2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
3EQLC 1LF0A 4LRWA 1COWD 4RVCA 2HIVA 4I1SA 3ND8A 1AN0A 2KCCA 1TWAH 1CLUA 3DMNA 3HJNA 2OE2A 5EE9A 1W5TA 3GP8A 1KDPA 2I1QA 4MH0R 2JA7H 1XJCA 3LRPA 4QBFA 4QJ5A 3KTAA 1M6NA 2VUMG 4QFMA 2A9KA 1D2MA 2ZRGA 1OIWA 1T91A 1OKKD 4JKYA 3UMRA 2JJ8A 4GI7A 2E2IH 3OIVA 3EAQA 1YZQA 4LC1A 4LOAA 4JL8A 4B43A 1S9HA 2V55B 3AVQA 3FE2A 3ETLA 1IM2A 1S1MA 3KTAB 1P2VA 4QQBX 1UBCA 3CB4A 1IN4A 1CBUA 1GJXA 4D82A 3CPWA 1E2HA 4XOIA 4LFCL 2JEBI 1SMYC 3MG9A 1Q1QA 5C4MA 2P5SA 1AZTA 1XEXB 3IHWA 3Q5DA 2GAOA 1NRJB 4OWTB 3K8AA 1MRSA 2FEOA 3PXGA 2B7CA 3U3JA 4DCSA 5KPDA 5F9FA 3NDPA 1ZINA 3ZVNA 1WYDA 3S1NH 1QG2A 4GNXA 4JI1Q 1ESNA 1H8ED 4TMTA 1Q21A 1H95A 2ODWA 2HF8A 1FNMA 2VLIA 3QVVA 4YONB 4IO9A 1XNRQ 4YMTA 1J2JA 1RJ9B 3KX2A 3QF4A 4PANA 2J7PD 1D5CA 4RFVA 4HAWA 1FX0B 4TYNA 3K0CC 5CK5A 2V1XA 3KYHC 5CM9C 4H02A 2I3BA 3KLRA 5L3SA 5GAHC 2PL3A 8OHMA 1E24A 2BIFA 3B1WA 2ID0A 4ZDWA 2VQEL 2R62A 2GEUA 2DYKA 1S40A 3W3AA 1SRUA 4TQ9A 5LDDC 4AH6A 4NCIA 1E9RA 1RYHA 3PUXA 2XZPA 1XEFA 2NMVA 2XB4A 1F5NA 4IKEA 4MRPA 1RRGA 3OPOA 1DADA 5M3FG 3K81C 1S0UA 1QHSA 2KA7A 1SXJA 1W44A 4Q1AA 2K50A 1V8QA 1PUJA 3SOPA 1YITA 1YJWA 3A7AB 2OBMA 4R4IA 3U6KA 1ASZA 1NG1A 2NTYC 2R9VA 3LW7A 5E4FA 1E9FA 3D4RA 3CR8A 1WFQA 2YU9H 4A6XA 1OXXK 4A76A 2KE5A 1QZGA 4XH9B 1KSHA 3WYFA 4DDWA 2ZANA 4C0BA 2PNHA 1WXQA 1S3OA 1CJVC 1P2SA 1J70A 3RNUA 2JA8G 4HIDA 4Q48A 5CIQA 4DCVA 2H5XA 1G3UA 4X8OA 1IL2A 3LGJA 3T1OA 4B3BA 4A2QA 1TWCH 3WXMA 2OTJA 2FGKA 3REGA 4D0NA 4UXHA 5C2JB 1EFTA 1SKYE 2D0OA 5C44G 2JLRA 4BA1I 4QG7A 1CIPA 4B3ML 4OWXB 1N6IA 2FNAA 3I8XA 5B2ZA 4F91B 1CKOA 2FJUA 1RW4A 2F1JA 2QGNA 1ESMA 5C4XG 2N42A 2VP2A 1NMYA 3OE7D 1Q3HA 5TXGA 1E2KA 1MO5A 1MO4A 4YCVA 3HOUH 4GT1A 1VG8A 2ZS7A 1H8HA 1KD1C 1AQYA 1OHHA 4QJ4A 4A92A 2GNOA 5FH9A 3UDIA 1KRSA 3AF2A 3C7KA 4C3ZA 2FSGA 2W6JA 2DBYA 4PPGA 3VR2A 4G7OC 2D2EA 2FG5A 1E2MA 2YOHA 4IDQA 4KI0A 1VPLA 5LMUL 4JSYA 5FUVA 1E2IA 3B5JA 4IFEA 4M9SA 5L8VA 1JI0A 3RRMA 4WZBE 1AGPA 2BMDA 3C41J 1HNXL 1SKQA 4GZYC 3I3SR 3DOFA 3CRKC 1KK1A 2GHIA 4GNKA 2WSMA 4OK6A 5P21A 3PIPA 2A5YB 4KJZA 1DBSA 3SJAA 1YKSA 1YZLA 3GJ6A 1TWHH 3A7LA 1SZPA 1E79D 2LXJA 1KJWA 2JXMB 4WJ3M 1GKYA 2ZI7A 4OI1A 4TL9A 4WXRA 1YZNA 4H44C 1II8A 3FPAA 1E0JA 2DY1A 1X9NA 3AKDA 4N0DA 4Q9IA 3ND9A 2VIIA 1KHTA 1GDDA 1PLJA 2J41A 1EOVA 3GTJH 5AUNB 1VQGA 1O87A 4D4JA 3U61B 4LF8Q 3I55A 4UNPA 2PLRA 2JLZA 3J81j 1FR3A 3GEIA 3B82A 3REFA 2BM1A 421PA 5CDFE 1UE1A 1CUKA 1IBRA 3CMEA 3PEVA 5CYPA 3ZVLA 4APVA 2X1VA 3LWNA 3DVLA 4AG6A 1X1RA 2PMDA 3IEVA 4Q4LA 1GUAA 2KCTA 1XPUA 2BV3A 3K1JA 3KF6A 4QL5A 2OZEA 4P31A 4U7DA 3BD9A 2V4DA 3CF0A 2QP9X 2JIZA 2ZR7A 3IGFA 3R9WA 1OB2A 5JEAJ 2QM8A 2FPMA 1PHJA 1W47A 4QJ3A 3A5UA 1DTSA 1OFUX 1US8B 4WBSA 4WZAE 3A8TA 4WA7A 5K8LA 4DHEA 2CJWA 1DS6A 3CQZH 4W5JA 2QROA 3S2DH 3RRZA 3U4ZA 4GMDA 2Z4RA 1HZCA 1A62A 3K7AH 1YU9A 4AYBE 4RCZA 3UWOA 3HKZE 3S1AB 3SYLA 4QM7A 2DNEA 4GN3B 3BB1A 2IT1A 3LXRA 4UY8C 4DR6Q 4Q19A 4HJ7A 3BXZA 3KFVA 4HJ9A 4A15A 3LDAA 1VQ6A 1S9DA 5A5GA 1WCMG 3QG5A 2F1MA 1CKNA 2D62A 3D31A 4KMUC 2A5DA 3MUFA 3T61A 5EJEA 5KDOA 1QHYA 4FWIB 3I4OA 1D8LA 2WOJA 1JAIA 2WWWA 2JLYA 4LHYA 1H9SA 1CTMA 4GLAC 2IXEA 4BY1G 2NIPA 1RVDA 3EBEA 1VQJA 1VTKA 4LX0A 3DXJC 1Z6TA 1HT1E 4PZZA 4GBMA 1K0RA 1Q3TA 3OYYA 3H0GG 3N2EA 4TYPA 4XD7D 4TYWA 4IDPA 4NMMA 3BK7A 4EFMA 3N70A 1FW6A 2B8GA 2AD1A 4TT3A 1HYQA 5DLQC 4RCNA 4KU4A 5AJVB 1QJOA 4LBZA 3ZYCA 2W6IA 4JOIA 3AF3A 2WKQA 5J47A 4BWYA 3SR0A 1E9EA 2ATWA 4IXNA 1N0UA 1I94Q 2XOKD 4LFBQ 4LJAA 2E5LQ 3I2ZA 3CRLC 1U0LA 1E9AA 2GXQA 2OCBA 3FFBA 4M22A 1ZKOA 3H4MA 1NJFA 3CCMA 4JI1L 1IOZA 3ZJYA 3AVPA 4WW0A 4JSTA 1BYIA 2C9CA 1CFMA 4LF4Q 1ZYRC 2JAQA 5FUWA 3VQTA 4DZZA 2YWGA 4PO8A 5FTMA 5FOTA 4DLSA 5H8WA 4BUJA 1NNEA 1N5IA 3A1WA 4BLRA 1MJCA 1KI8A 3CC4A 1KSJA 2ZUBA 4ARZA 5KO2A 3VHXA 2VSFA 4IJMA 1B9NA 3G48A 3DPUA 2YC4C 5EE3A 4DEXA 4JJKA 3WP1B 1WB9A 1C9KA 5C4GB 3TVDA 1GD7A 1N6NA 2Q8IB 2J7PA 1P9NA 4NCNA 2K5VA 4GKKQ 3FKSD 3KXIA 3K70C 4DV0Q 5CJPA 5LBIA 4BPBA 2ZRLA 3Q7PA 1HEIA 4TMWA 1OYWA 4NYMR 2E87A 1MRNA 2QMHA 4C0AC 1GL9B 5JI3E 1E2VA 1NP6A 3GEHA 2EJFC 3CMAA 3E5HA 4AD8A 4AKHA 3NVAA 3DLLA 2J7KA 4AQYL 5AJZA 4AYWA 2K7VA 4L5SA 1UBEA 1UDXA 1Z6YA 4GS3A 4M4SA 3MRSA 2OBNA 1BKDR 3Q72A 3CF6R 1N6PA 2WSSD 3J81c 3S1RH 2JJ2D 2O52A 1Z0JA 2D06A 2E9SA 3H86A 3LX8A 1J8MF 3LVRE 2ZTSA 4FXPA 4LBVA 4PZLA 4DSUA 3J7ZC 2QP3A 2H92A 3GEEA 4KFRA 5J40A 4BZXA 3D6TB 2LWIA 3K80C 3G82C 3OTOL 2DFLA 4LV6A 5JWHA 1Z6XA 4ZO4A 2XITA 4IDNA 2J5XA 3FDIA 4TTRA 5HPYB 3H3VH 2UKDA 3QXSA 4R4CA 1SVKA 2FH5B 4X8MA 4BY7G 3CO5A 4B74A 1G6PA 3W8NA 4QC2A 4B3FX 2G88A 2EIFA 2NVQH 1M7GA 2G77B 4XVRA 4Q1CA 3VU9B 2ZJQA 1U8AA 3NBXX 2E74C 1TKWB 1ZUIA 2D2FA 5B30A 2ZJYA 4G5SA 2OEPA 1PVOA 5HE8A 2NN6I 1H9KA 5IP7G 1X3SA 3B2EA 3SDZA 2AWOA 1Y1WG 1NI3A 1XBTA 1W4AA 2RHDA 3GD7A 4LF5L 1R7RA 5TVKA 1ZD8A 3GLGA 5JLJA 1T8UA 5EAYA 1TF7A 1KGDA 2EU8A 2IYXA 2HEIA 2UVQA 3ZGXA 2D7DA 1CJMA 3S15H 3W5JA 2X8AA 2G0NA 1NY5A 1N34L 3NDBB 2HV8A 1CI3M 2WJJA 2WPDA 3ZS8A 1I5FA 1GUNA 1NL3A 3CZPA 3WMEA 721PA 2FMXA 3I62A 1DVRA 1N36L 4B3GA 2QTFA 1VF5C 1M74A 2ZRCA 3SYKA 4PV1C 2BM0A 4QBGB 5EQTA 1JB7A 4BBSG 1NN1A 1IBMQ 1X8KA 2C99A 1MIUA 4V03A 2E2HH 3ZZTA 1SHKA 1KSFX 1VG9B 3F2CA 1KZ7B 2XJ4A 1CR4A 3FPPA 1CR2A 1E1QA 3CH4B 2W83A 4JBWA 1J6QA 3J7A5 1AA9A 4R98A 1SMXA 4MA4A 4LF7L 1QZHA 2X77A 2JJQA 1E79A 5KYKA 1G5PA 4JMPA 1YR6A 2QRNA 1UE5A 3CIOA 2OILA 4HAZA 4CF7A 3CC7A 4CEHB 3TJZA 1NJIC 3EPLA 1WOCA 4GLXA 4KCGA 3S1MH 2REBA 4K8OA 2H57A 4PHHA 2QAGB 3RS0A 5GAGC 4BXXG 4J15A 3IQWA 2EFGA 3F2BA 5J5CA 4YMWA 3UDXA 2NO0A 2W00A 3J80c 4YDSA 3RZDH 2WMOB 1KOFA 3I8SA 1RC8A 2ZAMA 2ZJ5A 2OG2A 1R0WA 4FMBB 4DAMA 221PA 2IHEA 3CCRA 1I2MA 4C9BA 5FJ8H 2O8FB 1FUUA 2OV2A 2V7QA 3S16H 1NF3A 4HZUA 4RJLA 3NH9A 4I1UA 3RSLA 4TQUS 2J3EA 2G9NA 4P73A 2XGJA 4A8JB 2R6CA 1M7HA 1QF9A 3AB9A 4IVRA 4YMSA 1XZPA 1OFHA 3EZ7A 1RZ3A 1G18A 3K09C 3U9SA 1FMLA 2A68C 3K0AA 4HI0E 4OYHA 1KO1A 4LGMA 5HCNA 1Q82C 2PH1A 4ACAA 1NLZA 5FPSA 1T5EA 1IBKQ 1J7KA 1W1WA 2GVZC 3HR8A 4RSGA 1ZD1A 1VCIA 2ZE8A 3FMCA 3CXCA 1II0A 2JA5G 3QUSA 4QXAA 5HKKD 1E3MA 2L0XA 3BWDD 2QF7A 4Q4JA 4LC0A 1IBKL 4KV9A 2WFWA 3VX3A 4L5TA 2W0MA 3IPYA 1Z2CA 1VIAA 2CCGA 1HR0L 4DRZA 2ZJPA 2QAGC 4TSFA 2JJ1D 1VG1A 4GZMA 3A6PC 2N1BA 3GLFA 3WP0A 1DAKA 1GTVA 5HTKA 3AF4A 2PZFA 1OKKA 5IP7H 2PCLA 2E8GA 3GTQH 2N78A 4A93H 1KO7A 2Q3MA 2IX0A 4IPHA 2C98A 5FBWB 1WMSA 2B3GA 1Z29A 2A1AA 3QKRA 5TMPA 1P73A 5BXQC 2F6RA 3U4QA 3CONA 2CDNA 5FI0B 3L7ZC 5J3BA 2Z5FA 1SQ5A 5LPNA 4DB4A 2BBSA 3KKOA 3BORA 4LHZA 3N5CA 1W4BA 4Q4HB 5KUTA 1VQKA 1T3HA 3RLNA 2I5MX 2D0PA 1G16A 4G7ZC 1GG2A 1NVWQ 1X6OA 1VQ9A 1TEXA 3ONWA 4A82A 1QHXA 4RD3A 2CWAA 1XZQA 5IK2D 3KB2A 3GO5A 1G19A 1XEWX 2QA4A 1TQ6A 2B8FA 2VPPA 1TNDA 2CQOA 1AH9A 4IVPA 4Q1BA 1W49A 2EXDA 3CCQA 4IOAA 1DAEA 2HUPA 3N6RA 5CJ2A 5D3MA 3FHTA 5KSPA 3ZIAD 1XMSA 1NBMA 3ASZA 5B64A 2A2ZA 2N49A 2FOLA 4IDOA 2XJ9A 3A4MA 2J0QA 1T5IA 4P74A 4TLDA 1IN5A 4Z8YA 2XXAA 5FFMA 1JXMA 4EDHA 1QBKC 2LMCB 4NXML 2YKGA 5JCPA 4BRUA 4DDUA 1JJGA 2WWHA 2R7ZH 3PO2H 4LI0A 3AEVA 1L1OB 5FUYA 5FOXA 4HAYA 1ZIOA 2JIZD 4BXXH 4U02A 4GSYA 4Q00A 4B3XA 3GLGE 3Q3JB 1TQ4A 4V0NA 2NVXH 3FYHA 4OHWA 4GP6A 3U3MA 2QEQA 3H0KA 3PUWA 3CW2A 3VNVA 2GF9A 2Z6KC 1F2UB 1IN8A 1E2JA 2JASA 3F3YA 3I4MG 4LPSA 4KXFB 3R7WB 1PH8A 3OFND 4CGZA 1EWQA 4AKGA 1T0HB 3VFDA 3CPHA 4LF9L 2ATXA 4GLVB 1YIJA 4C0LA 2WJYA 3GFPA 4DR5Q 2CVHA 2WV9A 1I4LD 1A6XA 4NPSA 4DV2Q 1U8ZA 2GVBA 1FNNA 3TNFA 4KKTA 4Z1MD 1JQLB 1NKSA 4HAVA 4MTNA 2RHMA 3TEHB 3IIKA 5IYDG 1OIVA 4Z1MA 1CSPA 4LFAQ 2K5HA 1IY1A 2QY9A 2J46A 4FN5A 3FMPB 3MWJA 1U0JA 4TMXA 1FPMA 3E1SA 3PVSA 1GKIA 3L2OB 3T35A 2B7BA 1W0KA 3F1ZA 4EQ6B 4TTPA 5EP4A 3UXMA 4ESHA 4P3YA 4DUZQ 3M4OH 4IFDI 4LV5B 1EFUA 3W1BA 2DN8A 1I94L 2JA9A 2BHRA 2IXGA 4ASUA 5J4LA 2XTZA 3E0EA 2KJQA 2KSQA 3A74A 2PQAB 4HZUB 4WZ6A 3VR6A 2BH2A 2XAUA 4D26A 3EIVA 3NENA 1QHNA 2OUKA 4BLOA 3X1YA 4W5WA 3OIUA 1IYVA 2NZHA 4Q66C 3ADCA 2QG6A 3TW8B 3GTMH 2G0TA 2XOKA 5TDHA 1N2CE 1EWIA 1QHIA 2DWOA 2JLQA 2OBLA 4RZUA 3AV0B 1K8OA 2IY5B 3C15C 1K73C 3ADKA 1E96A 5L3RA 4R4QA 1JBKA 3F0TA 5C0XI 3AFQA 1U2RA 4ZKDA 1VECA 3DDCA 4MUBA 4OK5A 5L3VA 1OYYA 4Q03A 4A3EG 4NP6A 2ZRPA 4ILEA 4PR0A 2JLVA 4DR1L 4JT2A 1ONLA 2OTLA 3HOYG 5CYOA 5DIFA 3AVXA 1VCMA 1G4UR 2C77A 2ZEJA 1DAIA 1P72A 4DV3Q 4FMCF 1DPFA 5DI3A 2A69D 4X62Q 1J5EQ 2DCUA 1O3YA 3IIJA 3RLFA 3RN2A 2YNMA 5SZHB 2JLXA 5AK0A 2PX0A 1IXRC 4A0GA 2V1UA 1PH4A 1TMKA 4KVAA 1JJCB 1AKEA 3RC3A 1ZRHA 2WWIA 4DV0L 1IONA 5J4KA 3MSXA 3GTLH 1ZU4A 3UWKA 2GILA 2Q2HA 3HYTA 3DZ8A 1ZP6A 2J0UA 4DR7L 4UJ3A 2RB4A 2ZYTX 3RS5A 5GQOA 4A3MH 2FSIA 1FTNA 4A3GG 2DWPA 2GZHA 4LDJA 4UXIA 4DCNA 4NYJR 3HOZG 1NN3A 1B7YB 1RJ9A 5EXXA 3T15A 4KLKA 4Q7JB 5C46F 3G6EA 4QJFA 3HOZH 1VF7A 4URWR 4CEHA 2EFDB 4CEJB 4LWCA 4A3MG 2BH8A 4A3IH 3L2PA 3OIYA 3QBTA 4C3IH 4YMVA 2F52A 5DYGA 1ZC3A 2OCYC 4FD2A 2HXSA 1WBDA 2F1RA 3M4YA 4H13C 4LHWA 4WAUA 4W9MC 2H18A 4HYYA 3BS4A 4A4DA 3UKDA 4ZI2A 3NWJA 4UQOA 3PUVA 2PT7A 1ZM2A 4JVSB 4JVMA 4DR2Q 1XD9A 2EWVA 4J0QA 3CCEA 2HXYA 2CHVA 2E2JH 3KXLA 4MQBA 3HKSA 3U3KA 4I4LA 4XWKA 2CNWD 2FZLA 2ZM5A 1VQ5A 4IW3B 5EZ5A 5C18A 3K0FB 1XB2A 1VDZA 1H9JA 3MD0A 4HB3A 4M0LA 4BEBA 1R8SA 2NZJA 4DV6L 4QBIA 4A3CH 2FSFA 3EPKA 1W36D 1Y1VH 3NHBA 2XTIA 4JLMA 1VQLA 1W46A 1ZNYA 1FP6A 2FEMA 4TMKA 1QVCA 2WZQA 3VNUA 3SYNA 1BDOA 1LACA 3X1XA 4BFXA 4F92B 3MLEA 5HGQA 1LS1A 1KKLA 1W4RA 2BC9A 3I5YA 2FWRA 1RIFA 5CK4A 5K8IA 3UE0A 1KZGB 4GFDA 3SJZA 4JI6Q 4NCKA 2D74A 2Q9BA 3LWUA 4OGQC 4ZDIA 2AX4A 4CEIB 1BOFA 4HR7B 3C16C 1OIXA 5KSZA 4NYIR 2GJSA 1Q1EA 2ZITA 2CWPA 2A5FA 3U5ZB 1XTQA 4DLRA 2C9OA 3LH5A 5C44H 4URVR 4EPWA 1VYUA 2ONJA 5BN4A 2MSEB 2HHHL 1DG3A 2BMFA 2IYTA 3FP9A 2NG1A 4OX9Q 2IA5A 3IBGA 3KFUA 2C95A 2HHHQ 3L43A 3QXHA 1SXJB 1NY6A 1XEXA 3V4RA 3RLOA 2FFHA 3LO5A 1X65A 2C5LA 4LFCQ 2WWYA 1RL2A 4OI4A 4BZPA 4F4CA 4IQZA 3ZVRA 4C7OB 2JA6H 1X3FA 4DR4L 1KAGA 1FOEB 1MR3F 3J81i 1OF1A 2FFBA 4B48A 4YY3Q 1U8YA 1OH6A 1HURA 3CNOA 5D3MB 3LW8A 5EE0A 3TUJC 3ZH9B 4DR4Q 4YCWA 1B0UA 1YNNC 3O8DA 1MKHA 3PCOB 4IHQA 5LB2A 4CDGA 2QPOA 3THWB 4JI0Q 3QOFA 1NJGA 5EE1A 4JLBA 1SXJE 1IN6A 4H9GA 5TARA 4A3KH 2IC5A 4QGUA 1FQJA 3SZRA 1UE7A 2ALYB 4LUCA 5BN3A 1RKBA 1PJRA 1KL9A 3AGQA 3HOXG 4NYJQ 4A3KG 1N5KA 4DSTA 4HUQA 2CK3D 1N5JA 4FI3C 2NO7A 5DNYB 5C1BA 4R7ZA 1NE3A 1EFHA 2Q9AA 4NTZA 4FCVA 5AUOB 3K0EA 4LHVA 1KAWA 5EP2A 4EPXA 2AKAB 1KYIA 2PZEA 4JVLA 2VO1A 1FL0A 1E0SA 1D2EA 2OFOA 1R0XA 1XFAA 3DKVA 1U90A 1DELA 3FFAA 1GKUB 5AJWA 5HCIA 4IXMA 5G41A 5KSYA 5BQ5A 1DGSA 1OHHD 3GMTA 1KHIA 5FUXA 2O8CA 4QOSA 2QT1A 4PC1A 1HR0Q 4HAUA 2I1VB 3WRXC 4K0KL 2AFIE 1XTJA 2ZVPX 4A36A 2QENA 4KAXA 1AS0A 4AG5A 3QF4B 1YHBA 5FPHA 3HOXH 2EVWX 4PC2A 2B63G 3VKGA 4EPVA 4B3MQ 4PSAA 3G4SA 2H1LA 4GL2A 3CPEA 4EFNA 1L1OA 1YZUA 2QN6A 2GETA 4NYIQ 5JZVA 2B8TA 1NN0A 1UWVA 3H0GH 4FMDB 2ZTEA 3PJRA 3GFTA 2P3SA 3PG5A 4DVGA 2GN5A 2GAAA 2IYRA 2ZS8A 3UE1A 4IRUB 2FFAA 3AP2A 1G3MA 3Q9LA 2UUAL 3DEFA 4Q7MB 5FOSA 2ZYWX 3QF7A 4DK6C 4PHTA 2JA1A 3KJEA 4JCVE 2PMKA 3IO5A 5TB5A 1G8HA 1BBWA 2GVDC 1FFHA 4KKSA 2F9LA 3C5CA 1W36B 4AKIA 4LYFA 1V9PA 2A69C 4DUYQ 3AYHB 3TS0A 2A7QA 1VQFA 3U44B 1MKYA 2WKRA 2IHBA 1HCZA 3D8BA 5B58C 2QQEA 4IFDH 4CT5A 5FTLA 2WJVA 1D8TA 1YI2A 1YRBA 4GNXC 5IY0A 1Z3IX 2OAQ1 4MZ9A 2I5LX 2E5LL 4KYIB 521PA 5JMTA 2C8VA 2IEZA 3CWQA 3BDOA 5IRCD 2IF0A 5DI3B 4AYBG 3AVOA 4US1R 3AGPA 3R8CA 1SVOA 2QAJA 1E32A 3ZS9A 4QKQA 2GZAA 1PH1A 4M9ZA 3B7GA 3JAMc 2O8EA 2F1HA 1BBUA 1IY0A 2ZI5A 4PZ8A 2CXXA 4JLOA 3SFVA 1NMZA 2CL6X 4Q1DA 4KODA 2MFIA 2ZT9C 1N0VC 2FV8A 3MWLA 4AC9A 5KNCA 5LD2B 2ECKA 1XP8A 2OM2A 1NG9A 1GL6A 4AURA 2DNCA 2GWHA 2ZRBA 1NLFA 1XCMA 4PXAA 2Q3HA 4KFUA 1QVRA 3GLIE 3AP3A 3QPUA 3EARA 2O5IC 3AQQA 3AKEA 2OESA 1KJZA 3CPFA 1X6VA 1B9MA 4IVQA 4JI4L 4ABYA 2O5VA 4GZLA 2ATVA 4JBXA 1X1SA 4KHPL 1C4OA 1FZQA 2BMJA 2F43A 3WWVA 4AQYQ 1S72A 4I99A 2A6ED 1R10A 1L0WA 4LPKA 3GLIA 1RRCA 1KI6B 3SEAA 4AWXA 5DE3A 1UKYA 1EFWA 4JI2Q 3MJHA 2IL1A 2RF4A 4OJQA 3DM3A 2RGGA 3PFIA 4B71A 5JEDA 3TRFA 4BFZA 2DPXA 4HLQB 3HPRA 4LF9Q 3JZAA 3WY9A 2GVAA 4HB0A 4KLNA 2R93H 3EW9A 1C7YA 4G0NA 5FLXc 4MRVA 2OFXA 3BIFA 4PPQA 4XTRA 2GJKA 3AFPA 1J8YF 1KI4A 1GVNB 4FDBA 3OW7A 4DV1Q 1UAAA 3RHFA 2MNAA 2QI9C 3P26A 2AHOB 2IUTA 4S35A 1P2UA 4A3BH 3VR1A 2JJ1A 2Y8EA 4M21A 3RC8A 4BLSA 4MRSA 1E2ZA 3ER0A 1RYFA 1UKZA 3STBD 2NPIA 3K9LA 1GWNA 5DISB 3SS8A 4BLQA 3W5OA 2WTUA 3ERSX 1NBME 1I2DA 4JI7Q 1VHLA 3A37A 4G3XA 4RZ2A 2QMEA 4PTLA 5H1YA 5H70A 4IDHA 4D4LA 3UG7A 1YZTA 3I72A 4I1VA 1AJEA 4YWKA 1KC8C 3Q7QA 3THYB 3NG1A 1AS2A 1KI7A 4DR1Q 1KTVA 2HYDA 3IPXA 3M1IA 4B6EA 3U7HB 2VP4A 1L1OC 4HDQB 1D9ZA 3T1TA 4FWTA 3P1JA 2VEDA 2CEAA 4A3JH 4X62L 4C30A 3DHWC 1O7LA 4ZIRA 3FKSA 5AUQA 1A0IA 3K0SA 1ANKA 1F60A 2KCMA 3C5HA 4OJKA 5GVSA 2DGYA 3NBYC 3P4YA 2Q21A 3AVVA 5JI2E 3QEOA 1V43A 4DV7L 1VQOA 2A19A 4IPDA 4DR3L 2QPTA 3BOSA 3THXA 3SHFA 1JJ7A 3KQUA 1Z47A 3IKJA 4Q9JA 2HIXA 4NH0A 2J1LA 4M1WA 1XF9A 4C0SA 1YHAA 1HY3A 2IX3A 1N6HA 2HT6A 2QMOA 4C7OA 1OH5A 4JI8L 2K32A 4C3HH 2J0SA 1M1KC 2K52A 4A3LH 4LF8L 4QHTA 4TQAA 3IDQA 2JEOA 3TREA 1YHQA 4W5HA 1ZCAA 3SN6A 2V8OA 3B8HA 4PHFA 4HLDA 2JK8A 1ZNWA 1NBWA 1GNPA 1P16A 2OLKA 1LS6A 2YWHA 4X6AH 1XTSA 4G5OA 4TN1A 5IF9A 4PZ7A 1A82A 1BO6A 1FL9A 4LUVA 2V1CC 1LF5A 2VW9A 1NVXQ 1XRJA 2AR7A 2DUDA 3HWSA 4RD2A 3TLXA 2UXCL 1KI1A 4DJTA 3W3ZB 1ZM4A 3ULPA 3KKMA 4CVNA 3LBIA 1LM0A 1ZJ6A 3FMFA 5CITA 2LSSA 4DC9A 2L5TA 3T12A 1IHUA 2REXB 3BFKA 2XNDA 3LV8A 3KQLA 1TPZA 3LVQE 2P65A 1QHGA 3VMFA 2KB0A 2Q9CA 1N32L 2ZI3A 1GHJA 1XTKA 3WHLA 4HIKA 5D3QA 4F7WA 1G7CA 2A8VA 2FPLA 2O8DB 2CKZB 4UNNA 5A4JA 5L3SB 4B3SL 2JDIA 4GOPA 1VHTA 2Z0MA 4M1MA 3H1TA 2WAQG 2QNRA 4E09A 1G51A 2OSBA 1LYLA 2WJIA 4OX9L 4X66Q 2C2HA 1KIMA 2V4ZA 3HGBA 4DIEA 3GTKH 2CCZA 1G9XA 2CJWB 2B8WA 2FA9A 2VP5A 3QBVA 3THOA 1G8YA 3BJIC 4X66L 4JVNA 1HQCA 3SHWA 2NN6H 2AKWB 3SQWA 2IWHA 1IW7D 1L7VC 2ZRJA 4PQRA 1VQNA 3H2YA 3NC0C 3H15A 3SJCA 2P67A 4C2UA 2NVYH 2ERXA 4NXMQ 3M4QA 1R0YA 1R5OA 4D6PA 5HR5A 1H8HD 1P62B 5M5YH 3KJPA 1G3QA 1XJ0A 4HAXA 4LYJA 4EPYA 2WWGA 3EA0A 3KJHA 2X2FA 2YWFA 2IYQA 4B2LA 3DKPA 1X3EA 3FHWA 2GXSA 2HJVA 5FTJA 1FTSA 4UP9A 1Y69U 2UZIR 3FHCB 2UXBQ 2IS4A 4I7ZC 1G8PA 1KJYA 4V0OA 1WJJA 1R6BX 1Y3AA 3O8BA 4IFDG 3K9NA 4IPGA 1ZD9A 2ZJOA 4M1YA 4HIOA 2VQFL 4LF7Q 2IEYA 2IYLD 4B44A 3U58A 1W48A 5E7MA 4BLTA 2XB2A 1D6JA 1II8B 2F4VL 4PAQA 1TX4B 4IOJA 4MNOA 3FVQA 4GKKL 3PV0A 2KBEA 1P9RA 2ZYVX 3MWKA 1NMXA 2L15A 1WE2A 1Z6AA 1T6NA 2R6AA 4B3DA 4P33A 1BMFA 4NCHA 2ZSEA 2WB1E 1SN8A 3R9IA 4C4PA 1ZUHA 1YVCA 1KKMA 4UNQA 2BMEA 1A2BA 2QT0A 4JL6A 5DSZA 2CVFA 2RGNA 4RD4A 2O8DA 1K9MC 1JPJA 1CJUC 5IYDH 1R4AA 4DCTA 2VY3A 4CW7A 4GMXA 1IJEA 3LXXA 2I4IA 3TSOA 1PH7A 1GL7A 1Q90A 4JV5Q 4HUQB 5IWAQ 2PQAA 1E2DA 2D3WA 5CM8B 1LNZA 1TEVA 5TV2A 4DR2L 4PZ6A 5HZKA 2A68D 1ZM7A 3CCLA 3VX4A 5FR2A 1VQMA 3K53A 2QGQA 3W5IA 2HCJB 5JJKA 5KU1A 4TWZA 1SXJC 4O2DA 2OQKA 3BJUA 2O0JA 4B3CA 1YQTA 1A1VA 4A0HA 4NPHA 1GNRA 4LJ8A 2HLDA 3I56A 2UUAQ 1X54A 1IBLQ 5DH9A 2QSYA 1I6HH 3ZQ6A 4A0RA 4KLZA 4NKRA 5F98A 2VHCA 2GCOB 1FVIA 4O2RA 1Y8NB 4TSFD 4Y0AA 2JQOA 4X64L 1DARA 1JT8A 2H8KA 5DHFA 1EUJA 4JG2A 1IBLL 2CLDX 4DDTA 2O8CB 4UNSA 1XEWY 3PSIA 1Z2AA 2I5HA 2QP4A 5JS8A 1BKBA 4JBMA 1HQMC 2P2LA 3NBFA 1D2NA 3S17H 2NPFA 1W0KD 1EFRA 5E3HA 4QL3A 1FQKA 5BR8L 4LF4L 2GTPA 2WWXA 3GDEA 3TR5A 3ZLJA 2A6HC 4WIAA 2V6JA 1X86B 2H17A 1V5WA 5BYKA 5L3QA 1E1TA 3KL4A 4B3RL 4GRAA 2GBLC 2VS1A 3NC1C 1FJGL 1TADA 4QRHA 2H16A 3K0AB 2WBLC 3PO3H 1QVGA 2V3CC 3KJGA 4JI8Q 3OAAA 1E2WA 1CKNB 2OQ0A 4LJ9A 4A3FH 4OBEA 4P0TA 4ZCMA 4ZDKA 1H8EA 4C0JA 2AFHE 1V1QA 3LNNA 4DSNA 1AQUA 3A8IE 2ZRFA 2ZSAA 5E95A 2I0QA 3KF8B 1HUQA 1I4TD 3G5UA 4KO8A 4LY6A 4A75A 3THWA 1Z7TA 1IJFA 5C0XG 1Q46A 2B29A 1K8GA 1UFQA 5K36G 2ZTCA 3M3YH 3BBPA 5GJVC 5BW8A 2WOOA 3OEED 4B2PA 3GPLA 4URYR 5FL3A 4BEJA 4KHPQ 3K70D 4DV6Q 4G5QA 2ZSFA 3I5XA 3OHMA 2FE4A 2BBWA 4A8JC 1HA3A 2QA5A 3GJXC 2O8EB 1R9TH 2A78A 2ZREA 1TUEA 4F38A 3C4JA 3PUYA 1UEBA 1B23P 4C0HA 1X8JA 1Y14B 3GJ0A 1ODFA 4JI2L 1GZSA 3AQ4A 4BY7H 3C8UA 2NO9A 4HLUA 1OXVA 1UDWA 3DMDA 2YTXA 2MO1A 2IWRA 2ZI9A 2LKCA 4JLKA 2ZETA 3PF5A 1F2TB 1KDTA 4EQ5A 3SNHA 1IY2A 4RKFA 4FCTA 4A3CG 1XD2A 1WP9A 1W0JD 3AF1A 2ZJRA 3U50C 3LLUA 1FX0A 4JBKA 2BBTA 5LMNQ 4MDFA 1I3QH 1UKVY 3AB3A 3K9GA 4R71A 1WDTA 3B9PA 2ORVA 1ZMXA 2BCJQ 1IAQA 2FPKA 4OHXA 1AE3A 4Q4AA 2ZM6Q 4X65L 5E7IA 4Q1FA 4GNXB 5BN5A 1VG0B 3PCRB 3TSWA 4ACBA 2F43B 1GP2A 1YR8A 1GSIA 3JC66 3A1SA 3U4QB 2Y0SG 4HDCA 1CSQA 3GTPH 3EZ2A 4LFBL 4Q7KA 4EKDA 3BZKA 1VQDA 2JCSA 1NSFA 1LABA 2ZSBA 5GJCA 3ZD6A 1ZNZA 1K5GA 3MXUA 5DO9A 4DB2A 2YHSA 2FU5C 4YXWA 4Y52H 2VL7A 1TTTA 1XMIA 1E1RA 1VQ8A 4IJLA 4GN4B 3BC1A 5HE9A 3GFOA 4HATA 3I92A 3BFVA 4MGYR 1JEEA 2C35B 3CCUA 3KUDA 1IW7C 2R7DA 1YJ5A 3EC2A 1CR1A 4Q4JB 5AR1A 4POGA 2ERYA 4BFSA 1EESA 1OTCA 4IFBA 4C3JH 1J5EL 4LUZA 1HE1C 2VP6A 3GLFE 1E2QA 4QM6A 1KY3A 3T1HL 1J99A 1Y8PB 2VF8A 2CFMA 3NH6A 1B8AA 1QUQA 4KBGA 2QEXA 1DO2A 3KQNA 3W6NA 1EIFA 1VKJA 4GP7A 2ZRDA 1C1YA 4JI5L 2G1JA 4Q9HA 1T5LA 2NZ8A 1W3SA 2CL7X 4MKIA 1S2MA 4JOIC 1T8TA 2QBYB 3CCSA 4B3TL 2Q3FA 3FGNA 1MOZA 1VQIA 3WMFA 4UP7A 4A93G 4CIDA 4CEIA 2DB3A 5C4JH 1TAGA 1Z0AA 4A6PA 3Q85A 4HUTA 3TAHA 3CH5A 2RCNA 4HLUC 2AMCB 2WJHA 1JR3D 3Q5EA 1MT0A 4IJHA 4Q4HA 4URXR 2EYUA 3OEHA 3EC1A 4G7HC 3T34A 2C03A 4A2PA 5EP3A 2IK8A 4KSCA 2OWOA 1UE6A 1VMAA 2OHFA 4MKHA 4DNTB 3J81k 3WHKA 3L0IB 4JYAQ 5G3ZA 1II9A 3GLHE 1BMFD 2BJVA 1E4VA 5DYIA 4DLZA 3QG1A 1ETUA 2MSCB 2B63H 4R2HA 4EPTA 5JSZB 1Z0DA 4NONA 5FTNA 1JJVA 2BDTA 1K8MA 2A30A 4PHGA 3QSYA 3ECCA 4B47A 3KDSE 4H0LC 4DUGA 2R93G 1A2KC 1I4DD 4JLNA 1GRNA 3FTQA 4ALPA 2E75C 2NVTH 4M9XA 3PR1A 3W34A 2JLSA 1VQEA 2K5UA 4PG3A 5FBRB 2K4KA 3A1UA 1SFOH 4MYTA 3QQ5A 2N8NA 5FJ8G 3FWYA 1TUIA 4PC7A 1ZYUA 3A1VA 3FB4A 2XZOA 1KO8A 4XSGA 1PH6A 3CW2C 3G71A 2YC2C 3K0XA 1IYUA 4YHHL 1DOAA 3MAAC 4MYUA 3T06B 3I4LA 5J4YA 4XJXA 3WRYC 1YVDA 4PX9A 4CZ2A 2F3TA 1SXJD 3RN5A 2PI2A 3LBHA 4M53A 2AXPA 5CB6A 4GOJA 1N34Q 2VSOA 5FTKA 2VL6A 3R8FA 1Y1WH 1O7IA 1XWIA 1QHHA 1N36Q 4D2IA 3HOUG 1SVIA 1KY2A 4O25A 1NVVR 4AYXA 1N8RC 3WDNA 1PH9A 2P5TB 1N3BA 1LUZA 4BE7B 1R5NA 5JFGA 6Q21A 1HZ9A 4JI6L 3B13B 2VHQA 3EZ6A 4D0LB 2V6IA 121PA 2VSXA 1G5RA 4YDHB 3X1ZA 4M1OA 5DGXA 4LJ4A 4JI3L 3GTGH 1Z6HA 1EX6A 2PJZA 2VHJA 4LV8B 1YJ9A 5FPYA 4DLYA 2XNSA 4IEEA 1X3GA 3PIOA 4F4JA 1X8LA 1RE0A 2CE7A 3MGCA 3BU2A 3OEHD 3BB4A 2IYVA 3GLGB 1AZSC 1E1QD 3B1XA 3BE4A 2WSSA 2P6NA 3D7MA 1G8GA 2KHIA 2OAP1 4JI4Q 2VH5R 1U99A 5DLQE 4L4UA 4YY3L 1L2TA 1E22A 3NXSA 1TXYA 4OO1I 1LV7A 1OW3B 2EFCB 4M2LA 1KO5A 5G40A 1E3PA 5K8TA 3I4NH 1P2TA 3QPWA 3LQRA 4DNRB 4CYMA 4L15A 1YJNA 1PYBA 3H94A 1P60A 1TF5A 4HSEA 1XTRA 4PSVA 4DEYA 3KQHA 5KNBA 3SC3A 2AL7A 4II7A 2CW0C 1JE5A 5M3FH 1R5BA 4DKAC 4UPAA 2ZRHA 5JRZA 4DCUA 2J0VA 2O0KA 1IQPA 2EFHB 4Q1EA 1SHZA 1LTQA 3S1QH 3FOZA 2V7QD 4U5XA 4A3BG 4MYCA 2BBOA 2BE5C 2K14A 5FL7A 4ZIRB 1Z08A 1CEEA 1N5LA 1GFIA 2ZE5A 2ZUCA 1KMQA 4KFSA 4FCWA 1N33L 2W2TA 1FGUA 1W4CA 4OHVA 3VKHA 4JI7L 1F48A 1G7SA 4JYBA 3P4XA 4OI2A 1M1YE 2AD5A 4FMDF 4PC6A 1MO3A 3HOVG 2ZXUA 2Z43A 3RS2A 4HDOB 3SI7A 2ZROA 3ZD7A 4K0KQ 1Y8OB 4ZKEA 1U5KA 1Q44A 4PFSA 1XCPA 3NBHB 4B73A 1D7QA 2V9PA 3CRRA 3UDFA 4TYQA 2E76C 1PLLA 1DCZA 3KQKA 1F3OA 3UMFA 3W1GA 2NGRA 3AKYA 5M3MG 5E7NA 1QRAA 3RR5A 2B6HA 3LA6A 4NXNL 4TLEA 3KKQA 3OESA 5HKKA 4OO1G 2R7ZG 3PO2G 1KIXA 3KFXA 3LD9A 3O8CA 2VUMH 2Z6VA 3NEYA 1QVFA 4BBRH 1YNXA 4LSGA 2FXQA 2JA7G 2HLDD 2IX1A 2D5DA 1JECA 4RD6A 4MGIR 3HU3A 5JECA 3U3RA 1PLKA 3PF4A 2LXKA 1PH5A 1CJKC 2ZRNA 4ZCLA 4DIDA 4A0FA 3EWSA 5L3QB 3KZ1E 2IS6A 3SJBA 4GN5A 4C2MH 3BZCA 4G1UC 4A3FG 1L4YA 3EZ9A 3ZIAA 5KPJA 1Q8KA 1R2QA 4LJ7A 4L9WA 5A35A 1G6OA 3CZQA 3T53B 2ZSDA 5AJ3L 1W7AA 1E98A 3HKZG 1OXTA 3A0JA 1YHNA 2WKPA 3K9HA 2BCGY 3IEUA 2EFEB 3TQFA 1OPXA 4M1SA 3EPJA 1WBBA 2CK3A 3B9QA 1E9DA 4MGZR 5ELOA 1CRQA 1XPOA 1LFDB 4JI0L 1US8A 3K8YA 2RGEA 3LQQA 3NTUA 4DLUA 2OXCA 2ZU0C 4LWZA 1Z28A 4TLBA 1E6CA 1GRRA 2Z6KA 1W5SA 2EJMA 1N25A 1VCOA 1XD2B 2FN4A 2GCNA 3BGWA 3RWOA 4A2WA 2NN6G 1BVSA 3GLFB 2XTNA 3WYGA 1JR3A 3TH5A 2B92A 2R2AA 3P27A 4CRWB 2ZPTX 3B1VA 1QHHB 1GRQA 4OL0A 2G1KA 3BERA 1N33Q 4BLPA 2JA8H 2R7FA 2FFQA 1DAHA 3HU2A 1Y1VG 1G21E 4EX5A 2FGJA 2IYZA 1KXLA 2VTKA 3B6EA 3TQCA 1XD8A 4GOXA 4Q7LA 3TRZA 1OE0A 4QNRA 4K46A 3GLIB 1JPNA 1KMHB 4PPNA 3G0HA 3VR3A 3D0FA 1DE0A 4MUAA 2PNRC 1I50H 3AKCA 2QSZA 2CCJA 3NE5B 3ASYA 3GJ4A 4TTQA 1ELOA 4GOKA 4DUZL 2VNUD 1G6HA 2GBLA 2ZE6A 1RRFA 4OWWB 4HJ8A 3M0EA 5FOWA 3X2SA 3QXJA 4R4OA 5C0XJ 1S96A 1I6VC 1UEJA 1ZW6A 3TAUA 1TQDA 1EQQA 5FOVA 1W2HA 2F9MA 4P4SA 2A3RA 1ZBDA 1T3LA 1UM8A 5GROA 3J80i 4RG1A 4PO9A 3M9BA 1W36C 4PQYA 3ADDA 1NBMD 5ANRB 2EYQA 1T0JB 3LFUA 1G64A 3AVTA 3B60A 3RAPR 1M8PA 1VYTA 3AVWA 2ES2A 1DAMA 3K7UC 1YR9A 2VQFQ 2AUKA 2K33A 3THYA 4KITB 2C04A 2UZ3A 4QNMA 4JC0A 2WPDD 1J90A 1UKEA 3MJRA 4AK9A 1GUTA 3MEFA 3DOEA 2QUZA 1YEZA 3QKRB 3NKVA 1EWRA 2F3RA 2GEDA 4KVGA 5A0FA 1GUOA 1VQCA 1IXRA 1EK0A 1FP7A 2PJRA 4XTCS 4KYUA 2WIBA 3UK6A 1T9HA 2O0HA 2VYFA 4UKDA 1HJPA 4YMUA 2A6HD 4DR3Q 3NEJA 3PIRA 4LBYA 4C0QC 4D4KA 2ZRMA 1MV5A 4AYTA 5LD2C 2Z83A 1XNQQ 2RMKA 1GO3E 4PAMA 5FBQB 5JJLA 3SGIA 2IBMA 3HOYH 3ZJYC 2G6BA 2YYZA 2QE7A 1Q7YC 3PUZA 1KK3A 3BRWD 4JK1C 1FYCA 2BEJA 4BRWA 2LCFA 4B3RQ 4ERNA 4F93B 3U4VA 4JBYA 1ZIPA 3IRBA 3QXXA 3DL0A 1T4GA 2NOAA 3IUYA 4LZZA 2O8BA 2JLUA 3R9XA 1U9IC 2LKDA 3MWYW 3LNCA 3A4LA 1Q12A 4MYHA 1A5TA 4LJ5A 1MABA 3U7FB 1VQBA 4YC7A 2D2CC 3SU8A 4JLVA 3HDTA 4NB3A 1G20E 2RH5A 2BA1A 4ZI3A 2ORIA 4OQNA 2VP9A 1EWHA 3QEJA 1K6MA 3TW4A 1WCMH 4NYMQ 1OFTA 2Z4SA 3TS2A 2BEKA 2WM9B 2WHXA 1LW7A 3OW2A 1P7CA 3H84A 3RDPA 1YE8A 4IFDJ 4LK2A 1LY1A 4IOLA 3SFZA 2BDOA 2VBCA 3V00A 2WJGA 5EE5B 4DT1B 1SGWA 4A4IA 1VQHA 2OCAA 4DXAA 1HTWA 1PYSB 1QZXA 4DR5L 2RAPA 3DM5A 4DV1L 1QDEA 1MJEA 1XMVA 2W2XA 1SVSA 4JYCA 4X8HA 3EPHA 3CCJA 5FI1B 1KK2A 1WF3A 4B35A 4NBSA 4GOPC 1KAOA 1N6RA 3KUCA 4ZV4A 1TU4A 3F2DA 3KJOA 1C0AA 3N2IA 4QGAA 1Q81C 3T1QA 2PZGA 3GQBA 2JE6I 3F5FA 3CC2A 2PEZA 3TSZA 1E99A 3W9YA 2PCJA 3B1YA 1YRAA 3CF5A 1EFCA 3TIFA 4LYAA 4B2IA 1N6OA 4OXPA 5HY6A 4BASA 2AUJD 2UUBL 4L9SA 5C0XH 4OONA 1U0HC 4C2TA 3QKUA 4IOMA 1X55A 1WCV1 4XVQA 5E7JA 5KOYA 2HT1A 3X1DA 1TU2B 4RKEA 3W6PA 1T3SA 2D4HA 4N0EA 4HB2A 2IYWA 2KHJA 3B78A 3B1ZA 1HNXQ 4C0KA 1YZ6A 1Z63A 4GPTA 5SZIA 5IYCG 621PA 2UXBL 5LMNW 4Z54A 4IPCA 3ZQJA 2R6DA 4LBWA 1KNQA 2KWIA 4XSHA 4U00A 1IBML 1XDBA 4JI3Q 1YZKA 5JHHB 2BOVA 1JNYA 2XGTA 2IF2A 4LK1C 2XSZD 3LBNA 5FBLB 4DSOA 4E5UA 4EFLA 1NVUQ 3IILA 3WNBA 5G53C 2GZDA 2IS1A 4B75A 3GCGA 3PEWA 2YINC 2WVJA 4KSBA 1XCGB 3CRVA 4YWLA 3QY0A 2DWQA 4H1UA 1K5DA 3Q8XB 1KNXA 2ZRKA 5EXSA 3U7EB 4EQ6A 3KOJA 4OI0A 1AE2A 2G83A 2WAXA 5FL7D 4DLVA 5IT9c 1HE8B 4FW9A 4EPRA 1G1MA 4D4MA 1XMJA 2F4VQ 3HPQA 4LCBA 4B34A 1Q0UA 4L5QA 4MRNA 2J9RA 4AI6A 4JLAA 2IW3A 3EIEA 4JJZA 4BY1H 2P6UA 1GILA 3NELA 5AWFC 3WBKA 2IHFA 2ZM6L 2PEYA 1GIAA 1QVAA 5TY0A 5EUQB 1FUKA 4BFTA 1N0WA 2FDCA 3E2IA 4DR7Q 1Z06A 2JA5H 3NEMA 1LTLA 1NLYA 2X19A 1E7ZA 1PFSA 3HOWG 2YWEA 5H68A 2ZS9A 5K8UA 5F2EA 1N9WA 4JYAL 2ZTDA 5ELNA 1GOTA 2UXDL 2QORA 4N1AA 4P32A 2DFKB 3EG5A 2ZYUX 1M90C 1N32Q 2UU9L 2CLSA 3AUXA 1YZGA 2UXDQ 2GJ9A 1E2PA 1VCNA 4TL6A 1AM4D 2HQLA 4O0AA 1Z83A 5IP9G 5IDVA 4XIGS 2ORWA 4DK0A 2QQ0A 1OXUA 3B6YA 2CLCX 4Y7NH 3A8KE 4X8LA 3P32A 4HJ5A 3EIQA 1OLOA 2BWJA 3V9PA 4NXNQ 2GK6A 3BFXA 4OO1H 2Q2UA 1NKTA 3KKNA 5M3MH 3FKIH 1RFLA 4LF6L 3TGPA 4KHZA 4TL8A 3FKIG 4DV4L 3EIHA 1S3GA 2YOGA 3AF0A 1NSTA 1P3JA 3C14C 4NZYA 1O78A 1ASYA 3MFYA 2ASBA 2QAGA 3U6BA 4URZR 1L4UA 2XEXA 4PAOA 3CNNA 5JSZA 3QXCA 3STBC 2GESA 1KRTA 1A63A 2RKOA 3T5GA 4PSKA 1UBFA 4P71A 1HH4A 5C3EG 1G7TA 1HPCA 3CD6A 3QKSB 4DPGA 4ASUD 3OOCA 3VHLB 2W6ID 2JA6G 3UMSA 3JVVA 3ICEA 2ZU6A 4Q02A 3OIWA 4L8JA 5BR8Q 4DV5Q 2UUCQ 4AKEA 4JBJA 4HIMA 4E22A 4XVUA 4JT4A 5DI9A 1L2FA 3AUYA 1YBYA 1JR6A 2GXUA 2YV5A 2F1IA 1GKHA 5IHPA 5JS7A 2K75A 3FMIA 2BKEA 5JWRA 1E0KA 5GAEC 4YLGA 2NO1A 5BYJA 2ZAOA 2IXFA 1S3SA 1GAJA 2FF7A 4F4IA 3GLHA 3I73A 1G8FA 4O3MA 2ZJ8A 3RS7A 3RVBA 3S24A 1HNWQ 3MCAA 4G01B 4A3LG 4GKJL 1MABB 5KDDA 4QGGA 5JEEA 1HTPA 4DWJA 2HCBA 2P6RA 1YR7A 1UJ2A 1VQ7A 1EX7A 1WA5A 2ZRAA 4QY7A 3TBKA 2PI2E 1GUGA 5KNDA 4WJ4A 2CHGA 2QM7A 1CRPA 1CJTC 1G7RA 3W90A 3TQYA 2C78A 1AKYA 1XPRA 1OXSC 3I4NG 1Z0IA 3K0FA 2ZJZA 5FPKA 2CNWA 3U2QA 1P6XA 2FX3A 2CL0X 3S1AA 3THXB 2GF0A 1ZU5A 3IHLA 3CRQA 2GDJA 2R8RA 1F2TA 3TVTA 1NY4A 2VF7A 4ON9A 3EXAA 4OKSA 1E1RD 3V4FA 4LYHA 1CU1A 3CX8A 4LFAL 4A3JG 3VAAA 4DDVA 3Q8DA 3L82B 4HZIA 3ULLA 3CPJB 3CNLA 2MO0A 2PCFB 2AN9A 2QGZA 3U44A 2J59A 1OSNA 1M7BA 5M5XH 5JEAH 1KQSA 4XWAA 4DT1A 1Z0FA 1ONBA 1R8QA 2XX3A 3PITA 4Q4AB 1IXZA 3AH8A 3I4MH 3CRW1 5FLMG 5C3EH 4D25A 4CT4B 3GJ7A 3KDFB 2RGNC 2OT3B 1KSGA 1P4SA 1G3IA 1NVVQ 1UEIA 4L8GA 4A1FA 2W0SA 2ZJAA 1SR3A 1JALA 2C9YA 3QJYA 5FR1A 1P9WA 1LVGA 2DFNA 5IT5A 5IE8A 2WB1G 1K8RA 3ZDQA 4YXWD 1XNQL 1PZNA 2Q2IA 2QTHA 2JEAI 1KDOA 2FZ4A 4JS0A 1JEDA 3KJIA 3RRNA 1TWGH 4OK3A 2AHOA 3IBYA 3CX7A 4P4SB 4R2IA 2DR3A 4JZKA 1XJQA 1F2UA 3WNDA 3UPUA 1TWFH 4G5RA 1UADA 4WOPA 3ZVMA 2GCPA 5F3WB 3TUZC 1A8VA 3RZOH 4MKFA 1NTGA 4KN7C 5JEAG 2WP8J 3HFZB 3KLWA 1G3RA 2CMKA 3EA5A 5AUPB 4BQSA 1W2BA 3RS3A 3HOVH 2O8BB 1CR0A 4BFVA 1VIYA 1CKEA 1FJGQ 2JATA 2KENA 4ZPXA 1ZNXA 5EP1A 2X2EA 5CLLA 3MMPA 4XD7A 3WNCA 2B21A 1SVMA 3CBQA 4JI5Q 2BA0A 1HH2P 1E9BA 1E2GA 1G5TA 3KKPA 2QU8A 5F9HA 4DNIA 2G3YA 3A1TA 3BAFA 1DD2A 2PT5A 4LJ6A 2ODBA 4LJYA 5M5WH 2PLFA 1GUSA 3T1HQ 1XXHA 3CLVA 2CCKA 4MITA 5G3YA 2QZ4A 3H3VI 3T51B 3T1YL 1JAHA 4Q5IA 2C96A 2O5JC 1XMOL 1L8QA 1S4QA 3A58B 1HNWL 1AS3A 2IS2A 4A3EH 4EUNA 2Q6TA 3WYAA 1B70B 2WMNB 3W6OA 1XMOQ 1JQJC 4V0ME 2WICA 2ZI4A 1BS1A 1DXMA 2WIAA 2OO7A 3GJ5A 2QE7D 4E03A 5C4XH 1M34E 1S8FA 1PH2A 3AEZA 4B32A 2ASEA 3AVYA 4WXPA 2KI5A 5K36H 4MGKR 1RPZA 4JLPA 3VA7A 1E9CA 1MH1A 2UXCQ 2MSDB 4EJSA 1OH7A 1E4YA 4V02A 5EZ6B 4KN4C 1IXSB 1W2GA 2Q2TA 3SBEA 3U60B 3RABA 4B6FA 1LB1B 4E07A 2MMGA 4W7SA 2JGNA 4RFSA 2YTVA 3RANA 2J45A 1OFIA 2XNDD 1CP2A 2ZRIA 3PQCA 4DR6L 4LNQA 4OQLA 3T1VA 1SLJA 5IWAL 2GCOA 2PBRA 3TUIC 1VS0A 1E9SA 3CM0A 1HNZQ 4XWOA 4PZYA 1SE8A 2PMZE 1Q20A 2YZ2A 3AM1A 4Q18A 4DLWA 3CR7A 3EASA 1NMFA 3R7WA 5EXTA 1EGAA 1PV4A 3TR0A 2RGDA 3BG3A 1E94E 3K09A 4BFWA 2JLWA 2EVBA 2DHRA 5H1SE 1RRPA 3EWAA 2WAYA 4LF5Q 1XX6A 4ESVA 1HV8A 4FINA 2MMCA 3A5ZB 2VRWA 4L5BA 4X64Q 1WQ1R 2V54A 3DZDA 4EJSB 4IOCA 2R65A 4M1TA 3OE7A 3RYTC 5JHGB 3UDGA 4I1OA 3JZMA 4JKIA 4MKGA 2RHQB 4Q9LA 5AJ3Q 1IN7A 4S2EA 821PA 3EX7C 2GXAA 3RRYA 2QTVB 3SE0A 2O8FA 3LX5A 1U9IA 2SHKA 4WVFA 4H1VA 1QG4A 4A3DG 3M7NA 4ME3A 1H65A 2A5JA 2AK3A 3UANA 5KTYA 2H5EA 2RGBA 2K5NA 4R1JA 1H9RA 4NCJA 3QENA 3VDYA 5FLMH 5LB4A 5AJYA 1A7JA 4QGFA 4NE2A 2ZR9A 5DN6D 1E1OA 1XNRL 2ANBA 3EZFA 4M1KA 4M9QA 1ZUNB 2D7CA 5DN6A 5CIWA 3HU1A 2XSZA 3RWMB 3CX6A 4DV3L 3AVUA 4HLCA 3A8JE 4LHXA 4B33A 1KI9A 4NHOA 4Z51A 2EDGA 1BIFA 1OJLA 3OF5A 2YJTD 1D9XA 4A9AA 4A3DH 1S1CA 3T1YQ 4N3NA 4PMWA 2A5GA 2NO6A 1XTIA 2HYIC 3FMOB 3SBDA 3JAMi 4BFUA 4RZXA 2BJWA 1XNJA 5JWOA 5IK2A 4TZ6A 4GKJQ 1AGRA 3E9HA 1CTQA 1G17A 3FKQA 4DKXA 4EJSC 3W8RA 3TE6A 2F55A 2EQBA 5DHAA 1NMGA 4Q9KA 2HJGA 5CDFA 2TMKA 1MO6A 5KHOC 2DFTA 3WMGA 2J87A 2CBZA 2ANCA 2JDID 4PO1A 4Z8XA 4DUGD 2ZVQX 4Q21A 3QPVA 4DLTA 4GOPB 4P4UA 1TL7C 3LY5A 2PPBC 3OEEA 2REOA 3L0SA 2CE2X 4L5RC 3PEYA 3VTKA 1PH3A 4JIMA 2EQSA 4IOKA 3VR5A 1UF9A 4V0MA 2QBYA 3RSOA 4DV2L 3F8TA 1HNZL 4POFA 4OQMA 3QNUA 4TLCA 3PO3G 1KO4A 3OZXA 3U7GA 3T56B 1IYJB 3U3OA 1VQ4A 2ZE7A 3UIEA 2IYSA 3X1WA 2HF9A 2R6GA 1UPTA 3AP1A 4RD1A 3VU9A 1Z5ZA 2P0EA 1M2OB 4G5GA 4CEJA 4TYYA 1N6KA 1G41A 3IO3A 4IEIA 1XXHE 3IFTA 4X65Q 2HDNB 1GNQA 1Q86C 1EIYB 1G291 1E2EA 3I7FA 1N6LA 1Q22A 5IYBG 2YVUA 3CRMA 4K81B 3O8RA 5EXPA 2AWNA 3UATA 5GJWC 1G4AE 1ZVQA 1NN5A 2RGAA 1Y63A 5JRJA 1JJ2A 1ZM9A 1PUIA 3QE0A 5SZJA 4MDEA 3R20A 2BKUA 4AIIA 1EG7A 4YCUA 3HR7A 1XXHB 1Z07A 2Z0SA 3DO6A 1KK0A 1Z9FA 4RFSB 1HT2E 2F7SA 1NIJA 3NHAA 3PEUA 1QUQB 2ODNA 3QVUA 2E1RA 3LAWA 5HZHA 1WRBA 4D80A 4YWMA 4QBHA 4RY2A 5ELXA 4ZDJA 1CKMA 4O2LA 4US0R 2MQHA 4TT3D 2WAQE 5GADC 4I81A 5AJXA 1Q1ZA 2J0UB 1CXZA 1ZM3A 2Y0SE 2Q0HA 2ZIAA 4FMCB 1ZC4A 3TZUA 4UNRA 5GJBA 3HP1A 1YNJC 4NL4H 3BH7A 1P8LA 1Z6GA 4DUYL 1SVWA 1A4RA 1VYVA 4BZQA 5M04A 4TLAA 2GKSA 1ZAKA 2N46A 2KBFA 3OAAD 3IQXA 1E2FA 5FOUA 1HR0W 3I61A 1DG1G 3CWZA 1X56A 1RIPA 5KSOA 1Q1BA 2EW1A 3BB3A 4BECA 4BBSH 1TU3A 1OH8A 4MRRA 2ZUDA 1HQYE 1P5ZB 2OFWA 1U98A 1OT3A 2IHYA 1EYGA 4PC3A 1GITA 5LMUQ 4ITRC 4BGDA 4KBFA 3LLMA 3QKSA 4A3IG 4RZ3A 3KDFA 4JLDA 3MXNB 5GVRA 1WI5A 2KBNA 4R4TA 1XU4A 2GEVA 4QHSA 2ODEA 1U94A 3OFNA 5CLQA 3ZZ0A 4TZ0A 4D0GA 1SVLA 3CKLA 3VR4A 2IYYA 2H7VA 2VHUA 4R9UC 2QPAA 2R44A 4JLJA 3RNLA 5IP9H 5EUMA 2RGXA 2XZLA 1JXOA 1JB1A 5LMNL 2NZOA 3CUEF 3DM9B 3KXKA 4P72A 1VQPA 1U81A 4LUOA 1F6BA 2PX3A 3QIAA 4QGHA 4HJAA 4B3SQ 4NDZA 2VP0A 2R92H 1CS4C 3E9IA 1DO0A 2IUSA 4EIWA 2JJ2A 2RGCA 3CP0A 4TMVA 1PMRA 1JMCA 2R6FA 4GDFA 2ZJ2A 4NU0A 4TKOB 2AXNA 1H9SB 4BA2I 5GADl 1KI6A 3CCVA 4Q47A 1JR3E 1KMHA 2OCEA 1SULA 4QIWE 1EFRD 4OHZA 4L16A 3O47A 3K70B 3IIMA 4A8JA 2UUBQ 1KI2A 2GJAA 1C9OA 2AKYA 2F3IA 2OCPA 3JVUA 2R92G 3B85A 1Z0KA 4UXJA 4LJZC 3M85A 1NIPA 4EAQA 2EWWA 2ZR0A 4PQFA 3SQXA 3TKLA 4PPFA 1OV4A 1DEKA 2UU9Q 1E2NA 4LW1A 4BBRG 2CHQA 1XTDA 4DK3C 1E2LA 2ONKA 1KDRA 3D3QA 3L0PA 3GTOH 3L8YA 4M8NE 4TMZA 2W6JD 5FPTA 1ZCBA 3TMKA 4QHYA 3BH6A 5KDLA 1P75A 1Z8FA 4KKUA 1IZ6A 4HEJA 1SROA 5FBVB 3S2HH 3ULJA 1VQAA 1PA6A 5J4VA 1COWA 4UJ5A 4LF6Q 3GJ3A 3GLHB 1XMQQ 2RHSB 5IYCH 2W58A 2VZAA 2QMUA 2ZJBA 4B3TQ 4AIMA 2GJ8A 4Q01A 4OQXA 5BWMA 4TVAB 3CAMA 3L0OA 5J4HA 2XXAB 1XMQL 4P4TA 4RMFA 3L8ZA 1Q57A 4O0MA 4FIDA 1KI3A 4B76A 1K83H 2NQ2C 2W2VA 1TF2A 5UKDA 5SZKB 5CB8A 3NIBA 3HYRA 2BVNA 2OXRA 2ZI6A 3UG6A 4BFYA 4Y0VA 1SKYB 3I1FA 3A36A 1DAGA 4RCYA 1HZAA 3M4PA 3T5DA 1W0JA 2ZQ5A 1OB5A 1P61B 3NBZC 1K3RA 3E70C 4DV7Q 1EQRA 4DV5L 2UUCL 1TQ2A 3ICQB 4ZCIA 4A3GH 2QRZA 1H9MA 4YQFA 4V0LA 4DK1A 4P75A 2AK2A 5JCZA 2YOFA 3ADBA 3FHOA 2WWFA 3I32A 1GVPA 3ZZUA 4POAA 3BH0A 4D81A 5JBQA 2VQEQ 4DBLC 1HZBA 4JV5L 1DAFA 1UBGA 1GHKA 4V0KA 4URUR 3GJ8A 4ARZB 2N3SA 1AK2A 3K0CA 2VQSA 3KF6B 2A6EC 3M6AA 1EXMA 1FMJA 1R0ZA 2IYUA 2XTMA 1GM5A 3TK1A 1BH2A 2OLJA 2FSHA 3PENA 4OQFA 1CF4A 5IYBH 5JJIA 2VHTA 4HB4A 2GRJA 3RS4A 3VKWA 3EN2A 1AIPA 3A4NA 4OHYA 2YTYA 4YHHQ 2GK7A 2IUUA 4JL5A 4US2R 4AY2A 1E0AA 2GA8A 4RD0A 2QL6A 3P20A 3KB1A 3HOWH 4TL7A 1BYUA 4DV4Q 4KFTA 2EJGC 4UP8A 1E69A 2BE5D 4DLXA 1XJVA 3WBJA 1CULC 3PGZA 5B57C 3S14H 4DAYB 2VA8A 3QKTA 3OTOQ 1K8AC 1Z22A 3QI2A 3CF2A
chains in the Genus database with same CATH superfamily
4LRWA 4ENRA 3Q6IA 3EDQA 1COZA 4UW9A 4R0MA 4JW0A 2E4UA 5DTIA 4KOAA 2P0YA 2OE2A 1E3SA 1W5TA 1XZMA 4PYJA 2I1QA 1XJCA 5I3CA 3LCVB 2G5GX 3F71A 1M6NA 4QFMA 4Y6PA 3TXAA 2XMCA 2EQAA 1OIWA 2QRKA 3ORRA 1HG1A 1OKKD 5I8PA 5CLGA 1CUYA 3EAQA 5BSKA 2QRLA 3AVQA 3FSEA 1LPAB 4R40A 4E2XA 4EUFA 1IM2A 1JEOA 1KZHA 4G5YA 1M73E 1UBCA 4O29A 3CSSA 3P75A 3IQGX 4EHNA 4XOIA 2JEBI 1SMYC 2WFLA 3MG9A 4LRUA 1Q1QA 5FTWA 1KNAA 2P5SA 4DLPA 5A4AA 5C4MA 4HP8A 4J1SA 3TQHA 3Q5DA 5CA1B 2HUGA 2GAOA 1NRJB 2XWJB 3IEXA 3R1IA 4ZHQF 3A2KA 4M49A 1WTAA 2WR8A 3ZVNA 1K4MA 4L1KA 4S3MA 3KV3O 1ESNA 2B8JA 1H8ED 2OQRA 1MIOA 1H95A 3EDCA 4H15A 2HF8A 1E64A 4NZ9A 4YONB 4BCDA 4IO9A 3TGWA 3EISA 1J2JA 1RJ9B 3QF4A 3D2CA 2GERA 4BLWA 1AT1A 4M6WB 1K6XA 4TXNA 4TYNA 1XUOA 2FSSA 3U1BA 1PJSA 4H02A 2I3BA 2XYPA 4MP6A 1I2AA 2Y67A 3UHJA 1DWQA 1HKUA 1WTWA 2GD0A 3KL2A 2BIFA 4PGHA 4RHYA 2ID0A 2Z1DA 5ALMA 7MDHA 4WLNA 2FDCA 1RACA 2VQEL 2JCVA 5DASA 4ZDWA 4AB1A 4HADA 3QEBZ 5CVDA 2GEUA 4K6HA 4F4UA 4IURA 3Q4GA 4TUYF 4NCIA 5B36A 2V98A 4YHBA 1CA5A 3L0YA 3IUSA 4JB8A 3REQA 3PUXA 2XZPA 3KYCA 2NVYB 2XB4A 3LO8A 4GBGA 4IKEA 2NMVA 1URPA 3HOVB 1T0UA 2AEFA 5M3FG 3K81C 2KA7A 1JYFA 1VXRA 1W44A 4MR9B 4Q16A 4YUXA 1HNWB 4RKBA 3H99A 2XY4A 4RTOA 2XNHA 1YJWA 4JFRA 3EXEB 1KF0A 1LSJA 2E82A 4RWSC 1YS7A 1TWFB 2R9VA 1B1CA 2JFWA 1GQOA 1KIAA 3LW7A 2AFIA 4R9WA 3D4RA 3CR8A 4LECA 4U0JA 5KWEA 2YU9H 4DDWA 3I0NA 2IQIA 2Q2QA 4NP6A 4C0BA 3OZEA 2YVAA 1WXQA 5FOSA 1P2SA 1J70A 1EGMB 1WW2A 1V5GA 4P6VF 3OT5A 5CIQA 2O23A 1RYBA 2R6R1 4RHRA 3FTPA 2UYHA 3FR8A 1IL2A 1WD7A 3GA7A 1B76A 1TWCH 2AQ1B 4D0NA 1SK8A 4YP1A 1ULHA 3M4ZA 3DBVO 5M5BA 4NV1A 2D0OA 5C44G 3Q7EA 4YACA 1U6JA 2H1VA 3FYTA 1N6IA 4OWXB 2FNAA 5JD5A 4LXQA 1TLFA 1GSAA 1RW4A 3NC4A 2QGNA 2QLTA 1ESMA 2IKSA 3PDIB 5K4AA 1NMYA 3GOQA 1CE8B 1MO5A 1XZNA 5TXGA 5ITZB 1L7EA 4GT1A 3V48A 5BUQA 3EF1A 2WT8A 4DNOA 1FTWA 2GNOA 2CNNA 4LRYA 2WM3A 1KRSA 3RUFA 2YJ4A 1N0HA 4LHSA 2W6JA 4C3ZA 3VGJA 4G7OC 2YOHA 3H11B 1M2HA 2Q0SA 4UASA 2DB3A 2ICAA 4I50A 2CVZA 5ALVA 1HL7A 5LA6B 4ISBA 4WZBE 1XU7A 1XZHA 2I4NA 2BH9A 5JQWA 3TZKA 2BMDA 3IB3A 1HNXL 1SKQA 2NYZD 2QZZA 4K8RB 1AGNA 3RE1A 3RTAA 5MF6A 1P29A 3CRKC 2FTKE 3NPAA 4GNKA 1BQ4A 3JQBC 2M6SA 5LXTB 3PIPA 1N2OA 1C80A 1YZLA 1JU4A 5HF6A 1HYGA 3GJ6A 3NASA 1O03A 3K35A 4NENA 3GP7A 2PZTA 4FONA 4KIFA 2DY1A 1TJPB 2GO1A 3AKDA 1YF3A 3ND9A 1RXEA 4W9NA 5CHYA 4G67A 1J25A 1UZLA 4RNDB 2PLRA 3A3YA 4MW6A 4BO4A 3GEIA 1IM5A 1AKMA 1OT5A 2JIOA 1OZAA 4GPIB 4BATA 4CMIA 1IBRA 5IN5A 3VPBA 4DM3A 1CZNA 2O0MA 2OL4A 4LSWA 2F0LA 4H7EA 3VV3A 2EJBA 3LWNA 3DVLA 4TZKA 5HUQA 5C51B 4DA6A 3IEVA 3G2KA 3CWCA 3HCEA 4HQ0A 2YVQA 4IKPA 1KEEA 3ZHQA 3SF8B 1BU8A 2HCFA 4CM5A 4U7DA 3BD9A 16PKA 1MC5A 5JEAJ 1GG8A 2ZSHA 5HS6A 4DF7A 1W47A 3A5UA 4WZAE 4EH1A 2HU8A 5PNTA 3FYUC 1VZ3A 5FBKA 4CL2A 1DS6A 3PVCA 3CQZH 1BXZA 4HNQA 4UHBA 5HMMA 5HTOA 1Q95A 3A11A 3S2DH 3LNTA 3M3DA 4C43A 2CJFA 3RVQA 1OI7A 2XODA 3HACA 1O7YA 1A62A 5AVTA 4RCZA 4AYBE 4DA0A 1Q3LA 1F0NA 3BRQA 3BCUA 1SCNE 2ZYAA 3RIYA 4JUCA 4GN3B 3S1AB 5CDHA 4A3BB 1GUDA 1SWVA 2R1TB 4RA9A 5EMKA 1M1ZA 3PNOA 5C31A 3VO8A 1XFDA 5FLEX 2YXLA 2H0RA 2Y92A 3LDAA 2VDUE 4D8WA 4BU1A 3PICA 3IFSA 4IMRA 2A5DA 4DU9A 1EG2A 3IIIA 4KXWA 3NTRA 4WY2A 1UFVA 2GUWA 2XWPA 3I4OA 1D8LA 4Y7NB 2WOJA 3GEGA 2IXEA 1CTMA 3LA8A 2JAOA 5K03A 1RVDA 4PLZA 4M38A 2M6LA 5DBEX 3DXJC 1Z6TA 1HT1E 2DTDA 4IUDS 4ITVA 3KLOA 4XD7D 1K0RA 1Q3TA 3SZ3A 4A5OA 2ZWOA 2MTBA 3F7OA 2QLJA 3N2EA 3T1NA 5AM2A 1XQ1A 3AM5A 4J1TC 5DYNA 3AEXA 1WULS 4RCNA 4KU4A 1QJOA 4LBZA 4RHTA 1KTIA 5KYGA 2WKQA 7REQB 1NSYA 4LOJA 4XR4A 4BWYA 2ATWA 1AF4A 4IXNA 3NOQA 4L6AA 2AC2A 1V16A 2XOKD 3A6DA 4FZJA 3FFBA 4LJAA 4RPKA 3CRNA 4M22A 4FFBB 4Y2JA 3RCBA 1PO7A 3VPHA 1ZKOA 1NJFA 3HB7A 3AMUA 3N8DA 1LQUA 2WYUA 4PRKA 4IUBS 3ZJYA 3Q9NA 3VQTA 2JAQA 3TEMA 3Q88A 3TW8A 2YWGA 4PO8A 2BZGA 1JA0A 3SLKA 3I04M 2L69A 6REQA 4X6LA 1N5IA 4BLRA 4M1ZA 5CNMA 2FSVA 2HBZA 3BMQB 3FCOA 1E61A 3DNPA 5AHRA 1MVOA 3ZHUA 2ZUBA 1U1DA 2REQB 2AQIA 4IJMA 1R18A 3HUDA 1PKEA 5C4GB 1XI2A 2M9MA 3ESZA 4NCNA 2X8BA 3OF2A 3K70C 2OAGA 4DV0Q 3D81A 2ZRLA 3Q7PA 4WI1A 5LQRA 4NYMR 5BSGA 4H27A 2W6PA 3B1KA 3VZQA 3E5HA 4AKHA 4JU9A 3CINA 3BZUA 4RACA 1PS0A 3C7AA 1U2GA 4Q9AA 1SXGA 4CF6A 1UBEA 4KY5A 1JHUA 1CUDA 1UDXA 2YV1A 2WNSA 4IGAA 5B58T 3DDSA 4M4SA 3WJ7A 2BGWA 1X13A 5G0WA 1XU9A 1ODLA 1ESDA 3CF6R 1XIVA 3Q72A 3T5TA 2K05A 4TVBA 3S1RH 2G67A 4GXRA 4M60A 1VMPA 4Z9YA 1RAIA 2E9SA 5B53A 4PZLA 1EU1A 3JQEA 4B6SA 1T6XA 3SKVA 2QP3A 5BV0A 4BZXA 1I3CA 4FFLA 3K80C 4F87A 3C43A 5LBUA 3OTOL 2DFLA 1SXHA 4JR0A 5C0OE 4DWVA 5LWHA 4BBAA 5K0GA 1ZKDA 2LR0A 4MUMA 1CG6A 4IO1A 2UKDA 4TN5A 4BL5A 1A9ZA 2FH5B 2JLBA 1I3KA 4E2FA 2XA1A 4EGAA 1MX3A 4E6IA 4CJ1B 3D54D 4YT2A 1G6PA 1E5VA 1BXTA 5AD1A 4V0RA 3TNJA 1SOVA 2QVLA 1M7GA 2G77B 2WM8A 2C9DA 2EHJA 2Y71A 4MDYA 2VDVE 4XPIA 3RUPA 3RF7A 3NBXX 3DAOA 4V39A 5EYPA 1HT3A 1TKWB 1NDHA 2P4UA 2ID4A 4G26A 3C6ZA 3OA2A 2HHHB 2P2CA 4G5SA 1VKHA 1PVOA 3B2EA 2AXQA 4BQNA 1R64A 4K9KA 1Y1WG 5GV7A 1XZJA 1W4AA 3E22B 2FZCA 3NM5A 3GD7A 1JAYA 1EQUA 2G04A 3KAKA 2X5NA 4OXRA 4E4RA 4M37A 3SS7X 3PL5A 1HEYA 1TI7A 4IRXA 3KUPA 3CGWA 4H0FA 3UHOA 4ZYYA 1BR9A 1D0VA 1XA4A 3IYLW 1N34L 3NI2A 4YIJA 2B2TC 5TE9A 3ZS8A 3TTUA 5CV5A 3AUUA 1DXOA 4QECA 1I5FA 5FLXL 4MW0A 4BWGA 721PA 5I9NA 1D5WA 3KSDO 5L37A 4AZWA 2FZEA 1N36L 1ZAYA 1K5PA 4PNEA 1M6WA 5IT4A 4EJ0A 1DCTA 1D4FA 5ALKA 4XIYA 2J85A 1V8ZA 4QBGB 1M1UA 1RWOA 4V03A 4REQB 4N3BA 3TLEA 3FWZA 3LUPA 2I2FA 2GMWA 1I94B 4MWZA 4EA8A 4OFZA 1CR4A 3FPPA 1CR2A 1E1QA 4NFYA 3MCWA 2UZ1B 2GASA 2OGZA 2O3UA 1J6QA 4R98A 3IR7A 5JD6A 1QZHA 3HKCB 2JJQA 3V3TA 1G5PA 5FPPA 5I3ZA 4UU8A 3IPCA 3K32A 4CEHB 3IUMA 5IEBA 5JSKA 4FO2A 3KWMA 3FSRA 1WOCA 4GLXA 2DJ5A 4KQGA 2EZ8A 2REBA 2JFOA 4KCGA 4YUVA 2VDOB 3RJZA 1TJ3A 3G2IA 2QAGB 3NNSA 2QTMA 4J15A 3D9QX 2ZM6B 4WINA 3UDXA 2NO0A 1YB2A 2W00A 3J80c 1UDBA 2SEBD 1Z4IA 5F2NA 4E7PA 2WMOB 3PNKA 3RT9A 3I8SA 2ZAMA 2CYBA 2OXIA 3GGGA 4J0HA 4FMBB 4JP2A 4AVYA 4ATNA 1YL6A 1F2VA 1ZH8A 3ENVA 1SD1A 1K7YA 2V7QA 1NF3A 4RJLA 2P30A 4IUTA 1PWXA 2YWDA 4M9CA 1ZMBA 1TYEB 2W8BA 2MU1A 3QFHA 4P73A 2NXJA 2SKCA 3JW8A 5KEEA 3RSLA 3IE1A 4D99A 4PYQA 3AB9A 2ACWA 3HUEA 2EE1A 4CQMB 1RZ3A 4BNDB 3U9SA 3K0AA 3EWIA 1KO1A 3EEOA 5HCNA 1T5EA 3SSNA 1IBKQ 1W1WA 2WF9A 3VJRA 4QEZA 1CCWA 5ICCA 5AW4A 2BRUC 3CXCA 2F0EA 3QUSA 4QXAA 1DBIA 5EBDA 2WD7A 1EBUA 4Q4JA 5IUJC 2H07A 3GEBA 1U5CA 4I2NA 1PD1A 4WBXC 3P2KA 1Z2CA 2F0VA 4TVSA 3KYJB 3G2PA 1M6VB 3I52A 4D43A 4E11A 1VG1A 1YVPA 5FWDA 4WORA 2JFZA 3MELA 1KDVA 2WC1A 1QSGA 3WP0A 5HTKA 9ABPA 3K72B 4I8DA 3CU5A 1MOSA 4UARA 3PHGA 7AT1A 4ZAXA 4KACA 4B7ZA 2B36A 5J2TF 3GLSA 2XKJE 1PZID 2A9OA 4HEA1 2C29D 2CDNA 5D00A 3L7ZC 3TKAA 2Z5FA 3OTIA 4CHTA 4DB4A 3UFBA 2BBSA 4DLBA 4C3IB 2LXNA 4A3IB 3DTYA 2G09A 2P9FA 2D0PA 5TEWA 1G16A 5AOVA 1X6OA 1VQ9A 1OVMA 2XXBA 1P1JA 1YS1X 4IJUA 5I8ZA 2VUSA 3OPQA 2KUMA 1GUBA 5IK2D 2RH4A 5F1OA 3UO8B 3FRPB 1BCSB 1XEWX 2Z30A 2J6HA 1KORA 4O6VA 1YUMA 1W0CA 1R9GA 2QZJA 1G6ZA 5T4HA 3PGLA 4F21A 5D3MA 1XRMA 4RJTA 3S2UA 1NBMA 4PGAA 1OLUA 2N49A 1L5KA 1ZIYA 4N41A 2HQRA 3PC3A 4EW3A 1T5IA 2HLPA 3H1AA 1QH9A 1VC2A 2HPHA 2MDTA 3R5SA 4MV3A 2W93A 4TKMA 5FFMA 4MTCA 3U80A 3V97A 1UOPA 4Z3DA 4KD4A 2IHKA 1EQTA 5SYNA 4CKBA 2FFJA 3LQFA 3NU1A 4NMLA 1JJGA 2WWHA 3HUFA 5FUYA 4I6JA 3TSCA 1L1OB 2K2WA 3HJBA 4FPXA 5DXFA 4Z9CB 5KQMA 4HAYA 2XKKA 2X6LA 2RAUA 3FUCA 4GPAA 3GLGE 4GSYA 1TM4E 1Z18A 4LXIA 4R8LA 2NVXH 4OHWA 1OA0A 3U3MA 1ZZGA 1IOLA 2QEQA 3H0KA 4HF7A 3UY4A 3VNVA 2Z6KC 1BQEA 1E2JA 3MXPA 2AHRA 3OOSA 3PPXA 1CZGA 3URYA 4EYGA 4CGZA 2PUWA 2ZWPA 3UJNA 4KO2S 1E3LA 1NI4A 2OHIA 2WJYA 3SFTA 2YIVX 3CZ5A 2NWGA 1CSEE 2ADFA 4LAFA 1DIHA 3R3JA 4RKQA 3T5BA 1B7GO 5JBNA 1WCWA 3N2KA 2QKIC 1HI9A 4PG4A 1FLDA 5JO0A 1JQLB 2IQ5A 4MTNA 1Q6ZA 1Z33A 2RHMA 3GLTA 3KVNA 3C6YA 3AEKB 5IBPA 4BWGB 1NP3A 1CSPA 2K5HA 1WXHA 2J46A 4TWIA 3MWJA 2VQ6A 1FPMA 3PVSA 3SQNA 4OOFA 1V8BA 3NWBA 2Y1KA 3UXMA 1DLJA 4ESHA 2E4ZA 4ZUIA 2I33A 2PUDA 2DN8A 4ASUA 1AOXA 1X9HA 1AZLA 3CG0A 5TMEA 3TOSA 2GO7A 3E0EA 3D0OA 2BP7A 3N2GB 1STOA 1AHHA 4G89A 1ISGA 4NOLA 1NGSA 4QUHA 4DC1A 3P9QA 3VR6A 2C4MA 3ZJ4A 5HS4A 5MGNA 3SIXA 2OUKA 4LF7B 3BGDA 3X1YA 4GWLA 4E33A 4RULA 3ADCA 1J20A 2Z5VA 4QIHA 4F3RA 1EUCB 1N2CE 1EWIA 1QHIA 2DWOA 4RZUA 1V95A 2GN1A 5KVQA 1K73C 4F9FA 3G8DA 1WV1A 4OYLA 4R4QA 3D6VA 1KHHA 5C0XI 1LI7A 1QMGA 1LDBA 1U2RA 3IS3A 2XRZA 4NK4A 2DR2A 2RK6A 1UFRA 4H7JA 1XNRB 1JFSA 3OD5A 4FNGA 1X7GA 5MN4A 4Q3NA 1V1JA 1NNXA 4XFJA 1CS0A 1VCMA 5JVDB 3TRJA 1DAIA 2HNAA 1O97D 5HF9A 2A69D 4HQRA 1W75A 2DCUA 1O3YA 3OO1A 3RLFA 4L6IA 2G63A 5DTQA 2JLXA 2F4VB 1FW8A 3A2NA 1IXRC 1SC3A 1PJQA 3JQBA 4RW0A 3K73O 5DLYA 4YP7A 1PH4A 2C1ZA 2V5UA 1FQWA 1R9MA 1JJCB 1QE0A 1EEXB 2QV0A 2V0NA 1RF2D 3FYUB 3IAAA 3IP6A 4JCCA 4RGQA 1GOZA 1VE6A 2WWIA 4KQFA 1SUWA 3RBVA 3CKIB 3U4AA 3WGNA 3MQ4A 4YBRA 3LRTA 4GOOD 4DLNA 5B55A 4R1LA 4EECA 1XNHA 5HVNA 5J4KA 3MSXA 1XXGA 5ETJA 1G2IA 1R6TA 1W8DA 1VGQA 2GILA 2NNWB 4IX9A 1ZP6A 2UDPA 4DR7L 1LRLA 1NM5A 5GQOA 4A3MH 4W9NC 2DWPA 4QXRA 2J0SA 1VKNA 4J6HA 2HIAA 1B7YB 1TS2A 1RJ9A 3HGQA 4KLKA 5JDCC 5C46F 4BQPA 4QJFA 1U9RA 1VF7A 4QDUA 4DYDA 2EFDB 1EY6A 4HEHA 4NBLA 4A3MG 3O0TA 5CT5A 4WRDA 5K6TA 1QK5A 1ZC3A 1WDLA 2BTEA 3WA7A 2HXSA 4XIFA 4U2CA 2H1HA 3R7AA 4OHJA 1WBDA 4UHDA 4WAUA 3EZYA 2I5PO 1S5CD 2H18A 3OI7A 4FNOA 1Y7PA 3OWEB 2DSNA 5JTUA 4PG7A 5LQCA 4J0QA 5JAUA 2CY0A 4JHLA 5C5LA 3V4LA 3W4JA 2E2JH 1QGUA 2EBHX 3KXLA 5F2DA 1F8GA 3E8SA 3I9V1 1A3UA 3VHXB 1DPGA 2CNWD 3VU9A 4XWKA 2VBFA 2A5HA 1VQ5A 1G8JA 4PCUA 4C1BA 4J7AA 1EIHA 3DMPA 2Z8YA 1EWKA 1ECBA 3H2GA 4M0LA 3IV9A 2GEFA 1J0CA 4FE4A 3ZDXB 2FSFA 3VZCA 1C1DA 3LX4A 1S8NA 4BQQA 1FK8A 2QN7A 5LM3A 2ZVDA 1XRPA 2WF7A 2YH2A 5A03A 4EENA 3NLLA 4HNAB 2FP4A 1PYGA 3CKMA 3IMKA 1JJAA 1JBEA 2XB8A 3H5VA 4GNRA 1BDOA 1S2LA 1Q74A 4BVJA 1YDHA 3DTVB 3MLEA 1LS1A 3ZCQA 2XB6A 1JZQA 2G25A 2V7VA 5CK4A 5JVDF 3H8VA 1KZGB 2WIKA 1I6WA 3FN4A 4JI6Q 3QELA 3A1CA 4NCKA 2AR9A 2Q9BA 3A31A 4GZ6A 4MWTA 4ZVUA 4ZDIA 3HP4A 5CFPA 4X1IB 1UJ5A 2VJDA 2VB2X 1PX2A 3ABIA 3VI3B 10MHA 1GZ4A 5C1IA 2A5FA 2BDUA 1XTQA 1EM6A 4LS3A 4DLRA 4XD2A 3UT5A 4NAUA 5C44H 2TYSB 3AILA 4EPWA 1VYUA 1TMYA 4H4CA 2ONJA 4CR8A 2HHHL</