4IQZA

The crystal structure of a large insert in rna polymerase (rpoc) subunit from e. coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
183
structure length
178
Chain Sequence
AAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords DNA-directed RNA polymerase subunit beta'
total genus 37
structure length 178
sequence length 183
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA02
3CRKC 4G7HC 1Y69U 3VR5A 1SMYC 3T53B 2AUKA 3W3AA 1EWHA 4OGQC 5KNBA 1LABA 2BDOA 1K8OA 1YNNC 2EJGC 2K32A 1GUOA 2BA1A 2EDGA 4H0LC 3OW7A 3PV0A 3MFYA 3M7NA 3QJYA 2EJFC 2YYZA 4BA2I 2JE6I 1O78A 4G7OC 1GUNA 5JEAH 3A8JE 5A35A 3TZUA 4I7ZC 2BE5C 4KKUA 5K36H 3RLFA 2PCFB 2E75C 1Z7TA 3H94A 1VF5C 3QIAA 1VDZA 4KI0A 1DCZA 4G7ZC 4TQUS 1DD2A 2BA0A 1ZKOA 2KA7A 3SDZA 2JEAI 4XTCS 3IKJA 1OXXK 3A8KE 4PV1C 1GUSA 1OXVA 1CI3M 2E76C 2L5TA 3BG3A 1O7LA 3I73A 3DXJC 5BN5A 4OO1G 1Z6HA 4KMUC 3WDNA 3U9SA 2F1MA 1Q90A 4RCNA 5KNCA 1B9MA 1FR3A 3GQBA 2Q8IB 1K8MA 1GUGA 3VA7A 1I6VC 5C0XH 2PPBC 1VF7A 2IT1A 5K36G 1CFMA 3PUXA 2CW0C 4H44C 1CTMA 3PUZA 1IW7D 1OXSC 2NN6H 3L7ZC 4L8JA 3VR4A 3ND9A 3FMCA 3GD7A 3VR2A 4XIGS 5BN3A 2A6HC 3M4YA 1DXMA 3OPOA 3N6RA 5KNDA 2KCCA 4KHZA 1IW7C 1OXTA 2ZT9C 3AB9A 1G291 2JXMB 3P20A 4JK1C 1H9SA 2PNRC 1BDOA 1H9SB 1TU2B 1V8QA 2DNEA 3A7AB 3PUVA 4KKTA 4LJZC 4DK1A 4GZYC 1TKWB 1T5EA 2A69D 4DNTB 3VR6A 2D2CC 3CRLC 1H9KA 2D62A 4IFDH 1IYVA 3I4LA 3VR3A 1E2WA 2EJMA 3PUWA 4DNRB 1LACA 3I72A 3LNNA 1FYCA 5JEAG 3A8IE 3NE5B 4JBWA 2A6HD 1HTPA 1V43A 2EVBA 1ONLA 2V4DA 3EQLC 2A68D 1H9JA 3HGBA 3MXUA 3T56B 1GHJA 3LWUA 1PMRA 1Y8NB 2JEBI 2LMCB 1GUTA 2B8FA 4IQZA 1GJXA 1Q12A 1HPCA 1OXUA 3IFTA 3D4RA 1VCIA 2B8GA 3OOCA 1H9RA 1ZYRC 4DK0A 1QJOA 2QF7A 4KKSA 2NN6I 3ND8A 1HQMC 3QG1A 1HCZA 1YNJC 4TKOB 2K33A 2K7VA 4KN4C 1E2ZA 4H13C 2R6GA 2NN6G 4KN7C 3FPPA 2D5DA 2A6ED 1Y8PB 2DNCA 3T51B 1A6XA 5C0XG 2A6EC 3D31A 4OO1H 4HR7B 1Q1BA 2O5JC 2A69C 1GHKA 3PUYA 3M85A 3BDOA 2AUJD 3SE0A 1H9MA 2BE5D 1B9NA 3A7LA 1Q1EA 2DN8A 4BA1I 3KLRA 2O5IC 4IFDG 1Y8OB 1IYUA 2AWOA 4LK1C 1E2VA 2A68C 2E74C 5BN4A
chains in the Genus database with same CATH superfamily
3K80C 1ASYA 4UP9A 1F9SA 4LF9Q 4K5WA 1CK1A 4O1NA 3CXCA 4BXXH 1EYAA 1D5MC 1GUOA 1KQSA 3HOZH 2A1AA 1JQYD 3K57A 1XMQL 3H3VI 1UEBA 5CORA 4NKLA 2Q8RE 1S5ED 5JAVA 4DV6Q 4FXKC 1PZID 3UDGA 1GXDC 1RIPA 3EN2A 4DR6L 2JYOA 1AH9A 1C9OA 3QIAA 4NP5A 2Z6BA 1XTDA 2F3IA 2VB3X 4A3CG 4OL7A 2HCIA 1HFGA 4R8IA 2YU9H 3QOJA 2L11A 3A74A 3VA7A 5CBAE 4HIDA 4EQPA 3S14H 4BBRH 1GVPA 4A3DG 4JPBW 2ENBA 4DR7Q 4X3SA 3X3NA 2WAQG 5IGBA 2D9UA 1PH9A 4K5XA 1BQQT 3MWYW 2QA4A 2LY7A 5FJ8H 5IODA 4DFAA 4KD3A 2K52A 5IWAL 2KECA 3BZCA 4HSVA 1A2UA 2PQAA 3VR6A 2RDGA 5FK9C 1PZJD 1CHPD 1K0RA 3PO2B 1RD9D 4V0BA 2PNHA 5EAYA 5M3FB 3HKSA 2EYMA 2K03A 3DWAA 4GKKL 3CQZB 4J15A 3U50C 2B2WC 2G5DA 3F8TA 3HOZB 3OMGA 5LMUL 3P1HA 1QCBD 1S5CD 1NE3A 1ENCA 4NB3A 3VYSA 3PO2G 4H13C 4JW0A 1I4HA 3KJPA 3HOWH 1PYWD 2UUAL 1HRJA 4A3EB 4P73A 5L37A 1X3FA 1Q1BA 1PRTB 3K0YA 4CDFC 1ESFA 4ULLA 4X62Q 4Z9CB 4IUVA 1SYDA 1WTQA 1QB5D 4ZAIA 2O5IC 1B50A 5E4XA 1DZ1A 4RFBA 4OWWB 2Z6KC 5ISRA 2LKVA 5JJIA 2AHOB 4BXXG 4K0KQ 5EPLA 2OXPA 4FDBA 2K32A 1F77A 3GTKB 5C4HA 3MVVA 3M7NA 2BCOA 3BYTB 2UUCQ 5LL6S 4A3JH 5CV6A 1JOQA 3D8GA 4A3MB 1X3QA 1JWMD 3RR5A 2F0DA 1N34Q 3RZDH 1SE4A 4QCLA 1SMXA 5M9OA 3KLSA 5IP9H 3H0GG 1VMPA 3W1GA 5C4XG 1WYDA 3KF6B 3F2DA 4GOPB 1PLFA 4A3MG 4R4TA 2F0QA 1KABA 4DN4M 2ES2A 5CV8A 4R1JA 1A15A 1CZGA 4LUZA 3MXNB 4ODGA 4B3SQ 1N33Q 3TN2A 2FMMA 3GD7A 3VR2A 1XTCD 2RHSB 3QO2A 4X65Q 4B3MQ 3HOUH 5CBEE 2PW5A 3N6RA 2FHTA 2JN4A 4K6LA 4CJ1B 1S5FD 1QZHA 3P20A 4WFN3 3PF4A 1W6KA 4N9PA 3X3MA 4LJZC 1IHZA 3CCUA 4DU9A 3I4OA 3Q0AA 3OW2A 4DA2A 3HS0C 4C2MB 3E9HA 4DV0Q 3NE5B 4CJ0B 5JJKA 1GKHA 2D0PA 2VUMG 4DGZA 3HGBA 5FO8B 3T56B 2F0JA 1GHJA 1SYEA 3IFTA 3OOCA 4A3DB 1Q82C 1LM0A 2HUGA 2X6LA 2HHHQ 5DAUA 5ELBA 4TVAB 3OSOA 4BY7H 3R3OA 2SNSA 4DV5Q 3D31A 2NVTH 2B2YA 2Q8TA 1VQGA 1I4QA 2RVLA 1YNXA 1EY9A 1B9NA 3DWPA 5IYCG 4LK1C 1MSHA 2K14A 3RN2A 2ZT9C 4A3FH 4JI8L 1LTSD 1SDFA 2R7ZG 1XMQQ 2K5HA 1IBLL 2XRSD 3J7AF 4JI0Q 3OIPA 4OX9Q 4F8MA 2MUYA 3UE1A 3HOUB 3V2TA 3OW7A 1STYA 2MGSA 1R4PB 2WIIB 3URYA 4C3JG 2XTIA 1YI2A 1GM5A 2AQ1B 2P5ZX 4L5TA 3KJOA 3NQTA 2PI2E 1SFOH 2E2JH 1UE1A 2F0WA 5J22A 2R61A 1F2LA 4LF6Q 5GAHC 2BOSA 5K36H 1EY6A 1A3TA 2EYHA 1BCPB 1ASZA 1B8AA 1CSPA 4IO9A 1VQNA 3S15H 1J8IA 4KY7A 3NK9A 1B3AA 2L9HA 3STBD 4DR4Q 4RKLA 2DY8A 2UUAQ 2F0GA 4PMWA 3PUXA 1HA5A 3M9BA 5CV4A 2WAQB 2VW9A 3NHHA 1HUNA 2O4XA 1I4RA 2JK8A 1YZ6A 2OEOA 2Z4HA 4FP5D 4OIJA 1RKNA 1VQJA 5IP7H 5A2QL 1OXTA 3KYHC 4DUZL 1EYDA 1LUZA 4DV2L 2PNRC 1FNVA 1RCVD 5G3LF 1YHBA 3A7AB 2NB0A 1WCMG 2A69D 3UDIA 3H3VH 1KLUD 3U58A 3I70A 5C4JH 2D62A 1EIGA 1HNWQ 2IY5B 1N9WA 3I72A 2N88A 1V43A 2NTTA 3K7AH 1DM0B 2K50A 3HKZG 3TBIB 3C46A 1I4GA 1X3GA 3MHBA 1HQRD 2CFMA 3N52A 3RN5A 3HOUG 1AP0A 3HOXB 2EOTA 3A5UA 3AFQA 1TXYA 1KIXA 5IYDH 4WORA 4KN7C 5HY6A 3J7A5 2A5HA 2I46A 4IZ8A 4JCVE 4DNIA 3S16H 3NPPA 2R92B 2Z4IA 3M85A 3H15A 1AE2A 4R4IA 4JBKA 1EL0A 2DN8A 4DV3L 3GTOB 1JORA 2TMPA 4K8JA 1PV4A 3ULLA 4MNOA 1V1PA 2OF1A 4YWLA 4K2LA 2BA1A 2EDGA 1TS4A 3TMEA 4DV0L 5E7NA 3EIVA 3PV0A 4GNXB 4JI2L 3G6JB 2EJFC 2EZVA 2FFKB 3JC66 3QWNA 2N78A 1NSNS 5JEAH 4KKUA 5C3XA 4A3FB 5FLXc 3LX0A 3BS1A 1TWAH 5KGUA 1QG7A 4DAMA 2KOLA 2MP1A 3BVMA 1R4QB 1BO0A 1I50B 3BJUA 2N49A 4BY1B 5TSSA 4DR2Q 1MSGA 2NZ1D 4BBSB 4CDDC 2F0FA 2GVAA 4DV7L 1FR3A 4Y52H 1GUGA 2HT1A 2PPBC 4X3TA 1VQDA 2NN6H 1CM9A 3TP6A 5D3IB 4C56C 1VQ9A 2KVMA 3HOVB 2RQXA 4AH6A 1X54A 3IL8A 4KHZA 1MHWC 4PG3A 1IBLQ 2A19A 2OQKA 1JE5A 1TVXA 4A3KB 3FKIH 1SE3A 4UAIA 3D6WA 1O7ZA 3KF8A 1HTLD 3U4VA 2HQLA 2DUDA 3VDYA 3K5OA 3CAMA 4DV1L 3PIP3 2JA5H 1Q3LA 3S1QH 1GUTA 3I4NH 1OXUA 3JAME 1JOKA 2ICEC 5H1SE 5BR8Q 1STEA 2K33A 1XMOL 1KDAA 1PRTC 1JJ2A 4N9TA 4M1UB 1KRSA 4ZUIA 5E1FA 3HP3A 2GA4B 1YJWA 1U4RA 5AJ3Q 1B1ZA 1MGSA 1Q8KA 1TS5A 1HJPA 4TSSA 5M3MB 1I50H 3OWEB 1H9MA 2BE5D 2X69A 5CC4A 3AMUA 4POFA 3NP8A 4EQOA 1Y8OB 2JA8H 1SE2A 2AWOA 3SK4A 1C0AA 1PZKD 2SDFA 2QEXA 1B70B 2IL8A 4QIWE 3OMCA 4ID6A 1LTTD 2X6GA 2JA6H 1X6OA 3K5MA 3Q24A 1XMOQ 4GLXA 2A8VA 4FF2A 2M00A 4LF4Q 2NVYB 1NAPA 1Y1WH 3I7FA 4GLVB 4CBVA 2K5VA 2JE6I 4RH6A 1O78A 2A73B 1EFID 2LFNA 3J81j 2NTSA 4S3SA 3P7JA 2JEAI 3IKJA 3A8KE 3QR8A 4ALPA 4H7BA 1GUSA 4OO1G 4JI3L 2OWOA 1O7IA 3W5OA 3KDFA 1JE4A 4P74A 3A56A 1N34L 4C3HH 3LWEA 1B9MA 1KDCA 3MEHA 2XSCA 3FRPB 4XXEA 4JVZA 3GTJB 4PNYA 1CFMA 4XT3B 2CWAA 3CU7A 2KENA 3FMCA 3I91A 2J7ZA 5BN3A 3GO5A 4LF5L 1G2TA 1K3BC 4QMGA 4DV6L 3IRBA 4BBSH 5CV5A 3CCLA 3AB9A 3I3CA 1HNZQ 4IJHA 1X65A 1KRTA 4A3LH 4X64Q 4JI1Q 5LMNW 1N32L 1AFPA 4O2DA 2F4VQ 4JI4L 5IE8A 2IW3A 5EBDA 1V8QA 4LF9L 1FJGQ 4KKTA 1JWSD 2VNUD 3CC2A 4CKCA 1STHA 4ZYSA 2J4XA 4IFDH 1X9NA 4YY3Q 3LNNA 1UWVA 3FDTA 3EBEA 1MI2A 3F2UA 4DV7Q 2OTJA 1GUWA 2KHIA 4QUFA 2MQHA 3GTKH 1TWGB 2H4OA 2IX0A 4YY3L 5M5WB 4BBRB 1EU3A 4MN3A 4PZ6A 2E8GA 1ENFA 2K7VA 4KN4C 1BCPC 5FLXL 2IWHA 1FJGL 5J3BA 2F4VL 1STBA 1A0IA 1PH1A 2ICIA 1KL9A 1E3PA 5JVG3 1EQQA 1SAPA 5GQOA 4XT1B 4FO2A 2M9VA 2QILA 5CV9A 1A62A 2NVXH 1QNUA 3MXPA 1KD1C 4C3IB 3SEBA 1B3QA 4X64L 3VR5A 4HSPA 5M5XH 2LSSA 5FOBB 3VYRA 3W3AA 2OTLA 5EKIA 2MHVA 4JI8Q 2M2LA 4F87A 4F7XA 3TP7A 4A3GG 4HEDA 4JOIA 1NR4A 3F2CA 2F0EA 3CCJA 1TR5A 2YYZA 2MO0A 4A3FG 4YHHQ 4ZLTF 5A35A 3CCSA 2BE5C 2PCFB 1SJHD 1K28A 4R9WA 5LMNL 3D4DA 1F2ZA 4KI0A 4TQUS 5CV7A 4WJ4A 1X3EA 3MXGA 4HIKA 2KEDA 4FXGC 1K83H 4NXMQ 3DXJC 4DV4Q 5IYCH 1JC7A 3KK7A 3U9SA 2F1MA 1YEZA 4A3BH 1SYCA 5IIFA 4HN7A 1HZAA 4GKJQ 1L2FA 2F0LA 2XIWA 5FLMH 1N36Q 5T1GA 4KTAA 4L5SA 4LF4L 2WINB 5NUCA 3S15B 3PUZA 3GTGH 3TSSA 3VR4A 1U4MA 2UXDQ 5FLMG 4N8X1 3MZ5A 1NMFA 2HIXA 3BDCA 2B2YC 2ID0A 2EXZA 1WOCA 2G9HD 5EKLA 5I6WA 5KNDA 4QUCA 4XYOA 1G291 1EZ8A 3CHBD 3MTSA 5C3EH 3HEJA 4ZRZA 4AYBE 3H0GB 3H6MA 1VQCA 1H9KA 4RGNA 4DR3L 1DGSA 1ET9A 1E0BA 4JI7L 4K5VA 1L0WA 2QKIC 4JI6Q 2CCZA 2V4DA 4LWCA 4PZ8A 4R4CA 1S5DD 2JQOA 2JEBI 1HPCA 3G4SA 4DK0A 3NSWA 2R7FA 2E2HH 1TWFB 3ZYYX 1TT2A 2N55A 4MTNA 2EPBA 3V96A 3F2BA 1CA6A 4A3BG 1I5FA 3NXWA 2Q2IA 1A63A 5C0XG 1BBWA 1U9RA 2CW0D 2PW7A 1BCPF 4RA8A 2O5JC 3JAMc 1PRTD 5C0XI 5I6YA 4M8AA 4A3GB 1U0LA 3KLRA 1EEFD 5IYDG 4K0KL 1IKMA 1QE6A 3NENA 4HAEA 1PTOC 5FO7B 4IALA 2PQEA 1STGA 3T53B 1SXTA 3NBHA 1ENAA 1EWHA 4POGA 2D0OA 2K75A 2NZOA 4BY7B 4AYBB 5KYLA 2Z0SA 2NWGA 3CC4A 1SEBD 3NELA 1XX8A 1Z47A 2CKZB 5GAGC 3TZUA 2ALYB 5ELDA 3S17H 1WJJA 2XWBB 4DK6C 4DR2L 1KTKA 1CKMA 2KA7A 5J1ZA 3I4MH 1TQOA 1XPUA 3D3RA 5BN5A 1WTHA 3GTMB 4LFCL 1EQVA 2F52A 2Y0SE 3VYUA 5C4ZA 4A3IG 4K6DA 4DR3Q 4ME5A 3ICEA 4OIKA 5IGCA 3GQBA 5FO9B 3MAQA 4JI6L 4JYAQ 4PMBA 4RMFA 1B7YB 4JI2Q 5KRUA 1VQBA 3K58A 3NWSA 3T13A 2VUMB 2R93B 2XVSA 1TWHB 4A3BB 4H02A 3ULPA 5D65A 1G2SA 1B53A 2JA5G 2DNEA 5I9OA 3PUVA 1VQMA 2KHSA 1MJEA 4A3IB 1VMCA 1V9PA 2HDLA 2L0CA 1S72A 3SGIA 1ML0D 4RKBA 3I4LA 3PMFA 5EPKA 1RTOA 2EJMA 4A3LG 4ZKBB 3J7ZC 4FXDA 2NUCA 3WOEA 5LHY1 4GKJL 1V1OA 1DYQA 3BZKA 2TSSA 4YHHL 2A74C 3LWUA 1VQPA 4IQZA 3ONAB 5C44B 1AZQA 3D4RA 4B08A 4NXML 1XYIA 4KKSA 4AYBG 2LS01 1TWCH 3CW2C 2FJ2A 4A4IA 3J7AV 3ND8A 4FYDA 4TKOB 1OO9B 2B29A 1MKHA 2VQEQ 4KHPL 4QJFA 5JPMC 1HR0W 1XNQL 5G3LD 2XN9C 1A6XA 4DR6Q 1BCPD 5C4JB 1SYBA 2B2UA 2PMZE 3UDXA 3RZOH 1OTCA 1BVSA 1WVLA 1SE8A 5M5YB 1AE3A 4CDEC 1Q1EA 4EVOA 4RGMA 1I94L 2XWJB 2B63B 4DUZQ 3CCMA 2L4NA 3A55A 4X66L 1Y69U 3CF5A 3AYHB 3GV6A 4IFDI 4PMCA 3I4NG 4GN3B 1YNNC 2UXCL 1XNRL 5ELNA 1QNKA 2EJGC 2JA7H 2DY7A 1PFSA 2VUMH 3FVQA 4C3JB 2GVBA 2EYJA 4NPSA 4AQYL 1RDPD 3PIO3 4YWKA 2Z1CA 3A8JE 3C1EA 4DXFA 3S2HH 2R7DA 2NVYH 1RJTA 4RHSA 3R93A 1Y1WB 2F0IA 2UXCQ 1DD2A 3SDZA 3GTPH 1SMYD 2L5TA 3NBHB 5LMUQ 3GDEA 3RMHA 2BH2A 5HURA 5DNFA 1H95A 1N8RC 1EOVA 4PZ7A 4LFAL 1K8MA 1PA6A 1ILPA 1HNZL 5K36G 1EY8A 4NMZA 1JB7A 1OXSC 4JI4Q 4XIGS 5E4WC 3OPOA 3J81c 3E0EA 4HMIA 2B2TA 5DM73 1IW7C 5C0XJ 1PTOF 1PH7A 2IPKD 3RZOB 3CCVA 2F0PA 1TKWB 2NBFA 3KOJA 4ME3A 2B63H 4IURA 1HA6A 1PH8A 2RA4A 5M3MH 1Q81C 4A3EG 4JBMA 2AMCB 4X62L 3Q23A 1EOTA 3FHWA 5KYIA 1PFMA 2LXJA 2JA7G 4DAYB 1F9PA 2L15A 4HTHA 4ABNA 1GJXA 4GNXA 2N3SA 1QOHA 1LV9A 1QJOA 3M3YB 2JP1A 4KJOA 3TDQA 1HCZA 1YNJC 5JEAJ 1EWIA 4C2MH 1UAPA 1HR0L 3S1MH 3UE0A 5DM63 1B44D 2QGQA 4KD4A 4DXGA 1EEID 1PFNA 3CP0A 5EKKA 4HCSA 3EFXD 1FNWA 1SROA 2RDFA 2Z9HA 2Z8LA 4WJ3M 4F88A 3OWFA 3J80c 3R8BA 3CCRA 5AJ3L 1IYUA 2ZTDA 3ITPA 5KEEA 1PH5A 1C7YA 3G7LA 4CKEA 3V05A 3K59A 5IWAQ 3BVZA 2AUKA 4DPGA 2XNAC 2EYLA 3K0XA 1PVOA 4FF1A 1N33L 1S5BD 5BR8L 4BBSG 1S3OA 1SNMA 1LO5D 3MFYA 3QJYA 1KNEA 4KLKA 5JJZA 3OYYA 3U9OA 1EQTA 2E75C 1VF5C 1UEAB 1VDZA 1AN8A 3CMEA 1A8VA 2BA0A 1HZBA 4XTCS 3E5SA 5I9PA 1YHAA 3BG3A 2E2JB 2OT2A 3PCOB 3TP5A 1Q90A 1Z9FA 1WTVA 1PH4A 1GO3E 2PO4A 5C0XH 1CKNB 2RSNA 1I4XA 3DWQA 1WD0A 3M4YA 1WTXA 1NMGA 1F9QA 5K5PA 3S1RH 1KAWA 2E5LQ 4G57A 2R7ZB 4OWTB 2YTYA 2RKSA 5C44G 4XQNA 1LTRD 2KHJA 5ELEA 4JC0A 1T9HA 1PDQA 2QDBA 4CGYB 5EJWA 3VR3A 3PUWA 3FP9A 2JA8G 3K81C 5EGTA 1E22A 4QF4A 1XPOA 1C8CA 1H9JA 4OHJA 2LMCB 4NXNQ 1X32A 3I55A 4J1MA 1XNRQ 1L1OB 1MBYA 1EY7A 2L1BA 4LFBQ 1E2ZA 1JR0D 4Q5VA 3KFUA 4HJ7A 1GD7A 3E9IA 1EIYB 2HD3A 1HXYD 1Y8PB 2Y0SG 2J0TD 3I8ZA 4FVMA 4JI1L 3L2PA 1N32Q 1QWYA 1VQKA 3WOFA 4IPHA 4KY6A 2EE1A 1QVGA 3T1YQ 1IXRA 1HH2P 3SR1A 1J9OA 1F2MA 1SYFA 1EFWA 4OONA 2Q2UA 1NJIC 1ET6A 4B3SL 1MIUA 3PIOA 1LTLA 3SK8A 2K04A 4DR7L 2AQ3B 2YU9B 3ERSX 4C1NI 1CA5A 2UXBQ 3KDFB 2WB1B 2EY2A 4B9XA 1SMYC 4I65A 3G48A 3MC0B 3I56A 1IYJB 1TS3A 5C5LA 2ZXPA 3CD6A 4A3JG 4B3TL 4O0AA 3S1MB 1QZGA 3E3XA 5LMNQ 4KK7A 3C2PA 1LTBD 2F0MA 5C3EB 1SN8A 2RF4A 2ZJQA 4R4OA 3DEOA 3AFPA 3NTHA 5I2XA 1OXXK 4PV1C 3VYTA 5JPNC 4KMUC 3Q22A 3Q6SA 2UXBL 1AEXA 4C3IG 3STBC 1FGBD 5IP9G 1U5KA 2HQEA 4ILWA 3HOXG 2L55A 1CTMA 3L3OC 2SEBD 3L7ZC 3T1HQ 1RL2A 3B6YA 2K5NA 2FMCA 4K14A 3ERQA 2KCCA 3PGZA 4DAVA 4LFBL 4QY7A 4EQ5A 4APVA 3FPUB 4IUUA 4UHVA 3EROA 1BDOA 1JCKB 3S14B 3PQIA 4DNTB 1XWEA 1JJGA 4DAYA 5IYBH 3OTOQ 3FKIB 4JBWA 2C5CA 2EVBA 1Y1VH 2HCCA 4JOIC 1Y14B 3OHXC 1HHVA 2V1CC 4LF6L 1JOOA 2KQ3A 4KY5A 1BKBA 3PF5A 1G8ZD 1MD2D 3KLSX 4BBRG 1L0XB 4OX9L 1VQOA 4JI0L 2HDMA 3QG1A 1CZWA 4RGTA 3PO2H 1TS2A 4C3HG 1Q8IA 2KEEA 4UY8C 4LW1A 5ELCA 3CQZH 5C4XH 3S1QB 4MHEA 2ZTCA 4P2CB 1LT3D 1SR3A 2F0VA 2PMZB 3M7GA 5M5XB 1BNZA 1E1OA 3H0GH 1Q7YC 1XNQQ 3DM3A 1WFQA 2RDHA 4ZUJA 2WB1E 1HNXQ 2WKDA 3ULJA 2F0KA 3K7AB 1Y1WG 1WCMH 3M4QA 2I07B 5KNBA 1JB3A 2HHHL 1KXLA 2OQ0A 1NBWA 2JJQA 5CGKA 4B9WA 3HOWB 2K05A 4YCWA 3HOZG 2ZM6L 1LTAD 4XYQA 2UU9Q 1VQ7A 1K83B 3T1YL 1PFBA 1JMCA 3MEFA 4IUNA 4I7AA 2E76C 3CPWA 2F3VA 3E0JA 1K0SA 1XPRA 3AU7A 3SK5A 2B2WA 1Q46A 1XJVA 4IPCA 4YWMA 5KNCA 4OWXB 4GKKQ 4L63B 4LFCQ 3R2IA 2FXQA 1KAAA 4LF8L 2CW0C 4RAUC 1CUKA 2WV6D 4L8JA 2EY1A 2K5QA 4HJ8A 2UU9L 3NWTA 1CQVA 1LT5D 4KHVA 4WJWA 5AFWA 5ELOA 3UDFA 3TS0A 5FKAC 3DMUA 5J39A 2JA5B 1DJRD 3S9WA 5I2YA 1STNA 4UPAA 4GZYC 1NNXA 3TEHB 5C5MA 3EA6A 1RTNA 3DHQA 1YIJA 1M90C 1IYVA 5JEAG 1E2WA 1K9MC 5FJ8G 4DNRB 1II3A 1GOZA 1HZ9A 1HTPA 3IFDA 1WD1A 2MNAA 1RHPA 1WCMB 4ZKCB 1NR2A 3U4ZA 2IX1A 2CVRA 4N8FA 3TQYA 2B8FA 3HZXA 1D1IA 2K4KA 3BDLA 5IGFA 1SNCA 4IFDJ 3L0OA 1CSQA 4P75A 3AEVA 2NN6I 2SOBA 3ZJYC 1S4ZA 1VS0A 2NN6G 4LAAA 1LT4D 2WP8J 4FNFA 2IHFA 4L5QA 4K8IA 3D6CA 4A3CH 3W1BA 2ZJRA 2EIFA 4Q0FA 1DOKA 4IUQA 2EYOA 1O80A 3BDOA 4GN4B 4RHRA 1JICA 1M4VA 3HOWG 3GTPB 3CPFA 1SLJA 2HIVA 2VL6A 3NQIA 1WTOA 1CHQD 3C1FA 4DUYQ 4KJNA 1G51A 4EQNA 4OGQC 2CHBD 3KLWA 4A3JB 1M8AA 1F9RA 3PO3B 1B4OA 2H5XA 5C44H 1WTRA 4QQBX 4RWSC 5T1IA 2XGTA 2E2DC 3D4WA 2F3WA 4UP7A 4WRDA 3OTOL 4JI7Q 4NW2A 1T5XD 3HOYH 2VQFL 3D0FA 3T4AC 2XRQD 2CH4A 1XXGA 3NTIA 1G91A 4XQQA 1DCZA 2ASBA 2IX3A 1EIHA 4X3UA 4GLAC 3TZDA 3PO3G 3HKZE 5KIXA 2YTXA 1VQEA 1L1OA 2CQOA 2Y0SB 1IL8A 1DOLA 1F2YA 4RG1A 2VQEL 3T1HL 4B3ML 2B3GA 4KHPQ 1SRUA 4LUOA 2KCTA 4DV4L 1VF7A 5EBCA 3EVQA 3HOXH 2KBNA 1CT1D 3GTQH 2FINB 2A6HC 1HZCA 1D6EC 1NUCA 4C3JH 3MFGA 2K1BA 1EYCA 4A3IH 2I5HA 4RCOA 1A2TA 5ELFA 1NY4A 2R92H 1K8GA 1H9SB 4DV5L 1YITA 1KNAA 2VZAA 4JI3Q 3KUPA 1PH3A 1SNQA 2R7ZH 2F03A 1IKLA 2GN5A 4CHTB 1FYCA 2OCEA 4Y7NH 2UUCL 4G4KA 1HNWL 1PMRA 3TS2A 1SNPA 4EX5A 1Q12A 3UI2A 2VB2X 4X3KA 4GN5A 2WKCA 3SVMA 2NVTB 4BS9A 2R6GA 4DKAC 2F0TA 4C1NK 2A6EC 2K28A 1QILA 3MXNA 3RLOA 1EYGA 5IGEA 1G6ZA 1HFNA 3SE0A 1L1OC 1PYBA 5IY0A 4BA1I 4U673 5DLQE 1YJ9A 2E74C 1LT6D 3KF6A 2ZM6Q 1SFOB 1O7YA 4GS3A 4HJAA 1ICFB 3BU2A 3NTKA 1I4PA 1IBML 4NXNL 2F0HA 2RCNA 1V1QA 1FL0A 1UE7A 1LABA 4O42A 3QOLA 1YVCA 3SXHA 2RSOA 1JWUD 2NVQB 4A3GH 3GTGB 4BA2I 4G7OC 5COYA 4LF5Q 2CQAA 2AKWB 1Z7TA 4J6HA 4RGOS 1P8LA 1CI3M 2B2UC 2F0UA 1O7LA 5IGDA 1U4LA 3HG9A 4DV3Q 1U4PA 1W6JA 4OELB 3AQQA 3HOYB 5EQ0A 1R9TB 2QW7A 1BOSA 1SNDA 1YBYA 1IBKQ 3HRZC 1I3QH 4LNQA 3QB3A 2CH4W 4H44C 3R2TA 1IW7D 3CCQA 4JBJA 1NCVA 1IZ6A 4J8QA 5LL6X 1YJNA 2AQ2B 3O13A 3KBXA 1H9SA 1CKOA 1TU2B 1K73C 3S2DB 4A93G 2K5WA 1STAA 1K3RA 2L12A 4UP8A 3OIQA 4A3KG 5JJLA 2PZTA 1LACA 1QVFA 3HOVH 1ONLA 4P72A 5DEHA 4MZ9A 3S16B 1Y8NB 3J7YW 2UXDL 3H91A 2PQAB 4IUTA 2B8GA 4FF4A 4V190 3DUZA 4HJ9A 1QUQB 4QL5A 2F4IA 2YV5A 2EYFA 3CC7A 1YHQA 2I0QA 2B39A 1DONA 1LTID 1FNUA 1S40A 4YCUA 2PYKA 1HR0Q 4X6AH 1FGUA 1TWCB 2R93G 1J6QA 1ZEQX 1IL2A 3F1ZA 3SHLA 3RNUA 2KJXA 5IYBG 2A68C 3S17B 3CRKC 1EIFA 4ZK9B 2QEJC 4ZQ3A 4HIOA 3CCEA 4QIWB 2BDOA 2JA6G 3RLNA 2I5MX 1KLGD 1QVCA 1VQLA 2WACA 4LMQD 5M3MG 3HFZB 5D3DA 5IT9L 4E6IA 1AZPA 1C4QA 2LXKA 1TIID 2R93H 3LGJA 3GP7A 3W2DA 1TWHH 4AIMA 4L6TB 1BUVT 1OXVA 2B2VA 2NYZD 3I73A 4IPGA 2JA6B 3GTQB 3S2HB 3PIPA 4LF7Q 1Y1VB 1VQ5A 1ICWA 4EGVA 2H1EA 2F0NA 4DF7A 1PXUA 3ER0A 2Q8IB 3WWVA 3MA2B 4LUVA 2WAQE 3SK6A 1VQ8A 4A93B 2DJGC 3VA5A 4OO1I 2G9DA 1X55A 1D8LA 1SSOA 3K6OA 1IBMQ 2JXMB 3CMAA 1D5ZC 1VQIA 3GV3A 1J5EL 4DR1L 1L0YB 1T5EA 1Y1VG 2D2CC 1HUMA 2RHQB 3CRLC 3FKIG 4C3HB 3I4MB 4HMJA 2NVXB 2PZWA 2VY3A 3HOYG 4DAPA 3A8IE 2A6HD 3J81E 3S1NB 1I3QB 5EPJA 1I94Q 1PH2A 2I5LX 1JJCB 1PTOB 5C6AA 3KF8B 1QUQA 1VCIA 3JAML 3J80E 1ZYRC 2BH8A 2QF7A 5M5YH 4LF7L 4XDXA 4X65L 1JT8A 3I2ZA 1BXTA 5GROA 2A6ED 2SNMA 2YTVA 2EYPA 2C35B 4JI5Q 2B2VC 4ZCKA 4B3RL 1HNXL 3A0JA 2B2TC 1FD7D 2EY5A 3PUYA 1GHKA 3J81i 5D14A 5GADC 1TY2A 3A7LA 3M4OH 1ESRA 3P75A 4JI5L 2AWNA 2IJ0A 4B3TQ 3KBGA 5BN4A 1FVIA 3RD4A 3GTLH 4G7HC 1LLRD 1YNND 5M5WH 4QGUA 4GOPC 1K8OA 5C3EG 5JOBA 2DJFC 4NDXA 3G6EA 4YIJA 2DGYA 5IP7G 2KUMA 1EUJA 2KCMA 4BWGB 2EY6A 1UE5A 1GUNA 1CKNA 4OEMB 3J80L 3H94A 1SNOA 1ZKOA 1R9TH 1V1PB 2VQFQ 3PSIA 4JYAL 1Z6HA 3J81L 1D2BA 3S1NH 1YNJD 5HGTA 3WDNA 3FEWX 4RCNA 4XQJA 1WTWA 1B2TA 5CYUA 1I6VC 1E24A 2IT1A 1X56A 3J80i 3S2DH 5M3FG 2K6AA 1WTPA 2N8NA 2VS1A 3K7UC 3ND9A 3DEPA 5IT9E 4DR4L 5FLXE 2JA7B 1SJED 1UE6A 5F2DA 4CDCC 3RUZA 4DK3C 4JK1C 2RBMA 4X66Q 3K5NA 3DLLA 1DOMA 3M4PA 4IN3A 2ZJPA 3M3YH 2F0SA 4CKBA 1I6HH 3A5ZB 1WI5A 3TREA 1K8AC 1UNSA 1BF4A 4A3KH 2ATWA 2F0OA 4FF3A 2C9OA 1IBKL 4A93H 2A68D 2QCPX 3NBIA 3MXUA 3I90A 1SYGA 2MFIA 1VQ4A 1LTGD 3Q8DA 3HKZB 1H9RA 5HGQA 1W3SA 1HQMC 4IUPA 4L5RC 1C48A 5JVH3 3BYYB 1D5XC 4IOAA 5E3FA 1AW7A 4LFAQ 3DM1A 1D7QA 5IT9c 3FPPA 4C3IH 1EZ6A 2D5DA 1EWCA 3NEMA 3T51B 1LYLA 4BY1G 2ZTEA 2PI2A 3E6ZX 4QB4A 1VQHA 1EY4A 3GTMH 2A69C 1EY0A 3I4MG 2AUJD 4BY1H 2UUBQ 1VQAA 2K01A 2NZHA 3EJIA 2E2HB 2WB1G 2PZUA 5A2QE 4A3EH 1CQFA 1PTOH 2Z6KA 1E2VA 2K5DA 4R4QA 2JSOA 4IFDG 4JG2A 4AQYQ 1D1KA 2MJ8A 4TRDA 4GNXC 1TY0A 1W2BA 1TWFH 1E1TA 1BBUA 4LF8Q 4H0LC 3TRZA 5IGGA 3M4OB 2R3ZA 1RODA 3K5LA 2E2IH 4I7ZC 3RLFA 4U68A 1Q86C 4K2KA 3GTLB 3S1RB 4IPDA 2NVQH 2CWPA 4G7ZC 5CR3A 5C3WA 1P16A 1SBBB 1PHJA 1BBXC 1J5EQ 4A3MH 1EU4A 4DR5Q 1N36L 3CKIB 1EY5A 2ZXOA 4IJLA 4CJ2C 1E7ZA 2QDLA 3BVGA 4Y7NB 4PQXA 1G6PA 3NUCA 3TP8A 1UUPA 1BR9A 4BY7G 2Q2TA 5I4DA 4DUYL 3GTOH 3PO3H 1RF2D 5M3FH 2E5LL 2UUBL 1X3PA 1PYSB 2O2LD 1KC8C 3JAMi 3GTJH 1M1KC 1DXMA 4YCVA 3L9AX 4JV5L 1PTOD 1TWAB 4HCEA 3IAYA 3G71A 3BZDB 5GAEC 2WFWA 4MIUA 5CMDA 2B63G 1MJCA 4DK1A 4HIMA 3S24A 3H3VC 4A76A 4DV1Q 5IOCA 4B3RQ 2R92G 4DV2Q 1A3VA 2MO1A 4UDUC 2EXDA 4R8NA 2VXWA 1ILQA 3EQLC 1KHIA 3A54A 1EQRA 2ZXRA 2JA8B 1PRTF 1VQ6A 4P71A 1ZXTA 3K8AA 4JV5Q 2JA9A 4KV6A 2E2IB 2EQSA 2KCNA 4A75A 3T16A 3C3LA 2Q2HA 4A3DH 1TWGH 4OXPA 4HJ5A 4DR1Q 2DNCA 1PH6A 1I6HB 1A3UA 2IHEA 4OO1H 4HR7B 2RCFA 3H09A 4IOCA 1VQFA 4MTKA 1KDBA 1NTGA 5C4XB 3RZDB 4GOPA 4DR5L 3HOVG 1ZYRD 3I4NB 2MPMA 2BDNA
chains in the Genus database with same CATH topology
1F9SA 4K5WA 1CK1A 4O1NA 1EYAA 1D5MC 1GUOA 1JQYD 3K57A 5CORA 4NKLA 2Q8RE 1S5ED 5JAVA 4FXKC 1PZID 1GXDC 2JYOA 3QIAA 4NP5A 2VB3X 4OL7A 2HCIA 1HFGA 4R8IA 3QOJA 2L11A 3VA7A 5CBAE 4EQPA 2ENBA 4X3SA 3X3NA 5IGBA 2D9UA 4K5XA 1BQQT 3MWYW 2LY7A 5IODA 4DFAA 4KD3A 2KECA 4HSVA 1A2UA 3VR6A 2RDGA 5FK9C 1PZJD 1CHPD 3PO2B 1RD9D 4V0BA 5M3FB 2EYMA 2K03A 3DWAA 3CQZB 2B2WC 3HOZB 3OMGA 3P1HA 1QCBD 1S5CD 1ENCA 3VYSA 4H13C 1I4HA 1PYWD 1HRJA 4A3EB 1Q1BA 1PRTB 3K0YA 1ESFA 4ULLA 4Z9CB 4IUVA 1SYDA 1WTQA 1QB5D 4ZAIA 2O5IC 1B50A 5E4XA 1DZ1A 4RFBA 5ISRA 2LKVA 5EPLA 2OXPA 2K32A 1F77A 3GTKB 5C4HA 3MVVA 3M7NA 2BCOA 3BYTB 5LL6S 5CV6A 1JOQA 3D8GA 4A3MB 1X3QA 1JWMD 2F0DA 1SE4A 4QCLA 5M9OA 3KLSA 1VMPA 1PLFA 2F0QA 1KABA 4DN4M 5CV8A 1A15A 1CZGA 4ODGA 3TN2A 2FMMA 3GD7A 3VR2A 1XTCD 3QO2A 5CBEE 2PW5A 3N6RA 2FHTA 4K6LA 4CJ1B 1S5FD 3P20A 4WFN3 1W6KA 4N9PA 3X3MA 4LJZC 1IHZA 4DU9A 3Q0AA 4DA2A 3HS0C 4C2MB 3NE5B 4CJ0B 4DGZA 3HGBA 5FO8B 3T56B 2F0JA 1GHJA 1SYEA 3IFTA 3OOCA 4A3DB 2HUGA 2X6LA 5DAUA 5ELBA 3OSOA 3R3OA 2SNSA 3D31A 2B2YA 2Q8TA 1I4QA 2RVLA 1EY9A 1B9NA 3DWPA 4LK1C 1MSHA 2ZT9C 1LTSD 1SDFA 2XRSD 3J7AF 3OIPA 4F8MA 2MUYA 3HOUB 3V2TA 3OW7A 1STYA 2MGSA 1R4PB 2WIIB 3URYA 4C3JG 2AQ1B 3NQTA 2F0WA 5J22A 2R61A 1F2LA 2BOSA 5K36H 1EY6A 1A3TA 2EYHA 1BCPB 1J8IA 4KY7A 3NK9A 1B3AA 2L9HA 4RKLA 2DY8A 2F0GA 4PMWA 3PUXA 1HA5A 5CV4A 2WAQB 3NHHA 1HUNA 2O4XA 1I4RA 2OEOA 2Z4HA 4FP5D 4OIJA 1RKNA 5A2QL 1OXTA 1EYDA 2PNRC 1FNVA 1RCVD 5G3LF 3A7AB 2NB0A 2A69D 1KLUD 3I70A 2D62A 1EIGA 3I72A 2N88A 1V43A 2NTTA 1DM0B 3TBIB 3C46A 1I4GA 3MHBA 1HQRD 3N52A 1AP0A 3HOXB 2EOTA 4WORA 4KN7C 2A5HA 2I46A 4IZ8A 3NPPA 2R92B 2Z4IA 3M85A 1EL0A 2DN8A 3GTOB 1JORA 2TMPA 4K8JA 1V1PA 2OF1A 4K2LA 2BA1A 2EDGA 1TS4A 3TMEA 3PV0A 3G6JB 2EJFC 2EZVA 2FFKB 3QWNA 5JEAH 1NSNS 4KKUA 5C3XA 4A3FB 3LX0A 3BS1A 5KGUA 1QG7A 2KOLA 2MP1A 3BVMA 1R4QB 1BO0A 1I50B 4BY1B 5TSSA 1MSGA 2NZ1D 4BBSB 2F0FA 1FR3A 1GUGA 2PPBC 4X3TA 2NN6H 1CM9A 3TP6A 5D3IB 4C56C 2KVMA 3HOVB 2RQXA 3IL8A 4KHZA 1TVXA 4A3KB 1SE3A 4UAIA 3D6WA 1O7ZA 3KF8A 1HTLD 3K5OA 3PIP3 1Q3LA 1GUTA 1OXUA 3JAME 1JOKA 2ICEC 1STEA 2K33A 1KDAA 1PRTC 4N9TA 4M1UB 4ZUIA 5E1FA 3HP3A 2GA4B 1U4RA 1B1ZA 1MGSA 1TS5A 4TSSA 5M3MB 3OWEB 1H9MA 2BE5D 2X69A 5CC4A 3AMUA 3NP8A 4EQOA 1Y8OB 1SE2A 2AWOA 3SK4A 1PZKD 2SDFA 2IL8A 3OMCA 4ID6A 1LTTD 2X6GA 3K5MA 3Q24A 4FF2A 2M00A 2NVYB 1NAPA 4CBVA 2JE6I 4RH6A 1O78A 2A73B 1EFID 2LFNA 2NTSA 4S3SA 3P7JA 2JEAI 3IKJA 3A8KE 4H7BA 1GUSA 4OO1G 1JE4A 3A56A 3LWEA 1B9MA 1KDCA 3MEHA 2XSCA 3FRPB 4XXEA 3GTJB 4PNYA 1CFMA 4XT3B 3CU7A 3FMCA 3I91A 2J7ZA 5BN3A 3GO5A 1G2TA 4QMGA 5CV5A 3AB9A 3I3CA 1AFPA 2IW3A 5EBDA 1V8QA 2VNUD 4KKTA 1JWSD 4CKCA 1STHA 4ZYSA 2J4XA 4IFDH 3LNNA 3FDTA 1MI2A 3F2UA 1GUWA 4QUFA 1TWGB 2H4OA 2IX0A 5M5WB 4BBRB 1EU3A 4MN3A 1ENFA 2K7VA 4KN4C 1BCPC 5FLXL 2IWHA 1STBA 2ICIA 5JVG3 1SAPA 4XT1B 4FO2A 2M9VA 2QILA 5CV9A 1QNUA 3MXPA 4C3IB 3SEBA 3VR5A 4HSPA 5FOBB 3VYRA 3W3AA 5EKIA 2MHVA 4F87A 2M2LA 4F7XA 3TP7A 4HEDA 1NR4A 2F0EA 1TR5A 2YYZA 4ZLTF 5A35A 2BE5C 2PCFB 1SJHD 4R9WA 3D4DA 1F2ZA 4KI0A 4TQUS 5CV7A 3MXGA 2KEDA 4FXGC 3DXJC 1JC7A 3KK7A 3U9SA 2F1MA 1SYCA 5IIFA 4HN7A 2F0LA 2XIWA 5T1GA 4KTAA 2WINB 5NUCA 3S15B 3PUZA 3TSSA 3VR4A 1U4MA 3MZ5A 3BDCA 2B2YC 2ID0A 2EXZA 2G9HD 5EKLA 5KNDA 5I6WA 4QUCA 4XYOA 1G291 1EZ8A 3CHBD 3MTSA 3HEJA 4ZRZA 3H0GB 3H6MA 4RGNA 1H9KA 1ET9A 1E0BA 4K5VA 2QKIC 2V4DA 1S5DD 2JEBI 1HPCA 4DK0A 3NSWA 1TWFB 3ZYYX 1TT2A 2N55A 2EPBA 3V96A 1CA6A 3NXWA 5C0XG 1U9RA 2CW0D 2PW7A 1BCPF 4RA8A 2O5JC 1PRTD 5C0XI 5I6YA 4M8AA 4A3GB 3KLRA 1EEFD 1IKMA 1QE6A 5FO7B 1PTOC 4HAEA 4IALA 2PQEA 1STGA 3T53B 1SXTA 3NBHA 1ENAA 1EWHA 4BY7B 4AYBB 5KYLA 2NWGA 1SEBD 1XX8A 1Z47A 3TZUA 5ELDA 2XWBB 1KTKA 2KA7A 5J1ZA 1TQOA 3D3RA 5BN5A 3GTMB 5C4ZA 1EQVA 3VYUA 4K6DA 4ME5A 4OIKA 5IGCA 3GQBA 5FO9B 3MAQA 4PMBA 5KRUA 3K58A 3NWSA 3T13A 2VUMB 2R93B 2XVSA 1TWHB 4A3BB 5D65A 1G2SA 1B53A 2DNEA 5I9OA 3PUVA 2KHSA 4A3IB 1VMCA 2HDLA 2L0CA 1ML0D 4RKBA 3I4LA 3PMFA 5EPKA 1RTOA 2EJMA 4ZKBB 4FXDA 2NUCA 3WOEA 5LHY1 1V1OA 1DYQA 2TSSA 2A74C 3LWUA 4IQZA 3ONAB 5C44B 1AZQA 3D4RA 4B08A 1XYIA 4KKSA 2LS01 3J7AV 4FYDA 2FJ2A 3ND8A 4TKOB 1OO9B 5JPMC 5G3LD 2XN9C 1A6XA 1BCPD 5C4JB 1SYBA 2B2UA 1WVLA 5M5YB 1Q1EA 4EVOA 4RGMA 2XWJB 2B63B 2L4NA 3A55A 1Y69U 3GV6A 4IFDI 4PMCA 1YNNC 1QNKA 2EJGC 2DY7A 3FVQA 4C3JB 2EYJA 1RDPD 3PIO3 2Z1CA 3A8JE 3C1EA 4DXFA 1RJTA 4RHSA 3R93A 1Y1WB 2F0IA 1DD2A 3SDZA 1SMYD 2L5TA 3RMHA 5HURA 5DNFA 1K8MA 1ILPA 5K36G 1EY8A 4NMZA 1OXSC 4XIGS 5E4WC 3OPOA 2B2TA 4HMIA 5DM73 1IW7C 5C0XJ 1PTOF 2IPKD 3RZOB 2F0PA 1TKWB 2NBFA 4IURA 1HA6A 2RA4A 3Q23A 1EOTA 5KYIA 1PFMA 1F9PA 4HTHA 4ABNA 1GJXA 1QOHA 1LV9A 1QJOA 3M3YB 2JP1A 4KJOA 3TDQA 1HCZA 1YNJC 5JEAJ 1UAPA 5DM63 1B44D 4KD4A 4DXGA 1EEID 1PFNA 5EKKA 4HCSA 3EFXD 1FNWA 2RDFA 2Z8LA 4F88A 3OWFA 3R8BA 1IYUA 3ITPA 5KEEA 3G7LA 4CKEA 3V05A 3K59A 3BVZA 2AUKA 2XNAC 2EYLA 4FF1A 1S5BD 1SNMA 1LO5D 3MFYA 3QJYA 1KNEA 5JJZA 3U9OA 1EQTA 2E75C 1VF5C 1UEAB 1VDZA 1AN8A 2BA0A 4XTCS 5I9PA 3E5SA 3BG3A 2E2JB 2OT2A 3TP5A 1Q90A 1WTVA 5C0XH 2PO4A 2RSNA 1I4XA 3DWQA 1WD0A 3M4YA 1WTXA 1F9QA 5K5PA 4G57A 2R7ZB 2RKSA 4XQNA 1LTRD 5ELEA 1PDQA 2QDBA 4CGYB 5EJWA 3VR3A 3PUWA 5EGTA 4QF4A 1C8CA 1H9JA 4OHJA 2LMCB 1X32A 4J1MA 1MBYA 1EY7A 2L1BA 1E2ZA 1JR0D 4Q5VA 1HXYD 1Y8PB 2J0TD 3I8ZA 4FVMA 1QWYA 3WOFA 4KY6A 2EE1A 3SR1A 1J9OA 1F2MA 1SYFA 1ET6A 3SK8A 2K04A 2AQ3B 2YU9B 4C1NI 1CA5A 2WB1B 2EY2A 4B9XA 1SMYC 4I65A 3MC0B 1TS3A 5C5LA 2ZXPA 3S1MB 4KK7A 3C2PA 1LTBD 2F0MA 5C3EB 3DEOA 3NTHA 5I2XA 1OXXK 4PV1C 3VYTA 5JPNC 4KMUC 3Q22A 3Q6SA 1AEXA 4C3IG 1FGBD 2HQEA 4ILWA 2L55A 1CTMA 3L3OC 2SEBD 3L7ZC 2FMCA 4K14A 3ERQA 2KCCA 4DAVA 3FPUB 4IUUA 3EROA 1BDOA 1JCKB 3S14B 4DNTB 1XWEA 4DAYA 3FKIB 4JBWA 2C5CA 2EVBA 2HCCA 3OHXC 1HHVA 1JOOA 2KQ3A 4KY5A 1G8ZD 1MD2D 3KLSX 1L0XB 2HDMA 3QG1A 1CZWA 4RGTA 1TS2A 4C3HG 1Q8IA 2KEEA 5ELCA 3S1QB 4MHEA 4P2CB 1LT3D 2F0VA 2PMZB 3M7GA 5M5XB 1BNZA 2RDHA 4ZUJA 2WKDA 2F0KA 3K7AB 2I07B 5KNBA 1JB3A 5CGKA 4B9WA 3HOWB 2K05A 1LTAD 4XYQA 1K83B 1PFBA 4IUNA 2E76C 2F3VA 3E0JA 3AU7A 3SK5A 2B2WA 5KNCA 4L63B 3R2IA 1KAAA 2CW0C 4RAUC 2WV6D 4L8JA 2EY1A 2K5QA 3NWTA 1CQVA 1LT5D 4KHVA 4WJWA 5AFWA 5FKAC 3DMUA 5J39A 2JA5B 1DJRD 3S9WA 5I2YA 1STNA 4GZYC 5C5MA 3EA6A 1RTNA 3DHQA 1IYVA 5JEAG 1E2WA 4DNRB 1II3A 1GOZA 1HTPA 3IFDA 1WD1A 1RHPA 1WCMB 4ZKCB 1NR2A 2IX1A 2CVRA 2B8FA 3HZXA 1D1IA 3BDLA 5IGFA 1SNCA 4IFDJ 2NN6I 2SOBA 1S4ZA 2NN6G 4LAAA 1LT4D 2WP8J 4FNFA 4K8IA 3D6CA 4Q0FA 1DOKA 4IUQA 2EYOA 1O80A 3BDOA 4RHRA 1JICA 1M4VA 3GTPB 3NQIA 1WTOA 1CHQD 3C1FA 4KJNA 4EQNA 2CHBD 4OGQC 4A3JB 1M8AA 1F9RA 3PO3B 1B4OA 1WTRA 4RWSC 5T1IA 3D4WA 2E2DC 2F3WA 4WRDA 4NW2A 1T5XD 3T4AC 2XRQD 1XXGA 3NTIA 1G91A 4XQQA 1DCZA 2IX3A 1EIHA 4X3UA 3TZDA 5KIXA 2Y0SB 1IL8A 1DOLA 1F2YA 1VF7A 5EBCA 3EVQA 1CT1D 2FINB 2A6HC 1D6EC 1NUCA 3MFGA 2K1BA 1EYCA 4RCOA 1A2TA 5ELFA 1H9SB 1KNAA 3KUPA 1SNQA 2F03A 1IKLA 4CHTB 1FYCA 4G4KA 1PMRA 1SNPA 1Q12A 3UI2A 2VB2X 4X3KA 2WKCA 3SVMA 2NVTB 4BS9A 2R6GA 2F0TA 4C1NK 2A6EC 2K28A 1QILA 3MXNA 5IGEA 1G6ZA 1HFNA 3SE0A 4BA1I 4U673 2E74C 1LT6D 1SFOB 1O7YA 3NTKA 1I4PA 2F0HA 4O42A 1LABA 3QOLA 3SXHA 2RSOA 1JWUD 2NVQB 3GTGB 4BA2I 4G7OC 5COYA 2CQAA 1Z7TA 4J6HA 4RGOS 1CI3M 2B2UC 2F0UA 1O7LA 5IGDA 1U4LA 3HG9A 1U4PA 1W6JA 3HOYB 5EQ0A 1R9TB 1BOSA 1SNDA 3HRZC 3QB3A 4H44C 3R2TA 1IW7D 1NCVA 4J8QA 5LL6X 2AQ2B 3O13A 3KBXA 1H9SA 1TU2B 3S2DB 2K5WA 1STAA 2L12A 3OIQA 2PZTA 1LACA 1ONLA 5DEHA 3S16B 1Y8NB 3J7YW 3H91A 4IUTA 2B8GA 4FF4A 4V190 3DUZA 2F4IA 2EYFA 2B39A 1DONA 1LTID 1FNUA 2PYKA 1TWCB 1ZEQX 3SHLA 2KJXA 2A68C 3S17B 3CRKC 4ZK9B 2QEJC 4ZQ3A 4QIWB 2BDOA 1KLGD 2WACA 4LMQD 5D3DA 5IT9L 4E6IA 1AZPA 1C4QA 1TIID 3W2DA 3GP7A 4L6TB 1BUVT 1OXVA 2B2VA 2NYZD 3I73A 2JA6B 3GTQB 3S2HB 1Y1VB 1ICWA 4EGVA 2H1EA 2F0NA 4DF7A 1PXUA 2Q8IB 3MA2B 3SK6A 4A93B 3VA5A 4OO1I 2G9DA 1SSOA 3K6OA 2JXMB 1D5ZC 3GV3A 1L0YB 1T5EA 2D2CC 1HUMA 3CRLC 4C3HB 3I4MB 4HMJA 2NVXB 2PZWA 4DAPA 3A8IE 2A6HD 3J81E 3S1NB 1I3QB 5EPJA 1PTOB 5C6AA 1VCIA 3JAML 3J80E 1ZYRC 2QF7A 4XDXA 1BXTA 2A6ED 2SNMA 2EYPA 2B2VC 2B2TC 1FD7D 2EY5A 3PUYA 1GHKA 5D14A 1TY2A 3A7LA 1ESRA 3P75A 2AWNA 2IJ0A 3KBGA 5BN4A 3RD4A 4G7HC 1LLRD 1YNND 1K8OA 5JOBA 4NDXA 4YIJA 2KUMA 4BWGB 2EY6A 1GUNA 3J80L 3H94A 1SNOA 1ZKOA 1V1PB 1Z6HA 3J81L 1D2BA 1YNJD 5HGTA 3WDNA 3FEWX 4RCNA 4XQJA 1WTWA 1B2TA 5CYUA 1I6VC 2IT1A 2K6AA 1WTPA 3ND9A 3DEPA 5IT9E 5FLXE 2JA7B 1SJED 5F2DA 3RUZA 4JK1C 2RBMA 3K5NA 1DOMA 4IN3A 2F0SA 4CKBA 1UNSA 1BF4A 2F0OA 4FF3A 2C9OA 2A68D 2QCPX 3NBIA 3MXUA 3I90A 1SYGA 1LTGD 3HKZB 1H9RA 1HQMC 4IUPA 1C48A 5JVH3 3BYYB 1D5XC 5E3FA 1AW7A 3DM1A 3FPPA 1EZ6A 2D5DA 1EWCA 3T51B 4QB4A 3E6ZX 1EY4A 2A69C 1EY0A 2AUJD 2K01A 3EJIA 2E2HB 2PZUA 5A2QE 1CQFA 1PTOH 1E2VA 2K5DA 2JSOA 4IFDG 1D1KA 2MJ8A 4TRDA 1TY0A 4H0LC 5IGGA 3M4OB 2R3ZA 1RODA 3K5LA 4I7ZC 3RLFA 4U68A 4K2KA 3GTLB 3S1RB 4G7ZC 5CR3A 5C3WA 1SBBB 1BBXC 1EU4A 3CKIB 1EY5A 2ZXOA 4CJ2C 4Y7NB 3BVGA 4PQXA 3NUCA 3TP8A 1UUPA 1BR9A 5I4DA 1RF2D 1X3PA 2O2LD 1DXMA 3L9AX 1PTOD 1TWAB 4HCEA 3IAYA 3BZDB 4MIUA 5CMDA 4DK1A 3H3VC 5IOCA 1A3VA 4UDUC 4R8NA 2VXWA 1ILQA 3EQLC 3A54A 2ZXRA 2JA8B 1PRTF 1ZXTA 4KV6A 2E2IB 2KCNA 3T16A 3C3LA 2DNCA 1I6HB 1A3UA 4OO1H 4HR7B 3H09A 1KDBA 5C4XB 3RZDB 1ZYRD 3I4NB 2MPMA 2BDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRK C;  4G7H C;  1Y69 U;  3VR5 A;  1SMY C;  3T53 B;  2AUK A;  3W3A A;  1EWH A;  4OGQ C;  5KNB A;  1LAB A;  2BDO A;  1K8O A;  1YNN C;  2EJG C;  2K32 A;  1GUO A;  2BA1 A;  2EDG A;  4H0L C;  3OW7 A;  3PV0 A;  3MFY A;  3M7N A;  3QJY A;  2EJF C;  2YYZ A;  4BA2 I;  2JE6 I;  1O78 A;  4G7O C;  1GUN A;  5JEA H;  3A8J E;  5A35 A;  3TZU A;  4I7Z C;  2BE5 C;  4KKU A;  5K36 H;  3RLF A;  2PCF B;  2E75 C;  1Z7T A;  3H94 A;  1VF5 C;  3QIA A;  1VDZ A;  4KI0 A;  1DCZ A;  4G7Z C;  4TQU S;  1DD2 A;  2BA0 A;  1ZKO A;  2KA7 A;  3SDZ A;  2JEA I;  4XTC S;  3IKJ A;  1OXX K;  3A8K E;  4PV1 C;  1GUS A;  1OXV A;  1CI3 M;  2E76 C;  2L5T A;  3BG3 A;  1O7L A;  3I73 A;  3DXJ C;  5BN5 A;  4OO1 G;  1Z6H A;  4KMU C;  3WDN A;  3U9S A;  2F1M A;  1Q90 A;  4RCN A;  5KNC A;  1B9M A;  1FR3 A;  3GQB A;  2Q8I B;  1K8M A;  1GUG A;  3VA7 A;  1I6V C;  5C0X H;  2PPB C;  1VF7 A;  2IT1 A;  5K36 G;  1CFM A;  3PUX A;  2CW0 C;  4H44 C;  1CTM A;  3PUZ A;  1IW7 D;  1OXS C;  2NN6 H;  3L7Z C;  4L8J A;  3VR4 A;  3ND9 A;  3FMC A;  3GD7 A;  3VR2 A;  4XIG S;  5BN3 A;  2A6H C;  3M4Y A;  1DXM A;  3OPO A;  3N6R A;  5KND A;  2KCC A;  4KHZ A;  1IW7 C;  1OXT A;  2ZT9 C;  3AB9 A;  1G29 1;  2JXM B;  3P20 A;  4JK1 C;  1H9S A;  2PNR C;  1BDO A;  1H9S B;  1TU2 B;  1V8Q A;  2DNE A;  3A7A B;  3PUV A;  4KKT A;  4LJZ C;  4DK1 A;  4GZY C;  1TKW B;  1T5E A;  2A69 D;  4DNT B;  3VR6 A;  2D2C C;  3CRL C;  1H9K A;  2D62 A;  4IFD H;  1IYV A;  3I4L A;  3VR3 A;  1E2W A;  2EJM A;  3PUW A;  4DNR B;  1LAC A;  3I72 A;  3LNN A;  1FYC A;  5JEA G;  3A8I E;  3NE5 B;  4JBW A;  2A6H D;  1HTP A;  1V43 A;  2EVB A;  1ONL A;  2V4D A;  3EQL C;  2A68 D;  1H9J A;  3HGB A;  3MXU A;  3T56 B;  1GHJ A;  3LWU A;  1PMR A;  1Y8N B;  2JEB I;  2LMC B;  1GUT A;  2B8F A;  4IQZ A;  1GJX A;  1Q12 A;  1HPC A;  1OXU A;  3IFT A;  3D4R A;  1VCI A;  2B8G A;  3OOC A;  1H9R A;  1ZYR C;  4DK0 A;  1QJO A;  2QF7 A;  4KKS A;  2NN6 I;  3ND8 A;  1HQM C;  3QG1 A;  1HCZ A;  1YNJ C;  4TKO B;  2K33 A;  2K7V A;  4KN4 C;  1E2Z A;  4H13 C;  2R6G A;  2NN6 G;  4KN7 C;  3FPP A;  2D5D A;  2A6E D;  1Y8P B;  2DNC A;  3T51 B;  1A6X A;  5C0X G;  2A6E C;  3D31 A;  4OO1 H;  4HR7 B;  1Q1B A;  2O5J C;  2A69 C;  1GHK A;  3PUY A;  3M85 A;  3BDO A;  2AUJ D;  3SE0 A;  1H9M A;  2BE5 D;  1B9N A;  3A7L A;  1Q1E A;  2DN8 A;  4BA1 I;  3KLR A;  2O5I C;  4IFD G;  1Y8O B;  1IYU A;  2AWO A;  4LK1 C;  1E2V A;  2A68 C;  2E74 C;  5BN4 A; 
#chains in the Genus database with same CATH topology
 3K80 C;  1ASY A;  4UP9 A;  1F9S A;  4LF9 Q;  4K5W A;  1CK1 A;  4O1N A;  3CXC A;  4BXX H;  1EYA A;  1D5M C;  1GUO A;  1KQS A;  3HOZ H;  2A1A A;  1JQY D;  3K57 A;  1XMQ L;  3H3V I;  1UEB A;  5COR A;  4NKL A;  2Q8R E;  1S5E D;  5JAV A;  4DV6 Q;  4FXK C;  1PZI D;  3UDG A;  1GXD C;  1RIP A;  3EN2 A;  4DR6 L;  2JYO A;  1AH9 A;  1C9O A;  3QIA A;  4NP5 A;  2Z6B A;  1XTD A;  2F3I A;  2VB3 X;  4A3C G;  4OL7 A;  2HCI A;  1HFG A;  4R8I A;  2YU9 H;  3QOJ A;  2L11 A;  3A74 A;  3VA7 A;  5CBA E;  4HID A;  4EQP A;  3S14 H;  4BBR H;  1GVP A;  4A3D G;  4JPB W;  2ENB A;  4DR7 Q;  4X3S A;  3X3N A;  2WAQ G;  5IGB A;  2D9U A;  1PH9 A;  4K5X A;  1BQQ T;  3MWY W;  2QA4 A;  2LY7 A;  5FJ8 H;  5IOD A;  4DFA A;  4KD3 A;  2K52 A;  5IWA L;  2KEC A;  3BZC A;  4HSV A;  1A2U A;  2PQA A;  3VR6 A;  2RDG A;  5FK9 C;  1PZJ D;  1CHP D;  1K0R A;  3PO2 B;  1RD9 D;  4V0B A;  2PNH A;  5EAY A;  5M3F B;  3HKS A;  2EYM A;  2K03 A;  3DWA A;  4GKK L;  3CQZ B;  4J15 A;  3U50 C;  2B2W C;  2G5D A;  3F8T A;  3HOZ B;  3OMG A;  5LMU L;  3P1H A;  1QCB D;  1S5C D;  1NE3 A;  1ENC A;  4NB3 A;  3VYS A;  3PO2 G;  4H13 C;  4JW0 A;  1I4H A;  3KJP A;  3HOW H;  1PYW D;  2UUA L;  1HRJ A;  4A3E B;  4P73 A;  5L37 A;  1X3F A;  1Q1B A;  1PRT B;  3K0Y A;  4CDF C;  1ESF A;  4ULL A;  4X62 Q;  4Z9C B;  4IUV A;  1SYD A;  1WTQ A;  1QB5 D;  4ZAI A;  2O5I C;  1B50 A;  5E4X A;  1DZ1 A;  4RFB A;  4OWW B;  2Z6K C;  5ISR A;  2LKV A;  5JJI A;  2AHO B;  4BXX G;  4K0K Q;  5EPL A;  2OXP A;  4FDB A;  2K32 A;  1F77 A;  3GTK B;  5C4H A;  3MVV A;  3M7N A;  2BCO A;  3BYT B;  2UUC Q;  5LL6 S;  4A3J H;  5CV6 A;  1JOQ A;  3D8G A;  4A3M B;  1X3Q A;  1JWM D;  3RR5 A;  2F0D A;  1N34 Q;  3RZD H;  1SE4 A;  4QCL A;  1SMX A;  5M9O A;  3KLS A;  5IP9 H;  3H0G G;  1VMP A;  3W1G A;  5C4X G;  1WYD A;  3KF6 B;  3F2D A;  4GOP B;  1PLF A;  4A3M G;  4R4T A;  2F0Q A;  1KAB A;  4DN4 M;  2ES2 A;  5CV8 A;  4R1J A;  1A15 A;  1CZG A;  4LUZ A;  3MXN B;  4ODG A;  4B3S Q;  1N33 Q;  3TN2 A;  2FMM A;  3GD7 A;  3VR2 A;  1XTC D;  2RHS B;  3QO2 A;  4X65 Q;  4B3M Q;  3HOU H;  5CBE E;  2PW5 A;  3N6R A;  2FHT A;  2JN4 A;  4K6L A;  4CJ1 B;  1S5F D;  1QZH A;  3P20 A;  4WFN 3;  3PF4 A;  1W6K A;  4N9P A;  3X3M A;  4LJZ C;  1IHZ A;  3CCU A;  4DU9 A;  3I4O A;  3Q0A A;  3OW2 A;  4DA2 A;  3HS0 C;  4C2M B;  3E9H A;  4DV0 Q;  3NE5 B;  4CJ0 B;  5JJK A;  1GKH A;  2D0P A;  2VUM G;  4DGZ A;  3HGB A;  5FO8 B;  3T56 B;  2F0J A;  1GHJ A;  1SYE A;  3IFT A;  3OOC A;  4A3D B;  1Q82 C;  1LM0 A;  2HUG A;  2X6L A;  2HHH Q;  5DAU A;  5ELB A;  4TVA B;  3OSO A;  4BY7 H;  3R3O A;  2SNS A;  4DV5 Q;  3D31 A;  2NVT H;  2B2Y A;  2Q8T A;  1VQG A;  1I4Q A;  2RVL A;  1YNX A;  1EY9 A;  1B9N A;  3DWP A;  5IYC G;  4LK1 C;  1MSH A;  2K14 A;  3RN2 A;  2ZT9 C;  4A3F H;  4JI8 L;  1LTS D;  1SDF A;  2R7Z G;  1XMQ Q;  2K5H A;  1IBL L;  2XRS D;  3J7A F;  4JI0 Q;  3OIP A;  4OX9 Q;  4F8M A;  2MUY A;  3UE1 A;  3HOU B;  3V2T A;  3OW7 A;  1STY A;  2MGS A;  1R4P B;  2WII B;  3URY A;  4C3J G;  2XTI A;  1YI2 A;  1GM5 A;  2AQ1 B;  2P5Z X;  4L5T A;  3KJO A;  3NQT A;  2PI2 E;  1SFO H;  2E2J H;  1UE1 A;  2F0W A;  5J22 A;  2R61 A;  1F2L A;  4LF6 Q;  5GAH C;  2BOS A;  5K36 H;  1EY6 A;  1A3T A;  2EYH A;  1BCP B;  1ASZ A;  1B8A A;  1CSP A;  4IO9 A;  1VQN A;  3S15 H;  1J8I A;  4KY7 A;  3NK9 A;  1B3A A;  2L9H A;  3STB D;  4DR4 Q;  4RKL A;  2DY8 A;  2UUA Q;  2F0G A;  4PMW A;  3PUX A;  1HA5 A;  3M9B A;  5CV4 A;  2WAQ B;  2VW9 A;  3NHH A;  1HUN A;  2O4X A;  1I4R A;  2JK8 A;  1YZ6 A;  2OEO A;  2Z4H A;  4FP5 D;  4OIJ A;  1RKN A;  1VQJ A;  5IP7 H;  5A2Q L;  1OXT A;  3KYH C;  4DUZ L;  1EYD A;  1LUZ A;  4DV2 L;  2PNR C;  1FNV A;  1RCV D;  5G3L F;  1YHB A;  3A7A B;  2NB0 A;  1WCM G;  2A69 D;  3UDI A;  3H3V H;  1KLU D;  3U58 A;  3I70 A;  5C4J H;  2D62 A;  1EIG A;  1HNW Q;  2IY5 B;  1N9W A;  3I72 A;  2N88 A;  1V43 A;  2NTT A;  3K7A H;  1DM0 B;  2K50 A;  3HKZ G;  3TBI B;  3C46 A;  1I4G A;  1X3G A;  3MHB A;  1HQR D;  2CFM A;  3N52 A;  3RN5 A;  3HOU G;  1AP0 A;  3HOX B;  2EOT A;  3A5U A;  3AFQ A;  1TXY A;  1KIX A;  5IYD H;  4WOR A;  4KN7 C;  5HY6 A;  3J7A 5;  2A5H A;  2I46 A;  4IZ8 A;  4JCV E;  4DNI A;  3S16 H;  3NPP A;  2R92 B;  2Z4I A;  3M85 A;  3H15 A;  1AE2 A;  4R4I A;  4JBK A;  1EL0 A;  2DN8 A;  4DV3 L;  3GTO B;  1JOR A;  2TMP A;  4K8J A;  1PV4 A;  3ULL A;  4MNO A;  1V1P A;  2OF1 A;  4YWL A;  4K2L A;  2BA1 A;  2EDG A;  1TS4 A;  3TME A;  4DV0 L;  5E7N A;  3EIV A;  3PV0 A;  4GNX B;  4JI2 L;  3G6J B;  2EJF C;  2EZV A;  2FFK B;  3JC6 6;  3QWN A;  2N78 A;  1NSN S;  5JEA H;  4KKU A;  5C3X A;  4A3F B;  5FLX c;  3LX0 A;  3BS1 A;  1TWA H;  5KGU A;  1QG7 A;  4DAM A;  2KOL A;  2MP1 A;  3BVM A;  1R4Q B;  1BO0 A;  1I50 B;  3BJU A;  2N49 A;  4BY1 B;  5TSS A;  4DR2 Q;  1MSG A;  2NZ1 D;  4BBS B;  4CDD C;  2F0F A;  2GVA A;  4DV7 L;  1FR3 A;  4Y52 H;  1GUG A;  2HT1 A;  2PPB C;  4X3T A;  1VQD A;  2NN6 H;  1CM9 A;  3TP6 A;  5D3I B;  4C56 C;  1VQ9 A;  2KVM A;  3HOV B;  2RQX A;  4AH6 A;  1X54 A;  3IL8 A;  4KHZ A;  1MHW C;  4PG3 A;  1IBL Q;  2A19 A;  2OQK A;  1JE5 A;  1TVX A;  4A3K B;  3FKI H;  1SE3 A;  4UAI A;  3D6W A;  1O7Z A;  3KF8 A;  1HTL D;  3U4V A;  2HQL A;  2DUD A;  3VDY A;  3K5O A;  3CAM A;  4DV1 L;  3PIP 3;  2JA5 H;  1Q3L A;  3S1Q H;  1GUT A;  3I4N H;  1OXU A;  3JAM E;  1JOK A;  2ICE C;  5H1S E;  5BR8 Q;  1STE A;  2K33 A;  1XMO L;  1KDA A;  1PRT C;  1JJ2 A;  4N9T A;  4M1U B;  1KRS A;  4ZUI A;  5E1F A;  3HP3 A;  2GA4 B;  1YJW A;  1U4R A;  5AJ3 Q;  1B1Z A;  1MGS A;  1Q8K A;  1TS5 A;  1HJP A;  4TSS A;  5M3M B;  1I50 H;  3OWE B;  1H9M A;  2BE5 D;  2X69 A;  5CC4 A;  3AMU A;  4POF A;  3NP8 A;  4EQO A;  1Y8O B;  2JA8 H;  1SE2 A;  2AWO A;  3SK4 A;  1C0A A;  1PZK D;  2SDF A;  2QEX A;  1B70 B;  2IL8 A;  4QIW E;  3OMC A;  4ID6 A;  1LTT D;  2X6G A;  2JA6 H;  1X6O A;  3K5M A;  3Q24 A;  1XMO Q;  4GLX A;  2A8V A;  4FF2 A;  2M00 A;  4LF4 Q;  2NVY B;  1NAP A;  1Y1W H;  3I7F A;  4GLV B;  4CBV A;  2K5V A;  2JE6 I;  4RH6 A;  1O78 A;  2A73 B;  1EFI D;  2LFN A;  3J81 j;  2NTS A;  4S3S A;  3P7J A;  2JEA I;  3IKJ A;  3A8K E;  3QR8 A;  4ALP A;  4H7B A;  1GUS A;  4OO1 G;  4JI3 L;  2OWO A;  1O7I A;  3W5O A;  3KDF A;  1JE4 A;  4P74 A;  3A56 A;  1N34 L;  4C3H H;  3LWE A;  1B9M A;  1KDC A;  3MEH A;  2XSC A;  3FRP B;  4XXE A;  4JVZ A;  3GTJ B;  4PNY A;  1CFM A;  4XT3 B;  2CWA A;  3CU7 A;  2KEN A;  3FMC A;  3I91 A;  2J7Z A;  5BN3 A;  3GO5 A;  4LF5 L;  1G2T A;  1K3B C;  4QMG A;  4DV6 L;  3IRB A;  4BBS H;  5CV5 A;  3CCL A;  3AB9 A;  3I3C A;  1HNZ Q;  4IJH A;  1X65 A;  1KRT A;  4A3L H;  4X64 Q;  4JI1 Q;  5LMN W;  1N32 L;  1AFP A;  4O2D A;  2F4V Q;  4JI4 L;  5IE8 A;  2IW3 A;  5EBD A;  1V8Q A;  4LF9 L;  1FJG Q;  4KKT A;  1JWS D;  2VNU D;  3CC2 A;  4CKC A;  1STH A;  4ZYS A;  2J4X A;  4IFD H;  1X9N A;  4YY3 Q;  3LNN A;  1UWV A;  3FDT A;  3EBE A;  1MI2 A;  3F2U A;  4DV7 Q;  2OTJ A;  1GUW A;  2KHI A;  4QUF A;  2MQH A;  3GTK H;  1TWG B;  2H4O A;  2IX0 A;  4YY3 L;  5M5W B;  4BBR B;  1EU3 A;  4MN3 A;  4PZ6 A;  2E8G A;  1ENF A;  2K7V A;  4KN4 C;  1BCP C;  5FLX L;  2IWH A;  1FJG L;  5J3B A;  2F4V L;  1STB A;  1A0I A;  1PH1 A;  2ICI A;  1KL9 A;  1E3P A;  5JVG 3;  1EQQ A;  1SAP A;  5GQO A;  4XT1 B;  4FO2 A;  2M9V A;  2QIL A;  5CV9 A;  1A62 A;  2NVX H;  1QNU A;  3MXP A;  1KD1 C;  4C3I B;  3SEB A;  1B3Q A;  4X64 L;  3VR5 A;  4HSP A;  5M5X H;  2LSS A;  5FOB B;  3VYR A;  3W3A A;  2OTL A;  5EKI A;  2MHV A;  4JI8 Q;  2M2L A;  4F87 A;  4F7X A;  3TP7 A;  4A3G G;  4HED A;  4JOI A;  1NR4 A;  3F2C A;  2F0E A;  3CCJ A;  1TR5 A;  2YYZ A;  2MO0 A;  4A3F G;  4YHH Q;  4ZLT F;  5A35 A;  3CCS A;  2BE5 C;  2PCF B;  1SJH D;  1K28 A;  4R9W A;  5LMN L;  3D4D A;  1F2Z A;  4KI0 A;  4TQU S;  5CV7 A;  4WJ4 A;  1X3E A;  3MXG A;  4HIK A;  2KED A;  4FXG C;  1K83 H;  4NXM Q;  3DXJ C;  4DV4 Q;  5IYC H;  1JC7 A;  3KK7 A;  3U9S A;  2F1M A;  1YEZ A;  4A3B H;  1SYC A;  5IIF A;  4HN7 A;  1HZA A;  4GKJ Q;  1L2F A;  2F0L A;  2XIW A;  5FLM H;  1N36 Q;  5T1G A;  4KTA A;  4L5S A;  4LF4 L;  2WIN B;  5NUC A;  3S15 B;  3PUZ A;  3GTG H;  3TSS A;  3VR4 A;  1U4M A;  2UXD Q;  5FLM G;  4N8X 1;  3MZ5 A;  1NMF A;  2HIX A;  3BDC A;  2B2Y C;  2ID0 A;  2EXZ A;  1WOC A;  2G9H D;  5EKL A;  5I6W A;  5KND A;  4QUC A;  4XYO A;  1G29 1;  1EZ8 A;  3CHB D;  3MTS A;  5C3E H;  3HEJ A;  4ZRZ A;  4AYB E;  3H0G B;  3H6M A;  1VQC A;  1H9K A;  4RGN A;  4DR3 L;  1DGS A;  1ET9 A;  1E0B A;  4JI7 L;  4K5V A;  1L0W A;  2QKI C;  4JI6 Q;  2CCZ A;  2V4D A;  4LWC A;  4PZ8 A;  4R4C A;  1S5D D;  2JQO A;  2JEB I;  1HPC A;  3G4S A;  4DK0 A;  3NSW A;  2R7F A;  2E2H H;  1TWF B;  3ZYY X;  1TT2 A;  2N55 A;  4MTN A;  2EPB A;  3V96 A;  3F2B A;  1CA6 A;  4A3B G;  1I5F A;  3NXW A;  2Q2I A;  1A63 A;  5C0X G;  1BBW A;  1U9R A;  2CW0 D;  2PW7 A;  1BCP F;  4RA8 A;  2O5J C;  3JAM c;  1PRT D;  5C0X I;  5I6Y A;  4M8A A;  4A3G B;  1U0L A;  3KLR A;  1EEF D;  5IYD G;  4K0K L;  1IKM A;  1QE6 A;  3NEN A;  4HAE A;  1PTO C;  5FO7 B;  4IAL A;  2PQE A;  1STG A;  3T53 B;  1SXT A;  3NBH A;  1ENA A;  1EWH A;  4POG A;  2D0O A;  2K75 A;  2NZO A;  4BY7 B;  4AYB B;  5KYL A;  2Z0S A;  2NWG A;  3CC4 A;  1SEB D;  3NEL A;  1XX8 A;  1Z47 A;  2CKZ B;  5GAG C;  3TZU A;  2ALY B;  5ELD A;  3S17 H;  1WJJ A;  2XWB B;  4DK6 C;  4DR2 L;  1KTK A;  1CKM A;  2KA7 A;  5J1Z A;  3I4M H;  1TQO A;  1XPU A;  3D3R A;  5BN5 A;  1WTH A;  3GTM B;  4LFC L;  1EQV A;  2F52 A;  2Y0S E;  3VYU A;  5C4Z A;  4A3I G;  4K6D A;  4DR3 Q;  4ME5 A;  3ICE A;  4OIK A;  5IGC A;  3GQB A;  5FO9 B;  3MAQ A;  4JI6 L;  4JYA Q;  4PMB A;  4RMF A;  1B7Y B;  4JI2 Q;  5KRU A;  1VQB A;  3K58 A;  3NWS A;  3T13 A;  2VUM B;  2R93 B;  2XVS A;  1TWH B;  4A3B B;  4H02 A;  3ULP A;  5D65 A;  1G2S A;  1B53 A;  2JA5 G;  2DNE A;  5I9O A;  3PUV A;  1VQM A;  2KHS A;  1MJE A;  4A3I B;  1VMC A;  1V9P A;  2HDL A;  2L0C A;  1S72 A;  3SGI A;  1ML0 D;  4RKB A;  3I4L A;  3PMF A;  5EPK A;  1RTO A;  2EJM A;  4A3L G;  4ZKB B;  3J7Z C;  4FXD A;  2NUC A;  3WOE A;  5LHY 1;  4GKJ L;  1V1O A;  1DYQ A;  3BZK A;  2TSS A;  4YHH L;  2A74 C;  3LWU A;  1VQP A;  4IQZ A;  3ONA B;  5C44 B;  1AZQ A;  3D4R A;  4B08 A;  4NXM L;  1XYI A;  4KKS A;  4AYB G;  2LS0 1;  1TWC H;  3CW2 C;  2FJ2 A;  4A4I A;  3J7A V;  3ND8 A;  4FYD A;  4TKO B;  1OO9 B;  2B29 A;  1MKH A;  2VQE Q;  4KHP L;  4QJF A;  5JPM C;  1HR0 W;  1XNQ L;  5G3L D;  2XN9 C;  1A6X A;  4DR6 Q;  1BCP D;  5C4J B;  1SYB A;  2B2U A;  2PMZ E;  3UDX A;  3RZO H;  1OTC A;  1BVS A;  1WVL A;  1SE8 A;  5M5Y B;  1AE3 A;  4CDE C;  1Q1E A;  4EVO A;  4RGM A;  1I94 L;  2XWJ B;  2B63 B;  4DUZ Q;  3CCM A;  2L4N A;  3A55 A;  4X66 L;  1Y69 U;  3CF5 A;  3AYH B;  3GV6 A;  4IFD I;  4PMC A;  3I4N G;  4GN3 B;  1YNN C;  2UXC L;  1XNR L;  5ELN A;  1QNK A;  2EJG C;  2JA7 H;  2DY7 A;  1PFS A;  2VUM H;  3FVQ A;  4C3J B;  2GVB A;  2EYJ A;  4NPS A;  4AQY L;  1RDP D;  3PIO 3;  4YWK A;  2Z1C A;  3A8J E;  3C1E A;  4DXF A;  3S2H H;  2R7D A;  2NVY H;  1RJT A;  4RHS A;  3R93 A;  1Y1W B;  2F0I A;  2UXC Q;  1DD2 A;  3SDZ A;  3GTP H;  1SMY D;  2L5T A;  3NBH B;  5LMU Q;  3GDE A;  3RMH A;  2BH2 A;  5HUR A;  5DNF A;  1H95 A;  1N8R C;  1EOV A;  4PZ7 A;  4LFA L;  1K8M A;  1PA6 A;  1ILP A;  1HNZ L;  5K36 G;  1EY8 A;  4NMZ A;  1JB7 A;  1OXS C;  4JI4 Q;  4XIG S;  5E4W C;  3OPO A;  3J81 c;  3E0E A;  4HMI A;  2B2T A;  5DM7 3;  1IW7 C;  5C0X J;  1PTO F;  1PH7 A;  2IPK D;  3RZO B;  3CCV A;  2F0P A;  1TKW B;  2NBF A;  3KOJ A;  4ME3 A;  2B63 H;  4IUR A;  1HA6 A;  1PH8 A;  2RA4 A;  5M3M H;  1Q81 C;  4A3E G;  4JBM A;  2AMC B;  4X62 L;  3Q23 A;  1EOT A;  3FHW A;  5KYI A;  1PFM A;  2LXJ A;  2JA7 G;  4DAY B;  1F9P A;  2L15 A;  4HTH A;  4ABN A;  1GJX A;  4GNX A;  2N3S A;  1QOH A;  1LV9 A;  1QJO A;  3M3Y B;  2JP1 A;  4KJO A;  3TDQ A;  1HCZ A;  1YNJ C;  5JEA J;  1EWI A;  4C2M H;  1UAP A;  1HR0 L;  3S1M H;  3UE0 A;  5DM6 3;  1B44 D;  2QGQ A;  4KD4 A;  4DXG A;  1EEI D;  1PFN A;  3CP0 A;  5EKK A;  4HCS A;  3EFX D;  1FNW A;  1SRO A;  2RDF A;  2Z9H A;  2Z8L A;  4WJ3 M;  4F88 A;  3OWF A;  3J80 c;  3R8B A;  3CCR A;  5AJ3 L;  1IYU A;  2ZTD A;  3ITP A;  5KEE A;  1PH5 A;  1C7Y A;  3G7L A;  4CKE A;  3V05 A;  3K59 A;  5IWA Q;  3BVZ A;  2AUK A;  4DPG A;  2XNA C;  2EYL A;  3K0X A;  1PVO A;  4FF1 A;  1N33 L;  1S5B D;  5BR8 L;  4BBS G;  1S3O A;  1SNM A;  1LO5 D;  3MFY A;  3QJY A;  1KNE A;  4KLK A;  5JJZ A;  3OYY A;  3U9O A;  1EQT A;  2E75 C;  1VF5 C;  1UEA B;  1VDZ A;  1AN8 A;  3CME A;  1A8V A;  2BA0 A;  1HZB A;  4XTC S;  3E5S A;  5I9P A;  1YHA A;  3BG3 A;  2E2J B;  2OT2 A;  3PCO B;  3TP5 A;  1Q90 A;  1Z9F A;  1WTV A;  1PH4 A;  1GO3 E;  2PO4 A;  5C0X H;  1CKN B;  2RSN A;  1I4X A;  3DWQ A;  1WD0 A;  3M4Y A;  1WTX A;  1NMG A;  1F9Q A;  5K5P A;  3S1R H;  1KAW A;  2E5L Q;  4G57 A;  2R7Z B;  4OWT B;  2YTY A;  2RKS A;  5C44 G;  4XQN A;  1LTR D;  2KHJ A;  5ELE A;  4JC0 A;  1T9H A;  1PDQ A;  2QDB A;  4CGY B;  5EJW A;  3VR3 A;  3PUW A;  3FP9 A;  2JA8 G;  3K81 C;  5EGT A;  1E22 A;  4QF4 A;  1XPO A;  1C8C A;  1H9J A;  4OHJ A;  2LMC B;  4NXN Q;  1X32 A;  3I55 A;  4J1M A;  1XNR Q;  1L1O B;  1MBY A;  1EY7 A;  2L1B A;  4LFB Q;  1E2Z A;  1JR0 D;  4Q5V A;  3KFU A;  4HJ7 A;  1GD7 A;  3E9I A;  1EIY B;  2HD3 A;  1HXY D;  1Y8P B;  2Y0S G;  2J0T D;  3I8Z A;  4FVM A;  4JI1 L;  3L2P A;  1N32 Q;  1QWY A;  1VQK A;  3WOF A;  4IPH A;  4KY6 A;  2EE1 A;  1QVG A;  3T1Y Q;  1IXR A;  1HH2 P;  3SR1 A;  1J9O A;  1F2M A;  1SYF A;  1EFW A;  4OON A;  2Q2U A;  1NJI C;  1ET6 A;  4B3S L;  1MIU A;  3PIO A;  1LTL A;  3SK8 A;  2K04 A;  4DR7 L;  2AQ3 B;  2YU9 B;  3ERS X;  4C1N I;  1CA5 A;  2UXB Q;  3KDF B;  2WB1 B;  2EY2 A;  4B9X A;  1SMY C;  4I65 A;  3G48 A;  3MC0 B;  3I56 A;  1IYJ B;  1TS3 A;  5C5L A;  2ZXP A;  3CD6 A;  4A3J G;  4B3T L;  4O0A A;  3S1M B;  1QZG A;  3E3X A;  5LMN Q;  4KK7 A;  3C2P A;  1LTB D;  2F0M A;  5C3E B;  1SN8 A;  2RF4 A;  2ZJQ A;  4R4O A;  3DEO A;  3AFP A;  3NTH A;  5I2X A;  1OXX K;  4PV1 C;  3VYT A;  5JPN C;  4KMU C;  3Q22 A;  3Q6S A;  2UXB L;  1AEX A;  4C3I G;  3STB C;  1FGB D;  5IP9 G;  1U5K A;  2HQE A;  4ILW A;  3HOX G;  2L55 A;  1CTM A;  3L3O C;  2SEB D;  3L7Z C;  3T1H Q;  1RL2 A;  3B6Y A;  2K5N A;  2FMC A;  4K14 A;  3ERQ A;  2KCC A;  3PGZ A;  4DAV A;  4LFB L;  4QY7 A;  4EQ5 A;  4APV A;  3FPU B;  4IUU A;  4UHV A;  3ERO A;  1BDO A;  1JCK B;  3S14 B;  3PQI A;  4DNT B;  1XWE A;  1JJG A;  4DAY A;  5IYB H;  3OTO Q;  3FKI B;  4JBW A;  2C5C A;  2EVB A;  1Y1V H;  2HCC A;  4JOI C;  1Y14 B;  3OHX C;  1HHV A;  2V1C C;  4LF6 L;  1JOO A;  2KQ3 A;  4KY5 A;  1BKB A;  3PF5 A;  1G8Z D;  1MD2 D;  3KLS X;  4BBR G;  1L0X B;  4OX9 L;  1VQO A;  4JI0 L;  2HDM A;  3QG1 A;  1CZW A;  4RGT A;  3PO2 H;  1TS2 A;  4C3H G;  1Q8I A;  2KEE A;  4UY8 C;  4LW1 A;  5ELC A;  3CQZ H;  5C4X H;  3S1Q B;  4MHE A;  2ZTC A;  4P2C B;  1LT3 D;  1SR3 A;  2F0V A;  2PMZ B;  3M7G A;  5M5X B;  1BNZ A;  1E1O A;  3H0G H;  1Q7Y C;  1XNQ Q;  3DM3 A;  1WFQ A;  2RDH A;  4ZUJ A;  2WB1 E;  1HNX Q;  2WKD A;  3ULJ A;  2F0K A;  3K7A B;  1Y1W G;  1WCM H;  3M4Q A;  2I07 B;  5KNB A;  1JB3 A;  2HHH L;  1KXL A;  2OQ0 A;  1NBW A;  2JJQ A;  5CGK A;  4B9W A;  3HOW B;  2K05 A;  4YCW A;  3HOZ G;  2ZM6 L;  1LTA D;  4XYQ A;  2UU9 Q;  1VQ7 A;  1K83 B;  3T1Y L;  1PFB A;  1JMC A;  3MEF A;  4IUN A;  4I7A A;  2E76 C;  3CPW A;  2F3V A;  3E0J A;  1K0S A;  1XPR A;  3AU7 A;  3SK5 A;  2B2W A;  1Q46 A;  1XJV A;  4IPC A;  4YWM A;  5KNC A;  4OWX B;  4GKK Q;  4L63 B;  4LFC Q;  3R2I A;  2FXQ A;  1KAA A;  4LF8 L;  2CW0 C;  4RAU C;  1CUK A;  2WV6 D;  4L8J A;  2EY1 A;  2K5Q A;  4HJ8 A;  2UU9 L;  3NWT A;  1CQV A;  1LT5 D;  4KHV A;  4WJW A;  5AFW A;  5ELO A;  3UDF A;  3TS0 A;  5FKA C;  3DMU A;  5J39 A;  2JA5 B;  1DJR D;  3S9W A;  5I2Y A;  1STN A;  4UPA A;  4GZY C;  1NNX A;  3TEH B;  5C5M A;  3EA6 A;  1RTN A;  3DHQ A;  1YIJ A;  1M90 C;  1IYV A;  5JEA G;  1E2W A;  1K9M C;  5FJ8 G;  4DNR B;  1II3 A;  1GOZ A;  1HZ9 A;  1HTP A;  3IFD A;  1WD1 A;  2MNA A;  1RHP A;  1WCM B;  4ZKC B;  1NR2 A;  3U4Z A;  2IX1 A;  2CVR A;  4N8F A;  3TQY A;  2B8F A;  3HZX A;  1D1I A;  2K4K A;  3BDL A;  5IGF A;  1SNC A;  4IFD J;  3L0O A;  1CSQ A;  4P75 A;  3AEV A;  2NN6 I;  2SOB A;  3ZJY C;  1S4Z A;  1VS0 A;  2NN6 G;  4LAA A;  1LT4 D;  2WP8 J;  4FNF A;  2IHF A;  4L5Q A;  4K8I A;  3D6C A;  4A3C H;  3W1B A;  2ZJR A;  2EIF A;  4Q0F A;  1DOK A;  4IUQ A;  2EYO A;  1O80 A;  3BDO A;  4GN4 B;  4RHR A;  1JIC A;  1M4V A;  3HOW G;  3GTP B;  3CPF A;  1SLJ A;  2HIV A;  2VL6 A;  3NQI A;  1WTO A;  1CHQ D;  3C1F A;  4DUY Q;  4KJN A;  1G51 A;  4EQN A;  4OGQ C;  2CHB D;  3KLW A;  4A3J B;  1M8A A;  1F9R A;  3PO3 B;  1B4O A;  2H5X A;  5C44 H;  1WTR A;  4QQB X;  4RWS C;  5T1I A;  2XGT A;  2E2D C;  3D4W A;  2F3W A;  4UP7 A;  4WRD A;  3OTO L;  4JI7 Q;  4NW2 A;  1T5X D;  3HOY H;  2VQF L;  3D0F A;  3T4A C;  2XRQ D;  2CH4 A;  1XXG A;  3NTI A;  1G91 A;  4XQQ A;  1DCZ A;  2ASB A;  2IX3 A;  1EIH A;  4X3U A;  4GLA C;  3TZD A;  3PO3 G;  3HKZ E;  5KIX A;  2YTX A;  1VQE A;  1L1O A;  2CQO A;  2Y0S B;  1IL8 A;  1DOL A;  1F2Y A;  4RG1 A;  2VQE L;  3T1H L;  4B3M L;  2B3G A;  4KHP Q;  1SRU A;  4LUO A;  2KCT A;  4DV4 L;  1VF7 A;  5EBC A;  3EVQ A;  3HOX H;  2KBN A;  1CT1 D;  3GTQ H;  2FIN B;  2A6H C;  1HZC A;  1D6E C;  1NUC A;  4C3J H;  3MFG A;  2K1B A;  1EYC A;  4A3I H;  2I5H A;  4RCO A;  1A2T A;  5ELF A;  1NY4 A;  2R92 H;  1K8G A;  1H9S B;  4DV5 L;  1YIT A;  1KNA A;  2VZA A;  4JI3 Q;  3KUP A;  1PH3 A;  1SNQ A;  2R7Z H;  2F03 A;  1IKL A;  2GN5 A;  4CHT B;  1FYC A;  2OCE A;  4Y7N H;  2UUC L;  4G4K A;  1HNW L;  1PMR A;  3TS2 A;  1SNP A;  4EX5 A;  1Q12 A;  3UI2 A;  2VB2 X;  4X3K A;  4GN5 A;  2WKC A;  3SVM A;  2NVT B;  4BS9 A;  2R6G A;  4DKA C;  2F0T A;  4C1N K;  2A6E C;  2K28 A;  1QIL A;  3MXN A;  3RLO A;  1EYG A;  5IGE A;  1G6Z A;  1HFN A;  3SE0 A;  1L1O C;  1PYB A;  5IY0 A;  4BA1 I;  4U67 3;  5DLQ E;  1YJ9 A;  2E74 C;  1LT6 D;  3KF6 A;  2ZM6 Q;  1SFO B;  1O7Y A;  4GS3 A;  4HJA A;  1ICF B;  3BU2 A;  3NTK A;  1I4P A;  1IBM L;  4NXN L;  2F0H A;  2RCN A;  1V1Q A;  1FL0 A;  1UE7 A;  1LAB A;  4O42 A;  3QOL A;  1YVC A;  3SXH A;  2RSO A;  1JWU D;  2NVQ B;  4A3G H;  3GTG B;  4BA2 I;  4G7O C;  5COY A;  4LF5 Q;  2CQA A;  2AKW B;  1Z7T A;  4J6H A;  4RGO S;  1P8L A;  1CI3 M;  2B2U C;  2F0U A;  1O7L A;  5IGD A;  1U4L A;  3HG9 A;  4DV3 Q;  1U4P A;  1W6J A;  4OEL B;  3AQQ A;  3HOY B;  5EQ0 A;  1R9T B;  2QW7 A;  1BOS A;  1SND A;  1YBY A;  1IBK Q;  3HRZ C;  1I3Q H;  4LNQ A;  3QB3 A;  2CH4 W;  4H44 C;  3R2T A;  1IW7 D;  3CCQ A;  4JBJ A;  1NCV A;  1IZ6 A;  4J8Q A;  5LL6 X;  1YJN A;  2AQ2 B;  3O13 A;  3KBX A;  1H9S A;  1CKO A;  1TU2 B;  1K73 C;  3S2D B;  4A93 G;  2K5W A;  1STA A;  1K3R A;  2L12 A;  4UP8 A;  3OIQ A;  4A3K G;  5JJL A;  2PZT A;  1LAC A;  1QVF A;  3HOV H;  1ONL A;  4P72 A;  5DEH A;  4MZ9 A;  3S16 B;  1Y8N B;  3J7Y W;  2UXD L;  3H91 A;  2PQA B;  4IUT A;  2B8G A;  4FF4 A;  4V19 0;  3DUZ A;  4HJ9 A;  1QUQ B;  4QL5 A;  2F4I A;  2YV5 A;  2EYF A;  3CC7 A;  1YHQ A;  2I0Q A;  2B39 A;  1DON A;  1LTI D;  1FNU A;  1S40 A;  4YCU A;  2PYK A;  1HR0 Q;  4X6A H;  1FGU A;  1TWC B;  2R93 G;  1J6Q A;  1ZEQ X;  1IL2 A;  3F1Z A;  3SHL A;  3RNU A;  2KJX A;  5IYB G;  2A68 C;  3S17 B;  3CRK C;  1EIF A;  4ZK9 B;  2QEJ C;  4ZQ3 A;  4HIO A;  3CCE A;  4QIW B;  2BDO A;  2JA6 G;  3RLN A;  2I5M X;  1KLG D;  1QVC A;  1VQL A;  2WAC A;  4LMQ D;  5M3M G;  3HFZ B;  5D3D A;  5IT9 L;  4E6I A;  1AZP A;  1C4Q A;  2LXK A;  1TII D;  2R93 H;  3LGJ A;  3GP7 A;  3W2D A;  1TWH H;  4AIM A;  4L6T B;  1BUV T;  1OXV A;  2B2V A;  2NYZ D;  3I73 A;  4IPG A;  2JA6 B;  3GTQ B;  3S2H B;  3PIP A;  4LF7 Q;  1Y1V B;  1VQ5 A;  1ICW A;  4EGV A;  2H1E A;  2F0N A;  4DF7 A;  1PXU A;  3ER0 A;  2Q8I B;  3WWV A;  3MA2 B;  4LUV A;  2WAQ E;  3SK6 A;  1VQ8 A;  4A93 B;  2DJG C;  3VA5 A;  4OO1 I;  2G9D A;  1X55 A;  1D8L A;  1SSO A;  3K6O A;  1IBM Q;  2JXM B;  3CMA A;  1D5Z C;  1VQI A;  3GV3 A;  1J5E L;  4DR1 L;  1L0Y B;  1T5E A;  1Y1V G;  2D2C C;  1HUM A;  2RHQ B;  3CRL C;  3FKI G;  4C3H B;  3I4M B;  4HMJ A;  2NVX B;  2PZW A;  2VY3 A;  3HOY G;  4DAP A;  3A8I E;  2A6H D;  3J81 E;  3S1N B;  1I3Q B;  5EPJ A;  1I94 Q;  1PH2 A;  2I5L X;  1JJC B;  1PTO B;  5C6A A;  3KF8 B;  1QUQ A;  1VCI A;  3JAM L;  3J80 E;  1ZYR C;  2BH8 A;  2QF7 A;  5M5Y H;  4LF7 L;  4XDX A;  4X65 L;  1JT8 A;  3I2Z A;  1BXT A;  5GRO A;  2A6E D;  2SNM A;  2YTV A;  2EYP A;  2C35 B;  4JI5 Q;  2B2V C;  4ZCK A;  4B3R L;  1HNX L;  3A0J A;  2B2T C;  1FD7 D;  2EY5 A;  3PUY A;  1GHK A;  3J81 i;  5D14 A;  5GAD C;  1TY2 A;  3A7L A;  3M4O H;  1ESR A;  3P75 A;  4JI5 L;  2AWN A;  2IJ0 A;  4B3T Q;  3KBG A;  5BN4 A;  1FVI A;  3RD4 A;  3GTL H;  4G7H C;  1LLR D;  1YNN D;  5M5W H;  4QGU A;  4GOP C;  1K8O A;  5C3E G;  5JOB A;  2DJF C;  4NDX A;  3G6E A;  4YIJ A;  2DGY A;  5IP7 G;  2KUM A;  1EUJ A;  2KCM A;  4BWG B;  2EY6 A;  1UE5 A;  1GUN A;  1CKN A;  4OEM B;  3J80 L;  3H94 A;  1SNO A;  1ZKO A;  1R9T H;  1V1P B;  2VQF Q;  3PSI A;  4JYA L;  1Z6H A;  3J81 L;  1D2B A;  3S1N H;  1YNJ D;  5HGT A;  3WDN A;  3FEW X;  4RCN A;  4XQJ A;  1WTW A;  1B2T A;  5CYU A;  1I6V C;  1E24 A;  2IT1 A;  1X56 A;  3J80 i;  3S2D H;  5M3F G;  2K6A A;  1WTP A;  2N8N A;  2VS1 A;  3K7U C;  3ND9 A;  3DEP A;  5IT9 E;  4DR4 L;  5FLX E;  2JA7 B;  1SJE D;  1UE6 A;  5F2D A;  4CDC C;  3RUZ A;  4DK3 C;  4JK1 C;  2RBM A;  4X66 Q;  3K5N A;  3DLL A;  1DOM A;  3M4P A;  4IN3 A;  2ZJP A;  3M3Y H;  2F0S A;  4CKB A;  1I6H H;  3A5Z B;  1WI5 A;  3TRE A;  1K8A C;  1UNS A;  1BF4 A;  4A3K H;  2ATW A;  2F0O A;  4FF3 A;  2C9O A;  1IBK L;  4A93 H;  2A68 D;  2QCP X;  3NBI A;  3MXU A;  3I90 A;  1SYG A;  2MFI A;  1VQ4 A;  1LTG D;  3Q8D A;  3HKZ B;  1H9R A;  5HGQ A;  1W3S A;  1HQM C;  4IUP A;  4L5R C;  1C48 A;  5JVH 3;  3BYY B;  1D5X C;  4IOA A;  5E3F A;  1AW7 A;  4LFA Q;  3DM1 A;  1D7Q A;  5IT9 c;  3FPP A;  4C3I H;  1EZ6 A;  2D5D A;  1EWC A;  3NEM A;  3T51 B;  1LYL A;  4BY1 G;  2ZTE A;  2PI2 A;  3E6Z X;  4QB4 A;  1VQH A;  1EY4 A;  3GTM H;  2A69 C;  1EY0 A;  3I4M G;  2AUJ D;  4BY1 H;  2UUB Q;  1VQA A;  2K01 A;  2NZH A;  3EJI A;  2E2H B;  2WB1 G;  2PZU A;  5A2Q E;  4A3E H;  1CQF A;  1PTO H;  2Z6K A;  1E2V A;  2K5D A;  4R4Q A;  2JSO A;  4IFD G;  4JG2 A;  4AQY Q;  1D1K A;  2MJ8 A;  4TRD A;  4GNX C;  1TY0 A;  1W2B A;  1TWF H;  1E1T A;  1BBU A;  4LF8 Q;  4H0L C;  3TRZ A;  5IGG A;  3M4O B;  2R3Z A;  1ROD A;  3K5L A;  2E2I H;  4I7Z C;  3RLF A;  4U68 A;  1Q86 C;  4K2K A;  3GTL B;  3S1R B;  4IPD A;  2NVQ H;  2CWP A;  4G7Z C;  5CR3 A;  5C3W A;  1P16 A;  1SBB B;  1PHJ A;  1BBX C;  1J5E Q;  4A3M H;  1EU4 A;  4DR5 Q;  1N36 L;  3CKI B;  1EY5 A;  2ZXO A;  4IJL A;  4CJ2 C;  1E7Z A;  2QDL A;  3BVG A;  4Y7N B;  4PQX A;  1G6P A;  3NUC A;  3TP8 A;  1UUP A;  1BR9 A;  4BY7 G;  2Q2T A;  5I4D A;  4DUY L;  3GTO H;  3PO3 H;  1RF2 D;  5M3F H;  2E5L L;  2UUB L;  1X3P A;  1PYS B;  2O2L D;  1KC8 C;  3JAM i;  3GTJ H;  1M1K C;  1DXM A;  4YCV A;  3L9A X;  4JV5 L;  1PTO D;  1TWA B;  4HCE A;  3IAY A;  3G71 A;  3BZD B;  5GAE C;  2WFW A;  4MIU A;  5CMD A;  2B63 G;  1MJC A;  4DK1 A;  4HIM A;  3S24 A;  3H3V C;  4A76 A;  4DV1 Q;  5IOC A;  4B3R Q;  2R92 G;  4DV2 Q;  1A3V A;  2MO1 A;  4UDU C;  2EXD A;  4R8N A;  2VXW A;  1ILQ A;  3EQL C;  1KHI A;  3A54 A;  1EQR A;  2ZXR A;  2JA8 B;  1PRT F;  1VQ6 A;  4P71 A;  1ZXT A;  3K8A A;  4JV5 Q;  2JA9 A;  4KV6 A;  2E2I B;  2EQS A;  2KCN A;  4A75 A;  3T16 A;  3C3L A;  2Q2H A;  4A3D H;  1TWG H;  4OXP A;  4HJ5 A;  4DR1 Q;  2DNC A;  1PH6 A;  1I6H B;  1A3U A;  2IHE A;  4OO1 H;  4HR7 B;  2RCF A;  3H09 A;  4IOC A;  1VQF A;  4MTK A;  1KDB A;  1NTG A;  5C4X B;  3RZD B;  4GOP A;  4DR5 L;  3HOV G;  1ZYR D;  3I4N B;  2MPM A;  2BDN A; 
#chains in the Genus database with same CATH homology
 1F9S A;  4K5W A;  1CK1 A;  4O1N A;  1EYA A;  1D5M C;  1GUO A;  1JQY D;  3K57 A;  5COR A;  4NKL A;  2Q8R E;  1S5E D;  5JAV A;  4FXK C;  1PZI D;  1GXD C;  2JYO A;  3QIA A;  4NP5 A;  2VB3 X;  4OL7 A;  2HCI A;  1HFG A;  4R8I A;  3QOJ A;  2L11 A;  3VA7 A;  5CBA E;  4EQP A;  2ENB A;  4X3S A;  3X3N A;  5IGB A;  2D9U A;  4K5X A;  1BQQ T;  3MWY W;  2LY7 A;  5IOD A;  4DFA A;  4KD3 A;  2KEC A;  4HSV A;  1A2U A;  3VR6 A;  2RDG A;  5FK9 C;  1PZJ D;  1CHP D;  3PO2 B;  1RD9 D;  4V0B A;  5M3F B;  2EYM A;  2K03 A;  3DWA A;  3CQZ B;  2B2W C;  3HOZ B;  3OMG A;  3P1H A;  1QCB D;  1S5C D;  1ENC A;  3VYS A;  4H13 C;  1I4H A;  1PYW D;  1HRJ A;  4A3E B;  1Q1B A;  1PRT B;  3K0Y A;  1ESF A;  4ULL A;  4Z9C B;  4IUV A;  1SYD A;  1WTQ A;  1QB5 D;  4ZAI A;  2O5I C;  1B50 A;  5E4X A;  1DZ1 A;  4RFB A;  5ISR A;  2LKV A;  5EPL A;  2OXP A;  2K32 A;  1F77 A;  3GTK B;  5C4H A;  3MVV A;  3M7N A;  2BCO A;  3BYT B;  5LL6 S;  5CV6 A;  1JOQ A;  3D8G A;  4A3M B;  1X3Q A;  1JWM D;  2F0D A;  1SE4 A;  4QCL A;  5M9O A;  3KLS A;  1VMP A;  1PLF A;  2F0Q A;  1KAB A;  4DN4 M;  5CV8 A;  1A15 A;  1CZG A;  4ODG A;  3TN2 A;  2FMM A;  3GD7 A;  3VR2 A;  1XTC D;  3QO2 A;  5CBE E;  2PW5 A;  3N6R A;  2FHT A;  4K6L A;  4CJ1 B;  1S5F D;  3P20 A;  4WFN 3;  1W6K A;  4N9P A;  3X3M A;  4LJZ C;  1IHZ A;  4DU9 A;  3Q0A A;  4DA2 A;  3HS0 C;  4C2M B;  3NE5 B;  4CJ0 B;  4DGZ A;  3HGB A;  5FO8 B;  3T56 B;  2F0J A;  1GHJ A;  1SYE A;  3IFT A;  3OOC A;  4A3D B;  2HUG A;  2X6L A;  5DAU A;  5ELB A;  3OSO A;  3R3O A;  2SNS A;  3D31 A;  2B2Y A;  2Q8T A;  1I4Q A;  2RVL A;  1EY9 A;  1B9N A;  3DWP A;  4LK1 C;  1MSH A;  2ZT9 C;  1LTS D;  1SDF A;  2XRS D;  3J7A F;  3OIP A;  4F8M A;  2MUY A;  3HOU B;  3V2T A;  3OW7 A;  1STY A;  2MGS A;  1R4P B;  2WII B;  3URY A;  4C3J G;  2AQ1 B;  3NQT A;  2F0W A;  5J22 A;  2R61 A;  1F2L A;  2BOS A;  5K36 H;  1EY6 A;  1A3T A;  2EYH A;  1BCP B;  1J8I A;  4KY7 A;  3NK9 A;  1B3A A;  2L9H A;  4RKL A;  2DY8 A;  2F0G A;  4PMW A;  3PUX A;  1HA5 A;  5CV4 A;  2WAQ B;  3NHH A;  1HUN A;  2O4X A;  1I4R A;  2OEO A;  2Z4H A;  4FP5 D;  4OIJ A;  1RKN A;  5A2Q L;  1OXT A;  1EYD A;  2PNR C;  1FNV A;  1RCV D;  5G3L F;  3A7A B;  2NB0 A;  2A69 D;  1KLU D;  3I70 A;  2D62 A;  1EIG A;  3I72 A;  2N88 A;  1V43 A;  2NTT A;  1DM0 B;  3TBI B;  3C46 A;  1I4G A;  3MHB A;  1HQR D;  3N52 A;  1AP0 A;  3HOX B;  2EOT A;  4WOR A;  4KN7 C;  2A5H A;  2I46 A;  4IZ8 A;  3NPP A;  2R92 B;  2Z4I A;  3M85 A;  1EL0 A;  2DN8 A;  3GTO B;  1JOR A;  2TMP A;  4K8J A;  1V1P A;  2OF1 A;  4K2L A;  2BA1 A;  2EDG A;  1TS4 A;  3TME A;  3PV0 A;  3G6J B;  2EJF C;  2EZV A;  2FFK B;  3QWN A;  5JEA H;  1NSN S;  4KKU A;  5C3X A;  4A3F B;  3LX0 A;  3BS1 A;  5KGU A;  1QG7 A;  2KOL A;  2MP1 A;  3BVM A;  1R4Q B;  1BO0 A;  1I50 B;  4BY1 B;  5TSS A;  1MSG A;  2NZ1 D;  4BBS B;  2F0F A;  1FR3 A;  1GUG A;  2PPB C;  4X3T A;  2NN6 H;  1CM9 A;  3TP6 A;  5D3I B;  4C56 C;  2KVM A;  3HOV B;  2RQX A;  3IL8 A;  4KHZ A;  1TVX A;  4A3K B;  1SE3 A;  4UAI A;  3D6W A;  1O7Z A;  3KF8 A;  1HTL D;  3K5O A;  3PIP 3;  1Q3L A;  1GUT A;  1OXU A;  3JAM E;  1JOK A;  2ICE C;  1STE A;  2K33 A;  1KDA A;  1PRT C;  4N9T A;  4M1U B;  4ZUI A;  5E1F A;  3HP3 A;  2GA4 B;  1U4R A;  1B1Z A;  1MGS A;  1TS5 A;  4TSS A;  5M3M B;  3OWE B;  1H9M A;  2BE5 D;  2X69 A;  5CC4 A;  3AMU A;  3NP8 A;  4EQO A;  1Y8O B;  1SE2 A;  2AWO A;  3SK4 A;  1PZK D;  2SDF A;  2IL8 A;  3OMC A;  4ID6 A;  1LTT D;  2X6G A;  3K5M A;  3Q24 A;  4FF2 A;  2M00 A;  2NVY B;  1NAP A;  4CBV A;  2JE6 I;  4RH6 A;  1O78 A;  2A73 B;  1EFI D;  2LFN A;  2NTS A;  4S3S A;  3P7J A;  2JEA I;  3IKJ A;  3A8K E;  4H7B A;  1GUS A;  4OO1 G;  1JE4 A;  3A56 A;  3LWE A;  1B9M A;  1KDC A;  3MEH A;  2XSC A;  3FRP B;  4XXE A;  3GTJ B;  4PNY A;  1CFM A;  4XT3 B;  3CU7 A;  3FMC A;  3I91 A;  2J7Z A;  5BN3 A;  3GO5 A;  1G2T A;  4QMG A;  5CV5 A;  3AB9 A;  3I3C A;  1AFP A;  2IW3 A;  5EBD A;  1V8Q A;  2VNU D;  4KKT A;  1JWS D;  4CKC A;  1STH A;  4ZYS A;  2J4X A;  4IFD H;  3LNN A;  3FDT A;  1MI2 A;  3F2U A;  1GUW A;  4QUF A;  1TWG B;  2H4O A;  2IX0 A;  5M5W B;  4BBR B;  1EU3 A;  4MN3 A;  1ENF A;  2K7V A;  4KN4 C;  1BCP C;  5FLX L;  2IWH A;  1STB A;  2ICI A;  5JVG 3;  1SAP A;  4XT1 B;  4FO2 A;  2M9V A;  2QIL A;  5CV9 A;  1QNU A;  3MXP A;  4C3I B;  3SEB A;  3VR5 A;  4HSP A;  5FOB B;  3VYR A;  3W3A A;  5EKI A;  2MHV A;  4F87 A;  2M2L A;  4F7X A;  3TP7 A;  4HED A;  1NR4 A;  2F0E A;  1TR5 A;  2YYZ A;  4ZLT F;  5A35 A;  2BE5 C;  2PCF B;  1SJH D;  4R9W A;  3D4D A;  1F2Z A;  4KI0 A;  4TQU S;  5CV7 A;  3MXG A;  2KED A;  4FXG C;  3DXJ C;  1JC7 A;  3KK7 A;  3U9S A;  2F1M A;  1SYC A;  5IIF A;  4HN7 A;  2F0L A;  2XIW A;  5T1G A;  4KTA A;  2WIN B;  5NUC A;  3S15 B;  3PUZ A;  3TSS A;  3VR4 A;  1U4M A;  3MZ5 A;  3BDC A;  2B2Y C;  2ID0 A;  2EXZ A;  2G9H D;  5EKL A;  5KND A;  5I6W A;  4QUC A;  4XYO A;  1G29 1;  1EZ8 A;  3CHB D;  3MTS A;  3HEJ A;  4ZRZ A;  3H0G B;  3H6M A;  4RGN A;  1H9K A;  1ET9 A;  1E0B A;  4K5V A;  2QKI C;  2V4D A;  1S5D D;  2JEB I;  1HPC A;  4DK0 A;  3NSW A;  1TWF B;  3ZYY X;  1TT2 A;  2N55 A;  2EPB A;  3V96 A;  1CA6 A;  3NXW A;  5C0X G;  1U9R A;  2CW0 D;  2PW7 A;  1BCP F;  4RA8 A;  2O5J C;  1PRT D;  5C0X I;  5I6Y A;  4M8A A;  4A3G B;  3KLR A;  1EEF D;  1IKM A;  1QE6 A;  5FO7 B;  1PTO C;  4HAE A;  4IAL A;  2PQE A;  1STG A;  3T53 B;  1SXT A;  3NBH A;  1ENA A;  1EWH A;  4BY7 B;  4AYB B;  5KYL A;  2NWG A;  1SEB D;  1XX8 A;  1Z47 A;  3TZU A;  5ELD A;  2XWB B;  1KTK A;  2KA7 A;  5J1Z A;  1TQO A;  3D3R A;  5BN5 A;  3GTM B;  5C4Z A;  1EQV A;  3VYU A;  4K6D A;  4ME5 A;  4OIK A;  5IGC A;  3GQB A;  5FO9 B;  3MAQ A;  4PMB A;  5KRU A;  3K58 A;  3NWS A;  3T13 A;  2VUM B;  2R93 B;  2XVS A;  1TWH B;  4A3B B;  5D65 A;  1G2S A;  1B53 A;  2DNE A;  5I9O A;  3PUV A;  2KHS A;  4A3I B;  1VMC A;  2HDL A;  2L0C A;  1ML0 D;  4RKB A;  3I4L A;  3PMF A;  5EPK A;  1RTO A;  2EJM A;  4ZKB B;  4FXD A;  2NUC A;  3WOE A;  5LHY 1;  1V1O A;  1DYQ A;  2TSS A;  2A74 C;  3LWU A;  4IQZ A;  3ONA B;  5C44 B;  1AZQ A;  3D4R A;  4B08 A;  1XYI A;  4KKS A;  2LS0 1;  3J7A V;  4FYD A;  2FJ2 A;  3ND8 A;  4TKO B;  1OO9 B;  5JPM C;  5G3L D;  2XN9 C;  1A6X A;  1BCP D;  5C4J B;  1SYB A;  2B2U A;  1WVL A;  5M5Y B;  1Q1E A;  4EVO A;  4RGM A;  2XWJ B;  2B63 B;  2L4N A;  3A55 A;  1Y69 U;  3GV6 A;  4IFD I;  4PMC A;  1YNN C;  1QNK A;  2EJG C;  2DY7 A;  3FVQ A;  4C3J B;  2EYJ A;  1RDP D;  3PIO 3;  2Z1C A;  3A8J E;  3C1E A;  4DXF A;  1RJT A;  4RHS A;  3R93 A;  1Y1W B;  2F0I A;  1DD2 A;  3SDZ A;  1SMY D;  2L5T A;  3RMH A;  5HUR A;  5DNF A;  1K8M A;  1ILP A;  5K36 G;  1EY8 A;  4NMZ A;  1OXS C;  4XIG S;  5E4W C;  3OPO A;  2B2T A;  4HMI A;  5DM7 3;  1IW7 C;  5C0X J;  1PTO F;  2IPK D;  3RZO B;  2F0P A;  1TKW B;  2NBF A;  4IUR A;  1HA6 A;  2RA4 A;  3Q23 A;  1EOT A;  5KYI A;  1PFM A;  1F9P A;  4HTH A;  4ABN A;  1GJX A;  1QOH A;  1LV9 A;  1QJO A;  3M3Y B;  2JP1 A;  4KJO A;  3TDQ A;  1HCZ A;  1YNJ C;  5JEA J;  1UAP A;  5DM6 3;  1B44 D;  4KD4 A;  4DXG A;  1EEI D;  1PFN A;  5EKK A;  4HCS A;  3EFX D;  1FNW A;  2RDF A;  2Z8L A;  4F88 A;  3OWF A;  3R8B A;  1IYU A;  3ITP A;  5KEE A;  3G7L A;  4CKE A;  3V05 A;  3K59 A;  3BVZ A;  2AUK A;  2XNA C;  2EYL A;  4FF1 A;  1S5B D;  1SNM A;  1LO5 D;  3MFY A;  3QJY A;  1KNE A;  5JJZ A;  3U9O A;  1EQT A;  2E75 C;  1VF5 C;  1UEA B;  1VDZ A;  1AN8 A;  2BA0 A;  4XTC S;  5I9P A;  3E5S A;  3BG3 A;  2E2J B;  2OT2 A;  3TP5 A;  1Q90 A;  1WTV A;  5C0X H;  2PO4 A;  2RSN A;  1I4X A;  3DWQ A;  1WD0 A;  3M4Y A;  1WTX A;  1F9Q A;  5K5P A;  4G57 A;  2R7Z B;  2RKS A;  4XQN A;  1LTR D;  5ELE A;  1PDQ A;  2QDB A;  4CGY B;  5EJW A;  3VR3 A;  3PUW A;  5EGT A;  4QF4 A;  1C8C A;  1H9J A;  4OHJ A;  2LMC B;  1X32 A;  4J1M A;  1MBY A;  1EY7 A;  2L1B A;  1E2Z A;  1JR0 D;  4Q5V A;  1HXY D;  1Y8P B;  2J0T D;  3I8Z A;  4FVM A;  1QWY A;  3WOF A;  4KY6 A;  2EE1 A;  3SR1 A;  1J9O A;  1F2M A;  1SYF A;  1ET6 A;  3SK8 A;  2K04 A;  2AQ3 B;  2YU9 B;  4C1N I;  1CA5 A;  2WB1 B;  2EY2 A;  4B9X A;  1SMY C;  4I65 A;  3MC0 B;  1TS3 A;  5C5L A;  2ZXP A;  3S1M B;  4KK7 A;  3C2P A;  1LTB D;  2F0M A;  5C3E B;  3DEO A;  3NTH A;  5I2X A;  1OXX K;  4PV1 C;  3VYT A;  5JPN C;  4KMU C;  3Q22 A;  3Q6S A;  1AEX A;  4C3I G;  1FGB D;  2HQE A;  4ILW A;  2L55 A;  1CTM A;  3L3O C;  2SEB D;  3L7Z C;  2FMC A;  4K14 A;  3ERQ A;  2KCC A;  4DAV A;  3FPU B;  4IUU A;  3ERO A;  1BDO A;  1JCK B;  3S14 B;  4DNT B;  1XWE A;  4DAY A;  3FKI B;  4JBW A;  2C5C A;  2EVB A;  2HCC A;  3OHX C;  1HHV A;  1JOO A;  2KQ3 A;  4KY5 A;  1G8Z D;  1MD2 D;  3KLS X;  1L0X B;  2HDM A;  3QG1 A;  1CZW A;  4RGT A;  1TS2 A;  4C3H G;  1Q8I A;  2KEE A;  5ELC A;  3S1Q B;  4MHE A;  4P2C B;  1LT3 D;  2F0V A;  2PMZ B;  3M7G A;  5M5X B;  1BNZ A;  2RDH A;  4ZUJ A;  2WKD A;  2F0K A;  3K7A B;  2I07 B;  5KNB A;  1JB3 A;  5CGK A;  4B9W A;  3HOW B;  2K05 A;  1LTA D;  4XYQ A;  1K83 B;  1PFB A;  4IUN A;  2E76 C;  2F3V A;  3E0J A;  3AU7 A;  3SK5 A;  2B2W A;  5KNC A;  4L63 B;  3R2I A;  1KAA A;  2CW0 C;  4RAU C;  2WV6 D;  4L8J A;  2EY1 A;  2K5Q A;  3NWT A;  1CQV A;  1LT5 D;  4KHV A;  4WJW A;  5AFW A;  5FKA C;  3DMU A;  5J39 A;  2JA5 B;  1DJR D;  3S9W A;  5I2Y A;  1STN A;  4GZY C;  5C5M A;  3EA6 A;  1RTN A;  3DHQ A;  1IYV A;  5JEA G;  1E2W A;  4DNR B;  1II3 A;  1GOZ A;  1HTP A;  3IFD A;  1WD1 A;  1RHP A;  1WCM B;  4ZKC B;  1NR2 A;  2IX1 A;  2CVR A;  2B8F A;  3HZX A;  1D1I A;  3BDL A;  5IGF A;  1SNC A;  4IFD J;  2NN6 I;  2SOB A;  1S4Z A;  2NN6 G;  4LAA A;  1LT4 D;  2WP8 J;  4FNF A;  4K8I A;  3D6C A;  4Q0F A;  1DOK A;  4IUQ A;  2EYO A;  1O80 A;  3BDO A;  4RHR A;  1JIC A;  1M4V A;  3GTP B;  3NQI A;  1WTO A;  1CHQ D;  3C1F A;  4KJN A;  4EQN A;  2CHB D;  4OGQ C;  4A3J B;  1M8A A;  1F9R A;  3PO3 B;  1B4O A;  1WTR A;  4RWS C;  5T1I A;  3D4W A;  2E2D C;  2F3W A;  4WRD A;  4NW2 A;  1T5X D;  3T4A C;  2XRQ D;  1XXG A;  3NTI A;  1G91 A;  4XQQ A;  1DCZ A;  2IX3 A;  1EIH A;  4X3U A;  3TZD A;  5KIX A;  2Y0S B;  1IL8 A;  1DOL A;  1F2Y A;  1VF7 A;  5EBC A;  3EVQ A;  1CT1 D;  2FIN B;  2A6H C;  1D6E C;  1NUC A;  3MFG A;  2K1B A;  1EYC A;  4RCO A;  1A2T A;  5ELF A;  1H9S B;  1KNA A;  3KUP A;  1SNQ A;  2F03 A;  1IKL A;  4CHT B;  1FYC A;  4G4K A;  1PMR A;  1SNP A;  1Q12 A;  3UI2 A;  2VB2 X;  4X3K A;  2WKC A;  3SVM A;  2NVT B;  4BS9 A;  2R6G A;  2F0T A;  4C1N K;  2A6E C;  2K28 A;  1QIL A;  3MXN A;  5IGE A;  1G6Z A;  1HFN A;  3SE0 A;  4BA1 I;  4U67 3;  2E74 C;  1LT6 D;  1SFO B;  1O7Y A;  3NTK A;  1I4P A;  2F0H A;  4O42 A;  1LAB A;  3QOL A;  3SXH A;  2RSO A;  1JWU D;  2NVQ B;  3GTG B;  4BA2 I;  4G7O C;  5COY A;  2CQA A;  1Z7T A;  4J6H A;  4RGO S;  1CI3 M;  2B2U C;  2F0U A;  1O7L A;  5IGD A;  1U4L A;  3HG9 A;  1U4P A;  1W6J A;  3HOY B;  5EQ0 A;  1R9T B;  1BOS A;  1SND A;  3HRZ C;  3QB3 A;  4H44 C;  3R2T A;  1IW7 D;  1NCV A;  4J8Q A;  5LL6 X;  2AQ2 B;  3O13 A;  3KBX A;  1H9S A;  1TU2 B;  3S2D B;  2K5W A;  1STA A;  2L12 A;  3OIQ A;  2PZT A;  1LAC A;  1ONL A;  5DEH A;  3S16 B;  1Y8N B;  3J7Y W;  3H91 A;  4IUT A;  2B8G A;  4FF4 A;  4V19 0;  3DUZ A;  2F4I A;  2EYF A;  2B39 A;  1DON A;  1LTI D;  1FNU A;  2PYK A;  1TWC B;  1ZEQ X;  3SHL A;  2KJX A;  2A68 C;  3S17 B;  3CRK C;  4ZK9 B;  2QEJ C;  4ZQ3 A;  4QIW B;  2BDO A;  1KLG D;  2WAC A;  4LMQ D;  5D3D A;  5IT9 L;  4E6I A;  1AZP A;  1C4Q A;  1TII D;  3W2D A;  3GP7 A;  4L6T B;  1BUV T;  1OXV A;  2B2V A;  2NYZ D;  3I73 A;  2JA6 B;  3GTQ B;  3S2H B;  1Y1V B;  1ICW A;  4EGV A;  2H1E A;  2F0N A;  4DF7 A;  1PXU A;  2Q8I B;  3MA2 B;  3SK6 A;  4A93 B;  3VA5 A;  4OO1 I;  2G9D A;  1SSO A;  3K6O A;  2JXM B;  1D5Z C;  3GV3 A;  1L0Y B;  1T5E A;  2D2C C;  1HUM A;  3CRL C;  4C3H B;  3I4M B;  4HMJ A;  2NVX B;  2PZW A;  4DAP A;  3A8I E;  2A6H D;  3J81 E;  3S1N B;  1I3Q B;  5EPJ A;  1PTO B;  5C6A A;  1VCI A;  3JAM L;  3J80 E;  1ZYR C;  2QF7 A;  4XDX A;  1BXT A;  2A6E D;  2SNM A;  2EYP A;  2B2V C;  2B2T C;  1FD7 D;  2EY5 A;  3PUY A;  1GHK A;  5D14 A;  1TY2 A;  3A7L A;  1ESR A;  3P75 A;  2AWN A;  2IJ0 A;  3KBG A;  5BN4 A;  3RD4 A;  4G7H C;  1LLR D;  1YNN D;  1K8O A;  5JOB A;  4NDX A;  4YIJ A;  2KUM A;  4BWG B;  2EY6 A;  1GUN A;  3J80 L;  3H94 A;  1SNO A;  1ZKO A;  1V1P B;  1Z6H A;  3J81 L;  1D2B A;  1YNJ D;  5HGT A;  3WDN A;  3FEW X;  4RCN A;  4XQJ A;  1WTW A;  1B2T A;  5CYU A;  1I6V C;  2IT1 A;  2K6A A;  1WTP A;  3ND9 A;  3DEP A;  5IT9 E;  5FLX E;  2JA7 B;  1SJE D;  5F2D A;  3RUZ A;  4JK1 C;  2RBM A;  3K5N A;  1DOM A;  4IN3 A;  2F0S A;  4CKB A;  1UNS A;  1BF4 A;  2F0O A;  4FF3 A;  2C9O A;  2A68 D;  2QCP X;  3NBI A;  3MXU A;  3I90 A;  1SYG A;  1LTG D;  3HKZ B;  1H9R A;  1HQM C;  4IUP A;  1C48 A;  5JVH 3;  3BYY B;  1D5X C;  5E3F A;  1AW7 A;  3DM1 A;  3FPP A;  1EZ6 A;  2D5D A;  1EWC A;  3T51 B;  4QB4 A;  3E6Z X;  1EY4 A;  2A69 C;  1EY0 A;  2AUJ D;  2K01 A;  3EJI A;  2E2H B;  2PZU A;  5A2Q E;  1CQF A;  1PTO H;  1E2V A;  2K5D A;  2JSO A;  4IFD G;  1D1K A;  2MJ8 A;  4TRD A;  1TY0 A;  4H0L C;  5IGG A;  3M4O B;  2R3Z A;  1ROD A;  3K5L A;  4I7Z C;  3RLF A;  4U68 A;  4K2K A;  3GTL B;  3S1R B;  4G7Z C;  5CR3 A;  5C3W A;  1SBB B;  1BBX C;  1EU4 A;  3CKI B;  1EY5 A;  2ZXO A;  4CJ2 C;  4Y7N B;  3BVG A;  4PQX A;  3NUC A;  3TP8 A;  1UUP A;  1BR9 A;  5I4D A;  1RF2 D;  1X3P A;  2O2L D;  1DXM A;  3L9A X;  1PTO D;  1TWA B;  4HCE A;  3IAY A;  3BZD B;  4MIU A;  5CMD A;  4DK1 A;  3H3V C;  5IOC A;  1A3V A;  4UDU C;  4R8N A;  2VXW A;  1ILQ A;  3EQL C;  3A54 A;  2ZXR A;  2JA8 B;  1PRT F;  1ZXT A;  4KV6 A;  2E2I B;  2KCN A;  3T16 A;  3C3L A;  2DNC A;  1I6H B;  1A3U A;  4OO1 H;  4HR7 B;  3H09 A;  1KDB A;  5C4X B;  3RZD B;  1ZYR D;  3I4N B;  2MPM A;  2BDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...