4IQZA

The crystal structure of a large insert in rna polymerase (rpoc) subunit from e. coli
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
183
structure length
178
Chain Sequence
AAESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTLSSLVVLDSAERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit beta'
publication title The crystal structure of a large insert in RNA polymerase (RpoC) subunit from E. coli
rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 37
structure length 178
sequence length 183
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iqzA02
1TKWB 3FPPA 1HPCA 5K36H 1GUSA 4DNRB 1H9KA 2EVBA 4JK1C 1O78A 4H0LC 3GQBA 2E76C 1G291 2IT1A 2EJGC 2DNCA 4KKUA 2A68D 3BDOA 4KKTA 2CW0C 2A69C 1Y8PB 3PUXA 2K33A 3T51B 2O5IC 2AUKA 3OPOA 1OXTA 3QIAA 2E74C 2L5TA 5JEAG 3A7LA 1ZYRC 4G7HC 2BDOA 3VR5A 2R6GA 1E2ZA 1H9RA 1OXVA 1PMRA 2E75C 2B8GA 2EJMA 1YNNC 2KA7A 2JEBI 2PNRC 1A6XA 1CTMA 3VR4A 1HTPA 4KHZA 5JEAH 1LABA 4KI0A 4DNTB 3SE0A 1FR3A 1GUNA 3T56B 3PUZA 4H44C 3ND9A 3CRLC 4DK0A 2ZT9C 3RLFA 3M85A 4LJZC 2V4DA 3EQLC 3T53B 1HQMC 3D4RA 2F1MA 2QF7A 2O5JC 4XTCS 3MXUA 3VR3A 1Q90A 2AWOA 3SDZA 2KCCA 1HCZA 1ZKOA 4KKSA 1VF5C 2YYZA 1E2WA 1OXSC 3MFYA 5C0XG 1OXUA 4I7ZC 2AUJD 3QG1A 4DK1A 3VR2A 4IFDG 3ND8A 3CRKC 4G7OC 1VF7A 2BE5D 1Q1BA 1GHJA 1T5EA 2LMCB 2JEAI 1LACA 3OW7A 1GUTA 2A68C 5C0XH 3TZUA 4LK1C 2PPBC 1H9SB 5BN3A 4OGQC 2A6HD 1SMYC 3N6RA 4XIGS 2Q8IB 4BA2I 3VR6A 3OOCA 1OXXK 2BE5C 1V43A 2K32A 1IYUA 3P20A 4H13C 3A8IE 2JE6I 4BA1I 1O7LA 3I4LA 3HGBA 3LWUA 5BN5A 2JXMB 2BA1A 2D62A 1K8MA 1IW7D 3A7AB 2K7VA 1YNJC 4KN4C 4PV1C 1CI3M 1H9JA 1B9NA 1EWHA 1VDZA 3A8JE 1H9MA 1FYCA 3BG3A 1GHKA 1QJOA 2D2CC 4OO1G 1GUOA 3PUVA 3I73A 3DXJC 1DXMA 1I6VC 1GUGA 5A35A 1Y8NB 1Q1EA 1K8OA 2NN6I 1Y69U 1IW7C 1CFMA 5K36G 3IKJA 2PCFB 3U9SA 4IQZA 3M7NA 1Z7TA 2DNEA 3AB9A 4HR7B 4IFDH 5KNCA 4G7ZC 2D5DA 2A69D 3I72A 1VCIA 1ONLA 2NN6G 3FMCA 4TKOB 5KNDA 3LNNA 4TQUS 1Q12A 3L7ZC 3WDNA 3IFTA 3H94A 1Y8OB 1B9MA 2EDGA 3QJYA 4KMUC 3A8KE 3NE5B 3W3AA 2NN6H 1V8QA 3PV0A 2A6HC 4KN7C 5KNBA 2A6ED 1TU2B 1DCZA 3M4YA 1DD2A 3GD7A 1BDOA 2BA0A 4GZYC 1H9SA 4JBWA 4L8JA 3PUYA 2DN8A 5BN4A 2EJFC 3KLRA 2A6EC 1Z6HA 3PUWA 3D31A 4RCNA 4OO1H 3VA7A 1IYVA 1GJXA 1E2VA 2B8FA
chains in the Genus database with same CATH superfamily
4DV2Q 1IL8A 3L2PA 4A3KG 4C3IH 3BU2A 3ER0A 4LF6Q 4UDUC 2KCNA 1LTSD 4DKAC 1EEID 2VY3A 3WWVA 1KNAA 4EQPA 4BBSH 1MKHA 3HEJA 1EY0A 4JI3L 3SR1A 4KKTA 4GN3B 1QZHA 3FHWA 3SGIA 3A56A 2A19A 4RGTA 4Y52H 4QL5A 4LUOA 1R4QB 2E2JH 3RZOB 2E75C 4X3TA 1W6KA 3H3VI 2KOLA 4XQQA 1VQBA 1NCVA 1HR0W 1WTWA 1J6QA 1TT2A 5IE8A 2KJXA 1XTCD 2I07B 3SEBA 1RODA 4XDXA 5M3MH 5FLXc 1YBYA 2M00A 3WOEA 2L11A 4JBKA 3ULLA 4KKSA 1VF5C 2B2YA 3S1QB 2YYZA 2OXPA 1U5KA 3TRZA 3W1GA 4O0AA 3KLSX 4L5RC 4EX5A 1DONA 1RHPA 3H3VC 1SSOA 1GD7A 1NTGA 3TZUA 4LFCL 4X65Q 2WB1B 3FKIH 3VR6A 4DK3C 1Z9FA 1S5CD 2K32A 1AZQA 1V1QA 2JXMB 3X3MA 2N78A 2R92H 4CKEA 3DEOA 1CQVA 2C5CA 4EQOA 4QY7A 4DR5Q 1EWHA 3A8JE 1WYDA 1ICWA 3PUVA 2F0NA 2L15A 1LT3D 1EZ8A 3BVZA 4GLAC 3M3YH 5J22A 4YY3Q 3HOZB 3GTGH 3U9SA 4JW0A 3BS1A 2DJGC 4HR7B 3I72A 3CC2A 3NTIA 4A4IA 4UY8C 4TQUS 3IFTA 2HCIA 5DLQE 3OTOQ 4Z9CB 1F2LA 5IODA 5JPMC 2KHJA 2KEDA 2ICEC 2JA7H 1SE8A 1Q8IA 2AQ2B 4GZYC 1STYA 1SE3A 2F0HA 1MGSA 4L8JA 4QCLA 3K5LA 3TP5A 2ASBA 3UDGA 5C3WA 2J0TD 1X3QA 4QGUA 1DOMA 3MTSA 3NBHA 1HXYD 1S72A 5C44B 1ICFB 1Q82C 1E24A 2A5HA 4DR3L 3STBC 4JK1C 2DNCA 2YTVA 3CCLA 3GTOH 3E3XA 1SE2A 3KOJA 1YHAA 2I46A 4RAUC 4P73A 1N36L 5M9OA 1CTMA 1IBLQ 1VQMA 4CDFC 2ZJRA 1PH5A 3ND9A 4LNQA 1WTRA 4JPBW 1KRSA 4BXXH 3QOLA 4DV7L 1I3QH 3QB3A 2PI2A 2F0VA 1Q90A 4E6IA 4DV5Q 4QF4A 1WCMB 1XXGA 4RHRA 2F3WA 1OXUA 5LMUL 2UXBQ 2YTYA 4ZUJA 2AQ3B 5IGBA 3OMGA 3HOXG 2AWNA 3LX0A 1HH2P 3TS2A 4C1NK 2ZJQA 5CV7A 5I2XA 2LFNA 3EBEA 3S1MB 1F9QA 1I4GA 5JJLA 2F0PA 1RDPD 2HUGA 3HP3A 1VQJA 4H13C 5C4XB 3VDYA 4HEDA 2BH8A 1IBML 3A55A 4FXKC 4LF8L 5BN5A 2JK8A 3AEVA 2F4VQ 4DR6Q 4K0KL 1JOOA 5CORA 3P75A 1Y1VG 2K04A 4X64L 3RZOH 1NAPA 2F0UA 4A3LH 1GUOA 3J7AV 1WTQA 2XSCA 4IZ8A 4K2LA 5KEEA 2SEBD 5JPNC 1X3PA 2LS01 4C3IG 2WAQB 2OTLA 2JYOA 4BBSG 4WFN3 1SJHD 1SYDA 3E0EA 5KNDA 3PQIA 1XNQL 3QJYA 3E0JA 4NMZA 3NE5B 2QGQA 5AJ3Q 2F0KA 1KTKA 2A6HC 4J15A 1EIFA 4B3TL 1SNQA 4RH6A 2B2WC 1VQGA 3M4OB 3H91A 1FNUA 1SYEA 4ZLTF 2O2LD 5I4DA 5E4XA 3G6EA 1K3RA 2QDLA 3CKIB 3RN2A 2SNMA 4I7AA 1F2YA 3STBD 1G6PA 4RCNA 2LXKA 4X66L 3DM1A 1HNXL 5KRUA 2K1BA 1LTID 1GUSA 5E4WC 3NQTA 2IJ0A 2EJGC 3BDOA 1TIID 3C3LA 4RG1A 2B2UA 3KF6B 4AYBB 1BBXC 3HOZH 1WTHA 2ZXRA 3MWYW 3FKIG 2F0QA 3J7A5 2NVTB 3MFGA 1OXVA 1YNNC 2IHFA 1A6XA 4KHZA 2EZVA 1PZJD 3H6MA 1VQ5A 4LUVA 2R92G 5CV4A 2ZTEA 2F0JA 4DV2L 5EPKA 2Z8LA 1EZ6A 4LF6L 3CP0A 4OWTB 4LAAA 1E2WA 1KNEA 1TWCB 1U4RA 4RGMA 2V1CC 3CRKC 3F1ZA 3KBGA 5C44H 2A68C 3EFXD 1H9SB 2EY2A 1B50A 4RKLA 2K4KA 4K14A 1J5EQ 3DEPA 1LT4D 3I56A 4DV3L 3A5UA 1UEAB 4HJ7A 3PO3B 2YTXA 3UE0A 2BA1A 1B9NA 1Y14B 1X55A 4DU9A 3CCQA 3NQIA 5C3XA 2Y0SE 2Z6KA 4IOCA 1DXMA 4XT1B 3ULJA 4GNXA 1EWIA 4DUZQ 5IGCA 3IKJA 5IP9H 1M90C 1Z7TA 4IOAA 1KDCA 4X65L 1B7YB 1SR3A 3SK5A 1HR0Q 1ONLA 3CPWA 2J4XA 1JORA 1Q12A 4EVOA 2UXDQ 1UE6A 2HHHQ 4FF4A 2VZAA 2EQSA 4K6LA 1QNKA 1TWGB 4JCVE 2EYHA 4DR5L 3GTPH 2DN8A 5K5PA 3S1MH 2CQAA 1Z6HA 5CV6A 3K8AA 4ME3A 2PQAA 3QOJA 4YY3L 4DUYQ 4EQNA 5C4XH 1E7ZA 2GVBA 4C2MH 2QA4A 2EY5A 3HOYB 4BXXG 3Q6SA 3MC0B 5FLXE 3Q23A 1HPCA 2ATWA 2R7DA 4FF2A 3K59A 1D5XC 2KQ3A 4CKCA 5I6WA 2FMMA 4DAYA 4IUPA 1JWMD 1JB7A 1YNND 3Q24A 1X54A 2F03A 3GDEA 5F2DA 2WACA 1VQHA 2C9OA 4OEMB 5C5LA 1X6OA 2EXDA 1CHQD 1M8AA 1N9WA 1DGSA 2XIWA 1QUQB 2XRSD 5EPLA 1YIJA 4KI0A 1JJ2A 3CCVA 1I50H 1LT5D 5J3BA 3T56B 5JJIA 4IUTA 2JA6B 2WFWA 1N33Q 2CVRA 4A3LG 1UE7A 3T53B 1FJGQ 1XPOA 5G3LD 3Q8DA 1FL0A 3HOVH 3M4OH 2MUYA 2BDNA 1OXSC 1N32Q 3KDFA 3D6CA 5IGGA 4H02A 2K5NA 1UUPA 3ND8A 3W2DA 4AIMA 1T5EA 1EQQA 5C5MA 5C0XH 1WFQA 2XN9C 2FXQA 2R7FA 2B2YC 4OGQC 3I70A 4P2CB 1IBLL 1X3FA 1OXXK 2N49A 5FLXL 2PZTA 3I4LA 4QB4A 3AYHB 3TBIB 3VYRA 4IFDI 3P7JA 4JVZA 4J6HA 3NSWA 3C1FA 1KC8C 3CQZB 1LTGD 4KHVA 2UXBL 3PIO3 1PDQA 1Q1EA 3PCOB 1K83B 4GN4B 1IW7C 1EIYB 3BJUA 1STAA 1NBWA 1DOLA 1STNA 3K58A 4OX9Q 2RQXA 1K3BC 4AYBE 5IP7H 1JWUD 1EFID 1BVSA 3HOZG 5CV8A 4AH6A 4F8MA 2EYPA 1V8QA 1BF4A 1TWAB 2YU9B 2F4VL 4DR6L 4RMFA 4C3IB 1Y1WB 4S3SA 3PIPA 4BBSB 2K05A 4JBWA 1U0LA 3PUYA 3M4PA 3URYA 3S16B 3K5OA 2E5LQ 2PMZB 4KN4C 5T1IA 1ENCA 2KVMA 3PO3H 1PV4A 1I5FA 2NZHA 4XYQA 2B2WA 1PZID 3S1RH 2KUMA 3IRBA 1UAPA 2E76C 5IYDH 3K0YA 4KKUA 3EA6A 3VYSA 5AJ3L 5C44G 4LF4Q 3KYHC 4DXFA 5M3MB 4NB3A 2MPMA 2SOBA 1N36Q 4K5WA 4ODGA 4G4KA 1GUWA 3G6JB 1PMRA 4HIOA 1EY5A 3K57A 4L5SA 1A3TA 3VR4A 3HS0C 5JEAH 3JC66 2RSNA 3U4ZA 4DFAA 3K80C 3TDQA 1JE4A 2PNHA 5D14A 1TWGH 2ZJPA 2PYKA 3BDLA 4FXGC 1B44D 1HUMA 2EY1A 2QF7A 1SXTA 2AWOA 2KHIA 3MVVA 3SDZA 4GLXA 3IL8A 4JI8Q 4C3JB 4I7ZC 4FO2A 2B63B 3HOYH 2G9HD 4HJ5A 1FGBD 4WRDA 4LF5L 5IWAQ 3KLWA 3A0JA 3M3YB 1L1OA 2Q8IB 3UI2A 3OOCA 3GTGB 1FGUA 4PNYA 2L55A 2JE6I 2QILA 1IBMQ 2UXCL 4LF8Q 1G2SA 3M7GA 1YJ9A 4K0KQ 1WOCA 1EFWA 1S5BD 4U673 1IW7D 2QCPX 3A7AB 1ZEQX 1CHPD 4X64Q 3MAQA 1CI3M 2NWGA 4OONA 3I7FA 2IHEA 1N8RC 3NP8A 5C4XG 5C3EH 2ALYB 3EIVA 1PYBA 1K8OA 1NR4A 2JA7B 4DPGA 2KHSA 3J7YW 5DAUA 2JA6H 4CDCC 2CHBD 2CW0D 3BYTB 2A69D 5IOCA 1J5EL 2K5HA 1RF2D 4R4OA 1HHVA 1ZYRD 4N8FA 5ELOA 1EQVA 2MO0A 2F0EA 1VQIA 5G3LF 2NN6H 4PZ8A 5FLMH 2WAQG 3OHXC 4WJ3M 1PH7A 1XJVA 1BDOA 1XPRA 2P5ZX 3CW2C 4ZCKA 4CGYB 2VW9A 4JOIA 2EJFC 5GROA 5KYLA 4NXMQ 4OO1H 1D1IA 4DUZL 2N88A 3FDTA 4GLVB 4WJWA 5GAGC 1HR0L 3I4NB 4X3KA 5ELCA 2JN4A 1PRTD 2UXDL 5EAYA 1BCPD 3CQZH 3GQBA 2HHHL 1XWEA 2RKSA 3JAMc 2K33A 4QUCA 3T51B 1K83H 4KK7A 1OXTA 1V9PA 1C8CA 1G51A 3RMHA 5M3FB 1YNXA 4PQXA 3TZDA 2K5VA 2RBMA 2B2UC 2GN5A 4AYBG 4DUYL 4H44C 5JJZA 2AKWB 3L3OC 1TWAH 4KY5A 2YU9H 3A54A 3EQLC 3KK7A 3MXNB 1Y1WH 1STGA 2F1MA 2FMCA 2X6LA 2ENBA 3CCEA 1HCZA 2FHTA 1JR0D 1EOVA 3MHBA 2HT1A 3DHQA 4A3EB 3S16H 1KAWA 1LM0A 1L2FA 3J80c 4CKBA 2LY7A 3O13A 2RDGA 4DV6Q 3K7AH 2CQOA 4ULLA 3R2TA 1EYAA 1V43A 5IIFA 3FPUB 4DV3Q 4R8IA 4FF3A 1N33L 1FJGL 1XYIA 3I2ZA 3GP7A 4KJOA 4A3GB 1HA5A 1IKLA 1W2BA 1NR2A 4OWXB 2UU9Q 1EQRA 1QWYA 5KIXA 2PMZE 1TWFB 3DWQA 3AMUA 1HNWQ 1N32L 1KXLA 3PO3G 5T1GA 4JC0A 4DN4M 1CKOA 1NY4A 3R2IA 2PCFB 3N52A 2IPKD 3HOUB 2NYZD 1VMPA 1C7YA 3NUCA 4A93B 2Z6KC 5IYDG 2NTTA 2IL8A 2QW7A 4BY1H 4GNXC 1PVOA 1A8VA 1P16A 1Y8OB 4R1JA 2E2HH 1QB5D 1NE3A 4C3JH 4DNIA 1XMQQ 1SMXA 2B63H 1YI2A 1U9RA 5C4JB 4BS9A 2F0MA 3FEWX 4DV4Q 1I94Q 5C4HA 1AH9A 1IKMA 4KD4A 1TKWB 1D2BA 4DA2A 3TQYA 2VB3X 4OX9L 2CWAA 3ITPA 1PTOC 1HTLD 1H9KA 3OIQA 1O78A 4PG3A 3NEMA 1EYCA 3ICEA 3ULPA 4U68A 3X3NA 2XVSA 3I4OA 3HOYG 1V1OA 2OWOA 1LTBD 5D65A 1JB3A 1IZ6A 5DM73 3OPOA 4FP5D 1UEBA 3R3OA 2UUBQ 5C0XJ 1VQ6A 2BDOA 2Q2IA 2PZUA 2R6GA 1MBYA 3G4SA 3K5MA 3NBIA 2PNRC 4LF7L 1SNMA 4K5VA 2Y0SB 2BH2A 2E5LL 3M85A 4CJ0B 5JVG3 3ERQA 5FO7B 4YHHQ 2O5JC 3BZDB 5C3EG 1D6EC 3D3RA 3H3VH 4KD3A 3K6OA 4EQ5A 4LF4L 2JA6G 2HQLA 2R93H 1CSQA 2DUDA 2RF4A 3KF8A 1Q1BA 5ELBA 4N8X1 2PPBC 1UWVA 4OXPA 3I4NH 2Q8RE 2TMPA 1EYDA 1L0XB 2HIXA 5LL6S 5FLMG 2F0SA 3A5ZB 1RL2A 4L6TB 1PRTF 4R9WA 1JJCB 2M2LA 4A3IB 1IBKQ 1F9SA 5M3FH 4A3FB 4M8AA 2RA4A 1JT8A 4OO1G 4R8NA 1BUVT 3I90A 5EKLA 4JI8L 5CBAE 1EEFD 3D4WA 5M5WB 1CFMA 1VQCA 3BVGA 4A3DB 1D8LA 4XXEA 2CH4W 1CSPA 1EOTA 3GTPB 5IWAL 3TEHB 3PMFA 3GTMH 4G57A 4IPCA 2IW3A 3J7AF 1XNRQ 2WP8J 2EOTA 4C2MB 2NVQB 3OYYA 4A3EH 5EBDA 3JAMi 2RDFA 1CKNA 4DXGA 2D0PA 1KHIA 3I3CA 2UUCQ 1QCBD 4BBRB 1BKBA 1DOKA 3Q22A 1SDFA 2AHOB 5JEAJ 2E8GA 5BN4A 1E3PA 4HIMA 1PTOD 3PUWA 2XTIA 4ZKBB 1EU3A 4JI7L 1IL2A 1Y1WG 1NJIC 1S3OA 2CH4A 4JG2A 5CV9A 1BBWA 1AE2A 1LTLA 4IN3A 1YITA 4C56C 4A3GH 3NENA 3CU7A 2RHSB 2VL6A 3OWFA 1I50B 2NZ1D 1TWFH 5C6AA 2ZM6L 3PUXA 3GTJB 1DJRD 5ELFA 1MJEA 4QJFA 1WD0A 3HOVB 3EVQA 1PYWD 3HOUH 2VQEQ 4A93H 2B8GA 1Q46A 3I4MB 1XTDA 1A15A 3PF4A 1G6ZA 4EGVA 5M3MG 4NXML 5GADC 1X65A 1R9TB 3PUZA 2QEXA 1F2MA 1A2TA 1CA6A 2F0TA 2V4DA 2RCFA 4JI5Q 4HSPA 3K5NA 5C4JH 5C4ZA 2F4IA 1GM5A 4APVA 3DM3A 1KD1C 2ZTCA 1KAAA 2AUJD 3V96A 4DK6C 2D9UA 4KY6A 4BY1G 1LACA 3OW7A 1S5DD 4LF5Q 3DLLA 4CHTB 1YJWA 5EGTA 2XWJB 4C3JG 2F3IA 4HIKA 5JVH3 5FO8B 4JI0Q 4GOPA 1XPUA 2B2TA 2B63G 1BR9A 4IUUA 3VYTA 2UXCQ 1E0BA 2PW7A 1CA5A 4TVAB 3PIP3 1L1OC 2RDHA 1HZ9A 1V1PA 4M1UB 4RFBA 3LWEA 1A3UA 3G7LA 3AQQA 5FOBB 1CZWA 1ASYA 4ZRZA 1B53A 1S5FD 4IQZA 5CBEE 4HCSA 4DV6L 1O80A 4IUVA 1STBA 2WKCA 1GKHA 3WDNA 2JA7G 4OWWB 4KMUC 3JAME 2G9DA 3PO2B 1LTRD 4H7BA 5KNBA 5NUCA 3GV3A 3MA2B 3S1RB 2EY6A 1K0SA 2UU9L 3SHLA 4J1MA 4DGZA 1HNWL 2I5HA 1SN8A 4FNFA 1KLUD 2PO4A 2DNEA 4FYDA 1B3QA 4JOIC 2PW5A 4A3IH 1SEBD 3VA5A 3TS0A 5EKKA 4A3FH 2R93G 2VB2X 2L0CA 3H0GB 5I2YA 1CUKA 3BDCA 2K03A 3FVQA 2K50A 4PMCA 1XMQL 3G48A 4YIJA 5M5WH 3QIAA 3D6WA 2EE1A 3J80E 4G7HC 4PZ6A 3I4NG 4A3DH 1H9RA 4JI6L 3C46A 2JA5B 1D5ZC 1HFNA 3RN5A 1HTPA 4DV4L 1I94L 3B6YA 3SXHA 3KLSA 3S14H 3CRLC 1K0RA 4DK0A 4B3MQ 2NVQH 5M3FG 4BBRH 4FF1A 2A8VA 3D4DA 3JAML 2F0IA 1VQOA 3T13A 1EUJA 1VQPA 1A0IA 3KJOA 2F52A 4R4QA 4PMWA 1SROA 2VQFL 1ET6A 5J39A 4IUNA 4YWKA 2UUBL 4Y7NH 2VS1A 3AFQA 4RHSA 4POFA 1PTOF 3MXNA 2VXWA 2XNAC 4LK1C 4LMQD 5JJKA 5C3EB 4HIDA 4A3EG 1JMCA 2VUMH 3NBHB 1O7IA 1AE3A 3GTJH 3F2DA 1VQAA 1QVGA 1GVPA 1TS5A 4YHHL 1ZXTA 4O2DA 2DY7A 3J81j 3WOFA 3I91A 4HN7A 2B2VA 4CBVA 1QVFA 3I4MH 3M9BA 3J80L 4Q5VA 1C9OA 5LMNW 1R9TH 3OIPA 5IYBH 2FJ2A 4A3GG 3CMEA 1GOZA 3AB9A 1IXRA 4B08A 2M9VA 2D5DA 2AMCB 2O4XA 4TKOB 1UE1A 3S17B 3HKZE 1EY7A 4MIUA 3NXWA 2EDGA 4MNOA 4B3SQ 2I5MX 1K9MC 2D0OA 3TP8A 3HOUG 1TU2B 3K7UC 4P74A 1IBKL 4A93G 3A74A 2LXJA 5BR8Q 3CD6A 2XWBB 3HG9A 1DD2A 4MN3A 4JI1Q 1NSNS 2MNAA 3KLRA 1PXUA 5TSSA 2PZWA 1PH2A 2B8FA 3MZ5A 3FPPA 3S9WA 1I4PA 4L63B 1XNRL 4A76A 2NTSA 4IUQA 2CW0C 3GV6A 2A69C 2B39A 3AFPA 2UUCL 1Z47A 4DAMA 3SK6A 1ILQA 2IX0A 4XT3B 1ZYRC 2VNUD 4B9XA 5IGFA 1BNZA 4LF7Q 5I9OA 4K8IA 1HUNA 1FR3A 5EKIA 2WIIB 2ZT9C 3PO2H 2K14A 2X69A 3K7AB 1Q8KA 1LTTD 4O1NA 4ZAIA 1O7YA 3VR3A 1PFSA 2OT2A 1EY9A 2Y0SG 4RKBA 4ZK9B 3U4VA 4LFAL 3J7ZC 3VR2A 2HDMA 3D0FA 2MHVA 1PRTC 4NW2A 4UP7A 4QMGA 2EXZA 1BCPC 2JEAI 2LMCB 3R93A 4OIKA 4ME5A 2VQEL 2L4NA 4KJNA 3GTQB 1VQ9A 2ZXPA 1WTXA 2G5DA 2BE5C 3H0GH 3A8IE 4XYOA 1SJED 4KY7A 1NMGA 4ALPA 4X62Q 4JI5L 1I6HH 2KCTA 1BOSA 2D62A 2K52A 4BY1B 2H1EA 1ET9A 4QIWB 1YNJC 1XX8A 1U4LA 2E2HB 1H9MA 4HJ9A 4DV1Q 2JA5H 1PH4A 5IP9G 1X9NA 1GUGA 2K5QA 1PYSB 1B2TA 4FXDA 1XMOL 1A3VA 4A3IG 2EYMA 1G8ZD 3RLNA 2MO1A 1F2ZA 4GKJQ 3ONAB 4A3FG 4IFDH 4G7ZC 3F2BA 1WTOA 3FMCA 2N8NA 3V2TA 4DF7A 4JI0L 1B9MA 1LYLA 1ESRA 5CR3A 4A3DG 3W3AA 4CJ1B 4A3MH 1MIUA 4IPGA 2OF1A 3GD7A 3ZJYC 1VQ7A 5CV5A 1PZKD 5JAVA 3UDFA 1E22A 4OHJA 4RCOA 4JBMA 2A6EC 4JI7Q 1CK1A 4BBRG 1VQEA 1MI2A 1PFNA 1YJNA 2IT1A 1K8AC 1LT6D 2Z4HA 2ZM6Q 3HOWH 1TVXA 1Y8PB 3M4QA 1VQLA 4O42A 2A74C 4MHEA 4AQYQ 3CPFA 1D7QA 1I4HA 1Q7YC 1EL0A 1RKNA 3NPPA 2K28A 4BWGB 3OW2A 2VUMG 2F0LA 3BVMA 2R93B 1LABA 3S17H 4DNTB 3Q0AA 1MSHA 4C3HB 4N9TA 4GNXB 3HOVG 1WTVA 1S40A 5FK9C 5M5XB 4LF9L 3D4RA 3I4MG 4FVMA 2UUAQ 1T5XD 4DR7L 2X6GA 5CMDA 2KCCA 4LUZA 1L0WA 1G2TA 5IYBG 4HJAA 1TS2A 5C0XG 1B3AA 4P75A 2NVXB 4P71A 2BE5D 2DJFC 1CM9A 3CCMA 3FP9A 4IJLA 1HZBA 3EJIA 4NPSA 2XRQD 4XIGS 4BA2I 1HZCA 1YNJD 1PTOB 3T1HQ 2KBNA 2PQAB 5H1SE 3L0OA 4CJ2C 1SRUA 3KF6A 4B3ML 5I9PA 2WV6D 3CCJA 4A3BB 2JA8B 3GTKH 3GTMB 2PI2E 1VMCA 5DEHA 5GAEC 5A2QE 4X3UA 2K7VA 3S2HB 2C35B 2Z0SA 4GOPC 2JA9A 2B2TC 1B70B 1HNZQ 4DAYB 4L5QA 3T1YQ 5IP7G 4DR1Q 2OEOA 1MSGA 4KLKA 4CDDC 3P1HA 5CGKA 2R61A 4KN7C 1G91A 1LTAD 2A6ED 1WVLA 1RJTA 4HMIA 1MHWC 1H9SA 3F2UA 1N34L 4HJ8A 4A3JB 2L9HA 3PO2G 3GTQH 4XQNA 4OL7A 4LFBL 3KDFB 3RZDH 3VA7A 4R4IA 2QKIC 1E1OA 1UE5A 4JI4Q 1NMFA 3CCUA 3CCSA 5KYIA 3LGJA 2KEEA 5K36H 3H09A 5IT9E 5D3DA 2EVBA 1ML0D 2I5LX 1P8LA 4B3SL 3UDXA 3J81E 5A2QL 3DUZA 4POGA 2ES2A 5BR8L 1AW7A 1OTCA 1WJJA 5JEAG 5GAHC 1PFMA 5LMNQ 4JI6Q 2Q2HA 3H0GG 1LO5D 2KCMA 3OSOA 1DYQA 4JI1L 3IAYA 2KA7A 5HURA 4JV5Q 5CYUA 2E2IB 1Q86C 1STEA 4QIWE 4RGNA 4UHVA 4ZQ3A 2RVLA 2JA5G 2EYLA 4F88A 3KBXA 2HD3A 2R3ZA 1DZ1A 3SVMA 1ENAA 1EYGA 2VQFQ 1L0YB 3S15B 4IFDG 1E1TA 5M5YH 1FNWA 1D1KA 1OO9B 2SNSA 5AFWA 2Q2TA 1TY2A 1WTPA 2K01A 2FINB 3W5OA 4A3MG 1TR5A 1LLRD 1KDBA 1O7LA 1YVCA 5IT9L 3E6ZX 3GO5A 3TN2A 5IGEA 3CAMA 2HCCA 2K6AA 3HKSA 3J81L 1A63A 1VDZA 4NXNQ 3BG3A 1GHKA 2D2CC 1QUQA 1AN8A 1F9PA 3NWSA 4IALA 5A35A 2Z4IA 4C3HH 1GXDC 1EWCA 4QQBX 1PH9A 3D8GA 3V05A 2B2VC 4YCWA 1FD7D 5M5XH 2ZXOA 2NN6G 3HOWG 2CKZB 1RIPA 1JOKA 3I55A 4J8QA 3L9AX 1M4VA 4X62L 1BCPF 2EYJA 2NVXH 4P72A 2MGSA 1SNOA 3G71A 1RCVD 2BA0A 4DV1L 2JJQA 3TMEA 3S1NB 2RCNA 5JOBA 1TWHB 1UNSA 3RLOA 1PTOH 1IYVA 1E2VA 1B8AA 4HSVA 3S2DB 2A73B 4GKJL 4GS3A 4A3BH 4XQJA 2JA8H 1JJGA 3CHBD 4DNRB 3S2HH 1NUCA 2R7ZH 1L1OB 1HA6A 5EQ0A 3T16A 3S14B 5ELNA 4K5XA 1RD9D 3IFDA 2O5IC 4X6AH 2RHQB 3TP6A 1JWSD 1KIXA 5ELDA 1E2ZA 2L12A 5HY6A 5LL6X 1JC7A 3EROA 2GA4B 3AU7A 1SNCA 4JYAQ 1I4XA 1YZ6A 3SE0A 1GUNA 4MZ9A 4Y7NB 4KV6A 4ZYSA 4MTNA 5LHY1 1J8IA 3KUPA 1PH6A 1CZGA 4XTCS 1EIHA 4CDEC 2VUMB 1C0AA 1ZKOA 4A3JH 4LFAQ 3MFYA 3HKZB 4DK1A 4DV0L 4AQYL 4G7OC 4IFDJ 3J80i 1S5ED 1SAPA 3W1BA 4JI2Q 2KECA 4DR4Q 2H5XA 4R4TA 1SMYC 1BO0A 1J9OA 4C1NI 1PFBA 3I8ZA 1YEZA 1W6JA 1IYUA 4UAIA 3MXPA 3S1QH 2OTJA 1B4OA 4B3RQ 2NZOA 2UUAL 1ILPA 1K8GA 4I65A 2SDFA 4IPHA 4YWMA 3R8BA 3I73A 1QZGA 3DXJC 4DR2L 1XMOQ 2IY5B 2E2IH 2IX3A 1Y69U 3DWAA 2IX1A 5HGQA 1H95A 5K36G 3HZXA 2E2DC 4IJHA 5FO9B 1HJPA 1MJCA 5E1FA 5KNCA 2MP1A 3KFUA 1F9RA 2B3GA 3LNNA 3U9OA 4BY7B 3T1HL 5DM63 3H94A 3SK4A 2NVYB 3A8KE 5ISRA 2F0OA 5IY0A 3OWEB 3PV0A 1X32A 1DCZA 1DM0B 1IYJB 4HMJA 5J1ZA 3S15H 2WB1E 2DGYA 2CFMA 3K81C 4A3KB 1HNZL 1CKMA 1MD2D 4R4CA 4PMBA 4A75A 1PLFA 1JQYD 3T1YL 3D31A 3QO2A 4DR1L 3U50C 1O7ZA 2BCOA 2NUCA 2NBFA 4ABNA 3UE1A 1AEXA 4GKKQ 4F87A 3RR5A 1LUZA 4KHPQ 5IGDA 1A62A 2EIFA 2QEJC 3CCRA 1SNDA 1LV9A 3A7LA 3HRZC 3NHHA 2JSOA 3DWPA 5HGTA 1KRTA 2JEBI 3FRPB 1VQDA 2AQ1B 4V190 1GO3E 4ZUIA 1R4PB 1TXYA 4YWLA 4JI4L 4LF9Q 4HAEA 1VQ8A 4N9PA 5C0XI 1HQMC 1JE5A 4GN5A 5IYCH 4DR7Q 1IHZA 2JP1A 2OQ0A 3F8TA 4C3HG 2Q2UA 3S1NH 4X3SA 1SLJA 1TWHH 1SMYD 2EYOA 2WKDA 2Z9HA 1I6HB 1VF7A 4ILWA 4ID6A 3ZYYX 5COYA 1SFOB 1TS3A 3S2DH 5LMNL 3TREA 1STHA 2A6HD 3E9IA 3N6RA 1ASZA 1HFGA 2BOSA 4JV5L 1JICA 1RTNA 1FVIA 2EPBA 1RTOA 2H4OA 1WCMH 3CC4A 2K75A 1KLGD 5IT9c 4PV1C 2CCZA 4JBJA 4NDXA 3PSIA 3J81c 4IURA 1I6VC 4A3MB 2KENA 1PH8A 1TS4A 2JA8G 4A3BG 2OQKA 1FNVA 2R7ZG 4ZKCB 1Q81C 3OTOL 3DMUA 4JI3Q 2NB0A 1HRJA 1AZPA 4YCUA 5D3IB 1EY4A 1VQ4A 1EY6A 3T4AC 1N34Q 1PRTB 4NXNL 3TP7A 3U58A 3UDIA 1BCPB 4V0BA 3HOWB 3MEHA 4LFBQ 2F0WA 1SYGA 4A3CH 1B1ZA 1GJXA 2Q8TA 4L5TA 3KF8B 1ENFA 3KJPA 2OCEA 4QUFA 4A3JG 2RSOA 1PA6A 1G291 1CT1D 3RUZA 2A68D 5EBCA 1SYFA 1AP0A 2WAQE 2AUKA 5GQOA 2L5TA 1KABA 3QR8A 2FFKB 1YHQA 2YV5A 3PGZA 2EJMA 2L1BA 4LFCQ 2CWPA 2WINB 1EU4A 1QE6A 3OMCA 5ELEA 4BY7H 2NVYH 1WD1A 3VYUA 1SYBA 2MQHA 5FJ8H 1TY0A 1VQKA 1QOHA 3HOXB 3E9HA 1X3EA 5CC4A 1YHBA 3MXUA 2WB1G 4RA8A 1JOQA 4A3KH 5E7NA 2NVTH 2ZTDA 4DV5L 1QVCA 3GTKB 1II3A 3QG1A 1CKNB 4F7XA 1GHJA 5EPJA 3GTLB 1GUTA 2N55A 5BN3A 4IPDA 2ID0A 1Y1VB 4LW1A 4KTAA 2JQOA 3F2CA 5EJWA 4JYAL 3PF5A 2LKVA 3LWUA 2N3SA 3K0XA 5L37A 1TWCH 2K5WA 2GVAA 1F77A 1K8MA 3CXCA 1KL9A 1BXTA 1H9JA 1BQQT 4DAVA 1VS0A 1NNXA 2PQEA 1WI5A 1X3GA 3ERSX 1U4PA 4FDBA 2NN6I 1K28A 2Z6BA 1EY8A 2E2JB 2J7ZA 1CQFA 2TSSA 3M7NA 4JI2L 4DR4L 1D5MC 1VCIA 3NELA 3MEFA 4DR3Q 3E5SA 4RWSC 3RZDB 1W3SA 3NWTA 2F0FA 4OO1I 4DAPA 3SK8A 5FKAC 1PHJA 3M4YA 2LSSA 1I4QA 4B3RL 4WJ4A 1SE4A 1SFOH 4YCVA 1SYCA 3CMAA 4Q0FA 4B9WA 3BYYB 4OELB 3NTKA 2HDLA 2Z1CA 5E3FA 1Q3LA 5IYCG 1PH3A 4LWCA 1ESFA 3FKIB 3TSSA 4DV7Q 1VQNA 3CC7A 4H0LC 1M1KC 3NTHA 4HCEA 4GOPB 5LMUQ 1T9HA 1KQSA 2A1AA 1TQOA 1K73C 2R92B 2E74C 4UPAA 4OIJA 5KGUA 1HQRD 3VR5A 1V1PB 2F0GA 2HQEA 2HIVA 4RGOS 1EIGA 1C4QA 1HZAA 1WCMG 5M5YB 2XGTA 4NKLA 3RLFA 3C2PA 4LJZC 3NK9A 1BBUA 4TSSA 4WORA 2I0QA 3CF5A 1I4RA 4K2KA 1JCKB 1A2UA 4PZ7A 3RD4A 2B29A 3HFZB 4GKKL 1QG7A 4NP5A 4UP9A 3MXGA 1AFPA 4DV0Q 3J81i 4KHPL 1KDAA 5I6YA 4HTHA 4UP8A 1PH1A 2MJ8A 3QWNA 3BZKA 1X56A 3HKZG 2MFIA 1XNQQ 2F0DA 3C1EA 3P20A 1SBBB 4BA1I 3HGBA 1SNPA 4B3TQ 3RNUA 4TRDA 3EN2A 4IO9A 1FYCA 4A3CG 1QJOA 1U4MA 1S4ZA 3BZCA 4DR2Q 3GTOB 1Y8NB 4X66Q 2IWHA 4MTKA 1HNXQ 3HOXH 2DY8A 2K5DA 3L7ZC 1EQTA 1QILA 2EYFA 5DNFA 2QDBA 3H15A 2R7ZB 4K8JA 1QNUA 2F3VA 1I3QB 3GTLH 4BY7G 2ICIA 4K6DA 1Y1VH 5FJ8G 3PIOA 1C48A 1VQFA 3S24A
chains in the Genus database with same CATH topology
1IL8A 4UDUC 2KCNA 1LTSD 1EEID 1KNAA 4EQPA 3HEJA 1EY0A 3SR1A 4KKTA 3A56A 4RGTA 1R4QB 3RZOB 2E75C 4X3TA 1W6KA 2KOLA 4XQQA 1NCVA 1WTWA 1TT2A 2KJXA 1XTCD 2I07B 3SEBA 1RODA 4XDXA 2M00A 3WOEA 2L11A 4KKSA 1VF5C 2B2YA 3S1QB 2YYZA 2OXPA 3KLSX 1DONA 1RHPA 3H3VC 1SSOA 3TZUA 2WB1B 3VR6A 1S5CD 2K32A 1AZQA 2JXMB 3X3MA 4CKEA 3DEOA 1CQVA 2C5CA 4EQOA 1EWHA 3A8JE 1ICWA 3PUVA 2F0NA 1LT3D 1EZ8A 3BVZA 5J22A 3HOZB 3U9SA 3BS1A 4HR7B 3I72A 3NTIA 4TQUS 3IFTA 2HCIA 4Z9CB 1F2LA 5IODA 5JPMC 2KEDA 2ICEC 1Q8IA 2AQ2B 4GZYC 1STYA 1SE3A 2F0HA 1MGSA 4L8JA 4QCLA 3K5LA 3TP5A 5C3WA 2J0TD 1X3QA 1DOMA 3MTSA 3NBHA 1HXYD 5C44B 2A5HA 4JK1C 2DNCA 1SE2A 2I46A 4RAUC 5M9OA 1CTMA 3ND9A 1WTRA 3QOLA 3QB3A 2F0VA 1Q90A 4E6IA 4QF4A 1WCMB 1XXGA 4RHRA 2F3WA 1OXUA 4ZUJA 2AQ3B 5IGBA 3OMGA 2AWNA 3LX0A 4C1NK 5CV7A 5I2XA 2LFNA 3S1MB 1F9QA 1I4GA 2F0PA 1RDPD 2HUGA 3HP3A 4H13C 5C4XB 4HEDA 3A55A 4FXKC 5BN5A 1JOOA 5CORA 3P75A 2K04A 1NAPA 2F0UA 1GUOA 3J7AV 1WTQA 2XSCA 4IZ8A 4K2LA 5KEEA 2SEBD 5JPNC 1X3PA 2LS01 4C3IG 2WAQB 2JYOA 4WFN3 1SJHD 1SYDA 5KNDA 3QJYA 3E0JA 4NMZA 3NE5B 2F0KA 1KTKA 2A6HC 1SNQA 4RH6A 2B2WC 3M4OB 3H91A 1FNUA 1SYEA 4ZLTF 2O2LD 5I4DA 5E4XA 3CKIB 2SNMA 1F2YA 4RCNA 3DM1A 5KRUA 2K1BA 1LTID 1GUSA 5E4WC 3NQTA 2IJ0A 2EJGC 3BDOA 1TIID 3C3LA 2B2UA 4AYBB 1BBXC 2ZXRA 3MWYW 2F0QA 2NVTB 3MFGA 1OXVA 1YNNC 1A6XA 4KHZA 2EZVA 1PZJD 3H6MA 5CV4A 2F0JA 5EPKA 2Z8LA 1EZ6A 4LAAA 1E2WA 1KNEA 1TWCB 1U4RA 4RGMA 3KBGA 3CRKC 2A68C 3EFXD 1H9SB 2EY2A 1B50A 4RKLA 4K14A 3DEPA 1LT4D 1UEAB 3PO3B 2BA1A 1B9NA 4DU9A 3NQIA 5C3XA 1DXMA 4XT1B 5IGCA 3IKJA 1Z7TA 1KDCA 3SK5A 1ONLA 2J4XA 1JORA 1Q12A 4EVOA 4FF4A 4K6LA 1QNKA 1TWGB 2EYHA 2DN8A 5K5PA 2CQAA 1Z6HA 5CV6A 3QOJA 4EQNA 3HOYB 2EY5A 3Q6SA 3MC0B 5FLXE 3Q23A 1HPCA 4FF2A 3K59A 1D5XC 2KQ3A 4CKCA 5I6WA 2FMMA 4DAYA 4IUPA 1JWMD 1YNND 3Q24A 2F03A 5F2DA 2WACA 2C9OA 5C5LA 1CHQD 1M8AA 2XIWA 2XRSD 5EPLA 4KI0A 1LT5D 3T56B 4IUTA 2JA6B 2CVRA 3T53B 5G3LD 2MUYA 2BDNA 1OXSC 3D6CA 5IGGA 3ND8A 1UUPA 3W2DA 1T5EA 5C5MA 5C0XH 2XN9C 2B2YC 4OGQC 3I70A 4P2CB 1OXXK 5FLXL 2PZTA 3I4LA 4QB4A 3TBIB 3VYRA 4IFDI 3P7JA 4J6HA 3NSWA 3C1FA 3CQZB 1LTGD 4KHVA 3PIO3 1PDQA 1Q1EA 1K83B 1IW7C 1STAA 1DOLA 1STNA 3K58A 2RQXA 1JWUD 1EFID 5CV8A 4F8MA 2EYPA 1V8QA 1BF4A 1TWAB 2YU9B 4C3IB 1Y1WB 4S3SA 4BBSB 2K05A 4JBWA 3PUYA 3URYA 3S16B 3K5OA 2PMZB 5T1IA 4KN4C 1ENCA 2KVMA 4XYQA 2B2WA 1PZID 2KUMA 1UAPA 2E76C 3K0YA 4KKUA 3EA6A 3VYSA 4DXFA 5M3MB 2MPMA 2SOBA 4K5WA 4ODGA 4G4KA 1GUWA 3G6JB 1PMRA 1EY5A 3K57A 1A3TA 3VR4A 3HS0C 5JEAH 2RSNA 4DFAA 3TDQA 1JE4A 5D14A 2PYKA 3BDLA 4FXGC 1B44D 1HUMA 2EY1A 2QF7A 1SXTA 2AWOA 3MVVA 3SDZA 3IL8A 4C3JB 4I7ZC 4FO2A 2B63B 2G9HD 1FGBD 4WRDA 3M3YB 2Q8IB 3UI2A 3OOCA 3GTGB 4PNYA 2L55A 2JE6I 2QILA 1G2SA 3M7GA 1S5BD 4U673 1IW7D 2QCPX 3A7AB 1ZEQX 1CHPD 3MAQA 1CI3M 2NWGA 3NP8A 1K8OA 1NR4A 2JA7B 3J7YW 2KHSA 5DAUA 2CHBD 2CW0D 3BYTB 2A69D 5IOCA 1RF2D 1HHVA 1ZYRD 1EQVA 2F0EA 5G3LF 2NN6H 3OHXC 1BDOA 4CGYB 2EJFC 5KYLA 4OO1H 1D1IA 2N88A 3FDTA 4WJWA 3I4NB 4X3KA 5ELCA 1PRTD 1BCPD 3GQBA 1XWEA 2RKSA 2K33A 4QUCA 3T51B 4KK7A 1OXTA 1C8CA 3RMHA 5M3FB 4PQXA 3TZDA 2RBMA 2B2UC 4H44C 5JJZA 3L3OC 4KY5A 3A54A 3EQLC 3KK7A 1STGA 2F1MA 2FMCA 2X6LA 2ENBA 1HCZA 2FHTA 1JR0D 3MHBA 3DHQA 4A3EB 4CKBA 2LY7A 3O13A 2RDGA 4ULLA 3R2TA 1EYAA 5IIFA 1V43A 3FPUB 4R8IA 4FF3A 1XYIA 3GP7A 4KJOA 4A3GB 1HA5A 1IKLA 1NR2A 1QWYA 5KIXA 3DWQA 1TWFB 3AMUA 5T1GA 4DN4M 3R2IA 2PCFB 3N52A 2IPKD 3HOUB 2NYZD 1VMPA 3NUCA 4A93B 2NTTA 2IL8A 1Y8OB 1QB5D 1U9RA 5C4JB 4BS9A 2F0MA 3FEWX 5C4HA 1IKMA 4KD4A 1TKWB 1D2BA 4DA2A 2VB3X 3ITPA 1PTOC 1HTLD 1H9KA 3OIQA 1O78A 1EYCA 4U68A 3X3NA 2XVSA 1V1OA 1LTBD 5D65A 1JB3A 5DM73 3OPOA 4FP5D 3R3OA 5C0XJ 2BDOA 2PZUA 2R6GA 1MBYA 3K5MA 3NBIA 2PNRC 1SNMA 4K5VA 2Y0SB 3M85A 4CJ0B 5JVG3 3ERQA 5FO7B 2O5JC 3BZDB 1D6EC 3D3RA 4KD3A 3K6OA 3KF8A 1Q1BA 5ELBA 2PPBC 2Q8RE 2TMPA 1EYDA 1L0XB 5LL6S 2F0SA 4L6TB 1PRTF 4R9WA 4A3IB 2M2LA 1F9SA 4A3FB 4M8AA 2RA4A 4OO1G 4R8NA 1BUVT 3I90A 5EKLA 5CBAE 1EEFD 3D4WA 5M5WB 1CFMA 3BVGA 4A3DB 4XXEA 1EOTA 3GTPB 3PMFA 4G57A 2IW3A 3J7AF 2WP8J 2EOTA 4C2MB 2NVQB 5EBDA 2RDFA 4DXGA 3I3CA 1QCBD 4BBRB 3Q22A 1DOKA 1SDFA 5JEAJ 5BN4A 1PTOD 3PUWA 4ZKBB 1EU3A 5CV9A 4IN3A 4C56C 3CU7A 3OWFA 1I50B 2NZ1D 5C6AA 3PUXA 3GTJB 1DJRD 5ELFA 3HOVB 1WD0A 3EVQA 1PYWD 2B8GA 3I4MB 1A15A 1G6ZA 4EGVA 1R9TB 3PUZA 1F2MA 1A2TA 1CA6A 2F0TA 2V4DA 4HSPA 3K5NA 5C4ZA 2F4IA 1KAAA 2AUJD 3V96A 2D9UA 4KY6A 1LACA 3OW7A 1S5DD 4CHTB 5EGTA 2XWJB 4C3JG 5JVH3 5FO8B 2B2TA 1BR9A 4IUUA 3VYTA 1E0BA 2PW7A 1CA5A 3PIP3 2RDHA 1V1PA 4M1UB 4RFBA 3LWEA 1A3UA 3G7LA 5FOBB 1CZWA 4ZRZA 1B53A 1S5FD 4IQZA 5CBEE 4HCSA 1O80A 4IUVA 1STBA 2WKCA 3WDNA 4KMUC 3JAME 2G9DA 3PO2B 1LTRD 4H7BA 5KNBA 5NUCA 3GV3A 3MA2B 3S1RB 2EY6A 3SHLA 4J1MA 4DGZA 4FNFA 1KLUD 2PO4A 2DNEA 4FYDA 2PW5A 1SEBD 3VA5A 5EKKA 2VB2X 2L0CA 3H0GB 5I2YA 3FVQA 3BDCA 2K03A 4PMCA 4YIJA 3QIAA 3D6WA 2EE1A 3J80E 4G7HC 1H9RA 3C46A 2JA5B 1D5ZC 1HFNA 1HTPA 3SXHA 3KLSA 3CRLC 4DK0A 4FF1A 3D4DA 3JAML 2F0IA 3T13A 4PMWA 1ET6A 5J39A 4IUNA 4RHSA 1PTOF 3MXNA 2VXWA 2XNAC 4LK1C 4LMQD 5C3EB 1TS5A 1ZXTA 2DY7A 3WOFA 3I91A 4HN7A 2B2VA 4CBVA 4Q5VA 3J80L 3OIPA 2FJ2A 1GOZA 3AB9A 4B08A 2M9VA 2D5DA 2O4XA 4TKOB 3S17B 1EY7A 4MIUA 3NXWA 2EDGA 3TP8A 1TU2B 2XWBB 3HG9A 1DD2A 4MN3A 1NSNS 3KLRA 1PXUA 5TSSA 2PZWA 2B8FA 3MZ5A 3FPPA 3S9WA 1I4PA 4L63B 2NTSA 4IUQA 2CW0C 3GV6A 2A69C 2B39A 1Z47A 3SK6A 1ILQA 2IX0A 4XT3B 1ZYRC 2VNUD 4B9XA 5IGFA 1BNZA 5I9OA 4K8IA 1HUNA 1FR3A 5EKIA 2WIIB 2ZT9C 2X69A 3K7AB 4ZAIA 1LTTD 4O1NA 1O7YA 3VR3A 2OT2A 1EY9A 4RKBA 4ZK9B 3VR2A 2HDMA 2MHVA 1PRTC 4NW2A 4QMGA 2EXZA 1BCPC 2JEAI 2LMCB 3R93A 4OIKA 4ME5A 2L4NA 4KJNA 3GTQB 2ZXPA 1WTXA 2BE5C 3A8IE 4XYOA 1SJED 4KY7A 1BOSA 2D62A 4BY1B 2H1EA 1ET9A 4QIWB 1YNJC 1XX8A 1U4LA 2E2HB 1H9MA 1GUGA 2K5QA 1B2TA 4FXDA 1A3VA 2EYMA 1G8ZD 1F2ZA 3ONAB 4IFDH 4G7ZC 1WTOA 3FMCA 3V2TA 4DF7A 1B9MA 1ESRA 5CR3A 3W3AA 4CJ1B 2OF1A 3GD7A 5CV5A 1PZKD 5JAVA 4OHJA 4RCOA 2A6EC 1CK1A 1MI2A 1PFNA 2IT1A 1LT6D 2Z4HA 1TVXA 1Y8PB 4O42A 2A74C 4MHEA 1I4HA 1EL0A 1RKNA 3NPPA 2K28A 4BWGB 2F0LA 3BVMA 2R93B 1LABA 4DNTB 3Q0AA 1MSHA 4C3HB 4N9TA 1WTVA 5FK9C 5M5XB 3D4RA 4FVMA 1T5XD 2X6GA 5CMDA 2KCCA 1G2TA 1TS2A 5C0XG 1B3AA 2NVXB 2BE5D 1CM9A 3EJIA 2XRQD 4XIGS 4BA2I 1YNJD 1PTOB 4CJ2C 5I9PA 2WV6D 4A3BB 2JA8B 3GTMB 1VMCA 5DEHA 5A2QE 4X3UA 2K7VA 3S2HB 2B2TC 2OEOA 1MSGA 3P1HA 5CGKA 2R61A 4KN7C 1G91A 1LTAD 2A6ED 1WVLA 1RJTA 4HMIA 1H9SA 3F2UA 4A3JB 2L9HA 4XQNA 4OL7A 3VA7A 2QKIC 5KYIA 2KEEA 5K36H 3H09A 5IT9E 5D3DA 2EVBA 1ML0D 3J81E 5A2QL 3DUZA 1AW7A 5JEAG 1PFMA 1LO5D 3OSOA 1DYQA 3IAYA 2KA7A 5HURA 2E2IB 5CYUA 1STEA 4RGNA 4ZQ3A 2RVLA 2EYLA 4F88A 3KBXA 2R3ZA 1DZ1A 3SVMA 1ENAA 1L0YB 3S15B 4IFDG 1FNWA 1D1KA 1OO9B 2SNSA 5AFWA 1TY2A 1WTPA 2K01A 2FINB 1TR5A 1LLRD 1KDBA 1O7LA 5IT9L 3E6ZX 3GO5A 3TN2A 5IGEA 2HCCA 2K6AA 3J81L 1VDZA 3BG3A 1GHKA 2D2CC 1AN8A 1F9PA 3NWSA 4IALA 5A35A 2Z4IA 1GXDC 1EWCA 3D8GA 3V05A 2B2VC 1FD7D 2ZXOA 2NN6G 1JOKA 4J8QA 3L9AX 1M4VA 1BCPF 2EYJA 2MGSA 1SNOA 1RCVD 2BA0A 3TMEA 3S1NB 5JOBA 1TWHB 1UNSA 1PTOH 1IYVA 1E2VA 4HSVA 3S2DB 2A73B 4XQJA 3CHBD 4DNRB 1NUCA 1HA6A 5EQ0A 3T16A 3S14B 4K5XA 1RD9D 3IFDA 2O5IC 3TP6A 1JWSD 5ELDA 1E2ZA 2L12A 5LL6X 1JC7A 3EROA 2GA4B 3AU7A 1SNCA 1I4XA 3SE0A 1GUNA 4Y7NB 4KV6A 4ZYSA 5LHY1 1J8IA 3KUPA 1CZGA 4XTCS 1EIHA 2VUMB 1ZKOA 3MFYA 3HKZB 4DK1A 4G7OC 4IFDJ 1S5ED 1SAPA 2KECA 1SMYC 1BO0A 1J9OA 4C1NI 1PFBA 3I8ZA 1W6JA 1IYUA 4UAIA 3MXPA 1B4OA 1ILPA 4I65A 2SDFA 3R8BA 3I73A 3DXJC 2IX3A 1Y69U 3DWAA 2IX1A 5K36G 3HZXA 2E2DC 5FO9B 5E1FA 5KNCA 2MP1A 1F9RA 3LNNA 3U9OA 4BY7B 5DM63 3H94A 3SK4A 2NVYB 3A8KE 5ISRA 2F0OA 3OWEB 3PV0A 1X32A 1DCZA 1DM0B 5J1ZA 4HMJA 4A3KB 1MD2D 4PMBA 1PLFA 1JQYD 3D31A 3QO2A 1O7ZA 2BCOA 2NUCA 2NBFA 4ABNA 1AEXA 4F87A 5IGDA 2QEJC 1SNDA 1LV9A 3A7LA 3HRZC 3NHHA 2JSOA 3DWPA 5HGTA 2JEBI 3FRPB 2AQ1B 4V190 4ZUIA 1R4PB 4HAEA 4N9PA 5C0XI 1HQMC 1IHZA 2JP1A 4C3HG 4X3SA 1SMYD 2WKDA 2EYOA 1I6HB 1VF7A 4ILWA 4ID6A 3ZYYX 5COYA 1SFOB 1TS3A 1STHA 2A6HD 3N6RA 1HFGA 2BOSA 1JICA 1RTNA 2EPBA 1RTOA 2H4OA 1KLGD 4PV1C 4NDXA 4IURA 1I6VC 4A3MB 1TS4A 1FNVA 4ZKCB 3DMUA 2NB0A 1HRJA 1AZPA 5D3IB 1EY4A 1EY6A 3T4AC 1PRTB 3TP7A 1BCPB 4V0BA 3HOWB 3MEHA 2F0WA 1SYGA 1B1ZA 1GJXA 2Q8TA 1ENFA 4QUFA 2RSOA 1G291 1CT1D 3RUZA 2A68D 5EBCA 1SYFA 1AP0A 2AUKA 2L5TA 1KABA 2FFKB 2EJMA 2L1BA 2WINB 1EU4A 1QE6A 3OMCA 5ELEA 1WD1A 3VYUA 1SYBA 1TY0A 1QOHA 3HOXB 5CC4A 3MXUA 4RA8A 1JOQA 3GTKB 1II3A 3QG1A 4F7XA 1GHJA 5EPJA 3GTLB 1GUTA 2N55A 5BN3A 2ID0A 1Y1VB 4KTAA 5EJWA 2LKVA 3LWUA 2K5WA 1F77A 1K8MA 1BXTA 1H9JA 1BQQT 4DAVA 2PQEA 1U4PA 2NN6I 1EY8A 2E2JB 2J7ZA 1CQFA 2TSSA 3M7NA 1D5MC 1VCIA 3E5SA 4RWSC 3RZDB 3NWTA 2F0FA 4OO1I 4DAPA 3SK8A 5FKAC 3M4YA 1I4QA 1SE4A 1SYCA 4Q0FA 4B9WA 3BYYB 3NTKA 2HDLA 2Z1CA 5E3FA 1Q3LA 3TSSA 1ESFA 3FKIB 4H0LC 3NTHA 4HCEA 1TQOA 2R92B 2E74C 4OIJA 5KGUA 1HQRD 3VR5A 1V1PB 2F0GA 2HQEA 4RGOS 1EIGA 1C4QA 5M5YB 4NKLA 3RLFA 3C2PA 4LJZC 3NK9A 4TSSA 4WORA 1I4RA 4K2KA 1JCKB 1A2UA 3RD4A 1QG7A 4NP5A 3MXGA 1AFPA 5I6YA 1KDAA 4HTHA 2MJ8A 3QWNA 2F0DA 3C1EA 3P20A 4BA1I 1SBBB 3HGBA 1SNPA 4TRDA 1FYCA 1QJOA 1U4MA 1S4ZA 3GTOB 1Y8NB 2IWHA 2DY8A 2K5DA 3L7ZC 1EQTA 1QILA 2EYFA 5DNFA 2QDBA 2R7ZB 4K8JA 1QNUA 2F3VA 1I3QB 2ICIA 4K6DA 1C48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKW B;  3FPP A;  1HPC A;  5K36 H;  1GUS A;  4DNR B;  1H9K A;  2EVB A;  4JK1 C;  1O78 A;  4H0L C;  3GQB A;  2E76 C;  1G29 1;  2IT1 A;  2EJG C;  2DNC A;  4KKU A;  2A68 D;  3BDO A;  4KKT A;  2CW0 C;  2A69 C;  1Y8P B;  3PUX A;  2K33 A;  3T51 B;  2O5I C;  2AUK A;  3OPO A;  1OXT A;  3QIA A;  2E74 C;  2L5T A;  5JEA G;  3A7L A;  1ZYR C;  4G7H C;  2BDO A;  3VR5 A;  2R6G A;  1E2Z A;  1H9R A;  1OXV A;  1PMR A;  2E75 C;  2B8G A;  2EJM A;  1YNN C;  2KA7 A;  2JEB I;  2PNR C;  1A6X A;  1CTM A;  3VR4 A;  1HTP A;  4KHZ A;  5JEA H;  1LAB A;  4KI0 A;  4DNT B;  3SE0 A;  1FR3 A;  1GUN A;  3T56 B;  3PUZ A;  4H44 C;  3ND9 A;  3CRL C;  4DK0 A;  2ZT9 C;  3RLF A;  3M85 A;  4LJZ C;  2V4D A;  3EQL C;  3T53 B;  1HQM C;  3D4R A;  2F1M A;  2QF7 A;  2O5J C;  4XTC S;  3MXU A;  3VR3 A;  1Q90 A;  2AWO A;  3SDZ A;  2KCC A;  1HCZ A;  1ZKO A;  4KKS A;  1VF5 C;  2YYZ A;  1E2W A;  1OXS C;  3MFY A;  5C0X G;  1OXU A;  4I7Z C;  2AUJ D;  3QG1 A;  4DK1 A;  3VR2 A;  4IFD G;  3ND8 A;  3CRK C;  4G7O C;  1VF7 A;  2BE5 D;  1Q1B A;  1GHJ A;  1T5E A;  2LMC B;  2JEA I;  1LAC A;  3OW7 A;  1GUT A;  2A68 C;  5C0X H;  3TZU A;  4LK1 C;  2PPB C;  1H9S B;  5BN3 A;  4OGQ C;  2A6H D;  1SMY C;  3N6R A;  4XIG S;  2Q8I B;  4BA2 I;  3VR6 A;  3OOC A;  1OXX K;  2BE5 C;  1V43 A;  2K32 A;  1IYU A;  3P20 A;  4H13 C;  3A8I E;  2JE6 I;  4BA1 I;  1O7L A;  3I4L A;  3HGB A;  3LWU A;  5BN5 A;  2JXM B;  2BA1 A;  2D62 A;  1K8M A;  1IW7 D;  3A7A B;  2K7V A;  1YNJ C;  4KN4 C;  4PV1 C;  1CI3 M;  1H9J A;  1B9N A;  1EWH A;  1VDZ A;  3A8J E;  1H9M A;  1FYC A;  3BG3 A;  1GHK A;  1QJO A;  2D2C C;  4OO1 G;  1GUO A;  3PUV A;  3I73 A;  3DXJ C;  1DXM A;  1I6V C;  1GUG A;  5A35 A;  1Y8N B;  1Q1E A;  1K8O A;  2NN6 I;  1Y69 U;  1IW7 C;  1CFM A;  5K36 G;  3IKJ A;  2PCF B;  3U9S A;  4IQZ A;  3M7N A;  1Z7T A;  2DNE A;  3AB9 A;  4HR7 B;  4IFD H;  5KNC A;  4G7Z C;  2D5D A;  2A69 D;  3I72 A;  1VCI A;  1ONL A;  2NN6 G;  3FMC A;  4TKO B;  5KND A;  3LNN A;  4TQU S;  1Q12 A;  3L7Z C;  3WDN A;  3IFT A;  3H94 A;  1Y8O B;  1B9M A;  2EDG A;  3QJY A;  4KMU C;  3A8K E;  3NE5 B;  3W3A A;  2NN6 H;  1V8Q A;  3PV0 A;  2A6H C;  4KN7 C;  5KNB A;  2A6E D;  1TU2 B;  1DCZ A;  3M4Y A;  1DD2 A;  3GD7 A;  1BDO A;  2BA0 A;  4GZY C;  1H9S A;  4JBW A;  4L8J A;  3PUY A;  2DN8 A;  5BN4 A;  2EJF C;  3KLR A;  2A6E C;  1Z6H A;  3PUW A;  3D31 A;  4RCN A;  4OO1 H;  3VA7 A;  1IYV A;  1GJX A;  1E2V A;  2B8F A; 
#chains in the Genus database with same CATH topology
 4DV2 Q;  1IL8 A;  3L2P A;  4A3K G;  4C3I H;  3BU2 A;  3ER0 A;  4LF6 Q;  4UDU C;  2KCN A;  1LTS D;  4DKA C;  1EEI D;  2VY3 A;  3WWV A;  1KNA A;  4EQP A;  4BBS H;  1MKH A;  3HEJ A;  1EY0 A;  4JI3 L;  3SR1 A;  4KKT A;  4GN3 B;  1QZH A;  3FHW A;  3SGI A;  3A56 A;  2A19 A;  4RGT A;  4Y52 H;  4QL5 A;  4LUO A;  1R4Q B;  2E2J H;  3RZO B;  2E75 C;  4X3T A;  1W6K A;  3H3V I;  2KOL A;  4XQQ A;  1VQB A;  1NCV A;  1HR0 W;  1WTW A;  1J6Q A;  1TT2 A;  5IE8 A;  2KJX A;  1XTC D;  2I07 B;  3SEB A;  1ROD A;  4XDX A;  5M3M H;  5FLX c;  1YBY A;  2M00 A;  3WOE A;  2L11 A;  4JBK A;  3ULL A;  4KKS A;  1VF5 C;  2B2Y A;  3S1Q B;  2YYZ A;  2OXP A;  1U5K A;  3TRZ A;  3W1G A;  4O0A A;  3KLS X;  4L5R C;  4EX5 A;  1DON A;  1RHP A;  3H3V C;  1SSO A;  1GD7 A;  1NTG A;  3TZU A;  4LFC L;  4X65 Q;  2WB1 B;  3FKI H;  3VR6 A;  4DK3 C;  1Z9F A;  1S5C D;  2K32 A;  1AZQ A;  1V1Q A;  2JXM B;  3X3M A;  2N78 A;  2R92 H;  4CKE A;  3DEO A;  1CQV A;  2C5C A;  4EQO A;  4QY7 A;  4DR5 Q;  1EWH A;  3A8J E;  1WYD A;  1ICW A;  3PUV A;  2F0N A;  2L15 A;  1LT3 D;  1EZ8 A;  3BVZ A;  4GLA C;  3M3Y H;  5J22 A;  4YY3 Q;  3HOZ B;  3GTG H;  3U9S A;  4JW0 A;  3BS1 A;  2DJG C;  4HR7 B;  3I72 A;  3CC2 A;  3NTI A;  4A4I A;  4UY8 C;  4TQU S;  3IFT A;  2HCI A;  5DLQ E;  3OTO Q;  4Z9C B;  1F2L A;  5IOD A;  5JPM C;  2KHJ A;  2KED A;  2ICE C;  2JA7 H;  1SE8 A;  1Q8I A;  2AQ2 B;  4GZY C;  1STY A;  1SE3 A;  2F0H A;  1MGS A;  4L8J A;  4QCL A;  3K5L A;  3TP5 A;  2ASB A;  3UDG A;  5C3W A;  2J0T D;  1X3Q A;  4QGU A;  1DOM A;  3MTS A;  3NBH A;  1HXY D;  1S72 A;  5C44 B;  1ICF B;  1Q82 C;  1E24 A;  2A5H A;  4DR3 L;  3STB C;  4JK1 C;  2DNC A;  2YTV A;  3CCL A;  3GTO H;  3E3X A;  1SE2 A;  3KOJ A;  1YHA A;  2I46 A;  4RAU C;  4P73 A;  1N36 L;  5M9O A;  1CTM A;  1IBL Q;  1VQM A;  4CDF C;  2ZJR A;  1PH5 A;  3ND9 A;  4LNQ A;  1WTR A;  4JPB W;  1KRS A;  4BXX H;  3QOL A;  4DV7 L;  1I3Q H;  3QB3 A;  2PI2 A;  2F0V A;  1Q90 A;  4E6I A;  4DV5 Q;  4QF4 A;  1WCM B;  1XXG A;  4RHR A;  2F3W A;  1OXU A;  5LMU L;  2UXB Q;  2YTY A;  4ZUJ A;  2AQ3 B;  5IGB A;  3OMG A;  3HOX G;  2AWN A;  3LX0 A;  1HH2 P;  3TS2 A;  4C1N K;  2ZJQ A;  5CV7 A;  5I2X A;  2LFN A;  3EBE A;  3S1M B;  1F9Q A;  1I4G A;  5JJL A;  2F0P A;  1RDP D;  2HUG A;  3HP3 A;  1VQJ A;  4H13 C;  5C4X B;  3VDY A;  4HED A;  2BH8 A;  1IBM L;  3A55 A;  4FXK C;  4LF8 L;  5BN5 A;  2JK8 A;  3AEV A;  2F4V Q;  4DR6 Q;  4K0K L;  1JOO A;  5COR A;  3P75 A;  1Y1V G;  2K04 A;  4X64 L;  3RZO H;  1NAP A;  2F0U A;  4A3L H;  1GUO A;  3J7A V;  1WTQ A;  2XSC A;  4IZ8 A;  4K2L A;  5KEE A;  2SEB D;  5JPN C;  1X3P A;  2LS0 1;  4C3I G;  2WAQ B;  2OTL A;  2JYO A;  4BBS G;  4WFN 3;  1SJH D;  1SYD A;  3E0E A;  5KND A;  3PQI A;  1XNQ L;  3QJY A;  3E0J A;  4NMZ A;  3NE5 B;  2QGQ A;  5AJ3 Q;  2F0K A;  1KTK A;  2A6H C;  4J15 A;  1EIF A;  4B3T L;  1SNQ A;  4RH6 A;  2B2W C;  1VQG A;  3M4O B;  3H91 A;  1FNU A;  1SYE A;  4ZLT F;  2O2L D;  5I4D A;  5E4X A;  3G6E A;  1K3R A;  2QDL A;  3CKI B;  3RN2 A;  2SNM A;  4I7A A;  1F2Y A;  3STB D;  1G6P A;  4RCN A;  2LXK A;  4X66 L;  3DM1 A;  1HNX L;  5KRU A;  2K1B A;  1LTI D;  1GUS A;  5E4W C;  3NQT A;  2IJ0 A;  2EJG C;  3BDO A;  1TII D;  3C3L A;  4RG1 A;  2B2U A;  3KF6 B;  4AYB B;  1BBX C;  3HOZ H;  1WTH A;  2ZXR A;  3MWY W;  3FKI G;  2F0Q A;  3J7A 5;  2NVT B;  3MFG A;  1OXV A;  1YNN C;  2IHF A;  1A6X A;  4KHZ A;  2EZV A;  1PZJ D;  3H6M A;  1VQ5 A;  4LUV A;  2R92 G;  5CV4 A;  2ZTE A;  2F0J A;  4DV2 L;  5EPK A;  2Z8L A;  1EZ6 A;  4LF6 L;  3CP0 A;  4OWT B;  4LAA A;  1E2W A;  1KNE A;  1TWC B;  1U4R A;  4RGM A;  2V1C C;  3CRK C;  3F1Z A;  3KBG A;  5C44 H;  2A68 C;  3EFX D;  1H9S B;  2EY2 A;  1B50 A;  4RKL A;  2K4K A;  4K14 A;  1J5E Q;  3DEP A;  1LT4 D;  3I56 A;  4DV3 L;  3A5U A;  1UEA B;  4HJ7 A;  3PO3 B;  2YTX A;  3UE0 A;  2BA1 A;  1B9N A;  1Y14 B;  1X55 A;  4DU9 A;  3CCQ A;  3NQI A;  5C3X A;  2Y0S E;  2Z6K A;  4IOC A;  1DXM A;  4XT1 B;  3ULJ A;  4GNX A;  1EWI A;  4DUZ Q;  5IGC A;  3IKJ A;  5IP9 H;  1M90 C;  1Z7T A;  4IOA A;  1KDC A;  4X65 L;  1B7Y B;  1SR3 A;  3SK5 A;  1HR0 Q;  1ONL A;  3CPW A;  2J4X A;  1JOR A;  1Q12 A;  4EVO A;  2UXD Q;  1UE6 A;  2HHH Q;  4FF4 A;  2VZA A;  2EQS A;  4K6L A;  1QNK A;  1TWG B;  4JCV E;  2EYH A;  4DR5 L;  3GTP H;  2DN8 A;  5K5P A;  3S1M H;  2CQA A;  1Z6H A;  5CV6 A;  3K8A A;  4ME3 A;  2PQA A;  3QOJ A;  4YY3 L;  4DUY Q;  4EQN A;  5C4X H;  1E7Z A;  2GVB A;  4C2M H;  2QA4 A;  2EY5 A;  3HOY B;  4BXX G;  3Q6S A;  3MC0 B;  5FLX E;  3Q23 A;  1HPC A;  2ATW A;  2R7D A;  4FF2 A;  3K59 A;  1D5X C;  2KQ3 A;  4CKC A;  5I6W A;  2FMM A;  4DAY A;  4IUP A;  1JWM D;  1JB7 A;  1YNN D;  3Q24 A;  1X54 A;  2F03 A;  3GDE A;  5F2D A;  2WAC A;  1VQH A;  2C9O A;  4OEM B;  5C5L A;  1X6O A;  2EXD A;  1CHQ D;  1M8A A;  1N9W A;  1DGS A;  2XIW A;  1QUQ B;  2XRS D;  5EPL A;  1YIJ A;  4KI0 A;  1JJ2 A;  3CCV A;  1I50 H;  1LT5 D;  5J3B A;  3T56 B;  5JJI A;  4IUT A;  2JA6 B;  2WFW A;  1N33 Q;  2CVR A;  4A3L G;  1UE7 A;  3T53 B;  1FJG Q;  1XPO A;  5G3L D;  3Q8D A;  1FL0 A;  3HOV H;  3M4O H;  2MUY A;  2BDN A;  1OXS C;  1N32 Q;  3KDF A;  3D6C A;  5IGG A;  4H02 A;  2K5N A;  1UUP A;  3ND8 A;  3W2D A;  4AIM A;  1T5E A;  1EQQ A;  5C5M A;  5C0X H;  1WFQ A;  2XN9 C;  2FXQ A;  2R7F A;  2B2Y C;  4OGQ C;  3I70 A;  4P2C B;  1IBL L;  1X3F A;  1OXX K;  2N49 A;  5FLX L;  2PZT A;  3I4L A;  4QB4 A;  3AYH B;  3TBI B;  3VYR A;  4IFD I;  3P7J A;  4JVZ A;  4J6H A;  3NSW A;  3C1F A;  1KC8 C;  3CQZ B;  1LTG D;  4KHV A;  2UXB L;  3PIO 3;  1PDQ A;  1Q1E A;  3PCO B;  1K83 B;  4GN4 B;  1IW7 C;  1EIY B;  3BJU A;  1STA A;  1NBW A;  1DOL A;  1STN A;  3K58 A;  4OX9 Q;  2RQX A;  1K3B C;  4AYB E;  5IP7 H;  1JWU D;  1EFI D;  1BVS A;  3HOZ G;  5CV8 A;  4AH6 A;  4F8M A;  2EYP A;  1V8Q A;  1BF4 A;  1TWA B;  2YU9 B;  2F4V L;  4DR6 L;  4RMF A;  4C3I B;  1Y1W B;  4S3S A;  3PIP A;  4BBS B;  2K05 A;  4JBW A;  1U0L A;  3PUY A;  3M4P A;  3URY A;  3S16 B;  3K5O A;  2E5L Q;  2PMZ B;  4KN4 C;  5T1I A;  1ENC A;  2KVM A;  3PO3 H;  1PV4 A;  1I5F A;  2NZH A;  4XYQ A;  2B2W A;  1PZI D;  3S1R H;  2KUM A;  3IRB A;  1UAP A;  2E76 C;  5IYD H;  3K0Y A;  4KKU A;  3EA6 A;  3VYS A;  5AJ3 L;  5C44 G;  4LF4 Q;  3KYH C;  4DXF A;  5M3M B;  4NB3 A;  2MPM A;  2SOB A;  1N36 Q;  4K5W A;  4ODG A;  4G4K A;  1GUW A;  3G6J B;  1PMR A;  4HIO A;  1EY5 A;  3K57 A;  4L5S A;  1A3T A;  3VR4 A;  3HS0 C;  5JEA H;  3JC6 6;  2RSN A;  3U4Z A;  4DFA A;  3K80 C;  3TDQ A;  1JE4 A;  2PNH A;  5D14 A;  1TWG H;  2ZJP A;  2PYK A;  3BDL A;  4FXG C;  1B44 D;  1HUM A;  2EY1 A;  2QF7 A;  1SXT A;  2AWO A;  2KHI A;  3MVV A;  3SDZ A;  4GLX A;  3IL8 A;  4JI8 Q;  4C3J B;  4I7Z C;  4FO2 A;  2B63 B;  3HOY H;  2G9H D;  4HJ5 A;  1FGB D;  4WRD A;  4LF5 L;  5IWA Q;  3KLW A;  3A0J A;  3M3Y B;  1L1O A;  2Q8I B;  3UI2 A;  3OOC A;  3GTG B;  1FGU A;  4PNY A;  2L55 A;  2JE6 I;  2QIL A;  1IBM Q;  2UXC L;  4LF8 Q;  1G2S A;  3M7G A;  1YJ9 A;  4K0K Q;  1WOC A;  1EFW A;  1S5B D;  4U67 3;  1IW7 D;  2QCP X;  3A7A B;  1ZEQ X;  1CHP D;  4X64 Q;  3MAQ A;  1CI3 M;  2NWG A;  4OON A;  3I7F A;  2IHE A;  1N8R C;  3NP8 A;  5C4X G;  5C3E H;  2ALY B;  3EIV A;  1PYB A;  1K8O A;  1NR4 A;  2JA7 B;  4DPG A;  2KHS A;  3J7Y W;  5DAU A;  2JA6 H;  4CDC C;  2CHB D;  2CW0 D;  3BYT B;  2A69 D;  5IOC A;  1J5E L;  2K5H A;  1RF2 D;  4R4O A;  1HHV A;  1ZYR D;  4N8F A;  5ELO A;  1EQV A;  2MO0 A;  2F0E A;  1VQI A;  5G3L F;  2NN6 H;  4PZ8 A;  5FLM H;  2WAQ G;  3OHX C;  4WJ3 M;  1PH7 A;  1XJV A;  1BDO A;  1XPR A;  2P5Z X;  3CW2 C;  4ZCK A;  4CGY B;  2VW9 A;  4JOI A;  2EJF C;  5GRO A;  5KYL A;  4NXM Q;  4OO1 H;  1D1I A;  4DUZ L;  2N88 A;  3FDT A;  4GLV B;  4WJW A;  5GAG C;  1HR0 L;  3I4N B;  4X3K A;  5ELC A;  2JN4 A;  1PRT D;  2UXD L;  5EAY A;  1BCP D;  3CQZ H;  3GQB A;  2HHH L;  1XWE A;  2RKS A;  3JAM c;  2K33 A;  4QUC A;  3T51 B;  1K83 H;  4KK7 A;  1OXT A;  1V9P A;  1C8C A;  1G51 A;  3RMH A;  5M3F B;  1YNX A;  4PQX A;  3TZD A;  2K5V A;  2RBM A;  2B2U C;  2GN5 A;  4AYB G;  4DUY L;  4H44 C;  5JJZ A;  2AKW B;  3L3O C;  1TWA H;  4KY5 A;  2YU9 H;  3A54 A;  3EQL C;  3KK7 A;  3MXN B;  1Y1W H;  1STG A;  2F1M A;  2FMC A;  2X6L A;  2ENB A;  3CCE A;  1HCZ A;  2FHT A;  1JR0 D;  1EOV A;  3MHB A;  2HT1 A;  3DHQ A;  4A3E B;  3S16 H;  1KAW A;  1LM0 A;  1L2F A;  3J80 c;  4CKB A;  2LY7 A;  3O13 A;  2RDG A;  4DV6 Q;  3K7A H;  2CQO A;  4ULL A;  3R2T A;  1EYA A;  1V43 A;  5IIF A;  3FPU B;  4DV3 Q;  4R8I A;  4FF3 A;  1N33 L;  1FJG L;  1XYI A;  3I2Z A;  3GP7 A;  4KJO A;  4A3G B;  1HA5 A;  1IKL A;  1W2B A;  1NR2 A;  4OWX B;  2UU9 Q;  1EQR A;  1QWY A;  5KIX A;  2PMZ E;  1TWF B;  3DWQ A;  3AMU A;  1HNW Q;  1N32 L;  1KXL A;  3PO3 G;  5T1G A;  4JC0 A;  4DN4 M;  1CKO A;  1NY4 A;  3R2I A;  2PCF B;  3N52 A;  2IPK D;  3HOU B;  2NYZ D;  1VMP A;  1C7Y A;  3NUC A;  4A93 B;  2Z6K C;  5IYD G;  2NTT A;  2IL8 A;  2QW7 A;  4BY1 H;  4GNX C;  1PVO A;  1A8V A;  1P16 A;  1Y8O B;  4R1J A;  2E2H H;  1QB5 D;  1NE3 A;  4C3J H;  4DNI A;  1XMQ Q;  1SMX A;  2B63 H;  1YI2 A;  1U9R A;  5C4J B;  4BS9 A;  2F0M A;  3FEW X;  4DV4 Q;  1I94 Q;  5C4H A;  1AH9 A;  1IKM A;  4KD4 A;  1TKW B;  1D2B A;  4DA2 A;  3TQY A;  2VB3 X;  4OX9 L;  2CWA A;  3ITP A;  1PTO C;  1HTL D;  1H9K A;  3OIQ A;  1O78 A;  4PG3 A;  3NEM A;  1EYC A;  3ICE A;  3ULP A;  4U68 A;  3X3N A;  2XVS A;  3I4O A;  3HOY G;  1V1O A;  2OWO A;  1LTB D;  5D65 A;  1JB3 A;  1IZ6 A;  5DM7 3;  3OPO A;  4FP5 D;  1UEB A;  3R3O A;  2UUB Q;  5C0X J;  1VQ6 A;  2BDO A;  2Q2I A;  2PZU A;  2R6G A;  1MBY A;  3G4S A;  3K5M A;  3NBI A;  2PNR C;  4LF7 L;  1SNM A;  4K5V A;  2Y0S B;  2BH2 A;  2E5L L;  3M85 A;  4CJ0 B;  5JVG 3;  3ERQ A;  5FO7 B;  4YHH Q;  2O5J C;  3BZD B;  5C3E G;  1D6E C;  3D3R A;  3H3V H;  4KD3 A;  3K6O A;  4EQ5 A;  4LF4 L;  2JA6 G;  2HQL A;  2R93 H;  1CSQ A;  2DUD A;  2RF4 A;  3KF8 A;  1Q1B A;  5ELB A;  4N8X 1;  2PPB C;  1UWV A;  4OXP A;  3I4N H;  2Q8R E;  2TMP A;  1EYD A;  1L0X B;  2HIX A;  5LL6 S;  5FLM G;  2F0S A;  3A5Z B;  1RL2 A;  4L6T B;  1PRT F;  4R9W A;  1JJC B;  2M2L A;  4A3I B;  1IBK Q;  1F9S A;  5M3F H;  4A3F B;  4M8A A;  2RA4 A;  1JT8 A;  4OO1 G;  4R8N A;  1BUV T;  3I90 A;  5EKL A;  4JI8 L;  5CBA E;  1EEF D;  3D4W A;  5M5W B;  1CFM A;  1VQC A;  3BVG A;  4A3D B;  1D8L A;  4XXE A;  2CH4 W;  1CSP A;  1EOT A;  3GTP B;  5IWA L;  3TEH B;  3PMF A;  3GTM H;  4G57 A;  4IPC A;  2IW3 A;  3J7A F;  1XNR Q;  2WP8 J;  2EOT A;  4C2M B;  2NVQ B;  3OYY A;  4A3E H;  5EBD A;  3JAM i;  2RDF A;  1CKN A;  4DXG A;  2D0P A;  1KHI A;  3I3C A;  2UUC Q;  1QCB D;  4BBR B;  1BKB A;  1DOK A;  3Q22 A;  1SDF A;  2AHO B;  5JEA J;  2E8G A;  5BN4 A;  1E3P A;  4HIM A;  1PTO D;  3PUW A;  2XTI A;  4ZKB B;  1EU3 A;  4JI7 L;  1IL2 A;  1Y1W G;  1NJI C;  1S3O A;  2CH4 A;  4JG2 A;  5CV9 A;  1BBW A;  1AE2 A;  1LTL A;  4IN3 A;  1YIT A;  4C56 C;  4A3G H;  3NEN A;  3CU7 A;  2RHS B;  2VL6 A;  3OWF A;  1I50 B;  2NZ1 D;  1TWF H;  5C6A A;  2ZM6 L;  3PUX A;  3GTJ B;  1DJR D;  5ELF A;  1MJE A;  4QJF A;  1WD0 A;  3HOV B;  3EVQ A;  1PYW D;  3HOU H;  2VQE Q;  4A93 H;  2B8G A;  1Q46 A;  3I4M B;  1XTD A;  1A15 A;  3PF4 A;  1G6Z A;  4EGV A;  5M3M G;  4NXM L;  5GAD C;  1X65 A;  1R9T B;  3PUZ A;  2QEX A;  1F2M A;  1A2T A;  1CA6 A;  2F0T A;  2V4D A;  2RCF A;  4JI5 Q;  4HSP A;  3K5N A;  5C4J H;  5C4Z A;  2F4I A;  1GM5 A;  4APV A;  3DM3 A;  1KD1 C;  2ZTC A;  1KAA A;  2AUJ D;  3V96 A;  4DK6 C;  2D9U A;  4KY6 A;  4BY1 G;  1LAC A;  3OW7 A;  1S5D D;  4LF5 Q;  3DLL A;  4CHT B;  1YJW A;  5EGT A;  2XWJ B;  4C3J G;  2F3I A;  4HIK A;  5JVH 3;  5FO8 B;  4JI0 Q;  4GOP A;  1XPU A;  2B2T A;  2B63 G;  1BR9 A;  4IUU A;  3VYT A;  2UXC Q;  1E0B A;  2PW7 A;  1CA5 A;  4TVA B;  3PIP 3;  1L1O C;  2RDH A;  1HZ9 A;  1V1P A;  4M1U B;  4RFB A;  3LWE A;  1A3U A;  3G7L A;  3AQQ A;  5FOB B;  1CZW A;  1ASY A;  4ZRZ A;  1B53 A;  1S5F D;  4IQZ A;  5CBE E;  4HCS A;  4DV6 L;  1O80 A;  4IUV A;  1STB A;  2WKC A;  1GKH A;  3WDN A;  2JA7 G;  4OWW B;  4KMU C;  3JAM E;  2G9D A;  3PO2 B;  1LTR D;  4H7B A;  5KNB A;  5NUC A;  3GV3 A;  3MA2 B;  3S1R B;  2EY6 A;  1K0S A;  2UU9 L;  3SHL A;  4J1M A;  4DGZ A;  1HNW L;  2I5H A;  1SN8 A;  4FNF A;  1KLU D;  2PO4 A;  2DNE A;  4FYD A;  1B3Q A;  4JOI C;  2PW5 A;  4A3I H;  1SEB D;  3VA5 A;  3TS0 A;  5EKK A;  4A3F H;  2R93 G;  2VB2 X;  2L0C A;  3H0G B;  5I2Y A;  1CUK A;  3BDC A;  2K03 A;  3FVQ A;  2K50 A;  4PMC A;  1XMQ L;  3G48 A;  4YIJ A;  5M5W H;  3QIA A;  3D6W A;  2EE1 A;  3J80 E;  4G7H C;  4PZ6 A;  3I4N G;  4A3D H;  1H9R A;  4JI6 L;  3C46 A;  2JA5 B;  1D5Z C;  1HFN A;  3RN5 A;  1HTP A;  4DV4 L;  1I94 L;  3B6Y A;  3SXH A;  3KLS A;  3S14 H;  3CRL C;  1K0R A;  4DK0 A;  4B3M Q;  2NVQ H;  5M3F G;  4BBR H;  4FF1 A;  2A8V A;  3D4D A;  3JAM L;  2F0I A;  1VQO A;  3T13 A;  1EUJ A;  1VQP A;  1A0I A;  3KJO A;  2F52 A;  4R4Q A;  4PMW A;  1SRO A;  2VQF L;  1ET6 A;  5J39 A;  4IUN A;  4YWK A;  2UUB L;  4Y7N H;  2VS1 A;  3AFQ A;  4RHS A;  4POF A;  1PTO F;  3MXN A;  2VXW A;  2XNA C;  4LK1 C;  4LMQ D;  5JJK A;  5C3E B;  4HID A;  4A3E G;  1JMC A;  2VUM H;  3NBH B;  1O7I A;  1AE3 A;  3GTJ H;  3F2D A;  1VQA A;  1QVG A;  1GVP A;  1TS5 A;  4YHH L;  1ZXT A;  4O2D A;  2DY7 A;  3J81 j;  3WOF A;  3I91 A;  4HN7 A;  2B2V A;  4CBV A;  1QVF A;  3I4M H;  3M9B A;  3J80 L;  4Q5V A;  1C9O A;  5LMN W;  1R9T H;  3OIP A;  5IYB H;  2FJ2 A;  4A3G G;  3CME A;  1GOZ A;  3AB9 A;  1IXR A;  4B08 A;  2M9V A;  2D5D A;  2AMC B;  2O4X A;  4TKO B;  1UE1 A;  3S17 B;  3HKZ E;  1EY7 A;  4MIU A;  3NXW A;  2EDG A;  4MNO A;  4B3S Q;  2I5M X;  1K9M C;  2D0O A;  3TP8 A;  3HOU G;  1TU2 B;  3K7U C;  4P74 A;  1IBK L;  4A93 G;  3A74 A;  2LXJ A;  5BR8 Q;  3CD6 A;  2XWB B;  3HG9 A;  1DD2 A;  4MN3 A;  4JI1 Q;  1NSN S;  2MNA A;  3KLR A;  1PXU A;  5TSS A;  2PZW A;  1PH2 A;  2B8F A;  3MZ5 A;  3FPP A;  3S9W A;  1I4P A;  4L63 B;  1XNR L;  4A76 A;  2NTS A;  4IUQ A;  2CW0 C;  3GV6 A;  2A69 C;  2B39 A;  3AFP A;  2UUC L;  1Z47 A;  4DAM A;  3SK6 A;  1ILQ A;  2IX0 A;  4XT3 B;  1ZYR C;  2VNU D;  4B9X A;  5IGF A;  1BNZ A;  4LF7 Q;  5I9O A;  4K8I A;  1HUN A;  1FR3 A;  5EKI A;  2WII B;  2ZT9 C;  3PO2 H;  2K14 A;  2X69 A;  3K7A B;  1Q8K A;  1LTT D;  4O1N A;  4ZAI A;  1O7Y A;  3VR3 A;  1PFS A;  2OT2 A;  1EY9 A;  2Y0S G;  4RKB A;  4ZK9 B;  3U4V A;  4LFA L;  3J7Z C;  3VR2 A;  2HDM A;  3D0F A;  2MHV A;  1PRT C;  4NW2 A;  4UP7 A;  4QMG A;  2EXZ A;  1BCP C;  2JEA I;  2LMC B;  3R93 A;  4OIK A;  4ME5 A;  2VQE L;  2L4N A;  4KJN A;  3GTQ B;  1VQ9 A;  2ZXP A;  1WTX A;  2G5D A;  2BE5 C;  3H0G H;  3A8I E;  4XYO A;  1SJE D;  4KY7 A;  1NMG A;  4ALP A;  4X62 Q;  4JI5 L;  1I6H H;  2KCT A;  1BOS A;  2D62 A;  2K52 A;  4BY1 B;  2H1E A;  1ET9 A;  4QIW B;  1YNJ C;  1XX8 A;  1U4L A;  2E2H B;  1H9M A;  4HJ9 A;  4DV1 Q;  2JA5 H;  1PH4 A;  5IP9 G;  1X9N A;  1GUG A;  2K5Q A;  1PYS B;  1B2T A;  4FXD A;  1XMO L;  1A3V A;  4A3I G;  2EYM A;  1G8Z D;  3RLN A;  2MO1 A;  1F2Z A;  4GKJ Q;  3ONA B;  4A3F G;  4IFD H;  4G7Z C;  3F2B A;  1WTO A;  3FMC A;  2N8N A;  3V2T A;  4DF7 A;  4JI0 L;  1B9M A;  1LYL A;  1ESR A;  5CR3 A;  4A3D G;  3W3A A;  4CJ1 B;  4A3M H;  1MIU A;  4IPG A;  2OF1 A;  3GD7 A;  3ZJY C;  1VQ7 A;  5CV5 A;  1PZK D;  5JAV A;  3UDF A;  1E22 A;  4OHJ A;  4RCO A;  4JBM A;  2A6E C;  4JI7 Q;  1CK1 A;  4BBR G;  1VQE A;  1MI2 A;  1PFN A;  1YJN A;  2IT1 A;  1K8A C;  1LT6 D;  2Z4H A;  2ZM6 Q;  3HOW H;  1TVX A;  1Y8P B;  3M4Q A;  1VQL A;  4O42 A;  2A74 C;  4MHE A;  4AQY Q;  3CPF A;  1D7Q A;  1I4H A;  1Q7Y C;  1EL0 A;  1RKN A;  3NPP A;  2K28 A;  4BWG B;  3OW2 A;  2VUM G;  2F0L A;  3BVM A;  2R93 B;  1LAB A;  3S17 H;  4DNT B;  3Q0A A;  1MSH A;  4C3H B;  4N9T A;  4GNX B;  3HOV G;  1WTV A;  1S40 A;  5FK9 C;  5M5X B;  4LF9 L;  3D4R A;  3I4M G;  4FVM A;  2UUA Q;  1T5X D;  4DR7 L;  2X6G A;  5CMD A;  2KCC A;  4LUZ A;  1L0W A;  1G2T A;  5IYB G;  4HJA A;  1TS2 A;  5C0X G;  1B3A A;  4P75 A;  2NVX B;  4P71 A;  2BE5 D;  2DJF C;  1CM9 A;  3CCM A;  3FP9 A;  4IJL A;  1HZB A;  3EJI A;  4NPS A;  2XRQ D;  4XIG S;  4BA2 I;  1HZC A;  1YNJ D;  1PTO B;  3T1H Q;  2KBN A;  2PQA B;  5H1S E;  3L0O A;  4CJ2 C;  1SRU A;  3KF6 A;  4B3M L;  5I9P A;  2WV6 D;  3CCJ A;  4A3B B;  2JA8 B;  3GTK H;  3GTM B;  2PI2 E;  1VMC A;  5DEH A;  5GAE C;  5A2Q E;  4X3U A;  2K7V A;  3S2H B;  2C35 B;  2Z0S A;  4GOP C;  2JA9 A;  2B2T C;  1B70 B;  1HNZ Q;  4DAY B;  4L5Q A;  3T1Y Q;  5IP7 G;  4DR1 Q;  2OEO A;  1MSG A;  4KLK A;  4CDD C;  3P1H A;  5CGK A;  2R61 A;  4KN7 C;  1G91 A;  1LTA D;  2A6E D;  1WVL A;  1RJT A;  4HMI A;  1MHW C;  1H9S A;  3F2U A;  1N34 L;  4HJ8 A;  4A3J B;  2L9H A;  3PO2 G;  3GTQ H;  4XQN A;  4OL7 A;  4LFB L;  3KDF B;  3RZD H;  3VA7 A;  4R4I A;  2QKI C;  1E1O A;  1UE5 A;  4JI4 Q;  1NMF A;  3CCU A;  3CCS A;  5KYI A;  3LGJ A;  2KEE A;  5K36 H;  3H09 A;  5IT9 E;  5D3D A;  2EVB A;  1ML0 D;  2I5L X;  1P8L A;  4B3S L;  3UDX A;  3J81 E;  5A2Q L;  3DUZ A;  4POG A;  2ES2 A;  5BR8 L;  1AW7 A;  1OTC A;  1WJJ A;  5JEA G;  5GAH C;  1PFM A;  5LMN Q;  4JI6 Q;  2Q2H A;  3H0G G;  1LO5 D;  2KCM A;  3OSO A;  1DYQ A;  4JI1 L;  3IAY A;  2KA7 A;  5HUR A;  4JV5 Q;  5CYU A;  2E2I B;  1Q86 C;  1STE A;  4QIW E;  4RGN A;  4UHV A;  4ZQ3 A;  2RVL A;  2JA5 G;  2EYL A;  4F88 A;  3KBX A;  2HD3 A;  2R3Z A;  1DZ1 A;  3SVM A;  1ENA A;  1EYG A;  2VQF Q;  1L0Y B;  3S15 B;  4IFD G;  1E1T A;  5M5Y H;  1FNW A;  1D1K A;  1OO9 B;  2SNS A;  5AFW A;  2Q2T A;  1TY2 A;  1WTP A;  2K01 A;  2FIN B;  3W5O A;  4A3M G;  1TR5 A;  1LLR D;  1KDB A;  1O7L A;  1YVC A;  5IT9 L;  3E6Z X;  3GO5 A;  3TN2 A;  5IGE A;  3CAM A;  2HCC A;  2K6A A;  3HKS A;  3J81 L;  1A63 A;  1VDZ A;  4NXN Q;  3BG3 A;  1GHK A;  2D2C C;  1QUQ A;  1AN8 A;  1F9P A;  3NWS A;  4IAL A;  5A35 A;  2Z4I A;  4C3H H;  1GXD C;  1EWC A;  4QQB X;  1PH9 A;  3D8G A;  3V05 A;  2B2V C;  4YCW A;  1FD7 D;  5M5X H;  2ZXO A;  2NN6 G;  3HOW G;  2CKZ B;  1RIP A;  1JOK A;  3I55 A;  4J8Q A;  3L9A X;  1M4V A;  4X62 L;  1BCP F;  2EYJ A;  2NVX H;  4P72 A;  2MGS A;  1SNO A;  3G71 A;  1RCV D;  2BA0 A;  4DV1 L;  2JJQ A;  3TME A;  3S1N B;  2RCN A;  5JOB A;  1TWH B;  1UNS A;  3RLO A;  1PTO H;  1IYV A;  1E2V A;  1B8A A;  4HSV A;  3S2D B;  2A73 B;  4GKJ L;  4GS3 A;  4A3B H;  4XQJ A;  2JA8 H;  1JJG A;  3CHB D;  4DNR B;  3S2H H;  1NUC A;  2R7Z H;  1L1O B;  1HA6 A;  5EQ0 A;  3T16 A;  3S14 B;  5ELN A;  4K5X A;  1RD9 D;  3IFD A;  2O5I C;  4X6A H;  2RHQ B;  3TP6 A;  1JWS D;  1KIX A;  5ELD A;  1E2Z A;  2L12 A;  5HY6 A;  5LL6 X;  1JC7 A;  3ERO A;  2GA4 B;  3AU7 A;  1SNC A;  4JYA Q;  1I4X A;  1YZ6 A;  3SE0 A;  1GUN A;  4MZ9 A;  4Y7N B;  4KV6 A;  4ZYS A;  4MTN A;  5LHY 1;  1J8I A;  3KUP A;  1PH6 A;  1CZG A;  4XTC S;  1EIH A;  4CDE C;  2VUM B;  1C0A A;  1ZKO A;  4A3J H;  4LFA Q;  3MFY A;  3HKZ B;  4DK1 A;  4DV0 L;  4AQY L;  4G7O C;  4IFD J;  3J80 i;  1S5E D;  1SAP A;  3W1B A;  4JI2 Q;  2KEC A;  4DR4 Q;  2H5X A;  4R4T A;  1SMY C;  1BO0 A;  1J9O A;  4C1N I;  1PFB A;  3I8Z A;  1YEZ A;  1W6J A;  1IYU A;  4UAI A;  3MXP A;  3S1Q H;  2OTJ A;  1B4O A;  4B3R Q;  2NZO A;  2UUA L;  1ILP A;  1K8G A;  4I65 A;  2SDF A;  4IPH A;  4YWM A;  3R8B A;  3I73 A;  1QZG A;  3DXJ C;  4DR2 L;  1XMO Q;  2IY5 B;  2E2I H;  2IX3 A;  1Y69 U;  3DWA A;  2IX1 A;  5HGQ A;  1H95 A;  5K36 G;  3HZX A;  2E2D C;  4IJH A;  5FO9 B;  1HJP A;  1MJC A;  5E1F A;  5KNC A;  2MP1 A;  3KFU A;  1F9R A;  2B3G A;  3LNN A;  3U9O A;  4BY7 B;  3T1H L;  5DM6 3;  3H94 A;  3SK4 A;  2NVY B;  3A8K E;  5ISR A;  2F0O A;  5IY0 A;  3OWE B;  3PV0 A;  1X32 A;  1DCZ A;  1DM0 B;  1IYJ B;  4HMJ A;  5J1Z A;  3S15 H;  2WB1 E;  2DGY A;  2CFM A;  3K81 C;  4A3K B;  1HNZ L;  1CKM A;  1MD2 D;  4R4C A;  4PMB A;  4A75 A;  1PLF A;  1JQY D;  3T1Y L;  3D31 A;  3QO2 A;  4DR1 L;  3U50 C;  1O7Z A;  2BCO A;  2NUC A;  2NBF A;  4ABN A;  3UE1 A;  1AEX A;  4GKK Q;  4F87 A;  3RR5 A;  1LUZ A;  4KHP Q;  5IGD A;  1A62 A;  2EIF A;  2QEJ C;  3CCR A;  1SND A;  1LV9 A;  3A7L A;  3HRZ C;  3NHH A;  2JSO A;  3DWP A;  5HGT A;  1KRT A;  2JEB I;  3FRP B;  1VQD A;  2AQ1 B;  4V19 0;  1GO3 E;  4ZUI A;  1R4P B;  1TXY A;  4YWL A;  4JI4 L;  4LF9 Q;  4HAE A;  1VQ8 A;  4N9P A;  5C0X I;  1HQM C;  1JE5 A;  4GN5 A;  5IYC H;  4DR7 Q;  1IHZ A;  2JP1 A;  2OQ0 A;  3F8T A;  4C3H G;  2Q2U A;  3S1N H;  4X3S A;  1SLJ A;  1TWH H;  1SMY D;  2EYO A;  2WKD A;  2Z9H A;  1I6H B;  1VF7 A;  4ILW A;  4ID6 A;  3ZYY X;  5COY A;  1SFO B;  1TS3 A;  3S2D H;  5LMN L;  3TRE A;  1STH A;  2A6H D;  3E9I A;  3N6R A;  1ASZ A;  1HFG A;  2BOS A;  4JV5 L;  1JIC A;  1RTN A;  1FVI A;  2EPB A;  1RTO A;  2H4O A;  1WCM H;  3CC4 A;  2K75 A;  1KLG D;  5IT9 c;  4PV1 C;  2CCZ A;  4JBJ A;  4NDX A;  3PSI A;  3J81 c;  4IUR A;  1I6V C;  4A3M B;  2KEN A;  1PH8 A;  1TS4 A;  2JA8 G;  4A3B G;  2OQK A;  1FNV A;  2R7Z G;  4ZKC B;  1Q81 C;  3OTO L;  3DMU A;  4JI3 Q;  2NB0 A;  1HRJ A;  1AZP A;  4YCU A;  5D3I B;  1EY4 A;  1VQ4 A;  1EY6 A;  3T4A C;  1N34 Q;  1PRT B;  4NXN L;  3TP7 A;  3U58 A;  3UDI A;  1BCP B;  4V0B A;  3HOW B;  3MEH A;  4LFB Q;  2F0W A;  1SYG A;  4A3C H;  1B1Z A;  1GJX A;  2Q8T A;  4L5T A;  3KF8 B;  1ENF A;  3KJP A;  2OCE A;  4QUF A;  4A3J G;  2RSO A;  1PA6 A;  1G29 1;  1CT1 D;  3RUZ A;  2A68 D;  5EBC A;  1SYF A;  1AP0 A;  2WAQ E;  2AUK A;  5GQO A;  2L5T A;  1KAB A;  3QR8 A;  2FFK B;  1YHQ A;  2YV5 A;  3PGZ A;  2EJM A;  2L1B A;  4LFC Q;  2CWP A;  2WIN B;  1EU4 A;  1QE6 A;  3OMC A;  5ELE A;  4BY7 H;  2NVY H;  1WD1 A;  3VYU A;  1SYB A;  2MQH A;  5FJ8 H;  1TY0 A;  1VQK A;  1QOH A;  3HOX B;  3E9H A;  1X3E A;  5CC4 A;  1YHB A;  3MXU A;  2WB1 G;  4RA8 A;  1JOQ A;  4A3K H;  5E7N A;  2NVT H;  2ZTD A;  4DV5 L;  1QVC A;  3GTK B;  1II3 A;  3QG1 A;  1CKN B;  4F7X A;  1GHJ A;  5EPJ A;  3GTL B;  1GUT A;  2N55 A;  5BN3 A;  4IPD A;  2ID0 A;  1Y1V B;  4LW1 A;  4KTA A;  2JQO A;  3F2C A;  5EJW A;  4JYA L;  3PF5 A;  2LKV A;  3LWU A;  2N3S A;  3K0X A;  5L37 A;  1TWC H;  2K5W A;  2GVA A;  1F77 A;  1K8M A;  3CXC A;  1KL9 A;  1BXT A;  1H9J A;  1BQQ T;  4DAV A;  1VS0 A;  1NNX A;  2PQE A;  1WI5 A;  1X3G A;  3ERS X;  1U4P A;  4FDB A;  2NN6 I;  1K28 A;  2Z6B A;  1EY8 A;  2E2J B;  2J7Z A;  1CQF A;  2TSS A;  3M7N A;  4JI2 L;  4DR4 L;  1D5M C;  1VCI A;  3NEL A;  3MEF A;  4DR3 Q;  3E5S A;  4RWS C;  3RZD B;  1W3S A;  3NWT A;  2F0F A;  4OO1 I;  4DAP A;  3SK8 A;  5FKA C;  1PHJ A;  3M4Y A;  2LSS A;  1I4Q A;  4B3R L;  4WJ4 A;  1SE4 A;  1SFO H;  4YCV A;  1SYC A;  3CMA A;  4Q0F A;  4B9W A;  3BYY B;  4OEL B;  3NTK A;  2HDL A;  2Z1C A;  5E3F A;  1Q3L A;  5IYC G;  1PH3 A;  4LWC A;  1ESF A;  3FKI B;  3TSS A;  4DV7 Q;  1VQN A;  3CC7 A;  4H0L C;  1M1K C;  3NTH A;  4HCE A;  4GOP B;  5LMU Q;  1T9H A;  1KQS A;  2A1A A;  1TQO A;  1K73 C;  2R92 B;  2E74 C;  4UPA A;  4OIJ A;  5KGU A;  1HQR D;  3VR5 A;  1V1P B;  2F0G A;  2HQE A;  2HIV A;  4RGO S;  1EIG A;  1C4Q A;  1HZA A;  1WCM G;  5M5Y B;  2XGT A;  4NKL A;  3RLF A;  3C2P A;  4LJZ C;  3NK9 A;  1BBU A;  4TSS A;  4WOR A;  2I0Q A;  3CF5 A;  1I4R A;  4K2K A;  1JCK B;  1A2U A;  4PZ7 A;  3RD4 A;  2B29 A;  3HFZ B;  4GKK L;  1QG7 A;  4NP5 A;  4UP9 A;  3MXG A;  1AFP A;  4DV0 Q;  3J81 i;  4KHP L;  1KDA A;  5I6Y A;  4HTH A;  4UP8 A;  1PH1 A;  2MJ8 A;  3QWN A;  3BZK A;  1X56 A;  3HKZ G;  2MFI A;  1XNQ Q;  2F0D A;  3C1E A;  3P20 A;  1SBB B;  4BA1 I;  3HGB A;  1SNP A;  4B3T Q;  3RNU A;  4TRD A;  3EN2 A;  4IO9 A;  1FYC A;  4A3C G;  1QJO A;  1U4M A;  1S4Z A;  3BZC A;  4DR2 Q;  3GTO B;  1Y8N B;  4X66 Q;  2IWH A;  4MTK A;  1HNX Q;  3HOX H;  2DY8 A;  2K5D A;  3L7Z C;  1EQT A;  1QIL A;  2EYF A;  5DNF A;  2QDB A;  3H15 A;  2R7Z B;  4K8J A;  1QNU A;  2F3V A;  1I3Q B;  3GTL H;  4BY7 G;  2ICI A;  4K6D A;  1Y1V H;  5FJ8 G;  3PIO A;  1C48 A;  1VQF A;  3S24 A; 
#chains in the Genus database with same CATH homology
 1IL8 A;  4UDU C;  2KCN A;  1LTS D;  1EEI D;  1KNA A;  4EQP A;  3HEJ A;  1EY0 A;  3SR1 A;  4KKT A;  3A56 A;  4RGT A;  1R4Q B;  3RZO B;  2E75 C;  4X3T A;  1W6K A;  2KOL A;  4XQQ A;  1NCV A;  1WTW A;  1TT2 A;  2KJX A;  1XTC D;  2I07 B;  3SEB A;  1ROD A;  4XDX A;  2M00 A;  3WOE A;  2L11 A;  4KKS A;  1VF5 C;  2B2Y A;  3S1Q B;  2YYZ A;  2OXP A;  3KLS X;  1DON A;  1RHP A;  3H3V C;  1SSO A;  3TZU A;  2WB1 B;  3VR6 A;  1S5C D;  2K32 A;  1AZQ A;  2JXM B;  3X3M A;  4CKE A;  3DEO A;  1CQV A;  2C5C A;  4EQO A;  1EWH A;  3A8J E;  1ICW A;  3PUV A;  2F0N A;  1LT3 D;  1EZ8 A;  3BVZ A;  5J22 A;  3HOZ B;  3U9S A;  3BS1 A;  4HR7 B;  3I72 A;  3NTI A;  4TQU S;  3IFT A;  2HCI A;  4Z9C B;  1F2L A;  5IOD A;  5JPM C;  2KED A;  2ICE C;  1Q8I A;  2AQ2 B;  4GZY C;  1STY A;  1SE3 A;  2F0H A;  1MGS A;  4L8J A;  4QCL A;  3K5L A;  3TP5 A;  5C3W A;  2J0T D;  1X3Q A;  1DOM A;  3MTS A;  3NBH A;  1HXY D;  5C44 B;  2A5H A;  4JK1 C;  2DNC A;  1SE2 A;  2I46 A;  4RAU C;  5M9O A;  1CTM A;  3ND9 A;  1WTR A;  3QOL A;  3QB3 A;  2F0V A;  1Q90 A;  4E6I A;  4QF4 A;  1WCM B;  1XXG A;  4RHR A;  2F3W A;  1OXU A;  4ZUJ A;  2AQ3 B;  5IGB A;  3OMG A;  2AWN A;  3LX0 A;  4C1N K;  5CV7 A;  5I2X A;  2LFN A;  3S1M B;  1F9Q A;  1I4G A;  2F0P A;  1RDP D;  2HUG A;  3HP3 A;  4H13 C;  5C4X B;  4HED A;  3A55 A;  4FXK C;  5BN5 A;  1JOO A;  5COR A;  3P75 A;  2K04 A;  1NAP A;  2F0U A;  1GUO A;  3J7A V;  1WTQ A;  2XSC A;  4IZ8 A;  4K2L A;  5KEE A;  2SEB D;  5JPN C;  1X3P A;  2LS0 1;  4C3I G;  2WAQ B;  2JYO A;  4WFN 3;  1SJH D;  1SYD A;  5KND A;  3QJY A;  3E0J A;  4NMZ A;  3NE5 B;  2F0K A;  1KTK A;  2A6H C;  1SNQ A;  4RH6 A;  2B2W C;  3M4O B;  3H91 A;  1FNU A;  1SYE A;  4ZLT F;  2O2L D;  5I4D A;  5E4X A;  3CKI B;  2SNM A;  1F2Y A;  4RCN A;  3DM1 A;  5KRU A;  2K1B A;  1LTI D;  1GUS A;  5E4W C;  3NQT A;  2IJ0 A;  2EJG C;  3BDO A;  1TII D;  3C3L A;  2B2U A;  4AYB B;  1BBX C;  2ZXR A;  3MWY W;  2F0Q A;  2NVT B;  3MFG A;  1OXV A;  1YNN C;  1A6X A;  4KHZ A;  2EZV A;  1PZJ D;  3H6M A;  5CV4 A;  2F0J A;  5EPK A;  2Z8L A;  1EZ6 A;  4LAA A;  1E2W A;  1KNE A;  1TWC B;  1U4R A;  4RGM A;  3KBG A;  3CRK C;  2A68 C;  3EFX D;  1H9S B;  2EY2 A;  1B50 A;  4RKL A;  4K14 A;  3DEP A;  1LT4 D;  1UEA B;  3PO3 B;  2BA1 A;  1B9N A;  4DU9 A;  3NQI A;  5C3X A;  1DXM A;  4XT1 B;  5IGC A;  3IKJ A;  1Z7T A;  1KDC A;  3SK5 A;  1ONL A;  2J4X A;  1JOR A;  1Q12 A;  4EVO A;  4FF4 A;  4K6L A;  1QNK A;  1TWG B;  2EYH A;  2DN8 A;  5K5P A;  2CQA A;  1Z6H A;  5CV6 A;  3QOJ A;  4EQN A;  3HOY B;  2EY5 A;  3Q6S A;  3MC0 B;  5FLX E;  3Q23 A;  1HPC A;  4FF2 A;  3K59 A;  1D5X C;  2KQ3 A;  4CKC A;  5I6W A;  2FMM A;  4DAY A;  4IUP A;  1JWM D;  1YNN D;  3Q24 A;  2F03 A;  5F2D A;  2WAC A;  2C9O A;  5C5L A;  1CHQ D;  1M8A A;  2XIW A;  2XRS D;  5EPL A;  4KI0 A;  1LT5 D;  3T56 B;  4IUT A;  2JA6 B;  2CVR A;  3T53 B;  5G3L D;  2MUY A;  2BDN A;  1OXS C;  3D6C A;  5IGG A;  3ND8 A;  1UUP A;  3W2D A;  1T5E A;  5C5M A;  5C0X H;  2XN9 C;  2B2Y C;  4OGQ C;  3I70 A;  4P2C B;  1OXX K;  5FLX L;  2PZT A;  3I4L A;  4QB4 A;  3TBI B;  3VYR A;  4IFD I;  3P7J A;  4J6H A;  3NSW A;  3C1F A;  3CQZ B;  1LTG D;  4KHV A;  3PIO 3;  1PDQ A;  1Q1E A;  1K83 B;  1IW7 C;  1STA A;  1DOL A;  1STN A;  3K58 A;  2RQX A;  1JWU D;  1EFI D;  5CV8 A;  4F8M A;  2EYP A;  1V8Q A;  1BF4 A;  1TWA B;  2YU9 B;  4C3I B;  1Y1W B;  4S3S A;  4BBS B;  2K05 A;  4JBW A;  3PUY A;  3URY A;  3S16 B;  3K5O A;  2PMZ B;  5T1I A;  4KN4 C;  1ENC A;  2KVM A;  4XYQ A;  2B2W A;  1PZI D;  2KUM A;  1UAP A;  2E76 C;  3K0Y A;  4KKU A;  3EA6 A;  3VYS A;  4DXF A;  5M3M B;  2MPM A;  2SOB A;  4K5W A;  4ODG A;  4G4K A;  1GUW A;  3G6J B;  1PMR A;  1EY5 A;  3K57 A;  1A3T A;  3VR4 A;  3HS0 C;  5JEA H;  2RSN A;  4DFA A;  3TDQ A;  1JE4 A;  5D14 A;  2PYK A;  3BDL A;  4FXG C;  1B44 D;  1HUM A;  2EY1 A;  2QF7 A;  1SXT A;  2AWO A;  3MVV A;  3SDZ A;  3IL8 A;  4C3J B;  4I7Z C;  4FO2 A;  2B63 B;  2G9H D;  1FGB D;  4WRD A;  3M3Y B;  2Q8I B;  3UI2 A;  3OOC A;  3GTG B;  4PNY A;  2L55 A;  2JE6 I;  2QIL A;  1G2S A;  3M7G A;  1S5B D;  4U67 3;  1IW7 D;  2QCP X;  3A7A B;  1ZEQ X;  1CHP D;  3MAQ A;  1CI3 M;  2NWG A;  3NP8 A;  1K8O A;  1NR4 A;  2JA7 B;  3J7Y W;  2KHS A;  5DAU A;  2CHB D;  2CW0 D;  3BYT B;  2A69 D;  5IOC A;  1RF2 D;  1HHV A;  1ZYR D;  1EQV A;  2F0E A;  5G3L F;  2NN6 H;  3OHX C;  1BDO A;  4CGY B;  2EJF C;  5KYL A;  4OO1 H;  1D1I A;  2N88 A;  3FDT A;  4WJW A;  3I4N B;  4X3K A;  5ELC A;  1PRT D;  1BCP D;  3GQB A;  1XWE A;  2RKS A;  2K33 A;  4QUC A;  3T51 B;  4KK7 A;  1OXT A;  1C8C A;  3RMH A;  5M3F B;  4PQX A;  3TZD A;  2RBM A;  2B2U C;  4H44 C;  5JJZ A;  3L3O C;  4KY5 A;  3A54 A;  3EQL C;  3KK7 A;  1STG A;  2F1M A;  2FMC A;  2X6L A;  2ENB A;  1HCZ A;  2FHT A;  1JR0 D;  3MHB A;  3DHQ A;  4A3E B;  4CKB A;  2LY7 A;  3O13 A;  2RDG A;  4ULL A;  3R2T A;  1EYA A;  5IIF A;  1V43 A;  3FPU B;  4R8I A;  4FF3 A;  1XYI A;  3GP7 A;  4KJO A;  4A3G B;  1HA5 A;  1IKL A;  1NR2 A;  1QWY A;  5KIX A;  3DWQ A;  1TWF B;  3AMU A;  5T1G A;  4DN4 M;  3R2I A;  2PCF B;  3N52 A;  2IPK D;  3HOU B;  2NYZ D;  1VMP A;  3NUC A;  4A93 B;  2NTT A;  2IL8 A;  1Y8O B;  1QB5 D;  1U9R A;  5C4J B;  4BS9 A;  2F0M A;  3FEW X;  5C4H A;  1IKM A;  4KD4 A;  1TKW B;  1D2B A;  4DA2 A;  2VB3 X;  3ITP A;  1PTO C;  1HTL D;  1H9K A;  3OIQ A;  1O78 A;  1EYC A;  4U68 A;  3X3N A;  2XVS A;  1V1O A;  1LTB D;  5D65 A;  1JB3 A;  5DM7 3;  3OPO A;  4FP5 D;  3R3O A;  5C0X J;  2BDO A;  2PZU A;  2R6G A;  1MBY A;  3K5M A;  3NBI A;  2PNR C;  1SNM A;  4K5V A;  2Y0S B;  3M85 A;  4CJ0 B;  5JVG 3;  3ERQ A;  5FO7 B;  2O5J C;  3BZD B;  1D6E C;  3D3R A;  4KD3 A;  3K6O A;  3KF8 A;  1Q1B A;  5ELB A;  2PPB C;  2Q8R E;  2TMP A;  1EYD A;  1L0X B;  5LL6 S;  2F0S A;  4L6T B;  1PRT F;  4R9W A;  4A3I B;  2M2L A;  1F9S A;  4A3F B;  4M8A A;  2RA4 A;  4OO1 G;  4R8N A;  1BUV T;  3I90 A;  5EKL A;  5CBA E;  1EEF D;  3D4W A;  5M5W B;  1CFM A;  3BVG A;  4A3D B;  4XXE A;  1EOT A;  3GTP B;  3PMF A;  4G57 A;  2IW3 A;  3J7A F;  2WP8 J;  2EOT A;  4C2M B;  2NVQ B;  5EBD A;  2RDF A;  4DXG A;  3I3C A;  1QCB D;  4BBR B;  3Q22 A;  1DOK A;  1SDF A;  5JEA J;  5BN4 A;  1PTO D;  3PUW A;  4ZKB B;  1EU3 A;  5CV9 A;  4IN3 A;  4C56 C;  3CU7 A;  3OWF A;  1I50 B;  2NZ1 D;  5C6A A;  3PUX A;  3GTJ B;  1DJR D;  5ELF A;  3HOV B;  1WD0 A;  3EVQ A;  1PYW D;  2B8G A;  3I4M B;  1A15 A;  1G6Z A;  4EGV A;  1R9T B;  3PUZ A;  1F2M A;  1A2T A;  1CA6 A;  2F0T A;  2V4D A;  4HSP A;  3K5N A;  5C4Z A;  2F4I A;  1KAA A;  2AUJ D;  3V96 A;  2D9U A;  4KY6 A;  1LAC A;  3OW7 A;  1S5D D;  4CHT B;  5EGT A;  2XWJ B;  4C3J G;  5JVH 3;  5FO8 B;  2B2T A;  1BR9 A;  4IUU A;  3VYT A;  1E0B A;  2PW7 A;  1CA5 A;  3PIP 3;  2RDH A;  1V1P A;  4M1U B;  4RFB A;  3LWE A;  1A3U A;  3G7L A;  5FOB B;  1CZW A;  4ZRZ A;  1B53 A;  1S5F D;  4IQZ A;  5CBE E;  4HCS A;  1O80 A;  4IUV A;  1STB A;  2WKC A;  3WDN A;  4KMU C;  3JAM E;  2G9D A;  3PO2 B;  1LTR D;  4H7B A;  5KNB A;  5NUC A;  3GV3 A;  3MA2 B;  3S1R B;  2EY6 A;  3SHL A;  4J1M A;  4DGZ A;  4FNF A;  1KLU D;  2PO4 A;  2DNE A;  4FYD A;  2PW5 A;  1SEB D;  3VA5 A;  5EKK A;  2VB2 X;  2L0C A;  3H0G B;  5I2Y A;  3FVQ A;  3BDC A;  2K03 A;  4PMC A;  4YIJ A;  3QIA A;  3D6W A;  2EE1 A;  3J80 E;  4G7H C;  1H9R A;  3C46 A;  2JA5 B;  1D5Z C;  1HFN A;  1HTP A;  3SXH A;  3KLS A;  3CRL C;  4DK0 A;  4FF1 A;  3D4D A;  3JAM L;  2F0I A;  3T13 A;  4PMW A;  1ET6 A;  5J39 A;  4IUN A;  4RHS A;  1PTO F;  3MXN A;  2VXW A;  2XNA C;  4LK1 C;  4LMQ D;  5C3E B;  1TS5 A;  1ZXT A;  2DY7 A;  3WOF A;  3I91 A;  4HN7 A;  2B2V A;  4CBV A;  4Q5V A;  3J80 L;  3OIP A;  2FJ2 A;  1GOZ A;  3AB9 A;  4B08 A;  2M9V A;  2D5D A;  2O4X A;  4TKO B;  3S17 B;  1EY7 A;  4MIU A;  3NXW A;  2EDG A;  3TP8 A;  1TU2 B;  2XWB B;  3HG9 A;  1DD2 A;  4MN3 A;  1NSN S;  3KLR A;  1PXU A;  5TSS A;  2PZW A;  2B8F A;  3MZ5 A;  3FPP A;  3S9W A;  1I4P A;  4L63 B;  2NTS A;  4IUQ A;  2CW0 C;  3GV6 A;  2A69 C;  2B39 A;  1Z47 A;  3SK6 A;  1ILQ A;  2IX0 A;  4XT3 B;  1ZYR C;  2VNU D;  4B9X A;  5IGF A;  1BNZ A;  5I9O A;  4K8I A;  1HUN A;  1FR3 A;  5EKI A;  2WII B;  2ZT9 C;  2X69 A;  3K7A B;  4ZAI A;  1LTT D;  4O1N A;  1O7Y A;  3VR3 A;  2OT2 A;  1EY9 A;  4RKB A;  4ZK9 B;  3VR2 A;  2HDM A;  2MHV A;  1PRT C;  4NW2 A;  4QMG A;  2EXZ A;  1BCP C;  2JEA I;  2LMC B;  3R93 A;  4OIK A;  4ME5 A;  2L4N A;  4KJN A;  3GTQ B;  2ZXP A;  1WTX A;  2BE5 C;  3A8I E;  4XYO A;  1SJE D;  4KY7 A;  1BOS A;  2D62 A;  4BY1 B;  2H1E A;  1ET9 A;  4QIW B;  1YNJ C;  1XX8 A;  1U4L A;  2E2H B;  1H9M A;  1GUG A;  2K5Q A;  1B2T A;  4FXD A;  1A3V A;  2EYM A;  1G8Z D;  1F2Z A;  3ONA B;  4IFD H;  4G7Z C;  1WTO A;  3FMC A;  3V2T A;  4DF7 A;  1B9M A;  1ESR A;  5CR3 A;  3W3A A;  4CJ1 B;  2OF1 A;  3GD7 A;  5CV5 A;  1PZK D;  5JAV A;  4OHJ A;  4RCO A;  2A6E C;  1CK1 A;  1MI2 A;  1PFN A;  2IT1 A;  1LT6 D;  2Z4H A;  1TVX A;  1Y8P B;  4O42 A;  2A74 C;  4MHE A;  1I4H A;  1EL0 A;  1RKN A;  3NPP A;  2K28 A;  4BWG B;  2F0L A;  3BVM A;  2R93 B;  1LAB A;  4DNT B;  3Q0A A;  1MSH A;  4C3H B;  4N9T A;  1WTV A;  5FK9 C;  5M5X B;  3D4R A;  4FVM A;  1T5X D;  2X6G A;  5CMD A;  2KCC A;  1G2T A;  1TS2 A;  5C0X G;  1B3A A;  2NVX B;  2BE5 D;  1CM9 A;  3EJI A;  2XRQ D;  4XIG S;  4BA2 I;  1YNJ D;  1PTO B;  4CJ2 C;  5I9P A;  2WV6 D;  4A3B B;  2JA8 B;  3GTM B;  1VMC A;  5DEH A;  5A2Q E;  4X3U A;  2K7V A;  3S2H B;  2B2T C;  2OEO A;  1MSG A;  3P1H A;  5CGK A;  2R61 A;  4KN7 C;  1G91 A;  1LTA D;  2A6E D;  1WVL A;  1RJT A;  4HMI A;  1H9S A;  3F2U A;  4A3J B;  2L9H A;  4XQN A;  4OL7 A;  3VA7 A;  2QKI C;  5KYI A;  2KEE A;  5K36 H;  3H09 A;  5IT9 E;  5D3D A;  2EVB A;  1ML0 D;  3J81 E;  5A2Q L;  3DUZ A;  1AW7 A;  5JEA G;  1PFM A;  1LO5 D;  3OSO A;  1DYQ A;  3IAY A;  2KA7 A;  5HUR A;  2E2I B;  5CYU A;  1STE A;  4RGN A;  4ZQ3 A;  2RVL A;  2EYL A;  4F88 A;  3KBX A;  2R3Z A;  1DZ1 A;  3SVM A;  1ENA A;  1L0Y B;  3S15 B;  4IFD G;  1FNW A;  1D1K A;  1OO9 B;  2SNS A;  5AFW A;  1TY2 A;  1WTP A;  2K01 A;  2FIN B;  1TR5 A;  1LLR D;  1KDB A;  1O7L A;  5IT9 L;  3E6Z X;  3GO5 A;  3TN2 A;  5IGE A;  2HCC A;  2K6A A;  3J81 L;  1VDZ A;  3BG3 A;  1GHK A;  2D2C C;  1AN8 A;  1F9P A;  3NWS A;  4IAL A;  5A35 A;  2Z4I A;  1GXD C;  1EWC A;  3D8G A;  3V05 A;  2B2V C;  1FD7 D;  2ZXO A;  2NN6 G;  1JOK A;  4J8Q A;  3L9A X;  1M4V A;  1BCP F;  2EYJ A;  2MGS A;  1SNO A;  1RCV D;  2BA0 A;  3TME A;  3S1N B;  5JOB A;  1TWH B;  1UNS A;  1PTO H;  1IYV A;  1E2V A;  4HSV A;  3S2D B;  2A73 B;  4XQJ A;  3CHB D;  4DNR B;  1NUC A;  1HA6 A;  5EQ0 A;  3T16 A;  3S14 B;  4K5X A;  1RD9 D;  3IFD A;  2O5I C;  3TP6 A;  1JWS D;  5ELD A;  1E2Z A;  2L12 A;  5LL6 X;  1JC7 A;  3ERO A;  2GA4 B;  3AU7 A;  1SNC A;  1I4X A;  3SE0 A;  1GUN A;  4Y7N B;  4KV6 A;  4ZYS A;  5LHY 1;  1J8I A;  3KUP A;  1CZG A;  4XTC S;  1EIH A;  2VUM B;  1ZKO A;  3MFY A;  3HKZ B;  4DK1 A;  4G7O C;  4IFD J;  1S5E D;  1SAP A;  2KEC A;  1SMY C;  1BO0 A;  1J9O A;  4C1N I;  1PFB A;  3I8Z A;  1W6J A;  1IYU A;  4UAI A;  3MXP A;  1B4O A;  1ILP A;  4I65 A;  2SDF A;  3R8B A;  3I73 A;  3DXJ C;  2IX3 A;  1Y69 U;  3DWA A;  2IX1 A;  5K36 G;  3HZX A;  2E2D C;  5FO9 B;  5E1F A;  5KNC A;  2MP1 A;  1F9R A;  3LNN A;  3U9O A;  4BY7 B;  5DM6 3;  3H94 A;  3SK4 A;  2NVY B;  3A8K E;  5ISR A;  2F0O A;  3OWE B;  3PV0 A;  1X32 A;  1DCZ A;  1DM0 B;  5J1Z A;  4HMJ A;  4A3K B;  1MD2 D;  4PMB A;  1PLF A;  1JQY D;  3D31 A;  3QO2 A;  1O7Z A;  2BCO A;  2NUC A;  2NBF A;  4ABN A;  1AEX A;  4F87 A;  5IGD A;  2QEJ C;  1SND A;  1LV9 A;  3A7L A;  3HRZ C;  3NHH A;  2JSO A;  3DWP A;  5HGT A;  2JEB I;  3FRP B;  2AQ1 B;  4V19 0;  4ZUI A;  1R4P B;  4HAE A;  4N9P A;  5C0X I;  1HQM C;  1IHZ A;  2JP1 A;  4C3H G;  4X3S A;  1SMY D;  2WKD A;  2EYO A;  1I6H B;  1VF7 A;  4ILW A;  4ID6 A;  3ZYY X;  5COY A;  1SFO B;  1TS3 A;  1STH A;  2A6H D;  3N6R A;  1HFG A;  2BOS A;  1JIC A;  1RTN A;  2EPB A;  1RTO A;  2H4O A;  1KLG D;  4PV1 C;  4NDX A;  4IUR A;  1I6V C;  4A3M B;  1TS4 A;  1FNV A;  4ZKC B;  3DMU A;  2NB0 A;  1HRJ A;  1AZP A;  5D3I B;  1EY4 A;  1EY6 A;  3T4A C;  1PRT B;  3TP7 A;  1BCP B;  4V0B A;  3HOW B;  3MEH A;  2F0W A;  1SYG A;  1B1Z A;  1GJX A;  2Q8T A;  1ENF A;  4QUF A;  2RSO A;  1G29 1;  1CT1 D;  3RUZ A;  2A68 D;  5EBC A;  1SYF A;  1AP0 A;  2AUK A;  2L5T A;  1KAB A;  2FFK B;  2EJM A;  2L1B A;  2WIN B;  1EU4 A;  1QE6 A;  3OMC A;  5ELE A;  1WD1 A;  3VYU A;  1SYB A;  1TY0 A;  1QOH A;  3HOX B;  5CC4 A;  3MXU A;  4RA8 A;  1JOQ A;  3GTK B;  1II3 A;  3QG1 A;  4F7X A;  1GHJ A;  5EPJ A;  3GTL B;  1GUT A;  2N55 A;  5BN3 A;  2ID0 A;  1Y1V B;  4KTA A;  5EJW A;  2LKV A;  3LWU A;  2K5W A;  1F77 A;  1K8M A;  1BXT A;  1H9J A;  1BQQ T;  4DAV A;  2PQE A;  1U4P A;  2NN6 I;  1EY8 A;  2E2J B;  2J7Z A;  1CQF A;  2TSS A;  3M7N A;  1D5M C;  1VCI A;  3E5S A;  4RWS C;  3RZD B;  3NWT A;  2F0F A;  4OO1 I;  4DAP A;  3SK8 A;  5FKA C;  3M4Y A;  1I4Q A;  1SE4 A;  1SYC A;  4Q0F A;  4B9W A;  3BYY B;  3NTK A;  2HDL A;  2Z1C A;  5E3F A;  1Q3L A;  3TSS A;  1ESF A;  3FKI B;  4H0L C;  3NTH A;  4HCE A;  1TQO A;  2R92 B;  2E74 C;  4OIJ A;  5KGU A;  1HQR D;  3VR5 A;  1V1P B;  2F0G A;  2HQE A;  4RGO S;  1EIG A;  1C4Q A;  5M5Y B;  4NKL A;  3RLF A;  3C2P A;  4LJZ C;  3NK9 A;  4TSS A;  4WOR A;  1I4R A;  4K2K A;  1JCK B;  1A2U A;  3RD4 A;  1QG7 A;  4NP5 A;  3MXG A;  1AFP A;  5I6Y A;  1KDA A;  4HTH A;  2MJ8 A;  3QWN A;  2F0D A;  3C1E A;  3P20 A;  4BA1 I;  1SBB B;  3HGB A;  1SNP A;  4TRD A;  1FYC A;  1QJO A;  1U4M A;  1S4Z A;  3GTO B;  1Y8N B;  2IWH A;  2DY8 A;  2K5D A;  3L7Z C;  1EQT A;  1QIL A;  2EYF A;  5DNF A;  2QDB A;  2R7Z B;  4K8J A;  1QNU A;  2F3V A;  1I3Q B;  2ICI A;  4K6D A;  1C48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...