4IQZA

The crystal structure of a large insert in rna polymerase (rpoc) subunit from e. coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
183
structure length
178
Chain Sequence
b'AAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta'
publication title The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 37
structure length 178
sequence length 183
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA02
1IYVA 2DNCA 1GUTA 5KNCA 4KN4C 1OXTA 1PMRA 1Q90A 3PUZA 5KNDA 3SDZA 3MFYA 4XTCS 1OXVA 1TKWB 3ND8A 2NN6H 2JEAI 1DD2A 4KI0A 1H9RA 2AWOA 3VR6A 4BA2I 2LMCB 3OW7A 1SMYC 5K36H 4DK0A 3VR5A 5K36G 1A6XA 1EWHA 2EJFC 2L5TA 2AUJD 4I7ZC 2BDOA 1GUGA 1H9KA 2QF7A 4KKSA 4H44C 2A6ED 1Y8PB 3W3AA 3L7ZC 1VF5C 1H9JA 2YYZA 1B9MA 3I73A 2JXMB 3WDNA 5BN3A 1OXUA 2D62A 1HTPA 1CFMA 1VCIA 3A8IE 3BG3A 1LACA 3M4YA 4LJZC 2O5IC 1IW7C 1H9SA 3VR2A 3I72A 2O5JC 4IQZA 5KNBA 2BA0A 1E2ZA 3LNNA 2E75C 3N6RA 3SE0A 3D31A 1Q1EA 4DNRB 3IFTA 3PUYA 3QJYA 1BDOA 2Q8IB 4BA1I 2NN6G 2PPBC 3PUVA 3GD7A 4LK1C 1GUNA 1ZYRC 2K32A 2PCFB 1E2VA 3T51B 3HGBA 4H0LC 5JEAH 5C0XH 4OO1H 3T53B 4KN7C 3FPPA 3ND9A 2B8GA 1GHJA 4G7HC 1Y69U 1ZKOA 2KCCA 3IKJA 3A8KE 3AB9A 1IYUA 4GZYC 1ONLA 1YNNC 1FR3A 3D4RA 1IW7D 2BE5C 4JBWA 2DN8A 3I4LA 3EQLC 3DXJC 3VR3A 1DXMA 4G7OC 2NN6I 2DNEA 1Y8NB 1YNJC 1O78A 3BDOA 4IFDH 3QIAA 1GUSA 1VF7A 4IFDG 4KMUC 1HCZA 2JEBI 1GJXA 1H9MA 2PNRC 1FYCA 1QJOA 2A69C 3CRKC 1V8QA 4TKOB 3RLFA 3U9SA 3FMCA 4PV1C 4HR7B 2ZT9C 1HPCA 4OGQC 2KA7A 1G291 3LWUA 1GUOA 1V43A 3KLRA 5BN5A 1Q1BA 2CW0C 3TZUA 5JEAG 4OO1G 1HQMC 1VDZA 5C0XG 2BA1A 3GQBA 3VR4A 2EJMA 2BE5D 2A6HC 3QG1A 3NE5B 2V4DA 2EVBA 1TU2B 3A8JE 4H13C 1Z7TA 1I6VC 2D5DA 4JK1C 5BN4A 2A68C 2AUKA 4TQUS 1CI3M 1GHKA 4RCNA 1Z6HA 2K7VA 2EDGA 3PV0A 4KKUA 3M85A 1K8OA 2EJGC 2A69D 2B8FA 1OXSC 3OOCA 5A35A 4G7ZC 1CTMA 3A7AB 1E2WA 1B9NA 3CRLC 2E74C 2D2CC 4DNTB 2IT1A 3VA7A 4KKTA 3P20A 2JE6I 1H9SB 2E76C 1LABA 1T5EA 1K8MA 4DK1A 2A6HD 3MXUA 3T56B 1O7LA 3PUWA 3M7NA 4XIGS 1Y8OB 4KHZA 2A68D 1OXXK 2F1MA 2R6GA 1DCZA 3A7LA 2K33A 3H94A 3PUXA 1Q12A 3OPOA 4L8JA 2A6EC
chains in the Genus database with same CATH superfamily
4PZ6A 3KBXA 1MKHA 3NELA 2WIIB 1EZ8A 3PUZA 4HMIA 4ALPA 5KNDA 3MFYA 3Q6SA 2DGYA 3J7YW 2H1EA 2PI2E 2RCFA 1A6XA 2OEOA 4I7ZC 3ULJA 2A6ED 3I56A 2YTVA 4GNXB 1DJRD 2K28A 1ESRA 5IGEA 1EYAA 4DV7Q 3BG3A 1B53A 5LMNL 1JB7A 3BZKA 4C2MH 1CSPA 3M3YB 1XXGA 2KUMA 1HZCA 2MUYA 3I8ZA 1E2ZA 4C3JB 2KQ3A 2VUMG 2I46A 4S3SA 5E4XA 1PFBA 5JEAH 2DY8A 2NTTA 3T53B 1PYWD 4LW1A 4UDUC 1UAPA 1GHJA 1CQFA 1Y69U 1AFPA 4AYBG 1NJIC 3S1QB 4XT3B 2ZJPA 3HP3A 1U9RA 1YNNC 1IW7D 5IWAL 1AH9A 4K5WA 1V1PB 3VR3A 3QWNA 2K5NA 1VF7A 3S1RH 2L15A 4DV6L 2NWGA 3GV6A 5JJLA 2R92G 1DGSA 4A3FB 2BH2A 2E2HB 2A73B 4OEMB 1CT1D 2ZTEA 4BS9A 3OYYA 3TZUA 4BY7B 4I65A 4F7XA 1CKMA 2QA4A 4DR6Q 5M5YB 2D5DA 3TSSA 3ULPA 2L1BA 4CDFC 1TS4A 1HRJA 2VS1A 1Z9FA 3EFXD 3PIO3 2B2WC 2NVTH 1GUWA 2F0QA 4QUCA 1QZHA 3AQQA 3O13A 4A3DG 1B44D 3S16B 2B2YC 4A3KH 2JE6I 4KV6A 5M9OA 1VQBA 2G9HD 1WTXA 2L9HA 2WB1B 3U9OA 1VQKA 2VXWA 1VQIA 4DAPA 2K33A 3HOZH 3H94A 1RODA 1L0XB 3MC0B 1YIJA 1SXTA 4KTAA 2E2IH 1Q7YC 2SOBA 2F0VA 2MPMA 3AFQA 2PMZB 2QKIC 3EA6A 1Q90A 2EY2A 1QOHA 3I4NB 5GAGC 1WD1A 4X62Q 1TKWB 4AH6A 2FXQA 1EOVA 1WCMG 4A4IA 1PXUA 3VR6A 3OTOL 1X3QA 2Z4IA 4HIKA 4P2CB 1ICWA 2EQSA 4JI5L 2F03A 2HQLA 1QB5D 4TSSA 4A3JG 5FLXc 1YVCA 4HSVA 2OCEA 2F4IA 1CFMA 4JI3Q 1D7QA 1YHQA 1SE4A 1K8GA 1H9SA 4NPSA 3KDFA 1I4XA 4QB4A 4CKCA 2RDHA 3PGZA 1LLRD 3K7AH 5F2DA 1VQPA 2JYOA 4A3BG 2SEBD 3S17B 4GLAC 5J1ZA 1OTCA 2VW9A 1NCVA 1BR9A 4BBSB 4YCVA 4IUNA 1AZQA 1TT2A 3QO2A 2WV6D 1JWMD 4C3IG 3CXCA 1BBUA 4JBKA 1F9PA 1WTPA 2VY3A 5C4XG 5D3IB 4ILWA 4R4IA 2VQEQ 4HJAA 1PH9A 3GTPH 3BDOA 3GTGB 1GJXA 1O7ZA 1X55A 3U9SA 3AMUA 4HN7A 2XSCA 2K04A 3A54A 1O7YA 5D14A 1LT3D 4DN4M 1SR3A 4L5TA 4NP5A 3W5OA 4A75A 4DV1L 1KLUD 4EQNA 3SR1A 1Z7TA 1EFID 5I4DA 2IJ0A 2TMPA 2KEDA 1GO3E 2F4VL 1CI3M 2HD3A 3WWVA 4DV4Q 2FJ2A 5AFWA 2WKCA 1BOSA 1LTRD 4XYQA 1EUJA 1CKNB 3OOCA 2F3WA 4LF7Q 5KYLA 2EY1A 5E3FA 1R4PB 3SGIA 2CW0D 3HOVG 1SYBA 1MI2A 5NUCA 2I5HA 4Y52H 3R8BA 1A8VA 2AWNA 4DK1A 1TXYA 3K5NA 5M3FH 1E24A 3I2ZA 1S5DD 4RWSC 4V0BA 3FKIG 4APVA 2PW7A 3SK8A 3UDXA 1UE7A 3GTLH 2TSSA 4Q5VA 5CV7A 1Q8KA 1HXYD 5IODA 5T1GA 2F0OA 2VQFL 1IYVA 1YNJD 4YCWA 2EYLA 4KN4C 5C3EG 4PZ7A 3GP7A 2F0UA 2RDGA 2D9UA 2N3SA 1IBLQ 2NN6H 4BY1B 3G71A 4DR2Q 1NMFA 4FNFA 2HDMA 1UE1A 4HJ9A 4DXGA 3NTHA 1WTVA 3QR8A 4FXDA 4XYOA 3M4OB 3CCJA 3WOFA 1VF5C 4YWMA 5FLXE 1GKHA 1ESFA 3UDFA 1PZKD 4V190 2O5IC 2CH4W 4LUOA 1LT4D 3EN2A 1HJPA 2IHEA 2Z6KC 4IQZA 2FMCA 4LFCQ 3E0JA 1NSNS 1SNMA 1RJTA 3E3XA 1SMYD 4HIMA 1A0IA 3CCLA 1CKOA 1II3A 2EYMA 3E0EA 4EQPA 2MNAA 1K0RA 1X3FA 1D2BA 3FPPA 5G3LF 2B8GA 5ELCA 4DR7Q 4YY3L 3HOYH 4B3ML 4ODGA 1X9NA 3A8KE 3CPFA 1IYUA 4N9PA 4GZYC 4A3LH 3KJOA 4AQYQ 4JBWA 1Y1VB 2C35B 5CGKA 2ZTDA 2UU9L 1AEXA 3I4MH 1BF4A 3TEHB 5M3MB 1UE6A 2A1AA 2PNRC 5HGTA 4HAEA 1V8QA 3G6JB 1G6PA 2IWHA 4HR7B 1TIID 4B9XA 3STBC 4K5VA 3CQZH 3F8TA 3RZOH 1EY9A 2QDLA 1W6JA 5C0XG 3HOUG 4GKKQ 4A3EB 2A6HC 4KMUC 1PH2A 4C3HB 3CP0A 2NTSA 1S40A 2KBNA 1EL0A 1KL9A 3E9HA 1I6HB 2K4KA 3H6MA 1WJJA 1Z47A 2F0LA 3RLNA 3NQIA 1IKMA 1I4QA 1RHPA 1E2WA 2KENA 2E74C 2D2CC 4DNTB 5IGFA 4DV3Q 3KF6A 2F0JA 3CKIB 1YNND 3A7LA 4DV5Q 1EY7A 3BVMA 4TVAB 1EIHA 1XX8A 1GD7A 4HSPA 2E2JH 4JI7L 3GTQH 2A6EC 2MO1A 4QY7A 2F3VA 5I2XA 1GUTA 1AZPA 3CCVA 1PH6A 3SVMA 4ME5A 3J81L 3ULLA 1J5EL 1M90C 4JV5L 1A63A 1WTRA 2AWOA 5D65A 4QJFA 1I4GA 1LTTD 1GOZA 3F1ZA 4A3IH 1R9TH 1I3QH 1IKLA 2UXDL 1X32A 1YZ6A 5ISRA 4DPGA 2PYKA 4QIWB 1XPOA 3J7ZC 2WB1E 4ZKCB 3CCRA 2YYZA 1C48A 1STBA 2EYFA 4CJ0B 3H3VC 3CF5A 5COYA 3UDGA 5JVH3 1IW7C 1PZID 2XRQD 4QCLA 1LTBD 4FP5D 5C4HA 1STNA 1F9QA 4HTHA 1Q46A 4K5XA 3S1MH 1WOCA 1V1OA 1CK1A 2RHSB 4NXNL 1CA6A 3T13A 3JAML 2R92B 1C4QA 3HGBA 4L6TB 1K9MC 1TWHH 2NVQB 2XTIA 3TREA 4J1MA 1BVSA 3K81C 3GTJB 2VZAA 4IPHA 2H4OA 1ONLA 2E8GA 1WI5A 1AN8A 4A3MG 1HNXL 3J7AF 1DXMA 4BXXH 2M9VA 1I94Q 3FPUB 1V1QA 1TS3A 4A93H 1H9MA 2QW7A 4TKOB 2EYJA 1EY8A 4A3DB 4OGQC 5IYCG 5E1FA 1EFWA 1CSQA 1HQMC 2ZM6Q 2ES2A 4I7AA 3FDTA 1SNDA 1UUPA 2EJMA 4H13C 5BN4A 4A3CH 4KHPQ 1KHIA 2LY7A 2JA8H 3V96A 2WKDA 1Q8IA 1Z6HA 2WAQE 4LF6Q 2F0MA 3KLWA 2A69D 1OXSC 1CTMA 5C4JH 1UWVA 4UAIA 2VL6A 4A3KG 1LTAD 1PH4A 1T5EA 5EKLA 1HA6A 5FK9C 2JA6G 4KHZA 2IX1A 2CQAA 2F1MA 5CV8A 4FF3A 2B2WA 3HOZG 3AEVA 4DV2L 2F0HA 4ME3A 3T1YQ 4A3JB 3Q24A 1I50H 1MGSA 2NZ1D 4M8AA 1OXTA 1PH5A 4PMCA 4A3GB 1L1OA 3M4QA 4OX9Q 1F2LA 3L9AX 2KJXA 3ND8A 1SAPA 1EY6A 2LMCB 4K6DA 4N8X1 2EY5A 2KCTA 2UUBQ 1EEFD 5FJ8H 2F0IA 1TWFH 1B3AA 3NBIA 3PIP3 3DWQA 4DAYA 2B2UC 1MSGA 2EE1A 4A3BB 1C9OA 3BS1A 1EYCA 1STYA 1K83B 4LJZC 1HNWQ 3HZXA 4X3KA 2NVYB 3OW2A 1BBWA 3G48A 4B3RQ 1KABA 2HCIA 2LXKA 2YV5A 2O5JC 1OO9B 3PO2B 4WFN3 4C1NK 3SE0A 2F0EA 3D31A 4WJ4A 1SRUA 4HCEA 1BDOA 2PQAA 2PW5A 4LK1C 3HOXB 3S2HH 2L4NA 1IL2A 2GA4B 4IN3A 5GAHC 1STAA 1S5BD 1U4LA 1QNUA 2M00A 1KAWA 2XWJB 3F2UA 3I4LA 1N34Q 2P5ZX 2NZOA 3I4OA 2V1CC 1I4PA 4ZAIA 4XQNA 2JA5H 2EXDA 1FNWA 1LTLA 1FYCA 3CRKC 5LMNW 4X62L 3TS0A 1PV4A 1X65A 5C3WA 4IUUA 1XNRL 3HOVB 2CW0C 1A3UA 3AYHB 1S5FD 1E22A 4KK7A 2B2TA 4CDCC 1TU2B 2BDNA 4FF1A 1EEID 3FKIB 3F2BA 3OIPA 2EZVA 1HUMA 1EYGA 4IUVA 1A3VA 5GQOA 3NBHB 4JI3L 4FDBA 5KRUA 1RDPD 2ZJRA 1KRSA 1W6KA 3LWEA 2DJGC 5CORA 5C3EB 5EPJA 1K28A 4O0AA 3CRLC 5C0XI 1E1TA 1SYEA 5EKKA 1LM0A 2G9DA 2NUCA 3P20A 5EAYA 1VQGA 3ERQA 2QILA 1K8MA 2C5CA 4LWCA 1UEBA 1AP0A 4JOIC 2F0KA 1DOMA 1O7LA 1K3RA 3KOJA 4N9TA 3H3VH 2MO0A 1X56A 1SE8A 4RGMA 1BCPB 1RKNA 4YIJA 4IFDI 3DUZA 2CQOA 5JJKA 1PTOB 5IGDA 2E5LQ 2OT2A 3GTMB 1IHZA 3T1HQ 4K8IA 3VYSA 3STBD 1DD2A 2L55A 3U50C 1SMYC 4RGTA 3VR5A 4GOPC 3JC66 3PQIA 4QF4A 2QF7A 2FHTA 2IL8A 1PRTB 4KKSA 3BZDB 1PHJA 2E2DC 1ZEQX 2NZHA 3M3YH 1H9JA 3CPWA 4P74A 4C3JH 1NUCA 2K75A 2XVSA 4X3TA 4DV4L 1Y1WG 3LGJA 3HFZB 5H1SE 1KAAA 5G3LD 3N6RA 2KECA 1C7YA 3EROA 4LF7L 2F0FA 2RDFA 4K0KQ 1EQRA 3ND9A 4MZ9A 5C0XJ 3PF5A 3I3CA 3IKJA 4IUTA 4LMQD 1XMQQ 3HOUB 1M4VA 1ML0D 5L37A 4IUQA 1PFNA 1HR0Q 4LF4Q 1U4PA 2ZXPA 4QIWE 2JN4A 3DXJC 3BVGA 4NKLA 1EOTA 4A3FH 1QVCA 3DWPA 4AYBE 1O78A 2E2HH 2M2LA 3I4MG 4IFDJ 1LT5D 4TRDA 1M1KC 2JA7G 4BY7H 3QOLA 1IBLL 3ZJYC 1HH2P 4DR2L 3TBIB 3KDFB 5M5YH 1VQAA 2N88A 4JI0Q 1VQNA 4X66L 3OIQA 2MHVA 3A8JE 3KBGA 1X3GA 1GVPA 1WTOA 3BJUA 2DJFC 3S16H 4GLXA 4LF8Q 4L63B 1LTID 4DUYQ 1FL0A 3OSOA 5IP9G 4LFCL 1LYLA 3TP6A 1EQQA 1PYSB 1HZ9A 3NEMA 3S24A 2R7ZG 2RF4A 3PSIA 3M7NA 5AJ3Q 4RGNA 1WVLA 2F0NA 4DR7L 2QCPX 1SEBD 3H15A 3OMCA 3M4PA 3I4NH 4AQYL 4GLVB 2RVLA 4LFBQ 4C56C 1EY0A 3Q0AA 4LF5L 2FFKB 3HRZC 4UY8C 1TWAH 4RGOS 3FEWX 4KHVA 5K36H 1TWCB 4RKLA 1EWHA 2L11A 4A3IG 2BDOA 3T16A 3NUCA 1YITA 2MGSA 5IGBA 5EBCA 4CJ1B 1G2SA 2SDFA 3L2PA 1VCIA 2K50A 5IYBH 1F9RA 3J80L 4A3MB 3FP9A 4U673 1SJHD 4FF4A 2BA0A 4YWKA 4H7BA 2H5XA 3S17H 4UP9A 3CHBD 3TQYA 1ZXTA 4BBSH 2F0SA 3HOWH 3NQTA 3ICEA 1Y14B 4DV3L 1HNZQ 2AQ2B 2K03A 2K5DA 4K8JA 2NVXB 5E7NA 1C0AA 4EQOA 1PDQA 3AB9A 5M5WB 1EWIA 3D4RA 4DV5L 4R4OA 4K14A 5ELBA 2L0CA 1K0SA 2F0TA 3S2DB 2NYZD 2Z1CA 1GUSA 3MZ5A 4ID6A 3CCMA 2NVTB 1EY5A 2A69C 2EYOA 2ZJQA 3CC2A 5I2YA 5HURA 1YHAA 1A62A 4OWXB 1VQ4A 1MD2D 3BDLA 4NW2A 3GQBA 3VR4A 2BE5D 1YNXA 1SJED 2EVBA 5IE8A 2JA6B 2WAQB 2UXCQ 2AUKA 4BWGB 2JA8G 3S1NH 1B70B 1JR0D 3HOZB 2LS01 4YCUA 2K7VA 4J6HA 3CAMA 3H0GH 3K6OA 1JT8A 2IHFA 1EQTA 4KKTA 1WD0A 1KQSA 4HIOA 3PO3B 2Z8LA 1L2FA 1SFOB 1M8AA 2FINB 2GN5A 1VMPA 1JE5A 1JOQA 3I90A 4AIMA 1WTQA 3D8GA 1G6ZA 4UP8A 4BY1H 5C44G 1IXRA 4X65Q 3R3OA 4DR5Q 3SK5A 3TMEA 4GKJL 3MXNA 2RSNA 3R93A 1ENFA 3M4OH 1F77A 1D1KA 3VA5A 1VQDA 2DY7A 5FJ8G 1S3OA 1XNQL 2ZM6L 2R93B 1SYCA 1HZAA 1F2ZA 1VQHA 4KHPL 4P72A 3I73A 2JXMB 1KLGD 2LXJA 1KD1C 1SYDA 3PIOA 1S5CD 4LF6L 3I70A 3VYRA 3IFDA 1QE6A 4X3SA 4POFA 5ELEA 3NWSA 4WJWA 2B2UA 5LMUL 1VQCA 1SROA 2B2VA 1ZYRC 1R4QB 2MFIA 3BDCA 2B63H 1U5KA 1Y1VH 2SNMA 2X6GA 4XT1B 1DM0B 1SNPA 2DNEA 4OXPA 3BVZA 1MIUA 5EKIA 2JA5G 4OX9L 4JI8L 5DNFA 3FMCA 1ENCA 4A3EH 1IBML 2K5WA 4LUVA 4C3HH 1B7YB 4OO1G 1VDZA 1I5FA 3PMFA 3E5SA 4RHSA 1MBYA 4IJLA 1LTSD 3NENA 5CV5A 4F87A 2CWAA 4JK1C 1I6HH 3EVQA 4R8NA 4PG3A 3U4VA 2N49A 1G8ZD 1JB3A 4RCNA 4ZQ3A 3GTLB 2ICEC 4DV6Q 1AE2A 1BCPF 5JPMC 4PZ8A 4B3RL 3Q23A 5EPLA 1CHQD 1ASYA 1PTOF 3VA7A 4IUPA 4P71A 2K52A 3RZDB 3TZDA 3T56B 1MHWC 3NTIA 3PUWA 4IOAA 2A68D 1DCZA 3NPPA 1JWSD 2GVAA 1NTGA 2A19A 1EIYB 1PRTF 4OHJA 1PFMA 3U4ZA 1N34L 1PH3A 3J7A5 4YHHL 1VQ6A 1Y1WB 4NXML 1NNXA 4C1NI 4DK0A 4DUZQ 1BBXC 1IBKQ 3HKZE 1GUGA 2HHHQ 1DOLA 1ET6A 1JC7A 1FJGQ 1BO0A 2QGQA 4NDXA 3S14B 2SNSA 1CKNA 3KLSX 1B9MA 5BN3A 2D62A 4C3JG 2AKWB 4OIJA 1PTOC 1KDBA 4GOPA 2R92H 3HKZG 3H91A 3QJYA 4N8FA 4NB3A 3RMHA 1CHPD 1CM9A 2RHQB 4G57A 5A2QL 2JA7B 1L1OB 2PCFB 5IGCA 3H09A 5IT9c 3GTJH 3KYHC 2VUMB 4JBMA 3GTOB 1FGBD 4G7HC 1VQ5A 3J80i 4CKEA 1N8RC 1JQYD 1HFNA 3J81c 3F2DA 3HKSA 4IOCA 1QCBD 4AYBB 2DN8A 1PH7A 1SYFA 2BCOA 4DAYB 2HIVA 5DM73 1N36L 4X64L 4A76A 1Y8NB 4A3FG 4OIKA 4A3DH 4IPCA 1TVXA 2XIWA 4O1NA 1B50A 5EPKA 3UE1A 2K05A 4PV1C 4ZCKA 3C1EA 1SE2A 4JW0A 3J81j 4R4CA 3FHWA 5JEAG 3ONAB 2HCCA 1CZGA 2R7ZB 4R4QA 3A0JA 4IPGA 1JJ2A 4GNXC 3HS0C 1KNAA 4ZYSA 2JSOA 2PZUA 5DLQE 2OF1A 3DM3A 4ZLTF 2RSOA 2HIXA 2IT1A 4OL7A 4JYAQ 3FRPB 1EZ6A 4K0KL 4DV1Q 4RCOA 1VQJA 1B3QA 4A3JH 4BBRH 1R9TB 4OWTB 4A3IB 2PQEA 5KEEA 1BKBA 3PUXA 2OWOA 1XMQL 4A3GH 3AFPA 1KXLA 3HEJA 1HR0L 4LF4L 2DNCA 4DNIA 3DLLA 4DV7L 3KF8A 3K0YA 2AMCB 2F0PA 2A8VA 4OELB 2IY5B 3I91A 4B3SQ 4A3BH 4ZUJA 3S1MB 1JICA 1P8LA 5K36G 4OONA 1WCMB 2AUJD 2X69A 1SNOA 1NAPA 1PYBA 5GAEC 4JI0L 3TDQA 3TS2A 1K83H 3OMGA 1Y8PB 2NVYH 4ZK9B 2YU9B 4JBJA 2EYPA 3PO2H 1HTPA 3E9IA 4CJ2C 5FO8B 2B2YA 1Q3LA 4DF7A 4DV0Q 2XRSD 4JPBW 3HOXH 2E75C 4DUYL 5JOBA 2GVBA 5IY0A 5K5PA 2Q8IB 1KNEA 3GD7A 4Y7NH 4JI1Q 1E2VA 3T51B 3K58A 4BBSG 3HOWG 5IT9E 4UHVA 5IOCA 2IW3A 5AJ3L 1VQOA 2B39A 1NR2A 2KCMA 4DAMA 2BE5C 3J81E 5KYIA 3CCSA 4DR6L 1A2UA 2CHBD 1ENAA 4C3IB 2PO4A 3LX0A 3BU2A 3QIAA 4JC0A 1DONA 5C4XB 4EX5A 3HOVH 3KJPA 1MJEA 2ICIA 4JVZA 1ASZA 3GTKB 4B3MQ 1XPUA 5EQ0A 3FKIH 1Q81C 2N78A 5IIFA 1ET9A 4MN3A 3PF4A 3DEOA 3BYTB 2NBFA 3E6ZX 4TQUS 1EU3A 5C3EH 2JK8A 4KD3A 1K8OA 2O2LD 2QEJC 3DHQA 3H0GG 4G7ZC 5C44B 4OO1I 1B9NA 1SDFA 1YEZA 3K80C 1ZYRD 3MEHA 1VQLA 2K6AA 4HJ7A 3MXUA 3VYUA 2WACA 2R61A 3RR5A 1FNVA 1HNZL 4HMJA 4DK3C 1SN8A 1PTOH 3A8IE 2MP1A 4L8JA 1EWCA 4DR4Q 3MXPA 4HJ8A 2J4XA 2HQEA 3S15B 2F0WA 2Y0SE 2F0DA 2F52A 3TP5A 4X6AH 2K5HA 3CD6A 5IP7H 2WFWA 5KIXA 3D0FA 1UEAB 1G2TA 2ASBA 5M3FG 2Y0SG 2J7ZA 3URYA 1S5ED 1GM5A 4DKAC 3GDEA 4XXEA 4JI7Q 3W3AA 1K8AC 4JI2Q 4CGYB 2UXCL 1LACA 5IGGA 4JV5Q 4KY5A 4WJ3M 5KNBA 5FO7B 2BOSA 5D3DA 5FO9B 1TWGB 2VQEL 3LNNA 5CV4A 2NN6G 1O7IA 1IL8A 5CR3A 5CV9A 5C0XH 2Z6BA 3HOUH 2XNAC 4KD4A 2HUGA 4CDEC 1E0BA 2PZWA 3G4SA 2YTYA 2B63G 3J81i 3V05A 2VNUD 1L0WA 5BR8Q 1MSHA 1TY2A 2OQ0A 3R2TA 4RFBA 2ZTCA 2I5MX 4X3UA 4IFDH 5J22A 4L5RC 4KY6A 4KLKA 4DR5L 4NXNQ 3VR2A 2FMMA 1QZGA 1HPCA 3S1QH 3A74A 2L12A 4U68A 4C3HG 3OHXC 1S72A 2BA1A 4QUFA 3PIPA 4RMFA 1BCPD 4FF2A 3HOYG 1I6VC 4LUZA 2A68C 2B3GA 2Z6KA 4A3LG 2RA4A 1PTOD 1GHKA 5JVG3 3M85A 5M5XB 1EQVA 3JAMi 2UUAQ 1TS2A 1KC8C 1D5XC 1NR4A 3IAYA 4HEDA 5JAVA 1H9SB 2E76C 1JOOA 1C8CA 1PRTD 2CCZA 3D6CA 4B3TQ 1D5MC 3CW2C 1DZ1A 3A55A 1N32Q 3K5LA 2Q8RE 4MTNA 4LAAA 2G5DA 4LF9Q 1QVGA 1I4HA 5I9OA 1OXVA 1TWCH 5EJWA 4B9WA 5FOBB 1JOKA 1EIFA 5JJIA 4KI0A 2IPKD 5FKAC 4DK6C 4OWWB 1FVIA 2F3IA 3HKZB 3TP8A 2L5TA 2CFMA 1UE5A 3VDYA 4PMWA 4DV2Q 2RKSA 3NBHA 2KEEA 1NBWA 1RL2A 2WINB 4A3MH 5CBEE 3L7ZC 4HJ5A 2R7DA 3WDNA 2A5HA 1OXUA 3K57A 3M4YA 3DEPA 4LNQA 4EQ5A 4FXGC 1I4RA 2Z9HA 3MXGA 2A74C 4HIDA 2RBMA 2HDLA 3K8AA 1HA5A 3PUYA 4C2MB 5IYCH 1QUQA 4LFAQ 1QILA 3T4AC 3PUVA 4M1UB 2NVXH 2JP1A 4DR3Q 2ZXOA 1KRTA 2YTXA 5M5WH 3CMEA 5JEAJ 3MXNB 2OTJA 3PCOB 1G91A 3RUZA 2LFNA 4F8MA 5CC4A 3S2DH 1RIPA 4GKKL 4RAUC 1EIGA 3M9BA 4K2KA 3D4DA 3W2DA 4RA8A 2KVMA 2R3ZA 4DFAA 5ELDA 1WTHA 4DGZA 2UXBQ 3VYTA 1N9WA 3D3RA 5JPNC 3CC7A 1EY4A 3B6YA 1L1OC 1RD9D 2KA7A 3S1RB 3A5ZB 2JA6H 4RG1A 4FYDA 4DUZL 5GROA 1IBKL 4GN3B 4EGVA 2HHHL 2CVRA 3J80c 1LT6D 1XTCD 1FJGL 2K5VA 4EVOA 3MEFA 3GTGH 4JI6Q 1HQRD 2EDGA 3NP8A 5FLXL 1RF2D 2Z0SA 1QNKA 4BXXG 4IURA 1KIXA 1ILQA 3A7AB 3PO3H 1XNRQ 1SFOH 4A93G 1JJGA 4MTKA 2D0PA 1CUKA 4XDXA 3BYYB 3Q22A 1O80A 1D8LA 4PNYA 5IYDH 1F2MA 4GNXA 1N33Q 1TWAB 3QB3A 5E4WC 4A3KB 1XMOQ 2R6GA 3EBEA 4BBRG 5CMDA 2O4XA 2JA9A 3MAQA 1IYJB 1E3PA 4A3CG 1FNUA 3ZYYX 2UUCQ 4A3GG 2QEXA 3CCQA 2OTLA 2EYHA 5KNCA 2E2IB 2AHOB 2IX3A 1HFGA 1KDAA 3C3LA 2RQXA 5C4ZA 2VB3X 1H9RA 3OWFA 3OW7A 5GADC 3RNUA 1CA5A 2R93H 3K59A 1XWEA 2EJFC 5ELFA 3UE0A 1H9KA 1V1PA 5FLMH 1PVOA 3HOWB 4QMGA 1ILPA 3D4WA 3K5OA 1WTWA 4JI4Q 1B4OA 3PO2G 2B2TC 3P7JA 5HGQA 4MNOA 1Q82C 2RCNA 1BQQT 4B08A 1VQ9A 1I94L 2WP8J 4FXKC 3HOXG 4DNRB 2ZXRA 4L5QA 4DR1Q 2KHSA 1SE3A 4JYAL 3J7AV 1J9OA 1BXTA 3G7LA 3F2CA 4FO2A 5I6YA 3K7AB 5C5MA 4QQBX 1SNCA 3M7GA 1TY0A 1FR3A 3K5MA 3KF6B 5TSSA 3EQLC 2ALYB 4JCVE 4XQQA 2NN6I 3S1NB 4CKBA 1AW7A 3TN2A 1HZBA 1HCZA 3MHBA 3IL8A 3RLFA 3AU7A 3GTPB 2KHIA 3H0GB 1W2BA 1G291 4KJNA 1V43A 4GOPB 3MVVA 4B3SL 2Q2HA 3SK4A 2V4DA 1XJVA 3SK6A 2AQ3B 1YJNA 3J80E 4P73A 2K01A 3U58A 5LMNQ 2D0OA 1S4ZA 3T1YL 5M3MH 3PV0A 3MWYW 3L0OA 5J3BA 3RD4A 2Q2UA 2EJGC 1J6QA 3RZDH 4DV0L 2AQ1B 3C46A 4JI1L 3CCUA 4X66Q 4J8QA 1MJCA 1ICFB 1Y8OB 2UUBL 1FD7D 5IWAQ 3TP7A 2Y0SB 5M3FB 2LKVA 2Q2TA 1HTLD 1Y1WH 2OXPA 2KHJA 1HNWL 3NK9A 3X3NA 3SDZA 2LSSA 5IP7G 2N55A 2CWPA 3NWTA 1SYGA 2K14A 3P75A 3S14H 4MIUA 1U4RA 4K2LA 1TR5A 1B1ZA 1VQ7A 2X6LA 3X3MA 4GN5A 1HHVA 2B63B 1X3PA 1JORA 3NSWA 3RN5A 1FGUA 3SXHA 1STHA 4O42A 4CDDC 4LF5Q 5C5LA 2JA7H 3QOJA 1K73C 4JOIA 5ELOA 1Q1EA 1HR0W 2VUMH 5C6AA 3GTOH 4BA1I 3KF8B 2BH8A 1GUNA 2K32A 5JJZA 2PNHA 4KN7C 4RKBA 3R2IA 2KCCA 3IRBA 2XGTA 4ZUIA 2F0GA 3BZCA 1BCPC 4GS3A 1DOKA 1VQEA 3HOYB 1F2YA 4DR4L 4G7OC 1HUNA 5IP9H 1NE3A 4ABNA 4IFDG 2Q2IA 1X6OA 3OTOQ 2NVQH 2ZT9C 4PMBA 2R7ZH 1X54A 3I4MB 3LWUA 3KLRA 3L3OC 5BN5A 2N8NA 4JI5Q 4QGUA 2XWBB 1SLJA 3WOEA 4RHRA 1PRTC 3NE5B 5IT9L 3CQZB 3RZOB 4HCSA 5CYUA 5DAUA 3P1HA 2CH4A 4JI2L 4IZ8A 5I6WA 3RN2A 3GV3A 2EIFA 3V2TA 2K1BA 3ERSX 4CHTB 5A35A 1PA6A 2E5LL 4RH6A 1WFQA 3T1HL 4BY7G 5HY6A 1TS5A 2XN9C 3W1BA 4ZKBB 3N52A 4O2DA 3I55A 1OXXK 3W1GA 3A5UA 1H95A 1L0YB 2PQAB 3G6EA 5DM63 1Q12A 1LUZA 1PFSA 3OWEB 5BR8L 1JE4A 2VB2X 1YBYA 1PMRA 3Q8DA 2E2JB 1WYDA 3GTQB 4YWLA 3C2PA 3JAMc 1P16A 1K3BC 4XTCS 2PMZE 4G4KA 1WCMH 3CC4A 2WB1G 3GO5A 4DAVA 2C9OA 4L5SA 4Z9CB 2YU9H 2I0QA 2R7FA 1YI2A 1YHBA 1I3QB 1NMGA 3TRZA 5LHY1 3NHHA 2JJQA 2F4VQ 2I07B 1XYIA 4CBVA 2K5QA 1G51A 1U4MA 3I4NG 1KTKA 4GKJQ 1JMCA 4JG2A 1VMCA 4DU9A 1JCKB 2UUAL 3IFTA 1T5XD 2PPBC 4P75A 3CU7A 4QL5A 4ULLA 2QDBA 4IJHA 1XNQQ 1E7ZA 1SNQA 1JJCB 1Q86C 1ZKOA 4B3TL 4MHEA 1TWHB 4C3IH 1N32L 2VQFQ 2ATWA 3DMUA 5C4XH 2JQOA 1XPRA 5IYBG 4IPDA 4LF9L 5LMUQ 2JEBI 3GTKH 2I5LX 4WRDA 4LF8L 5EBDA 1U0LA 2DUDA 4A93B 1GUOA 1KDCA 4KY7A 1STEA 1X3EA 5EGTA 3DM1A 3EIVA 4ZRZA 1VQ8A 2WAQG 1AE3A 3QG1A 1PH8A 4BBRB 1UNSA 2EY6A 5T1IA 1E1OA 2EXZA 4XQJA 3I7FA 5C44H 2CKZB 2PI2A 2J0TD 3C1FA 1F9SA 4KKUA 1QWYA 1LTGD 2JA8B 2B8FA 4JI8Q 5A2QE 4IALA 3KFUA 3PO3G 1IBMQ 4LFBL 2OQKA 1RTOA 4R9WA 1LABA 4LFAL 3KLSA 1J8IA 5IYDG 5C4JB 4DR3L 1QG7A 4YY3Q 4XIGS 4GN4B 1IZ6A 1EYDA 2B2VC 3S15H 2MQHA 2Z4HA 1YJWA 4IO9A 3D6WA 1DYQA 2PZTA 4WORA 3SHLA 2UU9Q 4R8IA 4NMZA 1I50B 3JAME 2UXBL 5C3XA 1D5ZC 3NXWA 3MFGA 2JEAI 2ENBA 1BNZA 3UDIA 4BA2I 3MTSA 2R93G 3HG9A 4Q0FA 4UPAA 1VQMA 3KUPA 1W3SA 3FVQA 1VQFA 4Y7NB 5FLMG 4H44C 2ID0A 1TWFB 3SEBA 5CBAE 1T9HA 1TWGH 3A56A 3GTMH 1YJ9A 2HT1A 3ER0A 1SSOA 2Q8TA 1A3TA 1PZJD 4YHHQ 4JI6L 3I72A 4NXMQ 4BY1G 5ELNA 4R1JA 3NTKA 2EPBA 1CZWA 3DWAA 3H3VI 4OO1H 4H0LC 1QVFA 1VS0A 3S9WA 4H02A 3CCEA 1GXDC 2NB0A 1D6EC 1N33L 1RCVD 5DEHA 4DA2A 1XMOL 3S2HB 1TQOA 1SBBB 2UUCL 1J5EQ 1B2TA 1YNJC 1V9PA 2B29A 1EU4A 1QJOA 1JWUD 3KK7A 4UP7A 2JA5B 4F88A 4R4TA 2UXDQ 1BUVT 1Q1BA 1B8AA 3ITPA 5CV6A 5I9PA 1A2TA 2KCNA 4FVMA 3RLOA 1QUQB 1STGA 3UI2A 5M5XH 1Y1VG 1N36Q 4X64Q 5LL6X 4JI4L 2IX0A 5M3MG 1NY4A 1A15A 1D1IA 1PLFA 2EOTA 1SMXA 4X65L 3MA2B 4K6LA 5LL6S 1LO5D 3K7UC 4DR1L 4POGA 5KGUA 4E6IA 2A6HD 4KJOA 4A3EG 4DXFA 3K0XA 1RTNA 5J39A 4J15A 1PH1A 2MJ8A 1LV9A 3CMAA 1CQVA 4PQXA 1XTDA 3EJIA 3OPOA 2KOLA 1HNXQ
chains in the Genus database with same CATH topology
3KBXA 2WIIB 1EZ8A 3PUZA 4HMIA 5KNDA 3MFYA 3Q6SA 3J7YW 2H1EA 1A6XA 2OEOA 4I7ZC 2A6ED 1DJRD 2K28A 1ESRA 5IGEA 1EYAA 3BG3A 1B53A 3M3YB 1XXGA 2KUMA 2MUYA 3I8ZA 1E2ZA 4C3JB 2KQ3A 2I46A 4S3SA 5E4XA 1PFBA 5JEAH 2DY8A 2NTTA 3T53B 1PYWD 4UDUC 1UAPA 1GHJA 1CQFA 1Y69U 1AFPA 3S1QB 4XT3B 3HP3A 1U9RA 1YNNC 1IW7D 4K5WA 1V1PB 3VR3A 3QWNA 1VF7A 2NWGA 3GV6A 4A3FB 2E2HB 2A73B 1CT1D 4BS9A 3TZUA 4BY7B 4I65A 4F7XA 5M5YB 2D5DA 3TSSA 2L1BA 1TS4A 1HRJA 3EFXD 3PIO3 2B2WC 1GUWA 2F0QA 4QUCA 3O13A 1B44D 3S16B 2B2YC 2JE6I 4KV6A 5M9OA 2G9HD 1WTXA 2L9HA 2WB1B 3U9OA 2VXWA 4DAPA 2K33A 3H94A 1RODA 1L0XB 3MC0B 1SXTA 4KTAA 2SOBA 2F0VA 2MPMA 2PMZB 2QKIC 3EA6A 1Q90A 2EY2A 1QOHA 3I4NB 1WD1A 1TKWB 1PXUA 3VR6A 1X3QA 2Z4IA 4P2CB 1ICWA 2F03A 1QB5D 4TSSA 4HSVA 2F4IA 1CFMA 1SE4A 1H9SA 1I4XA 4QB4A 4CKCA 2RDHA 1LLRD 5F2DA 2JYOA 2SEBD 3S17B 5J1ZA 1NCVA 1BR9A 4BBSB 4IUNA 1AZQA 1TT2A 3QO2A 2WV6D 1JWMD 4C3IG 1F9PA 1WTPA 5D3IB 4ILWA 3BDOA 3GTGB 1GJXA 1O7ZA 3U9SA 3AMUA 4HN7A 2XSCA 2K04A 3A54A 1O7YA 5D14A 1LT3D 4DN4M 4NP5A 1KLUD 4EQNA 3SR1A 1Z7TA 1EFID 5I4DA 2IJ0A 2TMPA 2KEDA 1CI3M 2FJ2A 5AFWA 2WKCA 1BOSA 1LTRD 4XYQA 3OOCA 2F3WA 5KYLA 2EY1A 5E3FA 1R4PB 2CW0D 1SYBA 1MI2A 5NUCA 3R8BA 2AWNA 4DK1A 3K5NA 4RWSC 1S5DD 4V0BA 2PW7A 3SK8A 2TSSA 4Q5VA 5CV7A 1HXYD 5IODA 5T1GA 2F0OA 1IYVA 1YNJD 2EYLA 4KN4C 3GP7A 2F0UA 2RDGA 2D9UA 2NN6H 4BY1B 4FNFA 2HDMA 4DXGA 3NTHA 1WTVA 4FXDA 4XYOA 3M4OB 3WOFA 1VF5C 5FLXE 1ESFA 1PZKD 4V190 2O5IC 1LT4D 4IQZA 2FMCA 3E0JA 1NSNS 1SNMA 1RJTA 1SMYD 1II3A 2EYMA 4EQPA 1D2BA 3FPPA 5G3LF 2B8GA 5ELCA 4ODGA 3A8KE 4GZYC 1IYUA 4N9PA 4JBWA 1Y1VB 5CGKA 1AEXA 1BF4A 5M3MB 2PNRC 5HGTA 4HAEA 1V8QA 3G6JB 2IWHA 4HR7B 1TIID 4B9XA 4K5VA 1EY9A 1W6JA 5C0XG 4A3EB 2A6HC 4KMUC 4C3HB 1EL0A 2NTSA 1I6HB 3H6MA 1Z47A 2F0LA 3NQIA 1IKMA 1I4QA 1RHPA 1E2WA 2E74C 2D2CC 4DNTB 5IGFA 2F0JA 3CKIB 1YNND 3A7LA 1EY7A 3BVMA 1EIHA 1XX8A 4HSPA 2A6EC 2F3VA 5I2XA 1GUTA 1AZPA 3SVMA 4ME5A 3J81L 1WTRA 2AWOA 5D65A 1I4GA 1LTTD 1GOZA 1IKLA 1X32A 5ISRA 2PYKA 4QIWB 4ZKCB 2YYZA 1C48A 1STBA 4CJ0B 2EYFA 3H3VC 5COYA 5JVH3 1IW7C 1PZID 2XRQD 4QCLA 1LTBD 4FP5D 5C4HA 1STNA 1F9QA 4HTHA 4K5XA 1V1OA 1CK1A 1CA6A 3T13A 3JAML 2R92B 1C4QA 3HGBA 4L6TB 2NVQB 4J1MA 3GTJB 2H4OA 1ONLA 1AN8A 3J7AF 1DXMA 2M9VA 3FPUB 1TS3A 1H9MA 4TKOB 2EYJA 1EY8A 4A3DB 4OGQC 5E1FA 1HQMC 3FDTA 1SNDA 1UUPA 2EJMA 4H13C 5BN4A 2LY7A 3V96A 2WKDA 1Q8IA 1Z6HA 2F0MA 2A69D 1OXSC 1CTMA 4UAIA 1LTAD 1T5EA 5EKLA 1HA6A 5FK9C 2IX1A 4KHZA 2CQAA 2F1MA 5CV8A 4FF3A 2B2WA 2F0HA 4A3JB 3Q24A 1MGSA 2NZ1D 4M8AA 1OXTA 4PMCA 4A3GB 1F2LA 3L9AX 2KJXA 3ND8A 1SAPA 1EY6A 2LMCB 4K6DA 2EY5A 1EEFD 2F0IA 1B3AA 3NBIA 3PIP3 3DWQA 4DAYA 2B2UC 1MSGA 2EE1A 4A3BB 3BS1A 1EYCA 1STYA 1K83B 4LJZC 3HZXA 4X3KA 2NVYB 1KABA 2HCIA 2O5JC 1OO9B 3PO2B 4WFN3 4C1NK 3SE0A 2F0EA 3D31A 4HCEA 1BDOA 2PW5A 4LK1C 3HOXB 2L4NA 2GA4B 4IN3A 1STAA 1S5BD 1U4LA 1QNUA 2M00A 2XWJB 3F2UA 3I4LA 1I4PA 4ZAIA 4XQNA 1FNWA 1FYCA 3CRKC 5C3WA 4IUUA 3HOVB 2CW0C 1A3UA 1S5FD 4KK7A 2B2TA 1TU2B 2BDNA 4FF1A 1EEID 3FKIB 3OIPA 2EZVA 1HUMA 4IUVA 1A3VA 5KRUA 1RDPD 3LWEA 1W6KA 5CORA 5C3EB 5EPJA 3CRLC 5C0XI 1SYEA 5EKKA 3P20A 2G9DA 2NUCA 3ERQA 2QILA 1K8MA 2C5CA 1AP0A 2F0KA 1DOMA 1O7LA 4N9TA 4RGMA 1BCPB 1RKNA 4YIJA 4IFDI 3DUZA 1PTOB 5IGDA 2OT2A 3GTMB 1IHZA 4K8IA 3VYSA 1DD2A 2L55A 1SMYC 4RGTA 3VR5A 4QF4A 2QF7A 2FHTA 2IL8A 1PRTB 4KKSA 3BZDB 2E2DC 1ZEQX 1H9JA 1NUCA 2XVSA 4X3TA 1KAAA 5G3LD 3N6RA 2KECA 3EROA 2F0FA 2RDFA 3ND9A 5C0XJ 3I3CA 3IKJA 4IUTA 4LMQD 3HOUB 1M4VA 1ML0D 4IUQA 1PFNA 1U4PA 2ZXPA 3DXJC 3BVGA 4NKLA 1EOTA 3DWPA 1O78A 2M2LA 4IFDJ 1LT5D 4TRDA 3QOLA 3TBIB 2N88A 3OIQA 2MHVA 3A8JE 3KBGA 1WTOA 4L63B 1LTID 3OSOA 3TP6A 3M7NA 4RGNA 1WVLA 2F0NA 2QCPX 1SEBD 3OMCA 2RVLA 4C56C 1EY0A 3Q0AA 2FFKB 3HRZC 4RGOS 3FEWX 4KHVA 5K36H 1TWCB 4RKLA 1EWHA 2L11A 2BDOA 3T16A 3NUCA 2MGSA 5IGBA 5EBCA 4CJ1B 1G2SA 2SDFA 1VCIA 1F9RA 3J80L 4A3MB 4U673 1SJHD 4FF4A 2BA0A 4H7BA 3CHBD 1ZXTA 2F0SA 3NQTA 2AQ2B 2K03A 2K5DA 4K8JA 2NVXB 4EQOA 1PDQA 3AB9A 5M5WB 3D4RA 4K14A 5ELBA 2L0CA 2F0TA 3S2DB 2NYZD 2Z1CA 1GUSA 3MZ5A 4ID6A 2NVTB 1EY5A 2A69C 2EYOA 5I2YA 5HURA 1MD2D 3BDLA 4NW2A 3GQBA 3VR4A 2BE5D 1SJED 2EVBA 2JA6B 2WAQB 2AUKA 4BWGB 1JR0D 3HOZB 2LS01 2K7VA 4J6HA 3K6OA 1EQTA 4KKTA 1WD0A 3PO3B 2Z8LA 1SFOB 1M8AA 2FINB 1VMPA 1JOQA 3I90A 1WTQA 3D8GA 1G6ZA 3R3OA 3SK5A 3TMEA 3MXNA 2RSNA 3R93A 1ENFA 1F77A 1D1KA 3VA5A 2DY7A 2R93B 1SYCA 1F2ZA 3I73A 2JXMB 1KLGD 1SYDA 1S5CD 3I70A 3VYRA 3IFDA 1QE6A 4X3SA 5ELEA 3NWSA 4WJWA 2B2UA 2B2VA 1ZYRC 1R4QB 3BDCA 2SNMA 2X6GA 4XT1B 1DM0B 1SNPA 2DNEA 3BVZA 5EKIA 5DNFA 3FMCA 1ENCA 2K5WA 4OO1G 1VDZA 3PMFA 3E5SA 4RHSA 1MBYA 1LTSD 5CV5A 4F87A 4JK1C 3EVQA 4R8NA 1G8ZD 1JB3A 4RCNA 4ZQ3A 3GTLB 2ICEC 1BCPF 5JPMC 3Q23A 5EPLA 1CHQD 1PTOF 3VA7A 4IUPA 3RZDB 3TZDA 3T56B 3NTIA 3PUWA 2A68D 1DCZA 3NPPA 1JWSD 1PRTF 4OHJA 1PFMA 1Y1WB 4C1NI 4DK0A 1BBXC 1GUGA 1DOLA 1ET6A 1JC7A 1BO0A 4NDXA 3S14B 2SNSA 3KLSX 1B9MA 5BN3A 2D62A 4C3JG 4OIJA 1PTOC 1KDBA 3H91A 3QJYA 3RMHA 1CHPD 1CM9A 4G57A 5A2QL 2JA7B 2PCFB 5IGCA 3H09A 2VUMB 3GTOB 1FGBD 4G7HC 4CKEA 1JQYD 1HFNA 1QCBD 4AYBB 2DN8A 1SYFA 2BCOA 5DM73 1Y8NB 4OIKA 1TVXA 2XIWA 4O1NA 1B50A 5EPKA 2K05A 4PV1C 3C1EA 1SE2A 5JEAG 3ONAB 2HCCA 1CZGA 2R7ZB 3HS0C 1KNAA 4ZYSA 2JSOA 2PZUA 2OF1A 4ZLTF 2RSOA 2IT1A 4OL7A 3FRPB 1EZ6A 4RCOA 1R9TB 4A3IB 2PQEA 5KEEA 3PUXA 3HEJA 2DNCA 3KF8A 3K0YA 2F0PA 3I91A 4ZUJA 3S1MB 1JICA 5K36G 1WCMB 2AUJD 2X69A 1SNOA 1NAPA 3TDQA 3OMGA 1Y8PB 4ZK9B 2YU9B 2EYPA 1HTPA 4CJ2C 5FO8B 2B2YA 1Q3LA 4DF7A 2XRSD 2E75C 5JOBA 5K5PA 2Q8IB 1KNEA 3GD7A 1E2VA 3T51B 3K58A 5IT9E 5IOCA 2IW3A 2B39A 1NR2A 3J81E 2BE5C 5KYIA 1A2UA 2CHBD 1ENAA 4C3IB 2PO4A 3LX0A 3QIAA 1DONA 5C4XB 2ICIA 3GTKB 5EQ0A 5IIFA 1ET9A 4MN3A 3DEOA 3BYTB 2NBFA 3E6ZX 4TQUS 1EU3A 4KD3A 1K8OA 2O2LD 2QEJC 3DHQA 4G7ZC 5C44B 4OO1I 1B9NA 1SDFA 1ZYRD 3MEHA 2K6AA 3MXUA 3VYUA 2WACA 2R61A 1FNVA 4HMJA 1PTOH 3A8IE 2MP1A 4L8JA 1EWCA 3MXPA 2J4XA 2HQEA 3S15B 2F0WA 2F0DA 3TP5A 5KIXA 1UEAB 1G2TA 2J7ZA 3URYA 1S5ED 4XXEA 3W3AA 4CGYB 1LACA 5IGGA 4KY5A 5KNBA 5FO7B 5FO9B 2BOSA 5D3DA 1TWGB 3LNNA 5CV4A 2NN6G 1IL8A 5CR3A 5CV9A 5C0XH 2XNAC 4KD4A 2HUGA 1E0BA 2PZWA 3V05A 2VNUD 1MSHA 1TY2A 3R2TA 4RFBA 4X3UA 4IFDH 5J22A 4KY6A 3VR2A 2FMMA 1HPCA 2L12A 4U68A 4C3HG 3OHXC 2BA1A 4QUFA 1BCPD 4FF2A 1I6VC 2A68C 2RA4A 1PTOD 1GHKA 5JVG3 3M85A 5M5XB 1EQVA 1TS2A 1D5XC 1NR4A 3IAYA 4HEDA 5JAVA 1H9SB 2E76C 1JOOA 1C8CA 1PRTD 3D6CA 1D5MC 1DZ1A 3A55A 3K5LA 2Q8RE 4LAAA 1I4HA 5I9OA 1OXVA 5EJWA 4B9WA 5FOBB 1JOKA 4KI0A 2IPKD 5FKAC 3HKZB 3TP8A 2L5TA 4PMWA 2RKSA 3NBHA 2KEEA 2WINB 5CBEE 3L7ZC 3WDNA 2A5HA 1OXUA 3K57A 3DEPA 3M4YA 1I4RA 4FXGC 3MXGA 2A74C 2RBMA 2HDLA 1HA5A 3PUYA 4C2MB 1QILA 3T4AC 3PUVA 4M1UB 2JP1A 2ZXOA 5JEAJ 1G91A 3RUZA 2LFNA 4F8MA 5CC4A 4RAUC 1EIGA 4K2KA 3D4DA 3W2DA 4RA8A 2KVMA 2R3ZA 4DFAA 5ELDA 4DGZA 3VYTA 3D3RA 5JPNC 1EY4A 1RD9D 3S1RB 2KA7A 4FYDA 4EGVA 2CVRA 1LT6D 1XTCD 4EVOA 1HQRD 2EDGA 3NP8A 5FLXL 1RF2D 1QNKA 4IURA 1ILQA 3A7AB 4XDXA 3BYYB 3Q22A 1O80A 4PNYA 1F2MA 1TWAB 3QB3A 5E4WC 4A3KB 2R6GA 5CMDA 2O4XA 3MAQA 1FNUA 3ZYYX 2EYHA 5KNCA 2E2IB 2IX3A 1HFGA 1KDAA 3C3LA 2RQXA 5C4ZA 2VB3X 1H9RA 3OWFA 3OW7A 1CA5A 3K59A 1XWEA 2EJFC 5ELFA 1H9KA 1V1PA 3HOWB 4QMGA 1ILPA 3D4WA 3K5OA 1WTWA 1B4OA 2B2TC 3P7JA 1BQQT 4B08A 2WP8J 4FXKC 4DNRB 2ZXRA 2KHSA 1SE3A 3J7AV 1J9OA 1BXTA 3G7LA 4FO2A 5I6YA 3K7AB 5C5MA 1SNCA 3M7GA 1TY0A 1FR3A 3K5MA 5TSSA 3EQLC 4XQQA 2NN6I 3S1NB 4CKBA 1AW7A 3TN2A 1HCZA 3MHBA 3IL8A 3RLFA 3AU7A 3GTPB 3H0GB 1G291 4KJNA 1V43A 3MVVA 3SK4A 2V4DA 3SK6A 2AQ3B 3J80E 2K01A 1S4ZA 3PV0A 3MWYW 3RD4A 2EJGC 2AQ1B 3C46A 4J8QA 1Y8OB 1FD7D 3TP7A 2Y0SB 5M3FB 2LKVA 1HTLD 2OXPA 3NK9A 3X3NA 3SDZA 2N55A 3NWTA 1SYGA 3P75A 4MIUA 1U4RA 4K2LA 1TR5A 1B1ZA 2X6LA 3X3MA 1HHVA 2B63B 1X3PA 1JORA 3NSWA 3SXHA 1STHA 4O42A 5C5LA 3QOJA 1Q1EA 5C6AA 4BA1I 1GUNA 2K32A 5JJZA 4KN7C 4RKBA 3R2IA 2KCCA 4ZUIA 2F0GA 1BCPC 3HOYB 1DOKA 1F2YA 4G7OC 1HUNA 4ABNA 4IFDG 2ZT9C 4PMBA 3I4MB 3LWUA 3KLRA 3L3OC 5BN5A 2XWBB 3WOEA 4RHRA 1PRTC 3NE5B 5IT9L 3CQZB 3RZOB 4HCSA 5CYUA 5DAUA 3P1HA 4IZ8A 5I6WA 3GV3A 3V2TA 2K1BA 4CHTB 5A35A 4RH6A 1TS5A 2XN9C 4ZKBB 3N52A 1OXXK 1L0YB 5DM63 1Q12A 3OWEB 1JE4A 2VB2X 1PMRA 2E2JB 3GTQB 3C2PA 4XTCS 4G4KA 3GO5A 4DAVA 2C9OA 4Z9CB 1I3QB 5LHY1 3NHHA 2I07B 1XYIA 4CBVA 2K5QA 1U4MA 1KTKA 1VMCA 4DU9A 1JCKB 3IFTA 1T5XD 2PPBC 3CU7A 4ULLA 2QDBA 1SNQA 1ZKOA 4MHEA 1TWHB 3DMUA 2JEBI 4WRDA 5EBDA 4A93B 1GUOA 1KDCA 4KY7A 1STEA 5EGTA 3DM1A 4ZRZA 3QG1A 4BBRB 1UNSA 2EY6A 5T1IA 2EXZA 4XQJA 2J0TD 3C1FA 1F9SA 4KKUA 1QWYA 1LTGD 2JA8B 2B8FA 5A2QE 4IALA 1RTOA 4R9WA 1LABA 3KLSA 1J8IA 5C4JB 1QG7A 4XIGS 1EYDA 2B2VC 2Z4HA 3D6WA 1DYQA 2PZTA 4WORA 3SHLA 4R8IA 4NMZA 1I50B 3JAME 5C3XA 1D5ZC 3NXWA 3MFGA 2JEAI 2ENBA 1BNZA 4BA2I 3MTSA 3HG9A 4Q0FA 3KUPA 3FVQA 4Y7NB 4H44C 2ID0A 1TWFB 5CBAE 3SEBA 3A56A 1SSOA 2Q8TA 1A3TA 1PZJD 3I72A 3NTKA 2EPBA 1CZWA 3DWAA 4OO1H 4H0LC 3S9WA 1GXDC 2NB0A 1D6EC 1RCVD 5DEHA 4DA2A 3S2HB 1TQOA 1SBBB 1B2TA 1YNJC 1EU4A 1QJOA 1JWUD 3KK7A 2JA5B 4F88A 1BUVT 1Q1BA 3ITPA 5CV6A 5I9PA 1A2TA 2KCNA 4FVMA 1STGA 3UI2A 5LL6X 2IX0A 1A15A 1D1IA 1PLFA 2EOTA 3MA2B 4K6LA 5LL6S 1LO5D 5KGUA 4E6IA 2A6HD 4KJOA 4DXFA 1RTNA 5J39A 2MJ8A 1LV9A 1CQVA 4PQXA 3EJIA 3OPOA 2KOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYV A;  2DNC A;  1GUT A;  5KNC A;  4KN4 C;  1OXT A;  1PMR A;  1Q90 A;  3PUZ A;  5KND A;  3SDZ A;  3MFY A;  4XTC S;  1OXV A;  1TKW B;  3ND8 A;  2NN6 H;  2JEA I;  1DD2 A;  4KI0 A;  1H9R A;  2AWO A;  3VR6 A;  4BA2 I;  2LMC B;  3OW7 A;  1SMY C;  5K36 H;  4DK0 A;  3VR5 A;  5K36 G;  1A6X A;  1EWH A;  2EJF C;  2L5T A;  2AUJ D;  4I7Z C;  2BDO A;  1GUG A;  1H9K A;  2QF7 A;  4KKS A;  4H44 C;  2A6E D;  1Y8P B;  3W3A A;  3L7Z C;  1VF5 C;  1H9J A;  2YYZ A;  1B9M A;  3I73 A;  2JXM B;  3WDN A;  5BN3 A;  1OXU A;  2D62 A;  1HTP A;  1CFM A;  1VCI A;  3A8I E;  3BG3 A;  1LAC A;  3M4Y A;  4LJZ C;  2O5I C;  1IW7 C;  1H9S A;  3VR2 A;  3I72 A;  2O5J C;  4IQZ A;  5KNB A;  2BA0 A;  1E2Z A;  3LNN A;  2E75 C;  3N6R A;  3SE0 A;  3D31 A;  1Q1E A;  4DNR B;  3IFT A;  3PUY A;  3QJY A;  1BDO A;  2Q8I B;  4BA1 I;  2NN6 G;  2PPB C;  3PUV A;  3GD7 A;  4LK1 C;  1GUN A;  1ZYR C;  2K32 A;  2PCF B;  1E2V A;  3T51 B;  3HGB A;  4H0L C;  5JEA H;  5C0X H;  4OO1 H;  3T53 B;  4KN7 C;  3FPP A;  3ND9 A;  2B8G A;  1GHJ A;  4G7H C;  1Y69 U;  1ZKO A;  2KCC A;  3IKJ A;  3A8K E;  3AB9 A;  1IYU A;  4GZY C;  1ONL A;  1YNN C;  1FR3 A;  3D4R A;  1IW7 D;  2BE5 C;  4JBW A;  2DN8 A;  3I4L A;  3EQL C;  3DXJ C;  3VR3 A;  1DXM A;  4G7O C;  2NN6 I;  2DNE A;  1Y8N B;  1YNJ C;  1O78 A;  3BDO A;  4IFD H;  3QIA A;  1GUS A;  1VF7 A;  4IFD G;  4KMU C;  1HCZ A;  2JEB I;  1GJX A;  1H9M A;  2PNR C;  1FYC A;  1QJO A;  2A69 C;  3CRK C;  1V8Q A;  4TKO B;  3RLF A;  3U9S A;  3FMC A;  4PV1 C;  4HR7 B;  2ZT9 C;  1HPC A;  4OGQ C;  2KA7 A;  1G29 1;  3LWU A;  1GUO A;  1V43 A;  3KLR A;  5BN5 A;  1Q1B A;  2CW0 C;  3TZU A;  5JEA G;  4OO1 G;  1HQM C;  1VDZ A;  5C0X G;  2BA1 A;  3GQB A;  3VR4 A;  2EJM A;  2BE5 D;  2A6H C;  3QG1 A;  3NE5 B;  2V4D A;  2EVB A;  1TU2 B;  3A8J E;  4H13 C;  1Z7T A;  1I6V C;  2D5D A;  4JK1 C;  5BN4 A;  2A68 C;  2AUK A;  4TQU S;  1CI3 M;  1GHK A;  4RCN A;  1Z6H A;  2K7V A;  2EDG A;  3PV0 A;  4KKU A;  3M85 A;  1K8O A;  2EJG C;  2A69 D;  2B8F A;  1OXS C;  3OOC A;  5A35 A;  4G7Z C;  1CTM A;  3A7A B;  1E2W A;  1B9N A;  3CRL C;  2E74 C;  2D2C C;  4DNT B;  2IT1 A;  3VA7 A;  4KKT A;  3P20 A;  2JE6 I;  1H9S B;  2E76 C;  1LAB A;  1T5E A;  1K8M A;  4DK1 A;  2A6H D;  3MXU A;  3T56 B;  1O7L A;  3PUW A;  3M7N A;  4XIG S;  1Y8O B;  4KHZ A;  2A68 D;  1OXX K;  2F1M A;  2R6G A;  1DCZ A;  3A7L A;  2K33 A;  3H94 A;  3PUX A;  1Q12 A;  3OPO A;  4L8J A;  2A6E C; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  3KBX A;  1MKH A;  3NEL A;  2WII B;  1EZ8 A;  3PUZ A;  4HMI A;  4ALP A;  5KND A;  3MFY A;  3Q6S A;  2DGY A;  3J7Y W;  2H1E A;  2PI2 E;  2RCF A;  1A6X A;  2OEO A;  4I7Z C;  3ULJ A;  2A6E D;  3I56 A;  2YTV A;  4GNX B;  1DJR D;  2K28 A;  1ESR A;  5IGE A;  1EYA A;  4DV7 Q;  3BG3 A;  1B53 A;  5LMN L;  1JB7 A;  3BZK A;  4C2M H;  1CSP A;  3M3Y B;  1XXG A;  2KUM A;  1HZC A;  2MUY A;  3I8Z A;  1E2Z A;  4C3J B;  2KQ3 A;  2VUM G;  2I46 A;  4S3S A;  5E4X A;  1PFB A;  5JEA H;  2DY8 A;  2NTT A;  3T53 B;  1PYW D;  4LW1 A;  4UDU C;  1UAP A;  1GHJ A;  1CQF A;  1Y69 U;  1AFP A;  4AYB G;  1NJI C;  3S1Q B;  4XT3 B;  2ZJP A;  3HP3 A;  1U9R A;  1YNN C;  1IW7 D;  5IWA L;  1AH9 A;  4K5W A;  1V1P B;  3VR3 A;  3QWN A;  2K5N A;  1VF7 A;  3S1R H;  2L15 A;  4DV6 L;  2NWG A;  3GV6 A;  5JJL A;  2R92 G;  1DGS A;  4A3F B;  2BH2 A;  2E2H B;  2A73 B;  4OEM B;  1CT1 D;  2ZTE A;  4BS9 A;  3OYY A;  3TZU A;  4BY7 B;  4I65 A;  4F7X A;  1CKM A;  2QA4 A;  4DR6 Q;  5M5Y B;  2D5D A;  3TSS A;  3ULP A;  2L1B A;  4CDF C;  1TS4 A;  1HRJ A;  2VS1 A;  1Z9F A;  3EFX D;  3PIO 3;  2B2W C;  2NVT H;  1GUW A;  2F0Q A;  4QUC A;  1QZH A;  3AQQ A;  3O13 A;  4A3D G;  1B44 D;  3S16 B;  2B2Y C;  4A3K H;  2JE6 I;  4KV6 A;  5M9O A;  1VQB A;  2G9H D;  1WTX A;  2L9H A;  2WB1 B;  3U9O A;  1VQK A;  2VXW A;  1VQI A;  4DAP A;  2K33 A;  3HOZ H;  3H94 A;  1ROD A;  1L0X B;  3MC0 B;  1YIJ A;  1SXT A;  4KTA A;  2E2I H;  1Q7Y C;  2SOB A;  2F0V A;  2MPM A;  3AFQ A;  2PMZ B;  2QKI C;  3EA6 A;  1Q90 A;  2EY2 A;  1QOH A;  3I4N B;  5GAG C;  1WD1 A;  4X62 Q;  1TKW B;  4AH6 A;  2FXQ A;  1EOV A;  1WCM G;  4A4I A;  1PXU A;  3VR6 A;  3OTO L;  1X3Q A;  2Z4I A;  4HIK A;  4P2C B;  1ICW A;  2EQS A;  4JI5 L;  2F03 A;  2HQL A;  1QB5 D;  4TSS A;  4A3J G;  5FLX c;  1YVC A;  4HSV A;  2OCE A;  2F4I A;  1CFM A;  4JI3 Q;  1D7Q A;  1YHQ A;  1SE4 A;  1K8G A;  1H9S A;  4NPS A;  3KDF A;  1I4X A;  4QB4 A;  4CKC A;  2RDH A;  3PGZ A;  1LLR D;  3K7A H;  5F2D A;  1VQP A;  2JYO A;  4A3B G;  2SEB D;  3S17 B;  4GLA C;  5J1Z A;  1OTC A;  2VW9 A;  1NCV A;  1BR9 A;  4BBS B;  4YCV A;  4IUN A;  1AZQ A;  1TT2 A;  3QO2 A;  2WV6 D;  1JWM D;  4C3I G;  3CXC A;  1BBU A;  4JBK A;  1F9P A;  1WTP A;  2VY3 A;  5C4X G;  5D3I B;  4ILW A;  4R4I A;  2VQE Q;  4HJA A;  1PH9 A;  3GTP H;  3BDO A;  3GTG B;  1GJX A;  1O7Z A;  1X55 A;  3U9S A;  3AMU A;  4HN7 A;  2XSC A;  2K04 A;  3A54 A;  1O7Y A;  5D14 A;  1LT3 D;  4DN4 M;  1SR3 A;  4L5T A;  4NP5 A;  3W5O A;  4A75 A;  4DV1 L;  1KLU D;  4EQN A;  3SR1 A;  1Z7T A;  1EFI D;  5I4D A;  2IJ0 A;  2TMP A;  2KED A;  1GO3 E;  2F4V L;  1CI3 M;  2HD3 A;  3WWV A;  4DV4 Q;  2FJ2 A;  5AFW A;  2WKC A;  1BOS A;  1LTR D;  4XYQ A;  1EUJ A;  1CKN B;  3OOC A;  2F3W A;  4LF7 Q;  5KYL A;  2EY1 A;  5E3F A;  1R4P B;  3SGI A;  2CW0 D;  3HOV G;  1SYB A;  1MI2 A;  5NUC A;  2I5H A;  4Y52 H;  3R8B A;  1A8V A;  2AWN A;  4DK1 A;  1TXY A;  3K5N A;  5M3F H;  1E24 A;  3I2Z A;  1S5D D;  4RWS C;  4V0B A;  3FKI G;  4APV A;  2PW7 A;  3SK8 A;  3UDX A;  1UE7 A;  3GTL H;  2TSS A;  4Q5V A;  5CV7 A;  1Q8K A;  1HXY D;  5IOD A;  5T1G A;  2F0O A;  2VQF L;  1IYV A;  1YNJ D;  4YCW A;  2EYL A;  4KN4 C;  5C3E G;  4PZ7 A;  3GP7 A;  2F0U A;  2RDG A;  2D9U A;  2N3S A;  1IBL Q;  2NN6 H;  4BY1 B;  3G71 A;  4DR2 Q;  1NMF A;  4FNF A;  2HDM A;  1UE1 A;  4HJ9 A;  4DXG A;  3NTH A;  1WTV A;  3QR8 A;  4FXD A;  4XYO A;  3M4O B;  3CCJ A;  3WOF A;  1VF5 C;  4YWM A;  5FLX E;  1GKH A;  1ESF A;  3UDF A;  1PZK D;  4V19 0;  2O5I C;  2CH4 W;  4LUO A;  1LT4 D;  3EN2 A;  1HJP A;  2IHE A;  2Z6K C;  4IQZ A;  2FMC A;  4LFC Q;  3E0J A;  1NSN S;  1SNM A;  1RJT A;  3E3X A;  1SMY D;  4HIM A;  1A0I A;  3CCL A;  1CKO A;  1II3 A;  2EYM A;  3E0E A;  4EQP A;  2MNA A;  1K0R A;  1X3F A;  1D2B A;  3FPP A;  5G3L F;  2B8G A;  5ELC A;  4DR7 Q;  4YY3 L;  3HOY H;  4B3M L;  4ODG A;  1X9N A;  3A8K E;  3CPF A;  1IYU A;  4N9P A;  4GZY C;  4A3L H;  3KJO A;  4AQY Q;  4JBW A;  1Y1V B;  2C35 B;  5CGK A;  2ZTD A;  2UU9 L;  1AEX A;  3I4M H;  1BF4 A;  3TEH B;  5M3M B;  1UE6 A;  2A1A A;  2PNR C;  5HGT A;  4HAE A;  1V8Q A;  3G6J B;  1G6P A;  2IWH A;  4HR7 B;  1TII D;  4B9X A;  3STB C;  4K5V A;  3CQZ H;  3F8T A;  3RZO H;  1EY9 A;  2QDL A;  1W6J A;  5C0X G;  3HOU G;  4GKK Q;  4A3E B;  2A6H C;  4KMU C;  1PH2 A;  4C3H B;  3CP0 A;  2NTS A;  1S40 A;  2KBN A;  1EL0 A;  1KL9 A;  3E9H A;  1I6H B;  2K4K A;  3H6M A;  1WJJ A;  1Z47 A;  2F0L A;  3RLN A;  3NQI A;  1IKM A;  1I4Q A;  1RHP A;  1E2W A;  2KEN A;  2E74 C;  2D2C C;  4DNT B;  5IGF A;  4DV3 Q;  3KF6 A;  2F0J A;  3CKI B;  1YNN D;  3A7L A;  4DV5 Q;  1EY7 A;  3BVM A;  4TVA B;  1EIH A;  1XX8 A;  1GD7 A;  4HSP A;  2E2J H;  4JI7 L;  3GTQ H;  2A6E C;  2MO1 A;  4QY7 A;  2F3V A;  5I2X A;  1GUT A;  1AZP A;  3CCV A;  1PH6 A;  3SVM A;  4ME5 A;  3J81 L;  3ULL A;  1J5E L;  1M90 C;  4JV5 L;  1A63 A;  1WTR A;  2AWO A;  5D65 A;  4QJF A;  1I4G A;  1LTT D;  1GOZ A;  3F1Z A;  4A3I H;  1R9T H;  1I3Q H;  1IKL A;  2UXD L;  1X32 A;  1YZ6 A;  5ISR A;  4DPG A;  2PYK A;  4QIW B;  1XPO A;  3J7Z C;  2WB1 E;  4ZKC B;  3CCR A;  2YYZ A;  1C48 A;  1STB A;  2EYF A;  4CJ0 B;  3H3V C;  3CF5 A;  5COY A;  3UDG A;  5JVH 3;  1IW7 C;  1PZI D;  2XRQ D;  4QCL A;  1LTB D;  4FP5 D;  5C4H A;  1STN A;  1F9Q A;  4HTH A;  1Q46 A;  4K5X A;  3S1M H;  1WOC A;  1V1O A;  1CK1 A;  2RHS B;  4NXN L;  1CA6 A;  3T13 A;  3JAM L;  2R92 B;  1C4Q A;  3HGB A;  4L6T B;  1K9M C;  1TWH H;  2NVQ B;  2XTI A;  3TRE A;  4J1M A;  1BVS A;  3K81 C;  3GTJ B;  2VZA A;  4IPH A;  2H4O A;  1ONL A;  2E8G A;  1WI5 A;  1AN8 A;  4A3M G;  1HNX L;  3J7A F;  1DXM A;  4BXX H;  2M9V A;  1I94 Q;  3FPU B;  1V1Q A;  1TS3 A;  4A93 H;  1H9M A;  2QW7 A;  4TKO B;  2EYJ A;  1EY8 A;  4A3D B;  4OGQ C;  5IYC G;  5E1F A;  1EFW A;  1CSQ A;  1HQM C;  2ZM6 Q;  2ES2 A;  4I7A A;  3FDT A;  1SND A;  1UUP A;  2EJM A;  4H13 C;  5BN4 A;  4A3C H;  4KHP Q;  1KHI A;  2LY7 A;  2JA8 H;  3V96 A;  2WKD A;  1Q8I A;  1Z6H A;  2WAQ E;  4LF6 Q;  2F0M A;  3KLW A;  2A69 D;  1OXS C;  1CTM A;  5C4J H;  1UWV A;  4UAI A;  2VL6 A;  4A3K G;  1LTA D;  1PH4 A;  1T5E A;  5EKL A;  1HA6 A;  5FK9 C;  2JA6 G;  4KHZ A;  2IX1 A;  2CQA A;  2F1M A;  5CV8 A;  4FF3 A;  2B2W A;  3HOZ G;  3AEV A;  4DV2 L;  2F0H A;  4ME3 A;  3T1Y Q;  4A3J B;  3Q24 A;  1I50 H;  1MGS A;  2NZ1 D;  4M8A A;  1OXT A;  1PH5 A;  4PMC A;  4A3G B;  1L1O A;  3M4Q A;  4OX9 Q;  1F2L A;  3L9A X;  2KJX A;  3ND8 A;  1SAP A;  1EY6 A;  2LMC B;  4K6D A;  4N8X 1;  2EY5 A;  2KCT A;  2UUB Q;  1EEF D;  5FJ8 H;  2F0I A;  1TWF H;  1B3A A;  3NBI A;  3PIP 3;  3DWQ A;  4DAY A;  2B2U C;  1MSG A;  2EE1 A;  4A3B B;  1C9O A;  3BS1 A;  1EYC A;  1STY A;  1K83 B;  4LJZ C;  1HNW Q;  3HZX A;  4X3K A;  2NVY B;  3OW2 A;  1BBW A;  3G48 A;  4B3R Q;  1KAB A;  2HCI A;  2LXK A;  2YV5 A;  2O5J C;  1OO9 B;  3PO2 B;  4WFN 3;  4C1N K;  3SE0 A;  2F0E A;  3D31 A;  4WJ4 A;  1SRU A;  4HCE A;  1BDO A;  2PQA A;  2PW5 A;  4LK1 C;  3HOX B;  3S2H H;  2L4N A;  1IL2 A;  2GA4 B;  4IN3 A;  5GAH C;  1STA A;  1S5B D;  1U4L A;  1QNU A;  2M00 A;  1KAW A;  2XWJ B;  3F2U A;  3I4L A;  1N34 Q;  2P5Z X;  2NZO A;  3I4O A;  2V1C C;  1I4P A;  4ZAI A;  4XQN A;  2JA5 H;  2EXD A;  1FNW A;  1LTL A;  1FYC A;  3CRK C;  5LMN W;  4X62 L;  3TS0 A;  1PV4 A;  1X65 A;  5C3W A;  4IUU A;  1XNR L;  3HOV B;  2CW0 C;  1A3U A;  3AYH B;  1S5F D;  1E22 A;  4KK7 A;  2B2T A;  4CDC C;  1TU2 B;  2BDN A;  4FF1 A;  1EEI D;  3FKI B;  3F2B A;  3OIP A;  2EZV A;  1HUM A;  1EYG A;  4IUV A;  1A3V A;  5GQO A;  3NBH B;  4JI3 L;  4FDB A;  5KRU A;  1RDP D;  2ZJR A;  1KRS A;  1W6K A;  3LWE A;  2DJG C;  5COR A;  5C3E B;  5EPJ A;  1K28 A;  4O0A A;  3CRL C;  5C0X I;  1E1T A;  1SYE A;  5EKK A;  1LM0 A;  2G9D A;  2NUC A;  3P20 A;  5EAY A;  1VQG A;  3ERQ A;  2QIL A;  1K8M A;  2C5C A;  4LWC A;  1UEB A;  1AP0 A;  4JOI C;  2F0K A;  1DOM A;  1O7L A;  1K3R A;  3KOJ A;  4N9T A;  3H3V H;  2MO0 A;  1X56 A;  1SE8 A;  4RGM A;  1BCP B;  1RKN A;  4YIJ A;  4IFD I;  3DUZ A;  2CQO A;  5JJK A;  1PTO B;  5IGD A;  2E5L Q;  2OT2 A;  3GTM B;  1IHZ A;  3T1H Q;  4K8I A;  3VYS A;  3STB D;  1DD2 A;  2L55 A;  3U50 C;  1SMY C;  4RGT A;  3VR5 A;  4GOP C;  3JC6 6;  3PQI A;  4QF4 A;  2QF7 A;  2FHT A;  2IL8 A;  1PRT B;  4KKS A;  3BZD B;  1PHJ A;  2E2D C;  1ZEQ X;  2NZH A;  3M3Y H;  1H9J A;  3CPW A;  4P74 A;  4C3J H;  1NUC A;  2K75 A;  2XVS A;  4X3T A;  4DV4 L;  1Y1W G;  3LGJ A;  3HFZ B;  5H1S E;  1KAA A;  5G3L D;  3N6R A;  2KEC A;  1C7Y A;  3ERO A;  4LF7 L;  2F0F A;  2RDF A;  4K0K Q;  1EQR A;  3ND9 A;  4MZ9 A;  5C0X J;  3PF5 A;  3I3C A;  3IKJ A;  4IUT A;  4LMQ D;  1XMQ Q;  3HOU B;  1M4V A;  1ML0 D;  5L37 A;  4IUQ A;  1PFN A;  1HR0 Q;  4LF4 Q;  1U4P A;  2ZXP A;  4QIW E;  2JN4 A;  3DXJ C;  3BVG A;  4NKL A;  1EOT A;  4A3F H;  1QVC A;  3DWP A;  4AYB E;  1O78 A;  2E2H H;  2M2L A;  3I4M G;  4IFD J;  1LT5 D;  4TRD A;  1M1K C;  2JA7 G;  4BY7 H;  3QOL A;  1IBL L;  3ZJY C;  1HH2 P;  4DR2 L;  3TBI B;  3KDF B;  5M5Y H;  1VQA A;  2N88 A;  4JI0 Q;  1VQN A;  4X66 L;  3OIQ A;  2MHV A;  3A8J E;  3KBG A;  1X3G A;  1GVP A;  1WTO A;  3BJU A;  2DJF C;  3S16 H;  4GLX A;  4LF8 Q;  4L63 B;  1LTI D;  4DUY Q;  1FL0 A;  3OSO A;  5IP9 G;  4LFC L;  1LYL A;  3TP6 A;  1EQQ A;  1PYS B;  1HZ9 A;  3NEM A;  3S24 A;  2R7Z G;  2RF4 A;  3PSI A;  3M7N A;  5AJ3 Q;  4RGN A;  1WVL A;  2F0N A;  4DR7 L;  2QCP X;  1SEB D;  3H15 A;  3OMC A;  3M4P A;  3I4N H;  4AQY L;  4GLV B;  2RVL A;  4LFB Q;  4C56 C;  1EY0 A;  3Q0A A;  4LF5 L;  2FFK B;  3HRZ C;  4UY8 C;  1TWA H;  4RGO S;  3FEW X;  4KHV A;  5K36 H;  1TWC B;  4RKL A;  1EWH A;  2L11 A;  4A3I G;  2BDO A;  3T16 A;  3NUC A;  1YIT A;  2MGS A;  5IGB A;  5EBC A;  4CJ1 B;  1G2S A;  2SDF A;  3L2P A;  1VCI A;  2K50 A;  5IYB H;  1F9R A;  3J80 L;  4A3M B;  3FP9 A;  4U67 3;  1SJH D;  4FF4 A;  2BA0 A;  4YWK A;  4H7B A;  2H5X A;  3S17 H;  4UP9 A;  3CHB D;  3TQY A;  1ZXT A;  4BBS H;  2F0S A;  3HOW H;  3NQT A;  3ICE A;  1Y14 B;  4DV3 L;  1HNZ Q;  2AQ2 B;  2K03 A;  2K5D A;  4K8J A;  2NVX B;  5E7N A;  1C0A A;  4EQO A;  1PDQ A;  3AB9 A;  5M5W B;  1EWI A;  3D4R A;  4DV5 L;  4R4O A;  4K14 A;  5ELB A;  2L0C A;  1K0S A;  2F0T A;  3S2D B;  2NYZ D;  2Z1C A;  1GUS A;  3MZ5 A;  4ID6 A;  3CCM A;  2NVT B;  1EY5 A;  2A69 C;  2EYO A;  2ZJQ A;  3CC2 A;  5I2Y A;  5HUR A;  1YHA A;  1A62 A;  4OWX B;  1VQ4 A;  1MD2 D;  3BDL A;  4NW2 A;  3GQB A;  3VR4 A;  2BE5 D;  1YNX A;  1SJE D;  2EVB A;  5IE8 A;  2JA6 B;  2WAQ B;  2UXC Q;  2AUK A;  4BWG B;  2JA8 G;  3S1N H;  1B70 B;  1JR0 D;  3HOZ B;  2LS0 1;  4YCU A;  2K7V A;  4J6H A;  3CAM A;  3H0G H;  3K6O A;  1JT8 A;  2IHF A;  1EQT A;  4KKT A;  1WD0 A;  1KQS A;  4HIO A;  3PO3 B;  2Z8L A;  1L2F A;  1SFO B;  1M8A A;  2FIN B;  2GN5 A;  1VMP A;  1JE5 A;  1JOQ A;  3I90 A;  4AIM A;  1WTQ A;  3D8G A;  1G6Z A;  4UP8 A;  4BY1 H;  5C44 G;  1IXR A;  4X65 Q;  3R3O A;  4DR5 Q;  3SK5 A;  3TME A;  4GKJ L;  3MXN A;  2RSN A;  3R93 A;  1ENF A;  3M4O H;  1F77 A;  1D1K A;  3VA5 A;  1VQD A;  2DY7 A;  5FJ8 G;  1S3O A;  1XNQ L;  2ZM6 L;  2R93 B;  1SYC A;  1HZA A;  1F2Z A;  1VQH A;  4KHP L;  4P72 A;  3I73 A;  2JXM B;  1KLG D;  2LXJ A;  1KD1 C;  1SYD A;  3PIO A;  1S5C D;  4LF6 L;  3I70 A;  3VYR A;  3IFD A;  1QE6 A;  4X3S A;  4POF A;  5ELE A;  3NWS A;  4WJW A;  2B2U A;  5LMU L;  1VQC A;  1SRO A;  2B2V A;  1ZYR C;  1R4Q B;  2MFI A;  3BDC A;  2B63 H;  1U5K A;  1Y1V H;  2SNM A;  2X6G A;  4XT1 B;  1DM0 B;  1SNP A;  2DNE A;  4OXP A;  3BVZ A;  1MIU A;  5EKI A;  2JA5 G;  4OX9 L;  4JI8 L;  5DNF A;  3FMC A;  1ENC A;  4A3E H;  1IBM L;  2K5W A;  4LUV A;  4C3H H;  1B7Y B;  4OO1 G;  1VDZ A;  1I5F A;  3PMF A;  3E5S A;  4RHS A;  1MBY A;  4IJL A;  1LTS D;  3NEN A;  5CV5 A;  4F87 A;  2CWA A;  4JK1 C;  1I6H H;  3EVQ A;  4R8N A;  4PG3 A;  3U4V A;  2N49 A;  1G8Z D;  1JB3 A;  4RCN A;  4ZQ3 A;  3GTL B;  2ICE C;  4DV6 Q;  1AE2 A;  1BCP F;  5JPM C;  4PZ8 A;  4B3R L;  3Q23 A;  5EPL A;  1CHQ D;  1ASY A;  1PTO F;  3VA7 A;  4IUP A;  4P71 A;  2K52 A;  3RZD B;  3TZD A;  3T56 B;  1MHW C;  3NTI A;  3PUW A;  4IOA A;  2A68 D;  1DCZ A;  3NPP A;  1JWS D;  2GVA A;  1NTG A;  2A19 A;  1EIY B;  1PRT F;  4OHJ A;  1PFM A;  3U4Z A;  1N34 L;  1PH3 A;  3J7A 5;  4YHH L;  1VQ6 A;  1Y1W B;  4NXM L;  1NNX A;  4C1N I;  4DK0 A;  4DUZ Q;  1BBX C;  1IBK Q;  3HKZ E;  1GUG A;  2HHH Q;  1DOL A;  1ET6 A;  1JC7 A;  1FJG Q;  1BO0 A;  2QGQ A;  4NDX A;  3S14 B;  2SNS A;  1CKN A;  3KLS X;  1B9M A;  5BN3 A;  2D62 A;  4C3J G;  2AKW B;  4OIJ A;  1PTO C;  1KDB A;  4GOP A;  2R92 H;  3HKZ G;  3H91 A;  3QJY A;  4N8F A;  4NB3 A;  3RMH A;  1CHP D;  1CM9 A;  2RHQ B;  4G57 A;  5A2Q L;  2JA7 B;  1L1O B;  2PCF B;  5IGC A;  3H09 A;  5IT9 c;  3GTJ H;  3KYH C;  2VUM B;  4JBM A;  3GTO B;  1FGB D;  4G7H C;  1VQ5 A;  3J80 i;  4CKE A;  1N8R C;  1JQY D;  1HFN A;  3J81 c;  3F2D A;  3HKS A;  4IOC A;  1QCB D;  4AYB B;  2DN8 A;  1PH7 A;  1SYF A;  2BCO A;  4DAY B;  2HIV A;  5DM7 3;  1N36 L;  4X64 L;  4A76 A;  1Y8N B;  4A3F G;  4OIK A;  4A3D H;  4IPC A;  1TVX A;  2XIW A;  4O1N A;  1B50 A;  5EPK A;  3UE1 A;  2K05 A;  4PV1 C;  4ZCK A;  3C1E A;  1SE2 A;  4JW0 A;  3J81 j;  4R4C A;  3FHW A;  5JEA G;  3ONA B;  2HCC A;  1CZG A;  2R7Z B;  4R4Q A;  3A0J A;  4IPG A;  1JJ2 A;  4GNX C;  3HS0 C;  1KNA A;  4ZYS A;  2JSO A;  2PZU A;  5DLQ E;  2OF1 A;  3DM3 A;  4ZLT F;  2RSO A;  2HIX A;  2IT1 A;  4OL7 A;  4JYA Q;  3FRP B;  1EZ6 A;  4K0K L;  4DV1 Q;  4RCO A;  1VQJ A;  1B3Q A;  4A3J H;  4BBR H;  1R9T B;  4OWT B;  4A3I B;  2PQE A;  5KEE A;  1BKB A;  3PUX A;  2OWO A;  1XMQ L;  4A3G H;  3AFP A;  1KXL A;  3HEJ A;  1HR0 L;  4LF4 L;  2DNC A;  4DNI A;  3DLL A;  4DV7 L;  3KF8 A;  3K0Y A;  2AMC B;  2F0P A;  2A8V A;  4OEL B;  2IY5 B;  3I91 A;  4B3S Q;  4A3B H;  4ZUJ A;  3S1M B;  1JIC A;  1P8L A;  5K36 G;  4OON A;  1WCM B;  2AUJ D;  2X69 A;  1SNO A;  1NAP A;  1PYB A;  5GAE C;  4JI0 L;  3TDQ A;  3TS2 A;  1K83 H;  3OMG A;  1Y8P B;  2NVY H;  4ZK9 B;  2YU9 B;  4JBJ A;  2EYP A;  3PO2 H;  1HTP A;  3E9I A;  4CJ2 C;  5FO8 B;  2B2Y A;  1Q3L A;  4DF7 A;  4DV0 Q;  2XRS D;  4JPB W;  3HOX H;  2E75 C;  4DUY L;  5JOB A;  2GVB A;  5IY0 A;  5K5P A;  2Q8I B;  1KNE A;  3GD7 A;  4Y7N H;  4JI1 Q;  1E2V A;  3T51 B;  3K58 A;  4BBS G;  3HOW G;  5IT9 E;  4UHV A;  5IOC A;  2IW3 A;  5AJ3 L;  1VQO A;  2B39 A;  1NR2 A;  2KCM A;  4DAM A;  2BE5 C;  3J81 E;  5KYI A;  3CCS A;  4DR6 L;  1A2U A;  2CHB D;  1ENA A;  4C3I B;  2PO4 A;  3LX0 A;  3BU2 A;  3QIA A;  4JC0 A;  1DON A;  5C4X B;  4EX5 A;  3HOV H;  3KJP A;  1MJE A;  2ICI A;  4JVZ A;  1ASZ A;  3GTK B;  4B3M Q;  1XPU A;  5EQ0 A;  3FKI H;  1Q81 C;  2N78 A;  5IIF A;  1ET9 A;  4MN3 A;  3PF4 A;  3DEO A;  3BYT B;  2NBF A;  3E6Z X;  4TQU S;  1EU3 A;  5C3E H;  2JK8 A;  4KD3 A;  1K8O A;  2O2L D;  2QEJ C;  3DHQ A;  3H0G G;  4G7Z C;  5C44 B;  4OO1 I;  1B9N A;  1SDF A;  1YEZ A;  3K80 C;  1ZYR D;  3MEH A;  1VQL A;  2K6A A;  4HJ7 A;  3MXU A;  3VYU A;  2WAC A;  2R61 A;  3RR5 A;  1FNV A;  1HNZ L;  4HMJ A;  4DK3 C;  1SN8 A;  1PTO H;  3A8I E;  2MP1 A;  4L8J A;  1EWC A;  4DR4 Q;  3MXP A;  4HJ8 A;  2J4X A;  2HQE A;  3S15 B;  2F0W A;  2Y0S E;  2F0D A;  2F52 A;  3TP5 A;  4X6A H;  2K5H A;  3CD6 A;  5IP7 H;  2WFW A;  5KIX A;  3D0F A;  1UEA B;  1G2T A;  2ASB A;  5M3F G;  2Y0S G;  2J7Z A;  3URY A;  1S5E D;  1GM5 A;  4DKA C;  3GDE A;  4XXE A;  4JI7 Q;  3W3A A;  1K8A C;  4JI2 Q;  4CGY B;  2UXC L;  1LAC A;  5IGG A;  4JV5 Q;  4KY5 A;  4WJ3 M;  5KNB A;  5FO7 B;  2BOS A;  5D3D A;  5FO9 B;  1TWG B;  2VQE L;  3LNN A;  5CV4 A;  2NN6 G;  1O7I A;  1IL8 A;  5CR3 A;  5CV9 A;  5C0X H;  2Z6B A;  3HOU H;  2XNA C;  4KD4 A;  2HUG A;  4CDE C;  1E0B A;  2PZW A;  3G4S A;  2YTY A;  2B63 G;  3J81 i;  3V05 A;  2VNU D;  1L0W A;  5BR8 Q;  1MSH A;  1TY2 A;  2OQ0 A;  3R2T A;  4RFB A;  2ZTC A;  2I5M X;  4X3U A;  4IFD H;  5J22 A;  4L5R C;  4KY6 A;  4KLK A;  4DR5 L;  4NXN Q;  3VR2 A;  2FMM A;  1QZG A;  1HPC A;  3S1Q H;  3A74 A;  2L12 A;  4U68 A;  4C3H G;  3OHX C;  1S72 A;  2BA1 A;  4QUF A;  3PIP A;  4RMF A;  1BCP D;  4FF2 A;  3HOY G;  1I6V C;  4LUZ A;  2A68 C;  2B3G A;  2Z6K A;  4A3L G;  2RA4 A;  1PTO D;  1GHK A;  5JVG 3;  3M85 A;  5M5X B;  1EQV A;  3JAM i;  2UUA Q;  1TS2 A;  1KC8 C;  1D5X C;  1NR4 A;  3IAY A;  4HED A;  5JAV A;  1H9S B;  2E76 C;  1JOO A;  1C8C A;  1PRT D;  2CCZ A;  3D6C A;  4B3T Q;  1D5M C;  3CW2 C;  1DZ1 A;  3A55 A;  1N32 Q;  3K5L A;  2Q8R E;  4MTN A;  4LAA A;  2G5D A;  4LF9 Q;  1QVG A;  1I4H A;  5I9O A;  1OXV A;  1TWC H;  5EJW A;  4B9W A;  5FOB B;  1JOK A;  1EIF A;  5JJI A;  4KI0 A;  2IPK D;  5FKA C;  4DK6 C;  4OWW B;  1FVI A;  2F3I A;  3HKZ B;  3TP8 A;  2L5T A;  2CFM A;  1UE5 A;  3VDY A;  4PMW A;  4DV2 Q;  2RKS A;  3NBH A;  2KEE A;  1NBW A;  1RL2 A;  2WIN B;  4A3M H;  5CBE E;  3L7Z C;  4HJ5 A;  2R7D A;  3WDN A;  2A5H A;  1OXU A;  3K57 A;  3M4Y A;  3DEP A;  4LNQ A;  4EQ5 A;  4FXG C;  1I4R A;  2Z9H A;  3MXG A;  2A74 C;  4HID A;  2RBM A;  2HDL A;  3K8A A;  1HA5 A;  3PUY A;  4C2M B;  5IYC H;  1QUQ A;  4LFA Q;  1QIL A;  3T4A C;  3PUV A;  4M1U B;  2NVX H;  2JP1 A;  4DR3 Q;  2ZXO A;  1KRT A;  2YTX A;  5M5W H;  3CME A;  5JEA J;  3MXN B;  2OTJ A;  3PCO B;  1G91 A;  3RUZ A;  2LFN A;  4F8M A;  5CC4 A;  3S2D H;  1RIP A;  4GKK L;  4RAU C;  1EIG A;  3M9B A;  4K2K A;  3D4D A;  3W2D A;  4RA8 A;  2KVM A;  2R3Z A;  4DFA A;  5ELD A;  1WTH A;  4DGZ A;  2UXB Q;  3VYT A;  1N9W A;  3D3R A;  5JPN C;  3CC7 A;  1EY4 A;  3B6Y A;  1L1O C;  1RD9 D;  2KA7 A;  3S1R B;  3A5Z B;  2JA6 H;  4RG1 A;  4FYD A;  4DUZ L;  5GRO A;  1IBK L;  4GN3 B;  4EGV A;  2HHH L;  2CVR A;  3J80 c;  1LT6 D;  1XTC D;  1FJG L;  2K5V A;  4EVO A;  3MEF A;  3GTG H;  4JI6 Q;  1HQR D;  2EDG A;  3NP8 A;  5FLX L;  1RF2 D;  2Z0S A;  1QNK A;  4BXX G;  4IUR A;  1KIX A;  1ILQ A;  3A7A B;  3PO3 H;  1XNR Q;  1SFO H;  4A93 G;  1JJG A;  4MTK A;  2D0P A;  1CUK A;  4XDX A;  3BYY B;  3Q22 A;  1O80 A;  1D8L A;  4PNY A;  5IYD H;  1F2M A;  4GNX A;  1N33 Q;  1TWA B;  3QB3 A;  5E4W C;  4A3K B;  1XMO Q;  2R6G A;  3EBE A;  4BBR G;  5CMD A;  2O4X A;  2JA9 A;  3MAQ A;  1IYJ B;  1E3P A;  4A3C G;  1FNU A;  3ZYY X;  2UUC Q;  4A3G G;  2QEX A;  3CCQ A;  2OTL A;  2EYH A;  5KNC A;  2E2I B;  2AHO B;  2IX3 A;  1HFG A;  1KDA A;  3C3L A;  2RQX A;  5C4Z A;  2VB3 X;  1H9R A;  3OWF A;  3OW7 A;  5GAD C;  3RNU A;  1CA5 A;  2R93 H;  3K59 A;  1XWE A;  2EJF C;  5ELF A;  3UE0 A;  1H9K A;  1V1P A;  5FLM H;  1PVO A;  3HOW B;  4QMG A;  1ILP A;  3D4W A;  3K5O A;  1WTW A;  4JI4 Q;  1B4O A;  3PO2 G;  2B2T C;  3P7J A;  5HGQ A;  4MNO A;  1Q82 C;  2RCN A;  1BQQ T;  4B08 A;  1VQ9 A;  1I94 L;  2WP8 J;  4FXK C;  3HOX G;  4DNR B;  2ZXR A;  4L5Q A;  4DR1 Q;  2KHS A;  1SE3 A;  4JYA L;  3J7A V;  1J9O A;  1BXT A;  3G7L A;  3F2C A;  4FO2 A;  5I6Y A;  3K7A B;  5C5M A;  4QQB X;  1SNC A;  3M7G A;  1TY0 A;  1FR3 A;  3K5M A;  3KF6 B;  5TSS A;  3EQL C;  2ALY B;  4JCV E;  4XQQ A;  2NN6 I;  3S1N B;  4CKB A;  1AW7 A;  3TN2 A;  1HZB A;  1HCZ A;  3MHB A;  3IL8 A;  3RLF A;  3AU7 A;  3GTP B;  2KHI A;  3H0G B;  1W2B A;  1G29 1;  4KJN A;  1V43 A;  4GOP B;  3MVV A;  4B3S L;  2Q2H A;  3SK4 A;  2V4D A;  1XJV A;  3SK6 A;  2AQ3 B;  1YJN A;  3J80 E;  4P73 A;  2K01 A;  3U58 A;  5LMN Q;  2D0O A;  1S4Z A;  3T1Y L;  5M3M H;  3PV0 A;  3MWY W;  3L0O A;  5J3B A;  3RD4 A;  2Q2U A;  2EJG C;  1J6Q A;  3RZD H;  4DV0 L;  2AQ1 B;  3C46 A;  4JI1 L;  3CCU A;  4X66 Q;  4J8Q A;  1MJC A;  1ICF B;  1Y8O B;  2UUB L;  1FD7 D;  5IWA Q;  3TP7 A;  2Y0S B;  5M3F B;  2LKV A;  2Q2T A;  1HTL D;  1Y1W H;  2OXP A;  2KHJ A;  1HNW L;  3NK9 A;  3X3N A;  3SDZ A;  2LSS A;  5IP7 G;  2N55 A;  2CWP A;  3NWT A;  1SYG A;  2K14 A;  3P75 A;  3S14 H;  4MIU A;  1U4R A;  4K2L A;  1TR5 A;  1B1Z A;  1VQ7 A;  2X6L A;  3X3M A;  4GN5 A;  1HHV A;  2B63 B;  1X3P A;  1JOR A;  3NSW A;  3RN5 A;  1FGU A;  3SXH A;  1STH A;  4O42 A;  4CDD C;  4LF5 Q;  5C5L A;  2JA7 H;  3QOJ A;  1K73 C;  4JOI A;  5ELO A;  1Q1E A;  1HR0 W;  2VUM H;  5C6A A;  3GTO H;  4BA1 I;  3KF8 B;  2BH8 A;  1GUN A;  2K32 A;  5JJZ A;  2PNH A;  4KN7 C;  4RKB A;  3R2I A;  2KCC A;  3IRB A;  2XGT A;  4ZUI A;  2F0G A;  3BZC A;  1BCP C;  4GS3 A;  1DOK A;  1VQE A;  3HOY B;  1F2Y A;  4DR4 L;  4G7O C;  1HUN A;  5IP9 H;  1NE3 A;  4ABN A;  4IFD G;  2Q2I A;  1X6O A;  3OTO Q;  2NVQ H;  2ZT9 C;  4PMB A;  2R7Z H;  1X54 A;  3I4M B;  3LWU A;  3KLR A;  3L3O C;  5BN5 A;  2N8N A;  4JI5 Q;  4QGU A;  2XWB B;  1SLJ A;  3WOE A;  4RHR A;  1PRT C;  3NE5 B;  5IT9 L;  3CQZ B;  3RZO B;  4HCS A;  5CYU A;  5DAU A;  3P1H A;  2CH4 A;  4JI2 L;  4IZ8 A;  5I6W A;  3RN2 A;  3GV3 A;  2EIF A;  3V2T A;  2K1B A;  3ERS X;  4CHT B;  5A35 A;  1PA6 A;  2E5L L;  4RH6 A;  1WFQ A;  3T1H L;  4BY7 G;  5HY6 A;  1TS5 A;  2XN9 C;  3W1B A;  4ZKB B;  3N52 A;  4O2D A;  3I55 A;  1OXX K;  3W1G A;  3A5U A;  1H95 A;  1L0Y B;  2PQA B;  3G6E A;  5DM6 3;  1Q12 A;  1LUZ A;  1PFS A;  3OWE B;  5BR8 L;  1JE4 A;  2VB2 X;  1YBY A;  1PMR A;  3Q8D A;  2E2J B;  1WYD A;  3GTQ B;  4YWL A;  3C2P A;  3JAM c;  1P16 A;  1K3B C;  4XTC S;  2PMZ E;  4G4K A;  1WCM H;  3CC4 A;  2WB1 G;  3GO5 A;  4DAV A;  2C9O A;  4L5S A;  4Z9C B;  2YU9 H;  2I0Q A;  2R7F A;  1YI2 A;  1YHB A;  1I3Q B;  1NMG A;  3TRZ A;  5LHY 1;  3NHH A;  2JJQ A;  2F4V Q;  2I07 B;  1XYI A;  4CBV A;  2K5Q A;  1G51 A;  1U4M A;  3I4N G;  1KTK A;  4GKJ Q;  1JMC A;  4JG2 A;  1VMC A;  4DU9 A;  1JCK B;  2UUA L;  3IFT A;  1T5X D;  2PPB C;  4P75 A;  3CU7 A;  4QL5 A;  4ULL A;  2QDB A;  4IJH A;  1XNQ Q;  1E7Z A;  1SNQ A;  1JJC B;  1Q86 C;  1ZKO A;  4B3T L;  4MHE A;  1TWH B;  4C3I H;  1N32 L;  2VQF Q;  2ATW A;  3DMU A;  5C4X H;  2JQO A;  1XPR A;  5IYB G;  4IPD A;  4LF9 L;  5LMU Q;  2JEB I;  3GTK H;  2I5L X;  4WRD A;  4LF8 L;  5EBD A;  1U0L A;  2DUD A;  4A93 B;  1GUO A;  1KDC A;  4KY7 A;  1STE A;  1X3E A;  5EGT A;  3DM1 A;  3EIV A;  4ZRZ A;  1VQ8 A;  2WAQ G;  1AE3 A;  3QG1 A;  1PH8 A;  4BBR B;  1UNS A;  2EY6 A;  5T1I A;  1E1O A;  2EXZ A;  4XQJ A;  3I7F A;  5C44 H;  2CKZ B;  2PI2 A;  2J0T D;  3C1F A;  1F9S A;  4KKU A;  1QWY A;  1LTG D;  2JA8 B;  2B8F A;  4JI8 Q;  5A2Q E;  4IAL A;  3KFU A;  3PO3 G;  1IBM Q;  4LFB L;  2OQK A;  1RTO A;  4R9W A;  1LAB A;  4LFA L;  3KLS A;  1J8I A;  5IYD G;  5C4J B;  4DR3 L;  1QG7 A;  4YY3 Q;  4XIG S;  4GN4 B;  1IZ6 A;  1EYD A;  2B2V C;  3S15 H;  2MQH A;  2Z4H A;  1YJW A;  4IO9 A;  3D6W A;  1DYQ A;  2PZT A;  4WOR A;  3SHL A;  2UU9 Q;  4R8I A;  4NMZ A;  1I50 B;  3JAM E;  2UXB L;  5C3X A;  1D5Z C;  3NXW A;  3MFG A;  2JEA I;  2ENB A;  1BNZ A;  3UDI A;  4BA2 I;  3MTS A;  2R93 G;  3HG9 A;  4Q0F A;  4UPA A;  1VQM A;  3KUP A;  1W3S A;  3FVQ A;  1VQF A;  4Y7N B;  5FLM G;  4H44 C;  2ID0 A;  1TWF B;  3SEB A;  5CBA E;  1T9H A;  1TWG H;  3A56 A;  3GTM H;  1YJ9 A;  2HT1 A;  3ER0 A;  1SSO A;  2Q8T A;  1A3T A;  1PZJ D;  4YHH Q;  4JI6 L;  3I72 A;  4NXM Q;  4BY1 G;  5ELN A;  4R1J A;  3NTK A;  2EPB A;  1CZW A;  3DWA A;  3H3V I;  4OO1 H;  4H0L C;  1QVF A;  1VS0 A;  3S9W A;  4H02 A;  3CCE A;  1GXD C;  2NB0 A;  1D6E C;  1N33 L;  1RCV D;  5DEH A;  4DA2 A;  1XMO L;  3S2H B;  1TQO A;  1SBB B;  2UUC L;  1J5E Q;  1B2T A;  1YNJ C;  1V9P A;  2B29 A;  1EU4 A;  1QJO A;  1JWU D;  3KK7 A;  4UP7 A;  2JA5 B;  4F88 A;  4R4T A;  2UXD Q;  1BUV T;  1Q1B A;  1B8A A;  3ITP A;  5CV6 A;  5I9P A;  1A2T A;  2KCN A;  4FVM A;  3RLO A;  1QUQ B;  1STG A;  3UI2 A;  5M5X H;  1Y1V G;  1N36 Q;  4X64 Q;  5LL6 X;  4JI4 L;  2IX0 A;  5M3M G;  1NY4 A;  1A15 A;  1D1I A;  1PLF A;  2EOT A;  1SMX A;  4X65 L;  3MA2 B;  4K6L A;  5LL6 S;  1LO5 D;  3K7U C;  4DR1 L;  4POG A;  5KGU A;  4E6I A;  2A6H D;  4KJO A;  4A3E G;  4DXF A;  3K0X A;  1RTN A;  5J39 A;  4J15 A;  1PH1 A;  2MJ8 A;  1LV9 A;  3CMA A;  1CQV A;  4PQX A;  1XTD A;  3EJI A;  3OPO A;  2KOL A;  1HNX Q; 
#chains in the Genus database with same CATH homology
 3KBX A;  2WII B;  1EZ8 A;  3PUZ A;  4HMI A;  5KND A;  3MFY A;  3Q6S A;  3J7Y W;  2H1E A;  1A6X A;  2OEO A;  4I7Z C;  2A6E D;  1DJR D;  2K28 A;  1ESR A;  5IGE A;  1EYA A;  3BG3 A;  1B53 A;  3M3Y B;  1XXG A;  2KUM A;  2MUY A;  3I8Z A;  1E2Z A;  4C3J B;  2KQ3 A;  2I46 A;  4S3S A;  5E4X A;  1PFB A;  5JEA H;  2DY8 A;  2NTT A;  3T53 B;  1PYW D;  4UDU C;  1UAP A;  1GHJ A;  1CQF A;  1Y69 U;  1AFP A;  3S1Q B;  4XT3 B;  3HP3 A;  1U9R A;  1YNN C;  1IW7 D;  4K5W A;  1V1P B;  3VR3 A;  3QWN A;  1VF7 A;  2NWG A;  3GV6 A;  4A3F B;  2E2H B;  2A73 B;  1CT1 D;  4BS9 A;  3TZU A;  4BY7 B;  4I65 A;  4F7X A;  5M5Y B;  2D5D A;  3TSS A;  2L1B A;  1TS4 A;  1HRJ A;  3EFX D;  3PIO 3;  2B2W C;  1GUW A;  2F0Q A;  4QUC A;  3O13 A;  1B44 D;  3S16 B;  2B2Y C;  2JE6 I;  4KV6 A;  5M9O A;  2G9H D;  1WTX A;  2L9H A;  2WB1 B;  3U9O A;  2VXW A;  4DAP A;  2K33 A;  3H94 A;  1ROD A;  1L0X B;  3MC0 B;  1SXT A;  4KTA A;  2SOB A;  2F0V A;  2MPM A;  2PMZ B;  2QKI C;  3EA6 A;  1Q90 A;  2EY2 A;  1QOH A;  3I4N B;  1WD1 A;  1TKW B;  1PXU A;  3VR6 A;  1X3Q A;  2Z4I A;  4P2C B;  1ICW A;  2F03 A;  1QB5 D;  4TSS A;  4HSV A;  2F4I A;  1CFM A;  1SE4 A;  1H9S A;  1I4X A;  4QB4 A;  4CKC A;  2RDH A;  1LLR D;  5F2D A;  2JYO A;  2SEB D;  3S17 B;  5J1Z A;  1NCV A;  1BR9 A;  4BBS B;  4IUN A;  1AZQ A;  1TT2 A;  3QO2 A;  2WV6 D;  1JWM D;  4C3I G;  1F9P A;  1WTP A;  5D3I B;  4ILW A;  3BDO A;  3GTG B;  1GJX A;  1O7Z A;  3U9S A;  3AMU A;  4HN7 A;  2XSC A;  2K04 A;  3A54 A;  1O7Y A;  5D14 A;  1LT3 D;  4DN4 M;  4NP5 A;  1KLU D;  4EQN A;  3SR1 A;  1Z7T A;  1EFI D;  5I4D A;  2IJ0 A;  2TMP A;  2KED A;  1CI3 M;  2FJ2 A;  5AFW A;  2WKC A;  1BOS A;  1LTR D;  4XYQ A;  3OOC A;  2F3W A;  5KYL A;  2EY1 A;  5E3F A;  1R4P B;  2CW0 D;  1SYB A;  1MI2 A;  5NUC A;  3R8B A;  2AWN A;  4DK1 A;  3K5N A;  4RWS C;  1S5D D;  4V0B A;  2PW7 A;  3SK8 A;  2TSS A;  4Q5V A;  5CV7 A;  1HXY D;  5IOD A;  5T1G A;  2F0O A;  1IYV A;  1YNJ D;  2EYL A;  4KN4 C;  3GP7 A;  2F0U A;  2RDG A;  2D9U A;  2NN6 H;  4BY1 B;  4FNF A;  2HDM A;  4DXG A;  3NTH A;  1WTV A;  4FXD A;  4XYO A;  3M4O B;  3WOF A;  1VF5 C;  5FLX E;  1ESF A;  1PZK D;  4V19 0;  2O5I C;  1LT4 D;  4IQZ A;  2FMC A;  3E0J A;  1NSN S;  1SNM A;  1RJT A;  1SMY D;  1II3 A;  2EYM A;  4EQP A;  1D2B A;  3FPP A;  5G3L F;  2B8G A;  5ELC A;  4ODG A;  3A8K E;  4GZY C;  1IYU A;  4N9P A;  4JBW A;  1Y1V B;  5CGK A;  1AEX A;  1BF4 A;  5M3M B;  2PNR C;  5HGT A;  4HAE A;  1V8Q A;  3G6J B;  2IWH A;  4HR7 B;  1TII D;  4B9X A;  4K5V A;  1EY9 A;  1W6J A;  5C0X G;  4A3E B;  2A6H C;  4KMU C;  4C3H B;  1EL0 A;  2NTS A;  1I6H B;  3H6M A;  1Z47 A;  2F0L A;  3NQI A;  1IKM A;  1I4Q A;  1RHP A;  1E2W A;  2E74 C;  2D2C C;  4DNT B;  5IGF A;  2F0J A;  3CKI B;  1YNN D;  3A7L A;  1EY7 A;  3BVM A;  1EIH A;  1XX8 A;  4HSP A;  2A6E C;  2F3V A;  5I2X A;  1GUT A;  1AZP A;  3SVM A;  4ME5 A;  3J81 L;  1WTR A;  2AWO A;  5D65 A;  1I4G A;  1LTT D;  1GOZ A;  1IKL A;  1X32 A;  5ISR A;  2PYK A;  4QIW B;  4ZKC B;  2YYZ A;  1C48 A;  1STB A;  4CJ0 B;  2EYF A;  3H3V C;  5COY A;  5JVH 3;  1IW7 C;  1PZI D;  2XRQ D;  4QCL A;  1LTB D;  4FP5 D;  5C4H A;  1STN A;  1F9Q A;  4HTH A;  4K5X A;  1V1O A;  1CK1 A;  1CA6 A;  3T13 A;  3JAM L;  2R92 B;  1C4Q A;  3HGB A;  4L6T B;  2NVQ B;  4J1M A;  3GTJ B;  2H4O A;  1ONL A;  1AN8 A;  3J7A F;  1DXM A;  2M9V A;  3FPU B;  1TS3 A;  1H9M A;  4TKO B;  2EYJ A;  1EY8 A;  4A3D B;  4OGQ C;  5E1F A;  1HQM C;  3FDT A;  1SND A;  1UUP A;  2EJM A;  4H13 C;  5BN4 A;  2LY7 A;  3V96 A;  2WKD A;  1Q8I A;  1Z6H A;  2F0M A;  2A69 D;  1OXS C;  1CTM A;  4UAI A;  1LTA D;  1T5E A;  5EKL A;  1HA6 A;  5FK9 C;  2IX1 A;  4KHZ A;  2CQA A;  2F1M A;  5CV8 A;  4FF3 A;  2B2W A;  2F0H A;  4A3J B;  3Q24 A;  1MGS A;  2NZ1 D;  4M8A A;  1OXT A;  4PMC A;  4A3G B;  1F2L A;  3L9A X;  2KJX A;  3ND8 A;  1SAP A;  1EY6 A;  2LMC B;  4K6D A;  2EY5 A;  1EEF D;  2F0I A;  1B3A A;  3NBI A;  3PIP 3;  3DWQ A;  4DAY A;  2B2U C;  1MSG A;  2EE1 A;  4A3B B;  3BS1 A;  1EYC A;  1STY A;  1K83 B;  4LJZ C;  3HZX A;  4X3K A;  2NVY B;  1KAB A;  2HCI A;  2O5J C;  1OO9 B;  3PO2 B;  4WFN 3;  4C1N K;  3SE0 A;  2F0E A;  3D31 A;  4HCE A;  1BDO A;  2PW5 A;  4LK1 C;  3HOX B;  2L4N A;  2GA4 B;  4IN3 A;  1STA A;  1S5B D;  1U4L A;  1QNU A;  2M00 A;  2XWJ B;  3F2U A;  3I4L A;  1I4P A;  4ZAI A;  4XQN A;  1FNW A;  1FYC A;  3CRK C;  5C3W A;  4IUU A;  3HOV B;  2CW0 C;  1A3U A;  1S5F D;  4KK7 A;  2B2T A;  1TU2 B;  2BDN A;  4FF1 A;  1EEI D;  3FKI B;  3OIP A;  2EZV A;  1HUM A;  4IUV A;  1A3V A;  5KRU A;  1RDP D;  3LWE A;  1W6K A;  5COR A;  5C3E B;  5EPJ A;  3CRL C;  5C0X I;  1SYE A;  5EKK A;  3P20 A;  2G9D A;  2NUC A;  3ERQ A;  2QIL A;  1K8M A;  2C5C A;  1AP0 A;  2F0K A;  1DOM A;  1O7L A;  4N9T A;  4RGM A;  1BCP B;  1RKN A;  4YIJ A;  4IFD I;  3DUZ A;  1PTO B;  5IGD A;  2OT2 A;  3GTM B;  1IHZ A;  4K8I A;  3VYS A;  1DD2 A;  2L55 A;  1SMY C;  4RGT A;  3VR5 A;  4QF4 A;  2QF7 A;  2FHT A;  2IL8 A;  1PRT B;  4KKS A;  3BZD B;  2E2D C;  1ZEQ X;  1H9J A;  1NUC A;  2XVS A;  4X3T A;  1KAA A;  5G3L D;  3N6R A;  2KEC A;  3ERO A;  2F0F A;  2RDF A;  3ND9 A;  5C0X J;  3I3C A;  3IKJ A;  4IUT A;  4LMQ D;  3HOU B;  1M4V A;  1ML0 D;  4IUQ A;  1PFN A;  1U4P A;  2ZXP A;  3DXJ C;  3BVG A;  4NKL A;  1EOT A;  3DWP A;  1O78 A;  2M2L A;  4IFD J;  1LT5 D;  4TRD A;  3QOL A;  3TBI B;  2N88 A;  3OIQ A;  2MHV A;  3A8J E;  3KBG A;  1WTO A;  4L63 B;  1LTI D;  3OSO A;  3TP6 A;  3M7N A;  4RGN A;  1WVL A;  2F0N A;  2QCP X;  1SEB D;  3OMC A;  2RVL A;  4C56 C;  1EY0 A;  3Q0A A;  2FFK B;  3HRZ C;  4RGO S;  3FEW X;  4KHV A;  5K36 H;  1TWC B;  4RKL A;  1EWH A;  2L11 A;  2BDO A;  3T16 A;  3NUC A;  2MGS A;  5IGB A;  5EBC A;  4CJ1 B;  1G2S A;  2SDF A;  1VCI A;  1F9R A;  3J80 L;  4A3M B;  4U67 3;  1SJH D;  4FF4 A;  2BA0 A;  4H7B A;  3CHB D;  1ZXT A;  2F0S A;  3NQT A;  2AQ2 B;  2K03 A;  2K5D A;  4K8J A;  2NVX B;  4EQO A;  1PDQ A;  3AB9 A;  5M5W B;  3D4R A;  4K14 A;  5ELB A;  2L0C A;  2F0T A;  3S2D B;  2NYZ D;  2Z1C A;  1GUS A;  3MZ5 A;  4ID6 A;  2NVT B;  1EY5 A;  2A69 C;  2EYO A;  5I2Y A;  5HUR A;  1MD2 D;  3BDL A;  4NW2 A;  3GQB A;  3VR4 A;  2BE5 D;  1SJE D;  2EVB A;  2JA6 B;  2WAQ B;  2AUK A;  4BWG B;  1JR0 D;  3HOZ B;  2LS0 1;  2K7V A;  4J6H A;  3K6O A;  1EQT A;  4KKT A;  1WD0 A;  3PO3 B;  2Z8L A;  1SFO B;  1M8A A;  2FIN B;  1VMP A;  1JOQ A;  3I90 A;  1WTQ A;  3D8G A;  1G6Z A;  3R3O A;  3SK5 A;  3TME A;  3MXN A;  2RSN A;  3R93 A;  1ENF A;  1F77 A;  1D1K A;  3VA5 A;  2DY7 A;  2R93 B;  1SYC A;  1F2Z A;  3I73 A;  2JXM B;  1KLG D;  1SYD A;  1S5C D;  3I70 A;  3VYR A;  3IFD A;  1QE6 A;  4X3S A;  5ELE A;  3NWS A;  4WJW A;  2B2U A;  2B2V A;  1ZYR C;  1R4Q B;  3BDC A;  2SNM A;  2X6G A;  4XT1 B;  1DM0 B;  1SNP A;  2DNE A;  3BVZ A;  5EKI A;  5DNF A;  3FMC A;  1ENC A;  2K5W A;  4OO1 G;  1VDZ A;  3PMF A;  3E5S A;  4RHS A;  1MBY A;  1LTS D;  5CV5 A;  4F87 A;  4JK1 C;  3EVQ A;  4R8N A;  1G8Z D;  1JB3 A;  4RCN A;  4ZQ3 A;  3GTL B;  2ICE C;  1BCP F;  5JPM C;  3Q23 A;  5EPL A;  1CHQ D;  1PTO F;  3VA7 A;  4IUP A;  3RZD B;  3TZD A;  3T56 B;  3NTI A;  3PUW A;  2A68 D;  1DCZ A;  3NPP A;  1JWS D;  1PRT F;  4OHJ A;  1PFM A;  1Y1W B;  4C1N I;  4DK0 A;  1BBX C;  1GUG A;  1DOL A;  1ET6 A;  1JC7 A;  1BO0 A;  4NDX A;  3S14 B;  2SNS A;  3KLS X;  1B9M A;  5BN3 A;  2D62 A;  4C3J G;  4OIJ A;  1PTO C;  1KDB A;  3H91 A;  3QJY A;  3RMH A;  1CHP D;  1CM9 A;  4G57 A;  5A2Q L;  2JA7 B;  2PCF B;  5IGC A;  3H09 A;  2VUM B;  3GTO B;  1FGB D;  4G7H C;  4CKE A;  1JQY D;  1HFN A;  1QCB D;  4AYB B;  2DN8 A;  1SYF A;  2BCO A;  5DM7 3;  1Y8N B;  4OIK A;  1TVX A;  2XIW A;  4O1N A;  1B50 A;  5EPK A;  2K05 A;  4PV1 C;  3C1E A;  1SE2 A;  5JEA G;  3ONA B;  2HCC A;  1CZG A;  2R7Z B;  3HS0 C;  1KNA A;  4ZYS A;  2JSO A;  2PZU A;  2OF1 A;  4ZLT F;  2RSO A;  2IT1 A;  4OL7 A;  3FRP B;  1EZ6 A;  4RCO A;  1R9T B;  4A3I B;  2PQE A;  5KEE A;  3PUX A;  3HEJ A;  2DNC A;  3KF8 A;  3K0Y A;  2F0P A;  3I91 A;  4ZUJ A;  3S1M B;  1JIC A;  5K36 G;  1WCM B;  2AUJ D;  2X69 A;  1SNO A;  1NAP A;  3TDQ A;  3OMG A;  1Y8P B;  4ZK9 B;  2YU9 B;  2EYP A;  1HTP A;  4CJ2 C;  5FO8 B;  2B2Y A;  1Q3L A;  4DF7 A;  2XRS D;  2E75 C;  5JOB A;  5K5P A;  2Q8I B;  1KNE A;  3GD7 A;  1E2V A;  3T51 B;  3K58 A;  5IT9 E;  5IOC A;  2IW3 A;  2B39 A;  1NR2 A;  3J81 E;  2BE5 C;  5KYI A;  1A2U A;  2CHB D;  1ENA A;  4C3I B;  2PO4 A;  3LX0 A;  3QIA A;  1DON A;  5C4X B;  2ICI A;  3GTK B;  5EQ0 A;  5IIF A;  1ET9 A;  4MN3 A;  3DEO A;  3BYT B;  2NBF A;  3E6Z X;  4TQU S;  1EU3 A;  4KD3 A;  1K8O A;  2O2L D;  2QEJ C;  3DHQ A;  4G7Z C;  5C44 B;  4OO1 I;  1B9N A;  1SDF A;  1ZYR D;  3MEH A;  2K6A A;  3MXU A;  3VYU A;  2WAC A;  2R61 A;  1FNV A;  4HMJ A;  1PTO H;  3A8I E;  2MP1 A;  4L8J A;  1EWC A;  3MXP A;  2J4X A;  2HQE A;  3S15 B;  2F0W A;  2F0D A;  3TP5 A;  5KIX A;  1UEA B;  1G2T A;  2J7Z A;  3URY A;  1S5E D;  4XXE A;  3W3A A;  4CGY B;  1LAC A;  5IGG A;  4KY5 A;  5KNB A;  5FO7 B;  5FO9 B;  2BOS A;  5D3D A;  1TWG B;  3LNN A;  5CV4 A;  2NN6 G;  1IL8 A;  5CR3 A;  5CV9 A;  5C0X H;  2XNA C;  4KD4 A;  2HUG A;  1E0B A;  2PZW A;  3V05 A;  2VNU D;  1MSH A;  1TY2 A;  3R2T A;  4RFB A;  4X3U A;  4IFD H;  5J22 A;  4KY6 A;  3VR2 A;  2FMM A;  1HPC A;  2L12 A;  4U68 A;  4C3H G;  3OHX C;  2BA1 A;  4QUF A;  1BCP D;  4FF2 A;  1I6V C;  2A68 C;  2RA4 A;  1PTO D;  1GHK A;  5JVG 3;  3M85 A;  5M5X B;  1EQV A;  1TS2 A;  1D5X C;  1NR4 A;  3IAY A;  4HED A;  5JAV A;  1H9S B;  2E76 C;  1JOO A;  1C8C A;  1PRT D;  3D6C A;  1D5M C;  1DZ1 A;  3A55 A;  3K5L A;  2Q8R E;  4LAA A;  1I4H A;  5I9O A;  1OXV A;  5EJW A;  4B9W A;  5FOB B;  1JOK A;  4KI0 A;  2IPK D;  5FKA C;  3HKZ B;  3TP8 A;  2L5T A;  4PMW A;  2RKS A;  3NBH A;  2KEE A;  2WIN B;  5CBE E;  3L7Z C;  3WDN A;  2A5H A;  1OXU A;  3K57 A;  3DEP A;  3M4Y A;  1I4R A;  4FXG C;  3MXG A;  2A74 C;  2RBM A;  2HDL A;  1HA5 A;  3PUY A;  4C2M B;  1QIL A;  3T4A C;  3PUV A;  4M1U B;  2JP1 A;  2ZXO A;  5JEA J;  1G91 A;  3RUZ A;  2LFN A;  4F8M A;  5CC4 A;  4RAU C;  1EIG A;  4K2K A;  3D4D A;  3W2D A;  4RA8 A;  2KVM A;  2R3Z A;  4DFA A;  5ELD A;  4DGZ A;  3VYT A;  3D3R A;  5JPN C;  1EY4 A;  1RD9 D;  3S1R B;  2KA7 A;  4FYD A;  4EGV A;  2CVR A;  1LT6 D;  1XTC D;  4EVO A;  1HQR D;  2EDG A;  3NP8 A;  5FLX L;  1RF2 D;  1QNK A;  4IUR A;  1ILQ A;  3A7A B;  4XDX A;  3BYY B;  3Q22 A;  1O80 A;  4PNY A;  1F2M A;  1TWA B;  3QB3 A;  5E4W C;  4A3K B;  2R6G A;  5CMD A;  2O4X A;  3MAQ A;  1FNU A;  3ZYY X;  2EYH A;  5KNC A;  2E2I B;  2IX3 A;  1HFG A;  1KDA A;  3C3L A;  2RQX A;  5C4Z A;  2VB3 X;  1H9R A;  3OWF A;  3OW7 A;  1CA5 A;  3K59 A;  1XWE A;  2EJF C;  5ELF A;  1H9K A;  1V1P A;  3HOW B;  4QMG A;  1ILP A;  3D4W A;  3K5O A;  1WTW A;  1B4O A;  2B2T C;  3P7J A;  1BQQ T;  4B08 A;  2WP8 J;  4FXK C;  4DNR B;  2ZXR A;  2KHS A;  1SE3 A;  3J7A V;  1J9O A;  1BXT A;  3G7L A;  4FO2 A;  5I6Y A;  3K7A B;  5C5M A;  1SNC A;  3M7G A;  1TY0 A;  1FR3 A;  3K5M A;  5TSS A;  3EQL C;  4XQQ A;  2NN6 I;  3S1N B;  4CKB A;  1AW7 A;  3TN2 A;  1HCZ A;  3MHB A;  3IL8 A;  3RLF A;  3AU7 A;  3GTP B;  3H0G B;  1G29 1;  4KJN A;  1V43 A;  3MVV A;  3SK4 A;  2V4D A;  3SK6 A;  2AQ3 B;  3J80 E;  2K01 A;  1S4Z A;  3PV0 A;  3MWY W;  3RD4 A;  2EJG C;  2AQ1 B;  3C46 A;  4J8Q A;  1Y8O B;  1FD7 D;  3TP7 A;  2Y0S B;  5M3F B;  2LKV A;  1HTL D;  2OXP A;  3NK9 A;  3X3N A;  3SDZ A;  2N55 A;  3NWT A;  1SYG A;  3P75 A;  4MIU A;  1U4R A;  4K2L A;  1TR5 A;  1B1Z A;  2X6L A;  3X3M A;  1HHV A;  2B63 B;  1X3P A;  1JOR A;  3NSW A;  3SXH A;  1STH A;  4O42 A;  5C5L A;  3QOJ A;  1Q1E A;  5C6A A;  4BA1 I;  1GUN A;  2K32 A;  5JJZ A;  4KN7 C;  4RKB A;  3R2I A;  2KCC A;  4ZUI A;  2F0G A;  1BCP C;  3HOY B;  1DOK A;  1F2Y A;  4G7O C;  1HUN A;  4ABN A;  4IFD G;  2ZT9 C;  4PMB A;  3I4M B;  3LWU A;  3KLR A;  3L3O C;  5BN5 A;  2XWB B;  3WOE A;  4RHR A;  1PRT C;  3NE5 B;  5IT9 L;  3CQZ B;  3RZO B;  4HCS A;  5CYU A;  5DAU A;  3P1H A;  4IZ8 A;  5I6W A;  3GV3 A;  3V2T A;  2K1B A;  4CHT B;  5A35 A;  4RH6 A;  1TS5 A;  2XN9 C;  4ZKB B;  3N52 A;  1OXX K;  1L0Y B;  5DM6 3;  1Q12 A;  3OWE B;  1JE4 A;  2VB2 X;  1PMR A;  2E2J B;  3GTQ B;  3C2P A;  4XTC S;  4G4K A;  3GO5 A;  4DAV A;  2C9O A;  4Z9C B;  1I3Q B;  5LHY 1;  3NHH A;  2I07 B;  1XYI A;  4CBV A;  2K5Q A;  1U4M A;  1KTK A;  1VMC A;  4DU9 A;  1JCK B;  3IFT A;  1T5X D;  2PPB C;  3CU7 A;  4ULL A;  2QDB A;  1SNQ A;  1ZKO A;  4MHE A;  1TWH B;  3DMU A;  2JEB I;  4WRD A;  5EBD A;  4A93 B;  1GUO A;  1KDC A;  4KY7 A;  1STE A;  5EGT A;  3DM1 A;  4ZRZ A;  3QG1 A;  4BBR B;  1UNS A;  2EY6 A;  5T1I A;  2EXZ A;  4XQJ A;  2J0T D;  3C1F A;  1F9S A;  4KKU A;  1QWY A;  1LTG D;  2JA8 B;  2B8F A;  5A2Q E;  4IAL A;  1RTO A;  4R9W A;  1LAB A;  3KLS A;  1J8I A;  5C4J B;  1QG7 A;  4XIG S;  1EYD A;  2B2V C;  2Z4H A;  3D6W A;  1DYQ A;  2PZT A;  4WOR A;  3SHL A;  4R8I A;  4NMZ A;  1I50 B;  3JAM E;  5C3X A;  1D5Z C;  3NXW A;  3MFG A;  2JEA I;  2ENB A;  1BNZ A;  4BA2 I;  3MTS A;  3HG9 A;  4Q0F A;  3KUP A;  3FVQ A;  4Y7N B;  4H44 C;  2ID0 A;  1TWF B;  5CBA E;  3SEB A;  3A56 A;  1SSO A;  2Q8T A;  1A3T A;  1PZJ D;  3I72 A;  3NTK A;  2EPB A;  1CZW A;  3DWA A;  4OO1 H;  4H0L C;  3S9W A;  1GXD C;  2NB0 A;  1D6E C;  1RCV D;  5DEH A;  4DA2 A;  3S2H B;  1TQO A;  1SBB B;  1B2T A;  1YNJ C;  1EU4 A;  1QJO A;  1JWU D;  3KK7 A;  2JA5 B;  4F88 A;  1BUV T;  1Q1B A;  3ITP A;  5CV6 A;  5I9P A;  1A2T A;  2KCN A;  4FVM A;  1STG A;  3UI2 A;  5LL6 X;  2IX0 A;  1A15 A;  1D1I A;  1PLF A;  2EOT A;  3MA2 B;  4K6L A;  5LL6 S;  1LO5 D;  5KGU A;  4E6I A;  2A6H D;  4KJO A;  4DXF A;  1RTN A;  5J39 A;  2MJ8 A;  1LV9 A;  1CQV A;  4PQX A;  3EJI A;  3OPO A;  2KOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...