2R6GA

The crystal structure of the e. coli maltose transporter
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Maltose/maltodextrin import ATP-binding protein malK
publication title Crystal structure of a catalytic intermediate of the maltose transporter.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2r6gA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r6gA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2r6gA01
2E75C 2JK8A 2VQFQ 1AIPA 1YKSA 1E2NA 3NEYA 5E7JA 1N6OA 3TAUA 1DAIA 1VQIA 1ZUHA 2J41A 4P33A 1JJGA 2RHMA 2X2FA 3EAQA 4QQBX 3OE7D 3SOPA 2WWYA 2FPMA 4PR0A 1QJOA 5FBQB 4AIIA 5AJWA 1MOZA 1W2HA 1WDTA 1WXQA 1XF9A 2ZRHA 3GQBA 2A9KA 5IK2A 5FPYA 4LFCL 2DB3A 3KQNA 2NZJA 4XH9B 1AKYA 3W1GA 2GF0A 1IY2A 4FW9A 3UWOA 4Z1MD 1TQ6A 2Z4SA 2ZI9A 1GVPA 4BFWA 721PA 4BWYA 3B9QA 2KBNA 1Z6XA 1N33Q 2CE2X 5LB2A 4TYYA 3HR8A 4EFNA 5KOYA 2YWFA 2WKQA 4APVA 2QL6A 2ZJBA 3CR8A 5DI9A 3M7NA 4NU0A 3KF8B 1PVOA 1P5ZB 3GLHA 4HI0E 1N5LA 1XNRQ 1D5CA 2DY1A 1RE0A 1IY0A 1GUTA 1TUIA 4TZ0A 4JLMA 1A0IA 1NY5A 1A8VA 3HOVG 1Q12A 1G41A 1EX7A 1N5KA 4DSOA 2IF2A 1P8LA 3A5ZB 1YHQA 2JJ8A 2N1BA 3PENA 5HKKD 5JJKA 1GUAA 2ZI5A 3SYLA 4B48A 4QKQA 1TTTA 1E79A 1L1OA 2OE2A 3CW2C 4YXWA 3BRWD 1FR3A 3FHOA 3GJ3A 5M5WH 1XTSA 5AJZA 2KCTA 2JA5H 1UE7A 3I7FA 1TF7A 3W8RA 4MKGA 1A82A 2AWOA 4GNXC 3KQKA 2P6RA 1IYUA 2BA0A 4P4TA 3SNHA 621PA 1RFLA 4AKGA 1DGSA 4ZKEA 4HAVA 4X62Q 4TL9A 4ACBA 2K5HA 2WB1E 5GJBA 1G8FA 4LJZC 4BFTA 2R6GA 1QUQB 3EIHA 3KXLA 4QNRA 3K0AB 1YZGA 5JS8A 3S1AA 2ZRNA 3EC1A 2C96A 5HY6A 4B3SQ 3CNNA 5FI0B 2JA6G 2Q9CA 2YTVA 4MYHA 3SHWA 5H1SE 2W0MA 2JJ2A 1ZCBA 2K14A 4B3XA 1PHJA 2UZIR 2PNHA 2F1IA 1D9XA 4LCBA 3TEHB 5FJ8H 1MR3F 1SR3A 4C2MH 4GPTA 1E2IA 1KO7A 1Y1WH 1KJYA 2L0XA 2NN6I 4GBMA 3WBJA 2B7CA 1NN0A 4PC6A 3H1TA 4PPGA 1E9RA 1VF5C 5G41A 3PJRA 3T1YQ 4URUR 3C5HA 3BFVA 4GKJQ 1G16A 1AM4D 1HZAA 2WJYA 4Q9HA 3RS4A 3TR5A 2JLXA 1P2TA 1SMYC 1G7CA 1XMVA 3VR3A 1P2SA 3HOUG 1K8GA 4B76A 2QBYA 2FSFA 4TL7A 1OT3A 4BLQA 1KI9A 4GOKA 3RS5A 3W3ZB 1KK3A 1HEIA 4EPRA 1EYGA 1NN1A 4GL2A 2OXRA 3NIBA 4N3NA 3KFUA 4PHTA 3UIEA 2JA9A 1OYWA 2G0TA 4BZXA 1S3GA 1VYTA 2YOHA 2ZI3A 3FYHA 4A3LH 5CLQA 4POFA 3R9IA 3W5IA 2BMFA 3HOXH 1T0HB 3DZDA 4ASUA 1N36L 1C7YA 2JA1A 3TAHA 3MJHA 3BXZA 1H9SA 1BO6A 5TMPA 1XTDA 1JAHA 1SKQA 3TSOA 1X86B 3A4NA 2W6JD 1L7VC 1KI6B 1M2OB 2VF8A 4HDOB 3LY5A 3G71A 2C9CA 2IA5A 3ZJYA 1VCIA 2CK3A 1JPJA 2VP5A 4BZPA 1ZNWA 4D4KA 4LNQA 1FX0A 4C0BA 4D0NA 2O8DB 3E9HA 2UXBQ 1H8HA 1HQYE 2R6DA 4RSGA 1ZD8A 1UKVY 3SI7A 3T1TA 2ZAOA 3I8SA 2QY9A 2A7QA 4GZLA 5J40A 3BC1A 2R65A 2ZEJA 3HYRA 1FUUA 1ZKOA 5KNBA 2VA8A 2AXNA 1X56A 5IDVA 5J47A 3Q8DA 3KKQA 1GKIA 3CIOA 2QAGA 2A5YB 4OO1I 4H9GA 2UUCL 4TWZA 2WJJA 5E7MA 3WYGA 2CHQA 4DR6L 3I73A 1VIYA 1ZUNB 2E9SA 4MQBA 4LFBL 3OIYA 3E2IA 3K0FB 2HLDD 1I6VC 3D0FA 2K4KA 2G6BA 4PQYA 1N25A 2ZTEA 5B57C 3I5XA 1E9EA 4GMDA 3MXUA 2ATWA 4LPKA 2BKUA 4ZPXA 3FKSA 2FWRA 1CTQA 2VHJA 2A68D 5IP9G 5AJ3Q 3LBNA 3HOZH 3N2EA 2YYZA 5JJIA 3LA6A 5DIFA 4QFMA 4DUZL 5TXGA 1EESA 1DO2A 1G3QA 2CHVA 4QGAA 1MKYA 4W7SA 1EWHA 2R2AA 1LB1B 2QA4A 3A1SA 3S14H 1WE2A 3KOJA 1P4SA 3GEEA 5IK2D 1TKWB 2Q21A 1TWCH 3U5ZB 1SVMA 4U02A 4NCHA 2GAAA 4M1SA 1T3SA 4DSUA 2V1UA 3AVYA 5C44H 2B8GA 1U0JA 2D2EA 1JQJC 2FFBA 3PIPA 1RRCA 4MDFA 1GUGA 1WF3A 4KLNA 2I4IA 3GCGA 4G0NA 3ZLJA 2Z83A 3PQCA 4IVQA 4DLSA 2PNRC 3REGA 3FHCB 1Q0UA 1XTIA 3QY0A 4PX9A 4UPAA 2CLCX 4RD2A 3CRRA 2G9NA 3ICQB 4YWLA 3TQYA 1E24A 1G6HA 2PJZA 2JA8G 4KBGA 4PC3A 1WCMH 1F5NA 2FH5B 3AF2A 4DLTA 2F3IA 1R0YA 1VG1A 4LOAA 2ZM6L 2QPAA 3GJ4A 4AYBE 1E79D 1QHNA 3VNVA 2AN9A 4NYIR 4V0KA 2MMCA 1N6LA 4EPTA 1YJNA 2DWQA 2QI9C 1MO4A 1Z08A 2QN6A 3LRPA 3Q85A 4MTNA 4JLJA 1EQRA 2OLKA 4JBMA 2HV8A 2UVQA 1E1TA 1Z28A 2D7DA 3CRW1 1W44A 1YZQA 4NYJQ 5GVRA 1UBGA 4F38A 4DV0L 1CU1A 3HFZB 4IOLA 3V4RA 2R7ZH 4W5JA 4C7OB 3IPXA 2N46A 3NDPA 3W6NA 4BFUA 3A5UA 3CD6A 1RKBA 3LD9A 3QG5A 1OB2A 4EAQA 1XD8A 3I4MH 2ZR7A 3BZCA 1JPNA 3HU2A 3T12A 5FTKA 2ZRPA 4DRZA 3I56A 1GNQA 2GVBA 1XMQL 1PUIA 4HZIA 1KQSA 1G21E 1I94L 1FUKA 2J0SA 1ZRHA 2D62A 2A1AA 2WWGA 4B3DA 4K81B 1T5IA 2PCLA 3EA0A 4HAXA 4DSNA 1KSFX 1OXUA 1RVDA 2FZLA 1W3SA 2K75A 2J45A 2O0HA 2WAXA 1D2NA 3KLRA 3A1WA 3HU1A 4EFMA 1DAMA 1OH6A 1HNXL 4IPHA 1GUSA 1XMIA 4B75A 3AEVA 2ORIA 4HATA 4TSFA 1A7JA 4C3HH 2RF4A 3BIFA 4DJTA 1FGUA 4DKAC 1NVUQ 2J5XA 3B1ZA 2BBTA 2O5JC 1I4DD 3ZVRA 4FMBB 1WQ1R 2E2IH 1E2KA 3A1UA 4LUZA 2GILA 4DV5Q 5DISB 4BFZA 4ESVA 4F4CA 4IDPA 3QIAA 1Q90A 1YR6A 4NZYA 2D0PA 3B1WA 2DN8A 3KTAA 4PFSA 1KHIA 4BGDA 4P31A 1U9IC 4BLSA 1ZD1A 4LJ7A 2JA5G 1OJLA 2GWHA 1QG2A 3QNUA 1Z9FA 4KU4A 4RFSA 2R92H 3PUZA 2UXDQ 1VPLA 1L4YA 1BBWA 3CW2A 1XXHB 3OTOQ 4DR5L 2BKEA 3QVUA 4Q4AA 3SU8A 1LABA 4JSTA 2ATXA 1GRNA 1Y8NB 1GKHA 2IXFA 5KO2A 3ZYCA 3FMIA 2UXCQ 1WFQA 4WW0A 3HKZG 4GNXA 2F1HA 4YMWA 2EFEB 1HE1C 3TQCA 4E22A 2JXMB 2EVWX 4JLNA 1S96A 2EJMA 1Z0DA 1KDTA 4LPSA 2NZHA 2CK3D 3D4RA 2XOKA 1G1MA 1XBTA 2YOFA 5M04A 1AJEA 4A82A 3CPEA 2MSDB 2P6UA 4A3CH 4CVNA 5F3WB 5FJ8G 1E0KA 2OFWA 1NE3A 3THOA 3SQXA 3NVAA 2O0JA 3QG1A 2CQOA 1Y1WG 4Q66C 5SZIA 3QKTA 3M9BA 1SLJA 1XU4A 4LF6Q 3DEFA 3VR6A 1JT8A 2ZSEA 5AUQA 3U44B 2ZR0A 5EZ5A 3TVDA 1OKKA 1G5RA 1Z29A 2DR3A 2EIFA 1QVRA 3SC3A 2OQKA 3SFVA 3LH5A 5BR8Q 4UKDA 3T1QA 1XPUA 3H86A 2VO1A 5D3MB 1UKYA 4GNKA 5IT9c 3FKSD 3FFBA 4IHQA 1HH2P 3NH9A 5CLLA 1TXYA 4LX0A 3WYFA 5FL3A 3EW9A 3K0CC 3BAFA 4A36A 1SZPA 2BEJA 2GAOA 121PA 3DHWC 1JEEA 4KYUA 2O8BA 3UG6A 2A6ED 1YEZA 4B71A 1M1KC 1L8QA 1ZD9A 3PUWA 4IPDA 4OBEA 5FTJA 3KF6A 2E2HH 1A2BA 2ZE8A 4A3LG 2IXEA 3J81j 3NEJA 4HLQB 3HOXG 2H16A 3VKGA 4HJ5A 3ZS9A 1LY1A 3B5JA 1FFHA 3WP1B 5EE1A 2A5DA 4EPXA 1ASYA 3CO5A 3CR7A 3SBEA 1N6IA 5KYKA 2JE6I 1ONLA 3CCMA 3S1RH 3AFQA 2G83A 2PX0A 2W6IA 3PITA 4TMTA 1CJUC 2Q3FA 4BFSA 4DUGA 4KV9A 2QM7A 4LWZA 4M1MA 4DEYA 1CBUA 3BOSA 3RVBA 1OYYA 2G88A 2A8VA 4JBKA 4NMMA 5JEDA 3OAAA 2PEYA 2ZSAA 4DDWA 2DBYA 2JASA 4Q1AA 3T51B 2JAQA 2ZSFA 2P67A 2B8WA 2NVXH 2UZ3A 2TMKA 3PO2H 4DDVA 4EPYA 4Z8XA 3NELA 4DR4L 1QHHA 3GJ7A 2SHKA 4US2R 3CF5A 3NHAA 3EIQA 4A75A 4HAWA 1OXVA 4BBRH 2WAQG 1MABB 1XEWX 3CH4B 3GLFA 1OTCA 1P16A 3K09C 4NTZA 4ACAA 1YIJA 4PV1C 3CRQA 1KY3A 2PPBC 1W36C 4OK5A 3H3VI 3HOZG 1G64A 4UXJA 1A62A 1XWIA 4UNPA 3O47A 1PA6A 2QMUA 3NKVA 5E7IA 1OIWA 1IXZA 2I5MX 3H0KA 1I5FA 1M74A 1KMHA 3MWLA 2R8RA 4DK0A 1YJ5A 5DN6A 5H68A 2PI2E 1Z6YA 1A5TA 3UMRA 3AFPA 4ERNA 1JXMA 1YHNA 2YC4C 4H1VA 5C44G 1NVVQ 4L5RC 3L0IB 2V4ZA 1KO8A 2J9RA 1FPMA 4KLZA 2JGNA 3T15A 2HJGA 2XTNA 2OCEA 5J4VA 5JWHA 1E1RA 5JHGB 4UP9A 1XJCA 2PQAB 4HB2A 4QM7A 2Q2IA 1OV4A 1RZ3A 2Q8IB 1OFHA 3AVOA 4TSFD 3ADCA 1E2ZA 1KZ7B 1FQKA 2ZANA 3VFDA 4Q02A 1UEJA 2DWOA 2EFHB 2QQ0A 1Y1VH 1R5BA 4V0LA 1WCMG 3TZUA 4IO9A 1OFTA 2IEYA 4M1OA 2IS2A 1QVGA 5HCNA 1MIUA 3QF7A 4WA7A 3HU3A 4F4JA 2XTMA 4ON9A 1N3BA 4EQ6B 4IEEA 3AVVA 4WZBE 4LUVA 4Q4JB 2VZAA 2V6IA 5EJEA 4V03A 4F7WA 5JEAH 4HB0A 3EX7C 4I99A 3SYKA 5IYBH 1IW7D 3G4SA 3I4OA 4HDQB 2J59A 3PR1A 1XJ0A 1E0SA 2ZE5A 2R7ZG 1CIPA 4UP7A 3TW4A 4C0KA 4TYWA 2QQEA 4CGZA 4BLOA 4V0ME 4IFDH 3I4MG 4IDNA 4TMWA 3GTPH 5FH9A 4DCNA 1AK2A 4AYTA 2QORA 1NP6A 4BFVA 3HR7A 4GN5A 1EOVA 2XOKD 1ZC3A 4LYAA 1XEXB 2C03A 5FUXA 2OZEA 821PA 1XD2B 2VP0A 3BB1A 4GSYA 3EIVA 4XJXA 1L0WA 2NVQH 1KO5A 3AM1A 3SN6A 4B2IA 1XMOQ 1AE3A 1RYHA 5G40A 2Q2HA 1OXXK 1GJXA 1E2FA 3IHWA 5G53C 4BQSA 1S1CA 3FOZA 1BH2A 2OSBA 1Q8KA 4B3MQ 3R8CA 2FG5A 5JEAJ 3X2SA 3O8RA 2VRWA 2QP9X 2YWGA 1T6NA 2ZROA 3LNCA 2CW0C 4ZDKA 2YU9H 2IX1A 3M85A 4TLAA 3U7EB 2V3CC 2BM0A 1VQ4A 1EFTA 2MO1A 3OESA 1O87A 1YRBA 1QVAA 1X8LA 3U9SA 4EQ5A 1G4AE 2QTFA 2PMKA 4OWXB 2GXQA 4IFDJ 1G3MA 4FMCB 4YC7A 2PCFB 3E5HA 4ABYA 3RHFA 1PYSB 2YVUA 4M9SA 3Q5EA 3LQRA 1LS1A 3KXKA 1CRPA 3KJHA 5JSZA 3RRNA 4C0JA 1VG0B 4TL6A 3LFUA 4M53A 1JR6A 3MGCA 2PI2A 3STBC 1RJ9A 4GRAA 3DKPA 1VCMA 4M1YA 1EFUA 3CPWA 2R92G 3HOYH 1I4TD 2IS1A 4W5HA 4JVNA 4LJAA 1J5EQ 3FMOB 3OEEA 5JI3E 1PLJA 3TREA 2DPXA 1U9IA 1B7YB 2LXJA 4QXAA 1ZW6A 3MCAA 2BOVA 2H7VA 4AG6A 4LF8L 3GJ8A 1XFAA 3AF3A 1TU4A 1YR9A 3SGIA 1N0WA 2W6ID 3L0PA 4MITA 3QXXA 2HYDA 4JLDA 1UAAA 3TVTA 5DI3A 4FN5A 3RRZA 4TLDA 3J7ZC 2BC9A 5FR1A 2WOOA 4JI0Q 3MXNB 1Z2CA 4HLDA 3CF2A 4RY2A 4A3CG 1E9BA 5IHPA 3PGZA 1IM2A 3OAAD 2FFQA 2V1XA 3OIVA 1VIAA 2O52A 1AGRA 2EW1A 3JVUA 3U6BA 4DR2L 1NY6A 1I3QH 2BMJA 2ZJ2A 4GZMA 3ADBA 5ANRB 4B3FX 1Q81C 2WSMA 1G18A 2XB2A 3X1WA 4Z1MA 4X65L 4NYJR 3VR2A 4JVLA 3SE0A 2IY5B 3QBTA 4PZZA 4V0MA 4XWOA 4GLXA 1ZCAA 1Z7TA 1IYJB 2OLJA 4JLPA 1K5GA 1LUZA 1JJ7A 1OFIA 2FFHA 4JI1Q 4LBWA 2J0UA 3DKVA 3GLGB 1AS2A 3AVWA 3KQLA 2NVTH 4RCYA 1EFRA 1AN0A 3M4PA 3KJOA 3THYA 2IYUA 2KB0A 3QF4A 2XNDA 4CT5A 1A6XA 2V6JA 3EASA 3EZ2A 3K0CA 3UDIA 4PQFA 5DN6D 3KUCA 1WB9A 3T5GA 2NQ2C 4CT4B 3VHLB 2ONJA 4TVAB 1GTVA 1ZYUA 4NXMQ 2VP2A 1XCGB 2WBLC 3I4LA 1N34Q 4L8JA 2J7PD 2QMHA 1MO6A 1M7BA 5ELOA 1F3OA 1QHGA 3B9PA 3N5CA 1IAQA 4MGYR 5KSYA 1EQQA 3OOCA 2P2LA 3L82B 1E1RD 2ASBA 1AE2A 1KIXA 1AH9A 2UUAQ 1BMFD 2VQEQ 1QHIA 2KA7A 2QA5A 4G5QA 4JBYA 3VU9A 2GJ9A 4QL3A 4DV2L 5DGXA 3REFA 1TWFH 2GEUA 4O2RA 2WKPA 5L3RA 2F4VQ 1LF0A 4DV3Q 4JJKA 5J4LA 3LXXA 1DG3A 3MSXA 1NTGA 1FTNA 4DB2A 1IBLL 1F2TB 1IYVA 1QDEA 3GFTA 1E2VA 5AJYA 4HIDA 3P4YA 3FMFA 1VKJA 3H94A 2ZJQA 2X1VA 4LHZA 1QBKC 4B3TQ 3OHMA 3X1ZA 4J0QA 4BBRG 4IPGA 4DV1Q 1N5IA 1TQDA 4OJKA 4X64L 4Q4HB 1KC8C 5G3ZA 1NMXA 4CEJA 2E76C 2QM8A 1F2UA 2Q3HA 2ZRCA 3WP0A 2QNRA 3ZD7A 1GAJA 5D3QA 2AKWB 4R4TA 4P74A 1HE8B 5GJVC 1HJPA 4PHFA 5GAEC 2IHFA 3O8DA 4XD7D 4DDUA 5F2EA 3K09A 4Y0AA 4ZDJA 1TEXA 3FPPA 4F91B 1W4RA 3OZXA 2VSOA 3DOEA 1A1VA 1G3RA 4Q4LA 1VQDA 3CONA 4ITRC 1CSPA 4NCIA 4PSKA 3VKHA 2VS1A 4DNIA 3OW7A 3KDFB 3B82A 1HTWA 2HYIC 4MKHA 2ZSDA 2CLDX 3A74A 3NTUA 3U3RA 1GL9B 2Q6TA 5EP4A 2ODBA 2KE5A 3ZZTA 2QSZA 2GEVA 4KITB 2FFAA 3VA7A 1BKDR 2E5LQ 3P4XA 5M3FH 5K36H 4JI6Q 1JB1A 2BJVA 1FP7A 5KSOA 3X1DA 3CCRA 1KDOA 4Q9IA 1Y1VG 3HKZE 1DPFA 2VLIA 2WAYA 2GESA 1ZJ6A 3KQHA 3I5YA 1GOTA 2VSFA 1J99A 1E94E 2O8CA 1K8AC 3IBGA 4YCWA 1XTJA 3L0OA 2Z0SA 4TN1A 1H9MA 2CLSA 2WPDA 3RANA 2IW3A 2P0EA 1A4RA 5GJWC 2IUSA 1ZNXA 2QTVB 3LWNA 3CRLC 5JEAG 2NN6H 1EIFA 1XEFA 2X19A 4HZUA 5IYBG 3GTLH 1OHHA 3UE1A 3EZ6A 2LXKA 2IYLD 4NKRA 1R0ZA 3P27A 4EKDA 2I1QA 3IFTA 3OEED 5LD2C 1QRAA 5FTNA 2ZJPA 1CR0A 3OYYA 4Q19A 5EQTA 2NMVA 3FKQA 2CKZB 4B2PA 3A1TA 2KENA 3W1BA 1Y63A 4NCNA 1TQ4A 2CL0X 4OHYA 4IFDG 4Q1EA 3W34A 4TQAA 2V55B 3RN2A 5CM9C 4DAYB 4MGZR 5FOXA 1ZM7A 1CKEA 3ERSX 4JYAQ 1YR7A 1AKEA 4Q7JB 3K9HA 3K70B 4LW1A 4FWTA 2ZTCA 1E2MA 3QKSB 4LZZA 4GZYC 2KHIA 4RD1A 4A93H 1K73C 1K8RA 4HUQB 4KFSA 2MSCB 2PX3A 3L8YA 1K5DA 1MJCA 2MFIA 3SDZA 4UNQA 3AKCA 1II0A 1XTRA 3B7GA 4UY8C 4B43A 2XXAB 1IBKQ 3GEIA 3BG3A 3RSOA 3PV0A 3RLFA 5HE9A 3TRZA 1XJQA 3NDBB 1V1QA 3IIKA 3IHLA 4JI7Q 2RHQB 3GTQH 2Q3MA 2XZPA 4JI8L 2ZUBA 4X62L 3CCEA 4M9QA 3F3YA 4EJSB 1N6NA 3HGBA 1AQUA 4K0KL 4RMFA 2YWHA 1FJGL 4I1VA 4D82A 1KDPA 4JSYA 4IFEA 3MWJA 2GTPA 1EFRD 4B3SL 1W0KA 1Q1ZA 1AZTA 2XNDD 2JLUA 3HOYG 4OO1H 3CCLA 3GPLA 4NH0A 5SZJA 1SGWA 3E70C 3AKYA 1DADA 2J87A 1I4LD 1R8SA 2CVHA 4PPFA 1E1OA 4PQRA 4NE2A 2NG1A 1R5NA 3B13B 3LX5A 1PLLA 1RIPA 2RCNA 2HHHL 2UUBL 4JI2L 1T3HA 2C5LA 2NPIA 3CNLA 5TARA 4D4LA 4NB3A 5HZKA 2WAQE 3ECCA 1VF7A 5LMUQ 1YJWA 1IW7C 1UKEA 2V1CC 1ZP6A 1CKOA 2ZR9A 4GKJL 1GP2A 4LY6A 3RS2A 2NZ8A 1OFUX 3PEYA 1K0RA 4C3IH 1OF1A 3WXMA 2O8FA 1EX6A 2ANBA 3BB3A 3QEJA 3QKUA 4JKIA 4BY1H 2QT1A 3EPJA 2FE4A 5AUOB 4LFAQ 1IBML 1FOEB 1VCOA 4QGUA 3PEVA 2GK6A 4IRUB 4DUYL 3U4VA 1M6NA 1UEBA 2IYYA 2OCBA 3RS0A 3GLIB 2GCOB 3AVPA 1FNMA 1QHYA 2AD5A 3T1HL 1ZNYA 2NTYC 4II7A 3RS3A 2Z6KC 2QMEA 5JRZA 4FXPA 4DC9A 1CKNB 1AA9A 2EYQA 1XTKA 1B9MA 3B1YA 2W0SA 2XGTA 1B8AA 2C35B 4G01B 3QXSA 3LV8A 1KAWA 1DEKA 5KDOA 3U7FB 4JV5Q 1Q57A 4PANA 4TTPA 3U50C 1KI1A 1M7GA 1U81A 1E99A 2BMDA 3UANA 2L5TA 1IJEA 4TMKA 1WJJA 1NF3A 2A69C 1S0UA 1KAOA 2DYKA 2R7FA 3LO5A 4TQ9A 4DXAA 1W36D 2B29A 3M6AA 4KSCA 4KLKA 3C8UA 1VMAA 2ODNA 2ORVA 2FEOA 2ZRBA 3BGWA 1SXJC 1TF2A 2C2HA 2F43B 4KMUC 1VQ9A 4DR7Q 2CJWB 2KBEA 3DMNA 4CEIA 2CL7X 3CB4A 2OCAA 2ZU6A 3IKJA 2Z6VA 3T06B 2WJIA 3NC0C 1R0XA 4A8JB 3GTKH 3AGPA 5FL7A 2FV8A 1GILA 4GN4B 4QL5A 5L3SA 2HCJB 3GJXC 2NO1A 1HT1E 5BN3A 1KRTA 1J6QA 3JZMA 4IOKA 4Q7MB 1E9CA 2QSYA 3GD7A 1ODFA 4Q48A 2YTYA 1F6BA 3LVRE 4A3JG 2BDTA 4PZ7A 2W83A 4R4CA 4IVRA 2NIPA 3ONWA 4PSVA 4JK1C 2WJVA 5TV2A 2WPDD 3UXMA 4YHHL 4B44A 2HIXA 1RYFA 4DV7L 2GNOA 4OK6A 3NENA 4KHZA 2AFHE 4UJ3A 5JHHB 1NJFA 1OHHD 1EK0A 4KXFB 1LM0A 5FLMH 4A4IA 1NBME 2IX0A 4JC0A 1PZNA 3FKIG 4OL0A 4RZ2A 4B32A 2AK2A 3CH5A 4CW7A 5GAHC 4A3FH 1CJVC 1YQTA 3D3QA 3AUYA 1QHXA 3UATA 3IUYA 4A3MH 2PZGA 4C9BA 3OFND 3F2BA 3M4OH 2HUPA 2FF7A 5KTYA 3PO3H 3BBPA 3RC8A 3TSZA 4AC9A 4GOPB 1JJ2A 1MH1A 3LBHA 1P61B 5TDHA 4X66Q 2ZPTX 2G3YA 1R7RA 2D2CC 4PSAA 5JRJA 1NSTA 4B74A 3AEZA 3VAAA 1E3MA 1S4QA 2ODWA 3U3JA 2W2XA 3U60B 2GZDA 3U3OA 3RAPR 4WXRA 5M3FG 5K36G 4PHGA 1ZU5A 3SR0A 3T5DA 1RPZA 3AUXA 1YI2A 4A3IH 2VHUA 3AF0A 3CCQA 1VQNA 3CMEA 4LF9L 4P75A 3NBHB 4B33A 4HAYA 2IYRA 3H84A 4D80A 5C2JB 4A3KH 3LXRA 1VYUA 1X3FA 4H0LC 1SN8A 2WWWA 4POGA 5K8TA 2BDOA 1XD9A 4NYMR 3KDSE 1NVVR 4QM6A 1KL9A 2EFDB 4DV6L 4OX9L 3CX6A 2LSSA 1W0KD 3UKDA 2NN6G 2DCUA 1GL7A 3WRXC 4B3CA 4HUTA 1N36Q 1I2MA 1SQ5A 1U8AA 3CP0A 4Y7NH 1U8ZA 3ADKA 3A4MA 3B85A 3CLVA 3Q9LA 4QJ3A 3STBD 3TS2A 4L9SA 4O0MA 1UBEA 4ZIRB 2WFWA 1R0WA 3B2EA 5M3MH 4YMVA 2ZUCA 3CMAA 5LMNW 1KIMA 1FYCA 2GJAA 4TL8A 3D8BA 3U4QA 2BH8A 3MMPA 4TLEA 1OPXA 5H70A 1S72A 2XSZD 3L8ZA 3EPKA 1VS0A 4HLCA 1G6PA 5CDFE 2EDGA 4B6FA 3R7WB 3HPQA 2VNUD 3BU2A 5GVSA 3I62A 1MKHA 4FI3C 3THXB 1V43A 3IO5A 4DLUA 4IOJA 5KDLA 1P7CA 4A93G 1OIXA 3NBFA 4O2LA 3VTKA 1IN8A 4DSTA 2UUCQ 4MKIA 4BPBA 5IRCD 4W9MC 4QJ5A 2EFCB 2O8EA 4DR6Q 5FPTA 3H0GG 1EWRA 2GVAA 4LFBQ 1SXJE 4RFVA 4DT1A 1OE0A 2BJWA 3CZQA 4DHEA 1GSIA 4BRUA 2UXDL 1DXMA 1NBMA 3OTOL 2K5UA 2NO7A 4RG1A 4MA4A 2KCMA 1YU9A 2Q9AA 4H13C 1CJKC 3M3YH 3PEWA 3BH6A 1ASZA 4YMSA 2DFLA 1FZQA 3U4ZA 2VY3A 1SHZA 3KKOA 4AYWA 4AY2A 1Q7YC 1CI3M 5EAYA 2QU8A 2ZJOA 5JS7A 4HLUC 3CX7A 5EE3A 2BHRA 3ZH9B 2UU9L 4JI5L 2P6NA 1HTPA 1NLZA 4ARZB 4OO1G 3CUEF 4AK9A 5FOWA 2O0KA 4WJ4A 4KHPL 2WIAA 5JCPA 3ZVNA 1G5PA 3VNUA 3TS0A 5CB6A 1N6RA 4GKKL 2F52A 4GI7A 3ADDA 4MH0R 1P9NA 3F2DA 1RRPA 3H3VH 3UMFA 2BBSA 5FL7D 3NBYC 5KPDA 1GITA 2H18A 1Q20A 4MUAA 2GDJA 2REBA 1Q1BA 1CRQA 2ZM6Q 1E0JA 2A5JA 4BY1G 1TU2B 2J3EA 4RD4A 1OB5A 2K32A 4O0AA 3BFXA 3BFKA 1U98A 4XWAA 4CEHB 3A8JE 4HYYA 5BWMA 1NRJB 1US8B 2WMOB 1R10A 1PH2A 2REOA 2IYXA 4ZCIA 5JECA 4LHVA 1ONBA 5A5GA 3DOFA 1I50H 2BCGY 2WOJA 2VYFA 5L3QB 3AVTA 2XJ4A 1CEEA 1X65A 5LMNL 3KB2A 2OTJA 1AGPA 4URVR 2EJGC 4DV0Q 1LNZA 1XZQA 5FPHA 1J8MF 4BUJA 3MD0A 4PC1A 4QG7A 2Z6KA 4Z54A 4QGGA 4B3GA 1AS3A 1P6XA 1M1YE 1PJRA 1UJ2A 4A0FA 2IF0A 3AGQA 1UEIA 1H8EA 1CR4A 1DELA 4BE7B 4IFBA 1W4AA 1QG4A 2JCSA 3ASYA 3AVQA 1TF5A 4AURA 1I94Q 1N0VC 2ZRJA 5CDFA 3PUVA 2JLRA 5IWAL 2J46A 3L7ZC 4KVGA 4US0R 4A6XA 1OLOA 1G4UR 1G51A 2AHOA 5A4JA 3AVXA 2HDNB 3LQQA 1BOFA 1SVWA 2ERXA 2PL3A 4IKEA 1HNXQ 4P4SA 2PMZE 3B1XA 1EGAA 421PA 2GJ8A 1P9WA 1PH4A 1SXJA 4HAZA 4JT2A 1W49A 3S1NH 2ZS9A 4DIEA 3RN5A 3ER0A 1OXSC 1JMCA 3VMFA 4OYHA 1G7SA 3X1YA 3BH0A 3PUYA 3M4QA 2VPPA 1YZTA 4HSEA 3Q7PA 1G291 3VR1A 4RD3A 5FBWB 5CB8A 1PLKA 1VQ6A 5IE8A 4DCTA 2NO0A 1CSQA 1E9DA 1TU3A 3K7AH 2ZI7A 4MRPA 4FMCF 4M22A 1R6BX 1GUNA 4LHYA 2JJQA 4DR5Q 2C8VA 4MZ9A 2CCGA 3CPHA 2YKGA 3AKEA 3HOWH 2WJHA 4M1TA 4ALPA 4BLTA 4QBHA 5FLMG 4Y52H 2ASEA 2PT7A 4JI3Q 1VQEA 1MJEA 1NMZA 2IYQA 1D2MA 3O8BA 4A3FG 4A4DA 3LW8A 1NN5A 2O5IC 5IY0A 1H9JA 2WZQA 1BVSA 1VDZA 1U2RA 1WA5A 4A3MG 1KNQA 1YR8A 2FJUA 2FPLA 2GZHA 1XRJA 2Y0SG 3J80i 3UDGA 2YJTD 2ZS8A 2ZYVX 4L4UA 4LGMA 4DCUA 3PG5A 4OI0A 2RGXA 3PO3G 1VQJA 1Z6GA 1WYDA 4URYR 5CITA 2ZRMA 1G7RA 3G48A 1KI8A 3I32A 3GTJH 3KFVA 4KFUA 3VX4A 1U94A 2H8KA 4PC2A 3ZD6A 4DEXA 221PA 2LMCB 1QZGA 3U7HB 1IN5A 2ERYA 4LHWA 5C4JH 3J80c 4LF7L 5FBVB 4JKYA 4J15A 1DD2A 2B21A 1YE8A 1SKYB 2BIFA 2IEZA 4Q9LA 1YNNC 4O25A 1CFMA 4KI0A 1D9ZA 4BEBA 4A3IG 4KBFA 4R2IA 5EP1A 3VQTA 4B34A 1NBMD 3E0EA 2NO9A 4LYFA 1C0AA 1E2EA 1VECA 2ZE6A 3KKNA 1CXZA 1NG1A 2ALYB 1E2DA 4HB3A 4LHXA 2WJGA 2XAUA 3CKLA 3IEVA 1S3OA 2PMDA 4A3KG 4LF5L 2J7PA 4M1WA 4S2EA 1T8UA 3GLHB 1CULC 2A5GA 1CJMA 4B2LA 4H02A 2XGJA 4H1UA 4RZ3A 1QUQA 1HNWL 1RC8A 1HR0W 1UM8A 3K0XA 3CWZA 1BMFA 2ES2A 2F6RA 3K0AA 4LV8B 4TMXA 4ZKDA 4DR1L 1COWD 3C7KA 1W4BA 3IDQA 4A15A 3WNBA 3FMCA 3FGNA 1N32L 4CDGA 2FDCA 2DFKB 2DUDA 1G6OA 4LJYA 5TB5A 3B60A 1WP9A 3Q8XB 3RNLA 1NG9A 2MQHA 4U00A 4UJ5A 1L1OB 1HNZL 4WIAA 2JLWA 3WMGA 1EWQA 5M3MG 4L15A 5L8VA 5UKDA 5KHOC 1UE6A 2JJ1D 3AF1A 5B30A 3FP9A 4EFLA 4R4IA 1H95A 1WBBA 4ME3A 3CRKC 1EWIA 2GETA 4M0LA 3EN2A 2OILA 2KWIA 3MAAC 1PH3A 1KJWA 1X9NA 5EP2A 4JVSB 3S1QH 1Z07A 3KFXA 3CC7A 1W4CA 1KYIA 3W3AA 1N5JA 2XNSA 1QZXA 4U7DA 4DR4Q 5FTMA 4QGHA 1M8PA 4OHXA 3VR4A 3KYHC 1UFQA 4DNTB 4R98A 4XD7A 3EIEA 2ZITA 5SZHB 3S1AB 3WNCA 1ZIOA 1IL2A 4KVAA 1TWAH 2H92A 4HJ8A 2WWXA 1IQPA 4OQLA 2ZYTX 3EARA 2CEAA 4A0GA 2I5HA 4LJ4A 4Q01A 3SZRA 3I55A 2D7CA 2FSGA 4TMVA 2N3SA 1KHTA 4BASA 2XZLA 1EUJA 1SULA 1W0JA 2IWRA 4I1UA 4B3BA 4GOJA 5C46F 2LKCA 5CK5A 2IUUA 4KFRA 4P0TA 1KI6A 1H8ED 4JCVE 5J4KA 3S15H 3R9WA 1XDBA 2A19A 4DV4L 4YY3L 1FTSA 3A0JA 1UKZA 1X3GA 3CC4A 2O8DA 1IN7A 4XOIA 1X54A 2EU8A 4G5GA 3WMEA 4B3RL 2QBYB 1KAGA 4XSHA 5IYDH 3LLMA 4C2UA 4HLUA 2XTZA 2A69D 2P65A 3D6TB 2FU5C 2WICA 4JYBA 4RCZA 4K8OA 3AB9A 1JB7A 1XCPA 3S2HH 1SXJD 2Z43A 4F4IA 5IYCH 2IHBA 1E9AA 1Z0JA 3D31A 3BJUA 2QGNA 4MDEA 1ZVQA 4AH6A 1OW3B 1Z0KA 1QF9A 2D2FA 3EA5A 2AXPA 3K0FA 3OIWA 2CCZA 5FOUA 1HR0L 1RRGA 1XNJA 1HCZA 5FOTA 2E74C 1H9SB 2RGEA 1CF4A 2OBNA 3AQQA 4MGIR 3PSIA 1Z22A 2ZIAA 4LK2A 3HDTA 1A63A 4M2LA 2IYVA 3ZGXA 1M90C 3HWSA 1FX0B 2ODEA 2C95A 4FINA 4TLBA 1DAGA 3ZDQA 3KQUA 1R8QA 3I72A 1X3SA 4OI4A 1U90A 1CJTC 3A6PC 5C0XJ 1UDXA 1N34L 1N9WA 1RL2A 3JAMi 4AQYL 5HE8A 1XNQL 1DO0A 3GO5A 5ELNA 1LS6A 1XXHE 1ZUIA 4MYCA 4DIDA 2A78A 4PAQA 4URWR 2IS4A 3WDNA 1XMSA 2VHCA 2QAGB 4Q1CA 2J0QA 5IF9A 4LWCA 2XITA 2XEXA 4H44C 4K46A 3CF0A 3K8YA 3PVSA 5C18A 4DK1A 4DV3L 4IDQA 2ID0A 4QBIA 1W1WA 3SHFA 3JAMc 4DBLC 5JEEA 3GTGH 2OCPA 3EZFA 1K3RA 2XX3A 1VTKA 2OEPA 3V00A 4PAOA 4HB4A 1R4AA 4B3TL 1N6HA 4Z8YA 3TQFA 3AVUA 4KJZA 1PV4A 2A6HC 1KZGB 4C3JH 4W5WA 2MMGA 1HURA 1RRFA 2OQ0A 4DV1L 1ELOA 4LF4Q 3NWJA 3P32A 4IDOA 5DO9A 4AYXA 2EVBA 2DNCA 4FDBA 2JLVA 3ZVLA 4QC2A 2R7DA 2GXUA 2JATA 2YC2C 3VHXA 3WYAA 4GT1A 4BECA 5CIQA 4C7OA 1EXMA 1P3JA 4DK3C 2IYZA 4F92B 1GIAA 4ZCMA 1W2GA 1TUEA 1X8KA 2H57A 4LBVA 4DR3L 2HCBA 4LV6A 2ZTDA 2GZAA 2GF9A 5EUQB 1M34E 4URZR 5JCZA 5DLQE 4U5XA 3RNUA 1QZHA 4Q03A 3BS4A 1T8TA 1ZM3A 3HOWG 4ZDWA 3U3MA 4YDHB 1O7IA 3BDOA 1UF9A 4G5OA 1QVCA 5KDDA 2ZTSA 1JXOA 2C99A 2GKSA 3JVVA 3U2QA 3GTMH 5LBIA 2A3RA 4JOIC 2A2ZA 3SJBA 4A3JH 1Q44A 1X6OA 3M0EA 1RIFA 3B78A 3S24A 3IGFA 4F93B 2F1MA 2QRZA 2RKOA 1HPCA 1Q21A 3PF4A 3MUFA 1H9KA 1UADA 4KYIB 2RH5A 4A9AA 1EFHA 3WWVA 2OM2A 4PPNA 4NXNL 2XXAA 1G20E 4ESHA 1LACA 2YV5A 1B0UA 2XB4A 2G1JA 5C0XI 3MWKA 4TT3A 3RABA 4L5TA 4DR2Q 1NMGA 4NBSA 4HIKA 2IYWA 3BE4A 3FKIH 3LNNA 3AYHB 1IXRC 5KUTA 1E22A 3SYNA 2E1RA 4JI4Q 5AJXA 4B6EA 2K52A 4DPGA 4A3DH 2KJQA 1OIVA 1JAIA 3LLUA 4FD2A 4X65Q 4YDSA 2PH1A 2QP4A 2ZYWX 6Q21A 2FMXA 4IEIA 5EXSA 3MFYA 3TGPA 3C41J 1XXHA 2HEIA 5C4XH 2CMKA 2JDIA 1LW7A 1W0JD 1Z2AA 3UE0A 4FIDA 1NIPA 1Y3AA 4MRRA 2CWPA 2HXYA 3GDEA 2ZXUA 4BLRA 1S3SA 4BLPA 5K8UA 4QHYA 4LUOA 2GCNA 2CNWA 2X77A 4L5QA 5A0FA 2AD1A 3V4FA 1A2KC 3S2DH 1NNEA 4UNSA 4KSBA 4OONA 1SKYE 2JLQA 5AUPB 3W6PA 3G6EA 2X2EA 3VR5A 1KKLA 2ZRKA 2ZRLA 4XIGS 3CWQA 3KJGA 1HT2E 1J70A 2VHTA 1P60A 2WMNB 1G9XA 3ZZ0A 2VQFL 1WBDA 1GDDA 2K33A 2FX3A 1GO3E 2FOLA 4ZDIA 2P5SA 1B70B 1D7QA 3RSLA 5M5YH 1N8RC 1IHUA 4JLVA 1OSNA 1Z8FA 3TKLA 4NPHA 4EPWA 3AF4A 3A37A 3KTAB 4JL8A 2PCJA 1II8B 3RYTC 3JC66 3U44A 2C9OA 5J3BA 1L4UA 4RFSB 5LPNA 1JI0A 1FNNA 2FN4A 5HR5A 1GM5A 2KI5A 1IBLQ 4Q4AB 1NMFA 3Q5DA 5D3MA 3DXJC 1E4YA 4P4UA 3SEAA 3TRFA 4I1OA 4MRSA 1E32A 1G8GA 2D3WA 1N33L 4NPSA 2E8GA 4GNXB 1X1RA 4R7ZA 2FSHA 3DL0A 2HJVA 1KNXA 2QF7A 3AP3A 3FMPB 3DM3A 4DLXA 4CZ2A 3F8TA 3PIRA 4DAMA 4X64Q 1XNRL 4FCVA 3S16H 2PZFA 1F48A 1NMYA 1Q22A 3OFNA 4MRVA 1GFIA 5DSZA 2RGBA 2IHYA 1P62B 1S9HA 4OI1A 4OXPA 2F3TA 2IUTA 4LDJA 3PXGA 4AKHA 1T3LA 1DVRA 2I0QA 3T61A 2WV9A 1LTLA 1L2TA 4FCWA 1GRQA 4IDHA 1E6CA 5LMUL 2AKYA 4ZCLA 4GLAC 5EE9A 1MRSA 2DFTA 2ZUDA 5J5CA 2QE7A 3H0GH 1GHJA 3RC3A 4GMXA 4TTQA 4V02A 3IPYA 1DS6A 1E2GA 2ZRFA 5IYDG 1AZSC 4QY7A 4Q9JA 3T1VA 1UPTA 2PEZA 4LFAL 1LV7A 1KTVA 2J1LA 1T0JB 1V9PA 4N0DA 1KI4A 4C0SA 4E03A 4O3MA 2O8BB 3KB1A 1TEVA 2IL1A 1CR2A 5IYCG 2VBCA 2ZQ5A 2F9MA 3B6EA 3ETLA 4WBSA 3GP8A 3KF6B 1FL9A 1YHAA 4IOAA 1YRAA 3W9YA 3R8FA 1Q46A 4O2DA 3C14C 3A7AB 3UG7A 2B8FA 1MABA 2YINC 4HJ9A 3QVVA 4PTLA 3EPHA 1JE5A 4LC1A 4JV5L 3CX8A 3QUSA 2Y0SE 3R20A 5GJCA 3RLOA 4DLRA 4Z51A 1PH5A 2GBLC 2LCFA 4FCTA 2V8OA 4BFYA 1JJVA 4IXMA 1S9DA 2ZSBA 3SJCA 1JALA 1KD1C 4D6PA 2R62A 1GUOA 2JQOA 5L3VA 1Z0AA 1FVIA 3KKPA 3T1YL 2RGNC 2IYSA 1XPRA 4WXPA 1T5LA 3I4NH 4NCJA 2H17A 2XSZA 1ZM4A 4DR7L 4CRWB 4UNRA 3SBDA 4D4MA 4TQUS 1AS0A 2QENA 2A30A 3MLEA 5EXTA 2QGZA 4IJLA 1CR1A 1UBCA 1C1YA 1P2VA 3K7UC 4JS0A 4NP6A 3T35A 2KSQA 2WSSA 3FVQA 4IOCA 1SFOH 2EXDA 3P20A 1JEDA 1QHHB 1NVXQ 1G8YA 2PQAA 4QJ4A 1E0AA 1PFSA 2PT5A 4DLYA 4ZI3A 4B35A 3LWUA 2F7SA 5TVKA 3AV0B 2BCJQ 3MRSA 3GLFB 3G82C 2BE5C 3F2CA 3TUIC 2WP8J 5C1BA 4FMDB 3BERA 4AD8A 3MWYW 4OHZA 2DGYA 1VQ7A 1JNYA 4TT3D 4GS3A 4BXXH 1G7TA 2FPKA 1OH8A 4UNNA 3I92A 3L43A 2KBFA 5AUNB 4V0NA 1KMHB 4EQ6A 4LK1C 4JJZA 2V54A 4Q4JA 1VQLA 1VQ5A 1E98A 4DK6C 3WNDA 5C3EH 4LFCQ 1E2QA 1QHSA 2I3BA 3AH8A 4EDHA 2HQLA 1PYBA 1YVCA 4JI8Q 4G5SA 4XTRA 5FR2A 3TUJC 3EBEA 4HJ7A 2UXBL 5E7NA 3EZ9A 1GNPA 2N42A 1E1QD 2BBWA 2D74A 4K0KQ 1S40A 1Z6TA 2JDID 1Z6AA 2QROA 1FJGQ 1X6VA 3HP1A 4WOPA 4X8HA 3BB4A 2EFGA 4DWJA 4D25A 3ICEA 4DZZA 1Q1QA 1KSHA 1D8LA 1JJCB 2RHSB 4QNMA 3K70C 1KKMA 1GRRA 4AWXA 3OPOA 2CNWD 5DYGA 1W2BA 4HAUA 5BN5A 3GLGE 1E9FA 1SVOA 1GVNB 1IONA 3ND8A 1XP8A 3I61A 1XEXA 1W7AA 4X66L 1XD2A 1WMSA 3ULPA 2IYTA 2UUBQ 2CVFA 2HHHQ 4HR7B 4JI2Q 4GFDA 3RRMA 3LDAA 4KKUA 3EPLA 1UWVA 3E9IA 3N2IA 3PCOB 5AJ3L 2OWOA 1P73A 1VG8A 3RZOH 4N1AA 2OUKA 2B8TA 4M21A 1KO4A 1GWNA 4CYMA 4Q21A 1RW4A 4G3XA 5E4FA 3DPUA 2IHEA 1J90A 2JA7H 5JWOA 4JL5A 3EG5A 2C78A 4EJSC 2BV3A 4JOIA 1NY4A 4BY7H 2ZETA 3FPAA 1IBMQ 1VQBA 3AKDA 1TWGH 1HYQA 1D6JA 3FDIA 3OIUA 4DUYQ 4OJQA 3BH7A 1YNJC 3U58A 4Q47A 4KKSA 1SE8A 2QZ4A 3NXSA 3OEHA 2JIZD 2QRNA 4TYQA 5BYKA 4YCUA 3T1HQ 5KSPA 1P2UA 2VHQA 3J81i 2NPFA 4BEJA 5ELXA 2IS6A 2VL6A 1H9RA 3DM5A 3NG1A 4L8GA 4A3DG 3Q7QA 3T53B 1E9SA 2FZ4A 4WAUA 1NJGA 5DHAA 1IXRA 4PAMA 1B9NA 4JMPA 2CCKA 1U0LA 3CCVA 5C4XG 2P5TB 3Q3JB 1DOAA 3PUXA 4RVCA 3PEUA 5FBRB 5HPYB 4M1KA 3NH6A 3UPUA 1KI2A 2VP4A 3J81c 4LBZA 4LI0A 5EUMA 1FQJA 2CHGA 4R71A 2WVJA 2YNMA 2DHRA 2OV2A 3I3SR 2QE7D 1LYLA 2GN5A 3R9XA 2CXXA 3DZ8A 1X1SA 1ZNZA 5AK0A 1M7HA 3TR0A 2ZREA 4QIWE 4OGQC 2VQSA 1GHKA 3PF5A 1YJ9A 3CM0A 4C2TA 5JSZB 2W2TA 2DWPA 1KGDA 5EP3A 2QEXA 2XZOA 4E09A 3LBIA 2OXCA 3DLLA 1Z83A 1MO3A 1DE0A 2ECKA 2LKDA 5JZVA 1RJ9B 2AKAB 2BMEA 4NHOA 4X8LA 4RJLA 2ATVA 2LWIA 1J8YF 5CJ2A 4A3EH 1Z06A 3UMSA 4KCGA 4AIMA 3L2PA 1F60A 1LF5A 1I6HH 1KSJA 3TJZA 4IQZA 4KN4C 1X3EA 2Q2UA 2JEOA 3GJ5A 3RS7A 1SVSA 4YHHQ 4DVGA 4A76A 5DYIA 4DV7Q 1W46A 1DAFA 3J81k 3GLGA 2GA8A 2ZI6A 4EUNA 3K0SA 2AWNA 1S8FA 5DI3B 1JR3E 5B64A 4YQFA 2R6FA 5BXQC 2GK7A 1KK0A 3K81C 2HIVA 3CXCA 3ZS8A 1PMRA 1Q82C 5DH9A 1O7LA 2CBZA 4DDTA 4EIWA 4C0LA 1E2LA 2C98A 1CLUA 3FWYA 4A8JC 4YWMA 4DCVA 3F1ZA 5JI2E 1VQKA 4JYCA 3THWB 1Y14B 2C77A 3CBQA 4AKIA 3MG9A 5HGQA 1CS4C 4DV5L 2WSSD 4P3YA 2ZT9C 3QKRB 5CYOA 3UK6A 2V7QA 2CL6X 3PIOA 3DVLA 4C3ZA 5BW8A 1KI7A 3T1OA 3A8KE 1P75A 4TLCA 3IEUA 4LYHA 4X8MA 3P1JA 5DHFA 2VTKA 4GP6A 4MUBA 3WMFA 4CF7A 3FTQA 4OWWB 3PCRB 3IQXA 5FI1B 3MJRA 4AI6A 1K6MA 1FMLA 1JQLB 1F2TA 1Z0FA 4DCSA 4YXWD 1SVLA 2JEAI 5FLXc 3QPWA 4DUZQ 2J0UB 4ILEA 4L5SA 2UXCL 1D8TA 4QOSA 1HQMC 2WWIA 2K5NA 3CNOA 4JT4A 3QF4B 3THYB 3W8NA 2ZI4A 2X8AA 4TYNA 1VHTA 1GZSA 2HF9A 3TNFA 4URXR 4LF9Q 1NKSA 1COWA 3BJIC 4LBYA 1E2HA 4Q4HA 1IZ6A 4Q1FA 2VSXA 4JLBA 3T34A 2VP9A 3FB4A 2AFIE 2G1KA 4I7ZC 3KZ1E 2A6HD 4AKEA 2R6AA 1WOCA 1GKUB 2N78A 3K8AA 2H5EA 2OFOA 3N70A 2IBMA 2I5LX 4C0QC 2ZRIA 5IP7H 1U8YA 2VUMH 3GJ6A 3CCSA 3VU9B 4DV6Q 4GOPC 4OX9Q 3HJNA 1VHLA 2W2VA 3NBXX 4LF6L 2JJ1A 4JLOA 2JJ2D 3A7LA 2ZYUX 3A8TA 3DM9B 3TMKA 2ZS7A 2GBLA 1X8JA 2V9PA 5H8WA 3RZDH 3I4NG 1Q86C 2GRJA 2QG6A 5BR8L 1HY3A 5F9FA 3BWDD 3F5FA 3K9GA 3KDFA 2CFMA 4GP7A 4G7OC 2BVNA 3O8CA 2E2JH 3CPJB 2RGNA 4OHVA 5P21A 2EYUA 1NBWA 2QEQA 1OH7A 1GL6A 4XWKA 4MKFA 1NKTA 4RD6A 4JBJA 1EIYB 1KI3A 2H1LA 2YZ2A 4JLKA 2K5VA 1R9TH 4LJ5A 2K7VA 4NCKA 4Q5IA 4WZAE 5EXPA 1Z63A 2G0NA 2RGDA 4JG2A 4P32A 4CEJB 5FPSA 1F2UB 1ZC4A 2BEKA 2GJKA 2GVZC 4R9UC 1C9OA 4BZQA 3S17H 3I8XA 1BIFA 1EFWA 1CTMA 3TW8B 1VQHA 4BXXG 2EQBA 1G5TA 3DO6A 3OEHD 1II8A 2AR7A 1DARA 2BBOA 3B1VA 4L5BA 3TUZC 3B6YA 3NEMA 3ULLA 1JR3A 1W36B 2ORWA 2JLYA 4PC7A 1HZCA 3GLIE 1H65A 1W5SA 1XPOA 2ZU0C 5C3EG 4DKXA 3ZZUA 1VQAA 1XMQQ 1Q1EA 2FGKA 4OQMA 4ASUD 5FTLA 5CM8B 3GLFE 1TWHH 1FL0A 4IJHA 2FSIA 4HDCA 3OW2A 1XCMA 4JI3L 1R2QA 4LJ9A 3ND9A 4R1JA 2RGCA 2XTIA 3EWSA 2AX4A 3BD9A 2P3SA 1B23P 1MV5A 2ZAMA 2UU9Q 4JI5Q 4HJAA 4RZUA 4M9ZA 1Q3HA 1H8HD 3CRMA 3CZPA 3GFPA 1HUQA 4MRNA 3Q72A 4YONB 2WHXA 2NVYH 1FMJA 4KHPQ 1G19A 2B7BA 2NO6A 2O8CB 1XB2A 4KN7C 3TBKA 3W90A 4GKKQ 1MRNA 1KSGA 1W47A 4I4LA 2R93H 1E4VA 1XX6A 2PLFA 1KK2A 3H2YA 4PG3A 2VW9A 3QKSA 4LRWA 1KJZA 1SVIA 1ZYRC 3IQWA 4HUQA 4DLWA 3WBKA 4PHHA 2PJRA 2RAPA 3ZIAA 5EXXA 4QHSA 1ETUA 4NL4H 2JA7G 3WHKA 1VQFA 4HZUB 1G17A 1O3YA 2GEDA 3L2OB 2KCCA 1VQMA 4BY7G 1BS1A 2W58A 4JVMA 4Q7KA 5AJVB 3ZQ6A 5FUVA 2D4HA 2IXGA 4YCVA 3VX3A 1T9HA 3K9LA 3QI2A 1L2FA 1U0HC 1UBFA 4B47A 3TLXA 1HZ9A 4YMTA 1HV8A 4EJSA 1KXLA 3RWMB 4GLVB 5KNDA 1DCZA 2ZJRA 2B63H 2FEMA 2UKDA 5B2ZA 3NHBA 3ASZA 5CJPA 1KK1A 3W5OA 4OK3A 1SHKA 2KHJA 1XTQA 5LMNQ 4HIOA 3SFZA 2AUKA 1YZNA 4C0HA 2WM9B 3GTOH 2Z0MA 3C5CA 2GJSA 2GVDC 3QPUA 5EE5B 4E5UA 4IVPA 3CQZH 1CUKA 4B73A 3AQ4A 4NDZA 1PUJA 2QAJA 4PXAA 4JLAA 1DG1G 4R4QA 5E95A 5J4YA 4NONA 4LUCA 2B3GA 1N2CE 1W48A 4DNRB 2IX3A 2V7QD 2OO7A 3CAMA 1EG7A 2OBLA 5IWAQ 1ZU4A 4ZI2A 4A0HA 3U6KA 1Z3IX 4YWKA 1BKBA 1P9RA 1PH6A 2HT1A 5CK4A 1HZBA 2F9LA 3NBZC 2VP6A 5FOSA 1KRSA 1LTQA 3IIJA 4Q7LA 1BYIA 1YHBA 1E96A 2PLRA 2PZEA 4A2WA 4BBSH 3K80C 2JLZA 3SQWA 4GDFA 3GLIA 2GCOA 2R44A 3K1JA 3N6RA 2ZJAA 5F98A 4C0AC 5KSZA 4D4JA 2OFXA 3LAWA 2N49A 4A3EG 1LVGA 1CKNA 1N0UA 2OG2A 2VF7A 4TZ6A 4C4PA 3KJEA 1K8OA 1UDWA 1G8HA 1ZMXA 2WIBA 1Q3TA 1XMOL 1ANKA 3QE0A 4A3GH 4ARZA 4BRWA 5GADC 4B3ML 1XEWY 1XMJA 3T56B 2ZJ5A 2DNEA 4NYMQ 2WB1G 3FHTA 4RD0A 3L0SA 4UP8A 1G8PA 1JECA 4DLVA 2Z4RA 1KY2A 4MGKR 4L9WA 4MYTA 5C4GB 2O8FB 3TSWA 1WI5A 1T5EA 8OHMA 2EWWA 2Z5FA 2F43A 2W00A 2CJWA 1SMXA 5FFMA 5AWFC 5BYJA 3SJAA 5K8IA 3LX8A 1Y69U 5DLQC 5JJLA 2VIIA 5JMTA 4Y0VA 1IXSB 4OQNA 4Q1DA 4A3BH 1Y8PB 3RLNA 5GAGC 1JBKA 1G3IA 4Q9KA 4WZ6A 4A8JA 4A92A 1V8QA 2QTHA 2REXB 5K8LA 1MT0A 1NLFA 4NYIQ 4PZYA 3W5JA 2MSEB 2OAP1 2JEBI 1VQGA 1VG9B 2FGJA 1J2JA 4X6AH 1NN3A 4HEJA 4LV5B 1X55A 2MO0A 2ZRAA 5HTKA 1GKYA 1J5EL 1HQCA 2RGGA 4LJ6A 3TE6A 3KXIA 1DAKA 1GG2A 5CYPA 1FW6A 2DFNA 2C9YA 1VCNA 5JWRA 4LF7Q 2BE5D 4IXNA 1JR3D 4RCNA 2JLSA 3EQLC 3CC2A 1IN6A 3VDYA 2CE7A 4US1R 4A0RA 2Q9BA 4XVQA 1SRUA 4E07A 4JI0L 1GD7A 1CP2A 2Q0HA 4CEIB 2H5XA 4LF5Q 2BWJA 1IJFA 3CF6R 2WTUA 5J4HA 5JFGA 3B8HA 2V4DA 3QEOA 3W6OA 1HNWQ 5IP7G 1YBYA 2VUMG 2A5FA 3DDCA 4G5RA 4D0GA 5BQ5A 4DR1Q 5C0XH 3D7MA 3HYTA 2A68C 4RKFA 4L16A 1N32Q 3CRVA 5L3SB 1E7ZA 3IRBA 3AP1A 4RZXA 4A2PA 4TYPA 3IILA 4EX5A 4IOMA 1D2EA 4GOPA 2ONKA 2ZE7A 3A58B 1HNZQ 3K70D 3CCUA 1ESMA 1ZM2A 1QVFA 3A1VA 1DBSA 1R5OA 3HKSA 2XJ9A 2YOGA 4D0LB 2Y8EA 3EXAA 1ZBDA 1OKKD 2K50A 1NL3A 2GCPA 3U3KA 3A36A 3ZIAD 2EQSA 2EJFC 3F0TA 1BBUA 4JI1L 4GOXA 3MEFA 2WWFA 4XTCS 4LF4L 4UQOA 1Y8OB 3FE2A 1ZAKA 3GJ0A 4A2QA 2QMOA 1C9KA 3SS8A 3I2ZA 4EPVA 3IBYA 3RR5A 2C04A 5CIWA 5FUYA 5TY0A 3ZQJA 1TAGA 4NXML 2IC5A 4BA1I 1ZINA 2QUZA 4ZV4A 5KU1A 2EWVA 2AMCB 4GN3B 4RKEA 4YLGA 3BZKA 3ZVMA 4XSGA 2YTXA 2UUAL 2VQEL 3C15C 1L1OC 3HOVH 4A1FA 4KKTA 3OF5A 4JL6A 1Z6HA 2F4VL 1N6PA 1T91A 2FA9A 1YZUA 2YWEA 4OI2A 5GROA 4N0EA 3QBVA 1IY1A 2OAQ1 3TK1A 1E3PA 2CWAA 2F1JA 3U61B 4ZIRA 2CCJA 4G7HC 4DUGD 5EZ6B 1KDRA 4ZO4A 4D26A 3I1FA 3K9NA 4DV4Q 4YY3Q 3WRYC 2PBRA 3J7A5 3FFAA 4QGFA 3QSYA 4YMUA 4LSGA 4S35A 1NSFA 4B3RQ 1HA3A 4KAXA 4UXIA 4R2HA 2F55A 3ULJA 5HZHA 1G3UA 3JZAA 2AK3A 1PH9A 2OESA 4TKOB 1UE1A 4P72A 4MYUA 5LDDC 3THWA 3LGJA 3R7WA 3CPFA 2R93G 3RWOA 5B58C 3THXA 4M4SA 3QPVA 3SJZA 2BA1A 2GHIA 3QKRA 4A6PA 4FWIB 2VEDA 3OE7A 4KO8A 5FOVA 1W5TA 4IPCA 2D06A 3K0EA 3C16C 4PO1A 4BFXA 4JI4L 2RHDA 2GXSA 2AL7A 3WY9A 1YZ6A 3KKMA 4AYBG 3RDPA 1HR0Q 1XZPA 2JA6H 3KL4A 2QT0A 1OXTA 4C30A 4DB4A 1SROA 3BK7A 1PH8A 1II9A 1VQOA 3QXHA 4UXHA 4D2IA 4Q00A 1E2PA 3H4MA 2F3RA 4Q18A 3QQ5A 4AG5A 4JBWA 1KMQA 1AQYA 2B63G 1IBRA 3DMDA 3E1SA 4LF8Q 1KO1A 5EE0A 1UE5A 1DAHA 1YZLA 5LD2B 3U4QB 2MNAA 3PFIA 2NOAA 5DNYB 4PMWA 1MO5A 1TADA 4V0OA 1OH5A 1VQCA 1P72A 4QBFA 2N8NA 1LFDB 1WRBA 2E5LL 1Z47A 4PZ6A 4JI6L 2FNAA 2ZJZA 4HIMA 3GEHA 4POAA 5KPJA 3GMTA 4AQYQ 1TL7C 3HOUH 3EWAA 1CKMA 1XNQQ 3CCJA 4IFDI 3VKWA 5HKKA 5JBQA 2ZJ8A 4OHWA 5H1YA 1J7KA 1BDOA 1NLYA 5DE3A 3EC2A 4OWTB 4QRHA 2IK8A 2O8EB 4WJ3M 2R6CA 3P26A 5SZKB 2BH2A 1Z0IA 3U7GA 1KOFA 4OQXA 5IT5A 2J0VA 3A8IE 1T4GA 3KX2A 2QGQA 4MNOA 1S1MA 4DT1B 4LJ8A 2FXQA 1PH1A 4JZKA 3NC1C 1BYUA 1IN4A 4LYJA 2OT3B 4PO9A 4I81A 3ZJYC 5BN4A 1K8MA 3X1XA 5LB4A 1YVDA 5G3YA 1V5WA 3PO2G 3G0HA 5GQOA 2O5VA 1E1QA 2QP3A 4BBSG 4QHTA 4CEHA 3BORA 3QENA 2ZJYA 5KNCA 1US8A 4BA2I 3RRYA 1DTSA 1O78A 5GADl 3M4YA 1VQ8A 2OBMA 3FHWA 5JLJA 1K9MC 3LVQE 5HCIA 5L3QA 4FMDF 3UDFA 3G5UA 4P73A 2J7KA 3QXJA 2E87A 2QAGC 2QPOA 4JYAL 1EFCA 2YHSA 2ZVQX 3TIFA 1YNXA 1HH4A 4CIDA 5F9HA 2ZM5A 3UDXA 2NGRA 2RB4A 2L15A 4DR3Q 3IIMA 4A3GG 4PO8A 1E2WA 4G7ZC 4X8OA 1ESNA 2HT6A 4LC0A 4JIMA 4D81A 2RMKA 4XVUA 2GXAA 1SVKA 4PZLA 2NZOA 1NI3A 3GLHE 4DV2Q 1TQ2A 1YZKA 1PH7A 1NIJA 1IBKL 1TMKA 1VYVA 2WWHA 4KODA 2G77B 1IOZA 4WVFA 2A6EC 3AP2A 4M8NE 5IP9H 4JI7L 1GNRA 3IO3A 5AR1A 2IWHA 5E3HA 2F1RA 3NE5B 3C4JA 2D0OA 2Q2TA 3HPRA 3LW7A 4OKSA 3QOFA 4A3BG 3QXCA 2JIZA 4QBGB 3KJIA 2B6HA 3UWKA 1XJVA 4PZ8A 4JBXA 2VH5R 5FBLB 3TH5A 2WKRA 1TNDA 3EZ7A 5M5XH 1S2MA 3A4LA 4Q1BA 4XVRA 4NXNQ 3S1MH 1FP6A 1Z5ZA 4PPQA 2ZRGA 2D5DA 1WCV1 3KUDA 4M9XA 1I2DA 3WHLA 2AUJD 3AB3A 5A35A 1VQPA 3K53A 4QJFA 2OCYC 2W6JA 4P71A 3M1IA 2VL7A 4IW3B 1NJIC 2OHFA 2RGAA 2OTLA 2ANCA 3GFOA 4I1SA 4OQFA 1ZM9A 1U99A 5FUWA 1K83H 4R4OA 2BM1A 2B92A 4DLZA 4IJMA 3QJYA 2JA8H 2HXSA 1TPZA 2AHOB 2I1VB 2ZVPX 521PA 5FPKA 1N6KA 3KLWA 1C4OA 2ZRDA 4G1UC 4KFTA 2IT1A 1NVWQ 1TX4B 3V9PA 2HF8A 4P4SB 3H15A 1YITA 1SXJB 1E69A 1U5KA 2R9VA 1E2JA 5C4MA 5C0XG 4TMZA 2CDNA 3KJPA 1ZIPA 4TTRA 2QPTA 2HLDA 1DAEA
chains in the Genus database with same CATH superfamily
2JK8A 3HCBA 2IJ0A 1KL7A 1YQUA 3A25A 1ZUHA 3PFKA 1JJGA 3T52A 3EAQA 1ESRA 3TDQA 2A9KA 4LFCL 1FYXA 4MVJG 2IHUA 4I3GA 1Z6XA 4BBRB 5KOYA 4HI0E 3UK7A 4G6ZA 4BMPB 1Q12A 1P8LA 1YHQA 1BDIA 4U2DA 1NUPA 3PXAA 4G8DA 2X0DA 1QV7A 3TIGA 4JV5B 1UE7A 5EC8A 4YPVA 2TMPA 4RPCA 3MJ4A 4ACBA 2Z2XA 4MVJP 4BFTA 1DTWA 4RVOA 5JZ9A 2JA6G 4RZIA 1DWUA 4C2MH 2BFDA 3ZI4A 1VMPA 4JU9A 1G16A 3H9QA 4KPGA 1PNTA 1O03A 4JYZA 3K6KA 3WQBA 2ZZMA 4N3NA 1KP9A 4X7RA 3ZWDA 3EN0A 4POFA 1VC2A 2P69A 2I6UA 3I05A 4CLXA 5LOVB 5HGJA 5HRCA 3AMVA 3G71A 2CD7A 3WFIA 3IVAA 3SI7A 1UKVY 3CY6A 5FWYA 3A3YA 2R65A 4U7PB 1FUUA 5KNBA 3KKQA 2OOKA 2UYOA 3F46A 1GSAA 1GUBA 2HLDD 2K4KA 2GHTA 5SICE 5DTMA 3FYUC 1C0EA 2YYAA 5TXGA 3MGKA 1MKYA 3SKYA 3S14H 4DSUA 1FDUA 1I1QB 1HPLA 4HRYA 3KQWA 2YJ4A 5K3FB 1VE6A 3OFKA 3LY7A 1IB0A 3F4LA 2FSSA 4KBGA 4PC3A 4OHUA 4OIJA 4F84A 4TV8F 2DP4E 4LOAA 2IEAA 4YR7A 3ABQB 1AXRA 2HGSA 5FAXA 3C98A 4M7RA 3BGSA 1UBGA 1SEBD 3E5SA 3LOQA 1BZYA 2ZR7A 3E9RA 4QO7A 1RPTA 2J0SA 1ZRHA 4PBRA 2PAAA 1DOKA 4UHJA 4HH0A 4ENTA 4ZAYA 2O2IA 2C4WA 3LHIA 3LCRA 2F59A 3U37A 2C4TA 2HKIA 1DXYA 2BBTA 5FA8A 4AWAA 1QMGA 4ESVA 4UVGA 4KQ6A 2ADMA 4IPTA 2L2QA 4CJ2C 3QNUA 4Z8XA 1YC5A 1W5EA 2FKAA 1ADFA 1B1ZA 2ATXA 2LBPA 2UXCQ 4I46A 4E22A 2ETXA 3EGDA 4A3CH 3KC2A 2JAWA 4YJFB 3AUTA 2J7ZA 1XU4A 3JR7A 3ANMA 5LYJA 1QVRA 1C8LA 3QVLA 3NTIA 2VO1A 2W2NA 2OPBA 1YEZA 5FTJA 2XMZA 5IXJA 2DBVO 3FRJA 4D4LA 1JHQA 2VUIB 3C2PA 1RXEA 5BMVB 3WIOA 5AJTA 5CBEE 1JAXA 2R66A 4EPYA 1OX4A 1BEEA 4A75A 4BBRH 2X6QA 3HBLA 3PPVA 1KY3A 4C3IB 2JA5B 4UNPA 1SQSA 2DX7A 1ZGZA 5H68A 3R93A 3M5CA 1Z15A 3T15A 1U2SA 2Y0DA 1S4ZA 2HJGA 1V1PA 4G86A 4UP9A 1LD3A 4X93A 1XJCA 3VYUA 2Q2IA 4E6IA 4AMYA 2DWOA 5B1YA 3DHNA 1R5BA 1OFTA 5HCNA 3AR3A 4PZ9A 2I76A 1WIWA 3M4ZA 5EFOA 3UWMA 3FDXA 3TX6A 3V8VA 5BT8A 1RMTA 3RQSA 3F47A 4HB0A 1U8TA 1MBYA 3UAYA 1EFPA 4NR0A 2E49A 4S12A 5FH9A 1GGEA 1NP6A 1AN8A 2CHEA 5P8WA 3E53A 2PZJA 4QUEA 2G0AA 4POOA 4DIUA 3KBXA 5JEAJ 3RWBA 3GAZA 2BGMA 2XYGA 1O87A 3VKGA 4IFDJ 1KYYA 4GNRA 3I04M 1PJSA 2NM0A 4M53A 5ERXA 4GBGA 3STBC 3HOZB 4OGWA 1C7QA 2R2GA 5A3RA 4YAWA 4QXAA 5JVDB 4YCAA 3EPPA 1ECPA 4KY5A 1S2OA 2W6ID 2DULA 3WZMA 1BVUA 4JLDA 3EIUA 4GUAA 1KXZA 2DY0A 1YOVA 3ILVA 1PTJA 3V8NA 1BMQA 2PM8A 3HM9A 1WCMB 2ZJ2A 4GZMA 3LLSA 3OPYB 2MYNA 1MHPA 3FSJX 1YUBA 4KTAA 1PZXA 5K7SA 1T9AA 3O7MA 3NBIA 4F2WA 5BUQA 3I90A 2CGEA 1JFRA 1RLJA 5FO9B 2F8SA 4UUAA 1YIOA 5LNK1 1GFZA 2YVKA 3ABSB 1A8PA 1BMFD 3DS8A 3H17A 3UOWA 3KSUA 4Q3CA 4PLHA 2ZB2A 3TCNA 3MSXA 4CKWA 3P4YA 4HTFA 4PO3X 4O4LB 3DVQX 3RYCB 5ALXA 5CA1B 3ZXXA 2QM8A 2PDAA 2VRCA 1HJPA 4BNTA 2PIAA 3R0IA 4ZDJA 1WETA 1KFJB 5ES4B 5A02A 4ITRC 1RZVA 3L6EA 3CCBA 3U3RA 3NT2A 4MJ7A 2P9GA 2NP6A 1WL8A 4D4GA 3NATA 2ODBA 1Z8HA 2GEVA 3H19A 5M3FH 5A0VA 3HDHA 4BNHA 5FADA 4YB8A 4YCWA 3K73O 1S5CD 1VL1A 2Z0SA 3O13A 1PDWA 4IHJB 3MINB 1URPA 4D4IA 1U7HA 1P18A 2I1QA 2IY8A 4DXGA 3VUEA 1J22A 2W6NA 2EX4A 1IJKA 8LDHA 1QZZA 1GPDG 4RM2A 2PBZA 2PKEA 1UT6A 3ZWWA 4BWGB 4FWTA 3IMCA 1I6KA 1K8RA 1NV8A 4B43A 3GEIA 5FUBA 4XKJA 3ZTTA 1XZKA 1XN1A 3RVRA 4EJSB 4K0KL 3UAOA 5GOTA 3KVNA 2X13A 3MWJA 4WKNA 3M70A 2WHPA 1WKCA 1UAGA 3HOYG 5CDTA 2YFHA 1XRSB 4RF5A 4ZALA 1SUAA 5JPIA 4FFWA 5D8DA 5HZKA 5DYYA 1UKEA 5K5EA 4C3IH 3WXMA 2HTEA 5JAOA 3LQ1A 2PZUA 3RS0A 4DQXA 4ZVLA 3P8ZA 4O4HF 1AA9A 1ICFB 4ZK9B 1ZXBA 3A14A 5T4EA 2NZ2A 4N5NA 4TTPA 1ZJ5A 3OZDA 2RH9B 1TJ5A 2BEWB 3BGWA 4QXPA 2ZIWB 3PXCX 2XYHA 3BMXA 2H4XA 3NONA 2Z6VA 4JH0A 3GTKH 2H3HA 4QL5A 4NICA 2ZT8A 4JBHA 1ODFA 2B2YA 2YU9B 1ZOOA 1VL6A 1JH8A 3V6LA 2Y77A 1Z18A 2EL9A 4F11A 3RQIA 3HDJA 2IX0A 2HTFA 1X1BA 3FKIG 2PMWB 4B32A 1CJVC 3KOZA 4C9BA 3IUYA 3VVMA 3CEAA 1R74A 1J21A 4EMTA 3TB6A 3PIIA 1B42A 1HFKA 3T5DA 1H2HA 2J09A 3CCQA 3ZGVA 1A50B 1KMMA 4LXXA 1AFPA 3H84A 4JC8A 1YL6A 2GARA 1SUIA 1X3FA 2BDOA 2NYZD 4L85A 1XD9A 1I51A 3F7NA 3L5OA 1F6WA 4UVIA 3TQQA 1R0WA 4MB2A 1UPCA 4P81A 2PUVA 2VJMB 3N0RA 2G1PA 4ZPJA 3HDGA 2QG9A 1D07A 4DUZB 3ZZNA 3JR3A 4Y67A 4X44A 3WL7A 4DSTA 3VTKA 1E1LA 5D87A 2GVAA 3GTMB 1DT5A 4BWVA 3CZQA 1YIAA 4U3JB 4RSRA 2J6CA 3ZGNA 4RG1A 1CJKC 1YK0A 1UBMS 3QOXA 2ZJOA 4L5IA 4YDQA 4BNUA 1ZD5A 3A10A 1HTPA 4HDSA 4E31A 2BCOA 4EEXA 3TS0A 5CB6A 1I2BA 3ADDA 4PAWA 1TRKA 4AY6A 5EFZA 4YREA 5I6YA 3Q8MA 4LQDA 5JROA 2W6MA 5A1JA 3ROEA 5LP6B 1Y4AE 1NUUA 1IRXA 5IC6A 3QHQA 4F8MA 1OFGA 1PJRA 4GE3A 1H23A 4Q39A 2TECE 4HVLA 3ZZMA 2VHZA 3E7XA 5T64A 4BIIA 1GL3A 2D0OB 1E0DA 4P4SA 4LDAA 1KBZA 4Y6QA 3T4UA 4KN8A 2PR7A 3D5EA 3N59A 4OYHA 3M4QA 2XA2A 3HADA 1EEID 2PGOA 2RG7A 3GMDA 2XI4A 1ZJZA 4R31A 1AMNA 2B37A 4J7UA 1NN5A 1AUQA 4B08A 4HL6A 1BVSA 2GZHA 5LWHA 2ZS8A 1NR2A 3GCZA 3CKMA 1W25A 4MUYA 1MA0A 3MMNA 4HMPA 4OO3A 3A06A 4JKYA 2IEZA 5CMLA 1ZZGA 1T4DA 4BJ6A 2VBIA 3OT4A 1FY2A 1FDSA 2X4GA 3IESA 1CULC 4HNHA 1HNWL 3WDKA 2F6RA 3MYYA 5TB5A 1PT7A 4L3WA 3RNLA 4WIAA 3QYPA 4FBMA 4R4IA 2Y1OA 1UC4B 1S5BD 5IJ0B 3T7IA 3CX3A 2O2EA 4EG1A 3PZBA 3S1AB 1ZIOA 1Z16A 3INYA 2JA7B 3QEKA 1Y1SA 1EUJA 1RCVD 1SULA 4I1UA 2LKCA 4TUYF 3WMEA 1LC3A 4C2UA 3QKIA 5T4FA 1PKXA 1IG3A 4EGJA 1I7QB 2I3AA 1XHLA 2WJPA 1NR5A 4F2DA 4YECA 3KQUA 1X3SA 1C8KA 2CXNA 3JAMi 1RL2A 4MQEB 5ELNA 1XXHE 4PAQA 4UAGA 4BZZA 1EP1B 4RCOA 2QAGB 4Y7NB 5JO0A 1IM8A 1QF7A 1VI2A 5FEMA 4WZBA 5GZ6A 2YJ5A 4DV3L 2PKCA 1YAHA 3JAMc 3R9XB 3GTGH 3TZKA 4XCQA 1YBHA 4H7IA 2C3YA 3AYXB 4BTLA 4FDBA 2CFTA 4QC2A 2WKWA 3FA2A 1BXRA 2OHIA 4DK3C 1X8KA 2I65A 1M34E 5IGDA 5IAJA 5LVAA 4LSMA 1JXOA 3GTMH 4KY6A 2EKDA 1DMRA 2G07A 4PPNA 4YCDA 2FW9A 1W29A 3I34X 3LNNA 1CHNA 5CFMA 4B6OA 3NOXA 3LDUA 3PPYA 2JVJA 3GDEA 1Y33E 2X77A 5LCXA 3EEBA 3BMCB 1KKLA 1GZDA 3DOIA 2O9JA 5COAA 1B7GO 4CV2A 1OSNA 4D7AA 3OTHA 4RJJA 1H05A 4U9HS 1AG9A 2JS7A 2NVYB 1G8GA 4YUYA 2HJVA 3AP3A 4TV8A 4QGBA 3PIRA 1U5AA 1EIHA 1F9QA 1ZSNA 5JJBA 4BQQA 1GFIA 3DP7A 3I53A 2BTQB 4IDHA 3HOWB 3SYTA 2OF1A 3RC3A 2NQ8A 5EBCA 1E2GA 2FLVA 4QY7A 2G8LA 3R3HA 4KUHA 4LFAL 2AFIB 3GTOB 4WK0B 5A6VA 3LS2A 1CR2A 1WD5A 1EQVA 2Q0SA 1SC6A 1QCDA 2DHDA 3QUSA 1KAMA 5KX5A 3MTSA 1WTXA 3LT0A 3LXMA 3W5HA 3I70A 1T5LA 3N2YA 1Y3BE 3NTRA 1HX7A 2GSDA 3AERB 4CG1A 3FVQA 2EXDA 1E5TA 1B76A 4JLWA 5DM2A 4A3GB 1PFSA 4B35A 3LWUA 3ZJ5A 2OGSA 4YIJA 3ZKWB 2PKQO 1S5DD 1OH8A 3VDMA 1G91A 4EQ6A 4JJZA 3FH0A 2I3BA 1PYBA 4HNGA 1XKQA 3O9VA 1E1QD 1GRRA 1PR9A 3IBSA 4N6GA 2QVXX 3I61A 4X66L 5KOJA 2UUPA 2HHHQ 1QOHA 4UTXA 4WY8A 3GT7A 3PCOB 4Q21A 1GFSA 1J90A 4K28A 3UPTA 2JA7H 5JWOA 3EG5A 3ZE7A 4P1ZA 1NVGA 4R01A 3O73A 1A2UA 4INZA 4REQB 4G89A 1ODIA 2W93A 1H3FA 4A3DG 1LH0A 3T53B 1A88A 3O9MA 1D4FA 3LUKA 2OYRA 4IGIA 1F8GA 3NDIA 1RWXA 2OV2A 1FS4A 1EVQA 2ONCA 3DZ8A 1USWA 2ZREA 1FFDA 1YJ9A 4CLRA 3UJNA 3SR3A 4AIMA 2N88A 3NXKA 1X3EA 2QZJA 3TJZA 1ORVA 3KBGA 4XLZA 3D43A 4FYDA 1F7UA 3A6DA 4DCVA 3STVA 1EEHA 4U68A 2VYQA 3JWJA 4AKIA 2Z8XA 2WSSD 1QM5A 2V7QA 5CGKA 2P79A 5A1TA 3ANXA 1GZ7A 1JQLB 5JDIC 4DBVO 1OX6A 4DU9A 1XA3A 2LTAA 3C3CA 3FB4A 2QTNA 3Q9UA 2BW0A 2V9PA 2OQIA 3MERA 1QYDA 2ACEA 3F97A 3HXKA 4LJ5A 5EXPA 1VL2A 5FPSA 4DF7A 4DMUB 5KEIA 3ROQA 4BZQA 4QYIB 3S17H 3VBEA 4G36A 3RT1A 3IS3A 1DARA 2BBOA 4L5BA 5FFFA 1JR3A 3L46A 3PHJA 4PC7A 4QQRA 1V9SA 3L6BA 1R2QA 4LJ9A 1DLIA 1EI9A 2G9UA 4GZ3A 1FS5A 5E3IA 2NVYH 2NO6A 2Z4HA 3IP5A 4CFSA 3H2YA 4QNNA 5MFPA 3KYBA 1CHDA 3OFSA 4C4SA 1RWQA 1VQFA 4G56A 3Q0AA 2KCCA 4LZLA 3OIFA 4Q7KA 1QYIA 2IXGA 1X9HA 2IZ7A 5B1DA 3OWOA 4IALA 6CHYA 2NYUA 3HKDB 3OKCA 1C0PA 2KEEA 4NS1A 1V9CA 5HF9A 2NT4A 3GTOH 3GRYA 5J4YA 1J0EA 1WPXA 4IY1A 5DYTA 2VPWA 2AZXA 1FB5A 3CAMA 4RK4A 2VK4A 4IINA 2A14A 2JFXA 3NYRA 1T2NA 1DQZA 4OGGA 3AYZB 2PLRA 3P71T 4A2WA 3K80C 1SBTA 4WKBA 5K3SA 3K96A 4RA8A 1J0DA 3CZ5A 3WB0A 4TZ6A 1EB8A 5DK4A 3DE0X 4URHA 4RAQA 4DREA 4A3GH 5GADC 5EUCA 3T56B 3WB2A 3RBAA 1G8PA 1LC0A 3LUBA 4L8FA 4DLVA 4MGKR 3TSWA 4BNNA 1O5IA 3NWPA 4OREX 5GAGC 1X1AA 3EYAA 5T3YA 2B20A 3B20A 1FLVA 3P4UA 5L9AA 1VCNA 2EXZA 4E5VA 5J4HA 2C20A 3EGVA 1R88A 5LHY1 2VPYA 4DWOA 3OLVA 2F00A 1HEYA 4L16A 4AJNA 4EX5A 1KRHA 5TT1A 3S2SA 1DBSA 1R5OA 4N5MA 2GCPA 4M1EA 3LPNA 3IFSA 3IBYA 1SU4A 2C04A 3ZQJA 1IQ0A 5KU1A 3PKJA 4YLGA 2HRZA 5IOCA 3D8TA 4EG7A 4ARIA 2J3DA 1WQ3A 2A67A 3DCYA 2FYTA 1SZJG 3WLIA 1PTOF 2CCJA 4ZO4A 1Y8QA 2P6OA 4KNVA 4YY3Q 4K2AA 1GZ4A 4S35A 5HZHA 3AFIA 1F7VA 4ZT7A 2VB2X 2BA1A 2X7XA 5YASA 4XM2A 2VEDA 4KO8A 1W5TA 2BTOA 4WGGA 5HMLA 3KL4A 1OXTA 3E15A 3QXHA 2B63G 5EE0A 2XEDA 3ENQA 3FAZA 3S2IA 2Z2ZA 2OD9A 1J7KA 3U39A 2FZEA 3P26A 4EMSA 2YXDA 4OATA 2IKQA 4DAOA 1A8QA 3N52A 1Z4QA 4QHTA 1WCIB 2ZJYA 5JLJA 1JQDA 5KOHA 4UEWA 5E6UA 4BQEA 4UEKA 1U31A 4DR3Q 4C4TA 3R7SA 3GLHE 1GAWA 1WTCA 2HXGA 1NIJA 4H6XA 2I0FA 2H1RA 4WVFA 1GNRA 4JI7L 3C7TA 5C34B 4G0XA 2XQFA 3JD1A 4JB0A 5IODA 2CZQA 1I7PA 1I2DA 2AUJD 3K53A 4QJFA 4ZYZA 2RGAA 4KK3A 3AUUA 2ZCJA 5LP1A 3V9PA 2HF8A 1E2JA 1NULA 1SJ9A 4JI7B 3CQZB 1ZIPA 2IDKA 4ZEVA 2WWYA 1VJTA 3A1DA 4Q82A 4AP6A 2Z1MA 2NVXB 1MQSA 4Z1MD 1CYEA 2CVZA 2XIQA 2ETVA 1LA2A 4CTKA 3KLNA 5LKRA 1NR1A 4TZ0A 3NHSA 2AFRA 4MQFA 4WBNB 5C53B 2I67A 3HXMA 4YJDA 2INGX 1PDOA 1WU8A 2JBHA 5HIAA 1NW5A 5BW4A 2FRDA 3FNBA 2YV3A 3WGGA 3ZHOA 3NM5A 2PH5A 3FNEA 2PWBA 4AB1A 5EA2A 3ZBQA 5AVYA 2MSNA 2O54A 2C4UA 5BRNA 1XMVA 3DBHA 1XG5A 3DMPA 4DPKA 3L7DA 5JNWA 1IVSA 3W3ZB 2EF1A 1ONPA 4IEFB 4DNFA 3W5IA 4NARA 3HYNA 5JOBA 2F2TA 3C3WA 1V6CA 4GH5A 3O2QB 1IMOA 2W48A 3A4NA 3ROKA 4KEAA 3D4NA 2AHRA 2O8DB 1UKBA 2QUJA 3PNMA 2NU6B 4LTDA 2VA8A 2JFNA 1ML0D 5AXDA 2XYVA 1Q7EA 3I8OA 4GM0A 4F6CA 1LPAB 4GMDA 2A68D 1R0RE 1TFUA 3KR9A 2R2AA 5LQSA 3A1SA 3GEEA 5IK2D 4J2HA 1ZGBA 4KX3A 3O4VA 1M6YA 4PX9A 1R8YA 2G9NA 1E24A 3AF2A 1R0YA 2MINB 16PKA 3ROGA 2PUHA 5J58A 5I7UA 3OVMA 1E1TA 2O8VA 3UNXA 1DMSA 2Z5GA 1QFYA 1RKBA 4DRZA 1JUDA 4B3DA 1T5IA 2QLBA 3SQDA 5HCUA 1QCYA 3EWNA 1RVDA 1XTBA 4BLRA 4YRJA 2PRZA 4GMKA 1TYBE 4TSFA 4C3HH 2RF4A 3BIFA 5BSVA 2XDAA 5JE8A 5LMCA 4RHSA 1ZISA 4HBZA 1ZD1A 4YP0A 1X7ZB 4LAFA 5ECYA 1PYDA 3BCRA 5KNLA 3U16A 1A76A 4PLTA 1GRNA 4MA5A 2BLLA 2HIAA 1H6CA 4UHKA 3I9OA 2EVWX 3HWX1 1V11A 2BYTA 5K1ZA 3FJYA 1WVLA 4HWRA 2NXCA 4HX9A 1OKKA 3WGZA 1T3ZA 3LH5A 3T1QA 3FYTA 1RZRD 1X8XA 4ID9A 3OM9A 5DM1A 1HFEL 3PUWA 4IPDA 3GGDA 2X4DA 3E81A 4HLQB 3ZS9A 2HNBA 3GTQB 3K6RA 4DUGA 3HBJA 4WI1A 4GD3Q 2IOYA 3IR6A 3OJXA 3HLTA