2EVBA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Lipid binding protein,transferase
molecule keywords methylmalonyl-CoA decarboxylase gamma chain
total genus 13
structure length 74
sequence length 74
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2evbA00
3AB9A 3MFYA 2K32A 3PUYA 1G291 2A6ED 1VDZA 1DD2A 3PUWA 1HPCA 1Z6HA 1GHKA 1GUNA 1HTPA 1IYUA 2AWOA 2L5TA 3CRKC 1V43A 4JK1C 1Q12A 3A7LA 3WDNA 3VA7A 2A6HD 1E2WA 1IYVA 1HCZA 2QF7A 4RCNA 1K8MA 3FMCA 1TKWB 3A8JE 2A68C 3HGBA 3PUVA 4DNRB 2DNCA 3A7AB 2E75C 1LABA 2D5DA 2EDGA 4KKSA 4TKOB 1VF5C 3M7NA 3BG3A 1Y8PB 1ZKOA 3ND9A 3VR5A 4H0LC 3VR4A 4PV1C 2V4DA 5KNBA 1H9KA 5BN5A 1K8OA 1IW7C 3EQLC 2DN8A 2AUJD 5C0XG 4DK0A 3I72A 2Q8IB 1OXXK 2B8GA 3P20A 1H9MA 5A35A 1TU2B 2KA7A 2JEAI 2LMCB 4OO1G 3PV0A 4G7ZC 3A8IE 3ND8A 5KNCA 2DNEA 4KI0A 3H94A 1H9SB 1OXTA 1VCIA 2A6EC 1ONLA 4IQZA 1V8QA 1GUTA 3I73A 4G7HC 2E76C 1O7LA 2BE5C 4KKTA 2CW0C 2BA0A 1O78A 1Y8OB 4L8JA 4OO1H 1Q1EA 2JE6I 3SE0A 2JXMB 4BA1I 2EJMA 4GZYC 1CFMA 1E2VA 4IFDH 1GJXA 3IKJA 1H9JA 1A6XA 4KHZA 3D4RA 2JEBI 5K36H 1T5EA 1I6VC 1EWHA 4I7ZC 3SDZA 1Q90A 2A68D 1DXMA 1B9NA 2BE5D 2A69C 4H13C 2PPBC 1QJOA 3D31A 5BN4A 2F1MA 1OXSC 3I4LA 2NN6H 1E2ZA 3IFTA 3T51B 3OOCA 2YYZA 4LK1C 3GD7A 2BA1A 1CI3M 2B8FA 4H44C 3OW7A 1GHJA 2D62A 3M85A 1OXVA 3MXUA 3BDOA 1SMYC 2D2CC 2NN6I 4DNTB 3VR3A 1OXUA 3T53B 5C0XH 4BA2I 2EJGC 3QG1A 1HQMC 3LWUA 2AUKA 2EJFC 2KCCA 1B9MA 3NE5B 1Y69U 1GUGA 5K36G 2ZT9C 3DXJC 3PUZA 3A8KE 3RLFA 1GUOA 1H9RA 2K33A 4KMUC 4LJZC 4XIGS 1Q1BA 4JBWA 4G7OC 4XTCS 2EVBA 4HR7B 3TZUA 3KLRA 1BDOA 5JEAG 3T56B 1VF7A 2PNRC 4TQUS 2E74C 1Z7TA 3VR2A 1FR3A 1GUSA 1FYCA 1PMRA 3QJYA 3M4YA 2O5IC 2BDOA 1IW7D 1DCZA 2K7VA 5BN3A 2PCFB 3L7ZC 3OPOA 3U9SA 3W3AA 2NN6G 2A6HC 4KKUA 3N6RA 4OGQC 3VR6A 1YNNC 2IT1A 4DK1A 2O5JC 5JEAH 2A69D 1Y8NB 4IFDG 4KN4C 1H9SA 4KN7C 3CRLC 3LNNA 2R6GA 1LACA 3QIAA 1YNJC 3FPPA 3PUXA 3GQBA 1CTMA 1ZYRC 5KNDA
chains in the Genus database with same CATH superfamily
3AB9A 3GP7A 1EL0A 2Z6BA 4LF8L 3ERSX 1V43A 4IPHA 4DV0L 4B3TL 1E2WA 3H15A 4DR1Q 1O7IA 2K5NA 4RCNA 3VA5A 1PH4A 2D9UA 2H4OA 3A8JE 2VQEQ 3NPPA 1A8VA 1Y8PB 3ND9A 1YIJA 1STHA 1YITA 1LT5D 3QOLA 1CQVA 4EQOA 3S2DH 3RUZA 5IP7G 1K8GA 1X56A 2D0OA 2RKSA 1A63A 2NZOA 1SNCA 3VDYA 1RTOA 1PYWD 1WCMG 5AFWA 1KDBA 2KVMA 1H9MA 4QL5A 2B2UA 2HIXA 3J7A5 2DNEA 2VB2X 1TWAB 4HJAA 1CK1A 2ALYB 1QZHA 3A0JA 1X55A 1ASYA 2QCPX 3U50C 2WP8J 3GTJB 4L5RC 1VQLA 5J3BA 2PZUA 2HHHL 1FJGQ 2EJMA 3H0GH 4IFDH 1PFMA 2R61A 2A69C 3M4QA 2QDBA 3A5UA 1DM0B 1HXYD 2UUAL 2HHHQ 1Y1WB 1RD9D 4FO2A 2VUMG 3SXHA 3FKIH 1K73C 3OOCA 1BUVT 1EY5A 5AJ3L 1EU3A 1S5BD 3STBD 1OXVA 1Y14B 2EYLA 4A3DB 3KF6A 1D5MC 4RMFA 4DR5Q 4A3KB 3PCOB 4LFBQ 1NJIC 1JWMD 4J8QA 4YCVA 3ER0A 3M9BA 4KLKA 4HTHA 4KHVA 1Q7YC 5IGFA 2KEDA 2XNAC 3VYTA 1FNVA 2N88A 3OW2A 4A3IH 3DEOA 3I4NG 1XPRA 3DM1A 1BCPC 1E0BA 1CZWA 1X65A 2XRSD 3TBIB 5C3EB 2J0TD 4OX9L 1STEA 3S9WA 4KHPL 3M4YA 4CDEC 3GTKH 1TS3A 3RR5A 2JA8G 3GTMH 1N33Q 2A73B 3I4NH 3K58A 1B4OA 4KKUA 2NVXB 3UE0A 2QEJC 4A76A 4G4KA 4KN4C 1PLFA 5ELEA 4DGZA 2DUDA 3S16H 1L1OA 1PYSB 4OWWB 1L2FA 1LTLA 1UEAB 2G5DA 4IFDJ 3BYTB 4OELB 4JOIC 4ZQ3A 3RMHA 2JK8A 5LMUL 3Q8DA 2K5VA 1MGSA 2UXCQ 2OWOA 3R2IA 5EPLA 2HQLA 3CHBD 2N55A 4LF4L 1A2TA 5BN5A 4KD4A 1HH2P 1VQ6A 4DR4L 1XXGA 2B39A 2P5ZX 1BQQT 2MO0A 2Q8IB 1EQQA 1SSOA 4ODGA 4ALPA 3TP6A 4ZRZA 1ZXTA 4KY7A 2K4KA 1RHPA 3KBGA 1CKOA 3S17H 2IL8A 3KLSA 3W2DA 2BA0A 1D7QA 1Q1EA 2RCFA 1A2UA 4A75A 2F0WA 1LLRD 4LF9L 2PQAB 4A3JH 1A6XA 3NWTA 1EWHA 1CKMA 1MBYA 1M8AA 1E24A 3GTOB 4DK6C 3DM3A 4J6HA 3ULLA 2SOBA 1JOOA 4LMQD 2NN6H 1GD7A 2Z1CA 2RHQB 3MEHA 3CCEA 3U58A 2ASBA 1C9OA 4X65L 4H44C 3M85A 2D62A 2JYOA 4A3KG 1YHAA 2IY5B 1SFOB 2HCIA 5I2XA 1A3TA 4GKJQ 4GLVB 4HSPA 2KCCA 2PI2E 5NUCA 2ATWA 1B8AA 1PH5A 3PUZA 3RLFA 3HKZB 4GNXC 3RD4A 4A3KH 4UAIA 5JEAG 3GV3A 1D6EC 3CQZB 2K03A 3RZDH 1Z7TA 1K3RA 3BU2A 1Q8IA 4BY1G 4KY5A 1STAA 4NMZA 3WWVA 4A4IA 2A6HC 4ZUJA 1YNNC 3WOFA 5I6YA 3JAML 4HCSA 5JEAH 1K3BC 2KCNA 5KRUA 1PZID 5JEAJ 3A54A 3GTKB 1LTBD 3KK7A 1CSQA 1VMCA 1ENAA 3ERQA 1CT1D 1N34L 2A6ED 2VB3X 1G6PA 1D8LA 1GHKA 3UDFA 1DOKA 1FGBD 5KNCA 3WDNA 3X3NA 5FO9B 3CPWA 1WTOA 1IYVA 4DV0Q 4DV6L 4UP7A 4DV3L 4CJ1B 4DNRB 2DNCA 2ZJQA 4R4TA 4O0AA 5JPNC 4Q0FA 5IIFA 1EY8A 1J5EL 1C48A 1L0XB 1IXRA 2Z4HA 4A3FG 4DF7A 2UU9L 1PZJD 2AUJD 1VQAA 4R4IA 3BS1A 5FK9C 2WB1G 1RTNA 4H7BA 4RWSC 2B63B 1JC7A 2F4IA 4K6DA 5M9OA 4G7ZC 2WINB 4F7XA 2JA8H 4Y52H 4U68A 1VCIA 3K57A 4A3LG 3MWYW 3AFPA 1O7ZA 1MSHA 4R1JA 1SNMA 1NCVA 3J81i 1LO5D 3SE0A 3R93A 4A3BB 3BZCA 1H95A 2PO4A 4KHZA 1KAAA 3UDGA 5M3MH 2UUCL 2WIIB 1DXMA 4DV6Q 3GTLB 2JA6H 2F3WA 1XNQQ 2JN4A 3F1ZA 5BR8L 3NWSA 5FKAC 1W6KA 4IUUA 4DV2L 3M3YH 3J80c 1VQ7A 1S4ZA 1B3AA 2QW7A 1I3QH 4HMIA 4C3HB 2NZ1D 1SNOA 1PH6A 2F0LA 3I90A 5FLXE 5FLXc 1S5ED 2UXDQ 1FL0A 1X3QA 4RGTA 4XQNA 3NQIA 1SMYD 1DJRD 4XTCS 4X62L 1SMXA 4N9PA 2ICEC 2PNRC 2AWNA 1IZ6A 1QB5D 1PTOC 2K28A 3G7LA 2K05A 2L11A 4JI8L 2E2IH 2KBNA 1LTTD 2PCFB 1B7YB 3L7ZC 3OPOA 5JAVA 1GVPA 3EA6A 1RKNA 2PNHA 4FP5D 2TSSA 4WJ3M 5IGGA 1YJNA 4A3JB 3A74A 3PUXA 1E1OA 2KJXA 4DR2L 2KOLA 3KFUA 2I5LX 1VQGA 2ZM6Q 2XSCA 2B29A 1WI5A 4GKJL 1ESRA 1N36Q 1EZ8A 3ONAB 1A15A 5GROA 2JA7B 1KTKA 3CKIB 2ZXPA 4O2DA 2GVAA 5IYCH 2VZAA 3HOZB 2ICIA 1SLJA 5KEEA 1T9HA 4DV5Q 3S1MB 4DR2Q 2NBFA 1I50H 4F8MA 1KL9A 4JI2L 2PI2A 1EY4A 1KIXA 2JA5G 4K14A 1UE1A 2SDFA 2RQXA 4B3MQ 1D2BA 1TWGH 1XMOL 4LF7Q 2K6AA 4QUFA 1P8LA 1BBUA 2HQEA 1TS4A 4YCUA 3NHHA 1ONLA 1V8QA 2QILA 1E7ZA 3NK9A 2JA5H 5IY0A 1PH3A 2QDLA 3KF8A 2F0TA 2JE6I 3ICEA 1VQIA 1AFPA 2E5LQ 1QWYA 3S1MH 3PIP3 3CCQA 1JB3A 1YHQA 1B44D 1SYFA 3PIOA 1TWHB 5BN4A 2EOTA 1R9TB 5CBEE 3HOXB 1TY0A 3J80E 2IW3A 4G57A 2EY1A 1YBYA 1F9RA 3QG1A 5IWAL 5E4WC 2H5XA 5CV7A 3CCLA 4OEMB 1VS0A 5JOBA 1IBLL 3HOYB 4DUYQ 4RAUC 1BDOA 1HJPA 1NR2A 2F3IA 3PQIA 4IPGA 4J1MA 4JI5L 4JVZA 4I65A 4YWKA 2Y0SE 2IHEA 3SR1A 4FVMA 2K7VA 2WKCA 2PMZE 3S1NB 1I94Q 4V0BA 1L1OB 4YHHQ 1JWSD 1HA6A 4JI7Q 4IOCA 4POGA 2EYFA 3U9OA 4C3IB 3H0GG 2O2LD 4IPCA 4IFDG 4JI5Q 2R6GA 3TP5A 5JVH3 1CA5A 1NR4A 2KHSA 4JI0L 4DAPA 3PUWA 1JCKB 1EEID 1BO0A 1RDPD 3A7LA 2E5LL 2LKVA 1WTPA 5C44B 1WJJA 2F4VL 2R7ZB 3HGBA 1M4VA 4BY7G 1TWCH 2EDGA 3M7NA 1E3PA 1UE6A 4H0LC 1PH2A 3PO2B 4L63B 1SFOH 3K6OA 2OXPA 1CHPD 1S5FD 5I9PA 4IFDI 3UDXA 3I56A 4IPDA 2L0CA 4B3ML 2ZTEA 2VQFL 4JYAQ 1VQ9A 2JA6B 2B8GA 2KA7A 5DM63 3HOUB 1BCPB 3A8IE 1Y1WH 2WV6D 1PXUA 4TVAB 1J6QA 2J4XA 1XMQQ 3HOWH 1V1OA 2EQSA 1V9PA 5FLMH 4G7HC 3W1GA 2Q2HA 2CW0C 2WAQG 4PMCA 1N36L 2J7ZA 4IUPA 1Y1VH 4NXMQ 3I4MB 1BR9A 1SNQA 1I94L 1EQTA 4Y7NB 1ILPA 2B2YC 4BBSG 1BKBA 3I4LA 1OXSC 4DV5L 4DV7L 1LTRD 1NAPA 3T51B 3J80i 5K5PA 1XNRL 3T1HQ 2R92G 1K8AC 4AIMA 4FNFA 1V1QA 4IJHA 3L0OA 1ENFA 1J5EQ 3MFGA 3VYRA 4WFN3 3DUZA 3FKIB 3I8ZA 1N32L 5C4XB 1JICA 3DXJC 1YVCA 2C5CA 3A8KE 5KYLA 4XQJA 1AZQA 2B2TC 4KMUC 1Q1BA 3EJIA 1TY2A 4FXDA 3J7AF 5C4XG 1PRTD 2NVXH 4QF4A 3VR2A 1FR3A 3CD6A 4BY1B 1Q81C 1MHWC 5M3FG 2BDOA 1IHZA 2CH4W 2F0OA 4DR3L 4B3SQ 4IURA 3W3AA 4JI3Q 3FP9A 5IP7H 2NTTA 4X64L 3H91A 4LUOA 1XNQL 4NXNQ 5JJLA 2CWAA 1ZYRC 5KNDA 1HNZQ 3PUYA 3D6WA 3E9IA 1IYUA 2AWOA 4B3RL 5EBDA 1EWIA 1HCZA 2QF7A 1LM0A 3HOXH 2D5DA 3GTGH 1DZ1A 2F52A 4K2LA 4U673 3TREA 2ZJRA 2DY8A 4HIKA 4KTAA 1WYDA 1WTQA 5IODA 2DN8A 3NP8A 4EGVA 2H1EA 3P7JA 4QGUA 3GTQH 4QY7A 1FD7D 3R8BA 1KDAA 2WKDA 5CV6A 2K50A 5DAUA 2Z6KA 1SE3A 4JI1Q 4PZ6A 1OXTA 4BY1H 3GTQB 2HDMA 3K80C 2X69A 2NWGA 3Q0AA 1JOQA 2WB1B 2YV5A 2BOSA 4GZYC 1BVSA 1CA6A 2MGSA 4WRDA 1W3SA 2GA4B 4ME5A 1L0WA 1W2BA 1XTDA 2CW0D 5CR3A 4DAMA 2AMCB 4RHSA 2E2HH 1I4RA 4HSVA 4LF6L 3IAYA 3GTJH 2PPBC 2F1MA 3OW7A 5IP9H 1EYGA 3S14H 2VUMH 2EY5A 4DV7Q 2EZVA 4RHRA 5CORA 4BBSH 4GOPA 3CU7A 2EJFC 4DKAC 2ZT9C 3MEFA 1N34Q 1H9RA 1Q8KA 4XIGS 4G7OC 2CQOA 3Q22A 4R8NA 3J7AV 1JE4A 3I4NB 3KLRA 3P75A 1QVCA 1K83H 4DAYA 4LUZA 2E74C 4GN4B 3K5MA 1QUQA 4A3LH 5CV9A 4JCVE 4BBRB 3BDLA 3CCJA 3A55A 3KDFB 5C5LA 3J81L 3I2ZA 3E0EA 3N6RA 2OCEA 3CQZH 3U4ZA 4JI7L 5EPKA 3TZDA 4KN7C 4DR3Q 1K0RA 4B3SL 1LACA 3HG9A 4EQPA 2WAQE 3MAQA 3CC4A 3GTMB 2B63H 3MXGA 3ITPA 2R7ZG 1M1KC 3FRPB 1Q12A 3OSOA 1HFNA 1NE3A 1R9TH 1WTRA 1TR5A 3A7AB 2MUYA 1ZKOA 3VR5A 1NMFA 1S40A 3PF5A 2OQ0A 5KNBA 4LFBL 4R8IA 4DR5L 2X6LA 4GN5A 5JJZA 1K8OA 1IW7C 4I7AA 5TSSA 4EX5A 3URYA 3KBXA 4GN3B 5GAEC 1TU2B 2JA5B 4LF9Q 3NQTA 5CV4A 2Z6KC 1WTVA 4AH6A 2NYZD 3H94A 1AW7A 1SE2A 2A6EC 3PF4A 1YHBA 4KHPQ 1GUTA 1SYGA 5HURA 4OX9Q 3Q24A 2BE5C 1Y8OB 2F0KA 4CBVA 2CFMA 3C1EA 3TRZA 2B2WA 2RCNA 1KLUD 2DY7A 4O1NA 4I7ZC 1VQHA 2RSNA 5D65A 4MHEA 1VQBA 1XMOQ 1G51A 4JBMA 1QJOA 1VQ4A 3MTSA 3HOVG 1Q46A 4OHJA 3C2PA 2BA1A 2E2HB 1DYQA 3FKIG 5T1IA 1PRTC 1BNZA 4K8JA 5H1SE 1PA6A 1U5KA 1I4XA 3TMEA 2EYJA 4K5VA 5ELBA 2ZXRA 2YTXA 4RGOS 5ELDA 4EVOA 4MIUA 4NPSA 4HCEA 4DA2A 4POFA 3I4OA 2NUCA 3HP3A 4TQUS 2JA8B 2KEEA 3LWEA 2B3GA 1CM9A 4IJLA 2UUBQ 5BN3A 2KECA 2KUMA 4CKCA 1NUCA 2WB1E 3SGIA 2M9VA 4NXML 1N8RC 2A69D 3KUPA 3L9AX 1Q3LA 3LNNA 4PZ8A 4DFAA 4JI4Q 1YNJC 3GQBA 5EPJA 4FF4A 3PMFA 1SYBA 3ULPA 2HD3A 2JA7G 5IP9G 1CHQD 3VA7A 1F2ZA 1FJGL 4BXXG 4PMBA 4BWGB 2MP1A 4UY8C 3C1FA 2R3ZA 5C44G 3O13A 5J22A 2XVSA 3JC66 3T1YL 2YTYA 4FF2A 1GO3E 1OTCA 2Y0SB 3X3MA 1ML0D 4GS3A 5JJIA 2PMZB 5C0XG 3KF6B 2VQEL 3I72A 1SYCA 2CCZA 3J81E 2BDNA 1VQDA 3PV0A 5EGTA 3RZDB 3I55A 3CC2A 1RJTA 1ZYRD 3F2DA 1UWVA 4J15A 4HIOA 4DV2Q 1SXTA 4A93H 5JVG3 1O78A 2DGYA 5COYA 2B63G 2OEOA 1RCVD 1JT8A 2CKZB 3CCMA 5E4XA 2JEBI 3TS2A 3TDQA 2KHIA 5C0XI 1L0YB 3SDZA 1U0LA 5DM73 4ILWA 1S3OA 2A68D 1EIYB 4JI0Q 3E3XA 5KYIA 1PYBA 3E5SA 3F2UA 4A93G 4OIJA 5J39A 1CZGA 4CHTB 2OF1A 1FNWA 1AE3A 2F0VA 5IT9c 2R92B 3KJOA 2A74C 1MIUA 1SEBD 3L3OC 3GTOH 3NBHA 2D2CC 2NN6I 3SK6A 3RLOA 4C3IH 1OXUA 3T53B 4JI8Q 2KQ3A 2XGTA 4ZAIA 1B9MA 1TS5A 2BCOA 5IE8A 1R4PB 4KK7A 1GUOA 1KNAA 5LMNQ 4ZCKA 4LJZC 2FXQA 2E2DC 4DUZQ 4KJNA 4GKKQ 4YY3L 3J81j 3BVGA 2O5IC 3K5NA 2LSSA 1VQJA 2K04A 2JQOA 2NN6G 1ICFB 1AZPA 4OGQC 3VR6A 3K7UC 4L5SA 3CRLC 3LX0A 1T5XD 4IUQA 2DJFC 1EY9A 4C3JH 4GLXA 1VDZA 1DD2A 3NTKA 1YJ9A 1TWHH 1GUNA 5E7NA 1TWAH 4JK1C 2R92H 2CWPA 1HZ9A 2E2JB 1K8MA 1IBMQ 3FMCA 3D3RA 3VR4A 2JP1A 4DV1Q 4P72A 2AHOB 5IT9E 5EBCA 4XXEA 4A3BG 1QG7A 3EQLC 3AU7A 4QIWE 4QIWB 2IX0A 2F0FA 1LTAD 2HIVA 1KC8C 3AQQA 2F0DA 5HY6A 3HKSA 3NSWA 3H6MA 4DR1L 2QKIC 1C7YA 2Q8TA 5E1FA 1QNKA 4RKBA 1GUWA 1O7YA 3HZXA 3F2BA 3S1NH 1LYLA 4QMGA 2OTLA 5FO7B 2YU9B 3EROA 1IL8A 2VS1A 1VQOA 3N52A 4KKTA 4CGYB 4DV3Q 1LT3D 2N3SA 1I5FA 4A3FB 1HZBA 4LFCQ 2LS01 3Q6SA 4K5WA 1WTWA 4H13C 3SK8A 2K5WA 2F0UA 2PQEA 4C56C 3HOXG 1LT4D 1EFID 4IUNA 2Q2UA 1JMCA 1XWEA 2B8FA 5IT9L 3UI2A 4R4CA 3S24A 3BDOA 1S5DD 4JI3L 3BJUA 4DK3C 5C0XH 3CP0A 2DJGC 1K83B 2L55A 2RVLA 4KD3A 1Y69U 3NE5B 5M5YB 4CJ0B 1HR0Q 3I4MH 1UNSA 2MFIA 1YI2A 1AH9A 1ESFA 2K33A 5JJKA 4X62Q 3R2TA 1PH9A 4P74A 1D5XC 4B3RQ 1O80A 2F0QA 4BBSB 2A19A 3TN2A 5I2YA 5C0XJ 3L2PA 4AQYL 1PMRA 4K0KQ 3HOWB 5M5WB 3HOYH 4YIJA 3GTPB 2B2VA 2ID0A 1U4MA 3G71A 2R93B 2JJQA 5I6WA 2K5QA 5GAHC 1EFWA 3G6EA 3OMCA 1VQKA 3QIAA 3KLSX 2AQ2B 3OTOL 3MFYA 4HEDA 3S1QB 4IOAA 1WFQA 1HTPA 1VQCA 4PQXA 3CRKC 5LL6S 1JORA 1YJWA 3DWPA 3HOWG 4K2KA 3NXWA 1BOSA 4N8FA 4LFCL 1J8IA 3D4DA 4L5QA 5EKLA 5M5WH 4KKSA 1VF5C 4C3JG 1SRUA 4LUVA 3SVMA 2EYOA 4WJWA 4GKKL 2F0GA 1LT6D 4Q5VA 5AJ3Q 4XT3B 1ET6A 3P20A 4CJ2C 5A35A 3NTHA 4B08A 3DLLA 4OO1G 5ELCA 2IJ0A 1TIID 2VW9A 2VQFQ 4JYAL 2EXDA 4A3MH 1PFNA 1KDCA 5LMUQ 3M7GA 5DNFA 1GJXA 4EQNA 4ULLA 1VQPA 1Q90A 1A62A 1IYJB 1Y1VG 4JBJA 5D3IB 1HQRD 4JPBW 4P75A 3GO5A 4H02A 1Y1VB 1EY7A 1BF4A 1I4PA 2PQAA 3HRZC 3B6YA 5M3FH 2VY3A 2Z8LA 5CBAE 4DV4L 4BA2I 5CV8A 1AP0A 1HQMC 3LWUA 1X54A 2Q2TA 2K01A 2LXKA 2C35B 3FPUB 4B3TQ 1M90C 3QOJA 5GQOA 1I6HH 1X3PA 2G9DA 2QA4A 2A1AA 1XJVA 2FMMA 1FYCA 3QJYA 5C4XH 3WOEA 1IW7D 3K5OA 4GNXB 1RL2A 5J1ZA 2B2VC 1EQRA 3MXNB 1EU4A 1HUMA 1FGUA 2IT1A 3S15H 5C3EH 2L4NA 1YEZA 2KHJA 1LTID 3D0FA 5ELOA 1CUKA 2G9HD 1DGSA 2GN5A 3OWEB 4IO9A 5FJ8H 3HOYG 1WD0A 1VQFA 1Z6HA 3IL8A 4LFAL 1ICWA 1XX8A 1I4HA 3KF8B 1CQFA 4DUYL 1LUZA 3S1RH 4F87A 4DV4Q 4BBRH 4X3SA 2RF4A 4DR4Q 5FJ8G 3ZYYX 4PV1C 2ENBA 2K5HA 2R7FA 4CKEA 4A3CG 4JBKA 4X64Q 1H9KA 1PFSA 2F0HA 1WCMH 2I46A 1SE4A 3OMGA 3PSIA 3NBHB 5DLQE 2ZTDA 3CAMA 2LMCB 5E3FA 3J81c 3ND8A 5ELFA 1CKNA 5D14A 4KI0A 3E9HA 4LF4Q 1EQVA 5CMDA 3F8TA 5I9OA 3I3CA 1IBLQ 2F0JA 4JG2A 4KY6A 4L8JA 2F4VQ 4OO1H 1AE2A 1WOCA 3K81C 3STBC 5FLXL 1PTOB 1IBKL 4LF8Q 1SNDA 1QOHA 2I0QA 3MA2B 3BZKA 4A3MG 4BXXH 2AKWB 4RCOA 1NSNS 1C0AA 2I5MX 3I91A 2YYZA 4ZK9B 4JI2Q 5C44H 1PZKD 2RA4A 3NUCA 1GHJA 1BBXC 3UE1A 1QCBD 5EAYA 1A3UA 3V2TA 1Y1WG 2B2TA 4A3GH 5F2DA 4ZKBB 5LL6X 3A56A 3Q23A 4TSSA 1QVFA 1D1KA 2EY6A 4A3DG 3T16A 3EIVA 4JV5Q 5K36G 1Q86C 5C4HA 5ELNA 3U4VA 4DN4M 4NP5A 4A3GB 1G91A 1ILQA 2SEBD 4GLAC 1HNXQ 2UXBQ 1B3QA 1UEBA 2SNSA 1HNWL 4ZYSA 4C2MH 4ID6A 1NNXA 3HOZH 4DAVA 4QB4A 1NY4A 2K5DA 1II3A 4HJ9A 1EIFA 1XTCD 2LXJA 3VYSA 1H9SA 3TEHB 4K8IA 3V96A 3FDTA 1HUNA 3BDCA 1YNXA 5IGBA 5IYDG 4QJFA 1EY6A 3RNUA 1HR0W 4YWLA 1WCMB 4HMJA 4LF6Q 4FYDA 3G48A 1MJEA 4TKOB 4MNOA 5IYDH 5C3XA 4DPGA 2PZWA 1D1IA 3NENA 3M4OH 4UDUC 2RDHA 1QNUA 1EZ6A 4LF5L 3H3VI 2LFNA 3JAMc 2XRQD 5T1GA 4YHHL 2OT2A 2JEAI 2TMPA 2HDLA 1VQNA 1F2MA 3AFQA 4X3KA 1S5CD 3HS0C 5IGEA 1EYAA 4IUVA 3G6JB 2ZJPA 2K14A 1RIPA 1VMPA 4IALA 3D8GA 4CDDC 3VYUA 2JXMB 4BA1I 2NVYH 3J7YW 1S72A 2C9OA 1E2VA 1F2YA 2NZHA 4RFBA 2HCCA 4OONA 3NBIA 3M3YB 2EXZA 3S14B 4HAEA 1DONA 1J9OA 4Z9CB 1JE5A 2XTIA 1RF2D 4FF1A 1WTXA 1KLGD 1E1TA 3DWQA 4XDXA 2RDFA 2MNAA 3SEBA 5C4ZA 2KCTA 3HOVH 4NXNL 1JJ2A 5IYBG 2PYKA 4NB3A 4C3HG 4JI1L 1STBA 3IFDA 2VNUD 1HTLD 4X66Q 1KD1C 2EJGC 2PZTA 1EWCA 3HOVB 1CKNB 1BCPF 1Z47A 2AQ3B 2F0SA 3D4WA 3RZOH 4AYBG 4JBWA 3TZUA 4A3GG 3GDEA 4AQYQ 3OIPA 4BS9A 5C6AA 3KJPA 2EYPA 1SJED 4C3HH 3H3VC 4AYBB 2A8VA 1GKHA 2RBMA 1EOVA 5EKKA 2K52A 2WACA 1UAPA 1V1PB 1NMGA 1JR0D 4TRDA 4R4QA 4UP8A 3ZJYC 1NBWA 2XIWA 1MKHA 4A3IG 1GM5A 2K32A 1KAWA 1C4QA 2EIFA 3G4SA 5L37A 3TS0A 2A5HA 2ZTCA 1N32Q 2F3VA 4JI6L 4QCLA 5C5MA 2L15A 1U4PA 2EYMA 3S16B 1TKWB 2PW7A 2QEXA 5G3LD 1XYIA 2E75C 1LABA 5D3DA 1PRTB 1U4RA 3BG3A 3K59A 1JJGA 1CSPA 3FVQA 2V4DA 2JA6G 1PTOH 1DOMA 1JQYD 4CDFC 2Y0SG 2MJ8A 1F9PA 4A3IB 5I4DA 4IN3A 2IPKD 1OXXK 4PG3A 4P73A 2FFKB 1EEFD 3EVQA 4JI6Q 4FDBA 1SAPA 3HOZG 3MHBA 2QGQA 1H9SB 4QUCA 2E2JH 2WAQB 3DWAA 4IQZA 2N78A 4X65Q 2R7ZH 1LV9A 1XNRQ 1K9MC 1SN8A 4ME3A 1HZAA 3H3VH 2KCMA 3FEWX 3M4PA 4WORA 4O42A 5M3MG 2MHVA 5IOCA 1SYDA 3CCUA 2IX1A 1U9RA 4IUTA 2Z0SA 1TWFH 2B2UC 4N9TA 3I70A 1X3EA 3LGJA 4L6TB 2NB0A 3D31A 4RA8A 3E6ZX 3EBEA 1HHVA 1E2ZA 4RKLA 2K1BA 4YY3Q 4DNIA 1PH7A 3S1RB 1KABA 1STYA 3K5LA 1JWUD 4LWCA 5LMNW 1BXTA 1E22A 4ZLTF 1QE6A 3HKZE 1XMQL 5DEHA 1IL2A 1LTGD 4MZ9A 1B50A 1HRJA 1KQSA 3NEMA 1GUGA 3NELA 1MSGA 1TS2A 4OWTB 1GXDC 5IYBH 4HR7B 1X3GA 3H09A 4HN7A 4OWXB 1TWGB 4N8X1 1VF7A 1B53A 2MQHA 5CV5A 5IYCG 1PVOA 2FMCA 2SNMA 4DUZL 1G2TA 2UXCL 1P16A 3DEPA 5LMNL 5FOBB 1TVXA 4ZUIA 2IHFA 3HKZG 1IBKQ 2V1CC 5GAGC 3M4OB 3KYHC 4A3BH 3K8AA 4B9XA 3FPPA 2HUGA 5FO8B 2R93G 1CTMA 3TQYA 4LNQA 3U9SA 1RODA 1TWCB 1G291 1V1PA 4A3EB 1HPCA 4X6AH 3PO3B 2KENA 2L5TA 4K6LA 5IWAQ 2NVTH 3E0JA 4DR7L 3S17B 3PO3G 4P2CB 1B1ZA 3PUVA 3HOUG 4X3UA 2F0PA 2MPMA 1BCPD 4B9WA 1DOLA 3PO2G 3CCVA 1HNZL 1B2TA 3MZ5A 1HZCA 2L1BA 1VQEA 3KOJA 5C4JH 5HGTA 4WJ4A 2JA9A 5M5YH 4E6IA 1MD2D 1PTOD 2D0PA 3I7FA 3OIQA 3UDIA 3BYYB 2M00A 3FHWA 1VQ8A 4HJ8A 2EPBA 1PHJA 1KRTA 2ES2A 1UE5A 3I73A 2JA7H 4UP9A 4CDCC 2E76C 3JAMi 5KGUA 2F0MA 1G2SA 3GTGB 3MXNA 2I07B 1K28A 3PIPA 4APVA 3OWFA 2CHBD 3T1YQ 2VL6A 4GOPC 1F9SA 1H9JA 3DHQA 3HEJA 3I4MG 1T5EA 4A3MB 1FVIA 1JB7A 2IWHA 3AEVA 1WD1A 3J80L 3T1HL 4K5XA 2RSOA 2NVTB 4XT1B 3C46A 1FNUA 1HNXL 2UXBL 3V05A 4LK1C 4BBRG 5M3MB 2UUAQ 2NVQH 2E8GA 2X6GA 3MXUA 1SMYC 4DNTB 4DU9A 2MO1A 1QILA 4OXPA 4JV5L 4DAYB 5ISRA 3CW2C 2VXWA 1X9NA 5M5XB 3K0XA 1NTGA 4P71A 4DR7Q 2EE1A 4FXKC 3CMAA 2VUMB 2FINB 3EFXD 3GTPH 2M2LA 4PMWA 4JI4L 4BY7H 2LY7A 3RN2A 4GOPB 4QQBX 4NW2A 3S15B 1ET9A 2Q2IA 3TP7A 3RN5A 1GUSA 3CF5A 3F2CA 2CVRA 2YTVA 2UXDL 4R9WA 2O5JC 2UUBL 4DK1A 3QB3A 2ZM6L 4KV6A 5KIXA 1TT2A 2K75A 4R4OA 3MC0B 5CC4A 4C3IG 4A3JG 4A3EG 4X3TA 4Y7NH 3BVMA 5FLMG 4NKLA 4L5TA 4V190 2Z4IA 1YNND 1STNA 1F2LA 2A6HD 1EIGA 1F77A 2XWJB 1SNPA 3EN2A 2A68C 3K0YA 2F0IA 3SK5A 3W1BA 4DXGA 4A3EH 1IKMA 4X66L 4OO1I 2NTSA 2L12A 3D6CA 3CCSA 1SYEA 5A2QL 2F0NA 4DR6L 2R7DA 1D5ZC 1SDFA 1HA5A 4MN3A 1SROA 1Z9FA 1TQOA 4MTKA 1XPOA 1W6JA 3PO2H 1SR3A 1PH8A 5C4JB 2NVYB 1MI2A 4LFAQ 3CXCA 4EQ5A 3C3LA 4C2MB 4K0KL 1I3QB 1O7LA 5EQ0A 4F88A 1BBWA 2R93H 2OQKA 2B2YA 5LHY1 4XQQA 1YZ6A 1CFMA 4C1NK 3D4RA 1C8CA 1I4QA 1JOKA 1KHIA 2F03A 1I6VC 1UE7A 3T13A 2YU9H 2UUCQ 2NVQB 1B9NA 2OTJA 2UU9Q 3OTOQ 1MJCA 4A93B 3PO3H 4JOIA 3HOUH 1WVLA 1VQ5A 2HT1A 1QVGA 4YWMA 3GD7A 2O4XA 1CI3M 2AQ1B 4FF3A 5A2QE 3GTLH 5HGQA 1YNJD 2PW5A 3CPFA 4XYOA 3QO2A 3RLNA 4KJOA 4RGMA 5EJWA 1OO9B 1IBML 1KXLA 1SJHD 3GV6A 1AEXA 4A3FH 1AN8A 1G6ZA 2IX3A 4M8AA 4HJ7A 1R4QB 3AMUA 5CGKA 4FXGC 1KRSA 3T56B 2GVBA 4DR6Q 2FHTA 4JC0A 3S2HH 2XWBB 2JSOA 5JPMC 4IZ8A 4LF7L 1DCZA 1UUPA 5C3WA 3QR8A 1EUJA 4S3SA 4C3JB 1EIHA 1X3FA 2BH8A 3K7AB 4LW1A 4HIDA 1GOZA 3W5OA 3H0GB 4LF5Q 4RG1A 3KDFA 3T4AC 1G8ZD 1Q82C 4ZKCB 5G3LF 1A3VA 3A5ZB 5BR8Q 2ZXOA 4DXFA 5IGCA 3CMEA 3ULJA 2I5HA 4CKBA 1PV4A 1PDQA 1PRTF 3NTIA 3CC7A 3BZDB 5M3FB 3TSSA 1HNWQ 3S1QH 1X32A 1I4GA 1F9QA 4AYBE 1VQMA 3K7AH 3PGZA 4OL7A 4DV1L 3P1HA 1EYCA 1QUQB 2N49A 4HIMA 4A3CH 4DK0A 1PTOF 1ENCA 1U4LA 3JAME 1ZEQX 2WFWA 3MXPA 4GNXA 4YCWA 4BY7B 1SBBB 3SK4A 1TXYA 1EY0A 3R3OA 1WTHA 3S2HB 1A0IA 2CH4A 1X6OA 4PNYA 1K0SA 1EYDA 1EOTA 2EYHA 1QZGA 4ABNA 3CCRA 3MVVA 5CYUA 3HFZB 4C1NI 5M5XH 2BH2A 3IKJA 5K36H 1IKLA 3IRBA 2BE5D 4XYQA 1SE8A 4JW0A 4RH6A 4RGNA 3QWNA 1KNEA 2EY2A 2Z9HA 4MTNA 3IFTA 1JJCB 2L9HA 5IGDA 1PFBA 4PZ7A 3J7ZC 4M1UB 1TWFB 1L1OC 3OYYA 3KLWA 5EKIA 3VR3A 1HR0L 3DMUA 4UHVA 2AUKA 1B70B 1N9WA 1PH1A 1N33L 1I50B 4LAAA 1STGA 3TP8A 4A3DH 2RHSB 3AYHB 2N8NA 2EVBA 4OIKA 2Q8RE 2CQAA 4UPAA 3PIO3 1XPUA 3RZOB 3BVZA 2XN9C 3SHLA 1I6HB 3S2DB 4HJ5A 4NDXA 1Y8NB 2F0EA 1LTSD 2FJ2A 2RDGA 5GADC 1HFGA 2B2WC 5C3EG 2E2IB 3OHXC 1ASZA
chains in the Genus database with same CATH topology
3AB9A 3GP7A 1EL0A 1V43A 1E2WA 4RCNA 3VA5A 2D9UA 2H4OA 3A8JE 3NPPA 1Y8PB 3ND9A 1STHA 1LT5D 3QOLA 1CQVA 4EQOA 3RUZA 2RKSA 1SNCA 1RTOA 1PYWD 5AFWA 1KDBA 2KVMA 1H9MA 2B2UA 2DNEA 2VB2X 1TWAB 1CK1A 2QCPX 2WP8J 3GTJB 2PZUA 2EJMA 4IFDH 1PFMA 2R61A 2A69C 2QDBA 1DM0B 1HXYD 1Y1WB 1RD9D 4FO2A 3SXHA 3OOCA 1BUVT 1EY5A 1EU3A 1S5BD 1OXVA 4A3DB 2EYLA 1D5MC 4A3KB 1JWMD 4J8QA 4HTHA 4KHVA 5IGFA 2KEDA 2XNAC 3VYTA 1FNVA 2N88A 3DEOA 3DM1A 1BCPC 1E0BA 1CZWA 2XRSD 5C3EB 3TBIB 2J0TD 1STEA 3S9WA 3M4YA 1TS3A 2A73B 3K58A 1B4OA 4KKUA 2NVXB 2QEJC 4G4KA 4KN4C 1PLFA 5ELEA 4DGZA 1UEAB 4IFDJ 3BYTB 4ZQ3A 3RMHA 1MGSA 3R2IA 5EPLA 3CHBD 2N55A 1A2TA 5BN5A 4KD4A 1XXGA 2B39A 1BQQT 2Q8IB 1SSOA 4ODGA 3TP6A 4ZRZA 1ZXTA 4KY7A 1RHPA 3KBGA 2IL8A 3KLSA 3W2DA 2BA0A 1Q1EA 1A2UA 2F0WA 1LLRD 1A6XA 3NWTA 1EWHA 1MBYA 1M8AA 3GTOB 4J6HA 2SOBA 1JOOA 4LMQD 2NN6H 2Z1CA 3MEHA 4H44C 3M85A 2D62A 2JYOA 1SFOB 2HCIA 5I2XA 1A3TA 4HSPA 2KCCA 5NUCA 3PUZA 3RLFA 3HKZB 3RD4A 4UAIA 5JEAG 3GV3A 1D6EC 3CQZB 2K03A 1Z7TA 1Q8IA 4KY5A 1STAA 4NMZA 2A6HC 4ZUJA 1YNNC 3WOFA 5I6YA 3JAML 4HCSA 5JEAH 2KCNA 5KRUA 1PZID 5JEAJ 3A54A 3GTKB 1LTBD 3KK7A 1VMCA 1ENAA 3ERQA 1CT1D 2A6ED 2VB3X 1GHKA 5KNCA 1DOKA 1FGBD 3WDNA 3X3NA 5FO9B 1IYVA 1WTOA 4CJ1B 4DNRB 2DNCA 5JPNC 4Q0FA 5IIFA 1EY8A 1C48A 1L0XB 2Z4HA 4DF7A 1PZJD 2AUJD 3BS1A 5FK9C 1RTNA 4H7BA 4RWSC 2B63B 1JC7A 2F4IA 4K6DA 5M9OA 4G7ZC 2WINB 4F7XA 4U68A 1VCIA 3K57A 3MWYW 1O7ZA 1MSHA 1SNMA 1NCVA 1LO5D 3SE0A 3R93A 4A3BB 2PO4A 4KHZA 1KAAA 2WIIB 1DXMA 3GTLB 2F3WA 3NWSA 5FKAC 1W6KA 4IUUA 1S4ZA 1B3AA 4HMIA 4C3HB 2NZ1D 1SNOA 2F0LA 3I90A 5FLXE 1S5ED 1X3QA 4RGTA 4XQNA 3NQIA 1SMYD 1DJRD 4XTCS 4N9PA 2ICEC 2PNRC 2AWNA 1QB5D 1PTOC 2K28A 3G7LA 2K05A 2L11A 1LTTD 2PCFB 5JAVA 3L7ZC 3OPOA 3EA6A 1RKNA 4FP5D 2TSSA 5IGGA 4A3JB 3PUXA 2KJXA 2KOLA 2XSCA 1ESRA 1EZ8A 3ONAB 1A15A 2JA7B 1KTKA 3CKIB 2ZXPA 3HOZB 2ICIA 5KEEA 3S1MB 2NBFA 4F8MA 1EY4A 4K14A 2SDFA 2RQXA 1D2BA 2K6AA 4QUFA 2HQEA 1TS4A 3NHHA 1ONLA 1V8QA 2QILA 3NK9A 3KF8A 2F0TA 2JE6I 1AFPA 1QWYA 3PIP3 1JB3A 1B44D 1SYFA 1TWHB 5BN4A 2EOTA 1R9TB 5CBEE 3HOXB 1TY0A 3J80E 2IW3A 4G57A 2EY1A 1F9RA 3QG1A 5E4WC 5CV7A 5JOBA 3HOYB 4RAUC 1BDOA 1NR2A 4J1MA 4I65A 3SR1A 4FVMA 2K7VA 2WKCA 3S1NB 4V0BA 1JWSD 1HA6A 2EYFA 3U9OA 4C3IB 4IFDG 2O2LD 2R6GA 3TP5A 5JVH3 1CA5A 1NR4A 2KHSA 4DAPA 3PUWA 1JCKB 1EEID 1BO0A 1RDPD 3A7LA 2LKVA 1WTPA 5C44B 2R7ZB 3HGBA 1M4VA 2EDGA 3M7NA 4H0LC 3PO2B 4L63B 3K6OA 2OXPA 1CHPD 1S5FD 5I9PA 4IFDI 2L0CA 2JA6B 2B8GA 2KA7A 5DM63 3HOUB 1BCPB 3A8IE 2WV6D 1PXUA 2J4XA 1V1OA 4G7HC 2CW0C 4PMCA 2J7ZA 4IUPA 3I4MB 1BR9A 1SNQA 1EQTA 4Y7NB 1ILPA 2B2YC 3I4LA 1OXSC 1LTRD 1NAPA 3T51B 5K5PA 4FNFA 1ENFA 3MFGA 3VYRA 4WFN3 3DUZA 3FKIB 3I8ZA 5C4XB 1JICA 4XQJA 3A8KE 2C5CA 3DXJC 5KYLA 1AZQA 2B2TC 4KMUC 1Q1BA 3EJIA 1TY2A 4FXDA 3J7AF 1PRTD 4QF4A 3VR2A 1FR3A 4BY1B 2BDOA 1IHZA 2F0OA 4IURA 3W3AA 2NTTA 3H91A 1ZYRC 5KNDA 3PUYA 3D6WA 1IYUA 2AWOA 5EBDA 1HCZA 2QF7A 2D5DA 1DZ1A 4K2LA 4U673 2DY8A 4KTAA 1WTQA 5IODA 2DN8A 3NP8A 4EGVA 2H1EA 3P7JA 1FD7D 3R8BA 1KDAA 2WKDA 5CV6A 5DAUA 1SE3A 1OXTA 3GTQB 2HDMA 2X69A 2NWGA 3Q0AA 1JOQA 2WB1B 2BOSA 4GZYC 1CA6A 2MGSA 4WRDA 2GA4B 4ME5A 5CR3A 2CW0D 4RHSA 1I4RA 4HSVA 3IAYA 2PPBC 2F1MA 3OW7A 2EY5A 2EZVA 4RHRA 5CORA 3CU7A 2EJFC 2ZT9C 1H9RA 4XIGS 4G7OC 3J7AV 3Q22A 4R8NA 1JE4A 3I4NB 3KLRA 3P75A 4DAYA 2E74C 3K5MA 5CV9A 4BBRB 3BDLA 3A55A 5C5LA 3J81L 3N6RA 5EPKA 3TZDA 4KN7C 1LACA 3HG9A 4EQPA 3MAQA 3GTMB 3MXGA 3ITPA 3FRPB 1Q12A 3OSOA 1HFNA 1WTRA 1TR5A 3A7AB 2MUYA 1ZKOA 3VR5A 5KNBA 4R8IA 2X6LA 5JJZA 1K8OA 1IW7C 5TSSA 3URYA 3KBXA 1TU2B 2JA5B 3NQTA 5CV4A 1WTVA 2NYZD 3H94A 1AW7A 1SE2A 2A6EC 1GUTA 1SYGA 5HURA 3Q24A 2BE5C 1Y8OB 2F0KA 4CBVA 3C1EA 2B2WA 1KLUD 2DY7A 4O1NA 4I7ZC 5D65A 2RSNA 4MHEA 1QJOA 3MTSA 4OHJA 3C2PA 2BA1A 2E2HB 1DYQA 5T1IA 1PRTC 1BNZA 4K8JA 1I4XA 3TMEA 2EYJA 4K5VA 5ELBA 2ZXRA 4RGOS 5ELDA 4EVOA 4MIUA 4HCEA 4DA2A 2NUCA 3HP3A 4TQUS 2JA8B 2KEEA 3LWEA 1CM9A 5BN3A 2KECA 2KUMA 4CKCA 1NUCA 2M9VA 2A69D 3KUPA 3L9AX 1Q3LA 3LNNA 4DFAA 1YNJC 3GQBA 5EPJA 4FF4A 3PMFA 1SYBA 1CHQD 3VA7A 1F2ZA 4PMBA 4BWGB 2MP1A 3C1FA 2R3ZA 3O13A 5J22A 2XVSA 4FF2A 2Y0SB 3X3MA 1ML0D 2PMZB 5C0XG 3I72A 1SYCA 3J81E 2BDNA 3PV0A 5EGTA 3RZDB 1RJTA 1ZYRD 1SXTA 5JVG3 1O78A 5COYA 2OEOA 1RCVD 5E4XA 2JEBI 3TDQA 5C0XI 1L0YB 3SDZA 5DM73 4ILWA 2A68D 5KYIA 3E5SA 3F2UA 4OIJA 5J39A 4CHTB 1CZGA 2OF1A 1FNWA 2F0VA 2R92B 2A74C 1SEBD 3L3OC 3NBHA 2D2CC 2NN6I 3SK6A 1OXUA 3T53B 2KQ3A 4ZAIA 1B9MA 1TS5A 2BCOA 1R4PB 4KK7A 1GUOA 1KNAA 4LJZC 2E2DC 4KJNA 3BVGA 2O5IC 3K5NA 2K04A 2NN6G 1AZPA 4OGQC 3VR6A 3CRLC 3LX0A 1T5XD 4IUQA 1EY9A 1VDZA 1DD2A 3NTKA 1GUNA 4JK1C 2E2JB 1K8MA 3FMCA 3D3RA 3VR4A 2JP1A 5IT9E 5EBCA 4XXEA 1QG7A 3EQLC 3AU7A 4QIWB 2IX0A 2F0FA 1LTAD 2F0DA 3NSWA 3H6MA 2QKIC 2Q8TA 5E1FA 1QNKA 4RKBA 1GUWA 1O7YA 3HZXA 4QMGA 5FO7B 2YU9B 3EROA 1IL8A 3N52A 4KKTA 4CGYB 1LT3D 4A3FB 2LS01 3Q6SA 4K5WA 1WTWA 4H13C 3SK8A 2K5WA 2F0UA 2PQEA 4C56C 1LT4D 1EFID 4IUNA 1XWEA 2B8FA 5IT9L 3UI2A 3BDOA 1S5DD 5C0XH 1K83B 2L55A 2RVLA 4KD3A 1Y69U 3NE5B 5M5YB 4CJ0B 1UNSA 1ESFA 2K33A 3R2TA 1D5XC 1O80A 2F0QA 4BBSB 3TN2A 5I2YA 5C0XJ 1PMRA 3HOWB 5M5WB 4YIJA 3GTPB 2B2VA 2ID0A 1U4MA 2R93B 5I6WA 2K5QA 3OMCA 3QIAA 3KLSX 2AQ2B 3MFYA 4HEDA 3S1QB 1HTPA 4PQXA 3CRKC 5LL6S 1JORA 3DWPA 4K2KA 3NXWA 1BOSA 1J8IA 3D4DA 5EKLA 4KKSA 1VF5C 4C3JG 3SVMA 2EYOA 4WJWA 2F0GA 1LT6D 4Q5VA 4XT3B 1ET6A 3P20A 4CJ2C 5A35A 3NTHA 4B08A 4OO1G 5ELCA 2IJ0A 1TIID 1PFNA 1KDCA 3M7GA 5DNFA 1GJXA 4EQNA 4ULLA 1Q90A 5D3IB 1HQRD 3GO5A 1Y1VB 1EY7A 1BF4A 1I4PA 3HRZC 2Z8LA 5CBAE 4BA2I 5CV8A 1AP0A 1HQMC 3LWUA 2K01A 3FPUB 3QOJA 1X3PA 2G9DA 2FMMA 1FYCA 3QJYA 3WOEA 1IW7D 3K5OA 5J1ZA 2B2VC 1EU4A 1HUMA 2IT1A 2L4NA 1LTID 2G9HD 3OWEB 1WD0A 1Z6HA 3IL8A 1ICWA 1XX8A 1I4HA 1CQFA 4F87A 4X3SA 3ZYYX 4PV1C 2ENBA 4CKEA 1H9KA 2F0HA 2I46A 1SE4A 3OMGA 2LMCB 5E3FA 3ND8A 5ELFA 5D14A 4KI0A 1EQVA 5CMDA 5I9OA 3I3CA 2F0JA 4KY6A 4L8JA 4OO1H 5FLXL 1PTOB 1SNDA 1QOHA 3MA2B 4RCOA 1NSNS 3I91A 2YYZA 4ZK9B 1PZKD 2RA4A 3NUCA 1GHJA 1BBXC 1QCBD 1A3UA 3V2TA 2B2TA 5F2DA 4ZKBB 3Q23A 3A56A 5LL6X 4TSSA 1D1KA 2EY6A 3T16A 5K36G 5C4HA 4DN4M 4NP5A 4A3GB 1G91A 1ILQA 2SEBD 2SNSA 4ZYSA 4ID6A 4DAVA 4QB4A 2K5DA 1II3A 1XTCD 3VYSA 1H9SA 4K8IA 3V96A 3FDTA 1HUNA 3BDCA 5IGBA 1EY6A 1WCMB 4HMJA 4FYDA 4TKOB 5C3XA 2PZWA 1D1IA 4UDUC 2RDHA 1QNUA 1EZ6A 2LFNA 2XRQD 5T1GA 2OT2A 2JEAI 2TMPA 2HDLA 1F2MA 4X3KA 1S5CD 3HS0C 5IGEA 1EYAA 4IUVA 3G6JB 1VMPA 4IALA 3D8GA 3VYUA 2JXMB 4BA1I 3J7YW 2C9OA 1E2VA 1F2YA 4RFBA 2HCCA 3NBIA 3M3YB 2EXZA 3S14B 4HAEA 1DONA 1J9OA 4Z9CB 4FF1A 1RF2D 1WTXA 1KLGD 3DWQA 4XDXA 2RDFA 3SEBA 5C4ZA 2PYKA 4C3HG 1STBA 3IFDA 2VNUD 1HTLD 2EJGC 2PZTA 1EWCA 3HOVB 1BCPF 1Z47A 2AQ3B 2F0SA 3D4WA 4JBWA 3TZUA 3OIPA 3H3VC 4BS9A 5C6AA 2EYPA 1SJED 4AYBB 2RBMA 5EKKA 2WACA 1UAPA 1V1PB 1JR0D 4TRDA 2XIWA 2K32A 1C4QA 2A5HA 2F3VA 4QCLA 5C5MA 1U4PA 2EYMA 3S16B 1TKWB 2PW7A 5G3LD 1XYIA 2E75C 1LABA 5D3DA 1PRTB 1U4RA 3BG3A 3K59A 3FVQA 2V4DA 1PTOH 1DOMA 1JQYD 2MJ8A 1F9PA 4A3IB 5I4DA 4IN3A 2IPKD 1OXXK 2FFKB 1EEFD 3EVQA 1SAPA 3MHBA 1H9SB 4QUCA 2WAQB 3DWAA 4IQZA 1LV9A 3FEWX 4WORA 4O42A 2MHVA 5IOCA 1SYDA 2IX1A 1U9RA 4IUTA 2B2UC 4N9TA 3I70A 4L6TB 2NB0A 3D31A 4RA8A 3E6ZX 1HHVA 1E2ZA 4RKLA 2K1BA 3S1RB 1KABA 1STYA 3K5LA 1JWUD 1BXTA 4ZLTF 1QE6A 5DEHA 1LTGD 1B50A 1HRJA 1GUGA 1MSGA 1TS2A 1GXDC 4HR7B 3H09A 4HN7A 1TWGB 1VF7A 1B53A 5CV5A 2FMCA 2SNMA 1G2TA 3DEPA 5FOBB 1TVXA 4ZUIA 3M4OB 4B9XA 3FPPA 2HUGA 5FO8B 1CTMA 3U9SA 1RODA 1TWCB 1G291 1V1PA 4A3EB 1HPCA 3PO3B 2L5TA 4K6LA 3E0JA 3S17B 4P2CB 1B1ZA 3PUVA 4X3UA 2F0PA 2MPMA 1BCPD 4B9WA 1DOLA 1B2TA 3MZ5A 2L1BA 5HGTA 4E6IA 1MD2D 1PTOD 3OIQA 3BYYB 2M00A 2EPBA 3I73A 2E76C 5KGUA 2F0MA 1G2SA 3GTGB 3MXNA 2I07B 3OWFA 2CHBD 1F9SA 1H9JA 3DHQA 3HEJA 1T5EA 4A3MB 2IWHA 1WD1A 3J80L 4K5XA 2RSOA 2NVTB 4XT1B 3C46A 1FNUA 3V05A 4LK1C 5M3MB 2X6GA 3MXUA 1SMYC 4DNTB 4DU9A 1QILA 5ISRA 2VXWA 5M5XB 2EE1A 4FXKC 2VUMB 2FINB 3EFXD 2M2LA 4PMWA 2LY7A 4NW2A 3S15B 1ET9A 3TP7A 1GUSA 2CVRA 4R9WA 2O5JC 4DK1A 3QB3A 4KV6A 5KIXA 1TT2A 3MC0B 5CC4A 4C3IG 4X3TA 3BVMA 4NKLA 4V190 2Z4IA 1YNND 1STNA 1F2LA 2A6HD 1EIGA 1F77A 2XWJB 1SNPA 3K0YA 2A68C 3SK5A 2F0IA 4DXGA 1IKMA 4OO1I 2NTSA 2L12A 3D6CA 1SYEA 5A2QL 2F0NA 1D5ZC 1SDFA 1HA5A 4MN3A 1TQOA 1W6JA 5C4JB 2NVYB 1MI2A 3C3LA 4C2MB 1I3QB 1O7LA 5EQ0A 4F88A 2B2YA 5LHY1 4XQQA 1CFMA 4C1NK 3D4RA 1C8CA 1I4QA 1JOKA 2F03A 1I6VC 3T13A 2NVQB 1B9NA 4A93B 1WVLA 3GD7A 2O4XA 1CI3M 2AQ1B 4FF3A 5A2QE 1YNJD 2PW5A 4XYOA 3QO2A 4KJOA 4RGMA 5EJWA 1OO9B 1SJHD 3GV6A 1AEXA 1AN8A 1G6ZA 2IX3A 4M8AA 1R4QB 3AMUA 5CGKA 4FXGC 3T56B 2FHTA 2XWBB 2JSOA 5JPMC 4IZ8A 1DCZA 1UUPA 5C3WA 4S3SA 4C3JB 1EIHA 3K7AB 1GOZA 3H0GB 3T4AC 1G8ZD 4ZKCB 5G3LF 1A3VA 5IGCA 2ZXOA 4DXFA 4CKBA 1PDQA 1PRTF 3NTIA 3BZDB 5M3FB 3TSSA 1X32A 1I4GA 1F9QA 4OL7A 3P1HA 1EYCA 4DK0A 3JAME 1U4LA 1PTOF 1ENCA 1ZEQX 3MXPA 4BY7B 1SBBB 3SK4A 1EY0A 3R3OA 3S2HB 4PNYA 1EYDA 1EOTA 2EYHA 4ABNA 3MVVA 5CYUA 4C1NI 3IKJA 5K36H 1IKLA 2BE5D 4XYQA 4RH6A 4RGNA 3QWNA 1KNEA 2EY2A 3IFTA 2L9HA 5IGDA 1PFBA 4M1UB 1TWFB 5EKIA 3VR3A 3DMUA 2AUKA 1I50B 4LAAA 1STGA 3TP8A 2EVBA 4OIKA 2Q8RE 2CQAA 3PIO3 3RZOB 3BVZA 2XN9C 3SHLA 1I6HB 3S2DB 4NDXA 1Y8NB 2F0EA 1LTSD 2FJ2A 2RDGA 1HFGA 2B2WC 2E2IB 3OHXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB9 A;  3MFY A;  2K32 A;  3PUY A;  1G29 1;  2A6E D;  1VDZ A;  1DD2 A;  3PUW A;  1HPC A;  1Z6H A;  1GHK A;  1GUN A;  1HTP A;  1IYU A;  2AWO A;  2L5T A;  3CRK C;  1V43 A;  4JK1 C;  1Q12 A;  3A7L A;  3WDN A;  3VA7 A;  2A6H D;  1E2W A;  1IYV A;  1HCZ A;  2QF7 A;  4RCN A;  1K8M A;  3FMC A;  1TKW B;  3A8J E;  2A68 C;  3HGB A;  3PUV A;  4DNR B;  2DNC A;  3A7A B;  2E75 C;  1LAB A;  2D5D A;  2EDG A;  4KKS A;  4TKO B;  1VF5 C;  3M7N A;  3BG3 A;  1Y8P B;  1ZKO A;  3ND9 A;  3VR5 A;  4H0L C;  3VR4 A;  4PV1 C;  2V4D A;  5KNB A;  1H9K A;  5BN5 A;  1K8O A;  1IW7 C;  3EQL C;  2DN8 A;  2AUJ D;  5C0X G;  4DK0 A;  3I72 A;  2Q8I B;  1OXX K;  2B8G A;  3P20 A;  1H9M A;  5A35 A;  1TU2 B;  2KA7 A;  2JEA I;  2LMC B;  4OO1 G;  3PV0 A;  4G7Z C;  3A8I E;  3ND8 A;  5KNC A;  2DNE A;  4KI0 A;  3H94 A;  1H9S B;  1OXT A;  1VCI A;  2A6E C;  1ONL A;  4IQZ A;  1V8Q A;  1GUT A;  3I73 A;  4G7H C;  2E76 C;  1O7L A;  2BE5 C;  4KKT A;  2CW0 C;  2BA0 A;  1O78 A;  1Y8O B;  4L8J A;  4OO1 H;  1Q1E A;  2JE6 I;  3SE0 A;  2JXM B;  4BA1 I;  2EJM A;  4GZY C;  1CFM A;  1E2V A;  4IFD H;  1GJX A;  3IKJ A;  1H9J A;  1A6X A;  4KHZ A;  3D4R A;  2JEB I;  5K36 H;  1T5E A;  1I6V C;  1EWH A;  4I7Z C;  3SDZ A;  1Q90 A;  2A68 D;  1DXM A;  1B9N A;  2BE5 D;  2A69 C;  4H13 C;  2PPB C;  1QJO A;  3D31 A;  5BN4 A;  2F1M A;  1OXS C;  3I4L A;  2NN6 H;  1E2Z A;  3IFT A;  3T51 B;  3OOC A;  2YYZ A;  4LK1 C;  3GD7 A;  2BA1 A;  1CI3 M;  2B8F A;  4H44 C;  3OW7 A;  1GHJ A;  2D62 A;  3M85 A;  1OXV A;  3MXU A;  3BDO A;  1SMY C;  2D2C C;  2NN6 I;  4DNT B;  3VR3 A;  1OXU A;  3T53 B;  5C0X H;  4BA2 I;  2EJG C;  3QG1 A;  1HQM C;  3LWU A;  2AUK A;  2EJF C;  2KCC A;  1B9M A;  3NE5 B;  1Y69 U;  1GUG A;  5K36 G;  2ZT9 C;  3DXJ C;  3PUZ A;  3A8K E;  3RLF A;  1GUO A;  1H9R A;  2K33 A;  4KMU C;  4LJZ C;  4XIG S;  1Q1B A;  4JBW A;  4G7O C;  4XTC S;  2EVB A;  4HR7 B;  3TZU A;  3KLR A;  1BDO A;  5JEA G;  3T56 B;  1VF7 A;  2PNR C;  4TQU S;  2E74 C;  1Z7T A;  3VR2 A;  1FR3 A;  1GUS A;  1FYC A;  1PMR A;  3QJY A;  3M4Y A;  2O5I C;  2BDO A;  1IW7 D;  1DCZ A;  2K7V A;  5BN3 A;  2PCF B;  3L7Z C;  3OPO A;  3U9S A;  3W3A A;  2NN6 G;  2A6H C;  4KKU A;  3N6R A;  4OGQ C;  3VR6 A;  1YNN C;  2IT1 A;  4DK1 A;  2O5J C;  5JEA H;  2A69 D;  1Y8N B;  4IFD G;  4KN4 C;  1H9S A;  4KN7 C;  3CRL C;  3LNN A;  2R6G A;  1LAC A;  3QIA A;  1YNJ C;  3FPP A;  3PUX A;  3GQB A;  1CTM A;  1ZYR C;  5KND A; 
#chains in the Genus database with same CATH topology
 3AB9 A;  3GP7 A;  1EL0 A;  2Z6B A;  4LF8 L;  3ERS X;  1V43 A;  4IPH A;  4DV0 L;  4B3T L;  1E2W A;  3H15 A;  4DR1 Q;  1O7I A;  2K5N A;  4RCN A;  3VA5 A;  1PH4 A;  2D9U A;  2H4O A;  3A8J E;  2VQE Q;  3NPP A;  1A8V A;  1Y8P B;  3ND9 A;  1YIJ A;  1STH A;  1YIT A;  1LT5 D;  3QOL A;  1CQV A;  4EQO A;  3S2D H;  3RUZ A;  5IP7 G;  1K8G A;  1X56 A;  2D0O A;  2RKS A;  1A63 A;  2NZO A;  1SNC A;  3VDY A;  1RTO A;  1PYW D;  1WCM G;  5AFW A;  1KDB A;  2KVM A;  1H9M A;  4QL5 A;  2B2U A;  2HIX A;  3J7A 5;  2DNE A;  2VB2 X;  1TWA B;  4HJA A;  1CK1 A;  2ALY B;  1QZH A;  3A0J A;  1X55 A;  1ASY A;  2QCP X;  3U50 C;  2WP8 J;  3GTJ B;  4L5R C;  1VQL A;  5J3B A;  2PZU A;  2HHH L;  1FJG Q;  2EJM A;  3H0G H;  4IFD H;  1PFM A;  2R61 A;  2A69 C;  3M4Q A;  2QDB A;  3A5U A;  1DM0 B;  1HXY D;  2UUA L;  2HHH Q;  1Y1W B;  1RD9 D;  4FO2 A;  2VUM G;  3SXH A;  3FKI H;  1K73 C;  3OOC A;  1BUV T;  1EY5 A;  5AJ3 L;  1EU3 A;  1S5B D;  3STB D;  1OXV A;  1Y14 B;  2EYL A;  4A3D B;  3KF6 A;  1D5M C;  4RMF A;  4DR5 Q;  4A3K B;  3PCO B;  4LFB Q;  1NJI C;  1JWM D;  4J8Q A;  4YCV A;  3ER0 A;  3M9B A;  4KLK A;  4HTH A;  4KHV A;  1Q7Y C;  5IGF A;  2KED A;  2XNA C;  3VYT A;  1FNV A;  2N88 A;  3OW2 A;  4A3I H;  3DEO A;  3I4N G;  1XPR A;  3DM1 A;  1BCP C;  1E0B A;  1CZW A;  1X65 A;  2XRS D;  3TBI B;  5C3E B;  2J0T D;  4OX9 L;  1STE A;  3S9W A;  4KHP L;  3M4Y A;  4CDE C;  3GTK H;  1TS3 A;  3RR5 A;  2JA8 G;  3GTM H;  1N33 Q;  2A73 B;  3I4N H;  3K58 A;  1B4O A;  4KKU A;  2NVX B;  3UE0 A;  2QEJ C;  4A76 A;  4G4K A;  4KN4 C;  1PLF A;  5ELE A;  4DGZ A;  2DUD A;  3S16 H;  1L1O A;  1PYS B;  4OWW B;  1L2F A;  1LTL A;  1UEA B;  2G5D A;  4IFD J;  3BYT B;  4OEL B;  4JOI C;  4ZQ3 A;  3RMH A;  2JK8 A;  5LMU L;  3Q8D A;  2K5V A;  1MGS A;  2UXC Q;  2OWO A;  3R2I A;  5EPL A;  2HQL A;  3CHB D;  2N55 A;  4LF4 L;  1A2T A;  5BN5 A;  4KD4 A;  1HH2 P;  1VQ6 A;  4DR4 L;  1XXG A;  2B39 A;  2P5Z X;  1BQQ T;  2MO0 A;  2Q8I B;  1EQQ A;  1SSO A;  4ODG A;  4ALP A;  3TP6 A;  4ZRZ A;  1ZXT A;  4KY7 A;  2K4K A;  1RHP A;  3KBG A;  1CKO A;  3S17 H;  2IL8 A;  3KLS A;  3W2D A;  2BA0 A;  1D7Q A;  1Q1E A;  2RCF A;  1A2U A;  4A75 A;  2F0W A;  1LLR D;  4LF9 L;  2PQA B;  4A3J H;  1A6X A;  3NWT A;  1EWH A;  1CKM A;  1MBY A;  1M8A A;  1E24 A;  3GTO B;  4DK6 C;  3DM3 A;  4J6H A;  3ULL A;  2SOB A;  1JOO A;  4LMQ D;  2NN6 H;  1GD7 A;  2Z1C A;  2RHQ B;  3MEH A;  3CCE A;  3U58 A;  2ASB A;  1C9O A;  4X65 L;  4H44 C;  3M85 A;  2D62 A;  2JYO A;  4A3K G;  1YHA A;  2IY5 B;  1SFO B;  2HCI A;  5I2X A;  1A3T A;  4GKJ Q;  4GLV B;  4HSP A;  2KCC A;  2PI2 E;  5NUC A;  2ATW A;  1B8A A;  1PH5 A;  3PUZ A;  3RLF A;  3HKZ B;  4GNX C;  3RD4 A;  4A3K H;  4UAI A;  5JEA G;  3GV3 A;  1D6E C;  3CQZ B;  2K03 A;  3RZD H;  1Z7T A;  1K3R A;  3BU2 A;  1Q8I A;  4BY1 G;  4KY5 A;  1STA A;  4NMZ A;  3WWV A;  4A4I A;  2A6H C;  4ZUJ A;  1YNN C;  3WOF A;  5I6Y A;  3JAM L;  4HCS A;  5JEA H;  1K3B C;  2KCN A;  5KRU A;  1PZI D;  5JEA J;  3A54 A;  3GTK B;  1LTB D;  3KK7 A;  1CSQ A;  1VMC A;  1ENA A;  3ERQ A;  1CT1 D;  1N34 L;  2A6E D;  2VB3 X;  1G6P A;  1D8L A;  1GHK A;  3UDF A;  1DOK A;  1FGB D;  5KNC A;  3WDN A;  3X3N A;  5FO9 B;  3CPW A;  1WTO A;  1IYV A;  4DV0 Q;  4DV6 L;  4UP7 A;  4DV3 L;  4CJ1 B;  4DNR B;  2DNC A;  2ZJQ A;  4R4T A;  4O0A A;  5JPN C;  4Q0F A;  5IIF A;  1EY8 A;  1J5E L;  1C48 A;  1L0X B;  1IXR A;  2Z4H A;  4A3F G;  4DF7 A;  2UU9 L;  1PZJ D;  2AUJ D;  1VQA A;  4R4I A;  3BS1 A;  5FK9 C;  2WB1 G;  1RTN A;  4H7B A;  4RWS C;  2B63 B;  1JC7 A;  2F4I A;  4K6D A;  5M9O A;  4G7Z C;  2WIN B;  4F7X A;  2JA8 H;  4Y52 H;  4U68 A;  1VCI A;  3K57 A;  4A3L G;  3MWY W;  3AFP A;  1O7Z A;  1MSH A;  4R1J A;  1SNM A;  1NCV A;  3J81 i;  1LO5 D;  3SE0 A;  3R93 A;  4A3B B;  3BZC A;  1H95 A;  2PO4 A;  4KHZ A;  1KAA A;  3UDG A;  5M3M H;  2UUC L;  2WII B;  1DXM A;  4DV6 Q;  3GTL B;  2JA6 H;  2F3W A;  1XNQ Q;  2JN4 A;  3F1Z A;  5BR8 L;  3NWS A;  5FKA C;  1W6K A;  4IUU A;  4DV2 L;  3M3Y H;  3J80 c;  1VQ7 A;  1S4Z A;  1B3A A;  2QW7 A;  1I3Q H;  4HMI A;  4C3H B;  2NZ1 D;  1SNO A;  1PH6 A;  2F0L A;  3I90 A;  5FLX E;  5FLX c;  1S5E D;  2UXD Q;  1FL0 A;  1X3Q A;  4RGT A;  4XQN A;  3NQI A;  1SMY D;  1DJR D;  4XTC S;  4X62 L;  1SMX A;  4N9P A;  2ICE C;  2PNR C;  2AWN A;  1IZ6 A;  1QB5 D;  1PTO C;  2K28 A;  3G7L A;  2K05 A;  2L11 A;  4JI8 L;  2E2I H;  2KBN A;  1LTT D;  2PCF B;  1B7Y B;  3L7Z C;  3OPO A;  5JAV A;  1GVP A;  3EA6 A;  1RKN A;  2PNH A;  4FP5 D;  2TSS A;  4WJ3 M;  5IGG A;  1YJN A;  4A3J B;  3A74 A;  3PUX A;  1E1O A;  2KJX A;  4DR2 L;  2KOL A;  3KFU A;  2I5L X;  1VQG A;  2ZM6 Q;  2XSC A;  2B29 A;  1WI5 A;  4GKJ L;  1ESR A;  1N36 Q;  1EZ8 A;  3ONA B;  1A15 A;  5GRO A;  2JA7 B;  1KTK A;  3CKI B;  2ZXP A;  4O2D A;  2GVA A;  5IYC H;  2VZA A;  3HOZ B;  2ICI A;  1SLJ A;  5KEE A;  1T9H A;  4DV5 Q;  3S1M B;  4DR2 Q;  2NBF A;  1I50 H;  4F8M A;  1KL9 A;  4JI2 L;  2PI2 A;  1EY4 A;  1KIX A;  2JA5 G;  4K14 A;  1UE1 A;  2SDF A;  2RQX A;  4B3M Q;  1D2B A;  1TWG H;  1XMO L;  4LF7 Q;  2K6A A;  4QUF A;  1P8L A;  1BBU A;  2HQE A;  1TS4 A;  4YCU A;  3NHH A;  1ONL A;  1V8Q A;  2QIL A;  1E7Z A;  3NK9 A;  2JA5 H;  5IY0 A;  1PH3 A;  2QDL A;  3KF8 A;  2F0T A;  2JE6 I;  3ICE A;  1VQI A;  1AFP A;  2E5L Q;  1QWY A;  3S1M H;  3PIP 3;  3CCQ A;  1JB3 A;  1YHQ A;  1B44 D;  1SYF A;  3PIO A;  1TWH B;  5BN4 A;  2EOT A;  1R9T B;  5CBE E;  3HOX B;  1TY0 A;  3J80 E;  2IW3 A;  4G57 A;  2EY1 A;  1YBY A;  1F9R A;  3QG1 A;  5IWA L;  5E4W C;  2H5X A;  5CV7 A;  3CCL A;  4OEM B;  1VS0 A;  5JOB A;  1IBL L;  3HOY B;  4DUY Q;  4RAU C;  1BDO A;  1HJP A;  1NR2 A;  2F3I A;  3PQI A;  4IPG A;  4J1M A;  4JI5 L;  4JVZ A;  4I65 A;  4YWK A;  2Y0S E;  2IHE A;  3SR1 A;  4FVM A;  2K7V A;  2WKC A;  2PMZ E;  3S1N B;  1I94 Q;  4V0B A;  1L1O B;  4YHH Q;  1JWS D;  1HA6 A;  4JI7 Q;  4IOC A;  4POG A;  2EYF A;  3U9O A;  4C3I B;  3H0G G;  2O2L D;  4IPC A;  4IFD G;  4JI5 Q;  2R6G A;  3TP5 A;  5JVH 3;  1CA5 A;  1NR4 A;  2KHS A;  4JI0 L;  4DAP A;  3PUW A;  1JCK B;  1EEI D;  1BO0 A;  1RDP D;  3A7L A;  2E5L L;  2LKV A;  1WTP A;  5C44 B;  1WJJ A;  2F4V L;  2R7Z B;  3HGB A;  1M4V A;  4BY7 G;  1TWC H;  2EDG A;  3M7N A;  1E3P A;  1UE6 A;  4H0L C;  1PH2 A;  3PO2 B;  4L63 B;  1SFO H;  3K6O A;  2OXP A;  1CHP D;  1S5F D;  5I9P A;  4IFD I;  3UDX A;  3I56 A;  4IPD A;  2L0C A;  4B3M L;  2ZTE A;  2VQF L;  4JYA Q;  1VQ9 A;  2JA6 B;  2B8G A;  2KA7 A;  5DM6 3;  3HOU B;  1BCP B;  3A8I E;  1Y1W H;  2WV6 D;  1PXU A;  4TVA B;  1J6Q A;  2J4X A;  1XMQ Q;  3HOW H;  1V1O A;  2EQS A;  1V9P A;  5FLM H;  4G7H C;  3W1G A;  2Q2H A;  2CW0 C;  2WAQ G;  4PMC A;  1N36 L;  2J7Z A;  4IUP A;  1Y1V H;  4NXM Q;  3I4M B;  1BR9 A;  1SNQ A;  1I94 L;  1EQT A;  4Y7N B;  1ILP A;  2B2Y C;  4BBS G;  1BKB A;  3I4L A;  1OXS C;  4DV5 L;  4DV7 L;  1LTR D;  1NAP A;  3T51 B;  3J80 i;  5K5P A;  1XNR L;  3T1H Q;  2R92 G;  1K8A C;  4AIM A;  4FNF A;  1V1Q A;  4IJH A;  3L0O A;  1ENF A;  1J5E Q;  3MFG A;  3VYR A;  4WFN 3;  3DUZ A;  3FKI B;  3I8Z A;  1N32 L;  5C4X B;  1JIC A;  3DXJ C;  1YVC A;  2C5C A;  3A8K E;  5KYL A;  4XQJ A;  1AZQ A;  2B2T C;  4KMU C;  1Q1B A;  3EJI A;  1TY2 A;  4FXD A;  3J7A F;  5C4X G;  1PRT D;  2NVX H;  4QF4 A;  3VR2 A;  1FR3 A;  3CD6 A;  4BY1 B;  1Q81 C;  1MHW C;  5M3F G;  2BDO A;  1IHZ A;  2CH4 W;  2F0O A;  4DR3 L;  4B3S Q;  4IUR A;  3W3A A;  4JI3 Q;  3FP9 A;  5IP7 H;  2NTT A;  4X64 L;  3H91 A;  4LUO A;  1XNQ L;  4NXN Q;  5JJL A;  2CWA A;  1ZYR C;  5KND A;  1HNZ Q;  3PUY A;  3D6W A;  3E9I A;  1IYU A;  2AWO A;  4B3R L;  5EBD A;  1EWI A;  1HCZ A;  2QF7 A;  1LM0 A;  3HOX H;  2D5D A;  3GTG H;  1DZ1 A;  2F52 A;  4K2L A;  4U67 3;  3TRE A;  2ZJR A;  2DY8 A;  4HIK A;  4KTA A;  1WYD A;  1WTQ A;  5IOD A;  2DN8 A;  3NP8 A;  4EGV A;  2H1E A;  3P7J A;  4QGU A;  3GTQ H;  4QY7 A;  1FD7 D;  3R8B A;  1KDA A;  2WKD A;  5CV6 A;  2K50 A;  5DAU A;  2Z6K A;  1SE3 A;  4JI1 Q;  4PZ6 A;  1OXT A;  4BY1 H;  3GTQ B;  2HDM A;  3K80 C;  2X69 A;  2NWG A;  3Q0A A;  1JOQ A;  2WB1 B;  2YV5 A;  2BOS A;  4GZY C;  1BVS A;  1CA6 A;  2MGS A;  4WRD A;  1W3S A;  2GA4 B;  4ME5 A;  1L0W A;  1W2B A;  1XTD A;  2CW0 D;  5CR3 A;  4DAM A;  2AMC B;  4RHS A;  2E2H H;  1I4R A;  4HSV A;  4LF6 L;  3IAY A;  3GTJ H;  2PPB C;  2F1M A;  3OW7 A;  5IP9 H;  1EYG A;  3S14 H;  2VUM H;  2EY5 A;  4DV7 Q;  2EZV A;  4RHR A;  5COR A;  4BBS H;  4GOP A;  3CU7 A;  2EJF C;  4DKA C;  2ZT9 C;  3MEF A;  1N34 Q;  1H9R A;  1Q8K A;  4XIG S;  4G7O C;  2CQO A;  3Q22 A;  4R8N A;  3J7A V;  1JE4 A;  3I4N B;  3KLR A;  3P75 A;  1QVC A;  1K83 H;  4DAY A;  4LUZ A;  2E74 C;  4GN4 B;  3K5M A;  1QUQ A;  4A3L H;  5CV9 A;  4JCV E;  4BBR B;  3BDL A;  3CCJ A;  3A55 A;  3KDF B;  5C5L A;  3J81 L;  3I2Z A;  3E0E A;  3N6R A;  2OCE A;  3CQZ H;  3U4Z A;  4JI7 L;  5EPK A;  3TZD A;  4KN7 C;  4DR3 Q;  1K0R A;  4B3S L;  1LAC A;  3HG9 A;  4EQP A;  2WAQ E;  3MAQ A;  3CC4 A;  3GTM B;  2B63 H;  3MXG A;  3ITP A;  2R7Z G;  1M1K C;  3FRP B;  1Q12 A;  3OSO A;  1HFN A;  1NE3 A;  1R9T H;  1WTR A;  1TR5 A;  3A7A B;  2MUY A;  1ZKO A;  3VR5 A;  1NMF A;  1S40 A;  3PF5 A;  2OQ0 A;  5KNB A;  4LFB L;  4R8I A;  4DR5 L;  2X6L A;  4GN5 A;  5JJZ A;  1K8O A;  1IW7 C;  4I7A A;  5TSS A;  4EX5 A;  3URY A;  3KBX A;  4GN3 B;  5GAE C;  1TU2 B;  2JA5 B;  4LF9 Q;  3NQT A;  5CV4 A;  2Z6K C;  1WTV A;  4AH6 A;  2NYZ D;  3H94 A;  1AW7 A;  1SE2 A;  2A6E C;  3PF4 A;  1YHB A;  4KHP Q;  1GUT A;  1SYG A;  5HUR A;  4OX9 Q;  3Q24 A;  2BE5 C;  1Y8O B;  2F0K A;  4CBV A;  2CFM A;  3C1E A;  3TRZ A;  2B2W A;  2RCN A;  1KLU D;  2DY7 A;  4O1N A;  4I7Z C;  1VQH A;  2RSN A;  5D65 A;  4MHE A;  1VQB A;  1XMO Q;  1G51 A;  4JBM A;  1QJO A;  1VQ4 A;  3MTS A;  3HOV G;  1Q46 A;  4OHJ A;  3C2P A;  2BA1 A;  2E2H B;  1DYQ A;  3FKI G;  5T1I A;  1PRT C;  1BNZ A;  4K8J A;  5H1S E;  1PA6 A;  1U5K A;  1I4X A;  3TME A;  2EYJ A;  4K5V A;  5ELB A;  2ZXR A;  2YTX A;  4RGO S;  5ELD A;  4EVO A;  4MIU A;  4NPS A;  4HCE A;  4DA2 A;  4POF A;  3I4O A;  2NUC A;  3HP3 A;  4TQU S;  2JA8 B;  2KEE A;  3LWE A;  2B3G A;  1CM9 A;  4IJL A;  2UUB Q;  5BN3 A;  2KEC A;  2KUM A;  4CKC A;  1NUC A;  2WB1 E;  3SGI A;  2M9V A;  4NXM L;  1N8R C;  2A69 D;  3KUP A;  3L9A X;  1Q3L A;  3LNN A;  4PZ8 A;  4DFA A;  4JI4 Q;  1YNJ C;  3GQB A;  5EPJ A;  4FF4 A;  3PMF A;  1SYB A;  3ULP A;  2HD3 A;  2JA7 G;  5IP9 G;  1CHQ D;  3VA7 A;  1F2Z A;  1FJG L;  4BXX G;  4PMB A;  4BWG B;  2MP1 A;  4UY8 C;  3C1F A;  2R3Z A;  5C44 G;  3O13 A;  5J22 A;  2XVS A;  3JC6 6;  3T1Y L;  2YTY A;  4FF2 A;  1GO3 E;  1OTC A;  2Y0S B;  3X3M A;  1ML0 D;  4GS3 A;  5JJI A;  2PMZ B;  5C0X G;  3KF6 B;  2VQE L;  3I72 A;  1SYC A;  2CCZ A;  3J81 E;  2BDN A;  1VQD A;  3PV0 A;  5EGT A;  3RZD B;  3I55 A;  3CC2 A;  1RJT A;  1ZYR D;  3F2D A;  1UWV A;  4J15 A;  4HIO A;  4DV2 Q;  1SXT A;  4A93 H;  5JVG 3;  1O78 A;  2DGY A;  5COY A;  2B63 G;  2OEO A;  1RCV D;  1JT8 A;  2CKZ B;  3CCM A;  5E4X A;  2JEB I;  3TS2 A;  3TDQ A;  2KHI A;  5C0X I;  1L0Y B;  3SDZ A;  1U0L A;  5DM7 3;  4ILW A;  1S3O A;  2A68 D;  1EIY B;  4JI0 Q;  3E3X A;  5KYI A;  1PYB A;  3E5S A;  3F2U A;  4A93 G;  4OIJ A;  5J39 A;  1CZG A;  4CHT B;  2OF1 A;  1FNW A;  1AE3 A;  2F0V A;  5IT9 c;  2R92 B;  3KJO A;  2A74 C;  1MIU A;  1SEB D;  3L3O C;  3GTO H;  3NBH A;  2D2C C;  2NN6 I;  3SK6 A;  3RLO A;  4C3I H;  1OXU A;  3T53 B;  4JI8 Q;  2KQ3 A;  2XGT A;  4ZAI A;  1B9M A;  1TS5 A;  2BCO A;  5IE8 A;  1R4P B;  4KK7 A;  1GUO A;  1KNA A;  5LMN Q;  4ZCK A;  4LJZ C;  2FXQ A;  2E2D C;  4DUZ Q;  4KJN A;  4GKK Q;  4YY3 L;  3J81 j;  3BVG A;  2O5I C;  3K5N A;  2LSS A;  1VQJ A;  2K04 A;  2JQO A;  2NN6 G;  1ICF B;  1AZP A;  4OGQ C;  3VR6 A;  3K7U C;  4L5S A;  3CRL C;  3LX0 A;  1T5X D;  4IUQ A;  2DJF C;  1EY9 A;  4C3J H;  4GLX A;  1VDZ A;  1DD2 A;  3NTK A;  1YJ9 A;  1TWH H;  1GUN A;  5E7N A;  1TWA H;  4JK1 C;  2R92 H;  2CWP A;  1HZ9 A;  2E2J B;  1K8M A;  1IBM Q;  3FMC A;  3D3R A;  3VR4 A;  2JP1 A;  4DV1 Q;  4P72 A;  2AHO B;  5IT9 E;  5EBC A;  4XXE A;  4A3B G;  1QG7 A;  3EQL C;  3AU7 A;  4QIW E;  4QIW B;  2IX0 A;  2F0F A;  1LTA D;  2HIV A;  1KC8 C;  3AQQ A;  2F0D A;  5HY6 A;  3HKS A;  3NSW A;  3H6M A;  4DR1 L;  2QKI C;  1C7Y A;  2Q8T A;  5E1F A;  1QNK A;  4RKB A;  1GUW A;  1O7Y A;  3HZX A;  3F2B A;  3S1N H;  1LYL A;  4QMG A;  2OTL A;  5FO7 B;  2YU9 B;  3ERO A;  1IL8 A;  2VS1 A;  1VQO A;  3N52 A;  4KKT A;  4CGY B;  4DV3 Q;  1LT3 D;  2N3S A;  1I5F A;  4A3F B;  1HZB A;  4LFC Q;  2LS0 1;  3Q6S A;  4K5W A;  1WTW A;  4H13 C;  3SK8 A;  2K5W A;  2F0U A;  2PQE A;  4C56 C;  3HOX G;  1LT4 D;  1EFI D;  4IUN A;  2Q2U A;  1JMC A;  1XWE A;  2B8F A;  5IT9 L;  3UI2 A;  4R4C A;  3S24 A;  3BDO A;  1S5D D;  4JI3 L;  3BJU A;  4DK3 C;  5C0X H;  3CP0 A;  2DJG C;  1K83 B;  2L55 A;  2RVL A;  4KD3 A;  1Y69 U;  3NE5 B;  5M5Y B;  4CJ0 B;  1HR0 Q;  3I4M H;  1UNS A;  2MFI A;  1YI2 A;  1AH9 A;  1ESF A;  2K33 A;  5JJK A;  4X62 Q;  3R2T A;  1PH9 A;  4P74 A;  1D5X C;  4B3R Q;  1O80 A;  2F0Q A;  4BBS B;  2A19 A;  3TN2 A;  5I2Y A;  5C0X J;  3L2P A;  4AQY L;  1PMR A;  4K0K Q;  3HOW B;  5M5W B;  3HOY H;  4YIJ A;  3GTP B;  2B2V A;  2ID0 A;  1U4M A;  3G71 A;  2R93 B;  2JJQ A;  5I6W A;  2K5Q A;  5GAH C;  1EFW A;  3G6E A;  3OMC A;  1VQK A;  3QIA A;  3KLS X;  2AQ2 B;  3OTO L;  3MFY A;  4HED A;  3S1Q B;  4IOA A;  1WFQ A;  1HTP A;  1VQC A;  4PQX A;  3CRK C;  5LL6 S;  1JOR A;  1YJW A;  3DWP A;  3HOW G;  4K2K A;  3NXW A;  1BOS A;  4N8F A;  4LFC L;  1J8I A;  3D4D A;  4L5Q A;  5EKL A;  5M5W H;  4KKS A;  1VF5 C;  4C3J G;  1SRU A;  4LUV A;  3SVM A;  2EYO A;  4WJW A;  4GKK L;  2F0G A;  1LT6 D;  4Q5V A;  5AJ3 Q;  4XT3 B;  1ET6 A;  3P20 A;  4CJ2 C;  5A35 A;  3NTH A;  4B08 A;  3DLL A;  4OO1 G;  5ELC A;  2IJ0 A;  1TII D;  2VW9 A;  2VQF Q;  4JYA L;  2EXD A;  4A3M H;  1PFN A;  1KDC A;  5LMU Q;  3M7G A;  5DNF A;  1GJX A;  4EQN A;  4ULL A;  1VQP A;  1Q90 A;  1A62 A;  1IYJ B;  1Y1V G;  4JBJ A;  5D3I B;  1HQR D;  4JPB W;  4P75 A;  3GO5 A;  4H02 A;  1Y1V B;  1EY7 A;  1BF4 A;  1I4P A;  2PQA A;  3HRZ C;  3B6Y A;  5M3F H;  2VY3 A;  2Z8L A;  5CBA E;  4DV4 L;  4BA2 I;  5CV8 A;  1AP0 A;  1HQM C;  3LWU A;  1X54 A;  2Q2T A;  2K01 A;  2LXK A;  2C35 B;  3FPU B;  4B3T Q;  1M90 C;  3QOJ A;  5GQO A;  1I6H H;  1X3P A;  2G9D A;  2QA4 A;  2A1A A;  1XJV A;  2FMM A;  1FYC A;  3QJY A;  5C4X H;  3WOE A;  1IW7 D;  3K5O A;  4GNX B;  1RL2 A;  5J1Z A;  2B2V C;  1EQR A;  3MXN B;  1EU4 A;  1HUM A;  1FGU A;  2IT1 A;  3S15 H;  5C3E H;  2L4N A;  1YEZ A;  2KHJ A;  1LTI D;  3D0F A;  5ELO A;  1CUK A;  2G9H D;  1DGS A;  2GN5 A;  3OWE B;  4IO9 A;  5FJ8 H;  3HOY G;  1WD0 A;  1VQF A;  1Z6H A;  3IL8 A;  4LFA L;  1ICW A;  1XX8 A;  1I4H A;  3KF8 B;  1CQF A;  4DUY L;  1LUZ A;  3S1R H;  4F87 A;  4DV4 Q;  4BBR H;  4X3S A;  2RF4 A;  4DR4 Q;  5FJ8 G;  3ZYY X;  4PV1 C;  2ENB A;  2K5H A;  2R7F A;  4CKE A;  4A3C G;  4JBK A;  4X64 Q;  1H9K A;  1PFS A;  2F0H A;  1WCM H;  2I46 A;  1SE4 A;  3OMG A;  3PSI A;  3NBH B;  5DLQ E;  2ZTD A;  3CAM A;  2LMC B;  5E3F A;  3J81 c;  3ND8 A;  5ELF A;  1CKN A;  5D14 A;  4KI0 A;  3E9H A;  4LF4 Q;  1EQV A;  5CMD A;  3F8T A;  5I9O A;  3I3C A;  1IBL Q;  2F0J A;  4JG2 A;  4KY6 A;  4L8J A;  2F4V Q;  4OO1 H;  1AE2 A;  1WOC A;  3K81 C;  3STB C;  5FLX L;  1PTO B;  1IBK L;  4LF8 Q;  1SND A;  1QOH A;  2I0Q A;  3MA2 B;  3BZK A;  4A3M G;  4BXX H;  2AKW B;  4RCO A;  1NSN S;  1C0A A;  2I5M X;  3I91 A;  2YYZ A;  4ZK9 B;  4JI2 Q;  5C44 H;  1PZK D;  2RA4 A;  3NUC A;  1GHJ A;  1BBX C;  3UE1 A;  1QCB D;  5EAY A;  1A3U A;  3V2T A;  1Y1W G;  2B2T A;  4A3G H;  5F2D A;  4ZKB B;  5LL6 X;  3A56 A;  3Q23 A;  4TSS A;  1QVF A;  1D1K A;  2EY6 A;  4A3D G;  3T16 A;  3EIV A;  4JV5 Q;  5K36 G;  1Q86 C;  5C4H A;  5ELN A;  3U4V A;  4DN4 M;  4NP5 A;  4A3G B;  1G91 A;  1ILQ A;  2SEB D;  4GLA C;  1HNX Q;  2UXB Q;  1B3Q A;  1UEB A;  2SNS A;  1HNW L;  4ZYS A;  4C2M H;  4ID6 A;  1NNX A;  3HOZ H;  4DAV A;  4QB4 A;  1NY4 A;  2K5D A;  1II3 A;  4HJ9 A;  1EIF A;  1XTC D;  2LXJ A;  3VYS A;  1H9S A;  3TEH B;  4K8I A;  3V96 A;  3FDT A;  1HUN A;  3BDC A;  1YNX A;  5IGB A;  5IYD G;  4QJF A;  1EY6 A;  3RNU A;  1HR0 W;  4YWL A;  1WCM B;  4HMJ A;  4LF6 Q;  4FYD A;  3G48 A;  1MJE A;  4TKO B;  4MNO A;  5IYD H;  5C3X A;  4DPG A;  2PZW A;  1D1I A;  3NEN A;  3M4O H;  4UDU C;  2RDH A;  1QNU A;  1EZ6 A;  4LF5 L;  3H3V I;  2LFN A;  3JAM c;  2XRQ D;  5T1G A;  4YHH L;  2OT2 A;  2JEA I;  2TMP A;  2HDL A;  1VQN A;  1F2M A;  3AFQ A;  4X3K A;  1S5C D;  3HS0 C;  5IGE A;  1EYA A;  4IUV A;  3G6J B;  2ZJP A;  2K14 A;  1RIP A;  1VMP A;  4IAL A;  3D8G A;  4CDD C;  3VYU A;  2JXM B;  4BA1 I;  2NVY H;  3J7Y W;  1S72 A;  2C9O A;  1E2V A;  1F2Y A;  2NZH A;  4RFB A;  2HCC A;  4OON A;  3NBI A;  3M3Y B;  2EXZ A;  3S14 B;  4HAE A;  1DON A;  1J9O A;  4Z9C B;  1JE5 A;  2XTI A;  1RF2 D;  4FF1 A;  1WTX A;  1KLG D;  1E1T A;  3DWQ A;  4XDX A;  2RDF A;  2MNA A;  3SEB A;  5C4Z A;  2KCT A;  3HOV H;  4NXN L;  1JJ2 A;  5IYB G;  2PYK A;  4NB3 A;  4C3H G;  4JI1 L;  1STB A;  3IFD A;  2VNU D;  1HTL D;  4X66 Q;  1KD1 C;  2EJG C;  2PZT A;  1EWC A;  3HOV B;  1CKN B;  1BCP F;  1Z47 A;  2AQ3 B;  2F0S A;  3D4W A;  3RZO H;  4AYB G;  4JBW A;  3TZU A;  4A3G G;  3GDE A;  4AQY Q;  3OIP A;  4BS9 A;  5C6A A;  3KJP A;  2EYP A;  1SJE D;  4C3H H;  3H3V C;  4AYB B;  2A8V A;  1GKH A;  2RBM A;  1EOV A;  5EKK A;  2K52 A;  2WAC A;  1UAP A;  1V1P B;  1NMG A;  1JR0 D;  4TRD A;  4R4Q A;  4UP8 A;  3ZJY C;  1NBW A;  2XIW A;  1MKH A;  4A3I G;  1GM5 A;  2K32 A;  1KAW A;  1C4Q A;  2EIF A;  3G4S A;  5L37 A;  3TS0 A;  2A5H A;  2ZTC A;  1N32 Q;  2F3V A;  4JI6 L;  4QCL A;  5C5M A;  2L15 A;  1U4P A;  2EYM A;  3S16 B;  1TKW B;  2PW7 A;  2QEX A;  5G3L D;  1XYI A;  2E75 C;  1LAB A;  5D3D A;  1PRT B;  1U4R A;  3BG3 A;  3K59 A;  1JJG A;  1CSP A;  3FVQ A;  2V4D A;  2JA6 G;  1PTO H;  1DOM A;  1JQY D;  4CDF C;  2Y0S G;  2MJ8 A;  1F9P A;  4A3I B;  5I4D A;  4IN3 A;  2IPK D;  1OXX K;  4PG3 A;  4P73 A;  2FFK B;  1EEF D;  3EVQ A;  4JI6 Q;  4FDB A;  1SAP A;  3HOZ G;  3MHB A;  2QGQ A;  1H9S B;  4QUC A;  2E2J H;  2WAQ B;  3DWA A;  4IQZ A;  2N78 A;  4X65 Q;  2R7Z H;  1LV9 A;  1XNR Q;  1K9M C;  1SN8 A;  4ME3 A;  1HZA A;  3H3V H;  2KCM A;  3FEW X;  3M4P A;  4WOR A;  4O42 A;  5M3M G;  2MHV A;  5IOC A;  1SYD A;  3CCU A;  2IX1 A;  1U9R A;  4IUT A;  2Z0S A;  1TWF H;  2B2U C;  4N9T A;  3I70 A;  1X3E A;  3LGJ A;  4L6T B;  2NB0 A;  3D31 A;  4RA8 A;  3E6Z X;  3EBE A;  1HHV A;  1E2Z A;  4RKL A;  2K1B A;  4YY3 Q;  4DNI A;  1PH7 A;  3S1R B;  1KAB A;  1STY A;  3K5L A;  1JWU D;  4LWC A;  5LMN W;  1BXT A;  1E22 A;  4ZLT F;  1QE6 A;  3HKZ E;  1XMQ L;  5DEH A;  1IL2 A;  1LTG D;  4MZ9 A;  1B50 A;  1HRJ A;  1KQS A;  3NEM A;  1GUG A;  3NEL A;  1MSG A;  1TS2 A;  4OWT B;  1GXD C;  5IYB H;  4HR7 B;  1X3G A;  3H09 A;  4HN7 A;  4OWX B;  1TWG B;  4N8X 1;  1VF7 A;  1B53 A;  2MQH A;  5CV5 A;  5IYC G;  1PVO A;  2FMC A;  2SNM A;  4DUZ L;  1G2T A;  2UXC L;  1P16 A;  3DEP A;  5LMN L;  5FOB B;  1TVX A;  4ZUI A;  2IHF A;  3HKZ G;  1IBK Q;  2V1C C;  5GAG C;  3M4O B;  3KYH C;  4A3B H;  3K8A A;  4B9X A;  3FPP A;  2HUG A;  5FO8 B;  2R93 G;  1CTM A;  3TQY A;  4LNQ A;  3U9S A;  1ROD A;  1TWC B;  1G29 1;  1V1P A;  4A3E B;  1HPC A;  4X6A H;  3PO3 B;  2KEN A;  2L5T A;  4K6L A;  5IWA Q;  2NVT H;  3E0J A;  4DR7 L;  3S17 B;  3PO3 G;  4P2C B;  1B1Z A;  3PUV A;  3HOU G;  4X3U A;  2F0P A;  2MPM A;  1BCP D;  4B9W A;  1DOL A;  3PO2 G;  3CCV A;  1HNZ L;  1B2T A;  3MZ5 A;  1HZC A;  2L1B A;  1VQE A;  3KOJ A;  5C4J H;  5HGT A;  4WJ4 A;  2JA9 A;  5M5Y H;  4E6I A;  1MD2 D;  1PTO D;  2D0P A;  3I7F A;  3OIQ A;  3UDI A;  3BYY B;  2M00 A;  3FHW A;  1VQ8 A;  4HJ8 A;  2EPB A;  1PHJ A;  1KRT A;  2ES2 A;  1UE5 A;  3I73 A;  2JA7 H;  4UP9 A;  4CDC C;  2E76 C;  3JAM i;  5KGU A;  2F0M A;  1G2S A;  3GTG B;  3MXN A;  2I07 B;  1K28 A;  3PIP A;  4APV A;  3OWF A;  2CHB D;  3T1Y Q;  2VL6 A;  4GOP C;  1F9S A;  1H9J A;  3DHQ A;  3HEJ A;  3I4M G;  1T5E A;  4A3M B;  1FVI A;  1JB7 A;  2IWH A;  3AEV A;  1WD1 A;  3J80 L;  3T1H L;  4K5X A;  2RSO A;  2NVT B;  4XT1 B;  3C46 A;  1FNU A;  1HNX L;  2UXB L;  3V05 A;  4LK1 C;  4BBR G;  5M3M B;  2UUA Q;  2NVQ H;  2E8G A;  2X6G A;  3MXU A;  1SMY C;  4DNT B;  4DU9 A;  2MO1 A;  1QIL A;  4OXP A;  4JV5 L;  4DAY B;  5ISR A;  3CW2 C;  2VXW A;  1X9N A;  5M5X B;  3K0X A;  1NTG A;  4P71 A;  4DR7 Q;  2EE1 A;  4FXK C;  3CMA A;  2VUM B;  2FIN B;  3EFX D;  3GTP H;  2M2L A;  4PMW A;  4JI4 L;  4BY7 H;  2LY7 A;  3RN2 A;  4GOP B;  4QQB X;  4NW2 A;  3S15 B;  1ET9 A;  2Q2I A;  3TP7 A;  3RN5 A;  1GUS A;  3CF5 A;  3F2C A;  2CVR A;  2YTV A;  2UXD L;  4R9W A;  2O5J C;  2UUB L;  4DK1 A;  3QB3 A;  2ZM6 L;  4KV6 A;  5KIX A;  1TT2 A;  2K75 A;  4R4O A;  3MC0 B;  5CC4 A;  4C3I G;  4A3J G;  4A3E G;  4X3T A;  4Y7N H;  3BVM A;  5FLM G;  4NKL A;  4L5T A;  4V19 0;  2Z4I A;  1YNN D;  1STN A;  1F2L A;  2A6H D;  1EIG A;  1F77 A;  2XWJ B;  1SNP A;  3EN2 A;  2A68 C;  3K0Y A;  2F0I A;  3SK5 A;  3W1B A;  4DXG A;  4A3E H;  1IKM A;  4X66 L;  4OO1 I;  2NTS A;  2L12 A;  3D6C A;  3CCS A;  1SYE A;  5A2Q L;  2F0N A;  4DR6 L;  2R7D A;  1D5Z C;  1SDF A;  1HA5 A;  4MN3 A;  1SRO A;  1Z9F A;  1TQO A;  4MTK A;  1XPO A;  1W6J A;  3PO2 H;  1SR3 A;  1PH8 A;  5C4J B;  2NVY B;  1MI2 A;  4LFA Q;  3CXC A;  4EQ5 A;  3C3L A;  4C2M B;  4K0K L;  1I3Q B;  1O7L A;  5EQ0 A;  4F88 A;  1BBW A;  2R93 H;  2OQK A;  2B2Y A;  5LHY 1;  4XQQ A;  1YZ6 A;  1CFM A;  4C1N K;  3D4R A;  1C8C A;  1I4Q A;  1JOK A;  1KHI A;  2F03 A;  1I6V C;  1UE7 A;  3T13 A;  2YU9 H;  2UUC Q;  2NVQ B;  1B9N A;  2OTJ A;  2UU9 Q;  3OTO Q;  1MJC A;  4A93 B;  3PO3 H;  4JOI A;  3HOU H;  1WVL A;  1VQ5 A;  2HT1 A;  1QVG A;  4YWM A;  3GD7 A;  2O4X A;  1CI3 M;  2AQ1 B;  4FF3 A;  5A2Q E;  3GTL H;  5HGQ A;  1YNJ D;  2PW5 A;  3CPF A;  4XYO A;  3QO2 A;  3RLN A;  4KJO A;  4RGM A;  5EJW A;  1OO9 B;  1IBM L;  1KXL A;  1SJH D;  3GV6 A;  1AEX A;  4A3F H;  1AN8 A;  1G6Z A;  2IX3 A;  4M8A A;  4HJ7 A;  1R4Q B;  3AMU A;  5CGK A;  4FXG C;  1KRS A;  3T56 B;  2GVB A;  4DR6 Q;  2FHT A;  4JC0 A;  3S2H H;  2XWB B;  2JSO A;  5JPM C;  4IZ8 A;  4LF7 L;  1DCZ A;  1UUP A;  5C3W A;  3QR8 A;  1EUJ A;  4S3S A;  4C3J B;  1EIH A;  1X3F A;  2BH8 A;  3K7A B;  4LW1 A;  4HID A;  1GOZ A;  3W5O A;  3H0G B;  4LF5 Q;  4RG1 A;  3KDF A;  3T4A C;  1G8Z D;  1Q82 C;  4ZKC B;  5G3L F;  1A3V A;  3A5Z B;  5BR8 Q;  2ZXO A;  4DXF A;  5IGC A;  3CME A;  3ULJ A;  2I5H A;  4CKB A;  1PV4 A;  1PDQ A;  1PRT F;  3NTI A;  3CC7 A;  3BZD B;  5M3F B;  3TSS A;  1HNW Q;  3S1Q H;  1X32 A;  1I4G A;  1F9Q A;  4AYB E;  1VQM A;  3K7A H;  3PGZ A;  4OL7 A;  4DV1 L;  3P1H A;  1EYC A;  1QUQ B;  2N49 A;  4HIM A;  4A3C H;  4DK0 A;  1PTO F;  1ENC A;  1U4L A;  3JAM E;  1ZEQ X;  2WFW A;  3MXP A;  4GNX A;  4YCW A;  4BY7 B;  1SBB B;  3SK4 A;  1TXY A;  1EY0 A;  3R3O A;  1WTH A;  3S2H B;  1A0I A;  2CH4 A;  1X6O A;  4PNY A;  1K0S A;  1EYD A;  1EOT A;  2EYH A;  1QZG A;  4ABN A;  3CCR A;  3MVV A;  5CYU A;  3HFZ B;  4C1N I;  5M5X H;  2BH2 A;  3IKJ A;  5K36 H;  1IKL A;  3IRB A;  2BE5 D;  4XYQ A;  1SE8 A;  4JW0 A;  4RH6 A;  4RGN A;  3QWN A;  1KNE A;  2EY2 A;  2Z9H A;  4MTN A;  3IFT A;  1JJC B;  2L9H A;  5IGD A;  1PFB A;  4PZ7 A;  3J7Z C;  4M1U B;  1TWF B;  1L1O C;  3OYY A;  3KLW A;  5EKI A;  3VR3 A;  1HR0 L;  3DMU A;  4UHV A;  2AUK A;  1B70 B;  1N9W A;  1PH1 A;  1N33 L;  1I50 B;  4LAA A;  1STG A;  3TP8 A;  4A3D H;  2RHS B;  3AYH B;  2N8N A;  2EVB A;  4OIK A;  2Q8R E;  2CQA A;  4UPA A;  3PIO 3;  1XPU A;  3RZO B;  3BVZ A;  2XN9 C;  3SHL A;  1I6H B;  3S2D B;  4HJ5 A;  4NDX A;  1Y8N B;  2F0E A;  1LTS D;  2FJ2 A;  2RDG A;  5GAD C;  1HFG A;  2B2W C;  5C3E G;  2E2I B;  3OHX C;  1ASZ A; 
#chains in the Genus database with same CATH homology
 3AB9 A;  3GP7 A;  1EL0 A;  1V43 A;  1E2W A;  4RCN A;  3VA5 A;  2D9U A;  2H4O A;  3A8J E;  3NPP A;  1Y8P B;  3ND9 A;  1STH A;  1LT5 D;  3QOL A;  1CQV A;  4EQO A;  3RUZ A;  2RKS A;  1SNC A;  1RTO A;  1PYW D;  5AFW A;  1KDB A;  2KVM A;  1H9M A;  2B2U A;  2DNE A;  2VB2 X;  1TWA B;  1CK1 A;  2QCP X;  2WP8 J;  3GTJ B;  2PZU A;  2EJM A;  4IFD H;  1PFM A;  2R61 A;  2A69 C;  2QDB A;  1DM0 B;  1HXY D;  1Y1W B;  1RD9 D;  4FO2 A;  3SXH A;  3OOC A;  1BUV T;  1EY5 A;  1EU3 A;  1S5B D;  1OXV A;  4A3D B;  2EYL A;  1D5M C;  4A3K B;  1JWM D;  4J8Q A;  4HTH A;  4KHV A;  5IGF A;  2KED A;  2XNA C;  3VYT A;  1FNV A;  2N88 A;  3DEO A;  3DM1 A;  1BCP C;  1E0B A;  1CZW A;  2XRS D;  5C3E B;  3TBI B;  2J0T D;  1STE A;  3S9W A;  3M4Y A;  1TS3 A;  2A73 B;  3K58 A;  1B4O A;  4KKU A;  2NVX B;  2QEJ C;  4G4K A;  4KN4 C;  1PLF A;  5ELE A;  4DGZ A;  1UEA B;  4IFD J;  3BYT B;  4ZQ3 A;  3RMH A;  1MGS A;  3R2I A;  5EPL A;  3CHB D;  2N55 A;  1A2T A;  5BN5 A;  4KD4 A;  1XXG A;  2B39 A;  1BQQ T;  2Q8I B;  1SSO A;  4ODG A;  3TP6 A;  4ZRZ A;  1ZXT A;  4KY7 A;  1RHP A;  3KBG A;  2IL8 A;  3KLS A;  3W2D A;  2BA0 A;  1Q1E A;  1A2U A;  2F0W A;  1LLR D;  1A6X A;  3NWT A;  1EWH A;  1MBY A;  1M8A A;  3GTO B;  4J6H A;  2SOB A;  1JOO A;  4LMQ D;  2NN6 H;  2Z1C A;  3MEH A;  4H44 C;  3M85 A;  2D62 A;  2JYO A;  1SFO B;  2HCI A;  5I2X A;  1A3T A;  4HSP A;  2KCC A;  5NUC A;  3PUZ A;  3RLF A;  3HKZ B;  3RD4 A;  4UAI A;  5JEA G;  3GV3 A;  1D6E C;  3CQZ B;  2K03 A;  1Z7T A;  1Q8I A;  4KY5 A;  1STA A;  4NMZ A;  2A6H C;  4ZUJ A;  1YNN C;  3WOF A;  5I6Y A;  3JAM L;  4HCS A;  5JEA H;  2KCN A;  5KRU A;  1PZI D;  5JEA J;  3A54 A;  3GTK B;  1LTB D;  3KK7 A;  1VMC A;  1ENA A;  3ERQ A;  1CT1 D;  2A6E D;  2VB3 X;  1GHK A;  5KNC A;  1DOK A;  1FGB D;  3WDN A;  3X3N A;  5FO9 B;  1IYV A;  1WTO A;  4CJ1 B;  4DNR B;  2DNC A;  5JPN C;  4Q0F A;  5IIF A;  1EY8 A;  1C48 A;  1L0X B;  2Z4H A;  4DF7 A;  1PZJ D;  2AUJ D;  3BS1 A;  5FK9 C;  1RTN A;  4H7B A;  4RWS C;  2B63 B;  1JC7 A;  2F4I A;  4K6D A;  5M9O A;  4G7Z C;  2WIN B;  4F7X A;  4U68 A;  1VCI A;  3K57 A;  3MWY W;  1O7Z A;  1MSH A;  1SNM A;  1NCV A;  1LO5 D;  3SE0 A;  3R93 A;  4A3B B;  2PO4 A;  4KHZ A;  1KAA A;  2WII B;  1DXM A;  3GTL B;  2F3W A;  3NWS A;  5FKA C;  1W6K A;  4IUU A;  1S4Z A;  1B3A A;  4HMI A;  4C3H B;  2NZ1 D;  1SNO A;  2F0L A;  3I90 A;  5FLX E;  1S5E D;  1X3Q A;  4RGT A;  4XQN A;  3NQI A;  1SMY D;  1DJR D;  4XTC S;  4N9P A;  2ICE C;  2PNR C;  2AWN A;  1QB5 D;  1PTO C;  2K28 A;  3G7L A;  2K05 A;  2L11 A;  1LTT D;  2PCF B;  5JAV A;  3L7Z C;  3OPO A;  3EA6 A;  1RKN A;  4FP5 D;  2TSS A;  5IGG A;  4A3J B;  3PUX A;  2KJX A;  2KOL A;  2XSC A;  1ESR A;  1EZ8 A;  3ONA B;  1A15 A;  2JA7 B;  1KTK A;  3CKI B;  2ZXP A;  3HOZ B;  2ICI A;  5KEE A;  3S1M B;  2NBF A;  4F8M A;  1EY4 A;  4K14 A;  2SDF A;  2RQX A;  1D2B A;  2K6A A;  4QUF A;  2HQE A;  1TS4 A;  3NHH A;  1ONL A;  1V8Q A;  2QIL A;  3NK9 A;  3KF8 A;  2F0T A;  2JE6 I;  1AFP A;  1QWY A;  3PIP 3;  1JB3 A;  1B44 D;  1SYF A;  1TWH B;  5BN4 A;  2EOT A;  1R9T B;  5CBE E;  3HOX B;  1TY0 A;  3J80 E;  2IW3 A;  4G57 A;  2EY1 A;  1F9R A;  3QG1 A;  5E4W C;  5CV7 A;  5JOB A;  3HOY B;  4RAU C;  1BDO A;  1NR2 A;  4J1M A;  4I65 A;  3SR1 A;  4FVM A;  2K7V A;  2WKC A;  3S1N B;  4V0B A;  1JWS D;  1HA6 A;  2EYF A;  3U9O A;  4C3I B;  4IFD G;  2O2L D;  2R6G A;  3TP5 A;  5JVH 3;  1CA5 A;  1NR4 A;  2KHS A;  4DAP A;  3PUW A;  1JCK B;  1EEI D;  1BO0 A;  1RDP D;  3A7L A;  2LKV A;  1WTP A;  5C44 B;  2R7Z B;  3HGB A;  1M4V A;  2EDG A;  3M7N A;  4H0L C;  3PO2 B;  4L63 B;  3K6O A;  2OXP A;  1CHP D;  1S5F D;  5I9P A;  4IFD I;  2L0C A;  2JA6 B;  2B8G A;  2KA7 A;  5DM6 3;  3HOU B;  1BCP B;  3A8I E;  2WV6 D;  1PXU A;  2J4X A;  1V1O A;  4G7H C;  2CW0 C;  4PMC A;  2J7Z A;  4IUP A;  3I4M B;  1BR9 A;  1SNQ A;  1EQT A;  4Y7N B;  1ILP A;  2B2Y C;  3I4L A;  1OXS C;  1LTR D;  1NAP A;  3T51 B;  5K5P A;  4FNF A;  1ENF A;  3MFG A;  3VYR A;  4WFN 3;  3DUZ A;  3FKI B;  3I8Z A;  5C4X B;  1JIC A;  4XQJ A;  3A8K E;  2C5C A;  3DXJ C;  5KYL A;  1AZQ A;  2B2T C;  4KMU C;  1Q1B A;  3EJI A;  1TY2 A;  4FXD A;  3J7A F;  1PRT D;  4QF4 A;  3VR2 A;  1FR3 A;  4BY1 B;  2BDO A;  1IHZ A;  2F0O A;  4IUR A;  3W3A A;  2NTT A;  3H91 A;  1ZYR C;  5KND A;  3PUY A;  3D6W A;  1IYU A;  2AWO A;  5EBD A;  1HCZ A;  2QF7 A;  2D5D A;  1DZ1 A;  4K2L A;  4U67 3;  2DY8 A;  4KTA A;  1WTQ A;  5IOD A;  2DN8 A;  3NP8 A;  4EGV A;  2H1E A;  3P7J A;  1FD7 D;  3R8B A;  1KDA A;  2WKD A;  5CV6 A;  5DAU A;  1SE3 A;  1OXT A;  3GTQ B;  2HDM A;  2X69 A;  2NWG A;  3Q0A A;  1JOQ A;  2WB1 B;  2BOS A;  4GZY C;  1CA6 A;  2MGS A;  4WRD A;  2GA4 B;  4ME5 A;  5CR3 A;  2CW0 D;  4RHS A;  1I4R A;  4HSV A;  3IAY A;  2PPB C;  2F1M A;  3OW7 A;  2EY5 A;  2EZV A;  4RHR A;  5COR A;  3CU7 A;  2EJF C;  2ZT9 C;  1H9R A;  4XIG S;  4G7O C;  3J7A V;  3Q22 A;  4R8N A;  1JE4 A;  3I4N B;  3KLR A;  3P75 A;  4DAY A;  2E74 C;  3K5M A;  5CV9 A;  4BBR B;  3BDL A;  3A55 A;  5C5L A;  3J81 L;  3N6R A;  5EPK A;  3TZD A;  4KN7 C;  1LAC A;  3HG9 A;  4EQP A;  3MAQ A;  3GTM B;  3MXG A;  3ITP A;  3FRP B;  1Q12 A;  3OSO A;  1HFN A;  1WTR A;  1TR5 A;  3A7A B;  2MUY A;  1ZKO A;  3VR5 A;  5KNB A;  4R8I A;  2X6L A;  5JJZ A;  1K8O A;  1IW7 C;  5TSS A;  3URY A;  3KBX A;  1TU2 B;  2JA5 B;  3NQT A;  5CV4 A;  1WTV A;  2NYZ D;  3H94 A;  1AW7 A;  1SE2 A;  2A6E C;  1GUT A;  1SYG A;  5HUR A;  3Q24 A;  2BE5 C;  1Y8O B;  2F0K A;  4CBV A;  3C1E A;  2B2W A;  1KLU D;  2DY7 A;  4O1N A;  4I7Z C;  5D65 A;  2RSN A;  4MHE A;  1QJO A;  3MTS A;  4OHJ A;  3C2P A;  2BA1 A;  2E2H B;  1DYQ A;  5T1I A;  1PRT C;  1BNZ A;  4K8J A;  1I4X A;  3TME A;  2EYJ A;  4K5V A;  5ELB A;  2ZXR A;  4RGO S;  5ELD A;  4EVO A;  4MIU A;  4HCE A;  4DA2 A;  2NUC A;  3HP3 A;  4TQU S;  2JA8 B;  2KEE A;  3LWE A;  1CM9 A;  5BN3 A;  2KEC A;  2KUM A;  4CKC A;  1NUC A;  2M9V A;  2A69 D;  3KUP A;  3L9A X;  1Q3L A;  3LNN A;  4DFA A;  1YNJ C;  3GQB A;  5EPJ A;  4FF4 A;  3PMF A;  1SYB A;  1CHQ D;  3VA7 A;  1F2Z A;  4PMB A;  4BWG B;  2MP1 A;  3C1F A;  2R3Z A;  3O13 A;  5J22 A;  2XVS A;  4FF2 A;  2Y0S B;  3X3M A;  1ML0 D;  2PMZ B;  5C0X G;  3I72 A;  1SYC A;  3J81 E;  2BDN A;  3PV0 A;  5EGT A;  3RZD B;  1RJT A;  1ZYR D;  1SXT A;  5JVG 3;  1O78 A;  5COY A;  2OEO A;  1RCV D;  5E4X A;  2JEB I;  3TDQ A;  5C0X I;  1L0Y B;  3SDZ A;  5DM7 3;  4ILW A;  2A68 D;  5KYI A;  3E5S A;  3F2U A;  4OIJ A;  5J39 A;  4CHT B;  1CZG A;  2OF1 A;  1FNW A;  2F0V A;  2R92 B;  2A74 C;  1SEB D;  3L3O C;  3NBH A;  2D2C C;  2NN6 I;  3SK6 A;  1OXU A;  3T53 B;  2KQ3 A;  4ZAI A;  1B9M A;  1TS5 A;  2BCO A;  1R4P B;  4KK7 A;  1GUO A;  1KNA A;  4LJZ C;  2E2D C;  4KJN A;  3BVG A;  2O5I C;  3K5N A;  2K04 A;  2NN6 G;  1AZP A;  4OGQ C;  3VR6 A;  3CRL C;  3LX0 A;  1T5X D;  4IUQ A;  1EY9 A;  1VDZ A;  1DD2 A;  3NTK A;  1GUN A;  4JK1 C;  2E2J B;  1K8M A;  3FMC A;  3D3R A;  3VR4 A;  2JP1 A;  5IT9 E;  5EBC A;  4XXE A;  1QG7 A;  3EQL C;  3AU7 A;  4QIW B;  2IX0 A;  2F0F A;  1LTA D;  2F0D A;  3NSW A;  3H6M A;  2QKI C;  2Q8T A;  5E1F A;  1QNK A;  4RKB A;  1GUW A;  1O7Y A;  3HZX A;  4QMG A;  5FO7 B;  2YU9 B;  3ERO A;  1IL8 A;  3N52 A;  4KKT A;  4CGY B;  1LT3 D;  4A3F B;  2LS0 1;  3Q6S A;  4K5W A;  1WTW A;  4H13 C;  3SK8 A;  2K5W A;  2F0U A;  2PQE A;  4C56 C;  1LT4 D;  1EFI D;  4IUN A;  1XWE A;  2B8F A;  5IT9 L;  3UI2 A;  3BDO A;  1S5D D;  5C0X H;  1K83 B;  2L55 A;  2RVL A;  4KD3 A;  1Y69 U;  3NE5 B;  5M5Y B;  4CJ0 B;  1UNS A;  1ESF A;  2K33 A;  3R2T A;  1D5X C;  1O80 A;  2F0Q A;  4BBS B;  3TN2 A;  5I2Y A;  5C0X J;  1PMR A;  3HOW B;  5M5W B;  4YIJ A;  3GTP B;  2B2V A;  2ID0 A;  1U4M A;  2R93 B;  5I6W A;  2K5Q A;  3OMC A;  3QIA A;  3KLS X;  2AQ2 B;  3MFY A;  4HED A;  3S1Q B;  1HTP A;  4PQX A;  3CRK C;  5LL6 S;  1JOR A;  3DWP A;  4K2K A;  3NXW A;  1BOS A;  1J8I A;  3D4D A;  5EKL A;  4KKS A;  1VF5 C;  4C3J G;  3SVM A;  2EYO A;  4WJW A;  2F0G A;  1LT6 D;  4Q5V A;  4XT3 B;  1ET6 A;  3P20 A;  4CJ2 C;  5A35 A;  3NTH A;  4B08 A;  4OO1 G;  5ELC A;  2IJ0 A;  1TII D;  1PFN A;  1KDC A;  3M7G A;  5DNF A;  1GJX A;  4EQN A;  4ULL A;  1Q90 A;  5D3I B;  1HQR D;  3GO5 A;  1Y1V B;  1EY7 A;  1BF4 A;  1I4P A;  3HRZ C;  2Z8L A;  5CBA E;  4BA2 I;  5CV8 A;  1AP0 A;  1HQM C;  3LWU A;  2K01 A;  3FPU B;  3QOJ A;  1X3P A;  2G9D A;  2FMM A;  1FYC A;  3QJY A;  3WOE A;  1IW7 D;  3K5O A;  5J1Z A;  2B2V C;  1EU4 A;  1HUM A;  2IT1 A;  2L4N A;  1LTI D;  2G9H D;  3OWE B;  1WD0 A;  1Z6H A;  3IL8 A;  1ICW A;  1XX8 A;  1I4H A;  1CQF A;  4F87 A;  4X3S A;  3ZYY X;  4PV1 C;  2ENB A;  4CKE A;  1H9K A;  2F0H A;  2I46 A;  1SE4 A;  3OMG A;  2LMC B;  5E3F A;  3ND8 A;  5ELF A;  5D14 A;  4KI0 A;  1EQV A;  5CMD A;  5I9O A;  3I3C A;  2F0J A;  4KY6 A;  4L8J A;  4OO1 H;  5FLX L;  1PTO B;  1SND A;  1QOH A;  3MA2 B;  4RCO A;  1NSN S;  3I91 A;  2YYZ A;  4ZK9 B;  1PZK D;  2RA4 A;  3NUC A;  1GHJ A;  1BBX C;  1QCB D;  1A3U A;  3V2T A;  2B2T A;  5F2D A;  4ZKB B;  3Q23 A;  3A56 A;  5LL6 X;  4TSS A;  1D1K A;  2EY6 A;  3T16 A;  5K36 G;  5C4H A;  4DN4 M;  4NP5 A;  4A3G B;  1G91 A;  1ILQ A;  2SEB D;  2SNS A;  4ZYS A;  4ID6 A;  4DAV A;  4QB4 A;  2K5D A;  1II3 A;  1XTC D;  3VYS A;  1H9S A;  4K8I A;  3V96 A;  3FDT A;  1HUN A;  3BDC A;  5IGB A;  1EY6 A;  1WCM B;  4HMJ A;  4FYD A;  4TKO B;  5C3X A;  2PZW A;  1D1I A;  4UDU C;  2RDH A;  1QNU A;  1EZ6 A;  2LFN A;  2XRQ D;  5T1G A;  2OT2 A;  2JEA I;  2TMP A;  2HDL A;  1F2M A;  4X3K A;  1S5C D;  3HS0 C;  5IGE A;  1EYA A;  4IUV A;  3G6J B;  1VMP A;  4IAL A;  3D8G A;  3VYU A;  2JXM B;  4BA1 I;  3J7Y W;  2C9O A;  1E2V A;  1F2Y A;  4RFB A;  2HCC A;  3NBI A;  3M3Y B;  2EXZ A;  3S14 B;  4HAE A;  1DON A;  1J9O A;  4Z9C B;  4FF1 A;  1RF2 D;  1WTX A;  1KLG D;  3DWQ A;  4XDX A;  2RDF A;  3SEB A;  5C4Z A;  2PYK A;  4C3H G;  1STB A;  3IFD A;  2VNU D;  1HTL D;  2EJG C;  2PZT A;  1EWC A;  3HOV B;  1BCP F;  1Z47 A;  2AQ3 B;  2F0S A;  3D4W A;  4JBW A;  3TZU A;  3OIP A;  3H3V C;  4BS9 A;  5C6A A;  2EYP A;  1SJE D;  4AYB B;  2RBM A;  5EKK A;  2WAC A;  1UAP A;  1V1P B;  1JR0 D;  4TRD A;  2XIW A;  2K32 A;  1C4Q A;  2A5H A;  2F3V A;  4QCL A;  5C5M A;  1U4P A;  2EYM A;  3S16 B;  1TKW B;  2PW7 A;  5G3L D;  1XYI A;  2E75 C;  1LAB A;  5D3D A;  1PRT B;  1U4R A;  3BG3 A;  3K59 A;  3FVQ A;  2V4D A;  1PTO H;  1DOM A;  1JQY D;  2MJ8 A;  1F9P A;  4A3I B;  5I4D A;  4IN3 A;  2IPK D;  1OXX K;  2FFK B;  1EEF D;  3EVQ A;  1SAP A;  3MHB A;  1H9S B;  4QUC A;  2WAQ B;  3DWA A;  4IQZ A;  1LV9 A;  3FEW X;  4WOR A;  4O42 A;  2MHV A;  5IOC A;  1SYD A;  2IX1 A;  1U9R A;  4IUT A;  2B2U C;  4N9T A;  3I70 A;  4L6T B;  2NB0 A;  3D31 A;  4RA8 A;  3E6Z X;  1HHV A;  1E2Z A;  4RKL A;  2K1B A;  3S1R B;  1KAB A;  1STY A;  3K5L A;  1JWU D;  1BXT A;  4ZLT F;  1QE6 A;  5DEH A;  1LTG D;  1B50 A;  1HRJ A;  1GUG A;  1MSG A;  1TS2 A;  1GXD C;  4HR7 B;  3H09 A;  4HN7 A;  1TWG B;  1VF7 A;  1B53 A;  5CV5 A;  2FMC A;  2SNM A;  1G2T A;  3DEP A;  5FOB B;  1TVX A;  4ZUI A;  3M4O B;  4B9X A;  3FPP A;  2HUG A;  5FO8 B;  1CTM A;  3U9S A;  1ROD A;  1TWC B;  1G29 1;  1V1P A;  4A3E B;  1HPC A;  3PO3 B;  2L5T A;  4K6L A;  3E0J A;  3S17 B;  4P2C B;  1B1Z A;  3PUV A;  4X3U A;  2F0P A;  2MPM A;  1BCP D;  4B9W A;  1DOL A;  1B2T A;  3MZ5 A;  2L1B A;  5HGT A;  4E6I A;  1MD2 D;  1PTO D;  3OIQ A;  3BYY B;  2M00 A;  2EPB A;  3I73 A;  2E76 C;  5KGU A;  2F0M A;  1G2S A;  3GTG B;  3MXN A;  2I07 B;  3OWF A;  2CHB D;  1F9S A;  1H9J A;  3DHQ A;  3HEJ A;  1T5E A;  4A3M B;  2IWH A;  1WD1 A;  3J80 L;  4K5X A;  2RSO A;  2NVT B;  4XT1 B;  3C46 A;  1FNU A;  3V05 A;  4LK1 C;  5M3M B;  2X6G A;  3MXU A;  1SMY C;  4DNT B;  4DU9 A;  1QIL A;  5ISR A;  2VXW A;  5M5X B;  2EE1 A;  4FXK C;  2VUM B;  2FIN B;  3EFX D;  2M2L A;  4PMW A;  2LY7 A;  4NW2 A;  3S15 B;  1ET9 A;  3TP7 A;  1GUS A;  2CVR A;  4R9W A;  2O5J C;  4DK1 A;  3QB3 A;  4KV6 A;  5KIX A;  1TT2 A;  3MC0 B;  5CC4 A;  4C3I G;  4X3T A;  3BVM A;  4NKL A;  4V19 0;  2Z4I A;  1YNN D;  1STN A;  1F2L A;  2A6H D;  1EIG A;  1F77 A;  2XWJ B;  1SNP A;  3K0Y A;  2A68 C;  3SK5 A;  2F0I A;  4DXG A;  1IKM A;  4OO1 I;  2NTS A;  2L12 A;  3D6C A;  1SYE A;  5A2Q L;  2F0N A;  1D5Z C;  1SDF A;  1HA5 A;  4MN3 A;  1TQO A;  1W6J A;  5C4J B;  2NVY B;  1MI2 A;  3C3L A;  4C2M B;  1I3Q B;  1O7L A;  5EQ0 A;  4F88 A;  2B2Y A;  5LHY 1;  4XQQ A;  1CFM A;  4C1N K;  3D4R A;  1C8C A;  1I4Q A;  1JOK A;  2F03 A;  1I6V C;  3T13 A;  2NVQ B;  1B9N A;  4A93 B;  1WVL A;  3GD7 A;  2O4X A;  1CI3 M;  2AQ1 B;  4FF3 A;  5A2Q E;  1YNJ D;  2PW5 A;  4XYO A;  3QO2 A;  4KJO A;  4RGM A;  5EJW A;  1OO9 B;  1SJH D;  3GV6 A;  1AEX A;  1AN8 A;  1G6Z A;  2IX3 A;  4M8A A;  1R4Q B;  3AMU A;  5CGK A;  4FXG C;  3T56 B;  2FHT A;  2XWB B;  2JSO A;  5JPM C;  4IZ8 A;  1DCZ A;  1UUP A;  5C3W A;  4S3S A;  4C3J B;  1EIH A;  3K7A B;  1GOZ A;  3H0G B;  3T4A C;  1G8Z D;  4ZKC B;  5G3L F;  1A3V A;  5IGC A;  2ZXO A;  4DXF A;  4CKB A;  1PDQ A;  1PRT F;  3NTI A;  3BZD B;  5M3F B;  3TSS A;  1X32 A;  1I4G A;  1F9Q A;  4OL7 A;  3P1H A;  1EYC A;  4DK0 A;  3JAM E;  1U4L A;  1PTO F;  1ENC A;  1ZEQ X;  3MXP A;  4BY7 B;  1SBB B;  3SK4 A;  1EY0 A;  3R3O A;  3S2H B;  4PNY A;  1EYD A;  1EOT A;  2EYH A;  4ABN A;  3MVV A;  5CYU A;  4C1N I;  3IKJ A;  5K36 H;  1IKL A;  2BE5 D;  4XYQ A;  4RH6 A;  4RGN A;  3QWN A;  1KNE A;  2EY2 A;  3IFT A;  2L9H A;  5IGD A;  1PFB A;  4M1U B;  1TWF B;  5EKI A;  3VR3 A;  3DMU A;  2AUK A;  1I50 B;  4LAA A;  1STG A;  3TP8 A;  2EVB A;  4OIK A;  2Q8R E;  2CQA A;  3PIO 3;  3RZO B;  3BVZ A;  2XN9 C;  3SHL A;  1I6H B;  3S2D B;  4NDX A;  1Y8N B;  2F0E A;  1LTS D;  2FJ2 A;  2RDG A;  1HFG A;  2B2W C;  2E2I B;  3OHX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...