2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
1HT1E 2AN9A 3BH6A 2F1HA 3KJIA 1IW7C 4X65Q 4PMWA 4DV0L 2MMCA 1AM4D 2HF9A 3ADKA 3W6OA 1IXRA 3RS2A 4AQYQ 2D5DA 4JLKA 4JIMA 3ASYA 5KYKA 4CEJA 4MUBA 1J7KA 1WP9A 5FOVA 4DV5L 4Q4HA 1GVNB 4YXWA 1IBLQ 3LRPA 2H7VA 5M5YH 4HZUB 3L8ZA 3GTQH 2FPLA 4H44C 4YHHQ 4RD1A 3DXJC 1YI2A 2O0HA 1GL7A 1YQTA 5FOXA 4AG6A 2WKQA 4B3SQ 3W3ZB 5EP4A 2BJWA 1Q1QA 2B92A 3SC3A 3UIEA 2J7KA 1BYUA 1NBMD 4JI4L 1K83H 1HQMC 1VG1A 4D4MA 3GLIB 4Q1CA 1MKHA 2N78A 3TS2A 1TL7C 3HR8A 4JBXA 4L4UA 4MQBA 2CCGA 3ADCA 3K0SA 3AYHB 4KITB 4DV2Q 1HEIA 1P73A 4KFTA 4F93B 2R92G 2AUJD 2RF4A 2R93H 4Q01A 2PCFB 5JEAJ 1SULA 2FEMA 2GK6A 3F5FA 2QF7A 2JA7G 1LB1B 3L0OA 1UBEA 4LFCQ 3ZH9B 3OFND 3THYB 4Q03A 1GJXA 2CL6X 2F1JA 2JLRA 3MXUA 3N5CA 5DIFA 1WYDA 1N2CE 4AWXA 4EIWA 1FPMA 1Z2CA 1I2DA 5GAGC 2B7CA 3AH8A 4JLBA 4N0DA 3K0FA 1GZSA 4TWZA 5DNYB 3KQKA 4OI2A 3AKEA 4LFAQ 4TLBA 4D0GA 1MKYA 3P4XA 4JYCA 3LDAA 4IRUB 1YZKA 5CB8A 2Y0SE 4CEIA 4HLCA 1GD7A 5LMNW 3GTMH 3RANA 1KI9A 2F4VL 2JA9A 1B9NA 4PHGA 4CRWB 4RD6A 1Y8NB 5L3QA 3Q9LA 4A82A 2H17A 2ASBA 1Q1ZA 4TL7A 3CX6A 3GLFE 4M21A 4TN1A 1CR4A 4RFSB 5FI1B 3SFZA 4RZXA 4DAYB 4MYHA 4KYIB 3THXB 2D2FA 3A7AB 2PMKA 1J99A 4GKKL 2RGXA 1KC8C 1JEEA 3DO6A 3FMFA 4TT3A 3T53B 5DISB 4LUCA 4RKFA 1CR2A 2ZSFA 4ZI3A 4PZ6A 2BCGY 3GEIA 5GJWC 2GJ9A 1DAMA 3KJOA 5HPYB 2ZE5A 4QXAA 1OFUX 2JEBI 1WRBA 1QG4A 1Z83A 3Q8XB 1GILA 3H0GH 1IYJB 4A8JA 1A2KC 1PH2A 1SVWA 4Q4JA 2OCYC 3BDOA 4KI0A 4LF9Q 2B21A 5L8VA 2XOKA 3FE2A 3I62A 3IKJA 2CW0C 5DSZA 5FPSA 4G0NA 2EFCB 4DV4L 1G5TA 2PL3A 1T3SA 2AWNA 1UE6A 3CCVA 1P4SA 4LF4Q 5AUNB 2QROA 3DL0A 3EPLA 4OWWB 2R92H 3HPQA 1WMSA 2AXPA 5CLQA 3ZZ0A 4DB4A 4B3ML 2BM0A 4LV8B 5L3SB 4TQ9A 1GL6A 1W7AA 1FR3A 1JXOA 1TF7A 3KZ1E 4G1UC 3SJZA 2QSYA 5BN3A 1A0IA 4GP7A 1F3OA 2REOA 2ZRDA 2Y0SG 2IS6A 2MO1A 5BWMA 2DNCA 4HAZA 3T34A 5KHOC 1U0HC 2BH8A 4OO1G 3DKPA 3OAAA 1ZC4A 2Z0MA 4QOSA 4YY3L 3AVOA 2A5JA 2ANBA 4JJKA 4P4UA 1L4YA 1YVCA 1FUKA 1G20E 2FZLA 4ZCLA 1NVXQ 4DK6C 1OB5A 4DSTA 1L2TA 4JSYA 1E9EA 1E79A 3SOPA 4ON9A 5ANRB 2DN8A 4DR6Q 2ZRGA 1MT0A 1EIFA 3TIFA 2J0UB 2IF0A 2IX0A 1GO3E 4GOPC 3TRZA 1LS6A 1V5WA 2ZSEA 2WPDD 1ZYRC 1R0XA 2QGZA 1NTGA 3DVLA 3S1MH 1XXHB 4PPQA 4LJZC 5KPJA 3VQTA 2Q2TA 4GLXA 1E1RA 4V0NA 2PZFA 2GVAA 4JKYA 4AC9A 1HJPA 2VQFL 4KVAA 3TKLA 4HLUA 4Q9JA 4ASUA 4BFXA 1NN3A 3NHAA 4RVCA 3TK1A 3WYFA 2RHMA 2X1VA 1NP6A 4LY6A 4AY2A 1KI6A 2BBWA 1PLJA 3FGNA 1CF4A 3K0CC 3M9BA 3J7A5 1GG2A 3ZJYA 5FTKA 3SQWA 5CIWA 4US2R 2EWWA 2Q3HA 3LQQA 4B6EA 4JI8Q 2B63G 3QXCA 5IYCG 4AI6A 4V0LA 1TWHH 2B29A 4Q4AB 2ZIAA 2BKUA 2MQHA 2PZGA 1C9OA 1PLLA 3A1WA 2EJGC 2R9VA 4DCSA 1TWCH 3PIOA 3G6EA 2A68C 4UY8C 2WV9A 2XITA 3N2IA 1R10A 2ZRBA 4KO8A 1E2NA 3ZGXA 2XTIA 3IPXA 4CEHA 1OW3B 4LHWA 1E2VA 1SVKA 2BV3A 2F1IA 4A3DG 2ZE6A 3C4JA 3GJ6A 4L5TA 4LUOA 4W5HA 1VQJA 4YCVA 2ZRHA 4KV9A 4AH6A 4DHEA 2XEXA 4ME3A 4TMXA 4WZ6A 1VQBA 2YC2C 4XH9B 3QVUA 4QHSA 3UG6A 5B57C 4JI5Q 3TGPA 1AS2A 2F52A 1NG9A 1NJFA 4HDCA 5FL7D 2R44A 3KKNA 4P73A 2AFHE 4GNXB 4IJHA 2WSMA 4MDFA 1HNWL 3RS7A 3HWSA 3X1WA 3GDEA 1T0JB 2F9LA 2FN4A 3EN2A 3EIHA 5SZKB 1W5TA 5B30A 5C1BA 2H57A 3KJGA 2F43B 1R0ZA 2WAQG 2YVUA 3GJXC 1N6KA 3PUZA 4BPBA 4OBEA 1C9KA 5ELNA 2C98A 4GKKQ 1E9DA 3IQXA 4A36A 1FNNA 4B2IA 1BOFA 5J3BA 4BQSA 1F2TB 2X2EA 3RWOA 1F2UB 2QORA 1G8YA 3PEVA 3M85A 4WIAA 5H1YA 5BR8Q 3RN2A 3EIQA 4TMWA 1U5KA 1SVOA 1KRTA 2HT6A 3IBGA 4C3HH 1EYGA 1BS1A 1DOAA 1MH1A 4BFTA 4DUGD 4JI1Q 4GOXA 1MO6A 1UWVA 2PI2E 4HJ7A 2F7SA 4EQ5A 2GBLC 3R7WB 1NMGA 1VIYA 1I50H 2BIFA 1IBKL 2C9YA 4ALPA 1FYCA 3G71A 2DCUA 1ZNWA 4LJ7A 3KQHA 2BBTA 2JLZA 1GUAA 1T6NA 1QVCA 1P72A 2OWOA 1KO5A 3KLWA 2GXAA 2K5HA 1QHGA 4O25A 2MFIA 5J4KA 2CK3D 1E9BA 3ICEA 1QHIA 5AUQA 1NNEA 5HCIA 3HU2A 4UJ5A 3CD6A 1DAFA 2IYXA 3G48A 1UPTA 2W0SA 3BAFA 1E1TA 3QPVA 1F6BA 3QQ5A 4XD7D 4YDHB 3CCQA 1SXJD 1OYWA 1W2HA 2B8TA 4JL5A 1UE7A 2H92A 2PLRA 2REBA 1D8LA 2ZI3A 5K8UA 4DIDA 3GTJH 1VIAA 3AVVA 3AVWA 1PUIA 1P2VA 3P1JA 1N36L 4BY7G 1PMRA 2N8NA 4M8NE 2BHRA 4I1OA 4OX9Q 1XMOL 1G7SA 1I4TD 2HXSA 1S40A 3EZ7A 3QBVA 5E7NA 2ZYVX 3LAWA 4GOPA 1G7TA 2FX3A 4PC3A 2ZI6A 4JKIA 4DV2L 4OONA 1JPJA 1XFAA 2I4IA 2WTUA 2IHFA 3BIFA 3WHLA 1I94L 3K9HA 4DDVA 1JB1A 3U7GA 5HE9A 3D6TB 3ZVRA 2H1LA 3AGQA 1K8RA 2OE2A 3ADDA 2DHRA 1YRBA 2ZU0C 3CBQA 1DG1G 1F60A 1R5OA 3QBTA 3K70D 2IW3A 2K7VA 4IOLA 3MD0A 2FDCA 1JT8A 3X1XA 621PA 1NE3A 2VQEL 4U5XA 4D2IA 3KB1A 4A6XA 1R6BX 1Z28A 1M6NA 4EFLA 4QBHA 5FPKA 4YMWA 4PC7A 1J90A 2E5LL 4BFUA 3TW8B 2FFAA 1RKBA 3QJYA 5CLLA 3AKDA 3X1YA 1PJRA 3OF5A 4F4JA 4L15A 2P5SA 3EC2A 3BBPA 3X2SA 4B3MQ 2XTZA 1E9AA 2WIAA 2UU9Q 3F0TA 3HR7A 3KXKA 1XNQL 3GJ3A 4TMTA 1PYSB 4A76A 5SZJA 4L8JA 1IBMQ 2P2LA 4NONA 4P31A 1QHNA 4RD3A 2YYZA 2BWJA 5IP9H 1XXHA 4Q7LA 1ZMXA 2P6UA 1FW6A 3V00A 5F3WB 2Z6VA 1JI0A 1YHAA 3MGCA 1SROA 1GFIA 1DG3A 1Q57A 4LCBA 3TH5A 3OZXA 4LFAL 1E94E 1OV4A 4OJKA 5DN6A 2XXAB 2KB0A 4US0R 3DM5A 4NXNQ 4IOAA 3LXXA 5DO9A 2DYKA 2Z6KC 2GXSA 4NL4H 5A5GA 3UWKA 4GKJQ 1YR8A 2VH5R 4MUAA 3T35A 1TMKA 4MKFA 4LHVA 5E3HA 3U3RA 5KDLA 1K3RA 5FBWB 1UBCA 2Q3MA 3C8UA 3CO5A 4TYYA 1I4LD 3MMPA 5G41A 1JAIA 1KMQA 2HXYA 3KJEA 4ASUD 1HE1C 1YZNA 5LMUQ 2GEDA 3CF5A 2YTVA 2VHCA 1Q1EA 3A4MA 1FX0A 4OYHA 3CP0A 1YZ6A 1PH5A 3EA0A 1ZM4A 2CE7A 2AHOA 2UZ3A 1ZD1A 4JLMA 5HR5A 3HOWH 4JYAQ 1PLKA 4O0MA 3E9IA 1X1RA 1GRQA 4UNQA 3U60B 4D80A 4B6FA 4HB0A 3CNNA 4MGKR 4KJZA 3IQWA 3OTOL 2KCMA 3Q8DA 4A3IG 4PZ7A 2B6HA 3B1VA 5JWHA 3CW2A 5EZ5A 4U02A 721PA 5AR1A 4LHYA 4LX0A 4C30A 4UP7A 4DV6L 2UXDQ 2LKCA 2YNMA 4RSGA 4WW0A 2OXRA 2VSOA 1UBGA 4URUR 4WOPA 4XJXA 2ASEA 1SGWA 5A0FA 4LSGA 4G7OC 4WJ4A 1XEWY 3CRKC 1DO2A 5BN5A 1VYVA 1U90A 3LX8A 4JLJA 2QRNA 2Z0SA 3NHBA 2BA0A 1PVOA 4WAUA 1SVMA 2GHIA 4L5SA 2IYRA 2LCFA 2GF0A 3C7KA 4JYAL 2RGBA 3HJNA 2OG2A 4Q1EA 1ZUNB 1Z7TA 2V4DA 4XIGS 3IIMA 3ECCA 4HAXA 4IVQA 3X1ZA 1WE2A 5FBVB 2QPOA 4Q00A 2KSQA 4YDSA 2EFEB 5D3QA 3HYTA 1O3YA 1VYTA 5GQOA 4M4SA 4JI3L 3ZDQA 1N34L 1H95A 2DWPA 4NCHA 5IT9c 1N6HA 1CR1A 5JJIA 2WJJA 3TS0A 3KJHA 3CRVA 1CFMA 2VF7A 4G5QA 5HE8A 4S2EA 1WI5A 2QQEA 2GJKA 5HKKD 3OIWA 1OT3A 4IO9A 4HSEA 3O8CA 4X66L 1LV7A 1X8LA 3GTOH 4IVPA 4PQFA 2B3GA 5FOUA 2H18A 3QEOA 4QJFA 1KY3A 3I61A 2O0JA 1SMXA 5EQTA 1E24A 1E2JA 4H02A 3A1UA 1XTQA 1S2MA 1W0KD 1H9SA 4A3MG 4NXMQ 4M1TA 1YZGA 3PFIA 1VQCA 2NVXH 2K33A 1Z0AA 2WAXA 1OIXA 3B1XA 4DNIA 3W6NA 4QBIA 3SZRA 5LDDC 4MGZR 5H70A 2RGNA 1W49A 4EJSB 1GHKA 3I5YA 4URVR 3THWA 1LF0A 4LC1A 2HYDA 3BG3A 3H84A 4IFDH 3K9GA 4QQBX 3I73A 5IP9G 4PSKA 5AK0A 1BKBA 2QMUA 1X8JA 5CM9C 1JQLB 2C2HA 2EFDB 3MUFA 5FR2A 2JGNA 4TYPA 3SNHA 3ASZA 4C2UA 4DNTB 1EG7A 2QTHA 3B7GA 5JI3E 1E1QA 2C8VA 3CKLA 4CZ2A 2QGQA 3NH9A 3A36A 4RZ2A 2EFGA 2QZ4A 4UXIA 1U81A 4LC0A 2AR7A 3RS4A 2O8EA 1UE1A 1Q3HA 1UBFA 2ZRPA 3PQCA 1A82A 3SR0A 3TR5A 4C0LA 2ES2A 4NCIA 1B70B 1JR3A 1ZCAA 3MXNB 4JI3Q 1HUQA 2VP2A 3RC3A 2NIPA 4MZ9A 4BXXG 3CF6R 1KSGA 1CUKA 4WBSA 3SU8A 3VHXA 4MKIA 1R4AA 1Z0DA 4LI0A 1JJCB 3T1YQ 2VL7A 4KMUC 3BS4A 3EZ2A 4I99A 1VCNA 4M1WA 4BLQA 5J47A 2ZM5A 3A1TA 2WZQA 1FFHA 1C4OA 1NBMA 3OHMA 4MRVA 4FI3C 4JMPA 4Q5IA 2A68D 4P74A 3FMIA 1Z5ZA 4OI1A 1W1WA 5HZHA 4F7WA 4A15A 8OHMA 2XNDD 2AK3A 2V1CC 4HDOB 4LBZA 4LYHA 4N1AA 2CKZB 3NBHB 1P9RA 1W5SA 4AKEA 1VCIA 4KBGA 4N3NA 4RD0A 2R93G 5TVKA 5K36H 2OBMA 4LPKA 2HQLA 5HTKA 2DNEA 4JI2L 4AYWA 4R4IA 2OCAA 3M4OH 3GTGH 1X3FA 4KKSA 4TLDA 3RZOH 4LBWA 1TKWB 1E3PA 2QUZA 4XWOA 3W90A 3GLIE 2QPAA 1ESMA 421PA 2O5IC 3TRFA 1V9PA 4TT3D 4D4JA 4MNOA 1XWIA 2F3IA 2QE7D 4JI6L 4WJ3M 1Y3AA 3KYHC 3NEYA 4JS0A 2UZIR 3M4QA 2PMDA 2CXXA 1IQPA 1CI3M 1P8LA 3R7WA 4A1FA 1TTTA 3MLEA 3TUJC 3RS3A 1VS0A 4RG1A 1S72A 1FX0B 4GZLA 2PJZA 4IDHA 3B5JA 4IOCA 4N0EA 3BH0A 4PPGA 4B43A 4K0KL 3AGPA 5IT5A 1P75A 2VHTA 3U58A 3X1DA 2BOVA 1XMIA 2FXQA 1N36Q 2J0UA 3CF2A 4D6PA 1F5NA 5L3RA 3MFYA 4HYYA 121PA 1Q0UA 3E1SA 5UKDA 1I6HH 5HGQA 1ZINA 4V02A 2FOLA 1PH9A 4OK3A 1E2KA 2ZAOA 2W6IA 5EAYA 4EFNA 5BW8A 2WMOB 2WWHA 1Y14B 2GZHA 3CWZA 1U0JA 2NPFA 1QDEA 4XWAA 2JEAI 2CJWA 3BH7A 3CZPA 1Z6GA 3KXIA 3P27A 4YLGA 4A2QA 1XNJA 1SHKA 4M53A 1LABA 3LD9A 4Z8XA 1WBDA 4LUZA 3RRMA 4R4TA 4AURA 3ZD7A 1XP8A 3A1SA 2EYUA 2RGNC 521PA 2O8BB 1PUJA 5FUWA 5EXXA 3QF4B 1UKVY 1EGAA 1P7CA 2EVBA 3CPJB 3T06B 1G4UR 2XB4A 4X8MA 1CJTC 4A0HA 1D2NA 1XEXA 4BZXA 1S1MA 4UPAA 3TSOA 3STBD 2ZJ2A 4V0OA 1NLZA 3JC66 3S1QH 1T0HB 1VQHA 3LA6A 4JI8L 1IN4A 2AUKA 4DR5L 3KTAA 2PJRA 1W4CA 5L3VA 2GKSA 3WNDA 5FPYA 4QL5A 2CCJA 2JLVA 1NI3A 5EZ6B 2Z4RA 4Q7MB 1CBUA 1K6MA 2JA8H 1ZKOA 1IYVA 2KBEA 3F3YA 1XJQA 2XTNA 3LLMA 4Q19A 2F9MA 1G291 3NEJA 1OH8A 4MKGA 4W9MC 1E2GA 5CITA 4EJSA 3EASA 4B3GA 1LY1A 3THWB 1IJFA 3LBIA 3TQFA 2BC9A 2WSSA 3LW8A 4DSOA 2XX3A 4ERNA 3CNLA 1CJKC 3VNVA 1E2LA 1K5DA 3KOJA 5IYDG 3DHWC 3TQCA 4MGIR 3I7FA 4DLRA 4D81A 1S1CA 2CHVA 3EA5A 3KUDA 4H13C 3MAAC 4BLTA 3MCAA 3LH5A 3AUXA 4H1UA 4D0NA 3NC1C 2DPXA 2E9SA 2JXMB 5G53C 2JATA 5HCNA 5KU1A 2FGKA 4AKIA 1CJVC 5G3YA 2ZPTX 1KSHA 1X3EA 4A3FG 1LFDB 3VMFA 4RMFA 1M1KC 2P65A 1RFLA 2D2CC 5L3SA 4Q7JB 4DV1L 2KE5A 4R1JA 1OH7A 4QGAA 4LBYA 1R9TH 2VUMG 3U6KA 4JCVE 4Q9HA 3ZS9A 5IHPA 3DEFA 1IN7A 3W5OA 5LB4A 5H1SE 2IBMA 2ZI5A 4W5JA 4B2LA 3U3JA 5FL3A 3ER0A 3WYAA 1JJGA 3T1TA 1Y1VH 1ZBDA 1IXZA 1AS3A 1YR9A 1OXSC 4EPXA 4NH0A 4NP6A 5C18A 3GLHE 4XOIA 4P4SB 2NZHA 2FF7A 2YWFA 3JVUA 1SVLA 2VLIA 4Q1AA 1O7IA 1XJ0A 2IHYA 1DVRA 2Q0HA 3I5XA 3ZLJA 2DB3A 4JLPA 2NZ8A 1YNXA 1Y1WH 1G7CA 1RZ3A 1Z06A 4URZR 1J70A 3DPUA 4R4CA 2W6JA 3OYYA 1DE0A 3MJHA 4BUJA 1B8AA 4DWJA 3U7HB 4CEJB 3FHTA 3K81C 4X62L 3PF5A 3REGA 1L1OA 3J81c 2JA8G 4HJ9A 3NE5B 1ZNYA 3AF4A 3VR4A 1CJUC 3FOZA 1NSTA 3FKQA 4GKJL 1EFHA 1X55A 2A1AA 1J5EL 2ZROA 4AIMA 2C35B 2SHKA 1HZAA 2V54A 3CX8A 2IYSA 2QEQA 1VQ9A 1HZ9A 1G21E 2UUCQ 2PCJA 3HP1A 3QI2A 4BASA 2ZTSA 3AF0A 4GNXC 2C78A 4GOPB 2OAQ1 2B63H 1N32L 2A6HD 3WNCA 3VU9B 1Q22A 3TAUA 2WWGA 2JLYA 5BR8L 4KBFA 4LWCA 2GCPA 2H16A 2OSBA 4Q4AA 1Z6AA 2Z6KA 3G0HA 4DV4Q 5KNCA 3BXZA 5C2JB 3PO2H 1IY1A 3E0EA 4JOIA 3PR1A 1MR3F 3TW4A 2ZYUX 2EQSA 3CH4B 4JBWA 1KI3A 1XZPA 3S1AB 4A0GA 5KUTA 3KJPA 5GROA 2BJVA 1K8AC 2QAGA 3MSXA 2XXAA 1NMYA 4ABYA 1ETUA 2VQFQ 3RR5A 1Z0FA 1G19A 3I4LA 2VSXA 1EESA 3L2PA 4R4OA 4DR1L 2OO7A 4DDWA 1CKNB 3Q7QA 4PC2A 4Q4LA 2IYWA 1Y1WG 5B58C 4LJ5A 4AKHA 5SZHB 3CRQA 3TZUA 2NN6H 1SFOH 3A0JA 4LJAA 3GJ7A 1XNRL 2NG1A 4A3CH 3B78A 5FOSA 4B73A 2CL7X 2LXJA 1TADA 5JEAG 2XSZA 4P33A 2OCBA 4PSAA 3RZDH 1J5EQ 2NVTH 1AK2A 2JJ2D 4UNPA 1KJYA 1V1QA 4IXMA 1XTIA 3UMFA 5K8IA 3VA7A 3S16H 2NZOA 3AUYA 3EQLC 4OHVA 3AP3A 1OJLA 2FJUA 1GAJA 4FDBA 2ZI4A 1E32A 3K70C 3FWYA 2QT1A 3T5GA 1RPZA 3MRSA 2ZR0A 5JRZA 3LWUA 4A3GG 2P6RA 4H0LC 3SFVA 1MABA 1MO3A 4QRHA 1VCOA 4GS3A 4PO8A 3RAPR 2D0PA 3ERSX 1PA6A 3K53A 3EX7C 4NU0A 1G5PA 4B3DA 4A3LH 2KBFA 4WZBE 1YZLA 1P5ZB 3CC4A 3OW7A 1YNJC 4ZPXA 1SXJE 1OE0A 2GJ8A 2W00A 2UXCL 3W6PA 3WP0A 4DEYA 1K8OA 3B85A 4I81A 4RD2A 4LPSA 3OOCA 3NBZC 1KO8A 5DYGA 3ADBA 4QBFA 4TZ0A 4HJ5A 2CQOA 1KZGB 2WJIA 1E69A 1N5IA 5JRJA 3N6RA 4WVFA 2OBLA 2X77A 3OFNA 2B7BA 1JPNA 1G8PA 1XTKA 2MSCB 4BLRA 4GL2A 3RLNA 4A3LG 2YINC 5CK4A 4DR4L 3OEEA 1W2BA 3FKIG 2E2IH 1EFUA 4G7HC 1JR3E 2LKDA 4QJ3A 3SJBA 5LD2B 3PXGA 4BLPA 2RH5A 5JWRA 2FMXA 1HR0Q 1S3OA 1QZHA 3ETLA 2ZANA 3P26A 4PX9A 2XGTA 1VQ4A 1M7GA 1P2SA 2J46A 1DD2A 2ZI9A 5DHAA 1AJEA 3I2ZA 1RRCA 2VHJA 2JLWA 4DR2Q 2AKYA 2AKWB 4R7ZA 2QG6A 1WA5A 3QKSB 4B3SL 4XTRA 2VRWA 3AVXA 2EYQA 2OQKA 1EFTA 2WWFA 1U9IC 2XOKD 5C3EH 4GOJA 5KSZA 3AFPA 5TY0A 1B0UA 1KO7A 1OLOA 1GUNA 2E2JH 3BOSA 1KYIA 2N3SA 1E98A 3MWKA 3QOFA 4V0MA 3PO2G 4MTNA 1S8FA 1SXJB 2GRJA 2J87A 4DRZA 2CJWB 3SE0A 2J0QA 2A5FA 1GKUB 1KY2A 4Z54A 2YOHA 2BVNA 2Q9CA 1WCMH 2OQ0A 1QZXA 4BA2I 1IJEA 3EC1A 1Q21A 5FL7A 2G83A 6Q21A 2FSIA 4ZDWA 3PVSA 2FA9A 3GLGE 1BIFA 3A8TA 2ANCA 4I4LA 5AJXA 2IHBA 2QPTA 4HAUA 3SYNA 4EDHA 3B6YA 4QJ5A 3T1HL 1IY0A 1EWHA 1V43A 1K8GA 1JECA 1KNQA 3PCOB 1J2JA 1R0WA 2IXGA 3GPLA 4TYNA 3ND9A 5KDDA 4HB3A 2GZAA 4KU4A 4A93H 2BE5C 1GVPA 4L9WA 3Q72A 1YJNA 3OIYA 2VYFA 1VQNA 1P2TA 2O5VA 3NKVA 4A8JC 3FP9A 3HOXG 4A3CG 1KSFX 1WDTA 5E7MA 2IUSA 3QSYA 3FKIH 3UDFA 1EIYB 5P21A 1MV5A 3B13B 2K4KA 2DGYA 2GK7A 3J81j 4RKEA 4EFMA 1QVRA 3DM9B 2VHQA 4OXPA 3D7MA 1XJVA 4UNSA 1OB2A 1UE5A 2ZJPA 2VO1A 4UNRA 1GITA 2JJ8A 1VHTA 2ZYTX 4JL8A 2O8CA 1B9MA 3KKPA 3K70B 1DS6A 4K0KQ 2K5VA 2R7ZG 1AQUA 1N6LA 1H9JA 2HIXA 2ZUBA 1DAHA 4BA1I 3VU9A 2NO6A 4LV5B 1TU3A 4LRWA 4PZLA 4CGZA 4PHFA 1B7YB 4QIWE 1C0AA 5J40A 2IWRA 2ODWA 3QENA 4A6PA 1CR0A 4LF7L 4CEIB 3T51B 4G5SA 1Z6HA 4CW7A 3EAQA 1NJGA 3TQYA 3ZYCA 3WY9A 1XEWX 2V6JA 4DT1B 3EPJA 1GHJA 1TEXA 5C4XH 3PCRB 1JJ2A 2YWHA 4JJZA 2ZTDA 2YV5A 1F2UA 4D26A 4OHZA 1TAGA 1OFHA 1US8B 4TLEA 4BECA 1G6HA 1D7QA 2V7QA 2GXUA 3VR3A 3U4QA 3TE6A 2JQOA 1TQ2A 4IPCA 3CXCA 1FJGQ 5SZIA 4OI4A 4QKQA 5BN4A 5GAHC 4OI0A 2FZ4A 3UKDA 2J0SA 3QG1A 1E99A 2WWIA 1E0SA 3DM3A 3AKYA 5EE9A 1E2EA 2YKGA 2WJHA 1YITA 2HLDD 2IHEA 4UXHA 3KFXA 4FN5A 4DCNA 1ZAKA 3K9LA 5C4JH 2V6IA 4QGFA 3R9WA 2VP0A 1CXZA 3H2YA 1TWFH 4ZCMA 4FMDB 1KI7A 3IRBA 2ZU6A 2K32A 3L0PA 4W7SA 3W5IA 2R6DA 3TLXA 1KQSA 3BRWD 3RRZA 3PEUA 3HOUG 1YR7A 5AJ3L 3M7NA 1M8PA 5FBQB 3EZ6A 4HUQB 4IW3B 1I3QH 4HJAA 2HLDA 1XNQQ 3A8IE 1E6CA 1GKYA 5DH9A 2KJQA 3OIVA 1H9SB 2J9RA 2Q2IA 1T8TA 2F3RA 2C9CA 4RZUA 1ONLA 4EX5A 4JC0A 4X66Q 2IUUA 2XGJA 1SZPA 1OHHA 2Z43A 1CIPA 2KENA 2VW9A 4L9SA 3NBFA 1KSJA 4WZAE 1NBME 4B3CA 2DFTA 2Z4SA 2ZI7A 4DXAA 3QF7A 2QNRA 3OTOQ 1G6OA 4K8OA 4PO9A 4BGDA 3I1FA 4A3EG 2UUBL 1K8MA 3SYLA 4BFVA 2GN5A 4AQYL 3T1OA 2UXCQ 4K46A 2VTKA 4Q47A 2WKPA 4EJSC 2CE2X 3EARA 1IBKQ 4RCYA 1QJOA 4E03A 1QHXA 1V8QA 5GVSA 2QTVB 3VKGA 2FEOA 1A8VA 5GJVC 2NO0A 1C7YA 3RNUA 1E9RA 1FQKA 1QF9A 1I94Q 1YJWA 2IYZA 1G4AE 2XZPA 4KSCA 1W36D 1Q46A 4R2IA 1M90C 5KSYA 1PH1A 4HZUA 1KOFA 1FOEB 4A3JG 1ZM9A 1JB7A 1N0VC 5IF9A 1ZW6A 2PT7A 4LFBL 5DLQC 4LF6L 1E2MA 3KKOA 4DR5Q 1QHHB 3B6EA 1PHJA 1FVIA 3T61A 2OESA 4DLVA 4AYXA 2ZRNA 2WIBA 3AVTA 3SBDA 5AWFC 3PJRA 4FCVA 3MEFA 3BB1A 4TMKA 2NTYC 2IYUA 3E2IA 1HNWQ 1KJWA 1VHLA 1DADA 3BK7A 3LLUA 5FUXA 4ZCIA 5FTLA 3AM1A 1DBSA 1EWQA 4GZYC 1SE8A 2E8GA 1W2GA 1TWAH 4DV6Q 1HPCA 2UXDL 1NKTA 2W2XA 1SKQA 4C0QC 3B1ZA 2HCBA 1GDDA 3WDNA 1FNMA 1NRJB 4TKOB 5M5WH 2JE6I 1T5IA 1CRQA 1ZU4A 2XZOA 1KXLA 3QKSA 4PHHA 1QVGA 1A4RA 1XD2A 5IP7H 1TU2B 3CPWA 1H65A 2ZSAA 2EXDA 4A3BH 1QG2A 4BLSA 4EQ6A 4DIEA 5JS7A 2GF9A 4BEJA 2IYYA 1KDTA 5GADC 2KHIA 1UAAA 3QNUA 5JEEA 1R8SA 1VQLA 5GAEC 4TTPA 1CTMA 4TL9A 1KI1A 2P5TB 4KKUA 2NVQH 2QQ0A 4LHZA 4HLQB 1AN0A 2BH2A 4H1VA 3P32A 2GEVA 4R9UC 4CT4B 2QSZA 1G3RA 2WOJA 2ZJYA 4HEJA 4QM7A 1MIUA 2BA1A 4GMDA 2MO0A 1HQYE 5BYJA 1COWA 4IHQA 1OHHD 1RIFA 4LUVA 2CNWA 1Q82C 3M3YH 1AKYA 2H8KA 3CB4A 2JA7H 3IGFA 1GKHA 4DLUA 4QC2A 4YONB 3PUYA 4G01B 1OYYA 2PX0A 3U7EB 4IJLA 2IS1A 2HHHL 4A3BG 2Q6TA 5KPDA 4ESHA 2DFLA 4QHTA 4DKAC 3SGIA 5J4VA 2D7CA 1Z6TA 4MRRA 4TL6A 4MYTA 3U2QA 3M4PA 4Q48A 1SKYE 2BMEA 1ESNA 1Y69U 3AF3A 1MJEA 4P3YA 4OHWA 1R5BA 3WMEA 2V8OA 1TWGH 1AZTA 2VSFA 3TSZA 1YKSA 1S0UA 2WM9B 1EOVA 1Q7YC 3FDIA 4FINA 4GBMA 4DCVA 1UJ2A 1W36B 1EFCA 2A19A 2VQEQ 3GJ0A 4TQUS 2MSDB 2BDTA 3ZD6A 1PH7A 1XD8A 3VR6A 3PUWA 4Y52H 1SVSA 1U94A 1US8A 2CDNA 2OFWA 4OQNA 1N6PA 4DSNA 4KYUA 4X8LA 4AG5A 4OHYA 3CPHA 3QKUA 1OH5A 4P0TA 2Q8IB 2JCSA 3KKQA 3TVTA 2AX4A 3R9XA 2EWVA 1Q20A 5FH9A 1FGUA 2FGJA 4HB2A 4YC7A 4C0KA 4F4CA 4Q7KA 3FTQA 1B23P 4B71A 2KA7A 2X8AA 1ONBA 3SBEA 3P20A 4BRWA 3K7AH 2WHXA 2ZS9A 3M4YA 4NZYA 4DV3Q 3HGBA 4JVSB 2F3TA 4NYMR 4KHPL 5LMNQ 1T91A 2ZRJA 2WP8J 5M5XH 1KHIA 2CEAA 2CVFA 2PBRA 3VDYA 1BMFD 1X3SA 2QMOA 1NVWQ 1FQJA 2W0MA 3IO3A 4Y0AA 3HPRA 2VP4A 3UWOA 1JR3D 4A75A 3O8BA 4JL6A 2QP9X 5J5CA 1CULC 3VHLB 4QNMA 1SR3A 3EZ9A 5DGXA 3VNUA 1Q12A 3JZMA 4IDQA 2F43A 5EUQB 3KKMA 5JJLA 3U61B 1ZJ6A 3HOZG 1SVIA 2UVQA 4QGUA 1NVUQ 5JSZB 4KLZA 5LB2A 3SS8A 1X56A 3VKHA 1XZQA 1YHQA 5DLQE 5EE1A 2FU5C 4X64L 2IXFA 2ZRLA 3THOA 4DCTA 1FJGL 1W4RA 4Q02A 3A74A 5JJKA 3GLHB 4Q1FA 3UG7A 2FFBA 4OHXA 2ZJZA 5IYDH 3GJ8A 3SHWA 5DE3A 4LF7Q 2HCJB 1ASYA 2CK3A 5C4XG 4FMCB 2O8DA 1TF5A 5M3MG 5AJ3Q 2QAJA 1VF7A 1L0WA 1LTQA 3DZ8A 1EQRA 3KX2A 3PEWA 3M0EA 4RZ3A 4NKRA 4UKDA 4OQLA 1ZRHA 4ZDIA 2AHOB 3CLVA 4QL3A 2IXEA 4TQAA 2AMCB 3K09A 3B82A 4Q9LA 1KKMA 1W0KA 2OILA 2REXB 1J8YF 3CR7A 5CK5A 4LNQA 1DXMA 1N25A 5FFMA 2ZJ8A 3OEHD 3TNFA 2QA5A 2WAQE 3DMDA 4NB3A 4AKGA 1W4AA 1XPUA 3RRNA 4DLSA 2AL7A 2K14A 2ZXUA 1QHHA 2FH5B 1Z2AA 4GZMA 3CF0A 2E76C 5CIQA 2XAUA 1PH4A 4DBLC 1FTNA 2ZM6Q 3AEZA 2GCOA 1NVVR 4JLOA 2JJ2A 1YVDA 3BB3A 2K75A 3TMKA 4JT4A 4OO1H 2R6AA 2ZS8A 5AUOB 3BFKA 4DB2A 4BBRH 2LXKA 5FR1A 4HB4A 1Z47A 2ZR7A 1E0AA 2GXQA 3VX4A 2NO1A 1HZCA 4IFDI 2O5JC 1U9IA 4XVUA 2YOGA 1E2FA 4IJMA 1RYHA 3KUCA 1XMQL 1E9SA 3K9NA 1X86B 3T1HQ 1A62A 1E0KA 1E0JA 1ZUIA 1GRNA 2OBNA 2VY3A 2WKRA 3FYHA 4I7ZC 1BBUA 3IDQA 1H9KA 3W34A 2ZRIA 4AYTA 1Z22A 1AIPA 2E2HH 2BMJA 4P75A 1G5RA 1JNYA 3B1WA 1U98A 3B2EA 5CJ2A 1IAQA 2OV2A 1EFRD 4B3XA 4BLOA 5J4HA 1VQIA 3TBKA 2F1MA 2ZSBA 3GO5A 3S2HH 3S14H 3BE4A 3L82B 2J7PD 4B3RQ 2PEYA 3G82C 4HIDA 5TARA 4LYJA 5IK2A 2JK8A 1D9XA 3GFPA 5KSPA 4HIMA 2CNWD 3MWJA 4HLUC 1KIXA 2HJGA 4A3GH 1XBTA 4B3RL 1D5CA 2PQAA 2DR3A 1G7RA 2XNDA 4ACBA 2UUAQ 4TLAA 3CM0A 5HY6A 1NY5A 4FXPA 3U5ZB 3LQRA 1N33Q 1IYUA 2RGDA 1G51A 3W9YA 3QF4A 5TDHA 1FTSA 2B8GA 3TREA 2FSHA 4JT2A 4RD4A 1VDZA 4AYBE 4A3EH 2J59A 3VR5A 1X54A 3LY5A 3RHFA 3U3MA 4DUGA 4Z1MD 5ELOA 4MA4A 4NPHA 5CM8B 4DLWA 4LV6A 1OFIA 1DAEA 2C95A 1LVGA 1P6XA 4M9XA 4DLYA 1YHBA 4UNNA 1ZIOA 5E7IA 3EWSA 2QY9A 4KFUA 1ANKA 4DNRB 1RW4A 4OQFA 2CCZA 1G3UA 1HTPA 1Y8OB 1FP6A 3GQBA 5FTMA 4OO1I 2JDIA 1VYUA 1E22A 3H1TA 3OEHA 1P16A 4JI2Q 4U00A 3CRW1 5FBLB 4DV1Q 4JBJA 4NTZA 2O8EB 4LK2A 1W0JD 1L7VC 1MRNA 4B3BA 2ZJ5A 3CCJA 3QIAA 1SXJA 4F4IA 4DR3L 1KI8A 2E1RA 1NLYA 4L16A 5FUYA 3CX7A 4WA7A 2ZT9C 1X8KA 1ZYUA 2A78A 4ESVA 4B32A 3JAMi 1RRFA 2G88A 5EXTA 4BY1G 3RSOA 2VF8A 2Y8EA 1QRAA 2KCTA 3PENA 3T1QA 1WB9A 1R0YA 2A69D 1E1QD 1GKIA 3PIPA 4PTLA 4PG3A 2Q9AA 3CIOA 3CCLA 4URYR 4EQ6B 3QKRB 4FD2A 1TQ6A 3VR2A 2KI5A 3IUYA 4A3KH 2J41A 3UE1A 3AV0B 3CMAA 4ARZB 1XDBA 5IP7G 1D2EA 3W1GA 1M34E 4K81B 1WCV1 4LOAA 3IEUA 5FTNA 2PQAB 1XJCA 4JI6Q 1TUIA 3QKTA 3GCGA 3BGWA 2BEKA 1SHZA 4LGMA 4TTRA 1NN0A 3JZAA 1ZNXA 2X2FA 2LSSA 3H94A 4NYMQ 4QBGB 1UDXA 4C3ZA 3H3VH 3H15A 3FHWA 2B8WA 1X1SA 4LDJA 4M0LA 1EX6A 4M1OA 1KHTA 2Q2HA 4YMUA 3RC8A 2GDJA 3UMSA 4EPYA 4PPNA 2IK8A 1E9FA 3TVDA 3HOWG 4FIDA 1M2OB 2GVZC 3K8AA 3IPYA 5FOWA 4EPTA 4KKTA 2C04A 2ORIA 3GEHA 1YZUA 1FUUA 2WB1G 3K7UC 1NMXA 1P9NA 2WOOA 4KSBA 1GUSA 3GJ5A 3C14C 1LF5A 3MWLA 1JMCA 1TEVA 3H0KA 3C5HA 3Q5DA 1IN6A 2VS1A 1IBLL 4PXAA 2ZETA 3CC2A 1I6VC 1KAWA 1G8FA 3FKSA 4G5GA 3LW7A 3W8RA 4KN4C 1RVDA 2W6ID 4QNRA 4OGQC 2OTJA 1BBWA 2WMNB 2IS4A 5EXPA 1CKMA 4UQOA 3OEED 2YOFA 4ZIRB 3BJUA 1E1OA 2ECKA 5FUVA 3SYKA 2JJ1D 1CRPA 1L2FA 2C03A 1W0JA 4I1VA 1S3SA 4BY1H 3I4NG 2NN6I 2ZSDA 1VQ6A 1MO4A 3LBHA 2WWXA 5EP1A 3U9SA 4OJQA 2IEYA 1KMHB 2R65A 3CH5A 3H4MA 3PIRA 4FMDF 4RY2A 1TUEA 2GNOA 1AKEA 2R8RA 2NPIA 2ZRMA 4DPGA 3AF2A 4TLCA 5LBIA 2HT1A 4ARZA 4X65L 1AE2A 4I1UA 4LF4L 2NN6G 1NVVQ 1RRGA 2TMKA 4II7A 1XMJA 4BRUA 5F9FA 1K73C 4GN3B 1KK1A 3UDGA 1OSNA 2IYTA 2BBOA 4IDOA 3K0XA 1WCMG 2ODBA 3K09C 4LJ9A 1HY3A 1E96A 1MJCA 3K0AB 1KAGA 4C2MH 4V0ME 4IXNA 1L1OC 2VPPA 1I4DD 3BFXA 1BVSA 4C4PA 2HYIC 3GD7A 3PO3H 1F2TA 1Q3TA 2FPKA 1G9XA 3RLFA 1VQGA 1J8MF 3LVQE 4YWKA 1OH6A 3STBC 2MNAA 2PZEA 3I4MG 2WB1E 3A8KE 2ZVQX 3AF1A 4EPWA 4IPGA 1SN8A 2YTYA 3EIEA 1HYQA 3QG5A 2F6RA 3KTAB 4GSYA 2GESA 2N42A 1XF9A 3NH6A 4U7DA 1CKOA 1SXJC 2C9OA 5G3ZA 5GVRA 4B75A 2OUKA 1XPRA 3LWNA 1H8HD 2NO7A 4GNXA 4LF8Q 1TQ4A 1Z07A 2IUTA 2XTMA 2R6FA 1VECA 1XMQQ 2RMKA 4NDZA 5AJWA 4YQFA 3FMOB 4DV7Q 4Q1BA 1U8AA 4CYMA 1LS1A 1KAOA 1YZQA 4X8HA 4LHXA 1EFRA 3WP1B 4JLVA 1HNZQ 2XJ4A 4IVRA 4DJTA 5C46F 4C0AC 3BORA 4NPSA 5DHFA 1QVAA 4MKHA 3NC0C 4ZO4A 3HKZG 2GTPA 4V0KA 5TV2A 2FFQA 3UXMA 1OKKD 1EFWA 5HZKA 3GTLH 3I4MH 5E95A 1X6OA 4JI1L 5FLXc 3EWAA 1H8HA 2JA5H 2DWOA 2ZM6L 2O8CB 1AGPA 3NVAA 4A0RA 2W2VA 2AWOA 4BE7B 3EZFA 1QBKC 1H9MA 2D62A 1C1YA 3UANA 2IC5A 4BFWA 1GTVA 1MABB 3QXXA 2I1QA 3GLHA 2A30A 3WWVA 4JI0L 1F48A 2V9PA 5KO2A 2VL6A 3LNNA 1GOTA 3J80i 1COWD 1O78A 4A4IA 1OKKA 1A63A 4X6AH 1UADA 3BB4A 4PC1A 1GNRA 1JE5A 1J6QA 1AH9A 4LWZA 2AD1A 2CCKA 3WMFA 2JLXA 1Y8PB 3Q5EA 2QL6A 4A2PA 1VQEA 2ZR9A 2VQSA 3L8YA 3T12A 4HLDA 3EPHA 3DKVA 2AXNA 2GA8A 2KWIA 4Q18A 4OQXA 3B1YA 2QGNA 4JYBA 4IDPA 4PFSA 1KK3A 1G16A 4RFSA 3LNCA 4D4LA 1A1VA 1PH8A 5DI3B 5C3EG 3FPPA 5IDVA 1P60A 3ZQ6A 2A69C 1N6NA 1R8QA 2N1BA 2ZJBA 4QHYA 1FZQA 1KI2A 4S35A 1PFSA 3BWDD 4PQYA 2N49A 3J7ZC 1WOCA 1VQAA 1W4BA 4LJYA 1XU4A 4E07A 2OAP1 3R8FA 1VQOA 1QHSA 1DO0A 1XD9A 3UPUA 4NCKA 3BD9A 3ND8A 1N6RA 2GETA 4BFYA 1N6IA 2D2EA 4RFVA 4A8JB 4P32A 5JLJA 2XSZD 1KD1C 2QM8A 4ITRC 3F2BA 1ELOA 2XZLA 1T5LA 4UJ3A 1K9MC 1ZM7A 2A6EC 4JBMA 3AB9A 3J81i 3CMEA 5IE8A 3CCUA 1YU9A 2CBZA 2H5EA 3U50C 2ZQ5A 2ZREA 4G5OA 1QUQB 4JLDA 4AK9A 3EPKA 1GP2A 3IILA 3L0SA 5TMPA 4EKDA 1RE0A 2JA5G 2R2AA 2WVJA 3OESA 4BFZA 4LF5Q 3NDBB 3GP8A 3MWYW 4BWYA 4DV3L 1Z08A 2NQ2C 1DCZA 4TTQA 4GT1A 1LYLA 5GJCA 4FW9A 3D0FA 4IFDJ 1ZM3A 2W83A 3ONWA 3CQZH 3KLRA 2QAGC 3ZZUA 3HFZB 4B3TL 1N33L 2XJ9A 3NBYC 4TSFA 1JQJC 4PQRA 1UF9A 4HAWA 2ONJA 3W1BA 2WBLC 4LZZA 4C0JA 2DFKB 2FPMA 3J81k 1Q90A 4M9ZA 4XSGA 4M2LA 4O3MA 3IBYA 1SRUA 3F8TA 3AVYA 1E2ZA 1WXQA 1UKYA 2X19A 4YY3Q 2L0XA 1PV4A 4M1YA 2Z5FA 4Q4HB 2NO9A 4HJ8A 4HR7B 2Q9BA 4POAA 1KGDA 3U44B 2I1VB 1CLUA 3B9QA 1CJMA 3V9PA 1RC8A 3GMTA 4NYIR 4LF5L 4D0LB 2K52A 3A4LA 4C0HA 4QM6A 1OXXK 3W3AA 4OWTB 3ULJA 1TF2A 2ORWA 3HU3A 4NE2A 3B60A 4PAMA 1PH3A 1W46A 4HI0E 3E70C 1CKNA 1OIVA 1IOZA 5JI2E 2WWWA 1VCMA 1Z6YA 5D3MB 5LMUL 1Q86C 4C0BA 4DLZA 1OFTA 3QPWA 2HHHQ 4A3DH 3BFVA 3OPOA 1Q81C 3I92A 4DLXA 1YNNC 2ZJQA 2QENA 3GLFA 3G5UA 4B35A 2RB4A 2ERXA 1UEBA 3R8CA 4GN4B 2N46A 2DFNA 2K5UA 3VTKA 3GLGB 3JAMc 1EUJA 2ZVPX 4RCZA 1S96A 3OAAD 1VG9B 2GWHA 3RS5A 1FL0A 1AGRA 2J45A 1Z63A 1QUQA 1KK0A 2JA1A 1UFQA 2YU9H 3TSWA 2ZUCA 4B34A 2QMHA 1N3BA 4M1MA 3THYA 3QXSA 3KL4A 3FB4A 3AQQA 3SJCA 3KFUA 1UKZA 4JVMA 1ZCBA 4IFBA 4POGA 4QFMA 5J4YA 3LGJA 2VP6A 3UE0A 5B2ZA 2MMGA 4B2PA 4DV0Q 4LW1A 3ZJYC 1G1MA 2EFHB 3AVPA 3A8JE 1Y63A 1NLFA 5AJVB 4CDGA 3A7LA 1T9HA 1GNQA 1BO6A 1IM2A 4UP8A 5G40A 4HAVA 2P6NA 3R9IA 4BFSA 3HOUH 4L5BA 4Q4JB 4WXPA 1JAHA 1MO5A 2G77B 1VKJA 1A2BA 1HH4A 1HCZA 1NG1A 4XSHA 5L3QB 2L5TA 4JI7Q 3RRYA 1H9RA 2QMEA 5B64A 1GIAA 2FSGA 2YC4C 5JHGB 2BKEA 3P4YA 2EVWX 4CF7A 4A3IH 4M9SA 3L0IB 1X6VA 4B44A 1JJ7A 1WBBA 1YJ5A 3U44A 4A92A 4Z51A 4UP9A 1O7LA 4F38A 2MSEB 5IY0A 2E74C 3CCRA 1XMSA 2J0VA 2RGCA 2A6ED 1N5KA 4NBSA 4QJ4A 2FWRA 3ZQJA 2PCLA 3HOXH 3RDPA 2I5HA 1VG0B 1E2WA 2CWPA 2VUMH 2ODEA 4AD8A 2YWGA 3ZVNA 4P72A 4P71A 5D3MA 2G9NA 5KNBA 4C7OA 2RHSB 5EUMA 1N34Q 1Q8KA 2EJMA 2QRZA 4LFBQ 3ZIAD 4XTCS 5JFGA 3TUIC 4XD7A 4LJ8A 4DR2L 1DAIA 4D4KA 1N32Q 3PGZA 1EX7A 4LBVA 4B3FX 4QGHA 1SLJA 4YCUA 4LJ6A 4KN7C 3TJZA 4JI4Q 2HF8A 5DYIA 1YE8A 2FV8A 2GJAA 1HR0L 3HOYH 5DI9A 1JXMA 1GUGA 2UUBQ 1ZC3A 4YWMA 3SEAA 1YEZA 2V1XA 5TB5A 1FL9A 2D0OA 2Q2UA 1IHUA 4EUNA 5JBQA 3A58B 4KFSA 4HUTA 4JI0Q 3NDPA 3ZIAA 5M3FG 3KXLA 1I5FA 3T5DA 4AIIA 2OM2A 1DPFA 3KDFA 2GBLA 2YZ2A 3WYGA 2PI2A 5IWAQ 3ZZTA 3RSLA 1KL9A 3GTPH 4C3IH 2I5LX 2P3SA 2QTFA 3PO3G 2JLQA 4JVLA 4M9QA 4EAQA 3QEJA 2I3BA 4YMTA 4OWXB 1U8ZA 5IWAL 1UDWA 1XCPA 3D8BA 3KQNA 2GEUA 1KI6B 3CRMA 3HDTA 4F91B 4RCNA 3AEVA 1GUOA 4PC6A 5EP2A 4PZZA 4KHZA 1KJZA 1BKDR 3QE0A 2WJYA 2A3RA 1VQ8A 4OK6A 2GZDA 4ACAA 4HAYA 1NMZA 1MRSA 4JG2A 2QM7A 4J0QA 1GM5A 4DK0A 2PPBC 1OIWA 1T8UA 1NSFA 3IHLA 3KB2A 3NWJA 4WXRA 3C16C 2IX3A 4LF8L 4JBYA 1GNPA 3C41J 3REFA 4B74A 5GADl 5K36G 1OPXA 3NENA 2ZAMA 4G3XA 1CKEA 2FNAA 3K0FB 4ZI2A 3CNOA 4DV7L 2YTXA 2GILA 3CZQA 4OKSA 4URXR 1U99A 2OCPA 4TL8A 2EU8A 1R7RA 2RAPA 3RYTC 3ZVMA 2O8DB 2D3WA 1HT2E 1VG8A 2J7PA 1CU1A 3WXMA 2A5DA 2Z83A 3HOVG 4DC9A 3NBXX 1Z9FA 3OIUA 3Q3JB 2J5XA 3K8YA 2C77A 2K5NA 3NIBA 2QBYA 3HU1A 4OL0A 1E4VA 1KZ7B 4IOKA 4DUZQ 3LBNA 3LX5A 4ZDJA 4IEEA 1HNXQ 1A7JA 1GUTA 4DKXA 2XNSA 1Q1BA 1K5GA 3HOYG 4QY7A 2IEZA 3CRRA 4BXXH 3QXHA 2JAQA 3HOZH 4MH0R 1ZD8A 4HATA 3TR0A 4DZZA 4DAMA 4MRPA 3SJAA 1ZM2A 3I4OA 1XEFA 4IOMA 2BBSA 2ONKA 3U3KA 5FLMH 2V3CC 3BZCA 4TYQA 1S3GA 4M1SA 4B47A 2ZYWX 1QVFA 4FWTA 2CVHA 4KLNA 2YWEA 4L5QA 5F2EA 3PUXA 5E7JA 2ZRFA 3KF8B 2AK2A 4P4TA 3GLGA 1JEDA 2IX1A 2V7QD 2WPDA 2GAAA 2QI9C 1KI4A 4PO1A 2OFXA 2E75C 1D2MA 1E2IA 2PX3A 2G1JA 4NXNL 1Z0KA 3AB3A 3PG5A 3U4QB 4DR4Q 3D31A 1CTQA 2C5LA 1BMFA 2VNUD 5IYCH 1WQ1R 4DCUA 2IL1A 2QT0A 4QGGA 4BBSG 4JI5L 4URWR 3WBKA 2PMZE 4D25A 1XX6A 2JIZD 2A6HC 1T3HA 5CYPA 3KDFB 3I55A 2BEJA 5AJYA 1YHNA 5LMNL 2LWIA 2GCNA 5IYBH 4IEIA 3LO5A 2BM1A 3SHFA 2UUCL 1BH2A 1NF3A 1S9HA 2NOAA 4Q1DA 4R71A 1T3LA 4FMBB 3U3OA 3T56B 2WFWA 3EXAA 1S9DA 3UMRA 3BZKA 1ZUHA 1FMLA 3CUEF 1E2DA 1KTVA 2G0TA 4KFRA 4YMSA 4F92B 2QBYB 2JIZA 1G8GA 2EW1A 2BMDA 3VKWA 4DUZL 2CLCX 2WICA 1A6XA 1DTSA 1NIPA 3R20A 4CT5A 4DVGA 2ZJRA 5IK2D 2JEOA 1YJ9A 2QN6A 3K0AA 1NY4A 2OCEA 1XEXB 3DLLA 1IL2A 2NZJA 1KDOA 1HA3A 4ZIRA 2R7DA 2GVBA 2RHQB 1IONA 3DZDA 1ODFA 1G3IA 1E7ZA 3U4ZA 4BZQA 4GDFA 4Y7NH 4BZPA 2VA8A 3DDCA 4YCWA 1DGSA 3S15H 1P2UA 3PV0A 3SDZA 1T4GA 3UK6A 2O8FA 4A3MH 2WJVA 2ZRAA 1Z8FA 2NGRA 1N9WA 4R2HA 1G3QA 3U7FB 5JCPA 3ULLA 2W58A 2R62A 3FVQA 2B8FA 1W47A 4GN5A 1VQFA 3U6BA 4FCWA 5C4MA 1K0RA 5FTJA 3AVQA 1NBWA 3LV8A 2IF2A 2OXCA 3IHWA 3NG1A 2OHFA 4IFDG 1N6OA 4TMVA 4A3FH 5JECA 5KSOA 3GFOA 3AVUA 2OZEA 3NXSA 1U0LA 2VP9A 5KNDA 4JVNA 4LFCL 1A5TA 5FPHA 2G0NA 3RNLA 4NYJQ 2ZTEA 3H0GG 3J80c 1AZSC 1W44A 3E9HA 2DUDA 2JJQA 2BDOA 1Z29A 2JA6G 2ORVA 4C7OB 1AE3A 4LYAA 3O8DA 4C2TA 1XB2A 1Z0JA 5FJ8G 4KODA 4HIKA 1E2PA 3FHCB 4P4SA 4NMMA 3I4NH 2OTLA 1DAKA 1NJIC 3DOFA 4PSVA 1YBYA 4PHTA 4R4QA 2F1RA 1DELA 4TYWA 1VPLA 4JOIC 1N5JA 3B8HA 1AA9A 3A6PC 4GP6A 3IIJA 1T5EA 3BERA 4A93G 4A3JH 1VQPA 1R2QA 4ZKEA 2EDGA 2ZE8A 1XD2B 1X3GA 3ULPA 2HUPA 3G4SA 1ZNZA 3HYRA 4LYFA 4IPDA 4ZV4A 2UUAL 3FPAA 5JZVA 5F98A 1VQMA 4GFDA 3DMNA 2E5LQ 1ZVQA 3OE7D 4GI7A 4DR3Q 1SQ5A 3PITA 3LFUA 4KVGA 3RWMB 5C0XJ 4Q9IA 1XXHE 4DV5Q 1KDPA 1GWNA 2I0QA 2QEXA 1OF1A 4MYUA 2JASA 2BMFA 1ZP6A 4GNKA 5K8LA 1UM8A 2IA5A 2D4HA 1GRRA 4LJ4A 5A35A 1II9A 2AD5A 2FG5A 3ZVLA 1OTCA 1AQYA 2IWHA 1H8EA 4A3KG 1TU4A 3V4RA 4X62Q 1QZGA 1IN5A 3CC7A 5BQ5A 1CS4C 1OXUA 3OE7A 4FWIB 4JSTA 3K0EA 2C99A 3PUVA 4GRAA 1VTKA 3WMGA 2RGGA 1Z3IX 2V1UA 1P62B 1QHYA 4TVAB 4APVA 2V55B 4O2RA 3WNBA 4ZKDA 3B9PA 2D7DA 3BJIC 4XVRA 3ZS8A 4GPTA 4X8OA 2KCCA 1TNDA 3VFDA 1E1RD 1CSPA 2HV8A 1BDOA 2QU8A 3L7ZC 4OX9L 1BYIA 4A2WA 5C0XI 4LF9L 1JBKA 2J3EA 3S1AA 1TQDA 3GTKH 2V4ZA 2GCOB 2EJFC 4L8GA 3CCEA 1ZU5A 2IT1A 4ZDKA 3LXRA 2NVYH 1KMHA 2NMVA 1N8RC 5CB6A 2OT3B 4TSFD 1KKLA 4IFEA 1ASZA 1IY2A 2RCNA 1HZBA 3EIVA 3H3VI 2CL0X 2G1KA 2ZS7A 4Y0VA 3AFQA 3FHOA 5H68A 4BEBA 4MRNA 4C0SA 4PR0A 3KQLA 3S1RH 1KK2A 5C44H 3NEMA 1I2MA 1WF3A 2O52A 2P67A 1OXTA 3A37A 1VQ7A 1DAGA 3RN5A 1UEJA 3KQUA 5BYKA 4V03A 1FMJA 1XTDA 1KDRA 1M7BA 2EQBA 5DN6D 5JEDA 3O8RA 5K8TA 3IFTA 1LM0A 2F4VQ 1G6PA 1EK0A 1IXSB 1E2QA 2ZRCA 5JS8A 2OFOA 5JEAH 3A4NA 1EWRA 2VBCA 3NELA 2GJSA 3Q85A 1XPOA 3T1YL 1FP7A 2CFMA 2WAYA 1KO1A 5A4JA 1CEEA 4UXJA 1LACA 3QPUA 1KRSA 4A9AA 3WHKA 1VQ5A 1RIPA 2EIFA 3GEEA 3T1VA 3EG5A 4DR6L 2E87A 2WWYA 3N2EA 4DR1Q 4IQZA 1G17A 3S24A 1NIJA 2RGAA 4YHHL 2WJGA 3LVRE 5KDOA 2A2ZA 5EXSA 5M04A 3VX3A 2IYQA 3C15C 4AYBG 3H86A 4IPHA 4MDEA 1E2HA 3I56A 2FE4A 3I3SR 1NY6A 4IKEA 2J1LA 3O47A 1X9NA 3CONA 4KCGA 1XTSA 3ICQB 4NYIQ 3CW2C 3EBEA 2HIVA 1E79D 5IRCD 4NHOA 4A0FA 3HKSA 3N70A 4DT1A 2KBNA 1EQQA 1N5LA 4NCJA 3GFTA 3WRXC 1KO4A 1D9ZA 1CSQA 2ZE7A 4DDUA 5EE3A 2JA6H 2ERYA 4HZIA 1NL3A 4PAQA 1II8B 4HUQA 5AJZA 1D6JA 3SQXA 4NCNA 2IS2A 1MOZA 1SMYC 1G41A 3HKZE 2L15A 2DBYA 1N0UA 1GSIA 3CCMA 3A5UA 4MGYR 4JI7L 2QP4A 1IN8A 4B33A 1G18A 3PF4A 2CMKA 3SN6A 3S2DH 2ALYB 2JLSA 3KF6A 1P3JA 4HDQB 4TMZA 1O87A 1E3MA 2PLFA 1W36C 1PZNA 3AQ4A 5KTYA 4MITA 4JBKA 1HNXL 1KNXA 1IXRC 5FLMG 3F1ZA 1JJVA 4E5UA 2CHQA 2ZJAA 1UKEA 3WBJA 1XMVA 3FFBA 2R7FA 4H9GA 5IYBG 1P61B 1LTLA 1IW7D 2GAOA 2YJTD 4ILEA 1Y1VG 3AKCA 2A7QA 4BY7H 1EXMA 1XRJA 2ID0A 4XWKA 1TXYA 1WJJA 3S17H 4CIDA 1TX4B 2UXBL 1HV8A 2A5GA 4US1R 4YMVA 1S4QA 2JDID 2ZEJA 2IYVA 3QVVA 2ZUDA 4I1SA 2HEIA 1CP2A 1WFQA 2C96A 5HKKA 4NYJR 1W48A 5EE0A 1X65A 1HNZL 4BBSH 3M6AA 4EPVA 4LK1C 5H8WA 5JMTA 3UDIA 4IOJA 4J15A 4Z1MA 1HH2P 3T15A 3VR1A 2VEDA 1Z6XA 2CWAA 5ELXA 2RKOA 5FOTA 2PEZA 2IYLD 2WSSD 2ZRKA 4PZ8A 5C0XG 3RVBA 3DOEA 2ATVA 3U4VA 1NKSA 4RJLA 4IDNA 3RLOA 4Q9KA 4Z8YA 3RS0A 2YHSA 4B76A 1RL2A 1U2RA 1U8YA 5BXQC 3IO5A 4YWLA 1G8HA 4OK5A 4Q66C 2UXBQ 1JALA 3NTUA 5GJBA 1G3MA 2R7ZH 3PSIA 1EWIA 1LNZA 3CPEA 4YXWD 2OLJA 4BBRG 4QG7A 1SKYB 1NN1A 1R5NA 2VZAA 2D06A 4D82A 3WRYC 221PA 3UDXA 2JLUA 3MJRA 1M74A 2BCJQ 3CCSA 3CRLC 3KF6B 2W6JD 1G64A 3Q7PA 2PNRC 4W5WA 1Q44A 2Q21A 3K1JA 4G5RA 2A9KA 1LUZA 1XCGB 3CWQA 3SI7A 3C5CA 4KLKA 3IIKA 2O0KA 4TZ6A 3I32A 2VHUA 2CLSA 4DR7Q 2GVDC 2VP5A 3GLIA 5LD2C 3F2DA 2CLDX 4FCTA 4E09A 1AS0A 3VAAA 3I8XA 2G6BA 4GLVB 2QA4A 3L43A 4G7ZC 4NXML 1RJ9B 4DR7L 2FSFA 2RHDA 1XMOQ 3HOVH 1II8A 1H8ED 1W3SA 1XTRA 5E4FA 5FJ8H 3OW2A 2OEPA 2QE7A 3MG9A 3BC1A 2UKDA 5AUPB 5JSZA 3THXA 1L1OB 3W5JA 5EE5B 4LF6Q 1OXVA 1NMFA 4M22A 1Z0IA 1ZIPA 3A1VA 5JWOA 4DLTA 1D8TA 4MRSA 1PH6A 3FFAA 4JK1C 2XB2A 1IZ6A 2F55A 3L2OB 3QUSA 1VF5C 4E22A 5F9HA 3GJ4A 5FI0B 4JLAA 5LPNA 2O8FB 4CEHB 5C0XH 4JV5Q 3QXJA 2Q3FA 1VQDA 2AFIE 2RGEA 1DARA 2ODNA 2O8BA 4L5RC 4DUYL 1VMAA 2CHGA 4GLAC 2ZJOA 1E4YA 4DK1A 3QY0A 4JV5L 3QKRA 4XVQA 5KOYA 1ZD9A 2HJVA 4DK3C 5CDFA 4R98A 1HQCA 4X64Q 1HE8B 3IEVA 4MYCA 2A8VA 3TEHB 1N0WA 5M3FH 5TXGA 3RABA 1II0A 4DDTA 5CDFE 4GOKA 2AKAB 3D4RA 3AP1A 3KDSE 1YRAA 2QAGB 4DEXA 1YIJA 2HDNB 1KIMA 2VIIA 5JCZA 3GLFB 3TAHA 1DEKA 2BE5D 3TUZC 4PZYA 1RYFA 3E5HA 4KXFB 5J4LA 4C3JH 4KHPQ 1XNRQ 2FFHA 4A4DA 1M1YE 4DUYQ 1HR0W 1HURA 5CJPA 5FPTA 1VQKA 4M1KA 4O2LA 2ATWA 4HIOA 3M1IA 4Q21A 4PANA 2DY1A 5DI3A 4POFA 3CR8A 4GMXA 4JZKA 3W8NA 5EJEA 2UU9L 3CPFA 2PH1A 4DSUA 2LMCB 1HTWA 1E9CA 3BU2A 1IBRA 1NN5A 3EW9A 4B48A 1IBML 1XTJA 3I8SA 5C4GB 2R6CA 5CYOA 5JHHB 3I72A 2DWQA 2ZTCA 3FMCA 4KAXA 2ATXA 1TPZA 3K0CA 1YR6A 4O2DA 4C9BA 1UEIA 4PV1C 4PAOA 1GL9B 2JJ1A 4PPFA 1RJ9A 1YZTA 2A5YB 1L8QA 2R6GA 4CVNA 3PEYA 1LW7A 2QP3A 4B3TQ 1XCMA 2ZITA 5FBRB 3K80C 4FMCF 3V4FA 3KFVA 4JLNA 3JVVA 4OQMA 2W2TA 2G3YA 1L4UA 2D74A 2H5XA 2OLKA 821PA 5C44G 2P0EA 3S1NH 3F2CA 2IY5B 3D3QA 2K50A 3FKSD 2I5MX 4EPRA 2KHJA 1PYBA 2PT5A 5EP3A 3A5ZB 2PNHA 1M7HA 3AP2A 3UATA 3CAMA 1P9WA 3FMPB 4O0AA 5M3MH 1RRPA 1JR6A
chains in the Genus database with same CATH superfamily
1C1DB 2AN9A 3RYCB 3GN1A 1YS9A 4FILA 2V4UA 4P3PA 1IW7C 1IAVA 2GZ1A 1HG0A 2NZXA 2MMCA 3BUSA 1P7YA 4D97A 1AM4D 1NR5A 2XE6A 3W6OA 1IXRA 2X69A 2ZTHA 3GJTA 2A86A 3RS2A 2JHCA 4JLKA 4O33A 5D6NA 2RHTA 2QQ5A 1H94A 4WXEA 3FCYA 5HF5A 1P2BA 5HBRA 2HK7A 4CEJA 3OKCA 5FOVA 1GYPA 4H0NA 3SSAA 4YXWA 3ZD9A 2A0FA 1BA3A 3IOYA 3H2SA 4HZUB 1KIAA 1YC5A 3WZMA 1FU7A 4BFCA 1A7AA 4H44C 2AN3A 5JXIA 2VTDA 3JQAD 3QU7A 4RD1A 5K6RA 3V2UA 4E08A 5KX5B 5AI0A 2WKQA 1VSVA 3KZKA 4B6JA 2XCIA 2BJWA 4KJOA 4WBXC 4IURA 4UTVA 8ABPA 1FZTA 2B92A 4LKRA 3NXKA 4L3WA 5K3FB 3SC3A 3PHIA 1USKA 3DVQX 1BYUA 3BJMA 4JI4L 1K83H 2EHDA 2OD9A 1I0IA 1VG1A 3O90A 1E18A 4FLEA 5JAVA 5I9TA 1MKHA 2Y1LA 1A3UA 3DO8A 4FUQA 4TKUA 4FXOA 1CA6A 5JXGA 3ADCA 3AYHB 3VAYA 3GCDA 4KITB 2X86A 4H4CA 4UM8B 3UAWA 3FN4A 4V1CI 1A8SA 4FBGA 4BBZA 4TKMA 1ZMRA 4Q01A 2PCFB 5JEAJ 2FEMA 2GK6A 1S2LA 2QF7A 1U0FA 3F5FA 5FPPA 3T3PB 4B6QA 4YJ2F 1EQTA 3OFND 3THYB 1UJBA 3E2MA 4O0LA 4BNLA 5IXJA 3N2ZB 3N8IA 4UCWA 1WYDA 4LWOA 1QWYA 1Z2CA 3PSHA 2MR5A 1J9OA 1I2DA 4U0KA 4PWZA 1SMKA 4L8LA 2NXJA 4CLRA 2B4RO 2JARA 2TMGA 3IKVA 4OI2A 1X7XB 1RZRD 2YFQA 2PQ6A 4LFAQ 5FA6A 1W76A 4G0VA 2CHBD 2FMFA 3LDAA 4HEDA 3HNPA 2Y0SE 1LLUA 2JHGA 4HLCA 3KF8A 4C89A 5LMNW 1HDXA 2O23A 3QM1A 3W5VA 1PT6A 3SICE 1AF7A 4CRWB 1Y8NB 1XTUA 2A1IA 5ALLA 3RF6A 3Q9LA 3UJPA 4A82A 3RHFA 4M9CA 4Q7QA 3C3JA 4RFSB 1TO2E 4R16A 1NFFA 5DM4A 1G8ZD 3BCRA 2Q07A 3A7AB 1TLLA 2YQ4A 1HYGA 3J7AF 1K6JA 2FQQA 1FTWA 1EWYA 3BSFA 1OT5A 4KXWA 5JO9A 2YMMA 1JEEA 1FS5A 1XZLA 3BHNA 4IV5A 5DISB 3BS1A 1CR2A 2I62A 3ANXA 2G9HD 3U0VA 5JMOA 2BCGY 1AEXA 2E4ZA 3I76A 3PFHA 4F88A 3VSBA 2F1OA 3MWDB 3KYCB 4O02B 1OFUX 2BP7A 2ECFA 1QG4A 2BGWA 4X7RA 1IYJB 5EUBA 3CX4A 1A2KC 3ZGZA 4HH4A 1PH2A 3VXKA 1BC5A 3I62A 1TA4A 1U2PA 4XFKA 3SBOA 5ADWA 5FPSA 3NTHA 4G0NA 2EFCB 1GR0A 1Z2OX 2AWNA 3QVJA 2Q5EA 2ZJ6A 1P4SA 3MHBA 1RM0A 2Y0BA 2DHDA 1NW7A 4OQ4A 2DFDA 4A3MB 1I4PA 5JPMC 4OWWB 2R92H 2FWBA 2IHTA 2J6BA 3LDFA 3PTLA 4R5HA 3O3NB 1BRTA 3H5VA 2A59A 1SOUA 1GL6A 4LV8B 4RVGA 5AM4A 1JXOA 1WUYA 3A6JA 3COYA 4G1UC 5EIEA 5ERXA 2Z9CA 4P36A 4CLEA 5D65A 1A0IA 2OHIA 3BXEA 4I7AA 2G72A 3CJTA 2ZRDA 3DOHA 3GEGA 4GP7A 3SJUA 4BMNA 4R1SA 2IS6A 5BWMA 1MX1A 2J4DA 3LKDA 3SOZA 2W6ZA 3EROA 4YTEA 2P77A 3QFCA 3FROA 4JJKA 1RKVA 1TI7A 4HEQA 4PIVA 1Y33E 4ZCLA 2IOYA 4C6HA 4DMKA 1R5JA 4WBNF 2YWDA 1L2TA 4JSYA 5BT8A 1UJNA 4A3DB 5DXJA 3KCNA 5HFAA 4DR6Q 3RVNA 3L6DA 2IHUA 2YVAA 2IEGA 4F0JA 2VUIB 1U0SY 1ES9A 1EIFA 1MT0A 2I71A 1DKUA 1L7MA 2X8JB 3CX3A 1NW5A 3TIFA 3GY0A 2J3HA 4KGXA 5EI5A 3SX4A 3WLKX 3AXSA 1NTGA 1XN4A 3ZDZB 3BZDB 4TPKA 3LUDA 2P9QA 4EW6A 1H2AS 4DUZB 4LJZC 3C5VA 4LZAA 3ZJVA 3HCPA 2CXUA 2Y1KA 3VQTA 3ZY4A 5ES3A 4CMEC 3NDIA 3WLFA 5K0CA 2PZFA 3ELDA 1S8AA 1V8OA 3TGLA 1HJPA 1AQLA 3KDPA 4WK0B 1MX5A 2I4NA 5ALPA 4BFXA 2EC5A 3MTAA 4ZTUB 2ZBVA 3NHAA 3WYFA 2XMZA 4RMIA 4AY2A 3MAJA 1IATA 3CZ4A 4J94A 1KI6A 3FGNA 7AT1A 2PUHA 2NSYA 3AEUB 3M9BA 3J7A5 1GG2A 1QLJA 1Q6ZA 1SCBA 2P2CA 3K0CC 2D5AA 3K96A 3UMBA 4US2R 1EVQA 3BKWA 1KJ9A 4RXTA 5FYQA 5K2MA 3TOSA 5I9SA 3IOMA 5IYCG 1QRDA 2I80A 3WX0A 3KZNA 5DWDA 4Q4AB 2ZIAA 3IQGX 2BKUA 1PLLA 3A1WA 4FFRA 3DMUA 5EKXA 3CLKA 3NT4A 4J0JA 1JLLA 1TS5A 3OZVA 2L1BA 3PIOA 2WV9A 2XITA 4IYRA 4RZUA 5DX0A 1YFLA 1LU9A 4ZT6A 2VHXA 4KREA 1OW3B 1DB3A 3HA2A 3IPRA 5LJLA 2F17A 2ZIUB 4J8PA 1EIGA 1TVXA 4W5HA 1X7YA 3UJNA 3IALA 4YCVA 1H42A 1S01A 1FC0A 5JAQA 3CRNA 4AH6A 5LKAA 4MYDA 4TMXA 2YC2C 4GSLA 3C39A 4XH9B 2Q2NA 4QHSA 4D8YA 1MAUA 1U4SA 5EIFA 2ZAGA 3SG0A 1WDLA 1AS2A 3A1NA 2FXIA 5FL7D 4ARCA 2R44A 1BVUA 1ID1A 1KAMA 3KKNA 1R1DA 4HMPA 4C76A 4IJHA 2LR0A 4MI9A 3U62A 5AVRA 3HWSA 1XNQB 5DNCA 1T0JB 1VKRA 1AQIA 2HU8A 4ZALA 3RJ9A 3KJGA 1SEPA 3TS1A 2F43B 3GP7A 2WAQG 1R0ZA 4FR5A 1AUQA 1XZMA 3PUZA 1RRVA 3OCUA 2GKOA 4B7ZA 4C5CA 5CDTA 1MJGA 5MN4A 3DUZA 3DEPA 2ZSIA 1CQWA 3PIIA 3KQMA 3IQXA 3IJRA 4WI1A 2FI1A 5TMEA 1N9GA 3SK0A 1T0BA 1F2UB 3QH4A 4LG1A 2QORA 3L46A 3PEVA 3ZLUA 3M85A 5BR8Q 4MO9A 4EB6B 1X1BA 3RUFA 1RHUA 4H3KB 1KRTA 1XDWA 4C3HH 2HQSA 3DAFA 3FUVA 4JI1Q 3OI7A 1T6XA 3EXIA 1UWVA 3OX1A 4XM2A 3W0LB 4DPKA 2EEZA 4EF6A 1M1UA 4HN2A 4YWHA 1S89A 3R7WB 3W2HA 1FYCA 1WZNA 1ZNWA 2ZZMA 2OCXA 1EX1A 2ZJ1A 2V9CA 2JLZA 1YFJA 3H16A 3CKYA 4Z3KA 3EYWA 3ROQA 1C9EA 2FPUA 2K5HA 4LSMA 5EPEA 5MN6A 2CK3D 2FRDA 2I6UA 3OETA 1V41E 3CD6A 1WY7A 3PFCA 2PBLA 1EVLA 4XD7D 4D1YA 1J0EA 4IJVA 4PVCA 3FGZA 4ZJYA 1ECPA 1SXJD 2M98A 1KEPA 5IZ4A 4AVYA 2B8TA 5K8UA 1D8LA 2ZI3A 4DIDA 3AVWA 1ZN8A 2I2FA 2OM6A 4GC5A 1G7SA 1XMPA 2Z6UA 1S40A 3D3JA 4TTVA 3KELA 3N7UA 4LMPA 2FX3A 4PC3A 4MVCA 4JKIA 5E4JA 2A1UA 4YRDA 1VJCA 2X13A 2ZG6A 4YPVA 1JPJA 3VNSA 4O1NA 3RYIA 4MIKA 1QQ7A 3W4IA 1QB7A 1KH3A 2IIPA 1UMCB 3IAS1 5K6TA 4Z1MA 2H1LA 1PDQA 1NW4A 2CLEB 4P53A 2DT8A 5HIJA 1KOLA 3ZHUA 2AMFA 2XKJE 3GBPA 2DHRA 1YRBA 3QYAA 1GSOA 4G1FA 3ZDFA 4EZEA 4M37A 3OSZA 5LWHA 5CR3A 2G5TA 2FDRA 3NOOA 3O1IC 1NQ5A 2VAVA 2B63B 3H09A 4LJLA 3G6WA 2NZVG 3X1XA 2UAGA 1KZ1A 1MU0A 1PFKA 3LC1O 5I4BA 2PVPA 3F98A 3AG5A 3Q7EA 4C22A 2SCUA 4W5QA 3LXUX 2C4KA 1M6NA 2Y1CA 3COJA 4QBHA 4PC7A 2J33A 4RHYA 4KQWA 3X1YA 1RKBA 3ZGYA 1PJRA 3H4VA 1DDIA 3OF5A 4F4JA 1M1ZA 1PWXA 3X2SA 4KHVA 2WIAA 3K6OA 3JQ8B 3OQ1A 3Q6NA 1QP0A 4I4TB 1IPEA 4JB8A 1D09A 1H66A 4KUHA 3GJ3A 2WACA 4TMTA 1PYSB 5JAUA 4L8JA 1BCSB 5AKIA 1QCDA 4P31A 3E61A 4RWZA 4FCCA 2YYZA 1XXHA 3EGEA 4UE3S 1U0TA 1N33B 2IBSA 1U7ZA 4FP5D 4G9EA 2P6UA 1H4TA 4JH0A 4IQFA 3MGCA 3EPPA 3JALB 5FF9A 2OO5C 4GE0A 3LK6A 1OV4A 3OZXA 4OJKA 2Q9UA 2WWTA 2PXHA 3HWRA 4H6XA 1MFPA 2KB0A 1J00A 3DM5A 3LG2A 4XQCA 5E3JA 4UBIA 1EK2A 1U5AA 2IE0A 2Z6KC 2GXSA 1K75A 4E0BA 1FVXA 1YR8A 4MUAA 2JHPA 3RT1A 3DE7X 1N4AA 1W1IA 4YLYA 2I67A 4JX9A 1XRRA 1K3RA 4KUGA 5F2NA 3ONVA 3C8UA 4TYYA 1EFPA 5JQWA 1EK5A 1UBLS 3KJEA 1KMQA 2X3UA 3EGOA 4PHCA 1J2YA 4KN9S 3SC2A 4WXHA 5JQGB 1NUSA 5JZOA 1DMSA 3SF8B 1TB4A 4H1HA 4TS4A 1LLRD 1UDAA 2BFBA 2HRCA 4INOA 1FX0A 1U2ZA 4Q3OA 3Q8MA 2AEFA 1MXFA 4EITA 3CP0A 1UIMA 2G17A 1YZ6A 1PH5A 4NRDA 5EGSA 5B6IA 3DB1A 3M82A 4JLMA 4I9NA 4R1NA 4N47A 4JYAQ 1PLKA 3EXG1 1BJRE 4UNQA 3U60B 4KDCA 4D80A 2BGMA 5BN4B 1CV2A 3CPSA 4FHGA 4MGKR 1RWPA 3OTOL 1UQUA 2C31A 1MGSA 2HA0A 3NX4A 3ITKA 5AM3A 3HXLA 3FTNA 3NEPX 4C30A 4DYVA 4LE2A 1JNXX 4I55A 4WZBB 3TN2A 4DV6L 4RSGA 4BKOA 3TSAA 5JXWA 1RWWA 2XCSB 4DPMA 5ALMA 1ZOSA 3RU3A 2PZTA 4IHAA 5AKEA 4CTJA 4ND2A 4WOPA 3OHXC 1V16B 2ASEA 3PHHA 3N05A 1KP2A 2O6HA 2VA9A 4G7OC 3DZIA 3VH2A 2CXQA 5CURA 3HEMA 1N4DA 1VYVA 1IRXA 3CNBA 5DHTA 2PYDA 2B37A 2FB9A 2QRNA 3NHBA 4Y9TA 4BIMA 4RGVA 4EUNA 4YY3B 4KR6A 1L9KA 1SEVA 3C3MA 3E3LA 1BE8A 3SDSA 3TX2A 2ZBEA 3ZCTA 4JJFA 2RGBA 3OEWA 5AICA 3TJRA 4Q1EA 4DG8A 1ARZA 2J67A 3H8VA 3STUA 1IY9A 1R37A 1GPLA 4YDSA 1A9SA 2EFEB 1D5WA 3A2LA 3HYTA 4OHOA 1VYTA 5GQOA 1DT3A 2VF2A 1MCZA 4WY5A 5KYVA 3UGJA 2XUKA 5ALWA 1X80B 3INGA 4GL4A 3ROZA 3SYTA 1F12A 1N6HA 3DOCA 1CR1A 4FGUA 3RSSA 3K5HA 1OLXA 4LSWA 3ML1A 1TT7A 1NYRA 1VJGA 2VF7A 1EOTA 3CE9A 5KOJA 2J5QA 4H08A 2CNBA 1OT3A 3NHLA 4IO9A 1HDGO 4HSEA 4X66L 1LV7A 1X8LA 3LPLA 3HDHA 4IVPA 4JFAA 4PQFA 3GDHA 4KN8A 2W2PA 2XRFA 3QNWA 1V3TA 4I9GA 1UXKA 1HX7A 2Q2QA 5FLKA 1CUYA 2WYOA 5EQTA 1E24A 5LU8A 5DGCA 2G71A 3A1UA 4XW2A 3L7LA 4TV8A 4PXSA 1A50B 2WSYB 1XTQA 3BEOA 1S2MA 1Q0LA 1ECLA 2NT4A 3O8QA 5AVOA 1YZGA 4N5IX 4RPLA 1VQCA 2PSJA 5DPMA 5H3HA 2PD4A 3B1XA 3W6NA 4BUZA 2WFLB 5H70A 3SKVA 2RGNA 3UJ3X 3VO2A 3WB1A 2OBXA 4EJSB 3EHEA 2W8BB 1LF0A 4LC1A 3RYIB 2V5AA 3PJFA 4YJKA 4OQQA 2M6KA 1NNUA 4QQBX 2ZWIA 5IP9G 3EVGA 4PSKA 4UU0A 2JA6B 1WIWA 1JRLA 2C2HA 1KTKA 4FF3A 2EFDB 2QTBA 3KV1A 1U04A 3F6BX 3M6UA 4TYPA 3TD6A 3SNHA 4CM8B 3ASZA 1ABBA 5IGGA 2W2KA 4DNTB 1TYZA 2HSGA 2EIXA 2V96A 1TJNA 2C8VA 3DR5A 4CZ2A 2QGQA 3C3BA 2QZ4A 3OO1A 1ZJJA 2ZCUA 4K28A 2VUTA 3O82A 5FWXB 1KYVA 1USIA 2AEJA 4P0QB 2D5CA 1T3ZA 1B70B 4NCIA 1SXPA 4OIJA 5EPLA 1E3SA 1JR3A 2FQYA 2V65A 4JI3Q 4IHJB 4K26A 1CFJA 2PWZA 4UU8A 4XIYA 3WWYA 5ICEA 4WBSA 3DWIA 2J07A 3N0XA 4RVHA 4QOEA 4CHTB 1R4AA 1HQDA 1RM4A 1Z0DA 2XHEA 3FSGD 4G0YA 2GSDA 3T1YQ 4MUHA 2X4DA 4RJKA 4B4DA 4KMUC 2WAAA 4I99A 1P4HA 4CG2A 3CLSC 4UZEA 2C5BA 1CZNA 3EFEA 2HREA 2J6IA 2WZQA 5E38A 3RIXA 4CIXA 2K04A 4QXMA 4UHHA 3FMIA 3V80A 1Z5ZA 4OI1A 3KOUA 3F4BA 2D54A 1W1WA 4YLEA 4AUMA 8OHMA 2HA2A 2BGKA 3ZHRA 4LBZA 1X3LA 4L4YA 4LYHA 3T1HB 2EG9A 2CKZB 1P9RA 5HKBA 4NABA 1SCIA 4N3NA 3I2FA 2R93G 1PK8A 3DAYA 4AULA 4GX1A 5B58T 3TB4A 5IGCA 4EB3A 2AMYA 1PSDA 3PZBA 5HTKA 3NBKA 2PUTA 3SCZA 2HB6A 5GAJA 4R4IA 3ZHQA 2V7EA 1ZK4A 2NO4A 1X3FA 1E4EB 3ZR4B 3PEFA 3DW1X 4G23A 3W90A 1VM6A 2GYVA 2QPAA 3LVBA 2O5IC 3LCUA 1FSZA 4D4JA 4TT3D 3AERA 5AW6A 3GFGA 1RHQA 5LCXA 4BNKA 4JI6L 4WJ3M 3NEYA 3KYHC 4FGLA 4JNKA 2UZIR 3FNHA 5COQA 2CXXA 2VYVD 1CI3M 3KPVA 3R7WA 1NUUA 3IL2A 1YHZA 3TUJC 4JJEA 4UMFA 1FX0B 4GZLA 1OTHA 2PJZA 4IOCA 2D1FA 3BH0A 4R2XA 4PPGA 1KDBA 3L41A 3OX3A 3FA2A 1AUXA 1NW6A 4QU9A 4TV8B 5F7ZA 1P75A 2VHTA 5JC1A 3Q8KA 4I1PA 4D9IA 1N36Q 1JDVA 2J0UA 4LAFA 1PSWA 3BCUA 3G0DA 1F5NA 4UAIA 4HYYA 3F2UA 1TD1A 1WSWA 1TM3E 5L3RA 5C7YA 3K30A 4LW8A 4NECA 3T1YB 2WFLA 4D4GA 3IBSA 3X3NA 9MHTA 4V02A 4IHJA 1FPQA 2FOLA 1T9ZA 2PZKA 2ZAOA 3HSKA 1W5BA 4OK3A 2W6IA 5TT0A 5EAYA 2FN3A 4YV1A 1T0PA 1U2EA 1N2EA 3DVSX 3MGGA 4RF2A 1Q0HA 1MAWA 1U0JA 4Y2GA 2NPFA 4XWAA 2OTCA 3EJ6A 3H1FA 2B2WC 5G3LD 2VK1A 1GR1A 5LU9A 4KR3A 1REQA 3CB2A 3DTTA 1XNJA 3H0EA 3C45A 3K3PA 4M53A 3WO1A 3EBPA 3AI3A 4R4TA 1QC5A 1V5FA 1D1SA 5LLSA 2VSYA 3WQHA 3HZXA 2SOBA 1JDBC 3GTOB 3A1SA 3HCBA 2W6PA 521PA 4DC1A 2XVZA 5FUWA 3SZ3A 2O8BB 4CR7A 1IBMB 2DJIA 3WK8A 3CZRA 2CUTA 2I7DA 3RGWS 1VSTA 5AFSA 5KYGA 4YCJA 3LC7O 1R0RE 1WDMA 4IIJF 4ZA2A 1K97A 4YMGA 2UU9B 4GPEA 4X8MA 2P11A 1CJTC 1GPBA 4J07A 5EIAA 4A0HA 1JPUA 4WOKA 4BEVA 2Q8QA 1T6ZA 1S1MA 2PT9A 4CHTA 1CEYA 4I66A 4V0OA 1EHIA 1VQHA 3D1VA 3PUIA 1J25A 4OHKA 1G98A 3C5WP 4JR2A 2RHBA 3SNKA 4FYXA 5FPYA 3TLAA 1W5FA 3SHVA 3WWZA 4KK4A 1NI3A 4PINA 4QJIA 1G55A 4UTPA 3NHHA 3GUCA 3L7OA 3O0TA 1SXTA 1K6MA 1Z5VA 5KYUB 1EXDA 1LUAA 1H4SA 3DDZX 3DJFA 5TNXA 2XHZA 1NBWB 1XJQA 4JN6B 2XTNA 4Y1FA 3F3KA 1L6RA 3LLMA 1ZGHA 1L5GB 3RH0A 2BI8A 4BHTA 4CE6A 4LTMA 3B1JA 3NEJA 2XVSA 2HJ9A 2VG8A 3C7TA 3K16A 4H3VA 3RODA 4W9MC 1RWBA 1E2GA 1RYYA 4EJSA 3FUTA 3O75A 3GDFA</