4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
b'MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COME
molecule tags Transcription
source organism Streptococcus pneumoniae
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
2FEKA 2LUOA 1PEYA 4FB4A 4KFCA 1SXHA 2L18A 2ID7A 2PLNA 4W5NA 3K9CA 3TD9A 3OM0A 1ZH2A 4NV3A 4N41A 2P4UA 4RV5A 5JNVA 1XWWA 1F51E 1JL3A 3M6MD 4RK4A 3GWGA 1KGSA 1PNRA 1U0SY 2IPNA 1DCMA 3O2JA 4XASA 1PNTA 1L5ZA 1D1QA 3F6CA 3GYBA 1EWTA 4G0ZA 2IPLA 4YGXB 1DJMA 2R4QA 4WWHA 4DQDA 4KZKA 4EUKA 2JCGA 4H60A 3Q7TA 2WB4A 3T6KA 1NY5A 1P6UA 3O2SB 2WWVD 2AYZA 2GX6A 4P98A 1NXVA 3NHZA 3QEMA 4O1HA 4YLEA 2QV0A 4NCBA 2B1JA 5FWXB 5IC5A 3TMYA 3NNDA 1JF8A 3ROFA 1D2AA 1GCGA 1ZITA 1TM2A 4XQQA 1VKRA 3N75A 2JBAA 5CNKA 2GI4A 3ROTA 2WY2D 3CG0A 2CHEA 1QQAA 4YP9A 5IUJC 5IUNC 3EAFA 4JB0A 1RXIA 4OATA 1S8NA 2FQYA 3GBPA 4JA2A 2FKAA 5DLEA 3IDOA 4MS4B 2JB9A 3H75A 2F8TA 3HDVA 4H3KB 3H5TA 4MYRA 3E61A 3OQOA 3N0WA 3H1FA 5TPWA 3RVKA 1E6KA 2FLWA 3M9XA 3QX8A 2GWRA 3O21A 1TJYA 4G0OA 4Q7EA 1ZN2A 4MS3A 3FDFA 4OBBA 4WZZA 4YRZA 2JVIA 3OMWA 1NXPA 7ABPA 2JBAB 3H1EA 3HUUA 3O2QB 4WT7A 4KQ9A 1LBHA 1CHNA 1T34A 3I45A 3Q15C 4KK4A 5EWLA 3RVMA 2PUEA 4LX8A 1DZ3A 1DBPA 1B00A 1Z13A 3JPYA 4YO7A 3CTPA 1D5WA 1DBWA 2V0NA 2LIVA 3CHYA 5BRJA 1KMIY 1Z12A 2A9QA 2X7XA 3BREA 3Q7SA 1HEYA 1D4ZA 4M88A 1Z2EA 1BDJA 3LUGA 3QELA 4RSMA 3DLBA 4XXEA 1ZHHA 3QLUA 1EFAA 5JNWA 3I09A 3M9WA 2CD7A 1BVHA 1BDIA 3FFTA 4RK6A 4B09A 4MS1B 3EDCA 4EGSA 1U04A 1P8AA 3NNNA 3O75A 3EULA 5KQPA 1Z18A 1RXEA 4JAVC 3KHTA 4ML3A 4DN6A 3OO0A 4LZLA 1Z15A 2F8SA 5EWMB 2PL9A 1Z2DA 2FTKE 4KQCA 3KCNA 1ISRA 4MQEB 1QP4A 2MYPA 2FQWA 3NNSA 2P9HA 3A0RB 1U8TA 9ABPA 2HQOA 1QNLA 1JFVA 1D1PA 4PEVA 2E4XA 3H5LA 4RK1A 3CLKA 1USGA 3CG4A 1P6QA 4KRFA 5TPWB 1GUDA 4KPYA 3GL9A 3G85A 4F12A 4N03A 4P1ZA 3RVLA 1SXIA 4KV7A 1YVUA 1XHFA 4Z9AA 4D74A 4MQFB 2I6FA 3LUCA 1BAPA 1DC8A 2O20A 1FFSA 2PJUA 3JPWA 4G0XA 4Z99A 3R0JA 1OXKB 4O5AA 2VYCA 4WXEA 1WETA 3OLZA 3EQZA 3HEBA 2E4VA 3QLUC 3A10A 4HNSA 2QZJA 1GUBA 2M1ZA 3DLHA 3GA5A 3QELB 6CHYA 5TQ0A 3N53A 5EWJB 1FSPA 2FMFA 2PUCA 3SY8A 5HM6A 4RK7A 4RK0A 1SRRA 4S04A 1FFWA 2IPAB 3H6HA 3MM4A 4G97A 5ABPA 4OLAA 2L2QA 2FMKA 3L49A 2PL1A 6ABPA 1RZRD 1YK1A 2HSGA 3EODA 3OLYA 1APBA 5IEBA 1K68A 2LP4Y 1RZRA 1FQWA 2FVYA 1QP0A 3QLVC 5HQJA 3B2NA 2E4WA 4XYQA 4UHJA 2FSPA 5TQ0B 5KWSA 4IMIB 5IEJA 4Z4GA 5T3YA 4Z9BA 2GKGA 1QKKA 2KYRA 3FGZA 5IULC 4JOQA 1NXTA 3A0UA 3T8YA 3CZ5A 3KYIB 2FMIA 4F8JA 3HO1A 3C97A 1DP4A 2PUGA 4RXTA 1USIA 2M98A 3D8UA 4Z4HA 4ZJPA 5C5EA 4H3HB 4HNRA 3VNAA 2OQRA 4MGEA 2JK1A 3QLVA 3O1JC 4G86A 2CWDA 3TO5A 1ABEA 4LE2A 4ZMSA 2IYNA 4N47A 3RVQA 3G1WA 3F73A 4MS3B 2NZUG 4MLDA 2FLKA 4HYEA 3SG0A 1YMVA 3HSYA 5EWJA 3OO1A 1YIOA 1QPZA 4TN5A 4XXHA 5IX8A 4L4UA 5DTEA 5TE9A 3FFXA 4W5OA 2QSJA 2ID9A 3OLWA 1I3CA 4JB2A 2FMHA 3MF4A 4G0YA 1MAVA 1A0OA 4PE5B 4EYKA 1Z25A 3N8IA 4ETMA 3SNKA 4YWHA 4RZSA 3OM1A 3F7NA 4Y9TA 2B4AA 4QPJC 5FWYB 4ZYLA 1JWLA 3IP5A 3T95A 3SM9A 1L5YA 1JHZA 3F6PA 1Z17A 2ZAYA 1M5TA 4EYOA 4RKQA 2DRIA 1GCAA 4MRMA 1TVMA 3LUDA 1NXOA 3CNBA 3HCWA 5CHYA 5C5CA 3LKVA 3H5VA 1M2EA 3IP6A 4RXUA 4RY9A 4TMYA 1ZH4A 3RH0A 2QW1A 5CNMA 5TPZD 4Z4EA 5KC9A 4G0MA 4Q6BA 2IPMA 4E7PA 4ETIA 3O74A 3NBMA 4IGAA 4IRXA 3EQ2A 1JBEA 1FFGA 3NHMA 4LDAA 3MYYA 3HM9A 1ZVVA 2L17A 1QO0D 2HQBA 8ABPA 3HV2A 1JX6A 3N0XA 5D2CA 2LBPA 3KLOA 1RNLA 4XAQA 3RVNA 5KQMA 3HVRA 1DCKA 3SAJA 5I4CA 2FQXA 1C0EA 2E4UA 4QYWA 3SQNA 1GLGA 4D6XA 2IKSA 5CNIA 5FBKA 2MYUA 2VUIB 4ETNA 1QMPA 3ILYA 2FN9A 4QYMA 4NCAA 4KK3A 2ZWMA 5KQLA 4RK5A 4Z4FA 3QK7A 1RPJA 4YCSA 3OLVA 3C3KA 4ZMRA 4XQJA 4HNQA 4XYOA 2PE5A 1P2FA 3FMVA 3GBVA 5B3JC 3O1HB 1LJLA 3HXMA 1F4VA 4ZPJA 2LPMA 5B3JA 4RY0A 3JY6A 5FWYA 2PAFA 1JYEA 1JFSA 2TMYA 1ZGZA 4G0QA 4KNYA 3HK2A 3MQ4A 4PYRA 3IP7A 2JVJA 2PMCA 3H6GA 5PNTA 3RVJA 4GNRA 1KRWA 3OQNA 3BRQA 1YK0A 3JS5A 4G0PA 4MR8B 5TQJA 5BQ3A 4F11A 3QEKA 2WJAA 3Q7RA 3S99A 4YR7A 2FXIA 3GRCA 2PUBA 3CRNA 2VK2A 4PZ0A 3DGFC 4MAAA 1JH9A 3LTEA 2NZVG 4W5RA 4W5QA 3JTEA 1J56A 1Y1LA 4MS4A 5DCLA 3W9SA 1IIBA 4XFKA 5KQGA 4WXMA 2JVKA 2RJNA 3FFWA 4LRQA 5E3JA 4RS3A 1NXXA 4MS1A 2MSLA 5KI6A 4MR9A 5CNJA 1BA2A 1BDHA 2PUFA 4EVQA 3DGEC 4RKRA 1NXSA 3CFYA 4D6YA 2QVGA 3LUJA 3DZDA 1QO0A 1DRJA 1DG9A 5JNRA 2CHFA 2E4ZA 1Z26A 1JDPA 2RJOA 3IPAA 5TPZA 2FW0A 3HS3A 4OLBA 3UUGA 4TLMB 1UDRA 1NATA 4OTZA 1EAYA 5IUKC 3H5IA 1PEAA 3MA0A 4MR7A 2R48A 4NICA 1H9CA 2IOYA 3QLTA 1ZGGA 1ZESA 1ZDMA 5IBQA 5BR1A 1DBQA 3BRSA 4EVSA 1A04A 5TQ2B 1JYFA 1YMUA 5HKOA 3A3KA 2A9RA 3BILA 4MR8A 5DGCA 5JNTA 3C3MA 2HPHA 2W42A 1JLKA 2VUHB 2MSWA 4O1IA 3OMXA 4YS6A 4F3TA 2RGYA 1JDNA 5BRAA 3KG2A 1ZY2A 3K4HA 3QEMB 5JS1A 5EWMA 3LUKA 1LJUA 4FE7A 4IF4A 3HJFA 1ZAYA 1EWKA 4EVRA 1NXWA 4XLTA 3RVOA 3RVPA 4TLLB 3BS1A 5JNSA 2QU7A 2E4YA 2R25B 3RQIA 4W5TA 3H5OA 1LBIA 4KVFA 2MSKA 4MR9B 1U2QA 1QQBA 1TLFA 4S05A 4G4KA 2QVCA 4MQFA 3UK0A 2PUAA 1JFTA 1YS7A 3I42A 1VPWA 4QICA 1E6LA 2QR3A 2H3HA 3KLNA 4IMJB 4OG2A 3LUFA 5HSGA 4RWEA 2NT4A 3ILHA 3Q9SA 2HJ9A 4F06A 5JNUA 2Q5CA 1MIHA 2NT3A 4LDZA 2NUBA 4XARA 5ED4A 1A2OA 1PUXA 3KJXA 5TQ2A 2YHBA 1LK0A 2N9UA 3UKJA 1EWVA 2JRLA 1MB3A 1YS6A 2HQRA 4MR7B 1M5UA 4Z4CA 1TMYA 3LKBA 5GOTA 5DKFA 3VNBA 1DRKA 2R47A 4MPTA 4IILA 1C4WA 2XDYA 3H5WA 3LUHA 3RVSA 3OQMA 4DADA 4FE4A 2L19A 4KMRA 4L85A 1E2BA 4LE0A 2MYTA 3KTOA 1VLZA 1CEYA 2WMYA 2PKXA 2H0AA 2YHAA 4LE1A 5F64A 4KREA 3O1IC 1DCFA 4N0QA 4N76A 3I5AA 3BBLA 4E7OA 4MLCA 1ABFA 2J48A 3CS3A 4EY3A 2FEWB 1AB6A 1SXGA 1URPA 3OLXA 2OENG 5EWLB 2QXYA 4UHKA 3CU5A 4WUTA 2WJWA 1EHCA 4YV7A 2A9OA 3TB6A 1SD5A 3URMA 1M2FA 3KSMA 1U2PA 1W9HA 4GPAA 1R8JA 3LUAA 4MRMB 3HZHA 4CBVA 3LMKA 3E3MA 1YTUA 1E6MA 2AYXA 2BGGA 3HUTA 3L6UA 4N0PA 1NTRA 2IDMA 3C6QA 4XQNA 1USKA 4Z0NA 4Q6WA 3GV0A 5KC8A 3RVRA 3CZCA 1OXBB 4RXMA 1MB0A 2GBPA 1MVOA 5T7BA 5JS2A 3N6VA 2FEPA 2RDMA 3C3WA 1DC7A 3N0RA 4JP1A 1QP7A 1Z16A 1VRVA 3IPCA 4Z4IA 3T38A 3TX6A 1KRXA 1ISSA 3LOPA 3MMNA 3Q41A 2PUDA 4RY8A 3QX9A 3EJWA 3KS9A 3DBIA 3GT7A 2A9PA 3CKMA 4MQEA 1AB5A 4RDCA 3P9YA 3IP9A 1W25A 3LFTA 4JASB 2MYNA 3JVDA 1K66A 2FN8A 4EYGA 3JVIA 3D02A 5FWXA 5FBHA 1CYEA 4NQRA 3KKEA 3HDGA 2WRZA 3H1GA 4EYQA 3MIZA 4RU1A 5GQSA 3EGCA 3KYJB 4PICA 1PHRA 1XHEA
chains in the Genus database with same CATH superfamily
2O2HA 2FOLA 3UUWA 1ZZEA 3RUFA 1G55A 3NIFB 2RJ3A 1SYBA 3GGPA 3OJOA 4XE5A 5B2FA 3ABZA 1I7SB 2OHOA 3ESXA 4DR4L 3DE7X 3TECE 4MCJA 5M5XH 1NE7A 3VC1A 1I8TA 2B2XA 3PT5A 1OB5A 4TS3A 2WU3A 3UV3A 1EG7A 4C1NA 3WWVA 4MYTA 3S1MH 2GNPA 3CISA 5ELCA 1UMDB 4IH9A 3W9UA 1OF1A 3ESZA 1G0NA 1U0SY 1RACA 1P6XA 1SE2A 3F6CA 1HDCA 5IT9L 1E3IA 1EBUA 2KB0A 2PNFA 2ZAIA 3GJZA 4YGXB 2R4QA 2XX3A 1I3QB 4FXDA 4E2WA 4D25A 2K5VA 2RSOA 3MXOA 3F5MA 4LSZA 1EDOA 1E79D 1XJQA 2OBMA 4RHEA 2B3GA 1LPOA 3HFSA 3ZZMA 1JG2A 1P6UA 1XZFA 4POFA 5FI3A 3ZKWA 4AWXA 1H3EA 2BHNA 5JADA 1NBIA 2HK6A 1Z75A 2NO5A 4PHGA 5E4WC 1EQ2A 1Y3IA 4LPSA 1LS6A 3CLUD 4M7PA 3LGAA 1WY7A 1O4VA 1S2DA 1PHJA 1CP2A 4C2MH 3CEPB 4H2DA 3K0AA 2YZKA 2YYAA 2HCTA 3NT5A 5CA0A 1V48A 3T12A 4F9TA 3AHIA 4ZYUA 5IUJC 4HLUC 1NWCA 2IVZA 5C1PA 2WTXA 1U65A 3VHRA 3CGGA 3V4FA 1NVBA 4BX0A 5CB0A 1WDWB 3L7YA 1BE8A 3M70A 4MS4B 5CA1A 4RPKA 4MKXA 3AR6A 3N0WA 3H1FA 5GQOA 1STGA 1JT2A 4QDOA 2P3SA 3ACCA 4NVRA 3NP8A 1RFGE 1T35A 5IP9H 1DLIA 3AJEA 4CM8B 3RIMA 3BMQA 5K7SA 3K35A 1WB9A 4QHSA 4BFYA 4NYMR 3GPIA 5A9TA 4E70A 10MHA 1L0BA 4QU0A 2IF0A 1SVWA 4KK4A 4F46A 4A3EB 4JT9A 3RUPA 1VPTA 3ASUA 3DMNA 3TQFA 2BKVA 4A5OA 3R74A 1KZ1A 3JYHA 4DCUA 1B00A 1Z13A 5HF6A 2H5LA 1JJGA 2QZ9A 3NS7A 4J1TC 1PKEA 2AVNA 1GTL1 1QP8A 2RGWA 2WSBA 4BX2A 2G0TA 5HMLA 4EGVA 4YTEA 4YRBA 3L7BA 4UVIA 2GVBA 2OG1A 4RVFA 3EG9A 2H85A 1RQ2A 2ZPUA 4PM4A 3LUGA 3KXLA 2Z6KA 5EZ6B 1GGFA 4OI1A 3WJ7A 1Y89A 2Q45A 3G2NA 3TG2A 3LYHA 3OEHD 3FDZA 3QLUA 5I8ZA 4CQNA 1RWWA 4DR4B 1D5MC 1ZI6A 3FFTA 4LZJA 3LQFA 2WSMA 4JR1A 3VGPA 1EDDA 2B8GA 1JHPA 2PXCA 2EP8A 1SOVA 1A2UA 2RGRA 1REQA 2GWHA 5IC4A 1B8OA 3NYWA 4A93B 1DUVG 1T8YA 2GAFA 2O7QA 3WP1B 1CUDA 1LK5A 1TZ2A 1TWFH 3HKBB 2IJ0A 3OO0A 1T36A 1JR3A 3EGEA 4RPHA 4MQEB 3H99A 2JN4A 4POAA 3OLCX 1YIDA 2C7RA 1F7UA 4EG7A 1T4MA 2QPTA 3YASA 5BW6B 1NIPA 4BQNA 4D0RA 3I2ZA 4RE5A 1HR0W 2F0IA 5M5YB 1JJFA 2NU8A 2BEVA 3CLKA 3SS8A 1P6QA 4CE6A 3FWYA 2QNIA 3RSSA 3LHDA 4CUJA 1X39A 4D9BA 4ZK2A 2G04A 4RIFA 3NUZA 4B4KA 1MG5A 4MTLA 2AOXA 4A3LG 2GTPA 1AFPA 2QGZA 5ULLA 2FB9A 2DP4E 4RCVA 4IPGA 2BGLA 4X6UA 4KDEA 2AQ1B 4FGUA 1JIJA 3LUCA 3PIIA 4X61A 1Q3LA 2PEYA 4L5YA 5EPEA 2GK6A 1IBML 1BS1A 4BLSA 4C7MA 3GZJA 4IXTA 2A5DA 4G5XA 3RHFA 3F2CA 1GPH1 1KLUD 4Y7CA 3WBKA 1D03A 1YDGA 3HEBA 4P3PA 4KGDA 5EMHA 3DBHA 1E5DA 2OK8A 1OYVA 2QZJA 3U39A 4DCOA 2X4GA 4RHRA 1H6DA 4BNNA 1MIOB 1TWFB 3GFGA 3SR3A 3ZXYA 4DUYL 1VL5A 3B6JA 4XIFA 5H02A 1RQPA 4H7KA 4R9NA 1P17A 5ALUA 3CF4A 5COBA 4P86A 3D59A 1E8NA 1BCPC 4OREX 4HIMA 5KCZA 3QVKA 3FDXA 3JWHA 1A9TA 3KJPA 1EYAA 1JPUA 1D1TA 1P9LA 1ST3A 2W7TA 2X8JA 4G1FA 3AW9A 4LGMA 1YRHA 4S04A 4XIGS 1SNYA 2FMKA 2ZYRA 3P8ZA 4UMVA 4M37A 4ALKA 5C1IA 1L4MA 4C4XA 3K9QO 2BFNA 3W1GA 3IJ5A 3LA6A 1EOVA 1Y7LA 2EDCA 3FAKA 4A3FH 4FCTA 3ZU5A 4B84A 2R8BA 4NP5A 3IMCA 2FF7A 4XJVA 4MZXA 4YVFA 5HQJA 3HCDA 5B57C 3UJ6A 1XXHE 2PS0A 2WUDA 4FNAA 5GGYA 1GDTA 5JD5A 3R6WA 4HR7A 3S3TA 2F64A 5L3QB 2H5IA 4KAFA 1EK0A 2GJKA 3HGTA 1EWHA 4WNYA 5G41A 3UQYS 1ZRNA 1MBYA 2XGSA 3EAQA 3FGZA 4NJOA 2CFOA 5EHXA 5JI2E 1MQAA 4A0RA 1GSHA 1J09A 1U8ZA 2WD9A 3CZ5A 2Q6OA 3AH8A 3KYIB 2M9VA 1EBFA 3LRXA 4HIOA 4U2CA 3U37A 2DUMA 1BFUA 1S4MA 4OO1H 4H6XA 3U4CA 1A1VA 3D8UA 1EQVA 5FOXA 3EQ9A 2VPPA 1NMGA 1WYDA 4HH3C 5KYVA 3RHSA 4A8JB 4BMPB 1DPFA 2IZZA 4MV8A 2K14A 3N86A 2WMOB 4CI0B 2BFFA 3VC2A 1PQWA 1I6HH 2A9VA 4UAUA 3E8XA 2C4NA 2ZU0C 1GN8A 2FEXA 3Q40A 4XVRA 2XXAA 1QH8A 2V97A 2ZM6B 3M4PA 2HPVA 4YP6A 4E3ZA 2RH5A 1RM3A 3E15A 1XZGA 4D9FA 2BGMA 1DEOA 1JIIA 1RHJA 4IHJB 4YV2A 3I6BA 4BX3A 3CSDA 5E7NA 3CWQA 4TOIA 4Y1RB 3D8TA 2BSQA 2CLCX 1HDYA 1VPDA 3RU2A 4F5YA 2AEEA 5IRCD 1O0CA 1WF3A 4IQ4A 2QGQA 4Q3AA 5HIAA 1JZQA 2FSSA 2NX2A 3BB4A 3KCQA 3PDCA 2PT6A 3JAME 1EWCA 2O8BA 4Y0AA 2GCEA 3MF4A 4G0YA 3MRSA 3JQFA 5HBGA 1GQRA 3BE5A 1CQXA 3ZEAA 2HH9A 3EZGA 3AYHB 4DLKA 3U60B 1A9SA 3UATA 2WQ7A 4HRYA 3I04A 1XZMA 3MVVA 3V4OA 5FOBB 5JH7F 5K05A 5IWAB 3LDFA 3F6PA 2JH8A 1NNEA 1C1XB 4A26A 3VKWA 2F1OA 1KVQA 4C3JG 1YNOA 2PK3A 4RKQA 2PVCA 4HTFB 2C4VA 4IQZA 3VYTB 4RTMA 3OZTA 5DSXA 4WINA 5CHYA 2AG8A 3ELYA 3HZRA 1VQDA 3HBAA 3DMDA 4BB0A 2MSDB 3IFTA 3EFOB 4MI6A 4DPKA 1FSSA 4ESOA 1M2HA 5I4IA 1ZH4A 3GO4A 3RH0A 4L27A 1U1CA 1XZQA 1JALA 5LC1A 3WHPA 1VCMA 2IPMA 2QRMA 3SK5A 3DONA 2CLDX 3EQ7A 2VR1A 3E22B 1SXTA 1QCCA 1J7KA 1RQNA 2IXEA 3B1JA 4IRXA 4QGBA 2N3SA 2QUHA 1PI3A 3R9XA 2QN1A 2NMVA 4RD3A 4AIMA 1E0KA 1VJ0A 1TUEA 2HQBA 2VKQA 2ZJYA 1W8DA 3AJ8A 3OKCA 3QF7A 4NDNE 5LUAA 2WK1A 3GLSA 4UHFA 2HIVA 1NW5A 1DRUA 3SAJA 5AICA 2PKQO 3RTDA 4MP6A 1IW7C 4EMBA 3BWCA 3EY4A 2A94A 5CCXA 2QVXX 4DLYA 4EABA 4TVOA 3UAXA 1P2VA 2Q0XA 3WYEA 4KLAA 3MGBA 1QCYA 2PUJA 2QD3A 2HD3A 5KYNA 4FCWA 1D5ZC 3CZRA 1OH8A 5I9SA 3DOUA 2OSBA 5TDHA 5AVXA 4OKIA 4EJSB 4EA6A 1SQ6A 2Q3HA 4QQKA 4NJEB 5A2GA 3H87A 4YCLA 2NSJA 3EIFA 4WGGA 3ZE0B 1W4LA 2EZ8A 3PCRB 1P1JA 1YRYE 3B3FA 2QAGC 2JJ8A 4NULA 3BHNA 4A36A 4H6VA 2JLAA 3MJHA 5JY1A 1HDOA 4MWTA 5FQOA 3DNPA 5U4XA 1GV0A 3AUTA 1B1ZA 5ILGA 2W48A 5KNDD 2IBSA 1F1BA 4NCHA 1MGPA 1ZINA 3D8SA 1BS9A 3L6DA 4F0JA 4G0PA 4LNUA 5BQ3A 5JBNA 3K9HA 4ARSA 1DIHA 1OD6A 4BBRB 3HDTA 3PRHA 1ODFA 3CRNA 3AFMA 4PO8A 4FFMA 4Q39A 3DGFC 2FK8A 5KTOA 2B98A 1C5KA 3I92A 2J9XB 1YC2A 1BF4A 2NZVG 3A4MA 1OFUA 3AL2A 5FEMA 4B7AA 5JFOA 2V7QA 1NG9A 4WZAA 2AA3A 4QXAA 1IQ0A 5DCLA 4BXXH 3MMSA 3D6NB 4QA9A 3PUJA 4R7TA 4JBWA 5HKLA 3NDBB 1JILA 2BGNA 3BQMB 2SNSA 1FP4A 2GZ3A 3RS4A 4I55F 4ZVVA 2Q5IA 1TX4B 3EBOA 2QA4A 3P4YA 5LYJA 3S2HB 2E0IA 2H0QA 5KNBD 1ZYUA 4LTMA 4ZVOA 4IXNA 3ZD8A 1P9NA 5D85A 4ED9A 3R8FA 1M2VA 3EWIA 3G5MA 2CCKA 3IOYA 1Y48E 2VHXA 4QLOA 2DWOA 4X1OA 4AN0A 4E03A 3LK7A 3ZHTA 1I2DA 2J8ZA 2B4RO 5FJIA 5K51A 1XRNA 2A3RA 4O2DA 2VCEA 1E3TA 2Y6UA 4DDKA 3GTJH 2FK7A 1PD1A 1MPTA 1Z5NA 3FHOA 1K83B 2ES2A 4J1QA 4JODA 4A6PA 4BMVA 2B61A 2YIJA 1RAGA 3BMOA 4DRZA 1TWGH 2ZB2A 1L7EA 2JA2A 1U99A 4P4NA 1ZJYA 4FD3A 2BE7A 2JGJA 4LZNA 3JVUA 3CCUA 1RPNA 1S9HA 2C88A 2KWIA 5FAXA 2R92B 4PNYA 1WMAA 2HRZA 1ETHA 1SZPA 3GX1A 5JNTA 1JR0D 4DA8A 1UP4A 4GI7A 5AW7A 1VI2A 4YH1A 1WZ2A 2MOKA 5D51S 1ZNQO 1U7UA 2VAVA 3BXEA 1JHVA 4MIKA 4O1IA 4OMFG 4N8EA 4Q16A 3T54A 4CU5A 2GLUA 1G5PA 2RGYA 1JHQA 1NF8A 3CUTA 2MO1A 5CGQB 2B0JA 3HSKA 5DYIA 5H81A 3U7JA 1AVTA 4AL4A 4CF5A 4TV8A 4YMUA 1IWOA 2GDJA 2EJWA 3A05A 4CLXA 4NXML 1K6EA 1UIRA 1BQ4A 3N9IA 5DTJA 2XQFA 5LBUA 2W8BA 3A9VA 1BWRA 4HO1X 1FU4A 1ULBA 1G5RA 3DHQA 2GM9A 5LZ2A 1L9KA 1OLUA 4DSUA 3JATA 1ORTA 2YVUA 1GFSA 4HB4A 1CS0A 4IJ6A 2K5WA 2AN4A 3N5KA 3ZCTA 4DV2L 1N8KA 2FWNA 1XKQA 1QCZA 1W4CA 4RTQA 3I72A 3EZ7A 3FHJA 4D45A 1Y1VH 1DTEA 3VR3D 3UMYA 5TX7A 3MAGA 4JJ7A 1QQBA 1B1CA 2BCJQ 1KY2A 1FUYB 4YCDA 3I39X 5D6NA 2DFPA 3PQCA 4RIHA 5DYGA 3K73O 4PLVA 1X9GA 3II6X 1FP1D 3OFSA 5CGKA 3TS0A 1TAQA 1V7PC 2GILA 4YHHQ 2QT9A 4HGZA 4R1OA 4REMA 1KJIA 2AVDA 5CCBA 1HXYD 2BKLA 1Y1WG 1LTHR 2ZJQA 1PH5A 4NNOA 1AA6A 3H7AA 1SUEA 1XK7A 2G9HD 1QZUA 4FDVA 4UUOA 5LZ8A 2PQEA 1EMDA 1J8YF 2AN3A 3M83A 4LNHA 3UG7A 1SBNE 4C9BA 3F2UA 1BVSA 3DZ8A 3HBFA 3M4XA 1GT6A 4IDFA 3C3CA 2P6NA 1F8UA 1Q74A 1PFBA 1UC8A 2C0PA 3NC1C 1FNNA 4O4HF 4UPVA 5C18A 4RCOA 1DRKA 2D2XA 1KO4A 2GPNA 4E0BA 2GJ8A 1QF6A 3BF8A 3O3MB 1DTWB 1BDMA 4OFWA 3RVSA 4B81A 4EW3A 3B13B 2L19A 4P9NA 1TA4A 2WYIA 3C3DA 3E3XA 3FNHA 1DWUA 1UBFA 3ICOA 2OEOA 1U94A 2Q5HA 5AI6A 4EFMA 4BAGA 1EWQA 3TS2A 1H93A 3A14A 4F60A 2R6ZA 2VF5X 3OOHA 4E7OA 3COWA 3F3SA 3SVZA 2PXXA 1AMUA 5H82A 3FNIA 3ZU6A 3MCTA 4PNPA 3ZXIA 1NV9A 3GJTA 1X8LA 4F85A 4MCIA 1DDIA 3PVCA 5CT9A 2IUUA 3IHKA 3N28A 3H8JA 3W4IA 1P2DA 5EHZA 3A1EA 2OR3A 2JFFA 4MIYA 4P5PA 4QUFA 4YWMA 3DEHA 5DASA 4HDNB 5C5LA 5EWLB 2IDZA 3ZK8A 3OQIB 1MC4A 4Q82A 4HZUA 1FS6A 3QFSA 1SCIA 4CUZA 2UYHA 3GJ3A 5FAKA 1V1MA 2OESA 4C2BA 4H3VA 5I4DA 2QE7D 4DWOA 1BFKA 2GO1A 3PXXA 4JELA 3E9NA 1FXUA 4QG7A 1A8IA 3HACA 1UPFA 1KOLA 4EAAA 1AT1A 5UKDA 1SRUA 3VU9B 5DHQA 3UWSA 1Z5VA 2ONJA 3HBMA 1NVVR 3CGWA 2E48A 1J42A 1KZ9A 3O31A 1NVUQ 1PK8A 1EA7A 4D9CA 1YZQA 4YJGA 3D4DA 2ORWA 4ZZ2A 1PSZA 2OV1A 3C6ZA 1UT8A 3HMQA 1K9MC 1HDRA 4RHUA 5DV9A 3TOVA 3DDUA 1TJ3A 3CPEA 3O1LA 3AILA 1QUFA 3EPHA 1OXUA 1KO8A 1VE9A 2LVBA 2QUZA 2VBCA 3PF8A 4PGFA 1CVLA 4KQ2A 5IC6A 4A8TA 4CTKA 1G1AA 2ANCA 4FF3A 1Q7GA 2YWJA 3MLEA 4D0LB 1U0NA 2VWPA 1OFVA 1ZUHA 5E0OA 1JB3A 1D6JA 1LT5D 5IT5A 1TT2A 3N2GA 3ORYA 4GKKQ 3U3MA 1JJAA 2B92A 1S2MA 4CM4B 3ZXUB 4G07A 1MGSA 4B79A 5ALEA 1WFQA 3MUOA 5T6MA 2QQFA 3T94A 3C43A 4EPYA 5L51A 3KQHA 2E89A 5J22A 2R7ZB 4KFRA 4DB4A 4PQEA 3OFJA 3KTAA 4IFDJ 3E6ZX 4WKNA 1Y7IA 1H9SB 5G0UA 4AYBB 5DBOA 2MPMA 1PT6A 1PH2A 3DTVD 4AMZA 5B7NA 1KRHA 1BCRB 2VXBA 1TWGB 1BW9A 3KYJB 4R9VA 1RLOA 4DR6Q 4PICA 5BR8L 2CLKB 2JQOA 3HXLA 2D06A 4IDOA 3WMGA 1GWNA 3IUYA 4BGIA 2D0PA 1PJ3A 1K08A 1M2KA 1N9GA 1Z08A 2B2WA 4R4CA 3HJNA 2BTQA 4R1LA 1E5XA 5JNVA 1ILWA 1VL1A 3ILVA 5EZYA 4C4RA 1L4BA 1CQJB 3CC7A 4CV2A 3AOEC 4NMWA 1Q83A 4KY7A 3A8IE 2JK8A 1VQCA 2RGCA 2ZRDA 1SULA 3N2IA 2X0NA 3O2JA 4KQ1A 2OK7A 5AQEA 1DELA 1KZHA 4KXUA 5THKA 2O8NA 3PQDA 1OKKD 4LF6L 4XSVA 5AXCA 4C4AA 1RSZA 4CIVA 1D2NA 1QFYA 4JK1C 1QFXA 1KMCA 3Q7TA 1HA3A 4C3HH 4HGOA 1H1TA 1TF5A 1CT1D 2BH2A 4DV1L 3UMGA 4QGSA 3FHTA 3A7LA 2O52A 2JKZA 2YXNA 1N8NA 3AWIA 3C4VA 3FKSD 3DO6A 3O2SB 4FYVA 1ANKA 4LI0A 1VQ7A 4DMFA 5JVDB 3LPDA 2JGEA 2A78A 4L73A 4OSEA 3RZDH 2HLHA 4IPDA 2OWEA 4A3IH 4IRUB 3OD1A 1D4AA 2HNKA 3MTDA 3QQPA 1QC5B 4WKPA 1SYGA 2GHQA 2AHRA 5B64A 3GDEA 1DZ1A 3FMCA 2GSDA 4WASA 3KLPX 4F6LA 1ZGBA 3F4KA 4NZYA 1VF7A 1LWOA 1R3UA 2J3JA 4V0ME 4U2EA 4CL3A 3D6UA 5H9WA 3N0VA 6NULA 1NI5A 1V8OA 1C3JA 2IHKA 4JBXA 4RSRA 4UY8C 5CPBA 5T6BA 3ZIDA 5KNLA 1RXIA 1WXDA 1SIWA 1UKCA 4QXQA 4TLEA 4XLZA 2Q8NA 5DLEA 1SG0A 1BDHA 5HM8A 1XFAA 2Q62A 5BV2P 1YJCA 1XNQL 3KETA 1E8MA 3M49A 3QVJA 4PLPA 1HG0A 3L84A 3E61A 2ZRLA 3OJEA 4DQUA 1KZ4A 1SG9A 2AQ2B 1N92A 1YUMA 4R8MA 4MVJE 4P54A 3RLOA 4MZDA 3WGYA 5KU1A 2H5EA 4Q7EA 1ODIA 1UWCA 1S9DA 1E6EA 2HCBA 3FDFA 4B80A 4OGGA 5F1PA 4DIEA 1PGPA 2FX3A 2JEAI 5GTDA 2R1TA 3H1EA 2FY8A 4KK7A 3WLIA 4TUYF 4BEBA 4TL7A 5ILOA 2HXGA 4A3JH 1JJ2A 2JD0A 5D7BA 5EWLA 2ZSIA 4C3VA 4EMSA 2EYOA 5CV8A 4C29A 1S7CA 1Q2UA 4BNFA 1GYQA 2FZLA 2RK3A 3MTQA 4LX8A 5EIBD 1B16A 4ZOLF 5LP6F 3JPYA 3N07A 1Q15A 2K05A 4W99A 1CZWA 3ZY2A 4K6DA 1Y63A 2X13A 3MWEA 5BO5A 4KQWA 5LBIA 1KWGA 3WJ2A 1RPAA 2QAGB 3AR9A 4WOPA 1AZTA 1HL7A 1OW3B 2V8OA 5FIUA 2EW2A 1C4KA 4K2HA 1EUCB 1LT6D 3JYQA 4MJ3A 4EY4A 3UG6A 5K4AA 1A69A 2DMRA 3FCAA 1G38A 3N2KA 3PCXA 3TUZC 4CR7A 2MJLA 3K0KA 2N0SA 3L7OA 3RAPR 3ZLVA 2QRJA 1G21B 2GA4B 1YQ9A 2Z3WA 3AY3A 3AB9A 4EQPA 1T8SA 3X3HA 1X42A 5LVAA 3U56A 4ZLTF 4CN9A 2P0EA 2OLKA 4QNRA 1E1YA 1S5DD 1Z18A 1UJ6A 4NEHB 1GNLA 2XHZA 3L7ZC 1KAEA 3C98A 4WLNA 2O6LA 4B2LA 2RI6A 3H1TA 4JJKA 1CPYA 1UAYA 2HUPA 3GDOA 3PQFA 4KN8A 3I4NG 3DLPX 4Z0TA 4CHTB 4AZSA 5FK9C 5FLXE 4KJOA 1JDZA 2D2IA 4OMCA 4D4LA 3O83A 3BVZA 1KJQA 2BD0A 2EWVA 3CZ9A 3T1YQ 4RGTA 5DX0A 1K89A 121PA 4HJ5A 1PWZA 2BOVA 2VXWA 4IUCS 3T15A 1X1SA 3GL9A 1KL7A 1Q12A 4ZEWA 2PFGA 2NTVA 5F7XA 1UUFA 2Y66A 2E1RA 5I4BA 3AVYA 4CG1A 5ELFA 5DT2A 3DMHA 3H11B 5J1SB 2QDXA 3FLMA 3RQSA 1ORVA 3E70C 3PIO3 4PY2A 2J9FB 1YNXA 5KYLA 1A8QA 4OQ4A 5EKDA 2Q4DA 3E84A 3WBJA 1OLSB 3GFTA 4JXXA 4DTIA 5LQAA 1IDOA 3D9QX 4B6SA 1S4QA 3VSCA 1Z3CA 1XD8A 4W9NC 2C5LA 1KZYC 1DU4A 1A9OA 1K27A 2QEQA 4S35A 3RK0A 1LNQA 4WK0B 1QE3A 4R2JA 1Y5IA 3DLHA 4ZJYA 6YASA 4P2GA 4QG3A 3CRLC 3E4DA 3RSLA 5EWJB 5K8CA 4DLXA 5A4FS 4IPHA 4ZTUB 1XMXA 2R79A 3A4VA 3FMPB 3GRAA 4TM8A 1KS2A 3HOYH 1ECBA 2VT2A 1XBTA 5BQOA 4B3TQ 1WULS 4F8YA 1R74A 3C8DA 5FBZA 3LHSA 3KLSA 2EE1A 5HJ2A 1E77A 4Y1RA 3ZH9B 4ZQGA 4IEIA 1E98A 5ABPA 3RTCA 1OTHA 2NO0A 4EFKA 1D0VA 3AFIA 5A6SB 3T3IA 4YHHB 1W75A 5NULA 4C6SA 4X85A 2DBZA 2XR1A 1K68A 4PZDA 1GHKA 2AR7A 4ZZ1A 2A3NA 4JLSA 1DRVA 1ZH6A 5FPKA 4ARIA 3OZXA 3J81k 4IUVA 4AY3A 5EE5B 3HDQA 1Y3BE 3ZDEA 1RXSA 3I2JA 1CQFA 3R3JA 4KACA 4PYLA 5M04A 3C2PA 1L4KA 1HKUA 5B1HA 5ELLA 3EUWA 5KOJA 2R6GA 5AMXA 8ATCA 4U3JA 5ALFA 2RHBA 4GWKA 3IVRA 3RT9A 3SGLA 4BCDA 3H0GG 1B50A 1GARA 3NHBA 3NJRA 5JCOA 3NRCA 3B3AA 4E2ZA 3I1FA 4A3EG 1EX6A 1M2VB 1L7AA 1WW8A 4IQGA 3E3NA 5C5EA 5DK6A 4V0LA 4M8SA 1VPVA 4O3FA 1VGRA 3ONFA 3ZCQA 5CYGA 3OCJA 4ARCA 4OHRA 2K1BA 2UXCL 3KKPA 4EG0A 1TYAE 4ODIA 3J81L 1C9EA 4RDXA 1OZGA 5CJPA 3K0CC 1XU4A 4GL4A 3TJMA 4DA7A 3DYVA 3KJNA 5IK2D 5F9FA 2D6FA 3TI9A 2W0MA 4C6TA 4O0LA 1NJSA 3VM6A 3U4AA 4RFBA 3MCAA 4ZOLB 1SVIA 3H9GA 2BI8A 3DNFA 2C7BA 4QOGA 3E05A 2EXXA 2RG7A 2INGX 3PBKA 4ZTBA 3HCCA 4ON9A 1N9KA 1ZUD1 2H29A 4W5WA 1RYNA 2XKJE 3NAMA 4YMGA 4NCJA 3GTQB 1CERA 5HZMA 4ZCKA 5AM0A 1BCPB 5FUQA 1T5OA 2FMHA 3QM1A 1MG0A 1N2CE 1GSOA 3IALA 3BIWA 2NZYA 3DG9A 4K8JA 1I30A 4HQRA 4X91A 2ASEA 2C77A 3S6JA 3NBIA 2KHSA 2HHLA 1K28A 2HJHA 3UXHA 3H15A 2BL4A 3Q85A 4WOJA 3UJBA 3TQQA 1V16B 4UNSA 2H00A 4HS4A 4ZT6A 1O95A 1PJ2A 2FMUA 3LUDA 3R5FA 4GN5A 1F20A 4HGNA 2K04A 4MA4A 5IJZA 2XT9A 4W4TA 5BUQA 3SWWA 1DJLA 2G28A 2PH3A 5EY5B 2FSGA 2GZMA 5HIKA 2ZWOA 5K36H 2YWHA 5JCOC 3IFSA 2BBOA 2W00A 1FFDA 5MGBA 1YQXA 2QTLA 4MWDA 3NZEA 2AQHA 3BAZA 2A84A 1PK9A 4DHEA 1J7JA 1TQOA 2NXWA 3BSYA 1Z4QA 1XN1A 4D9EA 5I7FA 3TTTA 3CQ9A 1A5SB 1IVYA 1DINA 4YXWD 3JQAB 5L7TA 5EZYB 4TMKA 621PA 1MJGM 2GD6A 3EZFA 2RA4A 1NR2A 5IWAQ 2Q6LA 4QQNA 1PMRA 1EY5A 2KCNA 3F8TA 1G7SA 2NU7B 3HDJA 3TCKA 3W6NA 4D9NA 1EYGA 2R8OA 5H80A 2Q4BA 1WV0A 2QXTA 3GG2A 4ZMRA 1K3TA 2TYSB 1JRLA 5ELBA 5AXAA 4DCPA 3G0IA 3O92A 1WTRA 2G25A 4ITUA 1GCIA 3M2PA 4HDRB 4MA5A 3BMQB 3JYLA 4HLDA 4PFKA 5AYVA 4DRXA 3FCSB 2Y92A 5AW3A 1QNFA 3TL3A 3CX3A 4D3DA 5FRDA 1R66A 3URYA 1XMVA 3HK2A 4E5MA 5IYBG 3NELA 5IE8A 1F2VA 4IV5A 1Q0UA 2WNHA 4Z7QB 3IP7A 4JT2A 4ZJUA 5AVSA 1NBEA 3PO2G 1JEDA 1V47A 2FXVA 5LHY1 3G6EA 3H6GA 4FNFA 3I0MA 1RP1A 4HEJA 3BZKA 3K7AH 3HMKA 3R6LA 5GINE 1YK0A 1YFZA 2JPDA 3A6KA 4Q1BA 3QF4A 4CIDA 3PXDA 5LL6P 3CRMA 4V3CA 3COJA 2OCXA 4I1OA 5CA0B 3OCUA 1O95C 2VK2A 1X1TA 2VQDA 1ZW6A 4IJMA 1M0TA 4G4IA 4CW7A 4MPPA 3EOAI 3WXMA 3D5QA 3HXPA 1LTBD 1NI3A 4IDEA 4M46A 1GPDG 3E35A 4CEJA 3LG2A 1VQBA 3AMUA 1M8FA 2I5MX 2XZLA 3FVWA 3D0OA 2CHGA 2B36A 2J3DA 2WJ6A 4KGVA 3IPLA 1G1MA 4MS4A 5CA1B 1PZID 3G4SA 3ROQA 3VDQA 5JS8A 1VJTA 2BKXA 4DR3B 1XU9A 2WIGA 2YRWA 3EMVA 4HQLA 3IODA 2UXDL 2ZR9A 4OONA 4HLNA 3NP7A 1O96A 3WLLA 3IKLA 1HSZA 4QLBA 4RGOS 3M81A 3T5TA 4JI7L 3Q22A 1JQKA 1LDBA 1J0BA 3J7A5 5KBYA 2E49A 1VQFA 4ME6A 4BVLA 5CC4A 1QS0A 2I2CA 2QM0A 4QYSA 3SCZA 3NQTA 4HWGA 4DR2B 1HNXB 3PHJA 5JPCA 1PTOC 5E3FA 3UCFA 4CDDC 2V9ZA 4HEHA 4CEJB 2WAOA 1W35A 1JJBA 1TRHA 3D6MA 3IYLW 1IBKB 3H9UA 4TXJA 4GECA 4EKGA 1GNTA 3CZ4A 4L8VA 4LISA 4GMGA 2HAEA 3CMEA 4QU8A 2WT8A 2YJ3A 3EGOA 4JEMA 2LXJA 2SKEA 2ZTHA 2B63H 1XCLA 1PRTB 3KWMA 3T3OA 3S17B 3GY0A 4LV8B 2CHQA 5IBQA 4B47A 3ZW8A 3FFAA 1PZMA 4QM7A 2WTNA 1V4VA 3GQBB 2I6SA 1WR8A 4TMZA 4UTPA 1JYFA 3BMCB 3UW1A 1ZSNA 1B43A 1KYZA 1H2BA 4I36A 4V0MA 1FVHA 1L8AA 3M33A 3K4PA 1LUAA 2GPBA 4MGHA 3CUYA 2QORA 5LQKA 2XGJA 3KEQA 2YYZA 4MRVA 3K80C 4WE3A 5EJFA 3NT2A 3WLHA 4UQOA 1O6FA 4Z1MA 2X7HA 3F6SA 3LUKA 1XZPA 3RLIA 5HF5A 2DH6A 4EVIA 3SSNA 2R5WA 1NGSA 3M7NA 2JA5B 1HUNA 2GNOA 1HFNA 4CMJA 3BULA 2FPSA 1BS2A 4E30A 4H02A 2B94A 3AW8A 4Z49A 1O54A 1DB3A 1QWOA 1J5EL 4XDGA 1ESCA 2DBRA 1U2QA 3KBBA 1AA9A 1K8YB 3MWJA 3GAAA 3Q8WA 3PO3H 4CJ1B 2AJTA 3A26A 3K70D 4TWBA 4COKA 3UMVA 2DEUA 3EVEA 2O8FB 4FYIA 2C4UA 1XROA 4WW0A 3IXQA 2P40A 3ECSA 3MG9A 4DEXA 3ZQ4A 1SPBS 2GD0A 3R93A 1UJBA 4GFDA 2ZUSA 1P80A 2NSYA 3PI6A 3R2JA 4HL6A 5E9QA 4BIMA 1V6AA 3NYQA 1WMFA 3GRRA 3FPBA 2F6RA 1IZZA 1Z6TA 3I2YX 3I34X 4A03A 4ZIRA 2A1AA 1B70B 4A2QA 4XWWA 5CDFE 3KJXA 2OGZA 4RM3A 4CN8A 1LK0A 2AX4A 1YS6A 4UKDA 1DUIA 2DSTA 4OQYA 2KECA 3CXRA 3FN4A 4RLHA 3TE6A 1KYVA 3TUJC 1ZGAA 4DDWA 3MBOA 3I8ZA 3NI2A 3UK7A 2DT8A 3VA5A 1DM0B 4KV6A 3LUHA 4FOPA 5C44G 2BISA 4O0MA 4RJKA 4TV8B 1LTID 1I36A 4QHTA 3G5AA 5CAEA 1YUNA 4MEBA 2ZE8A 3MCVA 3CUEF 5E1OA 4BE4A 4E4YA 5A9SA 2ZIXB 4V03A 5HX7A 1S8FA 1K7SN 4QRHA 3EJ6A 2H0AA 1SYFA 1P5ZB 1B3RA 1J22A 1Z0JA 2JGIA 1JQ5A 3JSAA 3NGXA 2C9BA 3L0ZA 4WJZA 3TOSA 3N2GB 4N76A 2OTCA 1MDFA 2QD2A 4L0QA 1MR3F 1E24A 1Y3DE 2J48A 2JI9A 3C85A 3GEPA 5FWAA 2IGTA 4QXRA 3OOJA 4CM8A 5IGDA 4EARA 1UBGA 3CPJB 3OQJA 3MGCA 4MHSA 4FB5A 1WV1A 3RUEA 2DPLA 4D81A 1EYDA 5BY2A 5I6DA 1M8JA 3NOOA 1JFLA 1S2OA 1QGED 1XRQA 1T3TA 3A56A 4B3RL 2JC3A 3DB2A 3DDOA 4JYZA 3RAFC 2YW9A 2R7MA 1U1FA 3OPYB 2DGDA 1NQUA 2BI4A 2R5FA 5KTRA 2GETA 4LXHA 4F3RA 5BSVA 5IM4F 3CM0A 5DNYB 3DUWA 3D0QA 4WCVA 2WIDA 2K50A 3EGXA 4HPXB 4FGWA 2QG9A 1YACA 1KMHA 2Q1WA 3ZHSA 5IM4A 4GP9A 4QY7A 3NVKI 4XWOA 1BEZA 1NMEA 4CZ2A 5LJLA 4C6HA 3QWHA 5AW6A 4QNNA 1TO1E 4RCZA 1JBKA 3AR7A 2JA1A 3F7OA 2K5DA 1RWNA 2VY3A 2FPGB 2I78A 4G1UC 2I62A 4MARA 1NN1A 1P5HA 1GA6A 1M73E 2V7VA 4KXLA 1QCDA 1CVRA 5FR1A 3GUCA 2CHUA 1LI5A 2HIAA 3UAZA 2PT5A 1JR4A 4BNTA 1O7IA 3EH1A 2GKOA 2MR5A 2Q3LA 3GB9A 4YO8A 1J8DA 1A8UA 4AJNA 3ZZ0A 3U4MA 3K8AA 2R6CA 3H94A 2ZAOA 3B7GA 3LBAA 3D6WA 3I37X 3WGQA 1T3GA 1SVSA 5CEEA 4P08A 1X32A 1LSJA 3Q41A 3I6YA 1GUYA 4GVPA 4RY8A 3V80A 5K9ZA 5IP5A 1PH9A 4X8MA 3R9WA 1PR4A 3KBGA 3V1NA 1Q1QA 2ZETA 1KEZA 5K8VA 3QB3A 5ITVA 3MGAA 1MJNA 2AN9A 2X8WA 3B3JA 4QOSA 2IKQA 5KJCA 4L4SA 1IZ0A 3TQCA 3OMGA 1V8FA 3SJAA 3LC1O 3WIVA 4CLHA 4YJ2F 1EINA 3V2IA 1T1RA 1U4MA 1QTNA 3HB4X 2O1WA 4RU1A 3UPDA 4TSKA 5L8VA 4AQYB 3BWXA 4A8PA 1E9BA 3GGJA 5BYKA 2QQGA 3WRXA 3KYDA 4ACBA 3PGZA 4C5BA 4FBGA 3ZIAA 4IGFA 2IIQA 4FYMA 4LRSB 4Q21A 2Q1YA 1V3QE 3KOMA 2GVAA 4OQDA 4WK6A 5E7MA 1CQZA 1YBHA 4DLRA 4Y18A 4J90A 3KYCB 1MZPA 1MO3A 4G8CA 2YICA 3NTRA 1M3SA 3TD9A 4YQFA 5F98A 1Z0FA 5AQ1A 1PG5A 1C9OA 1S8AA 2Q3CA 3DPIA 5K3AA 1P1KA 1XTIA 3O82A 3UICA 1J49A 3OAAA 1EJ2A 1K8XB 4RSGA 1LRLA 1PNRA 3OTOL 1XZBA 5A5GA 1FFYA 2GOYA 2XVSA 4UU8A 1D1QA 4FFVA 4LOKA 5EQTA 4OMDA 4JB8A 4D57A 2VTBA 2VI5A 4B2IA 5DM70 4ZVTA 2R6R1 3RSCA 2RHLA 5BSGA 4YCUA 4OLHA 4Z4QA 1OBHA 1HZZA 1PRYA 3CCMA 3EXG1 4A1FA 3FIUA 1LCIA 3MLBA 4AZWA 3PUYA 1SKAA 3CRW1 3MJCA 2QV0A 4G24A 4UZSA 2Q2NA 5KNDA 2DFVA 4RVCA 5EVJA 7MHTA 3C8ZA 4Q4LA 3TMYA 3RUCA 3AIKA 3C39A 3LT4A 1B15A 3QMWA 2OMKA 4DC1A 5EMKA 4A3FB 2CNLA 1U5BA 1G20E 5DGTA 3HS0C 2B6HA 4XQQA 4J7XA 3N75A 2IX3A 5IJ0A 4JBJA 2HMAA 2QRQA 3X1JA 3TEMA 1Q91A 3TTXA 3WTCA 4F7XA 5G1PA 3EEBA 1A97A 4LF8L 1A2KC 1SHLA 4V1CB 4W5JA 1MA3A 3V2UA 1HLPA 5T8KA 3TZHA 3GBPA 4L8JA 2Q2OA 2GB4A 4CXMA 1KI6A 9LDTA 3AI7A 1P45A 1T5DX 3E2PA 4MYRA 4UFOA 3SF8B 3LD9A 4LCBA 3BGDA 1AUOA 4Q9AA 4XGKA 1EFLA 1QBGA 5CR3A 3QX8A 4R1SA 3ZIUA 2BGKA 3AIIA 4AWBA 1CY6A 4OYLA 1LTQA 5BN5A 3ZDZB 3ZOZA 2I22A 3N6RA 4GMKA 2PSEA 1Q0LA 3QVVA 2C84A 4BBZA 1G8SA 1YDMA 3BM5A 4NMXB 3UJ8A 4ZVUA 1T34A 3I45A 3T4XA 2MGSA 2ONYA 4EO7A 1HPLA 1VLMA 2R86A 2VZ0A 3H2IA 4AF7A 3OPYA 2OXPA 2IPXA 3CINA 3GFPA 1Y9AA 2IU3A 3AVXA 1AHHA 2ZI5A 4Y3UA 1PH4A 3TNLA 5BVHB 1WXGA 1UOEA 1UJ2A 3G2HA 2ZYUX 3IRUA 3QVMA 4H59A 4JJ6A 1Z4JA 1KMIY 3DOOA 4D4KA 1BH6A 4U00A 3BREA 4DIUA 1HEYA 3WV4A 4ABTA 3THWB 4P72A 5AK5A 1KO7A 2YINC 3GR6A 3WX0A 2QTRA 5IWCA 1QZXA 4RV9A 4IVQA 2F4VL 4RSMA 3BHMA 3SP1A 5CURA 2IXTA 3TZQA 4DCNA 2R96A 2PUVA 4NXNL 1FLNA 1R6AA 2XDAA 4KBYA 4QBHA 3OTHA 1B0AA 3OT1B 4QBFA 2R66A 4XIJA 1RJ9B 4BGUA 4BXXG 1CUIA 5KTMA 4RULA 1K8MA 5DMHA 4HMIA 5E8RA 5MF6A 2ENUA 3ZVNA 3GMSA 3SVTA 1R6DA 1V3VA 3N2NA 2OEPA 2WM3A 4ZTZB 1DT3A 3WL8A 4P0PB 1L4LA 1OFTA 5EWMB 4PG5A 2ZI9A 5JMPA 1SCUA 3SN6A 2C1EA 4V1CA 1U9YA 2MYPA 2FQWA 3C6XA 2XUAA 1BXTA 4I7AA 2ZI4A 4KE7A 4UP8A 3SOZA 1XXHA 3NGMA 1Y1PA 1GG5A 3O9MA 5AK0A 3U26A 5KYWA 2KJQA 3O4HA 4HH1A 2HJGA 3DTYA 1RRPA 4FJ2A 3SF8A 2JFUA 3MWFA 3K0EA 3VU1A 5IXJA 1N5IA 2AUTA 1ZS9A 1UXOA 3V8RA 1FJXA 3I4MB 2ZI3A 1QWSA 1U7DA 4JH0A 1ZIDA 3CZAA 2BDNA 3S5JA 3RBAA 4DG8A 5MFZA 3ZLJA 1TZCA 4Z53A 1YULA 1N33Q 1UF9A 2J5BA 5JSYA 5LA6F 5K3FA 2EV9A 1RABA 4YWJA 2YWFA 1JI3A 1ZD1A 1NP3A 4YRSA 3KB8A 1G5FA 1H2HA 3T5GA 2WJYA 5F2NA 3SX4A 3PFFA 5JDCA 1GUBA 4NMMA 4L6TB 1XZ8A 2ARKA 3BHJA 3WGHA 4BMZA 1HDEA 1KI9A 1P77A 1OWMA 1XGKA 4HCJA 5GPBA 3FTQA 3KM0A 4FC7A 1NBOA 2DX7A 1DE0A 4E22A 1KBQA 5AKXA 3WWEA 1B42A 1Q2XA 5G1NA 4NQZA 3Q3CA 5BVGB 1CUEA 2DTDA 3BL5A 3CNQS 3NH6A 2H17A 2XMGA 2HA2A 3EVQA 3QMMA 3WGKA 1RDPD 3IJEB 1AHNA 2NAPA 5LDHA 3RNLA 2JA5G 4ZCIA 3EODA 5E8JA 5ALZA 2GEFA 4DGZA 1YZNA 5LIPA 1APBA 1DYQA 4EEXA 2LP4Y 3INRA 3I3SR 1KLGD 1YCFA 2B9VA 3DZHA 1X9HA 4D4IA 3GAZA 4FXKC 5I3CA 3HR7A 4YJ3B 4JR2A 2L1BA 3K1JA 2IJGX 3DWIA 5J4LA 3WXBA 3L3OC 4LG1A 2VT3A 1J5XA 1B74A 3I9FA 1ZUWA 2QDKA 3IIKA 3TQYA 3L07A 4CIYA 1Y98A 5GY7A 1NOJA 1WD7A 3VPCA 1CRWG 1BX3A 2RKOA 2QR2A 1WE2A 2GZHA 4F8JA 1D2GA 1N6RA 4CLRA 4RXTA 4PNEA 4CTOA 1WPGA 3IIEA 3IIIA 5YASA 4ERNA 2RHHA 3MXGA 4PYOA 2CFRA 4EKDA 3E1KA 2XSCA 1GKUB 3QLVA 4TXLA 5EESA 3VSAA 3TEJA 1S7GA 1ABEA 4PTZA 1QOHA 4LWCA 5K0BA 2D1QA 2FW8A 1KMHB 1M54A 2FP3A 1RHPA 4XI9A 5HKBA 3WRWA 1I1HA 1YNJC 4NCXA 1ZGHA 2ICAA 3JYNA 2WACA 5JC8A 1FJGB 4JI6L 1I50B 3M4OB 2FFHA 1J9ZA 3BWEA 1GR1A 1QJ4A 2LKVA 5AHXA 2WM9B 1R0WA 3U31A 4EI8A 5P21A 2QKIC 3ACDA 1ZOPA 2XCIA 2ZSJA 4XXHA 3PQIA 5KVQA 2XHEA 2QK4A 5DTEA 4DQKA 2ZM6Q 1R64A 1JWBB 2BFDA 1EIHA 4Q18A 4BRZA 1EVEA 3PT9A 1WOCA 2G9QA 2ID9A 1Q11A 1WA5A 2IHTA 1I3CA 4I19A 4IUPA 4IO9A 4IOJA 2ZJ8A 2ECFA 4NHEA 3C15C 1GN9A 5M29A 1K7XB 1A0OA 4HRVA 4M6WB 3M1LA 1XX6A 1YZGA 1LLUA 2ZQZA 5JIBA 5AD1A 3NORA 2NZHA 4G5YA 3T3MB 3D0KA 4C2AA 4HBGA 3V8NA 4M0DA 3SZ3A 2YJ4A 1T8TA 4OJQA 4URVR 2MO0A 1UPTA 3FJYA 2HHHB 3GQVA 3PEEA 1NM5A 3DEOA 1DMSA 4QUHA 1PFNA 1E2WA 4A2PA 5FJ8H 1D09A 2QNRA 4E88A 3KPUA 1TVMA 3JQPA 4C43A 4R54A 3HCWA 1BHQ1 2FZ5A 4M1WA 4U4AA 3V48A 4EJMA 4PXYA 1K8ZB 4LMPA 4OUDB 1HE4A 3MB5A 3KZCA 4MW5A 1ZMTA 2WJGA 2QRHA 3Q9LA 5J63A 1KE2A 1TM4E 2VDNB 3WGIA 1FBTA 4GWLA 4LJ5A 4J0QA 3B1XA 1YZ6A 4NFHA 2VH1A 2EYQA 1JPVA 3DEPA 1YR7A 3PCTA 1V71A 2CXHA 4IGAA 1R5JA 4TYPA 3TINA 2MHCA 5LFAA 4HWPA 4A4DA 1OTCA 3NO4A 3RG2A 3OOWA 2BGRA 3KB2A 2VSYA 3KUCA 4UHBA 4YROA 1NIJA 5ALOA 3TE7A 1ZVVA 3TGWA 5JU6A 1LLFA 4AKTA 1T8UA 4J7UA 3M1YA 2MWMA 1C7FA 3MD0A 1ODLA 3BVMA 4PFJA 4QYWA 2IRWA 4X64Q 5ESRA 4D6XA 3T1HB 2H4OA 1K8GA 3H2ZA 1IBMB 2CMHA 5KQLA 1FRZA 3PQ4A 3S1SA 4YIHA 3EXHC 2NYRA 3HXKA 1TTTA 3QOLA 1GG2A 1QTIA 1XB2A 1Z68A 2UUPA 3GHYA 3R3HA 1LTTD 3WL6A 4EG4A 4ER6A 1P2FA 2HDHA 4I2NA 1NQXA 2I8CA 2C4TA 3GLVA 5DP2A 3DLCA 4KSBA 4D42A 1N78A 1SCJA 3L4BC 1CSQA 2EL7A 3AEQA 2VHJA 3TREA 1WVGA 3CLRC 4X1YA 4XIIA 3W6ZA 3ADCA 3WB9A 2X2FA 1NJ6A 2C78A 3CCEA 1J0DA 2JCBA 2B78A 3EXFA 3L0SA 3N05A 3SU8A 2ZJRA 5LMNQ 1V1OA 1U3CA 1I6HB 1YCDA 2FUG6 2PV0A 2G9ZA 3LNNA 2Q0SA 5AR1A 1YZTA 5AM2A 2CYAA 1I4GA 1CB7A 1TUBA 3LS2A 4EZBA 4LF7L 4KXNA 1NAIA 1TT5B 1XLWA 4ZCQA 4PMBA 4EIWA 3CD6A 2G4CA 3TQSA 4NKRA 1PS9A 2QD5A 3KOOA 4TVKA 5KYIA 4A5SA 3ZKAA 3GTMB 3GRCA 4UMDA 2PRKA 4JFAA 4H4EA 5K3SA 1KSFX 2A14A 1KAOA 3GDFA 5C0OE 2F1IA 4BWVA 4FZVA 2ISSD 1T0PA 1Q1BA 1GNVA 2QRVA 3H7IA 3PL5A 3WI7A 1RZVA 2NZ1D 2OT3B 2YBDA 4EYSA 4BNDB 4V2IA 4O4JA 1RW4A 3ZGNA 4OFXA 3RS7A 3PG5A 2PX5A 3VC3A 4KXVA 4G57A 2MSLA 3A2MA 3DDZX 1H2YA 1P4GA 2UUBQ 4YAGA 1DARA 3L02A 2HHHQ 1NXSA 3K0YA 1SZJG 2OCLA 4M9XA 3RU3A 1P2UA 2DHDA 5CGZA 3R20A 3KQSA 1BYIA 3FPKA 3OETA 3AZPA 4ZO9A 5E9WA 1RTOA 1KMNA 5FI5A 4LKOA 3FB1A 5K3OA 3PKZA 3GT3A 3T7CA 3U7RA 5IYDH 3NHLA 2XA9A 2XNDD 2GN4A 1YONA 2OL4A 4G8JA 2HYDA 5ISRA 3IOEA 1SAYA 3D8NA 3H42B 1XTCD 4OI4A 1VE7A 2H16A 4DV1B 1P75A 1HRJA 1XDZA 1RE1A 3H5IA 4RKEA 3FB4A 4I55B 3CQZH 3GTQH 4WESA 4NABA 2BUBA 3BE4A 3T1HQ 3IHTA 4DFDA 1ACLA 3AEZA 1SMKA 3E9DA 1KEKA 4KIUA 1A04A 3E5NA 5HKOA 1OX4A 2JD1A 1PGQA 2VZAA 4BP9A 1R8YA 5FP0A 3WLPA 2J6HA 1PT5A 1ZJ4A 4H1HA 2F90A 1ML4A 3HWWA 5AHOA 4BMCA 5HYVA 4X3UA 2TSSA 2VJDA 1QAMA 3BK2A 3NM4A 3C1UA 3JD0A 3QYJA 4ZARA 5I47A 4ZUIA 2QUJA 3EEIA 5JASA 4KG7A 3T4PA 3AVTA 4P34A 3V8VA 3K16A 4FE7A 2BKEA 3FBWA 4L02A 4NS4A 3LDHA 1XKXA 4FBLA 4FFRA 4MKRA 1L0YB 4OSPA 4Q1EA 3S7ZA 1O9GA 3DD5A 4JDPA 3L1VA 3QE3A 1N8RC 3ZNPA 3CQZB 1M8GA 3STUA 2BZ1A 3BS1A 3VRHA 5IDXA 4AO7A 2OAEA 1EY4A 2YTYA 1JC7A 1V35A 3R75A 3PWKA 1KMMA 2XYGA 1ZU4A 2E37A 4DEYA 1OPXA 3DL7A 1Q0SA 4QMGA 1U7TA 5KIXA 1E66A 5GGXA 5FYDA 4M9RA 2GHRA 1DCTA 4IXDA 3IR6A 5JOBA 3K53A 1J00A 1ST2A 2ZRIA 1M2NA 3M6IA 3CVJA 2O0JA 1CSEE 3A6ZA 3UZUA 2RSNA 2YN0A 4ENSA 5LQDA 2HCIA 4QVIA 3ROXA 4HAEA 1RKBA 1V9LA 2AOTA 3R3ZA 4L9SA 2WINB 4TV9B 4XARA 3TKAA 2D7DA 4RKBA 5L45A 5A0VA 3K9FC 2J5RA 1V5WA 1AKQA 3W2FA 1CSPA 5L3SB 1OKKA 2B39A 4KD3A 3X3MA 1CU1A 1MNQA 2BBWA 2JAQA 1FQKA 1Z38A 2VAXA 2W2OA 2X6TA 3MS4A 1O58A 2PRIA 4R1NA 4HPWA 1YVEI 4M53A 3VNBA 5J2TB 1L8QA 4XPIB 4R0NA 5BXYA 4ZI7A 3UK1A 1E2BA 1KKMA 1ZVMA 2PFSA 1FXSA 3T9BA 3IULA 4CIAA 2BIFA 4FGLA 4P8RA 4E08A 4KREA 1HZJA 2OM6A 1K7FB 1J5EQ 2QAIA 2XB8A 1PJAA 4ZVMA 2E5LL 1ZCJA 4ZHQA 4CEHB 1K92A 4L75A 1E3QA 3SE7A 3FSJX 3ZD7A 1C14A 4FFNA 4FIZA 4XQGA 2EQ5A 3RB8A 4C4TA 5CB6A 1M0EA 3BD8A 1FVOA 2DHEA 3IRBA 3WNQA 1II9A 3CS3A 2C7QA 3SBOA 3ZJVA 4QARA 1PFGA 3EFHA 4UNPA 1B2TA 1Q90A 1G2PA 2PZUA 2ZVJA 3MD9A 4BMOB 4DILA 1M1UA 2OENG 3HI6A 3GRFA 5FYQA 2JKVA 2MUYA 1ZD9A 2IV7A 3F6YA 2RC5A 3CT4A 3G2QA 3RVDA 2CVZA 2J1LA 4XM1A 3UO8B 4LDRA 1GTG1 4JOCA 1LH0A 1IHDA 2IIVA 1OI7A 1ZOLA 4WVLA 3TMAA 1CUZA 5BYAA 2G36A 4FKZA 1GCOA 4OIJA 2QAGA 2B2TA 5JWHA 2X2OA 3E9QA 2OYRA 2ADMA 2BGGA 3QWIA 2UZ3A 3IGFA 1BO6A 1Q95A 5M3MH 5DWVA 4Y7NB 1R4AA 1L5RA 1Z8HA 4ILKA 4TYMA 1ZUIA 2FFAA 4GQAA 5IYZB 1TIKA 3WDMA 4AULA 5FOQA 5FLXc 1EB9A 1SSOA 1AUQA 1A8PA 1GZ6A 3QPUA 2ZVPX 4HUQA 3VV2A 2RB4A 1EY6A 2AHOB 2W2LD 1CR6A 1G8KA 2JIPA 1CE8B 2Z1CA 4M7WA 4DPGA 3BGIA 1KEWA 2QBYA 3ZNQA 3GCXA 2L82A 1TXYA 5A1JA 1POWA 2YOGA 5LL6S 2J0UA 1EZZA 2X86A 1NAPA 4J76A 1F8FA 2OD2A 4X3PA 4AWAA 3K0CA 3A3YA 1WUJS 1VKOA 3DVQX 2RQXA 4L6AA 1IYVA 5C8XA 5EFOA 1XAHA 1AKYA 1Z82A 3DKRA 1K66A 4H1VA 3TP5A 2EJTA 4YGYA 2WUVA 4LMAA 5LDGA 4BAUA 3B7PA 4BWFB 2DQKA 4TQGA 1V8DA 1NI4B 3AHFA 2XYPA 3R9IA 4BY9E 4UNQA 2D2EA 1GTMA 2V59A 2J7PA 4F71A 4EYQA 4GKJB 1F8XA 3CSUA 1QG4A 1YMQA 1MH1A 1U0JA 3QX7A 4P3XA 2JD2A 1QDEA 1EVLA 2QIOA 3TLGA 3OOSA 4ZDKA 2C9MA 3QR8A 2DCUA 4H27A 4MUGA 1JIQA 5EKSA 2I4MA 3WFJA 4J49A 1WVLA 2ZFUA 3EIHA 3SHFA 1IJKA 1ZSYA 1E0AA 2PKCA 1RYZA 5C3WA 1Z83A 6GPBA 1AKVA 2MSCB 4WKCA 2E5WA 5FUWA 2PX8A 4LJ6A 4MVJA 3OESA 3PHIA 1V9PA 3K5NA 3S1RH 1CIJA 2C0QA 2XF2A 4JQOA 1O7LA 5EUBA 4DMUB 1H0KA 1R9TH 2QLTA 1IOVA 1CKEA 4ARZB 3ZYZA 1H42A 5ALMA 3PZBA 1KL9A 4MVJG 2CQAA 1CLUA 4B34A 1XPJA 4B7ZA 3VNSA 3DDNA 4GL2A 3CCVA 1I01A 3B6IA 3OHMA 3OW7A 1U0LA 4G37A 4I5GA 4KZKA 2JS7A 4C0KA 3WL5A 2CZCA 1ZEJA 4Q01A 1E2KA 2TMDA 2BDOA 1WTQA 4IGEA 4D8VA 1YRLA 1ZCZA 4AQYL 1BU8A 1IATA 1NVAA 5ALTA 4AMBA 4M8AA 2FG6C 1BMFD 1TNDA 4MICA 4D9IA 5GADl 2I2AA 3SM3A 3JWIA 4UE3S 3F7TA 3JZFA 3MMPA 3VYRB 5B58C 4NCBA 3WSWA 4YFVA 4RVSA 1TAGA 2JIZA 2DJFC 2SOBA 3GLIB 1OPRA 1ZITA 4DLZA 4BFLA 1JVSA 4FOLA 5T5QA 5TT1A 3TW6A 5BW5A 1EQQA 2R8YA 1GZ4A 2Y3IA 2NU9A 1KYYA 3IPYA 3R0XA 3ULKA 3G7NA 1QF9A 1TO2E 4EHNA 1J2JA 5GVSA 5M7EA 1AH9A 1M9NA 1ADJA 4K6HA 4DAEA 5CVCA 3NUCA 1YR6A 4L50A 2OHJA 3CJRA 1PTOF 3B2EA 1UC5B 5C44B 2H4JA 2JB9A 5ETJA 5A5DA 3VA7A 5LQJA 1ENOA 2BRUA 1W34A 2ETVA 1W3SA 1CVIA 1K3UB 2ET6A 2MNAA 3MCWA 4DR5B 4DXGA 2WKDA 1IDN1 4QUCA 2SKDA 3CE9A 4QWMA 2ZRHA 4L5IA 1X70A 2UUAQ 1ZN2A 4HB0A 4Q0FA 2VJKA 3EFEA 2O7VA 1WTOA 3AUJB 3EZLA 1K7EB 3U9TA 1KP2A 3N2KB 4BNZA 4DNIA 1HQYE 4PLZA 1S96A 2HPAA 3LBYA 4EB0A 3Q7IA 1W76A 3AUUA 1BNZA 3FZQA 2RONA 2F8LA 2XZTA 5EUMA 3SSAA 4RJ2A 1V1MB 1R4QB 4DVGA 1EYZA 1U9CA 3FKJA 5H5JA 1L4UA 1QE5A 3DAPA 1XDSA 5ISMA 3CTPA 4QF4A 1D5WA 1DSSG 1K97A 3FYSA 4QUKA 1CHDA 3AOEA 4R3WA 5F7ZA 3AHEA 1RKQA 2A9KA 2VHQA 3CHYA 5BRJA 5ELXA 4BKQA 3IMGA 2CV2A 1U90A 4HI0E 1W8IA 1ESMA 1QTQA 4AC9A 2EW8A 1GGEA 2VIIA 5KMGA 1NC3A 3ES9A 3MWKA 4DZRA 3QELA 3WWPA 2PMKA 2R1TB 3E5HA 3H16A 2JARA 1I6KA 1ZHHA 2FFJA 2Q5OA 2XAAA 2D8MA 2ORIA 2EYJA 3ABSB 4XUEA 1EXVA 1XJVA 1S3GA 1VJRA 1U02A 3R2IA 1ADFA 2FX2A 1N2CB 4JI3Q 2XUIA 3HGQA 1E3WB 2G9NA 2YU9H 5K3EA 1JEQA 1WUYA 2NADA 2E8GA 1U9JA 3M6WA 1U3WA 4UUMA 4ZOCA 3FZEA 5HKAA 2HDNB 1W1WA 1VHLA 2A5FA 1UBSB 3NTVA 4DNQA 4EITA 1PK7A 2X7JA 2P2ZA 5KYUA 3BS4A 1NJFA 1TEXA 2C0CA 3GDHA 1ZI9A 1MXFA 1N6PA 1U8TA 4O2LA 4LDQA 3WGGA 3PD1A 4YYEA 1ENPA 1G8HA 4RK1A 1PFMA 1L6IA 4RS4A 1P3Y1 1QPBA 4RV4A 2PZEA 4GKAA 4J1SA 1PDOA 2G1UA 5T41A 2PWBA 1G8MA 2ZWAA 2Y1EA 2EHJA 4I2VA 1JN0A 5EGSA 2MINB 1SJHD 1YB6A 3WISA 1XHFA 2I99A 1I2CA 1TM3E 3EGDA 3D4WA 1E5TA 3D3JA 4WFQA 5CFOA 4DXFA 2I6FA 4FOOA 3KUUA 5DZSA 2UU9Q 2PGNA 2VDLB 1PL0A 2C2MA 1C9MA 2JA8G 3DZFA 5F3DA 3S2FA 1IMOA 4AXBA 4GOND 3S2YA 3T1OA 4K81B 3HOXB 4DCMA 1VBNA 4LX0A 1RC8A 1Q16A 1EFVA 4ZO6A 4K5WA 3QX3A 2A74C 3RYCA 1PDVA 3FRPB 2V6JA 1VJ5A 2HQ1A 3OSOA 1HFEL 1ZOOA 3WLQA 1Y6FA 1XYVA 3IP3A 5BXQC 1WLSA 5DLYA 1O97C 3UHPA 1DJRD 1UMBA 4IINA 2M9MA 5CDFA 1GQFA 1I51A 2PGIA 1Z4NA 1EUDA 1P33A 1Z74A 4CQLB 4YRLA 4WFKA 1QV7A 1T0IA 2IU0A 3E27A 5K20A 3Q3JB 1Y8OB 1IQUA 3MM4A 5AOVA 4G3XA 2L2QA 3WHLA 3M6LA 3NOXA 3PUKA 4KHPQ 5E1DA 3G3EA 5TJHA 2WM2A 1XZLA 3OOCA 3QYAA 1A4XA 4JSRA 4RY2A 3KVVA 1LM0A 5M5WB 1WCMB 1GPJA 2JFVA 2NUTA 3TSZA 1NUAA 3VO9A 3OZGA 4A3CG 3SE0A 5IH7A 1A27A 4CKZA 1V1PA 3NMUF 4CF6A 4OHJA 1CKOA 2EBWA 1QKKA 2UKDA 2XZOA 2G88A 4HWSA 5C2JB 3A28A 2B4YA 2Q9BA 5KYKA 1OXTA 3B5JA 1DAIA 1M1NB 5HGXA 2XTMA 2YVKA 1Y6ZA 3ZWNA 5AJXA 4QPNA 1W88B 1C9DB 1PFQA 4Z4HA 3S81A 1YI2A 3K9NA 3B70A 5J1ZA 5BSTA 1KWKA 1BA3A 1XDUA 4KHZA 3V96A 4BWGA 1EIYB 1D7OA 4MHTA 4MYHA 4FO2A 1Y80A 4QATA 5TF0A 1L3CA 4YV1A 2IYNA 4DKAC 1JDBC 3MTEA 5FPPA 2HREA 3T3DA 3T5PA 4YREA 4DCJA 1JAXA 3THYB 1N32B 5DVZA 3FE2A 2AUNA 1H2AS 4DNTB 3UB2A 1GPAA 2XE7A 3UOWA 5CXQA 2KQ3A 5B4TA 1W2HA 4E4TA 2X14A 3OLWA 5FPYA 4FWTA 1LF0A 5CA0F 1Z9FA 3P1HA 2JDIA 4B3DA 4XGNA 2XCSB 1YB2A 3IXLA 3SIPA 4IJKA 2LCFA 4FMCB 3HSSA 4E5YA 2VATA 5I8WA 3OQIA 2IWHA 4PPYA 4IEEA 3K8OE 1L8OA 2BHTA 3KHKA 4J0FA 4L6IA 4MB0A 1IN7A 1U0EA 2ZAYA 3RRJA 1QIFA 4I46A 2B4QA 1K2VN 2GZAA 4YY3L 4M2LA 4DDVA 3RD5A 1P73A 1AQIA 4LOIA 3QVGB 1PH8A 1FDOA 3TIIA 1GITA 4JLWA 1N6HA 3QEBZ 2PMEA 4HWRA 2QZSA 3IP6A 1E1OA 1SU6A 4HX9A 1Q0QA 2RK4A 4MROA 4NBNA 4E07A 1FGUA 4A0SA 1PZXA 2CNOA 5L37A 3D8RA 4Q6BA 5FFMA 1YR1A 4PC2A 1CZLA 1E96A 4V24A 1DADA 4BRUA 5BP7A 2DM6A 1O96B 2W6IA 3U49A 3QG1A 1GTJ1 3TRJA 4NOKA 2IUSA 5AJYA 2DWCA 4A3MB 3ELBA 1RC1A 1W2WB 2OCYC 3FRJA 3HL4A 3KLOA 2HLNA 3L9WA 3OC0A 4WCFA 4WN9A 3QKWA 5KQMA 1X55A 5A7GA 3V2HA 4L72A 1XA4A 4QJ5A 5CNIA 1HDXA 2VUIB 5CH3A 1SELA 3NYIA 4GYYA 3IAXA 4PWYA 5AFSA 1MUUA 4DUYB 3NR2A 1IZ8A 2AF4C 4PTYA 3TW8B 4DREA 1D5CA 1FB5A 3CCFA 2HU2A 4WN3A 1KORA 3VC7A 1PTOD 1RYYA 3C1FA 1W6UA 1J2TA 1KARA 2F3PA 2V7QD 4QEKA 2V3WA 3NAGA 3V4VB 2W2MA 3AM3A 4CDGA 1I94L 2JFBA 3PITA 3SICE 1CFJA 3SBEA 2C99A 5B3JA 2ZTSA 2BTOA 3O26A 2I2BA 4J29A 3V7FA 1PZEA 4OJYA 5ERXA 4JP5A 3J80c 2O3QA 1YFLA 3MQ4A 4DGSA 3WY9A 2HBRA 2XB4A 2BRUC 1T2NA 2VK4A 4DV3L 3KF6A 1VG1A 2ZTLA 2OZLB 1A7AA 2REBA 2ID4A 3C7AA 1GG8A 1S5CD 2OXEA 4DR3Q 2RGNA 2WTEA 3IT3A 4LUZA 3O9ZA 3PUIA 3O47A 3URKA 4F11A 4NAHA 3S1QH 2GF2A 4WFN3 3DWFA 3RROA 1G20A 4ZAIA 4ZYXA 2O4XA 5IGCA 1J6QA 2K4KA 2VNAA 2Y4NA 2PWZA 3QP9A 3X1DA 1M6EX 3RWOA 4PQXA 2CFCA 4M49A 2R68A 2A57A 2O2EA 3W9SA 1I5FA 4XFKA 4JGGA 1UNSA 3QPVA 4Y2YA 4AFNA 2AEFA 1GUFA 5FORA 4DLAA 3UJPA 1VL2A 2LXNA 3DS8A 2NVYH 1QF7A 1X1CA 3OA2A 4LHYA 4PX5A 4RS3A 1K0RA 3EJIA 1HEIA 1SCAA 5CNJA 3A32A 4NR0A 3DGEC 3QLEA 4QGFA 5AVUA 1TWAH 3EXHB 5IFLA 1JIXA 1HYQA 4D6YA 2I1VB 5BYBA 4PAWA 3LXXA 4J0DA 4B4WA 1UZMA 2VXCA 1EFWA 1GA4A 3K5LA 2ASVA 4A8JA 2DR2A 2ZJ3A 2AMLA 3LCRA 3ANSA 5CVEA 3CX4A 5A06A 2QN9A 1RS0A 2W6JD 1GEGA 4XEUA 2NZJA 2P6MA 3RRXA 3RNUA 1EAYA 1U3VA 3BMNB 1RTTA 2O1EA 3EOZA 1GGMA 3IOCA 4BEJA 3A9TA 2A59A 4CMCA 4WLEA 5IY0A 3HP3A 2ADOA 4AU1A 1FA9A 1MH9A 3OSUA 3A6PC 5G1OA 3VH1A 1GR0A 4HDKB 3NENA 4HDCA 3VZPA 4TSRA 1FFAA 3QW2A 1M6VB 3A9UA 4MKFA 2H65A 3G1UA 4YDHB 3A8KE 3S2SA 4QXOA 4QPZA 4RZ3A 2HPHA 1VQMA 1UP7A 4COOA 1I4QA 2MSWA 3EVFA 4LEIA 5BSWA 3FH0A 3KB6A 5SZJA 4A3BG 2TMGA 1BQQT 4YS6A 4FTWA 5EZSA 1MC1A 1MZVA 4I1YA 5BRAA 3VQTA 5JJ5A 1ASZA 1R0CA 1AUXA 2W98A 4UM9D 4L28A 5T4EA 1UOPA 1W0CA 3EN2A 2WM8A 4JCCA 3E0JA 4BGVA 1HA6A 1NUTA 1ZN9A 5GJVC 1RWXA 2HBYA 1A8SA 3K92A 1H2RS 3MHPA 5DI9A 2NU6A 4TQ9A 1FP7A 3KBXA 1XTUA 1Z5WA 3GP8A 1GPLA 1SUBA 1FP4B 3S17H 2F4NA 3AQIA 3D3WB 3KWJA 3OSZA 4P3KA 3RVPA 2Q46A 5JSFA 1SVMA 1YJNA 1N36L 3E23A 1W0KA 4AZVA 5JNSA 5HKKA 2PR2A 1FFXB 4BBJA 1NW4A 4G1VA 4GWGA 4F38A 5ENZA 2BSAA 3NM6B 1G8PA 1JSXA 1JVNA 1UM9A 3O8QB 4FFLA 4KH0A 5T67A 4DFAA 4JI8L 4MWBA 5BQ5A 3UK0A 4TKOB 1YS7A 5KDLA 2VJOA 2W58A 1GZ5A 4ADSG 2QY9A 1VPWA 5FTMA 2QR3A 3LLSA 4F88A 4PG4A 5M3MG 3BTSA 1M2JA 3HOWB 3P2EA 4KQHA 3H4TA 3LF1A 4I3FA 1GADO 4MP8A 2NT4A 2Q4RA 4OFBA 1RAAA 1DCZA 3BD9A 1XMOL 2OQKA 2QPAA 3O38A 4JKOA 2PBZA 3ZWXA 4LDZA 4N65A 1X86B 2GPWA 2NUBA 2XQIA 2YNMD 3FBGA 3L0IB 5EUCA 3RC9A 4B73A 2JRLA 4FJ1A 1B0UA 3SDBA 3AM1A 2IXFA 2IYYA 3MFGA 2Y1FA 4OAOA 4I9NA 4F56A 5HOEA 3K6SA 3CLVA 4D8XA 3DEYX 5B53A 3TS1A 3I2GA 3QEJA 3VGJA 4YUVA 1C4WA 3DOJA 3Q1LA 5K0ZA 1Y8RB 1U2DC 3RSQA 1DOZA 5CVJA 4LHVA 3VJRA 4DADA 3ZTTA 1LWNA 2OHXA 3D0RA 1ZWKA 2OCPA 5LMNL 4LE0A 3AVWA 3ZVRA 1AXGA 4UM9B 5EIOA 4GLOA 4JVZA 1IBLB 4LE1A 4HTAA 1T3LA 4DUZQ 2WHPA 2V74B 4A91A 2FZ4A 4G0NA 5J5AA 4CKXA 1BD4A 2GQ0A 4LFAQ 3DKKA 4G4SO 2F43B 1T9KA 1XDWA 2XBLA 4GOJA 4L8LA 4WL0A 3WDLA 3SKVA 1ECJA 1SVLA 2C2HA 2QTNA 4JI1B 5K0GA 3MUEA 3NBHA 1BN7A 1IEWA 2VP5A 3GFOA 2NP6A 3NTHA 5F1YA 3QPBA 3S44A 4GNXC 3HEMA 3MFQA 4X7MA 3A70A 4OJTA 4XLLA 3OICA 3PI7A 2NWQA 2WJWA 3H3XA 4INAA 4K5QA 5D3MB 1QYXA 3WMEA 4YV7A 3LRPA 1ZKOA 1TTPB 3F4LA 5IVKA 1ET9A 3R6GA 3ND7A 4AS3A 2K28A 2Y0BA 1QH8B 4DLWA 5E7JA 4CBVA 5KOHB 2DFDA 1MNAA 2ENBA 1BKSB 3T1HL 1E6MA 2UXBB 2AYXA 4AJ4A 2R7ZH 1ULTA 3KXDA 2BH8A 4IX1A 2Y8EA 4TV8F 1SXQA 4P92A 4PCLA 1XTSA 2EX0A 3AUFA 3H65A 4L4YA 5FA6A 4PYJA 1I1NA 2F00A 1JAZA 2YJGA 2EYLA 4AJEA 4C0SA 3TPZA 3AI3A 4GZ6A 4FGJA 5JC1A 1ZLXA 4BNGA 3K6SB 2AUJD 2BI7A 1PNVA 1M6YA 3K94A 4DUGD 2F59A 2YIMA 5ELOA 3H2JA 2WWRA 2VDRB 4NY1A 4OAQA 3I2IA 1WIWA 3CNOA 1DQYA 1ISSA 3H8WA 4OHMA 4WLVA 4BY7H 3WZ2A 3ZUPA 4EUSA 1TOAA 2B2TC 3DT6A 1JQDA 1OZHA 3FNFA 1SOMA 2IT1A 1P5FA 2P0YA 2XUHA 3HRHA 4ZO4A 2FMTA 4K8OA 1C0LA 3P9YA 1Q21A 3A6GA 4TVBA 4C3IH 2F4IA 5TB5A 4BLWA 3ZVKA 3BJUA 4A4IA 3CUKA 1IUNA 5K5EA 2Q7XA 2CFIA 4RACA 2OF1A 2FN3A 3FUUA 1R8QA 1CZGA 2N47A 3IAAA 2X1HA 3S70A 5KHOC 4F4JA 3DWEX 1N0WA 3VZBA 3IKVA 1Y6RA 3P71T 3H1GA 4GOMD 4CNBA 1JEYB 2QTBA 3NWJA 3HU3A 3K0SA 4JNCA 1F38A 3TK1A 4LDJA 5C80A 2GCIA 1LX7A 1GZ3A 2NQ2C 1P72A 2DJ5A 2B8NA 3M3HA 4MN3A 2FJUA 2ZUUA 1N2HA 1T0BA 2GRUA 5DLPA 2FR1A 3IT2A 3S14B 1DOHA 2YV5A 3PL1A 2M2LA 1KDPA 5FA8A 3TNFA 3GLQA 2VSQA 3DBHB 5HRUA 5F78A 4XD7D 4YK7A 3EX7C 1KP9A 2C9CA 2H06A 1WI5A 2BBSA 4AMVA 1JL3A 1Y4SA 1C7IA 3GUZA 2AZDA 3G2JA 4R2WA 1LJ8A 4W1PA 1SPXA 1N75A 2FRVA 4N8SA 6Q21A 4H4DA 1UBEA 4DLTA 1PX2A 4C08A 4D9KA 1Z7YA 4QT4A 4DU9A 2E55A 1IUPA