4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Transcription
molecule keywords COME
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
3SY8A 3HM9A 3C6QA 1ZITA 3N0WA 3HJFA 3C3WA 2YHBA 4IF4A 1BDHA 2E4YA 4Z0NA 1A04A 1ISSA 3T38A 1ZGGA 5EWJB 3QLTA 3LUJA 2MYNA 3CHYA 4XXEA 1WETA 3Q7RA 2B4AA 3O2SB 4G97A 1P2FA 4RK7A 2E4UA 4TN5A 4MS1B 3TX6A 3I42A 3OQNA 1PNTA 1DJMA 4WZZA 1ZAYA 3BREA 1USGA 3GA5A 3T95A 2MSLA 1FFGA 2R25B 4RKQA 1C4WA 2DRIA 4XQQA 2FKAA 1W25A 1ZY2A 3LUHA 4N41A 4Z9AA 4NICA 3LKVA 5TPWA 3HV2A 1GUDA 1LBIA 1EWTA 4WUTA 2PUFA 1H9CA 2QVGA 3BRSA 1QO0A 2PUCA 1S8NA 4QICA 1BVHA 3I09A 3T6KA 3TMYA 1BDIA 4MRMA 3NHZA 1VRVA 1XHFA 2MYPA 2QSJA 3IPAA 1YTUA 4EYOA 5EWMA 5IEBA 3JS5A 4YLEA 1KMIY 4IILA 3EULA 4MS4A 5DGCA 3ROFA 2F8TA 1D1QA 3EJWA 4IRXA 4RK5A 2A9QA 5KQMA 2R48A 3N0XA 3R0JA 1ZVVA 1XWWA 1RXEA 4HYEA 3OO1A 4MR9B 1R8JA 2WB4A 4TMYA 3HCWA 1SD5A 3TO5A 1FFWA 4B09A 3M9WA 5BR1A 2MSWA 2NZVG 4P1ZA 2QR3A 3QEMB 4LDZA 4LX8A 4DN6A 1MIHA 3Q7TA 2LUOA 2NZUG 5BRAA 5FWXA 2QZJA 2A9OA 1JLKA 1AB6A 2QW1A 3QEKA 3RVKA 3TD9A 4F12A 3Q15C 5F64A 3RVNA 6ABPA 3JVIA 3NNDA 1APBA 3OLWA 2BGGA 4MR9A 4MGEA 2GWRA 4ZYLA 5CNJA 4PYRA 2NT4A 1L5YA 1U0SY 9ABPA 2M98A 3M6MD 5TPZA 3HXMA 3FGZA 1RXIA 5HM6A 2NT3A 3KG2A 3L6UA 1QP4A 1DBWA 3LUFA 4MQEA 1M2FA 3OLYA 1JFSA 4RU1A 5KQPA 1DCKA 4QYMA 2IPNA 5PNTA 5C5CA 2FQYA 5EWMB 1NXTA 1BA2A 2M1ZA 3NNSA 2GX6A 3DGFC 3GBPA 3G85A 4JB0A 3RVJA 3UK0A 5JNTA 4W5TA 4Z4FA 4G0XA 1YVUA 3FFXA 4JP1A 4YWHA 4ZJPA 2PUBA 4KRFA 1BDJA 4Q7EA 2WJAA 2PAFA 3LMKA 2VYCA 1DRJA 1PEYA 3H1GA 3C3MA 5JS2A 4Z4HA 1D1PA 1Z18A 4MR7A 2CWDA 2PUGA 3IP6A 4MLDA 1ISRA 3H1EA 1LK0A 3Q7SA 4Z4GA 4RK0A 4PICA 4Y9TA 2FQWA 3DGEC 1Z15A 3KSMA 3CTPA 2OENG 2AYXA 3GWGA 1JWLA 4F06A 1QQBA 3IDOA 2IPLA 2PMCA 4RZSA 4MRMB 3OO0A 5HSGA 4IGAA 2WRZA 3O74A 4PZ0A 2FLKA 3MM4A 5FWYA 1JFVA 1Z12A 3LUKA 2LBPA 2H3HA 3O21A 1MB3A 1NXPA 4MQFA 1VLZA 4G4KA 1QMPA 3E61A 4EUKA 2PE5A 2A9PA 2HQBA 1U04A 2HQOA 1JYFA 1DZ3A 3HSYA 1CHNA 4HNQA 3JPYA 4LZLA 4XQNA 1YMUA 4FE7A 4XARA 3E3MA 1URPA 1SRRA 1Y1LA 2ID7A 3N75A 4RY0A 5BRJA 3CZCA 5IULC 5TQJA 3CG4A 3RVOA 5I4CA 3QX9A 3CKMA 3W9SA 2NUBA 2GKGA 1QPZA 3KYJB 5C5EA 1YK1A 3H5LA 4RXTA 1D2AA 4RY9A 3LTEA 3IP9A 1HEYA 2FW0A 4MR8A 3I45A 3S99A 3C3KA 1TVMA 3LUDA 1GCAA 2FMFA 2Q5CA 3H75A 1LJLA 4JB2A 4O5AA 5FWYB 4XYQA 4EYQA 4OLAA 3LUGA 3IPCA 3RVLA 2PLNA 3KKEA 3F7NA 2YHAA 1EFAA 4N76A 4P98A 2CHEA 2GBPA 2RDMA 2WMYA 4Z4CA 1JYEA 1Z13A 2WWVD 4H3HB 1ZESA 4YRZA 8ABPA 2QV0A 1A2OA 1P8AA 2FN8A 3HUTA 3JPWA 1A0OA 4KMRA 3OMWA 3I5AA 4RKRA 5HQJA 4CBVA 1NY5A 1TJYA 3BILA 4ZMSA 1E2BA 4HNRA 1JDNA 3HDGA 3H5TA 2PUEA 5CNMA 3EGCA 5KC8A 4W5RA 1EWKA 2FSPA 1SXIA 1JH9A 4RS3A 5EWLB 2B1JA 4EY3A 1DCMA 3H5VA 5DKFA 3K4HA 1F4VA 3GT7A 4ETNA 3UUGA 3CU5A 4LRQA 3OQOA 4RWEA 1GUBA 2E4XA 3A0RB 4L85A 3NHMA 1TLFA 4FB4A 4YO7A 3HVRA 4D74A 4EYKA 2PL1A 2F8SA 3LUAA 4MS3B 4N0QA 1JF8A 5KQLA 4MS3A 3Q9SA 4MR8B 3CLKA 3HUUA 2JCGA 4FE4A 1GLGA 2HSGA 4MAAA 3T8YA 5DLEA 2W42A 5E3JA 4PE5B 1EAYA 5JNSA 3OLXA 1ZHHA 3JTEA 1W9HA 1NTRA 1ZN2A 4RK6A 1YK0A 2FMHA 1QP0A 4G0ZA 4OTZA 1U8TA 3HZHA 5EWLA 5TPZD 3O1HB 5IUKC 4D6XA 3DLBA 2L18A 3IP5A 1TM2A 3KLNA 3CRNA 4G86A 3O1IC 1LJUA 5IBQA 4N0PA 4MQEB 5HKOA 3A3KA 1XHEA 4YS6A 2HPHA 4JAVC 4QYWA 3DBIA 4MR7B 2VUIB 4KQCA 2L2QA 1QQAA 4Z4EA 5JS1A 4OATA 5BQ3A 2JBAB 4LDAA 3N0RA 5JNWA 3LUCA 1E6LA 2QXYA 4KV7A 2PUDA 4Z99A 1M2EA 3A0UA 3HS3A 2N9UA 5EWJA 5IEJA 5FBKA 4D6YA 4EVQA 4YP9A 1YS7A 2WY2D 1DC8A 3FDFA 4JA2A 2R4QA 4Z9BA 4UHKA 3NBMA 1C0EA 3SG0A 4KVFA 1PUXA 1K68A 2IDMA 3QEMA 1E6MA 4NCAA 3L49A 2ZAYA 3QLUA 4Q6WA 5IC5A 4MYRA 4RXUA 1E6KA 5KC9A 4Q6BA 1Z2DA 3O1JC 3Q41A 4G0PA 1K66A 1KGSA 3SNKA 4O1IA 2E4ZA 5IUNC 1OXKB 2I6FA 3URMA 2LIVA 1MB0A 5CNIA 3C97A 2FMIA 2HQRA 3H1FA 3H6GA 2P4UA 3TB6A 4S04A 1U2PA 1D4ZA 2VUHB 5TQ2A 4F8JA 4MS4B 3NNNA 4E7PA 2PUAA 1M5UA 1DC7A 3OM1A 4EGSA 1FFSA 4L4UA 3KHTA 2FMKA 4MS1A 3D02A 2MYTA 4JASB 1YIOA 2RJNA 3FFTA 4M88A 1QKKA 4N03A 3VNBA 1AB5A 4XFKA 1F51E 3EQ2A 1RZRA 3LOPA 4PEVA 4LE1A 5CHYA 3CNBA 3H6HA 2IPMA 2JK1A 1OXBB 1DBPA 4E7OA 3N6VA 3G1WA 6CHYA 4W5QA 5T7BA 1CEYA 3MA0A 1P6QA 4TLMB 1B00A 3ILYA 5DCLA 4EVRA 2H0AA 3BRQA 4F11A 1Z17A 4KK3A 2FVYA 4KQ9A 3EDCA 4ETIA 2AYZA 3EQZA 2JVIA 5KI6A 1D5WA 3GBVA 5TPWB 2R47A 1YMVA 4KPYA 1GCGA 1RPJA 1VKRA 1MAVA 2FEWB 4MLCA 4TLLB 4XXHA 3LFTA 1TMYA 4HNSA 1VPWA 5JNUA 5TQ2B 3QLVC 1NXXA 2JVKA 1JFTA 3IP7A 4MQFB 3K9CA 2FLWA 2MSKA 4DQDA 1JBEA 5CNKA 7ABPA 3CZ5A 1ABEA 4LE2A 2FEKA 4F3TA 4XASA 4RY8A 1J56A 3O75A 1RZRD 5JNRA 4GPAA 4NQRA 1QO0D 2QU7A 2ID9A 3MMNA 4IMIB 4OLBA 2E4VA 4DADA 3KLOA 4KREA 3QX8A 3RQIA 3QELB 4OBBA 1DBQA 5ED4A 3ROTA 1NATA 2OQRA 3P9YA 4NV3A 1ABFA 2L17A 2KYRA 2JRLA 3CFYA 1YS6A 4RSMA 2IPAB 4G0YA 1JX6A 4NCBA 3KYIB 4YGXB 3EODA 4YV7A 1PNRA 4YCSA 4W5NA 2XDYA 1Z26A 3B2NA 3KS9A 3MYYA 2GI4A 4LE0A 3KCNA 4IMJB 1USKA 4N47A 3CS3A 4WT7A 3QLVA 5KWSA 3GRCA 1M5TA 3D8UA 5T3YA 3RVMA 4EYGA 1USIA 2LPMA 3ILHA 5KQGA 3HO1A 2ZWMA 1EWVA 5GQSA 3OLVA 3H5IA 3A10A 3H5OA 1QNLA 1Z16A 4KZKA 5D2CA 4ZMRA 5B3JC 1UDRA 1DG9A 3N8IA 1SXHA 3RVQA 1NXWA 1DCFA 2RGYA 1JHZA 3KJXA 4RV5A 2IKSA 1IIBA 1L5ZA 4QPJC 5GOTA 4WWHA 5TQ0B 1NXVA 3RH0A 3O2QB 3RVPA 4Z4IA 5FWXB 5IX8A 5FBHA 1RNLA 4ML3A 2FXIA 2X7XA 3SAJA 3RVSA 1DRKA 3QELA 3H5WA 2LP4Y 4XQJA 1DP4A 2FQXA 5B3JA 1I3CA 3SM9A 4RK4A 3JY6A 1JDPA 2VK2A 4OG2A 5TE9A 3SQNA 1T34A 1NXOA 1PEAA 1Z25A 1QP7A 4O1HA 3OMXA 3QK7A 3GV0A 4GNRA 2RJOA 2QVCA 4KNYA 2PKXA 2TMYA 3BS1A 4RK1A 1P6UA 4KK4A 3RVRA 3OM0A 2J48A 3HEBA 1BAPA 3N53A 3HK2A 2IYNA 2FTKE 2E4WA 3MF4A 5IUJC 3DLHA 2HJ9A 1ZH4A 3KTOA 1EHCA 3UKJA 5JNVA 1KRWA 4ZPJA 2MYUA 4UHJA 1NXSA 2CHFA 4JOQA 2JB9A 4G0QA 4XYOA 2PJUA 1SXGA 3OQMA 2A9RA 2IOYA 4MPTA 4XAQA 5ABPA 2JBAA 1U2QA 4G0OA 4H60A 1KRXA 3JVDA 1FQWA 4XLTA 3CG0A 4WXEA 1CYEA 3GYBA 3M9XA 2L19A 3F6PA 4H3KB 3MIZA 3MQ4A 1MVOA 2WJWA 3LKBA 4RXMA 3QLUC 4KFCA 4W5OA 5TQ0A 4ETMA 1PHRA 1ZGZA 2CD7A 2P9HA 3OLZA 4EVSA 1ZH2A 2V0NA 4RDCA 3HDVA 2FEPA 3FMVA 3GL9A 3EAFA 3F73A 3VNAA 2FN9A 1JL3A 2O20A 3FFWA 3O2JA 1LBHA 1FSPA 4G0MA 4WXMA 3F6CA 5DTEA 4YR7A 1ZDMA 4S05A 3DZDA 2JVJA 1Z2EA 3BBLA 2PL9A
chains in the Genus database with same CATH superfamily
5AQ1A 2XE4A 4BNZA 2ZJRA 4HDMA 1F7UA 3S40A 3VR3D 2GZHA 4IF4A 4NP5A 1MEEA 1RC8A 5IF3A 4JJFA 1E94E 1YZQA 3PNQA 4LAFA 2H1OA 2JJ2A 2JFUA 3O3OB 5I9TA 4GLJA 5LMNL 3K0FA 3LUJA 1C41A 3EFEA 4G4IA 2HHHB 2N88A 4OGQC 3GRRA 3G88A 3TL3A 2FMTA 3KCQA 1PK8A 4GDMA 3T7CA 2C4HA 4JEIA 4TN5A 1EXWA 2FRDA 4JLKA 5TEWA 4GGPA 5EBDA 1PNTA 3E2IA 1Y9AA 4DXAA 4FFMA 4P33A 2K33A 3RVDA 1F9QA 1OBFO 3GA5A 4FJ2A 5IAKA 4XT1B 2BUAA 2VSXA 3SLGA 4BB5A 4DCGA 2C97A 2QS9A 3QOLA 1BE1A 3WFJA 4ARCA 4UQLA 3PTLA 1IEQA 2A5YB 3AIOA 1ICWA 3V5NA 2R1TA 1W96A 3EDOA 2VK4A 4XSVA 4YI3A 4DA9A 3UMYA 3OQ6A 1X70A 1DQZA 1KC3A 4HATA 1TTQB 1X39A 4QICA 3DZCA 4TWIA 3O94A 4B08A 4B3JA 6YASA 2RI0A 3IELA 1PW5A 3HR8A 3PD7A 2NUTA 2G3YA 2A69D 1QFZA 4WNIA 3EWNA 1FSZA 3GGCA 5F2NA 4DV7B 5DT2A 2SCUB 1BCSB 1R3DA 2XGMA 1QQTA 3JSXA 4JC4A 5BSVA 1Q22A 4GEKA 3VKHA 2SBTA 2W4QA 2O59A 3G0OA 2A1UA 4EMBA 1L0YB 3MAJA 4UEQA 2RGNA 3B20A 3FWHA 1XT6A 4CQNA 2EJTA 4I1UA 2F8TA 5D84A 2GK3A 3OESA 1JDUA 1BKDR 1QG7A 1PZNA 1XZGA 2Z57A 3N0XA 3S1LA 2A67A 4RTLA 1CM9A 1J9ZA 1MVLA 2PLWA 1TW2A 3QQPA 3HWSA 4U9HS 2GESA 4ND4A 3UOGA 3G6WA 4FYXA 3TBFA 3WWCA 2PNJA 2QN7A 1F20A 2X8LA 5DX1A 3GTKH 1ST3A 3Q0IA 4ZCPA 1SMYC 4HC4A 5BR1A 3F2CA 4EQNA 3RNLA 1VE7A 5G40A 1CUSA 4TKZA 3UTDA 3FYDA 3TTVA 5K8LA 1PVDA 1ESFA 1W4BA 2X9QA 2X0DA 5I48A 1A4UA 1AE1A 1L1QA 3PFBA 3LNNA 1IN5A 4H6PA 3PWKA 3AF2A 3L9XA 2RHBA 1IAVA 1YAHA 4B0PA 3P71T 4DMRA 2PL5A 2V3VA 3B1WA 2BKVA 4Y0NA 5T5QA 3I9V1 2XMBA 4FZ5A 3RHSA 4TYMA 2G67A 1W5TA 1LACA 5BPFA 2BGUA 1J8MF 1SNPA 3TGPA 3T3HA 3CX7A 3QIVA 4IDAA 4L1KA 4HWSA 4RDHA 3ZNNA 4WY5A 4CLOA 5BOSB 3C46A 4AWXA 4OO1I 1RXIA 3G6KA 4WN9B 3BGVA 3CEAA 3ODGA 4FVTA 5C4HA 1O4VA 1VJDA 3JC66 1CJUC 3QJGA 3HN6A 4P75A 3AV3A 4Q3KA 2EVWX 4MQEA 5AK0A 1PNQA 3LPNA 4DLYA 5B1EA 5D7NA 3A8KE 2YWBA 3B2QA 3QE2A 3NEPX 4F8MA 1STHA 2JI7A 1IY8A 5I9LA 3KHSA 1H2RS 1BJTA 1GPWB 3DPUA 4E03A 3AUXA 2WTUA 1LLQA 1G38A 3CCJA 3PO3G 4BNIA 1A2BA 4OKSA 1CQIB 2Y0SE 4BCDA 4DM3A 3LPMA 1HEUA 4NV0A 1CUDA 1PJAA 4CU5A 2WJAA 3FHOA 3GP7A 1Q7RA 1UEBA 1DRJA 3KF6B 1KK1A 1NRWA 4XTCS 3LNCA 2ATXA 2H06A 2X5KO 4FOOA 1DGSA 4Y30A 1U63A 4TV9B 2O23A 5IODA 1YONA 3MELA 3P9QA 3VAAA 2PMZE 3DAPA 3EXEB 1T4BA 2AZTA 2Z56A 3UJAA 5ICGA 3BAFA 5AUNB 2YFHA 4IV0A 5A3JA 3KQTA 4C0XA 2EEZA 2AQ8A 1S8FA 4RGYA 4JUAA 3LE8A 2FQWA 3GTGB 1B16A 1CULC 1Z15A 2CE7A 1QFSA 2GFIA 2IZ7A 3AB3A 1YIAA 2XRSD 3G89A 2BMEA 4BBZA 1Y7TA 3TNDA 4BX0A 2YXBA 4OBWA 1SAYA 1O3YA 3H5NA 4MKZA 4TXNA 2LXJA 3QWHA 2FUEA 4DA6A 4LOAA 2XIQA 4D9HA 2W2OA 5H4GA 1YVCA 1Z56C 2G82A 1XA3A 2NYVA 3BK1A 4HJ9A 4AIMA 2Q28A 3PCTA 2FLKA 4RABA 5CLGA 1Z12A 3QU4A 5TB5A 4HN2A 4BBSG 5E3IA 1ACMA 5LQKA 1EVIA 1QMPA 2OXCA 1LTTD 3E1SA 5KWVA 2XAUA 3I2FA 4O2BB 2DULA 3KE9A 3V2IA 3EBPA 1U5BB 1J8VA 4IAOA 5CCEA 4RTKA 2CXPA 3HOWH 2WJHA 1SHKA 2YVUA 3JPYA 1SBYA 2HK6A 1YITA 2PM8A 4I50B 4HXYA 2R1ZA 4KQ2A 3P7MA 1CZGA 1NM5C 2HSZA 3CX4A 2F0MA 1Z4OA 2ASVA 1PBTA 5DYWA 4QG3A 1RWOA 1WEKA 4PZEA 5E7NA 4MARA 1S4MA 5E0OA 5ALMA 1VSQA 5GGXA 4LXYA 3RFVA 4EO7A 2GLTA 1A9RA 2AFHA 2XYGA 2ZE5A 3TD6A 4A3IB 3AQ4A 4C0WA 5ADVA 1ELOA 1U6IA 1K8OA 2ZJ8A 3AR9A 5AIBA 1M1NA 2MWMA 3ESAA 3SICE 2WE8A 2E89A 1RAAA 4HP8A 1G42A 2WVGA 1UXKA 4CIYA 1D7AA 4CEJB 4AFNA 3AUFA 2WB2A 1M72A 1HEYA 1Z2NX 4Z7NB 5M34A 5CD9A 4BO3A 3I7FA 2XECA 4F60A 3I1YA 4BMSA 1VYVA 1JHQA 1HE4A 4I9GA 3UFBA 4FDMA 1LW6E 1EE9A 2C7RA 4A3EG 3QVTA 3CEJA 1DWQA 1P9NA 2KHSA 3H75A 3K32A 3LV8A 1TT7A 4DDMA 4Y67A 1D8LA 2RHQB 4FINA 4NNJA 2WUVA 4XQGA 2IDKA 5JQGF 2C7OA 2XNHA 2LIPA 4K1LA 1A8PA 1YRYE 5FNVA 5H3CA 3LGXA 1XEAA 1NN1A 1PG2A 4O1MA 2QRLA 1XQ9A 1FFEA 4ZDKA 2JA7G 3G0DA 1B9MA 4BVHA 5DYTA 1UFKA 3LUPA 1R4NB 4F45A 2QMUA 1PK9A 5GV7A 4ZMSA 5KNDH 1REQB 3MRSA 3Q72A 1ZKOA 1AY0A 1C8BA 2D0IA 3D8RA 3KM0A 3L7JA 3FKJA 4F0JA 2ZI5A 5IHXA 1R8SA 4C14A 4F86A 2R00A 1DCMA 4J91A 1K8AC 4IJHA 3U31A 1SKMA 1IXYA 4WESA 3TZCA 1H4VB 3V3TA 4C3HB 4Q1FA 5DPMA 2CNOA 2PVPA 1DEOA 4J3NA 2C88A 2VXOA 4F3YA 4KHPL 2G9HD 5C8VA 2JIZA 5HY6A 2NQ2C 4A6XA 2XOEA 2B3TA 4N5MA 2DP4E 1ULSA 5FWDA 4NXMB 2UVQA 2ENWA 1UFQA 2TS1A 2CV0A 3DUFB 2R68A 3KQSA 4BLUA 5EUCA 1NLFA 4PIPA 2CVFA 4CHTB 2ZIFA 4EKGA 3DHNA 4DNRB 2COUA 3CC7A 3K0EA 1GXSB 1VG1A 1GL3A 2VDNB 2WKWA 4EY5A 4PG5A 4HQ6A 1LNQA 1MEOA 1H0RA 3HYLA 4RACA 4YUZA 1JZSA 3RRZA 2WLSA 1BVRA 2AMLA 2WHPA 3H1AA 4JL8A 1QYXA 2ZPAA 4G0ZA 4BGEA 3AETA 3A25A 3EEFA 1AO0A 1JLLA 4HQ0A 5G53C 1JR6A 1K75A 1ZH6A 2W9XA 1KGDA 3VX4A 3TSSA 4AL4A 3S27A 3VTKA 5HKOA 1XHEA 3MMXA 3T51B 2YJ5A 4FDAA 4N3GA 5ALPA 1LJ8A 7ADHA 1ECLA 4MOWA 3SF0A 1EK1A 3LD9A 2NU9B 3SK8A 4NXNL 3FWZA 4N3CA 1AN0A 2PMEA 1M2VB 2GZRA 3QKSA 4LDAA 3WLHA 4IVPA 3ECSA 2O2XA 3CZ4A 1TA9A 2WT9A 4RA6B 1KMHB 3DMNA 2VPIA 4GBJA 4HQOA 3M6WA 1GD7A 3MIIA 4KH1A 2NTVA 1JJBA 5D14A 2ZRMA 2EYLA 4D4GA 6ADHA 2R751 3PCOB 3M5WA 1GNQA 1YZLA 4EB8A 4YMLA 1A98A 2XJ4A 5AHXA 5ELDA 2NTYC 5J39A 3GD5A 1LTKA 5M3BA 4BVBA 3OT5A 5IT9E 4JA2A 5G4KB 1SKQA 4Z9BA 4JI3Q 1AF7A 1FLNA 2R6ZA 2BJHA 3NBKA 4OL0A 4ROTA 4RO0A 5I4BA 5JIBA 4DL9A 4IDOA 4CMEA 1Y5NA 1BCRB 1T3ZA 1XZPA 5IC5A 4RVCA 4Q7MB 2A6HC 1PJSA 2Q3DA 2V3WA 2DFDA 2H4JA 2VXYA 3MJDA 4QREA 4TYYA 1K66A 1TZJA 2VFAA 4DF3A 4HG2A 2AL7A 3KVVA 3PKIA 4IV5A 2QP3A 3ET4A 4ENRA 4PZ8A 1WMBA 4BP3A 5BMOA 5GADl 3ADBA 1SVLA 1CNMA 1HV8A 2QR2A 3JQPA 2ZI3A 4MPDA 5JSUA 5JWRA 2XV1A 2ROQA 1JSXA 3HOWB 1WSDA 2VF7A 4M2LA 4J0DA 2HJRA 4M7WA 5E6UA 3ZIAD 1L7OA 3ZV5A 2GZ1A 3B3QA 3NIDB 4B2YA 1Q91A 1PIWA 2LSSA 3D4LA 1ZI8A 4CN8A 4L4UA 4A3FB 3H3VH 4DA8A 2Z8LA 1FVFA 1I13A 2QX9A 4XR9A 4A15A 4I4IA 2PCJA 3AHEA 3D7KA 3FUVA 3GY0A 1QBGA 2I87A 2DUJA 3JQQA 3ZZTA 2GPBA 3QUTA 3EY9A 2KENA 2XNAC 3H6HA 2QRJA 3N87A 1FB5A 3EG9A 3OZEA 5G41A 4P4SB 3FRIA 2AUKA 3AP2A 1ZWKA 5IVHA 2NX2A 3CPFA 3WMXA 1RXUA 4N01A 4R2HA 3W2DA 1HR0L 1J0DA 1GGMA 1J7JA 3O4FA 3S8EA 3GQVA 3NRJA 4A3GH 1TZKA 2F62A 1B00A 3WLQA 2KI5A 1LM0A 2BSAA 1Y3AA 3U9OA 4HSPA 4A3MB 5K8UA 4KJXA 3WMWA 1DHRA 1KYYA 4MVJA 3IX7A 4O6VA 3CCSA 3KSDO 4DCUA 4CODB 4YXWD 4ZHQF 4MA5A 1L5LA 3UB3A 5IM5A 5ELNA 5CXQA 1L3IA 4IYRA 1M7GA 5AVVA 5JSFA 4NU5A 1Q0ZA 2VHXA 3R9XB 2XB2A 1NP6A 3K5WA 1NIPA 2OVFA 1DXOA 2X1HA 1JB1A 1SQ0A 1GCGA 1J2RA 3GTPB 2WFWA 2FEWB 1Y5IA 4IFIA 4UPDA 1CB7A 2XDQA 4O4JB 4RJKA 2P9FA 4X64B 3FIUA 3CNQS 4JK1C 2KWIA 5K3FA 5B3LA 4FNAA 1QH8A 4J3JA 5JE8A 2F3SA 4OX9Y 4CKWA 1OLUA 3RSQA 5F4ZA 5EZQA 2WQ6A 2GPSA 4LAAA 4A3KG 1RCTE 2NSYA 4XQ9A 3OZWA 3QA3E 5I7FA 1Y89A 1ZL2A 5K3SA 1MW9X 3OE5A 2OLJA 4YWMA 4UPEA 1EVJA 3OCUA 1AA6A 2WAAA 5TSSA 3VA7A 3H0CA 4RORA 5CM9C 4EUEA 1CIVA 4E6IA 1E4VA 1Y1PA 3IEXA 4RPGA 2XSCA 2KB0A 3C4JA 1P31A 3S2EA 1G2OA 2IIPA 3ULPA 2HQLA 2HA3A 3NGXA 4PANA 2H4FA 2GTHA 4R7GA 2B2YC 3DTVD 3OJOA 1UUFA 5KWEA 1NATA 2OQRA 1ORTA 2Z04A 3D2AA 3PQ6A 4OL9A 4KN9S 4INJA 1ABFA 3I4CA 1ZJ5A 1XTUA 1FLVA 1XGKA 3IOYA 4N12A 1LFAA 2F0VA 5EUBA 1U2TA 2ECOA 2ZYRA 2F64A 4MNOA 4FE3A 3KBBA 1LWNA 1E58A 2B0JA 4YDSA 2X1LA 4UTXA 4NCBA 2EIFA 4ZKBB 1C30A 1WO8A 5EUMA 3RIEA 4DG9A 1O77A 5C8YF 1R5OA 4W82A 5AOCA 3K57A 1GHJA 1N2ZA 2NOAA 3KS9A 5CGQB 3Q7IA 4HI0E 4XJVA 3RRFA 2NVTB 3N8GA 1U4MA 4RL4A 1T2CA 1F2ZA 1NW8A 1UT8A 2QYTA 3I2KA 1E2FA 3ZXSA 4P71A 3S29A 5AM2A 1CRPA 4XRRA 4O1NA 5JVG3 2V8BA 2I33A 3DDZX 5DDIP 2DWOA 1HE2A 1N2SA 3DYBA 4EYGA 2QMQA 4RE5A 4D45A 3GJ0A 2RDHA 3HU3A 4CDNA 2J3JA 3RUZA 4BXXH 1B4DA 1E69A 1SQSA 1Z16A 2CF5A 2V7TA 3GOHA 3GWZA 4HXEB 721PA 3HCCA 2G80A 4MDEA 1HDCA 1SBTA 3OFJA 2GCGA 2QL7A 2HDWA 3J80L 1PDQA 4CVNA 3KJXA 2IHZA 5LZ7A 3FX2A 5KS2A 5DGHA 5FO1A 1O08A 2I0QA 2ZYHA 2QAGB 1MAHA 5IT0A 1QTRA 1RLJA 1CQJA 2W6QA 4RW0A 1ENFA 3H5WA 4BLWA 1DTSA 1EWCA 2FQXA 2II6A 1PZEA 3JY6A 2IFTA 1JWAB 1WG8A 2BGLA 4KRGA 1V11A 4ZEOA 4ARVA 2PLRA 1O6BA 2A94A 2FMXA 2X9GA 3JTMA 3J7TA 1OLSA 4OKIA 4C3IH 3AU8A 4BQSA 3NU1A 3ZLJA 2QTFA 4MEBA 3BH6A 1TQ8A 5JG7A 1ONPA 3I4MH 2DY0A 3G17A 5F51A 2REXB 4BZXA 3EEYA 4BQFA 1QHFA 3RMHA 1I1QB 4FFLA 1VRCA 2ECKA 2GEFA 1V3TA 1VL6A 5LQSA 4K2KA 3N53A 3OCWA 2IYNA 4YEDA 2CHBD 5F2KA 4BGUA 5IUJC 2ASEA 4AY4A 1NYRA 3KTOA 1SCKA 1OPRA 1X3LA 3HFGA 4V3CA 3WDKA 5CAEA 3ZCXA 4OIKA 1JQJC 4LZOA 2QBYB 1G9TA 4JOQA 5FNZA 1UOEA 2ZSUA 5EZSA 5FOXA 5FOVA 2PJUA 5J2UF 4KXMA 4IDEA 3V34A 4TTSA 5M3FH 3AHHA 4QEKA 4PX2A 4KVZA 3ZCUA 1BMFA 4CKCA 2XVXA 5TXGA 4BN5A 3AI1A 4FM9A 3RFFA 3CRRA 2NO5A 4FFSA 4ZVRA 3GN2A 4P7FA 3GTLH 3RYIB 4RTOA 4UMEA 2IYPA 2VK1A 2VS1A 1UKAA 2VRBA 4RPCA 4CF3A 3GD7A 1Y42X 1LW7A 1N32B 3KX2A 1P7PA 1CE8A 1Q0PA 1LTID 1M1NB 1J1IA 1WHSB 5H83A 4B85A 1E8DA 1H2HA 3GOQA 1I6VC 1FUUA 1VJ0A 3M0EA 4E4TA 5FOBB 1B8NA 2SCUA 1IM5A 4CTOA 1GGJA 2IY8A 4BKPA 4FOLA 1IUKA 4RFLA 4X7PA 1AZWA 1YCFA 4GRDA 3WRWA 1GKYA 1QHYA 4ZGGA 3PHLA 3HXOA 1XQ6A 5AK5A 2GCIA 3HC7A 3H0KA 3O2JA 1TQ4A 3ZE6A 2WM2A 4YP1A 1EAMA 4LFCL 1KABA 1SY7A 3UV6A 4KLRA 4WZAA 1U2SA 4QZVA 3SJCA 4L9WA 3WOVA 2QD3A 1SU4A 2CVQA 3F49S 3HMQA 5C5IA 2EFCB 5DK4A 3ZNQA 1WJGA 2NTJA 3IQXA 3LBAA 2W4MA 2FPGB 3IT0A 5IFLA 1ZYRC 1K8XB 4L6AA 2XQIA 5LR6A 2BCOA 1MJFA 3BQ9A 1P39A 1YI8A 5JASA 3E1GA 1QFXA 4I8DA 3TFQA 3DKIA 1FCJA 2QDBA 1P80A 4OLJA 1Q92A 5DXJA 3FPLA 1UMDA 3WX0A 4AB1A 1GM5A 4EKIA 3D43A 1UJ4A 1JBQA 1KPGA 5CV5A 1QK3A 2AEFA 2P9EA 4WK2B 1X3PA 3IFTA 2ODPA 2CMDA 5CXUA 4WZZA 4OU5A 5B4TA 3NAQA 5TMPA 3HOUH 1I3MA 3T95A 3OJEA 1IXSB 2JA5B 1W5EA 1XZBA 4URHA 1YA6A 2DHEA 4JI1B 1V7PC 5CH3A 4FEEA 2CWPA 2I54A 1SKAA 1H1LB 5AJTA 1G0OA 5ICMA 3D3RA 1ECPA 1K5DA 5JROA 4DXGA 3HV2A 1KEUA 2WK1A 1QE0A 3G82C 2B2CA 2O8CA 4BBRH 1NRXA 2C95A 3AR7A 5D3KA 1JG2A 2XMQA 3VSEA 1UZLA 1QB5D 3W1BA 1Y37A 4TS1A 5AIAA 1SVUA 2ZIXB 3LP6A 1FYFA 1TPZA 1H1TA 1EFLA 2VA8A 3ZXIA 1YNJD 3FMFA 3WMGA 2X9NA 2F9LA 4H17A 1XNQL 2X7HA 1B73A 4LYHA 1M2KA 3D6UA 2CH4A 3EASA 4I5GA 5DN6D 4B6OA 1U9IC 4QTUB 5EIHA 4CTKA 1Z88A 4PIVA 2ZR7A 4BVFA 5HMMA 2G04A 5DULA 5E6RB 2H48A 1Z4IA 4WCVA 1FMJA 3HE3A 1XKLA 2DMRA 3GUCA 2GT1A 1RVDA 4B9WA 2VJOA 1QH9A 2Q0SA 3CLTC 3QKTA 4TMYA 4EMSA 3A14A 5CVVA 1J0XO 4P1ZA 1RJDA 3GLTA 4KBFA 2A1TR 3DEJA 2WJIA 4LDZA 4Q4LA 3TI9A 1TPYA 4TRMA 4BMNA 2VTBA 3QU2A 3EXAA 1V5GA 5D5PA 3VYUB 2EYQA 4TTQA 3G7LA 5BVHB 5BRAA 1CWUA 4RTPA 2A73B 4UTOA 1TYCA 4KHPB 1SKBA 4TL7A 3II6X 4LDQA 4GOPB 4POAA 1EEFD 1VMKA 4YRKA 3RVKA 1T3LA 5F64A 2RKOA 5GM1A 4Q4AB 1JE0A 1N3LA 1HA5A 2FPPB 5E4JA 4MGEA 4LF9Q 2GWRA 2B8GA 3QOFA 3RHFA 2A6ED 1RYDA 3AEQA 3B3AA 1KYWA 4MHSA 1VCIA 3TL2A 4ENWA 4KO2S 5TPZA 2XZTA 3FGZA 1T36B 4ZTUB 1M2WA 3S2HH 4FVMA 2CW0C 1BFDA 4MWBA 4XEUA 5AKZA 1M34B 4ZRZA 4HIOA 1XFDA 5AWFC 1W85B 2Y1LA 1NASA 1TJNA 3BZBA 3LJKA 1QP4A 3BWDD 1SOMA 5J47A 4W7SA 3OZRA 3DUZA 4LTNA 2FFJA 1PS0A 3FNRA 3KWJA 5FWAA 5PNTA 5U1PA 1PH3A 2R5NA 3WLMA 2A30A 1LPNA 1WPQA 1SHJA 1ZGBA 2DT5A 2PUWA 4NKLA 2X2FA 2M6LA 2BFCA 2VI5A 3RVJA 4B4WA 4F97A 4O4HF 2LTAA 4R8SA 3TQHA 2RHJA 5EXTA 1O96A 3DCIA 5DMXA 5E8RA 1KL7A 1D2EA 1LDNA 6REQB 4TMFA 3T4XA 3D5QA 1O7YA 4Z4HA 5LUAA 2OHFA 3BOSA 1DPFA 1KFCB 2QG4A 4M0CA 3TIFA 3UOWA 2AN1A 2GBCA 3BERA 4YCVA 2CBXA 2VHYA 2Y93A 1BW9B 2WFAA 4LV5B 1Y4SA 3KXLA 2I1LA 2WD8A 1P1CA 1QTQA 3VVBA 4CJ1B 3A6GA 4H31A 4C56C 1X1RA 4RHSA 4MMYB 4RVOA 2CLCX 2GB4A 3USCS 3WDSA 4A0FA 1AC5A 1G8GA 1XJ5A 2HR1A 2UV8A 1QONA 4PNEA 4Q9AA 5SY9A 1SN8A 1Q7EA 3S2HB 5E9WA 1KRTA 3FYUC 2FN7A 2COEA 2MCFA 2XUPA 1FFDA 2ZCJA 1NUSA 3UUFA 1EGVB 4CM9D 5AJUA 5ISMA 1Q7BA 1Y9ZA 3MM4A 4OOEA 4QEZA 1GQOA 5D3ZA 2XDAA 4RDIA 2C5HA 4ZXPA 4D3YA 2XRZA 5DGDA 1V26A 5KJ1A 2OGWA 1XL1A 3RHZA 4BAUA 1Y1TA 3OE1A 1EIGA 4B6SA 1QGUA 4J7XA 1N6PA 4UVDA 3MFYA 3VNRA 1N1MA 2QM8A 4GR4A 4KGXA 5EZYB 3VU0A 3ELDA 4D2IA 2ZCUA 3S5UA 2JGDB 1HC7A 1Z8NA 4K9QA 3L02A 2YZKA 1G2QA 2PS9A 1KTKA 1R0SA 2BFFA 2F1IA 2XIJA 1XP8A 2J9YB 5TQJA 3WNCA 4BO7A 1EZ8A 1QIFA 2I2XB 2IXBA 3TSWA 4ZFNA 4D0LB 1JHXA 1KSHA 3VSDA 2JAXA 2NW6A 3KYJB 3WK5A 2VSOA 1SLJA 1XNJA 1EHYA 1Y8RB 2QD4A 2VZ0A 5FPTA 1A3TA 1D2AA 4ZWNA 2PGJA 4LFAL 3VU9A 2F0EA 1CW2B 1PR5A 4X20B 4AJHA 1B2TA 1FP6A 2P5SA 2BV3A 3KU4A 4LRTB 2H2IA 1EK5A 1YNNC 1WDLA 2MFIA 3C3KA 4Q1DA 5B2ZA 3S99A 3T7IA 5JO0A 4K0KL 1GCAA 3KQHA 1F2UB 1Q7YC 1B3QA 1DTWB 2OPBA 1WZEA 3NPPA 2YXNA 1OLOA 2Q8IB 4YXFA 3OZTA 3U9SA 3P9XA 4G7ZC 3QU7A 4WXPA 5FNVF 2B8TA 1TCBA 4FC6A 1QPBA 2IEYA 3VR6A 4JP8A 4N54A 4YGYA 4KD4A 5EPEA 2WWVD 4EGCB 4EY7A 4BTVA 2NU9A 4YRZA 2PRJA 3I72A 3RRJA 4DAMA 4PC2A 5KX5B 1RTNA 2X5XA 3HV0A 3UJ8A 4PZLA 2O8DA 1NWCA 3QUAA 4R8NA 5IWAL 3ASZA 5LD2B 3HDGA 3LX4A 4QGGA 1TC2A 5IAOA 5JQGA 2FQ1A 1L2TA 4QU8A 3HO6A 1SXIA 5KVQA 2A7XA 1T10A 3HKCA 4X41A 4KAFA 1NJ5A 4LPKA 3SK0A 3W06A 4YCNA 1XXHB 3UWSA 2HIXA 1AK2A 1NVEA 4RVHA 4YAFA 3STXA 5JS6A 1SNMA 4PSUA 2B5VA 3T06B 5A5GA 2KJQA 3GVXA 1GP2A 4PQFA 4QDXA 1HYGA 4TTTS 4UUMA 1N32Q 1Y3DE 2DBVO 2E21A 3C3XA 3RS7A 4CCWA 3AVVA 2HXSA 5BNFA 1KSGA 2XLCA 2D4HA 2RI6A 3R9IA 1OASA 4JP2A 1L0XB 3SVLA 3ZXYA 2WF9A 1FDOA 4MS3A 3U3ZA 5KQLA 1E61A 1B76A 5BMVB 2VTEA 5CFNA 4YDHB 4X20A 3HGQA 1FYDA 2Q1YA 1YQUA 4HWTA 4CL2A 2P9YA 2XNDA 3DEIA 4AYBG 1YHBA 2EJBA 1QGOA 3CCUA 3JD1A 3K9BA 4TMVA 4JSRA 4XJXA 1DWOA 4MGIR 2Q8RE 3VDNB 1CHPD 1PTKA 2XCLA 3OLXA 1K6XA 2D0PB 4Z0HO 5CDYA 3VYRB 1NTRA 2DERA 3GV3A 3AUUA 4S1WA 5LKRA 2F0OA 4WOKA 4EMUA 1XLTA 2ODBA 4QSMA 5A0VA 2G8NA 4JEUA 1V5WA 4O2LA 1JWBB 1KORA 2PWAA 2J3HA 1TGVA 2H18A 2L18A 1ENCA 2QTWB 3SYMA 1RI1A 3REQB 1UKZA 1WU7A 2R8OA 3O1IC 2V7QA 1CRWG 1Q82C 3K0AA 3Q0TA 3QW4B 5G0SA 3C8DA 3K2IA 4MVYA 3V1MA 1XDWA 3EUEA 4J2HA 2OTJA 1EU4A 4P4SA 3V4RA 3UKOA 3ZIAA 3U3XA 3N8DA 4MP8A 3Q7PA 2V1XA 4NR0A 5K6TA 4ZRDA 1NMEA 1G5HA 1CVRA 1G5TA 2WU0A 3J7AF 2MTBA 5EWJA 3T0GA 4C7OA 2NQTA 4RAQA 2CKMA 4DLNA 2XTAA 4L4ZA 4LGVA 1E5VA 5JYDA 4KBGA 3A2KA 5CEJA 5K3AA 1JFFB 5K0JA 1J49A 3AX6A 1YF3A 2CL5A 2B34A 3AZOA 4CF6A 3CQZH 4OHBA 4YN3A 4O8CA 3STUA 2ZRCA 5IYDH 3OOSA 4YJ2B 1JT2A 2WSBA 5ILOA 4I1OA 1XK7A 4U5XA 2JGKA 2QTLA 4R31A 3UGKA 3VR1A 3RT1A 2IDMA 3QEMA 1XQYA 5DWQA 1PMRA 4Q6WA 4LF5L 3O3CA 1HSOA 3EVZA 4RAOA 4ZHSA 1IBLL 3TXAA 1S2DA 1CS0B 1S5FD 1OLSB 1DDIA 3Q41A 4A27A 4BL5A 2IL1A 4EHHA 1BCPD 4KI0A 3L0PA 3COVA 1EKXA 2O1SA 2RK4A 1P72A 4DR6L 4C43A 1Q2UA 2YICA 3I62A 1KI6B 2VHUA 2JFOA 1OLUB 3P9IA 1K4KA 4FP5D 3W2FA 3GPBA 5IDXA 3U7FB 2BLNA 4ZAYA 1YZ3A 4YTEA 5L45A 4D02A 4KLAA 3RB8A 5C8ZA 3G2HA 4R4CA 1DINA 2Z43A 4GQAA 1U2DA 1XU7A 4BMDA 4A3DG 1QS0A 5IPFA 4C04A 3LXMA 5ER6A 5JR3A 3EXG2 1EB8A 5K0GA 5JAZA 1W8IA 4RLFA 4K8RB 3GH3A 2CBZA 3ZJ5A 1F51E 1QB7A 1D2BA 2DX7A 1IBKB 2X69A 3DOHA 1BH6A 2XBMA 2JK1A 4AJ9A 4PLHA 4C3IG 4TL8A 3RU3A 2ZUDA 4IHJF 3TPCA 3UO8B 2AUTA 2E2HB 1QHHA 5C3MA 2P2LA 3I4MG 2V6BA 3VR4A 2VP4A 2X19A 3ED1A 4A1OA 4B0OA 2I91A 4MROA 2ZKIA 4P53A 2IYUA 1K83H 1N3IA 5FBLB 1G20A 4DUGA 1QCYA 3GEIA 2JH3A 4ZU3A 3S15H 1JHRA 3DMPA 4TV9A 4N9TA 1SIOA 5KHAA 2YUTA 3WQBA 1IN8A 1QSGA 4L4YA 1G3MA 4JFAA 3QLEA 4AULA 4XB1A 4CM4B 1O97D 4J1QA 1ZVQA 2VDOB 2QL6A 5CYFA 1PKXA 1ZN9A 1QTNA 5LWHA 2R47A 2HPVA 2NNWB 2G06A 1AEXA 3JD0A 2HFKA 1ZXLA 2DKOA 4HNSA 1AE2A 4DUYB 3MWFA 3JW8A 1A69A 2YVAA 2RARA 2W6PA 3R7SA 3ANSA 3VJLA 5TGZA 4M37A 4QUHA 4MTLA 1SELA 1X7WB 2B2YA 4FXGC 2OGUA 1LRKA 3G1UA 1KFKB 3G2NA 4HRVA 4Q82A 1HY3A 4NARA 5JYEA 2Z3WA 3M1AA 2WIDA 5HVNA 3BCRA 2WUFA 1GCUA 2PR2A 1Q17A 3OIFA 2IU6A 1X7XB 4FGWA 2OQIA 1N2CB 2VSQA 3PQDA 4TRJA 4XB6B 2L5TA 5FLEX 4QKQA 5JNRA 5IM4A 3OSZA 2F0QA 2XKAA 4BLTA 4F71A 4KXLA 1IWOA 1YOVB 2UAGA 1PZKD 1GOZA 1E0DA 1HMPA 3ETGA 3G3EA 3LKDA 3KK7A 4GKKQ 1U8EA 2Q6VA 1VE3A 3DMYA 1PRTD 5GAHC 1EP3B 3M33A 4Y2XA 2FFQA 4HYQA 2HWKA 3BCHA 4OBBA 2H4XA 1NGSA 1E2JA 4A3GG 3K35A 3KETA 2VTBB 1HBJA 1V8DA 1LSSA 4J0CA 3ZWBA 3SE7A 1BWPA 3VGPA 3HMKA 2DKNA 2HDLA 4YRFA 3BHJA 1SM4A 3P45A 2QMYA 1J2EA 3K6KA 3N28A 4I1SA 4JLMA 3E0EA 3SBOA 5K01A 1KS2A 2CYAA 5ARCA 3EQ6A 4BNUA 4QOHA 3X1ZA 4DILA 1R0LA 4IHKA 3V97A 1XBTA 1EM8B 3IUBA 4CMCA 3NXWA 2GM9A 4IMJB 1U80A 3TMAA 2WV7A 1CQPA 1IQPA 2ZTHA 3CR7A 3JQAD 3ZHYA 4D8YA 1NQAO 1X86B 3C6BA 2WNSA 3DP9A 4TVKA 3ZWDA 4FUTA 4BP8A 4LVNA 3EGDA 4UBNA 1ZHOA 3HO1A 2PGOA 3K9GA 3ZX4A 2ODEA 3LQFA 4KMOA 4C30A 1PTOH 5DHPA 1SD1A 2YHIA 3U37A 1O57A 2NXJA 3O31A 1D03A 4B76A 1UDXA 2JLRA 3H5OA 3MTBA 4X24A 3VOAA 3W2HA 2WQ7A 1A2QA 1T6NA 2QTBA 4F5DA 2ID8A 2PKEA 4CDEC 1V8BA 2FGKA 2GLXA 5CV8A 2V7GA 3VOSA 2OC9A 3PDHA 5IXSA 3IKTA 2JIOA 3CWCA 3RYTC 1U4SA 1NXWA 1YQ9A 1ZS9A 3GX1A 3NOVA 3WLAA 1ABBA 2WTNA 4Q9IA 4GLOA 2VNJA 1LV7A 4DLWA 4ER7A 1P1KA 2FCAA 3A5UA 3L79A 4BVAA 5KYWB 2HHJA 4HDSB 4F6RA 4I3HA 1X3FA 3VXKA 1HRKA 4UAUA 3EROA 1CZUA 3DAOA 1D1SA 1IPEA 1BRMA 1IQ0A 2PZGA 1CJBA 2ZB7A 4LJKA 1W1WA 4KVGA 2PPVA 4YP6A 5MFZA 4JELA 4P58A 5FJJA 4FNMA 1W30A 4H2DA 2Q3LA 1TKBA 4UVGA 3L04A 5HIKA 1CR4A 4JOIC 1QXSA 1GNPA 3IT3A 5FFNA 3RADC 4GT1A 1IK6A 1T8RA 1A2UA 2VP6A 3D6CA 1CA6A 2H3EA 2Y0EA 4E11A 2XGTA 3PO3B 4A3EB 1N0WA 3B70A 2EYUA 4MLZA 1GSHA 2PKXA 3F97A 1E89A 3C43A 2PI2E 1GAWA 1P6UA 2G36A 4JUCA 2VH5R 3R7NA 3UGQA 3I05A 3N8HA 1RXWA 5A2QA 4OX9B 1EM8A 3IL8A 5C3WA 1DAMA 3K58A 2OOSA 3ELUA 3SZRA 1W0CA 3HOZB 1C7EA 4N9PA 4ZPJA 4G01B 3X1WA 2EGHA 1WTQA 2Q2QA 4AUEA 1YC5A 3TLZA 3WIBA 1PFVA 1N5RA 1VMDA 1SXGA 3OCVA 4R2WA 3CEHA 1U4LA 3PUWA 2B63G 4EG1A 5EIEA 4YIHA 2X40A 4UTNA 1II9A 4G0OA 1DOZA 1YXMA 1H1LA 1X9GA 4R1SA 4WJKB 3U44A 1DKUA 4WXEA 1IH8A 2XVMA 1QZ3A 1T5LA 3DMRA 1QILA 1T2AA 5U4QA 1NW9B 2HLDD 3NSWA 1GNRA 3FFBA 4WSOA 4J1NA 4ZAWA 3S55A 2BN4A 1V4VA 3WK4A 4BBSB 1H2XA 3WLLA 1DV2A 1VCHA 4MKHA 4BNWA 5DFAA 1J9EA 3DMDA 2L9HA 2P9HA 1PTJC 4NULA 5DOZA 2XYVA 1ZM3A 3UJHA 5EHZA 2ZXOA 1YA4A 1SN7A 3N86A 4FR2A 5HILA 3LY9A 4BNYA 1C3LA 3D0KA 4D3DA 1FLDA 4LEIA 2YRFA 3O83A 3WDLA 1JBKA 2IRWA 2N46A 4ZQBA 4K2HA 1ZINA 1NULA 2Y92A 2Y2UA 1NVKA 3GQBA 4WNAB 1TWFB 2PHZA 4FLMA 1M9NA 3TLJA 4PVCA 4CLDA 4L5SA 1U2ZA 3NJRA 5JRDS 4K1XA 3MGCA 5L3ZA 3IEVA 3C41J 5J2UB 1OIVA 5IFKA 3C3WA 4HEA1 1DLJA 2F1OA 3A1CA 3DDOA 2ODWA 1A04A 1ISSA 1O7IA 7YASA 5K8IA 1F1JA 1V6CA 3FKQA 3SJUA 3CRKC 3GLGB 1VQNA 1HI9A 3WB1A 3K70D 1IXRA 2MYNA 5IBRA 4OHWA 4Z4QA 5LQMA 4PTLA 3O2SB 1O97C 3GLFB 4WESB 2H1IA 1M1YB 4UHFA 4LJLA 4R2KA 3HKDA 3HOZG 3BMXA 1BHQ1 1JYSA 4M8AA 1JRLA 2B4RO 3ELBA 3LBNA 4Q4AA 4DLAA 4CETA 4HMQA 1AKTA 5I9MA 1E2WA 1Z07A 1C9YA 3TZKA 1T9KA 2VDPB 2DRIA 3S1AB 4XQQA 3T7DA 1YJWA 1W25A 4AMUA 3IAYA 5C46F 3C4QA 1KK3A 1PZGA 2Q2WA 4MVJI 2JNWA 3I01A 3GP3A 1ZRNA 5AICA 3U4HA 3EG9B 5EGTA 4WUTA 1O54A 5KPJA 3OW7A 5LMUB 1H42A 1QVAA 3LHIA 5DAUA 1S8NA 4QPPA 4I08A 1DIAA 5FI1B 3F4BA 2VNUD 1ZK4A 2AYYA 4PO1A 4UBLA 3KZCA 3O26A 1TT2A 1DQRA 4MW0A 4J0IA 4RQAA 1F8GA 3IPAA 1MJEA 4BKMA 2XA2A 1O94A 2M2IA 4I9FA 1LTLA 1J24A 1KK0A 1LSUA 1KMIY 4P7JA 3IULA 4XYLA 2JIBA 4EY6A 5C51B 3MOSA 4PQXA 3WSTA 2ONCA 1ZCJA 2P2NA 3VC7A 1J33A 2BZSA 3OZIA 4HAUA 1ZJ6A 1BDMA 5IYZA 1PR9A 1NDHA 1UP6A 4G07A 5IWAB 2OQ0A 3BDLA 3H3VI 1K92A 1VQ9A 1CCWA 4TL9A 3U4VA 4K8JA 5BW8A 1RW4A 1WKVA 1FMFA 4N40A 4NONA 3LDGA 3UHPA 5ELCA 5D5QA 4GI3A 4B09A 4DV6B 2C7PA 1I50H 2QR3A 1JUDA 4AYBB 1JR4A 2X5NA 3K80C 3JQGB 4GSKA 4MKXA 2CN1A 4OXNA 3WL3A 4GN3B 2NZ1D 2B5WA 3KZNA 1R5NA 1U9CA 2QLLA 2CZQA 4TT3A 1YQDA 5FWXA 3T5AA 4IZ8A 4Q39A 4QOJA 2RI1A 3NOOA 1U8YA 1P29A 2B78A 1BR9A 3KPJA 3KVNA 5D6OA 1D6SA 5AKGA 1C3VA 2J9ZB 3GPIA 3FETA 2A5FA 1NYQA 2V0CA 2RBMA 2RHGB 4B4UA 3ZKAA 3IDFA 3PHBE 2AD5A 1E9EA 4RPJA 4MRSA 4PYRA 3TQFA 3PLAE 4HT3B 3P27A 2YNMD 1XAHA 1TWAH 1C7FA 1NPYA 1UF9A 3B8EA 4L50A 4KQMA 4OXKA 3VYTB 1Z9FA 4WBNF 5ALYA 4HQNA 4R81A 1UQRA 1C0AA 1TECE 2F4VL 1Y1RA 1ORHA 1A77A 2CXRA 2GRUA 2FR8C 2MR6A 3DC7A 4PYIA 4WTOA 5DN9A 1SB8A 4YK7A 4OHYA 3WHPA 4CCAA 3WOFA 1BN6A 4F7XA 3FCAA 2FQYA 3F1KA 4Q16A 1KFJB 4H59A 1F4PA 3NBHB 3IVXA 3NNSA 4DG8A 3S1SA 4ZREA 3G85A 1PYSB 1EGMB 3ND9A 2QN8A 2YJ3A 4CQMB 1VF7A 1ZA1A 4B32A 3A3NA 3EEBA 1UBUS 1ECJA 1FU8A 2VYVA 3I04A 4R51A 4Y2HA 1P2DA 5DSXA 4MHEA 4KRFA 4FHZA 4S2EA 2QGZA 4GKKB 3C3MA 3VC1A 4KXVA 4B3TB 1NVVQ 3T56B 2O3UA 4K40A 1SCIA 3FBTA 1TWAB 3I5UA 4HPWA 3NC4A 4IQZA 3QF7A 3T3PB 5JMTA 5CC4A 3JQAA 4ML3A 3JQBA 1S2MA 2FWMX 5LOVF 1EDOA 4P4LA 1UZMA 2R0QC 3H3XA 3LOQA 1MNAA 1XCGB 1FNNA 4FX5A 4GVPA 4IJMA 3VV2A 3DMUA 2VAMA 4LWPA 1ZK2A 3CLRD 1L7EA 1OYVA 5FPHA 3BB1A 4K6CA 2HD3A 2IEIA 2P8JA 3MJVA 1A9XA 3OF5A 4G1VA 3KJQA 2G28A 2Y68A 2QMZA 1BGVA 3HA5A 1T5DX 4GPBA 3SEZA 1NQVA 5HK9A 2XOKA 4FXOA 1DIHA 5IP7G 3HBAA 4OO3A 5C5DA 2HSEA 1K7SN 2ADMA 2P30A 1SK8A 2W5UA 1JDVA 3I01M 3KQPA 2J3IA 1NF9A 4MVJF 4ZHQA 5HUHA 3GJ3A 1G5QA 1LNSA 2D5IA 4DGQA 1ZJJA 3FY4A 4MVXA 5FLXE 4ZYZA 1XVTA 5B36A 1L5QA 5J4LA 1EFRA 2H65A 3B51X 4NENA 4TYNA 4H02A 1H69A 5K0SA 5B4UA 4YV1A 4L5IA 4C3JB 2EKLA 2XWBB 1TK9A 3UT6A 2BGNA 1Y1LA 4GD3Q 4PZCA 1P1RA 3JQDA 4WY8A 2O0JA 2IX3A 3DT9A 1W88A 3ONEA 5IULC 1YHQA 1MUUA 2YBDA 3ZDAA 4AJJA 3W5JA 4BTEA 4CV2A 3KJGA 4WKPA 1K5HA 2A5DA 2HSJA 4MW9A 4YHBA 1XLUA 2UXDQ 1W36B 4C0JA 1XEXA 2J4XA 2OR3A 2XBLA 4HGOA 4OREX 3W9YA 4YUAA 1HZCA 4XWWA 3SIRA 3P2MA 3LTEA 2CMHA 1C0PA 3F9IA 4Y8VA 5JDIA 1WX1A 4DR4Q 3E9ZA 3GTMH 1CUGA 1US8B 5E1FA 2HBQA 4JBHA 4LBZA 3TLKA 4B6RA 1WUJS 4NXNQ 1C2TA 1TVMA 4MRNA 1BCSA 4N1AA 4FDTA 2V6IA 4YRQA 5F33A 5FCDA 1H9SB 3KC2A 4P9NA 1I3QH 3BKWA 3LUGA 4LNAA 2HMAA 3IIIA 4ENPA 2ENUA 1MAUA 3PD1A 1TWCB 4GX2A 1Q3TA 1YIDA 2QRKA 3NRBA 3K1ZA 3OPQA 3QU9A 1BEUB 3N6RA 1VP3A 5FA5A 2PX6A 3CO0S 3A05A 5AHWA 1TADA 3V1KA 3ODPA 2BZ1A 3CF0A 1I4GA 3DHVA 4L5JA 4RC9A 5D85A 3TJMA 2CCZA 3R23A 3KBGA 1JICA 1PD0A 2IEAA 4NEGA 3JVVA 5TF4A 1ULAA 3ROZA 2P7IA 3C3CA 1G9SA 2POCA 2VZLA 2PUEA 3EGCA 1ULZA 3Q9NA 4NAVA 2B1JA 5EE3A 3ZDRA 4YMIA 2FQQA 3P9NA 3WGVA 3T5DA 1DPGA 1HF3A 3VI3B 3RIXA 1R4ZA 2O3SA 3NANA 4DK6C 1ZZGA 4K9OA 3F3KA 1L4GA 3CU5A 1NW7A 4DLVA 5ITZB 5C5MA 4ACBA 3SK5A 3KZXA 3LPLA 6NULA 1C48A 2PZMA 4EPTA 1MO4A 4ZXFA 5KTMA 3HVRA 3N9IA 3QFCA 5L4NA 4D74A 2A88A 3QFTA 2PL1A 1ONBA 4JIMA 1K8ZB 2GN5A 2VPTA 3G1TA 2JANA 2XGOA 3NEJA 1MX5A 1ZM4A 3BZDB 3JQCA 4CCYA 3ECCA 3HU2A 4G4GA 4MR8B 5BSRA 2Z1DA 3AKZA 4A8PA 1M6WA 2JDIA 1RZVA 1IBKQ 1T15A 4C4PA 2GXAA 3OJCA 2W6JD 4YREA 5C3UA 2JIDA 2ZIWB 3DS8A 4COOA 4E6EA 2INGX 1LA2A 1XUOA 4M1YA 4F2DA 5GTDA 4EDFA 2BMFA 1KI1A 4MRRA 1FSSA 4F87A 2R1TB 1TEHA 4IQGA 2ZRFA 4U7WA 1J2TA 1KI9A 3PGKA 4IL5A 1FVIA 1P9OA 2ID0A 1T4MA 1J0CA 1TM2A 3CRNA 4PV7A 2J59A 3LDFA 1CSQA 3D81A 3FAZA 5H1YA 4IRMA 1BFKA 4NPAA 2VIIA 4PG3A 4QYWA 4RJIA 5LQJA 3CF4G 4PCAA 5L3QA 1QQAA 2N1MA 2Q3BA 1Y48E 4HB0A 3T53B 2VDMB 1XPUA 3MBKA 1ES9A 1F6DA 4RZIA 4ARSA 3K2EA 4H27A 3U0BA 1E5LA 3U4GA 3WHKA 1M2EA 2Q45A 5GVSA 2RF4A 5IEJA 1TWGB 3BZCA 4EVQA 4RQUA 5CR9A 4KUGA 2TMKA 2C42A 4G0VA 5HS6A 1JB3A 1D2CA 1UP7A 2EKZA 4P3PA 1S9HA 2I7DA 1NQUA 4TKLA 1TQ2A 2R84A 4WFJA 3DVAB 3FCEA 1YBHA 3C1OA 4B3MB 1JDJA 1XWEA 1H9BA 3JARB 3TXYA 2YV5A 2ZM6Q 4A3JB 3OTGA 3FJ1A 3WQHA 3JZIA 2GFHA 5JPCA 4MP3A 2K28A 1PJRA 5IVIA 4K81B 4OL7A 2QN9A 1D4OA 4PR3A 3O4RA 4E14A 5A2GA 3MLEA 4OXIA 1H6BA 3O1JC 4Y6LA 2AW3A 3UH1A 2XZLA 3WB9A 4RTNA 5CB4A 1PF7E 1U1FA 5L53A 5IUNC 2QX4A 4UREA 4MJXA 2AFIA 4WMLA 1B0PA 1YD7A 3ORFA 2WVAA 3E3NA 2PD4A 1QIEA 2O7SA 3IS3A 4IOJA 4F8JA 1QUQB 3IKLA 4MW4A 1V8OA 1UM8A 2NACA 3BF8A 4FYYA 3VO1A 1YKSA 1FFSA 2MPMA 4XDGA 4L5RC 1BIFA 3AIIA 1G7SA 3K94A 3BYZA 1HKHA 3E6AA 2JEYA 3GMTA 2FMKA 3ASVA 4GZ5A 2SNSA 4WNAA 2QTHA 3R7AA 4Q3LA 2YNMA 4JLOA 3KR9A 2RJNA 2HK7A 3WLEA 1FJGL 1MI2A 3Q3JB 3RD5A 1Z5NA 1TVXA 1QF7A 4CKEA 1A8HA 4RM2A 3WJ2A 3MPOA 2PSHA 1S5CD 121PA 4R3NA 1X7YA 4L7QA 5AW3A 2HJWA 1EWRA 2E9SA 3G2OA 4F91B 4X60A 2NZXA 5EJAA 2ZJQA 1SUIA 2WMDA 2V7EA 1NJSA 4V03A 2ATCA 3V1NA 4RWZA 2VAXA 5H81A 3MMSA 3K7EA 4QARA 3SC6A 1DADA 3AEUA 4RCOA 1YR9A 4HR7A 4QTYA 3QIAA 3EZ7A 1LT4D 4GN5A 1XEWX 4ZOQI 5IYDG 2EE1A 2EFEB 4BE4A 3GAZA 3OA0A 2BM9A 4QDOA 3SYKA 1YBYA 1Z17A 2KSQA 3QWFA 5A7FA 4O0LA 1R16A 2FVYA 2AEJA 3RDPA 4X66Q 2AYZA 2EFHB 2CXSA 2RGDA 1H9RA 1E3IA 4ZVMA 2B83A 2O8CB 3GBVA 3HEJA 3W1GA 3KT6A 1E9RA 4MTCA 4FI3C 2E5WA 2W2KB 3AI2A 5AK4A 3VFDA 3RYCA 4AY2A 3OLCX 1BYIA 1PS8A 1K4YA 1TMYA 1H1DA 2PXHA 5JNUA 1IIRA 1M2JA 1MFZA 1ZUWA 2WC1A 2JVKA 1XCMA 2A1TS 4IUYA 2F0LA 5FUBA 2XXAA 4OHZA 3NIFB 1B3BA 1STNA 2FLWA 4QFDA 4QOIA 5BN5B 4BVJA 4F1KA 1BF4A 4X1KA 4J43A 5LD2C 4L5CA 4I2NA 3WXMA 4BMPB 2XCSB 4B3TQ 4DNOA 4XASA 4NI5A 3AMUA 5KDDA 1IHPA 4IUDS 3ZU2A 2C4MA 1U3CA 2DH6A 1J56A 2X22A 3GP8A 2X0IA 3WGUA 4MQBA 3T1NA 3ZVKA 5LZ4A 1JG6A 3PHHA 4XDHA 3LBYA 3EUFA 3M89A 4PO8A 4WORA 1FRZA 4QTXA 4NESA 1H8HA 3F7MA 1HR0B 4GXRA 2RH4A 3A4TA 3KRTA 2PU5A 4KXWA 4FQ5A 4ZAIA 4I7AA 4RCZA 4BLSA 1PT7A 4ISCA 4BV3A 4AKIA 2AZ4A 4AQYL 3LY7A 3JQGA 1Y82A 4AX4A 1XZEA 1DWUA 3HKSA 2KYRA 3PC2A 1PZXA 3HU5A 4URYR 4Y7DA 1HG1A 4YP5A 1NLMA 1I3KA 3H17A 1K9VF 3I9OA 3SXUA 5LP6C 1N36L 3E6ZX 2WVHA 2JEOA 4ZAGA 2Q4EA 4ZJUA 1U0EA 1Y1KE 4JP3A 5HIJA 5B3AA 3W5HA 2IEDA 2Q62A 5IJ9B 1Z26A 3LDUA 2DLDA 3STTA 2FZKA 3PDCA 1OXTA 3HOZH 1WLYA 1EUDA 2I4RA 3CLTD 3E9DA 4G36A 4G5RA 4KDCA 4B4OA 1RQPA 3G5LA 3KHKA 3QE0A 3AVUA 3L2OB 4AZVA 2P6OA 4FJ1A 4KO3S 2Y8EA 5F3RA 4RTQA 1ZKDA 3RFXA 5ELMA 1FQJA 4ZOLB 3BDCA 1F14A 2XCQA 3AJRA 5E4XA 3GRVA 2R6CA 4HB3A 1B8PA 2J3QA 3FVVA 3FZQA 4QPCA 3ZV6A 2DPMA 4AO8A 2WB1G 2HV9A 5A9SB 5AW0A 1R10A 1EUJA 2J85A 2YIDA 2FW6A 4DVGA 3UJ9A 3INTA 3HFJA 4AZ0A 2EOAA 1GDTA 3DWQA 2RGYA 4HQRA 5TVGA 1V3UA 4TM8A 4DV0L 1YB2A 2RIPA 4EI9A 3WV4A 2RGGA 4FPXA 4UE2A 1L1RA 4G5QA 2VF2A 1ZRSA 4RD2A 5FBHA 4B48A 3MZ5A 1SR3A 1VL2A 2FXIA 2GOYA 4AKSA 4B75A 4CJ0B 4OP1A 4C03A 1FFHA 2R92B 4WRDA 1DZIA 2ISQA 3GR6A 5C9ZA 1TXYA 5KYVA 2ZAOA 2HLDA 5BWOA 3N8KA 3SQNA 1KQSA 2IKQA 3DTVA 4X91A 4UAGA 2QGQA 5FA6A 3U26A 2G6BA 4L08A 4DUPA 2JAHA 3BXGA 2M9VA 2D5CA 2D7JA 4GNRA 3CVWA 4AXXA 3IQZA 4M0KA 1DV1A 1FUIA 2QVCA 1GXSA 1HTBA 2AUJD 3I0NA 3QNMA 3Q6NA 5TMBA 1GTG1 1YR1A 4R05A 4KK4A 2AOVA 2I1WA 1F77A 1UT6A 3OM0A 5UKDA 4DM7A 4EVIA 1VS0A 1Y5MA 5IN4A 1EY7A 2WU4A 1QH1A 1MR3F 1FPMA 4NH0A 4B3RQ 3T4PA 1RYMA 1VM6A 3RC7A 3UMCA 2VSFA 3WIVA 1ULUA 1H0SA 5JNVA 3H42B 2FMUA 2QQ0A 3B1XA 2Z8ZA 1CY1A 1UXIA 2SNMA 2J0TD 2CVRA 1UC5B 2QIOA 2Y66A 4A75A 3E8SA 4LMBA 4W5JA 1JEJA 5D5HA 4ZALA 2HO5A 3NHUA 1PRTF 4B3SQ 1M6VB 4BEVA 5AI6A 3F9RA 1PH6A 4MPTA 5AVOA 3TAHA 3CPWA 3CQ9A 5CB6A 2OECA 2PN1A 2I46A 2ZDHA 4HRXA 5CBEE 1DDGA 3WKDA 3HOYB 2PDAA 3V2TA 2PJZA 4FC7A 1U0OC 4M7PA 3SJZA 1BMDA 3LHFA 3WVNA 3A8TA 4OAOA 1VQ8A 4NW2A 1ZIOA 1ZU5A 5IWAQ 1Y8RA 3FR8A 4FBLA 4NJMA 5EI5A 4FWTA 2WIGA 5HQTA 1RAGA 3D3KA 3GLGA 3G8BA 3QE4A 4EQ6A 2I6SA 1K2VN 1VQAA 1YS1X 2B94A 4DV6Q 1ENZA 5EINA 4UOQA 5FJ8H 3O4JA 2ZAIA 1QLWA 1XDBA 3SVTA 2V9PA 1ADYA 4REQA 5AVWA 1HA6A 4TV8F 2WDPA 2MNAA 4DQLA 4XB2A 3BMQB 3P9RA 4WOBA 5JFTA 3OJLA 4JV5B 3CNNA 4JJKA 4YQEA 4M3NA 4CT5A 3F6SA 2UUCL 5DTEA 5C4ZA 1UBKS 3T1TA 4LF6B 2EQAA 1SC1A 1NJ6A 1CEQA 3ER0A 2UXDB 1VQPA 4KYIB 3SY8A 4DIUA 1ZITA 5DLPA 2X6RA 2FFBA 4WLVA 4CMIB 5B3KA 4HGPA 1YFLA 2JA9A 2V5AA 4MICA 4TT8A 3T38A 4DCVA 2FMMA 1R2QA 4HWOA 3S1MH 3MW8A 3SZ3A 4FSXA 3UCFA 3DHYA 4I4LA 1PKEA 2IH2A 1WETA 2H1FA 1SMKA 2YQ4A 3EIUA 1T24A 1Z7EA 3IUSA 5I2YA 1A3CA 3SM3A 1VA5A 3Q9LA 5B7NA 1SVNA 2XQJA 1V1QA 3KOWA 3PQ2A 1X1QA 4I55A 2CZCA 4LJYA 5SYMA 1EJ0A 1H5NA 2WF6A 4QXQA 3OQNA 1KH1A 2AN9A 3PV0A 1DEXA 1USGA 4TLCA 5EKLA 1VOTA 3RS4A 5DBIA 1C4WA 1PR0A 1T3SA 1PR6A 5DCUA 1HL3A 3V80A 3LYUA 2R97A 5F2EA 4AZSA 2IY9A 1T8TA 4TZTA 1IBSA 4IW3B 3JQ7A 5CPFA 4JC8A 1DIRA 3H1BA 1JTEA 4YWJA 4JZYA 5JNTA 3LWNA 1IBKL 4X6LA 2V5VA 2PY6A 4II3A 4Q3EA 1R4PB 3DWIA 4ALNA 2EW1A 1VRVA 5JAQA 1RAFA 3ANXA 1L0WA 4QUIA 3NBHA 1M0EA 1SQGA 1YJ5A 3A7EA 3EGWA 4G41A 1U81A 4DIMA 4CQJA 1B0AA 1PA6A 1NURA 2AOUA 2O8NA 1GA4A 2BELA 3HCEA 3IMKA 4YJKA 5LXTB 2C7QA 1Y1WB 1Y8QA 3T5BA 3IC5A 2Q2HA 3REQA 1JE4A 2I8LA 5I7VA 5KQMA 3T1YB 4KE7A 4WJ4A 5IGDA 3Q24A 1IYVA 3GTQH 2B99A 1PNVA 2CXOA 3FZEA 3R0JA 4QFBA 1BWSA 4GS3A 2P5TB 1B8AA 4YMWA 3CRVA 4BX3A 1ACLA 2Z2KA 2BFBA 2PFSA 1NKVA 3C6KA 1V1PB 3QOYA 5FYQA 1PJCA 2REQA 1A96A 2H2AA 2PUTA 3HCWA 4QYXA 1WQ1R 4BO8A 4D57A 2AEEA 3LFUA 2WT4A 2WAQG 4PZZA 1V16A 3FXAA 4DZRA 3I9NA 4LMQD 4OQNA 1A4IA 3GJXC 1AS0A 2AZDA 4XT3B 4Y2PA 4YACA 4AS2A 2OHGA 2RKWA 4A36A 1UJ5A 4C4TA 1SXJE 4KEAA 3GLKA 3TLCA 3ZDCA 2ZIEA 4HLUA 2HHLA 2I80A 2IYWA 2Z2XA 3LCJA 3TZBA 3BORA 3Q15C 1X14A 5D00A 2BBTA 4LXXA 4MCAA 4DV5L 3GLSA 3OLWA 3J81i 2F17A 4AY6A 2O8EB 4LDNA 2ZSEA 5G3ZA 5E6SA 3WWZA 3WO0A 1Y4ZA 3CB4A 3H8JA 1G20E 2JLAA 1Q8IA 1NN5A 4TLDA 5LWQA 3BE8A 4YRNA 3A9SA 4DK1A 1QOQB 4J75A 4S3MA 2XA1A 3LM8A 3P0RA 4EHJA 1DKRA 4HDMB 1PH8A 1DX9A 4NH4A 3FF4A 3ZEAA 1JFSA 1NQTA 4BFVA 2DFLA 2FZVA 1NZFA 2OBNA 2FSSA 2TMDA 3EC2A 4QUGA 3AFHA 1KQNA 5HNKA 4DV1B 2EYMA 5EIXA 3JQ6A 1Q95A 3PGA1 2HLPA 4JB0A 1XZKA 4WCFA 1T8PA 5HGJA 3TTUA 3NTRA 2FSHA 3FFXA 3LYLA 3M7GA 4QY7A 2Z1NA 1OZHA 4CLRA 2IT1A 2WTXA 1P77A 4IIDA 4E5MA 5KBYA 4GMXA 3WDNA 1XR3A 2BFBB 1CUBA 5JS2A 3X3HA 2XD9A 3U7HB 2ZJ2A 4OFBA 1KKLA 2BCJQ 5D1NA 1UBFA 1KY2A 4RD6A 5AJZA 4MR7A 1Y9JA 2W2VA 4OB6A 3TTTA 2PUGA 2D6FA 2AXQA 4R2JA 5ALRA 1QVFA 1X9IA 1IBCA 1JXMA 2Z2IA 4LVCA 4CTMA 4Y9TA 1DJQA 2P4QA 2YYSA 3SHFA 4GYWA 1PG0A 3HYRA 1H2FA 3GEHA 1CUFA 5AQEA 2OSBA 2DFTA 5HDQA 4C4YA 2IS1A 2O8FB 4D8UA 4FDBA 3KAQA 4B4KA 1KXLA 2FEMA 1TO6A 5P8WA 1CZWA 1EYDA 3H86A 4BFYA 5C8XA 3L5KA 1VXOA 2NADA 3VR5H 2IPLA 1RRFA 3HS0C 1B26A 3KAJA 1QZZA 1VQ1A 4CMAA 4BDSA 5B1YA 1J00A 3C85A 3AR2A 2C5BA 1YCGA 4K88A 5EHQA 3LQYA 3RK1A 1EVKA 2CDNA 2M32A 4B47A 1DKOA 4IDHA 1UE5A 3DZ8A 3S17B 4H4EA 3ZBPA 3ZE9A 1VLZA 1CVLA 5ITWA 4D46A 2ZJ5A 2HDOA 1QUQA 1CA5A 4ISBA 2E75C 1AG9A 1R8YA 1U5BA 2HQOA 5CORA 2O2SA 1CHNA 3AQIA 3V8RA 4MB2A 3WBJA 1IDN1 4LW8A 3PX7A 4OHPA 1L5VA 1PK7A 2QE7A 3L92A 4MV5A 3VVLA 2DPHA 3AU7A 1R15A 4U7FA 3R8FA 5LNK1 4BQOA 4F2WA 3TS2A 2J9FB 2CY0A 3FKSA 2RBKA 3F6EX 3OC6A 1F9SA 3K09C 5AW9A 4ENVA 1BCPB 2EBUA 1N0VC 5M7EA 1P33A 1EESA 5BWNA 5CVTA 3NIGB 1XXLA 3K53A 4LMPA 5A35A 3U1VA 5K0TA 2IUFA 1N32L 4YJ3A 4EG7A 2NSJA 5IXYA 5T6MA 4ODGA 1ILPA 3HJNA 2V55B 1XTDA 1ZHFA 2AG8A 2YVQA 3UT5A 5DB4A 1P0IA 4K6LA 2BF4A 4X95A 4ZZIA 4N3NA 4GMGA 4N8EA 1TM7E 4HJRA 4BC1A 5K0BA 3OCJA 4V39A 2X23A 3QY9A 2UZAA 4JD5A 3ZWOA 2KCCA 1Z7WA 2C2OA 2QUAA 2FHSA 2WMYA 3E70C 3ICPA 4GPZA 4N65A 1TFRA 4OO1G 2HADA 1HLDA 1S72A 1CRLA 3CUUA 5KJ6A 4XCXA 4FCWA 4H7DA 3C5CA 3HOVB 3TSZA 1C9DB 1T9HA 3I5AA 1IBMQ 1XTZA 3CSUA 4JNCA 1X3GA 1Z35A 2D2EA 3G6EA 4QSHA 3NEMA 3WLSA 4TX1A 1JMVA 2IHKA 4PPGA 1O2DA 3E9IA 1UIRA 4A82A 1DCTA 2OCAA 1O03A 2OYSA 3PWSA 4EY3A 4D81A 5CB4B 4IUBS 1G5PA 4UBKA 4EG5A 4YAKA 1TW3A 4YY3B 2UUAB 1KJ8A 4H18A 1WMSA 3EDYA 4C0BA 1XI2A 1KZHA 2X8JB 3IOCA 2K03A 4HGRA 4CWAA 5JLAA 4JBJA 3I2JA 3PITA 3JXEA 4DT1B 3MA2B 3S1NH 1A50B 1T2NA 1XCJA 2ZVDA 3CLVA 3NHMA 4FMBB 1STAA 3SPXA 1U0NA 2MSEB 4HDCA 4DBZA 1RRGA 4C1BA 1AHPA 3PUXA 4R4IA 3UI2A 2YS7A 5TSDA 1EY0A 3IRUA 2OBXA 1JOOA 3ND7A 3NKVA 5F2OA 4NU0A 3SOPA 3B9BA 5KYLA 1U0JA 4EX6A 3DUFA 3FVRA 4GWLA 4V2UA 4YQZA 4DA4A 3TZDA 2BUBA 2ZBDA 1HTTA 1YB7A 2JA5H 3V7FA 4MAAA 2W42A 5DLEA 3X1MA 3MXNA 1PWXA 1N9GB 2P40A 4MJ3A 3DVLA 4OM7A 4C0SA 3U9TA 1SNQA 1GG9A 4LK2A 1KDBA 4E31A 5HRAA 4LF7Q 1V0JA 3K05A 4O4LB 2PVSA 1VGRA 5TPZD 2FZ4A 1ONNA 1R37A 2OC4A 4PG8A 3LWZA 3BQMB 4V24A 4PPQA 1XN4A 4L3VA 1MQ8B 2ZQ5A 3F5FA 3NIWA 4QDUA 2DPYA 4WGGA 2AFIE 1II3A 1ZCAA 4DDKA 4EQZA 1YNND 4F04A 4JAVC 1O94C 5ECGC 5J58A 1L7DA 1R8XA 4II2A 3PWZA 4M1QA 4QPNA 4X54A 2FPIB 2XITA 3OWHA 4NCIA 4K6DA 4ZVUA 5TMDA 3UUWA 4KKVA 1YVPA 3HWWA 5EQ0A 3BN3A 4JLAA 4X8LA 1IJKA 1OH7A 1TZBA 4JI2B 4P2CB 1WUKS 4Y2TA 2DFNA 5J23A 2GDJA 1UPXA 3V9PA 4OMDA 1J8FA 3PBKA 3F0TA 3NGMA 3UWOA 1KSJA 1RLMA 4Q3OA 4HDOB 4F1WA 4OHVA 1IN7A 1RQLA 4FZJA 4LPSA 5A7HA 9LDBA 5I7EA 5K09A 1LK5A 3KEMA 1XPJA 3NHAA 2GKSA 3WYNA 1QOPB 2MJ8A 5J2TB 1E2EA 1CLUA 3GUHA 1YI1A 3SG0A 2NWGA 3LC7O 5YASA 2HIAA 3R0QA 1P62B 2G7MC 3PF5A 2Y99A 1SGWA 5KVSA 2F0WA 2K5WA 1T1IA 2H52A 1UEIA 5IE8A 3KJHA 4UNQA 4RXUA 4NJEB 1NAIA 1X80B 2VXBA 4ME5A 3GHHA 1ZSYA 1ODJA 1PFKA 1S2LA 4U7HA 3SJBA 5KJFA 4DV6L 1CUHA 5DXAA 2EYFA 3OOHA 1BWRA 1QV9A 3IDAA 3LLMA 2EJCA 3G48A 4FT2A 4N3BA 3FI9A 2WILA 4P36A 4OHOA 3CD6A 2C8LA 2JGDA 4HS4A 3H2BA 3TAUA 2V59A 4LQCA 1MQAA 3TOCA 3BKXA 3CE9A 1SA0B 1D4ZA 1GVPA 3BTSA 3MWEA 2XR1A 3JQRA 2XT6A 4J16C 4NDAA 3BGIA 4NZMA 4UM7A 4WLEA 1WHTB 5A04A 5M3MG 3O7MA 5EIWA 3HP4A 1DC7A 2AA3A 2Z0MA 1V41E 2WLTA 3GAMA 4NXML 3U39A 2QOEA 1KDRA 3KO8A 1AGNA 3OQJA 1WSWA 4IDBA 2OYCA 4JQZA 1JEYB 5IGBA 2AMJA 4MS1A 4QE3A 4MIEA 1EEHA 1XAJA 1I51A 1B3RA 3ZZMA 4JVNA 5BNTA 1RJ9A 5LMNB 2Y77A 1NNI1 1KJIA 3V2HA 4JYMA 1RZRA 2MMGA 4W6QA 4G63A 5EJ2A 2AI3A 4YYEA 1DTWA 3BA6A 4FFBA 3GDGA 3V7WA 5JEDA 2HHHL 1DNPA 1UK8A 1G8PA 2HBYA 1RDPD 2J4CA 2Q5HA 5TT0A 3FVQA 3PFWO 3KE8A 5CH8A 1QO7A 4W5QA 1JAZA 2VB2X 2I3AA 4AJOA 4BVLA 3FPCA 4HIKA 3DE4X 3LAWA 2K5HA 2YNMC 4FNFA 4OIFA 1T9CA 1DGQA 1L5FA 2B7CA 6AT1A 3HVKA 4X00A 5IJ9A 4W9NC 1UBCA 2X76A 3A6DA 5MHTA 3TNFA 1E9CA 2Q4RA 4I5IA 4M1TA 3OOWA 2WG0A 2ZB8A 4UBMA 2YMMA 4EELA 3S0JA 5HPYB 4X62Q 3ZLVA 1NQOA 4XUDA 2GO1A 3H9QA 1E7MA 4RJJA 2DGYA 4KPYA 1YR3A 4BO4A 2XWSA 4MVCA 1NNUA 4LFCQ 5BMVF 3QTLA 3N70A 1H22A 3UK7A 4D9BA 3B1ZA 3Q11A 4P5EA 1R4AA 3OPYB 1FW6A 2QV7A 1IVNA 1FYEA 1WXFA 3I0ZA 1GVHA 1QUFA 4IIXA 3H1PA 3P2EA 4AZ0B 4LFBQ 1A7JA 1HORA 2A9JA 3NUCA 2JARA 1KEVA 2YIJA 3KKOA 4R9RA 3UH0A 1A4RA 4DLLA 4JI7L 2HLNA 1E98A 1POXA 4RY8A 3SP1A 3LW8A 4GBGA 1SBCA 2EW8A 5KPDA 5LKAA 3A9UA 3TLBA 1E7QA 4C89A 4ZQIA 2K14A 2BM1A 2JKZA 3MWLA 4EB6B 3MXOA 2P6NA 3HI4A 3G5AA 4IMIB 5KAMA 3EXIB 3N05A 4KTVE 3WE7A 1J5PA 4PXYA 4R9VA 4ZO6A 3COSA 2KS6A 3RS8A 1E0AA 1DBQA 1RYHA 1YQQA 5DE3A 4IFBA 1HMYA 2O6LA 1NF3A 1P1FA 1TCAA 5SY4A 4HS9A 3EIQA 4UARA 4UUAA 5JV5A 1XE3A 4CF5A 2L17A 3AHIA 3WWEA 2WR8A 1FP4B 4LCJA 3TDKA 2QU8A 3OKFA 1X77A 4OOFA 2YDYA 3CFYA 3DHEA 4GHWA 4NYIQ 4TKVB 3VNUA 1M2NA 3T1YQ 2EGUA 3NDIA 3BJMA 1OYWA 3LHDA 1K73C 3H9CA 4G1MB 4QGFA 3NHHA 2HTEA 4BMXA 4URUR 1G18A 3JD2A 3CX3A 4YCSA 3KDSE 4F9EA 3QXHA 3GG9A 4ASUD 1TWGH 2IYAA 2NU7A 5U9CA 2JIQA 3CKKA 3SCZA 4FYKA 1E2IA 4W6ZA 1YZGA 3ZY3A 1P3JA 4A3FH 5GROA 3F74A 4EFKA 3GRCA 3L01A 2KA7A 4DAOA 2O2GA 1N5JA 2X8AA 3SDZA 4U8GA 1J06A 2CGEA 1YA8A 5EXSA 3S7TA 4BATA 4B31A 1AF4A 2O4XA 4DN4M 2XB9A 3HPRA 4TOIA 5B3JC 1F48A 4Q5IA 5J9FA 4O08A 1JIKA 4DCCA 5CBKA 1WZUA 1NHGA 3RVQA 1N6HA 2EHJA 4ZCMA 1JHZA 2ZKLA 4DY4A 1IIBA 1IJBA 3Q9UA 4HJXA 4ZQEA 4JQCA 3FTCA 4DLXA 2WAYA 1STOA 1MTZA 3HBNA 1RC1A 5A9TA 4V1CI 2JA5G 1LPAB 2BBOA 2IYEA 4MUXA 1B4OA 1CY4A 1V6SA 4LNQA 1K27A 2D7CA 2G76A 2KHZA 2LP4Y 3IVGA 4Y3UA 1P7VA 1AIPA 2F0GA 3E7XA 4FK8A 4PG4A 2DYKA 3JYQA 4TKUA 4ARBA 4LJ9A 1JDPA 1NVTA 3OKAA 4RULA 4DR1Q 3D4DA 4LF9L 3NC1C 3RTEA 2XYQA 5AVTA 2PANA 1BN7A 3EIEA 4MI6A 1A82A 2WINI 4V0RA 4EQPA 4JWKA 3OX1A 1U1EA 4C7KA 4NS4A 3ES9A 2VL7A 4L9AA 4ER5A 1GGVA 3ZGVA 2JA1A 1WY5A 2ZVPX 4HWPA 5JAPA 3ZHUA 1WE2A 2X6GA 1G7TA 5JD4A 2XKJE 4DA7A 2GJ8A 2WJ6A 2ZJ4A 2OQ2A 1IULA 2UZ1B 3JRXA 1ESZA 2QTRA 3BICA 2OD9A 1W4LA 3FUWA 1HFGA 1P1JA 4KSBA 1QPGA 5D3MB 3IKVA 2YZMA 2MHVA 1ZH4A 3ZU5A 5M2QA 1SHLA 2VAPA 4APVA 3WWPA 2AWNA 1BROA 1BU8A 1I6WA 1NN3A 4LSWA 2JFVA 4RA8A 4REMA 4A6EA 4CM1A 3I9KA 1QHGA 3U16A 2LNDA 4JYZA 1AGPA 1Y9EA 3QPDA 1FY2A 3BFJA 4G23A 4IEEA 4JEHA 1I1NA 1L5RA 1E62A 1T5OA 5GAJA 1M8PA 3FTNA 2Z6UA 5CYPA