4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
b'MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COME
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
3QX8A 2VK2A 1BDIA 4RY9A 5FBHA 5B3JA 1JX6A 1NATA 3H5VA 4LDAA 1MIHA 2N9UA 3OLWA 4XQJA 1DBWA 3HZHA 3GBVA 4WT7A 1SD5A 1KGSA 2PUAA 2FMKA 5B3JC 3K9CA 3QELB 1M2FA 5IUNC 4NCAA 4QYMA 1A04A 4JAVC 2QZJA 5IULC 4RY0A 1P6UA 1ZDMA 2AYZA 3DGFC 3EULA 2RGYA 4Z4FA 4MS4A 5T3YA 4GNRA 3EGCA 4D6YA 4L4UA 2ID9A 2NUBA 3NHMA 3CS3A 4NV3A 4IMIB 3JVDA 3ILHA 3A3KA 4IILA 3D8UA 3H1GA 4Q6BA 1C4WA 3RH0A 1DRJA 4Z4CA 4MPTA 3OQOA 2NZUG 1VLZA 2CHFA 2FEWB 4MR7A 1JH9A 3JS5A 2DRIA 1Z15A 3HXMA 4YGXB 3KJXA 3E61A 1LJLA 1QP4A 2JK1A 4YP9A 1NXOA 1NTRA 4MR9A 5JNWA 4RK1A 4KK3A 4MRMB 4IF4A 5PNTA 1IIBA 1Y1LA 4RKRA 5FWXA 4H3KB 4LE0A 1W9HA 4XYQA 3KTOA 4MS1B 1VRVA 3HDGA 4RSMA 2KYRA 4F3TA 4G0YA 3CZ5A 3N75A 6ABPA 4LE2A 2IKSA 5T7BA 2RJNA 3OO0A 4MQEA 2W42A 4NCBA 3QEMB 4O1HA 1UDRA 2NT3A 1BVHA 3RVOA 2IDMA 1YS6A 3K4HA 2WJAA 3O1IC 4RY8A 3HV2A 4JASB 1A0OA 2B1JA 5TQ0B 1FFGA 4EVSA 1DCKA 2MYUA 2MYNA 3M9XA 1TMYA 4WZZA 5CHYA 3C3MA 1ISSA 2PL1A 2GKGA 3BS1A 1DRKA 3KLNA 3TMYA 4F06A 2E4WA 2A9PA 3O75A 2JVJA 3Q41A 4G0XA 2L19A 3EDCA 3HUUA 2VUIB 4XXHA 1BAPA 1RPJA 4WUTA 3GYBA 3URMA 3RVMA 4LX8A 1URPA 2FXIA 3OM1A 4O5AA 4ETNA 4FB4A 4JOQA 3LUCA 2FLWA 3EODA 2WMYA 4MR8B 4XYOA 2QU7A 5CNKA 5TQ2A 3SQNA 2FQWA 3SG0A 3QEKA 4Z99A 1M5UA 3LFTA 5IUKC 1OXKB 6CHYA 3VNBA 2FSPA 1NXSA 4ZYLA 3RQIA 4ZPJA 2VYCA 2FW0A 2ZAYA 3L6UA 2FVYA 2E4XA 1EWVA 3H1EA 1U2QA 4DQDA 3RVSA 1YK0A 3Q9SA 1DP4A 2CHEA 4H60A 1S8NA 2WRZA 4HNQA 4XASA 2JVKA 2FQXA 5TPZD 2HQRA 5F64A 5KQMA 5HKOA 2RDMA 4YR7A 5DTEA 1CYEA 3OM0A 4W5QA 1RZRD 1USKA 3KKEA 4MAAA 3QEMA 2NT4A 3QX9A 3IPCA 4ETMA 5JNRA 1ZGZA 2FN9A 4DN6A 3LOPA 2E4UA 4JA2A 3HVRA 4QICA 2FQYA 5ED4A 2Q5CA 2PUEA 4H3HB 1KMIY 3O1JC 5EWJA 3RVRA 2A9OA 1DBQA 1F4VA 3D02A 5EWMB 1Z25A 3RVLA 3O2SB 2PMCA 3SNKA 1XWWA 5JS2A 2A9RA 3FGZA 4XFKA 5EWLB 3IP6A 1XHEA 1D5WA 3N8IA 3GT7A 1PNRA 3KSMA 4B09A 3QK7A 3LKVA 2JB9A 4QYWA 4RXTA 1ZVVA 2FMFA 3KG2A 3O2QB 3N0RA 1SXGA 4Q7EA 2PJUA 4D74A 1FFSA 4P1ZA 5FBKA 1E6LA 4PICA 4XARA 4EYOA 3VNAA 9ABPA 3TB6A 5TPWB 3A10A 1DBPA 2QXYA 3Q7TA 2F8SA 2E4ZA 5FWYA 4TLMB 1RZRA 3IP7A 3CU5A 1E6KA 4RV5A 2PLNA 3G85A 3Q7SA 4KZKA 2XDYA 1ZH4A 5KQLA 4F12A 4Z4HA 1ZESA 2OENG 4MQFB 4IRXA 4RK0A 4XQQA 2FEPA 2MSLA 4RK4A 2WWVD 1EFAA 2L18A 1CEYA 4W5TA 2FN8A 4KK4A 5DGCA 4ZJPA 3N6VA 1Z2EA 1QNLA 4WWHA 5DCLA 3S99A 1RXEA 3UUGA 3DBIA 3MM4A 4N03A 3F6CA 4HNRA 4NICA 4S04A 3MMNA 4ETIA 3NNSA 2MSWA 1QKKA 3KLOA 4MYRA 5CNIA 3CG0A 4Z4EA 4RK7A 1P2FA 4PYRA 5E3JA 1JDNA 2FLKA 2JBAB 2MYTA 3H5WA 3NNNA 4MS3A 3DLBA 2CWDA 5IX8A 1LBIA 3LKBA 4N47A 2LP4Y 4FE4A 2MYPA 2PAFA 3FDFA 5D2CA 5ABPA 4KVFA 3RVQA 1ZN2A 2V0NA 3GV0A 2PE5A 2F8TA 3L49A 3Q15C 1QPZA 4KNYA 1PEYA 3LUHA 1FQWA 3HSYA 3N53A 4HNSA 1U2PA 5BR1A 3HO1A 5JS1A 3ROFA 3EQZA 2M1ZA 3H5IA 4HYEA 1SXHA 2P4UA 5CNJA 1NXVA 1QP0A 3MIZA 3SY8A 3F7NA 3JPWA 3H5TA 1QMPA 3QLVA 2M98A 3H5LA 3QELA 1E6MA 4KREA 3CRNA 3EJWA 1D1QA 3BRQA 3QLVC 3HK2A 1M2EA 5CNMA 4ZMRA 3FFXA 4RDCA 4KQCA 3OMWA 1Z17A 1D2AA 1A2OA 3MQ4A 1ZH2A 3HUTA 4GPAA 2HPHA 1RXIA 3B2NA 4RS3A 2QVCA 1JF8A 4QPJC 2R48A 4N41A 3GA5A 1E2BA 1KRXA 1Z16A 3BREA 3KYJB 3CLKA 1MB0A 3A0UA 5DLEA 3HJFA 3CG4A 3CKMA 3FFTA 4RK5A 3T8YA 1SRRA 1P8AA 4W5OA 3N0XA 1AB6A 4EYQA 2HQBA 1QQBA 2A9QA 3KS9A 4OTZA 4MRMA 8ABPA 4D6XA 1MAVA 4XQNA 4G86A 2X7XA 4MLDA 1W25A 4RWEA 5KWSA 4YO7A 3OLZA 1J56A 4XLTA 5TE9A 2JCGA 1EHCA 4MS1A 4KRFA 2ZWMA 5EWMA 2FTKE 4MS4B 1K68A 1ZHHA 1QO0D 4Q6WA 5IEBA 4W5NA 2FMHA 3IP5A 1APBA 2PUGA 1I3CA 5KC8A 4XAQA 2FMIA 1YMVA 4TN5A 2LPMA 5HSGA 3NNDA 1LBHA 1U0SY 3IPAA 1BDHA 2O20A 1RNLA 4TMYA 3LUAA 5TQ0A 4MR7B 1PHRA 1QP7A 2LBPA 4YS6A 4ZMSA 2IPNA 1Z13A 5JNVA 1JYEA 2P9HA 3QLTA 1JBEA 1NXXA 4F8JA 1JL3A 2HSGA 1EAYA 4MLCA 3OLVA 3BBLA 4S05A 3LUDA 1VKRA 2QSJA 5IUJC 1OXBB 4Z9BA 4G0QA 4MR9B 2YHAA 4EY3A 3TD9A 3KCNA 5FWXB 2H0AA 3W9SA 1GCGA 3NHZA 2IYNA 2QW1A 1P6QA 3DGEC 2LUOA 4G0ZA 4Y9TA 3C3WA 3M6MD 3RVNA 3GWGA 2OQRA 3QLUA 1JFTA 1Z12A 1WETA 2AYXA 4E7PA 2QVGA 5TPZA 2HJ9A 5TQJA 2PUDA 4MR8A 1QO0A 2TMYA 3T6KA 3HM9A 3N0WA 3QLUC 3H1FA 3I42A 4MQEB 1TM2A 4OATA 3GL9A 3C3KA 1U04A 3KHTA 3SM9A 2PKXA 1JLKA 1TLFA 3NBMA 5BQ3A 3LTEA 3CNBA 1YVUA 1M5TA 7ABPA 4LE1A 1D4ZA 4EVQA 2IPAB 2FEKA 3KYIB 3UK0A 2FKAA 4Z4GA 1Z26A 1ISRA 1DCMA 1GUDA 3I5AA 2VUHB 4L85A 4LZLA 1JDPA 2YHBA 4YV7A 4IGAA 3I45A 4RXUA 5C5CA 1BDJA 3ILYA 3LUKA 3C97A 4KV7A 4W5RA 4EGSA 1ZAYA 3OLYA 2CD7A 4Z0NA 1R8JA 2JVIA 1VPWA 1YK1A 4ML3A 5BRAA 1ZY2A 4RZSA 4Z9AA 2GX6A 1FSPA 2LIVA 3JVIA 3O74A 4M88A 3LUFA 4EUKA 5TQ2B 3RVKA 1ZGGA 1GCAA 3OLXA 1SXIA 4PEVA 5JNTA 3JTEA 3H6HA 1YIOA 3BILA 1Z2DA 3HDVA 2PL9A 2HQOA 1ABEA 1CHNA 1BA2A 2NZVG 3JY6A 4JB2A 3CZCA 4EYKA 4PE5B 5EWLA 4YLEA 3ROTA 4TLLB 1TJYA 1L5ZA 2E4YA 5GQSA 4IMJB 4KFCA 1GUBA 1USIA 5IC5A 2R47A 1NXWA 2R25B 3TX6A 1PEAA 4F11A 4P98A 3IDOA 4WXEA 4JB0A 3DZDA 4DADA 3F73A 1U8TA 3LMKA 3RVPA 2PUBA 1B00A 4O1IA 4RKQA 4RU1A 1JWLA 2IPLA 4N76A 5TPWA 1YTUA 3UKJA 1NY5A 3A0RB 2L17A 3Q7RA 3E3MA 3GBPA 5KQGA 1USGA 1JYFA 4G4KA 3O1HB 3FFWA 4UHJA 3F6PA 2PUFA 3OO1A 5GOTA 4LDZA 4MQFA 5KQPA 4YWHA 1LK0A 2R4QA 4OLAA 2GBPA 1JFVA 5IEJA 2ID7A 3O2JA 3OMXA 1PUXA 5EWJB 4RK6A 1F51E 1T34A 4YRZA 1DJMA 5JNUA 1Z18A 4G0MA 4CBVA 1DC8A 2MSKA 4UHKA 3I09A 3JPYA 4N0QA 3LUGA 1FFWA 2GI4A 3OQNA 4MGEA 4EYGA 2JBAA 1HEYA 1PNTA 4G97A 4YCSA 4G0OA 4Z4IA 2QR3A 4KQ9A 1NXTA 1ZITA 3T38A 4G0PA 2IPMA 2H3HA 1DCFA 3EQ2A 5DKFA 4OLBA 3RVJA 1LJUA 1JHZA 2BGGA 3M9WA 4FE7A 3MYYA 1EWKA 5I4CA 1JFSA 4KPYA 2I6FA 5IBQA 1ABFA 5FWYB 1L5YA 4NQRA 3H5OA 4E7OA 5HM6A 2QV0A 3CHYA 5HQJA 5KI6A 5BRJA 2J48A 3C6QA 2IOYA 1DG9A 3HS3A 3CFYA 2WJWA 3P9YA 4RXMA 3FMVA 2PUCA 3DLHA 3H75A 3R0JA 1TVMA 3H6GA 1QQAA 2L2QA 4JP1A 4WXMA 1KRWA 1K66A 1AB5A 1MB3A 3MA0A 3T95A 1D1PA 3OQMA 1NXPA 1XHFA 2WB4A 3LUJA 3O21A 2JRLA 3TO5A 4LRQA 4PZ0A 2GWRA 4XXEA 4N0PA 1GLGA 3G1WA 1YS7A 4KMRA 4MS3B 4OBBA 5C5EA 3HEBA 1C0EA 1MVOA 4OG2A 1YMUA 1H9CA 3GRCA 1DZ3A 3CTPA 3IP9A 4EVRA 1EWTA 2B4AA 5KC9A 5JNSA 2E4VA 3BRSA 3EAFA 1DC7A 3SAJA 3MF4A 2WY2D 2RJOA 3HCWA
chains in the Genus database with same CATH superfamily
1KFCB 3R5SA 3H6MA 1BDIA 1XWFA 3COYA 5DP1A 1G9XA 2AQHA 4YUVA 1Z7YA 3AMVA 5EL0A 1G60A 2FPKA 1DNPA 4K8IA 3EA0A 2NP7A 5D7NA 3I91A 1V0JA 2PEYA 4BO2A 4KJNA 1AXGA 5GONB 3M1AA 4D57A 5JJBA 4TSKA 3UJ7A 3WMEA 5KNDH 3K92A 1XBTA 3HEJA 1GUSA 4MR9A 3UJ3X 4B80A 3BH6A 3GAFA 5AHWA 1ZKOA 2YWBA 4Y1GA 5T7BA 3P5SA 4F04A 2E7ZA 2WJAA 1N8SA 3G5MA 1A5TA 3ORSA 4D4JA 1PJQA 5IGGA 3L40A 2PKEA 3H2IA 2VF7A 5IARA 3C3EA 3EHDA 2Y1DA 3E27A 5EAIA 4MVJE 1Q0SA 2EQBA 1Q6YA 1MRZA 2GR9A 2W0MA 2XR1A 3SIRA 1KAOA 2FSIA 3OX4A 1KIFA 4EUEA 1FE8A 1TX4B 5KYYB 4D46A 2M6SA 4UE2A 2I5LX 1WCWA 2N0SA 1RAHA 3TQFA 4TSSA 3BERA 3KPJA 4Z8XA 1D1KA 1CYEA 1MO3A 1C7QA 1NU6A 2RGGA 4OVKA 4JVLA 3H8WA 5IDVA 5EWJA 3QB3A 1M7HA 2RHSB 1QH8B 3QMVA 2C31A 2KHSA 2OZLB 4D8UA 3DEPA 3A1UA 2V8BA 4NJMB 1KDCA 3MRTA 4CIAA 2V8OA 1Q92A 1WLYA 5BT8A 4KGZA 1Z7EA 1QK4A 2Z56A 1T5TA 1LM0A 1ZNZA 4QEZA 1Z4LA 3QYJA 4LF4Q 1AZPA 3EDQA 1CQIA 5H3LA 4OQPA 1JILA 3MM4A 1FF9A 2F3IA 4M1MA 3WRYA 3I04A 3CF6R 4O4IB 1YQWA 1D5MC 1O7LA 4BX2A 3W7VA 3FKSD 1ZG3A 3R44A 3WB9A 4PG6A 2BMJA 4BVLA 3UAXA 1PWHA 1EA7A 2FPXA 1E79D 2R7ZG 5T6BA 3UFBA 3RT9A 3TRZA 5D14A 4BP8A 4U8HA 5CFNA 4J2HA 1FJXA 3ANNA 4BMYA 2AG5A 2W7TA 2WYUA 3SR4A 2Q8RE 4Q9IA 1ZZGA 3LDAA 2H1HA 4NZMA 3JTMA 3F2VA 4RTKA 2QTFA 4H02A 1WTQA 3NNDA 3QOJA 4EJ2A 2DYKA 2G8NA 3H09A 1PHRA 2LBPA 5A9RA 4CMIB 1X7WB 1WDTA 4PCUA 2VHZA 4QHSA 2OVBA 2VJAA 4B3ML 5JSUA 3FMGA 3C8MA 2ZYUX 3KUKA 4XKJA 2AA3A 2HZBA 3B78A 4F2PA 8MHTA 3JZAA 3ANLA 3LVBA 3UH1A 4EAQA 1R9GA 3AUFA 3HZZA 1U7UA 1D4ZA 3EMDA 4ZAXA 4O33A 4Z4GA 3DLAA 3V7WA 3TQTA 1YNJD 4UDYX 5BQXA 3OBBA 1THZA 2CL5A 4LMBA 2C5GA 4KYUA 2JGEA 1TAUA 1RD4A 3J7AV 1AD2A 4JI1L 3SX0A 3RUAA 3UYKA 1Z4NA 4MWTA 3FGOA 1Z2DA 3A55A 1SBHA 2WZBA 2D1TA 4OAQA 3CW2C 2GPNA 1JI0A 4R7ZA 2OEOA 1G6PA 3AINA 3I4NB 4O0LA 2YMQA 1KU6A 3C98A 4B3SQ 1JWLA 4LTMA 1T8SA 4B87A 4C04A 2PZAA 5IZ4A 1EP2B 3UANA 4RABA 5LZ2A 3W9BA 4Y2TA 3FVRA 3MGGA 1QB7A 4MVJI 4DC1A 1SXJC 1YQXA 4BV8A 1ZM7A 3KD3A 1TEHA 3FWNA 5K4GA 1LJUA 3CX8A 1GARA 1RJ9A 2HA4A 3F8SA 4C7JA 2XRFA 3PDIB 1I10A 4L5RC 2VBCA 1JU4A 4WBXC 4MZXA 3PZBA 4JV5Q 4WXMA 4GP7A 2LKDA 3CNOA 3BB3A 3BJMA 1XVVA 3PGZA 5M3FB 3DFUA 4GWGA 3MZ5A 1PGOA 1H05A 2WY2D 3L0YA 4GWLA 1PZXA 1ZMOA 2QGNA 4G1MB 3QEJA 5KYGA 3AB7A 4GI1A 1RWNA 3SBOA 2PT9A 5TARA 3C3XA 4J0QA 2GN2A 3R0ZA 3HBAA 1OROA 3GQBB 1UDCA 2IX9A 2BR3A 2PJDA 1Z4JA 3DOCA 5DIFA 3WGZA 3OUUA 2ANBA 3OOJA 4RK1A 3DBHA 1SLJA 3TTYA 2OFPA 1QWYA 3EF1A 1ZP6A 5F1YA 1K7SN 3L82B 5C3XA 1L1OC 3TQHA 4DXHA 1AIPA 2D7JA 3KJHA 3I2GA 4CJ1B 3IAHA 4YRFA 2ODTX 1MJCA 3PF4A 4WKOA 4GC5A 4M0PA 3JWHA 5AI9A 5CXUA 2ZPUA 2JD1A 2XVSA 1OBOA 5AKYA 1QAMA 4HHEA 3TIGA 3P4UA 4K8OA 1ATIA 2NQ2C 3WICA 2C5AA 2J31A 4EZBA 4Q9JA 2OUIA 1VLVA 3I1YA 3G48A 3RKSA 2HJWA 3AUKA 5JY6A 2QX4A 4CLXA 4Q5IA 5FHQA 4I1PA 3VNQA 4FSDA 1DJPA 1GRNA 5JI3E 3VR0A 2DEUA 3N52A 2R8OA 5J22A 3G8YA 1L4YA 3SNKA 4LXXA 3IP6A 3M4ZA 3OSZA 1EFVB 3UW1A 4DV3B 3WY9A 4YHHQ 3IOCA 1IHUA 1AE1A 2NTEA 4H1TA 4TLDA 3R3UA 2ZJRA 3FA2A 3GYGA 4TGLA 4CE6A 4LJ5A 4LF8Q 1EK6A 4LF7L 3PA6A 3VR6D 5J4LA 4B9WA 2Z4HA 1LTLA 2H7CA 2VK8A 4HZUB 1DU4A 1TNDA 4MIUA 1KOJA 1D2CA 3TPCA 3DCNA 2OHGA 4U6SA 1DGSA 2XBLA 5D2CA 2J3QA 2V0NA 1SVOA 1HZ9A 2WT9A 1U2SA 2NXCA 1SG9A 3ZGXA 4E21A 3BKXA 1K9MC 3FB4A 1SB8A 4KQCA 1BJTA 4Y7DA 3RLIA 2OCYC 3IUSA 1YQQA 3AUYA 3RS8A 5IT9E 2O0JA 5LZ8A 1JQDA 5HXAA 2BKXA 3DYBA 3P2MA 4OQDA 1W75A 3GOQA 4W8HA 1D8AA 4BO9A 5H80A 1LK7A 3TLEA 2FTKE 4BNNA 1DX6A 5B7QA 3LNNA 3GEHA 5CU7A 4BEBA 3FMCA 4JI8Q 3GRRA 3I4CA 1P62B 4D96A 4UEQA 2RKOA 5SICE 4TOIA 5IMBA 1C3JA 4OXXA 1ARZA 2G17A 3OWFA 4I9UA 1XLVA 2DUNA 5AK0A 1FXUA 2H4FA 4OEHA 5B2FA 5JRZA 3THRA 1LT6D 1NHGA 1W4ZA 2C88A 1PTKA 3GLKA 1LPOA 3R77A 2PCJA 2IT1A 3IEMA 3HFSA 4R69A 2WJPA 2PI2A 3KQPA 4N3AA 5IRCD 2Q1SA 2JVIA 4E12A 4A3EG 1PTOC 4ZVQA 3P9RA 2A6HD 4OP1A 3G88A 4YP6A 5KTKA 1IM5A 5JEEA 5LCXA 2WFWA 2ZYTX 2H4ZA 1GSAA 4ZHQB 5CLHA 3TZBA 5BXQC 1F3OA 3ZWBA 1USGA 2PBLA 2BH2A 4XD2A 4H6WA 3OEHD 2ZBQA 5A0VA 4XEHA 3M3DA 1NBMA 3QV1A 1DWQA 1YI0A 4GO1A 4PC7A 1G7CA 1HLDA 1JQJC 1SYEA 3KUDA 1VKOA 3I61A 1VQ6A 5D3IB 1OE0A 4QRDA 4G0PA 1MMFB 1T4MA 2EIHA 3AFQA 4BE7B 5HVNA 2P6UA 4LDQA 4F9EA 5IWAQ 5C44G 4GKVA 2QNBA 2Z58A 1AKTA 1CIPA 4EA6A 2YVUA 2PIDA 5EIEA 4J91A 3AVOA 4K9PA 1EUYA 2N3SA 1RL2A 1KH2A 1AO0A 1KDTA 2G04A 4D8VA 4U0JA 2DWUA 4CMKA 2QMZA 5HFNA 3WRXC 4LBZA 1G51A 3A6JA 2WLSA 4DV6Q 5IULC 1QE5A 4WJLA 4LF5B 3VDMA 4XOUA 1C48A 1RI3A 2H4JA 4IHKA 4NYJR 5DCYA 2QN9A 1EHIA 4IF4A 5DGXA 1LD3A 1AUXA 4R9WA 2F43B 3SE0A 1OREA 2EYOA 4G1FA 1DQPA 5T1IA 2Q2VA 3N75A 2GHTA 5DCWA 2CXPA 3CM0A 1T8RA 3SN6A 4B7UA 2BFEB 3DEHA 3K1AB 4ZC1A 4QATA 1Y5RA 2PX6A 1G2SA 3THWA 4RORA 1N57A 1ZYRD 3LUCA 1YBMA 3WNZA 1E3TA 4LMPA 5IT9L 1N2OA 1AKNA 1CZNA 2CK3A 1UPTA 2VJCA 2GBFA 3KT0A 3RRYA 1T25A 2ZXRA 1U1EA 1ZGJA 3BVZA 1RYBA 4XASA 2QMEA 4UASA 1KEUA 2IYAA 1VB5A 5HIJA 3V1NA 3NUZA 5F51A 1KAMA 1OI2A 1O8CA 3DFMA 2DECA 2PYZA 4JUBA 1MDBA 1O57A 2PU5A 2P3SA 3RBZA 3FTFA 1G19A 4D4IA 4IOCA 2P0YA 2DUWA 1LPMA 4WXHA 4DCUA 5KWVA 1RYFA 1JJFA 2HXGA 1G8FA 2XSCA 2FEPA 2ZRAA 1YCGA 1HH2P 1XEXA 4UEOA 4J29A 5IKPA 4AJ4A 3SDSA 4FX2A 4UBIA 2UZIR 2NQ8A 3ZHVA 3X3MA 4JJ7A 3I6IA 3Q7QA 3LHSA 2ZROA 2PAFA 4GI2A 3KWJA 3SC6A 2VP2A 3LUHA 4QYTA 1JHDA 2ALJA 3K71B 1XZGA 4RQUA 4MQMA 5DTQA 3T7KA 3U4ZA 2IU3A 2HC9A 2V58A 4WK4B 2QQEA 5AKXA 4U00A 4PC6A 2QL9A 1K3TA 1G2OA 1PRYA 4C29A 1B41A 2BJHA 5DP2A 2P9EA 3KM0A 4PG3A 3LKZA 2CDRA 3NGMA 3GP8A 5EPOA 3I64A 2XTJA 1OXTA 4RY2A 1F17A 3WK5A 1ZMRA 4ZI7A 5IU6A 1VC2A 5CH5A 4DNTB 2R1VB 5T1GA 2X13A 1QPBA 3K5MA 3W9SA 4R31A 3B3FA 4B3BA 4DC9A 2R3SA 1N4DA 4B6FA 2VZ8A 1YJWA 4EGJA 1KAQA 4B34A 2H4XA 2V4DA 1CUAA 5IJAA 5K7SA 2EZUA 2HTFA 1E4EA 1PZJD 3QU5A 1R4AA 4ZAIA 1C4QA 1NI4B 3GUCA 1ZVMA 1J07A 4BFSA 3MJEA 3NHYA 4C4XA 4L5AA 1OZ0A 4CMEC 3JQ9A 3Q8XB 3RVKA 1GT6A 3L04A 3VKWA 1I8TA 2ZIFA 2VB2X 1WTOA 2QP9X 3GLGE 3CV3A 2WF6A 2EYQA 4U3JB 1YE8A 3KXIA 2RHRA 2YQ4A 3GEDA 3ZG6A 4QGBA 4JBYA 1KZ7B 3CX7A 3L8YA 3O90A 4CN9A 4E1VA 2GCEA 5KQPA 2P8JA 1N5LA 4NH0A 2ID7A 4Q82A 1SVNA 1ZH0A 1RP1A 5J2TB 3GFSA 1RKQA 1Q3KA 4KNWA 2JQOA 2NN6I 1RWOA 1X7GA 4RW0A 1MOPA 1KIAA 2OFWA 5DHQA 4J43A 4G1EB 2J6IA 4KQEA 4P3KA 4WFKA 2EZ4A 3NHUA 5HQJA 3DFKA 2BONA 1CSEE 2EYUA 4LKOA 2X8WA 4JP1A 1PRTC 2F2TA 3MD0A 2VQFQ 5H02A 4XSHA 1XNRQ 2E8GA 4J1MA 3QGMA 2YV1A 1I0ZA 3IV6A 1TTHA 5LLTA 1GLGA 2RGBA 3KQLA 3W7BA 3ABRB 3TW6A 1VG0B 5LD2B 5EXDA 2B4AA 3DBLB 3MWDB 2JI6A 1XDUA 1WOMA 2Q8TA 4MCJA 1RF2D 3K0CA 2KEDA 1YRHA 3FTPA 1L1QA 4MRSA 2PUAA 2DUDA 2GJAA 5AFSA 2CFSA 1O03A 2EDAA 3WGHA 3K9WA 1K88A 1A4UA 1WLSA 2CUNA 3AM3A 2P5YA 3JS5A 3P0EA 3D4BA 5GY7A 1UOEA 3M9BA 4WNAA 2PZTA 4ZI7F 5FL7A 2AN3A 4JBKA 1Z8NA 4TUYA 5GAEC 2W48A 3P9CA 3WIBA 2Y1WA 3EEOA 5DHRA 1DQRA 1W85A 2JA7G 1PWYE 4WJWA 4MA5A 4OHKA 2HT1A 3A58B 2W43A 3NT4A 2RHCA 4W6QA 4C5BA 2MOKA 1BQQT 1CIVA 1RXSA 1LI4A 3O93A 1E32A 1QYDA 2VUMG 4M1KA 3ENQA 3KOJA 1GV0A 1RWWA 5KREA 4OJYA 4ZEVA 3JQFC 4I66A 4BEJA 1O54A 3PQ3A 1S1CA 3WGUA 4LF6L 1QRAA 4PPGA 3BT7A 3AESB 2ZR7A 1G3RA 3COVA 3KHSA 3NBQA 3WZ2A 4C3HB 4RGQA 1HNXB 1Y81A 3EZ7A 3E70C 1U7OA 3GEGA 2O2LD 3IFSA 3O8QA 3AV0B 1WF3A 4JLVA 5JYEA 1L1EA 5JFGA 3RVDA 1V45E 3RVRA 2A5JA 1JVNA 1J2EA 1PAUA 4AKGA 2IIPA 2W6IA 4Q1EA 2C7GA 1CWUA 1E7QA 1FFCA 2I4MA 4BV9A 4CDRA 4BQPA 2XTAA 4EYOA 5EE9A 5JC8A 1G8HA 1VBKA 2CXQA 4ZT4A 4O1NA 1X7HA 1LBTA 1I80A 2OO7A 1V16A 3E5HA 3U49A 4PZZA 3G49A 1X1SA 1SCAA 3OQPA 2YWHA 3GVHA 3F49S 2VNAA 2J0EA 1M6NA 5CVDA 2ZJ3A 9ATCA 4OH1A 2BGJA 5CX1A 3P19A 4RD3A 4L07A 3VYRA 4UPAA 3HKCA 1JDBC 2BFWA 3TRDA 4IJQA 3SBEA 4IS3A 1JZTA 4CKWA 4HNSA 3R6TA 4CKBA 1GZUA 1MD9A 4HYEA 4KGVA 5DAUA 3I6MA 1UK9A 2OV6A 4WLFA 2CXXA 4BFLA 4KXMA 2FYTA 4JHLA 3A9RA 2YJNA 4ABTA 1JICA 2RK4A 3AERB 4AO7A 4W9RA 1UE5A 1CKEA 1CY1A 3OEYA 2W2OA 3ADOA 4V3BA 3AFGA 2V96A 2XRMA 1NBEA 3T12A 1G6OA 1C3LA 4MLDA 3QWNA 2K7ZA 5LYYA 1EZ8A 1A95A 1IULA 2FSVA 2W2KB 5ALEA 4TUYF 4QBFA 3FZQA 3C24A 2OZVA 4B79A 5G3LD 8LDHA 5E8RA 4HR7B 3NOVA 3K0AB 3J7ZC 1QP7A 4X62L 3DMPA 2RGWA 3FAKA 3BZDB 4OX9Q 4NARA 3LUDA 1Q22A 3E9IA 1DOZA 3HYSA 4JP3A 4R2HA 3MEFA 2ZRLA 4PYOA 4LVUA 2DOKA 4RH1A 4D56A 1WTCA 2JBWA 4PBTA 1GTRA 2AKWB 3G02A 2VDJA 3UIEA 5GQOA 5I9TA 3R9IA 2WSSA 1WA5A 1X3GA 4IGAA 1MORA 3JQQA 3CONA 1IZ6A 3CLSC 1LTTD 1IEQA 4D9MA 5JWHA 1U4MA 3H0GG 4HWOA 4DFDA 3FTNA 5LKRA 2PL9A 5T67A 5HS6A 4OBWA 1ZI8A 2DY8A 1V4VA 3W2GA 1Y37A 1E4OA 5T3UA 2IE8A 1PQYA 2QAJA 3LMKA 3W34A 5G0UA 3A0RB 3SHQA 1TQ2A 2WJJA 3UJAA 3M8KA 5AJXA 2J67A 3VR4H 3PCTA 1NE7A 3OURA 3WQSB 4ZJZA 1KJWA 4RF5A 3SGIA 1UIRA 4L3VA 2E2JB 3DDOA 1YJ9A 2MSKA 4I7ZC 4XJVA 3Q8WA 1U3TA 2O2DA 4MV1A 4WERA 1JIUA 4COOA 1Y6ZA 2BHNA 2VP4A 4QDTA 3L6DA 1GHTA 1R37A 2DR2A 1GUGA 5AW9A 3FDXA 4NZYA 2JGNA 3LHFA 4NG4A 1RQNA 4P5DA 2PZFA 2GN4A 1VMIA 1GJRA 4PRKA 3AQ4A 3KPYA 1AN9A 4CKZA 4JFAA 1NU8A 3PSIA 2VDWB 5C5EA 1CQVA 3W2FA 1FP2A 1Z34A 2O2IA 2KA7A 2NVUB 1FU8A 3SQLA 3U80A 3HYTA 2ZE7A 4TTJA 5ALWA 4CFYA 4HBGA 4YPFA 4C2UA 2L11A 3SC4A 1AC5A 2WABA 2FPIB 4FT2A 4NBTA 3OTOL 4YYEA 1JFLA 2GTPA 2DQZA 4FW8A 1I3QH 4YALA 2LVBA 4Q0FA 1VQKA 1L7EA 4V0BA 5JH7A 1UJBA 2VQDA 3L0DA 4RPLA 3OZSA 4CR8A 1IXZA 4EUSA 5J9FA 3CKLA 3UQZA 4DM4A 1Z7TA 4C30A 5ELBA 1Y42X 2R5NA 3OOCA 4GVXA 1A97A 4KE8A 3PHGA 5CEJA 4JL8A 3S1MB 5CFLA 3K8ZA 3I8XA 4EJMA 1PH5A 3G0CA 3EUFA 3MUOA 2RGUA 4XSGA 4GOPB 5HZMA 3RRFA 1RI1A 5KYUB 1SRUA 2ACEA 1P9WA 4B17A 5CDFA 2B2NA 3T1HB 2C3YA 2QJWA 4OWXB 3AT1A 4BATA 2J08A 1XWEA 1BUVT 3TPFA 3KZCA 1HOXA 2B3TA 5C8ZA 1Q1EA 1RD9D 1E9EA 1XZBA 1JQLB 2IL1A 2YU9H 4K81B 1Q21A 5BYKA 2HK7A 2C98A 1YNND 4A6EA 1UJ6A 4M9RA 4P82A 3WAKA 1K3BC 4JXKA 1ZKDA 1Y1KE 5CBPB 4BNDA 4NU8X 3WHPA 3OSUA 4IFDG 5KIAA 4RCOA 2NTVA 1UEAB 3ZX5A 2H1EA 1KDVA 1O94A 4LBWA 2ZCUA 2FZ4A 3N5KA 1Y1WH 2IWRA 3Q4GA 3O8CA 1BHQ1 4DR1Q 2FN4A 4FFSA 1QRDA 4JVNA 2H06A 4MUIA 1MB9A 5TLSA 4E14A 3IEPA 1O87A 4D80A 2YY6A 4TQUS 2ZB3A 5CCDA 1GTL1 1NMGA 4J0IA 4YDSA 4N03A 3F6CA 1GSHA 3R4VA 4ETIA 3K9FC 4FHFA 1GM5A 5BN4A 1XXHA 4JLJA 2R8ZA 5GWXA 1GTJ1 4RV9A 2FHTA 2F4IA 1QZHA 2IUYA 2DR3A 5D3QA 3H5IA 4HRXA 4KXFB 3H87A 3NORA 2LWIA 3K70B 5B1HA 5A4JA 2IS6A 1YI2A 4JYAQ 1RPTA 2XVZA 5AVTA 2J1LA 2NSHA 5HX7A 5JH7F 1QIDA 1KHIA 3I9FA 1G5RA 4MITA 1EUQA 3ASVA 2IEZA 1N7IA 1DG3A 4RLQA 3AC0A 1YUNA 2GJKA 5DX8A 1EESA 5C4IA 4Q1FA 1K8YB 3STBD 1WHTB 4PC3A 4K6OA 3EQ6A 4DNOA 2DWQA 4C7MA 3MJ4A 1Q7RA 5MN5A 1O9BA 4D8YA 3Q8DA 4ITUA 2D9UA 3NTUA 4EDFA 3NCHA 1K0UA 4WLUA 2QM7A 3C7CB 2ERXA 1CY8A 5BQ3A 5D3DA 1R6BX 1N9WA 4Z3OA 5DDIP 5D01A 2I2BA 1NY4A 5C5CA 3CLUD 1TW3A 1L4MA 2XGSA 3VR5H 4MWEA 2PHZA 3K5WA 5JZSA 1OGYA 5E4YA 1S1MA 1BA2A 1NVVQ 2XRYA 4L6IA 3OT4A 5U4QA 3UJDA 1WDWB 5DGHA 4OIJA 4U2BA 4RA6B 2QUKA 4UAIA 5CM8B 3D3WA 1JAXA 4BAZA 2FA9A 3NYQA 5CB4A 5KQGA 4BNGA 1WIWA 4PWYA 3WL4A 5BUZA 3N8GA 1U1IA 1ZUD1 3LPAA 3U26A 5C4GB 1YASA 5KOYA 2DY0A 4D02A 2CJYA 2K75A 3SZ3A 4LJZC 3A4LA 3HCPA 2BFDA 1N1GA 1VPVA 2RHGB 3VAYA 3Q8KA 2EHJA 4RNCA 3QQPA 4BS9A 3C3PA 1CJUC 4DC0A 1E3IA 1RRFA 5I5EA 2BM8A 4BDTA 3ZBUA 4ZK2A 5A1TA 2QOEA 4Y18A 2XT9A 2XD4A 4OO1G 3JQGB 4NONA 5KU1A 1BO6A 2BGIA 3MF4A 4LOIA 1WUTA 1J70A 5P8WA 2QI9C 2D8MA 1MPXA 2WAQG 3B60A 5IT9c 2QTVB 3AILA 2IX0A 3LC2O 5BVGB 1ND6A 1VLHA 4FNFA 1X9HA 2OB1A 3I37X 5D1NA 5D65A 2GBIA 3DEIA 1YNOA 3SX2A 2FJ0A 1ENZA 4B3JA 1D2EA 4B71A 2R2AA 4DIDA 3FY4A 1S7CA 3GIWA 2IS2A 3F96A 4CQLB 4ND8A 5BOSB 2GRAA 3Q98A 3WJ2A 2UUPA 3AXSA 2XLBA 4XPIB 1ISPA 1SBNE 1R00A 1JXQA 3OP4A 5AW4A 1G18A 3ULJA 3HSSA 4JKOA 5BYBA 1FYFA 5CVTA 3TLYA 4CL3A 3HKZE 2FCRA 1DOLA 1QAQA 1SOMA 1C1XA 2QT1A 4TKMA 2DFPA 1DIBA 4YI5A 2WI8A 4LX8A 3L8FA 3DOUA 1FMCA 2B5VA 5DJ5A 3R7NA 2VYQA 2V54A 5C4HA 2H5XA 2C5HA 4DYHA 5C9ZA 1DEHA 4EMUA 1F3LA 5B6IA 4IIFA 1A6XA 3NBKA 3G13A 4IUNA 2QRVB 1E66A 1UKBA 3ZHOA 1NFFA 3WTBA 1T15A 1W8IA 4CDEC 3LXMA 2PGIA 3ZN2A 1PTOH 3NCTA 3EXHA 3ETGA 4QJIA 4ETMA 3BN3A 4KSBA 2O5VA 2PUEA 5CB4F 2IXEA 4E3WA 4KN6A 1R4ZA 2FZLA 4BB9A 2ORED 4L16A 1BRTA 3S1RB 1A9RA 3OI7A 1WXFA 1USWA 2Y9MB 4N0DA 5I9BA 3RT7A 3I83A 3AM1A 2GCPA 3E03A 4WQMA 3VNAA 4R1QA 5TJHA 3ZV3A 3I5MA 3MJDA 1ZJ5A 3MXTA 2XXBA 1O7ZA 1UBNA 1LT5D 1EL0A 4Q9AA 1HTTA 1SYFA 4GOJA 1BN6A 4J4TA 1KI8A 2JDIA 2OBLA 3LX4A 1JDTA 4BNIA 3V8EA 1WD0A 5FHRA 1VZ3A 2ZVDA 1Z06A 1M1YE 5EXSA 2VC2B 3SYKA 1RKBA 3H5TA 4D4HA 4DNQA 1NSFA 2CJWB 4A8JC 1N8RC 1U1DA 2B63G 2XYQA 1NTOA 2QS9A 1JLMA 1FTSA 1Z6XA 5BMVB 2DNCA 1X7ZA 5AO9A 4JBJA 2BA0A 2XUQA 4WOCA 2RH9B 4JX9A 3MELA 1BRMA 3IKJA 1KVQA 3CKMA 4GLXA 5AM3A 3GTLB 3VX3A 3KEGA 2VPPA 5BR4A 1T5XD 1YRYE 1MENA 4F6CA 4XLTA 3CZ4A 1Y8AA 1T43A 4HJRA 1Z47A 2OO5C 4MYUA 1SUIA 3EY4A 3ZWYA 4RQTA 4WMLA 5EIHA 1P1HA 2PN1A 3EJIA 1EAYA 1DOHA 1WUKS 2D1FA 5A9TA 4HADA 3BGVA 3HVKA 3UPTA 1HA3A 1ZK3A 2ZM5A 3VYSA 3S3TA 3PS9A 5JZMA 1YHQA 3GLVA 3FWZA 1CY2A 4RL4A 4CM5A 4A2PA 1JAZA 5ILOA 1IU9A 5DRTA 1P77A 4B7ZA 2C3UA 1WFQA 3QNMA 1E59A 1TMGE 3BMQB 1HYEA 1FNSA 2WJ6A 3CSUA 1VCMA 1ISRA 1N5DA 5FPKA 3HOVB 4JI7Q 2ZE8A 1UPCA 3GEPA 2C04A 2L15A 4Q7KA 3FUUA 3VZRA 1YI8A 1FGBD 1CR4A 1VL5A 2GYYA 1GAEO 3E58A 1B50A 4KFCA 2NVQB 4C3VA 3EC2A 2CXHA 1CUUA 3QE0A 5EMKA 1H8EA 1HR0B 1Q77A 3U0BA 2D0PB 2E3JA 2P2GA 2E2IB 9GPBA 5GZ1A 4BNLA 2LGJA 1VQDA 3UWDA 3U81A 1SA0A 5C32A 1OI4A 1I4QA 1IB0A 4RIFA 2OBBA 1XRSB 4LVCA 1CP3A 3NQTA 4QJ4A 2O5CA 4A27A 3PNPA 1E2GA 3GLIB 2RGEA 721PA 2P67A 4E5NA 2QVYX 2DP4E 3QVUA 1ZU4A 4P8RA 2WU1A 3M34A 4G7OC 4U7HA 5LZ5A 3TOXA 4LOLA 1U28A 2DQYA 3SS9X 4CNBA 4J0HA 5EN4A 1H9SB 2VJKA 3UB2A 4R1OA 2DHEA 3WSWA 1FQJA 5B3JA 4LXQA 4RJKA 3FRIA 3EUEA 2YJZA 3OCCA 4NCAA 4FGZA 1V9SA 1PJRA 2G28A 4GM4A 4NTZA 4KR6A 4AL4A 3MUFA 2OCKA 2ZYSA 3BBPA 4EW2A 3HY3A 1PFMA 1ZXBA 4L50A 1SPBS 4RGTA 2R2GA 1TUBB 5BYAA 1JAHA 2G5DA 1V96A 4HDSB 2ONZA 1K28A 1G21A 4LG1A 3T35A 2JD2A 4PAMA 3QBEA 5ARBA 2RMKA 3RZDH 1RACA 5AYVA 3KTOA 3LQRA 2ONKA 2BLLA 1SOWA 4Q4LA 3RJMA 1EDBA 3B3QA 3DF7A 5ADVA 3TCXB 2DU8A 2Q41A 4E07A 2GESA 3T5MA 3PV0A 5BN3A 2VRCD 2NXEA 1A5AB 4R0NA 4M3NA 3IULA 1MEJA 4G6ZA 2MDTA 2A9PA 3S2ZA 4I5GA 3OZUA 3RF6A 1BAPA 4BBJA 1OLXB 1R9TH 1CB0A 4Q4AB 4JI4Q 2J9XB 1KZYC 5AJHA 2Y1FA 1KYYA 4UCXA 3PNOA 1KFEB 3U7QB 3UDXA 2X8JB 1F5NA 3TX2A 3L6UA 1TWHB 1CVRA 4B32A 4G8DA 1QS0B 2QRPA 4UVHA 4O02B 4KQMA 3ICOA 5KYWB 4OMUA 3LRPA 3IKMB 3JAME 2FR8C 4HPXB 3KUUA 3PGXA 5JS2A 2XDQB 3B7WA 1REQB 1EXDA 4L0CA 4A0RA 2FCAA 3D7KA 2E4ZA 5AW1A 3VUFA 4TS9A 2V6IA 4IV8A 3CYFA 4XQQA 2F0GA 4JX8A 4BL5A 4GG1A 5DGCA 4JLPA 4WWHA 5KTMA 1SCJA 4KGXA 3PT9A 2JJQA 1KP2A 3N2IA 2JGDB 4NICA 1KO7A 4A3GH 2VQEQ 3NNSA 2AG8A 1C3VA 1OYOA 1NWCA 2JH8A 4US2R 2GJSA 3HTXA 4N47A 3GLFB 2WINB 2F6RA 2H1IA 3UK1A 3MRVA 1S6YA 4HH1A 1JBQA 4UTXA 5JVDA 4NOMA 3VH2A 4YAWA 3X2FA 4OB7A 1WB6A 3D6WA 3LBNA 4PS0A 1II8B 3HK2A 1WW2A 4CM4A 1N36L 3CO0S 2BBWA 3ILVA 4QX6A 3S2EA 1C8BA 3TBHA 3ZWPA 4HDMB 4KO2S 5HZKA 2V3WA 5DLEA 2EX1A 1VIVA 4ND2A 4O0AA 3INRA 1RMTA 1I9CA 1XKXA 3F4LA 1Y9DA 1F9SA 3K9LA 2Q9BA 3KZKA 5DI9A 1FY2A 2A78A 4EKNB 1JJ2A 3U1BA 1T8UA 3FJYA 5SZHB 4OU4A 2QN1A 2O20A 4KN8A 4B35A 3GG9A 2X7JA 4FZRA 4MGIR 1FUYB 1UBFA 4DA4A 3OLVA 4O8CA 2J32A 5FWXB 1L1FA 5EHNA 4YV1A 3EGIA 2B4QA 2IXAA 1OV4A 4KXNA 4Q3BA 3T06B 4A3BH 4KXLA 2PWPA 2FWPA 2K4MA 3KWMA 4ZIRB 4RLFA 2BKEA 3WP1B 3PO3H 4CUKA 3T0GA 1AZQA 4DWOA 5LB2A 3ETHA 1NA5A 3MTJA 3KDSE 2ACVA 4EGSA 1TGVA 3UN1A 1K8QA 4LY3A 3LUFA 4C21A 1H2ZA 3PVSA 4TKUB 4M87A 2DCMA 4JB2A 1RAGA 1L5ZA 2JIDA 2QXUA 1DQZA 1XUOA 1FSSA 3PHIA 1JEQA 1NXWA 1D7OA 1K5PA 3GJZA 3KBBA 1YCFA 2H2WA 1BCPC 4BA1I 1VSUA 4WI1A 2WIFA 1V8FA 1LKZA 4AJNA 2V1UA 3UFXA 4G0OA 3MWEB 3V4PB 2X9VA 5H82A 2QYSA 1JHZA 2QSZA 3I28A 1XPRA 1Q2UA 4Z0HO 2BRUA 4HQ0A 5FF9A 1QIEA 4ZAVA 5GGXA 3FNQA 2H7XA 5DOZA 5JVDF 1U3DA 3BEOA 4TQAA 1IBSA 2VPIA 2EERA 1NLMA 1YD7A 3R9KA 4IJ5A 4KY6A 3QVKA 2A0YA 1K86A 3PC8A 4OGFA 2I9PA 5JXGA 1H5QA 2JEYA 4PTLA 5L4LA 1XFDA 4C14A 4QQNA 4BYMA 1M2OB 4TTTS 5CEEA 2GTIA 2GFIA 4GWKA 3KU4A 1MO2A 4JPBW 3RODA 1GPDG 1T0UA 2O8DA 1VSBA 1GAJA 2WWGA 4JP8A 4YMHA 1P2SA 5LL6X 1GXDC 3D8TA 1PIWA 1RBZA 1VLZA 4MR7A 2CHBD 3BH7A 3KJXA 1JECA 2VK4A 2GVNA 4I6JA 5BSUA 3LYUA 2I07B 1X3PA 1OHHD 1M74A 1MO5A 2Y2UA 2KYRA 1V5IA 2R6CA 4B85A 1OWMA 3KQUA 2BMWA 2O4CA 3WLMA 3HGMA 4UBOA 1CUHA 1NC3A 1N5RA 3KOXA 4H7HA 5BSMA 1E5XA 4Q3OA 2Z09A 2BJVA 3LWUA 1UAPA 2ZAOA 3S0JA 5I6WA 2CBXA 3JYHA 3KT6A 3KOZA 1O7JA 4D8WA 1COWA 5EIOA 3DA8A 2ZBFA 3S1AB 1Z5VA 3GRVA 1SJ9A 3M1IA 3NT2A 2NTJA 2YWJA 1DC6A 2NT4A 4J8PA 3HVRA 5CURA 4DSAA 2V7QA 4KHPB 3PWKA 3WV4A 4CPDA 3A1SA 1FR3A 4LNAA 1IOLA 4IUVA 4X66B 3OVMA 4PYIA 4KP7A 4WSOA 1OPRA 4XRGA 1I6HH 3UAOA 5CW2A 4L63B 2JA8H 4CDNA 2ZITA 3U4AA 4M7RA 1T6NA 2AT1A 3PTZA 4X90A 1ZRMA 1E58A 4KKVA 4KRGA 4A3IH 2VZAA 5IGDA 3NTQA 4R9RA 3IEIA 5K36H 4GX0A 5CFOA 2XNDD 1F2TB 3WKDA 3Q15C 3CLVA 3D3EA 2L5TA 4UM9B 4D99A 5DIZA 2JA5G 1ULHA 1O5OA 4TROA 1T10A 1XEWX 3NI2A 4NBRA 4DV2L 3LIIA 2OXFA 4RIIA 4G01B 5AKHA 2WILA 1G7RA 1IN7A 2J5KA 3DWIA 5EAYA 4KXUA 2XNJA 3NBXX 4QE3A 4WXYB 2HMSA 4NEHB 3ZD9A 2B1IA 4PLWA 4OUDB 5J1TB 2PVCA 3GV3A 5LSAA 1P8AA 3ZHQA 4A3KH 1R10A 3Q6MA 2VWGA 2UUCQ 2B6NA 3W1EA 3C5HA 2F3PA 1G20E 5LUBA 2E37A 3M6AA 5DN6D 4RMJA 2UZ0A 3UI2A 2EVWX 1KKLA 1GV1A 4KZPA 1VI6A 5CPBA 3ITPA 1IBMQ 4E03A 3TQOA 1PG2A 3GZJA 3T4EA 4OHPA 3RAGA 1VE6A 2Q45A 2XWSA 2KCTA 4DZZA 1SFOH 3C3WA 3GWGA 3S17B 5JECA 2YXLA 2A35A 4IHJA 5I4IA 3THSA 2VKTA 1IE3A 1V1RB 1GA4A 4XGKA 3OCUA 3BWEA 4TMXA 2I7DA 3NWBA 5ADWA 1ZMTA 4W5RA 3N6RA 4B73A 4X63A 2X3UA 4IR7A 4YJKA 4ENUA 1I0LA 3CNEA 4JXJA 4HCSA 4L5CA 2EARA 1ZOIA 2R84A 3U61B 2B8NA 1USIA 4Y6LA 1S2IA 4P98A 3G2MA 2B8EA 3ND6A 4NW2A 2Y0SE 1BWRA 2BFBA 3HB7A 1IBKB 3G68A 1XI2A 2NYRA 3QW2A 3SC2B 3IMFA 4LNUB 5H8WA 5CLFA 3OMXA 1Z45A 3LDHA 4OQZA 1QIJA 2A1AA 2PSSA 3DWQA 3HLYA 4FE7A 3F3SA 1J9OA 2JK8A 1KU0A 1OZGA 4BBRG 4EX5A 1AK9A 3CPHA 2QTWB 2CC2A 3CZQA 3QZUA 3TTXA 1EWQA 4PHHA 4CM9A 3HBNA 1U7WA 1NW8A 2KI5A 4P0PB 2WB4A 3PPIA 4W8OA 1N3IA 1DZ3A 3E22A 4JMLA 4PCVA 4RY9A 2UXBB 1MIHA 3WHLA 1C1HA 1QH1A 4BPRA 3PXAA 4H2DA 1GVPA 1W52X 4LYDA 4UVDA 4R7GA 4FMDB 4DR2L 1XNQB 4MVJH 4Q19A 4FFDA 3PO2G 1TQ8A 2WYWA 1B1ZA 4BHTA 2VFAA 2DWOA 2FFBA 4BB5A 2X0JA 3JSAA 1MIOA 2J5RA 4MHSA 1W1WA 4IHJF 2B1JA 4JBNA 2IFTA 2C5LA 4E4YA 5IXYA 4BY1B 1TCAA 4L5TA 1JP7A 1OX4B 4LZZA 2EV9A 4QU0A 4P74A 4TRRA 3W05A 4I3GA 2LE0A 2J7KA 3EZ9A 3OIVA 5EJEA 4FIZA 2XB6A 5JVG3 1YB5A 1NIJA 3LFTA 3HA7A 4TMFA 4AJ9A 4MV9A 3BTUA 1FMLA 3EZYA 4HZIA 3CRZA 4IGEA 3O0TA 1TT5A 3PUVA 5ALNA 4FS3A 3SMQA 4F4HA 3T9DA 3BE4A 2QJRA 2C97A 4Q24A 2ON6A 1QG2A 4LISA 1OB2A 2J9FB 4ZRNA 2ECPA 2FZWA 1GPKA 1TT7A 1ISHA 4KN4C 5TMEA 4WFN3 4GEKA 4UZEA 1WYDA 2GK7A 2YBEA 2NUAB 4PW0A 1XZNA 1E3PA 4CEHB 3QWIA 5A7HA 2GUGA 4NS1A 4YT5A 2I2DA 3T5DA 3HKBB 1Z74A 4KC0A 2R8BA 5GJVC 1DVRA 1QNLA 1RJGA 4ZKDA 4CODB 1SZCA 2RQXA 4D5EA 1KAAA 3EH1A 3AVYA 3AOEC 2CUZA 3O8LA 4U7FA 4OAPA 2VDOB 3DLBA 4EB3A 3DNPA 1VLLA 2R92H 5FO1A 1C8VB 2CE2X 4UOEA 1JSRA 4ALKA 2ZT7A 1S2OA 1DKQA 2H5LA 2ZI4A 2OV8A 4URYR 2Q5LA 5C3MA 2Y9PB 4BAUA 5BSVA 5KYIA 1F6DA 2C1XA 4Y6RA 2XVXA 3JU3A 4CCYA 2W00A 2NUTA 2N55A 1C9NA 3MXNA 2Q5QA 1W2GA 4IINA 4FBLA 1NHWA 4BLPA 2Z8ZA 4DHEA 2QMHA 4TTVA 5C0XI 2HSGA 4FCCA 2J3MA 1NVMB 3AF2A 4NENA 4MR8A 2ATIA 5JSQA 4X61A 2OPBA 3SHWA 1BYIA 4CIWA 5M34A 5LDHA 3HADA 4JP5A 2Z0MA 2PZWA 3IHWA 4DMFA 5IMSA 5B1EA 2F0SA 3E6AA 3E81A 4KV7A 5F3RA 1QE6A 1N9GA 4R6XA 4MHEA 3ZU3A 4A3DB 4B5KA 5B3KA 2GPWA 5FTKA 3ROTA 1KE2A 3N2LA 4HQKA 4XI9A 5FA6A 2H2HA 4WNCA 3G9TA 5CV6A 3ZUPA 5DHTA 5FPYA 1AH2A 2VTDA 1FYDA 3K09A 5J1SB 2BI7A 5GIPE 1B8OA 3DZHA 4FI3C 1ZU5A 2CFTA 3FYSA 2Z1MA 2HIMA 3D4PA 3LXRA 3LPDA 3PIIA 1IOWA 1DC3A 4GE0A 4ZU1X 3Q12A 2DH6A 3JWIA 5IBQA 1EYDA 1OLUA 4L72A 4E7OA 2PQ2A 3U9TA 4PXSA 2ZYVX 2IOYA 5ALHA 2I4OA 3RRJA 2R00C 3T95A 4N8SA 4MDFA 1O6GA 1W19A 2JA6B 4K6CA 1GRCA 3VZPA 1S40A 1DJOA 5B7NA 2R85A 1N8KA 4DLZA 3MBIA 5G3ZA 2ZJ2A 1GPH1 4JLUA 5CK5A 1MBZA 1TZCA 4PGAA 3I4MH 3ETDA 5DWVA 1IQPA 3NEJA 3FKIG 1I9GA 4YUYA 3JQ6A 1SAYA 4JLSA 1LY1A 3AF3A 1BS2A 5HGTA 1UDAA 4DIFA 3FOEC 5T4FA 4J7UA 3WAGA 1WPXA 4H6VA 1R4NA 1AX9A 1CDEA 1QO7A 1EY0A 1Q1QA 1VJRA 4G67A 2BEKA 1FJGB 3KF8B 2BF4A 5C0XH 3W6NA 2DQSA 2ZSHA 1XMPA 3I1IA 3UPUA 3H3VI 4K6KA 4CLOB 2ZI7A 4X1KB 2AQIA 4C4TA 2ZDHA 5IH7A 2Z1NA 4XDGA 3H65A 1L7PA 4WDQA 5A5EA 4YCWA 2RHMA 4EYSA 2HLDA 4NMZA 5ELOA 5DT9A 3ZK7A 5LQRA 2FZVA 4K9KA 3LL4A 2H8KA 3EDMA 3CPJB 4MRVA 1HKUA 1VI2A 3RYTC 1G8ZD 2I67A 3RLFA 4EPYA 3IDAA 4YMVA 2HLHA 5L3SA 5FWDA 4WZBA 3BB4A 1XRQA 1Z6TA 3L7ZC 1DL5A 2XUAA 3I4FA 1CS4C 4JA2A 1V4NA 5G41A 4OHUA 2Y2VA 4BNXA 4Q9LA 2WFAA 1KJNA 3OHMA 5C1BA 4O2BB 4I2NA 1U5CA 1M33A 3KEMA 3TZDA 5K8IA 1B3QA 4E94A 4M8LA 3GEIA 2DH5A 1UMDB 5DN9A 2YTZA 1IQUA 5T8KC 4XB6B 5BPFA 1IHXA 1K0RA 1JSZA 5IKEA 4IO9A 3D0QA 4NAUA 1GGMA 3GT0A 1U9ZA 2VPYA 3N7AA 4TLBA 4BP1A 1N0WA 1BWSA 1DXHA 2Z6VA 2OSVA 3GCWA 1B16A 1GKKA 4R1PA 1VSTA 1FU7A 3MHPA 5KCZA 4FYMA 2ECOA 2FP4B 5ICEA 2IIBA 3JQ7A 3KQTA 1JTVA 3SIWA 3GTPH 3HB9A 4Q3AA 5FBVB 4U0KA 4HUQB 3VTFA 4P81A 4FDUA 4IDFA 3WWDA 4JQYA 4H7IA 2HA7A 1H1TA 2WG0A 4S3SA 5KTOA 3NO4A 3OQ6A 3AFMA 1X77A 5G4LA 3SYTA 2KQ3A 3QPDA 1J0XO 5L8VA 5ESWA 4KLZA 3W1BA 1D6NA 1YMVA 2X9QA 4YT8A 4DQKA 2JA1A 2ZTLA 1M72A 3PIRA 7ADHA 4GMGA 3LHKA 3JWGA 1OMOA 3CZMA 3DLPX 1V3VA 3TRKA 2J46A 2HRQA 3CURA 1IVSA 2JIPA 5AIBA 2HH9A 2WTNA 2Z5LA 3H2HA 2G72A 1QC5B 3UENA 2XSZA 1UAYA 1A9QA 1YDMA 4I6GA 1GGVA 4UM5A 3S14H 1IRIA 4CU2A 5DPMA 1L5VA 3BHIA 1P4GA 4JBHA 5GZ3A 1QGUA 2E5LB 1MB4A 1CQPA 1FP1D 3A6PC 4DV1L 1AKEA 3P26A 3ZTTA 1AH9A 4PC2A 1W2WB 3IALA 1N2EA 3AIIA 1TRKA 3HDVA 1XE3A 1DCTA 3IPXA 2QG6A 1R8QA 4XFDA 4K9NA 3TX6A 4LYFA 1NM5A 1T9GR 4O1IA 3JAMc 3GTJB 2W8BA 3IXLA 2Z04A 4RULA 4GSYA 4L08A 1Y8ZA 2WSLA 4DV0B 5HWSA 5A6SB 4ZAYA 1JFVA 1RMQA 1Y8CA 4AYXA 1Y4DE 1Z33A 2PLFA 4RD6A 2ZQYA 3EGWA 1IVYA 2GK4A 4YCSA 2ZT5A 3OX1A 1KAWA 1OC4A 3ESRA 3M4OH 3TD2A 4GKKB 3H1BA 2NM0A 1DAHA 4FM9A 4DBVO 2J0UA 2WJWA 1MV5A 3VVMA 2PXHA 4ZYTA 3KLMX 5FLXA 4MI3A 3ZBTA 2GDZA 5CYUA 4YCDA 2P6OA 4CF6A 3U62A 3GRZA 3VR2D 3BRSA 4Q3NA 2RJOA 4OKIA 1ZUIA 2GN5A 3U9SA 5HIIA 2IIVA 1B2RA 1TQ4A 3RVBA 2R4TA 1FDIA 3UA3A 3M82A 1ZWLA 3SK8A 2YFKA 2X77A 2NN6H 1TVKB 1P0QA 1W7AA 2VUUA 4MYDA 1FLVA 1QIKA 3WK9A 4OK3A 1E69A 5F5XA 2YY5A 4HDKA 1M5RA 4J3JA 3IC5A 3ZDYB 1GQQA 4XQEA 1NE3A 2XNSA 2UVQA 3O5AA 5EPKA 1H2YA 1V95A 4H4CA 4RFSA 2OESA 1O7IA 1BH6A 1G2TA 4XWGA 1UZLA 1NW6A 4LWZA 1FNBA 1YFJA 1Q0ZA 5GPBA 3R0VA 4RGMA 1DIRA 2HGZA 4HNGA 2WMYA 1XZAA 4BEVA 1KOGA 3LT4A 1NQXA 5CR3A 5AHXA 4JENA 5CV7A 5JJCA 1KRTA 1YZFA 4ZAZA 2AWNA 1V7QA 2UXDQ 2ZW9A 3C5WP 2TMKA 2IVFA 3BFJA 1MCZA 1WTPA 5IKXA 1ZL2A 4G5OA 2XI4A 1M10A 4PWZA 2JLSA 4X1OA 1YR6A 3SZLA 3T9CA 3NBYC 3DKIA 1PGNA 1FNWA 3HPQA 2I78A 1ETHA 2MO1A 3GFOA 3JAKB 1RM3A 3NQIA 1UR5A 5GAHC 1S2MA 1E3SA 5AJ3Q 3HOUH 1XFAA 2OORC 1GD1O 1GPJA 3G5AA 2FWJA 1B93A 3AHHA 2XUKA 3B38A 1CUKA 2BCGY 2Y1GA 4DILA 4UCQA 4GLFA 3A2MA 4Q4HA 4JT4A 1Q0PA 4NMWA 4JZYA 3KEQA 3RJ5A 1GL7A 3GDGA 4UVIA 5ABPA 3JQ8B 4HY3A 4EO9A 3EBLA 2AUMA 3H94A 2X76A 5FI0B 1QMPA 2QN8A 2CQAA 1CFJA 1EOTA 3TEMA 5IVKA 4BXXH 4UDOA 1O6FA 2EPBA 1D2AA 1A71A 3EHEA 4OKNA 2Q3HA 4QPJC 3OPYB 3QENA 3LCVB 3LDGA 2JFWA 5IC6A 1TJPB 2A9QA 3K70D 1EP3B 3GJ7A 2PUVA 1EYAA 4MROA 1KZGB 2C9YA 3NDBB 2RB4A 2JH3A 4UPEA 2N3ZA 3PT5A 1ECFA 3PX7A 1X8KA 4C22A 4EVIA 2Q3BA 4TMYA 1DDGA 3I0MA 3E9ZA 1CFMA 1EVQA 1JL3A 2ZFUA 1I6LA 2C7OA 4MLCA 5BNTA 3AU8A 1BNZA 4B75A 2XKKA 4AQYB 3ECSA 4LJ4A 2MIIA 4CKEA 4MUXA 2BM0A 4PLPA 1E9VA 1C7EA 4O08A 1O6CA 2JA2A 1M8JA 3RHSA 3N70A 4UU0A 4L9AA 3EH2A 1R0ZA 3RR5A 5JJKA 4B0PA 3LUBA 1N33Q 4EQ6B 4E08A 2C9CA 4OFBA 5EKUA 4A2QA 3B1JA 1R8JA 2E74C 5FORA 1UF9A 3GFTA 2CCKA 2QL5A 2ODNA 1GKUB 2NZVG 4MB0A 3TP8A 2JFYA 1SB9A 1XLTC 3Q9LA 3UV6A 4F11A 4APVA 3L7KA 1R4PB 4N76A 1TZBA 1ML4A 3IERA 1CQJB 2WWRA 3ZY2A 4DARA 2YFYA 1WXDA 3ZEAA 5LMNB 1GRQA 3P2OA 4ZK6A 2O0MA 2YMMA 3ZWVA 5AJYA 2AGVA 4XT3B 2F0PA 3JQEA 4EYGA 4MPRA 2WKPA 1U4NA 2C2ZA 1TO2E 1RFLA 2N47A 4KPYA 2A1TR 1W93A 2MSCB 1IN8A 3RYFB 1UBCA 3CBQA 2O5IC 3CQZB 1NXPA 3KPVA 1J2JA 2QRJA 4JWKA 2V7WA 4HMOA 3TPZA 4AP5A 2R7LA 1XMSA 1GZ5A 5F2NA 3OICA 4KPFC 4MH0R 4Z7QB 4M83A 2ZRCA 3OZTA 2XV1A 2R6AA 4LDJA 4QPCA 3T56B 2PH5A 2B99A 3H2SA 2C4MA 4Z1OA 3DUFB 1V1QA 3AB8A 2QRUA 1K2WA 1PH3A 1ACJA 4QIWB 1T5OA 3FI9A 3ZPXA 3PXUA 2HIXA 1UOOA 2FPLA 1H2XA 4M0CA 5TNXA 2WVHA 2IU4A 2WJIA 4BP3A 3IAS1 4HYQA 3CCUA 1GZ6A 4P73A 1V71A 1PBTA 2L42A 3IIIA 1ZOOA 2XYGA 3R8XA 1XJWA 4BYGA 4IIVA 4XA8A 4N4AA 2YW2A 2FE4A 1W49A 4UP8A 2CVOA 2FQ1A 4QQ8A 2MHVA 2I5PO 1FBNA 2JN4A 4DUYB 1VQ4A 3QEKA 1G41A 1KHHA 1SUAA 2HDOA 4B3CA 1NXSA 1VRCA 1PYDA 4PFJA 3I4LA 1OBCA 1QANA 2VJOA 3UTDA 2VRWA 4AUEA 4I5FA 4HFRA 5HKOA 1XDSA 1UQUA 3K9BA 1G291 1SQGA 2GNPA 4H7KA 4YRSA 1SVLA 4M7WA 1ONSA 1AO3A 1XZIA 2R86A 4WFJA 2WKCA 1S3FA 2GN8A 4WXRA 4MDHA 3B51X 3T1QA 1QE3A 5FBKA 4DIBA 2A1IA 1DBPA 3JARB 3VVCA 5E9AA 4RK0A 1QFZA 1NQAO 5DCLA 3W6OA 2AE1A 2GCOB 3RIHA 3EYAA 2RHJA 3AHGA 4LX0A 1STBA 4TL9A 4C7XA 4LUOA 1IONA 1FTQA 4ZOBA 4H18A 1ZIXA 3TP7A 3R0XA 3A8IE 4F4UA 3K5PA 2LKCA 4KO4S 1SBTA 2VZEA 2F3RA 3GUVA 4I1UA 3AU9A 3E23A 2A57A 3S15H 1W46A 4V0SA 3EXIB 2HLPA 3R6DA 2J7PA 1L7QA 4ZCLA 3LV8A 4DLKA 1L4UA 1QYWA 3IP3A 4NAHA 1GTVA 2BIFA 5C3WA 2GBLC 4D43A 5C4XH 4J16A 1UPAA 2O2CA 4X7PA 5IP9H 2X0KA 4EKIA 2FR1A 3GLQA 2HMVA 2W6OA 3FLBA 5KVCA 5IBRA 1Q16A 2WIDA 5JEAG 1NVBA 2WAOA 4NNPA 2PBFA 2GOYA 1GD7A 2O8BA 1ONBA 2ZJYA 1SR8A 1MVLA 1A15A 5KCMA 3TZQA 4BCBA 4FUTA 1Z0AA 3WGGA 2QR5A 3F2DA 4UUQA 4M2LA 1IQ0A 1GCGA 3WHIA 1U2DC 4N9QA 2G77B 2DSTA 4FTWA 4P92A 3ST7A 4BJ5A 2JFBA 2O3JA 1KVTA 3IAYA 3OFSA 4LBYA 4RE6A 3LTEA 2NVTH 2YYAA 1IBLB 1XZJA 1YL5A 3UCFA 4BBZA 1XDWA 5ITSA 3D2LA 4RAQA 1KZ9A 4XJSA 1Q6ZA 5THKA 1FFEA 2QX6A 3KU1A 4RZSA 4PM4A 2ISCA 4IQGA 4DK0A 3UO8B 1VL1A 3QXXA 4NCKA 1PFQA 5TS2A 3BDVA 1WHSA 4BQNA 1GR0A 5FFFA 3AM4A 2NUCA 2DQKA 2LR0A 4A73A 4Q5VA 4C87A 1NJFA 1N9ZA 4LYAA 4Y7CA 4AZ3A 3BF7A 5HW0A 3F7OA 2IYQA 2C00A 3VKHA 2AN1A 4CBVA 2IA5A 2DPLA 1YB6A 1FFWA 3KYCA 2GPYA 2K5NA 2ROQA 3FD8A 1QH0A 4AG3A 4GOLD 2R65A 3HR8A 5KI6A 3HSKA 1YJQA 5BR8Q 1ZD2P 2NYUA 1W5SA 1NN3A 2X23A 1E98A 4YJ2A 3AEQB 4O8ZA 1YHBA 5DSTA 5I9OA 3GZNB 3AVUA 4DRZA 1SC9A 4Q3LA 1Z8DA 4MUMA 3L7MA 3COJA 3FAZA 5LL6P 3CCJA 4IDNA 4TQGA 1NCVA 1B4DA 4CR7A 2WWXA 3CJTA 3LX6A 5LXTA 1RZVA 1JR3D 4EQOA 1IJEA 3BGSA 1QNUA 3Q0IA 4HWGA 1EVIA 3S2HH 3PQCA 2I6QA 4LNHA 2BFFA 3RE1A 1M3SA 1SXPA 3O84A 1S5FD 4YB8A 4ZAGA 1SQSA 4ZANA 5ELNA 5T4HA 3W4JA 4LIPD 1KK0A 3RC7A 2XJ9A 3VSAA 4C88A 3V7UA 4MQEA 3QEMB 2FMTA 1NQWA 1N6OA 4P33A 5IAGA 1S5ED 3W8DA 1EQUA 2UUAL 4DV3L 2LW7A 2REBA 4IIJB 4TKVB 2VUIB 2XDAA 1QIGA 4HOYA 1XVTA 1H2AS 2DJ5A 4PZAA 1MSGA 4Q1CA 3PQFA 3TI9A 4IDHA 4BVBA 1SUDA 5REQB 3FCUB 1PFBA 4Z3DA 3BK7A 5IT5A 4B3GA 5C4ZA 1XV5A 2EWMA 1C3XA 4UCFA 2FQXA 5EI5A 4Y1EA 2XUJA 3B70A 5K01A 1U8EA 4F2HA 1UODA 3JZIA 1XDGA 1P2DA 3E2IA 3EZ6A 5FBWB 4I50A 4RD2A 1XWWA 4UKDA 1S8AA 2OXCA 4F2WA 1JEEA 2ENWA 3T34A 3CLTD 1VHLA 1SSOA 3RFVA 2CV0A 5D3ZA 2QK4A 2GT1A 1ZESA 1FVOA 4XX0B 4ZVPA 3TTUA 3N6VA 2Q4RA 3D6VA 4O0MA 1WEHA 4E2XA 3FYCA 4Z4EA 1R50A 4YJ2F 4CKCA 6YASA 5THXA 4L7QA 2MYPA 3SBXA 4I4LA 3B48A 2PYKA 4OHWA 1JEYB 1D6SA 3PFGA 3BOSA 2FSFA 1KQNA 5EP4A 3O3NB 3OEWA 2VI5A 3L4KA 5DHAA 2HBRA 5LXTF 2BJWA 2JJ1A 2YV2A 2DLNA 3HVUA 1E99A 3N0TA 4M46A 2B94A 5ALUA 1TTTA 1QYVA 4IYRA 1G9SA 2WHRA 5LNK6 3HO8A 4LK2A 3CWZA 2BP7B 1Q81C 1IHZA 2X6LA 4W5NA 2CXTA 4YAKA 3VHLB 1SBQA 1ZSNA 3OCJA 5ESXA 1ZN9A 4A3CH 2XMCA 2XBUA 5BP7A 4QU8A 1L7BA 1LO5D 1Z08A 2BC9A 2XE6A 5IJ0A 4TTRA 1DHTA 1GGEA 3CF2A 4HNUA 2F4VQ 2B21A 5HDQA 1LEHA 3CT4A 4TYMA 1VB3A 3UK7A 3DT9A 5DRYA 3CT6A 3V8BA 3COPA 3MWGA 3AUXA 2ZXOA 4Z0NA 2C7QA 4EHHA 2XWBB 5K1ZA 1SKQA 5EHZA 3OLXA 4O6VA 4YY3Q 3K31A 3NHWA 4PLGA 2HDLA 4R41A 2R1TB 1RRPA 3QNWA 4I50F 3BEDA 3ZD6A 1XK7A 1Z6ZA 4EQPA 1O5IA 2CYBA 2NW6A 3RVPA 2JANA 3G7SA 2PRZA 4L6AA 4DGZA 2HI0A 2X40A 4HQLA 4TN1A 1CB7A 3S24A 3EDOA 4PPYA 1J8IA 3AIMA 1VCOA 3K20A 4GSKA 1C30A 1JKFA 1F2UA 3H3VC 4LF5L 1M8PA 4CM8B 4M4SA 1O95A 4R9NA 3KWLA 4P53A 2CLDX 1H9AA 4F8YA 3R7SA 1DCZA 5JAIA 4N7JA 4AO6A 3LRTA 4G2NA 3QH4A 3PUHA 3FSEA 1G55A 3U9LA 2Y8EA 3WGKA 3V3TA 3EPLA 2CWAA 2FPOA 5B3AA 2PRYA 4CMCA 1E22A 3CTPA 1SKUA 1VSQA 3NTLA 4RMHA 1CI3M 2Q8PA 4AQ7A 5I2XA 2VK2A 3OF2A 3RYIA 3L79A 3MCWA 2ZBGA 5T57A 1ODSA 2A74C 3SXPA 4MX8A 1RJEA 3GDHA 2DXIA 4PZ8A 3T0FA 1I1HA 3L8EA 2GN6A 2HCRA 1Y7PA 2PO7A 1Q3TA 2D1QA 1TCUA 4X8MA 1Z63A 3ZTWA 3G17A 1USUA 1QJOA 3Q3CA 4KQHA 5AXCA 2E75C 3ICPA 4EY4A 4IWYA 1UFOA 2C59A 4JL6A 4KLNA 2EF0A 5EFOA 4GW3A 2DB3A 2H92A 4HKTA 1XXGA 1EXNA 3DAYA 2AG6A 1CR2A 1NXQA 2BFMA 2GZRA 4YXWA 2JEBI 4EGFA 2DQ4A 2UXCQ 1QFSA 2CLCX 3RC2A 2VTEA 2FW6A 3T3GA 1FNVA 1X9GA 2LNDA 3QJYA 1G4UR 2FLWA 1G5HA 5CNKA 1SC4A 4J7AA 1WPRA 3IELA 3OTGA 1R0KA 1UJMA 4BNUA 2B69A 3DQQA 3QPVA 4ZO8A 2BKAA 1R4QB 3WS7A 4QC2A 2A5DA 4QGSA 5KTYA 4QOJA 3T4UA 1QVVA 1L5FA 1JR2A 2XZTA 4QOSA 4DN6A 5TJ9A 2ONJA 3ZDCA 5DNVA 2ZUSA 3EF3A 4QVGA 4QIHA 2OFXA 4XVQA 4EDHA 3PBKA 4JLDA 4DK3C 2QSYA 1H85A 1CEEA 4B6QA 4D0SA 1BR9A 1TA0A 5DW3A 4FFMA 4KDRA 4Y1RA 1ZK0A 2GKOA 4NDZA 2I91A 1TU3A 2WWVD 4NFHA 5IYZA 4W5TA 4XSVA 3PDHA 4S04A 1ZR2A 1CJKC 5BN5B 3SF0A 1ZM9A 3CH7A 3D4OA 4HEA6 1K6IA 3DWGA 4F5DA 5E1BA 4N01A 3DEFA 3E7WA 4W7SA 5FOBB 4GKBA 1VSVA 2A1TS 4F0JA 1N6IA 5CA0B 4BNVA 1ZOLA 1JFRA 4G56A 2H11A 4UM9D 4A8TA 1I32A 4H31A 5CFRA 4AXBA 2NTTA 5JV5A 2GILA 2A6EC 1WMSA 1Z5ZA 2QGQA 3NHFA 4CTKA 1IEVA 1EE9A 3O8RA 1T2AA 2EJWA 3OZBA 2TMGA 1D2GA 4QOFA 5DSXA 2P2CA 3SJUA 4C0QC 5F2EA 2XXAB 2JFQA 4YQFA 4F46A 1W73A 2G4VA 3AYXB 3GLHA 4Q6WA 3ZY6A 3PQ2A 4AZ0A 4EHNA 3TMEA 2WPDD 4W9NA 1SVSA 5EZYA 3I2YX 3BMXA 2IOFK 2OCXA 5KTNA 1F2VA 3FMOB 3W3AH 1LRJA 3V9PA 4AY5A 4KN7C 1XPOA 4K2AA 1WW8A 1XTIA 3FSGA 1G2QA 1ORIA 1CSPA 3JAML 4KWEA 5AVJA 1U04A 3B1VA 3N2GA 5M5YB 3HOZB 4JI0Q 4R8VA 3KKOA 1XEWY 4FMCB 5GMOA 3QU7A 1T3GA 4NSNA 1U2TA 4JQOA 2BBOA 1JDPA 1WCV1 1NNLA 4IIGA 4L6CA 1TAQA 4KWTA 5B12A 4CF7A 2R4UA 1RTOA 1JR4A 1HSZA 4CEJA 1PBNA 3VYTB 2FU5C 1W3SA 1PE0A 4X45A 4QUBA 3GDFA 3FKJA 1PEAA 4ITRC 3FE2A 4WK2B 4AJJA 1Q7YC 1RWPA 3K35A 2WF8A 5JXJA 2NO5A 1NYLA 3R74A 3UHOA 1G6HA 3E7DA 4YT2A 3D8RA 4K9SA 4WJ4A 5AVZA 4R68A 3KE8A 1ESMA 5JJ5A 1UWLA 2VA9A 1AS2A 4CV2A 2ZK7A 4A3MB 1XTZA 5IYZF 3KKNA 4QU9A 1QIFA 3OQNA 4B6RA 2P4QA 4D92A 2BW0A 4L8VA 1KJZA 1YVEI 2XOKA 3K0HA 3HJNA 5LL6S 2VWHA 2QTLA 3ELYA 3TDKA 3VI3B 5KNCA 4GRAA 2QZ4A 4YAEA 4DR5Q 1VJ5A 5D51S 2IYZA 2SNIE 1CJTC 1YBHA 4DB2A 3ACDA 2JASA 1RIIA 1MRNA 3V1YA 1ORRA 1C7JA 1N32B 1HLFA 3OQMA 1A8VA 4KDFA 2IJGX 4D6PA 3CVWA 2J45A 4DUGD 1B26A 3O3CA 2SKCA 1PNVA 4A9AA 3KALA 2V9ZA 2QRZA 1Z07A 2ZPTX 3UWSA 5EJ5A 2B8GA 7GPBA 1RQ2A 1A8UA 3VOTA 1SCDA 1CDOA 2AMFA 4KQFA 4LCJA 2W70A 4DJFC 1EOVA 4N49A 4R8KA 1W88A 4GXRA 1TS4A 1LW7A 3L06A 2OSBA 1J2TA 2BBSA 2GM4A 4EJSC 5EZYF 1VPLA 4G4IA 4EM6A 2GA4B 4D8TA 2DHCA 3PYLA 2AFIB 1AVTA 2PKRA 2C0PA 4L5IA 3CCQA 2UZ1A 4G9BA 1E1LA 3DHYA 1KJ9A 4EMSA 3LT1A 4YCVA 1FSGA 1FNCA 1ICWA 2BI4A 3GMDA 2CZQA 5LMUQ 1WOYA 2AYYA 5JJZA 1OBFO 3IO3A 5TC4A 1L5KA 1SC6A 1FP4A 1D0IA 5CD9A 3TM4A 3P2JA 3DXYA 1V1MA 3EGDA 5FRDA 4DPGA 3BTSA 3WLAA 1XMOL 3R3VA 4H7FA 3LP8A 4DWWA 4INZA 3EOAI 5FYQA 4JC5A 3BWYA 4WOJA 2XVAA 4NH4A 4BQEA 1QBGA 1R0YA 1U4PA 1VXOA 3CNLA 3E53A 3ZKWA 1FL0A 2AI3A 3RMHA 5F9HA 4HVCA 4LYYA 4H3HB 5DM1A 3GOHA 4XZ3A 3V4SA 3G7UA 3OF3A 1EM8A 3R8CA 1UZUA 2ZWAA 3V96A 4OSPA 5D8DA 4GOKA 5F78A 3H9JA 1N3YA 3TTWA 4GLOA 4IMPA 3I2IA 2UVPB 4EKEA 3PGJA 3H9CA 4NCNA 2MSLA 4BB6A 3MWYW 4DM3A 4CFSA 1LBQA 1HGXA 4J1TC 5IFKA 4HGQA 4LHZA 2HSJA 3FDJA 4JI5Q 2OXTA 5M5XB 1NQUA 4WRDA 1HNZL 2XGMA 5C35A 3IB6A 1S8OA 3NU1A 1QXSA 3V8RA 3DE1X 1EUCB 1YF3A 2X8BA 1U0JA 5KYXA 1PH7A 4QXOA 4RZHA 2QZZA 4C6TA 4E51A 1T13A 2QAGB 3I8SA 2NTYC 1G42A 2PQAB 4OIMA 4B3TB 1G8YA 3BTVA 2CNWD 1UBTS 2G0NA 1W35A 3MZ0A 4WOPA 3E5NA 1BDHA 4EL0A 3ULLA 1JTEA 4BGUA 5EKSA 3SK6A 4C7VA 2IPNA 5JNVA 4JK1C 2BDOA 4NS4A 4P84A 4X5OA 3M6MD 1QVZA 2NPOA 3QLUA 3I53A 5BUSA 2G6TA 3N0WA 1FBTA 5HIKA 4LHSA 4XD7A 2IYVA 3RPEA 3SM9A 1C1DB 4GKJB 4QUEA 3BMNB 5FTJA 1SHUX 1CSQA 4LHEA 1WG8A 3OE7A 4RA9B 1NL3A 3OJLA 1TMKA 2BGTA 1I7PA 4ML3A 3HOXB 1M6YA 2X9GA 3QY0A 4ENRA 2GZ3A 3DOIA 1SUSA 1RDPD 3AW9A 1NDUA 1ZD9A 4RZXA 3KQOA 4OI1A 4RMIA 1DV2A 2KUMA 2BEWB 3Q7EA 1UANA 4IDGA 2G9QA 3JVVA 1W44A 5IDXA 3TLKA 1ONLA 1R9MA 1UK6A 5C53B 1RJDA 3GJXC 4BA2I 3HWRA 2ZCJA 2XN9C 3VSDA 3PIOA 1DEOA 1EWCA 3TDQA 3PFNA 2TMDA 1L5YA 4TZ0A 2UU9Q 3T5CA 3A6GA 3RG2A 1BEZA 4U2FA 3W4IA 1HE2A 5FL3A 4DAVA 2Y0PA 4C4YA 4EVOA 1J90A 1GY8A 4N0PA 2Y6UA 3LLUA 3S8YA 5GAJA 4GL2A 1RWVA 2Z8LA 2N78A 3T1HL 4AJKA 3J81A 3ON5A 2JHPA 4DR7B 2IHEA 4BIMA 1MQAA 1HT0A 3ZCTA 1X8LA 4MAFA 2I3AA 2BFOA 3NS7A 1CY6A 5IAKA 4F56A 2HHHB 1BXKA 2W6CX 4C6RA 1ZEJA 1Z7BA 1LBSA 4NWIA 2I2WA 2PBZA 1V7PC 2HMTA 3LQ1A 7REQB 1OZHA 4H9GA 2Y0BA 2YMPA 1T1GA 2D2XA 2QQFA 4BJ6A 5JSYA 4MZDA 3NK9A 3URMA 3VH1A 1PH9A 4FB4A 4L3WA 3ZW9A 3WIDA 2OXEA 1VHWA 5EKKA 5B7GA 2Q1UA 1RKVA 5L3ZA 4JL5A 1YK0A 4ZV7A 3FP9A 3UJHA 4OB8A 4IGKA 1MQ9A 3I01M 2WTAA 4U9IS 3COZA 3KKEA 4FYDA 2V5VA 1DPGA 2BKLA 5P21A 2IU0A 3THOA 1Y3AA 1HZBA 4M0DA 3OQVA 2QD3A 3EIQA 4DDMA 1LDEA 4X9XA 1QG4A 4K6MA 3PEUA 1GKIA 4S1WA 3RTGA 4DV7B 1VQGA 2ZIEA 1FP7A 2L18A 1ZHFA 3Q0AA 2VJDA 2CD9A 4MNOA 4NABA 1NUAA 4F3RA 5GADC 1MD2D 3RG8A 3Q5DA 1ADYA 1KI9A 2JAOA 3EXEB 4P3PA 1Y14B 5C3EH 1XYVA 5EYPA 1M8AA 2FZ5A 4YQEA 3T1YQ 1IBRA 2PL3A 2NX2A 4PQFA 4MO9A 3R9XA 5IYDG 1A2OA 3AUJB 1PL0A 4DAYA 3CE6A 1M34B 5AJVB 1E62A 4ZEWA 1P19A 1KRXA 4L75A 5B30A 3MW8A 4RK5A 2BF7A 1NG9A 3EFXD 2PKWA 5M3MH 3F7MA 3J81i 4I55A 4EYQA 3CC4A 4EEZA 3NELA 1NVTA 1AM4D 4J0EA 4KRXA 4HQNA 4X93A 5HTOA 5EVJA 2ZG6A 2P78A 1VE9A 2BGMA 1A2UA 4JN6B 3PQ8A 4DR4B 3IPAA 2ZRDA 1RNLA 1V8BA 3D3JA 1G8JA 1U9IA 3MS2A 2RBGA 1PLKA 4NXMQ 2C4UA 5J2UB 4BY7H 3WDMA 1H2RS 2XPCA 3M4PA 1QLWA 3TD9A 1RKXA 4MZ9A 1HR0W 3L07A 2QZPA 5IJ9A 3T6KA 1E7ZA 3C3BA 3LF1A 4LF9Q 3Q6IA 1GA6A 4PC1A 5GGYA 3WYNA 3F2BA 1SO8A 4CLRB 4WCFB 1OAKA 1YAHA 3L1IA 4BBSH 3BFVA 4DJJA 4IDEA 4JGGA 2RC6A 1GPAA 1DO8A 1GUTA 5BQOA 3O74A 2P2SA 3ZKAA 2K33A 3RIGA 2R60A 4V0MA 1I4HA 1E9DA 1ZMBA 5K0CA 4H3VA 3PE6A 3WQRA 1LLUA 1ZRSA 1U8AA 2H2AA 2UYOA 4RKQA 4FXKC 4K88A 4V0OA 3RQSA 1V2GA 4Q37A 1YNJC 3FFWA 1JKXA 3VPDA 4BTEA 3WNCA 4ZICA 1K83H 1JDZA 4FGLA 3GMSA 221PA 3I5XA 3HFZB 1L5HB 3J7A5 3ERSX 2IHFA 1P2BA 2H3HA 4DAOA 3W06A 4AAYA 2W2TA 3VYUA 1KNQA 3GXOA 2EGHA 2WAXA 3WQBA 4EP1A 4M9ZA 3TR6A 4JDPA 3VKFA 2ZQZA 2P5ZX 2J4XA 3WGNA 2XUIA 2HWWA 3MA0A 4ITVA 1KWGA 3OOHA 1NGSA 1N1MA 2PGNA 5JE8A 4KH0A 3I04M 4B83A 2EQ5A 2SNSA 2XGTA 4R9SA 1BXGB 2J3HA 4OQLA 5CC4A 3LP5A 3LCMA 3PQ7A 4WT7A 2ZUVA 5KPDA 1L0BA 1RTKA 4ALJA 4I55F 5EJ8A 4R2MA 5CYFA 4GNRA 2OXPA 4R1LA 5NULA 3NHMA 1CKNB 3CPWA 3FLMA 4J2OA 2PVSA 1N5JA 4CV3A 2R6JA 2QRKA 1YJBA 4R54A 4OHVA 4Q7LA 2IW3A 3HH8A 3R5XA 3R2JA 3IT2A 1EFWA 1Z7WA 4R71A 1VMKA 1P61B 1U0NA 3ZJYC 2IP4A