4IQZA

The crystal structure of a large insert in rna polymerase (rpoc) subunit from e. coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
183
structure length
178
Chain Sequence
AAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords DNA-directed RNA polymerase subunit beta'
publication title The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
rcsb
source organism Escherichia coli
total genus 37
structure length 178
sequence length 183
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA02
1Q90A 3EQLC 3PUVA 2IT1A 1T5EA 4IFDG 1DXMA 4DNRB 2A6EC 3BG3A 3PV0A 4TQUS 1A6XA 2DNEA 1I6VC 2EJMA 2F1MA 3OPOA 4HR7B 4KMUC 2DNCA 2E74C 4PV1C 5JEAG 4GZYC 1GJXA 1VDZA 2NN6I 1OXUA 2E75C 3VR2A 3T56B 3VR5A 2ZT9C 2EJFC 4I7ZC 5A35A 1K8MA 2JXMB 3A8JE 2B8GA 4KKUA 2AUKA 4H44C 4TKOB 1LACA 1E2VA 1VCIA 1H9SA 1Z7TA 3D31A 3A7AB 3GD7A 4KKTA 4KHZA 2LMCB 1K8OA 2AUJD 3BDOA 1TKWB 1H9SB 2A69D 5BN5A 1Q1BA 1YNNC 1VF5C 2D5DA 3QIAA 1QJOA 3I4LA 4KN4C 3IKJA 1HTPA 3HGBA 4JK1C 3U9SA 4IQZA 1V43A 4OO1H 4G7HC 2DN8A 4H13C 1GUNA 1ZYRC 1GUSA 3VA7A 1GUGA 3OOCA 1H9KA 3IFTA 4DNTB 1Q12A 2BA1A 1HPCA 4DK0A 2EDGA 1IW7C 2BA0A 1OXVA 1GHJA 2JEBI 1VF7A 3ND9A 1EWHA 2BDOA 4KI0A 5KNDA 3M7NA 3AB9A 4DK1A 3M4YA 1FYCA 2PPBC 4XIGS 1ONLA 3M85A 1GHKA 3PUWA 1Y8OB 3I72A 3TZUA 1DD2A 3MXUA 4JBWA 4H0LC 2E76C 2AWOA 1ZKOA 1H9MA 2O5IC 3I73A 2KCCA 2A6HC 3QG1A 2K7VA 4XTCS 5BN4A 3CRKC 3MFYA 2A6ED 1BDOA 2K32A 3PUZA 5KNCA 3KLRA 4OO1G 1OXTA 5K36H 1Y8NB 1FR3A 1O78A 1PMRA 3W3AA 1HQMC 2PCFB 3VR6A 2O5JC 3SE0A 1OXSC 2BE5C 1LABA 2PNRC 2R6GA 3A8IE 2Q8IB 4BA1I 5C0XH 1H9RA 2D2CC 2EJGC 3NE5B 1HCZA 2NN6H 4KN7C 2JE6I 1Z6HA 3FPPA 5KNBA 1B9NA 2V4DA 3A8KE 2YYZA 3GQBA 1CI3M 1E2ZA 2K33A 1Y8PB 3SDZA 1CFMA 2A69C 3T53B 3PUYA 1GUTA 2A68C 1B9MA 3N6RA 1H9JA 4RCNA 3H94A 1IYVA 3ND8A 4G7OC 4LJZC 3RLFA 3PUXA 2A6HD 4OGQC 4LK1C 2JEAI 4IFDH 3L7ZC 5K36G 2CW0C 1G291 4BA2I 3FMCA 3VR4A 1O7LA 2D62A 3D4RA 1YNJC 3CRLC 5BN3A 5JEAH 3VR3A 2QF7A 1GUOA 1DCZA 2BE5D 5C0XG 3OW7A 1IW7D 1TU2B 2NN6G 3LWUA 4KKSA 3T51B 1OXXK 2EVBA 3DXJC 1Y69U 1CTMA 4L8JA 4G7ZC 1Q1EA 3LNNA 1E2WA 3WDNA 2KA7A 2B8FA 3P20A 3A7LA 1V8QA 1SMYC 2A68D 3QJYA 1IYUA 2L5TA
chains in the Genus database with same CATH superfamily
4UDUC 1IKLA 2F0NA 1TVXA 4A3MG 5COYA 4V0BA 1EOTA 3KUPA 1M8AA 3D4WA 4UHVA 4JVZA 2R93B 3PO2B 4DUYQ 1K83H 3TSSA 1STEA 1TS3A 5IGGA 3FVQA 3NTKA 2UU9Q 1F9SA 2I5LX 4QMGA 2M2LA 3D8GA 4B3RL 2XN9C 1F77A 2RSOA 4MTNA 1HHVA 4JK1C 4XQJA 4CDCC 1IBLL 3MEFA 2QEJC 3R93A 1C0AA 3TQYA 2F0LA 1ICWA 5EJWA 1OXVA 3H0GG 5C3EB 1B7YB 1JJCB 5KNDA 4A3LH 2H5XA 3WOEA 5M5WB 3JAMi 3M4YA 3M3YB 1AW7A 2B2YA 3I73A 4LF9Q 3HKZB 3AFPA 1VQAA 4NXMQ 1WOCA 3U9OA 2NZHA 5K36H 2ATWA 2BH2A 3SE0A 4R9WA 4A93B 1NMFA 2H1EA 1XPUA 3QOLA 1X32A 2LFNA 1YIJA 1JOKA 4YY3Q 3GTGH 2E2JH 3K7AB 4DV6Q 4L5TA 2QILA 1KDAA 1GOZA 1SJED 2F0JA 1CFMA 2A69C 3J81i 2JA7B 5EPLA 1EYAA 4EQOA 4AH6A 5IYDG 2WAQG 2ZTCA 5J39A 2OTLA 2CKZB 2EXZA 1I4PA 1X55A 2R93H 3PO2H 2F0QA 1GUOA 1C9OA 1TWCB 4LF7Q 1S5BD 2K6AA 3MZ5A 3NPPA 3NQTA 4WJWA 1N36Q 3LWUA 3UDIA 2N88A 2PO4A 4Y52H 1PDQA 4FP5D 2LY7A 4JYAQ 4QIWE 1CT1D 3UDXA 3P20A 4QCLA 3S2DH 4JBMA 1PYWD 5I6YA 1BVSA 3D6WA 4B9WA 2I0QA 1A15A 3WOFA 4DNRB 3H09A 3NBIA 4JI2Q 5JJKA 4JI7Q 5JEAG 1PH6A 1JJ2A 5ELCA 1PTOB 4UY8C 2E2IH 1VDZA 1V1PA 1O7YA 1EY6A 3KLSX 4A3BB 2B2VC 2K5HA 3G6JB 1SFOH 5M3MB 2EYMA 3BVMA 1E1OA 2CQOA 4Q5VA 3AFQA 3DWQA 4KHZA 4XQNA 4KY5A 1K8OA 1VQMA 1K3RA 4F87A 2VW9A 1VQBA 5I6WA 4IFDI 2ZXRA 3FDTA 4X66L 1LTRD 3HOUB 1ET6A 3ITPA 1L1OA 1MI2A 2RCFA 3IKJA 1IXRA 3TP5A 2C35B 3QWNA 4JOIC 2JA8G 2F52A 4DGZA 4KHPL 2CW0D 4A93H 1XX8A 3EIVA 2AQ2B 2EOTA 3OOCA 1TIID 1YVCA 1HPCA 4R1JA 2F03A 3K7AH 1EWCA 1L0XB 4DR6Q 3CCLA 3AB9A 3TS0A 1FYCA 4C56C 3HOYG 2KEDA 3GTLB 1UE5A 1YNND 3AEVA 3OW2A 1HJPA 4IZ8A 1CA5A 1XYIA 1G2TA 3J81j 4NPSA 3KDFA 1A3TA 2Z8LA 4DN4M 2E5LQ 1WTXA 1S72A 1W6JA 3NENA 4CKBA 1OTCA 2FHTA 4X3TA 4RHRA 2DY7A 3GQBA 3PUYA 4X62Q 2EZVA 2PW7A 3G6EA 4OX9Q 3STBD 2OTJA 2EYJA 3PUXA 4IFDH 1ESFA 2NVXH 1PTOH 1SNMA 5C4XB 3S15B 2XIWA 4BA2I 5F2DA 3D4RA 1YNJC 1K8GA 1KQSA 1TY2A 3I90A 5M3MH 1IZ6A 3OW7A 1JOOA 3S1MB 1DGSA 4CJ2C 1OXXK 4A3DB 2N55A 1SMXA 3HOWH 3J7AV 3GV3A 1B44D 5C3XA 4DV1Q 3C46A 3RD4A 1V8QA 1AE3A 2VNUD 2KQ3A 1QG7A 5EPJA 4L5SA 3VYTA 4AYBB 2UUAQ 3U58A 2Q2IA 1XTDA 2EJMA 3OPOA 2R92H 3D6CA 1QWYA 4MHEA 4DA2A 2EJFC 3C1EA 2RDFA 1K8MA 2NVTH 4KKUA 2EE1A 2ZJRA 5CBAE 3GTLH 2R7ZG 2RCNA 3U50C 3CCRA 1NNXA 3J7YW 1H95A 5FLMG 1QVCA 2JA5G 1QJOA 1BCPD 4QY7A 2B3GA 1NJIC 2MPMA 3RUZA 5JPMC 1RTNA 1D8LA 2X6GA 1JB7A 1SRUA 1HR0Q 1JMCA 4OWTB 2YU9H 1D5XC 2BDOA 1N9WA 1BOSA 2PZUA 4APVA 3RMHA 4EQ5A 3I4MG 3CCUA 5ISRA 3NK9A 1VQIA 1EEID 2KCMA 4ZKCB 2RDHA 2CHBD 4MN3A 4ZAIA 1SAPA 1PFSA 1R4PB 3GTQB 1MHWC 3MFYA 4H02A 4DUYL 1TWGB 4OO1G 1LT5D 1N33Q 1CHPD 3S1MH 3FKIH 2UU9L 4C3HB 4A3DH 4OONA 4YCVA 1VQDA 4QUCA 1JE5A 3MXPA 4F7XA 3A5ZB 3RN5A 4B3TL 1VQEA 3W1GA 4DAMA 4O0AA 3TEHB 1HZAA 2A68C 4RCNA 2F3VA 3M4PA 4LK1C 1R9TB 1B8AA 4DNIA 2F3IA 2MQHA 5HGTA 4DR3Q 1EFID 1G291 5FJ8G 1Z47A 3A5UA 4A3KG 4C3IG 4GN4B 4BY7H 1DCZA 1DOKA 5LL6X 2HHHQ 5C0XG 4C2MH 1IW7D 1A62A 1BCPF 2P5ZX 1DZ1A 1SNDA 2AKWB 3BZKA 1E2WA 5M5XB 3X3MA 3CCMA 4NXML 2X6LA 2KA7A 2QEXA 2B8FA 3SR1A 4EX5A 1EFWA 1SMYC 3ZJYC 1BUVT 5IP9G 1DXMA 1JWUD 1EY0A 1L2FA 2B39A 3I4NB 2EY2A 2YTVA 2K52A 4IPCA 2AWNA 4JI3L 3ULPA 1I4GA 4YY3L 4NKLA 3VR5A 3T16A 4RHSA 3L3OC 2ZT9C 3UE1A 4RG1A 2NZOA 5FOBB 3J7A5 1I6HB 1IBLQ 3GTKH 4KJNA 1UE7A 1ILQA 5CGKA 3PIO3 3A7AB 1BQQT 1I4RA 1R4QB 3PSIA 4ZK9B 5KYLA 3MVVA 1RHPA 3K6OA 4A3IB 3E0EA 1TWFB 2D5DA 1TWGH 3J81c 3QIAA 4QB4A 1RF2D 4LF7L 3OTOL 1Q8KA 3H6MA 3DUZA 1N36L 3MXGA 1V43A 3SK5A 4C3HH 2XWBB 1GUNA 2M00A 4BY7G 1QILA 2EDGA 3G71A 4F88A 1X9NA 4M1UB 2Q8TA 5I4DA 4DK1A 1TS2A 4B3ML 2K5VA 1XWEA 2BDNA 1EIFA 4JI2L 4K8IA 1WD0A 3I2ZA 1GKHA 4A3FH 3K5MA 5KYIA 2A6HC 3QG1A 5KIXA 3CC7A 3C3LA 2BOSA 3O13A 4AQYL 1FR3A 4DV7Q 3NTIA 4DKAC 3VR6A 1AN8A 4XQQA 3HKSA 1EQQA 2ZXPA 2I07B 4BA1I 4DXFA 5M5XH 1M4VA 1QE6A 2F0MA 1D1KA 3BYTB 4IURA 3GTOB 2A73B 3FP9A 3FEWX 3HOZG 2K33A 1PA6A 3T1YQ 1B9MA 3I4NH 2B2UC 1STHA 3T1HQ 4HCSA 3N52A 4WRDA 5CYUA 3GDEA 4A3JB 5BN3A 1I6HH 3K5NA 3EA6A 1YI2A 4DR6L 2I46A 2PZWA 4F8MA 3AMUA 1I94Q 1JOQA 1YJ9A 2VS1A 2JN4A 3OIQA 2KHIA 1TWAB 1ENAA 3S2HH 3J80c 4A3IH 1BXTA 2IPKD 1HQRD 1TWFH 1PZKD 1X3EA 4YCWA 3M4OB 2OT2A 2J4XA 3EVQA 2L55A 1CM9A 1RCVD 2E5LL 3I91A 1A6XA 4TQUS 1MJCA 2F1MA 2DNCA 4X66Q 4GKKL 1SE4A 1QZHA 3VR2A 4BBSB 3T13A 1SN8A 4A3MB 2SEBD 5C44G 1AP0A 2IW3A 4X62L 4WORA 2HDMA 3SHLA 4BBRH 2C9OA 3Q23A 1HUNA 1EU4A 3BDOA 2MFIA 1DJRD 1UE6A 1ZXTA 1FGUA 2F0OA 2B2WA 1STYA 3OMCA 1GO3E 4JOIA 4A3EH 2NVYB 2QCPX 4LF6L 1PV4A 1SEBD 4DV1L 5I9OA 2JEBI 3GTOH 2NZ1D 2Z4HA 2LXKA 4P72A 2JA6G 4C3JH 4IOCA 1X3QA 2AQ1B 3F2BA 1NR4A 2UUAL 3GP7A 3PUWA 2GVAA 1ZKOA 5ELOA 2Y0SE 4A3JH 1XMOL 2Z0SA 2E2DC 2L11A 2PW5A 1J6QA 1LT4D 2RHSB 1OXTA 3GTPH 2IJ0A 3DWPA 4YWKA 1ENCA 4PMBA 4K5WA 5D3IB 5BR8Q 2A74C 3A8IE 4KY6A 1PYSB 5IYBG 3F1ZA 3NE5B 1VMCA 1EZ8A 4IUTA 4PZ6A 1LTSD 3BYYB 1K83B 2EQSA 1E2ZA 2VY3A 2RQXA 1X54A 2HT1A 1BR9A 1JICA 1YBYA 3BDLA 4RKLA 1KC8C 3NXWA 5G3LD 3KJOA 3PF5A 4A3MH 3W5OA 5C6AA 2BE5D 3MEHA 5C4JH 5GAHC 4CDDC 1U4MA 2NN6G 1Y1VG 5DM73 4A75A 1Q3LA 4DR4L 3WDNA 1GUWA 2KBNA 2NTSA 1N33L 2F0IA 2IT1A 1KRTA 2WACA 3PV0A 2NVYH 2DUDA 2PZTA 4LUZA 4RA8A 3S1NH 4BS9A 3S16B 1MJEA 4OWWB 1KLUD 1OXUA 4HTHA 3PO3G 3CPFA 4KY7A 4H44C 3H0GH 3TP6A 1SE3A 4DV5Q 1X3FA 4DR3L 3NP8A 1TS4A 4PMWA 3CQZH 2ENBA 3T4AC 1VMPA 1TT2A 2HHHL 4JI0L 2WB1E 4DF7A 3TZDA 2FXQA 2NBFA 3K5LA 4C1NI 3LX0A 2JA8B 1H9KA 1VQKA 1EUJA 1GVPA 4IFDJ 2G9HD 2CVRA 2ZJQA 4B9XA 4JI5Q 5G3LF 2KEEA 1CHQD 3I72A 1D7QA 3AU7A 3MXUA 1A2UA 4NB3A 5IYDH 4B3TQ 4EGVA 2A6ED 3S2DB 5AFWA 2XSCA 1Y1WG 5C3WA 4O2DA 2N49A 4DV3Q 2OWOA 3Q24A 3M9BA 4DK6C 3L2PA 4HSPA 3RLOA 3IRBA 1VQ9A 1WCMG 2E2IB 1VQFA 2K5WA 4LF5Q 3E5SA 3HOXG 2CCZA 3BS1A 1RODA 3HEJA 3CPWA 4FXGC 1SFOB 3OMGA 3DM1A 3N6RA 3F8TA 1IYVA 4ZRZA 3K0YA 3S16H 1FD7D 4G57A 1UE1A 2CW0C 4NDXA 1RJTA 5JEAH 1JT8A 2FJ2A 1CZGA 4QQBX 2Y0SG 1BO0A 5C4ZA 2QDBA 4JI3Q 2KJXA 3SK6A 2WV6D 3NHHA 1UWVA 1PFMA 2EPBA 1VQPA 4DV7L 2RDGA 2F0KA 3SK4A 1Q90A 3EQLC 1A2TA 1LUZA 2WFWA 3PIOA 2JA8H 1A3UA 3OWEB 4PV1C 5GAGC 1KLGD 3DMUA 1HNZQ 4MNOA 5CORA 3LGJA 3DEOA 3OTOQ 4U673 1SNCA 1PRTB 2AUKA 3T1YL 2IL8A 1LACA 2VQEQ 4MTKA 5IGFA 3T1HL 3HOYH 1VQ6A 2VL6A 3H3VH 4A3GG 4CHTB 1VF5C 2BH8A 4OIKA 3STBC 3I4LA 5IIFA 1HZCA 3S1QH 1I94L 4B3MQ 3KLWA 4JI4L 2DN8A 3CU7A 2F3WA 2JP1A 2NVXB 1D1IA 1CUKA 3MWYW 1LLRD 2BA1A 1PH1A 3PMFA 2M9VA 1HZ9A 3C2PA 3CCQA 2BA0A 4QIWB 2MJ8A 3TDQA 1SYEA 3PIP3 1VF7A 4AQYQ 3UI2A 2KHJA 4X64L 3Q22A 1ONLA 4OHJA 5IGBA 4XXEA 3I4MB 4P2CB 2Q2HA 1SYBA 3HOWB 1CQVA 4HEDA 1NMGA 2K14A 2SNSA 1B70B 4YCUA 4DPGA 3CMEA 2Z6KA 1II3A 1HR0W 3S1RB 4LFBL 5HGQA 4A3CG 1M90C 1PFBA 2R92B 2D2CC 5C4HA 3J80i 2CWAA 3A8KE 1SDFA 3H3VC 2IY5B 1RD9D 2NVTB 2WB1G 2K04A 1CI3M 3OWFA 3OHXC 5DLQE 1EIYB 3W2DA 1STBA 3IL8A 1Y14B 1BCPC 1JORA 3DM3A 4LJZC 4UAIA 1M1KC 3ICEA 5ELBA 4U68A 3M7GA 3DWAA 1BBWA 4DV4L 1O7LA 1S5DD 2ZXOA 1WTWA 3HFZB 1QOHA 1KTKA 4C3IB 3LWEA 2UUBL 1XNQQ 5CV9A 4GKKQ 2R7ZH 2JYOA 3I8ZA 3GTJB 2YU9B 1FNVA 4ZYSA 1KXLA 2A5HA 2F0UA 2H4OA 1DOLA 2EYOA 2FFKB 4QL5A 5FLMH 2JA5H 2AHOB 2G9DA 5BR8L 2N78A 4RMFA 3NELA 4KD3A 2IX3A 2IHFA 4GOPC 1EY8A 1YEZA 1CK1A 5FLXE 5AJ3Q 4QJFA 1HFGA 5C0XI 2E74C 2B63G 1F2LA 2ASBA 4LNQA 3VA5A 1F9PA 1NTGA 5LMNL 1I4HA 3K7UC 3FKIB 3D4DA 4LW1A 3D31A 4DV0L 3GD7A 4IUQA 3I4MH 4LF6Q 4LFAQ 5IGDA 3KK7A 2K75A 3P1HA 4FNFA 1AH9A 4FVMA 4HJAA 4WJ3M 4WFN3 1HTPA 3E0JA 3HGBA 5DNFA 3V96A 3S1RH 1YZ6A 1E3PA 3KF6B 4OO1H 4YHHQ 1PRTC 2X69A 5EKLA 4GNXC 3E6ZX 4IO9A 4AYBE 1W6KA 1IL8A 1C8CA 1D5ZC 4DAYA 1XMOQ 1EEFD 2KCTA 4DNTB 3MHBA 2QDLA 1IW7C 4CDEC 4BY7B 2JA7G 2ALYB 1U4RA 4C2MB 4IJLA 4XYQA 5D3DA 1FVIA 5IE8A 5ELDA 3NEMA 1SNOA 2D9UA 3PCOB 3RZOH 1H9MA 4V190 1I5FA 3ULLA 2K03A 5IY0A 1CSQA 1T5XD 1XTCD 2RVLA 2HQEA 5FJ8H 1ET9A 1QVGA 4A3KH 4C3IH 1F2MA 4QUFA 2YV5A 2PNRC 2PQAA 3A54A 4DV5L 5C0XH 3VDYA 4IOAA 2KECA 4GS3A 2K28A 3GTJH 3FPPA 4G4KA 4ABNA 5M3FH 1SXTA 4CKEA 1YHBA 3GTKB 3J7ZC 1TY0A 4X3UA 1LTID 3ND8A 2L12A 5IP9H 4DU9A 3FRPB 1LYLA 5IGEA 4DR4Q 5C5MA 3VYRA 5FO9B 4ZLTF 4XDXA 1K9MC 2MO0A 5DM63 5M9OA 4JI5L 2R3ZA 3SGIA 2JA9A 3T51B 3CC2A 2CFMA 1CTMA 2CH4W 3HRZC 3LNNA 3HOUG 4DR7L 1BNZA 4JG2A 3GV6A 4TKOB 2UXCQ 5DAUA 2Z9HA 3S14B 4DV3L 5IOCA 4I65A 4XT1B 3TS2A 1IBKL 4BXXG 2B2TA 4NW2A 4A3FB 3F2UA 4LF5L 1CSPA 2WKDA 5J3BA 2MGSA 3T56B 2NWGA 5A35A 4HJ7A 4DXGA 2B2YC 4JI0Q 4RGTA 3S17H 1EY7A 2F0FA 1Q8IA 4KKTA 3ULJA 1QNKA 1K28A 2HD3A 3I70A 4HCEA 4KD4A 5M3FG 4ALPA 1ESRA 1ML0D 4O1NA 1WJJA 2A1AA 4KJOA 4GN5A 4FXDA 1VQNA 4CJ1B 4CJ0B 5EPKA 4G7HC 5FK9C 3D0FA 5FLXL 1GUSA 2RHQB 3VA7A 1DM0B 2DJGC 2VB3X 5HURA 1Q12A 4DAYB 2DGYA 1NUCA 2A19A 4RWSC 3JAME 3CCVA 5KGUA 3HOZH 4K2LA 1CQFA 3WWVA 5EKIA 4EQPA 4N9TA 3S2HB 5C4XG 1SNQA 4L6TB 1PTOD 1HNZL 2PMZB 1G51A 4P74A 3CRKC 4BWGB 1K0SA 2F0PA 4RH6A 1T9HA 3KLRA 1WTQA 1A63A 4J15A 2JJQA 4R4IA 2VQEL 1X56A 4YIJA 3URYA 4AIMA 3EBEA 5E4WC 5FO8B 2J0TD 2PQAB 2V4DA 2YYZA 3CHBD 3TREA 1NSNS 1V9PA 2HQLA 4AYBG 5JOBA 3S14H 4M8AA 3V05A 3J81E 3IAYA 2QKIC 4BBRB 1W2BA 5GAEC 1XPRA 2NVQH 1SE2A 1CKMA 2LKVA 1LTGD 1F2YA 5C44H 5JAVA 5E3FA 1YNXA 1KRSA 4A3EB 3CF5A 4XT3B 1WTHA 1IBMQ 1X65A 4JI6L 1L1OC 1FL0A 1Y1VB 4OIJA 2A68D 1WFQA 2EIFA 1HTLD 4C3JB 5CC4A 5ELFA 1WVLA 1UNSA 1YJWA 2Q2TA 4NXNQ 1B53A 1J9OA 1TWHB 1Q7YC 3M4QA 1KHIA 2NN6I 2UUCQ 4HN7A 1KIXA 3GTPB 4KTAA 1PTOF 1OO9B 3OIPA 4JI4Q 2JA6H 1MD2D 3BZDB 1X6OA 1SMYD 1NAPA 5BN5A 3RZDH 1Q1BA 3PIPA 2ICIA 4KN4C 2F0SA 1G8ZD 4X64Q 5CV6A 3RR5A 5H1SE 3U9SA 1FJGQ 2XTIA 4Q0FA 1O7IA 1XNQL 2FMCA 2WKCA 4HIDA 1GUGA 4R4CA 4L63B 1E22A 4YWLA 5IYBH 2HCCA 2OXPA 3AQQA 1I3QH 1S5CD 2PYKA 5C4JB 2E2HH 4LFBQ 2VB2X 3Q6SA 2F4IA 5JEAJ 2B2VA 1EOVA 2CQAA 5GADC 1E0BA 1NR2A 4H0LC 5AJ3L 2O5IC 4UP8A 1ILPA 2A8VA 4DAPA 3L0OA 3RN2A 2RA4A 2EYPA 1S3OA 3S1NB 1VQHA 4LFAL 2KENA 4HIMA 3KBXA 2IWHA 4JBKA 2NN6H 1LT3D 1Y1VH 4DV4Q 1N32Q 5KNBA 1KNAA 2Q2UA 1C7YA 3H0GB 3HOXB 3SDZA 3T53B 3JAML 4YHHL 2UUBQ 5CBEE 4CDFC 5JJZA 4TSSA 4UPAA 1TWHH 3KFUA 2A6HD 2JEAI 3KF8B 3CCSA 3CQZB 1JE4A 2Z1CA 4N8FA 2PNHA 2DY8A 5FKAC 4LFCQ 1F2ZA 3OSOA 3A56A 5IWAQ 2L1BA 2R7FA 2G5DA 5EGTA 3PO3H 2D0OA 5CV7A 3K0XA 3CP0A 5J22A 3NWTA 2Y0SB 3K58A 2QGQA 1QVFA 3A7LA 5LMNQ 1IYUA 3BVGA 4DR2Q 4RCOA 2KOLA 3CW2C 3J81L 4DV0Q 4FO2A 1E7ZA 4S3SA 2A6EC 4J8QA 4YWMA 3RLNA 1LO5D 2Z6BA 3K8AA 1VQJA 2WAQB 5IP7G 3ER0A 3I3CA 3PGZA 2LXJA 1K8AC 1S40A 1YITA 3QO2A 1B50A 5JVG3 3W1BA 2OQKA 1EYDA 2F4VL 1GD7A 1EQVA 1SYGA 1F9QA 4X3SA 3H15A 5EBCA 4IQZA 1I50B 2I5MX 4CKCA 1Y1WH 1PYBA 2VUMG 4HJ9A 5FO7B 5NUCA 4K5XA 1WCMH 2OF1A 2WINB 2UXCL 1STAA 3HOXH 4ZUIA 3H91A 5EBDA 3CC4A 3M85A 1GHKA 1S5ED 4RGMA 5LL6S 1N8RC 1DD2A 2F0VA 3QR8A 4JBWA 2RF4A 5EQ0A 3HOVG 2KCCA 5CV5A 4ODGA 4POFA 5I9PA 1BDOA 2K32A 1WTVA 1RL2A 1PXUA 3G7LA 1N34Q 4RAUC 4QGUA 1LABA 1LTTD 3SVMA 1VS0A 1VQGA 3CCEA 1VQ4A 1H9RA 4JI8Q 3SXHA 1SNPA 1CA6A 1WTRA 1B9NA 3K81C 4GLVB 1TQOA 1HZBA 2BCOA 3I4OA 5IT9E 3J7AF 1SSOA 3DHQA 1CKNB 4ZCKA 4HAEA 4KV6A 2AMCB 1H9JA 1AEXA 2WB1B 1A8VA 3HOYB 1B3QA 3RLFA 1HA5A 1XMQQ 3K80C 1EYCA 1Q82C 4BBSG 4DR7Q 3MFGA 5J1ZA 2ZTEA 5I2YA 2OEOA 4ZUJA 3CRLC 1ZYRD 3CCJA 2ES2A 3S1QB 2OCEA 4ID6A 1QUQA 1BCPB 4IUVA 1J5EQ 1IBKQ 4KKSA 4B3SQ 4R8NA 1PFNA 3H3VI 5IODA 1QZGA 1IHZA 4A3GH 4H7BA 3AYHB 4C1NK 1VQCA 2EYLA 1PHJA 1I50H 1EYGA 4PG3A 2HIXA 3BG3A 4LF8L 1EIGA 3HZXA 3G4SA 3HKZE 5C5LA 2E75C 2AQ3B 5M5YB 4GOPB 1X3GA 2B63B 4BY1G 1EY9A 4K2KA 2DJFC 4K14A 1E2VA 1VCIA 3R2IA 4JI1L 1L0YB 4FXKC 2YTYA 4DV2Q 2UXDL 5C0XJ 1YNNC 3V2TA 2NYZD 1MSHA 4P71A 1HNXQ 1PLFA 3TP8A 1KAWA 2HIVA 1SROA 2CWPA 3CKIB 4ME3A 1IBML 1PZJD 4A3CH 4LF4Q 3ND9A 4KI0A 4GNXB 2V1CC 2NUCA 2K1BA 3EN2A 1EZ6A 1G6PA 5TSSA 2UXBQ 1EY4A 4NXNL 1Y8OB 4I7AA 3TZUA 4FF2A 2K5NA 1QCBD 4IUUA 2R7ZB 2F0WA 2YTXA 4WJ4A 1LTAD 2F0DA 2K01A 3BZCA 3KF6A 5CV4A 3MXNA 2UUCL 1S4ZA 2NB0A 4XTCS 4DR1Q 5KNCA 2EY1A 2O4XA 2JA5B 3CXCA 4RGOS 5D14A 3CAMA 4K8JA 2SNMA 1EQRA 5EKKA 4LUVA 4CGYB 4KN7C 4KK7A 4A3LG 3G48A 3U4ZA 4O42A 1Y8PB 3ERQA 1FJGL 4RGNA 4PQXA 3KLSA 1IKMA 2WIIB 3CMAA 5KEEA 4JI6Q 5K36G 3TN2A 5M5YH 2N8NA 3VR3A 3IFDA 2B63H 5C3EH 3MAQA 1KAAA 5M5WH 2F0HA 2EY6A 1AFPA 1RTOA 3M3YH 3NBHA 3QB3A 1QUQB 4HSVA 1SYDA 4LWCA 4K6LA 2K4KA 4XYOA 4GLAC 5IYCH 4NMZA 3VYUA 5IT9L 1CZWA 3K59A 2VQFQ 5I2XA 1MIUA 2B2WC 5LMUQ 4OO1I 1MGSA 1QB5D 3TRZA 5JJIA 3I55A 3RZOB 2JSOA 1HNWQ 2B2UA 1XNRQ 1LV9A 2DNEA 4CBVA 2R93G 3PO2G 1N32L 1GJXA 2QW7A 1PH5A 4A3KB 1Q86C 2B8GA 2FINB 3OYYA 2R61A 3Q8DA 4DFAA 2JA7H 3U4VA 1BKBA 3R3OA 4JV5Q 1KDCA 1UUPA 2AUJD 1I4XA 4IUNA 2WP8J 1K73C 2A69D 4HMJA 4LFCL 1B3AA 5M3FB 4A76A 5IWAL 1P16A 1HRJA 2MO1A 1TWCH 3S9WA 5D65A 5FLXc 4ZKBB 4OL7A 1SBBB 4DAVA 2ZM6L 5C3EG 1JJGA 1EU3A 2OQ0A 3GO5A 4JBJA 1GHJA 3MA2B 4TRDA 1EWHA 4DR2L 3NUCA 1DONA 2E8GA 2FMMA 2RKSA 2RBMA 5IYCG 3HKZG 1JQYD 1ICFB 2HCIA 3SEBA 3I56A 4E6IA 2K7VA 3ONAB 5LHY1 5BN4A 3PUZA 1EWIA 4A93G 2LSSA 3P7JA 1O78A 1PMRA 2XWJB 1HQMC 3MXNB 3W3AA 4A3BH 1U4PA 2IX0A 5T1GA 5DEHA 1F9RA 3F2CA 1HCZA 3MC0B 5GROA 3FHWA 3HOUH 3S17B 2PI2A 1SYFA 5CMDA 1PH4A 4K0KQ 3FPUB 2XRQD 3H94A 2KUMA 4DR5Q 4OGQC 4ZQ3A 5JJLA 1NBWA 1XPOA 4BXXH 1RIPA 4L5QA 2GA4B 2RSNA 3BU2A 4FF1A 4ME5A 3ZYYX 2HUGA 1LTLA 1NE3A 5A2QE 1V1PB 4IPHA 4ULLA 1Q1EA 4GKJQ 3A0JA 3NBHB 1D5MC 3SK8A 1ENFA 1MBYA 2IHEA 1PTOC 1N34L 3A55A 1AE2A 4IALA 3HOZB 4IFDG 1ASYA 1L1OB 4JI8L 1PH3A 2F4VQ 4KMUC 4GZYC 4LMQD 5T1IA 4DUZL 4A3BG 2MUYA 1LM0A 4IPGA 5M3MG 2EXDA 1PH9A 4R4QA 1TS5A 1Q81C 1Q46A 3HOWG 4HJ8A 3EFXD 2LMCB 5IGCA 2O2LD 4UP9A 1XMQL 3DEPA 1KDBA 1PH2A 1STNA 1YHAA 1KD1C 4PZ7A 1FGBD 2C5CA 2VZAA 5E7NA 5C4XH 5K5PA 3S15H 1LT6D 1UEBA 3E9IA 2JQOA 1J5EL 2SOBA 1ASZA 4OEMB 4B3SL 2R92G 4IJHA 4X65Q 4FF3A 1YNJD 5EAYA 2NVQB 4JPBW 1W3SA 2F0TA 4RFBA 1QNUA 4FYDA 3KDFB 1A3VA 1C48A 3M7NA 4OXPA 1JWSD 2ZJPA 2L0CA 1JCKB 5C44B 3E9HA 2AWOA 4TVAB 5HY6A 3I7FA 4HMIA 3S24A 1MKHA 2TMPA 5ELEA 3F2DA 2I5HA 1PRTD 1PVOA 1B2TA 2VXWA 3BDCA 4MZ9A 2QA4A 2PCFB 3HP3A 1JB3A 2R6GA 3RNUA 2Q8IB 1B4OA 3L9AX 1BBXC 4DV2L 1VQ8A 5ELNA 3UDGA 4LF9L 1X3PA 2Z4IA 1HNXL 3JAMc 2K05A 1SE8A 2JA6B 1GUTA 1A0IA 2LS01 1AZPA 4G7OC 1PZID 4GN3B 1FNUA 1C4QA 1XXGA 2PQEA 4LF4L 4J6HA 3RZDB 4B3RQ 2PI2E 1VQ7A 1V1QA 3FMCA 2PMZE 1STGA 4DV6L 3FKIG 4FDBA 2UXBL 3BJUA 1RDPD 4R4OA 4DK3C 4A3DG 1KL9A 4EVOA 1VQ5A 3DXJC 4LF8Q 1UEAB 4Y7NB 4K5VA 1IYJB 3GTQH 4DR1L 1I3QB 1SR3A 1B1ZA 1BBUA 4OWXB 4IUPA 2E2HB 2MNAA 2GVBA 3UE0A 1P8LA 3KF8A 4A4IA 4X6AH 4JI1Q 3P75A 2R7DA 1LTBD 5KRUA 2UXDQ 2ZTDA 2HDLA 4GLXA 4JYAL 4I7ZC 4NP5A 5LMNW 4RKBA 3MTSA 5A2QL 1H9SA 2TSSA 2L4NA 4X3KA 1PRTF 2KHSA 4OELB 3A74A 1TKWB 3R8BA 4JI7L 1R9TH 2K5DA 1E1TA 2Z6KC 3PF4A 4P75A 4POGA 3KOJA 2Q8RE 2XNAC 1SJHD 1U9RA 4H13C 1O7ZA 2EY5A 1EL0A 1HA6A 1I4QA 4DK0A 3JC66 2VUMB 1G2SA 2VQFL 2SDFA 4IPDA 2MP1A 4PZ8A 1HFNA 3EJIA 5LMUL 3NQIA 3PO3B 1ZEQX 3GTMB 2ICEC 3TMEA 4JW0A 1HNWL 1XNRL 3CD6A 2E76C 4K6DA 2CH4A 1U5KA 1V1OA 2MHVA 1VQOA 2L15A 3HOVB 4C3HG 1Y8NB 3TBIB 1G91A 1L0WA 2O5JC 1HH2P 1HXYD 2BE5C 5JVH3 1PH8A 4JV5L 1DOMA 4Y7NH 4LAAA 1WI5A 3EROA 2F0EA 1WTOA 3TP7A 1MSGA 2JK8A 3J80E 4PNYA 5JPNC 1K3BC 3HG9A 4ILWA 1YJNA 2XRSD 4A3FG 4L5RC 3B6YA 3BVZA 3ERSX 3L7ZC 1D2BA 4J1MA 4JC0A 4KHVA 4R8IA 3VR4A 5IP7H 4B08A 1U4LA 3D3RA 1Y1WB 1JC7A 3DLLA 1O80A 4KHPQ 4IN3A 1TU2B 1Y69U 1E24A 1JWMD 4L8JA 4PMCA 4OX9L 4FF4A 1CKNA 1WCMB 1WYDA 3QJYA 4R4TA 2F0GA 2L5TA 3I4NG 1S5FD 1TR5A 2XGTA 3PUVA 3PQIA 3NTHA 1T5EA 1JR0D 1IL2A 4N8X1 4QF4A 3NSWA 4HJ5A 1I6VC 1CKOA 4HR7B 1EIHA 2VUMH 3R2TA 1TXYA 4HIOA 1YHQA 2L9HA 2JXMB 3A8JE 4K0KL 2ID0A 3GTMH 3UDFA 1J8IA 3Q0AA 1EY5A 1Z7TA 4A3IG 4BY1B 4DR5L 1Z9FA 2ZM6Q 2D0PA 1SYCA 5CR3A 1D6EC 1H9SB 1DYQA 1SLJA 1PH7A 3HOVH 1FNWA 5E1FA 1U0LA 2KCNA 2J7ZA 1K0RA 1ZYRC 4GOPA 2GN5A 3K5OA 4MIUA 4GKJL 1TWAH 2NTTA 3IFTA 1G6ZA 2WAQE 3M4OH 2EYHA 4BBRG 2PPBC 3C1FA 4XIGS 3KJPA 1VQLA 1GM5A 5CV8A 3E3XA 4N9PA 4LUOA 2KVMA 3KBGA 1XJVA 2K50A 1HR0L 4A3GB 4BBSH 4P73A 3VYSA 5GQOA 4A3EG 4JCVE 1OXSC 1WD1A 1WTPA 1UAPA 4GNXA 1RKNA 2XVSA 2EJGC 2N3SA 1GXDC 2JE6I 1Z6HA 1KNEA 5E4XA 5L37A 4C3JG 3NWSA 1AZQA 1KABA 2B2TC 1BF4A 4X65L 4HIKA 4EQNA 4A3JG 3HS0C 1HUMA 3QOJA 2D62A 2QF7A 2K5QA 4UP7A 1NY4A 3KYHC 1EQTA 4BY1H 2EVBA 4KLKA 3K57A 4G7ZC 4DUZQ 2EYFA 3J80L 1NCVA 5IT9c 4Z9CB 3GTGB 2B29A 2IX1A 2E2JB 3X3NA
chains in the Genus database with same CATH topology
4UDUC 1IKLA 2F0NA 1TVXA 5COYA 4V0BA 1EOTA 3KUPA 1M8AA 3D4WA 2R93B 3PO2B 3TSSA 1STEA 1TS3A 5IGGA 3FVQA 3NTKA 1F9SA 4QMGA 2M2LA 3D8GA 2XN9C 1F77A 2RSOA 1HHVA 4JK1C 4XQJA 2QEJC 3R93A 2F0LA 1ICWA 5EJWA 1OXVA 5C3EB 5KNDA 3WOEA 5M5WB 3M4YA 3M3YB 1AW7A 2B2YA 3I73A 3HKZB 3U9OA 5K36H 3SE0A 4R9WA 4A93B 2H1EA 3QOLA 1X32A 2LFNA 1JOKA 3K7AB 2QILA 1KDAA 1GOZA 1SJED 2F0JA 1CFMA 2A69C 2JA7B 5EPLA 1EYAA 4EQOA 5J39A 2EXZA 1I4PA 2F0QA 1GUOA 1TWCB 1S5BD 2K6AA 3MZ5A 3NPPA 3NQTA 4WJWA 3LWUA 2N88A 2PO4A 1PDQA 4FP5D 2LY7A 1CT1D 3P20A 4QCLA 1PYWD 5I6YA 3D6WA 4B9WA 1A15A 3WOFA 4DNRB 3H09A 3NBIA 5JEAG 5ELCA 1PTOB 1VDZA 1V1PA 1O7YA 1EY6A 3KLSX 4A3BB 2B2VC 3G6JB 5M3MB 2EYMA 3BVMA 4Q5VA 3DWQA 4KHZA 4XQNA 4KY5A 1K8OA 4F87A 5I6WA 4IFDI 2ZXRA 3FDTA 1LTRD 3HOUB 1ET6A 3ITPA 1MI2A 3IKJA 3TP5A 3QWNA 4DGZA 2CW0D 1XX8A 3OOCA 2AQ2B 2EOTA 1TIID 1HPCA 2F03A 1EWCA 1L0XB 3AB9A 1FYCA 4C56C 2KEDA 3GTLB 1YNND 4IZ8A 1CA5A 1XYIA 1G2TA 1A3TA 2Z8LA 4DN4M 1WTXA 1W6JA 4CKBA 2FHTA 4X3TA 4RHRA 2DY7A 3GQBA 3PUYA 2EZVA 2PW7A 2EYJA 3PUXA 4IFDH 1ESFA 1PTOH 1SNMA 5C4XB 3S15B 2XIWA 4BA2I 5F2DA 3D4RA 1YNJC 1TY2A 3I90A 3OW7A 1JOOA 3S1MB 4CJ2C 1OXXK 4A3DB 2N55A 3J7AV 3GV3A 1B44D 5C3XA 3C46A 3RD4A 1V8QA 2VNUD 2KQ3A 1QG7A 5EPJA 3VYTA 4AYBB 2EJMA 3OPOA 3D6CA 1QWYA 4MHEA 4DA2A 2EJFC 3C1EA 2RDFA 1K8MA 4KKUA 2EE1A 5CBAE 3J7YW 1QJOA 1BCPD 2MPMA 3RUZA 5JPMC 1RTNA 2X6GA 1D5XC 2BDOA 1BOSA 2PZUA 3RMHA 5ISRA 3NK9A 1EEID 4ZKCB 2RDHA 2CHBD 4MN3A 4ZAIA 1SAPA 1R4PB 3GTQB 3MFYA 1TWGB 4OO1G 1LT5D 1CHPD 4C3HB 4QUCA 3MXPA 4F7XA 2A68C 4RCNA 2F3VA 4LK1C 1R9TB 5HGTA 1EFID 1G291 1Z47A 4C3IG 1DCZA 1DOKA 5LL6X 5C0XG 1IW7D 1BCPF 1DZ1A 1SNDA 1E2WA 5M5XB 3X3MA 2X6LA 2KA7A 2B8FA 3SR1A 1SMYC 1BUVT 1DXMA 1JWUD 1EY0A 2B39A 3I4NB 2EY2A 2AWNA 1I4GA 4NKLA 3VR5A 3T16A 4RHSA 3L3OC 2ZT9C 1I6HB 5FOBB 4KJNA 5CGKA 1ILQA 3PIO3 3A7AB 1BQQT 1I4RA 1R4QB 5KYLA 4ZK9B 3MVVA 1RHPA 3K6OA 4A3IB 1TWFB 2D5DA 3QIAA 4QB4A 1RF2D 3H6MA 3DUZA 3MXGA 1V43A 3SK5A 2XWBB 1GUNA 2M00A 1QILA 2EDGA 4F88A 4M1UB 2Q8TA 5I4DA 4DK1A 1TS2A 1XWEA 2BDNA 4K8IA 1WD0A 3K5MA 5KYIA 2A6HC 3QG1A 5KIXA 3C3LA 2BOSA 3O13A 1FR3A 3NTIA 3VR6A 1AN8A 4XQQA 2ZXPA 2I07B 4BA1I 4DXFA 1M4VA 1QE6A 2F0MA 1D1KA 3BYTB 4IURA 3GTOB 2A73B 3FEWX 2K33A 1B9MA 2B2UC 1STHA 4HCSA 3N52A 4WRDA 5CYUA 4A3JB 5BN3A 3K5NA 3EA6A 2I46A 2PZWA 4F8MA 3AMUA 1JOQA 3OIQA 1TWAB 1ENAA 1BXTA 2IPKD 1HQRD 1PZKD 3M4OB 2OT2A 2J4XA 3EVQA 2L55A 1CM9A 1RCVD 3I91A 1A6XA 4TQUS 2F1MA 2DNCA 1SE4A 3VR2A 4BBSB 3T13A 4A3MB 2SEBD 1AP0A 2IW3A 4WORA 2HDMA 3SHLA 2C9OA 3Q23A 1HUNA 1EU4A 3BDOA 1DJRD 1ZXTA 2F0OA 2B2WA 1STYA 3OMCA 2NVYB 2QCPX 1SEBD 5I9OA 2JEBI 2NZ1D 2Z4HA 1X3QA 2AQ1B 1NR4A 3GP7A 3PUWA 1ZKOA 2E2DC 2L11A 2PW5A 1LT4D 1OXTA 2IJ0A 3DWPA 1ENCA 4PMBA 4K5WA 5D3IB 2A74C 3A8IE 4KY6A 3NE5B 1VMCA 1EZ8A 4IUTA 1LTSD 3BYYB 1K83B 1E2ZA 2RQXA 1BR9A 1JICA 3BDLA 4RKLA 3NXWA 5G3LD 5C6AA 2BE5D 3MEHA 1U4MA 2NN6G 5DM73 1Q3LA 3WDNA 1GUWA 2NTSA 2F0IA 2IT1A 2WACA 3PV0A 2PZTA 4RA8A 4BS9A 3S16B 1KLUD 1OXUA 4HTHA 4KY7A 4H44C 3TP6A 1SE3A 3NP8A 1TS4A 4PMWA 2ENBA 3T4AC 1VMPA 1TT2A 4DF7A 3TZDA 2NBFA 3K5LA 4C1NI 3LX0A 2JA8B 1H9KA 4IFDJ 2G9HD 2CVRA 4B9XA 5G3LF 2KEEA 1CHQD 3I72A 3AU7A 3MXUA 1A2UA 4EGVA 2A6ED 3S2DB 5AFWA 2XSCA 5C3WA 3Q24A 4HSPA 2E2IB 2K5WA 3E5SA 3BS1A 1RODA 3HEJA 4FXGC 1SFOB 3OMGA 3DM1A 3N6RA 1IYVA 4ZRZA 3K0YA 1FD7D 4G57A 2CW0C 4NDXA 1RJTA 5JEAH 2FJ2A 1CZGA 1BO0A 5C4ZA 2QDBA 2KJXA 3SK6A 2WV6D 3NHHA 2EPBA 1PFMA 2RDGA 2F0KA 3SK4A 1Q90A 3EQLC 1A2TA 1A3UA 3OWEB 4PV1C 1KLGD 3DMUA 5CORA 3DEOA 4U673 1SNCA 1PRTB 2AUKA 2IL8A 1LACA 5IGFA 4CHTB 1VF5C 4OIKA 3I4LA 5IIFA 2DN8A 3CU7A 2F3WA 2JP1A 2NVXB 1D1IA 3MWYW 1LLRD 2BA1A 3PMFA 2M9VA 3C2PA 3TDQA 2BA0A 2MJ8A 4QIWB 1SYEA 3PIP3 1VF7A 3UI2A 3Q22A 1ONLA 4OHJA 5IGBA 4XXEA 3I4MB 4P2CB 1SYBA 3HOWB 1CQVA 4HEDA 2SNSA 1II3A 3S1RB 1PFBA 2R92B 2D2CC 5C4HA 3A8KE 1SDFA 3H3VC 1RD9D 2NVTB 2K04A 1CI3M 3OWFA 3OHXC 3W2DA 1STBA 3IL8A 1JORA 1BCPC 4LJZC 4UAIA 5ELBA 4U68A 3M7GA 3DWAA 1O7LA 1S5DD 2ZXOA 1WTWA 1QOHA 1KTKA 4C3IB 3LWEA 5CV9A 2JYOA 3I8ZA 3GTJB 2YU9B 1FNVA 4ZYSA 2A5HA 2F0UA 2H4OA 1DOLA 2EYOA 2FFKB 1C8CA 2G9DA 4KD3A 2IX3A 1EY8A 1CK1A 5FLXE 1HFGA 5C0XI 2E74C 1F2LA 3VA5A 1F9PA 1I4HA 3FKIB 3D4DA 3D31A 3GD7A 4IUQA 5IGDA 3KK7A 3P1HA 4FNFA 4FVMA 4WFN3 1HTPA 3E0JA 3HGBA 5DNFA 3V96A 4OO1H 1PRTC 2X69A 5EKLA 3E6ZX 1W6KA 1IL8A 1D5ZC 4DAYA 1EEFD 4DNTB 3MHBA 1IW7C 4BY7B 1U4RA 4C2MB 4XYQA 5D3DA 5ELDA 1SNOA 2D9UA 1H9MA 4V190 2K03A 1T5XD 1XTCD 2RVLA 2HQEA 1ET9A 1F2MA 4QUFA 2PNRC 3A54A 5C0XH 2KECA 2K28A 3FPPA 4G4KA 4ABNA 1SXTA 4CKEA 3GTKB 1TY0A 4X3UA 1LTID 3ND8A 2L12A 4DU9A 3FRPB 5IGEA 5C5MA 3VYRA 5FO9B 4ZLTF 4XDXA 5DM63 5M9OA 2R3ZA 3T51B 1CTMA 3HRZC 3LNNA 1BNZA 3GV6A 4TKOB 5DAUA 3S14B 5IOCA 4I65A 4XT1B 2B2TA 4NW2A 4A3FB 3F2UA 2WKDA 2MGSA 3T56B 2NWGA 5A35A 4DXGA 2B2YC 4RGTA 1EY7A 2F0FA 1Q8IA 4KKTA 1QNKA 3I70A 4HCEA 4KD4A 1ESRA 1ML0D 4O1NA 4KJOA 4FXDA 4CJ1B 4CJ0B 5EPKA 4G7HC 5FK9C 5FLXL 1GUSA 3VA7A 1DM0B 2VB3X 5HURA 1Q12A 1NUCA 4RWSC 3JAME 5KGUA 4K2LA 1CQFA 5EKIA 4EQPA 4N9TA 3S2HB 1SNQA 4L6TB 1PTOD 2PMZB 3CRKC 4BWGB 2F0PA 4RH6A 1WTQA 3KLRA 4YIJA 3URYA 5E4WC 5FO8B 2J0TD 2V4DA 2YYZA 3CHBD 1NSNS 5JOBA 4M8AA 3V05A 3J81E 3IAYA 2QKIC 4BBRB 1SE2A 2LKVA 1LTGD 1F2YA 5JAVA 5E3FA 4A3EB 4XT3B 1Y1VB 4OIJA 2A68D 1HTLD 4C3JB 5CC4A 5ELFA 1WVLA 1UNSA 1B53A 1J9OA 1TWHB 2NN6I 4HN7A 3GTPB 4KTAA 1PTOF 1OO9B 3OIPA 1MD2D 3BZDB 1SMYD 1NAPA 5BN5A 1Q1BA 2ICIA 4KN4C 2F0SA 1G8ZD 5CV6A 3U9SA 4Q0FA 2FMCA 2WKCA 1GUGA 4L63B 2HCCA 2OXPA 1S5CD 2PYKA 5C4JB 2VB2X 3Q6SA 2F4IA 5JEAJ 2B2VA 2CQAA 1E0BA 1NR2A 4H0LC 2O5IC 1ILPA 4DAPA 2RA4A 2EYPA 3S1NB 3KBXA 2IWHA 2NN6H 1LT3D 5KNBA 1KNAA 3H0GB 3HOXB 3SDZA 3T53B 3JAML 5CBEE 5JJZA 4TSSA 2A6HD 2JEAI 3CQZB 1JE4A 2Z1CA 2DY8A 5FKAC 1F2ZA 3OSOA 3A56A 2L1BA 5EGTA 5CV7A 5J22A 3NWTA 2Y0SB 3K58A 3A7LA 1IYUA 3BVGA 4RCOA 2KOLA 3J81L 4FO2A 4S3SA 2A6EC 4J8QA 1LO5D 2WAQB 3I3CA 3QO2A 1B50A 5JVG3 1EYDA 1EQVA 1SYGA 1F9QA 4X3SA 5EBCA 4IQZA 1I50B 4CKCA 5FO7B 5NUCA 4K5XA 2OF1A 2WINB 1STAA 4ZUIA 3H91A 5EBDA 3M85A 1GHKA 1S5ED 4RGMA 5LL6S 1DD2A 2F0VA 4JBWA 5EQ0A 2KCCA 5CV5A 4ODGA 5I9PA 1WTVA 1BDOA 2K32A 1PXUA 3G7LA 4RAUC 1LABA 1LTTD 3SVMA 1H9RA 3SXHA 1SNPA 1CA6A 1WTRA 1B9NA 1TQOA 2BCOA 5IT9E 3J7AF 1SSOA 3DHQA 4HAEA 4KV6A 1H9JA 1AEXA 2WB1B 3HOYB 3RLFA 1HA5A 1EYCA 3MFGA 5J1ZA 5I2YA 2OEOA 4ZUJA 3CRLC 1ZYRD 3S1QB 4ID6A 1BCPB 4IUVA 4KKSA 4R8NA 1PFNA 5IODA 1IHZA 4H7BA 4C1NK 2EYLA 3BG3A 1EIGA 3HZXA 5C5LA 2E75C 2AQ3B 5M5YB 2B63B 1EY9A 4K2KA 4K14A 1E2VA 1VCIA 3R2IA 1L0YB 4FXKC 5C0XJ 1YNNC 3V2TA 2NYZD 1MSHA 1PLFA 3TP8A 3CKIB 1PZJD 3ND9A 4KI0A 2NUCA 2K1BA 1EZ6A 5TSSA 1EY4A 1Y8OB 4FF2A 3TZUA 1QCBD 4IUUA 2R7ZB 2F0WA 1LTAD 2F0DA 2K01A 5CV4A 3MXNA 1S4ZA 2NB0A 4XTCS 5KNCA 2EY1A 2O4XA 2JA5B 4RGOS 5D14A 4K8JA 2SNMA 5EKKA 4CGYB 4KN7C 4KK7A 4O42A 1Y8PB 3ERQA 4RGNA 4PQXA 3KLSA 1IKMA 2WIIB 5KEEA 5K36G 3TN2A 3VR3A 3IFDA 3MAQA 1KAAA 2F0HA 2EY6A 1AFPA 1RTOA 3NBHA 3QB3A 4HSVA 1SYDA 4K6LA 4XYOA 4NMZA 3VYUA 5IT9L 1CZWA 3K59A 5I2XA 2B2WC 4OO1I 1MGSA 1QB5D 3RZOB 2JSOA 2B2UA 1LV9A 2DNEA 4CBVA 1GJXA 4A3KB 2B8GA 2FINB 2R61A 4DFAA 3R3OA 1KDCA 1UUPA 2AUJD 1I4XA 4IUNA 2WP8J 2A69D 4HMJA 5M3FB 1B3AA 1HRJA 3S9WA 5D65A 4ZKBB 4OL7A 1SBBB 4DAVA 1EU3A 3GO5A 1GHJA 3MA2B 4TRDA 1EWHA 3NUCA 1DONA 2FMMA 2RKSA 2RBMA 1JQYD 2HCIA 3SEBA 4E6IA 2K7VA 3ONAB 5LHY1 5BN4A 3PUZA 3P7JA 1O78A 1PMRA 2XWJB 1HQMC 3W3AA 1U4PA 2IX0A 5T1GA 5DEHA 1F9RA 1HCZA 3MC0B 3S17B 1SYFA 5CMDA 3FPUB 2XRQD 3H94A 2KUMA 4OGQC 4ZQ3A 2GA4B 2RSNA 4FF1A 4ME5A 3ZYYX 2HUGA 5A2QE 1V1PB 4ULLA 1Q1EA 1D5MC 3SK8A 1ENFA 1MBYA 1PTOC 3A55A 4IALA 3HOZB 4IFDG 4KMUC 4GZYC 4LMQD 5T1IA 2MUYA 1TS5A 3EFXD 2LMCB 5IGCA 2O2LD 3DEPA 1KDBA 1STNA 1FGBD 2C5CA 5K5PA 1LT6D 2SOBA 4FF3A 1YNJD 2NVQB 2F0TA 4RFBA 1QNUA 4FYDA 1A3VA 1C48A 3M7NA 1JWSD 2L0CA 1JCKB 5C44B 2AWOA 4HMIA 2TMPA 5ELEA 1PRTD 1B2TA 2VXWA 3BDCA 2PCFB 3HP3A 1JB3A 2R6GA 2Q8IB 1B4OA 3L9AX 1BBXC 1X3PA 2Z4IA 2K05A 2JA6B 1GUTA 2LS01 1AZPA 4G7OC 1PZID 1FNUA 1C4QA 1XXGA 2PQEA 4J6HA 3RZDB 3FMCA 1STGA 1RDPD 4EVOA 3DXJC 1UEAB 4Y7NB 4K5VA 1I3QB 1B1ZA 2E2HB 4IUPA 3KF8A 3P75A 1LTBD 5KRUA 2HDLA 4I7ZC 4NP5A 4RKBA 3MTSA 5A2QL 1H9SA 2TSSA 2L4NA 4X3KA 1PRTF 2KHSA 1TKWB 3R8BA 2K5DA 2Q8RE 2XNAC 1SJHD 1U9RA 4H13C 1O7ZA 2EY5A 1EL0A 1HA6A 1I4QA 4DK0A 2VUMB 1G2SA 2SDFA 1HFNA 2MP1A 3EJIA 3NQIA 3PO3B 1ZEQX 3GTMB 2ICEC 3TMEA 2E76C 4K6DA 1V1OA 2MHVA 3HOVB 4C3HG 1Y8NB 3TBIB 1G91A 2O5JC 1HXYD 2BE5C 5JVH3 1DOMA 4LAAA 3EROA 2F0EA 1WTOA 3TP7A 1MSGA 3J80E 4PNYA 5JPNC 3HG9A 4ILWA 2XRSD 3BVZA 3L7ZC 1D2BA 4J1MA 4KHVA 4R8IA 3VR4A 4B08A 1U4LA 3D3RA 1Y1WB 1JC7A 1O80A 4IN3A 1TU2B 1Y69U 4PMCA 1JWMD 4L8JA 4FF4A 1WCMB 3QJYA 2F0GA 2L5TA 1S5FD 1TR5A 3PUVA 3NTHA 1T5EA 1JR0D 4QF4A 3NSWA 1I6VC 4HR7B 1EIHA 3R2TA 2L9HA 2JXMB 3A8JE 2ID0A 1J8IA 3Q0AA 1EY5A 1Z7TA 4BY1B 1SYCA 5CR3A 1D6EC 1H9SB 1DYQA 1FNWA 5E1FA 2KCNA 2J7ZA 1ZYRC 3K5OA 4MIUA 2NTTA 3IFTA 1G6ZA 2EYHA 2PPBC 3C1FA 4XIGS 5CV8A 4N9PA 2KVMA 3KBGA 4A3GB 3VYSA 1OXSC 1WD1A 1WTPA 1UAPA 1RKNA 2XVSA 2EJGC 1GXDC 2JE6I 1Z6HA 1KNEA 5E4XA 4C3JG 3NWSA 1AZQA 1KABA 2B2TC 1BF4A 4EQNA 3HS0C 1HUMA 3QOJA 2D62A 2QF7A 2K5QA 1EQTA 2EVBA 3K57A 4G7ZC 2EYFA 3J80L 1NCVA 4Z9CB 3GTGB 2IX1A 2E2JB 3X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 A;  3EQL C;  3PUV A;  2IT1 A;  1T5E A;  4IFD G;  1DXM A;  4DNR B;  2A6E C;  3BG3 A;  3PV0 A;  4TQU S;  1A6X A;  2DNE A;  1I6V C;  2EJM A;  2F1M A;  3OPO A;  4HR7 B;  4KMU C;  2DNC A;  2E74 C;  4PV1 C;  5JEA G;  4GZY C;  1GJX A;  1VDZ A;  2NN6 I;  1OXU A;  2E75 C;  3VR2 A;  3T56 B;  3VR5 A;  2ZT9 C;  2EJF C;  4I7Z C;  5A35 A;  1K8M A;  2JXM B;  3A8J E;  2B8G A;  4KKU A;  2AUK A;  4H44 C;  4TKO B;  1LAC A;  1E2V A;  1VCI A;  1H9S A;  1Z7T A;  3D31 A;  3A7A B;  3GD7 A;  4KKT A;  4KHZ A;  2LMC B;  1K8O A;  2AUJ D;  3BDO A;  1TKW B;  1H9S B;  2A69 D;  5BN5 A;  1Q1B A;  1YNN C;  1VF5 C;  2D5D A;  3QIA A;  1QJO A;  3I4L A;  4KN4 C;  3IKJ A;  1HTP A;  3HGB A;  4JK1 C;  3U9S A;  4IQZ A;  1V43 A;  4OO1 H;  4G7H C;  2DN8 A;  4H13 C;  1GUN A;  1ZYR C;  1GUS A;  3VA7 A;  1GUG A;  3OOC A;  1H9K A;  3IFT A;  4DNT B;  1Q12 A;  2BA1 A;  1HPC A;  4DK0 A;  2EDG A;  1IW7 C;  2BA0 A;  1OXV A;  1GHJ A;  2JEB I;  1VF7 A;  3ND9 A;  1EWH A;  2BDO A;  4KI0 A;  5KND A;  3M7N A;  3AB9 A;  4DK1 A;  3M4Y A;  1FYC A;  2PPB C;  4XIG S;  1ONL A;  3M85 A;  1GHK A;  3PUW A;  1Y8O B;  3I72 A;  3TZU A;  1DD2 A;  3MXU A;  4JBW A;  4H0L C;  2E76 C;  2AWO A;  1ZKO A;  1H9M A;  2O5I C;  3I73 A;  2KCC A;  2A6H C;  3QG1 A;  2K7V A;  4XTC S;  5BN4 A;  3CRK C;  3MFY A;  2A6E D;  1BDO A;  2K32 A;  3PUZ A;  5KNC A;  3KLR A;  4OO1 G;  1OXT A;  5K36 H;  1Y8N B;  1FR3 A;  1O78 A;  1PMR A;  3W3A A;  1HQM C;  2PCF B;  3VR6 A;  2O5J C;  3SE0 A;  1OXS C;  2BE5 C;  1LAB A;  2PNR C;  2R6G A;  3A8I E;  2Q8I B;  4BA1 I;  5C0X H;  1H9R A;  2D2C C;  2EJG C;  3NE5 B;  1HCZ A;  2NN6 H;  4KN7 C;  2JE6 I;  1Z6H A;  3FPP A;  5KNB A;  1B9N A;  2V4D A;  3A8K E;  2YYZ A;  3GQB A;  1CI3 M;  1E2Z A;  2K33 A;  1Y8P B;  3SDZ A;  1CFM A;  2A69 C;  3T53 B;  3PUY A;  1GUT A;  2A68 C;  1B9M A;  3N6R A;  1H9J A;  4RCN A;  3H94 A;  1IYV A;  3ND8 A;  4G7O C;  4LJZ C;  3RLF A;  3PUX A;  2A6H D;  4OGQ C;  4LK1 C;  2JEA I;  4IFD H;  3L7Z C;  5K36 G;  2CW0 C;  1G29 1;  4BA2 I;  3FMC A;  3VR4 A;  1O7L A;  2D62 A;  3D4R A;  1YNJ C;  3CRL C;  5BN3 A;  5JEA H;  3VR3 A;  2QF7 A;  1GUO A;  1DCZ A;  2BE5 D;  5C0X G;  3OW7 A;  1IW7 D;  1TU2 B;  2NN6 G;  3LWU A;  4KKS A;  3T51 B;  1OXX K;  2EVB A;  3DXJ C;  1Y69 U;  1CTM A;  4L8J A;  4G7Z C;  1Q1E A;  3LNN A;  1E2W A;  3WDN A;  2KA7 A;  2B8F A;  3P20 A;  3A7L A;  1V8Q A;  1SMY C;  2A68 D;  3QJY A;  1IYU A;  2L5T A; 
#chains in the Genus database with same CATH topology
 4UDU C;  1IKL A;  2F0N A;  1TVX A;  4A3M G;  5COY A;  4V0B A;  1EOT A;  3KUP A;  1M8A A;  3D4W A;  4UHV A;  4JVZ A;  2R93 B;  3PO2 B;  4DUY Q;  1K83 H;  3TSS A;  1STE A;  1TS3 A;  5IGG A;  3FVQ A;  3NTK A;  2UU9 Q;  1F9S A;  2I5L X;  4QMG A;  2M2L A;  3D8G A;  4B3R L;  2XN9 C;  1F77 A;  2RSO A;  4MTN A;  1HHV A;  4JK1 C;  4XQJ A;  4CDC C;  1IBL L;  3MEF A;  2QEJ C;  3R93 A;  1C0A A;  3TQY A;  2F0L A;  1ICW A;  5EJW A;  1OXV A;  3H0G G;  5C3E B;  1B7Y B;  1JJC B;  5KND A;  4A3L H;  2H5X A;  3WOE A;  5M5W B;  3JAM i;  3M4Y A;  3M3Y B;  1AW7 A;  2B2Y A;  3I73 A;  4LF9 Q;  3HKZ B;  3AFP A;  1VQA A;  4NXM Q;  1WOC A;  3U9O A;  2NZH A;  5K36 H;  2ATW A;  2BH2 A;  3SE0 A;  4R9W A;  4A93 B;  1NMF A;  2H1E A;  1XPU A;  3QOL A;  1X32 A;  2LFN A;  1YIJ A;  1JOK A;  4YY3 Q;  3GTG H;  2E2J H;  3K7A B;  4DV6 Q;  4L5T A;  2QIL A;  1KDA A;  1GOZ A;  1SJE D;  2F0J A;  1CFM A;  2A69 C;  3J81 i;  2JA7 B;  5EPL A;  1EYA A;  4EQO A;  4AH6 A;  5IYD G;  2WAQ G;  2ZTC A;  5J39 A;  2OTL A;  2CKZ B;  2EXZ A;  1I4P A;  1X55 A;  2R93 H;  3PO2 H;  2F0Q A;  1GUO A;  1C9O A;  1TWC B;  4LF7 Q;  1S5B D;  2K6A A;  3MZ5 A;  3NPP A;  3NQT A;  4WJW A;  1N36 Q;  3LWU A;  3UDI A;  2N88 A;  2PO4 A;  4Y52 H;  1PDQ A;  4FP5 D;  2LY7 A;  4JYA Q;  4QIW E;  1CT1 D;  3UDX A;  3P20 A;  4QCL A;  3S2D H;  4JBM A;  1PYW D;  5I6Y A;  1BVS A;  3D6W A;  4B9W A;  2I0Q A;  1A15 A;  3WOF A;  4DNR B;  3H09 A;  3NBI A;  4JI2 Q;  5JJK A;  4JI7 Q;  5JEA G;  1PH6 A;  1JJ2 A;  5ELC A;  1PTO B;  4UY8 C;  2E2I H;  1VDZ A;  1V1P A;  1O7Y A;  1EY6 A;  3KLS X;  4A3B B;  2B2V C;  2K5H A;  3G6J B;  1SFO H;  5M3M B;  2EYM A;  3BVM A;  1E1O A;  2CQO A;  4Q5V A;  3AFQ A;  3DWQ A;  4KHZ A;  4XQN A;  4KY5 A;  1K8O A;  1VQM A;  1K3R A;  4F87 A;  2VW9 A;  1VQB A;  5I6W A;  4IFD I;  2ZXR A;  3FDT A;  4X66 L;  1LTR D;  3HOU B;  1ET6 A;  3ITP A;  1L1O A;  1MI2 A;  2RCF A;  3IKJ A;  1IXR A;  3TP5 A;  2C35 B;  3QWN A;  4JOI C;  2JA8 G;  2F52 A;  4DGZ A;  4KHP L;  2CW0 D;  4A93 H;  1XX8 A;  3EIV A;  2AQ2 B;  2EOT A;  3OOC A;  1TII D;  1YVC A;  1HPC A;  4R1J A;  2F03 A;  3K7A H;  1EWC A;  1L0X B;  4DR6 Q;  3CCL A;  3AB9 A;  3TS0 A;  1FYC A;  4C56 C;  3HOY G;  2KED A;  3GTL B;  1UE5 A;  1YNN D;  3AEV A;  3OW2 A;  1HJP A;  4IZ8 A;  1CA5 A;  1XYI A;  1G2T A;  3J81 j;  4NPS A;  3KDF A;  1A3T A;  2Z8L A;  4DN4 M;  2E5L Q;  1WTX A;  1S72 A;  1W6J A;  3NEN A;  4CKB A;  1OTC A;  2FHT A;  4X3T A;  4RHR A;  2DY7 A;  3GQB A;  3PUY A;  4X62 Q;  2EZV A;  2PW7 A;  3G6E A;  4OX9 Q;  3STB D;  2OTJ A;  2EYJ A;  3PUX A;  4IFD H;  1ESF A;  2NVX H;  1PTO H;  1SNM A;  5C4X B;  3S15 B;  2XIW A;  4BA2 I;  5F2D A;  3D4R A;  1YNJ C;  1K8G A;  1KQS A;  1TY2 A;  3I90 A;  5M3M H;  1IZ6 A;  3OW7 A;  1JOO A;  3S1M B;  1DGS A;  4CJ2 C;  1OXX K;  4A3D B;  2N55 A;  1SMX A;  3HOW H;  3J7A V;  3GV3 A;  1B44 D;  5C3X A;  4DV1 Q;  3C46 A;  3RD4 A;  1V8Q A;  1AE3 A;  2VNU D;  2KQ3 A;  1QG7 A;  5EPJ A;  4L5S A;  3VYT A;  4AYB B;  2UUA Q;  3U58 A;  2Q2I A;  1XTD A;  2EJM A;  3OPO A;  2R92 H;  3D6C A;  1QWY A;  4MHE A;  4DA2 A;  2EJF C;  3C1E A;  2RDF A;  1K8M A;  2NVT H;  4KKU A;  2EE1 A;  2ZJR A;  5CBA E;  3GTL H;  2R7Z G;  2RCN A;  3U50 C;  3CCR A;  1NNX A;  3J7Y W;  1H95 A;  5FLM G;  1QVC A;  2JA5 G;  1QJO A;  1BCP D;  4QY7 A;  2B3G A;  1NJI C;  2MPM A;  3RUZ A;  5JPM C;  1RTN A;  1D8L A;  2X6G A;  1JB7 A;  1SRU A;  1HR0 Q;  1JMC A;  4OWT B;  2YU9 H;  1D5X C;  2BDO A;  1N9W A;  1BOS A;  2PZU A;  4APV A;  3RMH A;  4EQ5 A;  3I4M G;  3CCU A;  5ISR A;  3NK9 A;  1VQI A;  1EEI D;  2KCM A;  4ZKC B;  2RDH A;  2CHB D;  4MN3 A;  4ZAI A;  1SAP A;  1PFS A;  1R4P B;  3GTQ B;  1MHW C;  3MFY A;  4H02 A;  4DUY L;  1TWG B;  4OO1 G;  1LT5 D;  1N33 Q;  1CHP D;  3S1M H;  3FKI H;  2UU9 L;  4C3H B;  4A3D H;  4OON A;  4YCV A;  1VQD A;  4QUC A;  1JE5 A;  3MXP A;  4F7X A;  3A5Z B;  3RN5 A;  4B3T L;  1VQE A;  3W1G A;  4DAM A;  4O0A A;  3TEH B;  1HZA A;  2A68 C;  4RCN A;  2F3V A;  3M4P A;  4LK1 C;  1R9T B;  1B8A A;  4DNI A;  2F3I A;  2MQH A;  5HGT A;  4DR3 Q;  1EFI D;  1G29 1;  5FJ8 G;  1Z47 A;  3A5U A;  4A3K G;  4C3I G;  4GN4 B;  4BY7 H;  1DCZ A;  1DOK A;  5LL6 X;  2HHH Q;  5C0X G;  4C2M H;  1IW7 D;  1A62 A;  1BCP F;  2P5Z X;  1DZ1 A;  1SND A;  2AKW B;  3BZK A;  1E2W A;  5M5X B;  3X3M A;  3CCM A;  4NXM L;  2X6L A;  2KA7 A;  2QEX A;  2B8F A;  3SR1 A;  4EX5 A;  1EFW A;  1SMY C;  3ZJY C;  1BUV T;  5IP9 G;  1DXM A;  1JWU D;  1EY0 A;  1L2F A;  2B39 A;  3I4N B;  2EY2 A;  2YTV A;  2K52 A;  4IPC A;  2AWN A;  4JI3 L;  3ULP A;  1I4G A;  4YY3 L;  4NKL A;  3VR5 A;  3T16 A;  4RHS A;  3L3O C;  2ZT9 C;  3UE1 A;  4RG1 A;  2NZO A;  5FOB B;  3J7A 5;  1I6H B;  1IBL Q;  3GTK H;  4KJN A;  1UE7 A;  1ILQ A;  5CGK A;  3PIO 3;  3A7A B;  1BQQ T;  1I4R A;  1R4Q B;  3PSI A;  4ZK9 B;  5KYL A;  3MVV A;  1RHP A;  3K6O A;  4A3I B;  3E0E A;  1TWF B;  2D5D A;  1TWG H;  3J81 c;  3QIA A;  4QB4 A;  1RF2 D;  4LF7 L;  3OTO L;  1Q8K A;  3H6M A;  3DUZ A;  1N36 L;  3MXG A;  1V43 A;  3SK5 A;  4C3H H;  2XWB B;  1GUN A;  2M00 A;  4BY7 G;  1QIL A;  2EDG A;  3G71 A;  4F88 A;  1X9N A;  4M1U B;  2Q8T A;  5I4D A;  4DK1 A;  1TS2 A;  4B3M L;  2K5V A;  1XWE A;  2BDN A;  1EIF A;  4JI2 L;  4K8I A;  1WD0 A;  3I2Z A;  1GKH A;  4A3F H;  3K5M A;  5KYI A;  2A6H C;  3QG1 A;  5KIX A;  3CC7 A;  3C3L A;  2BOS A;  3O13 A;  4AQY L;  1FR3 A;  4DV7 Q;  3NTI A;  4DKA C;  3VR6 A;  1AN8 A;  4XQQ A;  3HKS A;  1EQQ A;  2ZXP A;  2I07 B;  4BA1 I;  4DXF A;  5M5X H;  1M4V A;  1QE6 A;  2F0M A;  1D1K A;  3BYT B;  4IUR A;  3GTO B;  2A73 B;  3FP9 A;  3FEW X;  3HOZ G;  2K33 A;  1PA6 A;  3T1Y Q;  1B9M A;  3I4N H;  2B2U C;  1STH A;  3T1H Q;  4HCS A;  3N52 A;  4WRD A;  5CYU A;  3GDE A;  4A3J B;  5BN3 A;  1I6H H;  3K5N A;  3EA6 A;  1YI2 A;  4DR6 L;  2I46 A;  2PZW A;  4F8M A;  3AMU A;  1I94 Q;  1JOQ A;  1YJ9 A;  2VS1 A;  2JN4 A;  3OIQ A;  2KHI A;  1TWA B;  1ENA A;  3S2H H;  3J80 c;  4A3I H;  1BXT A;  2IPK D;  1HQR D;  1TWF H;  1PZK D;  1X3E A;  4YCW A;  3M4O B;  2OT2 A;  2J4X A;  3EVQ A;  2L55 A;  1CM9 A;  1RCV D;  2E5L L;  3I91 A;  1A6X A;  4TQU S;  1MJC A;  2F1M A;  2DNC A;  4X66 Q;  4GKK L;  1SE4 A;  1QZH A;  3VR2 A;  4BBS B;  3T13 A;  1SN8 A;  4A3M B;  2SEB D;  5C44 G;  1AP0 A;  2IW3 A;  4X62 L;  4WOR A;  2HDM A;  3SHL A;  4BBR H;  2C9O A;  3Q23 A;  1HUN A;  1EU4 A;  3BDO A;  2MFI A;  1DJR D;  1UE6 A;  1ZXT A;  1FGU A;  2F0O A;  2B2W A;  1STY A;  3OMC A;  1GO3 E;  4JOI A;  4A3E H;  2NVY B;  2QCP X;  4LF6 L;  1PV4 A;  1SEB D;  4DV1 L;  5I9O A;  2JEB I;  3GTO H;  2NZ1 D;  2Z4H A;  2LXK A;  4P72 A;  2JA6 G;  4C3J H;  4IOC A;  1X3Q A;  2AQ1 B;  3F2B A;  1NR4 A;  2UUA L;  3GP7 A;  3PUW A;  2GVA A;  1ZKO A;  5ELO A;  2Y0S E;  4A3J H;  1XMO L;  2Z0S A;  2E2D C;  2L11 A;  2PW5 A;  1J6Q A;  1LT4 D;  2RHS B;  1OXT A;  3GTP H;  2IJ0 A;  3DWP A;  4YWK A;  1ENC A;  4PMB A;  4K5W A;  5D3I B;  5BR8 Q;  2A74 C;  3A8I E;  4KY6 A;  1PYS B;  5IYB G;  3F1Z A;  3NE5 B;  1VMC A;  1EZ8 A;  4IUT A;  4PZ6 A;  1LTS D;  3BYY B;  1K83 B;  2EQS A;  1E2Z A;  2VY3 A;  2RQX A;  1X54 A;  2HT1 A;  1BR9 A;  1JIC A;  1YBY A;  3BDL A;  4RKL A;  1KC8 C;  3NXW A;  5G3L D;  3KJO A;  3PF5 A;  4A3M H;  3W5O A;  5C6A A;  2BE5 D;  3MEH A;  5C4J H;  5GAH C;  4CDD C;  1U4M A;  2NN6 G;  1Y1V G;  5DM7 3;  4A75 A;  1Q3L A;  4DR4 L;  3WDN A;  1GUW A;  2KBN A;  2NTS A;  1N33 L;  2F0I A;  2IT1 A;  1KRT A;  2WAC A;  3PV0 A;  2NVY H;  2DUD A;  2PZT A;  4LUZ A;  4RA8 A;  3S1N H;  4BS9 A;  3S16 B;  1MJE A;  4OWW B;  1KLU D;  1OXU A;  4HTH A;  3PO3 G;  3CPF A;  4KY7 A;  4H44 C;  3H0G H;  3TP6 A;  1SE3 A;  4DV5 Q;  1X3F A;  4DR3 L;  3NP8 A;  1TS4 A;  4PMW A;  3CQZ H;  2ENB A;  3T4A C;  1VMP A;  1TT2 A;  2HHH L;  4JI0 L;  2WB1 E;  4DF7 A;  3TZD A;  2FXQ A;  2NBF A;  3K5L A;  4C1N I;  3LX0 A;  2JA8 B;  1H9K A;  1VQK A;  1EUJ A;  1GVP A;  4IFD J;  2G9H D;  2CVR A;  2ZJQ A;  4B9X A;  4JI5 Q;  5G3L F;  2KEE A;  1CHQ D;  3I72 A;  1D7Q A;  3AU7 A;  3MXU A;  1A2U A;  4NB3 A;  5IYD H;  4B3T Q;  4EGV A;  2A6E D;  3S2D B;  5AFW A;  2XSC A;  1Y1W G;  5C3W A;  4O2D A;  2N49 A;  4DV3 Q;  2OWO A;  3Q24 A;  3M9B A;  4DK6 C;  3L2P A;  4HSP A;  3RLO A;  3IRB A;  1VQ9 A;  1WCM G;  2E2I B;  1VQF A;  2K5W A;  4LF5 Q;  3E5S A;  3HOX G;  2CCZ A;  3BS1 A;  1ROD A;  3HEJ A;  3CPW A;  4FXG C;  1SFO B;  3OMG A;  3DM1 A;  3N6R A;  3F8T A;  1IYV A;  4ZRZ A;  3K0Y A;  3S16 H;  1FD7 D;  4G57 A;  1UE1 A;  2CW0 C;  4NDX A;  1RJT A;  5JEA H;  1JT8 A;  2FJ2 A;  1CZG A;  4QQB X;  2Y0S G;  1BO0 A;  5C4Z A;  2QDB A;  4JI3 Q;  2KJX A;  3SK6 A;  2WV6 D;  3NHH A;  1UWV A;  1PFM A;  2EPB A;  1VQP A;  4DV7 L;  2RDG A;  2F0K A;  3SK4 A;  1Q90 A;  3EQL C;  1A2T A;  1LUZ A;  2WFW A;  3PIO A;  2JA8 H;  1A3U A;  3OWE B;  4PV1 C;  5GAG C;  1KLG D;  3DMU A;  1HNZ Q;  4MNO A;  5COR A;  3LGJ A;  3DEO A;  3OTO Q;  4U67 3;  1SNC A;  1PRT B;  2AUK A;  3T1Y L;  2IL8 A;  1LAC A;  2VQE Q;  4MTK A;  5IGF A;  3T1H L;  3HOY H;  1VQ6 A;  2VL6 A;  3H3V H;  4A3G G;  4CHT B;  1VF5 C;  2BH8 A;  4OIK A;  3STB C;  3I4L A;  5IIF A;  1HZC A;  3S1Q H;  1I94 L;  4B3M Q;  3KLW A;  4JI4 L;  2DN8 A;  3CU7 A;  2F3W A;  2JP1 A;  2NVX B;  1D1I A;  1CUK A;  3MWY W;  1LLR D;  2BA1 A;  1PH1 A;  3PMF A;  2M9V A;  1HZ9 A;  3C2P A;  3CCQ A;  2BA0 A;  4QIW B;  2MJ8 A;  3TDQ A;  1SYE A;  3PIP 3;  1VF7 A;  4AQY Q;  3UI2 A;  2KHJ A;  4X64 L;  3Q22 A;  1ONL A;  4OHJ A;  5IGB A;  4XXE A;  3I4M B;  4P2C B;  2Q2H A;  1SYB A;  3HOW B;  1CQV A;  4HED A;  1NMG A;  2K14 A;  2SNS A;  1B70 B;  4YCU A;  4DPG A;  3CME A;  2Z6K A;  1II3 A;  1HR0 W;  3S1R B;  4LFB L;  5HGQ A;  4A3C G;  1M90 C;  1PFB A;  2R92 B;  2D2C C;  5C4H A;  3J80 i;  2CWA A;  3A8K E;  1SDF A;  3H3V C;  2IY5 B;  1RD9 D;  2NVT B;  2WB1 G;  2K04 A;  1CI3 M;  3OWF A;  3OHX C;  5DLQ E;  1EIY B;  3W2D A;  1STB A;  3IL8 A;  1Y14 B;  1BCP C;  1JOR A;  3DM3 A;  4LJZ C;  4UAI A;  1M1K C;  3ICE A;  5ELB A;  4U68 A;  3M7G A;  3DWA A;  1BBW A;  4DV4 L;  1O7L A;  1S5D D;  2ZXO A;  1WTW A;  3HFZ B;  1QOH A;  1KTK A;  4C3I B;  3LWE A;  2UUB L;  1XNQ Q;  5CV9 A;  4GKK Q;  2R7Z H;  2JYO A;  3I8Z A;  3GTJ B;  2YU9 B;  1FNV A;  4ZYS A;  1KXL A;  2A5H A;  2F0U A;  2H4O A;  1DOL A;  2EYO A;  2FFK B;  4QL5 A;  5FLM H;  2JA5 H;  2AHO B;  2G9D A;  5BR8 L;  2N78 A;  4RMF A;  3NEL A;  4KD3 A;  2IX3 A;  2IHF A;  4GOP C;  1EY8 A;  1YEZ A;  1CK1 A;  5FLX E;  5AJ3 Q;  4QJF A;  1HFG A;  5C0X I;  2E74 C;  2B63 G;  1F2L A;  2ASB A;  4LNQ A;  3VA5 A;  1F9P A;  1NTG A;  5LMN L;  1I4H A;  3K7U C;  3FKI B;  3D4D A;  4LW1 A;  3D31 A;  4DV0 L;  3GD7 A;  4IUQ A;  3I4M H;  4LF6 Q;  4LFA Q;  5IGD A;  3KK7 A;  2K75 A;  3P1H A;  4FNF A;  1AH9 A;  4FVM A;  4HJA A;  4WJ3 M;  4WFN 3;  1HTP A;  3E0J A;  3HGB A;  5DNF A;  3V96 A;  3S1R H;  1YZ6 A;  1E3P A;  3KF6 B;  4OO1 H;  4YHH Q;  1PRT C;  2X69 A;  5EKL A;  4GNX C;  3E6Z X;  4IO9 A;  4AYB E;  1W6K A;  1IL8 A;  1C8C A;  1D5Z C;  4DAY A;  1XMO Q;  1EEF D;  2KCT A;  4DNT B;  3MHB A;  2QDL A;  1IW7 C;  4CDE C;  4BY7 B;  2JA7 G;  2ALY B;  1U4R A;  4C2M B;  4IJL A;  4XYQ A;  5D3D A;  1FVI A;  5IE8 A;  5ELD A;  3NEM A;  1SNO A;  2D9U A;  3PCO B;  3RZO H;  1H9M A;  4V19 0;  1I5F A;  3ULL A;  2K03 A;  5IY0 A;  1CSQ A;  1T5X D;  1XTC D;  2RVL A;  2HQE A;  5FJ8 H;  1ET9 A;  1QVG A;  4A3K H;  4C3I H;  1F2M A;  4QUF A;  2YV5 A;  2PNR C;  2PQA A;  3A54 A;  4DV5 L;  5C0X H;  3VDY A;  4IOA A;  2KEC A;  4GS3 A;  2K28 A;  3GTJ H;  3FPP A;  4G4K A;  4ABN A;  5M3F H;  1SXT A;  4CKE A;  1YHB A;  3GTK B;  3J7Z C;  1TY0 A;  4X3U A;  1LTI D;  3ND8 A;  2L12 A;  5IP9 H;  4DU9 A;  3FRP B;  1LYL A;  5IGE A;  4DR4 Q;  5C5M A;  3VYR A;  5FO9 B;  4ZLT F;  4XDX A;  1K9M C;  2MO0 A;  5DM6 3;  5M9O A;  4JI5 L;  2R3Z A;  3SGI A;  2JA9 A;  3T51 B;  3CC2 A;  2CFM A;  1CTM A;  2CH4 W;  3HRZ C;  3LNN A;  3HOU G;  4DR7 L;  1BNZ A;  4JG2 A;  3GV6 A;  4TKO B;  2UXC Q;  5DAU A;  2Z9H A;  3S14 B;  4DV3 L;  5IOC A;  4I65 A;  4XT1 B;  3TS2 A;  1IBK L;  4BXX G;  2B2T A;  4NW2 A;  4A3F B;  3F2U A;  4LF5 L;  1CSP A;  2WKD A;  5J3B A;  2MGS A;  3T56 B;  2NWG A;  5A35 A;  4HJ7 A;  4DXG A;  2B2Y C;  4JI0 Q;  4RGT A;  3S17 H;  1EY7 A;  2F0F A;  1Q8I A;  4KKT A;  3ULJ A;  1QNK A;  1K28 A;  2HD3 A;  3I70 A;  4HCE A;  4KD4 A;  5M3F G;  4ALP A;  1ESR A;  1ML0 D;  4O1N A;  1WJJ A;  2A1A A;  4KJO A;  4GN5 A;  4FXD A;  1VQN A;  4CJ1 B;  4CJ0 B;  5EPK A;  4G7H C;  5FK9 C;  3D0F A;  5FLX L;  1GUS A;  2RHQ B;  3VA7 A;  1DM0 B;  2DJG C;  2VB3 X;  5HUR A;  1Q12 A;  4DAY B;  2DGY A;  1NUC A;  2A19 A;  4RWS C;  3JAM E;  3CCV A;  5KGU A;  3HOZ H;  4K2L A;  1CQF A;  3WWV A;  5EKI A;  4EQP A;  4N9T A;  3S2H B;  5C4X G;  1SNQ A;  4L6T B;  1PTO D;  1HNZ L;  2PMZ B;  1G51 A;  4P74 A;  3CRK C;  4BWG B;  1K0S A;  2F0P A;  4RH6 A;  1T9H A;  3KLR A;  1WTQ A;  1A63 A;  4J15 A;  2JJQ A;  4R4I A;  2VQE L;  1X56 A;  4YIJ A;  3URY A;  4AIM A;  3EBE A;  5E4W C;  5FO8 B;  2J0T D;  2PQA B;  2V4D A;  2YYZ A;  3CHB D;  3TRE A;  1NSN S;  1V9P A;  2HQL A;  4AYB G;  5JOB A;  3S14 H;  4M8A A;  3V05 A;  3J81 E;  3IAY A;  2QKI C;  4BBR B;  1W2B A;  5GAE C;  1XPR A;  2NVQ H;  1SE2 A;  1CKM A;  2LKV A;  1LTG D;  1F2Y A;  5C44 H;  5JAV A;  5E3F A;  1YNX A;  1KRS A;  4A3E B;  3CF5 A;  4XT3 B;  1WTH A;  1IBM Q;  1X65 A;  4JI6 L;  1L1O C;  1FL0 A;  1Y1V B;  4OIJ A;  2A68 D;  1WFQ A;  2EIF A;  1HTL D;  4C3J B;  5CC4 A;  5ELF A;  1WVL A;  1UNS A;  1YJW A;  2Q2T A;  4NXN Q;  1B53 A;  1J9O A;  1TWH B;  1Q7Y C;  3M4Q A;  1KHI A;  2NN6 I;  2UUC Q;  4HN7 A;  1KIX A;  3GTP B;  4KTA A;  1PTO F;  1OO9 B;  3OIP A;  4JI4 Q;  2JA6 H;  1MD2 D;  3BZD B;  1X6O A;  1SMY D;  1NAP A;  5BN5 A;  3RZD H;  1Q1B A;  3PIP A;  2ICI A;  4KN4 C;  2F0S A;  1G8Z D;  4X64 Q;  5CV6 A;  3RR5 A;  5H1S E;  3U9S A;  1FJG Q;  2XTI A;  4Q0F A;  1O7I A;  1XNQ L;  2FMC A;  2WKC A;  4HID A;  1GUG A;  4R4C A;  4L63 B;  1E22 A;  4YWL A;  5IYB H;  2HCC A;  2OXP A;  3AQQ A;  1I3Q H;  1S5C D;  2PYK A;  5C4J B;  2E2H H;  4LFB Q;  2VB2 X;  3Q6S A;  2F4I A;  5JEA J;  2B2V A;  1EOV A;  2CQA A;  5GAD C;  1E0B A;  1NR2 A;  4H0L C;  5AJ3 L;  2O5I C;  4UP8 A;  1ILP A;  2A8V A;  4DAP A;  3L0O A;  3RN2 A;  2RA4 A;  2EYP A;  1S3O A;  3S1N B;  1VQH A;  4LFA L;  2KEN A;  4HIM A;  3KBX A;  2IWH A;  4JBK A;  2NN6 H;  1LT3 D;  1Y1V H;  4DV4 Q;  1N32 Q;  5KNB A;  1KNA A;  2Q2U A;  1C7Y A;  3H0G B;  3HOX B;  3SDZ A;  3T53 B;  3JAM L;  4YHH L;  2UUB Q;  5CBE E;  4CDF C;  5JJZ A;  4TSS A;  4UPA A;  1TWH H;  3KFU A;  2A6H D;  2JEA I;  3KF8 B;  3CCS A;  3CQZ B;  1JE4 A;  2Z1C A;  4N8F A;  2PNH A;  2DY8 A;  5FKA C;  4LFC Q;  1F2Z A;  3OSO A;  3A56 A;  5IWA Q;  2L1B A;  2R7F A;  2G5D A;  5EGT A;  3PO3 H;  2D0O A;  5CV7 A;  3K0X A;  3CP0 A;  5J22 A;  3NWT A;  2Y0S B;  3K58 A;  2QGQ A;  1QVF A;  3A7L A;  5LMN Q;  1IYU A;  3BVG A;  4DR2 Q;  4RCO A;  2KOL A;  3CW2 C;  3J81 L;  4DV0 Q;  4FO2 A;  1E7Z A;  4S3S A;  2A6E C;  4J8Q A;  4YWM A;  3RLN A;  1LO5 D;  2Z6B A;  3K8A A;  1VQJ A;  2WAQ B;  5IP7 G;  3ER0 A;  3I3C A;  3PGZ A;  2LXJ A;  1K8A C;  1S40 A;  1YIT A;  3QO2 A;  1B50 A;  5JVG 3;  3W1B A;  2OQK A;  1EYD A;  2F4V L;  1GD7 A;  1EQV A;  1SYG A;  1F9Q A;  4X3S A;  3H15 A;  5EBC A;  4IQZ A;  1I50 B;  2I5M X;  4CKC A;  1Y1W H;  1PYB A;  2VUM G;  4HJ9 A;  5FO7 B;  5NUC A;  4K5X A;  1WCM H;  2OF1 A;  2WIN B;  2UXC L;  1STA A;  3HOX H;  4ZUI A;  3H91 A;  5EBD A;  3CC4 A;  3M85 A;  1GHK A;  1S5E D;  4RGM A;  5LL6 S;  1N8R C;  1DD2 A;  2F0V A;  3QR8 A;  4JBW A;  2RF4 A;  5EQ0 A;  3HOV G;  2KCC A;  5CV5 A;  4ODG A;  4POF A;  5I9P A;  1BDO A;  2K32 A;  1WTV A;  1RL2 A;  1PXU A;  3G7L A;  1N34 Q;  4RAU C;  4QGU A;  1LAB A;  1LTT D;  3SVM A;  1VS0 A;  1VQG A;  3CCE A;  1VQ4 A;  1H9R A;  4JI8 Q;  3SXH A;  1SNP A;  1CA6 A;  1WTR A;  1B9N A;  3K81 C;  4GLV B;  1TQO A;  1HZB A;  2BCO A;  3I4O A;  5IT9 E;  3J7A F;  1SSO A;  3DHQ A;  1CKN B;  4ZCK A;  4HAE A;  4KV6 A;  2AMC B;  1H9J A;  1AEX A;  2WB1 B;  1A8V A;  3HOY B;  1B3Q A;  3RLF A;  1HA5 A;  1XMQ Q;  3K80 C;  1EYC A;  1Q82 C;  4BBS G;  4DR7 Q;  3MFG A;  5J1Z A;  2ZTE A;  5I2Y A;  2OEO A;  4ZUJ A;  3CRL C;  1ZYR D;  3CCJ A;  2ES2 A;  3S1Q B;  2OCE A;  4ID6 A;  1QUQ A;  1BCP B;  4IUV A;  1J5E Q;  1IBK Q;  4KKS A;  4B3S Q;  4R8N A;  1PFN A;  3H3V I;  5IOD A;  1QZG A;  1IHZ A;  4A3G H;  4H7B A;  3AYH B;  4C1N K;  1VQC A;  2EYL A;  1PHJ A;  1I50 H;  1EYG A;  4PG3 A;  2HIX A;  3BG3 A;  4LF8 L;  1EIG A;  3HZX A;  3G4S A;  3HKZ E;  5C5L A;  2E75 C;  2AQ3 B;  5M5Y B;  4GOP B;  1X3G A;  2B63 B;  4BY1 G;  1EY9 A;  4K2K A;  2DJF C;  4K14 A;  1E2V A;  1VCI A;  3R2I A;  4JI1 L;  1L0Y B;  4FXK C;  2YTY A;  4DV2 Q;  2UXD L;  5C0X J;  1YNN C;  3V2T A;  2NYZ D;  1MSH A;  4P71 A;  1HNX Q;  1PLF A;  3TP8 A;  1KAW A;  2HIV A;  1SRO A;  2CWP A;  3CKI B;  4ME3 A;  1IBM L;  1PZJ D;  4A3C H;  4LF4 Q;  3ND9 A;  4KI0 A;  4GNX B;  2V1C C;  2NUC A;  2K1B A;  3EN2 A;  1EZ6 A;  1G6P A;  5TSS A;  2UXB Q;  1EY4 A;  4NXN L;  1Y8O B;  4I7A A;  3TZU A;  4FF2 A;  2K5N A;  1QCB D;  4IUU A;  2R7Z B;  2F0W A;  2YTX A;  4WJ4 A;  1LTA D;  2F0D A;  2K01 A;  3BZC A;  3KF6 A;  5CV4 A;  3MXN A;  2UUC L;  1S4Z A;  2NB0 A;  4XTC S;  4DR1 Q;  5KNC A;  2EY1 A;  2O4X A;  2JA5 B;  3CXC A;  4RGO S;  5D14 A;  3CAM A;  4K8J A;  2SNM A;  1EQR A;  5EKK A;  4LUV A;  4CGY B;  4KN7 C;  4KK7 A;  4A3L G;  3G48 A;  3U4Z A;  4O42 A;  1Y8P B;  3ERQ A;  1FJG L;  4RGN A;  4PQX A;  3KLS A;  1IKM A;  2WII B;  3CMA A;  5KEE A;  4JI6 Q;  5K36 G;  3TN2 A;  5M5Y H;  2N8N A;  3VR3 A;  3IFD A;  2B63 H;  5C3E H;  3MAQ A;  1KAA A;  5M5W H;  2F0H A;  2EY6 A;  1AFP A;  1RTO A;  3M3Y H;  3NBH A;  3QB3 A;  1QUQ B;  4HSV A;  1SYD A;  4LWC A;  4K6L A;  2K4K A;  4XYO A;  4GLA C;  5IYC H;  4NMZ A;  3VYU A;  5IT9 L;  1CZW A;  3K59 A;  2VQF Q;  5I2X A;  1MIU A;  2B2W C;  5LMU Q;  4OO1 I;  1MGS A;  1QB5 D;  3TRZ A;  5JJI A;  3I55 A;  3RZO B;  2JSO A;  1HNW Q;  2B2U A;  1XNR Q;  1LV9 A;  2DNE A;  4CBV A;  2R93 G;  3PO2 G;  1N32 L;  1GJX A;  2QW7 A;  1PH5 A;  4A3K B;  1Q86 C;  2B8G A;  2FIN B;  3OYY A;  2R61 A;  3Q8D A;  4DFA A;  2JA7 H;  3U4V A;  1BKB A;  3R3O A;  4JV5 Q;  1KDC A;  1UUP A;  2AUJ D;  1I4X A;  4IUN A;  2WP8 J;  1K73 C;  2A69 D;  4HMJ A;  4LFC L;  1B3A A;  5M3F B;  4A76 A;  5IWA L;  1P16 A;  1HRJ A;  2MO1 A;  1TWC H;  3S9W A;  5D65 A;  5FLX c;  4ZKB B;  4OL7 A;  1SBB B;  4DAV A;  2ZM6 L;  5C3E G;  1JJG A;  1EU3 A;  2OQ0 A;  3GO5 A;  4JBJ A;  1GHJ A;  3MA2 B;  4TRD A;  1EWH A;  4DR2 L;  3NUC A;  1DON A;  2E8G A;  2FMM A;  2RKS A;  2RBM A;  5IYC G;  3HKZ G;  1JQY D;  1ICF B;  2HCI A;  3SEB A;  3I56 A;  4E6I A;  2K7V A;  3ONA B;  5LHY 1;  5BN4 A;  3PUZ A;  1EWI A;  4A93 G;  2LSS A;  3P7J A;  1O78 A;  1PMR A;  2XWJ B;  1HQM C;  3MXN B;  3W3A A;  4A3B H;  1U4P A;  2IX0 A;  5T1G A;  5DEH A;  1F9R A;  3F2C A;  1HCZ A;  3MC0 B;  5GRO A;  3FHW A;  3HOU H;  3S17 B;  2PI2 A;  1SYF A;  5CMD A;  1PH4 A;  4K0K Q;  3FPU B;  2XRQ D;  3H94 A;  2KUM A;  4DR5 Q;  4OGQ C;  4ZQ3 A;  5JJL A;  1NBW A;  1XPO A;  4BXX H;  1RIP A;  4L5Q A;  2GA4 B;  2RSN A;  3BU2 A;  4FF1 A;  4ME5 A;  3ZYY X;  2HUG A;  1LTL A;  1NE3 A;  5A2Q E;  1V1P B;  4IPH A;  4ULL A;  1Q1E A;  4GKJ Q;  3A0J A;  3NBH B;  1D5M C;  3SK8 A;  1ENF A;  1MBY A;  2IHE A;  1PTO C;  1N34 L;  3A55 A;  1AE2 A;  4IAL A;  3HOZ B;  4IFD G;  1ASY A;  1L1O B;  4JI8 L;  1PH3 A;  2F4V Q;  4KMU C;  4GZY C;  4LMQ D;  5T1I A;  4DUZ L;  4A3B G;  2MUY A;  1LM0 A;  4IPG A;  5M3M G;  2EXD A;  1PH9 A;  4R4Q A;  1TS5 A;  1Q81 C;  1Q46 A;  3HOW G;  4HJ8 A;  3EFX D;  2LMC B;  5IGC A;  2O2L D;  4UP9 A;  1XMQ L;  3DEP A;  1KDB A;  1PH2 A;  1STN A;  1YHA A;  1KD1 C;  4PZ7 A;  1FGB D;  2C5C A;  2VZA A;  5E7N A;  5C4X H;  5K5P A;  3S15 H;  1LT6 D;  1UEB A;  3E9I A;  2JQO A;  1J5E L;  2SOB A;  1ASZ A;  4OEM B;  4B3S L;  2R92 G;  4IJH A;  4X65 Q;  4FF3 A;  1YNJ D;  5EAY A;  2NVQ B;  4JPB W;  1W3S A;  2F0T A;  4RFB A;  1QNU A;  4FYD A;  3KDF B;  1A3V A;  1C48 A;  3M7N A;  4OXP A;  1JWS D;  2ZJP A;  2L0C A;  1JCK B;  5C44 B;  3E9H A;  2AWO A;  4TVA B;  5HY6 A;  3I7F A;  4HMI A;  3S24 A;  1MKH A;  2TMP A;  5ELE A;  3F2D A;  2I5H A;  1PRT D;  1PVO A;  1B2T A;  2VXW A;  3BDC A;  4MZ9 A;  2QA4 A;  2PCF B;  3HP3 A;  1JB3 A;  2R6G A;  3RNU A;  2Q8I B;  1B4O A;  3L9A X;  1BBX C;  4DV2 L;  1VQ8 A;  5ELN A;  3UDG A;  4LF9 L;  1X3P A;  2Z4I A;  1HNX L;  3JAM c;  2K05 A;  1SE8 A;  2JA6 B;  1GUT A;  1A0I A;  2LS0 1;  1AZP A;  4G7O C;  1PZI D;  4GN3 B;  1FNU A;  1C4Q A;  1XXG A;  2PQE A;  4LF4 L;  4J6H A;  3RZD B;  4B3R Q;  2PI2 E;  1VQ7 A;  1V1Q A;  3FMC A;  2PMZ E;  1STG A;  4DV6 L;  3FKI G;  4FDB A;  2UXB L;  3BJU A;  1RDP D;  4R4O A;  4DK3 C;  4A3D G;  1KL9 A;  4EVO A;  1VQ5 A;  3DXJ C;  4LF8 Q;  1UEA B;  4Y7N B;  4K5V A;  1IYJ B;  3GTQ H;  4DR1 L;  1I3Q B;  1SR3 A;  1B1Z A;  1BBU A;  4OWX B;  4IUP A;  2E2H B;  2MNA A;  2GVB A;  3UE0 A;  1P8L A;  3KF8 A;  4A4I A;  4X6A H;  4JI1 Q;  3P75 A;  2R7D A;  1LTB D;  5KRU A;  2UXD Q;  2ZTD A;  2HDL A;  4GLX A;  4JYA L;  4I7Z C;  4NP5 A;  5LMN W;  4RKB A;  3MTS A;  5A2Q L;  1H9S A;  2TSS A;  2L4N A;  4X3K A;  1PRT F;  2KHS A;  4OEL B;  3A74 A;  1TKW B;  3R8B A;  4JI7 L;  1R9T H;  2K5D A;  1E1T A;  2Z6K C;  3PF4 A;  4P75 A;  4POG A;  3KOJ A;  2Q8R E;  2XNA C;  1SJH D;  1U9R A;  4H13 C;  1O7Z A;  2EY5 A;  1EL0 A;  1HA6 A;  1I4Q A;  4DK0 A;  3JC6 6;  2VUM B;  1G2S A;  2VQF L;  2SDF A;  4IPD A;  2MP1 A;  4PZ8 A;  1HFN A;  3EJI A;  5LMU L;  3NQI A;  3PO3 B;  1ZEQ X;  3GTM B;  2ICE C;  3TME A;  4JW0 A;  1HNW L;  1XNR L;  3CD6 A;  2E76 C;  4K6D A;  2CH4 A;  1U5K A;  1V1O A;  2MHV A;  1VQO A;  2L15 A;  3HOV B;  4C3H G;  1Y8N B;  3TBI B;  1G91 A;  1L0W A;  2O5J C;  1HH2 P;  1HXY D;  2BE5 C;  5JVH 3;  1PH8 A;  4JV5 L;  1DOM A;  4Y7N H;  4LAA A;  1WI5 A;  3ERO A;  2F0E A;  1WTO A;  3TP7 A;  1MSG A;  2JK8 A;  3J80 E;  4PNY A;  5JPN C;  1K3B C;  3HG9 A;  4ILW A;  1YJN A;  2XRS D;  4A3F G;  4L5R C;  3B6Y A;  3BVZ A;  3ERS X;  3L7Z C;  1D2B A;  4J1M A;  4JC0 A;  4KHV A;  4R8I A;  3VR4 A;  5IP7 H;  4B08 A;  1U4L A;  3D3R A;  1Y1W B;  1JC7 A;  3DLL A;  1O80 A;  4KHP Q;  4IN3 A;  1TU2 B;  1Y69 U;  1E24 A;  1JWM D;  4L8J A;  4PMC A;  4OX9 L;  4FF4 A;  1CKN A;  1WCM B;  1WYD A;  3QJY A;  4R4T A;  2F0G A;  2L5T A;  3I4N G;  1S5F D;  1TR5 A;  2XGT A;  3PUV A;  3PQI A;  3NTH A;  1T5E A;  1JR0 D;  1IL2 A;  4N8X 1;  4QF4 A;  3NSW A;  4HJ5 A;  1I6V C;  1CKO A;  4HR7 B;  1EIH A;  2VUM H;  3R2T A;  1TXY A;  4HIO A;  1YHQ A;  2L9H A;  2JXM B;  3A8J E;  4K0K L;  2ID0 A;  3GTM H;  3UDF A;  1J8I A;  3Q0A A;  1EY5 A;  1Z7T A;  4A3I G;  4BY1 B;  4DR5 L;  1Z9F A;  2ZM6 Q;  2D0P A;  1SYC A;  5CR3 A;  1D6E C;  1H9S B;  1DYQ A;  1SLJ A;  1PH7 A;  3HOV H;  1FNW A;  5E1F A;  1U0L A;  2KCN A;  2J7Z A;  1K0R A;  1ZYR C;  4GOP A;  2GN5 A;  3K5O A;  4MIU A;  4GKJ L;  1TWA H;  2NTT A;  3IFT A;  1G6Z A;  2WAQ E;  3M4O H;  2EYH A;  4BBR G;  2PPB C;  3C1F A;  4XIG S;  3KJP A;  1VQL A;  1GM5 A;  5CV8 A;  3E3X A;  4N9P A;  4LUO A;  2KVM A;  3KBG A;  1XJV A;  2K50 A;  1HR0 L;  4A3G B;  4BBS H;  4P73 A;  3VYS A;  5GQO A;  4A3E G;  4JCV E;  1OXS C;  1WD1 A;  1WTP A;  1UAP A;  4GNX A;  1RKN A;  2XVS A;  2EJG C;  2N3S A;  1GXD C;  2JE6 I;  1Z6H A;  1KNE A;  5E4X A;  5L37 A;  4C3J G;  3NWS A;  1AZQ A;  1KAB A;  2B2T C;  1BF4 A;  4X65 L;  4HIK A;  4EQN A;  4A3J G;  3HS0 C;  1HUM A;  3QOJ A;  2D62 A;  2QF7 A;  2K5Q A;  4UP7 A;  1NY4 A;  3KYH C;  1EQT A;  4BY1 H;  2EVB A;  4KLK A;  3K57 A;  4G7Z C;  4DUZ Q;  2EYF A;  3J80 L;  1NCV A;  5IT9 c;  4Z9C B;  3GTG B;  2B29 A;  2IX1 A;  2E2J B;  3X3N A; 
#chains in the Genus database with same CATH homology
 4UDU C;  1IKL A;  2F0N A;  1TVX A;  5COY A;  4V0B A;  1EOT A;  3KUP A;  1M8A A;  3D4W A;  2R93 B;  3PO2 B;  3TSS A;  1STE A;  1TS3 A;  5IGG A;  3FVQ A;  3NTK A;  1F9S A;  4QMG A;  2M2L A;  3D8G A;  2XN9 C;  1F77 A;  2RSO A;  1HHV A;  4JK1 C;  4XQJ A;  2QEJ C;  3R93 A;  2F0L A;  1ICW A;  5EJW A;  1OXV A;  5C3E B;  5KND A;  3WOE A;  5M5W B;  3M4Y A;  3M3Y B;  1AW7 A;  2B2Y A;  3I73 A;  3HKZ B;  3U9O A;  5K36 H;  3SE0 A;  4R9W A;  4A93 B;  2H1E A;  3QOL A;  1X32 A;  2LFN A;  1JOK A;  3K7A B;  2QIL A;  1KDA A;  1GOZ A;  1SJE D;  2F0J A;  1CFM A;  2A69 C;  2JA7 B;  5EPL A;  1EYA A;  4EQO A;  5J39 A;  2EXZ A;  1I4P A;  2F0Q A;  1GUO A;  1TWC B;  1S5B D;  2K6A A;  3MZ5 A;  3NPP A;  3NQT A;  4WJW A;  3LWU A;  2N88 A;  2PO4 A;  1PDQ A;  4FP5 D;  2LY7 A;  1CT1 D;  3P20 A;  4QCL A;  1PYW D;  5I6Y A;  3D6W A;  4B9W A;  1A15 A;  3WOF A;  4DNR B;  3H09 A;  3NBI A;  5JEA G;  5ELC A;  1PTO B;  1VDZ A;  1V1P A;  1O7Y A;  1EY6 A;  3KLS X;  4A3B B;  2B2V C;  3G6J B;  5M3M B;  2EYM A;  3BVM A;  4Q5V A;  3DWQ A;  4KHZ A;  4XQN A;  4KY5 A;  1K8O A;  4F87 A;  5I6W A;  4IFD I;  2ZXR A;  3FDT A;  1LTR D;  3HOU B;  1ET6 A;  3ITP A;  1MI2 A;  3IKJ A;  3TP5 A;  3QWN A;  4DGZ A;  2CW0 D;  1XX8 A;  3OOC A;  2AQ2 B;  2EOT A;  1TII D;  1HPC A;  2F03 A;  1EWC A;  1L0X B;  3AB9 A;  1FYC A;  4C56 C;  2KED A;  3GTL B;  1YNN D;  4IZ8 A;  1CA5 A;  1XYI A;  1G2T A;  1A3T A;  2Z8L A;  4DN4 M;  1WTX A;  1W6J A;  4CKB A;  2FHT A;  4X3T A;  4RHR A;  2DY7 A;  3GQB A;  3PUY A;  2EZV A;  2PW7 A;  2EYJ A;  3PUX A;  4IFD H;  1ESF A;  1PTO H;  1SNM A;  5C4X B;  3S15 B;  2XIW A;  4BA2 I;  5F2D A;  3D4R A;  1YNJ C;  1TY2 A;  3I90 A;  3OW7 A;  1JOO A;  3S1M B;  4CJ2 C;  1OXX K;  4A3D B;  2N55 A;  3J7A V;  3GV3 A;  1B44 D;  5C3X A;  3C46 A;  3RD4 A;  1V8Q A;  2VNU D;  2KQ3 A;  1QG7 A;  5EPJ A;  3VYT A;  4AYB B;  2EJM A;  3OPO A;  3D6C A;  1QWY A;  4MHE A;  4DA2 A;  2EJF C;  3C1E A;  2RDF A;  1K8M A;  4KKU A;  2EE1 A;  5CBA E;  3J7Y W;  1QJO A;  1BCP D;  2MPM A;  3RUZ A;  5JPM C;  1RTN A;  2X6G A;  1D5X C;  2BDO A;  1BOS A;  2PZU A;  3RMH A;  5ISR A;  3NK9 A;  1EEI D;  4ZKC B;  2RDH A;  2CHB D;  4MN3 A;  4ZAI A;  1SAP A;  1R4P B;  3GTQ B;  3MFY A;  1TWG B;  4OO1 G;  1LT5 D;  1CHP D;  4C3H B;  4QUC A;  3MXP A;  4F7X A;  2A68 C;  4RCN A;  2F3V A;  4LK1 C;  1R9T B;  5HGT A;  1EFI D;  1G29 1;  1Z47 A;  4C3I G;  1DCZ A;  1DOK A;  5LL6 X;  5C0X G;  1IW7 D;  1BCP F;  1DZ1 A;  1SND A;  1E2W A;  5M5X B;  3X3M A;  2X6L A;  2KA7 A;  2B8F A;  3SR1 A;  1SMY C;  1BUV T;  1DXM A;  1JWU D;  1EY0 A;  2B39 A;  3I4N B;  2EY2 A;  2AWN A;  1I4G A;  4NKL A;  3VR5 A;  3T16 A;  4RHS A;  3L3O C;  2ZT9 C;  1I6H B;  5FOB B;  4KJN A;  5CGK A;  1ILQ A;  3PIO 3;  3A7A B;  1BQQ T;  1I4R A;  1R4Q B;  5KYL A;  4ZK9 B;  3MVV A;  1RHP A;  3K6O A;  4A3I B;  1TWF B;  2D5D A;  3QIA A;  4QB4 A;  1RF2 D;  3H6M A;  3DUZ A;  3MXG A;  1V43 A;  3SK5 A;  2XWB B;  1GUN A;  2M00 A;  1QIL A;  2EDG A;  4F88 A;  4M1U B;  2Q8T A;  5I4D A;  4DK1 A;  1TS2 A;  1XWE A;  2BDN A;  4K8I A;  1WD0 A;  3K5M A;  5KYI A;  2A6H C;  3QG1 A;  5KIX A;  3C3L A;  2BOS A;  3O13 A;  1FR3 A;  3NTI A;  3VR6 A;  1AN8 A;  4XQQ A;  2ZXP A;  2I07 B;  4BA1 I;  4DXF A;  1M4V A;  1QE6 A;  2F0M A;  1D1K A;  3BYT B;  4IUR A;  3GTO B;  2A73 B;  3FEW X;  2K33 A;  1B9M A;  2B2U C;  1STH A;  4HCS A;  3N52 A;  4WRD A;  5CYU A;  4A3J B;  5BN3 A;  3K5N A;  3EA6 A;  2I46 A;  2PZW A;  4F8M A;  3AMU A;  1JOQ A;  3OIQ A;  1TWA B;  1ENA A;  1BXT A;  2IPK D;  1HQR D;  1PZK D;  3M4O B;  2OT2 A;  2J4X A;  3EVQ A;  2L55 A;  1CM9 A;  1RCV D;  3I91 A;  1A6X A;  4TQU S;  2F1M A;  2DNC A;  1SE4 A;  3VR2 A;  4BBS B;  3T13 A;  4A3M B;  2SEB D;  1AP0 A;  2IW3 A;  4WOR A;  2HDM A;  3SHL A;  2C9O A;  3Q23 A;  1HUN A;  1EU4 A;  3BDO A;  1DJR D;  1ZXT A;  2F0O A;  2B2W A;  1STY A;  3OMC A;  2NVY B;  2QCP X;  1SEB D;  5I9O A;  2JEB I;  2NZ1 D;  2Z4H A;  1X3Q A;  2AQ1 B;  1NR4 A;  3GP7 A;  3PUW A;  1ZKO A;  2E2D C;  2L11 A;  2PW5 A;  1LT4 D;  1OXT A;  2IJ0 A;  3DWP A;  1ENC A;  4PMB A;  4K5W A;  5D3I B;  2A74 C;  3A8I E;  4KY6 A;  3NE5 B;  1VMC A;  1EZ8 A;  4IUT A;  1LTS D;  3BYY B;  1K83 B;  1E2Z A;  2RQX A;  1BR9 A;  1JIC A;  3BDL A;  4RKL A;  3NXW A;  5G3L D;  5C6A A;  2BE5 D;  3MEH A;  1U4M A;  2NN6 G;  5DM7 3;  1Q3L A;  3WDN A;  1GUW A;  2NTS A;  2F0I A;  2IT1 A;  2WAC A;  3PV0 A;  2PZT A;  4RA8 A;  4BS9 A;  3S16 B;  1KLU D;  1OXU A;  4HTH A;  4KY7 A;  4H44 C;  3TP6 A;  1SE3 A;  3NP8 A;  1TS4 A;  4PMW A;  2ENB A;  3T4A C;  1VMP A;  1TT2 A;  4DF7 A;  3TZD A;  2NBF A;  3K5L A;  4C1N I;  3LX0 A;  2JA8 B;  1H9K A;  4IFD J;  2G9H D;  2CVR A;  4B9X A;  5G3L F;  2KEE A;  1CHQ D;  3I72 A;  3AU7 A;  3MXU A;  1A2U A;  4EGV A;  2A6E D;  3S2D B;  5AFW A;  2XSC A;  5C3W A;  3Q24 A;  4HSP A;  2E2I B;  2K5W A;  3E5S A;  3BS1 A;  1ROD A;  3HEJ A;  4FXG C;  1SFO B;  3OMG A;  3DM1 A;  3N6R A;  1IYV A;  4ZRZ A;  3K0Y A;  1FD7 D;  4G57 A;  2CW0 C;  4NDX A;  1RJT A;  5JEA H;  2FJ2 A;  1CZG A;  1BO0 A;  5C4Z A;  2QDB A;  2KJX A;  3SK6 A;  2WV6 D;  3NHH A;  2EPB A;  1PFM A;  2RDG A;  2F0K A;  3SK4 A;  1Q90 A;  3EQL C;  1A2T A;  1A3U A;  3OWE B;  4PV1 C;  1KLG D;  3DMU A;  5COR A;  3DEO A;  4U67 3;  1SNC A;  1PRT B;  2AUK A;  2IL8 A;  1LAC A;  5IGF A;  4CHT B;  1VF5 C;  4OIK A;  3I4L A;  5IIF A;  2DN8 A;  3CU7 A;  2F3W A;  2JP1 A;  2NVX B;  1D1I A;  3MWY W;  1LLR D;  2BA1 A;  3PMF A;  2M9V A;  3C2P A;  3TDQ A;  2BA0 A;  2MJ8 A;  4QIW B;  1SYE A;  3PIP 3;  1VF7 A;  3UI2 A;  3Q22 A;  1ONL A;  4OHJ A;  5IGB A;  4XXE A;  3I4M B;  4P2C B;  1SYB A;  3HOW B;  1CQV A;  4HED A;  2SNS A;  1II3 A;  3S1R B;  1PFB A;  2R92 B;  2D2C C;  5C4H A;  3A8K E;  1SDF A;  3H3V C;  1RD9 D;  2NVT B;  2K04 A;  1CI3 M;  3OWF A;  3OHX C;  3W2D A;  1STB A;  3IL8 A;  1JOR A;  1BCP C;  4LJZ C;  4UAI A;  5ELB A;  4U68 A;  3M7G A;  3DWA A;  1O7L A;  1S5D D;  2ZXO A;  1WTW A;  1QOH A;  1KTK A;  4C3I B;  3LWE A;  5CV9 A;  2JYO A;  3I8Z A;  3GTJ B;  2YU9 B;  1FNV A;  4ZYS A;  2A5H A;  2F0U A;  2H4O A;  1DOL A;  2EYO A;  2FFK B;  1C8C A;  2G9D A;  4KD3 A;  2IX3 A;  1EY8 A;  1CK1 A;  5FLX E;  1HFG A;  5C0X I;  2E74 C;  1F2L A;  3VA5 A;  1F9P A;  1I4H A;  3FKI B;  3D4D A;  3D31 A;  3GD7 A;  4IUQ A;  5IGD A;  3KK7 A;  3P1H A;  4FNF A;  4FVM A;  4WFN 3;  1HTP A;  3E0J A;  3HGB A;  5DNF A;  3V96 A;  4OO1 H;  1PRT C;  2X69 A;  5EKL A;  3E6Z X;  1W6K A;  1IL8 A;  1D5Z C;  4DAY A;  1EEF D;  4DNT B;  3MHB A;  1IW7 C;  4BY7 B;  1U4R A;  4C2M B;  4XYQ A;  5D3D A;  5ELD A;  1SNO A;  2D9U A;  1H9M A;  4V19 0;  2K03 A;  1T5X D;  1XTC D;  2RVL A;  2HQE A;  1ET9 A;  1F2M A;  4QUF A;  2PNR C;  3A54 A;  5C0X H;  2KEC A;  2K28 A;  3FPP A;  4G4K A;  4ABN A;  1SXT A;  4CKE A;  3GTK B;  1TY0 A;  4X3U A;  1LTI D;  3ND8 A;  2L12 A;  4DU9 A;  3FRP B;  5IGE A;  5C5M A;  3VYR A;  5FO9 B;  4ZLT F;  4XDX A;  5DM6 3;  5M9O A;  2R3Z A;  3T51 B;  1CTM A;  3HRZ C;  3LNN A;  1BNZ A;  3GV6 A;  4TKO B;  5DAU A;  3S14 B;  5IOC A;  4I65 A;  4XT1 B;  2B2T A;  4NW2 A;  4A3F B;  3F2U A;  2WKD A;  2MGS A;  3T56 B;  2NWG A;  5A35 A;  4DXG A;  2B2Y C;  4RGT A;  1EY7 A;  2F0F A;  1Q8I A;  4KKT A;  1QNK A;  3I70 A;  4HCE A;  4KD4 A;  1ESR A;  1ML0 D;  4O1N A;  4KJO A;  4FXD A;  4CJ1 B;  4CJ0 B;  5EPK A;  4G7H C;  5FK9 C;  5FLX L;  1GUS A;  3VA7 A;  1DM0 B;  2VB3 X;  5HUR A;  1Q12 A;  1NUC A;  4RWS C;  3JAM E;  5KGU A;  4K2L A;  1CQF A;  5EKI A;  4EQP A;  4N9T A;  3S2H B;  1SNQ A;  4L6T B;  1PTO D;  2PMZ B;  3CRK C;  4BWG B;  2F0P A;  4RH6 A;  1WTQ A;  3KLR A;  4YIJ A;  3URY A;  5E4W C;  5FO8 B;  2J0T D;  2V4D A;  2YYZ A;  3CHB D;  1NSN S;  5JOB A;  4M8A A;  3V05 A;  3J81 E;  3IAY A;  2QKI C;  4BBR B;  1SE2 A;  2LKV A;  1LTG D;  1F2Y A;  5JAV A;  5E3F A;  4A3E B;  4XT3 B;  1Y1V B;  4OIJ A;  2A68 D;  1HTL D;  4C3J B;  5CC4 A;  5ELF A;  1WVL A;  1UNS A;  1B53 A;  1J9O A;  1TWH B;  2NN6 I;  4HN7 A;  3GTP B;  4KTA A;  1PTO F;  1OO9 B;  3OIP A;  1MD2 D;  3BZD B;  1SMY D;  1NAP A;  5BN5 A;  1Q1B A;  2ICI A;  4KN4 C;  2F0S A;  1G8Z D;  5CV6 A;  3U9S A;  4Q0F A;  2FMC A;  2WKC A;  1GUG A;  4L63 B;  2HCC A;  2OXP A;  1S5C D;  2PYK A;  5C4J B;  2VB2 X;  3Q6S A;  2F4I A;  5JEA J;  2B2V A;  2CQA A;  1E0B A;  1NR2 A;  4H0L C;  2O5I C;  1ILP A;  4DAP A;  2RA4 A;  2EYP A;  3S1N B;  3KBX A;  2IWH A;  2NN6 H;  1LT3 D;  5KNB A;  1KNA A;  3H0G B;  3HOX B;  3SDZ A;  3T53 B;  3JAM L;  5CBE E;  5JJZ A;  4TSS A;  2A6H D;  2JEA I;  3CQZ B;  1JE4 A;  2Z1C A;  2DY8 A;  5FKA C;  1F2Z A;  3OSO A;  3A56 A;  2L1B A;  5EGT A;  5CV7 A;  5J22 A;  3NWT A;  2Y0S B;  3K58 A;  3A7L A;  1IYU A;  3BVG A;  4RCO A;  2KOL A;  3J81 L;  4FO2 A;  4S3S A;  2A6E C;  4J8Q A;  1LO5 D;  2WAQ B;  3I3C A;  3QO2 A;  1B50 A;  5JVG 3;  1EYD A;  1EQV A;  1SYG A;  1F9Q A;  4X3S A;  5EBC A;  4IQZ A;  1I50 B;  4CKC A;  5FO7 B;  5NUC A;  4K5X A;  2OF1 A;  2WIN B;  1STA A;  4ZUI A;  3H91 A;  5EBD A;  3M85 A;  1GHK A;  1S5E D;  4RGM A;  5LL6 S;  1DD2 A;  2F0V A;  4JBW A;  5EQ0 A;  2KCC A;  5CV5 A;  4ODG A;  5I9P A;  1WTV A;  1BDO A;  2K32 A;  1PXU A;  3G7L A;  4RAU C;  1LAB A;  1LTT D;  3SVM A;  1H9R A;  3SXH A;  1SNP A;  1CA6 A;  1WTR A;  1B9N A;  1TQO A;  2BCO A;  5IT9 E;  3J7A F;  1SSO A;  3DHQ A;  4HAE A;  4KV6 A;  1H9J A;  1AEX A;  2WB1 B;  3HOY B;  3RLF A;  1HA5 A;  1EYC A;  3MFG A;  5J1Z A;  5I2Y A;  2OEO A;  4ZUJ A;  3CRL C;  1ZYR D;  3S1Q B;  4ID6 A;  1BCP B;  4IUV A;  4KKS A;  4R8N A;  1PFN A;  5IOD A;  1IHZ A;  4H7B A;  4C1N K;  2EYL A;  3BG3 A;  1EIG A;  3HZX A;  5C5L A;  2E75 C;  2AQ3 B;  5M5Y B;  2B63 B;  1EY9 A;  4K2K A;  4K14 A;  1E2V A;  1VCI A;  3R2I A;  1L0Y B;  4FXK C;  5C0X J;  1YNN C;  3V2T A;  2NYZ D;  1MSH A;  1PLF A;  3TP8 A;  3CKI B;  1PZJ D;  3ND9 A;  4KI0 A;  2NUC A;  2K1B A;  1EZ6 A;  5TSS A;  1EY4 A;  1Y8O B;  4FF2 A;  3TZU A;  1QCB D;  4IUU A;  2R7Z B;  2F0W A;  1LTA D;  2F0D A;  2K01 A;  5CV4 A;  3MXN A;  1S4Z A;  2NB0 A;  4XTC S;  5KNC A;  2EY1 A;  2O4X A;  2JA5 B;  4RGO S;  5D14 A;  4K8J A;  2SNM A;  5EKK A;  4CGY B;  4KN7 C;  4KK7 A;  4O42 A;  1Y8P B;  3ERQ A;  4RGN A;  4PQX A;  3KLS A;  1IKM A;  2WII B;  5KEE A;  5K36 G;  3TN2 A;  3VR3 A;  3IFD A;  3MAQ A;  1KAA A;  2F0H A;  2EY6 A;  1AFP A;  1RTO A;  3NBH A;  3QB3 A;  4HSV A;  1SYD A;  4K6L A;  4XYO A;  4NMZ A;  3VYU A;  5IT9 L;  1CZW A;  3K59 A;  5I2X A;  2B2W C;  4OO1 I;  1MGS A;  1QB5 D;  3RZO B;  2JSO A;  2B2U A;  1LV9 A;  2DNE A;  4CBV A;  1GJX A;  4A3K B;  2B8G A;  2FIN B;  2R61 A;  4DFA A;  3R3O A;  1KDC A;  1UUP A;  2AUJ D;  1I4X A;  4IUN A;  2WP8 J;  2A69 D;  4HMJ A;  5M3F B;  1B3A A;  1HRJ A;  3S9W A;  5D65 A;  4ZKB B;  4OL7 A;  1SBB B;  4DAV A;  1EU3 A;  3GO5 A;  1GHJ A;  3MA2 B;  4TRD A;  1EWH A;  3NUC A;  1DON A;  2FMM A;  2RKS A;  2RBM A;  1JQY D;  2HCI A;  3SEB A;  4E6I A;  2K7V A;  3ONA B;  5LHY 1;  5BN4 A;  3PUZ A;  3P7J A;  1O78 A;  1PMR A;  2XWJ B;  1HQM C;  3W3A A;  1U4P A;  2IX0 A;  5T1G A;  5DEH A;  1F9R A;  1HCZ A;  3MC0 B;  3S17 B;  1SYF A;  5CMD A;  3FPU B;  2XRQ D;  3H94 A;  2KUM A;  4OGQ C;  4ZQ3 A;  2GA4 B;  2RSN A;  4FF1 A;  4ME5 A;  3ZYY X;  2HUG A;  5A2Q E;  1V1P B;  4ULL A;  1Q1E A;  1D5M C;  3SK8 A;  1ENF A;  1MBY A;  1PTO C;  3A55 A;  4IAL A;  3HOZ B;  4IFD G;  4KMU C;  4GZY C;  4LMQ D;  5T1I A;  2MUY A;  1TS5 A;  3EFX D;  2LMC B;  5IGC A;  2O2L D;  3DEP A;  1KDB A;  1STN A;  1FGB D;  2C5C A;  5K5P A;  1LT6 D;  2SOB A;  4FF3 A;  1YNJ D;  2NVQ B;  2F0T A;  4RFB A;  1QNU A;  4FYD A;  1A3V A;  1C48 A;  3M7N A;  1JWS D;  2L0C A;  1JCK B;  5C44 B;  2AWO A;  4HMI A;  2TMP A;  5ELE A;  1PRT D;  1B2T A;  2VXW A;  3BDC A;  2PCF B;  3HP3 A;  1JB3 A;  2R6G A;  2Q8I B;  1B4O A;  3L9A X;  1BBX C;  1X3P A;  2Z4I A;  2K05 A;  2JA6 B;  1GUT A;  2LS0 1;  1AZP A;  4G7O C;  1PZI D;  1FNU A;  1C4Q A;  1XXG A;  2PQE A;  4J6H A;  3RZD B;  3FMC A;  1STG A;  1RDP D;  4EVO A;  3DXJ C;  1UEA B;  4Y7N B;  4K5V A;  1I3Q B;  1B1Z A;  2E2H B;  4IUP A;  3KF8 A;  3P75 A;  1LTB D;  5KRU A;  2HDL A;  4I7Z C;  4NP5 A;  4RKB A;  3MTS A;  5A2Q L;  1H9S A;  2TSS A;  2L4N A;  4X3K A;  1PRT F;  2KHS A;  1TKW B;  3R8B A;  2K5D A;  2Q8R E;  2XNA C;  1SJH D;  1U9R A;  4H13 C;  1O7Z A;  2EY5 A;  1EL0 A;  1HA6 A;  1I4Q A;  4DK0 A;  2VUM B;  1G2S A;  2SDF A;  1HFN A;  2MP1 A;  3EJI A;  3NQI A;  3PO3 B;  1ZEQ X;  3GTM B;  2ICE C;  3TME A;  2E76 C;  4K6D A;  1V1O A;  2MHV A;  3HOV B;  4C3H G;  1Y8N B;  3TBI B;  1G91 A;  2O5J C;  1HXY D;  2BE5 C;  5JVH 3;  1DOM A;  4LAA A;  3ERO A;  2F0E A;  1WTO A;  3TP7 A;  1MSG A;  3J80 E;  4PNY A;  5JPN C;  3HG9 A;  4ILW A;  2XRS D;  3BVZ A;  3L7Z C;  1D2B A;  4J1M A;  4KHV A;  4R8I A;  3VR4 A;  4B08 A;  1U4L A;  3D3R A;  1Y1W B;  1JC7 A;  1O80 A;  4IN3 A;  1TU2 B;  1Y69 U;  4PMC A;  1JWM D;  4L8J A;  4FF4 A;  1WCM B;  3QJY A;  2F0G A;  2L5T A;  1S5F D;  1TR5 A;  3PUV A;  3NTH A;  1T5E A;  1JR0 D;  4QF4 A;  3NSW A;  1I6V C;  4HR7 B;  1EIH A;  3R2T A;  2L9H A;  2JXM B;  3A8J E;  2ID0 A;  1J8I A;  3Q0A A;  1EY5 A;  1Z7T A;  4BY1 B;  1SYC A;  5CR3 A;  1D6E C;  1H9S B;  1DYQ A;  1FNW A;  5E1F A;  2KCN A;  2J7Z A;  1ZYR C;  3K5O A;  4MIU A;  2NTT A;  3IFT A;  1G6Z A;  2EYH A;  2PPB C;  3C1F A;  4XIG S;  5CV8 A;  4N9P A;  2KVM A;  3KBG A;  4A3G B;  3VYS A;  1OXS C;  1WD1 A;  1WTP A;  1UAP A;  1RKN A;  2XVS A;  2EJG C;  1GXD C;  2JE6 I;  1Z6H A;  1KNE A;  5E4X A;  4C3J G;  3NWS A;  1AZQ A;  1KAB A;  2B2T C;  1BF4 A;  4EQN A;  3HS0 C;  1HUM A;  3QOJ A;  2D62 A;  2QF7 A;  2K5Q A;  1EQT A;  2EVB A;  3K57 A;  4G7Z C;  2EYF A;  3J80 L;  1NCV A;  4Z9C B;  3GTG B;  2IX1 A;  2E2J B;  3X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...