2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
b'PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial RNA polymerase inhibitor
molecule tags Transcription
source organism Enterobacteria phage t7
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
1H9JA 4G7OC 1ZYRC 4TKOB 2AWOA 2DN8A 3QJYA 5KNCA 5C0XG 3D4RA 3N6RA 1IYUA 2YYZA 2E76C 3NE5B 1Q1BA 3A8IE 3FPPA 4JK1C 1GJXA 1HTPA 1Q90A 1Y8NB 2Q8IB 4HR7B 2BE5C 1OXUA 2E75C 1PMRA 2L5TA 3A8JE 3P20A 3VR4A 4BA1I 3M7NA 2NN6I 2NN6G 4OO1G 4XTCS 3T56B 1VF7A 3GQBA 2EVBA 4IFDG 4KHZA 3VR6A 4TQUS 3SDZA 3BDOA 2JEBI 4IQZA 4H44C 1VCIA 1SMYC 4JBWA 1YNNC 3U9SA 2BE5D 2E74C 1H9SB 4OO1H 2B8GA 2NN6H 3VR2A 1Z7TA 3IKJA 4KKTA 4DNTB 1IW7C 1IYVA 3HGBA 4G7ZC 2A69D 5JEAG 2A68C 3QIAA 4KKSA 2D62A 1O7LA 2V4DA 4BA2I 4IFDH 3OW7A 1CTMA 1EWHA 3EQLC 1V43A 1GUOA 3T51B 1E2VA 1ONLA 3CRKC 1YNJC 4XIGS 2KCCA 3L7ZC 1H9SA 3DXJC 1HCZA 3LNNA 2JXMB 3SE0A 2BDOA 2DNCA 1LABA 2A6ED 2D5DA 2ZT9C 2JE6I 2CW0C 3PV0A 1Z6HA 2BA1A 1GUGA 4DNRB 5BN4A 5JEAH 2A69C 1FR3A 2A6HC 5BN3A 2AUJD 3MXUA 1B9MA 1HQMC 2F1MA 3WDNA 4I7ZC 2LMCB 1CFMA 5KNDA 1CI3M 4GZYC 1DCZA 1VDZA 2K32A 2O5JC 3I73A 1Q1EA 5KNBA 1LACA 2A6HD 4DK0A 4DK1A 1GHKA 1G291 1GUTA 1Q12A 5K36H 1H9RA 1K8MA 3VR3A 4KI0A 1HPCA 1Y8OB 3OOCA 3I72A 3PUYA 3T53B 1V8QA 3PUVA 1B9NA 2EJMA 3PUZA 3I4LA 3A8KE 4LJZC 2R6GA 1H9MA 3PUWA 2IT1A 1E2WA 3VR5A 3ND8A 3D31A 3M4YA 4L8JA 1T5EA 1ZKOA 2A68D 4KN4C 1OXVA 5K36G 3A7AB 1OXXK 3CRLC 2QF7A 3PUXA 2BA0A 4H0LC 2O5IC 3OPOA 4KKUA 1A6XA 1TU2B 1OXSC 4LK1C 2PPBC 2B8FA 3ND9A 4KN7C 1Y69U 2K33A 3A7LA 3IFTA 4RCNA 3RLFA 5A35A 4H13C 1FYCA 3VA7A 1Y8PB 2KA7A 1E2ZA 4OGQC 2EJFC 3M85A 1I6VC 1GHJA 1TKWB 3LWUA 2PNRC 3AB9A 2EDGA 3TZUA 4PV1C 5BN5A 1BDOA 1IW7D 2K7VA 3KLRA 4KMUC 1DXMA 1OXTA 2D2CC 5C0XH 2AUKA 1DD2A 2DNEA 3MFYA 1K8OA 2EJGC 2PCFB 3W3AA 3QG1A 3GD7A 3H94A 1H9KA 2JEAI 4G7HC 3BG3A 1GUNA 1VF5C 2A6EC 3FMCA 1QJOA 1GUSA 1O78A
chains in the Genus database with same CATH superfamily
3S16B 5IOCA 2R7ZB 3KLSX 3UDFA 4DV2Q 1PV4A 3HOVH 2OQKA 3SK6A 1Q1BA 3A8IE 4JK1C 1N34Q 1IKMA 1ENCA 4P71A 2R7DA 2F0NA 4QIWB 4L5SA 5D14A 4MTKA 5E4XA 4IALA 1AW7A 3NTIA 1KABA 2X69A 2R93H 3X3MA 3M4PA 3HOWG 1QWYA 1SMYC 1VCIA 2Q8TA 5IY0A 5J22A 1QILA 4I7AA 3BZDB 4P2CB 2ZJRA 4OO1H 3QB3A 1ILPA 4H02A 2ENBA 2PQEA 5FO9B 2KUMA 4RCOA 3HKSA 4DV5L 3PO3H 1NMFA 1SNDA 2AQ1B 2CWAA 2WB1E 1KRSA 5FLMG 1K0RA 2L12A 3B6YA 3KDFA 1TR5A 3QOLA 1R9TB 4EGVA 4K8JA 2LS01 2Z1CA 2JYOA 1A8VA 1A2UA 2H1EA 3K7UC 5C3WA 3G71A 1HNXQ 4DU9A 2IL8A 1EY7A 4UP9A 1G91A 2B3GA 1ET9A 2DY8A 1JT8A 5KYIA 2SNSA 3JC66 1Q1EA 4NXNL 4R4OA 3J7YW 4AYBG 2KHJA 4JG2A 3T1YL 1SYGA 4KI0A 2HDMA 1BXTA 4FF4A 2IHFA 1UE7A 3OOCA 5EBCA 1QB5D 1WYDA 4YWLA 2X6LA 3S1MH 4I65A 3ND8A 4DAPA 2Y0SG 3BVZA 3J81i 2NTSA 1HUNA 3J7A5 1ESFA 1J5EL 2R7FA 5BR8L 3CC7A 2YTYA 1TU2B 4JBKA 2B8FA 1S5DD 2OEOA 1ASZA 2B2TC 4DUYQ 3FHWA 4R9WA 4X3KA 1XYIA 2A5HA 4QJFA 1IW7D 4FXDA 5LMNL 4J6HA 4IFDJ 1IBKQ 3S1RH 2EJGC 1D1KA 2I07B 3MEHA 1VQFA 4R8IA 3PQIA 3PIP3 4DR1Q 4CJ2C 2A6EC 2SOBA 3F1ZA 1S72A 5LMUQ 1TIID 4TKOB 2NZHA 3D4RA 3OTOQ 2IPKD 4A76A 1PH5A 1VQJA 4B9WA 3QR8A 3HOWH 4QB4A 1NSNS 1OXUA 3P20A 4HN7A 1VQGA 1IXRA 3GQBA 1MSGA 2K14A 2FFKB 2K4KA 2OCEA 1UE1A 4EQNA 4DUZL 1YNNC 3U9SA 4LFAL 3BU2A 5CV6A 3G4SA 4UP8A 3KYHC 4TSSA 2WACA 3H09A 3GDEA 1B3QA 3PF5A 1IYVA 2VW9A 5IYCG 4CDEC 1CKMA 3S1MB 4DR2L 1YNJC 4DV4Q 2EYPA 4C3JH 3DWAA 2EYOA 3HKZB 1LTRD 1DJRD 4DNRB 1VQHA 3I4MB 2NVQB 2A69C 4A3GG 3BZCA 2IW3A 3HOZB 4WORA 4ZKCB 3F2CA 2IX1A 4X3SA 4DAYB 2R7ZH 3RZOB 2OQ0A 1PFSA 4ULLA 1GHKA 3IFDA 2I46A 5D3DA 1RHPA 2YTXA 1ENFA 4WJ4A 1PFBA 3ULLA 2HD3A 2Y0SB 1MD2D 2IT1A 4M8AA 3PIOA 1MIUA 5GAGC 1O7YA 3NBHB 1W2BA 2NVXH 2EE1A 2ALYB 1LO5D 3I56A 2O5IC 3Q24A 2B2WA 4LK1C 4RAUC 2IX3A 2BCOA 3DEPA 1EEFD 1PTOB 1SJHD 5C3EH 4X6AH 1QZGA 2KENA 1E24A 2K01A 2I5LX 2NYZD 3J80L 1PH9A 3CCVA 2JQOA 3T4AC 3M3YH 1O7ZA 3CCQA 2M9VA 1DD2A 2KOLA 2L1BA 5IODA 2JA7B 1GKHA 1TVXA 2KBNA 2Z0SA 5CBEE 3KLWA 5E4WC 1TWAH 3NBHA 4G4KA 4X3UA 1SDFA 3SXHA 1SE3A 1DZ1A 1BVSA 4BBRB 1BO0A 5C44G 1JWMD 1CKOA 1R4QB 3C2PA 3KLSA 5AFWA 5I4DA 1PH6A 4RFBA 2K5HA 4IZ8A 5NUCA 1XJVA 1N9WA 2VB2X 2CH4W 1RL2A 4YWKA 5D65A 1U0LA 2R92G 4HCSA 2EY2A 2MO1A 1XPOA 2F0LA 3QIAA 3CCRA 1SMYD 1EWHA 3CC2A 1SRUA 3K58A 1ONLA 2O4XA 2RF4A 4A3IB 4GN5A 3SE0A 2ZT9C 3HOZH 2UXDL 3U4VA 4ID6A 2AUJD 3MFGA 3RZDH 4JI7L 1D5MC 4LF6L 2L9HA 2HHHQ 4BXXG 5FLMH 1F2MA 3L0OA 4DR2Q 2JJQA 1KTKA 4K5XA 1DOMA 1VDZA 2K32A 4NKLA 1I3QH 3L3OC 1M4VA 4ZRZA 1PRTC 3W2DA 4PQXA 1PA6A 4LJZC 2EJMA 2DUDA 1Y1WB 1JB3A 4XQJA 3R3OA 1NAPA 4YY3Q 3E6ZX 4JI1L 4DR4L 4DR6Q 3HZXA 4GNXB 1T5EA 2F0IA 3PSIA 2CWPA 4P75A 5C3EG 2Z6BA 2NVTH 3I7FA 1K8AC 4DR1L 2L15A 1VMPA 4OIJA 1J8IA 3K81C 4RCNA 3T16A 5DNFA 4DGZA 1FJGL 4B9XA 2BH2A 1C0AA 4G57A 2B29A 2JSOA 1RKNA 2KHIA 1WTHA 4NP5A 2M2LA 4K5WA 4A93B 3GTOH 1PFMA 3EJIA 3F2DA 1DGSA 4N9PA 2PMZE 1VQDA 1HNZL 4L63B 1HNWL 1EY5A 3DM1A 5JJKA 1BCPD 4NDXA 5C5MA 1G6ZA 1HR0W 3GTJB 2EY1A 1K0SA 4IOCA 3HOYH 1YNND 1EZ8A 2JA6G 2AWOA 1EFID 4AIMA 4NXML 4NXMQ 3RLOA 5DLQE 4AYBB 4HJ5A 4HIDA 5EKLA 3A8JE 1N33L 4XTCS 4LUVA 1XNQQ 1J9OA 2EVBA 4K5VA 2PW5A 5J39A 4IPGA 1J5EQ 1C7YA 4K2KA 1HR0Q 4MTNA 4QUFA 4HCEA 3S2HB 3VA5A 4EVOA 1VQAA 1GOZA 2B2WC 4K6DA 3A0JA 3HOZG 1X65A 1CTMA 5I2YA 2K03A 5IP9G 3TMEA 3K59A 1VQPA 1SYCA 2JXMB 5ELNA 2DNCA 3U4ZA 2JE6I 1XMQL 1ZYRD 1BBXC 4R4TA 1QCBD 3FKIH 4GLXA 3J81j 4K0KL 3TQYA 4CKEA 4V0BA 3MXNA 1X6OA 5CGKA 1TWGH 1JR0D 1Y14B 4A3GH 4C3IH 2QDLA 1KD1C 4FF1A 3P7JA 1PTOF 4DV2L 1QNKA 2EY5A 1XPRA 4ZUIA 3H0GH 1SJED 1OXXK 2CQAA 2ZTCA 1KRTA 2OWOA 1XPUA 5G3LD 4JI6Q 1JC7A 2L11A 1L1OC 2F3IA 3IFTA 1KDAA 4KY7A 5M3MH 2V1CC 1E2ZA 4C1NK 3SK5A 5FO7B 1LTTD 4HIMA 2NVYB 1GHJA 1X32A 3H91A 2NVXB 4OX9Q 1TS3A 1CZWA 3R93A 2HCIA 4DV3Q 4KD3A 4YWMA 4JYAL 5T1IA 3MFYA 2MNAA 1O80A 1SBBB 5H1SE 3NTHA 2NB0A 3F2BA 1E22A 2N78A 1CT1D 3TREA 4KD4A 4HSVA 1JE4A 2L5TA 3K5LA 1ZYRC 5C4XH 2VQEL 2F0QA 4A3JB 3TDQA 4JI0L 4ALPA 3MVVA 1WTOA 4FF3A 5FOBB 5EQ0A 3HG9A 1WTPA 3CCEA 4GKJL 3Q0AA 4BA1I 3TRZA 4JVZA 1VF7A 5C44H 3J7AV 4RHRA 5CV8A 3W1GA 2B2TA 3OWFA 3T13A 4HEDA 1ZXTA 1ASYA 5IYBG 1A0IA 4K0KQ 1KDCA 2F0JA 3NENA 4UPAA 4RHSA 2B2UA 2NN6H 1PRTB 2UUBQ 4ME3A 2VUMH 1EY9A 2A69D 1TS2A 1EQQA 2D62A 1IBKL 2A73B 3BYTB 3OW7A 5EBDA 4E6IA 4LNQA 3PF4A 5CR3A 5EJWA 3CRKC 5JOBA 4XIGS 2PI2E 5IGCA 1N36Q 5I6YA 2GVAA 4PZ6A 1V9PA 4PMBA 3E9IA 1I4RA 5BN4A 4X65L 3HS0C 3CMEA 1VQ5A 2XWJB 3CU7A 3H6MA 3S1NB 2HUGA 3GTOB 3W1BA 5L37A 1JOOA 1DCZA 4BY1B 2E2DC 5KNBA 1II3A 2HCCA 1WOCA 2UXBL 1F2YA 1LTSD 3D4DA 1HPCA 2EYFA 4JI8L 2OXPA 3OIPA 3VYSA 3PUWA 1GD7A 2AKWB 3K8AA 2H5XA 3STBC 5FLXL 1YITA 1K3RA 4JBJA 3TBIB 3S2HH 1TS5A 2PPBC 2PNHA 4WJWA 2KJXA 5FLXc 5C4JH 4H13C 3D8GA 2AHOB 5I2XA 2QW7A 1A15A 2UU9Q 2CCZA 3UI2A 1RTOA 3I91A 2UXCQ 1B50A 2RSNA 1E1TA 1W6KA 1RD9D 4QF4A 4IPCA 4C3JB 2D2CC 5EGTA 1X3QA 3Q23A 3T1HL 3S2DB 1U5KA 1KLUD 1ICWA 4FDBA 4LF8L 1B53A 3QJYA 4LAAA 2OT2A 4A3BG 4JI4Q 2C5CA 3S9WA 1PLFA 3FPPA 5EKKA 2EYLA 4L5QA 3ICEA 2JA8G 2WINB 4EQPA 4GLVB 4KHZA 4K14A 1U4MA 2B63B 2E2HB 4H44C 1CHPD 2L4NA 3V05A 4XT1B 4R1JA 1JJGA 4TRDA 1X54A 3KK7A 4KKTA 5IGFA 2K6AA 4A3FB 5KIXA 1KDBA 5IGGA 1LTGD 4POFA 4DV6L 3F8TA 3URYA 1QE6A 2VY3A 3Q6SA 4FP5D 5HGTA 1KQSA 4DFAA 4CBVA 2Q2TA 3K0XA 5JEAH 5FO8B 5CMDA 2WAQB 4AH6A 2JA7H 2PZUA 4YHHQ 4IOAA 2LMCB 4RGTA 1SROA 2HIXA 3S1QB 4GKKQ 2GA4B 2PO4A 4DV4L 5ELOA 1N32Q 3LGJA 2VQFL 4QGUA 3HKZG 1Q12A 3FKIG 1JOQA 1TWFH 4JI3Q 3CCUA 2AQ2B 3EBEA 4JPBW 5CV7A 3E0JA 1E3PA 4LWCA 2UUAQ 2CH4A 3NXWA 1SYFA 2L55A 2VL6A 1PZKD 5J1ZA 5COYA 1EYCA 4C3IG 5F2DA 1T9HA 2XWBB 1P8LA 3T1HQ 4RH6A 3PIO3 2K52A 2QCPX 2JA5B 4OO1I 1VQNA 1VQOA 1RODA 3RNUA 1D2BA 2AMCB 1VQ6A 1BCPB 3HP3A 1CA6A 4DR5Q 4FYDA 1SNPA 2MUYA 2UUAL 1HHVA 2QA4A 2K7VA 1Q7YC 1IL8A 4APVA 1K8OA 4NPSA 2G5DA 2K5NA 4A3CH 2QKIC 2DJGC 3TP6A 1RF2D 4Q0FA 1RJTA 4G7OC 5CV4A 1L0YB 1DM0B 5KNCA 2C35B 2EXDA 2YYZA 2UXDQ 4OHJA 1EUJA 1SNMA 3CCMA 2KEEA 4KHPL 1GJXA 1TY2A 1A3TA 4ABNA 1SEBD 2E75C 5ELCA 4FO2A 1YVCA 1Y1WH 1FL0A 4R8NA 1IBLQ 3I8ZA 5EPJA 1YEZA 4BS9A 1GO3E 1YHAA 4J1MA 1D7QA 3GTPH 5C4XG 2UUCQ 4A93H 3DHQA 1AEXA 5E1FA 1N34L 1TWCB 1HZAA 1LTAD 3HOUH 2BE5D 2KVMA 3IKJA 3NTKA 5IGEA 2WAQG 5JEAG 1NUCA 5M5XB 1P16A 1GUOA 3MXPA 1I4QA 5DAUA 5EKIA 2L0CA 3CKIB 1NR4A 2KCCA 3L7ZC 1F2ZA 1I94Q 2JA6B 3FKIB 4LMQD 4DR6L 2BA1A 2Q2IA 3CXCA 1QUQA 5IYCH 3JAMi 1KAWA 3GV3A 2VUMB 4DR5L 3CW2C 1QZHA 1B9MA 4ZK9B 3L9AX 3WDNA 1XNRQ 3GTGH 2PQAB 1L0WA 4DK6C 1WCMG 2F0GA 3BYYB 1LT3D 2B2VC 2XGTA 2ZM6Q 2FHTA 4HJ9A 4PMCA 3MWYW 1PYWD 3BVMA 2E5LL 1JJCB 4RGNA 2Z8LA 1B9NA 3S16H 4DF7A 3A8KE 2WIIB 2LKVA 1IZ6A 1FGBD 1SN8A 5FKAC 3N52A 2CFMA 2N8NA 4CDFC 3CRLC 3PUXA 1UE5A 3CAMA 2EY6A 2F0PA 2VS1A 1K83H 1TWFB 3OPOA 4KKUA 1OXSC 3HOXG 5D3IB 1CM9A 2NZ1D 4RMFA 4WRDA 3JAME 5CYUA 2E2IB 1TS4A 4YHHL 4KHVA 5E7NA 4CHTB 2EZVA 4FNFA 2PW7A 4EQOA 4WFN3 3I4MH 3MA2B 5GROA 3TZUA 1X3GA 1LM0A 4GN3B 3A74A 3ONAB 5C0XH 2GVBA 2RDGA 3NUCA 2RCFA 4TVAB 5JVH3 3BG3A 4OEMB 2Z6KA 2QEJC 2VXWA 4KHPQ 1QJOA 1ZKOA 4DR7Q 4HIOA 1A63A 1HFNA 1AE3A 4A93G 4PG3A 3AFPA 1IHZA 1UNSA 4YCWA 1EY0A 1QOHA 2Q8IB 4KV6A 1TWHH 4MNOA 3P1HA 2B2YC 3TS2A 1STYA 1K8GA 2E2JH 4KLKA 2F4VQ 1CSPA 2LXJA 5EPLA 2MPMA 3TS0A 2K5WA 4LF7L 1B7YB 3S17H 1B1ZA 2F0MA 2N3SA 4QMGA 1KL9A 3V96A 3M4QA 4LW1A 3OW2A 4CGYB 1QUQB 3CCJA 1I3QB 1SR3A 4JBMA 3JAMc 1V43A 3I4NH 2ATWA 3K5OA 1Q8KA 1E2VA 1WCMB 2R92H 5C44B 2HHHL 4OXPA 2K50A 4OONA 1WCMH 3BDCA 2R92B 1JICA 3Q22A 4FXKC 2A6HC 3K5MA 1V1OA 1Y1VG 4DUYL 1GM5A 3NHHA 2OF1A 2DJFC 1CFMA 1E1OA 3HOXB 2F0UA 4DK0A 3CCSA 3PMFA 1BCPC 3GTQH 2JA7G 2I5MX 3PUYA 1PHJA 2F0VA 1NE3A 4CJ1B 4F87A 4C3HB 2C9OA 3NQIA 4A3MG 2I5HA 4DA2A 4DNIA 5IYDG 1HNZQ 1WFQA 2QDBA 2K05A 3IAYA 1EQTA 5M3MB 1Y69U 1YJ9A 3IRBA 3X3NA 3RLFA 4U68A 4NW2A 1HTLD 3OYYA 2LFNA 1HZCA 2KHSA 4JI5Q 4A3BB 1BBWA 3KF6A 3J7AF 3OMCA 4RGOS 4YIJA 1K9MC 1BDOA 3PGZA 4JOIC 3S14H 4R4CA 2FXQA 3W5OA 1G2SA 1JOKA 1VQCA 4P73A 1WVLA 3HOVB 3K57A 1JMCA 1LV9A 3DLLA 5C4HA 1XTCD 2VB3X 1XNRL 1F2LA 1H9JA 5EPKA 3R2IA 3E0EA 1O7IA 2ZXRA 3LX0A 1EFWA 4GNXA 1AZQA 1GVPA 1Q90A 4IURA 3I2ZA 4HR7B 1PMRA 1CKNB 1M90C 2HDLA 1RDPD 3T56B 4GKKL 1JCKB 1NY4A 3QO2A 1PVOA 3SHLA 2E2HH 1QVCA 2ICIA 4IUTA 1K28A 1F9SA 4HMJA 2LY7A 4XQNA 3EN2A 5LL6S 4HIKA 4GOPA 1QG7A 5C4JB 1PH2A 2A68C 5C0XJ 4LFBL 3C1EA 3EQLC 3VYUA 3SGIA 1H9SA 2QILA 2KQ3A 2D5DA 5A2QL 1VQ9A 3CQZH 2CW0D 3AYHB 4Y7NH 1D6EC 1BKBA 4P74A 3MXUA 4JOIA 1EYDA 1L0XB 2PZTA 1VS0A 1YI2A 5KNDA 2R61A 4NXNQ 4JV5L 1FNWA 1WTXA 4HJAA 3L2PA 2UXBQ 4A3EH 2O5JC 1PZID 1MBYA 1H9RA 3R2TA 3VR3A 4BY7B 1Y8OB 1G8ZD 2I0QA 5K5PA 1K73C 5AJ3L 3TEHB 1PRTD 2ZTDA 5JAVA 3QOJA 4LF8Q 4X65Q 5IP7G 1W3SA 3CHBD 4U673 2E5LQ 1YHBA 1AN8A 1EOTA 2VNUD 1DONA 2BDNA 3OHXC 1CQVA 2WKCA 3HOWB 1MGSA 3U58A 4L6TB 4CKCA 2X6GA 5IGBA 3CPWA 3OIQA 1EL0A 1SNOA 2JA8B 2ZXOA 1IBML 5JEAJ 3PO2H 4KY6A 1BUVT 5C3EB 2DY7A 1BR9A 3NELA 4BY1H 2EDGA 2NTTA 4UP7A 3NBIA 2MGSA 3DM3A 1MI2A 2MHVA 3EVQA 4B3TL 1V1QA 3LWEA 4IJHA 3OWEB 4A3DG 3J81E 2JA5H 3GO5A 4F7XA 4A75A 4X62L 2P5ZX 1Q82C 3GTQB 1B8AA 1IYUA 3N6RA 1EQRA 5DM73 5M5WB 3SR1A 1HR0L 2Q2HA 4DV6Q 2KCNA 1U9RA 2EYJA 1V1PA 3PO2B 4IFDG 3TP5A 5M5YB 4X3TA 1DYQA 4DR3L 3AU7A 2E8GA 4IQZA 2B2YA 1VQ7A 2O2LD 4KK7A 3FPUB 4DNTB 4GS3A 5CORA 4J15A 1D1IA 1ENAA 1O7LA 5IYBH 3H3VC 4Q5VA 1G51A 5EAYA 1BQQT 4IFDI 3DXJC 1S3OA 2Z6KC 4ZAIA 3DMUA 1EIGA 4A3EG 2J7ZA 5LMUL 3MXGA 1G2TA 1AZPA 2QGQA 4A3KH 2F4VL 1RTNA 1I50H 4LF5Q 2SDFA 1CK1A 4BBRG 1HJPA 3Q8DA 2GN5A 3S1NH 4DXGA 3JAML 1UE6A 4FXGC 1U4RA 3KJPA 1GUWA 1LUZA 4PZ8A 2YV5A 2YTVA 5T1GA 4QUCA 1YJNA 3PUZA 3E5SA 3UDGA 2AWNA 3BJUA 1S4ZA 4AYBE 1XMQQ 1LTLA 4OWXB 2KCTA 1CZGA 1FNVA 2BA0A 3PO2G 1PYBA 3E9HA 1EU3A 1LTBD 3ITPA 4BY1G 4X64Q 3K5NA 2B39A 2K33A 1HQRD 3RMHA 5A35A 3VYRA 1F9QA 1M1KC 1X3EA 2LSSA 2EJFC 1EU4A 4A3DH 3A5UA 4V190 4JI7Q 4CDCC 4B3SL 1YIJA 3EROA 2FINB 4A3JH 3AMUA 5ELFA 3DWQA 1N8RC 2UUCL 1BNZA 2TMPA 3GD7A 3SK8A 1H9KA 1UUPA 2JEAI 1HZ9A 4BBSB 1CHQD 4IJLA 1XX8A 1VQ8A 1GUSA 2FJ2A 5IT9L 5C5LA 4DV7L 4OIKA 4A3MB 2BH8A 3NE5B 1ET6A 1EQVA 3S14B 3CF5A 3S2DH 4KY5A 1B2TA 4DAMA 1D8LA 1MHWC 4L5TA 4ZKBB 1TY0A 1EYGA 3D0FA 4DN4M 2N49A 2K04A 3S17B 1SYDA 3VR6A 4JI4L 4JBWA 3V2TA 2SNMA 3KFUA 4DR4Q 2F0HA 1KAAA 1EY6A 4F88A 4YY3L 2RDFA 2JA8H 1Z7TA 1FJGQ 1TWAB 4A3KG 1PDQA 1RCVD 4A4IA 2FMCA 3G7LA 1STNA 5A2QE 4PNYA 1X9NA 3PCOB 3EIVA 1TWHB 2WAQE 1GUGA 2R93B 4IUQA 1XXGA 1VQIA 3GTPB 4C2MB 1VQMA 4NMZA 1BCPF 1HQMC 2WV6D 4LF7Q 5FLXE 4AQYL 4H7BA 2FMMA 1I4XA 1IBLL 1SSOA 1ML0D 1PTOH 3I73A 5GAHC 4IN3A 2EYMA 4JI3L 4JYAQ 1NTGA 4OL7A 3MXNB 3I4LA 2JN4A 2RKSA 1A62A 3I4NB 1PXUA 5M5YH 3VYTA 1S5CD 5K36G 4BBSG 2QF7A 3CPFA 1B3AA 4XDXA 1TT2A 4GN4B 3OMGA 2UUBL 1IYJB 3GTKH 3J81L 3FRPB 4Y52H 5IP7H 4A3JG 2RBMA 3ZYYX 1HH2P 3MC0B 2F3VA 3J80E 5FJ8G 5LL6X 3M85A 1C48A 1E7ZA 3K7AH 4RG1A 5M5WH 1UEAB 4DXFA 1HA5A 2PCFB 3W3AA 3QG1A 4G7HC 3K7AB 3GTJH 1FYCA 2ZJQA 4WJ3M 5I9OA 4JI1Q 4DKAC 3P75A 1PRTF 1PH7A 4QY7A 5IT9E 1WD1A 1VQBA 2ASBA 3NWSA 1U4PA 3D3RA 1UWVA 2R3ZA 2XSCA 2YU9B 2F52A 2JA5G 3GTMB 2F03A 1EEID 3G6JB 3HOYG 4OO1G 1C9OA 1I94L 1PTOC 4DV3L 2EYHA 2JA6H 4RKLA 5CBAE 4C3IB 3KF6B 3NQTA 3CC4A 4JC0A 1JORA 1I4PA 3SDZA 3C1FA 4UAIA 4YCVA 2D0PA 3CD6A 2F0OA 1SE8A 1KHIA 2CVRA 3KDFB 1B70B 1EIHA 3G6EA 3UE0A 5E3FA 1Y1VB 3A54A 4OELB 3TP7A 3HGBA 5HGQA 4KKSA 1TWCH 2NVTB 2F0DA 2Q8RE 3AEVA 2F0KA 1XMOQ 5I9PA 1SYEA 2EQSA 4OX9L 1EIFA 4B3MQ 4B3SQ 1HCZA 3LNNA 3RN2A 2NWGA 1R4PB 4F8MA 2F0FA 2K75A 5KGUA 2F1MA 1A3UA 2CQOA 2KECA 5IP9H 1WD0A 5C4ZA 4GZYC 3G48A 1CKNA 1AP0A 1LT4D 2YU9H 1LT5D 3GTMH 3STBD 4HJ8A 4X66L 5JJLA 1TWGB 2PYKA 5K36H 3ULJA 1K8MA 4LFCQ 4BBSH 1WTVA 3C46A 3I72A 3WWVA 3PUVA 1X55A 1IKLA 3MTSA 1CSQA 5JPMC 1S5FD 1STEA 3D6CA 4O0AA 3VR5A 3D31A 2F4IA 3GTLH 2HQLA 3A56A 1E0BA 4IO9A 3MAQA 1PH1A 1BOSA 1X3FA 4HSPA 1OXVA 2K5DA 3A5ZB 5FK9C 3S15B 1GXDC 3S24A 4IPHA 4MHEA 3S15H 4KTAA 2HQEA 5ELDA 2A8VA 1EIYB 5GADC 1WTWA 3ND9A 5LHY1 1YJWA 1G6PA 1DOKA 1SFOH 4RGMA 5IIFA 1CUKA 4HMIA 2N88A 2Z9HA 5HY6A 3GTGB 4IUUA 4C2MH 3LWUA 2PQAA 3HOXH 1X3PA 5BN5A 2E2JB 5CV5A 5M3MG 1R9TH 2AUKA 1KC8C 1X56A 3GV6A 3QWNA 3FP9A 2NVQH 4A3GB 1GUNA 1K3BC 1Z9FA 4LF6Q 2KEDA 3ERQA 3J7ZC 1PZJD 2WP8J 4JCVE 3CP0A 1A3VA 4JI5L 3BS1A 3IL8A 4JI0Q 1BBUA 1I6HH 2VQEQ 1LLRD 4EQ5A 4HTHA 4O42A 1TXYA 4IUVA 1EZ6A 1Y8NB 1SE4A 2B2UC 2QEXA 2K1BA 3VR4A 2NN6G 4UDUC 3S1RB 1JQYD 1NBWA 5BR8Q 4TQUS 3OSOA 3FVQA 3ZJYC 2D0OA 5ISRA 4O2DA 1Q8IA 1N36L 2E74C 2G9HD 3ERSX 1EY8A 5G3LF 2IWHA 1AH9A 2RHQB 3RD4A 1IW7C 2MFIA 2NZOA 2RVLA 3GTLB 3H3VH 4LUOA 3RR5A 3I55A 1VMCA 4B3RL 3T51B 1YNJD 2R7ZG 4X64L 1LABA 2A6ED 4P72A 4QL5A 4BY7G 4R4IA 1VQ4A 3PV0A 2WB1B 4RA8A 4PMWA 2HIVA 1HNXL 5BN3A 3I4NG 3RZOH 3U9OA 3HEJA 1SFOB 5KEEA 5IGDA 5C6AA 1JJ2A 4DV5Q 1PH8A 3KUPA 1M8AA 1ESRA 2ZXPA 4L5RC 5AJ3Q 1L1OA 2R6GA 4DAYA 1EYAA 1H9MA 2VZAA 3D6WA 4ILWA 3H3VI 4ZCKA 5M3FG 3KOJA 4EX5A 4DV0Q 2HT1A 2M00A 1FGUA 4RKBA 2EXZA 3M4OB 2F3WA 4GOPC 3EFXD 3NEMA 3TSSA 4KN7C 2Z4HA 1N32L 5LMNQ 4ZUJA 3VA7A 3S1QH 1JE5A 1NNXA 4C3HG 3HOUB 3CCLA 1EWCA 1PH4A 4LF5L 1RIPA 5CV9A 4DV7Q 2D9UA 4PV1C 4JI6L 1L2FA 3KLRA 1LTID 3DUZA 2AQ3B 5GQOA 1SNCA 3H15A 1Q81C 3RLNA 4GNXC 3NK9A 2DNEA 4A3BH 4LFBQ 2PMZB 5IWAQ 5JJIA 4OWTB 4MN3A 1BF4A 1AE2A 1V1PB 2KCMA 4LUZA 1VF5C 4A3FH 4IUNA 5LMNW 1STBA 2OTLA 1ICFB 1DOLA 3NPPA 2DN8A 2RHSB 2CHBD 4MIUA 3BVGA 3UDIA 1KLGD 3SK4A 4JI8Q 2XRSD 3I90A 2BE5C 3M7NA 1FVIA 4A3IH 2A74C 4HAEA 2IX0A 4A3LG 4PZ7A 4A3KB 2NUCA 3BDOA 3AQQA 2N55A 4LFAQ 1EWIA 4BWGB 2ZJPA 4BY7H 3NSWA 4MZ9A 2EPBA 3M9BA 4BA2I 2V4DA 5M9OA 1HXYD 3MHBA 3RN5A 2J4XA 4ZYSA 4BXXH 2MP1A 4QIWE 3CMAA 4G7ZC 4GKJQ 1YNXA 2CW0C 3OTOL 4NB3A 1FR3A 3CQZB 1F9RA 4XQQA 2UXCL 1FD7D 1SAPA 3GP7A 3SEBA 1L1OB 1C8CA 3HRZC 2RSOA 1SYBA 1ZEQX 3J81c 5GAEC 2A6HD 4DK1A 1J6QA 2VQFQ 4K6LA 1MJEA 2RQXA 1KNAA 2MQHA 2XVSA 4OWWB 3T53B 5JVG3 3M3YB 3I70A 5KYLA 1MSHA 5M5XH 2NVYH 1HA6A 2WB1G 4XXEA 5IWAL 2Q2UA 3WOFA 4H0LC 2BOSA 1NMGA 2WFWA 1JWSD 4DR7L 3BDLA 4A3EB 2SEBD 3A7LA 5CC4A 1OTCA 4ZQ3A 2F0EA 1N33Q 1Y8PB 1I6HB 4JV5Q 4OGQC 4Z9CB 4A3CG 1KNEA 5C3XA 3PIPA 1STHA 1Q3LA 4A3FG 1LT6D 2LXKA 2B63H 2RA4A 1C4QA 4B08A 2F0TA 1OXTA 3T1YQ 1H95A 1I50B 1LYLA 3FDTA 4DV0L 3MEFA 4LF4L 2J0TD 2JP1A 3D4WA 4UY8C 1JB7A 4A3IG 4LF9Q 1W6JA 5DM63 2R93G 2NBFA 1HTPA 2RDHA 4GLAC 3HOUG 4ME5A 4KJOA 1CA5A 2NN6I 2ES2A 2F0SA 1I4HA 1A2TA 4ZLTF 1S40A 3KJOA 3SVMA 3WOEA 4C1NI 2ZM6L 1OO9B 1VQLA 2JEBI 1YZ6A 5C0XI 1I4GA 2B8GA 1Y1WG 3EA6A 4DK3C 2F0WA 4LF9L 2EIFA 1D5ZC 3U50C 3GTKB 5IE8A 2PZWA 4CDDC 1QVGA 4IFDH 4YCUA 1VQKA 3KF8B 5KRUA 2K5VA 1B4OA 4HJ7A 2K5QA 4IPDA 4XYOA 1S5BD 4QCLA 1Q86C 4POGA 1KXLA 4GOPB 2B2VA 4I7ZC 1F77A 1STGA 1WI5A 2G9DA 4O1NA 1LACA 1XNQL 3H0GG 1G291 2XNAC 3F2UA 1HNWQ 1QNUA 1SE2A 2RCNA 3TZDA 4BBRH 4XYQA 2CKZB 4IUPA 1E2WA 4L8JA 1PTOD 1EOVA 4DPGA 5J3BA 4KN4C 4XT3B 2E2IH 4CJ0B 3TP8A 5HURA 2IY5B 3BZKA 3PO3B 4R4QA 1A6XA 1XWEA 2MJ8A 3ULPA 3I4MG 5JJZA 1YBYA 4UHVA 5M3FH 1HRJA 3J80i 1CQFA 3NP8A 3O13A 1F9PA 1I6VC 2JK8A 1TKWB 3KBGA 4RWSC 2PI2A 1HUMA 2PNRC 3AB9A 1NCVA 4KMUC 5ELEA 1DXMA 1WJJA 1UEBA 3RZDB 4C3HH 1Z47A 1XTDA 3TN2A 3HOYB 4JI2L 3UE1A 2Y0SE 3FMCA 3C3LA 1B44D 1PFNA 3FEWX 3H94A 4A3DB 3E3XA 5C4XB 2K28A 2EOTA 5C0XG 2OTJA 2E76C 4FF2A 1SNQA 4DR3Q 1IL2A 1XMOL 4J8QA 4LF4Q 4JW0A 1QVFA 2XRQD 3A55A 2A19A 3HOVG 4N9TA 4LFCL 2VUMG 5M3FB 1MJCA 1SXTA 2ID0A 3MZ5A 2H4OA 3HKZE 1TQOA 3I4OA 4FVMA 3NWTA 1ILQA 1SMXA 2IHEA 1H9SB 4C3JG 1YHQA 3VR2A 4X62Q 3VDYA 1VQEA 3ER0A 3RUZA 4DAVA 4A3LH 3AFQA 3KBXA 4K8IA 4KJNA 1Y1VH 4DV1L 4C56C 2JA9A 4B3ML 4AQYQ 2BDOA 2IJ0A 2ZTEA 4X66Q 3H0GB 1Z6HA 5IT9c 4QQBX 1KIXA 1SLJA 3PO3G 4S3SA 3HFZB 2ICEC 3DWPA 4JI2Q 1CI3M 1WTRA 2WKDA 3I3CA 1Q46A 2XIWA 2MO0A 1GUTA 5TSSA 3M7GA 2DGYA 1WTQA 4B3TQ 4Y7NB 1U4LA 1NJIC 2XN9C 1S5ED 5ELBA 1V8QA 3K0YA 1JWUD 3M4YA 1D5XC 1STAA 1IBMQ 5I6WA 3J80c 2A68D 1PYSB 3A7AB 1HFGA 5DEHA 1PH3A 4DUZQ 3K80C 2A1AA 4DV1Q 1MKHA 2TSSA 3KF8A 2Z4IA 1NR2A 4ODGA 1FNUA 1EY4A 3DEOA 2XTIA 1HZBA 2KA7A 4A3MH 5IYDH 3R8BA 4M1UB 4N8FA 1K83B 4N8X1 1AFPA 3K6OA 5JPNC 3M4OH 4CKBA 2UU9L 1T5XD 4K2LA 4B3RQ 5FJ8H 1UAPA 3UDXA 2B63G 1I5FA 1O78A
chains in the Genus database with same CATH topology
3S16B 5IOCA 2R7ZB 3KLSX 3SK6A 1Q1BA 3A8IE 4JK1C 1IKMA 1ENCA 2F0NA 4QIWB 5D14A 5E4XA 4IALA 1AW7A 3NTIA 1KABA 2X69A 3X3MA 1QWYA 1SMYC 1VCIA 2Q8TA 5J22A 1QILA 3BZDB 4P2CB 4OO1H 3QB3A 1ILPA 2ENBA 2PQEA 5FO9B 2KUMA 4RCOA 1SNDA 2AQ1B 2L12A 1TR5A 3QOLA 1R9TB 4EGVA 4K8JA 2LS01 2Z1CA 2JYOA 1A2UA 2H1EA 5C3WA 4DU9A 2IL8A 1EY7A 1G91A 1ET9A 2DY8A 5KYIA 2SNSA 1Q1EA 3J7YW 1SYGA 4KI0A 2HDMA 1BXTA 4FF4A 3OOCA 5EBCA 1QB5D 2X6LA 4I65A 3ND8A 4DAPA 3BVZA 2NTSA 1HUNA 1ESFA 1TU2B 2B8FA 1S5DD 2OEOA 2B2TC 4R9WA 4X3KA 1XYIA 2A5HA 1IW7D 4FXDA 4J6HA 4IFDJ 2EJGC 1D1KA 2I07B 3MEHA 4R8IA 3PIP3 4CJ2C 2A6EC 2SOBA 1TIID 4TKOB 3D4RA 2IPKD 4B9WA 4QB4A 1NSNS 1OXUA 3P20A 4HN7A 3GQBA 1MSGA 2FFKB 4EQNA 1YNNC 3U9SA 5CV6A 4TSSA 2WACA 3H09A 1IYVA 3S1MB 1YNJC 2EYPA 3DWAA 2EYOA 3HKZB 1LTRD 1DJRD 4DNRB 3I4MB 2NVQB 2A69C 2IW3A 3HOZB 4WORA 4ZKCB 2IX1A 4X3SA 3RZOB 4ULLA 1GHKA 3IFDA 2I46A 5D3DA 1RHPA 1ENFA 1PFBA 2Y0SB 1MD2D 2IT1A 4M8AA 1O7YA 2EE1A 1LO5D 2O5IC 3Q24A 2B2WA 4LK1C 4RAUC 2IX3A 2BCOA 3DEPA 1EEFD 1PTOB 1SJHD 2K01A 2NYZD 3J80L 3T4AC 1O7ZA 2M9VA 1DD2A 2KOLA 2L1BA 5IODA 2JA7B 1TVXA 5CBEE 5E4WC 3NBHA 4G4KA 4X3UA 3SXHA 1SDFA 1SE3A 1DZ1A 4BBRB 1BO0A 1JWMD 1R4QB 3C2PA 3KLSA 5AFWA 5I4DA 4RFBA 4IZ8A 5NUCA 2VB2X 5D65A 4HCSA 2EY2A 2F0LA 3QIAA 1SMYD 1EWHA 3K58A 1ONLA 2O4XA 4A3IB 3SE0A 2ZT9C 4ID6A 2AUJD 3MFGA 1D5MC 2L9HA 1F2MA 1KTKA 1DOMA 4K5XA 1VDZA 2K32A 4NKLA 3L3OC 1M4VA 4ZRZA 1PRTC 3W2DA 4PQXA 4LJZC 2EJMA 1Y1WB 1JB3A 4XQJA 3R3OA 1NAPA 3E6ZX 3HZXA 1T5EA 2F0IA 1VMPA 4OIJA 1J8IA 4RCNA 3T16A 5DNFA 4DGZA 4B9XA 4G57A 2JSOA 1RKNA 4NP5A 2M2LA 4K5WA 4A93B 1PFMA 3EJIA 4N9PA 4L63B 1EY5A 3DM1A 1BCPD 4NDXA 5C5MA 1G6ZA 3GTJB 2EY1A 1YNND 1EZ8A 2AWOA 1EFID 4AYBB 5EKLA 3A8JE 4XTCS 1J9OA 2EVBA 4K5VA 2PW5A 5J39A 4K2KA 4QUFA 4HCEA 3S2HB 3VA5A 4EVOA 1GOZA 2B2WC 4K6DA 1CTMA 5I2YA 2K03A 3TMEA 3K59A 1SYCA 2JXMB 2DNCA 2JE6I 1ZYRD 1BBXC 1QCBD 4CKEA 4V0BA 3MXNA 5CGKA 1JR0D 4FF1A 3P7JA 1PTOF 1QNKA 2EY5A 4ZUIA 1SJED 1OXXK 2CQAA 5G3LD 1JC7A 2L11A 3IFTA 1KDAA 4KY7A 1E2ZA 4C1NK 3SK5A 5FO7B 1LTTD 2NVYB 1GHJA 1X32A 3H91A 2NVXB 1TS3A 1CZWA 3R93A 2HCIA 4KD3A 5T1IA 3MFYA 1O80A 1SBBB 3NTHA 2NB0A 1CT1D 4KD4A 4HSVA 1JE4A 2L5TA 3K5LA 1ZYRC 2F0QA 4A3JB 3TDQA 3MVVA 1WTOA 4FF3A 5FOBB 5EQ0A 3HG9A 1WTPA 3Q0AA 4BA1I 1VF7A 3J7AV 4RHRA 5CV8A 2B2TA 3OWFA 3T13A 4HEDA 1ZXTA 1KDCA 2F0JA 4RHSA 2B2UA 2NN6H 1PRTB 1EY9A 2A69D 1TS2A 2D62A 2A73B 3BYTB 3OW7A 5EBDA 4E6IA 5CR3A 5EJWA 3CRKC 5JOBA 4XIGS 5IGCA 5I6YA 4PMBA 1I4RA 5BN4A 3HS0C 2XWJB 3CU7A 3H6MA 3S1NB 2HUGA 3GTOB 1JOOA 1DCZA 4BY1B 2E2DC 5KNBA 1II3A 2HCCA 1F2YA 1LTSD 3D4DA 1HPCA 2EYFA 2OXPA 3OIPA 3VYSA 3PUWA 5FLXL 3TBIB 1TS5A 2PPBC 4WJWA 2KJXA 4H13C 3D8GA 5I2XA 1A15A 3UI2A 1RTOA 3I91A 1B50A 2RSNA 1W6KA 1RD9D 4QF4A 4C3JB 2D2CC 5EGTA 1X3QA 3Q23A 3S2DB 1KLUD 1ICWA 1B53A 3QJYA 4LAAA 2OT2A 2C5CA 3S9WA 1PLFA 3FPPA 5EKKA 2EYLA 2WINB 4EQPA 4KHZA 4K14A 1U4MA 2B63B 2E2HB 4H44C 1CHPD 2L4NA 3V05A 4XT1B 4TRDA 3KK7A 4KKTA 5IGFA 2K6AA 4A3FB 5KIXA 1KDBA 5IGGA 1LTGD 3URYA 1QE6A 4FP5D 3Q6SA 5HGTA 4DFAA 4CBVA 5JEAH 5FO8B 5CMDA 2WAQB 2PZUA 2LMCB 4RGTA 3S1QB 2GA4B 2PO4A 1Q12A 1JOQA 2AQ2B 5CV7A 3E0JA 3NXWA 1SYFA 2L55A 1PZKD 5J1ZA 5COYA 1EYCA 4C3IG 5F2DA 2XWBB 4RH6A 3PIO3 2QCPX 2JA5B 4OO1I 1RODA 1D2BA 1BCPB 3HP3A 1CA6A 4FYDA 1SNPA 2MUYA 1HHVA 2K7VA 1IL8A 1K8OA 2QKIC 3TP6A 1RF2D 4Q0FA 1RJTA 4G7OC 5CV4A 1L0YB 1DM0B 5KNCA 2YYZA 4OHJA 1SNMA 2KEEA 1GJXA 1TY2A 1A3TA 4ABNA 1SEBD 2E75C 5ELCA 4FO2A 4R8NA 3I8ZA 5EPJA 4BS9A 4J1MA 3DHQA 1AEXA 5E1FA 1TWCB 1LTAD 2BE5D 2KVMA 3IKJA 3NTKA 5IGEA 5JEAG 1NUCA 5M5XB 1GUOA 3MXPA 1I4QA 5DAUA 5EKIA 2L0CA 3CKIB 1NR4A 2KCCA 3L7ZC 1F2ZA 2JA6B 3FKIB 4LMQD 2BA1A 2VUMB 3GV3A 1B9MA 4ZK9B 3L9AX 3WDNA 2F0GA 1LT3D 3BYYB 2B2VC 2FHTA 4PMCA 3MWYW 1PYWD 3BVMA 4RGNA 2Z8LA 1B9NA 4DF7A 3A8KE 2WIIB 2LKVA 1FGBD 5FKAC 3N52A 3CRLC 3PUXA 2EY6A 2F0PA 1TWFB 3OPOA 4KKUA 1OXSC 5D3IB 1CM9A 2NZ1D 4WRDA 3JAME 5CYUA 2E2IB 1TS4A 4KHVA 4CHTB 2EZVA 4FNFA 2PW7A 4EQOA 4WFN3 3MA2B 3TZUA 3ONAB 5C0XH 2RDGA 3NUCA 5JVH3 3BG3A 2QEJC 2VXWA 1QJOA 1ZKOA 1HFNA 1IHZA 1UNSA 1EY0A 1QOHA 2Q8IB 4KV6A 3P1HA 2B2YC 1STYA 5EPLA 2MPMA 2K5WA 1B1ZA 2F0MA 4QMGA 3V96A 4CGYB 1I3QB 1V43A 3K5OA 1E2VA 1WCMB 5C44B 3BDCA 2R92B 1JICA 3Q22A 4FXKC 2A6HC 3K5MA 1V1OA 3NHHA 2OF1A 1CFMA 3HOXB 2F0UA 4DK0A 3PMFA 1BCPC 3PUYA 2F0VA 4CJ1B 4F87A 4C3HB 2C9OA 3NQIA 4DA2A 2QDBA 2K05A 3IAYA 1EQTA 5M3MB 1Y69U 3X3NA 3RLFA 4U68A 4NW2A 1HTLD 2LFNA 2KHSA 4A3BB 3J7AF 3OMCA 4RGOS 4YIJA 1BDOA 1G2SA 1JOKA 3HOVB 1WVLA 3K57A 1LV9A 5C4HA 1XTCD 2VB3X 1F2LA 1H9JA 5EPKA 3R2IA 2ZXRA 3LX0A 1AZQA 1Q90A 4IURA 4HR7B 1PMRA 2HDLA 1RDPD 3T56B 1JCKB 3QO2A 3SHLA 2ICIA 4IUTA 1F9SA 4HMJA 2LY7A 4XQNA 5LL6S 1QG7A 5C4JB 2A68C 5C0XJ 3C1EA 3EQLC 3VYUA 1H9SA 2QILA 2KQ3A 2D5DA 5A2QL 2CW0D 1D6EC 3MXUA 1EYDA 1L0XB 2PZTA 5KNDA 2R61A 1FNWA 1WTXA 2O5JC 1PZID 1MBYA 1H9RA 3R2TA 3VR3A 4BY7B 1Y8OB 1G8ZD 5K5PA 1PRTD 5JAVA 3QOJA 3CHBD 4U673 1AN8A 1EOTA 2VNUD 1DONA 2BDNA 3OHXC 1CQVA 2WKCA 3HOWB 1MGSA 4L6TB 4CKCA 2X6GA 5IGBA 3OIQA 1EL0A 1SNOA 2JA8B 2ZXOA 5JEAJ 4KY6A 1BUVT 5C3EB 2DY7A 1BR9A 2EDGA 2NTTA 3NBIA 2MGSA 1MI2A 2MHVA 3EVQA 3LWEA 3OWEB 3J81E 3GO5A 4F7XA 3GTQB 3N6RA 1IYUA 5DM73 5M5WB 3SR1A 2KCNA 1U9RA 2EYJA 1V1PA 3PO2B 4IFDG 3TP5A 5M5YB 4X3TA 1DYQA 3AU7A 4IQZA 2B2YA 2O2LD 4KK7A 3FPUB 4DNTB 5CORA 1D1IA 1ENAA 1O7LA 3H3VC 4Q5VA 1BQQT 4IFDI 3DXJC 4ZAIA 3DMUA 1EIGA 2J7ZA 3MXGA 1G2TA 1AZPA 1RTNA 2SDFA 1CK1A 4DXGA 3JAML 4FXGC 1U4RA 1GUWA 5T1GA 4QUCA 3PUZA 3E5SA 2AWNA 1S4ZA 1CZGA 1FNVA 2BA0A 1EU3A 1LTBD 3ITPA 3K5NA 2B39A 2K33A 1HQRD 3RMHA 5A35A 3VYRA 1F9QA 2EJFC 1EU4A 4V190 3EROA 2FINB 3AMUA 5ELFA 3DWQA 1BNZA 2TMPA 3GD7A 3SK8A 1H9KA 1UUPA 2JEAI 4BBSB 1CHQD 1XX8A 1GUSA 2FJ2A 5IT9L 5C5LA 4OIKA 4A3MB 3NE5B 1ET6A 1EQVA 3S14B 4KY5A 1B2TA 4ZKBB 1TY0A 4DN4M 2K04A 3S17B 1SYDA 3VR6A 4JBWA 3V2TA 2SNMA 2F0HA 1KAAA 1EY6A 4F88A 2RDFA 1Z7TA 1TWAB 1PDQA 1RCVD 2FMCA 3G7LA 1STNA 5A2QE 4PNYA 1TWHB 1GUGA 2R93B 4IUQA 1XXGA 3GTPB 4C2MB 4NMZA 1BCPF 1HQMC 2WV6D 5FLXE 4H7BA 2FMMA 1I4XA 1SSOA 1ML0D 1PTOH 3I73A 4IN3A 2EYMA 4OL7A 3I4LA 2RKSA 3I4NB 1PXUA 3VYTA 1S5CD 5K36G 2QF7A 1B3AA 4XDXA 1TT2A 3OMGA 3J81L 3FRPB 2RBMA 3ZYYX 3MC0B 2F3VA 3J80E 3M85A 5LL6X 1C48A 1UEAB 4DXFA 1HA5A 2PCFB 3W3AA 3QG1A 4G7HC 3K7AB 1FYCA 5I9OA 3P75A 1PRTF 5IT9E 1WD1A 3NWSA 1U4PA 3D3RA 2R3ZA 2XSCA 2YU9B 3GTMB 2F03A 1EEID 3G6JB 4OO1G 1PTOC 2EYHA 4RKLA 5CBAE 4C3IB 3NQTA 1JORA 1I4PA 3SDZA 3C1FA 4UAIA 2F0OA 2CVRA 1EIHA 5E3FA 1Y1VB 3A54A 3TP7A 3HGBA 4KKSA 2NVTB 2F0DA 2Q8RE 2F0KA 5I9PA 1SYEA 1HCZA 3LNNA 2NWGA 1R4PB 4F8MA 2F0FA 5KGUA 2F1MA 1A3UA 2KECA 1WD0A 5C4ZA 4GZYC 1AP0A 1LT4D 1LT5D 1TWGB 2PYKA 5K36H 1K8MA 1WTVA 3C46A 3I72A 3PUVA 5JPMC 1IKLA 3MTSA 1S5FD 1STEA 3D6CA 3VR5A 3D31A 2F4IA 3A56A 1E0BA 3MAQA 1BOSA 1OXVA 5FK9C 2K5DA 4HSPA 3S15B 1GXDC 4MHEA 4KTAA 2HQEA 5ELDA 1WTWA 3ND9A 5LHY1 1DOKA 4RGMA 5IIFA 4HMIA 2N88A 3GTGB 4IUUA 3LWUA 1X3PA 5BN5A 2E2JB 5CV5A 2AUKA 3GV6A 3QWNA 4A3GB 1GUNA 2KEDA 3ERQA 1PZJD 2WP8J 1A3VA 3BS1A 3IL8A 1LLRD 4HTHA 4O42A 4IUVA 1EZ6A 1Y8NB 1SE4A 2B2UC 2K1BA 3VR4A 2NN6G 4UDUC 3S1RB 1JQYD 4TQUS 3OSOA 3FVQA 5ISRA 1Q8IA 2E74C 2G9HD 2IWHA 1EY8A 5G3LF 3RD4A 1IW7C 2RVLA 3GTLB 1VMCA 3T51B 1YNJD 1LABA 2A6ED 3PV0A 2WB1B 4RA8A 4PMWA 5BN3A 3U9OA 3HEJA 1SFOB 5KEEA 5IGDA 5C6AA 3KUPA 1M8AA 1ESRA 2ZXPA 2R6GA 4DAYA 1EYAA 1H9MA 3D6WA 4ILWA 2M00A 3M4OB 4RKBA 2EXZA 2F3WA 3EFXD 3TSSA 4KN7C 2Z4HA 4ZUJA 3VA7A 4C3HG 3HOUB 1EWCA 5CV9A 2D9UA 4PV1C 3DUZA 1LTID 3KLRA 2AQ3B 1SNCA 3NK9A 2DNEA 2PMZB 4MN3A 1BF4A 1V1PB 1VF5C 4IUNA 1STBA 1DOLA 3NPPA 2DN8A 2CHBD 4MIUA 3BVGA 1KLGD 3SK4A 2XRSD 3I90A 2BE5C 3M7NA 2A74C 4HAEA 2IX0A 4A3KB 2NUCA 3BDOA 2N55A 4BWGB 3NSWA 2EPBA 4BA2I 2V4DA 5M9OA 1HXYD 3MHBA 2J4XA 4ZYSA 2MP1A 4G7ZC 2CW0C 1FR3A 3CQZB 1F9RA 4XQQA 1FD7D 1SAPA 3GP7A 3SEBA 1C8CA 3HRZC 2RSOA 1SYBA 1ZEQX 2A6HD 4DK1A 4K6LA 2RQXA 1KNAA 2XVSA 3T53B 5JVG3 3M3YB 3I70A 5KYLA 1MSHA 1HA6A 4XXEA 3WOFA 4H0LC 2BOSA 1JWSD 3BDLA 4A3EB 2SEBD 3A7LA 5CC4A 4ZQ3A 2F0EA 1I6HB 1Y8PB 4OGQC 4Z9CB 1KNEA 5C3XA 1STHA 1Q3LA 1LT6D 2RA4A 1C4QA 4B08A 2F0TA 1OXTA 1I50B 3FDTA 2J0TD 2JP1A 3D4WA 1W6JA 5DM63 2NBFA 1HTPA 2RDHA 4ME5A 4KJOA 1CA5A 2NN6I 2F0SA 1I4HA 1A2TA 4ZLTF 3SVMA 3WOEA 4C1NI 1OO9B 2JEBI 5C0XI 1I4GA 2B8GA 3EA6A 2F0WA 1D5ZC 3GTKB 2PZWA 4IFDH 5KRUA 1B4OA 2K5QA 4XYOA 1S5BD 4QCLA 2B2VA 4I7ZC 1F77A 1STGA 2G9DA 4O1NA 1LACA 1G291 2XNAC 3F2UA 1QNUA 1SE2A 3TZDA 4XYQA 4IUPA 1E2WA 4L8JA 1PTOD 4KN4C 4XT3B 4CJ0B 3TP8A 5HURA 1A6XA 3PO3B 1XWEA 2MJ8A 5JJZA 1HRJA 1CQFA 3NP8A 3O13A 1F9PA 1I6VC 1TKWB 3KBGA 4RWSC 1HUMA 2PNRC 3AB9A 1NCVA 4KMUC 5ELEA 1DXMA 3RZDB 1Z47A 3TN2A 3HOYB 3FMCA 3C3LA 1B44D 1PFNA 3FEWX 3H94A 4A3DB 5C4XB 2K28A 2EOTA 5C0XG 2E76C 4FF2A 1SNQA 4J8QA 2XRQD 3A55A 4N9TA 5M3FB 1SXTA 2ID0A 3MZ5A 2H4OA 1TQOA 4FVMA 3NWTA 1ILQA 1H9SB 4C3JG 3VR2A 3RUZA 4DAVA 3KBXA 4K8IA 4KJNA 4C56C 2BDOA 2IJ0A 3H0GB 1Z6HA 4S3SA 2ICEC 3DWPA 1CI3M 1WTRA 2WKDA 3I3CA 2XIWA 1GUTA 5TSSA 3M7GA 1WTQA 4Y7NB 1U4LA 2XN9C 1S5ED 5ELBA 1V8QA 3K0YA 1JWUD 3M4YA 1D5XC 1STAA 5I6WA 2A68D 3A7AB 1HFGA 5DEHA 2TSSA 3KF8A 2Z4IA 1NR2A 1FNUA 1EY4A 4ODGA 3DEOA 2KA7A 3R8BA 4M1UB 1K83B 1AFPA 3K6OA 5JPNC 4CKBA 1T5XD 4K2LA 1UAPA 1O78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9J A;  4G7O C;  1ZYR C;  4TKO B;  2AWO A;  2DN8 A;  3QJY A;  5KNC A;  5C0X G;  3D4R A;  3N6R A;  1IYU A;  2YYZ A;  2E76 C;  3NE5 B;  1Q1B A;  3A8I E;  3FPP A;  4JK1 C;  1GJX A;  1HTP A;  1Q90 A;  1Y8N B;  2Q8I B;  4HR7 B;  2BE5 C;  1OXU A;  2E75 C;  1PMR A;  2L5T A;  3A8J E;  3P20 A;  3VR4 A;  4BA1 I;  3M7N A;  2NN6 I;  2NN6 G;  4OO1 G;  4XTC S;  3T56 B;  1VF7 A;  3GQB A;  2EVB A;  4IFD G;  4KHZ A;  3VR6 A;  4TQU S;  3SDZ A;  3BDO A;  2JEB I;  4IQZ A;  4H44 C;  1VCI A;  1SMY C;  4JBW A;  1YNN C;  3U9S A;  2BE5 D;  2E74 C;  1H9S B;  4OO1 H;  2B8G A;  2NN6 H;  3VR2 A;  1Z7T A;  3IKJ A;  4KKT A;  4DNT B;  1IW7 C;  1IYV A;  3HGB A;  4G7Z C;  2A69 D;  5JEA G;  2A68 C;  3QIA A;  4KKS A;  2D62 A;  1O7L A;  2V4D A;  4BA2 I;  4IFD H;  3OW7 A;  1CTM A;  1EWH A;  3EQL C;  1V43 A;  1GUO A;  3T51 B;  1E2V A;  1ONL A;  3CRK C;  1YNJ C;  4XIG S;  2KCC A;  3L7Z C;  1H9S A;  3DXJ C;  1HCZ A;  3LNN A;  2JXM B;  3SE0 A;  2BDO A;  2DNC A;  1LAB A;  2A6E D;  2D5D A;  2ZT9 C;  2JE6 I;  2CW0 C;  3PV0 A;  1Z6H A;  2BA1 A;  1GUG A;  4DNR B;  5BN4 A;  5JEA H;  2A69 C;  1FR3 A;  2A6H C;  5BN3 A;  2AUJ D;  3MXU A;  1B9M A;  1HQM C;  2F1M A;  3WDN A;  4I7Z C;  2LMC B;  1CFM A;  5KND A;  1CI3 M;  4GZY C;  1DCZ A;  1VDZ A;  2K32 A;  2O5J C;  3I73 A;  1Q1E A;  5KNB A;  1LAC A;  2A6H D;  4DK0 A;  4DK1 A;  1GHK A;  1G29 1;  1GUT A;  1Q12 A;  5K36 H;  1H9R A;  1K8M A;  3VR3 A;  4KI0 A;  1HPC A;  1Y8O B;  3OOC A;  3I72 A;  3PUY A;  3T53 B;  1V8Q A;  3PUV A;  1B9N A;  2EJM A;  3PUZ A;  3I4L A;  3A8K E;  4LJZ C;  2R6G A;  1H9M A;  3PUW A;  2IT1 A;  1E2W A;  3VR5 A;  3ND8 A;  3D31 A;  3M4Y A;  4L8J A;  1T5E A;  1ZKO A;  2A68 D;  4KN4 C;  1OXV A;  5K36 G;  3A7A B;  1OXX K;  3CRL C;  2QF7 A;  3PUX A;  2BA0 A;  4H0L C;  2O5I C;  3OPO A;  4KKU A;  1A6X A;  1TU2 B;  1OXS C;  4LK1 C;  2PPB C;  2B8F A;  3ND9 A;  4KN7 C;  1Y69 U;  2K33 A;  3A7L A;  3IFT A;  4RCN A;  3RLF A;  5A35 A;  4H13 C;  1FYC A;  3VA7 A;  1Y8P B;  2KA7 A;  1E2Z A;  4OGQ C;  2EJF C;  3M85 A;  1I6V C;  1GHJ A;  1TKW B;  3LWU A;  2PNR C;  3AB9 A;  2EDG A;  3TZU A;  4PV1 C;  5BN5 A;  1BDO A;  1IW7 D;  2K7V A;  3KLR A;  4KMU C;  1DXM A;  1OXT A;  2D2C C;  5C0X H;  2AUK A;  1DD2 A;  2DNE A;  3MFY A;  1K8O A;  2EJG C;  2PCF B;  3W3A A;  3QG1 A;  3GD7 A;  3H94 A;  1H9K A;  2JEA I;  4G7H C;  3BG3 A;  1GUN A;  1VF5 C;  2A6E C;  3FMC A;  1QJO A;  1GUS A;  1O78 A; 
#chains in the Genus database with same CATH topology
 3S16 B;  5IOC A;  2R7Z B;  3KLS X;  3UDF A;  4DV2 Q;  1PV4 A;  3HOV H;  2OQK A;  3SK6 A;  1Q1B A;  3A8I E;  4JK1 C;  1N34 Q;  1IKM A;  1ENC A;  4P71 A;  2R7D A;  2F0N A;  4QIW B;  4L5S A;  5D14 A;  4MTK A;  5E4X A;  4IAL A;  1AW7 A;  3NTI A;  1KAB A;  2X69 A;  2R93 H;  3X3M A;  3M4P A;  3HOW G;  1QWY A;  1SMY C;  1VCI A;  2Q8T A;  5IY0 A;  5J22 A;  1QIL A;  4I7A A;  3BZD B;  4P2C B;  2ZJR A;  4OO1 H;  3QB3 A;  1ILP A;  4H02 A;  2ENB A;  2PQE A;  5FO9 B;  2KUM A;  4RCO A;  3HKS A;  4DV5 L;  3PO3 H;  1NMF A;  1SND A;  2AQ1 B;  2CWA A;  2WB1 E;  1KRS A;  5FLM G;  1K0R A;  2L12 A;  3B6Y A;  3KDF A;  1TR5 A;  3QOL A;  1R9T B;  4EGV A;  4K8J A;  2LS0 1;  2Z1C A;  2JYO A;  1A8V A;  1A2U A;  2H1E A;  3K7U C;  5C3W A;  3G71 A;  1HNX Q;  4DU9 A;  2IL8 A;  1EY7 A;  4UP9 A;  1G91 A;  2B3G A;  1ET9 A;  2DY8 A;  1JT8 A;  5KYI A;  2SNS A;  3JC6 6;  1Q1E A;  4NXN L;  4R4O A;  3J7Y W;  4AYB G;  2KHJ A;  4JG2 A;  3T1Y L;  1SYG A;  4KI0 A;  2HDM A;  1BXT A;  4FF4 A;  2IHF A;  1UE7 A;  3OOC A;  5EBC A;  1QB5 D;  1WYD A;  4YWL A;  2X6L A;  3S1M H;  4I65 A;  3ND8 A;  4DAP A;  2Y0S G;  3BVZ A;  3J81 i;  2NTS A;  1HUN A;  3J7A 5;  1ESF A;  1J5E L;  2R7F A;  5BR8 L;  3CC7 A;  2YTY A;  1TU2 B;  4JBK A;  2B8F A;  1S5D D;  2OEO A;  1ASZ A;  2B2T C;  4DUY Q;  3FHW A;  4R9W A;  4X3K A;  1XYI A;  2A5H A;  4QJF A;  1IW7 D;  4FXD A;  5LMN L;  4J6H A;  4IFD J;  1IBK Q;  3S1R H;  2EJG C;  1D1K A;  2I07 B;  3MEH A;  1VQF A;  4R8I A;  3PQI A;  3PIP 3;  4DR1 Q;  4CJ2 C;  2A6E C;  2SOB A;  3F1Z A;  1S72 A;  5LMU Q;  1TII D;  4TKO B;  2NZH A;  3D4R A;  3OTO Q;  2IPK D;  4A76 A;  1PH5 A;  1VQJ A;  4B9W A;  3QR8 A;  3HOW H;  4QB4 A;  1NSN S;  1OXU A;  3P20 A;  4HN7 A;  1VQG A;  1IXR A;  3GQB A;  1MSG A;  2K14 A;  2FFK B;  2K4K A;  2OCE A;  1UE1 A;  4EQN A;  4DUZ L;  1YNN C;  3U9S A;  4LFA L;  3BU2 A;  5CV6 A;  3G4S A;  4UP8 A;  3KYH C;  4TSS A;  2WAC A;  3H09 A;  3GDE A;  1B3Q A;  3PF5 A;  1IYV A;  2VW9 A;  5IYC G;  4CDE C;  1CKM A;  3S1M B;  4DR2 L;  1YNJ C;  4DV4 Q;  2EYP A;  4C3J H;  3DWA A;  2EYO A;  3HKZ B;  1LTR D;  1DJR D;  4DNR B;  1VQH A;  3I4M B;  2NVQ B;  2A69 C;  4A3G G;  3BZC A;  2IW3 A;  3HOZ B;  4WOR A;  4ZKC B;  3F2C A;  2IX1 A;  4X3S A;  4DAY B;  2R7Z H;  3RZO B;  2OQ0 A;  1PFS A;  4ULL A;  1GHK A;  3IFD A;  2I46 A;  5D3D A;  1RHP A;  2YTX A;  1ENF A;  4WJ4 A;  1PFB A;  3ULL A;  2HD3 A;  2Y0S B;  1MD2 D;  2IT1 A;  4M8A A;  3PIO A;  1MIU A;  5GAG C;  1O7Y A;  3NBH B;  1W2B A;  2NVX H;  2EE1 A;  2ALY B;  1LO5 D;  3I56 A;  2O5I C;  3Q24 A;  2B2W A;  4LK1 C;  4RAU C;  2IX3 A;  2BCO A;  3DEP A;  1EEF D;  1PTO B;  1SJH D;  5C3E H;  4X6A H;  1QZG A;  2KEN A;  1E24 A;  2K01 A;  2I5L X;  2NYZ D;  3J80 L;  1PH9 A;  3CCV A;  2JQO A;  3T4A C;  3M3Y H;  1O7Z A;  3CCQ A;  2M9V A;  1DD2 A;  2KOL A;  2L1B A;  5IOD A;  2JA7 B;  1GKH A;  1TVX A;  2KBN A;  2Z0S A;  5CBE E;  3KLW A;  5E4W C;  1TWA H;  3NBH A;  4G4K A;  4X3U A;  1SDF A;  3SXH A;  1SE3 A;  1DZ1 A;  1BVS A;  4BBR B;  1BO0 A;  5C44 G;  1JWM D;  1CKO A;  1R4Q B;  3C2P A;  3KLS A;  5AFW A;  5I4D A;  1PH6 A;  4RFB A;  2K5H A;  4IZ8 A;  5NUC A;  1XJV A;  1N9W A;  2VB2 X;  2CH4 W;  1RL2 A;  4YWK A;  5D65 A;  1U0L A;  2R92 G;  4HCS A;  2EY2 A;  2MO1 A;  1XPO A;  2F0L A;  3QIA A;  3CCR A;  1SMY D;  1EWH A;  3CC2 A;  1SRU A;  3K58 A;  1ONL A;  2O4X A;  2RF4 A;  4A3I B;  4GN5 A;  3SE0 A;  2ZT9 C;  3HOZ H;  2UXD L;  3U4V A;  4ID6 A;  2AUJ D;  3MFG A;  3RZD H;  4JI7 L;  1D5M C;  4LF6 L;  2L9H A;  2HHH Q;  4BXX G;  5FLM H;  1F2M A;  3L0O A;  4DR2 Q;  2JJQ A;  1KTK A;  4K5X A;  1DOM A;  1VDZ A;  2K32 A;  4NKL A;  1I3Q H;  3L3O C;  1M4V A;  4ZRZ A;  1PRT C;  3W2D A;  4PQX A;  1PA6 A;  4LJZ C;  2EJM A;  2DUD A;  1Y1W B;  1JB3 A;  4XQJ A;  3R3O A;  1NAP A;  4YY3 Q;  3E6Z X;  4JI1 L;  4DR4 L;  4DR6 Q;  3HZX A;  4GNX B;  1T5E A;  2F0I A;  3PSI A;  2CWP A;  4P75 A;  5C3E G;  2Z6B A;  2NVT H;  3I7F A;  1K8A C;  4DR1 L;  2L15 A;  1VMP A;  4OIJ A;  1J8I A;  3K81 C;  4RCN A;  3T16 A;  5DNF A;  4DGZ A;  1FJG L;  4B9X A;  2BH2 A;  1C0A A;  4G57 A;  2B29 A;  2JSO A;  1RKN A;  2KHI A;  1WTH A;  4NP5 A;  2M2L A;  4K5W A;  4A93 B;  3GTO H;  1PFM A;  3EJI A;  3F2D A;  1DGS A;  4N9P A;  2PMZ E;  1VQD A;  1HNZ L;  4L63 B;  1HNW L;  1EY5 A;  3DM1 A;  5JJK A;  1BCP D;  4NDX A;  5C5M A;  1G6Z A;  1HR0 W;  3GTJ B;  2EY1 A;  1K0S A;  4IOC A;  3HOY H;  1YNN D;  1EZ8 A;  2JA6 G;  2AWO A;  1EFI D;  4AIM A;  4NXM L;  4NXM Q;  3RLO A;  5DLQ E;  4AYB B;  4HJ5 A;  4HID A;  5EKL A;  3A8J E;  1N33 L;  4XTC S;  4LUV A;  1XNQ Q;  1J9O A;  2EVB A;  4K5V A;  2PW5 A;  5J39 A;  4IPG A;  1J5E Q;  1C7Y A;  4K2K A;  1HR0 Q;  4MTN A;  4QUF A;  4HCE A;  3S2H B;  3VA5 A;  4EVO A;  1VQA A;  1GOZ A;  2B2W C;  4K6D A;  3A0J A;  3HOZ G;  1X65 A;  1CTM A;  5I2Y A;  2K03 A;  5IP9 G;  3TME A;  3K59 A;  1VQP A;  1SYC A;  2JXM B;  5ELN A;  2DNC A;  3U4Z A;  2JE6 I;  1XMQ L;  1ZYR D;  1BBX C;  4R4T A;  1QCB D;  3FKI H;  4GLX A;  3J81 j;  4K0K L;  3TQY A;  4CKE A;  4V0B A;  3MXN A;  1X6O A;  5CGK A;  1TWG H;  1JR0 D;  1Y14 B;  4A3G H;  4C3I H;  2QDL A;  1KD1 C;  4FF1 A;  3P7J A;  1PTO F;  4DV2 L;  1QNK A;  2EY5 A;  1XPR A;  4ZUI A;  3H0G H;  1SJE D;  1OXX K;  2CQA A;  2ZTC A;  1KRT A;  2OWO A;  1XPU A;  5G3L D;  4JI6 Q;  1JC7 A;  2L11 A;  1L1O C;  2F3I A;  3IFT A;  1KDA A;  4KY7 A;  5M3M H;  2V1C C;  1E2Z A;  4C1N K;  3SK5 A;  5FO7 B;  1LTT D;  4HIM A;  2NVY B;  1GHJ A;  1X32 A;  3H91 A;  2NVX B;  4OX9 Q;  1TS3 A;  1CZW A;  3R93 A;  2HCI A;  4DV3 Q;  4KD3 A;  4YWM A;  4JYA L;  5T1I A;  3MFY A;  2MNA A;  1O80 A;  1SBB B;  5H1S E;  3NTH A;  2NB0 A;  3F2B A;  1E22 A;  2N78 A;  1CT1 D;  3TRE A;  4KD4 A;  4HSV A;  1JE4 A;  2L5T A;  3K5L A;  1ZYR C;  5C4X H;  2VQE L;  2F0Q A;  4A3J B;  3TDQ A;  4JI0 L;  4ALP A;  3MVV A;  1WTO A;  4FF3 A;  5FOB B;  5EQ0 A;  3HG9 A;  1WTP A;  3CCE A;  4GKJ L;  3Q0A A;  4BA1 I;  3TRZ A;  4JVZ A;  1VF7 A;  5C44 H;  3J7A V;  4RHR A;  5CV8 A;  3W1G A;  2B2T A;  3OWF A;  3T13 A;  4HED A;  1ZXT A;  1ASY A;  5IYB G;  1A0I A;  4K0K Q;  1KDC A;  2F0J A;  3NEN A;  4UPA A;  4RHS A;  2B2U A;  2NN6 H;  1PRT B;  2UUB Q;  4ME3 A;  2VUM H;  1EY9 A;  2A69 D;  1TS2 A;  1EQQ A;  2D62 A;  1IBK L;  2A73 B;  3BYT B;  3OW7 A;  5EBD A;  4E6I A;  4LNQ A;  3PF4 A;  5CR3 A;  5EJW A;  3CRK C;  5JOB A;  4XIG S;  2PI2 E;  5IGC A;  1N36 Q;  5I6Y A;  2GVA A;  4PZ6 A;  1V9P A;  4PMB A;  3E9I A;  1I4R A;  5BN4 A;  4X65 L;  3HS0 C;  3CME A;  1VQ5 A;  2XWJ B;  3CU7 A;  3H6M A;  3S1N B;  2HUG A;  3GTO B;  3W1B A;  5L37 A;  1JOO A;  1DCZ A;  4BY1 B;  2E2D C;  5KNB A;  1II3 A;  2HCC A;  1WOC A;  2UXB L;  1F2Y A;  1LTS D;  3D4D A;  1HPC A;  2EYF A;  4JI8 L;  2OXP A;  3OIP A;  3VYS A;  3PUW A;  1GD7 A;  2AKW B;  3K8A A;  2H5X A;  3STB C;  5FLX L;  1YIT A;  1K3R A;  4JBJ A;  3TBI B;  3S2H H;  1TS5 A;  2PPB C;  2PNH A;  4WJW A;  2KJX A;  5FLX c;  5C4J H;  4H13 C;  3D8G A;  2AHO B;  5I2X A;  2QW7 A;  1A15 A;  2UU9 Q;  2CCZ A;  3UI2 A;  1RTO A;  3I91 A;  2UXC Q;  1B50 A;  2RSN A;  1E1T A;  1W6K A;  1RD9 D;  4QF4 A;  4IPC A;  4C3J B;  2D2C C;  5EGT A;  1X3Q A;  3Q23 A;  3T1H L;  3S2D B;  1U5K A;  1KLU D;  1ICW A;  4FDB A;  4LF8 L;  1B53 A;  3QJY A;  4LAA A;  2OT2 A;  4A3B G;  4JI4 Q;  2C5C A;  3S9W A;  1PLF A;  3FPP A;  5EKK A;  2EYL A;  4L5Q A;  3ICE A;  2JA8 G;  2WIN B;  4EQP A;  4GLV B;  4KHZ A;  4K14 A;  1U4M A;  2B63 B;  2E2H B;  4H44 C;  1CHP D;  2L4N A;  3V05 A;  4XT1 B;  4R1J A;  1JJG A;  4TRD A;  1X54 A;  3KK7 A;  4KKT A;  5IGF A;  2K6A A;  4A3F B;  5KIX A;  1KDB A;  5IGG A;  1LTG D;  4POF A;  4DV6 L;  3F8T A;  3URY A;  1QE6 A;  2VY3 A;  3Q6S A;  4FP5 D;  5HGT A;  1KQS A;  4DFA A;  4CBV A;  2Q2T A;  3K0X A;  5JEA H;  5FO8 B;  5CMD A;  2WAQ B;  4AH6 A;  2JA7 H;  2PZU A;  4YHH Q;  4IOA A;  2LMC B;  4RGT A;  1SRO A;  2HIX A;  3S1Q B;  4GKK Q;  2GA4 B;  2PO4 A;  4DV4 L;  5ELO A;  1N32 Q;  3LGJ A;  2VQF L;  4QGU A;  3HKZ G;  1Q12 A;  3FKI G;  1JOQ A;  1TWF H;  4JI3 Q;  3CCU A;  2AQ2 B;  3EBE A;  4JPB W;  5CV7 A;  3E0J A;  1E3P A;  4LWC A;  2UUA Q;  2CH4 A;  3NXW A;  1SYF A;  2L55 A;  2VL6 A;  1PZK D;  5J1Z A;  5COY A;  1EYC A;  4C3I G;  5F2D A;  1T9H A;  2XWB B;  1P8L A;  3T1H Q;  4RH6 A;  3PIO 3;  2K52 A;  2QCP X;  2JA5 B;  4OO1 I;  1VQN A;  1VQO A;  1ROD A;  3RNU A;  1D2B A;  2AMC B;  1VQ6 A;  1BCP B;  3HP3 A;  1CA6 A;  4DR5 Q;  4FYD A;  1SNP A;  2MUY A;  2UUA L;  1HHV A;  2QA4 A;  2K7V A;  1Q7Y C;  1IL8 A;  4APV A;  1K8O A;  4NPS A;  2G5D A;  2K5N A;  4A3C H;  2QKI C;  2DJG C;  3TP6 A;  1RF2 D;  4Q0F A;  1RJT A;  4G7O C;  5CV4 A;  1L0Y B;  1DM0 B;  5KNC A;  2C35 B;  2EXD A;  2YYZ A;  2UXD Q;  4OHJ A;  1EUJ A;  1SNM A;  3CCM A;  2KEE A;  4KHP L;  1GJX A;  1TY2 A;  1A3T A;  4ABN A;  1SEB D;  2E75 C;  5ELC A;  4FO2 A;  1YVC A;  1Y1W H;  1FL0 A;  4R8N A;  1IBL Q;  3I8Z A;  5EPJ A;  1YEZ A;  4BS9 A;  1GO3 E;  1YHA A;  4J1M A;  1D7Q A;  3GTP H;  5C4X G;  2UUC Q;  4A93 H;  3DHQ A;  1AEX A;  5E1F A;  1N34 L;  1TWC B;  1HZA A;  1LTA D;  3HOU H;  2BE5 D;  2KVM A;  3IKJ A;  3NTK A;  5IGE A;  2WAQ G;  5JEA G;  1NUC A;  5M5X B;  1P16 A;  1GUO A;  3MXP A;  1I4Q A;  5DAU A;  5EKI A;  2L0C A;  3CKI B;  1NR4 A;  2KCC A;  3L7Z C;  1F2Z A;  1I94 Q;  2JA6 B;  3FKI B;  4LMQ D;  4DR6 L;  2BA1 A;  2Q2I A;  3CXC A;  1QUQ A;  5IYC H;  3JAM i;  1KAW A;  3GV3 A;  2VUM B;  4DR5 L;  3CW2 C;  1QZH A;  1B9M A;  4ZK9 B;  3L9A X;  3WDN A;  1XNR Q;  3GTG H;  2PQA B;  1L0W A;  4DK6 C;  1WCM G;  2F0G A;  3BYY B;  1LT3 D;  2B2V C;  2XGT A;  2ZM6 Q;  2FHT A;  4HJ9 A;  4PMC A;  3MWY W;  1PYW D;  3BVM A;  2E5L L;  1JJC B;  4RGN A;  2Z8L A;  1B9N A;  3S16 H;  4DF7 A;  3A8K E;  2WII B;  2LKV A;  1IZ6 A;  1FGB D;  1SN8 A;  5FKA C;  3N52 A;  2CFM A;  2N8N A;  4CDF C;  3CRL C;  3PUX A;  1UE5 A;  3CAM A;  2EY6 A;  2F0P A;  2VS1 A;  1K83 H;  1TWF B;  3OPO A;  4KKU A;  1OXS C;  3HOX G;  5D3I B;  1CM9 A;  2NZ1 D;  4RMF A;  4WRD A;  3JAM E;  5CYU A;  2E2I B;  1TS4 A;  4YHH L;  4KHV A;  5E7N A;  4CHT B;  2EZV A;  4FNF A;  2PW7 A;  4EQO A;  4WFN 3;  3I4M H;  3MA2 B;  5GRO A;  3TZU A;  1X3G A;  1LM0 A;  4GN3 B;  3A74 A;  3ONA B;  5C0X H;  2GVB A;  2RDG A;  3NUC A;  2RCF A;  4TVA B;  5JVH 3;  3BG3 A;  4OEM B;  2Z6K A;  2QEJ C;  2VXW A;  4KHP Q;  1QJO A;  1ZKO A;  4DR7 Q;  4HIO A;  1A63 A;  1HFN A;  1AE3 A;  4A93 G;  4PG3 A;  3AFP A;  1IHZ A;  1UNS A;  4YCW A;  1EY0 A;  1QOH A;  2Q8I B;  4KV6 A;  1TWH H;  4MNO A;  3P1H A;  2B2Y C;  3TS2 A;  1STY A;  1K8G A;  2E2J H;  4KLK A;  2F4V Q;  1CSP A;  2LXJ A;  5EPL A;  2MPM A;  3TS0 A;  2K5W A;  4LF7 L;  1B7Y B;  3S17 H;  1B1Z A;  2F0M A;  2N3S A;  4QMG A;  1KL9 A;  3V96 A;  3M4Q A;  4LW1 A;  3OW2 A;  4CGY B;  1QUQ B;  3CCJ A;  1I3Q B;  1SR3 A;  4JBM A;  3JAM c;  1V43 A;  3I4N H;  2ATW A;  3K5O A;  1Q8K A;  1E2V A;  1WCM B;  2R92 H;  5C44 B;  2HHH L;  4OXP A;  2K50 A;  4OON A;  1WCM H;  3BDC A;  2R92 B;  1JIC A;  3Q22 A;  4FXK C;  2A6H C;  3K5M A;  1V1O A;  1Y1V G;  4DUY L;  1GM5 A;  3NHH A;  2OF1 A;  2DJF C;  1CFM A;  1E1O A;  3HOX B;  2F0U A;  4DK0 A;  3CCS A;  3PMF A;  1BCP C;  3GTQ H;  2JA7 G;  2I5M X;  3PUY A;  1PHJ A;  2F0V A;  1NE3 A;  4CJ1 B;  4F87 A;  4C3H B;  2C9O A;  3NQI A;  4A3M G;  2I5H A;  4DA2 A;  4DNI A;  5IYD G;  1HNZ Q;  1WFQ A;  2QDB A;  2K05 A;  3IAY A;  1EQT A;  5M3M B;  1Y69 U;  1YJ9 A;  3IRB A;  3X3N A;  3RLF A;  4U68 A;  4NW2 A;  1HTL D;  3OYY A;  2LFN A;  1HZC A;  2KHS A;  4JI5 Q;  4A3B B;  1BBW A;  3KF6 A;  3J7A F;  3OMC A;  4RGO S;  4YIJ A;  1K9M C;  1BDO A;  3PGZ A;  4JOI C;  3S14 H;  4R4C A;  2FXQ A;  3W5O A;  1G2S A;  1JOK A;  1VQC A;  4P73 A;  1WVL A;  3HOV B;  3K57 A;  1JMC A;  1LV9 A;  3DLL A;  5C4H A;  1XTC D;  2VB3 X;  1XNR L;  1F2L A;  1H9J A;  5EPK A;  3R2I A;  3E0E A;  1O7I A;  2ZXR A;  3LX0 A;  1EFW A;  4GNX A;  1AZQ A;  1GVP A;  1Q90 A;  4IUR A;  3I2Z A;  4HR7 B;  1PMR A;  1CKN B;  1M90 C;  2HDL A;  1RDP D;  3T56 B;  4GKK L;  1JCK B;  1NY4 A;  3QO2 A;  1PVO A;  3SHL A;  2E2H H;  1QVC A;  2ICI A;  4IUT A;  1K28 A;  1F9S A;  4HMJ A;  2LY7 A;  4XQN A;  3EN2 A;  5LL6 S;  4HIK A;  4GOP A;  1QG7 A;  5C4J B;  1PH2 A;  2A68 C;  5C0X J;  4LFB L;  3C1E A;  3EQL C;  3VYU A;  3SGI A;  1H9S A;  2QIL A;  2KQ3 A;  2D5D A;  5A2Q L;  1VQ9 A;  3CQZ H;  2CW0 D;  3AYH B;  4Y7N H;  1D6E C;  1BKB A;  4P74 A;  3MXU A;  4JOI A;  1EYD A;  1L0X B;  2PZT A;  1VS0 A;  1YI2 A;  5KND A;  2R61 A;  4NXN Q;  4JV5 L;  1FNW A;  1WTX A;  4HJA A;  3L2P A;  2UXB Q;  4A3E H;  2O5J C;  1PZI D;  1MBY A;  1H9R A;  3R2T A;  3VR3 A;  4BY7 B;  1Y8O B;  1G8Z D;  2I0Q A;  5K5P A;  1K73 C;  5AJ3 L;  3TEH B;  1PRT D;  2ZTD A;  5JAV A;  3QOJ A;  4LF8 Q;  4X65 Q;  5IP7 G;  1W3S A;  3CHB D;  4U67 3;  2E5L Q;  1YHB A;  1AN8 A;  1EOT A;  2VNU D;  1DON A;  2BDN A;  3OHX C;  1CQV A;  2WKC A;  3HOW B;  1MGS A;  3U58 A;  4L6T B;  4CKC A;  2X6G A;  5IGB A;  3CPW A;  3OIQ A;  1EL0 A;  1SNO A;  2JA8 B;  2ZXO A;  1IBM L;  5JEA J;  3PO2 H;  4KY6 A;  1BUV T;  5C3E B;  2DY7 A;  1BR9 A;  3NEL A;  4BY1 H;  2EDG A;  2NTT A;  4UP7 A;  3NBI A;  2MGS A;  3DM3 A;  1MI2 A;  2MHV A;  3EVQ A;  4B3T L;  1V1Q A;  3LWE A;  4IJH A;  3OWE B;  4A3D G;  3J81 E;  2JA5 H;  3GO5 A;  4F7X A;  4A75 A;  4X62 L;  2P5Z X;  1Q82 C;  3GTQ B;  1B8A A;  1IYU A;  3N6R A;  1EQR A;  5DM7 3;  5M5W B;  3SR1 A;  1HR0 L;  2Q2H A;  4DV6 Q;  2KCN A;  1U9R A;  2EYJ A;  1V1P A;  3PO2 B;  4IFD G;  3TP5 A;  5M5Y B;  4X3T A;  1DYQ A;  4DR3 L;  3AU7 A;  2E8G A;  4IQZ A;  2B2Y A;  1VQ7 A;  2O2L D;  4KK7 A;  3FPU B;  4DNT B;  4GS3 A;  5COR A;  4J15 A;  1D1I A;  1ENA A;  1O7L A;  5IYB H;  3H3V C;  4Q5V A;  1G51 A;  5EAY A;  1BQQ T;  4IFD I;  3DXJ C;  1S3O A;  2Z6K C;  4ZAI A;  3DMU A;  1EIG A;  4A3E G;  2J7Z A;  5LMU L;  3MXG A;  1G2T A;  1AZP A;  2QGQ A;  4A3K H;  2F4V L;  1RTN A;  1I50 H;  4LF5 Q;  2SDF A;  1CK1 A;  4BBR G;  1HJP A;  3Q8D A;  2GN5 A;  3S1N H;  4DXG A;  3JAM L;  1UE6 A;  4FXG C;  1U4R A;  3KJP A;  1GUW A;  1LUZ A;  4PZ8 A;  2YV5 A;  2YTV A;  5T1G A;  4QUC A;  1YJN A;  3PUZ A;  3E5S A;  3UDG A;  2AWN A;  3BJU A;  1S4Z A;  4AYB E;  1XMQ Q;  1LTL A;  4OWX B;  2KCT A;  1CZG A;  1FNV A;  2BA0 A;  3PO2 G;  1PYB A;  3E9H A;  1EU3 A;  1LTB D;  3ITP A;  4BY1 G;  4X64 Q;  3K5N A;  2B39 A;  2K33 A;  1HQR D;  3RMH A;  5A35 A;  3VYR A;  1F9Q A;  1M1K C;  1X3E A;  2LSS A;  2EJF C;  1EU4 A;  4A3D H;  3A5U A;  4V19 0;  4JI7 Q;  4CDC C;  4B3S L;  1YIJ A;  3ERO A;  2FIN B;  4A3J H;  3AMU A;  5ELF A;  3DWQ A;  1N8R C;  2UUC L;  1BNZ A;  2TMP A;  3GD7 A;  3SK8 A;  1H9K A;  1UUP A;  2JEA I;  1HZ9 A;  4BBS B;  1CHQ D;  4IJL A;  1XX8 A;  1VQ8 A;  1GUS A;  2FJ2 A;  5IT9 L;  5C5L A;  4DV7 L;  4OIK A;  4A3M B;  2BH8 A;  3NE5 B;  1ET6 A;  1EQV A;  3S14 B;  3CF5 A;  3S2D H;  4KY5 A;  1B2T A;  4DAM A;  1D8L A;  1MHW C;  4L5T A;  4ZKB B;  1TY0 A;  1EYG A;  3D0F A;  4DN4 M;  2N49 A;  2K04 A;  3S17 B;  1SYD A;  3VR6 A;  4JI4 L;  4JBW A;  3V2T A;  2SNM A;  3KFU A;  4DR4 Q;  2F0H A;  1KAA A;  1EY6 A;  4F88 A;  4YY3 L;  2RDF A;  2JA8 H;  1Z7T A;  1FJG Q;  1TWA B;  4A3K G;  1PDQ A;  1RCV D;  4A4I A;  2FMC A;  3G7L A;  1STN A;  5A2Q E;  4PNY A;  1X9N A;  3PCO B;  3EIV A;  1TWH B;  2WAQ E;  1GUG A;  2R93 B;  4IUQ A;  1XXG A;  1VQI A;  3GTP B;  4C2M B;  1VQM A;  4NMZ A;  1BCP F;  1HQM C;  2WV6 D;  4LF7 Q;  5FLX E;  4AQY L;  4H7B A;  2FMM A;  1I4X A;  1IBL L;  1SSO A;  1ML0 D;  1PTO H;  3I73 A;  5GAH C;  4IN3 A;  2EYM A;  4JI3 L;  4JYA Q;  1NTG A;  4OL7 A;  3MXN B;  3I4L A;  2JN4 A;  2RKS A;  1A62 A;  3I4N B;  1PXU A;  5M5Y H;  3VYT A;  1S5C D;  5K36 G;  4BBS G;  2QF7 A;  3CPF A;  1B3A A;  4XDX A;  1TT2 A;  4GN4 B;  3OMG A;  2UUB L;  1IYJ B;  3GTK H;  3J81 L;  3FRP B;  4Y52 H;  5IP7 H;  4A3J G;  2RBM A;  3ZYY X;  1HH2 P;  3MC0 B;  2F3V A;  3J80 E;  5FJ8 G;  5LL6 X;  3M85 A;  1C48 A;  1E7Z A;  3K7A H;  4RG1 A;  5M5W H;  1UEA B;  4DXF A;  1HA5 A;  2PCF B;  3W3A A;  3QG1 A;  4G7H C;  3K7A B;  3GTJ H;  1FYC A;  2ZJQ A;  4WJ3 M;  5I9O A;  4JI1 Q;  4DKA C;  3P75 A;  1PRT F;  1PH7 A;  4QY7 A;  5IT9 E;  1WD1 A;  1VQB A;  2ASB A;  3NWS A;  1U4P A;  3D3R A;  1UWV A;  2R3Z A;  2XSC A;  2YU9 B;  2F52 A;  2JA5 G;  3GTM B;  2F03 A;  1EEI D;  3G6J B;  3HOY G;  4OO1 G;  1C9O A;  1I94 L;  1PTO C;  4DV3 L;  2EYH A;  2JA6 H;  4RKL A;  5CBA E;  4C3I B;  3KF6 B;  3NQT A;  3CC4 A;  4JC0 A;  1JOR A;  1I4P A;  3SDZ A;  3C1F A;  4UAI A;  4YCV A;  2D0P A;  3CD6 A;  2F0O A;  1SE8 A;  1KHI A;  2CVR A;  3KDF B;  1B70 B;  1EIH A;  3G6E A;  3UE0 A;  5E3F A;  1Y1V B;  3A54 A;  4OEL B;  3TP7 A;  3HGB A;  5HGQ A;  4KKS A;  1TWC H;  2NVT B;  2F0D A;  2Q8R E;  3AEV A;  2F0K A;  1XMO Q;  5I9P A;  1SYE A;  2EQS A;  4OX9 L;  1EIF A;  4B3M Q;  4B3S Q;  1HCZ A;  3LNN A;  3RN2 A;  2NWG A;  1R4P B;  4F8M A;  2F0F A;  2K75 A;  5KGU A;  2F1M A;  1A3U A;  2CQO A;  2KEC A;  5IP9 H;  1WD0 A;  5C4Z A;  4GZY C;  3G48 A;  1CKN A;  1AP0 A;  1LT4 D;  2YU9 H;  1LT5 D;  3GTM H;  3STB D;  4HJ8 A;  4X66 L;  5JJL A;  1TWG B;  2PYK A;  5K36 H;  3ULJ A;  1K8M A;  4LFC Q;  4BBS H;  1WTV A;  3C46 A;  3I72 A;  3WWV A;  3PUV A;  1X55 A;  1IKL A;  3MTS A;  1CSQ A;  5JPM C;  1S5F D;  1STE A;  3D6C A;  4O0A A;  3VR5 A;  3D31 A;  2F4I A;  3GTL H;  2HQL A;  3A56 A;  1E0B A;  4IO9 A;  3MAQ A;  1PH1 A;  1BOS A;  1X3F A;  4HSP A;  1OXV A;  2K5D A;  3A5Z B;  5FK9 C;  3S15 B;  1GXD C;  3S24 A;  4IPH A;  4MHE A;  3S15 H;  4KTA A;  2HQE A;  5ELD A;  2A8V A;  1EIY B;  5GAD C;  1WTW A;  3ND9 A;  5LHY 1;  1YJW A;  1G6P A;  1DOK A;  1SFO H;  4RGM A;  5IIF A;  1CUK A;  4HMI A;  2N88 A;  2Z9H A;  5HY6 A;  3GTG B;  4IUU A;  4C2M H;  3LWU A;  2PQA A;  3HOX H;  1X3P A;  5BN5 A;  2E2J B;  5CV5 A;  5M3M G;  1R9T H;  2AUK A;  1KC8 C;  1X56 A;  3GV6 A;  3QWN A;  3FP9 A;  2NVQ H;  4A3G B;  1GUN A;  1K3B C;  1Z9F A;  4LF6 Q;  2KED A;  3ERQ A;  3J7Z C;  1PZJ D;  2WP8 J;  4JCV E;  3CP0 A;  1A3V A;  4JI5 L;  3BS1 A;  3IL8 A;  4JI0 Q;  1BBU A;  1I6H H;  2VQE Q;  1LLR D;  4EQ5 A;  4HTH A;  4O42 A;  1TXY A;  4IUV A;  1EZ6 A;  1Y8N B;  1SE4 A;  2B2U C;  2QEX A;  2K1B A;  3VR4 A;  2NN6 G;  4UDU C;  3S1R B;  1JQY D;  1NBW A;  5BR8 Q;  4TQU S;  3OSO A;  3FVQ A;  3ZJY C;  2D0O A;  5ISR A;  4O2D A;  1Q8I A;  1N36 L;  2E74 C;  2G9H D;  3ERS X;  1EY8 A;  5G3L F;  2IWH A;  1AH9 A;  2RHQ B;  3RD4 A;  1IW7 C;  2MFI A;  2NZO A;  2RVL A;  3GTL B;  3H3V H;  4LUO A;  3RR5 A;  3I55 A;  1VMC A;  4B3R L;  3T51 B;  1YNJ D;  2R7Z G;  4X64 L;  1LAB A;  2A6E D;  4P72 A;  4QL5 A;  4BY7 G;  4R4I A;  1VQ4 A;  3PV0 A;  2WB1 B;  4RA8 A;  4PMW A;  2HIV A;  1HNX L;  5BN3 A;  3I4N G;  3RZO H;  3U9O A;  3HEJ A;  1SFO B;  5KEE A;  5IGD A;  5C6A A;  1JJ2 A;  4DV5 Q;  1PH8 A;  3KUP A;  1M8A A;  1ESR A;  2ZXP A;  4L5R C;  5AJ3 Q;  1L1O A;  2R6G A;  4DAY A;  1EYA A;  1H9M A;  2VZA A;  3D6W A;  4ILW A;  3H3V I;  4ZCK A;  5M3F G;  3KOJ A;  4EX5 A;  4DV0 Q;  2HT1 A;  2M00 A;  1FGU A;  4RKB A;  2EXZ A;  3M4O B;  2F3W A;  4GOP C;  3EFX D;  3NEM A;  3TSS A;  4KN7 C;  2Z4H A;  1N32 L;  5LMN Q;  4ZUJ A;  3VA7 A;  3S1Q H;  1JE5 A;  1NNX A;  4C3H G;  3HOU B;  3CCL A;  1EWC A;  1PH4 A;  4LF5 L;  1RIP A;  5CV9 A;  4DV7 Q;  2D9U A;  4PV1 C;  4JI6 L;  1L2F A;  3KLR A;  1LTI D;  3DUZ A;  2AQ3 B;  5GQO A;  1SNC A;  3H15 A;  1Q81 C;  3RLN A;  4GNX C;  3NK9 A;  2DNE A;  4A3B H;  4LFB Q;  2PMZ B;  5IWA Q;  5JJI A;  4OWT B;  4MN3 A;  1BF4 A;  1AE2 A;  1V1P B;  2KCM A;  4LUZ A;  1VF5 C;  4A3F H;  4IUN A;  5LMN W;  1STB A;  2OTL A;  1ICF B;  1DOL A;  3NPP A;  2DN8 A;  2RHS B;  2CHB D;  4MIU A;  3BVG A;  3UDI A;  1KLG D;  3SK4 A;  4JI8 Q;  2XRS D;  3I90 A;  2BE5 C;  3M7N A;  1FVI A;  4A3I H;  2A74 C;  4HAE A;  2IX0 A;  4A3L G;  4PZ7 A;  4A3K B;  2NUC A;  3BDO A;  3AQQ A;  2N55 A;  4LFA Q;  1EWI A;  4BWG B;  2ZJP A;  4BY7 H;  3NSW A;  4MZ9 A;  2EPB A;  3M9B A;  4BA2 I;  2V4D A;  5M9O A;  1HXY D;  3MHB A;  3RN5 A;  2J4X A;  4ZYS A;  4BXX H;  2MP1 A;  4QIW E;  3CMA A;  4G7Z C;  4GKJ Q;  1YNX A;  2CW0 C;  3OTO L;  4NB3 A;  1FR3 A;  3CQZ B;  1F9R A;  4XQQ A;  2UXC L;  1FD7 D;  1SAP A;  3GP7 A;  3SEB A;  1L1O B;  1C8C A;  3HRZ C;  2RSO A;  1SYB A;  1ZEQ X;  3J81 c;  5GAE C;  2A6H D;  4DK1 A;  1J6Q A;  2VQF Q;  4K6L A;  1MJE A;  2RQX A;  1KNA A;  2MQH A;  2XVS A;  4OWW B;  3T53 B;  5JVG 3;  3M3Y B;  3I70 A;  5KYL A;  1MSH A;  5M5X H;  2NVY H;  1HA6 A;  2WB1 G;  4XXE A;  5IWA L;  2Q2U A;  3WOF A;  4H0L C;  2BOS A;  1NMG A;  2WFW A;  1JWS D;  4DR7 L;  3BDL A;  4A3E B;  2SEB D;  3A7L A;  5CC4 A;  1OTC A;  4ZQ3 A;  2F0E A;  1N33 Q;  1Y8P B;  1I6H B;  4JV5 Q;  4OGQ C;  4Z9C B;  4A3C G;  1KNE A;  5C3X A;  3PIP A;  1STH A;  1Q3L A;  4A3F G;  1LT6 D;  2LXK A;  2B63 H;  2RA4 A;  1C4Q A;  4B08 A;  2F0T A;  1OXT A;  3T1Y Q;  1H95 A;  1I50 B;  1LYL A;  3FDT A;  4DV0 L;  3MEF A;  4LF4 L;  2J0T D;  2JP1 A;  3D4W A;  4UY8 C;  1JB7 A;  4A3I G;  4LF9 Q;  1W6J A;  5DM6 3;  2R93 G;  2NBF A;  1HTP A;  2RDH A;  4GLA C;  3HOU G;  4ME5 A;  4KJO A;  1CA5 A;  2NN6 I;  2ES2 A;  2F0S A;  1I4H A;  1A2T A;  4ZLT F;  1S40 A;  3KJO A;  3SVM A;  3WOE A;  4C1N I;  2ZM6 L;  1OO9 B;  1VQL A;  2JEB I;  1YZ6 A;  5C0X I;  1I4G A;  2B8G A;  1Y1W G;  3EA6 A;  4DK3 C;  2F0W A;  4LF9 L;  2EIF A;  1D5Z C;  3U50 C;  3GTK B;  5IE8 A;  2PZW A;  4CDD C;  1QVG A;  4IFD H;  4YCU A;  1VQK A;  3KF8 B;  5KRU A;  2K5V A;  1B4O A;  4HJ7 A;  2K5Q A;  4IPD A;  4XYO A;  1S5B D;  4QCL A;  1Q86 C;  4POG A;  1KXL A;  4GOP B;  2B2V A;  4I7Z C;  1F77 A;  1STG A;  1WI5 A;  2G9D A;  4O1N A;  1LAC A;  1XNQ L;  3H0G G;  1G29 1;  2XNA C;  3F2U A;  1HNW Q;  1QNU A;  1SE2 A;  2RCN A;  3TZD A;  4BBR H;  4XYQ A;  2CKZ B;  4IUP A;  1E2W A;  4L8J A;  1PTO D;  1EOV A;  4DPG A;  5J3B A;  4KN4 C;  4XT3 B;  2E2I H;  4CJ0 B;  3TP8 A;  5HUR A;  2IY5 B;  3BZK A;  3PO3 B;  4R4Q A;  1A6X A;  1XWE A;  2MJ8 A;  3ULP A;  3I4M G;  5JJZ A;  1YBY A;  4UHV A;  5M3F H;  1HRJ A;  3J80 i;  1CQF A;  3NP8 A;  3O13 A;  1F9P A;  1I6V C;  2JK8 A;  1TKW B;  3KBG A;  4RWS C;  2PI2 A;  1HUM A;  2PNR C;  3AB9 A;  1NCV A;  4KMU C;  5ELE A;  1DXM A;  1WJJ A;  1UEB A;  3RZD B;  4C3H H;  1Z47 A;  1XTD A;  3TN2 A;  3HOY B;  4JI2 L;  3UE1 A;  2Y0S E;  3FMC A;  3C3L A;  1B44 D;  1PFN A;  3FEW X;  3H94 A;  4A3D B;  3E3X A;  5C4X B;  2K28 A;  2EOT A;  5C0X G;  2OTJ A;  2E76 C;  4FF2 A;  1SNQ A;  4DR3 Q;  1IL2 A;  1XMO L;  4J8Q A;  4LF4 Q;  4JW0 A;  1QVF A;  2XRQ D;  3A55 A;  2A19 A;  3HOV G;  4N9T A;  4LFC L;  2VUM G;  5M3F B;  1MJC A;  1SXT A;  2ID0 A;  3MZ5 A;  2H4O A;  3HKZ E;  1TQO A;  3I4O A;  4FVM A;  3NWT A;  1ILQ A;  1SMX A;  2IHE A;  1H9S B;  4C3J G;  1YHQ A;  3VR2 A;  4X62 Q;  3VDY A;  1VQE A;  3ER0 A;  3RUZ A;  4DAV A;  4A3L H;  3AFQ A;  3KBX A;  4K8I A;  4KJN A;  1Y1V H;  4DV1 L;  4C56 C;  2JA9 A;  4B3M L;  4AQY Q;  2BDO A;  2IJ0 A;  2ZTE A;  4X66 Q;  3H0G B;  1Z6H A;  5IT9 c;  4QQB X;  1KIX A;  1SLJ A;  3PO3 G;  4S3S A;  3HFZ B;  2ICE C;  3DWP A;  4JI2 Q;  1CI3 M;  1WTR A;  2WKD A;  3I3C A;  1Q46 A;  2XIW A;  2MO0 A;  1GUT A;  5TSS A;  3M7G A;  2DGY A;  1WTQ A;  4B3T Q;  4Y7N B;  1U4L A;  1NJI C;  2XN9 C;  1S5E D;  5ELB A;  1V8Q A;  3K0Y A;  1JWU D;  3M4Y A;  1D5X C;  1STA A;  1IBM Q;  5I6W A;  3J80 c;  2A68 D;  1PYS B;  3A7A B;  1HFG A;  5DEH A;  1PH3 A;  4DUZ Q;  3K80 C;  2A1A A;  4DV1 Q;  1MKH A;  2TSS A;  3KF8 A;  2Z4I A;  1NR2 A;  4ODG A;  1FNU A;  1EY4 A;  3DEO A;  2XTI A;  1HZB A;  2KA7 A;  4A3M H;  5IYD H;  3R8B A;  4M1U B;  4N8F A;  1K83 B;  4N8X 1;  1AFP A;  3K6O A;  5JPN C;  3M4O H;  4CKB A;  2UU9 L;  1T5X D;  4K2L A;  4B3R Q;  5FJ8 H;  1UAP A;  3UDX A;  2B63 G;  1I5F A;  1O78 A; 
#chains in the Genus database with same CATH homology
 3S16 B;  5IOC A;  2R7Z B;  3KLS X;  3SK6 A;  1Q1B A;  3A8I E;  4JK1 C;  1IKM A;  1ENC A;  2F0N A;  4QIW B;  5D14 A;  5E4X A;  4IAL A;  1AW7 A;  3NTI A;  1KAB A;  2X69 A;  3X3M A;  1QWY A;  1SMY C;  1VCI A;  2Q8T A;  5J22 A;  1QIL A;  3BZD B;  4P2C B;  4OO1 H;  3QB3 A;  1ILP A;  2ENB A;  2PQE A;  5FO9 B;  2KUM A;  4RCO A;  1SND A;  2AQ1 B;  2L12 A;  1TR5 A;  3QOL A;  1R9T B;  4EGV A;  4K8J A;  2LS0 1;  2Z1C A;  2JYO A;  1A2U A;  2H1E A;  5C3W A;  4DU9 A;  2IL8 A;  1EY7 A;  1G91 A;  1ET9 A;  2DY8 A;  5KYI A;  2SNS A;  1Q1E A;  3J7Y W;  1SYG A;  4KI0 A;  2HDM A;  1BXT A;  4FF4 A;  3OOC A;  5EBC A;  1QB5 D;  2X6L A;  4I65 A;  3ND8 A;  4DAP A;  3BVZ A;  2NTS A;  1HUN A;  1ESF A;  1TU2 B;  2B8F A;  1S5D D;  2OEO A;  2B2T C;  4R9W A;  4X3K A;  1XYI A;  2A5H A;  1IW7 D;  4FXD A;  4J6H A;  4IFD J;  2EJG C;  1D1K A;  2I07 B;  3MEH A;  4R8I A;  3PIP 3;  4CJ2 C;  2A6E C;  2SOB A;  1TII D;  4TKO B;  3D4R A;  2IPK D;  4B9W A;  4QB4 A;  1NSN S;  1OXU A;  3P20 A;  4HN7 A;  3GQB A;  1MSG A;  2FFK B;  4EQN A;  1YNN C;  3U9S A;  5CV6 A;  4TSS A;  2WAC A;  3H09 A;  1IYV A;  3S1M B;  1YNJ C;  2EYP A;  3DWA A;  2EYO A;  3HKZ B;  1LTR D;  1DJR D;  4DNR B;  3I4M B;  2NVQ B;  2A69 C;  2IW3 A;  3HOZ B;  4WOR A;  4ZKC B;  2IX1 A;  4X3S A;  3RZO B;  4ULL A;  1GHK A;  3IFD A;  2I46 A;  5D3D A;  1RHP A;  1ENF A;  1PFB A;  2Y0S B;  1MD2 D;  2IT1 A;  4M8A A;  1O7Y A;  2EE1 A;  1LO5 D;  2O5I C;  3Q24 A;  2B2W A;  4LK1 C;  4RAU C;  2IX3 A;  2BCO A;  3DEP A;  1EEF D;  1PTO B;  1SJH D;  2K01 A;  2NYZ D;  3J80 L;  3T4A C;  1O7Z A;  2M9V A;  1DD2 A;  2KOL A;  2L1B A;  5IOD A;  2JA7 B;  1TVX A;  5CBE E;  5E4W C;  3NBH A;  4G4K A;  4X3U A;  3SXH A;  1SDF A;  1SE3 A;  1DZ1 A;  4BBR B;  1BO0 A;  1JWM D;  1R4Q B;  3C2P A;  3KLS A;  5AFW A;  5I4D A;  4RFB A;  4IZ8 A;  5NUC A;  2VB2 X;  5D65 A;  4HCS A;  2EY2 A;  2F0L A;  3QIA A;  1SMY D;  1EWH A;  3K58 A;  1ONL A;  2O4X A;  4A3I B;  3SE0 A;  2ZT9 C;  4ID6 A;  2AUJ D;  3MFG A;  1D5M C;  2L9H A;  1F2M A;  1KTK A;  1DOM A;  4K5X A;  1VDZ A;  2K32 A;  4NKL A;  3L3O C;  1M4V A;  4ZRZ A;  1PRT C;  3W2D A;  4PQX A;  4LJZ C;  2EJM A;  1Y1W B;  1JB3 A;  4XQJ A;  3R3O A;  1NAP A;  3E6Z X;  3HZX A;  1T5E A;  2F0I A;  1VMP A;  4OIJ A;  1J8I A;  4RCN A;  3T16 A;  5DNF A;  4DGZ A;  4B9X A;  4G57 A;  2JSO A;  1RKN A;  4NP5 A;  2M2L A;  4K5W A;  4A93 B;  1PFM A;  3EJI A;  4N9P A;  4L63 B;  1EY5 A;  3DM1 A;  1BCP D;  4NDX A;  5C5M A;  1G6Z A;  3GTJ B;  2EY1 A;  1YNN D;  1EZ8 A;  2AWO A;  1EFI D;  4AYB B;  5EKL A;  3A8J E;  4XTC S;  1J9O A;  2EVB A;  4K5V A;  2PW5 A;  5J39 A;  4K2K A;  4QUF A;  4HCE A;  3S2H B;  3VA5 A;  4EVO A;  1GOZ A;  2B2W C;  4K6D A;  1CTM A;  5I2Y A;  2K03 A;  3TME A;  3K59 A;  1SYC A;  2JXM B;  2DNC A;  2JE6 I;  1ZYR D;  1BBX C;  1QCB D;  4CKE A;  4V0B A;  3MXN A;  5CGK A;  1JR0 D;  4FF1 A;  3P7J A;  1PTO F;  1QNK A;  2EY5 A;  4ZUI A;  1SJE D;  1OXX K;  2CQA A;  5G3L D;  1JC7 A;  2L11 A;  3IFT A;  1KDA A;  4KY7 A;  1E2Z A;  4C1N K;  3SK5 A;  5FO7 B;  1LTT D;  2NVY B;  1GHJ A;  1X32 A;  3H91 A;  2NVX B;  1TS3 A;  1CZW A;  3R93 A;  2HCI A;  4KD3 A;  5T1I A;  3MFY A;  1O80 A;  1SBB B;  3NTH A;  2NB0 A;  1CT1 D;  4KD4 A;  4HSV A;  1JE4 A;  2L5T A;  3K5L A;  1ZYR C;  2F0Q A;  4A3J B;  3TDQ A;  3MVV A;  1WTO A;  4FF3 A;  5FOB B;  5EQ0 A;  3HG9 A;  1WTP A;  3Q0A A;  4BA1 I;  1VF7 A;  3J7A V;  4RHR A;  5CV8 A;  2B2T A;  3OWF A;  3T13 A;  4HED A;  1ZXT A;  1KDC A;  2F0J A;  4RHS A;  2B2U A;  2NN6 H;  1PRT B;  1EY9 A;  2A69 D;  1TS2 A;  2D62 A;  2A73 B;  3BYT B;  3OW7 A;  5EBD A;  4E6I A;  5CR3 A;  5EJW A;  3CRK C;  5JOB A;  4XIG S;  5IGC A;  5I6Y A;  4PMB A;  1I4R A;  5BN4 A;  3HS0 C;  2XWJ B;  3CU7 A;  3H6M A;  3S1N B;  2HUG A;  3GTO B;  1JOO A;  1DCZ A;  4BY1 B;  2E2D C;  5KNB A;  1II3 A;  2HCC A;  1F2Y A;  1LTS D;  3D4D A;  1HPC A;  2EYF A;  2OXP A;  3OIP A;  3VYS A;  3PUW A;  5FLX L;  3TBI B;  1TS5 A;  2PPB C;  4WJW A;  2KJX A;  4H13 C;  3D8G A;  5I2X A;  1A15 A;  3UI2 A;  1RTO A;  3I91 A;  1B50 A;  2RSN A;  1W6K A;  1RD9 D;  4QF4 A;  4C3J B;  2D2C C;  5EGT A;  1X3Q A;  3Q23 A;  3S2D B;  1KLU D;  1ICW A;  1B53 A;  3QJY A;  4LAA A;  2OT2 A;  2C5C A;  3S9W A;  1PLF A;  3FPP A;  5EKK A;  2EYL A;  2WIN B;  4EQP A;  4KHZ A;  4K14 A;  1U4M A;  2B63 B;  2E2H B;  4H44 C;  1CHP D;  2L4N A;  3V05 A;  4XT1 B;  4TRD A;  3KK7 A;  4KKT A;  5IGF A;  2K6A A;  4A3F B;  5KIX A;  1KDB A;  5IGG A;  1LTG D;  3URY A;  1QE6 A;  4FP5 D;  3Q6S A;  5HGT A;  4DFA A;  4CBV A;  5JEA H;  5FO8 B;  5CMD A;  2WAQ B;  2PZU A;  2LMC B;  4RGT A;  3S1Q B;  2GA4 B;  2PO4 A;  1Q12 A;  1JOQ A;  2AQ2 B;  5CV7 A;  3E0J A;  3NXW A;  1SYF A;  2L55 A;  1PZK D;  5J1Z A;  5COY A;  1EYC A;  4C3I G;  5F2D A;  2XWB B;  4RH6 A;  3PIO 3;  2QCP X;  2JA5 B;  4OO1 I;  1ROD A;  1D2B A;  1BCP B;  3HP3 A;  1CA6 A;  4FYD A;  1SNP A;  2MUY A;  1HHV A;  2K7V A;  1IL8 A;  1K8O A;  2QKI C;  3TP6 A;  1RF2 D;  4Q0F A;  1RJT A;  4G7O C;  5CV4 A;  1L0Y B;  1DM0 B;  5KNC A;  2YYZ A;  4OHJ A;  1SNM A;  2KEE A;  1GJX A;  1TY2 A;  1A3T A;  4ABN A;  1SEB D;  2E75 C;  5ELC A;  4FO2 A;  4R8N A;  3I8Z A;  5EPJ A;  4BS9 A;  4J1M A;  3DHQ A;  1AEX A;  5E1F A;  1TWC B;  1LTA D;  2BE5 D;  2KVM A;  3IKJ A;  3NTK A;  5IGE A;  5JEA G;  1NUC A;  5M5X B;  1GUO A;  3MXP A;  1I4Q A;  5DAU A;  5EKI A;  2L0C A;  3CKI B;  1NR4 A;  2KCC A;  3L7Z C;  1F2Z A;  2JA6 B;  3FKI B;  4LMQ D;  2BA1 A;  2VUM B;  3GV3 A;  1B9M A;  4ZK9 B;  3L9A X;  3WDN A;  2F0G A;  1LT3 D;  3BYY B;  2B2V C;  2FHT A;  4PMC A;  3MWY W;  1PYW D;  3BVM A;  4RGN A;  2Z8L A;  1B9N A;  4DF7 A;  3A8K E;  2WII B;  2LKV A;  1FGB D;  5FKA C;  3N52 A;  3CRL C;  3PUX A;  2EY6 A;  2F0P A;  1TWF B;  3OPO A;  4KKU A;  1OXS C;  5D3I B;  1CM9 A;  2NZ1 D;  4WRD A;  3JAM E;  5CYU A;  2E2I B;  1TS4 A;  4KHV A;  4CHT B;  2EZV A;  4FNF A;  2PW7 A;  4EQO A;  4WFN 3;  3MA2 B;  3TZU A;  3ONA B;  5C0X H;  2RDG A;  3NUC A;  5JVH 3;  3BG3 A;  2QEJ C;  2VXW A;  1QJO A;  1ZKO A;  1HFN A;  1IHZ A;  1UNS A;  1EY0 A;  1QOH A;  2Q8I B;  4KV6 A;  3P1H A;  2B2Y C;  1STY A;  5EPL A;  2MPM A;  2K5W A;  1B1Z A;  2F0M A;  4QMG A;  3V96 A;  4CGY B;  1I3Q B;  1V43 A;  3K5O A;  1E2V A;  1WCM B;  5C44 B;  3BDC A;  2R92 B;  1JIC A;  3Q22 A;  4FXK C;  2A6H C;  3K5M A;  1V1O A;  3NHH A;  2OF1 A;  1CFM A;  3HOX B;  2F0U A;  4DK0 A;  3PMF A;  1BCP C;  3PUY A;  2F0V A;  4CJ1 B;  4F87 A;  4C3H B;  2C9O A;  3NQI A;  4DA2 A;  2QDB A;  2K05 A;  3IAY A;  1EQT A;  5M3M B;  1Y69 U;  3X3N A;  3RLF A;  4U68 A;  4NW2 A;  1HTL D;  2LFN A;  2KHS A;  4A3B B;  3J7A F;  3OMC A;  4RGO S;  4YIJ A;  1BDO A;  1G2S A;  1JOK A;  3HOV B;  1WVL A;  3K57 A;  1LV9 A;  5C4H A;  1XTC D;  2VB3 X;  1F2L A;  1H9J A;  5EPK A;  3R2I A;  2ZXR A;  3LX0 A;  1AZQ A;  1Q90 A;  4IUR A;  4HR7 B;  1PMR A;  2HDL A;  1RDP D;  3T56 B;  1JCK B;  3QO2 A;  3SHL A;  2ICI A;  4IUT A;  1F9S A;  4HMJ A;  2LY7 A;  4XQN A;  5LL6 S;  1QG7 A;  5C4J B;  2A68 C;  5C0X J;  3C1E A;  3EQL C;  3VYU A;  1H9S A;  2QIL A;  2KQ3 A;  2D5D A;  5A2Q L;  2CW0 D;  1D6E C;  3MXU A;  1EYD A;  1L0X B;  2PZT A;  5KND A;  2R61 A;  1FNW A;  1WTX A;  2O5J C;  1PZI D;  1MBY A;  1H9R A;  3R2T A;  3VR3 A;  4BY7 B;  1Y8O B;  1G8Z D;  5K5P A;  1PRT D;  5JAV A;  3QOJ A;  3CHB D;  4U67 3;  1AN8 A;  1EOT A;  2VNU D;  1DON A;  2BDN A;  3OHX C;  1CQV A;  2WKC A;  3HOW B;  1MGS A;  4L6T B;  4CKC A;  2X6G A;  5IGB A;  3OIQ A;  1EL0 A;  1SNO A;  2JA8 B;  2ZXO A;  5JEA J;  4KY6 A;  1BUV T;  5C3E B;  2DY7 A;  1BR9 A;  2EDG A;  2NTT A;  3NBI A;  2MGS A;  1MI2 A;  2MHV A;  3EVQ A;  3LWE A;  3OWE B;  3J81 E;  3GO5 A;  4F7X A;  3GTQ B;  3N6R A;  1IYU A;  5DM7 3;  5M5W B;  3SR1 A;  2KCN A;  1U9R A;  2EYJ A;  1V1P A;  3PO2 B;  4IFD G;  3TP5 A;  5M5Y B;  4X3T A;  1DYQ A;  3AU7 A;  4IQZ A;  2B2Y A;  2O2L D;  4KK7 A;  3FPU B;  4DNT B;  5COR A;  1D1I A;  1ENA A;  1O7L A;  3H3V C;  4Q5V A;  1BQQ T;  4IFD I;  3DXJ C;  4ZAI A;  3DMU A;  1EIG A;  2J7Z A;  3MXG A;  1G2T A;  1AZP A;  1RTN A;  2SDF A;  1CK1 A;  4DXG A;  3JAM L;  4FXG C;  1U4R A;  1GUW A;  5T1G A;  4QUC A;  3PUZ A;  3E5S A;  2AWN A;  1S4Z A;  1CZG A;  1FNV A;  2BA0 A;  1EU3 A;  1LTB D;  3ITP A;  3K5N A;  2B39 A;  2K33 A;  1HQR D;  3RMH A;  5A35 A;  3VYR A;  1F9Q A;  2EJF C;  1EU4 A;  4V19 0;  3ERO A;  2FIN B;  3AMU A;  5ELF A;  3DWQ A;  1BNZ A;  2TMP A;  3GD7 A;  3SK8 A;  1H9K A;  1UUP A;  2JEA I;  4BBS B;  1CHQ D;  1XX8 A;  1GUS A;  2FJ2 A;  5IT9 L;  5C5L A;  4OIK A;  4A3M B;  3NE5 B;  1ET6 A;  1EQV A;  3S14 B;  4KY5 A;  1B2T A;  4ZKB B;  1TY0 A;  4DN4 M;  2K04 A;  3S17 B;  1SYD A;  3VR6 A;  4JBW A;  3V2T A;  2SNM A;  2F0H A;  1KAA A;  1EY6 A;  4F88 A;  2RDF A;  1Z7T A;  1TWA B;  1PDQ A;  1RCV D;  2FMC A;  3G7L A;  1STN A;  5A2Q E;  4PNY A;  1TWH B;  1GUG A;  2R93 B;  4IUQ A;  1XXG A;  3GTP B;  4C2M B;  4NMZ A;  1BCP F;  1HQM C;  2WV6 D;  5FLX E;  4H7B A;  2FMM A;  1I4X A;  1SSO A;  1ML0 D;  1PTO H;  3I73 A;  4IN3 A;  2EYM A;  4OL7 A;  3I4L A;  2RKS A;  3I4N B;  1PXU A;  3VYT A;  1S5C D;  5K36 G;  2QF7 A;  1B3A A;  4XDX A;  1TT2 A;  3OMG A;  3J81 L;  3FRP B;  2RBM A;  3ZYY X;  3MC0 B;  2F3V A;  3J80 E;  3M85 A;  5LL6 X;  1C48 A;  1UEA B;  4DXF A;  1HA5 A;  2PCF B;  3W3A A;  3QG1 A;  4G7H C;  3K7A B;  1FYC A;  5I9O A;  3P75 A;  1PRT F;  5IT9 E;  1WD1 A;  3NWS A;  1U4P A;  3D3R A;  2R3Z A;  2XSC A;  2YU9 B;  3GTM B;  2F03 A;  1EEI D;  3G6J B;  4OO1 G;  1PTO C;  2EYH A;  4RKL A;  5CBA E;  4C3I B;  3NQT A;  1JOR A;  1I4P A;  3SDZ A;  3C1F A;  4UAI A;  2F0O A;  2CVR A;  1EIH A;  5E3F A;  1Y1V B;  3A54 A;  3TP7 A;  3HGB A;  4KKS A;  2NVT B;  2F0D A;  2Q8R E;  2F0K A;  5I9P A;  1SYE A;  1HCZ A;  3LNN A;  2NWG A;  1R4P B;  4F8M A;  2F0F A;  5KGU A;  2F1M A;  1A3U A;  2KEC A;  1WD0 A;  5C4Z A;  4GZY C;  1AP0 A;  1LT4 D;  1LT5 D;  1TWG B;  2PYK A;  5K36 H;  1K8M A;  1WTV A;  3C46 A;  3I72 A;  3PUV A;  5JPM C;  1IKL A;  3MTS A;  1S5F D;  1STE A;  3D6C A;  3VR5 A;  3D31 A;  2F4I A;  3A56 A;  1E0B A;  3MAQ A;  1BOS A;  1OXV A;  5FK9 C;  2K5D A;  4HSP A;  3S15 B;  1GXD C;  4MHE A;  4KTA A;  2HQE A;  5ELD A;  1WTW A;  3ND9 A;  5LHY 1;  1DOK A;  4RGM A;  5IIF A;  4HMI A;  2N88 A;  3GTG B;  4IUU A;  3LWU A;  1X3P A;  5BN5 A;  2E2J B;  5CV5 A;  2AUK A;  3GV6 A;  3QWN A;  4A3G B;  1GUN A;  2KED A;  3ERQ A;  1PZJ D;  2WP8 J;  1A3V A;  3BS1 A;  3IL8 A;  1LLR D;  4HTH A;  4O42 A;  4IUV A;  1EZ6 A;  1Y8N B;  1SE4 A;  2B2U C;  2K1B A;  3VR4 A;  2NN6 G;  4UDU C;  3S1R B;  1JQY D;  4TQU S;  3OSO A;  3FVQ A;  5ISR A;  1Q8I A;  2E74 C;  2G9H D;  2IWH A;  1EY8 A;  5G3L F;  3RD4 A;  1IW7 C;  2RVL A;  3GTL B;  1VMC A;  3T51 B;  1YNJ D;  1LAB A;  2A6E D;  3PV0 A;  2WB1 B;  4RA8 A;  4PMW A;  5BN3 A;  3U9O A;  3HEJ A;  1SFO B;  5KEE A;  5IGD A;  5C6A A;  3KUP A;  1M8A A;  1ESR A;  2ZXP A;  2R6G A;  4DAY A;  1EYA A;  1H9M A;  3D6W A;  4ILW A;  2M00 A;  3M4O B;  4RKB A;  2EXZ A;  2F3W A;  3EFX D;  3TSS A;  4KN7 C;  2Z4H A;  4ZUJ A;  3VA7 A;  4C3H G;  3HOU B;  1EWC A;  5CV9 A;  2D9U A;  4PV1 C;  3DUZ A;  1LTI D;  3KLR A;  2AQ3 B;  1SNC A;  3NK9 A;  2DNE A;  2PMZ B;  4MN3 A;  1BF4 A;  1V1P B;  1VF5 C;  4IUN A;  1STB A;  1DOL A;  3NPP A;  2DN8 A;  2CHB D;  4MIU A;  3BVG A;  1KLG D;  3SK4 A;  2XRS D;  3I90 A;  2BE5 C;  3M7N A;  2A74 C;  4HAE A;  2IX0 A;  4A3K B;  2NUC A;  3BDO A;  2N55 A;  4BWG B;  3NSW A;  2EPB A;  4BA2 I;  2V4D A;  5M9O A;  1HXY D;  3MHB A;  2J4X A;  4ZYS A;  2MP1 A;  4G7Z C;  2CW0 C;  1FR3 A;  3CQZ B;  1F9R A;  4XQQ A;  1FD7 D;  1SAP A;  3GP7 A;  3SEB A;  1C8C A;  3HRZ C;  2RSO A;  1SYB A;  1ZEQ X;  2A6H D;  4DK1 A;  4K6L A;  2RQX A;  1KNA A;  2XVS A;  3T53 B;  5JVG 3;  3M3Y B;  3I70 A;  5KYL A;  1MSH A;  1HA6 A;  4XXE A;  3WOF A;  4H0L C;  2BOS A;  1JWS D;  3BDL A;  4A3E B;  2SEB D;  3A7L A;  5CC4 A;  4ZQ3 A;  2F0E A;  1I6H B;  1Y8P B;  4OGQ C;  4Z9C B;  1KNE A;  5C3X A;  1STH A;  1Q3L A;  1LT6 D;  2RA4 A;  1C4Q A;  4B08 A;  2F0T A;  1OXT A;  1I50 B;  3FDT A;  2J0T D;  2JP1 A;  3D4W A;  1W6J A;  5DM6 3;  2NBF A;  1HTP A;  2RDH A;  4ME5 A;  4KJO A;  1CA5 A;  2NN6 I;  2F0S A;  1I4H A;  1A2T A;  4ZLT F;  3SVM A;  3WOE A;  4C1N I;  1OO9 B;  2JEB I;  5C0X I;  1I4G A;  2B8G A;  3EA6 A;  2F0W A;  1D5Z C;  3GTK B;  2PZW A;  4IFD H;  5KRU A;  1B4O A;  2K5Q A;  4XYO A;  1S5B D;  4QCL A;  2B2V A;  4I7Z C;  1F77 A;  1STG A;  2G9D A;  4O1N A;  1LAC A;  1G29 1;  2XNA C;  3F2U A;  1QNU A;  1SE2 A;  3TZD A;  4XYQ A;  4IUP A;  1E2W A;  4L8J A;  1PTO D;  4KN4 C;  4XT3 B;  4CJ0 B;  3TP8 A;  5HUR A;  1A6X A;  3PO3 B;  1XWE A;  2MJ8 A;  5JJZ A;  1HRJ A;  1CQF A;  3NP8 A;  3O13 A;  1F9P A;  1I6V C;  1TKW B;  3KBG A;  4RWS C;  1HUM A;  2PNR C;  3AB9 A;  1NCV A;  4KMU C;  5ELE A;  1DXM A;  3RZD B;  1Z47 A;  3TN2 A;  3HOY B;  3FMC A;  3C3L A;  1B44 D;  1PFN A;  3FEW X;  3H94 A;  4A3D B;  5C4X B;  2K28 A;  2EOT A;  5C0X G;  2E76 C;  4FF2 A;  1SNQ A;  4J8Q A;  2XRQ D;  3A55 A;  4N9T A;  5M3F B;  1SXT A;  2ID0 A;  3MZ5 A;  2H4O A;  1TQO A;  4FVM A;  3NWT A;  1ILQ A;  1H9S B;  4C3J G;  3VR2 A;  3RUZ A;  4DAV A;  3KBX A;  4K8I A;  4KJN A;  4C56 C;  2BDO A;  2IJ0 A;  3H0G B;  1Z6H A;  4S3S A;  2ICE C;  3DWP A;  1CI3 M;  1WTR A;  2WKD A;  3I3C A;  2XIW A;  1GUT A;  5TSS A;  3M7G A;  1WTQ A;  4Y7N B;  1U4L A;  2XN9 C;  1S5E D;  5ELB A;  1V8Q A;  3K0Y A;  1JWU D;  3M4Y A;  1D5X C;  1STA A;  5I6W A;  2A68 D;  3A7A B;  1HFG A;  5DEH A;  2TSS A;  3KF8 A;  2Z4I A;  1NR2 A;  1FNU A;  1EY4 A;  4ODG A;  3DEO A;  2KA7 A;  3R8B A;  4M1U B;  1K83 B;  1AFP A;  3K6O A;  5JPN C;  4CKB A;  1T5X D;  4K2L A;  1UAP A;  1O78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...