2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
2UKDA 5K8IA 3SJAA 3KQLA 1S1MA 1TL7C 1J8MF 3KDFB 2WWXA 4IDOA 1HT1E 1A5TA 1EIFA 1GNPA 4EUNA 2XNSA 4NYJQ 2JJ2A 4I1VA 5GAGC 2OBMA 4G5OA 4XSHA 1J99A 4KN7C 1NTGA 2PQAA 4DR3Q 1AH9A 1NVVR 1XWIA 5EE3A 3WY9A 3T1TA 2ZVQX 3VA7A 3I4MH 1NJFA 1H9KA 3KF8B 1NBMA 2NVQH 3K70C 2D2CC 1A0IA 1PA6A 5FL7D 3ZH9B 1TU2B 2OTJA 2R92H 3WBJA 3CNOA 1T91A 4G7OC 1IN4A 4ARZB 2O8BB 1R8SA 4TMWA 3ZZTA 4X65L 2KBNA 2ZJRA 2CHQA 4Q47A 4A93H 2VPPA 2IYWA 3ZJYA 4BLPA 2GWHA 3T15A 2IYQA 2V7QD 1GWNA 1IN7A 1UFQA 2H5XA 1G64A 2D0PA 4PZ7A 3A1SA 4MA4A 5C0XJ 4PFSA 1DE0A 4JI1Q 4UQOA 3FB4A 3GJ6A 1PYBA 1E1QD 1ZNYA 2A6ED 3LWUA 2HV8A 3NE5B 5FOXA 1AZTA 4JJKA 4V0ME 1HTPA 2E76C 2KJQA 4B48A 1HQCA 2VL6A 1XNRL 4Q02A 5SZHB 3VR1A 2L5TA 4H9GA 4A3CG 4MRNA 1KQSA 5KTYA 3B2EA 4DUGD 3G48A 2IS1A 3J81c 3W6PA 3U6BA 1U8YA 3VKGA 4DV2Q 1VQ7A 4A3DH 1II8B 1OFIA 1E79D 4WVFA 2XXAB 5JRZA 3RSOA 1K6MA 2AD5A 1TWGH 2PNHA 1CS4C 2FV8A 3FWYA 3IO5A 3LFUA 5L3RA 2IS2A 4BE7B 5FLXc 2PNRC 1QVRA 3W90A 3THXA 3RHFA 1UWVA 3GLHB 3T1HQ 4KLZA 4PQYA 1N9WA 1IBRA 4BBSG 2Z6KA 1UKEA 4Q1BA 1FOEB 4EJSA 1UJ2A 3QXSA 1W5SA 2CJWB 2D7CA 2QAJA 4IFDG 3T5GA 2D5DA 4A3BG 1O7IA 3BJUA 2V6IA 4UY8C 1BKDR 1J90A 3K09C 3MGCA 4LF6Q 4D4JA 2VL7A 5ANRB 1P62B 3NEYA 1XCGB 4Y7NH 2UUBQ 1TF7A 1HZ9A 3KJHA 4HAUA 5FBLB 5G40A 2FN4A 3K9GA 4DB2A 4FI3C 3KQKA 2YKGA 3K9HA 1GNQA 4L9SA 5CJ2A 5KOYA 4Q4JB 3FYHA 5TXGA 1XEWX 3KJGA 2JA9A 1R0XA 1E9AA 3G5UA 821PA 2WWYA 1HNWL 2D2EA 2UUCL 1CKOA 1MKYA 1VQGA 4APVA 3HPRA 4AG5A 4WAUA 2IHFA 4DLSA 3JAMi 1YR9A 5CB6A 2A5DA 3I2ZA 2HCBA 4EFLA 1NE3A 3VR4A 1KOFA 1K8AC 3CRLC 4URYR 4KKSA 1GJXA 2X8AA 2YOHA 3H4MA 1Z63A 2VQEL 1ZUNB 5EUMA 2ZRPA 1V8QA 3EWSA 1TU4A 2UZ3A 3A1TA 3U6KA 1Z0AA 1JEDA 3QE0A 5SZKB 4GLVB 1LB1B 4D80A 1K83H 1G8FA 4P4TA 3TRFA 1XCPA 4B76A 3RNUA 2IBMA 4FXPA 5CIQA 5DGXA 1X1SA 1U0LA 2QPAA 1L1OC 2VSOA 4NP6A 4OJKA 4TYPA 3VAAA 2WAQG 2CLCX 3M9BA 4B3GA 4FCTA 2Q8IB 1Y14B 2O0HA 2VYFA 3PQCA 2DB3A 2XZLA 4U02A 1BVSA 4PAOA 2O8CA 3GJXC 1X56A 3IKJA 1JBKA 3HU1A 2JEAI 4X62L 4IO9A 1S72A 1H8HD 1K5DA 3PCRB 5G53C 3WRXC 4DLRA 2ZANA 1COWA 3V4FA 1E2VA 2QGNA 2J3EA 1U0JA 4ILEA 4H02A 1VQDA 1DELA 1GKUB 2GTPA 2E2JH 1YR8A 2GNOA 3BD9A 1RC8A 2K5HA 1FPMA 3AP3A 2DCUA 3CRRA 3LDAA 1CR2A 4CF7A 4B34A 1E3MA 1V5WA 2XSZD 1VCIA 4JL5A 3MJHA 4LDJA 2A19A 1E2MA 2CXXA 3C5CA 4TTQA 5LBIA 5JWRA 2RHMA 1XTIA 3B82A 1YHBA 1MO5A 2OO7A 4LF4L 1IYVA 3L2PA 3PITA 5IK2D 5A0FA 2AHOA 2ZJAA 4JI4Q 2C99A 5E7MA 4DV5Q 2QTFA 3WYGA 4M53A 5EXPA 2N8NA 5KDLA 2FDCA 3BIFA 1G8HA 1AM4D 1KJYA 2WB1G 4DV7Q 3CPFA 1KRTA 3HOVG 1NLFA 2BV3A 4JI6L 2BKUA 2KWIA 4AYBE 3VU9A 4A2QA 1DEKA 2BE5C 4D4LA 3L82B 5FI1B 4MYCA 2E5LL 4TL9A 5HE9A 5IYCG 4HAXA 4JVSB 1JPJA 2EJMA 4NXNL 3X1YA 3GLGE 4NU0A 1OYYA 2NPIA 2X77A 4A0FA 3B9PA 3BG3A 2QGZA 4NZYA 2D0OA 4C3HH 4US0R 4BFZA 4HR7B 2PX3A 1ZAKA 2MNAA 1XEXA 4TLCA 1N3BA 3QXJA 1L8QA 1XPOA 4M9ZA 1MT0A 1IYUA 4A9AA 2K50A 1IXSB 3BS4A 1IBLL 1HQYE 2AK3A 3S1RH 2BH2A 2K4KA 2ZE6A 4JLNA 1IQPA 2PEZA 1OXSC 3NBHB 2OAP1 2MSEB 2QI9C 4MRSA 3TSWA 4WXPA 5DLQE 1GHJA 4TZ6A 1Q57A 1EX6A 1G8YA 1W0KA 4X8OA 3NBFA 2PCJA 1NJGA 4E03A 5BQ5A 3TEHB 2HDNB 3QSYA 2H5EA 1VDZA 2VRWA 4DSNA 4V03A 2W83A 1ZU4A 4EX5A 1FJGL 3PR1A 3GTGH 2C9OA 3UDXA 2DUDA 4Q7MB 4TMVA 4FDBA 5IDVA 3R8CA 4IHQA 1CKNA 2ZS9A 1IXRC 1F48A 1YJNA 1GL6A 2C9CA 3AKEA 2Z0SA 2IXFA 5FR2A 4OI1A 1XXHE 1MJCA 2Q3HA 1HURA 1VQOA 1QHXA 2CDNA 3LH5A 3QXHA 3LLUA 4QOSA 5AJVB 1G5RA 2GN5A 2ZSDA 5M5WH 5KPDA 3WNCA 1Z6YA 3BORA 1R2QA 2AFHE 4B6EA 5D3QA 4TWZA 2A30A 5AUPB 2ONJA 2QP9X 3CZPA 3S14H 4BQSA 3F2DA 2OFOA 5G3YA 4JLOA 1QHHA 3EPHA 1E2QA 1KK3A 2H57A 2FXQA 2HJVA 2PEYA 4JI2L 2J46A 2A69C 3LNNA 5BN4A 1X3FA 1Q0UA 1SN8A 1D5CA 1E2ZA 2QRZA 3A6PC 4LFCQ 2GRJA 2ZJOA 3CNNA 3GJ7A 4Q1EA 4DRZA 4QM6A 1BDOA 2UXBL 3EIVA 5AJWA 3SC3A 4NDZA 4GLAC 2G83A 4M1OA 4A8JC 2VP4A 4LV5B 1US8B 4KKTA 2K5UA 5KSYA 2JLZA 3U44A 3VNUA 2J0QA 2IS6A 4Y0VA 1HH2P 3CX8A 3T1QA 4MGIR 4TTRA 1XJCA 5B2ZA 1N6PA 1F2UA 4A2WA 1UF9A 1EFRD 1VQKA 3I62A 3ZIAD 4DR7L 3CRMA 1KGDA 1Z28A 3RZDH 3M6AA 2OCYC 2CKZB 4G5SA 4LJYA 5FBRB 4QM7A 5BXQC 2AWNA 4OXPA 2CFMA 2QTVB 4QXAA 3R9IA 5AR1A 3DL0A 5DHAA 4GKKL 5L3VA 1LM0A 4C0BA 3OTOQ 2J1LA 4NPHA 3W3AA 1SKYB 5FPSA 1JECA 2X1VA 4BFYA 3W3ZB 4H0LC 3W8RA 2G3YA 1W49A 1Q44A 4BY1G 1TWFH 3EAQA 3SU8A 4OHYA 1DAFA 1Z6GA 4EPYA 3A8JE 2FA9A 3DO6A 2CL7X 1MV5A 4H1VA 4H13C 3AB3A 3N5CA 4BUJA 2ZREA 4FMCF 1N6HA 4G5RA 4NYIR 4NCNA 4IKEA 3IEVA 1N6LA 1N33L 2GCOA 1SQ5A 4LJ5A 4Q7JB 4PAMA 3S1AB 2JA7G 1CXZA 1XD2B 4DPGA 1JJGA 2K75A 3CP0A 1J70A 1ZM7A 2XJ9A 4NYJR 1I4TD 2R8RA 2F1MA 4RCYA 3CNLA 3DHWC 2Z6VA 2ANBA 1UE6A 3EX7C 3SBEA 2QRNA 3AM1A 1U81A 1DAMA 1A63A 5C4XH 1VQMA 4V0KA 4EAQA 4KCGA 1E32A 2WAXA 3ER0A 1ODFA 4L16A 2C2HA 3ADKA 2XB2A 4LF7L 4PHTA 1YU9A 5JHGB 4A3EG 3QOFA 3K53A 1IN6A 1Z8FA 2PMDA 2I5MX 2I3BA 4QGHA 3AVTA 1RE0A 5FOTA 3RRNA 1NJIC 4X65Q 4IOAA 1NY5A 3KUCA 1E9SA 1A8VA 3UMRA 3A1UA 4A82A 4A1FA 4OK3A 1SVKA 4FCWA 3ZDQA 5C3EG 4F92B 2WMOB 5HZKA 3L43A 4P75A 1W36B 4DCVA 2PT7A 3TVTA 4YMWA 4TMXA 5B30A 2P0EA 3CCSA 1S2MA 4MYTA 1XU4A 3AKCA 1OJLA 2CLDX 4HZUB 5AJZA 5CITA 1RPZA 4NCKA 1MABB 4KYUA 1AK2A 4Q4AA 4M1SA 1Q1BA 1P75A 4DT1A 2IL1A 5BYJA 2JLSA 1KDTA 4HEJA 4A3KH 1DO0A 1U2RA 2GBLA 2O8DB 5EE1A 1FR3A 3H94A 3U50C 2VHQA 4QC2A 1Y8NB 1JQLB 3CCEA 3H0GG 2R6DA 2E75C 1TUEA 3RLFA 2XOKD 1SFOH 3U2QA 1OXXK 4PPNA 4AKGA 4GNXB 1TWCH 3JAMc 3GMTA 3IIKA 2P3SA 1FP6A 3LQRA 1G291 3GLFB 1S4QA 2FGKA 4B3TL 3FKSD 3WBKA 4L8JA 3T1VA 4DVGA 1Z0FA 2QF7A 1NLYA 5C18A 2R93G 4OQMA 2VQFL 4A92A 2A5GA 2X19A 2ZRJA 4NXML 4QG7A 1G20E 1XEFA 3L0SA 4JI7Q 2HXYA 4DV0L 2N42A 2ZRCA 3OAAD 4IOJA 4JLAA 4NCJA 4BLQA 1UAAA 2QM8A 1JT8A 3ND9A 3K81C 1L1OA 2B6HA 1EK0A 4JOIC 1CR1A 1FW6A 3F2BA 5M3MH 3B1YA 2DR3A 4US2R 1A2BA 4JBYA 2Z0MA 3WMFA 1G19A 1ZYRC 3JZAA 3FHTA 3IBYA 1I94L 4JVMA 3S24A 1FQJA 1NBME 2JJ8A 1P60A 1VPLA 4CEHB 2ZR7A 4HB2A 4QQBX 2A6EC 3AF0A 4AIMA 2JA5G 2CVHA 2EQSA 1MKHA 4GI7A 4A0HA 1DCZA 3AGPA 1N6RA 1ZM2A 3W8NA 2UUCQ 3UG7A 1E9FA 4XJXA 4OK5A 1YRBA 4HLUC 1MR3F 2CLSA 3VKHA 4KSCA 4M9SA 4D81A 4NCHA 2VUMH 3U3JA 2LMCB 2Q2HA 4AYWA 2CCJA 1NMXA 1N8RC 2WWIA 4MRPA 1Z22A 1YVDA 1KSFX 3LAWA 4A76A 2VBCA 5JSZB 1SLJA 5FJ8G 1YZGA 3H2YA 3U7EB 4YQFA 3UPUA 1Z0KA 5GJCA 4DLXA 1QHYA 5FLMG 1MJEA 1E1RA 2CCGA 2DHRA 2IXEA 5LMUQ 3PJRA 1FQKA 1XD8A 3TW4A 4DAYB 1E9EA 1FZQA 3CZQA 3I4NG 5FOSA 1VF5C 2ZRNA 1GDDA 1KIMA 1KKLA 1SVMA 1BIFA 1TTTA 4BBRG 3S2HH 1XBTA 4GZMA 4RSGA 5FOUA 3TJZA 1UDWA 2TMKA 4U00A 3KX2A 4J15A 1CEEA 4A3GG 3T1OA 5LPNA 3KXKA 3HOWH 3AFQA 4A3FG 2XTZA 4BPBA 1AS3A 621PA 1CJUC 5AJYA 4LHYA 1AKEA 3GO5A 3EASA 5TVKA 1N5IA 1L4UA 5CDFA 2JJ1A 3F1ZA 3CPHA 4G3XA 1F2TB 4O0MA 4UXHA 4QJ3A 1PH1A 2F3RA 2H18A 2IYYA 1S96A 4ZDKA 4URXR 1YIJA 4DV3L 2D62A 2BBTA 1ZM4A 1VQBA 1E9DA 3ZJYC 1SHKA 3WP0A 5BYKA 5J4YA 5JJLA 1ANKA 5J3BA 2ORVA 1Y1WH 1GRRA 3PVSA 2F52A 3J81j 4JLKA 5DYGA 1J8YF 1GRQA 3AUYA 2EDGA 1NMZA 1L2TA 3B85A 1CF4A 4A36A 1OH8A 1E1OA 3SQWA 1OE0A 4LPKA 1RJ9B 4ACAA 1YZUA 1M6NA 3I61A 4DAMA 2KBFA 5FFMA 1X3GA 2CEAA 3FMIA 1XFAA 4GS3A 2ODBA 2A1AA 5BWMA 1LABA 1IXRA 2VNUD 3LBNA 3BB1A 3OFNA 1GOTA 3UG6A 3GJ0A 2MSCB 5CLQA 4CIDA 2FPMA 5L3SA 1YE8A 3R7WB 3ULLA 3T1YQ 2E5LQ 2Q0HA 4M1TA 1U98A 4QHSA 3KFXA 3NBXX 3FKQA 4RJLA 3X1XA 1Z3IX 3PUYA 4RFSA 4Z1MA 1XNQL 1RKBA 2B92A 4Y0AA 2NZJA 2XAUA 2D7DA 4FINA 1W0JA 4EJSC 3VQTA 2MO1A 4X66L 2IUSA 1HNZL 1IJEA 1KK2A 4Q4HB 1BOFA 2R7ZH 1VHTA 1W48A 3CX6A 5CM8B 1N36Q 1FVIA 5DHFA 4Q1FA 2Y0SG 4OO1I 1IHUA 3M0EA 4E07A 4DC9A 3RS3A 1TU3A 1VKJA 3BFXA 4OJQA 5F9HA 2MQHA 1VYVA 3C5HA 4PQFA 2QAGC 2ZI9A 1TUIA 4TN1A 5H8WA 3B78A 4M22A 4BLSA 2QE7D 2VP2A 4GRAA 1E94E 4ZIRB 1PH3A 4JBXA 1G3RA 4A8JA 3LGJA 2FWRA 2HYIC 2BMDA 1KK0A 1XXHA 2ATXA 2EYQA 4OWWB 4LJ4A 4KLKA 5JI2E 1AKYA 4GP7A 4ZI3A 2F4VQ 1QVAA 2GILA 3GTQH 1GAJA 2NOAA 1Y8OB 2VF7A 3K7UC 4WBSA 3NDBB 1NLZA 3HGBA 2HXSA 2Y8EA 3K0FA 4IDNA 4MUAA 2K5NA 4KHPL 4YWMA 5LB2A 4LW1A 3BZKA 1R5NA 1I3QH 2Z4RA 3HU3A 3L0PA 4JI8Q 2QT0A 1TWHH 1B70B 5IYDG 1XP8A 3N2EA 2GAAA 3FOZA 4LF5Q 3E70C 3TQFA 4ASUA 1KDOA 5DE3A 1SXJB 3BRWD 2ZJZA 2A5JA 4D82A 4IPCA 1RRFA 3UANA 3K0AA 5EXXA 1PYSB 5K8LA 3IRBA 5FH9A 3S16H 4F38A 3OW7A 4PC6A 1FUUA 1RW4A 2QMHA 4R9UC 2FPLA 1Y1VH 4O2LA 3HR8A 3R9WA 2PBRA 1VCMA 4KVAA 4Z1MD 3U4QA 4DR1L 1D9ZA 3EIHA 1SULA 4A6PA 4UJ5A 3B7GA 3PF5A 2P6RA 2ZRAA 1W0JD 1UE1A 1VQHA 2NO1A 3A74A 2UXBQ 3MCAA 4R71A 4I99A 2QL6A 1ONBA 3DM3A 2FOLA 4ITRC 3T56B 2GCPA 4JI3L 1KMQA 4TQUS 3KB2A 4UJ3A 4A3DG 2ZRGA 3GLGB 1G8GA 1YJ5A 2EFCB 3S1QH 3EZ9A 2QENA 4UNQA 1QVFA 4MGYR 1AIPA 1G6OA 1GUNA 4DR7Q 1PH6A 4LJAA 1OW3B 1C4OA 1N32Q 4B3MQ 3Q9LA 2GAOA 1VQEA 1OH6A 1EYGA 4DR5L 4EPRA 1E0SA 5EP3A 4B75A 3TAUA 1XF9A 4WOPA 2ZM5A 2CHVA 4Q48A 2YTXA 1ZUIA 2OAQ1 5JCZA 2ZRBA 1W4CA 1HCZA 2N78A 3IQWA 2ZU6A 3VR3A 3GFPA 5KSOA 3PO2G 4QL5A 2KENA 1MRNA 3SHFA 5C4MA 2Q2TA 2C8VA 3A4LA 5F3WB 2GJ8A 2QP4A 1E69A 4YCWA 5KNDA 1H9RA 3EZFA 1O7LA 2FGJA 2JDID 2WOOA 3BAFA 3P20A 2I5LX 5IE8A 3IDQA 2KCMA 4NKRA 1VS0A 1Q46A 4KFRA 1P7CA 1OHHD 1HV8A 2RMKA 4URZR 4ACBA 2EYUA 4ASUD 3E1SA 2GETA 3ULPA 4D0LB 3KQUA 3Q5DA 3NH6A 1LUZA 2ZTSA 1E79A 2Z4SA 3B1ZA 1LS6A 4TLAA 4G5QA 3VNVA 3DOEA 4DHEA 1JJCB 5KUTA 4GP6A 3R8FA 3KDSE 4CT4B 2OEPA 1D7QA 5FTLA 1T8TA 3UMFA 1YNJC 2VHUA 3Q8XB 2OQ0A 4BZPA 3CRW1 4PHFA 2AUKA 2J45A 2C04A 4TQ9A 1B8AA 3ZVLA 3K0EA 1Z6HA 1DGSA 1SGWA 5M04A 1JQJC 3ZD7A 5FL7A 4P33A 3THWB 3SNHA 1W7AA 4YHHL 2O8EB 3W9YA 5H70A 3P4YA 2IUUA 3FP9A 2ZE7A 4P4UA 3K0CA 5DI9A 1P9RA 2IX1A 4B3BA 4BWYA 2GCNA 1E9RA 3RAPR 1CJMA 4KFUA 2Q9AA 3KKMA 3PIRA 4P32A 5EE9A 3S2DH 1N34L 4QFMA 3I4OA 4JOIA 2YU9H 1LNZA 2ZTDA 4HUQB 1VYUA 4GOJA 5CLLA 2HIVA 5IP7H 2V7QA 3HDTA 4N1AA 4NMMA 4KSBA 4ZCMA 1TEXA 1ZIPA 1GFIA 2CL0X 1LW7A 4PHHA 3EPJA 2XX3A 3G71A 4JLVA 2W00A 1E24A 1E1QA 1CRQA 1E99A 1EFUA 1R10A 2B7CA 4P74A 2OILA 2ZUCA 3CX7A 4OK6A 2KCTA 1GD7A 1S3GA 521PA 1SZPA 1XRJA 3M3YH 2VQSA 5IYBH 4YDHB 5FTJA 4C0HA 2P65A 4AI6A 4EPWA 1KZGB 2GA8A 4LJZC 1MO6A 4LBVA 1M7HA 5HCNA 3ASZA 1DD2A 2K7VA 1EXMA 1GL7A 1P3JA 4MKFA 4OX9L 4PC7A 4P4SB 4TSFD 2JLUA 4DV6L 4LUVA 3AV0B 1PFSA 2WOJA 3LNCA 4B3TQ 1QZHA 2UUAL 3LVQE 4PQRA 4PTLA 1SROA 3HKZE 4PV1C 2IT1A 1VQFA 4C3IH 1HY3A 2WKPA 1CSQA 2HF8A 3K7AH 4D0NA 4A0GA 2J87A 1EQRA 4CRWB 221PA 1IXZA 3T06B 4OO1G 4ZCIA 4EQ6A 4CYMA 1TQ2A 1G7TA 4DLVA 3O8BA 5K36H 3AYHB 1GKYA 1KL9A 4GOKA 2BIFA 2RGGA 2OG2A 1OB5A 1XPUA 2V1XA 1CJKC 1T5IA 1U9IC 1G1MA 2YWEA 2CW0C 2AX4A 1K9MC 4A4DA 2VS1A 2ZROA 2A3RA 3NKVA 4JS0A 1FMJA 1VHLA 1XTKA 1TF5A 2CMKA 5FL3A 3O8CA 2D74A 2PJRA 4LF9L 4RG1A 1X6VA 2WJGA 3L0IB 5FUVA 4GOPB 5C44H 3NH9A 5AUQA 2RGAA 4I4LA 4KYIB 2WP8J 4MYHA 4B2LA 3P26A 4NONA 4XVQA 2NO7A 2YOFA 4C7OA 4JKYA 1DARA 1XD9A 3DPUA 2RHQB 4BY7G 4M21A 2YWFA 4HIDA 1GUGA 4KVGA 4DBLC 5J4VA 1WYDA 3Q7PA 1BBWA 4JLPA 3B9QA 3SN6A 1N0VC 4Q4LA 1XMVA 2REOA 3IO3A 2H16A 1KO4A 3ZD6A 4LJ6A 1HA3A 2KE5A 3KKOA 2GJ9A 3QF7A 3ND8A 3MFYA 4PSAA 5EXSA 1A6XA 3S1MH 3HP1A 3LO5A 2JASA 1TKWB 3JVUA 1VYTA 2YTYA 3L2OB 4OKSA 1QZXA 3I73A 2I4IA 2V4ZA 4M0LA 3H84A 5FPYA 4RKEA 1HUQA 4C0AC 1BKBA 4I1OA 2H17A 2HEIA 1E9BA 3CH4B 1JR3D 2QN6A 2UXCL 2ID0A 4RD3A 1CP2A 1DVRA 1EUJA 2LCFA 1XTQA 3LXRA 3C7KA 3MWLA 1Z0IA 1M74A 4PZZA 1H8HA 2K33A 3MLEA 4ZPXA 4DDUA 1Y69U 3PEYA 1EWHA 2RCNA 5BR8Q 1BMFA 4AK9A 1CFMA 2YINC 1VIYA 4TL6A 2DFLA 2R9VA 4IOMA 4AKIA 3M4YA 4IJHA 2ZJQA 1NY6A 4DV1Q 2PZFA 2XITA 4Z54A 4PPGA 3TH5A 3HOUG 5J4HA 3JC66 1QUQA 5FBWB 2XSZA 3RC3A 2DBYA 5M3FG 3L7ZC 4B3RL 5FUWA 4LZZA 2WWGA 1VF7A 3KB1A 4DSOA 1E22A 1S9DA 4M9XA 4I81A 3WYFA 4CEIA 2QAGA 1FGUA 1A1VA 4C3ZA 1KAWA 1Z08A 2C96A 4AH6A 3CCUA 5IK2A 1EG7A 1RL2A 4HJ9A 3HJNA 3LX8A 3U3OA 2AXPA 1TQ6A 2OE2A 4KU4A 1UADA 4PPQA 1S3SA 1XJQA 2RB4A 2PQAB 2QY9A 2OBNA 1ESNA 2GBLC 2VLIA 4HI0E 1IYJB 2O52A 4YY3L 4YMSA 4N0EA 1UM8A 1RVDA 5KSZA 2P67A 5CYPA 1DPFA 2LSSA 4DLYA 2NMVA 1G21E 4B3FX 1YJ9A 2A8VA 2JLRA 3PO3G 3TGPA 2J7PA 2QTHA 3OHMA 5KNBA 4FD2A 4X66Q 2ZU0C 3KF6A 4MH0R 4JK1C 4DR2Q 2I0QA 5BW8A 3GLIA 3TK1A 1FMLA 4DR6L 2ALYB 4TKOB 3A1VA 3NBZC 4RVCA 2JIZA 2JA1A 2DWQA 2EJGC 1QG2A 5AWFC 4LFAQ 3RR5A 4AQYL 5FBVB 2IHEA 4DR4L 1N6NA 1UKZA 3U58A 3C16C 5KYKA 2XNDA 2JGNA 3UIEA 3TS2A 4NB3A 2VP9A 1C9KA 4QGGA 5JEAH 1BMFD 3OIYA 1DAKA 1G17A 2JQOA 1H9MA 2JA8G 3NTUA 1GO3E 3Q8DA 4RZXA 3X1WA 1K8RA 4Q66C 1CU1A 4QGFA 2PJZA 3ZS8A 5CDFE 1D9XA 2D3WA 3QKRA 4C3JH 3M4OH 3TRZA 2NVTH 1ZD8A 1A82A 1OLOA 1TNDA 3ECCA 4CW7A 1ELOA 1CJVC 2N49A 2A9KA 1JMCA 1E2HA 2BJVA 3N70A 2A5YB 3THXB 4AG6A 4KHPQ 2IYTA 4OBEA 3RS2A 4EJSB 4PXAA 1VQ9A 1EOVA 4KJZA 3HOXG 4DJTA 4F91B 4A3LG 2R2AA 2WAQE 3CF0A 1MH1A 1DS6A 3FGNA 2EQBA 2JEBI 1XTJA 1QZGA 2HIXA 3FMCA 1G18A 1E4VA 3IHWA 1IBML 2AKWB 4DLUA 4XIGS 4DLTA 4DV4L 4AYBG 1P9NA 1PUIA 3Q3JB 4IOCA 3OOCA 4IPHA 4D25A 1ZKOA 3PUZA 1W46A 3PEWA 5HE8A 4DR1Q 2BMJA 3A8TA 1X8JA 2EJFC 2AFIE 2OUKA 1WMSA 1YBYA 4YCUA 4OI0A 5A35A 4KBFA 1Y63A 4AYTA 3EA5A 2J7PD 4B3SL 4GKJQ 1GTVA 4POAA 1ZJ6A 5FTKA 1MO3A 4JI3Q 1NSTA 2Q21A 2ZUDA 4X8HA 5C0XH 2O5IC 1YZQA 1RFLA 5DIFA 1X65A 4LK2A 3AF2A 1SVIA 2JIZD 3DM5A 4A4IA 2PLFA 3E2IA 4PAQA 3QPWA 2ATVA 4JJZA 4POGA 1EFRA 2NO0A 2EWVA 3H3VH 2A78A 2GF9A 2XNDD 2D2FA 2WB1E 1C0AA 3ZIAA 2D4HA 4UP8A 1BS1A 2MMGA 3PEVA 4JG2A 4LHWA 2YV5A 4RY2A 3T5DA 1WDTA 3UKDA 3B60A 1X8LA 3CBQA 1J5EL 1NN0A 2MFIA 2WM9B 4GDFA 1T5LA 2GK7A 3EWAA 5AJ3L 5JS7A 5L8VA 4TL8A 1PZNA 3M4QA 2O8CB 3VX3A 1IOZA 1AJEA 2WKRA 4GL2A 1QJOA 2CCKA 4HIOA 2Q2IA 1H9SA 4Q9HA 2F43A 3DM9B 1XMQL 1M1YE 1R4AA 1U90A 4WA7A 4C4PA 1XPRA 3HFZB 4L9WA 4XVUA 2QGQA 4JLDA 1GP2A 1AS0A 2NGRA 3BK7A 1B9NA 4A3MG 1U94A 5CK4A 2V3CC 4OQXA 3VHLB 4A6XA 3EZ2A 2B63G 1Z6XA 2PMZE 1B9MA 1ZCAA 1JB1A 1RRGA 2YNMA 1E2DA 4DUYL 1JAHA 5G3ZA 4DXAA 1N0WA 2GESA 4GNKA 2OCEA 4A3CH 2WV9A 1HR0L 2YC2C 1NVUQ 5JJIA 2IHBA 2AHOB 1IY1A 2OFWA 4R98A 1K8OA 3D0FA 4DUZL 2PH1A 3O8RA 1KNQA 5EP2A 3PIPA 2WFWA 3B1VA 1LY1A 1IY2A 3H1TA 1Z83A 3I56A 5HCIA 4PG3A 2Q3MA 1U8ZA 2ZM6Q 4LWCA 1NN1A 1Q1QA 1W2HA 2IK8A 2IXGA 4YHHQ 1S9HA 3I4LA 1KMHB 2NO9A 4C30A 4URUR 1LYLA 3EW9A 3EQLC 1FNNA 1HE1C 1RIFA 4NHOA 4OQNA 1GNRA 3U3RA 3VU9B 2ZETA 2GZDA 4HATA 4BBSH 4GZYC 1FUKA 1LV7A 1SHZA 1SRUA 2UVQA 5SZIA 4IFDH 1ZW6A 1WFQA 3TE6A 2HYDA 4A3BH 2WZQA 2ZJ5A 4BXXG 4NE2A 3MWYW 1U9IA 1XEXB 4M2LA 4HIKA 1YNNC 5KDOA 2K14A 1DAGA 2IW3A 2ES2A 4B44A 1ZYUA 3QEJA 2W6JA 3LBHA 3OIUA 1E1TA 3AP2A 3QVVA 2V1CC 5L3QA 3BOSA 4TYNA 5LMNL 3A7AB 2QZ4A 2IUTA 1K8GA 3ICEA 3T34A 2F7SA 3RZOH 1UE5A 4JV5L 3REFA 3P27A 4PANA 4HAYA 1QHGA 4LV8B 1PH4A 1G3IA 2WJVA 2IWHA 3IHLA 2AR7A 3QF4A 5FUXA 5EE0A 4OX9Q 2IA5A 2NG1A 2JA6G 4X64L 3HOYG 2K32A 2P6NA 2XOKA 4QBFA 1GUSA 3C41J 3KQNA 3KYHC 4H44C 1KO7A 4UXIA 1KY3A 2QROA 3FKSA 2KB0A 4Q18A 3PCOB 4DZZA 2ZSEA 2BKEA 4D4KA 1YRAA 1Q90A 3FMPB 3OEHD 2ZJYA 4MGZR 2VSFA 1KAGA 3AKYA 4LJ7A 4R2HA 5B64A 2O8FA 3TR0A 5IT9c 1RRCA 2QA4A 5M5XH 2XTMA 3AVQA 3OAAA 4JBJA 4OYHA 2RHSB 2V55B 4QBIA 2C78A 3IPXA 2IC5A 2VF8A 1YEZA 4MKHA 5DN6D 1NN3A 2KI5A 2DNCA 2XEXA 5EQTA 3DZ8A 5FI0B 2IX3A 1AZSC 2HHHL 1TEVA 4RMFA 2YYZA 2ZRDA 3CR7A 3OIWA 1ZM3A 5FOWA 1HEIA 1E2EA 2DPXA 4DK0A 2MO0A 4LUOA 4KAXA 3DKVA 4UNNA 2VZAA 4JT4A 4LPSA 2ERXA 4EPTA 1M7GA 4TLBA 4JI5L 2ERYA 3ZZUA 2UXDL 2QT1A 4YXWD 2ZRFA 5JJKA 2W0SA 4Q9LA 3GTPH 5FOVA 4C7OB 2NQ2C 1HNXL 2EU8A 1CJTC 1S0UA 4LI0A 3SGIA 3EBEA 1G5TA 3CPJB 2W6JD 2ATWA 4IOKA 4LUCA 1U0HC 2ZS7A 1F2UB 1W36D 3WXMA 1IJFA 1BH2A 1XNRQ 2W2VA 4FIDA 4UNRA 1G6HA 3AVXA 2ASBA 2QSYA 4K0KL 1QHIA 5KDDA 3V4RA 1T3SA 3RS5A 3DMDA 1GG2A 1RYFA 2DFNA 3MRSA 4B3CA 2J0UA 1MIUA 4BLOA 1VQ5A 5HKKD 4HB3A 1ZU5A 2I1QA 2OCPA 2LKDA 3K70B 5F9FA 3IBGA 3RSLA 4IVRA 1WCMG 3LV8A 5GVRA 3HOVH 1KJWA 2EFGA 2B29A 4B33A 5DI3A 4JL8A 4LGMA 4LJ9A 3RS4A 3SYKA 1X1RA 3CH5A 5IYCH 4DEXA 3LLMA 2QQEA 2YWHA 4C0KA 1YHQA 1KYIA 2QEXA 3FE2A 3K0CC 2HQLA 2QNRA 3RWMB 2NN6G 4X8MA 4DDWA 2UU9L 1JJ2A 3CCLA 5TDHA 1DG1G 4B3XA 2G0NA 3IIMA 1G9XA 3CRKC 1I6VC 2KCCA 5DSZA 1PVOA 1X3EA 1OIVA 2GCOB 4EPXA 1HJPA 2Q6TA 4DWJA 1ZUHA 1KNXA 1Z29A 3DOFA 5JHHB 2K5VA 3MMPA 1OXUA 4HDCA 4UPAA 3KKPA 4Q7KA 3QQ5A 1TQ4A 4LY6A 3KKQA 3K8YA 3NC0C 1S40A 2V1UA 1QVCA 3HOZG 1ZP6A 4IFEA 3WMEA 1P6XA 2OSBA 1WB9A 1PLJA 4CDGA 3GTKH 1HNWQ 4Y52H 1KI7A 4MNOA 5J5CA 4YY3Q 1XB2A 1L2FA 4HAWA 4YMTA 3GTJH 1SVOA 4F4CA 2A7QA 3KJEA 5CK5A 4P0TA 2DFTA 1TX4B 3UWOA 2QBYA 2VQEQ 1W4AA 5JRJA 2J0SA 3CD6A 4G01B 3TR5A 4TMTA 4GN3B 2HLDA 1L7VC 3ZZ0A 3J7ZC 3F3YA 3CC7A 4LNQA 4QJ4A 3LY5A 1NVVQ 4B2IA 4CZ2A 1XEWY 1ZBDA 3PGZA 4LF8L 1DG3A 3U4ZA 1VCNA 1D8TA 4OL0A 4Z8XA 1AE3A 1E2WA 3KLRA 4DCUA 3GP8A 4DR4Q 1QG4A 4KKUA 2IY5B 2GXUA 4MZ9A 1EFCA 3AQ4A 1ZD9A 4Q4AB 3REGA 3UATA 1SVLA 4BZXA 4DT1B 4X62Q 1WOCA 2J7KA 1KDRA 3PUVA 3BDOA 2GJKA 1EQQA 4TMKA 5GJVC 5P21A 2WHXA 4JI1L 1G7CA 3ETLA 2E87A 3NDPA 4FCVA 2C03A 2JAQA 2QE7A 2JXMB 3CO5A 3SDZA 4WW0A 3QXXA 4HLQB 4MTNA 3DXJC 3A5ZB 2WBLC 4ESVA 3IFTA 1X55A 3MXNB 3AEVA 1D2NA 3AVYA 2B21A 2NVYH 3DKPA 4YMUA 4W9MC 3KFUA 4LFBL 2KSQA 2AWOA 3SQXA 4DV2L 1GITA 3FMFA 4JSTA 4BEBA 4ESHA 2GVAA 2BA1A 1T8UA 1GVNB 3GPLA 4LF4Q 1TF2A 4AKHA 4Z8YA 4BZQA 4JBMA 1WCV1 1AQUA 3C4JA 5AJXA 4EFNA 2ZQ5A 4RFVA 5E95A 3V00A 1Q20A 2ZRHA 721PA 4OWXB 3KKNA 4AD8A 5J47A 1M1KC 3EN2A 2ZI5A 1EWQA 1IBMQ 3FHWA 1L1OB 5GADC 1N0UA 1ZMXA 3ZVNA 3T1HL 1N5KA 2XZPA 1QVGA 4EPVA 1FX0B 1II9A 3TKLA 4JI6Q 4CEJB 1L4YA 1H95A 4IPGA 3GDEA 4TYQA 2EFHB 3NG1A 1WRBA 4TT3D 1SXJA 3PXGA 4BY1H 4LF6L 3D4RA 2W58A 3IGFA 4IJMA 2R7DA 4NXNQ 4A3JG 3EC2A 3MD0A 4DNIA 4B74A 4ZDJA 4WZ6A 3A7LA 3U4VA 1N5JA 3ADCA 2HLDD 1P8LA 2G0TA 1DO2A 5EAYA 3TVDA 1R5BA 4BFXA 1A7JA 3GTOH 3A8KE 1RIPA 4PZ6A 4F4JA 1FFHA 3RLOA 1NL3A 421PA 3C8UA 2V9PA 3QNUA 4DK3C 5J40A 3TAHA 5C46F 2JA7H 4QRHA 1CR4A 1NY4A 1IBLQ 4KBGA 3GLIE 2F55A 3U3KA 3SHWA 4C2TA 1VECA 1OTCA 1W5TA 2AKYA 3HR7A 4NH0A 2WIBA 1F5NA 1OPXA 2BCGY 3NBYC 1CR0A 1CI3M 3QG1A 1YZTA 5CM9C 4Z51A 2G77B 3BFVA 2AMCB 1NIJA 1E4YA 1Z2AA 1E2NA 2B8TA 1FJGQ 1J5EQ 3EPKA 2QEQA 4D0GA 4X8LA 4PC2A 4IDPA 4S2EA 3LW8A 4PC3A 3QKSA 1UPTA 3PFIA 1JNYA 5D3MA 4D4MA 3EC1A 2I1VB 3FHCB 1GRNA 1BBUA 4B47A 1EESA 3LXXA 1G6PA 5ELXA 3I4MG 2ODEA 3I1FA 3NXSA 2JLQA 3NENA 4IXMA 3SFZA 3ZVRA 3B6YA 2JDIA 2EIFA 5C3EH 2GZAA 5E3HA 5IY0A 3FMOB 2R92G 5J4LA 3NC1C 2YHSA 1OHHA 3I7FA 1U5KA 4OHWA 1KC8C 5FPHA 5F98A 1DADA 3S17H 4A93G 1P72A 4JVLA 4WXRA 1XNJA 3EIQA 2OLJA 3EARA 4UXJA 4IVPA 2Q9BA 2QA5A 4OHVA 2E74C 5KSPA 4JI2Q 4YWKA 3EXAA 3SR0A 3M1IA 1SXJD 3W5JA 5GADl 2K52A 1Q82C 2BMEA 2H8KA 3BGWA 3NIBA 4DUZQ 2N1BA 2VHTA 1GKHA 2ZRLA 1W2GA 3VTKA 2FFHA 4C2UA 1Y3AA 1LF0A 2F1HA 3H0GH 2OHFA 3RLNA 2REBA 1LTLA 3FFBA 4M1WA 4Q01A 2JLYA 2XGTA 1E96A 4A3IH 1QBKC 3LX5A 1X9NA 3KTAA 2DWPA 2FEMA 2GHIA 3NHBA 2AN9A 2I5HA 2GXQA 2ZUBA 5L3SB 3I55A 3IUYA 3OZXA 2R93H 1N6IA 2BBOA 2O5VA 3LA6A 1AGPA 1T6NA 4JI4L 3ULJA 3CCMA 4DV5L 4B43A 4RFSB 2PMKA 1H65A 4HJ5A 4DV7L 1ZRHA 3LBIA 1IM2A 3BJIC 2J0VA 2J59A 1R9TH 2CK3A 2IYLD 3B5JA 4L8GA 5ELNA 2IYXA 2ZE8A 3BERA 5E4FA 3UE1A 1JXOA 1KO5A 3J7A5 4GKKQ 4QNRA 3NEJA 2BM1A 1Z07A 1GVPA 2A2ZA 1FL0A 1ZC3A 5EUQB 1VTKA 2NO6A 1BYUA 3IILA 3WP1B 1GUTA 3M4PA 5JWOA 3CMEA 2JA5H 1JEEA 2AXNA 4QHTA 3KQHA 1JJVA 2OXRA 3R20A 4JBKA 4L5SA 3X2SA 1KSJA 1XJ0A 3QI2A 2ZAMA 1U8AA 2FFAA 4AKEA 4A8JB 3WDNA 2PX0A 1N33Q 1N25A 1HZAA 4TSFA 3W1BA 1S1CA 1XXHB 3RRZA 2FG5A 1E0JA 2QQ0A 5FJ8H 5KPJA 3W5OA 1M8PA 3GJ8A 4OHXA 1KSHA 5HPYB 2ZXUA 1KKMA 2J9RA 1D8LA 1M2OB 1NIPA 2PZGA 4P4SA 4ZDIA 5IT5A 1CTQA 3RN5A 3PENA 3K0FB 3GJ3A 4TVAB 4LUZA 4KHZA 3SI7A 2BA0A 4QBGB 4XH9B 1NMYA 3I4NH 2Z83A 3Q85A 2WSMA 1ASZA 2R7FA 4BBRH 4LF7Q 1NKSA 1I4DD 4US1R 1NSFA 3KDFA 3GEEA 4Q1DA 2XTIA 3K0AB 4KODA 3CC4A 1K3RA 1EFWA 1T3HA 1JAIA 5E7IA 4B71A 5IP9H 1KD1C 3R9XA 2CE2X 4A3FH 1VMAA 4DK1A 3FKIH 5TB5A 1VG9B 3A58B 4PZYA 4C0LA 3U60B 3U4QB 1CULC 2OV2A 4LHZA 1GSIA 5G41A 3WYAA 4HDOB 3LD9A 1KIXA 4M4SA 2W6ID 3UXMA 3C15C 2QUZA 2CK3D 2UXDQ 1I2MA 3IPYA 3OEED 4P31A 4ARZA 4DCSA 2O8BA 3UMSA 2R6GA 2FU5C 2N3SA 2ZE5A 3K9LA 4ZKEA 3SZRA 1SKQA 4E09A 3CPWA 3CCRA 3E5HA 1R0YA 3NEMA 4LFCL 2AK2A 3W6NA 1KI1A 4GT1A 4LC1A 2FNAA 4WJ3M 4IPDA 3K0SA 3D31A 1YZKA 3EG5A 1G8PA 1CUKA 1C9OA 5CYOA 1E9CA 3U7GA 2BCJQ 1WJJA 4HLCA 3X1DA 2QMOA 2YVUA 1MRSA 4DK6C 2WKQA 3RS7A 2ZTCA 1X3SA 4Q03A 2KHIA 4X6AH 4LYJA 1CRPA 1P9WA 2ZEJA 1NRJB 3B13B 3GQBA 3TS0A 1UEIA 1VG1A 1E2PA 3CAMA 1II8A 1JR3A 4NYMQ 1OKKD 2IYZA 4OONA 4BLRA 4F4IA 3WHKA 5JLJA 2NZOA 2VQFQ 2W2XA 4NXMQ 3FHOA 3GFOA 3U3MA 1XDBA 5GJWC 3OTOL 2EWWA 4L5BA 4DV0Q 2ZSBA 2ZI6A 1P4SA 1ESMA 4EFMA 3GTMH 4W5HA 2BVNA 5H1YA 4XD7D 3GLHA 1Q7YC 4PPFA 2LWIA 1RYHA 1WI5A 2ODWA 1TMKA 5GROA 5KNCA 3H86A 1VQ6A 5JEAJ 4GN5A 2CJWA 3DZDA 4MUBA 1N2CE 3E0EA 1N6OA 4Q1CA 4QGAA 5HTKA 1I94Q 1F60A 1NF3A 3AVUA 2GJSA 1YKSA 3GEHA 3JVVA 1KI6B 5FTNA 2OLKA 1V43A 4F7WA 3CRVA 1IW7D 1FP7A 1W44A 1UE7A 4RZUA 1ZM9A 2OFXA 3THYB 3RWOA 1W36C 4PHGA 4YDSA 1KY2A 3RRYA 1Z7TA 1R0WA 4CGZA 3D8BA 4B6FA 5HY6A 1Z0DA 1Z0JA 1PHJA 2FMXA 2VH5R 3MAAC 1YITA 4Q4JA 2IX0A 3TUZC 3K0XA 2F1JA 1P2VA 2Z43A 2G1JA 2H1LA 3QBTA 3STBD 2R44A 3MUFA 4JKIA 4A2PA 1JR6A 2EVWX 4LOAA 5F2EA 1YZ6A 2CVFA 4R4QA 2ZJ2A 1C7YA 1GILA 3CLVA 3UE0A 1JI0A 2ZYUX 2OM2A 4IDQA 4JMPA 2FE4A 4GNXC 121PA 2QG6A 3VDYA 4JLMA 5IYDH 2PL3A 4AURA 2G1KA 4LF8Q 3CB4A 1AE2A 3CWQA 4Q9JA 3A4NA 1NKTA 4XVRA 5J4KA 3TUIC 3CM0A 3QENA 4LJ8A 5K8TA 5EP4A 2PI2E 2PT5A 2WPDD 3DDCA 3EIEA 3P1JA 4QNMA 2JLXA 4Q7LA 1OYWA 1M90C 5EE5B 4O3MA 2GVBA 2W0MA 4QJ5A 1NMGA 1N5LA 3TSZA 4LX0A 2ZITA 1P61B 5C4JH 2ZPTX 3GD7A 4O25A 1AS2A 1FNMA 4O2RA 3B1WA 2LXKA 4DV3Q 5TMPA 2OXCA 2ODNA 4Q19A 3THYA 1G5PA 1NG1A 1QF9A 3CC2A 1T4GA 2L15A 4EDHA 1GUOA 4LFBQ 1TAGA 1VQAA 1TWAH 2BMFA 4LC0A 5TARA 3RS0A 1ONLA 3TBKA 2QMUA 4B3DA 8OHMA 3TNFA 3W5IA 3CPEA 1KRSA 2GEDA 3VX4A 1K5GA 3CF2A 3WMGA 4JYBA 4C0JA 4U7DA 2RH5A 2JLVA 3CQZH 3QVUA 4BA2I 2OESA 5UKDA 2JEOA 3O47A 4AWXA 4EQ6B 1CTMA 2WWFA 3RDPA 3HWSA 5DISB 2HF9A 1X8KA 4BA1I 3J80i 1E2JA 2VHJA 3CW2A 3CCVA 4ZV4A 1IN5A 1D2EA 2DN8A 5DNYB 1E2LA 4TZ0A 2OQKA 1P16A 1PH2A 4JI7L 1E3PA 4A75A 2JJ2D 4DSTA 4UKDA 3PO2H 3KOJA 1ZD1A 3AB9A 3W1GA 4JI0L 4XWOA 1NBMD 1XMIA 5IWAL 1XNQQ 3ZS9A 3T12A 4I1SA 1HT2E 1OH5A 1XMOL 1OV4A 3CONA 4KLNA 4TLEA 5E7JA 3RNLA 2VTKA 2HT1A 2GDJA 4PSVA 3ZGXA 2QU8A 4MDEA 1HNZQ 3ZVMA 3KL4A 4C9BA 3SBDA 4URWR 4PO1A 4KXFB 2ZJPA 3NWJA 2JJQA 3CCQA 1DAHA 1XCMA 2G9NA 2ZSFA 1HTWA 4JL6A 4KITB 2ZJ8A 4IQZA 4QJFA 4BFWA 4C2MH 1KJZA 3BWDD 4GSYA 4BRUA 2ZYVX 3RRMA 3I8SA 4C0QC 2HJGA 2XZOA 4OWTB 5H1SE 2P5SA 5TY0A 2WTUA 5K8UA 4XSGA 2IHYA 2RGCA 4LWZA 4IFDJ 3CF5A 2V54A 5LMUL 4OQLA 3OYYA 1W2BA 1LACA 2PPBC 5C4XG 1KI4A 2R6CA 3S1NH 2ZYWX 5CJPA 5EP1A 4BRWA 1NG9A 4TYWA 3QUSA 4DNTB 4GPTA 4ZKDA 3I32A 4LSGA 4Q9KA 4BGDA 4PO9A 1J2JA 2GJAA 3E9IA 1KI2A 4II7A 1B7YB 2QSZA 2O0JA 5B57C 4I1UA 1CIPA 3IIJA 2FSFA 3DEFA 3ZQ6A 1UEJA 1YJWA 1IL2A 4DDTA 2ZRIA 4JYAL 2IYVA 1Z6AA 1H9JA 1QUQB 3AKDA 4LBWA 2FPKA 2NPFA 1B23P 4BEJA 3MWJA 3VR5A 3F2CA 1SMYC 4CEIB 1K0RA 2OCBA 2QAGB 3G6EA 3MJRA 4R7ZA 1G3MA 1G7SA 3ZLJA 2BJWA 2IF2A 5ELOA 2N46A 1G51A 4TYYA 1SXJE 3KXIA 1T0JB 4XWAA 3SYLA 4KMUC 5JZVA 3KJOA 3A1WA 1Z6TA 1E2FA 3B8HA 1EWRA 3B1XA 2VIIA 4A3KG 3AVVA 4S35A 1OIWA 1G3UA 5IRCD 2FJUA 2PLRA 3HU2A 4V0OA 2NN6I 2C5LA 4RCNA 3I5XA 4QY7A 1ZNXA 2O5JC 2UZIR 3OF5A 1V1QA 1KMHA 1OH7A 4OO1H 1US8A 3DMNA 1O87A 4KFSA 4DR5Q 1FTSA 3T1YL 1XZQA 3QG5A 3KF6B 2WJJA 3UK6A 5HZHA 3GLIB 3TQCA 3KFVA 1NN5A 4GOXA 3AF4A 3BU2A 4Q21A 4EIWA 5HR5A 4DSUA 4MKIA 4GBMA 4BECA 1Q12A 1YHAA 4PSKA 2CHGA 4R4IA 4M1MA 2D06A 1JE5A 1HE8B 1P2SA 4HZIA 4RZ2A 3OPOA 4TTPA 1IBKL 5M3MG 1N36L 1SE8A 1S3OA 2CWPA 2A6HD 1KDPA 1SXJC 4IRUB 4JIMA 1HZCA 4XOIA 1XJVA 4YLGA 2ZR0A 2BOVA 2GEUA 3CKLA 4BY7H 4I7ZC 1GIAA 4HIMA 4PZLA 1HYQA 3GJ4A 3AVOA 1I6HH 2ZTEA 3CF6R 3QKRB 1COWD 5JEDA 1EIYB 1OT3A 2AKAB 2AUJD 2GEVA 3KJPA 2ZYTX 3MXUA 4LV6A 1ZINA 3OEHA 1G3QA 2CE7A 2VUMG 2ANCA 3VHXA 4KFTA 3S1AA 1U99A 1Q21A 1XD2A 4IW3B 1YR7A 3SJZA 4A0RA 1TQDA 2F4VL 2XTNA 2REXB 1R6BX 1HQMC 1SMXA 4G0NA 5EJEA 2V4DA 5DN6A 3AUXA 3SS8A 2PCFB 1NI3A 3A0JA 2PCLA 1ZIOA 1IZ6A 1VQ8A 3T51B 2FZ4A 3D7MA 1E7ZA 3FFAA 4BFTA 5AUOB 6Q21A 4JI8L 3CUEF 1CLUA 4RD2A 5C1BA 4LF5L 4JLJA 4IVQA 1E98A 4UP9A 3AF1A 1X6OA 2H7VA 2XJ4A 4MQBA 3WHLA 4GLXA 1N34Q 2Z5FA 3D6TB 5DLQC 3PUWA 5FUYA 3HOWG 1UBCA 3HOUH 4M9QA 4BASA 1PH9A 1X54A 2OZEA 4YXWA 1NP6A 1TPZA 3V9PA 4D2IA 3U7FB 2OWOA 5M3FH 3FDIA 5EXTA 1ETUA 4WIAA 3JZMA 3I5YA 5E7NA 3HPQA 2LKCA 2R65A 2QPOA 2YC4C 4IEIA 4WJ4A 4DIEA 2EXDA 3PSIA 1Z5ZA 3N2IA 1KXLA 4QBHA 4L4UA 1E0KA 3VKWA 4HZUA 5LD2C 3BBPA 2YTVA 1Y1WG 1MABA 4NYMR 5HKKA 2VA8A 4DIDA 2QORA 2V8OA 5CIWA 1PH7A 1YVCA 3MG9A 2ORWA 1W0KD 4DV6Q 4O0AA 4QKQA 4PR0A 3F0TA 1UKYA 1CKNB 2UUAQ 4B3ML 1N32L 1FL9A 2NTYC 4OI4A 4TQAA 4DKXA 4QL3A 1LVGA 2FEOA 4QGUA 2QPTA 2O8DA 2WMNB 5EZ6B 4KI0A 3TQYA 1K73C 1EFHA 3BH6A 2QMEA 3SFVA 2C9YA 4J0QA 3PO3H 4GNXA 3TZUA 1J7KA 2A68D 2C98A 3RYTC 1OFHA 4FMDB 1K8MA 1H9SB 3WNBA 3GLFA 3EPLA 2F43B 1H8EA 2GK6A 3UDFA 1VG8A 4MDFA 3K80C 1OF1A 1NBWA 5A4JA 2FX3A 2R62A 3I3SR 4V02A 1UKVY 1PJRA 4AY2A 1PV4A 2RGNC 1ZVQA 4O2DA 3ERSX 2KBEA 4KV9A 1VCOA 1W1WA 1OXVA 3AF3A 4IEEA 5BN5A 1VQPA 3CR8A 4L5RC 1OB2A 4JCVE 2EFEB 2RGXA 4LF9Q 1QHHB 1WE2A 3VR6A 4XWKA 1MOZA 1JB7A 2R7ZG 3QXCA 1II0A 4HB0A 2JA8H 3ONWA 3RANA 4IDHA 2OBLA 4CEHA 3K1JA 2JE6I 1W3SA 3LWNA 5GJBA 4G1UC 2GXAA 1D6JA 5H68A 4EQ5A 1P73A 2LXJA 4HSEA 2DY1A 4MGKR 3T53B 2FH5B 3FPPA 2BDTA 3UWKA 3U44B 5DYIA 1PLKA 3X1ZA 1KI9A 2KA7A 4W7SA 2PZEA 3HOXH 2WICA 5AK0A 4ZCLA 2BH8A 4A3LH 1KI8A 1E6CA 1X86B 2RGEA 5JSZA 4UP7A 3FTQA 2FZLA 1LS1A 2H92A 1Q81C 5AUNB 2CQOA 2RGBA 3J80c 2A5FA 2QM7A 3QPUA 1KHIA 4AC9A 1ZNZA 4HJ7A 1DXMA 2PI2A 2GKSA 2SHKA 1I4LD 4JC0A 3K09A 1GKIA 4HDQB 2P5TB 4POFA 1UBEA 2F9LA 2UXCQ 2ZJBA 4WZAE 2ZVPX 1F6BA 3ZQJA 3TUJC 2FF7A 5L3QB 3A8IE 4ABYA 3K70D 5B58C 1T0HB 4LYAA 4V0MA 5TV2A 1CSPA 1AQYA 1JR3E 3A36A 3PEUA 1IW7C 4OI2A 4Q1AA 4NCIA 2VW9A 4JLBA 1O3YA 2J41A 1H8ED 2P6UA 3KZ1E 3QF4B 2OT3B 5FBQB 2L0XA 1XX6A 1XMJA 3D3QA 5GAHC 3DLLA 1Y1VG 1RZ3A 2IYSA 1UDXA 2DFKB 2VSXA 3L8ZA 4UNSA 2RGDA 2ZAOA 3P4XA 3Q72A 3CRQA 4OQFA 3GTLH 1NVWQ 2IWRA 4B3RQ 1F2TA 3AEZA 4GOPC 3TREA 3GLHE 2XB4A 4HAZA 3OW2A 5JI3E 4A3IG 3FPAA 3STBC 4GZLA 2HT6A 1R5OA 1JPNA 4P73A 2CCZA 3EZ6A 2O8FB 4JZKA 2WJYA 2J5XA 3TMKA 2RAPA 1BYIA 3QY0A 2ECKA 2XGJA 5BN3A 1IONA 1IN8A 2VY3A 1Q1ZA 2BWJA 2FFQA 2VHCA 4B2PA 3KLWA 1KSGA 3AGQA 3BZCA 1HZBA 1VQCA 2ZIAA 3ASYA 1RJ9A 4WZBE 3TSOA 2RF4A 1Q3HA 4JI0Q 1FTNA 2Q9CA 2RHDA 2ZSAA 3J81k 1KI3A 5IWAQ 3U7HB 4TT3A 4DR3L 4GMXA 1EWIA 5LDDC 2JLWA 1FX0A 2BHRA 1T3LA 1W4RA 1VQJA 4LHXA 1XMOQ 1F3OA 5FPTA 2HUPA 3MWKA 3R7WA 2DYKA 4R4OA 4B32A 1FYCA 1IY0A 4A3MH 1SVSA 1YZNA 4DR6Q 4Q00A 1P2TA 1PLLA 4IXNA 4K81B 4U5XA 1EX7A 1G7RA 2B63H 2ZI7A 1DOAA 4AQYQ 2GVZC 2CNWA 4N0DA 1PUJA 3BC1A 1JXMA 4RZ3A 3G82C 4L5TA 1XTDA 1HPCA 4Q4HA 2GXSA 4HLDA 1AGRA 2FSHA 1GHKA 2IYRA 4DCNA 5IF9A 3WWVA 1S8FA 2J0UB 3U61B 2E2IH 1ZCBA 2R6AA 3THOA 2WSSA 2V6JA 2YJTD 3CXCA 2BM0A 2P2LA 4Q9IA 1TXYA 3I92A 1NNEA 2WJHA 4UNPA 3LW7A 2Q2UA 2E1RA 5JFGA 2B8FA 4W5WA 2BC9A 1OSNA 1XZPA 3GEIA 5DI3B 4HUTA 4DLWA 4ZIRA 5JMTA 3K9NA 1LFDB 5LB4A 4ERNA 5KU1A 4DB4A 2ZI3A 1PMRA 4FMBB 1YQTA 1M34E 3SE0A 3CCJA 4LRWA 3Q5EA 4ON9A 5IP9G 4DCTA 1KHTA 4BXXH 5GAEC 1BO6A 2AD1A 3FKIG 2CBZA 2EW1A 1Y8PB 4G5GA 4URVR 3ICQB 1DBSA 2YZ2A 4JYAQ 1WA5A 3GCGA 2GF0A 1ZNWA 1XMSA 4DV4Q 3EA0A 5BR8L 3KJIA 4FWIB 5SZJA 4BFVA 4YMVA 3T35A 1WBDA 3MEFA 3QKUA 1W4BA 1CKEA 4RD4A 2BEJA 2C95A 4DV1L 5IP7G 4AYXA 3G0HA 3WRYC 4M1KA 3AFPA 2UUBL 4B3SQ 1QHNA 2DWOA 1Q86C 2JA6H 4FN5A 3HOYH 4JT2A 4KN4C 1CKMA 3J81i 5IYBG 1A4RA 2BDOA 2BBWA 3AP1A 3OESA 3ADDA 2O0KA 3T61A 2QBYB 2WVJA 2NZ8A 1P5ZB 2CNWD 1E0AA 2FSIA 4JVNA 4EKDA 3BH0A 2E2HH 4DEYA 1PH8A 4GN4B 1OFTA 3GFTA 4DLZA 2IEZA 3RVBA 4ZDWA 5DO9A 1Q22A 5C4GB 3GLGA 2NIPA 3PG5A 1JALA 1OIXA 1R0ZA 3QBVA 3E9HA 4ME3A 3PF4A 1GM5A 2IYUA 2WSSD 3SOPA 1E1RD 4NPSA 5AJ3Q 4A3EH 4R4CA 1A2KC 1AN0A 2Z6KC 1V9PA 3CW2C 5C0XI 2HCJB 2ZT9C 4HJ8A 4QHYA 2G88A 3H0KA 4DR2L 1RRPA 5K36G 4RD6A 1IBKQ 2WAYA 3OE7A 3P32A 2E9SA 4MRRA 3ADBA 1JJ7A 2BE5D 4LK1C 1Q8KA 3H3VI 1IAQA 1I2DA 1OFUX 1XMQQ 1AA9A 1WF3A 4R2IA 4TLDA 5C2JB 4LFAL 4M8NE 1Z9FA 4JBWA 2Y0SE 1G41A 2B8GA 1EFTA 2ZRKA 1R7RA 4PC1A 3A5UA 1UBFA 1ZC4A 3B6EA 4RCZA 1DAIA 5C44G 1I5FA 1DAEA 1Q3TA 2F3IA 2JJ1D 3G4SA 3IEUA 4DUYQ 1KK1A 2F6RA 4BLTA 2CL6X 4MITA 3QIAA 2C35B 5M5YH 4LYFA 5DH9A 1R8QA 2VEDA 3GJ5A 1J6QA 1HR0Q 2B7BA 2FSGA 5KO2A 2E8GA 1VQIA 3F5FA 3U9SA 1LTQA 3WNDA 1QHSA 1VIAA 3BH7A 2VP0A 2F1IA 3DVLA 3ZYCA 3LQQA 1WCMH 3UDGA 3N6RA 3EZ7A 1YNXA 4GMDA 2CWAA 1W47A 2VP6A 2ASEA 4D6PA 3AVPA 4BFSA 3VFDA 4LHVA 1KTVA 2ZS8A 2ZI4A 3OFND 2YWGA 4CEJA 2NVXH 3KXLA 3THWA 1E2IA 4YCVA 2DGYA 3PV0A 2NN6H 4R4TA 2O8EA 2GZHA 5FR1A 3A37A 2W6IA 2A6HC 1P2UA 1HR0W 2RGNA 3A4MA 3OEEA 3TLXA 1T9HA 3PUXA 3SJBA 1C1YA 1KO8A 3L8YA 3HKSA 3NELA 1YR6A 5EZ5A 1GL9B 4XTCS 4HUQA 4GKJL 4NBSA 3K8AA 5LMNQ 3BB3A 1E2GA 4B73A 4FWTA 4DNRB 4JV5Q 1UBGA 1EGAA 3HOZH 2BEKA 2IEYA 3OE7D 4KO8A 4LCBA 4BFUA 5JCPA 4MKGA 1KO1A 1N6KA 2AL7A 4IFDI 3BE4A 4E22A 2A69D 1G16A 3S15H 5JWHA 2Q3FA 4NL4H 4X64Q 2X2EA 1L0WA 3QEOA 1WBBA 3QKSB 1SKYE 3BFKA 4ZI2A 5JEEA 3I72A 4IOLA 4W5JA 5D3MB 5GQOA 2JK8A 4YONB 1B0UA 2XXAA 5HGQA 1OKKA 3MSXA 4Q5IA 2DNEA 4YWLA 1NVXQ 5FLMH 4XTRA 3SYNA 2ZRMA 3OIVA 4M1YA 3VR2A 4FMDF 1XTSA 5LMNW 1SVWA 1VG0B 1WQ1R 2W2TA 4HB4A 3FVQA 3M85A 4N3NA 3TIFA 4A15A 3TW8B 4LBYA 4XD7A 3C14C 1QRAA 4RKFA 3SEAA 2RKOA 3RC8A 2G6BA 4C0SA 1I50H 1GZSA 2HHHQ 4F93B 4A3GH 3BB4A 1NMFA 1VQ4A 1ASYA 3HYRA 4E5UA 3BXZA 5LD2B 2YOGA 1Z06A 2MMCA 4K8OA 3H15A 4IJLA 1CBUA 1KZ7B 2GVDC 2IF0A 4B35A 4K46A 4JI5Q 1KI6A 2EVBA 3KUDA 1GUAA 4DDVA 3O8DA 1G4AE 1Z47A 4P71A 4PMWA 3NVAA 4V0LA 5JBQA 4LBZA 2QP3A 4LYHA 5IHPA 2F3TA 3KTAB 2JCSA 2ONKA 4GOPA 4L5QA 2B3GA 4DKAC 4H1UA 4PO8A 5CB8A 4D26A 3AVWA 3Q7QA 1HNXQ 1MO4A 3AH8A 5JEAG 1SR3A 3CIOA 2BBSA 1YHNA 2B8WA 2VO1A 1WXQA 3QJYA 4JSYA 5JECA 4K0KQ 4HYYA 2ZM6L 4CT5A 3F8TA 1QDEA 1TADA 2ZR9A 4IFBA 3AQQA 2JATA 4MRVA 4QIWE 4YC7A 4P3YA 1E2KA 3W6OA 2A68C 1Q1EA 3QPVA 5GVSA 3IQXA 4TL7A 3W34A 3VMFA 1UEBA 3RABA 4OGQC 1OXTA 4CVNA 2KHJA 3HKZG 1HH4A 2IS4A 3RN2A 2WWHA 2MSDB 3L0OA 3LVRE 4AIIA 4ALPA 2WPDA 1DTSA 2X2FA 4NTZA 4OHZA 4PX9A 1YZLA 3LRPA 4A3JH 2EFDB 1T5EA 3PIOA 1G4UR 3I8XA 1D2MA 3SJCA 2C77A 4MYUA 4L15A 3UDIA 4R1JA 2WIAA 3QKTA 1PH5A 4TMZA 4G7HC 2WWWA 4V0NA 2UU9Q 5KHOC 1YI2A 4JYCA 4FW9A 1LF5A 4HAVA 5FPKA 4HJAA 3GLFE 4DUGA 4HLUA 2VP5A 5JS8A 3M7NA 2OTLA 1M7BA 4RD1A 2F9MA 4G7ZC 2WJIA 2F1RA 1KAOA 4FMCB 5FTMA 2FFBA 2ORIA 1VQNA 3NHAA 5A5GA 3U5ZB 4PZ8A 4ZO4A 3HYTA 2NZHA 2OCAA 5C0XG 1WP9A 4P72A 3CWZA 4GFDA 4RD0A 1XTRA 1A62A 1VQLA 1O78A 3CMAA 1Z2CA 2R6FA 4NYIQ
chains in the Genus database with same CATH superfamily
3GZNB 4NJEB 4FYKA 2AG0A 4L72A 3L6RA 5HQTA 1NVVR 3GRPA 1H2WA 3E9ZA 4MQLA 4KX5A 3S8EA 1JDPA 4K26A 1ZSVA 2VXOA 3AR5A 1VJGA 2H5XA 4JI1Q 3GJ6A 3CW9A 4RMNA 2IHZA 3MAGA 4MRNA 5KTYA 4DUGD 4DDMA 2Q2OA 3RU9A 2ZSKA 3RSOA 3EXFB 1FRNA 1IYZA 3MFQA 1AKUA 1Y1SA 4Q1BA 4KXWA 3Q0AA 4FHCA 4TTVA 3KR2A 3RWBA 3A9SA 1W88B 2B83A 3MGCA 4UY8C 4CMGA 2G63A 3NT4A 3EMDA 3DTVD 1RMTA 3MS4A 3JQAB 3DBLA 3FYHA 4YPVA 2D2EA 4P92A 2QJTA 2GN6A 2HCBA 4EF5A 3W04A 1RZUA 5HZMA 2TECE 4KMMA 1B73A 3HP3A 2H85A 1TU4A 2NNWB 5ESDA 2XQIA 1OBOA 2IBMA 3GT4A 2CY0A 2VSOA 4RMHA 2DB3A 3BICA 1K9VF 5DNFA 2XLBA 1LTBD 1S72A 1YCGA 1WUHS 1COWA 4XQEA 1VIMA 3B38A 5K3FA 4LDJA 2A19A 4V24A 1IYVA 1MFZA 1NE7A 3OMWA 3KJXA 2Q6LA 4JFAA 2IQIA 1BQEA 4FFWA 3SIPA 2YH2A 2ZXRA 3AM3A 2IITA 1XRLA 4JR2A 4C3HH 1HQRD 3SHLA 1MOPA 5DLQE 3DUZA 1H5NA 3AR8A 1ZXTA 5F78A 3UJPA 1NOIA 4RACA 4Q7MB 5CPFA 2Y0SB 2ZS9A 1XXHE 4A03A 3WMRA 1SNMA 3QVJA 2EY2A 1VMKA 1DQZA 3M34A 4B6EA 4C08A 2QP9X 3DDOA 2H57A 4O02B 1D5CA 4MKRA 2GBPA 2GRJA 2JKYA 3Q9SA 1JHMA 2HBYA 4BBZA 1TC1A 4OKNA 4Y0VA 3ABOB 3GL9A 1IMOA 2IYPA 4AL4A 4CM5A 2TS1A 1JG4A 2QTVB 2QYTA 3R9IA 5JNSA 1TWAB 4PZUA 3EOZA 1O7JA 2BH9A 2P3QA 3PDJA 3EAQA 1KEKA 2IL8A 4AF8A 3A8JE 2Y92A 1LPSA 3P0EA 2ZREA 4OA5A 5E6UA 1BXTA 1E6EA 2BGKA 3BTSA 1T0PA 5D7NA 3BWYA 2GPAA 4PNYA 5I7FA 2ZB2A 1AF7A 3RRNA 2Q4EA 5B55A 1SYEA 1CF9A 3A2NA 2MYNA 1P2BA 2C9ZA 2CLDX 4YROA 3KJNA 3LBFA 3PDUA 5EJ7A 5A5FA 1G0NA 4B7CA 2JLSA 4D9FA 1K6JA 2B4AA 1SFOH 3W5BA 4HSVA 1CS0A 1NLYA 5PNTA 3P9QA 1ULUA 4BLQA 1EK0A 1FW6A 4A23A 1A2BA 4JI8B 3LS2A 1RPJA 3TTVA 3ONDA 2WWIA 4BX9A 3C3JA 3CUYA 1RADA 3M8KA 4MWSA 5IBPA 3NYQA 1EP3B 1BIFA 5EPKA 1XBTA 4RSGA 2H65A 3KX2A 3AT1A 1MHWC 1AKEA 3NPMA 1P7WA 2JJ1A 2C1ZA 4J1QA 1F2TB 3R0ZA 4ZDKA 2ORVA 3OCVA 3NANA 2RG7A 2D59A 4RE6A 3SNKA 4RWEA 1XA3A 1GOTA 1K4YA 3EPRA 3T1YQ 2XZDA 4M1TA 1JRLA 4RFSA 2OGSA 1A3UA 4FYVA 4BLVA 5ISMA 4UHVA 2MO1A 2AG1A 1IJEA 1PTOC 4Q4HB 3IFDA 4HRXA 1C7QA 1YI8A 5JPNC 3WICA 3LHFA 4Y3UA 1TUIA 1VRVA 4HDMA 3ZG6A 3NTXA 2CXRA 2HXSA 3K0FA 4HQ0A 4RBNA 1EIHA 3TQFA 1SXJB 5EXXA 4ZPJA 2AOUA 3B7GA 2B1GA 3IOBA 2AZ4A 3CXRA 1Q0PA 3R4VA 1NRXA 3GLGB 1TLFA 2ZWVA 3BILA 2P8SA 2MSNA 4J3JA 1Q0LA 4OFWA 2H7YA 1ODCA 5IDWA 3ZXUB 4UTOA 4YJGB 4BVGA 4L4RA 2B30A 2JDID 5T57A 1JOOA 1Q6YA 1JDBB 4URZR 4X93A 5F3RA 4MQ5A 3R44A 3W0LB 2K2WA 2XUHA 3GR6A 5KOHA 1SUPA 3HVIA 3Q8XB 4TQ9A 2IS1A 1YKFA 2JI6A 5FF9A 5AW4A 3S81A 4DNFA 5IDYA 2PZLA 3K0CA 3MN1A 5A2QL 4FS3A 2RSLA 3HXKA 4HQFA 4KSBA 3UF0A 1TEXA 2HPAA 4KR7A 1LTAD 1LTKA 4JX8A 5KNBH 3RSSA 1DZ1A 1YBVA 2YV1A 2P65A 1BGWA 3HZOA 1RI4A 1GTJ1 4MKFA 3PZRA 3D8GA 1TAQA 5KYGA 2PMWB 2C82A 4CL0A 4ZCIA 2AMLA 3ERQA 5K36H 5JDCA 1OX5A 2QUKA 4LXHA 2CW0C 5HDBB 3EGEA 1XTKA 4LF9L 3ITNA 1L7XA 2P9YA 1ENYA 1GUGA 4BATA 4D9IA 1Y1KE 2IDMA 4X3TA 1M6VA 3K1YA 4M0LA 5K6AC 2BEWB 2QN6A 2A6PA 5DM0A 1QX4A 3LXRA 2D8MA 2VG8A 1E1YA 1PFBA 2LR0A 2AYZA 2DBYA 5H81A 2AE2A 3Q0EA 2G9VA 5IK2A 4PYOA 3HJNA 4ZALA 4PPQA 2JAUA 3EXIB 3MJVA 2W98A 1WXHA 2R48A 4JN6B 5FTWA 2FFKB 1WCYA 2OPHA 4P0PB 3MWGA 4Z4EA 2I0QA 4GVXA 1DB3A 2WSIA 4EY8A 4OYRA 3KKEA 2B3DA 3EQ2A 1DBPA 1KAQA 5IVKA 4DR4L 4HEA1 4TRDA 3OTGA 3LP5A 1G17A 1H22A 3NTUA 4K6GA 3TJRA 4Q66C 2Z2XA 3ZNOA 1ZD8A 3CG4A 4HXEB 1JMCA 5ALFA 5A7HA 3REOA 1PTOB 3IALA 3ORSA 3JAWA 4JP8A 2HIXA 1B4OA 4DLUA 4DV4L 3IBFA 4NS4A 3AUSA 1WMSA 1UOPA 1VRWA 1OZFA 3BZWA 2PTHA 2ZUDA 5C0XH 1S6YA 1UXOA 3DM5A 3AUTA 1SK9A 3NTVA 2EJWA 1I2ZA 2A78A 2D2FA 3ZIAA 3PQ5A 3OVMA 1T3TA 3IJPA 2MFIA 4R0VA 5JS7A 4CCWA 1PF7E 1TZJA 4GF5A 4K9SA 4I0WB 1AJEA 2ZZMA 5JYDA 2GEJA 3MHTA 1F17A 3D5QA 3NOVA 4XQGA 3X2FA 1RRGA 3O74A 1V3UA 5AD1A 4IIUA 4H1HA 5HMMA 3B1VA 2WFWA 2ALJA 3BSSA 5EMJA 5IVDA 1ZA2A 4URUR 4ZGWA 4OQNA 3VU9B 4RNCA 1T4MA 4MMYB 4XASA 1J6UA 2VQEB 3D6UA 1RYYA 4GX5A 4IH4A 3UGQA 3LIPA 4LV8B 1G3IA 1DRVA 1U9ZA 1NU6A 2PWPA 4RFLA 4Q18A 2ZSEA 4LJ7A 1Y3HA 1YMUA 2KEDA 1UDCA 3QE9Y 2BP7B 4LF4B 2IC5A 4EHKA 1R27A 5LDGA 3FCEA 3LOQA 1JLMA 5FULA 1TM7E 4JI5L 2C7RA 2BELA 1C5KA 4Z9CB 2YXLA 4YXWD 3A4VA 4XQ9A 3LGSA 1CJTC 1S0UA 3CPJB 1IJFA 1TZKA 2ASBA 1GG2A 1ZU5A 4HQ6A 1K1EA 2FWJA 4RVUA 4KN9S 2WYOA 1FJGB 1HHVA 1APBA 5AO9A 2YWHA 4C0KA 9MHTA 5IT9L 1GQYA 2VK1A 1BZYA 2NN6G 5KWEA 5ELXA 3TLEA 4UPAA 2I8AA 4G0YA 1TQ4A 1TR5A 2V1UA 1RWVA 5JNWA 3PQ8A 4Y6QA 4X95A 4HDSA 1Y3BE 4QUBA 4P0TA 4Z7QB 5JRJA 4A1OA 4FBGA 2VJDA 1NGSA 4EEZA 2E0IA 3S2IA 4DREA 2Z2KA 4RTNA 4Z8XA 3FVTA 5B3KA 3KYJB 2MINA 3QVSA 4GPD1 4ZAXA 4ZHQA 2DLCX 4JA2A 1UJ6A 1NXWA 2VDWA 2ZYGA 2HGSA 4JSTA 1LDYA 1T8UA 1OLUA 2ZRHA 3T1HL 4LW8A 1L4YA 2DHEA 2O2ZA 2PA0A 5H7XA 5SY6A 3IGFA 1MAAA 1JLLA 3ADCA 1YA4A 3LYLA 4M76B 1LK7A 1BCSB 2F55A 2XB8A 3J80A 4INAA 3V7FA 5DF1A 1F4LA 5EMMA 4CM9D 3AEUA 1PJ3A 1LLRD 5D3MA 3HFSA 2IX9A 1WIWA 3HSYA 2GZAA 5IY0A 3H4TA 1AMNA 2R86A 4JJIA 3RM3A 4D79A 5CFNA 4O5OA 2W6OA 4FQ8A 5HIIA 4LJSA 3LX5A 3NHBA 1HRDA 2HBZA 1WMAA 4OSOA 1E9VA 4XPZA 4AJ4A 2JHGA 5KTNA 3OPVA 1RJTA 3CCMA 3LL7A 2Z9CA 5KNLA 1KZ1A 3MCZA 2ZE8A 5FA8A 1F8FA 5BOSB 2BM1A 1STHA 3V4OA 1UZAA 1VTKA 3HOVB 2JA5H 2WAOA 4WERA 3PNVA 3ZY3A 2XRMA 1D2RA 1C29B 1HZAA 4WBNB 4NBWA 1M2OB 3DHQA 4FFBA 3SOZA 1QP0A 1Y6JA 4QBGB 5TEWA 1ENAA 2EYMA 3D5EA 1QH8A 3A10A 2ARKA 3Q8LA 4TS3A 3BVMA 4ID9A 1PSWA 3KF8A 4JUIA 3U60B 5G41A 3NORA 2GLTA 2EW2A 5C0OE 4MMXB 2IVFA 4FKMA 5EVJA 2VZ9A 1VLQA 2TMGA 1T5SA 1B6TA 1OQAA 3KLBA 1CQFA 3X1DA 4DK6C 2ZTCA 2O3QA 3LK6A 2KHIA 3AJRA 1CRPA 2QZ9A 4K8RB 3NUGA 4JELA 1U6IA 3ZHZA 2YZMA 4RORA 2ZSBA 2ZBFA 3JYLA 4EFMA 4YACA 1K7EB 3EGIA 3CVUA 5KQMA 2WHRA 4MUBA 5JSYA 3PJDA 1UBRS 3U4IA 1Z0DA 2FMXA 1RBMA 2EY1A 4OB6A 1YITA 4Q4JA 4KQ2A 2PYDA 4NFHA 1P8JA 5BSWA 2QJOA 4X3CA 2QAIA 2PL3A 3WO1A 2WKDA 3B53X 3TP7A 1NKTA 1PT9A 4XVRA 3G8AA 1T6XA 5PGMA 4JLWA 2G04A 2F1KA 1WSDA 2X5XA 1NMGA 1KMNA 1GPYA 5HKAA 1NI4B 3A0UA 2NU9B 5C3EB 2Q5FA 5B6IA 1QFSA 3WGNA 3O47A 1FRQA 2P5UA 4MR9A 1PJLA 1E2LA 3IQDB 4KIFA 4MTKA 1IKLA 1XNQQ 3DWGA 1HT2E 4MDEA 5E7JA 4YV0A 4IHAA 2QU8A 4EKGA 1O5IA 2G9NA 1SHLA 4PQXA 1QYXA 5TT0A 1F8UA 1EZ1A 1DWUA 5I4IA 1AF4A 4UAGA 5BSUA 3UCFA 4GX1A 1LRLA 1J2JA 4CN8A 4BMZA 1E5LA 3P9ZA 1IL2A 1Z6AA 4IGIA 2XMSA 3BTVA 2IZOA 2XB6A 3UJCA 4CEIB 2ZWAA 3RT9A 1ORIA 4J76A 2IF2A 4Q7EA 3F2UA 5L53A 3KXIA 4TYYA 2FR8C 5LUBA 3BWMA 5IRCD 5J2UF 4E5VA 3NYRA 1A98A 1F9EA 2GOYA 1JHYA 2YJGA 3EFOB 1U7ZA 4R83A 3AF4A 5KYUA 2ZIFA 3OOYA 3DOUA 5I7WA 3TZ6A 3ZTYA 3BD6A 4MVJP 2Q27A 1IM5A 2VQ3A 1T5OA 2FMHA 2AZTA 3QLVA 4PZLA 1HYQA 1EIYB 4EZEA 4ZT5A 2GEVA 4GG1A 5C53B 1K7SN 2SKCA 4OGLA 4B3RB 1TQDA 2JI9A 4CMEA 3U80A 1JR0D 2V4DA 5EKTA 5AW2A 5DM73 4V3BA 3UQZA 1R00A 1QFYA 2GAFA 2VVTA 4HADA 4Q3OA 3FOWA 5BWNA 4GC5A 1PI3A 2EXDA 2E4VA 5LD2C 2BHSA 1X32A 2CKDA 4DZTA 4KI7A 5DULA 3AUAA 2O8DA 5B4VA 1JSZA 1U2EA 3SFVA 1I6WA 2QNBA 3RYTC 3WL7A 1C7RA 3I3SR 1NXVA 5K99A 3NC4A 5BN5A 2VJQA 4L5RC 2EFEB 4DLLA 4ZWNA 2R7ZG 3TFQA 2HX1A 3LWNA 5GJBA 4B3SB 2KA7A 2IPOA 2WICA 3H19A 3ZH2A 2CQOA 2RGBA 4O1IA 1HK7A 4DAYA 3CVXA 3TUJC 2ZDGA 2GZSA 3K70D 4MUGA 1EFID 1CV2A 2MIIA 5LYJF 4BNDA 4JLBA 3RBVA 3QF4B 2ZJ6A 3UH0A 5LA6A 3AEZA 3C3WA 4ZI7A 1FFYA 2HT6A 2X2OA 3S9WA 2WJYA 5BN3A 1IDN1 1Q1ZA 3AC0A 3WA7A 1TDJA 4U7WA 2F0DA 4X3SA 3V7WA 3PDIA 3WHIA 5LDHA 2RHDA 1CHQD 4GMXA 4AUKA 2QSJA 2HDWA 3ZGOA 4ENVA 1U0GA 5KYLA 2B61A 1PUXA 3PTZA 3E9NA 2GVZC 5BNIA 3G82C 1BUVT 4NDXA 4AIRA 3PHCA 1QCBD 2V6JA 1L7MA 4AP6A 5L4NA 4DKJA 1H6DA 3H9CA 4P08A 4X64B 3CZMA 1T9ZA 1YQTA 4DCTA 2I7DA 1Q7EA 2GYUA 1DBSA 3OOSA 1ULHA 2GF0A 1YFLA 1XMSA 4G84A 3N2KA 5IP7G 2JGFA 3G9UA 4OBBA 3R3ZA 2UUBL 1J20A 2EJUA 4KN4C 1TD9A 3RB8A 1U7TA 1GA1A 3KQPA 3EDCA 3ICVA 2VDOB 3GFTA 5C4GB 4C3IG 1OIXA 2H3HA 2NZWA 2HDOA 4ZEOA 2IPXA 1V9PA 1H1LB 3TD6A 5ELMA 4YRZA 4DR2L 1TJ3A 5JAVA 3ZI4A 2VPZA 2WAYA 4W7IA 3K6SB 2BE5D 4RZSA 1JHAA 4JBWA 2B8GA 1EFTA 3HRZC 4PC1A 2CB9A 1UBFA 1PFUA 1IXYA 1RPAA 2VJPA 2JEZA 4PPYA 3QIAA 2C35B 2WNIA 2B7BA 4RL4A 4H3HB 1MQAA 5F7OA 3WNDA 1BXZA 2EYLA 1SBYA 4RGNA 2PVCA 3PXBA 3HEMA 1ZX1A 5KHLB 4PMBA 2Q4RA 3OO1A 2XYRA 5H9WA 1V45E 2W6IA 3U09A 1P2UA 1HR0W 3A4MA 4XYGA 1Y8QA 3G68A 2B20A 2BEKA 4BFUA 4E22A 4HDKA 2VUTA 3QEOA 4Q82A 3TD9A 5JEEA 4YCNA 4Y6LA 3OLYA 1JVNA 2NUTA 1W6JA 2I6FA 1SVWA 4C43A 4UD2A 1VKNA 1ISFA 3H7AA 1IZ8A 3BXZA 5LD2B 4LZAA 4K8OA 5JBIA 1HSZA 3KUDA 3LDHA 4H1UA 1SYGA 3F5MA 1WHTB 4D26A 4N8EA 4XGIA 2W42A 4C3JG 3AQQA 3JWJA 4LNUB 3VMFA 2KHJA 5I6YA 1RNLA 3ZWVA 3WDMA 5LHY1 1X3QA 1PZKD 2F00A 4FW9A 4HAVA 3GLFE 3G2HA 1CZRA 5KQPA 1FFAA 1CUBA 5DNWA 5JVG3 1E79D 4IUQA 2R6FA 5BY2A 2EKDA 1A5TA 3K5NA 4RJ2A 5DW3A 2OBMA 5AI6A 3MIZA 4FLEA 4G5OA 4KN7C 3I4MH 3ZH9B 2OK8A 1TU2B 2R92H 2E2HB 3SSOA 4DV5B 2BI8A 2KECA 3IAXA 2VHEA 1K28A 4YREA 1U28A 1WXWA 1WOYA 4WUTA 1E1QD 4CL3A 4RJKA 5G0SA 5AW8A 2GRAA 3MBOA 4WCFC 4Q93A 3OJXA 2FV8A 3IO5A 3SKYA 3FNEA 1X42A 4ZQGA 3GLHB 1O5TA 5AI9A 1UJ2A 3ENKA 1IAVA 1F1BA 2EATA 1WCMB 1P7ZA 2H4HA 2VL7A 5ANRB 1XCGB 5JSUA 4QTZA 2QW1A 1JMKC 3Q15C 4MPPA 5CJ2A 1JG6A 1E9AA 4JSRA 3HPRA 3AOEA 2WIGA 3I2ZA 2ZBEA 1FNCA 1L5GB 1K8AC 1QRUA 5I7SA 3HOZB 2YOHA 3SZGA 4IUUA 1Z0AA 3QE0A 3ZR4B 1K83H 1KS9A 3KT3A 5CIQA 1U0LA 2RBEA 4MIKA 4TXMA 3R6GA 3WZMA 4AMBA 4JK3A 3E9EA 2JEAI 2HZBA 3WRXC 3OTOB 2KLBA 5CXUA 3DV9A 2PNFA 4CF7A 3CFYA 1FZTA 4HH0A 2YRFA 1GG8A 4YJHB 3BZBA 3B82A 2OO7A 4FUQA 1CA6A 4IJVA 1B15A 2D5AA 3O95A 2E6KA 4X71A 3QOXA 3KBGA 5FO0A 2C99A 5DX8A 3CNBA 5ENZA 3UBTA 3MXOA 3FSGA 1WB6A 1YD7A 3CKKA 1XRPA 2I67A 3PQDA 3DB1A 4GDMA 2YWDA 4C7XA 2PGAA 2MNAA 4OM7A 4A9AA 1ESZA 4KIJA 5IAAA 2YCBA 3WFJA 2HQSA 2PEZA 4MRSA 2MSEB 4CDMA 5T4FA 2PCJA 3DYVA 1NW8A 3OTWA 1JEYA 1MJCA 1UEAB 1HURA 5IGCA 1XDUA 3LLUA 5AJVB 2AQHA 3MOSA 3WNCA 5LQSA 1LA2A 5LP6A 1XDSA 3COJA 2VJMA 4LMBA 1UWCA 3IQFA 4LHEA 3TSSA 2ZJOA 3CNNA 3STYA 1S3FA 4FYHA 4A93B 2JBWA 1A9PA 4MGIR 3CRMA 3RZDH 5DEHA 5TPZD 1MVLA 4EI9A 5IU6A 2J1LA 4P4GA 4PYMA 3W3AA 4EG3A 4RY9A 4BFYA 4BO6A 2R1TA 1ENCA 4H1VA 4QXRA 1CXZA 1HLGA 1J70A 4NYJR 1NDUA 2NTVA 4EYEA 1EP1B 4ZV7A 4KCGA 2RJOA 2BT4A 1PWHA 1YU9A 4GMKA 1RE0A 4LQLA 5AK5A 4YWJA 4ICIA 3KUCA 3D3JA 1EMDA 4A82A 4A1FA 2I5PO 5IUJC 5FX2A 5ALVA 1NR5A 4E3ZA 4D3XA 2PT7A 3T3DA 1YDWA 4IV5A 4HQOA 4A3KH 3C39A 1OXKB 5JVH3 1OXXK 3G2NA 2HJWA 3L7YA 4OQMA 5JW6A 3DHNA 5A5VA 2PQEA 3M3PA 3FUXA 1CR1A 5M3MH