2EVBA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lipid binding protein,transferase
molecule keywords methylmalonyl-CoA decarboxylase gamma chain
total genus 13
structure length 74
sequence length 74
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2evbA00
2NN6I 4DNTB 4JBWA 3W3AA 2R6GA 1IYVA 1GUOA 1YNJC 2JXMB 3AB9A 4I7ZC 2E74C 4KKUA 2BDOA 4LJZC 2NN6H 1OXTA 1DD2A 2DN8A 1H9MA 1OXXK 3GD7A 3QIAA 1H9SA 1H9KA 2A68D 1I6VC 2Q8IB 3N6RA 3D4RA 3D31A 2DNEA 3LNNA 2CW0C 1VF5C 2LMCB 3VA7A 1H9RA 1LACA 2B8FA 1FR3A 2EVBA 3A8KE 3U9SA 3IFTA 3A7LA 5BN3A 4IFDG 4G7HC 2PNRC 1V8QA 3FPPA 2PPBC 2NN6G 1GUNA 2ZT9C 3SDZA 4H0LC 1O7LA 4KMUC 2O5IC 5KNBA 2KA7A 3BG3A 1QJOA 5JEAG 3LWUA 5K36G 4GZYC 1Y69U 1GJXA 3H94A 5KNDA 3PV0A 1HQMC 4XTCS 1CFMA 1GUSA 2A6EC 1Y8OB 2K7VA 2K33A 3CRLC 2A6HD 3MXUA 3A8JE 4KI0A 3GQBA 3PUZA 4G7OC 1LABA 2BA0A 1TU2B 2K32A 5JEAH 2EJFC 4BA2I 1IYUA 2D5DA 3QG1A 4H13C 3T51B 1YNNC 2JEAI 2D2CC 3OPOA 2EDGA 3M85A 1DXMA 3SE0A 3A7AB 2A6ED 1Q90A 1H9SB 1Y8PB 3VR3A 1T5EA 2PCFB 3VR4A 4KN4C 1OXSC 2B8GA 2KCCA 3HGBA 4H44C 3A8IE 3I4LA 1VF7A 1EWHA 3PUVA 5KNCA 4TQUS 1Q1BA 1ZYRC 2O5JC 1HCZA 1PMRA 1SMYC 5K36H 4HR7B 2YYZA 1FYCA 3QJYA 4KKSA 1VDZA 3NE5B 4XIGS 2D62A 3VR5A 5A35A 4IFDH 3DXJC 3VR6A 3TZUA 4DK1A 3WDNA 1Q1EA 1IW7C 3I72A 1OXUA 1E2ZA 2EJGC 1A6XA 2V4DA 2AUJD 4BA1I 1H9JA 1E2VA 2E75C 1HTPA 1Z7TA 3L7ZC 1O78A 1Q12A 3MFYA 4KHZA 1DCZA 4LK1C 3EQLC 5C0XH 2A68C 1GUTA 2BE5D 3OW7A 2E76C 3VR2A 2JEBI 1GHKA 3PUYA 3T53B 1CTMA 1V43A 2F1MA 1B9NA 2AUKA 3P20A 3I73A 2QF7A 1CI3M 2L5TA 4L8JA 1ONLA 3FMCA 1GUGA 1IW7D 1Y8NB 1HPCA 4OO1G 3OOCA 3PUXA 1GHJA 2JE6I 1B9MA 3BDOA 3ND9A 2DNCA 1K8MA 4OGQC 1K8OA 4DNRB 1E2WA 4KKTA 4JK1C 2EJMA 2A69D 3M4YA 3KLRA 1TKWB 2IT1A 3RLFA 5BN4A 4DK0A 3IKJA 1VCIA 4RCNA 2AWOA 1OXVA 4OO1H 3PUWA 5C0XG 2A69C 1Z6HA 4G7ZC 3ND8A 4PV1C 2BA1A 1ZKOA 4TKOB 4IQZA 5BN5A 3M7NA 2A6HC 3CRKC 1G291 3T56B 4KN7C 2BE5C 1BDOA
chains in the Genus database with same CATH superfamily
2B2TC 3FEWX 4GNXA 1GUOA 1HH2P 4HIKA 5IYDH 2E74C 4KKUA 2CQOA 1AZQA 2YU9B 1CUKA 2D0OA 2Q8IB 3D31A 1NCVA 4NXMQ 4WJ3M 1BBUA 2B8FA 4JI6Q 3HOYB 1XMQQ 1TS2A 2Z6BA 3K0XA 3UE0A 2C5CA 4ZK9B 4HEDA 5HURA 4U673 4C2MH 2HCCA 1PDQA 2X6GA 3CU7A 1MJEA 5LMUL 3DMUA 1PRTF 2DY8A 1J6QA 2E2DC 1VQDA 2UXCQ 1HR0W 3S2HH 1UE7A 4HTHA 4QUCA 1KTKA 2A1AA 2Z0SA 1I50H 5JVG3 3CPWA 4LUVA 4P2CB 2KCMA 4HIDA 2LS01 3HGBA 2QDLA 1U5KA 3F2BA 5J1ZA 4KY6A 5LMNW 3A0JA 2F03A 1FNUA 4X3KA 4JI7Q 4UDUC 4KY5A 5A35A 4DAYA 1CKOA 1XNRQ 2KEEA 4B3MQ 4KY7A 1H9JA 4DV6L 3S1MB 4KLKA 5IYBH 3NQTA 1S5BD 1D6EC 1GD7A 3TS0A 1WTXA 4PQXA 2HIXA 3MA2B 2A5HA 2NZHA 4OEMB 4CDDC 2BH2A 2PW5A 1IW7D 4QQBX 3TREA 4RCOA 2B2YC 5D3DA 1YNND 3QB3A 1SNMA 3ND9A 4DNRB 4DPGA 4KKTA 1JWUD 4XXEA 3HOUB 5C4XB 4A3BB 2JK8A 4GKKQ 1TWGH 1EOVA 2F0IA 2F0FA 2IX3A 2AQ3B 2HT1A 1KHIA 2NB0A 1YZ6A 1T9HA 1Q46A 3CRKC 4IUPA 4V190 1RIPA 5IP7G 4F88A 3CCUA 1H9MA 2RHQB 3D4DA 3RUZA 2GVBA 2R3ZA 4X64Q 1SROA 1I6VC 4N8X1 2AKWB 5GQOA 5M3MG 3MZ5A 5GAGC 2NZ1D 1VF5C 1WJJA 4UHVA 3A8KE 4C3JH 4R9WA 1WCMG 1ZEQX 3GTGH 1W6KA 1RF2D 3I4MB 1HFGA 3Q0AA 3SDZA 3GTKH 3KLSX 3Q6SA 4HJ7A 1I3QH 2K6AA 3UI2A 5JAVA 1TVXA 5GADC 1D5XC 1FJGL 4HJ5A 2TSSA 4DV7L 1EZ8A 1F2MA 3PQIA 3ULJA 3AU7A 5JPNC 3CW2C 4MHEA 3SK5A 2KHSA 4JCVE 2TMPA 3J80i 1LYLA 3NTIA 1EEID 3PF4A 1N36Q 2R92B 5C0XJ 4DR5L 4CGYB 4Q0FA 4LF7Q 2D62A 4JG2A 2WB1G 5C0XI 4K14A 1SNPA 1OXUA 1E22A 3PO2G 3HOXH 1NJIC 3K80C 4LFAQ 2L0CA 3G48A 4YWLA 4DR6Q 2OTJA 4IUVA 2J4XA 4KHZA 1T5XD 4JOIC 4QIWB 2CHBD 3RZDH 3I91A 3CMAA 1EY9A 2E76C 3QWNA 5IGGA 4DA2A 3I4NB 3OIPA 4LMQD 4DR4L 1BQQT 4ZLTF 1LTLA 2L5TA 1GUGA 3CCSA 4JI4L 4IZ8A 1LTSD 4LNQA 4FF3A 3OMGA 4ALPA 1E2WA 1QZGA 4C3IG 2EE1A 5LL6X 5BN4A 4EGVA 4S3SA 1N36L 1OXVA 1XNRL 1HZBA 1NTGA 3M4OH 5C0XG 1IXRA 3NEMA 3L9AX 1A0IA 2N3SA 5IGFA 4X3TA 3UDGA 3OSOA 3HOXG 4QF4A 1B1ZA 1WCMH 4LF6Q 1Y1VH 4HCEA 1TWCH 3KDFA 2RF4A 4Z9CB 4JYAL 3A55A 1G91A 2VQEQ 1QZHA 4X3UA 5I2YA 2DNEA 5J3BA 1TWAH 4E6IA 1FR3A 1NE3A 4ODGA 3A7LA 4DV0L 1BOSA 3KF8A 5KGUA 3J81j 2R92G 1CA5A 1ET6A 3TP7A 1WTPA 1XPUA 1MKHA 2QCPX 3MXNB 5M3MH 1XPRA 2RDHA 4GZYC 5CV5A 1HR0Q 1NR2A 3K7AH 5IOCA 5IWAQ 1LTRD 4PZ7A 3BYTB 5HGTA 2RQXA 2JA8B 1PV4A 2JA5B 2K32A 2K01A 4GN3B 4RKLA 2SNMA 1PH7A 4JOIA 3E9HA 1ESRA 3H6MA 3M85A 1CKMA 3FKIG 4A3EB 2PQAA 5C5LA 3ZYYX 2RDFA 1PFBA 2RSOA 1YNXA 1VF7A 4LF6L 2UUAL 3S1RH 4B3RQ 1QE6A 2VXWA 5K36H 4DV1L 2H4OA 2I5LX 3VR5A 2AHOB 1PYBA 2JA5G 4K0KL 1F9QA 4GN4B 1A6XA 2I0QA 5IODA 2EIFA 1LTID 1XNQQ 3S1NB 1KLUD 4HJAA 3T1YQ 3J7YW 3SK6A 2PZUA 3CCRA 4LF9L 3H15A 1JB3A 1UNSA 3T53B 1CSPA 3KBGA 2CVRA 3W2DA 1EYAA 4JPBW 2VY3A 1PTOF 1F9RA 3M3YB 4P72A 4DN4M 5CV9A 3OOCA 1B9MA 2VUMH 4YWMA 2E2JB 3HOVH 1A15A 4XYQA 1U0LA 3RZOB 4MNOA 3RLFA 1LUZA 4DUYL 1SNOA 1U4MA 2E2IB 2CWPA 3K5LA 1J8IA 2A69C 4A3KB 3I3CA 1IBML 1SYDA 1NUCA 3K6OA 3H3VC 4R4QA 3EFXD 4IQZA 4DV6Q 1PRTB 2UUAQ 4OWTB 1G291 3PO3H 4MTNA 1MHWC 2N55A 1GOZA 4A3FG 1IYVA 3VYRA 3SVMA 4N9PA 3GTLB 2F4VQ 2BDOA 3HOXB 1E1OA 2R7ZG 3GD7A 5CV8A 3AEVA 5J39A 5KIXA 1NAPA 2B39A 1X9NA 3RNUA 2CWAA 4JI2L 1A62A 4DR4Q 1BBWA 2B2WA 1EIHA 2B29A 5CV7A 4BXXG 4FF2A 1AH9A 1EFID 2MHVA 5C3EG 1EQQA 3I4NH 2HQLA 2LY7A 4OX9Q 4BXXH 3HOWB 2K05A 4DK6C 3W1BA 3EVQA 1JMCA 1AE2A 1R9TH 3U4ZA 1VQ4A 1W6JA 2HDMA 1HQMC 4JI8Q 4O42A 3MEHA 1VQNA 1DOLA 4HSPA 3TQYA 1TXYA 2HIVA 4IUNA 3WOEA 4K5VA 2A8VA 4A3MH 3BU2A 4R1JA 3DWQA 3T51B 3AFPA 3ICEA 1Q81C 1ESFA 1SFOH 3ULPA 5M5WH 5T1GA 1XTCD 2B8GA 3BYYB 3NBHB 2F0SA 5IT9E 2J0TD 1HNXL 2OWOA 2WV6D 3TEHB 2B2WC 3G4SA 1VQJA 4JYAQ 1VQEA 1SXTA 1IL8A 2AQ1B 1EY7A 4A3IB 3I72A 5EBDA 1QNKA 4UY8C 1B53A 2E75C 4M8AA 4NMZA 5C3WA 1X3GA 1EY5A 3RR5A 1K9MC 1N32L 1I4QA 2HHHQ 3V05A 1VQ6A 4CJ2C 2HQEA 1FNWA 2J7ZA 4K5WA 4JI8L 4DAYB 3CC2A 1DZ1A 3P20A 2GN5A 5LMUQ 4CJ0B 1OO9B 1M1KC 2ID0A 1DOKA 3HOUG 5FJ8H 3STBC 2L11A 1VQCA 3NELA 1SYBA 1LT6D 2K75A 3IL8A 3OW2A 2OXPA 1TS4A 4B3ML 3HKZE 3W1GA 4A3EH 2AWOA 4BWGB 4IPGA 4IO9A 4BBSB 3S14B 2ZTCA 4PG3A 2ALYB 4ME5A 2AMCB 1KXLA 1DD2A 4JI0Q 1EU3A 1K3BC 4ME3A 4C3JG 3DLLA 3ULLA 3AB9A 3PIP3 4ZYSA 3NHHA 1ENCA 1PYSB 4CKBA 3HFZB 5IIFA 1PH4A 1TQOA 1DYQA 2UXBQ 3FPPA 3Q23A 1P16A 2R7FA 1STEA 2E8GA 2O5IC 1FNVA 4HIOA 5JEAG 5I4DA 5JJLA 1RL2A 2G9DA 4MTKA 1GXDC 1Y1WG 2EYMA 2XVSA 2OQ0A 2IX1A 3A8JE 2DY7A 1PFSA 1EIFA 1PH5A 1EIGA 2BA0A 5M3FB 4KHVA 2JA6H 5GROA 5DM73 1GUWA 2NTTA 1TWAB 3KF6A 3VYSA 1I50B 1T5EA 2PCFB 3NWTA 4APVA 3N52A 3PO2B 4XDXA 3MFGA 2M9VA 1HNXQ 1SMYC 1U4LA 1XTDA 2CCZA 4J8QA 1VDZA 3EA6A 4ABNA 3K5MA 4M1UB 2K4KA 4YHHL 2EYPA 2MP1A 2WAQB 2XWBB 2N88A 5GAHC 2WP8J 4BBRG 3MFYA 1YNJD 2UXDQ 5C0XH 3OW7A 3PUYA 4RG1A 4A3GG 3GO5A 1EYGA 1LTTD 2I46A 3E5SA 1GHJA 4GKJL 1VQ5A 2DNCA 4PZ6A 1YI2A 1RD9D 3V96A 4JK1C 1JJCB 4A3MB 1BKBA 3HOYH 1IHZA 3J81L 2ZM6L 3M7GA 3K58A 1HRJA 3HKZG 5ELOA 1KAAA 3HOUH 3HOYG 1X65A 1C7YA 4A3KG 2E5LL 3FDTA 2O2LD 1ZKOA 4TKOB 3J7AV 3FHWA 4H02A 4QL5A 2L15A 4FVMA 2PW7A 2BCOA 3E6ZX 4L5QA 3MAQA 2IL8A 3I56A 1J5EL 1YNJC 2F0WA 1JWMD 2JXMB 4FP5D 5DNFA 2QILA 1I94L 4IUTA 1OXTA 1SE4A 3KJPA 1H9SA 4QCLA 3K81C 4K5XA 2EYFA 3TN2A 4C3JB 4LF5Q 4CDFC 3PCOB 1JR0D 1WTHA 5JJKA 2ZXRA 3MWYW 4WJWA 2FMMA 4AYBB 4DNIA 1BVSA 2UXCL 1S4ZA 1Z47A 4G7HC 1I3QB 3A5ZB 2WKCA 2B2VA 2X69A 2JA8G 1JICA 4A3IG 1QB5D 1B50A 1RTOA 3BG3A 1QJOA 2VNUD 1TS5A 1PZKD 4NPSA 2F0GA 3I4MH 2NVQB 2I5MX 4GOPC 2ZTDA 1U4RA 2K7VA 2K33A 1SE2A 5FO9B 4A76A 4X66L 2OEOA 4J6HA 4JI6L 4QY7A 1HFNA 5C5MA 2KCNA 3HEJA 3R3OA 1PHJA 1HNZL 1V9PA 3PGZA 2JEAI 3KLSA 2HD3A 4LFAL 2NBFA 3K8AA 1N8RC 1CK1A 1Y1WB 3M9BA 1RDPD 2K28A 2C9OA 4A93G 2VB3X 4H44C 4IPDA 2Y0SB 4OWXB 3S14H 1TWHB 4BBRH 4BY7H 3VYUA 4YCUA 4BY1B 2KHIA 4IFDH 1UUPA 1QVCA 4R8NA 3TZUA 1HTLD 4OXPA 3WDNA 4K0KQ 4IUUA 3AYHB 3OTOQ 2PQAB 2EJGC 2PMZB 5E7NA 3C46A 4BA1I 4KD3A 4LUZA 2Q8RE 3K57A 3MHBA 2EXDA 2FINB 5TSSA 1WI5A 4BY1G 4DV7Q 4RHSA 1STNA 1HZCA 1E3PA 2D0PA 2QF7A 1CSQA 4AQYQ 1EFWA 4IURA 3T13A 3CAMA 1PYWD 2FMCA 2B63G 4DUZL 1B2TA 1GVPA 1TIID 4HIMA 2H5XA 1E24A 1WOCA 1VQKA 1AN8A 2IY5B 1SDFA 1O7ZA 1LT3D 3CCEA 4OO1H 3DWAA 1VQPA 2ICEC 1W2BA 2SNSA 1EY8A 2BA1A 2PZWA 4DXGA 3M4OB 4DR2Q 5LMNQ 2A74C 4N8FA 2JJQA 2F0DA 4KN7C 4DNTB 2Q2HA 4P71A 2F3VA 2EYHA 1PVOA 1VQBA 5IWAL 3QIAA 4DV1Q 2E2JH 5AFWA 1STBA 4JI4Q 1FL0A 1L2FA 3QO2A 3VA7A 1HA5A 3C1FA 1JORA 4RFBA 2BH8A 3A56A 3BVGA 1NSNS 4IFDJ 5C6AA 3A5UA 1VMPA 3S16H 4XQNA 5M5XB 4DAVA 4XTCS 5A2QL 2WB1B 1B4OA 1Y8OB 2SOBA 4K8IA 3J80L 1WD0A 3EJIA 4DR7L 3QOJA 3K7AB 2KVMA 3RZDB 4H13C 1SEBD 3NUCA 4XT3B 2EDGA 2GA4B 4B9WA 1XNQL 1HJPA 4HMJA 1UE5A 1YHQA 3A7AB 1H9SB 4F8MA 4N9TA 4A3LG 3T1HL 3I4LA 4B3SQ 4HSVA 1YIJA 4FXDA 4C3HH 3IAYA 3F2UA 1H95A 2MUYA 1JC7A 4YIJA 2B63B 1LTBD 2K14A 1F77A 2QGQA 4K2KA 3S1RB 2ZJRA 1MBYA 2OT2A 1CHPD 5H1SE 2JA6B 1FVIA 3OYYA 3CMEA 4L5TA 1WYDA 3L7ZC 1K3RA 1EU4A 1KRTA 5JJZA 2RCFA 2JA9A 1NR4A 3UDFA 3S1NH 1OTCA 2HDLA 3I8ZA 3LX0A 4LW1A 2AUKA 4L8JA 2VW9A 4LFBL 2PI2A 3S24A 4X65L 2ZXOA 4EQNA 4C1NK 3CHBD 3BDOA 2KUMA 5DM63 1V1QA 1I4XA 2FFKB 3D8GA 4QMGA 5EPKA 1VQGA 1WTOA 1EWCA 2N49A 3ND8A 4KD4A 1CKNA 4QGUA 3G7LA 5EJWA 1VQ8A 3GTKB 4DV4L 5COYA 2KOLA 2UU9L 4CHTB 4OWWB 1KL9A 4BS9A 5ELCA 4B08A 4RAUC 1PTOH 1L0XB 1SYEA 3G6EA 3HOWG 2VQFQ 3GV6A 3GTMH 1TS3A 3X3NA 1C9OA 3D4WA 4C56C 1H9KA 5LMNL 1BNZA 1EUJA 2SEBD 5C4HA 2Q2TA 4PZ8A 3RN2A 2FJ2A 3DEPA 2PO4A 5BN3A 3H0GG 5E1FA 1TR5A 4HN7A 3SK8A 2A73B 1STYA 3UDIA 4OONA 3BS1A 1EL0A 1A2TA 2LXJA 3L3OC 4I7AA 5K36G 4DKAC 2LKVA 3IRBA 3MXUA 1CM9A 3TZDA 4GLAC 4WJ4A 4RH6A 4K2LA 2DGYA 1RJTA 1PXUA 1AW7A 1Y14B 2PQEA 3S2DB 4IN3A 1F9PA 4GLVB 5C44B 1J5EQ 2G9HD 1CQVA 1I4HA 2XTIA 1X3EA 3G71A 3T1YL 4DR1Q 1K8AC 2XIWA 1AP0A 1FYCA 3P7JA 4P73A 1BCPC 1SE8A 1V1PB 4RGNA 4DK1A 4QUFA 1PRTC 1YHBA 1BF4A 2V4DA 1AFPA 3NQIA 2NUCA 1BCPB 1BCPD 4X65Q 5D14A 1PLFA 1EQRA 4ID6A 1CKNB 4GNXC 3Q24A 1K83H 1CTMA 2R61A 4EQPA 1WTRA 3GTJH 2AQ2B 3E3XA 1JQYD 1SYFA 5M5XH 3PUXA 4DAMA 2JE6I 1UEBA 5CMDA 3JAMi 1KDAA 2EOTA 1K8OA 4HAEA 4JI3L 3M4YA 1NMGA 4LFBQ 1VQIA 3KYHC 3OMCA 2XWJB 1MSHA 1TWFH 3NWSA 2VQFL 3TDQA 1S5DD 3BDLA 1MI2A 1KNEA 3MXGA 4QB4A 5M3MB 1WTWA 3KBXA 3JAME 4B3TL 1R4QB 1X54A 1KQSA 2H1EA 5FKAC 2KBNA 2ZXPA 1N33L 1RCVD 3TBIB 1YHAA 2MNAA 3NENA 2A19A 5IGCA 3NK9A 4GN5A 1QWYA 3DM3A 4A3JH 3I2ZA 3BZCA 4ZKCB 2IWHA 4NW2A 1ET9A 2UXDL 3HZXA 4HCSA 4KMUC 1BBXC 2KA7A 4NKLA 1G6ZA 3DHQA 2Q2UA 4OL7A 5T1IA 3I55A 3H94A 2XRSD 4C1NI 4NB3A 4UP9A 1PZJD 3CRLC 1HZAA 1HQRD 4XQJA 5JPMC 4G7OC 1AEXA 4CBVA 5CBEE 1YJNA 3QG1A 2RVLA 2D2CC 1V1PA 3F1ZA 1QUQB 4LWCA 1IBMQ 1CA6A 1PH9A 3FKIB 3VR4A 1D7QA 3J80c 4KN4C 2RBMA 5HGQA 4HMIA 5KNCA 3HOVG 1Q8IA 2F0KA 3W5OA 3CCMA 4DGZA 4ILWA 4DR1L 3PF5A 3F8TA 1SN8A 3JAMc 2EY1A 2NZOA 3D6WA 1X56A 3GTMB 4B3TQ 4GKJQ 2ATWA 3VYTA 3RZOH 4OELB 1KIXA 1O78A 1V1OA 1A63A 2JN4A 2E2IH 4POFA 1AZPA 1HHVA 1GUTA 2OCEA 1A8VA 1FGBD 4FXGC 3PIOA 4KJNA 2F1MA 1ICWA 1CI3M 3E9IA 3HS0C 3FPUB 2K5DA 4JI1Q 1PFMA 4C3IB 3SK4A 1K8MA 1CT1D 2I07B 3GTQH 2A69D 2N78A 4DV3L 3C3LA 2K03A 5LHY1 3MTSA 1VCIA 3KF8B 1JOOA 1K28A 2B2UC 1D1KA 4YHHQ 1FGUA 1X32A 3J7A5 3PSIA 3CQZH 2A6HC 3MEFA 2SDFA 3OTOL 1LO5D 3HKZB 1PH6A 3PO3G 4I7ZC 4DV2Q 2Z8LA 3K5OA 4X62L 3S1QB 2MJ8A 3KLWA 1SMXA 4DUYQ 5IYBG 1CQFA 4GS3A 4UP8A 1NY4A 3IFTA 5M5YB 2Z6KA 1Q8KA 2PPBC 3ZJYC 3CXCA 3CCVA 3H0GH 2F0EA 2ZT9C 4GNXB 3J81i 5CC4A 4A3CG 1Q3LA 1HUMA 3H09A 4DAPA 2OF1A 1F9SA 3M3YH 3U58A 4JV5L 3MC0B 4KI0A 3EN2A 1N34Q 3E0EA 5I9OA 4J15A 4JI0L 2EJFC 1AE3A 2K1BA 2D5DA 2Q8TA 1HXYD 1B3QA 3BZDB 1S5FD 4A3FB 1N33Q 2K5HA 4MN3A 2F4VL 1SNDA 3VR3A 2Q2IA 3BVMA 1II3A 1EWHA 5GAEC 5IGDA 1IKLA 1HCZA 4NDXA 1VS0A 1VQAA 2IJ0A 2YTVA 2K04A 3DXJC 2F3WA 3S16B 5IP9G 3WOFA 3GDEA 2QKIC 3PMFA 1IBKL 1E2VA 4A3DB 3CPFA 4JBMA 1LM0A 1RTNA 4FDBA 2R93H 4OIKA 2ZTEA 2QEJC 4AIMA 3LGJA 2R93G 2A68C 1G6PA 1A3VA 1O80A 2OQKA 2JEBI 1BUVT 1QNUA 5BR8Q 1K0SA 5IYDG 1PA6A 5AJ3L 2DJFC 3PIPA 1PTOD 4DXFA 4KJOA 3UDXA 5ELBA 1DJRD 2PNHA 3CD6A 1HUNA 2EJMA 4PMBA 3G6JB 2K5VA 3K0YA 1IL2A 2JP1A 1EY4A 3IKJA 3X3MA 4R4TA 2JA7H 4B3SL 3J7AF 3L0OA 2L4NA 4ULLA 5IYCG 2Y0SE 5EKKA 2ENBA 2IHEA 3K5NA 3I90A 4TVAB 2R6GA 2KEDA 2F0NA 5IE8A 1PFNA 2N8NA 5G3LD 3HOZB 5M3FH 2FHTA 2A68D 1EY6A 1BCPF 1JT8A 2M00A 2EYLA 3D4RA 1KLGD 1MSGA 3NPPA 2F0HA 5NUCA 2CH4A 2IHFA 1LT4D 2F0MA 5KNBA 1SE3A 2YTXA 2UUCL 1CFMA 2A6EC 2F3IA 3ONAB 5I9PA 4L5SA 3GQBA 1B44D 4TSSA 1KC8C 1PH2A 1B7YB 2QW7A 4UP7A 5C4XH 2NTSA 4RGTA 2JA6G 2IW3A 5CV6A 1EQVA 3OIQA 4RHRA 4WRDA 3GTPH 2UXBL 1C0AA 4C3HB 5C3EB 3PUVA 4JI2Q 2UU9Q 1Q1BA 5J22A 2RKSA 5JJIA 2CH4W 1BR9A 4X62Q 1ZXTA 5I6YA 5EPLA 3D0FA 2WACA 3I4OA 1QILA 1E2ZA 4GKKL 1QUQA 2KQ3A 1Z7TA 5KEEA 3KJOA 4A4IA 1JOQA 1FD7D 1DCZA 3EQLC 4A75A 3GTGB 3GTOH 3M4PA 1F2LA 1B9NA 2NVXH 5C44H 5FLMG 2K52A 3R93A 4O2DA 4OO1G 2VQEL 1I6HH 4JVZA 5FK9C 1EWIA 2XNAC 4LF4Q 1WFQA 3EBEA 4WORA 3H3VH 4DU9A 2PI2E 2R7ZB 2OTLA 4B3RL 4X64L 5ISRA 4RCNA 1C48A 1YEZA 5E4WC 5FLXL 3CKIB 2F0JA 5CORA 4PV1C 4ZCKA 1WVLA 1YITA 1PTOB 1YBYA 5BN5A 2NVQH 2Z1CA 3T56B 3FRPB 3OWFA 4FF1A 1HNWQ 4C3IH 4YY3Q 4EQOA 1D1IA 2JSOA 4OIJA 3O13A 4LJZC 4LFCQ 1X6OA 2NVYH 1D8LA 5EQ0A 2HCIA 3J81E 4IFDG 3ER0A 3CF5A 1IBLQ 1F2ZA 3NBIA 2EYJA 5KYLA 4BY7B 3NBHA 2PYKA 1X55A 4IALA 3PV0A 3TS2A 1TY2A 1XMQL 1LABA 5C4JB 1D2BA 3CC7A 5KRUA 3F2CA 2LSSA 4DR6L 4A3JG 1DXMA 3JAML 1I94Q 1Y8PB 2F0UA 4PNYA 1PH8A 2VL6A 3I7FA 1HNWL 4TQUS 1B8AA 3CC4A 3SEBA 1IBKQ 2E2HH 1QVFA 1WCMB 3QJYA 2K50A 2YYZA 4XIGS 4C2MB 5CGKA 1Y1VG 3VR6A 3IFDA 4A3DG 2CQAA 5IGBA 2O4XA 3R2IA 2CKZB 3C1EA 1LTGD 4A3GB 5AJ3Q 5G3LF 4A3CH 1UE1A 4CKEA 4DR7Q 2IX0A 3I4NG 1VQFA 1I4GA 1BXTA 1MJCA 1Q7YC 3C2PA 1KD1C 1RHPA 2L12A 2MQHA 2F0VA 1MD2D 4A3MG 1B3AA 4IUQA 1VQMA 5A2QE 1VMCA 2WB1E 3TMEA 4IJLA 5CV4A 3S15B 2QA4A 4AYBE 4F7XA 3K59A 4J1MA 1S40A 2JA5H 1M90C 1U9RA 1U4PA 1TY0A 2RSNA 4KHPL 1HA6A 4IOAA 4IPHA 1DGSA 1WD1A 1Y1WH 2Z6KC 3KUPA 3AQQA 1F2YA 3VDYA 3PUWA 1TT2A 3TSSA 4A93H 2VUMG 1TWHH 1XPOA 4PMWA 5FLXE 4BY1H 2DUDA 2F4IA 3J81c 3W3AA 2B2YA 4DR3L 4LF8L 3HOZG 3DM1A 2QEXA 2LFNA 3QR8A 4LF7L 4V0BA 2F0LA 2EZVA 3P75A 5E3FA 1D5MC 3AFQA 1DM0B 3LNNA 2VB2X 3BJUA 3VA5A 4A3JB 1CZGA 1LACA 3U9SA 2EVBA 4I65A 2B2UA 2PNRC 3KF6B 5FO8B 2MPMA 5IP7H 1PRTD 2WFWA 1GUNA 1O7LA 3MVVA 3RMHA 4WFN3 1KDCA 2DJGC 3SHLA 1GJXA 2P5ZX 4CKCA 1I6HB 4LF4L 5DAUA 1Y1VB 1ZYRD 1XXGA 2B63H 2B3GA 1ILQA 4BY7G 1LV9A 5ELEA 3CQZB 4CDCC 1R4PB 2WAQE 4DK3C 2Y0SG 3HOZH 1N32Q 1TU2B 1S5ED 2EPBA 5JEAH 1QCBD 1STGA 5FLMH 1KDBA 5EGTA 4ZKBB 1ASZA 3FKIH 4A3EG 1M4VA 1L0YB 1K8GA 2CFMA 5D65A 1SYGA 5IGEA 3F2DA 4H7BA 5FO7B 4OO1I 2KCCA 2IPKD 3I4MG 4L6TB 4A3KH 1O7IA 3ERSX 5ELFA 4EX5A 4FYDA 2NYZD 2NVTH 2O5JC 4JI5Q 5M3FG 1EYCA 3NP8A 2EXZA 4RMFA 2WINB 4KKSA 4GOPA 4DV2L 3M4QA 4RWSC 1PTOC 3EIVA 1IZ6A 4G57A 3L2PA 2NVYB 4DV3Q 4B9XA 5IYCH 1XX8A 5C3EH 1LTAD 4CDEC 1G8ZD 4A3BG 3HOWH 1V43A 1EOTA 3KDFB 3RLOA 1L1OB 4ZUJA 3FMCA 1NMFA 2L1BA 2M2LA 5FOBB 4JBJA 4POGA 3HKSA 2JA7G 1EYDA 2KCTA 1LLRD 3DEOA 1Q82C 5E4XA 1SNCA 2R7DA 3P1HA 4UAIA 3H3VI 2RA4A 1CZWA 5ELNA 4KV6A 4EVOA 2LXKA 2F0PA 5C3XA 1SFOB 2R93B 4G7ZC 4A3LH 4YY3L 3CCQA 2F0OA 2KHJA 5M9OA 3S17B 1VQLA 1TWGB 3S9WA 1S72A 4LF5L 4BBSG 2KJXA 1IYJB 4JI3Q 4NXNQ 4JBWA 2E5LQ 4JW0A 3NXWA 4YWKA 1I5FA 4F87A 4JC0A 5EKIA 1PH3A 2ZM6Q 3V2TA 3BVZA 1QG7A 5HY6A 3I70A 4A3GH 1K0RA 2RCNA 4Y7NB 1SR3A 3S2DH 1SSOA 1H9RA 1D5ZC 1LT5D 3OHXC 1V8QA 1KABA 2Z4HA 2EY2A 3U9OA 1K73C 4LF9Q 5M5YH 1ILPA 3J7ZC 1SNQA 1VQHA 1Y69U 3PO3B 4RGMA 1G2SA 5BR8L 1GUSA 4DF7A 2A6HD 2WIIB 3PUZA 2WAQG 4IPCA 3A54A 1M8AA 2MGSA 4UPAA 1X3FA 3RD4A 5F2DA 4JBKA 2RHSB 2BOSA 1G51A 3OPOA 1XWEA 1NBWA 3U4VA 1OXSC 4RA8A 5CYUA 2F0QA 4NXNL 5C44G 1K83B 1S5CD 2ES2A 3GP7A 3GV3A 1B70B 3GTJB 4QJFA 3D6CA 4IJHA 2L9HA 4ZAIA 3Q22A 1E0BA 2JQOA 1SJHD 2KENA 2MFIA 4A3BH 1IW7C 1UE6A 1KNAA 5DEHA 5C4JH 3MXNA 2AUJD 4L63B 4XT1B 4JI5L 1HTPA 4DR2L 1VQ7A 4AQYL 2HUGA 4O1NA 1S3OA 4TRDA 4LK1C 3TP8A 1L1OC 1SYCA 4P75A 2EY5A 2BE5D 4DUZQ 4R4IA 3LWEA 5DLQE 4G4KA 1STAA 3R2TA 1G2TA 2E2HB 1ML0D 1O7YA 4XQQA 3HRZC 3TP6A 4OX9L 1J9OA 4DV0Q 1ASYA 1FJGQ 2YU9H 1PZID 4OHJA 1I4RA 2JA7B 4GOPB 2IT1A 3ERQA 4Y52H 1QOHA 1HZ9A 2I5HA 3RLNA 5C4XG 1Z6HA 4FXKC 1X3PA 2UUBL 3WWVA 3RN5A 1UWVA 3MXPA 3CP0A 2ZJPA 2YTYA 3PIO3 1C4QA 3TP5A 1SJED 4LUOA 5IY0A 1JB7A 1ENAA 1SAPA 2FXQA 2K5WA 3KOJA 2NN6H 1OXXK 3S2HB 1CHQD 1STHA 1TWCB 1GO3E 3HOVB 4GLXA 4DV5L 3N6RA 4KK7A 4R4CA 3ITPA 2R92H 3EROA 2ZJQA 3TRZA 1DONA 2HHHL 3J80E 1E7ZA 4NXML 3KK7A 3NTHA 4KHPQ 3LWUA 3FP9A 2WKDA 1JOKA 4A3DH 5IP9H 4L5RC 4RGOS 2EQSA 4P74A 4MIUA 4NP5A 5JOBA 3B6YA 3DWPA 1IYUA 4YCWA 1YNNC 1I4PA 2JA8H 1P8LA 3S1MH 4LFCL 1MGSA 1TWFB 1ICFB 5LL6S 3SE0A 2G5DA 3KFUA 1Q90A 5K5PA 5C4ZA 4ZUIA 2QDBA 1A3UA 3S17H 1JE4A 2BDNA 2B2VC 2PZTA 1JJGA 4X3SA 1PMRA 3NSWA 4HR7B 4K8JA 2XN9C 1A3TA 1R9TB 4XYOA 2Z4IA 1L0WA 5CBAE 2L55A 1IKMA 4C3HG 1W3SA 5I2XA 4Q5VA 1XJVA 5CR3A 4DR5Q 4DV4Q 1Q12A 4HJ9A 1N34L 3T1HQ 3OWEB 1Q86C 1A2UA 1IBLL 1EIYB 3VR2A 3T16A 1GHKA 4FF4A 3PO2H 1HR0L 3AMUA 1JCKB 2NVTB 3I73A 4MZ9A 3GTOB 1ONLA 1JJ2A 1Y8NB 1YJ9A 1XMOQ 1HPCA 1EZ6A 4AYBG 2GVAA 2R7ZH 4OGQC 1BO0A 5ELDA 3NTKA 3K7UC 3S1QH 2VUMB 1TKWB 1X3QA 2MO0A 4A3IH 4DK0A 2JYOA 1UAPA 3UE1A 2F52A 4FO2A 4EQ5A 1C8CA 2PMZE 1JE5A 4CJ1B 4BBRB 3H0GB 2VS1A 4DV5Q 2EYOA 3BDCA 2D9UA 1WTQA 3M7NA 3BZKA 2BE5C 3SR1A 2NN6I 5EKLA 3U50C 2DN8A 4YCVA 2MO1A 3T4AC 3GTPB 3HG9A 1HNZQ 2X6LA 1SLJA 3CCLA 2CW0C 2LMCB 4O0AA 4A3FH 3SXHA 1NNXA 5JEAJ 4KTAA 2NN6G 2Z9HA 1PH1A 4JV5Q 4FNFA 1GKHA 4H0LC 1YJWA 1Z9FA 2ICIA 5I6WA 4X6AH 4K6DA 1UEAB 4QIWE 2EY6A 1DOMA 5KNDA 2VZAA 2YV5A 4IOCA 4HJ8A 4IFDI 2F0TA 2B2TA 5D3IB 2ASBA 3GTQB 4BA2I 5IT9c 2K5QA 3CCJA 2XSCA 1EQTA 5EPJA 4Y7NH 1QVGA 2A6ED 3Q8DA 2NVXB 4R4OA 3A8IE 1EY0A 3URYA 1ZYRC 1JWSD 4ZQ3A 2AWNA 5M5WB 1SBBB 5EBCA 1N9WA 2XGTA 3NE5B 1ENFA 4PMCA 2UUBQ 4X66Q 1KRSA 1Q1EA 1WTVA 1RKNA 4RKBA 4JI1L 1XMOL 1VQ9A 3E0JA 3A74A 4K6LA 2C35B 1SMYD 5EAYA 1EEFD 4LAAA 1GM5A 2NWGA 1KAWA 2KECA 2UUCQ 1E1TA 4DFAA 2K5NA 1YVCA 3S15H 3GTLH 2V1CC 3QOLA 3D3RA 1MIUA 5FLXc 3FVQA 4ZRZA 3KLRA 3HP3A 3SGIA 4BBSH 2RDGA 1SRUA 5FJ8G 4U68A 4AH6A 2XRQD 3R8BA 5JVH3 3H91A 4DR3Q 1VQOA 4LF8Q 3STBD 5L37A 5KYIA 5IT9L 4R8IA 4JI7L 1XYIA 3DUZA 4A93B 1L1OA 2CW0D 1RODA 3JC66 1BDOA
chains in the Genus database with same CATH topology
2B2TC 3FEWX 1GUOA 2E74C 4KKUA 1AZQA 2YU9B 2Q8IB 3D31A 1NCVA 2B8FA 3HOYB 1TS2A 2C5CA 4ZK9B 4HEDA 5HURA 4U673 2HCCA 1PDQA 2X6GA 3CU7A 3DMUA 1PRTF 2DY8A 2E2DC 4HTHA 4QUCA 1KTKA 5JVG3 4P2CB 2LS01 3HGBA 5J1ZA 4KY6A 2F03A 1FNUA 4X3KA 4UDUC 4KY5A 5A35A 4DAYA 2KEEA 4KY7A 1H9JA 3S1MB 3NQTA 1S5BD 1D6EC 1WTXA 4PQXA 3MA2B 2A5HA 2PW5A 1IW7D 4RCOA 2B2YC 5D3DA 1YNND 3QB3A 1SNMA 3ND9A 4DNRB 4KKTA 1JWUD 4XXEA 3HOUB 5C4XB 4A3BB 2F0IA 2F0FA 2IX3A 2AQ3B 2NB0A 3CRKC 4IUPA 4V190 4F88A 1H9MA 3D4DA 3RUZA 2R3ZA 1I6VC 3MZ5A 2NZ1D 1VF5C 3A8KE 4R9WA 1ZEQX 1W6KA 1RF2D 3I4MB 1HFGA 3Q0AA 3SDZA 3KLSX 3Q6SA 2K6AA 3UI2A 5JAVA 1TVXA 1D5XC 2TSSA 1EZ8A 1F2MA 3AU7A 5JPNC 4MHEA 3SK5A 2KHSA 2TMPA 3NTIA 1EEID 2R92B 5C0XJ 4CGYB 4Q0FA 2D62A 5C0XI 4K14A 1SNPA 1OXUA 2L0CA 4IUVA 2J4XA 4KHZA 1T5XD 4QIWB 2CHBD 3I91A 1EY9A 2E76C 3QWNA 5IGGA 4DA2A 3I4NB 3OIPA 4LMQD 1BQQT 4ZLTF 2L5TA 1GUGA 4IZ8A 1LTSD 4FF3A 3OMGA 1E2WA 4C3IG 2EE1A 5LL6X 5BN4A 4EGVA 4S3SA 1OXVA 5C0XG 3L9AX 5IGFA 4X3TA 3OSOA 4QF4A 1B1ZA 4HCEA 4Z9CB 3A55A 1G91A 4X3UA 5I2YA 2DNEA 4E6IA 1FR3A 4ODGA 3A7LA 1BOSA 3KF8A 5KGUA 1CA5A 1ET6A 3TP7A 1WTPA 2QCPX 2RDHA 4GZYC 5CV5A 1NR2A 5IOCA 1LTRD 3BYTB 5HGTA 2RQXA 2JA8B 2JA5B 2K32A 2K01A 4RKLA 2SNMA 1ESRA 3H6MA 3M85A 4A3EB 5C5LA 3ZYYX 2RDFA 1PFBA 2RSOA 1VF7A 1QE6A 2VXWA 5K36H 2H4OA 3VR5A 1F9QA 1A6XA 5IODA 1LTID 3S1NB 1KLUD 3J7YW 3SK6A 2PZUA 1JB3A 1UNSA 3T53B 3KBGA 2CVRA 3W2DA 1EYAA 1PTOF 1F9RA 3M3YB 4DN4M 5CV9A 3OOCA 1B9MA 2E2JB 1A15A 4XYQA 3RZOB 3RLFA 1SNOA 1U4MA 2E2IB 3K5LA 1J8IA 2A69C 4A3KB 3I3CA 1SYDA 1NUCA 3K6OA 3H3VC 3EFXD 4IQZA 1PRTB 1G291 2N55A 1GOZA 1IYVA 3VYRA 3SVMA 4N9PA 3GTLB 2BDOA 3HOXB 3GD7A 5CV8A 5J39A 5KIXA 1NAPA 2B39A 2B2WA 1EIHA 5CV7A 4FF2A 1EFID 2MHVA 2LY7A 3HOWB 2K05A 3EVQA 1W6JA 2HDMA 1HQMC 4O42A 3MEHA 1DOLA 4HSPA 4IUNA 3WOEA 4K5VA 3T51B 3DWQA 1ESFA 5T1GA 1XTCD 2B8GA 3BYYB 2F0SA 5IT9E 2J0TD 2WV6D 2B2WC 1SXTA 1IL8A 2AQ1B 1EY7A 4A3IB 3I72A 5EBDA 1QNKA 1B53A 2E75C 4M8AA 4NMZA 5C3WA 1EY5A 1I4QA 3V05A 4CJ2C 2HQEA 1FNWA 2J7ZA 4K5WA 1DZ1A 3P20A 4CJ0B 1OO9B 2ID0A 1DOKA 2L11A 1SYBA 1LT6D 3IL8A 2OXPA 1TS4A 2AWOA 4BWGB 4BBSB 3S14B 4ME5A 1DD2A 1EU3A 4C3JG 3AB9A 3PIP3 4ZYSA 3NHHA 1ENCA 4CKBA 5IIFA 1TQOA 1DYQA 3FPPA 3Q23A 1STEA 2O5IC 1FNVA 5JEAG 5I4DA 2G9DA 1GXDC 2EYMA 2XVSA 2IX1A 3A8JE 2DY7A 1EIGA 2BA0A 5M3FB 4KHVA 1GUWA 5DM73 2NTTA 1TWAB 3VYSA 1I50B 1T5EA 2PCFB 3NWTA 3N52A 3PO2B 4XDXA 3MFGA 2M9VA 1SMYC 1U4LA 4J8QA 1VDZA 3EA6A 4ABNA 3K5MA 4M1UB 2EYPA 2MP1A 2WAQB 2XWBB 2N88A 2WP8J 3MFYA 1YNJD 5C0XH 3OW7A 3PUYA 3GO5A 1LTTD 2I46A 3E5SA 1GHJA 2DNCA 1RD9D 3V96A 4JK1C 4A3MB 1IHZA 3J81L 3K58A 3M7GA 1HRJA 1KAAA 3FDTA 2O2LD 1ZKOA 4TKOB 3J7AV 4FVMA 2PW7A 2BCOA 3E6ZX 3MAQA 2IL8A 1YNJC 2F0WA 1JWMD 2JXMB 4FP5D 5DNFA 2QILA 4IUTA 1OXTA 1SE4A 1H9SA 4QCLA 4K5XA 3TN2A 2EYFA 4C3JB 1JR0D 2ZXRA 3MWYW 4WJWA 2FMMA 4AYBB 1S4ZA 1Z47A 4G7HC 1I3QB 2WKCA 2B2VA 2X69A 1JICA 1QB5D 1B50A 1RTOA 3BG3A 1QJOA 2VNUD 1TS5A 1PZKD 2F0GA 2NVQB 1U4RA 2K7VA 2K33A 1SE2A 5FO9B 2OEOA 4J6HA 1HFNA 5C5MA 2KCNA 3HEJA 3R3OA 2JEAI 3KLSA 2NBFA 1CK1A 1Y1WB 1RDPD 2K28A 2C9OA 2VB3X 4H44C 2Y0SB 1TWHB 3VYUA 4BY1B 4IFDH 1UUPA 4R8NA 3TZUA 1HTLD 3WDNA 4IUUA 2EJGC 2PMZB 3C46A 4BA1I 4KD3A 2Q8RE 3K57A 3MHBA 2FINB 5TSSA 4RHSA 1STNA 2QF7A 4IURA 3T13A 1PYWD 2FMCA 1B2TA 1TIID 1AN8A 1SDFA 1O7ZA 1LT3D 4OO1H 3DWAA 2ICEC 2SNSA 1EY8A 2BA1A 2PZWA 4DXGA 3M4OB 2A74C 2F0DA 4KN7C 4DNTB 2F3VA 2EYHA 3QIAA 5AFWA 1STBA 3QO2A 3VA7A 1HA5A 3C1FA 1JORA 4RFBA 3A56A 4IFDJ 3BVGA 1NSNS 5C6AA 1VMPA 4XQNA 5M5XB 4DAVA 4XTCS 5A2QL 2WB1B 1B4OA 1Y8OB 2SOBA 3J80L 1WD0A 4K8IA 3EJIA 3QOJA 3K7AB 2KVMA 3RZDB 4H13C 1SEBD 3NUCA 4XT3B 2EDGA 2GA4B 4B9WA 4HMJA 3A7AB 1H9SB 4F8MA 4N9TA 3I4LA 4HSVA 4FXDA 3IAYA 3F2UA 2MUYA 1JC7A 2B63B 4YIJA 1LTBD 4K2KA 1F77A 3S1RB 1MBYA 2OT2A 1CHPD 2JA6B 3L7ZC 1EU4A 5JJZA 1NR4A 2HDLA 3I8ZA 3LX0A 2AUKA 4L8JA 2ZXOA 4EQNA 4C1NK 3CHBD 3BDOA 2KUMA 5DM63 1I4XA 2FFKB 3D8GA 4QMGA 5EPKA 1WTOA 1EWCA 3ND8A 4KD4A 3G7LA 5EJWA 3GTKB 5COYA 2KOLA 4CHTB 4BS9A 5ELCA 4B08A 4RAUC 1PTOH 1L0XB 1SYEA 3GV6A 1TS3A 3X3NA 3D4WA 4C56C 1H9KA 1BNZA 2SEBD 5C4HA 2FJ2A 3DEPA 2PO4A 5BN3A 5E1FA 1TR5A 4HN7A 3SK8A 2A73B 1STYA 3BS1A 1EL0A 1A2TA 3L3OC 5K36G 2LKVA 3MXUA 1CM9A 3TZDA 4RH6A 4K2LA 1RJTA 1PXUA 1AW7A 2PQEA 3S2DB 4IN3A 1F9PA 5C44B 2G9HD 1CQVA 1I4HA 2XIWA 1AP0A 1FYCA 3P7JA 1BCPC 1V1PB 4RGNA 4DK1A 4QUFA 1PRTC 1BF4A 2V4DA 1AFPA 3NQIA 2NUCA 1BCPB 1BCPD 5D14A 1PLFA 4ID6A 3Q24A 1CTMA 2R61A 4EQPA 1WTRA 2AQ2B 1JQYD 1SYFA 3PUXA 2JE6I 5CMDA 1KDAA 2EOTA 1K8OA 4HAEA 3M4YA 3OMCA 2XWJB 1MSHA 3NWSA 3TDQA 1S5DD 3BDLA 1MI2A 1KNEA 3MXGA 4QB4A 5M3MB 1WTWA 3KBXA 3JAME 1R4QB 2H1EA 5FKAC 2ZXPA 1RCVD 3TBIB 5IGCA 3NK9A 1QWYA 4ZKCB 2IWHA 4NW2A 1ET9A 3HZXA 4HCSA 4KMUC 1BBXC 2KA7A 4NKLA 1G6ZA 3DHQA 4OL7A 5T1IA 3H94A 2XRSD 4C1NI 1PZJD 3CRLC 1HQRD 4XQJA 5JPMC 4G7OC 1AEXA 4CBVA 5CBEE 3QG1A 2RVLA 2D2CC 1V1PA 1CA6A 3FKIB 3VR4A 4KN4C 2RBMA 4HMIA 5KNCA 1Q8IA 2F0KA 4DGZA 4ILWA 2EY1A 3D6WA 3GTMB 3VYTA 1O78A 1V1OA 1AZPA 1HHVA 1GUTA 1FGBD 4FXGC 4KJNA 2F1MA 1ICWA 1CI3M 3HS0C 3FPUB 2K5DA 1PFMA 4C3IB 3SK4A 1K8MA 1CT1D 2I07B 2A69D 3C3LA 2K03A 5LHY1 3MTSA 1VCIA 1JOOA 2B2UC 1D1KA 1X32A 2A6HC 2SDFA 1LO5D 3HKZB 4I7ZC 2Z8LA 3K5OA 3S1QB 2MJ8A 1CQFA 3IFTA 5M5YB 2PPBC 2F0EA 2ZT9C 5CC4A 1Q3LA 1HUMA 3H09A 4DAPA 2OF1A 1F9SA 3MC0B 4KI0A 5I9OA 2EJFC 2K1BA 2D5DA 2Q8TA 1HXYD 3BZDB 1S5FD 4A3FB 4MN3A 1SNDA 3VR3A 3BVMA 1II3A 1EWHA 5IGDA 1IKLA 1HCZA 4NDXA 2IJ0A 2K04A 3DXJC 2F3WA 3S16B 3WOFA 2QKIC 3PMFA 1E2VA 4A3DB 1RTNA 4OIKA 2QEJC 2A68C 1A3VA 1O80A 2JEBI 1BUVT 1QNUA 1PTOD 4DXFA 4KJOA 5ELBA 1DJRD 1HUNA 2EJMA 4PMBA 3G6JB 3K0YA 2JP1A 1EY4A 3IKJA 3X3MA 3J7AF 2L4NA 4ULLA 5EKKA 2ENBA 3K5NA 3I90A 2R6GA 2KEDA 2F0NA 1PFNA 5G3LD 3HOZB 2FHTA 2A68D 1EY6A 1BCPF 2M00A 2EYLA 3D4RA 1KLGD 1MSGA 3NPPA 2F0HA 5NUCA 1LT4D 2F0MA 5KNBA 1SE3A 1CFMA 2A6EC 3ONAB 5I9PA 3GQBA 1B44D 4TSSA 2NTSA 4RGTA 2IW3A 5CV6A 1EQVA 3OIQA 4RHRA 4WRDA 4C3HB 5C3EB 3PUVA 1Q1BA 5J22A 2RKSA 1BR9A 1ZXTA 5I6YA 5EPLA 2WACA 1QILA 1E2ZA 2KQ3A 1Z7TA 5KEEA 1JOQA 1FD7D 1DCZA 3EQLC 3GTGB 1F2LA 1B9NA 3R93A 4OO1G 5FK9C 2XNAC 4WORA 4DU9A 2R7ZB 5ISRA 4RCNA 1C48A 5E4WC 5FLXL 3CKIB 2F0JA 5CORA 4PV1C 1WVLA 1PTOB 5BN5A 2Z1CA 3T56B 3FRPB 3OWFA 4FF1A 4EQOA 1D1IA 2JSOA 4OIJA 3O13A 4LJZC 5EQ0A 2HCIA 3J81E 4IFDG 1F2ZA 3NBIA 2EYJA 5KYLA 4BY7B 3NBHA 2PYKA 4IALA 3PV0A 1TY2A 1LABA 5C4JB 1D2BA 5KRUA 1DXMA 3JAML 1Y8PB 2F0UA 4PNYA 4TQUS 3SEBA 1WCMB 2YYZA 3QJYA 4XIGS 4C2MB 5CGKA 3VR6A 3IFDA 2CQAA 5IGBA 2O4XA 3R2IA 3C1EA 1LTGD 4A3GB 5G3LF 4CKEA 2IX0A 1I4GA 1BXTA 3C2PA 1RHPA 2L12A 2F0VA 1MD2D 1B3AA 4IUQA 5A2QE 1VMCA 3TMEA 5CV4A 3S15B 4F7XA 3K59A 4J1MA 1U9RA 1U4PA 1TY0A 2RSNA 1HA6A 1WD1A 3KUPA 1F2YA 3PUWA 1TT2A 2CW0D 4PMWA 5FLXE 2F4IA 3W3AA 2B2YA 3DM1A 2LFNA 4V0BA 2F0LA 2EZVA 3P75A 5E3FA 1D5MC 1DM0B 3LNNA 2VB2X 4A3JB 3VA5A 1CZGA 1LACA 3U9SA 2EVBA 2B2UA 2PNRC 4I65A 5FO8B 2MPMA 1PRTD 1GUNA 1O7LA 3MVVA 3RMHA 4WFN3 1KDCA 3SHLA 1GJXA 4CKCA 1I6HB 5DAUA 1Y1VB 1ZYRD 1XXGA 1ILQA 1LV9A 5ELEA 3CQZB 1R4PB 1TU2B 1S5ED 2EPBA 5JEAH 1QCBD 1STGA 1KDBA 5EGTA 4ZKBB 1M4VA 1L0YB 5D65A 1SYGA 5IGEA 4H7BA 5FO7B 4OO1I 2KCCA 2IPKD 4L6TB 4FYDA 5ELFA 2O5JC 2NYZD 1EYCA 3NP8A 2EXZA 2WINB 4KKSA 4RWSC 1PTOC 4G57A 2NVYB 4B9XA 1XX8A 1LTAD 1G8ZD 1V43A 1EOTA 4ZUJA 3FMCA 2L1BA 2M2LA 5FOBB 1EYDA 1LLRD 3DEOA 5E4XA 1SNCA 3P1HA 4UAIA 2RA4A 1CZWA 4KV6A 4EVOA 2F0PA 5C3XA 1SFOB 2R93B 4G7ZC 2F0OA 5M9OA 3S17B 1TWGB 3S9WA 2KJXA 4JBWA 3NXWA 4F87A 5EKIA 3V2TA 3BVZA 1QG7A 3I70A 4Y7NB 1SSOA 1H9RA 1D5ZC 1LT5D 3OHXC 1V8QA 1KABA 2Z4HA 2EY2A 3U9OA 1ILPA 1SNQA 1Y69U 3PO3B 4RGMA 1G2SA 1GUSA 4DF7A 2A6HD 2WIIB 3PUZA 3A54A 1M8AA 2MGSA 3RD4A 5F2DA 2BOSA 3OPOA 1XWEA 1OXSC 4RA8A 5CYUA 2F0QA 1K83B 1S5CD 3GP7A 3GV3A 3GTJB 3D6CA 2L9HA 4ZAIA 3Q22A 1E0BA 1SJHD 1IW7C 1KNAA 5DEHA 3MXNA 2AUJD 4L63B 4XT1B 1HTPA 2HUGA 4O1NA 4TRDA 4LK1C 3TP8A 1SYCA 2EY5A 2BE5D 3LWEA 4G4KA 1STAA 3R2TA 1G2TA 2E2HB 1ML0D 1O7YA 4XQQA 3HRZC 3TP6A 1J9OA 1PZID 4OHJA 1I4RA 2JA7B 2IT1A 3ERQA 1QOHA 1Z6HA 4FXKC 1X3PA 3MXPA 3PIO3 1C4QA 3TP5A 1SJED 1ENAA 1SAPA 2K5WA 2NN6H 1OXXK 3S2HB 1CHQD 1STHA 1TWCB 3HOVB 3N6RA 4KK7A 3ITPA 3EROA 1DONA 3J80E 3KK7A 3NTHA 3LWUA 2WKDA 1JOKA 4RGOS 4MIUA 4NP5A 5JOBA 3DWPA 1IYUA 1YNNC 1I4PA 1MGSA 1TWFB 5LL6S 3SE0A 1Q90A 5K5PA 5C4ZA 4ZUIA 2QDBA 1A3UA 1JE4A 2BDNA 2B2VC 2PZTA 4X3SA 1PMRA 3NSWA 4HR7B 4K8JA 2XN9C 1A3TA 1R9TB 4XYOA 2Z4IA 5CBAE 2L55A 1IKMA 4C3HG 5I2XA 4Q5VA 5CR3A 1Q12A 3OWEB 1A2UA 3VR2A 3T16A 1GHKA 4FF4A 3AMUA 1JCKB 2NVTB 3I73A 3GTOB 1ONLA 1Y8NB 1HPCA 1EZ6A 4OGQC 1BO0A 5ELDA 3NTKA 2VUMB 1TKWB 1X3QA 4DK0A 2JYOA 1UAPA 4FO2A 1C8CA 4CJ1B 4BBRB 3H0GB 2EYOA 3BDCA 2D9UA 3M7NA 1WTQA 2BE5C 3SR1A 2NN6I 5EKLA 2DN8A 3T4AC 3GTPB 3HG9A 2X6LA 2CW0C 2LMCB 3SXHA 5JEAJ 4KTAA 2NN6G 4FNFA 4H0LC 2ICIA 5I6WA 4K6DA 1UEAB 2EY6A 1DOMA 5KNDA 4IFDI 2F0TA 2B2TA 5D3IB 3GTQB 4BA2I 2K5QA 2XSCA 1EQTA 5EPJA 2A6ED 2NVXB 3A8IE 1EY0A 3URYA 1ZYRC 1JWSD 4ZQ3A 2AWNA 5M5WB 1SBBB 5EBCA 3NE5B 1ENFA 4PMCA 1Q1EA 1WTVA 1RKNA 4RKBA 3E0JA 4K6LA 1SMYD 1EEFD 4LAAA 2NWGA 2KECA 4DFAA 3QOLA 3D3RA 3FVQA 4ZRZA 3KLRA 3HP3A 2RDGA 4U68A 2XRQD 3R8BA 5JVH3 3H91A 5KYIA 5IT9L 4R8IA 1XYIA 3DUZA 4A93B 3TSSA 1RODA 1BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  4DNT B;  4JBW A;  3W3A A;  2R6G A;  1IYV A;  1GUO A;  1YNJ C;  2JXM B;  3AB9 A;  4I7Z C;  2E74 C;  4KKU A;  2BDO A;  4LJZ C;  2NN6 H;  1OXT A;  1DD2 A;  2DN8 A;  1H9M A;  1OXX K;  3GD7 A;  3QIA A;  1H9S A;  1H9K A;  2A68 D;  1I6V C;  2Q8I B;  3N6R A;  3D4R A;  3D31 A;  2DNE A;  3LNN A;  2CW0 C;  1VF5 C;  2LMC B;  3VA7 A;  1H9R A;  1LAC A;  2B8F A;  1FR3 A;  2EVB A;  3A8K E;  3U9S A;  3IFT A;  3A7L A;  5BN3 A;  4IFD G;  4G7H C;  2PNR C;  1V8Q A;  3FPP A;  2PPB C;  2NN6 G;  1GUN A;  2ZT9 C;  3SDZ A;  4H0L C;  1O7L A;  4KMU C;  2O5I C;  5KNB A;  2KA7 A;  3BG3 A;  1QJO A;  5JEA G;  3LWU A;  5K36 G;  4GZY C;  1Y69 U;  1GJX A;  3H94 A;  5KND A;  3PV0 A;  1HQM C;  4XTC S;  1CFM A;  1GUS A;  2A6E C;  1Y8O B;  2K7V A;  2K33 A;  3CRL C;  2A6H D;  3MXU A;  3A8J E;  4KI0 A;  3GQB A;  3PUZ A;  4G7O C;  1LAB A;  2BA0 A;  1TU2 B;  2K32 A;  5JEA H;  2EJF C;  4BA2 I;  1IYU A;  2D5D A;  3QG1 A;  4H13 C;  3T51 B;  1YNN C;  2JEA I;  2D2C C;  3OPO A;  2EDG A;  3M85 A;  1DXM A;  3SE0 A;  3A7A B;  2A6E D;  1Q90 A;  1H9S B;  1Y8P B;  3VR3 A;  1T5E A;  2PCF B;  3VR4 A;  4KN4 C;  1OXS C;  2B8G A;  2KCC A;  3HGB A;  4H44 C;  3A8I E;  3I4L A;  1VF7 A;  1EWH A;  3PUV A;  5KNC A;  4TQU S;  1Q1B A;  1ZYR C;  2O5J C;  1HCZ A;  1PMR A;  1SMY C;  5K36 H;  4HR7 B;  2YYZ A;  1FYC A;  3QJY A;  4KKS A;  1VDZ A;  3NE5 B;  4XIG S;  2D62 A;  3VR5 A;  5A35 A;  4IFD H;  3DXJ C;  3VR6 A;  3TZU A;  4DK1 A;  3WDN A;  1Q1E A;  1IW7 C;  3I72 A;  1OXU A;  1E2Z A;  2EJG C;  1A6X A;  2V4D A;  2AUJ D;  4BA1 I;  1H9J A;  1E2V A;  2E75 C;  1HTP A;  1Z7T A;  3L7Z C;  1O78 A;  1Q12 A;  3MFY A;  4KHZ A;  1DCZ A;  4LK1 C;  3EQL C;  5C0X H;  2A68 C;  1GUT A;  2BE5 D;  3OW7 A;  2E76 C;  3VR2 A;  2JEB I;  1GHK A;  3PUY A;  3T53 B;  1CTM A;  1V43 A;  2F1M A;  1B9N A;  2AUK A;  3P20 A;  3I73 A;  2QF7 A;  1CI3 M;  2L5T A;  4L8J A;  1ONL A;  3FMC A;  1GUG A;  1IW7 D;  1Y8N B;  1HPC A;  4OO1 G;  3OOC A;  3PUX A;  1GHJ A;  2JE6 I;  1B9M A;  3BDO A;  3ND9 A;  2DNC A;  1K8M A;  4OGQ C;  1K8O A;  4DNR B;  1E2W A;  4KKT A;  4JK1 C;  2EJM A;  2A69 D;  3M4Y A;  3KLR A;  1TKW B;  2IT1 A;  3RLF A;  5BN4 A;  4DK0 A;  3IKJ A;  1VCI A;  4RCN A;  2AWO A;  1OXV A;  4OO1 H;  3PUW A;  5C0X G;  2A69 C;  1Z6H A;  4G7Z C;  3ND8 A;  4PV1 C;  2BA1 A;  1ZKO A;  4TKO B;  4IQZ A;  5BN5 A;  3M7N A;  2A6H C;  3CRK C;  1G29 1;  3T56 B;  4KN7 C;  2BE5 C;  1BDO A; 
#chains in the Genus database with same CATH topology
 2B2T C;  3FEW X;  4GNX A;  1GUO A;  1HH2 P;  4HIK A;  5IYD H;  2E74 C;  4KKU A;  2CQO A;  1AZQ A;  2YU9 B;  1CUK A;  2D0O A;  2Q8I B;  3D31 A;  1NCV A;  4NXM Q;  4WJ3 M;  1BBU A;  2B8F A;  4JI6 Q;  3HOY B;  1XMQ Q;  1TS2 A;  2Z6B A;  3K0X A;  3UE0 A;  2C5C A;  4ZK9 B;  4HED A;  5HUR A;  4U67 3;  4C2M H;  2HCC A;  1PDQ A;  2X6G A;  3CU7 A;  1MJE A;  5LMU L;  3DMU A;  1PRT F;  2DY8 A;  1J6Q A;  2E2D C;  1VQD A;  2UXC Q;  1HR0 W;  3S2H H;  1UE7 A;  4HTH A;  4QUC A;  1KTK A;  2A1A A;  2Z0S A;  1I50 H;  5JVG 3;  3CPW A;  4LUV A;  4P2C B;  2KCM A;  4HID A;  2LS0 1;  3HGB A;  2QDL A;  1U5K A;  3F2B A;  5J1Z A;  4KY6 A;  5LMN W;  3A0J A;  2F03 A;  1FNU A;  4X3K A;  4JI7 Q;  4UDU C;  4KY5 A;  5A35 A;  4DAY A;  1CKO A;  1XNR Q;  2KEE A;  4B3M Q;  4KY7 A;  1H9J A;  4DV6 L;  3S1M B;  4KLK A;  5IYB H;  3NQT A;  1S5B D;  1D6E C;  1GD7 A;  3TS0 A;  1WTX A;  4PQX A;  2HIX A;  3MA2 B;  2A5H A;  2NZH A;  4OEM B;  4CDD C;  2BH2 A;  2PW5 A;  1IW7 D;  4QQB X;  3TRE A;  4RCO A;  2B2Y C;  5D3D A;  1YNN D;  3QB3 A;  1SNM A;  3ND9 A;  4DNR B;  4DPG A;  4KKT A;  1JWU D;  4XXE A;  3HOU B;  5C4X B;  4A3B B;  2JK8 A;  4GKK Q;  1TWG H;  1EOV A;  2F0I A;  2F0F A;  2IX3 A;  2AQ3 B;  2HT1 A;  1KHI A;  2NB0 A;  1YZ6 A;  1T9H A;  1Q46 A;  3CRK C;  4IUP A;  4V19 0;  1RIP A;  5IP7 G;  4F88 A;  3CCU A;  1H9M A;  2RHQ B;  3D4D A;  3RUZ A;  2GVB A;  2R3Z A;  4X64 Q;  1SRO A;  1I6V C;  4N8X 1;  2AKW B;  5GQO A;  5M3M G;  3MZ5 A;  5GAG C;  2NZ1 D;  1VF5 C;  1WJJ A;  4UHV A;  3A8K E;  4C3J H;  4R9W A;  1WCM G;  1ZEQ X;  3GTG H;  1W6K A;  1RF2 D;  3I4M B;  1HFG A;  3Q0A A;  3SDZ A;  3GTK H;  3KLS X;  3Q6S A;  4HJ7 A;  1I3Q H;  2K6A A;  3UI2 A;  5JAV A;  1TVX A;  5GAD C;  1D5X C;  1FJG L;  4HJ5 A;  2TSS A;  4DV7 L;  1EZ8 A;  1F2M A;  3PQI A;  3ULJ A;  3AU7 A;  5JPN C;  3CW2 C;  4MHE A;  3SK5 A;  2KHS A;  4JCV E;  2TMP A;  3J80 i;  1LYL A;  3NTI A;  1EEI D;  3PF4 A;  1N36 Q;  2R92 B;  5C0X J;  4DR5 L;  4CGY B;  4Q0F A;  4LF7 Q;  2D62 A;  4JG2 A;  2WB1 G;  5C0X I;  4K14 A;  1SNP A;  1OXU A;  1E22 A;  3PO2 G;  3HOX H;  1NJI C;  3K80 C;  4LFA Q;  2L0C A;  3G48 A;  4YWL A;  4DR6 Q;  2OTJ A;  4IUV A;  2J4X A;  4KHZ A;  1T5X D;  4JOI C;  4QIW B;  2CHB D;  3RZD H;  3I91 A;  3CMA A;  1EY9 A;  2E76 C;  3QWN A;  5IGG A;  4DA2 A;  3I4N B;  3OIP A;  4LMQ D;  4DR4 L;  1BQQ T;  4ZLT F;  1LTL A;  2L5T A;  1GUG A;  3CCS A;  4JI4 L;  4IZ8 A;  1LTS D;  4LNQ A;  4FF3 A;  3OMG A;  4ALP A;  1E2W A;  1QZG A;  4C3I G;  2EE1 A;  5LL6 X;  5BN4 A;  4EGV A;  4S3S A;  1N36 L;  1OXV A;  1XNR L;  1HZB A;  1NTG A;  3M4O H;  5C0X G;  1IXR A;  3NEM A;  3L9A X;  1A0I A;  2N3S A;  5IGF A;  4X3T A;  3UDG A;  3OSO A;  3HOX G;  4QF4 A;  1B1Z A;  1WCM H;  4LF6 Q;  1Y1V H;  4HCE A;  1TWC H;  3KDF A;  2RF4 A;  4Z9C B;  4JYA L;  3A55 A;  1G91 A;  2VQE Q;  1QZH A;  4X3U A;  5I2Y A;  2DNE A;  5J3B A;  1TWA H;  4E6I A;  1FR3 A;  1NE3 A;  4ODG A;  3A7L A;  4DV0 L;  1BOS A;  3KF8 A;  5KGU A;  3J81 j;  2R92 G;  1CA5 A;  1ET6 A;  3TP7 A;  1WTP A;  1XPU A;  1MKH A;  2QCP X;  3MXN B;  5M3M H;  1XPR A;  2RDH A;  4GZY C;  5CV5 A;  1HR0 Q;  1NR2 A;  3K7A H;  5IOC A;  5IWA Q;  1LTR D;  4PZ7 A;  3BYT B;  5HGT A;  2RQX A;  2JA8 B;  1PV4 A;  2JA5 B;  2K32 A;  2K01 A;  4GN3 B;  4RKL A;  2SNM A;  1PH7 A;  4JOI A;  3E9H A;  1ESR A;  3H6M A;  3M85 A;  1CKM A;  3FKI G;  4A3E B;  2PQA A;  5C5L A;  3ZYY X;  2RDF A;  1PFB A;  2RSO A;  1YNX A;  1VF7 A;  4LF6 L;  2UUA L;  3S1R H;  4B3R Q;  1QE6 A;  2VXW A;  5K36 H;  4DV1 L;  2H4O A;  2I5L X;  3VR5 A;  2AHO B;  1PYB A;  2JA5 G;  4K0K L;  1F9Q A;  4GN4 B;  1A6X A;  2I0Q A;  5IOD A;  2EIF A;  1LTI D;  1XNQ Q;  3S1N B;  1KLU D;  4HJA A;  3T1Y Q;  3J7Y W;  3SK6 A;  2PZU A;  3CCR A;  4LF9 L;  3H15 A;  1JB3 A;  1UNS A;  3T53 B;  1CSP A;  3KBG A;  2CVR A;  3W2D A;  1EYA A;  4JPB W;  2VY3 A;  1PTO F;  1F9R A;  3M3Y B;  4P72 A;  4DN4 M;  5CV9 A;  3OOC A;  1B9M A;  2VUM H;  4YWM A;  2E2J B;  3HOV H;  1A15 A;  4XYQ A;  1U0L A;  3RZO B;  4MNO A;  3RLF A;  1LUZ A;  4DUY L;  1SNO A;  1U4M A;  2E2I B;  2CWP A;  3K5L A;  1J8I A;  2A69 C;  4A3K B;  3I3C A;  1IBM L;  1SYD A;  1NUC A;  3K6O A;  3H3V C;  4R4Q A;  3EFX D;  4IQZ A;  4DV6 Q;  1PRT B;  2UUA Q;  4OWT B;  1G29 1;  3PO3 H;  4MTN A;  1MHW C;  2N55 A;  1GOZ A;  4A3F G;  1IYV A;  3VYR A;  3SVM A;  4N9P A;  3GTL B;  2F4V Q;  2BDO A;  3HOX B;  1E1O A;  2R7Z G;  3GD7 A;  5CV8 A;  3AEV A;  5J39 A;  5KIX A;  1NAP A;  2B39 A;  1X9N A;  3RNU A;  2CWA A;  4JI2 L;  1A62 A;  4DR4 Q;  1BBW A;  2B2W A;  1EIH A;  2B29 A;  5CV7 A;  4BXX G;  4FF2 A;  1AH9 A;  1EFI D;  2MHV A;  5C3E G;  1EQQ A;  3I4N H;  2HQL A;  2LY7 A;  4OX9 Q;  4BXX H;  3HOW B;  2K05 A;  4DK6 C;  3W1B A;  3EVQ A;  1JMC A;  1AE2 A;  1R9T H;  3U4Z A;  1VQ4 A;  1W6J A;  2HDM A;  1HQM C;  4JI8 Q;  4O42 A;  3MEH A;  1VQN A;  1DOL A;  4HSP A;  3TQY A;  1TXY A;  2HIV A;  4IUN A;  3WOE A;  4K5V A;  2A8V A;  4A3M H;  3BU2 A;  4R1J A;  3DWQ A;  3T51 B;  3AFP A;  3ICE A;  1Q81 C;  1ESF A;  1SFO H;  3ULP A;  5M5W H;  5T1G A;  1XTC D;  2B8G A;  3BYY B;  3NBH B;  2F0S A;  5IT9 E;  2J0T D;  1HNX L;  2OWO A;  2WV6 D;  3TEH B;  2B2W C;  3G4S A;  1VQJ A;  4JYA Q;  1VQE A;  1SXT A;  1IL8 A;  2AQ1 B;  1EY7 A;  4A3I B;  3I72 A;  5EBD A;  1QNK A;  4UY8 C;  1B53 A;  2E75 C;  4M8A A;  4NMZ A;  5C3W A;  1X3G A;  1EY5 A;  3RR5 A;  1K9M C;  1N32 L;  1I4Q A;  2HHH Q;  3V05 A;  1VQ6 A;  4CJ2 C;  2HQE A;  1FNW A;  2J7Z A;  4K5W A;  4JI8 L;  4DAY B;  3CC2 A;  1DZ1 A;  3P20 A;  2GN5 A;  5LMU Q;  4CJ0 B;  1OO9 B;  1M1K C;  2ID0 A;  1DOK A;  3HOU G;  5FJ8 H;  3STB C;  2L11 A;  1VQC A;  3NEL A;  1SYB A;  1LT6 D;  2K75 A;  3IL8 A;  3OW2 A;  2OXP A;  1TS4 A;  4B3M L;  3HKZ E;  3W1G A;  4A3E H;  2AWO A;  4BWG B;  4IPG A;  4IO9 A;  4BBS B;  3S14 B;  2ZTC A;  4PG3 A;  2ALY B;  4ME5 A;  2AMC B;  1KXL A;  1DD2 A;  4JI0 Q;  1EU3 A;  1K3B C;  4ME3 A;  4C3J G;  3DLL A;  3ULL A;  3AB9 A;  3PIP 3;  4ZYS A;  3NHH A;  1ENC A;  1PYS B;  4CKB A;  3HFZ B;  5IIF A;  1PH4 A;  1TQO A;  1DYQ A;  2UXB Q;  3FPP A;  3Q23 A;  1P16 A;  2R7F A;  1STE A;  2E8G A;  2O5I C;  1FNV A;  4HIO A;  5JEA G;  5I4D A;  5JJL A;  1RL2 A;  2G9D A;  4MTK A;  1GXD C;  1Y1W G;  2EYM A;  2XVS A;  2OQ0 A;  2IX1 A;  3A8J E;  2DY7 A;  1PFS A;  1EIF A;  1PH5 A;  1EIG A;  2BA0 A;  5M3F B;  4KHV A;  2JA6 H;  5GRO A;  5DM7 3;  1GUW A;  2NTT A;  1TWA B;  3KF6 A;  3VYS A;  1I50 B;  1T5E A;  2PCF B;  3NWT A;  4APV A;  3N52 A;  3PO2 B;  4XDX A;  3MFG A;  2M9V A;  1HNX Q;  1SMY C;  1U4L A;  1XTD A;  2CCZ A;  4J8Q A;  1VDZ A;  3EA6 A;  4ABN A;  3K5M A;  4M1U B;  2K4K A;  4YHH L;  2EYP A;  2MP1 A;  2WAQ B;  2XWB B;  2N88 A;  5GAH C;  2WP8 J;  4BBR G;  3MFY A;  1YNJ D;  2UXD Q;  5C0X H;  3OW7 A;  3PUY A;  4RG1 A;  4A3G G;  3GO5 A;  1EYG A;  1LTT D;  2I46 A;  3E5S A;  1GHJ A;  4GKJ L;  1VQ5 A;  2DNC A;  4PZ6 A;  1YI2 A;  1RD9 D;  3V96 A;  4JK1 C;  1JJC B;  4A3M B;  1BKB A;  3HOY H;  1IHZ A;  3J81 L;  2ZM6 L;  3M7G A;  3K58 A;  1HRJ A;  3HKZ G;  5ELO A;  1KAA A;  3HOU H;  3HOY G;  1X65 A;  1C7Y A;  4A3K G;  2E5L L;  3FDT A;  2O2L D;  1ZKO A;  4TKO B;  3J7A V;  3FHW A;  4H02 A;  4QL5 A;  2L15 A;  4FVM A;  2PW7 A;  2BCO A;  3E6Z X;  4L5Q A;  3MAQ A;  2IL8 A;  3I56 A;  1J5E L;  1YNJ C;  2F0W A;  1JWM D;  2JXM B;  4FP5 D;  5DNF A;  2QIL A;  1I94 L;  4IUT A;  1OXT A;  1SE4 A;  3KJP A;  1H9S A;  4QCL A;  3K81 C;  4K5X A;  2EYF A;  3TN2 A;  4C3J B;  4LF5 Q;  4CDF C;  3PCO B;  1JR0 D;  1WTH A;  5JJK A;  2ZXR A;  3MWY W;  4WJW A;  2FMM A;  4AYB B;  4DNI A;  1BVS A;  2UXC L;  1S4Z A;  1Z47 A;  4G7H C;  1I3Q B;  3A5Z B;  2WKC A;  2B2V A;  2X69 A;  2JA8 G;  1JIC A;  4A3I G;  1QB5 D;  1B50 A;  1RTO A;  3BG3 A;  1QJO A;  2VNU D;  1TS5 A;  1PZK D;  4NPS A;  2F0G A;  3I4M H;  2NVQ B;  2I5M X;  4GOP C;  2ZTD A;  1U4R A;  2K7V A;  2K33 A;  1SE2 A;  5FO9 B;  4A76 A;  4X66 L;  2OEO A;  4J6H A;  4JI6 L;  4QY7 A;  1HFN A;  5C5M A;  2KCN A;  3HEJ A;  3R3O A;  1PHJ A;  1HNZ L;  1V9P A;  3PGZ A;  2JEA I;  3KLS A;  2HD3 A;  4LFA L;  2NBF A;  3K8A A;  1N8R C;  1CK1 A;  1Y1W B;  3M9B A;  1RDP D;  2K28 A;  2C9O A;  4A93 G;  2VB3 X;  4H44 C;  4IPD A;  2Y0S B;  4OWX B;  3S14 H;  1TWH B;  4BBR H;  4BY7 H;  3VYU A;  4YCU A;  4BY1 B;  2KHI A;  4IFD H;  1UUP A;  1QVC A;  4R8N A;  3TZU A;  1HTL D;  4OXP A;  3WDN A;  4K0K Q;  4IUU A;  3AYH B;  3OTO Q;  2PQA B;  2EJG C;  2PMZ B;  5E7N A;  3C46 A;  4BA1 I;  4KD3 A;  4LUZ A;  2Q8R E;  3K57 A;  3MHB A;  2EXD A;  2FIN B;  5TSS A;  1WI5 A;  4BY1 G;  4DV7 Q;  4RHS A;  1STN A;  1HZC A;  1E3P A;  2D0P A;  2QF7 A;  1CSQ A;  4AQY Q;  1EFW A;  4IUR A;  3T13 A;  3CAM A;  1PYW D;  2FMC A;  2B63 G;  4DUZ L;  1B2T A;  1GVP A;  1TII D;  4HIM A;  2H5X A;  1E24 A;  1WOC A;  1VQK A;  1AN8 A;  2IY5 B;  1SDF A;  1O7Z A;  1LT3 D;  3CCE A;  4OO1 H;  3DWA A;  1VQP A;  2ICE C;  1W2B A;  2SNS A;  1EY8 A;  2BA1 A;  2PZW A;  4DXG A;  3M4O B;  4DR2 Q;  5LMN Q;  2A74 C;  4N8F A;  2JJQ A;  2F0D A;  4KN7 C;  4DNT B;  2Q2H A;  4P71 A;  2F3V A;  2EYH A;  1PVO A;  1VQB A;  5IWA L;  3QIA A;  4DV1 Q;  2E2J H;  5AFW A;  1STB A;  4JI4 Q;  1FL0 A;  1L2F A;  3QO2 A;  3VA7 A;  1HA5 A;  3C1F A;  1JOR A;  4RFB A;  2BH8 A;  3A56 A;  3BVG A;  1NSN S;  4IFD J;  5C6A A;  3A5U A;  1VMP A;  3S16 H;  4XQN A;  5M5X B;  4DAV A;  4XTC S;  5A2Q L;  2WB1 B;  1B4O A;  1Y8O B;  2SOB A;  4K8I A;  3J80 L;  1WD0 A;  3EJI A;  4DR7 L;  3QOJ A;  3K7A B;  2KVM A;  3RZD B;  4H13 C;  1SEB D;  3NUC A;  4XT3 B;  2EDG A;  2GA4 B;  4B9W A;  1XNQ L;  1HJP A;  4HMJ A;  1UE5 A;  1YHQ A;  3A7A B;  1H9S B;  4F8M A;  4N9T A;  4A3L G;  3T1H L;  3I4L A;  4B3S Q;  4HSV A;  1YIJ A;  4FXD A;  4C3H H;  3IAY A;  3F2U A;  1H95 A;  2MUY A;  1JC7 A;  4YIJ A;  2B63 B;  1LTB D;  2K14 A;  1F77 A;  2QGQ A;  4K2K A;  3S1R B;  2ZJR A;  1MBY A;  2OT2 A;  1CHP D;  5H1S E;  2JA6 B;  1FVI A;  3OYY A;  3CME A;  4L5T A;  1WYD A;  3L7Z C;  1K3R A;  1EU4 A;  1KRT A;  5JJZ A;  2RCF A;  2JA9 A;  1NR4 A;  3UDF A;  3S1N H;  1OTC A;  2HDL A;  3I8Z A;  3LX0 A;  4LW1 A;  2AUK A;  4L8J A;  2VW9 A;  4LFB L;  2PI2 A;  3S24 A;  4X65 L;  2ZXO A;  4EQN A;  4C1N K;  3CHB D;  3BDO A;  2KUM A;  5DM6 3;  1V1Q A;  1I4X A;  2FFK B;  3D8G A;  4QMG A;  5EPK A;  1VQG A;  1WTO A;  1EWC A;  2N49 A;  3ND8 A;  4KD4 A;  1CKN A;  4QGU A;  3G7L A;  5EJW A;  1VQ8 A;  3GTK B;  4DV4 L;  5COY A;  2KOL A;  2UU9 L;  4CHT B;  4OWW B;  1KL9 A;  4BS9 A;  5ELC A;  4B08 A;  4RAU C;  1PTO H;  1L0X B;  1SYE A;  3G6E A;  3HOW G;  2VQF Q;  3GV6 A;  3GTM H;  1TS3 A;  3X3N A;  1C9O A;  3D4W A;  4C56 C;  1H9K A;  5LMN L;  1BNZ A;  1EUJ A;  2SEB D;  5C4H A;  2Q2T A;  4PZ8 A;  3RN2 A;  2FJ2 A;  3DEP A;  2PO4 A;  5BN3 A;  3H0G G;  5E1F A;  1TR5 A;  4HN7 A;  3SK8 A;  2A73 B;  1STY A;  3UDI A;  4OON A;  3BS1 A;  1EL0 A;  1A2T A;  2LXJ A;  3L3O C;  4I7A A;  5K36 G;  4DKA C;  2LKV A;  3IRB A;  3MXU A;  1CM9 A;  3TZD A;  4GLA C;  4WJ4 A;  4RH6 A;  4K2L A;  2DGY A;  1RJT A;  1PXU A;  1AW7 A;  1Y14 B;  2PQE A;  3S2D B;  4IN3 A;  1F9P A;  4GLV B;  5C44 B;  1J5E Q;  2G9H D;  1CQV A;  1I4H A;  2XTI A;  1X3E A;  3G71 A;  3T1Y L;  4DR1 Q;  1K8A C;  2XIW A;  1AP0 A;  1FYC A;  3P7J A;  4P73 A;  1BCP C;  1SE8 A;  1V1P B;  4RGN A;  4DK1 A;  4QUF A;  1PRT C;  1YHB A;  1BF4 A;  2V4D A;  1AFP A;  3NQI A;  2NUC A;  1BCP B;  1BCP D;  4X65 Q;  5D14 A;  1PLF A;  1EQR A;  4ID6 A;  1CKN B;  4GNX C;  3Q24 A;  1K83 H;  1CTM A;  2R61 A;  4EQP A;  1WTR A;  3GTJ H;  2AQ2 B;  3E3X A;  1JQY D;  1SYF A;  5M5X H;  3PUX A;  4DAM A;  2JE6 I;  1UEB A;  5CMD A;  3JAM i;  1KDA A;  2EOT A;  1K8O A;  4HAE A;  4JI3 L;  3M4Y A;  1NMG A;  4LFB Q;  1VQI A;  3KYH C;  3OMC A;  2XWJ B;  1MSH A;  1TWF H;  3NWS A;  2VQF L;  3TDQ A;  1S5D D;  3BDL A;  1MI2 A;  1KNE A;  3MXG A;  4QB4 A;  5M3M B;  1WTW A;  3KBX A;  3JAM E;  4B3T L;  1R4Q B;  1X54 A;  1KQS A;  2H1E A;  5FKA C;  2KBN A;  2ZXP A;  1N33 L;  1RCV D;  3TBI B;  1YHA A;  2MNA A;  3NEN A;  2A19 A;  5IGC A;  3NK9 A;  4GN5 A;  1QWY A;  3DM3 A;  4A3J H;  3I2Z A;  3BZC A;  4ZKC B;  2IWH A;  4NW2 A;  1ET9 A;  2UXD L;  3HZX A;  4HCS A;  4KMU C;  1BBX C;  2KA7 A;  4NKL A;  1G6Z A;  3DHQ A;  2Q2U A;  4OL7 A;  5T1I A;  3I55 A;  3H94 A;  2XRS D;  4C1N I;  4NB3 A;  4UP9 A;  1PZJ D;  3CRL C;  1HZA A;  1HQR D;  4XQJ A;  5JPM C;  4G7O C;  1AEX A;  4CBV A;  5CBE E;  1YJN A;  3QG1 A;  2RVL A;  2D2C C;  1V1P A;  3F1Z A;  1QUQ B;  4LWC A;  1IBM Q;  1CA6 A;  1PH9 A;  3FKI B;  3VR4 A;  1D7Q A;  3J80 c;  4KN4 C;  2RBM A;  5HGQ A;  4HMI A;  5KNC A;  3HOV G;  1Q8I A;  2F0K A;  3W5O A;  3CCM A;  4DGZ A;  4ILW A;  4DR1 L;  3PF5 A;  3F8T A;  1SN8 A;  3JAM c;  2EY1 A;  2NZO A;  3D6W A;  1X56 A;  3GTM B;  4B3T Q;  4GKJ Q;  2ATW A;  3VYT A;  3RZO H;  4OEL B;  1KIX A;  1O78 A;  1V1O A;  1A63 A;  2JN4 A;  2E2I H;  4POF A;  1AZP A;  1HHV A;  1GUT A;  2OCE A;  1A8V A;  1FGB D;  4FXG C;  3PIO A;  4KJN A;  2F1M A;  1ICW A;  1CI3 M;  3E9I A;  3HS0 C;  3FPU B;  2K5D A;  4JI1 Q;  1PFM A;  4C3I B;  3SK4 A;  1K8M A;  1CT1 D;  2I07 B;  3GTQ H;  2A69 D;  2N78 A;  4DV3 L;  3C3L A;  2K03 A;  5LHY 1;  3MTS A;  1VCI A;  3KF8 B;  1JOO A;  1K28 A;  2B2U C;  1D1K A;  4YHH Q;  1FGU A;  1X32 A;  3J7A 5;  3PSI A;  3CQZ H;  2A6H C;  3MEF A;  2SDF A;  3OTO L;  1LO5 D;  3HKZ B;  1PH6 A;  3PO3 G;  4I7Z C;  4DV2 Q;  2Z8L A;  3K5O A;  4X62 L;  3S1Q B;  2MJ8 A;  3KLW A;  1SMX A;  4DUY Q;  5IYB G;  1CQF A;  4GS3 A;  4UP8 A;  1NY4 A;  3IFT A;  5M5Y B;  2Z6K A;  1Q8K A;  2PPB C;  3ZJY C;  3CXC A;  3CCV A;  3H0G H;  2F0E A;  2ZT9 C;  4GNX B;  3J81 i;  5CC4 A;  4A3C G;  1Q3L A;  1HUM A;  3H09 A;  4DAP A;  2OF1 A;  1F9S A;  3M3Y H;  3U58 A;  4JV5 L;  3MC0 B;  4KI0 A;  3EN2 A;  1N34 Q;  3E0E A;  5I9O A;  4J15 A;  4JI0 L;  2EJF C;  1AE3 A;  2K1B A;  2D5D A;  2Q8T A;  1HXY D;  1B3Q A;  3BZD B;  1S5F D;  4A3F B;  1N33 Q;  2K5H A;  4MN3 A;  2F4V L;  1SND A;  3VR3 A;  2Q2I A;  3BVM A;  1II3 A;  1EWH A;  5GAE C;  5IGD A;  1IKL A;  1HCZ A;  4NDX A;  1VS0 A;  1VQA A;  2IJ0 A;  2YTV A;  2K04 A;  3DXJ C;  2F3W A;  3S16 B;  5IP9 G;  3WOF A;  3GDE A;  2QKI C;  3PMF A;  1IBK L;  1E2V A;  4A3D B;  3CPF A;  4JBM A;  1LM0 A;  1RTN A;  4FDB A;  2R93 H;  4OIK A;  2ZTE A;  2QEJ C;  4AIM A;  3LGJ A;  2R93 G;  2A68 C;  1G6P A;  1A3V A;  1O80 A;  2OQK A;  2JEB I;  1BUV T;  1QNU A;  5BR8 Q;  1K0S A;  5IYD G;  1PA6 A;  5AJ3 L;  2DJF C;  3PIP A;  1PTO D;  4DXF A;  4KJO A;  3UDX A;  5ELB A;  1DJR D;  2PNH A;  3CD6 A;  1HUN A;  2EJM A;  4PMB A;  3G6J B;  2K5V A;  3K0Y A;  1IL2 A;  2JP1 A;  1EY4 A;  3IKJ A;  3X3M A;  4R4T A;  2JA7 H;  4B3S L;  3J7A F;  3L0O A;  2L4N A;  4ULL A;  5IYC G;  2Y0S E;  5EKK A;  2ENB A;  2IHE A;  3K5N A;  3I90 A;  4TVA B;  2R6G A;  2KED A;  2F0N A;  5IE8 A;  1PFN A;  2N8N A;  5G3L D;  3HOZ B;  5M3F H;  2FHT A;  2A68 D;  1EY6 A;  1BCP F;  1JT8 A;  2M00 A;  2EYL A;  3D4R A;  1KLG D;  1MSG A;  3NPP A;  2F0H A;  5NUC A;  2CH4 A;  2IHF A;  1LT4 D;  2F0M A;  5KNB A;  1SE3 A;  2YTX A;  2UUC L;  1CFM A;  2A6E C;  2F3I A;  3ONA B;  5I9P A;  4L5S A;  3GQB A;  1B44 D;  4TSS A;  1KC8 C;  1PH2 A;  1B7Y B;  2QW7 A;  4UP7 A;  5C4X H;  2NTS A;  4RGT A;  2JA6 G;  2IW3 A;  5CV6 A;  1EQV A;  3OIQ A;  4RHR A;  4WRD A;  3GTP H;  2UXB L;  1C0A A;  4C3H B;  5C3E B;  3PUV A;  4JI2 Q;  2UU9 Q;  1Q1B A;  5J22 A;  2RKS A;  5JJI A;  2CH4 W;  1BR9 A;  4X62 Q;  1ZXT A;  5I6Y A;  5EPL A;  3D0F A;  2WAC A;  3I4O A;  1QIL A;  1E2Z A;  4GKK L;  1QUQ A;  2KQ3 A;  1Z7T A;  5KEE A;  3KJO A;  4A4I A;  1JOQ A;  1FD7 D;  1DCZ A;  3EQL C;  4A75 A;  3GTG B;  3GTO H;  3M4P A;  1F2L A;  1B9N A;  2NVX H;  5C44 H;  5FLM G;  2K52 A;  3R93 A;  4O2D A;  4OO1 G;  2VQE L;  1I6H H;  4JVZ A;  5FK9 C;  1EWI A;  2XNA C;  4LF4 Q;  1WFQ A;  3EBE A;  4WOR A;  3H3V H;  4DU9 A;  2PI2 E;  2R7Z B;  2OTL A;  4B3R L;  4X64 L;  5ISR A;  4RCN A;  1C48 A;  1YEZ A;  5E4W C;  5FLX L;  3CKI B;  2F0J A;  5COR A;  4PV1 C;  4ZCK A;  1WVL A;  1YIT A;  1PTO B;  1YBY A;  5BN5 A;  2NVQ H;  2Z1C A;  3T56 B;  3FRP B;  3OWF A;  4FF1 A;  1HNW Q;  4C3I H;  4YY3 Q;  4EQO A;  1D1I A;  2JSO A;  4OIJ A;  3O13 A;  4LJZ C;  4LFC Q;  1X6O A;  2NVY H;  1D8L A;  5EQ0 A;  2HCI A;  3J81 E;  4IFD G;  3ER0 A;  3CF5 A;  1IBL Q;  1F2Z A;  3NBI A;  2EYJ A;  5KYL A;  4BY7 B;  3NBH A;  2PYK A;  1X55 A;  4IAL A;  3PV0 A;  3TS2 A;  1TY2 A;  1XMQ L;  1LAB A;  5C4J B;  1D2B A;  3CC7 A;  5KRU A;  3F2C A;  2LSS A;  4DR6 L;  4A3J G;  1DXM A;  3JAM L;  1I94 Q;  1Y8P B;  2F0U A;  4PNY A;  1PH8 A;  2VL6 A;  3I7F A;  1HNW L;  4TQU S;  1B8A A;  3CC4 A;  3SEB A;  1IBK Q;  2E2H H;  1QVF A;  1WCM B;  3QJY A;  2K50 A;  2YYZ A;  4XIG S;  4C2M B;  5CGK A;  1Y1V G;  3VR6 A;  3IFD A;  4A3D G;  2CQA A;  5IGB A;  2O4X A;  3R2I A;  2CKZ B;  3C1E A;  1LTG D;  4A3G B;  5AJ3 Q;  5G3L F;  4A3C H;  1UE1 A;  4CKE A;  4DR7 Q;  2IX0 A;  3I4N G;  1VQF A;  1I4G A;  1BXT A;  1MJC A;  1Q7Y C;  3C2P A;  1KD1 C;  1RHP A;  2L12 A;  2MQH A;  2F0V A;  1MD2 D;  4A3M G;  1B3A A;  4IUQ A;  1VQM A;  5A2Q E;  1VMC A;  2WB1 E;  3TME A;  4IJL A;  5CV4 A;  3S15 B;  2QA4 A;  4AYB E;  4F7X A;  3K59 A;  4J1M A;  1S40 A;  2JA5 H;  1M90 C;  1U9R A;  1U4P A;  1TY0 A;  2RSN A;  4KHP L;  1HA6 A;  4IOA A;  4IPH A;  1DGS A;  1WD1 A;  1Y1W H;  2Z6K C;  3KUP A;  3AQQ A;  1F2Y A;  3VDY A;  3PUW A;  1TT2 A;  3TSS A;  4A93 H;  2VUM G;  1TWH H;  1XPO A;  4PMW A;  5FLX E;  4BY1 H;  2DUD A;  2F4I A;  3J81 c;  3W3A A;  2B2Y A;  4DR3 L;  4LF8 L;  3HOZ G;  3DM1 A;  2QEX A;  2LFN A;  3QR8 A;  4LF7 L;  4V0B A;  2F0L A;  2EZV A;  3P75 A;  5E3F A;  1D5M C;  3AFQ A;  1DM0 B;  3LNN A;  2VB2 X;  3BJU A;  3VA5 A;  4A3J B;  1CZG A;  1LAC A;  3U9S A;  2EVB A;  4I65 A;  2B2U A;  2PNR C;  3KF6 B;  5FO8 B;  2MPM A;  5IP7 H;  1PRT D;  2WFW A;  1GUN A;  1O7L A;  3MVV A;  3RMH A;  4WFN 3;  1KDC A;  2DJG C;  3SHL A;  1GJX A;  2P5Z X;  4CKC A;  1I6H B;  4LF4 L;  5DAU A;  1Y1V B;  1ZYR D;  1XXG A;  2B63 H;  2B3G A;  1ILQ A;  4BY7 G;  1LV9 A;  5ELE A;  3CQZ B;  4CDC C;  1R4P B;  2WAQ E;  4DK3 C;  2Y0S G;  3HOZ H;  1N32 Q;  1TU2 B;  1S5E D;  2EPB A;  5JEA H;  1QCB D;  1STG A;  5FLM H;  1KDB A;  5EGT A;  4ZKB B;  1ASZ A;  3FKI H;  4A3E G;  1M4V A;  1L0Y B;  1K8G A;  2CFM A;  5D65 A;  1SYG A;  5IGE A;  3F2D A;  4H7B A;  5FO7 B;  4OO1 I;  2KCC A;  2IPK D;  3I4M G;  4L6T B;  4A3K H;  1O7I A;  3ERS X;  5ELF A;  4EX5 A;  4FYD A;  2NYZ D;  2NVT H;  2O5J C;  4JI5 Q;  5M3F G;  1EYC A;  3NP8 A;  2EXZ A;  4RMF A;  2WIN B;  4KKS A;  4GOP A;  4DV2 L;  3M4Q A;  4RWS C;  1PTO C;  3EIV A;  1IZ6 A;  4G57 A;  3L2P A;  2NVY B;  4DV3 Q;  4B9X A;  5IYC H;  1XX8 A;  5C3E H;  1LTA D;  4CDE C;  1G8Z D;  4A3B G;  3HOW H;  1V43 A;  1EOT A;  3KDF B;  3RLO A;  1L1O B;  4ZUJ A;  3FMC A;  1NMF A;  2L1B A;  2M2L A;  5FOB B;  4JBJ A;  4POG A;  3HKS A;  2JA7 G;  1EYD A;  2KCT A;  1LLR D;  3DEO A;  1Q82 C;  5E4X A;  1SNC A;  2R7D A;  3P1H A;  4UAI A;  3H3V I;  2RA4 A;  1CZW A;  5ELN A;  4KV6 A;  4EVO A;  2LXK A;  2F0P A;  5C3X A;  1SFO B;  2R93 B;  4G7Z C;  4A3L H;  4YY3 L;  3CCQ A;  2F0O A;  2KHJ A;  5M9O A;  3S17 B;  1VQL A;  1TWG B;  3S9W A;  1S72 A;  4LF5 L;  4BBS G;  2KJX A;  1IYJ B;  4JI3 Q;  4NXN Q;  4JBW A;  2E5L Q;  4JW0 A;  3NXW A;  4YWK A;  1I5F A;  4F87 A;  4JC0 A;  5EKI A;  1PH3 A;  2ZM6 Q;  3V2T A;  3BVZ A;  1QG7 A;  5HY6 A;  3I70 A;  4A3G H;  1K0R A;  2RCN A;  4Y7N B;  1SR3 A;  3S2D H;  1SSO A;  1H9R A;  1D5Z C;  1LT5 D;  3OHX C;  1V8Q A;  1KAB A;  2Z4H A;  2EY2 A;  3U9O A;  1K73 C;  4LF9 Q;  5M5Y H;  1ILP A;  3J7Z C;  1SNQ A;  1VQH A;  1Y69 U;  3PO3 B;  4RGM A;  1G2S A;  5BR8 L;  1GUS A;  4DF7 A;  2A6H D;  2WII B;  3PUZ A;  2WAQ G;  4IPC A;  3A54 A;  1M8A A;  2MGS A;  4UPA A;  1X3F A;  3RD4 A;  5F2D A;  4JBK A;  2RHS B;  2BOS A;  1G51 A;  3OPO A;  1XWE A;  1NBW A;  3U4V A;  1OXS C;  4RA8 A;  5CYU A;  2F0Q A;  4NXN L;  5C44 G;  1K83 B;  1S5C D;  2ES2 A;  3GP7 A;  3GV3 A;  1B70 B;  3GTJ B;  4QJF A;  3D6C A;  4IJH A;  2L9H A;  4ZAI A;  3Q22 A;  1E0B A;  2JQO A;  1SJH D;  2KEN A;  2MFI A;  4A3B H;  1IW7 C;  1UE6 A;  1KNA A;  5DEH A;  5C4J H;  3MXN A;  2AUJ D;  4L63 B;  4XT1 B;  4JI5 L;  1HTP A;  4DR2 L;  1VQ7 A;  4AQY L;  2HUG A;  4O1N A;  1S3O A;  4TRD A;  4LK1 C;  3TP8 A;  1L1O C;  1SYC A;  4P75 A;  2EY5 A;  2BE5 D;  4DUZ Q;  4R4I A;  3LWE A;  5DLQ E;  4G4K A;  1STA A;  3R2T A;  1G2T A;  2E2H B;  1ML0 D;  1O7Y A;  4XQQ A;  3HRZ C;  3TP6 A;  4OX9 L;  1J9O A;  4DV0 Q;  1ASY A;  1FJG Q;  2YU9 H;  1PZI D;  4OHJ A;  1I4R A;  2JA7 B;  4GOP B;  2IT1 A;  3ERQ A;  4Y52 H;  1QOH A;  1HZ9 A;  2I5H A;  3RLN A;  5C4X G;  1Z6H A;  4FXK C;  1X3P A;  2UUB L;  3WWV A;  3RN5 A;  1UWV A;  3MXP A;  3CP0 A;  2ZJP A;  2YTY A;  3PIO 3;  1C4Q A;  3TP5 A;  1SJE D;  4LUO A;  5IY0 A;  1JB7 A;  1ENA A;  1SAP A;  2FXQ A;  2K5W A;  3KOJ A;  2NN6 H;  1OXX K;  3S2H B;  1CHQ D;  1STH A;  1TWC B;  1GO3 E;  3HOV B;  4GLX A;  4DV5 L;  3N6R A;  4KK7 A;  4R4C A;  3ITP A;  2R92 H;  3ERO A;  2ZJQ A;  3TRZ A;  1DON A;  2HHH L;  3J80 E;  1E7Z A;  4NXM L;  3KK7 A;  3NTH A;  4KHP Q;  3LWU A;  3FP9 A;  2WKD A;  1JOK A;  4A3D H;  5IP9 H;  4L5R C;  4RGO S;  2EQS A;  4P74 A;  4MIU A;  4NP5 A;  5JOB A;  3B6Y A;  3DWP A;  1IYU A;  4YCW A;  1YNN C;  1I4P A;  2JA8 H;  1P8L A;  3S1M H;  4LFC L;  1MGS A;  1TWF B;  1ICF B;  5LL6 S;  3SE0 A;  2G5D A;  3KFU A;  1Q90 A;  5K5P A;  5C4Z A;  4ZUI A;  2QDB A;  1A3U A;  3S17 H;  1JE4 A;  2BDN A;  2B2V C;  2PZT A;  1JJG A;  4X3S A;  1PMR A;  3NSW A;  4HR7 B;  4K8J A;  2XN9 C;  1A3T A;  1R9T B;  4XYO A;  2Z4I A;  1L0W A;  5CBA E;  2L55 A;  1IKM A;  4C3H G;  1W3S A;  5I2X A;  4Q5V A;  1XJV A;  5CR3 A;  4DR5 Q;  4DV4 Q;  1Q12 A;  4HJ9 A;  1N34 L;  3T1H Q;  3OWE B;  1Q86 C;  1A2U A;  1IBL L;  1EIY B;  3VR2 A;  3T16 A;  1GHK A;  4FF4 A;  3PO2 H;  1HR0 L;  3AMU A;  1JCK B;  2NVT B;  3I73 A;  4MZ9 A;  3GTO B;  1ONL A;  1JJ2 A;  1Y8N B;  1YJ9 A;  1XMO Q;  1HPC A;  1EZ6 A;  4AYB G;  2GVA A;  2R7Z H;  4OGQ C;  1BO0 A;  5ELD A;  3NTK A;  3K7U C;  3S1Q H;  2VUM B;  1TKW B;  1X3Q A;  2MO0 A;  4A3I H;  4DK0 A;  2JYO A;  1UAP A;  3UE1 A;  2F52 A;  4FO2 A;  4EQ5 A;  1C8C A;  2PMZ E;  1JE5 A;  4CJ1 B;  4BBR B;  3H0G B;  2VS1 A;  4DV5 Q;  2EYO A;  3BDC A;  2D9U A;  1WTQ A;  3M7N A;  3BZK A;  2BE5 C;  3SR1 A;  2NN6 I;  5EKL A;  3U50 C;  2DN8 A;  4YCV A;  2MO1 A;  3T4A C;  3GTP B;  3HG9 A;  1HNZ Q;  2X6L A;  1SLJ A;  3CCL A;  2CW0 C;  2LMC B;  4O0A A;  4A3F H;  3SXH A;  1NNX A;  5JEA J;  4KTA A;  2NN6 G;  2Z9H A;  1PH1 A;  4JV5 Q;  4FNF A;  1GKH A;  4H0L C;  1YJW A;  1Z9F A;  2ICI A;  5I6W A;  4X6A H;  4K6D A;  1UEA B;  4QIW E;  2EY6 A;  1DOM A;  5KND A;  2VZA A;  2YV5 A;  4IOC A;  4HJ8 A;  4IFD I;  2F0T A;  2B2T A;  5D3I B;  2ASB A;  3GTQ B;  4BA2 I;  5IT9 c;  2K5Q A;  3CCJ A;  2XSC A;  1EQT A;  5EPJ A;  4Y7N H;  1QVG A;  2A6E D;  3Q8D A;  2NVX B;  4R4O A;  3A8I E;  1EY0 A;  3URY A;  1ZYR C;  1JWS D;  4ZQ3 A;  2AWN A;  5M5W B;  1SBB B;  5EBC A;  1N9W A;  2XGT A;  3NE5 B;  1ENF A;  4PMC A;  2UUB Q;  4X66 Q;  1KRS A;  1Q1E A;  1WTV A;  1RKN A;  4RKB A;  4JI1 L;  1XMO L;  1VQ9 A;  3E0J A;  3A74 A;  4K6L A;  2C35 B;  1SMY D;  5EAY A;  1EEF D;  4LAA A;  1GM5 A;  2NWG A;  1KAW A;  2KEC A;  2UUC Q;  1E1T A;  4DFA A;  2K5N A;  1YVC A;  3S15 H;  3GTL H;  2V1C C;  3QOL A;  3D3R A;  1MIU A;  5FLX c;  3FVQ A;  4ZRZ A;  3KLR A;  3HP3 A;  3SGI A;  4BBS H;  2RDG A;  1SRU A;  5FJ8 G;  4U68 A;  4AH6 A;  2XRQ D;  3R8B A;  5JVH 3;  3H91 A;  4DR3 Q;  1VQO A;  4LF8 Q;  3STB D;  5L37 A;  5KYI A;  5IT9 L;  4R8I A;  4JI7 L;  1XYI A;  3DUZ A;  4A93 B;  1L1O A;  2CW0 D;  1ROD A;  3JC6 6;  1BDO A; 
#chains in the Genus database with same CATH homology
 2B2T C;  3FEW X;  1GUO A;  2E74 C;  4KKU A;  1AZQ A;  2YU9 B;  2Q8I B;  3D31 A;  1NCV A;  2B8F A;  3HOY B;  1TS2 A;  2C5C A;  4ZK9 B;  4HED A;  5HUR A;  4U67 3;  2HCC A;  1PDQ A;  2X6G A;  3CU7 A;  3DMU A;  1PRT F;  2DY8 A;  2E2D C;  4HTH A;  4QUC A;  1KTK A;  5JVG 3;  4P2C B;  2LS0 1;  3HGB A;  5J1Z A;  4KY6 A;  2F03 A;  1FNU A;  4X3K A;  4UDU C;  4KY5 A;  5A35 A;  4DAY A;  2KEE A;  4KY7 A;  1H9J A;  3S1M B;  3NQT A;  1S5B D;  1D6E C;  1WTX A;  4PQX A;  3MA2 B;  2A5H A;  2PW5 A;  1IW7 D;  4RCO A;  2B2Y C;  5D3D A;  1YNN D;  3QB3 A;  1SNM A;  3ND9 A;  4DNR B;  4KKT A;  1JWU D;  4XXE A;  3HOU B;  5C4X B;  4A3B B;  2F0I A;  2F0F A;  2IX3 A;  2AQ3 B;  2NB0 A;  3CRK C;  4IUP A;  4V19 0;  4F88 A;  1H9M A;  3D4D A;  3RUZ A;  2R3Z A;  1I6V C;  3MZ5 A;  2NZ1 D;  1VF5 C;  3A8K E;  4R9W A;  1ZEQ X;  1W6K A;  1RF2 D;  3I4M B;  1HFG A;  3Q0A A;  3SDZ A;  3KLS X;  3Q6S A;  2K6A A;  3UI2 A;  5JAV A;  1TVX A;  1D5X C;  2TSS A;  1EZ8 A;  1F2M A;  3AU7 A;  5JPN C;  4MHE A;  3SK5 A;  2KHS A;  2TMP A;  3NTI A;  1EEI D;  2R92 B;  5C0X J;  4CGY B;  4Q0F A;  2D62 A;  5C0X I;  4K14 A;  1SNP A;  1OXU A;  2L0C A;  4IUV A;  2J4X A;  4KHZ A;  1T5X D;  4QIW B;  2CHB D;  3I91 A;  1EY9 A;  2E76 C;  3QWN A;  5IGG A;  4DA2 A;  3I4N B;  3OIP A;  4LMQ D;  1BQQ T;  4ZLT F;  2L5T A;  1GUG A;  4IZ8 A;  1LTS D;  4FF3 A;  3OMG A;  1E2W A;  4C3I G;  2EE1 A;  5LL6 X;  5BN4 A;  4EGV A;  4S3S A;  1OXV A;  5C0X G;  3L9A X;  5IGF A;  4X3T A;  3OSO A;  4QF4 A;  1B1Z A;  4HCE A;  4Z9C B;  3A55 A;  1G91 A;  4X3U A;  5I2Y A;  2DNE A;  4E6I A;  1FR3 A;  4ODG A;  3A7L A;  1BOS A;  3KF8 A;  5KGU A;  1CA5 A;  1ET6 A;  3TP7 A;  1WTP A;  2QCP X;  2RDH A;  4GZY C;  5CV5 A;  1NR2 A;  5IOC A;  1LTR D;  3BYT B;  5HGT A;  2RQX A;  2JA8 B;  2JA5 B;  2K32 A;  2K01 A;  4RKL A;  2SNM A;  1ESR A;  3H6M A;  3M85 A;  4A3E B;  5C5L A;  3ZYY X;  2RDF A;  1PFB A;  2RSO A;  1VF7 A;  1QE6 A;  2VXW A;  5K36 H;  2H4O A;  3VR5 A;  1F9Q A;  1A6X A;  5IOD A;  1LTI D;  3S1N B;  1KLU D;  3J7Y W;  3SK6 A;  2PZU A;  1JB3 A;  1UNS A;  3T53 B;  3KBG A;  2CVR A;  3W2D A;  1EYA A;  1PTO F;  1F9R A;  3M3Y B;  4DN4 M;  5CV9 A;  3OOC A;  1B9M A;  2E2J B;  1A15 A;  4XYQ A;  3RZO B;  3RLF A;  1SNO A;  1U4M A;  2E2I B;  3K5L A;  1J8I A;  2A69 C;  4A3K B;  3I3C A;  1SYD A;  1NUC A;  3K6O A;  3H3V C;  3EFX D;  4IQZ A;  1PRT B;  1G29 1;  2N55 A;  1GOZ A;  1IYV A;  3VYR A;  3SVM A;  4N9P A;  3GTL B;  2BDO A;  3HOX B;  3GD7 A;  5CV8 A;  5J39 A;  5KIX A;  1NAP A;  2B39 A;  2B2W A;  1EIH A;  5CV7 A;  4FF2 A;  1EFI D;  2MHV A;  2LY7 A;  3HOW B;  2K05 A;  3EVQ A;  1W6J A;  2HDM A;  1HQM C;  4O42 A;  3MEH A;  1DOL A;  4HSP A;  4IUN A;  3WOE A;  4K5V A;  3T51 B;  3DWQ A;  1ESF A;  5T1G A;  1XTC D;  2B8G A;  3BYY B;  2F0S A;  5IT9 E;  2J0T D;  2WV6 D;  2B2W C;  1SXT A;  1IL8 A;  2AQ1 B;  1EY7 A;  4A3I B;  3I72 A;  5EBD A;  1QNK A;  1B53 A;  2E75 C;  4M8A A;  4NMZ A;  5C3W A;  1EY5 A;  1I4Q A;  3V05 A;  4CJ2 C;  2HQE A;  1FNW A;  2J7Z A;  4K5W A;  1DZ1 A;  3P20 A;  4CJ0 B;  1OO9 B;  2ID0 A;  1DOK A;  2L11 A;  1SYB A;  1LT6 D;  3IL8 A;  2OXP A;  1TS4 A;  2AWO A;  4BWG B;  4BBS B;  3S14 B;  4ME5 A;  1DD2 A;  1EU3 A;  4C3J G;  3AB9 A;  3PIP 3;  4ZYS A;  3NHH A;  1ENC A;  4CKB A;  5IIF A;  1TQO A;  1DYQ A;  3FPP A;  3Q23 A;  1STE A;  2O5I C;  1FNV A;  5JEA G;  5I4D A;  2G9D A;  1GXD C;  2EYM A;  2XVS A;  2IX1 A;  3A8J E;  2DY7 A;  1EIG A;  2BA0 A;  5M3F B;  4KHV A;  1GUW A;  5DM7 3;  2NTT A;  1TWA B;  3VYS A;  1I50 B;  1T5E A;  2PCF B;  3NWT A;  3N52 A;  3PO2 B;  4XDX A;  3MFG A;  2M9V A;  1SMY C;  1U4L A;  4J8Q A;  1VDZ A;  3EA6 A;  4ABN A;  3K5M A;  4M1U B;  2EYP A;  2MP1 A;  2WAQ B;  2XWB B;  2N88 A;  2WP8 J;  3MFY A;  1YNJ D;  5C0X H;  3OW7 A;  3PUY A;  3GO5 A;  1LTT D;  2I46 A;  3E5S A;  1GHJ A;  2DNC A;  1RD9 D;  3V96 A;  4JK1 C;  4A3M B;  1IHZ A;  3J81 L;  3K58 A;  3M7G A;  1HRJ A;  1KAA A;  3FDT A;  2O2L D;  1ZKO A;  4TKO B;  3J7A V;  4FVM A;  2PW7 A;  2BCO A;  3E6Z X;  3MAQ A;  2IL8 A;  1YNJ C;  2F0W A;  1JWM D;  2JXM B;  4FP5 D;  5DNF A;  2QIL A;  4IUT A;  1OXT A;  1SE4 A;  1H9S A;  4QCL A;  4K5X A;  3TN2 A;  2EYF A;  4C3J B;  1JR0 D;  2ZXR A;  3MWY W;  4WJW A;  2FMM A;  4AYB B;  1S4Z A;  1Z47 A;  4G7H C;  1I3Q B;  2WKC A;  2B2V A;  2X69 A;  1JIC A;  1QB5 D;  1B50 A;  1RTO A;  3BG3 A;  1QJO A;  2VNU D;  1TS5 A;  1PZK D;  2F0G A;  2NVQ B;  1U4R A;  2K7V A;  2K33 A;  1SE2 A;  5FO9 B;  2OEO A;  4J6H A;  1HFN A;  5C5M A;  2KCN A;  3HEJ A;  3R3O A;  2JEA I;  3KLS A;  2NBF A;  1CK1 A;  1Y1W B;  1RDP D;  2K28 A;  2C9O A;  2VB3 X;  4H44 C;  2Y0S B;  1TWH B;  3VYU A;  4BY1 B;  4IFD H;  1UUP A;  4R8N A;  3TZU A;  1HTL D;  3WDN A;  4IUU A;  2EJG C;  2PMZ B;  3C46 A;  4BA1 I;  4KD3 A;  2Q8R E;  3K57 A;  3MHB A;  2FIN B;  5TSS A;  4RHS A;  1STN A;  2QF7 A;  4IUR A;  3T13 A;  1PYW D;  2FMC A;  1B2T A;  1TII D;  1AN8 A;  1SDF A;  1O7Z A;  1LT3 D;  4OO1 H;  3DWA A;  2ICE C;  2SNS A;  1EY8 A;  2BA1 A;  2PZW A;  4DXG A;  3M4O B;  2A74 C;  2F0D A;  4KN7 C;  4DNT B;  2F3V A;  2EYH A;  3QIA A;  5AFW A;  1STB A;  3QO2 A;  3VA7 A;  1HA5 A;  3C1F A;  1JOR A;  4RFB A;  3A56 A;  4IFD J;  3BVG A;  1NSN S;  5C6A A;  1VMP A;  4XQN A;  5M5X B;  4DAV A;  4XTC S;  5A2Q L;  2WB1 B;  1B4O A;  1Y8O B;  2SOB A;  3J80 L;  1WD0 A;  4K8I A;  3EJI A;  3QOJ A;  3K7A B;  2KVM A;  3RZD B;  4H13 C;  1SEB D;  3NUC A;  4XT3 B;  2EDG A;  2GA4 B;  4B9W A;  4HMJ A;  3A7A B;  1H9S B;  4F8M A;  4N9T A;  3I4L A;  4HSV A;  4FXD A;  3IAY A;  3F2U A;  2MUY A;  1JC7 A;  2B63 B;  4YIJ A;  1LTB D;  4K2K A;  1F77 A;  3S1R B;  1MBY A;  2OT2 A;  1CHP D;  2JA6 B;  3L7Z C;  1EU4 A;  5JJZ A;  1NR4 A;  2HDL A;  3I8Z A;  3LX0 A;  2AUK A;  4L8J A;  2ZXO A;  4EQN A;  4C1N K;  3CHB D;  3BDO A;  2KUM A;  5DM6 3;  1I4X A;  2FFK B;  3D8G A;  4QMG A;  5EPK A;  1WTO A;  1EWC A;  3ND8 A;  4KD4 A;  3G7L A;  5EJW A;  3GTK B;  5COY A;  2KOL A;  4CHT B;  4BS9 A;  5ELC A;  4B08 A;  4RAU C;  1PTO H;  1L0X B;  1SYE A;  3GV6 A;  1TS3 A;  3X3N A;  3D4W A;  4C56 C;  1H9K A;  1BNZ A;  2SEB D;  5C4H A;  2FJ2 A;  3DEP A;  2PO4 A;  5BN3 A;  5E1F A;  1TR5 A;  4HN7 A;  3SK8 A;  2A73 B;  1STY A;  3BS1 A;  1EL0 A;  1A2T A;  3L3O C;  5K36 G;  2LKV A;  3MXU A;  1CM9 A;  3TZD A;  4RH6 A;  4K2L A;  1RJT A;  1PXU A;  1AW7 A;  2PQE A;  3S2D B;  4IN3 A;  1F9P A;  5C44 B;  2G9H D;  1CQV A;  1I4H A;  2XIW A;  1AP0 A;  1FYC A;  3P7J A;  1BCP C;  1V1P B;  4RGN A;  4DK1 A;  4QUF A;  1PRT C;  1BF4 A;  2V4D A;  1AFP A;  3NQI A;  2NUC A;  1BCP B;  1BCP D;  5D14 A;  1PLF A;  4ID6 A;  3Q24 A;  1CTM A;  2R61 A;  4EQP A;  1WTR A;  2AQ2 B;  1JQY D;  1SYF A;  3PUX A;  2JE6 I;  5CMD A;  1KDA A;  2EOT A;  1K8O A;  4HAE A;  3M4Y A;  3OMC A;  2XWJ B;  1MSH A;  3NWS A;  3TDQ A;  1S5D D;  3BDL A;  1MI2 A;  1KNE A;  3MXG A;  4QB4 A;  5M3M B;  1WTW A;  3KBX A;  3JAM E;  1R4Q B;  2H1E A;  5FKA C;  2ZXP A;  1RCV D;  3TBI B;  5IGC A;  3NK9 A;  1QWY A;  4ZKC B;  2IWH A;  4NW2 A;  1ET9 A;  3HZX A;  4HCS A;  4KMU C;  1BBX C;  2KA7 A;  4NKL A;  1G6Z A;  3DHQ A;  4OL7 A;  5T1I A;  3H94 A;  2XRS D;  4C1N I;  1PZJ D;  3CRL C;  1HQR D;  4XQJ A;  5JPM C;  4G7O C;  1AEX A;  4CBV A;  5CBE E;  3QG1 A;  2RVL A;  2D2C C;  1V1P A;  1CA6 A;  3FKI B;  3VR4 A;  4KN4 C;  2RBM A;  4HMI A;  5KNC A;  1Q8I A;  2F0K A;  4DGZ A;  4ILW A;  2EY1 A;  3D6W A;  3GTM B;  3VYT A;  1O78 A;  1V1O A;  1AZP A;  1HHV A;  1GUT A;  1FGB D;  4FXG C;  4KJN A;  2F1M A;  1ICW A;  1CI3 M;  3HS0 C;  3FPU B;  2K5D A;  1PFM A;  4C3I B;  3SK4 A;  1K8M A;  1CT1 D;  2I07 B;  2A69 D;  3C3L A;  2K03 A;  5LHY 1;  3MTS A;  1VCI A;  1JOO A;  2B2U C;  1D1K A;  1X32 A;  2A6H C;  2SDF A;  1LO5 D;  3HKZ B;  4I7Z C;  2Z8L A;  3K5O A;  3S1Q B;  2MJ8 A;  1CQF A;  3IFT A;  5M5Y B;  2PPB C;  2F0E A;  2ZT9 C;  5CC4 A;  1Q3L A;  1HUM A;  3H09 A;  4DAP A;  2OF1 A;  1F9S A;  3MC0 B;  4KI0 A;  5I9O A;  2EJF C;  2K1B A;  2D5D A;  2Q8T A;  1HXY D;  3BZD B;  1S5F D;  4A3F B;  4MN3 A;  1SND A;  3VR3 A;  3BVM A;  1II3 A;  1EWH A;  5IGD A;  1IKL A;  1HCZ A;  4NDX A;  2IJ0 A;  2K04 A;  3DXJ C;  2F3W A;  3S16 B;  3WOF A;  2QKI C;  3PMF A;  1E2V A;  4A3D B;  1RTN A;  4OIK A;  2QEJ C;  2A68 C;  1A3V A;  1O80 A;  2JEB I;  1BUV T;  1QNU A;  1PTO D;  4DXF A;  4KJO A;  5ELB A;  1DJR D;  1HUN A;  2EJM A;  4PMB A;  3G6J B;  3K0Y A;  2JP1 A;  1EY4 A;  3IKJ A;  3X3M A;  3J7A F;  2L4N A;  4ULL A;  5EKK A;  2ENB A;  3K5N A;  3I90 A;  2R6G A;  2KED A;  2F0N A;  1PFN A;  5G3L D;  3HOZ B;  2FHT A;  2A68 D;  1EY6 A;  1BCP F;  2M00 A;  2EYL A;  3D4R A;  1KLG D;  1MSG A;  3NPP A;  2F0H A;  5NUC A;  1LT4 D;  2F0M A;  5KNB A;  1SE3 A;  1CFM A;  2A6E C;  3ONA B;  5I9P A;  3GQB A;  1B44 D;  4TSS A;  2NTS A;  4RGT A;  2IW3 A;  5CV6 A;  1EQV A;  3OIQ A;  4RHR A;  4WRD A;  4C3H B;  5C3E B;  3PUV A;  1Q1B A;  5J22 A;  2RKS A;  1BR9 A;  1ZXT A;  5I6Y A;  5EPL A;  2WAC A;  1QIL A;  1E2Z A;  2KQ3 A;  1Z7T A;  5KEE A;  1JOQ A;  1FD7 D;  1DCZ A;  3EQL C;  3GTG B;  1F2L A;  1B9N A;  3R93 A;  4OO1 G;  5FK9 C;  2XNA C;  4WOR A;  4DU9 A;  2R7Z B;  5ISR A;  4RCN A;  1C48 A;  5E4W C;  5FLX L;  3CKI B;  2F0J A;  5COR A;  4PV1 C;  1WVL A;  1PTO B;  5BN5 A;  2Z1C A;  3T56 B;  3FRP B;  3OWF A;  4FF1 A;  4EQO A;  1D1I A;  2JSO A;  4OIJ A;  3O13 A;  4LJZ C;  5EQ0 A;  2HCI A;  3J81 E;  4IFD G;  1F2Z A;  3NBI A;  2EYJ A;  5KYL A;  4BY7 B;  3NBH A;  2PYK A;  4IAL A;  3PV0 A;  1TY2 A;  1LAB A;  5C4J B;  1D2B A;  5KRU A;  1DXM A;  3JAM L;  1Y8P B;  2F0U A;  4PNY A;  4TQU S;  3SEB A;  1WCM B;  2YYZ A;  3QJY A;  4XIG S;  4C2M B;  5CGK A;  3VR6 A;  3IFD A;  2CQA A;  5IGB A;  2O4X A;  3R2I A;  3C1E A;  1LTG D;  4A3G B;  5G3L F;  4CKE A;  2IX0 A;  1I4G A;  1BXT A;  3C2P A;  1RHP A;  2L12 A;  2F0V A;  1MD2 D;  1B3A A;  4IUQ A;  5A2Q E;  1VMC A;  3TME A;  5CV4 A;  3S15 B;  4F7X A;  3K59 A;  4J1M A;  1U9R A;  1U4P A;  1TY0 A;  2RSN A;  1HA6 A;  1WD1 A;  3KUP A;  1F2Y A;  3PUW A;  1TT2 A;  2CW0 D;  4PMW A;  5FLX E;  2F4I A;  3W3A A;  2B2Y A;  3DM1 A;  2LFN A;  4V0B A;  2F0L A;  2EZV A;  3P75 A;  5E3F A;  1D5M C;  1DM0 B;  3LNN A;  2VB2 X;  4A3J B;  3VA5 A;  1CZG A;  1LAC A;  3U9S A;  2EVB A;  2B2U A;  2PNR C;  4I65 A;  5FO8 B;  2MPM A;  1PRT D;  1GUN A;  1O7L A;  3MVV A;  3RMH A;  4WFN 3;  1KDC A;  3SHL A;  1GJX A;  4CKC A;  1I6H B;  5DAU A;  1Y1V B;  1ZYR D;  1XXG A;  1ILQ A;  1LV9 A;  5ELE A;  3CQZ B;  1R4P B;  1TU2 B;  1S5E D;  2EPB A;  5JEA H;  1QCB D;  1STG A;  1KDB A;  5EGT A;  4ZKB B;  1M4V A;  1L0Y B;  5D65 A;  1SYG A;  5IGE A;  4H7B A;  5FO7 B;  4OO1 I;  2KCC A;  2IPK D;  4L6T B;  4FYD A;  5ELF A;  2O5J C;  2NYZ D;  1EYC A;  3NP8 A;  2EXZ A;  2WIN B;  4KKS A;  4RWS C;  1PTO C;  4G57 A;  2NVY B;  4B9X A;  1XX8 A;  1LTA D;  1G8Z D;  1V43 A;  1EOT A;  4ZUJ A;  3FMC A;  2L1B A;  2M2L A;  5FOB B;  1EYD A;  1LLR D;  3DEO A;  5E4X A;  1SNC A;  3P1H A;  4UAI A;  2RA4 A;  1CZW A;  4KV6 A;  4EVO A;  2F0P A;  5C3X A;  1SFO B;  2R93 B;  4G7Z C;  2F0O A;  5M9O A;  3S17 B;  1TWG B;  3S9W A;  2KJX A;  4JBW A;  3NXW A;  4F87 A;  5EKI A;  3V2T A;  3BVZ A;  1QG7 A;  3I70 A;  4Y7N B;  1SSO A;  1H9R A;  1D5Z C;  1LT5 D;  3OHX C;  1V8Q A;  1KAB A;  2Z4H A;  2EY2 A;  3U9O A;  1ILP A;  1SNQ A;  1Y69 U;  3PO3 B;  4RGM A;  1G2S A;  1GUS A;  4DF7 A;  2A6H D;  2WII B;  3PUZ A;  3A54 A;  1M8A A;  2MGS A;  3RD4 A;  5F2D A;  2BOS A;  3OPO A;  1XWE A;  1OXS C;  4RA8 A;  5CYU A;  2F0Q A;  1K83 B;  1S5C D;  3GP7 A;  3GV3 A;  3GTJ B;  3D6C A;  2L9H A;  4ZAI A;  3Q22 A;  1E0B A;  1SJH D;  1IW7 C;  1KNA A;  5DEH A;  3MXN A;  2AUJ D;  4L63 B;  4XT1 B;  1HTP A;  2HUG A;  4O1N A;  4TRD A;  4LK1 C;  3TP8 A;  1SYC A;  2EY5 A;  2BE5 D;  3LWE A;  4G4K A;  1STA A;  3R2T A;  1G2T A;  2E2H B;  1ML0 D;  1O7Y A;  4XQQ A;  3HRZ C;  3TP6 A;  1J9O A;  1PZI D;  4OHJ A;  1I4R A;  2JA7 B;  2IT1 A;  3ERQ A;  1QOH A;  1Z6H A;  4FXK C;  1X3P A;  3MXP A;  3PIO 3;  1C4Q A;  3TP5 A;  1SJE D;  1ENA A;  1SAP A;  2K5W A;  2NN6 H;  1OXX K;  3S2H B;  1CHQ D;  1STH A;  1TWC B;  3HOV B;  3N6R A;  4KK7 A;  3ITP A;  3ERO A;  1DON A;  3J80 E;  3KK7 A;  3NTH A;  3LWU A;  2WKD A;  1JOK A;  4RGO S;  4MIU A;  4NP5 A;  5JOB A;  3DWP A;  1IYU A;  1YNN C;  1I4P A;  1MGS A;  1TWF B;  5LL6 S;  3SE0 A;  1Q90 A;  5K5P A;  5C4Z A;  4ZUI A;  2QDB A;  1A3U A;  1JE4 A;  2BDN A;  2B2V C;  2PZT A;  4X3S A;  1PMR A;  3NSW A;  4HR7 B;  4K8J A;  2XN9 C;  1A3T A;  1R9T B;  4XYO A;  2Z4I A;  5CBA E;  2L55 A;  1IKM A;  4C3H G;  5I2X A;  4Q5V A;  5CR3 A;  1Q12 A;  3OWE B;  1A2U A;  3VR2 A;  3T16 A;  1GHK A;  4FF4 A;  3AMU A;  1JCK B;  2NVT B;  3I73 A;  3GTO B;  1ONL A;  1Y8N B;  1HPC A;  1EZ6 A;  4OGQ C;  1BO0 A;  5ELD A;  3NTK A;  2VUM B;  1TKW B;  1X3Q A;  4DK0 A;  2JYO A;  1UAP A;  4FO2 A;  1C8C A;  4CJ1 B;  4BBR B;  3H0G B;  2EYO A;  3BDC A;  2D9U A;  3M7N A;  1WTQ A;  2BE5 C;  3SR1 A;  2NN6 I;  5EKL A;  2DN8 A;  3T4A C;  3GTP B;  3HG9 A;  2X6L A;  2CW0 C;  2LMC B;  3SXH A;  5JEA J;  4KTA A;  2NN6 G;  4FNF A;  4H0L C;  2ICI A;  5I6W A;  4K6D A;  1UEA B;  2EY6 A;  1DOM A;  5KND A;  4IFD I;  2F0T A;  2B2T A;  5D3I B;  3GTQ B;  4BA2 I;  2K5Q A;  2XSC A;  1EQT A;  5EPJ A;  2A6E D;  2NVX B;  3A8I E;  1EY0 A;  3URY A;  1ZYR C;  1JWS D;  4ZQ3 A;  2AWN A;  5M5W B;  1SBB B;  5EBC A;  3NE5 B;  1ENF A;  4PMC A;  1Q1E A;  1WTV A;  1RKN A;  4RKB A;  3E0J A;  4K6L A;  1SMY D;  1EEF D;  4LAA A;  2NWG A;  2KEC A;  4DFA A;  3QOL A;  3D3R A;  3FVQ A;  4ZRZ A;  3KLR A;  3HP3 A;  2RDG A;  4U68 A;  2XRQ D;  3R8B A;  5JVH 3;  3H91 A;  5KYI A;  5IT9 L;  4R8I A;  1XYI A;  3DUZ A;  4A93 B;  3TSS A;  1ROD A;  1BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...