4CBVA

X-ray structure of full-length come from streptococcus pneumoniae.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
251
structure length
251
Chain Sequence
MKVLILEDVIEHQVRLERILDEISKESNIPISYKTTGKVREFEEYIENDEVNQLYFLAIDIHGIEKKGFEVAQLIRHYNPYAIIVFITSRSEFATLTYKYQVSALDFVDKDINDEMFKKRIEQNIFYTKSMLLENEDVVDYFDYNYKGNDLKIPYHDILYIETTGVSHKLRIIGKNFAKEFYGTMTDIQEKDKHTQRFYSPHKSFLVNIGNIREIDRKNLEIVFYEDHRCPISRLKIRKLKDILEKKSQKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords COME
publication title Structural Insights Into the Dimerization of the Response Regulator Come from Streptococcus Pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 71
structure length 251
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4cbvA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4cbvA01
1YS6A 1JH9A 2IPAB 2A9RA 2NT4A 1DC7A 3OMWA 3LMKA 9ABPA 4Z4IA 4EVQA 1PEAA 4B09A 5JNSA 5KQLA 5EWMA 1BAPA 3LKVA 4RK4A 3TD9A 3RQIA 3CRNA 4LRQA 5T3YA 3TMYA 4XYQA 1M2FA 3KYJB 2FN9A 4RXMA 4XARA 3Q41A 4QPJC 1PNRA 3GT7A 1WETA 4KPYA 4G86A 2LUOA 4RV5A 2HSGA 1EHCA 3ILYA 4TLLB 2FMHA 1GLGA 4RK7A 4PE5B 1CEYA 3I42A 5CNMA 5JNVA 4Y9TA 3VNBA 3F6PA 3BRQA 4Z9AA 1QP0A 1NY5A 5KQGA 3NBMA 1W9HA 1ABEA 2FMKA 2VYCA 3CKMA 3H5TA 3LUKA 3N6VA 3BBLA 3QX9A 5TQ2B 5FBKA 4W5TA 5HSGA 2GBPA 3H1FA 2IPNA 4Q7EA 3KS9A 4CBVA 1BA2A 1QO0D 4WZZA 2DRIA 2VUHB 4P1ZA 4TN5A 3UKJA 4TLMB 3OLVA 3KLOA 2IKSA 4JB0A 4OATA 3H6HA 4MRMA 3RVMA 2M98A 1JWLA 4YWHA 5BRJA 4QYWA 4F3TA 4RXTA 5TQ2A 4YR7A 4EUKA 4NV3A 1QKKA 1DJMA 4NQRA 3BRSA 4DQDA 2ZWMA 3N53A 3HUTA 3NNSA 4MS1B 4MR8A 4XYOA 1TMYA 1ZAYA 3GA5A 4O5AA 3C6QA 2FMIA 3I45A 3O2SB 1NXPA 1JX6A 3I09A 3P9YA 4F11A 4HYEA 1C0EA 5JNUA 1T34A 2CD7A 2FEPA 4GPAA 2FN8A 4MS3A 4EYQA 1JL3A 4XQQA 3MM4A 5KQPA 1F51E 2RJOA 4YO7A 3OM1A 4MR9A 2N9UA 2R48A 4W5NA 3JVDA 3O2QB 2MSLA 3KJXA 4RK5A 4EYOA 4MAAA 3LUDA 1U2QA 1Z2EA 1PEYA 3CHYA 3OO1A 1Z25A 1ZHHA 1DBWA 3GV0A 5TE9A 3O74A 4RKQA 1JBEA 4OBBA 3HZHA 4G4KA 4WWHA 3QLUC 2JK1A 1EAYA 4KK4A 3MA0A 4RWEA 3SQNA 4ETIA 3Q15C 2WWVD 2Q5CA 3OQNA 3LOPA 4KVFA 4RXUA 5KC9A 2M1ZA 5FWYB 4JASB 3IPAA 5EWJA 2LBPA 5D2CA 3HEBA 2FLWA 3CZ5A 2NZUG 3KCNA 3HCWA 1RZRA 2B4AA 3RVLA 4O1HA 2P9HA 5E3JA 3T6KA 1Z18A 5IEBA 3H5WA 1ZDMA 1ABFA 1URPA 5GQSA 1QNLA 3O1HB 4RS3A 1ISRA 1LJUA 1YVUA 3CG0A 3EULA 3GL9A 4KFCA 4Z4EA 3JTEA 2I6FA 3RVRA 8ABPA 4N76A 1ZH4A 3QLVA 5JNTA 5DGCA 4ZMSA 4H3HB 1I3CA 4LE1A 2NUBA 2BGGA 2PKXA 4IILA 4GNRA 1YTUA 1S8NA 3O2JA 3OM0A 4ZPJA 4D74A 4HNRA 2JVIA 1JYFA 3TX6A 3ILHA 1J56A 3GBVA 5TQJA 1D2AA 1ZVVA 3OLYA 3Q7TA 5TPWB 2E4XA 3FGZA 3QELB 2FSPA 3SY8A 6ABPA 2PE5A 1EWKA 4IRXA 3IP5A 2MYPA 5KWSA 3D8UA 3HVRA 4MGEA 1XHEA 1SRRA 2V0NA 2MSKA 5CNKA 2QSJA 1ZGGA 2IDMA 3GBPA 4G0YA 1RXEA 4JAVC 5TPWA 1KRXA 4G0XA 3T38A 3C3WA 2HQBA 3LKBA 2GKGA 1YS7A 1PUXA 5EWMB 1P8AA 4F8JA 4LX8A 5HQJA 4MLDA 3MQ4A 1TLFA 1MB0A 1YMUA 4MPTA 4JB2A 1OXBB 1DCMA 4UHJA 1SXIA 4ZMRA 1TM2A 4Z4FA 1DCKA 3NHMA 1JHZA 3HSYA 1QP4A 3HJFA 4LDAA 5F64A 3DLBA 1DG9A 1DRJA 2NZVG 3EJWA 5KC8A 1EWVA 2L2QA 3H1EA 4JP1A 3ROFA 1Z13A 3HDGA 4OTZA 4QYMA 3MF4A 1AB5A 1Z2DA 2LP4Y 2ZAYA 3EODA 3OO0A 1L5YA 3LUJA 3OQOA 3RVNA 1K68A 1NXXA 1YK0A 4MRMB 4H3KB 3S99A 1JFTA 3I5AA 1YMVA 2L19A 2WJWA 1U04A 1BDJA 2PL1A 2CWDA 2A9OA 4L4UA 2MYUA 2PUCA 4XQJA 1TJYA 4WXMA 1A2OA 5TPZD 1D1PA 2B1JA 4WT7A 4MR8B 4YP9A 4MR7A 1GUDA 5C5CA 5FBHA 2QXYA 4PZ0A 3N8IA 1KMIY 3O1IC 1ZITA 3JY6A 5T7BA 3HK2A 4KQ9A 1APBA 1JDPA 3CS3A 2JBAA 3F6CA 5ABPA 4OG2A 2A9QA 3N75A 2W42A 4JA2A 1AB6A 3RVSA 4MS3B 1K66A 3IP7A 2PAFA 3MIZA 3HM9A 2PUEA 1DCFA 2ID7A 1ZH2A 2AYXA 3F7NA 3IP9A 1NXOA 3OLWA 2HJ9A 1OXKB 4MR9B 1ISSA 1D4ZA 4MQEA 1XHFA 1EWTA 2FQXA 2FVYA 2H3HA 3FFTA 4FE4A 2FQYA 1GCGA 3N0RA 3SM9A 4F12A 4G0MA 4Q6BA 3QX8A 1VKRA 2AYZA 3N0WA 2E4ZA 1E6KA 1LBHA 1ZGZA 1USGA 1ZY2A 2R4QA 2WMYA 3UK0A 3KYIB 2FW0A 5ED4A 1RNLA 3OQMA 3LUAA 4O1IA 2JCGA 2FXIA 3C3MA 3NNDA 1C4WA 2GX6A 3OLZA 3JVIA 4IGAA 3B2NA 4MYRA 1FSPA 3EAFA 1A04A 1MAVA 3KKEA 1NXWA 4ZJPA 3OMXA 5EWJB 3QEMB 1FFSA 1HEYA 2FTKE 4RK6A 4DADA 5BRAA 4KNYA 4Z99A 3IP6A 1DC8A 5DCLA 1U2PA 2PUAA 4W5QA 3M9WA 3MMNA 4WUTA 3SG0A 1JF8A 2CHEA 3Q9SA 2OQRA 2QU7A 2CHFA 4D6YA 1JFSA 1SXGA 1DBPA 3KSMA 4HNQA 4H60A 4TMYA 3QEMA 2LIVA 4S04A 1FQWA 3BILA 2TMYA 5FWXB 3CNBA 3GYBA 5IX8A 1BVHA 2X7XA 1D1QA 1E6LA 3URMA 1FFWA 1CHNA 1GUBA 3KG2A 3D02A 3HUUA 3NHZA 2FEKA 1H9CA 4HNSA 4MQFA 5FWXA 1USKA 1P6UA 3RVOA 3FDFA 4IMIB 2FKAA 1JFVA 2QZJA 2FMFA 2QVGA 3H5VA 4G0ZA 3KLNA 3K4HA 4LE2A 1LK0A 2YHBA 5GOTA 3KHTA 2H0AA 7ABPA 2QW1A 4LZLA 1XWWA 1VLZA 4QICA 1QMPA 5JS2A 3KTOA 3VNAA 4YV7A 5JNWA 4KQCA 2P4UA 5IUKC 4Z4HA 4RY9A 4Z9BA 3RH0A 3Q7SA 5DKFA 1QO0A 1P6QA 3H1GA 2VK2A 4RKRA 2IYNA 1PNTA 4ZYLA 1BDIA 3CFYA 4RK1A 5EWLA 4XFKA 4MS4A 2LPMA 2FLKA 3NNNA 4M88A 3QLTA 3DGFC 3H6GA 4W5RA 4RY0A 4XAQA 3RVPA 5DTEA 2PL9A 1PHRA 2WY2D 4MLCA 3GWGA 4XQNA 2FQWA 2QVCA 4ML3A 3CZCA 3QLUA 3F73A 2PLNA 3GRCA 3W9SA 2VUIB 1M5TA 3ROTA 2MSWA 4XASA 1Y1LA 5B3JC 2QR3A 4F06A 3A10A 4OLAA 3O1JC 3JPYA 1RZRD 4MR7B 4N03A 5CNJA 2A9PA 3QK7A 4YCSA 4RSMA 3T8YA 2JB9A 3LFTA 2WRZA 1QQBA 2HQRA 2JBAB 2XDYA 3C3KA 4KK3A 3RVJA 3E3MA 2IOYA 1MB3A 1M5UA 1YK1A 3A0RB 3H5IA 5BQ3A 1QP7A 2F8TA 4LDZA 3UUGA 3BS1A 3SNKA 1USIA 1Z17A 3FMVA 1MVOA 4NICA 3FFXA 3LUFA 3LUHA 3BREA 4G0QA 3C97A 4EY3A 5HM6A 4Q6WA 2RGYA 6CHYA 4MQEB 4RZSA 1VRVA 2GI4A 2OENG 5CHYA 1VPWA 4D6XA 4NCAA 4ETMA 4G0OA 4ETNA 4LE0A 4N41A 1TVMA 1NXSA 3HDVA 3Q7RA 1RPJA 3O21A 4KZKA 2HQOA 1NXTA 2FEWB 4EYGA 5I4CA 1Z16A 2RJNA 2IPMA 3CG4A 4KRFA 1A0OA 2MYNA 2L17A 3N0XA 5IBQA 5TQ0B 3OLXA 1KGSA 1FFGA 1Z15A 3QLVC 4RY8A 4KV7A 5JS1A 3EQ2A 1QQAA 4N0QA 4RK0A 4Z0NA 5IUJC 1RXIA 3RVQA 3DGEC 3HV2A 1IIBA 3TO5A 4G97A 4YRZA 3EQZA 3LUCA 5TQ0A 2QV0A 1DZ3A 3H75A 5B3JA 3CU5A 2PUGA 1LBIA 1NATA 4MS1A 1B00A 5KI6A 1P2FA 2MYTA 2HPHA 1NXVA 3CLKA 4OLBA 4L85A 3LUGA 3L6UA 1U8TA 5IEJA 1ZN2A 4W5OA 4JOQA 1F4VA 3JS5A 4PEVA 5KQMA 2E4VA 3G1WA 3DLHA 4E7OA 2E4YA 4PICA 4P98A 2KYRA 4NCBA 4MQFB 5C5EA 5HKOA 3HO1A 3CTPA 3EDCA 1E6MA 3A0UA 3O75A 3H5LA 2RDMA 1DP4A 4DN6A 1SD5A 1E2BA 3IDOA 3K9CA 4RDCA 2E4WA 2YHAA 1BDHA 1JLKA 4FE7A 3DBIA 3L49A 4WXEA 1SXHA 1ZESA 2PUBA 2JVKA 2ID9A 4KMRA 4EYKA 2PUFA 3T95A 2PMCA 4IMJB 4YS6A 1W25A 5DLEA 4RU1A 2JRLA 1D5WA 3E61A 5IULC 1GCAA 4XXHA 3QEKA 5EWLB 3TB6A 4MS4B 5FWYA 4N0PA 4Z4CA 4XXEA 1NTRA 3JPWA 2O20A 5TPZA 3R0JA 2PUDA 3HXMA 1M2EA 1JDNA 1UDRA 1JYEA 2E4UA 1U0SY 1Z26A 5CNIA 4S05A 4EVRA 2L18A 2PJUA 4YLEA 3DZDA 1R8JA 2GWRA 4XLTA 3HS3A 2R47A 4PYRA 3M9XA 1DRKA 1MIHA 1DBQA 2JVJA 2NT3A 3LTEA 2IPLA 1EFAA 4EVSA 3FFWA 4Z4GA 2WB4A 3M6MD 3A3KA 3G85A 3RVKA 1Z12A 5BR1A 2F8SA 4IF4A 1KRWA 3EGCA 4E7PA 5IUNC 4EGSA 3H5OA 4KREA 4G0PA 4UHKA 3SAJA 1YIOA 2J48A 3IPCA 3QELA 1CYEA 3MYYA 2R25B 5IC5A 5JNRA 1LJLA 5PNTA 1QPZA 4YGXB 4N47A 1L5ZA 4FB4A 2WJAA
chains in the Genus database with same CATH superfamily
1VHLA 3TSYA 4YX9A 1EA7A 1SBQA 2VDKB 5G53C 5KVAA 4DN4M 1XRLA 2DFNA 1PK9A 3LKVA 2YWGA 1A76A 3SXHA 4MMXB 4AICA 1VE9A 3NLLA 2PGOA 1T9DA 1XRRA 4OUDB 1YJNA 2PZLA 5CNMA 1XF9A 3RYFA 2VHZA 4NYJR 5BN4B 1SULA 1EVZA 2VYFA 3GN1A 3KZMA 4DYHA 1BJTA 4MV4A 3HB5X 2E75C 4R16A 1U1GA 4XSVA 4U0KA 2HXYA 3WX0A 1NLMA 1FMJA 4MGZR 4C2AA 5FDFA 2HUGA 4GOND 4UDYX 1UDCA 5IS2A 2IQ5A 4RFSA 1W4ZA 3GK3A 5LCXA 2WFAA 4MAAA 4ZC8A 2C7VA 3ZE7A 3K81C 6PFKA 5IVHA 2C3MA 2FPMA 3CNOA 4C3HB 1FDIA 1K6XA 1Q19A 2ZQYA 3I9V1 3G5AA 2I6FA 1QCDA 2CL0X 3IDFA 3ZWVA 4BWGB 5IKOA 2VF8A 1SBYA 4HNRA 5JQGA 3IODA 1CG6A 5DLQE 4MV5A 1IY2A 2RVLA 3BMXA 3INRA 4BN4A 3UE0A 1CSEE 4ISBA 5CH3A 5JRZA 1JDTA 4Y6PA 2AN3A 1T10A 3ZDAA 4LKOA 3LT5A 2PZBA 2OOSA 1KJQA 2WAQE 4X85A 4YGYA 3UXHA 1KHTA 1KY3A 2ZM6B 1GXDC 5KCZA 4R51A 3GMSA 3O4JA 2PX4A 1XL0A 3S40A 3N5CA 3TLAA 4YUXA 1BWSA 3U17A 2Y4OA 1K8AC 2D3TA 1EXVA 1X92A 3OWXA 2Z5LA 1KH3A 4C4OA 4EDFA 3MQ2A 3N8HA 4BX9A 3V33A 1WDMA 3EVCA 1GCGA 4GICA 3TCNA 4C9BA 1RQ7A 3LUAA 2X8WA 1CFZA 2C0PA 2F0HA 3AHEA 1WBBA 3HBNA 4LJSA 3TTTA 4IVQA 4I81A 2VTBA 2JLUA 3AW9A 1X65A 4LUZA 2GKSA 5ALHA 5B55A 1G55A 5AK4A 2FWNA 5EGNA 4TS9A 1QE3A 2FP4B 4U3JB 4NZMA 3O8RA 1CHNA 1VB5A 2V4MA 1VSBA 1WSWA 1EUCA 1P6UA 2QZJA 4IG9A 4IURA 3GHHA 1H23A 1XGKA 1KJYA 2BWJA 3TM5A 1EZ6A 3PGLA 3M0EA 1NSNS 1HG1A 2NVQB 3OW2A 4R9NA 2GAFA 1IXKA 3AEQA 3OT4A 1UJCA 2YC2C 3FLBA 2OSBA 4BIMA 5AM5A 2OEPA 3QUAA 2V65A 2HFJA 3H1BA 1JQ5A 2FOXA 5A6SB 1L3IA 1Y3DE 1GY8A 2FRDA 4M46A 4ZYVA 5C31A 1K73C 1V95A 4U673 4DV6Q 3ILXA 3GTOB 3QEJA 4RSMA 1S01A 3EFBA 2P35A 4KFTA 1U9ZA 3K30A 3T53B 2UVPA 3RFTA 1USIA 3A9CA 3TD6A 5KOHA 4RGNA 3H15A 4U9UA 4YHBA 1NVVR 2IHYA 1VBMA 2GAOA 1G3UA 2BW0A 1BVYF 1RHPA 1X32A 3EOBI 2ZJ1A 3NWJA 3KOUA 2OZKA 2ERXA 1H1LB 2EZVA 4M0KA 3UA4A 4F8EA 3IFSA 1XVIA 1SKQA 1VI2A 3SR0A 3DZ8A 2I3DA 1PUJA 1SXQA 5I9MA 2Y1OA 2Z30A 2ZTEA 4ZDWA 2QTZA 2F3VA 2BGNA 1WMBA 5KQMA 5LFAA 3IE1A 1NDHA 2W2PA 3QLEA 2HHHQ 3A0UA 1ENPA 4PINA 4UAGA 1SD5A 4MTCA 4BQNA 3FTFA 2W4MA 3G49A 2RC5A 4HDAA 1PJ2A 2DH6A 4B9XA 5EIBD 3N07A 3D64A 4FYIA 5CB0A 3VYRB 1F5NA 1V3TA 2NN6G 2QAJA 3SX0A 2L18A 5D1NA 4WNYA 3RGWS 4C2TA 4BJ6A 1K9SA 2C77A 2FW7A 2J32A 3CLRD 5D84A 2C9ZA 1E7QA 3HWWA 4ZN6A 3ZU2A 4F3KA 1YS6A 3AB9A 2IX1A 3LMKA 1HDYA 5G3YA 1TU2B 3RNUA 3FF1A 4O1MA 4I9HA 2NV0A 5EZYB 5I9BA 3ESAA 3S27A 1JHPA 1ZH6A 1YCFA 2A9KA 3H9JA 4ZKDA 9MHTA 4V0SA 5B7PA 3N6VA 4REOA 1ADYA 1TZJA 1Z6ZA 1VPTA 1SVNA 5EPOA 4C21A 3OT1B 2EAUA 3Q7IA 3S2HH 5KVSA 3CJTA 1F9PA 1V43A 4R1OA 1E3EA 2CVQA 2O3UA 1O94D 4N40A 5E6SB 3D0KA 3BXOA 4C14A 1MQAA 5ANRB 5EE9A 4RTMA 1LPOA 4BWYA 3WI7A 2OYSA 3PZBA 1XDZA 1GR1A 1PJ4A 4WCFA 4WASA 5L3ZA 2X8AA 4DIFA 5FOSA 2P69A 3SQNA 1J6QA 2DFKB 2HJSA 1W88A 2ZIGA 4PHHA 3NQIA 1E2IA 5C1PA 4EB8A 1O97D 1RRFA 4DF7A 5HM8A 4AYTA 4K5XA 4N01A 3MCVA 4LJ5A 1KY2A 4AJ4A 2PKXA 1QM5A 1S8NA 2BJWA 4E22A 3GLHA 1F8GA 1JYFA 4MUFA 2VF2A 1TOAA 4YTEA 2FZCA 5DV9A 1OAKA 1RFLA 3WSWA 1SURA 1KBQA 3H0GH 3ZOKA 3H4MA 5HK9A 5GINE 5BNFA 3HKSA 4JKIA 4L07A 1J2JA 1T4CB 1VQCA 3D31A 1U3DA 3TZKA 1WU7A 1P0MA 5IAKA 1TMKA 2GD6A 4R4QA 3ZD9A 2ZOSA 1JIUA 3GJTA 5D7NA 1EDDA 5FF9A 4A2PA 3L8MA 3LQFA 2II6A 3N2KA 3T3EA 3AVQA 2XT9A 4L4UA 2FPWA 1SNDA 3HI6A 2VNHA 3C7AA 5A7GA 1UOOA 1WY7A 3QVVA 3J81c 3JAWB 4YRKA 3B8HA 4KUHA 3GOHA 2Q3LA 4FXOA 3ULLA 1AQLA 2XNDD 1D4ZA 3DBLA 3J81E 3FCXA 2EZTA 4MUMA 4EGQA 4RGVA 4UDOA 2F43A 2ZUCA 3Q8DA 1Y9EA 1DZ1A 1T9ZA 3V2HA 2FY8A 3CKYA 1J1IA 5BNWA 4CM9A 5DEOA 3EZXA 3H99A 1YZKA 2VO1A 3AU8A 4MCJA 3HVKA 2ORED 1TY0A 3C3YA 2YFHA 1BOSA 3UT6A 2ZIWB 2W8BB 2C9YA 2UUAB 2CJPA 1KWKA 3FOBA 1CR0A 3HADA 4QTTB 4OWTB 4D3FA 1JSZA 1K97A 3AH8A 3NIWA 1XZMA 4CL8A 2SKCA 1YZQA 4AI6A 1G9XA 1EFKA 4F45A 1YBFA 3QVJA 2FUG6 1GTRA 3Q6SA 1WCV1 3C4QA 3FWYA 5B1EA 1A9QA 1D04A 1TF7A 1G19A 1I50B 1J49A 4O0MA 3QB3A 4F8YA 3FYHA 4RLSA 1KDVA 4BMOB 3RAEC 2IYRA 1ZK0A 4OP3A 2VUSA 2E87A 2J67A 3SJUA 1U7OA 3GB9A 4PYOA 1TM1E 4EYGA 3BSSA 3PEVA 4A1OA 2BSQA 3FCUB 2G5DA 4BXOA 4TPKA 2ID4A 4NMXB 1G5HA 2NUPA 1RXIA 5A2GA 3L41A 1OC4A 4RZHA 1DQZA 5M3MH 2ZIUB 3RJTA 2Y0EA 1UBRS 5JJLA 2R00C 1ZYRC 2RHMA 3CV3A 3U13A 1YACA 1H3NA 2I6XA 4X1YB 2NU9A 5BMVB 2V6MA 4C0BA 4EMSA 1SJED 2ERYA 4M9UA 4A93H 2AKAB 5JJBA 1HQCA 1OLXA 2HO4A 1QVZA 3JD0A 4N9PA 4C0LA 2OORA 2HMTA 3AQ4A 1TVXA 4B3GA 3BK1A 4V0RA 3S15B 5DTJA 1Z0ZA 2PO7A 4M2LA 2KCTA 2HTEA 3D7SA 4D1YA 5K6AA 2EFHB 3R24A 4UHKA 3Q7EA 4KXLA 1V5IA 5KTKA 3QKRB 4MCHA 1U8ZA 2O54A 2P3LA 4Q0FA 2VHEA 1Z22A 3AG5A 4DJFC 1JG7A 3TNJA 2XUAA 3AEYA 4B32A 4PBTA 1Y6ZA 1G17A 4NBNA 1C9YA 3RF6A 5DHFA 2RAUA 3OEHD 4DBLE 4BO5A 1Z5PA 1NP6A 1ORRA 1PH1A 3AEKB 3HN2A 3CO5A 3HTXA 3PMFA 3MW8A 3EZ7A 3W8DA 3EPLA 3P9XA 1EMDA 4OLFA 3EBEA 2RJOA 3T9CA 1T9HA 3JVDA 3O2QB 4IVNA 4UD6A 3UK2A 1UMCA 2E2JB 5DXJA 1XXGA 1BJKA 3PYLA 4U7TB 1K0UA 3P9NA 2GPJA 2OO7A 3W9UA 3K5MA 1K7YA 2A0YA 1XD2B 5E3JA 5REQB 4BX2A 2NO6A 4I8DA 2XCRB 2VUTA 4DIMA 1QKJA 1QV6A 1KDBA 2D9UA 4B35A 3TXAA 4AG6A 3TX6A 4P4LA 3KM0A 2D8AA 1RD9D 3MWGA 4GLAC 2VYND 1KRXA 3GELA 2XMCA 5EWMB 3IVRA 3LCVB 1RI3A 4RPJA 1XU4A 4GR9A 2YXDA 4IFTA 5BMOA 3BH6A 1CF9A 4L51A 2EW1A 4CKWA 5J1ZA 2AQ3B 3NYIA 5JAZA 3B60A 1B43A 2VZ0A 3BK7A 1NNSA 3C85A 3RLIA 3EGDA 5C52B 1TPYA 3ZE1B 1UAPA 1SVKA 4QUAA 2RK6A 2QZPA 4YCNA 4EX5A 3C5EA 2A8VA 2JLSA 4UNPA 2DQKA 1ECPA 1APBA 1JDPA 4K0KL 3FZGA 4L8GA 3SGLA 1TU4A 4YASA 3GTKH 2CHBD 2ZRGA 1J4AA 3RSFA 2H1IA 3IP9A 1KVRA 2FVYA 1K63A 5FI3A 2RI0A 1QCYA 2I67A 1BC5A 2MCFA 4QCLA 4FP9A 4YJHB 2O2DA 1LF5A 4DKJA 5JNLA 4LUOA 4DCGA 1AZSC 2PG3A 1OH7A 4TKUB 4M0FA 1CQIA 4ZOEA 3IIIA 1PF7E 3Q2KA 5BR8Q 4NCXA 5E6UB 3GFFA 3ROXA 1PYWD 4DLAA 4B76A 1D7OA 2Z4TA 5CT5A 4RCVA 4P2GA 4P5DA 4DNPA 3S5JA 4GKJB 4PFJA 3M6AA 1ESMA 4MH0R 2EZ4A 1IYVA 2Z98A 4ALMA 1MX9A 2ACKA 4MGHA 2ZAIA 3MGKA 4KIFA 4YCSA 1U3VA 2H2HA 2PRKA 3NM6B 2JI8A 2JBAB 3LQ1A 3ZKWB 2ZBEA 3FNIA 4RA6B 5BT9A 4A75A 3DT6A 4MV0A 4EY3A 4DDUA 1YS4A 2Q99A 3KR9A 4IFEA 5I4CA 3EY4A 5COYA 1LTRD 2FDRA 4DVGA 3MTJA 3OLXA 4RY8A 1ZCAA 1J39A 1PZID 1WVIA 2GTPA 2Z1MA 3FKIG 1DAEA 3M6WA 4WLUA 1KSGA 2N1BA 3CU5A 4ZVTA 3CNNA 2ICAA 4EQ5A 3LL7A 4ER6A 3N6XA 3LQYA 3QY0A 2HMSA 1F4VA 4ER5A 2IS6A 3VR6D 4GEKA 3PDHA 4V2UA 1DGSA 2BA1A 2F0WA 3C1UA 4YDSA 4W9MC 4NEHB 4CEIA 3T95A 3IAUA 2O50A 4WFN3 3WBBA 5CAEA 5DW0A 2Q7XA 2B21A 2WWRA 4F5YA 721PA 3SZ3A 3T3DA 2GSDA 1RAIA 1LSUA 4RNDB 1Z26A 2ID8A 5JVDF 3HS3A 2WPDD 5GQOA 2N3ZA 2QG4A 5I9LA 2BFCB 2D4HA 1K5DA 2JFUA 2R92H 5PNTA 1H4SA 4V190 4J16C 5JWOA 1PW5A 4RH3A 1Q8IA 1R9JA 1NZFA 3Q9UA 5IWAL 3EIOA 3MB8A 3B1KA 2P67A 2COUA 2FMHA 5DRYA 2PLAA 1UBGA 3BPSA 5IXSA 4WEOA 3E35A 4GOOD 3DMDA 5I7FA 3DVQX 5IT0A 4H2DA 1ZU4A 1XZCA 3K05A 1NYLA 1W35A 4HK4A 4X65L 1MKYA 1H2FA 4RX1A 1OV6A 3SQOA 1RDFA 3M3HA 3UCEA 5AVZA 2NU8B 4P22A 2K4MA 4JYPA 1YDFA 1GRVA 2NX2A 1THMA 3AUSA 1B1AA 4F4FA 4Q15A 1ZD3A 4P5PA 1GKIA 1U2DC 3RVLA 4QJIA 1Q0QA 3A9WA 1WXDA 3DQPA 5E7NA 1OZ0A 1QNLA 3NBQA 2Z83A 2JN4A 2NW6A 5FUVA 3ILHA 3TVDA 1BXKA 1C1DA 1NHWA 1YBVA 5CNKA 3OBBA 3WLRA 4IHAA 2HJWA 5TPWA 2GZ3A 1LLDA 4M8SA 2PRIA 1SQFA 1HUQA 4Z4FA 1Z06A 5BNIA 2HSWA 3MWFA 3HXOA 1K2WA 4DK3C 1VDMA 1IEWA 4ZAVA 1JOOA 5D85A 1X7XB 2I6GA 3M1LA 2LP4Y 2VW9A 4UU8A 4OO1H 1JHRA 3HVIA 1GZ7A 1ZU5A 3OQOA 4CIYA 5AKHA 3EG9A 4C7BA 2EY6A 4JGBA 3IQGX 4TSFA 3H42B 3ZZUA 3H2SA 5ALJA 4DXAA 3OQJA 3P20A 1DQPA 1JIXA 4DQLA 3FX2A 4GYJA 1Z38A 3RIGA 4TN1A 3ZNQA 1K7SN 3C98A 4DR3Q 1T2DA 1L4MA 4JBJA 3CKIB 3ME5A 5TSSA 2QMEA 1HLFA 2GEUA 2R4QA 4EJ0A 2WMYA 3PNOA 3GRVA 3NXSA 4P71A 1SIOA 4U7DA 2TMGA 2C42A 4PLHA 1EY5A 2R9VA 3HUDA 1ATZA 1XCLA 3KSMA 4BY1B 1H2ZA 3BD7A 3GLGE 4UCWA 1BVRA 1X80A 1Y1KE 1LFAA 3HCCA 4RTOA 2DY1A 5ECWA 1J8IA 2PJRA 4YEDA 2Q2TA 1ZD8A 4JITA 1Z2PX 4AMBA 3BT7A 1C5KA 2FX3A 1SKYE 4N82A 4OQNA 1ZG3A 5KNDA 2JAQA 3SGIA 4H1HA 3M2PA 4QQ8A 1YE8A 4BLOA 3RVPA 2HRZA 3NAMA 3T3OA 4JC5A 3PPXA 3VXKA 1S1MA 2CZQA 1ENOA 5KTNA 3WGHA 3BORA 1QH1A 3PHBE 4K6KA 4BVKA 3KFLA 1JWBB 4D3YA 4P08A 5EE3A 5DHSA 2HXSA 3DJYA 3SYRA 1YULA 3A0RB 3DOHA 3KVRA 1NBMD 1ZLYA 4K6HA 5ADWA 4DLLA 5CM9C 3LY7A 1C30B 1N32B 2WVHA 3D6NB 4BO3A 1SC4A 1W52X 1YRWA 3DBHB 4EW1A 3KQUA 6Q21A 2F1OA 2KLBA 2IEDA 3HO8A 2EATA 1RJ9A 4A3EB 3MSXA 4HCJA 3VPXA 1X13A 3WZ2A 3LUCA 4OXRA 4WHMA 1NCVA 5K8VA 5DMXA 1AGYA 2YRWA 1Q3HA 5BP7A 1CKEA 1CS4C 1D07A 1VQ5A 3PO3H 2YN4A 3K6SA 5J2UA 4DXFA 1VYUA 1YHNA 2EP5A 2DY7A 1EESA 3DTYA 4U02A 2ZIZA 2EKLA 3O8DA 1J0CA 4NOJA 3DWAA 5L9AA 5LBIA 1N3BA 3RO7A 3H0KA 2JIMA 4L7VA 3GRYA 1GKHA 4E5NA 2G0AA 1V35A 3OUTA 1K7FB 3CQ9A 1K0RA 4KLRA 5AM0A 2UXDB 4BRWA 2UUBQ 4E2WA 4R83A 1GZ3A 4G7ZC 2C5AA 3JQRA 5JNRA 1Q0TA 1XLTA 5KYXB 3P2IA 1VJCA 2W83A 1LS1A 1LVUA 4B3HA 5FO9B 2CCZA 3AU9A 5CLIA 4Q3BA 5JI2E 2PJZA 2JIZA 4KY7A 4BNDB 3L0BA 4LV5B 2HHLA 4GVPA 3CF4G 2HIAA 3LO8A 3EHEA 1GUFA 4CJXA 5JYEA 4IMPA 4BMCA 2AR9A 1YQTA 4GDMA 4AZ0A 4UHHA 1NUAA 5I01A 4NI5A 3ZBTA 2DLCX 3LP8A 4NF2A 4DCPA 4DFAA 5J9FA 3UOGA 1IHOA 2ZJYA 2ZYDA 2VQDA 2J33A 1TR5A 3ZQUA 4BO4A 4OB8A 1E24A 3GO5A 4Y1GA 4DUYB 1FFEA 1J99A 3UY4A 3A9UA 2JCBA 1GA1A 4HFMA 4BFZA 3IULA 1BO6A 5BQPA 5IZCA 4X90A 2QYOA 2QGZA 1D8AA 1D2AA 5CX1A 3OTHA 4BKRA 1CUSA 3VUEA 3GFPA 5A3SA 4RHXA 3HVRA 1KI6A 1XHEA 4IJVA 4D0RA 3P7MA 1EUZA 2YV4A 4JAVC 3R7WA 2YMQA 1DG3A 3V4PB 1WLYA 1D2MA 4MPTA 5KVQA 2QDLA 2C99A 3R3OA 3KVVA 4CKZA 1MEOA 1VECA 3ESQA 4OBEA 3D8NA 4D0GA 1PG2A 3TDNA 2VIIA 2ORIA 5DBHX 4Z7QB 3R0IA 3DNPA 1SY7A 2F59A 1QFJA 1ZNXA 4GIBA 5IABA 2G82A 1R9TB 4BKUA 1KFCB 3IT1A 3DWIA 1N2CE 3K8YA 3KPYA 4X71A 3HM9A 3DEKA 1UINA 1C3VA 4ZGGA 2GNAA 3V9AA 2F1KA 1UXIA 2O7QA 1OWMA 5GV8A 2FXIA 1ADFA 2R4UA 2WTXA 1EQQA 1G98A 1RAAA 2JA5G 2AJBA 3UMBA 3FI9A 16PKA 5FCDA 4KW7A 5GROA 4HMQA 1FFYA 2JA6H 3L4KA 1VJRA 1B16A 1Z4IA 1DAFA 3MXPA 3PIIA 5JS8A 4G9BA 1PLFA 4DC1A 2H0AA 4MRAA 3IH5A 3HDHA 3WMFA 4RM2A 1M2VB 1C7EA 4ZVKA 1LDNA 5TLSA 1EGAA 3V9PA 2RHTA 4F4JA 4MRPA 4PZZA 2D0OB 5LMUL 2ZS7A 2HA0A 2FLKA 3DGFC 3H6GA 3A31A 5JHGB 4DK6C 4AZVA 4HKTA 1WAMA 5IAJA 3KLMX 2NVYB 2GAAA 2E2DC 4F06A 5HRUA 3HOUH 1FLAA 4Q18A 1XVLA 4JI1L 1P8LA 5EE1A 2AOVA 2CE7A 2WMDA 3MBKA 1GQFA 5LIPA 3TW8A 5A4KA 4LDZA 3EVBA 4BJ5A 4YC7A 3F3YA 2IXBA 3NVKI 3Q7PA 4BATA 4BA2I 4N0MA 5LQDA 2H85A 1JR3E 1XCOA 2E85A 3BX1A 2NGRA 3F5MA 4HOYA 5K2MA 4G5QA 3PQFA 5BR7A 2BGKA 1WDWB 1O8BA 5F5XA 3C15C 2OK8A 4AO8A 1V3UA 1N6NA 2V98A 4JLKA 3PEYA 4XIIA 1ZXTA 4BZZA 5LP1A 2PM8A 1E32A 4AYXA 1PJQA 5KHAA 4B9EA 1Z8DA 2IY9A 2WJ4A 1IBMB 2GRJA 3H5LA 1C7ZA 4NYIR 2PZAA 3HFZB 2W0SA 1M7BA 2KCCA 4B47A 1E4YA 1SG9A 3LXRA 1KF0A 4N7RA 4V0KA 1U8FO 1BROA 1Z6PA 3LKZA 1T15A 3QOFA 4ZI3A 2B7CA 4ZAIA 4OB6A 3EXHC 3ITPA 1DBQA 4OA5A 2Q0QA 5JLJA 2ONCA 2B2UA 4LGYA 3H5OA 3U6BA 3OEEA 3TSCA 3PUIA 2IA5A 2I1QA 3T3PB 4B82A 4JP2A 2GCNA 5ALKA 2QL9A 2ZPAA 4KPYA 3C6YA 5EP4A 1KK1A 2JGDB 5LU9A 2J6BA 3QITA 2IODA 3I8ZA 4QXMA 2P4HX 2PMWB 3QUCA 3P2OA 4KO4S 3MA2B 1YR9A 4JV5B 3N76A 3UH0A 2ZWMA 1LCIA 1TMYA 3HGTA 1W6JA 4I3HA 5T5QA 1P2SA 3PENA 1R6DA 2V74B 4MW1A 2FN8A 5IP9H 1XZJA 4DOMA 2FSVC 4ENQA 4RK5A 3WQQA 3F47A 1YDHA 4DMGA 4DCMA 4I65A 1YONA 2XMQA 4KGDA 1XTSA 2PSFA 3S17H 1ZVMA 1KR2A 2E2IB 3TTWA 2PQ2A 1FTWA 4NKRA 1FW8A 2VQEQ 2H0RA 2ZRMA 2YZNA 1OXVA 1S3SA 3D8RA 1EIGA 3OJFA 4LXXA 4S35A 4JD5A 3E70C 4KFRA 4D74A 1Z56C 3NQ41 1G3MA 4RTRA 5K51A 1STYA 1L7MA 4MVJE 2CLCX 4EJSB 4RMGA 5ELLA 2H1SA 2XZOA 4R3UC 5F1OA 3R3JA 3VYUB 3L18A 3KLBA 2FG5A 3CR3C 1EX9A 4HWKA 4RCZA 3LKBA 4IZHA 4F8JA 5DM1A 4P4UA 4NDZA 1RYDA 4YY3B 1E2MA 3GO4A 3DM3A 4MV7A 2CHVA 1E2FA 2SOBA 4DF3A 1E2JA 4HWRA 5IP5A 4ZK9B 5T67A 3DLBA 1THTA 5L8VA 4NL4H 4JQZA 4PRZA 2QE7A 2LXJA 2AVDA 4M1YA 4A3BH 2PZ8A 4OX9Q 5FTWA 3R5JA 3DOIA 4WCDA 2B1JA 1SIBE 5BN5A 5K0EA 5KWVA 4MJLA 1SIWA 4LECA 1BWPA 3NP9A 2XMPA 3P27A 4YXWD 5J58A 1KA9H 1SN7A 2QNRA 3DEOA 2R7DA 4R8IA 1ZGZA 2QEQA 5CG1A 2P6RA 2TS1A 3LL4A 4EW2A 3LRXA 4FJ0A 4MUXA 4II3A 1YQWA 3DMFA 2GA4B 2SKEA 3DMGA 3HRIA 3PIOA 3MQFA 4BLQA 3THXA 2X9NA 4QFBA 2IYVA 4FEEA 1KFJB 5PGMA 1PGOA 4C3UA 1W6UA 2B20A 4MA4A 3ZX5A 4Y1RA 1Y4ZA 2EBFX 2WTEA 1LW6E 4HNSA 4C3HG 2QN3A 1LTID 2OZLA 2I62A 2QG9A 5DO9A 1J5PA 4MQUA 4DUZQ 3IPXA 4OKNA 3CJQA 4G85A 1EAMA 3KOYA 3HKZB 2UZ1A 2C5FA 2AKEA 1NMXA 5F98A 3MWLA 1YVCA 1XTBA 1WP9A 5JAHA 1SC3A 2JEZA 1N9KA 2VYVA 4EYSA 4P72A 2IPKD 3MYRA 3A56A 2DQ4A 4K9RA 1N33B 3IDAA 5AKYA 5JSKA 1MSHA 5KYYA 1JR6A 4O4LB 3WLFA 2X77A 5F4BA 5EMNA 3LUHA 3SC2A 1SNQA 3IBSA 5KNBH 1DBSA 3GT3A 2AX4A 1OKKD 4JBIA 4Q3DA 2OXCA 3O21A 2OYRA 3GT0A 4H7JA 2ZRPA 4DRZA 1K3TA 2IDKA 1QQAA 4N0QA 2VFAA 1Y5RA 2XMDA 4NR0A 1FFXB 3WRYA 4G25A 1P2FA 1KSFX 4I9UA 4G4SO 3PCXA 1PZHA 4BZXA 3NTOA 1VE3A 3AVUA 3A6GA 4KVGA 2QT1A 4BNWA 1OVGA 2YR0A 3M4JA 2AQKA 2FYTA 5HGTA 4B2IA 4DNFA 2FA9A 4CMBA 1V8DA 2DPGA 1BN7A 4Q4HA 1Z0SA 2GR9A 1XU9A 2IYTA 1EGHA 1WXEA 3THWB 5JISA 5BV7A 4FSDA 1RP1A 2EX0A 1LC3A 4K88A 2O20A 1NVMB 3ZGOA 4AQYB 2H18A 1HWYA 4JXKA 4B8YA 3VVMA 4YREA 1LT3D 1EG7A 5KTSA 1O4VA 1GV0A 3TTUA 2CVHA 4L95C 2QGNA 2BMWA 1XYGA 5I6DA 3DHQA 2HI0A 4L5AA 1X7ZA 3MWEA 1XJVA 4X44A 4Z4IA 5AI5A 4GZLA 2CXTA 1M2FA 1MHPA 1NAHA 1QQ6A 4CF3A 2KJQA 3V4LA 1F8FA 4JBWA 4C3IB 4U1RA 4PN3A 1QORA 4BA1I 4B3CA 1NI4A 4E2YA 2GN0A 1XTIA 1J5EB 3YASA 2BIFA 1P4JA 4P1ZA 1P0IA 2B2VA 2HHJA 1YZTA 2B2WC 4TWZA 5HF5A 5BOVA 1CUDA 1B50A 1WZCA 4B3SL 1WOCA 2BI4A 1PUIA 4OHYA 2PA3A 2C5BA 5CJJA 2ZATA 1A7KA 2MR5A 4DA0A 2CUKA 1KP2A 2OWDA 3GPIA 2REXB 1FNCA 4EJ6A 4DR5L 4G89A 3X1WA 5C5IA 4FOOA 1RC8A 5TGDA 2V9PA 1ZC4A 5D6OA 4TUYF 1VLMA 3O8OA 3DOEA 4JODA 4LJ6A 1SXJE 4LOHA 1F2TB 2BSXA 4KIUA 3OCYA 4HC4A 3U37A 3R8FA 3LRPA 1Q1QA 1RABA 4J1TC 1GIAA 4RLHA 2I3BA 4BO2A 3NU1A 2C78A 2WYHA 3VJMA 3WAJA 4I3FA 3WNBA 5J5AA 1H05A 4ALIA 3B6EA 3UFXA 3AX6A 1YT5A 1YMUA 1FJXA 3UUEA 1R0CA 3JR7A 2X4GA 4KHPB 8OHMA 2QHXA 1P7PA 2Y66A 3VR1A 3T9BA 3ZK7A 4GLJA 2IE8A 4IUDS 1ZUD1 2OCDA 3NWPA 3BMQB 4C6TA 1W0JD 3WLHA 3DWQA 2Z08A 1YCHA 1LB1B 4XJTA 2XGJA 4OBWA 4MS3B 3IP7A 1I01A 1STOA 2CLIB 2PAFA 3PUJA 1EVYA 1YTLA 1ADGA 4K6MA 1KY5A 1AKTA 1I6HH 4PHCA 4KI0A 5JVDB 2DKFA 3ER0A 1TU0A 3P0IA 1VCNA 4YRPA 2I46A 3FOZA 1TRHA 2QTWB 2JLXA 4MV3A 3MMNA 1NQOA 1DIGA 2J9ZB 2J9FA 4Y2PA 3PHLA 1OTXA 4HDRA 3DHEA 3ZEAA 4G81A 1F8UA 5NLLA 3JWGA 3M4OH 1DSSG 4MA5A 4DG8A 4LSZA 1HORA 5IGDA 1E2GA 3P2MA 1DWOA 5CW1A 3ZJVA 3PNBA 2QBYB 3NHAA 3SE0A 3HYRA 5L37A 4AKHA 1QO0A 2CFMA 1BBXC 1KQGA 5JH7A 4RH0A 1MIOB 2ORYA 3LP6A 1TJ5A 3UATA 1MEJA 5EJAA 5FXMA 4DLVA 3HMKA 4UTRA 5KNCH 3GRCA 3I1JA 4O4HF 1GU1A 4KDEA 4EHFA 1AXRA 2JHCA 1Y4UA 4V2IA 2ATEA 2HK7A 2IF2A 1QIIA 4WOKA 3GHYA 1ZH0A 3BS1A 4H18A 3FOAA 2CMDA 3X44A 4D0SA 5HJ5A 3FLEA 1M34A 2P5TB 1FRNA 2J0SA 4GSYA 1T0UA 5DBOA 4BQRA 4LS3A 2WABA 3R9WA 1BXGA 3UAGA 4OV6B 3F2DA 4BVEA 2HJHA 4HYQA 1BNCA 3K5WA 5ELEA 1EFID 3AUYA 3DF9A 5M3FH 4UDNA 1EYGA 3G2OA 1RLOA 2H4HA 5HE9A 4LMRA 4COOA 1SQ5A 3V7WA 4UM7A 4IJLA 3KVNA 1VPEA 3EA6A 2GLTA 3K0AB 4Z86A 4OM7A 3V1LA 4A3FG 1GPYA 2O8FA 4L5CA 3C7KA 5AR1A 1P16A 4NEQA 3CLTD 3ISTA 1R6AA 3URYA 1O0SA 3L7BA 5A9SB 4IDFA 2VHXA 2XCOA 4HD8A 4A8PA 1V8OA 1FDWA 5DM2A 2VTDA 1Q7GA 4ANFA 2GHTA 2IHZA 3K94A 5DM0A 1QPZA 3K5HA 4KLNA 3G48A 1CUWA 3D7KA 4GXQA 1E1QD 4KN4C 1R9GA 3L6BA 3O3MB 2JA7H 2BKVA 3IAS1 3FN4A 3QIVA 2JKVA 4IXTA 1LTBD 3HCRA 1D5CA 3NDIA 4Y9TA 5AOVA 2IU0A 5EJ4A 5EJ5A 1AURA 3GTMB 4BMPB 4MUEA 2ZE8A 1PFMA 3IRBA 3FGOA 1EL0A 4QARA 2HPVA 1MJFA 1DARA 2YYZA 4ZICA 1NF2A 3MUEA 2QT9A 1CQXA 1RRCA 4YO7A 2A78A 2YHIB 4W5NA 5KSPA 3GDOA 3TLEA 1CYDA 5EHXA 4N3GA 2JKZA 4M83A 4BLWA 4FEGA 3DC2A 4MUIA 4FK8A 2CHGA 2Q5CA 5C1DA 5DYIA 1JXMA 1H9KA 2XTJA 2VRCA 2QLTA 3IEVA 1ZINA 5HE8A 1HA3A 3K59A 2JRCA 4OJMX 5H3CA 2LRHA 1SD2A 1U3CA 4L9SA 3UG7A 1T9CA 4BUCA 2CLHB 3PEUA 1KZ1A 3HWRA 3AF5A 2V7GA 5G4KA 4Z9FA 1WTPA 4DJEC 4N1AA 4RL4A 1R16A 4TL8A 4H7EA 1W1UA 4NOMA 5HA5A 1SVIA 4LYYA 4X94A 3MTIA 2B98A 1FYEA 2PS9A 4CIBA 4YJ3A 4XYMA 5AYVA 2MSEB 1BQQT 1UXJA 2G63A 1NXXA 1G6ZA 4MRMB 3U4VA 4PHTA 2ZRQA 2WZQA 3TPCA 3IAXA 1Y6FA 3SWWA 1JKMA 4B08A 3H8VA 1A1VA 1LYLA 2A6PA 2EJWA 4AYWA 3HKEB 4AKSA 1NJSA 1P5HA 4F5WA 2FETA 1AV6A 1UZNA 1TB4A 4CT4B 6YASA 2QG6A 2P9QA 1QAOA 4KITB 1AHNA 5CLQA 4CWAA 2BEUA 1G8JA 5SICE 2CYAA 2W6MA 4YHHB 1G6OA 3RVOA 1HQMC 5I9SA 1FP2A 4L22A 3WO1A 5IWCA 4K1XA 2XH8A 5CB4A 1HNWL 5A9RA 3JQGA 1SHZA 4LX0A 4PPFA 4C0KA 3WHIA 4IKEA 5AFSA 2QUZA 2GDZA 1Q0PA 4LNUB 1HT3A 2ZRCA 5LB2A 4U9IS 3HXQA 4A3MH 3MJRA 1E9DA 4PV1C 4NU8X 1IXYA 4QUFA 3DM5A 1SVWA 4M0MA 2QYSA 2VDNB 1C48A 4CHGA 4DCNA 5JZVA 5JSQA 2WU4A 5ALEA 4X62L 3CPHA 5J3BA 2GEBA 3NTXA 2XMGA 2QD1A 4D9EA 1BD4A 1XAJA 1KI1A 3UUGA 1NMQA 2PBZA 2AMYA 2W2VA 2R751 3IUNA 1A2KC 4YQEA 4W82A 2A1UA 2GHQA 4KGVA 2DP4E 1UKAA 1TIID 5F7OA 3JZIA 4BX0A 4PCUA 2RJNA 1FVFA 1QLWA 1EGVB 2AV6A 3RFXA 2XYVA 5IBQA 3AK4A 3X1JA 4ENWA 1KJWA 2C5LA 1GTVA 4RAUC 3FZEA 4R5HA 3S8MA 4UNSA 5BQOA 1HMPA 3Q8LA 4B7XA 2AFHB 4WBNA 1PH6A 2A84A 1UAAA 4QVGA 3CNHA 4FQ7A 1I33A 3BQMB 4HEA1 4LNAA 2ZIVB 5KYGA 5EMHA 4E14A 1CZRA 4MI6A 3TDKA 1QAQA 3AB3A 4DC9A 3COPA 3FEWX 4MO9A 2E4WA 2NACA 2ZRKA 5I2YA 2DGDA 4WXEA 4MIUA 1OGIA 3BBPA 4P7JA 1HO3A 2B8FA 3R8XA 4TLAA 1HEUA 4DWJA 1ILEA 2EFJA 1YQEA 4OJKA 1YZYA 2O19A 5FL7D 4Z9YA 1B6TA 3WFJA 2NVUA 3PL5A 5G0SA 2REOA 2HUPA 3KEFA 1VMCA 4NS4A 1MJCA 4Y2XA 3UPDA 2QJWA 4G0PA 1FXSA 1RACA 2W2KA 3JRWA 3L7JA 2Y67A 1N36L 4QPNA 4BLSA 1NTOA 4FLMA 3RQIA 2WKCA 1WUTA 5EG5A 2EHJA 2D4AA 1Q86C 4MI1A 4ZVRA 1L7AA 4RQUA 3U44A 4E3WA 4GMHA 3CKKA 1JIIA 4ICIA 421PA 5EHGA 4ID6A 3LUKA 1KNQA 1X7WA 3ZCXA 4JH0A 3RUIA 5ELOA 1I4QA 1WDKA 3GZ4A 1ISPA 1KJ8A 1N3LA 1YNJD 1EPUA 1RHMA 5K3EA 2XA2A 3QPWA 4NWIA 4C4XA 2VJPA 4MKXA 2ZE5A 3P4XA 1GGVA 1NVTA 1QS0A 4DB2A 1JWAB 4OI1A 1HLGA 2GARA 4UDUC 2NZJA 3JSAA 5DXFA 5LWHA 2XW6A 3LCMA 4R8MA 3MEFA 2F48A 3K80C 4NTZA 4L5TA 2WWVD 4EEKA 2B3GA 1IZ9A 3HEBA 4FZVA 2WNHA 1UJBA 1NFRA 3IOYA 1UT8A 3WB9A 4IKPA 3KOZA 3IS3A 2YQ4A 2YJNA 2DWPA 3WWZA 2DWUA 1MOPA 4NVRA 2WT4A 2G4CA 1TT5A 3ANLA 4KDRA 2V0NA 1GDTA 4NZOA 3NBHA 1TFUA 1K7CA 1KYVA 1STAA 4X66Q 3K2BA 3HOZB 1IDOA 1JKIA 1C9OA 2NQ8A 3HNRA 1E60A 3Q11A 1ESZA 4UPDA 2H8KA 4CCYA 3CYFA 4MIOA 2Q5LA 3HDGA 4LFCL 2B1QA 1PJCA 3WL4A 3Q0IA 3U50C 3B9QA 2RK4A 3K8QA 5E7JA 3S16H 4M1SA 1I7SB 1D1PA 2AZTA 3FUCA 1S5ED 4HEQA 1ZITA 2V7QA 3ZLVA 1R7RA 4NXMB 3ZBQA 1I6MA 2BR4A 4URXR 2JEBI 1EQUA 3EHDA 1DCFA 5AXBA 3GIWA 3DUZA 3QH4A 1PA6A 3I6IA 1I3OA 4YT2A 3UK0A 4I1OA 1U5KA 3GIDA 1M9NA 3OPXA 4E32A 5LQJA 3UN1A 1EFPA 1JVNA 3NVDA 3C1EA 4KQ2A 1SQ6A 2ZB8A 4S04A 1GG5A 4IHQA 4CV0A 2C5HA 2CGEA 4EBBA 4BKOA 1UZLA 1I2CA 3CB4A 1LPBB 4MQFA 4TKMA 4QQFA 4MITA 4DEXA 2Q2WA 4OGWA 5J1TB 1SMKA 4A9AA 3D7RA 2X0FA 1KZ7B 1VQ7A 2PVSA 2ZE7A 3B12A 5FOXA 2NG1A 1ZIOA 1WCMH 4MW7A 1VLJA 3QWHA 5LBTA 2QUBA 2GN9A 4PG8A 2J3HA 3SHTA 4UTPA 3A1FA 1PRYA 4D45A 4M22A 4MLCA 1PD1A 1CK4A 1PJLA 4LUVA 5DM73 4A0RA 2AHRA 2ECFA 3EXHB 3BMNA 2AOTA 5CGQB 2BJVA 1IZ6A 3U7QB 2P6MA 4FC7A 3C3KA 2WUGA 1G20E 1MB3A 3MOIA 1XAGA 1SZPA 3JZDA 4RVDA 1AK1A 3U9TA 2V7BA 3PQ5A 5I7RA 2G77B 2V0CA 4HUJA 1VPWA 5E0OA 4CUZA 1K8GA 1VG0B 1LT6D 2VF4X 4Z51A 4INOA 1TMOA 1VLQA 3ZWKA 4JQCA 2YZGA 2AL7A 1E18A 5EI5A 4P4NA 2R60A 3MAGA 2Z1DA 1Y37A 1JQDA 3COYA 3ND5A 3AKDA 1JOQA 3R0XA 1EWQA 4O59O 2H1FA 2JJ1A 4L5IA 2XSZA 3EIVA 3JQ6A 1CHDA 1NUTA 5ELMA 4P80A 5IYZA 2GPAA 4WUVA 3FWHA 2AQ2B 4BY1G 5IKXA 2XKBA 2ZJZA 5LZ5A 2HYIC 1V8PA 5AUQA 3LXUX 4YRCA 2NVBA 3GTGH 1GRNA 4GKKL 2V03A 3VR4D 3HMQA 2W71A 1CIJA 1THZA 2ZUDA 3NTHA 3RC1A 5AVSA 3NMUF 2A57A 3EVFA 2DUMA 5KWJA 1L1RA 2ZWOA 1X15A 3ZWPA 3PLAE 5I9NA 2W6JA 1ARZA 3FWPA 3P9ZA 1P5ZB 1U80A 2FR8A 2DR0A 3R5XA 1FK8A 1SC1A 2CKDA 3R3VA 2M6LA 1QR2A 3ROPA 2NXEA 7REQB 1R1DA 1D0IA 4YGXB 1G2QA 2GXSA 2GNOA 1NQWA 3A4LA 3NGXA 4G7OC 5JNSA 3MD0A 4RK4A 3CRNA 5I7AA 4KO2S 1Z5UA 1AMNA 1F60A 2BKEA 3NATA 5LOVB 3IX7A 3OQIB 2FPPB 1JALA 2VH1A 2GTHA 4C3VA 4DV7B 3DMPA 1A4RA 1TUEA 4G8JA 4OATA 3OJOA 5CA0B 1UPAA 4YROA 4YLYA 4RJKA 4B75A 5E2IA 3Q40A 3SBOA 1ZJYA 3JZMA 3DZJA 5D86A 4A3EG 1R5NA 4LF5B 1PG0A 2TSYB 3QFSA 1ZNWA 2ABWA 5BOSA 2BUAA 1Z0IA 1RYNA 3SK4A 3CN9A 4DIEA 3RYTC 1U0RA 3Q98A 1CQVA 3C7DB 4DQKA 4R1MA 4GZ5A 2WU1A 1Y82A 4Q1DA 2VK4A 3HRZC 1XNHA 4BFCA 2XTAA 3EGXA 2QMOA 2QYTA 4AO7A 2WHPA 3WG9A 3PHIA 1GTJ1 2L9HA 1FS6A 2Z04A 1ICWA 1Y6QA 4LVOA 1WQ3A 1QGOA 3V6LA 2J0EA 4CM8A 1XMOQ 1V6CA 4Z0TA 3ZCSA 2GFIA 5K0TA 3AVPA 4PYNA 4WZAE 2L11A 4TMTA 3ANTA 1Z6HA 4WK4B 2OG2A 2W7TA 4BGDA 1Z5GA 2AOUA 2QLJA 3IR5A 4PCAA 1Q46A 1C9JA 1QHFA 2C4HA 2VDWB 4DLZA 4DZRA 1LTAD 3V96A 3KVOA 2CT8A 3ZR4B 3BFVA 5JPMC 2HGSA 4J6EA 3IUJA 3C4VA 3NOQA 1QC5A 2R1TB 3EVGA 1MBZA 3I5AA 1H2BA 5I7EA 2B39A 1ZS9A 4IDGA 4MW2A 3R9XB 5TB5A 1L5NA 2Q0HA 3RTAA 5J3JA 2JXMB 3WOEA 2OP1A 4Q4LA 1YBHA 4DNOA 4L6CA 2AN1A 3E5NA 4GPTA 1YVEI 2ZUVA 4GYYA 3Q2OA 1R18A 2YX1A 4ZZIA 3ZHOA 3G88A 2C29D 1LT5D 5ALDA 2ETVA 1ZMBA 1E6WA 2GX6A 3ILVA 4C3OB 4WDQA 3EARA 1N4AA 1NXWA 1FRQA 4N8DA 5HIJA 4RULA 2ZBRA 4UZEA 3QVGA 4FZJA 3E9IA 1SCAA 1I32A 4C22A 1A2TA 3KLWA 4MYHA 1HHVA 4QYSA 4IDPA 3LDHA 3HDYA 3U4CA 1EVLA 5C4HA 2BZ1A 2AZDA 5IK2A 4XDGA 3CRW1 1D2BA 5CV5A 3UANA 3H5NA 5LA6B 2BFDA 4IDNA 4Y2SA 3G0OA 2JGJA 4Z4HA 4IOCA 1BQEA 4JBMA 1XRJA 1HJPA 4EH1A 1MO2A 1PJ8A 3VKVA 2NSDA 4HLNA 3DG9A 2QKIC 1Z7GA 4QT0A 5LMCA 3C70A 5A4MS 1HUMA 3ED5A 1T5EA 1N92A 1W85A 1O7LA 1EFWA 2OGZA 4B3RQ 3DFUA 5ALUA 4F7WA 4MINA 1LI4A 1Y6GA 5F21A 4XIGS 5TGTA 3L6EA 2XF2A 4OM8A 3ESBA 5B1HA 2RE8A 3SNKA 1XJQA 1Y8PB 2G36A 4BUZA 4TL7A 3NTLA 4TUYB 3VUFA 3MJCA 4NPSA 1Q7TA 1Q7BA 4B6SA 4HZIA 1ZYRD 6ADHA 5LKAA 5M34A 3DB2A 5FUWA 3TGWA 2L17A 3HU2A 1J7KA 2GHIA 4GKAA 4LF8B 4FGZA 5K6RA 5BN3B 3RLOA 4RKFA 1UEXC 1GA6A 4A3KB 4FS8A 1TXGA 1P9OA 2VHUA 3BZCA 2B2NA 1WXHA 2R93B 4HP8A 1ZIXA 1SHUX 4LF4L 1VLHA 4YRTA 2GVNA 1FDVA 2IY7A 1C7FA 3NIBA 1NONA 1MNAA 5AVUA 4J2TA 1QE5A 2ATIA 3SU8A 1EJBA 3UMGA 1ZJ6A 4MVJI 1TTTA 3HKBA 2FOIA 1JEQA 2C2GA 5FBVB 1RXCA 4V02A 1JYEA 1DDGA 121PA 4S05A 1ZK1A 3I12A 2HD4A 1WOMA 4MTLA 5DM63 1N5RA 2JG3A 4RHSA 3DR5A 1WWKA 1MA3A 4FDMA 4V0LA 3OWEB 3SAJA 2QAGA 3RB8A 1YE5A 2QNIA 1B93A 1G8PA 3DTTA 2X8JA 5GMOA 3EB9A 1PQUA 1X1AA 4CV1A 4F1WA 4NJMA 2GAIA 1NZDA 2ODEA 2GNPA 3CQZH 1UFQA 1M8JA 4DLWA 2QUHA 4PIMA 4KLKA 1GFZA 1F2LA 3K9NA 3OMLA 4C0HA 5BWNA 3LNNA 2V8BA 4EUHA 3KSZO 3WP1B 4KAAA 2G09A 3UKJA 4OKSA 3ICQB 4NV3A 1GGKA 3TLZA 3WWDA 3D8GA 4PC1A 3RYIA 2ZI4A 3MLEA 2OC9A 4O63O 2FEPA 3PFCA 2JIBA 5A4FS 1SCIA 2CDNA 4UAJA 1M1UA 3GLIB 1HC7A 3STYA 4RKQA 3CUUA 3JAME 4ZU3A 3KL4A 4D4IA 2IHEA 5C37A 3T6KA 4XWKA 2PI2A 3T9EA 1CP3A 1RBZA 4MQLA 1Y1RA 4Q4JA 4LE1A 3ZDDA 1U6IA 1ICIA 3AUFA 4K2AA 3ZQ4A 4C20A 1XPJA 3D8UA 3WK8A 3IVCA 3LU1A 4NMLA 4LSMA 2FZ4A 2GDJA 1U0FA 1NPTO 3QVOA 1U1FA 1YS7A 2DTEA 3DOFA 4J94A 1FJGB 3P0EA 2X7JA 4MLDA 1MB0A 4UHBA 2ZI7A 2BFFA 2KA7A 1YXMA 3CRLC 3BZDB 5GM1A 2D74A 4KQ1A 3UHAA 2WFLA 5B37A 1DADA 2CXXA 4A76A 3CGGA 4CNQA 2ZAYA 2JATA 3SXUA 4EB6A 1T5SA 1N9WA 1JFTA 1E5TA 2ZVJA 4RHEA 5L3RA 1Y8RA 4IXWA 2DFLA 1MC5A 2ZM6Q 2NSHA 2XUFA 4MJXA 4TSKA 2EV9A 3UHOA 4J49A 2VT6A 2QTLA 5E6RB 2I1VB 4PONA 4EFNA 3PC6A 3QE3A 2J6CA 1Q1AA 3J81L 4IPGA 3HWX1 1W73A 1GILA 5JV5A 2HA6A 4EA6A 4P3XA 3MRVA 3MC0B 2LXKA 2Z6UA 1JSRA 3N3AC 1DC8A 2VJBA 2NTSA 4NFLA 4HQRA 5GAJA 3Q9SA 2ZJQA 1H9MA 5DP1A 2PXCA 3G59A 3GFTA 3SPXA 3A3PA 3NC1C 4FEYA 4CT0A 1G5IA 3HP4A 1VXRA 2FJUA 1NBWB 4ARBA 4YT8A 3PIPA 2HK6A 3QZUA 4YAGA 4TYYA 2O0HA 3DFKA 3DSRA 1N6PA 1E4EA 1FU4A 4Y6RA 1QTQA 4BFXA 4BNJA 3BCRA 3QFRA 1GXSA 5CXXA 2Z9CA 1GL3A 1G5PA 4LWZA 4MCAA 5CDUA 1QH9A 2ZXEA 1KSHA 1E2EA 3M7GA 1JWUD 2ECQA 1Z63A 5CR9A 1GRRA 1EM8B 5HURA 3RS5A 2HM7A 1RXVA 8MHTA 1YK1A 1VMEA 3D6WA 1TT2A 1N2HA 1Y4SA 1SVLA 2AYYA 3OCZA 3D4OA 1W48A 5K9ZA 1TQ6A 4TMZA 4BEWA 2GO7A 4CNBA 4LTDA 4Y2RA 1CE8B 2X9LA 2ZTHA 1FUIA 4C07A 4JY7A 3QLVC 2OFPA 1ITZA 3IOEA 4J90A 5G1PA 5AICA 1MJGA 4EUNA 3S1MB 3HJRA 3VSBA 4G0VA 3L02A 5LJLA 1NFQA 4TROA 3O94A 2YHAA 1G64A 4MQMA 4FE7A 5DSTA 2A73B 2WSBA 2ZUFA 5IAEA 2B4QA 1D0VA 2XIWA 1JEOA 1DQRA 4CCWA 3RRNA 5CLHA 4G56A 1IN7A 3D1VA 1NTRA 4HDCA 4DREA 3A7LA 3DT9A 1BHSA 1XUOA 4DA9A 1Z07A 2Q07A 2PD4A 4YLEA 3G8CA 3ELBA 1JIQA 2OAP1 2C2YA 3PO2G 2BL4A 3BZBA 5WRFA 3B7GA 4GS5A 1G2PA 3GUHA 4BCBA 3MGCA 1JH9A 1RT9A 5EQFA 5LIRA 2FWJA 2QP3A 5CVCA 1T29A 1H1TA 3KYJB 3X2SA 2HCBA 5CCEA 3D1LA 4ZKEA 2A59A 4E1BA 5L6MB 4ER7A 1P4GA 4Z9AA 3GQVA 4B79A 5JEAG 3ZDBA 1DI0A 1K83H 1DXOA 4LI0A 4JJ4A 5DLYA 4KKSA 4FZRA 4YR7A 3TXXA 1JHXA 1LDGA 3LY5A 4DV0B 4EMBA 4OIFA 5BWCA 2D2FA 5J63A 3OF2A 4L8YA 4HX2A 4FGKA 5BVGB 3HB0A 3E7WA 4YCJA 1UBJS 1O95D 3NEYA 4G07A 3COVA 1T26A 1MAUA 2Q9BA 4FNGA 5CORA 4TVOA 3VAAA 4FF4A 1N6KA 3ANNA 1L8AA 3LBIA 1T1EA 2FW1A 4HQFA 4BVFA 1NP3A 1QH8A 4OH1A 1O0BA 5E3FA 2P5YA 4HIMA 1V1MB 1TU3A 1TW3A 4NJOA 4DPMA 3HL0A 2Z8ZA 4MULA 3B3GA 2OTLA 2QSJA 3QP9A 2PMEA 4CTJA 3GRUA 4IO0A 3QJGA 2H4XA 3C2PA 1E3QA 4ZOLA 3TG8A 1KO8A 3NWBA 1DCKA 4D9CA 4ZQEA 4DZTA 3CRMA 3FUTA 2GKOA 1BCPC 3K9QO 2KI5A 1QV9A 3CLVA 4IWNA 2A9VA 4IFDI 5IAOA 2NU7B 3F7MA 4TWJA 2Q5QA 1YZFA 4AJPA 1JH8A 3PQIA 1NSTA 2RDHA 1SMXA 1FVHA 3RYHA 4Y2YA 4DJJA 3A2NA 4DGZA 1E0JA 4CF4A 1IC6A 1U2TA 4EI7A 4O02B 3DLPX 4S2UA 1TQHA 3NV9A 5I4IA 2AYZA 3NETA 4AG5A 1NR2A 1UK7A 4ZOQI 1W75A 2YTYA 2CUTA 1P1IA 4JZYA 3IO5A 2WEKA 4UZFA 3U26A 3QEMB 1HT1E 2MMCA 5FI0B 2Z57A 1F4LA 1X94A 1K27A 3EGEA 3B9RA 5LQMA 4WDRA 3CNBA 4JLWA 4W1RA 2XOEA 2Q1UA 1BCPF 4HGOA 1K0SA 5ERXA 3WJAA 2M1XA 2YWBA 5DYNA 3NTVA 4TMXA 3DYBA 4FF1A 1FJHA 1VQHA 1EP9A 2PW7A 1D7AA 3DL2A 4RHUA 5DKFA 1HNZB 4KPFC 2UUAQ 4YMVA 3FHLA 4M88A 4GRIA 1O1YA 3FNFA 3IBTA 4ZO7A 3K2EA 2NZHA 4BNNA 3AR6A 3OPMA 3M3DA 1A2QA 1KAGA 3DP7A 5ALPA 2QR3A 3AYHB 3CLHA 4X1IA 1ETUA 1VI6A 4GP7A 2RH5A 3ZCPA 2AMLA 3QK7A 3C7CB 2JB9A 2R8BA 1SAYA 4GLOA 2HQRA 1Z6QA 4RVCA 1UZAA 2Q1XA 1SUDA 1IRXA 1O3YA 6CHYA 3UWKA 5B58C 3SVLA 1NW8A 4ETMA 1RAEA 2Q6KA 1AQYA 4AYBB 2QXTA 2BD0A 3LWZA 1HR0B 4CN8A 3GUVA 1Y8NB 5IGGA 1AUQA 1MBYA 3S2FA 1EDZA 3D43A 3LC2O 1FFGA 1ODFA 1Y89A 4RHCA 1U0OC 2XVAA 2CKZB 1F1BA 4JR0A 4TVSA 4YCVA 2W2LA 2ZRAA 2VP3A 5L95A 3IAEA 4C4YA 3EIWA 3MFGA 3O8QB 5ESDA 3OX1A 1HFEL 1Z47A 2R7NA 2MJ8A 4BVHA 2ID9A 3L46A 4I4TF 1VYHA 2FINB 3TKAA 4OXQA 4N0PA 1SYCA 4L8WB 1IHXA 4RD2A 2ZAOA 3LCJA 5LQKA 4JR1A 3RBXA 2PD3A 1ESEA 5DTQA 9LDTA 1NRJB 3NKLA 2JDIA 3THSA 2HCCA 1L7RA 5FTNA 3UWPA 3SXPA 3LGJA 5C2JB 3HN7A 1VGRA 4BEJA 2MINB 1VL2A 1VIYA 5CDYA 5ECYA 1UE7A 4EQPA 3RSHA 2XKKA 1G38A 4QSHA 5IT9E 1KHIA 3ILYA 4EVIA 4HVLA 3MCWA 4RK7A 2HU5A 7MDHA 3VNBA 3LLUA 4PQXA 1B8NA 1XFAA 3HFRA 5HSGA 1JAIA 4PX9A 2Q2QA 4CFSA 5FPYA 1NA5A 4QB4A 2B34A 2R2AA 1U0GA 2WAAA 4WXHA 1QIJA 4TTPA 2K04A 3C1FA 4NQZA 4AMUA 2EYPA 4YWMA 2E5LL 4W5JA 4XKJA 3IMCA 3PGZA 1ZBQA 3SVZA 4KU4A 5K3OA 2B2YA 3L9XA 4JHXA 3PEWA 4C7KA 1R66A 3CXCA 2G8LA 4ENTA 1DKLA 5A0VA 4UVIA 3T1QA 2PZEA 3KLSX 1WVGA 3FSGA 1PHPA 3QEBZ 2YDYA 4YH1A 5K3FB 3A9RA 4X54A 1NDUA 4RCNA 4RS3A 2PCFB 3L84A 2EIHA 2F4VL 3KJQA 3GV3A 2DQYA 2AD5A 6ABPA 3G2NA 1XPUA 1L5HA 4GWLA 1D1SA 2VQFQ 3SKVA 4LX8A 3IHWA 3DXYA 1SCUB 4Z0HO 2QCPX 2PX5A 3VPDA 5IP7H 3WRWA 3WYAA 2D2CC 1EJ2A 4CRWB 1R8YA 4K1LA 3ZBUA 2O2XA 1D6JA 1U2GA 1COWA 2Q2UA 2RI1A 3A2KA 3Q1LA 1VHQA 1XZBA 3ANYB 5JI3E 1HE1C 2ARKA 1XAIA 1CB0A 1UPTA 4BLTA 4HRYA 1E5QA 1AC5A 5AQ1A 1LDMA 3V1MA 2DKOA 3G5TA 3ORHA 3VVCA 3V1UA 3T9AA 5DT2A 1AQJA 4XDXA 1IOZA 2YBDA 3EXIB 2Z6KC 3WLOA 1EIWA 2V6BA 1FW6A 1TGYA 4AWAA 3GEPA 1A8PA 1CP2A 1IVYA 5FL3A 3SLKA 2F9LA 4C7OB 4A6EA 3WIUA 4Z7JA 2XXJA 1QVFA 4ARSA 1DLIA 2F1HA 3TOXA 5FAXA 2YWRA 2OCAA 2COEA 3FDZB 2H2IA 1FXWA 2BMJA 2PWAA 2CF6A 4V0QA 4QNRA 1MOZA 1TYEB 1T6BY 1KQFA 3DXXA 3IV7A 3TLCA 3SC6A 3ORQA 3FPJA 4D98A 3VO9A 2XWJB 3STXA 2B5WA 3W6NA 3JRNA 4ZU1X 4L0MA 4H0FA 4UOEA 4W5RA 3KELA 3EMKA 4V0BA 2B1IA 5TMEA 3CH4B 5BR4A 3RG8A 2XNCA 2NBFA 1ODLA 4GKJQ 1ZR4A 5FFFA 4YR9A 3EBLA 3UT5A 3BIOA 5F3RA 1TIPA 3K8AA 2NM0A 3PDJA 2P1RA 4GOLD 1WW8A 1GUNA 4BVBA 1UKYA 1NVWQ 4KRGA 1YRQA 1K8YB 2YNMC 2IS4A 1W96A 1CS0A 2WINB 2QK4A 3GEDA 1Y1PA 1X77A 4DRXB 4KGZA 4QUIA 2FWRA 5JHHB 4HDQB 2QTHA 3M6VA 4HXEB 1ET6A 2R6CA 2I34A 4LF9L 1J33A 4BTEA 2GZRA 3KKLA 1TYZA 1SJHD 4HX5A 2K1BA 1TAHA 3OAAD 1KS2A 4KO3S 3NFYA 5B3JA 1X7YA 1TQDA 3LA8A 2GCGA 1TI7A 3WDLA 4AY5A 1F12A 4TV9F 4G2TA 5BW4A 4DV4B 3ZS9A 5J59A 1X1QA 5BSWA 4ESEA 5E7IA 2R7FA 1DFGA 3I9JA 4DSTA 4G4IA 1WM1A 3J7YW 2VKQA 3FBWA 5LBUA 1F38A 3DKRA 5ITWA 1KABA 1Y5NA 4KAFA 1MR3F 3B20A 2A1IA 4HSPA 2HWKA 2VT3A 4CDMA 2QRLA 3LIIA 4L16A 2WHQA 1Y4DE 3FOWA 4NMMA 4XGKA 4BX8A 4QDKA 2B35A 4FGUA 1JFLA 4QBTA 4X91A 2DNCA 4Q7KA 3URKA 1Z0AA 5BN1A 4Q4AA 3OEWA 5KNDH 2CMHA 4LC9A 4R6WA 2DEUA 3RZOB 4K3VA 1TQ2A 5AJZA 3ZHZA 4IUPA 5DYYA 1VJ5A 4D6PA 1SOAA 3K3PA 2I91A 2V55B 4L6TB 1JQYD 3CKMA 5ELFA 2C84A 4QGAA 4DAYB 2B2XA 3H1FA 4X64B 3I91A 4Q7EA 1H3FA 4NBUA 4XD2A 2QAIA 1EXMA 3G9TA 2O2SA 1VM6A 1KJIA 2KHIA 4JVSB 2FMIA 4D4HA 1O6CA 3I09A 4EQ6A 3KQLA 3PXXA 4U4AA 5M5YB 2YIVX 1Z34A 5BXYA 3TIIA 3ZOZA 4F9GA 2YHSA 2FHSA 4P2BA 1E89A 1SB9A 1JN0A 4O2RA 2H1HA 3FPGA 5IKPA 1PGQA 5IGBA 2ICIA 4GW3A 1WF6A 5K3BA 5GVSA 5EJ2A 2I2CA 5I5EA 4MWGA 5D5QA 4LFAL 2H11A 3FYUA 3V32A 1P0CA 1CY2A 3MPOA 2WSLA 2UU9L 2EX1A 2GLUA 3MTSA 3T13A 1NBOA 2WR8A 4NARA 1MP0A 3E3LA 4F2DA 3DO5A 5D3MB 1X86B 4HEHA 4WV3A 1IU9A 4N9QA 5DM4A 5CFOA 4IZOA 2H5IA 3LM8A 5TNXA 5EPJA 1WXGA 4HBGA 4J3JA 2WJ3A 3ZZ0A 3KJIA 3FIJA 1HFGA 1B1CA 3SJZA 3CIOA 1NT2A 4C0QC 2C82A 3KTFA 2EBWA 2OWEA 5FNVF 3GGSA 5JC8A 3L8HA 1ILQA 3HOXB 3G2HA 3WVNA 1Y1SA 5F23A 3KETA 2ODPA 4WKGA 1MI2A 1V8QA 1GUAA 1IHPA 4GZ3A 3N0RA 1X55A 2VKTA 1RCFA 2FXVA 4MUJA 4ABTA 1II3A 3L82B 3EVNA 2NO5A 1RQPA 2VRBA 1QJOA 4Y67A 3BM5A 1HDIA 1W4BA 4XD7D 5GWXA 5BUSA 1GQRA 3LCRA 1ZGJA 2EDCA 2QU7A 2ZSEA 4XQCA 4DK0A 3OM8A 2FWPA 3S5UA 3EXFB 4J8PA 2H4ZA 3SYKA 3WAGA 4I7AA 4G0ZA 5C8YF 3JD3A 4GKBA 3PUVA 5CJ2A 4KK7A 1PT8A 3I83A 4X3OA 5EAIA 4R1TA 4Z9BA 3QKIA 1JQJC 3BJMA 4BJ3A 2PRZA 4JP3A 3OD5A 3RIHA 1BCSB 1A27A 3DZCA 1ZPDA 3AVWA 1R15A 4DCCA 1KDTA 2W8ZA 4PAQA 5ALMA 4E2FA 3HOZG 2O52A 4U9HS 5F2DA 3JALA 4QL3A 5G0UA 2QY6A 2FHPA 1R8QA 4RDIA 3SVMA 3ADBA 4XVRA 1RU3A 2YWHA 5CNJA 4DLXA 3MXNA 3H4TA 5THQA 3HKDA 4YALA 4IXDA 3N0TA 4OK6A 2YVKA 5HDQA 4UATA 3OICA 2RCFA 4ARVA 4V38A 1FYDA 3H09A 2AQ1B 1D2GA 4MK4A 3H0EA 1RWXA 2I3GA 2K75A 1AV7A 4U6SA 1P0QA 3EE6A 4ZZ3A 4DV5B 1N32Q 1Q81C 2HLPA 1H69A 3BHIA 2EU8A 2WWFA 1V7ZA 4CODB 3D6AA 3KQQA 2C98A 3OZIA 2BFPA 3S2DH 1EDBA 3DB1A 2GSWA 1K8OA 5BNZA 5K0GA 3FHOA 4OYHA 2AHOA 3OZ7A 2GILA 2X42A 2YJ3A 3HJBA 5IJWA 1SKAA 3IGFA 2PKEA 4Q4CA 2OBXA 4IUCS 3NHSA 5F78A 3EJIA 4FBMA 1BE8A 2PGXA 3PQ8A 4P0TA 3IA7A 1T6NA 3IAYA 4PXAA 2V97A 2ZYVX 3GCWA 4QIHA 5T3YA 2WKSA 4KYVA 1LV8A 2P77A 3OM9A 4KE7A 1YIAA 1E63A 2NNWB 1ELOA 3ACCA 3NBMA 1CK1A 4GQBA 5C4ZA 3TOCA 4YI5A 3W6UA 1WCIA 5A4DA 1SNPA 2V3CC 2BN4A 4JB0A 4PU0A 1GKLA 8ATCA 1XQYA 3IIMA 3B9PA 1T5LA 2AOWA 1KMHA 4DA7A 1DU4A 3PRJA 3H1PA 2EC5A 1D7QA 1DAKA 2Q45A 3C6MA 1HZZC 1UFOA 1ZLXA 5INTA 4S1WA 5HJ7A 2FZ5A 3A4MA 2IVFA 2RHHA 1UM9B 1WXWA 1HQRD 3AU7A 2I7DA 3K9HA 4MR9A 2R48A 4IR7A 1AS2A 3KAJA 1PEYA 5IMBA 2VZEA 4WNAB 3HYLA 3K8ZA 4QT4A 4B6GA 2I5LX 4RWEA 2H92A 1O9GA 2LDXA 4OQ4A 1QIFA 3H5WA 3S7TA 3SSMA 5LZ9A 2EWVA 1GDDA 3ISJA 3HB4X 1A9YA 1Y8AA 1BTOA 2FF7A 4UU0A 2JVIA 5ICFA 3L0ZA 4DUYQ 5EKLA 1E2ZA 4M3NA 1LNZA 4R84A 2XWPA 4H3VA 4INPA 4EY6A 1U90A 5EMLA 1HKUA 1V1JA 5ADVA 2HRRA 3FKSA 3GVXA 3AESA 4Q03A 1ZICA 1NBME 2I7CA 5E2AA 5AVYA 3ZCUA 4J91A 5K1ZA 1E2WA 1C7JA 3KK0A 3RSCA 3K4PA 1ZRNA 1TJYA 5KUTA 4QLOA 5GAEC 2FZKA 5IYDG 3O84A 1OGYA 1AT1A 1GOTA 2FW8A 4RKLA 3S44A 2F1JA 3WNVA 5JCZA 2C4TA 1QP7A 5A06A 3DDCA 4RESA 3JQQA 5JRJA 2B99A 3L06A 5JASA 1FU7A 3HVUA 4BPRA 5CVTA 3ZHCA 1A04A 3FJ1A 5CM2Z 2GCPA 4U00A 1N6LA 1XVVA 1VCOA 2I71A 3PUWA 4MQ6A 2MQHA 4YYZA 2ZETA 2G17A 3KG2A 3HUUA 3LRTA 2NPOA 1KTVA 5B1YA 4R8SA 1UMBB 3VR5D 5A0FA 4WN9A 5HGJA 1WCWA 4QICA 4RY9A 1DLJA 5KHLB 2EXDA 4A36A 1F3LA 1GN8A 2ZJ8A 3HLKA 3HXPA 2CN1A 4M7PA 4RQAA 1TEHA 2ZG6A 3FPKA 4EPTA 3VC7A 3F7OA 2VCEA 3ULKA 4LBWA 1EXNA 3IJEB 2ZP1A 2ZBFA 4XQNA 3TSOA 5D7BA 4PF1A 1Y1LA 2PSDA 4CQJA 1N25A 3WGOA 4BIIA 3H2ZA 4RL6A 3MFQA 4BQPA 3OE4A 3BIJA 1H9SA 5KTYA 3B48A 1SUWA 4Q3LA 5JMOA 5ALZA 2UXBQ 5BQ3A 1W6KA 2IYQA 4HQKA 4CM7A 2VSXA 1YAJA 4DIUA 3VPHA 2GI4A 2QQEA 1ZNQO 3RHSA 3CPFA 3S1SA 5FBWB 5IJ0B 1J2UA 4YPFA 2HIHA 5DWDA 4I5GA 4QD3A 3HEJA 1XLUA 1KGSA 5BW6B 5BSMA 4GC5A 2Z5GA 4C05A 1H1DA 2ZYIA 2AFRA 5KYUB 3LIPA 4LGVA 2F8LA 4PZ9A 1TUBB 3UAOA 3KF6B 3DBOB 4KC0A 1M1NA 4EHNA 4UXHA 1XNGA 2JS7A 3T35A 2ZT6A 2Q0XA 4Q21A 4GPZA 2RGEA 1ML4A 4GNKA 2IL8A 4UE3S 1SZCA 4ZCMA 3H86A 3G3EA 4WY5A 5LQCA 2WTBA 2X22A 2RHDA 5KPJA 5EQJB 5TPZA 1I8TA 1J0XO 3WNDA 4CLDA 3I90A 5AMXA 1HA6A 1CIPA 4G26A 1Z7YA 1K9VF 2FSFA 1P9NA 3JQDA 3I23A 4BS9A 4OF4A 3M7IA 5I7WA 3IIEA 5HW0A 2R8YA 3ZWAA 2P4QA 2FZGA 3UWDA 3E1SA 3JWJA 4ZKBB 1BXTA 2Q46A 5E4JA 1WZIA 4TS1A 2J59A 9GPBA 4FX5A 2BELA 1CEQA 4ITVA 1WFQA 2QX4A 2OB2A 1B44D 3OTOL 1YJ5A 2NN6I 1Y7HA 3A55A 1G60A 1Z4MA 1XYVA 1MDBA 2QRZA 3TFQA 3IXMA 3NOVA 5AJXA 3HOWB 3RU7A 4FS3A 5TMBA 4KTVE 4YCUA 4DCOA 2WTMA 3Q23A 3RF7A 3FM9A 2B78A 3K9LA 4JV5Q 1Q22A 2HV9A 1AU9A 1UM8A 4ALLA 4UASA 1FSZA 4IG4A 4A3KG 3UAWA 2A0KA 4DAVA 1WULS 4R81A 5DN6A 4CM3A 1KVTA 3FY4A 3B1VA 5IEBA 4B40A 4QTUB 1S4ZA 2WJIA 3RYCB 1DMSA 5KU1A 2XYHA 3S6JA 3MXOA 3TD2A 1GRQA 1YHAA 4KQHA 4RADA 2L0XA 5K36G 1V0JA 4ILEA 2E8GA 4NHEA 1AN8A 4B6FA 1S5CD 2ZBUA 4WMLA 4KX3A 1OTHA 3LWDA 3X3MA 1NRIA 3HA5A 4RMFA 1L0WA 4HSEA 4US2R 4FWTA 5KVVA 2LVBA 5C35A 5IASA 3MUOA 3PE3A 5LXTA 2VK1A 4YY3Q 4A3JB 4G36A 1GL6A 3TE6A 1BFKA 2JZNA 1G59A 2NU6B 4EF6A 3NXKA 3V42A 5F3DA 5KX5F 1U4OA 1J2RA 5FB3A 1Y3FE 2JFOA 4I4TB 3D7LA 3BH7A 2WAYA 1YU6A 3TINA 3ORYA 3KD2A 2JD0A 3HS0C 3VKWA 1KMNA 2Q1TA 1X6VA 2EXZA 1PNOA 4LN1A 5LZ2A 3W8RA 4HJ8A 3WWOA 4L50A 2PFKA 4C0JA 2H29A 1N2OA 3TJMA 2ZRJA 1FFSA 1JCKB 3WIVA 5EZ6B 1X7HA 2NWGA 3PR2B 3W90A 2QPLA 2CVRA 1BG6A 2FRDC 2X6QA 3PC8A 1RWKA 2IDJA 1DINA 3LFUA 2P2ZA 1Q20A 2SNSA 5CYUA 1RQGA 4X3CA 1JU3A 1FDRA 3G9UA 3AINA 1P73A 3AKCA 4TX1A 1J8DA 2F3QA 2XPCA 1TVEA 4XTRA 1PLKA 1Z4OA 2UZ3A 3DE7X 2C00A 3THYB 4AY4A 3WRVA 5A04A 3PX3A 3AXTA 3Q8KA 3I1FA 1FPMA 1I10A 1XZLA 5JXWA 1RTNA 4KXFB 4X3KA 3RS7A 1C8VB 1S8AA 4RMHA 4GH5A 4BP3A 1BZYA 1RZRD 3P32A 4B34A 3FMCA 2O8CB 5FI1B 4XCXA 2HCIA 4BBRH 4HRXA 2C2BA 3RTDA 1DIRA 3BEDA 3TVYA 3CAMA 1FRVA 1N33Q 3ZGYA 1A7AA 4MJ7A 1CQJB 4D46A 2G9QA 2D5CA 3ABSB 4F21A 2FGJA 3I6MA 2D0IA 3O92A 3AB8A 1V7QA 4N48A 4A3GB 3EQ2A 1PH2A 3EGIA 1KMQA 3O7WA 1GHJA 2PIAA 3DGEC 3TEFA 3SEFA 5A4IS 4ZANA 4X6UA 2I4IA 5CC4A 4GU5A 5HIAA 1SH7A 2FDCA 4GX0A 3BWMA 3FHJA 2RDGA 1Y1VB 4D8XA 4F04A 2JJ2D 3HDQA 5AXDA 2REQB 1HH2P 2PUJA 3BKXA 1J25A 1VJDA 4V1CI 1NP7A 4NCKA 1CUZA 2FPOA 5IULC 1Y9AA 4MB6A 4GM4A 1ANKA 3QEKA 5H9WA 1V7CA 4NXNL 4KXVA 3WGGA 2V6JA 5AW5A 3DPIA 2OD7A 3T1OA 4AP9A 3TL2A 1UBLS 3L7OA 3CU7A 1KO5A 3N2IA 4Z4GA 3U7FB 1PYBA 4EGSA 5E1OA 2J48A 4AQYQ 1XROA 3WDNA 3VDXA 3NJRA 4PVCA 3O9MA 3ZHUA 1WIWA 4CQLB 4W1QA 3N52A 2CXPA 1S7CA 4TRMA 1V1PB 3AFGA 4O0AA 4JYAQ 1H8ED 1P3JA 2GBGA