4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COME
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
3O1HB 4G86A 5HQJA 4N47A 1JFSA 1QP4A 4N76A 5FBHA 4EVSA 3F73A 1P8AA 2CHFA 4P1ZA 2KYRA 4Z9AA 4Z0NA 3QX9A 1JFTA 3CNBA 5DLEA 4RK1A 3D02A 2PJUA 3NHMA 2WJWA 4N03A 1EAYA 5IUJC 1EWTA 4KQ9A 5JNSA 3RH0A 4KMRA 2V0NA 3IP7A 4RY8A 3F6CA 3LKVA 2E4UA 1DC7A 4KK4A 4M88A 1AB6A 3N75A 2WRZA 5GOTA 3HCWA 4MRMA 2P9HA 2F8SA 3JS5A 5EWMB 2FEKA 3KS9A 3A0UA 4ETNA 4OATA 3LOPA 3RVLA 1LBHA 4RK6A 1A04A 2MYTA 1MB3A 2FLWA 1Z2DA 3I5AA 3RVQA 3QK7A 3HUUA 4NQRA 4QPJC 2YHBA 3CZCA 4RXMA 4EYOA 2E4VA 2MYNA 3M9XA 4MQEA 1RXEA 4MS1B 4MR9B 3BRSA 3OQNA 5CNIA 3MYYA 3OMWA 2FEPA 4YWHA 1Z12A 3CRNA 5EWJA 1NXPA 3TMYA 1U2PA 2MYUA 5CNMA 4Y9TA 2RDMA 2L19A 2NT4A 9ABPA 4D74A 1EWKA 1USIA 2MSWA 2VYCA 1FFGA 1YVUA 4MR8A 4IGAA 3QX8A 4O5AA 5IEBA 4N41A 3N0RA 4JA2A 1QO0D 1EFAA 3LUFA 2R47A 4F12A 4XQQA 2JK1A 1JDPA 3OO0A 4MS3B 2PUBA 2GKGA 5C5EA 1Z15A 1U04A 3MM4A 4PEVA 3TX6A 3T95A 3EQ2A 1IIBA 3LUHA 1P6QA 1M2FA 4IMIB 3CG0A 2PUEA 2MYPA 2WB4A 4MR7A 1EHCA 2J48A 1ZDMA 1JYFA 1JH9A 1B00A 1QO0A 2VUIB 4XYQA 3C3WA 1DBWA 1FQWA 1QNLA 4Q6WA 2HQBA 1BDHA 4JB0A 4L85A 2MSLA 4RK4A 2L2QA 1QQBA 3O1JC 4QICA 2YHAA 4XQJA 4N0PA 3JY6A 4RXTA 4RZSA 1KGSA 6ABPA 4RK7A 1KMIY 5BR1A 4CBVA 4G4KA 2QV0A 3KCNA 2QW1A 5TPWB 3H1FA 3BRQA 1NATA 2L18A 4F8JA 1M5TA 3CZ5A 4JOQA 4MQFA 3UK0A 1MVOA 4H60A 3Q7RA 7ABPA 4PZ0A 2FTKE 4MAAA 1USGA 3HEBA 4TN5A 1M2EA 4OLBA 5TQ0B 3N53A 4YS6A 3DLHA 4WT7A 4FE4A 1PHRA 5JNVA 1AB5A 3SNKA 4RSMA 3H5TA 2IKSA 3UKJA 4EVQA 2JCGA 2PUAA 4KZKA 4YV7A 2ZAYA 2CHEA 2A9OA 2JBAB 3LTEA 3H5WA 4G0QA 4Z4IA 4F3TA 1QP7A 4MYRA 5DKFA 3Q15C 4PICA 1DP4A 3C6QA 4E7PA 3MIZA 3ROTA 4H3KB 1RPJA 2PKXA 1URPA 3H1GA 3HUTA 3OLYA 3ROFA 1VLZA 5KQGA 4MS4B 4KREA 3MF4A 3NNSA 4Z99A 1ZN2A 5IX8A 1FSPA 4YCSA 2RGYA 2DRIA 2HQRA 4IRXA 5EWMA 3RVJA 4WWHA 1SXGA 4YR7A 3E3MA 4NCBA 3OLXA 2A9QA 3DGFC 4IILA 2QVCA 1YIOA 3CHYA 3K4HA 1U8TA 2FSPA 1DCMA 3I45A 1D1QA 5HSGA 2FMIA 3EQZA 3BBLA 1R8JA 1SD5A 3FMVA 5IUNC 4H3HB 1MB0A 1A2OA 4PE5B 3O2JA 4UHJA 1D5WA 2QVGA 3RVNA 3T8YA 1YTUA 3OMXA 1PEAA 1DBPA 1YS6A 1ZITA 5FWYB 1PNTA 3EDCA 1SXHA 4UHKA 4N0QA 3RVOA 3D8UA 3N6VA 3QEMB 3S99A 3TB6A 3SAJA 3UUGA 3H6HA 4JB2A 1GUDA 4FE7A 1C4WA 5HM6A 5JS2A 4MS3A 1ZGGA 4DQDA 4ZPJA 3TO5A 5IC5A 4G0OA 4B09A 3Q7SA 2PUGA 1QPZA 3JPWA 1GCGA 2FKAA 1QKKA 5T3YA 1I3CA 1J56A 4XARA 1DRKA 3LUAA 1YS7A 2HSGA 3JTEA 3IDOA 3O2QB 4QYMA 1D2AA 3H5OA 1EWVA 3L6UA 4YGXB 1DCKA 6CHYA 5I4CA 1PNRA 4LRQA 3OLZA 4WXMA 1K66A 5IBQA 5FWXB 2FMKA 4RK5A 1BVHA 3QLTA 1SXIA 3GYBA 2A9PA 3QLUC 4G0ZA 2WMYA 2NZUG 1JDNA 3KYIB 5TE9A 4RXUA 4EUKA 3CKMA 1JLKA 5PNTA 2I6FA 5IEJA 2WJAA 2HQOA 3CU5A 3MQ4A 2IDMA 3KKEA 4G0YA 1DBQA 4EVRA 3F7NA 2CWDA 5ED4A 4MPTA 5B3JC 2WY2D 4RK0A 5TPZD 5TQ2B 5T7BA 1VPWA 2B4AA 3H5IA 5ABPA 1CEYA 1YMVA 3IP9A 1BDJA 3BILA 5DGCA 4NCAA 2QSJA 1M5UA 1P2FA 2OENG 2NT3A 4O1HA 4QYWA 2JBAA 2R48A 5KQPA 2FW0A 5TPZA 4NICA 4Z4FA 4LDAA 3MA0A 4ZYLA 4LE2A 3I09A 1OXKB 3LUJA 3K9CA 1LJLA 3GV0A 5BQ3A 1Z18A 4HNSA 4MS4A 1DG9A 4GPAA 2H3HA 1K68A 4Z4GA 3N0WA 1USKA 1NXXA 3CFYA 4NV3A 2JVKA 1Y1LA 3A10A 3Q7TA 3HDGA 4PYRA 4EYGA 4YLEA 5IUKC 2A9RA 5CNJA 1T34A 2PE5A 2E4XA 4XYOA 3M6MD 3NHZA 3NNNA 1LJUA 3L49A 1XHFA 1D1PA 1XHEA 3O1IC 1JHZA 4XLTA 4EY3A 4OLAA 3QELA 1NXSA 1HEYA 3HZHA 4WZZA 2M1ZA 3JPYA 3HSYA 3I42A 3BS1A 2HJ9A 3RVRA 2P4UA 1UDRA 4LX8A 4XQNA 4TLMB 1YMUA 2OQRA 3IPCA 4DADA 5JNUA 4W5NA 4EYQA 2FLKA 3EJWA 1NY5A 5EWJB 1QMPA 3OLWA 3DZDA 4LZLA 3M9WA 3SM9A 5F64A 3QEKA 5JNTA 4XXHA 2LPMA 2JB9A 4EYKA 2AYXA 4KVFA 2FVYA 1P6UA 1SRRA 5FBKA 1RXIA 3JVIA 3MMNA 4YRZA 3H5VA 2FQWA 3HV2A 3BREA 1DRJA 3FFXA 2FN9A 2LUOA 2FN8A 3H5LA 3IP5A 1PEYA 4RY0A 4Z9BA 2PUDA 3LMKA 3DLBA 3Q41A 1U0SY 1QP0A 5KI6A 1NTRA 5EWLB 1XWWA 2QU7A 8ABPA 3GL9A 3RVKA 1DCFA 4MR7B 4XAQA 2PAFA 1L5ZA 5FWXA 1ISRA 3H75A 2F8TA 5E3JA 4MS1A 1RZRD 4MR9A 2E4WA 3B2NA 1TM2A 3OLVA 3OM1A 1TJYA 1QQAA 4RU1A 1JYEA 3Q9SA 3LUDA 3SG0A 3T6KA 3OQMA 2IPLA 5CNKA 5IULC 5JNWA 3O75A 4LE1A 2ZWMA 4W5OA 2M98A 3ILHA 4ETMA 3O74A 4DN6A 5TQ2A 1RZRA 4JASB 3HDVA 2VUHB 4Z4HA 3KYJB 4W5RA 3OQOA 1E6LA 2GI4A 1CYEA 1W25A 5KC8A 4W5QA 1A0OA 5CHYA 5KQMA 4W5TA 3GT7A 1LBIA 1ZVVA 1NXOA 4KK3A 1E6MA 4Q6BA 4Z4CA 3P9YA 1F51E 5KQLA 4OTZA 2E4ZA 3LKBA 3LUGA 2QZJA 3E61A 5HKOA 4MLCA 3HM9A 2BGGA 1S8NA 3T38A 2LIVA 3QLVC 4MGEA 2FXIA 3C3KA 1YK1A 1NXTA 4HYEA 2O20A 4ETIA 1VRVA 3H6GA 3QLUA 1Z25A 3GBPA 3QLVA 5TQJA 2PL9A 3A3KA 3C3MA 3ILYA 1Z13A 5KWSA 4G0MA 4XASA 5JNRA 5TPWA 3HK2A 2QXYA 1ZHHA 4KV7A 2RJNA 4KQCA 3C97A 2ID7A 5KC9A 1CHNA 2FMHA 4L4UA 4LE0A 1ZH2A 1JBEA 5B3JA 2FEWB 4RV5A 1PUXA 2IPMA 3N0XA 3FFWA 2XDYA 3SQNA 4YO7A 4O1IA 2ID9A 4OBBA 5TQ0A 1Z26A 3OO1A 2GWRA 2RJOA 1GUBA 4XXEA 4D6XA 1DZ3A 3HS3A 1KRWA 5D2CA 3RQIA 4LDZA 4RKRA 3CS3A 3KG2A 1H9CA 3IPAA 2FQYA 3TD9A 3LFTA 3R0JA 1RNLA 2TMYA 1ZAYA 1W9HA 4RY9A 2R25B 2E4YA 4HNQA 4MRMB 3NBMA 1DJMA 4HNRA 3VNAA 3OM0A 4JP1A 5DCLA 3GA5A 3CLKA 3GRCA 4KFCA 1D4ZA 1ZH4A 1BDIA 5EWLA 2X7XA 3FFTA 4S04A 1NXWA 3DGEC 3H1EA 3RVSA 4RKQA 4KPYA 3KJXA 4WUTA 3EGCA 5DTEA 4YP9A 4S05A 1ZY2A 3JVDA 3GWGA 3KLNA 4IMJB 2QR3A 4ZJPA 1Z16A 2JVIA 3KSMA 2PUCA 1MIHA 4TLLB 4MQEB 3HVRA 2H0AA 4OG2A 3W9SA 4KRFA 3HO1A 3KHTA 1TLFA 1KRXA 2HPHA 2PMCA 3FDFA 3G1WA 1ABEA 1ZGZA 4EGSA 4ZMRA 4MLDA 2GBPA 5C5CA 4FB4A 5FWYA 3LUKA 2IPNA 3KTOA 1FFSA 1YK0A 2N9UA 4KNYA 3FGZA 4ZMSA 1U2QA 2IOYA 3QEMA 1BA2A 4JAVC 4MR8B 3EULA 1GCAA 2Q5CA 4WXEA 2W42A 3A0RB 2NUBA 1Z17A 3CTPA 2R4QA 2JRLA 1ABFA 2PUFA 2AYZA 2FMFA 3O21A 4F06A 4Z4EA 1JL3A 3IP6A 4GNRA 2IYNA 2IPAB 4RDCA 2WWVD 4F11A 1TMYA 1FFWA 4Q7EA 3EAFA 1F4VA 2GX6A 1E6KA 3LUCA 1JWLA 1WETA 3G85A 3O2SB 1LK0A 2JVJA 2LBPA 3CG4A 3HJFA 1C0EA 2L17A 2B1JA 2LP4Y 3VNBA 2PL1A 2FQXA 3RVPA 4XFKA 5GQSA 3NNDA 4G0PA 1ZESA 1BAPA 3F6PA 1DC8A 4IF4A 1TVMA 1VKRA 4G97A 4RS3A 3EODA 3URMA 1APBA 1JX6A 5JS1A 1JFVA 4RWEA 1GLGA 3DBIA 1OXBB 2CD7A 3RVMA 1Z2EA 2MSKA 1E2BA 4MQFB 4E7OA 1NXVA 2NZVG 5BRJA 4G0XA 4ML3A 2VK2A 4P98A 4TMYA 3SY8A 3HXMA 1MAVA 3KLOA 5BRAA 2PLNA 3GBVA 3N8IA 3QELB 1JF8A 1L5YA 1ISSA 4D6YA
chains in the Genus database with same CATH superfamily
4H16A 1MFZA 4BGIA 4M1OA 4N82A 4ZT5A 1NF2A 2R11A 4B35A 3Q6SA 4DSNA 3CKYA 2H2IA 1NW4A 2QUIA 2NVYB 1EEXB 5CT5A 3HBJA 3KFXA 4D9KA 1GSAA 3G59A 4HFMA 3LC1O 3T5CA 4YAFA 2HMVA 4Q9NA 5AIAA 1NOIA 3VR1A 5FI3A 2HIAA 3GFFA 4AG3A 2UV8A 3ILSA 4BNKA 3S81A 9ABPA 1ECPA 1Y4SA 4LHVA 1U7WA 3IAEA 3PUVA 1XV5A 1YHZA 4FE3A 4IH9A 4PS1A 1STNA 3TGWA 2XXBA 2HBYA 2PK3A 4YUZA 2O7RA 3B6EA 4XCXA 2BAGA 1XD2B 2J33A 4M0PA 5KYYB 3PJGA 3IUNA 3G9QA 2G17A 4HEQA 3PR3A 4G2NA 5I45A 3VRHA 4JI2L 2XCRB 3VNQA 4WOPA 2XIJA 4P7BA 2C2MA 4CMBA 2JEOA 2VP9A 2JA8B 2H07A 4B3TQ 3NH6A 3IEPA 3VYRA 4AF7A 5K3DA 1MJHA 2V3VA 1DOKA 2LVBA 4E1BA 5HSGA 3CCLA 2XSCA 2PFGA 1OH7A 2ODPA 4ZYTA 1ONOA 3O2JA 1EM8B 1EEFD 4RHUA 4GPTA 4FILA 4IXDA 3RAGA 5EMLA 3VDNB 4QU9A 2H63A 5LZ9A 4MW7A 5FLXL 2VHXA 5HZHA 3L8ZA 1HI9A 5BV7A 1KYIA 3ABZA 3TFQA 1LBSA 5D3QA 4M8AA 1QZUA 4Y6SA 2Z5VA 3FYUB 4HAOA 5COAA 2G9RA 1M7HA 3GNLA 4II2A 4XIFA 1Z7TA 1WPRA 4OK5A 1ZD3A 4MUGA 3GVIA 1I6WA 5ANRB 2JANA 4QFMA 4IGKA 2VC2B 3GZ4A 1XXHB 4NKRA 2GEDA 4HNSA 3KQTA 4L75A 3N74A 3J7A5 1UWKA 1DKLA 5DTIA 1U65A 1AQYA 4DARA 2R7MA 3IBTA 3I9OA 3L7OA 2ZB3A 1I7LA 2J7ZA 5KOHA 3DEZA 5IODA 3GP3A 1RCUA 3JQQA 4GPIB 2H59A 3H9UA 3UV3A 4D44A 1JKMA 2FXQA 1ODLA 3I1JA 1KZ4A 4H9GA 2XGTA 3HB1A 4LBWA 1E2EA 3S2ZA 1ORVA 2ZCUA 4Y9DA 3GDHA 1SNMA 3ESAA 3B3JA 3FLBA 3ZQ6A 3QITA 2G70A 1LTSD 3BFKA 2NU9A 3K0CA 2EJBA 2NU8B 4N5MA 5K01A 1T5TA 2J3MA 4M0EA 1GYPA 1M6EX 1VE1A 1LQTA 5CHYA 2QGZA 2HJVA 4J3NA 5KQLA 4NYMQ 1S5BD 4OB8A 1IK6A 4AQYL 1QHSA 1R5OA 4D8TA 5TQJA 3K0HA 1KK1A 3WGNA 2HK8A 4HNTA 1Q57A 3I2KA 4E1VA 3C14C 1ZHHA 3EXEB 2OCXA 4BVEA 4C3HH 3SD7A 3TUZC 3OQ6A 3E27A 5M5XH 4X66L 4X7PA 1KOFA 4JBGA 2Z9HA 2PV7A 1IOZA 5IC6A 2FCAA 4C01A 4A3BG 3AESB 4PLWA 4ZO7A 2NV0A 4JR2A 3DXYA 4GXQA 2GRUA 3P26A 3J81L 1FU8A 3ASYA 1RJGA 4IOCA 3RWMB 5I47A 3GVPA 2YJGA 2K75A 2O0MA 1GNRA 5DI3A 4R7ZA 3FLMA 1DDGA 4CLHA 1JRLA 5I7FA 1WZUA 2MSDB 4DAMA 3KR2A 2C5BA 4MCIA 5FLEX 3ZHCA 3HLKA 1MBZA 3UGKA 3B6YA 2OHOA 3EAFA 3ENVA 2PW5A 1G7CA 4YDSA 1F8XA 1Q5PA 1O7LA 1C7YA 1F2YA 5FNVA 2HT6A 2FUKA 4RSGA 1HE8B 1UF9A 3HCDA 3WY9A 3FUVA 2W0SA 1OAAA 3BGWA 1WZIA 3FHLA 3EZLA 5G40A 4W9NC 3UDGA 3L40A 3RYFA 1Q1EA 1AMOA 4LYHA 2VHTA 3PTAA 3TZKA 3P4UA 3QK7A 1SPBS 3JWHA 4WNYA 4UEQA 3MWDA 4MQEA 4BX9A 1DEAA 1YB1A 2FOIA 1KMMA 2X8JA 2GETA 5C4XG 1U8EA 4DV0L 2AR0A 3P96A 3T7DA 2GBIA 1GGJA 5J5CA 4JR1A 3NETA 4WEQA 4TL7A 5D3DA 5CX4A 1GHTA 1LC0A 4OHVA 1WIWA 4V0RA 4YHHQ 1M2FA 4QBFA 2UXCB 1FUKA 4MMXB 1D03A 4M22A 5LQCA 3D1VA 1FYEA 4X41A 1J5EL 4J0CA 4PG7A 4GF5A 5T5QA 2C04A 4UEKA 2H4ZA 3OPQA 4A3MH 1A95A 3QOJA 1D5XC 3HI6A 3P5BA 4PZ0A 4UEWA 3IPXA 1UK9A 3SC2A 5CFQA 4HXEB 3N2NA 4MW4A 1XJWA 4FGLA 4FUTA 3CPWA 5HE9A 3IPLA 5JH7B 2X8LA 1XXGA 3QKRB 5BWBA 3ZDAA 2QE6A 3A9VA 5JBQA 4KXVA 3MSXA 4BE4A 2H4XA 1BFUA 2CEAA 3SYNA 1XZHA 2NVTH 1PFBA 1RQNA 2CNDA 1F8GA 4UTOA 4K2LA 1FDRA 4DAYB 1G59A 4BFVA 3HOYH 2OBYA 3CRW1 2JGLA 3ZHXA 4CTKA 2V7PA 1UZUA 4B3RB 1OWNA 4JI0Q 1DXYA 4GDMA 5EUBA 4QUKA 1WA5A 2Y0PA 4FXOA 1GU0A 1UFKA 2R3SA 1E7YA 3BCUA 4XKJA 2CXXA 1M67A 3RD4A 1JEQB 2ZDGA 3NWOA 3KT8A 1YDGA 1ZCJA 3BXPA 3UUWA 3TQRA 4Q3KA 4E51A 4CETA 4YDQA 3PNKA 3ZUPA 2Z4RA 3FDZA 1UDWA 1B8NA 3UJDA 2DAPA 5FPYA 3C39A 1LLQA 5BV2P 4I7EA 2XB8A 3Q7TA 5EKSA 3DMRA 1T5DX 1N32Q 2INGX 1QQ5A 3HZXA 4RPLA 2Q5QA 4AYBB 1VKOA 3MS2A 3IPCA 3U48A 3TNFA 3TQHA 5IN4A 1Z45A 3WMWA 1W2HA 1YB6A 2WVHA 4MTKA 3WKEA 5GONA 5CB4B 2ZIVB 1KNXA 2WV7A 4XWWA 1SELA 4TRDA 4N01A 1MXFA 4IWXA 2X69A 2VS1A 1FLVA 1XOIA 3TEMA 3KB2A 3MT8A 3V8VA 1K3UB 5ICEA 3LUDA 3N3AC 1B0UA 2BMJA 4BWGB 2C0PA 5GVSA 4DQXA 1H05A 3MELA 4LJ7A 3JXEA 2OM6A 4UATA 4KNWA 2WD8A 5M04A 2PGJA 2V5VA 1E1YA 1NG9A 4DLTA 4UD6A 2E4ZA 5H0IA 2CVRA 3HOWB 5HKOA 1VBNA 1SC6A 1JMYA 3OCJA 1C9KA 2ZTHA 1TDJA 5FH9A 3C3MA 5I9PA 4PQFA 3E9CA 4RH3A 1DIAA 4JOCA 4YO7A 2FF5A 4G7OC 1RODA 5AK4A 2UUCQ 1C3OA 1E3IA 3EIEA 2Z58A 2ACEA 2GN9A 1GVHA 4YLYA 5LL6S 1AFPA 1KXZA 1T43A 1CWUA 2P41A 4OHFA 4RF3A 1WLYA 5HXAA 2TMKA 1WUIS 4F9GA 4OH1A 2PZGA 1ML4A 2QVXX 2CNBA 3UT5A 1UBJS 4XJVA 2K5DA 3EXIB 2DTEA 4KNYA 2PMWB 4BBAA 3SJCA 3ZBUA 1H4VB 4MKGA 1OGYA 2NUBA 3NVMB 1HEUA 4B3MB 1P73A 1IRIA 3DE1X 2HNBA 3AERA 1OCEA 5IMBA 5ADUS 1TZKA 3VTAA 2QS9A 3OMLA 5BVGB 2E5LL 2HF8A 5JD3A 1Z63A 4HSGA 3CEHA 2B3TA 2AKAB 3T53B 5E6SA 4R4IA 3AI1A 2NZVG 2V0GA 1HNXB 3W2HA 5I01A 1Z2NX 4G86A 4AKGA 1A2BA 5C3MA 3KZOA 7YASA 4DR2L 2HRCA 1SBZA 2BISA 4HAWA 2Q3FA 3V9AA 2N46A 4HAUA 4NJOA 5FWNA 5ERYA 1CQPA 3R74A 4RAQA 1EY9A 4KO8A 1G66A 3THRA 3LOPA 1U0FA 4O02B 5EP1A 4PGMA 2H9IA 4X62L 5KS2A 2MYNA 2XOKD 1ZGBA 1O5TA 4WVLA 3CRRA 5K5EA 3AHCA 3P0IA 2C5GA 4I1RA 1U98A 3MLEA 3AHJA 1QO0D 2VHEA 3IE1A 5ICSA 1P44A 4HS4A 4TTTS 3AG6A 4CKEA 1LTLA 2BDTA 1KO1A 1FX1A 3U5TA 4DRYA 1W49A 3A2NA 3QI7A 4IDBA 4OQXA 5TMBA 3U26A 1CY1A 5JS7A 4INPA 3BC1A 4ETWA 5A7HA 4H3SA 3IVAA 2WM2A 4DRXB 3V4FA 4U5QA 4YO8A 4ZZ0A 4QARA 1WXFA 2ST1A 4Z4IA 2PMZB 4G1CA 1GV1A 1OBCA 1RRPA 1FTSA 5KQGA 1FMTA 2EF0A 3Q0AA 1UBUS 3KV3O 2XUHA 4DLAA 4EI7A 2UXDB 1R6TA 4GN3B 1AMNA 3IDSA 2J85A 4IRMA 3S14B 3BH7A 3EBLA 2O2XA 1DCMA 3ZYYX 1QLJA 4ABTA 1P3JA 4X8LA 4A0FA 1UMDA 5U4XA 4HOYA 1EUQA 5DM0A 4JU8A 1II9A 4DV1L 4A3GH 1INLA 1DBPA 4CM7A 2UUPA 1PNTA 1A2UA 3SLGA 3FDTA 1DWPA 3PLAE 1B74A 4L28A 4RA8A 2IHYA 3PIPA 3DSRA 5JO0A 3SR1A 2VHQA 1FSSA 2PZEA 4X60A 1NDUA 2FWMX 1KDTA 3FI0A 4BNXA 4RGNA 4B6EA 2B69A 1X87A 1P2UA 4ED9A 3TLKA 3D7SA 2HB6A 1X2EA 5EINA 3IR6A 1P4GA 4A3JH 2O6HA 3W8EA 2RHJA 3D4WA 1Z0AA 1IVNA 1S2NA 4EB6A 1ZD9A 1EJ2A 3ZXUB 2O8FA 3VR5H 3DLAA 1HPLA 3SGLA 2FH5B 4WNCA 3ER0A 3P9XA 4YK7A 3MA0A 1GG8A 5FBLB 5C51B 4EHBA 2I2XB 3B7PA 4I5DA 5F78A 5M5WB 1W73A 2RGEA 3EXHA 2JLUA 3FYHA 2XBUA 1GD1O 3KELA 2M1ZA 2VUMG 2OQRA 5CXQA 1YRHA 4I3FA 5K3AA 1Z5VA 3GTOB 4PCAA 2IZ5A 2GO1A 1PW7A 2Q3HA 3FEWX 3F67A 1NTGA 4RY0A 2LTAA 1C14A 2OV3A 3KDFB 1PNVA 2QL6A 1Y8RA 5F4ZA 2VJKA 3PDHA 3ZDQA 3MVEA 2WZBA 3HOXH 1SCJA 4QOIA 5M29A 1TJYA 5EJ6A 1WTPA 5GM1A 5ICFA 1XDBA 4TKLA 3AVPA 3RSOA 3DFKA 1JORA 3ZIDA 3O74A 4L78A 1P61B 1AHPA 4OQPA 2RGAA 1V9CA 3PD0A 5JWHA 1XTKA 4LYDA 3TR5A 2EJUA 2X6GA 1YK1A 1S1MA 3U3RA 4WVFA 1DPFA 5JVDF 3IH5A 1THGA 1QRSA 4WJLA 1EU3A 5GGYA 2Q6LA 1S6YA 2Z4TA 4V2UA 4LXYA 4O1IA 4R8LA 3LOQA 1T5IA 3OEEA 1Q7RA 3CM0A 1AZWA 3UFBA 4F5DA 1BX3A 1DJQA 2VXBA 1JJBA 3HB9A 2MHVA 3HP1A 4U2GA 1YU6A 1HL3A 4NBUA 3A11A 2ZRDA 4JUFA 4Z49A 2VAXA 4C2BA 3QG5A 4OU5A 4Q93A 4DNTB 3PXAA 4AZ0B 4GZLA 3KJOA 4F60A 1YK0A 4TMFA 1FJXA 1CY4A 2PZJA 3S1MH 5CFLA 1OF1A 1RAEA 5H8WA 4ADSG 2DCMA 2VAWA 3KOXA 4B4DA 1KVUA 3DCNA 4HPJB 2EZVA 2H17A 1JNXX 2FPSA 2V7TA 2BEJA 3LL7A 3RVPA 1JR6A 4JROA 1SQSA 3BD6A 2C7QA 4M9QA 4RA9A 2KWIA 4JITA 2Q3LA 4HH3C 4CODB 1A97A 4NH4A 1K27A 3WL7A 1IWOA 3R7NA 4J7AA 3BYYB 3AEXA 2AHRA 4WLEA 2ZKLA 3PX2A 3C15C 1OWLA 2XKKA 2ATCA 1GZ3A 4WZBE 1LDYA 1YUNA 2LD4A 1GNLA 4DBLC 1X7WA 2YYYA 3FZGA 2JEYA 1OU0A 3NVAA 1RLMA 1LTHR 3F2DA 1U2RA 2VRCD 2SICE 5E0OA 3CX6A 4D43A 4RTJA 1QB5D 3VPGA 1E92A 2WZDA 2GKGA 2EV9A 4HDSA 1EFRA 1T3HA 1QIMA 2OBLA 1QAMA 1U4MA 3E5HA 1R0RE 3REFA 2AQ8A 4DSTA 3STBD 6ABPA 4CKBB 4GT1A 1P80A 2QLTA 2ZBUA 3IDQA 5DXJA 2VDWA 3KTFA 5DOZA 4P93A 1H9JA 2PUHA 3WP1B 1PH9A 1AC5A 5H4GA 3VC3A 2HH9A 1F4LA 3KKQA 5D8DA 3A5ZB 1BHSA 4PV1C 2YJ3A 3WADA 3BQ9A 4L5QA 3FKSD 3TUIC 3OOYA 4M8KA 2JW5A 4U2FA 2YTZA 4AK9A 5KTPA 4JN6B 3ZHVA 1KO8A 4I1PA 2RH9B 3IBGA 3RHFA 2OHJA 3TQIA 1U0GA 3OWHA 3HXPA 3AUJB 4IF6A 2RG7A 5AMXA 3LO8A 2XITA 4EECA 1BU8A 5JZBA 1SR3A 5CV9A 3PVSA 5IC5A 4B2LA 3O95A 2JI6A 5M3BA 3OF2A 5AI5A 3SYMA 5AI0A 3BTOA 2P5YA 1SBIA 1K9MC 3SDZA 1XZ8A 1QWOA 2DU8A 5AHWA 3RIMA 3Q24A 1M2VB 3WB0A 3JC66 4OMDA 2A6HD 5ICGA 1XX8A 3H5IA 2A68C 3UXEA 3BXOA 5IVDA 1BTOA 1WDTA 2Y0SB 2HTFA 2YWRA 3IQWA 4AN4A 5A04A 2Z56A 4NTZA 1SFOB 2PZ8A 2CLLB 2Q6TA 1EVZA 2QORA 3LHSA 2HYIC 2NVUA 1FNUA 3S1QB 1VG9B 4F8MA 5PGMA 3AMVA 5L7YA 4IGEA 3U17A 4DADA 4L5IA 4ZDKA 4PTLA 1L8OA 2JLQA 5EWJB 2MHCA 3BRWA 1KQNA 1S7CA 1WQ4A 2FLVA 5HIAA 1CUSA 3MGAA 5D01A 1A1SA 3EX7C 1DRJA 2FF7A 4BWFB 5B1YA 2VJPA 1PZJD 3VR6D 4OHJA 2HQSA 1NI3A 4EZBA 4QUIA 3H75A 1RZRD 1KFKB 3RWBA 2WIJA 1DX4A 2JAHA 4JIMA 4B8ZA 5JFTA 3AKCA 4Y52H 2P4SA 2VQDA 2I91A 3MCWA 1LPMA 1C50A 1RAFA 3GLTA 4FX5A 1UFOA 4LFCB 3GPCA 1AXRA 4G89A 1A50B 4EKEA 3H6MA 1WG8A 4Z9FA 1YNSA 2SKCA 1K4KA 1U0EA 1NMGA 5KEIA 2ZAMA 3D3KA 4RSRA 2AJLI 3F8WA 3CC2A 3P9KA 5C7OO 3GFSA 4A3KB 5FB3A 1DQRA 5LMNQ 1VQ8A 1RAHA 3CUKA 2C2HA 4LQLA 2ZXPA 2GK3A 4A6EA 3E7XA 4D46A 5AOCA 1ESCA 3GRUA 4BGDA 4KOAA 2K6GA 2B1RA 1XAGA 4O4JA 3SVMA 2C7GA 3H5AA 3SXJA 4UDNA 4XT3B 2IS6A 5I2XA 4XJSA 1ZWKA 2Y1KA 4Q5VA 1DTEA 4BB5A 3C3CA 1OIWA 2OZVA 3O8OB 2HA4A 3DTVD 5FOXA 4JU9A 1AZSC 4C6TA 3LX8A 3FLEA 2XTNA 4O3FA 5DLYA 3RR2A 3D4DA 2HXYA 4LC0A 1XTUA 2BZ1A 1QIKA 1W94A 2L17A 4LJYA 5DWQA 3AYHB 3ZE7A 5JS1A 4LHZA 2FDCA 1A15A 1LPNA 3DBIA 5NUCA 1JE1A 4A3DH 2WVJA 4BQIA 3UJHA 3DD1A 5B12A 4R9NA 3NDPA 4GYKA 3J81i 2BGRA 5LBIA 4OA5A 1ZRNA 1G98A 4XPZA 4C89A 4Y2PA 4FF1A 4CU2A 3O3OB 1T4DA 1I32A 4AY4A 1YZKA 2RHDA 1OLXB 1QILA 5IYZB 4O2AF 3ZOZA 2WIAA 4MS1B 2GZ3A 3L18A 1CUCA 3ZQJA 3VR6H 2D7JA 5HA5A 2GPBA 4AP9A 3L6BA 4PHCA 1F8UA 4L6CA 3RJ5A 2EDAA 5F7OA 1T25A 2J4CA 1J8DA 2B36A 2KM1A 3WWVA 3S2UA 2GD1O 1IDN1 1CKNA 3CZPA 2XHEA 3L4EA 4U6SA 5I2YA 5IVPA 2HDMA 1FUIA 5KTYA 3L1VA 5IK2A 4GRDA 4L85A 1G8AA 4AY3A 2QP4A 4BBZA 1MB9A 1I1NA 1V37A 3H1FA 3MXGA 1T2CA 1HT0A 1F14A 3KT3A 3A1EA 1JIVA 1TE2A 4TN5A 2Q8QA 3E53A 3GPDG 1YZ6A 2IX1A 3LPDA 4ZAWA 1Q6YA 1U80A 2EX1A 3T5GA 3HTXA 3TW4A 3EDQA 4O0AA 4QNRA 1SK9A 1GSOA 4QQKA 1HTBA 3UMYA 4LJKA 4MDEA 5T1IA 3ED1A 1A5BB 3R9IA 4GZMA 2CB9A 4XA8A 2PT5A 4OHYA 4PZUA 4RIEA 1N36L 1DL5A 1G5RA 1LUAA 5CFPA 1PTOD 5AVYA 2B82A 3ZE1B 1GUDA 3J80c 2MINA 1ZJWA 3WLQA 3EW9A 1EVJA 4PHTA 3K0YA 5DW0A 1ULBA 4D5EA 1SR8A 4C29A 1SXIA 1YA4A 4A5OA 2NZUG 2DN8A 3P0HA 4NNOA 3ECAA 1VPWA 2SCUB 2K1BA 1FYWA 1YMVA 1NPTO 1RFGE 1C7EA 3R7LA 4EHKA 4CM9D 2X1VA 1QDLB 4EA9A 2VQEB 1J33A 4DMGA 2R6DA 1IQUA 2YZ2A 3TOCA 3UC5A 1Q14A 1ODJA 4CM5A 2WWYA 1XPRA 4XYOA 1P5ZB 5AOVA 5E6RB 4OXIA 2H92A 4A3IB 4KODA 4WZZA 1NVUQ 2YXBA 4ZAFA 3NP8A 1NUSA 5DNAA 4MIOA 4HVCA 5AKXA 2IYFA 3GT0A 1KFJB 2XCUA 3HP3A 2Y8EA 2YZMA 4KE6A 3H83A 3HVHA 4MVJF 4WBNF 5D00A 2EKDA 4MH0R 4NBKA 1LTGD 4EJMA 2DUWA 4JLAA 3IHWA 2WFLA 3S28A 1CJKC 3RGWS 3FPKA 3REQB 5HEKA 5D5HA 4PM4A 4OWXB 3GEMA 4NPHA 1KVTA 3GCWA 5A02A 2ZWMA 2FGJA 2IL8A 1O5IA 4DMCA 1PJRA 1KZ9A 6ADHA 1EG2A 1SVUA 3ZK9A 3CF4A 1T5HX 1R37A 8AT1A 2PGIA 1JIKA 3OZCA 4Q6BA 3U1VA 5IJ0B 3OIFA 4HYEA 2NVQH 4B1FA 1M1NB 2QQ5A 3EJ6A 3GN1A 4XASA 3S15H 3FNEA 1TADA 2WIKA 1PEKE 1VYUA 4BMSA 1SXJB 3OTWA 2GEKA 421PA 3HOVG 1C8VB 2W43A 5AW5A 1JSZA 2PGXA 2AMVA 2WJ4A 1L1FA 4C3IG 3U4DA 1DJMA 2E2JB 1NR2A 4QEKA 1YR8A 4H4EA 5F21A 4BHTA 7REQB 1PTOH 2VRWA 1R64A 2J6CA 4JI4Q 1QSGA 4YP9A 3A36A 1QU2A 3KKPA 1HNXQ 1PO7A 3U49A 3K0XA 4L5SA 4RVHA 1M0TA 2BR5A 4YRAA 2OQIA 4MV0A 3ZTTA 1TVEA 2O8EA 1HR0B 3ER8A 3BIXA 1VQJA 1SVOA 2JK0A 3G7SA 1GTL1 1VQKA 3ZK7A 4DV2Q 1RLIA 2QI9F 4ZI3A 3E1GA 3PCTA 4XGQA 3RDPA 5LP6F 4H17A 1JR4A 3A6EA 3SHLA 1KR2A 4EBBA 3UWKA 3F3YA 5AUOB 3PEWA 1N9GA 5LQUA 3WVNA 2OUKA 3LG2A 3WRYA 2OSBA 4Y7DA 1D6MA 2IIVA 1OZGA 5KSOA 5IP7G 3OIPA 4OHXA 1GOTA 4GZ6A 3IPRA 4ENWA 4QGUA 2OB1A 3WYFA 3E3OA 1X7XA 5AUNB 3EEIA 2FEKA 2GN1A 1MB3A 1BWRA 5LDHA 2BV3A 4CE6A 1IL2A 1ZOIA 4EPXA 1XEWX 4F38A 1V3QE 5CT8A 5FWDA 4AECA 1Y0BA 3M5CA 2O8DA 3CCBA 2CV2A 4I1YA 3ZWCA 5A2QA 2Z04A 4M37A 2HA2A 3OQBA 5CW2A 2J31A 1THMA 5CV4A 3B60A 4I4NA 4CLOA 1BDHA 2MQHA 2KQUA 4QGGA 4BNFA 4JI0B 4RGBA 4Q7MB 2OCLA 2YIJA 4B7UA 2XMBA 3Q23A 3CSDA 3M4NA 4QLAA 4FR2A 3A4VA 3W1WA 2ZAYA 1DTWB 3S1LA 3MIZA 4J0QA 3GQBA 1W0KD 5EZYA 2AOTA 2OXTA 4Z99A 3DGFC 1B50A 4NZOA 5GZ3A 3FAZA 4G0NA 2OLJA 2V74B 4XQEA 1BHJA 3T5TA 4WJKB 3GFPA 4CF4A 2ECPA 2BTQA 2PA0A 3T8YA 3RJ9A 1N32B 1QYIA 2WAXA 1TC1A 2N3ZA 2O2LD 4MUHA 2QLJA 2PUGA 2YW2A 3TSZA 2J4DA 1JDVA 2I71A 5AJYA 3GLGB 3A6LA 4FN5A 3DFIA 4N5IX 4TMZA 4JJFA 4HWKA 4Z8XA 3BORA 2WAAA 2RH4A 4JDPA 4RCYA 3FHCB 4NHEA 2ZUUA 4ZALA 3B5JA 3Q1LA 1QC5B 4XQCA 3VI4B 5JDCA 1Z2CA 2WF6A 1YIAA 2FW0A 4K6GA 1CFZA 4A16A 1S2DA 4HGNA 4KYTA 1EX7A 4UOQA 3IQFA 3PCRB 2E2DC 3V9PA 1QPBA 5EKXA 3KXLA 4IHQA 3UATA 3DMUA 1RT9A 3E48A 3V46A 2Z83A 1VKZA 5B2ZA 3E9NA 1D1PA 1E2NA 4ENPA 3T3DA 5K3FA 4EY3A 4NX2A 1YE5A 1V5IA 2I7TA 2B2UC 3OOSA 3EJWA 2HUNA 1PSWA 2GCGA 2V8BA 3GJXC 4MV4A 3I72A 4Y7CA 2AYXA 3MLBA 2WMOB 3H5VA 1Z39A 4W5HA 4YRNA 5CEFA 4RIGA 1H2WA 1BHO1 1QR2A 5F7JA 1VPTA 3O38A 1KTKA 4IEEA 4D0GA 2NO5A 3COZA 1UJ5A 2PVCA 1YKSA 2BMWA 1US8B 3E18A 3C3EA 4RGMA 4JB8A 4B3SQ 3FCSB 3I53A 4FMCF 3II6X 2D00A 1W5EA 4IJMA 2EWWA 4XFDA 3NQTA 2WZQA 3HM2A 3RANA 4EOGA 3IDAA 3KRTA 5TS2A 2PZUA 1EVIA 1STEA 2R1UA 3TG8A 3C43A 2XNSA 1DQSA 4HQ0A 1ZOOA 4MLCA 3HM9A 1Y6QA 2I67A 4WQMA 4M0MA 4QVGA 4CQJA 3JR7A 1N78A 2A59A 4OYHA 1DBSA 4E5SA 2RHLA 2VBFA 2H16A 5TR9A 3DT9A 1BE1A 4O4HA 4G5GA 5L37A 4LF9L 1J2UA 5AH0A 1GPKA 1PK9A 1V1RB 2P6MA 1R0LA 1D5CA 4WCDA 1SN8A 3ENKA 5EIFA 2IL1A 4DXHA 4ABNA 3AFQA 1YI2A 2ZKIA 1K7YA 4ER5A 4TLLB 1EP3B 2P62A 2MSCB 3C7KA 3NC0C 2R93H 2C2XA 3PDJA 1A9OA 1G8SA 4K9DA 1QG6A 2K14A 2W42A 3OF5A 4DK0A 4HCJA 4CFZA 4QSMA 4Z2AA 1VE3A 1BQQT 4AMYA 3CNNA 5FOQA 2P1ZA 4EI8A 4ZCSA 3M8KA 5JSKA 2GZMA 1PYDA 4YRDA 3VU9B 4R16A 4H59A 3H13A 2PU5A 4XVUA 1K5DA 3L8CA 3FF1A 4I7AA 3K0AB 2CHFA 2JA7G 3H18A 1EGVB 3FZNA 2NSDA 1VMAA 4WV3A 2ISSD 3F6CA 4AS2A 4PX2A 3ROKA 1B6RA 2J7PD 5J47A 3DZGA 4G5RA 1VG8A 3EPPA 2CL0X 1TGYA 2B94A 3LC7O 1HC7A 5J40A 3CMEA 5EJEA 3UBMA 2F1RA 5EXDA 4FGKA 2HUGA 2Q7DA 2RDFA 5AESA 2BDOA 3MYRA 2B8JA 2GD0A 4KE9A 1MC5A 4C3JG 4I5GA 5EZ5A 4MN3A 3OP4A 4K9RA 1T1IA 1E7SA 2BLLA 1N6RA 2IOHA 3VUEA 4CZ2A 1XZDA 4NBTA 1ZM4A 4UTNA 1QX3A 2W9XA 5KSWB 5C32A 3HKDB 3MJFA 4YRSA 3TTUA 2ZFUA 4E14A 1QKJA 3GQVA 4EVQA 4HTFA 3UFXB 3RIYA 4NYJQ 3HKZG 1VCNA 1JP7A 1NKSA 3ZWMA 4N0DA 1R9NA 5IT9L 1VLVA 1ADBA 4N8FA 1RP7A 3IXMA 1FW6A 5JD5A 3TKLA 3UAOA 5KX5B 1R8JA 2X58A 5CX1A 3BICA 4PSVA 2F3UA 2X22A 1E1LA 3LBYA 2PGAA 1TF2A 4HQLA 1CUIA 4LCEA 3VUFA 2AX4A 1QHHA 4DQDA 1OROA 3VO8A 5BO5A 3GLFB 3DBLA 2E21A 3QBTA 1EXWA 2A86A 2HHAA 4L0DA 4AY6A 1VCIA 4KHPL 4B8YA 1P31A 2NNLD 3NBUA 2P1RA 3T12A 1YNND 1E5VA 3KBOA 4OQEA 3UPUA 1ZD4A 5EPLA 4EGVA 3OJOA 5D65A 2V7XA 4FNOA 4Q9KA 4JDUA 3EJIA 8LDHA 3NYIA 3KDAA 4A6PA 1QX4A 5K3CA 3WNZA 2WUWE 4N49A 4E11A 2RK6A 5IS2A 1QZHA 4X6YA 4Z1MA 5AHOA 3R3YA 3KF8A 3DC2A 3O4GA 2NVXB 3UAZA 1K88A 3K59A 1WW8A 3ZY3A 4QAQA 1O6GA 1T3TA 1JHUA 5CNJA 3NNNA 1G5FA 2F1KA 4JT2A 4QO7A 1DTSA 4ZOEA 2ZIGA 4A0SA 2JHFA 4B81A 2P4UA 4AX8A 3J80E 2ZM6Q 4L8LA 3DAGA 1EFPB 3R7SA 3R40A 5DISB 4JR0A 1WB5A 2RK3A 4OXNA 2HEGA 1Y8NB 1Z8DA 2TS1A 4HN9A 1GUYA 4QF4A 1KLGD 1K28A 2RJ3A 4P5DA 1XYVA 1KI7A 2JA9A 2E76C 1OBOA 1LI4A 1QE5A 4IXMA 2AJBA 2QSYA 5BR8Q 5BSUA 1YRYE 3Q9SA 4GOOD 4K3VA 4N7JA 4L02A 2AOUA 2ZSIA 4WNIA 2VHZA 3RYIA 3I8ZA 1VQNA 2J6IA 4RL4A 1E3WA 3N7AA 4EBFA 2W6PA 2VXYA 3K1ZA 3R6GA 2AUKA 1UC9A 4OD0A 1B8OA 3UT6A 1ZG3A 5EMKA 1XMQQ 1J0XO 2V1UA 1TGVA 3GBPA 1JDSA 1S3FA 4HN2A 5EJFA 3HB0A 2WINI 2OUIA 3T35A 3RZDB 3ER9A 2DNEA 1E8DA 5ELCA 5NULA 3IIIA 2IXGA 4NMMA 3AFOA 5KOJA 3HCNA 2WNIA 1KERA 2BF7A 4LPKA 1VA4A 1SROA 1GZVA 3T4AC 1W85A 4B47A 5AKGA 4DPGA 1ZRSA 2V54A 3NX4A 5IKEA 4IKOA 3DVAB 1LH0A 2C29D 4GS3A 3A8KE 3N70A 2VYNA 5G3ZA 2PMCA 4G24A 1LA2A 2GM3A 2WIIB 4JW0A 3OU2A 2AVNA 1Z17A 4GLLA 4ZHQB 2P0YA 3B3FA 2IH5A 4A93B 3V80A 3V8RA 2XRMA 3Q98A 3HJUA 2PSSA 1K7XB 1TA0A 2ZBGA 5ECWA 1Y1VG 4BKPA 4F97A 1E69A 2J1LA 4R1LA 1CNMA 3JQGB 3N8IA 4EG6A 2X0IA 4RJTA 3FM9A 1IJEA 3FTFA 4D4HA 1UKAA 2QQEA 1WKVA 2IX3A 3DBHB 3F6RA 2AMFA 4BVLA 4I55A 3DOFA 4BLVA 1F9SA 4MUEA 1DC7A 5DNDA 5LYJF 3B1XA 3EIXA 2Q2QA 4DIEA 4TLDA 3V48A 4Z3DA 1JT8A 2F2TA 2R8RA 1DXQA 3LBIA 3MW8A 4JBKA 3K71B 1WTAA 2HMAA 2IRWA 4HL6A 2W6ID 3C3XA 4G41A 2HMYB 1I6MA 3L4BA 2DWQA 3SBXA 4C08A 2JI4A 2PAAA 5J2UF 3R77A 2I33A 1K3FA 2A4KA 5EPUA 5EPKA 1QVVA 2AN3A 3CB2A 4CW7A 4M1KA 5FL7A 2P4HX 1JEYB 1K8AC 3DP9A 1Y4AE 2WU0A 3SR0A 4BO5A 2QSZA 4Z1OA 2F7SA 3CN9A 3OE5A 2ZSJA 1D4OA 4ALNA 2UVPB 3PNVA 1USGA 1H2YA 3WMEA 4QUBA 5EGNA 5JXWA 1G0OA 3AM3A 2B0JA 3UKJA 2Q2TA 5FIUA 4FEAA 5LDGA 4MV1A 5EQ0A 5JSYA 2P9CA 1WF6A 1MA3A 1UBTS 3CW2C 2ZUCA 4YI5A 3FVWA 1Q0UA 4P3YA 4FDBA 2B2WA 1R6XA 2OWDA 1JXAA 4B3HA 1NVDA 1E1TA 4IICA 3TZHA 4MVCA 3INYA 1ZVMA 3OMXA 1YI8A 3K9QO 3O83A 3O8NA 2DE0X 4BBRG 2EWVA 2VQEQ 2NZYA 4BKUA 4GP9A 2R2AA 3QOXA 3TS0A 4MAMA 1Q90A 2PRSA 5EEHA 5T3YA 1J56A 3H17A 3ITPA 1XZQA 3KSBC 2WLTA 4L0CA 1KAGA 3X1YA 3QLTA 1VPLA 3CVXA 4G0ZA 3L7AA 1DINA 1F77A 3MVVA 4AYWA 1OZFA 4NL4H 2O2YA 1SYDA 1KZYC 3U80A 1CLUA 1U7TA 2Z98A 4O1NA 2JLCA 5A3RA 5IP9H 1D5ZC 1PDOA 4DNRB 4WOCA 2G80A 4IXWA 4C0QC 2B7BA 2CKMA 4KO1S 3JQDA 1YHQA 1AE3A 2D5AA 3O0DA 5INTA 1ESEA 5FORA 1E0AA 4L5AA 1MJCA 1LO5D 3M6FA 1KO5A 1XJQA 1M6VB 3V7YA 2G82A 2QY9A 3QV2A 2I2DA 3FPJA 1YNJD 3HKCB 4QYIB 3OE7A 2ODEA 3UA3A 3N7UA 3UMBA 4G5XA 1BVYF 2NTVA 2FN8A 3GJZA 3WWPA 4XCVA 4II3A 2ZG6A 3OHSX 3RS4A 5LMNB 3O92A 2BEUB 5MDHA 2G5PA 5AKEA 5G4KA 5K3BA 3WB1A 2CHQA 4IHJF 3U3XA 4YPVA 4OUDB 4QUJA 2UXBB 2R60A 4DYHA 2CFTA 1TR5A 5I9BA 1PVOA 1GARA 3MRSA 2X15A 3BWDD 1XELA 1E6LA 2EYFA 4MKZA 4NZPA 5KQMA 1V1MB 3TI9A 2YS7A 3LUGA 5JY6A 3CLTD 2A3NA 3WQBA 4JJAA 2O3TA 4WGFA 3RS2A 3DQPA 3BKXA 4AY2A 2XQVA 5LR6A 4Y18A 1D1TA 3H1BA 3NBQA 1WOYA 1M10A 5JLJA 1KIFA 1P0IA 4TZ6A 3EG9A 2JFGA 3V1LA 4ZOLA 1XNRQ 3FCXA 1HR0Q 3GPLA 1PR4A 3K0FA 3QXSA 2VJNA 3RTCA 1SVWA 2ZSDA 3ZS9A 3ELBA 3FSEA 3Q0TA 4C7MA 4MRMB 1PWYE 2P4EA 2RGCA 1X13A 4QREA 3OCWA 3C8MA 1UPAA 3EGCA 2B99A 3GNQA 1UT8A 4HGPA 4PYQA 4LDRA 4LXQA 4D4LA 4OI0A 1BSVA 1Q19A 4WN9B 3PQEA 1FSGA 5ALKA 2XMZA 1L4NA 2I7CA 4QU8A 2XWPA 3FOEC 4RZ2A 1BGXT 3PHHA 2WIGA 4UBNA 3B6ZA 1EFDN 1P9WA 4X1IA 2XX3A 1Z4NA 4PRYA 2PRZA 4PANA 4BX3A 4RS3A 1H8HA 4RTMA 4KJOA 5U9CA 4KBGA 4MQMA 4OO3A 2GA9A 1X19A 2I1VB 3IQXA 2Z2KA 3M81A 1KHHA 3KR1A 3CF5A 3CJQA 4A3FH 4QVIA 1SMYC 3R7WB 3EZGA 2VJYA 5IT5A 2HCIA 1FB5A 3UWMA 1VL8A 4LOKA 2YXDA 2NW6A 3H99A 4DILA 1KXLA 5AW7A 3O2NA 3R24A 1NVVR 4MJ7A 4FO2A 2HPAA 3QKUA 1QFJA 3WA7A 1JKXA 3KQUA 1MENA 4KXYA 4HRXA 1MV8A 1PH3A 2VKQA 2B9EA 3HS0C 2CV0A 2UYHA 3KV1A 3GP7A 5HK8A 5DZSA 2GR9A 2WHYA 3C3BA 1IIBA 4K03A 4QLBA 1YC5A 1LPPA 2AUMA 2NP6A 4EFNA 3RYTC 3PUJA 2A5HA 1PQYA 4J2OA 4TX1A 1NMFA 5FKJA 1EJBA 1RBYA 4FEYA 4EJFA 3H2ZA 3CN7A 5EIBC 5TX7A 4ZI2A 2HRBA 1YJXA 3QPBA 5DMHA 3ZHSA 2I54A 1V25A 1SG9A 1UMBB 3JALA 3W5AA 1W47A 3LQQA 2Y0DA 4D42A 2IZ6A 1F48A 5KYUA 3EEOA 3UDXA 2CLMB 4YJ3A 4BQOA 3R6TA 2I7DA 4NJEB 4BGUA 4GD3Q 3V05A 1EWQA 4F86A 1KYQA 1EGHA 2NIPA 4J6FA 2N42A 5E6UA 4D8XA 2NO9A 4RTSA 5IGFA 3GTJB 4AUEA 2V6IA 4DPLA 4MRVA 1ZGAA 3RARA 3KPUA 5BUQA 4PO1A 3RVOA 1WU7A 1A2TA 3S99A 3C7CB 2QRVB 4TGLA 3D6FA 1JKFA 2W2LD 2IE8A 3AR2A 1T3LA 2HJWA 2QILA 3NTQA 1GUTA 3LUBA 4D8WA 4G1FA 3OVMA 3H3VI 3A70A 5FWXB 3C85A 4ZXFA 1KPGA 3SHQA 5GPBA 3R5FA 2F00A 1LYLA 2BFFB 3AIMA 4LW8A 3W77A 1ZGHA 1X54A 1SVSA 4RF4A 4KXUA 1FXSA 3LHFA 2BE5C 5FD8A 3Q8KA 3ZLUA 4EGCB 5K05A 4RMHA 3DE5X 5B36A 5KNLA 3SI7A 4G4JA 3MTQA 3NAZA 3KVRA 1RMQA 1NFQA 4HGZA 4ESEA 5L4NA 3MWEB 4QX6A 3IHTA 1FY2A 2XNDD 4X8MA 4DAVA 1R9JA 1KKMA 1A8QA 4DK3C 1NXSA 2O5RA 4U2EA 1S3IA 4YMGA 4RETA 3K4QA 1J0EA 2LXNA 3H1PA 1BEZA 4OQFA 1QCBD 4F96A 2P6OA 2VTKA 2R6HA 4TVSA 1P6UA 2JFBA 3TEFA 3FNHA 3IJPA 3FFXA 4MICA 3BVMA 4MA4A 4RHFA 1NTRA 1WTHA 1MW9X 3INRA 4BBSB 2W4MA 2WTUA 1O7YA 3KTAB 1UBEA 3NPPA 4NFHA 2XH8A 3R4CA 1MC1A 4RU1A 1MGOA 1M0EA 3T7IA 3KSUA 2IPLA 2YMMA 4Q9IA 3VR5D 4JI4B 4WIAA 3WQSB 4MWGA 3CZ4A 3H2BA 4KX5A 3M0EA 1SXQA 3HDVA 3L8DA 4KEAA 4RVGA 5AKJA 4GI2A 4W1RA 1RR6A 5EIXA 2M6SA 4BJ1A 1NI4B 1ES9A 1SWWA 4X63A 5JXJA 1W88B 3H4MA 3NC1C 3NWEA 1E6MA 4OM8A 2W5UA 2Z4HA 4CQMB 3D0QA 4NCXA 4KAAA 2YL2A 1Q7EA 4TYYA 2KEDA 4DV2B 3NXKA 1HBJA 1MB4A 1Y98A 1U8AA 1TA9A 1SUCA 1YIDA 1XZAA 4DK6C 3QNMA 2DUNA 4LDZA 5FOTA 2WTEA 3RZOB 4LSGA 2ZI5A 1RI2A 5D5PA 4DIDA 5H02A 3MWJA 1Z8NA 4BLOA 3C6BA 5EUCA 2YJ5A 1O0SA 3RUCA 1K2VN 1GHJA 3H1EA 1HXYD 1G63A 2OMEA 1IBSA 1N2CA 3CHBD 3BMXA 2ZGVA 4OKIA 3SKYA 4CKCB 3FZQA 1L5NA 1SNOA 3O8BA 4NMWA 1SYGA 3L01A 1N6KA 1GPH1 1F4VA 3CMMA 2FPLA 3ZLJA 3LUCA 1L0YB 1YQEA 2JVJA 3EFHA 1MH1A 1BJTA 5B1SA 1ZNWA 5HOEA 2W71A 2P2SA 3ZUGA 1QE0A 2E2IH 1Q7BA 3URMA 3BGVA 3OKFA 4R81A 4DQVA 5CIQA 3ZNOA 2VB2X 1E2BA 5TGTA 4QAJA 4IHKA 4PTZA 4BNHA 1N1EA 1OWMA 1E7QA 4URZR 3V7WA 4JV5L 1Y3DE 1NNSA 2BFEA 5DIFA 2IT1A 4K87A 3BHMA 1A9XB 3THYB 3I6ZA 1CIVA 3PTZA 3RM3A 1X7GA 1RYEA 3ADDA 5CH3A 2LMCB 1D4AA 2ILVA 2QT1A 2O3QA 1N0UA 1CBUA 2FPKA 2ZJAA 1LZKA 5IBRA 5LQJA 1HNZQ 1ORRA 1OH8A 2QG6A 4ONEA 1R16A 1ULSA 1M2OA 5TQVA 5E1BA 4B2PA 1Q46A 1A8VA 5ALTA 3QXJA 1AGNA 1VXRA 1JU9A 2ZJ7A 1CR4A 1SVLA 4BFCA 3UXHA 5JS8A 3GVHA 2FX3A 1JECA 3PNYA 2V6BA 1MF7A 1AEXA 2ZB8A 1IOLA 3DWAA 1SCIA 4GQIA 4BQSA 1VGQA 1SC1A 2G04A 3CONA 3WC4A 4A1FA 1PVVA 3KETA 3ZU2A 1EXVA 1TRKA 4D02A 3VPHA 2DJGC 2BFBB 2OHVA 4M1TA 4DUPA 4FNGA 2A9QA 5BVHB 1DFHA 2CKZB 1MLDA 1IJBA 4AD8A 5GZ6A 1GVPA 3BBLA 2BC9A 4HGQA 4P7KA 5CGZA 4JJZA 5KAPA 2IXTA 4B34A 4EG0A 4GC5A 4D3SA 3K6SB 4BJ6A 4KAJA 5JD6A 4EA6A 3H6HA 4MIKA 2M00A 2XSZD 2DHRA 3PSIA 2O07A 4OHCA 5J4YA 3G7NA 4JXKA 1Q82C 3E3AA 3R5JA 1W46A 2J4XA 5C18A 3QHPA 5K0LA 4TUYF 3RRNA 3GI1A 3AXSA 2JLVA 3HGTA 3HU1A 2H06A 1CJVC 2EY6A 1GRCA 1LNZA 1F60A 3T7JA 1WUYA 1X70A 3ZXXA 4B3SB 2B4AA 3GEEA 4L5RC 3FHJA 3WK6A 3C5HA 4D97A 1EWIA 5IHPA 3HFJA 4XUGB 2CSUA 4RQBA 1XMIA 1A9YA 3AUKA 3O4RA 5CBEE 1TYBE 5JE8A 4P8RA 5BV1A 4YRGA 2RGNC 3SX4A 1VXOA 4A92A 4ZK6A 4UZSA 3HKBA 2H1WA 2R7FA 4IFDG 3ZTYA 1VQIA 5JAUA 5DLQC 2HX1A 2C9CA 4YCUA 1OREA 2XQKA 2MFIA 4YQYA 3ESBA 2VZ9A 1CUEA 4BXXH 5HTOA 1ODSA 5ALEA 3JSXA 2XZDA 1MC8A 4C5CA 3INGA 1G8KA 2RONA 1HE3A 1J1UA 3U4IA 4O4LF 2YN4A 2OO5C 4BRZA 1GZ7A 3SOZA 2UZ3A 4P2GA 2OEPA 4DJFC 2O48X 2XB4A 1SXJC 4IUBS 3HI4A 4X5OA 2GI4A 3E1KA 3MD9A 2AJCA 4NCNA 4PHGA 3T9DA 3USES 3F5SA 1U9YA 5KPJA 2FSVA 2MJLA 1X55A 2IV7A 2HIGA 2O20A 1VRVA 4GNXC 3S16B 4NYIR 3WP0A 2GZ1A 1DLJA 1H0RA 2P7IA 5E9AA 3C97A 4HVLA 4X24A 2DVMA 4CMGA 4CR6A 2BW0A 2H1OA 4HSVA 3KKMA 2A78A 5IG2A 3NWBA 2J3IA 2CMKA 2FUEA 1Q11A 2O5VA 5L8VA 2AZMA 2CUTA 1W9HA 3OKPA 4UNPA 1QJCA 3TKYA 3OLCX 2M2IA 3BXFA 4B17A 5EGSA 2IHNA 3EA5A 1Y7PA 4IGFA 1AKWA 4HS9A 2F0DA 1WCV1 4BY7H 4JCCA 1TM7E 4FEGA 4ZMRA 1X7ZB 2I5HA 3G0BA 3BDAA 5H68A 2RKSA 5DN9A 2A30A 4ASUA 2PLAA 4P74A 1BXRB 4A3LG 1K92A 1K75A 2FMFA 3PPXA 1QV7A 2ATEA 4WY2A 1EVLA 4DANA 4BXOA 3GO4A 2VF2A 4G0PA 1BAPA 2NN6I 3G49A 2H8GA 3HCAA 3L46A 2ID0A 4QJFA 4KXNA 4WOBA 1PGOA 2DJFC 4FMDF 4FMPA 4DSZA 1AKEA 1SJ9A 1HG1A 3FCOA 1TT5B 3C8UA 5G3LF 2ECFA 1FX0A 3AVOA 2R6AA 1BFDA 1GPWB 3HPRA 4QUGA 1JDTA 3HA7A 3PP8A 4QUHA 5BN3B 3ZWQA 4IV8A 1LDEA 2ZJFA 3M9XA 3DCIA 4ESVA 2GFQA 3PQDA 2MR5A 1X9GA 1XRMA 4RVCA 2WB2A 3TMYA 4JSTA 1J21A 4ALLA 2I4MA 3DO6A 4KJZA 3CUUA 3WLFA 1OU4A 2YIVX 5J3BA 2XA1A 2V1CC 4DMRA 2J9YB 5GIOE 1YU9A 2VSNA 5K8TA 2Y1CA 5I8ZA 4ANFA 5KTRA 3KR0A 3KJNA 1ZHOA 1AK1A 4G4KA 4C3OB 1W0JD 3OE4A 2H5XA 4RTRA 5EE9A 4YCAA 1J8MF 3FPEA 3AHEA 4ZYYA 1MRZA 5HKKD 4PINA 1LGYA 4BMXA 3NEJA 4X7RA 1P4AA 5DYGA 2P2CA 2JFNA 1G21E 3M49A 4FIDA 3SS9X 1DKOA 8ADHA 1VLZA 3UXYA 1HQMC 2CDNA 5B3LA 4JS0A 1FRFS 2HWYA 2QD4A 3RYCB 3FNGA 5LKRA 3CHYA 1TO6A 1DMSA 4TT3A 2Z9BA 1PRTF 1H5NA 4RQTA 2ZYTX 3K6OA 2A0UA 3RFCA 1BBUA 3A9CA 3PXBA 2QRKA 3MTJA 1VP3A 2G3YA 4O2BB 1YRLA 2QRHA 4DR4Q 1J5PA 4AKSA 1NMQA 2ZM6B 4OEHA 4US2R 2WHPA 5GINE 1D2AA 1PLFA 3VSEA 3V6MA 1RRMA 1I2CA 2KLHA 3RROA 1EYGA 1OIXA 1NE7A 3CUVA 1L1QA 3C1UA 1OGIA 4FP5D 1S8OA 4TRJA 1TYAE 1Z35A 1UWLA 5BR8B 3P9ZA 2D13A 2REBA 1TY0A 4GOLD 4BO4A 4ZDJA 4LJSA 5SZKB 3TLGB 4FHZA 4DDWA 3E3LA 2XMPA 1DG9A 3C5WP 2J67A 4TS1A 1GNTA 2B21A 4LF7Q 3Q0EA 2UXBQ 3OM8A 2PUWA 3M1LA 1XMQB 1XP8A 4MWBA 4OFBA 4L8FA 2EZUA 2ZWAA 2CHVA 4B4VA 2VATA 4DR6Q 2ZI6A 3OIWA 1QMPA 2OOKA 4EL0A 3VDMA 2WV6D 2Q7OE 3NBHB 3DAHA 4TKVA 4WZ6A 3QQ5A 4AWBA 2A0KA 3UF0A 4KQFA 4B0OA 3BK1A 5KDOA 4P34A 1X3FA 3D3EA 3GJ5A 1CUYA 4QXAA 3JWIA 2Y4NA 3NUQA 1XZBA 4WDRA 1NL3A 3HDHA 1HF3A 1WUHS 4EUNA 4YRCA 4C04A 4YMLA 3PYMA 3HBFA 3L3BA 4TL8A 1OLOA 1V4VA 4G3XA 3UE1A 1FVOA 3Q3GE 2X3YA 3ZZUA 5JSFA 1BWSA 1R27A 1S3SA 1V1OA 2NYZD 4J6EA 1NXTA 4P81A 4MDFA 4LCBA 3HMQA 2ADFA 1OB5A 3ESXA 2BA0A 4A03A 4MNTA 4I50A 4S1PA 3W2GA 5SZHB 1OH6A 3IDZA 3CJRA 4NK4A 2O0KA 2X41A 4XXEA 2OHFA 1NSFA 2IXBA 3JYOA 4B6OA 2XBMA 2LXKA 1N9KA 2QZ4A 2ZDQA 1LWOA 2Q41A 2L0XA 1Q86C 2ZSBA 3FFTA 4FYPA 1PIWA 2I07B 4G1EB 2ZE6A 5E8RA 1FFHA 3B52X 1W36D 1AN0A 2A5DA 5JAQA 4Q4HA 5EFOA 5C44H 4O5OA 3EVDA 3CMCO 3WG9A 4UNNA 3WGJA 3HHPA 4JHLA 1TWGH 3GLQA 1LTAD 3J81j 2B61A 1LY1A 3V8QA 1XMOL 1NUUA 2GFIA 3A0RB 4YBZA 5B6JA 5BR4A 1QWYA 1T2VA 3KU4A 5AKLA 1A1VA 2FW7A 3GJYA 1NBHA 5H9VA 4MVJM 2WHQA 3EHEA 2B1JA 2XE7A 4XJXA 3G8DA 2BGNA 4UXJA 4AJHA 3KB6A 5G0SA 1H1LA 2WYUA 4BVBA 1E96A 4P4LA 1KDAA 1NW3A 4N7MA 1Y7HA 1ECCA 3TCXB 2QUZA 2K50A 4PQXA 4HAYA 4PFJA 1IEQA 2O7VA 1HZZA 4JQCA 4DNXA 4OP2A 4B4KA 5LOVF 4KQ9A 4NECA 1G7TA 1RKNA 2DERA 3D81A 4M88A 4YI3A 4BTLA 3JQFC 4BMCA 3E0QA 3EFOA 2PCLA 5AKIA 4CYMA 3QH4A 3U50C 5A0FA 5FK9C 3SHTA 3AILA 1JQDA 5D3IB 1XZEA 2GJKA 1VL2A 1E1RD 2WVGA 2AX3A 1BCSB 4MVYA 4MVJG 1NIPA 1YHAA 4IIFA 3A6PC 2PDAA 3WAJA 1PEDA 1PYWD 3MOSA 3UCFA 3C8HA 3SJZA 3VPBA 1X80A 2HJHA 2AW3A 2IFTA 3DO8A 3QOYA 1XGKA 1CJMA 2R96A 4NZYA 4MB0A 4R1UA 1HMPA 1T2FA 1XQ1A 3TVTA 4C4AA 1AXEA 1SUIA 1QQBA 2IYVA 3O1JC 4Q1FA 1D6JA 5K51A 1G2PA 4JL6A 5EHZA 1CTQA 1UQRA 3I1FA 1SCNE 3H94A 4FYVA 4OO1H 2G67A 1ILWA 5CLHA 2ZTEA 3CRLC 3T54A 1PFMA 2AC7A 3NBIA 3W1VA 1Z0KA 4LJ6A 4O3MA 2CMFA 2D0IA 2RC5A 3OZDA 2Z08A 1AG9A 2QVCA 4H18A 1M72A 2BP7A 1P0MA 3Q8DA 3KO8A 5GAGC 3PXXA 5KOHB 4ZZ3A 1G0NA 2I4OA 5GZ1A 3QEMB 3VSBA 2WWWA 1R4AA 1MEOA 1E64A 5F23A 2C84A 2JJYA 3FPCA 2YWBA 2HWUA 5B7PA 2DFVA 2CWAA 3WNVA 4X64L 2P6PA 1NMSA 5C8VA 3B9PA 2NU9B 2F62A 3MN1A 1BRTA 3CR3C 4HWRA 4BNTA 4DV3B 5CLJA 3H42B 1ZA2A 4BQPA 4I5IA 4CF5A 1FL0A 4I4IA 3RUZA 3VGPA 4NNJA 1RZVA 1OXKB 5HWSA 4ZKBB 4LS3A 2I1LA 1SPXA 5CYPA 4GNXB 1BH2A 1BWPA 4EYGA 2PKCA 3KL4A 4WXHA 4OLJA 2XUZA 3AUXA 2X2EA 3V3TA 5BSRA 1KJYA 2JFUA 3RC2A 3DKVA 4QODA 2XE6A 5JZSA 3D1LA 4AJ4A 3D2AA 3QF4A 1XEFA 5GV8A 2E7ZA 1XNRB 1ZSYA 3WHPA 1CHPD 4ZVUA 1DSSG 1I6HB 5F77A 2PV0A 3DHWC 4P5PA 1WCMH 5HZMA 2IYYA 1GXSA 2PT6A 2YNMC 4URHA 1ZYRC 3B12A 3DQQA 2CNWD 3CO5A 5IULC 1QG2A 4M0CA 3D6NB 3OZEA 2K28A 1Z4OA 1YR2A 2YZ7A 2VP6A 4XYEA 5IMSA 1JJ7A 3OCUA 1RDPD 5KOIA 2LZ0A 2HIXA 4KOEC 4E5YA 1SKYB 1XZKA 3SKVA 3ZX4A 1W3SA 5CA1B 5FNVB 4KPEC 3VR4A 1P1CA 3GA0A 2CYCA 5LQRA 1KYXA 3G2PA 2P9JA 3BYZA 2QNIA 3I3OA 4GNKA 4XB6B 3NW9A 3QKWA 3LFTA 4BVJA 3FMPB 4GFDA 1GGMA 3RYFB 4DPKA 1PL0A 4KFCA 1D09A 3GP5A 5DNWA 2FEAA 3GLIB 1IONA 1PFGA 3M3HA 3SJ7A 3WNDA 3MWDB 4FSDA 4OHPA 4MQEB 3FKIG 1TVXA 1EMDA 2X8JB 4H1TA 3G1WA 2ZXEA 1VDZA 3A14A 3F9RA 4HLDA 3X2FA 1Q8KA 4DGZA 5IWCA 5EJAA 5M3MH 1J09A 1CJBA 1LFDB 3I39X 3CTPA 3A6KA 2GEVA 3QW4B 4Z4EA 1O8BA 2KJQA 5FPTA 1YI0A 3I4MB 2O2DA 4JA0A 5T4EA 1IM8A 1Y5RA 3OCCA 5DBHX 1Y1WH 1KI2A 3MTEA 4AKHA 1QPGA 1FFEA 1L5MA 2O1WA 3VPXA 3OY2A 3T1YL 4ML3A 1COWD 5FV7A 2D5CA 6LDHA 2BY4A 4D0NA 4OA8A 5AW3A 5CV7A 1DEOA 2G06A 3SX0A 3EVEA 2YQZA 3P71T 4C3ZA 3GAFA 4MRAA 5HILA 3NV9A 2OE2A 1D8LA 1WMDA 4OHWA 3MTGA 4OLHA 4U63A 3P0EA 5CEJA 3A0UA 4XYBA 1A76A 3WNBA 2NB0A 1GL3A 2N78A 5KO2A 5KNDD 1BQ3A 3HC7A 3EEBA 2WP8J 4F45A 1VQDA 4KLKA 4DQUA 1XTTA 3CBGA 2GFHA 1CE8A 3LYUA 4QGAA 4LJAA 3WLEA 3K58A 1FJHA 2ZXRA 4XD2A 4R9RA 4MR7A 4QL3A 2AKYA 4PGAA 4A10A 1IXYA 5JSHA 4PZYA 1YJQA 3K32A 3V8MA 2NBFA 4BJHB 2Q5JA 5CTJA 4G7HC 2ORWA 2NUAA 4YVFA 3DBOB 1JB1A 2YHSA 3LNCA 4AQDA 1GUNA 1G291 1XEAA 1G2TA 3K9LA 1P1JA 2JF0A 1VHWA 1N2XA 3LRTA 4TQAA 1TW2A 3TD6A 1K6XA 4J3FA 2WAQB 4Z51A 5CLIA 4O4IB 1RRGA 4MRSA 1ZSVA 2HD3A 3HFZB 3TMEA 2JEBI 3QVOA 1G3UA 2F3IA 1T5OA 2ZAIA 3HNPA 3NCTA 2H6EA 3MCAA 4A9AA 4LZJA 3HCCA 5EP3A 1U28C 3DUFA 3UHFA 3G6KA 1C4WA 1PWZA 1N3LA 4E6EA 3LP8A 1GCGA 3ZIAD 3LUAA 4L9AA 3CNOA 3QFSA 5B30A 2A19A 5JOBA 4RMJA 1TKBA 3I3SR 3MFGA 4DYVA 3IA2A 3W9UA 5AI9A 2C5EA 3EDYA 3ROMA 1Y80A 2GVAA 4C2MB 5HBRA 3EZFA 1OJLA 2R7ZG 1ID1A 2CQOA 4D6PA 1CRPA 3NUZA 2QXUA 4RTQA 4YJ2A 4C7VA 1JBKA 3CFYA 3VAYA 3ZCRA 5C9ZA 1CDEA 1UPUA 4BZQA 1ZNQO 4KH1A 4YMTA 1FDIA 5KYGA 3DPIA 4ZT3A 3EBEA 2Z4IA 4Z9YA 1RTKA 4OH7A 3HABA 1OFUA 4PLZA 2FE1A 5KNDH 3C4QA 1AZQA 3IP5A 1YJNA 3B6MA 3AYZB 1SKBA 2NPFA 1UBMS 2O5CA 4Q1VA 1K2WA 1W96A 1PH4A 3AVXA 1EUDA 2IK8A 3KDPA 4JC5A 1AZTA 4FUQA 1FVFA 4CIYA 1OI4A 1TCVA 4LHYA 4LE1A 2R7NA 1T0PA 4YQEA 1XD9A 3HUEA 3HCFA 1XDSA 1E60A 3AERB 3CLSD 1KI8A 2Y67A 2A0FA 4L5YA 5JCOC 4DLUA 1W35A 2ZP1A 3NBFA 1RYYA 4WCVA 1VLQA 1LSJA 3G9TA 3L4JA 2B4YA 5EYPB 1ZP6A 1DC4A 4D4IA 1FS5A 4QOJA 1IL8A 3F3SA 4PXAA 1Z4LA 4DA8A 4ZEMA 2B63H 4PG6A 3C1AA 2ZK7A 1Y89A 2WR8A 2Q5HA 5CYGA 2E0IA 5C5LA 3IKLA 3S1RH 3TPZA 3ONEA 4Q37A 4ZC8A 2BIFA 1P4SA 5IYCH 3CLKA 1YFLA 5JQGF 5FBQB 4UP9A 2HCFA 4YXWD 3B6IA 1Z16A 1MIHA 3AHIA 3H19A 3Q4GA 2BGIA 3WBJA 5JDIC 3WYDA 3WGMA 5IAGA 1ZK2A 1U4NA 3N2KA 3ZCVA 4HIKA 2IDKA 4GXTA 3SBOA 3MK31 1QLHA 4RSHA 4EABA 5EE5B 1HNZB 3A1SA 4CKEB 2QF7A 1VKHA 4DUGA 4F5EA 2ZRAA 5C34B 4IF4A 1WZNA 3KQYA 4FGSA 4QLOA 3VM6A 3D43A 4HMPA 1VIDA 3EEYA 4JYBA 1CK1A 2VH1A 1YHYA 1AIPA 5FBHA 2QR2A 4ZC1A 2JA5B 4Y0VA 5E4FA 2IYPA 4RKBA 4QXOA 4FTWA 1TJNA 2QX8A 4KYVA 4MWCA 2YASA 4DUZL 2I4TA 3T7AA 4CU5A 2ZJRA 5LXTA 2WG2A 3A58B 4HZUA 2L4NA 4ARIA 2A58A 1HQRD 3QYFA 4ND4A 2XNHA 3NP7A 5ELMA 2OGZA 3A6JA 4WLVA 3OQNA 4ZQIA 3WQRA 1GNQA 4NE2A 1HNWQ 1UBCA 4GOND 3LK7A 5CHEA 3CEAA 1G2OA 1ARZA 4LQ4A 3VHLB 1N5DA 5C4HA 2IIBA 1M8JA 2BH2A 2ZYGA 3W5SA 1P1FA 1YZNA 3OJLA 1QFSA 4M9UA 2BEWB 4X3CA 1VF5C 4KAXA 5ADVA 4BN5A 3G9UA 1UIRA 3MB8A 3CZ5A 4M38A 4H7DA 4NCJA 3TSOA 4EB6B 2EF1A 2AN5A 1CVLA 2Y9PB 2O8FB 1MAAA 3DWPA 3CLUC 5FI5A 2CDCA 3LOUA 2JA8H 1NYLA 4KR9A 3ROFA 3P2IA 2OCYC 3FNQA 3TW0A 4WZAA 4BFSA 4YRRA 3BK7A 1WP9A 3EXHB 3WK5A 1NUTA 2VWGA 2FSPA 4HQFA 4WTOA 1HTWA 1WMFA 5IM4A 1D5WA 4CKXA 4E5DA 4ZCLA 1RRVA 1ZITA 1VE9A 1MMFB 4UBMA 4DG8A 1KOLA 1TMOA 2C1ZA 4ZPJA 5JWOA 4L7QA 2IGTA 1C9NA 4PTYA 1KZ1A 1QKKA 1PBTA 4MUNA 3RSGA 5EIAA 1Y8RB 4QYMA 1KAEA 5ITSA 3TFOA 2C4MA 4G1UC 1VOTA 3AGPA 2XGGA 2ISQA 2DUJA 4ARZA 2CWPA 2QGFA 1J2RA 3QTBA 3UW3A 3TAXA 2F0VA 1NC3A 3MGKA 2K5HA 3TZCA 3SYKA 2DKOA 2EY1A 1V8ZA 1HDIA 2PX3A 2A92A 2E82A 4YFYA 1GUGA 2WKQA 4UTZA 4NV3A 4V24A 4UNRA 2X13A 1YQDA 1ODKA 2HJ9A 1YMUA 2JZOA 2ATVA 4TS9A 4LIPD 1UZAA 4X65L 2LRHA 3MWFA 3KFUA 1DC5A 1SBBB 4O08A 3LBAA 1Y6ZA 3FJOA 3CGWA 4PZ8A 4H6XA 3CURA 1L5ZA 1PDWA 3U7EB 3LVQE 3DT8A 4WAUA 3CRKC 2BKAA 4ZV9A 4DR1Q 1GTJ1 3CLRD 3DMFA 4KJXA 1Y4DE 3NRCA 1UT5A 4OAOA 3DEKA 2NU6A 1ISJA 5ALXA 4H27A 4KIGA 3DV2A 3AR9A 4LC1A 1GVNB 1FOEB 1F51E 1NBOA 1IIRA 1DD2A 1YDMA 5EXSA 1TUBA 4TSKA 3EC2A 2EG9A 3UGQA 4R2WA 1EXMA 4Q9DA 4RA9B 4KPUA 3BG3A 1GP2A 1UC4B 5B3JA 3WA6A 4K5QA 4ZIRA 4Y2QA 1A9RA 2OD2A 1R66A 3O26A 4YRMA 2R5WA 3ZVKA 4PONA 3OM0A 4F9FA 3RSFA 5TF4A 4DKJA 4RS4A 4Q3DA 4JOSA 3PPVA 1MOZA 1QIHA 1VI2A 1IPFA 1XDGA 3FPLA 2JFXA 3M4YA 1I94L 4CN9A 2QCPX 4OB6A 4JP2A 1CZKA 3V5NA 4B31A 1DFGA 2DPHA 2JKYA 3O21A 4HDSB 2GLUA 1FDUA 2WSLA 3WK7A 4EJSA 5IYDG 3H0EA 1JIUA 3E81A 3L9WA 1W44A 3QUQA 4EG5A 1VQ5A 2YXEA 2PFSA 4QEDA 1NVTA 1L4KA 4YT4A 4GLOA 2GEJA 5B3KA 2Z2YA 4DA0A 4JD5A 2CBZA 3QI2A 3I9NA 1L1OC 3GIDA 2P9TA 2ODWA 5I7RA 2PJUA 4LWPA 4R1SA 1ISHA 1G4HA 5BW8A 1EUCA 4KQGA 4YV0A 3M34A 4QJ4A 4I3HA 5IDQA 3ON5A 1BBXC 2R4TA 3EH2A 4DLKA 2J87A 1KI9A 1P17A 5FLMH 4LF4Q 1U1CA 3LY8A 4JBYA 4WKBA 3PKIA 3BH0A 1Y1RA 2DFNA 5CDFE 4V1CA 1SBTA 1A69A 4K8OA 4ZEWA 2ZRLA 4R1NA 4DKAC 1UR5A 3LT4A 4GBGA 4WL0A 3Q87B 4PC3A 3CKKA 4DR4B 4C03A 5KJ1A 4U7FA 1CI3M 2L2QA 4L07A 3ZH2A 2EFJA 4LV8B 2B3DA 3RK4A 4J0KA 1H9AA 4MIUA 4FGUA 4DU9A 1GZ6A 5SV2A 3N2EA 4YAWA 1JHMA 2ZXOA 3PQ3A 1QOHA 4BY1G 4W6ZA 3ROEA 4ZRZA 2BHSA 2NVUB 3GEIA 4LJ9A 4QT0A 3L0YA 4NCBA 4GKBA 1EZZA 3C6MA 3SVLA 4R1QA 4S35A 4DV3Q 4LF7B 1ZEQX 4AUKA 2NO4A 2WMDA 4PSKA 2RA4A 4LI0A 2FGKA 4D3FA 2XLBA 4DR6B 2ZCJA 5FAKA 1EE9A 4G2TA 4P54A 2QTHA 1GRRA 2VJAA 3PQ7A 3HZRA 3HRZC 3N87A 4X3TA 3QMVA 3BD8A 1T4CA 4QPPA 1MJ5A 4LHEA 3AG5A 4MHEA 4MW2A 4A2WA 1EFUA 2GD6A 3CU5A 1E9AA 2ZJ5A 2HXSA 3IUJA 3EUFA 4EUHA 4Y2HA 1LCIA 2MSEB 1O87A 4PVCA 4X85A 3KAPA 1KS2A 5B6IA 4UP8A 2QLFA 1C8BA 4AJ1A 2PD4A 1F2TB 3ETLA 3AF3A 1UJ4A 4TV9A 4HNHA 1T8UA 2IWHA 3G71A 2CE2X 4HBGA 5J4VA 1SSOA 1GUAA 1V8PA 2WJIA 3CH7A 3J80i 3GRPA 4XQNA 4QFDA 2LCFA 5IDYA 1OXUA 4TTPA 5T8KA 1EVYA 3TBFA 2Q6IA 5BY2A 1KETA 5C3EG 2WJZB 5G0WA 2AEMA 3QXCA 1GUFA 1BXGB 3E8XA 2NWGA 3ESQA 4WUVA 2ZU0C 1VQPA 5C7IO 2JLBA 3GL9A 4N4AA 4BMDA 5IT4A 1EQRA 3JAMA 4DBLE 2RKBA 1WUTA 4U9HS 1Q7TA 1WSBA 5JBIA 3S17B 2CXRA 2FB9A 1NUQA 2BGKA 3DD5A 3OT1A 4C4OA 1RYDA 3LWNA 3HUFA 2HHHL 2QP9X 1ZI8A 3T15A 3KBXA 4OHBA 1W6JA 4NBRA 3HOWH 2DG2A 5ECDA 3FDJA 4C7OA 1WPXA 3ZTWA 2BH9A 1WBBA 1Y4UA 1GJRA 5IRCD 2YC2C 1K73C 1LK7A 3ITNA 2IPMA 4XM1A 4J94A 2LKVA 3NTOA 3CMAA 3GJ4A 5K99A 3IAM6 1EHYA 4HSEA 2HREA 3PC8C 4HNQA 4DLSA 2R1TB 1TD9A 3GRCA 5DSTA 2JEZA 5EMHA 1EWHA 1EDEA 1YQTA 5LJLA 3FIUA 3I23A 3UBTA 4KRGA 4V3CA 3K6RA 3SZLA 4K5WA 2DLCX 3LY9A 2JRLA 5D5QA 3KFVA 2IQ5A 2GXUA 1V6AA 1D1IA 1CKNB 5KREA 3RBAA 1J39A 1DZIA 4ND6A 1TTTA 4CI9A 1NVEA 3OKAA 2O5EA 1IUOA 4NXNL 3OA0A 2JJ2D 3I0NA 1OX4B 3KLSA 1J90A 4H35A 2G5GX 4TN1A 4BASA 1IU9A 2XLCA 3ILXA 3KWJA 4AUMA 1DX6A 2ZRKA 4RGTA 1Q7YC 4XWOA 2QRPA 1WDLA 4Y9RA 3GG2A 2RAPA 1ND6A 1W2WB 5CK4A 1SUPA 3HJNA 16PKA 1Z56C 5FI1B 3QVWA 4BLQA 2XBLA 5LDDC 1R0YA 2BKLA 1YO6A 4A1OA 4YJGB 3ZKAA 4G0UA 5BSWA 2C9YA 4G07A 3OX4A 1RYZA 3I55A 4FT2A 4ZVNA 2FSUA 3OCVA 2MINB 3ZGXA 4K2HA 1NP7A 1PWEA 3LBNA 5I7UA 4JZKA 2CT8A 4LMAA 2D5IA 1AZLA 1N8TA 1O3YA 1XF9A 2PCFB 4KLRA 2VQ3A 4N54A 2QX9A 1M5TA 1E58A 4TL9A 1NSTA 1STGA 1FDTA 8GPBA 4PU0A 4FVMA 3FYSA 2B8WA 3R0QA 5B2EA 4RSMA 1UAGA 3W1EA 1G7RA 5HIJA 3RK1A 3JQPA 3UJBA 4E7PA 1Z2OX 3QPWA 1ZVJA 1E6CA 2GO7A 3DV0B 1SUEA 3Q3HA 3ETEA 2V6JA 2XD4A 1L3CA 3KEOA 3IUSA 2VPWA 3S14H 4YCDA 1UWCA 2C5LA 3SIXA 2NZJA 2I0FA 4CJ0B 2C7PA 3O93A 1MR3F 5IYBG 4Y0AA 4JT8A 5LL6X 2AXPA 5D1HA 4NY1A 2NZWA 1T9BA 3RC3A 4N5NA 5M9OA 4CT4B 1ADGA 2VAVA 3Q7SA 1T91A 3RLNA 3NIFB 2W6JD 4LISA 1OH5A 1E0KA 2H4HA 3K80C 3UG7A 3IQGX 5AW0A 5CDYA 2BM1A 4ZFNA 1JZSA 2WPDD 2G9VA 1WI5A 4DV4Q 2RAVA 5B1IA 5JI3E 1Z2AA 2PR2A 5JZMA 2UZ1A 5AFWA 5HPYB 3DZJA 1HH2P 3N0VA 4LJ5A 4WOKA 4DR7L 3ZGVA 3H0CA 3T3OA 1DKMA 3AFIA 3EMKA 3I32A 3BDVA 1K68A 1HKUA 1T1JA 4IIDA 4LFBQ 2A9RA 3RJMA 1I6LA 5M5WH 3PIO3 1E66A 3WWYA 1XTBA 5CT9A 4EPTA 2X3UA 2Z3WA 4P3XA 1ZONA 4JYMA 2VSFA 2EGUA 1XZMA 3VGJA 4QXQA 2Y0EA 3H3VC 2WWGA 3P9PA 3GTOH 3HEAA 5IZCA 1SJHD 3JVIA 4GM1A 4RACA 2VH5R 1CP3A 3TLCA 3K7AB 1U5KA 5JTUA 2OQVA 5EN4A 4U8HA 1U7PA 3ENWA 1SZJG 3BMOA 1FZQA 3JR3A 1YZFA 1XC7A 2O14A 2IH4A 4HO1X 3I2HA 1RPNA 2O8EB 1C9JA 4JLSA 2P77A 1PV4A 3RSLA 3PL5A 2NU7A 2WINB