2B2WC

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2wC00
3I3CA 2XIWA 2B2YA 2J7ZA 2K03A 4XT1B 2K01A 3Q6SA 1WTOA 1B2TA 1BO0A 1EOTA 1G91A 5JJZA 2B2WC 3MWYW 2KEEA 5CBAE 1G6ZA 1F2LA 5T1IA 1SAPA 1JICA 1HFNA 1WTXA 4LMQD 4U68A 1CA6A 3KBXA 1NAPA 2EOTA 1RODA 2H1EA 4O42A 5COYA 2DY7A 2N88A 1XYIA 3I91A 2KVMA 2NZ1D 4X3SA 1E0BA 3SVMA 3HP3A 4XDXA 1M8AA 5AFWA 4R8IA 1GUWA 2FINB 1RTOA 3D6WA 4CJ2C 1EIGA 4CJ1B 1AZPA 1ILPA 5E4WC 1PLFA 1TVXA 1QG7A 2L4NA 2RSOA 1LV9A 1XX8A 4NW2A 5E4XA 1WD0A 2B2UA 1BNZA 2B2TC 4OIJA 2D9UA 1DOMA 1DZ1A 1BBXC 1F9RA 4X3KA 1HA6A 1IKMA 4ZLTF 2L9HA 4IUUA 2NYZD 4IUPA 4OIKA 1O80A 2FFKB 5D65A 1EL0A 1PFMA 2RVLA 4CJ0B 2HUGA 3P7JA 5D14A 1A15A 4HAEA 3R93A 2HCIA 1MGSA 2X69A 4HEDA 1B4OA 1VMPA 1WTRA 1O7ZA 1ML0D 1WTWA 1DOKA 1NR2A 3F2UA 1WTQA 1EIHA 1WTPA 1EQTA 2B2VC 1AP0A 4ZK9B 4MHEA 1RTNA 3DEPA 1CM9A 4ZKCB 2K1BA 1RHPA 1DOLA 4QUCA 1J8IA 5EKIA 2X6LA 1WD1A 1DONA 1QE6A 2B2YC 4XT3B 2FHTA 1NR4A 5CBEE 1F9SA 1O7YA 3TZDA 5EPLA 1KNEA 2KECA 2IL8A 2L1BA 4RWSC 2Q8RE 3ONAB 3TN2A 2HCCA 2FJ2A 1B3AA 1KNAA 2L12A 4R9WA 2VXWA 3KUPA 4IURA 2KUMA 4HSVA 1F9QA 1Q3LA 2MGSA 2NWGA 4IUVA 3H91A 1JE4A 2RA4A 2RSNA 2SDFA 3FDTA 2JYOA 1U4MA 2BDNA 3GV6A 2FMMA 4RA8A 2B2WA 1QNKA 1S4ZA 2EPBA 5EJWA 2HDMA 1MI2A 2DY8A 2MJ8A 5EPJA 4DN4M 3LWEA 1B53A 2R3ZA 4ZKBB 2MPMA 2JP1A 2M2LA 3IFDA 1ICWA 1X3PA 4QUFA 1F9PA 1PFBA 1SSOA 2B2VA 1G2TA 1RJTA 2K28A 4HCSA 5T1GA 1U4LA 1ESRA 3GV3A 4IUTA 1ZXTA 4ZAIA 2L11A 1MSHA 4MN3A 5DNFA 2X6GA 2K05A 1HFGA 1PDQA 4UAIA 5CMDA 1U4RA 2B2TA 2N55A 1WVLA 1HRJA 3DEOA 1PFNA 1VMCA 1J9OA 3FPUB 3N52A 1WTVA 5CORA 4IUQA 3MTSA 3DM1A 4X3UA 2CVRA 1BF4A 2MP1A 1IL8A 1MSGA 1C8CA 3UI2A 3I8ZA 1SDFA 4X3TA 1CA5A 1X32A 5EQ0A 3G7LA 2HDLA 1ILQA 1AZQA 2B2UC 3IL8A 3I90A 1B50A 1G2SA 1U4PA 5EPKA 1HUNA 2EE1A 3QO2A 4RAUC 1HUMA 2K04A 1IKLA 2Q8TA 2KOLA 1X3QA 2KEDA 1HHVA 1NCVA
chains in the Genus database with same CATH superfamily
1B7YB 4KMUC 1UE5A 4XIGS 5FLXE 2EXZA 4DXGA 4BXXG 3PO2G 4ULLA 1Y8PB 1BBWA 4U68A 3CCMA 1ICFB 5J22A 2C35B 4CDFC 4JV5L 4OGQC 1XYIA 3MXNA 4LF9Q 1M8AA 4IOAA 2ICEC 2Z9HA 2PZWA 1VF5C 4PMCA 3NHHA 1Q8KA 4KKTA 1PV4A 3PF4A 1HNWL 3CU7A 2Z6KA 4K0KQ 1F9RA 1BVSA 4LK1C 4X66Q 1VQDA 4ME3A 2B3GA 1CUKA 1EL0A 1STYA 2NUCA 1HTPA 4Z9CB 2PO4A 2D62A 4B08A 1Y1VB 1FJGQ 2R7FA 5J39A 2E5LL 5IT9E 4YCVA 4QB4A 2JA5H 4RFBA 4DR1Q 5C44B 3HOUB 1BBUA 1CZGA 1K83B 4MTNA 4DV1L 1A3VA 4MTKA 4DR7L 2R92G 3SK5A 2OTLA 4RCOA 1O78A 3FKIH 2CKZB 4HSVA 3GTPB 1VQ4A 3J81L 1WFQA 4IUVA 2F1MA 3I2ZA 1BDOA 2EY5A 4XXEA 3J81c 4DV7Q 4HTHA 1O7LA 1S4ZA 4DK1A 2A69C 3VR5A 1I6HH 4DV3L 1JJCB 1GXDC 3IFDA 3SK8A 4A3GH 1RJTA 2IX0A 1B3QA 3HOVB 5M5YB 5C0XG 1WCMH 4OWTB 4DPGA 3EBEA 1EY8A 2AHOB 3SR1A 3BYYB 4DUZL 3C2PA 1HJPA 2H4OA 4UP8A 2CWPA 2VUMH 4PMBA 2C9OA 2BA1A 3NWTA 2PI2E 3KF8B 3G7LA 2UUBL 1ILQA 2WAQB 4WORA 3HOWB 1DGSA 1K8MA 2KOLA 5FO7B 1Q1BA 3AEVA 2Z1CA 1HQRD 2HQLA 2E2DC 4N9PA 4DR4Q 1E24A 1M4VA 1Y1VG 2LXJA 4OONA 5I2XA 4AQYL 2R93B 3CCRA 5JVG3 1LUZA 1WTXA 5C0XJ 1R9TH 3T51B 4DAYA 1NAPA 1KAAA 1RKNA 3NTIA 4FXDA 4DR2Q 5JEAG 2PI2A 3VR2A 3CC2A 4PZ6A 1CKMA 4BXXH 4JCVE 1I3QB 3E0JA 4OEMB 3VR6A 5EBDA 4Q0FA 4YY3L 1FGUA 4CJ1B 3G6JB 5E4WC 4WJWA 2BH2A 3SDZA 3G4SA 1C48A 1BXTA 3K0YA 2D9UA 2JA7H 1N36Q 2VZAA 5CV8A 1RD9D 4KY6A 1YNJD 1GUOA 2A1AA 4OIKA 2JA8B 3SK6A 3I73A 4K14A 1I4XA 2ZTEA 3MXNB 2IHFA 2K5HA 2QDLA 3AB9A 4HIMA 4DNIA 4XYOA 2JN4A 2YU9B 1CM9A 2B63B 3HOVG 3GTMB 5JEAJ 4X65Q 1O7YA 4B3TL 4FXGC 3NP8A 2IL8A 2Q8RE 1W3SA 2F0GA 2LS01 3QOLA 2NVQH 3NQIA 3TDQA 1LTBD 1XXGA 2VQEQ 1XMQL 5M3MH 3VYUA 2NVTH 2XRSD 2WAQG 1QNKA 2K5NA 3S17H 1GUGA 1Y69U 1B53A 3K57A 5ISRA 3KLSA 4V190 2EY2A 3WDNA 5IYBG 3ULJA 2NVXB 4K2LA 2NTSA 2A68D 1KLGD 3OTOQ 3D6CA 1EIFA 4KI0A 2KBNA 4DV2L 3E9HA 1PTOB 4KJNA 4B3RL 3URYA 4ALPA 1AW7A 1NSNS 2CVRA 1B8AA 4DK0A 1HNXL 4JI8Q 4DXFA 1IBML 4H44C 4X3TA 3ULLA 5K5PA 1MIUA 1X3FA 3T13A 1JB3A 5CV6A 1E2ZA 3J80i 1IKLA 2F0IA 4BY7B 4A3JB 3M7GA 4PG3A 1SNOA 3CMEA 1TWHB 2JA8G 2OTJA 4ILWA 3PUVA 2KUMA 3M4YA 4P71A 2JA6B 1CFMA 2UUAQ 2K03A 1EY7A 2B2WC 4NXMQ 2KCMA 2K4KA 4HJ8A 1H9MA 1QZGA 1LTAD 4R4CA 1HPCA 2BH8A 2JE6I 4PZ8A 3X3NA 4OX9Q 4HJAA 1I5FA 2AMCB 3PUZA 1VQLA 2PNRC 4JVZA 4HCEA 1VS0A 4HMJA 5NUCA 2KVMA 5CV5A 1OO9B 2E75C 4GOPA 4XDXA 5AFWA 2UU9Q 1A2UA 1RTOA 3FEWX 4LFBQ 2ICIA 1SYGA 5E4XA 1MBYA 2XN9C 4L5SA 3QIAA 5LMUQ 4OIJA 4LAAA 3S1MB 2CFMA 4ZUJA 4DNRB 2FFKB 4KJOA 1STEA 4KLKA 1SLJA 4HAEA 3V05A 3ZJYC 4PNYA 3K6OA 3NQTA 3EA6A 3CCUA 2XTIA 5L37A 1TS2A 3B6YA 2F0TA 2F0UA 1RTNA 5LMNQ 3JAMi 1S5FD 1TS5A 1F9SA 4EQOA 1LABA 1KQSA 5J1ZA 3D4DA 3PUYA 1PH6A 1FNVA 3AYHB 3CHBD 3KUPA 3NBHB 5IYDH 5C3WA 4P74A 3QR8A 3GQBA 1Y8OB 5C3EB 3IKJA 2IT1A 5GAHC 4BY7G 4RKBA 2MPMA 5ELNA 4ID6A 4MIUA 3PGZA 1V43A 2PZTA 2JA6G 1UUPA 1N8RC 2IPKD 5EKLA 1XNRL 3VA7A 4HCSA 5T1GA 5ELDA 5FO8B 5KYLA 1K8AC 2WINB 4OWXB 4RH6A 1H9KA 2K05A 3T56B 1QILA 1KXLA 4IJLA 1HRJA 1CKOA 4IQZA 1J9OA 1LT4D 4LFAQ 3FRPB 2LSSA 4C1NK 3FMCA 4KKSA 3EFXD 4ODGA 1SYDA 1D1IA 2B2UC 3CC4A 5EPKA 1EY4A 1VQCA 3NK9A 3S1RB 1L0XB 1E22A 1UE1A 3EN2A 1GJXA 4IZ8A 1VDZA 1MHWC 4KY5A 2CH4W 3J81i 1G51A 1JC7A 1F2LA 2ATWA 4IALA 3TSSA 4DGZA 3K81C 1HNZL 1B70B 5I6YA 3CCEA 1FYCA 4RHRA 5LMNW 2G9DA 4X3SA 1G291 4IFDG 4JI7Q 2IY5B 3CQZB 2WKCA 1TS3A 1PFSA 4JI4L 4POGA 1TVXA 2MUYA 1QUQB 4A3EB 3C3LA 1DOMA 3G48A 4ZLTF 4DR6L 1VQJA 1HZ9A 1HQMC 4FNFA 1Y1WB 5JJIA 2F0JA 3UE1A 1SNDA 1JJ2A 3U4ZA 3RNUA 1EEFD 1F77A 2HIVA 3A7AB 1BOSA 4K5WA 2UXBL 2E2IB 2PZUA 3F2UA 4U673 1EYDA 4WJ3M 3W1BA 4ZK9B 2PW7A 1EU3A 2GA4B 4A3DH 4DR3Q 1DONA 2FHTA 3T1HL 1SYBA 2GN5A 3IRBA 4JBJA 4O2DA 2HQEA 4IJHA 5ELCA 4F87A 5LHY1 5FLMG 4IFDJ 1QOHA 5JOBA 2ZJPA 5C5MA 3MVVA 3Q23A 2SNMA 1OXTA 1VQKA 1E7ZA 3GTLH 1LTID 5BN3A 1I4HA 2TSSA 5FOBB 4DV0L 1LTLA 1MI2A 5CGKA 1YNXA 1ENFA 1D6EC 3MXGA 2A6HC 3DWPA 1X3PA 4LF7Q 5HGTA 3GTJH 3A54A 1LM0A 4AIMA 4L6TB 3HOZH 2KHIA 1U4LA 2Q2TA 4LF5Q 1N9WA 1A63A 4KD3A 5F2DA 1JWSD 4YCUA 1EFWA 1DYQA 4DU9A 4JI3Q 1GHKA 2HIXA 3BYTB 2WFWA 2EYHA 3A56A 5CYUA 4FO2A 1PH1A 2EIFA 1NNXA 2JA5B 2A74C 4KY7A 1N34L 4A3EG 5IE8A 1HUNA 1PRTC 1I6VC 1GHJA 1HZAA 1M1KC 5IYCG 1YHBA 4RGTA 2JXMB 1Y1WG 3ND9A 4A3CG 1EYAA 1C4QA 1PRTB 3DHQA 4XT1B 4CKCA 5FJ8G 2EY6A 2ZM6L 2IX1A 1B2TA 3CMAA 2OXPA 4LF8Q 1CHPD 2KEEA 3FKIB 3HGBA 3MWYW 3KJPA 2XSCA 4LUOA 4KN7C 1S5DD 1Q81C 4ZUIA 2PPBC 2VB2X 4CBVA 3I91A 1I6HB 3QWNA 1GUWA 4RGNA 3RZOH 4H7BA 4K5VA 4A3GB 1JCKB 4AH6A 3G71A 1VQ5A 2B2TC 5GAGC 1KDBA 5C4JH 2F0DA 3KK7A 1PH3A 4GKKQ 1IZ6A 1WCMB 1JOKA 2J4XA 2K32A 1EFID 1VQ7A 5D65A 1IYJB 1K0SA 3DM3A 4QMGA 5IP7H 3S2HH 2VUMB 4APVA 4BBRH 1PH8A 4YWMA 1UE7A 4X62L 4G7HC 3GTGH 4LUZA 1EWCA 4KHVA 2RCFA 3KFUA 3X3MA 4NDXA 3H3VH 5GADC 3CXCA 3PUXA 1JE5A 1IYVA 3RZDH 3UE0A 5IWAQ 3STBD 3F2CA 2EY1A 2VXWA 3HKZE 3NTKA 1TWCH 1SJED 1F2ZA 1CK1A 1CSQA 2SNSA 2F0SA 4B3SL 1HH2P 1R9TB 5EJWA 1X54A 2LFNA 1KRSA 3BDLA 4C56C 5HGQA 5IIFA 1SSOA 4A4IA 5AJ3Q 4DFAA 3D3RA 3CPWA 2I5HA 3FKIG 2QDBA 3J80L 1Q7YC 1V9PA 1ZXTA 4J15A 3J80c 1KC8C 2DNCA 4LF9L 1PMRA 1UAPA 3K7UC 1OXXK 3BVGA 4FXKC 5H1SE 3HG9A 1XTCD 1MSGA 4K0KL 3UI2A 5TSSA 1IHZA 3RLFA 4X66L 4JOIC 5DEHA 4F8MA 2F4VQ 1WCMG 4G7OC 4RAUC 4P75A 1IBLQ 1KD1C 3I4MG 4IFDI 3OIQA 2F0PA 1BCPB 1TWAH 1NCVA 4GNXC 3M85A 1EEID 1FJGL 1SE2A 1N33Q 2K01A 2NVQB 3DUZA 2VUMG 2LMCB 4DR1L 5KGUA 4QIWE 4A3CH 2R92B 1HFNA 4JI6Q 3PV0A 2E2JH 4K6DA 2NVTB 4EGVA 3SHLA 4DUYQ 1EYGA 1MJEA 3S17B 2B39A 3SVMA 3KLRA 3H0GG 1SROA 5M5XH 4KHPL 1PLFA 3W1GA 4DV7L 1V1PA 3VDYA 5BN5A 3JAML 2ES2A 4KV6A 3JAMc 1EY5A 4IUUA 2IX3A 1O80A 1E1TA 3HRZC 2VQFQ 4NB3A 2F0LA 2RVLA 3BU2A 1YHAA 1Q12A 1SJHD 3J81E 3S2DH 5EKKA 2NBFA 3G6EA 2FMCA 1AP0A 1U9RA 1FNWA 2K1BA 4CDEC 4AYBB 1E2WA 1E2VA 4EQPA 3K80C 2JA7G 3EIVA 4JBKA 3T1YQ 1UEAB 3J7AV 1XNQQ 2DN8A 1A0IA 2F0MA 1KHIA 3VYTA 3RMHA 2O4XA 4JK1C 3PIOA 3MHBA 4QF4A 2ZXRA 2WKDA 5FO9B 4UY8C 3M7NA 1QNUA 1X9NA 3TRZA 3PUWA 1I4PA 4IN3A 4ZKBB 4DR4L 4DR5Q 4C2MB 4RG1A 4A3FH 4KN4C 1SXTA 2XRQD 3EROA 2I46A 4L5QA 4DR2L 1Q8IA 2KJXA 3BJUA 5M3MG 4UAIA 2N55A 1E1OA 2ZXOA 2EJMA 3DM1A 4X6AH 2MHVA 4A75A 1S5ED 3DWQA 1N36L 4CDCC 2HDLA 2UUCQ 1TU2B 1H9SB 1KTKA 3VYRA 4JBWA 1ET9A 1Q46A 2OWOA 1HR0Q 1ASYA 3I4MH 1LTGD 1ZYRD 1HZCA 1YI2A 1A2TA 1IYUA 2MQHA 4QQBX 1JOOA 4JI1Q 2SEBD 2JJQA 3H94A 1GUTA 1TWGH 4DAPA 1CA6A 1I4GA 4X65L 4HN7A 3GD7A 4YWKA 1YITA 4AYBG 1EWIA 3KF6A 1JJGA 3MFYA 2WB1E 3OMCA 1EZ8A 1ZEQX 2CHBD 3HP3A 1KIXA 1UWVA 5A2QL 2VQEL 4GN4B 3WOEA 2OEOA 1XX8A 1ET6A 3NUCA 4NW2A 3FHWA 4FF3A 4JV5Q 3F8TA 3H0GH 1G8ZD 4IO9A 4X64L 4P2CB 1D5ZC 1K0RA 1NTGA 2DNEA 1B1ZA 5LL6S 4CKEA 1A15A 1G6PA 2D0OA 5IP9G 3QG1A 1HA5A 1KRTA 2L55A 3A55A 4C3HH 3TZUA 1YBYA 4B9XA 3RR5A 4TKOB 2X6LA 3J7AF 4TSSA 3OPOA 3H15A 2MO0A 3TZDA 1CT1D 2IJ0A 5C3XA 4JI8L 5C6AA 4R4QA 1GOZA 1I94Q 2UXDL 1AH9A 2K7VA 2PMZE 1F2MA 4FP5D 2SDFA 2XWJB 4M1UB 2UXCQ 2ALYB 1PH4A 5IOCA 1HTLD 5CV7A 2EPBA 3T16A 2Z4IA 3H09A 2G5DA 2AKWB 2UUAL 4ZYSA 4DK3C 1K73C 1PFBA 2F0NA 2DJGC 3CRKC 1HR0W 4OX9L 1W6JA 4UP7A 3GTKH 2YTYA 3E5SA 1WOCA 3E9IA 1AEXA 2BOSA 5IYDG 2UU9L 1LACA 1TY2A 3HOXH 4WFN3 2MO1A 4LFBL 1EY0A 1VMCA 2LKVA 1XTDA 4DV6Q 3M3YH 1Y8NB 4CDDC 5LMUL 5C5LA 4GLXA 1C8CA 1EYCA 1C7YA 5EQ0A 3W3AA 2E76C 5M5WH 4A3DB 1L1OA 3HZXA 3QO2A 1I4QA 1JT8A 4Q5VA 2XNAC 2ZT9C 1PH2A 1X6OA 2GVAA 1WTOA 1EOTA 5IY0A 3D4RA 1PTOC 3S14B 1VQGA 2CQAA 3GTLB 5IGEA 5LMNL 3A5UA 4QL5A 3RN2A 4R4TA 2DY7A 4PV1C 3CCLA 2WIIB 3KDFA 4K8JA 1Z6HA 1ILPA 5I4DA 1FGBD 2K50A 1GVPA 3GTJB 5E1FA 1RL2A 3CPFA 4G7ZC 2B2UA 3M9BA 3HOZB 4GS3A 2Z6BA 4Y7NH 4BBSH 2OF1A 1IXRA 1KAWA 3S1NH 2RKSA 4IUNA 4YY3Q 5CC4A 3RD4A 4C3JH 1NMGA 3KF6B 2HCIA 4HEDA 2D2CC 4DV5Q 1VQNA 3S16B 1S5CD 1Z47A 1C9OA 2BA0A 3U9SA 4ZKCB 5IP9H 1DOLA 4QUCA 1BR9A 2Q2UA 1Q1EA 1WD1A 4GKJQ 2F0FA 4XT3B 4JI2Q 5EPLA 3MA2B 4LWCA 5GROA 1Y14B 4BA2I 4L63B 1I4RA 5GAEC 4Y52H 4DAYB 4B3TQ 2WB1B 2BDNA 1OXSC 1TY0A 3BVMA 4A3DG 1AE3A 3L2PA 4DN4M 5KNDA 2R3ZA 5C44H 1GO3E 2M2LA 3HOUH 3RZOB 5C4XG 2JEBI 3ER0A 2CCZA 1G2TA 5C4JB 3GV3A 1YNNC 2WP8J 4S3SA 5BR8L 5CMDA 3HS0C 1U4RA 4BY1G 1SNQA 4JI7L 3I4NG 1EZ6A 3ND8A 3R2TA 3S2HB 2CW0C 4BBRB 3PQIA 2MP1A 3GTGB 2EZVA 1B50A 3HOZG 1PZJD 4EVOA 3EJIA 2K04A 4B3RQ 2XVSA 2Y0SE 5ELOA 1QZHA 1IBMQ 1A62A 3I3CA 2XIWA 3Q22A 3RZDB 1X65A 1D2BA 1I50H 2A19A 2F0HA 1TWCB 2LXKA 1PYBA 1TR5A 3KBGA 1JICA 3K0XA 3HEJA 2I5MX 2PYKA 1P8LA 3D4WA 2AWNA 3OIPA 2N88A 5KNCA 2KQ3A 3NBIA 1L1OB 1PTOF 3HOWH 2FINB 3RN5A 1EIGA 1TKWB 1B9MA 4IPCA 3Q0AA 1LV9A 2A6HD 3IAYA 3T53B 2F52A 2NYZD 2WB1G 4IUPA 3CD6A 4WJ4A 2O2LD 4R1JA 4XQQA 3C1FA 3DWAA 1Q90A 3GP7A 3L7ZC 1QB5D 3KDFB 2K14A 3AMUA 4JI3L 2R7DA 1RHPA 5K36H 1GUSA 2ID0A 3TP7A 3U9OA 4XYQA 1TWAB 3TN2A 3ONAB 4JG2A 4MZ9A 3OWEB 3JC66 1J5EQ 3FP9A 5IP7G 5D3DA 4BBRG 1S3OA 1JORA 1XJVA 2K33A 1JMCA 3H91A 4GOPC 1U4MA 2N8NA 1EUJA 1X55A 1SYCA 5EPJA 2MJ8A 4GOPB 4GN3B 2F0EA 2B63H 1K28A 2L0CA 4LNQA 2V1CC 4QUFA 1KL9A 3SGIA 1Z7TA 5M5XB 3VYSA 3WOFA 1II3A 2F3WA 2QA4A 2K6AA 4ZAIA 3K8AA 5C4XH 1EIYB 3S1QH 5CV9A 1LTSD 1K8OA 3D31A 2GVBA 2EYJA 4QGUA 2BE5D 5CORA 2KCTA 1OTCA 1SMYC 4O1NA 3NE5B 1DXMA 4BY1H 3S2DB 3I4NH 1CA5A 3IL8A 4A3BH 1G2SA 1VQEA 2NN6H 4PZ7A 4LF4Q 2Q8TA 5D3IB 1ESFA 5KEEA 1ASZA 2F3VA 1NY4A 1IW7C 2ENBA 2F4IA 2B2YA 1LT6D 4P73A 5JVH3 1BO0A 3MZ5A 4PMWA 4HIKA 4A76A 2A8VA 2B8FA 2OQKA 3GTOH 1SR3A 1SYFA 4LMQD 1OXUA 3KBXA 5IGGA 3HOYH 1S72A 5IODA 2IHEA 1LTRD 5IWAL 4KKUA 2QKIC 5FKAC 3A7LA 3BZCA 3FVQA 1EQVA 4A3FB 1PH9A 1PZID 1R4PB 2L4NA 2EYOA 2EDGA 3M4OH 1PH7A 3KOJA 2CWAA 5IGBA 4IOCA 3E6ZX 1K3RA 1A6XA 1NE3A 4JI4Q 1UNSA 2BDOA 3F2BA 4YCWA 3MEFA 3K59A 4YHHQ 1WTRA 1IL2A 2JQOA 4LFCL 1N32L 2B2VC 1YJNA 2F03A 2IWHA 3L0OA 1TQOA 1CTMA 2VB3X 1UE6A 3M4PA 3NWSA 3GTQH 1K9MC 1VQ9A 1LT3D 2HHHQ 3K7AH 1YVCA 1VF7A 1Z9FA 2ASBA 1EWHA 3R3OA 3LWUA 4WRDA 3PIP3 1BUVT 3I4MB 3LX0A 3J80E 1SRUA 2F4VL 1Q3LA 2MGSA 4TVAB 2RA4A 1T5EA 1TWGB 3HKSA 4LF6L 1OXVA 2DGYA 4DNTB 1PYWD 2NN6I 2A6EC 1L0YB 1LTTD 1ICWA 3PMFA 2RHSB 2AWOA 4HJ5A 3V96A 4H0LC 1GKHA 2EYMA 4J1MA 4DV0Q 4JI6L 2HD3A 3VA5A 3ERQA 3H0GB 5DNFA 4DUYL 1XMOQ 3P20A 4A3LG 1WVLA 1PFNA 3BG3A 4A3IH 1BQQT 1QWYA 3PSIA 5I6WA 5JJLA 4A3KH 4A93H 4IUQA 3MTSA 2F0KA 1BF4A 5C3EH 4JI0L 4A3FG 5CV4A 4C3HB 5CR3A 1AE2A 1D5MC 2KCCA 2VQFL 1U4PA 3A0JA 1ZKOA 3QOJA 4NPSA 4UPAA 2KEDA 2EYLA 1N34Q 2ZJQA 2JA7B 4NP5A 5EBCA 1CI3M 3JAME 2E2HH 4H02A 1YZ6A 3TBIB 1D8LA 4NXNQ 2RDFA 3GDEA 3T1YL 4RKLA 4RGMA 2E74C 4HIOA 4F7XA 2ZM6Q 2QCPX 3DMUA 1A8VA 3NPPA 4YIJA 2XWBB 2I07B 1NJIC 1DJRD 4LJZC 1BCPC 1PYSB 1SNPA 2WAQE 5EAYA 1WD0A 1DD2A 3E3XA 1KDCA 4BS9A 2Q2IA 1K8GA 3GTKB 4J6HA 2E8GA 1RIPA 4X3KA 1HA6A 3BZKA 1YJWA 3CCQA 3J7ZC 2XGTA 4B3MQ 3S15H 4FYDA 4FVMA 4ME5A 1PFMA 3HOXB 1PRTF 3R93A 1HZBA 5M3MB 5KNBA 1O7ZA 2EVBA 1DOKA 1SMXA 3KF8A 5M5WB 4JI5Q 3H3VI 2TMPA 2ZTDA 2A69D 2Z4HA 4HMIA 4DV4Q 3WWVA 3NXWA 4X62Q 4CKBA 4IPDA 2L1BA 4RWSC 1WYDA 2NVYH 1VQBA 5KYIA 3PF5A 4QCLA 1PH5A 4POFA 4IPGA 4C3HG 3K5OA 2F3IA 2M00A 2OQ0A 2K5QA 3U50C 1HR0L 2JP1A 2K5WA 1RDPD 3W2DA 4A3MG 1F9PA 4V0BA 4E6IA 4B3SQ 4C3IH 2YYZA 3TS2A 4BBSB 4Y7NB 5FK9C 3DXJC 3BS1A 3S1NB 1FD7D 1PDQA 2NZOA 3F1ZA 4HJ7A 2KCNA 1T9HA 3OW2A 4C3JB 3NTHA 1SEBD 4X3UA 4A3LH 2P5ZX 1IL8A 1XWEA 1TS4A 3I8ZA 3I90A 1TT2A 1FR3A 4JYAQ 1H9RA 2EQSA 3MFGA 3I4LA 2R7ZH 3RUZA 1IBKQ 5A2QE 3HOXG 4KK7A 3K5LA 5M3FH 2AUJD 3Q6SA 4DA2A 3CP0A 4JC0A 3HFZB 4HJ9A 2I5LX 3I55A 4QY7A 1VQOA 5COYA 5G3LF 2PW5A 3OW7A 3IFTA 1I94L 1SN8A 3D6WA 2RSOA 3UDIA 1QVGA 2KA7A 2UXCL 1STAA 2N49A 2PCFB 4N8X1 3HKZB 5FLXL 1IKMA 2L9HA 1TIID 4KD4A 5FLXc 1EOVA 3CRLC 1SBBB 2V4DA 2DJFC 1BCPF 4KHPQ 3P7JA 1VQAA 4R4IA 1YHQA 3R2IA 1LO5D 3CCJA 3K58A 1ONLA 2R6GA 1WTWA 2JEAI 1NR2A 1XPOA 1D5XC 1TWFH 2VS1A 1CKNA 4BBSG 5EKIA 4RMFA 1VQMA 4C1NI 4DV6L 1KNEA 2KECA 4FF4A 1SE3A 2RHQB 1MD2D 3RLOA 1CQVA 2FJ2A 4P72A 4C3JG 5I9PA 2FXQA 1I50B 4IURA 1SE4A 5JAVA 1PXUA 2NWGA 2L15A 1FL0A 3FDTA 3OWFA 5IT9L 1QCBD 1HNWQ 1PTOD 5IT9c 2B2WA 1A3TA 2L5TA 4OO1G 1YEZA 3OTOL 4GN5A 1EQQA 3MC0B 1V1PB 3SXHA 3K5MA 2YV5A 2PQAA 1ESRA 4IUTA 2L11A 1MSHA 4A3MH 1XPRA 3PO3H 2E5LQ 4QIWB 5JPMC 1NUCA 1P16A 4OXPA 4DV1Q 2EJGC 5C44G 4JBMA 4DR7Q 3HOUG 2RQXA 2F0WA 3PO2H 3BZDB 2EYPA 3EVQA 2Z6KC 2Z8LA 2K5VA 3HKZG 4NXML 1MKHA 1RCVD 3T4AC 1U5KA 5JPNC 2O5JC 1X3QA 1AFPA 2PNHA 3CC7A 1H9JA 2CH4A 3MEHA 5C4HA 4DV5L 3ZYYX 4I65A 4DV3Q 1VQHA 1D7QA 5CBAE 1G6ZA 1VQIA 5T1IA 1NBWA 1EY6A 5DM73 4GKJL 4JI2L 2JK8A 3NBHA 3M4QA 1RF2D 1LLRD 2NZ1D 1E0BA 1EY9A 5IGDA 4DUZQ 4CJ2C 4GLVB 2CQOA 4YWLA 1QG7A 3ULPA 1ZYRC 1VQPA 4ZCKA 3EQLC 5HURA 4HIDA 2AQ2B 5JJKA 4FDBA 5HY6A 3S1QB 5C4XB 3TS0A 2WACA 1XPUA 5ELBA 2UUBQ 3N6RA 5IGCA 1YNND 2R92H 4ZRZA 2D0PA 4EX5A 3HOWG 1B4OA 4G57A 1SFOH 1QVFA 1ML0D 4BY1B 5DLQE 3I4NB 1H95A 1QJOA 4X64Q 2CW0D 4MHEA 4AQYQ 4A3BB 3CCVA 5LL6X 4IPHA 4UHVA 5KRUA 2R93G 3OHXC 4JPBW 2L12A 3NENA 4B9WA 3TEHB 5C0XH 1JE4A 2RSNA 3GTOB 2AQ3B 1JQYD 3MXUA 3J7YW 1FVIA 4EQNA 3HOYB 3TP8A 1GM5A 2N3SA 4BWGB 1YIJA 2DY8A 1V8QA 4HSPA 3CKIB 1CKNB 3ICEA 2UXDQ 5K36G 3Q8DA 4DAVA 2B8GA 4OO1H 1YNJC 3U4VA 1JR0D 4LFAL 1S5BD 3CW2C 3M4OB 1DCZA 1QUQA 4I7ZC 4L5RC 4MN3A 2X6GA 1HFGA 1CZWA 4M8AA 3L9AX 4LUVA 3PIO3 3A5ZB 3TMEA 1U0LA 2BCOA 3DEOA 3N52A 2JSOA 5IGFA 3ERSX 4UP9A 2B63G 3OSOA 1Y1VH 1SE8A 1V1OA 1SDFA 3TP5A 2B29A 4C2MH 1STHA 5JEAH 1XMQQ 2EE1A 3GTQB 2PQAB 1K83H 4MNOA 4FF1A 3TQYA 1LYLA 3K7AB 3OYYA 4J8QA 4TQUS 1VQ8A 1CSPA 2VY3A 3P1HA 1G91A 4K5XA 5JJZA 2QILA 3GTPH 3PIPA 2KHJA 5GQOA 2ZJRA 3KYHC 1WTHA 3AFQA 3I72A 4L5TA 4A3BG 2NN6G 3SK4A 3C46A 1J5EL 4O0AA 4R8IA 3H3VC 4GZYC 3CCSA 1AZPA 2A68C 4DV2Q 1L0WA 4N8FA 1VCIA 1HXYD 1BNZA 4FF2A 4OELB 3SE0A 3HOVH 5M5YH 1HNXQ 1BBXC 5C0XI 4K6LA 2PMZB 3HOYG 2J0TD 2KENA 4QJFA 2VNUD 1NMFA 4A3IB 4DR3L 4A3KB 4A93B 1L1OC 3C1EA 2K5DA 4BA1I 4A3JG 1SMYD 4K8IA 4XQJA 4XQNA 1J6QA 4OO1I 2RBMA 1QE6A 3SEBA 5CBEE 2SOBA 4H13C 5IYBH 3I7FA 4F88A 3A8IE 1B3AA 1X3EA 2EJFC 1KDAA 2Q2HA 1JWUD 5EGTA 2E2HB 1F9QA 1IW7D 4LF4L 2R93H 4CGYB 4LF7L 3GV6A 4OWWB 2FMMA 4RA8A 3OOCA 2I0QA 3MAQA 4LF5L 4GLAC 3GO5A 2OCEA 1I3QH 2F0VA 2JA9A 3S24A 1SNCA 2B2VA 1EU4A 4L8JA 5ELFA 2LY7A 2H5XA 1PRTD 3ITPA 2JA8H 3S15B 2B2TA 4LW1A 4NMZA 1S40A 1WTVA 2EYFA 1PA6A 2E2JB 5C4ZA 1CHQD 5BR8Q 2QF7A 5J3BA 1GD7A 2YU9H 1SYEA 1AZQA 3GTMH 4DAMA 2HT1A 2ZXPA 4LF8L 1W6KA 4KTAA 2IW3A 2AQ1B 3E0EA 1YJ9A 3V2TA 4YHHL 1HHVA 2QEXA 4A3IG 4R4OA 2NVYB 2Z0SA 1HCZA 4A3KG 4A93G 4CHTB 3TP6A 2RCNA 5C3EG 1M90C 1XNRQ 3NEMA 3AFPA 2HHHL 1SNMA 2EOTA 1ENCA 3H6MA 2H1EA 4O42A 5I2YA 4GKKL 1X3GA 1V1QA 3AU7A 3I56A 2DUDA 5M9OA 2AUKA 2NB0A 3A8JE 4C3IB 2NVXH 2A6ED 1KLUD 1JWMD 1D1KA 3Q24A 3S14H 4R8NA 5D14A 1PTOH 2NZHA 1MJCA 3D0FA 1QVCA 3O13A 1WTPA 1EQTA 1XMOL 2MNAA 1TXYA 2D5DA 3PCOB 3BDOA 4A3JH 2QGQA 1HNZQ 2QW7A 1F2YA 1O7IA 1TWHH 4JOIA 4BY7H 3LNNA 2R7ZB 4PQXA 2JA6H 2HCCA 3K5NA 1KNAA 4EQ5A 5M3FB 4R9WA 3W5OA 3RLNA 3I70A 2A73B 4GNXA 5G3LD 3R8BA 2JYOA 1VQFA 5AJ3L 1W2BA 3S16H 2WV6D 2OT2A 4OHJA 4DR6Q 3LWEA 4DF7A 1STBA 5KIXA 4DKAC 2Y0SB 3L3OC 4NXNL 4TRDA 4AYBE 2K28A 2C5CA 2UXBQ 3KJOA 1BCPD 4KHZA 1C0AA 3AQQA 1AN8A 3S1MH 1PHJA 1CQFA 2K52A 4HR7B 3KLWA 3LGJA 3UDXA 4ZQ3A 2K75A 3FPUB 1EQRA 3T1HQ 4N9TA 1IBLL 3J81j 2MFIA 2RF4A 1X32A 1Q86C 4C3IG 1N33L 4B3ML 1TWFB 3A8KE 2VW9A 1GUNA 1HUMA 2A5HA 4IFDH 1STGA 2N78A 1WTQA 1UEBA 2BE5C 1A3UA 4I7AA 2J7ZA 1PZKD 1FNUA 4JI5L 1WJJA 1SAPA 4DV4L 2R61A 2F0OA 4JW0A 2RDGA 1RODA 1ENAA 3U58A 2Q8IB 3UDFA 3CAMA 3CF5A 4G4KA 2R7ZG 1T5XD 2QEJC 4RHSA 3F2DA 1BKBA 5M3FG 3VR3A 3I4OA 1K3BC 5E7NA 4XTCS 1B44D 1DZ1A 2KHSA 4A3MB 1VQ6A 3PO3B 5DM63 1LT5D 5FLMH 3P75A 4CJ0B 2HUGA 3BDCA 2JA5G 1MGSA 3QB3A 2X69A 1VMPA 2Y0SG 1L2FA 1XNQL 3PO2B 5E3FA 1EIHA 5DAUA 3DEPA 1PVOA 1J8IA 2YTXA 1H9SA 3S1RH 2B2YC 3DLLA 1NR4A 4LFCQ 1N32Q 4UDUC 5A35A 2RDHA 3TREA 3NELA 5I9OA 4DR5L 1DM0B 1WI5A 2F0QA 4JYAL 3M3YB 4A3GG 1E3PA 1JB7A 5ELEA 2HDMA 1IBKL 3D8GA 3J7A5 1JOQA 4RGOS 1X56A 3FPPA 3CQZH 1STNA 3KLSX 3UDGA 4LF6Q 4K2KA 4ABNA 4A3EH 1KABA 2EXDA 2M9VA 2G9HD 3OMGA 5BN4A 2PQEA 2YTVA 3A74A 5IYCH 4GNXB 4RCNA 1Y1WH 2UUCL 2VL6A 4OL7A 3QJYA 5FJ8H 3NSWA 1B9NA 3S9WA 1SFOB 3BVZA 2E2IH 2O5IC 2NTTA 2ZTCA 3MXPA 4DK6C 1R4QB 1Q82C 3VR4A 3PO3G 4JI1L 4NKLA 3STBC 4JI0Q
chains in the Genus database with same CATH topology
4KMUC 4XIGS 5FLXE 2EXZA 4DXGA 4ULLA 1Y8PB 4U68A 5J22A 4OGQC 1XYIA 3MXNA 1M8AA 2ICEC 2PZWA 1VF5C 4PMCA 3NHHA 4KKTA 3CU7A 1F9RA 4LK1C 1EL0A 1STYA 2NUCA 1HTPA 4Z9CB 2PO4A 2D62A 4B08A 1Y1VB 5J39A 5IT9E 4QB4A 4RFBA 5C44B 3HOUB 1CZGA 1K83B 1A3VA 3SK5A 4RCOA 1O78A 4HSVA 3GTPB 3J81L 4IUVA 2F1MA 1BDOA 2EY5A 4XXEA 4HTHA 1O7LA 1S4ZA 4DK1A 2A69C 3VR5A 1GXDC 3IFDA 3SK8A 1RJTA 2IX0A 3HOVB 5M5YB 5C0XG 1EY8A 3SR1A 3BYYB 3C2PA 2H4OA 4PMBA 2C9OA 2BA1A 3NWTA 3G7LA 1ILQA 2WAQB 4WORA 3HOWB 1K8MA 2KOLA 5FO7B 1Q1BA 2Z1CA 1HQRD 2E2DC 4N9PA 1M4VA 5I2XA 2R93B 5JVG3 1WTXA 5C0XJ 3T51B 4DAYA 1NAPA 1KAAA 1RKNA 3NTIA 4FXDA 5JEAG 3VR2A 1I3QB 3E0JA 3VR6A 5EBDA 4Q0FA 4CJ1B 3G6JB 5E4WC 4WJWA 3SDZA 1C48A 1BXTA 3K0YA 2D9UA 5CV8A 1RD9D 4KY6A 1YNJD 1GUOA 4OIKA 2JA8B 3SK6A 3I73A 4K14A 1I4XA 3AB9A 4XYOA 2YU9B 1CM9A 2B63B 3GTMB 5JEAJ 1O7YA 4FXGC 3NP8A 2IL8A 2Q8RE 2F0GA 2LS01 3QOLA 3NQIA 3TDQA 1LTBD 1XXGA 3VYUA 2XRSD 1QNKA 1GUGA 1Y69U 1B53A 3K57A 5ISRA 3KLSA 4V190 2EY2A 3WDNA 2NVXB 4K2LA 2NTSA 2A68D 1KLGD 3D6CA 4KI0A 1PTOB 4KJNA 3URYA 1AW7A 1NSNS 2CVRA 4DK0A 4DXFA 4H44C 4X3TA 5K5PA 3T13A 1JB3A 5CV6A 1E2ZA 1IKLA 2F0IA 4BY7B 4A3JB 3M7GA 1SNOA 1TWHB 4ILWA 3PUVA 2KUMA 3M4YA 2JA6B 1CFMA 2K03A 1EY7A 2B2WC 1H9MA 1LTAD 1HPCA 2JE6I 3X3NA 3PUZA 2PNRC 4HCEA 4HMJA 5NUCA 2KVMA 5CV5A 1OO9B 2E75C 4XDXA 5AFWA 1A2UA 1RTOA 3FEWX 2ICIA 1SYGA 5E4XA 1MBYA 2XN9C 3QIAA 4OIJA 4LAAA 3S1MB 4ZUJA 4DNRB 2FFKB 4KJOA 1STEA 4HAEA 3V05A 4PNYA 3K6OA 3NQTA 3EA6A 1TS2A 2F0TA 2F0UA 1RTNA 1S5FD 1TS5A 1F9SA 4EQOA 1LABA 5J1ZA 3D4DA 3PUYA 1FNVA 3CHBD 3KUPA 5C3WA 3GQBA 1Y8OB 5C3EB 3IKJA 2IT1A 4RKBA 2MPMA 4ID6A 4MIUA 1V43A 2PZTA 1UUPA 2IPKD 5EKLA 3VA7A 4HCSA 5T1GA 5ELDA 5FO8B 5KYLA 2WINB 4RH6A 1H9KA 2K05A 3T56B 1QILA 1HRJA 4IQZA 1J9OA 1LT4D 3FRPB 4C1NK 3FMCA 4KKSA 3EFXD 4ODGA 1SYDA 1D1IA 2B2UC 5EPKA 1EY4A 3NK9A 3S1RB 1L0XB 1GJXA 4IZ8A 1VDZA 4KY5A 1JC7A 1F2LA 4IALA 3TSSA 4DGZA 5I6YA 1FYCA 4RHRA 2G9DA 4X3SA 1G291 4IFDG 3CQZB 2WKCA 1TS3A 1TVXA 2MUYA 4A3EB 3C3LA 1DOMA 4ZLTF 1HQMC 4FNFA 1Y1WB 2F0JA 1SNDA 1EEFD 1F77A 3A7AB 4K5WA 1BOSA 2E2IB 2PZUA 3F2UA 4U673 1EYDA 4ZK9B 2PW7A 1EU3A 2GA4B 1DONA 2FHTA 1SYBA 4F87A 5ELCA 2HQEA 5LHY1 4IFDJ 1QOHA 5JOBA 5C5MA 3MVVA 3Q23A 2SNMA 1OXTA 1LTID 5BN3A 1I4HA 2TSSA 5FOBB 1MI2A 5CGKA 1ENFA 1D6EC 3MXGA 2A6HC 3DWPA 1X3PA 5HGTA 3A54A 4L6TB 1U4LA 4KD3A 5F2DA 1JWSD 1DYQA 4DU9A 1GHKA 3BYTB 2EYHA 3A56A 5CYUA 4FO2A 2JA5B 2A74C 4KY7A 1HUNA 1PRTC 1I6VC 1GHJA 4RGTA 2JXMB 3ND9A 1EYAA 1C4QA 1PRTB 3DHQA 4XT1B 4CKCA 2IX1A 2EY6A 1B2TA 2OXPA 1CHPD 2KEEA 3FKIB 3HGBA 3MWYW 2XSCA 4KN7C 1S5DD 4ZUIA 2PPBC 2VB2X 4CBVA 3I91A 1I6HB 3QWNA 1GUWA 4RGNA 4H7BA 4K5VA 4A3GB 1JCKB 2B2TC 1KDBA 2F0DA 3KK7A 1WCMB 1JOKA 2J4XA 2K32A 1EFID 5D65A 4QMGA 2VUMB 4G7HC 1EWCA 4KHVA 3X3MA 4NDXA 3PUXA 1IYVA 2EY1A 2VXWA 3NTKA 1SJED 1F2ZA 1CK1A 2SNSA 2F0SA 1R9TB 5EJWA 2LFNA 3BDLA 4C56C 5IIFA 1SSOA 4DFAA 3D3RA 3J80L 2QDBA 1ZXTA 2DNCA 1PMRA 1UAPA 1OXXK 3BVGA 4FXKC 3HG9A 1XTCD 1MSGA 3UI2A 5TSSA 1IHZA 3RLFA 5DEHA 4F8MA 4G7OC 4RAUC 4IFDI 3OIQA 2F0PA 1BCPB 1NCVA 3M85A 1EEID 1SE2A 2K01A 2NVQB 3DUZA 2LMCB 5KGUA 2R92B 1HFNA 3PV0A 4K6DA 2NVTB 4EGVA 3SHLA 3S17B 2B39A 3SVMA 3KLRA 1PLFA 1V1PA 5BN5A 3JAML 4KV6A 1EY5A 4IUUA 2IX3A 1O80A 3HRZC 2F0LA 2RVLA 1Q12A 1SJHD 3J81E 5EKKA 2NBFA 2FMCA 1AP0A 1U9RA 1FNWA 2K1BA 4AYBB 1E2WA 1E2VA 4EQPA 1UEAB 3J7AV 2DN8A 2F0MA 3VYTA 3RMHA 2O4XA 4JK1C 3MHBA 4QF4A 2ZXRA 2WKDA 5FO9B 3M7NA 1QNUA 3PUWA 1I4PA 4IN3A 4ZKBB 4C2MB 4KN4C 1SXTA 2XRQD 3EROA 2I46A 1Q8IA 2KJXA 4UAIA 2N55A 2ZXOA 2EJMA 3DM1A 2MHVA 1S5ED 3DWQA 2HDLA 1TU2B 1H9SB 1KTKA 3VYRA 4JBWA 1ET9A 1LTGD 1ZYRD 1A2TA 1IYUA 1JOOA 2SEBD 3H94A 1GUTA 4DAPA 1CA6A 1I4GA 4HN7A 3GD7A 3MFYA 3OMCA 1EZ8A 1ZEQX 2CHBD 3HP3A 5A2QL 3WOEA 2OEOA 1XX8A 1ET6A 3NUCA 4NW2A 4FF3A 1G8ZD 4P2CB 1D5ZC 5LL6S 2DNEA 4CKEA 1B1ZA 1A15A 3QG1A 1HA5A 2L55A 3A55A 3TZUA 4B9XA 4TKOB 2X6LA 3J7AF 4TSSA 3OPOA 3TZDA 1CT1D 2IJ0A 5C3XA 5C6AA 1GOZA 2K7VA 1F2MA 4FP5D 2SDFA 2XWJB 4M1UB 5IOCA 1HTLD 5CV7A 2EPBA 3T16A 2Z4IA 3H09A 4ZYSA 1PFBA 2F0NA 3CRKC 1W6JA 3E5SA 1AEXA 2BOSA 1LACA 1TY2A 4WFN3 1EY0A 1VMCA 2LKVA 1Y8NB 5C5LA 1C8CA 1EYCA 5EQ0A 3W3AA 2E76C 4A3DB 3HZXA 3QO2A 1I4QA 4Q5VA 2XNAC 2ZT9C 1WTOA 1EOTA 3D4RA 1PTOC 3S14B 2CQAA 3GTLB 5IGEA 2DY7A 4PV1C 2WIIB 4K8JA 1Z6HA 1ILPA 5I4DA 1FGBD 3GTJB 5E1FA 4G7ZC 2B2UA 3HOZB 2OF1A 2RKSA 4IUNA 5CC4A 3RD4A 2HCIA 4HEDA 2D2CC 3S16B 1S5CD 1Z47A 2BA0A 3U9SA 4ZKCB 1DOLA 4QUCA 1BR9A 1Q1EA 1WD1A 2F0FA 4XT3B 5EPLA 3MA2B 4BA2I 4L63B 1I4RA 2WB1B 2BDNA 1OXSC 1TY0A 3BVMA 4DN4M 5KNDA 2R3ZA 2M2LA 3RZOB 2JEBI 1G2TA 5C4JB 3GV3A 1YNNC 2WP8J 4S3SA 5CMDA 3HS0C 1U4RA 1SNQA 1EZ6A 3ND8A 3R2TA 3S2HB 2CW0C 4BBRB 2MP1A 3GTGB 2EZVA 1B50A 1PZJD 4EVOA 3EJIA 2K04A 2XVSA 3I3CA 2XIWA 3Q22A 3RZDB 1D2BA 2F0HA 1TWCB 1TR5A 3KBGA 1JICA 3HEJA 2PYKA 3D4WA 2AWNA 3OIPA 2N88A 5KNCA 2KQ3A 3NBIA 1PTOF 2FINB 1EIGA 1TKWB 1B9MA 3Q0AA 1LV9A 2A6HD 3IAYA 3T53B 2NYZD 4IUPA 2O2LD 4XQQA 3C1FA 3DWAA 1Q90A 3GP7A 3L7ZC 1QB5D 3AMUA 1RHPA 5K36H 1GUSA 2ID0A 3TP7A 3U9OA 4XYQA 1TWAB 3TN2A 3ONAB 3OWEB 5D3DA 1JORA 2K33A 3H91A 1U4MA 1SYCA 5EPJA 2MJ8A 2F0EA 2L0CA 4QUFA 1Z7TA 5M5XB 3VYSA 3WOFA 1II3A 2F3WA 2K6AA 4ZAIA 5CV9A 1LTSD 1K8OA 3D31A 2EYJA 2BE5D 5CORA 1SMYC 4O1NA 3NE5B 1DXMA 3S2DB 1CA5A 3IL8A 1G2SA 2NN6H 2Q8TA 5D3IB 1ESFA 5KEEA 2F3VA 1IW7C 2ENBA 2F4IA 2B2YA 1LT6D 5JVH3 1BO0A 3MZ5A 4PMWA 2B8FA 1SYFA 4LMQD 1OXUA 3KBXA 5IGGA 5IODA 1LTRD 4KKUA 2QKIC 5FKAC 3A7LA 4A3FB 3FVQA 1EQVA 1PZID 1R4PB 2L4NA 2EYOA 2EDGA 5IGBA 3E6ZX 1A6XA 1UNSA 2BDOA 3K59A 1WTRA 2B2VC 2F03A 2IWHA 1TQOA 1CTMA 2VB3X 3NWSA 1LT3D 1VF7A 1EWHA 3R3OA 3LWUA 4WRDA 3PIP3 1BUVT 3I4MB 3LX0A 3J80E 1Q3LA 2MGSA 2RA4A 1T5EA 1TWGB 1OXVA 4DNTB 1PYWD 2NN6I 2A6EC 1L0YB 1LTTD 1ICWA 3PMFA 2AWOA 3V96A 4H0LC 2EYMA 4J1MA 3VA5A 3ERQA 3H0GB 5DNFA 3P20A 1WVLA 1PFNA 3BG3A 1BQQT 1QWYA 5I6WA 4IUQA 3MTSA 2F0KA 1BF4A 5CV4A 4C3HB 5CR3A 1D5MC 2KCCA 1U4PA 1ZKOA 3QOJA 2KEDA 2EYLA 2JA7B 4NP5A 5EBCA 1CI3M 3JAME 3TBIB 2RDFA 4RKLA 4RGMA 2E74C 4F7XA 2QCPX 3DMUA 3NPPA 4YIJA 2XWBB 2I07B 1DJRD 4LJZC 1BCPC 1DD2A 1SNPA 1WD0A 1KDCA 4BS9A 3GTKB 4J6HA 1HA6A 4X3KA 4FYDA 4FVMA 4ME5A 1PFMA 3HOXB 1PRTF 3R93A 5M3MB 5KNBA 1O7ZA 2EVBA 1DOKA 3KF8A 5M5WB 2TMPA 2A69D 2Z4HA 4HMIA 3NXWA 4CKBA 2L1BA 4RWSC 5KYIA 4QCLA 4C3HG 3K5OA 2M00A 2K5QA 2JP1A 2K5WA 1RDPD 3W2DA 1F9PA 4V0BA 4E6IA 2YYZA 4BBSB 4Y7NB 5FK9C 3DXJC 3BS1A 3S1NB 1FD7D 1PDQA 2KCNA 4C3JB 3NTHA 1SEBD 4X3UA 1IL8A 1XWEA 1TS4A 3I8ZA 3I90A 1TT2A 1FR3A 1H9RA 3MFGA 3I4LA 3RUZA 5A2QE 4KK7A 3K5LA 2AUJD 3Q6SA 4DA2A 5COYA 5G3LF 2PW5A 3OW7A 3IFTA 3D6WA 2RSOA 2KA7A 1STAA 2PCFB 3HKZB 5FLXL 1IKMA 2L9HA 1TIID 4KD4A 3CRLC 1SBBB 2V4DA 1BCPF 3P7JA 3R2IA 1LO5D 3K58A 1ONLA 2R6GA 1WTWA 2JEAI 1NR2A 1D5XC 5EKIA 4C1NI 1KNEA 2KECA 4FF4A 1SE3A 1MD2D 5I9PA 1CQVA 2FJ2A 4C3JG 1I50B 4IURA 1SE4A 5JAVA 1PXUA 2NWGA 3FDTA 3OWFA 5IT9L 1QCBD 1PTOD 2B2WA 1A3TA 2L5TA 4OO1G 3MC0B 1V1PB 3SXHA 3K5MA 1ESRA 4IUTA 2L11A 1MSHA 4QIWB 5JPMC 1NUCA 2EJGC 2RQXA 2F0WA 3BZDB 2EYPA 3EVQA 2Z8LA 1RCVD 3T4AC 5JPNC 2O5JC 1X3QA 1AFPA 1H9JA 3MEHA 5C4HA 3ZYYX 4I65A 5CBAE 1G6ZA 5T1IA 5DM73 1EY6A 3NBHA 1RF2D 1LLRD 2NZ1D 1E0BA 1EY9A 5IGDA 4CJ2C 1QG7A 1ZYRC 3EQLC 5HURA 2AQ2B 3S1QB 5C4XB 2WACA 5ELBA 3N6RA 5IGCA 1YNND 4ZRZA 1B4OA 4G57A 1ML0D 4BY1B 3I4NB 1QJOA 2CW0D 4MHEA 4A3BB 5LL6X 5KRUA 3OHXC 2L12A 4B9WA 5C0XH 1JE4A 2RSNA 3GTOB 2AQ3B 1JQYD 3MXUA 3J7YW 4EQNA 3HOYB 3TP8A 4BWGB 2DY8A 1V8QA 4HSPA 3CKIB 5K36G 4DAVA 2B8GA 4OO1H 1YNJC 1JR0D 1S5BD 3M4OB 1DCZA 4I7ZC 4MN3A 2X6GA 1HFGA 1CZWA 4M8AA 3L9AX 3PIO3 3TMEA 2BCOA 3DEOA 3N52A 2JSOA 5IGFA 3OSOA 1V1OA 1SDFA 3TP5A 1STHA 5JEAH 2EE1A 3GTQB 4FF1A 3K7AB 4J8QA 4TQUS 1G91A 3P1HA 4K5XA 5JJZA 2QILA 3I72A 2NN6G 3SK4A 3C46A 4R8IA 3H3VC 4GZYC 1AZPA 2A68C 1VCIA 1HXYD 1BNZA 4FF2A 3SE0A 1BBXC 5C0XI 4K6LA 2PMZB 2J0TD 2VNUD 4A3IB 4A3KB 4A93B 3C1EA 2K5DA 4BA1I 1SMYD 4K8IA 4XQJA 4XQNA 4OO1I 2RBMA 1QE6A 3SEBA 5CBEE 2SOBA 4H13C 4F88A 3A8IE 1B3AA 2EJFC 1KDAA 5EGTA 1JWUD 2E2HB 1F9QA 1IW7D 4CGYB 3GV6A 2FMMA 4RA8A 3OOCA 3MAQA 3GO5A 2F0VA 1SNCA 2B2VA 1EU4A 4L8JA 5ELFA 2LY7A 1PRTD 3ITPA 3S15B 2B2TA 4NMZA 1WTVA 2EYFA 2E2JB 5C4ZA 1CHQD 2QF7A 1SYEA 1AZQA 2ZXPA 1W6KA 4KTAA 2IW3A 2AQ1B 3V2TA 1HHVA 2NVYB 1HCZA 4CHTB 3TP6A 1SNMA 2EOTA 1ENCA 3H6MA 2H1EA 4O42A 5I2YA 3AU7A 5M9OA 2AUKA 4C3IB 2NB0A 3A8JE 2A6ED 1KLUD 1JWMD 1D1KA 3Q24A 4R8NA 5D14A 1PTOH 3O13A 1WTPA 1EQTA 2D5DA 3BDOA 1F2YA 3LNNA 2R7ZB 4PQXA 2HCCA 3K5NA 1KNAA 5M3FB 4R9WA 3I70A 2A73B 5G3LD 3R8BA 2JYOA 2WV6D 2OT2A 4OHJA 3LWEA 4DF7A 1STBA 5KIXA 2Y0SB 3L3OC 4TRDA 2K28A 2C5CA 1BCPD 4KHZA 1AN8A 1CQFA 4HR7B 4ZQ3A 3FPUB 4N9TA 1X32A 4C3IG 1TWFB 3A8KE 1GUNA 1HUMA 2A5HA 4IFDH 1STGA 1WTQA 2BE5C 1A3UA 2J7ZA 1PZKD 1FNUA 1SAPA 2R61A 2F0OA 2RDGA 1RODA 1ENAA 2Q8IB 4G4KA 1T5XD 2QEJC 4RHSA 3VR3A 4XTCS 1B44D 1DZ1A 2KHSA 4A3MB 3PO3B 5DM63 1LT5D 3P75A 4CJ0B 2HUGA 3BDCA 1MGSA 3QB3A 2X69A 1VMPA 3PO2B 5E3FA 1EIHA 5DAUA 3DEPA 1J8IA 1H9SA 2B2YC 1NR4A 4UDUC 5A35A 2RDHA 5I9OA 1DM0B 2F0QA 3M3YB 5ELEA 2HDMA 3D8GA 1JOQA 4RGOS 3FPPA 1STNA 3KLSX 4K2KA 4ABNA 1KABA 2M9VA 2G9HD 3OMGA 5BN4A 2PQEA 4RCNA 4OL7A 3QJYA 3NSWA 1B9NA 3S9WA 1SFOB 3BVZA 2O5IC 2NTTA 3MXPA 1R4QB 3VR4A 4NKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  2XIW A;  2B2Y A;  2J7Z A;  2K03 A;  4XT1 B;  2K01 A;  3Q6S A;  1WTO A;  1B2T A;  1BO0 A;  1EOT A;  1G91 A;  5JJZ A;  2B2W C;  3MWY W;  2KEE A;  5CBA E;  1G6Z A;  1F2L A;  5T1I A;  1SAP A;  1JIC A;  1HFN A;  1WTX A;  4LMQ D;  4U68 A;  1CA6 A;  3KBX A;  1NAP A;  2EOT A;  1ROD A;  2H1E A;  4O42 A;  5COY A;  2DY7 A;  2N88 A;  1XYI A;  3I91 A;  2KVM A;  2NZ1 D;  4X3S A;  1E0B A;  3SVM A;  3HP3 A;  4XDX A;  1M8A A;  5AFW A;  4R8I A;  1GUW A;  2FIN B;  1RTO A;  3D6W A;  4CJ2 C;  1EIG A;  4CJ1 B;  1AZP A;  1ILP A;  5E4W C;  1PLF A;  1TVX A;  1QG7 A;  2L4N A;  2RSO A;  1LV9 A;  1XX8 A;  4NW2 A;  5E4X A;  1WD0 A;  2B2U A;  1BNZ A;  2B2T C;  4OIJ A;  2D9U A;  1DOM A;  1DZ1 A;  1BBX C;  1F9R A;  4X3K A;  1HA6 A;  1IKM A;  4ZLT F;  2L9H A;  4IUU A;  2NYZ D;  4IUP A;  4OIK A;  1O80 A;  2FFK B;  5D65 A;  1EL0 A;  1PFM A;  2RVL A;  4CJ0 B;  2HUG A;  3P7J A;  5D14 A;  1A15 A;  4HAE A;  3R93 A;  2HCI A;  1MGS A;  2X69 A;  4HED A;  1B4O A;  1VMP A;  1WTR A;  1O7Z A;  1ML0 D;  1WTW A;  1DOK A;  1NR2 A;  3F2U A;  1WTQ A;  1EIH A;  1WTP A;  1EQT A;  2B2V C;  1AP0 A;  4ZK9 B;  4MHE A;  1RTN A;  3DEP A;  1CM9 A;  4ZKC B;  2K1B A;  1RHP A;  1DOL A;  4QUC A;  1J8I A;  5EKI A;  2X6L A;  1WD1 A;  1DON A;  1QE6 A;  2B2Y C;  4XT3 B;  2FHT A;  1NR4 A;  5CBE E;  1F9S A;  1O7Y A;  3TZD A;  5EPL A;  1KNE A;  2KEC A;  2IL8 A;  2L1B A;  4RWS C;  2Q8R E;  3ONA B;  3TN2 A;  2HCC A;  2FJ2 A;  1B3A A;  1KNA A;  2L12 A;  4R9W A;  2VXW A;  3KUP A;  4IUR A;  2KUM A;  4HSV A;  1F9Q A;  1Q3L A;  2MGS A;  2NWG A;  4IUV A;  3H91 A;  1JE4 A;  2RA4 A;  2RSN A;  2SDF A;  3FDT A;  2JYO A;  1U4M A;  2BDN A;  3GV6 A;  2FMM A;  4RA8 A;  2B2W A;  1QNK A;  1S4Z A;  2EPB A;  5EJW A;  2HDM A;  1MI2 A;  2DY8 A;  2MJ8 A;  5EPJ A;  4DN4 M;  3LWE A;  1B53 A;  2R3Z A;  4ZKB B;  2MPM A;  2JP1 A;  2M2L A;  3IFD A;  1ICW A;  1X3P A;  4QUF A;  1F9P A;  1PFB A;  1SSO A;  2B2V A;  1G2T A;  1RJT A;  2K28 A;  4HCS A;  5T1G A;  1U4L A;  1ESR A;  3GV3 A;  4IUT A;  1ZXT A;  4ZAI A;  2L11 A;  1MSH A;  4MN3 A;  5DNF A;  2X6G A;  2K05 A;  1HFG A;  1PDQ A;  4UAI A;  5CMD A;  1U4R A;  2B2T A;  2N55 A;  1WVL A;  1HRJ A;  3DEO A;  1PFN A;  1VMC A;  1J9O A;  3FPU B;  3N52 A;  1WTV A;  5COR A;  4IUQ A;  3MTS A;  3DM1 A;  4X3U A;  2CVR A;  1BF4 A;  2MP1 A;  1IL8 A;  1MSG A;  1C8C A;  3UI2 A;  3I8Z A;  1SDF A;  4X3T A;  1CA5 A;  1X32 A;  5EQ0 A;  3G7L A;  2HDL A;  1ILQ A;  1AZQ A;  2B2U C;  3IL8 A;  3I90 A;  1B50 A;  1G2S A;  1U4P A;  5EPK A;  1HUN A;  2EE1 A;  3QO2 A;  4RAU C;  1HUM A;  2K04 A;  1IKL A;  2Q8T A;  2KOL A;  1X3Q A;  2KED A;  1HHV A;  1NCV A; 
#chains in the Genus database with same CATH topology
 1B7Y B;  4KMU C;  1UE5 A;  4XIG S;  5FLX E;  2EXZ A;  4DXG A;  4BXX G;  3PO2 G;  4ULL A;  1Y8P B;  1BBW A;  4U68 A;  3CCM A;  1ICF B;  5J22 A;  2C35 B;  4CDF C;  4JV5 L;  4OGQ C;  1XYI A;  3MXN A;  4LF9 Q;  1M8A A;  4IOA A;  2ICE C;  2Z9H A;  2PZW A;  1VF5 C;  4PMC A;  3NHH A;  1Q8K A;  4KKT A;  1PV4 A;  3PF4 A;  1HNW L;  3CU7 A;  2Z6K A;  4K0K Q;  1F9R A;  1BVS A;  4LK1 C;  4X66 Q;  1VQD A;  4ME3 A;  2B3G A;  1CUK A;  1EL0 A;  1STY A;  2NUC A;  1HTP A;  4Z9C B;  2PO4 A;  2D62 A;  4B08 A;  1Y1V B;  1FJG Q;  2R7F A;  5J39 A;  2E5L L;  5IT9 E;  4YCV A;  4QB4 A;  2JA5 H;  4RFB A;  4DR1 Q;  5C44 B;  3HOU B;  1BBU A;  1CZG A;  1K83 B;  4MTN A;  4DV1 L;  1A3V A;  4MTK A;  4DR7 L;  2R92 G;  3SK5 A;  2OTL A;  4RCO A;  1O78 A;  3FKI H;  2CKZ B;  4HSV A;  3GTP B;  1VQ4 A;  3J81 L;  1WFQ A;  4IUV A;  2F1M A;  3I2Z A;  1BDO A;  2EY5 A;  4XXE A;  3J81 c;  4DV7 Q;  4HTH A;  1O7L A;  1S4Z A;  4DK1 A;  2A69 C;  3VR5 A;  1I6H H;  4DV3 L;  1JJC B;  1GXD C;  3IFD A;  3SK8 A;  4A3G H;  1RJT A;  2IX0 A;  1B3Q A;  3HOV B;  5M5Y B;  5C0X G;  1WCM H;  4OWT B;  4DPG A;  3EBE A;  1EY8 A;  2AHO B;  3SR1 A;  3BYY B;  4DUZ L;  3C2P A;  1HJP A;  2H4O A;  4UP8 A;  2CWP A;  2VUM H;  4PMB A;  2C9O A;  2BA1 A;  3NWT A;  2PI2 E;  3KF8 B;  3G7L A;  2UUB L;  1ILQ A;  2WAQ B;  4WOR A;  3HOW B;  1DGS A;  1K8M A;  2KOL A;  5FO7 B;  1Q1B A;  3AEV A;  2Z1C A;  1HQR D;  2HQL A;  2E2D C;  4N9P A;  4DR4 Q;  1E24 A;  1M4V A;  1Y1V G;  2LXJ A;  4OON A;  5I2X A;  4AQY L;  2R93 B;  3CCR A;  5JVG 3;  1LUZ A;  1WTX A;  5C0X J;  1R9T H;  3T51 B;  4DAY A;  1NAP A;  1KAA A;  1RKN A;  3NTI A;  4FXD A;  4DR2 Q;  5JEA G;  2PI2 A;  3VR2 A;  3CC2 A;  4PZ6 A;  1CKM A;  4BXX H;  4JCV E;  1I3Q B;  3E0J A;  4OEM B;  3VR6 A;  5EBD A;  4Q0F A;  4YY3 L;  1FGU A;  4CJ1 B;  3G6J B;  5E4W C;  4WJW A;  2BH2 A;  3SDZ A;  3G4S A;  1C48 A;  1BXT A;  3K0Y A;  2D9U A;  2JA7 H;  1N36 Q;  2VZA A;  5CV8 A;  1RD9 D;  4KY6 A;  1YNJ D;  1GUO A;  2A1A A;  4OIK A;  2JA8 B;  3SK6 A;  3I73 A;  4K14 A;  1I4X A;  2ZTE A;  3MXN B;  2IHF A;  2K5H A;  2QDL A;  3AB9 A;  4HIM A;  4DNI A;  4XYO A;  2JN4 A;  2YU9 B;  1CM9 A;  2B63 B;  3HOV G;  3GTM B;  5JEA J;  4X65 Q;  1O7Y A;  4B3T L;  4FXG C;  3NP8 A;  2IL8 A;  2Q8R E;  1W3S A;  2F0G A;  2LS0 1;  3QOL A;  2NVQ H;  3NQI A;  3TDQ A;  1LTB D;  1XXG A;  2VQE Q;  1XMQ L;  5M3M H;  3VYU A;  2NVT H;  2XRS D;  2WAQ G;  1QNK A;  2K5N A;  3S17 H;  1GUG A;  1Y69 U;  1B53 A;  3K57 A;  5ISR A;  3KLS A;  4V19 0;  2EY2 A;  3WDN A;  5IYB G;  3ULJ A;  2NVX B;  4K2L A;  2NTS A;  2A68 D;  1KLG D;  3OTO Q;  3D6C A;  1EIF A;  4KI0 A;  2KBN A;  4DV2 L;  3E9H A;  1PTO B;  4KJN A;  4B3R L;  3URY A;  4ALP A;  1AW7 A;  1NSN S;  2CVR A;  1B8A A;  4DK0 A;  1HNX L;  4JI8 Q;  4DXF A;  1IBM L;  4H44 C;  4X3T A;  3ULL A;  5K5P A;  1MIU A;  1X3F A;  3T13 A;  1JB3 A;  5CV6 A;  1E2Z A;  3J80 i;  1IKL A;  2F0I A;  4BY7 B;  4A3J B;  3M7G A;  4PG3 A;  1SNO A;  3CME A;  1TWH B;  2JA8 G;  2OTJ A;  4ILW A;  3PUV A;  2KUM A;  3M4Y A;  4P71 A;  2JA6 B;  1CFM A;  2UUA Q;  2K03 A;  1EY7 A;  2B2W C;  4NXM Q;  2KCM A;  2K4K A;  4HJ8 A;  1H9M A;  1QZG A;  1LTA D;  4R4C A;  1HPC A;  2BH8 A;  2JE6 I;  4PZ8 A;  3X3N A;  4OX9 Q;  4HJA A;  1I5F A;  2AMC B;  3PUZ A;  1VQL A;  2PNR C;  4JVZ A;  4HCE A;  1VS0 A;  4HMJ A;  5NUC A;  2KVM A;  5CV5 A;  1OO9 B;  2E75 C;  4GOP A;  4XDX A;  5AFW A;  2UU9 Q;  1A2U A;  1RTO A;  3FEW X;  4LFB Q;  2ICI A;  1SYG A;  5E4X A;  1MBY A;  2XN9 C;  4L5S A;  3QIA A;  5LMU Q;  4OIJ A;  4LAA A;  3S1M B;  2CFM A;  4ZUJ A;  4DNR B;  2FFK B;  4KJO A;  1STE A;  4KLK A;  1SLJ A;  4HAE A;  3V05 A;  3ZJY C;  4PNY A;  3K6O A;  3NQT A;  3EA6 A;  3CCU A;  2XTI A;  5L37 A;  1TS2 A;  3B6Y A;  2F0T A;  2F0U A;  1RTN A;  5LMN Q;  3JAM i;  1S5F D;  1TS5 A;  1F9S A;  4EQO A;  1LAB A;  1KQS A;  5J1Z A;  3D4D A;  3PUY A;  1PH6 A;  1FNV A;  3AYH B;  3CHB D;  3KUP A;  3NBH B;  5IYD H;  5C3W A;  4P74 A;  3QR8 A;  3GQB A;  1Y8O B;  5C3E B;  3IKJ A;  2IT1 A;  5GAH C;  4BY7 G;  4RKB A;  2MPM A;  5ELN A;  4ID6 A;  4MIU A;  3PGZ A;  1V43 A;  2PZT A;  2JA6 G;  1UUP A;  1N8R C;  2IPK D;  5EKL A;  1XNR L;  3VA7 A;  4HCS A;  5T1G A;  5ELD A;  5FO8 B;  5KYL A;  1K8A C;  2WIN B;  4OWX B;  4RH6 A;  1H9K A;  2K05 A;  3T56 B;  1QIL A;  1KXL A;  4IJL A;  1HRJ A;  1CKO A;  4IQZ A;  1J9O A;  1LT4 D;  4LFA Q;  3FRP B;  2LSS A;  4C1N K;  3FMC A;  4KKS A;  3EFX D;  4ODG A;  1SYD A;  1D1I A;  2B2U C;  3CC4 A;  5EPK A;  1EY4 A;  1VQC A;  3NK9 A;  3S1R B;  1L0X B;  1E22 A;  1UE1 A;  3EN2 A;  1GJX A;  4IZ8 A;  1VDZ A;  1MHW C;  4KY5 A;  2CH4 W;  3J81 i;  1G51 A;  1JC7 A;  1F2L A;  2ATW A;  4IAL A;  3TSS A;  4DGZ A;  3K81 C;  1HNZ L;  1B70 B;  5I6Y A;  3CCE A;  1FYC A;  4RHR A;  5LMN W;  2G9D A;  4X3S A;  1G29 1;  4IFD G;  4JI7 Q;  2IY5 B;  3CQZ B;  2WKC A;  1TS3 A;  1PFS A;  4JI4 L;  4POG A;  1TVX A;  2MUY A;  1QUQ B;  4A3E B;  3C3L A;  1DOM A;  3G48 A;  4ZLT F;  4DR6 L;  1VQJ A;  1HZ9 A;  1HQM C;  4FNF A;  1Y1W B;  5JJI A;  2F0J A;  3UE1 A;  1SND A;  1JJ2 A;  3U4Z A;  3RNU A;  1EEF D;  1F77 A;  2HIV A;  3A7A B;  1BOS A;  4K5W A;  2UXB L;  2E2I B;  2PZU A;  3F2U A;  4U67 3;  1EYD A;  4WJ3 M;  3W1B A;  4ZK9 B;  2PW7 A;  1EU3 A;  2GA4 B;  4A3D H;  4DR3 Q;  1DON A;  2FHT A;  3T1H L;  1SYB A;  2GN5 A;  3IRB A;  4JBJ A;  4O2D A;  2HQE A;  4IJH A;  5ELC A;  4F87 A;  5LHY 1;  5FLM G;  4IFD J;  1QOH A;  5JOB A;  2ZJP A;  5C5M A;  3MVV A;  3Q23 A;  2SNM A;  1OXT A;  1VQK A;  1E7Z A;  3GTL H;  1LTI D;  5BN3 A;  1I4H A;  2TSS A;  5FOB B;  4DV0 L;  1LTL A;  1MI2 A;  5CGK A;  1YNX A;  1ENF A;  1D6E C;  3MXG A;  2A6H C;  3DWP A;  1X3P A;  4LF7 Q;  5HGT A;  3GTJ H;  3A54 A;  1LM0 A;  4AIM A;  4L6T B;  3HOZ H;  2KHI A;  1U4L A;  2Q2T A;  4LF5 Q;  1N9W A;  1A63 A;  4KD3 A;  5F2D A;  1JWS D;  4YCU A;  1EFW A;  1DYQ A;  4DU9 A;  4JI3 Q;  1GHK A;  2HIX A;  3BYT B;  2WFW A;  2EYH A;  3A56 A;  5CYU A;  4FO2 A;  1PH1 A;  2EIF A;  1NNX A;  2JA5 B;  2A74 C;  4KY7 A;  1N34 L;  4A3E G;  5IE8 A;  1HUN A;  1PRT C;  1I6V C;  1GHJ A;  1HZA A;  1M1K C;  5IYC G;  1YHB A;  4RGT A;  2JXM B;  1Y1W G;  3ND9 A;  4A3C G;  1EYA A;  1C4Q A;  1PRT B;  3DHQ A;  4XT1 B;  4CKC A;  5FJ8 G;  2EY6 A;  2ZM6 L;  2IX1 A;  1B2T A;  3CMA A;  2OXP A;  4LF8 Q;  1CHP D;  2KEE A;  3FKI B;  3HGB A;  3MWY W;  3KJP A;  2XSC A;  4LUO A;  4KN7 C;  1S5D D;  1Q81 C;  4ZUI A;  2PPB C;  2VB2 X;  4CBV A;  3I91 A;  1I6H B;  3QWN A;  1GUW A;  4RGN A;  3RZO H;  4H7B A;  4K5V A;  4A3G B;  1JCK B;  4AH6 A;  3G71 A;  1VQ5 A;  2B2T C;  5GAG C;  1KDB A;  5C4J H;  2F0D A;  3KK7 A;  1PH3 A;  4GKK Q;  1IZ6 A;  1WCM B;  1JOK A;  2J4X A;  2K32 A;  1EFI D;  1VQ7 A;  5D65 A;  1IYJ B;  1K0S A;  3DM3 A;  4QMG A;  5IP7 H;  3S2H H;  2VUM B;  4APV A;  4BBR H;  1PH8 A;  4YWM A;  1UE7 A;  4X62 L;  4G7H C;  3GTG H;  4LUZ A;  1EWC A;  4KHV A;  2RCF A;  3KFU A;  3X3M A;  4NDX A;  3H3V H;  5GAD C;  3CXC A;  3PUX A;  1JE5 A;  1IYV A;  3RZD H;  3UE0 A;  5IWA Q;  3STB D;  3F2C A;  2EY1 A;  2VXW A;  3HKZ E;  3NTK A;  1TWC H;  1SJE D;  1F2Z A;  1CK1 A;  1CSQ A;  2SNS A;  2F0S A;  4B3S L;  1HH2 P;  1R9T B;  5EJW A;  1X54 A;  2LFN A;  1KRS A;  3BDL A;  4C56 C;  5HGQ A;  5IIF A;  1SSO A;  4A4I A;  5AJ3 Q;  4DFA A;  3D3R A;  3CPW A;  2I5H A;  3FKI G;  2QDB A;  3J80 L;  1Q7Y C;  1V9P A;  1ZXT A;  4J15 A;  3J80 c;  1KC8 C;  2DNC A;  4LF9 L;  1PMR A;  1UAP A;  3K7U C;  1OXX K;  3BVG A;  4FXK C;  5H1S E;  3HG9 A;  1XTC D;  1MSG A;  4K0K L;  3UI2 A;  5TSS A;  1IHZ A;  3RLF A;  4X66 L;  4JOI C;  5DEH A;  4F8M A;  2F4V Q;  1WCM G;  4G7O C;  4RAU C;  4P75 A;  1IBL Q;  1KD1 C;  3I4M G;  4IFD I;  3OIQ A;  2F0P A;  1BCP B;  1TWA H;  1NCV A;  4GNX C;  3M85 A;  1EEI D;  1FJG L;  1SE2 A;  1N33 Q;  2K01 A;  2NVQ B;  3DUZ A;  2VUM G;  2LMC B;  4DR1 L;  5KGU A;  4QIW E;  4A3C H;  2R92 B;  1HFN A;  4JI6 Q;  3PV0 A;  2E2J H;  4K6D A;  2NVT B;  4EGV A;  3SHL A;  4DUY Q;  1EYG A;  1MJE A;  3S17 B;  2B39 A;  3SVM A;  3KLR A;  3H0G G;  1SRO A;  5M5X H;  4KHP L;  1PLF A;  3W1G A;  4DV7 L;  1V1P A;  3VDY A;  5BN5 A;  3JAM L;  2ES2 A;  4KV6 A;  3JAM c;  1EY5 A;  4IUU A;  2IX3 A;  1O80 A;  1E1T A;  3HRZ C;  2VQF Q;  4NB3 A;  2F0L A;  2RVL A;  3BU2 A;  1YHA A;  1Q12 A;  1SJH D;  3J81 E;  3S2D H;  5EKK A;  2NBF A;  3G6E A;  2FMC A;  1AP0 A;  1U9R A;  1FNW A;  2K1B A;  4CDE C;  4AYB B;  1E2W A;  1E2V A;  4EQP A;  3K80 C;  2JA7 G;  3EIV A;  4JBK A;  3T1Y Q;  1UEA B;  3J7A V;  1XNQ Q;  2DN8 A;  1A0I A;  2F0M A;  1KHI A;  3VYT A;  3RMH A;  2O4X A;  4JK1 C;  3PIO A;  3MHB A;  4QF4 A;  2ZXR A;  2WKD A;  5FO9 B;  4UY8 C;  3M7N A;  1QNU A;  1X9N A;  3TRZ A;  3PUW A;  1I4P A;  4IN3 A;  4ZKB B;  4DR4 L;  4DR5 Q;  4C2M B;  4RG1 A;  4A3F H;  4KN4 C;  1SXT A;  2XRQ D;  3ERO A;  2I46 A;  4L5Q A;  4DR2 L;  1Q8I A;  2KJX A;  3BJU A;  5M3M G;  4UAI A;  2N55 A;  1E1O A;  2ZXO A;  2EJM A;  3DM1 A;  4X6A H;  2MHV A;  4A75 A;  1S5E D;  3DWQ A;  1N36 L;  4CDC C;  2HDL A;  2UUC Q;  1TU2 B;  1H9S B;  1KTK A;  3VYR A;  4JBW A;  1ET9 A;  1Q46 A;  2OWO A;  1HR0 Q;  1ASY A;  3I4M H;  1LTG D;  1ZYR D;  1HZC A;  1YI2 A;  1A2T A;  1IYU A;  2MQH A;  4QQB X;  1JOO A;  4JI1 Q;  2SEB D;  2JJQ A;  3H94 A;  1GUT A;  1TWG H;  4DAP A;  1CA6 A;  1I4G A;  4X65 L;  4HN7 A;  3GD7 A;  4YWK A;  1YIT A;  4AYB G;  1EWI A;  3KF6 A;  1JJG A;  3MFY A;  2WB1 E;  3OMC A;  1EZ8 A;  1ZEQ X;  2CHB D;  3HP3 A;  1KIX A;  1UWV A;  5A2Q L;  2VQE L;  4GN4 B;  3WOE A;  2OEO A;  1XX8 A;  1ET6 A;  3NUC A;  4NW2 A;  3FHW A;  4FF3 A;  4JV5 Q;  3F8T A;  3H0G H;  1G8Z D;  4IO9 A;  4X64 L;  4P2C B;  1D5Z C;  1K0R A;  1NTG A;  2DNE A;  1B1Z A;  5LL6 S;  4CKE A;  1A15 A;  1G6P A;  2D0O A;  5IP9 G;  3QG1 A;  1HA5 A;  1KRT A;  2L55 A;  3A55 A;  4C3H H;  3TZU A;  1YBY A;  4B9X A;  3RR5 A;  4TKO B;  2X6L A;  3J7A F;  4TSS A;  3OPO A;  3H15 A;  2MO0 A;  3TZD A;  1CT1 D;  2IJ0 A;  5C3X A;  4JI8 L;  5C6A A;  4R4Q A;  1GOZ A;  1I94 Q;  2UXD L;  1AH9 A;  2K7V A;  2PMZ E;  1F2M A;  4FP5 D;  2SDF A;  2XWJ B;  4M1U B;  2UXC Q;  2ALY B;  1PH4 A;  5IOC A;  1HTL D;  5CV7 A;  2EPB A;  3T16 A;  2Z4I A;  3H09 A;  2G5D A;  2AKW B;  2UUA L;  4ZYS A;  4DK3 C;  1K73 C;  1PFB A;  2F0N A;  2DJG C;  3CRK C;  1HR0 W;  4OX9 L;  1W6J A;  4UP7 A;  3GTK H;  2YTY A;  3E5S A;  1WOC A;  3E9I A;  1AEX A;  2BOS A;  5IYD G;  2UU9 L;  1LAC A;  1TY2 A;  3HOX H;  4WFN 3;  2MO1 A;  4LFB L;  1EY0 A;  1VMC A;  2LKV A;  1XTD A;  4DV6 Q;  3M3Y H;  1Y8N B;  4CDD C;  5LMU L;  5C5L A;  4GLX A;  1C8C A;  1EYC A;  1C7Y A;  5EQ0 A;  3W3A A;  2E76 C;  5M5W H;  4A3D B;  1L1O A;  3HZX A;  3QO2 A;  1I4Q A;  1JT8 A;  4Q5V A;  2XNA C;  2ZT9 C;  1PH2 A;  1X6O A;  2GVA A;  1WTO A;  1EOT A;  5IY0 A;  3D4R A;  1PTO C;  3S14 B;  1VQG A;  2CQA A;  3GTL B;  5IGE A;  5LMN L;  3A5U A;  4QL5 A;  3RN2 A;  4R4T A;  2DY7 A;  4PV1 C;  3CCL A;  2WII B;  3KDF A;  4K8J A;  1Z6H A;  1ILP A;  5I4D A;  1FGB D;  2K50 A;  1GVP A;  3GTJ B;  5E1F A;  1RL2 A;  3CPF A;  4G7Z C;  2B2U A;  3M9B A;  3HOZ B;  4GS3 A;  2Z6B A;  4Y7N H;  4BBS H;  2OF1 A;  1IXR A;  1KAW A;  3S1N H;  2RKS A;  4IUN A;  4YY3 Q;  5CC4 A;  3RD4 A;  4C3J H;  1NMG A;  3KF6 B;  2HCI A;  4HED A;  2D2C C;  4DV5 Q;  1VQN A;  3S16 B;  1S5C D;  1Z47 A;  1C9O A;  2BA0 A;  3U9S A;  4ZKC B;  5IP9 H;  1DOL A;  4QUC A;  1BR9 A;  2Q2U A;  1Q1E A;  1WD1 A;  4GKJ Q;  2F0F A;  4XT3 B;  4JI2 Q;  5EPL A;  3MA2 B;  4LWC A;  5GRO A;  1Y14 B;  4BA2 I;  4L63 B;  1I4R A;  5GAE C;  4Y52 H;  4DAY B;  4B3T Q;  2WB1 B;  2BDN A;  1OXS C;  1TY0 A;  3BVM A;  4A3D G;  1AE3 A;  3L2P A;  4DN4 M;  5KND A;  2R3Z A;  5C44 H;  1GO3 E;  2M2L A;  3HOU H;  3RZO B;  5C4X G;  2JEB I;  3ER0 A;  2CCZ A;  1G2T A;  5C4J B;  3GV3 A;  1YNN C;  2WP8 J;  4S3S A;  5BR8 L;  5CMD A;  3HS0 C;  1U4R A;  4BY1 G;  1SNQ A;  4JI7 L;  3I4N G;  1EZ6 A;  3ND8 A;  3R2T A;  3S2H B;  2CW0 C;  4BBR B;  3PQI A;  2MP1 A;  3GTG B;  2EZV A;  1B50 A;  3HOZ G;  1PZJ D;  4EVO A;  3EJI A;  2K04 A;  4B3R Q;  2XVS A;  2Y0S E;  5ELO A;  1QZH A;  1IBM Q;  1A62 A;  3I3C A;  2XIW A;  3Q22 A;  3RZD B;  1X65 A;  1D2B A;  1I50 H;  2A19 A;  2F0H A;  1TWC B;  2LXK A;  1PYB A;  1TR5 A;  3KBG A;  1JIC A;  3K0X A;  3HEJ A;  2I5M X;  2PYK A;  1P8L A;  3D4W A;  2AWN A;  3OIP A;  2N88 A;  5KNC A;  2KQ3 A;  3NBI A;  1L1O B;  1PTO F;  3HOW H;  2FIN B;  3RN5 A;  1EIG A;  1TKW B;  1B9M A;  4IPC A;  3Q0A A;  1LV9 A;  2A6H D;  3IAY A;  3T53 B;  2F52 A;  2NYZ D;  2WB1 G;  4IUP A;  3CD6 A;  4WJ4 A;  2O2L D;  4R1J A;  4XQQ A;  3C1F A;  3DWA A;  1Q90 A;  3GP7 A;  3L7Z C;  1QB5 D;  3KDF B;  2K14 A;  3AMU A;  4JI3 L;  2R7D A;  1RHP A;  5K36 H;  1GUS A;  2ID0 A;  3TP7 A;  3U9O A;  4XYQ A;  1TWA B;  3TN2 A;  3ONA B;  4JG2 A;  4MZ9 A;  3OWE B;  3JC6 6;  1J5E Q;  3FP9 A;  5IP7 G;  5D3D A;  4BBR G;  1S3O A;  1JOR A;  1XJV A;  2K33 A;  1JMC A;  3H91 A;  4GOP C;  1U4M A;  2N8N A;  1EUJ A;  1X55 A;  1SYC A;  5EPJ A;  2MJ8 A;  4GOP B;  4GN3 B;  2F0E A;  2B63 H;  1K28 A;  2L0C A;  4LNQ A;  2V1C C;  4QUF A;  1KL9 A;  3SGI A;  1Z7T A;  5M5X B;  3VYS A;  3WOF A;  1II3 A;  2F3W A;  2QA4 A;  2K6A A;  4ZAI A;  3K8A A;  5C4X H;  1EIY B;  3S1Q H;  5CV9 A;  1LTS D;  1K8O A;  3D31 A;  2GVB A;  2EYJ A;  4QGU A;  2BE5 D;  5COR A;  2KCT A;  1OTC A;  1SMY C;  4O1N A;  3NE5 B;  1DXM A;  4BY1 H;  3S2D B;  3I4N H;  1CA5 A;  3IL8 A;  4A3B H;  1G2S A;  1VQE A;  2NN6 H;  4PZ7 A;  4LF4 Q;  2Q8T A;  5D3I B;  1ESF A;  5KEE A;  1ASZ A;  2F3V A;  1NY4 A;  1IW7 C;  2ENB A;  2F4I A;  2B2Y A;  1LT6 D;  4P73 A;  5JVH 3;  1BO0 A;  3MZ5 A;  4PMW A;  4HIK A;  4A76 A;  2A8V A;  2B8F A;  2OQK A;  3GTO H;  1SR3 A;  1SYF A;  4LMQ D;  1OXU A;  3KBX A;  5IGG A;  3HOY H;  1S72 A;  5IOD A;  2IHE A;  1LTR D;  5IWA L;  4KKU A;  2QKI C;  5FKA C;  3A7L A;  3BZC A;  3FVQ A;  1EQV A;  4A3F B;  1PH9 A;  1PZI D;  1R4P B;  2L4N A;  2EYO A;  2EDG A;  3M4O H;  1PH7 A;  3KOJ A;  2CWA A;  5IGB A;  4IOC A;  3E6Z X;  1K3R A;  1A6X A;  1NE3 A;  4JI4 Q;  1UNS A;  2BDO A;  3F2B A;  4YCW A;  3MEF A;  3K59 A;  4YHH Q;  1WTR A;  1IL2 A;  2JQO A;  4LFC L;  1N32 L;  2B2V C;  1YJN A;  2F03 A;  2IWH A;  3L0O A;  1TQO A;  1CTM A;  2VB3 X;  1UE6 A;  3M4P A;  3NWS A;  3GTQ H;  1K9M C;  1VQ9 A;  1LT3 D;  2HHH Q;  3K7A H;  1YVC A;  1VF7 A;  1Z9F A;  2ASB A;  1EWH A;  3R3O A;  3LWU A;  4WRD A;  3PIP 3;  1BUV T;  3I4M B;  3LX0 A;  3J80 E;  1SRU A;  2F4V L;  1Q3L A;  2MGS A;  4TVA B;  2RA4 A;  1T5E A;  1TWG B;  3HKS A;  4LF6 L;  1OXV A;  2DGY A;  4DNT B;  1PYW D;  2NN6 I;  2A6E C;  1L0Y B;  1LTT D;  1ICW A;  3PMF A;  2RHS B;  2AWO A;  4HJ5 A;  3V96 A;  4H0L C;  1GKH A;  2EYM A;  4J1M A;  4DV0 Q;  4JI6 L;  2HD3 A;  3VA5 A;  3ERQ A;  3H0G B;  5DNF A;  4DUY L;  1XMO Q;  3P20 A;  4A3L G;  1WVL A;  1PFN A;  3BG3 A;  4A3I H;  1BQQ T;  1QWY A;  3PSI A;  5I6W A;  5JJL A;  4A3K H;  4A93 H;  4IUQ A;  3MTS A;  2F0K A;  1BF4 A;  5C3E H;  4JI0 L;  4A3F G;  5CV4 A;  4C3H B;  5CR3 A;  1AE2 A;  1D5M C;  2KCC A;  2VQF L;  1U4P A;  3A0J A;  1ZKO A;  3QOJ A;  4NPS A;  4UPA A;  2KED A;  2EYL A;  1N34 Q;  2ZJQ A;  2JA7 B;  4NP5 A;  5EBC A;  1CI3 M;  3JAM E;  2E2H H;  4H02 A;  1YZ6 A;  3TBI B;  1D8L A;  4NXN Q;  2RDF A;  3GDE A;  3T1Y L;  4RKL A;  4RGM A;  2E74 C;  4HIO A;  4F7X A;  2ZM6 Q;  2QCP X;  3DMU A;  1A8V A;  3NPP A;  4YIJ A;  2XWB B;  2I07 B;  1NJI C;  1DJR D;  4LJZ C;  1BCP C;  1PYS B;  1SNP A;  2WAQ E;  5EAY A;  1WD0 A;  1DD2 A;  3E3X A;  1KDC A;  4BS9 A;  2Q2I A;  1K8G A;  3GTK B;  4J6H A;  2E8G A;  1RIP A;  4X3K A;  1HA6 A;  3BZK A;  1YJW A;  3CCQ A;  3J7Z C;  2XGT A;  4B3M Q;  3S15 H;  4FYD A;  4FVM A;  4ME5 A;  1PFM A;  3HOX B;  1PRT F;  3R93 A;  1HZB A;  5M3M B;  5KNB A;  1O7Z A;  2EVB A;  1DOK A;  1SMX A;  3KF8 A;  5M5W B;  4JI5 Q;  3H3V I;  2TMP A;  2ZTD A;  2A69 D;  2Z4H A;  4HMI A;  4DV4 Q;  3WWV A;  3NXW A;  4X62 Q;  4CKB A;  4IPD A;  2L1B A;  4RWS C;  1WYD A;  2NVY H;  1VQB A;  5KYI A;  3PF5 A;  4QCL A;  1PH5 A;  4POF A;  4IPG A;  4C3H G;  3K5O A;  2F3I A;  2M00 A;  2OQ0 A;  2K5Q A;  3U50 C;  1HR0 L;  2JP1 A;  2K5W A;  1RDP D;  3W2D A;  4A3M G;  1F9P A;  4V0B A;  4E6I A;  4B3S Q;  4C3I H;  2YYZ A;  3TS2 A;  4BBS B;  4Y7N B;  5FK9 C;  3DXJ C;  3BS1 A;  3S1N B;  1FD7 D;  1PDQ A;  2NZO A;  3F1Z A;  4HJ7 A;  2KCN A;  1T9H A;  3OW2 A;  4C3J B;  3NTH A;  1SEB D;  4X3U A;  4A3L H;  2P5Z X;  1IL8 A;  1XWE A;  1TS4 A;  3I8Z A;  3I90 A;  1TT2 A;  1FR3 A;  4JYA Q;  1H9R A;  2EQS A;  3MFG A;  3I4L A;  2R7Z H;  3RUZ A;  1IBK Q;  5A2Q E;  3HOX G;  4KK7 A;  3K5L A;  5M3F H;  2AUJ D;  3Q6S A;  4DA2 A;  3CP0 A;  4JC0 A;  3HFZ B;  4HJ9 A;  2I5L X;  3I55 A;  4QY7 A;  1VQO A;  5COY A;  5G3L F;  2PW5 A;  3OW7 A;  3IFT A;  1I94 L;  1SN8 A;  3D6W A;  2RSO A;  3UDI A;  1QVG A;  2KA7 A;  2UXC L;  1STA A;  2N49 A;  2PCF B;  4N8X 1;  3HKZ B;  5FLX L;  1IKM A;  2L9H A;  1TII D;  4KD4 A;  5FLX c;  1EOV A;  3CRL C;  1SBB B;  2V4D A;  2DJF C;  1BCP F;  4KHP Q;  3P7J A;  1VQA A;  4R4I A;  1YHQ A;  3R2I A;  1LO5 D;  3CCJ A;  3K58 A;  1ONL A;  2R6G A;  1WTW A;  2JEA I;  1NR2 A;  1XPO A;  1D5X C;  1TWF H;  2VS1 A;  1CKN A;  4BBS G;  5EKI A;  4RMF A;  1VQM A;  4C1N I;  4DV6 L;  1KNE A;  2KEC A;  4FF4 A;  1SE3 A;  2RHQ B;  1MD2 D;  3RLO A;  1CQV A;  2FJ2 A;  4P72 A;  4C3J G;  5I9P A;  2FXQ A;  1I50 B;  4IUR A;  1SE4 A;  5JAV A;  1PXU A;  2NWG A;  2L15 A;  1FL0 A;  3FDT A;  3OWF A;  5IT9 L;  1QCB D;  1HNW Q;  1PTO D;  5IT9 c;  2B2W A;  1A3T A;  2L5T A;  4OO1 G;  1YEZ A;  3OTO L;  4GN5 A;  1EQQ A;  3MC0 B;  1V1P B;  3SXH A;  3K5M A;  2YV5 A;  2PQA A;  1ESR A;  4IUT A;  2L11 A;  1MSH A;  4A3M H;  1XPR A;  3PO3 H;  2E5L Q;  4QIW B;  5JPM C;  1NUC A;  1P16 A;  4OXP A;  4DV1 Q;  2EJG C;  5C44 G;  4JBM A;  4DR7 Q;  3HOU G;  2RQX A;  2F0W A;  3PO2 H;  3BZD B;  2EYP A;  3EVQ A;  2Z6K C;  2Z8L A;  2K5V A;  3HKZ G;  4NXM L;  1MKH A;  1RCV D;  3T4A C;  1U5K A;  5JPN C;  2O5J C;  1X3Q A;  1AFP A;  2PNH A;  3CC7 A;  1H9J A;  2CH4 A;  3MEH A;  5C4H A;  4DV5 L;  3ZYY X;  4I65 A;  4DV3 Q;  1VQH A;  1D7Q A;  5CBA E;  1G6Z A;  1VQI A;  5T1I A;  1NBW A;  1EY6 A;  5DM7 3;  4GKJ L;  4JI2 L;  2JK8 A;  3NBH A;  3M4Q A;  1RF2 D;  1LLR D;  2NZ1 D;  1E0B A;  1EY9 A;  5IGD A;  4DUZ Q;  4CJ2 C;  4GLV B;  2CQO A;  4YWL A;  1QG7 A;  3ULP A;  1ZYR C;  1VQP A;  4ZCK A;  3EQL C;  5HUR A;  4HID A;  2AQ2 B;  5JJK A;  4FDB A;  5HY6 A;  3S1Q B;  5C4X B;  3TS0 A;  2WAC A;  1XPU A;  5ELB A;  2UUB Q;  3N6R A;  5IGC A;  1YNN D;  2R92 H;  4ZRZ A;  2D0P A;  4EX5 A;  3HOW G;  1B4O A;  4G57 A;  1SFO H;  1QVF A;  1ML0 D;  4BY1 B;  5DLQ E;  3I4N B;  1H95 A;  1QJO A;  4X64 Q;  2CW0 D;  4MHE A;  4AQY Q;  4A3B B;  3CCV A;  5LL6 X;  4IPH A;  4UHV A;  5KRU A;  2R93 G;  3OHX C;  4JPB W;  2L12 A;  3NEN A;  4B9W A;  3TEH B;  5C0X H;  1JE4 A;  2RSN A;  3GTO B;  2AQ3 B;  1JQY D;  3MXU A;  3J7Y W;  1FVI A;  4EQN A;  3HOY B;  3TP8 A;  1GM5 A;  2N3S A;  4BWG B;  1YIJ A;  2DY8 A;  1V8Q A;  4HSP A;  3CKI B;  1CKN B;  3ICE A;  2UXD Q;  5K36 G;  3Q8D A;  4DAV A;  2B8G A;  4OO1 H;  1YNJ C;  3U4V A;  1JR0 D;  4LFA L;  1S5B D;  3CW2 C;  3M4O B;  1DCZ A;  1QUQ A;  4I7Z C;  4L5R C;  4MN3 A;  2X6G A;  1HFG A;  1CZW A;  4M8A A;  3L9A X;  4LUV A;  3PIO 3;  3A5Z B;  3TME A;  1U0L A;  2BCO A;  3DEO A;  3N52 A;  2JSO A;  5IGF A;  3ERS X;  4UP9 A;  2B63 G;  3OSO A;  1Y1V H;  1SE8 A;  1V1O A;  1SDF A;  3TP5 A;  2B29 A;  4C2M H;  1STH A;  5JEA H;  1XMQ Q;  2EE1 A;  3GTQ B;  2PQA B;  1K83 H;  4MNO A;  4FF1 A;  3TQY A;  1LYL A;  3K7A B;  3OYY A;  4J8Q A;  4TQU S;  1VQ8 A;  1CSP A;  2VY3 A;  3P1H A;  1G91 A;  4K5X A;  5JJZ A;  2QIL A;  3GTP H;  3PIP A;  2KHJ A;  5GQO A;  2ZJR A;  3KYH C;  1WTH A;  3AFQ A;  3I72 A;  4L5T A;  4A3B G;  2NN6 G;  3SK4 A;  3C46 A;  1J5E L;  4O0A A;  4R8I A;  3H3V C;  4GZY C;  3CCS A;  1AZP A;  2A68 C;  4DV2 Q;  1L0W A;  4N8F A;  1VCI A;  1HXY D;  1BNZ A;  4FF2 A;  4OEL B;  3SE0 A;  3HOV H;  5M5Y H;  1HNX Q;  1BBX C;  5C0X I;  4K6L A;  2PMZ B;  3HOY G;  2J0T D;  2KEN A;  4QJF A;  2VNU D;  1NMF A;  4A3I B;  4DR3 L;  4A3K B;  4A93 B;  1L1O C;  3C1E A;  2K5D A;  4BA1 I;  4A3J G;  1SMY D;  4K8I A;  4XQJ A;  4XQN A;  1J6Q A;  4OO1 I;  2RBM A;  1QE6 A;  3SEB A;  5CBE E;  2SOB A;  4H13 C;  5IYB H;  3I7F A;  4F88 A;  3A8I E;  1B3A A;  1X3E A;  2EJF C;  1KDA A;  2Q2H A;  1JWU D;  5EGT A;  2E2H B;  1F9Q A;  1IW7 D;  4LF4 L;  2R93 H;  4CGY B;  4LF7 L;  3GV6 A;  4OWW B;  2FMM A;  4RA8 A;  3OOC A;  2I0Q A;  3MAQ A;  4LF5 L;  4GLA C;  3GO5 A;  2OCE A;  1I3Q H;  2F0V A;  2JA9 A;  3S24 A;  1SNC A;  2B2V A;  1EU4 A;  4L8J A;  5ELF A;  2LY7 A;  2H5X A;  1PRT D;  3ITP A;  2JA8 H;  3S15 B;  2B2T A;  4LW1 A;  4NMZ A;  1S40 A;  1WTV A;  2EYF A;  1PA6 A;  2E2J B;  5C4Z A;  1CHQ D;  5BR8 Q;  2QF7 A;  5J3B A;  1GD7 A;  2YU9 H;  1SYE A;  1AZQ A;  3GTM H;  4DAM A;  2HT1 A;  2ZXP A;  4LF8 L;  1W6K A;  4KTA A;  2IW3 A;  2AQ1 B;  3E0E A;  1YJ9 A;  3V2T A;  4YHH L;  1HHV A;  2QEX A;  4A3I G;  4R4O A;  2NVY B;  2Z0S A;  1HCZ A;  4A3K G;  4A93 G;  4CHT B;  3TP6 A;  2RCN A;  5C3E G;  1M90 C;  1XNR Q;  3NEM A;  3AFP A;  2HHH L;  1SNM A;  2EOT A;  1ENC A;  3H6M A;  2H1E A;  4O42 A;  5I2Y A;  4GKK L;  1X3G A;  1V1Q A;  3AU7 A;  3I56 A;  2DUD A;  5M9O A;  2AUK A;  2NB0 A;  3A8J E;  4C3I B;  2NVX H;  2A6E D;  1KLU D;  1JWM D;  1D1K A;  3Q24 A;  3S14 H;  4R8N A;  5D14 A;  1PTO H;  2NZH A;  1MJC A;  3D0F A;  1QVC A;  3O13 A;  1WTP A;  1EQT A;  1XMO L;  2MNA A;  1TXY A;  2D5D A;  3PCO B;  3BDO A;  4A3J H;  2QGQ A;  1HNZ Q;  2QW7 A;  1F2Y A;  1O7I A;  1TWH H;  4JOI A;  4BY7 H;  3LNN A;  2R7Z B;  4PQX A;  2JA6 H;  2HCC A;  3K5N A;  1KNA A;  4EQ5 A;  5M3F B;  4R9W A;  3W5O A;  3RLN A;  3I70 A;  2A73 B;  4GNX A;  5G3L D;  3R8B A;  2JYO A;  1VQF A;  5AJ3 L;  1W2B A;  3S16 H;  2WV6 D;  2OT2 A;  4OHJ A;  4DR6 Q;  3LWE A;  4DF7 A;  1STB A;  5KIX A;  4DKA C;  2Y0S B;  3L3O C;  4NXN L;  4TRD A;  4AYB E;  2K28 A;  2C5C A;  2UXB Q;  3KJO A;  1BCP D;  4KHZ A;  1C0A A;  3AQQ A;  1AN8 A;  3S1M H;  1PHJ A;  1CQF A;  2K52 A;  4HR7 B;  3KLW A;  3LGJ A;  3UDX A;  4ZQ3 A;  2K75 A;  3FPU B;  1EQR A;  3T1H Q;  4N9T A;  1IBL L;  3J81 j;  2MFI A;  2RF4 A;  1X32 A;  1Q86 C;  4C3I G;  1N33 L;  4B3M L;  1TWF B;  3A8K E;  2VW9 A;  1GUN A;  1HUM A;  2A5H A;  4IFD H;  1STG A;  2N78 A;  1WTQ A;  1UEB A;  2BE5 C;  1A3U A;  4I7A A;  2J7Z A;  1PZK D;  1FNU A;  4JI5 L;  1WJJ A;  1SAP A;  4DV4 L;  2R61 A;  2F0O A;  4JW0 A;  2RDG A;  1ROD A;  1ENA A;  3U58 A;  2Q8I B;  3UDF A;  3CAM A;  3CF5 A;  4G4K A;  2R7Z G;  1T5X D;  2QEJ C;  4RHS A;  3F2D A;  1BKB A;  5M3F G;  3VR3 A;  3I4O A;  1K3B C;  5E7N A;  4XTC S;  1B44 D;  1DZ1 A;  2KHS A;  4A3M B;  1VQ6 A;  3PO3 B;  5DM6 3;  1LT5 D;  5FLM H;  3P75 A;  4CJ0 B;  2HUG A;  3BDC A;  2JA5 G;  1MGS A;  3QB3 A;  2X69 A;  1VMP A;  2Y0S G;  1L2F A;  1XNQ L;  3PO2 B;  5E3F A;  1EIH A;  5DAU A;  3DEP A;  1PVO A;  1J8I A;  2YTX A;  1H9S A;  3S1R H;  2B2Y C;  3DLL A;  1NR4 A;  4LFC Q;  1N32 Q;  4UDU C;  5A35 A;  2RDH A;  3TRE A;  3NEL A;  5I9O A;  4DR5 L;  1DM0 B;  1WI5 A;  2F0Q A;  4JYA L;  3M3Y B;  4A3G G;  1E3P A;  1JB7 A;  5ELE A;  2HDM A;  1IBK L;  3D8G A;  3J7A 5;  1JOQ A;  4RGO S;  1X56 A;  3FPP A;  3CQZ H;  1STN A;  3KLS X;  3UDG A;  4LF6 Q;  4K2K A;  4ABN A;  4A3E H;  1KAB A;  2EXD A;  2M9V A;  2G9H D;  3OMG A;  5BN4 A;  2PQE A;  2YTV A;  3A74 A;  5IYC H;  4GNX B;  4RCN A;  1Y1W H;  2UUC L;  2VL6 A;  4OL7 A;  3QJY A;  5FJ8 H;  3NSW A;  1B9N A;  3S9W A;  1SFO B;  3BVZ A;  2E2I H;  2O5I C;  2NTT A;  2ZTC A;  3MXP A;  4DK6 C;  1R4Q B;  1Q82 C;  3VR4 A;  3PO3 G;  4JI1 L;  4NKL A;  3STB C;  4JI0 Q; 
#chains in the Genus database with same CATH homology
 4KMU C;  4XIG S;  5FLX E;  2EXZ A;  4DXG A;  4ULL A;  1Y8P B;  4U68 A;  5J22 A;  4OGQ C;  1XYI A;  3MXN A;  1M8A A;  2ICE C;  2PZW A;  1VF5 C;  4PMC A;  3NHH A;  4KKT A;  3CU7 A;  1F9R A;  4LK1 C;  1EL0 A;  1STY A;  2NUC A;  1HTP A;  4Z9C B;  2PO4 A;  2D62 A;  4B08 A;  1Y1V B;  5J39 A;  5IT9 E;  4QB4 A;  4RFB A;  5C44 B;  3HOU B;  1CZG A;  1K83 B;  1A3V A;  3SK5 A;  4RCO A;  1O78 A;  4HSV A;  3GTP B;  3J81 L;  4IUV A;  2F1M A;  1BDO A;  2EY5 A;  4XXE A;  4HTH A;  1O7L A;  1S4Z A;  4DK1 A;  2A69 C;  3VR5 A;  1GXD C;  3IFD A;  3SK8 A;  1RJT A;  2IX0 A;  3HOV B;  5M5Y B;  5C0X G;  1EY8 A;  3SR1 A;  3BYY B;  3C2P A;  2H4O A;  4PMB A;  2C9O A;  2BA1 A;  3NWT A;  3G7L A;  1ILQ A;  2WAQ B;  4WOR A;  3HOW B;  1K8M A;  2KOL A;  5FO7 B;  1Q1B A;  2Z1C A;  1HQR D;  2E2D C;  4N9P A;  1M4V A;  5I2X A;  2R93 B;  5JVG 3;  1WTX A;  5C0X J;  3T51 B;  4DAY A;  1NAP A;  1KAA A;  1RKN A;  3NTI A;  4FXD A;  5JEA G;  3VR2 A;  1I3Q B;  3E0J A;  3VR6 A;  5EBD A;  4Q0F A;  4CJ1 B;  3G6J B;  5E4W C;  4WJW A;  3SDZ A;  1C48 A;  1BXT A;  3K0Y A;  2D9U A;  5CV8 A;  1RD9 D;  4KY6 A;  1YNJ D;  1GUO A;  4OIK A;  2JA8 B;  3SK6 A;  3I73 A;  4K14 A;  1I4X A;  3AB9 A;  4XYO A;  2YU9 B;  1CM9 A;  2B63 B;  3GTM B;  5JEA J;  1O7Y A;  4FXG C;  3NP8 A;  2IL8 A;  2Q8R E;  2F0G A;  2LS0 1;  3QOL A;  3NQI A;  3TDQ A;  1LTB D;  1XXG A;  3VYU A;  2XRS D;  1QNK A;  1GUG A;  1Y69 U;  1B53 A;  3K57 A;  5ISR A;  3KLS A;  4V19 0;  2EY2 A;  3WDN A;  2NVX B;  4K2L A;  2NTS A;  2A68 D;  1KLG D;  3D6C A;  4KI0 A;  1PTO B;  4KJN A;  3URY A;  1AW7 A;  1NSN S;  2CVR A;  4DK0 A;  4DXF A;  4H44 C;  4X3T A;  5K5P A;  3T13 A;  1JB3 A;  5CV6 A;  1E2Z A;  1IKL A;  2F0I A;  4BY7 B;  4A3J B;  3M7G A;  1SNO A;  1TWH B;  4ILW A;  3PUV A;  2KUM A;  3M4Y A;  2JA6 B;  1CFM A;  2K03 A;  1EY7 A;  2B2W C;  1H9M A;  1LTA D;  1HPC A;  2JE6 I;  3X3N A;  3PUZ A;  2PNR C;  4HCE A;  4HMJ A;  5NUC A;  2KVM A;  5CV5 A;  1OO9 B;  2E75 C;  4XDX A;  5AFW A;  1A2U A;  1RTO A;  3FEW X;  2ICI A;  1SYG A;  5E4X A;  1MBY A;  2XN9 C;  3QIA A;  4OIJ A;  4LAA A;  3S1M B;  4ZUJ A;  4DNR B;  2FFK B;  4KJO A;  1STE A;  4HAE A;  3V05 A;  4PNY A;  3K6O A;  3NQT A;  3EA6 A;  1TS2 A;  2F0T A;  2F0U A;  1RTN A;  1S5F D;  1TS5 A;  1F9S A;  4EQO A;  1LAB A;  5J1Z A;  3D4D A;  3PUY A;  1FNV A;  3CHB D;  3KUP A;  5C3W A;  3GQB A;  1Y8O B;  5C3E B;  3IKJ A;  2IT1 A;  4RKB A;  2MPM A;  4ID6 A;  4MIU A;  1V43 A;  2PZT A;  1UUP A;  2IPK D;  5EKL A;  3VA7 A;  4HCS A;  5T1G A;  5ELD A;  5FO8 B;  5KYL A;  2WIN B;  4RH6 A;  1H9K A;  2K05 A;  3T56 B;  1QIL A;  1HRJ A;  4IQZ A;  1J9O A;  1LT4 D;  3FRP B;  4C1N K;  3FMC A;  4KKS A;  3EFX D;  4ODG A;  1SYD A;  1D1I A;  2B2U C;  5EPK A;  1EY4 A;  3NK9 A;  3S1R B;  1L0X B;  1GJX A;  4IZ8 A;  1VDZ A;  4KY5 A;  1JC7 A;  1F2L A;  4IAL A;  3TSS A;  4DGZ A;  5I6Y A;  1FYC A;  4RHR A;  2G9D A;  4X3S A;  1G29 1;  4IFD G;  3CQZ B;  2WKC A;  1TS3 A;  1TVX A;  2MUY A;  4A3E B;  3C3L A;  1DOM A;  4ZLT F;  1HQM C;  4FNF A;  1Y1W B;  2F0J A;  1SND A;  1EEF D;  1F77 A;  3A7A B;  4K5W A;  1BOS A;  2E2I B;  2PZU A;  3F2U A;  4U67 3;  1EYD A;  4ZK9 B;  2PW7 A;  1EU3 A;  2GA4 B;  1DON A;  2FHT A;  1SYB A;  4F87 A;  5ELC A;  2HQE A;  5LHY 1;  4IFD J;  1QOH A;  5JOB A;  5C5M A;  3MVV A;  3Q23 A;  2SNM A;  1OXT A;  1LTI D;  5BN3 A;  1I4H A;  2TSS A;  5FOB B;  1MI2 A;  5CGK A;  1ENF A;  1D6E C;  3MXG A;  2A6H C;  3DWP A;  1X3P A;  5HGT A;  3A54 A;  4L6T B;  1U4L A;  4KD3 A;  5F2D A;  1JWS D;  1DYQ A;  4DU9 A;  1GHK A;  3BYT B;  2EYH A;  3A56 A;  5CYU A;  4FO2 A;  2JA5 B;  2A74 C;  4KY7 A;  1HUN A;  1PRT C;  1I6V C;  1GHJ A;  4RGT A;  2JXM B;  3ND9 A;  1EYA A;  1C4Q A;  1PRT B;  3DHQ A;  4XT1 B;  4CKC A;  2IX1 A;  2EY6 A;  1B2T A;  2OXP A;  1CHP D;  2KEE A;  3FKI B;  3HGB A;  3MWY W;  2XSC A;  4KN7 C;  1S5D D;  4ZUI A;  2PPB C;  2VB2 X;  4CBV A;  3I91 A;  1I6H B;  3QWN A;  1GUW A;  4RGN A;  4H7B A;  4K5V A;  4A3G B;  1JCK B;  2B2T C;  1KDB A;  2F0D A;  3KK7 A;  1WCM B;  1JOK A;  2J4X A;  2K32 A;  1EFI D;  5D65 A;  4QMG A;  2VUM B;  4G7H C;  1EWC A;  4KHV A;  3X3M A;  4NDX A;  3PUX A;  1IYV A;  2EY1 A;  2VXW A;  3NTK A;  1SJE D;  1F2Z A;  1CK1 A;  2SNS A;  2F0S A;  1R9T B;  5EJW A;  2LFN A;  3BDL A;  4C56 C;  5IIF A;  1SSO A;  4DFA A;  3D3R A;  3J80 L;  2QDB A;  1ZXT A;  2DNC A;  1PMR A;  1UAP A;  1OXX K;  3BVG A;  4FXK C;  3HG9 A;  1XTC D;  1MSG A;  3UI2 A;  5TSS A;  1IHZ A;  3RLF A;  5DEH A;  4F8M A;  4G7O C;  4RAU C;  4IFD I;  3OIQ A;  2F0P A;  1BCP B;  1NCV A;  3M85 A;  1EEI D;  1SE2 A;  2K01 A;  2NVQ B;  3DUZ A;  2LMC B;  5KGU A;  2R92 B;  1HFN A;  3PV0 A;  4K6D A;  2NVT B;  4EGV A;  3SHL A;  3S17 B;  2B39 A;  3SVM A;  3KLR A;  1PLF A;  1V1P A;  5BN5 A;  3JAM L;  4KV6 A;  1EY5 A;  4IUU A;  2IX3 A;  1O80 A;  3HRZ C;  2F0L A;  2RVL A;  1Q12 A;  1SJH D;  3J81 E;  5EKK A;  2NBF A;  2FMC A;  1AP0 A;  1U9R A;  1FNW A;  2K1B A;  4AYB B;  1E2W A;  1E2V A;  4EQP A;  1UEA B;  3J7A V;  2DN8 A;  2F0M A;  3VYT A;  3RMH A;  2O4X A;  4JK1 C;  3MHB A;  4QF4 A;  2ZXR A;  2WKD A;  5FO9 B;  3M7N A;  1QNU A;  3PUW A;  1I4P A;  4IN3 A;  4ZKB B;  4C2M B;  4KN4 C;  1SXT A;  2XRQ D;  3ERO A;  2I46 A;  1Q8I A;  2KJX A;  4UAI A;  2N55 A;  2ZXO A;  2EJM A;  3DM1 A;  2MHV A;  1S5E D;  3DWQ A;  2HDL A;  1TU2 B;  1H9S B;  1KTK A;  3VYR A;  4JBW A;  1ET9 A;  1LTG D;  1ZYR D;  1A2T A;  1IYU A;  1JOO A;  2SEB D;  3H94 A;  1GUT A;  4DAP A;  1CA6 A;  1I4G A;  4HN7 A;  3GD7 A;  3MFY A;  3OMC A;  1EZ8 A;  1ZEQ X;  2CHB D;  3HP3 A;  5A2Q L;  3WOE A;  2OEO A;  1XX8 A;  1ET6 A;  3NUC A;  4NW2 A;  4FF3 A;  1G8Z D;  4P2C B;  1D5Z C;  5LL6 S;  2DNE A;  4CKE A;  1B1Z A;  1A15 A;  3QG1 A;  1HA5 A;  2L55 A;  3A55 A;  3TZU A;  4B9X A;  4TKO B;  2X6L A;  3J7A F;  4TSS A;  3OPO A;  3TZD A;  1CT1 D;  2IJ0 A;  5C3X A;  5C6A A;  1GOZ A;  2K7V A;  1F2M A;  4FP5 D;  2SDF A;  2XWJ B;  4M1U B;  5IOC A;  1HTL D;  5CV7 A;  2EPB A;  3T16 A;  2Z4I A;  3H09 A;  4ZYS A;  1PFB A;  2F0N A;  3CRK C;  1W6J A;  3E5S A;  1AEX A;  2BOS A;  1LAC A;  1TY2 A;  4WFN 3;  1EY0 A;  1VMC A;  2LKV A;  1Y8N B;  5C5L A;  1C8C A;  1EYC A;  5EQ0 A;  3W3A A;  2E76 C;  4A3D B;  3HZX A;  3QO2 A;  1I4Q A;  4Q5V A;  2XNA C;  2ZT9 C;  1WTO A;  1EOT A;  3D4R A;  1PTO C;  3S14 B;  2CQA A;  3GTL B;  5IGE A;  2DY7 A;  4PV1 C;  2WII B;  4K8J A;  1Z6H A;  1ILP A;  5I4D A;  1FGB D;  3GTJ B;  5E1F A;  4G7Z C;  2B2U A;  3HOZ B;  2OF1 A;  2RKS A;  4IUN A;  5CC4 A;  3RD4 A;  2HCI A;  4HED A;  2D2C C;  3S16 B;  1S5C D;  1Z47 A;  2BA0 A;  3U9S A;  4ZKC B;  1DOL A;  4QUC A;  1BR9 A;  1Q1E A;  1WD1 A;  2F0F A;  4XT3 B;  5EPL A;  3MA2 B;  4BA2 I;  4L63 B;  1I4R A;  2WB1 B;  2BDN A;  1OXS C;  1TY0 A;  3BVM A;  4DN4 M;  5KND A;  2R3Z A;  2M2L A;  3RZO B;  2JEB I;  1G2T A;  5C4J B;  3GV3 A;  1YNN C;  2WP8 J;  4S3S A;  5CMD A;  3HS0 C;  1U4R A;  1SNQ A;  1EZ6 A;  3ND8 A;  3R2T A;  3S2H B;  2CW0 C;  4BBR B;  2MP1 A;  3GTG B;  2EZV A;  1B50 A;  1PZJ D;  4EVO A;  3EJI A;  2K04 A;  2XVS A;  3I3C A;  2XIW A;  3Q22 A;  3RZD B;  1D2B A;  2F0H A;  1TWC B;  1TR5 A;  3KBG A;  1JIC A;  3HEJ A;  2PYK A;  3D4W A;  2AWN A;  3OIP A;  2N88 A;  5KNC A;  2KQ3 A;  3NBI A;  1PTO F;  2FIN B;  1EIG A;  1TKW B;  1B9M A;  3Q0A A;  1LV9 A;  2A6H D;  3IAY A;  3T53 B;  2NYZ D;  4IUP A;  2O2L D;  4XQQ A;  3C1F A;  3DWA A;  1Q90 A;  3GP7 A;  3L7Z C;  1QB5 D;  3AMU A;  1RHP A;  5K36 H;  1GUS A;  2ID0 A;  3TP7 A;  3U9O A;  4XYQ A;  1TWA B;  3TN2 A;  3ONA B;  3OWE B;  5D3D A;  1JOR A;  2K33 A;  3H91 A;  1U4M A;  1SYC A;  5EPJ A;  2MJ8 A;  2F0E A;  2L0C A;  4QUF A;  1Z7T A;  5M5X B;  3VYS A;  3WOF A;  1II3 A;  2F3W A;  2K6A A;  4ZAI A;  5CV9 A;  1LTS D;  1K8O A;  3D31 A;  2EYJ A;  2BE5 D;  5COR A;  1SMY C;  4O1N A;  3NE5 B;  1DXM A;  3S2D B;  1CA5 A;  3IL8 A;  1G2S A;  2NN6 H;  2Q8T A;  5D3I B;  1ESF A;  5KEE A;  2F3V A;  1IW7 C;  2ENB A;  2F4I A;  2B2Y A;  1LT6 D;  5JVH 3;  1BO0 A;  3MZ5 A;  4PMW A;  2B8F A;  1SYF A;  4LMQ D;  1OXU A;  3KBX A;  5IGG A;  5IOD A;  1LTR D;  4KKU A;  2QKI C;  5FKA C;  3A7L A;  4A3F B;  3FVQ A;  1EQV A;  1PZI D;  1R4P B;  2L4N A;  2EYO A;  2EDG A;  5IGB A;  3E6Z X;  1A6X A;  1UNS A;  2BDO A;  3K59 A;  1WTR A;  2B2V C;  2F03 A;  2IWH A;  1TQO A;  1CTM A;  2VB3 X;  3NWS A;  1LT3 D;  1VF7 A;  1EWH A;  3R3O A;  3LWU A;  4WRD A;  3PIP 3;  1BUV T;  3I4M B;  3LX0 A;  3J80 E;  1Q3L A;  2MGS A;  2RA4 A;  1T5E A;  1TWG B;  1OXV A;  4DNT B;  1PYW D;  2NN6 I;  2A6E C;  1L0Y B;  1LTT D;  1ICW A;  3PMF A;  2AWO A;  3V96 A;  4H0L C;  2EYM A;  4J1M A;  3VA5 A;  3ERQ A;  3H0G B;  5DNF A;  3P20 A;  1WVL A;  1PFN A;  3BG3 A;  1BQQ T;  1QWY A;  5I6W A;  4IUQ A;  3MTS A;  2F0K A;  1BF4 A;  5CV4 A;  4C3H B;  5CR3 A;  1D5M C;  2KCC A;  1U4P A;  1ZKO A;  3QOJ A;  2KED A;  2EYL A;  2JA7 B;  4NP5 A;  5EBC A;  1CI3 M;  3JAM E;  3TBI B;  2RDF A;  4RKL A;  4RGM A;  2E74 C;  4F7X A;  2QCP X;  3DMU A;  3NPP A;  4YIJ A;  2XWB B;  2I07 B;  1DJR D;  4LJZ C;  1BCP C;  1DD2 A;  1SNP A;  1WD0 A;  1KDC A;  4BS9 A;  3GTK B;  4J6H A;  1HA6 A;  4X3K A;  4FYD A;  4FVM A;  4ME5 A;  1PFM A;  3HOX B;  1PRT F;  3R93 A;  5M3M B;  5KNB A;  1O7Z A;  2EVB A;  1DOK A;  3KF8 A;  5M5W B;  2TMP A;  2A69 D;  2Z4H A;  4HMI A;  3NXW A;  4CKB A;  2L1B A;  4RWS C;  5KYI A;  4QCL A;  4C3H G;  3K5O A;  2M00 A;  2K5Q A;  2JP1 A;  2K5W A;  1RDP D;  3W2D A;  1F9P A;  4V0B A;  4E6I A;  2YYZ A;  4BBS B;  4Y7N B;  5FK9 C;  3DXJ C;  3BS1 A;  3S1N B;  1FD7 D;  1PDQ A;  2KCN A;  4C3J B;  3NTH A;  1SEB D;  4X3U A;  1IL8 A;  1XWE A;  1TS4 A;  3I8Z A;  3I90 A;  1TT2 A;  1FR3 A;  1H9R A;  3MFG A;  3I4L A;  3RUZ A;  5A2Q E;  4KK7 A;  3K5L A;  2AUJ D;  3Q6S A;  4DA2 A;  5COY A;  5G3L F;  2PW5 A;  3OW7 A;  3IFT A;  3D6W A;  2RSO A;  2KA7 A;  1STA A;  2PCF B;  3HKZ B;  5FLX L;  1IKM A;  2L9H A;  1TII D;  4KD4 A;  3CRL C;  1SBB B;  2V4D A;  1BCP F;  3P7J A;  3R2I A;  1LO5 D;  3K58 A;  1ONL A;  2R6G A;  1WTW A;  2JEA I;  1NR2 A;  1D5X C;  5EKI A;  4C1N I;  1KNE A;  2KEC A;  4FF4 A;  1SE3 A;  1MD2 D;  5I9P A;  1CQV A;  2FJ2 A;  4C3J G;  1I50 B;  4IUR A;  1SE4 A;  5JAV A;  1PXU A;  2NWG A;  3FDT A;  3OWF A;  5IT9 L;  1QCB D;  1PTO D;  2B2W A;  1A3T A;  2L5T A;  4OO1 G;  3MC0 B;  1V1P B;  3SXH A;  3K5M A;  1ESR A;  4IUT A;  2L11 A;  1MSH A;  4QIW B;  5JPM C;  1NUC A;  2EJG C;  2RQX A;  2F0W A;  3BZD B;  2EYP A;  3EVQ A;  2Z8L A;  1RCV D;  3T4A C;  5JPN C;  2O5J C;  1X3Q A;  1AFP A;  1H9J A;  3MEH A;  5C4H A;  3ZYY X;  4I65 A;  5CBA E;  1G6Z A;  5T1I A;  5DM7 3;  1EY6 A;  3NBH A;  1RF2 D;  1LLR D;  2NZ1 D;  1E0B A;  1EY9 A;  5IGD A;  4CJ2 C;  1QG7 A;  1ZYR C;  3EQL C;  5HUR A;  2AQ2 B;  3S1Q B;  5C4X B;  2WAC A;  5ELB A;  3N6R A;  5IGC A;  1YNN D;  4ZRZ A;  1B4O A;  4G57 A;  1ML0 D;  4BY1 B;  3I4N B;  1QJO A;  2CW0 D;  4MHE A;  4A3B B;  5LL6 X;  5KRU A;  3OHX C;  2L12 A;  4B9W A;  5C0X H;  1JE4 A;  2RSN A;  3GTO B;  2AQ3 B;  1JQY D;  3MXU A;  3J7Y W;  4EQN A;  3HOY B;  3TP8 A;  4BWG B;  2DY8 A;  1V8Q A;  4HSP A;  3CKI B;  5K36 G;  4DAV A;  2B8G A;  4OO1 H;  1YNJ C;  1JR0 D;  1S5B D;  3M4O B;  1DCZ A;  4I7Z C;  4MN3 A;  2X6G A;  1HFG A;  1CZW A;  4M8A A;  3L9A X;  3PIO 3;  3TME A;  2BCO A;  3DEO A;  3N52 A;  2JSO A;  5IGF A;  3OSO A;  1V1O A;  1SDF A;  3TP5 A;  1STH A;  5JEA H;  2EE1 A;  3GTQ B;  4FF1 A;  3K7A B;  4J8Q A;  4TQU S;  1G91 A;  3P1H A;  4K5X A;  5JJZ A;  2QIL A;  3I72 A;  2NN6 G;  3SK4 A;  3C46 A;  4R8I A;  3H3V C;  4GZY C;  1AZP A;  2A68 C;  1VCI A;  1HXY D;  1BNZ A;  4FF2 A;  3SE0 A;  1BBX C;  5C0X I;  4K6L A;  2PMZ B;  2J0T D;  2VNU D;  4A3I B;  4A3K B;  4A93 B;  3C1E A;  2K5D A;  4BA1 I;  1SMY D;  4K8I A;  4XQJ A;  4XQN A;  4OO1 I;  2RBM A;  1QE6 A;  3SEB A;  5CBE E;  2SOB A;  4H13 C;  4F88 A;  3A8I E;  1B3A A;  2EJF C;  1KDA A;  5EGT A;  1JWU D;  2E2H B;  1F9Q A;  1IW7 D;  4CGY B;  3GV6 A;  2FMM A;  4RA8 A;  3OOC A;  3MAQ A;  3GO5 A;  2F0V A;  1SNC A;  2B2V A;  1EU4 A;  4L8J A;  5ELF A;  2LY7 A;  1PRT D;  3ITP A;  3S15 B;  2B2T A;  4NMZ A;  1WTV A;  2EYF A;  2E2J B;  5C4Z A;  1CHQ D;  2QF7 A;  1SYE A;  1AZQ A;  2ZXP A;  1W6K A;  4KTA A;  2IW3 A;  2AQ1 B;  3V2T A;  1HHV A;  2NVY B;  1HCZ A;  4CHT B;  3TP6 A;  1SNM A;  2EOT A;  1ENC A;  3H6M A;  2H1E A;  4O42 A;  5I2Y A;  3AU7 A;  5M9O A;  2AUK A;  4C3I B;  2NB0 A;  3A8J E;  2A6E D;  1KLU D;  1JWM D;  1D1K A;  3Q24 A;  4R8N A;  5D14 A;  1PTO H;  3O13 A;  1WTP A;  1EQT A;  2D5D A;  3BDO A;  1F2Y A;  3LNN A;  2R7Z B;  4PQX A;  2HCC A;  3K5N A;  1KNA A;  5M3F B;  4R9W A;  3I70 A;  2A73 B;  5G3L D;  3R8B A;  2JYO A;  2WV6 D;  2OT2 A;  4OHJ A;  3LWE A;  4DF7 A;  1STB A;  5KIX A;  2Y0S B;  3L3O C;  4TRD A;  2K28 A;  2C5C A;  1BCP D;  4KHZ A;  1AN8 A;  1CQF A;  4HR7 B;  4ZQ3 A;  3FPU B;  4N9T A;  1X32 A;  4C3I G;  1TWF B;  3A8K E;  1GUN A;  1HUM A;  2A5H A;  4IFD H;  1STG A;  1WTQ A;  2BE5 C;  1A3U A;  2J7Z A;  1PZK D;  1FNU A;  1SAP A;  2R61 A;  2F0O A;  2RDG A;  1ROD A;  1ENA A;  2Q8I B;  4G4K A;  1T5X D;  2QEJ C;  4RHS A;  3VR3 A;  4XTC S;  1B44 D;  1DZ1 A;  2KHS A;  4A3M B;  3PO3 B;  5DM6 3;  1LT5 D;  3P75 A;  4CJ0 B;  2HUG A;  3BDC A;  1MGS A;  3QB3 A;  2X69 A;  1VMP A;  3PO2 B;  5E3F A;  1EIH A;  5DAU A;  3DEP A;  1J8I A;  1H9S A;  2B2Y C;  1NR4 A;  4UDU C;  5A35 A;  2RDH A;  5I9O A;  1DM0 B;  2F0Q A;  3M3Y B;  5ELE A;  2HDM A;  3D8G A;  1JOQ A;  4RGO S;  3FPP A;  1STN A;  3KLS X;  4K2K A;  4ABN A;  1KAB A;  2M9V A;  2G9H D;  3OMG A;  5BN4 A;  2PQE A;  4RCN A;  4OL7 A;  3QJY A;  3NSW A;  1B9N A;  3S9W A;  1SFO B;  3BVZ A;  2O5I C;  2NTT A;  3MXP A;  1R4Q B;  3VR4 A;  4NKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...