2EVBA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
b'MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords methylmalonyl-CoA decarboxylase gamma chain
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lipid binding protein,transferase
total genus 13
structure length 74
sequence length 74
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2evbA00
2JE6I 4L8JA 3T51B 4DK1A 3KLRA 2K32A 1BDOA 4I7ZC 2AUKA 1G291 2A6ED 1IYUA 3M4YA 3H94A 1HCZA 5A35A 3PUVA 4IQZA 1HPCA 4OGQC 3CRKC 2F1MA 2YYZA 1H9RA 2A69D 2LMCB 3BDOA 2CW0C 4OO1H 2NN6H 1H9SA 2B8GA 3IFTA 1EWHA 1B9NA 3GD7A 3OPOA 3T56B 3AB9A 2PCFB 3RLFA 3VR6A 2JEBI 1K8OA 1E2ZA 3LWUA 4DK0A 2BE5C 1Q12A 1Z6HA 4BA2I 2A6HC 4IFDG 2E75C 1ZKOA 3L7ZC 1OXUA 1OXXK 4JBWA 5KNBA 1GUSA 2E76C 2EVBA 3BG3A 4PV1C 1OXTA 2D5DA 1V8QA 5BN5A 1OXSC 3TZUA 2K7VA 1H9JA 1E2VA 4GZYC 1Y8PB 3T53B 1PMRA 3MXUA 3FPPA 3PUWA 3SE0A 3A8JE 1V43A 2AUJD 3ND8A 1IW7D 2O5IC 3A7LA 1GHKA 3PUXA 1ONLA 2EDGA 3CRLC 3PV0A 3EQLC 1ZYRC 4KKSA 4JK1C 2KA7A 5JEAG 1CI3M 4IFDH 5K36G 2A6EC 5KNCA 3ND9A 4G7ZC 1GJXA 1GUTA 1B9MA 2A68D 4LK1C 4DNTB 5BN3A 4KN7C 1GUNA 1Q1EA 4LJZC 1K8MA 1VF5C 1FR3A 2QF7A 1H9KA 3VR5A 4H0LC 1H9SB 3QJYA 2O5JC 3VA7A 1LABA 1GUGA 1I6VC 4DNRB 2IT1A 2EJFC 1QJOA 1TKWB 1GHJA 1FYCA 3D31A 2D2CC 4HR7B 1H9MA 2K33A 2JEAI 3M7NA 3LNNA 5JEAH 2A6HD 3VR4A 3FMCA 1IYVA 5K36H 1HQMC 1DXMA 3PUYA 2EJGC 3WDNA 1HTPA 4KMUC 3IKJA 3SDZA 1OXVA 2V4DA 3OOCA 1Q90A 1Y8NB 1YNJC 2EJMA 3M85A 4OO1G 3A8IE 1A6XA 4G7HC 1E2WA 3D4RA 2JXMB 3I73A 1GUOA 2BA0A 3QG1A 3W3AA 4KKTA 4KN4C 1LACA 3VR3A 2Q8IB 3OW7A 4KHZA 3HGBA 5C0XG 3QIAA 4XTCS 2A69C 1IW7C 1VCIA 1VF7A 1VDZA 1TU2B 2BDOA 2L5TA 5KNDA 2NN6I 2AWOA 2PNRC 4KI0A 1Y69U 2DN8A 4BA1I 4TQUS 2ZT9C 2BE5D 4G7OC 2A68C 3N6RA 3NE5B 1CTMA 3MFYA 1O7LA 1CFMA 3DXJC 2DNEA 1Z7TA 3I72A 5BN4A 2D62A 4TKOB 4XIGS 5C0XH 1Y8OB 3U9SA 1T5EA 2B8FA 3A7AB 3P20A 2PPBC 2E74C 2NN6G 3PUZA 3VR2A 1Q1BA 2KCCA 4KKUA 1O78A 1DCZA 4H44C 4H13C 4RCNA 2BA1A 2R6GA 3A8KE 3GQBA 1DD2A 1YNNC 3I4LA 1SMYC 2DNCA
chains in the Genus database with same CATH superfamily
2UXDQ 1B7YB 1YJNA 4N8FA 4A3JH 5E7NA 1S5BD 1SJED 1G291 3G7LA 4JI5Q 5A35A 4IFDJ 3MHBA 4L6TB 1M90C 1VQPA 1D1IA 3OMCA 2ID0A 2C9OA 4X64L 4OO1H 3S9WA 1YIJA 2ZXRA 3KLWA 1D7QA 3AB9A 4A75A 2E2IB 2ZJRA 4NDXA 1AEXA 4CDFC 4A3FH 2E76C 3T13A 2QGQA 2EPBA 4R4TA 4CHTB 1E22A 2FMCA 1AZQA 5C44G 1VQNA 4Y7NB 1BBUA 4V190 3MFGA 1GHKA 3T16A 1HNXL 1HR0Q 4RG1A 4DF7A 4DR4Q 1CI3M 5C4XH 4R8IA 1XNQQ 3I56A 3HOZG 5C3WA 5LMNL 2F3WA 1UUPA 1FR3A 2J4XA 3WOFA 4OO1I 2OTJA 4IOCA 4DNRB 2EJFC 1WI5A 3FEWX 5FO9B 3K81C 2OXPA 2WAQE 4KV6A 2Q8RE 5CV9A 1L1OA 4FDBA 1G8ZD 2K28A 4JV5Q 4K0KL 3I70A 1WCMH 4JI2L 1YZ6A 2IY5B 4JOIC 1TS2A 3DMUA 1SLJA 2R3ZA 1CA6A 3OW7A 1J5EL 3MC0B 2FJ2A 1K73C 2NBFA 2ZXOA 1EOTA 2KCMA 2BDOA 2JJQA 3OMGA 3CXCA 1XPOA 3HRZC 3OTOQ 1Y1VB 3Q23A 3S1MB 3N6RA 4G4KA 4IPGA 4DR7Q 4UP8A 4P2CB 4QIWE 2BH2A 2VB3X 2H5XA 4CGYB 4C3JH 4YHHQ 2B29A 2PPBC 3GTPB 2ATWA 3U4ZA 4H44C 2KVMA 2R6GA 3I4LA 4O42A 2B63H 4RHSA 1W2BA 1LM0A 1F2LA 1SYCA 4GN3B 1KLUD 2R92H 3L0OA 1PRTC 3BU2A 4A3DH 4XT3B 1I50H 1KABA 3K5OA 3MTSA 4EQNA 1T9HA 1PH2A 3NTHA 4DAPA 2A73B 3I3CA 3TP5A 4K5VA 3CCUA 2R93G 1SN8A 4BA2I 4LF5Q 3HOXB 3S1QH 4KTAA 1MGSA 4UY8C 5C3EB 2KEDA 5M3MG 4JG2A 2JA7H 1XYIA 2JA8B 1V1PB 3GTMH 3HEJA 2JA6G 1ENAA 2UUCQ 4P75A 1TR5A 4WJWA 1EU4A 2F0KA 1XTDA 4LK1C 4RAUC 4RKBA 5BN3A 3LWEA 4DR6Q 5CV4A 3FKIB 1PTOC 1VF5C 4NP5A 4B3RQ 2O5JC 1S5CD 1TWFH 2B2YA 5FK9C 3HG9A 3R3OA 3HOYB 5I2YA 2HUGA 5JEAH 5DM63 3HKZE 4N9TA 1TWAH 4KY5A 1JICA 4M8AA 2PZTA 1EYDA 4UP7A 1LLRD 4JI0L 4H02A 1EIFA 1R9TH 3CCLA 1A2TA 3QWNA 3GTLH 4OEMB 1E2WA 2NVYH 4P71A 3ERQA 1LACA 4A93H 1QILA 4ZK9B 4XTCS 1XX8A 1YI2A 1G6PA 5IGDA 1SMXA 1F9RA 4HIMA 2SOBA 4ZQ3A 1PFNA 1VQBA 1Z7TA 1JOOA 2NZOA 1PZID 4HIOA 3T1YQ 3KLSX 4YWMA 2LY7A 1DCZA 1TY0A 1EOVA 2FFKB 2DNCA 3U58A 1Y1WG 4DK1A 2B2WC 3Q24A 1PYBA 4KHPQ 1SE2A 4BBSB 2VQFQ 1TWCH 1K83H 2MP1A 3BDOA 2CW0C 2CWPA 3D3RA 1ILQA 3NWTA 4HAEA 4PZ7A 3IFTA 3S2DH 4CKBA 3BZKA 4EX5A 3F1ZA 4NXNQ 2IHEA 5GROA 5M5YB 1BUVT 4X65Q 5HURA 3J80c 1L1OB 2D9UA 3M3YB 3OHXC 1JE5A 4JI3Q 1V9PA 1OXSC 1WTOA 4IALA 3TZUA 2RVLA 1H9JA 3I4MG 1Y8PB 3C1FA 3V96A 3OSOA 1CZGA 3GO5A 4TSSA 3CAMA 1L0YB 5FLXE 3DM3A 4F88A 1Z47A 1O80A 2IX3A 4NXML 3JAME 2KOLA 3DHQA 1DZ1A 3UE1A 1S5FD 4KD4A 4R9WA 3RD4A 3FPUB 3HKSA 1ILPA 5EPJA 1Q1EA 1I4XA 2I5LX 3AYHB 1VQEA 1HRJA 3EBEA 3DEPA 3NBHA 4A3KB 3PO2B 4HR7B 1GKHA 2TSSA 1NNXA 1VQ7A 1IBML 1B3QA 4K14A 2ZTDA 1LYLA 2IPKD 5K36H 1TWGH 4GNXC 4RGOS 1IBLL 2EJGC 4GLXA 1HTPA 1QVCA 5IOCA 4LF6L 2QW7A 4ZCKA 1PYWD 5DEHA 4Y7NH 4OO1G 3D4RA 1N34L 3U4VA 5CR3A 2N49A 1TQOA 1A15A 3L3OC 1UE5A 1QUQA 3X3MA 1IL2A 4X64Q 1SNOA 1BXTA 2NN6I 4LUVA 2DN8A 2ENBA 2R7DA 4WRDA 1JWUD 1I3QH 4X66L 4DV7Q 3GV3A 5BN4A 3PCOB 3BDCA 3K7AH 3G6JB 3K0YA 4ME5A 5CV8A 4C3IB 3CPWA 3E5SA 1S4ZA 3Q22A 4EGVA 4A3JB 3KBGA 5C4XG 1O7YA 3GQBA 2UXBL 2HIVA 2L0CA 5LMUL 1STGA 2Z4IA 2K32A 3F8TA 4DFAA 1N32L 4PZ8A 4K5XA 3DEOA 3PUVA 1HNXQ 4IPDA 5F2DA 5C5LA 1Q82C 4GLVB 3JAMc 1H9RA 1HNWL 1BCPD 1H95A 1LTTD 3S1MH 4HMJA 3P7JA 1K3BC 2XRQD 2R7ZH 3VR6A 3BZCA 4A3FB 3TQYA 4O1NA 2GVBA 1FJGL 1Q12A 2UUBQ 2EYJA 4POFA 3Q0AA 2JYOA 2KEEA 3PQIA 4DV5L 1S72A 3STBC 1YJ9A 1E2VA 3CCEA 2VL6A 3Q8DA 3CC4A 3TREA 1EY0A 2B2TC 3NSWA 2YV5A 1VQFA 4B3SL 4JI2Q 3RN5A 1RTOA 1MI2A 4KJNA 4PMWA 2B3GA 5NUCA 4IFDH 4K6LA 1V1OA 1J5EQ 3GTKH 1EZ6A 2A6EC 5CYUA 2JA5H 3UE0A 2RA4A 5FJ8H 3HOVB 1FVIA 1T5XD 2NZHA 2ZTEA 2QF7A 3OWEB 3D6CA 3UDXA 3VA7A 1LABA 1X9NA 4WJ4A 1JB3A 2Z4HA 4P74A 4G57A 4H7BA 2MFIA 4E6IA 2EY5A 3J80L 1WCMB 2ICEC 3PUYA 3RLOA 4ID6A 4A3EG 3SDZA 5IYCH 2AHOB 4OWXB 1VQ4A 4IURA 5C4ZA 3VA5A 2N3SA 1CKOA 1JT8A 4KKTA 4LF7Q 4CKEA 3S15B 3E0JA 2AWNA 3V2TA 2PI2E 3DLLA 4ODGA 4PMCA 5AJ3L 1XMQQ 1SYGA 3KF6B 1HH2P 1M1KC 2N88A 5IODA 3ZYYX 3KUPA 4I7AA 3HOYH 1FGBD 4GOPB 4ME3A 1CFMA 4C3JB 3W5OA 2VQEL 1LT6D 5K5PA 1RJTA 2K05A 2K5DA 4DUZQ 2B63B 4H13C 5FOBB 3A8KE 1PFMA 5CGKA 1EWIA 3MVVA 2HCIA 2LXKA 3E6ZX 3D6WA 2R92B 1YJWA 2M00A 3HZXA 2E5LL 2LKVA 4A3DB 4L5SA 1I50B 4YCVA 4A3MG 4RWSC 1LO5D 1RKNA 1U0LA 3BVGA 4ZUIA 4LF8L 3KOJA 4OGQC 4AH6A 4BBRG 3FP9A 1WOCA 2QKIC 5BR8Q 3E0EA 4BY1H 3QB3A 3T56B 1WVLA 1ML0D 3E3XA 3RLFA 1S3OA 3S1QB 1WJJA 3LGJA 3NBIA 3J80i 2SEBD 3J7A5 2PW7A 2UXCL 2K4KA 1KDAA 1ZKOA 2JSOA 5CV6A 1TT2A 1PYSB 1OXTA 2JA7B 2WIIB 4JI0Q 3GTMB 4C3HH 1HZ9A 4A76A 4LF9L 2EYOA 4J1MA 1KAWA 4JI1Q 5IP9H 5FLMG 2Q2UA 4FXDA 5EAYA 4HCSA 4RGNA 2Y0SG 3EFXD 1D8LA 1ZYRC 5IP7H 1D1KA 1OO9B 3H3VI 4G7ZC 2MGSA 1VQ8A 3F2DA 1DOKA 1GJXA 1KRTA 1TWFB 1B9MA 3BYTB 2QDBA 1NMFA 1ET6A 2F4VL 1C48A 1RCVD 2I5MX 2HT1A 1N8RC 2NB0A 1K8AC 1IL8A 3DWPA 2PMZE 5C0XI 1CHQD 1X6OA 2IWHA 4BWGB 5IT9c 1HQMC 1R9TB 2WAQB 2BOSA 3GTLB 2EY1A 3H0GH 1Q81C 2NVYB 4A93B 2KECA 5EPLA 2XNAC 4WFN3 1J6QA 1RF2D 4A3CH 5C4HA 2CFMA 2DUDA 5HGQA 1Y14B 2MPMA 4DGZA 1K8GA 2XN9C 2FHTA 4PG3A 1TU2B 4V0BA 1KDCA 1EQRA 3G71A 1F2ZA 1BR9A 1LTGD 3S24A 5L37A 4CJ2C 3A0JA 3NK9A 3GDEA 5JVH3 1QG7A 1N33L 1O7LA 1X3PA 1NY4A 4TKOB 5M5XB 4B9WA 2IX0A 2K5HA 3CHBD 3G6EA 2HCCA 2B8FA 4QL5A 5DNFA 1Q7YC 2NN6G 1GVPA 3PF5A 3ULLA 2ZTCA 4IUUA 1V1PA 3OW2A 3TS0A 2OCEA 1XPRA 3T1HQ 3N52A 4GLAC 4RHRA 4CDEC 2AUKA 4KLKA 1K83B 1IYUA 4DV4Q 3H94A 4CJ0B 3JAMi 1F2MA 2NTSA 2XIWA 3S2DB 2OQKA 4OELB 2LMCB 1KD1C 2Q8TA 1UWVA 1SDFA 4X3TA 1VQDA 1R4QB 2WB1E 3P1HA 3VYTA 2ZJPA 3VYUA 4A3GB 3LWUA 1EY9A 5G3LD 1I4HA 1K0RA 5TSSA 1OXXK 3BG3A 1S40A 1CZWA 3CPFA 4LF6Q 2R7FA 4DR2Q 1GUWA 1VQLA 3CMEA 4LFBL 4JI7Q 2EE1A 4YWLA 3ND8A 4ALPA 2RQXA 1PH7A 4KKSA 3FDTA 4FXGC 4OIKA 4B9XA 1G91A 3CW2C 3FHWA 1EQQA 4LFAL 4JBJA 5LMNW 4AIMA 3C1EA 2J0TD 2PW5A 1UNSA 4GN5A 3QJYA 4WJ3M 1XNRQ 2B2YC 4BY7B 1PFSA 1LTLA 3TMEA 1FNVA 1SAPA 4X66Q 2QDLA 1XMOL 1WD0A 1H9MA 1V1QA 1TWGB 2F0SA 1HUNA 4A3BH 2QEXA 1ICWA 1YHBA 2H4OA 2QCPX 1AP0A 1UEAB 1PVOA 4ILWA 4LF4L 1SYBA 3HKZB 4DXFA 3NTKA 1NE3A 5T1IA 3A54A 1YNJC 5I4DA 5C3XA 5LMUQ 3VYSA 1Y1VG 4R4IA 5EPKA 1E24A 1CKNB 3S14H 3S1RH 2K6AA 1L0XB 5GAHC 5ELOA 3HOVH 2F0VA 1A8VA 4FVMA 1I3QB 4KHVA 3SK8A 1B2TA 4A3LG 1CA5A 1CSPA 2K01A 2A68C 4DR1L 1DOLA 3K7AB 1BCPB 3DXJC 4DUYL 2EQSA 2VY3A 4DV2L 1B8AA 3P20A 4R4OA 1EFWA 3A55A 4L5RC 1BVSA 2B2VA 3W1GA 5IT9L 1E3PA 1LTSD 5JAVA 1WTRA 3BDLA 5KYIA 1LUZA 5FJ8G 1VQ5A 1TIID 2K5QA 3S15H 1I4QA 2Q2IA 3KFUA 2MUYA 1SNQA 1EYGA 4DNIA 3HOXG 1RD9D 1PZJD 2R7ZB 3D0FA 1G51A 4JBMA 2NVQH 5C3EG 1X3GA 3FVQA 2WACA 1JMCA 2PI2A 4JCVE 1PXUA 2JEBI 2JA8G 3ONAB 3AEVA 4GKJL 1LTAD 4DV0Q 5IYCG 4FF1A 3ICEA 4Y52H 2PQAB 1DYQA 5IYBH 4HN7A 2PQEA 4HTHA 3UDGA 1WTPA 1EY6A 4AYBE 4EQ5A 4DV1L 3G48A 3MEFA 4XQNA 1SROA 3FKIG 1U4RA 2SNSA 1E1TA 2CKZB 3GTKB 2JA5B 4IOAA 4QGUA 4K2KA 2MO0A 3HOYG 4OL7A 3CU7A 5AJ3Q 4HJ8A 2CVRA 1DM0B 4DNTB 1E7ZA 1YHAA 1HZCA 2EYLA 4YCUA 1GUNA 4LJZC 3GV6A 3IRBA 3BYYB 1H9SB 1PFBA 3DUZA 1FYCA 1EU3A 1NMGA 1IKLA 3QO2A 1KHIA 1KNEA 3FMCA 4LMQD 3E9HA 5IIFA 1XXGA 3CCQA 2F0UA 1NAPA 4EQOA 1MJEA 1X55A 1JWSD 4JI8Q 3M85A 1M8AA 2UUAQ 1NCVA 4DA2A 3BVMA 1PRTD 2N78A 3I90A 5JJKA 5C0XG 2IJ0A 4OWTB 3HP3A 4DV3L 2ZM6L 2A69C 1VF7A 1U5KA 5KNDA 3QOLA 1JORA 4DV6L 3HOWH 2AWOA 4QQBX 1X32A 3J80E 3PIOA 1A3TA 5JOBA 3AFQA 2EYFA 4MIUA 2XVSA 2D62A 3K5LA 1PTOH 4QCLA 4X3UA 3I7FA 2IHFA 2RHQB 5E1FA 3GTOH 5IP9G 1S5ED 3PUZA 3I4NH 4BBSG 3CP0A 4IUNA 1B1ZA 2BA1A 5C6AA 2L9HA 3NPPA 4A3IH 1P16A 4KK7A 2CQOA 1Q8KA 4K2LA 1JR0D 1N36Q 1HNZQ 4F87A 4BY1B 2K5VA 3CRKC 2XSCA 2EYPA 1PTOD 2A69D 3RLNA 1PLFA 1HUMA 3SHLA 2WKDA 1JOKA 5HGTA 2J7ZA 5M5XH 1Z6HA 2B39A 3OIPA 3ULJA 4PV1C 4MTNA 4C3HB 2F52A 2WP8J 4F7XA 2MJ8A 3FPPA 3SE0A 4R4CA 2KBNA 4YIJA 4LNQA 2CWAA 1IBKL 3PV0A 4A3KG 1B53A 3PO2G 4FF4A 2DY8A 4JPBW 3KF6A 1NSNS 3I8ZA 1G2SA 3KK7A 4RH6A 4OX9Q 3ERSX 4A3GH 3M9BA 4GOPA 1CQVA 1QZHA 2DY7A 1TKWB 4R4QA 1GHJA 5EJWA 1N33Q 2SNMA 4HSPA 1WTWA 2JQOA 4FP5D 3AQQA 3LNNA 3M7NA 3H0GB 5J1ZA 1HA6A 4DAVA 1FD7D 4IUPA 2N55A 4FXKC 4IUVA 3MZ5A 1NTGA 1HA5A 3D4DA 4JYAQ 5IWAL 4X62Q 1GUOA 3RZDH 3R2IA 2AMCB 3CCJA 3VR3A 4AQYL 2CW0D 3HGBA 3H09A 2UU9L 1IW7C 2AKWB 3URYA 2L5TA 1J9OA 3RNUA 1JCKB 1ZXTA 5CORA 4C3IG 3K5NA 3L2PA 4B08A 2E2DC 2R61A 4BY7H 1SE8A 5ELEA 4DR3L 2XTIA 4A3JG 3PO3H 2OT2A 4PNYA 3S17B 4JI4L 3TP6A 1AN8A 4RGMA 2E2JH 2F0EA 4J8QA 3PSIA 3CQZH 1DD2A 2RKSA 5D3DA 2MO1A 4KHZA 2EY6A 1X56A 1HZBA 3DWQA 2RSOA 5M5WH 2YTYA 4A3FG 3HOUH 2RDHA 2UXDL 1SE3A 2OQ0A 3TP7A 4LUOA 1SYEA 1ET9A 1A63A 4F8MA 4N8X1 2DGYA 1QVFA 3GD7A 3OPOA 1XPUA 3JC66 1Z9FA 1RIPA 2OWOA 4RA8A 1BBWA 3I2ZA 2BE5C 1XMOQ 4OHJA 5H1SE 4JBWA 1UE7A 2F0TA 4KD3A 1LTBD 1U9RA 2EXZA 5GAGC 4L5TA 4XQQA 1Q3LA 5JJLA 3T53B 1NBWA 1SFOB 3PMFA 3HOVG 3A8JE 3EIVA 4IJHA 1RTNA 4HEDA 5LHY1 3GTJH 1ONLA 1STHA 2EDGA 2RBMA 3IFDA 5LMNQ 1B50A 2VUMB 3E9IA 2ZXPA 1ENCA 2F3VA 5IGEA 2K04A 2CQAA 1ASYA 5EKKA 4L5QA 3TDQA 1WCMG 1JWMD 4UDUC 4H0LC 2YU9H 4DR1Q 5C44H 1I6VC 2NWGA 3GTQH 3TZDA 5JJZA 2HIXA 3CCVA 4A3BB 1C0AA 1SJHD 2K33A 1KDBA 1SSOA 4K0KQ 4QUCA 3M4OH 2CH4A 2PMZB 1QVGA 3HOZH 1OXVA 2NVXH 1LT3D 2KHJA 3S14B 4G7HC 4LWCA 4BS9A 3NWSA 1KTKA 1STNA 3X3NA 2F03A 3S1RB 3QIAA 4C3JG 1NR2A 2NVTH 1G2TA 4O2DA 1KIXA 2PNRC 2VZAA 2XWBB 4L63B 3W2DA 5IE8A 2B63G 5DAUA 1EY5A 1CKMA 1LTID 1SEBD 3MFYA 1NJIC 1F2YA 1EEFD 4DPGA 4U673 4GKJQ 2R92G 3STBD 4CDCC 4A3DG 4DR7L 5JEAJ 3BS1A 4MNOA 1OTCA 4S3SA 4DV1Q 1EIHA 4MHEA 4YHHL 1YNNC 5KEEA 2KCTA 2D5DA 5E4WC 3MXNA 4ZUJA 2A6ED 1W6KA 2F0QA 4IFDI 5M9OA 3PF4A 4P72A 2Q2TA 2NVQB 1VQJA 1PZKD 3S16H 2YTVA 2JA7G 1STYA 1TY2A 2X69A 5IT9E 4N9PA 4C56C 3F2CA 3UDIA 4HSVA 2WB1B 1A3UA 1XWEA 2P5ZX 1STBA 3L7ZC 1OXUA 1GUSA 2KUMA 5BN5A 3EROA 1XJVA 2K7VA 4DKAC 5KYLA 1PMRA 3EJIA 2CCZA 4DAYB 1V43A 3H3VC 1CKNA 1PA6A 2R93H 5JEAG 1WYDA 1KC8C 3A56A 4DV3Q 1KQSA 5KNCA 3J81c 1JOQA 1PRTB 4HJAA 5JPNC 3C46A 3S2HH 2RSNA 4POGA 1I5FA 5M3MH 3RN2A 4HIKA 2O4XA 1K8MA 1HXYD 2WAQG 3R8BA 1YHQA 2B2UA 1GD7A 4QUFA 4CDDC 2MHVA 3OIQA 1IHZA 1PH5A 4K8IA 4A93G 2GVAA 4B3RL 4YY3L 2JA6H 2K1BA 5COYA 2F0HA 1Y8NB 3A8IE 2F0FA 2QEJC 2K5NA 1EEID 1J8IA 2JXMB 3QG1A 4IUQA 1EQTA 1MIUA 2Q8IB 2DJGC 3HOWB 4XXEA 1P8LA 3NUCA 5M3FB 2Z0SA 4APVA 4DR5L 1PTOB 3BVZA 4KY7A 2X6GA 1VQAA 3GTOB 2PQAA 1L1OC 1X3EA 2IL8A 3I4NB 3EA6A 5EKIA 3BJUA 4NB3A 2F0MA 4A3IB 1D6EC 5CC4A 2B2VC 1ESRA 4X6AH 1SMYC 2F0LA 2HHHL 1I4GA 1ZEQX 1ZYRD 4I7ZC 5GQOA 2QA4A 3ITPA 1TS4A 2BCOA 3J7AF 4A3GG 5D65A 2VB2X 1Q46A 1IBKQ 1VQ6A 2A19A 1IYJB 1HPCA 1O7IA 3PGZA 2M9VA 2F1MA 4LW1A 2EXDA 4Z9CB 3J81j 2HD3A 2BDNA 1JB7A 1H9SA 2B8GA 3MEHA 4C1NI 2VQFL 1M4VA 1EQVA 3S17H 5C5MA 1Y1WH 2ES2A 1K8OA 1PRTF 4K5WA 4NXNL 3UDFA 3F2UA 5ELBA 3D4WA 1WTHA 1KL9A 5KNBA 3KYHC 1V8QA 3CCRA 5ELFA 2F0OA 3IL8A 3M4PA 2I5HA 3S1NH 4MTKA 1BNZA 4AYBB 4NXMQ 4OWWB 5J22A 3QOJA 1ASZA 5IWAQ 1EIGA 2K50A 3O13A 4BY7G 1S5DD 4HIDA 3KF8B 1F77A 1I94L 5K36G 3B6YA 4HJ9A 3DWAA 4LUZA 5JVG3 3MA2B 4X3SA 3CMAA 3I4MH 1KRSA 1JJGA 1H9KA 3HKZG 1IBMQ 1GUGA 4DR3Q 2IT1A 3TBIB 3H15A 1QWYA 1E1OA 3CC7A 2HDMA 5EQ0A 1IBLQ 2JEAI 2EYHA 1HTLD 3VR4A 2E2HH 1QZGA 1DONA 1DXMA 3NTIA 1N34Q 1SFOH 3CF5A 3MXNB 3OOCA 3RZDB 1W6JA 4XDXA 2EJMA 1A6XA 1SNCA 4LFCL 3K6OA 1TWHH 2F0WA 2VUMH 4PMBA 1TS3A 2L4NA 2NZ1D 4C2MH 3V05A 1IXRA 4TVAB 4RFBA 2LFNA 3PO3B 1UE6A 3J81L 1II3A 3WOEA 3A5UA 1DJRD 4RCOA 3K80C 2E2JB 4R8NA 2KQ3A 3RUZA 3CQZB 1Y8OB 3SVMA 2UXBQ 4DV7L 1RDPD 1X3FA 1Q1BA 4PZ6A 1AW7A 4GNXB 1O78A 1N32Q 3NXWA 4RCNA 1RHPA 5M5WB 3CKIB 2R7ZG 1G6ZA 1U4MA 1MJCA 4L8JA 3T51B 1SRUA 3M4QA 3HOUB 1SNDA 4DAMA 2OTLA 1HNWQ 1PH3A 2KHSA 1KNAA 1VMPA 3DM1A 5J3BA 5A2QL 2YYZA 4B3TL 2EY2A 2PZUA 4JW0A 5DLQE 2ALYB 1FJGQ 3TSSA 1EWHA 2Z8LA 3KDFB 2VXWA 4DV5Q 4IFDG 1GO3E 2JA5G 4KJOA 2EVBA 5GADC 2Z6KA 4B3SQ 2UUBL 1YNJD 4QMGA 1F9PA 2K03A 1K9MC 5JJIA 5IYDH 4RMFA 4JI6L 3SXHA 3A74A 3GTJB 1BF4A 4BXXH 1KXLA 2F0IA 2WINB 5IGCA 1VQHA 5D3IB 3A7LA 4TRDA 3CRLC 3J81i 1CQFA 3Q6SA 1VQMA 4FNFA 1EY8A 2MNAA 3GP7A 2YU9B 2A68D 5C44B 3QR8A 4KN7C 3GTQB 1Q8IA 2Y0SE 4HJ7A 4GOPC 3KLSA 5ISRA 1DGSA 3M4OB 2K75A 5CV7A 5C0XJ 2TMPA 3J7AV 3HOZB 2A8VA 2L15A 4ABNA 2NVXB 4NPSA 2JP1A 3AFPA 1VS0A 5FO7B 1HZAA 1TXYA 3AU7A 4JC0A 3GTGH 1JC7A 4DK3C 2NVTB 3SGIA 1FGUA 1JE4A 1YBYA 2KJXA 4EQPA 3CCMA 1SYFA 2NYZD 4LF7L 2K5WA 2KENA 2NUCA 5KRUA 4KI0A 4OXPA 4A3EH 1C7YA 2AQ3B 2VQEQ 2EIFA 2ZT9C 4G7OC 1XMQL 1VQCA 4QF4A 3WWVA 5I6WA 4XIGS 3FRPB 1BCPF 4QJFA 1YNXA 5EGTA 2E5LQ 4BY1G 2O2LD 3TN2A 2FINB 1PV4A 4DUZL 2JE6I 4LF8Q 1U4LA 3U9OA 3SEBA 5KGUA 1NR4A 1LV9A 4XYQA 2XRSD 4DK6C 4IQZA 3S16B 2PYKA 4GKKL 1HFGA 3I55A 5M3FH 1AE2A 1PH9A 1CK1A 1X3QA 4C3HG 1A0IA 5E3FA 2UXCQ 1B9NA 2FXQA 1YEZA 1EY7A 3VDYA 3CC2A 5BR8L 3K5MA 2A6HC 4A3MH 3EN2A 5IP7G 4YY3Q 1EZ8A 4LF9Q 1AH9A 5D14A 1AE3A 3MAQA 5FO8B 4BBRH 3SK6A 4GZYC 3SK4A 1HQRD 1WTXA 2R93B 2WKCA 3PUWA 5C4JH 3OWFA 3P75A 2O5IC 3MXGA 2XGTA 4JK1C 3S2HB 4DN4M 2KA7A 2F4VQ 2RF4A 5M3MB 1STAA 4OIJA 3A5ZB 4JI1L 3CD6A 4K6DA 3ER0A 3H0GG 1VQGA 2RHSB 2L12A 2IW3A 3VR5A 2NTTA 2RCFA 2Z9HA 4DR5Q 2JA6B 4UP9A 4A3CG 1QJOA 2L1BA 1MKHA 5FLMH 2RDGA 2A6HD 2OF1A 4GN4B 2F3IA 2LS01 5J39A 5AFWA 3TRZA 4JOIA 3RZOH 4P73A 2HHHQ 3I73A 1SNPA 4NMZA 4Q5VA 3HFZB 1VDZA 3SR1A 2H1EA 3R2TA 1NUCA 2RDFA 3M7GA 4ZLTF 4QB4A 5DM73 3MXPA 4BA1I 3MWYW 1CUKA 3R93A 2N8NA 2ICIA 4IZ8A 2F0DA 2C35B 1T5EA 1HHVA 2EYMA 1RODA 4DAYA 1VQKA 1WD1A 4CKCA 3VYRA 3J7YW 1PH8A 1WFQA 3M4YA 1HCZA 3T1HL 4JBKA 2IX1A 4J6HA 1L2FA 1I94Q 1I6HB 4B3ML 2GA4B 2EOTA 4DV4L 1PH4A 1K3RA 2NN6H 2G5DA 4EVOA 2VS1A 2I07B 1Y1WB 5CV5A 3OYYA 3PIO3 3F2BA 5LL6S 3I4OA 1CM9A 1CSQA 1E2ZA 2DJFC 1D2BA 4YCWA 1B44D 1C4QA 1YVCA 2E2IH 3S1NB 4LFBQ 2VUMG 3K58A 3PIPA 4KY6A 1EY4A 2AQ2B 4HMIA 4R1JA 2QILA 4ZKBB 4LFCQ 4J15A 1IW7D 4JI5L 4DR2L 3PUXA 2WFWA 1IZ6A 3EQLC 1SYDA 4GS3A 3NENA 4LFAQ 4A3BG 4JI7L 3I4MB 1QE6A 1ENFA 3T4AC 1BQQT 1LT5D 2PO4A 1PDQA 4Q0FA 2A74C 2CH4W 1HR0W 1AFPA 1QOHA 2B2UC 1RL2A 1BCPC 2C5CA 4I65A 1EYAA 4ZRZA 2E2HB 2D2CC 4LF4Q 1O7ZA 3K0XA 1B70B 4C1NK 1XNRL 1IYVA 5I2XA 1D5MC 2I0QA 2SDFA 5IGFA 4OONA 1EL0A 1UE1A 4KMUC 1N9WA 1BO0A 2ASBA 1PHJA 1Q90A 4NW2A 1SNMA 1TWHB 3NQIA 1EFID 1BOSA 1TS5A 2BA0A 3W3AA 4C2MB 4LAAA 4KN4C 4PQXA 1HR0L 4DR4L 4IJLA 4UHVA 1CHPD 1XNQL 3AMUA 3TS2A 4B3TQ 5FLXc 1SBBB 4DUYQ 2BE5D 1EWCA 4DV2Q 3NE5B 5GAEC 5E4XA 1D5ZC 4FF2A 1X54A 1EUJA 5IYDG 4IUTA 1Y1VH 1CT1D 1X65A 4BXXG 4ZAIA 2KCCA 4JV5L 1TVXA 4ZYSA 2A1AA 5LL6X 1UAPA 2G9HD 5IGGA 3K8AA 5G3LF 3GTPH 2Z1CA 4JI6Q 3J81E 4K8JA 4A3LH 2B2WA 1VQ9A 3TP8A 4CJ1B 1QCBD 3KF8A 4X3KA 5KIXA 3U50C 5IYBG 2WB1G 3D8GA 3H91A 5C4XB 1KAAA 1WTVA 3KJPA 1VMCA 3OTOL 1MD2D 4DK0A 3C2PA 4FF3A 1JJ2A 2E75C 2D0OA 3BZDB 3RMHA 4O0AA 2A5HA 1XTCD 1I4PA 4XYOA 4ULLA 3TEHB 3HOXH 1HFNA 5A2QE 4DV0L 4DXGA 3MXUA 3W1BA 5C3EH 4HJ5A 2JA8H 1GXDC 2L11A 2F0GA 1DOMA 3PIP3 2F4IA 5EBDA 1A3VA 3ND9A 3KJOA 4CBVA 1L0WA 1B4OA 2F0PA 4WORA 1LTRD 3FKIH 3D31A 4LF5L 1JJCB 5ELDA 4RKLA 3J7ZC 1D5XC 4GNXA 5IGBA 1AZPA 1YNND 3WDNA 3HOWG 1FL0A 3GTGB 2PNHA 2V4DA 1PH6A 5M3FG 1F9QA 2ZM6Q 1F9SA 4MN3A 3NP8A 4JI8L 4DV6Q 3RR5A 2I46A 2UUCL 1FNWA 2UUAL 2EZVA 5I9OA 4A3EB 3H3VH 4GKKQ 1A62A 5CBAE 3I4NG 2E8GA 4DR6L 3KDFA 3NQTA 2VW9A 1R4PB 3SK5A 4A3IG 3CCSA 1MSHA 3NBHB 2XWJB 5FKAC 5C0XH 3U9SA 1MBYA 3A7AB 5I9PA 2E74C 1MHWC 1JQYD 1GM5A 4YWKA 4FYDA 2FMMA 2Z6BA 4IPHA 1GUTA 1C9OA 1K0SA 1QB5D 3KLRA 1BDOA 1SE4A 2F0NA 1EIYB 5I6YA 1FNUA 2HQLA 3I91A 1YITA 1QUQB 2BH8A 1N36L 3ZJYC 4BBSH 1HNZL 2K52A 2PZWA 2PCFB 4ZKCB 5FLXL 4A3MB 2WV6D 2X6LA 4U68A 4AYBG 1WTQA 3JAML 5M5YH 3KBXA 4BBRB 1UEBA 1ICFB 3LX0A 4JVZA 2M2LA 4IO9A 3T1YL 1TWAB 2D0PA 3UI2A 2JA9A 2Z6KC 2RCNA 3C3LA 2HQEA 3M3YH 1QNKA 3L9AX 5C4JB 2B2TA 4A4IA 1VQIA 4QY7A 2KHIA 4M1UB 4KHPL 2Q2HA 2AUJD 4RGTA 5T1GA 2JK8A 1ESFA 1STEA 4UAIA 1GOZA 1I6HH 2AQ1B 2G9DA 4IN3A 1K28A 1E0BA 2GN5A 4NKLA 4DU9A 1MSGA 3K57A 5CMDA 5IY0A 3IAYA 3K59A 1BKBA 4IPCA 2Y0SB 1VQOA 1Q86C 1KLGD 4X65L 4OX9L 2HDLA 3G4SA 1A2UA 4A3KH 2V1CC 4JI3L 3PO2H 2L55A 3HS0C 3NEMA 1SMYD 3RZOB 2KCNA 2F0JA 3IKJA 4QIWB 4AQYQ 4MZ9A 3PO3G 3NHHA 2UU9Q 5ELCA 3NELA 4HCEA 4FO2A 3ULPA 1HJPA 1SR3A 5CBEE 1C8CA 4JYAL 1VCIA 3EVQA 2K14A 4X62L 4B3MQ 1IKMA 1TWCB 2VNUD 4XT1B 3H6MA 3K7UC 5EBCA 1QNUA 1Y69U 4JI4Q 4TQUS 4UPAA 2LXJA 5HY6A 1CTMA 2OEOA 4XQJA 1W3SA 2YTXA 1BBXC 2DNEA 5EKLA 3I72A 1PH1A 2CHBD 1PTOF 3HOUG 2ZJQA 5ELNA 1SXTA 2LSSA 1LT4D 1I4RA 1U4PA 2JN4A 1EYCA 4KKUA 2MQHA 4C3IH 1B3AA 5JPMC 3VR2A
chains in the Genus database with same CATH topology
1S5BD 1SJED 1G291 3G7LA 5A35A 4IFDJ 3MHBA 4L6TB 1D1IA 3OMCA 2ID0A 2C9OA 4OO1H 3S9WA 2ZXRA 3AB9A 2E2IB 4NDXA 1AEXA 2E76C 3T13A 2EPBA 4CHTB 2FMCA 1AZQA 4Y7NB 4V190 3MFGA 1GHKA 3T16A 4DF7A 1CI3M 4R8IA 5C3WA 2F3WA 1UUPA 1FR3A 2J4XA 3WOFA 4OO1I 4DNRB 2EJFC 3FEWX 5FO9B 2OXPA 4KV6A 2Q8RE 5CV9A 1G8ZD 2K28A 3I70A 1TS2A 3DMUA 2R3ZA 1CA6A 3OW7A 3MC0B 2FJ2A 2NBFA 2ZXOA 1EOTA 2BDOA 3OMGA 3HRZC 1Y1VB 3Q23A 3S1MB 3N6RA 4G4KA 4P2CB 2VB3X 4CGYB 2PPBC 3GTPB 4H44C 2KVMA 2R6GA 3I4LA 4O42A 4RHSA 1F2LA 1SYCA 1KLUD 1PRTC 4XT3B 1KABA 3K5OA 3MTSA 4EQNA 3NTHA 4DAPA 2A73B 3I3CA 3TP5A 4K5VA 4BA2I 3HOXB 4KTAA 1MGSA 5C3EB 2KEDA 1XYIA 2JA8B 1V1PB 3HEJA 1ENAA 1TR5A 4WJWA 1EU4A 2F0KA 4LK1C 5BN3A 4RAUC 4RKBA 3LWEA 5CV4A 3FKIB 1PTOC 4NP5A 1VF5C 2O5JC 1S5CD 2B2YA 5FK9C 3HG9A 3R3OA 3HOYB 5I2YA 2HUGA 5JEAH 5DM63 4N9TA 4KY5A 1JICA 4M8AA 2PZTA 1EYDA 1LLRD 1A2TA 3QWNA 1E2WA 3ERQA 1LACA 1QILA 4ZK9B 4XTCS 1XX8A 5IGDA 1F9RA 2SOBA 4ZQ3A 1PFNA 1Z7TA 1JOOA 1PZID 3KLSX 2LY7A 1DCZA 1TY0A 2FFKB 2DNCA 4DK1A 2B2WC 3Q24A 1SE2A 4BBSB 2MP1A 3BDOA 2CW0C 3D3RA 1ILQA 3NWTA 4HAEA 3IFTA 4CKBA 5M5YB 1BUVT 5HURA 2D9UA 3M3YB 3OHXC 1OXSC 1WTOA 4IALA 3TZUA 2RVLA 1H9JA 1Y8PB 3C1FA 3V96A 3OSOA 1CZGA 3GO5A 4TSSA 1L0YB 5FLXE 4F88A 1Z47A 1O80A 2IX3A 3JAME 2KOLA 3DHQA 1DZ1A 1S5FD 4KD4A 4R9WA 3RD4A 3FPUB 1ILPA 5EPJA 1Q1EA 1I4XA 1HRJA 3DEPA 3NBHA 4A3KB 3PO2B 4HR7B 2TSSA 4K14A 2IPKD 5K36H 4RGOS 2EJGC 1HTPA 5IOCA 1PYWD 5DEHA 4OO1G 3D4RA 5CR3A 1TQOA 1A15A 3L3OC 3X3MA 1SNOA 1BXTA 2NN6I 2DN8A 2ENBA 4WRDA 1JWUD 3GV3A 5BN4A 3BDCA 3G6JB 3K0YA 4ME5A 5CV8A 4C3IB 3E5SA 1S4ZA 3Q22A 4EGVA 4A3JB 3KBGA 1O7YA 3GQBA 2L0CA 1STGA 2Z4IA 2K32A 4DFAA 4K5XA 3DEOA 3PUVA 5F2DA 5C5LA 1H9RA 1BCPD 1LTTD 4HMJA 3P7JA 2XRQD 3VR6A 4A3FB 4O1NA 1Q12A 2EYJA 3Q0AA 2JYOA 2KEEA 1E2VA 1EY0A 2B2TC 3NSWA 1RTOA 1MI2A 4KJNA 4PMWA 5NUCA 4IFDH 4K6LA 1V1OA 1EZ6A 2A6EC 5CYUA 2RA4A 3HOVB 1T5XD 2QF7A 3OWEB 3D6CA 3VA7A 1LABA 1JB3A 2Z4HA 4G57A 4H7BA 4E6IA 2EY5A 3J80L 1WCMB 2ICEC 3PUYA 4ID6A 3SDZA 4IURA 5C4ZA 3VA5A 4KKTA 4CKEA 3S15B 3E0JA 2AWNA 3V2TA 4ODGA 4PMCA 1SYGA 2N88A 5IODA 3ZYYX 3KUPA 1FGBD 1CFMA 4C3JB 1LT6D 5K5PA 1RJTA 2K05A 2K5DA 2B63B 4H13C 5FOBB 3A8KE 1PFMA 5CGKA 3MVVA 2HCIA 3E6ZX 3D6WA 2R92B 2M00A 3HZXA 2LKVA 4A3DB 1I50B 4RWSC 1LO5D 1RKNA 3BVGA 4ZUIA 4OGQC 2QKIC 3QB3A 3T56B 1WVLA 1ML0D 3RLFA 3S1QB 3NBIA 2SEBD 2PW7A 1KDAA 1ZKOA 2JSOA 5CV6A 1TT2A 1OXTA 2JA7B 2WIIB 3GTMB 2EYOA 4J1MA 4FXDA 4HCSA 4RGNA 3EFXD 1ZYRC 1D1KA 1OO9B 4G7ZC 2MGSA 1GJXA 1DOKA 1TWFB 1B9MA 3BYTB 2QDBA 1ET6A 1C48A 1RCVD 2NB0A 1IL8A 3DWPA 5C0XI 1CHQD 2IWHA 1R9TB 4BWGB 1HQMC 2WAQB 2BOSA 3GTLB 2EY1A 2NVYB 4A93B 2KECA 5EPLA 2XNAC 4WFN3 1RF2D 5C4HA 2MPMA 4DGZA 2XN9C 2FHTA 1TU2B 4V0BA 1KDCA 1F2ZA 1BR9A 1LTGD 4CJ2C 3NK9A 5JVH3 1QG7A 1O7LA 1X3PA 5M5XB 4TKOB 4B9WA 2IX0A 3CHBD 2HCCA 2B8FA 5DNFA 2NN6G 4IUUA 1V1PA 3N52A 4RHRA 2AUKA 1K83B 1IYUA 3H94A 4CJ0B 1F2MA 2NTSA 2XIWA 3S2DB 2LMCB 2Q8TA 1SDFA 4X3TA 1R4QB 3P1HA 3VYTA 3VYUA 4A3GB 3LWUA 1EY9A 5G3LD 1I4HA 5TSSA 1OXXK 3BG3A 1CZWA 1GUWA 2EE1A 3ND8A 2RQXA 4KKSA 3FDTA 4FXGC 4OIKA 4B9XA 1G91A 3C1EA 2J0TD 2PW5A 1UNSA 3QJYA 2B2YC 4BY7B 3TMEA 1FNVA 1SAPA 1WD0A 1H9MA 1TWGB 2F0SA 1HUNA 1ICWA 2H4OA 2QCPX 1AP0A 1UEAB 4ILWA 1SYBA 3HKZB 4DXFA 3NTKA 5T1IA 3A54A 1YNJC 5I4DA 5C3XA 3VYSA 5EPKA 2K6AA 1L0XB 2F0VA 4FVMA 1I3QB 4KHVA 3SK8A 1B2TA 1CA5A 2K01A 2A68C 1DOLA 3K7AB 1BCPB 3DXJC 3P20A 3A55A 2B2VA 5IT9L 1LTSD 5JAVA 1WTRA 3BDLA 5KYIA 1TIID 2K5QA 1I4QA 2MUYA 1SNQA 1RD9D 1PZJD 2R7ZB 3FVQA 2WACA 1PXUA 2JEBI 3ONAB 1LTAD 4FF1A 1DYQA 4HN7A 2PQEA 4HTHA 1WTPA 1EY6A 4XQNA 1U4RA 2SNSA 3GTKB 2JA5B 4K2KA 4OL7A 3CU7A 2CVRA 1DM0B 4DNTB 2EYLA 1GUNA 4LJZC 3GV6A 3BYYB 1H9SB 1PFBA 3DUZA 1FYCA 1EU3A 1IKLA 3QO2A 1KNEA 3FMCA 4LMQD 5IIFA 1XXGA 2F0UA 1NAPA 4EQOA 1JWSD 3M85A 1M8AA 1NCVA 4DA2A 3BVMA 1PRTD 3I90A 5C0XG 2IJ0A 3HP3A 2A69C 1VF7A 5KNDA 3QOLA 1JORA 2AWOA 1X32A 3J80E 1A3TA 5JOBA 2EYFA 4MIUA 2XVSA 2D62A 3K5LA 1PTOH 4QCLA 4X3UA 5E1FA 1S5ED 3PUZA 4IUNA 1B1ZA 2BA1A 5C6AA 2L9HA 3NPPA 4KK7A 4K2LA 1JR0D 4F87A 4BY1B 3CRKC 2XSCA 2EYPA 1PTOD 2A69D 1PLFA 1HUMA 3SHLA 2WKDA 1JOKA 5HGTA 2J7ZA 1Z6HA 2B39A 3OIPA 4PV1C 4C3HB 2WP8J 4F7XA 2MJ8A 3FPPA 3SE0A 4YIJA 3PV0A 1B53A 4FF4A 2DY8A 1NSNS 3I8ZA 1G2SA 3KK7A 4RH6A 1CQVA 2DY7A 1TKWB 1GHJA 5EJWA 2SNMA 4HSPA 1WTWA 4FP5D 3M7NA 3LNNA 3H0GB 5J1ZA 1HA6A 4DAVA 1FD7D 4IUPA 2N55A 4FXKC 4IUVA 3MZ5A 3D4DA 1HA5A 1GUOA 3R2IA 3VR3A 2CW0D 3HGBA 3H09A 1IW7C 3URYA 2L5TA 1J9OA 1JCKB 1ZXTA 5CORA 4C3IG 3K5NA 4B08A 2E2DC 2R61A 5ELEA 2OT2A 4PNYA 3S17B 3TP6A 1AN8A 4RGMA 2F0EA 4J8QA 1DD2A 2RKSA 5D3DA 4KHZA 2EY6A 3DWQA 2RSOA 2RDHA 1SE3A 3TP7A 1SYEA 1ET9A 4F8MA 3GD7A 3OPOA 4RA8A 2BE5C 4OHJA 4JBWA 2F0TA 4KD3A 1LTBD 1U9RA 2EXZA 4XQQA 1Q3LA 3T53B 1SFOB 3PMFA 3A8JE 1RTNA 4HEDA 5LHY1 1ONLA 1STHA 2EDGA 2RBMA 3IFDA 1B50A 2VUMB 2ZXPA 1ENCA 2F3VA 5IGEA 2K04A 2CQAA 5EKKA 3TDQA 4UDUC 1JWMD 4H0LC 1I6VC 2NWGA 3TZDA 5JJZA 4A3BB 1SJHD 2K33A 1KDBA 1SSOA 4QUCA 2PMZB 1OXVA 1LT3D 3S14B 4G7HC 4BS9A 3NWSA 1KTKA 1STNA 3X3NA 2F03A 3S1RB 3QIAA 4C3JG 1NR2A 1G2TA 2PNRC 2XWBB 3W2DA 4L63B 5DAUA 1EY5A 1LTID 1SEBD 3MFYA 1F2YA 1EEFD 4U673 5JEAJ 3BS1A 4S3SA 1EIHA 4MHEA 1YNNC 5KEEA 2D5DA 5E4WC 3MXNA 4ZUJA 2A6ED 1W6KA 2F0QA 4IFDI 5M9OA 2NVQB 1PZKD 1STYA 1TY2A 2X69A 5IT9E 4N9PA 4C56C 4HSVA 2WB1B 1A3UA 1XWEA 1STBA 3L7ZC 1OXUA 1GUSA 2KUMA 5BN5A 3EROA 2K7VA 5KYLA 1PMRA 3EJIA 1V43A 3H3VC 5JEAG 3A56A 5KNCA 1JOQA 1PRTB 5JPNC 3C46A 2RSNA 2O4XA 1K8MA 1HXYD 3R8BA 2B2UA 4QUFA 2MHVA 3OIQA 1IHZA 4K8IA 2K1BA 5COYA 2F0HA 1Y8NB 3A8IE 2F0FA 2QEJC 1EEID 1J8IA 2JXMB 3QG1A 4IUQA 1EQTA 2Q8IB 3HOWB 4XXEA 3NUCA 5M3FB 1PTOB 3BVZA 4KY7A 2X6GA 3GTOB 2IL8A 3I4NB 3EA6A 5EKIA 2F0MA 4A3IB 1D6EC 5CC4A 2B2VC 1ESRA 1SMYC 2F0LA 1I4GA 1ZEQX 1ZYRD 4I7ZC 3ITPA 1TS4A 2BCOA 3J7AF 5D65A 2VB2X 1HPCA 2M9VA 2F1MA 4Z9CB 2BDNA 1H9SA 2B8GA 3MEHA 4C1NI 1M4VA 1EQVA 5C5MA 1K8OA 1PRTF 4K5WA 3F2UA 5ELBA 3D4WA 5KNBA 1V8QA 5ELFA 2F0OA 3IL8A 1BNZA 4AYBB 5J22A 3QOJA 1EIGA 3O13A 1S5DD 1F77A 5K36G 3DWAA 5JVG3 3MA2B 4X3SA 1H9KA 1GUGA 2IT1A 3TBIB 1QWYA 2HDMA 5EQ0A 2JEAI 2EYHA 1HTLD 3VR4A 1DONA 1DXMA 3NTIA 3OOCA 3RZDB 1W6JA 4XDXA 2EJMA 1A6XA 1SNCA 3K6OA 2F0WA 4PMBA 1TS3A 2L4NA 2NZ1D 3V05A 4RFBA 2LFNA 3PO3B 3J81L 1II3A 3WOEA 1DJRD 4RCOA 2E2JB 4R8NA 2KQ3A 3RUZA 3CQZB 1Y8OB 3SVMA 1RDPD 1Q1BA 1AW7A 1O78A 3NXWA 4RCNA 1RHPA 5M5WB 3CKIB 1G6ZA 1U4MA 4L8JA 3T51B 3HOUB 1SNDA 2KHSA 1KNAA 1VMPA 3DM1A 5A2QL 2YYZA 2EY2A 2PZUA 3TSSA 1EWHA 2Z8LA 2VXWA 4IFDG 4KJOA 2EVBA 1YNJD 4QMGA 1F9PA 2K03A 3SXHA 3GTJB 1BF4A 2F0IA 2WINB 5IGCA 5D3IB 3A7LA 4TRDA 3CRLC 1CQFA 3Q6SA 4FNFA 1EY8A 3GP7A 2YU9B 2A68D 5C44B 4KN7C 3GTQB 1Q8IA 3KLSA 5ISRA 3M4OB 5CV7A 5C0XJ 2TMPA 3J7AV 3HOZB 4ABNA 2NVXB 2JP1A 5FO7B 3AU7A 1JC7A 2NVTB 1JE4A 2KJXA 4EQPA 1SYFA 2NYZD 2K5WA 2NUCA 5KRUA 4KI0A 2AQ3B 2ZT9C 4G7OC 4QF4A 5I6WA 4XIGS 3FRPB 1BCPF 5EGTA 2O2LD 3TN2A 2FINB 2JE6I 1U4LA 5KGUA 3SEBA 3U9OA 1NR4A 1LV9A 4XYQA 2XRSD 4IQZA 3S16B 2PYKA 1HFGA 1CK1A 1X3QA 4C3HG 5E3FA 1B9NA 1EY7A 3K5MA 2A6HC 1EZ8A 5D14A 3MAQA 5FO8B 3SK6A 4GZYC 3SK4A 1HQRD 1WTXA 2R93B 2WKCA 3PUWA 3OWFA 3P75A 2O5IC 3MXGA 4JK1C 3S2HB 4DN4M 2KA7A 5M3MB 1STAA 4OIJA 4K6DA 2L12A 2IW3A 3VR5A 2NTTA 2JA6B 1QJOA 2L1BA 2RDGA 2A6HD 2OF1A 2LS01 5J39A 5AFWA 3I73A 1SNPA 4NMZA 4Q5VA 1VDZA 3SR1A 2H1EA 3R2TA 1NUCA 2RDFA 3M7GA 4ZLTF 4QB4A 5DM73 3MXPA 4BA1I 3MWYW 3R93A 2ICIA 4IZ8A 2F0DA 1T5EA 1HHVA 2EYMA 1RODA 4DAYA 1WD1A 4CKCA 3VYRA 3J7YW 3M4YA 1HCZA 2IX1A 4J6HA 1I6HB 2GA4B 2EOTA 2NN6H 4EVOA 2I07B 1Y1WB 5CV5A 3PIO3 5LL6S 1CM9A 1E2ZA 1D2BA 1B44D 1C4QA 3S1NB 3K58A 4KY6A 1EY4A 2AQ2B 4HMIA 2QILA 4ZKBB 1IW7D 3PUXA 3EQLC 1SYDA 3I4MB 1QE6A 1ENFA 3T4AC 1BQQT 1LT5D 2PO4A 1PDQA 4Q0FA 2A74C 1AFPA 1QOHA 2B2UC 1BCPC 2C5CA 4I65A 1EYAA 4ZRZA 2E2HB 2D2CC 1O7ZA 4C1NK 1IYVA 5I2XA 1D5MC 2SDFA 5IGFA 1EL0A 4KMUC 1BO0A 1Q90A 4NW2A 1SNMA 1TWHB 3NQIA 1EFID 1BOSA 1TS5A 2BA0A 3W3AA 4C2MB 4LAAA 4KN4C 4PQXA 1CHPD 3AMUA 1SBBB 2BE5D 1EWCA 3NE5B 5E4XA 1D5ZC 4FF2A 4IUTA 1CT1D 4ZAIA 2KCCA 1TVXA 4ZYSA 5LL6X 1UAPA 2G9HD 5IGGA 5G3LF 2Z1CA 3J81E 4K8JA 2B2WA 3TP8A 4CJ1B 1QCBD 3KF8A 4X3KA 5KIXA 3D8GA 3H91A 5C4XB 1KAAA 1WTVA 1VMCA 1MD2D 4DK0A 3C2PA 4FF3A 2E75C 3BZDB 3RMHA 2A5HA 1XTCD 1I4PA 4XYOA 4ULLA 1HFNA 5A2QE 4DXGA 3MXUA 1GXDC 2L11A 2F0GA 1DOMA 3PIP3 2F4IA 5EBDA 1A3VA 3ND9A 4CBVA 1B4OA 2F0PA 4WORA 1LTRD 3D31A 5ELDA 4RKLA 1D5XC 5IGBA 1AZPA 1YNND 3WDNA 3GTGB 2V4DA 1F9QA 1F9SA 4MN3A 3NP8A 2I46A 1FNWA 2EZVA 5I9OA 4A3EB 5CBAE 3NQTA 1R4PB 3SK5A 1MSHA 2XWJB 5FKAC 5C0XH 3U9SA 1MBYA 3A7AB 5I9PA 2E74C 1JQYD 4FYDA 2FMMA 1GUTA 1QB5D 3KLRA 1BDOA 1SE4A 2F0NA 5I6YA 1FNUA 3I91A 2PZWA 2PCFB 4ZKCB 5FLXL 4A3MB 2WV6D 2X6LA 4U68A 1WTQA 3JAML 3KBXA 4BBRB 3LX0A 2M2LA 1TWAB 3UI2A 3C3LA 2HQEA 1QNKA 3L9AX 5C4JB 2B2TA 4M1UB 2AUJD 4RGTA 5T1GA 4UAIA 1ESFA 1STEA 1GOZA 2AQ1B 2G9DA 4IN3A 1E0BA 4NKLA 4DU9A 1MSGA 3K57A 5CMDA 3IAYA 3K59A 2Y0SB 1KLGD 2HDLA 1A2UA 2L55A 3HS0C 3RZOB 1SMYD 2KCNA 2F0JA 3IKJA 4QIWB 3NHHA 5ELCA 4HCEA 4FO2A 5CBEE 1C8CA 1VCIA 3EVQA 1IKMA 1TWCB 2VNUD 4XT1B 3H6MA 5EBCA 1QNUA 1Y69U 4TQUS 1CTMA 2OEOA 4XQJA 1BBXC 2DNEA 5EKLA 3I72A 2CHBD 1PTOF 1SXTA 1LT4D 1I4RA 1U4PA 1EYCA 4KKUA 1B3AA 5JPMC 3VR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  4L8J A;  3T51 B;  4DK1 A;  3KLR A;  2K32 A;  1BDO A;  4I7Z C;  2AUK A;  1G29 1;  2A6E D;  1IYU A;  3M4Y A;  3H94 A;  1HCZ A;  5A35 A;  3PUV A;  4IQZ A;  1HPC A;  4OGQ C;  3CRK C;  2F1M A;  2YYZ A;  1H9R A;  2A69 D;  2LMC B;  3BDO A;  2CW0 C;  4OO1 H;  2NN6 H;  1H9S A;  2B8G A;  3IFT A;  1EWH A;  1B9N A;  3GD7 A;  3OPO A;  3T56 B;  3AB9 A;  2PCF B;  3RLF A;  3VR6 A;  2JEB I;  1K8O A;  1E2Z A;  3LWU A;  4DK0 A;  2BE5 C;  1Q12 A;  1Z6H A;  4BA2 I;  2A6H C;  4IFD G;  2E75 C;  1ZKO A;  3L7Z C;  1OXU A;  1OXX K;  4JBW A;  5KNB A;  1GUS A;  2E76 C;  2EVB A;  3BG3 A;  4PV1 C;  1OXT A;  2D5D A;  1V8Q A;  5BN5 A;  1OXS C;  3TZU A;  2K7V A;  1H9J A;  1E2V A;  4GZY C;  1Y8P B;  3T53 B;  1PMR A;  3MXU A;  3FPP A;  3PUW A;  3SE0 A;  3A8J E;  1V43 A;  2AUJ D;  3ND8 A;  1IW7 D;  2O5I C;  3A7L A;  1GHK A;  3PUX A;  1ONL A;  2EDG A;  3CRL C;  3PV0 A;  3EQL C;  1ZYR C;  4KKS A;  4JK1 C;  2KA7 A;  5JEA G;  1CI3 M;  4IFD H;  5K36 G;  2A6E C;  5KNC A;  3ND9 A;  4G7Z C;  1GJX A;  1GUT A;  1B9M A;  2A68 D;  4LK1 C;  4DNT B;  5BN3 A;  4KN7 C;  1GUN A;  1Q1E A;  4LJZ C;  1K8M A;  1VF5 C;  1FR3 A;  2QF7 A;  1H9K A;  3VR5 A;  4H0L C;  1H9S B;  3QJY A;  2O5J C;  3VA7 A;  1LAB A;  1GUG A;  1I6V C;  4DNR B;  2IT1 A;  2EJF C;  1QJO A;  1TKW B;  1GHJ A;  1FYC A;  3D31 A;  2D2C C;  4HR7 B;  1H9M A;  2K33 A;  2JEA I;  3M7N A;  3LNN A;  5JEA H;  2A6H D;  3VR4 A;  3FMC A;  1IYV A;  5K36 H;  1HQM C;  1DXM A;  3PUY A;  2EJG C;  3WDN A;  1HTP A;  4KMU C;  3IKJ A;  3SDZ A;  1OXV A;  2V4D A;  3OOC A;  1Q90 A;  1Y8N B;  1YNJ C;  2EJM A;  3M85 A;  4OO1 G;  3A8I E;  1A6X A;  4G7H C;  1E2W A;  3D4R A;  2JXM B;  3I73 A;  1GUO A;  2BA0 A;  3QG1 A;  3W3A A;  4KKT A;  4KN4 C;  1LAC A;  3VR3 A;  2Q8I B;  3OW7 A;  4KHZ A;  3HGB A;  5C0X G;  3QIA A;  4XTC S;  2A69 C;  1IW7 C;  1VCI A;  1VF7 A;  1VDZ A;  1TU2 B;  2BDO A;  2L5T A;  5KND A;  2NN6 I;  2AWO A;  2PNR C;  4KI0 A;  1Y69 U;  2DN8 A;  4BA1 I;  4TQU S;  2ZT9 C;  2BE5 D;  4G7O C;  2A68 C;  3N6R A;  3NE5 B;  1CTM A;  3MFY A;  1O7L A;  1CFM A;  3DXJ C;  2DNE A;  1Z7T A;  3I72 A;  5BN4 A;  2D62 A;  4TKO B;  4XIG S;  5C0X H;  1Y8O B;  3U9S A;  1T5E A;  2B8F A;  3A7A B;  3P20 A;  2PPB C;  2E74 C;  2NN6 G;  3PUZ A;  3VR2 A;  1Q1B A;  2KCC A;  4KKU A;  1O78 A;  1DCZ A;  4H44 C;  4H13 C;  4RCN A;  2BA1 A;  2R6G A;  3A8K E;  3GQB A;  1DD2 A;  1YNN C;  3I4L A;  1SMY C;  2DNC A; 
#chains in the Genus database with same CATH topology
 2UXD Q;  1B7Y B;  1YJN A;  4N8F A;  4A3J H;  5E7N A;  1S5B D;  1SJE D;  1G29 1;  3G7L A;  4JI5 Q;  5A35 A;  4IFD J;  3MHB A;  4L6T B;  1M90 C;  1VQP A;  1D1I A;  3OMC A;  2ID0 A;  2C9O A;  4X64 L;  4OO1 H;  3S9W A;  1YIJ A;  2ZXR A;  3KLW A;  1D7Q A;  3AB9 A;  4A75 A;  2E2I B;  2ZJR A;  4NDX A;  1AEX A;  4CDF C;  4A3F H;  2E76 C;  3T13 A;  2QGQ A;  2EPB A;  4R4T A;  4CHT B;  1E22 A;  2FMC A;  1AZQ A;  5C44 G;  1VQN A;  4Y7N B;  1BBU A;  4V19 0;  3MFG A;  1GHK A;  3T16 A;  1HNX L;  1HR0 Q;  4RG1 A;  4DF7 A;  4DR4 Q;  1CI3 M;  5C4X H;  4R8I A;  1XNQ Q;  3I56 A;  3HOZ G;  5C3W A;  5LMN L;  2F3W A;  1UUP A;  1FR3 A;  2J4X A;  3WOF A;  4OO1 I;  2OTJ A;  4IOC A;  4DNR B;  2EJF C;  1WI5 A;  3FEW X;  5FO9 B;  3K81 C;  2OXP A;  2WAQ E;  4KV6 A;  2Q8R E;  5CV9 A;  1L1O A;  4FDB A;  1G8Z D;  2K28 A;  4JV5 Q;  4K0K L;  3I70 A;  1WCM H;  4JI2 L;  1YZ6 A;  2IY5 B;  4JOI C;  1TS2 A;  3DMU A;  1SLJ A;  2R3Z A;  1CA6 A;  3OW7 A;  1J5E L;  3MC0 B;  2FJ2 A;  1K73 C;  2NBF A;  2ZXO A;  1EOT A;  2KCM A;  2BDO A;  2JJQ A;  3OMG A;  3CXC A;  1XPO A;  3HRZ C;  3OTO Q;  1Y1V B;  3Q23 A;  3S1M B;  3N6R A;  4G4K A;  4IPG A;  4DR7 Q;  4UP8 A;  4P2C B;  4QIW E;  2BH2 A;  2VB3 X;  2H5X A;  4CGY B;  4C3J H;  4YHH Q;  2B29 A;  2PPB C;  3GTP B;  2ATW A;  3U4Z A;  4H44 C;  2KVM A;  2R6G A;  3I4L A;  4O42 A;  2B63 H;  4RHS A;  1W2B A;  1LM0 A;  1F2L A;  1SYC A;  4GN3 B;  1KLU D;  2R92 H;  3L0O A;  1PRT C;  3BU2 A;  4A3D H;  4XT3 B;  1I50 H;  1KAB A;  3K5O A;  3MTS A;  4EQN A;  1T9H A;  1PH2 A;  3NTH A;  4DAP A;  2A73 B;  3I3C A;  3TP5 A;  4K5V A;  3CCU A;  2R93 G;  1SN8 A;  4BA2 I;  4LF5 Q;  3HOX B;  3S1Q H;  4KTA A;  1MGS A;  4UY8 C;  5C3E B;  2KED A;  5M3M G;  4JG2 A;  2JA7 H;  1XYI A;  2JA8 B;  1V1P B;  3GTM H;  3HEJ A;  2JA6 G;  1ENA A;  2UUC Q;  4P75 A;  1TR5 A;  4WJW A;  1EU4 A;  2F0K A;  1XTD A;  4LK1 C;  4RAU C;  4RKB A;  5BN3 A;  3LWE A;  4DR6 Q;  5CV4 A;  3FKI B;  1PTO C;  1VF5 C;  4NP5 A;  4B3R Q;  2O5J C;  1S5C D;  1TWF H;  2B2Y A;  5FK9 C;  3HG9 A;  3R3O A;  3HOY B;  5I2Y A;  2HUG A;  5JEA H;  5DM6 3;  3HKZ E;  4N9T A;  1TWA H;  4KY5 A;  1JIC A;  4M8A A;  2PZT A;  1EYD A;  4UP7 A;  1LLR D;  4JI0 L;  4H02 A;  1EIF A;  1R9T H;  3CCL A;  1A2T A;  3QWN A;  3GTL H;  4OEM B;  1E2W A;  2NVY H;  4P71 A;  3ERQ A;  1LAC A;  4A93 H;  1QIL A;  4ZK9 B;  4XTC S;  1XX8 A;  1YI2 A;  1G6P A;  5IGD A;  1SMX A;  1F9R A;  4HIM A;  2SOB A;  4ZQ3 A;  1PFN A;  1VQB A;  1Z7T A;  1JOO A;  2NZO A;  1PZI D;  4HIO A;  3T1Y Q;  3KLS X;  4YWM A;  2LY7 A;  1DCZ A;  1TY0 A;  1EOV A;  2FFK B;  2DNC A;  3U58 A;  1Y1W G;  4DK1 A;  2B2W C;  3Q24 A;  1PYB A;  4KHP Q;  1SE2 A;  4BBS B;  2VQF Q;  1TWC H;  1K83 H;  2MP1 A;  3BDO A;  2CW0 C;  2CWP A;  3D3R A;  1ILQ A;  3NWT A;  4HAE A;  4PZ7 A;  3IFT A;  3S2D H;  4CKB A;  3BZK A;  4EX5 A;  3F1Z A;  4NXN Q;  2IHE A;  5GRO A;  5M5Y B;  1BUV T;  4X65 Q;  5HUR A;  3J80 c;  1L1O B;  2D9U A;  3M3Y B;  3OHX C;  1JE5 A;  4JI3 Q;  1V9P A;  1OXS C;  1WTO A;  4IAL A;  3TZU A;  2RVL A;  1H9J A;  3I4M G;  1Y8P B;  3C1F A;  3V96 A;  3OSO A;  1CZG A;  3GO5 A;  4TSS A;  3CAM A;  1L0Y B;  5FLX E;  3DM3 A;  4F88 A;  1Z47 A;  1O80 A;  2IX3 A;  4NXM L;  3JAM E;  2KOL A;  3DHQ A;  1DZ1 A;  3UE1 A;  1S5F D;  4KD4 A;  4R9W A;  3RD4 A;  3FPU B;  3HKS A;  1ILP A;  5EPJ A;  1Q1E A;  1I4X A;  2I5L X;  3AYH B;  1VQE A;  1HRJ A;  3EBE A;  3DEP A;  3NBH A;  4A3K B;  3PO2 B;  4HR7 B;  1GKH A;  2TSS A;  1NNX A;  1VQ7 A;  1IBM L;  1B3Q A;  4K14 A;  2ZTD A;  1LYL A;  2IPK D;  5K36 H;  1TWG H;  4GNX C;  4RGO S;  1IBL L;  2EJG C;  4GLX A;  1HTP A;  1QVC A;  5IOC A;  4LF6 L;  2QW7 A;  4ZCK A;  1PYW D;  5DEH A;  4Y7N H;  4OO1 G;  3D4R A;  1N34 L;  3U4V A;  5CR3 A;  2N49 A;  1TQO A;  1A15 A;  3L3O C;  1UE5 A;  1QUQ A;  3X3M A;  1IL2 A;  4X64 Q;  1SNO A;  1BXT A;  2NN6 I;  4LUV A;  2DN8 A;  2ENB A;  2R7D A;  4WRD A;  1JWU D;  1I3Q H;  4X66 L;  4DV7 Q;  3GV3 A;  5BN4 A;  3PCO B;  3BDC A;  3K7A H;  3G6J B;  3K0Y A;  4ME5 A;  5CV8 A;  4C3I B;  3CPW A;  3E5S A;  1S4Z A;  3Q22 A;  4EGV A;  4A3J B;  3KBG A;  5C4X G;  1O7Y A;  3GQB A;  2UXB L;  2HIV A;  2L0C A;  5LMU L;  1STG A;  2Z4I A;  2K32 A;  3F8T A;  4DFA A;  1N32 L;  4PZ8 A;  4K5X A;  3DEO A;  3PUV A;  1HNX Q;  4IPD A;  5F2D A;  5C5L A;  1Q82 C;  4GLV B;  3JAM c;  1H9R A;  1HNW L;  1BCP D;  1H95 A;  1LTT D;  3S1M H;  4HMJ A;  3P7J A;  1K3B C;  2XRQ D;  2R7Z H;  3VR6 A;  3BZC A;  4A3F B;  3TQY A;  4O1N A;  2GVB A;  1FJG L;  1Q12 A;  2UUB Q;  2EYJ A;  4POF A;  3Q0A A;  2JYO A;  2KEE A;  3PQI A;  4DV5 L;  1S72 A;  3STB C;  1YJ9 A;  1E2V A;  3CCE A;  2VL6 A;  3Q8D A;  3CC4 A;  3TRE A;  1EY0 A;  2B2T C;  3NSW A;  2YV5 A;  1VQF A;  4B3S L;  4JI2 Q;  3RN5 A;  1RTO A;  1MI2 A;  4KJN A;  4PMW A;  2B3G A;  5NUC A;  4IFD H;  4K6L A;  1V1O A;  1J5E Q;  3GTK H;  1EZ6 A;  2A6E C;  5CYU A;  2JA5 H;  3UE0 A;  2RA4 A;  5FJ8 H;  3HOV B;  1FVI A;  1T5X D;  2NZH A;  2ZTE A;  2QF7 A;  3OWE B;  3D6C A;  3UDX A;  3VA7 A;  1LAB A;  1X9N A;  4WJ4 A;  1JB3 A;  2Z4H A;  4P74 A;  4G57 A;  4H7B A;  2MFI A;  4E6I A;  2EY5 A;  3J80 L;  1WCM B;  2ICE C;  3PUY A;  3RLO A;  4ID6 A;  4A3E G;  3SDZ A;  5IYC H;  2AHO B;  4OWX B;  1VQ4 A;  4IUR A;  5C4Z A;  3VA5 A;  2N3S A;  1CKO A;  1JT8 A;  4KKT A;  4LF7 Q;  4CKE A;  3S15 B;  3E0J A;  2AWN A;  3V2T A;  2PI2 E;  3DLL A;  4ODG A;  4PMC A;  5AJ3 L;  1XMQ Q;  1SYG A;  3KF6 B;  1HH2 P;  1M1K C;  2N88 A;  5IOD A;  3ZYY X;  3KUP A;  4I7A A;  3HOY H;  1FGB D;  4GOP B;  4ME3 A;  1CFM A;  4C3J B;  3W5O A;  2VQE L;  1LT6 D;  5K5P A;  1RJT A;  2K05 A;  2K5D A;  4DUZ Q;  2B63 B;  4H13 C;  5FOB B;  3A8K E;  1PFM A;  5CGK A;  1EWI A;  3MVV A;  2HCI A;  2LXK A;  3E6Z X;  3D6W A;  2R92 B;  1YJW A;  2M00 A;  3HZX A;  2E5L L;  2LKV A;  4A3D B;  4L5S A;  1I50 B;  4YCV A;  4A3M G;  4RWS C;  1LO5 D;  1RKN A;  1U0L A;  3BVG A;  4ZUI A;  4LF8 L;  3KOJ A;  4OGQ C;  4AH6 A;  4BBR G;  3FP9 A;  1WOC A;  2QKI C;  5BR8 Q;  3E0E A;  4BY1 H;  3QB3 A;  3T56 B;  1WVL A;  1ML0 D;  3E3X A;  3RLF A;  1S3O A;  3S1Q B;  1WJJ A;  3LGJ A;  3NBI A;  3J80 i;  2SEB D;  3J7A 5;  2PW7 A;  2UXC L;  2K4K A;  1KDA A;  1ZKO A;  2JSO A;  5CV6 A;  1TT2 A;  1PYS B;  1OXT A;  2JA7 B;  2WII B;  4JI0 Q;  3GTM B;  4C3H H;  1HZ9 A;  4A76 A;  4LF9 L;  2EYO A;  4J1M A;  1KAW A;  4JI1 Q;  5IP9 H;  5FLM G;  2Q2U A;  4FXD A;  5EAY A;  4HCS A;  4RGN A;  2Y0S G;  3EFX D;  1D8L A;  1ZYR C;  5IP7 H;  1D1K A;  1OO9 B;  3H3V I;  4G7Z C;  2MGS A;  1VQ8 A;  3F2D A;  1DOK A;  1GJX A;  1KRT A;  1TWF B;  1B9M A;  3BYT B;  2QDB A;  1NMF A;  1ET6 A;  2F4V L;  1C48 A;  1RCV D;  2I5M X;  2HT1 A;  1N8R C;  2NB0 A;  1K8A C;  1IL8 A;  3DWP A;  2PMZ E;  5C0X I;  1CHQ D;  1X6O A;  2IWH A;  4BWG B;  5IT9 c;  1HQM C;  1R9T B;  2WAQ B;  2BOS A;  3GTL B;  2EY1 A;  3H0G H;  1Q81 C;  2NVY B;  4A93 B;  2KEC A;  5EPL A;  2XNA C;  4WFN 3;  1J6Q A;  1RF2 D;  4A3C H;  5C4H A;  2CFM A;  2DUD A;  5HGQ A;  1Y14 B;  2MPM A;  4DGZ A;  1K8G A;  2XN9 C;  2FHT A;  4PG3 A;  1TU2 B;  4V0B A;  1KDC A;  1EQR A;  3G71 A;  1F2Z A;  1BR9 A;  1LTG D;  3S24 A;  5L37 A;  4CJ2 C;  3A0J A;  3NK9 A;  3GDE A;  5JVH 3;  1QG7 A;  1N33 L;  1O7L A;  1X3P A;  1NY4 A;  4TKO B;  5M5X B;  4B9W A;  2IX0 A;  2K5H A;  3CHB D;  3G6E A;  2HCC A;  2B8F A;  4QL5 A;  5DNF A;  1Q7Y C;  2NN6 G;  1GVP A;  3PF5 A;  3ULL A;  2ZTC A;  4IUU A;  1V1P A;  3OW2 A;  3TS0 A;  2OCE A;  1XPR A;  3T1H Q;  3N52 A;  4GLA C;  4RHR A;  4CDE C;  2AUK A;  4KLK A;  1K83 B;  1IYU A;  4DV4 Q;  3H94 A;  4CJ0 B;  3JAM i;  1F2M A;  2NTS A;  2XIW A;  3S2D B;  2OQK A;  4OEL B;  2LMC B;  1KD1 C;  2Q8T A;  1UWV A;  1SDF A;  4X3T A;  1VQD A;  1R4Q B;  2WB1 E;  3P1H A;  3VYT A;  2ZJP A;  3VYU A;  4A3G B;  3LWU A;  1EY9 A;  5G3L D;  1I4H A;  1K0R A;  5TSS A;  1OXX K;  3BG3 A;  1S40 A;  1CZW A;  3CPF A;  4LF6 Q;  2R7F A;  4DR2 Q;  1GUW A;  1VQL A;  3CME A;  4LFB L;  4JI7 Q;  2EE1 A;  4YWL A;  3ND8 A;  4ALP A;  2RQX A;  1PH7 A;  4KKS A;  3FDT A;  4FXG C;  4OIK A;  4B9X A;  1G91 A;  3CW2 C;  3FHW A;  1EQQ A;  4LFA L;  4JBJ A;  5LMN W;  4AIM A;  3C1E A;  2J0T D;  2PW5 A;  1UNS A;  4GN5 A;  3QJY A;  4WJ3 M;  1XNR Q;  2B2Y C;  4BY7 B;  1PFS A;  1LTL A;  3TME A;  1FNV A;  1SAP A;  4X66 Q;  2QDL A;  1XMO L;  1WD0 A;  1H9M A;  1V1Q A;  1TWG B;  2F0S A;  1HUN A;  4A3B H;  2QEX A;  1ICW A;  1YHB A;  2H4O A;  2QCP X;  1AP0 A;  1UEA B;  1PVO A;  4ILW A;  4LF4 L;  1SYB A;  3HKZ B;  4DXF A;  3NTK A;  1NE3 A;  5T1I A;  3A54 A;  1YNJ C;  5I4D A;  5C3X A;  5LMU Q;  3VYS A;  1Y1V G;  4R4I A;  5EPK A;  1E24 A;  1CKN B;  3S14 H;  3S1R H;  2K6A A;  1L0X B;  5GAH C;  5ELO A;  3HOV H;  2F0V A;  1A8V A;  4FVM A;  1I3Q B;  4KHV A;  3SK8 A;  1B2T A;  4A3L G;  1CA5 A;  1CSP A;  2K01 A;  2A68 C;  4DR1 L;  1DOL A;  3K7A B;  1BCP B;  3DXJ C;  4DUY L;  2EQS A;  2VY3 A;  4DV2 L;  1B8A A;  3P20 A;  4R4O A;  1EFW A;  3A55 A;  4L5R C;  1BVS A;  2B2V A;  3W1G A;  5IT9 L;  1E3P A;  1LTS D;  5JAV A;  1WTR A;  3BDL A;  5KYI A;  1LUZ A;  5FJ8 G;  1VQ5 A;  1TII D;  2K5Q A;  3S15 H;  1I4Q A;  2Q2I A;  3KFU A;  2MUY A;  1SNQ A;  1EYG A;  4DNI A;  3HOX G;  1RD9 D;  1PZJ D;  2R7Z B;  3D0F A;  1G51 A;  4JBM A;  2NVQ H;  5C3E G;  1X3G A;  3FVQ A;  2WAC A;  1JMC A;  2PI2 A;  4JCV E;  1PXU A;  2JEB I;  2JA8 G;  3ONA B;  3AEV A;  4GKJ L;  1LTA D;  4DV0 Q;  5IYC G;  4FF1 A;  3ICE A;  4Y52 H;  2PQA B;  1DYQ A;  5IYB H;  4HN7 A;  2PQE A;  4HTH A;  3UDG A;  1WTP A;  1EY6 A;  4AYB E;  4EQ5 A;  4DV1 L;  3G48 A;  3MEF A;  4XQN A;  1SRO A;  3FKI G;  1U4R A;  2SNS A;  1E1T A;  2CKZ B;  3GTK B;  2JA5 B;  4IOA A;  4QGU A;  4K2K A;  2MO0 A;  3HOY G;  4OL7 A;  3CU7 A;  5AJ3 Q;  4HJ8 A;  2CVR A;  1DM0 B;  4DNT B;  1E7Z A;  1YHA A;  1HZC A;  2EYL A;  4YCU A;  1GUN A;  4LJZ C;  3GV6 A;  3IRB A;  3BYY B;  1H9S B;  1PFB A;  3DUZ A;  1FYC A;  1EU3 A;  1NMG A;  1IKL A;  3QO2 A;  1KHI A;  1KNE A;  3FMC A;  4LMQ D;  3E9H A;  5IIF A;  1XXG A;  3CCQ A;  2F0U A;  1NAP A;  4EQO A;  1MJE A;  1X55 A;  1JWS D;  4JI8 Q;  3M85 A;  1M8A A;  2UUA Q;  1NCV A;  4DA2 A;  3BVM A;  1PRT D;  2N78 A;  3I90 A;  5JJK A;  5C0X G;  2IJ0 A;  4OWT B;  3HP3 A;  4DV3 L;  2ZM6 L;  2A69 C;  1VF7 A;  1U5K A;  5KND A;  3QOL A;  1JOR A;  4DV6 L;  3HOW H;  2AWO A;  4QQB X;  1X32 A;  3J80 E;  3PIO A;  1A3T A;  5JOB A;  3AFQ A;  2EYF A;  4MIU A;  2XVS A;  2D62 A;  3K5L A;  1PTO H;  4QCL A;  4X3U A;  3I7F A;  2IHF A;  2RHQ B;  5E1F A;  3GTO H;  5IP9 G;  1S5E D;  3PUZ A;  3I4N H;  4BBS G;  3CP0 A;  4IUN A;  1B1Z A;  2BA1 A;  5C6A A;  2L9H A;  3NPP A;  4A3I H;  1P16 A;  4KK7 A;  2CQO A;  1Q8K A;  4K2L A;  1JR0 D;  1N36 Q;  1HNZ Q;  4F87 A;  4BY1 B;  2K5V A;  3CRK C;  2XSC A;  2EYP A;  1PTO D;  2A69 D;  3RLN A;  1PLF A;  1HUM A;  3SHL A;  2WKD A;  1JOK A;  5HGT A;  2J7Z A;  5M5X H;  1Z6H A;  2B39 A;  3OIP A;  3ULJ A;  4PV1 C;  4MTN A;  4C3H B;  2F52 A;  2WP8 J;  4F7X A;  2MJ8 A;  3FPP A;  3SE0 A;  4R4C A;  2KBN A;  4YIJ A;  4LNQ A;  2CWA A;  1IBK L;  3PV0 A;  4A3K G;  1B53 A;  3PO2 G;  4FF4 A;  2DY8 A;  4JPB W;  3KF6 A;  1NSN S;  3I8Z A;  1G2S A;  3KK7 A;  4RH6 A;  4OX9 Q;  3ERS X;  4A3G H;  3M9B A;  4GOP A;  1CQV A;  1QZH A;  2DY7 A;  1TKW B;  4R4Q A;  1GHJ A;  5EJW A;  1N33 Q;  2SNM A;  4HSP A;  1WTW A;  2JQO A;  4FP5 D;  3AQQ A;  3LNN A;  3M7N A;  3H0G B;  5J1Z A;  1HA6 A;  4DAV A;  1FD7 D;  4IUP A;  2N55 A;  4FXK C;  4IUV A;  3MZ5 A;  1NTG A;  1HA5 A;  3D4D A;  4JYA Q;  5IWA L;  4X62 Q;  1GUO A;  3RZD H;  3R2I A;  2AMC B;  3CCJ A;  3VR3 A;  4AQY L;  2CW0 D;  3HGB A;  3H09 A;  2UU9 L;  1IW7 C;  2AKW B;  3URY A;  2L5T A;  1J9O A;  3RNU A;  1JCK B;  1ZXT A;  5COR A;  4C3I G;  3K5N A;  3L2P A;  4B08 A;  2E2D C;  2R61 A;  4BY7 H;  1SE8 A;  5ELE A;  4DR3 L;  2XTI A;  4A3J G;  3PO3 H;  2OT2 A;  4PNY A;  3S17 B;  4JI4 L;  3TP6 A;  1AN8 A;  4RGM A;  2E2J H;  2F0E A;  4J8Q A;  3PSI A;  3CQZ H;  1DD2 A;  2RKS A;  5D3D A;  2MO1 A;  4KHZ A;  2EY6 A;  1X56 A;  1HZB A;  3DWQ A;  2RSO A;  5M5W H;  2YTY A;  4A3F G;  3HOU H;  2RDH A;  2UXD L;  1SE3 A;  2OQ0 A;  3TP7 A;  4LUO A;  1SYE A;  1ET9 A;  1A63 A;  4F8M A;  4N8X 1;  2DGY A;  1QVF A;  3GD7 A;  3OPO A;  1XPU A;  3JC6 6;  1Z9F A;  1RIP A;  2OWO A;  4RA8 A;  1BBW A;  3I2Z A;  2BE5 C;  1XMO Q;  4OHJ A;  5H1S E;  4JBW A;  1UE7 A;  2F0T A;  4KD3 A;  1LTB D;  1U9R A;  2EXZ A;  5GAG C;  4L5T A;  4XQQ A;  1Q3L A;  5JJL A;  3T53 B;  1NBW A;  1SFO B;  3PMF A;  3HOV G;  3A8J E;  3EIV A;  4IJH A;  1RTN A;  4HED A;  5LHY 1;  3GTJ H;  1ONL A;  1STH A;  2EDG A;  2RBM A;  3IFD A;  5LMN Q;  1B50 A;  2VUM B;  3E9I A;  2ZXP A;  1ENC A;  2F3V A;  5IGE A;  2K04 A;  2CQA A;  1ASY A;  5EKK A;  4L5Q A;  3TDQ A;  1WCM G;  1JWM D;  4UDU C;  4H0L C;  2YU9 H;  4DR1 Q;  5C44 H;  1I6V C;  2NWG A;  3GTQ H;  3TZD A;  5JJZ A;  2HIX A;  3CCV A;  4A3B B;  1C0A A;  1SJH D;  2K33 A;  1KDB A;  1SSO A;  4K0K Q;  4QUC A;  3M4O H;  2CH4 A;  2PMZ B;  1QVG A;  3HOZ H;  1OXV A;  2NVX H;  1LT3 D;  2KHJ A;  3S14 B;  4G7H C;  4LWC A;  4BS9 A;  3NWS A;  1KTK A;  1STN A;  3X3N A;  2F03 A;  3S1R B;  3QIA A;  4C3J G;  1NR2 A;  2NVT H;  1G2T A;  4O2D A;  1KIX A;  2PNR C;  2VZA A;  2XWB B;  4L63 B;  3W2D A;  5IE8 A;  2B63 G;  5DAU A;  1EY5 A;  1CKM A;  1LTI D;  1SEB D;  3MFY A;  1NJI C;  1F2Y A;  1EEF D;  4DPG A;  4U67 3;  4GKJ Q;  2R92 G;  3STB D;  4CDC C;  4A3D G;  4DR7 L;  5JEA J;  3BS1 A;  4MNO A;  1OTC A;  4S3S A;  4DV1 Q;  1EIH A;  4MHE A;  4YHH L;  1YNN C;  5KEE A;  2KCT A;  2D5D A;  5E4W C;  3MXN A;  4ZUJ A;  2A6E D;  1W6K A;  2F0Q A;  4IFD I;  5M9O A;  3PF4 A;  4P72 A;  2Q2T A;  2NVQ B;  1VQJ A;  1PZK D;  3S16 H;  2YTV A;  2JA7 G;  1STY A;  1TY2 A;  2X69 A;  5IT9 E;  4N9P A;  4C56 C;  3F2C A;  3UDI A;  4HSV A;  2WB1 B;  1A3U A;  1XWE A;  2P5Z X;  1STB A;  3L7Z C;  1OXU A;  1GUS A;  2KUM A;  5BN5 A;  3ERO A;  1XJV A;  2K7V A;  4DKA C;  5KYL A;  1PMR A;  3EJI A;  2CCZ A;  4DAY B;  1V43 A;  3H3V C;  1CKN A;  1PA6 A;  2R93 H;  5JEA G;  1WYD A;  1KC8 C;  3A56 A;  4DV3 Q;  1KQS A;  5KNC A;  3J81 c;  1JOQ A;  1PRT B;  4HJA A;  5JPN C;  3C46 A;  3S2H H;  2RSN A;  4POG A;  1I5F A;  5M3M H;  3RN2 A;  4HIK A;  2O4X A;  1K8M A;  1HXY D;  2WAQ G;  3R8B A;  1YHQ A;  2B2U A;  1GD7 A;  4QUF A;  4CDD C;  2MHV A;  3OIQ A;  1IHZ A;  1PH5 A;  4K8I A;  4A93 G;  2GVA A;  4B3R L;  4YY3 L;  2JA6 H;  2K1B A;  5COY A;  2F0H A;  1Y8N B;  3A8I E;  2F0F A;  2QEJ C;  2K5N A;  1EEI D;  1J8I A;  2JXM B;  3QG1 A;  4IUQ A;  1EQT A;  1MIU A;  2Q8I B;  2DJG C;  3HOW B;  4XXE A;  1P8L A;  3NUC A;  5M3F B;  2Z0S A;  4APV A;  4DR5 L;  1PTO B;  3BVZ A;  4KY7 A;  2X6G A;  1VQA A;  3GTO B;  2PQA A;  1L1O C;  1X3E A;  2IL8 A;  3I4N B;  3EA6 A;  5EKI A;  3BJU A;  4NB3 A;  2F0M A;  4A3I B;  1D6E C;  5CC4 A;  2B2V C;  1ESR A;  4X6A H;  1SMY C;  2F0L A;  2HHH L;  1I4G A;  1ZEQ X;  1ZYR D;  4I7Z C;  5GQO A;  2QA4 A;  3ITP A;  1TS4 A;  2BCO A;  3J7A F;  4A3G G;  5D65 A;  2VB2 X;  1Q46 A;  1IBK Q;  1VQ6 A;  2A19 A;  1IYJ B;  1HPC A;  1O7I A;  3PGZ A;  2M9V A;  2F1M A;  4LW1 A;  2EXD A;  4Z9C B;  3J81 j;  2HD3 A;  2BDN A;  1JB7 A;  1H9S A;  2B8G A;  3MEH A;  4C1N I;  2VQF L;  1M4V A;  1EQV A;  3S17 H;  5C5M A;  1Y1W H;  2ES2 A;  1K8O A;  1PRT F;  4K5W A;  4NXN L;  3UDF A;  3F2U A;  5ELB A;  3D4W A;  1WTH A;  1KL9 A;  5KNB A;  3KYH C;  1V8Q A;  3CCR A;  5ELF A;  2F0O A;  3IL8 A;  3M4P A;  2I5H A;  3S1N H;  4MTK A;  1BNZ A;  4AYB B;  4NXM Q;  4OWW B;  5J22 A;  3QOJ A;  1ASZ A;  5IWA Q;  1EIG A;  2K50 A;  3O13 A;  4BY7 G;  1S5D D;  4HID A;  3KF8 B;  1F77 A;  1I94 L;  5K36 G;  3B6Y A;  4HJ9 A;  3DWA A;  4LUZ A;  5JVG 3;  3MA2 B;  4X3S A;  3CMA A;  3I4M H;  1KRS A;  1JJG A;  1H9K A;  3HKZ G;  1IBM Q;  1GUG A;  4DR3 Q;  2IT1 A;  3TBI B;  3H15 A;  1QWY A;  1E1O A;  3CC7 A;  2HDM A;  5EQ0 A;  1IBL Q;  2JEA I;  2EYH A;  1HTL D;  3VR4 A;  2E2H H;  1QZG A;  1DON A;  1DXM A;  3NTI A;  1N34 Q;  1SFO H;  3CF5 A;  3MXN B;  3OOC A;  3RZD B;  1W6J A;  4XDX A;  2EJM A;  1A6X A;  1SNC A;  4LFC L;  3K6O A;  1TWH H;  2F0W A;  2VUM H;  4PMB A;  1TS3 A;  2L4N A;  2NZ1 D;  4C2M H;  3V05 A;  1IXR A;  4TVA B;  4RFB A;  2LFN A;  3PO3 B;  1UE6 A;  3J81 L;  1II3 A;  3WOE A;  3A5U A;  1DJR D;  4RCO A;  3K80 C;  2E2J B;  4R8N A;  2KQ3 A;  3RUZ A;  3CQZ B;  1Y8O B;  3SVM A;  2UXB Q;  4DV7 L;  1RDP D;  1X3F A;  1Q1B A;  4PZ6 A;  1AW7 A;  4GNX B;  1O78 A;  1N32 Q;  3NXW A;  4RCN A;  1RHP A;  5M5W B;  3CKI B;  2R7Z G;  1G6Z A;  1U4M A;  1MJC A;  4L8J A;  3T51 B;  1SRU A;  3M4Q A;  3HOU B;  1SND A;  4DAM A;  2OTL A;  1HNW Q;  1PH3 A;  2KHS A;  1KNA A;  1VMP A;  3DM1 A;  5J3B A;  5A2Q L;  2YYZ A;  4B3T L;  2EY2 A;  2PZU A;  4JW0 A;  5DLQ E;  2ALY B;  1FJG Q;  3TSS A;  1EWH A;  2Z8L A;  3KDF B;  2VXW A;  4DV5 Q;  4IFD G;  1GO3 E;  2JA5 G;  4KJO A;  2EVB A;  5GAD C;  2Z6K A;  4B3S Q;  2UUB L;  1YNJ D;  4QMG A;  1F9P A;  2K03 A;  1K9M C;  5JJI A;  5IYD H;  4RMF A;  4JI6 L;  3SXH A;  3A74 A;  3GTJ B;  1BF4 A;  4BXX H;  1KXL A;  2F0I A;  2WIN B;  5IGC A;  1VQH A;  5D3I B;  3A7L A;  4TRD A;  3CRL C;  3J81 i;  1CQF A;  3Q6S A;  1VQM A;  4FNF A;  1EY8 A;  2MNA A;  3GP7 A;  2YU9 B;  2A68 D;  5C44 B;  3QR8 A;  4KN7 C;  3GTQ B;  1Q8I A;  2Y0S E;  4HJ7 A;  4GOP C;  3KLS A;  5ISR A;  1DGS A;  3M4O B;  2K75 A;  5CV7 A;  5C0X J;  2TMP A;  3J7A V;  3HOZ B;  2A8V A;  2L15 A;  4ABN A;  2NVX B;  4NPS A;  2JP1 A;  3AFP A;  1VS0 A;  5FO7 B;  1HZA A;  1TXY A;  3AU7 A;  4JC0 A;  3GTG H;  1JC7 A;  4DK3 C;  2NVT B;  3SGI A;  1FGU A;  1JE4 A;  1YBY A;  2KJX A;  4EQP A;  3CCM A;  1SYF A;  2NYZ D;  4LF7 L;  2K5W A;  2KEN A;  2NUC A;  5KRU A;  4KI0 A;  4OXP A;  4A3E H;  1C7Y A;  2AQ3 B;  2VQE Q;  2EIF A;  2ZT9 C;  4G7O C;  1XMQ L;  1VQC A;  4QF4 A;  3WWV A;  5I6W A;  4XIG S;  3FRP B;  1BCP F;  4QJF A;  1YNX A;  5EGT A;  2E5L Q;  4BY1 G;  2O2L D;  3TN2 A;  2FIN B;  1PV4 A;  4DUZ L;  2JE6 I;  4LF8 Q;  1U4L A;  3U9O A;  3SEB A;  5KGU A;  1NR4 A;  1LV9 A;  4XYQ A;  2XRS D;  4DK6 C;  4IQZ A;  3S16 B;  2PYK A;  4GKK L;  1HFG A;  3I55 A;  5M3F H;  1AE2 A;  1PH9 A;  1CK1 A;  1X3Q A;  4C3H G;  1A0I A;  5E3F A;  2UXC Q;  1B9N A;  2FXQ A;  1YEZ A;  1EY7 A;  3VDY A;  3CC2 A;  5BR8 L;  3K5M A;  2A6H C;  4A3M H;  3EN2 A;  5IP7 G;  4YY3 Q;  1EZ8 A;  4LF9 Q;  1AH9 A;  5D14 A;  1AE3 A;  3MAQ A;  5FO8 B;  4BBR H;  3SK6 A;  4GZY C;  3SK4 A;  1HQR D;  1WTX A;  2R93 B;  2WKC A;  3PUW A;  5C4J H;  3OWF A;  3P75 A;  2O5I C;  3MXG A;  2XGT A;  4JK1 C;  3S2H B;  4DN4 M;  2KA7 A;  2F4V Q;  2RF4 A;  5M3M B;  1STA A;  4OIJ A;  3A5Z B;  4JI1 L;  3CD6 A;  4K6D A;  3ER0 A;  3H0G G;  1VQG A;  2RHS B;  2L12 A;  2IW3 A;  3VR5 A;  2NTT A;  2RCF A;  2Z9H A;  4DR5 Q;  2JA6 B;  4UP9 A;  4A3C G;  1QJO A;  2L1B A;  1MKH A;  5FLM H;  2RDG A;  2A6H D;  2OF1 A;  4GN4 B;  2F3I A;  2LS0 1;  5J39 A;  5AFW A;  3TRZ A;  4JOI A;  3RZO H;  4P73 A;  2HHH Q;  3I73 A;  1SNP A;  4NMZ A;  4Q5V A;  3HFZ B;  1VDZ A;  3SR1 A;  2H1E A;  3R2T A;  1NUC A;  2RDF A;  3M7G A;  4ZLT F;  4QB4 A;  5DM7 3;  3MXP A;  4BA1 I;  3MWY W;  1CUK A;  3R93 A;  2N8N A;  2ICI A;  4IZ8 A;  2F0D A;  2C35 B;  1T5E A;  1HHV A;  2EYM A;  1ROD A;  4DAY A;  1VQK A;  1WD1 A;  4CKC A;  3VYR A;  3J7Y W;  1PH8 A;  1WFQ A;  3M4Y A;  1HCZ A;  3T1H L;  4JBK A;  2IX1 A;  4J6H A;  1L2F A;  1I94 Q;  1I6H B;  4B3M L;  2GA4 B;  2EOT A;  4DV4 L;  1PH4 A;  1K3R A;  2NN6 H;  2G5D A;  4EVO A;  2VS1 A;  2I07 B;  1Y1W B;  5CV5 A;  3OYY A;  3PIO 3;  3F2B A;  5LL6 S;  3I4O A;  1CM9 A;  1CSQ A;  1E2Z A;  2DJF C;  1D2B A;  4YCW A;  1B44 D;  1C4Q A;  1YVC A;  2E2I H;  3S1N B;  4LFB Q;  2VUM G;  3K58 A;  3PIP A;  4KY6 A;  1EY4 A;  2AQ2 B;  4HMI A;  4R1J A;  2QIL A;  4ZKB B;  4LFC Q;  4J15 A;  1IW7 D;  4JI5 L;  4DR2 L;  3PUX A;  2WFW A;  1IZ6 A;  3EQL C;  1SYD A;  4GS3 A;  3NEN A;  4LFA Q;  4A3B G;  4JI7 L;  3I4M B;  1QE6 A;  1ENF A;  3T4A C;  1BQQ T;  1LT5 D;  2PO4 A;  1PDQ A;  4Q0F A;  2A74 C;  2CH4 W;  1HR0 W;  1AFP A;  1QOH A;  2B2U C;  1RL2 A;  1BCP C;  2C5C A;  4I65 A;  1EYA A;  4ZRZ A;  2E2H B;  2D2C C;  4LF4 Q;  1O7Z A;  3K0X A;  1B70 B;  4C1N K;  1XNR L;  1IYV A;  5I2X A;  1D5M C;  2I0Q A;  2SDF A;  5IGF A;  4OON A;  1EL0 A;  1UE1 A;  4KMU C;  1N9W A;  1BO0 A;  2ASB A;  1PHJ A;  1Q90 A;  4NW2 A;  1SNM A;  1TWH B;  3NQI A;  1EFI D;  1BOS A;  1TS5 A;  2BA0 A;  3W3A A;  4C2M B;  4LAA A;  4KN4 C;  4PQX A;  1HR0 L;  4DR4 L;  4IJL A;  4UHV A;  1CHP D;  1XNQ L;  3AMU A;  3TS2 A;  4B3T Q;  5FLX c;  1SBB B;  4DUY Q;  2BE5 D;  1EWC A;  4DV2 Q;  3NE5 B;  5GAE C;  5E4X A;  1D5Z C;  4FF2 A;  1X54 A;  1EUJ A;  5IYD G;  4IUT A;  1Y1V H;  1CT1 D;  1X65 A;  4BXX G;  4ZAI A;  2KCC A;  4JV5 L;  1TVX A;  4ZYS A;  2A1A A;  5LL6 X;  1UAP A;  2G9H D;  5IGG A;  3K8A A;  5G3L F;  3GTP H;  2Z1C A;  4JI6 Q;  3J81 E;  4K8J A;  4A3L H;  2B2W A;  1VQ9 A;  3TP8 A;  4CJ1 B;  1QCB D;  3KF8 A;  4X3K A;  5KIX A;  3U50 C;  5IYB G;  2WB1 G;  3D8G A;  3H91 A;  5C4X B;  1KAA A;  1WTV A;  3KJP A;  1VMC A;  3OTO L;  1MD2 D;  4DK0 A;  3C2P A;  4FF3 A;  1JJ2 A;  2E75 C;  2D0O A;  3BZD B;  3RMH A;  4O0A A;  2A5H A;  1XTC D;  1I4P A;  4XYO A;  4ULL A;  3TEH B;  3HOX H;  1HFN A;  5A2Q E;  4DV0 L;  4DXG A;  3MXU A;  3W1B A;  5C3E H;  4HJ5 A;  2JA8 H;  1GXD C;  2L11 A;  2F0G A;  1DOM A;  3PIP 3;  2F4I A;  5EBD A;  1A3V A;  3ND9 A;  3KJO A;  4CBV A;  1L0W A;  1B4O A;  2F0P A;  4WOR A;  1LTR D;  3FKI H;  3D31 A;  4LF5 L;  1JJC B;  5ELD A;  4RKL A;  3J7Z C;  1D5X C;  4GNX A;  5IGB A;  1AZP A;  1YNN D;  3WDN A;  3HOW G;  1FL0 A;  3GTG B;  2PNH A;  2V4D A;  1PH6 A;  5M3F G;  1F9Q A;  2ZM6 Q;  1F9S A;  4MN3 A;  3NP8 A;  4JI8 L;  4DV6 Q;  3RR5 A;  2I46 A;  2UUC L;  1FNW A;  2UUA L;  2EZV A;  5I9O A;  4A3E B;  3H3V H;  4GKK Q;  1A62 A;  5CBA E;  3I4N G;  2E8G A;  4DR6 L;  3KDF A;  3NQT A;  2VW9 A;  1R4P B;  3SK5 A;  4A3I G;  3CCS A;  1MSH A;  3NBH B;  2XWJ B;  5FKA C;  5C0X H;  3U9S A;  1MBY A;  3A7A B;  5I9P A;  2E74 C;  1MHW C;  1JQY D;  1GM5 A;  4YWK A;  4FYD A;  2FMM A;  2Z6B A;  4IPH A;  1GUT A;  1C9O A;  1K0S A;  1QB5 D;  3KLR A;  1BDO A;  1SE4 A;  2F0N A;  1EIY B;  5I6Y A;  1FNU A;  2HQL A;  3I91 A;  1YIT A;  1QUQ B;  2BH8 A;  1N36 L;  3ZJY C;  4BBS H;  1HNZ L;  2K52 A;  2PZW A;  2PCF B;  4ZKC B;  5FLX L;  4A3M B;  2WV6 D;  2X6L A;  4U68 A;  4AYB G;  1WTQ A;  3JAM L;  5M5Y H;  3KBX A;  4BBR B;  1UEB A;  1ICF B;  3LX0 A;  4JVZ A;  2M2L A;  4IO9 A;  3T1Y L;  1TWA B;  2D0P A;  3UI2 A;  2JA9 A;  2Z6K C;  2RCN A;  3C3L A;  2HQE A;  3M3Y H;  1QNK A;  3L9A X;  5C4J B;  2B2T A;  4A4I A;  1VQI A;  4QY7 A;  2KHI A;  4M1U B;  4KHP L;  2Q2H A;  2AUJ D;  4RGT A;  5T1G A;  2JK8 A;  1ESF A;  1STE A;  4UAI A;  1GOZ A;  1I6H H;  2AQ1 B;  2G9D A;  4IN3 A;  1K28 A;  1E0B A;  2GN5 A;  4NKL A;  4DU9 A;  1MSG A;  3K57 A;  5CMD A;  5IY0 A;  3IAY A;  3K59 A;  1BKB A;  4IPC A;  2Y0S B;  1VQO A;  1Q86 C;  1KLG D;  4X65 L;  4OX9 L;  2HDL A;  3G4S A;  1A2U A;  4A3K H;  2V1C C;  4JI3 L;  3PO2 H;  2L55 A;  3HS0 C;  3NEM A;  1SMY D;  3RZO B;  2KCN A;  2F0J A;  3IKJ A;  4QIW B;  4AQY Q;  4MZ9 A;  3PO3 G;  3NHH A;  2UU9 Q;  5ELC A;  3NEL A;  4HCE A;  4FO2 A;  3ULP A;  1HJP A;  1SR3 A;  5CBE E;  1C8C A;  4JYA L;  1VCI A;  3EVQ A;  2K14 A;  4X62 L;  4B3M Q;  1IKM A;  1TWC B;  2VNU D;  4XT1 B;  3H6M A;  3K7U C;  5EBC A;  1QNU A;  1Y69 U;  4JI4 Q;  4TQU S;  4UPA A;  2LXJ A;  5HY6 A;  1CTM A;  2OEO A;  4XQJ A;  1W3S A;  2YTX A;  1BBX C;  2DNE A;  5EKL A;  3I72 A;  1PH1 A;  2CHB D;  1PTO F;  3HOU G;  2ZJQ A;  5ELN A;  1SXT A;  2LSS A;  1LT4 D;  1I4R A;  1U4P A;  2JN4 A;  1EYC A;  4KKU A;  2MQH A;  4C3I H;  1B3A A;  5JPM C;  3VR2 A; 
#chains in the Genus database with same CATH homology
 1S5B D;  1SJE D;  1G29 1;  3G7L A;  5A35 A;  4IFD J;  3MHB A;  4L6T B;  1D1I A;  3OMC A;  2ID0 A;  2C9O A;  4OO1 H;  3S9W A;  2ZXR A;  3AB9 A;  2E2I B;  4NDX A;  1AEX A;  2E76 C;  3T13 A;  2EPB A;  4CHT B;  2FMC A;  1AZQ A;  4Y7N B;  4V19 0;  3MFG A;  1GHK A;  3T16 A;  4DF7 A;  1CI3 M;  4R8I A;  5C3W A;  2F3W A;  1UUP A;  1FR3 A;  2J4X A;  3WOF A;  4OO1 I;  4DNR B;  2EJF C;  3FEW X;  5FO9 B;  2OXP A;  4KV6 A;  2Q8R E;  5CV9 A;  1G8Z D;  2K28 A;  3I70 A;  1TS2 A;  3DMU A;  2R3Z A;  1CA6 A;  3OW7 A;  3MC0 B;  2FJ2 A;  2NBF A;  2ZXO A;  1EOT A;  2BDO A;  3OMG A;  3HRZ C;  1Y1V B;  3Q23 A;  3S1M B;  3N6R A;  4G4K A;  4P2C B;  2VB3 X;  4CGY B;  2PPB C;  3GTP B;  4H44 C;  2KVM A;  2R6G A;  3I4L A;  4O42 A;  4RHS A;  1F2L A;  1SYC A;  1KLU D;  1PRT C;  4XT3 B;  1KAB A;  3K5O A;  3MTS A;  4EQN A;  3NTH A;  4DAP A;  2A73 B;  3I3C A;  3TP5 A;  4K5V A;  4BA2 I;  3HOX B;  4KTA A;  1MGS A;  5C3E B;  2KED A;  1XYI A;  2JA8 B;  1V1P B;  3HEJ A;  1ENA A;  1TR5 A;  4WJW A;  1EU4 A;  2F0K A;  4LK1 C;  5BN3 A;  4RAU C;  4RKB A;  3LWE A;  5CV4 A;  3FKI B;  1PTO C;  4NP5 A;  1VF5 C;  2O5J C;  1S5C D;  2B2Y A;  5FK9 C;  3HG9 A;  3R3O A;  3HOY B;  5I2Y A;  2HUG A;  5JEA H;  5DM6 3;  4N9T A;  4KY5 A;  1JIC A;  4M8A A;  2PZT A;  1EYD A;  1LLR D;  1A2T A;  3QWN A;  1E2W A;  3ERQ A;  1LAC A;  1QIL A;  4ZK9 B;  4XTC S;  1XX8 A;  5IGD A;  1F9R A;  2SOB A;  4ZQ3 A;  1PFN A;  1Z7T A;  1JOO A;  1PZI D;  3KLS X;  2LY7 A;  1DCZ A;  1TY0 A;  2FFK B;  2DNC A;  4DK1 A;  2B2W C;  3Q24 A;  1SE2 A;  4BBS B;  2MP1 A;  3BDO A;  2CW0 C;  3D3R A;  1ILQ A;  3NWT A;  4HAE A;  3IFT A;  4CKB A;  5M5Y B;  1BUV T;  5HUR A;  2D9U A;  3M3Y B;  3OHX C;  1OXS C;  1WTO A;  4IAL A;  3TZU A;  2RVL A;  1H9J A;  1Y8P B;  3C1F A;  3V96 A;  3OSO A;  1CZG A;  3GO5 A;  4TSS A;  1L0Y B;  5FLX E;  4F88 A;  1Z47 A;  1O80 A;  2IX3 A;  3JAM E;  2KOL A;  3DHQ A;  1DZ1 A;  1S5F D;  4KD4 A;  4R9W A;  3RD4 A;  3FPU B;  1ILP A;  5EPJ A;  1Q1E A;  1I4X A;  1HRJ A;  3DEP A;  3NBH A;  4A3K B;  3PO2 B;  4HR7 B;  2TSS A;  4K14 A;  2IPK D;  5K36 H;  4RGO S;  2EJG C;  1HTP A;  5IOC A;  1PYW D;  5DEH A;  4OO1 G;  3D4R A;  5CR3 A;  1TQO A;  1A15 A;  3L3O C;  3X3M A;  1SNO A;  1BXT A;  2NN6 I;  2DN8 A;  2ENB A;  4WRD A;  1JWU D;  3GV3 A;  5BN4 A;  3BDC A;  3G6J B;  3K0Y A;  4ME5 A;  5CV8 A;  4C3I B;  3E5S A;  1S4Z A;  3Q22 A;  4EGV A;  4A3J B;  3KBG A;  1O7Y A;  3GQB A;  2L0C A;  1STG A;  2Z4I A;  2K32 A;  4DFA A;  4K5X A;  3DEO A;  3PUV A;  5F2D A;  5C5L A;  1H9R A;  1BCP D;  1LTT D;  4HMJ A;  3P7J A;  2XRQ D;  3VR6 A;  4A3F B;  4O1N A;  1Q12 A;  2EYJ A;  3Q0A A;  2JYO A;  2KEE A;  1E2V A;  1EY0 A;  2B2T C;  3NSW A;  1RTO A;  1MI2 A;  4KJN A;  4PMW A;  5NUC A;  4IFD H;  4K6L A;  1V1O A;  1EZ6 A;  2A6E C;  5CYU A;  2RA4 A;  3HOV B;  1T5X D;  2QF7 A;  3OWE B;  3D6C A;  3VA7 A;  1LAB A;  1JB3 A;  2Z4H A;  4G57 A;  4H7B A;  4E6I A;  2EY5 A;  3J80 L;  1WCM B;  2ICE C;  3PUY A;  4ID6 A;  3SDZ A;  4IUR A;  5C4Z A;  3VA5 A;  4KKT A;  4CKE A;  3S15 B;  3E0J A;  2AWN A;  3V2T A;  4ODG A;  4PMC A;  1SYG A;  2N88 A;  5IOD A;  3ZYY X;  3KUP A;  1FGB D;  1CFM A;  4C3J B;  1LT6 D;  5K5P A;  1RJT A;  2K05 A;  2K5D A;  2B63 B;  4H13 C;  5FOB B;  3A8K E;  1PFM A;  5CGK A;  3MVV A;  2HCI A;  3E6Z X;  3D6W A;  2R92 B;  2M00 A;  3HZX A;  2LKV A;  4A3D B;  1I50 B;  4RWS C;  1LO5 D;  1RKN A;  3BVG A;  4ZUI A;  4OGQ C;  2QKI C;  3QB3 A;  3T56 B;  1WVL A;  1ML0 D;  3RLF A;  3S1Q B;  3NBI A;  2SEB D;  2PW7 A;  1KDA A;  1ZKO A;  2JSO A;  5CV6 A;  1TT2 A;  1OXT A;  2JA7 B;  2WII B;  3GTM B;  2EYO A;  4J1M A;  4FXD A;  4HCS A;  4RGN A;  3EFX D;  1ZYR C;  1D1K A;  1OO9 B;  4G7Z C;  2MGS A;  1GJX A;  1DOK A;  1TWF B;  1B9M A;  3BYT B;  2QDB A;  1ET6 A;  1C48 A;  1RCV D;  2NB0 A;  1IL8 A;  3DWP A;  5C0X I;  1CHQ D;  2IWH A;  1R9T B;  4BWG B;  1HQM C;  2WAQ B;  2BOS A;  3GTL B;  2EY1 A;  2NVY B;  4A93 B;  2KEC A;  5EPL A;  2XNA C;  4WFN 3;  1RF2 D;  5C4H A;  2MPM A;  4DGZ A;  2XN9 C;  2FHT A;  1TU2 B;  4V0B A;  1KDC A;  1F2Z A;  1BR9 A;  1LTG D;  4CJ2 C;  3NK9 A;  5JVH 3;  1QG7 A;  1O7L A;  1X3P A;  5M5X B;  4TKO B;  4B9W A;  2IX0 A;  3CHB D;  2HCC A;  2B8F A;  5DNF A;  2NN6 G;  4IUU A;  1V1P A;  3N52 A;  4RHR A;  2AUK A;  1K83 B;  1IYU A;  3H94 A;  4CJ0 B;  1F2M A;  2NTS A;  2XIW A;  3S2D B;  2LMC B;  2Q8T A;  1SDF A;  4X3T A;  1R4Q B;  3P1H A;  3VYT A;  3VYU A;  4A3G B;  3LWU A;  1EY9 A;  5G3L D;  1I4H A;  5TSS A;  1OXX K;  3BG3 A;  1CZW A;  1GUW A;  2EE1 A;  3ND8 A;  2RQX A;  4KKS A;  3FDT A;  4FXG C;  4OIK A;  4B9X A;  1G91 A;  3C1E A;  2J0T D;  2PW5 A;  1UNS A;  3QJY A;  2B2Y C;  4BY7 B;  3TME A;  1FNV A;  1SAP A;  1WD0 A;  1H9M A;  1TWG B;  2F0S A;  1HUN A;  1ICW A;  2H4O A;  2QCP X;  1AP0 A;  1UEA B;  4ILW A;  1SYB A;  3HKZ B;  4DXF A;  3NTK A;  5T1I A;  3A54 A;  1YNJ C;  5I4D A;  5C3X A;  3VYS A;  5EPK A;  2K6A A;  1L0X B;  2F0V A;  4FVM A;  1I3Q B;  4KHV A;  3SK8 A;  1B2T A;  1CA5 A;  2K01 A;  2A68 C;  1DOL A;  3K7A B;  1BCP B;  3DXJ C;  3P20 A;  3A55 A;  2B2V A;  5IT9 L;  1LTS D;  5JAV A;  1WTR A;  3BDL A;  5KYI A;  1TII D;  2K5Q A;  1I4Q A;  2MUY A;  1SNQ A;  1RD9 D;  1PZJ D;  2R7Z B;  3FVQ A;  2WAC A;  1PXU A;  2JEB I;  3ONA B;  1LTA D;  4FF1 A;  1DYQ A;  4HN7 A;  2PQE A;  4HTH A;  1WTP A;  1EY6 A;  4XQN A;  1U4R A;  2SNS A;  3GTK B;  2JA5 B;  4K2K A;  4OL7 A;  3CU7 A;  2CVR A;  1DM0 B;  4DNT B;  2EYL A;  1GUN A;  4LJZ C;  3GV6 A;  3BYY B;  1H9S B;  1PFB A;  3DUZ A;  1FYC A;  1EU3 A;  1IKL A;  3QO2 A;  1KNE A;  3FMC A;  4LMQ D;  5IIF A;  1XXG A;  2F0U A;  1NAP A;  4EQO A;  1JWS D;  3M85 A;  1M8A A;  1NCV A;  4DA2 A;  3BVM A;  1PRT D;  3I90 A;  5C0X G;  2IJ0 A;  3HP3 A;  2A69 C;  1VF7 A;  5KND A;  3QOL A;  1JOR A;  2AWO A;  1X32 A;  3J80 E;  1A3T A;  5JOB A;  2EYF A;  4MIU A;  2XVS A;  2D62 A;  3K5L A;  1PTO H;  4QCL A;  4X3U A;  5E1F A;  1S5E D;  3PUZ A;  4IUN A;  1B1Z A;  2BA1 A;  5C6A A;  2L9H A;  3NPP A;  4KK7 A;  4K2L A;  1JR0 D;  4F87 A;  4BY1 B;  3CRK C;  2XSC A;  2EYP A;  1PTO D;  2A69 D;  1PLF A;  1HUM A;  3SHL A;  2WKD A;  1JOK A;  5HGT A;  2J7Z A;  1Z6H A;  2B39 A;  3OIP A;  4PV1 C;  4C3H B;  2WP8 J;  4F7X A;  2MJ8 A;  3FPP A;  3SE0 A;  4YIJ A;  3PV0 A;  1B53 A;  4FF4 A;  2DY8 A;  1NSN S;  3I8Z A;  1G2S A;  3KK7 A;  4RH6 A;  1CQV A;  2DY7 A;  1TKW B;  1GHJ A;  5EJW A;  2SNM A;  4HSP A;  1WTW A;  4FP5 D;  3M7N A;  3LNN A;  3H0G B;  5J1Z A;  1HA6 A;  4DAV A;  1FD7 D;  4IUP A;  2N55 A;  4FXK C;  4IUV A;  3MZ5 A;  3D4D A;  1HA5 A;  1GUO A;  3R2I A;  3VR3 A;  2CW0 D;  3HGB A;  3H09 A;  1IW7 C;  3URY A;  2L5T A;  1J9O A;  1JCK B;  1ZXT A;  5COR A;  4C3I G;  3K5N A;  4B08 A;  2E2D C;  2R61 A;  5ELE A;  2OT2 A;  4PNY A;  3S17 B;  3TP6 A;  1AN8 A;  4RGM A;  2F0E A;  4J8Q A;  1DD2 A;  2RKS A;  5D3D A;  4KHZ A;  2EY6 A;  3DWQ A;  2RSO A;  2RDH A;  1SE3 A;  3TP7 A;  1SYE A;  1ET9 A;  4F8M A;  3GD7 A;  3OPO A;  4RA8 A;  2BE5 C;  4OHJ A;  4JBW A;  2F0T A;  4KD3 A;  1LTB D;  1U9R A;  2EXZ A;  4XQQ A;  1Q3L A;  3T53 B;  1SFO B;  3PMF A;  3A8J E;  1RTN A;  4HED A;  5LHY 1;  1ONL A;  1STH A;  2EDG A;  2RBM A;  3IFD A;  1B50 A;  2VUM B;  2ZXP A;  1ENC A;  2F3V A;  5IGE A;  2K04 A;  2CQA A;  5EKK A;  3TDQ A;  4UDU C;  1JWM D;  4H0L C;  1I6V C;  2NWG A;  3TZD A;  5JJZ A;  4A3B B;  1SJH D;  2K33 A;  1KDB A;  1SSO A;  4QUC A;  2PMZ B;  1OXV A;  1LT3 D;  3S14 B;  4G7H C;  4BS9 A;  3NWS A;  1KTK A;  1STN A;  3X3N A;  2F03 A;  3S1R B;  3QIA A;  4C3J G;  1NR2 A;  1G2T A;  2PNR C;  2XWB B;  3W2D A;  4L63 B;  5DAU A;  1EY5 A;  1LTI D;  1SEB D;  3MFY A;  1F2Y A;  1EEF D;  4U67 3;  5JEA J;  3BS1 A;  4S3S A;  1EIH A;  4MHE A;  1YNN C;  5KEE A;  2D5D A;  5E4W C;  3MXN A;  4ZUJ A;  2A6E D;  1W6K A;  2F0Q A;  4IFD I;  5M9O A;  2NVQ B;  1PZK D;  1STY A;  1TY2 A;  2X69 A;  5IT9 E;  4N9P A;  4C56 C;  4HSV A;  2WB1 B;  1A3U A;  1XWE A;  1STB A;  3L7Z C;  1OXU A;  1GUS A;  2KUM A;  5BN5 A;  3ERO A;  2K7V A;  5KYL A;  1PMR A;  3EJI A;  1V43 A;  3H3V C;  5JEA G;  3A56 A;  5KNC A;  1JOQ A;  1PRT B;  5JPN C;  3C46 A;  2RSN A;  2O4X A;  1K8M A;  1HXY D;  3R8B A;  2B2U A;  4QUF A;  2MHV A;  3OIQ A;  1IHZ A;  4K8I A;  2K1B A;  5COY A;  2F0H A;  1Y8N B;  3A8I E;  2F0F A;  2QEJ C;  1EEI D;  1J8I A;  2JXM B;  3QG1 A;  4IUQ A;  1EQT A;  2Q8I B;  3HOW B;  4XXE A;  3NUC A;  5M3F B;  1PTO B;  3BVZ A;  4KY7 A;  2X6G A;  3GTO B;  2IL8 A;  3I4N B;  3EA6 A;  5EKI A;  2F0M A;  4A3I B;  1D6E C;  5CC4 A;  2B2V C;  1ESR A;  1SMY C;  2F0L A;  1I4G A;  1ZEQ X;  1ZYR D;  4I7Z C;  3ITP A;  1TS4 A;  2BCO A;  3J7A F;  5D65 A;  2VB2 X;  1HPC A;  2M9V A;  2F1M A;  4Z9C B;  2BDN A;  1H9S A;  2B8G A;  3MEH A;  4C1N I;  1M4V A;  1EQV A;  5C5M A;  1K8O A;  1PRT F;  4K5W A;  3F2U A;  5ELB A;  3D4W A;  5KNB A;  1V8Q A;  5ELF A;  2F0O A;  3IL8 A;  1BNZ A;  4AYB B;  5J22 A;  3QOJ A;  1EIG A;  3O13 A;  1S5D D;  1F77 A;  5K36 G;  3DWA A;  5JVG 3;  3MA2 B;  4X3S A;  1H9K A;  1GUG A;  2IT1 A;  3TBI B;  1QWY A;  2HDM A;  5EQ0 A;  2JEA I;  2EYH A;  1HTL D;  3VR4 A;  1DON A;  1DXM A;  3NTI A;  3OOC A;  3RZD B;  1W6J A;  4XDX A;  2EJM A;  1A6X A;  1SNC A;  3K6O A;  2F0W A;  4PMB A;  1TS3 A;  2L4N A;  2NZ1 D;  3V05 A;  4RFB A;  2LFN A;  3PO3 B;  3J81 L;  1II3 A;  3WOE A;  1DJR D;  4RCO A;  2E2J B;  4R8N A;  2KQ3 A;  3RUZ A;  3CQZ B;  1Y8O B;  3SVM A;  1RDP D;  1Q1B A;  1AW7 A;  1O78 A;  3NXW A;  4RCN A;  1RHP A;  5M5W B;  3CKI B;  1G6Z A;  1U4M A;  4L8J A;  3T51 B;  3HOU B;  1SND A;  2KHS A;  1KNA A;  1VMP A;  3DM1 A;  5A2Q L;  2YYZ A;  2EY2 A;  2PZU A;  3TSS A;  1EWH A;  2Z8L A;  2VXW A;  4IFD G;  4KJO A;  2EVB A;  1YNJ D;  4QMG A;  1F9P A;  2K03 A;  3SXH A;  3GTJ B;  1BF4 A;  2F0I A;  2WIN B;  5IGC A;  5D3I B;  3A7L A;  4TRD A;  3CRL C;  1CQF A;  3Q6S A;  4FNF A;  1EY8 A;  3GP7 A;  2YU9 B;  2A68 D;  5C44 B;  4KN7 C;  3GTQ B;  1Q8I A;  3KLS A;  5ISR A;  3M4O B;  5CV7 A;  5C0X J;  2TMP A;  3J7A V;  3HOZ B;  4ABN A;  2NVX B;  2JP1 A;  5FO7 B;  3AU7 A;  1JC7 A;  2NVT B;  1JE4 A;  2KJX A;  4EQP A;  1SYF A;  2NYZ D;  2K5W A;  2NUC A;  5KRU A;  4KI0 A;  2AQ3 B;  2ZT9 C;  4G7O C;  4QF4 A;  5I6W A;  4XIG S;  3FRP B;  1BCP F;  5EGT A;  2O2L D;  3TN2 A;  2FIN B;  2JE6 I;  1U4L A;  5KGU A;  3SEB A;  3U9O A;  1NR4 A;  1LV9 A;  4XYQ A;  2XRS D;  4IQZ A;  3S16 B;  2PYK A;  1HFG A;  1CK1 A;  1X3Q A;  4C3H G;  5E3F A;  1B9N A;  1EY7 A;  3K5M A;  2A6H C;  1EZ8 A;  5D14 A;  3MAQ A;  5FO8 B;  3SK6 A;  4GZY C;  3SK4 A;  1HQR D;  1WTX A;  2R93 B;  2WKC A;  3PUW A;  3OWF A;  3P75 A;  2O5I C;  3MXG A;  4JK1 C;  3S2H B;  4DN4 M;  2KA7 A;  5M3M B;  1STA A;  4OIJ A;  4K6D A;  2L12 A;  2IW3 A;  3VR5 A;  2NTT A;  2JA6 B;  1QJO A;  2L1B A;  2RDG A;  2A6H D;  2OF1 A;  2LS0 1;  5J39 A;  5AFW A;  3I73 A;  1SNP A;  4NMZ A;  4Q5V A;  1VDZ A;  3SR1 A;  2H1E A;  3R2T A;  1NUC A;  2RDF A;  3M7G A;  4ZLT F;  4QB4 A;  5DM7 3;  3MXP A;  4BA1 I;  3MWY W;  3R93 A;  2ICI A;  4IZ8 A;  2F0D A;  1T5E A;  1HHV A;  2EYM A;  1ROD A;  4DAY A;  1WD1 A;  4CKC A;  3VYR A;  3J7Y W;  3M4Y A;  1HCZ A;  2IX1 A;  4J6H A;  1I6H B;  2GA4 B;  2EOT A;  2NN6 H;  4EVO A;  2I07 B;  1Y1W B;  5CV5 A;  3PIO 3;  5LL6 S;  1CM9 A;  1E2Z A;  1D2B A;  1B44 D;  1C4Q A;  3S1N B;  3K58 A;  4KY6 A;  1EY4 A;  2AQ2 B;  4HMI A;  2QIL A;  4ZKB B;  1IW7 D;  3PUX A;  3EQL C;  1SYD A;  3I4M B;  1QE6 A;  1ENF A;  3T4A C;  1BQQ T;  1LT5 D;  2PO4 A;  1PDQ A;  4Q0F A;  2A74 C;  1AFP A;  1QOH A;  2B2U C;  1BCP C;  2C5C A;  4I65 A;  1EYA A;  4ZRZ A;  2E2H B;  2D2C C;  1O7Z A;  4C1N K;  1IYV A;  5I2X A;  1D5M C;  2SDF A;  5IGF A;  1EL0 A;  4KMU C;  1BO0 A;  1Q90 A;  4NW2 A;  1SNM A;  1TWH B;  3NQI A;  1EFI D;  1BOS A;  1TS5 A;  2BA0 A;  3W3A A;  4C2M B;  4LAA A;  4KN4 C;  4PQX A;  1CHP D;  3AMU A;  1SBB B;  2BE5 D;  1EWC A;  3NE5 B;  5E4X A;  1D5Z C;  4FF2 A;  4IUT A;  1CT1 D;  4ZAI A;  2KCC A;  1TVX A;  4ZYS A;  5LL6 X;  1UAP A;  2G9H D;  5IGG A;  5G3L F;  2Z1C A;  3J81 E;  4K8J A;  2B2W A;  3TP8 A;  4CJ1 B;  1QCB D;  3KF8 A;  4X3K A;  5KIX A;  3D8G A;  3H91 A;  5C4X B;  1KAA A;  1WTV A;  1VMC A;  1MD2 D;  4DK0 A;  3C2P A;  4FF3 A;  2E75 C;  3BZD B;  3RMH A;  2A5H A;  1XTC D;  1I4P A;  4XYO A;  4ULL A;  1HFN A;  5A2Q E;  4DXG A;  3MXU A;  1GXD C;  2L11 A;  2F0G A;  1DOM A;  3PIP 3;  2F4I A;  5EBD A;  1A3V A;  3ND9 A;  4CBV A;  1B4O A;  2F0P A;  4WOR A;  1LTR D;  3D31 A;  5ELD A;  4RKL A;  1D5X C;  5IGB A;  1AZP A;  1YNN D;  3WDN A;  3GTG B;  2V4D A;  1F9Q A;  1F9S A;  4MN3 A;  3NP8 A;  2I46 A;  1FNW A;  2EZV A;  5I9O A;  4A3E B;  5CBA E;  3NQT A;  1R4P B;  3SK5 A;  1MSH A;  2XWJ B;  5FKA C;  5C0X H;  3U9S A;  1MBY A;  3A7A B;  5I9P A;  2E74 C;  1JQY D;  4FYD A;  2FMM A;  1GUT A;  1QB5 D;  3KLR A;  1BDO A;  1SE4 A;  2F0N A;  5I6Y A;  1FNU A;  3I91 A;  2PZW A;  2PCF B;  4ZKC B;  5FLX L;  4A3M B;  2WV6 D;  2X6L A;  4U68 A;  1WTQ A;  3JAM L;  3KBX A;  4BBR B;  3LX0 A;  2M2L A;  1TWA B;  3UI2 A;  3C3L A;  2HQE A;  1QNK A;  3L9A X;  5C4J B;  2B2T A;  4M1U B;  2AUJ D;  4RGT A;  5T1G A;  4UAI A;  1ESF A;  1STE A;  1GOZ A;  2AQ1 B;  2G9D A;  4IN3 A;  1E0B A;  4NKL A;  4DU9 A;  1MSG A;  3K57 A;  5CMD A;  3IAY A;  3K59 A;  2Y0S B;  1KLG D;  2HDL A;  1A2U A;  2L55 A;  3HS0 C;  3RZO B;  1SMY D;  2KCN A;  2F0J A;  3IKJ A;  4QIW B;  3NHH A;  5ELC A;  4HCE A;  4FO2 A;  5CBE E;  1C8C A;  1VCI A;  3EVQ A;  1IKM A;  1TWC B;  2VNU D;  4XT1 B;  3H6M A;  5EBC A;  1QNU A;  1Y69 U;  4TQU S;  1CTM A;  2OEO A;  4XQJ A;  1BBX C;  2DNE A;  5EKL A;  3I72 A;  2CHB D;  1PTO F;  1SXT A;  1LT4 D;  1I4R A;  1U4P A;  1EYC A;  4KKU A;  1B3A A;  5JPM C;  3VR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...