4IPCA

Structure of the n-terminal domain of rpa70, e7r mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipcA00
4A3EG 4P71A 3KF6A 4NB3A 5IP7H 5IT9c 4JI3L 1HNXQ 3HOWG 4DV0Q 2N3SA 4ME3A 1J5EQ 2R7ZG 5BR8Q 5AJ3Q 4AH6A 2D0PA 2C35B 2K14A 4IO9A 1VQNA 4JYAL 1HR0L 2QEXA 3W1GA 1T9HA 3HOXH 1KIXA 1VQFA 1A63A 4PZ8A 1CKNB 3G71A 1GD7A 2JA8H 3KF6B 5ELNA 2Q2UA 3JAMi 2VZAA 3U4VA 3CCJA 4DUZL 4JI2Q 3UDFA 1VQ9A 4HIDA 1N9WA 4QL5A 2N78A 3EBEA 2UUCQ 4LF6Q 3EIVA 4OWTB 1Q1EA 2VW9A 1PYBA 2IHFA 2B63G 5ELOA 3RN2A 1Y1VG 3U58A 5IE8A 1J6QA 2VQEL 2Z0SA 4GS3A 1IBMQ 3PIOA 5IYBG 1VQPA 1NMGA 4LF7L 4DR7L 4OX9Q 4L5QA 1CSQA 3CCVA 1YJNA 3DM3A 1K8GA 1PH2A 4APVA 4B3SL 1OTCA 4JV5L 1CSPA 4DUYQ 4MZ9A 4OO1I 2KBNA 1G6PA 3E9IA 4LWCA 1MJEA 1LTLA 1VQGA 3MXNB 1Q12A 5IWAL 3M4OH 2H5XA 4IOAA 1VQIA 1KL9A 1HZCA 3UDIA 2A1AA 1L0WA 4MNOA 3G4SA 2PMZE 1JMCA 1NY4A 4QIWE 5E7NA 3S1RH 3I2ZA 1L2FA 4B3ML 4BY1H 4DR6Q 4A3GH 1PH9A 2Q2HA 4BXXH 2AHOB 3A5UA 5C4XH 4DR1L 1B8AA 1PH7A 1HNZL 4DV7Q 4NXML 1I5FA 3GTJH 5C44G 4IOCA 4A3KH 1KQSA 1FJGQ 2LXJA 1Y1WG 2ZJQA 5DLQE 4GLXA 3DLLA 1KD1C 4HIKA 1L1OA 5LMUQ 2QGQA 4DV4Q 1YJ9A 3HOZH 3H0GH 5GADC 5M5WH 5IYDH 1A62A 2NN6I 4LF8Q 5FLMH 4LFCL 2R92H 1PVOA 3GTQH 2ALYB 3CW2C 1N8RC 1Q46A 3L2PA 1EFWA 2F52A 3CXCA 1VQOA 3CMAA 1E3PA 2CCZA 1L1OB 4EX5A 4DV1L 3S15H 4DR7Q 1XPRA 4IFDG 2K5NA 4YY3Q 4TVAB 2JQOA 4JBWA 2I5HA 4Y7NH 1PV4A 5JJIA 4B3TL 1FGUA 1U0LA 4JCVE 4A3IG 4A3CG 4LUVA 1YHAA 2YTXA 5IWAQ 1G51A 1X56A 4DV3Q 3CCSA 1VQMA 3AEVA 2ASBA 2Y0SG 3IRBA 4JBJA 2HIXA 1CUKA 5IYCG 1GO3E 4B3MQ 1V1QA 2OTJA 5IP7G 3PUVA 3RLOA 1N33Q 4GOPC 1HNZQ 3K7UC 2CWAA 2L15A 5M5YH 2WAQG 4DV2Q 1X9NA 4JI8Q 3G6EA 1X3EA 3J81i 2DUDA 3HOXG 1HZAA 1GM5A 2LXKA 4HJ9A 1PH1A 2OWOA 4A3DH 2JA8G 3ULJA 4JI1L 3KOJA 4HJAA 4LF4L 1N32L 1XNQL 4A3LH 4LUOA 1KC8C 3K80C 1QVGA 1IL2A 4JOIA 3W5OA 1M1KC 3PUWA 2KCTA 1TWGH 3NENA 1NE3A 1Q1BA 3D31A 4JI4Q 5JEAJ 2K75A 3U4ZA 4DPGA 1FL0A 2I5MX 2E5LL 2ZJRA 1VS0A 4P74A 4LF9Q 1MJCA 4A4IA 1M90C 1O7IA 1CKMA 1X6OA 4BBRH 2UXDL 3M4QA 1UWVA 1VQLA 3S1QH 4KHPL 2B3GA 4DR3Q 1PFSA 2KHJA 2WB1E 1PH5A 1XTDA 4DR2L 4A93H 1W3SA 1WI5A 2CWPA 2K5VA 3CCMA 2F4VL 4OWXB 5JEAG 2UU9Q 1N34L 1WCMG 1Q86C 2KHIA 4DV5L 4BY1G 4UP7A 2JA9A 3TEHB 3OTOL 1UE1A 4A3GG 4BXXG 4IFDJ 3PV0A 1SLJA 5IY0A 2ZTDA 4R4CA 4GKJL 1E1TA 4JI6Q 2YYZA 4KHZA 4NPSA 5JJLA 1BBUA 4BA2I 4R4IA 4A3KG 1RL2A 4GLAC 3GTMH 3HOVH 3TREA 3U50C 1VQ7A 2CFMA 4DR4L 2VL6A 1XNQQ 3PO3H 1N32Q 3SGIA 4DNIA 5LMNQ 1K9MC 2GVBA 3ULLA 1GKHA 1VQEA 3HOZG 3H0GG 2KCMA 4X65L 1XMQQ 3FHWA 5IYDG 1EQQA 1EIYB 1SMXA 1N36L 2BH2A 1G291 2JK8A 3Q8DA 5IP9H 2BA0A 1I50H 5H1SE 5FLMG 1YIJA 1OXVA 1EOVA 3CP0A 3K81C 1ASZA 2GVAA 1UE6A 1YJWA 1E7ZA 4GN3B 3FKIH 3G48A 2HHHL 3PF4A 4IFDI 1QZGA 3D0FA 4OO1G 2UUAL 4IJHA 5HGQA 4X64L 4MTNA 1LYLA 2PNHA 4LFAL 5FLXc 4JI0L 2KENA 2ZTEA 1W2BA 4GLVB 4LNQA 4A76A 1YEZA 2F4VQ 2ZTCA 1N34Q 4OXPA 4JI3Q 1NTGA 3VDYA 4JYAQ 2VQFL 1HR0Q 4GN5A 3S1NH 3NELA 2WP8J 3F2DA 2NN6G 5GAGC 1WOCA 2I0QA 4LF5L 4A3DG 2UXBL 1WYDA 4DUZQ 1QVCA 1VQ5A 3GTLH 3E0EA 4YCVA 1YVCA 2AKWB 1WFQA 2RF4A 4QGUA 1L1OC 1N36Q 4DAMA 4A3LG 1OXUA 1P8LA 1TWAH 4POFA 3AFPA 4GNXC 2N8NA 1SN8A 2ES2A 3MEFA 1MKHA 3I56A 3RZDH 3I55A 2WFWA 1A0IA 4IPHA 2VQEQ 4GN4B 1AE3A 2XGTA 3J7ZC 1Q81C 1XNRL 1RIPA 2CKZB 1KRSA 2YV5A 4X62L 3JC66 3STBD 4LF7Q 2JA7H 1AE2A 3A5ZB 1B7YB 4BBRG 2HT1A 4B3SQ 3CMEA 4JV5Q 3RN5A 3GDEA 1A8VA 3STBC 1V9PA 3CPFA 4QY7A 3CCUA 1R9TH 5GAHC 3J80c 1VQAA 2MQHA 4TQUS 4ALPA 4A93G 3ULPA 2NZOA 2JA5H 2A19A 3H15A 3HOUH 3PO2H 4L5TA 4YWKA 4O0AA 1BVSA 2IX1A 3KJPA 1JJCB 2VQFQ 3PF5A 4LUZA 4DR1Q 1K73C 1KAWA 4R4TA 5EAYA 4AYBG 4JI7L 2UXCL 2A8VA 1E1OA 4NXMQ 3PUYA 4P75A 2R6GA 1KRTA 3UE1A 2ZM6L 1C7YA 1JT8A 4LF5Q 3FP9A 3HOVG 2YTYA 1IZ6A 2WAQE 4BA1I 3PO3G 3PIPA 1VQBA 2EQSA 3UDXA 2MFIA 3KYHC 4KLKA 3HKZE 4XIGS 3PUXA 3CPWA 4RG1A 1QUQA 4DV6L 5M3FH 2AWNA 3NEMA 4LFCQ 1VQ6A 3PO2G 3AYHB 5IP9G 4B3RL 4JG2A 3CC7A 1UE7A 1PHJA 4IJLA 4JOIC 4HIOA 1K83H 1EUJA 3KLWA 3CQZH 1IYJB 5M5XH 1XMOL 1ASYA 2K50A 1OXTA 2Q2IA 3J80i 2IX0A 4NXNL 5M3MH 4YHHL 4DV1Q 3AFQA 4LW1A 2E2HH 4JBMA 1KXLA 1QUQB 4DKAC 1HNXL 5LMNW 4L5SA 3M3YH 1JB7A 2YTVA 1KHIA 1NMFA 1YBYA 3RLFA 3I7FA 1J5EL 2JA6H 4YWLA 3ERSX 5BR8L 5AJ3L 4B3TQ 3GTGH 4WJ4A 4JBKA 4UP9A 3CCLA 2NVXH 1K0RA 3KDFA 4DR5L 1X54A 3BJUA 2PI2E 2E8GA 2F3IA 1K8AC 3A74A 4O2DA 4JI2L 1P16A 2RHQB 4A3MH 3K8AA 2UUCL 4A3FH 3KDFB 5C0XI 4X66L 4HJ7A 5C4XG 2ZM6Q 3GTKH 3JAMc 3CD6A 3OW2A 4PZ6A 2Q2TA 1PH8A 3J81j 1PH3A 2OCEA 1IBML 2WB1G 1TXYA 2JE6I 2N49A 4P73A 4JI1Q 4LF4Q 1TWCH 3WWVA 3BU2A 4X6AH 3BZKA 1VQ8A 4J15A 1SROA 1Y14B 2V1CC 2RCNA 4DUYL 4PZ7A 1YZ6A 1HR0W 2Z6KA 2RHSB 3HFZB 4DK6C 2MNAA 2QA4A 2NVTH 1Z47A 3L0OA 4BBSH 4JI5L 3I4NH 4OONA 2VUMH 4KI0A 1QVFA 2E5LQ 2HQLA 4XTCS 2OQKA 1I6HH 1C0AA 4R1JA 1WJJA 1OXXK 3A0JA 3CF5A 4A3BH 1Q82C 2UUBL 2BH8A 2JA7G 4AQYL 3HOYH 4DR6L 2UXDQ 2D0OA 4KHPQ 1HJPA 3UDGA 4DV7L 5C3EH 2MO0A 3CCQA 4DR5Q 3CAMA 3NBHB 3ICEA 4C2MH 3S2HH 1FJGL 4A3JH 1S40A 4IPCA 4DR2Q 4RMFA 1PA6A 1E24A 4PG3A 1SRUA 4QJFA 4R4OA 1VQJA 1HZ9A 2JA5G 3HOUG 5LMUL 3TQYA 4DV4L 3S14H 1VQHA 5FJ8H 1QZHA 4DV5Q 1H95A 3OTOQ 4UPAA 5K36G 4LF8L 3TS0A 1BKBA 4C3HH 4X66Q 1UE5A 1FVIA 3KJOA 3I4MH 1GVPA 4YCUA 4GKJQ 2B29A 4YWMA 3S2DH 4BY7H 1LM0A 4IPDA 1IBKL 2R93H 2D62A 3F1ZA 4DR4Q 5GAEC 3J7A5 4YY3L 2R7FA 1EYGA 4GKKL 3S16H 1X3FA 4X65Q 3F8TA 5M3FG 1PYSB 4Y52H 1C9OA 1NBWA 3F2CA 3L7ZC 3S24A 3T1YL 2IT1A 4DV3L 4JI5Q 1SFOH 3CC4A 4FDBA 1DGSA 1EIFA 1WCMH 2ID0A 1Q8KA 3W1BA 1S3OA 2MO1A 4HJ5A 5M3MG 4A3EH 3AQQA 2HHHQ 2UUBQ 2ZJPA 3UE0A 4UY8C 4AQYQ 2E2JH 2UUAQ 3EN2A 4X64Q 1I3QH 3HOWH 2R7ZH 1N33L 4LFAQ 2JA6G 2K5HA 4JI0Q 4DV2L 3T1HL 2LSSA 4JI8L 1HH2P 1YI2A 2IY5B 3RNUA 3M85A 1YNXA 1MIUA 4GNXA 4K0KL 4LFBL 3I4OA 3RR5A 1E22A 1Z9FA 1HNWL 2GN5A 1OXSC 1X3GA 3J81c 4A3MG 4DK3C 2OTLA 1AH9A 3HKSA 3GTOH 3S1MH 2Y0SE 3TS2A 4A3FG 4OWWB 1K3RA 2XTIA 3LGJA 3PCOB 1IBKQ 2B63H 4P72A 1I94L 1IBLL 3B6YA 1Y1VH 1S72A 1NJIC 1CKOA 1Q7YC 1JJ2A 2E2IH 4JI4L 4GNXB 2VY3A 1YHQA 2ATWA 4AYBE 3GD7A 4GKKQ 2UXBQ 5IYBH 1X55A 2PI2A 1LUZA 5C4JH 4EQ5A 1B70B 3PSIA 1BBWA 4UP8A 4YCWA 4HJ8A 3BZCA 3T1YQ 1XPUA 3KFUA 3PGZA 4DR3L 1YITA 3H3VI 2HIVA 1JJGA 2JEBI 2JEAI 2VNUD 4C3JH 1JE5A 2AMCB 4BBSG 3I4NG 4POGA 2VUMG 3K7AH 1VQKA 2I5LX 3KF8B 1EWIA 5C0XJ 3F2BA 2UU9L 1XNRQ 4GOPA 3M7NA 3FKIG 4H02A 4X62Q 4A3BG 4QQBX 1XJVA 2YU9H 1VQDA 3HOYG 3T1HQ 4A75A 3CCEA 4DV0L 4R4QA 1UEBA 3GO5A 3M9BA 3GTPH 3OYYA 3HKZG 4JI6L 2OQ0A 5C3EG 5C44H 2VS1A 2EXDA 3PUZA 1Y1WH 4A3JG 1TWFH 1TWHH 4K0KQ 4JC0A 5HY6A 4LFBQ 1VQ4A 2CQOA 4GOPB 2NZHA 3CC2A 1HNWQ 1U5KA 5LMNL 2IHEA 1VCIA 3RLNA 4C3IH 5C0XG 1VQCA 5FJ8G 1SE8A 4HIMA 3RZOH 1XMQL 1EQRA 4IPGA 4DAYB 2R7DA 1D8LA 2K4KA 3K0XA 4JI7Q 4LF9L 2NVYH 1I94Q 1V43A 3E9HA 1IBLQ 3I4MG 1XPOA 2UXCQ 4LF6L 4BY7G 2PQAA 1IXRA 2K52A 3S17H 2R93G 3M4PA 2NVQH 2BA1A 3CCRA 2DGYA 1PH4A 4AIMA 3H3VH 2FXQA 3TRZA 2EIFA 4DV6Q 1HZBA 3ER0A 1PH6A 5JJKA 4OX9L 4A3IH 4A3CH 1SR3A 5J3BA 1YHBA 5GROA 4L5RC 4B3RQ 2PQAB 4PMWA 1D7QA 2AWOA 2JJQA 1X65A 2Z6KC 5GQOA 1XMOQ 2R92G 4WJ3M 5IYCH 1CKNA 4YHHQ 3ZJYC 4NXNQ
chains in the Genus database with same CATH superfamily
2KOLA 3KF6A 4P71A 1B9NA 4V0BA 3D8GA 2IWHA 4JYAL 1HR0L 4P2CB 2PZWA 2A6HD 1A63A 3VYRA 1JOQA 1NCVA 3G71A 2K5QA 5ELNA 2Q2UA 1WTRA 5CBAE 3GTPB 4HIDA 5TSSA 3EBEA 2UUCQ 3KK7A 3EIVA 1I4XA 3MWYW 4R8IA 2K33A 2B63G 2PCFB 5ELOA 5IE8A 1J6QA 1STYA 3PIOA 5IYBG 3W3AA 2RSOA 1VQPA 1NMGA 3AB9A 4OX9Q 1CSQA 4JV5L 4DUYQ 3E9IA 1A2UA 4LWCA 1VQGA 2A68C 1Q12A 3M4OH 2H5XA 4X3SA 3RD4A 1EY6A 5JEAH 1TWCB 5E7NA 3V2TA 1L2FA 1VMCA 4A3GH 2AHOB 3A5UA 4DR1L 3QWNA 3OWEB 3GTJH 4BBSB 5C44G 2ZJQA 1I6HB 3FPPA 2QEJC 4GLXA 1QJOA 2QGQA 1QNKA 5IYDH 4ZCKA 3HOXB 5FLMH 3HKZB 2Z1CA 5JVH3 1EYCA 2ALYB 1EFWA 1Q46A 3L2PA 2LFNA 4KN7C 4RHSA 3CXCA 1AP0A 5EKKA 4DR7Q 1ICFB 1B3QA 5FOBB 5IT9E 1A15A 1RF2D 1U0LA 3NE5B 1S5FD 3X3NA 1VQMA 3AEVA 3IRBA 5BN3A 1GO3E 4KKUA 4FXGC 1D5ZC 4IUTA 1U4MA 3MVVA 3SK5A 2WAQG 4DV2Q 1UEAB 1X3EA 3DUZA 3J81i 1GM5A 2LXKA 2NN6H 2OWOA 3R8BA 4BY1B 2SOBA 1N32L 4A3LH 1HQRD 1PTOD 1QCBD 4JOIA 5BN5A 1M1KC 2H1EA 2KCTA 3SDZA 2XN9C 1H9KA 1SXTA 1HFNA 3QJYA 5JEAJ 2K75A 3U4ZA 4DPGA 1FL0A 3H0GB 4FO2A 1VS0A 4FF4A 1MJCA 2SNSA 1CKMA 2EY6A 1X6OA 1A3VA 3GTQB 1M4VA 2UXDL 3M4QA 5DM63 5E4XA 2NZ1D 4I7ZC 4DR3Q 2B2YA 3VR5A 1XTDA 5EBCA 4A93H 1KLUD 2F4VL 5JEAG 1GHJA 1WCMG 1GUTA 4A3GG 1DXMA 3TEHB 4IFDJ 3PV0A 4GKJL 3K0YA 5D3DA 3DMUA 4JI6Q 5JJLA 3TP5A 4IZ8A 3HZXA 3U50C 4DR4L 2VL6A 1U9RA 3ULLA 3EQLC 4X65L 1EIYB 1EQQA 5IYDG 1G291 2XIWA 5FLMG 1STHA 1I50H 2BA0A 3T56B 4EVOA 1H9JA 3CP0A 1TWHB 1BO0A 3NK9A 4IFDI 3D0FA 4X64L 4MTNA 4CJ0B 2G9DA 1F9PA 2Z9HA 4LFAL 1TWGB 5FLXc 1TIID 4JI0L 3BS1A 1EYAA 3N6RA 2E2DC 4LNQA 3T4AC 1O7YA 2ZTCA 1N34Q 1LACA 1LT4D 4WFN3 2OT2A 3S1QB 1BR9A 4CKBA 1NTGA 5IODA 3Q6SA 1JB3A 4CHTB 5IIFA 4JYAQ 1V1PB 1HR0Q 1TT2A 5A2QL 4U68A 3S1NH 2NN6G 1X3PA 4YCVA 1T5EA 1YVCA 5EQ0A 4A3LG 4LJZC 1L1OC 4QCLA 1P8LA 1TWAH 3SXHA 4POFA 3I56A 1Q81C 2YV5A 4X62L 3STBD 2JA7H 1AE2A 1JOOA 4JV5Q 3GDEA 2F0GA 1ENAA 1MD2D 5LL6X 3K58A 4A93G 3ULPA 1EY7A 2A19A 2JA5H 4O0AA 4C1NK 4DR1Q 3A8JE 1KAWA 4AYBG 2UXCL 2A8VA 4P75A 3R2TA 1JT8A 5CBEE 2EQSA 1II3A 2MFIA 3UDXA 3PUXA 4RG1A 1U4RA 2AWNA 3NEMA 1D1IA 3AYHB 1SNOA 4KD4A 1PHJA 3TN2A 4HIOA 2KCNA 1K83H 1EUJA 3KLWA 1PTOF 4L63B 1JB7A 1KHIA 1YBYA 3RLFA 4WJ4A 1ESRA 3K5OA 3KBXA 1C8CA 2NVXH 5JJZA 2B2UC 2M2LA 3BJUA 2RA4A 2F3IA 3A74A 4JI2L 1P16A 5IGDA 2F0WA 4CJ1B 4X66L 4HJ7A 5C4XG 3GTKH 4KKTA 3V05A 1RD9D 1PH8A 1EZ8A 2OCEA 2WB1G 1TXYA 4FNFA 3WWVA 3BU2A 4X6AH 5KGUA 4LAAA 2L11A 1SROA 2RCNA 1NR4A 3FMCA 4CGYB 4S3SA 3NBHA 2LKVA 4JI5L 3I4NH 2L9HA 4MTKA 1OXXK 3A0JA 3CF5A 5M3FB 4FF2A 4KV6A 2JA7G 1EZ6A 2UXDQ 4HAEA 3CQZB 2J0TD 5C3EH 3CAMA 3KBGA 5M3MB 5I4DA 3S2HH 4IPCA 4RMFA 1SYEA 5CGKA 4PG3A 4ZLTF 5IGFA 2WIIB 1VQJA 1HZ9A 2JA5G 5LMUL 4DV4L 4TRDA 1QZHA 4K6DA 1RTNA 3TS0A 1SNQA 3KJOA 1FVIA 3I4MH 4GKJQ 3HEJA 2D5DA 4BY7H 1LM0A 5I2XA 3MXPA 2C5CA 3NQIA 4DR4Q 5GAEC 1S5CD 1JCKB 5LHY1 4YY3L 4GKKL 3DEOA 3MZ5A 4A3FB 4X65Q 3F8TA 4IUUA 4IALA 1B2TA 1NBWA 3VYUA 5C3XA 2BE5D 2IT1A 2TSSA 4DNTB 1ESFA 1XX8A 4JW0A 2CQAA 3DXJC 3GV3A 1J8IA 1PRTD 3W1BA 2FFKB 2MO1A 2AUJD 4A3EH 3AQQA 4UY8C 2ZJPA 3TSSA 1BF4A 2E2JH 4X64Q 2JXMB 4HMIA 2R7ZH 1N33L 4LFAQ 2K01A 3K6OA 2NVTB 4JI0Q 4MHEA 3CHBD 3T1HL 1CFMA 2N88A 2AQ2B 2IY5B 3JAME 3J81L 4GNXA 3FEWX 3HKSA 4C2MB 5FO7B 1BDOA 1PTOH 1K3RA 2XTIA 3PCOB 1IBKQ 1I94L 1JJ2A 2CVRA 3DEPA 1D2BA 4IUQA 1X55A 1LUZA 2RDFA 3E3XA 3IKJA 4C3HB 4XXEA 2F0NA 4EQ5A 1BBWA 1UUPA 4HJ8A 3S1NB 1E2ZA 3PMFA 2R93B 1JWSD 1JJGA 2JEBI 2JEAI 2AMCB 1PXUA 2BCOA 3I4NG 1DM0B 1EWIA 3CRLC 5KNDA 3FKIG 1BQQT 4H02A 4X62Q 4QQBX 3M7GA 1ZYRD 1TWAB 2HD3A 3NWSA 4R4QA 3GTPH 1Z7TA 4YIJA 5C3EG 2EXDA 2F0IA 1TWFH 2F0LA 4K0KQ 1QNUA 3HOWB 3CC2A 5LMNL 2IHEA 3RLNA 2FINB 3NP8A 1KDAA 4HIMA 1SYBA 2KEDA 4DAYB 2M9VA 2B2WC 2UXCQ 3I4MG 1V43A 3E9HA 1XPOA 4DNRB 4BY7G 5CV7A 2BA1A 2DGYA 1PH4A 4AIMA 2K28A 3S1MB 2WINB 2EIFA 3BDOA 4OX9L 1Y1VB 4A3CH 4WRDA 2E2IB 1H9RA 2F1MA 2Z6KC 2O4XA 4L8JA 2L4NA 4A3EG 1SNCA 5IT9c 4NB3A 1SYGA 1GUOA 4DN4M 3OSOA 2N3SA 4N8FA 2R7ZG 1X3QA 1VQNA 4AH6A 4IO9A 3MA2B 1FR3A 2QEXA 3HOXH 1KIXA 5FKAC 1GUWA 3OMCA 4PZ8A 2RQXA 1GD7A 3KF6B 4JI2Q 1VQ9A 3MFGA 2N78A 5I2YA 5KIXA 1Y1WB 4LF6Q 1Q1EA 3RUZA 3U58A 5FLXL 1SNMA 2VQEL 1ICWA 5A35A 4LF7L 1NSNS 4DR7L 4L5QA 1YJNA 3CCVA 1K8GA 3DM3A 1AZPA 1PH2A 4B3SL 4M8AA 1G6PA 1S5ED 4OO1I 4MZ9A 2KBNA 3P20A 1EIGA 1LTLA 1NUCA 2PW7A 2A1AA 1L0WA 1JMCA 1NY4A 4QIWE 4PMCA 1RCVD 4BY1H 4CDFC 4A3IB 2Q2HA 1TS3A 1MHWC 4EQPA 1PH7A 4NXML 4FXDA 5KYIA 5M9OA 3K57A 2XRSD 1KD1C 5CC4A 4HIKA 1L1OA 5LMUQ 4DV4Q 2NUCA 3QG1A 3H0GH 1STGA 1HA5A 1MSHA 5FK9C 1PVOA 3GTQH 2F0PA 4DXFA 3LWUA 1VQOA 3CMAA 3QR8A 2CCZA 4DV1L 3I73A 3Q0AA 1XPRA 4FF3A 4YY3Q 4TVAB 2JQOA 3IFDA 1PV4A 5JJIA 4JCVE 1IW7D 4A3CG 3CCSA 3TP7A 2ASBA 1ET9A 1ZEQX 1V1QA 1JICA 4NDXA 1N33Q 3K7UC 2CWAA 2QCPX 5EBDA 1QILA 3HOXG 1HZAA 2GA4B 4HJ9A 3S1RB 3GP7A 2JYOA 2RDHA 2TMPA 1B1ZA 3W2DA 4LF4L 3SK4A 4R8NA 3K80C 5IOCA 4XQQA 1QVGA 3W5OA 2MJ8A 3PUWA 1FD7D 1TWGH 3TP6A 1CQFA 1Q1BA 2K03A 3HOZB 2ZJRA 4F88A 1VMPA 5HGTA 1M90C 5KYLA 3KLSX 2R92B 1DOKA 3MXGA 4X3KA 3D4RA 3S1QH 3SEBA 1F2ZA 2B2UA 1PFSA 2KHJA 2E74C 4KKSA 3TZUA 1WI5A 2CWPA 3CCMA 1N34L 3J7AV 2ZT9C 4DV5L 4BY1G 4UP7A 3ONAB 1UE1A 3SVMA 3I72A 2A69D 3L3OC 3D3RA 4H13C 1LTAD 3TBIB 1LTTD 1BBUA 3TDQA 3U9SA 3KLRA 4F8MA 2CFMA 3NTHA 2NTSA 5LMNQ 3PIO3 3H0GG 2KCMA 3VR3A 1SMXA 1YIJA 5H1SE 2B39A 1EOVA 3DWQA 3G7LA 1YJWA 1TWFB 1E7ZA 1BUVT 1Y8PB 4GN3B 1PFBA 2HHHL 1QE6A 4QIWB 4IJHA 4ZKCB 1LYLA 2PNRC 1NR2A 1SMYC 3NBIA 3A56A 2QW7A 3T16A 1YEZA 3OWFA 3K5NA 1SYDA 2F03A 2OXPA 4RCNA 1HFGA 4ME5A 1KTKA 4K8IA 3F2DA 4DFAA 1TS4A 2MUYA 5GAGC 1QVCA 1TS2A 3E0EA 2AKWB 4QGUA 4JPBW 5EJWA 4GNXC 1E0BA 3NQTA 4X3TA 4IFDH 1TKWB 2N8NA 4TKOB 1SE2A 1EU4A 3MEFA 3PO3B 1A2TA 1I4QA 2VQEQ 4IUNA 3A7LA 2CKZB 1PRTC 3JC66 4LF7Q 2EOTA 3A5ZB 4LMQD 2HT1A 3J80L 1R4QB 4B3SQ 3CMEA 3VYTA 1TVXA 3CPFA 2JP1A 5GAHC 2MQHA 4TQUS 3FVQA 1X32A 1BVSA 2IX1A 2VQFQ 3PF5A 4R4TA 4NXMQ 1B53A 1R4PB 2Q8IB 1AEXA 3PUYA 1ONLA 2R6GA 3PQIA 3D6CA 4LF5Q 4DA2A 1IZ6A 2WAQE 4BA1I 1NNXA 1VQBA 3KYHC 4XIGS 2D2CC 1QUQA 5M3FH 1CI3M 1VQ6A 3OHXC 3CC7A 2XWBB 3CQZH 1IYJB 1KDBA 1XMOL 5EGTA 2K50A 1OXTA 1E2VA 5M3MH 4DV1Q 4F87A 3GTLB 1BCPB 3AFQA 4LW1A 4KMUC 2E2HH 1KXLA 4L5SA 1J5EL 3I7FA 2F0DA 3ERSX 2I07B 3RZDB 4UP9A 3CCLA 1HHVA 4QMGA 3BDCA 1X54A 1DJRD 1AZQA 3OMGA 2E8GA 1O7ZA 1K8AC 5A2QE 5NUCA 5CMDA 2B2WA 1G6ZA 3K8AA 1R9TB 4A3FH 4WORA 3JAMc 3C46A 2Q2TA 3J81j 1PH3A 4F7XA 2CW0C 1Y8OB 4P73A 4LF4Q 4FP5D 2AUKA 2HDLA 2V1CC 1UNSA 1Y14B 2KCCA 1Q8IA 3C3LA 3MHBA 5IT9L 2VB2X 4PZ7A 5JPNC 2KQ3A 2Z6KA 3BG3A 3HFZB 2QA4A 4QF4A 2NVTH 4IFDG 3L0OA 2WKDA 4OONA 1QVFA 4XTCS 2OQKA 2PPBC 2HCCA 2BH8A 3DWAA 3WDNA 1S5BD 2HUGA 4DV7L 2CH4A 1K28A 3ICEA 3NBHB 1CHQD 4H0LC 4ODGA 4C2MH 1S40A 2X6LA 1IHZA 3IFTA 3M3YB 5IGEA 2JA6B 1GXDC 3GTGB 1VQHA 1SJED 4DV5Q 3OPOA 3I91A 4U673 1SBBB 1BKBA 1EYDA 1KDCA 1YNND 2IL8A 4C3HH 4PMBA 2B29A 1AFPA 3KUPA 1IBKL 3NXWA 2R93H 2D62A 4Q5VA 3J7A5 1L0XB 1VDZA 1TY0A 2EYFA 2O2LD 3QOLA 5M3FG 4ILWA 3F2CA 5JOBA 4IUVA 1YNJC 2WV6D 4DV3L 1JWMD 1HQMC 1EIFA 2ID0A 1Q8KA 2F0HA 1S3OA 2HHHQ 1TU2B 5M3MG 3J7YW 1SYFA 2UUBQ 4FVMA 1K3BC 4RAUC 3HOWH 1A6XA 5IGGA 2D9UA 4JI8L 2VUMB 3RNUA 1QWYA 2Q8RE 1RKNA 2K5WA 1WTXA 4K0KL 3R93A 1OXSC 1M8AA 2OTLA 4ZUIA 3S1MH 4A3JB 2Y0SE 4A3FG 4OWWB 3LGJA 1Y1VH 2BDOA 2E2IH 4GNXB 1YHQA 2O5JC 4AYBE 3GD7A 3NPPA 1GUSA 2BOSA 3KF8A 1IKMA 5C4JH 1B70B 3PSIA 1EWHA 4YCWA 3F2UA 3S2DB 1DOMA 3KFUA 3PGZA 1C4QA 3BYTB 1JE5A 2DJGC 2I5LX 3NWTA 3M4YA 2UU9L 2F0UA 4JK1C 1O80A 5CV8A 3CCEA 1SFOB 1UEBA 3GO5A 4C56C 4H44C 3OYYA 1I4HA 3I70A 1H9MA 1S5DD 1CT1D 2VS1A 1Y1WH 4N9TA 5D3IB 4JC0A 3SK8A 4LFBQ 2NZHA 5DAUA 1HNWQ 2PQEA 2EYHA 1VQCA 1SE8A 4DXGA 1ML0D 5C6AA 1EQRA 1PFNA 1D8LA 2R7DA 2OEOA 4C3HG 2A6ED 2F0KA 4LF6L 2PQAA 1IXRA 2R93G 2SDFA 3LNNA 1EY4A 3M4PA 1SNDA 4XT3B 3GTOB 2FXQA 1WVLA 1HXYD 3ER0A 1EIHA 5JJKA 4A3IH 2PW5A 1PMRA 4L5RC 1G2SA 2F0MA 3VR2A 2O5IC 3FDTA 1LTGD 4KK7A 2JJQA 1XMOQ 5IYCH 1CKNA 4UHVA 3OOCA 3QOJA 2KECA 5IP7H 4JI3L 2QDBA 2EYMA 3HOWG 1J5EQ 1J9OA 4RH6A 2C35B 2K14A 3J81E 4C3JB 4RWSC 2A69C 5DNFA 1SJHD 3WOFA 3Q22A 1VQFA 2X69A 2EJGC 1F9SA 4NW2A 2E2HB 2VZAA 3U4VA 4DUZL 2A6HC 5I6WA 3UDFA 1H9SA 1N9WA 1LTBD 4OWTB 2VW9A 1PYBA 2IHFA 2NTTA 3URYA 1PZID 1Y1VG 3RN2A 3MXNA 1I6VC 4O1NA 4GS3A 3I4LA 3C1EA 2NVYB 1STAA 2A68D 2RSNA 1B50A 1CSPA 1MJEA 3S17B 2NVQB 4PNYA 3ND8A 1KL9A 1HZCA 2K05A 4KN4C 3A54A 3G4SA 2PMZE 3S1RH 1STNA 2ZXPA 1EY5A 5CV4A 1PH9A 3S9WA 1B8AA 2BDNA 4K5VA 4DV7Q 2MGSA 1I5FA 4IOCA 4OIJA 1KQSA 2LXJA 1Y1WG 5DLQE 2QF7A 4XYOA 5CV5A 2EVBA 3HOZH 5M5WH 3PIP3 2R92H 4RCOA 2KUMA 2E76C 1Q3LA 4ZKBB 1LT3D 3CW2C 1N8RC 2A5HA 1JWUD 4G7HC 2JA8B 2LS01 2B8FA 1L1OB 1FNUA 3S15H 2IX3A 4OO1H 2K5NA 4ID6A 2I5HA 4B3TL 4RGMA 3HS0C 4HMJA 1B44D 4A3IG 1RJTA 4CKCA 5EKLA 2YTXA 5IWAQ 4HCSA 1G51A 1V8QA 4DV3Q 4ZYSA 2G9HD 1XYIA 3RMHA 1BCPF 3A8IE 2G5DA 5IYCG 4B3MQ 4N9PA 1DYQA 2ICEC 3P75A 4K2KA 5IP7G 3RLOA 4GOPC 1HNZQ 1DCZA 4HSVA 2K1BA 1X9NA 3LWEA 5AFWA 4JI8Q 2DUDA 2XNAC 1TR5A 1PH1A 4BS9A 3ULJA 3VYSA 3KOJA 4HJAA 4LUOA 4X3UA 5FLXE 1U4LA 4A3KB 1W6JA 4I7AA 1SDFA 1NE3A 1PTOC 3NENA 1KNAA 4HTHA 1PLFA 2I5MX 3BVMA 4P74A 1O7IA 5C4ZA 2B2TA 4BWGB 5C4HA 2XWJB 1UWVA 1VQLA 4OIKA 2B3GA 1ILPA 3BVZA 4OWXB 2UU9Q 5C4JB 4Z9CB 2JA9A 4RGTA 1ENFA 1E1TA 2HCIA 2RVLA 2YYZA 4M1UB 2AQ1B 4BA2I 1LT6D 2HDMA 4JVZA 4GLAC 3HOVH 1XNQQ 3PO3H 2EY2A 3SGIA 4DNIA 1WTWA 1VQEA 1I4RA 3HOZG 1JOKA 3FHWA 1F9QA 2JK8A 3Q8DA 5IP9H 2R92G 3H6MA 3K81C 4QUCA 2GVAA 4A3DB 3LX0A 1KNEA 3G48A 1BNZA 4ZRZA 3I90A 1QZGA 1E2WA 4OO1G 5HGQA 1W2BA 2WKCA 2ZTEA 1C48A 1EQVA 4A76A 3EFXD 4OXPA 4BBRB 2K5DA 4L6TB 4JI3Q 1SNPA 4G7ZC 3EA6A 3BDLA 2VQFL 2RDGA 3NELA 2WP8J 5ELEA 1CK1A 1WOCA 2I0QA 4LF5L 1RHPA 2UXBL 1WYDA 4DUZQ 1VQ5A 1RODA 1I4PA 3GTLH 1N36Q 2RF4A 4DAMA 3VA7A 1GUGA 3GV6A 1S4ZA 2RBMA 2B2VC 1SN8A 2ES2A 3RZDH 2IPKD 3I55A 1A0IA 4IPHA 4IN3A 1XNRL 2H4OA 3AU7A 3PO2B 3RN5A 4MIUA 1A8VA 3STBC 3T53B 1V9PA 1R9TH 3CCUA 3BYYB 5CV9A 2MP1A 1EY8A 4ALPA 2NZOA 2KJXA 4YWKA 4RGOS 1TQOA 1K73C 1STBA 2DNCA 1E1OA 3UE1A 3VR4A 1C7YA 3HOVG 1WD1A 1ILQA 1Z6HA 3PO3G 2DY7A 1QB5D 3HKZE 3SHLA 4HR7B 5IP9G 1UE7A 4IJLA 5JAVA 1ASYA 2Q2IA 4YHHL 1FYCA 1QG7A 4WJWA 1MBYA 4IUPA 1QUQB 3M3YH 1HNXL 3Q23A 5M5WB 2EPBA 2JA6H 5BR8L 1PDQA 5AJ3L 4B3TQ 2A73B 3GTGH 4O42A 3UI2A 1W6KA 3KDFA 1SE4A 2CH4W 3C2PA 2IJ0A 3S15B 4XQNA 2HQEA 1OO9B 2RHQB 3MXUA 4DF7A 1JQYD 4K2LA 1O7LA 5C5LA 5C0XI 3VA5A 2EY5A 2ZM6Q 4N8X1 5K5PA 4PZ6A 3HOUB 2K7VA 2KA7A 4CDDC 5I6YA 1IBML 2N49A 4HCEA 2L12A 4XDXA 4CKEA 3BZKA 1VQ8A 2F4IA 2L1BA 3MTSA 1HR0W 4DK6C 1F77A 2MNAA 1HTLD 2F0QA 2VUMH 4ZAIA 4OELB 3J80E 4R1JA 3C1FA 1Q82C 2UUBL 4DR6L 2Z4IA 1GHKA 5G3LF 3H3VC 1HJPA 5EKIA 5M5XB 1HA6A 2MO0A 1GOZA 5COYA 3CCQA 4J6HA 4DR5Q 3OW7A 3A55A 1FJGL 4A3JH 3NUCA 3MC0B 4QJFA 3S14H 2L5TA 3TQYA 1ENCA 4LF8L 1LTID 3MEHA 1CA6A 3E0JA 1CA5A 3S2DH 1DD2A 4IPDA 1UAPA 1KABA 1SEBD 4A3MB 2LY7A 3FPUB 3U9OA 1X3FA 4H7BA 1HCZA 2K32A 1HUNA 4HN7A 4C1NI 3O13A 4V190 2SNMA 2L0CA 1SFOH 2PZUA 3HOVB 3CC4A 4FDBA 3P7JA 1DGSA 4XT1B 1WCMH 4HJ5A 2BE5C 3UE0A 4AQYQ 1I3QH 3ZYYX 5I9PA 2JA6G 2K5HA 3NHHA 4ZK9B 2N55A 2LSSA 3Q24A 1B9MA 3M85A 4A3BB 2PZTA 1MIUA 2FJ2A 1LV9A 2F0FA 3HOYB 4LFBL 3RR5A 1E22A 1TS5A 1Z9FA 1HNWL 1X3GA 3J81c 1AH9A 3GTOH 4TSSA 2ICIA 5C3WA 4B08A 1GUNA 3MFYA 1CKOA 4CDCC 1U4PA 1Q7YC 4JI4L 1HRJA 5DEHA 2UXBQ 4CDEC 2PI2A 1CM9A 4EGVA 1LLRD 3SE0A 4K8JA 4DAPA 3BZCA 3T1YQ 1XPUA 4IURA 3HP3A 5IGCA 4RGNA 3H3VI 2VNUD 4C3JH 3DWPA 5E4WC 2JN4A 5KRUA 2F0JA 2VUMG 3S16B 3KF8B 3F2BA 4DK0A 2WACA 1XNRQ 4GOPA 1VQDA 2XSCA 3M9BA 1PYWD 2OQ0A 1V1OA 1ZYRC 2B2TC 4A3JG 2EYLA 5HY6A 2FMMA 2CHBD 2F0EA 1F9RA 1VCIA 4C3IH 2EZVA 4FXKC 3DHQA 1DONA 1XMQL 2MHVA 4IPGA 3K0XA 4LF9L 2NVYH 1IBLQ 2Z6BA 5D65A 1RDPD 3HG9A 2K52A 1D1KA 3T51B 3S17H 2NVQH 3A7AB 4ULLA 3TRZA 1HZBA 2B63B 1SR3A 3CRKC 4R9WA 2XVSA 1WTOA 2PQAB 4PMWA 1D7QA 4J8QA 5GQOA 4YHHQ 3ZJYC 3GTMH 1HNXQ 2QILA 2J7ZA 4ME3A 4DV0Q 5BR8Q 5AJ3Q 1EL0A 2D0PA 2F3VA 4DU9A 5J22A 3W1GA 1T9HA 2EDGA 3K7AB 2Z8LA 1B3AA 1CKNB 4CBVA 1EY0A 2DJFC 2JA8H 2YU9B 3JAMi 3CCJA 2V4DA 1JE4A 4KY7A 3GQBA 5C44B 2C9OA 4QL5A 2PO4A 3QIAA 5T1IA 3NTKA 3TP8A 1BBXC 3RZOB 2Z0SA 1IBMQ 1H9SB 1B4OA 3H09A 2F0OA 3R2IA 4APVA 3K5MA 1G8ZD 1OTCA 5CV6A 2RCFA 1EFID 3MXNB 5IWAL 4C3JG 3ERQA 4IOAA 1VQIA 3UDIA 3H91A 4MNOA 3V96A 4OEMB 3I2ZA 4KY5A 1PFMA 4PQXA 4B3ML 4DR6Q 4BXXH 1EEFD 4RKLA 5C4XH 3SR1A 1HNZL 1F2YA 1I4GA 4UAIA 4A3KH 1FJGQ 4CJ2C 1XXGA 1CTMA 3DLLA 1FNWA 1IYVA 2R3ZA 1D6EC 3CU7A 3D6WA 1YJ9A 1WD0A 2B8GA 2KHSA 4C3IG 2WAQB 3R3OA 5GADC 1A62A 2NN6I 2B2VA 4LF8Q 2NYZD 4LFCL 1HTPA 3VR6A 1RTOA 2F52A 2EYPA 1E3PA 3S14B 1NAPA 4EX5A 1BCPD 4JBWA 4Y7NH 2EJMA 3H94A 1FGUA 3T13A 4LUVA 2ZXRA 1YHAA 1X56A 4KHVA 2DN8A 1PRTB 1IW7C 2Y0SG 1KLGD 3QB3A 2HIXA 4JBJA 1CUKA 4G7OC 2OTJA 3PUVA 5CYUA 1WTQA 2L15A 5M5YH 3M4OB 3G6EA 1LO5D 1DOLA 1WCMB 5FO9B 1EWCA 4A3GB 4A3DH 1CHPD 2JA8G 4JI1L 1I3QB 1XNQL 1XWEA 1KC8C 1HPCA 3GTJB 1IL2A 5IGBA 2F3WA 4K5XA 4I65A 4XQJA 1D5XC 3A8KE 3D31A 4JI4Q 5CORA 2E5LL 1MSGA 3CKIB 4A4IA 4BBRH 1SAPA 4KHPL 4MN3A 1HUMA 2WB1E 1WTVA 1PH5A 4DR2L 1W3SA 2KVMA 1LTRD 2K5VA 1EQTA 1ZXTA 1G2TA 1Q86C 2KHIA 4OHJA 3OTOL 4BXXG 5IY0A 1SLJA 3I3CA 2ZTDA 2EYJA 4R4CA 4KHZA 4NPSA 4R4IA 4K5WA 4A3KG 1RL2A 2K6AA 1G91A 3TREA 1GJXA 1VQ7A 2E75C 1N32Q 1K9MC 2GVBA 1GKHA 5EPKA 4LK1C 1XMQQ 2ENBA 2BH2A 1N36L 3PO2H 4LF9Q 1OXVA 2F0SA 1ASZA 1QOHA 1UE6A 3AMUA 1O78A 2R61A 3FKIH 1CQVA 2Z4HA 3PF4A 4C3IB 2F0TA 1SMYD 2UUAL 2NB0A 5D14A 2PNHA 3IAYA 1SYCA 2KENA 4GLVB 1V1PA 3OIPA 2F4VQ 3TMEA 1CZWA 3ND9A 3EJIA 5JPMC 1LT5D 2M00A 2NBFA 5ELCA 3VDYA 1DZ1A 2L55A 4GN5A 4A93B 3KLSA 5E1FA 2Y0SB 4ZUJA 1Y8NB 3N52A 5LL6S 1JR0D 3GTMB 5EPLA 4A3DG 1A3UA 4AYBB 1BXTA 1WFQA 1OXUA 3AFPA 3K59A 2FHTA 5ELDA 2VB3X 1MKHA 1MI2A 2WFWA 2DNEA 4GN4B 1AE3A 2XGTA 3J7ZC 1RIPA 1KRSA 1I50B 1B7YB 4BBRG 1EEID 4RFBA 5T1GA 4QY7A 5KNCA 3J80c 1VQAA 1F2LA 3L9AX 3H15A 1SSOA 4KD3A 2P5ZX 4L5TA 4EQOA 3HOUH 2K04A 1SE3A 3HGBA 5K36H 3KJPA 1JJCB 4LUZA 1EY9A 4JI7L 5EAYA 1STEA 1KRTA 2ZM6L 3J7AF 3FP9A 2YTYA 3PIPA 1CZGA 4KLKA 4QUFA 1MGSA 2SEBD 3CPWA 4DV6L 5C4XB 5BN4A 2F0VA 2QDLA 4EQNA 3E6ZX 4LFCQ 3PO2G 4KY6A 4FYDA 4B3RL 4JG2A 2WB1B 4JOIC 1ET6A 4UDUC 1XTCD 5M5XH 1AN8A 5J39A 1T5XD 3J80i 2IX0A 4NXNL 5I9OA 5JVG3 2J4XA 4JBMA 4DKAC 5LMNW 5FO8B 2YTVA 1NMFA 5C5MA 4YWLA 3K5LA 4JBKA 1D5MC 4NKLA 1IL8A 1K0RA 2PYKA 4ABNA 4DR5L 1F2MA 2XRQD 3HRZC 3FRPB 2B2YC 2PI2E 2JA7B 2VXWA 4O2DA 5F2DA 4Y7NB 4A3MH 3JAML 3DM1A 2IW3A 2UUCL 3E5SA 1AW7A 2CW0D 3KDFB 2JA5B 3CD6A 3OW2A 3EVQA 1KAAA 4KJNA 1PZKD 2JE6I 5EPJA 4JI1Q 1TWCH 2A74C 3TZDA 4J15A 5M5YB 2LMCB 4DUYL 5KEEA 1YZ6A 2QKIC 2RHSB 1Z47A 5G3LD 1K0SA 4BBSH 5CR3A 4KI0A 1I6HH 2E5LQ 2HQLA 1C0AA 1Y69U 1WJJA 4DGZA 4A3BH 1LABA 2PMZB 4AQYL 3HOYH 2D0OA 4KJOA 5L37A 1WTPA 4KHPQ 1K83B 3UDGA 2EJFC 5ISRA 4DR2Q 1PA6A 1E24A 1SRUA 4NMZA 4R4OA 3X3MA 3HOUG 3IL8A 5C0XH 1EU3A 3NSWA 5FJ8H 1H95A 2NWGA 3OTOQ 1LTSD 4UPAA 1Q90A 5K36G 4HSPA 2NVXB 4X66Q 1UE5A 2KEEA 1GVPA 4YCUA 4YWMA 2AQ3B 1TY2A 1FGBD 1YNNC 5ELFA 5J1ZA 3F1ZA 1EYGA 2R7FA 3S16H 1YNJD 4IQZA 3BZDB 1K8OA 3GTKB 1PYSB 4Y52H 1C9OA 3D4WA 3L7ZC 2EXZA 3S24A 5KNBA 3T1YL 4JI5Q 4J1MA 4NP5A 2UUAQ 1FNVA 3EN2A 4DV2L 3I4NB 1WTHA 1HH2P 1PRTF 1YI2A 3ITPA 3FKIB 1YNXA 2JSOA 4PV1C 3I4OA 2GN5A 1VF7A 2I46A 4A3MG 2MPMA 5C3EB 4DK3C 3S2HB 4FF1A 3TS2A 1VF5C 4B9XA 2B63H 4P72A 1IBLL 3B6YA 1S72A 1NJIC 2VY3A 4RHRA 2EE1A 2ATWA 4GKKQ 5IYBH 3I4MB 4UP8A 1BCPC 4BY7B 4ZQ3A 4K6LA 4DR3L 2ZXOA 1YITA 2Q8TA 5ELBA 2HIVA 1JORA 4QB4A 4G4KA 4BBSG 5HURA 1PZJD 4POGA 1IYUA 1ZKOA 2X6GA 3K7AH 5C0XJ 1VQKA 3M7NA 4A3BG 4RKBA 1XJVA 2YU9H 3HOYG 3T1HQ 4A75A 4DV0L 4DAYA 3MAQA 3HKZG 4DAVA 1L0YB 4JI6L 4K14A 3G6JB 5C44H 4KTAA 3PUZA 1EOTA 4A3EB 1K8MA 1TWHH 2E2JB 1VQ4A 2CQOA 4GOPB 2R7ZB 1U5KA 5C0XG 3D4DA 4DK1A 5FJ8G 3RZOH 4Q0FA 1JC7A 2K4KA 3BVGA 4JI7Q 3I8ZA 4OL7A 2EY1A 1I94Q 1A3TA 3SK6A 3NTIA 4E6IA 4G57A 2A6EC 2RKSA 3CCRA 3P1HA 3QO2A 2OF1A 3H3VH 1PTOB 4OGQC 3WOEA 4DV6Q 1PH6A 1IKLA 2EYOA 2DY8A 4XYQA 4GZYC 4RA8A 1BOSA 5J3BA 1YHBA 5GROA 4B9WA 5DM73 4B3RQ 5E3FA 2AWOA 1X65A 3OIQA 4HEDA 4WJ3M 2FMCA 3EROA 4NXNQ
chains in the Genus database with same CATH topology
4A3EG 4P71A 3KF6A 4NB3A 5IP7H 5IT9c 4JI3L 1HNXQ 3HOWG 4DV0Q 2N3SA 4ME3A 1J5EQ 2R7ZG 5BR8Q 5AJ3Q 4AH6A 2D0PA 2C35B 2K14A 4IO9A 1VQNA 4JYAL 1HR0L 2QEXA 3W1GA 1T9HA 3HOXH 1KIXA 1VQFA 1A63A 4PZ8A 1CKNB 3G71A 1GD7A 2JA8H 3KF6B 5ELNA 2Q2UA 3JAMi 2VZAA 3U4VA 3CCJA 4DUZL 4JI2Q 3UDFA 1VQ9A 4HIDA 1N9WA 4QL5A 2N78A 3EBEA 2UUCQ 4LF6Q 3EIVA 4OWTB 1Q1EA 2VW9A 1PYBA 2IHFA 2B63G 5ELOA 3RN2A 1Y1VG 3U58A 5IE8A 1J6QA 2VQEL 2Z0SA 4GS3A 1IBMQ 3PIOA 5IYBG 1VQPA 1NMGA 4LF7L 4DR7L 4OX9Q 4L5QA 1CSQA 3CCVA 1YJNA 3DM3A 1K8GA 1PH2A 4APVA 4B3SL 1OTCA 4JV5L 1CSPA 4DUYQ 4MZ9A 4OO1I 2KBNA 1G6PA 3E9IA 4LWCA 1MJEA 1LTLA 1VQGA 3MXNB 1Q12A 5IWAL 3M4OH 2H5XA 4IOAA 1VQIA 1KL9A 1HZCA 3UDIA 2A1AA 1L0WA 4MNOA 3G4SA 2PMZE 1JMCA 1NY4A 4QIWE 5E7NA 3S1RH 3I2ZA 1L2FA 4B3ML 4BY1H 4DR6Q 4A3GH 1PH9A 2Q2HA 4BXXH 2AHOB 3A5UA 5C4XH 4DR1L 1B8AA 1PH7A 1HNZL 4DV7Q 4NXML 1I5FA 3GTJH 5C44G 4IOCA 4A3KH 1KQSA 1FJGQ 2LXJA 1Y1WG 2ZJQA 5DLQE 4GLXA 3DLLA 1KD1C 4HIKA 1L1OA 5LMUQ 2QGQA 4DV4Q 1YJ9A 3HOZH 3H0GH 5GADC 5M5WH 5IYDH 1A62A 2NN6I 4LF8Q 5FLMH 4LFCL 2R92H 1PVOA 3GTQH 2ALYB 3CW2C 1N8RC 1Q46A 3L2PA 1EFWA 2F52A 3CXCA 1VQOA 3CMAA 1E3PA 2CCZA 1L1OB 4EX5A 4DV1L 3S15H 4DR7Q 1XPRA 4IFDG 2K5NA 4YY3Q 4TVAB 2JQOA 4JBWA 2I5HA 4Y7NH 1PV4A 5JJIA 4B3TL 1FGUA 1U0LA 4JCVE 4A3IG 4A3CG 4LUVA 1YHAA 2YTXA 5IWAQ 1G51A 1X56A 4DV3Q 3CCSA 1VQMA 3AEVA 2ASBA 2Y0SG 3IRBA 4JBJA 2HIXA 1CUKA 5IYCG 1GO3E 4B3MQ 1V1QA 2OTJA 5IP7G 3PUVA 3RLOA 1N33Q 4GOPC 1HNZQ 3K7UC 2CWAA 2L15A 5M5YH 2WAQG 4DV2Q 1X9NA 4JI8Q 3G6EA 1X3EA 3J81i 2DUDA 3HOXG 1HZAA 1GM5A 2LXKA 4HJ9A 1PH1A 2OWOA 4A3DH 2JA8G 3ULJA 4JI1L 3KOJA 4HJAA 4LF4L 1N32L 1XNQL 4A3LH 4LUOA 1KC8C 3K80C 1QVGA 1IL2A 4JOIA 3W5OA 1M1KC 3PUWA 2KCTA 1TWGH 3NENA 1NE3A 1Q1BA 3D31A 4JI4Q 5JEAJ 2K75A 3U4ZA 4DPGA 1FL0A 2I5MX 2E5LL 2ZJRA 1VS0A 4P74A 4LF9Q 1MJCA 4A4IA 1M90C 1O7IA 1CKMA 1X6OA 4BBRH 2UXDL 3M4QA 1UWVA 1VQLA 3S1QH 4KHPL 2B3GA 4DR3Q 1PFSA 2KHJA 2WB1E 1PH5A 1XTDA 4DR2L 4A93H 1W3SA 1WI5A 2CWPA 2K5VA 3CCMA 2F4VL 4OWXB 5JEAG 2UU9Q 1N34L 1WCMG 1Q86C 2KHIA 4DV5L 4BY1G 4UP7A 2JA9A 3TEHB 3OTOL 1UE1A 4A3GG 4BXXG 4IFDJ 3PV0A 1SLJA 5IY0A 2ZTDA 4R4CA 4GKJL 1E1TA 4JI6Q 2YYZA 4KHZA 4NPSA 5JJLA 1BBUA 4BA2I 4R4IA 4A3KG 1RL2A 4GLAC 3GTMH 3HOVH 3TREA 3U50C 1VQ7A 2CFMA 4DR4L 2VL6A 1XNQQ 3PO3H 1N32Q 3SGIA 4DNIA 5LMNQ 1K9MC 2GVBA 3ULLA 1GKHA 1VQEA 3HOZG 3H0GG 2KCMA 4X65L 1XMQQ 3FHWA 5IYDG 1EQQA 1EIYB 1SMXA 1N36L 2BH2A 1G291 2JK8A 3Q8DA 5IP9H 2BA0A 1I50H 5H1SE 5FLMG 1YIJA 1OXVA 1EOVA 3CP0A 3K81C 1ASZA 2GVAA 1UE6A 1YJWA 1E7ZA 4GN3B 3FKIH 3G48A 2HHHL 3PF4A 4IFDI 1QZGA 3D0FA 4OO1G 2UUAL 4IJHA 5HGQA 4X64L 4MTNA 1LYLA 2PNHA 4LFAL 5FLXc 4JI0L 2KENA 2ZTEA 1W2BA 4GLVB 4LNQA 4A76A 1YEZA 2F4VQ 2ZTCA 1N34Q 4OXPA 4JI3Q 1NTGA 3VDYA 4JYAQ 2VQFL 1HR0Q 4GN5A 3S1NH 3NELA 2WP8J 3F2DA 2NN6G 5GAGC 1WOCA 2I0QA 4LF5L 4A3DG 2UXBL 1WYDA 4DUZQ 1QVCA 1VQ5A 3GTLH 3E0EA 4YCVA 1YVCA 2AKWB 1WFQA 2RF4A 4QGUA 1L1OC 1N36Q 4DAMA 4A3LG 1OXUA 1P8LA 1TWAH 4POFA 3AFPA 4GNXC 2N8NA 1SN8A 2ES2A 3MEFA 1MKHA 3I56A 3RZDH 3I55A 2WFWA 1A0IA 4IPHA 2VQEQ 4GN4B 1AE3A 2XGTA 3J7ZC 1Q81C 1XNRL 1RIPA 2CKZB 1KRSA 2YV5A 4X62L 3JC66 3STBD 4LF7Q 2JA7H 1AE2A 3A5ZB 1B7YB 4BBRG 2HT1A 4B3SQ 3CMEA 4JV5Q 3RN5A 3GDEA 1A8VA 3STBC 1V9PA 3CPFA 4QY7A 3CCUA 1R9TH 5GAHC 3J80c 1VQAA 2MQHA 4TQUS 4ALPA 4A93G 3ULPA 2NZOA 2JA5H 2A19A 3H15A 3HOUH 3PO2H 4L5TA 4YWKA 4O0AA 1BVSA 2IX1A 3KJPA 1JJCB 2VQFQ 3PF5A 4LUZA 4DR1Q 1K73C 1KAWA 4R4TA 5EAYA 4AYBG 4JI7L 2UXCL 2A8VA 1E1OA 4NXMQ 3PUYA 4P75A 2R6GA 1KRTA 3UE1A 2ZM6L 1C7YA 1JT8A 4LF5Q 3FP9A 3HOVG 2YTYA 1IZ6A 2WAQE 4BA1I 3PO3G 3PIPA 1VQBA 2EQSA 3UDXA 2MFIA 3KYHC 4KLKA 3HKZE 4XIGS 3PUXA 3CPWA 4RG1A 1QUQA 4DV6L 5M3FH 2AWNA 3NEMA 4LFCQ 1VQ6A 3PO2G 3AYHB 5IP9G 4B3RL 4JG2A 3CC7A 1UE7A 1PHJA 4IJLA 4JOIC 4HIOA 1K83H 1EUJA 3KLWA 3CQZH 1IYJB 5M5XH 1XMOL 1ASYA 2K50A 1OXTA 2Q2IA 3J80i 2IX0A 4NXNL 5M3MH 4YHHL 4DV1Q 3AFQA 4LW1A 2E2HH 4JBMA 1KXLA 1QUQB 4DKAC 1HNXL 5LMNW 4L5SA 3M3YH 1JB7A 2YTVA 1KHIA 1NMFA 1YBYA 3RLFA 3I7FA 1J5EL 2JA6H 4YWLA 3ERSX 5BR8L 5AJ3L 4B3TQ 3GTGH 4WJ4A 4JBKA 4UP9A 3CCLA 2NVXH 1K0RA 3KDFA 4DR5L 1X54A 3BJUA 2PI2E 2E8GA 2F3IA 1K8AC 3A74A 4O2DA 4JI2L 1P16A 2RHQB 4A3MH 3K8AA 2UUCL 4A3FH 3KDFB 5C0XI 4X66L 4HJ7A 5C4XG 2ZM6Q 3GTKH 3JAMc 3CD6A 3OW2A 4PZ6A 2Q2TA 1PH8A 3J81j 1PH3A 2OCEA 1IBML 2WB1G 1TXYA 2JE6I 2N49A 4P73A 4JI1Q 4LF4Q 1TWCH 3WWVA 3BU2A 4X6AH 3BZKA 1VQ8A 4J15A 1SROA 1Y14B 2V1CC 2RCNA 4DUYL 4PZ7A 1YZ6A 1HR0W 2Z6KA 2RHSB 3HFZB 4DK6C 2MNAA 2QA4A 2NVTH 1Z47A 3L0OA 4BBSH 4JI5L 3I4NH 4OONA 2VUMH 4KI0A 1QVFA 2E5LQ 2HQLA 4XTCS 2OQKA 1I6HH 1C0AA 4R1JA 1WJJA 1OXXK 3A0JA 3CF5A 4A3BH 1Q82C 2UUBL 2BH8A 2JA7G 4AQYL 3HOYH 4DR6L 2UXDQ 2D0OA 4KHPQ 1HJPA 3UDGA 4DV7L 5C3EH 2MO0A 3CCQA 4DR5Q 3CAMA 3NBHB 3ICEA 4C2MH 3S2HH 1FJGL 4A3JH 1S40A 4IPCA 4DR2Q 4RMFA 1PA6A 1E24A 4PG3A 1SRUA 4QJFA 4R4OA 1VQJA 1HZ9A 2JA5G 3HOUG 5LMUL 3TQYA 4DV4L 3S14H 1VQHA 5FJ8H 1QZHA 4DV5Q 1H95A 3OTOQ 4UPAA 5K36G 4LF8L 3TS0A 1BKBA 4C3HH 4X66Q 1UE5A 1FVIA 3KJOA 3I4MH 1GVPA 4YCUA 4GKJQ 2B29A 4YWMA 3S2DH 4BY7H 1LM0A 4IPDA 1IBKL 2R93H 2D62A 3F1ZA 4DR4Q 5GAEC 3J7A5 4YY3L 2R7FA 1EYGA 4GKKL 3S16H 1X3FA 4X65Q 3F8TA 5M3FG 1PYSB 4Y52H 1C9OA 1NBWA 3F2CA 3L7ZC 3S24A 3T1YL 2IT1A 4DV3L 4JI5Q 1SFOH 3CC4A 4FDBA 1DGSA 1EIFA 1WCMH 2ID0A 1Q8KA 3W1BA 1S3OA 2MO1A 4HJ5A 5M3MG 4A3EH 3AQQA 2HHHQ 2UUBQ 2ZJPA 3UE0A 4UY8C 4AQYQ 2E2JH 2UUAQ 3EN2A 4X64Q 1I3QH 3HOWH 2R7ZH 1N33L 4LFAQ 2JA6G 2K5HA 4JI0Q 4DV2L 3T1HL 2LSSA 4JI8L 1HH2P 1YI2A 2IY5B 3RNUA 3M85A 1YNXA 1MIUA 4GNXA 4K0KL 4LFBL 3I4OA 3RR5A 1E22A 1Z9FA 1HNWL 2GN5A 1OXSC 1X3GA 3J81c 4A3MG 4DK3C 2OTLA 1AH9A 3HKSA 3GTOH 3S1MH 2Y0SE 3TS2A 4A3FG 4OWWB 1K3RA 2XTIA 3LGJA 3PCOB 1IBKQ 2B63H 4P72A 1I94L 1IBLL 3B6YA 1Y1VH 1S72A 1NJIC 1CKOA 1Q7YC 1JJ2A 2E2IH 4JI4L 4GNXB 2VY3A 1YHQA 2ATWA 4AYBE 3GD7A 4GKKQ 2UXBQ 5IYBH 1X55A 2PI2A 1LUZA 5C4JH 4EQ5A 1B70B 3PSIA 1BBWA 4UP8A 4YCWA 4HJ8A 3BZCA 3T1YQ 1XPUA 3KFUA 3PGZA 4DR3L 1YITA 3H3VI 2HIVA 1JJGA 2JEBI 2JEAI 2VNUD 4C3JH 1JE5A 2AMCB 4BBSG 3I4NG 4POGA 2VUMG 3K7AH 1VQKA 2I5LX 3KF8B 1EWIA 5C0XJ 3F2BA 2UU9L 1XNRQ 4GOPA 3M7NA 3FKIG 4H02A 4X62Q 4A3BG 4QQBX 1XJVA 2YU9H 1VQDA 3HOYG 3T1HQ 4A75A 3CCEA 4DV0L 4R4QA 1UEBA 3GO5A 3M9BA 3GTPH 3OYYA 3HKZG 4JI6L 2OQ0A 5C3EG 5C44H 2VS1A 2EXDA 3PUZA 1Y1WH 4A3JG 1TWFH 1TWHH 4K0KQ 4JC0A 5HY6A 4LFBQ 1VQ4A 2CQOA 4GOPB 2NZHA 3CC2A 1HNWQ 1U5KA 5LMNL 2IHEA 1VCIA 3RLNA 4C3IH 5C0XG 1VQCA 5FJ8G 1SE8A 4HIMA 3RZOH 1XMQL 1EQRA 4IPGA 4DAYB 2R7DA 1D8LA 2K4KA 3K0XA 4JI7Q 4LF9L 2NVYH 1I94Q 1V43A 3E9HA 1IBLQ 3I4MG 1XPOA 2UXCQ 4LF6L 4BY7G 2PQAA 1IXRA 2K52A 3S17H 2R93G 3M4PA 2NVQH 2BA1A 3CCRA 2DGYA 1PH4A 4AIMA 3H3VH 2FXQA 3TRZA 2EIFA 4DV6Q 1HZBA 3ER0A 1PH6A 5JJKA 4OX9L 4A3IH 4A3CH 1SR3A 5J3BA 1YHBA 5GROA 4L5RC 4B3RQ 2PQAB 4PMWA 1D7QA 2AWOA 2JJQA 1X65A 2Z6KC 5GQOA 1XMOQ 2R92G 4WJ3M 5IYCH 1CKNA 4YHHQ 3ZJYC 4NXNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E G;  4P71 A;  3KF6 A;  4NB3 A;  5IP7 H;  5IT9 c;  4JI3 L;  1HNX Q;  3HOW G;  4DV0 Q;  2N3S A;  4ME3 A;  1J5E Q;  2R7Z G;  5BR8 Q;  5AJ3 Q;  4AH6 A;  2D0P A;  2C35 B;  2K14 A;  4IO9 A;  1VQN A;  4JYA L;  1HR0 L;  2QEX A;  3W1G A;  1T9H A;  3HOX H;  1KIX A;  1VQF A;  1A63 A;  4PZ8 A;  1CKN B;  3G71 A;  1GD7 A;  2JA8 H;  3KF6 B;  5ELN A;  2Q2U A;  3JAM i;  2VZA A;  3U4V A;  3CCJ A;  4DUZ L;  4JI2 Q;  3UDF A;  1VQ9 A;  4HID A;  1N9W A;  4QL5 A;  2N78 A;  3EBE A;  2UUC Q;  4LF6 Q;  3EIV A;  4OWT B;  1Q1E A;  2VW9 A;  1PYB A;  2IHF A;  2B63 G;  5ELO A;  3RN2 A;  1Y1V G;  3U58 A;  5IE8 A;  1J6Q A;  2VQE L;  2Z0S A;  4GS3 A;  1IBM Q;  3PIO A;  5IYB G;  1VQP A;  1NMG A;  4LF7 L;  4DR7 L;  4OX9 Q;  4L5Q A;  1CSQ A;  3CCV A;  1YJN A;  3DM3 A;  1K8G A;  1PH2 A;  4APV A;  4B3S L;  1OTC A;  4JV5 L;  1CSP A;  4DUY Q;  4MZ9 A;  4OO1 I;  2KBN A;  1G6P A;  3E9I A;  4LWC A;  1MJE A;  1LTL A;  1VQG A;  3MXN B;  1Q12 A;  5IWA L;  3M4O H;  2H5X A;  4IOA A;  1VQI A;  1KL9 A;  1HZC A;  3UDI A;  2A1A A;  1L0W A;  4MNO A;  3G4S A;  2PMZ E;  1JMC A;  1NY4 A;  4QIW E;  5E7N A;  3S1R H;  3I2Z A;  1L2F A;  4B3M L;  4BY1 H;  4DR6 Q;  4A3G H;  1PH9 A;  2Q2H A;  4BXX H;  2AHO B;  3A5U A;  5C4X H;  4DR1 L;  1B8A A;  1PH7 A;  1HNZ L;  4DV7 Q;  4NXM L;  1I5F A;  3GTJ H;  5C44 G;  4IOC A;  4A3K H;  1KQS A;  1FJG Q;  2LXJ A;  1Y1W G;  2ZJQ A;  5DLQ E;  4GLX A;  3DLL A;  1KD1 C;  4HIK A;  1L1O A;  5LMU Q;  2QGQ A;  4DV4 Q;  1YJ9 A;  3HOZ H;  3H0G H;  5GAD C;  5M5W H;  5IYD H;  1A62 A;  2NN6 I;  4LF8 Q;  5FLM H;  4LFC L;  2R92 H;  1PVO A;  3GTQ H;  2ALY B;  3CW2 C;  1N8R C;  1Q46 A;  3L2P A;  1EFW A;  2F52 A;  3CXC A;  1VQO A;  3CMA A;  1E3P A;  2CCZ A;  1L1O B;  4EX5 A;  4DV1 L;  3S15 H;  4DR7 Q;  1XPR A;  4IFD G;  2K5N A;  4YY3 Q;  4TVA B;  2JQO A;  4JBW A;  2I5H A;  4Y7N H;  1PV4 A;  5JJI A;  4B3T L;  1FGU A;  1U0L A;  4JCV E;  4A3I G;  4A3C G;  4LUV A;  1YHA A;  2YTX A;  5IWA Q;  1G51 A;  1X56 A;  4DV3 Q;  3CCS A;  1VQM A;  3AEV A;  2ASB A;  2Y0S G;  3IRB A;  4JBJ A;  2HIX A;  1CUK A;  5IYC G;  1GO3 E;  4B3M Q;  1V1Q A;  2OTJ A;  5IP7 G;  3PUV A;  3RLO A;  1N33 Q;  4GOP C;  1HNZ Q;  3K7U C;  2CWA A;  2L15 A;  5M5Y H;  2WAQ G;  4DV2 Q;  1X9N A;  4JI8 Q;  3G6E A;  1X3E A;  3J81 i;  2DUD A;  3HOX G;  1HZA A;  1GM5 A;  2LXK A;  4HJ9 A;  1PH1 A;  2OWO A;  4A3D H;  2JA8 G;  3ULJ A;  4JI1 L;  3KOJ A;  4HJA A;  4LF4 L;  1N32 L;  1XNQ L;  4A3L H;  4LUO A;  1KC8 C;  3K80 C;  1QVG A;  1IL2 A;  4JOI A;  3W5O A;  1M1K C;  3PUW A;  2KCT A;  1TWG H;  3NEN A;  1NE3 A;  1Q1B A;  3D31 A;  4JI4 Q;  5JEA J;  2K75 A;  3U4Z A;  4DPG A;  1FL0 A;  2I5M X;  2E5L L;  2ZJR A;  1VS0 A;  4P74 A;  4LF9 Q;  1MJC A;  4A4I A;  1M90 C;  1O7I A;  1CKM A;  1X6O A;  4BBR H;  2UXD L;  3M4Q A;  1UWV A;  1VQL A;  3S1Q H;  4KHP L;  2B3G A;  4DR3 Q;  1PFS A;  2KHJ A;  2WB1 E;  1PH5 A;  1XTD A;  4DR2 L;  4A93 H;  1W3S A;  1WI5 A;  2CWP A;  2K5V A;  3CCM A;  2F4V L;  4OWX B;  5JEA G;  2UU9 Q;  1N34 L;  1WCM G;  1Q86 C;  2KHI A;  4DV5 L;  4BY1 G;  4UP7 A;  2JA9 A;  3TEH B;  3OTO L;  1UE1 A;  4A3G G;  4BXX G;  4IFD J;  3PV0 A;  1SLJ A;  5IY0 A;  2ZTD A;  4R4C A;  4GKJ L;  1E1T A;  4JI6 Q;  2YYZ A;  4KHZ A;  4NPS A;  5JJL A;  1BBU A;  4BA2 I;  4R4I A;  4A3K G;  1RL2 A;  4GLA C;  3GTM H;  3HOV H;  3TRE A;  3U50 C;  1VQ7 A;  2CFM A;  4DR4 L;  2VL6 A;  1XNQ Q;  3PO3 H;  1N32 Q;  3SGI A;  4DNI A;  5LMN Q;  1K9M C;  2GVB A;  3ULL A;  1GKH A;  1VQE A;  3HOZ G;  3H0G G;  2KCM A;  4X65 L;  1XMQ Q;  3FHW A;  5IYD G;  1EQQ A;  1EIY B;  1SMX A;  1N36 L;  2BH2 A;  1G29 1;  2JK8 A;  3Q8D A;  5IP9 H;  2BA0 A;  1I50 H;  5H1S E;  5FLM G;  1YIJ A;  1OXV A;  1EOV A;  3CP0 A;  3K81 C;  1ASZ A;  2GVA A;  1UE6 A;  1YJW A;  1E7Z A;  4GN3 B;  3FKI H;  3G48 A;  2HHH L;  3PF4 A;  4IFD I;  1QZG A;  3D0F A;  4OO1 G;  2UUA L;  4IJH A;  5HGQ A;  4X64 L;  4MTN A;  1LYL A;  2PNH A;  4LFA L;  5FLX c;  4JI0 L;  2KEN A;  2ZTE A;  1W2B A;  4GLV B;  4LNQ A;  4A76 A;  1YEZ A;  2F4V Q;  2ZTC A;  1N34 Q;  4OXP A;  4JI3 Q;  1NTG A;  3VDY A;  4JYA Q;  2VQF L;  1HR0 Q;  4GN5 A;  3S1N H;  3NEL A;  2WP8 J;  3F2D A;  2NN6 G;  5GAG C;  1WOC A;  2I0Q A;  4LF5 L;  4A3D G;  2UXB L;  1WYD A;  4DUZ Q;  1QVC A;  1VQ5 A;  3GTL H;  3E0E A;  4YCV A;  1YVC A;  2AKW B;  1WFQ A;  2RF4 A;  4QGU A;  1L1O C;  1N36 Q;  4DAM A;  4A3L G;  1OXU A;  1P8L A;  1TWA H;  4POF A;  3AFP A;  4GNX C;  2N8N A;  1SN8 A;  2ES2 A;  3MEF A;  1MKH A;  3I56 A;  3RZD H;  3I55 A;  2WFW A;  1A0I A;  4IPH A;  2VQE Q;  4GN4 B;  1AE3 A;  2XGT A;  3J7Z C;  1Q81 C;  1XNR L;  1RIP A;  2CKZ B;  1KRS A;  2YV5 A;  4X62 L;  3JC6 6;  3STB D;  4LF7 Q;  2JA7 H;  1AE2 A;  3A5Z B;  1B7Y B;  4BBR G;  2HT1 A;  4B3S Q;  3CME A;  4JV5 Q;  3RN5 A;  3GDE A;  1A8V A;  3STB C;  1V9P A;  3CPF A;  4QY7 A;  3CCU A;  1R9T H;  5GAH C;  3J80 c;  1VQA A;  2MQH A;  4TQU S;  4ALP A;  4A93 G;  3ULP A;  2NZO A;  2JA5 H;  2A19 A;  3H15 A;  3HOU H;  3PO2 H;  4L5T A;  4YWK A;  4O0A A;  1BVS A;  2IX1 A;  3KJP A;  1JJC B;  2VQF Q;  3PF5 A;  4LUZ A;  4DR1 Q;  1K73 C;  1KAW A;  4R4T A;  5EAY A;  4AYB G;  4JI7 L;  2UXC L;  2A8V A;  1E1O A;  4NXM Q;  3PUY A;  4P75 A;  2R6G A;  1KRT A;  3UE1 A;  2ZM6 L;  1C7Y A;  1JT8 A;  4LF5 Q;  3FP9 A;  3HOV G;  2YTY A;  1IZ6 A;  2WAQ E;  4BA1 I;  3PO3 G;  3PIP A;  1VQB A;  2EQS A;  3UDX A;  2MFI A;  3KYH C;  4KLK A;  3HKZ E;  4XIG S;  3PUX A;  3CPW A;  4RG1 A;  1QUQ A;  4DV6 L;  5M3F H;  2AWN A;  3NEM A;  4LFC Q;  1VQ6 A;  3PO2 G;  3AYH B;  5IP9 G;  4B3R L;  4JG2 A;  3CC7 A;  1UE7 A;  1PHJ A;  4IJL A;  4JOI C;  4HIO A;  1K83 H;  1EUJ A;  3KLW A;  3CQZ H;  1IYJ B;  5M5X H;  1XMO L;  1ASY A;  2K50 A;  1OXT A;  2Q2I A;  3J80 i;  2IX0 A;  4NXN L;  5M3M H;  4YHH L;  4DV1 Q;  3AFQ A;  4LW1 A;  2E2H H;  4JBM A;  1KXL A;  1QUQ B;  4DKA C;  1HNX L;  5LMN W;  4L5S A;  3M3Y H;  1JB7 A;  2YTV A;  1KHI A;  1NMF A;  1YBY A;  3RLF A;  3I7F A;  1J5E L;  2JA6 H;  4YWL A;  3ERS X;  5BR8 L;  5AJ3 L;  4B3T Q;  3GTG H;  4WJ4 A;  4JBK A;  4UP9 A;  3CCL A;  2NVX H;  1K0R A;  3KDF A;  4DR5 L;  1X54 A;  3BJU A;  2PI2 E;  2E8G A;  2F3I A;  1K8A C;  3A74 A;  4O2D A;  4JI2 L;  1P16 A;  2RHQ B;  4A3M H;  3K8A A;  2UUC L;  4A3F H;  3KDF B;  5C0X I;  4X66 L;  4HJ7 A;  5C4X G;  2ZM6 Q;  3GTK H;  3JAM c;  3CD6 A;  3OW2 A;  4PZ6 A;  2Q2T A;  1PH8 A;  3J81 j;  1PH3 A;  2OCE A;  1IBM L;  2WB1 G;  1TXY A;  2JE6 I;  2N49 A;  4P73 A;  4JI1 Q;  4LF4 Q;  1TWC H;  3WWV A;  3BU2 A;  4X6A H;  3BZK A;  1VQ8 A;  4J15 A;  1SRO A;  1Y14 B;  2V1C C;  2RCN A;  4DUY L;  4PZ7 A;  1YZ6 A;  1HR0 W;  2Z6K A;  2RHS B;  3HFZ B;  4DK6 C;  2MNA A;  2QA4 A;  2NVT H;  1Z47 A;  3L0O A;  4BBS H;  4JI5 L;  3I4N H;  4OON A;  2VUM H;  4KI0 A;  1QVF A;  2E5L Q;  2HQL A;  4XTC S;  2OQK A;  1I6H H;  1C0A A;  4R1J A;  1WJJ A;  1OXX K;  3A0J A;  3CF5 A;  4A3B H;  1Q82 C;  2UUB L;  2BH8 A;  2JA7 G;  4AQY L;  3HOY H;  4DR6 L;  2UXD Q;  2D0O A;  4KHP Q;  1HJP A;  3UDG A;  4DV7 L;  5C3E H;  2MO0 A;  3CCQ A;  4DR5 Q;  3CAM A;  3NBH B;  3ICE A;  4C2M H;  3S2H H;  1FJG L;  4A3J H;  1S40 A;  4IPC A;  4DR2 Q;  4RMF A;  1PA6 A;  1E24 A;  4PG3 A;  1SRU A;  4QJF A;  4R4O A;  1VQJ A;  1HZ9 A;  2JA5 G;  3HOU G;  5LMU L;  3TQY A;  4DV4 L;  3S14 H;  1VQH A;  5FJ8 H;  1QZH A;  4DV5 Q;  1H95 A;  3OTO Q;  4UPA A;  5K36 G;  4LF8 L;  3TS0 A;  1BKB A;  4C3H H;  4X66 Q;  1UE5 A;  1FVI A;  3KJO A;  3I4M H;  1GVP A;  4YCU A;  4GKJ Q;  2B29 A;  4YWM A;  3S2D H;  4BY7 H;  1LM0 A;  4IPD A;  1IBK L;  2R93 H;  2D62 A;  3F1Z A;  4DR4 Q;  5GAE C;  3J7A 5;  4YY3 L;  2R7F A;  1EYG A;  4GKK L;  3S16 H;  1X3F A;  4X65 Q;  3F8T A;  5M3F G;  1PYS B;  4Y52 H;  1C9O A;  1NBW A;  3F2C A;  3L7Z C;  3S24 A;  3T1Y L;  2IT1 A;  4DV3 L;  4JI5 Q;  1SFO H;  3CC4 A;  4FDB A;  1DGS A;  1EIF A;  1WCM H;  2ID0 A;  1Q8K A;  3W1B A;  1S3O A;  2MO1 A;  4HJ5 A;  5M3M G;  4A3E H;  3AQQ A;  2HHH Q;  2UUB Q;  2ZJP A;  3UE0 A;  4UY8 C;  4AQY Q;  2E2J H;  2UUA Q;  3EN2 A;  4X64 Q;  1I3Q H;  3HOW H;  2R7Z H;  1N33 L;  4LFA Q;  2JA6 G;  2K5H A;  4JI0 Q;  4DV2 L;  3T1H L;  2LSS A;  4JI8 L;  1HH2 P;  1YI2 A;  2IY5 B;  3RNU A;  3M85 A;  1YNX A;  1MIU A;  4GNX A;  4K0K L;  4LFB L;  3I4O A;  3RR5 A;  1E22 A;  1Z9F A;  1HNW L;  2GN5 A;  1OXS C;  1X3G A;  3J81 c;  4A3M G;  4DK3 C;  2OTL A;  1AH9 A;  3HKS A;  3GTO H;  3S1M H;  2Y0S E;  3TS2 A;  4A3F G;  4OWW B;  1K3R A;  2XTI A;  3LGJ A;  3PCO B;  1IBK Q;  2B63 H;  4P72 A;  1I94 L;  1IBL L;  3B6Y A;  1Y1V H;  1S72 A;  1NJI C;  1CKO A;  1Q7Y C;  1JJ2 A;  2E2I H;  4JI4 L;  4GNX B;  2VY3 A;  1YHQ A;  2ATW A;  4AYB E;  3GD7 A;  4GKK Q;  2UXB Q;  5IYB H;  1X55 A;  2PI2 A;  1LUZ A;  5C4J H;  4EQ5 A;  1B70 B;  3PSI A;  1BBW A;  4UP8 A;  4YCW A;  4HJ8 A;  3BZC A;  3T1Y Q;  1XPU A;  3KFU A;  3PGZ A;  4DR3 L;  1YIT A;  3H3V I;  2HIV A;  1JJG A;  2JEB I;  2JEA I;  2VNU D;  4C3J H;  1JE5 A;  2AMC B;  4BBS G;  3I4N G;  4POG A;  2VUM G;  3K7A H;  1VQK A;  2I5L X;  3KF8 B;  1EWI A;  5C0X J;  3F2B A;  2UU9 L;  1XNR Q;  4GOP A;  3M7N A;  3FKI G;  4H02 A;  4X62 Q;  4A3B G;  4QQB X;  1XJV A;  2YU9 H;  1VQD A;  3HOY G;  3T1H Q;  4A75 A;  3CCE A;  4DV0 L;  4R4Q A;  1UEB A;  3GO5 A;  3M9B A;  3GTP H;  3OYY A;  3HKZ G;  4JI6 L;  2OQ0 A;  5C3E G;  5C44 H;  2VS1 A;  2EXD A;  3PUZ A;  1Y1W H;  4A3J G;  1TWF H;  1TWH H;  4K0K Q;  4JC0 A;  5HY6 A;  4LFB Q;  1VQ4 A;  2CQO A;  4GOP B;  2NZH A;  3CC2 A;  1HNW Q;  1U5K A;  5LMN L;  2IHE A;  1VCI A;  3RLN A;  4C3I H;  5C0X G;  1VQC A;  5FJ8 G;  1SE8 A;  4HIM A;  3RZO H;  1XMQ L;  1EQR A;  4IPG A;  4DAY B;  2R7D A;  1D8L A;  2K4K A;  3K0X A;  4JI7 Q;  4LF9 L;  2NVY H;  1I94 Q;  1V43 A;  3E9H A;  1IBL Q;  3I4M G;  1XPO A;  2UXC Q;  4LF6 L;  4BY7 G;  2PQA A;  1IXR A;  2K52 A;  3S17 H;  2R93 G;  3M4P A;  2NVQ H;  2BA1 A;  3CCR A;  2DGY A;  1PH4 A;  4AIM A;  3H3V H;  2FXQ A;  3TRZ A;  2EIF A;  4DV6 Q;  1HZB A;  3ER0 A;  1PH6 A;  5JJK A;  4OX9 L;  4A3I H;  4A3C H;  1SR3 A;  5J3B A;  1YHB A;  5GRO A;  4L5R C;  4B3R Q;  2PQA B;  4PMW A;  1D7Q A;  2AWO A;  2JJQ A;  1X65 A;  2Z6K C;  5GQO A;  1XMO Q;  2R92 G;  4WJ3 M;  5IYC H;  1CKN A;  4YHH Q;  3ZJY C;  4NXN Q; 
#chains in the Genus database with same CATH topology
 2KOL A;  3KF6 A;  4P71 A;  1B9N A;  4V0B A;  3D8G A;  2IWH A;  4JYA L;  1HR0 L;  4P2C B;  2PZW A;  2A6H D;  1A63 A;  3VYR A;  1JOQ A;  1NCV A;  3G71 A;  2K5Q A;  5ELN A;  2Q2U A;  1WTR A;  5CBA E;  3GTP B;  4HID A;  5TSS A;  3EBE A;  2UUC Q;  3KK7 A;  3EIV A;  1I4X A;  3MWY W;  4R8I A;  2K33 A;  2B63 G;  2PCF B;  5ELO A;  5IE8 A;  1J6Q A;  1STY A;  3PIO A;  5IYB G;  3W3A A;  2RSO A;  1VQP A;  1NMG A;  3AB9 A;  4OX9 Q;  1CSQ A;  4JV5 L;  4DUY Q;  3E9I A;  1A2U A;  4LWC A;  1VQG A;  2A68 C;  1Q12 A;  3M4O H;  2H5X A;  4X3S A;  3RD4 A;  1EY6 A;  5JEA H;  1TWC B;  5E7N A;  3V2T A;  1L2F A;  1VMC A;  4A3G H;  2AHO B;  3A5U A;  4DR1 L;  3QWN A;  3OWE B;  3GTJ H;  4BBS B;  5C44 G;  2ZJQ A;  1I6H B;  3FPP A;  2QEJ C;  4GLX A;  1QJO A;  2QGQ A;  1QNK A;  5IYD H;  4ZCK A;  3HOX B;  5FLM H;  3HKZ B;  2Z1C A;  5JVH 3;  1EYC A;  2ALY B;  1EFW A;  1Q46 A;  3L2P A;  2LFN A;  4KN7 C;  4RHS A;  3CXC A;  1AP0 A;  5EKK A;  4DR7 Q;  1ICF B;  1B3Q A;  5FOB B;  5IT9 E;  1A15 A;  1RF2 D;  1U0L A;  3NE5 B;  1S5F D;  3X3N A;  1VQM A;  3AEV A;  3IRB A;  5BN3 A;  1GO3 E;  4KKU A;  4FXG C;  1D5Z C;  4IUT A;  1U4M A;  3MVV A;  3SK5 A;  2WAQ G;  4DV2 Q;  1UEA B;  1X3E A;  3DUZ A;  3J81 i;  1GM5 A;  2LXK A;  2NN6 H;  2OWO A;  3R8B A;  4BY1 B;  2SOB A;  1N32 L;  4A3L H;  1HQR D;  1PTO D;  1QCB D;  4JOI A;  5BN5 A;  1M1K C;  2H1E A;  2KCT A;  3SDZ A;  2XN9 C;  1H9K A;  1SXT A;  1HFN A;  3QJY A;  5JEA J;  2K75 A;  3U4Z A;  4DPG A;  1FL0 A;  3H0G B;  4FO2 A;  1VS0 A;  4FF4 A;  1MJC A;  2SNS A;  1CKM A;  2EY6 A;  1X6O A;  1A3V A;  3GTQ B;  1M4V A;  2UXD L;  3M4Q A;  5DM6 3;  5E4X A;  2NZ1 D;  4I7Z C;  4DR3 Q;  2B2Y A;  3VR5 A;  1XTD A;  5EBC A;  4A93 H;  1KLU D;  2F4V L;  5JEA G;  1GHJ A;  1WCM G;  1GUT A;  4A3G G;  1DXM A;  3TEH B;  4IFD J;  3PV0 A;  4GKJ L;  3K0Y A;  5D3D A;  3DMU A;  4JI6 Q;  5JJL A;  3TP5 A;  4IZ8 A;  3HZX A;  3U50 C;  4DR4 L;  2VL6 A;  1U9R A;  3ULL A;  3EQL C;  4X65 L;  1EIY B;  1EQQ A;  5IYD G;  1G29 1;  2XIW A;  5FLM G;  1STH A;  1I50 H;  2BA0 A;  3T56 B;  4EVO A;  1H9J A;  3CP0 A;  1TWH B;  1BO0 A;  3NK9 A;  4IFD I;  3D0F A;  4X64 L;  4MTN A;  4CJ0 B;  2G9D A;  1F9P A;  2Z9H A;  4LFA L;  1TWG B;  5FLX c;  1TII D;  4JI0 L;  3BS1 A;  1EYA A;  3N6R A;  2E2D C;  4LNQ A;  3T4A C;  1O7Y A;  2ZTC A;  1N34 Q;  1LAC A;  1LT4 D;  4WFN 3;  2OT2 A;  3S1Q B;  1BR9 A;  4CKB A;  1NTG A;  5IOD A;  3Q6S A;  1JB3 A;  4CHT B;  5IIF A;  4JYA Q;  1V1P B;  1HR0 Q;  1TT2 A;  5A2Q L;  4U68 A;  3S1N H;  2NN6 G;  1X3P A;  4YCV A;  1T5E A;  1YVC A;  5EQ0 A;  4A3L G;  4LJZ C;  1L1O C;  4QCL A;  1P8L A;  1TWA H;  3SXH A;  4POF A;  3I56 A;  1Q81 C;  2YV5 A;  4X62 L;  3STB D;  2JA7 H;  1AE2 A;  1JOO A;  4JV5 Q;  3GDE A;  2F0G A;  1ENA A;  1MD2 D;  5LL6 X;  3K58 A;  4A93 G;  3ULP A;  1EY7 A;  2A19 A;  2JA5 H;  4O0A A;  4C1N K;  4DR1 Q;  3A8J E;  1KAW A;  4AYB G;  2UXC L;  2A8V A;  4P75 A;  3R2T A;  1JT8 A;  5CBE E;  2EQS A;  1II3 A;  2MFI A;  3UDX A;  3PUX A;  4RG1 A;  1U4R A;  2AWN A;  3NEM A;  1D1I A;  3AYH B;  1SNO A;  4KD4 A;  1PHJ A;  3TN2 A;  4HIO A;  2KCN A;  1K83 H;  1EUJ A;  3KLW A;  1PTO F;  4L63 B;  1JB7 A;  1KHI A;  1YBY A;  3RLF A;  4WJ4 A;  1ESR A;  3K5O A;  3KBX A;  1C8C A;  2NVX H;  5JJZ A;  2B2U C;  2M2L A;  3BJU A;  2RA4 A;  2F3I A;  3A74 A;  4JI2 L;  1P16 A;  5IGD A;  2F0W A;  4CJ1 B;  4X66 L;  4HJ7 A;  5C4X G;  3GTK H;  4KKT A;  3V05 A;  1RD9 D;  1PH8 A;  1EZ8 A;  2OCE A;  2WB1 G;  1TXY A;  4FNF A;  3WWV A;  3BU2 A;  4X6A H;  5KGU A;  4LAA A;  2L11 A;  1SRO A;  2RCN A;  1NR4 A;  3FMC A;  4CGY B;  4S3S A;  3NBH A;  2LKV A;  4JI5 L;  3I4N H;  2L9H A;  4MTK A;  1OXX K;  3A0J A;  3CF5 A;  5M3F B;  4FF2 A;  4KV6 A;  2JA7 G;  1EZ6 A;  2UXD Q;  4HAE A;  3CQZ B;  2J0T D;  5C3E H;  3CAM A;  3KBG A;  5M3M B;  5I4D A;  3S2H H;  4IPC A;  4RMF A;  1SYE A;  5CGK A;  4PG3 A;  4ZLT F;  5IGF A;  2WII B;  1VQJ A;  1HZ9 A;  2JA5 G;  5LMU L;  4DV4 L;  4TRD A;  1QZH A;  4K6D A;  1RTN A;  3TS0 A;  1SNQ A;  3KJO A;  1FVI A;  3I4M H;  4GKJ Q;  3HEJ A;  2D5D A;  4BY7 H;  1LM0 A;  5I2X A;  3MXP A;  2C5C A;  3NQI A;  4DR4 Q;  5GAE C;  1S5C D;  1JCK B;  5LHY 1;  4YY3 L;  4GKK L;  3DEO A;  3MZ5 A;  4A3F B;  4X65 Q;  3F8T A;  4IUU A;  4IAL A;  1B2T A;  1NBW A;  3VYU A;  5C3X A;  2BE5 D;  2IT1 A;  2TSS A;  4DNT B;  1ESF A;  1XX8 A;  4JW0 A;  2CQA A;  3DXJ C;  3GV3 A;  1J8I A;  1PRT D;  3W1B A;  2FFK B;  2MO1 A;  2AUJ D;  4A3E H;  3AQQ A;  4UY8 C;  2ZJP A;  3TSS A;  1BF4 A;  2E2J H;  4X64 Q;  2JXM B;  4HMI A;  2R7Z H;  1N33 L;  4LFA Q;  2K01 A;  3K6O A;  2NVT B;  4JI0 Q;  4MHE A;  3CHB D;  3T1H L;  1CFM A;  2N88 A;  2AQ2 B;  2IY5 B;  3JAM E;  3J81 L;  4GNX A;  3FEW X;  3HKS A;  4C2M B;  5FO7 B;  1BDO A;  1PTO H;  1K3R A;  2XTI A;  3PCO B;  1IBK Q;  1I94 L;  1JJ2 A;  2CVR A;  3DEP A;  1D2B A;  4IUQ A;  1X55 A;  1LUZ A;  2RDF A;  3E3X A;  3IKJ A;  4C3H B;  4XXE A;  2F0N A;  4EQ5 A;  1BBW A;  1UUP A;  4HJ8 A;  3S1N B;  1E2Z A;  3PMF A;  2R93 B;  1JWS D;  1JJG A;  2JEB I;  2JEA I;  2AMC B;  1PXU A;  2BCO A;  3I4N G;  1DM0 B;  1EWI A;  3CRL C;  5KND A;  3FKI G;  1BQQ T;  4H02 A;  4X62 Q;  4QQB X;  3M7G A;  1ZYR D;  1TWA B;  2HD3 A;  3NWS A;  4R4Q A;  3GTP H;  1Z7T A;  4YIJ A;  5C3E G;  2EXD A;  2F0I A;  1TWF H;  2F0L A;  4K0K Q;  1QNU A;  3HOW B;  3CC2 A;  5LMN L;  2IHE A;  3RLN A;  2FIN B;  3NP8 A;  1KDA A;  4HIM A;  1SYB A;  2KED A;  4DAY B;  2M9V A;  2B2W C;  2UXC Q;  3I4M G;  1V43 A;  3E9H A;  1XPO A;  4DNR B;  4BY7 G;  5CV7 A;  2BA1 A;  2DGY A;  1PH4 A;  4AIM A;  2K28 A;  3S1M B;  2WIN B;  2EIF A;  3BDO A;  4OX9 L;  1Y1V B;  4A3C H;  4WRD A;  2E2I B;  1H9R A;  2F1M A;  2Z6K C;  2O4X A;  4L8J A;  2L4N A;  4A3E G;  1SNC A;  5IT9 c;  4NB3 A;  1SYG A;  1GUO A;  4DN4 M;  3OSO A;  2N3S A;  4N8F A;  2R7Z G;  1X3Q A;  1VQN A;  4AH6 A;  4IO9 A;  3MA2 B;  1FR3 A;  2QEX A;  3HOX H;  1KIX A;  5FKA C;  1GUW A;  3OMC A;  4PZ8 A;  2RQX A;  1GD7 A;  3KF6 B;  4JI2 Q;  1VQ9 A;  3MFG A;  2N78 A;  5I2Y A;  5KIX A;  1Y1W B;  4LF6 Q;  1Q1E A;  3RUZ A;  3U58 A;  5FLX L;  1SNM A;  2VQE L;  1ICW A;  5A35 A;  4LF7 L;  1NSN S;  4DR7 L;  4L5Q A;  1YJN A;  3CCV A;  1K8G A;  3DM3 A;  1AZP A;  1PH2 A;  4B3S L;  4M8A A;  1G6P A;  1S5E D;  4OO1 I;  4MZ9 A;  2KBN A;  3P20 A;  1EIG A;  1LTL A;  1NUC A;  2PW7 A;  2A1A A;  1L0W A;  1JMC A;  1NY4 A;  4QIW E;  4PMC A;  1RCV D;  4BY1 H;  4CDF C;  4A3I B;  2Q2H A;  1TS3 A;  1MHW C;  4EQP A;  1PH7 A;  4NXM L;  4FXD A;  5KYI A;  5M9O A;  3K57 A;  2XRS D;  1KD1 C;  5CC4 A;  4HIK A;  1L1O A;  5LMU Q;  4DV4 Q;  2NUC A;  3QG1 A;  3H0G H;  1STG A;  1HA5 A;  1MSH A;  5FK9 C;  1PVO A;  3GTQ H;  2F0P A;  4DXF A;  3LWU A;  1VQO A;  3CMA A;  3QR8 A;  2CCZ A;  4DV1 L;  3I73 A;  3Q0A A;  1XPR A;  4FF3 A;  4YY3 Q;  4TVA B;  2JQO A;  3IFD A;  1PV4 A;  5JJI A;  4JCV E;  1IW7 D;  4A3C G;  3CCS A;  3TP7 A;  2ASB A;  1ET9 A;  1ZEQ X;  1V1Q A;  1JIC A;  4NDX A;  1N33 Q;  3K7U C;  2CWA A;  2QCP X;  5EBD A;  1QIL A;  3HOX G;  1HZA A;  2GA4 B;  4HJ9 A;  3S1R B;  3GP7 A;  2JYO A;  2RDH A;  2TMP A;  1B1Z A;  3W2D A;  4LF4 L;  3SK4 A;  4R8N A;  3K80 C;  5IOC A;  4XQQ A;  1QVG A;  3W5O A;  2MJ8 A;  3PUW A;  1FD7 D;  1TWG H;  3TP6 A;  1CQF A;  1Q1B A;  2K03 A;  3HOZ B;  2ZJR A;  4F88 A;  1VMP A;  5HGT A;  1M90 C;  5KYL A;  3KLS X;  2R92 B;  1DOK A;  3MXG A;  4X3K A;  3D4R A;  3S1Q H;  3SEB A;  1F2Z A;  2B2U A;  1PFS A;  2KHJ A;  2E74 C;  4KKS A;  3TZU A;  1WI5 A;  2CWP A;  3CCM A;  1N34 L;  3J7A V;  2ZT9 C;  4DV5 L;  4BY1 G;  4UP7 A;  3ONA B;  1UE1 A;  3SVM A;  3I72 A;  2A69 D;  3L3O C;  3D3R A;  4H13 C;  1LTA D;  3TBI B;  1LTT D;  1BBU A;  3TDQ A;  3U9S A;  3KLR A;  4F8M A;  2CFM A;  3NTH A;  2NTS A;  5LMN Q;  3PIO 3;  3H0G G;  2KCM A;  3VR3 A;  1SMX A;  1YIJ A;  5H1S E;  2B39 A;  1EOV A;  3DWQ A;  3G7L A;  1YJW A;  1TWF B;  1E7Z A;  1BUV T;  1Y8P B;  4GN3 B;  1PFB A;  2HHH L;  1QE6 A;  4QIW B;  4IJH A;  4ZKC B;  1LYL A;  2PNR C;  1NR2 A;  1SMY C;  3NBI A;  3A56 A;  2QW7 A;  3T16 A;  1YEZ A;  3OWF A;  3K5N A;  1SYD A;  2F03 A;  2OXP A;  4RCN A;  1HFG A;  4ME5 A;  1KTK A;  4K8I A;  3F2D A;  4DFA A;  1TS4 A;  2MUY A;  5GAG C;  1QVC A;  1TS2 A;  3E0E A;  2AKW B;  4QGU A;  4JPB W;  5EJW A;  4GNX C;  1E0B A;  3NQT A;  4X3T A;  4IFD H;  1TKW B;  2N8N A;  4TKO B;  1SE2 A;  1EU4 A;  3MEF A;  3PO3 B;  1A2T A;  1I4Q A;  2VQE Q;  4IUN A;  3A7L A;  2CKZ B;  1PRT C;  3JC6 6;  4LF7 Q;  2EOT A;  3A5Z B;  4LMQ D;  2HT1 A;  3J80 L;  1R4Q B;  4B3S Q;  3CME A;  3VYT A;  1TVX A;  3CPF A;  2JP1 A;  5GAH C;  2MQH A;  4TQU S;  3FVQ A;  1X32 A;  1BVS A;  2IX1 A;  2VQF Q;  3PF5 A;  4R4T A;  4NXM Q;  1B53 A;  1R4P B;  2Q8I B;  1AEX A;  3PUY A;  1ONL A;  2R6G A;  3PQI A;  3D6C A;  4LF5 Q;  4DA2 A;  1IZ6 A;  2WAQ E;  4BA1 I;  1NNX A;  1VQB A;  3KYH C;  4XIG S;  2D2C C;  1QUQ A;  5M3F H;  1CI3 M;  1VQ6 A;  3OHX C;  3CC7 A;  2XWB B;  3CQZ H;  1IYJ B;  1KDB A;  1XMO L;  5EGT A;  2K50 A;  1OXT A;  1E2V A;  5M3M H;  4DV1 Q;  4F87 A;  3GTL B;  1BCP B;  3AFQ A;  4LW1 A;  4KMU C;  2E2H H;  1KXL A;  4L5S A;  1J5E L;  3I7F A;  2F0D A;  3ERS X;  2I07 B;  3RZD B;  4UP9 A;  3CCL A;  1HHV A;  4QMG A;  3BDC A;  1X54 A;  1DJR D;  1AZQ A;  3OMG A;  2E8G A;  1O7Z A;  1K8A C;  5A2Q E;  5NUC A;  5CMD A;  2B2W A;  1G6Z A;  3K8A A;  1R9T B;  4A3F H;  4WOR A;  3JAM c;  3C46 A;  2Q2T A;  3J81 j;  1PH3 A;  4F7X A;  2CW0 C;  1Y8O B;  4P73 A;  4LF4 Q;  4FP5 D;  2AUK A;  2HDL A;  2V1C C;  1UNS A;  1Y14 B;  2KCC A;  1Q8I A;  3C3L A;  3MHB A;  5IT9 L;  2VB2 X;  4PZ7 A;  5JPN C;  2KQ3 A;  2Z6K A;  3BG3 A;  3HFZ B;  2QA4 A;  4QF4 A;  2NVT H;  4IFD G;  3L0O A;  2WKD A;  4OON A;  1QVF A;  4XTC S;  2OQK A;  2PPB C;  2HCC A;  2BH8 A;  3DWA A;  3WDN A;  1S5B D;  2HUG A;  4DV7 L;  2CH4 A;  1K28 A;  3ICE A;  3NBH B;  1CHQ D;  4H0L C;  4ODG A;  4C2M H;  1S40 A;  2X6L A;  1IHZ A;  3IFT A;  3M3Y B;  5IGE A;  2JA6 B;  1GXD C;  3GTG B;  1VQH A;  1SJE D;  4DV5 Q;  3OPO A;  3I91 A;  4U67 3;  1SBB B;  1BKB A;  1EYD A;  1KDC A;  1YNN D;  2IL8 A;  4C3H H;  4PMB A;  2B29 A;  1AFP A;  3KUP A;  1IBK L;  3NXW A;  2R93 H;  2D62 A;  4Q5V A;  3J7A 5;  1L0X B;  1VDZ A;  1TY0 A;  2EYF A;  2O2L D;  3QOL A;  5M3F G;  4ILW A;  3F2C A;  5JOB A;  4IUV A;  1YNJ C;  2WV6 D;  4DV3 L;  1JWM D;  1HQM C;  1EIF A;  2ID0 A;  1Q8K A;  2F0H A;  1S3O A;  2HHH Q;  1TU2 B;  5M3M G;  3J7Y W;  1SYF A;  2UUB Q;  4FVM A;  1K3B C;  4RAU C;  3HOW H;  1A6X A;  5IGG A;  2D9U A;  4JI8 L;  2VUM B;  3RNU A;  1QWY A;  2Q8R E;  1RKN A;  2K5W A;  1WTX A;  4K0K L;  3R93 A;  1OXS C;  1M8A A;  2OTL A;  4ZUI A;  3S1M H;  4A3J B;  2Y0S E;  4A3F G;  4OWW B;  3LGJ A;  1Y1V H;  2BDO A;  2E2I H;  4GNX B;  1YHQ A;  2O5J C;  4AYB E;  3GD7 A;  3NPP A;  1GUS A;  2BOS A;  3KF8 A;  1IKM A;  5C4J H;  1B70 B;  3PSI A;  1EWH A;  4YCW A;  3F2U A;  3S2D B;  1DOM A;  3KFU A;  3PGZ A;  1C4Q A;  3BYT B;  1JE5 A;  2DJG C;  2I5L X;  3NWT A;  3M4Y A;  2UU9 L;  2F0U A;  4JK1 C;  1O80 A;  5CV8 A;  3CCE A;  1SFO B;  1UEB A;  3GO5 A;  4C56 C;  4H44 C;  3OYY A;  1I4H A;  3I70 A;  1H9M A;  1S5D D;  1CT1 D;  2VS1 A;  1Y1W H;  4N9T A;  5D3I B;  4JC0 A;  3SK8 A;  4LFB Q;  2NZH A;  5DAU A;  1HNW Q;  2PQE A;  2EYH A;  1VQC A;  1SE8 A;  4DXG A;  1ML0 D;  5C6A A;  1EQR A;  1PFN A;  1D8L A;  2R7D A;  2OEO A;  4C3H G;  2A6E D;  2F0K A;  4LF6 L;  2PQA A;  1IXR A;  2R93 G;  2SDF A;  3LNN A;  1EY4 A;  3M4P A;  1SND A;  4XT3 B;  3GTO B;  2FXQ A;  1WVL A;  1HXY D;  3ER0 A;  1EIH A;  5JJK A;  4A3I H;  2PW5 A;  1PMR A;  4L5R C;  1G2S A;  2F0M A;  3VR2 A;  2O5I C;  3FDT A;  1LTG D;  4KK7 A;  2JJQ A;  1XMO Q;  5IYC H;  1CKN A;  4UHV A;  3OOC A;  3QOJ A;  2KEC A;  5IP7 H;  4JI3 L;  2QDB A;  2EYM A;  3HOW G;  1J5E Q;  1J9O A;  4RH6 A;  2C35 B;  2K14 A;  3J81 E;  4C3J B;  4RWS C;  2A69 C;  5DNF A;  1SJH D;  3WOF A;  3Q22 A;  1VQF A;  2X69 A;  2EJG C;  1F9S A;  4NW2 A;  2E2H B;  2VZA A;  3U4V A;  4DUZ L;  2A6H C;  5I6W A;  3UDF A;  1H9S A;  1N9W A;  1LTB D;  4OWT B;  2VW9 A;  1PYB A;  2IHF A;  2NTT A;  3URY A;  1PZI D;  1Y1V G;  3RN2 A;  3MXN A;  1I6V C;  4O1N A;  4GS3 A;  3I4L A;  3C1E A;  2NVY B;  1STA A;  2A68 D;  2RSN A;  1B50 A;  1CSP A;  1MJE A;  3S17 B;  2NVQ B;  4PNY A;  3ND8 A;  1KL9 A;  1HZC A;  2K05 A;  4KN4 C;  3A54 A;  3G4S A;  2PMZ E;  3S1R H;  1STN A;  2ZXP A;  1EY5 A;  5CV4 A;  1PH9 A;  3S9W A;  1B8A A;  2BDN A;  4K5V A;  4DV7 Q;  2MGS A;  1I5F A;  4IOC A;  4OIJ A;  1KQS A;  2LXJ A;  1Y1W G;  5DLQ E;  2QF7 A;  4XYO A;  5CV5 A;  2EVB A;  3HOZ H;  5M5W H;  3PIP 3;  2R92 H;  4RCO A;  2KUM A;  2E76 C;  1Q3L A;  4ZKB B;  1LT3 D;  3CW2 C;  1N8R C;  2A5H A;  1JWU D;  4G7H C;  2JA8 B;  2LS0 1;  2B8F A;  1L1O B;  1FNU A;  3S15 H;  2IX3 A;  4OO1 H;  2K5N A;  4ID6 A;  2I5H A;  4B3T L;  4RGM A;  3HS0 C;  4HMJ A;  1B44 D;  4A3I G;  1RJT A;  4CKC A;  5EKL A;  2YTX A;  5IWA Q;  4HCS A;  1G51 A;  1V8Q A;  4DV3 Q;  4ZYS A;  2G9H D;  1XYI A;  3RMH A;  1BCP F;  3A8I E;  2G5D A;  5IYC G;  4B3M Q;  4N9P A;  1DYQ A;  2ICE C;  3P75 A;  4K2K A;  5IP7 G;  3RLO A;  4GOP C;  1HNZ Q;  1DCZ A;  4HSV A;  2K1B A;  1X9N A;  3LWE A;  5AFW A;  4JI8 Q;  2DUD A;  2XNA C;  1TR5 A;  1PH1 A;  4BS9 A;  3ULJ A;  3VYS A;  3KOJ A;  4HJA A;  4LUO A;  4X3U A;  5FLX E;  1U4L A;  4A3K B;  1W6J A;  4I7A A;  1SDF A;  1NE3 A;  1PTO C;  3NEN A;  1KNA A;  4HTH A;  1PLF A;  2I5M X;  3BVM A;  4P74 A;  1O7I A;  5C4Z A;  2B2T A;  4BWG B;  5C4H A;  2XWJ B;  1UWV A;  1VQL A;  4OIK A;  2B3G A;  1ILP A;  3BVZ A;  4OWX B;  2UU9 Q;  5C4J B;  4Z9C B;  2JA9 A;  4RGT A;  1ENF A;  1E1T A;  2HCI A;  2RVL A;  2YYZ A;  4M1U B;  2AQ1 B;  4BA2 I;  1LT6 D;  2HDM A;  4JVZ A;  4GLA C;  3HOV H;  1XNQ Q;  3PO3 H;  2EY2 A;  3SGI A;  4DNI A;  1WTW A;  1VQE A;  1I4R A;  3HOZ G;  1JOK A;  3FHW A;  1F9Q A;  2JK8 A;  3Q8D A;  5IP9 H;  2R92 G;  3H6M A;  3K81 C;  4QUC A;  2GVA A;  4A3D B;  3LX0 A;  1KNE A;  3G48 A;  1BNZ A;  4ZRZ A;  3I90 A;  1QZG A;  1E2W A;  4OO1 G;  5HGQ A;  1W2B A;  2WKC A;  2ZTE A;  1C48 A;  1EQV A;  4A76 A;  3EFX D;  4OXP A;  4BBR B;  2K5D A;  4L6T B;  4JI3 Q;  1SNP A;  4G7Z C;  3EA6 A;  3BDL A;  2VQF L;  2RDG A;  3NEL A;  2WP8 J;  5ELE A;  1CK1 A;  1WOC A;  2I0Q A;  4LF5 L;  1RHP A;  2UXB L;  1WYD A;  4DUZ Q;  1VQ5 A;  1ROD A;  1I4P A;  3GTL H;  1N36 Q;  2RF4 A;  4DAM A;  3VA7 A;  1GUG A;  3GV6 A;  1S4Z A;  2RBM A;  2B2V C;  1SN8 A;  2ES2 A;  3RZD H;  2IPK D;  3I55 A;  1A0I A;  4IPH A;  4IN3 A;  1XNR L;  2H4O A;  3AU7 A;  3PO2 B;  3RN5 A;  4MIU A;  1A8V A;  3STB C;  3T53 B;  1V9P A;  1R9T H;  3CCU A;  3BYY B;  5CV9 A;  2MP1 A;  1EY8 A;  4ALP A;  2NZO A;  2KJX A;  4YWK A;  4RGO S;  1TQO A;  1K73 C;  1STB A;  2DNC A;  1E1O A;  3UE1 A;  3VR4 A;  1C7Y A;  3HOV G;  1WD1 A;  1ILQ A;  1Z6H A;  3PO3 G;  2DY7 A;  1QB5 D;  3HKZ E;  3SHL A;  4HR7 B;  5IP9 G;  1UE7 A;  4IJL A;  5JAV A;  1ASY A;  2Q2I A;  4YHH L;  1FYC A;  1QG7 A;  4WJW A;  1MBY A;  4IUP A;  1QUQ B;  3M3Y H;  1HNX L;  3Q23 A;  5M5W B;  2EPB A;  2JA6 H;  5BR8 L;  1PDQ A;  5AJ3 L;  4B3T Q;  2A73 B;  3GTG H;  4O42 A;  3UI2 A;  1W6K A;  3KDF A;  1SE4 A;  2CH4 W;  3C2P A;  2IJ0 A;  3S15 B;  4XQN A;  2HQE A;  1OO9 B;  2RHQ B;  3MXU A;  4DF7 A;  1JQY D;  4K2L A;  1O7L A;  5C5L A;  5C0X I;  3VA5 A;  2EY5 A;  2ZM6 Q;  4N8X 1;  5K5P A;  4PZ6 A;  3HOU B;  2K7V A;  2KA7 A;  4CDD C;  5I6Y A;  1IBM L;  2N49 A;  4HCE A;  2L12 A;  4XDX A;  4CKE A;  3BZK A;  1VQ8 A;  2F4I A;  2L1B A;  3MTS A;  1HR0 W;  4DK6 C;  1F77 A;  2MNA A;  1HTL D;  2F0Q A;  2VUM H;  4ZAI A;  4OEL B;  3J80 E;  4R1J A;  3C1F A;  1Q82 C;  2UUB L;  4DR6 L;  2Z4I A;  1GHK A;  5G3L F;  3H3V C;  1HJP A;  5EKI A;  5M5X B;  1HA6 A;  2MO0 A;  1GOZ A;  5COY A;  3CCQ A;  4J6H A;  4DR5 Q;  3OW7 A;  3A55 A;  1FJG L;  4A3J H;  3NUC A;  3MC0 B;  4QJF A;  3S14 H;  2L5T A;  3TQY A;  1ENC A;  4LF8 L;  1LTI D;  3MEH A;  1CA6 A;  3E0J A;  1CA5 A;  3S2D H;  1DD2 A;  4IPD A;  1UAP A;  1KAB A;  1SEB D;  4A3M B;  2LY7 A;  3FPU B;  3U9O A;  1X3F A;  4H7B A;  1HCZ A;  2K32 A;  1HUN A;  4HN7 A;  4C1N I;  3O13 A;  4V19 0;  2SNM A;  2L0C A;  1SFO H;  2PZU A;  3HOV B;  3CC4 A;  4FDB A;  3P7J A;  1DGS A;  4XT1 B;  1WCM H;  4HJ5 A;  2BE5 C;  3UE0 A;  4AQY Q;  1I3Q H;  3ZYY X;  5I9P A;  2JA6 G;  2K5H A;  3NHH A;  4ZK9 B;  2N55 A;  2LSS A;  3Q24 A;  1B9M A;  3M85 A;  4A3B B;  2PZT A;  1MIU A;  2FJ2 A;  1LV9 A;  2F0F A;  3HOY B;  4LFB L;  3RR5 A;  1E22 A;  1TS5 A;  1Z9F A;  1HNW L;  1X3G A;  3J81 c;  1AH9 A;  3GTO H;  4TSS A;  2ICI A;  5C3W A;  4B08 A;  1GUN A;  3MFY A;  1CKO A;  4CDC C;  1U4P A;  1Q7Y C;  4JI4 L;  1HRJ A;  5DEH A;  2UXB Q;  4CDE C;  2PI2 A;  1CM9 A;  4EGV A;  1LLR D;  3SE0 A;  4K8J A;  4DAP A;  3BZC A;  3T1Y Q;  1XPU A;  4IUR A;  3HP3 A;  5IGC A;  4RGN A;  3H3V I;  2VNU D;  4C3J H;  3DWP A;  5E4W C;  2JN4 A;  5KRU A;  2F0J A;  2VUM G;  3S16 B;  3KF8 B;  3F2B A;  4DK0 A;  2WAC A;  1XNR Q;  4GOP A;  1VQD A;  2XSC A;  3M9B A;  1PYW D;  2OQ0 A;  1V1O A;  1ZYR C;  2B2T C;  4A3J G;  2EYL A;  5HY6 A;  2FMM A;  2CHB D;  2F0E A;  1F9R A;  1VCI A;  4C3I H;  2EZV A;  4FXK C;  3DHQ A;  1DON A;  1XMQ L;  2MHV A;  4IPG A;  3K0X A;  4LF9 L;  2NVY H;  1IBL Q;  2Z6B A;  5D65 A;  1RDP D;  3HG9 A;  2K52 A;  1D1K A;  3T51 B;  3S17 H;  2NVQ H;  3A7A B;  4ULL A;  3TRZ A;  1HZB A;  2B63 B;  1SR3 A;  3CRK C;  4R9W A;  2XVS A;  1WTO A;  2PQA B;  4PMW A;  1D7Q A;  4J8Q A;  5GQO A;  4YHH Q;  3ZJY C;  3GTM H;  1HNX Q;  2QIL A;  2J7Z A;  4ME3 A;  4DV0 Q;  5BR8 Q;  5AJ3 Q;  1EL0 A;  2D0P A;  2F3V A;  4DU9 A;  5J22 A;  3W1G A;  1T9H A;  2EDG A;  3K7A B;  2Z8L A;  1B3A A;  1CKN B;  4CBV A;  1EY0 A;  2DJF C;  2JA8 H;  2YU9 B;  3JAM i;  3CCJ A;  2V4D A;  1JE4 A;  4KY7 A;  3GQB A;  5C44 B;  2C9O A;  4QL5 A;  2PO4 A;  3QIA A;  5T1I A;  3NTK A;  3TP8 A;  1BBX C;  3RZO B;  2Z0S A;  1IBM Q;  1H9S B;  1B4O A;  3H09 A;  2F0O A;  3R2I A;  4APV A;  3K5M A;  1G8Z D;  1OTC A;  5CV6 A;  2RCF A;  1EFI D;  3MXN B;  5IWA L;  4C3J G;  3ERQ A;  4IOA A;  1VQI A;  3UDI A;  3H91 A;  4MNO A;  3V96 A;  4OEM B;  3I2Z A;  4KY5 A;  1PFM A;  4PQX A;  4B3M L;  4DR6 Q;  4BXX H;  1EEF D;  4RKL A;  5C4X H;  3SR1 A;  1HNZ L;  1F2Y A;  1I4G A;  4UAI A;  4A3K H;  1FJG Q;  4CJ2 C;  1XXG A;  1CTM A;  3DLL A;  1FNW A;  1IYV A;  2R3Z A;  1D6E C;  3CU7 A;  3D6W A;  1YJ9 A;  1WD0 A;  2B8G A;  2KHS A;  4C3I G;  2WAQ B;  3R3O A;  5GAD C;  1A62 A;  2NN6 I;  2B2V A;  4LF8 Q;  2NYZ D;  4LFC L;  1HTP A;  3VR6 A;  1RTO A;  2F52 A;  2EYP A;  1E3P A;  3S14 B;  1NAP A;  4EX5 A;  1BCP D;  4JBW A;  4Y7N H;  2EJM A;  3H94 A;  1FGU A;  3T13 A;  4LUV A;  2ZXR A;  1YHA A;  1X56 A;  4KHV A;  2DN8 A;  1PRT B;  1IW7 C;  2Y0S G;  1KLG D;  3QB3 A;  2HIX A;  4JBJ A;  1CUK A;  4G7O C;  2OTJ A;  3PUV A;  5CYU A;  1WTQ A;  2L15 A;  5M5Y H;  3M4O B;  3G6E A;  1LO5 D;  1DOL A;  1WCM B;  5FO9 B;  1EWC A;  4A3G B;  4A3D H;  1CHP D;  2JA8 G;  4JI1 L;  1I3Q B;  1XNQ L;  1XWE A;  1KC8 C;  1HPC A;  3GTJ B;  1IL2 A;  5IGB A;  2F3W A;  4K5X A;  4I65 A;  4XQJ A;  1D5X C;  3A8K E;  3D31 A;  4JI4 Q;  5COR A;  2E5L L;  1MSG A;  3CKI B;  4A4I A;  4BBR H;  1SAP A;  4KHP L;  4MN3 A;  1HUM A;  2WB1 E;  1WTV A;  1PH5 A;  4DR2 L;  1W3S A;  2KVM A;  1LTR D;  2K5V A;  1EQT A;  1ZXT A;  1G2T A;  1Q86 C;  2KHI A;  4OHJ A;  3OTO L;  4BXX G;  5IY0 A;  1SLJ A;  3I3C A;  2ZTD A;  2EYJ A;  4R4C A;  4KHZ A;  4NPS A;  4R4I A;  4K5W A;  4A3K G;  1RL2 A;  2K6A A;  1G91 A;  3TRE A;  1GJX A;  1VQ7 A;  2E75 C;  1N32 Q;  1K9M C;  2GVB A;  1GKH A;  5EPK A;  4LK1 C;  1XMQ Q;  2ENB A;  2BH2 A;  1N36 L;  3PO2 H;  4LF9 Q;  1OXV A;  2F0S A;  1ASZ A;  1QOH A;  1UE6 A;  3AMU A;  1O78 A;  2R61 A;  3FKI H;  1CQV A;  2Z4H A;  3PF4 A;  4C3I B;  2F0T A;  1SMY D;  2UUA L;  2NB0 A;  5D14 A;  2PNH A;  3IAY A;  1SYC A;  2KEN A;  4GLV B;  1V1P A;  3OIP A;  2F4V Q;  3TME A;  1CZW A;  3ND9 A;  3EJI A;  5JPM C;  1LT5 D;  2M00 A;  2NBF A;  5ELC A;  3VDY A;  1DZ1 A;  2L55 A;  4GN5 A;  4A93 B;  3KLS A;  5E1F A;  2Y0S B;  4ZUJ A;  1Y8N B;  3N52 A;  5LL6 S;  1JR0 D;  3GTM B;  5EPL A;  4A3D G;  1A3U A;  4AYB B;  1BXT A;  1WFQ A;  1OXU A;  3AFP A;  3K59 A;  2FHT A;  5ELD A;  2VB3 X;  1MKH A;  1MI2 A;  2WFW A;  2DNE A;  4GN4 B;  1AE3 A;  2XGT A;  3J7Z C;  1RIP A;  1KRS A;  1I50 B;  1B7Y B;  4BBR G;  1EEI D;  4RFB A;  5T1G A;  4QY7 A;  5KNC A;  3J80 c;  1VQA A;  1F2L A;  3L9A X;  3H15 A;  1SSO A;  4KD3 A;  2P5Z X;  4L5T A;  4EQO A;  3HOU H;  2K04 A;  1SE3 A;  3HGB A;  5K36 H;  3KJP A;  1JJC B;  4LUZ A;  1EY9 A;  4JI7 L;  5EAY A;  1STE A;  1KRT A;  2ZM6 L;  3J7A F;  3FP9 A;  2YTY A;  3PIP A;  1CZG A;  4KLK A;  4QUF A;  1MGS A;  2SEB D;  3CPW A;  4DV6 L;  5C4X B;  5BN4 A;  2F0V A;  2QDL A;  4EQN A;  3E6Z X;  4LFC Q;  3PO2 G;  4KY6 A;  4FYD A;  4B3R L;  4JG2 A;  2WB1 B;  4JOI C;  1ET6 A;  4UDU C;  1XTC D;  5M5X H;  1AN8 A;  5J39 A;  1T5X D;  3J80 i;  2IX0 A;  4NXN L;  5I9O A;  5JVG 3;  2J4X A;  4JBM A;  4DKA C;  5LMN W;  5FO8 B;  2YTV A;  1NMF A;  5C5M A;  4YWL A;  3K5L A;  4JBK A;  1D5M C;  4NKL A;  1IL8 A;  1K0R A;  2PYK A;  4ABN A;  4DR5 L;  1F2M A;  2XRQ D;  3HRZ C;  3FRP B;  2B2Y C;  2PI2 E;  2JA7 B;  2VXW A;  4O2D A;  5F2D A;  4Y7N B;  4A3M H;  3JAM L;  3DM1 A;  2IW3 A;  2UUC L;  3E5S A;  1AW7 A;  2CW0 D;  3KDF B;  2JA5 B;  3CD6 A;  3OW2 A;  3EVQ A;  1KAA A;  4KJN A;  1PZK D;  2JE6 I;  5EPJ A;  4JI1 Q;  1TWC H;  2A74 C;  3TZD A;  4J15 A;  5M5Y B;  2LMC B;  4DUY L;  5KEE A;  1YZ6 A;  2QKI C;  2RHS B;  1Z47 A;  5G3L D;  1K0S A;  4BBS H;  5CR3 A;  4KI0 A;  1I6H H;  2E5L Q;  2HQL A;  1C0A A;  1Y69 U;  1WJJ A;  4DGZ A;  4A3B H;  1LAB A;  2PMZ B;  4AQY L;  3HOY H;  2D0O A;  4KJO A;  5L37 A;  1WTP A;  4KHP Q;  1K83 B;  3UDG A;  2EJF C;  5ISR A;  4DR2 Q;  1PA6 A;  1E24 A;  1SRU A;  4NMZ A;  4R4O A;  3X3M A;  3HOU G;  3IL8 A;  5C0X H;  1EU3 A;  3NSW A;  5FJ8 H;  1H95 A;  2NWG A;  3OTO Q;  1LTS D;  4UPA A;  1Q90 A;  5K36 G;  4HSP A;  2NVX B;  4X66 Q;  1UE5 A;  2KEE A;  1GVP A;  4YCU A;  4YWM A;  2AQ3 B;  1TY2 A;  1FGB D;  1YNN C;  5ELF A;  5J1Z A;  3F1Z A;  1EYG A;  2R7F A;  3S16 H;  1YNJ D;  4IQZ A;  3BZD B;  1K8O A;  3GTK B;  1PYS B;  4Y52 H;  1C9O A;  3D4W A;  3L7Z C;  2EXZ A;  3S24 A;  5KNB A;  3T1Y L;  4JI5 Q;  4J1M A;  4NP5 A;  2UUA Q;  1FNV A;  3EN2 A;  4DV2 L;  3I4N B;  1WTH A;  1HH2 P;  1PRT F;  1YI2 A;  3ITP A;  3FKI B;  1YNX A;  2JSO A;  4PV1 C;  3I4O A;  2GN5 A;  1VF7 A;  2I46 A;  4A3M G;  2MPM A;  5C3E B;  4DK3 C;  3S2H B;  4FF1 A;  3TS2 A;  1VF5 C;  4B9X A;  2B63 H;  4P72 A;  1IBL L;  3B6Y A;  1S72 A;  1NJI C;  2VY3 A;  4RHR A;  2EE1 A;  2ATW A;  4GKK Q;  5IYB H;  3I4M B;  4UP8 A;  1BCP C;  4BY7 B;  4ZQ3 A;  4K6L A;  4DR3 L;  2ZXO A;  1YIT A;  2Q8T A;  5ELB A;  2HIV A;  1JOR A;  4QB4 A;  4G4K A;  4BBS G;  5HUR A;  1PZJ D;  4POG A;  1IYU A;  1ZKO A;  2X6G A;  3K7A H;  5C0X J;  1VQK A;  3M7N A;  4A3B G;  4RKB A;  1XJV A;  2YU9 H;  3HOY G;  3T1H Q;  4A75 A;  4DV0 L;  4DAY A;  3MAQ A;  3HKZ G;  4DAV A;  1L0Y B;  4JI6 L;  4K14 A;  3G6J B;  5C44 H;  4KTA A;  3PUZ A;  1EOT A;  4A3E B;  1K8M A;  1TWH H;  2E2J B;  1VQ4 A;  2CQO A;  4GOP B;  2R7Z B;  1U5K A;  5C0X G;  3D4D A;  4DK1 A;  5FJ8 G;  3RZO H;  4Q0F A;  1JC7 A;  2K4K A;  3BVG A;  4JI7 Q;  3I8Z A;  4OL7 A;  2EY1 A;  1I94 Q;  1A3T A;  3SK6 A;  3NTI A;  4E6I A;  4G57 A;  2A6E C;  2RKS A;  3CCR A;  3P1H A;  3QO2 A;  2OF1 A;  3H3V H;  1PTO B;  4OGQ C;  3WOE A;  4DV6 Q;  1PH6 A;  1IKL A;  2EYO A;  2DY8 A;  4XYQ A;  4GZY C;  4RA8 A;  1BOS A;  5J3B A;  1YHB A;  5GRO A;  4B9W A;  5DM7 3;  4B3R Q;  5E3F A;  2AWO A;  1X65 A;  3OIQ A;  4HED A;  4WJ3 M;  2FMC A;  3ERO A;  4NXN Q; 
#chains in the Genus database with same CATH homology
 4A3E G;  4P71 A;  3KF6 A;  4NB3 A;  5IP7 H;  5IT9 c;  4JI3 L;  1HNX Q;  3HOW G;  4DV0 Q;  2N3S A;  4ME3 A;  1J5E Q;  2R7Z G;  5BR8 Q;  5AJ3 Q;  4AH6 A;  2D0P A;  2C35 B;  2K14 A;  4IO9 A;  1VQN A;  4JYA L;  1HR0 L;  2QEX A;  3W1G A;  1T9H A;  3HOX H;  1KIX A;  1VQF A;  1A63 A;  4PZ8 A;  1CKN B;  3G71 A;  1GD7 A;  2JA8 H;  3KF6 B;  5ELN A;  2Q2U A;  3JAM i;  2VZA A;  3U4V A;  3CCJ A;  4DUZ L;  4JI2 Q;  3UDF A;  1VQ9 A;  4HID A;  1N9W A;  4QL5 A;  2N78 A;  3EBE A;  2UUC Q;  4LF6 Q;  3EIV A;  4OWT B;  1Q1E A;  2VW9 A;  1PYB A;  2IHF A;  2B63 G;  5ELO A;  3RN2 A;  1Y1V G;  3U58 A;  5IE8 A;  1J6Q A;  2VQE L;  2Z0S A;  4GS3 A;  1IBM Q;  3PIO A;  5IYB G;  1VQP A;  1NMG A;  4LF7 L;  4DR7 L;  4OX9 Q;  4L5Q A;  1CSQ A;  3CCV A;  1YJN A;  3DM3 A;  1K8G A;  1PH2 A;  4APV A;  4B3S L;  1OTC A;  4JV5 L;  1CSP A;  4DUY Q;  4MZ9 A;  4OO1 I;  2KBN A;  1G6P A;  3E9I A;  4LWC A;  1MJE A;  1LTL A;  1VQG A;  3MXN B;  1Q12 A;  5IWA L;  3M4O H;  2H5X A;  4IOA A;  1VQI A;  1KL9 A;  1HZC A;  3UDI A;  2A1A A;  1L0W A;  4MNO A;  3G4S A;  2PMZ E;  1JMC A;  1NY4 A;  4QIW E;  5E7N A;  3S1R H;  3I2Z A;  1L2F A;  4B3M L;  4BY1 H;  4DR6 Q;  4A3G H;  1PH9 A;  2Q2H A;  4BXX H;  2AHO B;  3A5U A;  5C4X H;  4DR1 L;  1B8A A;  1PH7 A;  1HNZ L;  4DV7 Q;  4NXM L;  1I5F A;  3GTJ H;  5C44 G;  4IOC A;  4A3K H;  1KQS A;  1FJG Q;  2LXJ A;  1Y1W G;  2ZJQ A;  5DLQ E;  4GLX A;  3DLL A;  1KD1 C;  4HIK A;  1L1O A;  5LMU Q;  2QGQ A;  4DV4 Q;  1YJ9 A;  3HOZ H;  3H0G H;  5GAD C;  5M5W H;  5IYD H;  1A62 A;  2NN6 I;  4LF8 Q;  5FLM H;  4LFC L;  2R92 H;  1PVO A;  3GTQ H;  2ALY B;  3CW2 C;  1N8R C;  1Q46 A;  3L2P A;  1EFW A;  2F52 A;  3CXC A;  1VQO A;  3CMA A;  1E3P A;  2CCZ A;  1L1O B;  4EX5 A;  4DV1 L;  3S15 H;  4DR7 Q;  1XPR A;  4IFD G;  2K5N A;  4YY3 Q;  4TVA B;  2JQO A;  4JBW A;  2I5H A;  4Y7N H;  1PV4 A;  5JJI A;  4B3T L;  1FGU A;  1U0L A;  4JCV E;  4A3I G;  4A3C G;  4LUV A;  1YHA A;  2YTX A;  5IWA Q;  1G51 A;  1X56 A;  4DV3 Q;  3CCS A;  1VQM A;  3AEV A;  2ASB A;  2Y0S G;  3IRB A;  4JBJ A;  2HIX A;  1CUK A;  5IYC G;  1GO3 E;  4B3M Q;  1V1Q A;  2OTJ A;  5IP7 G;  3PUV A;  3RLO A;  1N33 Q;  4GOP C;  1HNZ Q;  3K7U C;  2CWA A;  2L15 A;  5M5Y H;  2WAQ G;  4DV2 Q;  1X9N A;  4JI8 Q;  3G6E A;  1X3E A;  3J81 i;  2DUD A;  3HOX G;  1HZA A;  1GM5 A;  2LXK A;  4HJ9 A;  1PH1 A;  2OWO A;  4A3D H;  2JA8 G;  3ULJ A;  4JI1 L;  3KOJ A;  4HJA A;  4LF4 L;  1N32 L;  1XNQ L;  4A3L H;  4LUO A;  1KC8 C;  3K80 C;  1QVG A;  1IL2 A;  4JOI A;  3W5O A;  1M1K C;  3PUW A;  2KCT A;  1TWG H;  3NEN A;  1NE3 A;  1Q1B A;  3D31 A;  4JI4 Q;  5JEA J;  2K75 A;  3U4Z A;  4DPG A;  1FL0 A;  2I5M X;  2E5L L;  2ZJR A;  1VS0 A;  4P74 A;  4LF9 Q;  1MJC A;  4A4I A;  1M90 C;  1O7I A;  1CKM A;  1X6O A;  4BBR H;  2UXD L;  3M4Q A;  1UWV A;  1VQL A;  3S1Q H;  4KHP L;  2B3G A;  4DR3 Q;  1PFS A;  2KHJ A;  2WB1 E;  1PH5 A;  1XTD A;  4DR2 L;  4A93 H;  1W3S A;  1WI5 A;  2CWP A;  2K5V A;  3CCM A;  2F4V L;  4OWX B;  5JEA G;  2UU9 Q;  1N34 L;  1WCM G;  1Q86 C;  2KHI A;  4DV5 L;  4BY1 G;  4UP7 A;  2JA9 A;  3TEH B;  3OTO L;  1UE1 A;  4A3G G;  4BXX G;  4IFD J;  3PV0 A;  1SLJ A;  5IY0 A;  2ZTD A;  4R4C A;  4GKJ L;  1E1T A;  4JI6 Q;  2YYZ A;  4KHZ A;  4NPS A;  5JJL A;  1BBU A;  4BA2 I;  4R4I A;  4A3K G;  1RL2 A;  4GLA C;  3GTM H;  3HOV H;  3TRE A;  3U50 C;  1VQ7 A;  2CFM A;  4DR4 L;  2VL6 A;  1XNQ Q;  3PO3 H;  1N32 Q;  3SGI A;  4DNI A;  5LMN Q;  1K9M C;  2GVB A;  3ULL A;  1GKH A;  1VQE A;  3HOZ G;  3H0G G;  2KCM A;  4X65 L;  1XMQ Q;  3FHW A;  5IYD G;  1EQQ A;  1EIY B;  1SMX A;  1N36 L;  2BH2 A;  1G29 1;  2JK8 A;  3Q8D A;  5IP9 H;  2BA0 A;  1I50 H;  5H1S E;  5FLM G;  1YIJ A;  1OXV A;  1EOV A;  3CP0 A;  3K81 C;  1ASZ A;  2GVA A;  1UE6 A;  1YJW A;  1E7Z A;  4GN3 B;  3FKI H;  3G48 A;  2HHH L;  3PF4 A;  4IFD I;  1QZG A;  3D0F A;  4OO1 G;  2UUA L;  4IJH A;  5HGQ A;  4X64 L;  4MTN A;  1LYL A;  2PNH A;  4LFA L;  5FLX c;  4JI0 L;  2KEN A;  2ZTE A;  1W2B A;  4GLV B;  4LNQ A;  4A76 A;  1YEZ A;  2F4V Q;  2ZTC A;  1N34 Q;  4OXP A;  4JI3 Q;  1NTG A;  3VDY A;  4JYA Q;  2VQF L;  1HR0 Q;  4GN5 A;  3S1N H;  3NEL A;  2WP8 J;  3F2D A;  2NN6 G;  5GAG C;  1WOC A;  2I0Q A;  4LF5 L;  4A3D G;  2UXB L;  1WYD A;  4DUZ Q;  1QVC A;  1VQ5 A;  3GTL H;  3E0E A;  4YCV A;  1YVC A;  2AKW B;  1WFQ A;  2RF4 A;  4QGU A;  1L1O C;  1N36 Q;  4DAM A;  4A3L G;  1OXU A;  1P8L A;  1TWA H;  4POF A;  3AFP A;  4GNX C;  2N8N A;  1SN8 A;  2ES2 A;  3MEF A;  1MKH A;  3I56 A;  3RZD H;  3I55 A;  2WFW A;  1A0I A;  4IPH A;  2VQE Q;  4GN4 B;  1AE3 A;  2XGT A;  3J7Z C;  1Q81 C;  1XNR L;  1RIP A;  2CKZ B;  1KRS A;  2YV5 A;  4X62 L;  3JC6 6;  3STB D;  4LF7 Q;  2JA7 H;  1AE2 A;  3A5Z B;  1B7Y B;  4BBR G;  2HT1 A;  4B3S Q;  3CME A;  4JV5 Q;  3RN5 A;  3GDE A;  1A8V A;  3STB C;  1V9P A;  3CPF A;  4QY7 A;  3CCU A;  1R9T H;  5GAH C;  3J80 c;  1VQA A;  2MQH A;  4TQU S;  4ALP A;  4A93 G;  3ULP A;  2NZO A;  2JA5 H;  2A19 A;  3H15 A;  3HOU H;  3PO2 H;  4L5T A;  4YWK A;  4O0A A;  1BVS A;  2IX1 A;  3KJP A;  1JJC B;  2VQF Q;  3PF5 A;  4LUZ A;  4DR1 Q;  1K73 C;  1KAW A;  4R4T A;  5EAY A;  4AYB G;  4JI7 L;  2UXC L;  2A8V A;  1E1O A;  4NXM Q;  3PUY A;  4P75 A;  2R6G A;  1KRT A;  3UE1 A;  2ZM6 L;  1C7Y A;  1JT8 A;  4LF5 Q;  3FP9 A;  3HOV G;  2YTY A;  1IZ6 A;  2WAQ E;  4BA1 I;  3PO3 G;  3PIP A;  1VQB A;  2EQS A;  3UDX A;  2MFI A;  3KYH C;  4KLK A;  3HKZ E;  4XIG S;  3PUX A;  3CPW A;  4RG1 A;  1QUQ A;  4DV6 L;  5M3F H;  2AWN A;  3NEM A;  4LFC Q;  1VQ6 A;  3PO2 G;  3AYH B;  5IP9 G;  4B3R L;  4JG2 A;  3CC7 A;  1UE7 A;  1PHJ A;  4IJL A;  4JOI C;  4HIO A;  1K83 H;  1EUJ A;  3KLW A;  3CQZ H;  1IYJ B;  5M5X H;  1XMO L;  1ASY A;  2K50 A;  1OXT A;  2Q2I A;  3J80 i;  2IX0 A;  4NXN L;  5M3M H;  4YHH L;  4DV1 Q;  3AFQ A;  4LW1 A;  2E2H H;  4JBM A;  1KXL A;  1QUQ B;  4DKA C;  1HNX L;  5LMN W;  4L5S A;  3M3Y H;  1JB7 A;  2YTV A;  1KHI A;  1NMF A;  1YBY A;  3RLF A;  3I7F A;  1J5E L;  2JA6 H;  4YWL A;  3ERS X;  5BR8 L;  5AJ3 L;  4B3T Q;  3GTG H;  4WJ4 A;  4JBK A;  4UP9 A;  3CCL A;  2NVX H;  1K0R A;  3KDF A;  4DR5 L;  1X54 A;  3BJU A;  2PI2 E;  2E8G A;  2F3I A;  1K8A C;  3A74 A;  4O2D A;  4JI2 L;  1P16 A;  2RHQ B;  4A3M H;  3K8A A;  2UUC L;  4A3F H;  3KDF B;  5C0X I;  4X66 L;  4HJ7 A;  5C4X G;  2ZM6 Q;  3GTK H;  3JAM c;  3CD6 A;  3OW2 A;  4PZ6 A;  2Q2T A;  1PH8 A;  3J81 j;  1PH3 A;  2OCE A;  1IBM L;  2WB1 G;  1TXY A;  2JE6 I;  2N49 A;  4P73 A;  4JI1 Q;  4LF4 Q;  1TWC H;  3WWV A;  3BU2 A;  4X6A H;  3BZK A;  1VQ8 A;  4J15 A;  1SRO A;  1Y14 B;  2V1C C;  2RCN A;  4DUY L;  4PZ7 A;  1YZ6 A;  1HR0 W;  2Z6K A;  2RHS B;  3HFZ B;  4DK6 C;  2MNA A;  2QA4 A;  2NVT H;  1Z47 A;  3L0O A;  4BBS H;  4JI5 L;  3I4N H;  4OON A;  2VUM H;  4KI0 A;  1QVF A;  2E5L Q;  2HQL A;  4XTC S;  2OQK A;  1I6H H;  1C0A A;  4R1J A;  1WJJ A;  1OXX K;  3A0J A;  3CF5 A;  4A3B H;  1Q82 C;  2UUB L;  2BH8 A;  2JA7 G;  4AQY L;  3HOY H;  4DR6 L;  2UXD Q;  2D0O A;  4KHP Q;  1HJP A;  3UDG A;  4DV7 L;  5C3E H;  2MO0 A;  3CCQ A;  4DR5 Q;  3CAM A;  3NBH B;  3ICE A;  4C2M H;  3S2H H;  1FJG L;  4A3J H;  1S40 A;  4IPC A;  4DR2 Q;  4RMF A;  1PA6 A;  1E24 A;  4PG3 A;  1SRU A;  4QJF A;  4R4O A;  1VQJ A;  1HZ9 A;  2JA5 G;  3HOU G;  5LMU L;  3TQY A;  4DV4 L;  3S14 H;  1VQH A;  5FJ8 H;  1QZH A;  4DV5 Q;  1H95 A;  3OTO Q;  4UPA A;  5K36 G;  4LF8 L;  3TS0 A;  1BKB A;  4C3H H;  4X66 Q;  1UE5 A;  1FVI A;  3KJO A;  3I4M H;  1GVP A;  4YCU A;  4GKJ Q;  2B29 A;  4YWM A;  3S2D H;  4BY7 H;  1LM0 A;  4IPD A;  1IBK L;  2R93 H;  2D62 A;  3F1Z A;  4DR4 Q;  5GAE C;  3J7A 5;  4YY3 L;  2R7F A;  1EYG A;  4GKK L;  3S16 H;  1X3F A;  4X65 Q;  3F8T A;  5M3F G;  1PYS B;  4Y52 H;  1C9O A;  1NBW A;  3F2C A;  3L7Z C;  3S24 A;  3T1Y L;  2IT1 A;  4DV3 L;  4JI5 Q;  1SFO H;  3CC4 A;  4FDB A;  1DGS A;  1EIF A;  1WCM H;  2ID0 A;  1Q8K A;  3W1B A;  1S3O A;  2MO1 A;  4HJ5 A;  5M3M G;  4A3E H;  3AQQ A;  2HHH Q;  2UUB Q;  2ZJP A;  3UE0 A;  4UY8 C;  4AQY Q;  2E2J H;  2UUA Q;  3EN2 A;  4X64 Q;  1I3Q H;  3HOW H;  2R7Z H;  1N33 L;  4LFA Q;  2JA6 G;  2K5H A;  4JI0 Q;  4DV2 L;  3T1H L;  2LSS A;  4JI8 L;  1HH2 P;  1YI2 A;  2IY5 B;  3RNU A;  3M85 A;  1YNX A;  1MIU A;  4GNX A;  4K0K L;  4LFB L;  3I4O A;  3RR5 A;  1E22 A;  1Z9F A;  1HNW L;  2GN5 A;  1OXS C;  1X3G A;  3J81 c;  4A3M G;  4DK3 C;  2OTL A;  1AH9 A;  3HKS A;  3GTO H;  3S1M H;  2Y0S E;  3TS2 A;  4A3F G;  4OWW B;  1K3R A;  2XTI A;  3LGJ A;  3PCO B;  1IBK Q;  2B63 H;  4P72 A;  1I94 L;  1IBL L;  3B6Y A;  1Y1V H;  1S72 A;  1NJI C;  1CKO A;  1Q7Y C;  1JJ2 A;  2E2I H;  4JI4 L;  4GNX B;  2VY3 A;  1YHQ A;  2ATW A;  4AYB E;  3GD7 A;  4GKK Q;  2UXB Q;  5IYB H;  1X55 A;  2PI2 A;  1LUZ A;  5C4J H;  4EQ5 A;  1B70 B;  3PSI A;  1BBW A;  4UP8 A;  4YCW A;  4HJ8 A;  3BZC A;  3T1Y Q;  1XPU A;  3KFU A;  3PGZ A;  4DR3 L;  1YIT A;  3H3V I;  2HIV A;  1JJG A;  2JEB I;  2JEA I;  2VNU D;  4C3J H;  1JE5 A;  2AMC B;  4BBS G;  3I4N G;  4POG A;  2VUM G;  3K7A H;  1VQK A;  2I5L X;  3KF8 B;  1EWI A;  5C0X J;  3F2B A;  2UU9 L;  1XNR Q;  4GOP A;  3M7N A;  3FKI G;  4H02 A;  4X62 Q;  4A3B G;  4QQB X;  1XJV A;  2YU9 H;  1VQD A;  3HOY G;  3T1H Q;  4A75 A;  3CCE A;  4DV0 L;  4R4Q A;  1UEB A;  3GO5 A;  3M9B A;  3GTP H;  3OYY A;  3HKZ G;  4JI6 L;  2OQ0 A;  5C3E G;  5C44 H;  2VS1 A;  2EXD A;  3PUZ A;  1Y1W H;  4A3J G;  1TWF H;  1TWH H;  4K0K Q;  4JC0 A;  5HY6 A;  4LFB Q;  1VQ4 A;  2CQO A;  4GOP B;  2NZH A;  3CC2 A;  1HNW Q;  1U5K A;  5LMN L;  2IHE A;  1VCI A;  3RLN A;  4C3I H;  5C0X G;  1VQC A;  5FJ8 G;  1SE8 A;  4HIM A;  3RZO H;  1XMQ L;  1EQR A;  4IPG A;  4DAY B;  2R7D A;  1D8L A;  2K4K A;  3K0X A;  4JI7 Q;  4LF9 L;  2NVY H;  1I94 Q;  1V43 A;  3E9H A;  1IBL Q;  3I4M G;  1XPO A;  2UXC Q;  4LF6 L;  4BY7 G;  2PQA A;  1IXR A;  2K52 A;  3S17 H;  2R93 G;  3M4P A;  2NVQ H;  2BA1 A;  3CCR A;  2DGY A;  1PH4 A;  4AIM A;  3H3V H;  2FXQ A;  3TRZ A;  2EIF A;  4DV6 Q;  1HZB A;  3ER0 A;  1PH6 A;  5JJK A;  4OX9 L;  4A3I H;  4A3C H;  1SR3 A;  5J3B A;  1YHB A;  5GRO A;  4L5R C;  4B3R Q;  2PQA B;  4PMW A;  1D7Q A;  2AWO A;  2JJQ A;  1X65 A;  2Z6K C;  5GQO A;  1XMO Q;  2R92 G;  4WJ3 M;  5IYC H;  1CKN A;  4YHH Q;  3ZJY C;  4NXN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...