2EVBA

Structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form i
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
74
structure length
74
Chain Sequence
MVVSENVVSAPMPGKVLRVLVRVGDRVRVGQGLLVLEAMKMENEIPSPRDGVVKRILVKEGEAVDTGQPLIELG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein,transferase
molecule keywords methylmalonyl-CoA decarboxylase gamma chain
publication title Protein biotinylation visualized by a complex structure of biotin protein ligase with a substrate
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 13
structure length 74
sequence length 74
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2005-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2evbA00
1ZKOA 1Q1EA 2B8GA 2F1MA 1TU2B 1ZYRC 2B8FA 4JK1C 2AUJD 1VF7A 2E75C 2EJMA 2O5IC 3SDZA 3PUYA 1Z6HA 1GHJA 2AUKA 2JXMB 1Q1BA 2V4DA 3HGBA 3LWUA 3WDNA 1GUOA 2PCFB 5KNDA 4LJZC 4BA2I 1CTMA 1O78A 1OXUA 3PUZA 4IQZA 5BN4A 4BA1I 3VR6A 2JEAI 1GJXA 1OXSC 3BG3A 3QG1A 3M7NA 3U9SA 3FPPA 2JE6I 3CRLC 2DN8A 1HTPA 3QIAA 1IYVA 2EJGC 1YNJC 2BE5D 2NN6H 3GD7A 3AB9A 4H44C 2EJFC 1GHKA 4TQUS 5BN3A 4DNTB 4KI0A 4OO1H 3IKJA 2D2CC 3ND9A 1IYUA 2EDGA 3MFYA 3VA7A 2ZT9C 1O7LA 2L5TA 3D4RA 2NN6G 2EVBA 1FR3A 3I73A 3MXUA 1PMRA 2A6HD 3M4YA 1A6XA 4G7ZC 1EWHA 3OOCA 5A35A 2A69D 4OO1G 1VF5C 1LABA 3FMCA 2K33A 3A7AB 3T56B 2A68D 2BE5C 4DNRB 1OXVA 5JEAH 3CRKC 3ND8A 2KA7A 2NN6I 3NE5B 4XTCS 2KCCA 4KN4C 1V8QA 3VR2A 2BA1A 5BN5A 3DXJC 3A8KE 1YNNC 3KLRA 3BDOA 3T51B 1OXTA 4HR7B 2IT1A 5KNCA 1SMYC 2CW0C 1GUGA 1Q90A 1FYCA 3D31A 3W3AA 3T53B 3I4LA 1VDZA 2D5DA 5JEAG 1K8OA 2A6HC 1HQMC 2E76C 1E2VA 1H9SB 1I6VC 2LMCB 2AWOA 1ONLA 2D62A 4G7HC 2A69C 3GQBA 4I7ZC 3OPOA 4DK0A 1HPCA 3LNNA 3SE0A 1QJOA 1Y8NB 4JBWA 5K36H 1T5EA 1E2ZA 2A68C 4GZYC 4G7OC 4PV1C 1Y8OB 3IFTA 3VR4A 1OXXK 5C0XH 4DK1A 2PPBC 2JEBI 2K7VA 4KKSA 4KKTA 2QF7A 1GUSA 2DNEA 4KN7C 4H13C 1LACA 4KHZA 3EQLC 1HCZA 2O5JC 3L7ZC 2A6EC 3A8IE 1CFMA 3RLFA 1CI3M 5K36G 3P20A 1V43A 3H94A 1DD2A 3VR3A 1G291 1DXMA 2A6ED 3PUVA 2K32A 5C0XG 1BDOA 1H9MA 1B9MA 1Z7TA 1H9KA 2YYZA 3PUXA 1K8MA 3M85A 1Y69U 1IW7C 5KNBA 4IFDH 2BA0A 2PNRC 3QJYA 1E2WA 1Y8PB 4RCNA 3I72A 2DNCA 1Q12A 3N6RA 4KMUC 1IW7D 3TZUA 1H9JA 4KKUA 3A7LA 3A8JE 1DCZA 3PUWA 4L8JA 2Q8IB 2R6GA 3PV0A 4LK1C 4TKOB 1H9SA 3VR5A 2E74C 1GUNA 3OW7A 4OGQC 1H9RA 4XIGS 1B9NA 1TKWB 2BDOA 4IFDG 1VCIA 1GUTA 4H0LC
chains in the Genus database with same CATH superfamily
1JMCA 2B2VC 3KLWA 4QL5A 1L1OC 2G9HD 2DGYA 3J80c 4JI2L 1NR2A 1Y14B 4R4TA 1EY9A 4GNXC 5EPKA 4ULLA 2R7ZH 3I3CA 4GN4B 2Y0SE 4JV5L 4P72A 4C3JH 2AHOB 2HD3A 5C4HA 3RZDB 4IPHA 2KHIA 1CTMA 5C44H 3HOVH 2PI2E 3S15B 3FPPA 4JOIA 3HKZG 4A93B 1IYVA 2EJGC 1KNAA 4C3JG 3FEWX 1JR0D 3TQYA 3RNUA 1S72A 5C44G 4KI0A 2JA5H 2F0HA 4WORA 4OO1H 2F0GA 2XWJB 4AQYQ 3K5NA 1RL2A 5EJWA 1O7YA 4YY3Q 3QR8A 1ENFA 4JYAL 1KC8C 1AFPA 4QF4A 4DKAC 1XXGA 2BOSA 1TWGH 3BVMA 3GV6A 3OMGA 3K5MA 4OO1G 4PMBA 4P75A 3VA5A 4ZKBB 1NMGA 3NE5B 3I4NB 5C4JH 3VR2A 1PTOH 1M1KC 3K80C 3BDOA 1I4XA 1V1PB 3D4DA 4KY6A 4DUYQ 1HR0Q 1ML0D 1LT4D 5M3FB 4Y52H 1VDZA 1I3QB 1SLJA 1HQRD 1D1IA 1S3OA 1ONLA 1EQQA 1D5XC 2VW9A 2A69C 1BXTA 4RCOA 4ID6A 4LMQD 1I50B 3UI2A 4HJAA 1GM5A 4JBMA 4R4QA 4KHVA 1EWCA 5FLXL 3DM1A 2WB1B 5LHY1 3S15H 3J7AV 4DV4L 2XNAC 3F2UA 3LX0A 1KRTA 1WTRA 3QOLA 4R4CA 4A93H 5CYUA 1BF4A 2UXDQ 2B2YC 5JJKA 5LL6S 5M5WB 4HAEA 1G2SA 1DOMA 5HGQA 3TP5A 1IW7C 2JQOA 5JVH3 4YWKA 4IUVA 4OX9L 1MSHA 4A3IB 2CQOA 1AW7A 3PUWA 4CDEC 2E2HB 3VYSA 1F2LA 4C1NI 3V05A 4OGQC 2RHSB 1K8GA 1EIYB 4ALPA 2P5ZX 1U4RA 3FKIG 2LFNA 4DR1L 3I4NH 2UXBQ 2EYLA 1II3A 3GTMB 2MQHA 4JI4L 4LFBL 5EKIA 2B2UC 1PRTC 1KDCA 3NTHA 4H7BA 5IIFA 1CA6A 1GXDC 3FP9A 2K5VA 4JPBW 5KNDA 5IT9L 1XNQL 3TDQA 3C46A 1XNRQ 3I4NG 2GVAA 4IUQA 1SE3A 4RKBA 2HQLA 4TSSA 4WFN3 1JJCB 1I50H 2WAQB 4R4IA 1BBWA 4P2CB 1HZ9A 4LF7Q 3OSOA 4H44C 3HP3A 2YTYA 3K59A 1YNJD 4NPSA 5DEHA 5CV6A 4TQUS 1BCPC 5LMUQ 3JAMi 2IHEA 2B29A 3IKJA 1CHQD 1Q86C 1PDQA 3MFYA 4LUOA 5CBEE 5A2QE 1SJHD 4DR4Q 2WB1G 3M4YA 4B3RL 1PTOD 5F2DA 1P8LA 2MGSA 4IPDA 2A8VA 3C3LA 2Z6BA 1WTQA 2NB0A 2ENBA 2HIXA 3CCQA 2E2HH 5IOCA 1SE8A 4DU9A 3GO5A 1LTTD 3Q6SA 1UAPA 5IGDA 1V1OA 3L3OC 1EUJA 5KGUA 1RJTA 3TP7A 1DONA 3GTMH 1YEZA 4G57A 2MJ8A 3T53B 2K75A 1SRUA 3ITPA 3I4MB 5IODA 2X69A 2XRSD 3FDTA 5IGGA 1PH9A 2F0QA 5LMNL 2F52A 2PZUA 4QGUA 1JE4A 1U4LA 1HNXQ 4K8JA 1QZGA 1BO0A 3L2PA 3RD4A 2PPBC 2ZJRA 3MFGA 2A5HA 2D9UA 2TMPA 1EU4A 2ZJQA 2F0SA 1DD2A 1KIXA 1H9KA 4IOCA 3OWEB 1VQAA 3RZOB 4RG1A 2RCFA 1TIID 1G6ZA 5D65A 1UNSA 3CP0A 3TSSA 1FNUA 1IYJB 2IJ0A 3MZ5A 3OW7A 2OWOA 2F0KA 2BDOA 5ELEA 3KF8B 3NUCA 3K7AB 3U9OA 2KEDA 1ZYRC 1J5EQ 4OEMB 4HJ5A 5DAUA 1B70B 3BZKA 1GHJA 4EQNA 4R4OA 1RF2D 2AQ3B 3UDFA 5C0XJ 1JWMD 3I4MH 4IO9A 2BH2A 1O78A 1OXUA 1C0AA 1B1ZA 2JEAI 2BH8A 3KF6B 3MC0B 1HTPA 4MNOA 4ZUJA 3UE1A 1YI2A 2N8NA 1EWIA 3HOYB 1YHBA 5JPMC 4QUCA 4EQ5A 3CCRA 3KDFA 3J80E 1X9NA 1QNKA 2ZTCA 5HURA 1RIPA 4C3IB 3VA7A 4ABNA 1MSGA 4YCWA 4C2MH 1EZ8A 4UP8A 4J15A 4B3TQ 4L5RC 1JC7A 4G7ZC 2K5WA 3G71A 3GTGH 4KHPL 4RHRA 2WKCA 1PHJA 4IUNA 1L0WA 1S4ZA 3T56B 4JI0Q 4FF3A 1BOSA 3KBGA 4DV0Q 1MKHA 3PQIA 3EROA 3QOJA 4JOIC 4UHVA 4LF5Q 4OIKA 1STHA 3PMFA 4IUPA 1EFWA 1K8OA 1H9SB 1I6VC 3K8AA 3DUZA 1TY0A 1IKMA 3IRBA 3IL8A 3VR4A 1U9RA 4DR2L 5C0XH 1S5BD 1YNXA 3FVQA 3HOXB 1C48A 1TS5A 1LACA 3J80i 1DJRD 3HOYH 4YWMA 2OF1A 2UXCQ 3L7ZC 4KV6A 3KJPA 4ZAIA 2K32A 5C0XG 3SEBA 4C3IH 3MXPA 1V1PA 3PO2B 3PO3B 1IBKQ 2MNAA 1IW7D 1WVLA 3OMCA 4DN4M 1WJJA 4JC0A 3EBEA 1HNWL 2L55A 3RN2A 2CKZB 4X66Q 3DWPA 2QILA 5M5XB 4C3IG 1W6KA 1LTLA 2NWGA 2Q2IA 4HN7A 2N78A 2MUYA 3I55A 1TU2B 3D4WA 1HUMA 1JB7A 1QZHA 3VDYA 1N34Q 3NK9A 3K57A 2YTXA 1PRTD 1R4PB 5EPJA 1X32A 4N9TA 4RGNA 1IL2A 2HCCA 2R92B 2K05A 3QG1A 3H3VC 2ICIA 4NKLA 3QIAA 5ELCA 4NXMQ 2BE5D 1EYCA 3E3XA 4GS3A 2H4OA 5EQ0A 4IFDJ 1S5FD 2VS1A 4FF2A 4IN3A 5HGTA 1D7QA 4JI2Q 1LUZA 2V1CC 2CW0D 5C3EH 2KECA 2F0OA 4JV5Q 1KAWA 3HKZE 2OTLA 3PO2H 3PO3H 1HRJA 3HEJA 3G6EA 1HUNA 3NWSA 5C3EG 3NBHB 4BS9A 5M5XH 1MGSA 3M4OB 1WCMB 2Z4IA 1Q3LA 2Z0SA 5E1FA 1QG7A 4QB4A 4PQXA 5FLXc 3GTOH 1JCKB 3D31A 2AQ2B 3W1GA 1VQOA 4JYAQ 5GQOA 4XYQA 3TP6A 5K36H 3NQTA 3KJOA 1Y8OB 1LT5D 3S1MH 2B2YA 1KTKA 4KKSA 1K8AC 4I65A 1PH8A 2Q2TA 2Z6KC 1ILPA 5K36G 1FVIA 3SHLA 3GDEA 3HFZB 4IFDH 3QJYA 1PFNA 4OELB 1UE7A 5IYBH 1A3UA 3H91A 2NVYB 4QIWB 2E74C 3ICEA 4HJ8A 3LWEA 2EY6A 1SYEA 3BVGA 4EQPA 4IFDG 3PIP3 1EQTA 4H0LC 5IT9c 2A1AA 3CCJA 5ELBA 2JK8A 1SN8A 1X6OA 4A3JG 3KUPA 5M9OA 4RA8A 3OTOL 3LWUA 1DOKA 2K04A 4DAYB 4OX9Q 1X65A 1A3VA 1NR4A 2SEBD 2LY7A 3J7AF 3UDXA 4HCSA 3MWYW 3GD7A 5C5LA 4DF7A 1M4VA 4DUZL 4JI8L 4DR1Q 1AZQA 2R7FA 2L11A 3K5LA 4JI4Q 4LFBQ 1QNUA 5M3MH 2Q8RE 3I56A 1WD1A 3AFPA 3H3VH 3BYYB 5C4XB 1XNQQ 2PMZE 1RODA 2M2LA 5D3IB 1Y1VB 3P1HA 5M3MG 2NVYH 1FGBD 3KF6A 5J3BA 3DXJC 4K0KQ 4A3BB 1OXTA 1C4QA 1Q7YC 2WB1E 4ZYSA 4A3DH 4HMJA 1EIHA 3ZYYX 3DHQA 1KRSA 4NP5A 2GVBA 1PTOC 3MEFA 1I6HB 4G7HC 4B3RQ 1G51A 4I7ZC 3AEVA 1CKNB 1QJOA 1N33L 2NZ1D 2LS01 4A3DG 4GKKL 1XMQL 3IFTA 1B8AA 3FHWA 4H02A 1KL9A 5COYA 5IGEA 3WWVA 2DJGC 1R4QB 1G8ZD 2I5LX 1TXYA 3IAYA 1VQ8A 2L9HA 3M4QA 1QUQB 1HR0W 2E2JB 3M3YB 1YZ6A 2HDLA 4IPGA 2F0UA 2QEJC 4ZUIA 4JBJA 4K5VA 4AYBB 2IY5B 1DCZA 1XPOA 1H9SA 3J81L 1PH1A 1WI5A 1ZXTA 1SROA 2Q8TA 4FXGC 1Y1VH 2JA9A 1KD1C 3P7JA 3MA2B 5DNFA 1VQMA 3O13A 1J8IA 4O0AA 4PMCA 3NTKA 4UAIA 4A3BH 4DV6L 4BY1H 3GTLB 5FO9B 3S1QB 2FXQA 2OT2A 4HIOA 1EYAA 2HT1A 1Y1VG 3ZJYC 5FO8B 4Z9CB 2AWNA 1Q8KA 1GD7A 2L0CA 1K0RA 2H5XA 4R9WA 4A3BG 4BY1G 2DN8A 1JOKA 1T5XD 4UP9A 3SK5A 3S14B 5M5YH 4B3SL 5AJ3Q 1AE3A 5C6AA 4JI3L 1XTCD 2R93B 2G5DA 1EFID 1VQDA 5E4XA 4BBSH 2NVQB 1HA6A 2ZT9C 1IHZA 1YHAA 1JWSD 3H0GB 4JCVE 5ISRA 1V9PA 4K5XA 1EWHA 4DK3C 3A7AB 4BBSG 3RN5A 5JJIA 4RKLA 3CRKC 5EGTA 2NN6I 2R7ZG 3MXNB 2EE1A 3RLNA 4DR7L 3HOVG 4L63B 3R2IA 2XRQD 1FYCA 4HIDA 3D6WA 3EFXD 3CAMA 2VB3X 2D5DA 2B63H 1EU3A 3GTKB 3S1QH 3BZDB 3ERSX 1PH6A 4A3GB 5GAHC 3KK7A 3LNNA 3BYTB 5ELFA 4TRDA 2BCOA 5GAGC 2JA5G 4GZYC 4G7OC 5EBDA 4KHPQ 1AEXA 3J7YW 2Z4HA 2B63G 4KKTA 2VUMB 2B2WC 1HTLD 3S14H 2ALYB 4ME3A 5IGCA 1CFMA 4L6TB 5FLXE 1QVCA 1G291 2FFKB 2FMMA 3CC2A 1Y8PB 1XPUA 5KRUA 4DR5Q 4GOPB 3H0GH 4R1JA 4A3MB 3Q0AA 4KD4A 2R6GA 3R2TA 3RZDH 1SR3A 2PYKA 2AKWB 3S1RB 4DR2Q 3A74A 1TKWB 2QGQA 2NBFA 1LV9A 4BWGB 4OXPA 2ZTDA 1LTRD 1Q1EA 4XQQA 4CKCA 3H0GG 1SAPA 2F0TA 3ER0A 1VF7A 4J1MA 1ICWA 1SFOB 2I5HA 5C4ZA 3CHBD 5I9PA 1CQVA 4IURA 1VQBA 1EY4A 1F9QA 2QKIC 2AUKA 3JAME 4UDUC 4LF6Q 3HOUB 3CCUA 3WDNA 4QCLA 4A93G 3B6YA 4P74A 1TT2A 1PA6A 5CORA 1HNWQ 4B9WA 3S16B 2JE6I 1TY2A 5I2YA 1XJVA 1EY0A 4DAVA 2EJFC 1PFMA 1Q82C 1X3GA 4DXGA 2B39A 5BN3A 1QOHA 1U5KA 4KJOA 1YNND 1SYGA 4B3ML 1S5ED 5IGBA 4V190 3TZDA 2NTSA 4DNIA 3C1EA 1KNEA 1H95A 2NYZD 1WTPA 4ZCKA 1IBML 3NPPA 5M3FH 4GLAC 2F0FA 2GN5A 3CQZB 4IPCA 1I3QH 4LW1A 3ULJA 4Q5VA 4A76A 5A35A 4K5WA 1SNPA 4A3MH 4DA2A 2BE5C 1OXVA 4X64L 1N8RC 1N9WA 4BY7B 2X6GA 2KCCA 2Z9HA 1PLFA 5M3FG 2K5NA 3T51B 3I4OA 3CF5A 1WTOA 4GKJL 2J0TD 4OO1I 3E6ZX 2CW0C 5IGFA 5EAYA 3BU2A 2NTTA 3NEMA 5M5WH 1CZGA 2LMCB 5JAVA 4DV2L 3DLLA 2F0PA 1M8AA 1JWUD 1HPCA 4A3IH 1A8VA 1ZEQX 1SNDA 2F3VA 1B2TA 3DEPA 1OXXK 1B3AA 4RGMA 1A2UA 2Z6KA 1EYGA 4GLXA 5KIXA 4KN7C 3F8TA 4HSVA 4IJHA 4IOAA 2O5JC 4A3IG 1EQVA 4YHHL 5ELDA 1AE2A 1DXMA 4XT1B 1Z7TA 5IE8A 4RCNA 3PGZA 1Q12A 1TR5A 5JEAJ 3A7LA 2F0LA 3CQZH 1Q8IA 1N36L 2EOTA 1U0LA 3E5SA 5JJZA 1F2ZA 4QMGA 5FLMH 3GTPB 1CKNA 1NUCA 5A2QL 2Y0SB 1I4QA 2LKVA 4BY7H 4A3KB 3KFUA 2K01A 3U4ZA 4K2KA 4X65L 2LXKA 5CV5A 1A2TA 4EQOA 5FLMG 1PH2A 2EY1A 2PQAA 1E7ZA 2WAQG 1YHQA 5L37A 3PUZA 2HQEA 2K5DA 2KCTA 3S2DB 4TVAB 3CCLA 3E0JA 3RMHA 3I91A 4HJ7A 3HOZB 3AB9A 2XSCA 5FKAC 3S24A 4MTKA 5H1SE 1X3PA 1VQHA 4JI7L 2EDGA 4NB3A 2KHJA 4L5SA 1TWAB 1O7LA 4N9PA 4UP7A 3OTOQ 1TS2A 3T4AC 4DR3L 3TEHB 1EY8A 4FDBA 1VQCA 2UU9L 4DNRB 5GROA 5JEAH 3UDIA 4KN4C 2XN9C 3GTPH 4DUZQ 4JI8Q 1PZKD 2WKDA 1RKNA 3I4MG 2VB2X 4G4KA 5FO7B 4A3KH 3K81C 3CD6A 1JT8A 2X6LA 1VQ5A 3A54A 5JEAG 2AWOA 2JJQA 2ID0A 3RZOH 3X3MA 2L15A 3E0EA 4LWCA 3OIPA 1D5MC 3E9HA 1F9RA 4MZ9A 3CC7A 4A3KG 1C7YA 1QE6A 1PYWD 2KCMA 2JA7B 2EYPA 1QCBD 4ZRZA 4U673 3HOZH 4QIWE 4M1UB 1PYSB 1SNMA 1K28A 3DWQA 3RLFA 3MXNA 1SYFA 3K7AH 4JI1Q 3I2ZA 4RAUC 3J81c 2Q2UA 1NAPA 1A6XA 1EIGA 3M85A 2RKSA 4KK7A 5FK9C 4DV1L 2MFIA 4OWWB 3S2HB 1CSQA 4KKUA 1G6PA 2YV5A 1EQRA 4AIMA 1N33Q 4IUUA 4XIGS 4LFAL 1H9RA 4GKKQ 1F9PA 3X3NA 2J7ZA 1B9NA 4DR6L 2XGTA 2F0JA 4WJ3M 3GTJB 1ZKOA 1CZWA 3G7LA 4N8X1 2IHFA 2RSNA 5BR8L 2AUJD 5EKLA 2E2DC 1N32L 2IX1A 1HNZL 4YCVA 1Z9FA 1NNXA 1FJGL 4LJZC 1DGSA 1YITA 2F0DA 3HOYG 1XTDA 1HH2P 4IQZA 3M7NA 3U9SA 3IFDA 4ILWA 4B9XA 1EZ6A 1S5DD 4GOPA 4C3HB 1SXTA 4K6LA 3STBD 3SK8A 2WFWA 2JA7H 4O42A 2QDLA 3J81j 4DV5L 2NVXB 2F0MA 5JPNC 2HIVA 1A3TA 3ND9A 2VQFL 1IYUA 1LM0A 1ENCA 4DV6Q 1VQIA 1PFBA 2L5TA 2K5QA 3S9WA 2HHHL 1K73C 2RSOA 4FYDA 3M4PA 4KLKA 3S2HH 1BCPF 4DXFA 1VF5C 4CJ2C 3K0XA 2JA6B 1UWVA 1PH5A 4XTCS 4F7XA 3T16A 1PZID 4PG3A 4B08A 2PNHA 5BN5A 3HOXH 4B3SQ 5KYLA 5IWAL 2SNMA 1Q90A 4JI3Q 3BDCA 1X3EA 5ELOA 5NUCA 4XT3B 4JI6L 1E2VA 4F8MA 3I90A 1KHIA 3A55A 3HOXG 3OPOA 2RDFA 5CV8A 5CMDA 3CCMA 2CHBD 3NBIA 3ERQA 2H1EA 3SK6A 1I5FA 1QB5D 1FGUA 2B2WA 2JEBI 2K7VA 4H13C 2E8GA 3MXGA 4MIUA 3K58A 2KJXA 3PO2G 3PO3G 1VS0A 5T1GA 3P20A 4DR7Q 2NVXH 1BDOA 1H9MA 1QILA 1LYLA 3PUXA 4DR4L 3UDGA 5G3LF 4DFAA 4OHJA 3T1YL 2PZTA 1VQ6A 4BXXH 3OIQA 2E2IB 4LF8L 2PW7A 1TS3A 4YCUA 2IX3A 1SSOA 3L9AX 4KJNA 4N8FA 1J9OA 1F9SA 4FF1A 2R92H 2JP1A 1GUTA 1MJCA 4BXXG 2B8GA 5J22A 2F1MA 1EEFD 1L2FA 4PZ7A 5IYDH 2JA8B 2EJMA 3PCOB 4YIJA 2PO4A 1E1TA 1MHWC 2RF4A 3RR5A 3QO2A 2R92G 1VQ7A 3CCVA 1SNOA 2V4DA 3G48A 4RMFA 5JOBA 1JOQA 3A5ZB 2XWBB 4HTHA 2F0EA 3SK4A 3GTQB 4CDCC 1R9TB 2ES2A 3TRZA 1OO9B 1OXSC 4UY8C 4LFCL 4F87A 5DLQE 3PSIA 1ILQA 4DPGA 4A75A 2EPBA 1HZBA 5IY0A 1IKLA 1LT6D 4DV4Q 1MI2A 1YJNA 5IYBG 2QA4A 1UUPA 1TWCB 3M4OH 2WIIB 1WCMH 5C5MA 1BUVT 5IYCH 1K3BC 1I4HA 4PNYA 4K8IA 2CFMA 4LUZA 2K33A 1WCMG 5D14A 4DV7L 2IWHA 2KA7A 2RQXA 4KD3A 2VZAA 4A3FB 2CH4A 5IYCG 3F2DA 3PIOA 2HUGA 1YNNC 4HIKA 1DM0B 1SE2A 3BVZA 1D2BA 3W5OA 1A63A 5CR3A 4R8IA 1BNZA 4XQNA 4B3MQ 4A3CH 2JA8H 3KF8A 5FJ8H 2C5CA 1XPRA 3P75A 3I4LA 2L12A 3PF5A 2KEEA 1BBUA 2F0VA 5TSSA 4BBRB 2NUCA 1Y8NB 4EVOA 4C1NK 1T5EA 1E2ZA 1RTOA 4A3CG 2JA8G 1F2MA 1Z47A 2QCPX 2DNEA 3EQLC 2UUCL 1MIUA 1SYBA 4GKJQ 1B3QA 2HCIA 3A5UA 1K9MC 3HOWB 2FHTA 4ME5A 3PUVA 2EXDA 3T1HL 4K14A 5CGKA 1VQ9A 5IP7H 1U4MA 3A56A 3H15A 4KMUC 5I9OA 4DV2Q 2L1BA 2O2LD 2YU9B 4L8JA 2RBMA 4JBKA 2DY8A 1YIJA 4DV3L 2AQ1B 2OQKA 2ASBA 4XDXA 3KYHC 1VCIA 3CMEA 1AP0A 2K28A 3J7ZC 4A3FH 2XVSA 3KBXA 1EOTA 3AYHB 3SDZA 2DJFC 1E3PA 1CA5A 4YHHQ 4LF4L 1EL0A 1JOOA 4Y7NB 1IZ6A 1LTSD 5C3WA 1Q1BA 1LTAD 3OYYA 4BA2I 3K0YA 4FXDA 3U4VA 1BR9A 4QJFA 3AQQA 5C4XH 4CDFC 3TREA 1VQ4A 3CRLC 5CV9A 5LMNQ 1N36Q 2PW5A 1CM9A 1WTHA 2IPKD 2E5LL 1E0BA 1LT3D 3VYUA 3JC66 3HKZB 4GLVB 5C4XG 4C3JB 1CSPA 2WAQE 2EYOA 1L0XB 1XX8A 4X65Q 5T1IA 2F0NA 2FMCA 1OTCA 5C44B 2EVBA 4A3LH 4NDXA 1TWHB 1K83B 1PH3A 4GN3B 4PZ8A 3I8ZA 1I6HH 2YU9H 4LAAA 4IJLA 3FMCA 1ESFA 2IL8A 4A3LG 4CJ0B 4A4IA 1GKHA 3A8KE 4GOPC 3J81i 4KY7A 3Q23A 1F77A 5CC4A 1CQFA 4XQJA 4JI7Q 2ICEC 2B2TC 3H3VI 1HQMC 1PXUA 1TWGB 1HFGA 4Y7NH 2RDGA 1SMXA 5J39A 1B53A 4DR3Q 2E2JH 4JBWA 4FP5D 2UUBL 3M3YH 2UU9Q 3CCSA 2O4XA 4PV1C 3DMUA 5C4JB 4DK1A 2KENA 2CWPA 4ZKCB 1ASZA 4ZK9B 2A6EC 2KBNA 3VYRA 4X62L 3CU7A 5EPLA 2JSOA 3NXWA 4AYBG 4WJWA 2BA0A 5AFWA 3GTLH 1E24A 2RHQB 5JJLA 1STYA 3NENA 1RTNA 2MO1A 4O1NA 1AZPA 3A8JE 1STGA 1TWHH 2DY7A 1SBBB 3PV0A 1K83H 3G6JB 2IX0A 4PMWA 4WJ4A 2R3ZA 4NXNL 1IXRA 1YBYA 1HA5A 3V96A 2D0PA 1NBWA 1MJEA 2R7DA 1JORA 3NBHA 1QWYA 4XXEA 3FKIB 1Z6HA 4M8AA 2R93H 4DV1Q 3HS0C 1GUOA 2PCFB 3FPUB 1C9OA 2ZXPA 2NVQH 2I0QA 1UE1A 1U4PA 4U68A 3T13A 1IBLL 1KABA 4LFAQ 3PF4A 2R93G 1B44D 5CV4A 5IP9H 4DR6Q 4RH6A 2Q2HA 3KLSX 2NZHA 5BR8Q 2PMZB 2D2CC 1ASYA 1N32Q 2UUAL 1HNZQ 2GA4B 5IP9G 1S5CD 4CBVA 1FJGQ 3GTKH 1Q46A 3AU7A 1L1OB 4GNXB 1I4RA 2A68D 4A3GH 1NMFA 1O7ZA 1E1OA 3STBC 2EYMA 1M90C 5IT9E 2ZM6L 1VQKA 4RFBA 3KLRA 2VUMH 3HZXA 3K5OA 3NELA 5KNCA 4DV5Q 3CW2C 3A0JA 4FXKC 2VQFQ 3BJUA 4A3GG 3ULLA 2F4VL 3FKIH 2HHHQ 3MEHA 5FOBB 2TSSA 2VUMG 2KOLA 2A73B 1CUKA 1K0SA 2RDHA 4FNFA 4DAYA 3TMEA 3JAML 1GUSA 3S1RH 1PTOF 4KHZA 5DM63 1W6JA 4E6IA 1PYBA 5IWAQ 3D0FA 4OWXB 1V43A 3H94A 4IZ8A 1P16A 4A3MG 3EJIA 2CQAA 1Y69U 1SFOH 3TP8A 3D3RA 3BDLA 4CKEA 5I2XA 1TQOA 4JI6Q 3I72A 1EIFA 3TS0A 1NY4A 1CKOA 1B4OA 3HOUH 1UE6A 1GVPA 4DAPA 1KDAA 4X3SA 5CV7A 3BS1A 3S16H 1XYIA 1FL0A 4K0KL 4P71A 4LF9L 3D6CA 2OXPA 3HOUG 2E75C 1V1QA 3EA6A 2O5IC 3J7A5 3NQIA 3PUYA 5ELNA 4S3SA 4I7AA 5CBAE 1C8CA 2BDNA 1KDBA 3NSWA 3HGBA 1EY5A 2K50A 3T1YQ 4RWSC 1T9HA 1X3QA 4ZLTF 2OEOA 2VQEL 3VR6A 4J8QA 4LF8Q 4JI5L 1VQPA 1NCVA 3AFQA 5KYIA 3Q8DA 2EIFA 2C9OA 4HCEA 3ULPA 2N88A 3U50C 1MBYA 5I6YA 2AMCB 1FNVA 4JG2A 3G4SA 1JE5A 2N3SA 3D4RA 1I94L 2A6HD 4BY7G 3F1ZA 1D5ZC 3HRZC 5D3DA 1AH9A 3D8GA 1A62A 1PRTB 1QUQA 4LFCQ 3QB3A 3SXHA 1GUWA 3H6MA 1XMOL 1STBA 3DEOA 1V8QA 2BA1A 3KOJA 1W2BA 1BBXC 2IT1A 4PZ6A 3TBIB 1SE4A 4C2MB 3NTIA 1CKMA 2WINB 5EKKA 3QWNA 3GTGB 2D62A 2F3WA 1BCPB 2F0WA 3NP8A 3W2DA 3SE0A 4RGTA 2LXJA 1RCVD 3WOEA 1EY7A 4EX5A 4JVZA 4OL7A 3DWAA 4LNQA 5LL6X 2D0OA 4DV7Q 3URYA 4MTNA 2G9DA 5AJ3L 2KUMA 4IUTA 1STEA 1HHVA 3HG9A 3S17B 1S40A 1STAA 2R61A 1SYDA 2A6ED 1PV4A 4EGVA 5KNBA 1NSNS 2KVMA 1PH4A 3TZUA 4C56C 1LTID 1QVFA 4POFA 2Y0SG 2F0IA 2Q8IB 2L4NA 4GN5A 1GUNA 1I4PA 3GV3A 2OCEA 3S2DH 2EYHA 2QDBA 3U58A 3OHXC 3GP7A 4JK1C 2UUCQ 1B50A 2WACA 1G2TA 4AQYL 3F2BA 1VQNA 3TN2A 4YY3L 2CWAA 3T1HQ 2CCZA 4XYOA 2MP1A 4R8NA 1A0IA 1TWAH 5C3XA 2KQ3A 3HOZG 4YWLA 1I4GA 3C1FA 4NMZA 4BA1I 2MO0A 3J80L 1LTBD 4MHEA 2KCNA 2Z8LA 1YJ9A 3EN2A 1XMQQ 4QQBX 4DV3Q 1VMPA 1GHKA 1AN8A 4DUYL 1HR0L 3L0OA 4F88A 4WRDA 3KLSA 1Y1WB 1CK1A 3LGJA 4KY5A 2J4XA 1NTGA 3S17H 1BQQT 4LF4Q 2ZXOA 4HJ9A 3I73A 4DR5L 1O80A 1L0YB 1GO3E 3N52A 2YTVA 2EYJA 2A69D 2I46A 1LABA 1CHPD 3MVVA 1PRTF 1LLRD 1Q81C 2UXDL 1PVOA 1EYDA 2CH4W 4O2DA 2E5LQ 1X55A 2C35B 4CDDC 2EY2A 1DOLA 1WOCA 2B2TA 5C3EB 1SMYC 1JICA 1GUGA 1TWFB 2F4IA 3W3AA 2ZJPA 4LF6L 4LUVA 5JVG3 1X54A 2E76C 4Q0FA 2F03A 3PIPA 2JA7G 4DK0A 2K1BA 4A3EB 1D8LA 2B2VA 5HY6A 3TS2A 1L1OA 3EVQA 1JJ2A 4GNXA 2UXBL 1SEBD 2K4KA 1KXLA 3GTOB 1NE3A 3DM3A 2JN4A 3I7FA 1CI3M 4DGZA 3GTJH 3AMUA 4X3KA 3C2PA 1Y1WH 4KTAA 5J1ZA 1E2WA 3BZCA 1XNRL 3MHBA 4X3TA 1TVXA 3FRPB 3UE0A 2WP8J 2NZOA 4QUFA 3S1MB 4LK1C 3R3OA 2UUBQ 1WTVA 1J6QA 4LF7L 1Y1WG 2EXZA 1UEBA 4K2LA 4CJ1B 4AYBE 4C3HH 5LMUL 2B8FA 2N55A 1BCPD 4X62Q 4V0BA 2CVRA 1TWFH 4JW0A 1WFQA 2OQ0A 5KEEA 1SNCA 2K5HA 3CC4A 1PFSA 4FVMA 4C3HG 4OIJA 4A3JB 2MPMA 1ICFB 3E9IA 3M9BA 5E3FA 1UE5A 1PH7A 2JYOA 1DZ1A 1ET6A 5C0XI 4A3EH 2RCNA 5EBCA 1EEID 1G91A 4P73A 4NXNQ 2JA6H 1VMCA 1SNQA 4ZQ3A 1VQJA 4DNTB 1VQFA 1MD2D 2NVTB 3RUZA 1VQEA 4A3EG 4CGYB 2IW3A 1JJGA 2JA6G 3NWTA 3SR1A 5K5PA 3Q24A 2B3GA 1WTXA 3OOCA 3CKIB 4MN3A 4RGOS 5IYDG 1QVGA 1HNXL 1D6EC 1O7IA 3S1NB 1UEAB 1IBLQ 4HEDA 2SNSA 5G3LD 3V2TA 1CT1D 4IALA 1HXYD 5M3MB 5LMNW 1XWEA 1WYDA 3VYTA 4ODGA 4HSPA 2LSSA 2K6AA 3JAMc 2EQSA 4DAMA 2UUAQ 4RHSA 4CKBA 2PI2A 1SYCA 2K14A 3GQBA 2SOBA 3OWFA 4A3JH 2A68C 2E2IH 2VXWA 1RDPD 1HZCA 2B2UA 2VL6A 2ZM6Q 1J5EL 4A3DB 2SDFA 3A8IE 2FINB 5DM73 1ZYRD 3SGIA 2VNUD 3VR3A 1BVSA 2NVTH 2WV6D 2HDMA 2PNRC 1K3RA 2F4VQ 2DNCA 3MTSA 2XTIA 1DYQA 1IBMQ 1LO5D 2RVLA 4TKOB 1ET9A 3ONAB 3VR5A 5GADC 2ATWA 1HJPA 3GTQH 3W1BA 1R9TH 3R8BA 5FJ8G 2QW7A 3S1NH 1LTGD 4X64Q 5E4WC 1E22A 1VQLA 2VY3A 2XIWA 1PZJD 2F3IA 4L5QA 4X6AH 3K6OA 1JB3A 4X3UA 2Z1CA 1RD9D 4K6DA 1FD7D 2JXMB 1TWCH 5I6WA 1JQYD 2M9VA 4B3TL 4J6HA 5GAEC 4HIMA 1EY6A 3EIVA 2A74C 5BN4A 1NJIC 1GJXA 1IL8A 3BG3A 2PZWA 4JI0L 4DV0L 1YNJC 1YJWA 2NN6H 4UPAA 3CCEA 5IP7G 2ZXRA 3CMAA 4LF9Q 4LF5L 4BY1B 1STNA 2I5MX 4JI1L 3R93A 1WD0A 2A19A 3J81E 4AH6A 3H09A 2KHSA 4CHTB 4APVA 1B7YB 2NN6G 1FR3A 1KAAA 3MXUA 1PMRA 2QEXA 4IFDI 1SDFA 4L5TA 3K7UC 3RLOA 4A3FG 3OW2A 2VQEQ 1TS4A 3NHHA 4BBRH 2N49A 1X3FA 1KQSA 4JI5Q 5M5YB 3ND8A 2MHVA 4NW2A 2UXCL 3WOFA 1D1KA 1BKBA 1YVCA 4BBSB 4HR7B 3SVMA 3CXCA 2PQAB 1KLUD 2R7ZB 1F2YA 3CPFA 4BBRG 1SMYD 4HMIA 2A6HC 3HOWH 1IBKL 1FNWA 1X56A 4POGA 3HOVB 1I94Q 2EY5A 1HFNA 1KLGD 1W3SA 2PQEA 1A15A 4OWTB 2OTJA 2DUDA 1VQGA 4X66L 3I70A 4FF4A 3F2CA 1HZAA 3HOWG 2QF7A 1XMOQ 3CPWA 2JA5B 2K03A 2M00A 1HCZA 2RA4A 4OONA 2K52A 1RHPA 3HKSA 2B63B 1WTWA 2FJ2A 1N34L 1B9MA 2YYZA 1K8MA 2ZTEA 3PIO3 3MAQA 3M7GA 3N6RA 1H9JA 3Q22A 1ENAA 1GOZA 4DK6C 2EYFA 1EOVA 1ESRA 2I07B 4FO2A 4NXML 1SJED 3KDFB 5E7NA 4QY7A 5I4DA 2EZVA 1PTOB
chains in the Genus database with same CATH topology
2B2VC 2G9HD 1NR2A 1EY9A 5EPKA 4ULLA 3I3CA 5C4HA 3RZDB 1CTMA 3S15B 3FPPA 4A93B 1IYVA 2EJGC 1KNAA 4C3JG 3FEWX 1JR0D 4KI0A 2F0HA 4WORA 4OO1H 2F0GA 2XWJB 3K5NA 5EJWA 1O7YA 1ENFA 1AFPA 4QF4A 1XXGA 2BOSA 3BVMA 3GV6A 3OMGA 3K5MA 4OO1G 4PMBA 3VA5A 4ZKBB 3NE5B 3I4NB 3VR2A 1PTOH 3BDOA 1I4XA 1V1PB 3D4DA 4KY6A 1ML0D 1LT4D 5M3FB 1VDZA 1I3QB 1HQRD 1D1IA 1ONLA 1D5XC 2A69C 1BXTA 4RCOA 4ID6A 4LMQD 1I50B 3UI2A 4KHVA 1EWCA 5FLXL 3DM1A 2WB1B 5LHY1 3J7AV 2XNAC 3F2UA 3LX0A 1WTRA 3QOLA 5CYUA 1BF4A 2B2YC 5LL6S 5M5WB 4HAEA 1G2SA 1DOMA 3TP5A 1IW7C 5JVH3 4IUVA 1MSHA 4A3IB 1AW7A 3PUWA 2E2HB 3VYSA 1F2LA 4C1NI 3V05A 4OGQC 1U4RA 2LFNA 2EYLA 1II3A 3GTMB 5EKIA 2B2UC 1PRTC 1KDCA 3NTHA 4H7BA 5IIFA 1CA6A 1GXDC 5KNDA 5IT9L 3TDQA 3C46A 4IUQA 1SE3A 4RKBA 4TSSA 4WFN3 2WAQB 4P2CB 3OSOA 4H44C 3HP3A 3K59A 1YNJD 5DEHA 5CV6A 4TQUS 1BCPC 3IKJA 1CHQD 1PDQA 3MFYA 5CBEE 5A2QE 1SJHD 3M4YA 1PTOD 5F2DA 2MGSA 3C3LA 1WTQA 2NB0A 2ENBA 5IOCA 4DU9A 3GO5A 1LTTD 3Q6SA 1UAPA 5IGDA 1V1OA 3L3OC 5KGUA 1RJTA 3TP7A 1DONA 4G57A 2MJ8A 3T53B 3ITPA 3I4MB 5IODA 2X69A 2XRSD 3FDTA 5IGGA 2F0QA 2PZUA 1JE4A 1U4LA 4K8JA 1BO0A 3RD4A 2PPBC 3MFGA 2A5HA 2D9UA 2TMPA 1EU4A 2F0SA 1DD2A 1H9KA 3OWEB 3RZOB 1TIID 1G6ZA 5D65A 1UNSA 3TSSA 1FNUA 2IJ0A 3MZ5A 3OW7A 2F0KA 2BDOA 5ELEA 3NUCA 3K7AB 3U9OA 2KEDA 1ZYRC 5DAUA 1GHJA 4EQNA 1RF2D 2AQ3B 5C0XJ 1JWMD 1O78A 1OXUA 1B1ZA 2JEAI 3MC0B 1HTPA 4ZUJA 3HOYB 5JPMC 4QUCA 3J80E 1QNKA 5HURA 4C3IB 3VA7A 4ABNA 1MSGA 1EZ8A 1JC7A 4G7ZC 2K5WA 4RHRA 2WKCA 4IUNA 1S4ZA 3T56B 4FF3A 1BOSA 3KBGA 3EROA 3QOJA 4OIKA 1STHA 3PMFA 4IUPA 1K8OA 1H9SB 1I6VC 3DUZA 1TY0A 1IKMA 3IL8A 3VR4A 1U9RA 5C0XH 1S5BD 3FVQA 3HOXB 1C48A 1TS5A 1LACA 1DJRD 2OF1A 3L7ZC 4KV6A 4ZAIA 2K32A 5C0XG 3SEBA 3MXPA 1V1PA 3PO2B 3PO3B 1IW7D 1WVLA 3OMCA 4DN4M 2L55A 3DWPA 2QILA 5M5XB 4C3IG 1W6KA 2NWGA 4HN7A 2MUYA 1TU2B 3D4WA 1HUMA 3NK9A 3K57A 1PRTD 1R4PB 5EPJA 1X32A 4N9TA 4RGNA 2HCCA 2R92B 2K05A 3QG1A 3H3VC 2ICIA 4NKLA 3QIAA 5ELCA 2BE5D 1EYCA 2H4OA 5EQ0A 4IFDJ 1S5FD 4FF2A 4IN3A 5HGTA 2CW0D 2KECA 2F0OA 1HRJA 3HEJA 1HUNA 3NWSA 4BS9A 1MGSA 3M4OB 1WCMB 2Z4IA 1Q3LA 5E1FA 1QG7A 4QB4A 4PQXA 1JCKB 3D31A 2AQ2B 4XYQA 3TP6A 5K36H 3NQTA 1Y8OB 1LT5D 2B2YA 1KTKA 4KKSA 4I65A 1ILPA 5K36G 3SHLA 4IFDH 3QJYA 1PFNA 1A3UA 3H91A 2NVYB 4QIWB 2E74C 3LWEA 2EY6A 1SYEA 3BVGA 4EQPA 4IFDG 3PIP3 1EQTA 4H0LC 5ELBA 3KUPA 5M9OA 4RA8A 3LWUA 1DOKA 2K04A 1A3VA 1NR4A 2SEBD 2LY7A 3J7AF 4HCSA 3MWYW 3GD7A 5C5LA 4DF7A 1M4VA 1AZQA 2L11A 3K5LA 1QNUA 2Q8RE 1WD1A 3BYYB 5C4XB 1RODA 2M2LA 5D3IB 1Y1VB 3P1HA 1FGBD 3DXJC 4A3BB 1OXTA 1C4QA 4ZYSA 4HMJA 1EIHA 3ZYYX 3DHQA 4NP5A 1PTOC 1I6HB 4G7HC 4I7ZC 1QJOA 2NZ1D 2LS01 3IFTA 5COYA 5IGEA 1R4QB 1G8ZD 3IAYA 2L9HA 2E2JB 3M3YB 2HDLA 2F0UA 2QEJC 4ZUIA 4K5VA 4AYBB 1DCZA 1H9SA 3J81L 1ZXTA 2Q8TA 4FXGC 3P7JA 3MA2B 5DNFA 3O13A 1J8IA 4PMCA 3NTKA 4UAIA 3GTLB 5FO9B 3S1QB 2OT2A 1EYAA 5FO8B 4Z9CB 2AWNA 2L0CA 4R9WA 2DN8A 1JOKA 1T5XD 3SK5A 3S14B 5C6AA 2R93B 1XTCD 1EFID 5E4XA 2NVQB 1HA6A 2ZT9C 1IHZA 1JWSD 3H0GB 5ISRA 4K5XA 1EWHA 3A7AB 4RKLA 3CRKC 5EGTA 2NN6I 2EE1A 4L63B 3R2IA 2XRQD 1FYCA 3D6WA 3EFXD 2VB3X 2D5DA 1EU3A 3GTKB 3BZDB 4A3GB 3KK7A 3LNNA 3BYTB 5ELFA 4TRDA 2BCOA 4GZYC 4G7OC 5EBDA 1AEXA 3J7YW 2Z4HA 4KKTA 2VUMB 2B2WC 1HTLD 5IGCA 1CFMA 4L6TB 5FLXE 1G291 2FFKB 2FMMA 1Y8PB 5KRUA 4A3MB 3Q0AA 4KD4A 2R6GA 3R2TA 2PYKA 3S1RB 1TKWB 2NBFA 1LV9A 4BWGB 1LTRD 1Q1EA 4XQQA 4CKCA 1SAPA 2F0TA 4J1MA 1VF7A 1ICWA 1SFOB 5C4ZA 3CHBD 5I9PA 1CQVA 4IURA 1EY4A 1F9QA 2QKIC 2AUKA 3JAME 4UDUC 3HOUB 3WDNA 4QCLA 1TT2A 5CORA 4B9WA 3S16B 2JE6I 1TY2A 5I2YA 1EY0A 4DAVA 2EJFC 1PFMA 4DXGA 2B39A 5BN3A 1QOHA 4KJOA 1YNND 1SYGA 1S5ED 5IGBA 4V190 3TZDA 2NTSA 3C1EA 1KNEA 2NYZD 1WTPA 3NPPA 2F0FA 3CQZB 4Q5VA 5A35A 4K5WA 1SNPA 4DA2A 2BE5C 1OXVA 4BY7B 2X6GA 2KCCA 1PLFA 3T51B 1WTOA 2J0TD 4OO1I 3E6ZX 2CW0C 5IGFA 2NTTA 1CZGA 2LMCB 5JAVA 2F0PA 1M8AA 1JWUD 1HPCA 1ZEQX 1SNDA 2F3VA 1B2TA 3DEPA 1OXXK 1B3AA 4RGMA 1A2UA 5KIXA 4KN7C 4HSVA 2O5JC 1EQVA 5ELDA 1DXMA 4XT1B 1Z7TA 4RCNA 1Q12A 1TR5A 5JEAJ 3A7LA 2F0LA 1Q8IA 2EOTA 3E5SA 5JJZA 1F2ZA 4QMGA 3GTPB 1NUCA 5A2QL 2Y0SB 1I4QA 2LKVA 4A3KB 2K01A 4K2KA 5CV5A 1A2TA 4EQOA 2EY1A 3PUZA 2HQEA 2K5DA 3S2DB 3E0JA 3RMHA 3I91A 3HOZB 3AB9A 2XSCA 5FKAC 1X3PA 2EDGA 1TWAB 1O7LA 4N9PA 1TS2A 3T4AC 1EY8A 4DNRB 5JEAH 4KN4C 2XN9C 1PZKD 2WKDA 1RKNA 2VB2X 4G4KA 5FO7B 2X6LA 3A54A 5JEAG 2AWOA 2ID0A 3X3MA 3OIPA 1D5MC 1F9RA 1QE6A 1PYWD 2JA7B 2EYPA 1QCBD 4ZRZA 4U673 4M1UB 1SNMA 3DWQA 3RLFA 3MXNA 1SYFA 4RAUC 1NAPA 1A6XA 1EIGA 3M85A 2RKSA 4KK7A 5FK9C 3S2HB 4KKUA 4IUUA 4XIGS 1H9RA 1F9PA 3X3NA 2J7ZA 1B9NA 2F0JA 3GTJB 1ZKOA 1CZWA 3G7LA 2RSNA 2AUJD 5EKLA 2E2DC 2IX1A 4LJZC 2F0DA 4IQZA 3M7NA 3U9SA 3IFDA 4ILWA 4B9XA 1EZ6A 1S5DD 4C3HB 1SXTA 4K6LA 3SK8A 4O42A 2NVXB 2F0MA 5JPNC 1A3TA 3ND9A 1IYUA 1ENCA 1PFBA 2L5TA 2K5QA 3S9WA 2RSOA 4FYDA 1BCPF 4DXFA 1VF5C 4CJ2C 2JA6B 4XTCS 4F7XA 3T16A 1PZID 4B08A 5BN5A 5KYLA 2SNMA 1Q90A 3BDCA 5NUCA 4XT3B 1E2VA 4F8MA 3I90A 3A55A 3OPOA 2RDFA 5CMDA 5CV8A 2CHBD 3NBIA 3ERQA 2H1EA 3SK6A 1QB5D 2B2WA 2JEBI 2K7VA 4H13C 3MXGA 4MIUA 3K58A 2KJXA 5T1GA 3P20A 1BDOA 1H9MA 1QILA 3PUXA 5G3LF 4DFAA 4OHJA 2PZTA 3OIQA 2E2IB 2PW7A 1TS3A 2IX3A 1SSOA 3L9AX 4KJNA 1J9OA 1F9SA 4FF1A 2JP1A 1GUTA 2B8GA 5J22A 2F1MA 1EEFD 2JA8B 2EJMA 4YIJA 2PO4A 3QO2A 1SNOA 2V4DA 1JOQA 5JOBA 2XWBB 4HTHA 2F0EA 3SK4A 3GTQB 1R9TB 1OO9B 1OXSC 4F87A 1ILQA 2EPBA 1IKLA 1LT6D 1MI2A 1UUPA 1TWCB 2WIIB 5C5MA 1BUVT 1I4HA 4PNYA 4K8IA 2K33A 5D14A 2IWHA 2KA7A 2RQXA 4KD3A 4A3FB 2HUGA 1YNNC 1DM0B 1SE2A 3BVZA 1D2BA 5CR3A 4R8IA 1BNZA 4XQNA 3KF8A 2C5CA 3P75A 3I4LA 2L12A 2KEEA 2F0VA 5TSSA 4BBRB 2NUCA 1Y8NB 4EVOA 4C1NK 1T5EA 1E2ZA 1RTOA 1F2MA 1Z47A 2QCPX 2DNEA 3EQLC 1SYBA 2HCIA 3HOWB 2FHTA 4ME5A 3PUVA 4K14A 5CGKA 1U4MA 3A56A 4KMUC 5I9OA 2L1BA 2O2LD 2YU9B 4L8JA 2RBMA 2DY8A 2AQ1B 4XDXA 1VCIA 1AP0A 2K28A 2XVSA 3KBXA 1EOTA 3SDZA 1CA5A 1EL0A 1JOOA 4Y7NB 1LTSD 5C3WA 1Q1BA 1LTAD 4BA2I 3K0YA 4FXDA 1BR9A 3CRLC 5CV9A 2PW5A 1CM9A 2IPKD 1E0BA 1LT3D 3VYUA 3HKZB 4C3JB 2EYOA 1L0XB 1XX8A 5T1IA 2F0NA 2FMCA 5C44B 2EVBA 4NDXA 1TWHB 1K83B 3I8ZA 4LAAA 3FMCA 1ESFA 2IL8A 4CJ0B 3A8KE 4KY7A 3Q23A 1F77A 5CC4A 1CQFA 4XQJA 2ICEC 2B2TC 1HQMC 1PXUA 1TWGB 1HFGA 2RDGA 5J39A 1B53A 4JBWA 4FP5D 2O4XA 4PV1C 3DMUA 5C4JB 4DK1A 4ZKCB 4ZK9B 2A6EC 3VYRA 3CU7A 5EPLA 2JSOA 3NXWA 4WJWA 2BA0A 5AFWA 1STYA 4O1NA 1RTNA 1AZPA 3A8JE 1STGA 2DY7A 1SBBB 3G6JB 3PV0A 2IX0A 4PMWA 2R3ZA 1HA5A 3V96A 1JORA 3NBHA 1QWYA 4XXEA 3FKIB 1Z6HA 4M8AA 3HS0C 1GUOA 2PCFB 3FPUB 2ZXPA 1U4PA 4U68A 3T13A 1KABA 1B44D 5CV4A 4RH6A 3KLSX 2PMZB 2D2CC 2GA4B 1S5CD 4CBVA 3AU7A 1I4RA 2A68D 1O7ZA 2EYMA 5IT9E 4RFBA 3KLRA 3HZXA 3K5OA 5KNCA 4FXKC 3MEHA 5FOBB 2TSSA 2KOLA 2A73B 2RDHA 4FNFA 4DAYA 3TMEA 3JAML 1GUSA 1PTOF 4KHZA 5DM63 1W6JA 4E6IA 1V43A 3H94A 4IZ8A 3EJIA 2CQAA 1Y69U 3TP8A 3D3RA 3BDLA 4CKEA 5I2XA 1TQOA 3I72A 1B4OA 4DAPA 1KDAA 4X3SA 5CV7A 3BS1A 1XYIA 3D6CA 2OXPA 2E75C 3EA6A 2O5IC 3NQIA 3PUYA 5CBAE 4S3SA 1C8CA 2BDNA 1KDBA 3NSWA 3HGBA 1EY5A 4RWSC 1X3QA 4ZLTF 2OEOA 3VR6A 4J8QA 1NCVA 5KYIA 2C9OA 4HCEA 2N88A 1MBYA 5I6YA 1FNVA 3D4RA 2A6HD 1D5ZC 3HRZC 5D3DA 3D8GA 1PRTB 3QB3A 3SXHA 1GUWA 3H6MA 1STBA 3DEOA 1V8QA 2BA1A 1BBXC 2IT1A 3TBIB 1SE4A 4C2MB 3NTIA 2WINB 5EKKA 3QWNA 3GTGB 2D62A 2F3WA 1BCPB 2F0WA 3NP8A 3W2DA 3SE0A 4RGTA 1RCVD 3WOEA 1EY7A 4OL7A 3DWAA 5LL6X 3URYA 2G9DA 2KUMA 4IUTA 1STEA 1HHVA 3HG9A 3S17B 1STAA 2R61A 1SYDA 2A6ED 4EGVA 5KNBA 1NSNS 2KVMA 3TZUA 4C56C 1LTID 2Q8IB 2F0IA 2L4NA 1GUNA 1I4PA 3GV3A 2EYHA 2QDBA 3OHXC 3GP7A 4JK1C 1B50A 2WACA 1G2TA 3TN2A 4XYOA 2MP1A 4R8NA 5C3XA 2KQ3A 1I4GA 3C1FA 4NMZA 4BA1I 3J80L 1LTBD 4MHEA 2KCNA 2Z8LA 1VMPA 1GHKA 1AN8A 4F88A 4WRDA 3KLSA 1Y1WB 1CK1A 4KY5A 2J4XA 1BQQT 2ZXOA 3I73A 1O80A 1L0YB 3N52A 2EYJA 2A69D 2I46A 1LABA 1CHPD 3MVVA 1PRTF 1LLRD 1EYDA 2EY2A 1DOLA 2B2TA 5C3EB 1SMYC 1JICA 1GUGA 1TWFB 2F4IA 3W3AA 5JVG3 2E76C 4Q0FA 2F03A 4DK0A 2K1BA 4A3EB 2B2VA 3EVQA 1SEBD 3GTOB 1CI3M 4DGZA 3AMUA 4X3KA 3C2PA 4KTAA 5J1ZA 1E2WA 3MHBA 4X3TA 1TVXA 3FRPB 2WP8J 3S1MB 4QUFA 4LK1C 3R3OA 1WTVA 2EXZA 4K2LA 4CJ1B 2B8FA 2N55A 1BCPD 4V0BA 2CVRA 5KEEA 1SNCA 4FVMA 4C3HG 4OIJA 4A3JB 2MPMA 5E3FA 2JYOA 1DZ1A 1ET6A 5C0XI 5EBCA 1EEID 1G91A 1VMCA 1SNQA 4ZQ3A 4DNTB 1MD2D 2NVTB 3RUZA 4CGYB 2IW3A 3NWTA 3SR1A 5K5PA 3Q24A 1WTXA 3OOCA 3CKIB 4MN3A 4RGOS 1D6EC 3S1NB 1UEAB 4HEDA 2SNSA 5G3LD 3V2TA 1CT1D 4IALA 1HXYD 5M3MB 1XWEA 3VYTA 4ODGA 4HSPA 2K6AA 4RHSA 4CKBA 1SYCA 3GQBA 2SOBA 3OWFA 2A68C 2VXWA 1RDPD 2B2UA 4A3DB 2SDFA 3A8IE 2FINB 5DM73 1ZYRD 2VNUD 3VR3A 2WV6D 2HDMA 2PNRC 2DNCA 3MTSA 1DYQA 1LO5D 2RVLA 4TKOB 1ET9A 3ONAB 3VR5A 3R8BA 1LTGD 5E4WC 2XIWA 1PZJD 3K6OA 1JB3A 4X3UA 2Z1CA 1RD9D 4K6DA 1FD7D 2JXMB 5I6WA 1JQYD 2M9VA 4J6HA 1EY6A 2A74C 5BN4A 1GJXA 1IL8A 3BG3A 2PZWA 1YNJC 2NN6H 2ZXRA 4BY1B 1STNA 3R93A 1WD0A 3J81E 3H09A 2KHSA 4CHTB 2NN6G 1FR3A 1KAAA 3MXUA 1PMRA 4IFDI 1SDFA 1TS4A 3NHHA 5M5YB 3ND8A 2MHVA 4NW2A 3WOFA 1D1KA 4BBSB 4HR7B 3SVMA 1KLUD 2R7ZB 1F2YA 1SMYD 4HMIA 2A6HC 1FNWA 3HOVB 2EY5A 1HFNA 1KLGD 2PQEA 1A15A 3I70A 4FF4A 2QF7A 2JA5B 2K03A 2M00A 1HCZA 2RA4A 1RHPA 2B63B 1WTWA 2FJ2A 1B9MA 2YYZA 1K8MA 3PIO3 3MAQA 3M7GA 3N6RA 1H9JA 3Q22A 1ENAA 1GOZA 2EYFA 1ESRA 2I07B 4FO2A 1SJED 5I4DA 2EZVA 1PTOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKO A;  1Q1E A;  2B8G A;  2F1M A;  1TU2 B;  1ZYR C;  2B8F A;  4JK1 C;  2AUJ D;  1VF7 A;  2E75 C;  2EJM A;  2O5I C;  3SDZ A;  3PUY A;  1Z6H A;  1GHJ A;  2AUK A;  2JXM B;  1Q1B A;  2V4D A;  3HGB A;  3LWU A;  3WDN A;  1GUO A;  2PCF B;  5KND A;  4LJZ C;  4BA2 I;  1CTM A;  1O78 A;  1OXU A;  3PUZ A;  4IQZ A;  5BN4 A;  4BA1 I;  3VR6 A;  2JEA I;  1GJX A;  1OXS C;  3BG3 A;  3QG1 A;  3M7N A;  3U9S A;  3FPP A;  2JE6 I;  3CRL C;  2DN8 A;  1HTP A;  3QIA A;  1IYV A;  2EJG C;  1YNJ C;  2BE5 D;  2NN6 H;  3GD7 A;  3AB9 A;  4H44 C;  2EJF C;  1GHK A;  4TQU S;  5BN3 A;  4DNT B;  4KI0 A;  4OO1 H;  3IKJ A;  2D2C C;  3ND9 A;  1IYU A;  2EDG A;  3MFY A;  3VA7 A;  2ZT9 C;  1O7L A;  2L5T A;  3D4R A;  2NN6 G;  2EVB A;  1FR3 A;  3I73 A;  3MXU A;  1PMR A;  2A6H D;  3M4Y A;  1A6X A;  4G7Z C;  1EWH A;  3OOC A;  5A35 A;  2A69 D;  4OO1 G;  1VF5 C;  1LAB A;  3FMC A;  2K33 A;  3A7A B;  3T56 B;  2A68 D;  2BE5 C;  4DNR B;  1OXV A;  5JEA H;  3CRK C;  3ND8 A;  2KA7 A;  2NN6 I;  3NE5 B;  4XTC S;  2KCC A;  4KN4 C;  1V8Q A;  3VR2 A;  2BA1 A;  5BN5 A;  3DXJ C;  3A8K E;  1YNN C;  3KLR A;  3BDO A;  3T51 B;  1OXT A;  4HR7 B;  2IT1 A;  5KNC A;  1SMY C;  2CW0 C;  1GUG A;  1Q90 A;  1FYC A;  3D31 A;  3W3A A;  3T53 B;  3I4L A;  1VDZ A;  2D5D A;  5JEA G;  1K8O A;  2A6H C;  1HQM C;  2E76 C;  1E2V A;  1H9S B;  1I6V C;  2LMC B;  2AWO A;  1ONL A;  2D62 A;  4G7H C;  2A69 C;  3GQB A;  4I7Z C;  3OPO A;  4DK0 A;  1HPC A;  3LNN A;  3SE0 A;  1QJO A;  1Y8N B;  4JBW A;  5K36 H;  1T5E A;  1E2Z A;  2A68 C;  4GZY C;  4G7O C;  4PV1 C;  1Y8O B;  3IFT A;  3VR4 A;  1OXX K;  5C0X H;  4DK1 A;  2PPB C;  2JEB I;  2K7V A;  4KKS A;  4KKT A;  2QF7 A;  1GUS A;  2DNE A;  4KN7 C;  4H13 C;  1LAC A;  4KHZ A;  3EQL C;  1HCZ A;  2O5J C;  3L7Z C;  2A6E C;  3A8I E;  1CFM A;  3RLF A;  1CI3 M;  5K36 G;  3P20 A;  1V43 A;  3H94 A;  1DD2 A;  3VR3 A;  1G29 1;  1DXM A;  2A6E D;  3PUV A;  2K32 A;  5C0X G;  1BDO A;  1H9M A;  1B9M A;  1Z7T A;  1H9K A;  2YYZ A;  3PUX A;  1K8M A;  3M85 A;  1Y69 U;  1IW7 C;  5KNB A;  4IFD H;  2BA0 A;  2PNR C;  3QJY A;  1E2W A;  1Y8P B;  4RCN A;  3I72 A;  2DNC A;  1Q12 A;  3N6R A;  4KMU C;  1IW7 D;  3TZU A;  1H9J A;  4KKU A;  3A7L A;  3A8J E;  1DCZ A;  3PUW A;  4L8J A;  2Q8I B;  2R6G A;  3PV0 A;  4LK1 C;  4TKO B;  1H9S A;  3VR5 A;  2E74 C;  1GUN A;  3OW7 A;  4OGQ C;  1H9R A;  4XIG S;  1B9N A;  1TKW B;  2BDO A;  4IFD G;  1VCI A;  1GUT A;  4H0L C; 
#chains in the Genus database with same CATH topology
 1JMC A;  2B2V C;  3KLW A;  4QL5 A;  1L1O C;  2G9H D;  2DGY A;  3J80 c;  4JI2 L;  1NR2 A;  1Y14 B;  4R4T A;  1EY9 A;  4GNX C;  5EPK A;  4ULL A;  2R7Z H;  3I3C A;  4GN4 B;  2Y0S E;  4JV5 L;  4P72 A;  4C3J H;  2AHO B;  2HD3 A;  5C4H A;  3RZD B;  4IPH A;  2KHI A;  1CTM A;  5C44 H;  3HOV H;  2PI2 E;  3S15 B;  3FPP A;  4JOI A;  3HKZ G;  4A93 B;  1IYV A;  2EJG C;  1KNA A;  4C3J G;  3FEW X;  1JR0 D;  3TQY A;  3RNU A;  1S72 A;  5C44 G;  4KI0 A;  2JA5 H;  2F0H A;  4WOR A;  4OO1 H;  2F0G A;  2XWJ B;  4AQY Q;  3K5N A;  1RL2 A;  5EJW A;  1O7Y A;  4YY3 Q;  3QR8 A;  1ENF A;  4JYA L;  1KC8 C;  1AFP A;  4QF4 A;  4DKA C;  1XXG A;  2BOS A;  1TWG H;  3BVM A;  3GV6 A;  3OMG A;  3K5M A;  4OO1 G;  4PMB A;  4P75 A;  3VA5 A;  4ZKB B;  1NMG A;  3NE5 B;  3I4N B;  5C4J H;  3VR2 A;  1PTO H;  1M1K C;  3K80 C;  3BDO A;  1I4X A;  1V1P B;  3D4D A;  4KY6 A;  4DUY Q;  1HR0 Q;  1ML0 D;  1LT4 D;  5M3F B;  4Y52 H;  1VDZ A;  1I3Q B;  1SLJ A;  1HQR D;  1D1I A;  1S3O A;  1ONL A;  1EQQ A;  1D5X C;  2VW9 A;  2A69 C;  1BXT A;  4RCO A;  4ID6 A;  4LMQ D;  1I50 B;  3UI2 A;  4HJA A;  1GM5 A;  4JBM A;  4R4Q A;  4KHV A;  1EWC A;  5FLX L;  3DM1 A;  2WB1 B;  5LHY 1;  3S15 H;  3J7A V;  4DV4 L;  2XNA C;  3F2U A;  3LX0 A;  1KRT A;  1WTR A;  3QOL A;  4R4C A;  4A93 H;  5CYU A;  1BF4 A;  2UXD Q;  2B2Y C;  5JJK A;  5LL6 S;  5M5W B;  4HAE A;  1G2S A;  1DOM A;  5HGQ A;  3TP5 A;  1IW7 C;  2JQO A;  5JVH 3;  4YWK A;  4IUV A;  4OX9 L;  1MSH A;  4A3I B;  2CQO A;  1AW7 A;  3PUW A;  4CDE C;  2E2H B;  3VYS A;  1F2L A;  4C1N I;  3V05 A;  4OGQ C;  2RHS B;  1K8G A;  1EIY B;  4ALP A;  2P5Z X;  1U4R A;  3FKI G;  2LFN A;  4DR1 L;  3I4N H;  2UXB Q;  2EYL A;  1II3 A;  3GTM B;  2MQH A;  4JI4 L;  4LFB L;  5EKI A;  2B2U C;  1PRT C;  1KDC A;  3NTH A;  4H7B A;  5IIF A;  1CA6 A;  1GXD C;  3FP9 A;  2K5V A;  4JPB W;  5KND A;  5IT9 L;  1XNQ L;  3TDQ A;  3C46 A;  1XNR Q;  3I4N G;  2GVA A;  4IUQ A;  1SE3 A;  4RKB A;  2HQL A;  4TSS A;  4WFN 3;  1JJC B;  1I50 H;  2WAQ B;  4R4I A;  1BBW A;  4P2C B;  1HZ9 A;  4LF7 Q;  3OSO A;  4H44 C;  3HP3 A;  2YTY A;  3K59 A;  1YNJ D;  4NPS A;  5DEH A;  5CV6 A;  4TQU S;  1BCP C;  5LMU Q;  3JAM i;  2IHE A;  2B29 A;  3IKJ A;  1CHQ D;  1Q86 C;  1PDQ A;  3MFY A;  4LUO A;  5CBE E;  5A2Q E;  1SJH D;  4DR4 Q;  2WB1 G;  3M4Y A;  4B3R L;  1PTO D;  5F2D A;  1P8L A;  2MGS A;  4IPD A;  2A8V A;  3C3L A;  2Z6B A;  1WTQ A;  2NB0 A;  2ENB A;  2HIX A;  3CCQ A;  2E2H H;  5IOC A;  1SE8 A;  4DU9 A;  3GO5 A;  1LTT D;  3Q6S A;  1UAP A;  5IGD A;  1V1O A;  3L3O C;  1EUJ A;  5KGU A;  1RJT A;  3TP7 A;  1DON A;  3GTM H;  1YEZ A;  4G57 A;  2MJ8 A;  3T53 B;  2K75 A;  1SRU A;  3ITP A;  3I4M B;  5IOD A;  2X69 A;  2XRS D;  3FDT A;  5IGG A;  1PH9 A;  2F0Q A;  5LMN L;  2F52 A;  2PZU A;  4QGU A;  1JE4 A;  1U4L A;  1HNX Q;  4K8J A;  1QZG A;  1BO0 A;  3L2P A;  3RD4 A;  2PPB C;  2ZJR A;  3MFG A;  2A5H A;  2D9U A;  2TMP A;  1EU4 A;  2ZJQ A;  2F0S A;  1DD2 A;  1KIX A;  1H9K A;  4IOC A;  3OWE B;  1VQA A;  3RZO B;  4RG1 A;  2RCF A;  1TII D;  1G6Z A;  5D65 A;  1UNS A;  3CP0 A;  3TSS A;  1FNU A;  1IYJ B;  2IJ0 A;  3MZ5 A;  3OW7 A;  2OWO A;  2F0K A;  2BDO A;  5ELE A;  3KF8 B;  3NUC A;  3K7A B;  3U9O A;  2KED A;  1ZYR C;  1J5E Q;  4OEM B;  4HJ5 A;  5DAU A;  1B70 B;  3BZK A;  1GHJ A;  4EQN A;  4R4O A;  1RF2 D;  2AQ3 B;  3UDF A;  5C0X J;  1JWM D;  3I4M H;  4IO9 A;  2BH2 A;  1O78 A;  1OXU A;  1C0A A;  1B1Z A;  2JEA I;  2BH8 A;  3KF6 B;  3MC0 B;  1HTP A;  4MNO A;  4ZUJ A;  3UE1 A;  1YI2 A;  2N8N A;  1EWI A;  3HOY B;  1YHB A;  5JPM C;  4QUC A;  4EQ5 A;  3CCR A;  3KDF A;  3J80 E;  1X9N A;  1QNK A;  2ZTC A;  5HUR A;  1RIP A;  4C3I B;  3VA7 A;  4ABN A;  1MSG A;  4YCW A;  4C2M H;  1EZ8 A;  4UP8 A;  4J15 A;  4B3T Q;  4L5R C;  1JC7 A;  4G7Z C;  2K5W A;  3G71 A;  3GTG H;  4KHP L;  4RHR A;  2WKC A;  1PHJ A;  4IUN A;  1L0W A;  1S4Z A;  3T56 B;  4JI0 Q;  4FF3 A;  1BOS A;  3KBG A;  4DV0 Q;  1MKH A;  3PQI A;  3ERO A;  3QOJ A;  4JOI C;  4UHV A;  4LF5 Q;  4OIK A;  1STH A;  3PMF A;  4IUP A;  1EFW A;  1K8O A;  1H9S B;  1I6V C;  3K8A A;  3DUZ A;  1TY0 A;  1IKM A;  3IRB A;  3IL8 A;  3VR4 A;  1U9R A;  4DR2 L;  5C0X H;  1S5B D;  1YNX A;  3FVQ A;  3HOX B;  1C48 A;  1TS5 A;  1LAC A;  3J80 i;  1DJR D;  3HOY H;  4YWM A;  2OF1 A;  2UXC Q;  3L7Z C;  4KV6 A;  3KJP A;  4ZAI A;  2K32 A;  5C0X G;  3SEB A;  4C3I H;  3MXP A;  1V1P A;  3PO2 B;  3PO3 B;  1IBK Q;  2MNA A;  1IW7 D;  1WVL A;  3OMC A;  4DN4 M;  1WJJ A;  4JC0 A;  3EBE A;  1HNW L;  2L55 A;  3RN2 A;  2CKZ B;  4X66 Q;  3DWP A;  2QIL A;  5M5X B;  4C3I G;  1W6K A;  1LTL A;  2NWG A;  2Q2I A;  4HN7 A;  2N78 A;  2MUY A;  3I55 A;  1TU2 B;  3D4W A;  1HUM A;  1JB7 A;  1QZH A;  3VDY A;  1N34 Q;  3NK9 A;  3K57 A;  2YTX A;  1PRT D;  1R4P B;  5EPJ A;  1X32 A;  4N9T A;  4RGN A;  1IL2 A;  2HCC A;  2R92 B;  2K05 A;  3QG1 A;  3H3V C;  2ICI A;  4NKL A;  3QIA A;  5ELC A;  4NXM Q;  2BE5 D;  1EYC A;  3E3X A;  4GS3 A;  2H4O A;  5EQ0 A;  4IFD J;  1S5F D;  2VS1 A;  4FF2 A;  4IN3 A;  5HGT A;  1D7Q A;  4JI2 Q;  1LUZ A;  2V1C C;  2CW0 D;  5C3E H;  2KEC A;  2F0O A;  4JV5 Q;  1KAW A;  3HKZ E;  2OTL A;  3PO2 H;  3PO3 H;  1HRJ A;  3HEJ A;  3G6E A;  1HUN A;  3NWS A;  5C3E G;  3NBH B;  4BS9 A;  5M5X H;  1MGS A;  3M4O B;  1WCM B;  2Z4I A;  1Q3L A;  2Z0S A;  5E1F A;  1QG7 A;  4QB4 A;  4PQX A;  5FLX c;  3GTO H;  1JCK B;  3D31 A;  2AQ2 B;  3W1G A;  1VQO A;  4JYA Q;  5GQO A;  4XYQ A;  3TP6 A;  5K36 H;  3NQT A;  3KJO A;  1Y8O B;  1LT5 D;  3S1M H;  2B2Y A;  1KTK A;  4KKS A;  1K8A C;  4I65 A;  1PH8 A;  2Q2T A;  2Z6K C;  1ILP A;  5K36 G;  1FVI A;  3SHL A;  3GDE A;  3HFZ B;  4IFD H;  3QJY A;  1PFN A;  4OEL B;  1UE7 A;  5IYB H;  1A3U A;  3H91 A;  2NVY B;  4QIW B;  2E74 C;  3ICE A;  4HJ8 A;  3LWE A;  2EY6 A;  1SYE A;  3BVG A;  4EQP A;  4IFD G;  3PIP 3;  1EQT A;  4H0L C;  5IT9 c;  2A1A A;  3CCJ A;  5ELB A;  2JK8 A;  1SN8 A;  1X6O A;  4A3J G;  3KUP A;  5M9O A;  4RA8 A;  3OTO L;  3LWU A;  1DOK A;  2K04 A;  4DAY B;  4OX9 Q;  1X65 A;  1A3V A;  1NR4 A;  2SEB D;  2LY7 A;  3J7A F;  3UDX A;  4HCS A;  3MWY W;  3GD7 A;  5C5L A;  4DF7 A;  1M4V A;  4DUZ L;  4JI8 L;  4DR1 Q;  1AZQ A;  2R7F A;  2L11 A;  3K5L A;  4JI4 Q;  4LFB Q;  1QNU A;  5M3M H;  2Q8R E;  3I56 A;  1WD1 A;  3AFP A;  3H3V H;  3BYY B;  5C4X B;  1XNQ Q;  2PMZ E;  1ROD A;  2M2L A;  5D3I B;  1Y1V B;  3P1H A;  5M3M G;  2NVY H;  1FGB D;  3KF6 A;  5J3B A;  3DXJ C;  4K0K Q;  4A3B B;  1OXT A;  1C4Q A;  1Q7Y C;  2WB1 E;  4ZYS A;  4A3D H;  4HMJ A;  1EIH A;  3ZYY X;  3DHQ A;  1KRS A;  4NP5 A;  2GVB A;  1PTO C;  3MEF A;  1I6H B;  4G7H C;  4B3R Q;  1G51 A;  4I7Z C;  3AEV A;  1CKN B;  1QJO A;  1N33 L;  2NZ1 D;  2LS0 1;  4A3D G;  4GKK L;  1XMQ L;  3IFT A;  1B8A A;  3FHW A;  4H02 A;  1KL9 A;  5COY A;  5IGE A;  3WWV A;  2DJG C;  1R4Q B;  1G8Z D;  2I5L X;  1TXY A;  3IAY A;  1VQ8 A;  2L9H A;  3M4Q A;  1QUQ B;  1HR0 W;  2E2J B;  3M3Y B;  1YZ6 A;  2HDL A;  4IPG A;  2F0U A;  2QEJ C;  4ZUI A;  4JBJ A;  4K5V A;  4AYB B;  2IY5 B;  1DCZ A;  1XPO A;  1H9S A;  3J81 L;  1PH1 A;  1WI5 A;  1ZXT A;  1SRO A;  2Q8T A;  4FXG C;  1Y1V H;  2JA9 A;  1KD1 C;  3P7J A;  3MA2 B;  5DNF A;  1VQM A;  3O13 A;  1J8I A;  4O0A A;  4PMC A;  3NTK A;  4UAI A;  4A3B H;  4DV6 L;  4BY1 H;  3GTL B;  5FO9 B;  3S1Q B;  2FXQ A;  2OT2 A;  4HIO A;  1EYA A;  2HT1 A;  1Y1V G;  3ZJY C;  5FO8 B;  4Z9C B;  2AWN A;  1Q8K A;  1GD7 A;  2L0C A;  1K0R A;  2H5X A;  4R9W A;  4A3B G;  4BY1 G;  2DN8 A;  1JOK A;  1T5X D;  4UP9 A;  3SK5 A;  3S14 B;  5M5Y H;  4B3S L;  5AJ3 Q;  1AE3 A;  5C6A A;  4JI3 L;  1XTC D;  2R93 B;  2G5D A;  1EFI D;  1VQD A;  5E4X A;  4BBS H;  2NVQ B;  1HA6 A;  2ZT9 C;  1IHZ A;  1YHA A;  1JWS D;  3H0G B;  4JCV E;  5ISR A;  1V9P A;  4K5X A;  1EWH A;  4DK3 C;  3A7A B;  4BBS G;  3RN5 A;  5JJI A;  4RKL A;  3CRK C;  5EGT A;  2NN6 I;  2R7Z G;  3MXN B;  2EE1 A;  3RLN A;  4DR7 L;  3HOV G;  4L63 B;  3R2I A;  2XRQ D;  1FYC A;  4HID A;  3D6W A;  3EFX D;  3CAM A;  2VB3 X;  2D5D A;  2B63 H;  1EU3 A;  3GTK B;  3S1Q H;  3BZD B;  3ERS X;  1PH6 A;  4A3G B;  5GAH C;  3KK7 A;  3LNN A;  3BYT B;  5ELF A;  4TRD A;  2BCO A;  5GAG C;  2JA5 G;  4GZY C;  4G7O C;  5EBD A;  4KHP Q;  1AEX A;  3J7Y W;  2Z4H A;  2B63 G;  4KKT A;  2VUM B;  2B2W C;  1HTL D;  3S14 H;  2ALY B;  4ME3 A;  5IGC A;  1CFM A;  4L6T B;  5FLX E;  1QVC A;  1G29 1;  2FFK B;  2FMM A;  3CC2 A;  1Y8P B;  1XPU A;  5KRU A;  4DR5 Q;  4GOP B;  3H0G H;  4R1J A;  4A3M B;  3Q0A A;  4KD4 A;  2R6G A;  3R2T A;  3RZD H;  1SR3 A;  2PYK A;  2AKW B;  3S1R B;  4DR2 Q;  3A74 A;  1TKW B;  2QGQ A;  2NBF A;  1LV9 A;  4BWG B;  4OXP A;  2ZTD A;  1LTR D;  1Q1E A;  4XQQ A;  4CKC A;  3H0G G;  1SAP A;  2F0T A;  3ER0 A;  1VF7 A;  4J1M A;  1ICW A;  1SFO B;  2I5H A;  5C4Z A;  3CHB D;  5I9P A;  1CQV A;  4IUR A;  1VQB A;  1EY4 A;  1F9Q A;  2QKI C;  2AUK A;  3JAM E;  4UDU C;  4LF6 Q;  3HOU B;  3CCU A;  3WDN A;  4QCL A;  4A93 G;  3B6Y A;  4P74 A;  1TT2 A;  1PA6 A;  5COR A;  1HNW Q;  4B9W A;  3S16 B;  2JE6 I;  1TY2 A;  5I2Y A;  1XJV A;  1EY0 A;  4DAV A;  2EJF C;  1PFM A;  1Q82 C;  1X3G A;  4DXG A;  2B39 A;  5BN3 A;  1QOH A;  1U5K A;  4KJO A;  1YNN D;  1SYG A;  4B3M L;  1S5E D;  5IGB A;  4V19 0;  3TZD A;  2NTS A;  4DNI A;  3C1E A;  1KNE A;  1H95 A;  2NYZ D;  1WTP A;  4ZCK A;  1IBM L;  3NPP A;  5M3F H;  4GLA C;  2F0F A;  2GN5 A;  3CQZ B;  4IPC A;  1I3Q H;  4LW1 A;  3ULJ A;  4Q5V A;  4A76 A;  5A35 A;  4K5W A;  1SNP A;  4A3M H;  4DA2 A;  2BE5 C;  1OXV A;  4X64 L;  1N8R C;  1N9W A;  4BY7 B;  2X6G A;  2KCC A;  2Z9H A;  1PLF A;  5M3F G;  2K5N A;  3T51 B;  3I4O A;  3CF5 A;  1WTO A;  4GKJ L;  2J0T D;  4OO1 I;  3E6Z X;  2CW0 C;  5IGF A;  5EAY A;  3BU2 A;  2NTT A;  3NEM A;  5M5W H;  1CZG A;  2LMC B;  5JAV A;  4DV2 L;  3DLL A;  2F0P A;  1M8A A;  1JWU D;  1HPC A;  4A3I H;  1A8V A;  1ZEQ X;  1SND A;  2F3V A;  1B2T A;  3DEP A;  1OXX K;  1B3A A;  4RGM A;  1A2U A;  2Z6K A;  1EYG A;  4GLX A;  5KIX A;  4KN7 C;  3F8T A;  4HSV A;  4IJH A;  4IOA A;  2O5J C;  4A3I G;  1EQV A;  4YHH L;  5ELD A;  1AE2 A;  1DXM A;  4XT1 B;  1Z7T A;  5IE8 A;  4RCN A;  3PGZ A;  1Q12 A;  1TR5 A;  5JEA J;  3A7L A;  2F0L A;  3CQZ H;  1Q8I A;  1N36 L;  2EOT A;  1U0L A;  3E5S A;  5JJZ A;  1F2Z A;  4QMG A;  5FLM H;  3GTP B;  1CKN A;  1NUC A;  5A2Q L;  2Y0S B;  1I4Q A;  2LKV A;  4BY7 H;  4A3K B;  3KFU A;  2K01 A;  3U4Z A;  4K2K A;  4X65 L;  2LXK A;  5CV5 A;  1A2T A;  4EQO A;  5FLM G;  1PH2 A;  2EY1 A;  2PQA A;  1E7Z A;  2WAQ G;  1YHQ A;  5L37 A;  3PUZ A;  2HQE A;  2K5D A;  2KCT A;  3S2D B;  4TVA B;  3CCL A;  3E0J A;  3RMH A;  3I91 A;  4HJ7 A;  3HOZ B;  3AB9 A;  2XSC A;  5FKA C;  3S24 A;  4MTK A;  5H1S E;  1X3P A;  1VQH A;  4JI7 L;  2EDG A;  4NB3 A;  2KHJ A;  4L5S A;  1TWA B;  1O7L A;  4N9P A;  4UP7 A;  3OTO Q;  1TS2 A;  3T4A C;  4DR3 L;  3TEH B;  1EY8 A;  4FDB A;  1VQC A;  2UU9 L;  4DNR B;  5GRO A;  5JEA H;  3UDI A;  4KN4 C;  2XN9 C;  3GTP H;  4DUZ Q;  4JI8 Q;  1PZK D;  2WKD A;  1RKN A;  3I4M G;  2VB2 X;  4G4K A;  5FO7 B;  4A3K H;  3K81 C;  3CD6 A;  1JT8 A;  2X6L A;  1VQ5 A;  3A54 A;  5JEA G;  2AWO A;  2JJQ A;  2ID0 A;  3RZO H;  3X3M A;  2L15 A;  3E0E A;  4LWC A;  3OIP A;  1D5M C;  3E9H A;  1F9R A;  4MZ9 A;  3CC7 A;  4A3K G;  1C7Y A;  1QE6 A;  1PYW D;  2KCM A;  2JA7 B;  2EYP A;  1QCB D;  4ZRZ A;  4U67 3;  3HOZ H;  4QIW E;  4M1U B;  1PYS B;  1SNM A;  1K28 A;  3DWQ A;  3RLF A;  3MXN A;  1SYF A;  3K7A H;  4JI1 Q;  3I2Z A;  4RAU C;  3J81 c;  2Q2U A;  1NAP A;  1A6X A;  1EIG A;  3M85 A;  2RKS A;  4KK7 A;  5FK9 C;  4DV1 L;  2MFI A;  4OWW B;  3S2H B;  1CSQ A;  4KKU A;  1G6P A;  2YV5 A;  1EQR A;  4AIM A;  1N33 Q;  4IUU A;  4XIG S;  4LFA L;  1H9R A;  4GKK Q;  1F9P A;  3X3N A;  2J7Z A;  1B9N A;  4DR6 L;  2XGT A;  2F0J A;  4WJ3 M;  3GTJ B;  1ZKO A;  1CZW A;  3G7L A;  4N8X 1;  2IHF A;  2RSN A;  5BR8 L;  2AUJ D;  5EKL A;  2E2D C;  1N32 L;  2IX1 A;  1HNZ L;  4YCV A;  1Z9F A;  1NNX A;  1FJG L;  4LJZ C;  1DGS A;  1YIT A;  2F0D A;  3HOY G;  1XTD A;  1HH2 P;  4IQZ A;  3M7N A;  3U9S A;  3IFD A;  4ILW A;  4B9X A;  1EZ6 A;  1S5D D;  4GOP A;  4C3H B;  1SXT A;  4K6L A;  3STB D;  3SK8 A;  2WFW A;  2JA7 H;  4O42 A;  2QDL A;  3J81 j;  4DV5 L;  2NVX B;  2F0M A;  5JPN C;  2HIV A;  1A3T A;  3ND9 A;  2VQF L;  1IYU A;  1LM0 A;  1ENC A;  4DV6 Q;  1VQI A;  1PFB A;  2L5T A;  2K5Q A;  3S9W A;  2HHH L;  1K73 C;  2RSO A;  4FYD A;  3M4P A;  4KLK A;  3S2H H;  1BCP F;  4DXF A;  1VF5 C;  4CJ2 C;  3K0X A;  2JA6 B;  1UWV A;  1PH5 A;  4XTC S;  4F7X A;  3T16 A;  1PZI D;  4PG3 A;  4B08 A;  2PNH A;  5BN5 A;  3HOX H;  4B3S Q;  5KYL A;  5IWA L;  2SNM A;  1Q90 A;  4JI3 Q;  3BDC A;  1X3E A;  5ELO A;  5NUC A;  4XT3 B;  4JI6 L;  1E2V A;  4F8M A;  3I90 A;  1KHI A;  3A55 A;  3HOX G;  3OPO A;  2RDF A;  5CV8 A;  5CMD A;  3CCM A;  2CHB D;  3NBI A;  3ERQ A;  2H1E A;  3SK6 A;  1I5F A;  1QB5 D;  1FGU A;  2B2W A;  2JEB I;  2K7V A;  4H13 C;  2E8G A;  3MXG A;  4MIU A;  3K58 A;  2KJX A;  3PO2 G;  3PO3 G;  1VS0 A;  5T1G A;  3P20 A;  4DR7 Q;  2NVX H;  1BDO A;  1H9M A;  1QIL A;  1LYL A;  3PUX A;  4DR4 L;  3UDG A;  5G3L F;  4DFA A;  4OHJ A;  3T1Y L;  2PZT A;  1VQ6 A;  4BXX H;  3OIQ A;  2E2I B;  4LF8 L;  2PW7 A;  1TS3 A;  4YCU A;  2IX3 A;  1SSO A;  3L9A X;  4KJN A;  4N8F A;  1J9O A;  1F9S A;  4FF1 A;  2R92 H;  2JP1 A;  1GUT A;  1MJC A;  4BXX G;  2B8G A;  5J22 A;  2F1M A;  1EEF D;  1L2F A;  4PZ7 A;  5IYD H;  2JA8 B;  2EJM A;  3PCO B;  4YIJ A;  2PO4 A;  1E1T A;  1MHW C;  2RF4 A;  3RR5 A;  3QO2 A;  2R92 G;  1VQ7 A;  3CCV A;  1SNO A;  2V4D A;  3G48 A;  4RMF A;  5JOB A;  1JOQ A;  3A5Z B;  2XWB B;  4HTH A;  2F0E A;  3SK4 A;  3GTQ B;  4CDC C;  1R9T B;  2ES2 A;  3TRZ A;  1OO9 B;  1OXS C;  4UY8 C;  4LFC L;  4F87 A;  5DLQ E;  3PSI A;  1ILQ A;  4DPG A;  4A75 A;  2EPB A;  1HZB A;  5IY0 A;  1IKL A;  1LT6 D;  4DV4 Q;  1MI2 A;  1YJN A;  5IYB G;  2QA4 A;  1UUP A;  1TWC B;  3M4O H;  2WII B;  1WCM H;  5C5M A;  1BUV T;  5IYC H;  1K3B C;  1I4H A;  4PNY A;  4K8I A;  2CFM A;  4LUZ A;  2K33 A;  1WCM G;  5D14 A;  4DV7 L;  2IWH A;  2KA7 A;  2RQX A;  4KD3 A;  2VZA A;  4A3F B;  2CH4 A;  5IYC G;  3F2D A;  3PIO A;  2HUG A;  1YNN C;  4HIK A;  1DM0 B;  1SE2 A;  3BVZ A;  1D2B A;  3W5O A;  1A63 A;  5CR3 A;  4R8I A;  1BNZ A;  4XQN A;  4B3M Q;  4A3C H;  2JA8 H;  3KF8 A;  5FJ8 H;  2C5C A;  1XPR A;  3P75 A;  3I4L A;  2L12 A;  3PF5 A;  2KEE A;  1BBU A;  2F0V A;  5TSS A;  4BBR B;  2NUC A;  1Y8N B;  4EVO A;  4C1N K;  1T5E A;  1E2Z A;  1RTO A;  4A3C G;  2JA8 G;  1F2M A;  1Z47 A;  2QCP X;  2DNE A;  3EQL C;  2UUC L;  1MIU A;  1SYB A;  4GKJ Q;  1B3Q A;  2HCI A;  3A5U A;  1K9M C;  3HOW B;  2FHT A;  4ME5 A;  3PUV A;  2EXD A;  3T1H L;  4K14 A;  5CGK A;  1VQ9 A;  5IP7 H;  1U4M A;  3A56 A;  3H15 A;  4KMU C;  5I9O A;  4DV2 Q;  2L1B A;  2O2L D;  2YU9 B;  4L8J A;  2RBM A;  4JBK A;  2DY8 A;  1YIJ A;  4DV3 L;  2AQ1 B;  2OQK A;  2ASB A;  4XDX A;  3KYH C;  1VCI A;  3CME A;  1AP0 A;  2K28 A;  3J7Z C;  4A3F H;  2XVS A;  3KBX A;  1EOT A;  3AYH B;  3SDZ A;  2DJF C;  1E3P A;  1CA5 A;  4YHH Q;  4LF4 L;  1EL0 A;  1JOO A;  4Y7N B;  1IZ6 A;  1LTS D;  5C3W A;  1Q1B A;  1LTA D;  3OYY A;  4BA2 I;  3K0Y A;  4FXD A;  3U4V A;  1BR9 A;  4QJF A;  3AQQ A;  5C4X H;  4CDF C;  3TRE A;  1VQ4 A;  3CRL C;  5CV9 A;  5LMN Q;  1N36 Q;  2PW5 A;  1CM9 A;  1WTH A;  2IPK D;  2E5L L;  1E0B A;  1LT3 D;  3VYU A;  3JC6 6;  3HKZ B;  4GLV B;  5C4X G;  4C3J B;  1CSP A;  2WAQ E;  2EYO A;  1L0X B;  1XX8 A;  4X65 Q;  5T1I A;  2F0N A;  2FMC A;  1OTC A;  5C44 B;  2EVB A;  4A3L H;  4NDX A;  1TWH B;  1K83 B;  1PH3 A;  4GN3 B;  4PZ8 A;  3I8Z A;  1I6H H;  2YU9 H;  4LAA A;  4IJL A;  3FMC A;  1ESF A;  2IL8 A;  4A3L G;  4CJ0 B;  4A4I A;  1GKH A;  3A8K E;  4GOP C;  3J81 i;  4KY7 A;  3Q23 A;  1F77 A;  5CC4 A;  1CQF A;  4XQJ A;  4JI7 Q;  2ICE C;  2B2T C;  3H3V I;  1HQM C;  1PXU A;  1TWG B;  1HFG A;  4Y7N H;  2RDG A;  1SMX A;  5J39 A;  1B53 A;  4DR3 Q;  2E2J H;  4JBW A;  4FP5 D;  2UUB L;  3M3Y H;  2UU9 Q;  3CCS A;  2O4X A;  4PV1 C;  3DMU A;  5C4J B;  4DK1 A;  2KEN A;  2CWP A;  4ZKC B;  1ASZ A;  4ZK9 B;  2A6E C;  2KBN A;  3VYR A;  4X62 L;  3CU7 A;  5EPL A;  2JSO A;  3NXW A;  4AYB G;  4WJW A;  2BA0 A;  5AFW A;  3GTL H;  1E24 A;  2RHQ B;  5JJL A;  1STY A;  3NEN A;  1RTN A;  2MO1 A;  4O1N A;  1AZP A;  3A8J E;  1STG A;  1TWH H;  2DY7 A;  1SBB B;  3PV0 A;  1K83 H;  3G6J B;  2IX0 A;  4PMW A;  4WJ4 A;  2R3Z A;  4NXN L;  1IXR A;  1YBY A;  1HA5 A;  3V96 A;  2D0P A;  1NBW A;  1MJE A;  2R7D A;  1JOR A;  3NBH A;  1QWY A;  4XXE A;  3FKI B;  1Z6H A;  4M8A A;  2R93 H;  4DV1 Q;  3HS0 C;  1GUO A;  2PCF B;  3FPU B;  1C9O A;  2ZXP A;  2NVQ H;  2I0Q A;  1UE1 A;  1U4P A;  4U68 A;  3T13 A;  1IBL L;  1KAB A;  4LFA Q;  3PF4 A;  2R93 G;  1B44 D;  5CV4 A;  5IP9 H;  4DR6 Q;  4RH6 A;  2Q2H A;  3KLS X;  2NZH A;  5BR8 Q;  2PMZ B;  2D2C C;  1ASY A;  1N32 Q;  2UUA L;  1HNZ Q;  2GA4 B;  5IP9 G;  1S5C D;  4CBV A;  1FJG Q;  3GTK H;  1Q46 A;  3AU7 A;  1L1O B;  4GNX B;  1I4R A;  2A68 D;  4A3G H;  1NMF A;  1O7Z A;  1E1O A;  3STB C;  2EYM A;  1M90 C;  5IT9 E;  2ZM6 L;  1VQK A;  4RFB A;  3KLR A;  2VUM H;  3HZX A;  3K5O A;  3NEL A;  5KNC A;  4DV5 Q;  3CW2 C;  3A0J A;  4FXK C;  2VQF Q;  3BJU A;  4A3G G;  3ULL A;  2F4V L;  3FKI H;  2HHH Q;  3MEH A;  5FOB B;  2TSS A;  2VUM G;  2KOL A;  2A73 B;  1CUK A;  1K0S A;  2RDH A;  4FNF A;  4DAY A;  3TME A;  3JAM L;  1GUS A;  3S1R H;  1PTO F;  4KHZ A;  5DM6 3;  1W6J A;  4E6I A;  1PYB A;  5IWA Q;  3D0F A;  4OWX B;  1V43 A;  3H94 A;  4IZ8 A;  1P16 A;  4A3M G;  3EJI A;  2CQA A;  1Y69 U;  1SFO H;  3TP8 A;  3D3R A;  3BDL A;  4CKE A;  5I2X A;  1TQO A;  4JI6 Q;  3I72 A;  1EIF A;  3TS0 A;  1NY4 A;  1CKO A;  1B4O A;  3HOU H;  1UE6 A;  1GVP A;  4DAP A;  1KDA A;  4X3S A;  5CV7 A;  3BS1 A;  3S16 H;  1XYI A;  1FL0 A;  4K0K L;  4P71 A;  4LF9 L;  3D6C A;  2OXP A;  3HOU G;  2E75 C;  1V1Q A;  3EA6 A;  2O5I C;  3J7A 5;  3NQI A;  3PUY A;  5ELN A;  4S3S A;  4I7A A;  5CBA E;  1C8C A;  2BDN A;  1KDB A;  3NSW A;  3HGB A;  1EY5 A;  2K50 A;  3T1Y Q;  4RWS C;  1T9H A;  1X3Q A;  4ZLT F;  2OEO A;  2VQE L;  3VR6 A;  4J8Q A;  4LF8 Q;  4JI5 L;  1VQP A;  1NCV A;  3AFQ A;  5KYI A;  3Q8D A;  2EIF A;  2C9O A;  4HCE A;  3ULP A;  2N88 A;  3U50 C;  1MBY A;  5I6Y A;  2AMC B;  1FNV A;  4JG2 A;  3G4S A;  1JE5 A;  2N3S A;  3D4R A;  1I94 L;  2A6H D;  4BY7 G;  3F1Z A;  1D5Z C;  3HRZ C;  5D3D A;  1AH9 A;  3D8G A;  1A62 A;  1PRT B;  1QUQ A;  4LFC Q;  3QB3 A;  3SXH A;  1GUW A;  3H6M A;  1XMO L;  1STB A;  3DEO A;  1V8Q A;  2BA1 A;  3KOJ A;  1W2B A;  1BBX C;  2IT1 A;  4PZ6 A;  3TBI B;  1SE4 A;  4C2M B;  3NTI A;  1CKM A;  2WIN B;  5EKK A;  3QWN A;  3GTG B;  2D62 A;  2F3W A;  1BCP B;  2F0W A;  3NP8 A;  3W2D A;  3SE0 A;  4RGT A;  2LXJ A;  1RCV D;  3WOE A;  1EY7 A;  4EX5 A;  4JVZ A;  4OL7 A;  3DWA A;  4LNQ A;  5LL6 X;  2D0O A;  4DV7 Q;  3URY A;  4MTN A;  2G9D A;  5AJ3 L;  2KUM A;  4IUT A;  1STE A;  1HHV A;  3HG9 A;  3S17 B;  1S40 A;  1STA A;  2R61 A;  1SYD A;  2A6E D;  1PV4 A;  4EGV A;  5KNB A;  1NSN S;  2KVM A;  1PH4 A;  3TZU A;  4C56 C;  1LTI D;  1QVF A;  4POF A;  2Y0S G;  2F0I A;  2Q8I B;  2L4N A;  4GN5 A;  1GUN A;  1I4P A;  3GV3 A;  2OCE A;  3S2D H;  2EYH A;  2QDB A;  3U58 A;  3OHX C;  3GP7 A;  4JK1 C;  2UUC Q;  1B50 A;  2WAC A;  1G2T A;  4AQY L;  3F2B A;  1VQN A;  3TN2 A;  4YY3 L;  2CWA A;  3T1H Q;  2CCZ A;  4XYO A;  2MP1 A;  4R8N A;  1A0I A;  1TWA H;  5C3X A;  2KQ3 A;  3HOZ G;  4YWL A;  1I4G A;  3C1F A;  4NMZ A;  4BA1 I;  2MO0 A;  3J80 L;  1LTB D;  4MHE A;  2KCN A;  2Z8L A;  1YJ9 A;  3EN2 A;  1XMQ Q;  4QQB X;  4DV3 Q;  1VMP A;  1GHK A;  1AN8 A;  4DUY L;  1HR0 L;  3L0O A;  4F88 A;  4WRD A;  3KLS A;  1Y1W B;  1CK1 A;  3LGJ A;  4KY5 A;  2J4X A;  1NTG A;  3S17 H;  1BQQ T;  4LF4 Q;  2ZXO A;  4HJ9 A;  3I73 A;  4DR5 L;  1O80 A;  1L0Y B;  1GO3 E;  3N52 A;  2YTV A;  2EYJ A;  2A69 D;  2I46 A;  1LAB A;  1CHP D;  3MVV A;  1PRT F;  1LLR D;  1Q81 C;  2UXD L;  1PVO A;  1EYD A;  2CH4 W;  4O2D A;  2E5L Q;  1X55 A;  2C35 B;  4CDD C;  2EY2 A;  1DOL A;  1WOC A;  2B2T A;  5C3E B;  1SMY C;  1JIC A;  1GUG A;  1TWF B;  2F4I A;  3W3A A;  2ZJP A;  4LF6 L;  4LUV A;  5JVG 3;  1X54 A;  2E76 C;  4Q0F A;  2F03 A;  3PIP A;  2JA7 G;  4DK0 A;  2K1B A;  4A3E B;  1D8L A;  2B2V A;  5HY6 A;  3TS2 A;  1L1O A;  3EVQ A;  1JJ2 A;  4GNX A;  2UXB L;  1SEB D;  2K4K A;  1KXL A;  3GTO B;  1NE3 A;  3DM3 A;  2JN4 A;  3I7F A;  1CI3 M;  4DGZ A;  3GTJ H;  3AMU A;  4X3K A;  3C2P A;  1Y1W H;  4KTA A;  5J1Z A;  1E2W A;  3BZC A;  1XNR L;  3MHB A;  4X3T A;  1TVX A;  3FRP B;  3UE0 A;  2WP8 J;  2NZO A;  4QUF A;  3S1M B;  4LK1 C;  3R3O A;  2UUB Q;  1WTV A;  1J6Q A;  4LF7 L;  1Y1W G;  2EXZ A;  1UEB A;  4K2L A;  4CJ1 B;  4AYB E;  4C3H H;  5LMU L;  2B8F A;  2N55 A;  1BCP D;  4X62 Q;  4V0B A;  2CVR A;  1TWF H;  4JW0 A;  1WFQ A;  2OQ0 A;  5KEE A;  1SNC A;  2K5H A;  3CC4 A;  1PFS A;  4FVM A;  4C3H G;  4OIJ A;  4A3J B;  2MPM A;  1ICF B;  3E9I A;  3M9B A;  5E3F A;  1UE5 A;  1PH7 A;  2JYO A;  1DZ1 A;  1ET6 A;  5C0X I;  4A3E H;  2RCN A;  5EBC A;  1EEI D;  1G91 A;  4P73 A;  4NXN Q;  2JA6 H;  1VMC A;  1SNQ A;  4ZQ3 A;  1VQJ A;  4DNT B;  1VQF A;  1MD2 D;  2NVT B;  3RUZ A;  1VQE A;  4A3E G;  4CGY B;  2IW3 A;  1JJG A;  2JA6 G;  3NWT A;  3SR1 A;  5K5P A;  3Q24 A;  2B3G A;  1WTX A;  3OOC A;  3CKI B;  4MN3 A;  4RGO S;  5IYD G;  1QVG A;  1HNX L;  1D6E C;  1O7I A;  3S1N B;  1UEA B;  1IBL Q;  4HED A;  2SNS A;  5G3L D;  3V2T A;  1CT1 D;  4IAL A;  1HXY D;  5M3M B;  5LMN W;  1XWE A;  1WYD A;  3VYT A;  4ODG A;  4HSP A;  2LSS A;  2K6A A;  3JAM c;  2EQS A;  4DAM A;  2UUA Q;  4RHS A;  4CKB A;  2PI2 A;  1SYC A;  2K14 A;  3GQB A;  2SOB A;  3OWF A;  4A3J H;  2A68 C;  2E2I H;  2VXW A;  1RDP D;  1HZC A;  2B2U A;  2VL6 A;  2ZM6 Q;  1J5E L;  4A3D B;  2SDF A;  3A8I E;  2FIN B;  5DM7 3;  1ZYR D;  3SGI A;  2VNU D;  3VR3 A;  1BVS A;  2NVT H;  2WV6 D;  2HDM A;  2PNR C;  1K3R A;  2F4V Q;  2DNC A;  3MTS A;  2XTI A;  1DYQ A;  1IBM Q;  1LO5 D;  2RVL A;  4TKO B;  1ET9 A;  3ONA B;  3VR5 A;  5GAD C;  2ATW A;  1HJP A;  3GTQ H;  3W1B A;  1R9T H;  3R8B A;  5FJ8 G;  2QW7 A;  3S1N H;  1LTG D;  4X64 Q;  5E4W C;  1E22 A;  1VQL A;  2VY3 A;  2XIW A;  1PZJ D;  2F3I A;  4L5Q A;  4X6A H;  3K6O A;  1JB3 A;  4X3U A;  2Z1C A;  1RD9 D;  4K6D A;  1FD7 D;  2JXM B;  1TWC H;  5I6W A;  1JQY D;  2M9V A;  4B3T L;  4J6H A;  5GAE C;  4HIM A;  1EY6 A;  3EIV A;  2A74 C;  5BN4 A;  1NJI C;  1GJX A;  1IL8 A;  3BG3 A;  2PZW A;  4JI0 L;  4DV0 L;  1YNJ C;  1YJW A;  2NN6 H;  4UPA A;  3CCE A;  5IP7 G;  2ZXR A;  3CMA A;  4LF9 Q;  4LF5 L;  4BY1 B;  1STN A;  2I5M X;  4JI1 L;  3R93 A;  1WD0 A;  2A19 A;  3J81 E;  4AH6 A;  3H09 A;  2KHS A;  4CHT B;  4APV A;  1B7Y B;  2NN6 G;  1FR3 A;  1KAA A;  3MXU A;  1PMR A;  2QEX A;  4IFD I;  1SDF A;  4L5T A;  3K7U C;  3RLO A;  4A3F G;  3OW2 A;  2VQE Q;  1TS4 A;  3NHH A;  4BBR H;  2N49 A;  1X3F A;  1KQS A;  4JI5 Q;  5M5Y B;  3ND8 A;  2MHV A;  4NW2 A;  2UXC L;  3WOF A;  1D1K A;  1BKB A;  1YVC A;  4BBS B;  4HR7 B;  3SVM A;  3CXC A;  2PQA B;  1KLU D;  2R7Z B;  1F2Y A;  3CPF A;  4BBR G;  1SMY D;  4HMI A;  2A6H C;  3HOW H;  1IBK L;  1FNW A;  1X56 A;  4POG A;  3HOV B;  1I94 Q;  2EY5 A;  1HFN A;  1KLG D;  1W3S A;  2PQE A;  1A15 A;  4OWT B;  2OTJ A;  2DUD A;  1VQG A;  4X66 L;  3I70 A;  4FF4 A;  3F2C A;  1HZA A;  3HOW G;  2QF7 A;  1XMO Q;  3CPW A;  2JA5 B;  2K03 A;  2M00 A;  1HCZ A;  2RA4 A;  4OON A;  2K52 A;  1RHP A;  3HKS A;  2B63 B;  1WTW A;  2FJ2 A;  1N34 L;  1B9M A;  2YYZ A;  1K8M A;  2ZTE A;  3PIO 3;  3MAQ A;  3M7G A;  3N6R A;  1H9J A;  3Q22 A;  1ENA A;  1GOZ A;  4DK6 C;  2EYF A;  1EOV A;  1ESR A;  2I07 B;  4FO2 A;  4NXM L;  1SJE D;  3KDF B;  5E7N A;  4QY7 A;  5I4D A;  2EZV A;  1PTO B; 
#chains in the Genus database with same CATH homology
 2B2V C;  2G9H D;  1NR2 A;  1EY9 A;  5EPK A;  4ULL A;  3I3C A;  5C4H A;  3RZD B;  1CTM A;  3S15 B;  3FPP A;  4A93 B;  1IYV A;  2EJG C;  1KNA A;  4C3J G;  3FEW X;  1JR0 D;  4KI0 A;  2F0H A;  4WOR A;  4OO1 H;  2F0G A;  2XWJ B;  3K5N A;  5EJW A;  1O7Y A;  1ENF A;  1AFP A;  4QF4 A;  1XXG A;  2BOS A;  3BVM A;  3GV6 A;  3OMG A;  3K5M A;  4OO1 G;  4PMB A;  3VA5 A;  4ZKB B;  3NE5 B;  3I4N B;  3VR2 A;  1PTO H;  3BDO A;  1I4X A;  1V1P B;  3D4D A;  4KY6 A;  1ML0 D;  1LT4 D;  5M3F B;  1VDZ A;  1I3Q B;  1HQR D;  1D1I A;  1ONL A;  1D5X C;  2A69 C;  1BXT A;  4RCO A;  4ID6 A;  4LMQ D;  1I50 B;  3UI2 A;  4KHV A;  1EWC A;  5FLX L;  3DM1 A;  2WB1 B;  5LHY 1;  3J7A V;  2XNA C;  3F2U A;  3LX0 A;  1WTR A;  3QOL A;  5CYU A;  1BF4 A;  2B2Y C;  5LL6 S;  5M5W B;  4HAE A;  1G2S A;  1DOM A;  3TP5 A;  1IW7 C;  5JVH 3;  4IUV A;  1MSH A;  4A3I B;  1AW7 A;  3PUW A;  2E2H B;  3VYS A;  1F2L A;  4C1N I;  3V05 A;  4OGQ C;  1U4R A;  2LFN A;  2EYL A;  1II3 A;  3GTM B;  5EKI A;  2B2U C;  1PRT C;  1KDC A;  3NTH A;  4H7B A;  5IIF A;  1CA6 A;  1GXD C;  5KND A;  5IT9 L;  3TDQ A;  3C46 A;  4IUQ A;  1SE3 A;  4RKB A;  4TSS A;  4WFN 3;  2WAQ B;  4P2C B;  3OSO A;  4H44 C;  3HP3 A;  3K59 A;  1YNJ D;  5DEH A;  5CV6 A;  4TQU S;  1BCP C;  3IKJ A;  1CHQ D;  1PDQ A;  3MFY A;  5CBE E;  5A2Q E;  1SJH D;  3M4Y A;  1PTO D;  5F2D A;  2MGS A;  3C3L A;  1WTQ A;  2NB0 A;  2ENB A;  5IOC A;  4DU9 A;  3GO5 A;  1LTT D;  3Q6S A;  1UAP A;  5IGD A;  1V1O A;  3L3O C;  5KGU A;  1RJT A;  3TP7 A;  1DON A;  4G57 A;  2MJ8 A;  3T53 B;  3ITP A;  3I4M B;  5IOD A;  2X69 A;  2XRS D;  3FDT A;  5IGG A;  2F0Q A;  2PZU A;  1JE4 A;  1U4L A;  4K8J A;  1BO0 A;  3RD4 A;  2PPB C;  3MFG A;  2A5H A;  2D9U A;  2TMP A;  1EU4 A;  2F0S A;  1DD2 A;  1H9K A;  3OWE B;  3RZO B;  1TII D;  1G6Z A;  5D65 A;  1UNS A;  3TSS A;  1FNU A;  2IJ0 A;  3MZ5 A;  3OW7 A;  2F0K A;  2BDO A;  5ELE A;  3NUC A;  3K7A B;  3U9O A;  2KED A;  1ZYR C;  5DAU A;  1GHJ A;  4EQN A;  1RF2 D;  2AQ3 B;  5C0X J;  1JWM D;  1O78 A;  1OXU A;  1B1Z A;  2JEA I;  3MC0 B;  1HTP A;  4ZUJ A;  3HOY B;  5JPM C;  4QUC A;  3J80 E;  1QNK A;  5HUR A;  4C3I B;  3VA7 A;  4ABN A;  1MSG A;  1EZ8 A;  1JC7 A;  4G7Z C;  2K5W A;  4RHR A;  2WKC A;  4IUN A;  1S4Z A;  3T56 B;  4FF3 A;  1BOS A;  3KBG A;  3ERO A;  3QOJ A;  4OIK A;  1STH A;  3PMF A;  4IUP A;  1K8O A;  1H9S B;  1I6V C;  3DUZ A;  1TY0 A;  1IKM A;  3IL8 A;  3VR4 A;  1U9R A;  5C0X H;  1S5B D;  3FVQ A;  3HOX B;  1C48 A;  1TS5 A;  1LAC A;  1DJR D;  2OF1 A;  3L7Z C;  4KV6 A;  4ZAI A;  2K32 A;  5C0X G;  3SEB A;  3MXP A;  1V1P A;  3PO2 B;  3PO3 B;  1IW7 D;  1WVL A;  3OMC A;  4DN4 M;  2L55 A;  3DWP A;  2QIL A;  5M5X B;  4C3I G;  1W6K A;  2NWG A;  4HN7 A;  2MUY A;  1TU2 B;  3D4W A;  1HUM A;  3NK9 A;  3K57 A;  1PRT D;  1R4P B;  5EPJ A;  1X32 A;  4N9T A;  4RGN A;  2HCC A;  2R92 B;  2K05 A;  3QG1 A;  3H3V C;  2ICI A;  4NKL A;  3QIA A;  5ELC A;  2BE5 D;  1EYC A;  2H4O A;  5EQ0 A;  4IFD J;  1S5F D;  4FF2 A;  4IN3 A;  5HGT A;  2CW0 D;  2KEC A;  2F0O A;  1HRJ A;  3HEJ A;  1HUN A;  3NWS A;  4BS9 A;  1MGS A;  3M4O B;  1WCM B;  2Z4I A;  1Q3L A;  5E1F A;  1QG7 A;  4QB4 A;  4PQX A;  1JCK B;  3D31 A;  2AQ2 B;  4XYQ A;  3TP6 A;  5K36 H;  3NQT A;  1Y8O B;  1LT5 D;  2B2Y A;  1KTK A;  4KKS A;  4I65 A;  1ILP A;  5K36 G;  3SHL A;  4IFD H;  3QJY A;  1PFN A;  1A3U A;  3H91 A;  2NVY B;  4QIW B;  2E74 C;  3LWE A;  2EY6 A;  1SYE A;  3BVG A;  4EQP A;  4IFD G;  3PIP 3;  1EQT A;  4H0L C;  5ELB A;  3KUP A;  5M9O A;  4RA8 A;  3LWU A;  1DOK A;  2K04 A;  1A3V A;  1NR4 A;  2SEB D;  2LY7 A;  3J7A F;  4HCS A;  3MWY W;  3GD7 A;  5C5L A;  4DF7 A;  1M4V A;  1AZQ A;  2L11 A;  3K5L A;  1QNU A;  2Q8R E;  1WD1 A;  3BYY B;  5C4X B;  1ROD A;  2M2L A;  5D3I B;  1Y1V B;  3P1H A;  1FGB D;  3DXJ C;  4A3B B;  1OXT A;  1C4Q A;  4ZYS A;  4HMJ A;  1EIH A;  3ZYY X;  3DHQ A;  4NP5 A;  1PTO C;  1I6H B;  4G7H C;  4I7Z C;  1QJO A;  2NZ1 D;  2LS0 1;  3IFT A;  5COY A;  5IGE A;  1R4Q B;  1G8Z D;  3IAY A;  2L9H A;  2E2J B;  3M3Y B;  2HDL A;  2F0U A;  2QEJ C;  4ZUI A;  4K5V A;  4AYB B;  1DCZ A;  1H9S A;  3J81 L;  1ZXT A;  2Q8T A;  4FXG C;  3P7J A;  3MA2 B;  5DNF A;  3O13 A;  1J8I A;  4PMC A;  3NTK A;  4UAI A;  3GTL B;  5FO9 B;  3S1Q B;  2OT2 A;  1EYA A;  5FO8 B;  4Z9C B;  2AWN A;  2L0C A;  4R9W A;  2DN8 A;  1JOK A;  1T5X D;  3SK5 A;  3S14 B;  5C6A A;  2R93 B;  1XTC D;  1EFI D;  5E4X A;  2NVQ B;  1HA6 A;  2ZT9 C;  1IHZ A;  1JWS D;  3H0G B;  5ISR A;  4K5X A;  1EWH A;  3A7A B;  4RKL A;  3CRK C;  5EGT A;  2NN6 I;  2EE1 A;  4L63 B;  3R2I A;  2XRQ D;  1FYC A;  3D6W A;  3EFX D;  2VB3 X;  2D5D A;  1EU3 A;  3GTK B;  3BZD B;  4A3G B;  3KK7 A;  3LNN A;  3BYT B;  5ELF A;  4TRD A;  2BCO A;  4GZY C;  4G7O C;  5EBD A;  1AEX A;  3J7Y W;  2Z4H A;  4KKT A;  2VUM B;  2B2W C;  1HTL D;  5IGC A;  1CFM A;  4L6T B;  5FLX E;  1G29 1;  2FFK B;  2FMM A;  1Y8P B;  5KRU A;  4A3M B;  3Q0A A;  4KD4 A;  2R6G A;  3R2T A;  2PYK A;  3S1R B;  1TKW B;  2NBF A;  1LV9 A;  4BWG B;  1LTR D;  1Q1E A;  4XQQ A;  4CKC A;  1SAP A;  2F0T A;  4J1M A;  1VF7 A;  1ICW A;  1SFO B;  5C4Z A;  3CHB D;  5I9P A;  1CQV A;  4IUR A;  1EY4 A;  1F9Q A;  2QKI C;  2AUK A;  3JAM E;  4UDU C;  3HOU B;  3WDN A;  4QCL A;  1TT2 A;  5COR A;  4B9W A;  3S16 B;  2JE6 I;  1TY2 A;  5I2Y A;  1EY0 A;  4DAV A;  2EJF C;  1PFM A;  4DXG A;  2B39 A;  5BN3 A;  1QOH A;  4KJO A;  1YNN D;  1SYG A;  1S5E D;  5IGB A;  4V19 0;  3TZD A;  2NTS A;  3C1E A;  1KNE A;  2NYZ D;  1WTP A;  3NPP A;  2F0F A;  3CQZ B;  4Q5V A;  5A35 A;  4K5W A;  1SNP A;  4DA2 A;  2BE5 C;  1OXV A;  4BY7 B;  2X6G A;  2KCC A;  1PLF A;  3T51 B;  1WTO A;  2J0T D;  4OO1 I;  3E6Z X;  2CW0 C;  5IGF A;  2NTT A;  1CZG A;  2LMC B;  5JAV A;  2F0P A;  1M8A A;  1JWU D;  1HPC A;  1ZEQ X;  1SND A;  2F3V A;  1B2T A;  3DEP A;  1OXX K;  1B3A A;  4RGM A;  1A2U A;  5KIX A;  4KN7 C;  4HSV A;  2O5J C;  1EQV A;  5ELD A;  1DXM A;  4XT1 B;  1Z7T A;  4RCN A;  1Q12 A;  1TR5 A;  5JEA J;  3A7L A;  2F0L A;  1Q8I A;  2EOT A;  3E5S A;  5JJZ A;  1F2Z A;  4QMG A;  3GTP B;  1NUC A;  5A2Q L;  2Y0S B;  1I4Q A;  2LKV A;  4A3K B;  2K01 A;  4K2K A;  5CV5 A;  1A2T A;  4EQO A;  2EY1 A;  3PUZ A;  2HQE A;  2K5D A;  3S2D B;  3E0J A;  3RMH A;  3I91 A;  3HOZ B;  3AB9 A;  2XSC A;  5FKA C;  1X3P A;  2EDG A;  1TWA B;  1O7L A;  4N9P A;  1TS2 A;  3T4A C;  1EY8 A;  4DNR B;  5JEA H;  4KN4 C;  2XN9 C;  1PZK D;  2WKD A;  1RKN A;  2VB2 X;  4G4K A;  5FO7 B;  2X6L A;  3A54 A;  5JEA G;  2AWO A;  2ID0 A;  3X3M A;  3OIP A;  1D5M C;  1F9R A;  1QE6 A;  1PYW D;  2JA7 B;  2EYP A;  1QCB D;  4ZRZ A;  4U67 3;  4M1U B;  1SNM A;  3DWQ A;  3RLF A;  3MXN A;  1SYF A;  4RAU C;  1NAP A;  1A6X A;  1EIG A;  3M85 A;  2RKS A;  4KK7 A;  5FK9 C;  3S2H B;  4KKU A;  4IUU A;  4XIG S;  1H9R A;  1F9P A;  3X3N A;  2J7Z A;  1B9N A;  2F0J A;  3GTJ B;  1ZKO A;  1CZW A;  3G7L A;  2RSN A;  2AUJ D;  5EKL A;  2E2D C;  2IX1 A;  4LJZ C;  2F0D A;  4IQZ A;  3M7N A;  3U9S A;  3IFD A;  4ILW A;  4B9X A;  1EZ6 A;  1S5D D;  4C3H B;  1SXT A;  4K6L A;  3SK8 A;  4O42 A;  2NVX B;  2F0M A;  5JPN C;  1A3T A;  3ND9 A;  1IYU A;  1ENC A;  1PFB A;  2L5T A;  2K5Q A;  3S9W A;  2RSO A;  4FYD A;  1BCP F;  4DXF A;  1VF5 C;  4CJ2 C;  2JA6 B;  4XTC S;  4F7X A;  3T16 A;  1PZI D;  4B08 A;  5BN5 A;  5KYL A;  2SNM A;  1Q90 A;  3BDC A;  5NUC A;  4XT3 B;  1E2V A;  4F8M A;  3I90 A;  3A55 A;  3OPO A;  2RDF A;  5CMD A;  5CV8 A;  2CHB D;  3NBI A;  3ERQ A;  2H1E A;  3SK6 A;  1QB5 D;  2B2W A;  2JEB I;  2K7V A;  4H13 C;  3MXG A;  4MIU A;  3K58 A;  2KJX A;  5T1G A;  3P20 A;  1BDO A;  1H9M A;  1QIL A;  3PUX A;  5G3L F;  4DFA A;  4OHJ A;  2PZT A;  3OIQ A;  2E2I B;  2PW7 A;  1TS3 A;  2IX3 A;  1SSO A;  3L9A X;  4KJN A;  1J9O A;  1F9S A;  4FF1 A;  2JP1 A;  1GUT A;  2B8G A;  5J22 A;  2F1M A;  1EEF D;  2JA8 B;  2EJM A;  4YIJ A;  2PO4 A;  3QO2 A;  1SNO A;  2V4D A;  1JOQ A;  5JOB A;  2XWB B;  4HTH A;  2F0E A;  3SK4 A;  3GTQ B;  1R9T B;  1OO9 B;  1OXS C;  4F87 A;  1ILQ A;  2EPB A;  1IKL A;  1LT6 D;  1MI2 A;  1UUP A;  1TWC B;  2WII B;  5C5M A;  1BUV T;  1I4H A;  4PNY A;  4K8I A;  2K33 A;  5D14 A;  2IWH A;  2KA7 A;  2RQX A;  4KD3 A;  4A3F B;  2HUG A;  1YNN C;  1DM0 B;  1SE2 A;  3BVZ A;  1D2B A;  5CR3 A;  4R8I A;  1BNZ A;  4XQN A;  3KF8 A;  2C5C A;  3P75 A;  3I4L A;  2L12 A;  2KEE A;  2F0V A;  5TSS A;  4BBR B;  2NUC A;  1Y8N B;  4EVO A;  4C1N K;  1T5E A;  1E2Z A;  1RTO A;  1F2M A;  1Z47 A;  2QCP X;  2DNE A;  3EQL C;  1SYB A;  2HCI A;  3HOW B;  2FHT A;  4ME5 A;  3PUV A;  4K14 A;  5CGK A;  1U4M A;  3A56 A;  4KMU C;  5I9O A;  2L1B A;  2O2L D;  2YU9 B;  4L8J A;  2RBM A;  2DY8 A;  2AQ1 B;  4XDX A;  1VCI A;  1AP0 A;  2K28 A;  2XVS A;  3KBX A;  1EOT A;  3SDZ A;  1CA5 A;  1EL0 A;  1JOO A;  4Y7N B;  1LTS D;  5C3W A;  1Q1B A;  1LTA D;  4BA2 I;  3K0Y A;  4FXD A;  1BR9 A;  3CRL C;  5CV9 A;  2PW5 A;  1CM9 A;  2IPK D;  1E0B A;  1LT3 D;  3VYU A;  3HKZ B;  4C3J B;  2EYO A;  1L0X B;  1XX8 A;  5T1I A;  2F0N A;  2FMC A;  5C44 B;  2EVB A;  4NDX A;  1TWH B;  1K83 B;  3I8Z A;  4LAA A;  3FMC A;  1ESF A;  2IL8 A;  4CJ0 B;  3A8K E;  4KY7 A;  3Q23 A;  1F77 A;  5CC4 A;  1CQF A;  4XQJ A;  2ICE C;  2B2T C;  1HQM C;  1PXU A;  1TWG B;  1HFG A;  2RDG A;  5J39 A;  1B53 A;  4JBW A;  4FP5 D;  2O4X A;  4PV1 C;  3DMU A;  5C4J B;  4DK1 A;  4ZKC B;  4ZK9 B;  2A6E C;  3VYR A;  3CU7 A;  5EPL A;  2JSO A;  3NXW A;  4WJW A;  2BA0 A;  5AFW A;  1STY A;  4O1N A;  1RTN A;  1AZP A;  3A8J E;  1STG A;  2DY7 A;  1SBB B;  3G6J B;  3PV0 A;  2IX0 A;  4PMW A;  2R3Z A;  1HA5 A;  3V96 A;  1JOR A;  3NBH A;  1QWY A;  4XXE A;  3FKI B;  1Z6H A;  4M8A A;  3HS0 C;  1GUO A;  2PCF B;  3FPU B;  2ZXP A;  1U4P A;  4U68 A;  3T13 A;  1KAB A;  1B44 D;  5CV4 A;  4RH6 A;  3KLS X;  2PMZ B;  2D2C C;  2GA4 B;  1S5C D;  4CBV A;  3AU7 A;  1I4R A;  2A68 D;  1O7Z A;  2EYM A;  5IT9 E;  4RFB A;  3KLR A;  3HZX A;  3K5O A;  5KNC A;  4FXK C;  3MEH A;  5FOB B;  2TSS A;  2KOL A;  2A73 B;  2RDH A;  4FNF A;  4DAY A;  3TME A;  3JAM L;  1GUS A;  1PTO F;  4KHZ A;  5DM6 3;  1W6J A;  4E6I A;  1V43 A;  3H94 A;  4IZ8 A;  3EJI A;  2CQA A;  1Y69 U;  3TP8 A;  3D3R A;  3BDL A;  4CKE A;  5I2X A;  1TQO A;  3I72 A;  1B4O A;  4DAP A;  1KDA A;  4X3S A;  5CV7 A;  3BS1 A;  1XYI A;  3D6C A;  2OXP A;  2E75 C;  3EA6 A;  2O5I C;  3NQI A;  3PUY A;  5CBA E;  4S3S A;  1C8C A;  2BDN A;  1KDB A;  3NSW A;  3HGB A;  1EY5 A;  4RWS C;  1X3Q A;  4ZLT F;  2OEO A;  3VR6 A;  4J8Q A;  1NCV A;  5KYI A;  2C9O A;  4HCE A;  2N88 A;  1MBY A;  5I6Y A;  1FNV A;  3D4R A;  2A6H D;  1D5Z C;  3HRZ C;  5D3D A;  3D8G A;  1PRT B;  3QB3 A;  3SXH A;  1GUW A;  3H6M A;  1STB A;  3DEO A;  1V8Q A;  2BA1 A;  1BBX C;  2IT1 A;  3TBI B;  1SE4 A;  4C2M B;  3NTI A;  2WIN B;  5EKK A;  3QWN A;  3GTG B;  2D62 A;  2F3W A;  1BCP B;  2F0W A;  3NP8 A;  3W2D A;  3SE0 A;  4RGT A;  1RCV D;  3WOE A;  1EY7 A;  4OL7 A;  3DWA A;  5LL6 X;  3URY A;  2G9D A;  2KUM A;  4IUT A;  1STE A;  1HHV A;  3HG9 A;  3S17 B;  1STA A;  2R61 A;  1SYD A;  2A6E D;  4EGV A;  5KNB A;  1NSN S;  2KVM A;  3TZU A;  4C56 C;  1LTI D;  2Q8I B;  2F0I A;  2L4N A;  1GUN A;  1I4P A;  3GV3 A;  2EYH A;  2QDB A;  3OHX C;  3GP7 A;  4JK1 C;  1B50 A;  2WAC A;  1G2T A;  3TN2 A;  4XYO A;  2MP1 A;  4R8N A;  5C3X A;  2KQ3 A;  1I4G A;  3C1F A;  4NMZ A;  4BA1 I;  3J80 L;  1LTB D;  4MHE A;  2KCN A;  2Z8L A;  1VMP A;  1GHK A;  1AN8 A;  4F88 A;  4WRD A;  3KLS A;  1Y1W B;  1CK1 A;  4KY5 A;  2J4X A;  1BQQ T;  2ZXO A;  3I73 A;  1O80 A;  1L0Y B;  3N52 A;  2EYJ A;  2A69 D;  2I46 A;  1LAB A;  1CHP D;  3MVV A;  1PRT F;  1LLR D;  1EYD A;  2EY2 A;  1DOL A;  2B2T A;  5C3E B;  1SMY C;  1JIC A;  1GUG A;  1TWF B;  2F4I A;  3W3A A;  5JVG 3;  2E76 C;  4Q0F A;  2F03 A;  4DK0 A;  2K1B A;  4A3E B;  2B2V A;  3EVQ A;  1SEB D;  3GTO B;  1CI3 M;  4DGZ A;  3AMU A;  4X3K A;  3C2P A;  4KTA A;  5J1Z A;  1E2W A;  3MHB A;  4X3T A;  1TVX A;  3FRP B;  2WP8 J;  3S1M B;  4QUF A;  4LK1 C;  3R3O A;  1WTV A;  2EXZ A;  4K2L A;  4CJ1 B;  2B8F A;  2N55 A;  1BCP D;  4V0B A;  2CVR A;  5KEE A;  1SNC A;  4FVM A;  4C3H G;  4OIJ A;  4A3J B;  2MPM A;  5E3F A;  2JYO A;  1DZ1 A;  1ET6 A;  5C0X I;  5EBC A;  1EEI D;  1G91 A;  1VMC A;  1SNQ A;  4ZQ3 A;  4DNT B;  1MD2 D;  2NVT B;  3RUZ A;  4CGY B;  2IW3 A;  3NWT A;  3SR1 A;  5K5P A;  3Q24 A;  1WTX A;  3OOC A;  3CKI B;  4MN3 A;  4RGO S;  1D6E C;  3S1N B;  1UEA B;  4HED A;  2SNS A;  5G3L D;  3V2T A;  1CT1 D;  4IAL A;  1HXY D;  5M3M B;  1XWE A;  3VYT A;  4ODG A;  4HSP A;  2K6A A;  4RHS A;  4CKB A;  1SYC A;  3GQB A;  2SOB A;  3OWF A;  2A68 C;  2VXW A;  1RDP D;  2B2U A;  4A3D B;  2SDF A;  3A8I E;  2FIN B;  5DM7 3;  1ZYR D;  2VNU D;  3VR3 A;  2WV6 D;  2HDM A;  2PNR C;  2DNC A;  3MTS A;  1DYQ A;  1LO5 D;  2RVL A;  4TKO B;  1ET9 A;  3ONA B;  3VR5 A;  3R8B A;  1LTG D;  5E4W C;  2XIW A;  1PZJ D;  3K6O A;  1JB3 A;  4X3U A;  2Z1C A;  1RD9 D;  4K6D A;  1FD7 D;  2JXM B;  5I6W A;  1JQY D;  2M9V A;  4J6H A;  1EY6 A;  2A74 C;  5BN4 A;  1GJX A;  1IL8 A;  3BG3 A;  2PZW A;  1YNJ C;  2NN6 H;  2ZXR A;  4BY1 B;  1STN A;  3R93 A;  1WD0 A;  3J81 E;  3H09 A;  2KHS A;  4CHT B;  2NN6 G;  1FR3 A;  1KAA A;  3MXU A;  1PMR A;  4IFD I;  1SDF A;  1TS4 A;  3NHH A;  5M5Y B;  3ND8 A;  2MHV A;  4NW2 A;  3WOF A;  1D1K A;  4BBS B;  4HR7 B;  3SVM A;  1KLU D;  2R7Z B;  1F2Y A;  1SMY D;  4HMI A;  2A6H C;  1FNW A;  3HOV B;  2EY5 A;  1HFN A;  1KLG D;  2PQE A;  1A15 A;  3I70 A;  4FF4 A;  2QF7 A;  2JA5 B;  2K03 A;  2M00 A;  1HCZ A;  2RA4 A;  1RHP A;  2B63 B;  1WTW A;  2FJ2 A;  1B9M A;  2YYZ A;  1K8M A;  3PIO 3;  3MAQ A;  3M7G A;  3N6R A;  1H9J A;  3Q22 A;  1ENA A;  1GOZ A;  2EYF A;  1ESR A;  2I07 B;  4FO2 A;  1SJE D;  5I4D A;  2EZV A;  1PTO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...