4Z9CB

Ecpltab oxidized
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
ADYDKYFSNVQINNLSYGVYTSGGKESQFFCIGIKRDNVTLPIHNMCKVDVFGSHKQGFDAMMEMAKYYYATGESIRVYYKENVWSDSEFKKAFSTNELISLSTCSSSDYCMGPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pertussis toxin-like subunit ArtA
publication title Structure and function analyses of a pertussis-like toxin from pathogenic Escherichia coli reveal a distinct mechanism of inhibition of trimeric G proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 115
sequence length 115
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4z9cB00
1BXTA 5FKAC 3OWEB 1LTRD 3R2IA 2AQ2B 1CHQD 1T5XD 1D6EC 2TSSA 1BCPF 1ENFA 2QEJC 2AQ3B 2O2LD 1I4GA 1RCVD 3BYYB 3R8BA 1LT6D 4C56C 2IPKD 1TY2A 1PRTB 1LT5D 4RGOS 5ELFA 1TY0A 1DYQA 1PTOH 4RFBA 1LO5D 1LTBD 1FGBD 1FNVA 1CHPD 1F77A 3BZDB 1HQRD 1TS4A 4TSSA 3MFGA 4RHRA 2RDGA 1I4XA 2XRQD 1BCPB 3BVZA 1GOZA 4L6TB 2NTTA 1EWCA 1B1ZA 1KLGD 3GP7A 1AN8A 1I4RA 1S5FD 5TSSA 1SE2A 1HXYD 1PTOC 3DWQA 4RGNA 2AQ1B 1ET6A 1TS2A 1LLRD 1HA5A 5D3DA 1PZJD 1G8ZD 1LT3D 3EA6A 2Z8LA 1CQVA 1SXTA 3MC0B 2ICIA 1CK1A 2WV6D 4L63B 1EU3A 1D5ZC 1JWSD 1JWUD 1PZID 1RDPD 1PTOD 3DWAA 1PRTC 5ELDA 1KTKA 1L0XB 2XNAC 1EFID 4UDUC 3SEBA 1FNUA 2QILA 5D3IB 1FNWA 1PTOF 3KLSX 2SEBD 4BWGB 1JCKB 5ELEA 1SJHD 3V05A 3URYA 4K6LA 1QILA 1STEA 1XTCD 1LTAD 3BVGA 1JR0D 1V1OA 1M4VA 1I4PA 1EU4A 4RCOA 1S5ED 2R61A 4RGTA 1TS5A 4O1NA 1D5XC 4RGMA 1PRTF 5ELCA 1L0YB 1SEBD 1I4HA 5ELBA 2XRSD 1B44D 3CHBD 4DXGA 1I4QA 1LTGD 4DXFA 2J4XA 1MD2D 1PTOB 1UUPA 2XN9C 5FK9C 1LT4D 4Z9CB 1S5CD 1AW7A 4RHSA 1HTLD 1LTTD 1FD7D 2RDHA 5I4DA 3BVMA 3R2TA 1SJED 1V1PB 1ESFA 1SBBB 1DJRD 1UNSA 2CHBD 4OHJA 1D5MC 3DWPA 1CT1D 1SE4A 1XXGA 1EEFD 1S5DD 3TSSA 1RF2D 1PYWD 1PRTD 1BCPC 3EFXD 3W2DA 4ZYSA 1V1PA 1LTSD 1KLUD 1PZKD 3BYTB 1EEID 1SE3A 2G9HD 2IJ0A 1ET9A 1TS3A 3O13A 4RH6A 1S5BD 1LTID 1JWMD 1JQYD 1RD9D 1BCPD 2NTSA
chains in the Genus database with same CATH superfamily
3QOLA 2N78A 3T56B 5FKAC 1CZWA 1IKLA 3I4NH 2RF4A 3D8GA 2AQ2B 3ERQA 3ER0A 5GROA 4HJ5A 1ENFA 4PZ7A 4A3LH 3HG9A 3R8BA 1PV4A 2QGQA 1PH7A 2IPKD 3OIPA 4DR6Q 1K28A 1JC7A 5JJLA 3S1RH 3TP6A 2JA5B 4JI0Q 3UDGA 1C4QA 2L55A 1N34L 5DM73 2EJMA 4M1UB 5JOBA 3I72A 3F2CA 1MJCA 3S2HH 2FFKB 3PIP3 3P7JA 1Z9FA 1I4RA 4HMJA 3DWQA 1SYFA 4K8IA 3J80c 3HZXA 4PG3A 5FOBB 3T1HL 4JI3Q 2Q8RE 2OTJA 4LF6L 2Z8LA 1N32L 1KIXA 2JSOA 1GD7A 2K5NA 1R9TB 1OXXK 5CV4A 3TP8A 4PMBA 4A3JG 1O7IA 3EIVA 4CKEA 1EFID 2A8VA 3M4PA 2ZM6L 1IZ6A 4ZCKA 3CQZH 3GTMH 4RAUC 2NB0A 1WTPA 1QNKA 1E24A 4TVAB 3S17H 5I6WA 2I5LX 5IGEA 1VQMA 4LWCA 1NUCA 5ELCA 2JA6G 4DV0L 3KLWA 5J1ZA 1JJ2A 1XNQQ 1HZAA 4AYBG 3VR4A 2JEBI 1STAA 1HJPA 3SVMA 2VUMB 1YIJA 3GTQH 1XMOQ 1JJCB 1J6QA 4C3JG 3PF5A 2RSOA 3J81E 2X6GA 2A74C 2IY5B 1F9SA 3P20A 4WORA 4CDFC 5F2DA 3E9HA 1RF2D 1YI2A 4OELB 4QCLA 3HKSA 1C8CA 2K5WA 1A2TA 5C0XG 4ILWA 2E2IH 4ZAIA 1EQTA 1WTQA 3TZUA 4DAPA 1Q12A 2BE5C 2QW7A 2MNAA 5CR3A 1K0RA 4NKLA 3J7A5 4DR4Q 1KL9A 1BXTA 1GKHA 4A3JH 1Y8PB 2K04A 2K5VA 2WKDA 4XT1B 1BCPF 4XQNA 2E2HH 3V2TA 2K1BA 4X3TA 5EQ0A 4P74A 1EYDA 1I6HB 4C56C 4K2KA 1NR2A 1E2ZA 1GJXA 1JICA 2BOSA 5GAEC 1H9KA 3J81i 2SNMA 2NZ1D 3SHLA 1PH4A 1SE8A 5IYDG 2MGSA 5EGTA 4CJ2C 3HOWG 1HQRD 2JA6H 2EQSA 1WD0A 1STGA 4MTNA 3ULPA 1TWAB 1DONA 4JI2Q 1IW7C 4O0AA 4U673 4C3JH 4RGNA 3H3VH 3J81L 1XNRQ 2BA1A 3M7GA 3S24A 1K8GA 3G4SA 4HSVA 3NELA 3M3YH 1YJWA 3NSWA 3HGBA 2ICIA 1SMYC 2BA0A 1R4PB 1JWSD 4IFDG 3N52A 3FP9A 4NMZA 1Q86C 4UDUC 1V43A 1KDAA 4J1MA 5LL6S 1K83H 3STBC 2KQ3A 4X3UA 2IX3A 3U58A 4LFBL 4ZUIA 3VYRA 2SEBD 1MI2A 2E2DC 4BY7B 3MXNA 1VF7A 3BVGA 4K5WA 3S1NB 3QWNA 4HR7B 4RGMA 2YTVA 1RIPA 1MSHA 4MZ9A 4R9WA 4H44C 3T16A 4ZK9B 2OQKA 5LHY1 1FR3A 3BDLA 3K5MA 4JV5L 4DNTB 2AMCB 1UUPA 2L5TA 2R92B 3HOYB 3HOWH 4A75A 1H9SA 4LF8Q 5BR8Q 2EYHA 4DAYA 3HKZE 1J5EQ 1UNSA 3KBGA 2M2LA 1L1OA 5IWAL 3M4OB 1CKMA 1BCPC 4DPGA 2YTXA 4OXPA 3X3NA 5LMNW 1JOOA 1KLUD 1LTSD 3JC66 2HCCA 3TN2A 1YNXA 2SDFA 1U4RA 2EYPA 1WTOA 1VMPA 1VQ8A 2LXJA 4JVZA 4E6IA 4DR2L 4GOPB 4IFDH 3I70A 3V96A 3R2IA 4XYQA 4IUQA 3OPOA 4DKAC 2NVTB 1TWHB 2WACA 5LMUQ 3J80i 3DM3A 2F0NA 2CFMA 2ZT9C 1DOMA 3D31A 3L3OC 4A3GG 3I73A 1MSGA 1ICWA 4A3MG 1X56A 2NVYH 2DJGC 1KRTA 1YNNC 1HUNA 1FNVA 1U4MA 3OTOQ 3BS1A 2ZTCA 4R4QA 4PQXA 1E1OA 3CCSA 2PMZB 3S1QB 2EYJA 5LMNL 4OWTB 1YJ9A 3I91A 1PYSB 2GN5A 1AN8A 4DK0A 2KCNA 5JAVA 3FKIB 2F0WA 4S3SA 4RCNA 5C5LA 5D14A 1CQFA 3WDNA 3A7AB 1LT3D 3RZOH 5M5YB 1PXUA 4X65L 1BR9A 2R7DA 3SK4A 2BDNA 4LW1A 4IQZA 3BU2A 1DZ1A 2PW5A 4FXDA 1OTCA 3ERSX 3KFUA 1S4ZA 3G6JB 1F9PA 3C1EA 3TEHB 4KHVA 2F0LA 1B3QA 1WCMB 2E5LL 1LM0A 1PH8A 1ESRA 1XTCD 1AEXA 2HDMA 3QOJA 1C7YA 2JP1A 2VQEL 3SGIA 1S3OA 1IHZA 5I9PA 2KVMA 4DUZQ 1GUNA 4A3GH 5GQOA 3QR8A 3I4MB 1YHQA 3RD4A 1I4QA 4HSPA 2N88A 3VA7A 2WAQE 2KEDA 2HIVA 1VQEA 1NMFA 4RHSA 1V9PA 4IOAA 4IPDA 1WFQA 4FXKC 1X65A 4A3BB 3M4YA 1MIUA 4X6AH 4Y7NB 3NP8A 2UXDL 1SNDA 1Q8KA 1STBA 1Y1WG 3R3OA 4HJ7A 3K8AA 1PH6A 2YU9B 3MXPA 2D0OA 5C3WA 4CDCC 4HCEA 1DCZA 1B9NA 2HQLA 4LF9Q 4NDXA 1XPOA 1HUMA 3I90A 2JA7G 3K5NA 1Y1VG 5G3LF 3CCLA 4JI8L 1A2UA 2UUAL 4ABNA 4V0BA 1D6EC 3S16H 3MHBA 1X6OA 2K50A 3I2ZA 4A3CG 2O2LD 4HMIA 2Q8TA 3F2BA 2K33A 1PRTB 1PLFA 1LT5D 2HIXA 2JYOA 2JQOA 1TY0A 4IUVA 4JYAL 3H0GB 1HNZL 3X3MA 2VQFL 3NENA 1W3SA 1X9NA 3DLLA 2RCNA 3MFGA 2XWJB 4JI6Q 2IT1A 2VB2X 4DK6C 2L1BA 3NWSA 4B08A 5C4XG 4JW0A 2A6HC 1HNWQ 1EIHA 4MNOA 1B70B 1LACA 1WTWA 2HHHQ 2I5MX 3UDXA 2FHTA 2K03A 3VYSA 4JBKA 4OX9L 1L2FA 2ZJQA 2D9UA 3GQBA 1UAPA 4A3IH 1RKNA 1FYCA 1GO3E 2F3WA 5KNDA 4LUOA 3D4RA 1I6VC 4IALA 1D5ZC 4DR6L 1ONLA 3CD6A 3RZDB 1YEZA 3CCRA 1QE6A 1S40A 1SNQA 1ILQA 2ZTEA 1A62A 2P5ZX 1RTOA 4HN7A 2JA7H 2QILA 4IPCA 2F1MA 4DUYL 4NB3A 4P71A 4BWGB 5CV7A 4CDDC 5IE8A 2RHSB 1EY4A 1XWEA 2OF1A 5EPJA 2KCMA 5KNBA 3GTOB 3W1BA 2OEOA 2LKVA 2CH4A 2JJQA 4DAVA 4C3IB 2ID0A 1EL0A 3PUVA 1W2BA 5IYCG 1KABA 3VYUA 3U4ZA 5J39A 4UAIA 4FVMA 1WVLA 2JA5G 3R93A 2EXZA 1NBWA 1SSOA 1XXGA 1DD2A 1TQOA 1S5DD 5C4XH 3W2DA 2WIIB 1U5KA 1B8AA 1O78A 3IL8A 1VQDA 2NYZD 3KUPA 1CKOA 3CF5A 2NN6I 2CQOA 3K59A 1EEID 3CRLC 2UUBQ 3CU7A 2NN6H 2EZVA 3D6CA 3O13A 1S5BD 1LTID 1HZ9A 2CVRA 1E0BA 1HRJA 1EWIA 2EYLA 3C1FA 1XNQL 3GTPH 4FNFA 1T5XD 3IFTA 4X3SA 4KY7A 3A56A 2ZJPA 4GKJL 1I4GA 3UI2A 1XMOL 1O80A 3CP0A 1GHJA 3RR5A 3NTHA 5GAHC 4BBSG 3SK8A 2PW7A 5JJKA 2CH4W 4HIOA 2J0TD 4IJLA 4BY1B 2F3IA 5M5XH 4YY3Q 4G4KA 3CC7A 3A55A 2AUJD 5DAUA 4DR7Q 2F4VL 1KAAA 3I56A 3I4OA 4HTHA 1QZGA 2E75C 4I65A 4DV7Q 2B2WC 5L37A 5IYCH 4DR4L 1B1ZA 3JAME 5C3XA 4LFCQ 4PV1C 1QG7A 2X6LA 3AFPA 3GTLB 3CAMA 3KYHC 1VCIA 2V4DA 4KKUA 3AQQA 3HKZB 3G7LA 3C46A 3GDEA 4RG1A 4QL5A 3C2PA 4B3MQ 1JWUD 4OIKA 1RDPD 2R7FA 1KNAA 1C48A 2XNAC 5IGBA 4GLVB 3LWUA 1Q90A 2A69D 3MXNB 5KIXA 1PTOF 2F0IA 3H09A 4KY5A 4UPAA 3T13A 2I46A 3V05A 2MUYA 4G57A 4GS3A 1M1KC 3S2DB 1B2TA 1IYUA 1S5ED 1PRTF 2RA4A 3NK9A 1XNRL 4BBSH 1CFMA 3RLNA 5JVG3 3J81c 1B44D 1H9SB 3QJYA 1MD2D 1I50H 4DAYB 1E2VA 4C3HH 1B9MA 2H1EA 2PZUA 1L1OB 3CC2A 4ODGA 1XTDA 1SJED 1SFOB 3CCQA 1DJRD 3JAML 2PQAA 3KF6A 2N49A 1EEFD 4Q5VA 2B2UA 5C4JB 1YJNA 3EFXD 4B3RQ 4QMGA 5M9OA 2C9OA 4X66Q 1F2YA 4IZ8A 1KD1C 1UE5A 4GLAC 1SE3A 1CA6A 2K5DA 2M9VA 3Q0AA 1QJOA 3NPPA 2O4XA 5ELEA 5J22A 2B2YA 1WD1A 4FF3A 4V190 4DV2Q 3HOVB 1MKHA 1LTRD 1UE7A 2CQAA 1SDFA 1CSPA 1MGSA 1CHQD 2NZHA 3KJOA 4GN3B 1TWGB 3HFZB 5IIFA 1KAWA 5FO8B 4LF8L 5EJWA 3ZJYC 4YWLA 3KK7A 3AB9A 1KDCA 2F0MA 2QKIC 3GV6A 1VQ9A 5EBCA 4I7AA 2CW0C 1M8AA 2DNEA 4OO1G 3DMUA 1PH1A 2RSNA 2RCFA 4OIJA 5CC4A 4BY7G 1GUOA 1I4XA 2XRQD 5C0XJ 1GOZA 3D4DA 4L6TB 1FJGQ 1I6HH 3DUZA 1C0AA 2YYZA 4X3KA 3C3LA 3I7FA 2DY7A 2Z6BA 4A3DB 1PTOC 3FPUB 5KYLA 2WAQB 1TS2A 1LLRD 4J6HA 1XMQQ 4FO2A 4R4OA 5A2QE 1G8ZD 1W6KA 5LMUL 4HJAA 3EA6A 2R92G 2GVAA 3HOYG 2G5DA 1K8OA 2B2TC 4CKBA 1PRTC 1TWAH 4DN4M 3OTOL 2DJFC 4FF4A 2HDLA 3DEOA 3CKIB 1EY0A 1SMYD 2UXCQ 1GM5A 2Q2TA 4KD3A 3STBD 2Q2IA 1E3PA 1JORA 1GUWA 3ULLA 2VS1A 5CORA 3BJUA 3I3CA 3CXCA 2KEEA 2RHQB 4KJOA 4OO1H 3PF4A 1O7YA 5HY6A 5EAYA 1ML0D 4JI7L 4BY7H 1LT4D 4Z9CB 1JB7A 4JOIA 1K8AC 4RKBA 2IHEA 3S1NH 1EZ6A 4L8JA 1ESFA 1PHJA 4LJZC 2WFWA 3VDYA 4EQNA 4PMCA 4IFDJ 4JG2A 2A1AA 4GNXC 1Z47A 3E5SA 1IXRA 4EVOA 5LL6X 5M5WB 2AWOA 1Q46A 1JT8A 2R92H 5JPMC 3HOYH 1ET9A 4RH6A 3CPFA 4DUZL 2LXKA 3FKIG 4BA2I 1MBYA 1BCPD 4HAEA 1IL8A 3OWEB 5DEHA 3Q23A 1ZYRC 2KCTA 4QJFA 3ITPA 4AIMA 1PDQA 1A63A 4B3SL 5C6AA 1TY2A 3Q24A 4RFBA 3PO3B 1WCMG 1KNEA 2CCZA 2NVTH 2SNSA 1ZKOA 1YZ6A 1VQHA 1EFWA 1EWCA 2IX0A 1YNND 1H95A 3CCEA 1NCVA 3TQYA 2JK8A 3GTKB 3I4MG 1ET6A 1SLJA 1BDOA 1YHAA 1H9MA 1DM0B 5CMDA 1VDZA 2D5DA 2XTIA 4ME5A 3MC0B 4L5QA 4ALPA 3S1QH 1PZID 4JI5Q 2FXQA 2CWPA 1DXMA 2LS01 4JI4Q 4A3BG 1YNJC 1PH9A 1TWFB 2F0JA 3FKIH 1FNWA 1T9HA 4BBRB 2K52A 1JCKB 4A76A 4GN5A 2PNHA 1SJHD 2Z0SA 4JI6L 5M5YH 3H3VI 2VB3X 4EQOA 1HHVA 4MIUA 3NEMA 2N8NA 1V1OA 1I4PA 3ND8A 2KHIA 2HHHL 4KKSA 5C0XI 1U4LA 2WP8J 1XPRA 3PCOB 5C0XH 4K5VA 1QVFA 3S1RB 1OXVA 3T4AC 3BDCA 1LTGD 3TBIB 1CI3M 1WCMH 1SRUA 5IT9E 3PV0A 3CCVA 3U4VA 1IL2A 3A0JA 1ENAA 4HIMA 1EY5A 4I7ZC 3TS2A 2CHBD 3RN2A 5ELOA 3H0GG 4G7OC 2OQ0A 3KOJA 4ME3A 4N8X1 3FHWA 4K0KQ 4AQYQ 4DK1A 3PQIA 2RDFA 1V1PA 4R4TA 1TVXA 1TR5A 3Q6SA 4KV6A 3E3XA 1B50A 3BYTB 4H7BA 4LF4Q 1G91A 4N9TA 4FP5D 2PNRC 4IUTA 3KDFA 3EVQA 2EE1A 3HRZC 4GKKQ 2NTSA 1WTVA 2EYMA 5IYDH 3I8ZA 3CMEA 1O7ZA 3KLRA 4A3BH 1FL0A 3OMCA 3OOCA 2D2CC 3PUZA 5FLMG 3LWEA 3M9BA 2B39A 4K6DA 3LNNA 4KHPQ 4PNYA 5BN3A 2YU9H 5KEEA 3EROA 3S15B 3CC4A 4PMWA 1L1OC 2FMMA 3BDOA 3SXHA 4DNIA 4RGOS 4ULLA 1N36Q 3WWVA 1PTOH 1KRSA 4G7HC 4IFDI 1N33L 2UUBL 2EY2A 1UE6A 1X32A 3IFDA 5C4HA 1AFPA 2R3ZA 5IT9L 2MFIA 3K0XA 5M3MB 3S1MB 5AJ3L 1KLGD 4JCVE 2Q8IB 4A93B 2L15A 4OEMB 4F87A 1NTGA 5M3FB 4NW2A 4C3IG 4DV5L 3GTQB 2QDLA 3H0GH 1A3UA 2R6GA 3HP3A 3TREA 4JI1Q 1GXDC 2SOBA 1KHIA 4L63B 2K5QA 2A6HD 2B63G 2E2IB 1J8IA 1X55A 4YWKA 2NBFA 4B3TQ 1NSNS 5CGKA 5KYIA 4YY3L 2WB1E 1XPUA 2CWAA 3MA2B 5IP7G 2F0OA 4H0LC 1NR4A 3E9IA 5FLMH 2A73B 1RTNA 1SYBA 1X3QA 3A8KE 4LFCL 4DV1Q 1IBLQ 1SAPA 4LFAQ 1NY4A 2Q2HA 1KQSA 3RZDH 4F7XA 1Q82C 5IOCA 3NXWA 4IUUA 1SEBD 2HT1A 5K5PA 1I4HA 5ELBA 4P73A 1EY7A 5IODA 2Y0SE 4B3ML 2PQEA 3L2PA 5IYBG 2PQAB 4YIJA 3KF6B 3T1HQ 3R2TA 3OYYA 4BY1G 4P2CB 1SE4A 2BH2A 4CBVA 5T1IA 4DV6Q 2QCPX 4C3IH 2NVQB 4R8NA 3Q8DA 2ATWA 4POFA 5J3BA 2IJ0A 2DY8A 4A3MH 3HEJA 2AKWB 1VS0A 2B63H 3OW2A 3F2UA 3HOUG 3HKZG 1VQBA 4OONA 2F0VA 1AH9A 5ELNA 5IP7H 3FVQA 4X62Q 2PCFB 1TKWB 4YCWA 3CRKC 3RN5A 4R4IA 1X3GA 5GADC 1VQ7A 4X66L 1SROA 1VQNA 5T1GA 4DR3Q 2VY3A 1KDBA 4BA1I 1R4QB 2DNCA 1QVCA 2F0PA 2BDOA 3K57A 4DV2L 5IYBH 5TSSA 4CGYB 1VQCA 2VW9A 4BS9A 4CKCA 4NPSA 4BY1H 1HA6A 1PFSA 4X64Q 2BH8A 1PZJD 3NQIA 4KN7C 1CQVA 3RLOA 2K32A 2K7VA 4DV3L 5H1SE 1HQMC 4XYOA 2GVBA 1OXUA 1HR0Q 2ENBA 1L0XB 3AMUA 5EPKA 4R1JA 1F2MA 1FNUA 1Y8OB 5FJ8G 1LV9A 5FLXE 1DOLA 3MWYW 1YBYA 2L0CA 3NHHA 3KLSX 3GTLH 2K4KA 3E0JA 1QILA 1HFNA 3HOUH 1SYEA 4QGUA 2LY7A 3K5OA 2KA7A 1GUGA 3HOVG 4QF4A 2O5JC 4L5RC 3TP7A 1XMQL 1L0YB 2LFNA 3A5UA 1A0IA 2F0HA 5C44G 1Y1WH 2KBNA 4JI0L 1BQQT 3TRZA 3CCJA 1WTXA 1BVSA 1E22A 2HUGA 3S2DH 1Y1VH 1I3QB 4XT3B 5NUCA 1P8LA 2FMCA 1LABA 2K14A 2UXCL 3IKJA 4KJNA 4A3CH 1JB3A 2EJFC 5A35A 2F4IA 3SK6A 2EVBA 3AU7A 4JI3L 4LFBQ 2ASBA 5BN4A 3U50C 2RBMA 4R4CA 4A3DG 4PZ8A 2WAQG 2VXWA 1SFOH 2NVXB 2LMCB 3AFQA 4N9PA 3PSIA 2E8GA 5C4JH 1SNCA 4LAAA 5FJ8H 2TSSA 4KHZA 5FLXL 3T1YQ 1Q81C 3EBEA 2MP1A 4JBMA 5EBDA 1UE1A 1TXYA 4OWXB 4NXMQ 2N55A 1KC8C 4JPBW 1QVGA 1WTRA 2OWOA 1PVOA 3HOVH 1F77A 2ZTDA 3VR6A 2EDGA 1IBKQ 5C44H 4XXEA 5C4ZA 2CW0D 5IWAQ 3ND9A 4RWSC 3K81C 2QF7A 4IPGA 1GUSA 2X69A 2K28A 1IYJB 1HXYD 1RJTA 3M85A 4CJ0B 1G51A 4A3EB 3P1HA 1TWCB 4QUFA 2HQEA 4NP5A 2L12A 4IUPA 2WV6D 3QG1A 3EN2A 4K2LA 1QCBD 5JEAG 2DN8A 5IGCA 2UUCQ 3DXJC 3DWAA 1PTOD 3MEHA 5ELDA 1VQFA 1KTKA 4QY7A 1HFGA 1K73C 5HGTA 2AWNA 2B29A 3MFYA 3HS0C 4GN4B 4GOPC 3KF8A 1JR0D 2JA5H 2Q2UA 3F8TA 4A4IA 3W1GA 3PGZA 4RGTA 2GA4B 3CCMA 1C9OA 1TS5A 1D5XC 1DGSA 4KY6A 1GHKA 1EIYB 2VUMG 1II3A 2JA8B 1UEAB 4LF7Q 5LMNQ 4ZKBB 4TRDA 4YWMA 2TMPA 4DXFA 4JI5L 4JI4L 5DM63 4F88A 4LF5Q 3QIAA 3GO5A 1LTTD 2E2JB 2VNUD 1V1PB 4M8AA 3PO3G 1CT1D 3UE1A 5E3FA 3EJIA 1R9TH 2F03A 1X54A 4JI2L 4Y52H 2R7ZB 2EJGC 4H13C 3PO2B 3JAMi 4XDXA 4C2MB 3KDFB 3ONAB 4HIDA 3S14B 1WTHA 2L9HA 4A3IB 2IW3A 3K0YA 2F0GA 4B9XA 1G2TA 1N9WA 2Z6KC 3NTKA 3K58A 5JEAH 2E5LQ 3CCUA 4GLXA 3J7AV 2A6EC 1JMCA 2IWHA 5M5WH 1HCZA 4J15A 1RCVD 1OO9B 2MO0A 4C1NK 2WB1B 4UP9A 4EGVA 1BBUA 1ZYRD 4LUVA 2PZWA 4K0KL 2V1CC 3BZCA 4RA8A 3J7ZC 4AQYL 2UU9Q 2PO4A 1QUQA 5KRUA 3GTJB 4BBRG 1BKBA 1LO5D 4HCSA 2VUMH 3RUZA 2WKCA 5C3EB 4LF4L 2JA9A 4RHRA 1G6ZA 1BCPB 2F52A 1IYVA 3BVZA 2B2YC 2QEXA 3W5OA 2KUMA 1VQAA 2R93B 2BE5D 2Y0SB 1CZGA 3TP5A 5BR8L 1SNMA 2PYKA 1U9RA 1J5EL 2I0QA 5EPLA 1BF4A 4KHPL 1I94Q 2F0UA 1SXTA 4A3FB 1A15A 2B2VC 4DK3C 5C5MA 3PIO3 4R8IA 4JI8Q 1IBMQ 4EQ5A 5COYA 1N36L 1VQIA 1WI5A 3G48A 4AYBE 3GTKH 5CV5A 4RKLA 3T51B 1Y14B 1YNJD 1CA5A 3S9WA 3M7NA 1HNZQ 4RCOA 2R61A 2VQFQ 4O1NA 4NXNQ 3GV3A 1U0LA 2MO1A 1TWFH 1VF5C 4DAMA 3K7AB 2OXPA 1IW7D 4BBRH 3LX0A 5M5XB 5FK9C 4C1NI 4B3TL 4OX9Q 2F0QA 3ULJA 1SBBB 2L4NA 4XQJA 2YV5A 4YHHQ 1KXLA 1QWYA 1LUZA 2BCOA 4ZKCB 2B2TA 5I9OA 1BNZA 3D0FA 1IBLL 4DV1L 5FO7B 3MAQA 4LFAL 4OO1I 5M3MG 1VQGA 3GTGB 4A93G 4ZRZA 4DUYQ 5FO9B 5M3FG 2VL6A 3KLSA 5EKKA 1FVIA 1K3RA 4ID6A 1F2LA 2IL8A 4JOIC 1D1KA 4HIKA 1QZHA 4WJ3M 1EQRA 4DFAA 2A69C 5BN5A 4DV4Q 2Z9HA 4DV6L 5A2QL 4WJ4A 3BZDB 4BBSB 1XJVA 3WOEA 3TMEA 2L11A 1WJJA 1AP0A 3HOXB 3BG3A 1B7YB 2NTTA 2A68C 3M4OH 3S15H 1I50B 3NBIA 3PMFA 4C3HB 1WYDA 2EYFA 4GNXA 1XYIA 3H91A 2ICEC 3G6EA 2H5XA 1HR0W 1NE3A 3HOZB 2M00A 3SDZA 4X62L 3NBHA 3H15A 3PUWA 4ZQ3A 2KENA 1Z7TA 5M3MH 3S1MH 1A3TA 1E1TA 1JOQA 4A93H 1F2ZA 3SEBA 3UDFA 4LF9L 2I5HA 1TWHH 5M3FH 2F3VA 4GKJQ 4KK7A 4IJHA 4DR3L 2KHJA 2DUDA 3SK5A 4A3KB 3URYA 4CHTB 4KLKA 1A6XA 2WINB 3NE5B 3L7ZC 1SNOA 1VQPA 3ZYYX 4OGQC 2F4VQ 4RMFA 4X64L 2D62A 1CKNA 3SE0A 4QIWE 2EPBA 1EYGA 3A5ZB 1G291 5JJIA 4DR1Q 1VQLA 5CBEE 1HR0L 1K9MC 2E74C 4OHJA 3I4NB 1SNPA 1YVCA 2OT2A 2UXBQ 3FEWX 1PYWD 1HNWL 4O2DA 3DEPA 4G7ZC 1GVPA 3RMHA 4EX5A 1Q1EA 1N8RC 3E0EA 4HJ9A 4FXGC 1VQ6A 5E7NA 4J8QA 4DR5Q 3A74A 1CTMA 4TKOB 2OCEA 2XWBB 3S2HB 4XQQA 1HPCA 2NVQH 1HZBA 3BYYB 3MXGA 3LGJA 4DGZA 4UHVA 3VA5A 2ZXOA 3I4MH 3J7AF 1K0SA 2XIWA 2I07B 5ELFA 1ASZA 1S72A 1CUKA 1FGBD 1HNXQ 1CHPD 3RLFA 3SR1A 5I2XA 2PI2A 5E1FA 1E7ZA 2K5HA 3CW2C 2AHOB 4DA2A 4Y7NH 1EQQA 1XX8A 1LYLA 3K5LA 4L5TA 4DF7A 1SE2A 3CQZB 1IKMA 2AUKA 3FPPA 3T1YL 3GTMB 1OXTA 3E6ZX 1VQOA 1AZPA 1JJGA 4ZLTF 2N3SA 3S17B 5FLXc 4NXML 1STYA 2XSCA 4KKTA 1EU3A 2H4OA 1TIID 1Y8NB 3DHQA 3J80E 3NWTA 2F0SA 3K7UC 1BO0A 2ES2A 1Q3LA 3ICEA 1EIGA 3OHXC 1H9RA 1IBKL 4KMUC 1TT2A 3KF8B 4UP8A 1SMXA 5D65A 2PI2E 1V1QA 4QUCA 2LSSA 1B53A 4BXXG 4H02A 3VR5A 1EU4A 2A19A 1DOKA 1VQJA 4TQUS 4MHEA 3B6YA 2EY5A 5CBAE 3OIQA 1D8LA 3UE0A 4P72A 2MHVA 4WFN3 3TS0A 2XN9C 2UUCL 2EXDA 1NAPA 1CM9A 4JBJA 1AW7A 4DR7L 1HTLD 5E4XA 1QB5D 1FD7D 1MJEA 2OTLA 3BVMA 4B9WA 4A3JB 3CPWA 4DV7L 1NNXA 2DGYA 2E2HB 1N34Q 4FYDA 3MVVA 2KJXA 4DNRB 1I3QH 1B3AA 2KOLA 4LF7L 4LNQA 3NUCA 4A3EG 3J80L 2HD3A 1STNA 2JA6B 2EYOA 1PFBA 3A8IE 3GTOH 2KHSA 4LF5L 2AQ3B 3PIOA 2K6AA 4AYBB 5K36G 4LF6Q 1RL2A 1N32Q 1QUQB 2F0KA 4KI0A 5EKIA 4K14A 2Z1CA 5IGDA 4BXXH 1SN8A 4KD4A 3P75A 4C3JB 1DYQA 4LUZA 5KGUA 5JJZA 4JI7Q 2F0EA 1LTBD 2NVXH 5G3LD 1D7QA 1HZCA 2ZM6Q 3M3YB 4KN4C 1TS4A 4TSSA 2RDGA 1YITA 4L5SA 1ENCA 4XIGS 1K83B 1EZ8A 2CKZB 2JA8G 3AEVA 4OWWB 2AQ1B 4JC0A 4HJ8A 1UWVA 4DV0Q 3VYTA 5HGQA 1TU2B 1JE5A 4B3RL 2YTYA 3JAMc 1ZEQX 1ICFB 1ASYA 2UU9L 3F1ZA 1ILPA 3EQLC 1EYCA 5IP9G 3D3RA 2JE6I 2R7ZG 3PO2G 4EQPA 1EYAA 4A3EH 1PH2A 3MXUA 2RQXA 4B3SQ 1J9OA 1TWCH 1SR3A 4A3IG 3HOWB 1M90C 2A5HA 3H94A 1PH5A 3PUXA 2NUCA 5K36H 5CYUA 2JN4A 1EUJA 3PIPA 1EQVA 2J7ZA 1UEBA 3PUYA 4IUNA 5E4WC 1I94L 3D4WA 4P75A 3VR2A 2RVLA 1PTOB 2Z4HA 5I6YA 2WB1G 5DLQE 1VQ4A 2FJ2A 1IBML 4JBWA 5I4DA 4ZUJA 5I2YA 4F8MA 3CMAA 2K01A 5JEAJ 1V8QA 1D5MC 2KECA 1Y69U 2PPBC 3J81j 1FJGL 1PMRA 2JA8H 5C3EG 5EKLA 5IGGA 1Z6HA 1NJIC 1TS3A 2R93G 4NXNL 2Y0SG 1RD9D 1WOCA 2E2JH 2NVYB 2JXMB 2D0PA 2XGTA 5JPNC 5IP9H 4A3FG 1P16A 2QEJC 5ISRA 2R7ZH 3PO2H 1EIFA 4C2MH 1ZXTA 1HH2P 3S14H 1Q8IA 1NMGA 5CV9A 4O42A 2NN6G 4YHHL 3QB3A 1SYDA 3QO2A 2RKSA 2A6ED 2MPMA 1K8MA 3L0OA 4IPHA 4CDEC 3RZOB 2O5IC 1VQ5A 1T5EA 1RHPA 2EOTA 3U9OA 1AE3A 4GNXB 1JOKA 2EIFA 4Q0FA 4QIWB 3GP7A 1FGUA 2K05A 3FRPB 1EY6A 1BOSA 1S5FD 3VR3A 4WJWA 2ZXPA 2QA4A 2NZOA 3GTJH 3L9AX 2B8GA 5KNCA 3NBHB 1RODA 5D3DA 3I55A 5HURA 4IURA 5C3EH 3A7LA 3KJPA 3M4QA 3IAYA 4JV5Q 2KCCA 1PYBA 4IOCA 4DV4L 1CSQA 3BZKA 2IX1A 4POGA 4A3GB 2R93H 1TWGH 3NQTA 4A3MB 3A54A 5D3IB 2C35B 2B63B 2Z4IA 4K6LA 1EOVA 1STEA 1YHBA 1PH3A 4A3FH 4WRDA 2NWGA 3OMGA 3DM1A 4LMQD 5CV6A 1E2WA 1CKNB 2ALYB 3RNUA 4IO9A 1N33Q 4DR2Q 4N8FA 2MQHA 3OW7A 3CHBD 2JEAI 3TDQA 2J4XA 2MJ8A 5AJ3Q 1PA6A 1GUTA 4LK1C 4UP7A 1X3PA 3K6OA 1X3FA 1S5CD 5DNFA 4DV5Q 4A3DH 2RDHA 4QB4A 3W3AA 3OWFA 3DWPA 2B8FA 3NTIA 3TSSA 1PRTD 1AE2A 4ZYSA 3K7AH 1W6JA 1U4PA 1LTLA 3S16B 4MTKA 4OL7A 1PZKD 2EY1A 3HOXG 1QOHA 1Q7YC 2G9HD 1B4OA 2EY6A 2PZTA 4GZYC 4FDBA 4C3HG 2K75A 1BUVT 3J7YW 3U9SA 2G9DA 1JWMD 1JQYD 2B2WA 1EWHA 1F9RA 1Q1BA 3G71A 3UDIA 1X3EA 3HOZG 1EOTA 4K5XA 4GOPA 4YCUA 5IY0A 3Q22A 1AZQA 4DR1L 2ZXRA 4QQBX 3GD7A 1QNUA 4APVA 1LT6D 4K8JA 4X65Q 3GTGH 1F9QA 3HOUB 1STHA 1BBWA 2UXBL 2B3GA 3MEFA 5GAGC 2F0FA 3A8JE 5JVH3 4FF2A 4A3KG 3K80C 3AYHB 3IRBA 2HCIA 4UY8C 3WOFA 4JK1C 1VMCA 4AH6A 1JE4A 1Y1WB 3I4LA 2IHFA 2F0TA 2VQEQ 1H9JA 5IGFA 2JA7B 4DR5L 1Y1VB 4XTCS 4MN3A 1BBXC 1MHWC 1HA5A 4IN3A 2B2UC 2A68D 1CK1A 3OSOA 1D1IA 1HTPA 2Z6KA 3HOXH 1A3VA 3H6MA 3I4NG 3F2DA 3N6RA 1HNXL 3H3VC 1SYGA 2E76C 4HEDA 4KTAA 1D2BA 4DU9A 4A3LG 4GKKL 2ZJRA 1VQKA 5AFWA 2XVSA 2UXDQ 3HOZH 4U68A 2F0DA 3FMCA 4FF1A 1PFMA 1G6PA 1LTAD 1M4VA 1EY9A 3PO3H 3TZDA 2PMZE 5C4XB 1SYCA 3T53B 2QDBA 2XRSD 4DXGA 4CJ1B 2UUAQ 4A3KH 1G2SA 1PFNA 1O7LA 5C44B 2VZAA 1EY8A 1K3BC 2FINB 3GTPB 3MZ5A 3KBXA 4YCVA 1L0WA 1I5FA 4DV3Q 4JYAQ 1A8VA 2B2VA 2C5CA 4PZ6A 5IT9c 3D6WA 1OXSC 5CV8A 3MTSA 4JI1L 3FDTA
chains in the Genus database with same CATH topology
3QOLA 3T56B 5FKAC 1CZWA 1IKLA 3D8GA 2AQ2B 3ERQA 1ENFA 3HG9A 3R8BA 2IPKD 3OIPA 1JC7A 3TP6A 2JA5B 1C4QA 2L55A 5DM73 2EJMA 4M1UB 5JOBA 3I72A 2FFKB 3PIP3 3P7JA 1I4RA 4HMJA 3DWQA 1SYFA 4K8IA 3HZXA 5FOBB 2Q8RE 2Z8LA 2JSOA 1R9TB 1OXXK 5CV4A 3TP8A 4PMBA 4CKEA 1EFID 4RAUC 2NB0A 1WTPA 1QNKA 5I6WA 5IGEA 1NUCA 5ELCA 5J1ZA 3VR4A 2JEBI 1STAA 3SVMA 2VUMB 4C3JG 2RSOA 3J81E 2X6GA 2A74C 1F9SA 3P20A 4WORA 5F2DA 1RF2D 4QCLA 1C8CA 2K5WA 1A2TA 5C0XG 4ILWA 4ZAIA 1EQTA 1WTQA 3TZUA 4DAPA 1Q12A 2BE5C 5CR3A 4NKLA 1BXTA 1Y8PB 2K04A 2WKDA 4XT1B 1BCPF 4XQNA 3V2TA 2K1BA 4X3TA 5EQ0A 1EYDA 1I6HB 4C56C 4K2KA 1NR2A 1E2ZA 1GJXA 1JICA 2BOSA 1H9KA 2SNMA 2NZ1D 3SHLA 2MGSA 5EGTA 4CJ2C 1HQRD 1WD0A 1STGA 1TWAB 1DONA 1IW7C 4U673 4RGNA 3J81L 2BA1A 3M7GA 4HSVA 3NSWA 3HGBA 2ICIA 1SMYC 2BA0A 1R4PB 1JWSD 4IFDG 3N52A 4NMZA 4UDUC 1V43A 1KDAA 4J1MA 5LL6S 2IX3A 2KQ3A 4X3UA 4ZUIA 3VYRA 2SEBD 1MI2A 2E2DC 4BY7B 3MXNA 1VF7A 3BVGA 4K5WA 3S1NB 3QWNA 4HR7B 4RGMA 1MSHA 4R9WA 3T16A 4H44C 5LHY1 4ZK9B 1FR3A 3BDLA 3K5MA 4DNTB 1UUPA 2L5TA 2R92B 3HOYB 1H9SA 2EYHA 4DAYA 1UNSA 3KBGA 2M2LA 3M4OB 1BCPC 3X3NA 1JOOA 1KLUD 1LTSD 2HCCA 3TN2A 2SDFA 1U4RA 2EYPA 1WTOA 1VMPA 4E6IA 4IFDH 3I70A 3V96A 3R2IA 4XYQA 4IUQA 3OPOA 2NVTB 1TWHB 2WACA 2F0NA 2ZT9C 1DOMA 3D31A 3L3OC 3I73A 1MSGA 1ICWA 1YNNC 1HUNA 1FNVA 1U4MA 3BS1A 4PQXA 2PMZB 3S1QB 2EYJA 3I91A 1AN8A 4DK0A 2KCNA 5JAVA 3FKIB 2F0WA 4S3SA 4RCNA 5C5LA 5D14A 1CQFA 3WDNA 3A7AB 1LT3D 5M5YB 1PXUA 1BR9A 3SK4A 2BDNA 4IQZA 1DZ1A 2PW5A 4FXDA 1S4ZA 3G6JB 1F9PA 3C1EA 4KHVA 2F0LA 1WCMB 1ESRA 1XTCD 1AEXA 2HDMA 3QOJA 2JP1A 1IHZA 5I9PA 2KVMA 1GUNA 3I4MB 3RD4A 1I4QA 4HSPA 2N88A 3VA7A 2KEDA 4RHSA 4FXKC 4A3BB 3M4YA 4Y7NB 3NP8A 1SNDA 1STBA 3R3OA 2YU9B 3MXPA 5C3WA 4HCEA 1DCZA 1B9NA 4NDXA 1HUMA 3I90A 3K5NA 5G3LF 1A2UA 4ABNA 4V0BA 1D6EC 3MHBA 2O2LD 4HMIA 2Q8TA 2K33A 1PRTB 1PLFA 1LT5D 2JYOA 1TY0A 4IUVA 3H0GB 3X3MA 3MFGA 2XWJB 2IT1A 2VB2X 2L1BA 3NWSA 4B08A 2A6HC 1EIHA 1LACA 1WTWA 2FHTA 2K03A 3VYSA 2D9UA 3GQBA 1UAPA 1RKNA 1FYCA 2F3WA 5KNDA 3D4RA 1I6VC 4IALA 1D5ZC 1ONLA 3RZDB 1QE6A 1SNQA 1ILQA 1RTOA 4HN7A 2QILA 2F1MA 4BWGB 5CV7A 1EY4A 1XWEA 5EPJA 2OF1A 5KNBA 3GTOB 2OEOA 2LKVA 4DAVA 4C3IB 2ID0A 1EL0A 3PUVA 1KABA 3VYUA 5J39A 4UAIA 4FVMA 1WVLA 3R93A 2EXZA 1SSOA 1XXGA 1DD2A 1TQOA 1S5DD 3W2DA 2WIIB 1O78A 3IL8A 2NYZD 3KUPA 2NN6I 3K59A 1EEID 3CRLC 3CU7A 2NN6H 2EZVA 3D6CA 3O13A 1S5BD 1LTID 2CVRA 1E0BA 1HRJA 2EYLA 3C1FA 4FNFA 1T5XD 3IFTA 4X3SA 4KY7A 3A56A 1I4GA 3UI2A 1O80A 1GHJA 3NTHA 3SK8A 2PW7A 2J0TD 4BY1B 4G4KA 3A55A 2AUJD 5DAUA 1KAAA 4HTHA 2E75C 4I65A 2B2WC 1B1ZA 3JAME 5C3XA 4PV1C 1QG7A 2X6LA 3GTLB 1VCIA 2V4DA 4KKUA 3HKZB 3G7LA 3C46A 3C2PA 1JWUD 4OIKA 1RDPD 1KNAA 1C48A 2XNAC 5IGBA 3LWUA 1Q90A 2A69D 5KIXA 1PTOF 2F0IA 3H09A 4KY5A 3T13A 2I46A 3V05A 2MUYA 4G57A 3S2DB 1B2TA 1IYUA 1S5ED 1PRTF 2RA4A 3NK9A 1CFMA 5JVG3 1B44D 1H9SB 3QJYA 1MD2D 1E2VA 1B9MA 2H1EA 2PZUA 4ODGA 1SJED 1SFOB 1DJRD 3JAML 1EEFD 4Q5VA 2B2UA 5C4JB 3EFXD 4QMGA 5M9OA 2C9OA 1F2YA 4IZ8A 1SE3A 1CA6A 2K5DA 2M9VA 3Q0AA 1QJOA 3NPPA 2O4XA 5ELEA 5J22A 2B2YA 1WD1A 4FF3A 4V190 3HOVB 1LTRD 2CQAA 1SDFA 1MGSA 1CHQD 5IIFA 1TWGB 5FO8B 5EJWA 3KK7A 3AB9A 1KDCA 2F0MA 2QKIC 3GV6A 5EBCA 2CW0C 1M8AA 2DNEA 4OO1G 3DMUA 2RSNA 4OIJA 5CC4A 1GUOA 1I4XA 2XRQD 5C0XJ 1GOZA 3D4DA 4L6TB 3DUZA 2YYZA 4X3KA 3C3LA 2DY7A 4A3DB 1PTOC 3FPUB 5KYLA 2WAQB 1TS2A 1LLRD 4J6HA 4FO2A 5A2QE 1G8ZD 1W6KA 3EA6A 1K8OA 2B2TC 4CKBA 1PRTC 4DN4M 4FF4A 2HDLA 3DEOA 3CKIB 1EY0A 1SMYD 4KD3A 1JORA 1GUWA 5CORA 3I3CA 2KEEA 4OO1H 4KJOA 1O7YA 1ML0D 1LT4D 4Z9CB 4RKBA 1EZ6A 4L8JA 1ESFA 4LJZC 4EQNA 4PMCA 4IFDJ 1Z47A 3E5SA 4EVOA 5LL6X 5M5WB 2AWOA 5JPMC 1ET9A 4RH6A 4BA2I 1MBYA 1BCPD 4HAEA 1IL8A 3OWEB 5DEHA 3Q23A 1ZYRC 3ITPA 1PDQA 5C6AA 1TY2A 3Q24A 4RFBA 3PO3B 1KNEA 2SNSA 1ZKOA 1EWCA 2IX0A 1YNND 1NCVA 3GTKB 1ET6A 1BDOA 1H9MA 1DM0B 5CMDA 1VDZA 2D5DA 4ME5A 3MC0B 1PZID 2LS01 1DXMA 1YNJC 1TWFB 2F0JA 1FNWA 4BBRB 1JCKB 1SJHD 2VB3X 4EQOA 1HHVA 4MIUA 1V1OA 1I4PA 3ND8A 4KKSA 5C0XI 1U4LA 2WP8J 5C0XH 4K5VA 3S1RB 1OXVA 3T4AC 3BDCA 1LTGD 3TBIB 1CI3M 5IT9E 3PV0A 1ENAA 1EY5A 4I7ZC 2CHBD 4G7OC 4DK1A 2RDFA 1V1PA 1TVXA 1TR5A 3Q6SA 4KV6A 1B50A 3BYTB 4H7BA 1G91A 4N9TA 4FP5D 2PNRC 4IUTA 3EVQA 2EE1A 3HRZC 2NTSA 1WTVA 2EYMA 3I8ZA 1O7ZA 3KLRA 3OMCA 3OOCA 2D2CC 3PUZA 3LWEA 2B39A 4K6DA 3LNNA 4PNYA 5BN3A 5KEEA 3EROA 3S15B 4PMWA 2FMMA 3BDOA 3SXHA 4RGOS 4ULLA 1PTOH 4G7HC 4IFDI 2EY2A 1X32A 3IFDA 5C4HA 1AFPA 2R3ZA 5IT9L 5M3MB 3S1MB 1KLGD 2Q8IB 4A93B 4F87A 5M3FB 4NW2A 4C3IG 3GTQB 1A3UA 2R6GA 3HP3A 1GXDC 2SOBA 4L63B 2K5QA 2A6HD 2E2IB 1J8IA 2NBFA 1NSNS 5CGKA 5KYIA 3MA2B 2F0OA 4H0LC 1NR4A 2A73B 1RTNA 1SYBA 1X3QA 3A8KE 1SAPA 4F7XA 5IOCA 3NXWA 4IUUA 1SEBD 5K5PA 1I4HA 5ELBA 1EY7A 5IODA 2PQEA 4YIJA 3R2TA 4P2CB 1SE4A 4CBVA 5T1IA 2QCPX 2NVQB 4R8NA 2IJ0A 2DY8A 3HEJA 3F2UA 2F0VA 3FVQA 2PCFB 1TKWB 3CRKC 5T1GA 1KDBA 4BA1I 1R4QB 2DNCA 2F0PA 2BDOA 3K57A 5TSSA 4CGYB 4BS9A 4CKCA 1HA6A 1PZJD 3NQIA 4KN7C 1CQVA 2K32A 2K7VA 1HQMC 4XYOA 1OXUA 2ENBA 1L0XB 3AMUA 5EPKA 1F2MA 1FNUA 1Y8OB 1LV9A 5FLXE 1DOLA 3MWYW 2L0CA 3NHHA 3KLSX 3E0JA 1QILA 1HFNA 1SYEA 2LY7A 3K5OA 2KA7A 1GUGA 4QF4A 2O5JC 3TP7A 1L0YB 2LFNA 2F0HA 1BQQT 1WTXA 2HUGA 1I3QB 4XT3B 5NUCA 2FMCA 1LABA 3IKJA 4KJNA 1JB3A 2EJFC 5A35A 2F4IA 3SK6A 2EVBA 3AU7A 5BN4A 2RBMA 2VXWA 2NVXB 2LMCB 4N9PA 1SNCA 4LAAA 2TSSA 4KHZA 5FLXL 2MP1A 5EBDA 2N55A 1WTRA 1F77A 3VR6A 2EDGA 4XXEA 5C4ZA 2CW0D 3ND9A 4RWSC 2QF7A 1GUSA 2X69A 2K28A 1HXYD 1RJTA 3M85A 4CJ0B 4A3EB 3P1HA 1TWCB 4QUFA 2HQEA 4NP5A 2L12A 4IUPA 2WV6D 3QG1A 4K2LA 1QCBD 5JEAG 2DN8A 5IGCA 3DXJC 3DWAA 1PTOD 3MEHA 5ELDA 1KTKA 1HFGA 5HGTA 2AWNA 3MFYA 3HS0C 3KF8A 1JR0D 4RGTA 2GA4B 1TS5A 1D5XC 4KY6A 1GHKA 2JA8B 1II3A 1UEAB 4ZKBB 4TRDA 2TMPA 4DXFA 5DM63 4F88A 3QIAA 3GO5A 1LTTD 2E2JB 2VNUD 1V1PB 4M8AA 1CT1D 5E3FA 3EJIA 2F03A 2R7ZB 2EJGC 4H13C 3PO2B 4XDXA 4C2MB 3ONAB 3S14B 2L9HA 4A3IB 2IW3A 3K0YA 2F0GA 4B9XA 1G2TA 3K58A 3NTKA 5JEAH 3J7AV 2A6EC 2IWHA 1HCZA 1RCVD 1OO9B 4C1NK 2WB1B 4EGVA 1ZYRD 2PZWA 4RA8A 3GTJB 2PO4A 5KRUA 1LO5D 4HCSA 3RUZA 2WKCA 5C3EB 4RHRA 1G6ZA 1BCPB 1IYVA 3BVZA 2B2YC 2KUMA 2R93B 2BE5D 2Y0SB 1CZGA 3TP5A 1SNMA 2PYKA 1U9RA 5EPLA 1BF4A 2F0UA 1SXTA 4A3FB 1A15A 2B2VC 5C5MA 3PIO3 4R8IA 5COYA 5CV5A 4RKLA 3T51B 1YNJD 1CA5A 3S9WA 3M7NA 4RCOA 2R61A 4O1NA 3GV3A 1VF5C 3K7AB 2OXPA 1IW7D 3LX0A 5M5XB 5FK9C 4C1NI 2F0QA 1SBBB 2L4NA 4XQJA 1QWYA 2BCOA 4ZKCB 2B2TA 5I9OA 1BNZA 5FO7B 3MAQA 4OO1I 3GTGB 4ZRZA 5FO9B 3KLSA 5EKKA 4ID6A 1F2LA 2IL8A 1D1KA 4DFAA 2A69C 5BN5A 5A2QL 3BZDB 4BBSB 3WOEA 3TMEA 2L11A 1AP0A 3HOXB 3BG3A 2NTTA 2A68C 1I50B 3NBIA 3PMFA 4C3HB 2EYFA 1XYIA 3H91A 2ICEC 3HOZB 2M00A 3SDZA 3NBHA 3PUWA 4ZQ3A 1Z7TA 1A3TA 1JOQA 1F2ZA 3SEBA 2F3VA 4KK7A 3SK5A 4A3KB 3URYA 4CHTB 1A6XA 2WINB 3NE5B 3L7ZC 1SNOA 3ZYYX 4OGQC 2D62A 3SE0A 2EPBA 1G291 5CBEE 2E74C 4OHJA 3I4NB 1SNPA 2OT2A 3FEWX 1PYWD 3DEPA 4G7ZC 3RMHA 1Q1EA 4FXGC 4J8QA 1CTMA 4TKOB 2XWBB 3S2HB 4XQQA 1HPCA 3BYYB 3MXGA 4DGZA 3VA5A 2ZXOA 3J7AF 2XIWA 2I07B 5ELFA 1FGBD 1CHPD 3RLFA 3SR1A 5I2XA 5E1FA 4DA2A 1XX8A 3K5LA 4DF7A 1SE2A 3CQZB 1IKMA 2AUKA 3FPPA 3GTMB 1OXTA 3E6ZX 1AZPA 4ZLTF 3S17B 1STYA 2XSCA 4KKTA 1EU3A 2H4OA 1TIID 1Y8NB 3DHQA 3J80E 3NWTA 2F0SA 1BO0A 1Q3LA 1EIGA 3OHXC 1H9RA 4KMUC 1TT2A 5D65A 4QUCA 1B53A 3VR5A 1EU4A 1DOKA 4TQUS 4MHEA 2EY5A 5CBAE 3OIQA 2MHVA 4WFN3 2XN9C 1NAPA 1CM9A 1AW7A 1HTLD 5E4XA 1QB5D 1FD7D 3BVMA 4B9WA 4A3JB 2E2HB 4FYDA 3MVVA 2KJXA 4DNRB 1B3AA 2KOLA 3NUCA 3J80L 1STNA 2JA6B 2EYOA 1PFBA 3A8IE 2KHSA 2AQ3B 2K6AA 4AYBB 5K36G 2F0KA 4KI0A 5EKIA 4K14A 2Z1CA 5IGDA 4KD4A 4C3JB 3P75A 1DYQA 5KGUA 5JJZA 2F0EA 1LTBD 5G3LD 3M3YB 4KN4C 1TS4A 4TSSA 2RDGA 1ENCA 4XIGS 1K83B 1EZ8A 2AQ1B 3VYTA 1TU2B 1ZEQX 1ILPA 3EQLC 1EYCA 3D3RA 2JE6I 4EQPA 1EYAA 3MXUA 2RQXA 1J9OA 3HOWB 2A5HA 3H94A 3PUXA 2NUCA 5K36H 5CYUA 1EQVA 2J7ZA 3PUYA 4IUNA 5E4WC 3D4WA 3VR2A 2RVLA 1PTOB 2Z4HA 5I6YA 2FJ2A 4JBWA 5I4DA 4ZUJA 5I2YA 4F8MA 2K01A 5JEAJ 1V8QA 1D5MC 2KECA 1Y69U 2PPBC 1PMRA 5EKLA 5IGGA 1Z6HA 1TS3A 1RD9D 2NVYB 2JXMB 5JPNC 2QEJC 5ISRA 1ZXTA 1Q8IA 5CV9A 4O42A 2NN6G 1SYDA 2RKSA 3QB3A 3QO2A 2A6ED 2MPMA 1K8MA 3RZOB 2O5IC 1T5EA 1RHPA 2EOTA 3U9OA 1JOKA 4Q0FA 4QIWB 3GP7A 2K05A 1EY6A 1S5FD 1BOSA 3FRPB 3VR3A 4WJWA 2ZXPA 3L9AX 2B8GA 5KNCA 1RODA 5D3DA 5HURA 4IURA 3A7LA 3IAYA 2KCCA 2IX1A 4A3GB 3NQTA 4A3MB 3A54A 5D3IB 2B63B 2Z4IA 4K6LA 1STEA 4WRDA 2NWGA 3OMGA 3DM1A 4LMQD 5CV6A 1E2WA 3OW7A 2JEAI 3CHBD 3TDQA 2J4XA 2MJ8A 1GUTA 4LK1C 1X3PA 3K6OA 1S5CD 5DNFA 2RDHA 4QB4A 3W3AA 3OWFA 3DWPA 2B8FA 3NTIA 3TSSA 1PRTD 4ZYSA 1W6JA 1U4PA 3S16B 4OL7A 1PZKD 2EY1A 1QOHA 2G9HD 1B4OA 2EY6A 2PZTA 4GZYC 4C3HG 1BUVT 3J7YW 3U9SA 2G9DA 1JWMD 1JQYD 2B2WA 1EWHA 1F9RA 1Q1BA 1EOTA 4K5XA 3Q22A 1AZQA 2ZXRA 3GD7A 1QNUA 1LT6D 4K8JA 1F9QA 3HOUB 1STHA 2F0FA 3A8JE 5JVH3 4FF2A 2HCIA 3WOFA 4JK1C 1VMCA 1JE4A 1Y1WB 3I4LA 2F0TA 1H9JA 5IGFA 2JA7B 1Y1VB 4XTCS 4MN3A 1BBXC 1HA5A 4IN3A 2B2UC 2A68D 1CK1A 3OSOA 1D1IA 1HTPA 1A3VA 3H6MA 3N6RA 3H3VC 1SYGA 2E76C 4HEDA 4KTAA 1D2BA 4DU9A 5AFWA 2XVSA 4U68A 2F0DA 3FMCA 4FF1A 1PFMA 1LTAD 1M4VA 1EY9A 3TZDA 5C4XB 1SYCA 3T53B 2QDBA 2XRSD 4DXGA 4CJ1B 1G2SA 1PFNA 1O7LA 5C44B 1EY8A 2FINB 3GTPB 3KBXA 3MZ5A 2B2VA 2C5CA 3D6WA 1OXSC 5CV8A 3MTSA 3FDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXT A;  5FKA C;  3OWE B;  1LTR D;  3R2I A;  2AQ2 B;  1CHQ D;  1T5X D;  1D6E C;  2TSS A;  1BCP F;  1ENF A;  2QEJ C;  2AQ3 B;  2O2L D;  1I4G A;  1RCV D;  3BYY B;  3R8B A;  1LT6 D;  4C56 C;  2IPK D;  1TY2 A;  1PRT B;  1LT5 D;  4RGO S;  5ELF A;  1TY0 A;  1DYQ A;  1PTO H;  4RFB A;  1LO5 D;  1LTB D;  1FGB D;  1FNV A;  1CHP D;  1F77 A;  3BZD B;  1HQR D;  1TS4 A;  4TSS A;  3MFG A;  4RHR A;  2RDG A;  1I4X A;  2XRQ D;  1BCP B;  3BVZ A;  1GOZ A;  4L6T B;  2NTT A;  1EWC A;  1B1Z A;  1KLG D;  3GP7 A;  1AN8 A;  1I4R A;  1S5F D;  5TSS A;  1SE2 A;  1HXY D;  1PTO C;  3DWQ A;  4RGN A;  2AQ1 B;  1ET6 A;  1TS2 A;  1LLR D;  1HA5 A;  5D3D A;  1PZJ D;  1G8Z D;  1LT3 D;  3EA6 A;  2Z8L A;  1CQV A;  1SXT A;  3MC0 B;  2ICI A;  1CK1 A;  2WV6 D;  4L63 B;  1EU3 A;  1D5Z C;  1JWS D;  1JWU D;  1PZI D;  1RDP D;  1PTO D;  3DWA A;  1PRT C;  5ELD A;  1KTK A;  1L0X B;  2XNA C;  1EFI D;  4UDU C;  3SEB A;  1FNU A;  2QIL A;  5D3I B;  1FNW A;  1PTO F;  3KLS X;  2SEB D;  4BWG B;  1JCK B;  5ELE A;  1SJH D;  3V05 A;  3URY A;  4K6L A;  1QIL A;  1STE A;  1XTC D;  1LTA D;  3BVG A;  1JR0 D;  1V1O A;  1M4V A;  1I4P A;  1EU4 A;  4RCO A;  1S5E D;  2R61 A;  4RGT A;  1TS5 A;  4O1N A;  1D5X C;  4RGM A;  1PRT F;  5ELC A;  1L0Y B;  1SEB D;  1I4H A;  5ELB A;  2XRS D;  1B44 D;  3CHB D;  4DXG A;  1I4Q A;  1LTG D;  4DXF A;  2J4X A;  1MD2 D;  1PTO B;  1UUP A;  2XN9 C;  5FK9 C;  1LT4 D;  4Z9C B;  1S5C D;  1AW7 A;  4RHS A;  1HTL D;  1LTT D;  1FD7 D;  2RDH A;  5I4D A;  3BVM A;  3R2T A;  1SJE D;  1V1P B;  1ESF A;  1SBB B;  1DJR D;  1UNS A;  2CHB D;  4OHJ A;  1D5M C;  3DWP A;  1CT1 D;  1SE4 A;  1XXG A;  1EEF D;  1S5D D;  3TSS A;  1RF2 D;  1PYW D;  1PRT D;  1BCP C;  3EFX D;  3W2D A;  4ZYS A;  1V1P A;  1LTS D;  1KLU D;  1PZK D;  3BYT B;  1EEI D;  1SE3 A;  2G9H D;  2IJ0 A;  1ET9 A;  1TS3 A;  3O13 A;  4RH6 A;  1S5B D;  1LTI D;  1JWM D;  1JQY D;  1RD9 D;  1BCP D;  2NTS A; 
#chains in the Genus database with same CATH topology
 3QOL A;  2N78 A;  3T56 B;  5FKA C;  1CZW A;  1IKL A;  3I4N H;  2RF4 A;  3D8G A;  2AQ2 B;  3ERQ A;  3ER0 A;  5GRO A;  4HJ5 A;  1ENF A;  4PZ7 A;  4A3L H;  3HG9 A;  3R8B A;  1PV4 A;  2QGQ A;  1PH7 A;  2IPK D;  3OIP A;  4DR6 Q;  1K28 A;  1JC7 A;  5JJL A;  3S1R H;  3TP6 A;  2JA5 B;  4JI0 Q;  3UDG A;  1C4Q A;  2L55 A;  1N34 L;  5DM7 3;  2EJM A;  4M1U B;  5JOB A;  3I72 A;  3F2C A;  1MJC A;  3S2H H;  2FFK B;  3PIP 3;  3P7J A;  1Z9F A;  1I4R A;  4HMJ A;  3DWQ A;  1SYF A;  4K8I A;  3J80 c;  3HZX A;  4PG3 A;  5FOB B;  3T1H L;  4JI3 Q;  2Q8R E;  2OTJ A;  4LF6 L;  2Z8L A;  1N32 L;  1KIX A;  2JSO A;  1GD7 A;  2K5N A;  1R9T B;  1OXX K;  5CV4 A;  3TP8 A;  4PMB A;  4A3J G;  1O7I A;  3EIV A;  4CKE A;  1EFI D;  2A8V A;  3M4P A;  2ZM6 L;  1IZ6 A;  4ZCK A;  3CQZ H;  3GTM H;  4RAU C;  2NB0 A;  1WTP A;  1QNK A;  1E24 A;  4TVA B;  3S17 H;  5I6W A;  2I5L X;  5IGE A;  1VQM A;  4LWC A;  1NUC A;  5ELC A;  2JA6 G;  4DV0 L;  3KLW A;  5J1Z A;  1JJ2 A;  1XNQ Q;  1HZA A;  4AYB G;  3VR4 A;  2JEB I;  1STA A;  1HJP A;  3SVM A;  2VUM B;  1YIJ A;  3GTQ H;  1XMO Q;  1JJC B;  1J6Q A;  4C3J G;  3PF5 A;  2RSO A;  3J81 E;  2X6G A;  2A74 C;  2IY5 B;  1F9S A;  3P20 A;  4WOR A;  4CDF C;  5F2D A;  3E9H A;  1RF2 D;  1YI2 A;  4OEL B;  4QCL A;  3HKS A;  1C8C A;  2K5W A;  1A2T A;  5C0X G;  4ILW A;  2E2I H;  4ZAI A;  1EQT A;  1WTQ A;  3TZU A;  4DAP A;  1Q12 A;  2BE5 C;  2QW7 A;  2MNA A;  5CR3 A;  1K0R A;  4NKL A;  3J7A 5;  4DR4 Q;  1KL9 A;  1BXT A;  1GKH A;  4A3J H;  1Y8P B;  2K04 A;  2K5V A;  2WKD A;  4XT1 B;  1BCP F;  4XQN A;  2E2H H;  3V2T A;  2K1B A;  4X3T A;  5EQ0 A;  4P74 A;  1EYD A;  1I6H B;  4C56 C;  4K2K A;  1NR2 A;  1E2Z A;  1GJX A;  1JIC A;  2BOS A;  5GAE C;  1H9K A;  3J81 i;  2SNM A;  2NZ1 D;  3SHL A;  1PH4 A;  1SE8 A;  5IYD G;  2MGS A;  5EGT A;  4CJ2 C;  3HOW G;  1HQR D;  2JA6 H;  2EQS A;  1WD0 A;  1STG A;  4MTN A;  3ULP A;  1TWA B;  1DON A;  4JI2 Q;  1IW7 C;  4O0A A;  4U67 3;  4C3J H;  4RGN A;  3H3V H;  3J81 L;  1XNR Q;  2BA1 A;  3M7G A;  3S24 A;  1K8G A;  3G4S A;  4HSV A;  3NEL A;  3M3Y H;  1YJW A;  3NSW A;  3HGB A;  2ICI A;  1SMY C;  2BA0 A;  1R4P B;  1JWS D;  4IFD G;  3N52 A;  3FP9 A;  4NMZ A;  1Q86 C;  4UDU C;  1V43 A;  1KDA A;  4J1M A;  5LL6 S;  1K83 H;  3STB C;  2KQ3 A;  4X3U A;  2IX3 A;  3U58 A;  4LFB L;  4ZUI A;  3VYR A;  2SEB D;  1MI2 A;  2E2D C;  4BY7 B;  3MXN A;  1VF7 A;  3BVG A;  4K5W A;  3S1N B;  3QWN A;  4HR7 B;  4RGM A;  2YTV A;  1RIP A;  1MSH A;  4MZ9 A;  4R9W A;  4H44 C;  3T16 A;  4ZK9 B;  2OQK A;  5LHY 1;  1FR3 A;  3BDL A;  3K5M A;  4JV5 L;  4DNT B;  2AMC B;  1UUP A;  2L5T A;  2R92 B;  3HOY B;  3HOW H;  4A75 A;  1H9S A;  4LF8 Q;  5BR8 Q;  2EYH A;  4DAY A;  3HKZ E;  1J5E Q;  1UNS A;  3KBG A;  2M2L A;  1L1O A;  5IWA L;  3M4O B;  1CKM A;  1BCP C;  4DPG A;  2YTX A;  4OXP A;  3X3N A;  5LMN W;  1JOO A;  1KLU D;  1LTS D;  3JC6 6;  2HCC A;  3TN2 A;  1YNX A;  2SDF A;  1U4R A;  2EYP A;  1WTO A;  1VMP A;  1VQ8 A;  2LXJ A;  4JVZ A;  4E6I A;  4DR2 L;  4GOP B;  4IFD H;  3I70 A;  3V96 A;  3R2I A;  4XYQ A;  4IUQ A;  3OPO A;  4DKA C;  2NVT B;  1TWH B;  2WAC A;  5LMU Q;  3J80 i;  3DM3 A;  2F0N A;  2CFM A;  2ZT9 C;  1DOM A;  3D31 A;  3L3O C;  4A3G G;  3I73 A;  1MSG A;  1ICW A;  4A3M G;  1X56 A;  2NVY H;  2DJG C;  1KRT A;  1YNN C;  1HUN A;  1FNV A;  1U4M A;  3OTO Q;  3BS1 A;  2ZTC A;  4R4Q A;  4PQX A;  1E1O A;  3CCS A;  2PMZ B;  3S1Q B;  2EYJ A;  5LMN L;  4OWT B;  1YJ9 A;  3I91 A;  1PYS B;  2GN5 A;  1AN8 A;  4DK0 A;  2KCN A;  5JAV A;  3FKI B;  2F0W A;  4S3S A;  4RCN A;  5C5L A;  5D14 A;  1CQF A;  3WDN A;  3A7A B;  1LT3 D;  3RZO H;  5M5Y B;  1PXU A;  4X65 L;  1BR9 A;  2R7D A;  3SK4 A;  2BDN A;  4LW1 A;  4IQZ A;  3BU2 A;  1DZ1 A;  2PW5 A;  4FXD A;  1OTC A;  3ERS X;  3KFU A;  1S4Z A;  3G6J B;  1F9P A;  3C1E A;  3TEH B;  4KHV A;  2F0L A;  1B3Q A;  1WCM B;  2E5L L;  1LM0 A;  1PH8 A;  1ESR A;  1XTC D;  1AEX A;  2HDM A;  3QOJ A;  1C7Y A;  2JP1 A;  2VQE L;  3SGI A;  1S3O A;  1IHZ A;  5I9P A;  2KVM A;  4DUZ Q;  1GUN A;  4A3G H;  5GQO A;  3QR8 A;  3I4M B;  1YHQ A;  3RD4 A;  1I4Q A;  4HSP A;  2N88 A;  3VA7 A;  2WAQ E;  2KED A;  2HIV A;  1VQE A;  1NMF A;  4RHS A;  1V9P A;  4IOA A;  4IPD A;  1WFQ A;  4FXK C;  1X65 A;  4A3B B;  3M4Y A;  1MIU A;  4X6A H;  4Y7N B;  3NP8 A;  2UXD L;  1SND A;  1Q8K A;  1STB A;  1Y1W G;  3R3O A;  4HJ7 A;  3K8A A;  1PH6 A;  2YU9 B;  3MXP A;  2D0O A;  5C3W A;  4CDC C;  4HCE A;  1DCZ A;  1B9N A;  2HQL A;  4LF9 Q;  4NDX A;  1XPO A;  1HUM A;  3I90 A;  2JA7 G;  3K5N A;  1Y1V G;  5G3L F;  3CCL A;  4JI8 L;  1A2U A;  2UUA L;  4ABN A;  4V0B A;  1D6E C;  3S16 H;  3MHB A;  1X6O A;  2K50 A;  3I2Z A;  4A3C G;  2O2L D;  4HMI A;  2Q8T A;  3F2B A;  2K33 A;  1PRT B;  1PLF A;  1LT5 D;  2HIX A;  2JYO A;  2JQO A;  1TY0 A;  4IUV A;  4JYA L;  3H0G B;  1HNZ L;  3X3M A;  2VQF L;  3NEN A;  1W3S A;  1X9N A;  3DLL A;  2RCN A;  3MFG A;  2XWJ B;  4JI6 Q;  2IT1 A;  2VB2 X;  4DK6 C;  2L1B A;  3NWS A;  4B08 A;  5C4X G;  4JW0 A;  2A6H C;  1HNW Q;  1EIH A;  4MNO A;  1B70 B;  1LAC A;  1WTW A;  2HHH Q;  2I5M X;  3UDX A;  2FHT A;  2K03 A;  3VYS A;  4JBK A;  4OX9 L;  1L2F A;  2ZJQ A;  2D9U A;  3GQB A;  1UAP A;  4A3I H;  1RKN A;  1FYC A;  1GO3 E;  2F3W A;  5KND A;  4LUO A;  3D4R A;  1I6V C;  4IAL A;  1D5Z C;  4DR6 L;  1ONL A;  3CD6 A;  3RZD B;  1YEZ A;  3CCR A;  1QE6 A;  1S40 A;  1SNQ A;  1ILQ A;  2ZTE A;  1A62 A;  2P5Z X;  1RTO A;  4HN7 A;  2JA7 H;  2QIL A;  4IPC A;  2F1M A;  4DUY L;  4NB3 A;  4P71 A;  4BWG B;  5CV7 A;  4CDD C;  5IE8 A;  2RHS B;  1EY4 A;  1XWE A;  2OF1 A;  5EPJ A;  2KCM A;  5KNB A;  3GTO B;  3W1B A;  2OEO A;  2LKV A;  2CH4 A;  2JJQ A;  4DAV A;  4C3I B;  2ID0 A;  1EL0 A;  3PUV A;  1W2B A;  5IYC G;  1KAB A;  3VYU A;  3U4Z A;  5J39 A;  4UAI A;  4FVM A;  1WVL A;  2JA5 G;  3R93 A;  2EXZ A;  1NBW A;  1SSO A;  1XXG A;  1DD2 A;  1TQO A;  1S5D D;  5C4X H;  3W2D A;  2WII B;  1U5K A;  1B8A A;  1O78 A;  3IL8 A;  1VQD A;  2NYZ D;  3KUP A;  1CKO A;  3CF5 A;  2NN6 I;  2CQO A;  3K59 A;  1EEI D;  3CRL C;  2UUB Q;  3CU7 A;  2NN6 H;  2EZV A;  3D6C A;  3O13 A;  1S5B D;  1LTI D;  1HZ9 A;  2CVR A;  1E0B A;  1HRJ A;  1EWI A;  2EYL A;  3C1F A;  1XNQ L;  3GTP H;  4FNF A;  1T5X D;  3IFT A;  4X3S A;  4KY7 A;  3A56 A;  2ZJP A;  4GKJ L;  1I4G A;  3UI2 A;  1XMO L;  1O80 A;  3CP0 A;  1GHJ A;  3RR5 A;  3NTH A;  5GAH C;  4BBS G;  3SK8 A;  2PW7 A;  5JJK A;  2CH4 W;  4HIO A;  2J0T D;  4IJL A;  4BY1 B;  2F3I A;  5M5X H;  4YY3 Q;  4G4K A;  3CC7 A;  3A55 A;  2AUJ D;  5DAU A;  4DR7 Q;  2F4V L;  1KAA A;  3I56 A;  3I4O A;  4HTH A;  1QZG A;  2E75 C;  4I65 A;  4DV7 Q;  2B2W C;  5L37 A;  5IYC H;  4DR4 L;  1B1Z A;  3JAM E;  5C3X A;  4LFC Q;  4PV1 C;  1QG7 A;  2X6L A;  3AFP A;  3GTL B;  3CAM A;  3KYH C;  1VCI A;  2V4D A;  4KKU A;  3AQQ A;  3HKZ B;  3G7L A;  3C46 A;  3GDE A;  4RG1 A;  4QL5 A;  3C2P A;  4B3M Q;  1JWU D;  4OIK A;  1RDP D;  2R7F A;  1KNA A;  1C48 A;  2XNA C;  5IGB A;  4GLV B;  3LWU A;  1Q90 A;  2A69 D;  3MXN B;  5KIX A;  1PTO F;  2F0I A;  3H09 A;  4KY5 A;  4UPA A;  3T13 A;  2I46 A;  3V05 A;  2MUY A;  4G57 A;  4GS3 A;  1M1K C;  3S2D B;  1B2T A;  1IYU A;  1S5E D;  1PRT F;  2RA4 A;  3NK9 A;  1XNR L;  4BBS H;  1CFM A;  3RLN A;  5JVG 3;  3J81 c;  1B44 D;  1H9S B;  3QJY A;  1MD2 D;  1I50 H;  4DAY B;  1E2V A;  4C3H H;  1B9M A;  2H1E A;  2PZU A;  1L1O B;  3CC2 A;  4ODG A;  1XTD A;  1SJE D;  1SFO B;  3CCQ A;  1DJR D;  3JAM L;  2PQA A;  3KF6 A;  2N49 A;  1EEF D;  4Q5V A;  2B2U A;  5C4J B;  1YJN A;  3EFX D;  4B3R Q;  4QMG A;  5M9O A;  2C9O A;  4X66 Q;  1F2Y A;  4IZ8 A;  1KD1 C;  1UE5 A;  4GLA C;  1SE3 A;  1CA6 A;  2K5D A;  2M9V A;  3Q0A A;  1QJO A;  3NPP A;  2O4X A;  5ELE A;  5J22 A;  2B2Y A;  1WD1 A;  4FF3 A;  4V19 0;  4DV2 Q;  3HOV B;  1MKH A;  1LTR D;  1UE7 A;  2CQA A;  1SDF A;  1CSP A;  1MGS A;  1CHQ D;  2NZH A;  3KJO A;  4GN3 B;  1TWG B;  3HFZ B;  5IIF A;  1KAW A;  5FO8 B;  4LF8 L;  5EJW A;  3ZJY C;  4YWL A;  3KK7 A;  3AB9 A;  1KDC A;  2F0M A;  2QKI C;  3GV6 A;  1VQ9 A;  5EBC A;  4I7A A;  2CW0 C;  1M8A A;  2DNE A;  4OO1 G;  3DMU A;  1PH1 A;  2RSN A;  2RCF A;  4OIJ A;  5CC4 A;  4BY7 G;  1GUO A;  1I4X A;  2XRQ D;  5C0X J;  1GOZ A;  3D4D A;  4L6T B;  1FJG Q;  1I6H H;  3DUZ A;  1C0A A;  2YYZ A;  4X3K A;  3C3L A;  3I7F A;  2DY7 A;  2Z6B A;  4A3D B;  1PTO C;  3FPU B;  5KYL A;  2WAQ B;  1TS2 A;  1LLR D;  4J6H A;  1XMQ Q;  4FO2 A;  4R4O A;  5A2Q E;  1G8Z D;  1W6K A;  5LMU L;  4HJA A;  3EA6 A;  2R92 G;  2GVA A;  3HOY G;  2G5D A;  1K8O A;  2B2T C;  4CKB A;  1PRT C;  1TWA H;  4DN4 M;  3OTO L;  2DJF C;  4FF4 A;  2HDL A;  3DEO A;  3CKI B;  1EY0 A;  1SMY D;  2UXC Q;  1GM5 A;  2Q2T A;  4KD3 A;  3STB D;  2Q2I A;  1E3P A;  1JOR A;  1GUW A;  3ULL A;  2VS1 A;  5COR A;  3BJU A;  3I3C A;  3CXC A;  2KEE A;  2RHQ B;  4KJO A;  4OO1 H;  3PF4 A;  1O7Y A;  5HY6 A;  5EAY A;  1ML0 D;  4JI7 L;  4BY7 H;  1LT4 D;  4Z9C B;  1JB7 A;  4JOI A;  1K8A C;  4RKB A;  2IHE A;  3S1N H;  1EZ6 A;  4L8J A;  1ESF A;  1PHJ A;  4LJZ C;  2WFW A;  3VDY A;  4EQN A;  4PMC A;  4IFD J;  4JG2 A;  2A1A A;  4GNX C;  1Z47 A;  3E5S A;  1IXR A;  4EVO A;  5LL6 X;  5M5W B;  2AWO A;  1Q46 A;  1JT8 A;  2R92 H;  5JPM C;  3HOY H;  1ET9 A;  4RH6 A;  3CPF A;  4DUZ L;  2LXK A;  3FKI G;  4BA2 I;  1MBY A;  1BCP D;  4HAE A;  1IL8 A;  3OWE B;  5DEH A;  3Q23 A;  1ZYR C;  2KCT A;  4QJF A;  3ITP A;  4AIM A;  1PDQ A;  1A63 A;  4B3S L;  5C6A A;  1TY2 A;  3Q24 A;  4RFB A;  3PO3 B;  1WCM G;  1KNE A;  2CCZ A;  2NVT H;  2SNS A;  1ZKO A;  1YZ6 A;  1VQH A;  1EFW A;  1EWC A;  2IX0 A;  1YNN D;  1H95 A;  3CCE A;  1NCV A;  3TQY A;  2JK8 A;  3GTK B;  3I4M G;  1ET6 A;  1SLJ A;  1BDO A;  1YHA A;  1H9M A;  1DM0 B;  5CMD A;  1VDZ A;  2D5D A;  2XTI A;  4ME5 A;  3MC0 B;  4L5Q A;  4ALP A;  3S1Q H;  1PZI D;  4JI5 Q;  2FXQ A;  2CWP A;  1DXM A;  2LS0 1;  4JI4 Q;  4A3B G;  1YNJ C;  1PH9 A;  1TWF B;  2F0J A;  3FKI H;  1FNW A;  1T9H A;  4BBR B;  2K52 A;  1JCK B;  4A76 A;  4GN5 A;  2PNH A;  1SJH D;  2Z0S A;  4JI6 L;  5M5Y H;  3H3V I;  2VB3 X;  4EQO A;  1HHV A;  4MIU A;  3NEM A;  2N8N A;  1V1O A;  1I4P A;  3ND8 A;  2KHI A;  2HHH L;  4KKS A;  5C0X I;  1U4L A;  2WP8 J;  1XPR A;  3PCO B;  5C0X H;  4K5V A;  1QVF A;  3S1R B;  1OXV A;  3T4A C;  3BDC A;  1LTG D;  3TBI B;  1CI3 M;  1WCM H;  1SRU A;  5IT9 E;  3PV0 A;  3CCV A;  3U4V A;  1IL2 A;  3A0J A;  1ENA A;  4HIM A;  1EY5 A;  4I7Z C;  3TS2 A;  2CHB D;  3RN2 A;  5ELO A;  3H0G G;  4G7O C;  2OQ0 A;  3KOJ A;  4ME3 A;  4N8X 1;  3FHW A;  4K0K Q;  4AQY Q;  4DK1 A;  3PQI A;  2RDF A;  1V1P A;  4R4T A;  1TVX A;  1TR5 A;  3Q6S A;  4KV6 A;  3E3X A;  1B50 A;  3BYT B;  4H7B A;  4LF4 Q;  1G91 A;  4N9T A;  4FP5 D;  2PNR C;  4IUT A;  3KDF A;  3EVQ A;  2EE1 A;  3HRZ C;  4GKK Q;  2NTS A;  1WTV A;  2EYM A;  5IYD H;  3I8Z A;  3CME A;  1O7Z A;  3KLR A;  4A3B H;  1FL0 A;  3OMC A;  3OOC A;  2D2C C;  3PUZ A;  5FLM G;  3LWE A;  3M9B A;  2B39 A;  4K6D A;  3LNN A;  4KHP Q;  4PNY A;  5BN3 A;  2YU9 H;  5KEE A;  3ERO A;  3S15 B;  3CC4 A;  4PMW A;  1L1O C;  2FMM A;  3BDO A;  3SXH A;  4DNI A;  4RGO S;  4ULL A;  1N36 Q;  3WWV A;  1PTO H;  1KRS A;  4G7H C;  4IFD I;  1N33 L;  2UUB L;  2EY2 A;  1UE6 A;  1X32 A;  3IFD A;  5C4H A;  1AFP A;  2R3Z A;  5IT9 L;  2MFI A;  3K0X A;  5M3M B;  3S1M B;  5AJ3 L;  1KLG D;  4JCV E;  2Q8I B;  4A93 B;  2L15 A;  4OEM B;  4F87 A;  1NTG A;  5M3F B;  4NW2 A;  4C3I G;  4DV5 L;  3GTQ B;  2QDL A;  3H0G H;  1A3U A;  2R6G A;  3HP3 A;  3TRE A;  4JI1 Q;  1GXD C;  2SOB A;  1KHI A;  4L63 B;  2K5Q A;  2A6H D;  2B63 G;  2E2I B;  1J8I A;  1X55 A;  4YWK A;  2NBF A;  4B3T Q;  1NSN S;  5CGK A;  5KYI A;  4YY3 L;  2WB1 E;  1XPU A;  2CWA A;  3MA2 B;  5IP7 G;  2F0O A;  4H0L C;  1NR4 A;  3E9I A;  5FLM H;  2A73 B;  1RTN A;  1SYB A;  1X3Q A;  3A8K E;  4LFC L;  4DV1 Q;  1IBL Q;  1SAP A;  4LFA Q;  1NY4 A;  2Q2H A;  1KQS A;  3RZD H;  4F7X A;  1Q82 C;  5IOC A;  3NXW A;  4IUU A;  1SEB D;  2HT1 A;  5K5P A;  1I4H A;  5ELB A;  4P73 A;  1EY7 A;  5IOD A;  2Y0S E;  4B3M L;  2PQE A;  3L2P A;  5IYB G;  2PQA B;  4YIJ A;  3KF6 B;  3T1H Q;  3R2T A;  3OYY A;  4BY1 G;  4P2C B;  1SE4 A;  2BH2 A;  4CBV A;  5T1I A;  4DV6 Q;  2QCP X;  4C3I H;  2NVQ B;  4R8N A;  3Q8D A;  2ATW A;  4POF A;  5J3B A;  2IJ0 A;  2DY8 A;  4A3M H;  3HEJ A;  2AKW B;  1VS0 A;  2B63 H;  3OW2 A;  3F2U A;  3HOU G;  3HKZ G;  1VQB A;  4OON A;  2F0V A;  1AH9 A;  5ELN A;  5IP7 H;  3FVQ A;  4X62 Q;  2PCF B;  1TKW B;  4YCW A;  3CRK C;  3RN5 A;  4R4I A;  1X3G A;  5GAD C;  1VQ7 A;  4X66 L;  1SRO A;  1VQN A;  5T1G A;  4DR3 Q;  2VY3 A;  1KDB A;  4BA1 I;  1R4Q B;  2DNC A;  1QVC A;  2F0P A;  2BDO A;  3K57 A;  4DV2 L;  5IYB H;  5TSS A;  4CGY B;  1VQC A;  2VW9 A;  4BS9 A;  4CKC A;  4NPS A;  4BY1 H;  1HA6 A;  1PFS A;  4X64 Q;  2BH8 A;  1PZJ D;  3NQI A;  4KN7 C;  1CQV A;  3RLO A;  2K32 A;  2K7V A;  4DV3 L;  5H1S E;  1HQM C;  4XYO A;  2GVB A;  1OXU A;  1HR0 Q;  2ENB A;  1L0X B;  3AMU A;  5EPK A;  4R1J A;  1F2M A;  1FNU A;  1Y8O B;  5FJ8 G;  1LV9 A;  5FLX E;  1DOL A;  3MWY W;  1YBY A;  2L0C A;  3NHH A;  3KLS X;  3GTL H;  2K4K A;  3E0J A;  1QIL A;  1HFN A;  3HOU H;  1SYE A;  4QGU A;  2LY7 A;  3K5O A;  2KA7 A;  1GUG A;  3HOV G;  4QF4 A;  2O5J C;  4L5R C;  3TP7 A;  1XMQ L;  1L0Y B;  2LFN A;  3A5U A;  1A0I A;  2F0H A;  5C44 G;  1Y1W H;  2KBN A;  4JI0 L;  1BQQ T;  3TRZ A;  3CCJ A;  1WTX A;  1BVS A;  1E22 A;  2HUG A;  3S2D H;  1Y1V H;  1I3Q B;  4XT3 B;  5NUC A;  1P8L A;  2FMC A;  1LAB A;  2K14 A;  2UXC L;  3IKJ A;  4KJN A;  4A3C H;  1JB3 A;  2EJF C;  5A35 A;  2F4I A;  3SK6 A;  2EVB A;  3AU7 A;  4JI3 L;  4LFB Q;  2ASB A;  5BN4 A;  3U50 C;  2RBM A;  4R4C A;  4A3D G;  4PZ8 A;  2WAQ G;  2VXW A;  1SFO H;  2NVX B;  2LMC B;  3AFQ A;  4N9P A;  3PSI A;  2E8G A;  5C4J H;  1SNC A;  4LAA A;  5FJ8 H;  2TSS A;  4KHZ A;  5FLX L;  3T1Y Q;  1Q81 C;  3EBE A;  2MP1 A;  4JBM A;  5EBD A;  1UE1 A;  1TXY A;  4OWX B;  4NXM Q;  2N55 A;  1KC8 C;  4JPB W;  1QVG A;  1WTR A;  2OWO A;  1PVO A;  3HOV H;  1F77 A;  2ZTD A;  3VR6 A;  2EDG A;  1IBK Q;  5C44 H;  4XXE A;  5C4Z A;  2CW0 D;  5IWA Q;  3ND9 A;  4RWS C;  3K81 C;  2QF7 A;  4IPG A;  1GUS A;  2X69 A;  2K28 A;  1IYJ B;  1HXY D;  1RJT A;  3M85 A;  4CJ0 B;  1G51 A;  4A3E B;  3P1H A;  1TWC B;  4QUF A;  2HQE A;  4NP5 A;  2L12 A;  4IUP A;  2WV6 D;  3QG1 A;  3EN2 A;  4K2L A;  1QCB D;  5JEA G;  2DN8 A;  5IGC A;  2UUC Q;  3DXJ C;  3DWA A;  1PTO D;  3MEH A;  5ELD A;  1VQF A;  1KTK A;  4QY7 A;  1HFG A;  1K73 C;  5HGT A;  2AWN A;  2B29 A;  3MFY A;  3HS0 C;  4GN4 B;  4GOP C;  3KF8 A;  1JR0 D;  2JA5 H;  2Q2U A;  3F8T A;  4A4I A;  3W1G A;  3PGZ A;  4RGT A;  2GA4 B;  3CCM A;  1C9O A;  1TS5 A;  1D5X C;  1DGS A;  4KY6 A;  1GHK A;  1EIY B;  2VUM G;  1II3 A;  2JA8 B;  1UEA B;  4LF7 Q;  5LMN Q;  4ZKB B;  4TRD A;  4YWM A;  2TMP A;  4DXF A;  4JI5 L;  4JI4 L;  5DM6 3;  4F88 A;  4LF5 Q;  3QIA A;  3GO5 A;  1LTT D;  2E2J B;  2VNU D;  1V1P B;  4M8A A;  3PO3 G;  1CT1 D;  3UE1 A;  5E3F A;  3EJI A;  1R9T H;  2F03 A;  1X54 A;  4JI2 L;  4Y52 H;  2R7Z B;  2EJG C;  4H13 C;  3PO2 B;  3JAM i;  4XDX A;  4C2M B;  3KDF B;  3ONA B;  4HID A;  3S14 B;  1WTH A;  2L9H A;  4A3I B;  2IW3 A;  3K0Y A;  2F0G A;  4B9X A;  1G2T A;  1N9W A;  2Z6K C;  3NTK A;  3K58 A;  5JEA H;  2E5L Q;  3CCU A;  4GLX A;  3J7A V;  2A6E C;  1JMC A;  2IWH A;  5M5W H;  1HCZ A;  4J15 A;  1RCV D;  1OO9 B;  2MO0 A;  4C1N K;  2WB1 B;  4UP9 A;  4EGV A;  1BBU A;  1ZYR D;  4LUV A;  2PZW A;  4K0K L;  2V1C C;  3BZC A;  4RA8 A;  3J7Z C;  4AQY L;  2UU9 Q;  2PO4 A;  1QUQ A;  5KRU A;  3GTJ B;  4BBR G;  1BKB A;  1LO5 D;  4HCS A;  2VUM H;  3RUZ A;  2WKC A;  5C3E B;  4LF4 L;  2JA9 A;  4RHR A;  1G6Z A;  1BCP B;  2F52 A;  1IYV A;  3BVZ A;  2B2Y C;  2QEX A;  3W5O A;  2KUM A;  1VQA A;  2R93 B;  2BE5 D;  2Y0S B;  1CZG A;  3TP5 A;  5BR8 L;  1SNM A;  2PYK A;  1U9R A;  1J5E L;  2I0Q A;  5EPL A;  1BF4 A;  4KHP L;  1I94 Q;  2F0U A;  1SXT A;  4A3F B;  1A15 A;  2B2V C;  4DK3 C;  5C5M A;  3PIO 3;  4R8I A;  4JI8 Q;  1IBM Q;  4EQ5 A;  5COY A;  1N36 L;  1VQI A;  1WI5 A;  3G48 A;  4AYB E;  3GTK H;  5CV5 A;  4RKL A;  3T51 B;  1Y14 B;  1YNJ D;  1CA5 A;  3S9W A;  3M7N A;  1HNZ Q;  4RCO A;  2R61 A;  2VQF Q;  4O1N A;  4NXN Q;  3GV3 A;  1U0L A;  2MO1 A;  1TWF H;  1VF5 C;  4DAM A;  3K7A B;  2OXP A;  1IW7 D;  4BBR H;  3LX0 A;  5M5X B;  5FK9 C;  4C1N I;  4B3T L;  4OX9 Q;  2F0Q A;  3ULJ A;  1SBB B;  2L4N A;  4XQJ A;  2YV5 A;  4YHH Q;  1KXL A;  1QWY A;  1LUZ A;  2BCO A;  4ZKC B;  2B2T A;  5I9O A;  1BNZ A;  3D0F A;  1IBL L;  4DV1 L;  5FO7 B;  3MAQ A;  4LFA L;  4OO1 I;  5M3M G;  1VQG A;  3GTG B;  4A93 G;  4ZRZ A;  4DUY Q;  5FO9 B;  5M3F G;  2VL6 A;  3KLS A;  5EKK A;  1FVI A;  1K3R A;  4ID6 A;  1F2L A;  2IL8 A;  4JOI C;  1D1K A;  4HIK A;  1QZH A;  4WJ3 M;  1EQR A;  4DFA A;  2A69 C;  5BN5 A;  4DV4 Q;  2Z9H A;  4DV6 L;  5A2Q L;  4WJ4 A;  3BZD B;  4BBS B;  1XJV A;  3WOE A;  3TME A;  2L11 A;  1WJJ A;  1AP0 A;  3HOX B;  3BG3 A;  1B7Y B;  2NTT A;  2A68 C;  3M4O H;  3S15 H;  1I50 B;  3NBI A;  3PMF A;  4C3H B;  1WYD A;  2EYF A;  4GNX A;  1XYI A;  3H91 A;  2ICE C;  3G6E A;  2H5X A;  1HR0 W;  1NE3 A;  3HOZ B;  2M00 A;  3SDZ A;  4X62 L;  3NBH A;  3H15 A;  3PUW A;  4ZQ3 A;  2KEN A;  1Z7T A;  5M3M H;  3S1M H;  1A3T A;  1E1T A;  1JOQ A;  4A93 H;  1F2Z A;  3SEB A;  3UDF A;  4LF9 L;  2I5H A;  1TWH H;  5M3F H;  2F3V A;  4GKJ Q;  4KK7 A;  4IJH A;  4DR3 L;  2KHJ A;  2DUD A;  3SK5 A;  4A3K B;  3URY A;  4CHT B;  4KLK A;  1A6X A;  2WIN B;  3NE5 B;  3L7Z C;  1SNO A;  1VQP A;  3ZYY X;  4OGQ C;  2F4V Q;  4RMF A;  4X64 L;  2D62 A;  1CKN A;  3SE0 A;  4QIW E;  2EPB A;  1EYG A;  3A5Z B;  1G29 1;  5JJI A;  4DR1 Q;  1VQL A;  5CBE E;  1HR0 L;  1K9M C;  2E74 C;  4OHJ A;  3I4N B;  1SNP A;  1YVC A;  2OT2 A;  2UXB Q;  3FEW X;  1PYW D;  1HNW L;  4O2D A;  3DEP A;  4G7Z C;  1GVP A;  3RMH A;  4EX5 A;  1Q1E A;  1N8R C;  3E0E A;  4HJ9 A;  4FXG C;  1VQ6 A;  5E7N A;  4J8Q A;  4DR5 Q;  3A74 A;  1CTM A;  4TKO B;  2OCE A;  2XWB B;  3S2H B;  4XQQ A;  1HPC A;  2NVQ H;  1HZB A;  3BYY B;  3MXG A;  3LGJ A;  4DGZ A;  4UHV A;  3VA5 A;  2ZXO A;  3I4M H;  3J7A F;  1K0S A;  2XIW A;  2I07 B;  5ELF A;  1ASZ A;  1S72 A;  1CUK A;  1FGB D;  1HNX Q;  1CHP D;  3RLF A;  3SR1 A;  5I2X A;  2PI2 A;  5E1F A;  1E7Z A;  2K5H A;  3CW2 C;  2AHO B;  4DA2 A;  4Y7N H;  1EQQ A;  1XX8 A;  1LYL A;  3K5L A;  4L5T A;  4DF7 A;  1SE2 A;  3CQZ B;  1IKM A;  2AUK A;  3FPP A;  3T1Y L;  3GTM B;  1OXT A;  3E6Z X;  1VQO A;  1AZP A;  1JJG A;  4ZLT F;  2N3S A;  3S17 B;  5FLX c;  4NXM L;  1STY A;  2XSC A;  4KKT A;  1EU3 A;  2H4O A;  1TII D;  1Y8N B;  3DHQ A;  3J80 E;  3NWT A;  2F0S A;  3K7U C;  1BO0 A;  2ES2 A;  1Q3L A;  3ICE A;  1EIG A;  3OHX C;  1H9R A;  1IBK L;  4KMU C;  1TT2 A;  3KF8 B;  4UP8 A;  1SMX A;  5D65 A;  2PI2 E;  1V1Q A;  4QUC A;  2LSS A;  1B53 A;  4BXX G;  4H02 A;  3VR5 A;  1EU4 A;  2A19 A;  1DOK A;  1VQJ A;  4TQU S;  4MHE A;  3B6Y A;  2EY5 A;  5CBA E;  3OIQ A;  1D8L A;  3UE0 A;  4P72 A;  2MHV A;  4WFN 3;  3TS0 A;  2XN9 C;  2UUC L;  2EXD A;  1NAP A;  1CM9 A;  4JBJ A;  1AW7 A;  4DR7 L;  1HTL D;  5E4X A;  1QB5 D;  1FD7 D;  1MJE A;  2OTL A;  3BVM A;  4B9W A;  4A3J B;  3CPW A;  4DV7 L;  1NNX A;  2DGY A;  2E2H B;  1N34 Q;  4FYD A;  3MVV A;  2KJX A;  4DNR B;  1I3Q H;  1B3A A;  2KOL A;  4LF7 L;  4LNQ A;  3NUC A;  4A3E G;  3J80 L;  2HD3 A;  1STN A;  2JA6 B;  2EYO A;  1PFB A;  3A8I E;  3GTO H;  2KHS A;  4LF5 L;  2AQ3 B;  3PIO A;  2K6A A;  4AYB B;  5K36 G;  4LF6 Q;  1RL2 A;  1N32 Q;  1QUQ B;  2F0K A;  4KI0 A;  5EKI A;  4K14 A;  2Z1C A;  5IGD A;  4BXX H;  1SN8 A;  4KD4 A;  3P75 A;  4C3J B;  1DYQ A;  4LUZ A;  5KGU A;  5JJZ A;  4JI7 Q;  2F0E A;  1LTB D;  2NVX H;  5G3L D;  1D7Q A;  1HZC A;  2ZM6 Q;  3M3Y B;  4KN4 C;  1TS4 A;  4TSS A;  2RDG A;  1YIT A;  4L5S A;  1ENC A;  4XIG S;  1K83 B;  1EZ8 A;  2CKZ B;  2JA8 G;  3AEV A;  4OWW B;  2AQ1 B;  4JC0 A;  4HJ8 A;  1UWV A;  4DV0 Q;  3VYT A;  5HGQ A;  1TU2 B;  1JE5 A;  4B3R L;  2YTY A;  3JAM c;  1ZEQ X;  1ICF B;  1ASY A;  2UU9 L;  3F1Z A;  1ILP A;  3EQL C;  1EYC A;  5IP9 G;  3D3R A;  2JE6 I;  2R7Z G;  3PO2 G;  4EQP A;  1EYA A;  4A3E H;  1PH2 A;  3MXU A;  2RQX A;  4B3S Q;  1J9O A;  1TWC H;  1SR3 A;  4A3I G;  3HOW B;  1M90 C;  2A5H A;  3H94 A;  1PH5 A;  3PUX A;  2NUC A;  5K36 H;  5CYU A;  2JN4 A;  1EUJ A;  3PIP A;  1EQV A;  2J7Z A;  1UEB A;  3PUY A;  4IUN A;  5E4W C;  1I94 L;  3D4W A;  4P75 A;  3VR2 A;  2RVL A;  1PTO B;  2Z4H A;  5I6Y A;  2WB1 G;  5DLQ E;  1VQ4 A;  2FJ2 A;  1IBM L;  4JBW A;  5I4D A;  4ZUJ A;  5I2Y A;  4F8M A;  3CMA A;  2K01 A;  5JEA J;  1V8Q A;  1D5M C;  2KEC A;  1Y69 U;  2PPB C;  3J81 j;  1FJG L;  1PMR A;  2JA8 H;  5C3E G;  5EKL A;  5IGG A;  1Z6H A;  1NJI C;  1TS3 A;  2R93 G;  4NXN L;  2Y0S G;  1RD9 D;  1WOC A;  2E2J H;  2NVY B;  2JXM B;  2D0P A;  2XGT A;  5JPN C;  5IP9 H;  4A3F G;  1P16 A;  2QEJ C;  5ISR A;  2R7Z H;  3PO2 H;  1EIF A;  4C2M H;  1ZXT A;  1HH2 P;  3S14 H;  1Q8I A;  1NMG A;  5CV9 A;  4O42 A;  2NN6 G;  4YHH L;  3QB3 A;  1SYD A;  3QO2 A;  2RKS A;  2A6E D;  2MPM A;  1K8M A;  3L0O A;  4IPH A;  4CDE C;  3RZO B;  2O5I C;  1VQ5 A;  1T5E A;  1RHP A;  2EOT A;  3U9O A;  1AE3 A;  4GNX B;  1JOK A;  2EIF A;  4Q0F A;  4QIW B;  3GP7 A;  1FGU A;  2K05 A;  3FRP B;  1EY6 A;  1BOS A;  1S5F D;  3VR3 A;  4WJW A;  2ZXP A;  2QA4 A;  2NZO A;  3GTJ H;  3L9A X;  2B8G A;  5KNC A;  3NBH B;  1ROD A;  5D3D A;  3I55 A;  5HUR A;  4IUR A;  5C3E H;  3A7L A;  3KJP A;  3M4Q A;  3IAY A;  4JV5 Q;  2KCC A;  1PYB A;  4IOC A;  4DV4 L;  1CSQ A;  3BZK A;  2IX1 A;  4POG A;  4A3G B;  2R93 H;  1TWG H;  3NQT A;  4A3M B;  3A54 A;  5D3I B;  2C35 B;  2B63 B;  2Z4I A;  4K6L A;  1EOV A;  1STE A;  1YHB A;  1PH3 A;  4A3F H;  4WRD A;  2NWG A;  3OMG A;  3DM1 A;  4LMQ D;  5CV6 A;  1E2W A;  1CKN B;  2ALY B;  3RNU A;  4IO9 A;  1N33 Q;  4DR2 Q;  4N8F A;  2MQH A;  3OW7 A;  3CHB D;  2JEA I;  3TDQ A;  2J4X A;  2MJ8 A;  5AJ3 Q;  1PA6 A;  1GUT A;  4LK1 C;  4UP7 A;  1X3P A;  3K6O A;  1X3F A;  1S5C D;  5DNF A;  4DV5 Q;  4A3D H;  2RDH A;  4QB4 A;  3W3A A;  3OWF A;  3DWP A;  2B8F A;  3NTI A;  3TSS A;  1PRT D;  1AE2 A;  4ZYS A;  3K7A H;  1W6J A;  1U4P A;  1LTL A;  3S16 B;  4MTK A;  4OL7 A;  1PZK D;  2EY1 A;  3HOX G;  1QOH A;  1Q7Y C;  2G9H D;  1B4O A;  2EY6 A;  2PZT A;  4GZY C;  4FDB A;  4C3H G;  2K75 A;  1BUV T;  3J7Y W;  3U9S A;  2G9D A;  1JWM D;  1JQY D;  2B2W A;  1EWH A;  1F9R A;  1Q1B A;  3G71 A;  3UDI A;  1X3E A;  3HOZ G;  1EOT A;  4K5X A;  4GOP A;  4YCU A;  5IY0 A;  3Q22 A;  1AZQ A;  4DR1 L;  2ZXR A;  4QQB X;  3GD7 A;  1QNU A;  4APV A;  1LT6 D;  4K8J A;  4X65 Q;  3GTG H;  1F9Q A;  3HOU B;  1STH A;  1BBW A;  2UXB L;  2B3G A;  3MEF A;  5GAG C;  2F0F A;  3A8J E;  5JVH 3;  4FF2 A;  4A3K G;  3K80 C;  3AYH B;  3IRB A;  2HCI A;  4UY8 C;  3WOF A;  4JK1 C;  1VMC A;  4AH6 A;  1JE4 A;  1Y1W B;  3I4L A;  2IHF A;  2F0T A;  2VQE Q;  1H9J A;  5IGF A;  2JA7 B;  4DR5 L;  1Y1V B;  4XTC S;  4MN3 A;  1BBX C;  1MHW C;  1HA5 A;  4IN3 A;  2B2U C;  2A68 D;  1CK1 A;  3OSO A;  1D1I A;  1HTP A;  2Z6K A;  3HOX H;  1A3V A;  3H6M A;  3I4N G;  3F2D A;  3N6R A;  1HNX L;  3H3V C;  1SYG A;  2E76 C;  4HED A;  4KTA A;  1D2B A;  4DU9 A;  4A3L G;  4GKK L;  2ZJR A;  1VQK A;  5AFW A;  2XVS A;  2UXD Q;  3HOZ H;  4U68 A;  2F0D A;  3FMC A;  4FF1 A;  1PFM A;  1G6P A;  1LTA D;  1M4V A;  1EY9 A;  3PO3 H;  3TZD A;  2PMZ E;  5C4X B;  1SYC A;  3T53 B;  2QDB A;  2XRS D;  4DXG A;  4CJ1 B;  2UUA Q;  4A3K H;  1G2S A;  1PFN A;  1O7L A;  5C44 B;  2VZA A;  1EY8 A;  1K3B C;  2FIN B;  3GTP B;  3MZ5 A;  3KBX A;  4YCV A;  1L0W A;  1I5F A;  4DV3 Q;  4JYA Q;  1A8V A;  2B2V A;  2C5C A;  4PZ6 A;  5IT9 c;  3D6W A;  1OXS C;  5CV8 A;  3MTS A;  4JI1 L;  3FDT A; 
#chains in the Genus database with same CATH homology
 3QOL A;  3T56 B;  5FKA C;  1CZW A;  1IKL A;  3D8G A;  2AQ2 B;  3ERQ A;  1ENF A;  3HG9 A;  3R8B A;  2IPK D;  3OIP A;  1JC7 A;  3TP6 A;  2JA5 B;  1C4Q A;  2L55 A;  5DM7 3;  2EJM A;  4M1U B;  5JOB A;  3I72 A;  2FFK B;  3PIP 3;  3P7J A;  1I4R A;  4HMJ A;  3DWQ A;  1SYF A;  4K8I A;  3HZX A;  5FOB B;  2Q8R E;  2Z8L A;  2JSO A;  1R9T B;  1OXX K;  5CV4 A;  3TP8 A;  4PMB A;  4CKE A;  1EFI D;  4RAU C;  2NB0 A;  1WTP A;  1QNK A;  5I6W A;  5IGE A;  1NUC A;  5ELC A;  5J1Z A;  3VR4 A;  2JEB I;  1STA A;  3SVM A;  2VUM B;  4C3J G;  2RSO A;  3J81 E;  2X6G A;  2A74 C;  1F9S A;  3P20 A;  4WOR A;  5F2D A;  1RF2 D;  4QCL A;  1C8C A;  2K5W A;  1A2T A;  5C0X G;  4ILW A;  4ZAI A;  1EQT A;  1WTQ A;  3TZU A;  4DAP A;  1Q12 A;  2BE5 C;  5CR3 A;  4NKL A;  1BXT A;  1Y8P B;  2K04 A;  2WKD A;  4XT1 B;  1BCP F;  4XQN A;  3V2T A;  2K1B A;  4X3T A;  5EQ0 A;  1EYD A;  1I6H B;  4C56 C;  4K2K A;  1NR2 A;  1E2Z A;  1GJX A;  1JIC A;  2BOS A;  1H9K A;  2SNM A;  2NZ1 D;  3SHL A;  2MGS A;  5EGT A;  4CJ2 C;  1HQR D;  1WD0 A;  1STG A;  1TWA B;  1DON A;  1IW7 C;  4U67 3;  4RGN A;  3J81 L;  2BA1 A;  3M7G A;  4HSV A;  3NSW A;  3HGB A;  2ICI A;  1SMY C;  2BA0 A;  1R4P B;  1JWS D;  4IFD G;  3N52 A;  4NMZ A;  4UDU C;  1V43 A;  1KDA A;  4J1M A;  5LL6 S;  2IX3 A;  2KQ3 A;  4X3U A;  4ZUI A;  3VYR A;  2SEB D;  1MI2 A;  2E2D C;  4BY7 B;  3MXN A;  1VF7 A;  3BVG A;  4K5W A;  3S1N B;  3QWN A;  4HR7 B;  4RGM A;  1MSH A;  4R9W A;  3T16 A;  4H44 C;  5LHY 1;  4ZK9 B;  1FR3 A;  3BDL A;  3K5M A;  4DNT B;  1UUP A;  2L5T A;  2R92 B;  3HOY B;  1H9S A;  2EYH A;  4DAY A;  1UNS A;  3KBG A;  2M2L A;  3M4O B;  1BCP C;  3X3N A;  1JOO A;  1KLU D;  1LTS D;  2HCC A;  3TN2 A;  2SDF A;  1U4R A;  2EYP A;  1WTO A;  1VMP A;  4E6I A;  4IFD H;  3I70 A;  3V96 A;  3R2I A;  4XYQ A;  4IUQ A;  3OPO A;  2NVT B;  1TWH B;  2WAC A;  2F0N A;  2ZT9 C;  1DOM A;  3D31 A;  3L3O C;  3I73 A;  1MSG A;  1ICW A;  1YNN C;  1HUN A;  1FNV A;  1U4M A;  3BS1 A;  4PQX A;  2PMZ B;  3S1Q B;  2EYJ A;  3I91 A;  1AN8 A;  4DK0 A;  2KCN A;  5JAV A;  3FKI B;  2F0W A;  4S3S A;  4RCN A;  5C5L A;  5D14 A;  1CQF A;  3WDN A;  3A7A B;  1LT3 D;  5M5Y B;  1PXU A;  1BR9 A;  3SK4 A;  2BDN A;  4IQZ A;  1DZ1 A;  2PW5 A;  4FXD A;  1S4Z A;  3G6J B;  1F9P A;  3C1E A;  4KHV A;  2F0L A;  1WCM B;  1ESR A;  1XTC D;  1AEX A;  2HDM A;  3QOJ A;  2JP1 A;  1IHZ A;  5I9P A;  2KVM A;  1GUN A;  3I4M B;  3RD4 A;  1I4Q A;  4HSP A;  2N88 A;  3VA7 A;  2KED A;  4RHS A;  4FXK C;  4A3B B;  3M4Y A;  4Y7N B;  3NP8 A;  1SND A;  1STB A;  3R3O A;  2YU9 B;  3MXP A;  5C3W A;  4HCE A;  1DCZ A;  1B9N A;  4NDX A;  1HUM A;  3I90 A;  3K5N A;  5G3L F;  1A2U A;  4ABN A;  4V0B A;  1D6E C;  3MHB A;  2O2L D;  4HMI A;  2Q8T A;  2K33 A;  1PRT B;  1PLF A;  1LT5 D;  2JYO A;  1TY0 A;  4IUV A;  3H0G B;  3X3M A;  3MFG A;  2XWJ B;  2IT1 A;  2VB2 X;  2L1B A;  3NWS A;  4B08 A;  2A6H C;  1EIH A;  1LAC A;  1WTW A;  2FHT A;  2K03 A;  3VYS A;  2D9U A;  3GQB A;  1UAP A;  1RKN A;  1FYC A;  2F3W A;  5KND A;  3D4R A;  1I6V C;  4IAL A;  1D5Z C;  1ONL A;  3RZD B;  1QE6 A;  1SNQ A;  1ILQ A;  1RTO A;  4HN7 A;  2QIL A;  2F1M A;  4BWG B;  5CV7 A;  1EY4 A;  1XWE A;  5EPJ A;  2OF1 A;  5KNB A;  3GTO B;  2OEO A;  2LKV A;  4DAV A;  4C3I B;  2ID0 A;  1EL0 A;  3PUV A;  1KAB A;  3VYU A;  5J39 A;  4UAI A;  4FVM A;  1WVL A;  3R93 A;  2EXZ A;  1SSO A;  1XXG A;  1DD2 A;  1TQO A;  1S5D D;  3W2D A;  2WII B;  1O78 A;  3IL8 A;  2NYZ D;  3KUP A;  2NN6 I;  3K59 A;  1EEI D;  3CRL C;  3CU7 A;  2NN6 H;  2EZV A;  3D6C A;  3O13 A;  1S5B D;  1LTI D;  2CVR A;  1E0B A;  1HRJ A;  2EYL A;  3C1F A;  4FNF A;  1T5X D;  3IFT A;  4X3S A;  4KY7 A;  3A56 A;  1I4G A;  3UI2 A;  1O80 A;  1GHJ A;  3NTH A;  3SK8 A;  2PW7 A;  2J0T D;  4BY1 B;  4G4K A;  3A55 A;  2AUJ D;  5DAU A;  1KAA A;  4HTH A;  2E75 C;  4I65 A;  2B2W C;  1B1Z A;  3JAM E;  5C3X A;  4PV1 C;  1QG7 A;  2X6L A;  3GTL B;  1VCI A;  2V4D A;  4KKU A;  3HKZ B;  3G7L A;  3C46 A;  3C2P A;  1JWU D;  4OIK A;  1RDP D;  1KNA A;  1C48 A;  2XNA C;  5IGB A;  3LWU A;  1Q90 A;  2A69 D;  5KIX A;  1PTO F;  2F0I A;  3H09 A;  4KY5 A;  3T13 A;  2I46 A;  3V05 A;  2MUY A;  4G57 A;  3S2D B;  1B2T A;  1IYU A;  1S5E D;  1PRT F;  2RA4 A;  3NK9 A;  1CFM A;  5JVG 3;  1B44 D;  1H9S B;  3QJY A;  1MD2 D;  1E2V A;  1B9M A;  2H1E A;  2PZU A;  4ODG A;  1SJE D;  1SFO B;  1DJR D;  3JAM L;  1EEF D;  4Q5V A;  2B2U A;  5C4J B;  3EFX D;  4QMG A;  5M9O A;  2C9O A;  1F2Y A;  4IZ8 A;  1SE3 A;  1CA6 A;  2K5D A;  2M9V A;  3Q0A A;  1QJO A;  3NPP A;  2O4X A;  5ELE A;  5J22 A;  2B2Y A;  1WD1 A;  4FF3 A;  4V19 0;  3HOV B;  1LTR D;  2CQA A;  1SDF A;  1MGS A;  1CHQ D;  5IIF A;  1TWG B;  5FO8 B;  5EJW A;  3KK7 A;  3AB9 A;  1KDC A;  2F0M A;  2QKI C;  3GV6 A;  5EBC A;  2CW0 C;  1M8A A;  2DNE A;  4OO1 G;  3DMU A;  2RSN A;  4OIJ A;  5CC4 A;  1GUO A;  1I4X A;  2XRQ D;  5C0X J;  1GOZ A;  3D4D A;  4L6T B;  3DUZ A;  2YYZ A;  4X3K A;  3C3L A;  2DY7 A;  4A3D B;  1PTO C;  3FPU B;  5KYL A;  2WAQ B;  1TS2 A;  1LLR D;  4J6H A;  4FO2 A;  5A2Q E;  1G8Z D;  1W6K A;  3EA6 A;  1K8O A;  2B2T C;  4CKB A;  1PRT C;  4DN4 M;  4FF4 A;  2HDL A;  3DEO A;  3CKI B;  1EY0 A;  1SMY D;  4KD3 A;  1JOR A;  1GUW A;  5COR A;  3I3C A;  2KEE A;  4OO1 H;  4KJO A;  1O7Y A;  1ML0 D;  1LT4 D;  4Z9C B;  4RKB A;  1EZ6 A;  4L8J A;  1ESF A;  4LJZ C;  4EQN A;  4PMC A;  4IFD J;  1Z47 A;  3E5S A;  4EVO A;  5LL6 X;  5M5W B;  2AWO A;  5JPM C;  1ET9 A;  4RH6 A;  4BA2 I;  1MBY A;  1BCP D;  4HAE A;  1IL8 A;  3OWE B;  5DEH A;  3Q23 A;  1ZYR C;  3ITP A;  1PDQ A;  5C6A A;  1TY2 A;  3Q24 A;  4RFB A;  3PO3 B;  1KNE A;  2SNS A;  1ZKO A;  1EWC A;  2IX0 A;  1YNN D;  1NCV A;  3GTK B;  1ET6 A;  1BDO A;  1H9M A;  1DM0 B;  5CMD A;  1VDZ A;  2D5D A;  4ME5 A;  3MC0 B;  1PZI D;  2LS0 1;  1DXM A;  1YNJ C;  1TWF B;  2F0J A;  1FNW A;  4BBR B;  1JCK B;  1SJH D;  2VB3 X;  4EQO A;  1HHV A;  4MIU A;  1V1O A;  1I4P A;  3ND8 A;  4KKS A;  5C0X I;  1U4L A;  2WP8 J;  5C0X H;  4K5V A;  3S1R B;  1OXV A;  3T4A C;  3BDC A;  1LTG D;  3TBI B;  1CI3 M;  5IT9 E;  3PV0 A;  1ENA A;  1EY5 A;  4I7Z C;  2CHB D;  4G7O C;  4DK1 A;  2RDF A;  1V1P A;  1TVX A;  1TR5 A;  3Q6S A;  4KV6 A;  1B50 A;  3BYT B;  4H7B A;  1G91 A;  4N9T A;  4FP5 D;  2PNR C;  4IUT A;  3EVQ A;  2EE1 A;  3HRZ C;  2NTS A;  1WTV A;  2EYM A;  3I8Z A;  1O7Z A;  3KLR A;  3OMC A;  3OOC A;  2D2C C;  3PUZ A;  3LWE A;  2B39 A;  4K6D A;  3LNN A;  4PNY A;  5BN3 A;  5KEE A;  3ERO A;  3S15 B;  4PMW A;  2FMM A;  3BDO A;  3SXH A;  4RGO S;  4ULL A;  1PTO H;  4G7H C;  4IFD I;  2EY2 A;  1X32 A;  3IFD A;  5C4H A;  1AFP A;  2R3Z A;  5IT9 L;  5M3M B;  3S1M B;  1KLG D;  2Q8I B;  4A93 B;  4F87 A;  5M3F B;  4NW2 A;  4C3I G;  3GTQ B;  1A3U A;  2R6G A;  3HP3 A;  1GXD C;  2SOB A;  4L63 B;  2K5Q A;  2A6H D;  2E2I B;  1J8I A;  2NBF A;  1NSN S;  5CGK A;  5KYI A;  3MA2 B;  2F0O A;  4H0L C;  1NR4 A;  2A73 B;  1RTN A;  1SYB A;  1X3Q A;  3A8K E;  1SAP A;  4F7X A;  5IOC A;  3NXW A;  4IUU A;  1SEB D;  5K5P A;  1I4H A;  5ELB A;  1EY7 A;  5IOD A;  2PQE A;  4YIJ A;  3R2T A;  4P2C B;  1SE4 A;  4CBV A;  5T1I A;  2QCP X;  2NVQ B;  4R8N A;  2IJ0 A;  2DY8 A;  3HEJ A;  3F2U A;  2F0V A;  3FVQ A;  2PCF B;  1TKW B;  3CRK C;  5T1G A;  1KDB A;  4BA1 I;  1R4Q B;  2DNC A;  2F0P A;  2BDO A;  3K57 A;  5TSS A;  4CGY B;  4BS9 A;  4CKC A;  1HA6 A;  1PZJ D;  3NQI A;  4KN7 C;  1CQV A;  2K32 A;  2K7V A;  1HQM C;  4XYO A;  1OXU A;  2ENB A;  1L0X B;  3AMU A;  5EPK A;  1F2M A;  1FNU A;  1Y8O B;  1LV9 A;  5FLX E;  1DOL A;  3MWY W;  2L0C A;  3NHH A;  3KLS X;  3E0J A;  1QIL A;  1HFN A;  1SYE A;  2LY7 A;  3K5O A;  2KA7 A;  1GUG A;  4QF4 A;  2O5J C;  3TP7 A;  1L0Y B;  2LFN A;  2F0H A;  1BQQ T;  1WTX A;  2HUG A;  1I3Q B;  4XT3 B;  5NUC A;  2FMC A;  1LAB A;  3IKJ A;  4KJN A;  1JB3 A;  2EJF C;  5A35 A;  2F4I A;  3SK6 A;  2EVB A;  3AU7 A;  5BN4 A;  2RBM A;  2VXW A;  2NVX B;  2LMC B;  4N9P A;  1SNC A;  4LAA A;  2TSS A;  4KHZ A;  5FLX L;  2MP1 A;  5EBD A;  2N55 A;  1WTR A;  1F77 A;  3VR6 A;  2EDG A;  4XXE A;  5C4Z A;  2CW0 D;  3ND9 A;  4RWS C;  2QF7 A;  1GUS A;  2X69 A;  2K28 A;  1HXY D;  1RJT A;  3M85 A;  4CJ0 B;  4A3E B;  3P1H A;  1TWC B;  4QUF A;  2HQE A;  4NP5 A;  2L12 A;  4IUP A;  2WV6 D;  3QG1 A;  4K2L A;  1QCB D;  5JEA G;  2DN8 A;  5IGC A;  3DXJ C;  3DWA A;  1PTO D;  3MEH A;  5ELD A;  1KTK A;  1HFG A;  5HGT A;  2AWN A;  3MFY A;  3HS0 C;  3KF8 A;  1JR0 D;  4RGT A;  2GA4 B;  1TS5 A;  1D5X C;  4KY6 A;  1GHK A;  2JA8 B;  1II3 A;  1UEA B;  4ZKB B;  4TRD A;  2TMP A;  4DXF A;  5DM6 3;  4F88 A;  3QIA A;  3GO5 A;  1LTT D;  2E2J B;  2VNU D;  1V1P B;  4M8A A;  1CT1 D;  5E3F A;  3EJI A;  2F03 A;  2R7Z B;  2EJG C;  4H13 C;  3PO2 B;  4XDX A;  4C2M B;  3ONA B;  3S14 B;  2L9H A;  4A3I B;  2IW3 A;  3K0Y A;  2F0G A;  4B9X A;  1G2T A;  3K58 A;  3NTK A;  5JEA H;  3J7A V;  2A6E C;  2IWH A;  1HCZ A;  1RCV D;  1OO9 B;  4C1N K;  2WB1 B;  4EGV A;  1ZYR D;  2PZW A;  4RA8 A;  3GTJ B;  2PO4 A;  5KRU A;  1LO5 D;  4HCS A;  3RUZ A;  2WKC A;  5C3E B;  4RHR A;  1G6Z A;  1BCP B;  1IYV A;  3BVZ A;  2B2Y C;  2KUM A;  2R93 B;  2BE5 D;  2Y0S B;  1CZG A;  3TP5 A;  1SNM A;  2PYK A;  1U9R A;  5EPL A;  1BF4 A;  2F0U A;  1SXT A;  4A3F B;  1A15 A;  2B2V C;  5C5M A;  3PIO 3;  4R8I A;  5COY A;  5CV5 A;  4RKL A;  3T51 B;  1YNJ D;  1CA5 A;  3S9W A;  3M7N A;  4RCO A;  2R61 A;  4O1N A;  3GV3 A;  1VF5 C;  3K7A B;  2OXP A;  1IW7 D;  3LX0 A;  5M5X B;  5FK9 C;  4C1N I;  2F0Q A;  1SBB B;  2L4N A;  4XQJ A;  1QWY A;  2BCO A;  4ZKC B;  2B2T A;  5I9O A;  1BNZ A;  5FO7 B;  3MAQ A;  4OO1 I;  3GTG B;  4ZRZ A;  5FO9 B;  3KLS A;  5EKK A;  4ID6 A;  1F2L A;  2IL8 A;  1D1K A;  4DFA A;  2A69 C;  5BN5 A;  5A2Q L;  3BZD B;  4BBS B;  3WOE A;  3TME A;  2L11 A;  1AP0 A;  3HOX B;  3BG3 A;  2NTT A;  2A68 C;  1I50 B;  3NBI A;  3PMF A;  4C3H B;  2EYF A;  1XYI A;  3H91 A;  2ICE C;  3HOZ B;  2M00 A;  3SDZ A;  3NBH A;  3PUW A;  4ZQ3 A;  1Z7T A;  1A3T A;  1JOQ A;  1F2Z A;  3SEB A;  2F3V A;  4KK7 A;  3SK5 A;  4A3K B;  3URY A;  4CHT B;  1A6X A;  2WIN B;  3NE5 B;  3L7Z C;  1SNO A;  3ZYY X;  4OGQ C;  2D62 A;  3SE0 A;  2EPB A;  1G29 1;  5CBE E;  2E74 C;  4OHJ A;  3I4N B;  1SNP A;  2OT2 A;  3FEW X;  1PYW D;  3DEP A;  4G7Z C;  3RMH A;  1Q1E A;  4FXG C;  4J8Q A;  1CTM A;  4TKO B;  2XWB B;  3S2H B;  4XQQ A;  1HPC A;  3BYY B;  3MXG A;  4DGZ A;  3VA5 A;  2ZXO A;  3J7A F;  2XIW A;  2I07 B;  5ELF A;  1FGB D;  1CHP D;  3RLF A;  3SR1 A;  5I2X A;  5E1F A;  4DA2 A;  1XX8 A;  3K5L A;  4DF7 A;  1SE2 A;  3CQZ B;  1IKM A;  2AUK A;  3FPP A;  3GTM B;  1OXT A;  3E6Z X;  1AZP A;  4ZLT F;  3S17 B;  1STY A;  2XSC A;  4KKT A;  1EU3 A;  2H4O A;  1TII D;  1Y8N B;  3DHQ A;  3J80 E;  3NWT A;  2F0S A;  1BO0 A;  1Q3L A;  1EIG A;  3OHX C;  1H9R A;  4KMU C;  1TT2 A;  5D65 A;  4QUC A;  1B53 A;  3VR5 A;  1EU4 A;  1DOK A;  4TQU S;  4MHE A;  2EY5 A;  5CBA E;  3OIQ A;  2MHV A;  4WFN 3;  2XN9 C;  1NAP A;  1CM9 A;  1AW7 A;  1HTL D;  5E4X A;  1QB5 D;  1FD7 D;  3BVM A;  4B9W A;  4A3J B;  2E2H B;  4FYD A;  3MVV A;  2KJX A;  4DNR B;  1B3A A;  2KOL A;  3NUC A;  3J80 L;  1STN A;  2JA6 B;  2EYO A;  1PFB A;  3A8I E;  2KHS A;  2AQ3 B;  2K6A A;  4AYB B;  5K36 G;  2F0K A;  4KI0 A;  5EKI A;  4K14 A;  2Z1C A;  5IGD A;  4KD4 A;  4C3J B;  3P75 A;  1DYQ A;  5KGU A;  5JJZ A;  2F0E A;  1LTB D;  5G3L D;  3M3Y B;  4KN4 C;  1TS4 A;  4TSS A;  2RDG A;  1ENC A;  4XIG S;  1K83 B;  1EZ8 A;  2AQ1 B;  3VYT A;  1TU2 B;  1ZEQ X;  1ILP A;  3EQL C;  1EYC A;  3D3R A;  2JE6 I;  4EQP A;  1EYA A;  3MXU A;  2RQX A;  1J9O A;  3HOW B;  2A5H A;  3H94 A;  3PUX A;  2NUC A;  5K36 H;  5CYU A;  1EQV A;  2J7Z A;  3PUY A;  4IUN A;  5E4W C;  3D4W A;  3VR2 A;  2RVL A;  1PTO B;  2Z4H A;  5I6Y A;  2FJ2 A;  4JBW A;  5I4D A;  4ZUJ A;  5I2Y A;  4F8M A;  2K01 A;  5JEA J;  1V8Q A;  1D5M C;  2KEC A;  1Y69 U;  2PPB C;  1PMR A;  5EKL A;  5IGG A;  1Z6H A;  1TS3 A;  1RD9 D;  2NVY B;  2JXM B;  5JPN C;  2QEJ C;  5ISR A;  1ZXT A;  1Q8I A;  5CV9 A;  4O42 A;  2NN6 G;  1SYD A;  2RKS A;  3QB3 A;  3QO2 A;  2A6E D;  2MPM A;  1K8M A;  3RZO B;  2O5I C;  1T5E A;  1RHP A;  2EOT A;  3U9O A;  1JOK A;  4Q0F A;  4QIW B;  3GP7 A;  2K05 A;  1EY6 A;  1S5F D;  1BOS A;  3FRP B;  3VR3 A;  4WJW A;  2ZXP A;  3L9A X;  2B8G A;  5KNC A;  1ROD A;  5D3D A;  5HUR A;  4IUR A;  3A7L A;  3IAY A;  2KCC A;  2IX1 A;  4A3G B;  3NQT A;  4A3M B;  3A54 A;  5D3I B;  2B63 B;  2Z4I A;  4K6L A;  1STE A;  4WRD A;  2NWG A;  3OMG A;  3DM1 A;  4LMQ D;  5CV6 A;  1E2W A;  3OW7 A;  2JEA I;  3CHB D;  3TDQ A;  2J4X A;  2MJ8 A;  1GUT A;  4LK1 C;  1X3P A;  3K6O A;  1S5C D;  5DNF A;  2RDH A;  4QB4 A;  3W3A A;  3OWF A;  3DWP A;  2B8F A;  3NTI A;  3TSS A;  1PRT D;  4ZYS A;  1W6J A;  1U4P A;  3S16 B;  4OL7 A;  1PZK D;  2EY1 A;  1QOH A;  2G9H D;  1B4O A;  2EY6 A;  2PZT A;  4GZY C;  4C3H G;  1BUV T;  3J7Y W;  3U9S A;  2G9D A;  1JWM D;  1JQY D;  2B2W A;  1EWH A;  1F9R A;  1Q1B A;  1EOT A;  4K5X A;  3Q22 A;  1AZQ A;  2ZXR A;  3GD7 A;  1QNU A;  1LT6 D;  4K8J A;  1F9Q A;  3HOU B;  1STH A;  2F0F A;  3A8J E;  5JVH 3;  4FF2 A;  2HCI A;  3WOF A;  4JK1 C;  1VMC A;  1JE4 A;  1Y1W B;  3I4L A;  2F0T A;  1H9J A;  5IGF A;  2JA7 B;  1Y1V B;  4XTC S;  4MN3 A;  1BBX C;  1HA5 A;  4IN3 A;  2B2U C;  2A68 D;  1CK1 A;  3OSO A;  1D1I A;  1HTP A;  1A3V A;  3H6M A;  3N6R A;  3H3V C;  1SYG A;  2E76 C;  4HED A;  4KTA A;  1D2B A;  4DU9 A;  5AFW A;  2XVS A;  4U68 A;  2F0D A;  3FMC A;  4FF1 A;  1PFM A;  1LTA D;  1M4V A;  1EY9 A;  3TZD A;  5C4X B;  1SYC A;  3T53 B;  2QDB A;  2XRS D;  4DXG A;  4CJ1 B;  1G2S A;  1PFN A;  1O7L A;  5C44 B;  1EY8 A;  2FIN B;  3GTP B;  3KBX A;  3MZ5 A;  2B2V A;  2C5C A;  3D6W A;  1OXS C;  5CV8 A;  3MTS A;  3FDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...