2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
1HJPA 1DAMA 5J4VA 1Z28A 1VG1A 2BMDA 4FWIB 2MMCA 1VQOA 4Q1EA 1YZUA 2QMUA 1E24A 4BRWA 2R2AA 3EC1A 2HQLA 2OQKA 2BC9A 3EX7C 2WAQG 1ZUNB 3OOCA 3M3YH 1BYIA 2Q6TA 3FE2A 1ETUA 3TREA 3FMOB 5G3ZA 2R6AA 3AP3A 2UZ3A 3QF4B 4DSOA 2O8FB 2XGJA 1W0JA 3EPLA 1BDOA 4LF9L 1E79A 2X1VA 2EFGA 3TQCA 2GWHA 1M7BA 1N0WA 1FUKA 5GJWC 1AQYA 2ATVA 3FMFA 1I6HH 3K7AH 4RFVA 4YCVA 1E98A 1KIMA 1OHHD 1U81A 4IVQA 5JS8A 3RWOA 1JQJC 4XJXA 1NBMD 4JL6A 1ZC4A 4TT3A 4XIGS 3PJRA 2MFIA 2W6ID 2ALYB 2WOJA 4N0DA 1IXRC 1KKMA 1I94Q 4JLVA 2WZQA 2Z43A 3WNDA 5DI3A 1RE0A 4JOIA 1KI8A 2X19A 4AY2A 5AUNB 1XD8A 4QJ4A 1WDTA 2VHUA 3I61A 2CW0C 4IVRA 1FVIA 1E2FA 3ZLJA 4DR6L 2IF2A 2PT5A 1IBKQ 1G4AE 4LOAA 1GDDA 2ZRIA 1QUQB 3QXCA 3SN6A 3OW2A 4A3GH 1S72A 1XTIA 4EJSA 5JWHA 2OFWA 4E22A 1BVSA 2O8EA 1R0YA 2F7SA 4DV0Q 1EFHA 2F4VL 4OO1I 2J0UA 4QKQA 5EP4A 5JWOA 1DOAA 4WAUA 4AD8A 5L3SA 1SROA 4A9AA 1ZD8A 4WZBE 2F43B 3GTLH 1QG2A 2PX3A 2O8CA 4AIMA 3H15A 3GO5A 4RCZA 1H9KA 3ULPA 1K73C 2FZ4A 1PHJA 1HH4A 1N3BA 4DV0L 1E32A 1J90A 1SVSA 2YINC 5CK5A 3KKMA 3E9HA 1D5CA 1P62B 2HF8A 2ODBA 2Z6VA 2ZRPA 1XD9A 2GVZC 4BXXG 1XFAA 5IYDH 3EIQA 4GZLA 2GA8A 4A3BH 1Q1ZA 4JC0A 1WBBA 3HOZH 1NY5A 4YWLA 2J5XA 3E9IA 1N8RC 3U3RA 3X2SA 4GNXA 1K8AC 5B58C 4G5SA 3GEEA 3VR4A 1NJGA 4HEJA 2E1RA 3GFOA 3NBYC 3KB2A 3GMTA 1I94L 4LYHA 1SMXA 3MG9A 1KI2A 4JL5A 5AJYA 1H8HD 4DDWA 3J7ZC 1DAEA 1VYUA 4E03A 2F6RA 4DUGA 3J81j 4DR1Q 5IYBG 1A1VA 3FKIG 1KXLA 2ATWA 2QROA 4PC2A 4URXR 3ADBA 1Q82C 1KK1A 1G3QA 1W2BA 3F8TA 4PZ8A 1QVGA 1KK3A 4A6XA 4DLSA 4NXML 1O7IA 3BH0A 1XPUA 5EP1A 4CYMA 4B3RQ 3PITA 5K8TA 3UK6A 4DDVA 3A1SA 2X77A 5KNDA 3X1YA 2XEXA 2QQEA 2Z4SA 2ZI7A 4P4SB 4R71A 3C5CA 2WTUA 4JI8Q 3S15H 3UG6A 1NIPA 2GILA 4MH0R 1EIYB 4YWKA 2YTYA 3KJEA 2VIIA 4FI3C 4PPFA 1COWD 4O2RA 2D06A 1VQCA 3AEZA 3D31A 2DR3A 2WPDD 2GAAA 3P4XA 1RJ9A 1E9EA 2EFHB 2P2LA 3FYHA 3SOPA 3GD7A 4A3BG 2ZRDA 1XMQL 2N3SA 5IP7G 1W5TA 2DNEA 3NELA 4BXXH 1W48A 2V7QA 3CBQA 4DV2L 3CZPA 4I1SA 4IXMA 2DWPA 4Q7KA 4PV1C 3F1ZA 1XXHB 2NN6G 1G5PA 4X6AH 1SXJA 3QPVA 3WXMA 1SVOA 4JLKA 3CCEA 4KN7C 3LW8A 1JQLB 3K8AA 4B33A 1VQLA 4BFWA 1N5KA 1KQSA 2ZI5A 4OQFA 2GVDC 3WP0A 2R6FA 3A7AB 5DI3B 4A3DH 5DN6A 3SEAA 4G1UC 2CL6X 4NU0A 1E2VA 2ZM6L 4OQXA 1KNQA 3S1MH 1ZIPA 1GKYA 2F3TA 2RH5A 3FTQA 4BLSA 5B30A 3W1BA 1YJ9A 1WBDA 5C0XI 2QGZA 4A3LH 4MTNA 4YONB 3SGIA 1OXXK 2PZFA 2F1IA 4OX9L 5CYOA 1S1MA 2BOVA 4CRWB 3L2OB 4DR2L 2W2XA 3UIEA 1FX0B 5IWAL 2HHHL 1DELA 2OTJA 4JBYA 4BE7B 2Q3HA 2WBLC 4GOJA 3KF6A 2Y0SE 2OBMA 3KUCA 2WM9B 1X3SA 4M1SA 3U6KA 2JJ1D 4YMUA 3OEED 2QE7D 4LJ9A 3KKOA 2DGYA 4JG2A 2YV5A 4A3IH 4HJAA 4JI0L 3H0GG 1X1RA 1UM8A 4FCVA 4KCGA 4DV3L 1IY0A 3MJHA 4GFDA 2QAGA 2QQ0A 4M8NE 1BKBA 2YC2C 3MXNB 2YWHA 1NLYA 1VQJA 3IHWA 1HY3A 4WZAE 3RDPA 4K0KL 3PO3G 1L8QA 3TLXA 1FTSA 4Q9KA 3REGA 1E0KA 5L3VA 4KI0A 1RPZA 1NMZA 2IYTA 1PUJA 4EPXA 1US8A 5C4XG 3MD0A 1JXMA 2XZPA 3KKQA 1BH2A 3TGPA 3R9XA 1CU1A 1E99A 2E75C 2RHSB 3RN5A 2IUSA 3SYKA 4A4DA 5JSZA 1G6HA 1EWQA 3FMPB 2UXDQ 4AYBG 2ZJAA 4MKGA 1C1YA 3IFTA 5JEEA 3TQYA 4LF8L 4O25A 1I4DD 1ZINA 1NF3A 3U7HB 1HNWQ 2IW3A 3IPYA 2VQFL 5F2EA 3U4VA 2QAGC 4DLUA 4TYPA 3CCLA 2GETA 1HH2P 2C04A 3H3VH 3TE6A 5BR8Q 1N33L 4UP8A 3GEIA 3PG5A 3PCRB 2JLUA 1TNDA 2A5GA 3OTOQ 4KBFA 4Q4HB 4JI4Q 4LRWA 5CJPA 4WVFA 2R6GA 1L4YA 1U8YA 2FE4A 2QPTA 1U5KA 2A6HC 3NC1C 4A8JB 1VHLA 3I1FA 1D8LA 3GQBA 4IDPA 1V43A 4PSVA 3UKDA 2ZJRA 1M34E 4B76A 3GLFA 3OHMA 3ZJYC 4ZI2A 1IJFA 4TTQA 1VPLA 1KZGB 2EW1A 4B2PA 5C44G 1Q1QA 4DK3C 1HNZQ 4LBYA 3AVUA 1SVKA 4P71A 2K5UA 2J0QA 2EWWA 4B32A 4HJ8A 2A68D 2HXSA 4U5XA 4A2PA 4JJZA 1KC8C 2QPOA 4DSUA 4H13C 3WRXC 5JCPA 5BYJA 3BC1A 2ZAMA 4TLEA 1E1TA 4LCBA 2XNSA 4X66Q 3I7FA 1GFIA 2PCLA 2REXB 2WJIA 2KCCA 2HIXA 3U61B 3QSYA 2V54A 5C3EG 1CKNA 3AVPA 4Q9HA 2UXBL 2WMNB 1IBRA 5EE9A 4EPWA 5AUOB 1NRJB 4LJ5A 5C18A 5JS7A 3ZD7A 4GLVB 2DFLA 2JGNA 2K5NA 2QTFA 3LXXA 1CR0A 4YDHB 1XJQA 5C44H 1MT0A 4Q1AA 3NEMA 5FOXA 3E0EA 2AKYA 4TQAA 2F1MA 5AR1A 2E76C 2EDGA 4LJAA 3GLGE 2VQEL 4PAMA 3K0XA 5DE3A 3K9GA 2IYVA 3CCJA 2RMKA 1XNRQ 1E79D 2HJGA 1K9MC 1GUSA 3LV8A 4DC9A 3ADDA 1N6KA 2PI2E 4QBIA 1J8YF 5JFGA 4TYYA 4JI3L 4X62Q 1DAFA 2D2CC 2MSCB 1RKBA 4Q7LA 2EIFA 1BMFA 3CNNA 4XTCS 5M04A 1NMXA 1KI3A 2PMDA 4IQZA 3A36A 1KO8A 4NDZA 4R4IA 2Q0HA 5SZJA 4WBSA 3EPKA 1MRSA 1YR7A 2HCJB 3RLFA 4LW1A 2CLDX 4EFNA 1OH7A 4UNSA 2BBTA 3MJRA 2CEAA 1GKHA 2V4DA 2B8WA 1N5IA 5HY6A 3B78A 4LFBL 2WKQA 2VHJA 3PUZA 5GAHC 2GVAA 1YNJC 2D7DA 1Y14B 1OV4A 1XMQQ 4L16A 4M22A 4XVQA 4QGUA 5JRZA 3GLGA 4BECA 2XJ4A 4IOKA 1JJVA 2E74C 5JSZB 2GEUA 1E9RA 2OAP1 1ZNWA 1A0IA 3K0FB 1GM5A 4HDQB 1YKSA 3H1TA 4K46A 4ZO4A 4QJ5A 4B6EA 4D0LB 4ZIRA 1UWVA 1EX6A 2LMCB 4QL3A 5FOWA 2ZRAA 3MCAA 1HR0L 5J47A 1JNYA 2FSIA 2VNUD 2AUJD 4DR3L 4BFVA 1W3SA 2J9RA 5M5YH 5EZ6B 4U7DA 4TZ0A 3CAMA 1ASZA 3QEOA 1DPFA 1VQIA 2BIFA 3L8YA 4PHHA 2IYRA 2A19A 1LFDB 2I5MX 3Q9LA 4D0NA 4IKEA 4A93G 4DK6C 2GXQA 4KLNA 1PH8A 4Q21A 3CH5A 4ALPA 1D7QA 1T91A 1MJEA 2C8VA 3EPJA 3U7EB 1OIWA 1DS6A 2QUZA 3L0PA 2CQOA 2A2ZA 2ZTDA 3OFND 3IEUA 1X55A 2QF7A 1DG1G 1V5WA 4OWTB 1ESMA 3IUYA 5GAGC 3C7KA 2ZXUA 1YR9A 3EW9A 3H0KA 1PYSB 4NXNL 4YY3Q 1CFMA 5FTMA 2O8DB 1P2SA 5JBQA 1AK2A 1J7KA 1KMHA 1ZYRC 1XNJA 5H1YA 3D4RA 1G21E 2YC4C 4A36A 1B9MA 1HPCA 1PA6A 2C98A 4R2HA 3R8CA 5G3YA 3BDOA 1GL9B 2A69C 5EJEA 2CCZA 4J15A 2UUBL 1IQPA 1S8FA 5IRCD 4MUBA 5FBWB 2FG5A 1XD2A 2G1KA 2Y0SG 1UFQA 3SHWA 3W8NA 4YMVA 1W7AA 1SXJE 2O5IC 1H9SB 1J6QA 3PV0A 1YITA 1Z6XA 1TQ6A 1VQ8A 2R7DA 4MRSA 5DSZA 4DCUA 3VKGA 3U9SA 4II7A 2ZVQX 2NG1A 4CVNA 2ZUDA 2JA8G 2OFXA 1AS3A 1C9OA 1FMLA 3K9NA 3NE5B 2HF9A 4LZZA 1WP9A 1XU4A 1PZNA 2XNDA 4LFAQ 4LF7Q 1TU3A 4DXAA 1EX7A 1IBLL 3KUDA 1N5JA 3KB1A 4DV7L 2IYLD 4US0R 2JEBI 4B75A 1NY6A 1L4UA 1ZCBA 5DNYB 2AWNA 2R93H 1IN8A 2OE2A 4TLDA 4B3XA 4K0KQ 4ME3A 4P75A 1IOZA 4G7OC 1VCOA 3I8SA 3TIFA 2IS6A 2J3EA 2C2HA 3THYA 5GADl 4JYBA 4IPDA 3KDFB 1CSPA 3Q8DA 2GKSA 4QXAA 2LKCA 4NKRA 4ZKDA 3BB1A 3HKZE 4MGYR 4EPVA 4GKJL 4P4SA 1G17A 5BN4A 3CRMA 1YZQA 4W9MC 2A1AA 2V1CC 3Q8XB 4AYBE 1B7YB 4DWJA 1KAGA 1IN5A 1NKTA 3Q72A 4BUJA 2ZROA 1Z83A 1I50H 1ZD1A 3LLUA 3NBZC 4LHVA 3DPUA 4XTRA 1VQGA 1LYLA 2B63G 2EYQA 2WIAA 4YXWA 2FH5B 2ZRFA 3RNLA 3HOWG 4MA4A 3VAAA 1FOEB 1JXOA 3W9YA 1SVMA 3BZCA 3PF5A 4M9XA 3H3VI 5FPHA 3RSOA 2C96A 4KKSA 2CK3D 3KKPA 4UKDA 2B8TA 3CWZA 4DAMA 1CR1A 3I5YA 1G3UA 3HOYG 3CF5A 3NBFA 4DR7Q 4PMWA 3EWSA 2IK8A 2ZANA 5ELXA 1HQMC 1R2QA 4QM7A 2KSQA 2ERYA 1G7RA 2PEYA 3SNHA 4BPBA 1IBMQ 4Q02A 4WZ6A 3RRYA 2I0QA 4LI0A 3HGBA 3CMAA 2HT6A 4B43A 1N32L 1TF2A 1OHHA 4OWWB 1OJLA 3LNCA 4FIDA 4XOIA 4IFBA 4OYHA 2BBWA 2FDCA 4M1TA 4D80A 2GF0A 1E1RD 4R4QA 1KMHB 1YRBA 3KX2A 4ON9A 3T1OA 4WXPA 2E9SA 3PVSA 1VQMA 1T3HA 2WWFA 3A7LA 1E4YA 1CR2A 3DMDA 4LV8B 1NG1A 5DGXA 3BB4A 4NPHA 2AN9A 3KFXA 3QKTA 1UKVY 4NYMQ 5HE9A 3TNFA 6Q21A 4APVA 1W44A 1ZUHA 4IO9A 1OPXA 3DEFA 3ULJA 1QZXA 3SBDA 4YQFA 2KI5A 2K5VA 4X65L 4V0KA 4P4UA 3DXJC 5AWFC 5BQ5A 2GJ8A 3EAQA 3U5ZB 3TVTA 2ZJPA 5IP9G 2JASA 1W1WA 5L3QA 4P0TA 1Y63A 1Y3AA 4C0SA 3C15C 1W4AA 1G6OA 2WB1E 4MGKR 4DBLC 1UEJA 4D4JA 1T5IA 3MWJA 4Q4AB 4ABYA 1UF9A 1G19A 2DN8A 2VSXA 4B44A 4PO9A 1W46A 2A78A 4M1OA 4A3IG 1IONA 2FFAA 2OHFA 2ZIAA 4Q66C 1IHUA 3RABA 4BFYA 1Z47A 3OPOA 1Q86C 1QVRA 2ZYVX 5J40A 5BN3A 4B3ML 4QQBX 2QM7A 2KCTA 1HZCA 2AKWB 2I5LX 4FXPA 4B3SL 3QENA 3T1YQ 2ZRLA 4QNMA 2IX3A 2QA4A 4JBKA 4DIDA 1XPOA 3UDXA 2D2FA 3Q7QA 4AQYL 4H44C 4MUAA 4TYNA 4DUYL 3PCOB 3HOUG 3WHKA 2X8AA 1OKKD 2FSFA 4KFRA 3SJZA 2O8FA 2WWXA 3PUXA 3U7FB 5KDOA 1TPZA 3K70B 1G6PA 3QIAA 2RB4A 2YZ2A 1EESA 1RVDA 5AK0A 3LWUA 2ZJOA 4AWXA 1FQKA 1RFLA 2ZSBA 1I2MA 1EIFA 3CCQA 2OESA 4QOSA 3R7WA 4ZDKA 4EQ6B 1KD1C 1HNXQ 1SMYC 2C9OA 3T5DA 4L5SA 4GOPC 1G8HA 1FGUA 1SLJA 5CB6A 2H17A 1E9DA 3I73A 1KRSA 3PSIA 3ZVMA 3GLHA 3PIOA 5AJXA 2UXCL 4TL8A 1E69A 1P7CA 5DIFA 5B64A 2F55A 2XTIA 2WIBA 4P3YA 4MRRA 1C9KA 4MKHA 1P6XA 1D9ZA 2WP8J 1S96A 2FPLA 4O0MA 2H16A 2VHTA 3CRW1 3MGCA 2B29A 4DLRA 5JLJA 2VLIA 1IJEA 2IXGA 3THOA 2JXMB 2V4ZA 1UEIA 3HKSA 2KHJA 3ZIAA 1NTGA 4IPGA 1OIVA 4JI5L 2JLSA 4L9WA 1YJNA 1WCMG 4GKKL 1NP6A 4R9UC 1NN0A 3TUIC 3UDGA 5E4FA 4GN3B 4JLNA 2DNCA 3FPAA 4RZXA 3EZ9A 2QE7A 1CKNB 4RZUA 5FPKA 2R7FA 1TKWB 3Q5EA 1OYWA 2W83A 4X62L 4JI3Q 2YNMA 2BH2A 2VUMG 3U3KA 3CRVA 4AURA 3BJUA 4R4CA 4A3EG 4OO1G 1VS0A 2Z0SA 4NONA 2H57A 3FB4A 3RS4A 3G0HA 1TXYA 2QRZA 4X64L 1G4UR 2GAOA 3BH6A 3QXSA 2ZJYA 3C14C 4DDUA 3CPJB 3U4QA 3Q85A 4A92A 3THXA 2PQAB 2K33A 4G5QA 4IVPA 4IFDJ 1G5TA 3VHLB 2CHQA 1P2VA 1T8TA 3LY5A 2VA8A 3NBXX 1X3FA 4AG6A 1W36D 3L2PA 3IIMA 5CLQA 2X2EA 3LXRA 5FTNA 1T0JB 3NBHB 4OGQC 3UG7A 1D2EA 2Q2TA 4JLBA 1HCZA 2P5SA 3RNUA 2PLFA 1P9RA 1NSFA 1E9FA 2FN4A 3W5JA 4JBWA 4TMTA 3PEWA 5C0XJ 1E2KA 1TWAH 4A6PA 1U90A 1VIYA 1SGWA 3OEEA 4G3XA 2F9MA 4RKFA 4RJLA 4BA1I 1SFOH 2MSEB 3AKDA 4BFSA 5GROA 3DM3A 3UDIA 2YJTD 2NVTH 4GLXA 4B47A 2K4KA 2IEYA 3ICQB 1CI3M 2O5VA 2Q9BA 1WI5A 4KV9A 3RYTC 3VKWA 4OXPA 5FLMH 4BZPA 2EJMA 2ZT9C 4LF4Q 4GKKQ 2NO7A 2AMCB 3P26A 1XMSA 4JVMA 2WJGA 4TL9A 3BFXA 4LJ7A 5DYIA 4Z1MA 3ULLA 4YWMA 2IXFA 3GEHA 3F2DA 1E2IA 1ZJ6A 1W2HA 2RGGA 4RY2A 1OTCA 2YTVA 1N2CE 2GEDA 2JJ2D 2VP0A 1X6VA 4URUR 2YKGA 1Z22A 1E2DA 4S35A 5H8WA 2DHRA 5KPDA 1DARA 3MXUA 2WJHA 4YY3L 4NXNQ 3KJGA 2N49A 4AC9A 2ZTEA 2ZTSA 2CK3A 4WIAA 3THYB 5M3FH 2BMEA 3TS2A 3CX6A 1EXMA 1KL9A 4LF5Q 3HOXH 3CB4A 4A3GG 3LWNA 3T34A 5IYCH 4M9SA 2NO0A 1NVWQ 1R8QA 1Z2AA 5FOSA 1ZKOA 3RHFA 2ZQ5A 4JT4A 1W0KA 1Z6YA 2QU8A 5LMUQ 3E5HA 4NYIR 2CJWA 4F93B 1GL7A 3STBC 1PH3A 4BBSH 1Q3HA 2VSOA 2OEPA 1RC8A 4F91B 3AH8A 4L15A 4HLUC 1VQ4A 4DKXA 1W4CA 4QBGB 4Z51A 4DV6Q 1QHIA 2F9LA 1E2JA 4TZ6A 4QIWE 2KWIA 1Q0UA 5DHAA 5J4KA 1P5ZB 4HB3A 1XEXA 1XD2B 4RKEA 1RRGA 3THXB 1VQ7A 4JT2A 4GS3A 4XWKA 2D3WA 4ITRC 1JB7A 2AXPA 2XNDD 3C41J 3PENA 1S3GA 2ODWA 2ORWA 1R0XA 1KIXA 2GZDA 2IUUA 1QVCA 2O8CB 4TQ9A 4NYJQ 1GITA 1QBKC 4JK1C 3K09A 3EIVA 2UU9Q 2B3GA 4Y7NH 4GI7A 2GNOA 4MKFA 3CF0A 4DCTA 1VG9B 5LDDC 5EXSA 5GVRA 3M4YA 2ATXA 2NPFA 5J4YA 1N36L 4BBSG 2XGTA 4JV5Q 2GCOA 1DAHA 3GJ7A 1QHGA 1Z07A 2CNWA 3LLMA 1MOZA 2CHVA 1IYJB 1UADA 4ASUD 2HJVA 2JATA 4OX9Q 1Q90A 1YHNA 3KKNA 3IILA 3QNUA 4XVUA 3VR6A 2VQFQ 4HUTA 3V4RA 1K5DA 4ARZA 2VHQA 2L0XA 3AV0B 2NMVA 3RANA 2KE5A 4JI5Q 2E2IH 4UP7A 3CRLC 4RCNA 3I5XA 1E2HA 1FP6A 1R6BX 4P32A 4UY8C 5HKKD 4XH9B 4BY1G 4EQ6A 4LWCA 3OEHD 3EZ2A 5IHPA 4Y0VA 4TYQA 3OZXA 1EWRA 4ZDJA 1UKZA 2QMHA 5FPYA 2RGBA 1JJCB 3J81c 1YJ5A 1JEEA 1RRCA 1T0HB 4FD2A 2FEMA 1ESNA 2R65A 3U2QA 2NO9A 3HU1A 3IBGA 1JJ2A 421PA 1GUTA 1FNNA 2AD5A 2R44A 3HU3A 4Q4HA 2Q2HA 4LV5B 4GN5A 5CIWA 3LQRA 1OYYA 1XCGB 1CKOA 1B70B 1G7CA 1B23P 3AB9A 1MRNA 4DLWA 4CZ2A 1VQ9A 2RGCA 3PO2H 5CM9C 5UKDA 2WB1G 4JI0Q 1XX6A 3QI2A 2A6ED 3P1JA 4I81A 2ZJZA 1Y1VG 2DBYA 221PA 3EZFA 1HT1E 3EIHA 2OILA 4A2QA 3D8BA 3DOEA 2A69D 4A4IA 1EG7A 4LSGA 3M0EA 3AKCA 4HLDA 2HLDA 3B6YA 1Z8FA 4IDNA 4PQFA 5KSYA 2NO1A 2BMFA 4IPHA 2I1VB 3IO3A 3HPRA 5JMTA 4DLYA 3D0FA 1OKKA 4I1UA 1X56A 4NYMR 1A4RA 4GOXA 1FJGL 3LRPA 1TX4B 2W2TA 1KDPA 3Q3JB 2ANBA 2FJUA 4N0EA 3SFZA 3HOVG 4KYIB 1I4LD 1YBYA 1FUUA 2ZE5A 3LD9A 3GFPA 2JDID 2CE7A 4FINA 1QVFA 4MGZR 5FTJA 4LGMA 4HAYA 2VP6A 4FDBA 3HPQA 2Q8IB 1GG2A 5C1BA 1WYDA 1FL9A 1TADA 2BJWA 2YVUA 4PAQA 5JCZA 1KHTA 2EYUA 3IGFA 1WCV1 3ZZ0A 4UNNA 3OTOL 2ZM6Q 5BYKA 2AD1A 4BFXA 821PA 2O8DA 4LF6L 4TYWA 3RS3A 4YCUA 4IFEA 4KKUA 1FX0A 2RGXA 2XX3A 4OQMA 3SJCA 2ONKA 3HR7A 2A8VA 4ZCLA 4BGDA 2R62A 4DB2A 3VTKA 4RMFA 2LSSA 1KDTA 4HLQB 3WYGA 4GZMA 4K81B 1ANKA 1VQHA 4LF7L 1FP7A 4B2LA 4N1AA 2DWQA 4TMKA 3U58A 1H9JA 3LVQE 2UUAL 1GNRA 1Z9FA 1GNQA 1N32Q 1JE5A 1QHHB 1RW4A 4JI8L 4FW9A 2J1LA 4B34A 1LV7A 1YU9A 5CJ2A 1XNQQ 2HDNB 1GKIA 1QHSA 2DWOA 2TMKA 1D9XA 3LFUA 1A2BA 1QRAA 3IPXA 2V6JA 1XTDA 4NYJR 5F98A 3MMPA 4NHOA 4D6PA 2YTXA 4NCIA 3S17H 2PMKA 2G83A 2XSZA 3DZ8A 1L1OA 1MO3A 5FOVA 1EGAA 2OWOA 1G20E 5KO2A 1FR3A 2ZR7A 5ELNA 3QUSA 2C99A 1IXRA 4UNQA 5CB8A 2PPBC 3HOUH 2WJJA 2P6RA 1AZTA 3RSLA 2A30A 1X1SA 4HIDA 3MAAC 3CCRA 3IHLA 3NTUA 3N70A 3ERSX 1E7ZA 1R0ZA 2LXJA 3W1GA 1E2QA 3UMRA 1AE3A 1HURA 1JR3D 2QORA 4DUZQ 3PR1A 4C0JA 4OQNA 1E1QD 1E9SA 4CGZA 4DUZL 2BVNA 1P9NA 4B3CA 3GFTA 4X8HA 1ZM7A 1SVLA 1PH2A 1PH1A 3G6EA 3BZKA 3U3JA 1N36Q 3B1VA 4L9SA 4EDHA 3L43A 1GUOA 1ZCAA 3T61A 3SFVA 4BRUA 1XDBA 1OFHA 2ZI6A 5J4HA 3TUZC 2W00A 3GP8A 3RC8A 4B35A 3VX3A 3A1VA 5CITA 2Z6KC 3B9QA 3RR5A 3EG5A 4KYUA 2R6DA 2A5JA 4HAUA 4IFDG 5C4JH 1HE1C 1J5EQ 1S3SA 1UKYA 2QENA 3EASA 4NYIQ 1UPTA 4Q9JA 5TDHA 3K09C 3SJAA 1RL2A 1QZHA 1Q1BA 1Z6HA 1TUIA 4BZXA 1NJIC 1KK0A 4F7WA 1W36B 3VNUA 2NTYC 2IT1A 1Q20A 1RIPA 4PPNA 1TAGA 1XP8A 5ANRB 5ELOA 1FL0A 1X3EA 3OW7A 3HKZG 2QPAA 3EWAA 2IYWA 3H84A 5H1SE 3QPWA 1G8GA 3KJIA 4EPYA 4PZYA 4W5WA 2Z0MA 2P6NA 1G291 3KYHC 1XNQL 2UZIR 1MR3F 4DEYA 4C0KA 4PO8A 2A3RA 1ZD9A 5JJLA 3B13B 2YWGA 1KMQA 4E5UA 5IK2D 2VP2A 5CLLA 4XWAA 4A0RA 3BH7A 3BOSA 1ZBDA 4XSHA 4NB3A 2RKOA 2F4VQ 4GMXA 3TSZA 1UDWA 3ZZTA 4A75A 1Z5ZA 3GTMH 4A3CG 3B6EA 2E5LL 3NG1A 3AF0A 2ZS9A 4PFSA 1MH1A 4BQSA 2V6IA 4DVGA 4E07A 1JJGA 1UBEA 2QSYA 4LUZA 5FL7A 1C7YA 1JR6A 4PPGA 1QVAA 2EVWX 3LO5A 3JC66 5SZHB 4A3MH 1KY2A 2E8GA 1R5NA 3DHWC 1UJ2A 2F1JA 3O8DA 4RD4A 3K53A 3GTJH 5FLMG 2J0UB 3PUVA 1UEBA 3T5GA 2QSZA 1E1RA 4B2IA 4A0HA 4ARZB 3LA6A 4YC7A 3KLWA 5EXPA 4C3JH 4URZR 2FV8A 5GQOA 3L82B 4I1VA 2OCEA 4GKJQ 2QZ4A 4JLMA 4QHTA 3U50C 1PH9A 1ASYA 2P3SA 3NH9A 3AEVA 3CO5A 1G41A 1EQQA 2IYZA 1KHIA 3LBNA 4BA2I 4LYJA 1D8TA 4IJLA 1Y1WH 1LW7A 1BYUA 2B6HA 3CPEA 1TWCH 3ONWA 3GLIE 4BASA 2J46A 3BXZA 4P72A 1N6NA 4TQUS 1W0KD 4UJ3A 3PXGA 1VECA 1AKEA 4YHHL 2BM0A 5EXXA 2VYFA 4DSNA 4C0LA 2WAYA 4XD7D 1T9HA 1WOCA 2JIZA 2GK7A 3I32A 3ADCA 3U44B 4A3EH 3AFQA 4HJ9A 2VUMH 1CIPA 1U94A 1Z08A 3QF4A 1JPJA 2B8FA 2KENA 2EFDB 4QC2A 2QP3A 1XEXB 1J8MF 3GCGA 2B7BA 4NTZA 4PZ6A 3CC4A 2V55B 1E9AA 1Z7TA 2W0MA 3DM9B 3EARA 4G5OA 5KNBA 3TRFA 4KHPQ 5E7MA 3AQQA 2ZETA 4D4LA 1VIAA 4PO1A 4CEJB 2ES2A 1LF5A 4V0MA 2NQ2C 3X1WA 2EJFC 2KBFA 5HTKA 1X8KA 3S1AB 1Z29A 3AP2A 2BDTA 1E2GA 2X2FA 1IAQA 3CONA 3F3YA 5BW8A 2JA5H 1Z6GA 2ONJA 2IYQA 2JLQA 1GP2A 1H8HA 4DR5L 1YR6A 1NIJA 4MYUA 4Y0AA 1AN0A 1P9WA 2REOA 2JQOA 1S4QA 3OE7A 4BFZA 2VP5A 1XNRL 4ERNA 2H7VA 5GVSA 1UDXA 4WOPA 3EIEA 3CX7A 4PAOA 1AM4D 4OONA 2RGAA 3V9PA 5LMNQ 3SQXA 2GRJA 2WKPA 4TL6A 2ZRMA 1R4AA 4Q9IA 1B8AA 1YJWA 1ZM2A 2ZI3A 1U99A 3JAMc 4PR0A 4X8MA 3HWSA 4J0QA 1BBWA 4G5GA 1KRTA 3SR0A 4OJKA 3TBKA 2FA9A 2RHMA 4DT1B 1E2LA 4Q00A 1H8EA 5C0XH 1OF1A 3KL4A 3MSXA 3FHWA 2N46A 4RFSB 1VQPA 3A4LA 3RWMB 1E3PA 1CUKA 3TS0A 1GZSA 1P2UA 3M6AA 1NMYA 5JJIA 4LFCQ 4URVR 1YVDA 4RSGA 4BBRG 1ZNYA 1M74A 3K9LA 1Z6AA 4BY7H 2QI9C 3KTAA 1OLOA 3BRWD 4Q1FA 4JLAA 1B9NA 1K8RA 2D0PA 4JSYA 5C0XG 2IF0A 3O47A 4JVSB 4UXIA 2ZE8A 2VTKA 2JLRA 3I4MH 4FMBB 3V00A 2IWHA 5D3MB 4LUOA 1BS1A 1SULA 4QL5A 1MO4A 3CMEA 1VQFA 4OK5A 2BM1A 4QBFA 2PQAA 4F4IA 3BBPA 4V0OA 1O87A 1JALA 4LJ6A 4P31A 1SQ5A 5EE3A 4C7OB 521PA 2VF8A 4W5HA 2JLZA 3AP1A 3RRMA 1RZ3A 4DR4L 2WSSD 2RGNA 3RLNA 4GNKA 1E94E 1GIAA 3CH4B 4G7ZC 5A0FA 1GRNA 3A5UA 1MJCA 2CLCX 4HIOA 5BR8L 1N33Q 5DHFA 2GJ9A 4NZYA 2ORIA 2JDIA 4OHVA 1PH4A 1HNWL 1NI3A 4DR4Q 1NSTA 3CX8A 2K75A 4OBEA 1W47A 2CE2X 1VG8A 4MYHA 4R98A 4EUNA 5A5GA 1KJWA 4LBWA 4Q18A 3ZH9B 5JEAH 1YIJA 3NVAA 4D26A 3S2DH 5K8LA 1YVCA 3WBJA 1RRFA 1YQTA 3I3SR 4MRNA 3TAHA 4CEIA 4FCTA 1GRQA 2EFCB 1YHAA 1BIFA 2VO1A 4TTRA 5TMPA 1VQDA 1Y69U 5DI9A 4MYTA 3FHTA 4QGGA 4IOMA 4A1FA 4LJZC 4TLCA 4RD1A 5IK2A 2H18A 2QL6A 4E09A 2W6IA 3BWDD 2OG2A 1L0WA 2FXQA 2ERXA 4URWR 3T1YL 3GJ0A 4CEJA 1KDOA 4R2IA 4PHFA 5H68A 4DRZA 2DPXA 1A6XA 4M21A 1KTVA 1MKHA 2ORVA 4MNOA 1F6BA 1YZGA 2VQSA 2XAUA 3AF1A 5DYGA 4HDCA 5EE5B 3EXAA 3IEVA 3VR1A 1H65A 1Z0AA 1EK0A 2IS1A 5JRJA 2MNAA 2GN5A 1UBFA 2WWGA 3P32A 3NENA 3L0OA 4DNRB 3F2CA 3CQZH 4KFTA 4PSAA 5JI3E 5KDDA 2XZLA 1E2MA 2GCNA 5FJ8G 3AQ4A 1Q21A 2DFKB 2N42A 4PQRA 1DAIA 2IEZA 2VL6A 4A3JG 4LYAA 1N34L 2KBNA 2IX1A 2F43A 3CF2A 3MFYA 2BBOA 2KB0A 2SHKA 3IQXA 3TMKA 1OB5A 2IC5A 3EPHA 2ZSAA 2OUKA 3K8YA 1IM2A 4A0GA 5HZKA 5JEAJ 1R7RA 4UJ5A 1EFWA 3W3ZB 4GLAC 2PEZA 3RS7A 4BEBA 4QGHA 1II0A 1N6HA 4ILEA 1PH5A 1OFUX 5AJVB 2L5TA 1IL2A 1DEKA 4OI2A 3SBEA 2XB2A 3SYLA 4PHGA 3AVVA 1AE2A 4Q48A 1WE2A 1A2KC 2BDOA 4BEJA 2IS4A 4A3FH 2I1QA 5HPYB 3SS8A 621PA 2MO1A 3AYHB 3CRQA 5CM8B 3MRSA 2RGEA 1G7SA 3LNNA 2WVJA 3NIBA 2K50A 2O0HA 1CS4C 2D4HA 2NGRA 2NVXH 4EKDA 1X54A 1BOFA 3VA7A 1KI1A 2FSGA 3GJXC 2WFWA 5C4GB 3AKEA 1NN3A 4DHEA 1S3OA 1X65A 4AH6A 1C0AA 3G71A 1CF4A 1E6CA 4MRPA 2IL1A 5E7NA 3KDSE 3KZ1E 2J41A 3FGNA 5TB5A 3DKVA 3W6NA 2PZGA 5EQTA 4LHWA 1BBUA 2A6HD 3CCVA 1ODFA 2G1JA 4NBSA 4US1R 1K8OA 1F5NA 5TVKA 5HCNA 3KQLA 1BO6A 1K8MA 1J99A 1HYQA 3O8BA 4AKEA 1GO3E 4PC6A 3HR8A 3LX5A 3QXXA 5FUWA 3PEUA 3KQHA 4FMCB 4JI2Q 3RRNA 2JAQA 1GVPA 4JMPA 2DFTA 2YOHA 4C0AC 1Z06A 3MWKA 3AVYA 2DCUA 3NEJA 1HT2E 1L7VC 1QDEA 1SVIA 3OE7D 1WQ1R 4KLZA 3WDNA 1A7JA 1HZAA 1KI4A 1TWFH 1O78A 3JAMi 4HIKA 3F5FA 3GJ5A 4JI2L 3BORA 2BCGY 2L15A 4JOIC 1KNXA 4NP6A 3UXMA 5B57C 3B5JA 1CRPA 3KJOA 3BFVA 2J0VA 1ZMXA 1EYGA 5EUMA 1OFIA 3U7GA 2G0NA 4DCNA 3C5HA 1OSNA 4FCWA 1Q57A 1X86B 1B0UA 3ZS8A 1QG4A 4HR7B 4LF9Q 1F60A 2EJGC 3M4QA 3RS0A 3VR5A 1XZPA 1SXJC 2R6CA 4HAXA 4IDQA 3RZDH 2HLDD 1DE0A 4U00A 1NVVR 1T4GA 3ZVLA 5AJ3L 4BZQA 2O0JA 1KSJA 3B9PA 1ZM3A 4Q4LA 4A3DG 4QGFA 3CIOA 4DSTA 4DV6L 5K8UA 5L3SB 4C7OA 3ZIAD 4C0QC 4KITB 2Z4RA 3WMGA 4C2UA 2BE5C 2PCJA 4M1MA 2BH8A 4PSKA 5FR1A 3KXLA 4ZCMA 3UE0A 2JEOA 5FOTA 3WMFA 2CL7X 3KQNA 4Q4AA 2FOLA 5EUQB 4UNPA 3RS5A 3GDEA 1SHKA 4Q1CA 4DPGA 1I3QH 2QTHA 4DR7L 4HSEA 2YOFA 3K80C 1CJTC 1VYTA 4H1VA 4IW3B 4C30A 2AUKA 3PUWA 4UP9A 1XCPA 3VR2A 4IHQA 1QHNA 4Q01A 1QHHA 5CDFA 1GKUB 2AL7A 2J7KA 1U9IC 3GTPH 1GUGA 2IX0A 2AHOB 1VF7A 3FFAA 3HFZB 4A3FG 3F0TA 4W7SA 2VRWA 3PEVA 1T5EA 1LM0A 1SE8A 5IDVA 2QTVB 5B2ZA 1WRBA 3ZDQA 4BLTA 1XZQA 3C4JA 4QHSA 1AS2A 1LVGA 3FVQA 2HEIA 5D3QA 2XTZA 2VPPA 3B1ZA 3N2IA 4GL2A 2OXRA 4AG5A 1JAHA 1HTWA 5G40A 3W5IA 1G8FA 4KJZA 4P73A 4JI6Q 2ZAOA 3IQWA 2HCBA 3S2HH 1L2FA 2NZJA 3TSOA 1FW6A 3BG3A 4GN4B 5M3MH 2A5FA 2BBSA 2F1HA 4A3JH 5IYBH 1T8UA 2HV8A 3L0SA 1HV8A 1Y1WG 4B3DA 2FGJA 4FN5A 3W8RA 2CJWB 1TEVA 3AUYA 4MQBA 5KPJA 1CJKC 4N3NA 1QJOA 4UPAA 2IS2A 2Q2UA 2QEXA 4DV1Q 1Z2CA 3GLIB 5SZKB 5FTLA 2JJ2A 1CTQA 3K81C 2A9KA 2ODNA 4CEIB 1II8A 4GOPA 2I4IA 2E2HH 2B92A 3K1JA 2OCAA 4LFCL 3DOFA 4D82A 4KFSA 2JLYA 4NCJA 2IUTA 3DDCA 1G1MA 4PANA 5FH9A 1ZU5A 4LUCA 4LK2A 2MSDB 1GL6A 1P61B 5E7JA 1XCMA 4LFBQ 3RAPR 1H9RA 3QVVA 2WKRA 3GLGB 1V1QA 3B2EA 5IT5A 2VP9A 3H2YA 3NH6A 2C77A 4X8OA 5KOYA 2R7ZG 4ZCIA 1XWIA 2OBLA 4MZ9A 1G9XA 3JZMA 4BY1H 4EJSC 1F2UA 1VMAA 3HYTA 4GMDA 3QXJA 3UANA 2UUBQ 2CXXA 4ACAA 2ZRNA 2I3BA 1E1OA 3FKSA 1PVOA 3M7NA 4IEIA 1NL3A 1ZU4A 5SZIA 3AM1A 1CKEA 4A3KH 2PH1A 5F9HA 1GD7A 1MIUA 1DAKA 4AI6A 2PX0A 5FFMA 1N6RA 1G16A 1VDZA 3ND8A 1KAOA 3OIUA 4V0ME 3W3AA 2IHYA 5JHGB 4DR5Q 3GPLA 3Q7PA 1G51A 2JEAI 2EQSA 1L1OB 1R5BA 1XJVA 1ZVQA 2R8RA 1M1KC 2WHXA 3P4YA 4A0FA 3BJIC 2VZAA 3PFIA 2AXNA 5HGQA 5KHOC 3PIRA 4HB4A 2Q21A 4DR3Q 1IN4A 1WB9A 4L8JA 2FWRA 5IY0A 3X1DA 5FL7D 4WW0A 5LB2A 1P16A 3PQCA 1AJEA 4Q7JB 2O8BB 4KN4C 2JA6G 3PO3H 2WSMA 2JA7H 3AKYA 3GJ6A 3MWLA 4KVGA 3T53B 2OT3B 1G8YA 4LHXA 1KI6A 1JT8A 3LAWA 5DO9A 2JA7G 1E2ZA 1GWNA 2D7CA 2WJVA 5FUXA 3TQFA 4D4KA 4Y52H 1R9TH 4PQYA 1KO7A 5LMUL 4PPQA 3WNBA 4C0HA 2FX3A 3ETLA 1XTQA 2JJQA 4ESHA 4HB0A 4C2TA 2AFHE 2B21A 2R9VA 3TAUA 5KYKA 2K32A 1OXVA 1VCIA 3SDZA 2LXKA 3QPUA 4D25A 3KFUA 2CMKA 3A58B 3I2ZA 4KFUA 4MDFA 4HLUA 4ACBA 5IYCG 2GBLA 3UDFA 5IE8A 1KDRA 1W5SA 3HOXG 1SKYE 1RRPA 4X64Q 2OCPA 1TMKA 4LY6A 3DM5A 5BN5A 3BS4A 2J7PA 2NOAA 4XD7A 3EA5A 1CRQA 4LPKA 2ZS8A 2A68C 1PUIA 2CNWD 3E2IA 3RRZA 4B6FA 5FI0B 3WWVA 2Q3FA 1KSGA 3ER0A 5CDFE 3OESA 2ZYUX 3BU2A 1JB1A 1MO6A 2PZEA 5LB4A 2WICA 1IW7C 1OXSC 2RGDA 5EXTA 4JCVE 1ZRHA 2ZRJA 3M9BA 1K8GA 2FMXA 2ZSDA 3QKSB 4GP6A 2QBYB 3J81k 1IYVA 2CBZA 4LF8Q 4KODA 2DY1A 2ZRBA 3K0AB 1AGPA 4M4SA 3M1IA 1SZPA 4DV5L 3R9IA 3KDFA 3L7ZC 3QBTA 3M85A 5KSOA 2NVQH 1QHXA 1WMSA 1PFSA 2BJVA 2J7PD 1N5LA 3QKUA 1JECA 1A62A 2ZSEA 2XTMA 3QKRB 3VMFA 2I5HA 2OZEA 2D2EA 4AKHA 2ZRKA 4RD6A 4U02A 4URYR 4IDOA 4CT4B 2ZU0C 1YZTA 5AJ3Q 4DEXA 5KUTA 2ZJ8A 3OIYA 1DG3A 4JKYA 3ZVNA 3AF2A 3TW4A 3AB3A 3J80c 2FU5C 3LX8A 1II8B 2YHSA 2A5YB 1YHBA 4IOCA 4B3SQ 4Q19A 5TARA 4NE2A 4DK1A 4DV3Q 1HNZL 1N9WA 2GXUA 3BK7A 1VQBA 4PZLA 1H9SA 2IHEA 1LTLA 4DNIA 4AQYQ 2G9NA 4OO1H 1TTTA 2QP9X 3DL0A 4JI1Q 3CW2A 1PMRA 2VHCA 4NXMQ 1GTVA 3G82C 3V4FA 1E1QA 1Q44A 4HATA 1F2TB 1NLFA 4BLPA 4QGAA 4C0BA 2ZJ5A 2FSHA 1AIPA 2F3RA 1WCMH 3CWQA 2ZPTX 1KI9A 4TMZA 2W6JA 3AVWA 1KOFA 4LNQA 1E96A 1VTKA 4HUQA 1SXJD 1KYIA 4US2R 1K5GA 3HOZG 1BKDR 3FPPA 4B3TQ 4D0GA 1E0AA 1LNZA 1OW3B 1LABA 3S24A 1U8AA 1KSFX 1S2MA 2BCJQ 3TUJC 1PJRA 4JLPA 3BGWA 3EZ6A 1H9MA 4JI4L 2CLSA 2H8KA 1CLUA 3D6TB 2ZJQA 2C35B 1SVWA 5DN6D 1G18A 4LDJA 4AYXA 1S9DA 2BE5D 4K8OA 3C16C 5FUYA 4QNRA 4CEHB 3F2BA 2AK3A 1JI0A 3H4MA 4JL8A 1UE5A 1E2PA 1FPMA 1G7TA 1VKJA 3FWYA 1JJ7A 1NVUQ 4Z8XA 4D81A 1P75A 2ZYTX 2W2VA 4GOKA 4MGIR 4RCYA 2OXCA 1FFHA 3A37A 4POAA 4TWZA 4CW7A 1DO0A 2CCGA 4BWYA 4ZIRB 3HJNA 4Q7MB 3A8IE 2FPMA 4Q1DA 3IO5A 5A35A 5JJKA 1VQKA 4HJ7A 3MWYW 1PYBA 1XTKA 3RZOH 2C9YA 2VSFA 1UE1A 2V7QD 3OAAD 4BLOA 4B3MQ 1UE7A 1WJJA 1J5EL 2PMZE 1P73A 1ZM9A 4R4TA 1X6OA 4POFA 4DNTB 2C9CA 2FGKA 3NC0C 4LYFA 3ZVRA 4GDFA 1NNEA 2CHGA 3GTOH 3R7WB 4DAYB 3T35A 4M0LA 1YR8A 4POGA 4UXJA 1XEWX 1S9HA 2QM8A 5P21A 4G7HC 1RIFA 1QZGA 5C2JB 5M5XH 2O52A 1Y8NB 1Q8KA 1Z6TA 1PLKA 3QKSA 2QBYA 2HYIC 1SN8A 1VG0B 2ZR9A 2UUCL 1TU2B 2H92A 3B60A 3MLEA 4ESVA 2ZI4A 1II9A 5GADC 3T1HL 2JA6H 1DBSA 1AKYA 4X65Q 1N6OA 4W5JA 1F3OA 4ZKEA 5JWRA 2IYSA 4HZIA 4JVNA 1X3GA 1H95A 2VP4A 5LBIA 3CCSA 4F4CA 2QT0A 1TQ4A 3CP0A 1KJZA 2RGNC 3TK1A 3KXIA 1XB2A 3WBKA 4AKGA 1FTNA 3TZUA 2OV2A 2QMEA 3QF7A 3W90A 4Z8YA 1YNNC 3PGZA 2GZHA 4DJTA 3CNLA 4DV7Q 5LPNA 1XPRA 2F1RA 1E4VA 4JJKA 4KSBA 1S0UA 3I4NH 5EZ5A 2ECKA 5L3QB 4L8GA 4Q03A 2V1XA 3CNOA 2YOGA 2GCOB 1GOTA 3VQTA 4ASUA 2Q2IA 3KQUA 5GJBA 3RLOA 2ZUCA 3IIKA 4TLBA 5C46F 2IYYA 3U4QB 1Z3IX 4NH0A 1X8LA 2V9PA 1NKSA 1EUJA 2R7ZH 4H02A 4P74A 3M4OH 2B8GA 1CBUA 1I4TD 1YRAA 2KJQA 3OF5A 3THWA 2J0SA 2J45A 4OI4A 4I4LA 3LH5A 4LF6Q 1FYCA 1DADA 2IHBA 1MABA 3FDIA 4QJFA 2FF7A 4O3MA 3ZD6A 4XWOA 4YLGA 4OQLA 3RN2A 3TJZA 3L8ZA 4MITA 2VH5R 2XITA 4L4UA 1TQDA 3I62A 3K70D 4Q1BA 1XMOQ 2F3IA 1PH6A 1AGRA 1KI7A 5FL3A 2BKEA 3W6PA 3HOWH 3ADKA 4IOLA 2ASBA 3CW2C 2QGQA 4PZ7A 1XXHE 2XTNA 4JKIA 5FJ8H 3TEHB 2BV3A 5FOUA 1SXJB 3STBD 3CR7A 4JBJA 3K0FA 4PC7A 1YZNA 4OI0A 3GLHB 5HE8A 1Q3TA 3ECCA 2WJYA 1N34Q 4AYTA 3VKHA 1OT3A 2ZE6A 3QVUA 5M3MG 2XXAB 4TSFA 4JBXA 4HI0E 1XTJA 3CF6R 4UQOA 5DLQC 2JA9A 2JK8A 3DMNA 4JBMA 3A4MA 1H8ED 3P27A 4YDSA 2RF4A 2VF7A 4A82A 1HTPA 3NXSA 4DLTA 5E7IA 3ICEA 1C4OA 2R93G 1G3RA 1NLZA 3NHBA 3T15A 3K0EA 2MO0A 4KXFB 4X8LA 3IDQA 4ZI3A 5AUPB 3CD6A 4R1JA 3PIPA 2IHFA 1V8QA 2ANCA 1T3LA 2VW9A 4KLKA 5J5CA 4EIWA 2BMJA 1E9BA 2AKAB 3PUYA 3B8HA 4TKOB 1KO4A 2JA8H 3I55A 1K3RA 2UVQA 2Z6KA 3PO2G 1US8B 2YYZA 2ZITA 4GRAA 2PCFB 1N0UA 3ZZUA 3DLLA 4HZUA 4NL4H 2XSZD 4Q4JA 4TSFD 4QY7A 1E22A 2ZYWX 4MKIA 2E2JH 2OBNA 1XJ0A 3WRYC 1W2GA 3W6OA 1W36C 3A6PC 3B1YA 1TF5A 1KO1A 2WWHA 1EQRA 3ZJYA 2V1UA 3IBYA 2QAGB 1CP2A 1COWA 3O8RA 2GJAA 2ZEJA 4KVAA 3E70C 1JR3A 4EFMA 4QFMA 1DO2A 3EQLC 1MKYA 1IW7D 3LGJA 1I5FA 1PH7A 2A5DA 3REFA 3OYYA 3PF4A 1WFQA 2WPDA 4S2EA 4EQ5A 1WXQA 4YMTA 5KSPA 2BA0A 5L3RA 4YMWA 1NN1A 4I1OA 4KU4A 4JI1L 1XTSA 1N0VC 1D2MA 2G6BA 5E95A 1Y8OB 2CVFA 3FHOA 3I72A 1MABB 3TR5A 3WY9A 1BMFD 1E2NA 1TUEA 2IYUA 3A0JA 3I4MG 3WYAA 3A5ZB 2GJSA 2UXDL 2UUCQ 2P0EA 3LVRE 3A1UA 1OH5A 4TMWA 3U6BA 2V3CC 4LHZA 1Z0FA 2ASEA 4JIMA 3A8KE 5DLQE 1JAIA 4KAXA 1YI2A 3KF8B 3GTKH 4M9QA 4QRHA 2O8BA 3R9WA 4HJ5A 2EU8A 2QMOA 4OK6A 4BBRH 5FLXc 3LW7A 2CCJA 1IN6A 2JE6I 1ZYUA 3WMEA 5KTYA 5F9FA 3EZ7A 4EJSB 1UKEA 2ZREA 1SHZA 1UBGA 1GHKA 5GJCA 3H94A 1CKMA 3FMIA 3ZQ6A 1Q7YC 4C3HH 2B7CA 4DV5Q 4MRVA 2UKDA 1M6NA 4Q5IA 4EFLA 4F38A 2HYDA 3B7GA 2QG6A 3WNCA 3QE0A 1VQ5A 1NE3A 4LUVA 1NVVQ 1OFTA 2C03A 4HDOB 1O7LA 4RG1A 4MYCA 4KSCA 4A2WA 3FOZA 3SQWA 1ZM4A 4Q4JB 3S1RH 2LWIA 1X8JA 2QY9A 3AGPA 1SKYB 5CYPA 3UPUA 4DDTA 1VHTA 1HZBA 3FP9A 2XB4A 4KBGA 1OXUA 2YU9H 3KFVA 3QY0A 4WJ4A 4DT1A 4FMDB 1CJUC 3GTGH 1EFCA 2PJZA 2K52A 4NCHA 2JA5G 2NO6A 3LQQA 1KZ7B 1VCNA 3R8FA 1GVNB 2GXAA 2MQHA 5AJWA 4AYWA 4QM6A 2JLVA 2OTLA 3CZQA 4A3KG 4B3TL 2O5JC 4IFDI 1OE0A 3K0AA 1E2EA 4BLRA 4DCVA 4B3GA 1OH6A 1XMVA 2PLRA 2XXAA 1KO5A 4F92B 2JLWA 4O0AA 3FHCB 5EP3A 4JV5L 3IRBA 1NVXQ 2JJ8A 3WYFA 2RHQB 2EFEB 3VU9A 3QBVA 1VQEA 2K5HA 4B74A 2AR7A 2BHRA 3S1AA 2CWPA 1S1CA 3J81i 1VYVA 4RVCA 1LS6A 2BWJA 2YWFA 2K14A 1CJMA 1IYUA 2BEJA 2D74A 3AF3A 3OIVA 1N6PA 5EAYA 1HQYE 3HOYH 2GXSA 2NPIA 4DB4A 2CWAA 1Y8PB 4LJ4A 1NBMA 1U0LA 4TT3D 5FBRB 5E3HA 4CDGA 3NDPA 4GNXC 3TR0A 1AZSC 3ZS9A 5C3EH 4CEHA 5FTKA 2AK2A 5KNCA 3CRRA 4C9BA 3I4OA 2B63H 3NHAA 2GTPA 3D3QA 5EP2A 2HXYA 3RVBA 2OO7A 1J2JA 4DUYQ 1E0SA 3BE4A 4OHYA 3THWB 1Q81C 4DV1L 2FZLA 4AKIA 4TMXA 2VL7A 4LJ8A 1IN7A 3VHXA 1P2TA 3MUFA 4F4JA 5EE0A 1TQ2A 3CC7A 1Z0KA 1PV4A 5J4LA 1E0JA 1W0JD 1LACA 2Z5FA 4LF5L 1ZP6A 3SHFA 3JVVA 5KU1A 2A6EC 2MMGA 2QNRA 4CT5A 5JEDA 1F2TA 3P20A 1LS1A 1QUQA 3AVXA 1ZUIA 2JA1A 4OWXB 2P67A 1YNXA 3TRZA 3VR3A 1IXSB 1M1YE 1TU4A 2WAXA 3GJ3A 1KKLA 3EA0A 1K6MA 4OJQA 3QG5A 2NZHA 3UE1A 4HLCA 2GVBA 3CC2A 1XJCA 3LDAA 1LB1B 5EE1A 1HEIA 3BFKA 5JEAG 1I6VC 1ONBA 3ZQJA 1EFRD 5J3BA 5F3WB 4D2IA 3N6RA 3K7UC 2R92G 4NPSA 2ZU6A 3BD9A 2UXCQ 3ND9A 1TWHH 4AIIA 1XEFA 8OHMA 2XZOA 4CF7A 1VF5C 4LF4L 3K9HA 1D2NA 3GLFB 3FFBA 4KHPL 2PNRC 4H0LC 4KHZA 2ZJ2A 1XRJA 5GJVC 1IY1A 1KJYA 2DUDA 4DZZA 3B85A 2GBLC 2LCFA 4PZZA 2C95A 4OKSA 1K83H 1NMGA 4PC3A 4KKTA 1JPNA 4V0LA 2O0KA 2ZR0A 4DV4L 5G41A 4GPTA 4B3BA 2IWRA 4JYAQ 3CPFA 4IXNA 2CKZB 1ZNXA 1CXZA 1KSHA 3KJHA 1OIXA 5C4XH 5LD2B 4C4PA 1HUQA 1HNXL 2P6UA 4LX0A 2OAQ1 3K70C 3AFPA 2FFQA 2PT7A 4YHHQ 1R10A 2C5LA 2QAJA 4TMVA 4IFDH 4WJ3M 1EFRA 2G3YA 4M2LA 4TN1A 2JIZD 1OB2A 2FFBA 2IYXA 1UAAA 2ZRGA 5K36H 2ZJBA 3T06B 2DYKA 2RAPA 1L2TA 3VFDA 1JBKA 1GNPA 4LBVA 3EN2A 4A93H 1XEWY 2V8OA 4M9ZA 3H0GH 3NEYA 4WXRA 2PBRA 2AWOA 4B3RL 5IWAQ 2HHHQ 1S40A 1CULC 4M1KA 4P33A 4EPTA 2PJRA 2ZRCA 3QXHA 4G0NA 4BY7G 1HZ9A 3JVUA 1A5TA 3SE0A 1AH9A 1P4SA 4RD0A 2H1LA 3CCUA 1YZKA 1GHJA 4PTLA 2RCNA 1GAJA 1WA5A 2OLJA 1XMOL 5DISB 5CIQA 5TV2A 3GLIA 5DH9A 3AF4A 2QRNA 3W5OA 4B3FX 4DK0A 3G48A 1FQJA 2D5DA 4A3LG 2IBMA 3ZYCA 5K36G 2EWVA 1EFTA 4HYYA 1G8PA 3HDTA 3HU2A 4FMDF 1UBCA 3CR8A 3GJ4A 4HAZA 4M1WA 4G5RA 5K8IA 4PX9A 5GAEC 1Q22A 3SI7A 3UMFA 1OXTA 3U4ZA 2DFNA 5IP9H 2EXDA 3A1WA 4HUQB 3I4LA 4LFAL 1Z0DA 1HE8B 2NZ8A 1L1OC 3BIFA 2P5TB 1QHYA 4H9GA 2XOKA 1VQNA 5IT9c 4JLOA 3U3MA 1CJVC 1DXMA 2F52A 2ZUBA 4B73A 4M53A 1W4BA 2E87A 5HR5A 3AVTA 1W49A 1J70A 5IP7H 2BKUA 3GLHE 4QG7A 4QBHA 3NDBB 3H86A 3GJ8A 1SR3A 3AGQA 3Q5DA 3CCMA 2G77B 2GJKA 4EAQA 4ZDIA 1M8PA 1JMCA 3TSWA 2R92H 4NCKA 2GESA 3DO6A 1NBME 4O2LA 4C3ZA 1CSQA 3A74A 3KJPA 4M1YA 2BEKA 4QHYA 1CR4A 2W58A 1XXHA 4LV6A 4L5BA 1O3YA 4UNRA 2AX4A 4PXAA 1VQAA 1IBML 1SKQA 4BLQA 2GEVA 4YCWA 5BXQC 3ASYA 1CTMA 1YZ6A 2EVBA 2N8NA 2A7QA 2OCBA 2NZOA 2QT1A 3EBEA 4DR1L 1NJFA 1M90C 2NN6I 1TF7A 5HCIA 2REBA 4JZKA 1D6JA 4DR6Q 4A8JC 1N6IA 1Z63A 4O2DA 1M7GA 2QGNA 3S16H 2FNAA 3HYRA 2C78A 3GTQH 1E2WA 1MO5A 3K0CC 4LBZA 3N2EA 4LWZA 3KOJA 1EOVA 1I2DA 1K0RA 1NMFA 1XMIA 1Q46A 2WAQE 2WSSA 3T1HQ 4JLJA 2Y8EA 2QA5A 1XMJA 4RZ2A 2PI2A 2OLKA 1Y1VH 2NVYH 1YHQA 3O8CA 4PG3A 5FBQB 1Z0JA 1AQUA 2W0SA 1DAGA 2ZVPX 1QF9A 1R8SA 1HR0W 4XSGA 5LMNW 4HIMA 1W4RA 2NIPA 3BB3A 3FKSD 5L8VA 4B71A 4GOPB 3PEYA 3L0IB 3CPWA 4LHYA 4ZDWA 4QJ3A 5BWMA 4IEEA 1YZLA 2ZRHA 4YMSA 5IYDG 1G3MA 4JYCA 5KDLA 2BA1A 4DLXA 1P60A 1P8LA 1VQ6A 3G4SA 4A3MG 2JCSA 2RHDA 4PC1A 1OH8A 2OCYC 2K7VA 1IBLQ 4NCNA 4BFUA 3OIWA 1XBTA 4LK1C 1ONLA 4YXWD 1JR3E 4C3IH 1SRUA 1ZIOA 4JYAL 4UXHA 3TH5A 4A3CH 1FNMA 4RZ3A 3TKLA 5LMNL 4WA7A 2LKDA 4A15A 3U3OA 4KMUC 3OAAA 4P4TA 3KF6B 5AJZA 3QG1A 1UE6A 5G53C 3NWJA 1P3JA 4RD3A 4OK3A 5FI1B 4DUGD 3WP1B 4ZPXA 5KSZA 5D3MA 1RYFA 2YWEA 1GUAA 3SYNA 3VDYA 4HAVA 1YE8A 5LD2C 3LBHA 1RYHA 2AFIE 4A76A 1AA9A 2AHOA 1EWHA 2GZAA 2N1BA 5FPTA 2JLXA 1E3MA 1U9IA 2QP4A 3QOFA 2IA5A 2J87A 1N25A 2WOOA 3T12A 3A4NA 1NBWA 3AVQA 3KTAB 1EWIA 1P72A 3NKVA 3J80i 2HIVA 2ID0A 5H70A 2IXEA 1M2OB 2WMOB 3TVDA 4RD2A 3BERA 1TL7C 3HP1A 5TY0A 2WWYA 4JSTA 2G0TA 3SZRA 1FJGQ 5JI2E 4B48A 1TEXA 2Q3MA 1KK2A 4IJMA 4AK9A 5FBVB 4RFSA 2D0OA 2P65A 1DGSA 1DTSA 1U8ZA 5FBLB 2ZSFA 4IJHA 4FMCF 4L5RC 1RJ9B 2OFOA 2EQBA 1LUZA 121PA 3ZGXA 4X66L 3QKRA 4IRUB 4JI7L 4TLAA 3TW8B 3FMCA 1ZAKA 4V03A 4JI7Q 1F48A 1ELOA 3IIJA 1HR0Q 3QEJA 4BFTA 3U60B 1KY3A 5HKKA 3IKJA 1G3IA 1WF3A 1R5OA 1EFUA 2ZI9A 3T51B 1GILA 4DV4Q 4D4MA 3VNVA 3B82A 4DCSA 4JLDA 1PLLA 4IPCA 1FZQA 1VCMA 3B1WA 4TTPA 3I92A 4H1UA 3DVLA 1U2RA 3CXCA 2H5XA 3K0SA 1TWGH 2FPKA 5IF9A 1IXZA 5M3FG 2VY3A 2CL0X 2GCPA 1GJXA 2Q9CA 3B1XA 4CIDA 2GK6A 1Q1EA 4IOJA 2ODEA 2VBCA 3N5CA 3JZAA 4OHZA 3E1SA 4PHTA 3J7A5 1FMJA 2GHIA 3QQ5A 3M4PA 4G01B 1IBKL 4I7ZC 2NN6H 1V9PA 3BAFA 4HB2A 3CM0A 3C8UA 4DLZA 2HUPA 3UWOA 3RC3A 2Z83A 1T6NA 4LC0A 5TXGA 5A4JA 1MV5A 3SJBA 3CPHA 3SU8A 3A1TA 3RS2A 3U44A 2QEQA 4GNXB 4LPSA 2XJ9A 1T5LA 3A8TA 4IDHA 3WHLA 2CDNA 2UU9L 3T56B 2CCKA 1R0WA 1DVRA 3CRKC 1NN5A 4IOAA 2FFHA 3D7MA 2XOKD 4GP7A 1XF9A 1HA3A 1Q12A 2VS1A 4EX5A 2PL3A 1E9CA 3I8XA 2KHIA 5HZHA 3OEHA 1G64A 5CK4A 4OHWA 2GDJA 4GBMA 3GLFE 1ZNZA 1KI6B 2UXBQ 4GSYA 2GF9A 2VQEQ 4Q9LA 3HOVH 1IZ6A 4L5TA 4EPRA 4NMMA 3AUXA 1AS0A 3I56A 1A82A 5JECA 1GRRA 2G88A 2O8EB 1G5RA 3DZDA 4ZV4A 2Q9AA 2IY5B 4GZYC 2ZM5A 5JZVA 3EC2A 2KCMA 3A8JE 3S1QH 1T3SA 4FWTA 2HT1A 3FKIH 4OL0A 3T1VA 4L5QA 1U0HC 3T1QA 1IY2A 4JI6L 2JJ1A 2ZS7A 721PA 1PLJA 2QN6A 4V02A 2CVHA 2WWWA 3KLRA 2KBEA 4Z1MD 5M5WH 3FKQA 2FEOA 4DLVA 3QJYA 1NG9A 3MEFA 3CKLA 4DR2Q 4A8JA 1LF0A 1U98A 1JEDA 2J59A 3K0CA 4OHXA 1XTRA 3G5UA 4TL7A 3KQKA 1KGDA 4Q47A 4GT1A 2OSBA 3UMSA 2VEDA 2ZTCA 1NY4A 3X1XA 1ZC3A 5AUQA 4DIEA 5JHHB 4KO8A 1DCZA 1F2UB 2WWIA 3OFNA 4XVRA 3UWKA 4OI1A 4LJYA 1A63A 5FPSA 2OQ0A 3UATA 1GUNA 1KAWA 2OM2A 2W6JD 1GSIA 1LTQA 2PNHA 2E5LQ 4HAWA 3CUEF 1M7HA 2ZE7A 2CFMA 1X9NA 1U0JA 1Z0IA 3KXKA 1N6LA 1A8VA 3ASZA 3X1ZA 2KA7A 5FR2A 3W34A 3AVOA 4JS0A 2UUAQ 3R20A 4DKAC 4MDEA 2D62A 3S1NH 1LY1A 3I4NG 1DD2A 1HQCA 3DKPA 2H5EA 3CLVA 4R7ZA 3T1TA 4TVAB 2WV9A 4JVLA 3VU9B 5C4MA 4R4OA 2DB3A 1CEEA 4DV2Q 1ZW6A 5FUVA 4V0NA 1YEZA 3S14H 4Z54A 4HZUB 4C2MH 2N78A 4I99A 3LBIA 3SC3A 3VX4A 4LC1A
chains in the Genus database with same CATH superfamily
5J4VA 2BMDA 4DM4A 4J0GA 3OZ7A 4DRYA 1JZQA 2R2AA 2ZKLA 3EC1A 2OQKA 2BC9A 1XZDA 3BAZA 3RK0A 2C2BA 5K45A 2FPWA 2Q6TA 1BYIA 1LI5A 3MIZA 1ETUA 3TREA 3T7JA 3AUUA 1FDWA 2FMKA 5AI6A 1QIMA 4Z4QA 4KNYA 3H5WA 1RRKA 3C3JA 5MN4A 1JHRA 1N0WA 4OQZA 4N8X1 5EQ0A 3DHEA 5GJWC 4TPKA 4JP5A 3K7AH 4KE8A 1HG1A 1V6CA 2QDBA 4XWGA 1E98A 1KIMA 3V4PB 4BVBA 3FCAA 2YZMA 3QP9A 3W1WA 2P8SA 4EKEA 4JL6A 4H17A 4WGFA 2CLKB 4DLLA 2ENBA 2EV9A 5F1YA 2RFLA 2WOJA 4N0DA 1KKMA 4C0WA 4Z4GA 1RE0A 5B3AA 2C7OA 2YV2A 2X19A 1RDFA 3CFYA 3WO0A 4QJ4A 3CHBD 1X1QA 3IJ5A 3BWCA 3GRKA 1BHO1 2C2WA 5E1BA 3W5CA 1QVZA 4DR6L 2PT5A 1IBKQ 2LBPA 2ZRIA 3W5HA 3QXCA 4U2BA 1JQYD 3OW2A 3FWHA 3JQGB 3JAML 3HYCA 4LYGA 3LQFA 3BSFA 4FLEA 5IM4F 1H4QA 2QLLA 5ULLA 5C52B 4HCJA 2AQ8A 3JARB 1FYVA 3QW2A 4IXTA 4E22A 5ICGA 4LSWA 4TS3A 1EFHA 1OTHA 2F4VL 2BR4A 5EP4A 1T5BA 2JGLA 3HJHA 4PLVA 1DOAA 4WAUA 4AD8A 3MZ0A 5TF0A 1ZD8A 1QG2A 2GBPA 2PX3A 4A8HA 1EU4A 3H15A 4YAUA 4MVCA 1H9KA 1K73C 4Z0NA 1GV0A 4AUEA 1HH4A 1JQBA 1U28C 1E32A 1J90A 4BWGA 2CUZA 3T7SA 1D5CA 1ID8A 2E4ZA 4MINA 4X71A 2ZRPA 2YASA 2P30A 3CC8A 4HDMB 1FZTA 2Q5FA 4GZLA 1HFEL 3UH0A 4YRBA 3GCXA 2W2LA 1Q1ZA 4DC1A 1PZEA 4QQKA 3SAJA 1CPYA 3DMTA 3E9IA 3IBSA 3U3RA 3X2SA 5LXTA 3D4DA 5JJ5A 2H2AA 2FZVA 1SCQA 3LOQA 1NVFA 2H31A 2O5RA 3HDVA 3VR4A 4G5SA 4RQUA 4EWLA 3GFOA 1HZZC 1OA0A 2NXEA 1C8VB 2YMQA 3NBYC 3NAMA 4RLHA 2YMMA 5H5JA 2Q6IA 1D1PA 3NLLA 1YL6A 1UBUS 1XZMA 2EGGA 2RAFA 4AFNA 1DTEA 3BQ9A 3TKAA 1LT6D 1Y9DA 3GZ4A 1BE6A 1DAEA 4DDWA 1VYUA 4DJAA 5A4MS 5JZSA 3J81j 5JCOA 2WF8A 2ATWA 4LNHA 4URXR 1Q82C 3L7KA 2AI3A 4YREA 3F8TA 2BFMA 4P7KA 4X1YB 3TEJA 3GRFA 1KQOA 3BH0A 2VTVA 5TPWA 5EP1A 4CYMA 3OPYA 2H8GA 4B3RQ 2Y6VA 5IAJA 4J0CA 3HXOA 2AH5A 2EIXA 3DZFA 5LQRA 3UK6A 4N9WA 2DUMA 3GFGA 3R7WB 4DDVA 5KNDA 1T1EA 1CDZA 2QQEA 2ZI7A 5I3CA 2Z5VA 4D79A 4L4SA 4R71A 5HRUA 5FHRA 1N5OX 1NIPA 3OP1A 4MH0R 1EIYB 2NTNA 3AUJB 3ET4A 4TRNA 3IRVA 4ZHQB 1MSGA 1L3BA 1O9GA 1GZ5A 1RLMA 2AS0A 2X5NA 1BU5A 4O2RA 4RBNA 4FE3A 2HHJA 2Q2WA 3L01A 5IXYA 2HWYA 2I0FA 2V0CA 1QGAA 3CXUA 4S2UA 3UT5B 4PNEA 3D31A 1UJNA 2XXAA 4REMA 4RK6A 4C3HB 5LR6A 4DA8A 4DNOA 4EG6A 4A3BG 2YFHA 3MJEA 3Q40A 5KJEA 2N3SA 4E3WA 4L50A 4IXMA 4NBVA 4K6LA 3ENNA 2C4KA 2WDPA 2QD5A 2QLBA 1GVHA 1F9PA 3RZOB 4OU4A 4Q7KA 1SMYD 3NTHA 2NN6G 2PO4A 1UP7A 1XXHB 3QPVA 4MZXA 4XYEA 2XRQD 1WZEA 4E5PA 2NUAB 2PUTA 3BE5A 3V34A 2Z3WA 1Y6GA 2G8LA 1KQSA 1X77A 4OQFA 2ILVA 3C7AA 5EMKA 4BE4A 1UXJA 5DI3B 5JOQA 2NVOA 3SEAA 4G1UC 2CL6X 2ZM6L 4UNIA 5B36A 3E81A 4BLSA 5B30A 3WJ2A 3W1BA 1YJ9A 3BD7A 1I3QB 2VG8A 4OJNA 1N34B 1BE8A 2PZFA 4N0QA 5CYOA 1SC1A 1RP1A 1CZRA 2EPBA 1JOQA 2AR0A 3LY8A 4BAUA 3OJCA 4LZLA 4Z7NB 4O1IA 3T52A 1LSOA 4TS1A 4BB0A 4RTSA 5CBAE 5IWAL 1UC9A 2X86A 4XRRA 4JBYA 2LIVA 3VDQA 2WBLC 1J7JA 3KF6A 5KREA 5JXJA 2ZTHA 3H8WA 2OBMA 3LQ4A 5E6SA 1Y1PA 3ZHOA 4YMUA 3OECA 3OMXA 1RKVA 2QE7D 1DEAA 2AUNA 5D3ZA 4G0WA 4G81A 3NBUA 1QR6A 3RE1A 2Z2YA 2A1UB 3KVYA 1IY0A 4FFRA 4GFDA 4KCGA 3PWKA 3TZHA 5KBYA 2QAGA 2EXZA 5SYAA 4ZT3A 3MXNB 3U3XA 1KR5A 2VJKA 3OTQA 4JIGA 4K2KA 1BO0A 3FSRA 4N0MA 4RFBA 3WQBA 3WV5A 3COZA 2M2LA 1FTSA 2V98A 4MVJF 2FX2A 3REGA 5L3VA 1VLHA 1RPZA 2J3KA 1HQRD 1DRKA 1EEFD 2J31A 4KXNA 3A25A 4EZIA 4KTTE 2XZPA 3BMXA 2R3ZA 1BH2A 3FVVA 1CU1A 4YJFB 1RXIA 4OB6A 4PWYA 5K0TA 3SYKA 2RHSB 1IM5A 1C9MA 4R1SA 1A3UA 1NFQA 2JSOA 3ZK9A 5JASA 5DMHA 1G6HA 1QO9A 2C7VA 3ORHA 3PFGA 3T9BA 4PMBA 3I53A 2YX1A 4AYBG 1X1BA 2YFYA 4K6DA 3IFTA 2B2VA 1C1YA 1J0AA 4WCDA 3AG6A 5D00A 1LLDA 5BV8A 3ZJVA 4UE2A 2DX7A 5CVDA 5J63A 5KEIA 1XDGA 2JA6B 5EFZA 4DLUA 2IYNA 4MIEA 2RH4A 2GETA 3RPEA 2C04A 3QPAA 1N33L 1GPKA 2I33A 2A74C 3PCRB 2A5GA 2QRQA 3OTOQ 4KBFA 1UXKA 5BURA 1BHQ1 4LRWA 4NZPA 2FW1A 4GGMX 1U8YA 2P3LA 1TYEB 4Y2UA 2JI7A 5AW6A 3AMUA 1V2HE 4EF6A 3SXUB 2NAFA 1VJGA 3D64A 3NVDA 1D2BA 5IANA 4BNFA 4PSVA 3K9FC 3GLFA 4EKGA 3SVLA 3ZJYC 4IVNA 1IJFA 5FEMA 1KZGB 1D1QA 2PH5A 2EW1A 4B2PA 2OEOA 5C44G 5JT1A 3DWFA 3G5MA 1SVKA 2BMWA 4P71A 4IIBA 2EWWA 3MRTA 1P17A 3I6BA 4HJ8A 4OM8A 3EDOA 4I9NA 4U5XA 5MN6A 1DHRA 1KC8C 4QX6A 5KYWB 4DSUA 4K9NA 4HMOA 1E1CA 4DQ0A 3F8SA 4O4LB 3JVEA 2R7ZB 2BJHA 5DWVA 2P11A 3W4IA 3A55A 4E5SA 3PNBA 2WZDA 1GFIA 5EPEA 4R16A 2REXB 1OX4B 2UZAA 3H2BA 2GBFA 3RW9A 2KCCA 4AY6A 1CJBA 3PGVA 5C3EG 3AVPA 1ORWA 3D3RA 3QLUC 4LDAA 4RS4A 4HX9A 4PX2A 4GLVB 1FJ2A 3HMQA 3I01A 1B2RA 3SDBA 2K5NA 1PJBA 2QTFA 1CR0A 4KXYA 4YDHB 5CXXA 3PQFA 1MT0A 1OX4A 3NEMA 5FOXA 1T2DA 1M9NA 3PBKA 4ZV9A 5BR4A 2AFIA 2L55A 2B2XA 1EFPA 3HCPA 3I34X 4ZP1A 3WFIA 4EY6A 3IPLA 1LPAB 1K6XA 1HNZB 3UAXA 2FWBA 4BBPA 4J0FA 1ETHA 3ZU5A 1ZONA 1W87A 1Z6QA 4PZUA 3OZTA 4TGLA 2RMKA 2VH1A 3Q7IA 4ZQFA 4JROA 4KPUA 1BKSB 3FSGD 3FRIA 1K9MC 4NNJA 1MJNA 3ZJ4A 3KLNA 3VZPA 4K5WA 1PP4A 2EHJA 2X4LA 3S2UA 4TTAA 4YMGA 4RM2A 2D2CC 1IBCA 1JJIA 3HZOA 1BRTA 5F7JA 1JTEA 2HDOA 2J9YB 4XTCS 2JFQA 1E3QA 2QL9A 3AHJA 3PQ6A 4I9UA 3KEOA 2ZSKA 3PNLA 5HIJA 2PX8A 3HO8A 2NVQB 1KO8A 4LFBB 1ENYA 4XYMA 5DASA 5SZJA 3T16A 4TN5A 5EPKA 4B5KA 1COZA 1S3FA 4KQ6A 5ICEA 4LW1A 3RLFA 2CLDX 1GZ3A 4DA9A 1ZH2A 5GMOA 4QD3A 4F3KA 1GKHA 4B4OA 3BEOA 2B8WA 2DUUA 3UWMA 3WMWA 1N5IA 3B78A 2WKQA 5IU6A 1OVMA 3W6UA 4ZRZA 2D7DA 1YH3A 1FJHA 5BW5A 2B5OA 2VFAA 2VF5X 4N5IX 2Q0QA 1WUIS 2Y0SB 3GLUA 5K4AA 2NP6A 1EGMB 1J21A 4FP9A 2E74C 3HSYA 3A0RB 5D6OA 1AZPA 1JKMA 4WKNA 1VLLA 2FQWA 1GM5A 3K0FB 3N39C 4JZYA 4OOFA 3R3XA 1D1TA 1E89A 3N8DA 4Y67A 3DC7A 5EJ2A 3ZHBA 2OZLA 3JU3A 1EX6A 2Q4TA 4B6EA 2LMCB 3DYIA 5LLSA 3MCAA 2EP8A 4YQYA 3KLBA 1GLNA 2VNUD 5AVZA 4S1VA 2AUJD 1X1CA 1W3SA 1L6IA 4NLLA 1XZGA 2I66A 2J9RA 4DCJA 1TAUA 1MXHA 2X9VA 3UGQA 2BGMA 1QONA 1DPFA 2BIFA 2FW0A 3CUKA 5COQA 3QVLA 2I5MX 2EWMA 1MIOA 3LBFA 4QU0A 2Y4NA 4IKEA 2HBYA 5A3VA 3TM5A 1PH8A 4TTVA 3VR4D 1D7QA 3VNRA 1MJEA 2C8VA 4C2BA 2X8LA 1DS6A 5JAMA 2R8BA 1BG6A 2JANA 5C37A 4NFLA 4HNGA 4MJ3A 2QF7A 1DG1G 1RLIA 4Q3NA 2FPPB 1QNLA 5KYWA 2VZ9A 1YJBA 3UJNA 3OFJA 4LF7B 1HRDA 1TT7A 3C7KA 5CFRA 1UQUA 2E7ZA 3MK31 4YY3Q 2AG6A 4B9AA 4WI1A 4C43A 4IUQA 1KMHA 1W6KA 1XVTA 5H1YA 3T4XA 2C98A 4R2HA 3R8CA 5BP7A 1XAGA 4P6VF 4LF6B 1JR0D 2A69C 4LOKA 4J15A 3HVIA 5LQCA 1RPJA 4QELA 2FG5A 2JLCA 2Y0SG 4GIBA 3ROTA 4ZZ3A 1QFZA 1Z34A 1J6QA 3LPNA 1EAYA 4MRSA 1TQ6A 1XWWA 1FVXA 2O8DB 2H1FA 4II7A 4Q7EA 2OP0A 4ALKA 1JVNA 2GTIA 3CVOA 2ZUDA 1AKRA 2JA8G 3S2YA 1AS3A 3SY8A 4XIFA 4G0VA 4KJOA 1WCYA 1WP9A 2QW8A 4JASB 5CRIA 4JP3A 4D43A 4ZGGA 1EWCA 5A6SA 3ZX5A 1SEBD 4DMFA 4YP1A 4RHXA 1L9XA 5F5XA 3KB1A 3RT1A 2DJ5A 4FUQA 3ENVA 3TP8A 2IYLD 2YH2A 5JSQA 5EGTA 1DJLA 3I6YA 1ZCBA 3LCMA 1EX1A 1RTNA 5AESA 2I4MA 2F17A 2OE2A 3COWA 4ME3A 3TIFA 5ALQA 1LPPA 2C2HA 4AMZA 3THYA 4CQMD 3KDFB 1I6HB 1CSPA 3Q8DA 3ANXA 4P84A 3ZTWA 5FJIA 1DL5A 1EYCA 4GKJL 3E84A 3NP9A 4BP9A 5BN4A 3A11A 1YZQA 1X32A 3S1RB 2V1CC 2IPAB 4YGXB 2XCTB 2EZ8A 1WTAA 1U6KA 3DDOA 3TLZA 3LKDA 1CUAA 2NXWA 4GXTA 4YBZA 1L3CA 4LDRA 4YXWA 2O3SA 2PXCA 4U2FA 3VAAA 3R9XB 4HYTA 1FOEB 2O2SA 3ZNNA 3W9YA 5CVJA 1B43A 3DL7A 3B6KA 2PNJA 4Y9SA 1XVAA 3RSOA 2CK3D 4KKSA 1M6VB 1RVV1 2ZYRA 4IHJA 5TPZD 4B3HA 3PWSA 4F6CA 4AJLA 4WCVA 1K4KA 3RUPA 3IHTA 3HV0A 2G1PA 3MB8A 3TBFA 1EWVA 1O4WA 1KC3A 3BD8A 1PYDA 1NI4B 3NTRA 5D84A 4Y1GA 4QM7A 2ERYA 1E6EA 4LEIA 4OHFA 4YJ2B 2IH4A 1GAXA 4WZ6A 2I0QA 1HDZA 1JJAA 2IUYA 4B43A 1N32L 5PNTA 4OWWB 1B6TA 4TRJA 1VBFA 1DPGA 4OYHA 1OASA 4D80A 3JQAB 4YCCA 2GF0A 3DPSA 2NYZD 4MTKA 1YRBA 2QXUA 2J7ZA 3KX2A 3QEMA 5ALXA 3Q11A 1WB4A 4TMYA 4MK4A 4UM9D 4WXPA 1UBKS 4ALMA 4EEKA 2PZTA 4ENUA 2WWFA 4JR2A 4LV8B 1CR2A 2CY0A 1QQTA 1NG1A 1B15A 3JZDA 3H9GA 2C3OA 2VAVA 3QKTA 3KFXA 1RHJA 4NPHA 3S7TA 4UD2A 4D9EA 3MCUA 3QPCA 1GZHB 1W44A 3E0QA 1RZRD 2JAUA 2BZSA 5ICFA 2GN2A 1Q74A 3BIJA 4L6IA 4AZVA 3LTNC 4QARA 3HOWB 5BQXA 4HN7A 3IHKA 4GSKA 4Y2SA 1DJMA 4X65L 1S01A 4V0KA 3MC0B 4P4UA 1TWFB 1BD3A 1ULUA 4I4TF 2QTGA 5AWFC 4B4UA 1B7GO 3RVSA 1DIRA 2J6IA 4L6AA 4BLWA 1A71A 1WMBA 5IP9G 3Q5GA 2JASA 4KH1A 2NYVA 3VI4B 3TRDA 3WDLA 3E58A 1ULZA 1ZN2A 2IDJA 4C0SA 3OF3A 3S81A 4KFCA 3NFRA 2QUIA 4LMRA 1JORA 1NSYA 3MILA 3NNDA 2ZVJA 4CDNA 2B4TO 2H07A 2XF8A 4IL5A 5EFOA 1T5IA 1U8CB 2D2XA 2W2QA 4RV4A 1YC5A 4LJRA 1TAQA 1DWPA 1YQEA 2ZIAA 5CT9A 3K35A 4BNGA 1Z47A 3CUTA 3DM1A 2ZYVX 2FCRA 1DQNA 3E9RA 2CWWA 3K8OE 1U4MA 2G76A 4I5IA 2ETXA 5GP1A 5H7XA 1NZJA 2HLNA 1M66A 4OM7A 4ROTA 4AJ2A 3GJQA 2VEOA 3QZUA 4JBKA 3SVMA 1XDDA 2HC9A 3EXIA 1R12A 4KY7A 1JB3A 1QX4A 3R6TA 1Y4SA 1SSOA 1UOPA 3Q7QA 4DMKA 1DTWA 4MQFB 1YUBA 4G9BA 1WEHA 3WHKA 2Q62A 1S2LA 2EDAA 3BTUA 3SJZA 4ETNA 3GUVA 4NJEA 3PUXA 5KIXA 4B3TB 3K70B 2QVBA 1G6PA 2X9GA 3H4TA 3QIAA 2YZ2A 3PD7A 5FO1A 1EESA 5AK0A 2ZJOA 3BD6A 5C4IA 4KY6A 4O4LF 1DC5A 1SUPA 2QVZX 1RFLA 2KQUA 1EIFA 5BT8A 4ZDKA 3OOJA 2VJYA 4Y9TA 2ZSUA 1N1GA 2IIBA 3IDFA 1KD1C 4MLPA 1SMYC 3PU6A 2C9OA 5KNDD 3MTEA 4L5SA 4DAPA 3EHEA 5CB6A 4ZPJA 2YRFA 4DA0A 1KRSA 1WAMA 2AFRA 3PSIA 2XVXA 3DZKA 1PJ2A 3UUWA 1U63A 1P7CA 4QUDA 1HX7A 1U0BB 3IL2A 4NAVA 1E7QA 2YW2A 5E4TA 2RJNA 4JJIA 1BCPC 1S96A 5LKRA 4D3DA 1M1XB 5DPMA 3MGCA 2HGSA 3MEQA 5JLJA 3I9NA 1IJEA 1J8DA 1E77A 1UEIA 3LI2A 1PWZA 3KIPA 1A9XB 4GX1A 2PO7A 4ML3A 4TM8A 1Z68A 4IPGA 1OIVA 2Y3IA 4HRAA 4R9UC 1NP6A 1WCMG 5J1ZA 3VYRB 4JLNA 4GQIA 4UPDA 3EZ9A 2QE7A 1CKNB 3HBMA 4ZRMA 4C14A 4UTPA 1OYWA 2W83A 4JI3Q 1K92A 3PFKA 1WUJS 2DPYA 1PT7A 4B46A 5JY6A 4A3EG 1QUFA 2Q3LA 2QD2A 2H57A 2PZAA 1NNUA 5JMWA 3RYIA 4D74A 1G4UR 2L69A 3U4QA 4V0BA 2XQGA 3CPJB 4A92A 1K4MA 3T4UA 4KYTA 1Q3LA 3DAHA 3U4CA 5FPQA 1G5TA 4DOMA 4UOQA 1P2VA 1NNLA 4WJZA 2VK2A 2FFJA 4YRLA 5FFNA 3HA3A 3PDHA 3IPAA 3PNYA 3HB7A 4WLVA 5CLQA 1YQGA 1G8JA 2Q2TA 1TIBA 1YO6A 1HCZA 2VJAA 3I3OA 3KR1A 2NUPB 3OMCA 4O2BB 3VV3A 5A5DA 4G36A 4JDPA 4X7PA 1TUGA 5JPCA 4HHEA 1HYBA 4XDXA 2YN4A 5K6AA 1SGWA 1KH1A 4NBNA 3OEEA 1U28A 2F9MA 4G3XA 3V6LA 4BFSA 5GROA 3UDIA 1H2FA 4GLXA 1TM1E 2Y0CA 3PP8A 4AZWA 4CUKA 4LF9B 1ISSA 1FLDA 4N82A 2OL4A 3BQMB 1WI5A 3OA2A 2C5EA 3RYTC 4OXPA 5FLMH 3EEQA 3VKWA 4BZPA 3W3AH 4BFZA 5J2UA 3P26A 1XMSA 1I1QB 4Z1MA 2PWBA 4LJ7A 3SR0A 3UY4A 3GEHA 5IABA 3BKWA 3F2DA 1E2IA 2K4MA 4RY2A 1RI4A 1N2CE 2GEDA 3MT0A 3T1YB 4XOUA 3Q8MA 1EX9A 3PNOA 3E3AA 4WLOA 2FZEA 1KABA 1Y42X 2JZCA 4ARAA 5KPDA 5ISMA 1O4VA 5EJ8A 1BXGB 4MUXA 1DRWA 3KJGA 1TW2A 2N49A 4HFRA 4WKBA</