2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
3RS0A 3GLIA 4Q18A 3PCRB 4GN4B 5DLQC 1L4YA 3KKQA 3OAAA 4QBHA 2J0QA 1DG1G 1SVOA 2J9RA 4RD6A 5IHPA 2AWOA 3U4ZA 1HR0W 4HAUA 4C2TA 1J8MF 1X8JA 3AFPA 1LVGA 2XAUA 4A3EG 2BM0A 2YTYA 1QUQB 4A3LH 1M7HA 2C96A 4FMCB 2V1UA 3LLUA 4A3JH 4WVFA 4G7ZC 1S40A 2W6ID 4IOCA 4MGKR 3I72A 4AYWA 3CD6A 2B92A 1IYVA 2VQEL 2GK7A 2Q21A 4FXPA 4M22A 4MRNA 4WAUA 4OHZA 1II0A 4A1FA 4YHHQ 4V0OA 1IZ6A 2EQSA 1N34L 1VQ7A 1QUQA 3Q3JB 3THXB 1KO1A 1OHHD 2RCNA 4FMDF 4V03A 3ULPA 1XJCA 3AB9A 1GL7A 2EQBA 2JLSA 2QPAA 4L8GA 3GFOA 1VQ5A 1HT2E 4M53A 4NYMR 5GAHC 3R9IA 3C16C 4A76A 3KTAB 2CE2X 5A5GA 4B3TL 4AKHA 2IX1A 4KKUA 1G4UR 1P4SA 1XMQL 3THXA 2O0HA 2HLDD 4MKFA 4N0DA 3Q7PA 3NG1A 3FPAA 3M7NA 4JV5L 4MQBA 3RS2A 1Y1WH 5CYPA 3KTAA 4A3BG 1OF1A 5FOUA 4I1VA 5FOWA 4LF9Q 2R9VA 3T56B 2YINC 2ZAMA 1YVDA 1MJEA 1VG0B 4B2LA 5JEAG 1AE2A 1WCMG 1HNXL 4RD4A 5E7NA 5FOVA 4A15A 1MH1A 4HJ5A 3ZZ0A 2BHRA 4DV2Q 3SDZA 2IUTA 2AD1A 5FBVB 1CEEA 1QHXA 2KB0A 3D3QA 4B73A 2C03A 4EPYA 3VHXA 5FLMH 4JI4Q 2GBLC 3AVOA 3VTKA 3SJAA 3HKZG 3W1GA 1A0IA 2BIFA 1NG9A 2KENA 3A7LA 1VQMA 1NBMA 1YZUA 1K5GA 2Z6KC 4NXNL 2P6UA 3A58B 1TF2A 4FD2A 1YZQA 3TR0A 4L8JA 2E5LL 4L5SA 4HLDA 1YR8A 2L0XA 2AXNA 2ODEA 2R6GA 5HZKA 1E96A 3EW9A 1MABB 4OWXB 3QF4B 1XEFA 3QBVA 2ONKA 5FOTA 4BUJA 3UDFA 3WP1B 4H1VA 4PHGA 1EWQA 2QQ0A 4BBSG 1M2OB 3AKEA 3QKRA 1HH2P 5D3MB 1N5JA 4JI8L 4P4TA 4JS0A 4BFYA 2VSFA 3LXRA 2DWPA 2QEXA 5HCNA 5IP7G 1D2NA 821PA 1MABA 3QF4A 5EUMA 4R98A 4QJ4A 1LTLA 3OYYA 1SQ5A 1ZCBA 1NLYA 3U7FB 4Q1DA 4Q4AB 2QA5A 1N6KA 2MSCB 4PPQA 3KJGA 1E6CA 1FR3A 4DR7L 1CP2A 2UXCQ 2HXYA 4LF7Q 2QY9A 5D3MA 3V4RA 4Q1AA 2G6BA 2R65A 3J81c 4IO9A 4A3DH 1E98A 2QMUA 1ZVQA 2Z0MA 2BEKA 5EQTA 4BE7B 3NKVA 4ZI2A 4H9GA 3PEWA 1R4AA 3VA7A 2FU5C 5K8LA 1AZTA 1HA3A 4Q4AA 3HDTA 1O7LA 4OO1G 1BVSA 4MYHA 2XXAB 1PH4A 1VF7A 1N6RA 2FMXA 2W0MA 1GKIA 1P16A 1LY1A 4QRHA 4WA7A 5FFMA 1E0AA 2GCNA 1IXZA 3ER0A 2FZ4A 1KDOA 1B0UA 3K0CA 5M5XH 2R92G 4I1SA 5DLQE 5FBWB 3TNFA 3LY5A 3C8UA 1CF4A 2XXAA 4LFBL 3QPWA 5M5WH 2PBRA 2JA6G 4M1SA 1W48A 4HLQB 4URXR 2GXAA 4OL0A 1ESMA 4ERNA 1XJQA 2B3GA 5AUPB 3GJ6A 1BMFD 4P32A 4ZDWA 5GVSA 2QT0A 1TF7A 2W58A 4CF7A 2HYIC 5FUWA 3OFND 1Z0AA 2H7VA 2R6AA 3IIMA 5GJCA 3I32A 2NO7A 2WAQG 2LXKA 4L5QA 2F4VL 3B1VA 1FTNA 4KAXA 4G1UC 1GNQA 1ZRHA 1K8AC 1Z8FA 3U2QA 2XJ9A 3STBC 3S1RH 5DSZA 3BORA 4Q02A 3W90A 5JEEA 3R8FA 1RPZA 4C0KA 5LMUQ 2ZITA 4FWTA 2B29A 1HQMC 3AH8A 3GQBA 1NY6A 2OAQ1 4ZO4A 4OONA 1ESNA 2ZVQX 3LGJA 2F3IA 1R0WA 2JATA 3DOEA 3SQXA 1KI9A 3GTJH 1R10A 5G3ZA 2OWOA 4DAMA 3TZUA 2OLKA 5IYDG 2YVUA 5D3QA 3FWYA 3F3YA 4IDHA 4M1YA 1A8VA 2CK3D 1Y1VG 2J46A 3TQFA 3CPWA 4LI0A 3ASYA 3HFZB 4A0FA 3T1HL 1YI2A 4BZPA 2ASEA 4RD3A 5KSYA 4UQOA 4IQZA 2YTXA 2ZTSA 3N2IA 1Q8KA 4LWZA 1CSQA 3DKPA 4Q48A 2JIZA 1FZQA 2K50A 2PJZA 3BB3A 4JI2L 1X86B 1YE8A 4YMUA 1WCV1 4LC1A 3EN2A 2XEXA 1SR3A 4X8LA 4IEIA 4DRZA 4GP6A 2J87A 1TWHH 2PNHA 3S16H 4NZYA 1KMHB 2WTUA 4M1TA 1AK2A 2O52A 4UJ5A 4Q9LA 2QP3A 4EPWA 3PCOB 5M3MG 1PFSA 4JVMA 3BAFA 1VKJA 3FKSA 5M5YH 4OO1I 3WY9A 5LDDC 1XPRA 1A7JA 4FCVA 2PI2A 4APVA 4IOJA 4POAA 4BQSA 3KLRA 1PH1A 5F2EA 2CL7X 1S4QA 4C0SA 1WJJA 1KO5A 1JMCA 4RVCA 1KMHA 1LYLA 5KPJA 2FFAA 3TUZC 3CR8A 2VQEQ 2ZI6A 3QUSA 1OH5A 1EFWA 3MMPA 3GO5A 3B6EA 4TMZA 3RABA 5TMPA 3KKOA 3ZVMA 1KTVA 1S9HA 1XD9A 1PHJA 1N34Q 2BEJA 3PGZA 3PIPA 4KITB 3VR2A 2DFKB 3RYTC 3W3AA 2JAQA 3DZDA 2V55B 3U44A 4MDEA 1FYCA 4ITRC 3MCAA 2ZJBA 5KU1A 1BKBA 1E79D 3S1AB 3EC2A 4KHZA 1KY2A 5G53C 1R0YA 4DUZQ 3BIFA 2O5VA 3AB3A 4DLUA 4Y7NH 1ZNXA 3TR5A 3KUCA 2H5EA 2ZR0A 1YNXA 3SC3A 2ZSDA 4O25A 3E9HA 4MUAA 2LWIA 3GP8A 5CDFE 1VCMA 5JCZA 2JJQA 4IFDH 3NELA 4PZ6A 3STBD 3DLLA 1C9OA 1G9XA 1GG2A 1SKQA 3A1WA 3KUDA 3ADDA 3CW2A 5LB4A 2NO9A 1UEBA 5J47A 3BFVA 2BBOA 4GZLA 4A82A 3M6AA 4B3RL 1HNXQ 3T1TA 3MXUA 1YJ5A 2P67A 4B2PA 1GRQA 3HKSA 2BKUA 2GNOA 4LJ5A 4DLZA 2F1IA 4A3FG 3KX2A 3GD7A 1WXQA 2CJWB 3AGQA 4BFZA 1VG1A 1QF9A 1E3MA 4P74A 5FI1B 4HJ8A 4A3CH 3CCLA 3RS4A 3NTUA 4CRWB 1R6BX 2CKZB 4B44A 1EFUA 1NG1A 4NXNQ 2NZHA 3IFTA 3QVVA 3ZS9A 2E5LQ 2JJ1D 1KIXA 2OXCA 3FVQA 4BY7H 1OXXK 2GTPA 2CJWA 2ZVPX 4LRWA 1U81A 2R62A 3CF6R 3X1ZA 4BLTA 2IS4A 1KAGA 4HAWA 5DE3A 3T5DA 2XX3A 1Z06A 2IYZA 1Y8NB 2N42A 5KYKA 4KVGA 2FSIA 3GPLA 2GXQA 4J15A 4GNXB 1Y8OB 2YC4C 2F3TA 5HE9A 3UDGA 1JB7A 2A19A 3CONA 4LPSA 3A1TA 2VSOA 1NSTA 3G82C 4PZZA 1A4RA 2I5MX 2RGCA 2C5LA 3H0KA 2FFHA 3BJUA 4RD1A 1XB2A 3H1TA 1XZQA 2P5TB 1E1QA 2WWHA 2X8AA 4GNXA 4DR7Q 2QNRA 3K70B 2JLWA 5BN5A 3RZDH 4GKJL 4AIMA 3J81i 2GF9A 4PXAA 4WW0A 1X1SA 2V4DA 1SXJB 1XNQL 1XTRA 2DCUA 4IDNA 2PQAB 5M3FH 1T6NA 4NE2A 2MFIA 2ZJQA 2GEVA 4TL9A 3BE4A 2PX3A 1BBWA 1RZ3A 1S1MA 2R6CA 3RNLA 3OTOL 3HOVG 1KK3A 2FGKA 1SXJA 5F3WB 1E4VA 2VIIA 2CCGA 4G3XA 3EPJA 2PQAA 1ZUHA 4A3LG 4UNQA 3HGBA 1G18A 1VDZA 5TDHA 1JQJC 4DV0L 4GRAA 2Q2UA 4JSTA 1TXYA 1KSFX 1XJ0A 1M1KC 1J6QA 1SMYC 3RLOA 1YZTA 3I1FA 1RYFA 1SROA 3PV0A 3T51B 2AKWB 4XD7A 1T9HA 3I4LA 4OJKA 1X1RA 1MO4A 4TWZA 3B85A 1K6MA 2OILA 3C14C 1NMZA 3HU2A 3K80C 1YZGA 3NDPA 4CT4B 1N6LA 2KBEA 2RGNA 3U3OA 3ZDQA 1ZNWA 2F4VQ 2IBMA 2ZSFA 1WI5A 1NI3A 1YU9A 5IY0A 1VQNA 2ANCA 2C98A 1IN4A 3IO5A 4KKSA 3PUYA 5KSPA 1P3JA 5TV2A 4FCWA 4V0NA 1BYUA 3AKYA 2QROA 1X9NA 4O2RA 1XTJA 1EQRA 1Y1WG 1G5RA 2X19A 5BN3A 1AH9A 1XMIA 5J40A 3UWKA 3OIYA 5G3YA 4KLKA 1C9KA 4TL8A 3FMCA 1XWIA 3LVQE 1TQ4A 4XH9B 4LYFA 5CM8B 5EP3A 2QL6A 2PJRA 4M8NE 1D7QA 1XPOA 1C1YA 2NO1A 621PA 3SGIA 3CC2A 2ASBA 1K5DA 2QRNA 2XJ4A 3A1UA 3LD9A 1OKKA 3QKTA 4FDBA 2Q9BA 3UPUA 3UE0A 5FLMG 1Z47A 3MJHA 1HCZA 1XBTA 3TIFA 1W44A 5FJ8H 3T1HQ 2E1RA 4Q7JB 2CCJA 3RSOA 1JQLB 4Z51A 1TWFH 3EPHA 2XTNA 4MRSA 2I5LX 4IDOA 1ZC3A 1NMGA 4JI2Q 1N0VC 2C04A 4A4DA 3TRFA 2L5TA 2ATWA 1TX4B 2OM2A 1XCPA 4A3EH 2QM7A 2QPOA 2EJFC 4C0BA 4HB3A 3PG5A 5EE1A 1BS1A 3L0SA 2V9PA 2QBYB 2CFMA 2W6IA 4C0QC 4L15A 3CNOA 3AVYA 4W5JA 1Z07A 5JSZB 4D0NA 1WYDA 2WWXA 3LW8A 2WJHA 2J0VA 4BECA 5FLXc 5L8VA 1OHHA 2WMNB 3L8YA 2QBYA 4CEIB 3I4NG 3FGNA 4ARZB 1VIAA 1CI3M 2RB4A 4JI3Q 3ZZUA 5EZ5A 3RR5A 3BH0A 4B71A 3DXJC 4XTCS 4DR2L 1P9RA 4KFSA 4JI7L 4DSNA 1ANKA 1T5IA 2AFHE 5HKKD 2ECKA 4YMWA 2CHVA 5EE0A 3NC1C 4GMDA 2HLDA 3V00A 4ARZA 4AYTA 5IRCD 4CEIA 3A0JA 2OTLA 4QNRA 4HJ7A 4ON9A 3WHKA 5GADC 2OLJA 4NYIQ 4LUCA 1C0AA 3HOYG 2V3CC 3T1OA 1AGRA 4A3BH 4R2IA 2QEQA 3AVPA 3D8BA 2IL1A 4GN3B 1Z6AA 1YZ6A 2PZFA 3GJ3A 4LNQA 4RZXA 2PMZE 3X1YA 1YHNA 1WBBA 2R7DA 1WCMH 4JLPA 3BB1A 5L3SB 4A3GG 3U58A 2ODWA 1KNXA 1TADA 1I4DD 1I5FA 4B3RQ 3UDXA 5EP4A 3GDEA 3IHWA 4EJSB 1ZW6A 2EJGC 1JXMA 2UVQA 1UPTA 1CJKC 3TMKA 4KVAA 1XX6A 4BASA 1XTIA 2ZE7A 1ONBA 4C3JH 1L0WA 3IEVA 2VUMG 5L3SA 1U0LA 3F2CA 5HPYB 4AH6A 4LSGA 2VEDA 4R4CA 5A0FA 3SZRA 3W5OA 2JA1A 4MGYR 1DADA 3U6BA 4EJSA 2IYQA 3PR1A 1G8PA 4PPNA 1N6NA 5H1SE 1US8B 4ESHA 1U90A 4F4CA 221PA 1NE3A 2DPXA 1XTKA 5IP9G 3SN6A 3ZIAD 2UUAL 3BJIC 4C3HH 2PT5A 5AJVB 1VF5C 4YCVA 3N2EA 3GCGA 4U02A 4HAXA 4URZR 1IYJB 5IP7H 4QBIA 1US8A 2AK3A 2R6DA 3EZ7A 3CRLC 3TSOA 4BRWA 3GFTA 1XNRL 3PUXA 1KI4A 3H0GG 2BBTA 2QGZA 1G1MA 4X6AH 2HCBA 1I4TD 4D82A 2K5UA 2ANBA 4DR1L 1LV7A 4DHEA 1HZ9A 4DAYB 2F9LA 5IE8A 3WBKA 1N33L 5EAYA 1GRRA 3GJ0A 3A8TA 1VYVA 4IVPA 5TVKA 1E2ZA 1T5EA 1W0KD 1X8LA 1XNQQ 2DBYA 1X55A 1Y69U 4NXML 1N6OA 4G5QA 4K0KL 4PC1A 4OO1H 2W2XA 5EE9A 2BH2A 3DDCA 2BE5C 3AF1A 1Z2CA 3QI2A 2RMKA 4KFUA 1JJ2A 2XTZA 1W2GA 3ADKA 3W6PA 3BWDD 3OTOQ 3PO3G 3E9IA 2IYYA 1E2KA 2ZRPA 4JYAL 2R92H 3ZS8A 3U7HB 2PEYA 2IYTA 4FCTA 2DWQA 2IS6A 4LHXA 3RRYA 4EPRA 4BLRA 4DKXA 1ZIOA 3NE5B 2JA6H 4EUNA 2DFTA 5GQOA 1TMKA 2F7SA 1BMFA 1CTQA 3AKDA 3CCQA 1YKSA 3PO2G 2J7KA 4DR6L 1Z6XA 2C8VA 2RHDA 4KSBA 1NRJB 1ZAKA 3OFNA 2ZANA 1ZJ6A 3E70C 3TBKA 1ASZA 2YWHA 1GUNA 2WB1G 4MKIA 2DWOA 1CR1A 2ZRBA 1X54A 4DT1B 2PZEA 4BLOA 4YWKA 1GWNA 2IYXA 3B78A 2J7PD 2WBLC 1G3QA 4HB2A 3FHOA 3QG1A 1Q81C 4Q7LA 5LD2C 1HY3A 3VR1A 1EWRA 3QG5A 2WPDD 3PQCA 1TL7C 3MWLA 4WJ4A 1P60A 1XFAA 2REBA 3VR6A 1LFDB 3HR8A 2Z6KA 1FQKA 2B8FA 3PIOA 1VCOA 2QMOA 4IDPA 3W5IA 4DT1A 2NMVA 2YC2C 3PEVA 2EW1A 1IXSB 4JLNA 4EX5A 4QBGB 5IYDH 4ALPA 3U9SA 4MDFA 1TUEA 1JPJA 1K8OA 4JCVE 2OCEA 1U8ZA 1XU4A 2V1XA 1LABA 2CK3A 2VHQA 3TH5A 4W9MC 2WJYA 1Y1VH 4OHVA 4G5SA 1DG3A 1J70A 2QAJA 3AEZA 4KN4C 2LXJA 1G8HA 4JLOA 1J2JA 3REGA 3S15H 2O8DB 1NY4A 1U0HC 4P4UA 2RGXA 2A1AA 1KJZA 1E0SA 4R1JA 3REFA 4DCSA 4C7OB 2E74C 4YY3L 1JXOA 4LUZA 2IYSA 2IHEA 1EXMA 2GN5A 2ZS7A 2QMEA 2ZJ2A 1V9PA 2D4HA 3EASA 4PZ7A 1UE1A 1DAHA 5M3MH 3OEED 5JMTA 1XEXB 2E2JH 2DNEA 3AVVA 2ZSBA 1ZUNB 4C7OA 5CDFA 4EQ5A 2A6EC 4O2DA 2BE5D 4WOPA 5EE5B 2BVNA 1CKOA 1TF5A 1OPXA 4Z1MD 3OESA 4BFXA 1F60A 3I73A 5AR1A 5JRZA 3BZCA 1XD8A 1XEXA 1VG9B 2EWVA 1QZHA 4E22A 3CCMA 1LNZA 2FX3A 1N36L 3CZPA 3KJEA 1GUGA 2MMCA 3IQXA 2H16A 5DO9A 1H65A 3SBEA 1JPNA 1GUOA 4BFUA 1LACA 4LW1A 1HPCA 1IXRC 2BC9A 3K81C 4HLUA 3MGCA 4QHTA 5BYJA 3M9BA 2FXQA 1E79A 1FGUA 4DR2Q 2ERXA 3ZJYC 1KMQA 2ZYVX 4IVRA 4PC7A 3TK1A 4JI7Q 4PX9A 4JI6L 4KLZA 3GEIA 2WM9B 1FNNA 3FTQA 1I50H 3FP9A 4JI5Q 1CUKA 4RKEA 3U3KA 2D2EA 4PC2A 3TVDA 4BZQA 3K0AB 2XZOA 1C7YA 4D4MA 1A6XA 1WQ1R 3NH9A 4RFSB 1KOFA 2WWFA 3IILA 3NBHB 1XXHE 4TL6A 3L8ZA 1KK1A 1ZD8A 1P9WA 2FFBA 4KBGA 4MYUA 3B1XA 4NCNA 5L3QB 4B35A 2KCTA 3ECCA 3SHWA 4IFDI 1OYYA 1XTSA 3K0AA 1GL9B 3HOZG 2VL7A 1QVGA 1KYIA 1M1YE 4RFSA 1D8LA 3U3JA 3NENA 3TKLA 2G0TA 3OEHD 3TSZA 4NB3A 1KC8C 3AV0B 3THOA 3OPOA 1BH2A 2ZE5A 4HZUB 4TQAA 5HZHA 4Q4HB 2B8TA 1Z0KA 4P3YA 5L3QA 1H95A 3CCRA 1D6JA 4U7DA 2G1KA 4IJHA 2JA5G 1N32L 2WAYA 3CLVA 1IQPA 2P6NA 2QA4A 2YNMA 3AFQA 2FH5B 2JJ1A 3DMNA 1IN8A 4A2PA 1UFQA 2GCOB 3B1WA 3TAUA 1ASYA 2FE4A 4Q4HA 3WNDA 5K36G 3BGWA 2JE6I 2FOLA 5DIFA 2NTYC 1EGAA 3N6RA 5C0XJ 1F3OA 1YZLA 2PL3A 4IOLA 1UE7A 2UUAQ 5DISB 4BZXA 4LFAL 1XMSA 2A7QA 4DV1L 1I2MA 2GCOA 1PYSB 1K83H 1FL0A 2ZTEA 2JEBI 1ZCAA 3NBFA 4B2IA 3MUFA 1VQFA 3LWNA 4IEEA 4DV7L 1XNRQ 5CK4A 2XNSA 2V8OA 3EXAA 3CCJA 3IPXA 4DR1Q 1P73A 2KWIA 1Z29A 1R8QA 4GLXA 3DO6A 3QE0A 5IT5A 1N33Q 3ZD6A 4PSVA 2JJ2D 4UNNA 3BDOA 1VTKA 4TLEA 3NBYC 4JLVA 4NXMQ 3RSLA 1E2QA 3BFXA 4K0KQ 4H02A 4LHYA 2NN6G 1KI7A 2LMCB 2HYDA 3HPRA 1IONA 1KO8A 3LH5A 4M0LA 4QKQA 3UE1A 3HOVH 2I1VB 1GKHA 1V43A 1KKLA 4NDZA 2P3SA 5SZKB 2L15A 4MH0R 1Q1BA 4HIKA 3GLGE 2RF4A 1E1RD 2FA9A 2EIFA 4JYAQ 2A3RA 1DE0A 2ZJZA 3NHBA 4O2LA 4JI1L 2VP4A 3CWQA 4DNTB 2BDOA 1KSJA 3VHLB 2CNWD 2R44A 1QZGA 2KA7A 2O0JA 1WRBA 1R0ZA 2WIBA 1QJOA 4MZ9A 2G77B 1TTTA 5J4YA 2GAAA 5JBQA 1N5IA 3M4PA 3I7FA 1CLUA 2J45A 5JS8A 4BWYA 4WZBE 3Q8DA 3TQCA 1SKYB 4URYR 4C0LA 4CW7A 3IPYA 3KB1A 3RN2A 1Z63A 4TL7A 2IS2A 1TU4A 1S1CA 1Q86C 3FPPA 5C3EH 1CJVC 1NVUQ 3H86A 2OUKA 5LBIA 1R5OA 2IT1A 4ACBA 1FPMA 4B75A 3KF6B 4JT4A 1UBFA 2TMKA 2PPBC 1O78A 4GP7A 3UG7A 2Q2IA 3CX7A 2ORWA 4KN7C 3LWUA 1XZPA 3F1ZA 2ATVA 4EPTA 3EIQA 4NYIR 4JG2A 1NMXA 2PH1A 3GEEA 5K8TA 3QIAA 1S96A 3VQTA 4B3DA 4R4OA 1Z0FA 2YWFA 1TKWB 2LSSA 4LFCL 4JYBA 1JJGA 4LJ4A 3BRWD 1VQHA 4OKSA 4MUBA 4D80A 1JR3D 4AURA 3VU9B 3W6NA 1GAJA 1E3PA 4V02A 3L0OA 2EVWX 4HB4A 2J3EA 2QORA 3X1XA 3RRMA 3K70D 3PVSA 1NLZA 2YOHA 2QF7A 1K0RA 2WP8J 1ELOA 3P4YA 2BH8A 2NVTH 1NIJA 3F2DA 3TS0A 1VIYA 4QOSA 3FYHA 2Z4SA 4L9WA 3VU9A 4BY1G 1XMOL 4HIMA 3K0SA 4Q21A 4OXPA 2N78A 2QTVB 1NIPA 1E22A 1MO3A 4IKEA 1E24A 5H1YA 1Q20A 4UNRA 1FUUA 4YY3Q 4OBEA 2NZOA 2VQFQ 1J5EQ 2E2HH 1AKYA 1KO7A 2BMEA 2QENA 2YHSA 4PHTA 4PSKA 3LQRA 5JHHB 4TYNA 4AIIA 1IY1A 2PT7A 5BXQC 1KL9A 1FX0B 2VPPA 5KDDA 3R9WA 1WMSA 3AF2A 1JB1A 2ZI7A 4R9UC 1YIJA 3I4MH 1WB9A 4IPHA 2Y0SE 3J80c 2QG6A 3OW7A 4A9AA 2D0PA 4R4QA 4C3IH 4DSOA 1Q90A 3J81j 1JR3E 4JOIC 3DHWC 3P26A 1FMLA 1NP6A 5GAEC 1JBKA 4LF4Q 1MV5A 2FWRA 3EZ9A 3MLEA 4EKDA 1P62B 2GVAA 3LXXA 3A6PC 1FX0A 4LK1C 1E9DA 1YITA 1SN8A 3U61B 3MD0A 1S72A 1Q21A 4RZUA 3I4NH 4DK3C 2ZEJA 2ZJRA 3Q5DA 1XJVA 5B57C 2HCJB 3EQLC 2K4KA 1E94E 2WIAA 1CIPA 3BFKA 4HDOB 3WYAA 2F1MA 1NMFA 1NSFA 4JVLA 3QSYA 2BA1A 2OCAA 5HKKA 3FB4A 4L5TA 1HE8B 2WVJA 1AE3A 3IO3A 4J0QA 2C2HA 2FF7A 4A8JC 4JI6Q 4X8OA 4G01B 4AC9A 4Q1BA 3HOYH 4KFTA 3TUJC 4GLAC 2XGJA 3RWMB 4QQBX 2K5VA 4KODA 3K09A 3EIEA 5EXXA 3L2OB 3F2BA 1KQSA 1K8GA 2UXBL 1CXZA 1G16A 1NJFA 1IW7C 4PAOA 4WIAA 3T5GA 4YXWD 4UP7A 3CR7A 3KL4A 3EWSA 4A3GH 3K7AH 1M7BA 3C5CA 3TJZA 4DCTA 4GLVB 3CMEA 1K3RA 2ATXA 1JE5A 1IY2A 2YZ2A 4OYHA 5FL7D 5IF9A 5CM9C 4L5RC 3TREA 4KFRA 1KDPA 3N5CA 1YQTA 4MRPA 4KHPL 3WDNA 3A36A 4TMVA 3ADCA 1X3SA 2FPLA 2Q3FA 4FI3C 3W8RA 4DDWA 2JA7G 2VUMH 4HATA 1P2UA 1DAFA 4O0MA 3KJIA 4K81B 5FBQB 4IOKA 1GZSA 1MRNA 1O3YA 1N32Q 2RGAA 3CZQA 2NGRA 2K14A 3OF5A 2XNDD 3U5ZB 2VP6A 4NCIA 4DEYA 4KBFA 1DXMA 3KJPA 2DY1A 3VFDA 4ZCMA 3U50C 1NKTA 3ZIAA 4V0KA 3X2SA 5IP9H 2CW0C 1WBDA 4LF6L 1EYGA 2A5DA 2GVZC 3NBZC 4GKKL 4BLPA 5ELXA 3P1JA 4B3GA 1E4YA 4D6PA 2XITA 4LFAQ 3NBXX 2NG1A 2ZRCA 4TVAB 1PH8A 1GILA 3B9QA 4DV1Q 1T3HA 3CIOA 5P21A 2R6FA 5GJWC 4N0EA 2YWEA 1OB2A 3H0GH 1NLFA 3EZFA 4TMWA 3W34A 5B58C 3K9NA 3I5XA 3OOCA 3UANA 4KCGA 1W5TA 4TYWA 1OFUX 5KSOA 1N6HA 3PUVA 2ES2A 4A93G 2G88A 2CLCX 1KSGA 1CKMA 1W0KA 1RRCA 1VQEA 1P75A 4LX0A 4A6PA 3CRKC 4QJFA 2E75C 2PCLA 5JZVA 2QAGC 3SYKA 1TQ6A 2Q0HA 2K75A 5HY6A 1X8KA 4JLBA 3T1VA 2QSZA 1W36C 3PO3H 1G7TA 1N0WA 2NZJA 4HR7B 4M9XA 4D4LA 4P4SB 4GI7A 1H9JA 3H15A 4FMDB 1XCGB 2C78A 4PO8A 4EDHA 1H8HD 3U4QB 1GDDA 4C30A 1OLOA 4A4IA 3TVTA 4JI1Q 1MKYA 3H4MA 4LC0A 2DGYA 3HKZE 3LFUA 4URWR 3C7KA 3NDBB 3IRBA 4UY8C 1EOVA 2H92A 4D0LB 2D2FA 1RRFA 2QQEA 5DYGA 4OGQC 5CJPA 3EZ6A 3PO2H 1G7CA 2ERYA 3J7ZC 1B9NA 1VQGA 1F2UB 3TS2A 1YZKA 2IEZA 3HR7A 3MAAC 3MWYW 2ZIAA 2GAOA 2W6JD 2IWHA 1H9SB 1PV4A 2QMHA 4OK3A 1EWIA 1MO6A 1KI1A 2OHFA 2OO7A 1FOEB 2CVHA 3TQYA 1OXTA 4B3TQ 4CT5A 1PH7A 1Z6TA 3I3SR 3O8RA 4DSTA 2J7PA 4IJLA 1XMQQ 3OIWA 5FTLA 4XIGS 1F2UA 4MRRA 4DPGA 3Q7QA 4GPTA 2ZE8A 2WPDA 1H9SA 3DL0A 2WWWA 5KDLA 3ULLA 2UUBL 4JV5Q 4NL4H 2O8CB 3FKQA 5TY0A 1AJEA 1OXUA 1TU2B 1E0JA 2IHBA 1W2BA 2QE7D 4M4SA 1H9MA 4LFCQ 4PHHA 3SNHA 3V9PA 2VP5A 4P71A 4MYCA 2O8CA 1YJ9A 1S2MA 3A5ZB 3BXZA 4JI0L 1EX6A 2AN9A 2GESA 4DUYL 2VHTA 3CPHA 4D2IA 4ZCIA 2W83A 4D81A 2WZQA 1DTSA 2JLZA 2IK8A 5AJ3L 2GDJA 2LCFA 4KV9A 4RCYA 2XZLA 2UUCL 4NHOA 2VSXA 2HDNB 1XMOQ 2WICA 3PEUA 4XWAA 4DNIA 1K8MA 1NJIC 5B2ZA 4LHZA 1PJRA 3QEOA 3B9PA 4PR0A 3AVTA 3VKHA 1VQ9A 1XXHB 3RS5A 3IBGA 1G7SA 4OHYA 4A3IG 1UE6A 2XOKD 3OEEA 3S1MH 5KHOC 1ZM4A 1CULC 4OWWB 3SR0A 4C0HA 1RW4A 3EA0A 5FL3A 4JI8Q 2DYKA 3J80i 1BO6A 2WAQE 4Z1MA 5KDOA 1XXHA 1VQ6A 4PQRA 1W36D 5BN4A 2IA5A 4KI0A 5HR5A 1P9NA 2AFIE 3I56A 4BFVA 3B82A 3I8SA 1OH6A 1L2TA 1BBUA 1KD1C 2VYFA 3CO5A 4IRUB 5AK0A 1ZC4A 4JLAA 1KI6B 2QTHA 1E9AA 2FZLA 5JEAJ 1JAHA 3UIEA 2O8EB 5CLLA 1X3GA 3QBTA 1U99A 2HIXA 4CVNA 3CH5A 2D7CA 4B34A 1PUIA 1PZNA 3B60A 3M0EA 4WXPA 2SHKA 5LD2B 2QM8A 4Q03A 3EX7C 4JKYA 1WDTA 4R2HA 4OWTB 1GUTA 3A74A 1YRAA 1KI6A 3SEAA 4C4PA 2BCGY 2O8EA 2EVBA 3WXMA 1N6PA 4LJ6A 5HCIA 2X77A 4LFBQ 1L8QA 3KKMA 3GJXC 1LUZA 1GVNB 2UXBQ 1H8ED 4I99A 3WP0A 1E2JA 4C9BA 3I62A 4QL5A 2PX0A 1Z7TA 4X64L 3FKIG 1M8PA 5DNYB 2ZSEA 3HOZH 3IBYA 1PYBA 2WKPA 1YBYA 2ZSAA 1KO4A 3EAQA 2A5JA 3CH4B 2Q2HA 1XEWX 2NOAA 2JK8A 4GSYA 3OEHA 4LBVA 3LX5A 4HLCA 1G17A 3GTLH 5IYCG 4KHPQ 1L1OC 1AQYA 1GOTA 2ZJOA 1RJ9B 3EZ2A 1KJYA 1S3SA 4X62L 1SVMA 5A35A 5C3EG 1R9TH 4LF5L 1Z6YA 2NIPA 1TQDA 1KDTA 4B3SL 3AP1A 2JA5H 1FUKA 2O8DA 3GLGB 1A2BA 1SZPA 1GM5A 4PHFA 1RRPA 4QY7A 2O8FB 2B21A 1EQQA 1YJWA 2JEAI 2Q8IB 2AKYA 1RJ9A 1V8QA 5K36H 5CB8A 3HYTA 4DUGD 1G6HA 2X2FA 4DLVA 4C2UA 4DV6L 3AVXA 1NL3A 1E9CA 3GLGA 1HUQA 2CE7A 4LF6Q 1TWCH 3CWZA 3LLMA 4GKKQ 4IPDA 4QHSA 2OESA 1NY5A 1SVLA 1HNZL 4NU0A 3S2HH 1XEWY 1PLLA 3AUYA 4OI0A 2O8FA 2W0SA 1E2MA 3K0CC 4HDCA 3G6EA 3ICQB 1IJFA 1J7KA 2KBFA 4DKAC 2MMGA 2AL7A 3CXCA 4DR5L 3CPFA 4EIWA 3ZQJA 2ONJA 1Y14B 2R93H 4TQ9A 3FMIA 1CJMA 4V0ME 1E69A 2N46A 4LJAA 2V6JA 2ID0A 4GN5A 3ZYCA 2GEUA 2JJ2A 2NZ8A 4NCJA 3OE7D 3PUZA 1SKYE 1ETUA 1CRQA 2KJQA 3K0EA 4BGDA 3ZD7A 2NN6H 4GL2A 1E2PA 2PZGA 3B13B 3K7UC 4JBKA 3L43A 1U2RA 2NVQH 5B64A 1E1RA 2QGNA 3ZJYA 3I4MG 1Z0IA 4MITA 3DOFA 3MRSA 3KQUA 2OEPA 2QT1A 4ESVA 1E7ZA 1HNWL 1GUSA 1A5TA 1X6VA 2CNWA 1I6HH 2OZEA 2ZAOA 2ZJ5A 3E5HA 4JLJA 4LBZA 1HZAA 4P31A 4PAMA 1OSNA 3UKDA 3RLNA 5J5CA 2J0UB 4GZMA 3UMSA 3W3ZB 4AK9A 4P73A 2RGGA 3BD9A 4JL8A 1UJ2A 2WOJA 1OFTA 3KOJA 4TLBA 1QVCA 2I5HA 1OIWA 2GF0A 5DN6D 3EIHA 2ORVA 1P72A 1NVVQ 4DCUA 2YV5A 4URUR 1CR0A 3LBIA 3M4QA 1II8B 2DFLA 4W5HA 4ZDJA 5JSZA 1NTGA 2ZI9A 4XOIA 2J0UA 1D9XA 3CMAA 1Q82C 3ASZA 3CNNA 1P61B 2GVBA 2BOVA 3GJ4A 4QFMA 3RC3A 1E2LA 4DR4L 3UXMA 2XSZD 3W1BA 2QPTA 4YMVA 2ORIA 3A4NA 4JIMA 2QUZA 4HUQB 5EZ6B 1EFRD 1II8A 2A8VA 4Z8YA 1MO5A 2IYLD 2UUBQ 1G6OA 2Z6VA 3E1SA 4IFEA 3W8NA 1GHKA 3U4VA 3NVAA 3OIVA 1OB5A 2QTFA 4F7WA 2FV8A 4HYYA 4HUQA 1JR3A 1JJVA 1XRJA 2IF0A 3UWOA 4B33A 5C0XG 3KKPA 1YHBA 3B8HA 1Z22A 1T8UA 3VNUA 1KDRA 3IIJA 4LJYA 4DUYQ 2V6IA 3I92A 1KI3A 4RD0A 1RYHA 3A7AB 2WSMA 4NKRA 1E2GA 5AJ3Q 1KNQA 4BY1H 1IBML 1COWD 3SFVA 3SU8A 2BDTA 2UUCQ 3WBJA 1G291 3FE2A 2WJIA 5KOYA 2W00A 2NVYH 3SE0A 4JLDA 1G3RA 1N3BA 3IEUA 4GOJA 4IJMA 4TTRA 3GLFE 1OFIA 3CCVA 5AJZA 1SVIA 4BLQA 4F4JA 1UBCA 1Y3AA 2VBCA 4IHQA 1G8YA 1GP2A 1W4RA 4US2R 3IKJA 1KKMA 4EFMA 3CCUA 1JJCB 3C41J 1JT8A 4DNRB 3HWSA 4TYQA 5F9HA 2OE2A 3SS8A 1K73C 1AN0A 2YWGA 4B3CA 4AY2A 1YNJC 4JJKA 4B3ML 4OQNA 3CF0A 2I0QA 4B3BA 4JT2A 4C0AC 3A1SA 1S3OA 1VCNA 2RAPA 1N25A 1Q57A 4R71A 4QGAA 3WMFA 4GKJQ 1W0JD 4BFSA 3O47A 3S17H 4L9SA 5DI3B 1FP6A 1G3IA 5DYIA 4NTZA 1VG8A 4TYPA 3SJBA 1GL6A 1TQ2A 3AUXA 2E8GA 4RCNA 3LBNA 3CRRA 3BG3A 3BERA 3EARA 3QXCA 4G5OA 1UDXA 4DXAA 5GAGC 3UG6A 1ZM9A 1B23P 2EFCB 1HURA 5DI3A 5KSZA 2ZJAA 2HV8A 3A5UA 4Q00A 3BH7A 3M85A 4CDGA 1ZNZA 3HOXH 4DV0Q 4Y52H 4XVRA 1AS0A 1KAWA 4YXWA 5KTYA 2JLQA 2ZR7A 4HZUA 1YNNC 3RNUA 5FH9A 3WNBA 2IX0A 4C0JA 4YCWA 5FL7A 4BFTA 3KDFB 2C95A 4PFSA 4XJXA 3WNCA 3IDQA 4X64Q 1PLJA 3H2YA 4RG1A 5AWFC 4Q01A 2ZI4A 3O8CA 2O5JC 4LK2A 4LGMA 3RN5A 2JA7H 3AGPA 5FPYA 4C3ZA 1AGPA 4DV4L 1SMXA 2R8RA 4X62Q 3KDFA 3CPEA 4BBRG 1L7VC 4BRUA 4Q66C 1MKHA 1RIFA 2GBLA 4DK0A 1KI2A 1ZU5A 4GNXC 2JEOA 2ZETA 3LVRE 3SYLA 2XNDA 3W5JA 4Q1CA 3CPJB 4QJ3A 2DNCA 3JC66 2XGTA 2LKCA 3MWKA 4F4IA 5G41A 3TGPA 1AKEA 1Q1ZA 4TYYA 2A5YB 2D5DA 1ZINA 2ZRMA 2HT6A 4P72A 3AF3A 4AYBG 1QZXA 2VF8A 4M1WA 5E7JA 5JJLA 1KK2A 1MJCA 2ZJYA 4NBSA 3PSIA 2ZRHA 4DLTA 2ZRNA 4QM7A 2E9SA 4ACAA 1W4CA 3A8IE 2GA8A 1HNZQ 2A9KA 4LJ7A 2VQSA 1I4LD 4WXRA 3FMFA 3U3RA 2N8NA 1DOAA 1O7IA 3B7GA 4JSYA 3SFZA 1RL2A 2EU8A 1GVPA 4GOPC 1EIYB 4DR5Q 3VDYA 1N6IA 1EFTA 4U00A 4URVR 3KJOA 1QHGA 4NCHA 3VR3A 4JOIA 4PTLA 2D06A 2FN4A 1LM0A 1JEDA 4A93H 2GZHA 3MG9A 5ANRB 4E03A 5JFGA 2QZ4A 3I61A 4OI1A 2ZREA 5AUQA 3RRZA 3CKLA 3D7MA 1HQYE 4LBWA 3S2DH 4A8JB 4M9QA 4DLRA 1EESA 1OIXA 2CDNA 5IYBG 2B8WA 1ZMXA 4TTQA 4DV2L 2EXDA 5FTJA 2P6RA 4TZ0A 5AJWA 2J1LA 1PA6A 3A8KE 2F52A 1OJLA 3VR4A 3MFYA 4K8OA 4KMUC 1K9MC 1CR4A 1H8HA 1ZM2A 2GETA 4A8JA 1L2FA 3MJRA 2UZIR 5DH9A 4LOAA 3P20A 2HHHL 1HNWQ 2NO6A 3AP2A 5EJEA 1HJPA 1FL9A 3HOWH 2GJ8A 4EPVA 121PA 4TTPA 2FSGA 1PVOA 2REXB 4MGZR 1Q7YC 3WYGA 2OSBA 1GNRA 3KXKA 1Q3HA 1FMJA 3F5FA 1E1TA 2W6JA 2WSSD 3CX6A 3I8XA 5GVRA 1T5LA 1LF5A 4NCKA 1T8TA 5E3HA 2EYUA 4JL5A 4NPHA 2C9YA 3S1AA 2MSEB 4P33A 4DLSA 5JJKA 1SGWA 1NJGA 1UDWA 2QP9X 4ZKDA 4HUTA 4Q4JB 3LAWA 4YQFA 1E9SA 1VQIA 1OYWA 4JVSB 4ZIRB 5BYKA 3I5YA 4DR4Q 1I3QH 3EPLA 1LS1A 5FR1A 1EFCA 2ALYB 4GNKA 4AG5A 3AEVA 2JJ8A 3PF4A 4ASUD 2H18A 1Q0UA 4JKIA 4DCNA 3M4OH 4Q4JA 3UMRA 4GOKA 1DBSA 2F6RA 2QE7A 2ZYTX 4TT3D 2NPFA 3RS7A 3TW4A 5C18A 1E2FA 1GD7A 3FDIA 4M9ZA 4YWMA 2ZRAA 4LF8L 3J7A5 4PZ8A 2CXXA 2FSFA 1G4AE 3K53A 1YVCA 3NH6A 4QC2A 3DPUA 4Q4LA 3C15C 3K9LA 4JMPA 1T0HB 4AWXA 3QEJA 1P8LA 2XTMA 1G8GA 1PH5A 1UM8A 1HE1C 1XNJA 2B6HA 2BWJA 3RAPR 2YOFA 4QG7A 3KXIA 1KY3A 2WKRA 4IPGA 5KNCA 1IN7A 1IBMQ 4PQFA 4H0LC 4AKEA 3RLFA 2QAGB 2D3WA 2ZU6A 1B70B 3CM0A 3W6OA 1R0XA 4W5WA 4YONB 3NXSA 2IF2A 2XOKA 3CNLA 4Q9IA 5SZHB 4A3IH 1NNEA 5UKDA 1W36B 2VP0A 2JXMB 4KYUA 2OTJA 1A2KC 2ZRFA 3A1VA 4BEBA 5JCPA 1FW6A 4CZ2A 1Q1QA 1MOZA 2VS1A 3TSWA 5TXGA 2WJVA 4DWJA 2BJWA 3RHFA 1DD2A 1G5PA 1Z28A 1VS0A 1UE5A 2WB1E 5LMNW 3R7WB 4Q5IA 1VYUA 1P2VA 5TARA 4UNPA 4B3MQ 1JNYA 1OFHA 1SVWA 4KLNA 3B5JA 3AF0A 2A6ED 2R93G 1W2HA 3Q5EA 5SZJA 3I4OA 4KYIB 1VQCA 3R7WA 2KSQA 3JAMc 1GTVA 2ZROA 1HT1E 1E2DA 1LF0A 5C46F 5E4FA 2PEZA 2Q3HA 4LJ9A 4UXJA 1PH6A 5EP1A 4F91B 2R7ZH 4NYJQ 521PA 4OHWA 4R4TA 1TUIA 3ADBA 1YR9A 3QXSA 1Q1EA 2IHFA 4B6FA 4QJ5A 3GTMH 3ZVLA 1E9BA 2NQ2C 5C4XG 4YDHB 2FSHA 1N5KA 2RH5A 3HP1A 3Q9LA 2IC5A 4LPKA 2H1LA 5FBLB 2ZM6L 4EQ6B 2CLDX 3U6KA 3KJHA 2BBWA 2AKAB 2J59A 1H8EA 3FFBA 4Q1EA 2F9MA 3KQNA 4RZ3A 2ZE6A 4I4LA 4L5BA 4PZYA 4B43A 1M6NA 3JVUA 1KHTA 3FKIH 2G1JA 2HT1A 5EP2A 4BXXG 4EQ6A 4LV5B 4CEJB 4DR6Q 1JR6A 3QXHA 2XTIA 1AIPA 4B47A 3VNVA 5IYCH 4UP9A 4NP6A 4V0MA 3PIRA 5CIWA 1P6XA 4DDVA 1NVVR 4QXAA 4LJ8A 5FR2A 4A2WA 3RC8A 4KXFB 4DV4Q 2AHOB 4LZZA 4N3NA 1SHKA 4CEJA 1A1VA 1HZCA 3QXJA 1NBWA 1IAQA 1MRSA 1ZBDA 2I3BA 3CAMA 1IBRA 2I4IA 2IXGA 3QF7A 2PCFB 4XVQA 3FOZA 3KFXA 4DSUA 3KQLA 1FTSA 3CF2A 4DUGA 1QHNA 2MQHA 4PC6A 4HZIA 2AHOA 2J41A 3KF6A 1ZKOA 2RHQB 1HEIA 3CRVA 5C44G 4TMKA 3CP0A 5AJYA 3PENA 4K46A 2WWYA 5ELOA 3DM9B 4LUOA 3GTOH 1UEJA 3IUYA 4GFDA 1X3EA 1QVRA 2A78A 3EBEA 4GS3A 4B48A 1WP9A 4ZV4A 4A92A 4A36A 3K0XA 1G41A 2ZT9C 1KAOA 4MYTA 4DUZL 4OK6A 3WMEA 1GKUB 3E0EA 2Z5FA 4QHYA 2ZRKA 1A82A 1X65A 3SHFA 3TRZA 2KHJA 2N49A 2VHCA 3OE7A 2YKGA 3DMDA 1ODFA 2ZUCA 3CCEA 2A68C 3K9GA 3KF8B 1FP7A 3TAHA 1E9RA 4DDTA 2VH5R 3AVUA 1XMVA 4FIDA 4DC9A 4ZCLA 4DV5L 1HTWA 3DEFA 1QVFA 2IY5B 4OQLA 3G5UA 1R8SA 4P0TA 1KIMA 1CR2A 1SE8A 5JWOA 4B3FX 1IBKL 1PLKA 5KNBA 3RANA 1U0JA 2NN6I 5FI0B 4QM6A 1N2CE 1Y63A 3QJYA 1VQ4A 1HV8A 2FFQA 4R7ZA 4YLGA 1Q3TA 1DELA 3KDSE 2OBMA 1KZGB 2HHHQ 1Q46A 4HIOA 5FPKA 5C4JH 4JVNA 3QKRB 2CWPA 4I1OA 3FHTA 2F3RA 3T12A 3EC1A 3GTPH 1IM2A 2VLIA 3QKSB 4QGGA 1JECA 1N36Q 4IFDJ 4QGFA 4RJLA 4TLDA 3NC0C 4G5RA 5DN6A 5J4KA 3KQKA 1Z0JA 1L1OB 4UPAA 1MT0A 2CLSA 4RSGA 3TUIC 5K8UA 3GLFB 2GK6A 5C4MA 3HOUG 2WKQA 3N70A 4Q9JA 1A63A 2QSYA 2VO1A 2GXSA 3E2IA 1UADA 3WMGA 3QKSA 4OK5A 2XSZA 5E95A 2VHJA 1X6OA 4LJZC 4LWCA 1G19A 2XZPA 1L1OA 1EFRA 3GLFA 2KCCA 3ERSX 2OBLA 2GILA 1GO3E 4TSFD 3H3VH 1S9DA 4UXIA 4BPBA 1G20E 4UJ3A 3T06B 3HOXG 3PXGA 1DCZA 3P4XA 3QPVA 3QY0A 2KCMA 1YZNA 3GJ8A 1GITA 4D26A 1OE0A 3T34A 5JI3E 2ZRIA 2ZUBA 1NN5A 3UATA 2V7QD 2JCSA 1JAIA 5C0XH 2AXPA 1R5BA 2HJGA 1IN5A 1IY0A 2OCYC 5SZIA 5K8IA 1U9IC 4LF8Q 2OCPA 5IDVA 3ZGXA 1AZSC 4FWIB 3QQ5A 1E2EA 4JL6A 1QG4A 3B1ZA 2IYVA 3AVWA 1E2WA 4Q47A 2JA8H 2WWIA 3KZ1E 3RS3A 1W3SA 1COWA 1R7RA 3AKCA 4A3KG 4WJ3M 2UKDA 1OXVA 2VP9A 2ZRDA 5EXSA 3SJZA 3X1WA 4TQUS 1YHAA 4D0GA 5J4VA 4IXNA 2E87A 3K0FB 2JLRA 3AYHB 4RFVA 2JLXA 1TWGH 4OJQA 1WE2A 1NN3A 3B2EA 3UMFA 1T91A 4E5UA 5JHGB 4KSCA 3SI7A 2NO0A 5IK2D 1KK0A 4HLUC 1DARA 2EFGA 1ZNYA 5FTNA 2CMKA 3MEFA 3GJ5A 4IXMA 1G8FA 3SOPA 2A68D 1TPZA 1OTCA 1SLJA 4MNOA 2CEAA 2R2AA 3K0FA 4YDSA 3FHCB 1XD2B 5DHAA 1DAGA 2G3YA 3ULJA 4IW3B 4LDJA 4H13C 4Q7KA 3W9YA 3SJCA 3G4SA 1P5ZB 4X8HA 4POFA 2JASA 4RZ2A 2VA8A 3AVQA 2GVDC 2ZI5A 4DV7Q 2HJVA 3KB2A 1VHTA 3L7ZC 1J90A 4BA2I 1CU1A 2Z0SA 4RD2A 1XD2A 2ZPTX 1W0JA 6Q21A 2IYUA 1DS6A 2Y8EA 4QBFA 3JAMi 1EWHA 4GBMA 2CCKA 2C99A 3CBQA 3RDPA 3MWJA 3VKGA 5FPHA 3Q8XB 1G64A 4DVGA 3HU1A 3I2ZA 4DCVA 1RIPA 1ZD1A 2OCBA 1ONLA 1CRPA 1W5SA 5BR8L 1NVWQ 2GZDA 5LPNA 1I94L 1H9RA 2MSDB 3R20A 5TB5A 3G0HA 2C9OA 5EXTA 1RE0A 2ZM6Q 3JVVA 4M2LA 2RHMA 3HOWG 3T1YL 1J8YF 4DLYA 1DVRA 2IEYA 4DV3L 4MRVA 4Q19A 2ZJPA 1IBLL 3PF5A 4P4SA 1UEIA 3U4QA 4DIEA 1W47A 4POGA 3NIBA 1WOCA 1F6BA 1IW7D 2ZRJA 2OV2A 3Q85A 3HU3A 2YTVA 1UBGA 5L3VA 2GJSA 4TLCA 4DBLC 3ZZTA 2OFXA 4PAQA 4ILEA 3BH6A 1MIUA 4A3MG 2YOGA 1O87A 5FUVA 4BBRH 3EG5A 1E2NA 4JBXA 4ZDIA 1P2SA 3AQQA 1DAMA 4E07A 4FMBB 2WOOA 2A69C 2PCJA 4DEXA 4AKIA 2EFHB 4ZKEA 3BOSA 1UKVY 5HE8A 3U44B 2NPIA 2CHQA 1HTPA 1U8AA 4PG3A 2OFWA 1OT3A 3QPUA 4G5GA 4RMFA 4F38A 5LMNL 4OQMA 3O8BA 4WBSA 2BBSA 4JI3L 8OHMA 4HSEA 4L16A 5L3RA 1GJXA 3ZVRA 1CTMA 4DDUA 1GRNA 2GJAA 2ZUDA 4UKDA 3PUWA 3D0FA 1IHUA 2P5SA 3D6TB 4OQFA 2HXSA 2Q2TA 2K5HA 4YCUA 1B7YB 2X1VA 3NWJA 3RWOA 2UZ3A 4RCZA 5CJ2A 2JLVA 5JJIA 1KHIA 2BKEA 4C2MH 1LS6A 4Q9HA 5C1BA 1QHHB 1I6VC 3SYNA 4A0RA 1D9ZA 4BA1I 2EDGA 1XPUA 3GEHA 4N1AA 1T3LA 5IYBH 2FDCA 3OZXA 1NMYA 1VCIA 2ZYUX 5CIQA 4DV5Q 4CGZA 1QVAA 4ME3A 2F1HA 3NEMA 3CX8A 2Z83A 2B7BA 5FUXA 3THWB 1GSIA 4LYJA 5IT9c 2FJUA 1QHHA 3KXLA 1IBKQ 1VYTA 3ND8A 3PEYA 4P75A 2BM1A 3DM3A 2YYZA 1QHSA 5BWMA 2WJGA 2RHSB 2CCZA 1CKEA 3AF4A 3QVUA 4US0R 4DLXA 1N0UA 3IHLA 1WF3A 2KE5A 1XMJA 3K1JA 3THWA 1HR0L 1JJ7A 2N1BA 3GLHE 2H5XA 5GJVC 2JQOA 1E0KA 1CFMA 2WSSA 5CLQA 1ZM7A 5FBRB 2HIVA 2H57A 2KI5A 4RY2A 1U8YA 4UXHA 1H9KA 3ZLJA 4O3MA 3CRMA 2G9NA 4DK6C 2JDID 1CKNB 1OV4A 1OW3B 3GJ7A 2ZRGA 4JK1C 3K9HA 2R7ZG 1EUJA 4KO8A 4OX9L 4JYCA 4NYJR 1TAGA 4JLKA 4ZDKA 2ODBA 3HYRA 1W46A 5JECA 1N8RC 2B63G 2BV3A 1CKNA 1KRSA 1CJUC 1RRGA 1ZD9A 3DZ8A 4QGHA 1AS3A 3OW2A 4ASUA 5JRJA 1E2VA 3VR5A 4JJZA 3EIVA 4LHWA 4A0GA 3LDAA 4TT3A 1Z83A 5B30A 2A69D 1F5NA 1A62A 1VQBA 2GZAA 1X3FA 4YMSA 4TMTA 5CYOA 1S8FA 1LW7A 3VMFA 2GEDA 1RC8A 1YHQA 4GOPB 2LKDA 2Z4RA 3OAAD 2MNAA 4LYHA 4TZ6A 2WFWA 4PC3A 2K32A 1VQPA 1IOZA 3U7EB 1Z6HA 3CRW1 5IWAL 1NVXQ 2Q9AA 3A4LA 4Q7MB 4DR3L 2JGNA 4GDFA 4B6EA 4A3JG 4AQYL 2DR3A 2OBNA 4GOPA 3A4MA 1UKEA 4H1UA 4HDQB 1HZBA 4B76A 3BB4A 1XDBA 4TMXA 3ZH9B 3Q72A 1HH4A 4NMMA 3S1QH 2JLYA 2GJKA 2AK2A 1GUAA 3C4JA 2C9CA 3V4FA 2QRZA 4HAYA 2AUKA 3ONWA 4D4KA 2PLRA 4QIWE 3T15A 2A5FA 2WWGA 4UNSA 5KO2A 4W7SA 3EA5A 3LNCA 3GLIE 1EG7A 4EFNA 1TEXA 4IOMA 2W2TA 1IYUA 1D5CA 4FW9A 3GTQH 4IDQA 3EWAA 2HQLA 3GTKH 5FPSA 3L0IB 2GRJA 3FMOB 1D2MA 3JZAA 1LTQA 3K09C 3ZQ6A 1G51A 3B1YA 2E2IH 1WFQA 1SFOH 1DEKA 4HJ9A 4LYAA 2PLFA 4TN1A 2JA9A 5ELNA 2I1QA 2PNRC 4WZAE 3T35A 4JBJA 4IPCA 1QHYA 2Q6TA 3QENA 2DN8A 4A75A 3DM5A 1IXRA 2WJJA 2UU9L 5C4XH 2F1JA 2OQ0A 3ZVNA 3LX8A 4M1MA 1SULA 5BR8Q 3PJRA 1N5LA 3WWVA 2IYRA 1I94Q 1ZM3A 2BMJA 3FFAA 2QP4A 3RZOH 5JWHA 1EFHA 5DGXA 1PH3A 1IN6A 4Y0AA 1GIAA 3MXNB 2MO0A 3T1YQ 1NBMD 1OIVA 3L2PA 1Z08A 5A4JA 3AQ4A 4BXXH 4DV3Q 4XSHA 4B74A 1IBLQ 1PH9A 4A0HA 3UK6A 3KYHC 3IQWA 4DB4A 3LQQA 1Z0DA 2ZRLA 2HUPA 2VY3A 2B7CA 3LNNA 4LUVA 4OHXA 5J4HA 2HF8A 3WYFA 4PO9A 1RVDA 1FFHA 1QDEA 2KBNA 2ZYWX 3BBPA 3KQHA 1QG2A 1QHIA 2E76C 2P2LA 2G0NA 5G40A 1JEEA 1V5WA 4KU4A 3OIUA 2ZTCA 2FPKA 1UBEA 4II7A 1M34E 1SVSA 2W2VA 2KHIA 3LBHA 1ZYUA 4X65L 2VF7A 1DAKA 2WV9A 1IL2A 3BK7A 3SBDA 1OH7A 5EE3A 1AM4D 4NYMQ 3S1NH 1CBUA 5C44H 5LMNQ 4A3DG 1KI8A 1KZ7B 4PMWA 1BKDR 2IX3A 3U7GA 3T53B 4Q9KA 4PPFA 2VTKA 2DHRA 4FN5A 1NBME 2OXRA 4PSAA 5H70A 5CB6A 4D25A 4TLAA 2NVXH 2REOA 4U5XA 1XCMA 2J0SA 3QKUA 1YR6A 2JLUA 4JI0Q 2A2ZA 2VHUA 1KRTA 1E9FA 4AG6A 4JI5L 1ZIPA 4IOAA 3L82B 1KJWA 1ZUIA 2VL6A 1M90C 1FJGL 2O0KA 4OI4A 3O8DA 3M3YH 2JA8G 1VHLA 4G7OC 4PZLA 5FPTA 1D2EA 3BC1A 2AMCB 2BJVA 1T3SA 1M74A 2Q9CA 2CBZA 4B32A 4XWOA 3NHAA 4I7ZC 2P0EA 3H94A 5JS7A 5JEAH 1VQJA 3R9XA 3THYB 1E2IA 3TEHB 2D7DA 2ZJ8A 5GROA 1XP8A 5E7IA 3WRYC 4MTNA 4AYXA 4TKOB 1NF3A 5F9FA 3BZKA 2VRWA 4H44C 2MO1A 1VECA 5FOSA 1S3GA 2IXEA 1VMAA 2EYQA 3CUEF 3KFUA 1NN0A 5GJBA 2ZTDA 3MSXA 1K8RA 4LBYA 3THYA 2P65A 3CC4A 4I81A 3A8JE 5FTKA 2UXDL 421PA 1W7AA 4S35A 1W49A 5KUTA 1HR0Q 3ETLA 3CW2C 1D8TA 1DO2A 1F2TB 3FMPB 4GT1A 3KKNA 4QNMA 5H68A 2BA0A 1UKZA 2FGJA 2CHGA 2A6HC 1T0JB 1XTDA 1X56A 3KLWA 2OQKA 2D0OA 1ZP6A 3HOUH 2K52A 4YWLA 2FPMA 4BBSH 2V1CC 4BEJA 1GKYA 2F43B 1TNDA 4I1UA 1EK0A 4M1OA 4ZPXA 4G7HC 1II9A 1TEVA 2A30A 4M9SA 1F2TA 5EUQB 4EFLA 3VAAA 4OX9Q 1GFIA 3LA6A 2BMDA 2FNAA 2HF9A 4TSFA 5FUYA 3KFVA 2VZAA 4FINA 1I2DA 1CSPA 5JI2E 5BW8A 1UWVA 4X66L 3ICEA 1W4BA 4NONA 5FOXA 2F43A 3D4RA 4BLSA 5CITA 2G83A 3CRQA 4G0NA 1QBKC 4KKTA 4BFWA 4A6XA 5JLJA 1OH8A 4JBYA 1SVKA 4GZYC 2J5XA 4DIDA 3H3VI 2QGQA 2CVFA 3AP3A 2V7QA 2GWHA 1PMRA 5EXPA 2JIZD 1BOFA 1FNMA 2B8GA 1Q12A 1Z5ZA 4JZKA 1U5KA 4QGUA 3GMTA 3NEYA 4OI2A 5AUOB 5C2JB 2RGEA 1RFLA 2AR7A 5C0XI 2O8BB 5IWAQ 3FKSD 4LF5Q 4A3KH 4B3SQ 2GHIA 4JBMA 2GCPA 4DR3Q 3C5HA 3G48A 1RKBA 2HEIA 4AQYQ 4ABYA 1WA5A 2IYWA 4YHHL 4HI0E 5IK2A 2ZQ5A 4LCBA 2GJ9A 4HIDA 1DAIA 1C4OA 2EWWA 3OHMA 2O8BA 2VNUD 2QI9C 4LY6A 4S2EA 4AI6A 2AD5A 2ODNA 4FMCF 4XSGA 5KPDA 2BCJQ 4DV6Q 3BS4A 1G5TA 4MKHA 2EJMA 1XTQA 2OFOA 2WMOB 3JZMA 3GTGH 4GMXA 3QOFA 1SXJC 4V0LA 4E09A 3LV8A 2PMDA 2CL0X 1BIFA 4AD8A 1N9WA 2IW3A 4WZ6A 2H17A 1AA9A 4MA4A 4M21A 1B8AA 1VQOA 1BDOA 1VPLA 4US1R 2PI2E 4LF9L 2F55A 1MR3F 721PA 4IFDG 3VKWA 3NEJA 4DB2A 2QU8A 2DFNA 3D31A 5FTMA 4XTRA 2ZU0C 4O0AA 1SRUA 1BYIA 1PUJA 1Z3IX 2BMFA 3F0TA 5LB2A 3R8CA 4YMTA 1DGSA 2YJTD 4F93B 2A6HD 2RGNC 4IFBA 4OQXA 3DKVA 4UP8A 1Z6GA 1KXLA 2AX4A 3DVLA 2UU9Q 1F48A 1W1WA 4JI4L 3PFIA 1Q44A 3BU2A 3CB4A 3SQWA 1AS2A 4PPGA 3WHLA 4JLMA 5H8WA 4A3CG 4R4IA 1G21E 4QL3A 4JC0A 4DJTA 1UKYA 5GADl 2D2CC 3I55A 1UAAA 4HB0A 4DK1A 1GNPA 1QRAA 2VP2A 1VQLA 2FEMA 2VQFL 3ND9A 3S24A 1J5EL 4BY7G 4RKFA 1LB1B 2IUUA 1JI0A 3GFPA 3K8YA 5BQ5A 1Q22A 2CQOA 3AM1A 2CWAA 2C35B 5J3BA 1VQDA 2AWNA 3U3MA 2H8KA 4A3MH 4Q1FA 1YEZA 1U9IA 2R7FA 4IVQA 1TU3A 1Y8PB 1E9EA 1EIFA 1VQKA 3P27A 3T61A 1KGDA 4HAZA 4DZZA 4PANA 4LF4L 1YR7A 3IGFA 3RRNA 2ZI3A 4Y0VA 1YJNA 1KSHA 1P2TA 1W4AA 5J4LA 2UXCL 2RGDA 4JBWA 3CQZH 4LF7L 4PQYA 1SHZA 4EPXA 4X65Q 5AJXA 2ZXUA 3GLHB 3RVBA 2DB3A 1E1QD 2D74A 3M1IA 4ZIRA 2OT3B 1G3UA 4L4UA 4CIDA 5E7MA 2XB4A 2IUSA 4CYMA 1B9MA 5M3FG 2DUDA 3B6YA 2FG5A 5DI9A 2QN6A 3M4YA 2V4ZA 3TLXA 4AKGA 5HGQA 2A5GA 4HAVA 4F92B 1ZYRC 1ZU4A 1XF9A 2AUJD 2CL6X 3GLHA 3QXXA 4M1KA 5AUNB 3H84A 4HEJA 3L0PA 4LV8B 4X8MA 1NN1A 4NH0A 2ZR9A 1YRBA 1FJGQ 1SXJD 2IWRA 2C77A 1L4UA 1R5NA 2OG2A 4XVUA 1G6PA 3TE6A 1CJTC 2WAXA 2Z43A 3F8TA 2VW9A 2EFDB 3PITA 5CK5A 2F1RA 4A2QA 1VQAA 4LV6A 4YC7A 1VQ8A 4Z8XA 5M04A 3VX3A 1T4GA 2RKOA 5KNDA 1HYQA 2ZS9A 2Q3MA 2YU9H 3LW7A 1AQUA 4HJAA 1PH2A 3FHWA 1J99A 5C4GB 3X1DA 1E2HA 3CC7A 1E1OA 2X2EA 3LRPA 4XD7D 1DPFA 2N3SA 2Y0SG 4XWKA 2QAGA 3HPQA 4A3FH 3TW8B 4MKGA 3CCSA 2RGBA 1EX7A 5HTKA 3J81k 3VX4A 3IIKA 2WHXA 4EAQA 2EFEB 4CEHB 5F98A 1NKSA 4ZI3A 1E32A 4DLWA 2D62A 4LHVA 3P32A 1JALA 1G3MA 4GOXA 5LMUL 3HJNA 1CS4C 3CF5A 2UXDQ 2XB2A 3T1QA 5DHFA 2K7VA 2O5IC 1V1QA 1DAEA 4PO1A 3U60B 4KJZA 1SXJE 3K8AA 1E99A 4CEHA 4NPSA 1S0UA 2IS1A 2JDIA 2IXFA 3LO5A 3UDIA 3A37A 2GXUA 4AYBE 3WRXC 2ZS8A 3G71A 3K70C 4PV1C 1FQJA 1Z2AA 4MGIR 1GHJA 3S14H 2GKSA 5JEDA 2V54A 1FVIA 4B3XA 2OAP1 1HQCA 2FEOA 1OXSC 1U94A 1UF9A 5JWRA 3GLIB 2B63H 1IJEA 1R2QA 1TWAH 1OKKD 2ZM5A 3EPKA 4D4JA 2IHYA 1G7RA 4EJSC 4X66Q 3QNUA 1P7CA 5FJ8G 2K33A 1DO0A 1U98A 2PMKA 1M7GA 4Z54A 2K5NA 1Z9FA
chains in the Genus database with same CATH superfamily
3EPRA 3BBLA 4NE9A 3WQRA 3KKQA 2Z9DA 4HAUA 3D7RA 1UMBB 4YREA 1NPTO 4MIUA 1Z7YA 1AN8A 4P2BA 3OFSA 1CM9A 4A10A 4YHHQ 1UMBA 4OP2A 4EO7A 2GN0A 3JQQA 2JS7A 4NYMR 1FFEA 2EF0A 3C16C 1KJ8A 4B3TL 1D04A 3EOBI 4HXFB 1GPUA 2YHUA 4ESOA 5J22A 4A3BG 4AROA 5JEAG 1OI3A 3SKVA 5BUSA 3AR4A 1YB2A 3MT9A 3NPPA 4Z4GA 3V8EA 4H0NA 2CVRA 2B63B 2WPNA 3D3EA 1E96A 3AKEA 3QKRA 4PYIA 3VNQA 1ZJ4A 2BISA 2MINB 2F0NA 5JVDB 1KR5A 1Z73A 3O0TA 5KOJB 1N6KA 3F9CA 2XD4A 1YJBA 2MINA 2G6BA 1EAYA 5JVDA 2BEKA 5KOJA 3DXZA 5D3IB 2WINI 1EUCB 3BJEA 2V5UA 1DKOA 3S5JA 1OILA 5GQSA 3WK7A 1EUCA 2EKDA 4M1SA 4URXR 2HL6A 2DM6A 1N1EA 4RYDA 2H4OA 4KUHA 5ICSA 1GNQA 1UBTS 3BORA 1KQGA 5LMUQ 2ZITA 2ACKA 3GTPB 3U0BA 4D5EA 1A8VA 1GKKA 4WH0A 3CXRA 3T9BA 4RPIA 1RLTA 1N33B 1NULA 2B1JA 1V6SA 4LWZA 3R0XA 4Q48A 1RCVD 5BQPA 4KW7A 5IXYA 2WU3A 5KQMA 3N28A 1S4QA 3OBBA 4HPJB 2JA8B 4EFKA 3N6XA 1T13A 1QV9A 3KKOA 1S9HA 4DMGA 3R0JA 3NQTA 2VB3X 1R0YA 3T5BA 3AHHA 2OHHA 1XWWA 4MUAA 2W6NA 5A03A 3PIO3 1EFKA 1VIDA 2C84A 3ZX5A 3NLLA 1HNXQ 3N8IA 1YJ5A 2GNOA 3H2IA 1VIMA 1WXQA 2PLWA 1E3MA 4W1QA 4E6IA 1T4CB 5KYKA 1PFQA 3MK31 2IGTA 5T8KA 3G82C 1RVV1 1A4RA 5FX2A 1T4CA 2VXBA 2WB2A 4ZD6A 5E3IA 1C7QA 4BKRA 4YXFA 4GPBA 3NYIA 2HDWA 1CPYA 1X7WB 3K4QA 2F4NA 2Q28A 3CN7A 1HDZA 2PXCA 1EYCA 1X7WA 3EPJA 3SZUA 3M49A 3E0QA 5TDHA 2B4AA 1U4MA 4FZ3A 2WAOA 5EQFA 2M9VA 2QRPA 1P7VA 4XIJA 3T51B 1T9HA 5JSFA 4LF8B 3P9NA 2LFNA 1KWKA 1NI3A 1CUIA 1D2RA 3IP3A 1XKXA 4UBOA 1GSHA 5EJFA 2C7GA 4AF7A 3JXEA 1H2HA 2FWAA 4FCWA 1XTJA 1IXYA 3HK2A 1T5TA 1D7QA 1VFNA 4GD3Q 3KL2A 3NKLA 2ARKA 1C3VA 1OKKA 5DWVA 5FJ8H 3GY0A 3B9BA 4Z51A 4UQPA 4JI2Q 1WPGA 3AY7A 3E03A 3WGVA 5I4DA 2QBYB 4YJ3B 1Z07A 3C6XA 2NXJA 4E3WA 2QBYA 3AM5A 4YJ3A 4BNTA 2A9OA 4DSNA 3QPBA 2LKVA 4ON9A 1GXDC 1TYDE 2OLJA 2O7VA 4HRAA 3N8KA 4X71A 4LNQA 1FK8A 5CM2Z 2DR0A 1SFOB 4A3GG 1R88A 3ZW7A 1HHVA 5C51B 3AETA 2EJGC 1EB8A 3HVIA 4K05A 1U0LA 5C4XB 3SZRA 3W5OA 1Q83A 1H2XA 4MV9A 2FP3A 2PKWA 3R24A 4KB5A 2L42A 4CQMB 2ERCA 4YCVA 4URZR 5DHPA 3LCJA 2HCBA 4CQMA 4EMUA 3CCBA 3RVRA 2JFUA 1TZ2A 4F97A 3CZRA 4OX9Y 3KQSA 4EYKA 1GPKA 1X55A 3ZCRA 4UOQA 2IYTA 4ML3A 3JASB 1LTRD 4BMSA 4UEQA 1S8OA 4FC7A 1EHIA 1NRJB 3JASA 3PHJA 1XL0A 1X54A 4BLOA 1SUDA 3B78A 3Q9UA 3WL7A 4K6LA 1XZJA 3HKZB 5TF0A 1TL7C 4QXPA 1XFAA 2REBA 4ND5A 2KCNA 4IDPA 1TC1A 3PEVA 4NDNE 4QBGB 2IODA 1TUEA 1XU4A 2IYEA 4ALIA 4G5SA 2MJLA 1J70A 1FLDA 3D7LA 2LXJA 1G8HA 4E5DA 1RS0A 3B70A 4AMBA 1A0OA 3FW1A 3P75A 4AMZA 4E5VA 3O92A 4MV5A 1ZSVA 4U2GA 2X9GA 2H7XA 4BB5A 1I9GA 1YVPA 2BMAA 3ID6C 3CCMA 4G09A 4C6RA 3M9BA 2Y1EA 2M98A 1NW5A 5IYZB 1YJAA 1M3SA 2WAQB 2QILA 3AEQB 4P2CB 1RM3A 5L6MB 5HILA 2QN9A 5IYZA 2VTBB 2CMDA 3VZPA 2IEDA 4ZQCB 3AEQA 4S1VA 3TYXA 2QL9A 1ZXLA 3ONDA 2VTBA 2WJ6A 3GRUA 1B8VA 5IBRA 2J3DA 2WRZA 1UFQA 4BP3A 2PRIA 3ES9A 1YZLA 4ZAZA 2GZSA 2PBFA 4PIMA 3NOOA 1XIVA 4DV7L 2V8OA 4GLXA 5LL6P 1MIOA 2RK3A 2CFCA 4M0LA 2HIHA 1FVOA 4HIKA 2FA9A 4JLWA 2PSFA 3LPDA 4N6GA 4XUDA 5LA6B 3Q8DA 1IWBB 3CG0A 2Q2IA 5B1YA 2ORWA 3IAEA 2PH1A 1SY7A 1Z0FA 2I6FA 1U2EA 4D80A 1JR3D 5EXDA 2DSNA 3IVMA 4DR5B 2OKCA 4M54A 2F1OA 3S14B 1PQWA 3BIWA 4PZCA 2N78A 5H1YA 3INYA 4BIMA 1AKYA 3CUTA 1SNQA 4U2CA 5EN4A 1IY1A 3AF2A 2E6UX 1UPCA 1YIJA 1WKVA 2Y0SE 2NT4A 3MA0A 1ZZEA 3FZGA 4C3IH 3ZHYA 1VE9A 3BEDA 3MLEA 2FWRA 3EZ9A 4LWQA 4KJXA 5IM4F 4NMLA 3KZXA 1ZJZA 2ZJRA 5I4IA 5B57C 3ZCVA 4HDOB 2PS1A 2YTZA 1NMFA 5KKAA 5HKKA 4HQRA 3VYUB 1AE3A 4AC9A 4YCLA 4QG3A 4KX5A 3C4QA 3VYUA 3T5GA 3PXEA 1T1JA 4WERA 1M7BA 3WIBA 2WV6D 4F4HA 2VSYA 2WUWE 3OKAA 2FPLA 3OLQA 3SHQA 2EBUA 3PZRA 3ZCSA 4A0SA 3VFDA 1QZUA 4G0YA 2YY6A 2JIDA 3DFKA 3MYYA 5D3ZA 3RIXA 1MZPA 4OJMX 2EJWA 3PHIA 4B6SA 2OCKA 3WGOA 3K15A 3OJXA 4BKQA 4NOKA 1QYWA 3ZKWB 3NIGB 5FNVF 5KX5F 1JEAA 4CDRA 3ZKWA 2KPOA 4KY7A 1AZPA 1YZKA 3MWYW 5ES4B 2CHFA 2OHFA 3D8GA 1SU4A 2J7PA 5F1OA 4ZZ3A 2C4MA 2A8YA 3BMQB 4MRRA 4EI2A 1EJ0A 1J2EA 4DMCA 2AX3A 3BMQA 3AJ9A 4FN4A 2K01A 4X60A 1JDTA 2GUWA 4PFKA 2ZBFA 2VSXA 4M8LA 1W75A 5JCJD 1Y4UA 3HG9A 3I6QA 3VKHA 2Q8PA 2XOKD 1U5CA 4Q9AA 3T5TA 3TD9A 1PF7E 4KI0A 1PHPA 2AFIE 1X7GA 5JV5A 4GXQA 2FDRA 4YWHA 1L7EA 2Q4BA 4JKYA 1WZNA 5F76A 1FTWA 5I4CA 3H3FA 3WK5A 3EVTA 1GPYA 5EMMA 2G5CA 2O7RA 2WKPA 1KU6A 3M3HA 4WXPA 1E1KA 4JXZA 2H31A 2PH3A 3AP1A 2Y66A 2O4CA 5F5LA 1UXIA 4C56C 1RRPA 4WY5A 1OI7A 1V8QA 1C0LA 1ZGCA 2B99A 1HUQA 5EIHA 4OI0A 1HNZL 4FBGA 3G6EA 1IJFA 3CXCA 2FWNA 1WTQA 1FYFA 4L0DA 3DDSA 1FFWA 5D84A 4O6VA 3ZQ4A 4D9BA 4DSZA 3W3ZB 3O9MA 3KV3O 3QV2A 3T7DA 1TTQB 3INTA 3CMAA 2GVBA 4DM3A 1KKUA 2ZXOA 1XTZA 2PRYA 2IYLD 1RWNA 3L1VA 3I9FA 1JJVA 2E4ZA 3UWOA 5AVTA 3S8MA 3KPYA 3E05A 2DH5A 2BDTA 1LSOA 1NURA 3E18A 2XRMA 4MNTA 3SE0A 3LPMA 5IOCA 3RFVA 4ZO7A 1JHVA 1IBKB 4LY0A 4B3CA 5EESA 2I0QA 2BKLA 4NHEA 4RWZA 4N5DA 3T99A 1N25A 1XI2A 4BFSA 2KQUA 1G3IA 3NHLA 1OBOA 3BG3A 1ITZA 3HCNA 4I2NA 1M72A 2PYKA 1Y42X 5CJJA 1SQSA 4BO8A 1XZDA 1LPAB 3UHJA 3NFYA 1XZHA 3L8EA 2CL5A 4EPXA 4DK0A 3FPJA 2XNDA 3MC0B 1A76A 4P72A 4M1WA 4EGVA 2ZRHA 3U3RA 5LZ2A 3A6GA 3MS7A 4WXYB 4OATA 1EIYB 1N6IA 5CH8A 1JEDA 5JFGA 3KT0A 1QCDA 4KQIA 2VN8A 3FPSA 2CDNA 2J33A 4HSPA 4OLBA 3G6JB 2CDAA 1H8HA 3I6IA 2YXDA 1D1PA 1TJ5A 4C07A 2NO6A 5I4KA 4JUCA 5EUCA 1X13A 1IBLB 3R3SA 1GCAA 1G6ZA 2JA6B 1QCCA 1YNND 4NZOA 1VMCA 5BMVB 1C2TA 4B6JA 2O2DA 4TMYA 3S29A 3UBMA 2L4NA 1TI7A 2FW0A 3AEVA 2JG3A 3K2EA 4JKIA 3M4OH 3IDOA 3RS7A 3SCZA 1Y6QA 1JE1A 4KWHA 4M9ZA 5HTOA 1SHTX 2ZRAA 4WE3A 4BE9A 1SUPA 2FVXA 5BV1A 1ZN8A 1ACJA 2WKRA 1NWHA 4FF2A 3MMZA 4JHLA 3HWWA 3S15B 4A3IH 4NPAA 4YCSA 4WCDA 1Q1QA 3A6JA 3ZDCA 2VS1A 3ZV7A 5LMNW 4MLZA 4Q37A 5M3MB 1VYUA 3DMGA 3Q5EA 3OZEA 1XRPA 2HWKA 3ZNOA 4R1NA 3PC8C 2RSLA 4JDPA 3ADBA 2VNKA 2YCBA 5A04A 3Q9LA 2I4LA 2CLDX 3GAZA 3E61A 2FB9A 2QJOA 5HK9A 3WDSA 2WNSA 1AIPA 5IYCH 4NP6A 1SHKA 1VB5A 3KFXA 4KWIA 1JA9A 3KF6A 1ZKOA 5C44G 4ZMRA 4B48A 2Q62A 2C2MA 1G41A 4MYTA 4QHYA 5FB3A 2WHYA 4N39A 1FRFS 3B6IA 3OD5A 4AY4A 1GG5A 1NLUA 4J2OA 3OMGA 1QVFA 4DUPA 1F9QA 5I6YA 3K1TA 5ESXA 1Q3TA 1LPMA 3ODPA 3QU7A 4R6WA 2D7JA 1KZGB 1UWLA 4RNDB 3O74A 5CEEA 3O4RA 3QKSB 4TLDA 1B23P 2ACVA 4RJLA 3FCEA 1Z0JA 4RSGA 4KR9A 1QJCA 5AHRA 1A63A 3H97A 2NAFA 2I62A 4JC5A 1I4HA 3QKSA 3DV0B 4LWCA 4J49A 4CQLA 1E3LA 13PKA 3EC7A 1U0RA 1M0EA 3P9ZA 1Y8CA 4C4YA 5G0TA 2V6GA 4RGQA 1SQGA 3KYDB 5I7OA 1E2WA 1PTOD 4DLNA 2VP9A 1YHAA 5E7QA 1NMEA 3AYHB 3UMFA 5JHGB 3KYDA 2NO0A 2EFGA 2AGVA 1G8FA 4YDSA 4IW3B 4JXXA 3VNAA 1M76A 3EQ9A 4Y7DA 1GQRA 3DT6A 5FPHA 1JLSA 3VU8A 1I4QA 3OETA 3HOWG 3SF0A 5IF3A 4TSKA 3PF5A 3AFIA 4DIEA 1W47A 5D5HA 4ZZ0A 3ADOA 5HW0A 4B4KA 2ETXA 2QRUA 4RMFA 2FOIA 3A1DA 4ENRA 3IMGA 1GRNA 1Z2DA 2EGGA 2I6QA 1GLGA 2K5HA 5T57A 1LXCA 4H0CA 1SUEA 5CJ2A 5JAIA 4LMBA 1B44D 4I6JA 5C1BA 1EUQA 4Z9BA 3I28A 2H1EA 2FDCA 5CIQA 2GHRA 1QVAA 3MZ5A 1DC6A 1JIUA 3LLVA 1NX9A 2GA9A 2QK4A 4HQ6A 3ZDRA 1F38A 1SR8A 2CVPA 4JVZA 3OMCA 3M81A 1ENYA 3K9HA 4MVJI 1L1RA 1SDFA 2JVJA 4LF4B 1W46A 4WECA 4A6DA 1BA3A 2A69D 2WTAA 3RYIB 5CYOA 4GIBA 2YYSA 1PWXA 3MHPA 1E66A 2GM4A 2K32A 3RYIA 4FF4A 4I2VA 4E12A 3LL7A 4D9JA 2G5DA 4DBLE 2JLYA 3Q72A 4DE5A 1A3UA 1SE4A 2YUTA 1XLWA 2NXWA 1ZDMA 4RANA 1NBOA 4CKXA 2NTNA 4WGFA 1GYRA 2O2ZA 3EA5A 2GAIA 3AO0B 3CA8A 1G51A 3QVKA 2JL1A 3V2GA 4EF6A 1O08A 3BF8A 2OQ0A 4M1MA 4OG2A 3EVFA 3D1LA 4Y0AA 1SYEA 1PT6A 3GG9A 5KYXB 3NRCA 2JRLA 3K57A 2WYOA 5KYXA 4LCEA 3KQHA 3MTEA 2RBGA 1GOZA 1F06A 4HS4A 1DAKA 1IL2A 2ASVA 3KQOA 2DHRA 3CKIB 1WUTA 4V0SA 4IOAA 2ZIEA 4K86A 3O8DA 5BYBA 1NNI1 4MICA 1UBLS 4E51A 5JEAH 1E2IA 3CUEF 3IQIX 1Q1GA 3A8JE 2HNKA 3CW2C 4QFCA 3DLIA 4MIKA 2CHGA 1RDFA 1ZP6A 3L3OC 5IBQA 3JCZA 1J6UA 4BEJA 1II9A 2HK8A 1VRVA 1M8GA 1T5OA 2FNAA 2NPOA 4U7TB 2Y1OA 5BW8A 4HADA 2C7BA 4NONA 4F86A 9GPBA 4JBYA 4GZYC 2J5XA 5ICFA 3AP3A 4NMXB 2FPOA 5EXPA 3NEYA 1RFLA 1L8LA 1ADJA 1AKNA 4PRKA 1XLTC 1Y5LA 5G0UA 2EWWA 3OHMA 5T1GA 3STXA 1WHSB 1CQPA 2H5JA 3IVCA 4MUMA 4PSDA 2D4AA 1F0NA 2BZGA 4WZ6A 3SM3A 5LR6A 1PX2A 1WHSA 3RIHA 4XTRA 4YVFA 2YJTD 3Q3EA 5EKKA 3S17B 1QFYA 4EY6A 3HO1A 1W1WA 5C32A 1NNSA 3PE6A 1TJ4A 5JY6A 3KLSX 1R4NB 5ALUA 2SKDA 5TQ0B 3GVCA 3CW9A 3T94A 1VQLA 1EP9A 1R4NA 3K8YA 3KDAA 3KZKA 2AWNA 1C0KA 4K5VA 2QM0A 1MQSA 5AYVA 4S1WA 2E48A 3HHPA 4RS3A 2R5WA 2P9GA 3I6MA 3M4YA 1QRTA 2F3UA 4GPD1 3DBLB 3U3DA 2VW9A 5CK5A 2H2HA 2AF4C 2Q3MA 4A93B 4K6MA 3DBLA 2PHZA 3LCRA 5PNTA 2CLKB 3DE1X 4NS1A 2BSAA 5M3BA 1T5BA 1E32A 2UXDQ 4UHEA 3GK3A 3T1QA 2OGTA 3HEBA 3F46A 4QRDA 3NTIA 1V3UA 1OCEA 4N3AA 4BVAA 1UF9A 3FR8A 4BQEA 3P2IA 5J39A 4D4JA 2AMJA 5FJ8G 5BOSB 2G4LA 3O5AA 1YJQA 1EIWA 1ZONA 4ZYUA 1K3TA 4OJNA 1ZH4A 4HQKA 4WJLA 4GBJA 5BOSA 4WZAA 2V1UA 4NFLA 4DV0B 4IOCA 3IVAA 5DVZA 2VQEL 3A25A 2PUAA 3CVOA 4V0OA 4K1XA 6LDHA 3E53A 2JLSA 4ITVA 1PQ4A 3WAJA 4A76A 4YAWA 2ID4A 3BHJA 3M7NA 2MHCA 1X15A 1GUFA 1VP3A 5JSQA 4RTLA 1YSCA 4MV0A 4RD4A 2ZXPA 4J7XA 1CUJA 3M4ZA 4MO2A 3KHUA 4UATA 1YR8A 4F3CA 2GR9A 2N0SA 4GL4A 4TKLA 2QEXA 4OH1A 3AHDA 3FDFA 3EWIA 4PU0A 4PPQA 1NI5A 2CFIA 4Q1AA 2HGSA 5F51A 1PJAA 1O89A 5FFMA 5DBHX 3H8VA 4YTEA 4LXXA 1D4ZA 1FRZA 1P1FA 3M9WA 1PRTD 1OWNA 3N8NA 3L9XA 3EULA 5AUPB 5I01A 1AW7A 3ZDYB 1VGVA 3NBAA 2HPAA 4Q02A 3RT9A 2GZMA 1Y8ZA 1DSSG 4UCQA 2I1WA 3UAYA 2AN5A 1GEEA 2PLNA 4J0JA 2W2PA 2WABA 3S3TA 5IT9A 3R8BA 3NAMA 2G7MC 3H2BA 4Z0NA 3GPDG 2B0CA 3WLKX 1MVOA 2FN8A 1MP0A 1XZEA 4JVMA 4FCVA 5F2EA 4RVCA 4G8BA 4KWEA 3C1AA 3ND6A 3DZDA 3RG2A 5KU1A 3IMKA 3S1AB 3WRWA 1O9HA 5G53C 4YPOA 1NVTA 3M5PA 3S1AA 4EX6A 4LEIA 1UEBA 5J47A 2EKZA 3MWGA 2MR6A 4GU5A 1UWKA 3OVMA 4P74A 2W2QA 5LZ7A 2NZHA 1R74A 1U7TA 3CZ4A 4PGMA 4J15A 3NUGA 1Y8OB 1P5RA 1XB2A 5TJHA 1E1QA 4RELA 1N9KA 4ZUJA 1ORWA 2DCUA 2ZBDA 2CMFA 2IOFA 2RIPA 1PFUA 1PSWA 2WKWA 4XB2A 1Y7LA 3DOUA 5CA1F 2PSDA 1G18A 4GRAA 2Q2UA 3OFJA 1USVA 4YRIA 1YZTA 1RYFA 3SHVA 1E2BA 3F6YA 2GPBA 4IWNA 3H87A 4H1HA 3UAGA 1XVLA 3OURA 3B85A 3WNVA 3NDPA 2F4VQ 2P7IA 1TC2A 3O1JC 3BFJA 1TZKA 4RWEA 5G3YA 4TL8A 4RPHA 1QQ7A 1PEDA 3DLBA 2B2XA 3CC2A 4DIOA 1HCZA 1XBTA 1EWVA 1TWFH 2EEZA 2IZ7A 3H65A 2V9PA 2VJPA 4C3IG 4JI1B 5T64A 4IH1A 2WWXA 1FDTA 5LJIA 4C1NK 4FNMA 1TLLA 2RB4A 1EX1A 3BH0A 5K5EA 1MHWC 4XTCS 2O1EA 1ANKA 2ZIWB 5ALEA 1JU3A 3IODA 2RHLA 3MRXA 3D4DA 2DECA 3SVTA 5BPHA 4GOMD 3FFWA 1ULUA 5EHIA 4B3RQ