4Z9CB

Ecpltab oxidized
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
115
structure length
115
Chain Sequence
ADYDKYFSNVQINNLSYGVYTSGGKESQFFCIGIKRDNVTLPIHNMCKVDVFGSHKQGFDAMMEMAKYYYATGESIRVYYKENVWSDSEFKKAFSTNELISLSTCSSSDYCMGPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function analyses of a pertussis-like toxin from pathogenic Escherichia coli reveal a distinct mechanism of inhibition of trimeric G proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Pertussis toxin-like subunit ArtA
total genus 26
structure length 115
sequence length 115
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2015-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4z9cB00
4DXFA 1CHPD 1BCPB 1PYWD 1JWUD 1SJHD 5ELCA 3EFXD 1RF2D 1XTCD 5I4DA 1JR0D 1EEFD 1SBBB 1LO5D 3MFGA 3DWPA 1B1ZA 1BXTA 1I4QA 1FNVA 1PTOF 1LTBD 1EFID 4Z9CB 1JWSD 1CQVA 1LLRD 5TSSA 1ET9A 1JCKB 1HA5A 1S5BD 1AN8A 2XRQD 3R8BA 3BVMA 4C56C 1HXYD 3URYA 2O2LD 1S5CD 4RHRA 1SE3A 1FNUA 1I4XA 3BYYB 1PRTC 2WV6D 2XRSD 2AQ2B 1FGBD 5D3DA 1L0XB 1RDPD 5ELEA 2AQ1B 1TS2A 4RGTA 2ICIA 3O13A 4UDUC 4DXGA 2RDGA 1LTTD 1HQRD 3OWEB 1TY0A 1D5ZC 1M4VA 1S5FD 2IPKD 1GOZA 1I4GA 1STEA 2J4XA 1D5XC 2SEBD 1L0YB 1PRTF 1CT1D 2AQ3B 4OHJA 1V1PB 1RCVD 4RH6A 4TSSA 1TS3A 5ELBA 1JWMD 1XXGA 1PTOD 4L63B 1SE2A 1DYQA 3V05A 2XNAC 1V1OA 5FKAC 1D5MC 1LTRD 4RHSA 4BWGB 3SEBA 1LTSD 1LT4D 1CK1A 2XN9C 1UNSA 3BYTB 5FK9C 4ZYSA 1BCPC 3TSSA 5ELFA 1EU4A 3BVZA 1PTOB 4RGOS 3BVGA 1DJRD 1ET6A 1KLGD 2G9HD 3BZDB 1PTOH 1FNWA 3R2IA 1KTKA 1BCPF 1LT6D 1PZJD 1JQYD 1PRTD 1PZKD 4RGMA 1LT3D 1EWCA 3W2DA 2QEJC 3DWAA 2NTTA 5D3IB 3KLSX 1G8ZD 1B44D 1TY2A 1V1PA 4RFBA 1TS5A 2NTSA 1D6EC 1ESFA 1SJED 3R2TA 4L6TB 1LT5D 1PZID 1QILA 2IJ0A 2Z8LA 1PRTB 4K6LA 1I4HA 2RDHA 1RD9D 1EU3A 1CHQD 1AW7A 1LTID 1I4PA 1LTGD 1BCPD 1FD7D 2TSSA 1SEBD 4O1NA 1TS4A 2CHBD 1UUPA 3DWQA 3EA6A 1S5DD 1MD2D 1I4RA 3MC0B 4RGNA 1F77A 2QILA 1SXTA 2R61A 4RCOA 1EEID 1HTLD 1S5ED 3CHBD 1KLUD 5ELDA 3GP7A 1T5XD 1LTAD 1SE4A 1PTOC 1ENFA
chains in the Genus database with same CATH superfamily
2F0GA 1PYWD 1J9OA 2K1BA 4JW0A 1CA6A 4BY7B 4A3EG 3KLSA 4JI5Q 1CTMA 1D1KA 2R3ZA 5E4WC 3QR8A 3GTMB 1KIXA 3CD6A 1MI2A 1A8VA 3CXCA 2BH8A 4DU9A 2BE5C 5TSSA 5JVG3 3Q23A 2WB1E 2F0UA 2JP1A 5IT9E 4B9XA 1QJOA 2NYZD 3A0JA 4ZKBB 3H0GB 4CKBA 5JPMC 3CQZH 1NJIC 5LHY1 3GTMH 1I4XA 4JCVE 4QB4A 1VQCA 1RDPD 3RN5A 1Y1VG 3F2UA 3HEJA 3ERQA 5GADC 1DCZA 1YZ6A 3PO3H 1STEA 1JJGA 1JOKA 2BA0A 2QKIC 3GTPH 2EYHA 4TSSA 4LFCQ 1JB7A 2G5DA 3A5UA 3V05A 5E4XA 3W5OA 3NUCA 5C3EG 1O7IA 5FKAC 2F0SA 4JI0L 1UEBA 2QDLA 1K3RA 4GNXC 3H91A 2L12A 1HHVA 1TR5A 5DEHA 1EU4A 3A56A 1PTOB 2OTJA 1C48A 2RCNA 4RGOS 4QCLA 1GUGA 1Y1WB 1KLGD 3BZDB 2JJQA 1SMYD 4HMJA 1W3SA 4IJLA 1KD1C 1KTKA 5JEAJ 5IYDH 2L0CA 2JA8B 2F0TA 4RGMA 4UAIA 1G291 4WRDA 1K83H 4JI1Q 3VYRA 5IGBA 5I9PA 4ZUIA 1I50B 1JORA 4LFAQ 5C3XA 4DV7Q 2A6HC 5I2YA 4DR2L 2V4DA 1R9TB 1BNZA 2JEAI 4IN3A 1XJVA 4OWWB 1GHJA 5KNDA 1N32L 1STNA 2R93G 3HOYB 3DWQA 2C9OA 4YCWA 3RZDH 2UXBL 3MC0B 4DV6Q 3BG3A 4JI0Q 2NVQB 3EQLC 1I6HB 4DAMA 2Q2UA 4F8MA 1XNRQ 1ENFA 1C4QA 5FLXL 1PA6A 3GDEA 1VF7A 3A54A 1B9MA 2VS1A 1VQEA 1VQOA 3NEMA 2X69A 4LNQA 2JK8A 4FF2A 2B2WA 1LLRD 2E2IH 4BBRB 1ILPA 3PIOA 4G7OC 3M4PA 3JAME 4HJ7A 3CCLA 4O2DA 5M3MB 2XRQD 3HOWB 1WCMH 3J80i 5J22A 4KI0A 4A3BG 3BYYB 1OTCA 2ASBA 1HR0L 3AFQA 3NP8A 4ZAIA 3RZOB 1STAA 2R93B 2GVBA 3M4YA 3CCUA 1M4VA 4J1MA 2UU9L 2HHHQ 1EYDA 4JI2Q 1TKWB 3IFDA 2DY8A 1IHZA 3RZDB 1SYFA 3E0EA 1PTOD 3OHXC 3NTIA 4B9WA 2Q2TA 4L5SA 2R7ZH 1YVCA 3NWSA 4MHEA 4U68A 4PG3A 4OEMB 1EY8A 3MFYA 1VQGA 4CDCC 4OO1H 1I5FA 1PV4A 2VXWA 3H15A 1F9PA 2CWAA 2H5XA 3UDIA 5IOCA 2UU9Q 3GTKB 4BY1B 1QG7A 5M5YB 4EQ5A 5M5XB 4QGUA 4OXPA 3U58A 4LF6Q 5M3MG 5E7NA 2ATWA 1KHIA 1Q8KA 3GD7A 1BO0A 5FLXE 4A3IB 1SYEA 3R2IA 1X55A 4A3JH 2IHFA 3A7AB 3KF8B 4FF4A 5EPKA 4DF7A 4HIKA 1FJGQ 4K5WA 2IHEA 3KLSX 2XIWA 1UE5A 1J8IA 3P75A 4DUZQ 5CV9A 3HGBA 4QIWE 1EYGA 2NZHA 1TS5A 1L1OA 1EIHA 1DOLA 1JMCA 3R2TA 3DMUA 2Z8LA 3J81i 5IY0A 3A5ZB 2RDHA 4ABNA 2FMCA 4K8JA 1IZ6A 1X3GA 4C3IH 1Q46A 4RGNA 5JAVA 3Q24A 3J81L 2F0QA 2ID0A 4RCOA 3PCOB 4KKUA 4PZ7A 5DM63 3OIQA 1VQ7A 4DAYB 3H09A 5JEAH 1LTAD 5FJ8G 3LX0A 4MN3A 1WFQA 3GV6A 4A3CG 1SJHD 2D2CC 5AJ3L 1VMPA 4XQNA 4GOPA 3X3NA 1ENCA 2FHTA 2LXJA 2EE1A 1EFID 4LUVA 2A74C 2KHSA 3F2BA 4X64Q 3J7AF 3PQIA 2ZT9C 1YNNC 2EYLA 3S1MH 4ULLA 1GUSA 5EKLA 4H0LC 1EZ8A 1HZBA 4F88A 4FF3A 1N36Q 2R7DA 1SNMA 1HQRD 1VQKA 1Y1VB 2QF7A 3KDFB 2DJFC 5C4ZA 2EQSA 3PO3B 2G9DA 3LWUA 4XIGS 4C1NI 1LUZA 2PQAB 3K6OA 4IPHA 2PCFB 1IYVA 1QUQA 3IL8A 3NBHB 1A15A 3OW2A 3H0GH 4AQYL 1GM5A 2N55A 2K50A 3FHWA 3L7ZC 5ELFA 1VQ6A 3HOYH 3A8IE 3HOUH 1DOMA 4DV0L 2K03A 4JOIA 4CDDC 1MSGA 1IW7C 5GAEC 1E1TA 2JYOA 4Y52H 3GTPB 3M4OB 2E2HB 2MO1A 3ULPA 4RFBA 4MZ9A 3G6EA 5T1IA 1JT8A 4IOCA 2NZOA 4B3MQ 5HGTA 4DR5L 3T13A 2A6ED 1HNZL 1PMRA 1RD9D 3PSIA 4C3HH 1A6XA 5LMNQ 3I4LA 1ZYRD 4IQZA 3OMGA 2B2VA 2F0DA 3EROA 4R8IA 2PMZB 1F77A 4KN7C 3K58A 5IT9L 1C7YA 1BF4A 1PVOA 4O42A 2WACA 4KJNA 3OYYA 3P20A 1HJPA 4ZK9B 4DNIA 2VQFQ 4JI4Q 2L15A 3GQBA 4L5RC 4GN4B 1Q1BA 1X9NA 4C3IG 4RCNA 1U4LA 1EWHA 4A93B 3F1ZA 4MTKA 1D2BA 1ASYA 2K05A 5AJ3Q 4IFDJ 3U4VA 4AYBB 4GN3B 3UE0A 4KHZA 2H1EA 2NVXB 1B7YB 4DV5L 1NR2A 4A3EB 1FYCA 4BBRG 3TZUA 1NSNS 2M2LA 1MJCA 2VZAA 1V1QA 2VUMG 1FNUA 4KHPL 4QQBX 1PRTC 5D65A 4QUCA 4NP5A 5IWAQ 1WJJA 4LF7L 3JC66 2PW7A 1N8RC 5KNBA 1D5ZC 2O5JC 3U4ZA 5LMNL 2R92B 4LF5L 1L0YB 1WD1A 5C4JH 4JBJA 1E2WA 4OHJA 4PNYA 5DAUA 1Q3LA 4OO1G 1P8LA 4H7BA 1PH7A 2WINB 1XYIA 1QNUA 2R92H 3D3RA 4KY5A 1HA6A 4BWGB 5M3MH 1HR0W 4IUTA 1CK1A 2XSCA 5EPJA 1W2BA 2A1AA 3LNNA 4GZYC 3PUWA 1XNQQ 1A3TA 1ET6A 1A2TA 4DR6L 2OQ0A 1DD2A 2F0NA 4UPAA 2A69D 3Q22A 4ME3A 4P73A 1I94Q 4AYBG 3CCSA 1Z6HA 4N8X1 1WCMG 4DUZL 2QEJC 4A3JB 2PYKA 3HOXH 3A74A 4X65L 1K8AC 2PQAA 2H4OA 4AYBE 2JA7B 3G7LA 1VQMA 3HKZB 3VYTA 1T9HA 4K6LA 4C3IB 5COYA 1I94L 2HD3A 2BH2A 5I6YA 1F2YA 2OQKA 1TIID 3MXNA 2ZM6Q 3QJYA 2HDMA 3SXHA 3S1MB 2R92G 2RHQB 3FDTA 2JN4A 2B2YA 2YU9H 3OPOA 2R61A 3H6MA 4J8QA 4YCUA 2ZTDA 5FO7B 4DUYL 2IY5B 3F2DA 1RODA 1C9OA 2BOSA 2JA6B 4CJ2C 3PO3G 3GTLH 4WJ4A 3TREA 4B3RQ 2ZM6L 1L0WA 1Y69U 3T56B 4RWSC 4UY8C 2MQHA 1JC7A 1SE8A 1HNWL 3HOVH 3S15H 1PH1A 4LF8Q 3CCRA 3C46A 2KJXA 4G7ZC 5KYIA 1I3QB 5ELNA 4JI1L 4C2MB 1XNRL 3HOZB 1HA5A 2RSNA 1SLJA 1AN8A 1R4QB 2Z6KA 2UXBQ 5IYDG 1PFSA 1VQNA 3R93A 1L0XB 3S1QB 4E6IA 4V190 3I56A 3ULLA 1TY0A 2IL8A 3PUVA 1GHKA 4R8NA 2D5DA 3GTOB 5GAHC 4ZUJA 2I5MX 4IFDI 2DNCA 3NXWA 1D7QA 3SR1A 1ONLA 1GUNA 2RSOA 1SDFA 1NBWA 1PFMA 3MXNB 5EBDA 2NVTB 3HOUB 3F2CA 5JJIA 4BY7H 5IYCH 3TSSA 2F1MA 4OIKA 3CCMA 2HUGA 5KEEA 3BS1A 4G4KA 4IJHA 1AE3A 2HIVA 4XTCS 2R7ZG 3HKZG 3Q8DA 4DR1L 1K8OA 3NTKA 2L9HA 3K7UC 1E0BA 3OWFA 2EY1A 4OO1I 2CW0C 2JEBI 3PMFA 1IBML 1HZCA 3J81E 2UXCQ 3PIP3 5IP7H 2SNMA 4KY6A 1V1PA 1CI3M 1U0LA 2JA8G 2E2JB 4DR5Q 1OXVA 2F3IA 3FKIH 4A4IA 1E24A 3AEVA 1DONA 2MNAA 4DR4L 1Q90A 3DEPA 2KEEA 1F2MA 2OF1A 5AFWA 5IP9H 5CR3A 1LTGD 3DHQA 1HZ9A 2PMZE 1VDZA 5CYUA 4LF6L 3V2TA 3I4OA 2RF4A 4JBWA 1JE4A 2P5ZX 2R6GA 4FXDA 4HN7A 1K8MA 2CQOA 5CV7A 1A63A 1JWUD 1O80A 3AFPA 3NQTA 1EQRA 5K36G 1JR0D 3PO2H 1RKNA 3ND8A 2L1BA 3I8ZA 1EQQA 2GN5A 1BXTA 2K7VA 3NWTA 1Y1WH 2B39A 2K5DA 4A3MG 1STYA 5IP7G 4XYOA 2ZXPA 3RZOH 2R93H 5ISRA 4G7HC 1ET9A 1J5EQ 2E5LQ 3KF8A 2JE6I 3I7FA 2Q2HA 1R4PB 3Q0AA 1NY4A 4C3HG 3CRLC 1EY0A 3S14H 4U673 4PMBA 1WYDA 4BBRH 3H94A 3S24A 1D8LA 4C3JB 2A68C 2EY5A 3U9OA 5D14A 1O78A 1JB3A 1YNJC 4L8JA 3CW2C 3UI2A 4JI6L 1FL0A 2IT1A 1GUWA 4TRDA 1BUVT 3NSWA 4OWXB 1A3VA 3HZXA 1SNQA 2L55A 1V43A 2F0EA 3KBGA 4R1JA 1G2TA 5M5WB 2X6GA 5C44H 1Q8IA 1WTHA 3K80C 3I72A 4ZYSA 1NTGA 1TWFH 1GD7A 1HCZA 1MIUA 2EVBA 5C3EH 4WJ3M 1N33Q 4Q0FA 2WKCA 3HKZE 3ICEA 2UUCQ 2A68D 3S16H 1VQAA 2E2IB 1J6QA 3E5SA 1UE7A 1PRTD 2Z1CA 4GOPB 3M7NA 4A3GH 4A3CH 1H9SA 5C4HA 5LL6S 3ULJA 1FVIA 1BVSA 1WTVA 4JG2A 3PV0A 3NQIA 1GO3E 2EZVA 4UP9A 1VMCA 1KRSA 3HOVG 3D6CA 1SMXA 1VQJA 2F0IA 1KDBA 3WWVA 1CHQD 1FGUA 5C0XI 4IPCA 1AZQA 5CBEE 4YY3Q 4FF1A 2MFIA 1QB5D 3EJIA 3Q6SA 2A19A 5DLQE 4YWMA 3PUXA 3UE1A 4YCVA 4POGA 5M5WH 5BR8L 4FO2A 3MWYW 4R4OA 2AWOA 3CCVA 3EFXD 1N33L 4GS3A 4NMZA 3GTKH 2A69C 4KHVA 3MEFA 1Z7TA 4YIJA 5CGKA 3DWPA 4F7XA 1B1ZA 3JAML 1KNEA 1WTWA 2F0PA 5CV8A 2VQFL 2O5IC 4MTNA 1HNXL 5C4XG 2JA9A 4YWLA 1JCKB 2F52A 4IUPA 2L5TA 3AMUA 1K28A 1SE3A 2LXKA 4LUOA 4A3KB 4P74A 4ZKCB 1GVPA 2ICEC 2AQ1B 5FJ8H 4RGTA 4DXGA 5C0XH 4TQUS 3M85A 5M3FB 2K04A 2EY2A 3A8JE 2J4XA 1I4GA 4MIUA 4WORA 2B2YC 5A2QE 1SRUA 3BZKA 1HQMC 1NAPA 4DAYA 3I91A 1KABA 4JPBW 2N3SA 4A3LH 2WB1G 2KCCA 4H02A 2F0LA 3QOJA 3K8AA 1HZAA 3HOYG 3ITPA 5JEAG 1LTRD 2NN6I 2ZJQA 1F9QA 3T1YL 4P71A 2X6LA 1TWAH 4CHTB 4DK3C 4QIWB 3J7ZC 1C8CA 1QZGA 1YNJD 2QA4A 1YBYA 1L1OB 4B3TQ 5I9OA 3A55A 4XT3B 2RDFA 2D9UA 1EUJA 3GTGB 4PQXA 1BCPF 1XMOQ 1PZKD 4R4IA 4K5XA 2NVYB 3D31A 4X64L 4BXXG 2K32A 3PUZA 4C3HB 2F0KA 3D8GA 5M3FG 2MPMA 2M00A 2QW7A 4K0KQ 3KOJA 2LMCB 1R9TH 1XNQL 4NXNQ 4Y7NH 2AUKA 1QCBD 1EY5A 3K59A 4HIOA 3P1HA 4A3JG 1EFWA 3M4QA 5C4XB 2IW3A 1E7ZA 2JXMB 1N32Q 4DR6Q 3CF5A 2KA7A 2CCZA 3J7A5 1EIYB 1KLUD 3S9WA 1WOCA 1K0SA 3DWAA 1G6PA 2A73B 4JBKA 2K5WA 1XMQQ 5JOBA 3MFGA 2NUCA 2UUBL 5LMUQ 3KJOA 3TDQA 4DV7L 4LFAL 2WB1B 1LTBD 1XMOL 1IBLQ 1JWSD 2E8GA 1LM0A 1JE5A 3DXJC 4I65A 1VQ4A 3HOWG 2LFNA 1UAPA 3I3CA 1A3UA 1IKMA 4WJWA 3ONAB 3LWEA 3ERSX 4HJ8A 3NENA 4DR3L 4DR7L 2JQOA 1EY6A 5IGGA 5ELEA 3T53B 5EGTA 2XWJB 2Z4HA 4AH6A 4KN4C 1H9RA 1LTTD 3D4WA 5FLXc 3G48A 2VUMB 2F0WA 5FLMH 2K4KA 1U5KA 2MP1A 2Z4IA 5BN5A 3CMAA 4PMWA 4C3JH 2KCNA 3T16A 2AQ3B 2F4VL 1XWEA 1CKNA 2EYPA 2D0OA 3TEHB 4X3SA 3TP6A 2YU9B 3T1HQ 4EQPA 1PLFA 2YTXA 4NW2A 1G2SA 3CPWA 5IP9G 3JAMi 1Q86C 5M5XH 2F0OA 3BYTB 1G6ZA 1PH2A 3VA5A 1Y8NB 1IBLL 5A35A 1SROA 2F4VQ 1F9RA 5C44G 2CFMA 4L5QA 3T1HL 2G9HD 3S1NH 1X6OA 3T4AC 2JA7H 4CJ0B 1TT2A 4C2MH 5NUCA 4LK1C 1S72A 1SSOA 4DFAA 4BBSG 2E74C 3FPPA 3CC4A 1RL2A 2B2TC 5CC4A 1IXRA 2KECA 2VB3X 2KCTA 2FFKB 2VY3A 2WIIB 2AMCB 1SNPA 2VB2X 1PZID 4GKJL 1H9MA 3B6YA 1V8QA 2GA4B 3I4NH 2PZWA 1VQ5A 4LF7Q 1ILQA 3PIO3 1MHWC 4YY3L 3W1GA 2I5HA 1STBA 2KCMA 3D6WA 4P2CB 3CCEA 3RN2A 3MAQA 1M1KC 3CHBD 4DV4L 4DV5Q 3IAYA 3BU2A 1Y1VH 2CH4A 3FMCA 3K81C 1PTOC 2NZ1D 3NBHA 3ND9A 3A8KE 3I73A 1SFOH 3K7AH 3N52A 1NCVA 4QY7A 2K6AA 3CCJA 1FNVA 3T51B 1XMQL 2JSOA 3KK7A 4A3FB 4DR4Q 3ZJYC 1VQIA 1DOKA 1JJCB 1Y14B 2B63H 3HOVB 3S15B 2Z9HA 3SK4A 3P7JA 3TS2A 1WTOA 4LMQD 1O7YA 4DK0A 2JA5B 4B3TL 2M9VA 5IGFA 3TP5A 2CH4W 1EY7A 1WVLA 1PH6A 5CMDA 1K9MC 4YWKA 1GOZA 3GTJH 4DR2Q 4P72A 3KLWA 4BBSH 1CT1D 3SGIA 2DY7A 3AU7A 4I7AA 4K0KL 1EIGA 1EWIA 1JWMD 3L3OC 1K73C 1UE6A 4CDEC 2UUAQ 1I6HH 5EKIA 1EYCA 3CAMA 3FKIG 4LWCA 4DK1A 3CCQA 3BDCA 2JA8H 1P16A 3PF5A 1NNXA 2K52A 5JPNC 2KUMA 4MNOA 4CGYB 4KJOA 1VCIA 3AB9A 2ALYB 1W6JA 2PO4A 1E1OA 5M3FH 2JA7G 3N6RA 1UWVA 3CU7A 5JJZA 4XQQA 5LMNW 1LT3D 2B63B 1B3QA 3MA2B 4DV1Q 2HQLA 3MHBA 1EIFA 1TY2A 4GLAC 4B3SL 4LF4Q 2N78A 2UXDQ 1D6EC 2D62A 4L6TB 2N88A 5HY6A 1HR0Q 1LT5D 4KD3A 2I5LX 1PRTB 1I4HA 2PZUA 4X3KA 3CC7A 1ASZA 1O7ZA 2EOTA 3CP0A 3QG1A 3KFUA 1HNWQ 4A3LG 3RUZA 3QIAA 1PYSB 3L9AX 3SVMA 3JAMc 2CVRA 4QL5A 1QE6A 3C3LA 5EAYA 1SN8A 1LTLA 1AEXA 1RJTA 4H44C 2C5CA 4KMUC 3S17B 2IX0A 5ELCA 3TBIB 4GNXB 2OCEA 1EEFD 1LO5D 4DK6C 3RD4A 1VQHA 2VQEL 2NVQH 1EYAA 2KOLA 1SNDA 2E76C 3GV3A 3NELA 1VQ9A 4DNTB 2K14A 3UDGA 4XXEA 4NPSA 3S17H 2E75C 4K5VA 5C4XH 1OXUA 4NXML 2D0PA 3CPFA 4C56C 2A6HD 4GLVB 2AKWB 1IYUA 1TWHH 1HH2P 3I90A 1F9SA 2AQ2B 4OIJA 2HCCA 2OXPA 3FKIB 4OONA 3OWEB 2F3WA 3IFTA 2RKSA 1X3QA 1SNCA 1XX8A 2SEBD 1B53A 2MO0A 1SAPA 1VQDA 5J1ZA 5ELBA 4APVA 5BR8Q 1CZGA 4AIMA 4DR1Q 2BDNA 2BCOA 1TU2B 2EXZA 2RA4A 1IL2A 4GKJQ 1IYJB 2QEXA 3QOLA 3QB3A 1YNND 1JOOA 1LTSD 1NE3A 2EYMA 4JI3L 1PH5A 1UNSA 1PDQA 4X66Q 1N34L 4O0AA 3VR4A 3BVZA 4M1UB 3S1RB 2NN6G 3G4SA 1DZ1A 4QJFA 2WAQB 3TS0A 1A2UA 1YHAA 1U9RA 3TQYA 4A3BB 2WAQG 3U50C 4QMGA 3V96A 2CKZB 2EY6A 2AWNA 4C3JG 4QUFA 4YHHQ 1BBWA 3KUPA 1RTOA 4LAAA 5HGQA 4LFBQ 3W3AA 3T1YQ 5D3IB 4JI5L 1QVGA 1AFPA 2IWHA 3K57A 4IO9A 2TMPA 4JI8L 1WTRA 4X3UA 3SE0A 4LW1A 2LS01 1ESFA 1SJED 1I6VC 1RHPA 1E2VA 2PW5A 3EVQA 3H0GG 2F0VA 4A3GB 3MXPA 4Q5VA 5LL6X 1QUQB 1X3PA 1F2ZA 4XT1B 1SEBD 5IT9c 4DGZA 2JA5G 1S5DD 5IE8A 1I4RA 1NUCA 3C2PA 2ENBA 2R7ZB 1PXUA 5BN4A 1M90C 2I0QA 4J15A 1NR4A 1BKBA 1B70B 1SE4A 3ZYYX 2PPBC 4A3MB 1K3BC 1KDCA 4FXKC 1CKOA 2CW0D 2K33A 2DJGC 3GTLB 4FXGC 1QWYA 5C3EB 5L37A 5CV5A 1B9NA 1CQVA 4IZ8A 2K01A 2NB0A 3SHLA 2B2TA 3HFZB 1S3OA 1I3QH 3BVMA 3BDLA 4GKKQ 4CDFC 3NTHA 2F0MA 2SNSA 1YJ9A 1Y1WG 2PI2E 1HUMA 2XRSD 2K5QA 4K2KA 4X62L 4BA2I 4TKOB 4H13C 4HCSA 2J0TD 3OTOQ 3UDFA 4FYDA 2OTLA 3MVVA 4A3IG 1SMYC 2B2WC 1PYBA 3CMEA 1PH8A 3PF4A 4BA1I 4RH6A 1V1PB 4ME5A 2UUBQ 3EN2A 4R9WA 4BBSB 2BDOA 3VR3A 4NB3A 4DKAC 2DGYA 3L2PA 3PUYA 3J80E 1XPRA 4K6DA 4DAPA 5FO9B 4OX9Q 3RR5A 3SEBA 4FDBA 1X3EA 3WDNA 1BQQT 5FK9C 2JA6G 4JI3Q 4GN5A 1CSQA 3NBIA 1WTPA 2PNHA 3SDZA 3DEOA 3FP9A 1JOQA 1CZWA 1NMGA 1EL0A 1CQFA 2Z6BA 1PZJD 1X65A 2OT2A 1YHQA 2DN8A 1S40A 1N36L 1LACA 4JV5L 3K5OA 1II3A 2PQEA 5FOBB 3M7GA 2KVMA 4HTHA 1EU3A 1VQBA 1MJEA 4CKCA 4BS9A 3QO2A 1EY9A 1E22A 1UUPA 5EJWA 4KTAA 1MBYA 3RLOA 2PNRC 1MD2D 4HJ9A 1TWHB 1DXMA 1ML0D 4K14A 1G51A 1HTLD 2A8VA 1B50A 4AQYQ 4B3ML 5C3WA 2ZJRA 2MGSA 3J81c 1TWCH 2ZTEA 1CA5A 3IKJA 4DXFA 1K83B 5I4DA 2YYZA 1OXXK 3J80L 1WTQA 4DA2A 3MXGA 4HSVA 4C1NK 2BA1A 2Q8TA 1YNXA 2Q2IA 1RIPA 4HSPA 5IYCG 1S5BD 2XVSA 4R4CA 3E9HA 1UEAB 1S5CD 4JYAL 3S2DB 2EJMA 2QCPX 1Q7YC 1J5EL 4A75A 4GOPC 1FGBD 3DLLA 1TS2A 1PFNA 2I46A 4X3TA 4X65Q 1F2LA 2RDGA 4JI2L 4A3IH 5JJLA 4XDXA 1BOSA 4GLXA 1Z47A 3U9SA 1RCVD 3DM3A 3TZDA 4DN4M 5FLMG 4L63B 1DYQA 4NXNL 1SR3A 5K36H 4A3DB 1IBKL 1V1OA 5M5YH 4RHSA 4I7ZC 4F87A 4LF5Q 5H1SE 3W1BA 3STBD 2AHOB 4OX9L 2BE5D 2XWBB 1ZKOA 2Q8RE 5IGDA 2E2DC 2N49A 1VQLA 4YHHL 1V9PA 1VQFA 2K28A 1VQPA 1DGSA 4A3BH 4TVAB 4CBVA 1BDOA 1EZ6A 1N9WA 1PH3A 5IWAL 5HURA 2F0FA 3S1QH 4IFDH 3S2HH 4JV5Q 2UUAL 4LJZC 3C1FA 4DUYQ 4DV2Q 1XTDA 3KJPA 4LUZA 2V1CC 3CC2A 3K5MA 2WP8J 1KC8C 2F03A 3RLNA 3QWNA 1I4PA 1Y8PB 3HOXB 2HCIA 4O1NA 1TS4A 2CHBD 2HQEA 1H9SB 1T5EA 5J3BA 3F8TA 1A62A 4DNRB 4A3KH 4BY7G 3WOFA 4ALPA 4X62Q 3TRZA 2UUCL 5JJKA 3J80c 1KL9A 3GP7A 4ODGA 3FEWX 4HR7B 3D4DA 4A3FH 1QVFA 4BXXH 4IUVA 1RF2D 1XTCD 3FVQA 3NPPA 4ZCKA 3E3XA 1CUKA 1U4PA 2B8FA 4UHVA 3J7AV 2B2VC 1SYBA 4XQJA 1MGSA 2YV5A 2E5LL 1RTNA 5E1FA 4ZQ3A 3KDFA 3K7AB 3I4MB 2MJ8A 1H95A 1ICFB 1SYCA 4B3RL 5KYLA 5M9OA 3GTJB 1HNXQ 2KENA 1TQOA 2A5HA 2VQEQ 2MUYA 4JYAQ 2L11A 3OOCA 5KIXA 3S2HB 3BDOA 2SOBA 3OSOA 4ZLTF 1PHJA 1CKNB 5C0XG 3CQZB 4A3KG 3I2ZA 1DM0B 3H3VI 1TXYA 1H9JA 1IL8A 4HIDA 4DV3Q 2ZTCA 2F0HA 4L5TA 1AE2A 1AZPA 5GAGC 1EQVA 2XNAC 1HNZQ 5IIFA 1B4OA 2HHHL 4DV0Q 3HOXG 4KD4A 3HG9A 3BVGA 1JJ2A 3I4MG 2VL6A 4DPGA 1HPCA 2F3VA 2WKDA 1H9KA 3I70A 4A76A 2NVTH 5ELOA 3J7YW 1VF5C 3AQQA 1STGA 4HMIA 3NE5B 2RQXA 2N8NA 2Z0SA 1KQSA 1B44D 1UE1A 2CWPA 1ZXTA 2NVYH 3M3YH 5IYBG 2XGTA 1GKHA 3TMEA 1YJWA 2KHIA 3TP8A 4RAUC 4QF4A 1BBXC 1YI2A 4A3EH 1YJNA 5IGEA 3TN2A 2KEDA 1IBMQ 1EY4A 2L4NA 4X6AH 4JI8Q 1SXTA 1TWCB 4NKLA 4DAVA 1T5XD 4G57A 3VDYA 1B2TA 4A3FG 1BCPB 5DNFA 2XTIA 1HFGA 1TWFB 2EDGA 1GXDC 1SBBB 1IW7D 1G91A 5KNCA 2B63G 1C0AA 3SK6A 3RMHA 4FVMA 4J6HA 1HFNA 5EQ0A 3MZ5A 2R7FA 2F4IA 5LMUL 4JBMA 5BN3A 4XYQA 5F2DA 2UXCL 1NMFA 3KF6A 4POFA 5G3LF 1VS0A 2YTVA 1A0IA 1WI5A 3HS0C 4LFCL 3URYA 2O2LD 3TP7A 3RNUA 1KNAA 5I2XA 2VUMH 4IFDG 3M3YB 5C0XJ 3O13A 3S1NB 1ZYRC 4ID6A 5EBCA 4OGQC 4HJ5A 1WCMB 3VA7A 2B29A 2IPKD 1AH9A 4PZ8A 1PRTF 1LYLA 4GKKL 3S14B 4RMFA 4BY1H 1IBKQ 5GROA 1XXGA 2DUDA 1SE2A 3RLFA 4EGVA 4EX5A 2UXDL 2FMMA 3OW7A 1ENAA 4KV6A 3OTOL 4WFN3 3K5NA 1VQ8A 4A3DG 1K8GA 1LT4D 2XN9C 2B3GA 2K5VA 4PV1C 1EQTA 3HP3A 2WFWA 2Y0SE 3I55A 1QNKA 3DM1A 1GUTA 4DR7Q 1S4ZA 2KBNA 4OL7A 3ER0A 1FNWA 3H3VH 4V0BA 3KYHC 2KHJA 1LT6D 3BZCA 4KKSA 1JQYD 1TWGH 4IALA 3HOUG 3S1RH 1XPUA 1KAWA 1O7LA 3DUZA 3IRBA 3VR6A 4DV6L 4EVOA 1WTXA 2I07B 2NTSA 4JOIC 2ZJPA 4LF8L 2OWOA 3G6JB 3VYUA 4EQNA 4KK7A 1PFBA 1HTPA 3EBEA 1OO9B 2Q8IB 1X32A 3AYHB 5G3LD 3K5LA 1BCPD 3VR2A 2TSSA 3I4NB 2RBMA 4JC0A 3EA6A 2VW9A 2K5NA 1YHBA 2QILA 4EQOA 2JA6H 2FJ2A 3E6ZX 2EIFA 1SNOA 1AP0A 3H3VC 1CHPD 1TWAB 1IKLA 5CV6A 2PZTA 1N34Q 5C5MA 4IUNA 4HJAA 1WD0A 1L2FA 3I4MH 4OELB 2HDLA 2Y0SG 1SYDA 1HXYD 1LV9A 4RHRA 5FO8B 3HOZH 2WV6D 3SK5A 2IX1A 4S3SA 4UDUC 2PI2A 1Q82C 4JI4L 4CJ1B 3J81j 1ESRA 5IGCA 4B08A 1YEZA 4X66L 3WOEA 1FJGL 4N9PA 4LFBL 3PGZA 2K5HA 3G71A 3A7LA 2EYJA 4JI6Q 2B2UC 2B8GA 3PO2G 1XPOA 3BJUA 2E2JH 2K75A 1PH9A 2C35B 3GTQH 4N9TA 1LABA 4FNFA 2QGQA 3FPUB 1B3AA 1E3PA 4K8IA 1QOHA 2IX3A 2DNEA 4M8AA 5EPLA 5KGUA 4KHPQ 1SYGA 5CBAE 3GO5A 3GTQB 2JA5H 4ZRZA 3LGJA 4IOAA 1B8AA 1QVCA 1PTOH 5EKKA 5C6AA 1KXLA 5JVH3 1X56A 4Y7NB 2YTYA 3K0XA 3KLRA 1GUOA 3W2DA 3GTOH 2NN6H 2NTTA 5CV4A 1G8ZD 1CKMA 1OXSC 3C1EA 2J7ZA 3GTGH 2RVLA 3MEHA 2LKVA 4OWTB 2SDFA 4UP8A 3NK9A 1BBUA 2ZXOA 4B3SQ 1CM9A 1I50H 1X3FA 2OEOA 1EOTA 2E2HH 3M4OH 1U4RA 1AW7A 1LTID 4R4QA 4JVZA 3HOWH 2O4XA 5GQOA 1W6KA 4A93H 4HCEA 4PMCA 5A2QL 1S5ED 4IUQA 4IURA 1M8AA 2GVAA 3VYSA 5I6WA 2HT1A 3MTSA 3K0YA 3HOZG 2RHSB 1YIJA 5C5LA 4IPDA 3OMCA 3CRKC 1OXTA 4KLKA 3HKSA 1I4QA 1Q1EA 4KKTA 3FRPB 5IODA 3M9BA 3D4RA 3PO2B 1PTOF 4Z9CB 4A93G 4HAEA 4K2LA 3UDXA 1U4MA 1MSHA 4P75A 1Q12A 3KF6B 1KDAA 5C44B 3R8BA 4IUUA 1BR9A 5C4JB 2ES2A 4DV2L 4PZ6A 3CKIB 2EYFA 5D3DA 1JICA 2NVXH 3KBXA 2NWGA 2QDBA 3OIPA 2AUJD 2ICIA 2ZXRA 4GNXA 1S5FD 1K0RA 2LY7A 4FP5D 1L1OC 1Z9FA 1D5XC 2NBFA 4RA8A 1MKHA 1FR3A 4JI7Q 2Z6KC 4RG1A 1TS3A 3EIVA 2VNUD 1KAAA 2HIXA 4RKBA 3PIPA 4DR3Q 2RCFA 1GJXA 2MHVA 5DM73 4ILWA 4R4TA 4N8FA 1D5MC 4BY1G 1YITA 2F0JA 1PH4A 4NXMQ 2EYOA 3R3OA 3I4NG 3X3MA 3HRZC 1BCPC 1TVXA 3E9IA 4JI7L 4LF9Q 5IYBH 1CSPA 2EJGC 1DJRD 4A3DH 2B2UA 2EXDA 4NDXA 1STHA 4DV1L 5J39A 4HEDA 1EWCA 2LSSA 1Q81C 5KRUA 3S16B 1HRJA 5T1GA 1X54A 3E0JA 3S2DH 4LF4L 4IPGA 1EOVA 4LF9L 3SK8A 1HUNA 1QZHA 2FINB 5CORA 2EJFC 2EPBA 2KQ3A 4RKLA 4UP7A 4DV4Q 2IJ0A 1QILA 4KY7A 1KRTA 4HIMA 1E2ZA 1ZEQX 1CFMA 4DV3L 2Y0SB 3MXUA 3STBC 4CKEA 2FXQA 2A6EC 1FD7D 3NHHA 5E3FA 1SFOB 1ICWA 4JK1C 3VR5A 1Y8OB 4A3GG 3D0FA 1EEID 4A3MH 5ELDA 2CQAA 3L0OA 5K5PA 2WAQE 1D1IA 1TWGB
chains in the Genus database with same CATH topology
2F0GA 1PYWD 1J9OA 2K1BA 1CA6A 4BY7B 3KLSA 1CTMA 1D1KA 2R3ZA 5E4WC 3GTMB 1MI2A 4DU9A 2BE5C 5TSSA 5JVG3 3Q23A 5IT9E 2F0UA 2JP1A 4B9XA 1QJOA 2NYZD 4ZKBB 3H0GB 4CKBA 5JPMC 5LHY1 1I4XA 4QB4A 1RDPD 3F2UA 3HEJA 3ERQA 1DCZA 1STEA 1JOKA 2BA0A 2QKIC 2EYHA 4TSSA 3V05A 5E4XA 3NUCA 5FKAC 2F0SA 3H91A 2L12A 1HHVA 1TR5A 5DEHA 1EU4A 3A56A 1PTOB 1C48A 4RGOS 4QCLA 1GUGA 1Y1WB 1KLGD 3BZDB 1SMYD 4HMJA 1KTKA 5JEAJ 2L0CA 2JA8B 2F0TA 4RGMA 4UAIA 1G291 4WRDA 3VYRA 5IGBA 5I9PA 4ZUIA 1I50B 1JORA 5C3XA 2A6HC 5I2YA 1BNZA 2V4DA 1R9TB 2JEAI 4IN3A 1GHJA 5KNDA 1STNA 3HOYB 3DWQA 2C9OA 3MC0B 3BG3A 2NVQB 3EQLC 1I6HB 4F8MA 1ENFA 1C4QA 5FLXL 1VF7A 3A54A 1B9MA 2X69A 4FF2A 2B2WA 1LLRD 4BBRB 1ILPA 4G7OC 3JAME 5M3MB 2XRQD 3HOWB 5J22A 4KI0A 3BYYB 3NP8A 4ZAIA 3RZOB 1STAA 2R93B 3M4YA 1M4VA 4J1MA 1EYDA 1TKWB 3IFDA 2DY8A 1IHZA 3RZDB 1SYFA 1PTOD 3OHXC 3NTIA 4B9WA 3NWSA 4MHEA 4U68A 1EY8A 3MFYA 4OO1H 2VXWA 1F9PA 5IOCA 3GTKB 4BY1B 1QG7A 5M5YB 5M5XB 3GD7A 1BO0A 5FLXE 4A3IB 1SYEA 3R2IA 3A7AB 4FF4A 5EPKA 4DF7A 4K5WA 3KLSX 2XIWA 1J8IA 3P75A 5CV9A 3HGBA 1TS5A 1EIHA 1DOLA 3R2TA 3DMUA 2Z8LA 2RDHA 4ABNA 2FMCA 4K8JA 4RGNA 5JAVA 3Q24A 3J81L 2F0QA 2ID0A 4RCOA 4KKUA 5DM63 3OIQA 3H09A 5JEAH 1LTAD 3LX0A 4MN3A 3GV6A 1SJHD 2D2CC 1VMPA 4XQNA 3X3NA 1ENCA 2FHTA 2EE1A 1EFID 2A74C 2KHSA 3J7AF 2ZT9C 1YNNC 2EYLA 4ULLA 1GUSA 5EKLA 4H0LC 1EZ8A 4F88A 4FF3A 1SNMA 1HQRD 1Y1VB 2QF7A 5C4ZA 3PO3B 2G9DA 3LWUA 4XIGS 4C1NI 3K6OA 2PCFB 1IYVA 3IL8A 1A15A 2N55A 3L7ZC 5ELFA 3A8IE 1DOMA 2K03A 1MSGA 1IW7C 2JYOA 3GTPB 3M4OB 2E2HB 4RFBA 5T1IA 5HGTA 3T13A 2A6ED 1PMRA 1RD9D 1A6XA 3I4LA 1ZYRD 4IQZA 3OMGA 2B2VA 2F0DA 3EROA 4R8IA 2PMZB 1F77A 4KN7C 3K58A 5IT9L 1BF4A 4O42A 2WACA 4KJNA 3P20A 4ZK9B 3GQBA 1Q1BA 4C3IG 4RCNA 1U4LA 1EWHA 4A93B 1D2BA 2K05A 4IFDJ 4AYBB 4KHZA 2H1EA 2NVXB 1NR2A 4A3EB 1FYCA 3TZUA 1NSNS 2M2LA 1FNUA 1PRTC 5D65A 4QUCA 4NP5A 2PW7A 5KNBA 1D5ZC 2O5JC 2R92B 1L0YB 1WD1A 1E2WA 4OHJA 4PNYA 5DAUA 1Q3LA 4OO1G 4H7BA 2WINB 1XYIA 1QNUA 3D3RA 4KY5A 1HA6A 4BWGB 4IUTA 1CK1A 2XSCA 5EPJA 4GZYC 3LNNA 3PUWA 1ET6A 1A3TA 1A2TA 1DD2A 2F0NA 2A69D 3Q22A 1Z6HA 2QEJC 4A3JB 2PYKA 2H4OA 2JA7B 3G7LA 3HKZB 3VYTA 4K6LA 4C3IB 5COYA 5I6YA 1F2YA 1TIID 3MXNA 3QJYA 2HDMA 3SXHA 3S1MB 3FDTA 2B2YA 3OPOA 2R61A 3H6MA 4J8QA 5FO7B 1RODA 2JA6B 2BOSA 4CJ2C 1Y69U 3T56B 4RWSC 1JC7A 3C46A 2KJXA 4G7ZC 5KYIA 1I3QB 4C2MB 3HOZB 1HA5A 2RSNA 1AN8A 1R4QB 3R93A 1L0XB 3S1QB 4E6IA 4V190 1TY0A 2IL8A 3PUVA 1GHKA 4R8NA 2D5DA 3GTOB 4ZUJA 4IFDI 2DNCA 3NXWA 3SR1A 1ONLA 1GUNA 2RSOA 1SDFA 1PFMA 5EBDA 2NVTB 3HOUB 3TSSA 2F1MA 4OIKA 2HUGA 5KEEA 3BS1A 4G4KA 4XTCS 1K8OA 3NTKA 2L9HA 1E0BA 3OWFA 2EY1A 4OO1I 2CW0C 2JEBI 3PMFA 3J81E 3PIP3 2SNMA 4KY6A 1V1PA 1CI3M 2E2JB 1OXVA 1DONA 1Q90A 3DEPA 2KEEA 1F2MA 2OF1A 5AFWA 5CR3A 1LTGD 3DHQA 1VDZA 5CYUA 3V2TA 4JBWA 1JE4A 2R6GA 4FXDA 4HN7A 1K8MA 5CV7A 1JWUD 1O80A 3NQTA 5K36G 1JR0D 1RKNA 3ND8A 2L1BA 3I8ZA 1BXTA 2K7VA 3NWTA 2B39A 2K5DA 1STYA 4XYOA 2ZXPA 5ISRA 4G7HC 1ET9A 3KF8A 2JE6I 1R4PB 3Q0AA 4C3HG 3CRLC 1EY0A 4U673 4PMBA 3H94A 4C3JB 2A68C 2EY5A 3U9OA 5D14A 1O78A 1JB3A 1YNJC 4L8JA 3UI2A 2IT1A 1GUWA 4TRDA 1BUVT 3NSWA 1A3VA 3HZXA 1SNQA 2L55A 1V43A 2F0EA 3KBGA 1G2TA 5M5WB 2X6GA 1Q8IA 3I72A 4ZYSA 1HCZA 2EVBA 4Q0FA 2WKCA 2A68D 2E2IB 3E5SA 1PRTD 2Z1CA 3M7NA 1H9SA 5C4HA 5LL6S 1WTVA 3PV0A 3NQIA 2EZVA 1VMCA 3D6CA 2F0IA 1KDBA 1CHQD 5C0XI 1AZQA 5CBEE 4FF1A 1QB5D 3EJIA 3Q6SA 3PUXA 4FO2A 3MWYW 2AWOA 3EFXD 4NMZA 2A69C 4KHVA 4YIJA 1Z7TA 5CGKA 3DWPA 4F7XA 1B1ZA 3JAML 1KNEA 1WTWA 2F0PA 5CV8A 2O5IC 1JCKB 4IUPA 2L5TA 3AMUA 1SE3A 4A3KB 4ZKCB 2ICEC 2AQ1B 4RGTA 4DXGA 5C0XH 4TQUS 3M85A 5M3FB 2K04A 2EY2A 3A8JE 2J4XA 1I4GA 4MIUA 4WORA 2B2YC 5A2QE 1HQMC 1NAPA 4DAYA 3I91A 1KABA 2KCCA 2F0LA 3QOJA 3ITPA 5JEAG 1LTRD 2NN6I 1F9QA 2X6LA 4CHTB 4QIWB 1C8CA 1YNJD 5I9OA 3A55A 4XT3B 2RDFA 2D9UA 3GTGB 4PQXA 1BCPF 1PZKD 4K5XA 2NVYB 3D31A 4C3HB 2K32A 3PUZA 2F0KA 3D8GA 2MPMA 2M00A 2LMCB 2AUKA 1QCBD 1EY5A 3K59A 3P1HA 5C4XB 2IW3A 2JXMB 2KA7A 1KLUD 3S9WA 3DWAA 2A73B 2K5WA 5JOBA 3MFGA 2NUCA 3TDQA 2WB1B 1LTBD 1JWSD 3DXJC 4I65A 2LFNA 1UAPA 3I3CA 1A3UA 1IKMA 4WJWA 3ONAB 3LWEA 1EY6A 5IGGA 5ELEA 3T53B 5EGTA 2XWJB 2Z4HA 4KN4C 1H9RA 1LTTD 3D4WA 2VUMB 2F0WA 2MP1A 2Z4IA 5BN5A 4PMWA 2KCNA 3T16A 2AQ3B 1XWEA 2EYPA 2YU9B 4X3SA 3TP6A 4EQPA 1PLFA 4NW2A 1G2SA 2F0OA 3BYTB 1G6ZA 3VA5A 1Y8NB 5A35A 1F9RA 2G9HD 3T4AC 4CJ0B 1TT2A 5NUCA 4LK1C 1SSOA 4DFAA 2E74C 3FPPA 2B2TC 5CC4A 2KECA 2VB3X 2WIIB 2FFKB 2VB2X 1SNPA 1PZID 1H9MA 1V8QA 2GA4B 2PZWA 1ILQA 3PIO3 1STBA 3D6WA 4P2CB 3MAQA 3CHBD 3IAYA 3FMCA 1PTOC 2NZ1D 3NBHA 3ND9A 3A8KE 3I73A 3N52A 1NCVA 2K6AA 1FNVA 3T51B 2JSOA 3KK7A 4A3FB 1DOKA 3HOVB 3S15B 3SK4A 3P7JA 1WTOA 4LMQD 1O7YA 4DK0A 2JA5B 2M9VA 5IGFA 3TP5A 1EY7A 1WVLA 5CMDA 1GOZA 1CT1D 2DY7A 3AU7A 1EIGA 1JWMD 3L3OC 5EKIA 1EYCA 4DK1A 3BDCA 5JPNC 2KUMA 4CGYB 4KJOA 1VCIA 3AB9A 1W6JA 2PO4A 3N6RA 5JJZA 3CU7A 4XQQA 1LT3D 2B63B 3MA2B 3MHBA 1TY2A 1D6EC 2D62A 4L6TB 2N88A 1LT5D 4KD3A 1PRTB 1I4HA 2PZUA 4X3KA 1O7ZA 2EOTA 3QG1A 3RUZA 3QIAA 3L9AX 3SVMA 2CVRA 1QE6A 3C3LA 1AEXA 1RJTA 4H44C 2C5CA 4KMUC 3S17B 2IX0A 5ELCA 3TBIB 1EEFD 1LO5D 3RD4A 1EYAA 2KOLA 1SNDA 2E76C 3GV3A 4DNTB 4XXEA 2E75C 4K5VA 1OXUA 4C56C 2A6HD 1IYUA 3I90A 1F9SA 2AQ2B 4OIJA 2HCCA 2OXPA 3FKIB 3OWEB 2F3WA 3IFTA 2RKSA 1X3QA 1SNCA 1XX8A 2SEBD 1B53A 1SAPA 5J1ZA 5ELBA 1CZGA 2BDNA 2BCOA 1TU2B 2EXZA 2RA4A 3QOLA 1YNND 1JOOA 1LTSD 2EYMA 3QB3A 1UNSA 1PDQA 3VR4A 3BVZA 4M1UB 3S1RB 2NN6G 1DZ1A 2WAQB 1A2UA 1U9RA 4A3BB 4QMGA 3V96A 2EY6A 2AWNA 4C3JG 4QUFA 4LAAA 3KUPA 1RTOA 3W3AA 5D3IB 1AFPA 2IWHA 3K57A 2TMPA 1WTRA 4X3UA 3SE0A 2LS01 1ESFA 1SJED 1I6VC 1RHPA 1E2VA 2PW5A 3EVQA 2F0VA 4A3GB 3MXPA 4Q5VA 5LL6X 1X3PA 1F2ZA 4XT1B 1SEBD 4DGZA 1S5DD 1I4RA 1NUCA 3C2PA 2ENBA 2R7ZB 1PXUA 5BN4A 1NR4A 1SE4A 3ZYYX 2PPBC 4A3MB 1KDCA 4FXKC 2CW0D 2K33A 3GTLB 4FXGC 1QWYA 5C3EB 5CV5A 1B9NA 1CQVA 4IZ8A 2K01A 2NB0A 3SHLA 2B2TA 3BVMA 3BDLA 3NTHA 2F0MA 2SNSA 1HUMA 2XRSD 2K5QA 4K2KA 4BA2I 4TKOB 4H13C 4HCSA 2J0TD 4FYDA 3MVVA 1SMYC 2B2WC 4BA1I 4RH6A 1V1PB 4ME5A 4R9WA 4BBSB 2BDOA 3VR3A 3PUYA 3J80E 4K6DA 4DAPA 5FO9B 3SEBA 3WDNA 1BQQT 5FK9C 3NBIA 1WTPA 3SDZA 3DEOA 1JOQA 1CZWA 1EL0A 1CQFA 1PZJD 2OT2A 2DN8A 1LACA 3K5OA 1II3A 2PQEA 5FOBB 3M7GA 2KVMA 4HTHA 1EU3A 4CKCA 4BS9A 3QO2A 1EY9A 1UUPA 5EJWA 4KTAA 1MBYA 2PNRC 1MD2D 1TWHB 1DXMA 1ML0D 4K14A 1HTLD 1B50A 5C3WA 2MGSA 1CA5A 3IKJA 4DXFA 1K83B 5I4DA 2YYZA 1OXXK 3J80L 1WTQA 4DA2A 3MXGA 4HSVA 4C1NK 2BA1A 2Q8TA 4HSPA 1S5BD 2XVSA 3S2DB 1UEAB 1S5CD 2EJMA 2QCPX 1FGBD 4X3TA 1TS2A 1PFNA 2I46A 1F2LA 2RDGA 4XDXA 1BOSA 1Z47A 3U9SA 1RCVD 3TZDA 4DN4M 4L63B 1DYQA 5K36H 4A3DB 1V1OA 4RHSA 4I7ZC 4F87A 2BE5D 2XWBB 1ZKOA 2Q8RE 5IGDA 2E2DC 2K28A 4CBVA 1BDOA 1EZ6A 5HURA 2F0FA 4IFDH 3C1FA 4LJZC 3K5MA 2WP8J 2F03A 3QWNA 1I4PA 1Y8PB 3HOXB 2HCIA 4O1NA 1TS4A 2CHBD 2HQEA 1H9SB 1T5EA 4DNRB 3WOFA 3GP7A 4ODGA 3FEWX 4HR7B 3D4DA 4IUVA 1RF2D 1XTCD 3FVQA 3NPPA 1U4PA 2B8FA 3J7AV 2B2VC 1SYBA 4XQJA 1MGSA 1RTNA 5E1FA 4ZQ3A 3K7AB 3I4MB 2MJ8A 1SYCA 5KYLA 5M9OA 3GTJB 1TQOA 2A5HA 2MUYA 2L11A 3OOCA 5KIXA 3S2HB 3BDOA 2SOBA 3OSOA 4ZLTF 5C0XG 3CQZB 1DM0B 1H9JA 1IL8A 2F0HA 1AZPA 1EQVA 2XNAC 5IIFA 1B4OA 4KD4A 3HG9A 3BVGA 1HPCA 2F3VA 2WKDA 1H9KA 3I70A 3J7YW 1VF5C 1STGA 4HMIA 3NE5B 2RQXA 1B44D 1ZXTA 3TMEA 3TP8A 4RAUC 4QF4A 1BBXC 5IGEA 3TN2A 2KEDA 1EY4A 2L4NA 1SXTA 1TWCB 4NKLA 4DAVA 1T5XD 4G57A 1B2TA 1BCPB 5DNFA 1HFGA 1TWFB 2EDGA 1GXDC 1SBBB 1IW7D 1G91A 5KNCA 3SK6A 3RMHA 4FVMA 4J6HA 1HFNA 5EQ0A 3MZ5A 2F4IA 5BN3A 4XYQA 5F2DA 5G3LF 3HS0C 3URYA 2O2LD 3TP7A 1KNAA 5I2XA 4IFDG 3M3YB 5C0XJ 3O13A 3S1NB 1ZYRC 4ID6A 5EBCA 4OGQC 1WCMB 3VA7A 2IPKD 1PRTF 3S14B 1XXGA 1SE2A 3RLFA 4EGVA 2FMMA 3OW7A 1ENAA 4KV6A 4WFN3 3K5NA 1LT4D 2XN9C 4PV1C 1EQTA 3HP3A 1QNKA 3DM1A 1GUTA 1S4ZA 4OL7A 1FNWA 4V0BA 1LT6D 4KKSA 1JQYD 4IALA 1O7LA 3DUZA 3VR6A 4EVOA 1WTXA 2I07B 2NTSA 3G6JB 3VYUA 4EQNA 4KK7A 1PFBA 1HTPA 1OO9B 2Q8IB 1X32A 5G3LD 3K5LA 1BCPD 3VR2A 2TSSA 3I4NB 2RBMA 3EA6A 2QILA 4EQOA 2FJ2A 3E6ZX 1SNOA 1AP0A 3H3VC 1CHPD 1TWAB 1IKLA 5CV6A 2PZTA 5C5MA 4IUNA 1WD0A 2HDLA 1SYDA 1HXYD 1LV9A 4RHRA 5FO8B 2WV6D 3SK5A 2IX1A 4S3SA 4UDUC 4CJ1B 1ESRA 5IGCA 4B08A 3WOEA 4N9PA 3A7LA 2EYJA 2B2UC 2B8GA 4N9TA 1LABA 4FNFA 3FPUB 1B3AA 4K8IA 1QOHA 2IX3A 2DNEA 4M8AA 5EPLA 5KGUA 1SYGA 5CBAE 3GO5A 3GTQB 4ZRZA 1PTOH 5EKKA 5C6AA 5JVH3 4Y7NB 3KLRA 1GUOA 3W2DA 2NN6H 2NTTA 5CV4A 1G8ZD 1OXSC 3C1EA 2J7ZA 2RVLA 3MEHA 2LKVA 2SDFA 3NK9A 2ZXOA 1CM9A 2OEOA 1EOTA 1U4RA 1AW7A 1LTID 2O4XA 1W6KA 4HCEA 4PMCA 5A2QL 1S5ED 4IUQA 4IURA 1M8AA 3VYSA 5I6WA 3MTSA 3K0YA 5C5LA 3OMCA 3CRKC 1OXTA 1I4QA 1Q1EA 4KKTA 3FRPB 5IODA 3D4RA 3PO2B 1PTOF 4Z9CB 4HAEA 4K2LA 1U4MA 1MSHA 1Q12A 5C44B 1KDAA 3R8BA 4IUUA 1BR9A 5C4JB 3CKIB 2EYFA 5D3DA 1JICA 3KBXA 2NWGA 2QDBA 3OIPA 2AUJD 2ICIA 2ZXRA 1S5FD 2LY7A 4FP5D 2NBFA 1D5XC 4RA8A 1FR3A 1TS3A 2VNUD 1KAAA 4RKBA 1GJXA 2MHVA 5DM73 4ILWA 1D5MC 2F0JA 2EYOA 3R3OA 3X3MA 3HRZC 1BCPC 1TVXA 2EJGC 1DJRD 2B2UA 4NDXA 1STHA 5J39A 4HEDA 1EWCA 5KRUA 3S16B 1HRJA 5T1GA 3E0JA 3SK8A 1HUNA 2FINB 5CORA 2EJFC 2EPBA 2KQ3A 4RKLA 2IJ0A 1QILA 4KY7A 1E2ZA 1ZEQX 1CFMA 2Y0SB 3MXUA 4CKEA 2A6EC 1FD7D 3NHHA 5E3FA 1SFOB 1ICWA 4JK1C 3VR5A 1Y8OB 1EEID 5ELDA 2CQAA 5K5PA 1D1IA 1TWGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXF A;  1CHP D;  1BCP B;  1PYW D;  1JWU D;  1SJH D;  5ELC A;  3EFX D;  1RF2 D;  1XTC D;  5I4D A;  1JR0 D;  1EEF D;  1SBB B;  1LO5 D;  3MFG A;  3DWP A;  1B1Z A;  1BXT A;  1I4Q A;  1FNV A;  1PTO F;  1LTB D;  1EFI D;  4Z9C B;  1JWS D;  1CQV A;  1LLR D;  5TSS A;  1ET9 A;  1JCK B;  1HA5 A;  1S5B D;  1AN8 A;  2XRQ D;  3R8B A;  3BVM A;  4C56 C;  1HXY D;  3URY A;  2O2L D;  1S5C D;  4RHR A;  1SE3 A;  1FNU A;  1I4X A;  3BYY B;  1PRT C;  2WV6 D;  2XRS D;  2AQ2 B;  1FGB D;  5D3D A;  1L0X B;  1RDP D;  5ELE A;  2AQ1 B;  1TS2 A;  4RGT A;  2ICI A;  3O13 A;  4UDU C;  4DXG A;  2RDG A;  1LTT D;  1HQR D;  3OWE B;  1TY0 A;  1D5Z C;  1M4V A;  1S5F D;  2IPK D;  1GOZ A;  1I4G A;  1STE A;  2J4X A;  1D5X C;  2SEB D;  1L0Y B;  1PRT F;  1CT1 D;  2AQ3 B;  4OHJ A;  1V1P B;  1RCV D;  4RH6 A;  4TSS A;  1TS3 A;  5ELB A;  1JWM D;  1XXG A;  1PTO D;  4L63 B;  1SE2 A;  1DYQ A;  3V05 A;  2XNA C;  1V1O A;  5FKA C;  1D5M C;  1LTR D;  4RHS A;  4BWG B;  3SEB A;  1LTS D;  1LT4 D;  1CK1 A;  2XN9 C;  1UNS A;  3BYT B;  5FK9 C;  4ZYS A;  1BCP C;  3TSS A;  5ELF A;  1EU4 A;  3BVZ A;  1PTO B;  4RGO S;  3BVG A;  1DJR D;  1ET6 A;  1KLG D;  2G9H D;  3BZD B;  1PTO H;  1FNW A;  3R2I A;  1KTK A;  1BCP F;  1LT6 D;  1PZJ D;  1JQY D;  1PRT D;  1PZK D;  4RGM A;  1LT3 D;  1EWC A;  3W2D A;  2QEJ C;  3DWA A;  2NTT A;  5D3I B;  3KLS X;  1G8Z D;  1B44 D;  1TY2 A;  1V1P A;  4RFB A;  1TS5 A;  2NTS A;  1D6E C;  1ESF A;  1SJE D;  3R2T A;  4L6T B;  1LT5 D;  1PZI D;  1QIL A;  2IJ0 A;  2Z8L A;  1PRT B;  4K6L A;  1I4H A;  2RDH A;  1RD9 D;  1EU3 A;  1CHQ D;  1AW7 A;  1LTI D;  1I4P A;  1LTG D;  1BCP D;  1FD7 D;  2TSS A;  1SEB D;  4O1N A;  1TS4 A;  2CHB D;  1UUP A;  3DWQ A;  3EA6 A;  1S5D D;  1MD2 D;  1I4R A;  3MC0 B;  4RGN A;  1F77 A;  2QIL A;  1SXT A;  2R61 A;  4RCO A;  1EEI D;  1HTL D;  1S5E D;  3CHB D;  1KLU D;  5ELD A;  3GP7 A;  1T5X D;  1LTA D;  1SE4 A;  1PTO C;  1ENF A; 
#chains in the Genus database with same CATH topology
 2F0G A;  1PYW D;  1J9O A;  2K1B A;  4JW0 A;  1CA6 A;  4BY7 B;  4A3E G;  3KLS A;  4JI5 Q;  1CTM A;  1D1K A;  2R3Z A;  5E4W C;  3QR8 A;  3GTM B;  1KIX A;  3CD6 A;  1MI2 A;  1A8V A;  3CXC A;  2BH8 A;  4DU9 A;  2BE5 C;  5TSS A;  5JVG 3;  3Q23 A;  2WB1 E;  2F0U A;  2JP1 A;  5IT9 E;  4B9X A;  1QJO A;  2NYZ D;  3A0J A;  4ZKB B;  3H0G B;  4CKB A;  5JPM C;  3CQZ H;  1NJI C;  5LHY 1;  3GTM H;  1I4X A;  4JCV E;  4QB4 A;  1VQC A;  1RDP D;  3RN5 A;  1Y1V G;  3F2U A;  3HEJ A;  3ERQ A;  5GAD C;  1DCZ A;  1YZ6 A;  3PO3 H;  1STE A;  1JJG A;  1JOK A;  2BA0 A;  2QKI C;  3GTP H;  2EYH A;  4TSS A;  4LFC Q;  1JB7 A;  2G5D A;  3A5U A;  3V05 A;  5E4X A;  3W5O A;  3NUC A;  5C3E G;  1O7I A;  5FKA C;  2F0S A;  4JI0 L;  1UEB A;  2QDL A;  1K3R A;  4GNX C;  3H91 A;  2L12 A;  1HHV A;  1TR5 A;  5DEH A;  1EU4 A;  3A56 A;  1PTO B;  2OTJ A;  1C48 A;  2RCN A;  4RGO S;  4QCL A;  1GUG A;  1Y1W B;  1KLG D;  3BZD B;  2JJQ A;  1SMY D;  4HMJ A;  1W3S A;  4IJL A;  1KD1 C;  1KTK A;  5JEA J;  5IYD H;  2L0C A;  2JA8 B;  2F0T A;  4RGM A;  4UAI A;  1G29 1;  4WRD A;  1K83 H;  4JI1 Q;  3VYR A;  5IGB A;  5I9P A;  4ZUI A;  1I50 B;  1JOR A;  4LFA Q;  5C3X A;  4DV7 Q;  2A6H C;  5I2Y A;  4DR2 L;  2V4D A;  1R9T B;  1BNZ A;  2JEA I;  4IN3 A;  1XJV A;  4OWW B;  1GHJ A;  5KND A;  1N32 L;  1STN A;  2R93 G;  3HOY B;  3DWQ A;  2C9O A;  4YCW A;  3RZD H;  2UXB L;  3MC0 B;  4DV6 Q;  3BG3 A;  4JI0 Q;  2NVQ B;  3EQL C;  1I6H B;  4DAM A;  2Q2U A;  4F8M A;  1XNR Q;  1ENF A;  1C4Q A;  5FLX L;  1PA6 A;  3GDE A;  1VF7 A;  3A54 A;  1B9M A;  2VS1 A;  1VQE A;  1VQO A;  3NEM A;  2X69 A;  4LNQ A;  2JK8 A;  4FF2 A;  2B2W A;  1LLR D;  2E2I H;  4BBR B;  1ILP A;  3PIO A;  4G7O C;  3M4P A;  3JAM E;  4HJ7 A;  3CCL A;  4O2D A;  5M3M B;  2XRQ D;  3HOW B;  1WCM H;  3J80 i;  5J22 A;  4KI0 A;  4A3B G;  3BYY B;  1OTC A;  2ASB A;  1HR0 L;  3AFQ A;  3NP8 A;  4ZAI A;  3RZO B;  1STA A;  2R93 B;  2GVB A;  3M4Y A;  3CCU A;  1M4V A;  4J1M A;  2UU9 L;  2HHH Q;  1EYD A;  4JI2 Q;  1TKW B;  3IFD A;  2DY8 A;  1IHZ A;  3RZD B;  1SYF A;  3E0E A;  1PTO D;  3OHX C;  3NTI A;  4B9W A;  2Q2T A;  4L5S A;  2R7Z H;  1YVC A;  3NWS A;  4MHE A;  4U68 A;  4PG3 A;  4OEM B;  1EY8 A;  3MFY A;  1VQG A;  4CDC C;  4OO1 H;  1I5F A;  1PV4 A;  2VXW A;  3H15 A;  1F9P A;  2CWA A;  2H5X A;  3UDI A;  5IOC A;  2UU9 Q;  3GTK B;  4BY1 B;  1QG7 A;  5M5Y B;  4EQ5 A;  5M5X B;  4QGU A;  4OXP A;  3U58 A;  4LF6 Q;  5M3M G;  5E7N A;  2ATW A;  1KHI A;  1Q8K A;  3GD7 A;  1BO0 A;  5FLX E;  4A3I B;  1SYE A;  3R2I A;  1X55 A;  4A3J H;  2IHF A;  3A7A B;  3KF8 B;  4FF4 A;  5EPK A;  4DF7 A;  4HIK A;  1FJG Q;  4K5W A;  2IHE A;  3KLS X;  2XIW A;  1UE5 A;  1J8I A;  3P75 A;  4DUZ Q;  5CV9 A;  3HGB A;  4QIW E;  1EYG A;  2NZH A;  1TS5 A;  1L1O A;  1EIH A;  1DOL A;  1JMC A;  3R2T A;  3DMU A;  2Z8L A;  3J81 i;  5IY0 A;  3A5Z B;  2RDH A;  4ABN A;  2FMC A;  4K8J A;  1IZ6 A;  1X3G A;  4C3I H;  1Q46 A;  4RGN A;  5JAV A;  3Q24 A;  3J81 L;  2F0Q A;  2ID0 A;  4RCO A;  3PCO B;  4KKU A;  4PZ7 A;  5DM6 3;  3OIQ A;  1VQ7 A;  4DAY B;  3H09 A;  5JEA H;  1LTA D;  5FJ8 G;  3LX0 A;  4MN3 A;  1WFQ A;  3GV6 A;  4A3C G;  1SJH D;  2D2C C;  5AJ3 L;  1VMP A;  4XQN A;  4GOP A;  3X3N A;  1ENC A;  2FHT A;  2LXJ A;  2EE1 A;  1EFI D;  4LUV A;  2A74 C;  2KHS A;  3F2B A;  4X64 Q;  3J7A F;  3PQI A;  2ZT9 C;  1YNN C;  2EYL A;  3S1M H;  4ULL A;  1GUS A;  5EKL A;  4H0L C;  1EZ8 A;  1HZB A;  4F88 A;  4FF3 A;  1N36 Q;  2R7D A;  1SNM A;  1HQR D;  1VQK A;  1Y1V B;  2QF7 A;  3KDF B;  2DJF C;  5C4Z A;  2EQS A;  3PO3 B;  2G9D A;  3LWU A;  4XIG S;  4C1N I;  1LUZ A;  2PQA B;  3K6O A;  4IPH A;  2PCF B;  1IYV A;  1QUQ A;  3IL8 A;  3NBH B;  1A15 A;  3OW2 A;  3H0G H;  4AQY L;  1GM5 A;  2N55 A;  2K50 A;  3FHW A;  3L7Z C;  5ELF A;  1VQ6 A;  3HOY H;  3A8I E;  3HOU H;  1DOM A;  4DV0 L;  2K03 A;  4JOI A;  4CDD C;  1MSG A;  1IW7 C;  5GAE C;  1E1T A;  2JYO A;  4Y52 H;  3GTP B;  3M4O B;  2E2H B;  2MO1 A;  3ULP A;  4RFB A;  4MZ9 A;  3G6E A;  5T1I A;  1JT8 A;  4IOC A;  2NZO A;  4B3M Q;  5HGT A;  4DR5 L;  3T13 A;  2A6E D;  1HNZ L;  1PMR A;  1RD9 D;  3PSI A;  4C3H H;  1A6X A;  5LMN Q;  3I4L A;  1ZYR D;  4IQZ A;  3OMG A;  2B2V A;  2F0D A;  3ERO A;  4R8I A;  2PMZ B;  1F77 A;  4KN7 C;  3K58 A;  5IT9 L;  1C7Y A;  1BF4 A;  1PVO A;  4O42 A;  2WAC A;  4KJN A;  3OYY A;  3P20 A;  1HJP A;  4ZK9 B;  4DNI A;  2VQF Q;  4JI4 Q;  2L15 A;  3GQB A;  4L5R C;  4GN4 B;  1Q1B A;  1X9N A;  4C3I G;  4RCN A;  1U4L A;  1EWH A;  4A93 B;  3F1Z A;  4MTK A;  1D2B A;  1ASY A;  2K05 A;  5AJ3 Q;  4IFD J;  3U4V A;  4AYB B;  4GN3 B;  3UE0 A;  4KHZ A;  2H1E A;  2NVX B;  1B7Y B;  4DV5 L;  1NR2 A;  4A3E B;  1FYC A;  4BBR G;  3TZU A;  1NSN S;  2M2L A;  1MJC A;  2VZA A;  1V1Q A;  2VUM G;  1FNU A;  4KHP L;  4QQB X;  1PRT C;  5D65 A;  4QUC A;  4NP5 A;  5IWA Q;  1WJJ A;  4LF7 L;  3JC6 6;  2PW7 A;  1N8R C;  5KNB A;  1D5Z C;  2O5J C;  3U4Z A;  5LMN L;  2R92 B;  4LF5 L;  1L0Y B;  1WD1 A;  5C4J H;  4JBJ A;  1E2W A;  4OHJ A;  4PNY A;  5DAU A;  1Q3L A;  4OO1 G;  1P8L A;  4H7B A;  1PH7 A;  2WIN B;  1XYI A;  1QNU A;  2R92 H;  3D3R A;  4KY5 A;  1HA6 A;  4BWG B;  5M3M H;  1HR0 W;  4IUT A;  1CK1 A;  2XSC A;  5EPJ A;  1W2B A;  2A1A A;  3LNN A;  4GZY C;  3PUW A;  1XNQ Q;  1A3T A;  1ET6 A;  1A2T A;  4DR6 L;  2OQ0 A;  1DD2 A;  2F0N A;  4UPA A;  2A69 D;  3Q22 A;  4ME3 A;  4P73 A;  1I94 Q;  4AYB G;  3CCS A;  1Z6H A;  4N8X 1;  1WCM G;  4DUZ L;  2QEJ C;  4A3J B;  2PYK A;  3HOX H;  3A74 A;  4X65 L;  1K8A C;  2PQA A;  2H4O A;  4AYB E;  2JA7 B;  3G7L A;  1VQM A;  3HKZ B;  3VYT A;  1T9H A;  4K6L A;  4C3I B;  5COY A;  1I94 L;  2HD3 A;  2BH2 A;  5I6Y A;  1F2Y A;  2OQK A;  1TII D;  3MXN A;  2ZM6 Q;  3QJY A;  2HDM A;  3SXH A;  3S1M B;  2R92 G;  2RHQ B;  3FDT A;  2JN4 A;  2B2Y A;  2YU9 H;  3OPO A;  2R61 A;  3H6M A;  4J8Q A;  4YCU A;  2ZTD A;  5FO7 B;  4DUY L;  2IY5 B;  3F2D A;  1ROD A;  1C9O A;  2BOS A;  2JA6 B;  4CJ2 C;  3PO3 G;  3GTL H;  4WJ4 A;  3TRE A;  4B3R Q;  2ZM6 L;  1L0W A;  1Y69 U;  3T56 B;  4RWS C;  4UY8 C;  2MQH A;  1JC7 A;  1SE8 A;  1HNW L;  3HOV H;  3S15 H;  1PH1 A;  4LF8 Q;  3CCR A;  3C46 A;  2KJX A;  4G7Z C;  5KYI A;  1I3Q B;  5ELN A;  4JI1 L;  4C2M B;  1XNR L;  3HOZ B;  1HA5 A;  2RSN A;  1SLJ A;  1AN8 A;  1R4Q B;  2Z6K A;  2UXB Q;  5IYD G;  1PFS A;  1VQN A;  3R93 A;  1L0X B;  3S1Q B;  4E6I A;  4V19 0;  3I56 A;  3ULL A;  1TY0 A;  2IL8 A;  3PUV A;  1GHK A;  4R8N A;  2D5D A;  3GTO B;  5GAH C;  4ZUJ A;  2I5M X;  4IFD I;  2DNC A;  3NXW A;  1D7Q A;  3SR1 A;  1ONL A;  1GUN A;  2RSO A;  1SDF A;  1NBW A;  1PFM A;  3MXN B;  5EBD A;  2NVT B;  3HOU B;  3F2C A;  5JJI A;  4BY7 H;  5IYC H;  3TSS A;  2F1M A;  4OIK A;  3CCM A;  2HUG A;  5KEE A;  3BS1 A;  4G4K A;  4IJH A;  1AE3 A;  2HIV A;  4XTC S;  2R7Z G;  3HKZ G;  3Q8D A;  4DR1 L;  1K8O A;  3NTK A;  2L9H A;  3K7U C;  1E0B A;  3OWF A;  2EY1 A;  4OO1 I;  2CW0 C;  2JEB I;  3PMF A;  1IBM L;  1HZC A;  3J81 E;  2UXC Q;  3PIP 3;  5IP7 H;  2SNM A;  4KY6 A;  1V1P A;  1CI3 M;  1U0L A;  2JA8 G;  2E2J B;  4DR5 Q;  1OXV A;  2F3I A;  3FKI H;  4A4I A;  1E24 A;  3AEV A;  1DON A;  2MNA A;  4DR4 L;  1Q90 A;  3DEP A;  2KEE A;  1F2M A;  2OF1 A;  5AFW A;  5IP9 H;  5CR3 A;  1LTG D;  3DHQ A;  1HZ9 A;  2PMZ E;  1VDZ A;  5CYU A;  4LF6 L;  3V2T A;  3I4O A;  2RF4 A;  4JBW A;  1JE4 A;  2P5Z X;  2R6G A;  4FXD A;  4HN7 A;  1K8M A;  2CQO A;  5CV7 A;  1A63 A;  1JWU D;  1O80 A;  3AFP A;  3NQT A;  1EQR A;  5K36 G;  1JR0 D;  3PO2 H;  1RKN A;  3ND8 A;  2L1B A;  3I8Z A;  1EQQ A;  2GN5 A;  1BXT A;  2K7V A;  3NWT A;  1Y1W H;  2B39 A;  2K5D A;  4A3M G;  1STY A;  5IP7 G;  4XYO A;  2ZXP A;  3RZO H;  2R93 H;  5ISR A;  4G7H C;  1ET9 A;  1J5E Q;  2E5L Q;  3KF8 A;  2JE6 I;  3I7F A;  2Q2H A;  1R4P B;  3Q0A A;  1NY4 A;  4C3H G;  3CRL C;  1EY0 A;  3S14 H;  4U67 3;  4PMB A;  1WYD A;  4BBR H;  3H94 A;  3S24 A;  1D8L A;  4C3J B;  2A68 C;  2EY5 A;  3U9O A;  5D14 A;  1O78 A;  1JB3 A;  1YNJ C;  4L8J A;  3CW2 C;  3UI2 A;  4JI6 L;  1FL0 A;  2IT1 A;  1GUW A;  4TRD A;  1BUV T;  3NSW A;  4OWX B;  1A3V A;  3HZX A;  1SNQ A;  2L55 A;  1V43 A;  2F0E A;  3KBG A;  4R1J A;  1G2T A;  5M5W B;  2X6G A;  5C44 H;  1Q8I A;  1WTH A;  3K80 C;  3I72 A;  4ZYS A;  1NTG A;  1TWF H;  1GD7 A;  1HCZ A;  1MIU A;  2EVB A;  5C3E H;  4WJ3 M;  1N33 Q;  4Q0F A;  2WKC A;  3HKZ E;  3ICE A;  2UUC Q;  2A68 D;  3S16 H;  1VQA A;  2E2I B;  1J6Q A;  3E5S A;  1UE7 A;  1PRT D;  2Z1C A;  4GOP B;  3M7N A;  4A3G H;  4A3C H;  1H9S A;  5C4H A;  5LL6 S;  3ULJ A;  1FVI A;  1BVS A;  1WTV A;  4JG2 A;  3PV0 A;  3NQI A;  1GO3 E;  2EZV A;  4UP9 A;  1VMC A;  1KRS A;  3HOV G;  3D6C A;  1SMX A;  1VQJ A;  2F0I A;  1KDB A;  3WWV A;  1CHQ D;  1FGU A;  5C0X I;  4IPC A;  1AZQ A;  5CBE E;  4YY3 Q;  4FF1 A;  2MFI A;  1QB5 D;  3EJI A;  3Q6S A;  2A19 A;  5DLQ E;  4YWM A;  3PUX A;  3UE1 A;  4YCV A;  4POG A;  5M5W H;  5BR8 L;  4FO2 A;  3MWY W;  4R4O A;  2AWO A;  3CCV A;  3EFX D;  1N33 L;  4GS3 A;  4NMZ A;  3GTK H;  2A69 C;  4KHV A;  3MEF A;  1Z7T A;  4YIJ A;  5CGK A;  3DWP A;  4F7X A;  1B1Z A;  3JAM L;  1KNE A;  1WTW A;  2F0P A;  5CV8 A;  2VQF L;  2O5I C;  4MTN A;  1HNX L;  5C4X G;  2JA9 A;  4YWL A;  1JCK B;  2F52 A;  4IUP A;  2L5T A;  3AMU A;  1K28 A;  1SE3 A;  2LXK A;  4LUO A;  4A3K B;  4P74 A;  4ZKC B;  1GVP A;  2ICE C;  2AQ1 B;  5FJ8 H;  4RGT A;  4DXG A;  5C0X H;  4TQU S;  3M85 A;  5M3F B;  2K04 A;  2EY2 A;  3A8J E;  2J4X A;  1I4G A;  4MIU A;  4WOR A;  2B2Y C;  5A2Q E;  1SRU A;  3BZK A;  1HQM C;  1NAP A;  4DAY A;  3I91 A;  1KAB A;  4JPB W;  2N3S A;  4A3L H;  2WB1 G;  2KCC A;  4H02 A;  2F0L A;  3QOJ A;  3K8A A;  1HZA A;  3HOY G;  3ITP A;  5JEA G;  1LTR D;  2NN6 I;  2ZJQ A;  1F9Q A;  3T1Y L;  4P71 A;  2X6L A;  1TWA H;  4CHT B;  4DK3 C;  4QIW B;  3J7Z C;  1C8C A;  1QZG A;  1YNJ D;  2QA4 A;  1YBY A;  1L1O B;  4B3T Q;  5I9O A;  3A55 A;  4XT3 B;  2RDF A;  2D9U A;  1EUJ A;  3GTG B;  4PQX A;  1BCP F;  1XMO Q;  1PZK D;  4R4I A;  4K5X A;  2NVY B;  3D31 A;  4X64 L;  4BXX G;  2K32 A;  3PUZ A;  4C3H B;  2F0K A;  3D8G A;  5M3F G;  2MPM A;  2M00 A;  2QW7 A;  4K0K Q;  3KOJ A;  2LMC B;  1R9T H;  1XNQ L;  4NXN Q;  4Y7N H;  2AUK A;  1QCB D;  1EY5 A;  3K59 A;  4HIO A;  3P1H A;  4A3J G;  1EFW A;  3M4Q A;  5C4X B;  2IW3 A;  1E7Z A;  2JXM B;  1N32 Q;  4DR6 Q;  3CF5 A;  2KA7 A;  2CCZ A;  3J7A 5;  1EIY B;  1KLU D;  3S9W A;  1WOC A;  1K0S A;  3DWA A;  1G6P A;  2A73 B;  4JBK A;  2K5W A;  1XMQ Q;  5JOB A;  3MFG A;  2NUC A;  2UUB L;  5LMU Q;  3KJO A;  3TDQ A;  4DV7 L;  4LFA L;  2WB1 B;  1LTB D;  1XMO L;  1IBL Q;  1JWS D;  2E8G A;  1LM0 A;  1JE5 A;  3DXJ C;  4I65 A;  1VQ4 A;  3HOW G;  2LFN A;  1UAP A;  3I3C A;  1A3U A;  1IKM A;  4WJW A;  3ONA B;  3LWE A;  3ERS X;  4HJ8 A;  3NEN A;  4DR3 L;  4DR7 L;  2JQO A;  1EY6 A;  5IGG A;  5ELE A;  3T53 B;  5EGT A;  2XWJ B;  2Z4H A;  4AH6 A;  4KN4 C;  1H9R A;  1LTT D;  3D4W A;  5FLX c;  3G48 A;  2VUM B;  2F0W A;  5FLM H;  2K4K A;  1U5K A;  2MP1 A;  2Z4I A;  5BN5 A;  3CMA A;  4PMW A;  4C3J H;  2KCN A;  3T16 A;  2AQ3 B;  2F4V L;  1XWE A;  1CKN A;  2EYP A;  2D0O A;  3TEH B;  4X3S A;  3TP6 A;  2YU9 B;  3T1H Q;  4EQP A;  1PLF A;  2YTX A;  4NW2 A;  1G2S A;  3CPW A;  5IP9 G;  3JAM i;  1Q86 C;  5M5X H;  2F0O A;  3BYT B;  1G6Z A;  1PH2 A;  3VA5 A;  1Y8N B;  1IBL L;  5A35 A;  1SRO A;  2F4V Q;  1F9R A;  5C44 G;  2CFM A;  4L5Q A;  3T1H L;  2G9H D;  3S1N H;  1X6O A;  3T4A C;  2JA7 H;  4CJ0 B;  1TT2 A;  4C2M H;  5NUC A;  4LK1 C;  1S72 A;  1SSO A;  4DFA A;  4BBS G;  2E74 C;  3FPP A;  3CC4 A;  1RL2 A;  2B2T C;  5CC4 A;  1IXR A;  2KEC A;  2VB3 X;  2KCT A;  2FFK B;  2VY3 A;  2WII B;  2AMC B;  1SNP A;  2VB2 X;  1PZI D;  4GKJ L;  1H9M A;  3B6Y A;  1V8Q A;  2GA4 B;  3I4N H;  2PZW A;  1VQ5 A;  4LF7 Q;  1ILQ A;  3PIO 3;  1MHW C;  4YY3 L;  3W1G A;  2I5H A;  1STB A;  2KCM A;  3D6W A;  4P2C B;  3CCE A;  3RN2 A;  3MAQ A;  1M1K C;  3CHB D;  4DV4 L;  4DV5 Q;  3IAY A;  3BU2 A;  1Y1V H;  2CH4 A;  3FMC A;  3K81 C;  1PTO C;  2NZ1 D;  3NBH A;  3ND9 A;  3A8K E;  3I73 A;  1SFO H;  3K7A H;  3N52 A;  1NCV A;  4QY7 A;  2K6A A;  3CCJ A;  1FNV A;  3T51 B;  1XMQ L;  2JSO A;  3KK7 A;  4A3F B;  4DR4 Q;  3ZJY C;  1VQI A;  1DOK A;  1JJC B;  1Y14 B;  2B63 H;  3HOV B;  3S15 B;  2Z9H A;  3SK4 A;  3P7J A;  3TS2 A;  1WTO A;  4LMQ D;  1O7Y A;  4DK0 A;  2JA5 B;  4B3T L;  2M9V A;  5IGF A;  3TP5 A;  2CH4 W;  1EY7 A;  1WVL A;  1PH6 A;  5CMD A;  1K9M C;  4YWK A;  1GOZ A;  3GTJ H;  4DR2 Q;  4P72 A;  3KLW A;  4BBS H;  1CT1 D;  3SGI A;  2DY7 A;  3AU7 A;  4I7A A;  4K0K L;  1EIG A;  1EWI A;  1JWM D;  3L3O C;  1K73 C;  1UE6 A;  4CDE C;  2UUA Q;  1I6H H;  5EKI A;  1EYC A;  3CAM A;  3FKI G;  4LWC A;  4DK1 A;  3CCQ A;  3BDC A;  2JA8 H;  1P16 A;  3PF5 A;  1NNX A;  2K52 A;  5JPN C;  2KUM A;  4MNO A;  4CGY B;  4KJO A;  1VCI A;  3AB9 A;  2ALY B;  1W6J A;  2PO4 A;  1E1O A;  5M3F H;  2JA7 G;  3N6R A;  1UWV A;  3CU7 A;  5JJZ A;  4XQQ A;  5LMN W;  1LT3 D;  2B63 B;  1B3Q A;  3MA2 B;  4DV1 Q;  2HQL A;  3MHB A;  1EIF A;  1TY2 A;  4GLA C;  4B3S L;  4LF4 Q;  2N78 A;  2UXD Q;  1D6E C;  2D62 A;  4L6T B;  2N88 A;  5HY6 A;  1HR0 Q;  1LT5 D;  4KD3 A;  2I5L X;  1PRT B;  1I4H A;  2PZU A;  4X3K A;  3CC7 A;  1ASZ A;  1O7Z A;  2EOT A;  3CP0 A;  3QG1 A;  3KFU A;  1HNW Q;  4A3L G;  3RUZ A;  3QIA A;  1PYS B;  3L9A X;  3SVM A;  3JAM c;  2CVR A;  4QL5 A;  1QE6 A;  3C3L A;  5EAY A;  1SN8 A;  1LTL A;  1AEX A;  1RJT A;  4H44 C;  2C5C A;  4KMU C;  3S17 B;  2IX0 A;  5ELC A;  3TBI B;  4GNX B;  2OCE A;  1EEF D;  1LO5 D;  4DK6 C;  3RD4 A;  1VQH A;  2VQE L;  2NVQ H;  1EYA A;  2KOL A;  1SND A;  2E76 C;  3GV3 A;  3NEL A;  1VQ9 A;  4DNT B;  2K14 A;  3UDG A;  4XXE A;  4NPS A;  3S17 H;  2E75 C;  4K5V A;  5C4X H;  1OXU A;  4NXM L;  2D0P A;  3CPF A;  4C56 C;  2A6H D;  4GLV B;  2AKW B;  1IYU A;  1TWH H;  1HH2 P;  3I90 A;  1F9S A;  2AQ2 B;  4OIJ A;  2HCC A;  2OXP A;  3FKI B;  4OON A;  3OWE B;  2F3W A;  3IFT A;  2RKS A;  1X3Q A;  1SNC A;  1XX8 A;  2SEB D;  1B53 A;  2MO0 A;  1SAP A;  1VQD A;  5J1Z A;  5ELB A;  4APV A;  5BR8 Q;  1CZG A;  4AIM A;  4DR1 Q;  2BDN A;  2BCO A;  1TU2 B;  2EXZ A;  2RA4 A;  1IL2 A;  4GKJ Q;  1IYJ B;  2QEX A;  3QOL A;  3QB3 A;  1YNN D;  1JOO A;  1LTS D;  1NE3 A;  2EYM A;  4JI3 L;  1PH5 A;  1UNS A;  1PDQ A;  4X66 Q;  1N34 L;  4O0A A;  3VR4 A;  3BVZ A;  4M1U B;  3S1R B;  2NN6 G;  3G4S A;  1DZ1 A;  4QJF A;  2WAQ B;  3TS0 A;  1A2U A;  1YHA A;  1U9R A;  3TQY A;  4A3B B;  2WAQ G;  3U50 C;  4QMG A;  3V96 A;  2CKZ B;  2EY6 A;  2AWN A;  4C3J G;  4QUF A;  4YHH Q;  1BBW A;  3KUP A;  1RTO A;  4LAA A;  5HGQ A;  4LFB Q;  3W3A A;  3T1Y Q;  5D3I B;  4JI5 L;  1QVG A;  1AFP A;  2IWH A;  3K57 A;  4IO9 A;  2TMP A;  4JI8 L;  1WTR A;  4X3U A;  3SE0 A;  4LW1 A;  2LS0 1;  1ESF A;  1SJE D;  1I6V C;  1RHP A;  1E2V A;  2PW5 A;  3EVQ A;  3H0G G;  2F0V A;  4A3G B;  3MXP A;  4Q5V A;  5LL6 X;  1QUQ B;  1X3P A;  1F2Z A;  4XT1 B;  1SEB D;  5IT9 c;  4DGZ A;  2JA5 G;  1S5D D;  5IE8 A;  1I4R A;  1NUC A;  3C2P A;  2ENB A;  2R7Z B;  1PXU A;  5BN4 A;  1M90 C;  2I0Q A;  4J15 A;  1NR4 A;  1BKB A;  1B70 B;  1SE4 A;  3ZYY X;  2PPB C;  4A3M B;  1K3B C;  1KDC A;  4FXK C;  1CKO A;  2CW0 D;  2K33 A;  2DJG C;  3GTL B;  4FXG C;  1QWY A;  5C3E B;  5L37 A;  5CV5 A;  1B9N A;  1CQV A;  4IZ8 A;  2K01 A;  2NB0 A;  3SHL A;  2B2T A;  3HFZ B;  1S3O A;  1I3Q H;  3BVM A;  3BDL A;  4GKK Q;  4CDF C;  3NTH A;  2F0M A;  2SNS A;  1YJ9 A;  1Y1W G;  2PI2 E;  1HUM A;  2XRS D;  2K5Q A;  4K2K A;  4X62 L;  4BA2 I;  4TKO B;  4H13 C;  4HCS A;  2J0T D;  3OTO Q;  3UDF A;  4FYD A;  2OTL A;  3MVV A;  4A3I G;  1SMY C;  2B2W C;  1PYB A;  3CME A;  1PH8 A;  3PF4 A;  4BA1 I;  4RH6 A;  1V1P B;  4ME5 A;  2UUB Q;  3EN2 A;  4R9W A;  4BBS B;  2BDO A;  3VR3 A;  4NB3 A;  4DKA C;  2DGY A;  3L2P A;  3PUY A;  3J80 E;  1XPR A;  4K6D A;  4DAP A;  5FO9 B;  4OX9 Q;  3RR5 A;  3SEB A;  4FDB A;  1X3E A;  3WDN A;  1BQQ T;  5FK9 C;  2JA6 G;  4JI3 Q;  4GN5 A;  1CSQ A;  3NBI A;  1WTP A;  2PNH A;  3SDZ A;  3DEO A;  3FP9 A;  1JOQ A;  1CZW A;  1NMG A;  1EL0 A;  1CQF A;  2Z6B A;  1PZJ D;  1X65 A;  2OT2 A;  1YHQ A;  2DN8 A;  1S40 A;  1N36 L;  1LAC A;  4JV5 L;  3K5O A;  1II3 A;  2PQE A;  5FOB B;  3M7G A;  2KVM A;  4HTH A;  1EU3 A;  1VQB A;  1MJE A;  4CKC A;  4BS9 A;  3QO2 A;  1EY9 A;  1E22 A;  1UUP A;  5EJW A;  4KTA A;  1MBY A;  3RLO A;  2PNR C;  1MD2 D;  4HJ9 A;  1TWH B;  1DXM A;  1ML0 D;  4K14 A;  1G51 A;  1HTL D;  2A8V A;  1B50 A;  4AQY Q;  4B3M L;  5C3W A;  2ZJR A;  2MGS A;  3J81 c;  1TWC H;  2ZTE A;  1CA5 A;  3IKJ A;  4DXF A;  1K83 B;  5I4D A;  2YYZ A;  1OXX K;  3J80 L;  1WTQ A;  4DA2 A;  3MXG A;  4HSV A;  4C1N K;  2BA1 A;  2Q8T A;  1YNX A;  2Q2I A;  1RIP A;  4HSP A;  5IYC G;  1S5B D;  2XVS A;  4R4C A;  3E9H A;  1UEA B;  1S5C D;  4JYA L;  3S2D B;  2EJM A;  2QCP X;  1Q7Y C;  1J5E L;  4A75 A;  4GOP C;  1FGB D;  3DLL A;  1TS2 A;  1PFN A;  2I46 A;  4X3T A;  4X65 Q;  1F2L A;  2RDG A;  4JI2 L;  4A3I H;  5JJL A;  4XDX A;  1BOS A;  4GLX A;  1Z47 A;  3U9S A;  1RCV D;  3DM3 A;  3TZD A;  4DN4 M;  5FLM G;  4L63 B;  1DYQ A;  4NXN L;  1SR3 A;  5K36 H;  4A3D B;  1IBK L;  1V1O A;  5M5Y H;  4RHS A;  4I7Z C;  4F87 A;  4LF5 Q;  5H1S E;  3W1B A;  3STB D;  2AHO B;  4OX9 L;  2BE5 D;  2XWB B;  1ZKO A;  2Q8R E;  5IGD A;  2E2D C;  2N49 A;  1VQL A;  4YHH L;  1V9P A;  1VQF A;  2K28 A;  1VQP A;  1DGS A;  4A3B H;  4TVA B;  4CBV A;  1BDO A;  1EZ6 A;  1N9W A;  1PH3 A;  5IWA L;  5HUR A;  2F0F A;  3S1Q H;  4IFD H;  3S2H H;  4JV5 Q;  2UUA L;  4LJZ C;  3C1F A;  4DUY Q;  4DV2 Q;  1XTD A;  3KJP A;  4LUZ A;  2V1C C;  3CC2 A;  3K5M A;  2WP8 J;  1KC8 C;  2F03 A;  3RLN A;  3QWN A;  1I4P A;  1Y8P B;  3HOX B;  2HCI A;  4O1N A;  1TS4 A;  2CHB D;  2HQE A;  1H9S B;  1T5E A;  5J3B A;  3F8T A;  1A62 A;  4DNR B;  4A3K H;  4BY7 G;  3WOF A;  4ALP A;  4X62 Q;  3TRZ A;  2UUC L;  5JJK A;  3J80 c;  1KL9 A;  3GP7 A;  4ODG A;  3FEW X;  4HR7 B;  3D4D A;  4A3F H;  1QVF A;  4BXX H;  4IUV A;  1RF2 D;  1XTC D;  3FVQ A;  3NPP A;  4ZCK A;  3E3X A;  1CUK A;  1U4P A;  2B8F A;  4UHV A;  3J7A V;  2B2V C;  1SYB A;  4XQJ A;  1MGS A;  2YV5 A;  2E5L L;  1RTN A;  5E1F A;  4ZQ3 A;  3KDF A;  3K7A B;  3I4M B;  2MJ8 A;  1H95 A;  1ICF B;  1SYC A;  4B3R L;  5KYL A;  5M9O A;  3GTJ B;  1HNX Q;  2KEN A;  1TQO A;  2A5H A;  2VQE Q;  2MUY A;  4JYA Q;  2L11 A;  3OOC A;  5KIX A;  3S2H B;  3BDO A;  2SOB A;  3OSO A;  4ZLT F;  1PHJ A;  1CKN B;  5C0X G;  3CQZ B;  4A3K G;  3I2Z A;  1DM0 B;  3H3V I;  1TXY A;  1H9J A;  1IL8 A;  4HID A;  4DV3 Q;  2ZTC A;  2F0H A;  4L5T A;  1AE2 A;  1AZP A;  5GAG C;  1EQV A;  2XNA C;  1HNZ Q;  5IIF A;  1B4O A;  2HHH L;  4DV0 Q;  3HOX G;  4KD4 A;  3HG9 A;  3BVG A;  1JJ2 A;  3I4M G;  2VL6 A;  4DPG A;  1HPC A;  2F3V A;  2WKD A;  1H9K A;  3I70 A;  4A76 A;  2NVT H;  5ELO A;  3J7Y W;  1VF5 C;  3AQQ A;  1STG A;  4HMI A;  3NE5 B;  2RQX A;  2N8N A;  2Z0S A;  1KQS A;  1B44 D;  1UE1 A;  2CWP A;  1ZXT A;  2NVY H;  3M3Y H;  5IYB G;  2XGT A;  1GKH A;  3TME A;  1YJW A;  2KHI A;  3TP8 A;  4RAU C;  4QF4 A;  1BBX C;  1YI2 A;  4A3E H;  1YJN A;  5IGE A;  3TN2 A;  2KED A;  1IBM Q;  1EY4 A;  2L4N A;  4X6A H;  4JI8 Q;  1SXT A;  1TWC B;  4NKL A;  4DAV A;  1T5X D;  4G57 A;  3VDY A;  1B2T A;  4A3F G;  1BCP B;  5DNF A;  2XTI A;  1HFG A;  1TWF B;  2EDG A;  1GXD C;  1SBB B;  1IW7 D;  1G91 A;  5KNC A;  2B63 G;  1C0A A;  3SK6 A;  3RMH A;  4FVM A;  4J6H A;  1HFN A;  5EQ0 A;  3MZ5 A;  2R7F A;  2F4I A;  5LMU L;  4JBM A;  5BN3 A;  4XYQ A;  5F2D A;  2UXC L;  1NMF A;  3KF6 A;  4POF A;  5G3L F;  1VS0 A;  2YTV A;  1A0I A;  1WI5 A;  3HS0 C;  4LFC L;  3URY A;  2O2L D;  3TP7 A;  3RNU A;  1KNA A;  5I2X A;  2VUM H;  4IFD G;  3M3Y B;  5C0X J;  3O13 A;  3S1N B;  1ZYR C;  4ID6 A;  5EBC A;  4OGQ C;  4HJ5 A;  1WCM B;  3VA7 A;  2B29 A;  2IPK D;  1AH9 A;  4PZ8 A;  1PRT F;  1LYL A;  4GKK L;  3S14 B;  4RMF A;  4BY1 H;  1IBK Q;  5GRO A;  1XXG A;  2DUD A;  1SE2 A;  3RLF A;  4EGV A;  4EX5 A;  2UXD L;  2FMM A;  3OW7 A;  1ENA A;  4KV6 A;  3OTO L;  4WFN 3;  3K5N A;  1VQ8 A;  4A3D G;  1K8G A;  1LT4 D;  2XN9 C;  2B3G A;  2K5V A;  4PV1 C;  1EQT A;  3HP3 A;  2WFW A;  2Y0S E;  3I55 A;  1QNK A;  3DM1 A;  1GUT A;  4DR7 Q;  1S4Z A;  2KBN A;  4OL7 A;  3ER0 A;  1FNW A;  3H3V H;  4V0B A;  3KYH C;  2KHJ A;  1LT6 D;  3BZC A;  4KKS A;  1JQY D;  1TWG H;  4IAL A;  3HOU G;  3S1R H;  1XPU A;  1KAW A;  1O7L A;  3DUZ A;  3IRB A;  3VR6 A;  4DV6 L;  4EVO A;  1WTX A;  2I07 B;  2NTS A;  4JOI C;  2ZJP A;  4LF8 L;  2OWO A;  3G6J B;  3VYU A;  4EQN A;  4KK7 A;  1PFB A;  1HTP A;  3EBE A;  1OO9 B;  2Q8I B;  1X32 A;  3AYH B;  5G3L D;  3K5L A;  1BCP D;  3VR2 A;  2TSS A;  3I4N B;  2RBM A;  4JC0 A;  3EA6 A;  2VW9 A;  2K5N A;  1YHB A;  2QIL A;  4EQO A;  2JA6 H;  2FJ2 A;  3E6Z X;  2EIF A;  1SNO A;  1AP0 A;  3H3V C;  1CHP D;  1TWA B;  1IKL A;  5CV6 A;  2PZT A;  1N34 Q;  5C5M A;  4IUN A;  4HJA A;  1WD0 A;  1L2F A;  3I4M H;  4OEL B;  2HDL A;  2Y0S G;  1SYD A;  1HXY D;  1LV9 A;  4RHR A;  5FO8 B;  3HOZ H;  2WV6 D;  3SK5 A;  2IX1 A;  4S3S A;  4UDU C;  2PI2 A;  1Q82 C;  4JI4 L;  4CJ1 B;  3J81 j;  1ESR A;  5IGC A;  4B08 A;  1YEZ A;  4X66 L;  3WOE A;  1FJG L;  4N9P A;  4LFB L;  3PGZ A;  2K5H A;  3G71 A;  3A7L A;  2EYJ A;  4JI6 Q;  2B2U C;  2B8G A;  3PO2 G;  1XPO A;  3BJU A;  2E2J H;  2K75 A;  1PH9 A;  2C35 B;  3GTQ H;  4N9T A;  1LAB A;  4FNF A;  2QGQ A;  3FPU B;  1B3A A;  1E3P A;  4K8I A;  1QOH A;  2IX3 A;  2DNE A;  4M8A A;  5EPL A;  5KGU A;  4KHP Q;  1SYG A;  5CBA E;  3GO5 A;  3GTQ B;  2JA5 H;  4ZRZ A;  3LGJ A;  4IOA A;  1B8A A;  1QVC A;  1PTO H;  5EKK A;  5C6A A;  1KXL A;  5JVH 3;  1X56 A;  4Y7N B;  2YTY A;  3K0X A;  3KLR A;  1GUO A;  3W2D A;  3GTO H;  2NN6 H;  2NTT A;  5CV4 A;  1G8Z D;  1CKM A;  1OXS C;  3C1E A;  2J7Z A;  3GTG H;  2RVL A;  3MEH A;  2LKV A;  4OWT B;  2SDF A;  4UP8 A;  3NK9 A;  1BBU A;  2ZXO A;  4B3S Q;  1CM9 A;  1I50 H;  1X3F A;  2OEO A;  1EOT A;  2E2H H;  3M4O H;  1U4R A;  1AW7 A;  1LTI D;  4R4Q A;  4JVZ A;  3HOW H;  2O4X A;  5GQO A;  1W6K A;  4A93 H;  4HCE A;  4PMC A;  5A2Q L;  1S5E D;  4IUQ A;  4IUR A;  1M8A A;  2GVA A;  3VYS A;  5I6W A;  2HT1 A;  3MTS A;  3K0Y A;  3HOZ G;  2RHS B;  1YIJ A;  5C5L A;  4IPD A;  3OMC A;  3CRK C;  1OXT A;  4KLK A;  3HKS A;  1I4Q A;  1Q1E A;  4KKT A;  3FRP B;  5IOD A;  3M9B A;  3D4R A;  3PO2 B;  1PTO F;  4Z9C B;  4A93 G;  4HAE A;  4K2L A;  3UDX A;  1U4M A;  1MSH A;  4P75 A;  1Q12 A;  3KF6 B;  1KDA A;  5C44 B;  3R8B A;  4IUU A;  1BR9 A;  5C4J B;  2ES2 A;  4DV2 L;  4PZ6 A;  3CKI B;  2EYF A;  5D3D A;  1JIC A;  2NVX H;  3KBX A;  2NWG A;  2QDB A;  3OIP A;  2AUJ D;  2ICI A;  2ZXR A;  4GNX A;  1S5F D;  1K0R A;  2LY7 A;  4FP5 D;  1L1O C;  1Z9F A;  1D5X C;  2NBF A;  4RA8 A;  1MKH A;  1FR3 A;  4JI7 Q;  2Z6K C;  4RG1 A;  1TS3 A;  3EIV A;  2VNU D;  1KAA A;  2HIX A;  4RKB A;  3PIP A;  4DR3 Q;  2RCF A;  1GJX A;  2MHV A;  5DM7 3;  4ILW A;  4R4T A;  4N8F A;  1D5M C;  4BY1 G;  1YIT A;  2F0J A;  1PH4 A;  4NXM Q;  2EYO A;  3R3O A;  3I4N G;  3X3M A;  3HRZ C;  1BCP C;  1TVX A;  3E9I A;  4JI7 L;  4LF9 Q;  5IYB H;  1CSP A;  2EJG C;  1DJR D;  4A3D H;  2B2U A;  2EXD A;  4NDX A;  1STH A;  4DV1 L;  5J39 A;  4HED A;  1EWC A;  2LSS A;  1Q81 C;  5KRU A;  3S16 B;  1HRJ A;  5T1G A;  1X54 A;  3E0J A;  3S2D H;  4LF4 L;  4IPG A;  1EOV A;  4LF9 L;  3SK8 A;  1HUN A;  1QZH A;  2FIN B;  5COR A;  2EJF C;  2EPB A;  2KQ3 A;  4RKL A;  4UP7 A;  4DV4 Q;  2IJ0 A;  1QIL A;  4KY7 A;  1KRT A;  4HIM A;  1E2Z A;  1ZEQ X;  1CFM A;  4DV3 L;  2Y0S B;  3MXU A;  3STB C;  4CKE A;  2FXQ A;  2A6E C;  1FD7 D;  3NHH A;  5E3F A;  1SFO B;  1ICW A;  4JK1 C;  3VR5 A;  1Y8O B;  4A3G G;  3D0F A;  1EEI D;  4A3M H;  5ELD A;  2CQA A;  3L0O A;  5K5P A;  2WAQ E;  1D1I A;  1TWG B; 
#chains in the Genus database with same CATH homology
 2F0G A;  1PYW D;  1J9O A;  2K1B A;  1CA6 A;  4BY7 B;  3KLS A;  1CTM A;  1D1K A;  2R3Z A;  5E4W C;  3GTM B;  1MI2 A;  4DU9 A;  2BE5 C;  5TSS A;  5JVG 3;  3Q23 A;  5IT9 E;  2F0U A;  2JP1 A;  4B9X A;  1QJO A;  2NYZ D;  4ZKB B;  3H0G B;  4CKB A;  5JPM C;  5LHY 1;  1I4X A;  4QB4 A;  1RDP D;  3F2U A;  3HEJ A;  3ERQ A;  1DCZ A;  1STE A;  1JOK A;  2BA0 A;  2QKI C;  2EYH A;  4TSS A;  3V05 A;  5E4X A;  3NUC A;  5FKA C;  2F0S A;  3H91 A;  2L12 A;  1HHV A;  1TR5 A;  5DEH A;  1EU4 A;  3A56 A;  1PTO B;  1C48 A;  4RGO S;  4QCL A;  1GUG A;  1Y1W B;  1KLG D;  3BZD B;  1SMY D;  4HMJ A;  1KTK A;  5JEA J;  2L0C A;  2JA8 B;  2F0T A;  4RGM A;  4UAI A;  1G29 1;  4WRD A;  3VYR A;  5IGB A;  5I9P A;  4ZUI A;  1I50 B;  1JOR A;  5C3X A;  2A6H C;  5I2Y A;  1BNZ A;  2V4D A;  1R9T B;  2JEA I;  4IN3 A;  1GHJ A;  5KND A;  1STN A;  3HOY B;  3DWQ A;  2C9O A;  3MC0 B;  3BG3 A;  2NVQ B;  3EQL C;  1I6H B;  4F8M A;  1ENF A;  1C4Q A;  5FLX L;  1VF7 A;  3A54 A;  1B9M A;  2X69 A;  4FF2 A;  2B2W A;  1LLR D;  4BBR B;  1ILP A;  4G7O C;  3JAM E;  5M3M B;  2XRQ D;  3HOW B;  5J22 A;  4KI0 A;  3BYY B;  3NP8 A;  4ZAI A;  3RZO B;  1STA A;  2R93 B;  3M4Y A;  1M4V A;  4J1M A;  1EYD A;  1TKW B;  3IFD A;  2DY8 A;  1IHZ A;  3RZD B;  1SYF A;  1PTO D;  3OHX C;  3NTI A;  4B9W A;  3NWS A;  4MHE A;  4U68 A;  1EY8 A;  3MFY A;  4OO1 H;  2VXW A;  1F9P A;  5IOC A;  3GTK B;  4BY1 B;  1QG7 A;  5M5Y B;  5M5X B;  3GD7 A;  1BO0 A;  5FLX E;  4A3I B;  1SYE A;  3R2I A;  3A7A B;  4FF4 A;  5EPK A;  4DF7 A;  4K5W A;  3KLS X;  2XIW A;  1J8I A;  3P75 A;  5CV9 A;  3HGB A;  1TS5 A;  1EIH A;  1DOL A;  3R2T A;  3DMU A;  2Z8L A;  2RDH A;  4ABN A;  2FMC A;  4K8J A;  4RGN A;  5JAV A;  3Q24 A;  3J81 L;  2F0Q A;  2ID0 A;  4RCO A;  4KKU A;  5DM6 3;  3OIQ A;  3H09 A;  5JEA H;  1LTA D;  3LX0 A;  4MN3 A;  3GV6 A;  1SJH D;  2D2C C;  1VMP A;  4XQN A;  3X3N A;  1ENC A;  2FHT A;  2EE1 A;  1EFI D;  2A74 C;  2KHS A;  3J7A F;  2ZT9 C;  1YNN C;  2EYL A;  4ULL A;  1GUS A;  5EKL A;  4H0L C;  1EZ8 A;  4F88 A;  4FF3 A;  1SNM A;  1HQR D;  1Y1V B;  2QF7 A;  5C4Z A;  3PO3 B;  2G9D A;  3LWU A;  4XIG S;  4C1N I;  3K6O A;  2PCF B;  1IYV A;  3IL8 A;  1A15 A;  2N55 A;  3L7Z C;  5ELF A;  3A8I E;  1DOM A;  2K03 A;  1MSG A;  1IW7 C;  2JYO A;  3GTP B;  3M4O B;  2E2H B;  4RFB A;  5T1I A;  5HGT A;  3T13 A;  2A6E D;  1PMR A;  1RD9 D;  1A6X A;  3I4L A;  1ZYR D;  4IQZ A;  3OMG A;  2B2V A;  2F0D A;  3ERO A;  4R8I A;  2PMZ B;  1F77 A;  4KN7 C;  3K58 A;  5IT9 L;  1BF4 A;  4O42 A;  2WAC A;  4KJN A;  3P20 A;  4ZK9 B;  3GQB A;  1Q1B A;  4C3I G;  4RCN A;  1U4L A;  1EWH A;  4A93 B;  1D2B A;  2K05 A;  4IFD J;  4AYB B;  4KHZ A;  2H1E A;  2NVX B;  1NR2 A;  4A3E B;  1FYC A;  3TZU A;  1NSN S;  2M2L A;  1FNU A;  1PRT C;  5D65 A;  4QUC A;  4NP5 A;  2PW7 A;  5KNB A;  1D5Z C;  2O5J C;  2R92 B;  1L0Y B;  1WD1 A;  1E2W A;  4OHJ A;  4PNY A;  5DAU A;  1Q3L A;  4OO1 G;  4H7B A;  2WIN B;  1XYI A;  1QNU A;  3D3R A;  4KY5 A;  1HA6 A;  4BWG B;  4IUT A;  1CK1 A;  2XSC A;  5EPJ A;  4GZY C;  3LNN A;  3PUW A;  1ET6 A;  1A3T A;  1A2T A;  1DD2 A;  2F0N A;  2A69 D;  3Q22 A;  1Z6H A;  2QEJ C;  4A3J B;  2PYK A;  2H4O A;  2JA7 B;  3G7L A;  3HKZ B;  3VYT A;  4K6L A;  4C3I B;  5COY A;  5I6Y A;  1F2Y A;  1TII D;  3MXN A;  3QJY A;  2HDM A;  3SXH A;  3S1M B;  3FDT A;  2B2Y A;  3OPO A;  2R61 A;  3H6M A;  4J8Q A;  5FO7 B;  1ROD A;  2JA6 B;  2BOS A;  4CJ2 C;  1Y69 U;  3T56 B;  4RWS C;  1JC7 A;  3C46 A;  2KJX A;  4G7Z C;  5KYI A;  1I3Q B;  4C2M B;  3HOZ B;  1HA5 A;  2RSN A;  1AN8 A;  1R4Q B;  3R93 A;  1L0X B;  3S1Q B;  4E6I A;  4V19 0;  1TY0 A;  2IL8 A;  3PUV A;  1GHK A;  4R8N A;  2D5D A;  3GTO B;  4ZUJ A;  4IFD I;  2DNC A;  3NXW A;  3SR1 A;  1ONL A;  1GUN A;  2RSO A;  1SDF A;  1PFM A;  5EBD A;  2NVT B;  3HOU B;  3TSS A;  2F1M A;  4OIK A;  2HUG A;  5KEE A;  3BS1 A;  4G4K A;  4XTC S;  1K8O A;  3NTK A;  2L9H A;  1E0B A;  3OWF A;  2EY1 A;  4OO1 I;  2CW0 C;  2JEB I;  3PMF A;  3J81 E;  3PIP 3;  2SNM A;  4KY6 A;  1V1P A;  1CI3 M;  2E2J B;  1OXV A;  1DON A;  1Q90 A;  3DEP A;  2KEE A;  1F2M A;  2OF1 A;  5AFW A;  5CR3 A;  1LTG D;  3DHQ A;  1VDZ A;  5CYU A;  3V2T A;  4JBW A;  1JE4 A;  2R6G A;  4FXD A;  4HN7 A;  1K8M A;  5CV7 A;  1JWU D;  1O80 A;  3NQT A;  5K36 G;  1JR0 D;  1RKN A;  3ND8 A;  2L1B A;  3I8Z A;  1BXT A;  2K7V A;  3NWT A;  2B39 A;  2K5D A;  1STY A;  4XYO A;  2ZXP A;  5ISR A;  4G7H C;  1ET9 A;  3KF8 A;  2JE6 I;  1R4P B;  3Q0A A;  4C3H G;  3CRL C;  1EY0 A;  4U67 3;  4PMB A;  3H94 A;  4C3J B;  2A68 C;  2EY5 A;  3U9O A;  5D14 A;  1O78 A;  1JB3 A;  1YNJ C;  4L8J A;  3UI2 A;  2IT1 A;  1GUW A;  4TRD A;  1BUV T;  3NSW A;  1A3V A;  3HZX A;  1SNQ A;  2L55 A;  1V43 A;  2F0E A;  3KBG A;  1G2T A;  5M5W B;  2X6G A;  1Q8I A;  3I72 A;  4ZYS A;  1HCZ A;  2EVB A;  4Q0F A;  2WKC A;  2A68 D;  2E2I B;  3E5S A;  1PRT D;  2Z1C A;  3M7N A;  1H9S A;  5C4H A;  5LL6 S;  1WTV A;  3PV0 A;  3NQI A;  2EZV A;  1VMC A;  3D6C A;  2F0I A;  1KDB A;  1CHQ D;  5C0X I;  1AZQ A;  5CBE E;  4FF1 A;  1QB5 D;  3EJI A;  3Q6S A;  3PUX A;  4FO2 A;  3MWY W;  2AWO A;  3EFX D;  4NMZ A;  2A69 C;  4KHV A;  4YIJ A;  1Z7T A;  5CGK A;  3DWP A;  4F7X A;  1B1Z A;  3JAM L;  1KNE A;  1WTW A;  2F0P A;  5CV8 A;  2O5I C;  1JCK B;  4IUP A;  2L5T A;  3AMU A;  1SE3 A;  4A3K B;  4ZKC B;  2ICE C;  2AQ1 B;  4RGT A;  4DXG A;  5C0X H;  4TQU S;  3M85 A;  5M3F B;  2K04 A;  2EY2 A;  3A8J E;  2J4X A;  1I4G A;  4MIU A;  4WOR A;  2B2Y C;  5A2Q E;  1HQM C;  1NAP A;  4DAY A;  3I91 A;  1KAB A;  2KCC A;  2F0L A;  3QOJ A;  3ITP A;  5JEA G;  1LTR D;  2NN6 I;  1F9Q A;  2X6L A;  4CHT B;  4QIW B;  1C8C A;  1YNJ D;  5I9O A;  3A55 A;  4XT3 B;  2RDF A;  2D9U A;  3GTG B;  4PQX A;  1BCP F;  1PZK D;  4K5X A;  2NVY B;  3D31 A;  4C3H B;  2K32 A;  3PUZ A;  2F0K A;  3D8G A;  2MPM A;  2M00 A;  2LMC B;  2AUK A;  1QCB D;  1EY5 A;  3K59 A;  3P1H A;  5C4X B;  2IW3 A;  2JXM B;  2KA7 A;  1KLU D;  3S9W A;  3DWA A;  2A73 B;  2K5W A;  5JOB A;  3MFG A;  2NUC A;  3TDQ A;  2WB1 B;  1LTB D;  1JWS D;  3DXJ C;  4I65 A;  2LFN A;  1UAP A;  3I3C A;  1A3U A;  1IKM A;  4WJW A;  3ONA B;  3LWE A;  1EY6 A;  5IGG A;  5ELE A;  3T53 B;  5EGT A;  2XWJ B;  2Z4H A;  4KN4 C;  1H9R A;  1LTT D;  3D4W A;  2VUM B;  2F0W A;  2MP1 A;  2Z4I A;  5BN5 A;  4PMW A;  2KCN A;  3T16 A;  2AQ3 B;  1XWE A;  2EYP A;  2YU9 B;  4X3S A;  3TP6 A;  4EQP A;  1PLF A;  4NW2 A;  1G2S A;  2F0O A;  3BYT B;  1G6Z A;  3VA5 A;  1Y8N B;  5A35 A;  1F9R A;  2G9H D;  3T4A C;  4CJ0 B;  1TT2 A;  5NUC A;  4LK1 C;  1SSO A;  4DFA A;  2E74 C;  3FPP A;  2B2T C;  5CC4 A;  2KEC A;  2VB3 X;  2WII B;  2FFK B;  2VB2 X;  1SNP A;  1PZI D;  1H9M A;  1V8Q A;  2GA4 B;  2PZW A;  1ILQ A;  3PIO 3;  1STB A;  3D6W A;  4P2C B;  3MAQ A;  3CHB D;  3IAY A;  3FMC A;  1PTO C;  2NZ1 D;  3NBH A;  3ND9 A;  3A8K E;  3I73 A;  3N52 A;  1NCV A;  2K6A A;  1FNV A;  3T51 B;  2JSO A;  3KK7 A;  4A3F B;  1DOK A;  3HOV B;  3S15 B;  3SK4 A;  3P7J A;  1WTO A;  4LMQ D;  1O7Y A;  4DK0 A;  2JA5 B;  2M9V A;  5IGF A;  3TP5 A;  1EY7 A;  1WVL A;  5CMD A;  1GOZ A;  1CT1 D;  2DY7 A;  3AU7 A;  1EIG A;  1JWM D;  3L3O C;  5EKI A;  1EYC A;  4DK1 A;  3BDC A;  5JPN C;  2KUM A;  4CGY B;  4KJO A;  1VCI A;  3AB9 A;  1W6J A;  2PO4 A;  3N6R A;  5JJZ A;  3CU7 A;  4XQQ A;  1LT3 D;  2B63 B;  3MA2 B;  3MHB A;  1TY2 A;  1D6E C;  2D62 A;  4L6T B;  2N88 A;  1LT5 D;  4KD3 A;  1PRT B;  1I4H A;  2PZU A;  4X3K A;  1O7Z A;  2EOT A;  3QG1 A;  3RUZ A;  3QIA A;  3L9A X;  3SVM A;  2CVR A;  1QE6 A;  3C3L A;  1AEX A;  1RJT A;  4H44 C;  2C5C A;  4KMU C;  3S17 B;  2IX0 A;  5ELC A;  3TBI B;  1EEF D;  1LO5 D;  3RD4 A;  1EYA A;  2KOL A;  1SND A;  2E76 C;  3GV3 A;  4DNT B;  4XXE A;  2E75 C;  4K5V A;  1OXU A;  4C56 C;  2A6H D;  1IYU A;  3I90 A;  1F9S A;  2AQ2 B;  4OIJ A;  2HCC A;  2OXP A;  3FKI B;  3OWE B;  2F3W A;  3IFT A;  2RKS A;  1X3Q A;  1SNC A;  1XX8 A;  2SEB D;  1B53 A;  1SAP A;  5J1Z A;  5ELB A;  1CZG A;  2BDN A;  2BCO A;  1TU2 B;  2EXZ A;  2RA4 A;  3QOL A;  1YNN D;  1JOO A;  1LTS D;  2EYM A;  3QB3 A;  1UNS A;  1PDQ A;  3VR4 A;  3BVZ A;  4M1U B;  3S1R B;  2NN6 G;  1DZ1 A;  2WAQ B;  1A2U A;  1U9R A;  4A3B B;  4QMG A;  3V96 A;  2EY6 A;  2AWN A;  4C3J G;  4QUF A;  4LAA A;  3KUP A;  1RTO A;  3W3A A;  5D3I B;  1AFP A;  2IWH A;  3K57 A;  2TMP A;  1WTR A;  4X3U A;  3SE0 A;  2LS0 1;  1ESF A;  1SJE D;  1I6V C;  1RHP A;  1E2V A;  2PW5 A;  3EVQ A;  2F0V A;  4A3G B;  3MXP A;  4Q5V A;  5LL6 X;  1X3P A;  1F2Z A;  4XT1 B;  1SEB D;  4DGZ A;  1S5D D;  1I4R A;  1NUC A;  3C2P A;  2ENB A;  2R7Z B;  1PXU A;  5BN4 A;  1NR4 A;  1SE4 A;  3ZYY X;  2PPB C;  4A3M B;  1KDC A;  4FXK C;  2CW0 D;  2K33 A;  3GTL B;  4FXG C;  1QWY A;  5C3E B;  5CV5 A;  1B9N A;  1CQV A;  4IZ8 A;  2K01 A;  2NB0 A;  3SHL A;  2B2T A;  3BVM A;  3BDL A;  3NTH A;  2F0M A;  2SNS A;  1HUM A;  2XRS D;  2K5Q A;  4K2K A;  4BA2 I;  4TKO B;  4H13 C;  4HCS A;  2J0T D;  4FYD A;  3MVV A;  1SMY C;  2B2W C;  4BA1 I;  4RH6 A;  1V1P B;  4ME5 A;  4R9W A;  4BBS B;  2BDO A;  3VR3 A;  3PUY A;  3J80 E;  4K6D A;  4DAP A;  5FO9 B;  3SEB A;  3WDN A;  1BQQ T;  5FK9 C;  3NBI A;  1WTP A;  3SDZ A;  3DEO A;  1JOQ A;  1CZW A;  1EL0 A;  1CQF A;  1PZJ D;  2OT2 A;  2DN8 A;  1LAC A;  3K5O A;  1II3 A;  2PQE A;  5FOB B;  3M7G A;  2KVM A;  4HTH A;  1EU3 A;  4CKC A;  4BS9 A;  3QO2 A;  1EY9 A;  1UUP A;  5EJW A;  4KTA A;  1MBY A;  2PNR C;  1MD2 D;  1TWH B;  1DXM A;  1ML0 D;  4K14 A;  1HTL D;  1B50 A;  5C3W A;  2MGS A;  1CA5 A;  3IKJ A;  4DXF A;  1K83 B;  5I4D A;  2YYZ A;  1OXX K;  3J80 L;  1WTQ A;  4DA2 A;  3MXG A;  4HSV A;  4C1N K;  2BA1 A;  2Q8T A;  4HSP A;  1S5B D;  2XVS A;  3S2D B;  1UEA B;  1S5C D;  2EJM A;  2QCP X;  1FGB D;  4X3T A;  1TS2 A;  1PFN A;  2I46 A;  1F2L A;  2RDG A;  4XDX A;  1BOS A;  1Z47 A;  3U9S A;  1RCV D;  3TZD A;  4DN4 M;  4L63 B;  1DYQ A;  5K36 H;  4A3D B;  1V1O A;  4RHS A;  4I7Z C;  4F87 A;  2BE5 D;  2XWB B;  1ZKO A;  2Q8R E;  5IGD A;  2E2D C;  2K28 A;  4CBV A;  1BDO A;  1EZ6 A;  5HUR A;  2F0F A;  4IFD H;  3C1F A;  4LJZ C;  3K5M A;  2WP8 J;  2F03 A;  3QWN A;  1I4P A;  1Y8P B;  3HOX B;  2HCI A;  4O1N A;  1TS4 A;  2CHB D;  2HQE A;  1H9S B;  1T5E A;  4DNR B;  3WOF A;  3GP7 A;  4ODG A;  3FEW X;  4HR7 B;  3D4D A;  4IUV A;  1RF2 D;  1XTC D;  3FVQ A;  3NPP A;  1U4P A;  2B8F A;  3J7A V;  2B2V C;  1SYB A;  4XQJ A;  1MGS A;  1RTN A;  5E1F A;  4ZQ3 A;  3K7A B;  3I4M B;  2MJ8 A;  1SYC A;  5KYL A;  5M9O A;  3GTJ B;  1TQO A;  2A5H A;  2MUY A;  2L11 A;  3OOC A;  5KIX A;  3S2H B;  3BDO A;  2SOB A;  3OSO A;  4ZLT F;  5C0X G;  3CQZ B;  1DM0 B;  1H9J A;  1IL8 A;  2F0H A;  1AZP A;  1EQV A;  2XNA C;  5IIF A;  1B4O A;  4KD4 A;  3HG9 A;  3BVG A;  1HPC A;  2F3V A;  2WKD A;  1H9K A;  3I70 A;  3J7Y W;  1VF5 C;  1STG A;  4HMI A;  3NE5 B;  2RQX A;  1B44 D;  1ZXT A;  3TME A;  3TP8 A;  4RAU C;  4QF4 A;  1BBX C;  5IGE A;  3TN2 A;  2KED A;  1EY4 A;  2L4N A;  1SXT A;  1TWC B;  4NKL A;  4DAV A;  1T5X D;  4G57 A;  1B2T A;  1BCP B;  5DNF A;  1HFG A;  1TWF B;  2EDG A;  1GXD C;  1SBB B;  1IW7 D;  1G91 A;  5KNC A;  3SK6 A;  3RMH A;  4FVM A;  4J6H A;  1HFN A;  5EQ0 A;  3MZ5 A;  2F4I A;  5BN3 A;  4XYQ A;  5F2D A;  5G3L F;  3HS0 C;  3URY A;  2O2L D;  3TP7 A;  1KNA A;  5I2X A;  4IFD G;  3M3Y B;  5C0X J;  3O13 A;  3S1N B;  1ZYR C;  4ID6 A;  5EBC A;  4OGQ C;  1WCM B;  3VA7 A;  2IPK D;  1PRT F;  3S14 B;  1XXG A;  1SE2 A;  3RLF A;  4EGV A;  2FMM A;  3OW7 A;  1ENA A;  4KV6 A;  4WFN 3;  3K5N A;  1LT4 D;  2XN9 C;  4PV1 C;  1EQT A;  3HP3 A;  1QNK A;  3DM1 A;  1GUT A;  1S4Z A;  4OL7 A;  1FNW A;  4V0B A;  1LT6 D;  4KKS A;  1JQY D;  4IAL A;  1O7L A;  3DUZ A;  3VR6 A;  4EVO A;  1WTX A;  2I07 B;  2NTS A;  3G6J B;  3VYU A;  4EQN A;  4KK7 A;  1PFB A;  1HTP A;  1OO9 B;  2Q8I B;  1X32 A;  5G3L D;  3K5L A;  1BCP D;  3VR2 A;  2TSS A;  3I4N B;  2RBM A;  3EA6 A;  2QIL A;  4EQO A;  2FJ2 A;  3E6Z X;  1SNO A;  1AP0 A;  3H3V C;  1CHP D;  1TWA B;  1IKL A;  5CV6 A;  2PZT A;  5C5M A;  4IUN A;  1WD0 A;  2HDL A;  1SYD A;  1HXY D;  1LV9 A;  4RHR A;  5FO8 B;  2WV6 D;  3SK5 A;  2IX1 A;  4S3S A;  4UDU C;  4CJ1 B;  1ESR A;  5IGC A;  4B08 A;  3WOE A;  4N9P A;  3A7L A;  2EYJ A;  2B2U C;  2B8G A;  4N9T A;  1LAB A;  4FNF A;  3FPU B;  1B3A A;  4K8I A;  1QOH A;  2IX3 A;  2DNE A;  4M8A A;  5EPL A;  5KGU A;  1SYG A;  5CBA E;  3GO5 A;  3GTQ B;  4ZRZ A;  1PTO H;  5EKK A;  5C6A A;  5JVH 3;  4Y7N B;  3KLR A;  1GUO A;  3W2D A;  2NN6 H;  2NTT A;  5CV4 A;  1G8Z D;  1OXS C;  3C1E A;  2J7Z A;  2RVL A;  3MEH A;  2LKV A;  2SDF A;  3NK9 A;  2ZXO A;  1CM9 A;  2OEO A;  1EOT A;  1U4R A;  1AW7 A;  1LTI D;  2O4X A;  1W6K A;  4HCE A;  4PMC A;  5A2Q L;  1S5E D;  4IUQ A;  4IUR A;  1M8A A;  3VYS A;  5I6W A;  3MTS A;  3K0Y A;  5C5L A;  3OMC A;  3CRK C;  1OXT A;  1I4Q A;  1Q1E A;  4KKT A;  3FRP B;  5IOD A;  3D4R A;  3PO2 B;  1PTO F;  4Z9C B;  4HAE A;  4K2L A;  1U4M A;  1MSH A;  1Q12 A;  5C44 B;  1KDA A;  3R8B A;  4IUU A;  1BR9 A;  5C4J B;  3CKI B;  2EYF A;  5D3D A;  1JIC A;  3KBX A;  2NWG A;  2QDB A;  3OIP A;  2AUJ D;  2ICI A;  2ZXR A;  1S5F D;  2LY7 A;  4FP5 D;  2NBF A;  1D5X C;  4RA8 A;  1FR3 A;  1TS3 A;  2VNU D;  1KAA A;  4RKB A;  1GJX A;  2MHV A;  5DM7 3;  4ILW A;  1D5M C;  2F0J A;  2EYO A;  3R3O A;  3X3M A;  3HRZ C;  1BCP C;  1TVX A;  2EJG C;  1DJR D;  2B2U A;  4NDX A;  1STH A;  5J39 A;  4HED A;  1EWC A;  5KRU A;  3S16 B;  1HRJ A;  5T1G A;  3E0J A;  3SK8 A;  1HUN A;  2FIN B;  5COR A;  2EJF C;  2EPB A;  2KQ3 A;  4RKL A;  2IJ0 A;  1QIL A;  4KY7 A;  1E2Z A;  1ZEQ X;  1CFM A;  2Y0S B;  3MXU A;  4CKE A;  2A6E C;  1FD7 D;  3NHH A;  5E3F A;  1SFO B;  1ICW A;  4JK1 C;  3VR5 A;  1Y8O B;  1EEI D;  5ELD A;  2CQA A;  5K5P A;  1D1I A;  1TWG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...