4Z9CB

Ecpltab oxidized
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
ADYDKYFSNVQINNLSYGVYTSGGKESQFFCIGIKRDNVTLPIHNMCKVDVFGSHKQGFDAMMEMAKYYYATGESIRVYYKENVWSDSEFKKAFSTNELISLSTCSSSDYCMGPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pertussis toxin-like subunit ArtA
publication title Structure and function analyses of a pertussis-like toxin from pathogenic Escherichia coli reveal a distinct mechanism of inhibition of trimeric G proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 26
structure length 115
sequence length 115
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4z9cB00
2RDHA 4L6TB 5TSSA 1LTAD 1FNWA 1SBBB 3R8BA 1D5ZC 1PRTB 2ICIA 1LT5D 4RFBA 3TSSA 1LTID 3W2DA 1SE3A 1L0YB 2Z8LA 1JWSD 1JCKB 1V1PA 1BCPC 5D3DA 3MFGA 1EEFD 1TS3A 1B44D 1PTOH 1PYWD 5ELFA 3DWAA 1EWCA 2QEJC 1KLGD 1PRTD 4DXFA 4RCOA 4RHRA 4K6LA 1D5MC 2IPKD 2QILA 3O13A 1JQYD 2O2LD 1LTGD 1RCVD 1PRTF 4ZYSA 1M4VA 1S5ED 2G9HD 3BVMA 3DWQA 4O1NA 4C56C 1SE2A 1PTOC 1TS4A 1QILA 1BCPF 3BVGA 1CHPD 1D6EC 1SJED 1BCPB 1B1ZA 1I4GA 3EFXD 4Z9CB 1FNVA 1AW7A 2R61A 1I4HA 1RDPD 1UUPA 4UDUC 4BWGB 3V05A 1HTLD 1LTSD 1EEID 1TY0A 1D5XC 1SEBD 4L63B 4RGNA 2CHBD 3KLSX 1LT3D 4DXGA 1TS2A 1I4XA 2J4XA 1PZKD 2NTTA 5ELDA 5ELEA 4RGOS 1BCPD 2XRQD 5FKAC 1KTKA 4OHJA 2NTSA 1EFID 4TSSA 1FGBD 1HXYD 1HA5A 1XTCD 3BYTB 1AN8A 2AQ1B 1F77A 1LT6D 1LTTD 2IJ0A 1PZJD 1FNUA 3EA6A 1S5CD 1ET6A 1CQVA 1L0XB 1S5BD 1JWMD 1LTBD 1EU3A 5ELBA 1ESFA 1S5DD 2SEBD 3CHBD 1JR0D 5D3IB 4RGTA 1CHQD 1EU4A 1T5XD 1ET9A 1DYQA 2RDGA 1HQRD 1LTRD 1XXGA 2WV6D 1PRTC 1PTOD 1V1OA 1LO5D 1SXTA 2AQ2B 3DWPA 2AQ3B 1ENFA 1G8ZD 4RHSA 1STEA 1GOZA 1CT1D 1I4PA 3URYA 5I4DA 1S5FD 3BZDB 1PZID 4RH6A 5FK9C 2TSSA 3MC0B 1RD9D 2XN9C 4RGMA 3R2TA 1LT4D 1JWUD 1I4RA 1PTOF 1PTOB 1FD7D 1RF2D 3R2IA 1SJHD 1KLUD 1LLRD 1TY2A 1UNSA 1V1PB 2XRSD 1BXTA 1CK1A 1MD2D 3BVZA 1TS5A 3SEBA 3GP7A 5ELCA 1SE4A 2XNAC 3OWEB 3BYYB 1DJRD 1I4QA
chains in the Genus database with same CATH superfamily
1H9SB 4ALPA 4HIOA 3JAME 3OMCA 3S1MB 3ND9A 5JEAG 5C3WA 1K8GA 1STBA 1GHKA 4DR5Q 2C9OA 1L1OC 4ZKCB 4NP5A 4LF4L 1TWHB 2NYZD 2A19A 2B63G 4I7AA 1AZPA 3T1HQ 5BR8L 4Q5VA 1F9PA 5CGKA 4H0LC 4R4CA 4DAMA 2A1AA 3H3VH 4DNIA 4A3MB 5C44B 3G48A 1QZGA 3CRKC 3AFQA 1I6VC 3EROA 1X65A 4JI8Q 1YZ6A 2ALYB 4AQYQ 2QGQA 3MXPA 4B9XA 5LL6S 5JJIA 1VQ4A 2Q8RE 1S5ED 1HNZL 1NNXA 5EPJA 3R3OA 4CDFC 1PTOC 3FVQA 1IBML 1MHWC 4NXNL 5JOBA 4DV7L 4K0KQ 3KUPA 1NCVA 1RDPD 4BWGB 2IWHA 3KJPA 1BR9A 4KY5A 2OWOA 1SYBA 2JA6B 2RHQB 3OSOA 4L63B 1BBXC 1TU2B 3T53B 1O7ZA 4JC0A 2LFNA 2KENA 4A3MH 3DMUA 2RBMA 2ZJPA 3HKZG 2GN5A 2EY1A 4U68A 3UDFA 1AE2A 2E75C 5EBDA 1CZGA 1Q8KA 3KK7A 1B53A 1HZ9A 2HHHQ 2AQ1B 4UP7A 1F77A 2NVYB 1XPRA 1N34L 5IP9H 2L1BA 3PUYA 5KGUA 3CQZB 4XYOA 1MJEA 5HGTA 2EZVA 3T16A 1ESFA 5IGEA 2G5DA 4DV2L 4B3ML 1JT8A 1NSNS 5KNBA 3HOXH 4X65L 4NXML 1SNCA 2HUGA 1X9NA 2CWPA 1HZCA 4OO1G 1SE8A 2MJ8A 4NDXA 3J80c 1G8ZD 1SRUA 5AJ3L 2E2IH 1BOSA 1CT1D 5FK9C 1PZID 1YNND 4JW0A 3P7JA 2KEDA 1YITA 2ZT9C 1XNRL 2BA1A 2JP1A 1V1PB 3CQZH 4EX5A 3K5NA 4A3JB 1HNWQ 3C1EA 3K7UC 5FLMH 1SE4A 3KF6B 1HFGA 1E24A 1I4QA 1D1KA 5GROA 4PMWA 4HIMA 2R92H 2DGYA 2EJGC 1H9KA 4DR2L 1JB7A 2B8GA 1VQDA 4K2LA 4ZK9B 3L7ZC 1CSPA 4DFAA 1L0YB 4DUYL 2UUBL 2XIWA 2JN4A 1C8CA 2CW0D 3S1RB 1XPUA 2ZTDA 4KK7A 1ILQA 4LUVA 2VY3A 1D2BA 1BBUA 3KBXA 4G7ZC 3F2UA 4EVOA 3ERQA 2B2UA 4RAUC 2UUCQ 3RLOA 2PQEA 5C4ZA 1FL0A 5M9OA 4C3JB 2PCFB 1WCMB 1P16A 2JQOA 2PZUA 2NBFA 2F0TA 4Z9CB 1G6ZA 3BDCA 3HOUB 1L1OB 1I4HA 4IALA 3P75A 3HOYB 4DR6L 4CKBA 4IPDA 5E7NA 5ELOA 3A7LA 2XTIA 4KHZA 3VYTA 1EY5A 3K5LA 2K5QA 1PH8A 2N78A 1CI3M 3FKIG 2OQ0A 4N9PA 4A3EB 4X3SA 2UUAQ 4JI6L 1TWFH 4JI7Q 1FGBD 4PMCA 4O0AA 3NXWA 2IX3A 2PYKA 2VQEL 1O78A 4C3JH 3S1NH 5EPKA 4GOPA 5M3FB 1WCMH 4DV6L 2K14A 5I9PA 2A74C 2RHSB 2SEBD 4BBRB 4A3KB 3D4WA 2F03A 2ZJRA 2K28A 3S15B 4A3EH 1Z9FA 3A5UA 2O5IC 1A63A 2AQ2B 2QDLA 2X6GA 2F0GA 2TSSA 2OTLA 1YNXA 1Z7TA 2PI2E 3I4OA 4BBSB 2K5HA 1VQHA 4JI1L 1X3GA 4C3HH 1YVCA 4DV5L 1VQEA 3BZKA 5LMNL 1E2WA 3S15H 5E4XA 2IX0A 3LX0A 1IKLA 2Z4IA 1S3OA 1UEAB 1IBLQ 1YNJC 1HNXL 3PUXA 1O7YA 4IURA 5FLXc 1PV4A 1EEFD 4X3UA 1STYA 4OIJA 4KD4A 3FDTA 2SNMA 4K6LA 3HOXG 3C1FA 1CKNA 3M85A 1TWGB 4A75A 3PO2H 1BDOA 2BCOA 2HQEA 5C4JB 2MGSA 1LTGD 3Q0AA 1QVCA 3U9OA 3SGIA 1M4VA 1F2LA 4JI3Q 1YJ9A 3CD6A 4B3TL 3CCSA 1BCPF 3ERSX 5BN3A 3SVMA 1IHZA 3V05A 1FVIA 2NB0A 3R93A 3NTIA 4UHVA 4GNXC 3JAML 3I3CA 3GTPH 1DONA 3VYSA 4QJFA 4ZLTF 3AMUA 2LMCB 2HCCA 2B2TA 3BJUA 5FLMG 1E3PA 5ELDA 1TWGH 4JK1C 3VYRA 1WTVA 2R92G 1F2MA 4XDXA 1KAAA 1VS0A 2L0CA 4IJHA 2ZM6L 3EIVA 2J7ZA 3NQIA 3ER0A 1MKHA 5I6YA 4JI4Q 1HXYD 1VQFA 1I94Q 1RIPA 3HEJA 2N55A 1LT6D 3RD4A 1U5KA 1YHQA 1JE4A 3TS2A 4YHHQ 4UPAA 5FOBB 1Y1WB 5C4XH 1JR0D 5ELNA 2HDMA 3C2PA 1T5XD 2K5WA 2NN6H 4OIKA 1VQMA 2F3VA 4G7HC 2EYOA 4L8JA 4OL7A 3D6CA 1TXYA 1G2TA 3VR2A 4A3GH 4R9WA 4RGMA 2GA4B 3WOFA 5KRUA 1SFOB 2EPBA 1I4RA 1KAWA 5IT9c 1IL2A 4OO1I 1T9HA 1J8IA 5J39A 2ZTCA 1BXTA 1MD2D 1QOHA 5KEEA 4FO2A 4KKUA 2HIXA 1W2BA 5BN5A 1FR3A 2M00A 1H95A 4B3RQ 3J80E 1E0BA 2VQFL 3QOLA 2WKDA 1X54A 2K1BA 3HOZH 3GTMB 3TSSA 4JI5L 4MN3A 3EQLC 4A4IA 5IODA 1JCKB 4DR4Q 1K3BC 2F0LA 1XMOL 4LW1A 2EYFA 3JAMc 4CJ1B 1C4QA 3HOVH 1ICWA 2VZAA 5HGQA 1C48A 3S9WA 3CXCA 4YY3Q 3ULLA 2D2CC 3HGBA 3H94A 1H9JA 2RDFA 1QNKA 2H1EA 2OXPA 4KN4C 3I70A 2WAQE 1OO9B 2L55A 1STGA 3PUWA 4XTCS 2WFWA 5IGFA 2A68C 2WIIB 3BVMA 1G91A 1SLJA 2EYPA 1TS4A 4L5SA 2UXDL 4WRDA 1I4GA 3PGZA 3GTQH 3OTOQ 2R61A 2JA9A 2IL8A 4ODGA 4UDUC 1YNNC 2NVTB 2PZWA 2QCPX 4KTAA 5C3EB 2NVXH 2WINB 4GOPB 4C3HG 1Q8IA 4FXDA 1TS2A 1ZEQX 1B4OA 3VR5A 2K50A 4IUUA 2XRQD 2DY7A 2VXWA 5C5LA 2JYOA 1UWVA 5CR3A 1YHBA 3C3LA 4GZYC 1N33L 2IJ0A 1Y1VG 1N8RC 5JJLA 1S5CD 1NBWA 4QIWB 4EQNA 3GTJH 4TQUS 3CC2A 1XTDA 5J1ZA 2ID0A 4RGTA 4A93B 3RZDB 5IWAL 3C46A 3X3NA 3KF8B 1QVFA 3UDIA 2E8GA 2K03A 3PO2G 3DWPA 4LF5L 2Z6BA 3CMAA 4RHSA 3X3MA 1XPOA 3M7NA 1GOZA 2DN8A 5I4DA 1TT2A 3WDNA 2F0JA 2KCMA 4KY6A 1N32L 1CZWA 1EOTA 2WB1E 3E6ZX 3SE0A 4RMFA 4Y7NH 1DOMA 4OWWB 1L0WA 4DR1L 1I50B 1TR5A 5A2QE 4DV0L 4PNYA 5ELCA 1RTNA 2JEBI 4AYBE 4C3IH 4A3IB 1EQQA 3D6WA 5G3LD 3PIO3 4DV1L 3RZDH 4FF3A 4IFDJ 1SBBB 1NE3A 1HQMC 2HD3A 1CKNB 5C5MA 4R4TA 5G3LF 1IW7D 4QL5A 3H0GH 1JMCA 1PH3A 4JV5Q 4RKLA 1HCZA 4JI2L 3M4QA 2HQLA 3CCMA 3H3VC 5C4XG 1ICFB 4K8IA 5LMUQ 1AEXA 4MNOA 4LF4Q 4N8FA 4N9TA 3NWTA 3IFTA 1SNMA 2NN6G 2KCCA 2E2HH 2JA8B 3M4OH 5FLXE 3PIOA 2E5LQ 4O1NA 5AFWA 1PYSB 1QILA 4I65A 4A3GG 1CA5A 1EOVA 3EFXD 4OX9L 5EKLA 2KEEA 2A69D 2UXCL 5DEHA 3PF5A 5EKIA 1IBMQ 3KLSX 3D4RA 1C0AA 2R93H 3M4YA 3T1YQ 1HJPA 1SYFA 1KTKA 3P1HA 2BDOA 4HAEA 4P72A 4B3SL 4HSVA 3SK5A 3AYHB 3HOZG 5M3MB 2MHVA 1IYUA 1MSHA 4OELB 1TKWB 1ET6A 3HOVG 1S5BD 2NZHA 3J7YW 1BF4A 1EU3A 1PMRA 2VL6A 1PLFA 2HDLA 1EU4A 2G9DA 2YTYA 1VQNA 4A3BB 2RDGA 3S2DH 3NSWA 3PMFA 3KDFA 3GTOB 4CHTB 4DV2Q 2YTVA 3HKZE 2IX1A 4JBJA 2PI2A 5LHY1 4X65Q 4NXMQ 3F2BA 1JJ2A 3J7A5 5M5WH 1KL9A 3BZDB 4K5VA 1HFNA 3UE0A 2FINB 2RKSA 2PPBC 2CWAA 4ZRZA 1C9OA 3D8GA 3FP9A 3MFYA 1DOLA 5AJ3Q 5M5XH 4A3FB 3MXNB 1NTGA 3MXUA 3DM1A 5M5YH 2CQOA 1F9SA 2XGTA 1Q7YC 1N36L 1XNRQ 4A3BH 1V43A 1UE5A 1FNWA 5JPNC 4X3KA 2P5ZX 5IT9E 1WVLA 2E76C 1YBYA 3OMGA 3TREA 1IYVA 1ILPA 1SYDA 4DR2Q 2SOBA 1Q86C 5IYDH 3H15A 3AQQA 2VUMB 3DWAA 1EWCA 3ZYYX 4CDDC 4DUYQ 3QR8A 1XYIA 2UUBQ 1D1IA 4JOIA 1BUVT 2E2JH 4RHRA 5J3BA 5GQOA 4BS9A 2IPKD 1XWEA 1EIGA 1QUQA 4DUZL 3F2DA 1VQCA 2UXBL 4P71A 3HFZB 2RA4A 3DWQA 2Q2UA 3MHBA 1S4ZA 2LSSA 4EQ5A 3J7AF 4UP9A 4NPSA 1II3A 5GADC 1PA6A 3J80L 3E5SA 1S40A 4IQZA 4LFCL 4LF7Q 4RKBA 4QMGA 4FYDA 2KCTA 5CV5A 4ZAIA 1VDZA 2BE5D 2YU9H 1SNPA 4C3IG 2NTTA 3RZOB 4JI0L 1B8AA 4DR6Q 4A3CH 1QG7A 4FXGC 1EYDA 2LS01 1N9WA 2ZXPA 4LF8L 1EY0A 1GKHA 4GKJQ 3S1MH 4HR7B 4C2MB 1BNZA 3RN2A 4POFA 1P8LA 4JI6Q 3GTLB 3H0GG 3ITPA 4RG1A 1JWMD 1Q90A 2MUYA 3CC7A 3J7AV 5ELBA 1TWHH 1K83B 2RCNA 3TRZA 2VQEQ 2F0NA 1ESRA 1KC8C 1DXMA 3DEPA 4JOIC 1HQRD 1WJJA 1XXGA 1K9MC 3DLLA 1V1OA 3HOWB 2PQAB 1HHVA 5C44H 1DZ1A 4XT3B 1ENFA 3UDGA 1JORA 4HTHA 1S5FD 1HRJA 4C2MH 5I2XA 3EVQA 4CDEC 1TWAB 1NR4A 1FD7D 2O4XA 3R2IA 2CH4A 1KLUD 1LLRD 4BY1B 4K6DA 3I8ZA 3OIPA 4TKOB 2ZTEA 2Y0SG 2JA6H 2A68D 2R93G 1IYJB 1F9RA 4HJ5A 2K04A 4JI1Q 3AU7A 2L11A 3VR3A 1LT5D 1U0LA 4DV5Q 1SE3A 1WYDA 3MZ5A 5H1SE 4XT1B 5LMNQ 3K59A 1XMQL 5CYUA 3EN2A 3ND8A 3A54A 2F3WA 2NVYH 3W1GA 5IYCH 2UU9L 1H9MA 3SR1A 1HNXQ 3Q8DA 4P74A 3CRLC 4RCOA 3D4DA 2VW9A 1D5MC 3VDYA 2EJFC 4K5XA 4CKCA 4DGZA 2K32A 4CDCC 2MQHA 4K14A 1OXSC 3PUVA 1AE3A 4ZYSA 1VQKA 2JA7B 1ML0D 4NW2A 5A2QL 1PH4A 5CBAE 1FGUA 2NN6I 1JE5A 4DNRB 3I2ZA 4A3JH 4B3TQ 1A0IA 1CFMA 2PZTA 1KDCA 1IL8A 2RCFA 5EQ0A 3HRZC 4UAIA 4X66L 1Y8OB 2VB2X 4R8IA 1J5EL 1RTOA 2NTSA 4ZCKA 4PZ8A 3TS0A 4OEMB 5C3XA 2JK8A 1RKNA 3KDFB 2NUCA 1HA5A 1EIFA 3M7GA 4POGA 4GLXA 2ES2A 1VCIA 1WTOA 1MSGA 3H6MA 3S1RH 4P75A 5IYDG 1BBWA 1SYCA 3G7LA 1IW7C 1NAPA 4WJ3M 4DNTB 5FLXL 3RLNA 3SXHA 2ATWA 4MIUA 3GV3A 5JVH3 1ET9A 1NUCA 2XSCA 1TWCB 4OONA 2I5LX 3CAMA 3NTHA 4JCVE 2KJXA 1EFWA 2LY7A 3FHWA 3RR5A 2Q8IB 1I4PA 5DAUA 2X6LA 3T1HL 2PO4A 4JBWA 2XN9C 1Y69U 2GVAA 4IJLA 1LT4D 2FXQA 4R8NA 4IUQA 1PTOB 1DM0B 3A8KE 1VMPA 4JI8L 3HOUH 5GAEC 4J8QA 4AQYL 3HOYH 4ME5A 3SDZA 3OWEB 1SROA 3RLFA 2A69C 3D0FA 2JEAI 1TWCH 3K8AA 2I0QA 2AHOB 4DN4M 1MIUA 4L5RC 2YYZA 4K0KL 4A3CG 4R1JA 1QUQB 1LTID 5IY0A 2Z8LA 1KIXA 1CSQA 1QB5D 2VQFQ 3MWYW 4K8JA 1ASZA 4GNXA 1PTOH 4OWTB 5ELFA 5M3FH 4JI5Q 2DJGC 4NKLA 1G51A 1CQFA 2E74C 2L5TA 3S2HB 4BBRH 4A3KH 3NHHA 1QZHA 1M1KC 3Q24A 5COYA 2KUMA 3H91A 5ISRA 4A3MG 4PMBA 5C44G 3M3YB 2G9HD 4A3LH 3S17B 4FXKC 4RCNA 2B8FA 2SDFA 3IRBA 3E3XA 2F0VA 1UAPA 1AW7A 1X55A 4DA2A 1SNDA 2R7DA 4GKKL 1VQIA 5IP9G 1VQ6A 2M2LA 4BBSH 4HJ8A 2EDGA 2C5CA 4IPCA 4ZKBB 1SEBD 2BA0A 2CHBD 2UXDQ 5IT9L 1GM5A 4JYAQ 3T4AC 2JA6G 1HA6A 5ELEA 1BCPD 3U4VA 3QG1A 2R7FA 5I9OA 2YV5A 3JAMi 2KCNA 1HNWL 1XTCD 3BYTB 1I5FA 4A3DB 3QIAA 1KABA 4GN3B 1TQOA 5FJ8H 5IYCG 1B2TA 3TZUA 4ULLA 3ICEA 1N33Q 2EY5A 4H13C 3TP6A 2VNUD 2WACA 4GLAC 2RF4A 3I4NB 4JVZA 2FFKB 1RODA 2ZXRA 2I46A 4R4OA 4QQBX 1HR0L 1WTHA 5C4JH 2F0UA 3NENA 3K7AB 4IN3A 3WWVA 1ENCA 3PO3B 3MC0B 1STNA 4X64Q 1Q3LA 5EJWA 3A8JE 3QJYA 4KKSA 1KDBA 3STBD 3I4MB 2F0KA 5IGGA 4CGYB 3D3RA 1EZ6A 4S3SA 2UUCL 4A3JG 4M1UB 3G6EA 1DJRD 2WAQB 1DGSA 3LGJA 4WJWA 4DR1Q 4BY7B 3A74A 1RHPA 4YWLA 2SNSA 4DV0Q 4K5WA 2BE5C 4DV1Q 2AUJD 3W2DA 3A7AB 3GQBA 3K7AH 2XWBB 2DNCA 1CKMA 1M8AA 2QKIC 1PYWD 4DAPA 3ZJYC 1E2ZA 5IYBH 1NJIC 2UUAL 4KJOA 1Y1WH 2JA5B 2IHEA 5D65A 4F7XA 2B29A 1UE1A 2A5HA 1HH2P 4JI2Q 3EJIA 4KV6A 2GVBA 2N88A 3NP8A 2PW7A 3V96A 4IUVA 1E22A 2RVLA 4HJ9A 4DR3L 1DD2A 5KNCA 1I6HB 1SMYD 4WFN3 3NPPA 2D0PA 4LK1C 4IFDH 1SFOH 3E0JA 4C3JG 2F0EA 4KHVA 1WCMG 4GN4B 5GAGC 1JOQA 3HOUG 4QF4A 2JA5H 4RGNA 3HOYG 4OX9Q 1K0SA 1PZKD 2UXCQ 2R6GA 3SK4A 2AWNA 3SK6A 2V1CC 3KLRA 3PQIA 4H02A 5A35A 4A3EG 2Q2HA 1YEZA 4LFBL 1EL0A 3GTMH 1G291 2WB1B 3KOJA 3EA6A 1HTPA 1KXLA 3CCEA 1LTBD 2I5MX 3I73A 5M3FG 3MEHA 3GTKB 4QUFA 2LXKA 4AYBB 3VR4A 2R7ZB 1X3EA 5JAVA 2WP8J 4BBRG 4A3KG 3CCUA 1VMCA 2EY6A 4LWCA 1B70B 2AQ3B 5LMNW 1WD0A 3MVVA 2EIFA 1MBYA 1STEA 1VQGA 1IZ6A 4BXXH 4CJ0B 3S24A 2RSOA 1VQAA 5J22A 5JJKA 3F1ZA 2LKVA 4HSPA 2D5DA 2EXZA 3FPUB 1CK1A 5CV9A 3J81j 3J81L 1SN8A 1LABA 2KQ3A 2NVTH 5C3EH 4BBSG 4IUPA 3G71A 2QW7A 4GNXB 4DPGA 1YJWA 4JI3L 1KD1C 4V190 1EIHA 3TMEA 2CKZB 3K6OA 1ZYRD 1AH9A 1LTAD 1JB3A 3NQTA 3GD7A 2F0IA 2ICIA 5HY6A 4RFBA 4ABNA 1N36Q 1XNQL 2MO0A 5DM63 1X32A 1WFQA 4FF2A 4FF4A 3MFGA 1U4RA 2B63B 4HCEA 1YI2A 1AP0A 2BOSA 1SNQA 5C0XH 3UDXA 4LF9L 2TMPA 1HUMA 1SR3A 2V4DA 3E9HA 3U9SA 1KLGD 5FJ8G 5DM73 2F0QA 2WKCA 3L9AX 5CV7A 4JI4L 4A93H 2KVMA 4LMQD 3FRPB 2BDNA 2CFMA 2KOLA 2O2LD 3T13A 4YHHL 2EYLA 1X3QA 2FJ2A 2F52A 3GTGB 4DUZQ 1D6EC 3N52A 2B39A 1ASYA 5CV8A 4YIJA 1S72A 2NVQB 3TDQA 3OW2A 1AZQA 4X6AH 2FMCA 1I50H 2ENBA 1Q46A 1KHIA 1LUZA 4A3IH 4HJAA 3HKZB 3S16B 4LUZA 4DR7L 3NBIA 3CPWA 1ONLA 1QWYA 1X56A 3U4ZA 2H5XA 5BR8Q 4BA2I 1GJXA 1T5EA 2PNHA 3A56A 4IUTA 2K05A 2ZXOA 3CCRA 2K33A 4JI0Q 2L12A 3VYUA 1A3UA 3CP0A 2F4VL 3J81c 4LF8Q 5KYIA 4CBVA 4DKAC 3NBHA 5IYBG 1HNZQ 1Y1WG 4DV7Q 4NXNQ 1OXTA 1DYQA 3I7FA 3S16H 3G6JB 3M4PA 1AFPA 1Y14B 3G4SA 4QGUA 1W6KA 2KECA 3ULJA 3VA5A 5DLQE 2NZOA 2JA8H 4K2KA 4LUOA 5F2DA 1PYBA 5IOCA 3NEMA 3OWFA 1U4MA 1R4PB 3DEOA 4A76A 5JVG3 4QCLA 2Z9HA 1L2FA 4IFDG 1OTCA 1VQBA 1FYCA 4KN7C 3NELA 3SEBA 2HIVA 4KJNA 1N34Q 2VB3X 1IKMA 4DV4L 5C0XJ 4DK1A 5KNDA 4HJ7A 4KMUC 4B3MQ 1EYCA 2PMZE 1NR2A 4N8X1 3ONAB 2Z0SA 1E2VA 1ZXTA 5M3MH 1BCPC 2RQXA 2D9UA 3PCOB 1A2UA 1ENAA 4JG2A 4RWSC 4IOAA 4CJ2C 5JEAJ 1PRTD 3BDLA 4TVAB 2Y0SE 1VQJA 3W5OA 1XMQQ 4B9WA 1V8QA 4XXEA 2UU9Q 5KIXA 1EY8A 1U4PA 2KHIA 3GTOH 1RCVD 1PRTF 1R9TB 2CCZA 2K5VA 1HPCA 3GV6A 5IGBA 4O2DA 1E1OA 1EWIA 3BVGA 3TZDA 1A3VA 4BXXG 1B1ZA 5IP7H 1I3QB 2D0OA 5E1FA 4DV3L 1STHA 1UUPA 3K5OA 1H9RA 4IZ8A 1HTLD 1B7YB 3FKIB 3CMEA 4A3FH 1NMFA 4DXGA 4ZQ3A 5C3EG 1I4XA 3STBC 4ZUIA 1WTQA 1KDAA 1IBKL 4KHPL 3J80i 3NE5B 4OWXB 1W6JA 3L2PA 2DY8A 2NWGA 1Y8PB 2K52A 1E1TA 1LV9A 1VQPA 3HZXA 1KQSA 1EQRA 1J5EQ 1AN8A 1CUKA 1WI5A 4Q0FA 3BU2A 3F8TA 1OXUA 2VUMH 3EBEA 3IL8A 3OHXC 3FKIH 1OXXK 1JOKA 1D8LA 3I56A 4F8MA 5EGTA 4A93G 3IFDA 3K0XA 1BVSA 4JV5L 4PG3A 3UI2A 1HZAA 3BG3A 4M8AA 3HKSA 3QWNA 2XVSA 5LMUL 2OQKA 1VF5C 1NY4A 5EAYA 2XRSD 1SMYC 2MFIA 1MGSA 2Q2IA 5NUCA 4TRDA 1VQ7A 2E5LL 2XNAC 1EYGA 3NK9A 3BYYB 5BN4A 2K7VA 4DV6Q 4A3IG 3RZOH 2EVBA 1SMXA 3R8BA 1D5ZC 4HN7A 2EJMA 4BA1I 3I90A 1PVOA 4HIKA 2BH8A 2OCEA 3K57A 1EY6A 2IW3A 2EE1A 2AMCB 2B2YC 1B44D 4NB3A 2QA4A 3GTLH 3T1YL 3K0YA 2K01A 2KHSA 2F1MA 3HOXB 3OYYA 3TP7A 1K83H 2PNRC 2YTXA 4JPBW 4LJZC 3FEWX 2BH2A 2ZJQA 4LNQA 1SSOA 1JOOA 3CCVA 2E2IB 3HOWH 2F0FA 1GXDC 4HEDA 4C56C 5CV4A 2JSOA 2K4KA 3DXJC 2JA8G 3KFUA 3CCLA 1UEBA 3UE1A 2N49A 1A8VA 3RNUA 1BCPB 3CU7A 3TBIB 1VQLA 1TWAH 3P20A 4QB4A 5C6AA 4X62L 4BY1H 3TP5A 1D5XC 4CKEA 3SK8A 1K3RA 2R92B 3NBHB 1MI2A 1TVXA 4GKKQ 4OHJA 1GUNA 4KI0A 3FMCA 4ID6A 1ZYRC 2A73B 2X69A 3BDOA 4O42A 5M3MG 4L5QA 2K6AA 1PZJD 1FNUA 2A6HD 3NWSA 2FMMA 2JE6I 3OW7A 3CHBD 1EY4A 4PV1C 2MPMA 3Q23A 3CC4A 4LF6L 4ILWA 5EBCA 4XYQA 4DAYA 2WV6D 3Q6SA 2J0TD 4A3BG 1LO5D 2Q8TA 2F0MA 3J81E 4QUCA 4AH6A 1FJGL 1QCBD 4KY7A 4LFAL 2JA7H 2OEOA 3R2TA 4DF7A 1JWUD 1EYAA 1KNAA 1HR0Q 2O5JC 1LYLA 4J15A 2RSNA 3RUZA 5IP7G 1K8OA 5I2YA 2ZM6Q 4E6IA 1UNSA 1QE6A 3W3AA 4KLKA 2HCIA 1V9PA 4V0BA 4UY8C 4A3FG 1Q12A 4IO9A 2F0WA 1TWFB 4IFDI 4DR5L 2MO1A 5E4WC 3I4LA 4LF7L 4FP5D 3LWEA 4IPHA 5IGCA 3S1NB 1O7LA 4JBMA 5CC4A 2QEXA 3QOJA 4GN5A 2I07B 2CH4W 2VUMG 4OGQC 1B50A 2DUDA 4IUNA 3S14B 4GKJL 1X3PA 3MTSA 3HS0C 1JQYD 3W1BA 4PQXA 1WOCA 3KLWA 4I7ZC 5I6WA 1PH9A 1EQVA 2F4IA 1VQ5A 3K81C 2PW5A 3PV0A 1SJED 1WTPA 1LM0A 1WD1A 4DR3Q 4C3HB 4R4QA 2B3GA 1XMOQ 3U58A 3S14H 4RGOS 2HHHL 3DHQA 1K8AC 2KHJA 1TIID 2B2UC 4EGVA 1Y1VB 3K80C 2A8VA 3HP3A 5CMDA 1SNOA 1DCZA 1GUSA 4FDBA 4LFBQ 3KF8A 1S5DD 5K5PA 2QF7A 4MZ9A 3CW2C 2CVRA 1GHJA 1QNUA 4G4KA 1NMGA 2AUKA 2FHTA 2F0DA 4XQQA 3S2HH 5FO9B 4PZ7A 1QVGA 3PO2B 4HCSA 5C0XI 1PRTC 2HT1A 4FF1A 2CQAA 2JXMB 3I72A 3HOWG 3M3YH 3H09A 1Y1VH 5IGDA 4YWKA 3S17H 4DAVA 3FPPA 1O7IA 2B2VA 3I55A 4J1MA 4ME3A 4GOPC 5IE8A 1DOKA 3GTPB 1UE6A 1XJVA 3PF4A 3I91A 1WTRA 2EY2A 4BY1G 3E0EA 2A6ED 4G57A 1IXRA 1EY9A 5TSSA 1EY7A 2B2WA 1LTLA 2MNAA 1E7ZA 5IWAQ 3VR6A 1JWSD 2NZ1D 4HIDA 1GVPA 4AIMA 4JBKA 3RN5A 4A3DH 2M9VA 4H44C 5EPLA 2Q2TA 4LF5Q 1B3QA 5C4XB 1XNQQ 2KA7A 4R4IA 4DXFA 1WTWA 3AEVA 3L3OC 3QB3A 2Z4HA 1N32Q 2E2DC 2QILA 4C1NK 1Y8NB 4LF9Q 3I4NH 1WTXA 1K73C 2XWJB 1EUJA 2F3IA 4RA8A 1JC7A 3S1QB 5C4HA 3TP8A 4A3GB 5JJZA 2JA7G 3PO3H 3A0JA 4YCUA 1B9NA 4DK3C 2B2VC 2F0OA 4OXPA 3I4MH 1EEID 2Z6KA 1QJOA 1LT3D 1JICA 4JI7L 1PH2A 3A8IE 4B08A 2KBNA 2VS1A 3LNNA 1F2ZA 3CKIB 1RL2A 3N6RA 1PHJA 5FKAC 3HOZB 1SAPA 2Z1CA 4BY7H 4TSSA 4DAYB 3S1QH 2B2WC 1GUWA 1SDFA 1BKBA 3HOVB 4DR7Q 1LTTD 2EOTA 4F87A 3L0OA 1L0XB 3OIQA 3K58A 5IIFA 1XX8A 1KRTA 2F4VQ 4GLVB 5K36H 4ZUJA 4IPGA 2B2TC 3TQYA 1PTOD 1A2TA 4FNFA 3KLSA 3DM3A 1ZKOA 3BS1A 3MXNA 2DNEA 3NTKA 1I6HH 3GTQB 5LL6X 1PTOF 2AKWB 4B3SQ 3QO2A 1C7YA 4Y52H 1SJHD 2NVXB 1A6XA 3AFPA 4P2CB 4YWMA 3OOCA 3GP7A 1IBLL 3PSIA 5D14A 3TEHB 2Z6KC 1B9MA 2RDHA 1EZ8A 4L6TB 2F0PA 5CORA 1PFNA 3D31A 1PXUA 1CKOA 1PRTB 1UE7A 1BO0A 4DK0A 3J81i 1G6PA 2I5HA 4DV4Q 2K75A 4A3LG 3VA7A 4JYAL 1X3FA 2D62A 3GTJB 4XIGS 1G2SA 1A3TA 3JC66 4FVMA 1VQ9A 1GO3E 1LACA 3CPFA 5HURA 2F0SA 1H9SA 3NUCA 3OPOA 3KJOA 1MJCA 3GTKH 4HMIA 3K5MA 2A6HC 2R7ZH 3O13A 1PH6A 2OF1A 3RMHA 1SYEA 4X3TA 3V2TA 1YJNA 3CCJA 1PFBA 1BQQT 3GDEA 1SE2A 2F0HA 1STAA 2N8NA 1CHPD 1W3SA 4Y7NB 2K5DA 4KKTA 1PFMA 3MA2B 1LTSD 1PH7A 4C3IB 2CW0C 3A55A 3TN2A 5KYLA 2EYJA 4QY7A 2J4XA 4DV3Q 1VQOA 1I94L 4X64L 5CV6A 5JEAH 3GO5A 1HR0W 3T51B 1GUOA 5E3FA 3H0GB 1IBKQ 4KHPQ 2LXJA 3U50C 5FO8B 3H3VI 2UXBQ 4XQJA 2B63H 3F2CA 2ICEC 4A3DG 3PUZA 4PZ6A 4U673 1U9RA 1K0RA 2PQAA 4YCVA 1PH5A 3E9IA 1Z47A 1CHQD 4HMJA 1YIJA 2K5NA 2C35B 1LTRD 1PDQA 3T56B 4WJ4A 3J7ZC 4LFCQ 3IKJA 2E2HB 2PMZB 2EYMA 3I4NG 1O80A 1SXTA 3PIP3 2IT1A 3M4OB 1HZBA 1EWHA 2EQSA 3URYA 1M90C 3GTGH 1RD9D 4P73A 3PO3G 2DJFC 4XQNA 5CBEE 5DNFA 4B3RL 4EQOA 4F88A 2OT2A 2Y0SB 4QIWE 2NVQH 2EYHA 1TS5A 3I4MG 2R93B 1YHAA 4KD3A 5GAHC 4APVA 1TY0A 4DR4L 1R4QB 5T1IA 2WAQG 1Q81C 4C1NI 3BZCA 4BY7G 3HG9A 1B3AA 1V1PA 4YY3L 5D3DA 3PIPA 1TS3A 1F9QA 1Q1BA 3KF6A 2QEJC 2ASBA 2OTJA 3M9BA 3MXGA 2JJQA 1A62A 2H4OA 1HUNA 1Z6HA 4EQPA 3S2DB 2JA5G 1VF7A 5K36G 2N3SA 2L9HA 1OXVA 4OO1H 1J6QA 1X6OA 4MTKA 3OTOL 1JJCB 5M5WB 1J9OA 3LWUA 1CM9A 1GUTA 1Q1EA 4J6HA 1KNEA 4H7BA 3WOEA 1EIYB 2IHFA 5EKKA 4DU9A 1FNVA 2L4NA 5M5XB 1RJTA 3SHLA 3CCQA 3A5ZB 4YCWA 1D7QA 5M5YB 1YNJD 5T1GA 4GS3A 1F2YA 1GD7A 1U4LA 4X62Q 4IOCA 3KYHC 3AB9A 1EFID 2A6EC 1EQTA 1CA6A 3MEFA 3MAQA 2IY5B 1L1OA 1VQ8A 4UP8A 5FO7B 3IAYA 1CTMA 4WORA 2WB1G 1CQVA 2E2JB 1K28A 3B6YA 4LAAA 5D3IB 3Q22A 1A15A 4AYBG 4MTNA 3KBGA 2R7ZG 4DK6C 5JPMC 2MP1A 1PH1A 2R3ZA 1KRSA 4NMZA 4LF6Q 1R9TH 2QDBA 4RH6A 2B2YA 2L15A 4X66Q 5L37A 1PFSA 3ULPA 4G7OC 3DUZA 1RF2D 3CF5A 1V1QA 1I3QH 2EXDA 4MHEA 5C0XG 1TY2A 3BVZA 1FJGQ 1Q82C 1JJGA 4LFAQ 4L5TA 2YU9B 1K8MA 1SYGA 1GUGA 2AWOA
chains in the Genus database with same CATH topology
1H9SB 3JAME 3OMCA 3S1MB 3ND9A 5JEAG 5C3WA 1STBA 1GHKA 2C9OA 4ZKCB 4NP5A 1TWHB 2NYZD 1AZPA 4Q5VA 1F9PA 5CGKA 4H0LC 4A3MB 5C44B 3CRKC 1I6VC 3EROA 3MXPA 4B9XA 5LL6S 2Q8RE 1S5ED 5EPJA 3R3OA 1PTOC 3FVQA 5JOBA 3KUPA 1NCVA 1RDPD 4BWGB 2IWHA 1BR9A 4KY5A 1SYBA 2JA6B 3OSOA 4L63B 1BBXC 1TU2B 3T53B 1O7ZA 2LFNA 3DMUA 2RBMA 2EY1A 4U68A 2E75C 5EBDA 1CZGA 3KK7A 1B53A 2AQ1B 1F77A 2NVYB 2L1BA 3PUYA 5KGUA 3CQZB 4XYOA 5HGTA 2EZVA 3T16A 1ESFA 5IGEA 1NSNS 5KNBA 1SNCA 2HUGA 4OO1G 2MJ8A 4NDXA 1G8ZD 1BOSA 1CT1D 5FK9C 1PZID 1YNND 3P7JA 2KEDA 2ZT9C 2BA1A 2JP1A 1V1PB 3K5NA 4A3JB 3C1EA 1SE4A 1HFGA 1I4QA 1D1KA 4PMWA 2EJGC 1H9KA 2B8GA 4K2LA 4ZK9B 3L7ZC 4DFAA 1L0YB 2XIWA 1C8CA 2CW0D 3S1RB 4KK7A 1ILQA 1D2BA 3KBXA 4G7ZC 3F2UA 4EVOA 3ERQA 2B2UA 4RAUC 2PQEA 5C4ZA 5M9OA 4C3JB 2PCFB 1WCMB 2PZUA 4Z9CB 2NBFA 2F0TA 1G6ZA 3BDCA 3HOUB 1I4HA 4IALA 3P75A 3HOYB 4CKBA 3A7LA 4KHZA 3VYTA 1EY5A 3K5LA 2K5QA 1CI3M 4N9PA 4A3EB 4X3SA 1FGBD 4PMCA 3NXWA 2IX3A 2PYKA 1O78A 5EPKA 5M3FB 5I9PA 2A74C 2SEBD 4BBRB 4A3KB 3D4WA 2F03A 2K28A 3S15B 2O5IC 2AQ2B 2X6GA 2F0GA 2TSSA 1Z7TA 4BBSB 1E2WA 5E4XA 2IX0A 3LX0A 1IKLA 2Z4IA 1UEAB 1YNJC 3PUXA 1O7YA 4IURA 1EEFD 4X3UA 1STYA 4OIJA 4KD4A 3FDTA 2SNMA 4K6LA 3C1FA 3M85A 1TWGB 1BDOA 2BCOA 2HQEA 5C4JB 2MGSA 1LTGD 3Q0AA 3U9OA 1M4VA 1F2LA 1BCPF 5BN3A 3SVMA 1IHZA 3V05A 2NB0A 3R93A 3NTIA 3JAML 3I3CA 1DONA 3VYSA 4ZLTF 3AMUA 2LMCB 2HCCA 2B2TA 5ELDA 4JK1C 3VYRA 1WTVA 1F2MA 4XDXA 1KAAA 2L0CA 2J7ZA 3NQIA 5I6YA 1HXYD 3HEJA 2N55A 1LT6D 3RD4A 1JE4A 5FOBB 1Y1WB 1JR0D 2HDMA 3C2PA 1T5XD 2K5WA 2NN6H 4OIKA 2F3VA 4G7HC 2EYOA 4L8JA 4OL7A 3D6CA 1G2TA 3VR2A 4R9WA 4RGMA 2GA4B 3WOFA 5KRUA 1SFOB 2EPBA 1I4RA 4OO1I 1J8IA 5J39A 1BXTA 1MD2D 1QOHA 5KEEA 4FO2A 4KKUA 5BN5A 1FR3A 2M00A 3J80E 1E0BA 3QOLA 2WKDA 2K1BA 3GTMB 3TSSA 4MN3A 3EQLC 5IODA 1JCKB 2F0LA 2EYFA 4CJ1B 1C4QA 1ICWA 1C48A 3S9WA 2D2CC 3HGBA 3H94A 1H9JA 2RDFA 1QNKA 2H1EA 2OXPA 4KN4C 3I70A 1OO9B 2L55A 1STGA 3PUWA 4XTCS 5IGFA 2A68C 2WIIB 3BVMA 1G91A 2EYPA 1TS4A 4WRDA 1I4GA 2R61A 2IL8A 4ODGA 4UDUC 1YNNC 2NVTB 2PZWA 2QCPX 4KTAA 5C3EB 2WINB 4C3HG 1Q8IA 4FXDA 1TS2A 1ZEQX 1B4OA 3VR5A 4IUUA 2XRQD 2DY7A 2VXWA 5C5LA 2JYOA 5CR3A 3C3LA 4GZYC 2IJ0A 1S5CD 4QIWB 4EQNA 4TQUS 5J1ZA 2ID0A 4RGTA 4A93B 3RZDB 3C46A 3X3NA 2K03A 3DWPA 4RHSA 3X3MA 3M7NA 1GOZA 2DN8A 5I4DA 1TT2A 3WDNA 2F0JA 4KY6A 1CZWA 1EOTA 3E6ZX 3SE0A 1DOMA 1I50B 1TR5A 5A2QE 4PNYA 5ELCA 1RTNA 2JEBI 4A3IB 3D6WA 5G3LD 3PIO3 4FF3A 4IFDJ 1SBBB 1HQMC 5C5MA 5G3LF 1IW7D 4RKLA 1HCZA 3H3VC 4K8IA 1AEXA 4N9TA 3NWTA 3IFTA 1SNMA 2NN6G 2KCCA 2JA8B 5FLXE 4O1NA 5AFWA 1QILA 4I65A 1CA5A 3EFXD 5EKLA 2KEEA 2A69D 5DEHA 5EKIA 3KLSX 3D4RA 3M4YA 1SYFA 1KTKA 3P1HA 2BDOA 4HAEA 4HSVA 3SK5A 5M3MB 2MHVA 1IYUA 1MSHA 1TKWB 1ET6A 1S5BD 3J7YW 1BF4A 1EU3A 1PMRA 1PLFA 2HDLA 1EU4A 2G9DA 4A3BB 2RDGA 3NSWA 3PMFA 3GTOB 4CHTB 2IX1A 5LHY1 3BZDB 4K5VA 1HFNA 2FINB 2RKSA 2PPBC 4ZRZA 3D8GA 3MFYA 1DOLA 4A3FB 3MXUA 3DM1A 1F9SA 1V43A 1FNWA 5JPNC 4X3KA 5IT9E 1WVLA 2E76C 3OMGA 1IYVA 1ILPA 1SYDA 2SOBA 2VUMB 3DWAA 1EWCA 3ZYYX 1XYIA 1D1IA 1BUVT 4RHRA 4BS9A 2IPKD 1XWEA 1EIGA 2RA4A 3DWQA 3MHBA 1S4ZA 3J7AF 1II3A 3J80L 3E5SA 4IQZA 4RKBA 4QMGA 4FYDA 5CV5A 4ZAIA 1VDZA 2BE5D 1SNPA 4C3IG 2NTTA 3RZOB 1QG7A 4FXGC 1EYDA 2LS01 2ZXPA 1EY0A 4HR7B 4C2MB 1BNZA 3GTLB 3ITPA 1JWMD 1Q90A 2MUYA 3J7AV 5ELBA 1K83B 2F0NA 1ESRA 1DXMA 3DEPA 1HQRD 1XXGA 1V1OA 3HOWB 1HHVA 1DZ1A 4XT3B 1ENFA 1JORA 4HTHA 1S5FD 1HRJA 5I2XA 3EVQA 1TWAB 1NR4A 1FD7D 2O4XA 3R2IA 1KLUD 1LLRD 4BY1B 4K6DA 3I8ZA 3OIPA 4TKOB 2A68D 1F9RA 2K04A 2L11A 3AU7A 3VR3A 1LT5D 1SE3A 3MZ5A 4XT1B 3K59A 5CYUA 3ND8A 3A54A 2F3WA 1H9MA 3SR1A 3CRLC 4RCOA 3D4DA 1D5MC 2EJFC 4K5XA 4CKCA 4DGZA 2K32A 4K14A 1OXSC 3PUVA 4ZYSA 2JA7B 1ML0D 4NW2A 5A2QL 5CBAE 2NN6I 4DNRB 1CFMA 2PZTA 1KDCA 1IL8A 5EQ0A 3HRZC 4UAIA 1Y8OB 2VB2X 4R8IA 1RTOA 2NTSA 5C3XA 1RKNA 2NUCA 1HA5A 3M7GA 1VCIA 1WTOA 1MSGA 3H6MA 1SYCA 3G7LA 1IW7C 1NAPA 4DNTB 5FLXL 3SXHA 4MIUA 3GV3A 5JVH3 1ET9A 1NUCA 2XSCA 1TWCB 3NTHA 2KJXA 2LY7A 2Q8IB 1I4PA 5DAUA 2X6LA 2PO4A 4JBWA 2XN9C 1Y69U 1LT4D 4R8NA 4IUQA 1PTOB 1DM0B 3A8KE 1VMPA 4J8QA 4ME5A 3SDZA 3OWEB 3RLFA 2A69C 2JEAI 4DN4M 2YYZA 1LTID 2Z8LA 1QB5D 3MWYW 4K8JA 1PTOH 5ELFA 4NKLA 1CQFA 2E74C 2L5TA 3S2HB 3NHHA 3Q24A 5COYA 2KUMA 3H91A 5ISRA 4PMBA 3M3YB 2G9HD 3S17B 4FXKC 4RCNA 2B8FA 2SDFA 2F0VA 1UAPA 1AW7A 4DA2A 1SNDA 2M2LA 2EDGA 2C5CA 4ZKBB 1SEBD 2BA0A 2CHBD 5IT9L 3T4AC 1HA6A 5ELEA 1BCPD 3QG1A 5I9OA 2KCNA 1XTCD 3BYTB 4A3DB 3QIAA 1KABA 1TQOA 1B2TA 3TZUA 4ULLA 2EY5A 4H13C 3TP6A 2VNUD 2WACA 3I4NB 2FFKB 1RODA 2ZXRA 2I46A 2F0UA 3K7AB 4IN3A 3PO3B 1ENCA 3MC0B 1STNA 1Q3LA 5EJWA 3A8JE 3QJYA 4KKSA 1KDBA 3I4MB 2F0KA 5IGGA 4CGYB 3D3RA 1EZ6A 4S3SA 4M1UB 1DJRD 2AWOA 2WAQB 4WJWA 4BY7B 1RHPA 2SNSA 4K5WA 2BE5C 2AUJD 3W2DA 3A7AB 3GQBA 2XWBB 2DNCA 1M8AA 2QKIC 1PYWD 4DAPA 1E2ZA 4KJOA 2JA5B 5D65A 4F7XA 2A5HA 3EJIA 4KV6A 2N88A 3NP8A 2PW7A 3V96A 4IUVA 2RVLA 1DD2A 5KNCA 1I6HB 1SMYD 4WFN3 3NPPA 4LK1C 4IFDH 3E0JA 4C3JG 2F0EA 4KHVA 1JOQA 4QF4A 4RGNA 1PZKD 2R6GA 3SK4A 2AWNA 3SK6A 3KLRA 5A35A 1EL0A 1G291 2WB1B 3EA6A 1HTPA 1LTBD 3I73A 3MEHA 3GTKB 4QUFA 4AYBB 3VR4A 2R7ZB 5JAVA 2WP8J 1VMCA 2EY6A 2AQ3B 1WD0A 3MVVA 1MBYA 1STEA 4CJ0B 2RSOA 5J22A 2LKVA 4HSPA 2D5DA 2EXZA 3FPUB 1CK1A 5CV9A 3J81L 1LABA 2KQ3A 4IUPA 4V190 1EIHA 3TMEA 3K6OA 1ZYRD 1LTAD 1JB3A 3NQTA 3GD7A 2F0IA 2ICIA 4RFBA 4ABNA 5DM63 1X32A 4FF2A 4FF4A 3MFGA 1U4RA 2B63B 4HCEA 1AP0A 2BOSA 1SNQA 5C0XH 2TMPA 1HUMA 2V4DA 3U9SA 1KLGD 5DM73 2F0QA 2WKCA 3L9AX 5CV7A 2KVMA 4LMQD 3FRPB 2BDNA 2KOLA 2O2LD 3T13A 2EYLA 1X3QA 2FJ2A 3GTGB 1D6EC 3N52A 2B39A 5CV8A 4YIJA 2NVQB 3TDQA 1AZQA 2FMCA 2ENBA 3HKZB 3S16B 3NBIA 1ONLA 1QWYA 4BA2I 1GJXA 1T5EA 4IUTA 3A56A 2K05A 2ZXOA 2K33A 2L12A 3VYUA 1A3UA 5KYIA 4CBVA 3NBHA 1OXTA 1DYQA 3G6JB 1AFPA 1W6KA 2KECA 3VA5A 4K2KA 5IOCA 5F2DA 3OWFA 1U4MA 1R4PB 3DEOA 5JVG3 4QCLA 4IFDG 1FYCA 4KN7C 3SEBA 2VB3X 1IKMA 5C0XJ 4DK1A 5KNDA 4KMUC 1EYCA 1NR2A 3ONAB 1E2VA 1ZXTA 1BCPC 2RQXA 2D9UA 1A2UA 1ENAA 4RWSC 4CJ2C 5JEAJ 1PRTD 3BDLA 4B9WA 1V8QA 4XXEA 5KIXA 1EY8A 1U4PA 1RCVD 1PRTF 1R9TB 1HPCA 3GV6A 5IGBA 3BVGA 3TZDA 1A3VA 1B1ZA 1I3QB 5E1FA 1STHA 1UUPA 3K5OA 1H9RA 4IZ8A 1HTLD 3FKIB 4DXGA 4ZQ3A 1I4XA 4ZUIA 1WTQA 1KDAA 3NE5B 1W6JA 2DY8A 2NWGA 1Y8PB 1LV9A 3HZXA 1AN8A 4Q0FA 1OXUA 3IL8A 3OHXC 1OXXK 1JOKA 4F8MA 5EGTA 3IFDA 3UI2A 3BG3A 4M8AA 3QWNA 2XVSA 1VF5C 2XRSD 1SMYC 1MGSA 5NUCA 4TRDA 2XNAC 3NK9A 3BYYB 5BN4A 2K7VA 2EVBA 3R8BA 1D5ZC 4HN7A 2EJMA 4BA1I 3I90A 3K57A 1EY6A 2IW3A 2EE1A 2B2YC 1B44D 3K0YA 2K01A 2KHSA 2F1MA 3HOXB 3TP7A 2PNRC 4LJZC 3FEWX 1SSOA 1JOOA 2E2IB 2F0FA 1GXDC 4HEDA 4C56C 5CV4A 2JSOA 3DXJC 1BCPB 3CU7A 3TBIB 3P20A 4QB4A 5C6AA 3TP5A 1D5XC 4CKEA 3SK8A 2R92B 1MI2A 1TVXA 4OHJA 1GUNA 4KI0A 3FMCA 4ID6A 1ZYRC 2A73B 2X69A 3BDOA 4O42A 2K6AA 1PZJD 1FNUA 2A6HD 3NWSA 2FMMA 2JE6I 3OW7A 3CHBD 1EY4A 4PV1C 2MPMA 3Q23A 4ILWA 5EBCA 4XYQA 4DAYA 2WV6D 3Q6SA 2J0TD 1LO5D 2Q8TA 2F0MA 3J81E 4QUCA 1QCBD 4KY7A 2OEOA 4DF7A 3R2TA 1JWUD 1EYAA 1KNAA 2O5JC 3RUZA 1K8OA 2RSNA 5I2YA 4E6IA 1UNSA 1QE6A 3W3AA 2HCIA 4V0BA 1Q12A 2F0WA 1TWFB 4IFDI 5E4WC 3I4LA 4FP5D 3LWEA 5IGCA 3S1NB 1O7LA 5CC4A 3QOJA 2I07B 4OGQC 1B50A 4IUNA 3S14B 1X3PA 3MTSA 3HS0C 1JQYD 4PQXA 5I6WA 4I7ZC 1EQVA 2F4IA 2PW5A 3PV0A 1SJED 1WTPA 1WD1A 4C3HB 4RGOS 3DHQA 1TIID 2B2UC 4EGVA 1Y1VB 3HP3A 5CMDA 1SNOA 1DCZA 1GUSA 3KF8A 1S5DD 5K5PA 2QF7A 2CVRA 1GHJA 1QNUA 4G4KA 2AUKA 2FHTA 2F0DA 4XQQA 5FO9B 3PO2B 4HCSA 5C0XI 1PRTC 4FF1A 2CQAA 2JXMB 3I72A 3H09A 5IGDA 4DAVA 3FPPA 2B2VA 4J1MA 1DOKA 3GTPB 3I91A 1WTRA 2EY2A 2A6ED 4G57A 1EY9A 5TSSA 1EY7A 2B2WA 3VR6A 1JWSD 2NZ1D 2M9VA 4H44C 5EPLA 5C4XB 2KA7A 4DXFA 1WTWA 3L3OC 3QB3A 2Z4HA 2E2DC 2QILA 4C1NK 1Y8NB 1WTXA 2XWJB 4RA8A 1JC7A 3S1QB 5C4HA 3TP8A 4A3GB 5JJZA 1B9NA 2B2VC 2F0OA 1EEID 1QJOA 1LT3D 1JICA 3A8IE 4B08A 3LNNA 1F2ZA 3CKIB 3N6RA 5FKAC 3HOZB 1SAPA 2Z1CA 4TSSA 2B2WC 1GUWA 1SDFA 3HOVB 1LTTD 2EOTA 4F87A 1L0XB 3OIQA 3K58A 5IIFA 1XX8A 5K36H 4ZUJA 2B2TC 1PTOD 1A2TA 4FNFA 3KLSA 1ZKOA 3BS1A 3MXNA 2DNEA 3NTKA 3GTQB 5LL6X 1PTOF 3QO2A 1SJHD 2NVXB 1A6XA 4P2CB 3OOCA 3GP7A 5D14A 1B9MA 2RDHA 1EZ8A 4L6TB 2F0PA 5CORA 1PFNA 3D31A 1PXUA 1PRTB 1BO0A 4DK0A 3VA7A 2D62A 3GTJB 4XIGS 1G2SA 1A3TA 4FVMA 1LACA 5HURA 2F0SA 1H9SA 3NUCA 3OPOA 4HMIA 3K5MA 2A6HC 3O13A 2OF1A 3RMHA 1SYEA 4X3TA 3V2TA 1PFBA 1BQQT 1SE2A 2F0HA 1STAA 1CHPD 4Y7NB 2K5DA 4KKTA 1PFMA 3MA2B 1LTSD 4C3IB 2CW0C 3A55A 3TN2A 5KYLA 2EYJA 2J4XA 5CV6A 5JEAH 3GO5A 3T51B 1GUOA 5E3FA 3H0GB 5FO8B 4XQJA 2ICEC 3PUZA 4U673 1U9RA 1Z47A 1CHQD 4HMJA 3T56B 1LTRD 1PDQA 3IKJA 2E2HB 2PMZB 2EYMA 1O80A 1SXTA 3PIP3 2IT1A 3M4OB 1EWHA 3URYA 1RD9D 4XQNA 5CBEE 5DNFA 4EQOA 4F88A 2OT2A 2Y0SB 2EYHA 1TS5A 2R93B 4KD3A 1TY0A 1R4QB 5T1IA 4C1NI 3HG9A 1B3AA 1V1PA 5D3DA 1TS3A 1F9QA 1Q1BA 2QEJC 3MXGA 2H4OA 1HUNA 1Z6HA 4EQPA 3S2DB 1VF7A 5K36G 2L9HA 1OXVA 4OO1H 5M5WB 1J9OA 3LWUA 1CM9A 1GUTA 1Q1EA 4J6HA 1KNEA 4H7BA 3WOEA 5EKKA 4DU9A 1FNVA 2L4NA 5M5XB 1RJTA 3SHLA 5M5YB 1YNJD 5T1GA 1F2YA 1U4LA 3AB9A 1EFID 2A6EC 1EQTA 1CA6A 3MAQA 5FO7B 3IAYA 1CTMA 4WORA 1CQVA 2E2JB 4LAAA 5D3IB 3Q22A 1A15A 3KBGA 5JPMC 2MP1A 2R3ZA 4NMZA 2QDBA 4RH6A 2B2YA 4G7OC 3DUZA 1RF2D 4MHEA 5C0XG 1TY2A 3BVZA 2YU9B 1K8MA 1SYGA 1GUGA 4KJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RDH A;  4L6T B;  5TSS A;  1LTA D;  1FNW A;  1SBB B;  3R8B A;  1D5Z C;  1PRT B;  2ICI A;  1LT5 D;  4RFB A;  3TSS A;  1LTI D;  3W2D A;  1SE3 A;  1L0Y B;  2Z8L A;  1JWS D;  1JCK B;  1V1P A;  1BCP C;  5D3D A;  3MFG A;  1EEF D;  1TS3 A;  1B44 D;  1PTO H;  1PYW D;  5ELF A;  3DWA A;  1EWC A;  2QEJ C;  1KLG D;  1PRT D;  4DXF A;  4RCO A;  4RHR A;  4K6L A;  1D5M C;  2IPK D;  2QIL A;  3O13 A;  1JQY D;  2O2L D;  1LTG D;  1RCV D;  1PRT F;  4ZYS A;  1M4V A;  1S5E D;  2G9H D;  3BVM A;  3DWQ A;  4O1N A;  4C56 C;  1SE2 A;  1PTO C;  1TS4 A;  1QIL A;  1BCP F;  3BVG A;  1CHP D;  1D6E C;  1SJE D;  1BCP B;  1B1Z A;  1I4G A;  3EFX D;  4Z9C B;  1FNV A;  1AW7 A;  2R61 A;  1I4H A;  1RDP D;  1UUP A;  4UDU C;  4BWG B;  3V05 A;  1HTL D;  1LTS D;  1EEI D;  1TY0 A;  1D5X C;  1SEB D;  4L63 B;  4RGN A;  2CHB D;  3KLS X;  1LT3 D;  4DXG A;  1TS2 A;  1I4X A;  2J4X A;  1PZK D;  2NTT A;  5ELD A;  5ELE A;  4RGO S;  1BCP D;  2XRQ D;  5FKA C;  1KTK A;  4OHJ A;  2NTS A;  1EFI D;  4TSS A;  1FGB D;  1HXY D;  1HA5 A;  1XTC D;  3BYT B;  1AN8 A;  2AQ1 B;  1F77 A;  1LT6 D;  1LTT D;  2IJ0 A;  1PZJ D;  1FNU A;  3EA6 A;  1S5C D;  1ET6 A;  1CQV A;  1L0X B;  1S5B D;  1JWM D;  1LTB D;  1EU3 A;  5ELB A;  1ESF A;  1S5D D;  2SEB D;  3CHB D;  1JR0 D;  5D3I B;  4RGT A;  1CHQ D;  1EU4 A;  1T5X D;  1ET9 A;  1DYQ A;  2RDG A;  1HQR D;  1LTR D;  1XXG A;  2WV6 D;  1PRT C;  1PTO D;  1V1O A;  1LO5 D;  1SXT A;  2AQ2 B;  3DWP A;  2AQ3 B;  1ENF A;  1G8Z D;  4RHS A;  1STE A;  1GOZ A;  1CT1 D;  1I4P A;  3URY A;  5I4D A;  1S5F D;  3BZD B;  1PZI D;  4RH6 A;  5FK9 C;  2TSS A;  3MC0 B;  1RD9 D;  2XN9 C;  4RGM A;  3R2T A;  1LT4 D;  1JWU D;  1I4R A;  1PTO F;  1PTO B;  1FD7 D;  1RF2 D;  3R2I A;  1SJH D;  1KLU D;  1LLR D;  1TY2 A;  1UNS A;  1V1P B;  2XRS D;  1BXT A;  1CK1 A;  1MD2 D;  3BVZ A;  1TS5 A;  3SEB A;  3GP7 A;  5ELC A;  1SE4 A;  2XNA C;  3OWE B;  3BYY B;  1DJR D;  1I4Q A; 
#chains in the Genus database with same CATH topology
 1H9S B;  4ALP A;  4HIO A;  3JAM E;  3OMC A;  3S1M B;  3ND9 A;  5JEA G;  5C3W A;  1K8G A;  1STB A;  1GHK A;  4DR5 Q;  2C9O A;  1L1O C;  4ZKC B;  4NP5 A;  4LF4 L;  1TWH B;  2NYZ D;  2A19 A;  2B63 G;  4I7A A;  1AZP A;  3T1H Q;  5BR8 L;  4Q5V A;  1F9P A;  5CGK A;  4H0L C;  4R4C A;  4DAM A;  2A1A A;  3H3V H;  4DNI A;  4A3M B;  5C44 B;  3G48 A;  1QZG A;  3CRK C;  3AFQ A;  1I6V C;  3ERO A;  1X65 A;  4JI8 Q;  1YZ6 A;  2ALY B;  4AQY Q;  2QGQ A;  3MXP A;  4B9X A;  5LL6 S;  5JJI A;  1VQ4 A;  2Q8R E;  1S5E D;  1HNZ L;  1NNX A;  5EPJ A;  3R3O A;  4CDF C;  1PTO C;  3FVQ A;  1IBM L;  1MHW C;  4NXN L;  5JOB A;  4DV7 L;  4K0K Q;  3KUP A;  1NCV A;  1RDP D;  4BWG B;  2IWH A;  3KJP A;  1BR9 A;  4KY5 A;  2OWO A;  1SYB A;  2JA6 B;  2RHQ B;  3OSO A;  4L63 B;  1BBX C;  1TU2 B;  3T53 B;  1O7Z A;  4JC0 A;  2LFN A;  2KEN A;  4A3M H;  3DMU A;  2RBM A;  2ZJP A;  3HKZ G;  2GN5 A;  2EY1 A;  4U68 A;  3UDF A;  1AE2 A;  2E75 C;  5EBD A;  1CZG A;  1Q8K A;  3KK7 A;  1B53 A;  1HZ9 A;  2HHH Q;  2AQ1 B;  4UP7 A;  1F77 A;  2NVY B;  1XPR A;  1N34 L;  5IP9 H;  2L1B A;  3PUY A;  5KGU A;  3CQZ B;  4XYO A;  1MJE A;  5HGT A;  2EZV A;  3T16 A;  1ESF A;  5IGE A;  2G5D A;  4DV2 L;  4B3M L;  1JT8 A;  1NSN S;  5KNB A;  3HOX H;  4X65 L;  4NXM L;  1SNC A;  2HUG A;  1X9N A;  2CWP A;  1HZC A;  4OO1 G;  1SE8 A;  2MJ8 A;  4NDX A;  3J80 c;  1G8Z D;  1SRU A;  5AJ3 L;  2E2I H;  1BOS A;  1CT1 D;  5FK9 C;  1PZI D;  1YNN D;  4JW0 A;  3P7J A;  2KED A;  1YIT A;  2ZT9 C;  1XNR L;  2BA1 A;  2JP1 A;  1V1P B;  3CQZ H;  4EX5 A;  3K5N A;  4A3J B;  1HNW Q;  3C1E A;  3K7U C;  5FLM H;  1SE4 A;  3KF6 B;  1HFG A;  1E24 A;  1I4Q A;  1D1K A;  5GRO A;  4PMW A;  4HIM A;  2R92 H;  2DGY A;  2EJG C;  1H9K A;  4DR2 L;  1JB7 A;  2B8G A;  1VQD A;  4K2L A;  4ZK9 B;  3L7Z C;  1CSP A;  4DFA A;  1L0Y B;  4DUY L;  2UUB L;  2XIW A;  2JN4 A;  1C8C A;  2CW0 D;  3S1R B;  1XPU A;  2ZTD A;  4KK7 A;  1ILQ A;  4LUV A;  2VY3 A;  1D2B A;  1BBU A;  3KBX A;  4G7Z C;  3F2U A;  4EVO A;  3ERQ A;  2B2U A;  4RAU C;  2UUC Q;  3RLO A;  2PQE A;  5C4Z A;  1FL0 A;  5M9O A;  4C3J B;  2PCF B;  1WCM B;  1P16 A;  2JQO A;  2PZU A;  2NBF A;  2F0T A;  4Z9C B;  1G6Z A;  3BDC A;  3HOU B;  1L1O B;  1I4H A;  4IAL A;  3P75 A;  3HOY B;  4DR6 L;  4CKB A;  4IPD A;  5E7N A;  5ELO A;  3A7L A;  2XTI A;  4KHZ A;  3VYT A;  1EY5 A;  3K5L A;  2K5Q A;  1PH8 A;  2N78 A;  1CI3 M;  3FKI G;  2OQ0 A;  4N9P A;  4A3E B;  4X3S A;  2UUA Q;  4JI6 L;  1TWF H;  4JI7 Q;  1FGB D;  4PMC A;  4O0A A;  3NXW A;  2IX3 A;  2PYK A;  2VQE L;  1O78 A;  4C3J H;  3S1N H;  5EPK A;  4GOP A;  5M3F B;  1WCM H;  4DV6 L;  2K14 A;  5I9P A;  2A74 C;  2RHS B;  2SEB D;  4BBR B;  4A3K B;  3D4W A;  2F03 A;  2ZJR A;  2K28 A;  3S15 B;  4A3E H;  1Z9F A;  3A5U A;  2O5I C;  1A63 A;  2AQ2 B;  2QDL A;  2X6G A;  2F0G A;  2TSS A;  2OTL A;  1YNX A;  1Z7T A;  2PI2 E;  3I4O A;  4BBS B;  2K5H A;  1VQH A;  4JI1 L;  1X3G A;  4C3H H;  1YVC A;  4DV5 L;  1VQE A;  3BZK A;  5LMN L;  1E2W A;  3S15 H;  5E4X A;  2IX0 A;  3LX0 A;  1IKL A;  2Z4I A;  1S3O A;  1UEA B;  1IBL Q;  1YNJ C;  1HNX L;  3PUX A;  1O7Y A;  4IUR A;  5FLX c;  1PV4 A;  1EEF D;  4X3U A;  1STY A;  4OIJ A;  4KD4 A;  3FDT A;  2SNM A;  4K6L A;  3HOX G;  3C1F A;  1CKN A;  3M85 A;  1TWG B;  4A75 A;  3PO2 H;  1BDO A;  2BCO A;  2HQE A;  5C4J B;  2MGS A;  1LTG D;  3Q0A A;  1QVC A;  3U9O A;  3SGI A;  1M4V A;  1F2L A;  4JI3 Q;  1YJ9 A;  3CD6 A;  4B3T L;  3CCS A;  1BCP F;  3ERS X;  5BN3 A;  3SVM A;  1IHZ A;  3V05 A;  1FVI A;  2NB0 A;  3R93 A;  3NTI A;  4UHV A;  4GNX C;  3JAM L;  3I3C A;  3GTP H;  1DON A;  3VYS A;  4QJF A;  4ZLT F;  3AMU A;  2LMC B;  2HCC A;  2B2T A;  3BJU A;  5FLM G;  1E3P A;  5ELD A;  1TWG H;  4JK1 C;  3VYR A;  1WTV A;  2R92 G;  1F2M A;  4XDX A;  1KAA A;  1VS0 A;  2L0C A;  4IJH A;  2ZM6 L;  3EIV A;  2J7Z A;  3NQI A;  3ER0 A;  1MKH A;  5I6Y A;  4JI4 Q;  1HXY D;  1VQF A;  1I94 Q;  1RIP A;  3HEJ A;  2N55 A;  1LT6 D;  3RD4 A;  1U5K A;  1YHQ A;  1JE4 A;  3TS2 A;  4YHH Q;  4UPA A;  5FOB B;  1Y1W B;  5C4X H;  1JR0 D;  5ELN A;  2HDM A;  3C2P A;  1T5X D;  2K5W A;  2NN6 H;  4OIK A;  1VQM A;  2F3V A;  4G7H C;  2EYO A;  4L8J A;  4OL7 A;  3D6C A;  1TXY A;  1G2T A;  3VR2 A;  4A3G H;  4R9W A;  4RGM A;  2GA4 B;  3WOF A;  5KRU A;  1SFO B;  2EPB A;  1I4R A;  1KAW A;  5IT9 c;  1IL2 A;  4OO1 I;  1T9H A;  1J8I A;  5J39 A;  2ZTC A;  1BXT A;  1MD2 D;  1QOH A;  5KEE A;  4FO2 A;  4KKU A;  2HIX A;  1W2B A;  5BN5 A;  1FR3 A;  2M00 A;  1H95 A;  4B3R Q;  3J80 E;  1E0B A;  2VQF L;  3QOL A;  2WKD A;  1X54 A;  2K1B A;  3HOZ H;  3GTM B;  3TSS A;  4JI5 L;  4MN3 A;  3EQL C;  4A4I A;  5IOD A;  1JCK B;  4DR4 Q;  1K3B C;  2F0L A;  1XMO L;  4LW1 A;  2EYF A;  3JAM c;  4CJ1 B;  1C4Q A;  3HOV H;  1ICW A;  2VZA A;  5HGQ A;  1C48 A;  3S9W A;  3CXC A;  4YY3 Q;  3ULL A;  2D2C C;  3HGB A;  3H94 A;  1H9J A;  2RDF A;  1QNK A;  2H1E A;  2OXP A;  4KN4 C;  3I70 A;  2WAQ E;  1OO9 B;  2L55 A;  1STG A;  3PUW A;  4XTC S;  2WFW A;  5IGF A;  2A68 C;  2WII B;  3BVM A;  1G91 A;  1SLJ A;  2EYP A;  1TS4 A;  4L5S A;  2UXD L;  4WRD A;  1I4G A;  3PGZ A;  3GTQ H;  3OTO Q;  2R61 A;  2JA9 A;  2IL8 A;  4ODG A;  4UDU C;  1YNN C;  2NVT B;  2PZW A;  2QCP X;  4KTA A;  5C3E B;  2NVX H;  2WIN B;  4GOP B;  4C3H G;  1Q8I A;  4FXD A;  1TS2 A;  1ZEQ X;  1B4O A;  3VR5 A;  2K50 A;  4IUU A;  2XRQ D;  2DY7 A;  2VXW A;  5C5L A;  2JYO A;  1UWV A;  5CR3 A;  1YHB A;  3C3L A;  4GZY C;  1N33 L;  2IJ0 A;  1Y1V G;  1N8R C;  5JJL A;  1S5C D;  1NBW A;  4QIW B;  4EQN A;  3GTJ H;  4TQU S;  3CC2 A;  1XTD A;  5J1Z A;  2ID0 A;  4RGT A;  4A93 B;  3RZD B;  5IWA L;  3C46 A;  3X3N A;  3KF8 B;  1QVF A;  3UDI A;  2E8G A;  2K03 A;  3PO2 G;  3DWP A;  4LF5 L;  2Z6B A;  3CMA A;  4RHS A;  3X3M A;  1XPO A;  3M7N A;  1GOZ A;  2DN8 A;  5I4D A;  1TT2 A;  3WDN A;  2F0J A;  2KCM A;  4KY6 A;  1N32 L;  1CZW A;  1EOT A;  2WB1 E;  3E6Z X;  3SE0 A;  4RMF A;  4Y7N H;  1DOM A;  4OWW B;  1L0W A;  4DR1 L;  1I50 B;  1TR5 A;  5A2Q E;  4DV0 L;  4PNY A;  5ELC A;  1RTN A;  2JEB I;  4AYB E;  4C3I H;  4A3I B;  1EQQ A;  3D6W A;  5G3L D;  3PIO 3;  4DV1 L;  3RZD H;  4FF3 A;  4IFD J;  1SBB B;  1NE3 A;  1HQM C;  2HD3 A;  1CKN B;  5C5M A;  4R4T A;  5G3L F;  1IW7 D;  4QL5 A;  3H0G H;  1JMC A;  1PH3 A;  4JV5 Q;  4RKL A;  1HCZ A;  4JI2 L;  3M4Q A;  2HQL A;  3CCM A;  3H3V C;  5C4X G;  1ICF B;  4K8I A;  5LMU Q;  1AEX A;  4MNO A;  4LF4 Q;  4N8F A;  4N9T A;  3NWT A;  3IFT A;  1SNM A;  2NN6 G;  2KCC A;  2E2H H;  2JA8 B;  3M4O H;  5FLX E;  3PIO A;  2E5L Q;  4O1N A;  5AFW A;  1PYS B;  1QIL A;  4I65 A;  4A3G G;  1CA5 A;  1EOV A;  3EFX D;  4OX9 L;  5EKL A;  2KEE A;  2A69 D;  2UXC L;  5DEH A;  3PF5 A;  5EKI A;  1IBM Q;  3KLS X;  3D4R A;  1C0A A;  2R93 H;  3M4Y A;  3T1Y Q;  1HJP A;  1SYF A;  1KTK A;  3P1H A;  2BDO A;  4HAE A;  4P72 A;  4B3S L;  4HSV A;  3SK5 A;  3AYH B;  3HOZ G;  5M3M B;  2MHV A;  1IYU A;  1MSH A;  4OEL B;  1TKW B;  1ET6 A;  3HOV G;  1S5B D;  2NZH A;  3J7Y W;  1BF4 A;  1EU3 A;  1PMR A;  2VL6 A;  1PLF A;  2HDL A;  1EU4 A;  2G9D A;  2YTY A;  1VQN A;  4A3B B;  2RDG A;  3S2D H;  3NSW A;  3PMF A;  3KDF A;  3GTO B;  4CHT B;  4DV2 Q;  2YTV A;  3HKZ E;  2IX1 A;  4JBJ A;  2PI2 A;  5LHY 1;  4X65 Q;  4NXM Q;  3F2B A;  1JJ2 A;  3J7A 5;  5M5W H;  1KL9 A;  3BZD B;  4K5V A;  1HFN A;  3UE0 A;  2FIN B;  2RKS A;  2PPB C;  2CWA A;  4ZRZ A;  1C9O A;  3D8G A;  3FP9 A;  3MFY A;  1DOL A;  5AJ3 Q;  5M5X H;  4A3F B;  3MXN B;  1NTG A;  3MXU A;  3DM1 A;  5M5Y H;  2CQO A;  1F9S A;  2XGT A;  1Q7Y C;  1N36 L;  1XNR Q;  4A3B H;  1V43 A;  1UE5 A;  1FNW A;  5JPN C;  4X3K A;  2P5Z X;  5IT9 E;  1WVL A;  2E76 C;  1YBY A;  3OMG A;  3TRE A;  1IYV A;  1ILP A;  1SYD A;  4DR2 Q;  2SOB A;  1Q86 C;  5IYD H;  3H15 A;  3AQQ A;  2VUM B;  3DWA A;  1EWC A;  3ZYY X;  4CDD C;  4DUY Q;  3QR8 A;  1XYI A;  2UUB Q;  1D1I A;  4JOI A;  1BUV T;  2E2J H;  4RHR A;  5J3B A;  5GQO A;  4BS9 A;  2IPK D;  1XWE A;  1EIG A;  1QUQ A;  4DUZ L;  3F2D A;  1VQC A;  2UXB L;  4P71 A;  3HFZ B;  2RA4 A;  3DWQ A;  2Q2U A;  3MHB A;  1S4Z A;  2LSS A;  4EQ5 A;  3J7A F;  4UP9 A;  4NPS A;  1II3 A;  5GAD C;  1PA6 A;  3J80 L;  3E5S A;  1S40 A;  4IQZ A;  4LFC L;  4LF7 Q;  4RKB A;  4QMG A;  4FYD A;  2KCT A;  5CV5 A;  4ZAI A;  1VDZ A;  2BE5 D;  2YU9 H;  1SNP A;  4C3I G;  2NTT A;  3RZO B;  4JI0 L;  1B8A A;  4DR6 Q;  4A3C H;  1QG7 A;  4FXG C;  1EYD A;  2LS0 1;  1N9W A;  2ZXP A;  4LF8 L;  1EY0 A;  1GKH A;  4GKJ Q;  3S1M H;  4HR7 B;  4C2M B;  1BNZ A;  3RN2 A;  4POF A;  1P8L A;  4JI6 Q;  3GTL B;  3H0G G;  3ITP A;  4RG1 A;  1JWM D;  1Q90 A;  2MUY A;  3CC7 A;  3J7A V;  5ELB A;  1TWH H;  1K83 B;  2RCN A;  3TRZ A;  2VQE Q;  2F0N A;  1ESR A;  1KC8 C;  1DXM A;  3DEP A;  4JOI C;  1HQR D;  1WJJ A;  1XXG A;  1K9M C;  3DLL A;  1V1O A;  3HOW B;  2PQA B;  1HHV A;  5C44 H;  1DZ1 A;  4XT3 B;  1ENF A;  3UDG A;  1JOR A;  4HTH A;  1S5F D;  1HRJ A;  4C2M H;  5I2X A;  3EVQ A;  4CDE C;  1TWA B;  1NR4 A;  1FD7 D;  2O4X A;  3R2I A;  2CH4 A;  1KLU D;  1LLR D;  4BY1 B;  4K6D A;  3I8Z A;  3OIP A;  4TKO B;  2ZTE A;  2Y0S G;  2JA6 H;  2A68 D;  2R93 G;  1IYJ B;  1F9R A;  4HJ5 A;  2K04 A;  4JI1 Q;  3AU7 A;  2L11 A;  3VR3 A;  1LT5 D;  1U0L A;  4DV5 Q;  1SE3 A;  1WYD A;  3MZ5 A;  5H1S E;  4XT1 B;  5LMN Q;  3K59 A;  1XMQ L;  5CYU A;  3EN2 A;  3ND8 A;  3A54 A;  2F3W A;  2NVY H;  3W1G A;  5IYC H;  2UU9 L;  1H9M A;  3SR1 A;  1HNX Q;  3Q8D A;  4P74 A;  3CRL C;  4RCO A;  3D4D A;  2VW9 A;  1D5M C;  3VDY A;  2EJF C;  4K5X A;  4CKC A;  4DGZ A;  2K32 A;  4CDC C;  2MQH A;  4K14 A;  1OXS C;  3PUV A;  1AE3 A;  4ZYS A;  1VQK A;  2JA7 B;  1ML0 D;  4NW2 A;  5A2Q L;  1PH4 A;  5CBA E;  1FGU A;  2NN6 I;  1JE5 A;  4DNR B;  3I2Z A;  4A3J H;  4B3T Q;  1A0I A;  1CFM A;  2PZT A;  1KDC A;  1IL8 A;  2RCF A;  5EQ0 A;  3HRZ C;  4UAI A;  4X66 L;  1Y8O B;  2VB2 X;  4R8I A;  1J5E L;  1RTO A;  2NTS A;  4ZCK A;  4PZ8 A;  3TS0 A;  4OEM B;  5C3X A;  2JK8 A;  1RKN A;  3KDF B;  2NUC A;  1HA5 A;  1EIF A;  3M7G A;  4POG A;  4GLX A;  2ES2 A;  1VCI A;  1WTO A;  1MSG A;  3H6M A;  3S1R H;  4P75 A;  5IYD G;  1BBW A;  1SYC A;  3G7L A;  1IW7 C;  1NAP A;  4WJ3 M;  4DNT B;  5FLX L;  3RLN A;  3SXH A;  2ATW A;  4MIU A;  3GV3 A;  5JVH 3;  1ET9 A;  1NUC A;  2XSC A;  1TWC B;  4OON A;  2I5L X;  3CAM A;  3NTH A;  4JCV E;  2KJX A;  1EFW A;  2LY7 A;  3FHW A;  3RR5 A;  2Q8I B;  1I4P A;  5DAU A;  2X6L A;  3T1H L;  2PO4 A;  4JBW A;  2XN9 C;  1Y69 U;  2GVA A;  4IJL A;  1LT4 D;  2FXQ A;  4R8N A;  4IUQ A;  1PTO B;  1DM0 B;  3A8K E;  1VMP A;  4JI8 L;  3HOU H;  5GAE C;  4J8Q A;  4AQY L;  3HOY H;  4ME5 A;  3SDZ A;  3OWE B;  1SRO A;  3RLF A;  2A69 C;  3D0F A;  2JEA I;  1TWC H;  3K8A A;  2I0Q A;  2AHO B;  4DN4 M;  1MIU A;  4L5R C;  2YYZ A;  4K0K L;  4A3C G;  4R1J A;  1QUQ B;  1LTI D;  5IY0 A;  2Z8L A;  1KIX A;  1CSQ A;  1QB5 D;  2VQF Q;  3MWY W;  4K8J A;  1ASZ A;  4GNX A;  1PTO H;  4OWT B;  5ELF A;  5M3F H;  4JI5 Q;  2DJG C;  4NKL A;  1G51 A;  1CQF A;  2E74 C;  2L5T A;  3S2H B;  4BBR H;  4A3K H;  3NHH A;  1QZH A;  1M1K C;  3Q24 A;  5COY A;  2KUM A;  3H91 A;  5ISR A;  4A3M G;  4PMB A;  5C44 G;  3M3Y B;  2G9H D;  4A3L H;  3S17 B;  4FXK C;  4RCN A;  2B8F A;  2SDF A;  3IRB A;  3E3X A;  2F0V A;  1UAP A;  1AW7 A;  1X55 A;  4DA2 A;  1SND A;  2R7D A;  4GKK L;  1VQI A;  5IP9 G;  1VQ6 A;  2M2L A;  4BBS H;  4HJ8 A;  2EDG A;  2C5C A;  4IPC A;  4ZKB B;  1SEB D;  2BA0 A;  2CHB D;  2UXD Q;  5IT9 L;  1GM5 A;  4JYA Q;  3T4A C;  2JA6 G;  1HA6 A;  5ELE A;  1BCP D;  3U4V A;  3QG1 A;  2R7F A;  5I9O A;  2YV5 A;  3JAM i;  2KCN A;  1HNW L;  1XTC D;  3BYT B;  1I5F A;  4A3D B;  3QIA A;  1KAB A;  4GN3 B;  1TQO A;  5FJ8 H;  5IYC G;  1B2T A;  3TZU A;  4ULL A;  3ICE A;  1N33 Q;  2EY5 A;  4H13 C;  3TP6 A;  2VNU D;  2WAC A;  4GLA C;  2RF4 A;  3I4N B;  4JVZ A;  2FFK B;  1ROD A;  2ZXR A;  2I46 A;  4R4O A;  4QQB X;  1HR0 L;  1WTH A;  5C4J H;  2F0U A;  3NEN A;  3K7A B;  4IN3 A;  3WWV A;  1ENC A;  3PO3 B;  3MC0 B;  1STN A;  4X64 Q;  1Q3L A;  5EJW A;  3A8J E;  3QJY A;  4KKS A;  1KDB A;  3STB D;  3I4M B;  2F0K A;  5IGG A;  4CGY B;  3D3R A;  1EZ6 A;  4S3S A;  2UUC L;  4A3J G;  4M1U B;  3G6E A;  1DJR D;  2WAQ B;  1DGS A;  3LGJ A;  4WJW A;  4DR1 Q;  4BY7 B;  3A74 A;  1RHP A;  4YWL A;  2SNS A;  4DV0 Q;  4K5W A;  2BE5 C;  4DV1 Q;  2AUJ D;  3W2D A;  3A7A B;  3GQB A;  3K7A H;  2XWB B;  2DNC A;  1CKM A;  1M8A A;  2QKI C;  1PYW D;  4DAP A;  3ZJY C;  1E2Z A;  5IYB H;  1NJI C;  2UUA L;  4KJO A;  1Y1W H;  2JA5 B;  2IHE A;  5D65 A;  4F7X A;  2B29 A;  1UE1 A;  2A5H A;  1HH2 P;  4JI2 Q;  3EJI A;  4KV6 A;  2GVB A;  2N88 A;  3NP8 A;  2PW7 A;  3V96 A;  4IUV A;  1E22 A;  2RVL A;  4HJ9 A;  4DR3 L;  1DD2 A;  5KNC A;  1I6H B;  1SMY D;  4WFN 3;  3NPP A;  2D0P A;  4LK1 C;  4IFD H;  1SFO H;  3E0J A;  4C3J G;  2F0E A;  4KHV A;  1WCM G;  4GN4 B;  5GAG C;  1JOQ A;  3HOU G;  4QF4 A;  2JA5 H;  4RGN A;  3HOY G;  4OX9 Q;  1K0S A;  1PZK D;  2UXC Q;  2R6G A;  3SK4 A;  2AWN A;  3SK6 A;  2V1C C;  3KLR A;  3PQI A;  4H02 A;  5A35 A;  4A3E G;  2Q2H A;  1YEZ A;  4LFB L;  1EL0 A;  3GTM H;  1G29 1;  2WB1 B;  3KOJ A;  3EA6 A;  1HTP A;  1KXL A;  3CCE A;  1LTB D;  2I5M X;  3I73 A;  5M3F G;  3MEH A;  3GTK B;  4QUF A;  2LXK A;  4AYB B;  3VR4 A;  2R7Z B;  1X3E A;  5JAV A;  2WP8 J;  4BBR G;  4A3K G;  3CCU A;  1VMC A;  2EY6 A;  4LWC A;  1B70 B;  2AQ3 B;  5LMN W;  1WD0 A;  3MVV A;  2EIF A;  1MBY A;  1STE A;  1VQG A;  1IZ6 A;  4BXX H;  4CJ0 B;  3S24 A;  2RSO A;  1VQA A;  5J22 A;  5JJK A;  3F1Z A;  2LKV A;  4HSP A;  2D5D A;  2EXZ A;  3FPU B;  1CK1 A;  5CV9 A;  3J81 j;  3J81 L;  1SN8 A;  1LAB A;  2KQ3 A;  2NVT H;  5C3E H;  4BBS G;  4IUP A;  3G71 A;  2QW7 A;  4GNX B;  4DPG A;  1YJW A;  4JI3 L;  1KD1 C;  4V19 0;  1EIH A;  3TME A;  2CKZ B;  3K6O A;  1ZYR D;  1AH9 A;  1LTA D;  1JB3 A;  3NQT A;  3GD7 A;  2F0I A;  2ICI A;  5HY6 A;  4RFB A;  4ABN A;  1N36 Q;  1XNQ L;  2MO0 A;  5DM6 3;  1X32 A;  1WFQ A;  4FF2 A;  4FF4 A;  3MFG A;  1U4R A;  2B63 B;  4HCE A;  1YI2 A;  1AP0 A;  2BOS A;  1SNQ A;  5C0X H;  3UDX A;  4LF9 L;  2TMP A;  1HUM A;  1SR3 A;  2V4D A;  3E9H A;  3U9S A;  1KLG D;  5FJ8 G;  5DM7 3;  2F0Q A;  2WKC A;  3L9A X;  5CV7 A;  4JI4 L;  4A93 H;  2KVM A;  4LMQ D;  3FRP B;  2BDN A;  2CFM A;  2KOL A;  2O2L D;  3T13 A;  4YHH L;  2EYL A;  1X3Q A;  2FJ2 A;  2F52 A;  3GTG B;  4DUZ Q;  1D6E C;  3N52 A;  2B39 A;  1ASY A;  5CV8 A;  4YIJ A;  1S72 A;  2NVQ B;  3TDQ A;  3OW2 A;  1AZQ A;  4X6A H;  2FMC A;  1I50 H;  2ENB A;  1Q46 A;  1KHI A;  1LUZ A;  4A3I H;  4HJA A;  3HKZ B;  3S16 B;  4LUZ A;  4DR7 L;  3NBI A;  3CPW A;  1ONL A;  1QWY A;  1X56 A;  3U4Z A;  2H5X A;  5BR8 Q;  4BA2 I;  1GJX A;  1T5E A;  2PNH A;  3A56 A;  4IUT A;  2K05 A;  2ZXO A;  3CCR A;  2K33 A;  4JI0 Q;  2L12 A;  3VYU A;  1A3U A;  3CP0 A;  2F4V L;  3J81 c;  4LF8 Q;  5KYI A;  4CBV A;  4DKA C;  3NBH A;  5IYB G;  1HNZ Q;  1Y1W G;  4DV7 Q;  4NXN Q;  1OXT A;  1DYQ A;  3I7F A;  3S16 H;  3G6J B;  3M4P A;  1AFP A;  1Y14 B;  3G4S A;  4QGU A;  1W6K A;  2KEC A;  3ULJ A;  3VA5 A;  5DLQ E;  2NZO A;  2JA8 H;  4K2K A;  4LUO A;  5F2D A;  1PYB A;  5IOC A;  3NEM A;  3OWF A;  1U4M A;  1R4P B;  3DEO A;  4A76 A;  5JVG 3;  4QCL A;  2Z9H A;  1L2F A;  4IFD G;  1OTC A;  1VQB A;  1FYC A;  4KN7 C;  3NEL A;  3SEB A;  2HIV A;  4KJN A;  1N34 Q;  2VB3 X;  1IKM A;  4DV4 L;  5C0X J;  4DK1 A;  5KND A;  4HJ7 A;  4KMU C;  4B3M Q;  1EYC A;  2PMZ E;  1NR2 A;  4N8X 1;  3ONA B;  2Z0S A;  1E2V A;  1ZXT A;  5M3M H;  1BCP C;  2RQX A;  2D9U A;  3PCO B;  1A2U A;  1ENA A;  4JG2 A;  4RWS C;  4IOA A;  4CJ2 C;  5JEA J;  1PRT D;  3BDL A;  4TVA B;  2Y0S E;  1VQJ A;  3W5O A;  1XMQ Q;  4B9W A;  1V8Q A;  4XXE A;  2UU9 Q;  5KIX A;  1EY8 A;  1U4P A;  2KHI A;  3GTO H;  1RCV D;  1PRT F;  1R9T B;  2CCZ A;  2K5V A;  1HPC A;  3GV6 A;  5IGB A;  4O2D A;  1E1O A;  1EWI A;  3BVG A;  3TZD A;  1A3V A;  4BXX G;  1B1Z A;  5IP7 H;  1I3Q B;  2D0O A;  5E1F A;  4DV3 L;  1STH A;  1UUP A;  3K5O A;  1H9R A;  4IZ8 A;  1HTL D;  1B7Y B;  3FKI B;  3CME A;  4A3F H;  1NMF A;  4DXG A;  4ZQ3 A;  5C3E G;  1I4X A;  3STB C;  4ZUI A;  1WTQ A;  1KDA A;  1IBK L;  4KHP L;  3J80 i;  3NE5 B;  4OWX B;  1W6J A;  3L2P A;  2DY8 A;  2NWG A;  1Y8P B;  2K52 A;  1E1T A;  1LV9 A;  1VQP A;  3HZX A;  1KQS A;  1EQR A;  1J5E Q;  1AN8 A;  1CUK A;  1WI5 A;  4Q0F A;  3BU2 A;  3F8T A;  1OXU A;  2VUM H;  3EBE A;  3IL8 A;  3OHX C;  3FKI H;  1OXX K;  1JOK A;  1D8L A;  3I56 A;  4F8M A;  5EGT A;  4A93 G;  3IFD A;  3K0X A;  1BVS A;  4JV5 L;  4PG3 A;  3UI2 A;  1HZA A;  3BG3 A;  4M8A A;  3HKS A;  3QWN A;  2XVS A;  5LMU L;  2OQK A;  1VF5 C;  1NY4 A;  5EAY A;  2XRS D;  1SMY C;  2MFI A;  1MGS A;  2Q2I A;  5NUC A;  4TRD A;  1VQ7 A;  2E5L L;  2XNA C;  1EYG A;  3NK9 A;  3BYY B;  5BN4 A;  2K7V A;  4DV6 Q;  4A3I G;  3RZO H;  2EVB A;  1SMX A;  3R8B A;  1D5Z C;  4HN7 A;  2EJM A;  4BA1 I;  3I90 A;  1PVO A;  4HIK A;  2BH8 A;  2OCE A;  3K57 A;  1EY6 A;  2IW3 A;  2EE1 A;  2AMC B;  2B2Y C;  1B44 D;  4NB3 A;  2QA4 A;  3GTL H;  3T1Y L;  3K0Y A;  2K01 A;  2KHS A;  2F1M A;  3HOX B;  3OYY A;  3TP7 A;  1K83 H;  2PNR C;  2YTX A;  4JPB W;  4LJZ C;  3FEW X;  2BH2 A;  2ZJQ A;  4LNQ A;  1SSO A;  1JOO A;  3CCV A;  2E2I B;  3HOW H;  2F0F A;  1GXD C;  4HED A;  4C56 C;  5CV4 A;  2JSO A;  2K4K A;  3DXJ C;  2JA8 G;  3KFU A;  3CCL A;  1UEB A;  3UE1 A;  2N49 A;  1A8V A;  3RNU A;  1BCP B;  3CU7 A;  3TBI B;  1VQL A;  1TWA H;  3P20 A;  4QB4 A;  5C6A A;  4X62 L;  4BY1 H;  3TP5 A;  1D5X C;  4CKE A;  3SK8 A;  1K3R A;  2R92 B;  3NBH B;  1MI2 A;  1TVX A;  4GKK Q;  4OHJ A;  1GUN A;  4KI0 A;  3FMC A;  4ID6 A;  1ZYR C;  2A73 B;  2X69 A;  3BDO A;  4O42 A;  5M3M G;  4L5Q A;  2K6A A;  1PZJ D;  1FNU A;  2A6H D;  3NWS A;  2FMM A;  2JE6 I;  3OW7 A;  3CHB D;  1EY4 A;  4PV1 C;  2MPM A;  3Q23 A;  3CC4 A;  4LF6 L;  4ILW A;  5EBC A;  4XYQ A;  4DAY A;  2WV6 D;  3Q6S A;  2J0T D;  4A3B G;  1LO5 D;  2Q8T A;  2F0M A;  3J81 E;  4QUC A;  4AH6 A;  1FJG L;  1QCB D;  4KY7 A;  4LFA L;  2JA7 H;  2OEO A;  3R2T A;  4DF7 A;  1JWU D;  1EYA A;  1KNA A;  1HR0 Q;  2O5J C;  1LYL A;  4J15 A;  2RSN A;  3RUZ A;  5IP7 G;  1K8O A;  5I2Y A;  2ZM6 Q;  4E6I A;  1UNS A;  1QE6 A;  3W3A A;  4KLK A;  2HCI A;  1V9P A;  4V0B A;  4UY8 C;  4A3F G;  1Q12 A;  4IO9 A;  2F0W A;  1TWF B;  4IFD I;  4DR5 L;  2MO1 A;  5E4W C;  3I4L A;  4LF7 L;  4FP5 D;  3LWE A;  4IPH A;  5IGC A;  3S1N B;  1O7L A;  4JBM A;  5CC4 A;  2QEX A;  3QOJ A;  4GN5 A;  2I07 B;  2CH4 W;  2VUM G;  4OGQ C;  1B50 A;  2DUD A;  4IUN A;  3S14 B;  4GKJ L;  1X3P A;  3MTS A;  3HS0 C;  1JQY D;  3W1B A;  4PQX A;  1WOC A;  3KLW A;  4I7Z C;  5I6W A;  1PH9 A;  1EQV A;  2F4I A;  1VQ5 A;  3K81 C;  2PW5 A;  3PV0 A;  1SJE D;  1WTP A;  1LM0 A;  1WD1 A;  4DR3 Q;  4C3H B;  4R4Q A;  2B3G A;  1XMO Q;  3U58 A;  3S14 H;  4RGO S;  2HHH L;  3DHQ A;  1K8A C;  2KHJ A;  1TII D;  2B2U C;  4EGV A;  1Y1V B;  3K80 C;  2A8V A;  3HP3 A;  5CMD A;  1SNO A;  1DCZ A;  1GUS A;  4FDB A;  4LFB Q;  3KF8 A;  1S5D D;  5K5P A;  2QF7 A;  4MZ9 A;  3CW2 C;  2CVR A;  1GHJ A;  1QNU A;  4G4K A;  1NMG A;  2AUK A;  2FHT A;  2F0D A;  4XQQ A;  3S2H H;  5FO9 B;  4PZ7 A;  1QVG A;  3PO2 B;  4HCS A;  5C0X I;  1PRT C;  2HT1 A;  4FF1 A;  2CQA A;  2JXM B;  3I72 A;  3HOW G;  3M3Y H;  3H09 A;  1Y1V H;  5IGD A;  4YWK A;  3S17 H;  4DAV A;  3FPP A;  1O7I A;  2B2V A;  3I55 A;  4J1M A;  4ME3 A;  4GOP C;  5IE8 A;  1DOK A;  3GTP B;  1UE6 A;  1XJV A;  3PF4 A;  3I91 A;  1WTR A;  2EY2 A;  4BY1 G;  3E0E A;  2A6E D;  4G57 A;  1IXR A;  1EY9 A;  5TSS A;  1EY7 A;  2B2W A;  1LTL A;  2MNA A;  1E7Z A;  5IWA Q;  3VR6 A;  1JWS D;  2NZ1 D;  4HID A;  1GVP A;  4AIM A;  4JBK A;  3RN5 A;  4A3D H;  2M9V A;  4H44 C;  5EPL A;  2Q2T A;  4LF5 Q;  1B3Q A;  5C4X B;  1XNQ Q;  2KA7 A;  4R4I A;  4DXF A;  1WTW A;  3AEV A;  3L3O C;  3QB3 A;  2Z4H A;  1N32 Q;  2E2D C;  2QIL A;  4C1N K;  1Y8N B;  4LF9 Q;  3I4N H;  1WTX A;  1K73 C;  2XWJ B;  1EUJ A;  2F3I A;  4RA8 A;  1JC7 A;  3S1Q B;  5C4H A;  3TP8 A;  4A3G B;  5JJZ A;  2JA7 G;  3PO3 H;  3A0J A;  4YCU A;  1B9N A;  4DK3 C;  2B2V C;  2F0O A;  4OXP A;  3I4M H;  1EEI D;  2Z6K A;  1QJO A;  1LT3 D;  1JIC A;  4JI7 L;  1PH2 A;  3A8I E;  4B08 A;  2KBN A;  2VS1 A;  3LNN A;  1F2Z A;  3CKI B;  1RL2 A;  3N6R A;  1PHJ A;  5FKA C;  3HOZ B;  1SAP A;  2Z1C A;  4BY7 H;  4TSS A;  4DAY B;  3S1Q H;  2B2W C;  1GUW A;  1SDF A;  1BKB A;  3HOV B;  4DR7 Q;  1LTT D;  2EOT A;  4F87 A;  3L0O A;  1L0X B;  3OIQ A;  3K58 A;  5IIF A;  1XX8 A;  1KRT A;  2F4V Q;  4GLV B;  5K36 H;  4ZUJ A;  4IPG A;  2B2T C;  3TQY A;  1PTO D;  1A2T A;  4FNF A;  3KLS A;  3DM3 A;  1ZKO A;  3BS1 A;  3MXN A;  2DNE A;  3NTK A;  1I6H H;  3GTQ B;  5LL6 X;  1PTO F;  2AKW B;  4B3S Q;  3QO2 A;  1C7Y A;  4Y52 H;  1SJH D;  2NVX B;  1A6X A;  3AFP A;  4P2C B;  4YWM A;  3OOC A;  3GP7 A;  1IBL L;  3PSI A;  5D14 A;  3TEH B;  2Z6K C;  1B9M A;  2RDH A;  1EZ8 A;  4L6T B;  2F0P A;  5COR A;  1PFN A;  3D31 A;  1PXU A;  1CKO A;  1PRT B;  1UE7 A;  1BO0 A;  4DK0 A;  3J81 i;  1G6P A;  2I5H A;  4DV4 Q;  2K75 A;  4A3L G;  3VA7 A;  4JYA L;  1X3F A;  2D62 A;  3GTJ B;  4XIG S;  1G2S A;  1A3T A;  3JC6 6;  4FVM A;  1VQ9 A;  1GO3 E;  1LAC A;  3CPF A;  5HUR A;  2F0S A;  1H9S A;  3NUC A;  3OPO A;  3KJO A;  1MJC A;  3GTK H;  4HMI A;  3K5M A;  2A6H C;  2R7Z H;  3O13 A;  1PH6 A;  2OF1 A;  3RMH A;  1SYE A;  4X3T A;  3V2T A;  1YJN A;  3CCJ A;  1PFB A;  1BQQ T;  3GDE A;  1SE2 A;  2F0H A;  1STA A;  2N8N A;  1CHP D;  1W3S A;  4Y7N B;  2K5D A;  4KKT A;  1PFM A;  3MA2 B;  1LTS D;  1PH7 A;  4C3I B;  2CW0 C;  3A55 A;  3TN2 A;  5KYL A;  2EYJ A;  4QY7 A;  2J4X A;  4DV3 Q;  1VQO A;  1I94 L;  4X64 L;  5CV6 A;  5JEA H;  3GO5 A;  1HR0 W;  3T51 B;  1GUO A;  5E3F A;  3H0G B;  1IBK Q;  4KHP Q;  2LXJ A;  3U50 C;  5FO8 B;  3H3V I;  2UXB Q;  4XQJ A;  2B63 H;  3F2C A;  2ICE C;  4A3D G;  3PUZ A;  4PZ6 A;  4U67 3;  1U9R A;  1K0R A;  2PQA A;  4YCV A;  1PH5 A;  3E9I A;  1Z47 A;  1CHQ D;  4HMJ A;  1YIJ A;  2K5N A;  2C35 B;  1LTR D;  1PDQ A;  3T56 B;  4WJ4 A;  3J7Z C;  4LFC Q;  3IKJ A;  2E2H B;  2PMZ B;  2EYM A;  3I4N G;  1O80 A;  1SXT A;  3PIP 3;  2IT1 A;  3M4O B;  1HZB A;  1EWH A;  2EQS A;  3URY A;  1M90 C;  3GTG H;  1RD9 D;  4P73 A;  3PO3 G;  2DJF C;  4XQN A;  5CBE E;  5DNF A;  4B3R L;  4EQO A;  4F88 A;  2OT2 A;  2Y0S B;  4QIW E;  2NVQ H;  2EYH A;  1TS5 A;  3I4M G;  2R93 B;  1YHA A;  4KD3 A;  5GAH C;  4APV A;  1TY0 A;  4DR4 L;  1R4Q B;  5T1I A;  2WAQ G;  1Q81 C;  4C1N I;  3BZC A;  4BY7 G;  3HG9 A;  1B3A A;  1V1P A;  4YY3 L;  5D3D A;  3PIP A;  1TS3 A;  1F9Q A;  1Q1B A;  3KF6 A;  2QEJ C;  2ASB A;  2OTJ A;  3M9B A;  3MXG A;  2JJQ A;  1A62 A;  2H4O A;  1HUN A;  1Z6H A;  4EQP A;  3S2D B;  2JA5 G;  1VF7 A;  5K36 G;  2N3S A;  2L9H A;  1OXV A;  4OO1 H;  1J6Q A;  1X6O A;  4MTK A;  3OTO L;  1JJC B;  5M5W B;  1J9O A;  3LWU A;  1CM9 A;  1GUT A;  1Q1E A;  4J6H A;  1KNE A;  4H7B A;  3WOE A;  1EIY B;  2IHF A;  5EKK A;  4DU9 A;  1FNV A;  2L4N A;  5M5X B;  1RJT A;  3SHL A;  3CCQ A;  3A5Z B;  4YCW A;  1D7Q A;  5M5Y B;  1YNJ D;  5T1G A;  4GS3 A;  1F2Y A;  1GD7 A;  1U4L A;  4X62 Q;  4IOC A;  3KYH C;  3AB9 A;  1EFI D;  2A6E C;  1EQT A;  1CA6 A;  3MEF A;  3MAQ A;  2IY5 B;  1L1O A;  1VQ8 A;  4UP8 A;  5FO7 B;  3IAY A;  1CTM A;  4WOR A;  2WB1 G;  1CQV A;  2E2J B;  1K28 A;  3B6Y A;  4LAA A;  5D3I B;  3Q22 A;  1A15 A;  4AYB G;  4MTN A;  3KBG A;  2R7Z G;  4DK6 C;  5JPM C;  2MP1 A;  1PH1 A;  2R3Z A;  1KRS A;  4NMZ A;  4LF6 Q;  1R9T H;  2QDB A;  4RH6 A;  2B2Y A;  2L15 A;  4X66 Q;  5L37 A;  1PFS A;  3ULP A;  4G7O C;  3DUZ A;  1RF2 D;  3CF5 A;  1V1Q A;  1I3Q H;  2EXD A;  4MHE A;  5C0X G;  1TY2 A;  3BVZ A;  1FJG Q;  1Q82 C;  1JJG A;  4LFA Q;  4L5T A;  2YU9 B;  1K8M A;  1SYG A;  1GUG A;  2AWO A; 
#chains in the Genus database with same CATH homology
 1H9S B;  3JAM E;  3OMC A;  3S1M B;  3ND9 A;  5JEA G;  5C3W A;  1STB A;  1GHK A;  2C9O A;  4ZKC B;  4NP5 A;  1TWH B;  2NYZ D;  1AZP A;  4Q5V A;  1F9P A;  5CGK A;  4H0L C;  4A3M B;  5C44 B;  3CRK C;  1I6V C;  3ERO A;  3MXP A;  4B9X A;  5LL6 S;  2Q8R E;  1S5E D;  5EPJ A;  3R3O A;  1PTO C;  3FVQ A;  5JOB A;  3KUP A;  1NCV A;  1RDP D;  4BWG B;  2IWH A;  1BR9 A;  4KY5 A;  1SYB A;  2JA6 B;  3OSO A;  4L63 B;  1BBX C;  1TU2 B;  3T53 B;  1O7Z A;  2LFN A;  3DMU A;  2RBM A;  2EY1 A;  4U68 A;  2E75 C;  5EBD A;  1CZG A;  3KK7 A;  1B53 A;  2AQ1 B;  1F77 A;  2NVY B;  2L1B A;  3PUY A;  5KGU A;  3CQZ B;  4XYO A;  5HGT A;  2EZV A;  3T16 A;  1ESF A;  5IGE A;  1NSN S;  5KNB A;  1SNC A;  2HUG A;  4OO1 G;  2MJ8 A;  4NDX A;  1G8Z D;  1BOS A;  1CT1 D;  5FK9 C;  1PZI D;  1YNN D;  3P7J A;  2KED A;  2ZT9 C;  2BA1 A;  2JP1 A;  1V1P B;  3K5N A;  4A3J B;  3C1E A;  1SE4 A;  1HFG A;  1I4Q A;  1D1K A;  4PMW A;  2EJG C;  1H9K A;  2B8G A;  4K2L A;  4ZK9 B;  3L7Z C;  4DFA A;  1L0Y B;  2XIW A;  1C8C A;  2CW0 D;  3S1R B;  4KK7 A;  1ILQ A;  1D2B A;  3KBX A;  4G7Z C;  3F2U A;  4EVO A;  3ERQ A;  2B2U A;  4RAU C;  2PQE A;  5C4Z A;  5M9O A;  4C3J B;  2PCF B;  1WCM B;  2PZU A;  4Z9C B;  2NBF A;  2F0T A;  1G6Z A;  3BDC A;  3HOU B;  1I4H A;  4IAL A;  3P75 A;  3HOY B;  4CKB A;  3A7L A;  4KHZ A;  3VYT A;  1EY5 A;  3K5L A;  2K5Q A;  1CI3 M;  4N9P A;  4A3E B;  4X3S A;  1FGB D;  4PMC A;  3NXW A;  2IX3 A;  2PYK A;  1O78 A;  5EPK A;  5M3F B;  5I9P A;  2A74 C;  2SEB D;  4BBR B;  4A3K B;  3D4W A;  2F03 A;  2K28 A;  3S15 B;  2O5I C;  2AQ2 B;  2X6G A;  2F0G A;  2TSS A;  1Z7T A;  4BBS B;  1E2W A;  5E4X A;  2IX0 A;  3LX0 A;  1IKL A;  2Z4I A;  1UEA B;  1YNJ C;  3PUX A;  1O7Y A;  4IUR A;  1EEF D;  4X3U A;  1STY A;  4OIJ A;  4KD4 A;  3FDT A;  2SNM A;  4K6L A;  3C1F A;  3M85 A;  1TWG B;  1BDO A;  2BCO A;  2HQE A;  5C4J B;  2MGS A;  1LTG D;  3Q0A A;  3U9O A;  1M4V A;  1F2L A;  1BCP F;  5BN3 A;  3SVM A;  1IHZ A;  3V05 A;  2NB0 A;  3R93 A;  3NTI A;  3JAM L;  3I3C A;  1DON A;  3VYS A;  4ZLT F;  3AMU A;  2LMC B;  2HCC A;  2B2T A;  5ELD A;  4JK1 C;  3VYR A;  1WTV A;  1F2M A;  4XDX A;  1KAA A;  2L0C A;  2J7Z A;  3NQI A;  5I6Y A;  1HXY D;  3HEJ A;  2N55 A;  1LT6 D;  3RD4 A;  1JE4 A;  5FOB B;  1Y1W B;  1JR0 D;  2HDM A;  3C2P A;  1T5X D;  2K5W A;  2NN6 H;  4OIK A;  2F3V A;  4G7H C;  2EYO A;  4L8J A;  4OL7 A;  3D6C A;  1G2T A;  3VR2 A;  4R9W A;  4RGM A;  2GA4 B;  3WOF A;  5KRU A;  1SFO B;  2EPB A;  1I4R A;  4OO1 I;  1J8I A;  5J39 A;  1BXT A;  1MD2 D;  1QOH A;  5KEE A;  4FO2 A;  4KKU A;  5BN5 A;  1FR3 A;  2M00 A;  3J80 E;  1E0B A;  3QOL A;  2WKD A;  2K1B A;  3GTM B;  3TSS A;  4MN3 A;  3EQL C;  5IOD A;  1JCK B;  2F0L A;  2EYF A;  4CJ1 B;  1C4Q A;  1ICW A;  1C48 A;  3S9W A;  2D2C C;  3HGB A;  3H94 A;  1H9J A;  2RDF A;  1QNK A;  2H1E A;  2OXP A;  4KN4 C;  3I70 A;  1OO9 B;  2L55 A;  1STG A;  3PUW A;  4XTC S;  5IGF A;  2A68 C;  2WII B;  3BVM A;  1G91 A;  2EYP A;  1TS4 A;  4WRD A;  1I4G A;  2R61 A;  2IL8 A;  4ODG A;  4UDU C;  1YNN C;  2NVT B;  2PZW A;  2QCP X;  4KTA A;  5C3E B;  2WIN B;  4C3H G;  1Q8I A;  4FXD A;  1TS2 A;  1ZEQ X;  1B4O A;  3VR5 A;  4IUU A;  2XRQ D;  2DY7 A;  2VXW A;  5C5L A;  2JYO A;  5CR3 A;  3C3L A;  4GZY C;  2IJ0 A;  1S5C D;  4QIW B;  4EQN A;  4TQU S;  5J1Z A;  2ID0 A;  4RGT A;  4A93 B;  3RZD B;  3C46 A;  3X3N A;  2K03 A;  3DWP A;  4RHS A;  3X3M A;  3M7N A;  1GOZ A;  2DN8 A;  5I4D A;  1TT2 A;  3WDN A;  2F0J A;  4KY6 A;  1CZW A;  1EOT A;  3E6Z X;  3SE0 A;  1DOM A;  1I50 B;  1TR5 A;  5A2Q E;  4PNY A;  5ELC A;  1RTN A;  2JEB I;  4A3I B;  3D6W A;  5G3L D;  3PIO 3;  4FF3 A;  4IFD J;  1SBB B;  1HQM C;  5C5M A;  5G3L F;  1IW7 D;  4RKL A;  1HCZ A;  3H3V C;  4K8I A;  1AEX A;  4N9T A;  3NWT A;  3IFT A;  1SNM A;  2NN6 G;  2KCC A;  2JA8 B;  5FLX E;  4O1N A;  5AFW A;  1QIL A;  4I65 A;  1CA5 A;  3EFX D;  5EKL A;  2KEE A;  2A69 D;  5DEH A;  5EKI A;  3KLS X;  3D4R A;  3M4Y A;  1SYF A;  1KTK A;  3P1H A;  2BDO A;  4HAE A;  4HSV A;  3SK5 A;  5M3M B;  2MHV A;  1IYU A;  1MSH A;  1TKW B;  1ET6 A;  1S5B D;  3J7Y W;  1BF4 A;  1EU3 A;  1PMR A;  1PLF A;  2HDL A;  1EU4 A;  2G9D A;  4A3B B;  2RDG A;  3NSW A;  3PMF A;  3GTO B;  4CHT B;  2IX1 A;  5LHY 1;  3BZD B;  4K5V A;  1HFN A;  2FIN B;  2RKS A;  2PPB C;  4ZRZ A;  3D8G A;  3MFY A;  1DOL A;  4A3F B;  3MXU A;  3DM1 A;  1F9S A;  1V43 A;  1FNW A;  5JPN C;  4X3K A;  5IT9 E;  1WVL A;  2E76 C;  3OMG A;  1IYV A;  1ILP A;  1SYD A;  2SOB A;  2VUM B;  3DWA A;  1EWC A;  3ZYY X;  1XYI A;  1D1I A;  1BUV T;  4RHR A;  4BS9 A;  2IPK D;  1XWE A;  1EIG A;  2RA4 A;  3DWQ A;  3MHB A;  1S4Z A;  3J7A F;  1II3 A;  3J80 L;  3E5S A;  4IQZ A;  4RKB A;  4QMG A;  4FYD A;  5CV5 A;  4ZAI A;  1VDZ A;  2BE5 D;  1SNP A;  4C3I G;  2NTT A;  3RZO B;  1QG7 A;  4FXG C;  1EYD A;  2LS0 1;  2ZXP A;  1EY0 A;  4HR7 B;  4C2M B;  1BNZ A;  3GTL B;  3ITP A;  1JWM D;  1Q90 A;  2MUY A;  3J7A V;  5ELB A;  1K83 B;  2F0N A;  1ESR A;  1DXM A;  3DEP A;  1HQR D;  1XXG A;  1V1O A;  3HOW B;  1HHV A;  1DZ1 A;  4XT3 B;  1ENF A;  1JOR A;  4HTH A;  1S5F D;  1HRJ A;  5I2X A;  3EVQ A;  1TWA B;  1NR4 A;  1FD7 D;  2O4X A;  3R2I A;  1KLU D;  1LLR D;  4BY1 B;  4K6D A;  3I8Z A;  3OIP A;  4TKO B;  2A68 D;  1F9R A;  2K04 A;  2L11 A;  3AU7 A;  3VR3 A;  1LT5 D;  1SE3 A;  3MZ5 A;  4XT1 B;  3K59 A;  5CYU A;  3ND8 A;  3A54 A;  2F3W A;  1H9M A;  3SR1 A;  3CRL C;  4RCO A;  3D4D A;  1D5M C;  2EJF C;  4K5X A;  4CKC A;  4DGZ A;  2K32 A;  4K14 A;  1OXS C;  3PUV A;  4ZYS A;  2JA7 B;  1ML0 D;  4NW2 A;  5A2Q L;  5CBA E;  2NN6 I;  4DNR B;  1CFM A;  2PZT A;  1KDC A;  1IL8 A;  5EQ0 A;  3HRZ C;  4UAI A;  1Y8O B;  2VB2 X;  4R8I A;  1RTO A;  2NTS A;  5C3X A;  1RKN A;  2NUC A;  1HA5 A;  3M7G A;  1VCI A;  1WTO A;  1MSG A;  3H6M A;  1SYC A;  3G7L A;  1IW7 C;  1NAP A;  4DNT B;  5FLX L;  3SXH A;  4MIU A;  3GV3 A;  5JVH 3;  1ET9 A;  1NUC A;  2XSC A;  1TWC B;  3NTH A;  2KJX A;  2LY7 A;  2Q8I B;  1I4P A;  5DAU A;  2X6L A;  2PO4 A;  4JBW A;  2XN9 C;  1Y69 U;  1LT4 D;  4R8N A;  4IUQ A;  1PTO B;  1DM0 B;  3A8K E;  1VMP A;  4J8Q A;  4ME5 A;  3SDZ A;  3OWE B;  3RLF A;  2A69 C;  2JEA I;  4DN4 M;  2YYZ A;  1LTI D;  2Z8L A;  1QB5 D;  3MWY W;  4K8J A;  1PTO H;  5ELF A;  4NKL A;  1CQF A;  2E74 C;  2L5T A;  3S2H B;  3NHH A;  3Q24 A;  5COY A;  2KUM A;  3H91 A;  5ISR A;  4PMB A;  3M3Y B;  2G9H D;  3S17 B;  4FXK C;  4RCN A;  2B8F A;  2SDF A;  2F0V A;  1UAP A;  1AW7 A;  4DA2 A;  1SND A;  2M2L A;  2EDG A;  2C5C A;  4ZKB B;  1SEB D;  2BA0 A;  2CHB D;  5IT9 L;  3T4A C;  1HA6 A;  5ELE A;  1BCP D;  3QG1 A;  5I9O A;  2KCN A;  1XTC D;  3BYT B;  4A3D B;  3QIA A;  1KAB A;  1TQO A;  1B2T A;  3TZU A;  4ULL A;  2EY5 A;  4H13 C;  3TP6 A;  2VNU D;  2WAC A;  3I4N B;  2FFK B;  1ROD A;  2ZXR A;  2I46 A;  2F0U A;  3K7A B;  4IN3 A;  3PO3 B;  1ENC A;  3MC0 B;  1STN A;  1Q3L A;  5EJW A;  3A8J E;  3QJY A;  4KKS A;  1KDB A;  3I4M B;  2F0K A;  5IGG A;  4CGY B;  3D3R A;  1EZ6 A;  4S3S A;  4M1U B;  1DJR D;  2AWO A;  2WAQ B;  4WJW A;  4BY7 B;  1RHP A;  2SNS A;  4K5W A;  2BE5 C;  2AUJ D;  3W2D A;  3A7A B;  3GQB A;  2XWB B;  2DNC A;  1M8A A;  2QKI C;  1PYW D;  4DAP A;  1E2Z A;  4KJO A;  2JA5 B;  5D65 A;  4F7X A;  2A5H A;  3EJI A;  4KV6 A;  2N88 A;  3NP8 A;  2PW7 A;  3V96 A;  4IUV A;  2RVL A;  1DD2 A;  5KNC A;  1I6H B;  1SMY D;  4WFN 3;  3NPP A;  4LK1 C;  4IFD H;  3E0J A;  4C3J G;  2F0E A;  4KHV A;  1JOQ A;  4QF4 A;  4RGN A;  1PZK D;  2R6G A;  3SK4 A;  2AWN A;  3SK6 A;  3KLR A;  5A35 A;  1EL0 A;  1G29 1;  2WB1 B;  3EA6 A;  1HTP A;  1LTB D;  3I73 A;  3MEH A;  3GTK B;  4QUF A;  4AYB B;  3VR4 A;  2R7Z B;  5JAV A;  2WP8 J;  1VMC A;  2EY6 A;  2AQ3 B;  1WD0 A;  3MVV A;  1MBY A;  1STE A;  4CJ0 B;  2RSO A;  5J22 A;  2LKV A;  4HSP A;  2D5D A;  2EXZ A;  3FPU B;  1CK1 A;  5CV9 A;  3J81 L;  1LAB A;  2KQ3 A;  4IUP A;  4V19 0;  1EIH A;  3TME A;  3K6O A;  1ZYR D;  1LTA D;  1JB3 A;  3NQT A;  3GD7 A;  2F0I A;  2ICI A;  4RFB A;  4ABN A;  5DM6 3;  1X32 A;  4FF2 A;  4FF4 A;  3MFG A;  1U4R A;  2B63 B;  4HCE A;  1AP0 A;  2BOS A;  1SNQ A;  5C0X H;  2TMP A;  1HUM A;  2V4D A;  3U9S A;  1KLG D;  5DM7 3;  2F0Q A;  2WKC A;  3L9A X;  5CV7 A;  2KVM A;  4LMQ D;  3FRP B;  2BDN A;  2KOL A;  2O2L D;  3T13 A;  2EYL A;  1X3Q A;  2FJ2 A;  3GTG B;  1D6E C;  3N52 A;  2B39 A;  5CV8 A;  4YIJ A;  2NVQ B;  3TDQ A;  1AZQ A;  2FMC A;  2ENB A;  3HKZ B;  3S16 B;  3NBI A;  1ONL A;  1QWY A;  4BA2 I;  1GJX A;  1T5E A;  4IUT A;  3A56 A;  2K05 A;  2ZXO A;  2K33 A;  2L12 A;  3VYU A;  1A3U A;  5KYI A;  4CBV A;  3NBH A;  1OXT A;  1DYQ A;  3G6J B;  1AFP A;  1W6K A;  2KEC A;  3VA5 A;  4K2K A;  5IOC A;  5F2D A;  3OWF A;  1U4M A;  1R4P B;  3DEO A;  5JVG 3;  4QCL A;  4IFD G;  1FYC A;  4KN7 C;  3SEB A;  2VB3 X;  1IKM A;  5C0X J;  4DK1 A;  5KND A;  4KMU C;  1EYC A;  1NR2 A;  3ONA B;  1E2V A;  1ZXT A;  1BCP C;  2RQX A;  2D9U A;  1A2U A;  1ENA A;  4RWS C;  4CJ2 C;  5JEA J;  1PRT D;  3BDL A;  4B9W A;  1V8Q A;  4XXE A;  5KIX A;  1EY8 A;  1U4P A;  1RCV D;  1PRT F;  1R9T B;  1HPC A;  3GV6 A;  5IGB A;  3BVG A;  3TZD A;  1A3V A;  1B1Z A;  1I3Q B;  5E1F A;  1STH A;  1UUP A;  3K5O A;  1H9R A;  4IZ8 A;  1HTL D;  3FKI B;  4DXG A;  4ZQ3 A;  1I4X A;  4ZUI A;  1WTQ A;  1KDA A;  3NE5 B;  1W6J A;  2DY8 A;  2NWG A;  1Y8P B;  1LV9 A;  3HZX A;  1AN8 A;  4Q0F A;  1OXU A;  3IL8 A;  3OHX C;  1OXX K;  1JOK A;  4F8M A;  5EGT A;  3IFD A;  3UI2 A;  3BG3 A;  4M8A A;  3QWN A;  2XVS A;  1VF5 C;  2XRS D;  1SMY C;  1MGS A;  5NUC A;  4TRD A;  2XNA C;  3NK9 A;  3BYY B;  5BN4 A;  2K7V A;  2EVB A;  3R8B A;  1D5Z C;  4HN7 A;  2EJM A;  4BA1 I;  3I90 A;  3K57 A;  1EY6 A;  2IW3 A;  2EE1 A;  2B2Y C;  1B44 D;  3K0Y A;  2K01 A;  2KHS A;  2F1M A;  3HOX B;  3TP7 A;  2PNR C;  4LJZ C;  3FEW X;  1SSO A;  1JOO A;  2E2I B;  2F0F A;  1GXD C;  4HED A;  4C56 C;  5CV4 A;  2JSO A;  3DXJ C;  1BCP B;  3CU7 A;  3TBI B;  3P20 A;  4QB4 A;  5C6A A;  3TP5 A;  1D5X C;  4CKE A;  3SK8 A;  2R92 B;  1MI2 A;  1TVX A;  4OHJ A;  1GUN A;  4KI0 A;  3FMC A;  4ID6 A;  1ZYR C;  2A73 B;  2X69 A;  3BDO A;  4O42 A;  2K6A A;  1PZJ D;  1FNU A;  2A6H D;  3NWS A;  2FMM A;  2JE6 I;  3OW7 A;  3CHB D;  1EY4 A;  4PV1 C;  2MPM A;  3Q23 A;  4ILW A;  5EBC A;  4XYQ A;  4DAY A;  2WV6 D;  3Q6S A;  2J0T D;  1LO5 D;  2Q8T A;  2F0M A;  3J81 E;  4QUC A;  1QCB D;  4KY7 A;  2OEO A;  4DF7 A;  3R2T A;  1JWU D;  1EYA A;  1KNA A;  2O5J C;  3RUZ A;  1K8O A;  2RSN A;  5I2Y A;  4E6I A;  1UNS A;  1QE6 A;  3W3A A;  2HCI A;  4V0B A;  1Q12 A;  2F0W A;  1TWF B;  4IFD I;  5E4W C;  3I4L A;  4FP5 D;  3LWE A;  5IGC A;  3S1N B;  1O7L A;  5CC4 A;  3QOJ A;  2I07 B;  4OGQ C;  1B50 A;  4IUN A;  3S14 B;  1X3P A;  3MTS A;  3HS0 C;  1JQY D;  4PQX A;  5I6W A;  4I7Z C;  1EQV A;  2F4I A;  2PW5 A;  3PV0 A;  1SJE D;  1WTP A;  1WD1 A;  4C3H B;  4RGO S;  3DHQ A;  1TII D;  2B2U C;  4EGV A;  1Y1V B;  3HP3 A;  5CMD A;  1SNO A;  1DCZ A;  1GUS A;  3KF8 A;  1S5D D;  5K5P A;  2QF7 A;  2CVR A;  1GHJ A;  1QNU A;  4G4K A;  2AUK A;  2FHT A;  2F0D A;  4XQQ A;  5FO9 B;  3PO2 B;  4HCS A;  5C0X I;  1PRT C;  4FF1 A;  2CQA A;  2JXM B;  3I72 A;  3H09 A;  5IGD A;  4DAV A;  3FPP A;  2B2V A;  4J1M A;  1DOK A;  3GTP B;  3I91 A;  1WTR A;  2EY2 A;  2A6E D;  4G57 A;  1EY9 A;  5TSS A;  1EY7 A;  2B2W A;  3VR6 A;  1JWS D;  2NZ1 D;  2M9V A;  4H44 C;  5EPL A;  5C4X B;  2KA7 A;  4DXF A;  1WTW A;  3L3O C;  3QB3 A;  2Z4H A;  2E2D C;  2QIL A;  4C1N K;  1Y8N B;  1WTX A;  2XWJ B;  4RA8 A;  1JC7 A;  3S1Q B;  5C4H A;  3TP8 A;  4A3G B;  5JJZ A;  1B9N A;  2B2V C;  2F0O A;  1EEI D;  1QJO A;  1LT3 D;  1JIC A;  3A8I E;  4B08 A;  3LNN A;  1F2Z A;  3CKI B;  3N6R A;  5FKA C;  3HOZ B;  1SAP A;  2Z1C A;  4TSS A;  2B2W C;  1GUW A;  1SDF A;  3HOV B;  1LTT D;  2EOT A;  4F87 A;  1L0X B;  3OIQ A;  3K58 A;  5IIF A;  1XX8 A;  5K36 H;  4ZUJ A;  2B2T C;  1PTO D;  1A2T A;  4FNF A;  3KLS A;  1ZKO A;  3BS1 A;  3MXN A;  2DNE A;  3NTK A;  3GTQ B;  5LL6 X;  1PTO F;  3QO2 A;  1SJH D;  2NVX B;  1A6X A;  4P2C B;  3OOC A;  3GP7 A;  5D14 A;  1B9M A;  2RDH A;  1EZ8 A;  4L6T B;  2F0P A;  5COR A;  1PFN A;  3D31 A;  1PXU A;  1PRT B;  1BO0 A;  4DK0 A;  3VA7 A;  2D62 A;  3GTJ B;  4XIG S;  1G2S A;  1A3T A;  4FVM A;  1LAC A;  5HUR A;  2F0S A;  1H9S A;  3NUC A;  3OPO A;  4HMI A;  3K5M A;  2A6H C;  3O13 A;  2OF1 A;  3RMH A;  1SYE A;  4X3T A;  3V2T A;  1PFB A;  1BQQ T;  1SE2 A;  2F0H A;  1STA A;  1CHP D;  4Y7N B;  2K5D A;  4KKT A;  1PFM A;  3MA2 B;  1LTS D;  4C3I B;  2CW0 C;  3A55 A;  3TN2 A;  5KYL A;  2EYJ A;  2J4X A;  5CV6 A;  5JEA H;  3GO5 A;  3T51 B;  1GUO A;  5E3F A;  3H0G B;  5FO8 B;  4XQJ A;  2ICE C;  3PUZ A;  4U67 3;  1U9R A;  1Z47 A;  1CHQ D;  4HMJ A;  3T56 B;  1LTR D;  1PDQ A;  3IKJ A;  2E2H B;  2PMZ B;  2EYM A;  1O80 A;  1SXT A;  3PIP 3;  2IT1 A;  3M4O B;  1EWH A;  3URY A;  1RD9 D;  4XQN A;  5CBE E;  5DNF A;  4EQO A;  4F88 A;  2OT2 A;  2Y0S B;  2EYH A;  1TS5 A;  2R93 B;  4KD3 A;  1TY0 A;  1R4Q B;  5T1I A;  4C1N I;  3HG9 A;  1B3A A;  1V1P A;  5D3D A;  1TS3 A;  1F9Q A;  1Q1B A;  2QEJ C;  3MXG A;  2H4O A;  1HUN A;  1Z6H A;  4EQP A;  3S2D B;  1VF7 A;  5K36 G;  2L9H A;  1OXV A;  4OO1 H;  5M5W B;  1J9O A;  3LWU A;  1CM9 A;  1GUT A;  1Q1E A;  4J6H A;  1KNE A;  4H7B A;  3WOE A;  5EKK A;  4DU9 A;  1FNV A;  2L4N A;  5M5X B;  1RJT A;  3SHL A;  5M5Y B;  1YNJ D;  5T1G A;  1F2Y A;  1U4L A;  3AB9 A;  1EFI D;  2A6E C;  1EQT A;  1CA6 A;  3MAQ A;  5FO7 B;  3IAY A;  1CTM A;  4WOR A;  1CQV A;  2E2J B;  4LAA A;  5D3I B;  3Q22 A;  1A15 A;  3KBG A;  5JPM C;  2MP1 A;  2R3Z A;  4NMZ A;  2QDB A;  4RH6 A;  2B2Y A;  4G7O C;  3DUZ A;  1RF2 D;  4MHE A;  5C0X G;  1TY2 A;  3BVZ A;  2YU9 B;  1K8M A;  1SYG A;  1GUG A;  4KJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...