2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Bacterial RNA polymerase inhibitor
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
1E2WA 3SE0A 3CRKC 3WDNA 3A8JE 3U9SA 3QG1A 2O5JC 2BE5C 1HQMC 2KCCA 1CTMA 4H13C 5C0XG 2E74C 3OOCA 4L8JA 4G7ZC 3PUVA 3SDZA 2ZT9C 4KN7C 1ONLA 1DXMA 1FR3A 1VF5C 5JEAG 2JE6I 1IW7C 5A35A 1LACA 1Y8NB 3RLFA 3VR4A 3LWUA 3PUYA 1TU2B 2AUKA 2YYZA 2QF7A 2B8GA 2JEAI 2EJMA 3LNNA 1GUGA 2Q8IB 4IFDH 4TKOB 3T51B 1VCIA 3TZUA 2A6HC 4BA2I 3IFTA 2KA7A 4KN4C 4GZYC 5KNCA 4G7OC 1E2VA 2CW0C 3IKJA 2NN6I 3I4LA 2EDGA 3MFYA 4KHZA 1GUTA 3VA7A 4RCNA 1V8QA 2B8FA 1BDOA 3CRLC 4DK0A 2A69C 4XIGS 1Q12A 3D31A 3FPPA 4IFDG 1CI3M 3PV0A 3QJYA 2PPBC 3DXJC 2A68D 4HR7B 4IQZA 4DK1A 2F1MA 1IYVA 4KKSA 4OGQC 1CFMA 1Z6HA 1OXSC 1GHJA 3BG3A 3KLRA 3GD7A 2EJGC 4KKUA 4XTCS 2D62A 5BN5A 1A6XA 2PCFB 2L5TA 4DNTB 1H9KA 3AB9A 3H94A 1O7LA 1H9SB 1H9JA 2EVBA 3A8KE 1Y8OB 2DN8A 3N6RA 3M4YA 4LJZC 1GHKA 3OW7A 1VF7A 2E76C 1V43A 3M7NA 3OPOA 1SMYC 1I6VC 5BN3A 1B9NA 2BA0A 2E75C 3A8IE 4DNRB 1H9SA 1LABA 1E2ZA 1O78A 1Y8PB 1HTPA 3I73A 3ND8A 4KMUC 3T53B 5KNBA 1GUSA 2DNCA 2A68C 2PNRC 2V4DA 1H9RA 1ZKOA 3I72A 2D2CC 4BA1I 1PMRA 2A6ED 1OXUA 2O5IC 3HGBA 2K33A 1OXTA 5BN4A 4G7HC 3D4RA 1ZYRC 1VDZA 2JEBI 1OXXK 1YNNC 2A6HD 4KI0A 1Q1BA 4JBWA 2NN6H 5K36H 1FYCA 2K7VA 1QJOA 1DCZA 2BDOA 4JK1C 5KNDA 2R6GA 1T5EA 2JXMB 1G291 1Q1EA 4OO1H 2AWOA 1Z7TA 1B9MA 2A69D 2BE5D 3VR2A 4H44C 2AUJD 1K8MA 2DNEA 1DD2A 1K8OA 2EJFC 1EWHA 3FMCA 4KKTA 3M85A 3W3AA 2NN6G 3L7ZC 5K36G 1OXVA 4PV1C 1TKWB 1IW7D 3QIAA 3PUXA 1YNJC 3MXUA 3T56B 3P20A 4TQUS 3NE5B 2A6EC 1GUOA 4OO1G 2LMCB 2IT1A 3PUWA 1GJXA 3VR5A 2BA1A 3BDOA 3VR3A 3A7LA 5C0XH 3VR6A 1HPCA 1IYUA 4LK1C 3PUZA 1Q90A 4I7ZC 1H9MA 1HCZA 3GQBA 2K32A 3A7AB 3ND9A 2D5DA 4H0LC 3EQLC 5JEAH 1GUNA 1Y69U
chains in the Genus database with same CATH superfamily
4C3HB 1E2WA 4QIWE 3DM1A 3MC0B 5KIXA 2Z8LA 2Z9HA 2HQLA 1VQMA 1PH5A 2BE5C 1BCPB 2O5JC 1D7QA 4HIOA 4WJ4A 3CXCA 4AYBG 3UDIA 4FVMA 2B2TA 2F0EA 3KLSA 2BH2A 1IKMA 2ALYB 4WJWA 5A2QL 1CKOA 1ICWA 3MEHA 1AW7A 2Y0SG 2PQAB 4MNOA 3MAQA 1ENFA 2CH4W 2K04A 3IAYA 2UUBL 3V96A 1HA6A 5EAYA 1XNRL 5ELOA 1YJ9A 2PQAA 2PPBC 1LM0A 1T5XD 4LF7Q 2PZTA 5GAHC 3R2IA 1G91A 1JJCB 4X66L 1X9NA 4KKUA 1PH1A 4BBRH 1TS4A 1NR4A 1SE2A 4DNTB 1H9KA 3VYRA 1H9SB 3PQIA 1K8GA 1XJVA 1Y8OB 3JAMi 4Z9CB 5CMDA 2K5NA 1KTKA 3KLSX 4ME5A 1HQRD 1VF7A 1C7YA 3I4MH 4CKBA 3M7NA 3ERSX 3NTKA 2NVQB 4BBRG 1MIUA 1CZGA 1H9SA 1GVPA 1E2ZA 2Y0SB 4CDEC 2HIXA 1K73C 2DNCA 1PTOF 3I4MG 1CHPD 4GS3A 2PO4A 1TT2A 4CDFC 2I0QA 1P16A 1PZID 2DGYA 4A3MH 3CW2C 3CC4A 3X3MA 4LWCA 3MTSA 4GLVB 3RLNA 4HCSA 5KRUA 4IN3A 4NXNQ 3FMCA 1VQFA 3W3AA 5IYBH 2Q2IA 4A3MG 1YEZA 4ZKBB 5C3XA 2L12A 2ZXRA 3NE5B 4BBRB 3HS0C 2JA5H 2GN5A 4LF4Q 5FLXc 1LTRD 5C0XH 2QA4A 2E5LQ 1B50A 5IYBG 4DV4L 1PH3A 3I4MB 2K32A 5IYCH 4J15A 2VZAA 4G4KA 1ILPA 1STEA 3ULPA 2JA5G 3A8JE 5NUCA 1Q8KA 1HA5A 5AJ3Q 5C0XG 2E74C 2D0OA 5C3EH 1VF5C 4YHHL 5M5YH 2JE6I 5IYCG 1TWAH 5I4DA 4JI3Q 2WB1G 2K5DA 1KC8C 1G2SA 1STAA 1CK1A 1A0IA 2JQOA 3RR5A 2KA7A 3E6ZX 5C3EG 4DV0L 5M3FB 1Q82C 3PIOA 2Q2HA 3K7AB 1EY5A 3ERQA 4KHZA 4S3SA 2OQKA 2HIVA 1LTGD 2FHTA 2XRSD 2F0OA 4KKSA 3T13A 2JA5B 1JE5A 1NBWA 2VUMH 1GM5A 3D6WA 4YY3L 2D62A 3PO3H 4A3BH 1SYGA 2WB1B 4FF4A 2VUMG 4HN7A 1HR0Q 2ID0A 4LF9Q 4QQBX 3PO3G 1E0BA 3I73A 1C9OA 3WOEA 5C3EB 3OTOL 2N78A 2XRQD 4A3FB 4P2CB 1TWAB 4A3BG 2A8VA 3CCSA 2B2WC 1S5BD 1XXGA 1TWFH 2WINB 1OXTA 2MFIA 1FD7D 5ELDA 4DV3Q 4JV5Q 4K14A 5JVG3 4DR4L 1RD9D 3CMEA 2K75A 5DM63 1A2TA 3HZXA 4IJLA 5KNDA 4XQJA 2R6GA 5C4ZA 3JAML 4X62L 2RCFA 3J7YW 2BE5D 3NEMA 4YIJA 3K0YA 3OWEB 1RHPA 5LMUL 4V190 4GKKQ 2Q2TA 5EKIA 4A3JH 2VQEQ 2VUMB 4XYOA 3I91A 3F2BA 5EQ0A 4P74A 4DV1Q 4A3BB 4RH6A 1II3A 1KLUD 4A3JG 4DF7A 1Z47A 4MTNA 1DGSA 1CM9A 3ITPA 1YIJA 1X3QA 4UY8C 2A19A 1RJTA 5FO7B 3H15A 3HKZE 4R4QA 1HNWL 1MJEA 2CHBD 2LXJA 5HY6A 1N33L 5CBEE 3SDZA 1X6OA 3UDGA 2XGTA 1KHIA 4HAEA 1SBBB 3RLFA 4R8IA 1EZ8A 5IGGA 1XNQL 4DV7L 2ENBA 2J7ZA 1S40A 2Q8IB 3BDCA 1V9PA 4UDUC 3T1YL 1WOCA 2IX3A 3NBHB 3L3OC 4KN4C 4DR3Q 3J7AF 3S16H 1J5EQ 1PRTB 3BU2A 3NBHA 1I3QH 4K8JA 2FMMA 2VNUD 4F8MA 4A3JB 5J39A 1GOZA 5HURA 2IHEA 1RTNA 1Z6HA 4IUUA 2VY3A 1GHJA 4HMIA 1UAPA 3P75A 4DV2Q 4A3LH 1FGBD 1Y1VB 4UAIA 1HNXQ 2L1BA 1WCMH 1J8IA 4JI6L 2A73B 4A75A 1EY0A 3NSWA 3SGIA 5CYUA 5C0XI 4A3LG 3NK9A 2C5CA 5I2YA 1VQLA 4POFA 4DU9A 4JOIC 1WCMG 4KMUC 3A54A 3TQYA 2V4DA 4RKLA 3J7ZC 1KDAA 1V1QA 1BBXC 1VQNA 3K5OA 2RBMA 1U9RA 5CV9A 4RG1A 3U58A 2A6HD 1M4VA 5FLXL 2UU9Q 4A3KH 2K7VA 4PQXA 4QL5A 1CSPA 1EFID 1DCZA 2WAQE 3KUPA 3K58A 3S16B 1E22A 1PHJA 1KDCA 2DNEA 2G9DA 3KF8B 4Y52H 3CD6A 1LTID 4PV1C 4A3KG 1TXYA 1BO0A 5G3LD 2NZ1D 1JWMD 3G71A 4KY7A 1AE2A 2IT1A 2XIWA 3KF8A 3PMFA 3S2DH 1WCMB 2OTJA 2GVBA 3S1RB 5D14A 4DV5Q 4TVAB 3JC66 2WACA 3W1BA 4OX9L 4L6TB 1JB7A 3DMUA 3AMUA 4CKEA 2Z6KC 3CC2A 1YBYA 3BS1A 4YWKA 3MVVA 4WORA 4DR2L 1H95A 3EVQA 2UUCL 4JI4L 2QCPX 3EN2A 3NTIA 3GTJB 4R4CA 4UP8A 2IPKD 2VL6A 1UEAB 2NVYH 4ZCKA 4ZAIA 3RMHA 5EGTA 3HEJA 2JA8H 2B2VC 1F9PA 4OONA 1E2VA 3A5UA 2PI2E 1LTTD 3IL8A 4A93H 1BOSA 4RCNA 1F77A 1PTOH 3FPPA 5IT9c 1CZWA 4RFBA 2L15A 4GN4B 2QEXA 5ELEA 4HTHA 1CA5A 2M2LA 4DUZL 3BG3A 2FINB 1KAWA 4A93G 2F0NA 5I9OA 3RZDH 1S5ED 1VQOA 2F0HA 3CCQA 1Z9FA 1S5DD 1SEBD 5ELNA 1XPRA 1CQFA 5IYDH 5HGTA 2X6LA 4N8X1 5D65A 3NP8A 5KYLA 2ZTDA 1SNOA 3GTMH 3CP0A 1MSHA 4EQPA 3A8IE 3I7FA 1K3RA 2UUBQ 5IYDG 2EY6A 1XNRQ 3HOXH 1KNEA 2NVYB 2ZXPA 2LFNA 5C44H 2I5LX 2OF1A 1X3GA 4GOPC 1Q3LA 2XTIA 5IGCA 4X66Q 2K01A 1B3AA 1FNUA 3HOXG 4A93B 1WTOA 1PTOB 4L5TA 4ID6A 1G291 1Z7TA 1B9MA 2EIFA 5C44G 4K0KL 5JJLA 5G3LF 4K5XA 4DNIA 2KHJA 2EJFC 3M85A 4XYQA 2B2UA 1HH2P 1PYBA 4K8IA 1K9MC 2VB2X 2A6EC 2KHIA 4BBSH 1PYWD 1GJXA 1PH9A 2JSOA 1K8AC 2IW3A 1D1KA 4ME3A 1EL0A 2Z4IA 2ASBA 4GNXB 1H9MA 3AU7A 2CFMA 4BBSG 3I2ZA 4GNXA 4K6LA 5E3FA 2QKIC 3MXPA 5C4JH 5A35A 3CHBD 3K5LA 4ZYSA 3D8GA 1U4RA 2N88A 2RDHA 2QF7A 1SYEA 1L1OB 2WIIB 2JEAI 3OHXC 2TMPA 2OWOA 1ASYA 2LY7A 3H3VH 1LT6D 1JOOA 2NTSA 2DUDA 2F0MA 1L1OA 1QG7A 2Y0SE 1V8QA 2LXKA 4AH6A 4DV4Q 2F3IA 3M4OB 2RA4A 1IYVA 3K5NA 4JBMA 2F0FA 2XSCA 1TWGB 1MHWC 4OGQC 1LT3D 1A6XA 2AQ1B 2CWPA 4YHHQ 3TRZA 3PO2B 4LF6L 4BY7H 1BR9A 2XN9C 3EFXD 5CGKA 1JE4A 1XPOA 1X3FA 5LL6S 1VQBA 1EIYB 4MIUA 4X65L 1F9RA 4JI1L 4C2MH 1HTLD 3C3LA 2PNRC 5C4JB 4BY7G 1H9RA 3HGBA 4HJ7A 1AFPA 2CQOA 1VQ8A 2CQAA 1G2TA 1K0RA 5E4XA 1DYQA 4G57A 1LYLA 1W6KA 1E1OA 4YY3Q 2AKWB 5I2XA 1YHBA 2OCEA 2IY5B 4YCUA 3U4VA 1AE3A 4DR7L 3CQZH 4RGTA 4EVOA 4LFCL 4K5VA 4PMWA 3K57A 4BY1H 3BJUA 4PMBA 3LX0A 1EZ6A 2A1AA 1U0LA 5M5XB 1SLJA 4KLKA 4ZUJA 1XYIA 2IHFA 1NTGA 1I4GA 1YNJC 4M1UB 3P20A 1B3QA 3BVZA 3QOJA 2SEBD 3Q6SA 3CCJA 2D9UA 1TR5A 4BY1G 2CWAA 3GTGH 1N8RC 3RN2A 1IL8A 1U5KA 2QGQA 3VR6A 4LK1C 4CDDC 3Q23A 4BY7B 1BCPC 3HFZB 2R7FA 1LTSD 1UE6A 2KHSA 3K5MA 2VS1A 1E1TA 4DR4Q 4RGMA 1GUWA 3FHWA 2BOSA 4LUZA 4B08A 3S15B 3OOCA 1JICA 5T1IA 4X62Q 4P71A 4B3ML 2OQ0A 5IT9L 5LMUQ 1KXLA 4QB4A 1YNXA 4LMQD 3Q8DA 2MJ8A 1IYJB 4NW2A 2OXPA 1JOQA 2O2LD 4NMZA 1EQRA 2WB1E 1VQ7A 2OEOA 4BXXH 3JAMc 3CQZB 5C5MA 3I8ZA 3S1NH 1P8LA 3I4LA 3K0XA 3QOLA 3VA7A 1GUTA 4BY1B 3CCLA 1Q12A 3D31A 1PFNA 2EYJA 3EIVA 1BUVT 4BXXG 1C0AA 1JJ2A 1G6ZA 1CFMA 3FDTA 1HNWQ 4CBVA 2K4KA 4NDXA 1A63A 4OXPA 4QMGA 1N33Q 1NMGA 3MXGA 3G4SA 1ENCA 2Z1CA 4B9XA 1PXUA 3KOJA 3AFQA 1XNQQ 4DV7Q 2AWNA 4MHEA 1FJGL 3A74A 5M5WH 3T1YQ 1MKHA 2HDMA 1I6VC 3AYHB 1TS5A 3VR3A 1O78A 1I4HA 1KABA 1DJRD 2AQ2B 5LMNL 4BA1I 1NNXA 2A6ED 3HRZC 1AZPA 3GP7A 4JI2L 3SR1A 2QDLA 3CCUA 1AZQA 2JEBI 4AYBB 4KD3A 4EX5A 4U673 1WTHA 2E2JH 1KL9A 3J81E 2K14A 2BDOA 2B29A 1TWCH 1T5EA 4JI6Q 3H3VI 2XNAC 4AIMA 1YI2A 1B7YB 2VXWA 4JC0A 1XTCD 5IGDA 1O7YA 5D3DA 1UEBA 4OIJA 1BXTA 3V2TA 1DONA 1TKWB 1GO3E 4KK7A 1R4QB 4UP9A 2DY8A 2LMCB 3E9HA 1HUMA 2PW5A 5JAVA 3PIPA 2K1BA 5CV8A 4YCWA 4RAUC 2GVAA 3PUZA 1I50H 2EPBA 1EOVA 4JBKA 4HCEA 4H0LC 3VR4A 4DPGA 1D2BA 3CC7A 1G6PA 4B3SL 3U9SA 5COYA 2IL8A 3P1HA 5GADC 4FF1A 3Q22A 5IOCA 4O0AA 1D5ZC 3PUVA 1N34L 4KHPL 1VQHA 3IFDA 3S14H 1IW7C 2F52A 1I94L 3LWUA 5C4XH 1QE6A 1SYDA 2YYZA 4CJ0B 2PYKA 1IBML 2F0KA 5FKAC 3NWSA 3LNNA 3Q24A 2E2JB 3TZUA 2A6HC 1GXDC 5KYIA 3BYTB 3B6YA 3U9OA 3N52A 1PH4A 1K83H 1IXRA 2UXDL 2XVSA 4IFDJ 5C4XG 2VQFL 2HHHL 2YV5A 2B3GA 4OX9Q 3S1MH 2H4OA 1UE7A 4KJNA 2FMCA 4X64L 1KD1C 1EQTA 4UP7A 2ATWA 1QB5D 4DR2Q 1XWEA 2UUCQ 4JI4Q 2F4VL 1EQVA 5EBDA 1I50B 2L55A 3H0GH 1YITA 4A3MB 4DN4M 1VQGA 2CH4A 1GKHA 3Q0AA 4QUFA 2IJ0A 3KDFB 4JI0L 2MHVA 5LMNW 3H0GG 1A3UA 3S14B 1S3OA 2UXBL 1YNJD 1EU3A 1VQ4A 3K81C 3KDFA 4XT1B 1STGA 3FRPB 3MWYW 4KI0A 5IE8A 4FF3A 4DUZQ 3VYTA 1BCPD 5K36H 1X56A 1I6HH 5JOBA 1QJOA 4XXEA 2R7DA 4JYAL 4OO1H 3BVMA 3S1MB 1STHA 4PZ6A 4L5RC 3CCVA 1FNVA 4B3TL 4HIKA 3OIPA 5K36G 3NHHA 5M5YB 2ICIA 3TS0A 4IPDA 2SDFA 5J1ZA 3QIAA 4HSPA 3MXUA 1VQCA 1PVOA 4OO1G 1TQOA 1EY7A 3I56A 1LV9A 1A62A 2FXQA 1SFOH 1MJCA 3F2DA 1IYUA 5IIFA 2RSOA 4LW1A 1JORA 2QEJC 1HCZA 1I4XA 1VQJA 3GQBA 1D1IA 4ALPA 2C9OA 3GTLH 4V0BA 3J7AV 2RVLA 5J3BA 3GTKH 2ZJPA 5AFWA 2KCCA 5JEAJ 2X69A 1JWUD 1MD2D 1NUCA 1X32A 4K0KQ 3RN5A 4JVZA 4BS9A 2JK8A 2K5HA 2Z4HA 3PO3B 1GUGA 1HXYD 5GROA 3GTPH 4DUYL 1N32L 1I6HB 1I5FA 1SAPA 3VYSA 3IFTA 1SR3A 3FPUB 4XT3B 1J6QA 2MO0A 5F2DA 3R8BA 3MFYA 2RCNA 3CKIB 3HOUH 1VS0A 4RKBA 3T1HL 1CQVA 3L2PA 3D4WA 4A3CH 1E3PA 1SYCA 4DK1A 4JCVE 1MBYA 3DHQA 3CPFA 1TWFB 2EJGC 1RDPD 1SFOB 1SNDA 1SXTA 3HOUG 1IBLL 2OTLA 3H94A 1V1OA 2B63H 3DWAA 4A3CG 4HIMA 1WTVA 1EQQA 3GTLB 3TN2A 2PNHA 5KGUA 2WFWA 3GTKB 4ZK9B 1I4QA 4GLXA 2PZUA 3S1QH 1LABA 1QNKA 1NMFA 2B63G 4DKAC 1LTBD 2EYFA 3U50C 2EYMA 3K7UC 3KFUA 1BCPF 3H09A 2F0GA 3CAMA 2LKVA 2RDGA 4G7HC 3D4RA 3E3XA 3UE1A 3GTPB 4J8QA 2I07B 2K6AA 4DFAA 1ZXTA 1LT4D 3PCOB 4L5QA 1F9QA 3R3OA 2ZXOA 3VA5A 3EA6A 2KEEA 4Q5VA 3HOYH 4LF6Q 1ESRA 3RLOA 2JA7H 3F1ZA 3M3YH 1EWHA 1STBA 4ILWA 3K80C 3GV6A 2HCCA 1TIID 1IW7D 4JI8L 1KLGD 1EIHA 4TQUS 4X65Q 4JI1Q 1GUOA 2N3SA 2MPMA 3HOYG 1XTDA 2B63B 3LWEA 1IHZA 3UI2A 1LTLA 1PH6A 4OEMB 4R4IA 5FO8B 4LF8L 4Y7NH 3A5ZB 5JJZA 1X54A 4BWGB 2NVTH 1CSQA 3S1QB 2F0SA 3SXHA 1S4ZA 3ULLA 4A4IA 4U68A 2M00A 3L9AX 1I3QB 2OT2A 4H13C 4DR7Q 4X6AH 4FXGC 1X3EA 2F0DA 4A3EH 4LFCQ 1RL2A 4K2KA 1V1PB 1Y8NB 4MN3A 1QVFA 1MSGA 2SNSA 5JPNC 3CF5A 3HP3A 4C3IH 1B53A 2KJXA 5E4WC 1JOKA 4A3EG 4OELB 1V1PA 3TS2A 3TEHB 1K0SA 1TS2A 3HOYB 1Q7YC 2D0PA 4DR1L 2FJ2A 4OO1I 3OMGA 4C3IG 5BR8L 3QJYA 1HZAA 2P5ZX 4B3RL 1PFSA 3CCRA 4LFBL 2K28A 3KLRA 4PZ8A 4IO9A 5BN5A 2EYHA 2MP1A 4B3MQ 5I9PA 1G8ZD 4X3TA 4KJOA 3F2UA 1KRSA 4N9PA 2YTYA 4LUOA 4NKLA 5KEEA 4A3KB 1VQ6A 4LJZC 1WYDA 4JOIA 1PA6A 2NVTB 1K3BC 2WKCA 2MQHA 3GV3A 5IP9H 1SE8A 2A5HA 5H1SE 1IBKL 2Q8RE 3ND8A 4A3EB 4KY6A 1BKBA 2YTVA 3J80i 2JA8G 3G48A 4F87A 1EEID 1C4QA 1OXUA 2J0TD 1JMCA 3S2DB 2B2UC 1ZYRC 5IP9G 4NPSA 4A3GH 1PTOC 4DAMA 2WV6D 4RHSA 1RODA 2NN6H 3K59A 2ES2A 5I6YA 2LSSA 3SK8A 1O7IA 3ULJA 4A3GG 3GO5A 5EPKA 2G9HD 1FJGQ 3F2CA 4HJ8A 2NN6G 5I6WA 4QGUA 2YTXA 3UE0A 1D6EC 2F0IA 4NP5A 3C46A 4GNXC 1YVCA 3CMAA 2HQEA 3PUWA 2BA1A 1XPUA 5LMNQ 1PRTD 1X65A 1Q90A 3HOWH 2JA8B 4IURA 4JI2Q 4DR6L 3ND9A 1HZCA 3A7AB 1R9TH 2CW0C 1JQYD 3QG1A 2EOTA 1B2TA 4L8JA 4G7ZC 2F0UA 4KN7C 3HOWG 5FLMH 3E0EA 3S17H 4APVA 2UXCL 2ZTCA 3I3CA 4N8FA 3WWVA 4HJ5A 1TVXA 4A3GB 3RZDB 3NQIA 5IODA 5CR3A 5EPLA 4L5SA 1CUKA 4CGYB 5FLMG 5JJKA 1A2UA 4J6HA 2EDGA 3GTMB 3DLLA 1B1ZA 1XMOL 4DK0A 1W6JA 4O2DA 4HIDA 3PIO3 4DXGA 2JYOA 4EQ5A 1HHVA 4B3SQ 5IGFA 4P72A 5TSSA 2K5WA 4IPCA 3HOXB 1R4PB 2N49A 3MZ5A 5C44B 1EWIA 2WAQG 1QVGA 4B9WA 1N34Q 4KHPQ 4AYBE 1RIPA 3HOWB 2GA4B 3IRBA 4PZ7A 1I94Q 1DOMA 4Q0FA 3NENA 4RA8A 5CV5A 1R9TB 4FP5D 4GN3B 3M4YA 1IBMQ 1VQ5A 4A3IH 4GOPB 4JI7L 2E76C 4UPAA 4K5WA 3AQQA 1DM0B 2E75C 1WTPA 2UXDQ 3J81i 2VQFQ 2HHHQ 4OL7A 3S17B 1B4OA 1CKMA 1E24A 4GOPA 3L0OA 1N36L 4A3IG 1ZEQX 3H3VC 4BBSB 2QW7A 1VDZA 4X64Q 1OXXK 3I90A 4AQYL 3TREA 1FYCA 2F4VQ 1FNWA 2B2YA 1TS3A 1A3TA 2EXZA 4QF4A 3SHLA 2A69D 4PMCA 2SOBA 4GKJL 5EPJA 3BZDB 2E2DC 3RUZA 4YCVA 4JI0Q 2ZM6L 1HR0W 4GLAC 3KBXA 3KBGA 3J80L 2UXBQ 1CT1D 3BDOA 4ABNA 1S5FD 2HD3A 4A3IB 5IWAL 1Q81C 3J80E 1SE3A 2LS01 1WI5A 3WDNA 5C0XJ 5DEHA 3ONAB 1M8AA 2R92H 5M3MH 1XMQL 4JYAQ 2F0VA 2CCZA 3WOFA 4B3TQ 4ODGA 5DNFA 4LFAL 5IP7H 2B2TC 2M9VA 5GAEC 1EEFD 2R92G 4J1MA 2E2IH 3STBC 3J81j 5M3MG 4LUVA 3NWTA 3VYUA 3X3NA 2NN6I 1QILA 4EQOA 2PMZB 3W2DA 3I4OA 2NB0A 5IP7G 1STYA 4FNFA 4XIGS 1Q46A 4C2MB 3BVGA 2YU9H 1M1KC 1O7ZA 2KOLA 3E9IA 3GD7A 1Y14B 3D4DA 1JCKB 1ZYRD 2HCIA 3E5SA 1HFNA 1PTOD 3FVQA 1I4RA 2Z6BA 4NXML 4WFN3 1EYGA 1O7LA 4KHVA 2EY5A 1WTQA 4K2LA 2E2HH 4X3SA 3GTOH 1SROA 2AMCB 2BCOA 3RZOH 4DUYQ 3KK7A 1N32Q 2R92B 4MZ9A 5M3MB 2R3ZA 2PZWA 5KNBA 1VQAA 2A68C 2IX0A 2RHSB 2JP1A 1EIGA 3CCMA 3T1HQ 2UUAQ 1UUPA 5DLQE 2E2IB 3GTGB 2SNMA 1WVLA 3BDLA 3MA2B 4QJFA 1HNZL 1KIXA 5FOBB 1SMXA 2CW0D 1CA6A 1IBLQ 4JK1C 2ICEC 2NVQH 2PW7A 4KY5A 2YU9B 2J4XA 1K28A 3TP6A 3M4QA 1PYSB 2K52A 3J81L 1YHQA 1PZJD 3VR5A 4PNYA 4LF5L 5A2QE 1RTOA 3EROA 1L2FA 2E2HB 3GTOB 1KDBA 1A3VA 1HJPA 1QWYA 4RMFA 3RZOB 3S1NB 1S5CD 1ENAA 1BNZA 1IL2A 2DJFC 1U4PA 2JN4A 2KCTA 1QZGA 1W3SA 4CJ2C 1DXMA 1FR3A 1OTCA 3PGZA 2DJGC 1Q86C 1LACA 4R1JA 3FEWX 1M90C 4JI8Q 3M7GA 2IX1A 3KJOA 1EYDA 2H1EA 4IUVA 1WD0A 1VMCA 4UHVA 4GZYC 1TY2A 5KNCA 2X6GA 1DOKA 5M5WB 3U4ZA 4KD4A 1BDOA 1ICFB 4R4OA 4LF8Q 1TWHH 1EIFA 2F0JA 2B39A 3ZYYX 1NY4A 5C5LA 4ZKCB 2WKDA 4XTCS 2L5TA 2HUGA 2QDBA 3VDYA 3C2PA 2KVMA 3AB9A 4IUPA 1SNMA 3G6EA 1NSNS 2EVBA 3A8KE 1F2ZA 3N6RA 5M3FH 1WTXA 3NBIA 1GHKA 1TWCB 3K7AH 2V1CC 2RKSA 1JJGA 1SMYC 3D0FA 2ZJRA 1Y8PB 1I4PA 1RF2D 3HG9A 4H02A 4DR5L 3ZJYC 1LLRD 5M3FG 4JI5L 4DR1Q 2F3VA 3I72A 2D2CC 5BR8Q 4DK6C 1SJHD 3K6OA 5BN4A 4DV6L 2N8NA 4B3RQ 1OO9B 4F7XA 1KRTA 4LFBQ 1J9OA 4OHJA 4HMJA 1SRUA 1HRJA 3OIQA 1WTWA 1BBWA 3ER0A 4E6IA 4FYDA 1PFBA 3QB3A 1B44D 3MXNB 1TWHB 1EYAA 2RF4A 4H44C 1LT5D 1K8MA 4IOAA 2I5MX 1PH8A 4CDCC 1Q8IA 1SJED 3C1FA 1KNAA 4KKTA 4NB3A 2RQXA 4IJHA 4YWLA 4A3FH 5K5PA 5JJIA 5HGQA 1IBKQ 2MO1A 3OSOA 5C4XB 3SVMA 1SSOA 2F3WA 3MXNA 1U4MA 2I5HA 3DWQA 1MGSA 2CVRA 3STBD 1QVCA 3A7LA 3KJPA 4C56C 4HEDA 4A3FG 4HR7B 1K83B 1X55A 3SE0A 3CRKC 4IALA 1SYFA 2L9HA 2PQEA 3BZKA 1HQMC 1EUJA 1L0XB 3P7JA 4DA2A 2XWBB 1F2LA 3I70A 2BDNA 2BH8A 2TSSA 1AEXA 1LUZA 1S72A 1STNA 3NXWA 1VQIA 1B8AA 2AUKA 4FF2A 4JG2A 1Y1WH 1FGUA 4OIKA 3TP5A 1SNCA 3H0GB 2HT1A 5CV7A 1C8CA 4FO2A 3OYYA 1VQDA 1SNPA 3CPWA 1EWCA 3QR8A 4ZUIA 3NPPA 4DR6Q 4QIWB 4RHRA 1Y1WG 1EYCA 3OWFA 1CI3M 2FFKB 2A68D 3DXJC 1UNSA 5JVH3 4OWWB 1QNUA 1OXSC 3G6JB 2EYLA 1ET9A 3QWNA 1EOTA 4WJ3M 1SNQA 4XQNA 2EQSA 1F2MA 2UXCQ 1H9JA 1WD1A 1PRTC 1PV4A 3A0JA 1PZKD 4H7BA 5C6AA 1YJWA 1V43A 4PG3A 1B9NA 2ZTEA 5T1GA 4DNRB 1KQSA 4XDXA 2UUAL 2R7ZH 2AHOB 3JAME 5E1FA 1XMOQ 2NWGA 5EJWA 2K33A 1MI2A 4JW0A 1Y1WB 2F0QA 1DZ1A 1Y1VH 3UDXA 4GN5A 1E7ZA 1YNNC 3NQTA 3PF5A 1PH7A 2R7ZG 2RHQB 1PLFA 5ELFA 2EYOA 4O1NA 2MUYA 3H6MA 1Q1EA 4EGVA 1Y1VG 3VR2A 2AUJD 2K50A 1PH2A 5EKKA 2B2WA 3TDQA 4JI7Q 4CHTB 3A56A 2IWHA 1EY4A 1WJJA 4RCOA 5E7NA 1JT8A 1N36Q 3DM3A 1YZ6A 1Y69U 2ZJQA 4AQYQ 3HOUB 2AQ3B 4LF7L 3OMCA 5LHY1 2R7ZB 1AP0A 2ZT9C 1QOHA 3FKIH 1D8LA 1C48A 3RNUA 4P75A 4GKJQ 1TU2B 2KCMA 3TBIB 3I4NH 1VQ9A 1ET6A 2B8GA 4IFDH 2JA7G 3S1RH 1HZ9A 2ZM6Q 2EYPA 3FKIG 4OWXB 1JB3A 3TMEA 4G7OC 1ILQA 4O42A 3V05A 1U4LA 5CV6A 1SMYD 5DAUA 2JA6H 3I4NG 4CJ1B 2KEDA 1PDQA 2B8FA 3CRLC 4A3DH 2A69C 5IWAQ 4IFDG 3MEFA 1L0YB 1T9HA 4DAVA 2F1MA 1BQQT 3O13A 4YWMA 3HKSA 4IZ8A 1PFMA 3GTJH 1IZ6A 3J80c 1XMQQ 1RCVD 2JA6G 2PCFB 3I55A 4A3DG 4IUTA 3SK6A 3S24A 2DN8A 4LFAQ 1VQPA 1QUQB 2KUMA 4NXNL 3DEPA 3TZDA 3BZCA 3OPOA 5FLXE 2JA7B 5BN3A 4EQNA 1TY0A 3M3YB 1CKNB 2RDFA 3KYHC 3T53B 1BBUA 3FKIB 1QUQA 1BF4A 4LF4L 3TP7A 1NAPA 1BVSA 3I4NB 2O5IC 2E5LL 2F0PA 2Q8TA 3S9WA 1CKNA 4TSSA 2MGSA 1FVIA 2R93H 4Y7NB 5AJ3L 4QCLA 1VQKA 1SE4A 1AN8A 4P73A 4ULLA 3NUCA 4NXMQ 2JA6B 4A3DB 1RKNA 4LNQA 4POGA 4L63B 4JI3L 3CCEA 1K8OA 4MTKA 1HFGA 2KQ3A 1CHQD 2R93G 4IPHA 1QCBD 4X3KA 3GTQH 1F2YA 3NELA 2EXDA 4RGOS 1D5XC 3K8AA 3LGJA 1A15A 4IUNA 4C3IB 3UDFA 1HPCA 2EZVA 2F0WA 3HKZG 5JEAH 1DD2A 1F9SA 2EY1A 3EQLC 2PMZE 1GUNA 1WTRA 1UE5A 1NJIC 1HUNA 3PIP3 2L4NA 3HOZH 1L0WA 1EY6A 5EBCA 1HNZQ 3A55A 1HZBA 1CTMA 3M9BA 4X3UA 2NVXH 1D5MC 5JEAG 5CV4A 5CORA 3T16A 3PUYA 3HOZG 5EKLA 4DAPA 3OW2A 2EJMA 4TKOB 2L0CA 2R93B 1VCIA 2R61A 2Z6KA 4KTAA 2HDLA 3J7A5 4BA2I 4ZRZA 5ISRA 1HR0L 4LF9L 2KENA 3IKJA 2NTTA 5ELCA 4LF5Q 4KV6A 4HSVA 5M9OA 3M4PA 4IPGA 4M8AA 3S2HH 1EFWA 2JJQA 2XWJB 2MNAA 3HKZB 2K03A 4DV3L 3GTQB 1L1OC 4JV5L 3DUZA 3D3RA 3J81c 1DOLA 1VQEA 1EY9A 4I65A 5FJ8H 4R4TA 2B2VA 1YNND 3URYA 4XQQA 2H5XA 1NR2A 3SEBA 1FL0A 2WP8J 4I7AA 3HOZB 4GKKL 3T4AC 3OW7A 3AEVA 1ML0D 5FJ8G 2VQEL 1W2BA 3D6CA 4FXDA 3M4OH 1HTPA 2B2YC 1GUSA 2NVXB 3DEOA 2G5DA 2E8GA 1TWGH 5C3WA 1PMRA 4DV1L 4RWSC 3EBEA 3EJIA 4QY7A 2F03A 1Q1BA 4JBWA 2F0TA 2KECA 4IFDI 3PO2H 3CU7A 2K5QA 1VMPA 1JC7A 5L37A 3GDEA 5GQOA 2AWOA 4A76A 3S2HB 5LL6X 5FO9B 3DWPA 1G51A 3QO2A 5IGEA 2EY2A 1NCVA 1OXVA 2VW9A 2F4IA 4CKCA 3PO2G 4ZQ3A 3T56B 2L11A 3KLWA 4DR5Q 1X3PA 4DR3L 2CKZB 4JI5Q 3R93A 1QZHA 1J5EL 3MFGA 2K05A 3SK4A 4DGZA 4DV6Q 1SN8A 2WAQB 1EY8A 5CBAE 4JPBW 4C1NI 1JWSD 3SK5A 4DV2L 4HJAA 4JBJA 1GD7A 3PSIA 1HNXL 5M5XH 1ONLA 2NYZD 5ELBA 2N55A 1B70B 1PRTF 3W1GA 1WFQA 4C1NK 1NE3A 1KAAA 2Z0SA 2NZHA 4F88A 2EE1A 3T51B 4IUQA 4ZLTF 4TRDA 3G7LA 1YJNA 4R8NA 1AH9A 1LO5D 4QUCA 3MHBA 4DV0Q 2Q2UA 4C3JH 5CC4A 2A74C 2VB3X 3PV0A 3S15H 4IOCA 4IQZA 2O4XA 2KBNA 5J22A 4WRDA 3HOVH 2K5VA 4FDBA 1ESFA 1SYBA 2UU9L 3RD4A 2QILA 1ASZA 4C3JG 3NTHA 5DM73 4FXKC 4LAAA 1LTAD 2C35B 3HOVG 2JA9A 4DAYB 1UE1A 1XX8A 5JPMC 4C3HH 4HJ9A 3E0JA 2BA0A 2NBFA 1SDFA 3TSSA 4DAYA 4DXFA 1O80A 1JR0D 1ZKOA 2DY7A 5IY0A 4DV5L 2KCNA 2PI2A 3OTOQ 4RGNA 4C3HG 4K6DA 2RSNA 5IGBA 2NZOA 4OWTB 3F8TA 1N9WA 3TP8A 2NUCA 5C4HA 3KF6B 4C3JB 2JXMB 3FP9A 3AFPA 4N9TA 1UWVA 3BYYB 5D3IB 3L7ZC 3HOVB 3KF6A 3ICEA 3PF4A 2I46A 2F0LA 3PUXA 1A8VA 1IKLA 3W5OA 1EU4A 4DK3C 5IT9E 5FK9C 4I7ZC 3R2TA 4R9WA 1YHAA 2D5DA 3C1EA 3H91A 5GAGC
chains in the Genus database with same CATH topology
4C3HB 1E2WA 3DM1A 3MC0B 5KIXA 2Z8LA 2O5JC 2BE5C 1BCPB 4FVMA 2B2TA 2F0EA 3KLSA 1IKMA 4WJWA 5A2QL 1ICWA 3MEHA 1AW7A 3MAQA 1ENFA 3IAYA 2K04A 3V96A 1HA6A 2PPBC 1T5XD 2PZTA 3R2IA 1G91A 4KKUA 1TS4A 1NR4A 1SE2A 4DNTB 1H9KA 3VYRA 1H9SB 1Y8OB 4Z9CB 5CMDA 1KTKA 3KLSX 4ME5A 1HQRD 1VF7A 4CKBA 3M7NA 3NTKA 2NVQB 1CZGA 1H9SA 2Y0SB 1E2ZA 2DNCA 1PTOF 1CHPD 2PO4A 1TT2A 1PZID 3X3MA 3MTSA 4HCSA 5KRUA 4IN3A 3FMCA 3W3AA 4ZKBB 5C3XA 2L12A 2ZXRA 3NE5B 4BBRB 3HS0C 1LTRD 5C0XH 1B50A 3I4MB 2K32A 4G4KA 1ILPA 1STEA 3A8JE 5NUCA 1HA5A 5C0XG 2E74C 1VF5C 2JE6I 5I4DA 2K5DA 1G2SA 1STAA 1CK1A 2KA7A 3E6ZX 5M3FB 3K7AB 1EY5A 3ERQA 4KHZA 4S3SA 1LTGD 2FHTA 2XRSD 2F0OA 4KKSA 3T13A 2JA5B 3D6WA 2D62A 1SYGA 2WB1B 4FF4A 4HN7A 2ID0A 1E0BA 3I73A 3WOEA 5C3EB 2XRQD 4A3FB 4P2CB 1TWAB 2B2WC 1S5BD 1XXGA 2WINB 1OXTA 1FD7D 5ELDA 4K14A 5JVG3 1RD9D 5DM63 1A2TA 3HZXA 5KNDA 4XQJA 2R6GA 5C4ZA 3JAML 3J7YW 2BE5D 4YIJA 3K0YA 3OWEB 1RHPA 4V190 5EKIA 2VUMB 4XYOA 3I91A 5EQ0A 4A3BB 4RH6A 1II3A 1KLUD 4DF7A 1Z47A 3ITPA 1CM9A 1X3QA 1RJTA 5FO7B 2CHBD 5CBEE 3SDZA 4HAEA 1SBBB 3RLFA 4R8IA 1EZ8A 5IGGA 2ENBA 2J7ZA 2Q8IB 3BDCA 4UDUC 2IX3A 3L3OC 4KN4C 3J7AF 1PRTB 3NBHA 4K8JA 2FMMA 2VNUD 4F8MA 4A3JB 5J39A 1GOZA 5HURA 1RTNA 1Z6HA 4IUUA 1GHJA 4HMIA 1UAPA 3P75A 1FGBD 1Y1VB 4UAIA 2L1BA 1J8IA 2A73B 1EY0A 3NSWA 5CYUA 5C0XI 3NK9A 2C5CA 5I2YA 4DU9A 4KMUC 3A54A 2V4DA 4RKLA 1KDAA 1BBXC 3K5OA 2RBMA 1U9RA 5CV9A 2A6HD 1M4VA 5FLXL 2K7VA 4PQXA 1EFID 3S16B 1DCZA 3KUPA 3K58A 1KDCA 2DNEA 2G9DA 1LTID 4PV1C 1BO0A 5G3LD 2NZ1D 1JWMD 4KY7A 2IT1A 2XIWA 3KF8A 3PMFA 1WCMB 3S1RB 5D14A 2WACA 4L6TB 3DMUA 3AMUA 4CKEA 3BS1A 3MVVA 4WORA 3EVQA 2QCPX 3NTIA 3GTJB 2IPKD 1UEAB 4ZAIA 3RMHA 5EGTA 3HEJA 2B2VC 1F9PA 1E2VA 1LTTD 3IL8A 1BOSA 4RCNA 1F77A 1PTOH 3FPPA 1CZWA 4RFBA 5ELEA 4HTHA 1CA5A 2M2LA 3BG3A 2FINB 2F0NA 5I9OA 1S5ED 2F0HA 1S5DD 1SEBD 1CQFA 5HGTA 2X6LA 5D65A 3NP8A 5KYLA 1SNOA 1MSHA 4EQPA 3A8IE 2EY6A 1KNEA 2NVYB 2ZXPA 2LFNA 2OF1A 1Q3LA 5IGCA 2K01A 1B3AA 1FNUA 4A93B 1WTOA 1PTOB 4ID6A 1G291 1Z7TA 1B9MA 5G3LF 4K5XA 2EJFC 3M85A 4XYQA 2B2UA 4K8IA 2VB2X 2A6EC 1PYWD 1GJXA 2JSOA 2IW3A 1D1KA 1EL0A 2Z4IA 1H9MA 3AU7A 4K6LA 5E3FA 2QKIC 3MXPA 5A35A 3CHBD 3K5LA 4ZYSA 3D8GA 1U4RA 2N88A 2RDHA 2QF7A 1SYEA 2WIIB 2JEAI 3OHXC 2TMPA 2LY7A 1LT6D 1JOOA 2NTSA 2F0MA 1QG7A 1V8QA 3M4OB 2RA4A 1IYVA 3K5NA 2F0FA 2XSCA 1TWGB 4OGQC 1LT3D 1A6XA 2AQ1B 3PO2B 1BR9A 2XN9C 3EFXD 5CGKA 1JE4A 5LL6S 4MIUA 1F9RA 1HTLD 3C3LA 2PNRC 5C4JB 1H9RA 3HGBA 1AFPA 2CQAA 1G2TA 5E4XA 1DYQA 4G57A 1W6KA 5I2XA 4RGTA 4EVOA 4K5VA 4PMWA 3K57A 4PMBA 3LX0A 1EZ6A 5M5XB 4ZUJA 1XYIA 1I4GA 1YNJC 4M1UB 3P20A 3BVZA 3QOJA 2SEBD 3Q6SA 2D9UA 1TR5A 1IL8A 3VR6A 4LK1C 4BY7B 3Q23A 1BCPC 1LTSD 2KHSA 3K5MA 4RGMA 1GUWA 2BOSA 4B08A 3S15B 3OOCA 1JICA 5T1IA 5IT9L 4QB4A 4LMQD 2MJ8A 1JOQA 4NW2A 2OXPA 2O2LD 4NMZA 2OEOA 3CQZB 5C5MA 3I8ZA 3I4LA 3QOLA 3VA7A 1GUTA 4BY1B 1Q12A 3D31A 1PFNA 2EYJA 1BUVT 1G6ZA 1CFMA 3FDTA 4CBVA 4NDXA 4QMGA 3MXGA 1ENCA 2Z1CA 4B9XA 1PXUA 2AWNA 4MHEA 2HDMA 1I6VC 1TS5A 3VR3A 1I4HA 1O78A 1KABA 1DJRD 2AQ2B 4BA1I 2A6ED 3HRZC 1AZPA 3GP7A 3SR1A 1AZQA 2JEBI 4AYBB 4KD3A 4U673 3J81E 2BDOA 1T5EA 2XNAC 2VXWA 1XTCD 5IGDA 1O7YA 5D3DA 4OIJA 1BXTA 3V2TA 1DONA 1TKWB 4KK7A 1R4QB 2DY8A 2LMCB 1HUMA 2PW5A 5JAVA 2K1BA 5CV8A 4RAUC 3PUZA 2EPBA 4HCEA 4H0LC 3VR4A 1D2BA 3U9SA 5COYA 2IL8A 3P1HA 4FF1A 3Q22A 5IOCA 1D5ZC 3PUVA 3IFDA 1IW7C 3LWUA 1QE6A 1SYDA 2YYZA 4CJ0B 2PYKA 2F0KA 5FKAC 3NWSA 3LNNA 3Q24A 2E2JB 3TZUA 2A6HC 1GXDC 5KYIA 3BYTB 3U9OA 3N52A 2XVSA 4IFDJ 2H4OA 4KJNA 2FMCA 1EQTA 1QB5D 1XWEA 1EQVA 5EBDA 1I50B 2L55A 4A3MB 4DN4M 3Q0AA 4QUFA 2IJ0A 2MHVA 1A3UA 3S14B 1YNJD 1EU3A 4XT1B 1STGA 3FRPB 3MWYW 4KI0A 4FF3A 3VYTA 1BCPD 5K36H 5JOBA 1QJOA 4XXEA 4OO1H 3BVMA 3S1MB 1STHA 1FNVA 3OIPA 5K36G 3NHHA 5M5YB 2ICIA 2SDFA 5J1ZA 3QIAA 4HSPA 3MXUA 4OO1G 1TQOA 1EY7A 1LV9A 1IYUA 5IIFA 2RSOA 1JORA 2QEJC 1HCZA 1I4XA 3GQBA 1D1IA 2C9OA 4V0BA 3J7AV 2RVLA 5AFWA 2KCCA 5JEAJ 2X69A 1JWUD 1MD2D 1NUCA 1X32A 4BS9A 2Z4HA 3PO3B 1GUGA 1HXYD 1I6HB 1SAPA 3VYSA 3IFTA 3FPUB 4XT3B 5F2DA 3R8BA 3MFYA 3CKIB 4RKBA 1CQVA 3D4WA 1SYCA 4DK1A 1MBYA 3DHQA 1TWFB 2EJGC 1RDPD 1SFOB 1SNDA 1SXTA 3H94A 1V1OA 3DWAA 1WTVA 3GTLB 3TN2A 5KGUA 3GTKB 4ZK9B 1I4QA 2PZUA 1LABA 1QNKA 1LTBD 2EYFA 2EYMA 1BCPF 3H09A 2F0GA 2LKVA 2RDGA 4G7HC 3D4RA 3GTPB 4J8QA 2I07B 2K6AA 4DFAA 1ZXTA 1LT4D 1F9QA 3R3OA 2ZXOA 3VA5A 3EA6A 2KEEA 4Q5VA 1ESRA 1EWHA 1STBA 4ILWA 3GV6A 2HCCA 1TIID 1IW7D 1KLGD 1EIHA 4TQUS 1GUOA 2MPMA 2B63B 3LWEA 1IHZA 3UI2A 5FO8B 5JJZA 4BWGB 3S1QB 2F0SA 3SXHA 1S4ZA 4U68A 2M00A 3L9AX 1I3QB 2OT2A 4H13C 4FXGC 2F0DA 4K2KA 1V1PB 1Y8NB 4MN3A 1MSGA 2SNSA 5JPNC 3HP3A 1B53A 2KJXA 5E4WC 1JOKA 1V1PA 1TS2A 3HOYB 2FJ2A 4OO1I 3OMGA 4C3IG 3QJYA 2K28A 3KLRA 5BN5A 2EYHA 2MP1A 5I9PA 1G8ZD 4X3TA 4KJOA 3F2UA 4N9PA 4NKLA 5KEEA 4A3KB 4LJZC 2NVTB 2WKCA 3GV3A 2A5HA 2Q8RE 3ND8A 4A3EB 4KY6A 4F87A 1EEID 1C4QA 1OXUA 2J0TD 3S2DB 2B2UC 1ZYRC 1PTOC 2WV6D 4RHSA 1RODA 2NN6H 3K59A 5I6YA 3SK8A 3GO5A 5EPKA 2G9HD 2NN6G 5I6WA 1D6EC 2F0IA 4NP5A 3C46A 2HQEA 3PUWA 2BA1A 1PRTD 1Q90A 2JA8B 4IURA 3ND9A 3A7AB 2CW0C 1JQYD 3QG1A 2EOTA 1B2TA 4L8JA 4G7ZC 2F0UA 4KN7C 3I3CA 1TVXA 4A3GB 3RZDB 3NQIA 5IODA 5CR3A 5EPLA 4CGYB 1A2UA 4J6HA 2EDGA 3GTMB 1B1ZA 4DK0A 1W6JA 3PIO3 4DXGA 2JYOA 1HHVA 5IGFA 5TSSA 2K5WA 3HOXB 1R4PB 3MZ5A 5C44B 4B9WA 3HOWB 2GA4B 1DOMA 4Q0FA 4RA8A 5CV5A 1R9TB 4FP5D 3M4YA 2E76C 4K5WA 1DM0B 2E75C 1WTPA 4OL7A 3S17B 1B4OA 1ZEQX 3H3VC 4BBSB 1VDZA 1OXXK 3I90A 1FYCA 1FNWA 2B2YA 1TS3A 1A3TA 2EXZA 4QF4A 3SHLA 2A69D 4PMCA 2SOBA 5EPJA 3BZDB 2E2DC 3RUZA 3KBXA 3KBGA 3J80L 1CT1D 3BDOA 4ABNA 1S5FD 4A3IB 3J80E 1SE3A 2LS01 5C0XJ 3WDNA 5DEHA 3ONAB 1M8AA 2F0VA 3WOFA 4ODGA 5DNFA 2B2TC 2M9VA 1EEFD 4J1MA 3NWTA 3VYUA 3X3NA 2NN6I 1QILA 4EQOA 2PMZB 3W2DA 2NB0A 1STYA 4FNFA 4XIGS 4C2MB 3BVGA 1O7ZA 2KOLA 3GD7A 3D4DA 1JCKB 1ZYRD 2HCIA 3E5SA 1HFNA 1PTOD 3FVQA 1I4RA 4WFN3 1O7LA 4KHVA 2EY5A 1WTQA 4K2LA 4X3SA 2BCOA 3KK7A 2R92B 5M3MB 2R3ZA 2PZWA 5KNBA 2A68C 2IX0A 2JP1A 1EIGA 1UUPA 2E2IB 3GTGB 2SNMA 1WVLA 3BDLA 3MA2B 5FOBB 2CW0D 1CA6A 4JK1C 2ICEC 2PW7A 4KY5A 2YU9B 2J4XA 3TP6A 3J81L 1PZJD 3VR5A 4PNYA 5A2QE 1RTOA 3EROA 2E2HB 3GTOB 1KDBA 1A3VA 1QWYA 3RZOB 3S1NB 1S5CD 1ENAA 1BNZA 1U4PA 4CJ2C 1DXMA 1FR3A 1LACA 3FEWX 3M7GA 2IX1A 1EYDA 2H1EA 4IUVA 1WD0A 1VMCA 4GZYC 1TY2A 5KNCA 2X6GA 1DOKA 5M5WB 4KD4A 1BDOA 2F0JA 2B39A 3ZYYX 5C5LA 4ZKCB 2WKDA 4XTCS 2L5TA 2HUGA 2QDBA 3C2PA 2KVMA 3AB9A 4IUPA 1SNMA 1NSNS 2EVBA 3A8KE 1F2ZA 3N6RA 1WTXA 3NBIA 1GHKA 1TWCB 2RKSA 1SMYC 1Y8PB 1I4PA 1RF2D 3HG9A 1LLRD 2F3VA 3I72A 2D2CC 1SJHD 3K6OA 5BN4A 1OO9B 4F7XA 1J9OA 4OHJA 4HMJA 1HRJA 3OIQA 1WTWA 4E6IA 4FYDA 1PFBA 1B44D 3QB3A 1TWHB 1EYAA 4H44C 1LT5D 1K8MA 1Q8IA 1SJED 3C1FA 1KNAA 4KKTA 2RQXA 5K5PA 3OSOA 5C4XB 3SVMA 1SSOA 2F3WA 1U4MA 3MXNA 3DWQA 1MGSA 2CVRA 3A7LA 4C56C 4HEDA 4HR7B 1K83B 3SE0A 3CRKC 4IALA 1SYFA 2L9HA 2PQEA 1HQMC 1L0XB 3P7JA 4DA2A 2XWBB 1F2LA 3I70A 2BDNA 2TSSA 1AEXA 1STNA 3NXWA 2AUKA 4FF2A 4OIKA 3TP5A 1SNCA 3H0GB 5CV7A 1C8CA 4FO2A 1SNPA 1EWCA 4ZUIA 3NPPA 4QIWB 4RHRA 1EYCA 3OWFA 1CI3M 2FFKB 2A68D 3DXJC 1UNSA 5JVH3 1QNUA 1OXSC 3G6JB 2EYLA 1ET9A 3QWNA 1EOTA 1SNQA 4XQNA 1F2MA 1H9JA 1WD1A 1PRTC 1PZKD 4H7BA 5C6AA 1V43A 1B9NA 5T1GA 4DNRB 4XDXA 3JAME 5E1FA 2NWGA 5EJWA 2K33A 1MI2A 1Y1WB 2F0QA 1DZ1A 1YNNC 3NQTA 1PLFA 5ELFA 2EYOA 4O1NA 2MUYA 3H6MA 1Q1EA 4EGVA 3VR2A 2AUJD 5EKKA 2B2WA 3TDQA 4CHTB 3A56A 2IWHA 1EY4A 4RCOA 1Y69U 3HOUB 2AQ3B 3OMCA 5LHY1 2R7ZB 1AP0A 2ZT9C 1QOHA 1C48A 1TU2B 3TBIB 1ET6A 2B8GA 4IFDH 2EYPA 1JB3A 3TMEA 4G7OC 1ILQA 4O42A 3V05A 1U4LA 5CV6A 1SMYD 5DAUA 4CJ1B 2KEDA 1PDQA 2B8FA 3CRLC 2A69C 4IFDG 1L0YB 4DAVA 2F1MA 1BQQT 3O13A 4IZ8A 1PFMA 1RCVD 2PCFB 4IUTA 3SK6A 2DN8A 2KUMA 3DEPA 3TZDA 3OPOA 5FLXE 2JA7B 5BN3A 4EQNA 1TY0A 3M3YB 2RDFA 3T53B 3FKIB 1BF4A 3TP7A 1NAPA 3I4NB 2O5IC 2F0PA 2Q8TA 3S9WA 4TSSA 2MGSA 4Y7NB 4QCLA 1SE4A 1AN8A 4ULLA 2JA6B 3NUCA 4A3DB 1RKNA 4L63B 1K8OA 1HFGA 2KQ3A 1CHQD 1QCBD 4X3KA 1F2YA 4RGOS 1D5XC 4IUNA 1A15A 4C3IB 1HPCA 2EZVA 2F0WA 5JEAH 1DD2A 1F9SA 2EY1A 3EQLC 1GUNA 1WTRA 1HUNA 3PIP3 2L4NA 1EY6A 5EBCA 3A55A 1CTMA 4X3UA 1D5MC 5JEAG 5CV4A 5CORA 3T16A 3PUYA 5EKLA 4DAPA 2EJMA 4TKOB 2L0CA 2R93B 1VCIA 2R61A 4KTAA 2HDLA 4BA2I 4ZRZA 5ISRA 3IKJA 2NTTA 5ELCA 4KV6A 4HSVA 5M9OA 4M8AA 2XWJB 3HKZB 2K03A 3GTQB 3DUZA 3D3RA 1DOLA 1EY9A 4I65A 2B2VA 1YNND 3URYA 4XQQA 1NR2A 3SEBA 2WP8J 3HOZB 3T4AC 3OW7A 1ML0D 3D6CA 4FXDA 1HTPA 2B2YC 1GUSA 2NVXB 3DEOA 5C3WA 1PMRA 4RWSC 3EJIA 2F03A 1Q1BA 4JBWA 2F0TA 2KECA 4IFDI 3CU7A 2K5QA 1VMPA 1JC7A 2AWOA 3S2HB 5LL6X 5FO9B 3DWPA 3QO2A 5IGEA 2EY2A 1NCVA 1OXVA 2F4IA 4CKCA 4ZQ3A 3T56B 2L11A 1X3PA 3R93A 3MFGA 2K05A 3SK4A 4DGZA 2WAQB 1EY8A 5CBAE 4C1NI 1JWSD 3SK5A 1ONLA 2NYZD 5ELBA 2N55A 1PRTF 4C1NK 1KAAA 4F88A 2EE1A 3T51B 4IUQA 4ZLTF 4TRDA 3G7LA 4R8NA 1LO5D 4QUCA 3MHBA 5CC4A 2A74C 2VB3X 3PV0A 4IQZA 2O4XA 5J22A 4WRDA 1ESFA 1SYBA 3RD4A 2QILA 4C3JG 3NTHA 5DM73 4FXKC 4LAAA 1LTAD 1XX8A 5JPMC 3E0JA 2BA0A 2NBFA 1SDFA 3TSSA 4DAYA 4DXFA 1O80A 1JR0D 1ZKOA 2DY7A 2KCNA 4RGNA 4C3HG 4K6DA 2RSNA 5IGBA 3TP8A 2NUCA 5C4HA 4C3JB 2JXMB 4N9TA 3BYYB 5D3IB 3L7ZC 3HOVB 2I46A 2F0LA 3PUXA 1IKLA 1EU4A 5IT9E 5FK9C 4I7ZC 3R2TA 4R9WA 2D5DA 3C1EA 3H91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2W A;  3SE0 A;  3CRK C;  3WDN A;  3A8J E;  3U9S A;  3QG1 A;  2O5J C;  2BE5 C;  1HQM C;  2KCC A;  1CTM A;  4H13 C;  5C0X G;  2E74 C;  3OOC A;  4L8J A;  4G7Z C;  3PUV A;  3SDZ A;  2ZT9 C;  4KN7 C;  1ONL A;  1DXM A;  1FR3 A;  1VF5 C;  5JEA G;  2JE6 I;  1IW7 C;  5A35 A;  1LAC A;  1Y8N B;  3RLF A;  3VR4 A;  3LWU A;  3PUY A;  1TU2 B;  2AUK A;  2YYZ A;  2QF7 A;  2B8G A;  2JEA I;  2EJM A;  3LNN A;  1GUG A;  2Q8I B;  4IFD H;  4TKO B;  3T51 B;  1VCI A;  3TZU A;  2A6H C;  4BA2 I;  3IFT A;  2KA7 A;  4KN4 C;  4GZY C;  5KNC A;  4G7O C;  1E2V A;  2CW0 C;  3IKJ A;  2NN6 I;  3I4L A;  2EDG A;  3MFY A;  4KHZ A;  1GUT A;  3VA7 A;  4RCN A;  1V8Q A;  2B8F A;  1BDO A;  3CRL C;  4DK0 A;  2A69 C;  4XIG S;  1Q12 A;  3D31 A;  3FPP A;  4IFD G;  1CI3 M;  3PV0 A;  3QJY A;  2PPB C;  3DXJ C;  2A68 D;  4HR7 B;  4IQZ A;  4DK1 A;  2F1M A;  1IYV A;  4KKS A;  4OGQ C;  1CFM A;  1Z6H A;  1OXS C;  1GHJ A;  3BG3 A;  3KLR A;  3GD7 A;  2EJG C;  4KKU A;  4XTC S;  2D62 A;  5BN5 A;  1A6X A;  2PCF B;  2L5T A;  4DNT B;  1H9K A;  3AB9 A;  3H94 A;  1O7L A;  1H9S B;  1H9J A;  2EVB A;  3A8K E;  1Y8O B;  2DN8 A;  3N6R A;  3M4Y A;  4LJZ C;  1GHK A;  3OW7 A;  1VF7 A;  2E76 C;  1V43 A;  3M7N A;  3OPO A;  1SMY C;  1I6V C;  5BN3 A;  1B9N A;  2BA0 A;  2E75 C;  3A8I E;  4DNR B;  1H9S A;  1LAB A;  1E2Z A;  1O78 A;  1Y8P B;  1HTP A;  3I73 A;  3ND8 A;  4KMU C;  3T53 B;  5KNB A;  1GUS A;  2DNC A;  2A68 C;  2PNR C;  2V4D A;  1H9R A;  1ZKO A;  3I72 A;  2D2C C;  4BA1 I;  1PMR A;  2A6E D;  1OXU A;  2O5I C;  3HGB A;  2K33 A;  1OXT A;  5BN4 A;  4G7H C;  3D4R A;  1ZYR C;  1VDZ A;  2JEB I;  1OXX K;  1YNN C;  2A6H D;  4KI0 A;  1Q1B A;  4JBW A;  2NN6 H;  5K36 H;  1FYC A;  2K7V A;  1QJO A;  1DCZ A;  2BDO A;  4JK1 C;  5KND A;  2R6G A;  1T5E A;  2JXM B;  1G29 1;  1Q1E A;  4OO1 H;  2AWO A;  1Z7T A;  1B9M A;  2A69 D;  2BE5 D;  3VR2 A;  4H44 C;  2AUJ D;  1K8M A;  2DNE A;  1DD2 A;  1K8O A;  2EJF C;  1EWH A;  3FMC A;  4KKT A;  3M85 A;  3W3A A;  2NN6 G;  3L7Z C;  5K36 G;  1OXV A;  4PV1 C;  1TKW B;  1IW7 D;  3QIA A;  3PUX A;  1YNJ C;  3MXU A;  3T56 B;  3P20 A;  4TQU S;  3NE5 B;  2A6E C;  1GUO A;  4OO1 G;  2LMC B;  2IT1 A;  3PUW A;  1GJX A;  3VR5 A;  2BA1 A;  3BDO A;  3VR3 A;  3A7L A;  5C0X H;  3VR6 A;  1HPC A;  1IYU A;  4LK1 C;  3PUZ A;  1Q90 A;  4I7Z C;  1H9M A;  1HCZ A;  3GQB A;  2K32 A;  3A7A B;  3ND9 A;  2D5D A;  4H0L C;  3EQL C;  5JEA H;  1GUN A;  1Y69 U; 
#chains in the Genus database with same CATH topology
 4C3H B;  1E2W A;  4QIW E;  3DM1 A;  3MC0 B;  5KIX A;  2Z8L A;  2Z9H A;  2HQL A;  1VQM A;  1PH5 A;  2BE5 C;  1BCP B;  2O5J C;  1D7Q A;  4HIO A;  4WJ4 A;  3CXC A;  4AYB G;  3UDI A;  4FVM A;  2B2T A;  2F0E A;  3KLS A;  2BH2 A;  1IKM A;  2ALY B;  4WJW A;  5A2Q L;  1CKO A;  1ICW A;  3MEH A;  1AW7 A;  2Y0S G;  2PQA B;  4MNO A;  3MAQ A;  1ENF A;  2CH4 W;  2K04 A;  3IAY A;  2UUB L;  3V96 A;  1HA6 A;  5EAY A;  1XNR L;  5ELO A;  1YJ9 A;  2PQA A;  2PPB C;  1LM0 A;  1T5X D;  4LF7 Q;  2PZT A;  5GAH C;  3R2I A;  1G91 A;  1JJC B;  4X66 L;  1X9N A;  4KKU A;  1PH1 A;  4BBR H;  1TS4 A;  1NR4 A;  1SE2 A;  4DNT B;  1H9K A;  3VYR A;  1H9S B;  3PQI A;  1K8G A;  1XJV A;  1Y8O B;  3JAM i;  4Z9C B;  5CMD A;  2K5N A;  1KTK A;  3KLS X;  4ME5 A;  1HQR D;  1VF7 A;  1C7Y A;  3I4M H;  4CKB A;  3M7N A;  3ERS X;  3NTK A;  2NVQ B;  4BBR G;  1MIU A;  1CZG A;  1H9S A;  1GVP A;  1E2Z A;  2Y0S B;  4CDE C;  2HIX A;  1K73 C;  2DNC A;  1PTO F;  3I4M G;  1CHP D;  4GS3 A;  2PO4 A;  1TT2 A;  4CDF C;  2I0Q A;  1P16 A;  1PZI D;  2DGY A;  4A3M H;  3CW2 C;  3CC4 A;  3X3M A;  4LWC A;  3MTS A;  4GLV B;  3RLN A;  4HCS A;  5KRU A;  4IN3 A;  4NXN Q;  3FMC A;  1VQF A;  3W3A A;  5IYB H;  2Q2I A;  4A3M G;  1YEZ A;  4ZKB B;  5C3X A;  2L12 A;  2ZXR A;  3NE5 B;  4BBR B;  3HS0 C;  2JA5 H;  2GN5 A;  4LF4 Q;  5FLX c;  1LTR D;  5C0X H;  2QA4 A;  2E5L Q;  1B50 A;  5IYB G;  4DV4 L;  1PH3 A;  3I4M B;  2K32 A;  5IYC H;  4J15 A;  2VZA A;  4G4K A;  1ILP A;  1STE A;  3ULP A;  2JA5 G;  3A8J E;  5NUC A;  1Q8K A;  1HA5 A;  5AJ3 Q;  5C0X G;  2E74 C;  2D0O A;  5C3E H;  1VF5 C;  4YHH L;  5M5Y H;  2JE6 I;  5IYC G;  1TWA H;  5I4D A;  4JI3 Q;  2WB1 G;  2K5D A;  1KC8 C;  1G2S A;  1STA A;  1CK1 A;  1A0I A;  2JQO A;  3RR5 A;  2KA7 A;  3E6Z X;  5C3E G;  4DV0 L;  5M3F B;  1Q82 C;  3PIO A;  2Q2H A;  3K7A B;  1EY5 A;  3ERQ A;  4KHZ A;  4S3S A;  2OQK A;  2HIV A;  1LTG D;  2FHT A;  2XRS D;  2F0O A;  4KKS A;  3T13 A;  2JA5 B;  1JE5 A;  1NBW A;  2VUM H;  1GM5 A;  3D6W A;  4YY3 L;  2D62 A;  3PO3 H;  4A3B H;  1SYG A;  2WB1 B;  4FF4 A;  2VUM G;  4HN7 A;  1HR0 Q;  2ID0 A;  4LF9 Q;  4QQB X;  3PO3 G;  1E0B A;  3I73 A;  1C9O A;  3WOE A;  5C3E B;  3OTO L;  2N78 A;  2XRQ D;  4A3F B;  4P2C B;  1TWA B;  4A3B G;  2A8V A;  3CCS A;  2B2W C;  1S5B D;  1XXG A;  1TWF H;  2WIN B;  1OXT A;  2MFI A;  1FD7 D;  5ELD A;  4DV3 Q;  4JV5 Q;  4K14 A;  5JVG 3;  4DR4 L;  1RD9 D;  3CME A;  2K75 A;  5DM6 3;  1A2T A;  3HZX A;  4IJL A;  5KND A;  4XQJ A;  2R6G A;  5C4Z A;  3JAM L;  4X62 L;  2RCF A;  3J7Y W;  2BE5 D;  3NEM A;  4YIJ A;  3K0Y A;  3OWE B;  1RHP A;  5LMU L;  4V19 0;  4GKK Q;  2Q2T A;  5EKI A;  4A3J H;  2VQE Q;  2VUM B;  4XYO A;  3I91 A;  3F2B A;  5EQ0 A;  4P74 A;  4DV1 Q;  4A3B B;  4RH6 A;  1II3 A;  1KLU D;  4A3J G;  4DF7 A;  1Z47 A;  4MTN A;  1DGS A;  1CM9 A;  3ITP A;  1YIJ A;  1X3Q A;  4UY8 C;  2A19 A;  1RJT A;  5FO7 B;  3H15 A;  3HKZ E;  4R4Q A;  1HNW L;  1MJE A;  2CHB D;  2LXJ A;  5HY6 A;  1N33 L;  5CBE E;  3SDZ A;  1X6O A;  3UDG A;  2XGT A;  1KHI A;  4HAE A;  1SBB B;  3RLF A;  4R8I A;  1EZ8 A;  5IGG A;  1XNQ L;  4DV7 L;  2ENB A;  2J7Z A;  1S40 A;  2Q8I B;  3BDC A;  1V9P A;  4UDU C;  3T1Y L;  1WOC A;  2IX3 A;  3NBH B;  3L3O C;  4KN4 C;  4DR3 Q;  3J7A F;  3S16 H;  1J5E Q;  1PRT B;  3BU2 A;  3NBH A;  1I3Q H;  4K8J A;  2FMM A;  2VNU D;  4F8M A;  4A3J B;  5J39 A;  1GOZ A;  5HUR A;  2IHE A;  1RTN A;  1Z6H A;  4IUU A;  2VY3 A;  1GHJ A;  4HMI A;  1UAP A;  3P75 A;  4DV2 Q;  4A3L H;  1FGB D;  1Y1V B;  4UAI A;  1HNX Q;  2L1B A;  1WCM H;  1J8I A;  4JI6 L;  2A73 B;  4A75 A;  1EY0 A;  3NSW A;  3SGI A;  5CYU A;  5C0X I;  4A3L G;  3NK9 A;  2C5C A;  5I2Y A;  1VQL A;  4POF A;  4DU9 A;  4JOI C;  1WCM G;  4KMU C;  3A54 A;  3TQY A;  2V4D A;  4RKL A;  3J7Z C;  1KDA A;  1V1Q A;  1BBX C;  1VQN A;  3K5O A;  2RBM A;  1U9R A;  5CV9 A;  4RG1 A;  3U58 A;  2A6H D;  1M4V A;  5FLX L;  2UU9 Q;  4A3K H;  2K7V A;  4PQX A;  4QL5 A;  1CSP A;  1EFI D;  1DCZ A;  2WAQ E;  3KUP A;  3K58 A;  3S16 B;  1E22 A;  1PHJ A;  1KDC A;  2DNE A;  2G9D A;  3KF8 B;  4Y52 H;  3CD6 A;  1LTI D;  4PV1 C;  4A3K G;  1TXY A;  1BO0 A;  5G3L D;  2NZ1 D;  1JWM D;  3G71 A;  4KY7 A;  1AE2 A;  2IT1 A;  2XIW A;  3KF8 A;  3PMF A;  3S2D H;  1WCM B;  2OTJ A;  2GVB A;  3S1R B;  5D14 A;  4DV5 Q;  4TVA B;  3JC6 6;  2WAC A;  3W1B A;  4OX9 L;  4L6T B;  1JB7 A;  3DMU A;  3AMU A;  4CKE A;  2Z6K C;  3CC2 A;  1YBY A;  3BS1 A;  4YWK A;  3MVV A;  4WOR A;  4DR2 L;  1H95 A;  3EVQ A;  2UUC L;  4JI4 L;  2QCP X;  3EN2 A;  3NTI A;  3GTJ B;  4R4C A;  4UP8 A;  2IPK D;  2VL6 A;  1UEA B;  2NVY H;  4ZCK A;  4ZAI A;  3RMH A;  5EGT A;  3HEJ A;  2JA8 H;  2B2V C;  1F9P A;  4OON A;  1E2V A;  3A5U A;  2PI2 E;  1LTT D;  3IL8 A;  4A93 H;  1BOS A;  4RCN A;  1F77 A;  1PTO H;  3FPP A;  5IT9 c;  1CZW A;  4RFB A;  2L15 A;  4GN4 B;  2QEX A;  5ELE A;  4HTH A;  1CA5 A;  2M2L A;  4DUZ L;  3BG3 A;  2FIN B;  1KAW A;  4A93 G;  2F0N A;  5I9O A;  3RZD H;  1S5E D;  1VQO A;  2F0H A;  3CCQ A;  1Z9F A;  1S5D D;  1SEB D;  5ELN A;  1XPR A;  1CQF A;  5IYD H;  5HGT A;  2X6L A;  4N8X 1;  5D65 A;  3NP8 A;  5KYL A;  2ZTD A;  1SNO A;  3GTM H;  3CP0 A;  1MSH A;  4EQP A;  3A8I E;  3I7F A;  1K3R A;  2UUB Q;  5IYD G;  2EY6 A;  1XNR Q;  3HOX H;  1KNE A;  2NVY B;  2ZXP A;  2LFN A;  5C44 H;  2I5L X;  2OF1 A;  1X3G A;  4GOP C;  1Q3L A;  2XTI A;  5IGC A;  4X66 Q;  2K01 A;  1B3A A;  1FNU A;  3HOX G;  4A93 B;  1WTO A;  1PTO B;  4L5T A;  4ID6 A;  1G29 1;  1Z7T A;  1B9M A;  2EIF A;  5C44 G;  4K0K L;  5JJL A;  5G3L F;  4K5X A;  4DNI A;  2KHJ A;  2EJF C;  3M85 A;  4XYQ A;  2B2U A;  1HH2 P;  1PYB A;  4K8I A;  1K9M C;  2VB2 X;  2A6E C;  2KHI A;  4BBS H;  1PYW D;  1GJX A;  1PH9 A;  2JSO A;  1K8A C;  2IW3 A;  1D1K A;  4ME3 A;  1EL0 A;  2Z4I A;  2ASB A;  4GNX B;  1H9M A;  3AU7 A;  2CFM A;  4BBS G;  3I2Z A;  4GNX A;  4K6L A;  5E3F A;  2QKI C;  3MXP A;  5C4J H;  5A35 A;  3CHB D;  3K5L A;  4ZYS A;  3D8G A;  1U4R A;  2N88 A;  2RDH A;  2QF7 A;  1SYE A;  1L1O B;  2WII B;  2JEA I;  3OHX C;  2TMP A;  2OWO A;  1ASY A;  2LY7 A;  3H3V H;  1LT6 D;  1JOO A;  2NTS A;  2DUD A;  2F0M A;  1L1O A;  1QG7 A;  2Y0S E;  1V8Q A;  2LXK A;  4AH6 A;  4DV4 Q;  2F3I A;  3M4O B;  2RA4 A;  1IYV A;  3K5N A;  4JBM A;  2F0F A;  2XSC A;  1TWG B;  1MHW C;  4OGQ C;  1LT3 D;  1A6X A;  2AQ1 B;  2CWP A;  4YHH Q;  3TRZ A;  3PO2 B;  4LF6 L;  4BY7 H;  1BR9 A;  2XN9 C;  3EFX D;  5CGK A;  1JE4 A;  1XPO A;  1X3F A;  5LL6 S;  1VQB A;  1EIY B;  4MIU A;  4X65 L;  1F9R A;  4JI1 L;  4C2M H;  1HTL D;  3C3L A;  2PNR C;  5C4J B;  4BY7 G;  1H9R A;  3HGB A;  4HJ7 A;  1AFP A;  2CQO A;  1VQ8 A;  2CQA A;  1G2T A;  1K0R A;  5E4X A;  1DYQ A;  4G57 A;  1LYL A;  1W6K A;  1E1O A;  4YY3 Q;  2AKW B;  5I2X A;  1YHB A;  2OCE A;  2IY5 B;  4YCU A;  3U4V A;  1AE3 A;  4DR7 L;  3CQZ H;  4RGT A;  4EVO A;  4LFC L;  4K5V A;  4PMW A;  3K57 A;  4BY1 H;  3BJU A;  4PMB A;  3LX0 A;  1EZ6 A;  2A1A A;  1U0L A;  5M5X B;  1SLJ A;  4KLK A;  4ZUJ A;  1XYI A;  2IHF A;  1NTG A;  1I4G A;  1YNJ C;  4M1U B;  3P20 A;  1B3Q A;  3BVZ A;  3QOJ A;  2SEB D;  3Q6S A;  3CCJ A;  2D9U A;  1TR5 A;  4BY1 G;  2CWA A;  3GTG H;  1N8R C;  3RN2 A;  1IL8 A;  1U5K A;  2QGQ A;  3VR6 A;  4LK1 C;  4CDD C;  3Q23 A;  4BY7 B;  1BCP C;  3HFZ B;  2R7F A;  1LTS D;  1UE6 A;  2KHS A;  3K5M A;  2VS1 A;  1E1T A;  4DR4 Q;  4RGM A;  1GUW A;  3FHW A;  2BOS A;  4LUZ A;  4B08 A;  3S15 B;  3OOC A;  1JIC A;  5T1I A;  4X62 Q;  4P71 A;  4B3M L;  2OQ0 A;  5IT9 L;  5LMU Q;  1KXL A;  4QB4 A;  1YNX A;  4LMQ D;  3Q8D A;  2MJ8 A;  1IYJ B;  4NW2 A;  2OXP A;  1JOQ A;  2O2L D;  4NMZ A;  1EQR A;  2WB1 E;  1VQ7 A;  2OEO A;  4BXX H;  3JAM c;  3CQZ B;  5C5M A;  3I8Z A;  3S1N H;  1P8L A;  3I4L A;  3K0X A;  3QOL A;  3VA7 A;  1GUT A;  4BY1 B;  3CCL A;  1Q12 A;  3D31 A;  1PFN A;  2EYJ A;  3EIV A;  1BUV T;  4BXX G;  1C0A A;  1JJ2 A;  1G6Z A;  1CFM A;  3FDT A;  1HNW Q;  4CBV A;  2K4K A;  4NDX A;  1A63 A;  4OXP A;  4QMG A;  1N33 Q;  1NMG A;  3MXG A;  3G4S A;  1ENC A;  2Z1C A;  4B9X A;  1PXU A;  3KOJ A;  3AFQ A;  1XNQ Q;  4DV7 Q;  2AWN A;  4MHE A;  1FJG L;  3A74 A;  5M5W H;  3T1Y Q;  1MKH A;  2HDM A;  1I6V C;  3AYH B;  1TS5 A;  3VR3 A;  1O78 A;  1I4H A;  1KAB A;  1DJR D;  2AQ2 B;  5LMN L;  4BA1 I;  1NNX A;  2A6E D;  3HRZ C;  1AZP A;  3GP7 A;  4JI2 L;  3SR1 A;  2QDL A;  3CCU A;  1AZQ A;  2JEB I;  4AYB B;  4KD3 A;  4EX5 A;  4U67 3;  1WTH A;  2E2J H;  1KL9 A;  3J81 E;  2K14 A;  2BDO A;  2B29 A;  1TWC H;  1T5E A;  4JI6 Q;  3H3V I;  2XNA C;  4AIM A;  1YI2 A;  1B7Y B;  2VXW A;  4JC0 A;  1XTC D;  5IGD A;  1O7Y A;  5D3D A;  1UEB A;  4OIJ A;  1BXT A;  3V2T A;  1DON A;  1TKW B;  1GO3 E;  4KK7 A;  1R4Q B;  4UP9 A;  2DY8 A;  2LMC B;  3E9H A;  1HUM A;  2PW5 A;  5JAV A;  3PIP A;  2K1B A;  5CV8 A;  4YCW A;  4RAU C;  2GVA A;  3PUZ A;  1I50 H;  2EPB A;  1EOV A;  4JBK A;  4HCE A;  4H0L C;  3VR4 A;  4DPG A;  1D2B A;  3CC7 A;  1G6P A;  4B3S L;  3U9S A;  5COY A;  2IL8 A;  3P1H A;  5GAD C;  4FF1 A;  3Q22 A;  5IOC A;  4O0A A;  1D5Z C;  3PUV A;  1N34 L;  4KHP L;  1VQH A;  3IFD A;  3S14 H;  1IW7 C;  2F52 A;  1I94 L;  3LWU A;  5C4X H;  1QE6 A;  1SYD A;  2YYZ A;  4CJ0 B;  2PYK A;  1IBM L;  2F0K A;  5FKA C;  3NWS A;  3LNN A;  3Q24 A;  2E2J B;  3TZU A;  2A6H C;  1GXD C;  5KYI A;  3BYT B;  3B6Y A;  3U9O A;  3N52 A;  1PH4 A;  1K83 H;  1IXR A;  2UXD L;  2XVS A;  4IFD J;  5C4X G;  2VQF L;  2HHH L;  2YV5 A;  2B3G A;  4OX9 Q;  3S1M H;  2H4O A;  1UE7 A;  4KJN A;  2FMC A;  4X64 L;  1KD1 C;  1EQT A;  4UP7 A;  2ATW A;  1QB5 D;  4DR2 Q;  1XWE A;  2UUC Q;  4JI4 Q;  2F4V L;  1EQV A;  5EBD A;  1I50 B;  2L55 A;  3H0G H;  1YIT A;  4A3M B;  4DN4 M;  1VQG A;  2CH4 A;  1GKH A;  3Q0A A;  4QUF A;  2IJ0 A;  3KDF B;  4JI0 L;  2MHV A;  5LMN W;  3H0G G;  1A3U A;  3S14 B;  1S3O A;  2UXB L;  1YNJ D;  1EU3 A;  1VQ4 A;  3K81 C;  3KDF A;  4XT1 B;  1STG A;  3FRP B;  3MWY W;  4KI0 A;  5IE8 A;  4FF3 A;  4DUZ Q;  3VYT A;  1BCP D;  5K36 H;  1X56 A;  1I6H H;  5JOB A;  1QJO A;  4XXE A;  2R7D A;  4JYA L;  4OO1 H;  3BVM A;  3S1M B;  1STH A;  4PZ6 A;  4L5R C;  3CCV A;  1FNV A;  4B3T L;  4HIK A;  3OIP A;  5K36 G;  3NHH A;  5M5Y B;  2ICI A;  3TS0 A;  4IPD A;  2SDF A;  5J1Z A;  3QIA A;  4HSP A;  3MXU A;  1VQC A;  1PVO A;  4OO1 G;  1TQO A;  1EY7 A;  3I56 A;  1LV9 A;  1A62 A;  2FXQ A;  1SFO H;  1MJC A;  3F2D A;  1IYU A;  5IIF A;  2RSO A;  4LW1 A;  1JOR A;  2QEJ C;  1HCZ A;  1I4X A;  1VQJ A;  3GQB A;  1D1I A;  4ALP A;  2C9O A;  3GTL H;  4V0B A;  3J7A V;  2RVL A;  5J3B A;  3GTK H;  2ZJP A;  5AFW A;  2KCC A;  5JEA J;  2X69 A;  1JWU D;  1MD2 D;  1NUC A;  1X32 A;  4K0K Q;  3RN5 A;  4JVZ A;  4BS9 A;  2JK8 A;  2K5H A;  2Z4H A;  3PO3 B;  1GUG A;  1HXY D;  5GRO A;  3GTP H;  4DUY L;  1N32 L;  1I6H B;  1I5F A;  1SAP A;  3VYS A;  3IFT A;  1SR3 A;  3FPU B;  4XT3 B;  1J6Q A;  2MO0 A;  5F2D A;  3R8B A;  3MFY A;  2RCN A;  3CKI B;  3HOU H;  1VS0 A;  4RKB A;  3T1H L;  1CQV A;  3L2P A;  3D4W A;  4A3C H;  1E3P A;  1SYC A;  4DK1 A;  4JCV E;  1MBY A;  3DHQ A;  3CPF A;  1TWF B;  2EJG C;  1RDP D;  1SFO B;  1SND A;  1SXT A;  3HOU G;  1IBL L;  2OTL A;  3H94 A;  1V1O A;  2B63 H;  3DWA A;  4A3C G;  4HIM A;  1WTV A;  1EQQ A;  3GTL B;  3TN2 A;  2PNH A;  5KGU A;  2WFW A;  3GTK B;  4ZK9 B;  1I4Q A;  4GLX A;  2PZU A;  3S1Q H;  1LAB A;  1QNK A;  1NMF A;  2B63 G;  4DKA C;  1LTB D;  2EYF A;  3U50 C;  2EYM A;  3K7U C;  3KFU A;  1BCP F;  3H09 A;  2F0G A;  3CAM A;  2LKV A;  2RDG A;  4G7H C;  3D4R A;  3E3X A;  3UE1 A;  3GTP B;  4J8Q A;  2I07 B;  2K6A A;  4DFA A;  1ZXT A;  1LT4 D;  3PCO B;  4L5Q A;  1F9Q A;  3R3O A;  2ZXO A;  3VA5 A;  3EA6 A;  2KEE A;  4Q5V A;  3HOY H;  4LF6 Q;  1ESR A;  3RLO A;  2JA7 H;  3F1Z A;  3M3Y H;  1EWH A;  1STB A;  4ILW A;  3K80 C;  3GV6 A;  2HCC A;  1TII D;  1IW7 D;  4JI8 L;  1KLG D;  1EIH A;  4TQU S;  4X65 Q;  4JI1 Q;  1GUO A;  2N3S A;  2MPM A;  3HOY G;  1XTD A;  2B63 B;  3LWE A;  1IHZ A;  3UI2 A;  1LTL A;  1PH6 A;  4OEM B;  4R4I A;  5FO8 B;  4LF8 L;  4Y7N H;  3A5Z B;  5JJZ A;  1X54 A;  4BWG B;  2NVT H;  1CSQ A;  3S1Q B;  2F0S A;  3SXH A;  1S4Z A;  3ULL A;  4A4I A;  4U68 A;  2M00 A;  3L9A X;  1I3Q B;  2OT2 A;  4H13 C;  4DR7 Q;  4X6A H;  4FXG C;  1X3E A;  2F0D A;  4A3E H;  4LFC Q;  1RL2 A;  4K2K A;  1V1P B;  1Y8N B;  4MN3 A;  1QVF A;  1MSG A;  2SNS A;  5JPN C;  3CF5 A;  3HP3 A;  4C3I H;  1B53 A;  2KJX A;  5E4W C;  1JOK A;  4A3E G;  4OEL B;  1V1P A;  3TS2 A;  3TEH B;  1K0S A;  1TS2 A;  3HOY B;  1Q7Y C;  2D0P A;  4DR1 L;  2FJ2 A;  4OO1 I;  3OMG A;  4C3I G;  5BR8 L;  3QJY A;  1HZA A;  2P5Z X;  4B3R L;  1PFS A;  3CCR A;  4LFB L;  2K28 A;  3KLR A;  4PZ8 A;  4IO9 A;  5BN5 A;  2EYH A;  2MP1 A;  4B3M Q;  5I9P A;  1G8Z D;  4X3T A;  4KJO A;  3F2U A;  1KRS A;  4N9P A;  2YTY A;  4LUO A;  4NKL A;  5KEE A;  4A3K B;  1VQ6 A;  4LJZ C;  1WYD A;  4JOI A;  1PA6 A;  2NVT B;  1K3B C;  2WKC A;  2MQH A;  3GV3 A;  5IP9 H;  1SE8 A;  2A5H A;  5H1S E;  1IBK L;  2Q8R E;  3ND8 A;  4A3E B;  4KY6 A;  1BKB A;  2YTV A;  3J80 i;  2JA8 G;  3G48 A;  4F87 A;  1EEI D;  1C4Q A;  1OXU A;  2J0T D;  1JMC A;  3S2D B;  2B2U C;  1ZYR C;  5IP9 G;  4NPS A;  4A3G H;  1PTO C;  4DAM A;  2WV6 D;  4RHS A;  1ROD A;  2NN6 H;  3K59 A;  2ES2 A;  5I6Y A;  2LSS A;  3SK8 A;  1O7I A;  3ULJ A;  4A3G G;  3GO5 A;  5EPK A;  2G9H D;  1FJG Q;  3F2C A;  4HJ8 A;  2NN6 G;  5I6W A;  4QGU A;  2YTX A;  3UE0 A;  1D6E C;  2F0I A;  4NP5 A;  3C46 A;  4GNX C;  1YVC A;  3CMA A;  2HQE A;  3PUW A;  2BA1 A;  1XPU A;  5LMN Q;  1PRT D;  1X65 A;  1Q90 A;  3HOW H;  2JA8 B;  4IUR A;  4JI2 Q;  4DR6 L;  3ND9 A;  1HZC A;  3A7A B;  1R9T H;  2CW0 C;  1JQY D;  3QG1 A;  2EOT A;  1B2T A;  4L8J A;  4G7Z C;  2F0U A;  4KN7 C;  3HOW G;  5FLM H;  3E0E A;  3S17 H;  4APV A;  2UXC L;  2ZTC A;  3I3C A;  4N8F A;  3WWV A;  4HJ5 A;  1TVX A;  4A3G B;  3RZD B;  3NQI A;  5IOD A;  5CR3 A;  5EPL A;  4L5S A;  1CUK A;  4CGY B;  5FLM G;  5JJK A;  1A2U A;  4J6H A;  2EDG A;  3GTM B;  3DLL A;  1B1Z A;  1XMO L;  4DK0 A;  1W6J A;  4O2D A;  4HID A;  3PIO 3;  4DXG A;  2JYO A;  4EQ5 A;  1HHV A;  4B3S Q;  5IGF A;  4P72 A;  5TSS A;  2K5W A;  4IPC A;  3HOX B;  1R4P B;  2N49 A;  3MZ5 A;  5C44 B;  1EWI A;  2WAQ G;  1QVG A;  4B9W A;  1N34 Q;  4KHP Q;  4AYB E;  1RIP A;  3HOW B;  2GA4 B;  3IRB A;  4PZ7 A;  1I94 Q;  1DOM A;  4Q0F A;  3NEN A;  4RA8 A;  5CV5 A;  1R9T B;  4FP5 D;  4GN3 B;  3M4Y A;  1IBM Q;  1VQ5 A;  4A3I H;  4GOP B;  4JI7 L;  2E76 C;  4UPA A;  4K5W A;  3AQQ A;  1DM0 B;  2E75 C;  1WTP A;  2UXD Q;  3J81 i;  2VQF Q;  2HHH Q;  4OL7 A;  3S17 B;  1B4O A;  1CKM A;  1E24 A;  4GOP A;  3L0O A;  1N36 L;  4A3I G;  1ZEQ X;  3H3V C;  4BBS B;  2QW7 A;  1VDZ A;  4X64 Q;  1OXX K;  3I90 A;  4AQY L;  3TRE A;  1FYC A;  2F4V Q;  1FNW A;  2B2Y A;  1TS3 A;  1A3T A;  2EXZ A;  4QF4 A;  3SHL A;  2A69 D;  4PMC A;  2SOB A;  4GKJ L;  5EPJ A;  3BZD B;  2E2D C;  3RUZ A;  4YCV A;  4JI0 Q;  2ZM6 L;  1HR0 W;  4GLA C;  3KBX A;  3KBG A;  3J80 L;  2UXB Q;  1CT1 D;  3BDO A;  4ABN A;  1S5F D;  2HD3 A;  4A3I B;  5IWA L;  1Q81 C;  3J80 E;  1SE3 A;  2LS0 1;  1WI5 A;  3WDN A;  5C0X J;  5DEH A;  3ONA B;  1M8A A;  2R92 H;  5M3M H;  1XMQ L;  4JYA Q;  2F0V A;  2CCZ A;  3WOF A;  4B3T Q;  4ODG A;  5DNF A;  4LFA L;  5IP7 H;  2B2T C;  2M9V A;  5GAE C;  1EEF D;  2R92 G;  4J1M A;  2E2I H;  3STB C;  3J81 j;  5M3M G;  4LUV A;  3NWT A;  3VYU A;  3X3N A;  2NN6 I;  1QIL A;  4EQO A;  2PMZ B;  3W2D A;  3I4O A;  2NB0 A;  5IP7 G;  1STY A;  4FNF A;  4XIG S;  1Q46 A;  4C2M B;  3BVG A;  2YU9 H;  1M1K C;  1O7Z A;  2KOL A;  3E9I A;  3GD7 A;  1Y14 B;  3D4D A;  1JCK B;  1ZYR D;  2HCI A;  3E5S A;  1HFN A;  1PTO D;  3FVQ A;  1I4R A;  2Z6B A;  4NXM L;  4WFN 3;  1EYG A;  1O7L A;  4KHV A;  2EY5 A;  1WTQ A;  4K2L A;  2E2H H;  4X3S A;  3GTO H;  1SRO A;  2AMC B;  2BCO A;  3RZO H;  4DUY Q;  3KK7 A;  1N32 Q;  2R92 B;  4MZ9 A;  5M3M B;  2R3Z A;  2PZW A;  5KNB A;  1VQA A;  2A68 C;  2IX0 A;  2RHS B;  2JP1 A;  1EIG A;  3CCM A;  3T1H Q;  2UUA Q;  1UUP A;  5DLQ E;  2E2I B;  3GTG B;  2SNM A;  1WVL A;  3BDL A;  3MA2 B;  4QJF A;  1HNZ L;  1KIX A;  5FOB B;  1SMX A;  2CW0 D;  1CA6 A;  1IBL Q;  4JK1 C;  2ICE C;  2NVQ H;  2PW7 A;  4KY5 A;  2YU9 B;  2J4X A;  1K28 A;  3TP6 A;  3M4Q A;  1PYS B;  2K52 A;  3J81 L;  1YHQ A;  1PZJ D;  3VR5 A;  4PNY A;  4LF5 L;  5A2Q E;  1RTO A;  3ERO A;  1L2F A;  2E2H B;  3GTO B;  1KDB A;  1A3V A;  1HJP A;  1QWY A;  4RMF A;  3RZO B;  3S1N B;  1S5C D;  1ENA A;  1BNZ A;  1IL2 A;  2DJF C;  1U4P A;  2JN4 A;  2KCT A;  1QZG A;  1W3S A;  4CJ2 C;  1DXM A;  1FR3 A;  1OTC A;  3PGZ A;  2DJG C;  1Q86 C;  1LAC A;  4R1J A;  3FEW X;  1M90 C;  4JI8 Q;  3M7G A;  2IX1 A;  3KJO A;  1EYD A;  2H1E A;  4IUV A;  1WD0 A;  1VMC A;  4UHV A;  4GZY C;  1TY2 A;  5KNC A;  2X6G A;  1DOK A;  5M5W B;  3U4Z A;  4KD4 A;  1BDO A;  1ICF B;  4R4O A;  4LF8 Q;  1TWH H;  1EIF A;  2F0J A;  2B39 A;  3ZYY X;  1NY4 A;  5C5L A;  4ZKC B;  2WKD A;  4XTC S;  2L5T A;  2HUG A;  2QDB A;  3VDY A;  3C2P A;  2KVM A;  3AB9 A;  4IUP A;  1SNM A;  3G6E A;  1NSN S;  2EVB A;  3A8K E;  1F2Z A;  3N6R A;  5M3F H;  1WTX A;  3NBI A;  1GHK A;  1TWC B;  3K7A H;  2V1C C;  2RKS A;  1JJG A;  1SMY C;  3D0F A;  2ZJR A;  1Y8P B;  1I4P A;  1RF2 D;  3HG9 A;  4H02 A;  4DR5 L;  3ZJY C;  1LLR D;  5M3F G;  4JI5 L;  4DR1 Q;  2F3V A;  3I72 A;  2D2C C;  5BR8 Q;  4DK6 C;  1SJH D;  3K6O A;  5BN4 A;  4DV6 L;  2N8N A;  4B3R Q;  1OO9 B;  4F7X A;  1KRT A;  4LFB Q;  1J9O A;  4OHJ A;  4HMJ A;  1SRU A;  1HRJ A;  3OIQ A;  1WTW A;  1BBW A;  3ER0 A;  4E6I A;  4FYD A;  1PFB A;  3QB3 A;  1B44 D;  3MXN B;  1TWH B;  1EYA A;  2RF4 A;  4H44 C;  1LT5 D;  1K8M A;  4IOA A;  2I5M X;  1PH8 A;  4CDC C;  1Q8I A;  1SJE D;  3C1F A;  1KNA A;  4KKT A;  4NB3 A;  2RQX A;  4IJH A;  4YWL A;  4A3F H;  5K5P A;  5JJI A;  5HGQ A;  1IBK Q;  2MO1 A;  3OSO A;  5C4X B;  3SVM A;  1SSO A;  2F3W A;  3MXN A;  1U4M A;  2I5H A;  3DWQ A;  1MGS A;  2CVR A;  3STB D;  1QVC A;  3A7L A;  3KJP A;  4C56 C;  4HED A;  4A3F G;  4HR7 B;  1K83 B;  1X55 A;  3SE0 A;  3CRK C;  4IAL A;  1SYF A;  2L9H A;  2PQE A;  3BZK A;  1HQM C;  1EUJ A;  1L0X B;  3P7J A;  4DA2 A;  2XWB B;  1F2L A;  3I70 A;  2BDN A;  2BH8 A;  2TSS A;  1AEX A;  1LUZ A;  1S72 A;  1STN A;  3NXW A;  1VQI A;  1B8A A;  2AUK A;  4FF2 A;  4JG2 A;  1Y1W H;  1FGU A;  4OIK A;  3TP5 A;  1SNC A;  3H0G B;  2HT1 A;  5CV7 A;  1C8C A;  4FO2 A;  3OYY A;  1VQD A;  1SNP A;  3CPW A;  1EWC A;  3QR8 A;  4ZUI A;  3NPP A;  4DR6 Q;  4QIW B;  4RHR A;  1Y1W G;  1EYC A;  3OWF A;  1CI3 M;  2FFK B;  2A68 D;  3DXJ C;  1UNS A;  5JVH 3;  4OWW B;  1QNU A;  1OXS C;  3G6J B;  2EYL A;  1ET9 A;  3QWN A;  1EOT A;  4WJ3 M;  1SNQ A;  4XQN A;  2EQS A;  1F2M A;  2UXC Q;  1H9J A;  1WD1 A;  1PRT C;  1PV4 A;  3A0J A;  1PZK D;  4H7B A;  5C6A A;  1YJW A;  1V43 A;  4PG3 A;  1B9N A;  2ZTE A;  5T1G A;  4DNR B;  1KQS A;  4XDX A;  2UUA L;  2R7Z H;  2AHO B;  3JAM E;  5E1F A;  1XMO Q;  2NWG A;  5EJW A;  2K33 A;  1MI2 A;  4JW0 A;  1Y1W B;  2F0Q A;  1DZ1 A;  1Y1V H;  3UDX A;  4GN5 A;  1E7Z A;  1YNN C;  3NQT A;  3PF5 A;  1PH7 A;  2R7Z G;  2RHQ B;  1PLF A;  5ELF A;  2EYO A;  4O1N A;  2MUY A;  3H6M A;  1Q1E A;  4EGV A;  1Y1V G;  3VR2 A;  2AUJ D;  2K50 A;  1PH2 A;  5EKK A;  2B2W A;  3TDQ A;  4JI7 Q;  4CHT B;  3A56 A;  2IWH A;  1EY4 A;  1WJJ A;  4RCO A;  5E7N A;  1JT8 A;  1N36 Q;  3DM3 A;  1YZ6 A;  1Y69 U;  2ZJQ A;  4AQY Q;  3HOU B;  2AQ3 B;  4LF7 L;  3OMC A;  5LHY 1;  2R7Z B;  1AP0 A;  2ZT9 C;  1QOH A;  3FKI H;  1D8L A;  1C48 A;  3RNU A;  4P75 A;  4GKJ Q;  1TU2 B;  2KCM A;  3TBI B;  3I4N H;  1VQ9 A;  1ET6 A;  2B8G A;  4IFD H;  2JA7 G;  3S1R H;  1HZ9 A;  2ZM6 Q;  2EYP A;  3FKI G;  4OWX B;  1JB3 A;  3TME A;  4G7O C;  1ILQ A;  4O42 A;  3V05 A;  1U4L A;  5CV6 A;  1SMY D;  5DAU A;  2JA6 H;  3I4N G;  4CJ1 B;  2KED A;  1PDQ A;  2B8F A;  3CRL C;  4A3D H;  2A69 C;  5IWA Q;  4IFD G;  3MEF A;  1L0Y B;  1T9H A;  4DAV A;  2F1M A;  1BQQ T;  3O13 A;  4YWM A;  3HKS A;  4IZ8 A;  1PFM A;  3GTJ H;  1IZ6 A;  3J80 c;  1XMQ Q;  1RCV D;  2JA6 G;  2PCF B;  3I55 A;  4A3D G;  4IUT A;  3SK6 A;  3S24 A;  2DN8 A;  4LFA Q;  1VQP A;  1QUQ B;  2KUM A;  4NXN L;  3DEP A;  3TZD A;  3BZC A;  3OPO A;  5FLX E;  2JA7 B;  5BN3 A;  4EQN A;  1TY0 A;  3M3Y B;  1CKN B;  2RDF A;  3KYH C;  3T53 B;  1BBU A;  3FKI B;  1QUQ A;  1BF4 A;  4LF4 L;  3TP7 A;  1NAP A;  1BVS A;  3I4N B;  2O5I C;  2E5L L;  2F0P A;  2Q8T A;  3S9W A;  1CKN A;  4TSS A;  2MGS A;  1FVI A;  2R93 H;  4Y7N B;  5AJ3 L;  4QCL A;  1VQK A;  1SE4 A;  1AN8 A;  4P73 A;  4ULL A;  3NUC A;  4NXM Q;  2JA6 B;  4A3D B;  1RKN A;  4LNQ A;  4POG A;  4L63 B;  4JI3 L;  3CCE A;  1K8O A;  4MTK A;  1HFG A;  2KQ3 A;  1CHQ D;  2R93 G;  4IPH A;  1QCB D;  4X3K A;  3GTQ H;  1F2Y A;  3NEL A;  2EXD A;  4RGO S;  1D5X C;  3K8A A;  3LGJ A;  1A15 A;  4IUN A;  4C3I B;  3UDF A;  1HPC A;  2EZV A;  2F0W A;  3HKZ G;  5JEA H;  1DD2 A;  1F9S A;  2EY1 A;  3EQL C;  2PMZ E;  1GUN A;  1WTR A;  1UE5 A;  1NJI C;  1HUN A;  3PIP 3;  2L4N A;  3HOZ H;  1L0W A;  1EY6 A;  5EBC A;  1HNZ Q;  3A55 A;  1HZB A;  1CTM A;  3M9B A;  4X3U A;  2NVX H;  1D5M C;  5JEA G;  5CV4 A;  5COR A;  3T16 A;  3PUY A;  3HOZ G;  5EKL A;  4DAP A;  3OW2 A;  2EJM A;  4TKO B;  2L0C A;  2R93 B;  1VCI A;  2R61 A;  2Z6K A;  4KTA A;  2HDL A;  3J7A 5;  4BA2 I;  4ZRZ A;  5ISR A;  1HR0 L;  4LF9 L;  2KEN A;  3IKJ A;  2NTT A;  5ELC A;  4LF5 Q;  4KV6 A;  4HSV A;  5M9O A;  3M4P A;  4IPG A;  4M8A A;  3S2H H;  1EFW A;  2JJQ A;  2XWJ B;  2MNA A;  3HKZ B;  2K03 A;  4DV3 L;  3GTQ B;  1L1O C;  4JV5 L;  3DUZ A;  3D3R A;  3J81 c;  1DOL A;  1VQE A;  1EY9 A;  4I65 A;  5FJ8 H;  4R4T A;  2B2V A;  1YNN D;  3URY A;  4XQQ A;  2H5X A;  1NR2 A;  3SEB A;  1FL0 A;  2WP8 J;  4I7A A;  3HOZ B;  4GKK L;  3T4A C;  3OW7 A;  3AEV A;  1ML0 D;  5FJ8 G;  2VQE L;  1W2B A;  3D6C A;  4FXD A;  3M4O H;  1HTP A;  2B2Y C;  1GUS A;  2NVX B;  3DEO A;  2G5D A;  2E8G A;  1TWG H;  5C3W A;  1PMR A;  4DV1 L;  4RWS C;  3EBE A;  3EJI A;  4QY7 A;  2F03 A;  1Q1B A;  4JBW A;  2F0T A;  2KEC A;  4IFD I;  3PO2 H;  3CU7 A;  2K5Q A;  1VMP A;  1JC7 A;  5L37 A;  3GDE A;  5GQO A;  2AWO A;  4A76 A;  3S2H B;  5LL6 X;  5FO9 B;  3DWP A;  1G51 A;  3QO2 A;  5IGE A;  2EY2 A;  1NCV A;  1OXV A;  2VW9 A;  2F4I A;  4CKC A;  3PO2 G;  4ZQ3 A;  3T56 B;  2L11 A;  3KLW A;  4DR5 Q;  1X3P A;  4DR3 L;  2CKZ B;  4JI5 Q;  3R93 A;  1QZH A;  1J5E L;  3MFG A;  2K05 A;  3SK4 A;  4DGZ A;  4DV6 Q;  1SN8 A;  2WAQ B;  1EY8 A;  5CBA E;  4JPB W;  4C1N I;  1JWS D;  3SK5 A;  4DV2 L;  4HJA A;  4JBJ A;  1GD7 A;  3PSI A;  1HNX L;  5M5X H;  1ONL A;  2NYZ D;  5ELB A;  2N55 A;  1B70 B;  1PRT F;  3W1G A;  1WFQ A;  4C1N K;  1NE3 A;  1KAA A;  2Z0S A;  2NZH A;  4F88 A;  2EE1 A;  3T51 B;  4IUQ A;  4ZLT F;  4TRD A;  3G7L A;  1YJN A;  4R8N A;  1AH9 A;  1LO5 D;  4QUC A;  3MHB A;  4DV0 Q;  2Q2U A;  4C3J H;  5CC4 A;  2A74 C;  2VB3 X;  3PV0 A;  3S15 H;  4IOC A;  4IQZ A;  2O4X A;  2KBN A;  5J22 A;  4WRD A;  3HOV H;  2K5V A;  4FDB A;  1ESF A;  1SYB A;  2UU9 L;  3RD4 A;  2QIL A;  1ASZ A;  4C3J G;  3NTH A;  5DM7 3;  4FXK C;  4LAA A;  1LTA D;  2C35 B;  3HOV G;  2JA9 A;  4DAY B;  1UE1 A;  1XX8 A;  5JPM C;  4C3H H;  4HJ9 A;  3E0J A;  2BA0 A;  2NBF A;  1SDF A;  3TSS A;  4DAY A;  4DXF A;  1O80 A;  1JR0 D;  1ZKO A;  2DY7 A;  5IY0 A;  4DV5 L;  2KCN A;  2PI2 A;  3OTO Q;  4RGN A;  4C3H G;  4K6D A;  2RSN A;  5IGB A;  2NZO A;  4OWT B;  3F8T A;  1N9W A;  3TP8 A;  2NUC A;  5C4H A;  3KF6 B;  4C3J B;  2JXM B;  3FP9 A;  3AFP A;  4N9T A;  1UWV A;  3BYY B;  5D3I B;  3L7Z C;  3HOV B;  3KF6 A;  3ICE A;  3PF4 A;  2I46 A;  2F0L A;  3PUX A;  1A8V A;  1IKL A;  3W5O A;  1EU4 A;  4DK3 C;  5IT9 E;  5FK9 C;  4I7Z C;  3R2T A;  4R9W A;  1YHA A;  2D5D A;  3C1E A;  3H91 A;  5GAG C; 
#chains in the Genus database with same CATH homology
 4C3H B;  1E2W A;  3DM1 A;  3MC0 B;  5KIX A;  2Z8L A;  2O5J C;  2BE5 C;  1BCP B;  4FVM A;  2B2T A;  2F0E A;  3KLS A;  1IKM A;  4WJW A;  5A2Q L;  1ICW A;  3MEH A;  1AW7 A;  3MAQ A;  1ENF A;  3IAY A;  2K04 A;  3V96 A;  1HA6 A;  2PPB C;  1T5X D;  2PZT A;  3R2I A;  1G91 A;  4KKU A;  1TS4 A;  1NR4 A;  1SE2 A;  4DNT B;  1H9K A;  3VYR A;  1H9S B;  1Y8O B;  4Z9C B;  5CMD A;  1KTK A;  3KLS X;  4ME5 A;  1HQR D;  1VF7 A;  4CKB A;  3M7N A;  3NTK A;  2NVQ B;  1CZG A;  1H9S A;  2Y0S B;  1E2Z A;  2DNC A;  1PTO F;  1CHP D;  2PO4 A;  1TT2 A;  1PZI D;  3X3M A;  3MTS A;  4HCS A;  5KRU A;  4IN3 A;  3FMC A;  3W3A A;  4ZKB B;  5C3X A;  2L12 A;  2ZXR A;  3NE5 B;  4BBR B;  3HS0 C;  1LTR D;  5C0X H;  1B50 A;  3I4M B;  2K32 A;  4G4K A;  1ILP A;  1STE A;  3A8J E;  5NUC A;  1HA5 A;  5C0X G;  2E74 C;  1VF5 C;  2JE6 I;  5I4D A;  2K5D A;  1G2S A;  1STA A;  1CK1 A;  2KA7 A;  3E6Z X;  5M3F B;  3K7A B;  1EY5 A;  3ERQ A;  4KHZ A;  4S3S A;  1LTG D;  2FHT A;  2XRS D;  2F0O A;  4KKS A;  3T13 A;  2JA5 B;  3D6W A;  2D62 A;  1SYG A;  2WB1 B;  4FF4 A;  4HN7 A;  2ID0 A;  1E0B A;  3I73 A;  3WOE A;  5C3E B;  2XRQ D;  4A3F B;  4P2C B;  1TWA B;  2B2W C;  1S5B D;  1XXG A;  2WIN B;  1OXT A;  1FD7 D;  5ELD A;  4K14 A;  5JVG 3;  1RD9 D;  5DM6 3;  1A2T A;  3HZX A;  5KND A;  4XQJ A;  2R6G A;  5C4Z A;  3JAM L;  3J7Y W;  2BE5 D;  4YIJ A;  3K0Y A;  3OWE B;  1RHP A;  4V19 0;  5EKI A;  2VUM B;  4XYO A;  3I91 A;  5EQ0 A;  4A3B B;  4RH6 A;  1II3 A;  1KLU D;  4DF7 A;  1Z47 A;  3ITP A;  1CM9 A;  1X3Q A;  1RJT A;  5FO7 B;  2CHB D;  5CBE E;  3SDZ A;  4HAE A;  1SBB B;  3RLF A;  4R8I A;  1EZ8 A;  5IGG A;  2ENB A;  2J7Z A;  2Q8I B;  3BDC A;  4UDU C;  2IX3 A;  3L3O C;  4KN4 C;  3J7A F;  1PRT B;  3NBH A;  4K8J A;  2FMM A;  2VNU D;  4F8M A;  4A3J B;  5J39 A;  1GOZ A;  5HUR A;  1RTN A;  1Z6H A;  4IUU A;  1GHJ A;  4HMI A;  1UAP A;  3P75 A;  1FGB D;  1Y1V B;  4UAI A;  2L1B A;  1J8I A;  2A73 B;  1EY0 A;  3NSW A;  5CYU A;  5C0X I;  3NK9 A;  2C5C A;  5I2Y A;  4DU9 A;  4KMU C;  3A54 A;  2V4D A;  4RKL A;  1KDA A;  1BBX C;  3K5O A;  2RBM A;  1U9R A;  5CV9 A;  2A6H D;  1M4V A;  5FLX L;  2K7V A;  4PQX A;  1EFI D;  3S16 B;  1DCZ A;  3KUP A;  3K58 A;  1KDC A;  2DNE A;  2G9D A;  1LTI D;  4PV1 C;  1BO0 A;  5G3L D;  2NZ1 D;  1JWM D;  4KY7 A;  2IT1 A;  2XIW A;  3KF8 A;  3PMF A;  1WCM B;  3S1R B;  5D14 A;  2WAC A;  4L6T B;  3DMU A;  3AMU A;  4CKE A;  3BS1 A;  3MVV A;  4WOR A;  3EVQ A;  2QCP X;  3NTI A;  3GTJ B;  2IPK D;  1UEA B;  4ZAI A;  3RMH A;  5EGT A;  3HEJ A;  2B2V C;  1F9P A;  1E2V A;  1LTT D;  3IL8 A;  1BOS A;  4RCN A;  1F77 A;  1PTO H;  3FPP A;  1CZW A;  4RFB A;  5ELE A;  4HTH A;  1CA5 A;  2M2L A;  3BG3 A;  2FIN B;  2F0N A;  5I9O A;  1S5E D;  2F0H A;  1S5D D;  1SEB D;  1CQF A;  5HGT A;  2X6L A;  5D65 A;  3NP8 A;  5KYL A;  1SNO A;  1MSH A;  4EQP A;  3A8I E;  2EY6 A;  1KNE A;  2NVY B;  2ZXP A;  2LFN A;  2OF1 A;  1Q3L A;  5IGC A;  2K01 A;  1B3A A;  1FNU A;  4A93 B;  1WTO A;  1PTO B;  4ID6 A;  1G29 1;  1Z7T A;  1B9M A;  5G3L F;  4K5X A;  2EJF C;  3M85 A;  4XYQ A;  2B2U A;  4K8I A;  2VB2 X;  2A6E C;  1PYW D;  1GJX A;  2JSO A;  2IW3 A;  1D1K A;  1EL0 A;  2Z4I A;  1H9M A;  3AU7 A;  4K6L A;  5E3F A;  2QKI C;  3MXP A;  5A35 A;  3CHB D;  3K5L A;  4ZYS A;  3D8G A;  1U4R A;  2N88 A;  2RDH A;  2QF7 A;  1SYE A;  2WII B;  2JEA I;  3OHX C;  2TMP A;  2LY7 A;  1LT6 D;  1JOO A;  2NTS A;  2F0M A;  1QG7 A;  1V8Q A;  3M4O B;  2RA4 A;  1IYV A;  3K5N A;  2F0F A;  2XSC A;  1TWG B;  4OGQ C;  1LT3 D;  1A6X A;  2AQ1 B;  3PO2 B;  1BR9 A;  2XN9 C;  3EFX D;  5CGK A;  1JE4 A;  5LL6 S;  4MIU A;  1F9R A;  1HTL D;  3C3L A;  2PNR C;  5C4J B;  1H9R A;  3HGB A;  1AFP A;  2CQA A;  1G2T A;  5E4X A;  1DYQ A;  4G57 A;  1W6K A;  5I2X A;  4RGT A;  4EVO A;  4K5V A;  4PMW A;  3K57 A;  4PMB A;  3LX0 A;  1EZ6 A;  5M5X B;  4ZUJ A;  1XYI A;  1I4G A;  1YNJ C;  4M1U B;  3P20 A;  3BVZ A;  3QOJ A;  2SEB D;  3Q6S A;  2D9U A;  1TR5 A;  1IL8 A;  3VR6 A;  4LK1 C;  4BY7 B;  3Q23 A;  1BCP C;  1LTS D;  2KHS A;  3K5M A;  4RGM A;  1GUW A;  2BOS A;  4B08 A;  3S15 B;  3OOC A;  1JIC A;  5T1I A;  5IT9 L;  4QB4 A;  4LMQ D;  2MJ8 A;  1JOQ A;  4NW2 A;  2OXP A;  2O2L D;  4NMZ A;  2OEO A;  3CQZ B;  5C5M A;  3I8Z A;  3I4L A;  3QOL A;  3VA7 A;  1GUT A;  4BY1 B;  1Q12 A;  3D31 A;  1PFN A;  2EYJ A;  1BUV T;  1G6Z A;  1CFM A;  3FDT A;  4CBV A;  4NDX A;  4QMG A;  3MXG A;  1ENC A;  2Z1C A;  4B9X A;  1PXU A;  2AWN A;  4MHE A;  2HDM A;  1I6V C;  1TS5 A;  3VR3 A;  1I4H A;  1O78 A;  1KAB A;  1DJR D;  2AQ2 B;  4BA1 I;  2A6E D;  3HRZ C;  1AZP A;  3GP7 A;  3SR1 A;  1AZQ A;  2JEB I;  4AYB B;  4KD3 A;  4U67 3;  3J81 E;  2BDO A;  1T5E A;  2XNA C;  2VXW A;  1XTC D;  5IGD A;  1O7Y A;  5D3D A;  4OIJ A;  1BXT A;  3V2T A;  1DON A;  1TKW B;  4KK7 A;  1R4Q B;  2DY8 A;  2LMC B;  1HUM A;  2PW5 A;  5JAV A;  2K1B A;  5CV8 A;  4RAU C;  3PUZ A;  2EPB A;  4HCE A;  4H0L C;  3VR4 A;  1D2B A;  3U9S A;  5COY A;  2IL8 A;  3P1H A;  4FF1 A;  3Q22 A;  5IOC A;  1D5Z C;  3PUV A;  3IFD A;  1IW7 C;  3LWU A;  1QE6 A;  1SYD A;  2YYZ A;  4CJ0 B;  2PYK A;  2F0K A;  5FKA C;  3NWS A;  3LNN A;  3Q24 A;  2E2J B;  3TZU A;  2A6H C;  1GXD C;  5KYI A;  3BYT B;  3U9O A;  3N52 A;  2XVS A;  4IFD J;  2H4O A;  4KJN A;  2FMC A;  1EQT A;  1QB5 D;  1XWE A;  1EQV A;  5EBD A;  1I50 B;  2L55 A;  4A3M B;  4DN4 M;  3Q0A A;  4QUF A;  2IJ0 A;  2MHV A;  1A3U A;  3S14 B;  1YNJ D;  1EU3 A;  4XT1 B;  1STG A;  3FRP B;  3MWY W;  4KI0 A;  4FF3 A;  3VYT A;  1BCP D;  5K36 H;  5JOB A;  1QJO A;  4XXE A;  4OO1 H;  3BVM A;  3S1M B;  1STH A;  1FNV A;  3OIP A;  5K36 G;  3NHH A;  5M5Y B;  2ICI A;  2SDF A;  5J1Z A;  3QIA A;  4HSP A;  3MXU A;  4OO1 G;  1TQO A;  1EY7 A;  1LV9 A;  1IYU A;  5IIF A;  2RSO A;  1JOR A;  2QEJ C;  1HCZ A;  1I4X A;  3GQB A;  1D1I A;  2C9O A;  4V0B A;  3J7A V;  2RVL A;  5AFW A;  2KCC A;  5JEA J;  2X69 A;  1JWU D;  1MD2 D;  1NUC A;  1X32 A;  4BS9 A;  2Z4H A;  3PO3 B;  1GUG A;  1HXY D;  1I6H B;  1SAP A;  3VYS A;  3IFT A;  3FPU B;  4XT3 B;  5F2D A;  3R8B A;  3MFY A;  3CKI B;  4RKB A;  1CQV A;  3D4W A;  1SYC A;  4DK1 A;  1MBY A;  3DHQ A;  1TWF B;  2EJG C;  1RDP D;  1SFO B;  1SND A;  1SXT A;  3H94 A;  1V1O A;  3DWA A;  1WTV A;  3GTL B;  3TN2 A;  5KGU A;  3GTK B;  4ZK9 B;  1I4Q A;  2PZU A;  1LAB A;  1QNK A;  1LTB D;  2EYF A;  2EYM A;  1BCP F;  3H09 A;  2F0G A;  2LKV A;  2RDG A;  4G7H C;  3D4R A;  3GTP B;  4J8Q A;  2I07 B;  2K6A A;  4DFA A;  1ZXT A;  1LT4 D;  1F9Q A;  3R3O A;  2ZXO A;  3VA5 A;  3EA6 A;  2KEE A;  4Q5V A;  1ESR A;  1EWH A;  1STB A;  4ILW A;  3GV6 A;  2HCC A;  1TII D;  1IW7 D;  1KLG D;  1EIH A;  4TQU S;  1GUO A;  2MPM A;  2B63 B;  3LWE A;  1IHZ A;  3UI2 A;  5FO8 B;  5JJZ A;  4BWG B;  3S1Q B;  2F0S A;  3SXH A;  1S4Z A;  4U68 A;  2M00 A;  3L9A X;  1I3Q B;  2OT2 A;  4H13 C;  4FXG C;  2F0D A;  4K2K A;  1V1P B;  1Y8N B;  4MN3 A;  1MSG A;  2SNS A;  5JPN C;  3HP3 A;  1B53 A;  2KJX A;  5E4W C;  1JOK A;  1V1P A;  1TS2 A;  3HOY B;  2FJ2 A;  4OO1 I;  3OMG A;  4C3I G;  3QJY A;  2K28 A;  3KLR A;  5BN5 A;  2EYH A;  2MP1 A;  5I9P A;  1G8Z D;  4X3T A;  4KJO A;  3F2U A;  4N9P A;  4NKL A;  5KEE A;  4A3K B;  4LJZ C;  2NVT B;  2WKC A;  3GV3 A;  2A5H A;  2Q8R E;  3ND8 A;  4A3E B;  4KY6 A;  4F87 A;  1EEI D;  1C4Q A;  1OXU A;  2J0T D;  3S2D B;  2B2U C;  1ZYR C;  1PTO C;  2WV6 D;  4RHS A;  1ROD A;  2NN6 H;  3K59 A;  5I6Y A;  3SK8 A;  3GO5 A;  5EPK A;  2G9H D;  2NN6 G;  5I6W A;  1D6E C;  2F0I A;  4NP5 A;  3C46 A;  2HQE A;  3PUW A;  2BA1 A;  1PRT D;  1Q90 A;  2JA8 B;  4IUR A;  3ND9 A;  3A7A B;  2CW0 C;  1JQY D;  3QG1 A;  2EOT A;  1B2T A;  4L8J A;  4G7Z C;  2F0U A;  4KN7 C;  3I3C A;  1TVX A;  4A3G B;  3RZD B;  3NQI A;  5IOD A;  5CR3 A;  5EPL A;  4CGY B;  1A2U A;  4J6H A;  2EDG A;  3GTM B;  1B1Z A;  4DK0 A;  1W6J A;  3PIO 3;  4DXG A;  2JYO A;  1HHV A;  5IGF A;  5TSS A;  2K5W A;  3HOX B;  1R4P B;  3MZ5 A;  5C44 B;  4B9W A;  3HOW B;  2GA4 B;  1DOM A;  4Q0F A;  4RA8 A;  5CV5 A;  1R9T B;  4FP5 D;  3M4Y A;  2E76 C;  4K5W A;  1DM0 B;  2E75 C;  1WTP A;  4OL7 A;  3S17 B;  1B4O A;  1ZEQ X;  3H3V C;  4BBS B;  1VDZ A;  1OXX K;  3I90 A;  1FYC A;  1FNW A;  2B2Y A;  1TS3 A;  1A3T A;  2EXZ A;  4QF4 A;  3SHL A;  2A69 D;  4PMC A;  2SOB A;  5EPJ A;  3BZD B;  2E2D C;  3RUZ A;  3KBX A;  3KBG A;  3J80 L;  1CT1 D;  3BDO A;  4ABN A;  1S5F D;  4A3I B;  3J80 E;  1SE3 A;  2LS0 1;  5C0X J;  3WDN A;  5DEH A;  3ONA B;  1M8A A;  2F0V A;  3WOF A;  4ODG A;  5DNF A;  2B2T C;  2M9V A;  1EEF D;  4J1M A;  3NWT A;  3VYU A;  3X3N A;  2NN6 I;  1QIL A;  4EQO A;  2PMZ B;  3W2D A;  2NB0 A;  1STY A;  4FNF A;  4XIG S;  4C2M B;  3BVG A;  1O7Z A;  2KOL A;  3GD7 A;  3D4D A;  1JCK B;  1ZYR D;  2HCI A;  3E5S A;  1HFN A;  1PTO D;  3FVQ A;  1I4R A;  4WFN 3;  1O7L A;  4KHV A;  2EY5 A;  1WTQ A;  4K2L A;  4X3S A;  2BCO A;  3KK7 A;  2R92 B;  5M3M B;  2R3Z A;  2PZW A;  5KNB A;  2A68 C;  2IX0 A;  2JP1 A;  1EIG A;  1UUP A;  2E2I B;  3GTG B;  2SNM A;  1WVL A;  3BDL A;  3MA2 B;  5FOB B;  2CW0 D;  1CA6 A;  4JK1 C;  2ICE C;  2PW7 A;  4KY5 A;  2YU9 B;  2J4X A;  3TP6 A;  3J81 L;  1PZJ D;  3VR5 A;  4PNY A;  5A2Q E;  1RTO A;  3ERO A;  2E2H B;  3GTO B;  1KDB A;  1A3V A;  1QWY A;  3RZO B;  3S1N B;  1S5C D;  1ENA A;  1BNZ A;  1U4P A;  4CJ2 C;  1DXM A;  1FR3 A;  1LAC A;  3FEW X;  3M7G A;  2IX1 A;  1EYD A;  2H1E A;  4IUV A;  1WD0 A;  1VMC A;  4GZY C;  1TY2 A;  5KNC A;  2X6G A;  1DOK A;  5M5W B;  4KD4 A;  1BDO A;  2F0J A;  2B39 A;  3ZYY X;  5C5L A;  4ZKC B;  2WKD A;  4XTC S;  2L5T A;  2HUG A;  2QDB A;  3C2P A;  2KVM A;  3AB9 A;  4IUP A;  1SNM A;  1NSN S;  2EVB A;  3A8K E;  1F2Z A;  3N6R A;  1WTX A;  3NBI A;  1GHK A;  1TWC B;  2RKS A;  1SMY C;  1Y8P B;  1I4P A;  1RF2 D;  3HG9 A;  1LLR D;  2F3V A;  3I72 A;  2D2C C;  1SJH D;  3K6O A;  5BN4 A;  1OO9 B;  4F7X A;  1J9O A;  4OHJ A;  4HMJ A;  1HRJ A;  3OIQ A;  1WTW A;  4E6I A;  4FYD A;  1PFB A;  1B44 D;  3QB3 A;  1TWH B;  1EYA A;  4H44 C;  1LT5 D;  1K8M A;  1Q8I A;  1SJE D;  3C1F A;  1KNA A;  4KKT A;  2RQX A;  5K5P A;  3OSO A;  5C4X B;  3SVM A;  1SSO A;  2F3W A;  1U4M A;  3MXN A;  3DWQ A;  1MGS A;  2CVR A;  3A7L A;  4C56 C;  4HED A;  4HR7 B;  1K83 B;  3SE0 A;  3CRK C;  4IAL A;  1SYF A;  2L9H A;  2PQE A;  1HQM C;  1L0X B;  3P7J A;  4DA2 A;  2XWB B;  1F2L A;  3I70 A;  2BDN A;  2TSS A;  1AEX A;  1STN A;  3NXW A;  2AUK A;  4FF2 A;  4OIK A;  3TP5 A;  1SNC A;  3H0G B;  5CV7 A;  1C8C A;  4FO2 A;  1SNP A;  1EWC A;  4ZUI A;  3NPP A;  4QIW B;  4RHR A;  1EYC A;  3OWF A;  1CI3 M;  2FFK B;  2A68 D;  3DXJ C;  1UNS A;  5JVH 3;  1QNU A;  1OXS C;  3G6J B;  2EYL A;  1ET9 A;  3QWN A;  1EOT A;  1SNQ A;  4XQN A;  1F2M A;  1H9J A;  1WD1 A;  1PRT C;  1PZK D;  4H7B A;  5C6A A;  1V43 A;  1B9N A;  5T1G A;  4DNR B;  4XDX A;  3JAM E;  5E1F A;  2NWG A;  5EJW A;  2K33 A;  1MI2 A;  1Y1W B;  2F0Q A;  1DZ1 A;  1YNN C;  3NQT A;  1PLF A;  5ELF A;  2EYO A;  4O1N A;  2MUY A;  3H6M A;  1Q1E A;  4EGV A;  3VR2 A;  2AUJ D;  5EKK A;  2B2W A;  3TDQ A;  4CHT B;  3A56 A;  2IWH A;  1EY4 A;  4RCO A;  1Y69 U;  3HOU B;  2AQ3 B;  3OMC A;  5LHY 1;  2R7Z B;  1AP0 A;  2ZT9 C;  1QOH A;  1C48 A;  1TU2 B;  3TBI B;  1ET6 A;  2B8G A;  4IFD H;  2EYP A;  1JB3 A;  3TME A;  4G7O C;  1ILQ A;  4O42 A;  3V05 A;  1U4L A;  5CV6 A;  1SMY D;  5DAU A;  4CJ1 B;  2KED A;  1PDQ A;  2B8F A;  3CRL C;  2A69 C;  4IFD G;  1L0Y B;  4DAV A;  2F1M A;  1BQQ T;  3O13 A;  4IZ8 A;  1PFM A;  1RCV D;  2PCF B;  4IUT A;  3SK6 A;  2DN8 A;  2KUM A;  3DEP A;  3TZD A;  3OPO A;  5FLX E;  2JA7 B;  5BN3 A;  4EQN A;  1TY0 A;  3M3Y B;  2RDF A;  3T53 B;  3FKI B;  1BF4 A;  3TP7 A;  1NAP A;  3I4N B;  2O5I C;  2F0P A;  2Q8T A;  3S9W A;  4TSS A;  2MGS A;  4Y7N B;  4QCL A;  1SE4 A;  1AN8 A;  4ULL A;  2JA6 B;  3NUC A;  4A3D B;  1RKN A;  4L63 B;  1K8O A;  1HFG A;  2KQ3 A;  1CHQ D;  1QCB D;  4X3K A;  1F2Y A;  4RGO S;  1D5X C;  4IUN A;  1A15 A;  4C3I B;  1HPC A;  2EZV A;  2F0W A;  5JEA H;  1DD2 A;  1F9S A;  2EY1 A;  3EQL C;  1GUN A;  1WTR A;  1HUN A;  3PIP 3;  2L4N A;  1EY6 A;  5EBC A;  3A55 A;  1CTM A;  4X3U A;  1D5M C;  5JEA G;  5CV4 A;  5COR A;  3T16 A;  3PUY A;  5EKL A;  4DAP A;  2EJM A;  4TKO B;  2L0C A;  2R93 B;  1VCI A;  2R61 A;  4KTA A;  2HDL A;  4BA2 I;  4ZRZ A;  5ISR A;  3IKJ A;  2NTT A;  5ELC A;  4KV6 A;  4HSV A;  5M9O A;  4M8A A;  2XWJ B;  3HKZ B;  2K03 A;  3GTQ B;  3DUZ A;  3D3R A;  1DOL A;  1EY9 A;  4I65 A;  2B2V A;  1YNN D;  3URY A;  4XQQ A;  1NR2 A;  3SEB A;  2WP8 J;  3HOZ B;  3T4A C;  3OW7 A;  1ML0 D;  3D6C A;  4FXD A;  1HTP A;  2B2Y C;  1GUS A;  2NVX B;  3DEO A;  5C3W A;  1PMR A;  4RWS C;  3EJI A;  2F03 A;  1Q1B A;  4JBW A;  2F0T A;  2KEC A;  4IFD I;  3CU7 A;  2K5Q A;  1VMP A;  1JC7 A;  2AWO A;  3S2H B;  5LL6 X;  5FO9 B;  3DWP A;  3QO2 A;  5IGE A;  2EY2 A;  1NCV A;  1OXV A;  2F4I A;  4CKC A;  4ZQ3 A;  3T56 B;  2L11 A;  1X3P A;  3R93 A;  3MFG A;  2K05 A;  3SK4 A;  4DGZ A;  2WAQ B;  1EY8 A;  5CBA E;  4C1N I;  1JWS D;  3SK5 A;  1ONL A;  2NYZ D;  5ELB A;  2N55 A;  1PRT F;  4C1N K;  1KAA A;  4F88 A;  2EE1 A;  3T51 B;  4IUQ A;  4ZLT F;  4TRD A;  3G7L A;  4R8N A;  1LO5 D;  4QUC A;  3MHB A;  5CC4 A;  2A74 C;  2VB3 X;  3PV0 A;  4IQZ A;  2O4X A;  5J22 A;  4WRD A;  1ESF A;  1SYB A;  3RD4 A;  2QIL A;  4C3J G;  3NTH A;  5DM7 3;  4FXK C;  4LAA A;  1LTA D;  1XX8 A;  5JPM C;  3E0J A;  2BA0 A;  2NBF A;  1SDF A;  3TSS A;  4DAY A;  4DXF A;  1O80 A;  1JR0 D;  1ZKO A;  2DY7 A;  2KCN A;  4RGN A;  4C3H G;  4K6D A;  2RSN A;  5IGB A;  3TP8 A;  2NUC A;  5C4H A;  4C3J B;  2JXM B;  4N9T A;  3BYY B;  5D3I B;  3L7Z C;  3HOV B;  2I46 A;  2F0L A;  3PUX A;  1IKL A;  1EU4 A;  5IT9 E;  5FK9 C;  4I7Z C;  3R2T A;  4R9W A;  2D5D A;  3C1E A;  3H91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...