2EVBA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords methylmalonyl-CoA decarboxylase gamma chain
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lipid binding protein,transferase
total genus 13
structure length 74
sequence length 74
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2evbA00
3T51B 3U9SA 5KNCA 2AWOA 1Y69U 1FR3A 1CTMA 2KCCA 2EDGA 1A6XA 2K33A 5K36H 1YNJC 3M4YA 1G291 5JEAH 4KN7C 1H9SB 2DNEA 1H9RA 1BDOA 1Z7TA 4LK1C 4TQUS 4OO1G 2E75C 4OGQC 3N6RA 3RLFA 4DK1A 4LJZC 4DNRB 4DK0A 5C0XG 1GUGA 1GJXA 1VCIA 2A6ED 4OO1H 3SDZA 2V4DA 3A8KE 2R6GA 3PV0A 3PUYA 1DCZA 3T53B 4DNTB 1SMYC 2D62A 1LACA 2A6HD 3VA7A 4G7OC 2BDOA 4G7ZC 1ZYRC 1TU2B 2JEAI 1PMRA 3FPPA 3W3AA 4KHZA 2A6EC 2JXMB 3M85A 1QJOA 2YYZA 2ZT9C 3GD7A 5KNDA 1IYVA 5K36G 4I7ZC 4BA1I 5JEAG 5BN3A 3QIAA 4KKSA 4TKOB 4KMUC 1GUTA 3ND8A 2EJFC 1K8OA 3PUWA 2L5TA 1E2WA 1T5EA 4IFDH 1Q1BA 1GUNA 1HQMC 1Q1EA 3EQLC 1IW7D 1HCZA 1O78A 2AUKA 1Y8OB 1OXVA 1K8MA 5BN4A 1H9JA 4KN4C 1VDZA 2AUJD 2EVBA 1IW7C 3VR5A 2EJGC 4L8JA 2A68D 3I73A 3IKJA 3L7ZC 5BN5A 1Z6HA 2PNRC 4G7HC 1ONLA 4RCNA 3IFTA 3H94A 2BA1A 3VR3A 1CFMA 3MFYA 3CRKC 1Q12A 2CW0C 2A6HC 3D4RA 2BA0A 4JK1C 3MXUA 2F1MA 3VR6A 4IFDG 1Q90A 3AB9A 3BDOA 2NN6I 2EJMA 2PPBC 1VF5C 1H9MA 1OXSC 3I72A 2O5IC 1B9MA 3CRLC 4KKUA 3QJYA 2A69D 1O7LA 3A7LA 1OXXK 2LMCB 3KLRA 3LNNA 3GQBA 3NE5B 3I4LA 1HTPA 1I6VC 1H9KA 1VF7A 4XIGS 3VR4A 2PCFB 2JE6I 2D5DA 1GHKA 3PUVA 1TKWB 1V8QA 2O5JC 3DXJC 3SE0A 3VR2A 2K7VA 2B8GA 3PUZA 2D2CC 1EWHA 4BA2I 2NN6H 3D31A 3T56B 1E2VA 2B8FA 3OOCA 3A8JE 1YNNC 3WDNA 3OW7A 2JEBI 1FYCA 1GUSA 2A68C 2IT1A 4H44C 1DXMA 3QG1A 4KKTA 3OPOA 4H13C 2K32A 3LWUA 4PV1C 1CI3M 1OXUA 3A8IE 1H9SA 3TZUA 4H0LC 1V43A 5KNBA 4IQZA 1DD2A 2DN8A 3HGBA 1ZKOA 2Q8IB 3FMCA 1E2ZA 2DNCA 2BE5D 5A35A 4HR7B 1HPCA 3PUXA 1B9NA 1Y8NB 4GZYC 3A7AB 5C0XH 4JBWA 2NN6G 2QF7A 1GHJA 2A69C 3M7NA 2E74C 2E76C 1OXTA 2BE5C 4KI0A 3BG3A 4XTCS 1Y8PB 1IYUA 1LABA 3P20A 2KA7A 3ND9A 1GUOA
chains in the Genus database with same CATH superfamily
4PZ8A 4A76A 1CQFA 2K04A 5K36H 1L0XB 2IHEA 4NW2A 3TS2A 1WTHA 4P74A 4J15A 1SMYD 1Q82C 3NWTA 2OTLA 2R93B 1LTTD 4DNRB 2EXDA 1TS2A 2H1EA 2C5CA 2A6ED 2VS1A 3D6WA 3T53B 1SMYC 2KCTA 3PQIA 3ONAB 4L63B 2PW7A 4RAUC 4JV5Q 2A6EC 3RZDB 4JV5L 2R7DA 4YWKA 1E1TA 5KNDA 1CKOA 1J6QA 3QIAA 4R4OA 5IP9H 3S1RH 4V190 4A3GB 3HRZC 4MNOA 2AHOB 3J81j 1T5EA 4BBSB 1LT6D 3X3NA 1OXVA 5GQOA 3UDFA 4OWTB 1PA6A 2F0OA 3I73A 5BN5A 4A3KG 1DOLA 3IFTA 1BF4A 3RR5A 1CSPA 3H6MA 4XDXA 5FO9B 5BR8Q 4DK3C 4P75A 5BR8L 1HUNA 2ID0A 4YHHQ 4RFBA 4IPGA 3K0XA 2K03A 1A2UA 4KKUA 2GN5A 1O7LA 5HGTA 5JVH3 4DV6Q 1H9KA 3DWQA 1SFOB 4DV6L 2IL8A 3RZOB 4ABNA 2A8VA 3AMUA 3RD4A 1A0IA 4ZK9B 5I4DA 1MIUA 1MD2D 3CCVA 1U4RA 2ALYB 4H0LC 1V43A 4A3MB 3C3LA 2L55A 1ZKOA 3WOFA 1RKNA 2WKCA 1GO3E 3QOJA 3GO5A 5TSSA 5C0XH 1Y14B 2NN6G 5ELDA 4GKJL 2RDFA 1O7YA 2JK8A 1TS5A 4MTKA 1PLFA 5C4JH 1AZQA 4B3SQ 1EEID 2KCCA 1HTLD 4UAIA 1HH2P 4B3SL 3K6OA 3MC0B 1YNJC 1RF2D 2NVQB 1UE7A 4KN7C 4A3GG 4CDEC 4OO1G 5C44H 2E75C 4OGQC 2F0KA 4A3JB 4BBSG 3GTMH 5JVG3 1DCZA 5IYDH 2F0LA 3TDQA 1EYGA 5CYUA 5DNFA 1IYVA 2JA5H 4TKOB 4IPDA 4QMGA 2NZOA 1RD9D 4BBRB 4KLKA 5C4HA 3Q8DA 4IJLA 4YWLA 4GLAC 5LL6X 1X3FA 1V9PA 1PDQA 5BN4A 4U68A 2Q2UA 3CCMA 1L0YB 2EJGC 1SJED 2K50A 1HXYD 1NBWA 2HDMA 1WTQA 1FNUA 3FKIH 2XTIA 5GAGC 3F2BA 2F4VQ 2F4VL 2L15A 4R4QA 4JI1Q 4A3CH 4JI1L 3PF5A 4IJHA 4L5SA 3KYHC 3R2TA 1X3QA 3FEWX 3J81L 2R92B 1WTXA 5M3FH 2OQKA 1PHJA 4CKBA 2FJ2A 4R4CA 4IN3A 3PIOA 1JT8A 4ME5A 3SE0A 1S5ED 1A3UA 2K7VA 2F0UA 4RCOA 3C2PA 3ER0A 2QKIC 2F0TA 1KQSA 2VUMH 5EPLA 1TWCH 3K7AB 4A3KH 2K1BA 4A3DH 4A3IB 5CV4A 4V0BA 2RBMA 1DD2A 5ELFA 2MNAA 2UXBQ 2DNCA 1VQKA 4UPAA 2UXBL 4L6TB 1LTRD 1GOZA 5EKLA 3AQQA 3QB3A 3NELA 4DR6Q 3K5OA 2RSOA 5FLMG 4DR6L 3TEHB 1UE5A 2AWOA 1F2YA 1QUQB 1ASYA 1B1ZA 2K33A 4NDXA 1R9TH 4P71A 1X54A 2F0HA 1BDOA 1U4MA 4TQUS 1LLRD 4C56C 4CKCA 4X62Q 4ODGA 4FF1A 2BH2A 4X62L 3A8KE 2R6GA 3H15A 1RDPD 2K5VA 2AQ2B 1FD7D 2DY8A 4BS9A 5C3XA 2JA6B 4QUCA 3I4MG 4K5XA 5JJKA 4H02A 4H7BA 1CT1D 4PMWA 3Q22A 2IX1A 1K0RA 5IWAQ 1KD1C 2PQEA 3FVQA 5IWAL 1N8RC 5GAEC 1RHPA 3EQLC 1C4QA 3KBXA 1AE2A 2WAQB 1LYLA 2VB3X 3GTJB 4KN4C 1N9WA 4WJWA 3V96A 5C3EG 5M5WH 2LSSA 1S3OA 4DN4M 2BA1A 2J7ZA 3MFYA 1D1KA 3KJOA 2A6HC 3D4RA 5CBAE 1I5FA 3PO3G 1LM0A 3ERQA 3AB9A 4OHJA 3GV6A 3ULJA 1BCPD 4ZKCB 4LF6Q 4RKBA 4LF6L 3SGIA 4ZYSA 1VF7A 2PCFB 1YJ9A 4KK7A 2R93H 4XQJA 3WWVA 1FGBD 4WORA 5FLXE 1Z47A 3I56A 1EWHA 2NN6H 1CKNB 5EBDA 4NKLA 1E2VA 2EYHA 4X64Q 2XWBB 2F0SA 3S2DB 1LUZA 3RZDH 2A68C 1QUQA 1LT3D 1A15A 3KDFB 2XRSD 4H13C 2K28A 3SK4A 1BCPB 5EKIA 4A3GH 1VMPA 5G3LD 4K5WA 1HPCA 4BBSH 4KHPQ 1M4VA 2WAQE 4KHPL 1PFSA 3KLSA 2V1CC 2QF7A 1HA5A 3NTHA 5ELOA 1HRJA 3QOLA 3AFQA 5EJWA 2JA6G 1RTOA 3T51B 1XTDA 1EL0A 2B3GA 1IHZA 1WCMB 1TR5A 2ZTCA 1CTMA 2PZUA 5I9OA 4GS3A 2ZJQA 3EIVA 2ASBA 3OWFA 1HQRD 3H3VC 4PG3A 1VCIA 4U673 2WAQG 2YTYA 1K9MC 2CWAA 1W2BA 2N88A 1SFOH 3RZOH 3K5NA 5EPKA 3Q24A 1CHPD 1SMXA 2R7ZB 4A3FG 4O2DA 3M9BA 1N36Q 5J1ZA 1N36L 3PUWA 2HDLA 1W3SA 2KJXA 5JAVA 3OW2A 1O78A 1AH9A 1Y8OB 1XMQL 3N52A 1L1OC 2LKVA 3PO2B 4A3MH 5JPMC 4A3LG 1R4QB 2HT1A 3K5LA 3IKJA 4DR4Q 3SK6A 3MTSA 3HOVB 2DJGC 4L5QA 4DR4L 3H94A 5J3BA 3Q23A 4KJNA 1SE4A 1CKNA 3WOEA 1S72A 3F2DA 1X65A 2YTVA 4IPHA 1LTSD 2EJMA 5HGQA 3KDFA 2VQFL 4M1UB 2NVQH 2Q8TA 1B53A 1U4PA 5EBCA 5M3MB 4CJ2C 5IIFA 2E2IB 3CC7A 4A3JH 2I46A 1YVCA 1NMGA 2EYPA 4JBJA 1RODA 2L9HA 1PVOA 4RGTA 1U4LA 1EY4A 4FF2A 2CQAA 1P16A 1XPOA 4OIKA 5FKAC 3Q0AA 4OWWB 2F0JA 2Q8IB 2Z0SA 4BBRH 3I2ZA 4APVA 1W6KA 5A35A 5CC4A 1B9NA 3M3YB 4IUQA 1IYJB 3BDCA 3BG3A 1Y8PB 2KA7A 1D6EC 3U9OA 3UDIA 1SYBA 2K75A 2R7ZG 2EDGA 1U5KA 4F87A 4POFA 4LNQA 3KLSX 2K5WA 1Z7TA 1C7YA 2EXZA 4J8QA 3H91A 1B3AA 4GOPC 1SYFA 1YJNA 3H3VI 4K6DA 3PO2G 3PV0A 4LW1A 2R92H 1PYSB 1ZYRC 2K4KA 1PMRA 3S1MB 3HOYG 3GTKB 3FP9A 3GD7A 4FNFA 3HOVG 4XT3B 5JEAG 5BN3A 1KRTA 5EKKA 4MHEA 1XYIA 3S15B 1GUTA 1K73C 3J80E 5EGTA 2HIXA 2LXJA 5KRUA 3K7AH 2QEJC 1PTOD 1GUNA 2KHJA 3H0GG 1JWSD 5IOCA 1KDCA 3I91A 5D65A 4JI6Q 2VNUD 2AUJD 4ZAIA 4JI6L 4UY8C 4GN4B 1WJJA 2F03A 1MBYA 1KXLA 4LAAA 3ITPA 3VR3A 4DR2Q 4DR2L 1TWGB 3NXWA 2KECA 4IFDG 4G4KA 1D5ZC 1UWVA 3GTQB 4HJ9A 1SDFA 2PPBC 2AMCB 4RGOS 1BXTA 2IX3A 1PTOB 2O2LD 5I2XA 2LMCB 1STNA 1BQQT 1LT5D 5LHY1 1DOMA 1X55A 4C1NI 4BY7G 3VR2A 1JORA 2B8GA 2XVSA 4HSVA 1WD0A 3D31A 1FL0A 3VYRA 2L12A 2JA6H 4QJFA 3TBIB 1EWCA 4H44C 2KENA 3STBD 4B08A 5GAHC 1N33Q 2VW9A 2HQEA 2K05A 1N33L 3CU7A 3STBC 3VYSA 1XPUA 1JC7A 2DGYA 2K52A 2A69C 3P7JA 1UEAB 1GUWA 3GTJH 4K8IA 5CV6A 4HCEA 4KTAA 3HKZB 1LTBD 2RKSA 5CBEE 1FR3A 4ZLTF 2Z8LA 3RUZA 1Q8KA 1PZID 1J5EL 4QUFA 3TP5A 3F1ZA 4ILWA 5E7NA 3RLFA 3CC2A 1EYCA 4LJZC 3HEJA 4WRDA 4MZ9A 4IURA 1STBA 2N3SA 1KRSA 4DNIA 4JYAQ 1XPRA 2EYLA 2CH4W 2CW0D 1GM5A 3OTOQ 4JYAL 3E9IA 3OTOL 3CCEA 3FPPA 4JPBW 1PRTB 4RWSC 2EY6A 1SR3A 3NENA 1QJOA 2M00A 1EY9A 1I4HA 3HOUG 3MA2B 2JA7G 1EYAA 3R3OA 1MSGA 5JEAJ 3JAMc 3S2DH 3SK8A 5JOBA 1PH4A 2F3IA 2N55A 3EA6A 1H9JA 1KNAA 4YCWA 1VDZA 5FLXL 1F9RA 1GD7A 4KD3A 5C0XJ 3VR5A 4N9PA 1B44D 1Z6HA 5E3FA 2IY5B 3L3OC 4QQBX 2SDFA 2Z6KA 3S24A 4B3TQ 3KLWA 3HKZE 4B3TL 5JJIA 3MXUA 4Z9CB 4DV4Q 2K5HA 1B4OA 3J81i 4DV4L 1WCMH 1NCVA 2JQOA 4GLVB 4JOIA 2N8NA 1E24A 3J7AF 3ERSX 2LFNA 2F0PA 1C0AA 5HY6A 4NXMQ 2F0QA 3KLRA 4K2LA 1HTPA 4NXML 1Y1WB 3A54A 4R8IA 5GADC 2E2DC 4MIUA 4IUNA 1CHQD 4OWXB 3BVGA 5ELNA 5FOBB 3PUZA 4C3JG 1B50A 1XX8A 1VQ5A 4IUPA 3BU2A 2AQ1B 4ZKBB 1TY2A 1HNWQ 3HKZG 1EZ8A 4CKEA 1HNWL 1TWAB 3NTIA 3DUZA 2VQEQ 2IT1A 3I4OA 4YWMA 4CHTB 4KKTA 2VQEL 5FJ8G 4DV0Q 3VA5A 2R7ZH 2E5LQ 4DV0L 2ZXRA 5DLQE 4YHHL 3J7ZC 2E5LL 1TWHB 2BE5D 1G91A 3S17B 1WVLA 4RHSA 4QGUA 1KLGD 4JBWA 3MAQA 2X6LA 4DA2A 1XMOQ 1JOOA 3PO2H 3LWEA 3R8BA 1VQFA 1EUJA 2BE5C 2QGQA 4XTCS 1TQOA 1XMOL 1IYUA 1LABA 3KOJA 1BBWA 3U9SA 1G8ZD 1II3A 3C46A 3HOVH 1TWFB 3M4YA 5JEAH 4ME3A 1FJGQ 3OMCA 1PH8A 1FJGL 1HNZQ 1VQHA 3IFDA 5D14A 2F0MA 1HNZL 3H0GH 3CMAA 4K14A 1BKBA 2V4DA 4BY1G 4YCUA 3CQZB 3FPUB 1PZKD 4B9WA 5M3MH 1Z9FA 4KHZA 3SHLA 2E2IH 1VQ7A 3W1GA 2B2UA 2VB2X 2HD3A 2H5XA 3VDYA 1EIYB 1QB5D 4PMBA 3EJIA 1AN8A 2AQ3B 2E2JB 3CPFA 4IFDH 3FHWA 1I3QH 4R8NA 1EQTA 2P5ZX 1V1QA 1K8MA 3OWEB 1SE3A 1Y1WG 2HCIA 1ENAA 2WINB 2F0EA 4UP8A 4FXKC 5CGKA 5JJLA 1PH6A 1EY6A 3M3YH 3OSOA 2FXQA 2BCOA 3IL8A 2CCZA 3GTOB 1H9MA 1JB3A 3Q6SA 1B9MA 3QJYA 1YBYA 3A7LA 4HIOA 4EQPA 4IO9A 2A73B 2EYOA 2PO4A 5D3IB 2LY7A 4BWGB 2XIWA 1PH2A 3PUVA 1TS3A 4XQNA 2G9DA 1CUKA 3I4MB 1ENCA 4R9WA 2K5QA 2A5HA 2B8FA 2NTTA 3S1MH 1I94Q 3MXGA 5DAUA 1I94L 3GTKH 3SEBA 4XXEA 3QG1A 5NUCA 2K32A 1HR0W 1NAPA 1LTLA 3S15H 2RCFA 4IQZA 2Y0SE 2UXDQ 5DM73 5IT9c 1KNEA 2EYMA 1Q3LA 2UXDL 4DAMA 5L37A 2VY3A 3A7AB 4JW0A 1D5MC 4PQXA 5C3EB 1PFMA 4GNXB 2NUCA 3CXCA 4FXGC 3P20A 1EOTA 3JAME 4G7ZC 4DXGA 1S5CD 1YNXA 1SNMA 1Y69U 4C3HG 4LF7Q 4IOAA 5KYIA 2ZJRA 4LF7L 2HHHQ 3PO3B 3J80L 2HHHL 1TWGH 4L5RC 5EAYA 3S1NB 2Y0SG 4YY3Q 1IBKQ 3GTQH 4YY3L 3FDTA 1VQNA 4HN7A 1JE4A 1PTOH 1X3GA 2JEAI 4DK6C 4QF4A 3GTGB 2F52A 2MP1A 4NB3A 2R3ZA 4A3BB 1I4RA 2EYFA 1T9HA 4NP5A 2LS01 1Y1VB 3HOWB 1FNVA 2VXWA 2K14A 4JG2A 1YHBA 5KYLA 3S14B 4EQNA 3HOXB 3PMFA 2Z6BA 2F0VA 2E2HB 3NBIA 3V2TA 1KL9A 4L8JA 4IUTA 2UXCQ 5HURA 1PH7A 2UXCL 3NPPA 4XQQA 3CRKC 3OYYA 4UP9A 3UDGA 4A4IA 1WTPA 1Q90A 2IWHA 5I6YA 2IJ0A 3CRLC 2FMMA 1V1PB 3I4LA 4LF4Q 3QO2A 3VR4A 4LF4L 3TRZA 1HA6A 1EIHA 1AE3A 1FGUA 1V8QA 4O1NA 4A3EG 1D1IA 1IBMQ 4BA2I 1EIGA 2RHSB 1PZJD 1VQIA 4GNXA 1F2ZA 3S9WA 3E5SA 5C4ZA 4A75A 2XNAC 5LMNW 5IP7G 3OOCA 2O4XA 4A3FB 1FYCA 1BBXC 1QZGA 2EIFA 1E22A 4A93G 3I8ZA 1KLUD 4HMJA 4RKLA 3X3MA 1VQ4A 2NVTB 3BDLA 1YITA 3PUXA 3DWAA 3CKIB 1BCPC 4JBKA 3NEMA 5IGCA 3SR1A 1VQ9A 1IBLQ 4AQYQ 1JQYD 1GUOA 2KQ3A 3J81c 4AQYL 4EVOA 4X64L 4A3BG 4FP5D 1A6XA 5LL6S 1EEFD 1F9PA 2KBNA 3MVVA 3F8TA 3BS1A 3G71A 2PW5A 4GN3B 4F8MA 1Y1VG 3D4DA 3HOWG 3NQIA 4DK1A 1EIFA 1GUGA 4JVZA 1EY0A 4OO1H 1ILPA 3HOXG 3PUYA 1SE8A 3QR8A 4UDUC 5ISRA 1TU2B 3W3AA 1Y1WH 5E4WC 2PYKA 4RMFA 4ZQ3A 1JR0D 3D8GA 5IYBG 1QZHA 2FHTA 4I65A 1BCPF 4I7ZC 4KKSA 3D3RA 1I6HB 1B3QA 5C5MA 1IL2A 1PYWD 2CQOA 2EJFC 4M8AA 5A2QE 1TWAH 3I70A 1DONA 1W6JA 1WTVA 2KCMA 3OIPA 1V1PA 4DKAC 3T1HQ 3GTLB 1TWHH 1UE1A 3T1HL 1M90C 1UE6A 3BVMA 3S17H 2G9HD 3S16B 1ML0D 1HUMA 2RVLA 3AFPA 3A55A 3PIP3 4LMQD 1GXDC 1EWIA 2BA0A 3VR6A 2JSOA 3M4PA 4NMZA 4TRDA 5IT9E 1YJWA 1TVXA 2QA4A 5G3LF 1TWFH 3K59A 2K5NA 4LUZA 1TS4A 2CHBD 4I7AA 3CHBD 2JE6I 1SYGA 2RHQB 3CCJA 1ZXTA 4OEMB 3HOYB 3CQZH 3RN5A 3I4NG 3CD6A 1IKLA 3NQTA 4PZ7A 2Z9HA 5COYA 2KCNA 1CK1A 1F77A 3OPOA 1K3RA 4OX9Q 1NMFA 3BVZA 5FO8B 4OX9L 3H09A 4HCSA 3H0GB 2OQ0A 2E2JH 1VQGA 4JCVE 4B3MQ 3BZKA 2ES2A 4JI4Q 1K0SA 4B3ML 4JI4L 1EQQA 4GZYC 2K5DA 2E74C 3EVQA 4KI0A 4FXDA 1S4ZA 3S1QB 3L0OA 2B2VA 5FLMH 3UDXA 2YU9B 1VQAA 2B2YA 2ICIA 1G291 2ZM6Q 4N8FA 1H9SB 1HJPA 1I3QB 2N49A 2ZM6L 4J1MA 4HIDA 1CM9A 2H4OA 1JMCA 1HZAA 4AIMA 1VQMA 1SNQA 3GTOH 2B2TC 3SDZA 1XJVA 2KOLA 5JPNC 4BY7B 1QVGA 1A3TA 2A1AA 3CAMA 2JXMB 1JOKA 3ULPA 4AYBB 3I7FA 3BZCA 4R4TA 1QVFA 3D4WA 2KVMA 3I4MH 1CSQA 1R4PB 4OONA 4KMUC 5ELCA 2L5TA 5IY0A 5T1GA 1HR0Q 4JI2Q 3J7AV 1HR0L 2ZTEA 4JI2L 1FNWA 1NY4A 1PFNA 2NB0A 1DOKA 4Q0FA 5EQ0A 4CDCC 2M9VA 2F0NA 3P75A 3OIQA 1ESFA 2OWOA 4K6LA 1YNND 1NR4A 5C5LA 5LMUQ 1VS0A 5LMUL 4G7HC 4HJ8A 1J8IA 1MJCA 3BJUA 5C3EH 2BH8A 1CFMA 2XWJB 3CCSA 4JK1C 1YI2A 1YIJA 4WJ3M 1DJRD 2Q2HA 2QEXA 3BDOA 4Y7NB 1KAAA 1KABA 4DV5Q 3PO3H 1QVCA 4DV5L 4OL7A 5IGGA 3NK9A 3S1NH 1JWUD 2I07B 3S2HH 2JYOA 2OT2A 1RJTA 1PTOC 4OXPA 2J0TD 3DXJC 1CA5A 3HKSA 3JAML 4K2KA 2RDGA 4ZUIA 3HOUB 1VQLA 2JA7B 5C0XI 4AYBE 1ENFA 3R2IA 3GTGH 3A5ZB 1GUSA 2Z6KC 2HCCA 2ZXPA 3HS0C 3GDEA 4A3BH 1EQVA 4GKKQ 1AFPA 1OXUA 2WACA 1H9SA 4GKKL 4X66Q 5KNBA 4X66L 3HGBA 4JOIC 1WI5A 4DAYB 2GVBA 1Y1VH 3HOWH 3PCOB 4RGMA 1EU3A 3UE1A 3S14H 1JOQA 5J22A 2F4IA 3HOXH 3L2PA 3ZJYC 1EU4A 2EZVA 3GV3A 2E2HH 3ND9A 4IPCA 5KNCA 3M4QA 4AYBG 1PTOF 3RN2A 1KC8C 5C44G 2OF1A 2KHSA 5IYBH 4X6AH 1J9OA 1VQ6A 4QIWB 2AWNA 2DNEA 4UHVA 5E1FA 4HJAA 1SROA 4KJOA 1SYCA 3G4SA 1EOVA 2JJQA 3N6RA 1N34Q 3CCLA 1X6OA 1GJXA 3DM3A 1N34L 1STHA 4R4IA 1WTRA 1CQVA 3MXNB 4EX5A 4C3JB 1PRTD 3URYA 1ILQA 4WFN3 2WB1G 3M4OB 5DEHA 4DUZQ 2QW7A 2Z4HA 2PZWA 1VQPA 1IXRA 3L9AX 3TSSA 5CV5A 2K01A 2Q8RE 1ICWA 1YZ6A 5IGFA 4A3FH 1D2BA 1A2TA 2NWGA 4HIMA 1I4GA 4DPGA 2JA8G 3K58A 1NJIC 2B2WA 4KY7A 4LFAQ 2AUKA 1JJGA 4GN5A 4LFAL 2IX0A 1MSHA 2AKWB 3HOZB 2NVYB 2EVBA 3BYYB 1M1KC 3PIO3 1E7ZA 1G6ZA 3O13A 2NVTH 5KEEA 2PNRC 4A3LH 5D3DA 1WOCA 2SNSA 3RLNA 2CW0C 2Q2IA 2F3WA 2B2UC 3I4NH 2G5DA 1SE2A 3ULLA 4QIWE 2UUCQ 1G2TA 5CMDA 2UUCL 4JC0A 4ALPA 3GQBA 4BY1B 4DAYA 2R61A 1WFQA 2O5JC 4AH6A 1ESRA 2EPBA 4FDBA 1SNDA 1TIID 1CZWA 1B8AA 4JI3Q 4JI3L 3CCQA 1K83B 4A3DG 3WDNA 2VZAA 2JEBI 3E0JA 2BOSA 3I55A 1CI3M 1BNZA 2MUYA 1I6HH 4IFDJ 3KF8B 4F7XA 3G48A 4HEDA 1QNUA 1E3PA 4C3IB 1JJ2A 4ZRZA 2BDNA 4PNYA 3MXNA 3GTLH 3J80i 1JB7A 3VYUA 1I50B 3S16H 1XTCD 1BOSA 1G51A 2MJ8A 5A2QL 1DZ1A 3IRBA 2YTXA 1Q8IA 3BZDB 4R1JA 1MKHA 1HFNA 3NBHB 4DFAA 3VA7A 3HOZG 4G7OC 2BDOA 3J7YW 2QDBA 1Q86C 1PV4A 2EOTA 3TQYA 4KHVA 4BA1I 5IT9L 4B3RQ 1G6PA 3DWPA 3HOYH 4B3RL 4UP7A 4YIJA 3H3VH 1RL2A 2Z1CA 1BBUA 2UUAQ 1IZ6A 4DAVA 2F0GA 4DR1Q 2UUAL 1Q1BA 3AYHB 4DR1L 4X3UA 4DV3Q 3F2UA 5ELEA 4FF3A 4DV3L 2PMZB 2PQAB 3CC4A 1EZ6A 1DM0B 4JI8Q 4RA8A 4JI8L 3NHHA 3UE0A 1PXUA 2RF4A 3I90A 3K7UC 1SXTA 1O80A 2FFKB 4C3HB 4QY7A 1QNKA 5EPJA 2R7FA 3I3CA 3S1QH 2NN6I 1BR9A 3GP7A 3J7A5 1YHQA 2YU9H 2Y0SB 4Y52H 1B70B 2R93G 1LTAD 4QCLA 1ET9A 3KF8A 4LUOA 3E3XA 4GKJQ 2F0FA 4DR3Q 4Q5VA 4C3IG 2B63B 4DR3L 1GHKA 3SXHA 1YNJD 2D2CC 4OO1I 4HSPA 4HTHA 4BY7H 1QILA 1PH1A 1JE5A 1AZPA 5FLXc 1VQJA 3OHXC 3MZ5A 3CP0A 3TZUA 1U0LA 1STAA 2NVXB 5M5YB 4PMCA 2ICEC 1S40A 1DYQA 3W1BA 1SNPA 1YEZA 1F9QA 2PMZE 5I2YA 2EY1A 3NBHA 4KV6A 5M5XH 5DM63 1OXTA 4K0KQ 1AP0A 2CFMA 4K0KL 3HP3A 2YV5A 2QCPX 1B2TA 3D0FA 2WFWA 3M7GA 4GNXC 2RSNA 5E4XA 1H9RA 3ZYYX 1GKHA 5C3WA 4Y7NH 4ULLA 1KIXA 2JA8H 3KK7A 2TSSA 1DGSA 2PQAA 4A3EB 3DM1A 1ASZA 1AEXA 1FVIA 1VQOA 3M85A 3G6JB 5CR3A 4K5VA 4LF8Q 3T1YQ 4LF8L 5T1IA 2ATWA 2C35B 1HZBA 3T1YL 1ICFB 4CGYB 2L4NA 1WYDA 1OTCA 3HOUH 2JA7H 1N32Q 3MWYW 4A93B 2WP8J 4TSSA 1N32L 1HQMC 3JC66 5C4XB 4QL5A 4A3MG 5FK9C 4HJ5A 3S2HB 1JJCB 4KD4A 1IBKL 3A56A 2IHFA 4DU9A 3C1FA 2B63G 2J4XA 4NXNQ 3TMEA 3A74A 2OXPA 4MN3A 4NXNL 1MI2A 2MO1A 1STGA 4IZ8A 5IYCG 2KHIA 1NTGA 1SAPA 3MEFA 2ZTDA 4O0AA 1SYEA 4LF9Q 5IE8A 3HG9A 3I72A 4LF9L 3K81C 3EROA 4G57A 1LT4D 3A0JA 4A3JG 1OXXK 3LNNA 4X65Q 3NE5B 4X3KA 2B29A 4F88A 4X65L 2D5DA 2NTSA 1WTOA 3E6ZX 4X3SA 3CF5A 1CA6A 1GVPA 1HZCA 3RMHA 3KF6B 4C3JH 3A8JE 4CDFC 1EYDA 2D9UA 4JI5Q 4JI5L 3CCUA 2F0WA 4BBRG 4EGVA 3M4OH 4TVAB 3T13A 4C2MB 1CKMA 1KDAA 4CJ0B 1KDBA 1NSNS 4LUVA 1JCKB 3AEVA 2RA4A 5FJ8H 2DN8A 1O7IA 3FMCA 5F2DA 4NPSA 4HR7B 4RGNA 2KEEA 5K5PA 4DV7Q 3DLLA 1PH5A 1C8CA 4DV7L 1LTGD 1GHJA 1VQEA 4FO2A 4BXXG 4HJ7A 4QB4A 3CCRA 3F2CA 2NVYH 3HOZH 1IBML 4ZCKA 2M2LA 3TREA 2L11A 2D0PA 3TP6A 1A62A 2JA9A 3LX0A 3K0YA 3QWNA 1S5BD 1RTNA 4RG1A 2C9OA 2HIVA 3KUPA 2D0OA 1D7QA 5C4XG 2JP1A 4HMIA 1EFID 2L0CA 2R92G 2MO0A 3FRPB 4EQOA 1C48A 2EYJA 3HZXA 2D62A 4DGZA 1PH9A 2A6HD 4FF4A 4BY1H 4LF5Q 1D8LA 2YYZA 1EY7A 2RQXA 5ELBA 4LF5L 3KFUA 3I4NB 4P73A 1IBLL 2I5LX 2MPMA 3SVMA 1Q81C 2B2VC 3ICEA 1K3BC 1RCVD 1K83H 4XYQA 2UU9Q 1E2WA 2UU9L 2B2YC 3EN2A 4A3IG 1X9NA 2EE1A 1VQ8A 3GTPB 1UAPA 4XYOA 1IW7D 1HCZA 2Z4IA 3CW2C 1XXGA 4RH6A 2GVAA 1QOHA 3J80c 2NZ1D 3U4ZA 4WJ4A 1MHWC 1CZGA 4FVMA 3AU7A 1IW7C 2A68D 5IODA 4C3IH 4JI7Q 4JI7L 4YCVA 1NUCA 1Q12A 3KF6A 1UNSA 1QG7A 1PFBA 2B39A 4DF7A 1I50H 3U4VA 2FINB 2EY2A 2CVRA 5I6WA 3D6CA 4HIKA 4OIJA 3JAMi 1YHAA 1SSOA 2DUDA 4N8X1 4CDDC 2KUMA 1IKMA 1SJHD 4O42A 2MHVA 3CMEA 1LTID 4IUUA 3S1RB 3KBGA 2ENBA 3TZDA 3BYTB 1VQBA 1HNXQ 1X32A 3OW7A 1HNXL 2WV6D 2F0DA 4PV1C 3A8IE 4DR5Q 1KHIA 2EQSA 4ID6A 4OELB 1LV9A 4DR5L 3MEHA 5KIXA 4IALA 1E2ZA 4X3TA 2A74C 4HAEA 4KY5A 1Y8NB 1IL8A 4DAPA 2A19A 2QILA 1TT2A 5AFWA 3M7NA 1I4PA 2WKDA 3K57A 2VL6A 2F0IA 2KEDA 3TN2A 3DHQA 1A3VA 3P1HA 3SK5A 3RNUA 2CKZB 1SNCA 1L0WA 2MFIA 4P72A 4C3HH 5M9OA 1V1OA 4LWCA 3CPWA 3PSIA 1F9SA 1XMQQ 1EY8A 4DNTB 1HZ9A 3K5MA 1LACA 2SEBD 1BUVT 1STYA 4PZ6A 2XN9C 2SNMA 2B63H 5J39A 1VQDA 1SLJA 4S3SA 5GROA 1SYDA 5K36G 2X6GA 3B6YA 4E6IA 1ET6A 4XT1B 1STEA 5IYCH 1L1OB 3ND8A 5C6AA 2I0QA 2VQFQ 1K8OA 1BVSA 1XNQQ 3U58A 1XNQL 2OTJA 1A8VA 3W2DA 2SOBA 2NVXH 2WIIB 5M5YH 5KGUA 1WTWA 5C4JB 1X3PA 1X56A 2HQLA 1SBBB 1ONLA 5IP9G 2NZHA 3MFGA 1WCMG 3OMGA 1NR2A 5CV7A 3UI2A 5C44B 1U9RA 2RDHA 1M8AA 1EQRA 1H95A 3GTMB 3K8AA 2I5HA 4DXFA 4CJ1B 4L5TA 1K8AC 1KAWA 3VYTA 1I6VC 2F3VA 4XIGS 5M5XB 4RHRA 3MHBA 1Q7YC 2B2WC 1TKWB 4JBMA 1B7YB 1F2MA 1C9OA 2PZTA 2JA5B 1XNRQ 3T56B 1XNRL 2WB1B 2PI2E 1QE6A 2NBFA 4A3EH 2NYZD 1NNXA 4BXXH 1YNNC 1VMCA 4JI0Q 5IGDA 1EFWA 2MGSA 4JI0L 5IP7H 3LWUA 1ZYRD 2JA8B 1Q46A 1E0BA 4A93H 2MQHA 3HFZB 5C4XH 3J81E 1HHVA 3FKIB 3T16A 3TS0A 4N9TA 1JWMD 2N78A 1I4XA 4GLXA 1MGSA 3C1EA 1L2FA 2TMPA 3NP8A 3V05A 5CV9A 1MJEA 2UUBQ 2GA4B 2IPKD 2XGTA 2PI2A 1VQCA 2UUBL 4CBVA 3G6EA 3PGZA 4POGA 2PNHA 1F2LA 4GOPB 1PH3A 1BO0A 1G2SA 3DEOA 1PYBA 1LO5D 4LK1C 2JN4A 5M3FB 2OCEA 1L1OA 3K80C 5FO7B 2ZXOA 4P2CB 3TP7A 3NSWA 2DJFC 4DK0A 5C0XG 4A3IH 5M3MG 1QCBD 1ZEQX 5JJZA 4KY6A 1UUPA 4IFDI 2VUMB 1WD1A 1TWCB 4A3KB 4IUVA 2ZT9C 2HUGA 2RCNA 1EY5A 1TXYA 4LFBQ 5AJ3Q 2WB1E 4A3DB 1HFGA 4LFBL 2DY7A 5AJ3L 4DV2Q 4DR7Q 3A5UA 4DV2L 4DR7L 1Q1EA 2FMCA 4K8JA 1O7ZA 1RIPA 1E1OA 3G7LA 3T4AC 4C2MH 5IYDG 4C1NK 1T5XD 1K8GA 5IGEA 2XSCA 3EFXD 3L7ZC 1D5XC 3NTKA 4J6HA 4RCNA 2JA5G 1X3EA 3EBEA 1R9TB 3RLOA 3NWSA 2ZJPA 1SRUA 5CV8A 5LMNQ 1A63A 2F1MA 4DV1Q 5LMNL 4DUZL 1PRTC 1NE3A 4LFCQ 4FYDA 4DV1L 2L1BA 4LFCL 5I9PA 1S5DD 1TY0A 1VF5C 2B2TA 1OXSC 4MTNA 2O5IC 2A69D 2EY5A 1KTKA 3DEPA 1OO9B 3TP8A 2XRQD 2X69A 4EQ5A 1K28A 3FKIG 1JICA 1AW7A 3NUCA 2E8GA 3PF4A 3KJPA 2Q2TA 2I5MX 2CWPA 4ZUJA 3W5OA 4A3CG 3DMUA 2IW3A 2OEOA 2CH4A 3LGJA 3PIPA 2K6AA 1P8LA 3U50C 1J5EQ 1DXMA 1I4QA 3E9HA 3R93A 4GOPA 3MXPA 5M3FG 1S5FD 1UEBA 3E0EA 5IGBA 3IAYA 1PRTF 1SEBD 1SN8A 5M5WB 2QDLA 3GTPH 5H1SE 4IOCA 4DUYQ 1SNOA 4DUYL 2E76C 1QWYA 5CORA 2VUMG 2LXKA 4B9XA 1XWEA
chains in the Genus database with same CATH topology
1CQFA 2K04A 5K36H 1L0XB 4NW2A 1SMYD 3NWTA 2R93B 1LTTD 4DNRB 1TS2A 2H1EA 2C5CA 2A6ED 3D6WA 3T53B 1SMYC 3ONAB 4L63B 2PW7A 4RAUC 2A6EC 3RZDB 5KNDA 3QIAA 4V190 4A3GB 3HRZC 1T5EA 4BBSB 1LT6D 3X3NA 1OXVA 2F0OA 3I73A 5BN5A 1DOLA 3IFTA 1BF4A 3H6MA 4XDXA 5FO9B 1HUNA 2ID0A 4RFBA 2K03A 1A2UA 4KKUA 1O7LA 5HGTA 5JVH3 1H9KA 3DWQA 1SFOB 2IL8A 3RZOB 4ABNA 3AMUA 3RD4A 4ZK9B 5I4DA 1MD2D 1U4RA 4H0LC 1V43A 4A3MB 3C3LA 2L55A 1ZKOA 3WOFA 1RKNA 2WKCA 3QOJA 3GO5A 5TSSA 5C0XH 2NN6G 5ELDA 2RDFA 1O7YA 1TS5A 1PLFA 1AZQA 1EEID 2KCCA 1HTLD 4UAIA 3K6OA 3MC0B 1YNJC 1RF2D 2NVQB 4KN7C 4OO1G 2E75C 4OGQC 2F0KA 4A3JB 5JVG3 1DCZA 2F0LA 3TDQA 5CYUA 5DNFA 1IYVA 4TKOB 4QMGA 1RD9D 4BBRB 5C4HA 5LL6X 1PDQA 5BN4A 4U68A 1L0YB 2EJGC 1SJED 1HXYD 1WTQA 2HDMA 1FNUA 3R2TA 1X3QA 3FEWX 3J81L 2R92B 1WTXA 4CKBA 2FJ2A 4IN3A 4ME5A 3SE0A 1S5ED 1A3UA 2K7VA 2F0UA 4RCOA 3C2PA 2QKIC 2F0TA 5EPLA 3K7AB 2K1BA 4A3IB 5CV4A 4V0BA 2RBMA 1DD2A 5ELFA 2DNCA 4L6TB 1LTRD 1GOZA 5EKLA 3QB3A 3K5OA 2RSOA 2AWOA 1F2YA 1B1ZA 2K33A 4NDXA 2F0HA 1BDOA 1U4MA 4TQUS 1LLRD 4C56C 4CKCA 4ODGA 4FF1A 3A8KE 2R6GA 1RDPD 2AQ2B 1FD7D 2DY8A 4BS9A 5C3XA 2JA6B 4QUCA 4K5XA 4H7BA 3Q22A 1CT1D 4PMWA 2IX1A 2PQEA 3FVQA 1RHPA 3EQLC 1C4QA 3KBXA 2WAQB 2VB3X 3GTJB 4KN4C 4WJWA 3V96A 4DN4M 2BA1A 2J7ZA 3MFYA 1D1KA 2A6HC 3D4RA 5CBAE 3ERQA 3AB9A 4OHJA 3GV6A 1BCPD 4ZKCB 4RKBA 4ZYSA 1VF7A 2PCFB 4KK7A 4XQJA 1FGBD 4WORA 5FLXE 1Z47A 1EWHA 2NN6H 5EBDA 4NKLA 1E2VA 2EYHA 2XWBB 2F0SA 3S2DB 2A68C 1LT3D 1A15A 2XRSD 4H13C 2K28A 3SK4A 1BCPB 5EKIA 1VMPA 5G3LD 4K5WA 1HPCA 1M4VA 3KLSA 2QF7A 1HA5A 3NTHA 1HRJA 3QOLA 5EJWA 1RTOA 3T51B 1EL0A 1IHZA 1WCMB 1TR5A 1CTMA 2PZUA 5I9OA 3OWFA 1HQRD 3H3VC 1VCIA 4U673 2N88A 3K5NA 5EPKA 3Q24A 1CHPD 2R7ZB 5J1ZA 3PUWA 2HDLA 2KJXA 5JAVA 1O78A 1Y8OB 3N52A 2LKVA 3PO2B 5JPMC 1R4QB 3K5LA 3IKJA 3SK6A 3MTSA 3HOVB 3H94A 3Q23A 4KJNA 1SE4A 3WOEA 1LTSD 2EJMA 4M1UB 2Q8TA 1B53A 1U4PA 5EBCA 5M3MB 4CJ2C 5IIFA 2E2IB 2I46A 2EYPA 1RODA 2L9HA 4RGTA 1U4LA 1EY4A 4FF2A 2CQAA 4OIKA 5FKAC 3Q0AA 2F0JA 2Q8IB 5A35A 1W6KA 5CC4A 1B9NA 3M3YB 4IUQA 3BDCA 3BG3A 1Y8PB 2KA7A 1D6EC 3U9OA 1SYBA 2EDGA 4F87A 3KLSX 2K5WA 1Z7TA 2EXZA 4J8QA 3H91A 1B3AA 1SYFA 4K6DA 3PV0A 1ZYRC 1PMRA 3S1MB 3GTKB 4FNFA 3GD7A 4XT3B 5JEAG 5BN3A 5EKKA 4MHEA 1XYIA 3S15B 1GUTA 3J80E 5EGTA 5KRUA 2QEJC 1PTOD 1GUNA 1JWSD 5IOCA 1KDCA 3I91A 5D65A 2VNUD 2AUJD 4ZAIA 2F03A 1MBYA 4LAAA 3ITPA 3VR3A 1TWGB 3NXWA 2KECA 4IFDG 4G4KA 1D5ZC 3GTQB 1SDFA 2PPBC 4RGOS 1BXTA 2IX3A 1PTOB 2O2LD 5I2XA 2LMCB 1STNA 1BQQT 1LT5D 5LHY1 1DOMA 4C1NI 3VR2A 1JORA 2B8GA 2XVSA 4HSVA 1WD0A 3D31A 3VYRA 2L12A 3TBIB 1EWCA 4H44C 4B08A 2HQEA 2K05A 3CU7A 3VYSA 1JC7A 2A69C 3P7JA 1UEAB 1GUWA 4K8IA 5CV6A 4HCEA 4KTAA 3HKZB 1LTBD 2RKSA 5CBEE 1FR3A 4ZLTF 2Z8LA 3RUZA 1PZID 4QUFA 3TP5A 4ILWA 3RLFA 1EYCA 4LJZC 3HEJA 4WRDA 4IURA 1STBA 2EYLA 2CW0D 3FPPA 4RWSC 1PRTB 2EY6A 1QJOA 2M00A 1EY9A 1I4HA 3MA2B 1EYAA 3R3OA 1MSGA 5JEAJ 3SK8A 5JOBA 2N55A 3EA6A 1H9JA 1KNAA 1VDZA 5FLXL 4KD3A 1F9RA 5C0XJ 3VR5A 4N9PA 1B44D 1Z6HA 5E3FA 3L3OC 2SDFA 3MXUA 4Z9CB 1B4OA 1NCVA 3J7AF 2LFNA 2F0PA 2F0QA 3KLRA 4K2LA 1HTPA 1Y1WB 3A54A 4R8IA 2E2DC 4MIUA 4IUNA 1CHQD 3BVGA 5FOBB 3PUZA 4C3JG 1B50A 1XX8A 4IUPA 2AQ1B 4ZKBB 1TY2A 1EZ8A 4CKEA 1TWAB 3NTIA 3DUZA 2IT1A 4CHTB 4KKTA 3VA5A 2ZXRA 1TWHB 2BE5D 1G91A 3S17B 1WVLA 4RHSA 1KLGD 4JBWA 3MAQA 2X6LA 4DA2A 1JOOA 3LWEA 3R8BA 2BE5C 4XTCS 1TQOA 1IYUA 1LABA 3U9SA 1G8ZD 1II3A 3C46A 1TWFB 3M4YA 5JEAH 3OMCA 3IFDA 5D14A 2F0MA 4K14A 2V4DA 3CQZB 3FPUB 1PZKD 4B9WA 4KHZA 3SHLA 2B2UA 2VB2X 1QB5D 4PMBA 3EJIA 1AN8A 2AQ3B 2E2JB 4IFDH 4R8NA 1EQTA 1K8MA 3OWEB 1SE3A 2HCIA 1ENAA 2WINB 2F0EA 5CGKA 4FXKC 1EY6A 3OSOA 2BCOA 3IL8A 3GTOB 1H9MA 1JB3A 3Q6SA 1B9MA 3QJYA 3A7LA 4EQPA 2A73B 2EYOA 2PO4A 5D3IB 2LY7A 4BWGB 2XIWA 3PUVA 1TS3A 4XQNA 2G9DA 3I4MB 1ENCA 4R9WA 2K5QA 2A5HA 2B8FA 2NTTA 3MXGA 5DAUA 3SEBA 4XXEA 3QG1A 5NUCA 2K32A 1NAPA 4IQZA 5DM73 1KNEA 2EYMA 1Q3LA 3A7AB 1D5MC 4PQXA 5C3EB 1PFMA 2NUCA 4FXGC 3P20A 1EOTA 3JAME 4G7ZC 4DXGA 1S5CD 1SNMA 1Y69U 4C3HG 5KYIA 3PO3B 3J80L 3S1NB 3FDTA 4HN7A 1JE4A 1PTOH 2JEAI 4QF4A 3GTGB 2MP1A 2R3ZA 4A3BB 1I4RA 2EYFA 4NP5A 2LS01 1Y1VB 3HOWB 1FNVA 2VXWA 5KYLA 3S14B 4EQNA 3HOXB 3PMFA 2F0VA 2E2HB 3NBIA 3V2TA 4L8JA 4IUTA 5HURA 3NPPA 4XQQA 3CRKC 1WTPA 1Q90A 2IWHA 5I6YA 2IJ0A 3CRLC 2FMMA 1V1PB 3I4LA 3QO2A 3VR4A 1HA6A 1EIHA 1V8QA 4O1NA 1D1IA 4BA2I 1EIGA 1PZJD 1F2ZA 3S9WA 3E5SA 5C4ZA 2XNAC 3OOCA 2O4XA 4A3FB 1FYCA 1BBXC 3I8ZA 1KLUD 4HMJA 4RKLA 3X3MA 2NVTB 3BDLA 3PUXA 3DWAA 3CKIB 1BCPC 5IGCA 3SR1A 1JQYD 1GUOA 2KQ3A 4EVOA 4FP5D 1A6XA 5LL6S 1EEFD 1F9PA 3MVVA 3BS1A 2PW5A 4F8MA 3D4DA 3NQIA 4DK1A 1GUGA 1EY0A 4OO1H 1ILPA 3PUYA 4UDUC 5ISRA 1TU2B 3W3AA 5E4WC 2PYKA 4ZQ3A 1JR0D 3D8GA 2FHTA 4I65A 1BCPF 4I7ZC 4KKSA 3D3RA 1I6HB 5C5MA 1PYWD 2EJFC 4M8AA 5A2QE 3I70A 1DONA 1W6JA 1WTVA 3OIPA 1V1PA 3GTLB 3BVMA 2G9HD 3S16B 1ML0D 1HUMA 2RVLA 3A55A 3PIP3 4LMQD 1GXDC 2BA0A 3VR6A 2JSOA 4NMZA 4TRDA 5IT9E 1TVXA 5G3LF 3K59A 1TS4A 2CHBD 3CHBD 2JE6I 1SYGA 1ZXTA 3HOYB 1IKLA 3NQTA 5COYA 2KCNA 1CK1A 1F77A 3OPOA 3BVZA 5FO8B 3H09A 4HCSA 3H0GB 4GZYC 2K5DA 2E74C 3EVQA 4KI0A 4FXDA 1S4ZA 3S1QB 2B2VA 2YU9B 2B2YA 2ICIA 1G291 1H9SB 1I3QB 4J1MA 1CM9A 2H4OA 1SNQA 2B2TC 3SDZA 2KOLA 5JPNC 4BY7B 1A3TA 2JXMB 1JOKA 4AYBB 3D4WA 2KVMA 1R4PB 4KMUC 5ELCA 2L5TA 5T1GA 3J7AV 1FNWA 1PFNA 2NB0A 1DOKA 4Q0FA 5EQ0A 2M9VA 2F0NA 3P75A 3OIQA 1ESFA 4K6LA 1YNND 1NR4A 5C5LA 4G7HC 1J8IA 1CFMA 2XWJB 4JK1C 1DJRD 3BDOA 4Y7NB 1KAAA 1KABA 4OL7A 5IGGA 3NK9A 1JWUD 2I07B 2JYOA 2OT2A 1RJTA 1PTOC 2J0TD 3DXJC 1CA5A 3JAML 4K2KA 2RDGA 4ZUIA 3HOUB 2JA7B 5C0XI 1ENFA 3R2IA 1GUSA 2HCCA 2ZXPA 3HS0C 1EQVA 1AFPA 1OXUA 2WACA 1H9SA 5KNBA 3HGBA 4RGMA 1EU3A 1JOQA 5J22A 2F4IA 1EU4A 2EZVA 3GV3A 3ND9A 5KNCA 1PTOF 2OF1A 2KHSA 1J9OA 4QIWB 2AWNA 2DNEA 5E1FA 4KJOA 1SYCA 3N6RA 1GJXA 1STHA 1WTRA 1CQVA 4C3JB 1PRTD 3URYA 1ILQA 4WFN3 3M4OB 5DEHA 2Z4HA 2PZWA 3L9AX 3TSSA 5CV5A 2K01A 2Q8RE 1ICWA 5IGFA 1D2BA 1A2TA 2NWGA 1I4GA 3K58A 2B2WA 4KY7A 2AUKA 2IX0A 1MSHA 3HOZB 2NVYB 2EVBA 3BYYB 1G6ZA 3PIO3 3O13A 5KEEA 2PNRC 5D3DA 2SNSA 2CW0C 2F3WA 2B2UC 1SE2A 1G2TA 5CMDA 3GQBA 4BY1B 4DAYA 2R61A 2O5JC 1ESRA 2EPBA 1SNDA 1TIID 1CZWA 1K83B 3WDNA 2JEBI 3E0JA 2BOSA 1CI3M 1BNZA 2MUYA 4IFDJ 4F7XA 4HEDA 1QNUA 4C3IB 4ZRZA 2BDNA 4PNYA 3MXNA 3VYUA 1I50B 1XTCD 1BOSA 2MJ8A 1DZ1A 5A2QL 1Q8IA 3BZDB 1HFNA 4DFAA 3VA7A 4G7OC 2BDOA 3J7YW 2QDBA 2EOTA 4KHVA 4BA1I 5IT9L 3DWPA 4YIJA 2Z1CA 4DAVA 2F0GA 1Q1BA 4X3UA 3F2UA 5ELEA 4FF3A 2PMZB 1EZ6A 1DM0B 4RA8A 3NHHA 1PXUA 3I90A 1SXTA 1O80A 2FFKB 4C3HB 1QNKA 5EPJA 3I3CA 2NN6I 1BR9A 3GP7A 2Y0SB 1LTAD 4QCLA 1ET9A 3KF8A 2F0FA 4Q5VA 4C3IG 2B63B 1GHKA 3SXHA 1YNJD 2D2CC 4OO1I 4HSPA 4HTHA 1QILA 1AZPA 3OHXC 3MZ5A 3TZUA 1STAA 2NVXB 5M5YB 4PMCA 2ICEC 1DYQA 1SNPA 1F9QA 5I2YA 2EY1A 3NBHA 4KV6A 5DM63 1OXTA 1AP0A 3HP3A 2QCPX 1B2TA 3M7GA 2RSNA 5E4XA 1H9RA 3ZYYX 5C3WA 4ULLA 3KK7A 2TSSA 4A3EB 3DM1A 1AEXA 3M85A 3G6JB 5CR3A 4K5VA 5T1IA 4CGYB 2L4NA 3MWYW 4A93B 2WP8J 4TSSA 5C4XB 1HQMC 5FK9C 3S2HB 4KD4A 3A56A 4DU9A 3C1FA 2J4XA 3TMEA 4MN3A 2OXPA 1MI2A 1STGA 4IZ8A 1SAPA 1SYEA 3HG9A 3I72A 4G57A 3EROA 1LT4D 1OXXK 3LNNA 3NE5B 4X3KA 4F88A 2D5DA 2NTSA 1WTOA 3E6ZX 4X3SA 1CA6A 3RMHA 3A8JE 1EYDA 2D9UA 2F0WA 4EGVA 4C2MB 3T13A 1KDAA 4CJ0B 1KDBA 1NSNS 1JCKB 2RA4A 2DN8A 3FMCA 5F2DA 4HR7B 4RGNA 2KEEA 5K5PA 1C8CA 1LTGD 1GHJA 4FO2A 4QB4A 2M2LA 2L11A 3TP6A 3LX0A 3K0YA 3QWNA 1S5BD 1RTNA 2C9OA 3KUPA 2JP1A 4HMIA 1EFID 2L0CA 3FRPB 4EQOA 1C48A 2EYJA 3HZXA 2D62A 4DGZA 4FF4A 2A6HD 2YYZA 1EY7A 2RQXA 5ELBA 3I4NB 2MPMA 3SVMA 2B2VC 1RCVD 4XYQA 1E2WA 2B2YC 2EE1A 3GTPB 1UAPA 4XYOA 1IW7D 1HCZA 2Z4IA 1XXGA 4RH6A 1QOHA 2NZ1D 1CZGA 4FVMA 3AU7A 1IW7C 2A68D 5IODA 1NUCA 1Q12A 1UNSA 1QG7A 1PFBA 2B39A 4DF7A 2FINB 2EY2A 2CVRA 5I6WA 3D6CA 4OIJA 1SSOA 2KUMA 1IKMA 1SJHD 4O42A 2MHVA 1LTID 4IUUA 3S1RB 3KBGA 2ENBA 3TZDA 3BYTB 1X32A 3OW7A 2WV6D 2F0DA 4PV1C 3A8IE 4ID6A 1LV9A 3MEHA 5KIXA 4IALA 1E2ZA 4X3TA 2A74C 4HAEA 4KY5A 1Y8NB 1IL8A 4DAPA 2QILA 1TT2A 5AFWA 3M7NA 1I4PA 2WKDA 3K57A 2F0IA 2KEDA 3TN2A 3DHQA 1A3VA 3P1HA 3SK5A 1SNCA 5M9OA 1V1OA 1F9SA 1EY8A 4DNTB 3K5MA 1LACA 2SEBD 1BUVT 1STYA 2XN9C 2SNMA 5J39A 4S3SA 1SYDA 5K36G 2X6GA 4E6IA 1ET6A 4XT1B 1STEA 5C6AA 3ND8A 1K8OA 3W2DA 2SOBA 2WIIB 5KGUA 1WTWA 5C4JB 1X3PA 1SBBB 1ONLA 3OMGA 3MFGA 1NR2A 5CV7A 3UI2A 5C44B 1U9RA 2RDHA 1M8AA 3GTMB 4DXFA 4CJ1B 3VYTA 1I6VC 2F3VA 4XIGS 5M5XB 4RHRA 3MHBA 2B2WC 1TKWB 1F2MA 2JA5B 2PZTA 3T56B 2WB1B 1QE6A 2NBFA 2NYZD 1YNNC 1VMCA 5IGDA 2MGSA 3LWUA 1ZYRD 2JA8B 1E0BA 3J81E 1HHVA 3FKIB 3T16A 4N9TA 1JWMD 1I4XA 1MGSA 3C1EA 3NP8A 2TMPA 3V05A 5CV9A 2GA4B 2IPKD 4CBVA 1F2LA 1BO0A 1G2SA 3DEOA 1LO5D 4LK1C 5M3FB 5FO7B 2ZXOA 4P2CB 3TP7A 3NSWA 4DK0A 5C0XG 1QCBD 1ZEQX 5JJZA 4KY6A 1UUPA 4IFDI 2VUMB 1WD1A 1TWCB 4A3KB 4IUVA 2ZT9C 2HUGA 1EY5A 4A3DB 1HFGA 2DY7A 1Q1EA 2FMCA 4K8JA 1O7ZA 3G7LA 3T4AC 4C1NK 1T5XD 5IGEA 2XSCA 3EFXD 3L7ZC 1D5XC 3NTKA 4J6HA 4RCNA 1R9TB 3NWSA 5CV8A 2F1MA 1PRTC 4FYDA 2L1BA 5I9PA 1S5DD 1TY0A 1VF5C 2B2TA 1OXSC 2O5IC 2A69D 2EY5A 1KTKA 3DEPA 1OO9B 3TP8A 2XRQD 2X69A 1JICA 1AW7A 3NUCA 4ZUJA 3DMUA 2IW3A 2OEOA 2K6AA 1DXMA 1I4QA 3R93A 3MXPA 1S5FD 5IGBA 3IAYA 1PRTF 1SEBD 5M5WB 1SNOA 2E76C 1QWYA 5CORA 4B9XA 1XWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T51 B;  3U9S A;  5KNC A;  2AWO A;  1Y69 U;  1FR3 A;  1CTM A;  2KCC A;  2EDG A;  1A6X A;  2K33 A;  5K36 H;  1YNJ C;  3M4Y A;  1G29 1;  5JEA H;  4KN7 C;  1H9S B;  2DNE A;  1H9R A;  1BDO A;  1Z7T A;  4LK1 C;  4TQU S;  4OO1 G;  2E75 C;  4OGQ C;  3N6R A;  3RLF A;  4DK1 A;  4LJZ C;  4DNR B;  4DK0 A;  5C0X G;  1GUG A;  1GJX A;  1VCI A;  2A6E D;  4OO1 H;  3SDZ A;  2V4D A;  3A8K E;  2R6G A;  3PV0 A;  3PUY A;  1DCZ A;  3T53 B;  4DNT B;  1SMY C;  2D62 A;  1LAC A;  2A6H D;  3VA7 A;  4G7O C;  2BDO A;  4G7Z C;  1ZYR C;  1TU2 B;  2JEA I;  1PMR A;  3FPP A;  3W3A A;  4KHZ A;  2A6E C;  2JXM B;  3M85 A;  1QJO A;  2YYZ A;  2ZT9 C;  3GD7 A;  5KND A;  1IYV A;  5K36 G;  4I7Z C;  4BA1 I;  5JEA G;  5BN3 A;  3QIA A;  4KKS A;  4TKO B;  4KMU C;  1GUT A;  3ND8 A;  2EJF C;  1K8O A;  3PUW A;  2L5T A;  1E2W A;  1T5E A;  4IFD H;  1Q1B A;  1GUN A;  1HQM C;  1Q1E A;  3EQL C;  1IW7 D;  1HCZ A;  1O78 A;  2AUK A;  1Y8O B;  1OXV A;  1K8M A;  5BN4 A;  1H9J A;  4KN4 C;  1VDZ A;  2AUJ D;  2EVB A;  1IW7 C;  3VR5 A;  2EJG C;  4L8J A;  2A68 D;  3I73 A;  3IKJ A;  3L7Z C;  5BN5 A;  1Z6H A;  2PNR C;  4G7H C;  1ONL A;  4RCN A;  3IFT A;  3H94 A;  2BA1 A;  3VR3 A;  1CFM A;  3MFY A;  3CRK C;  1Q12 A;  2CW0 C;  2A6H C;  3D4R A;  2BA0 A;  4JK1 C;  3MXU A;  2F1M A;  3VR6 A;  4IFD G;  1Q90 A;  3AB9 A;  3BDO A;  2NN6 I;  2EJM A;  2PPB C;  1VF5 C;  1H9M A;  1OXS C;  3I72 A;  2O5I C;  1B9M A;  3CRL C;  4KKU A;  3QJY A;  2A69 D;  1O7L A;  3A7L A;  1OXX K;  2LMC B;  3KLR A;  3LNN A;  3GQB A;  3NE5 B;  3I4L A;  1HTP A;  1I6V C;  1H9K A;  1VF7 A;  4XIG S;  3VR4 A;  2PCF B;  2JE6 I;  2D5D A;  1GHK A;  3PUV A;  1TKW B;  1V8Q A;  2O5J C;  3DXJ C;  3SE0 A;  3VR2 A;  2K7V A;  2B8G A;  3PUZ A;  2D2C C;  1EWH A;  4BA2 I;  2NN6 H;  3D31 A;  3T56 B;  1E2V A;  2B8F A;  3OOC A;  3A8J E;  1YNN C;  3WDN A;  3OW7 A;  2JEB I;  1FYC A;  1GUS A;  2A68 C;  2IT1 A;  4H44 C;  1DXM A;  3QG1 A;  4KKT A;  3OPO A;  4H13 C;  2K32 A;  3LWU A;  4PV1 C;  1CI3 M;  1OXU A;  3A8I E;  1H9S A;  3TZU A;  4H0L C;  1V43 A;  5KNB A;  4IQZ A;  1DD2 A;  2DN8 A;  3HGB A;  1ZKO A;  2Q8I B;  3FMC A;  1E2Z A;  2DNC A;  2BE5 D;  5A35 A;  4HR7 B;  1HPC A;  3PUX A;  1B9N A;  1Y8N B;  4GZY C;  3A7A B;  5C0X H;  4JBW A;  2NN6 G;  2QF7 A;  1GHJ A;  2A69 C;  3M7N A;  2E74 C;  2E76 C;  1OXT A;  2BE5 C;  4KI0 A;  3BG3 A;  4XTC S;  1Y8P B;  1IYU A;  1LAB A;  3P20 A;  2KA7 A;  3ND9 A;  1GUO A; 
#chains in the Genus database with same CATH topology
 4PZ8 A;  4A76 A;  1CQF A;  2K04 A;  5K36 H;  1L0X B;  2IHE A;  4NW2 A;  3TS2 A;  1WTH A;  4P74 A;  4J15 A;  1SMY D;  1Q82 C;  3NWT A;  2OTL A;  2R93 B;  1LTT D;  4DNR B;  2EXD A;  1TS2 A;  2H1E A;  2C5C A;  2A6E D;  2VS1 A;  3D6W A;  3T53 B;  1SMY C;  2KCT A;  3PQI A;  3ONA B;  4L63 B;  2PW7 A;  4RAU C;  4JV5 Q;  2A6E C;  3RZD B;  4JV5 L;  2R7D A;  4YWK A;  1E1T A;  5KND A;  1CKO A;  1J6Q A;  3QIA A;  4R4O A;  5IP9 H;  3S1R H;  4V19 0;  4A3G B;  3HRZ C;  4MNO A;  2AHO B;  3J81 j;  1T5E A;  4BBS B;  1LT6 D;  3X3N A;  1OXV A;  5GQO A;  3UDF A;  4OWT B;  1PA6 A;  2F0O A;  3I73 A;  5BN5 A;  4A3K G;  1DOL A;  3IFT A;  1BF4 A;  3RR5 A;  1CSP A;  3H6M A;  4XDX A;  5FO9 B;  5BR8 Q;  4DK3 C;  4P75 A;  5BR8 L;  1HUN A;  2ID0 A;  4YHH Q;  4RFB A;  4IPG A;  3K0X A;  2K03 A;  1A2U A;  4KKU A;  2GN5 A;  1O7L A;  5HGT A;  5JVH 3;  4DV6 Q;  1H9K A;  3DWQ A;  1SFO B;  4DV6 L;  2IL8 A;  3RZO B;  4ABN A;  2A8V A;  3AMU A;  3RD4 A;  1A0I A;  4ZK9 B;  5I4D A;  1MIU A;  1MD2 D;  3CCV A;  1U4R A;  2ALY B;  4H0L C;  1V43 A;  4A3M B;  3C3L A;  2L55 A;  1ZKO A;  3WOF A;  1RKN A;  2WKC A;  1GO3 E;  3QOJ A;  3GO5 A;  5TSS A;  5C0X H;  1Y14 B;  2NN6 G;  5ELD A;  4GKJ L;  2RDF A;  1O7Y A;  2JK8 A;  1TS5 A;  4MTK A;  1PLF A;  5C4J H;  1AZQ A;  4B3S Q;  1EEI D;  2KCC A;  1HTL D;  4UAI A;  1HH2 P;  4B3S L;  3K6O A;  3MC0 B;  1YNJ C;  1RF2 D;  2NVQ B;  1UE7 A;  4KN7 C;  4A3G G;  4CDE C;  4OO1 G;  5C44 H;  2E75 C;  4OGQ C;  2F0K A;  4A3J B;  4BBS G;  3GTM H;  5JVG 3;  1DCZ A;  5IYD H;  2F0L A;  3TDQ A;  1EYG A;  5CYU A;  5DNF A;  1IYV A;  2JA5 H;  4TKO B;  4IPD A;  4QMG A;  2NZO A;  1RD9 D;  4BBR B;  4KLK A;  5C4H A;  3Q8D A;  4IJL A;  4YWL A;  4GLA C;  5LL6 X;  1X3F A;  1V9P A;  1PDQ A;  5BN4 A;  4U68 A;  2Q2U A;  3CCM A;  1L0Y B;  2EJG C;  1SJE D;  2K50 A;  1HXY D;  1NBW A;  2HDM A;  1WTQ A;  1FNU A;  3FKI H;  2XTI A;  5GAG C;  3F2B A;  2F4V Q;  2F4V L;  2L15 A;  4R4Q A;  4JI1 Q;  4A3C H;  4JI1 L;  3PF5 A;  4IJH A;  4L5S A;  3KYH C;  3R2T A;  1X3Q A;  3FEW X;  3J81 L;  2R92 B;  1WTX A;  5M3F H;  2OQK A;  1PHJ A;  4CKB A;  2FJ2 A;  4R4C A;  4IN3 A;  3PIO A;  1JT8 A;  4ME5 A;  3SE0 A;  1S5E D;  1A3U A;  2K7V A;  2F0U A;  4RCO A;  3C2P A;  3ER0 A;  2QKI C;  2F0T A;  1KQS A;  2VUM H;  5EPL A;  1TWC H;  3K7A B;  4A3K H;  2K1B A;  4A3D H;  4A3I B;  5CV4 A;  4V0B A;  2RBM A;  1DD2 A;  5ELF A;  2MNA A;  2UXB Q;  2DNC A;  1VQK A;  4UPA A;  2UXB L;  4L6T B;  1LTR D;  1GOZ A;  5EKL A;  3AQQ A;  3QB3 A;  3NEL A;  4DR6 Q;  3K5O A;  2RSO A;  5FLM G;  4DR6 L;  3TEH B;  1UE5 A;  2AWO A;  1F2Y A;  1QUQ B;  1ASY A;  1B1Z A;  2K33 A;  4NDX A;  1R9T H;  4P71 A;  1X54 A;  2F0H A;  1BDO A;  1U4M A;  4TQU S;  1LLR D;  4C56 C;  4CKC A;  4X62 Q;  4ODG A;  4FF1 A;  2BH2 A;  4X62 L;  3A8K E;  2R6G A;  3H15 A;  1RDP D;  2K5V A;  2AQ2 B;  1FD7 D;  2DY8 A;  4BS9 A;  5C3X A;  2JA6 B;  4QUC A;  3I4M G;  4K5X A;  5JJK A;  4H02 A;  4H7B A;  1CT1 D;  4PMW A;  3Q22 A;  2IX1 A;  1K0R A;  5IWA Q;  1KD1 C;  2PQE A;  3FVQ A;  5IWA L;  1N8R C;  5GAE C;  1RHP A;  3EQL C;  1C4Q A;  3KBX A;  1AE2 A;  2WAQ B;  1LYL A;  2VB3 X;  3GTJ B;  4KN4 C;  1N9W A;  4WJW A;  3V96 A;  5C3E G;  5M5W H;  2LSS A;  1S3O A;  4DN4 M;  2BA1 A;  2J7Z A;  3MFY A;  1D1K A;  3KJO A;  2A6H C;  3D4R A;  5CBA E;  1I5F A;  3PO3 G;  1LM0 A;  3ERQ A;  3AB9 A;  4OHJ A;  3GV6 A;  3ULJ A;  1BCP D;  4ZKC B;  4LF6 Q;  4RKB A;  4LF6 L;  3SGI A;  4ZYS A;  1VF7 A;  2PCF B;  1YJ9 A;  4KK7 A;  2R93 H;  4XQJ A;  3WWV A;  1FGB D;  4WOR A;  5FLX E;  1Z47 A;  3I56 A;  1EWH A;  2NN6 H;  1CKN B;  5EBD A;  4NKL A;  1E2V A;  2EYH A;  4X64 Q;  2XWB B;  2F0S A;  3S2D B;  1LUZ A;  3RZD H;  2A68 C;  1QUQ A;  1LT3 D;  1A15 A;  3KDF B;  2XRS D;  4H13 C;  2K28 A;  3SK4 A;  1BCP B;  5EKI A;  4A3G H;  1VMP A;  5G3L D;  4K5W A;  1HPC A;  4BBS H;  4KHP Q;  1M4V A;  2WAQ E;  4KHP L;  1PFS A;  3KLS A;  2V1C C;  2QF7 A;  1HA5 A;  3NTH A;  5ELO A;  1HRJ A;  3QOL A;  3AFQ A;  5EJW A;  2JA6 G;  1RTO A;  3T51 B;  1XTD A;  1EL0 A;  2B3G A;  1IHZ A;  1WCM B;  1TR5 A;  2ZTC A;  1CTM A;  2PZU A;  5I9O A;  4GS3 A;  2ZJQ A;  3EIV A;  2ASB A;  3OWF A;  1HQR D;  3H3V C;  4PG3 A;  1VCI A;  4U67 3;  2WAQ G;  2YTY A;  1K9M C;  2CWA A;  1W2B A;  2N88 A;  1SFO H;  3RZO H;  3K5N A;  5EPK A;  3Q24 A;  1CHP D;  1SMX A;  2R7Z B;  4A3F G;  4O2D A;  3M9B A;  1N36 Q;  5J1Z A;  1N36 L;  3PUW A;  2HDL A;  1W3S A;  2KJX A;  5JAV A;  3OW2 A;  1O78 A;  1AH9 A;  1Y8O B;  1XMQ L;  3N52 A;  1L1O C;  2LKV A;  3PO2 B;  4A3M H;  5JPM C;  4A3L G;  1R4Q B;  2HT1 A;  3K5L A;  3IKJ A;  4DR4 Q;  3SK6 A;  3MTS A;  3HOV B;  2DJG C;  4L5Q A;  4DR4 L;  3H94 A;  5J3B A;  3Q23 A;  4KJN A;  1SE4 A;  1CKN A;  3WOE A;  1S72 A;  3F2D A;  1X65 A;  2YTV A;  4IPH A;  1LTS D;  2EJM A;  5HGQ A;  3KDF A;  2VQF L;  4M1U B;  2NVQ H;  2Q8T A;  1B53 A;  1U4P A;  5EBC A;  5M3M B;  4CJ2 C;  5IIF A;  2E2I B;  3CC7 A;  4A3J H;  2I46 A;  1YVC A;  1NMG A;  2EYP A;  4JBJ A;  1ROD A;  2L9H A;  1PVO A;  4RGT A;  1U4L A;  1EY4 A;  4FF2 A;  2CQA A;  1P16 A;  1XPO A;  4OIK A;  5FKA C;  3Q0A A;  4OWW B;  2F0J A;  2Q8I B;  2Z0S A;  4BBR H;  3I2Z A;  4APV A;  1W6K A;  5A35 A;  5CC4 A;  1B9N A;  3M3Y B;  4IUQ A;  1IYJ B;  3BDC A;  3BG3 A;  1Y8P B;  2KA7 A;  1D6E C;  3U9O A;  3UDI A;  1SYB A;  2K75 A;  2R7Z G;  2EDG A;  1U5K A;  4F87 A;  4POF A;  4LNQ A;  3KLS X;  2K5W A;  1Z7T A;  1C7Y A;  2EXZ A;  4J8Q A;  3H91 A;  1B3A A;  4GOP C;  1SYF A;  1YJN A;  3H3V I;  4K6D A;  3PO2 G;  3PV0 A;  4LW1 A;  2R92 H;  1PYS B;  1ZYR C;  2K4K A;  1PMR A;  3S1M B;  3HOY G;  3GTK B;  3FP9 A;  3GD7 A;  4FNF A;  3HOV G;  4XT3 B;  5JEA G;  5BN3 A;  1KRT A;  5EKK A;  4MHE A;  1XYI A;  3S15 B;  1GUT A;  1K73 C;  3J80 E;  5EGT A;  2HIX A;  2LXJ A;  5KRU A;  3K7A H;  2QEJ C;  1PTO D;  1GUN A;  2KHJ A;  3H0G G;  1JWS D;  5IOC A;  1KDC A;  3I91 A;  5D65 A;  4JI6 Q;  2VNU D;  2AUJ D;  4ZAI A;  4JI6 L;  4UY8 C;  4GN4 B;  1WJJ A;  2F03 A;  1MBY A;  1KXL A;  4LAA A;  3ITP A;  3VR3 A;  4DR2 Q;  4DR2 L;  1TWG B;  3NXW A;  2KEC A;  4IFD G;  4G4K A;  1D5Z C;  1UWV A;  3GTQ B;  4HJ9 A;  1SDF A;  2PPB C;  2AMC B;  4RGO S;  1BXT A;  2IX3 A;  1PTO B;  2O2L D;  5I2X A;  2LMC B;  1STN A;  1BQQ T;  1LT5 D;  5LHY 1;  1DOM A;  1X55 A;  4C1N I;  4BY7 G;  3VR2 A;  1JOR A;  2B8G A;  2XVS A;  4HSV A;  1WD0 A;  3D31 A;  1FL0 A;  3VYR A;  2L12 A;  2JA6 H;  4QJF A;  3TBI B;  1EWC A;  4H44 C;  2KEN A;  3STB D;  4B08 A;  5GAH C;  1N33 Q;  2VW9 A;  2HQE A;  2K05 A;  1N33 L;  3CU7 A;  3STB C;  3VYS A;  1XPU A;  1JC7 A;  2DGY A;  2K52 A;  2A69 C;  3P7J A;  1UEA B;  1GUW A;  3GTJ H;  4K8I A;  5CV6 A;  4HCE A;  4KTA A;  3HKZ B;  1LTB D;  2RKS A;  5CBE E;  1FR3 A;  4ZLT F;  2Z8L A;  3RUZ A;  1Q8K A;  1PZI D;  1J5E L;  4QUF A;  3TP5 A;  3F1Z A;  4ILW A;  5E7N A;  3RLF A;  3CC2 A;  1EYC A;  4LJZ C;  3HEJ A;  4WRD A;  4MZ9 A;  4IUR A;  1STB A;  2N3S A;  1KRS A;  4DNI A;  4JYA Q;  1XPR A;  2EYL A;  2CH4 W;  2CW0 D;  1GM5 A;  3OTO Q;  4JYA L;  3E9I A;  3OTO L;  3CCE A;  3FPP A;  4JPB W;  1PRT B;  4RWS C;  2EY6 A;  1SR3 A;  3NEN A;  1QJO A;  2M00 A;  1EY9 A;  1I4H A;  3HOU G;  3MA2 B;  2JA7 G;  1EYA A;  3R3O A;  1MSG A;  5JEA J;  3JAM c;  3S2D H;  3SK8 A;  5JOB A;  1PH4 A;  2F3I A;  2N55 A;  3EA6 A;  1H9J A;  1KNA A;  4YCW A;  1VDZ A;  5FLX L;  1F9R A;  1GD7 A;  4KD3 A;  5C0X J;  3VR5 A;  4N9P A;  1B44 D;  1Z6H A;  5E3F A;  2IY5 B;  3L3O C;  4QQB X;  2SDF A;  2Z6K A;  3S24 A;  4B3T Q;  3KLW A;  3HKZ E;  4B3T L;  5JJI A;  3MXU A;  4Z9C B;  4DV4 Q;  2K5H A;  1B4O A;  3J81 i;  4DV4 L;  1WCM H;  1NCV A;  2JQO A;  4GLV B;  4JOI A;  2N8N A;  1E24 A;  3J7A F;  3ERS X;  2LFN A;  2F0P A;  1C0A A;  5HY6 A;  4NXM Q;  2F0Q A;  3KLR A;  4K2L A;  1HTP A;  4NXM L;  1Y1W B;  3A54 A;  4R8I A;  5GAD C;  2E2D C;  4MIU A;  4IUN A;  1CHQ D;  4OWX B;  3BVG A;  5ELN A;  5FOB B;  3PUZ A;  4C3J G;  1B50 A;  1XX8 A;  1VQ5 A;  4IUP A;  3BU2 A;  2AQ1 B;  4ZKB B;  1TY2 A;  1HNW Q;  3HKZ G;  1EZ8 A;  4CKE A;  1HNW L;  1TWA B;  3NTI A;  3DUZ A;  2VQE Q;  2IT1 A;  3I4O A;  4YWM A;  4CHT B;  4KKT A;  2VQE L;  5FJ8 G;  4DV0 Q;  3VA5 A;  2R7Z H;  2E5L Q;  4DV0 L;  2ZXR A;  5DLQ E;  4YHH L;  3J7Z C;  2E5L L;  1TWH B;  2BE5 D;  1G91 A;  3S17 B;  1WVL A;  4RHS A;  4QGU A;  1KLG D;  4JBW A;  3MAQ A;  2X6L A;  4DA2 A;  1XMO Q;  1JOO A;  3PO2 H;  3LWE A;  3R8B A;  1VQF A;  1EUJ A;  2BE5 C;  2QGQ A;  4XTC S;  1TQO A;  1XMO L;  1IYU A;  1LAB A;  3KOJ A;  1BBW A;  3U9S A;  1G8Z D;  1II3 A;  3C46 A;  3HOV H;  1TWF B;  3M4Y A;  5JEA H;  4ME3 A;  1FJG Q;  3OMC A;  1PH8 A;  1FJG L;  1HNZ Q;  1VQH A;  3IFD A;  5D14 A;  2F0M A;  1HNZ L;  3H0G H;  3CMA A;  4K14 A;  1BKB A;  2V4D A;  4BY1 G;  4YCU A;  3CQZ B;  3FPU B;  1PZK D;  4B9W A;  5M3M H;  1Z9F A;  4KHZ A;  3SHL A;  2E2I H;  1VQ7 A;  3W1G A;  2B2U A;  2VB2 X;  2HD3 A;  2H5X A;  3VDY A;  1EIY B;  1QB5 D;  4PMB A;  3EJI A;  1AN8 A;  2AQ3 B;  2E2J B;  3CPF A;  4IFD H;  3FHW A;  1I3Q H;  4R8N A;  1EQT A;  2P5Z X;  1V1Q A;  1K8M A;  3OWE B;  1SE3 A;  1Y1W G;  2HCI A;  1ENA A;  2WIN B;  2F0E A;  4UP8 A;  4FXK C;  5CGK A;  5JJL A;  1PH6 A;  1EY6 A;  3M3Y H;  3OSO A;  2FXQ A;  2BCO A;  3IL8 A;  2CCZ A;  3GTO B;  1H9M A;  1JB3 A;  3Q6S A;  1B9M A;  3QJY A;  1YBY A;  3A7L A;  4HIO A;  4EQP A;  4IO9 A;  2A73 B;  2EYO A;  2PO4 A;  5D3I B;  2LY7 A;  4BWG B;  2XIW A;  1PH2 A;  3PUV A;  1TS3 A;  4XQN A;  2G9D A;  1CUK A;  3I4M B;  1ENC A;  4R9W A;  2K5Q A;  2A5H A;  2B8F A;  2NTT A;  3S1M H;  1I94 Q;  3MXG A;  5DAU A;  1I94 L;  3GTK H;  3SEB A;  4XXE A;  3QG1 A;  5NUC A;  2K32 A;  1HR0 W;  1NAP A;  1LTL A;  3S15 H;  2RCF A;  4IQZ A;  2Y0S E;  2UXD Q;  5DM7 3;  5IT9 c;  1KNE A;  2EYM A;  1Q3L A;  2UXD L;  4DAM A;  5L37 A;  2VY3 A;  3A7A B;  4JW0 A;  1D5M C;  4PQX A;  5C3E B;  1PFM A;  4GNX B;  2NUC A;  3CXC A;  4FXG C;  3P20 A;  1EOT A;  3JAM E;  4G7Z C;  4DXG A;  1S5C D;  1YNX A;  1SNM A;  1Y69 U;  4C3H G;  4LF7 Q;  4IOA A;  5KYI A;  2ZJR A;  4LF7 L;  2HHH Q;  3PO3 B;  3J80 L;  2HHH L;  1TWG H;  4L5R C;  5EAY A;  3S1N B;  2Y0S G;  4YY3 Q;  1IBK Q;  3GTQ H;  4YY3 L;  3FDT A;  1VQN A;  4HN7 A;  1JE4 A;  1PTO H;  1X3G A;  2JEA I;  4DK6 C;  4QF4 A;  3GTG B;  2F52 A;  2MP1 A;  4NB3 A;  2R3Z A;  4A3B B;  1I4R A;  2EYF A;  1T9H A;  4NP5 A;  2LS0 1;  1Y1V B;  3HOW B;  1FNV A;  2VXW A;  2K14 A;  4JG2 A;  1YHB A;  5KYL A;  3S14 B;  4EQN A;  3HOX B;  3PMF A;  2Z6B A;  2F0V A;  2E2H B;  3NBI A;  3V2T A;  1KL9 A;  4L8J A;  4IUT A;  2UXC Q;  5HUR A;  1PH7 A;  2UXC L;  3NPP A;  4XQQ A;  3CRK C;  3OYY A;  4UP9 A;  3UDG A;  4A4I A;  1WTP A;  1Q90 A;  2IWH A;  5I6Y A;  2IJ0 A;  3CRL C;  2FMM A;  1V1P B;  3I4L A;  4LF4 Q;  3QO2 A;  3VR4 A;  4LF4 L;  3TRZ A;  1HA6 A;  1EIH A;  1AE3 A;  1FGU A;  1V8Q A;  4O1N A;  4A3E G;  1D1I A;  1IBM Q;  4BA2 I;  1EIG A;  2RHS B;  1PZJ D;  1VQI A;  4GNX A;  1F2Z A;  3S9W A;  3E5S A;  5C4Z A;  4A75 A;  2XNA C;  5LMN W;  5IP7 G;  3OOC A;  2O4X A;  4A3F B;  1FYC A;  1BBX C;  1QZG A;  2EIF A;  1E22 A;  4A93 G;  3I8Z A;  1KLU D;  4HMJ A;  4RKL A;  3X3M A;  1VQ4 A;  2NVT B;  3BDL A;  1YIT A;  3PUX A;  3DWA A;  3CKI B;  1BCP C;  4JBK A;  3NEM A;  5IGC A;  3SR1 A;  1VQ9 A;  1IBL Q;  4AQY Q;  1JQY D;  1GUO A;  2KQ3 A;  3J81 c;  4AQY L;  4EVO A;  4X64 L;  4A3B G;  4FP5 D;  1A6X A;  5LL6 S;  1EEF D;  1F9P A;  2KBN A;  3MVV A;  3F8T A;  3BS1 A;  3G71 A;  2PW5 A;  4GN3 B;  4F8M A;  1Y1V G;  3D4D A;  3HOW G;  3NQI A;  4DK1 A;  1EIF A;  1GUG A;  4JVZ A;  1EY0 A;  4OO1 H;  1ILP A;  3HOX G;  3PUY A;  1SE8 A;  3QR8 A;  4UDU C;  5ISR A;  1TU2 B;  3W3A A;  1Y1W H;  5E4W C;  2PYK A;  4RMF A;  4ZQ3 A;  1JR0 D;  3D8G A;  5IYB G;  1QZH A;  2FHT A;  4I65 A;  1BCP F;  4I7Z C;  4KKS A;  3D3R A;  1I6H B;  1B3Q A;  5C5M A;  1IL2 A;  1PYW D;  2CQO A;  2EJF C;  4M8A A;  5A2Q E;  1TWA H;  3I70 A;  1DON A;  1W6J A;  1WTV A;  2KCM A;  3OIP A;  1V1P A;  4DKA C;  3T1H Q;  3GTL B;  1TWH H;  1UE1 A;  3T1H L;  1M90 C;  1UE6 A;  3BVM A;  3S17 H;  2G9H D;  3S16 B;  1ML0 D;  1HUM A;  2RVL A;  3AFP A;  3A55 A;  3PIP 3;  4LMQ D;  1GXD C;  1EWI A;  2BA0 A;  3VR6 A;  2JSO A;  3M4P A;  4NMZ A;  4TRD A;  5IT9 E;  1YJW A;  1TVX A;  2QA4 A;  5G3L F;  1TWF H;  3K59 A;  2K5N A;  4LUZ A;  1TS4 A;  2CHB D;  4I7A A;  3CHB D;  2JE6 I;  1SYG A;  2RHQ B;  3CCJ A;  1ZXT A;  4OEM B;  3HOY B;  3CQZ H;  3RN5 A;  3I4N G;  3CD6 A;  1IKL A;  3NQT A;  4PZ7 A;  2Z9H A;  5COY A;  2KCN A;  1CK1 A;  1F77 A;  3OPO A;  1K3R A;  4OX9 Q;  1NMF A;  3BVZ A;  5FO8 B;  4OX9 L;  3H09 A;  4HCS A;  3H0G B;  2OQ0 A;  2E2J H;  1VQG A;  4JCV E;  4B3M Q;  3BZK A;  2ES2 A;  4JI4 Q;  1K0S A;  4B3M L;  4JI4 L;  1EQQ A;  4GZY C;  2K5D A;  2E74 C;  3EVQ A;  4KI0 A;  4FXD A;  1S4Z A;  3S1Q B;  3L0O A;  2B2V A;  5FLM H;  3UDX A;  2YU9 B;  1VQA A;  2B2Y A;  2ICI A;  1G29 1;  2ZM6 Q;  4N8F A;  1H9S B;  1HJP A;  1I3Q B;  2N49 A;  2ZM6 L;  4J1M A;  4HID A;  1CM9 A;  2H4O A;  1JMC A;  1HZA A;  4AIM A;  1VQM A;  1SNQ A;  3GTO H;  2B2T C;  3SDZ A;  1XJV A;  2KOL A;  5JPN C;  4BY7 B;  1QVG A;  1A3T A;  2A1A A;  3CAM A;  2JXM B;  1JOK A;  3ULP A;  4AYB B;  3I7F A;  3BZC A;  4R4T A;  1QVF A;  3D4W A;  2KVM A;  3I4M H;  1CSQ A;  1R4P B;  4OON A;  4KMU C;  5ELC A;  2L5T A;  5IY0 A;  5T1G A;  1HR0 Q;  4JI2 Q;  3J7A V;  1HR0 L;  2ZTE A;  4JI2 L;  1FNW A;  1NY4 A;  1PFN A;  2NB0 A;  1DOK A;  4Q0F A;  5EQ0 A;  4CDC C;  2M9V A;  2F0N A;  3P75 A;  3OIQ A;  1ESF A;  2OWO A;  4K6L A;  1YNN D;  1NR4 A;  5C5L A;  5LMU Q;  1VS0 A;  5LMU L;  4G7H C;  4HJ8 A;  1J8I A;  1MJC A;  3BJU A;  5C3E H;  2BH8 A;  1CFM A;  2XWJ B;  3CCS A;  4JK1 C;  1YI2 A;  1YIJ A;  4WJ3 M;  1DJR D;  2Q2H A;  2QEX A;  3BDO A;  4Y7N B;  1KAA A;  1KAB A;  4DV5 Q;  3PO3 H;  1QVC A;  4DV5 L;  4OL7 A;  5IGG A;  3NK9 A;  3S1N H;  1JWU D;  2I07 B;  3S2H H;  2JYO A;  2OT2 A;  1RJT A;  1PTO C;  4OXP A;  2J0T D;  3DXJ C;  1CA5 A;  3HKS A;  3JAM L;  4K2K A;  2RDG A;  4ZUI A;  3HOU B;  1VQL A;  2JA7 B;  5C0X I;  4AYB E;  1ENF A;  3R2I A;  3GTG H;  3A5Z B;  1GUS A;  2Z6K C;  2HCC A;  2ZXP A;  3HS0 C;  3GDE A;  4A3B H;  1EQV A;  4GKK Q;  1AFP A;  1OXU A;  2WAC A;  1H9S A;  4GKK L;  4X66 Q;  5KNB A;  4X66 L;  3HGB A;  4JOI C;  1WI5 A;  4DAY B;  2GVB A;  1Y1V H;  3HOW H;  3PCO B;  4RGM A;  1EU3 A;  3UE1 A;  3S14 H;  1JOQ A;  5J22 A;  2F4I A;  3HOX H;  3L2P A;  3ZJY C;  1EU4 A;  2EZV A;  3GV3 A;  2E2H H;  3ND9 A;  4IPC A;  5KNC A;  3M4Q A;  4AYB G;  1PTO F;  3RN2 A;  1KC8 C;  5C44 G;  2OF1 A;  2KHS A;  5IYB H;  4X6A H;  1J9O A;  1VQ6 A;  4QIW B;  2AWN A;  2DNE A;  4UHV A;  5E1F A;  4HJA A;  1SRO A;  4KJO A;  1SYC A;  3G4S A;  1EOV A;  2JJQ A;  3N6R A;  1N34 Q;  3CCL A;  1X6O A;  1GJX A;  3DM3 A;  1N34 L;  1STH A;  4R4I A;  1WTR A;  1CQV A;  3MXN B;  4EX5 A;  4C3J B;  1PRT D;  3URY A;  1ILQ A;  4WFN 3;  2WB1 G;  3M4O B;  5DEH A;  4DUZ Q;  2QW7 A;  2Z4H A;  2PZW A;  1VQP A;  1IXR A;  3L9A X;  3TSS A;  5CV5 A;  2K01 A;  2Q8R E;  1ICW A;  1YZ6 A;  5IGF A;  4A3F H;  1D2B A;  1A2T A;  2NWG A;  4HIM A;  1I4G A;  4DPG A;  2JA8 G;  3K58 A;  1NJI C;  2B2W A;  4KY7 A;  4LFA Q;  2AUK A;  1JJG A;  4GN5 A;  4LFA L;  2IX0 A;  1MSH A;  2AKW B;  3HOZ B;  2NVY B;  2EVB A;  3BYY B;  1M1K C;  3PIO 3;  1E7Z A;  1G6Z A;  3O13 A;  2NVT H;  5KEE A;  2PNR C;  4A3L H;  5D3D A;  1WOC A;  2SNS A;  3RLN A;  2CW0 C;  2Q2I A;  2F3W A;  2B2U C;  3I4N H;  2G5D A;  1SE2 A;  3ULL A;  4QIW E;  2UUC Q;  1G2T A;  5CMD A;  2UUC L;  4JC0 A;  4ALP A;  3GQB A;  4BY1 B;  4DAY A;  2R61 A;  1WFQ A;  2O5J C;  4AH6 A;  1ESR A;  2EPB A;  4FDB A;  1SND A;  1TII D;  1CZW A;  1B8A A;  4JI3 Q;  4JI3 L;  3CCQ A;  1K83 B;  4A3D G;  3WDN A;  2VZA A;  2JEB I;  3E0J A;  2BOS A;  3I55 A;  1CI3 M;  1BNZ A;  2MUY A;  1I6H H;  4IFD J;  3KF8 B;  4F7X A;  3G48 A;  4HED A;  1QNU A;  1E3P A;  4C3I B;  1JJ2 A;  4ZRZ A;  2BDN A;  4PNY A;  3MXN A;  3GTL H;  3J80 i;  1JB7 A;  3VYU A;  1I50 B;  3S16 H;  1XTC D;  1BOS A;  1G51 A;  2MJ8 A;  5A2Q L;  1DZ1 A;  3IRB A;  2YTX A;  1Q8I A;  3BZD B;  4R1J A;  1MKH A;  1HFN A;  3NBH B;  4DFA A;  3VA7 A;  3HOZ G;  4G7O C;  2BDO A;  3J7Y W;  2QDB A;  1Q86 C;  1PV4 A;  2EOT A;  3TQY A;  4KHV A;  4BA1 I;  5IT9 L;  4B3R Q;  1G6P A;  3DWP A;  3HOY H;  4B3R L;  4UP7 A;  4YIJ A;  3H3V H;  1RL2 A;  2Z1C A;  1BBU A;  2UUA Q;  1IZ6 A;  4DAV A;  2F0G A;  4DR1 Q;  2UUA L;  1Q1B A;  3AYH B;  4DR1 L;  4X3U A;  4DV3 Q;  3F2U A;  5ELE A;  4FF3 A;  4DV3 L;  2PMZ B;  2PQA B;  3CC4 A;  1EZ6 A;  1DM0 B;  4JI8 Q;  4RA8 A;  4JI8 L;  3NHH A;  3UE0 A;  1PXU A;  2RF4 A;  3I90 A;  3K7U C;  1SXT A;  1O80 A;  2FFK B;  4C3H B;  4QY7 A;  1QNK A;  5EPJ A;  2R7F A;  3I3C A;  3S1Q H;  2NN6 I;  1BR9 A;  3GP7 A;  3J7A 5;  1YHQ A;  2YU9 H;  2Y0S B;  4Y52 H;  1B70 B;  2R93 G;  1LTA D;  4QCL A;  1ET9 A;  3KF8 A;  4LUO A;  3E3X A;  4GKJ Q;  2F0F A;  4DR3 Q;  4Q5V A;  4C3I G;  2B63 B;  4DR3 L;  1GHK A;  3SXH A;  1YNJ D;  2D2C C;  4OO1 I;  4HSP A;  4HTH A;  4BY7 H;  1QIL A;  1PH1 A;  1JE5 A;  1AZP A;  5FLX c;  1VQJ A;  3OHX C;  3MZ5 A;  3CP0 A;  3TZU A;  1U0L A;  1STA A;  2NVX B;  5M5Y B;  4PMC A;  2ICE C;  1S40 A;  1DYQ A;  3W1B A;  1SNP A;  1YEZ A;  1F9Q A;  2PMZ E;  5I2Y A;  2EY1 A;  3NBH A;  4KV6 A;  5M5X H;  5DM6 3;  1OXT A;  4K0K Q;  1AP0 A;  2CFM A;  4K0K L;  3HP3 A;  2YV5 A;  2QCP X;  1B2T A;  3D0F A;  2WFW A;  3M7G A;  4GNX C;  2RSN A;  5E4X A;  1H9R A;  3ZYY X;  1GKH A;  5C3W A;  4Y7N H;  4ULL A;  1KIX A;  2JA8 H;  3KK7 A;  2TSS A;  1DGS A;  2PQA A;  4A3E B;  3DM1 A;  1ASZ A;  1AEX A;  1FVI A;  1VQO A;  3M85 A;  3G6J B;  5CR3 A;  4K5V A;  4LF8 Q;  3T1Y Q;  4LF8 L;  5T1I A;  2ATW A;  2C35 B;  1HZB A;  3T1Y L;  1ICF B;  4CGY B;  2L4N A;  1WYD A;  1OTC A;  3HOU H;  2JA7 H;  1N32 Q;  3MWY W;  4A93 B;  2WP8 J;  4TSS A;  1N32 L;  1HQM C;  3JC6 6;  5C4X B;  4QL5 A;  4A3M G;  5FK9 C;  4HJ5 A;  3S2H B;  1JJC B;  4KD4 A;  1IBK L;  3A56 A;  2IHF A;  4DU9 A;  3C1F A;  2B63 G;  2J4X A;  4NXN Q;  3TME A;  3A74 A;  2OXP A;  4MN3 A;  4NXN L;  1MI2 A;  2MO1 A;  1STG A;  4IZ8 A;  5IYC G;  2KHI A;  1NTG A;  1SAP A;  3MEF A;  2ZTD A;  4O0A A;  1SYE A;  4LF9 Q;  5IE8 A;  3HG9 A;  3I72 A;  4LF9 L;  3K81 C;  3ERO A;  4G57 A;  1LT4 D;  3A0J A;  4A3J G;  1OXX K;  3LNN A;  4X65 Q;  3NE5 B;  4X3K A;  2B29 A;  4F88 A;  4X65 L;  2D5D A;  2NTS A;  1WTO A;  3E6Z X;  4X3S A;  3CF5 A;  1CA6 A;  1GVP A;  1HZC A;  3RMH A;  3KF6 B;  4C3J H;  3A8J E;  4CDF C;  1EYD A;  2D9U A;  4JI5 Q;  4JI5 L;  3CCU A;  2F0W A;  4BBR G;  4EGV A;  3M4O H;  4TVA B;  3T13 A;  4C2M B;  1CKM A;  1KDA A;  4CJ0 B;  1KDB A;  1NSN S;  4LUV A;  1JCK B;  3AEV A;  2RA4 A;  5FJ8 H;  2DN8 A;  1O7I A;  3FMC A;  5F2D A;  4NPS A;  4HR7 B;  4RGN A;  2KEE A;  5K5P A;  4DV7 Q;  3DLL A;  1PH5 A;  1C8C A;  4DV7 L;  1LTG D;  1GHJ A;  1VQE A;  4FO2 A;  4BXX G;  4HJ7 A;  4QB4 A;  3CCR A;  3F2C A;  2NVY H;  3HOZ H;  1IBM L;  4ZCK A;  2M2L A;  3TRE A;  2L11 A;  2D0P A;  3TP6 A;  1A62 A;  2JA9 A;  3LX0 A;  3K0Y A;  3QWN A;  1S5B D;  1RTN A;  4RG1 A;  2C9O A;  2HIV A;  3KUP A;  2D0O A;  1D7Q A;  5C4X G;  2JP1 A;  4HMI A;  1EFI D;  2L0C A;  2R92 G;  2MO0 A;  3FRP B;  4EQO A;  1C48 A;  2EYJ A;  3HZX A;  2D62 A;  4DGZ A;  1PH9 A;  2A6H D;  4FF4 A;  4BY1 H;  4LF5 Q;  1D8L A;  2YYZ A;  1EY7 A;  2RQX A;  5ELB A;  4LF5 L;  3KFU A;  3I4N B;  4P73 A;  1IBL L;  2I5L X;  2MPM A;  3SVM A;  1Q81 C;  2B2V C;  3ICE A;  1K3B C;  1RCV D;  1K83 H;  4XYQ A;  2UU9 Q;  1E2W A;  2UU9 L;  2B2Y C;  3EN2 A;  4A3I G;  1X9N A;  2EE1 A;  1VQ8 A;  3GTP B;  1UAP A;  4XYO A;  1IW7 D;  1HCZ A;  2Z4I A;  3CW2 C;  1XXG A;  4RH6 A;  2GVA A;  1QOH A;  3J80 c;  2NZ1 D;  3U4Z A;  4WJ4 A;  1MHW C;  1CZG A;  4FVM A;  3AU7 A;  1IW7 C;  2A68 D;  5IOD A;  4C3I H;  4JI7 Q;  4JI7 L;  4YCV A;  1NUC A;  1Q12 A;  3KF6 A;  1UNS A;  1QG7 A;  1PFB A;  2B39 A;  4DF7 A;  1I50 H;  3U4V A;  2FIN B;  2EY2 A;  2CVR A;  5I6W A;  3D6C A;  4HIK A;  4OIJ A;  3JAM i;  1YHA A;  1SSO A;  2DUD A;  4N8X 1;  4CDD C;  2KUM A;  1IKM A;  1SJH D;  4O42 A;  2MHV A;  3CME A;  1LTI D;  4IUU A;  3S1R B;  3KBG A;  2ENB A;  3TZD A;  3BYT B;  1VQB A;  1HNX Q;  1X32 A;  3OW7 A;  1HNX L;  2WV6 D;  2F0D A;  4PV1 C;  3A8I E;  4DR5 Q;  1KHI A;  2EQS A;  4ID6 A;  4OEL B;  1LV9 A;  4DR5 L;  3MEH A;  5KIX A;  4IAL A;  1E2Z A;  4X3T A;  2A74 C;  4HAE A;  4KY5 A;  1Y8N B;  1IL8 A;  4DAP A;  2A19 A;  2QIL A;  1TT2 A;  5AFW A;  3M7N A;  1I4P A;  2WKD A;  3K57 A;  2VL6 A;  2F0I A;  2KED A;  3TN2 A;  3DHQ A;  1A3V A;  3P1H A;  3SK5 A;  3RNU A;  2CKZ B;  1SNC A;  1L0W A;  2MFI A;  4P72 A;  4C3H H;  5M9O A;  1V1O A;  4LWC A;  3CPW A;  3PSI A;  1F9S A;  1XMQ Q;  1EY8 A;  4DNT B;  1HZ9 A;  3K5M A;  1LAC A;  2SEB D;  1BUV T;  1STY A;  4PZ6 A;  2XN9 C;  2SNM A;  2B63 H;  5J39 A;  1VQD A;  1SLJ A;  4S3S A;  5GRO A;  1SYD A;  5K36 G;  2X6G A;  3B6Y A;  4E6I A;  1ET6 A;  4XT1 B;  1STE A;  5IYC H;  1L1O B;  3ND8 A;  5C6A A;  2I0Q A;  2VQF Q;  1K8O A;  1BVS A;  1XNQ Q;  3U58 A;  1XNQ L;  2OTJ A;  1A8V A;  3W2D A;  2SOB A;  2NVX H;  2WII B;  5M5Y H;  5KGU A;  1WTW A;  5C4J B;  1X3P A;  1X56 A;  2HQL A;  1SBB B;  1ONL A;  5IP9 G;  2NZH A;  3MFG A;  1WCM G;  3OMG A;  1NR2 A;  5CV7 A;  3UI2 A;  5C44 B;  1U9R A;  2RDH A;  1M8A A;  1EQR A;  1H95 A;  3GTM B;  3K8A A;  2I5H A;  4DXF A;  4CJ1 B;  4L5T A;  1K8A C;  1KAW A;  3VYT A;  1I6V C;  2F3V A;  4XIG S;  5M5X B;  4RHR A;  3MHB A;  1Q7Y C;  2B2W C;  1TKW B;  4JBM A;  1B7Y B;  1F2M A;  1C9O A;  2PZT A;  2JA5 B;  1XNR Q;  3T56 B;  1XNR L;  2WB1 B;  2PI2 E;  1QE6 A;  2NBF A;  4A3E H;  2NYZ D;  1NNX A;  4BXX H;  1YNN C;  1VMC A;  4JI0 Q;  5IGD A;  1EFW A;  2MGS A;  4JI0 L;  5IP7 H;  3LWU A;  1ZYR D;  2JA8 B;  1Q46 A;  1E0B A;  4A93 H;  2MQH A;  3HFZ B;  5C4X H;  3J81 E;  1HHV A;  3FKI B;  3T16 A;  3TS0 A;  4N9T A;  1JWM D;  2N78 A;  1I4X A;  4GLX A;  1MGS A;  3C1E A;  1L2F A;  2TMP A;  3NP8 A;  3V05 A;  5CV9 A;  1MJE A;  2UUB Q;  2GA4 B;  2IPK D;  2XGT A;  2PI2 A;  1VQC A;  2UUB L;  4CBV A;  3G6E A;  3PGZ A;  4POG A;  2PNH A;  1F2L A;  4GOP B;  1PH3 A;  1BO0 A;  1G2S A;  3DEO A;  1PYB A;  1LO5 D;  4LK1 C;  2JN4 A;  5M3F B;  2OCE A;  1L1O A;  3K80 C;  5FO7 B;  2ZXO A;  4P2C B;  3TP7 A;  3NSW A;  2DJF C;  4DK0 A;  5C0X G;  4A3I H;  5M3M G;  1QCB D;  1ZEQ X;  5JJZ A;  4KY6 A;  1UUP A;  4IFD I;  2VUM B;  1WD1 A;  1TWC B;  4A3K B;  4IUV A;  2ZT9 C;  2HUG A;  2RCN A;  1EY5 A;  1TXY A;  4LFB Q;  5AJ3 Q;  2WB1 E;  4A3D B;  1HFG A;  4LFB L;  2DY7 A;  5AJ3 L;  4DV2 Q;  4DR7 Q;  3A5U A;  4DV2 L;  4DR7 L;  1Q1E A;  2FMC A;  4K8J A;  1O7Z A;  1RIP A;  1E1O A;  3G7L A;  3T4A C;  4C2M H;  5IYD G;  4C1N K;  1T5X D;  1K8G A;  5IGE A;  2XSC A;  3EFX D;  3L7Z C;  1D5X C;  3NTK A;  4J6H A;  4RCN A;  2JA5 G;  1X3E A;  3EBE A;  1R9T B;  3RLO A;  3NWS A;  2ZJP A;  1SRU A;  5CV8 A;  5LMN Q;  1A63 A;  2F1M A;  4DV1 Q;  5LMN L;  4DUZ L;  1PRT C;  1NE3 A;  4LFC Q;  4FYD A;  4DV1 L;  2L1B A;  4LFC L;  5I9P A;  1S5D D;  1TY0 A;  1VF5 C;  2B2T A;  1OXS C;  4MTN A;  2O5I C;  2A69 D;  2EY5 A;  1KTK A;  3DEP A;  1OO9 B;  3TP8 A;  2XRQ D;  2X69 A;  4EQ5 A;  1K28 A;  3FKI G;  1JIC A;  1AW7 A;  3NUC A;  2E8G A;  3PF4 A;  3KJP A;  2Q2T A;  2I5M X;  2CWP A;  4ZUJ A;  3W5O A;  4A3C G;  3DMU A;  2IW3 A;  2OEO A;  2CH4 A;  3LGJ A;  3PIP A;  2K6A A;  1P8L A;  3U50 C;  1J5E Q;  1DXM A;  1I4Q A;  3E9H A;  3R93 A;  4GOP A;  3MXP A;  5M3F G;  1S5F D;  1UEB A;  3E0E A;  5IGB A;  3IAY A;  1PRT F;  1SEB D;  1SN8 A;  5M5W B;  2QDL A;  3GTP H;  5H1S E;  4IOC A;  4DUY Q;  1SNO A;  4DUY L;  2E76 C;  1QWY A;  5COR A;  2VUM G;  2LXK A;  4B9X A;  1XWE A; 
#chains in the Genus database with same CATH homology
 1CQF A;  2K04 A;  5K36 H;  1L0X B;  4NW2 A;  1SMY D;  3NWT A;  2R93 B;  1LTT D;  4DNR B;  1TS2 A;  2H1E A;  2C5C A;  2A6E D;  3D6W A;  3T53 B;  1SMY C;  3ONA B;  4L63 B;  2PW7 A;  4RAU C;  2A6E C;  3RZD B;  5KND A;  3QIA A;  4V19 0;  4A3G B;  3HRZ C;  1T5E A;  4BBS B;  1LT6 D;  3X3N A;  1OXV A;  2F0O A;  3I73 A;  5BN5 A;  1DOL A;  3IFT A;  1BF4 A;  3H6M A;  4XDX A;  5FO9 B;  1HUN A;  2ID0 A;  4RFB A;  2K03 A;  1A2U A;  4KKU A;  1O7L A;  5HGT A;  5JVH 3;  1H9K A;  3DWQ A;  1SFO B;  2IL8 A;  3RZO B;  4ABN A;  3AMU A;  3RD4 A;  4ZK9 B;  5I4D A;  1MD2 D;  1U4R A;  4H0L C;  1V43 A;  4A3M B;  3C3L A;  2L55 A;  1ZKO A;  3WOF A;  1RKN A;  2WKC A;  3QOJ A;  3GO5 A;  5TSS A;  5C0X H;  2NN6 G;  5ELD A;  2RDF A;  1O7Y A;  1TS5 A;  1PLF A;  1AZQ A;  1EEI D;  2KCC A;  1HTL D;  4UAI A;  3K6O A;  3MC0 B;  1YNJ C;  1RF2 D;  2NVQ B;  4KN7 C;  4OO1 G;  2E75 C;  4OGQ C;  2F0K A;  4A3J B;  5JVG 3;  1DCZ A;  2F0L A;  3TDQ A;  5CYU A;  5DNF A;  1IYV A;  4TKO B;  4QMG A;  1RD9 D;  4BBR B;  5C4H A;  5LL6 X;  1PDQ A;  5BN4 A;  4U68 A;  1L0Y B;  2EJG C;  1SJE D;  1HXY D;  1WTQ A;  2HDM A;  1FNU A;  3R2T A;  1X3Q A;  3FEW X;  3J81 L;  2R92 B;  1WTX A;  4CKB A;  2FJ2 A;  4IN3 A;  4ME5 A;  3SE0 A;  1S5E D;  1A3U A;  2K7V A;  2F0U A;  4RCO A;  3C2P A;  2QKI C;  2F0T A;  5EPL A;  3K7A B;  2K1B A;  4A3I B;  5CV4 A;  4V0B A;  2RBM A;  1DD2 A;  5ELF A;  2DNC A;  4L6T B;  1LTR D;  1GOZ A;  5EKL A;  3QB3 A;  3K5O A;  2RSO A;  2AWO A;  1F2Y A;  1B1Z A;  2K33 A;  4NDX A;  2F0H A;  1BDO A;  1U4M A;  4TQU S;  1LLR D;  4C56 C;  4CKC A;  4ODG A;  4FF1 A;  3A8K E;  2R6G A;  1RDP D;  2AQ2 B;  1FD7 D;  2DY8 A;  4BS9 A;  5C3X A;  2JA6 B;  4QUC A;  4K5X A;  4H7B A;  3Q22 A;  1CT1 D;  4PMW A;  2IX1 A;  2PQE A;  3FVQ A;  1RHP A;  3EQL C;  1C4Q A;  3KBX A;  2WAQ B;  2VB3 X;  3GTJ B;  4KN4 C;  4WJW A;  3V96 A;  4DN4 M;  2BA1 A;  2J7Z A;  3MFY A;  1D1K A;  2A6H C;  3D4R A;  5CBA E;  3ERQ A;  3AB9 A;  4OHJ A;  3GV6 A;  1BCP D;  4ZKC B;  4RKB A;  4ZYS A;  1VF7 A;  2PCF B;  4KK7 A;  4XQJ A;  1FGB D;  4WOR A;  5FLX E;  1Z47 A;  1EWH A;  2NN6 H;  5EBD A;  4NKL A;  1E2V A;  2EYH A;  2XWB B;  2F0S A;  3S2D B;  2A68 C;  1LT3 D;  1A15 A;  2XRS D;  4H13 C;  2K28 A;  3SK4 A;  1BCP B;  5EKI A;  1VMP A;  5G3L D;  4K5W A;  1HPC A;  1M4V A;  3KLS A;  2QF7 A;  1HA5 A;  3NTH A;  1HRJ A;  3QOL A;  5EJW A;  1RTO A;  3T51 B;  1EL0 A;  1IHZ A;  1WCM B;  1TR5 A;  1CTM A;  2PZU A;  5I9O A;  3OWF A;  1HQR D;  3H3V C;  1VCI A;  4U67 3;  2N88 A;  3K5N A;  5EPK A;  3Q24 A;  1CHP D;  2R7Z B;  5J1Z A;  3PUW A;  2HDL A;  2KJX A;  5JAV A;  1O78 A;  1Y8O B;  3N52 A;  2LKV A;  3PO2 B;  5JPM C;  1R4Q B;  3K5L A;  3IKJ A;  3SK6 A;  3MTS A;  3HOV B;  3H94 A;  3Q23 A;  4KJN A;  1SE4 A;  3WOE A;  1LTS D;  2EJM A;  4M1U B;  2Q8T A;  1B53 A;  1U4P A;  5EBC A;  5M3M B;  4CJ2 C;  5IIF A;  2E2I B;  2I46 A;  2EYP A;  1ROD A;  2L9H A;  4RGT A;  1U4L A;  1EY4 A;  4FF2 A;  2CQA A;  4OIK A;  5FKA C;  3Q0A A;  2F0J A;  2Q8I B;  5A35 A;  1W6K A;  5CC4 A;  1B9N A;  3M3Y B;  4IUQ A;  3BDC A;  3BG3 A;  1Y8P B;  2KA7 A;  1D6E C;  3U9O A;  1SYB A;  2EDG A;  4F87 A;  3KLS X;  2K5W A;  1Z7T A;  2EXZ A;  4J8Q A;  3H91 A;  1B3A A;  1SYF A;  4K6D A;  3PV0 A;  1ZYR C;  1PMR A;  3S1M B;  3GTK B;  4FNF A;  3GD7 A;  4XT3 B;  5JEA G;  5BN3 A;  5EKK A;  4MHE A;  1XYI A;  3S15 B;  1GUT A;  3J80 E;  5EGT A;  5KRU A;  2QEJ C;  1PTO D;  1GUN A;  1JWS D;  5IOC A;  1KDC A;  3I91 A;  5D65 A;  2VNU D;  2AUJ D;  4ZAI A;  2F03 A;  1MBY A;  4LAA A;  3ITP A;  3VR3 A;  1TWG B;  3NXW A;  2KEC A;  4IFD G;  4G4K A;  1D5Z C;  3GTQ B;  1SDF A;  2PPB C;  4RGO S;  1BXT A;  2IX3 A;  1PTO B;  2O2L D;  5I2X A;  2LMC B;  1STN A;  1BQQ T;  1LT5 D;  5LHY 1;  1DOM A;  4C1N I;  3VR2 A;  1JOR A;  2B8G A;  2XVS A;  4HSV A;  1WD0 A;  3D31 A;  3VYR A;  2L12 A;  3TBI B;  1EWC A;  4H44 C;  4B08 A;  2HQE A;  2K05 A;  3CU7 A;  3VYS A;  1JC7 A;  2A69 C;  3P7J A;  1UEA B;  1GUW A;  4K8I A;  5CV6 A;  4HCE A;  4KTA A;  3HKZ B;  1LTB D;  2RKS A;  5CBE E;  1FR3 A;  4ZLT F;  2Z8L A;  3RUZ A;  1PZI D;  4QUF A;  3TP5 A;  4ILW A;  3RLF A;  1EYC A;  4LJZ C;  3HEJ A;  4WRD A;  4IUR A;  1STB A;  2EYL A;  2CW0 D;  3FPP A;  4RWS C;  1PRT B;  2EY6 A;  1QJO A;  2M00 A;  1EY9 A;  1I4H A;  3MA2 B;  1EYA A;  3R3O A;  1MSG A;  5JEA J;  3SK8 A;  5JOB A;  2N55 A;  3EA6 A;  1H9J A;  1KNA A;  1VDZ A;  5FLX L;  4KD3 A;  1F9R A;  5C0X J;  3VR5 A;  4N9P A;  1B44 D;  1Z6H A;  5E3F A;  3L3O C;  2SDF A;  3MXU A;  4Z9C B;  1B4O A;  1NCV A;  3J7A F;  2LFN A;  2F0P A;  2F0Q A;  3KLR A;  4K2L A;  1HTP A;  1Y1W B;  3A54 A;  4R8I A;  2E2D C;  4MIU A;  4IUN A;  1CHQ D;  3BVG A;  5FOB B;  3PUZ A;  4C3J G;  1B50 A;  1XX8 A;  4IUP A;  2AQ1 B;  4ZKB B;  1TY2 A;  1EZ8 A;  4CKE A;  1TWA B;  3NTI A;  3DUZ A;  2IT1 A;  4CHT B;  4KKT A;  3VA5 A;  2ZXR A;  1TWH B;  2BE5 D;  1G91 A;  3S17 B;  1WVL A;  4RHS A;  1KLG D;  4JBW A;  3MAQ A;  2X6L A;  4DA2 A;  1JOO A;  3LWE A;  3R8B A;  2BE5 C;  4XTC S;  1TQO A;  1IYU A;  1LAB A;  3U9S A;  1G8Z D;  1II3 A;  3C46 A;  1TWF B;  3M4Y A;  5JEA H;  3OMC A;  3IFD A;  5D14 A;  2F0M A;  4K14 A;  2V4D A;  3CQZ B;  3FPU B;  1PZK D;  4B9W A;  4KHZ A;  3SHL A;  2B2U A;  2VB2 X;  1QB5 D;  4PMB A;  3EJI A;  1AN8 A;  2AQ3 B;  2E2J B;  4IFD H;  4R8N A;  1EQT A;  1K8M A;  3OWE B;  1SE3 A;  2HCI A;  1ENA A;  2WIN B;  2F0E A;  5CGK A;  4FXK C;  1EY6 A;  3OSO A;  2BCO A;  3IL8 A;  3GTO B;  1H9M A;  1JB3 A;  3Q6S A;  1B9M A;  3QJY A;  3A7L A;  4EQP A;  2A73 B;  2EYO A;  2PO4 A;  5D3I B;  2LY7 A;  4BWG B;  2XIW A;  3PUV A;  1TS3 A;  4XQN A;  2G9D A;  3I4M B;  1ENC A;  4R9W A;  2K5Q A;  2A5H A;  2B8F A;  2NTT A;  3MXG A;  5DAU A;  3SEB A;  4XXE A;  3QG1 A;  5NUC A;  2K32 A;  1NAP A;  4IQZ A;  5DM7 3;  1KNE A;  2EYM A;  1Q3L A;  3A7A B;  1D5M C;  4PQX A;  5C3E B;  1PFM A;  2NUC A;  4FXG C;  3P20 A;  1EOT A;  3JAM E;  4G7Z C;  4DXG A;  1S5C D;  1SNM A;  1Y69 U;  4C3H G;  5KYI A;  3PO3 B;  3J80 L;  3S1N B;  3FDT A;  4HN7 A;  1JE4 A;  1PTO H;  2JEA I;  4QF4 A;  3GTG B;  2MP1 A;  2R3Z A;  4A3B B;  1I4R A;  2EYF A;  4NP5 A;  2LS0 1;  1Y1V B;  3HOW B;  1FNV A;  2VXW A;  5KYL A;  3S14 B;  4EQN A;  3HOX B;  3PMF A;  2F0V A;  2E2H B;  3NBI A;  3V2T A;  4L8J A;  4IUT A;  5HUR A;  3NPP A;  4XQQ A;  3CRK C;  1WTP A;  1Q90 A;  2IWH A;  5I6Y A;  2IJ0 A;  3CRL C;  2FMM A;  1V1P B;  3I4L A;  3QO2 A;  3VR4 A;  1HA6 A;  1EIH A;  1V8Q A;  4O1N A;  1D1I A;  4BA2 I;  1EIG A;  1PZJ D;  1F2Z A;  3S9W A;  3E5S A;  5C4Z A;  2XNA C;  3OOC A;  2O4X A;  4A3F B;  1FYC A;  1BBX C;  3I8Z A;  1KLU D;  4HMJ A;  4RKL A;  3X3M A;  2NVT B;  3BDL A;  3PUX A;  3DWA A;  3CKI B;  1BCP C;  5IGC A;  3SR1 A;  1JQY D;  1GUO A;  2KQ3 A;  4EVO A;  4FP5 D;  1A6X A;  5LL6 S;  1EEF D;  1F9P A;  3MVV A;  3BS1 A;  2PW5 A;  4F8M A;  3D4D A;  3NQI A;  4DK1 A;  1GUG A;  1EY0 A;  4OO1 H;  1ILP A;  3PUY A;  4UDU C;  5ISR A;  1TU2 B;  3W3A A;  5E4W C;  2PYK A;  4ZQ3 A;  1JR0 D;  3D8G A;  2FHT A;  4I65 A;  1BCP F;  4I7Z C;  4KKS A;  3D3R A;  1I6H B;  5C5M A;  1PYW D;  2EJF C;  4M8A A;  5A2Q E;  3I70 A;  1DON A;  1W6J A;  1WTV A;  3OIP A;  1V1P A;  3GTL B;  3BVM A;  2G9H D;  3S16 B;  1ML0 D;  1HUM A;  2RVL A;  3A55 A;  3PIP 3;  4LMQ D;  1GXD C;  2BA0 A;  3VR6 A;  2JSO A;  4NMZ A;  4TRD A;  5IT9 E;  1TVX A;  5G3L F;  3K59 A;  1TS4 A;  2CHB D;  3CHB D;  2JE6 I;  1SYG A;  1ZXT A;  3HOY B;  1IKL A;  3NQT A;  5COY A;  2KCN A;  1CK1 A;  1F77 A;  3OPO A;  3BVZ A;  5FO8 B;  3H09 A;  4HCS A;  3H0G B;  4GZY C;  2K5D A;  2E74 C;  3EVQ A;  4KI0 A;  4FXD A;  1S4Z A;  3S1Q B;  2B2V A;  2YU9 B;  2B2Y A;  2ICI A;  1G29 1;  1H9S B;  1I3Q B;  4J1M A;  1CM9 A;  2H4O A;  1SNQ A;  2B2T C;  3SDZ A;  2KOL A;  5JPN C;  4BY7 B;  1A3T A;  2JXM B;  1JOK A;  4AYB B;  3D4W A;  2KVM A;  1R4P B;  4KMU C;  5ELC A;  2L5T A;  5T1G A;  3J7A V;  1FNW A;  1PFN A;  2NB0 A;  1DOK A;  4Q0F A;  5EQ0 A;  2M9V A;  2F0N A;  3P75 A;  3OIQ A;  1ESF A;  4K6L A;  1YNN D;  1NR4 A;  5C5L A;  4G7H C;  1J8I A;  1CFM A;  2XWJ B;  4JK1 C;  1DJR D;  3BDO A;  4Y7N B;  1KAA A;  1KAB A;  4OL7 A;  5IGG A;  3NK9 A;  1JWU D;  2I07 B;  2JYO A;  2OT2 A;  1RJT A;  1PTO C;  2J0T D;  3DXJ C;  1CA5 A;  3JAM L;  4K2K A;  2RDG A;  4ZUI A;  3HOU B;  2JA7 B;  5C0X I;  1ENF A;  3R2I A;  1GUS A;  2HCC A;  2ZXP A;  3HS0 C;  1EQV A;  1AFP A;  1OXU A;  2WAC A;  1H9S A;  5KNB A;  3HGB A;  4RGM A;  1EU3 A;  1JOQ A;  5J22 A;  2F4I A;  1EU4 A;  2EZV A;  3GV3 A;  3ND9 A;  5KNC A;  1PTO F;  2OF1 A;  2KHS A;  1J9O A;  4QIW B;  2AWN A;  2DNE A;  5E1F A;  4KJO A;  1SYC A;  3N6R A;  1GJX A;  1STH A;  1WTR A;  1CQV A;  4C3J B;  1PRT D;  3URY A;  1ILQ A;  4WFN 3;  3M4O B;  5DEH A;  2Z4H A;  2PZW A;  3L9A X;  3TSS A;  5CV5 A;  2K01 A;  2Q8R E;  1ICW A;  5IGF A;  1D2B A;  1A2T A;  2NWG A;  1I4G A;  3K58 A;  2B2W A;  4KY7 A;  2AUK A;  2IX0 A;  1MSH A;  3HOZ B;  2NVY B;  2EVB A;  3BYY B;  1G6Z A;  3PIO 3;  3O13 A;  5KEE A;  2PNR C;  5D3D A;  2SNS A;  2CW0 C;  2F3W A;  2B2U C;  1SE2 A;  1G2T A;  5CMD A;  3GQB A;  4BY1 B;  4DAY A;  2R61 A;  2O5J C;  1ESR A;  2EPB A;  1SND A;  1TII D;  1CZW A;  1K83 B;  3WDN A;  2JEB I;  3E0J A;  2BOS A;  1CI3 M;  1BNZ A;  2MUY A;  4IFD J;  4F7X A;  4HED A;  1QNU A;  4C3I B;  4ZRZ A;  2BDN A;  4PNY A;  3MXN A;  3VYU A;  1I50 B;  1XTC D;  1BOS A;  2MJ8 A;  1DZ1 A;  5A2Q L;  1Q8I A;  3BZD B;  1HFN A;  4DFA A;  3VA7 A;  4G7O C;  2BDO A;  3J7Y W;  2QDB A;  2EOT A;  4KHV A;  4BA1 I;  5IT9 L;  3DWP A;  4YIJ A;  2Z1C A;  4DAV A;  2F0G A;  1Q1B A;  4X3U A;  3F2U A;  5ELE A;  4FF3 A;  2PMZ B;  1EZ6 A;  1DM0 B;  4RA8 A;  3NHH A;  1PXU A;  3I90 A;  1SXT A;  1O80 A;  2FFK B;  4C3H B;  1QNK A;  5EPJ A;  3I3C A;  2NN6 I;  1BR9 A;  3GP7 A;  2Y0S B;  1LTA D;  4QCL A;  1ET9 A;  3KF8 A;  2F0F A;  4Q5V A;  4C3I G;  2B63 B;  1GHK A;  3SXH A;  1YNJ D;  2D2C C;  4OO1 I;  4HSP A;  4HTH A;  1QIL A;  1AZP A;  3OHX C;  3MZ5 A;  3TZU A;  1STA A;  2NVX B;  5M5Y B;  4PMC A;  2ICE C;  1DYQ A;  1SNP A;  1F9Q A;  5I2Y A;  2EY1 A;  3NBH A;  4KV6 A;  5DM6 3;  1OXT A;  1AP0 A;  3HP3 A;  2QCP X;  1B2T A;  3M7G A;  2RSN A;  5E4X A;  1H9R A;  3ZYY X;  5C3W A;  4ULL A;  3KK7 A;  2TSS A;  4A3E B;  3DM1 A;  1AEX A;  3M85 A;  3G6J B;  5CR3 A;  4K5V A;  5T1I A;  4CGY B;  2L4N A;  3MWY W;  4A93 B;  2WP8 J;  4TSS A;  5C4X B;  1HQM C;  5FK9 C;  3S2H B;  4KD4 A;  3A56 A;  4DU9 A;  3C1F A;  2J4X A;  3TME A;  4MN3 A;  2OXP A;  1MI2 A;  1STG A;  4IZ8 A;  1SAP A;  1SYE A;  3HG9 A;  3I72 A;  4G57 A;  3ERO A;  1LT4 D;  1OXX K;  3LNN A;  3NE5 B;  4X3K A;  4F88 A;  2D5D A;  2NTS A;  1WTO A;  3E6Z X;  4X3S A;  1CA6 A;  3RMH A;  3A8J E;  1EYD A;  2D9U A;  2F0W A;  4EGV A;  4C2M B;  3T13 A;  1KDA A;  4CJ0 B;  1KDB A;  1NSN S;  1JCK B;  2RA4 A;  2DN8 A;  3FMC A;  5F2D A;  4HR7 B;  4RGN A;  2KEE A;  5K5P A;  1C8C A;  1LTG D;  1GHJ A;  4FO2 A;  4QB4 A;  2M2L A;  2L11 A;  3TP6 A;  3LX0 A;  3K0Y A;  3QWN A;  1S5B D;  1RTN A;  2C9O A;  3KUP A;  2JP1 A;  4HMI A;  1EFI D;  2L0C A;  3FRP B;  4EQO A;  1C48 A;  2EYJ A;  3HZX A;  2D62 A;  4DGZ A;  4FF4 A;  2A6H D;  2YYZ A;  1EY7 A;  2RQX A;  5ELB A;  3I4N B;  2MPM A;  3SVM A;  2B2V C;  1RCV D;  4XYQ A;  1E2W A;  2B2Y C;  2EE1 A;  3GTP B;  1UAP A;  4XYO A;  1IW7 D;  1HCZ A;  2Z4I A;  1XXG A;  4RH6 A;  1QOH A;  2NZ1 D;  1CZG A;  4FVM A;  3AU7 A;  1IW7 C;  2A68 D;  5IOD A;  1NUC A;  1Q12 A;  1UNS A;  1QG7 A;  1PFB A;  2B39 A;  4DF7 A;  2FIN B;  2EY2 A;  2CVR A;  5I6W A;  3D6C A;  4OIJ A;  1SSO A;  2KUM A;  1IKM A;  1SJH D;  4O42 A;  2MHV A;  1LTI D;  4IUU A;  3S1R B;  3KBG A;  2ENB A;  3TZD A;  3BYT B;  1X32 A;  3OW7 A;  2WV6 D;  2F0D A;  4PV1 C;  3A8I E;  4ID6 A;  1LV9 A;  3MEH A;  5KIX A;  4IAL A;  1E2Z A;  4X3T A;  2A74 C;  4HAE A;  4KY5 A;  1Y8N B;  1IL8 A;  4DAP A;  2QIL A;  1TT2 A;  5AFW A;  3M7N A;  1I4P A;  2WKD A;  3K57 A;  2F0I A;  2KED A;  3TN2 A;  3DHQ A;  1A3V A;  3P1H A;  3SK5 A;  1SNC A;  5M9O A;  1V1O A;  1F9S A;  1EY8 A;  4DNT B;  3K5M A;  1LAC A;  2SEB D;  1BUV T;  1STY A;  2XN9 C;  2SNM A;  5J39 A;  4S3S A;  1SYD A;  5K36 G;  2X6G A;  4E6I A;  1ET6 A;  4XT1 B;  1STE A;  5C6A A;  3ND8 A;  1K8O A;  3W2D A;  2SOB A;  2WII B;  5KGU A;  1WTW A;  5C4J B;  1X3P A;  1SBB B;  1ONL A;  3OMG A;  3MFG A;  1NR2 A;  5CV7 A;  3UI2 A;  5C44 B;  1U9R A;  2RDH A;  1M8A A;  3GTM B;  4DXF A;  4CJ1 B;  3VYT A;  1I6V C;  2F3V A;  4XIG S;  5M5X B;  4RHR A;  3MHB A;  2B2W C;  1TKW B;  1F2M A;  2JA5 B;  2PZT A;  3T56 B;  2WB1 B;  1QE6 A;  2NBF A;  2NYZ D;  1YNN C;  1VMC A;  5IGD A;  2MGS A;  3LWU A;  1ZYR D;  2JA8 B;  1E0B A;  3J81 E;  1HHV A;  3FKI B;  3T16 A;  4N9T A;  1JWM D;  1I4X A;  1MGS A;  3C1E A;  3NP8 A;  2TMP A;  3V05 A;  5CV9 A;  2GA4 B;  2IPK D;  4CBV A;  1F2L A;  1BO0 A;  1G2S A;  3DEO A;  1LO5 D;  4LK1 C;  5M3F B;  5FO7 B;  2ZXO A;  4P2C B;  3TP7 A;  3NSW A;  4DK0 A;  5C0X G;  1QCB D;  1ZEQ X;  5JJZ A;  4KY6 A;  1UUP A;  4IFD I;  2VUM B;  1WD1 A;  1TWC B;  4A3K B;  4IUV A;  2ZT9 C;  2HUG A;  1EY5 A;  4A3D B;  1HFG A;  2DY7 A;  1Q1E A;  2FMC A;  4K8J A;  1O7Z A;  3G7L A;  3T4A C;  4C1N K;  1T5X D;  5IGE A;  2XSC A;  3EFX D;  3L7Z C;  1D5X C;  3NTK A;  4J6H A;  4RCN A;  1R9T B;  3NWS A;  5CV8 A;  2F1M A;  1PRT C;  4FYD A;  2L1B A;  5I9P A;  1S5D D;  1TY0 A;  1VF5 C;  2B2T A;  1OXS C;  2O5I C;  2A69 D;  2EY5 A;  1KTK A;  3DEP A;  1OO9 B;  3TP8 A;  2XRQ D;  2X69 A;  1JIC A;  1AW7 A;  3NUC A;  4ZUJ A;  3DMU A;  2IW3 A;  2OEO A;  2K6A A;  1DXM A;  1I4Q A;  3R93 A;  3MXP A;  1S5F D;  5IGB A;  3IAY A;  1PRT F;  1SEB D;  5M5W B;  1SNO A;  2E76 C;  1QWY A;  5COR A;  4B9X A;  1XWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...