4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
molecule keywords COME
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
1CEYA 5TPWB 1B00A 1DCMA 1APBA 3OM0A 3C6QA 5IBQA 1LJLA 4H3KB 3ILHA 4KQCA 3M9XA 5DKFA 4Z9BA 1ZGGA 2RJOA 4D6YA 1RZRA 4XYOA 2NT4A 3BILA 2JVJA 3EDCA 3T6KA 3DLBA 1LBIA 5FWYB 3P9YA 5PNTA 3TD9A 3VNAA 4OBBA 1H9CA 4JP1A 3TO5A 2M98A 3Q7RA 2L2QA 4MGEA 4MQFA 4EVQA 4XQNA 1ISRA 2QU7A 3W9SA 4MR7A 3LUHA 3JVDA 4F8JA 1ABFA 1F4VA 1TM2A 3OO1A 4YRZA 2PJUA 1DRJA 2PUGA 5DTEA 5KQMA 1DBPA 3HS3A 4ETMA 4RKRA 5EWMB 5CNKA 3TMYA 1BVHA 1SXHA 2FQWA 2N9UA 3OQOA 3MM4A 3H5VA 4M88A 1GUDA 1MB3A 4XXEA 4RY0A 4N47A 3DZDA 3LUDA 1JFVA 2F8TA 5JS2A 3LFTA 4MRMA 2VUIB 5T7BA 1E2BA 3FMVA 4EYGA 5IUJC 4G0ZA 4HNRA 2FQXA 3OQNA 5EWJA 2QZJA 4W5NA 1HEYA 4Q6BA 5IEJA 4XQJA 3NNDA 2PAFA 3HZHA 5B3JA 2E4XA 3CU5A 2DRIA 3HM9A 3QK7A 9ABPA 2O20A 3OLVA 3RVPA 2HQOA 1YVUA 4FE4A 1S8NA 2FSPA 4KNYA 4YP9A 4NCBA 1URPA 4Z0NA 1PEYA 4D74A 2FW0A 2VYCA 4RK4A 4YCSA 1ZH4A 2A9PA 1FFSA 2E4ZA 1A0OA 1CYEA 2ID7A 3MMNA 2PUAA 3H5TA 5TQ0B 2I6FA 2NUBA 3FFTA 3VNBA 5JNRA 1DJMA 3I09A 1NXWA 5FBHA 1JH9A 1XHFA 1YK0A 2JVIA 2A9RA 4PE5B 5T3YA 2E4VA 2PKXA 1YS6A 3Q9SA 3RVSA 4HYEA 1ZGZA 4MS1B 1Z15A 5C5EA 2NZVG 1M2EA 2MSLA 3KJXA 1JDNA 5ABPA 2PUCA 2QVCA 5HSGA 3JPWA 4H3HB 5ED4A 1Y1LA 4LDZA 1U8TA 1ZHHA 2W42A 1D4ZA 2A9QA 3LUKA 3O75A 4TN5A 2NZUG 4G0QA 2JVKA 1AB6A 3GA5A 3HUTA 4EYOA 1OXKB 1U2PA 1MB0A 3OLZA 4MS1A 2MYUA 4OTZA 5CNJA 5KQLA 1JHZA 1ISSA 3FFXA 3N53A 3R0JA 1RZRD 2WY2D 4ZYLA 4MR9B 1U04A 4JASB 4F12A 1ZDMA 4ML3A 2FKAA 1K66A 4XLTA 2L19A 4ZPJA 1GCGA 1UDRA 3JY6A 1QNLA 4XARA 3CKMA 2PUEA 2GWRA 1JYFA 3EODA 3TB6A 1USGA 4F11A 4YV7A 1A2OA 1E6KA 5C5CA 2FQYA 1GUBA 3GV0A 2LUOA 4G0PA 4G0MA 3K4HA 2R25B 1U2QA 3GWGA 2LPMA 2J48A 1OXBB 1QKKA 2LBPA 4W5QA 1P6QA 2E4UA 3I45A 5JS1A 2LIVA 5FWXB 5BR1A 3HJFA 2JRLA 4XFKA 2FEKA 1FFGA 2QW1A 4NV3A 2VK2A 1PNTA 3N0XA 1JFTA 5GOTA 3CG4A 2YHAA 3HCWA 4MR9A 2FMHA 4EY3A 3Q7SA 1D1QA 3HSYA 3KKEA 1D1PA 2XDYA 4RV5A 4RY9A 3SNKA 2QR3A 2WJAA 2YHBA 3KSMA 2IPMA 4W5TA 3BREA 4Z4HA 1EFAA 1Z13A 1TMYA 5KQPA 1F51E 2M1ZA 4RK5A 4QICA 4LRQA 4XXHA 2IPLA 5JNUA 4RK6A 4Q7EA 4RK7A 4XAQA 3HO1A 1NXTA 1DBWA 4P1ZA 3CZCA 4ETNA 2PMCA 1GCAA 3Q15C 5JNTA 2WB4A 3RVNA 1DP4A 3RVKA 5JNVA 4RZSA 5JNSA 1M2FA 1DG9A 1NATA 2FTKE 3CHYA 5KC9A 4HNSA 2OQRA 4YS6A 4EVRA 3F7NA 4KV7A 2FEPA 5FBKA 1LK0A 4XYQA 3G85A 1QO0D 4W5RA 3O1JC 2FMIA 1CHNA 1SXGA 1YMVA 2JBAB 4HNQA 4DN6A 3BS1A 3GRCA 4JOQA 3MF4A 3KYIB 3EGCA 1EWTA 1RXIA 3CNBA 3UK0A 3S99A 1QP7A 1RPJA 4RKQA 3JPYA 1AB5A 4XASA 2AYZA 4KMRA 4RDCA 3K9CA 3IP9A 4G4KA 1U0SY 4IF4A 4QYMA 1NXOA 1KRWA 4B09A 1BA2A 1A04A 4JA2A 5FWXA 3CS3A 3C3MA 4RY8A 3I5AA 4TMYA 3LMKA 5IX8A 2V0NA 4IMJB 3B2NA 4S05A 1NXXA 4NCAA 3LUAA 4LE1A 1DBQA 3LTEA 4G97A 3OLXA 4MQEB 3F6CA 1WETA 3SY8A 4PICA 5IULC 1VPWA 2H3HA 2WJWA 4ZMRA 3UUGA 2VUHB 5TQ2B 4E7OA 4F3TA 3RVQA 4WXMA 2QVGA 5BRAA 2MYTA 3RQIA 4ETIA 3HUUA 5TE9A 3TX6A 2QXYA 2GX6A 2JB9A 3IDOA 3FFWA 4TLMB 1KRXA 3ROFA 1BDIA 3QLTA 4N0QA 3OLWA 1PNRA 3IP6A 1Z12A 3L6UA 3OO0A 3SG0A 2HPHA 3E3MA 5TQJA 2RDMA 4CBVA 2PUFA 3CTPA 1EWKA 3RH0A 2P9HA 3IPCA 4O1HA 3LKVA 4MQFB 3F73A 1LJUA 1NY5A 5HKOA 1YIOA 2FXIA 4MS3A 4S04A 1ZVVA 1QO0A 4GPAA 1Z2EA 4Z99A 2JK1A 2PLNA 3MYYA 3IP5A 1M5TA 4MS4A 4Z9AA 4N76A 1PHRA 1FQWA 1QMPA 1W9HA 3EQZA 1D5WA 2MSWA 2E4WA 5TPWA 3E61A 1I3CA 1EWVA 2FLWA 3CLKA 4RK1A 3QEKA 4FB4A 1JWLA 4JB2A 1Z18A 2CHFA 4QYWA 5D2CA 3L49A 2MYPA 4EYQA 5BQ3A 4KVFA 4RXUA 3O2SB 4PEVA 3D02A 2MYNA 3MIZA 4TLLB 4MQEA 2B4AA 1YS7A 1L5ZA 4MR8A 4PZ0A 5IEBA 1DRKA 1C0EA 2ZWMA 5CNMA 4EYKA 3H6HA 1NXPA 5IUNC 1SD5A 4MR7B 1NTRA 3RVMA 2PL1A 4XQQA 3BBLA 2QV0A 4IMIB 2QSJA 3DGFC 7ABPA 4OLBA 3NBMA 1IIBA 4WUTA 4RXTA 4G0OA 1KGSA 4N03A 3H6GA 1ZH2A 8ABPA 1P2FA 1W25A 3O1IC 4E7PA 3SM9A 5EWLA 2FMKA 1M5UA 4OATA 2NT3A 3DBIA 1R8JA 2FVYA 3RVLA 3Q7TA 3IP7A 5TPZA 4L4UA 1QPZA 3KLOA 3H5IA 1BDHA 3HK2A 3O2QB 1JX6A 4YWHA 3H1GA 3C97A 3JVIA 5KWSA 5JNWA 1SXIA 1YTUA 1MAVA 1LBHA 2PL9A 3GBPA 5EWJB 1ZITA 3H5WA 2Q5CA 3UKJA 4G0YA 4EGSA 3F6PA 4MAAA 1DC8A 3JS5A 3QLUC 3KCNA 3QLVA 1MIHA 4IRXA 4EUKA 4MRMB 4MYRA 1JF8A 2E4YA 3OM1A 3C3WA 1ZN2A 1DCKA 4JAVC 1K68A 1RXEA 4L85A 3CG0A 3A3KA 3T38A 4NICA 1TLFA 1JBEA 2WRZA 4G86A 3EQ2A 1TJYA 1ZY2A 2R48A 3O21A 1Z2DA 2CWDA 4YO7A 4DQDA 4O5AA 3QX8A 3T95A 3JTEA 3H1EA 3H1FA 3LOPA 1EAYA 2FLKA 2TMYA 3LUFA 4WZZA 3GBVA 4F06A 1VRVA 2GKGA 3CFYA 4O1IA 3I42A 1D2AA 4MPTA 3SQNA 2JBAA 3MQ4A 3QELB 1USIA 2WWVD 4ZJPA 3T8YA 4MS3B 5KC8A 4Z4FA 1MVOA 4LE2A 1SRRA 4KFCA 4Z4GA 1JYEA 3H75A 1FFWA 4KK3A 3C3KA 1Z26A 1USKA 3O74A 4JB0A 4YLEA 3RVOA 4Z4IA 2B1JA 3CZ5A 1E6LA 4P98A 1JDPA 4KK4A 2IYNA 1P6UA 1YK1A 4PYRA 4IGAA 4WT7A 3H5OA 1P8AA 1QQBA 2IPAB 4LX8A 1Z25A 3N75A 5CNIA 2H0AA 2PUDA 5HQJA 1BAPA 5TQ2A 1VKRA 3KS9A 3LKBA 3EAFA 4LDAA 3HVRA 2L18A 3SAJA 1XHEA 5EWLB 3HDGA 2WMYA 3A0UA 3BRSA 1ZESA 2HQBA 2ZAYA 4LE0A 1XWWA 1GLGA 1JL3A 2HQRA 4OLAA 5IUKC 4UHJA 2FMFA 1DCFA 4Q6WA 1DC7A 4FE7A 3N0RA 1TVMA 4KREA 3EJWA 1VLZA 4ZMSA 3A10A 2MSKA 4RSMA 5KQGA 1ABEA 4EVSA 4NQRA 3N6VA 1PUXA 4Z4EA 5E3JA 1PEAA 3LUCA 2FN8A 1JFSA 4DADA 1DZ3A 3KTOA 3Q41A 3QLUA 3RVJA 1L5YA 1Z17A 1E6MA 2IPNA 3FGZA 3QEMB 1YMUA 3KLNA 4GNRA 4WXEA 3QLVC 5B3JC 3FDFA 3NHMA 2L17A 1QP0A 1JLKA 2CHEA 5CHYA 1FSPA 4H60A 2OENG 2IKSA 3IPAA 3KG2A 3G1WA 3URMA 3CRNA 3DGEC 4MS4B 3HEBA 3HXMA 3H5LA 3OMWA 3ROTA 4D6XA 2F8SA 2IOYA 5DLEA 4MLDA 3DLHA 2HSGA 4Z4CA 3NNNA 2FN9A 3GL9A 5I4CA 3KYJB 4RK0A 3HV2A 2A9OA 2IDMA 2JCGA 5IC5A 4G0XA 4WWHA 2CD7A 4N0PA 4UHKA 5FWYA 3M6MD 2LP4Y 4RXMA 2HJ9A 2ID9A 3HDVA 2RJNA 5DGCA 3N8IA 4N41A 1QP4A 2AYXA 1KMIY 4OG2A 4KRFA 6CHYA 3QELA 5DCLA 2P4UA 2FEWB 4MLCA 4W5OA 1Z16A 4Y9TA 3NHZA 1J56A 3LUGA 1T34A 4RWEA 1NXSA 1C4WA 1ZAYA 3EULA 4YGXB 2PE5A 1EHCA 4KZKA 3OLYA 4IILA 4KQ9A 2GBPA 5HM6A 1RNLA 5KI6A 3GT7A 3M9WA 3O2JA 3QEMA 4MR8B 4QPJC 5TPZD 2PUBA 2X7XA 4RU1A 2RGYA 3NNSA 3KHTA 3D8UA 3ILYA 2R4QA 3OQMA 5GQSA 2KYRA 5F64A 1BDJA 3BRQA 3RVRA 4KPYA 3MA0A 2R47A 1NXVA 3N0WA 5BRJA 4LZLA 4RS3A 5EWMA 1QQAA 3O1HB 4YR7A 3LUJA 5TQ0A 3A0RB 6ABPA 3GYBA 3OMXA 3QX9A 2BGGA 2GI4A
chains in the Genus database with same CATH superfamily
4DR7Q 1MZVA 1S01A 2X5NA 3BSYA 4KKUA 1GHTA 1Z0DA 2EJTA 3GF4A 4ND2A 1A9XA 5FOTA 2O3UA 1EQ2A 2V6FA 4UEOA 3JQBA 1DV2A 4G89A 4EY4A 1Q0QA 5K0ZA 4QM6A 1IQ0A 4Q3OA 4HD8A 1S72A 1L1FA 2PUHA 3MJCA 3KRTA 2IEIA 1E32A 3RLNA 2WICA 4FNOA 1YE5A 4PV7A 1HFKA 4RFSA 1E2JA 4URUR 5DHUA 1SJED 4NAVA 2I80A 4P0QB 1I9GA 4NARA 4EUSA 1DJLA 1WTHA 1ISRA 4BJ6A 4PPQA 1Y3IA 5D51S 2J59A 1JPVA 2H5JA 1ABFA 2OCAA 3JQGA 3MC1A 4HXGA 4JZKA 1P4JA 4ZAFA 4GZYC 3C14C 4OREX 9GPBA 4WOJA 1NU6A 3L7ZC 4GPEA 1K9MC 5CLJA 4TV9F 5CEEA 1LK5A 3ETHA 1O6GA 4M0LA 4UTXA 4A6DA 4HLCA 3I73A 2KHSA 5H02A 4ETWA 5IDWA 3TMEA 4FP5D 1XRPA 2GEUA 1SBZA 2HHAA 2VB2X 2VUMB 2VI5A 3Q0EA 4DPMA 4F38A 2XQFA 3MAAC 1P5RA 4L07A 1TU3A 4ZK2A 5CLIA 4P5EA 1DWOA 4QTYA 2GT1A 5A02A 4BCDA 1JFVA 3NSWA 5LP6C 2ZBRA 1YDEA 1W5EA 4OL9A 3NHLA 3NC4A 4HOYA 4YP6A 2Y0SG 3T1OA 4DFDA 5JFGA 1TIPA 3C3PA 3K09A 5A3RA 3A3NA 4BGEA 5CD1A 3IKTA 1LSJA 4CPDA 4N9PA 2XUQA 4N8DA 3EFOA 5GZ3A 3UK7A 3CVUA 4F9GA 4LUVA 4B3TL 2KLBA 1Q44A 2JA7H 2O7RA 4DZZA 3CU5A 2Q4DA 3R23A 2LXJA 4IZ8A 5I7AA 1VQHA 3D6CA 3ZGVA 3V00A 4Q03A 1HTBA 3GFBA 4EWLA 3GRRA 3VYTA 3RVPA 3W8NA 5HIIA 2BTQA 4YP9A 2ATIA 2QTMA 5DBFA 4BLRA 4D74A 3F3YA 4YCSA 3AERA 1W85A 4RVDA 3ZVKA 1DGQA 3AHGA 4H6WA 5A2QA 3EJIA 2IRWA 5EZSA 3G89A 2AMFA 2A57A 2DJFC 1LB1B 2QVYX 2XDWA 4B2LA 3C45A 5JNRA 3DHVA 1V35A 3C87A 5IBRA 2F0TA 1C30B 4W99A 4BBAA 2D2XA 1D6EC 1XXGA 1E20A 2XAAA 1IZ6A 2VDLB 2ZJ0A 3CSUA 2UV8A 3PF4A 1A88A 1E3JA 2A9RA 2YCBA 2N3ZA 3B6ZA 1KLUD 2AJ8A 3SYKA 3T4AC 1H1LA 1P3DA 4FSXA 4UEKA 4YPVA 5CG2A 4EZIA 2M2IA 2VZ0A 1N75A 2EX1A 4K9SA 2XW6A 5FUWA 4JXKA 4EPWA 4HJ7A 1HLGA 1ZD8A 3GR6A 3MA2B 3OF3A 4IQFA 4UOQA 3UEOA 3S7ZA 1PTOH 2QE7A 3IOCA 2A5JA 4NMLA 5C5IA 3BE6A 3ONFA 3ZTYA 3V8NA 5JWRA 1SBQA 3GTGB 1NBEA 4CM4A 3HOVB 2XYHA 1EIYB 4NHEA 2N49A 1S2GA 2HHLA 1YH3A 2F1HA 1KDZA 3GNQA 3HI4A 4HCEA 3K7AB 2CF5A 3EBEA 2PN1A 2QV7A 4CTOA 1U2PA 1V16A 5E8JA 2P67A 5B7QA 5D87A 4IX9A 4A3CG 1XJ0A 1JEDA 1Z62A 5KVQA 2DNCA 4JA0A 4DCPA 1BU8A 2XZOA 4JV5B 2HPVA 3KF8A 1Q1QA 2HMTA 1Q91A 3BD9A 4EW1A 1OYOA 1F9QA 3UMFA 3ZNPA 2GXAA 4JASB 1NNUA 3HJCA 1ZDMA 2HCTA 1KIAA 3RLFA 1JICA 1DT5A 1LJ8A 3AT1A 3FR7A 2D13A 2L4NA 2Z9CA 2ZR7A 3HN7A 4DEYA 5HKKA 3ULPA 4G1EB 1ZL2A 1GKIA 2X0RA 2DP4E 4LRYA 1L5LA 2FZEA 4B35A 3CKMA 3T3OA 2OPHA 4X8HA 5TIIA 5IS2A 4IDHA 4F11A 1CUEA 1HDCA 2VWGA 1MZPA 4NCHA 1MIUA 4GOPB 1B7GO 1BRTA 1WCIA 2EQ5A 2Q5FA 2OOSA 4J2HA 3TNLA 5MDHA 1JFRA 1DX4A 1LT6D 1N6OA 1UBUS 3AETB 2H63A 1QHNA 1LKZA 1U2QA 1R6VA 2I66A 3F6EX 3SZOA 3WMFA 5MN6A 1E5DA 1C9MA 2B30A 3PGZA 5IJ9A 3FDIA 4GBED 4P86A 2NBFA 5DBEX 1AMOA 4N5NA 1T0UA 2ENWA 4IALA 5F33A 2EX4A 3F2IA 2PGIA 3O90A 3QPAA 4MDHA 2IZ1A 1ZN7A 4J90A 5F73A 3ZWKA 3K9WA 1ARZA 4WZBA 1M75A 5EJIA 3U3MA 5TXGA 1JFTA 1P0QA 3CJTA 2AUNA 3M89A 1GQSA 1SB8A 1Z6HA 4NR0A 4RMHA 5MFZA 3FYUA 4RV5A 4ZCTA 4DV7L 4KZPA 1B76A 2HUPA 2I8AA 2IPMA 1T2AA 2BDEA 4FYJA 1PHJA 3CCVA 4UUQA 2R8EA 3DG9A 3G3EA 4V0ME 5BW8A 5J2UA 4RQUA 1BC5A 3HUFA 3TBHA 5KB3A 1HDYA 5JNWA 4GX1A 1RR6A 2JARA 3AY3A 4WA8A 3GIDA 1N5JA 2ECFA 3ZDXB 2VJAA 5AHOA 2WWFA 3UG7A 5G53C 4XIGS 2QG6A 5B3AA 4DUYB 4BMNA 2C9OA 4ULLA 4RE5A 2QMZA 2RK4A 3RIMA 4WXRA 4EFKA 1YVPA 2PUTA 4WQMA 2PZUA 3TZDA 4RVSA 1KDVA 3HOYH 3OG9A 4TTVA 3V1NA 5JZ9A 3U1BA 3GDOA 2QVLA 4IPTA 2AJDA 3GLGE 2F0PA 4KHPL 1PTJC 3AWDA 3G1UA 4K1LA 5K8LA 1KOJA 2ZPAA 1AMUA 4BV9A 5B37A 1GZSA 1A9OA 1Q57A 1TA4A 3E7PA 2BA0A 3Q1KA 3T1TA 1FXUA 1JG1A 1R1DA 4FYHA 2W2NA 2PMBA 4FZVA 4QXQA 5K0JA 2W8BB 4WKNA 4CCSA 4U39A 1R8YA 2VTDA 2H7VA 3LVQE 2NP6A 4Q3CA 5CK4A 1SVWA 2Z4IA 4YRFA 1FFEA 1XWIA 3X1KA 1KRHA 3VPCA 3K20A 1JFLA 3KAJA 1T13A 4LRSB 5E6SA 2IV2X 2UUAQ 1UOPA 3RHFA 3UATA 2JD2A 1AV7A 3CLTC 3NRBA 3WK8A 4CCYA 4CM3A 4KUEA 2CGEA 4P92A 3CCQA 1OAOA 2ZKIA 1F2UA 1TWGH 3QEOA 1YS2X 1CHPD 3A1SA 4IZIA 4P7KA 5KPJA 4HAEA 1RI3A 4Z7OB 3O4HA 1AKMA 1MB4A 2FQQA 3PD0A 3KLWA 3ZE8A 4KMRA 5BT9A 2ZSKA 1DRUA 3IP9A 4ME5A 3EPRA 4Q16A 1ADFA 2PRZA 3STVA 4Z7JA 1VKOA 4RW0A 3WTCA 1U7UA 1B8OA 4KMSA 3ZWWA 2XMQA 4EB6B 2CH4W 1P7CA 1DMSA 4AUKA 4H7EA 4EY7A 2V5VA 2V6IA 2O48X 2JEOA 3GUZA 4JA2A 4RA6A 1S2OA 4Q4HB 5EFOA 5FWXA 2J0VA 3ZWOA 4DXDA 2JA8G 1A63A 1FP6A 1PVVA 4HNGA 4MPDA 4TMYA 3UMRA 2ZCVA 4E2WA 3DBRA 3PGXA 1STOA 4B8ZA 2X76A 3OCUA 3K8AA 1DARA 4LXQA 4AJLA 4DAOA 5I3ZA 1BYIA 2ZVQX 1DJOA 3T53B 1U4PA 1FF9A 3DBHA 3PC4A 2NZHA 3M6IA 3R3YA 1N2OA 2YXLA 5KOJB 1RHQA 2I76A 2GDJA 1P33A 1U7OA 1CY2A 3UUGA 3M9BA 3RIEA 4MVJE 3AF3A 3ROZA 2PQ2A 3I05A 1PJAA 1KKMA 4ZK9B 3H3VH 3KVYA 4L9AA 5E1FA 3S68A 4XVCA 1SE8A 4OGKA 4TM7A 2CWPA 4TVOA 2B20A 4B9EA 3BHJA 2B2CA 1YUNA 1VG9B 3ULLA 2GNPA 4JBGA 5AM0A 4PO9A 4D3FA 4YMGA 1LRJA 1P4HA 4S2EA 1XWEA 2H0QA 2NVXB 5DCUA 5LWQA 4YJ2A 4QRDA 3FF1A 4RF2A 3QF7A 1WMBA 1PL8A 4RVGA 4ZU6X 3TTWA 5JQGB 1T9GS 1W73A 3MCWA 4XYLA 2ZB3A 1BNCA 1QE6A 4P81A 1O6BA 4Q01A 5KTTA 5HM8A 4JI0B 2QTFA 1TKAA 2IW1A 1Z2EA 1RWVA 1AHNA 2WUGA 3MOGA 5IYCG 4DANA 3O8CA 1RHKA 4WK4B 1BCSA 1KFBB 1NR4A 1KY5A 1QUEA 2ZJ2A 4ECEA 1H2WA 2Q2NA 4RG1A 2IUSA 5FHRA 1IOWA 1FDOA 3G0BA 1ORWA 1YVRA 2ZOSA 3HDTA 4QDOA 4C06A 2ZGVA 1IZ9A 4GXTA 2E4WA 4UM7A 2ZTCA 3S14B 2Q27A 3COSA 4OQXA 4YYZA 2P5SA 5T64A 1LO5D 3AFPA 4IEEA 1JWLA 2PX4A 4QDJA 4QYWA 3SJ7A 3SS9X 1ODLA 3GTQB 2HA6A 4ND1A 5FJIA 1XTIA 2PO5A 3ZY3A 1ONNA 3QJGA 4B8YA 1I4GA 4WKBA 4ZYXA 2Y93A 3GLHB 2ZYAA 4E2YA 1VLMA 2WA1A 5LHY1 3HDJA 4B6OA 5FUQA 2ZUFA 1I24A 3FTEA 3TUZC 4KR9A 1Z5ZA 1V1JA 3LBNA 4DWJA 4HJ8A 4RF4A 4JT2A 4BFWA 2EF1A 3TGWA 5AI5A 3LI2A 2PVCA 3UJDA 2OXEA 3OOCA 2ZRBA 3DEPA 3AESA 3FG9A 4HVAA 4ISBA 2CNWA 4RH0A 2KQUA 4WPGA 1IY9A 3EZNA 4LC1A 3U3OA 3TOXA 2VJOA 4PLVA 4XUCA 1NQTA 2H2IA 4CM1A 3BG3A 1U0BB 1BBXC 1IXYA 4Y2SA 2DQ4A 3K6SB 1L0YB 4JI4L 2J41A 1WCV1 3NANA 3VO8A 5DM70 1CLEA 2BSAA 3Q7TA 3BU2A 2K5DA 4J8QA 4KQWA 5F1PA 2BFBB 4W9MC 3EZ7A 5J4YA 3FCAA 3GTGH 1I51A 4RH6A 4FDVA 2HA0A 2Y0BA 2D1RA 5D5HA 4IF6A 2KA7A 1M2GA 3WLJA 4NHOA 1D4OA 4KLNA 4WVFA 1XDDA 3TAHA 4Z1MA 4JLWA 2PW5A 5AK3A 3GBPA 4YJ2B 1KIFA 4MH0R 3GGGA 3H5WA 4TXMA 5AKJA 4DMFA 1JB9A 1X74A 2GFHA 5C7LO 2X8WA 2W6OA 1LH0A 3C3EA 3DUWA 1EJ0A 2V4UA 1I7SB 2JHGA 3KCNA 3M4NA 4EUKA 3FVWA 3O0TA 2LCQA 4CF6A 3HI6A 3FKJA 1AKWA 2PBFA 4DAVA 2XWSA 1PV2A 1RT9A 4L5QA 2WVGA 3KWLA 3A6EA 4HAZA 1YB5A 3CF6R 1ODCA 3OFND 1PH8A 3RKUA 1YIJA 4WLFA 1DCTA 3IMEA 3R5SA 1U9RA 2X8JA 5IKPA 1I10A 1X7DA 1KH3A 3EQ2A 2HAEA 4N5LA 1P73A 1EWHA 1G1MA 2KX7A 4IV5A 3UJBA 1ZYUA 2VBFA 3W90A 3U09A 2OVFA 1CJTC 2V7XA 4EJSA 3D6HA 3H1FA 2YWXA 3LUFA 4K8RB 4RE6A 4XDGA 4AO7A 5CBPB 1YA6A 4JI4B 1Z7WA 3AONB 3LA8A 5J63A 4NXNB 4EVQA 1CK1A 2JBAA 3FCEA 3CVXA 5ILGA 2XMRA 1MFZA 4HF7A 3DTYA 2R93B 3PQ4A 1G42A 4X64L 4CM8B 2WSYB 1EUZA 3GQVA 3OZCA 4KLRA 1C4OA 1VQ9A 3KLPX 2ES4A 2XDQB 1GV1A 4X5OA 5HOEA 3GZTB 3SR0A 5DMHA 2WZDA 1CWUA 2Q2OA 3CQZB 2YH2A 3RVOA 4BMDA 1FFYA 4TQGA 2J87A 4XVHA 3Q7PA 1XD9A 2Z58A 4IPHA 1AN8A 4EKIA 1YRAA 1Z7YA 1U8CB 5K6AC 2WSSD 1JMYA 3TFOA 1L4BA 4TTIA 1XTBA 3QVTA 4RGNA 1N0HA 2OCLA 2PNHA 2Q29A 1DZIA 3VBCA 4FDUA 5EJ8A 5FUXA 5TS2A 1QGYA 1IOZA 1Y37A 1F2MA 3HL0A 1ISGA 1B26A 1O2DA 4GMHA 2IVFA 4MQUA 4IHJA 4P6VF 1K73C 1STEA 3EY4A 3HFJA 1UFQA 3PGKA 4ZAZA 3T7KA 3TQYA 3CZAA 1R0BA 3RJTA 2OT2A 2I34A 1ZXBA 2XCRB 4QEDA 1L8XA 1DQZA 3OIPA 2REBA 4S12A 4YI3A 5ECYA 1TVMA 2BEUA 3ICWA 5CFZA 5JLJA 5LA6A 3AJ8A 1CUBA 1HZAA 3VAZA 4N65A 2GAIA 3BQNB 2BISA 4F3YA 3ZK8A 4NDNE 1QRAA 2VRCA 4AZ3A 4ZOLB 3WYNA 4CHTB 1BOOA 2OGZA 4DA8A 1GEEA 1RQ7A 3STWA 1NE2A 3AF4A 4MIOA 1FDVA 3Q2IA 4WLNA 4EHAA 1V7QA 3CRRA 3I04A 3Q41A 4FINA 1ZL0A 1P9NA 4CVNA 4YTEA 4YQZA 2EBFX 2VHXA 3FOCA 1RQXA 1SKUA 3HR8A 4H16A 4S0XA 5K0BA 3H2YA 4LNUB 2HL6A 4D8YA 4OHBA 5CTAA 3AKZA 4N6NA 1VRCA 2ORIA 3PC3A 4UDOA 4B5LA 2G77B 2EJFC 5K2OA 2CNNA 2IZ5A 3RZOH 3S1QH 2GZSA 1LQTA 2R00C 1CDDA 1G8MA 4IWNA 2OK7A 4JUCA 3QWNA 3KUDA 2OHHA 2RONA 2MHVA 3P0FA 5EIAA 5DK6A 2JFXA 3AOEA 1CKEA 1PJQA 1QTIA 5EPJA 3C2QA 2CK3A 4ZVSA 4EA7A 5DRTA 2E48A 4QUAA 1G60A 1ZG3A 3LOUA 4OLHA 5KHAA 3UHAA 3VU9B 1D6SA 2L69A 5IC5A 3H0GB 3SEAA 3RCBA 1WP9A 1SR3A 1PNQA 2BJHA 2GK4A 3C3CA 5GZ1A 1JWUD 1L7DA 3CR3C 4J0KA 4ZYZA 2JH8A 2XD9A 3RSHA 1GQ2A 4FMDF 4B6JA 2Q45A 3NONA 1XG5A 3IDAA 2CW0D 4KNWA 3T13A 4BAGA 4F1KA 4AECA 5HGJA 4YUYA 4KI0A 2JCYA 3IUMA 5KWIA 2ZUWA 1E1QA 3DV9A 4YHHQ 4WJLA 5CW1A 3CUVA 2ASVA 5D00A 4A3JB 2K2QB 4WXHA 3VR1A 1FIUA 1T5TA 3RIYA 1A4XA 3A58B 5K3EA 5BV1A 3LUGA 2VDKB 1H4QA 4D79A 2O8DB 1YUBA 5KQSA 4DMKA 2XMDA 2VSOA 2AI1A 3IIEA 4ESOA 5DHQA 1SPBS 1R4AA 2VT6A 5K36G 1I5EA 2XQIA 4D3ZA 4LHYA 2PUBA 4WXPA 4AKEA 3N74A 3Q8WA 4HWTA 3Q12A 2QRZA 4BVFA 2YDXA 5BOSB 2QRPA 5LOVF 4DUGA 3GZJA 4M0UA 2ZAIA 2PIDA 2DQYA 4QUHA 2JHFA 1LTBD 2CVZA 2F03A 3CRKC 3OPYA 3VVCA 4WA7A 4LYDA 1NXVA 4QDXA 2EKBA 2BUAA 2ZYIA 4Y30A 3DM3A 4G0VA 4QUCA 3F2CA 2BFPA 4DR3L 5ALXA 3UGTA 1EYCA 1H5NA 2NNLD 1R16A 2QJTA 4O0MA 2GXQA 1TA9A 3A0RB 3D9QX 1IPFA 4US0R 4XM2A 5DX1A 3RYCB 3C3BA 1RHUA 3DE2X 5FCDA 2IS1A 1U9ZA 4ZVPA 3I1IA 1ATIA 1E1RD 5ELFA 1H85A 1XZMA 3SGIA 1DAFA 2GBLC 2N46A 2BGGA 4G5XA 1J8FA 2WFLB 4UD6A 2NV0A 1EESA 2C4UA 5KAMA 1GUTA 2DLCX 1UFKA 3L4KA 4B87A 2GCNA 4DLSA 4ETMA 2PKYX 3I52A 1J09A 1DDGA 2Y05A 1Q92A 1Z08A 3K80C 2QMUA 3PDJA 4FILA 1VXOA 3QOLA 4XYOA 4L51A 1GA1A 4G37A 2ILVA 3QEJA 1LTKA 1AUXA 1TNDA 4KQMA 1UBCA 1EIZA 2FEMA 4DK0A 1PH5A 2CZCA 2ECPA 3H11B 1L1RA 1X1DA 3LC0A 3PHHA 1FFBA 4IZHA 2G1AA 2RB5A 2GD6A 3JD0A 1CZHA 1WPRA 3IOBA 1YCHA 4HDMA 4A2PA 1AZQA 2C2YA 1JDBB 3L7JA 2PJUA 2XUDA 5E95A 4A8JC 4BMVA 4I36A 4B9XA 1WM1A 1IMOA 4ADSG 5BWNA 5C37A 4DR6B 5DWVA 3NOQA 1VLJA 4F4UA 1BX3A 2FQ1A 4G1UC 4FMCB 1SXHA 3M4YA 4WL0A 4X8LA 3SN6A 1GD7A 3RKRA 2OFXA 1CA5A 5CX1B 4O2BB 2O07A 1DAEA 4CDRA 3L1UA 1HI9A 4JMPA 4TLCA 5EXXA 1STHA 2J9FA 3JATB 1IKLA 4PMCA 1ZH0A 3BE8A 4N47A 3WGZA 2Q1XA 3ZWQA 2E49A 4DQUA 3D7MA 2BUCA 2CHQA 2VTVA 3BPSA 4TL7A 1N2HA 2VDWB 3H2SA 1T26A 3RNUA 2ZJYA 4HQRA 5AW4A 4ABTA 4UVGA 2H9AA 3ASVA 3L0YA 1OFVA 2FFJA 1H9AA 1O6ZA 2JIOA 3D2LA 3JQRA 4GM0A 4HDRA 4BMPB 1J70A 5EWJA 1MTOA 3C8DA 4O4HB 3VZBA 4Q4HA 3VSEA 4YUAA 1TGYA 4LYYA 3FJOA 2F3WA 5BW4A 4C3JH 3GVHA 3OWHA 2J9YB 4MAFA 3HM9A 4HZUB 4UU7A 5FTNA 5HZGA 5LBUA 4LF8B 4PVDA 3GA0A 3O8NA 4Q4LA 6NULA 4NCBA 3OCWA 3PF9A 5EC8A 3WDLA 4TUYB 1UM8A 1CFMA 4B75A 3U1VA 2KVMA 4E4YA 5K6RA 5CA1F 1L5HB 1TYCA 3NTIA 1N36B 2SNMA 2ZTEA 4IUTA 1O7YA 1PD1A 3FFTA 4ZOEA 5CDYA 2P35A 1EK1A 1H6AA 2AX3A 4GSLA 1FU7A 1NBIA 4KRXA 3DOJA 4K6MA 1KMHA 1U3WA 2BF4A 5EZYB 1YK0A 3S0JA 4ZVMA 1OPRA 3H9BA 3BMXA 4OQLA 1ONSA 4B3RB 4X3OA 3AB7A 3O38A 2NW6A 1RWXA 5GGYA 3IP3A 3W34A 4P5DA 1FJHA 2OP0A 2EL9A 2JQOA 1M1UA 2EYQA 2VYFA 3KLMX 4QYIA 4YMHA 1Z15A 2LVBA 3UANA 2Z57A 3NG1A 3D4NA 3EZYA 4LHEA 1DEKA 4Y1RB 5G3YA 2PUCA 3B1FA 2UZ1B 4KGDA 3P9NA 4YV0A 3IUSA 4IJ6A 4OQZA 3ESXA 3KSDO 1VQ6A 2YIDA 1FRVA 2C3PA 1XYIA 1Z3CA 3EA5A 4X7PA 1DQSA 5AJXA 3TEFA 4BA2I 1SKYB 1R5JA 4BLQA 3UAVA 2F4NA 1B2RA 1N2ZA 1NOJA 1Q11A 1SXJE 2OGTA 1QUQB 1JA9A 1YT5A 3C43A 1Y8RB 1T9HA 3LAWA 4FYIA 1WD5A 4URHA 5A3VA 3OIUA 1TKBA 2JJ1A 4RD0A 1SUFA 3FFXA 1AW7A 1KFKB 1NJ5A 2FWAA 1QX4A 2QI9C 2X9VA 2Y67A 3NHWA 1R0ZA 1R27A 3QWHA 4KR7A 3ERQA 1F8GA 2FZVA 2Q0XA 2R7NA 3GLVA 1Z68A 2C4WA 4C08A 2PWPA 3B36A 3HSSA 4HWKA 5ALUA 1U3FA 4WK2B 3SHWA 5ALZA 1NASA 1P80A 2VOEA 5GROA 1GCGA 3A8IE 2CEKA 3CUUA 3CRQA 5CFMA 2H2DA 3ZK9A 4ZXPA 3ZOZA 3QTTA 3T7JA 5H83A 5JVDF 2GEVA 4GDFA 5BN4B 2N47A 4ENPA 1VE6A 1EA7A 4C4SA 5AESA 1PGOA 2P2GA 2NTEA 3C4QA 2JA2A 3GV0A 2XB2A 3FTFA 3BAZA 4G0MA 1SZJG 2Q4RA 3L6OO 5TMPA 1HKUA 2FRXA 3ABSB 4BFLA 4CN9A 1LV8A 2Q21A 3QI2A 1REQA 1QKKA 4OV6B 2P6OA 4W1SA 5FNZA 1MC5A 5LWHA 4PIPA 3D4DA 2C5GA 3DW1X 2K87A 4QQKA 5G1NA 5AUNB 4FPXA 1GU7A 4DIUA 1TIBA 2FEKA 1E4EA 2WC1A 1P17A 1PNTA 1PJTA 2AJTA 2DC1A 2V1CC 2F1KA 2C3OA 2Z8ZA 3CA8A 3HCFA 1L7RA 3O84A 5EXEA 3E5RA 2C8VA 2UXBQ 2YWFA 4IRMA 3KSMA 1RAGA 1YKFA 4PIMA 4LFAB 3IEUA 4F6LA 1O6FA 1TMYA 3FSRA 2ZW9A 4MUNA 2Q6LA 1DQYA 1CQIA 1K0FA 4LAFA 3TOSA 4IVQA 1QWYA 3VR4D 5KQPA 3TQQA 1WTXA 1QONA 2CZQA 3HDHA 3HZRA 5JNUA 1QIDA 5SYAA 4Q7EA 5JEEA 1FZTA 1WD1A 3V4ZA 2O05A 3CWZA 3IVAA 2YWEA 1WXHA 1JG7A 1S5FD 1KZ1A 2J1LA 5G02A 5JJBA 1RL2A 4N7BA 4N3NA 4R6XA 2LGJA 4Z0PA 1XZJA 2E76C 2WB4A 4YXWD 2H48A 3OIDA 3PHJA 2EIFA 4HR7A 2C97A 4J7UA 1C7ZA 4JVZA 3ZQKA 5L8VA 2ZBPA 4I8IA 1HSZA 1R4ZA 4RZSA 2IEGA 1NM5A 5IGGA 1FS5A 3CN9A 3MWJA 1ENZA 2XKAA 4H1UA 4WFIA 2A4MA 3AZOA 4YB8A 3NEPX 3ITKA 2C7BA 4GD3Q 2KI5A 5JCZA 2QIOA 2AFVA 4YJGB 3UW3A 2IYWA 4I9FA 1CR6A 1QGAA 1G1AA 1HH4A 3ELYA 4R40A 4BWFB 4OHOA 5KYUA 4C5BA 4D98A 1QG4A 2Q1YA 3P5SA 4H1TA 4A8HA 1F2LA 1R50A 4KPGA 4WX2B 2ICEC 4TXJA 2HHHQ 2WQ7A 3JCZA 3BS1A 3QMMA 4ESEA 1JLLB 1N2BA 3U4QB 1R0SA 1ZUHA 2YZKA 1IVYA 4YAFA 5DRYA 3B9PA 4QNMA 3RRNA 3ZVNA 3CNBA 2V1XA 5C18A 5L6LB 2QRLA 3BH7A 5DEOA 4X00A 1XA0A 3AHJA 1GGVA 3DWEX 4DDHA 4L4XA 4D9MA 5H4HA 2PU7A 3LT5A 2AYZA 4ZEVA 3C3JA 3K9CA 4PC7A 4RFVA 3W05A 4G4KA 1YOVB 1GP2A 4TYPA 4ZVUA 4X7BA 4TV8A 2IOQA 4WZAB 5L4LA 1A04A 1AN0A 1G8HA 1PFVA 2F1OA 2HMWA 3DE4X 2OXIA 2W22A 1Q16A 1Z4PX 1HE5A 3W0LB 4UHBA 3WLRA 4RTQA 4O3MA 2W6JA 3ZWXA 1YZTA 2CLEB 2X6QA 1KJWA 1NW9B 3AFHA 2WHXA 4OQ4A 4Q02A 2X8AA 4BV8A 3K5PA 4G97A 1JW9B 2N3SA 4XWTA 4A92A 5IJZA 2I3DA 1K9VF 1CR4A 1XJVA 5K0SA 5EERA 1Q8IA 1JKJA 3VA7A 1PFBA 1XEAA 3ERSX 2MT9A 2HA5A 3RVQA 1BDOA 3NK9A 2X22A 4L50A 1AQJA 1ZINA 2IHVA 2VTEA 1J2EA 1TAQA 4OGWA 4ETIA 1RYHA 3QHQA 1YNNC 1K3FA 1C0AA 4YUVA 4LXUA 3VHQA 4DXGA 4TM8A 1ULHA 3WHKA 2JB9A 1FDWA 2NVUA 6YASA 3QU4A 1HF3A 2FPGB 4KDFA 2QMYA 1QFZA 1Q3TA 4BQEA 4DV2Q 3E3MA 1HX7A 2BE9A 3OP4A 1RE1A 1SM4A 1U3TA 1J5XA 3QKWA 3FSGA 2Y1OA 2NU6B 2Z2ZA 1QYIA 2FXIA 2EFEB 3QNMA 4GC5A 2WFLA 4IJHA 4FNFA 2CWAA 2Q8IB 3EGWA 4BMZA 2JLSA 2OY0A 1XPUA 1ZICA 2RG7A 1SMKA 1SVKA 2B98A 3IIIA 3NXKA 5LKAA 5LXTA 3ONNA 2NU7B 1S1CA 1G4UR 4EG5A 4DK1A 4A3KB 1GUAA 1Q5PA 4U0KA 1G3UA 1NMYA 1L1EA 4NXMQ 3AP3A 1NKVA 1A9XB 2G25A 4CG3A 1TKRA 3QKTA 4UC0A 1CK4A 3KQYA 1NJ6A 1G3RA 1NN0A 1P1RA 1QR2A 1AKQA 1NLUA 1IONA 2A86A 3FTCA 3L8MA 5FL7A 2OXTA 5BOSA 3L49A 5AJ3L 3QX3A 2HXSA 4X63A 2H7YA 3GI1A 1HNWL 4CQMB 2Z9BA 1KC1A 3TIGA 3CNHA 4DABA 1JR0D 1E5VA 4XDXA 3LY7A 4DNPA 3A9VA 1L4EA 1U99A 3OTWA 1KY4A 4G8CA 2FDXA 1MC1A 4OQDA 3KZCA 4YREA 3KDFB 1J07A 4ILEA 4P35A 1F6WA 1GQFA 4WDQA 3W5UA 4INOA 1ILQA 5BV7A 5HQ3B 5FEUA 1AH9A 2HNKA 4LTNA 4ILKA 1H9JA 5AJYA 4DAMA 3IO3A 5DT2A 3D3RA 2QAJA 3GT3A 5JS6A 2ZI4A 4WFQA 1BVSA 4MHEA 2M6RA 1WKVA 3RVLA 4Q05A 1W6JA 2YY6A 3IIMA 5TPZA 3TUJC 1RTTA 2A9KA 2OHVA 1WO8A 3FTNA 4FBGA 2VOJA 2I6QA 5AT1A 5EE5B 3CYFA 4KACA 3O2QB 4DR3B 4EQOA 1ZRHA 2P2LA 3PLAE 4LYEA 3F2UA 2H1IA 4CEHB 1W4CA 2NXEA 3V8EA 4PZAA 5FPHA 3S28A 4HWRA 4BQSA 2JA7G 3MEQA 4KQ6A 2R7KA 1ZC4A 3S6JA 4ALNA 1NYTA 2J3HA 4QU9A 1YHQA 1GUOA 2IOHA 3NDPA 2E2IB 5IMSA 1RHRA 3T1VA 1KQFA 1QAOA 1EXMA 4NEHB 2NZ2A 1SNCA 3QE2A 4RVFA 4OX9Y 1A6XA 2J5XA 1V9CA 3QVGA 5CH5A 5CV8A 3C3WA 2VXWA 1I6MA 3L7CA 4X1OA 3ZJYA 3L2PA 2V7BA 3U44A 2VZ8A 5EN4A 2QRKA 2QQFA 5MGBA 2FWJA 2W2KB 2PGNA 5JTTA 2ET6A 1JPNA 2AIRA 1ZY2A 4EJMA 2RK3A 2BBWA 4GNXB 1A77A 2ZYSA 3B48A 2O5IC 3PNMA 1UBHS 1XZAA 2AC2A 4LWPA 3SZRA 3T95A 3FGOA 4RPGA 4TQAA 4V1CA 1KC8C 4JBYA 3TD2A 3WIUA 2PV7A 1TADA 4GL2A 4IINA 4O6VA 4CUZA 1ZK1A 4WJ3M 2IP4A 4XR9A 1WB9A 3HL4A 3PMFA 2CMDA 4OQPA 5CTJA 5AWFC 2PJDA 4BBPA 5JARA 1HY3A 1X13A 1JA0A 2FP3A 2MR6A 5JH7F 5IT9A 1HTWA 2ANCA 4LZNA 1VKJA 1H1DA 3ZE1B 3FHCB 1SN8A 1QYXA 2ZUTA 1SOVA 1I4TD 2CL0X 3JD1A 4PX5A 3T9DA 2ZI3A 3S15H 1FVXA 1USKA 3K9NA 1O9BA 4F4IA 3S1MB 1DTSA 2Y0SB 2B1JA 1W0JA 1LTAD 2DG2A 2DPHA 3CZ5A 4XFDA 3ESAA 2A5HA 2I8CA 3MXOA 1W93A 4P9NA 4B40A 5JEAH 2VNSA 3W5CA 5J47A 1R8SA 4AH6A 2NACA 3BDIA 4LJ6A 4GS5A 3VOBA 1Z2CA 4N7JA 4G5HA 1Q7BA 5H81A 3KJNA 5THQA 1FTGA 1ZBDA 3TRJA 4FONA 3JVUA 4HFJA 5GM2A 3PR2B 4LDAA 1K0SA 2EJWA 2UVQA 3L9XA 3R3UA 4BB6A 4F5WA 3F2BA 1J90A 3TKAA 1H66A 5LQCA 2YWGA 4CF3A 2N78A 3HKBA 2RCFA 3WP0A 4JCVE 1E92A 2FEOA 4R3UC 5F3WB 2G70A 1SO8A 1E18A 4C4RA 5M3FH 3SK8A 4QRIA 5IGDA 1A5TA 3NASA 2HGSA 3PQ6A 5AI0A 4F9EA 4NYMQ 1YGPA 3ZQUA 2MPMA 3KQQA 4WNYA 3W06A 3ZBTA 4D0LB 5COAA 2O59A 2FMXA 2G1KA 2PKWA 4WFKA 4EPXA 4EVSA 4NQRA 3NTXA 3IRVA 5DFAA 1SBYA 3NB0A 1A8IA 4OF4A 3LUCA 3EYAA 3UUEA 3ZGOA 1F2TA 1DZ3A 4DB2A 2YWJA 1DELA 4AS3A 3KETA 5A4JA 1J5EQ 4H35A 2IPNA 1PLKA 3AF0A 4OL7A 2GBCA 1RW4A 2OL4A 2REQB 3FDFA 3NHMA 3OWOA 3QLVC 4GEGA 1T3LA 5CHYA 1WMAA 4D4IA 1WCXA 2QN1A 1R6UA 1AS0A 1DQPA 3D4RA 3FZYA 4NJEB 1OX6A 1Y1SA 2C00A 3E5MA 3IODA 4Y18A 1TC1A 4OMFG 1NV8A 3ROTA 1UPTA 2XITA 5M7EA 3GEIA 4C9BA 1MEEA 3WGQA 3FX2A 4B08A 1U2EA 3N2KA 3QVOA 3WIVA 1YE3A 4GOMD 4XJSA 2FP4A 4RIFA 4WBNF 3SJBA 4DV3B 4C3HB 1ITZA 1OX5A 4EG6A 1ETHA 2WDPA 2IDMA 2OGWA 1LBEA 3OC6A 1P91A 2XODA 3PD1A 4Q21A 5FA6A 1M6HA 1N9GA 4FGWA 3ERCA 4INAA 2JLVA 3WGJA 4RDIA 4DLLA 4EENA 1QNFA 3AR6A 5CORA 4TS4A 1IZ0A 1VECA 3IAM6 5LL6X 3PYLA 4OJTA 4U02A 4F1WA 2YU9B 2AYYA 4MW4A 5C3WA 5AW7A 3RFTA 2BKLA 3IFDA 3OFKA 2FEWB 3NT5A 4UUMA 5JROA 1WTPA 1PV4A 4RCYA 3W6OA 1JVSA 2WTXA 3AESB 4UTRA 1A3UA 1O7JA 4IOAA 2IYLD 2VDUE 4BNDA 4OFZA 1LSSA 3G79A 3PPVA 3E0EA 4X66Q 3VZSA 1GYPA 2H1LA 2AG5A 2JATA 1BD3A 1JHOA 3SE0A 1C1YA 1OLUA 1Z45A 1UWVA 1OJLA 1XO1A 3GJ4A 3JQ6A 4ENSA 3BT7A 4GPBA 2KMLA 5BNTA 4HQNA 1K8RA 4K5XA 1PDVA 5DHFA 3EUAA 3U31A 2HRBA 1R0LA 3KHTA 3U9OA 2XUZA 3FR8A 3EIEA 4PGAA 2XUKA 1VHLA 4X9XA 5CVEA 5GQSA 1ISHA 1D2CA 2GR9A 4PYIA 2PKQP 3FCOA 1KMMA 3A9WA 3PDIA 5CGQB 1ABBA 1Z63A 4KYUA 2POQX 4V38A 3BMQB 5EKLA 2EG9A 1EFID 2L0XA 1H2FA 4FHDA 1QS0B 1GJRA 3E7WA 3L8FA 4UQPA 2DWOA 1ZM2A 4KRGA 4BTEA 2I4OA 4BGIA 1OKKD 5FR1A 1BHQ1 1KJJA 3OA0A 3DO5A 1PN3A 1R9GA 2PSJA 1AXEA 4L6CA 1FMFA 1YQTA 3PPXA 2Z5VA 1L5QA 3SICE 2NO6A 2IUTA 2ZJ1A 2V96A 4LMBA 1UT6A 5FH9A 1MHPA 1DCMA 5IVPA 2QS9A 4XGIA 4ASUA 4GE3A 4IM7A 5LJIA 1XU9A 3ILHA 3M81A 3CB4A 4ZHQB 3W5BA 1P72A 2OEPA 1TXGA 3UG6A 1H22A 4GLAC 5C80A 3U7HB 4D8VA 3NIGB 3JQDA 3PG5A 2B83A 4G5QA 2AW3A 1KSHA 5ER9A 1TJ5A 2IYSA 3EE6A 4XD2A 3RTCA 2J5BA 3DC7A 5EIBC 4F8JA 3Q2OA 3OKCA 4CEHA 4MKIA 3OO1A 3KFVA 1XNQQ 2CL5A 5DTEA 3OBBA 3Q3JB 1DBPA 3HS3A 1SU4A 4FYKA 1GZ7A 1N1GA 3MMXA 3VYVA 4BRWA 4RKRA 5EPEA 2GKOA 5EE1A 1QOQB 2BA1A 3ET4A 3PJFA 1JQAA 2OD9A 2QPOA 4FOOA 3CH5A 3PDIB 1EJ6A 4PNZA 4W9NA 1PYGA 4ZJZA 3J7AC 1QGOA 3BJUA 5HBGA 4XXEA 4ND7A 5ELMA 1WUYA 1RKQA 4JT8A 4TVKA 1KZHA 2LWIA 1BKSB 1MSGA 1NT2A 4O8CA 2DFDA 5DLPA 2WV7A 3R20A 3K2IA 3KVNA 2X5JO 3WLOA 3G9TA 4F8YA 3I5YA 1BXRB 2W6PA 4W1PA 4C2UA 1NT4A 1CF9A 1QJ4A 1SYDA 3FYUC 3GFRA 2AUJD 1EDDA 3LZ6A 4X60A 4GN4B 4LVCA 4DR4B 3F1LA 1NHWA 3M7GA 1NJ2A 4K9LA 1ULBA 4DGSA 4DU9A 1FMLA 4W5NA 1E98A 3ILXA 4MYUA 1JECA 4O4IB 1G8KA 3UT6A 5FTLA 3DNFA 3WS7A 4BO3A 2ACEA 2NTYC 2X9QA 1I94B 1XELA 1FTYA 2QYHA 5BUCA 5GP1A 1U0OC 4ER5A 2ASEA 1VFPA 5L4SA 4AYXA 4NTZA 4HUTA 1U1FA 2O2IA 4JGGA 4UXHA 1MRNA 3AEUA 2BSQA 2H2FA 2PRIA 3R5JA 5DI3A 4J0EA 3U3XA 5D3DA 2A9PA 1ASYA 1Z5UA 2GF9A 5DDIP 3F47A 3PXCX 1L7EA 2JIZA 2D1SA 3JD2A 1WMDA 3ANNA 3MMNA 4AJHA 5TQ0B 4BRZA 1BN6A 1I7QB 1XNQB 1BRMA 2ZT8A 1X94A 4L5JA 3MRXA 3AVOA 1LNQA 4C3UA 1R3UA 3K0SA 1GR0A 2YN4A 3QOXA 3NR2A 4OB8A 1ZKOA 1ZCFA 1WVLA 4PLZA 3G0HA 3UC5A 1WI5A 3OJCA 1PT5A 3HN2A 5GAGC 1E3DA 1R0RE 1YHZA 4KWEA 1JBQA 2P3LA 3F9RA 4ZO4A 2P75A 3OQ6A 1Q22A 1SQGA 2P41A 3AF1A 3QUCA 4QFDA 1T9AA 2ZB4A 4OJKA 5I9LA 2JA9A 1R74A 4NOJA 4A3EG 1N4AA 1E7QA 3C8UA 4HRVA 2QJWA 4NI5A 3AVXA 4DLRA 4BNXA 1CZUA 3BB3A 4BVKA 4Z9CB 5FLKA 1GZUA 1P81A 3TNYA 1IWBB 2D6FA 1C50A 4KVGA 4NU0A 3VGJA 5LJLA 1QV7A 1VCHA 2IX9A 4EP1A 4F2WA 1X7XB 1QHYA 4C4TA 2RK6A 4ME6A 2GHTA 1ISSA 3SHLA 4FVMA 1EG2A 2EQSA 1N0IA 1WZUA 5C4JH 2CJYA 1VMDA 2FUKA 1SE3A 4K14A 1Y8QA 2D8AA 3KT8A 4LWOA 4M9XA 3BWYA 4NPCA 2LV8A 2XUHA 5G2OA 4JI7L 1SG6A 2OAEA 2PYIA 3ROMA 1IEXA 4MVJF 2EXZA 5J4VA 2JLCA 1LZLA 1Y63A 4FZ3A 1ULAA 3CCBA 3K0KA 8ATCA 2WQZA 1DIAA 1T1GA 1FSSA 1QNLA 3I3OA 4J15A 1JJ2A 2B99A 3COZA 3ECCA 5ALPA 2WF8A 1NMSA 2NVXH 1JYFA 2YN0A 4EQZA 5BUQA 3JAWA 4I0WB 3VV2A 2GRAA 3V8VA 3G68A 5ALOA 3FUCA 4PLCA 4ACAA 5LSAA 1PT7A 1YCDA 4JY7A 3CKYA 1X9GA 3KXPA 3E9CA 1EEHA 2GPNA 3QPWA 4KP7A 1JHDA 1FP4A 3GWGA 4MRRA 5I9TA 4DV6Q 1E9EA 1M0SA 5IJ0A 3Q9NA 3H8VA 4DARA 4HNHA 1CU1A 1N3YA 2BW0A 4DV7B 4J49A 2SOBA 5CLLA 2DGYA 2B78A 2ZBDA 4EGJA 5C52B 1XQ1A 4F0JA 1C3EA 2JRLA 3K15A 1TWCH 4WIAA 4XX1A 3SSMA 1JCKB 4UAIA 1PW7A 1ZOOA 3BFVA 3MN1A 2WSIA 4DWWA 3SVMA 4MR9A 4FF4A 4YT2A 2W0MA 4CDEC 2OORA 1JAYA 4G25A 4GZLA 1II8A 4TX1A 5C4XH 2WABA 4JI8Q 2I7TA 2Y0EA 5IH7A 4W5TA 4CDGA 5K01A 5DM63 1Y5LA 2IHUA 3B7PA 1AE2A 4D57A 1PW5A 4EUFA 2K4MA 4UU0A 2J3LA 3T7IA 3ZLJA 3I37X 1LTTD 2A1IA 1L9KA 4RK5A 2WUDA 2O2JA 2XADA 3GARA 5JD4A 1F7UA 1YR6A 1EG7A 1RDFA 1N7GA 1YR2A 4PO3X 5DGIA 3UJ7A 5EZQA 1JU3A 3WXMA 1KEEA 5EEHA 4NP6A 3CURA 3KZXA 5TQVA 1U8ZA 1HBJA 4YJ2F 1E6CA 3STYA 3T7EA 2I6UA 5TC4A 2JLRA 2ZYGA 1I32A 5DB4A 3VDYA 1IBRA 1N2CB 3DBVO 1H8HD 3Q1LA 3X3NA 2CWWA 1JJAA 1RE0A 1EBFA 3LSTA 4CL0A 3UENA 2GVBA 2AZXA 1P1KA 3DDCA 4MJ7A 2BEWB 1FTQA 2BGLA 4DIEA 3FVRA 4CV0A 1V7ZA 5ERGB 5BPFA 3IKJA 2O57A 1N1DA 5K51A 1I4DD 3W77A 4BB5A 2HK8A 4CEIA 5HGTA 1SU7A 3OHMA 3WSVA 2EOAA 1E94E 4B4UA 2QMOA 4LFBL 4MSUA 1CJVC 2ZUDA 4U2CA 4LJRA 7REQB 2C4HA 3E5SA 1X3GA 1HNZQ 4AMBA 5HQ3A 1G5RA 2B4RO 5D6OA 3V6LA 4BX8A 1S6YA 4OMCA 3B1XA 3D3NA 4Q3KA 1GG9A 5IKEA 3JPYA 4RDCA 3HP7A 3VNSA 4DV5Q 2OXRA 7MHTA 1VMIA 5C0XI 3AOGA 4MMZB 4IO1A 4RKFA 4D97A 3T56B 2GESA 3FRPB 1PP4A 3KTFA 1O03A 1V8QA 4IXTA 4DYVA 2CFCA 3T12A 3MILA 1BXTA 3KR1A 1V43A 2YC2C 3EHEA 4ZC8A 3KPUA 1VQ8A 1GA6A 3CUKA 4IMRA 4REMA 5FADA 4ZIRA 3PQDA 3QE3A 4YI5A 1I5RA 4PX9A 1EK0A 1FNDA 1YA4A 2HC9A 3I8XA 1DBQA 1GRNA 1MNQA 5DPMA 2ODTX 5L3RA 4DCMA 1ZR2A 3Q3HA 1RYMA 4M0DA 1UBOS 2Y2VA 4RWZA 1GA4A 1OY1A 3K09C 1QVZA 1OZ0A 1PBTA 2OGSA 2EEPA 3JARA 3LCRA 4E7OA 2VG8A 4YJFA 1HR0L 1EFCA 2QVGA 4DA4A 4YAGA 3L3OC 2QORA 4LCBA 1SHZA 4FCVA 2XCLA 4Q1DA 3EJ6A 1NVKA 2F1IA 1QTNA 3W79A 2BY4A 2RGGA 1BH6A 4W82A 2A68C 3FBTA 4LYHA 5JC8A 5JI2E 3EDOA 1H6DA 5M2QA 3ZUPA 1Z12A 4UEWA 2UYYA 2CD9A 4DT1B 1YAHA 3PF8A 4U2BA 4PAQA 3CWQA 4A0GA 2Q07A 1E0AA 3GT4A 3MXTA 1YIOA 5I7OA 1PFMA 2J0SA 1SU6A 5EFZA 1Z4LA 4BQPA 1PUJA 3VYRA 3JAKA 3Q88A 3ELUA 4GP6A 2Y1LA 2GPJA 4WCVA 1GDTA 2XT0A 3ZHVA 3N7AA 1H3NA 4A03A 1IM2A 3EBLA 4JH0A 1PHRA 1Z0IA 2J0QA 4J7XA 3HJTA 1YC5A 4OK3A 4HNTA 3ND9A 3EXG1 3AUXA 1Y1WB 4RHSA 1H8ED 5E7MA 2YQZA 3CX8A 4YAWA 5D2CA 3I92A 3K5NA 1Q81C 4MW7A 1QGZA 4TTRA 5LPNA 3NV9A 1CDEA 4FKBA 4RXUA 4YWJA 1W6KA 5HP4A 1RAAA 2C9CA 4ODGA 4K9QA 2RA4A 1XPRA 2CN1A 1UBEA 3ASUA 4D5EA 4MPJA 4N6GA 4AIMA 3QLEA 1A96A 4HDRB 1U80A 3TZBA 4D4MA 3SM3A 5BORA 4C0JA 2AMCB 4WORA 1SD5A 1X0XA 2C58A 1Y80A 2FXVA 1XYYA 3KU4A 3LNTA 2ZVDA 5DXAA 5TF4A 1ULZA 3FF4A 3H0EA 1T10A 1GOZA 1IHXA 3IKLA 1IEWA 2VHTA 4JBWA 4ESVA 5U9CA 1I0ZA 5D3MB 5EIFA 8ABPA 1LI7A 1I6HB 4K9RA 4KO4S 1KMQA 1S89A 1WSBA 3J80L 2IYUA 3IV7A 4FF2A 1QK3A 5DYWA 2WWTA 4QXOA 2P9GA 3IQXA 4MW9A 2VAXA 1H5QA 5C8VA 1JQ5A 4IQ0A 3HVUA 3MC0B 4GVLA 4Z7NB 4L4UA 4CTJA 2IV3A 1T1IA 2HF9A 3PK0A 4QULA 4P4LA 3CVYA 3ONAB 4MI9A 3GXBA 1K92A 2AT1A 3O31A 1VQAA 4Z1MD 5BN1A 3PEUA 2KEEA 4DDTA 3PPWA 3TH5A 1OVMA 5IYDH 3DR5A 3ELDA 2XXAB 2NYVA 3HKZG 2XNDA 5CDTA 1DIBA 2QLFA 4BNGA 3LDUA 3MQFA 3UVEA 4BECA 2PL5A 2ZRCA 2JA7B 1BKBA 1UJ6A 4JNCA 4OQQA 1PL6A 5CM9C 2F90A 5EINA 4DR7B 5KYXB 2BP7A 3IV6A 3OTQA 1AUQA 2EVBA 2P79A 2QAIA 3QVJA 5K3FB 1P19A 2V4ZA 1VBKA 4FLFA 4C1NI 3JTMA 4BQNA 3GIWA 4TWAA 4YJFB 5DXFA 1NNLA 4R4JA 4LVNA 2Q5LA 1Z2DA 3VZCA 3AG5A 2AKAB 3DHQA 3V2IA 3HOWB 3DONA 3Q6IA 3TF5A 3D6NB 5IOCA 2VHJA 4WZZA 1ZD2P 4HEQA 3RHTA 3GBVA 5IBCA 1Z6PA 2JJ8A 2A5DA 1HT2E 3FDZB 3PE3A 5FUYA 4D4HA 3QPCA 3I32A 1GD1O 1NTGA 4MX8A 1JHPA 1G8AA 4P4TA 1PRTD 3M4OB 5G0WA 5DN9A 4RTLA 2RC5A 2IE8A 4OWTB 4MULA 1TB4A 4OQMA 3VKFA 4ZGWA 4Z4FA 1PZID 2VQ6A 4KK3A 2A59A 3JR3A 5BV0A 4D9HA 3Q11A 3EGDB 3PDUA 4E94A 2A0YA 4NIMA 3K70B 4CV2A 1I4WA 4EI8A 1E0KA 5HF9A 3Q7QA 2OD7A 2O8DA 2Y2UA 4ICIA 1P8AA 1F0PA 4JI6B 3T4EA 4BLVA 4K6GA 2AN4A 2BMVA 4TGLA 3T52A 4IFDJ 2I2BA 2X69A 1N8SA 3IBYA 3A11A 1V8FA 4PR0A 3TM4A 1RSZA 2IUUA 4L57A 4P2GA 1VJGA 2L18A 4KR2A 1OLXA 1TJ3A 1V6SA 3M2TA 5NULA 4LNQA 4JSTA 4U00A 1SAPA 2ZSDA 4YJHB 5FKJA 3RLIA 4ER6A 3QW2A 4PX3A 1KDCA 1XWWA 4FQ8A 3ENNA 4RLQA 1XSEA 1A3TA 3NBIA 5EP3A 5I4IA 3KVOA 2PMDA 1U90A 2DHRA 3K94A 3MTJA 2CDCA 5G40A 2I1LA 2HU2A 1M5RA 1KKUA 1NUSA 4LQLA 3UOWA 2E8GA 3E9YA 4OUDA 2FPPB 4I50A 3RDPA 1K8OA 5L3SA 2X3UA 1II3A 3S2UA 3H9JA 2ZXEA 1Y1WH 1ABEA 2XTZA 4EPVA 4DEXA 5KOIA 2O5VA 2PZBA 4Y1FA 1Z22A 2F3UA 2I4IA 2MSCB 2UZIR 4ISCA 4IURA 1O97C 1UDWA 4Y9DA 3VH2A 3S81A 2VVTA 2WUWE 4N3CA 2BBOA 2ZM6L 3WL6A 5CDFE 2UZ1A 1U2SA 3L8ZA 4C30A 2FMCA 3TZLA 1AC5A 5HPYB 4JLDA 2R96A 4Y1RA 3JZDA 1NA5A 5EIOA 4EX7A 3DMGA 1SRUA 2XA1A 3QVKA 4QUKA 2B4TO 2FPSA 4EH1A 4WCFA 2ZAOA 1II8B 3I9V1 3FAZA 2F8SA 4PTLA 4ENVA 2CK3D 5F3RA 3LXUX 2JI6A 2QM3A 4JI0Q 2J5KA 3KQUA 3IQWA 1CYDA 1WDTA 3I53A 4W7HA 1J1ZA 4AYBB 1JTEA 2ONKA 5EKDA 2NU8B 1SD2A 2J4XA 3HGBA 3BK7A 5JQWA 2BEUB 2OCEA 3K6KA 2CD7A 1OV4A 5M34A 4RXMA 4U63A 3R3HA 2A58A 2CW0C 3HDVA 1CG6A 3TP8A 1XUOA 1PI3A 3KTAB 4O5OA 1Z5GA 4TKVB 1VE5A 4BJHB 1TUEA 1D6MA 4K8JA 3X1JA 1SVNA 5BVHA 1JLRA 4FCWA 4HAWA 3NTQA 2AYXA 2G5DA 2HD4A 1PD0A 2Q5JA 5I3CA 5KYTA 1U9CA 1JH8A 4EX6A 1C80A 6CHYA 1H05A 2BGKA 3JAWB 4PGFA 4W5OA 2V6GA 4M1ZA 5EQJB 3ZHSA 1YJNA 2YIMA 3NHZA 3THYA 3DOEA 1SKQA 3QPUA 1VJDA 5AKYA 4KKVA 4YCMA 5BWLA 4GQBA 5G1OA 3H94A 1FFDA 1A71A 4LGVA 2LXKA 5AW6A 3OZXA 4IILA 4DUZB 4NEQA 4A3GG 3SK5A 1OYVA 4K26A 3TTSA 4BEVA 2YZ7A 5C5MA 2WJ4A 4RH3A 2Z8YA 2H18A 3LWUA 1E63A 1NUAA 1G2TA 3EWAA 2M1XA 2RGYA 2WSMA 4LXIA 1XA3A 4FQ7A 3O9VA 3OQMA 2R4QA 1NVFA 3L4JA 1SVLA 1NVTA 2XUIA 4RD6A 2WYUA 3C0KA 3ABZA 2F17A 4KIUA 3S3TA 4DCTA 5HFNA 4G85A 4YRMA 3DTNA 3N0WA 2AH5A 3ILVA 2EDAA 5EE3A 4I1OA 1B6TA 3TCNA 3K9FC 3G9XA 1LSOA 1YC2A 1JWSD 2J0TD 4N3AA 4YR7A 2VPQA 3EVCA 2WP8J 3E9HA 3IA7A 2NO9A 5SZJA 1OTYA 2VAMA 2ZE8A 1JQLB 1N1MA 2XT6A 4QAJA 2ZKLA 1HDOA 2RG1A 1YDWA 3CMMA 3OMXA 4A10A 1QVRA 3E6AA 1PWYE 4KQHA 4QDKA 4MQ5A 1MBYA 4EABA 2C7QA 2YL2A 4TMXA 1Y5RA 3GJQA 4GZ5A 5LXTF 4O4HF 1GTRA 3PUKA 1R0XA 2NO7A 1AKTA 1LJLA 2AC7A 3AMVA 5I2XA 4CNQA 2I2XB 5EGNA 1EJBA 4TV9A 4CG0A 4L0CA 3NVDA 3U0BA 3D3JA 1Y34E 2VAPA 2XHZA 1WAMA 3GGJA 3PPIA 5KTSA 2WAQG 2G5GX 2ROQA 3VNAA 2IBSA 1ZHFA 3RS4A 3A9SA 4IXNA 3RR2A 2VTBB 5FD8A 3TMKA 1VS0A 2QEXA 3IFSA 4C4ZA 3JVDA 1UEBA 3FOWA 2D2VA 3AU7A 1F4VA 1USWA 4L76A 3X1XA 3CX4A 1R3DA 2VJDA 5ICFA 3SK0A 4H3SA 1WNFA 5KQMA 3SC2A 4FD3A 3IHWA 1VQBA 1R18A 1KAGA 3E0QA 4QY7A 3P1HA 3BZUA 3TTYA 4D6PA 5I7VA 1EL0A 4BY7G 2RKSA 5KDDA 3GTLB 2Y1GA 2X0EA 1UC9A 4TXNA 1MB3A 3MLEA 5SY9A 2R3ZA 3QJYA 2YJGA 2QAGA 4QASA 4NZNA 3VU8A 3C98A 2BEKA 1QF9A 3EK2A 2J0EA 1V4NA 2CNBA 2ZIEA 3QFTA 3V1TC 3LX8A 4BGDA 2IYQA 2GGSA 1T15A 2JFFA 4M1UB 3I4NG 1I94L 1G20A 3LW7A 4TZTA 3A9CA 4NBSA 5C4XG 4J1SA 4N01A 3QUSA 3WKDA 1ZVMA 4AXBA 3K59A 1BXRA 5E3IA 3D8GA 4FZRA 4KJXA 4IP0A 5AVZA 1SOUA 5DP1A 2EQAA 2H7CA 2OQ2A 3BCUA 4I4IA 2M6LA 4MDEA 4K46A 4L5CA 1WF6A 1Q95A 1Y3FE 3JZFA 4MV7A 4MW5A 4MRPA 2JBHA 2DFKB 5DNEA 1NAIA 3BIWA 1YONA 1VQIA 4INZA 1QGUB 2QW0X 2B2UA 5ELLA 4FOTA 3I8OA 5L53A 1EVYA 5ALIA 3O4FA 1V37A 3NFYA 1X9IA 4UY8C 5EXPA 4ACBA 2CJXA 4OXPA 1BCSB 5IE8A 2XYPA 3LGAA 4IJMA 3ULKA 7YASA 5L95A 5FB3A 3U19A 4B0OA 3X44A 3CC8A 4FW9A 1D5ZC 4POFA 2F43A 3LBHA 2DERA 1OYWA 4G7HC 2FW6A 3RW9A 4Q1VA 2VYND 4RVHA 3DMUA 3VC7A 4QSHA 4A3EB 3L07A 3AZPA 3W4JA 1N32B 3IQZA 3KQLA 1LT3D 4KPFC 5B36A 1DAIA 1GPLA 3E84A 3GEGA 4PHTA 3OE7A 5CJPA 2WG0A 221PA 2CF6A 3FMIA 4TTJA 1R0CA 3ZJTA 2PT6A 4BX2A 3EIVA 1C8CA 2WWRA 3GYBA 3R5KA 2HK9A 4M4SA 1K28A 2EZ8A 4M0CA 1GDHA 4FYYA 4OHPA 2HQEA 4TMTA 4X84A 3SS7X 5IP7H 5HSGA 4M46A 1KYVA 3CR7A 2R87A 4TZKA 1XZHA 2AD1A 1E0DA 2BJVA 2UYQA 3P1JA 4QUIA 1ML3A 1NU8A 1M3SA 1OV6A 2PMZE 1UDBA 1XFDA 1ORHA 1SYBA 1P3JA 4DF7A 2MSNA 3HBJA 3LX4A 4AZ3B 1SJ9A 3K6JA 4BLOA 2AFIA 2V1UA 1BDBA 2BZ1A 2AOWA 1QHHB 4PC6A 4DJDC 3KAKA 4F3KA 2QDBA 4IIYA 4NNPA 4P32A 4E5UA 1SZPA 2VDQB 2JJ1D 1DAGA 2MYUA 3V6MA 5LQDA 1EGAA 2WSLA 4P53A 2JLZA 2OXCA 3UFBA 2Y92A 4H17A 3QG1A 2ZYUX 4DJFC 1XMQL 5F2OA 4O63O 2PH1A 1SQFA 4CM9A 5K0GA 2Z8LA 2VPTA 3QYFA 2VJKA 1WCYA 2GKSA 1M72A 3ZI4A 4LTMA 3OTOL 2ZT6A 6REQB 2H4ZA 3QUTA 2DFLA 5AXAA 2ZLBA 3THOA 4G0UA 3KSRA 3TPZA 4D8TA 2V8OA 3D0KA 1CZOA 2QOEA 2O3SA 3C7DB 3CP0A 1P5FA 2A6PA 1EH5A 5G3ZA 3WHLA 3WICA 4C6SA 5H8WA 1G9TA 4PZDA 3RTEA 1S1MA 1KC3A 1XMXA 2ESRA 2B2TA 4A3MB 2V5UA 4HFMA 2K04A 2BC9A 2B63H 1Z4MA 5I7WA 1RMQA 2FWMX 3U7JA 2ODEA 4B4OA 3D5QA 3IVXA 3B1KA 4RHEA 2XBLA 1F2DA 1WXGA 3E23A 3N0TA 4FUQA 4W8HA 2DR0A 4MB6A 4OB7A 2DZDA 1ONOA 3ZWBA 4RCNA 4M0MA 4FD2A 5CCBA 3PO3B 1A1VA 3WBKA 5BR1A 3PEWA 1W4BA 1FSZA 1RIFA 1RZUA 2NM0A 3RU7A 4F2DA 3N2KB 1WVGA 1JIJA 4Z9FA 4D3YA 3PL5A 4OAPA 3VR6A 4DV6B 4BY7H 1U31A 1W9MA 1GTL1 2ZB7A 3OJLA 2D0PB 2YHBA 5FOBB 1Z8NA 5ILOA 4IUPA 3EY9A 2WFZA 4D02A 3DMNA 3K0EA 3GLHE 4QO8A 4EL0A 1K83B 4YY3L 5TF0A 2QAGC 4QBGB 1H2AS 4M54A 1F5SA 2D2IA 3RR5A 1GO3E 1YQ9A 1VJRA 2E9SA 3WLAA 5FPQA 4MEBA 1QH9A 1E6EA 1MHWC 1K63A 3IOEA 2Q3DA 5BN5B 3W2HA 1MG0A 4JD5A 5C0XG 3W8EA 1H2ZA 3C39A 5COYA 4MYSA 3IKMB 4YAKA 5JNTA 5ICGA 3ADOA 3I6IA 2XAUA 3GVCA 3P9RA 4F91B 2Z2JA 1NMXA 1TYZA 2RGXA 4L95C 4QBTA 4RACA 5HCUA 3UGKA 1NBHA 4QIWB 1YJXA 1MV5A 2SKCA 2E89A 3RGWS 4KKXB 1TJ4A 2QA5A 1KDAA 3NETA 4CEJA 3OHSX 2PXXA 4IFBA 1TQ8A 4I7ZC 1ECBA 1XOIA 3KWJA 3E2PA 2WM9B 1RWPA 1MG5A 1IIRA 3M1YA 4GQAA 3AETA 1NKTA 1UZMA 1Z82A 3T7AA 4UPEA 2XLCA 3HB1A 2P4EA 1KABA 1VHJA 2CKDA 1LK0A 2IPOA 3BOSA 3M6LA 5FJJA 4LC9A 2RH8A 3IAS1 3RRJA 3DEYX 5J1TB 2H59A 3TOZA 4DAEA 2V4MA 3AW9A 5EP1A 1HGXA 2HJGA 3PE6A 3UXEA 3E3OA 2BCJQ 3VU3A 3K32A 4BNMA 1LDBA 2PGAA 3L4BA 3WNZA 4RGQA 1PFNA 3S99A 1SVUA 3Q0IA 4DIKA 5TLSA 1D0VA 5DVZA 5TMEA 1LTGD 1EB9A 3NHKA 3JQQA 2FDCA 5DM0A 3GAAA 5BQOA 2RMKA 3ZHTA 2XCTB 2KECA 1SK9A 4HYYA 4L9RA 2PMEA 1UMDB 1V5WA 3KKLA 3LS2A 3KXKA 3MVVA 4XCVA 1L5WA 3FLMA 2VZLA 2GZ3A 2X19A 2Q5QA 3R9XB 2GPWA 4JITA 3ESBA 2ZRPA 5A4DA 1LDMA 3DAGA 3RT7A 1DEAA 5D3IB 2D06A 4H1HA 2RHWA 5L7YA 3DXZA 1INLA 4ZT5A 4X65L 1NXXA 2QDKA 1PGNA 3KJEA 2CCZA 4OBXA 3HA2A 1E2VA 3CSDA 4XTRA 5TB5A 5C81A 1W35A 2F3IA 2P4SA 3SCZA 4BNIA 3HKCA 2UXCB 5KGUA 2Q9UA 3ZCRA 4ZMRA 1K0RA 5TQ2B 1TYBE 3HQ4O 3SI7A 3VV3A 2CLHB 3O47A 3ZLTA 3QXGA 1G3QA 4OPMA 4AT1A 1EFRD 5HURA 1K1EA 1TR5A 2WM2A 3HUUA 3LIPA 3UT0A 5E3HA 2GEDA 3U44B 1PJ3A 4FU0A 1B42A 1XAJA 1Z7GA 2XI4A 3FFWA 3T7SA 4XD7D 1DGSA 2INGX 3MGCA 3RPEA 1WR8A 4MMXB 4JBXA 1SC4A 4I66A 2QR5A 4L5AA 5BWOA 1NULA 1PTOC 1C5KA 3F7MA 1NQ5A 1PNOA 1TAGA 2X4DA 3LKVA 3O4JA 3TNJA 3ZW8A 5IY0A 4C87A 5K4GA 5K8VA 1O8CA 3F67A 4GPAA 1DWPA 2D0DA 2XZDA 4FFRA 4NDZA 1CKMA 2GM5A 1IBMQ 4LF9Q 1J0AA 1N33Q 3F5SA 4MVJH 2FMTA 1XJCA 5FT9A 4DYHA 4ARIA 4PCAA 2SBTA 4YHHB 4REOA 5EESA 3KUXA 2ZANA 1SY7A 4MJLA 5COBA 1PT9A 1U3DA 2CUNA 3P52A 1W9HA 4QZVA 5JCJA 2GTHA 3PIO3 2QBYB 3B6KA 1C9JA 1R0KA 5C1PA 1DTWA 2HLNA 1CV2A 2YHUA 1O9GA 1OHHA 2X15A 3BQMB 3GTJB 3OCVA 5J22A 2BCOA 2BI4A 2O5RA 1W29A 2C5LA 4C07A 2PSHA 2E82A 3CZ4A 2WFAA 4H4EA 3DEAA 4HNAA 2E4AA 1RWOA 4AMGA 1E4VA 1RZVA 1U7PA 5AI6A 2NMVA 2WTUA 5A6SA 2EYFA 1RABA 1QVWA 4ARZB 1A7JA 4KIFA 4JI6L 1G9SA 2GD0A 3R3WA 1A3VA 1VLLA 2AQ3B 3FKQA 3GLTA 1P0FA 1YZ3A 1J9ZA 4X62Q 2P3SA 1E2LA 4Q39A 5EKUA 1ID8A 2VN8A 4OOFA 1GUGA 1F2UB 1X7YB 1ID1A 3CF5A 3ZDZB 4P71A 3R3JA 3HRIA 1J2JA 1ZFNA 4F72A 1I13A 1HXYD 1LK7A 5T4BA 4B2YA 2K5UA 5HE9A 1YZYA 2AI3A 4HX5A 4IKPA 1AJEA 2E75C 3U9TA 1NX6A 5FWNA 1BDHA 2F8MA 4K6FA 3RRMA 1EFVB 2HRZA 4A3IG 2F0EA 1AO3A 3HCOA 1RAFA 2OG2A 2OBFA 5GM1A 1JILA 4S3MA 4U2FA 1EYAA 2EEZA 4BP9A 3G5TA 1PFGA 4FT2A 2JS7A 2DSNA 2ANBA 2J31A 2YHIA 4WD3A 3UCXA 3X1DA 3MGGA 4G0YA 4RFSB 1C2YA 3PIDA 1L4HA 3L0CA 2A69C 1H0HA 2HWXA 1NYQA 3JQAB 4IRXA 4J76A 1X1RA 1HG1A 4MJ3A 4MYRA 5E6RB 1CUZA 1PGJA 1TF5A 2NVUB 4EZEA 1C1XB 2PKRA 2X0NA 4ZAYA 2VS1A 3DYIA 4A3IH 2Q6VA 3P9QA 1D1TA 4JJ8A 3BIXA 4FEAA 2AHRA 1PDWA 3N3BC 4KVZA 5F9MA 3WHIA 2R48A 3DWFA 3LXRA 3OZRA 4MV8A 4B3FX 1CRZA 2WZBA 3INTA 2Q6TA 3JTEA 3LOPA 3IQHX 5J39A 3HMQA 4KO8A 1FFXB 3RC2A 3WLLA 3HXPA 2SNIE 1VRVA 5CEJA 3DCYA 1RWMA 1HMYA 2R1TB 3KFUA 2AMJA 3GJ5A 2E87A 2Q4BA 4ND8A 1YZKA 4G5RA 5JCPA 4F71A 3OCXA 4KR6A 3H1AA 4CLEA 5A9RA 3DV2A 4EG8A 2EARA 2VB3X 3T3GA 2OGUA 5CRIA 2IHBA 3FVTA 3SZLA 3CH4B 3EGVA 1JQEA 3QMVA 5IJ9B 4D4JA 3IJPA 3OQJA 2Y4OA 5C1OA 1Z26A 1QIEA 2XY4A 2C2HA 5J1ZA 2JFGA 2ZSJA 5HW0A 3LFHA 3B1WA 3ODGA 2ZS8A 3KLSA 3I4OA 1Y4ZA 3FYDA 5FOXA 1EY8A 2PT5A 4E32A 3GTJH 4YUZA 2HYIC 2O19A 1QH8B 3SX0A 4F8MA 1BMFD 3L8CA 2XUPA 1U4RA 3J7ZC 3HO6A 3P4XA 2QEQA 3PUJA 4P93A 4BVBA 5D86A 2YV4A 2A8VA 1H2RS 3GCXA 4X7MA 1SE4A 3KZ1E 3W7BA 4PG4A 4MUIA 3G8AA 1ISJA 1ZWLA 1Y0BA 1PZHA 4DC0A 1ZOSA 1A8PA 2F52A 1F9EA 2NTVA 2ZUSA 3INNA 2WKQA 3LO5A 1J8YF 1FVOA 4JI6Q 1PFQA 2W0SA 3ICOA 1S2MA 3C1EA 2PNFA 1LLDA 3B5EA 5GADC 3JR7A 1Z0FA 3E5NA 3OPNA 1V41E 3M4PA 3BS4A 3BD6A 3DWPA 1PS9A 4QGFA 2WB1B 2F9LA 3L7OA 1CNFA 3EOZA 2I2CA 3O8QB 1TW2A 2VAVA 5HIKA 1XTVA 3PSAA 2BGWA 3T15A 3SPXA 4C5CA 4D3DA 4I4TB 2OCGA 3GYGA 5JJLA 1CULC 1XVTA 3DZJA 1MAUA 4F1JA 2Q7XA 3A6KA 4BRSA 2C95A 5JOQA 1C0PA 2IZZA 2JD0A 1PJBA 3ESYA 1G2PA 2FR8A 2IZ6A 3FAKA 4JWKA 1N5MA 1HZZC 3DCJA 3GUHA 4DW8A 5ETJA 4TSSA 3ZS9A 4MVJI 3NHJA 3QBJA 3TSCA 3RF6A 4GKKB 1F14A 1OWMA 4REQA 2HSZA 2JCSA 1QP0A 1JLKA 2IEBA 4US2R 3I4NH 3R6DA 2DWUA 4R8VA 1L2TA 2C96A 4H60A 4JS0A 4MITA 4V0KA 5KPDA 4RGYA 1DLJA 2GNOA 3HEBA 1CERA 1YFJA 5M5XB 1DAOA 3L3BA 1ODSA 2YTVA 5FTJA 1U0LA 2AVNA 2GHIA 2NSJA 2YFHA 1NKSA 3G9QA 3KLBA 4INPA 4QGGA 3ZWVA 5ALWA 1VDZA 4P58A 4HAXA 2GMWA 2G88A 4ZT6A 1HFGA 1QCZA 3HV2A 3J81k 1A8VA 1KEZA 4LJ8A 2J9GA 3GAMA 2NWGA 1XD2A 4WWHA 3PIOA 1OLOA 4WLOA 4G4JA 3V7FA 2BTOA 4K05A 3B2QA 5K09A 1C3XA 4A26A 3MAQA 2OZVA 3F1ZA 5M04A 2WP0A 3LVRE 1IM5A 4DUPA 3D8RA 3GTQH 1QLHA 2H5IA 2D4AA 4HGYA 5IXYA 2R4TA 1U6IA 3GP3A 4MV0A 2PKQO 1YMQA 2AZMA 4GLLA 3UV6A 5BN4A 2KM1A 4PSKA 5KYKA 1RWQA 3KEQA 4K40A 3AKEA 2Y76A 2QKYA 3L0DA 3RODA 1GAWA 1UBLS 1V8OA 1B3AA 1A72A 3GJYA 1RKVA 3PXXA 4HSGA 3AIOA 1NUUA 3H05A 2P6UA 4IGEA 4RTPA 2BOSA 3EULA 4C22A 2K5NA 3DKVA 1JZQA 5BO5A 3TCXB 4E70A 3CC4A 2AFHA 2HADA 2BKXA 1BJRE 2CDRA 1HQDA 2DFNA 4LQ4A 1SHUX 4MV6A 3O2JA 1G8FA 4FR5A 5C8YB 4M7OA 1U9JA 4K2KA 3P8ZA 4Y98A 5CXSA 3VDQA 1UJBA 4Q3AA 2PPLA 3W6PA 1T9CA 4B6SA 1N34Q 1M2HA 2PMWB 3NNSA 3WK7A 2AI2A 4OXYA 2Z4TA 2KOLA 3ITPA 3SEBA 1WZCA 3ETCA 1D8TA 2VATA 3CE6A 3FWKA 2QPTA 3HMKA 2BMWA 3NE5B 3OM8A 3QH4A 4KWIA 4LQDA 4RY2A 4UUOA 1BHSA 4JYAQ 1YI0A 4YC7A 1IN4A 1SXJA 3HWX1 2FFQA 4POOA 4IS3A 5K8IA 5G4KB 5J59A 3L77A 4PBRA 3IUYA 2P9EA 3WJ1A 1DRVA 2EIXA 2NO1A 2HF8A 1Y1VB 3JQGB 3EPLA 1EFUA 3BCRA 1K7EB 5IG2A 1W94A 5IKXA 4GZ6A 2DWCA 1UPCA 4S24A 1UUPA 1V3TA 3KKNA 1CB0A 1B00A 3GC6A 3D6TB 1Z83A 2OCYC 3CLHA 3DMDA 4JC5A 2RF4A 1K8ZB 4AS2A 4DPLA 1M34B 4ZQBA 1HYEA 4R4TA 5D5QA 1SNDA 2ERYA 2NQTA 4JK1C 1C9YA 2D7CA