6Y A;  1HNW L;  4HJ5 A;  4YWL A;  1Y1W B;  1I94 L;  1EEF D;  3EJI A;  2K04 A;  3FVQ A;  4HMI A;  3K7A H;  1TY0 A;  1LT4 D;  2KOL A;  4DV7 L;  4HSV A;  1AZQ A;  2EY5 A;  2Q2T A;  2CW0 C;  1BO0 A;  1PTO F;  3HOX B;  5D3I B;  1SNM A;  1VQB A;  1U4R A;  2HIV A;  4LUZ A;  1NSN S;  2BOS A;  1L0W A;  2OXP A;  1A62 A;  4L8J A;  1LT6 D;  2IX0 A;  5LMU Q;  4DR5 Q;  2E5L L;  5C6A A;  1SNO A;  4OWX B;  1BBW A;  2FMM A;  3VR2 A;  2LSS A;  2K03 A;  3RUZ A;  1RJT A;  2N78 A;  5CMD A;  3D6C A;  3H3V I;  4L6T B;  4LF5 Q;  2WAQ B;  5LMN W;  3KLS X;  4OO1 I;  3S24 A;  3FHW A;  5FKA C;  5LMN L;  3RZD B;  4NXN L;  4X3S A;  1UWV A;  2B2V C;  3OWF A;  2HCC A;  5KNC A;  2JA9 A;  3W1B A;  1Q7Y C;  5BR8 Q;  4ZAI A;  3CQZ H;  1EIY B;  1G2T A;  1ZYR D;  3MXN B;  3CCJ A;  2A6E C;  4DV1 L;  1A2U A;  2MPM A;  4QQB X;  1VF7 A;  4IOA A;  2NVQ H;  1E3P A;  5ISR A;  3X3M A;  1QVG A;  2XVS A;  1LTS D;  2WP8 J;  1JWS D;  1K83 H;  2I5L X;  1KL9 A;  2NZ1 D;  5FO9 B;  2PO4 A;  4QUF A;  1K8A C;  4KN4 C;  1W3S A;  2CQA A;  3C1F A;  2EPB A;  2ZM6 Q;  4A3B G;  1Z47 A;  1NNX A;  1YNN D;  3DM1 A;  5M5X B;  3A8K E;  1KIX A;  1Z7T A;  4JI7 Q;  4RCN A;  1SMX A;  4ZKC B;  4YWK A;  2KCT A;  2QGQ A;  4DR1 Q;  2G9H D;  4YCV A;  1ASZ A;  3KK7 A;  4V19 0;  2NTT A;  1SJE D;  3CU7 A;  2CFM A;  3BDL A;  4UAI A;  4NXN Q;  3S1M H;  3PCO B;  2B63 G;  5LMN Q;  3OIP A;  1ILP A;  5C4Z A;  3S1Q B;  3HOV B;  2KCN A;  2YTX A;  1I4Q A;  4B08 A;  4C3J H;  1WTX A;  5BN4 A;  5J3B A;  4GN5 A;  4AH6 A;  4EX5 A;  1XMO L;  1IZ6 A;  1ICF B;  3NTH A;  1T5E A;  1YBY A;  3SXH A;  3AYH B;  2NVX B;  2M2L A;  3TME A;  3TRZ A;  1OXV A;  5C3E B;  4GNX B;  1I4G A;  1WCM B;  1W2B A;  1PRT D;  2EJG C;  3K81 C;  5M5Y B;  1WTH A;  1B3A A;  3CCM A;  4B3M Q;  3A74 A;  1OO9 B;  1QUQ B;  4NW2 A;  3Q0A A;  4KD4 A;  3D4R A;  2VW9 A;  1I94 Q;  1PH2 A;  2E2J H;  1HNW Q;  2JP1 A;  4FXD A;  3TN2 A;  5C0X G;  3DLL A;  3DWP A;  2F0T A;  3SK4 A;  3UDI A;  4OWT B;  2UU9 Q;  1KLG D;  3TZU A;  4RA8 A;  1CKM A;  5FO7 B;  3OW2 A;  1S5C D;  4BA1 I;  5KND A;  3A7L A;  1IL8 A;  3HZX A;  1S4Z A;  4QIW B;  3KYH C;  5EKK A;  3TQY A;  1YJW A;  4UPA A;  3G4S A;  3S14 H;  4A93 H;  2Q8R E;  5I4D A;  4A3B B;  5GAE C;  2EYM A;  2YTY A;  2HIX A;  1E1O A;  1VQ7 A;  3NTK A;  4DV2 L;  4B3S Q;  2IHF A;  2WII B;  2RF4 A;  5JJL A;  3BVZ A;  1U4L A;  1VQN A;  2I0Q A;  3HOU G;  1S5E D;  2B2T A;  4IQZ A;  1TWA B;  2F0L A;  4DV4 Q;  1GUS A;  1N36 L;  1HR0 W;  1RHP A;  2I07 B;  5D14 A;  3M4Y A;  3I4L A;  4A3F G;  2EXZ A;  3K80 C;  3OMC A;  1SYE A;  1J8I A;  1D5X C;  2FJ2 A;  2NN6 I;  2A1A A;  3CCE A;  2VY3 A;  4A3I G;  3HOZ B;  1QWY A;  1NMG A;  3H0G B;  1R9T H;  1DM0 B;  5M3M B;  3GTQ B;  2K6A A;  3S2H B;  5M5W B;  2VL6 A;  3Q6S A;  4TSS A;  5D3D A;  1MIU A;  2EYF A;  3GV3 A;  4KKS A;  4C3I G;  2KJX A;  1PLF A;  5IYB H;  1HUN A;  1EIF A;  1K8O A;  4R8N A;  4G7O C;  1STG A;  2RHS B;  2WIN B;  3I90 A;  3V96 A;  4GN3 B;  2F03 A;  4B3R L;  2F0U A;  4K0K L;  4N9T A;  4GLV B;  4A93 B;  1H9S B;  1DOM A;  4TVA B;  3M4O H;  4LF6 Q;  2JA5 B;  3F2D A;  3A5Z B;  5I6Y A;  1WTR A;  2B8F A;  3CF5 A;  2RSO A;  3PQI A;  2LFN A;  5IP9 H;  1GD7 A;  4C3H H;  1S40 A;  1C9O A;  1Y1V B;  2K4K A;  3SHL A;  3E6Z X;  3K5O A;  3I4N B;  4IFD J;  1BQQ T;  5M3F G;  4IJL A;  3PO3 H;  1G29 1;  1S5B D;  2NVY B;  1DYQ A;  1X3Q A;  1L1O A;  2QDL A;  3UDF A;  1EY7 A;  2OEO A;  4LF6 L;  1WTW A;  3E3X A;  3LX0 A;  1N8R C;  2R92 B;  1CKN A;  5C4X H;  2F3V A;  2ALY B;  4M1U B;  3CP0 A;  2YU9 H;  2O5J C;  2PQA B;  2B2T C;  3AQQ A;  4A3D H;  1PH6 A;  2LY7 A;  4P71 A;  1DXM A;  1PFM A;  4A3C G;  3BDO A;  2L12 A;  1F9Q A;  1DJR D;  4MZ9 A;  1ZKO A;  1DGS A;  2LMC B;  5EAY A;  1HZA A;  3LNN A;  1KAB A;  1WTP A;  4I7Z C;  4BY1 B;  1A63 A;  1IKM A;  2HCI A;  5CV4 A;  2AQ1 B;  2R61 A;  2AUJ D;  2F0F A;  1PTO C;  4J6H A;  4H7B A;  2HD3 A;  1TII D;  3CRK C;  2IY5 B;  4R4C A;  3TP8 A;  3IRB A;  4X62 Q;  1SMY C;  1XPU A;  1XYI A;  4LFA Q;  1CT1 D;  2HUG A;  3KJP A;  4A3M G;  4LJZ C;  4YHH L;  2Z6B A;  4HJ8 A;  4LUO A;  3NBI A;  4DK3 C;  1BCP F;  5CV7 A;  5D65 A;  4K5X A;  1VDZ A;  3RR5 A;  3MTS A;  1JC7 A;  3CMA A;  1SE3 A;  4DV4 L;  4K2K A;  3CC2 A;  4LF4 Q;  3H09 A;  2Z9H A;  4DK0 A;  1XX8 A;  3H15 A;  4DV2 Q;  2CH4 A;  4DUZ Q;  1CA6 A;  3CCQ A;  5GAH C;  2IPK D;  5CC4 A;  5AFW A;  2JXM B;  2MQH A;  4A3F B;  2E2I H;  1XTC D;  2F1M A;  4E6I A;  1Y14 B;  1PYB A;  1GM5 A;  2JE6 I;  3Q8D A;  4DA2 A;  2PQA A;  4RKL A;  1PFN A;  2D62 A;  1T5X D;  1QG7 A;  1M8A A;  2K32 A;  3M4P A;  1AP0 A;  1MJE A;  1SNP A;  2D0O A;  3NEM A;  1C7Y A;  3KF6 B;  3HOW B;  2MGS A;  2R3Z A;  4G7H C;  2UUA Q;  2QEX A;  1PTO H;  4KK7 A;  2J4X A;  2QW7 A;  4O1N A;  2Y0S E;  1Y69 U;  2EVB A;  1VQL A;  2KQ3 A;  3K5M A;  2OQK A;  1CK1 A;  2K75 A;  3J7Z C;  4O42 A;  1SR3 A;  1RKN A;  1FL0 A;  3GO5 A;  4OEL B;  2XSC A;  4EQO A;  1YIJ A;  4A3E H;  3BYT B;  2F0E A;  2OTL A;  1BCP B;  1EY0 A;  2F0D A;  4P75 A;  4IOC A;  5C4H A;  4N8F A;  2EXD A;  3VYS A;  3PIO A;  3L2P A;  4WJ3 M;  1LTR D;  1NR4 A;  1CSQ A;  3G71 A;  3SGI A;  5EJW A;  3A0J A;  1PYS B;  2DJF C;  1C4Q A;  4UHV A;  1DOL A;  3FRP B;  2KHJ A;  1XMO Q;  1HJP A;  1EY6 A;  3QIA A;  4HIK A;  1CI3 M;  3RZO H;  2F0H A;  4B9W A;  2R7F A;  4DV0 Q;  4H13 C;  4FF3 A;  2XTI A;  5JOB A;  2JEA I;  4BBS B;  1FGB D;  2CHB D;  1YI2 A;  5E7N A;  1LTI D;  1TS3 A;  3LWE A;  4AYB B;  1B1Z A;  3GTK B;  4DNR B;  1VQC A;  1KDA A;  5KYI A;  4WOR A;  1RTN A;  3CCU A;  2ZJP A;  1UEB A;  3EA6 A;  1ESF A;  5IP7 G;  5JJK A;  4FF4 A;  4DR1 L;  1WOC A;  1R4P B;  1AE2 A;  4JI4 Q;  3STB C;  5FLX L;  3D0F A;  3PV0 A;  2IX1 A;  3IL8 A;  5G3L F;  5CBE E;  2L15 A;  1F9P A;  3H3V H;  3VYU A;  4ZQ3 A;  4XYQ A;  1K83 B;  1HR0 L;  4JI8 Q;  4KY7 A;  1U4M A;  2JA6 H;  1VF5 C;  2Z0S A;  3VA7 A;  3S1R H;  3G48 A;  4LFC L;  2ZM6 L;  4NB3 A;  3ULL A;  1TWF H;  3GP7 A;  3RNU A;  2MP1 A;  3J81 E;  4A3B H;  2EZV A;  4PNY A;  4P74 A;  3S2H H;  2NN6 G;  4B9X A;  1BVS A;  4GKK Q;  3C46 A;  1JT8 A;  3PUV A;  4NMZ A;  1XPR A;  2A5H A;  1G91 A;  5E4W C;  2BE5 D;  1TWG B;  5CYU A;  2UXB Q;  1EWH A;  4LF9 L;  5ELB A;  4IUQ A;  1Y8P B;  1E24 A;  3KBX A;  4OXP A;  1WVL A;  1Z6H A;  3P20 A;  5DLQ E;  3Q23 A;  2ZXO A;  2V1C C;  3RN5 A;  3KBG A;  1N34 L;  3ICE A;  5EKL A;  2RA4 A;  4LF5 L;  4QY7 A;  1YZ6 A;  2PI2 A;  2NVT H;  2RHQ B;  4C3J G;  3M85 A;  2XWB B;  2J0T D;  4DAV A;  4QJF A;  1VQ6 A;  1B4O A;  3DEP A;  1OXX K;  1X32 A;  2N88 A;  2EJM A;  5EGT A;  3EQL C;  1ENF A;  2K01 A;  4IFD G;  4GN4 B;  3C3L A;  1CTM A;  1J9O A;  5IT9 c;  1EY4 A;  4DR5 L;  2SNS A;  2N49 A;  3QJY A;  4PQX A;  4Z9C B;  1SLJ A;  1STH A;  3MA2 B;  3PUW A;  3T1H L;  1OTC A;  1VQE A;  1FD7 D;  1SMY D;  1BXT A;  2UUB Q;  4JYA L;  1Q82 C;  2OWO A;  3HOV G;  2GA4 B;  3SK5 A;  1SE4 A;  2E2J B;  4IUP A;  4JYA Q;  1I3Q B;  4R4Q A;  2KCM A;  4F87 A;  2F0M A;  3PGZ A;  1PH5 A;  1IW7 D;  2DUD A;  2A6E D;  2WKC A;  4ZUI A;  3H91 A;  2JA7 G;  4J1M A;  1KNA A;  4IFD I;  5KEE A;  3S1Q H;  1VQF A;  1V1P A;  4DF7 A;  1G2S A;  1PRT F;  4QF4 A;  3RMH A;  3OW7 A;  1XMQ Q;  2X69 A;  1QVC A;  4L5R C;  4FNF A;  4JOI C;  4BBS G;  2XNA C;  1HFN A;  2HHH L;  2HT1 A;  3R2T A;  4C2M B;  3S2D B;  5ELF A;  1BBU A;  1M4V A;  3SE0 A;  2XIW A;  3BJU A;  2R93 G;  4Y52 H;  2WB1 E;  2NZH A;  1YNX A;  4KKU A;  2L0C A;  1UAP A;  1IYU A;  2YYZ A;  4A3D B;  2B2Y A;  4DNI A;  3MWY W;  4Q5V A;  4R8I A;  1CZW A;  3C2P A;  3HOU B;  4X64 L;  1RIP A;  1BKB A;  1G6Z A;  1VQD A;  2NTS A;  1NBW A;  1A8V A;  1Q90 A;  2ASB A;  3AEV A;  3CCL A;  1SE8 A;  4YWM A;  4F88 A;  4C56 C;  5IGG A;  3J81 j;  3HRZ C;  5DAU A;  3IFT A;  4DV6 Q;  1QJO A;  2B2W C;  4ME3 A;  5C44 H;  4ULL A;  3U4Z A;  3BVM A;  2NVY H;  2QF7 A;  4LF8 Q;  2EE1 A;  4LFC Q;  3PSI A;  4JI2 L;  1HUM A;  1EWC A;  4LK1 C;  3CC4 A;  1HR0 Q;  4Y7N B;  4MTN A;  1PH1 A;  1YHB A;  1CHP D;  5CV9 A;  4YCW A;  2DY8 A;  3FKI H;  1G51 A;  1K3B C;  1WYD A;  4OO1 H;  2E2H H;  2TSS A;  3MZ5 A;  1STA A;  4JI5 L;  1X3P A;  4APV A;  1BNZ A;  1SDF A;  1VMP A;  5FOB B;  2AHO B;  4RGN A;  3PO2 H;  2JN4 A;  1S5D D;  1V9P A;  1A3U A;  3KDF A;  5C5M A;  1J6Q A;  5A35 A;  1TT2 A;  1A3V A;  4OON A;  1EQV A;  2C5C A;  1HRJ A;  3L9A X;  2D2C C;  1SRO A;  3SR1 A;  3W2D A;  5CGK A;  5IGB A;  1XJV A;  2B8G A;  1D5M C;  5IOD A;  2R7Z H;  1X55 A;  4JOI A;  4L5S A;  3TDQ A;  1UUP A;  1FR3 A;  1D5Z C;  1E0B A;  3HP3 A;  1CKO A;  3RZD H;  4FDB A;  4TKO B;  4RWS C;  2UXD Q;  2E2H B;  3CPW A;  4QCL A;  1EY5 A;  4IAL A;  4DR6 Q;  2BA0 A;  1V1O A;  4H02 A;  4JI1 L;  2E8G A;  1TS5 A;  1YNJ D;  2F4I A;  1C8C A;  4BY1 H;  1IYJ B;  4GNX A;  4NXM Q;  1H9R A;  5KGU A;  1O7Y A;  4C3I H;  5JPN C;  3MC0 B;  2R93 B;  2XRS D;  1MSH A;  1JB7 A;  3S14 B;  1QB5 D;  1EQR A;  3A8J E;  4RCO A;  3Q22 A;  1ZXT A;  1DD2 A;  2F0I A;  3KLR A;  1KDB A;  4JVZ A;  4TRD A;  4DXF A;  4RFB A;  2B63 H;  3WDN A;  3R93 A;  2UUA L;  4X66 Q;  1XNR L;  1K0R A;  4N8X 1;  3VR5 A;  1FGU A;  4RMF A;  4OIK A;  3CKI B;  1KRT A;  3DM3 A;  1Q12 A;  5GQO A;  4ODG A;  5IP9 G;  4KLK A;  3U9O A;  1H9S A;  2XGT A;  3K5L A;  3DWQ A;  3PMF A;  3IKJ A;  4BY7 B;  3PUY A;  3BZD B;  2A68 D;  5IYB G;  3W3A A;  3QWN A;  2NYZ D;  5LL6 S;  1KTK A;  1PH4 A;  1OXS C;  4G4K A;  1F77 A;  4NDX A;  1S72 A;  1FJG L;  2EYP A;  2RSN A;  5GAG C;  3F8T A;  4IPH A;  3HOY B;  5HUR A;  2OT2 A;  3HKZ G;  4DUZ L;  3PUX A;  3QOL A;  1EFI D;  2JYO A;  5FLX c;  2R93 H;  4A3K G;  3GDE A;  3KLS A;  2Y0S B;  3KF6 A;  2MNA A;  4KN7 C;  1D6E C;  2E76 C;  2GN5 A;  1PRT C;  1I4R A;  3M3Y B;  4UY8 C;  2F3I A;  2L55 A;  1SFO H;  3MXG A;  3A5U A;  1RDP D;  4PMW A;  4DUY L;  5EPL A;  2B2U C;  4A3J B;  2JA7 B;  4DXG A;  3ERO A;  3TZD A;  1Q8I A;  5DM7 3;  3CXC A;  3MXU A;  1SYB A;  2K5H A;  1Y1V G;  1HZ9 A;  4M8A A;  3H0G H;  3STB D;  2EIF A;  1PRT B;  3MVV A;  2KEE A;  3R8B A;  3VA5 A;  2R7Z B;  3NSW A;  1CM9 A;  3MXN A;  3O13 A;  4R9W A;  3PIO 3;  1D2B A;  4DFA A;  5BN3 A;  1GHJ A;  2F0Q A;  3CHB D;  4JI0 L;  2FHT A;  1YHA A;  1CSP A;  2YV5 A;  4XXE A;  5F2D A;  3I7F A;  3NP8 A;  4A3F H;  2E2I B;  3PO2 B;  3CQZ B;  2ZT9 C;  2ES2 A;  4CBV A;  3HOX G;  2FFK B;  3M7N A;  5DNF A;  1GUN A;  3OMG A;  1FNW A;  3I4M G;  4DKA C;  2AQ2 B;  3QB3 A;  2UXC L;  1W6J A;  4NKL A;  2Z6K C;  1O78 A;  2CQO A;  5M3M G;  2H1E A;  3NK9 A;  4CJ1 B;  2ICI A;  1LT5 D;  3I70 A;  2JJQ A;  1ZEQ X;  4JCV E;  2E75 C;  4MHE A;  1E2Z A;  1ROD A;  1IHZ A;  1S3O A;  2JSO A;  4IUV A;  4GOP A;  3H3V C;  2I46 A;  1EWI A;  4I65 A;  1CUK A;  3BYY B;  3T51 B;  1WCM G;  4R4O A;  1EQT A;  2A69 D;  4DAY A;  3HOU H;  1TXY A;  4A3J H;  2IL8 A;  1Y8N B;  3A7A B;  1VQP A;  4AYB G;  4X3U A;  5C0X I;  3KUP A;  2JA5 G;  1N33 Q;  1AFP A;  1LTG D;  3K0Y A;  5L37 A;  3T1Y L;  3D8G A;  3NPP A;  3E0E A;  5NUC A;  4OGQ C;  2JA6 B;  4K6D A;  2PNR C;  2ZTE A;  2RBM A;  1B44 D;  4ABN A;  3HOV H;  2F3W A;  3J7Y W;  1PZJ D;  2RDF A;  5H1S E;  2MO0 A;  4BA2 I;  4YCU A;  1EY8 A;  4JI2 Q;  2VQE Q;  3ZJY C;  4C2M H;  3TP7 A;  3M9B A;  2NVX H;  3GTO B;  4X65 L;  1EFW A;  1DCZ A;  3SK8 A;  2ICE C;  4JW0 A;  4YIJ A;  4DV6 L;  3MAQ A;  4JI3 Q;  1K28 A;  3M4O B;  1STN A;  1EYD A;  4DNT B;  1MBY A;  4ALP A;  3RLO A;  3ERS X;  1G6P A;  3BZK A;  4A3E G;  1HCZ A;  3MEF A;  4X64 Q;  2J7Z A;  5C4X G;  3U58 A;  1CFM A;  1PH8 A;  5EBC A;  1QUQ A;  3DHQ A;  4WFN 3;  4A4I A;  1XWE A;  3NBH B;  1AH9 A;  4EQN A;  5JJI A;  3ND9 A;  1Q81 C;  5M3F H;  3J80 c;  1Q86 C;  3UI2 A;  1PV4 A;  1MD2 D;  4CJ2 C;  4A3K H;  1IBL L;  2G5D A;  2UU9 L;  3OPO A;  1A2T A;  4GS3 A;  3NTI A;  2JK8 A;  2JA7 H;  1HH2 P;  1HA5 A;  3I4M B;  4R4T A;  2MO1 A;  4L5Q A;  1PTO D;  5LHY 1;  1BCP C;  3J7A V;  2VQF L;  1K9M C;  4DK6 C;  1I50 B;  3NE5 B;  4JG2 A;  1F2Z A;  2K1B A;  3PF4 A;  5HGT A;  4JBM A;  5K36 G;  4B3M L;  3VYT A;  1CKN B;  2A8V A;  2P5Z X;  1A0I A;  2NVQ B;  5CR3 A;  1K73 C;  3GV6 A;  1V8Q A;  3MFY A;  1WFQ A;  2R92 G;  3PUZ A;  3R3O A;  4IJH A;  1JIC A;  1SJH D;  2PQE A;  1KC8 C;  1FNV A;  1PDQ A;  2MJ8 A;  3T1H Q;  1HZB A;  2ATW A;  4LMQ D;  2PZU A;  5C0X J;  5C44 B;  3TRE A;  1VQO A;  4A3L H;  1GO3 E;  2SNM A;  2K5D A;  4RGO S;  2F4V Q;  4GKJ L;  3JAM c;  3A8I E;  1SBB B;  5A2Q L;  4Y7N H;  1YJ9 A;  4B3T L;  5JJZ A;  1N34 Q;  1SNC A;  2SDF A;  4K2L A;  5J39 A;  1H95 A;  2DN8 A;  3J80 i;  3FKI B;  3AFQ A;  1GUT A;  1EYG A;  1WJJ A;  2B2V A;  1HNZ Q;  3QR8 A;  1L0X B;  1N32 Q;  2UXB L;  2RDG A;  2WAQ E;  4U67 3;  5IWA L;  4O0A A;  2SOB A;  2F0P A;  2B2Y C;  1U5K A;  2RKS A;  3X3N A;  4JC0 A;  4GKK L;  4POG A;  1BDO A;  1AN8 A;  4IN3 A;  1UNS A;  2UUC L;  1Q1E A;  3LGJ A;  4DV3 Q;  1D7Q A;  1LTT D;  3SK6 A;  4JBW A;  1SND A;  1JWU D;  1EYA A;  1B70 B;  3H6M A;  3FPU B;  4CGY B;  3RZO B;  1PMR A;  4OHJ A;  1J5E Q;  3NEL A;  1LO5 D;  4PG3 A;  1MJC A;  2CH4 W;  4OL7 A;  3TS2 A;  2JA8 H;  2VUM B;  3NEN A;  3NWS A;  4FP5 D;  4UDU C;  5C4X B;  2EYO A;  2JEB I;  3UDX A;  3AU7 A;  1F2L A;  5C3X A;  1II3 A;  1JQY D;  5IGD A;  4LNQ A;  2CW0 D;  4C3I B;  4DV1 Q;  1XPO A;  1PFB A;  1YVC A;  3DEO A;  5IWA Q;  1EUJ A;  1EYC A;  2A73 B;  3VR3 A;  1R4Q B;  1UE1 A;  1KRS A;  5C3E H;  4JI4 L;  3OOC A;  1HQM C;  2GVB A;  1LTL A;  3H94 A;  2PNH A;  1N32 L;  3MFG A;  1QNU A;  1SEB D;  5IY0 A;  1MHW C;  2KUM A;  4HIO A;  3P75 A;  4CKB A;  4QB4 A;  1JR0 D;  4B3T Q;  2SEB D;  4K8J A;  4L63 B;  5C4J H;  2F4V L;  2XRQ D;  2Z4I A;  3AMU A;  3T53 B;  1IBK Q;  2JA6 G;  4FO2 A;  1PH3 A;  3E9I A;  4FXK C;  2OQ0 A;  1QIL A;  2UUC Q;  1P8L A;  2ZJR A;  5LMU L;  2VB2 X;  5FK9 C;  2XWJ B;  1Y1W G;  2QIL A;  2K28 A;  4ILW A;  1KQS A;  3CCS A;  1EY9 A;  3RLF A;  1CZG A;  2GVA A;  4L5T A;  4CDF C;  3BDC A;  4HJ9 A;  4C1N K;  1Z9F A;  1AZP A;  1KD1 C;  3RD4 A;  3HOZ G;  3ND8 A;  1PYW D;  2C9O A;  2VQF Q;  1TWH H;  4XIG S;  1JOK A;  1SRU A;  1STB A;  5I6W A;  3U4V A;  4A3G B;  3J80 E;  2QDB A;  3DXJ C;  3J81 L;  2L9H A;  5EQ0 A;  1KNE A;  3ULJ A;  1YNN C;  1V1P B;  1QCB D;  1U0L A;  2E2D C;  4OX9 L;  1F2Y A;  2LXK A;  1TR5 A;  2KVM A;  4XTC S;  2AKW B;  4A3M B;  1ONL A;  5ELD A;  3F2B A;  1O7L A;  2I5H A;  2MUY A;  2NUC A;  2WB1 G;  3TEH B;  2NB0 A;  4GOP B;  4WJW A;  2O4X A;  2F0G A;  3KOJ A;  2PPB C;  4C3H G;  4HJ7 A;  1P16 A;  2F0J A;  1XXG A;  4BXX G;  4IUN A;  4HSP A;  1I3Q H;  3MEH A;  3HOX H;  3J81 i;  1JOR A;  1VQK A;  2CKZ B;  2F0N A;  4JK1 C;  4LF4 L;  2LS0 1;  3ERQ A;  4R4I A;  1K8G A;  2FXQ A;  3M3Y H;  4JI3 L;  1ZYR C;  3CC7 A;  3TS0 A;  4IFD H;  2PZW A;  1LAB A;  4PZ6 A;  1VQM A;  4X65 Q;  1KXL A;  4DV5 L;  1VCI A;  4LFA L;  2EYH A;  4K6L A;  1KDC A;  1JE5 A;  3HOY H;  1EEI D;  2PW7 A;  4A3C H;  3G6E A;  4JI6 Q;  1RF2 D;  1JJC B;  3I91 A;  2K5Q A;  3WOE A;  4H0L C;  4EGV A;  4BY1 G;  3BVG A;  4RAU C;  1SAP A;  1MI2 A;  2B3G A;  1CHQ D;  3T1Y Q;  4CDD C;  3TSS A;  1N33 L;  1IKL A;  3T13 A;  2DGY A;  4HN7 A;  3PO2 G;  3SEB A;  2V4D A;  3J7A 5;  1SXT A;  1MGS A;  1SYG A;  1TVX A;  1PVO A;  4JBJ A;  5E1F A;  2FIN B;  1DON A;  1R9T B;  1FNU A;  4U68 A;  1YJN A;  4LFB L;  4IZ8 A;  3I4M H;  2R7Z G;  4OIJ A;  4LW1 A;  2B39 A;  5GRO A;  4YY3 L;  2ZTD A;  1SE2 A;  3KLW A;  4A93 G;  1Q46 A;  1SYC A;  1U4P A;  3V05 A;  1VQJ A;  1C48 A;  5M3M H;  5C44 G;  3S15 B;  4QMG A;  4DPG A;  2OTJ A;  4A3K B;  1F9S A;  3K0X A;  3S1R B;  1WTV A;  3BZC A;  2RCN A;  3C1E A;  2UXC Q;  4DAM A;  2A19 A;  3CD6 A;  1RL2 A;  1JCK B;  3FMC A;  4LFB Q;  5CBA E;  1TWA H;  3EFX D;  1CA5 A;  2X6L A;  2LKV A;  5J1Z A;  4MNO A;  4CKE A;  1WI5 A;  5IYC G;  1DZ1 A;  2CCZ A;  3FKI G;  3CW2 C;  4TQU S;  4IPD A;  4DR4 L;  4OO1 G;  4A3J G;  4KY5 A;  1H9M A;  2C35 B;  3Q24 A;  4BBR G;  3T16 A;  3HOY G;  2N55 A;  1UE5 A;  3J81 c;  3HOW H;  1ET6 A;  1BR9 A;  1JE4 A;  2Q8T A;  3K58 A;  3CCR A;  3S1N B;  3JAM L;  1AW7 A;  2PMZ E;  4HTH A;  1BCP D;  5CV8 A;  3GTO H;  4BBS H;  1TWF B;  2K05 A;  4KJO A;  2EY1 A;  1AEX A;  1ET9 A;  3NUC A;  1O7I A;  5KYL A;  4UP9 A;  2N3S A;  2AWO A;  3W1G A;  3U9S A;  5FLM H;  4XYO A;  4DUY Q;  1HA6 A;  1LAC A;  3V2T A;  1A3T A;  3FPP A;  5C0X H;  4ZKB B;  3I56 A;  1JOQ A;  4OWW B;  3E0J A;  4WJ4 A;  2VXW A;  3TP6 A;  1KAA A;  3EN2 A;  1V43 A;  1BOS A;  3MXP A;  4MIU A;  4XT1 B;  3F2U A;  3GTM B;  4DAP A;  1NMF A;  1UE6 A;  1QNK A;  4KHP Q;  4B3S L;  2KED A;  2WV6 D;  2X6G A;  4WRD A;  2BH8 A;  2R92 H;  4P73 A;  4A3E B;  2K50 A;  5ELN A;  4H44 C;  1VS0 A;  5COY A;  1TU2 B;  1V1Q A;  1HFG A;  1QOH A;  1GOZ A;  2AUK A;  3W5O A;  1GKH A;  1TWC H;  3DMU A;  4LUV A;  3L7Z C;  3RN2 A;  5KRU A;  3S1N H;  1HHV A;  3HEJ A;  4XQN A;  4DR3 L;  2PCF B;  3U50 C;  3GTP B;  1IXR A;  3GQB A;  3UDG A;  1UE7 A;  3CCV A;  4UP7 A;  4A3G H;  1TKW B;  2ZXP A;  3EBE A;  3GD7 A;  1AE3 A;  4OX9 Q;  5M5X H;  1YHQ A;  4X66 L;  1XNR Q;  2KBN A;  3HKZ E;  4KJN A;  1E2V A;  1K3R A;  3KF8 A;  1SN8 A;  4KHZ A;  2FMC A;  4O2D A;  1WD0 A;  1I6V C;  1LYL A;  3J80 L;  3HKS A;  4RG1 A;  3PIP A;  3D31 A;  4A3L G;  2WAQ G;  3S1M B;  1NAP A;  4RKB A;  1CQF A;  2NWG A;  3QOJ A;  1L2F A;  5K36 H;  1HZC A;  1NJI C;  1O7Z A;  2KCC A;  2BE5 C;  1N9W A;  4NP5 A;  4DR6 L;  4XT3 B;  4MN3 A;  1LUZ A;  3S9W A;  2R6G A;  2EYL A;  5IT9 L;  3H0G G;  2JQO A;  4GZY C;  1LLR D;  1X56 A;  5C4J B;  3IAY A;  3NQI A;  4PV1 C;  3G7L A;  4Q0F A;  4AQY Q;  1IBK L;  4QL5 A;  1H9K A;  3HS0 C;  1C0A A;  3CME A;  2EYJ A;  4QIW E;  4ZLT F;  1EOT A;  5E3F A;  3I55 A;  1X65 A;  2AQ3 B;  1EZ6 A;  5JVH 3;  4GLX A;  2L11 A;  4IPG A;  4ME5 A;  4KTA A;  1GUW A;  1VQ9 A;  1ILQ A;  1EU3 A;  4JI5 Q;  4V0B A;  3CAM A;  1X54 A;  3N52 A;  3NXW A;  1SFO B;  4KY6 A;  5IYC H;  1G8Z D;  1BBX C;  1EL0 A;  1I50 H;  4JI7 L;  4RHR A;  1NTG A;  4PZ7 A;  1T9H A;  3J7A F;  5ELO A;  2HQE A;  1GUO A;  4CKC A;  3K7A B;  1PH7 A;  4CDC C;  1J5E L;  1PZI D;  3D4D A;  3PO3 B;  2OF1 A;  5IOC A;  3OYY A;  3DWA A;  1ENA A;  5JAV A;  1EU4 A;  4AYB E;  1L1O B;  4X6A H;  1PH9 A;  3I8Z A;  1E7Z A;  4DV3 L;  3GTK H;  4JPB W; 
#chains in the Genus database with same CATH homology
 3N6R A;  3K6O A;  5JEA J;  2KEC A;  1ML0 D;  1OXU A;  2IJ0 A;  3L3O C;  2IW3 A;  1VMC A;  2B2U A;  2B63 B;  3K57 A;  1SNQ A;  5C3W A;  1Q1B A;  3NBH A;  1CQV A;  3K59 A;  5CV6 A;  4XQJ A;  1EIG A;  2BDO A;  2G9D A;  3K5N A;  4CHT B;  1WTQ A;  1IW7 C;  3OSO A;  1B50 A;  5ELC A;  4PMB A;  2DNE A;  1HTP A;  2H4O A;  3A55 A;  3D4W A;  2DNC A;  1RCV D;  5IT9 E;  2NBF A;  2BDN A;  3ONA B;  4RH6 A;  4C3J B;  2EY2 A;  4G57 A;  5C5L A;  5DM6 3;  5IGC A;  1MSG A;  1I4X A;  5IGF A;  2TMP A;  2QCP X;  3FEW X;  1Q3L A;  5J22 A;  3OWE B;  4FVM A;  2A68 C;  1TS4 A;  4IUT A;  3I73 A;  1ICW A;  4XDX A;  4N9P A;  1B9N A;  2MHV A;  5I9P A;  1I4P A;  3D6W A;  1W6K A;  3NQT A;  2RVL A;  4IUU A;  2JA8 B;  2NVT B;  2EY6 A;  4KHV A;  3E5S A;  4BBR B;  2Z1C A;  4HCE A;  4FXG C;  4ZRZ A;  3WOF A;  2A74 C;  1ESR A;  1TWC B;  1A15 A;  2A6H C;  3GTG B;  4ID6 A;  1BUV T;  4LAA A;  2HDM A;  1L0Y B;  4ZUJ A;  1NR2 A;  1UEA B;  5EBD A;  4CJ0 B;  1B9M A;  5COR A;  3AB9 A;  2K7V A;  4X3K A;  3I3C A;  2WAC A;  1A6X A;  4DGZ A;  5JEA G;  2ZXR A;  1SSO A;  1PZK D;  2VB3 X;  1KLU D;  3VR6 A;  3G6J B;  1HPC A;  1I6H B;  4RHS A;  5ELE A;  1GUG A;  4RGT A;  3P7J A;  1F9R A;  1HQR D;  3D3R A;  1BF4 A;  5A2Q E;  3SDZ A;  2RDH A;  2F0K A;  4ZK9 B;  5DEH A;  1D1K A;  2VNU D;  2QEJ C;  2A6H D;  3ITP A;  2AWN A;  2F0O A;  4KV6 A;  2QKI C;  4IUR A;  5KNB A;  4HCS A;  1TWH B;  2WB1 B;  5I2X A;  3MHB A;  5CV5 A;  4FF1 A;  4KMU C;  3CRL C;  3QG1 A;  2Q8I B;  5EKI A;  1LTB D;  3T56 B;  1E2W A;  1JB3 A;  2BCO A;  1PXU A;  2PMZ B;  1HTL D;  1EIH A;  3A54 A;  1WTO A;  4F8M A;  3FDT A;  4K5W A;  4FF2 A;  5E4X A;  1NCV A;  1I4H A;  4K14 A;  1PTO B;  1ENC A;  4FYD A;  1DOK A;  2A69 C;  2NN6 H;  5IIF A;  5I9O A;  3T4A C;  3BS1 A;  1RTO A;  3P1H A;  2CVR A;  5M3F B;  3HKZ B;  4C1N I;  5IGE A;  1SYF A;  2F0V A;  2F0W A;  4EQP A;  3S16 B;  3QO2 A;  4KD3 A;  3IFD A;  2Z8L A;  4BWG B;  5FLX E;  1K8M A;  2D9U A;  1JWM D;  1GHK A;  2O2L D;  4X3T A;  4HED A;  4XQQ A;  3EVQ A;  3ZYY X;  1SYD A;  2IT1 A;  3OIQ A;  1F2M A;  3HG9 A;  2O5I C;  2F0S A;  5JPM C;  4RGM A;  4K8I A;  1LT3 D;  1TQO A;  1FYC A;  4QUC A;  2D5D A;  4EVO A;  3URY A;  3BG3 A;  4KI0 A;  2WKD A;  5JEA H;  4DK1 A;  2B2W A;  1D1I A;  4P2C B;  1QE6 A;  1JOO A;  1TY2 A;  1NUC A;  5EPK A;  2K5W A;  2IX3 A;  3PIP 3;  1GJX A;  4HAE A;  3JAM E;  1IYV A;  2PZT A;  1OXT A;  2IWH A;  3HGB A;  2RQX A;  1B53 A;  3I72 A;  4A3I B;  3S17 B;  1Y8O B;  5T1G A;  2M9V A;  1O80 A;  5LL6 X;  4BS9 A;  2PYK A;  4HR7 B;  3DUZ A;  4F7X A;  1RD9 D;  3NWT A;  4S3S A;  3OHX C;  5TSS A;  1TS2 A;  2M00 A;  5JVG 3;  5T1I A;  5EPJ A;  1H9J A;  5FO8 B;  3R2I A;  2ENB A;  3LWU A;  2L5T A;  2KHS A;  3TP5 A;  1HXY D;  1LTA D;  3VYR A;  5KIX A;  1EZ8 A;  2KA7 A;  4K5V A;  1YNJ C;  2XN9 C;  3A56 A;  2K33 A;  3TBI B;  4ZYS A;  3NHH A;  4DN4 M;  3M7G A;  2ID0 A;  5K5P A;  2EOT A;  2Z4H A;  2YU9 B;  1STE A;  1U9R A;  4G7Z C;  1B2T A;  5M9O A;  2EJF C;  2E74 C;  2L1B A;  4DU9 A;  4HMJ A;  1LV9 A;  2BA1 A;  3GTL B;  3GTJ B;  2HDL A;  2DY7 A;  1S5F D;  5G3L D;  4KKT A;  5BN5 A;  3VR4 A;  4C3H B;  5I2Y A;  1GXD C;  2EDG A;  4J8Q A;  3SVM A;  4PMC A;  2PW5 A;  1WD1 A;  2L4N A;  1STY A;  1Y1W B;  1EEF D;  3EJI A;  2K04 A;  3FVQ A;  4HMI A;  1TY0 A;  1LT4 D;  2KOL A;  4HSV A;  1AZQ A;  2EY5 A;  2CW0 C;  1BO0 A;  1PTO F;  3HOX B;  5D3I B;  1SNM A;  1U4R A;  1NSN S;  2BOS A;  2OXP A;  4L8J A;  1LT6 D;  2IX0 A;  5C6A A;  1SNO A;  2FMM A;  3VR2 A;  2K03 A;  3RUZ A;  1RJT A;  5CMD A;  3D6C A;  4L6T B;  2WAQ B;  3KLS X;  4OO1 I;  5FKA C;  3RZD B;  4X3S A;  2B2V C;  3OWF A;  2HCC A;  5KNC A;  4ZAI A;  1G2T A;  1ZYR D;  2A6E C;  1A2U A;  2MPM A;  1VF7 A;  5ISR A;  3X3M A;  2XVS A;  1LTS D;  2WP8 J;  1JWS D;  2NZ1 D;  5FO9 B;  2PO4 A;  4QUF A;  4KN4 C;  2CQA A;  3C1F A;  2EPB A;  1Z47 A;  1YNN D;  3DM1 A;  5M5X B;  3A8K E;  1Z7T A;  4RCN A;  4ZKC B;  2G9H D;  3KK7 A;  4V19 0;  2NTT A;  1SJE D;  3CU7 A;  3BDL A;  4UAI A;  3OIP A;  1ILP A;  5C4Z A;  3S1Q B;  3HOV B;  2KCN A;  4B08 A;  1I4Q A;  1WTX A;  5BN4 A;  3NTH A;  1T5E A;  3SXH A;  2NVX B;  2M2L A;  3TME A;  1OXV A;  5C3E B;  1I4G A;  1WCM B;  1PRT D;  2EJG C;  5M5Y B;  1B3A A;  1OO9 B;  4NW2 A;  3Q0A A;  4KD4 A;  3D4R A;  2JP1 A;  4FXD A;  3TN2 A;  5C0X G;  3DWP A;  2F0T A;  3SK4 A;  1KLG D;  3TZU A;  4RA8 A;  5FO7 B;  1S5C D;  4BA1 I;  5KND A;  3A7L A;  1IL8 A;  3HZX A;  1S4Z A;  4QIW B;  5EKK A;  2Q8R E;  5I4D A;  4A3B B;  2EYM A;  3NTK A;  2WII B;  3BVZ A;  1U4L A;  1S5E D;  2B2T A;  4IQZ A;  1TWA B;  2F0L A;  1GUS A;  1RHP A;  2I07 B;  5D14 A;  3M4Y A;  3I4L A;  2EXZ A;  3OMC A;  1SYE A;  1J8I A;  1D5X C;  2FJ2 A;  2NN6 I;  3HOZ B;  1QWY A;  3H0G B;  1DM0 B;  5M3M B;  3GTQ B;  2K6A A;  3S2H B;  5M5W B;  3Q6S A;  4TSS A;  5D3D A;  2EYF A;  3GV3 A;  4KKS A;  4C3I G;  2KJX A;  1PLF A;  1HUN A;  1K8O A;  4R8N A;  4G7O C;  1STG A;  2WIN B;  3I90 A;  3V96 A;  2F03 A;  2F0U A;  4N9T A;  4A93 B;  1H9S B;  1DOM A;  2JA5 B;  5I6Y A;  1WTR A;  2B8F A;  2RSO A;  2LFN A;  1Y1V B;  3SHL A;  3E6Z X;  3K5O A;  3I4N B;  4IFD J;  1BQQ T;  1G29 1;  1S5B D;  2NVY B;  1DYQ A;  1X3Q A;  1EY7 A;  2OEO A;  1WTW A;  3LX0 A;  2R92 B;  2F3V A;  4M1U B;  2O5J C;  2B2T C;  2LY7 A;  1DXM A;  1PFM A;  3BDO A;  2L12 A;  1F9Q A;  1DJR D;  1ZKO A;  2LMC B;  1WTP A;  3LNN A;  4BY1 B;  1KAB A;  4I7Z C;  1IKM A;  2HCI A;  5CV4 A;  2AQ1 B;  2R61 A;  2AUJ D;  2F0F A;  1PTO C;  4J6H A;  4H7B A;  1TII D;  3CRK C;  3TP8 A;  1SMY C;  1XYI A;  1CT1 D;  2HUG A;  4LJZ C;  3NBI A;  1BCP F;  5CV7 A;  5D65 A;  4K5X A;  1VDZ A;  3MTS A;  1JC7 A;  1SE3 A;  4K2K A;  3H09 A;  4DK0 A;  1XX8 A;  1CA6 A;  2IPK D;  5CC4 A;  5AFW A;  2JXM B;  4A3F B;  1XTC D;  2F1M A;  4E6I A;  2JE6 I;  4DA2 A;  4RKL A;  1PFN A;  2D62 A;  1T5X D;  1QG7 A;  1M8A A;  2K32 A;  1AP0 A;  1SNP A;  3HOW B;  2MGS A;  2R3Z A;  4G7H C;  1PTO H;  4KK7 A;  2J4X A;  4O1N A;  1Y69 U;  2EVB A;  2KQ3 A;  3K5M A;  1CK1 A;  4O42 A;  1RKN A;  3GO5 A;  2XSC A;  4EQO A;  3BYT B;  2F0E A;  1BCP B;  1EY0 A;  2F0D A;  5C4H A;  3VYS A;  1LTR D;  1NR4 A;  5EJW A;  1C4Q A;  1DOL A;  3FRP B;  1EY6 A;  3QIA A;  1CI3 M;  2F0H A;  4B9W A;  4H13 C;  4FF3 A;  5JOB A;  2JEA I;  4BBS B;  1FGB D;  2CHB D;  1LTI D;  1TS3 A;  3LWE A;  4AYB B;  1B1Z A;  3GTK B;  4DNR B;  5KYI A;  1KDA A;  4WOR A;  1RTN A;  3EA6 A;  1ESF A;  4FF4 A;  1R4P B;  5FLX L;  3PV0 A;  2IX1 A;  3IL8 A;  5G3L F;  5CBE E;  1F9P A;  3VYU A;  4ZQ3 A;  4XYQ A;  1K83 B;  4KY7 A;  1U4M A;  1VF5 C;  3VA7 A;  3GP7 A;  2MP1 A;  3J81 E;  2EZV A;  4PNY A;  2NN6 G;  4B9X A;  3C46 A;  3PUV A;  4NMZ A;  2A5H A;  1G91 A;  5E4W C;  2BE5 D;  1TWG B;  5CYU A;  1EWH A;  5ELB A;  4IUQ A;  1Y8P B;  3KBX A;  1WVL A;  1Z6H A;  3P20 A;  3Q23 A;  2ZXO A;  3KBG A;  5EKL A;  2RA4 A;  4C3J G;  3M85 A;  2XWB B;  2J0T D;  4DAV A;  1B4O A;  3DEP A;  1OXX K;  1X32 A;  2N88 A;  2EJM A;  5EGT A;  3EQL C;  1ENF A;  2K01 A;  4IFD G;  3C3L A;  1CTM A;  1J9O A;  1EY4 A;  2SNS A;  3QJY A;  4PQX A;  4Z9C B;  1STH A;  3MA2 B;  3PUW A;  1FD7 D;  1SMY D;  1BXT A;  2GA4 B;  3SK5 A;  1SE4 A;  2E2J B;  4IUP A;  1I3Q B;  4F87 A;  2F0M A;  1IW7 D;  2A6E D;  2WKC A;  4ZUI A;  3H91 A;  4J1M A;  1KNA A;  4IFD I;  5KEE A;  1V1P A;  4DF7 A;  1G2S A;  1PRT F;  4QF4 A;  3RMH A;  3OW7 A;  2X69 A;  4FNF A;  2XNA C;  1HFN A;  3R2T A;  4C2M B;  3S2D B;  5ELF A;  1M4V A;  3SE0 A;  2XIW A;  4KKU A;  2L0C A;  1UAP A;  1IYU A;  2YYZ A;  4A3D B;  2B2Y A;  3MWY W;  4Q5V A;  4R8I A;  1CZW A;  3C2P A;  3HOU B;  1G6Z A;  2NTS A;  1Q90 A;  4F88 A;  4C56 C;  5IGG A;  3HRZ C;  5DAU A;  3IFT A;  1QJO A;  2B2W C;  4ULL A;  3BVM A;  2QF7 A;  2EE1 A;  1HUM A;  1EWC A;  4LK1 C;  4Y7N B;  1CHP D;  5CV9 A;  2DY8 A;  4OO1 H;  2TSS A;  3MZ5 A;  1STA A;  1X3P A;  1BNZ A;  1SDF A;  1VMP A;  5FOB B;  4RGN A;  1S5D D;  1A3U A;  5C5M A;  5A35 A;  1TT2 A;  1A3V A;  1EQV A;  2C5C A;  1HRJ A;  3L9A X;  2D2C C;  3SR1 A;  3W2D A;  5CGK A;  5IGB A;  2B8G A;  1D5M C;  5IOD A;  3TDQ A;  1UUP A;  1FR3 A;  1D5Z C;  1E0B A;  3HP3 A;  4TKO B;  4RWS C;  2E2H B;  4QCL A;  1EY5 A;  4IAL A;  2BA0 A;  1V1O A;  1TS5 A;  1YNJ D;  2F4I A;  1C8C A;  1H9R A;  5KGU A;  1O7Y A;  5JPN C;  3MC0 B;  2R93 B;  2XRS D;  1MSH A;  3S14 B;  1QB5 D;  3Q22 A;  3A8J E;  4RCO A;  1ZXT A;  1DD2 A;  2F0I A;  3KLR A;  1KDB A;  4TRD A;  4DXF A;  4RFB A;  3WDN A;  3R93 A;  3VR5 A;  4OIK A;  3CKI B;  1Q12 A;  4ODG A;  3U9O A;  1H9S A;  3K5L A;  3DWQ A;  3PMF A;  3IKJ A;  4BY7 B;  3PUY A;  3BZD B;  2A68 D;  3W3A A;  3QWN A;  2NYZ D;  5LL6 S;  1KTK A;  1OXS C;  4G4K A;  1F77 A;  4NDX A;  2EYP A;  2RSN A;  3HOY B;  5HUR A;  2OT2 A;  3PUX A;  3QOL A;  1EFI D;  2JYO A;  3KLS A;  2Y0S B;  4KN7 C;  1D6E C;  2E76 C;  1PRT C;  1I4R A;  3M3Y B;  2L55 A;  3MXG A;  1RDP D;  4PMW A;  5EPL A;  2B2U C;  4A3J B;  2JA7 B;  4DXG A;  3ERO A;  3TZD A;  1Q8I A;  5DM7 3;  3MXU A;  1SYB A;  4M8A A;  1PRT B;  2KEE A;  3MVV A;  3R8B A;  3VA5 A;  2R7Z B;  3NSW A;  1CM9 A;  3MXN A;  3O13 A;  4R9W A;  3PIO 3;  1D2B A;  4DFA A;  5BN3 A;  1GHJ A;  2F0Q A;  3CHB D;  2FHT A;  4XXE A;  5F2D A;  2E2I B;  3NP8 A;  3PO2 B;  3CQZ B;  2ZT9 C;  4CBV A;  2FFK B;  3M7N A;  5DNF A;  1GUN A;  3OMG A;  1FNW A;  2AQ2 B;  3QB3 A;  1W6J A;  4NKL A;  1O78 A;  2H1E A;  3NK9 A;  4CJ1 B;  2ICI A;  1LT5 D;  3I70 A;  1ZEQ X;  2E75 C;  4MHE A;  1E2Z A;  1ROD A;  1IHZ A;  2JSO A;  4IUV A;  3H3V C;  2I46 A;  4I65 A;  3BYY B;  3T51 B;  1EQT A;  2A69 D;  4DAY A;  2IL8 A;  1Y8N B;  3A7A B;  4X3U A;  5C0X I;  3KUP A;  1AFP A;  1LTG D;  3K0Y A;  3D8G A;  3NPP A;  5NUC A;  4OGQ C;  2JA6 B;  4K6D A;  2PNR C;  2RBM A;  1B44 D;  4ABN A;  2F3W A;  3J7Y W;  1PZJ D;  2RDF A;  4BA2 I;  1EY8 A;  3TP7 A;  3GTO B;  1DCZ A;  3SK8 A;  2ICE C;  4YIJ A;  3MAQ A;  3M4O B;  1STN A;  1EYD A;  4DNT B;  1MBY A;  1HCZ A;  2J7Z A;  1CFM A;  5EBC A;  3DHQ A;  4WFN 3;  1XWE A;  4EQN A;  3ND9 A;  3UI2 A;  1MD2 D;  4CJ2 C;  3OPO A;  1A2T A;  3NTI A;  1HA5 A;  3I4M B;  1PTO D;  5LHY 1;  1BCP C;  3J7A V;  1I50 B;  3NE5 B;  1F2Z A;  2K1B A;  5HGT A;  5K36 G;  3VYT A;  2NVQ B;  5CR3 A;  3GV6 A;  1V8Q A;  3MFY A;  3PUZ A;  3R3O A;  1JIC A;  1SJH D;  2PQE A;  1FNV A;  1PDQ A;  2MJ8 A;  4LMQ D;  2PZU A;  5C0X J;  5C44 B;  2SNM A;  2K5D A;  4RGO S;  3A8I E;  1SBB B;  5A2Q L;  5JJZ A;  1SNC A;  2SDF A;  4K2L A;  5J39 A;  2DN8 A;  3FKI B;  1GUT A;  2B2V A;  1L0X B;  2RDG A;  4U67 3;  2SOB A;  2F0P A;  2B2Y C;  2RKS A;  3X3N A;  1BDO A;  1AN8 A;  4IN3 A;  1UNS A;  1Q1E A;  1LTT D;  3SK6 A;  4JBW A;  1SND A;  1JWU D;  1EYA A;  3H6M A;  3FPU B;  4CGY B;  3RZO B;  1PMR A;  4OHJ A;  1LO5 D;  4OL7 A;  2VUM B;  4UDU C;  3NWS A;  4FP5 D;  5C4X B;  2EYO A;  2JEB I;  3AU7 A;  1F2L A;  5C3X A;  1II3 A;  1JQY D;  5IGD A;  2CW0 D;  4C3I B;  1PFB A;  3DEO A;  2A73 B;  1EYC A;  3VR3 A;  1R4Q B;  3OOC A;  1HQM C;  3H94 A;  3MFG A;  1QNU A;  1SEB D;  2KUM A;  3P75 A;  4CKB A;  4QB4 A;  1JR0 D;  2SEB D;  4K8J A;  4L63 B;  2XRQ D;  2Z4I A;  3AMU A;  3T53 B;  4FO2 A;  4FXK C;  1QIL A;  2VB2 X;  5FK9 C;  2XWJ B;  2QIL A;  2K28 A;  4ILW A;  1EY9 A;  3RLF A;  1CZG A;  3BDC A;  4C1N K;  1AZP A;  3RD4 A;  3ND8 A;  1PYW D;  2C9O A;  4XIG S;  1JOK A;  1STB A;  5I6W A;  4A3G B;  3J80 E;  2QDB A;  3DXJ C;  3J81 L;  2L9H A;  5EQ0 A;  1KNE A;  1YNN C;  1V1P B;  1QCB D;  2E2D C;  1F2Y A;  1TR5 A;  2KVM A;  4XTC S;  4A3M B;  1ONL A;  5ELD A;  1O7L A;  2MUY A;  2NUC A;  2NB0 A;  4WJW A;  2O4X A;  2F0G A;  2PPB C;  4C3H G;  2F0J A;  1XXG A;  4IUN A;  4HSP A;  3MEH A;  1JOR A;  2F0N A;  4JK1 C;  2LS0 1;  3ERQ A;  1ZYR C;  4IFD H;  2PZW A;  1LAB A;  1VCI A;  2EYH A;  4K6L A;  1KDC A;  1EEI D;  2PW7 A;  1RF2 D;  3I91 A;  2K5Q A;  3WOE A;  4H0L C;  4EGV A;  3BVG A;  4RAU C;  1SAP A;  1MI2 A;  1CHQ D;  3TSS A;  1IKL A;  3T13 A;  4HN7 A;  3SEB A;  2V4D A;  1SXT A;  1MGS A;  1SYG A;  1TVX A;  5E1F A;  2FIN B;  1DON A;  1R9T B;  1FNU A;  4U68 A;  4IZ8 A;  4OIJ A;  2B39 A;  1SE2 A;  1SYC A;  1U4P A;  3V05 A;  1C48 A;  3S15 B;  4QMG A;  4A3K B;  1F9S A;  3S1R B;  1WTV A;  3C1E A;  1JCK B;  3FMC A;  5CBA E;  3EFX D;  1CA5 A;  2X6L A;  2LKV A;  5J1Z A;  4CKE A;  1DZ1 A;  4TQU S;  4OO1 G;  4KY5 A;  1H9M A;  3Q24 A;  3T16 A;  2N55 A;  1ET6 A;  1BR9 A;  1JE4 A;  2Q8T A;  3K58 A;  3S1N B;  3JAM L;  1AW7 A;  4HTH A;  1BCP D;  5CV8 A;  1TWF B;  2K05 A;  4KJO A;  2EY1 A;  1AEX A;  1ET9 A;  3NUC A;  5KYL A;  1HA6 A;  2AWO A;  3U9S A;  4XYO A;  1LAC A;  3V2T A;  1A3T A;  3FPP A;  5C0X H;  4ZKB B;  1JOQ A;  3E0J A;  2VXW A;  3TP6 A;  1KAA A;  1V43 A;  1BOS A;  3MXP A;  4MIU A;  4XT1 B;  3F2U A;  3GTM B;  4DAP A;  1QNK A;  2KED A;  2WV6 D;  2X6G A;  4WRD A;  4A3E B;  4H44 C;  5COY A;  1TU2 B;  1HFG A;  1QOH A;  1GOZ A;  2AUK A;  3DMU A;  3L7Z C;  5KRU A;  1HHV A;  3HEJ A;  4XQN A;  2PCF B;  3GTP B;  3GQB A;  1TKW B;  2ZXP A;  3GD7 A;  4KJN A;  1E2V A;  3KF8 A;  4KHZ A;  2FMC A;  1WD0 A;  1I6V C;  3J80 L;  3D31 A;  3S1M B;  1NAP A;  4RKB A;  1CQF A;  2NWG A;  3QOJ A;  5K36 H;  1O7Z A;  2KCC A;  2BE5 C;  4NP5 A;  4XT3 B;  4MN3 A;  3S9W A;  2R6G A;  2EYL A;  5IT9 L;  4GZY C;  1LLR D;  5C4J B;  3IAY A;  3NQI A;  4PV1 C;  3G7L A;  4Q0F A;  1H9K A;  3HS0 C;  2EYJ A;  4ZLT F;  1EOT A;  5E3F A;  2AQ3 B;  1EZ6 A;  5JVH 3;  2L11 A;  4ME5 A;  4KTA A;  1GUW A;  1ILQ A;  1EU3 A;  4V0B A;  3N52 A;  3NXW A;  1SFO B;  4KY6 A;  1G8Z D;  1BBX C;  1EL0 A;  4RHR A;  3J7A F;  2HQE A;  1GUO A;  4CKC A;  3K7A B;  1PZI D;  3D4D A;  3PO3 B;  2OF1 A;  5IOC A;  3DWA A;  1ENA A;  5JAV A;  1EU4 A;  3I8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...