2LMCB

Structure of t7 transcription factor gp2-e. coli rnap jaw domain complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
61
structure length
61
Chain Sequence
b'PAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFEGERVERGDVISDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial RNA polymerase inhibitor
publication title Structural and Mechanistic Basis for the Inhibition of Escherichia coli RNA Polymerase by T7 Gp2.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transcription
total genus 5
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2lmcB00
2A6HD 1VF5C 2CW0C 1VDZA 1HPCA 2V4DA 1YNNC 1OXVA 3A8KE 3I4LA 3PUXA 2B8FA 4KI0A 4OO1H 1VCIA 1O78A 2AUKA 5BN5A 5C0XH 2O5IC 4G7ZC 3A7LA 3A8IE 3GD7A 3HGBA 3ND9A 2EJFC 3WDNA 4TQUS 4DNRB 1FR3A 1QJOA 3VR2A 1LACA 4XTCS 3BG3A 2BE5C 1I6VC 4KKSA 1CI3M 4KKUA 3VR5A 2QF7A 4HR7B 1A6XA 1SMYC 2A6HC 1GJXA 2JXMB 1OXUA 3D4RA 5KNBA 1BDOA 3A8JE 1H9KA 2A68D 1Y8PB 4H0LC 3M7NA 3PV0A 1H9RA 5BN3A 4JBWA 1K8MA 1TKWB 1PMRA 1IW7D 1E2VA 3PUZA 2E76C 1Z6HA 2K33A 1OXSC 2PCFB 2ZT9C 3PUVA 1H9SB 4RCNA 4DK0A 1V43A 1H9JA 1B9MA 3VR6A 2PPBC 2KCCA 3RLFA 1GHKA 2NN6G 3T51B 5JEAG 5K36G 2E74C 2IT1A 4DNTB 3CRKC 2D5DA 4LK1C 4IFDG 3T53B 3FMCA 3M85A 2D62A 1ZKOA 2A68C 2EDGA 3EQLC 4LJZC 1Z7TA 1ONLA 4H44C 4KHZA 3U9SA 2YYZA 1IW7C 2A6ED 2F1MA 2D2CC 3GQBA 1HTPA 2EVBA 2PNRC 2A69D 3CRLC 3FPPA 1IYUA 3M4YA 4G7HC 4L8JA 3OPOA 1GUTA 2LMCB 4IQZA 3VR3A 2NN6H 5K36H 3PUWA 3DXJC 2DN8A 4KKTA 5KNDA 3I73A 4BA2I 2B8GA 3IKJA 2AUJD 1FYCA 1DXMA 2JE6I 3SE0A 4PV1C 3VR4A 4KN7C 3BDOA 2A6EC 4I7ZC 1Y8NB 3D31A 4JK1C 1T5EA 1TU2B 3TZUA 1ZYRC 1GUNA 2BDOA 2A69C 4BA1I 1B9NA 1CFMA 1HQMC 1Q90A 2Q8IB 2KA7A 3H94A 2BA1A 1YNJC 1GUOA 1VF7A 1EWHA 1DCZA 3OOCA 4GZYC 3LWUA 2DNEA 1O7LA 3MXUA 3T56B 1E2WA 1H9SA 1CTMA 2DNCA 2EJGC 2JEBI 3MFYA 2JEAI 3QIAA 4G7OC 3L7ZC 1Y8OB 3OW7A 1K8OA 5BN4A 3ND8A 4TKOB 5JEAH 3IFTA 2O5JC 1DD2A 3W3AA 1Y69U 2EJMA 3PUYA 4IFDH 2K7VA 1OXTA 1OXXK 1E2ZA 2R6GA 4KMUC 2BA0A 3I72A 3A7AB 2NN6I 3VA7A 4OGQC 4OO1G 1IYVA 3P20A 1HCZA 4DK1A 3SDZA 1V8QA 2K32A 5C0XG 1Q1BA 3NE5B 5A35A 3QJYA 4XIGS 5KNCA 1H9MA 1Q1EA 2AWOA 3KLRA 3QG1A 1LABA 3LNNA 1G291 3AB9A 3N6RA 2L5TA 1GUGA 1Q12A 1GUSA 2BE5D 2E75C 4KN4C 1GHJA 4H13C
chains in the Genus database with same CATH superfamily
2VB2X 5EPJA 4M8AA 1STNA 4KV6A 5JOBA 3SK5A 3UDIA 4P74A 2PMZE 5C3EH 2LSSA 3H3VI 4DV0L 3HOVG 3NELA 1BXTA 3RZOH 3G48A 2X6LA 4LF5L 2L9HA 3K5LA 2EE1A 3S1MB 3TDQA 3DLLA 1G8ZD 1T9HA 1CSQA 1LTLA 3P75A 1I4GA 3L3OC 1NNXA 1WVLA 1N36L 3C46A 4P71A 4FO2A 4X65L 3A74A 1STAA 1D2BA 2NN6G 4KLKA 4IUTA 3U58A 1EIFA 4QJFA 2EYJA 3BVGA 4HSVA 2HCIA 3AMUA 4A75A 1S5ED 3I90A 4A3GB 1E7ZA 3C1EA 1P8LA 2B2TC 2IX3A 4RKLA 3VYTA 5IP9G 3PF4A 2K5VA 2R7ZH 1FNWA 4CKBA 3D4WA 1V1PB 3PIO3 1VQDA 1X6OA 2XIWA 2AUJD 1FYCA 3KDFA 1C8CA 4Z9CB 3VR4A 3SGIA 4A3BG 3FDTA 3D0FA 1HHVA 1K83B 1PH4A 1N32Q 5M5YH 2WP8J 2A19A 1GUOA 1YHAA 4JPBW 3OOCA 2ENBA 5ELBA 3TBIB 4RWSC 4A3LG 3IAYA 3SK4A 1KHIA 2JA5G 2VXWA 4JI1L 5C4JB 3S17H 1STGA 3TP5A 2WAQG 1PHJA 2WB1G 1JQYD 3BZKA 3F1ZA 5EPLA 4Y52H 4IPGA 2ZTEA 4N8X1 4IZ8A 1M1KC 1VQPA 4N9TA 3NEMA 4EQOA 4TRDA 4IPHA 1SAPA 2H5XA 4C1NK 2ASBA 2LFNA 4DPGA 4DV1Q 1NMGA 3MFGA 4CGYB 3HOZH 1X3GA 4GNXB 4AIMA 4K8IA 2B63H 1YJWA 1RCVD 3GP7A 4H13C 1EIYB 4A3JG 1VDZA 4J8QA 3UE1A 4KJOA 4X3UA 1HZ9A 5M3FG 2NVXH 4FF2A 5T1IA 1YHQA 2EQSA 1G51A 1L0WA 1QNUA 1HNZL 4XTCS 1B70B 4DV2Q 3GTGH 3VR5A 2ICEC 3H0GH 2MHVA 1CZWA 4JBWA 1F2MA 1LTRD 5M5XB 4FNFA 3PUVA 1E0BA 1X54A 2KCNA 1V9PA 3MEFA 3QR8A 2KCCA 1UAPA 1SLJA 3A55A 4XQJA 2EY5A 3PGZA 2UXCL 1HR0W 2NZOA 3RLNA 1ZKOA 4IUUA 2SOBA 3NENA 3E0EA 1EUJA 1XYIA 5ELDA 5CV4A 1XNRQ 4K0KL 1SROA 4IUNA 1IZ6A 4OX9L 3FPPA 1BR9A 3GTQH 2QDLA 2FJ2A 5IYDH 5LHY1 4IQZA 3QB3A 1C7YA 4QIWB 3O13A 5C4XB 2JE6I 3N52A 2PQEA 4JI5L 4JI2L 1E24A 3RR5A 1T5EA 4X62L 3MXPA 1U4LA 1LTTD 2ZJQA 2CH4W 2EY6A 4XYOA 4UHVA 3GTMB 4BBSG 2K01A 3F2CA 1SYDA 5C6AA 2B2UA 5IE8A 4ZUJA 3W5OA 4J6HA 4QUCA 2L11A 4M1UB 3GTJB 2JK8A 4G7OC 1HRJA 1DD2A 4E6IA 4B3SL 4IFDH 2Z6KA 4YCVA 1JE5A 5GADC 1PZJD 2GVAA 4L5QA 3UE0A 1HCZA 4DK1A 1HFNA 2SDFA 3HOVB 2UUBL 4DV3Q 4RGMA 1NUCA 1HNWQ 3F2BA 1KLGD 3WWVA 1OXVA 2F0OA 1W6JA 3L0OA 4B3RQ 1Q8KA 2Z1CA 5LL6S 2UUAQ 4DR6Q 1EWIA 1YZ6A 4QB4A 4POGA 4IFDI 4KKUA 3C2PA 2RA4A 3HFZB 4JG2A 1NSNS 2K5DA 5NUCA 1DOMA 4RKBA 3PV0A 3RN5A 1LTBD 2G5DA 3LX0A 4N8FA 4DK3C 1B9MA 3NBHA 3VR6A 4HSPA 1CHQD 5KRUA 1A3VA 4HIOA 2IY5B 1XX8A 2UXDQ 4DR3Q 2Y0SG 4ME3A 3JAME 3H91A 1HQRD 5C44H 3J80L 2XNAC 4A3BB 4H44C 4FF4A 1TS3A 1SFOH 5CBEE 2JSOA 3T1HQ 1LLRD 2E2HB 3I4MH 5C3WA 4HAEA 4GNXC 1C4QA 4DV4Q 4GOPA 3ULLA 2RVLA 1AW7A 2XVSA 2OF1A 1GD7A 1JB3A 3I73A 3LWEA 4Q5VA 2JA5B 4GKJL 2MO1A 4PV1C 4NB3A 1QCBD 3BDOA 3WOEA 4I7ZC 1F77A 1U4PA 2QEXA 1D5XC 4K5WA 4JI6L 2WAQB 3I7FA 2WB1B 2A8VA 1X3EA 1MSHA 4MTNA 2ICIA 1YEZA 4DV0Q 4PZ8A 3G7LA 2MP1A 3DWPA 3MWYW 5AFWA 3RZOB 1LTID 4LF5Q 2MNAA 4DR7L 5IWAL 3F2UA 4A3JB 1AEXA 3OIPA 2BA0A 2AQ1B 2OWOA 2EYFA 4HTHA 4ODGA 5M3FB 1EYGA 2E5LL 4R8NA 4PZ6A 4ME5A 1BF4A 1N36Q 4HN7A 1MD2D 3JC66 4C3JG 1XPRA 1H95A 2JQOA 4X65Q 4QIWE 1NBWA 4PNYA 2ID0A 5AJ3L 1WI5A 2TMPA 2M9VA 3BJUA 1HPCA 3TQYA 2NZ1D 1AH9A 1VQJA 2B8FA 3CC7A 1A62A 1Q3LA 3HOWH 2QKIC 4A3GH 5BN5A 4PMWA 5GQOA 3ND9A 4P72A 2HT1A 1JWMD 4BY1G 2QEJC 3BG3A 1VQCA 2F03A 2AWNA 5IP7H 4HJ7A 3NTKA 4F87A 5C44G 1CK1A 2UXBL 1KIXA 2B2WA 1FVIA 4B9XA 3PIPA 1TKWB 2Q2HA 4KK7A 3CXCA 3BDLA 2F0VA 1ENAA 2RSNA 1LT6D 2N55A 2ZT9C 3A54A 3CW2C 4YCUA 1H9JA 4ZAIA 1PVOA 3DWAA 1XTDA 4IUQA 2ATWA 2RHQB 3FP9A 4Y7NH 2MJ8A 1F9SA 3T13A 3Q22A 3PO2G 2EDGA 2WV6D 4IUVA 4KHZA 4YCWA 4JI1Q 2C5CA 2F0JA 2A5HA 5A2QE 1EQTA 2X69A 5C4JH 4BBSB 2PNRC 2K5WA 2CVRA 4O42A 4G4KA 4DAMA 1EIGA 2LMCB 4R8IA 4BXXH 3EFXD 2WKDA 2PI2E 4KKTA 1DONA 1I4XA 2MO0A 4ILWA 2B2YA 2E8GA 3HOZB 4CDEC 4JOIC 2B63B 4OWTB 3A0JA 5JJIA 3AFPA 3K8AA 1IHZA 2VW9A 4DK6C 1LTSD 1STEA 1WTHA 2NVXB 2K5QA 4HJ9A 5I6WA 1HNZQ 3CF5A 4GS3A 3GTGB 3PCOB 4RHSA 2R6GA 2ZXRA 3K6OA 4NXML 1PH6A 1TWGB 1XMQL 3HOWG 3GTPH 1NE3A 5IGGA 1D1IA 4C3HG 3H3VC 1SNQA 2KHJA 3CPFA 3D3RA 3I91A 4DNIA 4F8MA 5M5XH 2EXDA 2EOTA 2R7FA 4UAIA 2K28A 2XN9C 3AB9A 1JT8A 2F0LA 5IP7G 1HZCA 3K5MA 2UXCQ 3PIP3 1L1OA 4B3ML 3QOLA 3SK8A 2WAQE 1TY0A 1SRUA 5FO9B 2F0EA 3OWFA 2DY7A 2WB1E 1EYDA 1S3OA 2F4IA 3OMCA 2CH4A 1I50B 1X9NA 1UE6A 4K0KQ 4OX9Q 2O4XA 5GAHC 4MHEA 1G91A 3MVVA 2HD3A 3J7YW 4RGOS 2UU9L 2ZXPA 1VQNA 3G4SA 4L5SA 3I55A 1JOQA 4GN3B 1MJEA 1RJTA 3TREA 1BDOA 1VQHA 5C4XH 4JI5Q 1Y8PB 4JI2Q 4X62Q 4DV5L 4KY5A 4V0BA 3CCVA 3PUZA 2CCZA 3ITPA 1QOHA 2NZHA 1KRSA 4BXXG 3AU7A 1K8GA 4F88A 1A3TA 2F0DA 3NTIA 3EQLC 4K5VA 3V96A 3GTJH 3S2HH 5JAVA 4B3SQ 2JA8H 2IX1A 3NQIA 4XDXA 1EEID 3RD4A 1VMCA 4DGZA 1GUTA 2AQ3B 5CR3A 4BS9A 4IJHA 2B8GA 3I70A 3IKJA 4ID6A 2UUBQ 2JP1A 4Q0FA 3SE0A 3NBHB 2CWPA 4JK1C 3GO5A 2V1CC 5JEAJ 4LW1A 1FJGL 1BKBA 1SE8A 3H94A 1PRTB 4N9PA 1T5XD 4IJLA 2K1BA 1EOTA 1X3FA 4IOCA 5I2XA 3CU7A 5LMNL 2KCMA 3TP7A 2I5HA 4P75A 3U4ZA 1KRTA 4JBJA 1Q46A 3W3AA 1CA5A 1YHBA 3PUYA 4ZK9B 1E2ZA 4K6LA 3OTOQ 2DJGC 5HURA 2CW0D 2FHTA 1BBUA 1V8QA 3E9HA 3NE5B 3HKZG 4YIJA 4XIGS 1IYJB 5IP9H 5GAEC 4BY1B 2OTJA 3AQQA 2E2JH 2OTLA 4R4CA 1VMPA 4LF7Q 1KXLA 1CKNA 1QWYA 4K14A 3STBD 1QUQA 5EJWA 3HS0C 5C44B 5IYCG 1BNZA 2CW0C 1S5CD 4JV5L 5J1ZA 4GLVB 1SFOB 2OEOA 4A3BH 4L6TB 1CT1D 3K81C 1RHPA 1NR2A 3A7LA 1EYAA 5I2YA 3RLOA 3HG9A 1VQ9A 3VR2A 3S24A 4KD4A 3PSIA 1YBYA 3STBC 4A3LH 3PO2B 3FVQA 4EQPA 4A3DH 4K6DA 4GKJQ 2Q8RE 3A8JE 2NVTB 1IBLL 1A2TA 3VYUA 3QWNA 3RMHA 4JI6Q 1I4HA 5JVH3 3BU2A 2JA8G 4G57A 1X65A 2F3WA 4DR1L 1VQKA 2VL6A 2Z0SA 4YWKA 4YY3L 2QGQA 4LK1C 1B3AA 2G9HD 4FP5D 1XWEA 4F7XA 2EIFA 3NBIA 1A63A 4DR7Q 5IWAQ 5I4DA 3GQBA 1ZYRD 1S5BD 3KF6A 4IOAA 4A3JH 4B9WA 3M4YA 1VQ4A 2B2UC 4NXNL 2FXQA 2QCPX 1LM0A 2E5LQ 1SJHD 5M3FH 1AFPA 1CKOA 1S5DD 1BBWA 3A5ZB 4LMQD 1PRTF 1B3QA 4OEMB 4JI4Q 3Q8DA 5AJ3Q 3KLSX 1IKMA 4CHTB 1ZYRC 2Z6KC 5CV5A 1NMFA 1VS0A 3HOWB 3OYYA 2R3ZA 4C3HB 5F2DA 1J9OA 2DNEA 2EYOA 3MXUA 3T56B 5KIXA 2GN5A 4RFBA 5IYBG 3QIAA 1XMOQ 3OW7A 5BN4A 2F0SA 1QG7A 4RHRA 3J7AV 4GLXA 3H15A 1CHPD 5E4XA 1JJCB 1W2BA 3U50C 1SMXA 2K6AA 3TEHB 2UXBQ 1IYVA 1M90C 4QCLA 1SR3A 3SDZA 1M8AA 3NXWA 4JYAQ 2ZM6Q 5KNCA 5TSSA 3KYHC 1LABA 3J80E 2PZWA 2KEDA 1NR4A 4HCEA 4B08A 4Y7NB 2ZTDA 1E22A 2CFMA 1ENCA 1D5ZC 1PRTD 1SMYD 2LY7A 3OWEB 4DXGA 4A3DG 1SE2A 3ONAB 4K5XA 4XT1B 4YWLA 1MKHA 4BBSH 3HZXA 5KEEA 1O80A 2L55A 5LMUL 2FMCA 4RCOA 5FLMH 4KKSA 1ENFA 3Q24A 2PQAA 1PRTC 1SMYC 2KEEA 4PZ7A 4R4OA 1C48A 3M7NA 4XQQA 2IWHA 3DMUA 2HIVA 3AYHB 1KNAA 1J5EL 1SE3A 2KCTA 1L1OB 4EX5A 2RHSB 4HIMA 1PFMA 3AEVA 4ZYSA 1HUMA 1L2FA 3RLFA 3K57A 1LUZA 1SNCA 4R1JA 3EROA 5KYLA 1PTOB 4JYAL 3SEBA 5M5WH 3FRPB 2IW3A 3HOYG 1WTWA 4O1NA 2F1MA 1DOLA 3GTOB 3ICEA 1XTCD 2HDLA 4LF9L 4NXMQ 3GTPB 5JPNC 1XMQQ 1TWGH 1JOOA 3R8BA 3CHBD 3MEHA 4IPDA 2RDGA 4LF8L 5HY6A 1JMCA 1ILQA 1GM5A 3OW2A 2KENA 1TU2B 3CAMA 1R9TH 4B3MQ 1TR5A 2Q8IB 4PG3A 2BCOA 5CV9A 3RZDH 5M9OA 1U4RA 2DGYA 3HKZB 1I50H 4KY7A 3S2DB 4K2KA 1E2WA 2GA4B 1H9SA 3DEOA 3W1BA 1GUWA 2JEBI 4TSSA 5J3BA 4HJ8A 2UU9Q 4OIJA 1DM0B 3VA5A 1TVXA 3EJIA 1S72A 3CCLA 4OWXB 2FINB 4DV5Q 1SSOA 1Q1BA 5A35A 2YV5A 2YU9H 3Q6SA 2NB0A 4MTKA 1Q12A 5FLMG 1GOZA 1GUSA 3DHQA 5IGBA 3CD6A 2N88A 3S2HB 2KJXA 1PXUA 3VYRA 2IPKD 1JICA 3KJOA 3PQIA 2JA8B 1WTPA 2AUKA 1KAWA 3KF8B 1VQFA 1BUVT 1PV4A 1FR3A 3JAMi 1WD0A 1EFWA 1YITA 1LACA 1IKLA 1RTOA 2EY2A 2K52A 4WJ4A 2ALYB 3VYSA 4HR7B 3ERSX 3BZDB 4R4TA 4CDCC 5KNBA 1EWCA 2A68D 3A56A 1RIPA 2HHHL 5IGFA 1CQVA 1E2VA 3HRZC 1CKNB 1Z6HA 3W1GA 1FJGQ 1QUQB 1V43A 3ER0A 2M00A 1R4PB 1L0YB 3IL8A 5JEAG 5LMNQ 2D5DA 2Z4HA 4C3JH 2B2TA 2OXPA 1JB7A 2D62A 1FNVA 2A68C 3CC4A 1B2TA 2YYZA 1WCMG 4HJ5A 2A74C 4JI7L 4YHHL 3OTOL 1IYUA 1LT3D 2NVYH 3FHWA 4L8JA 3OMGA 1Y1WG 3BZCA 4L5TA 5M3MG 2E2JB 4BY1H 5CC4A 4RMFA 3CMEA 4BWGB 2RKSA 4LF7L 1D5MC 2JYOA 5I9PA 2ZJPA 1SXTA 2EY1A 4S3SA 4JV5Q 2EYLA 3V2TA 4KD3A 4L63B 2A73B 4QUFA 1U0LA 2IJ0A 5DLQE 1F9RA 3W2DA 3MAQA 3ULJA 1HXYD 1PTOD 4CKEA 2RSOA 2K04A 2QDBA 3KF6B 2QA4A 1Y8OB 2SNMA 3C1FA 3QO2A 3KBXA 4OIKA 1QZHA 1QILA 1HNXL 3M4OB 4XXEA 1EU4A 2IHFA 5IGCA 1L1OC 4PMCA 1KL9A 2H1EA 1VQLA 1B44D 3PO2H 4A3DB 2JA7H 4V190 3URYA 1IBLQ 5EKIA 2XRQD 2NVTH 4U673 5IGDA 1PTOC 4RGNA 4C3IG 2D9UA 3KLRA 4BBRG 3QG1A 4FDBA 4PQXA 1UE1A 4H02A 3N6RA 4DR1Q 1A15A 5E3FA 1MHWC 4JC0A 4DA2A 3BYTB 4YY3Q 4FXGC 3D6CA 2FMMA 4OHJA 3J80c 3GTKH 3DM1A 4KI0A 1LV9A 1S5FD 5DEHA 1O78A 2O5IC 4EGVA 1CZGA 1EFID 2VY3A 1XXGA 2EJFC 5BR8L 3HKZE 1GVPA 2RBMA 4TQUS 4NXNQ 4DNRB 5L37A 3KDFB 5D3IB 3HEJA 3I56A 1PZKD 5EGTA 2C35B 5C0XJ 3E0JA 3UDXA 1MI2A 4JI4L 3HOYB 4R4IA 4DUZL 3J81j 4DK0A 2RCFA 4DUYL 3CPWA 1JCKB 3CKIB 4RG1A 4IN3A 4AYBG 1TS4A 4C3HH 1RDPD 3Q0AA 4AQYL 2UUCL 1PYSB 1KAAA 4LJZC 2ZM6L 1XMOL 1X32A 1HJPA 2PQAB 4G7HC 2Z9HA 1X55A 1X3QA 3EA6A 4A76A 4WORA 2WFWA 2WIIB 3S14H 2M2LA 1K0RA 3PO3H 1GXDC 1STHA 3AFQA 3SXHA 2E2IH 2MQHA 3MA2B 2I46A 2JA7G 1W3SA 2KA7A 1E3PA 2BA1A 1TWCH 2BOSA 1NJIC 2OQKA 2ES2A 1N9WA 4GZYC 2JN4A 2SNSA 2OQ0A 4IUPA 3MFYA 1NAPA 5LMUQ 1JE4A 3DUZA 4IPCA 1Y69U 4A3IG 1QVCA 1GKHA 1HA5A 1I94L 3MXNA 1FL0A 3H09A 1R4QB 1HUNA 1EZ8A 3M4PA 5EBDA 1J5EQ 1H9MA 3X3MA 1SYFA 3HOXG 4QY7A 2WACA 1UE7A 5IIFA 2E75C 5I9OA 1VQ6A 2F4VL 3E3XA 2A6HD 5M5WB 1PTOH 4DR2L 1QZGA 1JOKA 1LT4D 5ELEA 4XQNA 5G3LD 4WJ3M 2HUGA 3GTOH 3DM3A 1TS5A 2OT2A 4LF9Q 2R93G 5KYIA 3K5OA 4C2MH 3TP6A 2LS01 2A6HC 1HTLD 1HR0L 5ISRA 2L12A 4LF8Q 3CCRA 2ZJRA 2F0KA 1WCMB 3SHLA 1H9RA 2JJQA 1R9TB 1IW7D 4CJ1B 2K33A 3GDEA 3TP8A 1DGSA 1WD1A 2QW7A 1Q8IA 1Y1WB 4DV7L 1JR0D 1PH1A 3RZDB 3CCEA 3DWQA 1GHKA 5M3MB 1PYWD 2XSCA 3S2DH 5IODA 1F2LA 1DOKA 5FKAC 3PO3G 4APVA 1SYCA 2I5LX 3I4NG 3J7A5 5EAYA 1IW7C 3F2DA 2Y0SB 4UPAA 3DEPA 1RD9D 1FGUA 5IYCH 1X56A 4I7AA 4JW0A 3VR3A 5HGTA 1KD1C 1EZ6A 3H6MA 3R3OA 4A3EG 3DXJC 2R7DA 2YTYA 2JA9A 4H7BA 2YU9B 4CJ0B 4L5RC 4A3MH 1VQIA 4QQBX 3L9AX 1SJED 1IXRA 5ELCA 1TT2A 3LGJA 4OXPA 4BA1I 1B9NA 4RAUC 4DAPA 5FOBB 4X66L 1KLUD 2XGTA 2L15A 2G9DA 3LWUA 4HMIA 4C3IB 1Y14B 4BBRB 4QMGA 2WKCA 2VQFL 2F52A 2L4NA 1BOSA 1OXXK 3EVQA 2MGSA 3A7AB 3SK6A 2HHHQ 2XTIA 3IFDA 5C3XA 1YNXA 1F9QA 4HIKA 1VQAA 1CUKA 1TS2A 1EY6A 2XRSD 1PH2A 4P2CB 1EOVA 1IL8A 3UDGA 4IURA 4DV6L 2BE5D 4C3JB 3RN2A 4FF3A 1IL2A 1GHJA 3RUZA 1GO3E 2K4KA 2O2LD 3MHBA 4GOPB 1VCIA 5C0XH 2VQEL 3R2IA 4RGTA 4JI7Q 3GD7A 4YHHQ 2NVYB 3FKIH 1QJOA 4AYBB 4DN4M 1ZXTA 1W6KA 1Z47A 4UP8A 1MSGA 5IT9L 1STYA 2VZAA 3OHXC 2BE5C 2Z4IA 4LFCL 1SEBD 5CORA 5IYBH 1OXUA 3CCMA 3S15B 4A3KH 1YVCA 1PLFA 5BN3A 2AMCB 3SR1A 1DYQA 3E9IA 2PO4A 5IOCA 2PPBC 1HFGA 4DFAA 3ZYYX 4LF6L 2F0IA 1WTRA 2ZXOA 3NHHA 2KOLA 3K0YA 1G6ZA 4ZLTF 4WFN3 4HEDA 4X3KA 1B8AA 5C0XI 4A3MG 3HKSA 1HNXQ 4NKLA 3M4OH 2JA7B 2EVBA 2AHOB 4LFBL 2MUYA 2DUDA 2YTVA 3OPOA 2I0QA 5C5MA 4A93G 4JI3L 4ZKBB 5IT9c 1UNSA 2XWJB 5CV8A 5DNFA 4FVMA 2EPBA 4JOIA 4BA2I 1UEBA 5D3DA 3TSSA 2PI2A 5IY0A 1DXMA 2L1BA 1XNQL 2VNUD 4A3IB 1EQRA 1GUNA 2VUMG 1MIUA 1VQMA 3GTKB 4LF4L 4IFDJ 4CDFC 1VF7A 3M3YH 1O7IA 1DCZA 3J80i 1G2SA 3F8TA 4CKCA 5BR8Q 1UEAB 2KHIA 4A4IA 3HOXB 2EZVA 2O5JC 4FYDA 3MC0B 2K05A 2RF4A 3CP0A 2Y0SE 4ZRZA 1HH2P 2X6GA 5COYA 3VA7A 1PH7A 1YNND 2VB3X 2J0TD 3HOYH 1ESFA 4GN4B 3EN2A 2R92G 1AP0A 2K32A 5C0XG 3CCJA 4DUZQ 4ZCKA 2Z8LA 3OIQA 4EVOA 4DUYQ 3FKIG 2R93B 5DM73 4KHPL 1G291 5C4ZA 1ZEQX 1VQEA 5CV6A 4AQYQ 1TQOA 2UUCQ 4OELB 3T1YL 3TS0A 4A3KG 1YNNC 4OO1H 5D65A 1A3UA 3CQZB 2BH8A 3KLSA 1EYCA 3P1HA 1Q82C 1I4QA 4ZUIA 3D4DA 3K80C 1I4RA 1RF2D 1G6PA 1EY0A 1EQVA 1EY8A 4WJWA 2JA6G 1LO5D 3MXNB 1I6VC 3S14B 3PO3B 4KY6A 1QB5D 3E6ZX 3I4NB 1BVSA 1SE4A 3SVMA 4LUZA 1KC8C 2E2IB 5FK9C 1DZ1A 1K8MA 4C1NI 4HIDA 1OXSC 4ZQ3A 4RCNA 1TWCB 2AKWB 5CMDA 1EY9A 5E7NA 4A3EB 3S1NH 5DAUA 3CCSA 4OO1I 3FMCA 3M85A 1FD7D 1AE3A 4IALA 1ONLA 4HCSA 3T16A 4CJ2C 3U9SA 1NY4A 1WTOA 4R9WA 1JWSD 1KDCA 1HTPA 2AQ2B 3KFUA 1I94Q 4DR4L 1C0AA 1KABA 2BH2A 4AYBE 1MGSA 1HA6A 3I3CA 1SN8A 4GOPC 4NDXA 2HQEA 5J22A 1MJCA 4KN7C 4PMBA 1SYBA 4X3TA 2F4VQ 3J7AF 1N34L 1Q90A 1EL0A 5C3EG 1F9PA 1P16A 4MIUA 4NPSA 4UDUC 4DR2Q 1WJJA 2XWBB 2KVMA 1J8IA 4B3TL 4CDDC 4TVAB 4C2MB 5JEAH 3ND8A 5FLXL 1I3QH 1WFQA 1WTQA 1DJRD 1RTNA 3K58A 2F0GA 2YTXA 1MBYA 1HR0Q 2B2VA 2D0PA 2F0PA 4EQ5A 3K7AB 4DR5L 4A3CH 1XJVA 4OO1G 4OGQC 1SNOA 1WCMH 1V1OA 3HOUH 3FPUB 2RDFA 2AWOA 1PH5A 1EQQA 4DV7Q 3S1QH 1Y1WH 4LUOA 4GN5A 2L5TA 1GUGA 5M3MH 1A2UA 1IBKL 1VQGA 3TMEA 2Q8TA 1JC7A 4POFA 1F2ZA 1RODA 3S16B 2R7ZG 2F0NA 2V4DA 3PUXA 3KBGA 1AE2A 2B3GA 4LFAL 4JI8Q 1B50A 4G7ZC 3A8IE 4DF7A 5I6YA 1BCPB 1TWAB 1CSPA 1IBML 3PMFA 4X3SA 5FLXc 1N8RC 2SEBD 1A6XA 4MZ9A 3J81L 3I8ZA 2NTSA 5GAGC 2F3VA 3GTLH 1GJXA 2JXMB 2RCNA 4A3MB 1PFSA 1H9KA 3S1RB 1AN8A 2NWGA 3NSWA 4ULLA 1PMRA 4ALPA 1B7YB 1SNPA 1AZPA 2B29A 4X66Q 1BO0A 1Q86C 4A93B 2B2WC 2CQOA 5ELOA 2E74C 2IT1A 4C3IH 4BBRH 1FNUA 1Z7TA 2P5ZX 1YJNA 2VQFQ 2F0QA 3OSOA 1BQQT 4X64L 2VUMB 2D2CC 3NWSA 5J39A 3CRLC 2A69D 1JJGA 3P7JA 1YNJD 3GV6A 3UDFA 1NTGA 3PUWA 3HOZG 1G2TA 2DN8A 1A8VA 2EXZA 1XPUA 4HMJA 2PZUA 2RDHA 3J81c 2B63G 5JVG3 1PTOF 2PW5A 2MFIA 3E5SA 3I4OA 1Y8NB 4DV6Q 3PF5A 2KUMA 2LKVA 2A69C 2NYZD 1PA6A 1O7YA 2OCEA 4GKKL 2B2YC 2MPMA 1YNJC 1RL2A 4A3CG 2DJFC 3MTSA 1C9OA 2R92B 2VQEQ 3KOJA 3HOUG 1QVGA 3FKIB 3H0GG 4DAVA 4BY7H 2F0FA 3L7ZC 4TKOB 4LFCQ 2K7VA 3GV3A 4FF1A 4KTAA 4RA8A 4A3KB 3I72A 3S15H 5E4WC 4MNOA 4GLAC 4A3FH 1WTXA 3TRZA 5FO8B 1K0SA 5LMNW 1B1ZA 3QJYA 2Q2TA 4U68A 3CMAA 2C9OA 1Q1EA 2QILA 4CBVA 1PFNA 3LNNA 4LF6Q 2KHSA 2JA6B 4K2LA 2NTTA 2I5MX 1BCPF 4DU9A 3KUPA 1VF5C 1LTGD 1ASZA 1I6HH 3A8KE 4K8JA 5IYDG 1KQSA 1KDAA 3M7GA 3NWTA 1SBBB 3EBEA 3MZ5A 4RH6A 3WDNA 4LFBQ 1Y1VH 2EYHA 4JBMA 2HCCA 1Z9FA 4JI3Q 1HZAA 1CKMA 1TWHB 2HQLA 3TS2A 1U9RA 2LXJA 1BBXC 1O7ZA 2F0MA 1TIID 1XNQQ 2NVQH 4A3IH 1S4ZA 1JORA 2CHBD 4LF4Q 1UWVA 3QOJA 4DKAC 1TWFH 4JI0L 3M3YB 2BDNA 2CKZB 1K28A 5GROA 2TSSA 3BS1A 4IFDG 1ET6A 4NMZA 1N33L 5ELNA 2F3IA 1NCVA 3HOXH 3NPPA 3BVMA 1ML0D 4WRDA 2A6ED 4ZKCB 1BCPD 4MN3A 5C3EB 2I07B 1KTKA 5IGEA 1KDBA 2PYKA 2Q2IA 4O2DA 3G6EA 1J6QA 5EQ0A 1U5KA 3S1MH 4BY7G 1F2YA 4KHPQ 1XPOA 2R93H 2ZTCA 4QGUA 2A6EC 1BCPC 5JPMC 3IRBA 3CCUA 3T1YQ 5H1SE 2BDOA 1K3BC 1VQBA 1HQMC 5DM63 3VDYA 4OL7A 1K9MC 4DAYA 1EEFD 2PNHA 2CWAA 4A3FG 1EWHA 3G6JB 3M4QA 3CQZH 5IT9E 4JVZA 2CQAA 1D8LA 1O7LA 4OONA 1SYEA 5CYUA 2DNCA 5EKKA 2JEAI 2KQ3A 3IFTA 1EY7A 2EJMA 3EIVA 1SNDA 3ZJYC 1EY4A 4HJAA 2R7ZB 4NW2A 3CCQA 2K50A 3I4NH 2WINB 3KJPA 3WOFA 3I2ZA 1LTAD 5G3LF 1PH8A 4O0AA 3D8GA 1WYDA 1PFBA 1Y1VG 3S1NB 4UY8C 4A3EH 4IO9A 3U9OA 1N32L 1K83H 5M5YB 3I4MG 2EYPA 1ET9A 2IHEA 1QE6A 1TXYA 3ERQA 1Q81C 1OTCA 2K75A 4LAAA 1PH3A 4DR4Q 3RNUA 1D1KA 5E1FA 1TY2A 3NUCA 1I4PA 1OO9B 2QF7A 3S17B 2B39A 3D4RA 3K0XA 2F0HA 3CC2A 1K73C 1VQ8A 4H0LC 1UUPA 1SYGA 1SNMA 1V1PA 1N34Q 2E76C 2PCFB 4LWCA 1H9SB 4LNQA 1AZQA 5CBAE 1RKNA 1ICWA 2KBNA 3NP8A 4DV1L 3C3LA 2NBFA 1YJ9A 3ULPA 4QL5A 4EQNA 5CV7A 3NQTA 3T53B 4J15A 4XYQA 1VQOA 4B3TQ 1LYLA 1E1TA 1I3QB 1SDFA 4P73A 2RQXA 3T4AC 4DR5Q 3TZDA 3K7AH 3KK7A 2FFKB 1YI2A 3HOUB 1EY5A 5K36H 4YWMA 4DV2L 1B53A 1CQFA 3H0GB 4UP7A 4ABNA 3S1QB 2GVBA 1PYBA 1UE5A 1U4MA 1ESRA 3G71A 2N3SA 2K5NA 3J7ZC 1E1OA 1IBKQ 4A3GG 2LXKA 1CFMA 1ICFB 5EBCA 2F0TA 3S16H 1CA6A 3NTHA 4GNXA 4LFAQ 2PMZB 4JI8L 2NUCA 3V05A 4NP5A 3R2TA 2K5HA 1CTMA 3S9WA 2EJGC 1LT5D 1TWAH 1IBMQ 2K03A 4R4QA 3GTLB 3JAML 1XNRL 4KMUC 4FXKC 3GTQB 5KGUA 5JJLA 3S1RH 1X3PA 5T1GA 4LUVA 2J4XA 5FJ8H 4UP9A 1PDQA 2Z6BA 4A93H 2IX0A 2IL8A 2L0CA 3FEWX 1STBA 4JBKA 1CM9A 3GTMH 3I4LA 4KHVA 1K3RA 4X64Q 2N8NA 4XT3B 2VUMH 3HGBA 1A0IA 1L0XB 5EPKA 2D0OA 2H4OA 2R61A 2K14A 1CI3M 1D6EC 3JAMc 4JCVE 1WOCA 1M4VA 3BDCA 3J81i 4FXDA 3B6YA 2HIXA 2J7ZA 3HP3A 5CGKA 2F0UA 5JJZA 1JJ2A 4GKKQ 3HOVH 3MXGA 3U4VA 1QNKA 4DV3L 3L2PA 2R92H 1K8AC 3T51B 5K36G 5FLXE 2DY8A 4DNTB 1V1QA 1HNWL 4KJNA 3CRKC 3K7UC 4BY7B 5ELFA 2EYMA 3BVZA 3BYYB 1ASYA 4B3RL 5K5PA 2Q2UA 2PZTA 2UUAL 2E2DC 4DR6L 1YIJA 4AH6A 4A3FB 2NN6H 3Q23A 1B4OA 3KF8A 1Q7YC 4OWWB 1EU3A 5KNDA 2KECA 3K5NA 2PW7A 3NK9A 2JA6H 4I65A 5LL6X 1VQ5A 3D31A 3TZUA 4DXFA 3M9BA 2B2VC 1PH9A 3KLWA 1I6HB 1ILPA 5EKLA 3TN2A 1I5FA 1EIHA 2F0WA 1PZID 5HGQA 3D6WA 1JWUD 3J81E 1Y1VB 3A5UA 4DR3L 5D14A 2UXDL 5FJ8G 3H3VH 2A1AA 3R93A 5C4XG 1K8OA 5C5LA 3X3NA 1HZBA 1WTVA 4X6AH 1TWHH 5C4HA 1FGBD 3PIOA 1OXTA 3T1HL 3I4MB 2E2HH 1II3A 3UI2A 2N78A 1D7QA 2NN6I 5JJKA 2NVQB 3P20A 2VS1A 4DV4L 1QVFA 2N49A 5A2QL 1VQ7A 4C56C 1TWFB 4QF4A 4JI0Q 3K59A 1KNEA 5FO7B 2JA5H 1S40A 2HDMA 4DAYB 4J1MA 4KN4C 1N33Q
chains in the Genus database with same CATH topology
2VB2X 5EPJA 4M8AA 1STNA 4KV6A 5JOBA 3SK5A 1BXTA 2X6LA 2L9HA 3K5LA 2EE1A 3S1MB 3TDQA 1G8ZD 3P75A 1I4GA 3L3OC 1WVLA 3C46A 4FO2A 1STAA 1D2BA 2NN6G 4IUTA 2EYJA 3BVGA 4HSVA 2HCIA 3AMUA 1S5ED 3I90A 4A3GB 3C1EA 2B2TC 2IX3A 4RKLA 3VYTA 1FNWA 4CKBA 3D4WA 1V1PB 3PIO3 2XIWA 2AUJD 1FYCA 1C8CA 4Z9CB 3VR4A 3FDTA 1HHVA 1K83B 2WP8J 1GUOA 3OOCA 2ENBA 5ELBA 3TBIB 4RWSC 3IAYA 3SK4A 2VXWA 5C4JB 1STGA 3TP5A 1JQYD 5EPLA 4IZ8A 4N9TA 4EQOA 4TRDA 1SAPA 4C1NK 2LFNA 3MFGA 4CGYB 4K8IA 1RCVD 3GP7A 4H13C 1VDZA 4J8QA 4KJOA 4X3UA 4FF2A 5T1IA 1QNUA 4XTCS 3VR5A 2ICEC 2MHVA 1CZWA 4JBWA 1F2MA 1LTRD 5M5XB 4FNFA 3PUVA 1E0BA 2KCNA 2KCCA 1UAPA 4XQJA 3A55A 2EY5A 1ZKOA 4IUUA 2SOBA 1XYIA 5ELDA 5CV4A 4IUNA 3FPPA 1BR9A 2FJ2A 5LHY1 4IQZA 3QB3A 4QIWB 3O13A 5C4XB 2JE6I 3N52A 2PQEA 1T5EA 3MXPA 1U4LA 1LTTD 4XYOA 2EY6A 3GTMB 2K01A 1SYDA 5C6AA 2B2UA 4ZUJA 4J6HA 4QUCA 2L11A 4M1UB 3GTJB 4G7OC 1HRJA 1DD2A 4E6IA 4IFDH 1PZJD 1HCZA 4DK1A 1HFNA 2SDFA 3HOVB 4RGMA 1NUCA 1KLGD 1OXVA 2F0OA 1W6JA 2Z1CA 5LL6S 4QB4A 4IFDI 4KKUA 3C2PA 2RA4A 1NSNS 2K5DA 5NUCA 1DOMA 4RKBA 3PV0A 1LTBD 3LX0A 1B9MA 3NBHA 3VR6A 4HSPA 1CHQD 5KRUA 1A3VA 1XX8A 3JAME 3H91A 1HQRD 3J80L 2XNAC 4A3BB 4H44C 4FF4A 1TS3A 5CBEE 2JSOA 1LLRD 2E2HB 5C3WA 4HAEA 1C4QA 2RVLA 1AW7A 2XVSA 2OF1A 1JB3A 3I73A 3LWEA 4Q5VA 2JA5B 4PV1C 1QCBD 3BDOA 3WOEA 4I7ZC 1F77A 1U4PA 1D5XC 4K5WA 2WAQB 2WB1B 1MSHA 2ICIA 3G7LA 2MP1A 3DWPA 3MWYW 5AFWA 3RZOB 1LTID 3F2UA 4A3JB 1AEXA 3OIPA 2BA0A 2AQ1B 2EYFA 4HTHA 4ODGA 5M3FB 4R8NA 4ME5A 1BF4A 4HN7A 1MD2D 4C3JG 4PNYA 2ID0A 2TMPA 2M9VA 1HPCA 2NZ1D 2B8FA 1Q3LA 2QKIC 5BN5A 4PMWA 3ND9A 1JWMD 2QEJC 3BG3A 2F03A 2AWNA 3NTKA 4F87A 1CK1A 2B2WA 4B9XA 1TKWB 4KK7A 3BDLA 2F0VA 1ENAA 2RSNA 1LT6D 2N55A 2ZT9C 3A54A 4ZAIA 1H9JA 3DWAA 4IUQA 2MJ8A 1F9SA 3T13A 3Q22A 2EDGA 2WV6D 4IUVA 4KHZA 2C5CA 2F0JA 2A5HA 5A2QE 1EQTA 2X69A 4BBSB 2PNRC 2K5WA 2CVRA 4O42A 4G4KA 1EIGA 2LMCB 4R8IA 3EFXD 2WKDA 4KKTA 1DONA 1I4XA 4ILWA 2B2YA 3HOZB 2B63B 1IHZA 1LTSD 1STEA 2NVXB 2K5QA 5I6WA 3GTGB 4RHSA 2R6GA 2ZXRA 3K6OA 1TWGB 5IGGA 1D1IA 4C3HG 3H3VC 1SNQA 4F8MA 3D3RA 3I91A 2EOTA 4UAIA 2K28A 2XN9C 3AB9A 2F0LA 3K5MA 3PIP3 3QOLA 3SK8A 1TY0A 5FO9B 2F0EA 3OWFA 2DY7A 1EYDA 2F4IA 3OMCA 1I50B 2O4XA 4MHEA 1G91A 3MVVA 3J7YW 4RGOS 2ZXPA 1JOQA 1RJTA 1BDOA 1Y8PB 4KY5A 4V0BA 3PUZA 3ITPA 1QOHA 3AU7A 4F88A 1A3TA 2F0DA 3NTIA 3EQLC 4K5VA 3V96A 5JAVA 2IX1A 3NQIA 4XDXA 1EEID 3RD4A 1VMCA 4DGZA 1GUTA 2AQ3B 5CR3A 4BS9A 2B8GA 3I70A 3IKJA 4ID6A 2JP1A 4Q0FA 3SE0A 4JK1C 3GO5A 5JEAJ 3H94A 1PRTB 4N9PA 1T5XD 2K1BA 1EOTA 5I2XA 3CU7A 3TP7A 3W3AA 1CA5A 3PUYA 4ZK9B 1E2ZA 4K6LA 5HURA 2CW0D 2FHTA 1V8QA 3NE5B 4YIJA 4XIGS 4BY1B 1VMPA 1QWYA 4K14A 5EJWA 3HS0C 5C44B 1BNZA 2CW0C 1S5CD 5J1ZA 1SFOB 2OEOA 4L6TB 1CT1D 1RHPA 1NR2A 3A7LA 1EYAA 5I2YA 3HG9A 3VR2A 4KD4A 3PO2B 3FVQA 4EQPA 4K6DA 2Q8RE 3A8JE 2NVTB 1A2TA 3VYUA 3QWNA 3RMHA 1I4HA 5JVH3 4G57A 2F3WA 4LK1C 1B3AA 2G9HD 4FP5D 1XWEA 4F7XA 3NBIA 5I4DA 3GQBA 1ZYRD 1S5BD 4B9WA 3M4YA 2B2UC 2QCPX 1SJHD 1AFPA 1S5DD 4LMQD 1PRTF 3KLSX 1IKMA 4CHTB 1ZYRC 5CV5A 3HOWB 2R3ZA 4C3HB 5F2DA 1J9OA 2DNEA 2EYOA 3MXUA 3T56B 5KIXA 4RFBA 3QIAA 3OW7A 5BN4A 2F0SA 1QG7A 4RHRA 3J7AV 1CHPD 5E4XA 2K6AA 1IYVA 4QCLA 3SDZA 1M8AA 3NXWA 5KNCA 5TSSA 1LABA 3J80E 2PZWA 2KEDA 1NR4A 4HCEA 4B08A 4Y7NB 1PRTD 1ENCA 1D5ZC 1SMYD 2LY7A 3OWEB 4DXGA 1SE2A 3ONAB 4K5XA 4XT1B 3HZXA 5KEEA 1O80A 2L55A 2FMCA 4RCOA 4KKSA 1ENFA 3Q24A 1PRTC 1SMYC 2KEEA 1C48A 3M7NA 4XQQA 2IWHA 3DMUA 1KNAA 1SE3A 1PFMA 4ZYSA 1HUMA 3RLFA 3K57A 1SNCA 3EROA 5KYLA 1PTOB 3SEBA 3FRPB 2IW3A 1WTWA 4O1NA 2F1MA 1DOLA 3GTOB 1XTCD 2HDLA 3GTPB 5JPNC 3R8BA 1JOOA 3CHBD 3MEHA 2RDGA 1ILQA 1TU2B 1TR5A 2Q8IB 2BCOA 5CV9A 5M9OA 1U4RA 3HKZB 4KY7A 3S2DB 4K2KA 1E2WA 2GA4B 1H9SA 3DEOA 1GUWA 2JEBI 4TSSA 4OIJA 1DM0B 3VA5A 1TVXA 3EJIA 2FINB 1SSOA 1Q1BA 5A35A 3Q6SA 2NB0A 1Q12A 1GOZA 1GUSA 3DHQA 5IGBA 3S2HB 2N88A 2KJXA 1PXUA 3VYRA 2IPKD 1JICA 2JA8B 1WTPA 2AUKA 1BUVT 1FR3A 1WD0A 1LACA 1IKLA 1RTOA 2EY2A 3VYSA 4HR7B 3BZDB 5KNBA 1EWCA 2A68D 3A56A 5IGFA 1CQVA 1E2VA 3HRZC 1Z6HA 1V43A 2M00A 1R4PB 1L0YB 3IL8A 5JEAG 2D5DA 2Z4HA 2B2TA 2OXPA 2D62A 1FNVA 2A68C 1B2TA 2YYZA 2A74C 1IYUA 1LT3D 4L8JA 3OMGA 2E2JB 5CC4A 4BWGB 2RKSA 1D5MC 2JYOA 5I9PA 1SXTA 2EY1A 4S3SA 2EYLA 3V2TA 4KD3A 4L63B 2A73B 4QUFA 3W2DA 2IJ0A 3MAQA 1F9RA 1HXYD 1PTOD 4CKEA 2RSOA 2K04A 2QDBA 1Y8OB 2SNMA 3C1FA 3QO2A 3KBXA 4OIKA 1QILA 3M4OB 4XXEA 1EU4A 5IGCA 4PMCA 2H1EA 4A3DB 1B44D 4V190 3URYA 5EKIA 2XRQD 4U673 5IGDA 1PTOC 4RGNA 4C3IG 2D9UA 3KLRA 3QG1A 4PQXA 3N6RA 1A15A 5E3FA 4DA2A 3BYTB 4FXGC 3D6CA 2FMMA 4OHJA 3DM1A 4KI0A 1LV9A 1S5FD 5DEHA 1O78A 2O5IC 4EGVA 1CZGA 1EFID 1XXGA 2EJFC 2RBMA 4TQUS 4DNRB 5D3IB 3HEJA 1PZKD 5EGTA 5C0XJ 3E0JA 1MI2A 3HOYB 4DK0A 1JCKB 3CKIB 4IN3A 1TS4A 1RDPD 3Q0AA 1KAAA 4LJZC 1X32A 4G7HC 1X3QA 3EA6A 4WORA 2WIIB 2M2LA 1GXDC 1STHA 3SXHA 3MA2B 2I46A 2KA7A 2BA1A 2BOSA 4GZYC 2SNSA 4IUPA 3MFYA 1NAPA 1JE4A 3DUZA 1Y69U 1HA5A 3MXNA 3H09A 1R4QB 1HUNA 1EZ8A 5EBDA 1H9MA 3X3MA 1SYFA 2WACA 5IIFA 2E75C 5I9OA 2A6HD 5M5WB 1PTOH 1JOKA 1LT4D 5ELEA 4XQNA 5G3LD 2HUGA 1TS5A 2OT2A 5KYIA 3K5OA 3TP6A 2LS01 2A6HC 1HTLD 5ISRA 2L12A 2F0KA 1WCMB 3SHLA 1H9RA 1R9TB 1IW7D 4CJ1B 2K33A 3TP8A 1WD1A 1Q8IA 1Y1WB 1JR0D 3RZDB 3DWQA 1GHKA 5M3MB 1PYWD 2XSCA 5IODA 1F2LA 1DOKA 5FKAC 1SYCA 1IW7C 2Y0SB 3DEPA 1RD9D 5HGTA 3VR3A 1EZ6A 3H6MA 3R3OA 3DXJC 4H7BA 2YU9B 4CJ0B 3L9AX 1SJED 5ELCA 1TT2A 4BA1I 1B9NA 4RAUC 4DAPA 5FOBB 1KLUD 2G9DA 3LWUA 4HMIA 4C3IB 4BBRB 4QMGA 2WKCA 2L4NA 1BOSA 1OXXK 3EVQA 2MGSA 3A7AB 3SK6A 3IFDA 5C3XA 1F9QA 1TS2A 1EY6A 2XRSD 4P2CB 1IL8A 4IURA 2BE5D 4C3JB 4FF3A 1GHJA 3RUZA 2O2LD 3MHBA 1VCIA 5C0XH 3R2IA 4RGTA 3GD7A 2NVYB 1QJOA 4AYBB 4DN4M 1ZXTA 1W6KA 1Z47A 1MSGA 5IT9L 1STYA 3OHXC 2BE5C 2Z4IA 1SEBD 5CORA 1OXUA 3S15B 1PLFA 5BN3A 3SR1A 1DYQA 2PO4A 5IOCA 2PPBC 1HFGA 4DFAA 3ZYYX 2F0IA 1WTRA 2ZXOA 3NHHA 2KOLA 3K0YA 1G6ZA 4ZLTF 4WFN3 4HEDA 4X3KA 5C0XI 4NKLA 2JA7B 2EVBA 2MUYA 3OPOA 5C5MA 4ZKBB 1UNSA 2XWJB 5CV8A 5DNFA 4FVMA 2EPBA 4BA2I 5D3DA 3TSSA 1DXMA 2L1BA 2VNUD 4A3IB 1GUNA 3GTKB 4IFDJ 1VF7A 1DCZA 1G2SA 4CKCA 1UEAB 3HOXB 2EZVA 2O5JC 4FYDA 3MC0B 2K05A 4ZRZA 2X6GA 5COYA 3VA7A 1YNND 2VB3X 2J0TD 1ESFA 1AP0A 2K32A 5C0XG 2Z8LA 3OIQA 4EVOA 2R93B 5DM73 1G291 5C4ZA 1ZEQX 5CV6A 1TQOA 1YNNC 4OO1H 5D65A 1A3UA 3CQZB 3KLSA 1EYCA 3P1HA 1I4QA 4ZUIA 3D4DA 1I4RA 1RF2D 1EY0A 1EQVA 1EY8A 4WJWA 1LO5D 1I6VC 3S14B 3PO3B 4KY6A 1QB5D 3E6ZX 3I4NB 1SE4A 3SVMA 2E2IB 5FK9C 1DZ1A 4C1NI 1K8MA 1OXSC 4ZQ3A 4RCNA 1TWCB 5CMDA 1EY9A 4A3EB 5DAUA 4OO1I 3FMCA 3M85A 1FD7D 4IALA 1ONLA 4HCSA 3T16A 4CJ2C 3U9SA 1WTOA 4R9WA 1JWSD 1KDCA 1HTPA 2AQ2B 1KABA 1MGSA 1HA6A 3I3CA 4NDXA 2HQEA 5J22A 4KN7C 4PMBA 1SYBA 4X3TA 3J7AF 1Q90A 1EL0A 1F9PA 4MIUA 4UDUC 2XWBB 2KVMA 1J8IA 4C2MB 5JEAH 3ND8A 5FLXL 1WTQA 1DJRD 1RTNA 3K58A 2F0GA 1MBYA 2B2VA 2F0PA 3K7AB 4OO1G 4OGQC 1SNOA 1V1OA 3FPUB 2RDFA 2AWOA 2L5TA 1GUGA 1A2UA 3TMEA 2Q8TA 1JC7A 1F2ZA 1RODA 3S16B 2F0NA 2V4DA 3PUXA 3KBGA 1B50A 4G7ZC 3A8IE 4DF7A 5I6YA 1BCPB 1TWAB 3PMFA 4X3SA 2SEBD 1A6XA 3J81L 3I8ZA 2NTSA 2F3VA 1GJXA 2JXMB 4A3MB 1H9KA 3S1RB 1AN8A 2NWGA 3NSWA 4ULLA 1PMRA 1SNPA 1AZPA 1BO0A 4A93B 2B2WC 2E74C 2IT1A 1FNUA 1Z7TA 2F0QA 3OSOA 1BQQT 2VUMB 2D2CC 3NWSA 5J39A 3CRLC 2A69D 3P7JA 1YNJD 3GV6A 3PUWA 1G2TA 2DN8A 2EXZA 4HMJA 2PZUA 2RDHA 5JVG3 1PTOF 2PW5A 3E5SA 1Y8NB 2KUMA 2LKVA 2A69C 2NYZD 1O7YA 2B2YC 2MPMA 1YNJC 3MTSA 2R92B 3FKIB 4DAVA 2F0FA 3L7ZC 4TKOB 2K7VA 3GV3A 4FF1A 4KTAA 4RA8A 4A3KB 3I72A 5E4WC 1WTXA 5FO8B 1B1ZA 3QJYA 4U68A 2C9OA 1Q1EA 2QILA 4CBVA 1PFNA 3LNNA 2KHSA 2JA6B 4K2LA 2NTTA 1BCPF 4DU9A 3KUPA 1VF5C 1LTGD 3A8KE 4K8JA 1KDAA 3M7GA 3NWTA 1SBBB 3MZ5A 4RH6A 3WDNA 2EYHA 2HCCA 1TWHB 1U9RA 1BBXC 1O7ZA 2F0MA 1TIID 1S4ZA 1JORA 2CHBD 3QOJA 3M3YB 2BDNA 2TSSA 3BS1A 4IFDG 1ET6A 4NMZA 1NCVA 3NPPA 3BVMA 1ML0D 4WRDA 4ZKCB 2A6ED 1BCPD 4MN3A 5C3EB 2I07B 1KTKA 5IGEA 1KDBA 2PYKA 5EQ0A 1F2YA 2A6EC 1BCPC 5JPMC 2BDOA 1HQMC 5DM63 4OL7A 4DAYA 1EEFD 1EWHA 3G6JB 5IT9E 2CQAA 1O7LA 1SYEA 5CYUA 2DNCA 5EKKA 2JEAI 2KQ3A 3IFTA 1EY7A 2EJMA 1SNDA 1EY4A 2R7ZB 4NW2A 2WINB 3WOFA 1LTAD 5G3LF 3D8GA 1PFBA 3S1NB 3U9OA 5M5YB 2EYPA 1ET9A 1QE6A 3ERQA 4LAAA 1D1KA 5E1FA 1TY2A 3NUCA 1I4PA 1OO9B 2QF7A 3S17B 2B39A 3D4RA 2F0HA 4H0LC 1UUPA 1SYGA 1SNMA 1V1PA 2E76C 2PCFB 1H9SB 1AZQA 5CBAE 1RKNA 1ICWA 3NP8A 3C3LA 2NBFA 4EQNA 5CV7A 3NQTA 3T53B 4XYQA 1I3QB 1SDFA 2RQXA 3T4AC 3TZDA 3KK7A 2FFKB 3HOUB 1EY5A 5K36H 1B53A 1CQFA 3H0GB 4ABNA 3S1QB 1U4MA 1ESRA 1CFMA 5EBCA 2F0TA 1CA6A 3NTHA 2PMZB 2NUCA 3V05A 4NP5A 3R2TA 1CTMA 3S9WA 2EJGC 1LT5D 2K03A 3GTLB 3JAML 4KMUC 4FXKC 3GTQB 5KGUA 1X3PA 5T1GA 2J4XA 1PDQA 2IX0A 2IL8A 2L0CA 3FEWX 1STBA 1CM9A 3I4LA 4KHVA 4XT3B 3HGBA 1L0XB 5EPKA 2H4OA 2R61A 1CI3M 1D6EC 1M4VA 3BDCA 4FXDA 2J7ZA 3HP3A 5CGKA 5JJZA 2F0UA 3MXGA 1QNKA 3T51B 5K36G 5FLXE 2DY8A 4DNTB 4KJNA 3CRKC 4BY7B 5ELFA 2EYMA 3BVZA 3BYYB 5K5PA 2PZTA 2E2DC 4A3FB 2NN6H 3Q23A 1B4OA 3KF8A 1EU3A 5KNDA 2KECA 3K5NA 2PW7A 3NK9A 4I65A 5LL6X 3D31A 3TZUA 4DXFA 2B2VC 1I6HB 1ILPA 5EKLA 3TN2A 1EIHA 2F0WA 1PZID 3D6WA 1JWUD 3J81E 1Y1VB 5D14A 3R93A 1K8OA 5C5LA 3X3NA 1WTVA 5C4HA 1FGBD 1OXTA 3I4MB 1II3A 3UI2A 2NN6I 2NVQB 3P20A 5A2QL 4C56C 1TWFB 4QF4A 3K59A 1KNEA 5FO7B 2HDMA 4J1MA 4KN4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H D;  1VF5 C;  2CW0 C;  1VDZ A;  1HPC A;  2V4D A;  1YNN C;  1OXV A;  3A8K E;  3I4L A;  3PUX A;  2B8F A;  4KI0 A;  4OO1 H;  1VCI A;  1O78 A;  2AUK A;  5BN5 A;  5C0X H;  2O5I C;  4G7Z C;  3A7L A;  3A8I E;  3GD7 A;  3HGB A;  3ND9 A;  2EJF C;  3WDN A;  4TQU S;  4DNR B;  1FR3 A;  1QJO A;  3VR2 A;  1LAC A;  4XTC S;  3BG3 A;  2BE5 C;  1I6V C;  4KKS A;  1CI3 M;  4KKU A;  3VR5 A;  2QF7 A;  4HR7 B;  1A6X A;  1SMY C;  2A6H C;  1GJX A;  2JXM B;  1OXU A;  3D4R A;  5KNB A;  1BDO A;  3A8J E;  1H9K A;  2A68 D;  1Y8P B;  4H0L C;  3M7N A;  3PV0 A;  1H9R A;  5BN3 A;  4JBW A;  1K8M A;  1TKW B;  1PMR A;  1IW7 D;  1E2V A;  3PUZ A;  2E76 C;  1Z6H A;  2K33 A;  1OXS C;  2PCF B;  2ZT9 C;  3PUV A;  1H9S B;  4RCN A;  4DK0 A;  1V43 A;  1H9J A;  1B9M A;  3VR6 A;  2PPB C;  2KCC A;  3RLF A;  1GHK A;  2NN6 G;  3T51 B;  5JEA G;  5K36 G;  2E74 C;  2IT1 A;  4DNT B;  3CRK C;  2D5D A;  4LK1 C;  4IFD G;  3T53 B;  3FMC A;  3M85 A;  2D62 A;  1ZKO A;  2A68 C;  2EDG A;  3EQL C;  4LJZ C;  1Z7T A;  1ONL A;  4H44 C;  4KHZ A;  3U9S A;  2YYZ A;  1IW7 C;  2A6E D;  2F1M A;  2D2C C;  3GQB A;  1HTP A;  2EVB A;  2PNR C;  2A69 D;  3CRL C;  3FPP A;  1IYU A;  3M4Y A;  4G7H C;  4L8J A;  3OPO A;  1GUT A;  2LMC B;  4IQZ A;  3VR3 A;  2NN6 H;  5K36 H;  3PUW A;  3DXJ C;  2DN8 A;  4KKT A;  5KND A;  3I73 A;  4BA2 I;  2B8G A;  3IKJ A;  2AUJ D;  1FYC A;  1DXM A;  2JE6 I;  3SE0 A;  4PV1 C;  3VR4 A;  4KN7 C;  3BDO A;  2A6E C;  4I7Z C;  1Y8N B;  3D31 A;  4JK1 C;  1T5E A;  1TU2 B;  3TZU A;  1ZYR C;  1GUN A;  2BDO A;  2A69 C;  4BA1 I;  1B9N A;  1CFM A;  1HQM C;  1Q90 A;  2Q8I B;  2KA7 A;  3H94 A;  2BA1 A;  1YNJ C;  1GUO A;  1VF7 A;  1EWH A;  1DCZ A;  3OOC A;  4GZY C;  3LWU A;  2DNE A;  1O7L A;  3MXU A;  3T56 B;  1E2W A;  1H9S A;  1CTM A;  2DNC A;  2EJG C;  2JEB I;  3MFY A;  2JEA I;  3QIA A;  4G7O C;  3L7Z C;  1Y8O B;  3OW7 A;  1K8O A;  5BN4 A;  3ND8 A;  4TKO B;  5JEA H;  3IFT A;  2O5J C;  1DD2 A;  3W3A A;  1Y69 U;  2EJM A;  3PUY A;  4IFD H;  2K7V A;  1OXT A;  1OXX K;  1E2Z A;  2R6G A;  4KMU C;  2BA0 A;  3I72 A;  3A7A B;  2NN6 I;  3VA7 A;  4OGQ C;  4OO1 G;  1IYV A;  3P20 A;  1HCZ A;  4DK1 A;  3SDZ A;  1V8Q A;  2K32 A;  5C0X G;  1Q1B A;  3NE5 B;  5A35 A;  3QJY A;  4XIG S;  5KNC A;  1H9M A;  1Q1E A;  2AWO A;  3KLR A;  3QG1 A;  1LAB A;  3LNN A;  1G29 1;  3AB9 A;  3N6R A;  2L5T A;  1GUG A;  1Q12 A;  1GUS A;  2BE5 D;  2E75 C;  4KN4 C;  1GHJ A;  4H13 C; 
#chains in the Genus database with same CATH topology
 2VB2 X;  5EPJ A;  4M8A A;  1STN A;  4KV6 A;  5JOB A;  3SK5 A;  3UDI A;  4P74 A;  2PMZ E;  5C3E H;  2LSS A;  3H3V I;  4DV0 L;  3HOV G;  3NEL A;  1BXT A;  3RZO H;  3G48 A;  2X6L A;  4LF5 L;  2L9H A;  3K5L A;  2EE1 A;  3S1M B;  3TDQ A;  3DLL A;  1G8Z D;  1T9H A;  1CSQ A;  1LTL A;  3P75 A;  1I4G A;  3L3O C;  1NNX A;  1WVL A;  1N36 L;  3C46 A;  4P71 A;  4FO2 A;  4X65 L;  3A74 A;  1STA A;  1D2B A;  2NN6 G;  4KLK A;  4IUT A;  3U58 A;  1EIF A;  4QJF A;  2EYJ A;  3BVG A;  4HSV A;  2HCI A;  3AMU A;  4A75 A;  1S5E D;  3I90 A;  4A3G B;  1E7Z A;  3C1E A;  1P8L A;  2B2T C;  2IX3 A;  4RKL A;  3VYT A;  5IP9 G;  3PF4 A;  2K5V A;  2R7Z H;  1FNW A;  4CKB A;  3D4W A;  1V1P B;  3PIO 3;  1VQD A;  1X6O A;  2XIW A;  2AUJ D;  1FYC A;  3KDF A;  1C8C A;  4Z9C B;  3VR4 A;  3SGI A;  4A3B G;  3FDT A;  3D0F A;  1HHV A;  1K83 B;  1PH4 A;  1N32 Q;  5M5Y H;  2WP8 J;  2A19 A;  1GUO A;  1YHA A;  4JPB W;  3OOC A;  2ENB A;  5ELB A;  3TBI B;  4RWS C;  4A3L G;  3IAY A;  3SK4 A;  1KHI A;  2JA5 G;  2VXW A;  4JI1 L;  5C4J B;  3S17 H;  1STG A;  3TP5 A;  2WAQ G;  1PHJ A;  2WB1 G;  1JQY D;  3BZK A;  3F1Z A;  5EPL A;  4Y52 H;  4IPG A;  2ZTE A;  4N8X 1;  4IZ8 A;  1M1K C;  1VQP A;  4N9T A;  3NEM A;  4EQO A;  4TRD A;  4IPH A;  1SAP A;  2H5X A;  4C1N K;  2ASB A;  2LFN A;  4DPG A;  4DV1 Q;  1NMG A;  3MFG A;  4CGY B;  3HOZ H;  1X3G A;  4GNX B;  4AIM A;  4K8I A;  2B63 H;  1YJW A;  1RCV D;  3GP7 A;  4H13 C;  1EIY B;  4A3J G;  1VDZ A;  4J8Q A;  3UE1 A;  4KJO A;  4X3U A;  1HZ9 A;  5M3F G;  2NVX H;  4FF2 A;  5T1I A;  1YHQ A;  2EQS A;  1G51 A;  1L0W A;  1QNU A;  1HNZ L;  4XTC S;  1B70 B;  4DV2 Q;  3GTG H;  3VR5 A;  2ICE C;  3H0G H;  2MHV A;  1CZW A;  4JBW A;  1F2M A;  1LTR D;  5M5X B;  4FNF A;  3PUV A;  1E0B A;  1X54 A;  2KCN A;  1V9P A;  3MEF A;  3QR8 A;  2KCC A;  1UAP A;  1SLJ A;  3A55 A;  4XQJ A;  2EY5 A;  3PGZ A;  2UXC L;  1HR0 W;  2NZO A;  3RLN A;  1ZKO A;  4IUU A;  2SOB A;  3NEN A;  3E0E A;  1EUJ A;  1XYI A;  5ELD A;  5CV4 A;  1XNR Q;  4K0K L;  1SRO A;  4IUN A;  1IZ6 A;  4OX9 L;  3FPP A;  1BR9 A;  3GTQ H;  2QDL A;  2FJ2 A;  5IYD H;  5LHY 1;  4IQZ A;  3QB3 A;  1C7Y A;  4QIW B;  3O13 A;  5C4X B;  2JE6 I;  3N52 A;  2PQE A;  4JI5 L;  4JI2 L;  1E24 A;  3RR5 A;  1T5E A;  4X62 L;  3MXP A;  1U4L A;  1LTT D;  2ZJQ A;  2CH4 W;  2EY6 A;  4XYO A;  4UHV A;  3GTM B;  4BBS G;  2K01 A;  3F2C A;  1SYD A;  5C6A A;  2B2U A;  5IE8 A;  4ZUJ A;  3W5O A;  4J6H A;  4QUC A;  2L11 A;  4M1U B;  3GTJ B;  2JK8 A;  4G7O C;  1HRJ A;  1DD2 A;  4E6I A;  4B3S L;  4IFD H;  2Z6K A;  4YCV A;  1JE5 A;  5GAD C;  1PZJ D;  2GVA A;  4L5Q A;  3UE0 A;  1HCZ A;  4DK1 A;  1HFN A;  2SDF A;  3HOV B;  2UUB L;  4DV3 Q;  4RGM A;  1NUC A;  1HNW Q;  3F2B A;  1KLG D;  3WWV A;  1OXV A;  2F0O A;  1W6J A;  3L0O A;  4B3R Q;  1Q8K A;  2Z1C A;  5LL6 S;  2UUA Q;  4DR6 Q;  1EWI A;  1YZ6 A;  4QB4 A;  4POG A;  4IFD I;  4KKU A;  3C2P A;  2RA4 A;  3HFZ B;  4JG2 A;  1NSN S;  2K5D A;  5NUC A;  1DOM A;  4RKB A;  3PV0 A;  3RN5 A;  1LTB D;  2G5D A;  3LX0 A;  4N8F A;  4DK3 C;  1B9M A;  3NBH A;  3VR6 A;  4HSP A;  1CHQ D;  5KRU A;  1A3V A;  4HIO A;  2IY5 B;  1XX8 A;  2UXD Q;  4DR3 Q;  2Y0S G;  4ME3 A;  3JAM E;  3H91 A;  1HQR D;  5C44 H;  3J80 L;  2XNA C;  4A3B B;  4H44 C;  4FF4 A;  1TS3 A;  1SFO H;  5CBE E;  2JSO A;  3T1H Q;  1LLR D;  2E2H B;  3I4M H;  5C3W A;  4HAE A;  4GNX C;  1C4Q A;  4DV4 Q;  4GOP A;  3ULL A;  2RVL A;  1AW7 A;  2XVS A;  2OF1 A;  1GD7 A;  1JB3 A;  3I73 A;  3LWE A;  4Q5V A;  2JA5 B;  4GKJ L;  2MO1 A;  4PV1 C;  4NB3 A;  1QCB D;  3BDO A;  3WOE A;  4I7Z C;  1F77 A;  1U4P A;  2QEX A;  1D5X C;  4K5W A;  4JI6 L;  2WAQ B;  3I7F A;  2WB1 B;  2A8V A;  1X3E A;  1MSH A;  4MTN A;  2ICI A;  1YEZ A;  4DV0 Q;  4PZ8 A;  3G7L A;  2MP1 A;  3DWP A;  3MWY W;  5AFW A;  3RZO B;  1LTI D;  4LF5 Q;  2MNA A;  4DR7 L;  5IWA L;  3F2U A;  4A3J B;  1AEX A;  3OIP A;  2BA0 A;  2AQ1 B;  2OWO A;  2EYF A;  4HTH A;  4ODG A;  5M3F B;  1EYG A;  2E5L L;  4R8N A;  4PZ6 A;  4ME5 A;  1BF4 A;  1N36 Q;  4HN7 A;  1MD2 D;  3JC6 6;  4C3J G;  1XPR A;  1H95 A;  2JQO A;  4X65 Q;  4QIW E;  1NBW A;  4PNY A;  2ID0 A;  5AJ3 L;  1WI5 A;  2TMP A;  2M9V A;  3BJU A;  1HPC A;  3TQY A;  2NZ1 D;  1AH9 A;  1VQJ A;  2B8F A;  3CC7 A;  1A62 A;  1Q3L A;  3HOW H;  2QKI C;  4A3G H;  5BN5 A;  4PMW A;  5GQO A;  3ND9 A;  4P72 A;  2HT1 A;  1JWM D;  4BY1 G;  2QEJ C;  3BG3 A;  1VQC A;  2F03 A;  2AWN A;  5IP7 H;  4HJ7 A;  3NTK A;  4F87 A;  5C44 G;  1CK1 A;  2UXB L;  1KIX A;  2B2W A;  1FVI A;  4B9X A;  3PIP A;  1TKW B;  2Q2H A;  4KK7 A;  3CXC A;  3BDL A;  2F0V A;  1ENA A;  2RSN A;  1LT6 D;  2N55 A;  2ZT9 C;  3A54 A;  3CW2 C;  4YCU A;  1H9J A;  4ZAI A;  1PVO A;  3DWA A;  1XTD A;  4IUQ A;  2ATW A;  2RHQ B;  3FP9 A;  4Y7N H;  2MJ8 A;  1F9S A;  3T13 A;  3Q22 A;  3PO2 G;  2EDG A;  2WV6 D;  4IUV A;  4KHZ A;  4YCW A;  4JI1 Q;  2C5C A;  2F0J A;  2A5H A;  5A2Q E;  1EQT A;  2X69 A;  5C4J H;  4BBS B;  2PNR C;  2K5W A;  2CVR A;  4O42 A;  4G4K A;  4DAM A;  1EIG A;  2LMC B;  4R8I A;  4BXX H;  3EFX D;  2WKD A;  2PI2 E;  4KKT A;  1DON A;  1I4X A;  2MO0 A;  4ILW A;  2B2Y A;  2E8G A;  3HOZ B;  4CDE C;  4JOI C;  2B63 B;  4OWT B;  3A0J A;  5JJI A;  3AFP A;  3K8A A;  1IHZ A;  2VW9 A;  4DK6 C;  1LTS D;  1STE A;  1WTH A;  2NVX B;  2K5Q A;  4HJ9 A;  5I6W A;  1HNZ Q;  3CF5 A;  4GS3 A;  3GTG B;  3PCO B;  4RHS A;  2R6G A;  2ZXR A;  3K6O A;  4NXM L;  1PH6 A;  1TWG B;  1XMQ L;  3HOW G;  3GTP H;  1NE3 A;  5IGG A;  1D1I A;  4C3H G;  3H3V C;  1SNQ A;  2KHJ A;  3CPF A;  3D3R A;  3I91 A;  4DNI A;  4F8M A;  5M5X H;  2EXD A;  2EOT A;  2R7F A;  4UAI A;  2K28 A;  2XN9 C;  3AB9 A;  1JT8 A;  2F0L A;  5IP7 G;  1HZC A;  3K5M A;  2UXC Q;  3PIP 3;  1L1O A;  4B3M L;  3QOL A;  3SK8 A;  2WAQ E;  1TY0 A;  1SRU A;  5FO9 B;  2F0E A;  3OWF A;  2DY7 A;  2WB1 E;  1EYD A;  1S3O A;  2F4I A;  3OMC A;  2CH4 A;  1I50 B;  1X9N A;  1UE6 A;  4K0K Q;  4OX9 Q;  2O4X A;  5GAH C;  4MHE A;  1G91 A;  3MVV A;  2HD3 A;  3J7Y W;  4RGO S;  2UU9 L;  2ZXP A;  1VQN A;  3G4S A;  4L5S A;  3I55 A;  1JOQ A;  4GN3 B;  1MJE A;  1RJT A;  3TRE A;  1BDO A;  1VQH A;  5C4X H;  4JI5 Q;  1Y8P B;  4JI2 Q;  4X62 Q;  4DV5 L;  4KY5 A;  4V0B A;  3CCV A;  3PUZ A;  2CCZ A;  3ITP A;  1QOH A;  2NZH A;  1KRS A;  4BXX G;  3AU7 A;  1K8G A;  4F88 A;  1A3T A;  2F0D A;  3NTI A;  3EQL C;  4K5V A;  3V96 A;  3GTJ H;  3S2H H;  5JAV A;  4B3S Q;  2JA8 H;  2IX1 A;  3NQI A;  4XDX A;  1EEI D;  3RD4 A;  1VMC A;  4DGZ A;  1GUT A;  2AQ3 B;  5CR3 A;  4BS9 A;  4IJH A;  2B8G A;  3I70 A;  3IKJ A;  4ID6 A;  2UUB Q;  2JP1 A;  4Q0F A;  3SE0 A;  3NBH B;  2CWP A;  4JK1 C;  3GO5 A;  2V1C C;  5JEA J;  4LW1 A;  1FJG L;  1BKB A;  1SE8 A;  3H94 A;  1PRT B;  4N9P A;  1T5X D;  4IJL A;  2K1B A;  1EOT A;  1X3F A;  4IOC A;  5I2X A;  3CU7 A;  5LMN L;  2KCM A;  3TP7 A;  2I5H A;  4P75 A;  3U4Z A;  1KRT A;  4JBJ A;  1Q46 A;  3W3A A;  1CA5 A;  1YHB A;  3PUY A;  4ZK9 B;  1E2Z A;  4K6L A;  3OTO Q;  2DJG C;  5HUR A;  2CW0 D;  2FHT A;  1BBU A;  1V8Q A;  3E9H A;  3NE5 B;  3HKZ G;  4YIJ A;  4XIG S;  1IYJ B;  5IP9 H;  5GAE C;  4BY1 B;  2OTJ A;  3AQQ A;  2E2J H;  2OTL A;  4R4C A;  1VMP A;  4LF7 Q;  1KXL A;  1CKN A;  1QWY A;  4K14 A;  3STB D;  1QUQ A;  5EJW A;  3HS0 C;  5C44 B;  5IYC G;  1BNZ A;  2CW0 C;  1S5C D;  4JV5 L;  5J1Z A;  4GLV B;  1SFO B;  2OEO A;  4A3B H;  4L6T B;  1CT1 D;  3K81 C;  1RHP A;  1NR2 A;  3A7L A;  1EYA A;  5I2Y A;  3RLO A;  3HG9 A;  1VQ9 A;  3VR2 A;  3S24 A;  4KD4 A;  3PSI A;  1YBY A;  3STB C;  4A3L H;  3PO2 B;  3FVQ A;  4EQP A;  4A3D H;  4K6D A;  4GKJ Q;  2Q8R E;  3A8J E;  2NVT B;  1IBL L;  1A2T A;  3VYU A;  3QWN A;  3RMH A;  4JI6 Q;  1I4H A;  5JVH 3;  3BU2 A;  2JA8 G;  4G57 A;  1X65 A;  2F3W A;  4DR1 L;  1VQK A;  2VL6 A;  2Z0S A;  4YWK A;  4YY3 L;  2QGQ A;  4LK1 C;  1B3A A;  2G9H D;  4FP5 D;  1XWE A;  4F7X A;  2EIF A;  3NBI A;  1A63 A;  4DR7 Q;  5IWA Q;  5I4D A;  3GQB A;  1ZYR D;  1S5B D;  3KF6 A;  4IOA A;  4A3J H;  4B9W A;  3M4Y A;  1VQ4 A;  2B2U C;  4NXN L;  2FXQ A;  2QCP X;  1LM0 A;  2E5L Q;  1SJH D;  5M3F H;  1AFP A;  1CKO A;  1S5D D;  1BBW A;  3A5Z B;  4LMQ D;  1PRT F;  1B3Q A;  4OEM B;  4JI4 Q;  3Q8D A;  5AJ3 Q;  3KLS X;  1IKM A;  4CHT B;  1ZYR C;  2Z6K C;  5CV5 A;  1NMF A;  1VS0 A;  3HOW B;  3OYY A;  2R3Z A;  4C3H B;  5F2D A;  1J9O A;  2DNE A;  2EYO A;  3MXU A;  3T56 B;  5KIX A;  2GN5 A;  4RFB A;  5IYB G;  3QIA A;  1XMO Q;  3OW7 A;  5BN4 A;  2F0S A;  1QG7 A;  4RHR A;  3J7A V;  4GLX A;  3H15 A;  1CHP D;  5E4X A;  1JJC B;  1W2B A;  3U50 C;  1SMX A;  2K6A A;  3TEH B;  2UXB Q;  1IYV A;  1M90 C;  4QCL A;  1SR3 A;  3SDZ A;  1M8A A;  3NXW A;  4JYA Q;  2ZM6 Q;  5KNC A;  5TSS A;  3KYH C;  1LAB A;  3J80 E;  2PZW A;  2KED A;  1NR4 A;  4HCE A;  4B08 A;  4Y7N B;  2ZTD A;  1E22 A;  2CFM A;  1ENC A;  1D5Z C;  1PRT D;  1SMY D;  2LY7 A;  3OWE B;  4DXG A;  4A3D G;  1SE2 A;  3ONA B;  4K5X A;  4XT1 B;  4YWL A;  1MKH A;  4BBS H;  3HZX A;  5KEE A;  1O80 A;  2L55 A;  5LMU L;  2FMC A;  4RCO A;  5FLM H;  4KKS A;  1ENF A;  3Q24 A;  2PQA A;  1PRT C;  1SMY C;  2KEE A;  4PZ7 A;  4R4O A;  1C48 A;  3M7N A;  4XQQ A;  2IWH A;  3DMU A;  2HIV A;  3AYH B;  1KNA A;  1J5E L;  1SE3 A;  2KCT A;  1L1O B;  4EX5 A;  2RHS B;  4HIM A;  1PFM A;  3AEV A;  4ZYS A;  1HUM A;  1L2F A;  3RLF A;  3K57 A;  1LUZ A;  1SNC A;  4R1J A;  3ERO A;  5KYL A;  1PTO B;  4JYA L;  3SEB A;  5M5W H;  3FRP B;  2IW3 A;  3HOY G;  1WTW A;  4O1N A;  2F1M A;  1DOL A;  3GTO B;  3ICE A;  1XTC D;  2HDL A;  4LF9 L;  4NXM Q;  3GTP B;  5JPN C;  1XMQ Q;  1TWG H;  1JOO A;  3R8B A;  3CHB D;  3MEH A;  4IPD A;  2RDG A;  4LF8 L;  5HY6 A;  1JMC A;  1ILQ A;  1GM5 A;  3OW2 A;  2KEN A;  1TU2 B;  3CAM A;  1R9T H;  4B3M Q;  1TR5 A;  2Q8I B;  4PG3 A;  2BCO A;  5CV9 A;  3RZD H;  5M9O A;  1U4R A;  2DGY A;  3HKZ B;  1I50 H;  4KY7 A;  3S2D B;  4K2K A;  1E2W A;  2GA4 B;  1H9S A;  3DEO A;  3W1B A;  1GUW A;  2JEB I;  4TSS A;  5J3B A;  4HJ8 A;  2UU9 Q;  4OIJ A;  1DM0 B;  3VA5 A;  1TVX A;  3EJI A;  1S72 A;  3CCL A;  4OWX B;  2FIN B;  4DV5 Q;  1SSO A;  1Q1B A;  5A35 A;  2YV5 A;  2YU9 H;  3Q6S A;  2NB0 A;  4MTK A;  1Q12 A;  5FLM G;  1GOZ A;  1GUS A;  3DHQ A;  5IGB A;  3CD6 A;  2N88 A;  3S2H B;  2KJX A;  1PXU A;  3VYR A;  2IPK D;  1JIC A;  3KJO A;  3PQI A;  2JA8 B;  1WTP A;  2AUK A;  1KAW A;  3KF8 B;  1VQF A;  1BUV T;  1PV4 A;  1FR3 A;  3JAM i;  1WD0 A;  1EFW A;  1YIT A;  1LAC A;  1IKL A;  1RTO A;  2EY2 A;  2K52 A;  4WJ4 A;  2ALY B;  3VYS A;  4HR7 B;  3ERS X;  3BZD B;  4R4T A;  4CDC C;  5KNB A;  1EWC A;  2A68 D;  3A56 A;  1RIP A;  2HHH L;  5IGF A;  1CQV A;  1E2V A;  3HRZ C;  1CKN B;  1Z6H A;  3W1G A;  1FJG Q;  1QUQ B;  1V43 A;  3ER0 A;  2M00 A;  1R4P B;  1L0Y B;  3IL8 A;  5JEA G;  5LMN Q;  2D5D A;  2Z4H A;  4C3J H;  2B2T A;  2OXP A;  1JB7 A;  2D62 A;  1FNV A;  2A68 C;  3CC4 A;  1B2T A;  2YYZ A;  1WCM G;  4HJ5 A;  2A74 C;  4JI7 L;  4YHH L;  3OTO L;  1IYU A;  1LT3 D;  2NVY H;  3FHW A;  4L8J A;  3OMG A;  1Y1W G;  3BZC A;  4L5T A;  5M3M G;  2E2J B;  4BY1 H;  5CC4 A;  4RMF A;  3CME A;  4BWG B;  2RKS A;  4LF7 L;  1D5M C;  2JYO A;  5I9P A;  2ZJP A;  1SXT A;  2EY1 A;  4S3S A;  4JV5 Q;  2EYL A;  3V2T A;  4KD3 A;  4L63 B;  2A73 B;  4QUF A;  1U0L A;  2IJ0 A;  5DLQ E;  1F9R A;  3W2D A;  3MAQ A;  3ULJ A;  1HXY D;  1PTO D;  4CKE A;  2RSO A;  2K04 A;  2QDB A;  3KF6 B;  2QA4 A;  1Y8O B;  2SNM A;  3C1F A;  3QO2 A;  3KBX A;  4OIK A;  1QZH A;  1QIL A;  1HNX L;  3M4O B;  4XXE A;  1EU4 A;  2IHF A;  5IGC A;  1L1O C;  4PMC A;  1KL9 A;  2H1E A;  1VQL A;  1B44 D;  3PO2 H;  4A3D B;  2JA7 H;  4V19 0;  3URY A;  1IBL Q;  5EKI A;  2XRQ D;  2NVT H;  4U67 3;  5IGD A;  1PTO C;  4RGN A;  4C3I G;  2D9U A;  3KLR A;  4BBR G;  3QG1 A;  4FDB A;  4PQX A;  1UE1 A;  4H02 A;  3N6R A;  4DR1 Q;  1A15 A;  5E3F A;  1MHW C;  4JC0 A;  4DA2 A;  3BYT B;  4YY3 Q;  4FXG C;  3D6C A;  2FMM A;  4OHJ A;  3J80 c;  3GTK H;  3DM1 A;  4KI0 A;  1LV9 A;  1S5F D;  5DEH A;  1O78 A;  2O5I C;  4EGV A;  1CZG A;  1EFI D;  2VY3 A;  1XXG A;  2EJF C;  5BR8 L;  3HKZ E;  1GVP A;  2RBM A;  4TQU S;  4NXN Q;  4DNR B;  5L37 A;  3KDF B;  5D3I B;  3HEJ A;  3I56 A;  1PZK D;  5EGT A;  2C35 B;  5C0X J;  3E0J A;  3UDX A;  1MI2 A;  4JI4 L;  3HOY B;  4R4I A;  4DUZ L;  3J81 j;  4DK0 A;  2RCF A;  4DUY L;  3CPW A;  1JCK B;  3CKI B;  4RG1 A;  4IN3 A;  4AYB G;  1TS4 A;  4C3H H;  1RDP D;  3Q0A A;  4AQY L;  2UUC L;  1PYS B;  1KAA A;  4LJZ C;  2ZM6 L;  1XMO L;  1X32 A;  1HJP A;  2PQA B;  4G7H C;  2Z9H A;  1X55 A;  1X3Q A;  3EA6 A;  4A76 A;  4WOR A;  2WFW A;  2WII B;  3S14 H;  2M2L A;  1K0R A;  3PO3 H;  1GXD C;  1STH A;  3AFQ A;  3SXH A;  2E2I H;  2MQH A;  3MA2 B;  2I46 A;  2JA7 G;  1W3S A;  2KA7 A;  1E3P A;  2BA1 A;  1TWC H;  2BOS A;  1NJI C;  2OQK A;  2ES2 A;  1N9W A;  4GZY C;  2JN4 A;  2SNS A;  2OQ0 A;  4IUP A;  3MFY A;  1NAP A;  5LMU Q;  1JE4 A;  3DUZ A;  4IPC A;  1Y69 U;  4A3I G;  1QVC A;  1GKH A;  1HA5 A;  1I94 L;  3MXN A;  1FL0 A;  3H09 A;  1R4Q B;  1HUN A;  1EZ8 A;  3M4P A;  5EBD A;  1J5E Q;  1H9M A;  3X3M A;  1SYF A;  3HOX G;  4QY7 A;  2WAC A;  1UE7 A;  5IIF A;  2E75 C;  5I9O A;  1VQ6 A;  2F4V L;  3E3X A;  2A6H D;  5M5W B;  1PTO H;  4DR2 L;  1QZG A;  1JOK A;  1LT4 D;  5ELE A;  4XQN A;  5G3L D;  4WJ3 M;  2HUG A;  3GTO H;  3DM3 A;  1TS5 A;  2OT2 A;  4LF9 Q;  2R93 G;  5KYI A;  3K5O A;  4C2M H;  3TP6 A;  2LS0 1;  2A6H C;  1HTL D;  1HR0 L;  5ISR A;  2L12 A;  4LF8 Q;  3CCR A;  2ZJR A;  2F0K A;  1WCM B;  3SHL A;  1H9R A;  2JJQ A;  1R9T B;  1IW7 D;  4CJ1 B;  2K33 A;  3GDE A;  3TP8 A;  1DGS A;  1WD1 A;  2QW7 A;  1Q8I A;  1Y1W B;  4DV7 L;  1JR0 D;  1PH1 A;  3RZD B;  3CCE A;  3DWQ A;  1GHK A;  5M3M B;  1PYW D;  2XSC A;  3S2D H;  5IOD A;  1F2L A;  1DOK A;  5FKA C;  3PO3 G;  4APV A;  1SYC A;  2I5L X;  3I4N G;  3J7A 5;  5EAY A;  1IW7 C;  3F2D A;  2Y0S B;  4UPA A;  3DEP A;  1RD9 D;  1FGU A;  5IYC H;  1X56 A;  4I7A A;  4JW0 A;  3VR3 A;  5HGT A;  1KD1 C;  1EZ6 A;  3H6M A;  3R3O A;  4A3E G;  3DXJ C;  2R7D A;  2YTY A;  2JA9 A;  4H7B A;  2YU9 B;  4CJ0 B;  4L5R C;  4A3M H;  1VQI A;  4QQB X;  3L9A X;  1SJE D;  1IXR A;  5ELC A;  1TT2 A;  3LGJ A;  4OXP A;  4BA1 I;  1B9N A;  4RAU C;  4DAP A;  5FOB B;  4X66 L;  1KLU D;  2XGT A;  2L15 A;  2G9D A;  3LWU A;  4HMI A;  4C3I B;  1Y14 B;  4BBR B;  4QMG A;  2WKC A;  2VQF L;  2F52 A;  2L4N A;  1BOS A;  1OXX K;  3EVQ A;  2MGS A;  3A7A B;  3SK6 A;  2HHH Q;  2XTI A;  3IFD A;  5C3X A;  1YNX A;  1F9Q A;  4HIK A;  1VQA A;  1CUK A;  1TS2 A;  1EY6 A;  2XRS D;  1PH2 A;  4P2C B;  1EOV A;  1IL8 A;  3UDG A;  4IUR A;  4DV6 L;  2BE5 D;  4C3J B;  3RN2 A;  4FF3 A;  1IL2 A;  1GHJ A;  3RUZ A;  1GO3 E;  2K4K A;  2O2L D;  3MHB A;  4GOP B;  1VCI A;  5C0X H;  2VQE L;  3R2I A;  4RGT A;  4JI7 Q;  3GD7 A;  4YHH Q;  2NVY B;  3FKI H;  1QJO A;  4AYB B;  4DN4 M;  1ZXT A;  1W6K A;  1Z47 A;  4UP8 A;  1MSG A;  5IT9 L;  1STY A;  2VZA A;  3OHX C;  2BE5 C;  2Z4I A;  4LFC L;  1SEB D;  5COR A;  5IYB H;  1OXU A;  3CCM A;  3S15 B;  4A3K H;  1YVC A;  1PLF A;  5BN3 A;  2AMC B;  3SR1 A;  1DYQ A;  3E9I A;  2PO4 A;  5IOC A;  2PPB C;  1HFG A;  4DFA A;  3ZYY X;  4LF6 L;  2F0I A;  1WTR A;  2ZXO A;  3NHH A;  2KOL A;  3K0Y A;  1G6Z A;  4ZLT F;  4WFN 3;  4HED A;  4X3K A;  1B8A A;  5C0X I;  4A3M G;  3HKS A;  1HNX Q;  4NKL A;  3M4O H;  2JA7 B;  2EVB A;  2AHO B;  4LFB L;  2MUY A;  2DUD A;  2YTV A;  3OPO A;  2I0Q A;  5C5M A;  4A93 G;  4JI3 L;  4ZKB B;  5IT9 c;  1UNS A;  2XWJ B;  5CV8 A;  5DNF A;  4FVM A;  2EPB A;  4JOI A;  4BA2 I;  1UEB A;  5D3D A;  3TSS A;  2PI2 A;  5IY0 A;  1DXM A;  2L1B A;  1XNQ L;  2VNU D;  4A3I B;  1EQR A;  1GUN A;  2VUM G;  1MIU A;  1VQM A;  3GTK B;  4LF4 L;  4IFD J;  4CDF C;  1VF7 A;  3M3Y H;  1O7I A;  1DCZ A;  3J80 i;  1G2S A;  3F8T A;  4CKC A;  5BR8 Q;  1UEA B;  2KHI A;  4A4I A;  3HOX B;  2EZV A;  2O5J C;  4FYD A;  3MC0 B;  2K05 A;  2RF4 A;  3CP0 A;  2Y0S E;  4ZRZ A;  1HH2 P;  2X6G A;  5COY A;  3VA7 A;  1PH7 A;  1YNN D;  2VB3 X;  2J0T D;  3HOY H;  1ESF A;  4GN4 B;  3EN2 A;  2R92 G;  1AP0 A;  2K32 A;  5C0X G;  3CCJ A;  4DUZ Q;  4ZCK A;  2Z8L A;  3OIQ A;  4EVO A;  4DUY Q;  3FKI G;  2R93 B;  5DM7 3;  4KHP L;  1G29 1;  5C4Z A;  1ZEQ X;  1VQE A;  5CV6 A;  4AQY Q;  1TQO A;  2UUC Q;  4OEL B;  3T1Y L;  3TS0 A;  4A3K G;  1YNN C;  4OO1 H;  5D65 A;  1A3U A;  3CQZ B;  2BH8 A;  3KLS A;  1EYC A;  3P1H A;  1Q82 C;  1I4Q A;  4ZUI A;  3D4D A;  3K80 C;  1I4R A;  1RF2 D;  1G6P A;  1EY0 A;  1EQV A;  1EY8 A;  4WJW A;  2JA6 G;  1LO5 D;  3MXN B;  1I6V C;  3S14 B;  3PO3 B;  4KY6 A;  1QB5 D;  3E6Z X;  3I4N B;  1BVS A;  1SE4 A;  3SVM A;  4LUZ A;  1KC8 C;  2E2I B;  5FK9 C;  1DZ1 A;  1K8M A;  4C1N I;  4HID A;  1OXS C;  4ZQ3 A;  4RCN A;  1TWC B;  2AKW B;  5CMD A;  1EY9 A;  5E7N A;  4A3E B;  3S1N H;  5DAU A;  3CCS A;  4OO1 I;  3FMC A;  3M85 A;  1FD7 D;  1AE3 A;  4IAL A;  1ONL A;  4HCS A;  3T16 A;  4CJ2 C;  3U9S A;  1NY4 A;  1WTO A;  4R9W A;  1JWS D;  1KDC A;  1HTP A;  2AQ2 B;  3KFU A;  1I94 Q;  4DR4 L;  1C0A A;  1KAB A;  2BH2 A;  4AYB E;  1MGS A;  1HA6 A;  3I3C A;  1SN8 A;  4GOP C;  4NDX A;  2HQE A;  5J22 A;  1MJC A;  4KN7 C;  4PMB A;  1SYB A;  4X3T A;  2F4V Q;  3J7A F;  1N34 L;  1Q90 A;  1EL0 A;  5C3E G;  1F9P A;  1P16 A;  4MIU A;  4NPS A;  4UDU C;  4DR2 Q;  1WJJ A;  2XWB B;  2KVM A;  1J8I A;  4B3T L;  4CDD C;  4TVA B;  4C2M B;  5JEA H;  3ND8 A;  5FLX L;  1I3Q H;  1WFQ A;  1WTQ A;  1DJR D;  1RTN A;  3K58 A;  2F0G A;  2YTX A;  1MBY A;  1HR0 Q;  2B2V A;  2D0P A;  2F0P A;  4EQ5 A;  3K7A B;  4DR5 L;  4A3C H;  1XJV A;  4OO1 G;  4OGQ C;  1SNO A;  1WCM H;  1V1O A;  3HOU H;  3FPU B;  2RDF A;  2AWO A;  1PH5 A;  1EQQ A;  4DV7 Q;  3S1Q H;  1Y1W H;  4LUO A;  4GN5 A;  2L5T A;  1GUG A;  5M3M H;  1A2U A;  1IBK L;  1VQG A;  3TME A;  2Q8T A;  1JC7 A;  4POF A;  1F2Z A;  1ROD A;  3S16 B;  2R7Z G;  2F0N A;  2V4D A;  3PUX A;  3KBG A;  1AE2 A;  2B3G A;  4LFA L;  4JI8 Q;  1B50 A;  4G7Z C;  3A8I E;  4DF7 A;  5I6Y A;  1BCP B;  1TWA B;  1CSP A;  1IBM L;  3PMF A;  4X3S A;  5FLX c;  1N8R C;  2SEB D;  1A6X A;  4MZ9 A;  3J81 L;  3I8Z A;  2NTS A;  5GAG C;  2F3V A;  3GTL H;  1GJX A;  2JXM B;  2RCN A;  4A3M B;  1PFS A;  1H9K A;  3S1R B;  1AN8 A;  2NWG A;  3NSW A;  4ULL A;  1PMR A;  4ALP A;  1B7Y B;  1SNP A;  1AZP A;  2B29 A;  4X66 Q;  1BO0 A;  1Q86 C;  4A93 B;  2B2W C;  2CQO A;  5ELO A;  2E74 C;  2IT1 A;  4C3I H;  4BBR H;  1FNU A;  1Z7T A;  2P5Z X;  1YJN A;  2VQF Q;  2F0Q A;  3OSO A;  1BQQ T;  4X64 L;  2VUM B;  2D2C C;  3NWS A;  5J39 A;  3CRL C;  2A69 D;  1JJG A;  3P7J A;  1YNJ D;  3GV6 A;  3UDF A;  1NTG A;  3PUW A;  3HOZ G;  1G2T A;  2DN8 A;  1A8V A;  2EXZ A;  1XPU A;  4HMJ A;  2PZU A;  2RDH A;  3J81 c;  2B63 G;  5JVG 3;  1PTO F;  2PW5 A;  2MFI A;  3E5S A;  3I4O A;  1Y8N B;  4DV6 Q;  3PF5 A;  2KUM A;  2LKV A;  2A69 C;  2NYZ D;  1PA6 A;  1O7Y A;  2OCE A;  4GKK L;  2B2Y C;  2MPM A;  1YNJ C;  1RL2 A;  4A3C G;  2DJF C;  3MTS A;  1C9O A;  2R92 B;  2VQE Q;  3KOJ A;  3HOU G;  1QVG A;  3FKI B;  3H0G G;  4DAV A;  4BY7 H;  2F0F A;  3L7Z C;  4TKO B;  4LFC Q;  2K7V A;  3GV3 A;  4FF1 A;  4KTA A;  4RA8 A;  4A3K B;  3I72 A;  3S15 H;  5E4W C;  4MNO A;  4GLA C;  4A3F H;  1WTX A;  3TRZ A;  5FO8 B;  1K0S A;  5LMN W;  1B1Z A;  3QJY A;  2Q2T A;  4U68 A;  3CMA A;  2C9O A;  1Q1E A;  2QIL A;  4CBV A;  1PFN A;  3LNN A;  4LF6 Q;  2KHS A;  2JA6 B;  4K2L A;  2NTT A;  2I5M X;  1BCP F;  4DU9 A;  3KUP A;  1VF5 C;  1LTG D;  1ASZ A;  1I6H H;  3A8K E;  4K8J A;  5IYD G;  1KQS A;  1KDA A;  3M7G A;  3NWT A;  1SBB B;  3EBE A;  3MZ5 A;  4RH6 A;  3WDN A;  4LFB Q;  1Y1V H;  2EYH A;  4JBM A;  2HCC A;  1Z9F A;  4JI3 Q;  1HZA A;  1CKM A;  1TWH B;  2HQL A;  3TS2 A;  1U9R A;  2LXJ A;  1BBX C;  1O7Z A;  2F0M A;  1TII D;  1XNQ Q;  2NVQ H;  4A3I H;  1S4Z A;  1JOR A;  2CHB D;  4LF4 Q;  1UWV A;  3QOJ A;  4DKA C;  1TWF H;  4JI0 L;  3M3Y B;  2BDN A;  2CKZ B;  1K28 A;  5GRO A;  2TSS A;  3BS1 A;  4IFD G;  1ET6 A;  4NMZ A;  1N33 L;  5ELN A;  2F3I A;  1NCV A;  3HOX H;  3NPP A;  3BVM A;  1ML0 D;  4WRD A;  2A6E D;  4ZKC B;  1BCP D;  4MN3 A;  5C3E B;  2I07 B;  1KTK A;  5IGE A;  1KDB A;  2PYK A;  2Q2I A;  4O2D A;  3G6E A;  1J6Q A;  5EQ0 A;  1U5K A;  3S1M H;  4BY7 G;  1F2Y A;  4KHP Q;  1XPO A;  2R93 H;  2ZTC A;  4QGU A;  2A6E C;  1BCP C;  5JPM C;  3IRB A;  3CCU A;  3T1Y Q;  5H1S E;  2BDO A;  1K3B C;  1VQB A;  1HQM C;  5DM6 3;  3VDY A;  4OL7 A;  1K9M C;  4DAY A;  1EEF D;  2PNH A;  2CWA A;  4A3F G;  1EWH A;  3G6J B;  3M4Q A;  3CQZ H;  5IT9 E;  4JVZ A;  2CQA A;  1D8L A;  1O7L A;  4OON A;  1SYE A;  5CYU A;  2DNC A;  5EKK A;  2JEA I;  2KQ3 A;  3IFT A;  1EY7 A;  2EJM A;  3EIV A;  1SND A;  3ZJY C;  1EY4 A;  4HJA A;  2R7Z B;  4NW2 A;  3CCQ A;  2K50 A;  3I4N H;  2WIN B;  3KJP A;  3WOF A;  3I2Z A;  1LTA D;  5G3L F;  1PH8 A;  4O0A A;  3D8G A;  1WYD A;  1PFB A;  1Y1V G;  3S1N B;  4UY8 C;  4A3E H;  4IO9 A;  3U9O A;  1N32 L;  1K83 H;  5M5Y B;  3I4M G;  2EYP A;  1ET9 A;  2IHE A;  1QE6 A;  1TXY A;  3ERQ A;  1Q81 C;  1OTC A;  2K75 A;  4LAA A;  1PH3 A;  4DR4 Q;  3RNU A;  1D1K A;  5E1F A;  1TY2 A;  3NUC A;  1I4P A;  1OO9 B;  2QF7 A;  3S17 B;  2B39 A;  3D4R A;  3K0X A;  2F0H A;  3CC2 A;  1K73 C;  1VQ8 A;  4H0L C;  1UUP A;  1SYG A;  1SNM A;  1V1P A;  1N34 Q;  2E76 C;  2PCF B;  4LWC A;  1H9S B;  4LNQ A;  1AZQ A;  5CBA E;  1RKN A;  1ICW A;  2KBN A;  3NP8 A;  4DV1 L;  3C3L A;  2NBF A;  1YJ9 A;  3ULP A;  4QL5 A;  4EQN A;  5CV7 A;  3NQT A;  3T53 B;  4J15 A;  4XYQ A;  1VQO A;  4B3T Q;  1LYL A;  1E1T A;  1I3Q B;  1SDF A;  4P73 A;  2RQX A;  3T4A C;  4DR5 Q;  3TZD A;  3K7A H;  3KK7 A;  2FFK B;  1YI2 A;  3HOU B;  1EY5 A;  5K36 H;  4YWM A;  4DV2 L;  1B53 A;  1CQF A;  3H0G B;  4UP7 A;  4ABN A;  3S1Q B;  2GVB A;  1PYB A;  1UE5 A;  1U4M A;  1ESR A;  3G71 A;  2N3S A;  2K5N A;  3J7Z C;  1E1O A;  1IBK Q;  4A3G G;  2LXK A;  1CFM A;  1ICF B;  5EBC A;  2F0T A;  3S16 H;  1CA6 A;  3NTH A;  4GNX A;  4LFA Q;  2PMZ B;  4JI8 L;  2NUC A;  3V05 A;  4NP5 A;  3R2T A;  2K5H A;  1CTM A;  3S9W A;  2EJG C;  1LT5 D;  1TWA H;  1IBM Q;  2K03 A;  4R4Q A;  3GTL B;  3JAM L;  1XNR L;  4KMU C;  4FXK C;  3GTQ B;  5KGU A;  5JJL A;  3S1R H;  1X3P A;  5T1G A;  4LUV A;  2J4X A;  5FJ8 H;  4UP9 A;  1PDQ A;  2Z6B A;  4A93 H;  2IX0 A;  2IL8 A;  2L0C A;  3FEW X;  1STB A;  4JBK A;  1CM9 A;  3GTM H;  3I4L A;  4KHV A;  1K3R A;  4X64 Q;  2N8N A;  4XT3 B;  2VUM H;  3HGB A;  1A0I A;  1L0X B;  5EPK A;  2D0O A;  2H4O A;  2R61 A;  2K14 A;  1CI3 M;  1D6E C;  3JAM c;  4JCV E;  1WOC A;  1M4V A;  3BDC A;  3J81 i;  4FXD A;  3B6Y A;  2HIX A;  2J7Z A;  3HP3 A;  5CGK A;  2F0U A;  5JJZ A;  1JJ2 A;  4GKK Q;  3HOV H;  3MXG A;  3U4V A;  1QNK A;  4DV3 L;  3L2P A;  2R92 H;  1K8A C;  3T51 B;  5K36 G;  5FLX E;  2DY8 A;  4DNT B;  1V1Q A;  1HNW L;  4KJN A;  3CRK C;  3K7U C;  4BY7 B;  5ELF A;  2EYM A;  3BVZ A;  3BYY B;  1ASY A;  4B3R L;  5K5P A;  2Q2U A;  2PZT A;  2UUA L;  2E2D C;  4DR6 L;  1YIJ A;  4AH6 A;  4A3F B;  2NN6 H;  3Q23 A;  1B4O A;  3KF8 A;  1Q7Y C;  4OWW B;  1EU3 A;  5KND A;  2KEC A;  3K5N A;  2PW7 A;  3NK9 A;  2JA6 H;  4I65 A;  5LL6 X;  1VQ5 A;  3D31 A;  3TZU A;  4DXF A;  3M9B A;  2B2V C;  1PH9 A;  3KLW A;  1I6H B;  1ILP A;  5EKL A;  3TN2 A;  1I5F A;  1EIH A;  2F0W A;  1PZI D;  5HGQ A;  3D6W A;  1JWU D;  3J81 E;  1Y1V B;  3A5U A;  4DR3 L;  5D14 A;  2UXD L;  5FJ8 G;  3H3V H;  2A1A A;  3R93 A;  5C4X G;  1K8O A;  5C5L A;  3X3N A;  1HZB A;  1WTV A;  4X6A H;  1TWH H;  5C4H A;  1FGB D;  3PIO A;  1OXT A;  3T1H L;  3I4M B;  2E2H H;  1II3 A;  3UI2 A;  2N78 A;  1D7Q A;  2NN6 I;  5JJK A;  2NVQ B;  3P20 A;  2VS1 A;  4DV4 L;  1QVF A;  2N49 A;  5A2Q L;  1VQ7 A;  4C56 C;  1TWF B;  4QF4 A;  4JI0 Q;  3K59 A;  1KNE A;  5FO7 B;  2JA5 H;  1S40 A;  2HDM A;  4DAY B;  4J1M A;  4KN4 C;  1N33 Q; 
#chains in the Genus database with same CATH homology
 2VB2 X;  5EPJ A;  4M8A A;  1STN A;  4KV6 A;  5JOB A;  3SK5 A;  1BXT A;  2X6L A;  2L9H A;  3K5L A;  2EE1 A;  3S1M B;  3TDQ A;  1G8Z D;  3P75 A;  1I4G A;  3L3O C;  1WVL A;  3C46 A;  4FO2 A;  1STA A;  1D2B A;  2NN6 G;  4IUT A;  2EYJ A;  3BVG A;  4HSV A;  2HCI A;  3AMU A;  1S5E D;  3I90 A;  4A3G B;  3C1E A;  2B2T C;  2IX3 A;  4RKL A;  3VYT A;  1FNW A;  4CKB A;  3D4W A;  1V1P B;  3PIO 3;  2XIW A;  2AUJ D;  1FYC A;  1C8C A;  4Z9C B;  3VR4 A;  3FDT A;  1HHV A;  1K83 B;  2WP8 J;  1GUO A;  3OOC A;  2ENB A;  5ELB A;  3TBI B;  4RWS C;  3IAY A;  3SK4 A;  2VXW A;  5C4J B;  1STG A;  3TP5 A;  1JQY D;  5EPL A;  4IZ8 A;  4N9T A;  4EQO A;  4TRD A;  1SAP A;  4C1N K;  2LFN A;  3MFG A;  4CGY B;  4K8I A;  1RCV D;  3GP7 A;  4H13 C;  1VDZ A;  4J8Q A;  4KJO A;  4X3U A;  4FF2 A;  5T1I A;  1QNU A;  4XTC S;  3VR5 A;  2ICE C;  2MHV A;  1CZW A;  4JBW A;  1F2M A;  1LTR D;  5M5X B;  4FNF A;  3PUV A;  1E0B A;  2KCN A;  2KCC A;  1UAP A;  4XQJ A;  3A55 A;  2EY5 A;  1ZKO A;  4IUU A;  2SOB A;  1XYI A;  5ELD A;  5CV4 A;  4IUN A;  3FPP A;  1BR9 A;  2FJ2 A;  5LHY 1;  4IQZ A;  3QB3 A;  4QIW B;  3O13 A;  5C4X B;  2JE6 I;  3N52 A;  2PQE A;  1T5E A;  3MXP A;  1U4L A;  1LTT D;  4XYO A;  2EY6 A;  3GTM B;  2K01 A;  1SYD A;  5C6A A;  2B2U A;  4ZUJ A;  4J6H A;  4QUC A;  2L11 A;  4M1U B;  3GTJ B;  4G7O C;  1HRJ A;  1DD2 A;  4E6I A;  4IFD H;  1PZJ D;  1HCZ A;  4DK1 A;  1HFN A;  2SDF A;  3HOV B;  4RGM A;  1NUC A;  1KLG D;  1OXV A;  2F0O A;  1W6J A;  2Z1C A;  5LL6 S;  4QB4 A;  4IFD I;  4KKU A;  3C2P A;  2RA4 A;  1NSN S;  2K5D A;  5NUC A;  1DOM A;  4RKB A;  3PV0 A;  1LTB D;  3LX0 A;  1B9M A;  3NBH A;  3VR6 A;  4HSP A;  1CHQ D;  5KRU A;  1A3V A;  1XX8 A;  3JAM E;  3H91 A;  1HQR D;  3J80 L;  2XNA C;  4A3B B;  4H44 C;  4FF4 A;  1TS3 A;  5CBE E;  2JSO A;  1LLR D;  2E2H B;  5C3W A;  4HAE A;  1C4Q A;  2RVL A;  1AW7 A;  2XVS A;  2OF1 A;  1JB3 A;  3I73 A;  3LWE A;  4Q5V A;  2JA5 B;  4PV1 C;  1QCB D;  3BDO A;  3WOE A;  4I7Z C;  1F77 A;  1U4P A;  1D5X C;  4K5W A;  2WAQ B;  2WB1 B;  1MSH A;  2ICI A;  3G7L A;  2MP1 A;  3DWP A;  3MWY W;  5AFW A;  3RZO B;  1LTI D;  3F2U A;  4A3J B;  1AEX A;  3OIP A;  2BA0 A;  2AQ1 B;  2EYF A;  4HTH A;  4ODG A;  5M3F B;  4R8N A;  4ME5 A;  1BF4 A;  4HN7 A;  1MD2 D;  4C3J G;  4PNY A;  2ID0 A;  2TMP A;  2M9V A;  1HPC A;  2NZ1 D;  2B8F A;  1Q3L A;  2QKI C;  5BN5 A;  4PMW A;  3ND9 A;  1JWM D;  2QEJ C;  3BG3 A;  2F03 A;  2AWN A;  3NTK A;  4F87 A;  1CK1 A;  2B2W A;  4B9X A;  1TKW B;  4KK7 A;  3BDL A;  2F0V A;  1ENA A;  2RSN A;  1LT6 D;  2N55 A;  2ZT9 C;  3A54 A;  4ZAI A;  1H9J A;  3DWA A;  4IUQ A;  2MJ8 A;  1F9S A;  3T13 A;  3Q22 A;  2EDG A;  2WV6 D;  4IUV A;  4KHZ A;  2C5C A;  2F0J A;  2A5H A;  5A2Q E;  1EQT A;  2X69 A;  4BBS B;  2PNR C;  2K5W A;  2CVR A;  4O42 A;  4G4K A;  1EIG A;  2LMC B;  4R8I A;  3EFX D;  2WKD A;  4KKT A;  1DON A;  1I4X A;  4ILW A;  2B2Y A;  3HOZ B;  2B63 B;  1IHZ A;  1LTS D;  1STE A;  2NVX B;  2K5Q A;  5I6W A;  3GTG B;  4RHS A;  2R6G A;  2ZXR A;  3K6O A;  1TWG B;  5IGG A;  1D1I A;  4C3H G;  3H3V C;  1SNQ A;  4F8M A;  3D3R A;  3I91 A;  2EOT A;  4UAI A;  2K28 A;  2XN9 C;  3AB9 A;  2F0L A;  3K5M A;  3PIP 3;  3QOL A;  3SK8 A;  1TY0 A;  5FO9 B;  2F0E A;  3OWF A;  2DY7 A;  1EYD A;  2F4I A;  3OMC A;  1I50 B;  2O4X A;  4MHE A;  1G91 A;  3MVV A;  3J7Y W;  4RGO S;  2ZXP A;  1JOQ A;  1RJT A;  1BDO A;  1Y8P B;  4KY5 A;  4V0B A;  3PUZ A;  3ITP A;  1QOH A;  3AU7 A;  4F88 A;  1A3T A;  2F0D A;  3NTI A;  3EQL C;  4K5V A;  3V96 A;  5JAV A;  2IX1 A;  3NQI A;  4XDX A;  1EEI D;  3RD4 A;  1VMC A;  4DGZ A;  1GUT A;  2AQ3 B;  5CR3 A;  4BS9 A;  2B8G A;  3I70 A;  3IKJ A;  4ID6 A;  2JP1 A;  4Q0F A;  3SE0 A;  4JK1 C;  3GO5 A;  5JEA J;  3H94 A;  1PRT B;  4N9P A;  1T5X D;  2K1B A;  1EOT A;  5I2X A;  3CU7 A;  3TP7 A;  3W3A A;  1CA5 A;  3PUY A;  4ZK9 B;  1E2Z A;  4K6L A;  5HUR A;  2CW0 D;  2FHT A;  1V8Q A;  3NE5 B;  4YIJ A;  4XIG S;  4BY1 B;  1VMP A;  1QWY A;  4K14 A;  5EJW A;  3HS0 C;  5C44 B;  1BNZ A;  2CW0 C;  1S5C D;  5J1Z A;  1SFO B;  2OEO A;  4L6T B;  1CT1 D;  1RHP A;  1NR2 A;  3A7L A;  1EYA A;  5I2Y A;  3HG9 A;  3VR2 A;  4KD4 A;  3PO2 B;  3FVQ A;  4EQP A;  4K6D A;  2Q8R E;  3A8J E;  2NVT B;  1A2T A;  3VYU A;  3QWN A;  3RMH A;  1I4H A;  5JVH 3;  4G57 A;  2F3W A;  4LK1 C;  1B3A A;  2G9H D;  4FP5 D;  1XWE A;  4F7X A;  3NBI A;  5I4D A;  3GQB A;  1ZYR D;  1S5B D;  4B9W A;  3M4Y A;  2B2U C;  2QCP X;  1SJH D;  1AFP A;  1S5D D;  4LMQ D;  1PRT F;  3KLS X;  1IKM A;  4CHT B;  1ZYR C;  5CV5 A;  3HOW B;  2R3Z A;  4C3H B;  5F2D A;  1J9O A;  2DNE A;  2EYO A;  3MXU A;  3T56 B;  5KIX A;  4RFB A;  3QIA A;  3OW7 A;  5BN4 A;  2F0S A;  1QG7 A;  4RHR A;  3J7A V;  1CHP D;  5E4X A;  2K6A A;  1IYV A;  4QCL A;  3SDZ A;  1M8A A;  3NXW A;  5KNC A;  5TSS A;  1LAB A;  3J80 E;  2PZW A;  2KED A;  1NR4 A;  4HCE A;  4B08 A;  4Y7N B;  1PRT D;  1ENC A;  1D5Z C;  1SMY D;  2LY7 A;  3OWE B;  4DXG A;  1SE2 A;  3ONA B;  4K5X A;  4XT1 B;  3HZX A;  5KEE A;  1O80 A;  2L55 A;  2FMC A;  4RCO A;  4KKS A;  1ENF A;  3Q24 A;  1PRT C;  1SMY C;  2KEE A;  1C48 A;  3M7N A;  4XQQ A;  2IWH A;  3DMU A;  1KNA A;  1SE3 A;  1PFM A;  4ZYS A;  1HUM A;  3RLF A;  3K57 A;  1SNC A;  3ERO A;  5KYL A;  1PTO B;  3SEB A;  3FRP B;  2IW3 A;  1WTW A;  4O1N A;  2F1M A;  1DOL A;  3GTO B;  1XTC D;  2HDL A;  3GTP B;  5JPN C;  3R8B A;  1JOO A;  3CHB D;  3MEH A;  2RDG A;  1ILQ A;  1TU2 B;  1TR5 A;  2Q8I B;  2BCO A;  5CV9 A;  5M9O A;  1U4R A;  3HKZ B;  4KY7 A;  3S2D B;  4K2K A;  1E2W A;  2GA4 B;  1H9S A;  3DEO A;  1GUW A;  2JEB I;  4TSS A;  4OIJ A;  1DM0 B;  3VA5 A;  1TVX A;  3EJI A;  2FIN B;  1SSO A;  1Q1B A;  5A35 A;  3Q6S A;  2NB0 A;  1Q12 A;  1GOZ A;  1GUS A;  3DHQ A;  5IGB A;  3S2H B;  2N88 A;  2KJX A;  1PXU A;  3VYR A;  2IPK D;  1JIC A;  2JA8 B;  1WTP A;  2AUK A;  1BUV T;  1FR3 A;  1WD0 A;  1LAC A;  1IKL A;  1RTO A;  2EY2 A;  3VYS A;  4HR7 B;  3BZD B;  5KNB A;  1EWC A;  2A68 D;  3A56 A;  5IGF A;  1CQV A;  1E2V A;  3HRZ C;  1Z6H A;  1V43 A;  2M00 A;  1R4P B;  1L0Y B;  3IL8 A;  5JEA G;  2D5D A;  2Z4H A;  2B2T A;  2OXP A;  2D62 A;  1FNV A;  2A68 C;  1B2T A;  2YYZ A;  2A74 C;  1IYU A;  1LT3 D;  4L8J A;  3OMG A;  2E2J B;  5CC4 A;  4BWG B;  2RKS A;  1D5M C;  2JYO A;  5I9P A;  1SXT A;  2EY1 A;  4S3S A;  2EYL A;  3V2T A;  4KD3 A;  4L63 B;  2A73 B;  4QUF A;  3W2D A;  2IJ0 A;  3MAQ A;  1F9R A;  1HXY D;  1PTO D;  4CKE A;  2RSO A;  2K04 A;  2QDB A;  1Y8O B;  2SNM A;  3C1F A;  3QO2 A;  3KBX A;  4OIK A;  1QIL A;  3M4O B;  4XXE A;  1EU4 A;  5IGC A;  4PMC A;  2H1E A;  4A3D B;  1B44 D;  4V19 0;  3URY A;  5EKI A;  2XRQ D;  4U67 3;  5IGD A;  1PTO C;  4RGN A;  4C3I G;  2D9U A;  3KLR A;  3QG1 A;  4PQX A;  3N6R A;  1A15 A;  5E3F A;  4DA2 A;  3BYT B;  4FXG C;  3D6C A;  2FMM A;  4OHJ A;  3DM1 A;  4KI0 A;  1LV9 A;  1S5F D;  5DEH A;  1O78 A;  2O5I C;  4EGV A;  1CZG A;  1EFI D;  1XXG A;  2EJF C;  2RBM A;  4TQU S;  4DNR B;  5D3I B;  3HEJ A;  1PZK D;  5EGT A;  5C0X J;  3E0J A;  1MI2 A;  3HOY B;  4DK0 A;  1JCK B;  3CKI B;  4IN3 A;  1TS4 A;  1RDP D;  3Q0A A;  1KAA A;  4LJZ C;  1X32 A;  4G7H C;  1X3Q A;  3EA6 A;  4WOR A;  2WII B;  2M2L A;  1GXD C;  1STH A;  3SXH A;  3MA2 B;  2I46 A;  2KA7 A;  2BA1 A;  2BOS A;  4GZY C;  2SNS A;  4IUP A;  3MFY A;  1NAP A;  1JE4 A;  3DUZ A;  1Y69 U;  1HA5 A;  3MXN A;  3H09 A;  1R4Q B;  1HUN A;  1EZ8 A;  5EBD A;  1H9M A;  3X3M A;  1SYF A;  2WAC A;  5IIF A;  2E75 C;  5I9O A;  2A6H D;  5M5W B;  1PTO H;  1JOK A;  1LT4 D;  5ELE A;  4XQN A;  5G3L D;  2HUG A;  1TS5 A;  2OT2 A;  5KYI A;  3K5O A;  3TP6 A;  2LS0 1;  2A6H C;  1HTL D;  5ISR A;  2L12 A;  2F0K A;  1WCM B;  3SHL A;  1H9R A;  1R9T B;  1IW7 D;  4CJ1 B;  2K33 A;  3TP8 A;  1WD1 A;  1Q8I A;  1Y1W B;  1JR0 D;  3RZD B;  3DWQ A;  1GHK A;  5M3M B;  1PYW D;  2XSC A;  5IOD A;  1F2L A;  1DOK A;  5FKA C;  1SYC A;  1IW7 C;  2Y0S B;  3DEP A;  1RD9 D;  5HGT A;  3VR3 A;  1EZ6 A;  3H6M A;  3R3O A;  3DXJ C;  4H7B A;  2YU9 B;  4CJ0 B;  3L9A X;  1SJE D;  5ELC A;  1TT2 A;  4BA1 I;  1B9N A;  4RAU C;  4DAP A;  5FOB B;  1KLU D;  2G9D A;  3LWU A;  4HMI A;  4C3I B;  4BBR B;  4QMG A;  2WKC A;  2L4N A;  1BOS A;  1OXX K;  3EVQ A;  2MGS A;  3A7A B;  3SK6 A;  3IFD A;  5C3X A;  1F9Q A;  1TS2 A;  1EY6 A;  2XRS D;  4P2C B;  1IL8 A;  4IUR A;  2BE5 D;  4C3J B;  4FF3 A;  1GHJ A;  3RUZ A;  2O2L D;  3MHB A;  1VCI A;  5C0X H;  3R2I A;  4RGT A;  3GD7 A;  2NVY B;  1QJO A;  4AYB B;  4DN4 M;  1ZXT A;  1W6K A;  1Z47 A;  1MSG A;  5IT9 L;  1STY A;  3OHX C;  2BE5 C;  2Z4I A;  1SEB D;  5COR A;  1OXU A;  3S15 B;  1PLF A;  5BN3 A;  3SR1 A;  1DYQ A;  2PO4 A;  5IOC A;  2PPB C;  1HFG A;  4DFA A;  3ZYY X;  2F0I A;  1WTR A;  2ZXO A;  3NHH A;  2KOL A;  3K0Y A;  1G6Z A;  4ZLT F;  4WFN 3;  4HED A;  4X3K A;  5C0X I;  4NKL A;  2JA7 B;  2EVB A;  2MUY A;  3OPO A;  5C5M A;  4ZKB B;  1UNS A;  2XWJ B;  5CV8 A;  5DNF A;  4FVM A;  2EPB A;  4BA2 I;  5D3D A;  3TSS A;  1DXM A;  2L1B A;  2VNU D;  4A3I B;  1GUN A;  3GTK B;  4IFD J;  1VF7 A;  1DCZ A;  1G2S A;  4CKC A;  1UEA B;  3HOX B;  2EZV A;  2O5J C;  4FYD A;  3MC0 B;  2K05 A;  4ZRZ A;  2X6G A;  5COY A;  3VA7 A;  1YNN D;  2VB3 X;  2J0T D;  1ESF A;  1AP0 A;  2K32 A;  5C0X G;  2Z8L A;  3OIQ A;  4EVO A;  2R93 B;  5DM7 3;  1G29 1;  5C4Z A;  1ZEQ X;  5CV6 A;  1TQO A;  1YNN C;  4OO1 H;  5D65 A;  1A3U A;  3CQZ B;  3KLS A;  1EYC A;  3P1H A;  1I4Q A;  4ZUI A;  3D4D A;  1I4R A;  1RF2 D;  1EY0 A;  1EQV A;  1EY8 A;  4WJW A;  1LO5 D;  1I6V C;  3S14 B;  3PO3 B;  4KY6 A;  1QB5 D;  3E6Z X;  3I4N B;  1SE4 A;  3SVM A;  2E2I B;  5FK9 C;  1DZ1 A;  4C1N I;  1K8M A;  1OXS C;  4ZQ3 A;  4RCN A;  1TWC B;  5CMD A;  1EY9 A;  4A3E B;  5DAU A;  4OO1 I;  3FMC A;  3M85 A;  1FD7 D;  4IAL A;  1ONL A;  4HCS A;  3T16 A;  4CJ2 C;  3U9S A;  1WTO A;  4R9W A;  1JWS D;  1KDC A;  1HTP A;  2AQ2 B;  1KAB A;  1MGS A;  1HA6 A;  3I3C A;  4NDX A;  2HQE A;  5J22 A;  4KN7 C;  4PMB A;  1SYB A;  4X3T A;  3J7A F;  1Q90 A;  1EL0 A;  1F9P A;  4MIU A;  4UDU C;  2XWB B;  2KVM A;  1J8I A;  4C2M B;  5JEA H;  3ND8 A;  5FLX L;  1WTQ A;  1DJR D;  1RTN A;  3K58 A;  2F0G A;  1MBY A;  2B2V A;  2F0P A;  3K7A B;  4OO1 G;  4OGQ C;  1SNO A;  1V1O A;  3FPU B;  2RDF A;  2AWO A;  2L5T A;  1GUG A;  1A2U A;  3TME A;  2Q8T A;  1JC7 A;  1F2Z A;  1ROD A;  3S16 B;  2F0N A;  2V4D A;  3PUX A;  3KBG A;  1B50 A;  4G7Z C;  3A8I E;  4DF7 A;  5I6Y A;  1BCP B;  1TWA B;  3PMF A;  4X3S A;  2SEB D;  1A6X A;  3J81 L;  3I8Z A;  2NTS A;  2F3V A;  1GJX A;  2JXM B;  4A3M B;  1H9K A;  3S1R B;  1AN8 A;  2NWG A;  3NSW A;  4ULL A;  1PMR A;  1SNP A;  1AZP A;  1BO0 A;  4A93 B;  2B2W C;  2E74 C;  2IT1 A;  1FNU A;  1Z7T A;  2F0Q A;  3OSO A;  1BQQ T;  2VUM B;  2D2C C;  3NWS A;  5J39 A;  3CRL C;  2A69 D;  3P7J A;  1YNJ D;  3GV6 A;  3PUW A;  1G2T A;  2DN8 A;  2EXZ A;  4HMJ A;  2PZU A;  2RDH A;  5JVG 3;  1PTO F;  2PW5 A;  3E5S A;  1Y8N B;  2KUM A;  2LKV A;  2A69 C;  2NYZ D;  1O7Y A;  2B2Y C;  2MPM A;  1YNJ C;  3MTS A;  2R92 B;  3FKI B;  4DAV A;  2F0F A;  3L7Z C;  4TKO B;  2K7V A;  3GV3 A;  4FF1 A;  4KTA A;  4RA8 A;  4A3K B;  3I72 A;  5E4W C;  1WTX A;  5FO8 B;  1B1Z A;  3QJY A;  4U68 A;  2C9O A;  1Q1E A;  2QIL A;  4CBV A;  1PFN A;  3LNN A;  2KHS A;  2JA6 B;  4K2L A;  2NTT A;  1BCP F;  4DU9 A;  3KUP A;  1VF5 C;  1LTG D;  3A8K E;  4K8J A;  1KDA A;  3M7G A;  3NWT A;  1SBB B;  3MZ5 A;  4RH6 A;  3WDN A;  2EYH A;  2HCC A;  1TWH B;  1U9R A;  1BBX C;  1O7Z A;  2F0M A;  1TII D;  1S4Z A;  1JOR A;  2CHB D;  3QOJ A;  3M3Y B;  2BDN A;  2TSS A;  3BS1 A;  4IFD G;  1ET6 A;  4NMZ A;  1NCV A;  3NPP A;  3BVM A;  1ML0 D;  4WRD A;  4ZKC B;  2A6E D;  1BCP D;  4MN3 A;  5C3E B;  2I07 B;  1KTK A;  5IGE A;  1KDB A;  2PYK A;  5EQ0 A;  1F2Y A;  2A6E C;  1BCP C;  5JPM C;  2BDO A;  1HQM C;  5DM6 3;  4OL7 A;  4DAY A;  1EEF D;  1EWH A;  3G6J B;  5IT9 E;  2CQA A;  1O7L A;  1SYE A;  5CYU A;  2DNC A;  5EKK A;  2JEA I;  2KQ3 A;  3IFT A;  1EY7 A;  2EJM A;  1SND A;  1EY4 A;  2R7Z B;  4NW2 A;  2WIN B;  3WOF A;  1LTA D;  5G3L F;  3D8G A;  1PFB A;  3S1N B;  3U9O A;  5M5Y B;  2EYP A;  1ET9 A;  1QE6 A;  3ERQ A;  4LAA A;  1D1K A;  5E1F A;  1TY2 A;  3NUC A;  1I4P A;  1OO9 B;  2QF7 A;  3S17 B;  2B39 A;  3D4R A;  2F0H A;  4H0L C;  1UUP A;  1SYG A;  1SNM A;  1V1P A;  2E76 C;  2PCF B;  1H9S B;  1AZQ A;  5CBA E;  1RKN A;  1ICW A;  3NP8 A;  3C3L A;  2NBF A;  4EQN A;  5CV7 A;  3NQT A;  3T53 B;  4XYQ A;  1I3Q B;  1SDF A;  2RQX A;  3T4A C;  3TZD A;  3KK7 A;  2FFK B;  3HOU B;  1EY5 A;  5K36 H;  1B53 A;  1CQF A;  3H0G B;  4ABN A;  3S1Q B;  1U4M A;  1ESR A;  1CFM A;  5EBC A;  2F0T A;  1CA6 A;  3NTH A;  2PMZ B;  2NUC A;  3V05 A;  4NP5 A;  3R2T A;  1CTM A;  3S9W A;  2EJG C;  1LT5 D;  2K03 A;  3GTL B;  3JAM L;  4KMU C;  4FXK C;  3GTQ B;  5KGU A;  1X3P A;  5T1G A;  2J4X A;  1PDQ A;  2IX0 A;  2IL8 A;  2L0C A;  3FEW X;  1STB A;  1CM9 A;  3I4L A;  4KHV A;  4XT3 B;  3HGB A;  1L0X B;  5EPK A;  2H4O A;  2R61 A;  1CI3 M;  1D6E C;  1M4V A;  3BDC A;  4FXD A;  2J7Z A;  3HP3 A;  5CGK A;  5JJZ A;  2F0U A;  3MXG A;  1QNK A;  3T51 B;  5K36 G;  5FLX E;  2DY8 A;  4DNT B;  4KJN A;  3CRK C;  4BY7 B;  5ELF A;  2EYM A;  3BVZ A;  3BYY B;  5K5P A;  2PZT A;  2E2D C;  4A3F B;  2NN6 H;  3Q23 A;  1B4O A;  3KF8 A;  1EU3 A;  5KND A;  2KEC A;  3K5N A;  2PW7 A;  3NK9 A;  4I65 A;  5LL6 X;  3D31 A;  3TZU A;  4DXF A;  2B2V C;  1I6H B;  1ILP A;  5EKL A;  3TN2 A;  1EIH A;  2F0W A;  1PZI D;  3D6W A;  1JWU D;  3J81 E;  1Y1V B;  5D14 A;  3R93 A;  1K8O A;  5C5L A;  3X3N A;  1WTV A;  5C4H A;  1FGB D;  1OXT A;  3I4M B;  1II3 A;  3UI2 A;  2NN6 I;  2NVQ B;  3P20 A;  5A2Q L;  4C56 C;  1TWF B;  4QF4 A;  3K59 A;  1KNE A;  5FO7 B;  2HDM A;  4J1M A;  4KN4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...