4IPCA

Structure of the n-terminal domain of rpa70, e7r mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipcA00
3FKIH 2HHHL 1L1OA 3KF6B 4BA1I 1JJ2A 4GN4B 4A3BH 4OO1G 3JAMc 1U0LA 1RL2A 2K4KA 4A3MH 1NY4A 1IYJB 2JJQA 4DR1L 5C4JH 4OX9L 1VQEA 4JI4L 4X64Q 1IBLL 1E24A 1Y1WG 3AFPA 1XNQQ 5C44H 3CMEA 4GLAC 5IYDH 4IPDA 3BU2A 2AWNA 4JOIA 5LMNL 1JE5A 3U58A 2KHIA 4NXNQ 3ULJA 2UXBQ 5M5WH 3TREA 4A3IG 5FJ8H 2KBNA 4UY8C 4Y7NH 3HOWG 3E9HA 1QVGA 3GTGH 3GTQH 2CWAA 4DV6Q 3STBC 2K5HA 1VQ4A 2YU9H 1BBUA 4JI0L 4MNOA 1PH2A 1HR0W 1SN8A 2AHOB 4OX9Q 4YWLA 1XPRA 1Z47A 2BA1A 3GDEA 2YTXA 4LF4L 5E7NA 2A8VA 3HOXG 2RF4A 3I4MG 1M90C 1J5EQ 4JI3L 2AMCB 3W1GA 1ASYA 2ZTDA 1QVFA 1E1TA 4DR1Q 2UUBQ 4DV0Q 5C0XI 1N33Q 3PO2H 3GTMH 2ID0A 1VCIA 4XIGS 3CCJA 1KIXA 2QEXA 3A74A 3K81C 3BJUA 4GNXA 1VQFA 1GD7A 1CKMA 3OTOQ 5LMNQ 4DR2Q 2OQKA 2JA7G 2Q2HA 2IT1A 4IFDG 2GVBA 1CSPA 2L15A 1U5KA 2JA5G 1SFOH 5IYCH 4X62L 5BR8Q 3CCMA 4APVA 1VQOA 1YITA 3J81c 2JQOA 3STBD 3CC2A 3RN5A 1SMXA 1TWCH 1VQKA 4BY1H 1PH8A 1MJCA 2HIXA 4JI5L 4LFBL 1EOVA 3HOVH 3CW2C 4HJ5A 1XPUA 3GTPH 3AFQA 1KD1C 1WI5A 4NXML 5DLQE 4UPAA 1WFQA 4DR6Q 4LF4Q 2VL6A 3CF5A 1VQ5A 3NENA 1OXXK 4LF5L 1TWHH 1P8LA 5IYBH 1EIFA 5C3EG 1ASZA 2F3IA 4KHPL 1HZ9A 3W1BA 2VS1A 4JI8L 1JMCA 4LF6Q 3T1YL 3CCRA 1Q1EA 3PCOB 1QUQB 4NPSA 4OWTB 4C3IH 2A19A 4LFCQ 1GO3E 3TS2A 4GN3B 3F8TA 3TQYA 1PV4A 2VUMG 4X65L 4A3KH 4DV5L 1YJ9A 3OW2A 2MO0A 2VY3A 1XMOL 3K7AH 4X62Q 1VQNA 4JCVE 4JI1L 1I50H 4BXXH 3I4NH 1CKOA 2YV5A 4DPGA 5GAGC 1V9PA 1PA6A 3NELA 4JI5Q 1QVCA 4LFBQ 2RHSB 3PUXA 4JI2L 5JEAG 1X3FA 3S15H 4BA2I 3HFZB 4NXMQ 2K14A 2Z0SA 3PF4A 1YBYA 2NVQH 4DV4L 1A8VA 1E3PA 3K0XA 4B3TL 1OXVA 2ZM6L 1K83H 5ELOA 2I0QA 3GTJH 2JA6G 4DR3L 1IBKL 2R93G 3GD7A 3CC7A 4KHPQ 1C7YA 2YYZA 2IHEA 4JI8Q 3T1YQ 3HOUH 1XJVA 4O2DA 1WJJA 2ZJRA 4QY7A 4HJ9A 2WFWA 4LF8L 4WJ4A 5IP7H 5GQOA 1PYBA 3EN2A 4JYAL 2QGQA 4H02A 5C4XH 4IOAA 4K0KQ 3F2BA 1L1OB 3D0FA 5H1SE 4R4IA 1XMOQ 1Q82C 4A75A 2E5LL 2Q2UA 1UE1A 2PQAB 1NE3A 3M7NA 1NMFA 5IP9H 2MO1A 2A1AA 3TS0A 1HNZL 1PH9A 1YVCA 1EUJA 2Q2TA 2K5NA 2VQFL 1S3OA 4BY7G 1PH4A 2BA0A 3KLWA 1C9OA 3WWVA 3I55A 4WJ3M 1WCMH 1M1KC 2ALYB 5IY0A 2HT1A 2IY5B 3U4ZA 1X9NA 1OXTA 4DR3Q 4A3LG 4DV1L 4JBKA 3J7A5 3KYHC 1GM5A 1E7ZA 3RR5A 3S2HH 3CCVA 1IXRA 4MTNA 3AYHB 4AQYL 5IE8A 1HNWQ 4A3EH 4AH6A 3CCSA 1K3RA 2B63H 4A4IA 2I5LX 5M5YH 1FJGQ 4P74A 4JYAQ 1VQAA 4DUZL 4DNIA 1HR0L 4B3SL 5M3FH 3S2DH 2GVAA 5AJ3L 2QA4A 1B7YB 4X66L 3KJPA 1P16A 2F4VL 4B3RL 4R4TA 1HNZQ 1LTLA 2DUDA 4DV2L 2RCNA 4GN5A 4LW1A 3PF5A 1QZHA 1N36L 2JA8H 4DR7Q 1LUZA 2PI2A 4DR4L 4LFAL 2JEAI 1KRSA 4JBJA 4AIMA 1SE8A 4EX5A 4JOIC 1VQ7A 2JK8A 4LUZA 4DV1Q 2OCEA 2R92H 1XMQQ 5C0XG 1X3GA 1KRTA 1VQHA 4AQYQ 1IBML 4A3DH 2KCTA 4L5TA 3E0EA 2KENA 4YHHL 3AQQA 3DLLA 3K7UC 3FHWA 4POFA 4DR5L 4QJFA 3AEVA 4DUZQ 4B3SQ 3PO3H 3F2DA 4LF9Q 2E2HH 1N9WA 1AE2A 4XTCS 1G51A 1O7IA 2HHHQ 2ZJQA 2HQLA 4QIWE 2I5MX 4X66Q 2F4VQ 1HZAA 1W3SA 4P71A 2VQEL 2ZJPA 4IOCA 2NN6I 1PH6A 1H95A 3PUYA 2H5XA 4RMFA 3DM3A 4JBWA 4YWKA 3S17H 4DR4Q 3U50C 1Y1VH 4IPGA 1YHBA 4GNXC 1Q7YC 1PH5A 1KHIA 1A63A 4JI4Q 1IBLQ 1TWGH 1Q46A 1VQ8A 4A3CG 4OO1I 4C2MH 4JI6L 1EQRA 3M9BA 4A3FH 3CD6A 2BH2A 3GTOH 2CCZA 4POGA 4OWWB 4HIOA 5HY6A 1JT8A 2LSSA 4GKJL 4JI0Q 1X54A 4JI7L 5IT9c 1Y1WH 3MEFA 1V1QA 2C35B 4HJAA 4BXXG 2OWOA 3I4NG 1UE5A 1Y14B 3IRBA 5M5XH 4EQ5A 5LMUL 3TRZA 4B3ML 3H0GG 3UDIA 1XTDA 2XGTA 3A5UA 4A3IH 2YTYA 3PUVA 3ULPA 4JI3Q 3HOWH 2Y0SG 2E2IH 1IL2A 1HZBA 1Q12A 4A3JG 5LMNW 2N3SA 1WOCA 1JJCB 4A93H 2ZTCA 2B29A 2N78A 1GKHA 1I5FA 4R4CA 3H3VI 2RHQB 4YY3L 3H3VH 3MXNB 2VW9A 2IX1A 3HOYG 4HIDA 3I4OA 3I4MH 1T9HA 2R7DA 1VQIA 1G291 3B6YA 3M4PA 4O0AA 5M3MG 1EFWA 4GKKL 3UE1A 5FLMG 3EIVA 4LF7L 3PUWA 2N8NA 1I94L 3K80C 5LMUQ 4JC0A 5IP9G 2JA7H 2Q2IA 1UWVA 3KDFA 1AH9A 4BBSG 4LF5Q 1Q1BA 2JA5H 3PSIA 4OXPA 3PIOA 3NEMA 2R7ZG 3KFUA 1VQPA 1X55A 4GLVB 4IJHA 4TVAB 4YWMA 2K5VA 1MKHA 1K73C 4QGUA 4DUYL 1EIYB 3J80i 3PUZA 2LXKA 4TQUS 3LGJA 3OYYA 4A3GG 2NVXH 2Z6KA 2UUAL 1E22A 4X65Q 5GAHC 1XNRL 4DV5Q 3CCLA 4P75A 1SLJA 4JI1Q 2ES2A 4GS3A 4LUOA 1WYDA 1A62A 5C3EH 1YI2A 4GKKQ 1EWIA 4DV3L 2ATWA 2NVYH 1FL0A 1Q86C 1W2BA 4JI2Q 2Y0SE 1RIPA 3FKIG 3BZKA 1DGSA 3S1QH 4DV4Q 2VUMH 4FDBA 4A3BG 1AE3A 1L0WA 4B3TQ 2ZM6Q 1BVSA 2XTIA 2VZAA 3CP0A 1PH7A 4A3MG 5JJKA 4GOPC 1IBKQ 2UU9L 1CUKA 4PG3A 2R7FA 2NVTH 1QUQA 2CWPA 1PFSA 3UE0A 4GOPA 4DUYQ 5C44G 1VQLA 2I5HA 4LF8Q 5IYDG 4KLKA 4JG2A 3G4SA 1XNRQ 3RLNA 5FJ8G 3T1HL 3L7ZC 1Q81C 1TWFH 2E5LQ 1G6PA 3M3YH 1K8GA 2K52A 2F52A 4QQBX 2JA6H 2R93H 1LYLA 3CCQA 1V43A 2HIVA 2OQ0A 1CSQA 4JV5L 5GADC 3K8AA 2GN5A 5J3BA 3PV0A 1K8AC 3CPFA 4DKAC 4ALPA 4Y52H 4PZ8A 2VQFQ 4GNXB 1KL9A 3RNUA 1KC8C 3HOZH 3ERSX 3I7FA 4NB3A 2UXBL 1I6HH 4L5QA 2NN6G 2OTLA 2CKZB 3E9IA 3J7ZC 1KXLA 3U4VA 2UU9Q 4DV6L 5ELNA 3PO2G 2AKWB 2WP8J 4QL5A 3W5OA 4AYBG 1YJWA 4L5RC 2ASBA 4PMWA 1EYGA 1PHJA 1X3EA 4RG1A 1Z9FA 1CKNA 1IZ6A 3I56A 1L2FA 1K0RA 3CCEA 2D0PA 4BY7H 1S72A 1HR0Q 3T1HQ 4A3FG 3RZDH 2PQAA 3S14H 3JAMi 5IYCG 1J5EL 1UEBA 5AJ3Q 1D7QA 5HGQA 4A3LH 4B3RQ 4PZ6A 1A0IA 1JB7A 3CQZH 4BY1G 5FLXc 4DV0L 2UUBL 4DV2Q 1R9TH 1N33L 1N36Q 4JV5Q 1BBWA 1X6OA 3HOVG 4DAMA 3CMAA 2UXCL 4LFAQ 1QZGA 3KF8B 3OTOL 4DR2L 2AWOA 4J15A 5GROA 4HIMA 4BBRH 3GTKH 3CAMA 4R4QA 1VS0A 4HJ8A 1MJEA 3ULLA 5BR8L 3CC4A 3ICEA 5IYBG 4IFDJ 3M4OH 2PMZE 5GAEC 1NTGA 1IBMQ 4A93G 5JJLA 4YHHQ 2EQSA 2JEBI 3SGIA 4DR5Q 1PYSB 1HZCA 4DR6L 1VQGA 4DAYB 4A3KG 1N32L 1TXYA 2PI2E 3D31A 3KDFB 4C3HH 2IHFA 1OXUA 1UE7A 2CQOA 3KF6A 3UDXA 1VQMA 5JJIA 4YCVA 3J81j 1VQDA 2VQEQ 4GLXA 2CFMA 4LF6L 3UDGA 1C0AA 2WB1G 4ME3A 4LUVA 1YEZA 2UXCQ 4LFCL 5IWAL 4L5SA 1JJGA 4AYBE 3G48A 2KCMA 3L2PA 1BKBA 2FXQA 3TEHB 1YIJA 1J6QA 2JA9A 3VDYA 3A5ZB 4LNQA 3HKSA 3GO5A 3J81i 2D0OA 2E2JH 3HOUG 4JI6Q 1UE6A 4DK3C 2K75A 3HOXH 3HKZG 1MIUA 4PZ7A 4UP9A 5IP7G 1X65A 3KOJA 5JEAJ 4GKJQ 1FVIA 5C4XG 1N32Q 4JI7Q 4IO9A 3ER0A 3H15A 1OTCA 3S1NH 4IFDI 4B3MQ 1YHAA 2MFIA 2NZOA 4A3CH 4IJLA 4DV7L 3EBEA 4YCWA 3I2ZA 2MNAA 4R4OA 1VQCA 3G6EA 4GOPB 2BH8A 3BZCA 1SRUA 5IWAQ 3RZOH 4JBMA 3PIPA 1KAWA 4YCUA 1WCMG 1OXSC 4K0KL 2Z6KC 1SROA 3J80c 2VNUD 2WAQG 1YHQA 3F2CA 5EAYA 3A0JA 4YY3Q 4UP7A 2UXDL 4IPHA 1N34L 1Q8KA 1NBWA 3H0GH 4KHZA 1S40A 3RLFA 4A76A 2OTJA 1SR3A 4R1JA 4A3EG 1EQQA 4HIKA 1VQ6A 2B63G 4A3JH 3S1RH 2WB1E 2PNHA 3ZJYC 4LF7Q 2UUCL 4X6AH 3M85A 5M3FG 2YTVA 1XPOA 1I94Q 3S1MH 4MZ9A 3G71A 3RN2A 1HNXL 3HOYH 3F1ZA 4DV7Q 2JA8G 3Q8DA 5K36G 1PVOA 1YNXA 1K9MC 4HJ7A 1HNWL 3JC66 3NBHB 1GVPA 2ZTEA 4KI0A 2MQHA 3HOZG 1HH2P 3S24A 5M3MH 1FJGL 3HKZE 1CKNB 5FLMH 3S16H 1VQBA 1I3QH 1X56A 3CXCA 4IPCA 1FGUA 1VQJA 4C3JH 2R92G 2D62A 1N8RC 2UXDQ 4UP8A 2UUAQ 1N34Q 2IX0A 1KQSA 3PGZA 4BBSH 4DR7L 2EIFA 2R7ZH 4A3DG 1B8AA 1D8LA 1LM0A 2N49A 1E1OA 2B3GA 3L0OA 4P73A 1VQ9A 2EXDA 4LWCA 1YZ6A 3UDFA 4DV3Q 2K50A 4X64L 3PO3G 1NMGA 3CPWA 2R6GA 2UUCQ 1TWAH 1XNQL 2V1CC 3FP9A 3CCUA 3RLOA 2JE6I 4DK6C 4A3GH 2KHJA 1NJIC 4NXNL 3GTLH 1YJNA 2NZHA 1XMQL 1HNXQ 2LXJA 5C0XJ 2WAQE 1PH3A 1Y1VG 4OWXB 2DGYA 1HJPA 3KJOA 3M4QA 4OONA 4BBRG 1L1OC 4P72A 4LF9L 1B70B 1PH1A 2E8GA
chains in the Genus database with same CATH superfamily
3FKIH 1L1OA 3MVVA 1DCZA 1U4RA 2B2YC 4OO1G 2K4KA 2CQAA 2WB1B 5C4JH 2WIIB 3CKIB 3HP3A 3AFPA 5C44H 4JOIA 5LMNL 4N9PA 4NKLA 2XWJB 2KBNA 3HOWG 1RD9D 4DV6Q 2QCPX 1HR0W 1Z7TA 1VDZA 2BA1A 1BNZA 5E7NA 5IGGA 1M90C 4JI3L 4EQNA 2ZTDA 4IUNA 3GTMH 3CCJA 4DAPA 3OTOQ 4DR2Q 1Y8NB 2Q2HA 2IT1A 2GVBA 1U5KA 3C1EA 3KBGA 5IYCH 2NVTB 4J8QA 5T1IA 1GUSA 2HIXA 4G7OC 2F0IA 5LL6X 1X32A 1CTMA 1STGA 3CW2C 5M5YB 3AFQA 4NXML 1DM0B 4UPAA 4DR6Q 3CF5A 3K57A 4OGQC 4E6IA 1LV9A 2A6ED 1SYBA 2FINB 4TRDA 3TDQA 1JMCA 3T1YL 3CCRA 3BDCA 4OWTB 2IJ0A 4LFCQ 2A73B 3F8TA 4DV5L 1YJ9A 3OW2A 1S5ED 3K7AH 1H9RA 1PRTD 5ELFA 1I50H 4HSPA 3I4NH 1NCVA 3HGBA 4K8IA 5ISRA 4LFBQ 4QIWB 1X3FA 4LAAA 2K5QA 1YBYA 2NVQH 1E3PA 1SE2A 3K0XA 4B3TL 1X3QA 4ILWA 3MAQA 4DR3L 2SOBA 4IUQA 3HOUH 1XJVA 1WJJA 2RA4A 4BBRB 4LF8L 5IP7H 1R4QB 1GUNA 1PYBA 2F0SA 5A2QL 3BVGA 5C4XH 5EKIA 5H1SE 3QG1A 1Q82C 4R4IA 2E5LL 2Q2UA 3MA2B 5IT9L 4WRDA 3MXNA 5IP9H 3KLSX 3MXUA 3TP6A 5D3IB 3OHXC 1EUJA 3KLWA 4C3HB 5E1FA 3V05A 3WOFA 1D5MC 4HCEA 4HCSA 1BXTA 2F0GA 4JBKA 1E7ZA 4RFBA 2E2IB 1IXRA 1RJTA 4MTNA 4RCNA 3MEHA 5IE8A 2SEBD 1LO5D 4AH6A 2XN9C 1E0BA 4A4IA 1FJGQ 4K6LA 4DUZL 4B3SL 1KNEA 1HR0L 2P5ZX 1EY8A 2X6LA 5M3FH 4B3RL 1P16A 1HNZQ 1LTLA 2RCNA 4LW1A 3PF5A 1HCZA 2JA8H 4DR7Q 4DR4L 4CDCC 1IHZA 2M2LA 1ILPA 2A74C 1VQ7A 4C3HG 4R8NA 1EOTA 4LUZA 4KY5A 2R92H 2B2TA 1KRTA 4OEMB 4A3DH 1GUWA 4U673 4JK1C 1NSNS 4QJFA 3JAME 1W6KA 3SHLA 3F2DA 2KHSA 3FEWX 3NQIA 3H91A 2F4VQ 2VQEL 2NN6I 5JOBA 3PUYA 5C3EB 3S17H 4GNXC 1Q7YC 1A63A 5J1ZA 1ENAA 1EIGA 3QIAA 1IYUA 3SEBA 1O7LA 4IUPA 4C2MH 2MUYA 1NR2A 4RHSA 4OO1H 1FNUA 2MP1A 2JP1A 3HG9A 4RKBA 2EYHA 3P7JA 4JI0Q 5CV8A 4BXXG 2OWOA 1Y14B 5M5XH 4EQ5A 4B3ML 2XGTA 1B3AA 3HOWH 2HCIA 1IL2A 1HZBA 1FD7D 5KNDA 4U68A 3FMCA 3FDTA 1STNA 3J81E 4QMGA 3NXWA 4R4CA 3H3VI 2RHQB 1KLUD 2EDGA 4MIUA 3I4OA 3PIO3 1AW7A 2F3VA 1VQIA 2DNEA 1G291 4O0AA 1UEAB 2KQ3A 1EFWA 5FLXL 2K1BA 4BY7B 1TU2B 4DAYA 4KN4C 2L9HA 5J39A 1IYVA 2B39A 4LF5Q 4IZ8A 3CQZB 2KUMA 1Q3LA 2RSNA 1X55A 3R2IA 4TVAB 1GJXA 4QGUA 5EQ0A 3SDZA 2LXKA 5M5WB 3OYYA 2QKIC 3CCLA 3RD4A 1S5BD 3E0JA 4GS3A 1WYDA 1A62A 3G7LA 1YI2A 4B9WA 2ATWA 5NUCA 1STAA 1RIPA 1BUVT 3FVQA 1DGSA 3BZKA 4X3SA 2IPKD 5FKAC 2R61A 1QOHA 4DV4Q 2LMCB 1AEXA 2ZM6Q 3P1HA 1YNNC 2AQ3B 2VZAA 2XTIA 3K5MA 2UU9L 1CUKA 2B2UA 2NVTH 3EROA 5I4DA 2CWPA 3UE0A 3HZXA 1G8ZD 2OXPA 3OWEB 4JG2A 4G7HC 2MPMA 3T1HL 3L7ZC 4JVZA 3BG3A 3J7AF 3M3YH 4V190 3UI2A 2PYKA 2GN5A 4KV6A 3PV0A 4MTKA 4DKAC 4Y52H 4PZ8A 2A68D 3ND8A 2VQFQ 2UXBL 4L5QA 1I6VC 3S1NB 1EY9A 3E9IA 2RBMA 5G3LF 5ELNA 2L4NA 2E75C 4Z9CB 2AKWB 1YJWA 4AYBG 5C5LA 3NBHA 4PMWA 1WTPA 1EYGA 5EGTA 1BBXC 5FO7B 5CR3A 1IZ6A 1L2FA 3IFDA 4A3FG 2PQAA 3S14H 3JAMi 1UEBA 2F0FA 1D7QA 2B2YA 4DN4M 4BY1G 2UUBL 3K5LA 1PXUA 3KLRA 4JV5Q 1X6OA 3HOVG 1QZGA 2AWOA 3MFGA 4BBRH 3GTKH 1HQRD 2ZXPA 4HJ8A 1HXYD 1HTPA 1A3TA 5TSSA 1WTOA 4C3IG 4YHHQ 2JEBI 4QF4A 4CKCA 2EZVA 4A3KG 1B44D 2PI2E 3D31A 3KDFB 4C3HH 4CJ1B 4CJ2C 4LMQD 1KDBA 3UDGA 1SXTA 4LUVA 4XYOA 4L5SA 2BOSA 1JJGA 1H9JA 2QF7A 1BKBA 2RKSA 4K5WA 5A2QE 1K0SA 3HKSA 3J81i 2KVMA 4I65A 1TQOA 5IT9E 4JI6Q 4DK3C 2K28A 4H0LC 1ESFA 1T5XD 1BQQT 3I91A 3FKIB 3NSWA 4JI7Q 2CW0D 2NZOA 1Q8IA 1O78A 4IJLA 1SYFA 2MNAA 1VQCA 4GOPB 1LTSD 2AUKA 1FGBD 3PIPA 3KUPA 4K0KL 2A5HA 2KEDA 4WJWA 3VYSA 1BR9A 2PMZB 1YHQA 5EAYA 2UXDL 4IPHA 5ELEA 1D2BA 2WV6D 4FVMA 1S40A 3RLFA 2RSOA 1SNPA 3I73A 4L8JA 2E2HB 2WB1E 2UUCL 1B9MA 1X3PA 2YTVA 3GV3A 3CRKC 3OSOA 3A8KE 4MZ9A 1NUCA 3RN2A 5K36G 3Q8DA 4QUFA 1DOKA 1CA6A 3GTMB 1EQVA 3HOZG 1HH2P 1GUGA 3S16H 5I9PA 3VR3A 3CXCA 3SE0A 1VQJA 1N8RC 1KTKA 1N34Q 1ENFA 2IX0A 1KQSA 2N49A 3L0OA 2B3GA 4K2KA 2Z6BA 4DF7A 4DV3Q 3PO3G 4X64L 2PQEA 1SE4A 1XNQL 1HTLD 3R2TA 4XT3B 1NJIC 2F0JA 1HNXQ 3VR4A 2DGYA 4RWSC 4KD3A 4P72A 4OX9L 2HHHL 2ZT9C 3M4YA 3K7AB 1JJ2A 2Q8RE 1I50B 3JAMc 1SDFA 2DN8A 1NY4A 4DR1L 3QB3A 1VQEA 4JI4L 1IBLL 1E24A 1Y1WG 2NVQB 4GLAC 2EYFA 2AWNA 3ULJA 5M5WH 3TREA 1XTCD 3VA5A 3P75A 1AZQA 3E9HA 1QVGA 4ZRZA 1EZ6A 3HOUB 2CWAA 3T13A 1A3UA 2AHOB 5FLXE 5C4XB 4YWLA 1XPRA 1RDPD 4LF4L 3O13A 2HDLA 2FFKB 4X3KA 3I4MG 2F0UA 5C3WA 2A6EC 3Q23A 1J5EQ 2K04A 3URYA 2AMCB 4DGZA 4B08A 1N33Q 2ID0A 1VCIA 3DEOA 4XIGS 5C0XH 1KIXA 1FNVA 3K81C 3NUCA 1PYWD 4GNXA 2C9OA 1LT3D 1CKMA 5LMNQ 2OQKA 4IFDG 2JA5G 3CCMA 5BR8Q 1PRTC 1YITA 2CHBD 3J81c 3STBD 3EJIA 3RN5A 2D2CC 1TWCH 4BY1H 1PH8A 3HOVH 1XPUA 3GTPH 1CQVA 1KD1C 2AQ2B 5M3FB 1AN8A 3MHBA 4ZK9B 2B8GA 1EQTA 3EA6A 3VYTA 2EYPA 1I4XA 1P8LA 4FXGC 2JA8B 1EIFA 1ASZA 4KHPL 2L55A 4JI8L 1A6XA 1Q1EA 1VMCA 4C3IH 1I6HB 1A3VA 4GN3B 3TQYA 1VMPA 2VUMG 4X65L 4A3KH 1F2MA 2R92B 2MO0A 1VQNA 1V1PB 4JCVE 4JI1L 4DPGA 2HDMA 4KJNA 1QVCA 1TS5A 3MC0B 4JI2L 5JEAG 5M9OA 3HFZB 4NXMQ 2K14A 2LS01 1A8VA 3ND9A 3T51B 1OXVA 2PZWA 4PQXA 2KJXA 3I90A 2I0QA 2EVBA 2R93G 3GD7A 1C7YA 2IHEA 3T1YQ 2L12A 2ZJRA 3SXHA 1MGSA 2RDGA 2WFWA 5CV5A 3NPPA 2F0LA 1W6JA 4F7XA 4OL7A 5JPMC 2D9UA 1B4OA 2PQAB 1EY4A 1NE3A 3U9SA 3AU7A 2A1AA 1ONLA 1EFID 5BN3A 3D3RA 4HR7B 1PH4A 2B2VC 3IFTA 4K5VA 5M5XB 2IY5B 4JW0A 1OXTA 4DR3Q 4CDEC 5BN4A 2IX3A 1QILA 5EBCA 5ELCA 1SMYD 4AQYL 2XWBB 1K3BC 4I7ZC 3S2DH 1WTRA 1S4ZA 1QE6A 1B7YB 4X66L 1DZ1A 1QZHA 4GN5A 1N36L 5K36H 3PMFA 4LFAL 1M4VA 1KRSA 2NWGA 1SE8A 4EX5A 2M9VA 3FPUB 1SAPA 1XMQQ 1CQFA 2NBFA 1IBML 3E0EA 1ZYRD 1TVXA 5L37A 2BDOA 3A56A 4DUZQ 4B3SQ 3PO3H 4LF9Q 5LHY1 1N9WA 1AE2A 2EE1A 2E2HH 2K32A 4Q5VA 4OHJA 1HZAA 3K0YA 4IUTA 5EPKA 2ZJPA 5ELDA 1PH6A 2K5DA 2Y0SB 3G6JB 2H5XA 4RMFA 3V96A 4DR4Q 4IPGA 1KHIA 4M1UB 1CHPD 3H09A 1QWYA 2EXZA 1Q46A 4XQJA 5JAVA 3CRLC 3VR5A 4IURA 4A3CG 4OO1I 1ICWA 2JSOA 2BH2A 4UDUC 3NBIA 3GTOH 1SNDA 4POGA 4HIOA 3NTKA 3I3CA 5HY6A 1F2ZA 2LSSA 3KBXA 4GKJL 1ILQA 1JE4A 1X54A 2WINB 5IT9c 1Y1WH 3MEFA 4HJAA 2C35B 5LMUL 1EY6A 3IRBA 3TRZA 3M3YB 3R8BA 3H0GG 1HRJA 1XTDA 2CVRA 3DWQA 2Y0SG 1CI3M 3C1FA 1TWAB 4A3JG 1SYDA 2N78A 3H94A 1HUNA 5KYIA 2DNCA 2HD3A 2VW9A 2KEEA 2IX1A 3HOYG 3I4MH 2R7DA 4L63B 1F2LA 3B6YA 2FHTA 1NAPA 4GKKL 1EU4A 1PLFA 3X3MA 1EZ8A 1I94L 3S14B 4N9TA 4PV1C 3KDFA 1AH9A 3LWUA 4BBSG 4IFDH 2JA5H 3PSIA 4XXEA 3WOEA 3PIOA 1VQPA 1JC7A 1QNUA 2EY6A 4YWMA 1WTXA 4HSVA 4DUYL 1EIYB 3PUZA 5DM63 3GTKB 2SNMA 2NVXH 2ZXRA 1XNRL 1SLJA 4LUOA 4C56C 2B8FA 1Q86C 2MHVA 2XSCA 2A68C 1SJED 3S1QH 2VUMH 1RKNA 4FDBA 4DXGA 4XDXA 1IBKQ 3QR8A 4PG3A 2R7FA 3I4LA 1QUQA 3Q22A 5FK9C 4GOPA 1JWMD 2I5HA 2NTSA 5JEAH 5IYDG 4KLKA 3G4SA 3RLNA 5FJ8G 1Q81C 1TWFH 2F52A 3F2UA 3SK8A 2R93H 5CV4A 3CCQA 2HIVA 1GHJA 1K8AC 2Z8LA 4ALPA 4GNXB 3KLSA 3I7FA 2XRQD 1I6HH 2NN6G 4DXFA 3J80L 3DWPA 4FF3A 2UU9Q 4DV6L 3PO2G 1OO9B 1CFMA 2G9DA 3X3NA 1X3EA 4DAVA 5EKLA 3CCEA 3I56A 4ZKBB 1QJOA 1LACA 1S72A 3T1HQ 4O42A 2QEJC 5AJ3Q 1JR0D 2Q8IB 3FRPB 1JB7A 5FLXc 4DV2Q 5D65A 2UXCL 3L9AX 1H9KA 2ZXOA 3OTOL 4DR2L 5GROA 3DWAA 4HIMA 3TP7A 2I46A 3CAMA 4R4QA 3S9WA 4IFDJ 1HHVA 3CC4A 5IYBG 2XNAC 3HKZB 4J1MA 4ODGA 2PMZE 4A93G 5JJLA 3S16B 1DXMA 2LFNA 3SGIA 4DR5Q 1PYSB 4DR6L 1N32L 1TXYA 2L5TA 3N52A 2IHFA 2CW0C 4YCVA 1VQDA 4GLXA 4ME3A 2K05A 4FXKC 1WCMB 4LFCL 5IWAL 2G5DA 3G48A 4KHVA 2FXQA 2Z4HA 1J6QA 2JA9A 3VDYA 5FO8B 2V4DA 5E4WC 2D0OA 2F0MA 2K75A 4XT1B 3HKZG 4QUCA 1KDCA 2KECA 3GP7A 3KOJA 3TZDA 5JEAJ 1LTID 4IO9A 4ULLA 2PZUA 2N55A 5C6AA 1YHAA 4A3CH 4DV7L 1Y8OB 3DMUA 4R4OA 2NZ1D 1SRUA 5HURA 4JBMA 1KAWA 4YCUA 1WCMG 1OXSC 1FR3A 4ID6A 4OELB 5EPJA 2WAQG 3F2CA 3R93A 4YY3Q 4UP7A 3K5OA 4KHZA 3H0GH 4HAEA 4A3EG 4R1JA 1EQQA 4HIKA 1B53A 1G2SA 4A3JH 4LF7Q 3M85A 1XPOA 4DA2A 3NQTA 2FMMA 2QDLA 3HOYH 1QNKA 2BCOA 4RH6A 4AYBB 2MQHA 3OMCA 3SVMA 1FJGL 2KOLA 2EOTA 2F0KA 4L6TB 4A3FB 2D62A 2UXDQ 2UUAQ 1JORA 2QW7A 5D14A 1V1PA 4BBSH 3PGZA 1BOSA 1MI2A 2EIFA 4DR7L 4BY1B 1B8AA 1TWCB 1D8LA 2F0NA 1VQ9A 3K5NA 3HOVB 2HQEA 1YZ6A 4LWCA 3UDFA 4CDFC 5C4ZA 5I6WA 3GTPB 2UUCQ 1LLRD 1TWAH 2V1CC 2B2VA 4RCOA 2JE6I 2KHJA 4NXNL 2MJ8A 2JYOA 2NZHA 2RDHA 2LXJA 3P20A 1Y1VG 1HJPA 1D1KA 1E2VA 3KJOA 4C3IB 4NW2A 2WACA 1L1OC 4A3KB 2D5DA 1HFGA 2BE5D 4BA1I 4GN4B 1GUOA 1QB5D 2PNRC 1WTVA 2PW7A 5I2XA 1RL2A 1YNJD 1TY2A 1C8CA 4X64Q 2IL8A 4BS9A 1XNQQ 1TS3A 3CMEA 5IYDH 3BU2A 1PZJD 3U58A 3OIPA 2KHIA 1IW7D 1CZGA 4A3IG 5FJ8H 1ET9A 3GTQH 1DJRD 1LTRD 2K5HA 3STBC 4DU9A 4JI0L 3DHQA 2J7ZA 4MNOA 3VYUA 4OX9Q 3Q0AA 3GDEA 4FP5D 3HOXG 1J9OA 4N8X1 3SK6A 1XWEA 2NVYB 4DR1Q 4DV0Q 5C0XI 1ML0D 3PO2H 2GA4B 2QEXA 1DOLA 5G3LD 3ITPA 2JA7G 4HTHA 1K28A 1Q90A 2F0EA 5IGFA 3T56B 4JPBW 1SFOH 4X62L 4APVA 1VQOA 4TSSA 3CC2A 2JQOA 1VQKA 4JI5L 1PFBA 3Q6SA 2QDBA 2OT2A 1WI5A 5DLQE 1WFQA 3S2DB 1U9RA 4PNYA 4LF4Q 1OXXK 4LF5L 1TWHH 5IIFA 5IYBH 3BZDB 1HZ9A 1ZXTA 2VS1A 4LF6Q 5DM73 3PCOB 4ZAIA 1QUQB 2F0OA 3HOZB 2X6GA 2A19A 1GO3E 1ZKOA 4J6HA 2CH4W 1XMOL 2TMPA 4BXXH 1BCPD 5CMDA 2YV5A 5GAGC 3D4WA 3Q24A 3S15H 4BA2I 3PO3B 1HA6A 4KD4A 4C3JG 2Z0SA 1LT5D 4DV4L 2EYMA 4GZYC 1UAPA 2ZM6L 3E6ZX 4EQOA 3VYRA 5I9OA 1K83H 5ELOA 3GTJH 2JA6G 4KHPQ 4JI8Q 3J80E 1BO0A 2B2WC 2X69A 4O2DA 3I8ZA 1SMYC 4HJ9A 4WJ4A 1B2TA 4ZKCB 4JYAL 2QGQA 3FPPA 4ZQ3A 4IOAA 3M4OB 3A7LA 4CDDC 1UE1A 2O4XA 3M7NA 1WVLA 3GTOB 2MO1A 3TS0A 2Z9HA 3GV6A 5KIXA 3J7YW 1CA5A 2VXWA 1VF5C 5JJZA 3TN2A 1YVCA 4FXDA 2VQFL 1S3OA 1Y1WB 2BA0A 3WWVA 2QILA 1WCMH 1M1KC 2DY8A 4CJ0B 3U4ZA 1X9NA 4A3LG 3CU7A 4DV1L 3KYHC 3RR5A 4YIJA 3S2HH 1HNWQ 4A3EH 5KEEA 1ZYRC 5DEHA 2I5LX 4P74A 4DNIA 1TS2A 1PTOD 4F88A 3OOCA 3I4MB 3KJPA 4R4TA 2DUDA 1LUZA 2JEAI 1CK1A 1LT4D 2MGSA 2Z4IA 4H13C 2PO4A 3A7AB 2JA5B 2OCEA 1WD1A 1EEFD 4AQYQ 4L5TA 1PRTB 4YHHL 3AQQA 3K7UC 3FHWA 1G6ZA 1U4LA 1GUTA 3T4AC 3SR1A 2NVXB 4XTCS 2EY2A 2G9HD 2ZJQA 3L3OC 2HQLA 4QIWE 1Y8PB 2I5MX 5A35A 4X66Q 1W3SA 4IOCA 1H95A 3DM3A 1CM9A 1B9NA 1EYDA 1TKWB 3U50C 1Y1VH 4KKTA 5DAUA 1JWUD 1MBYA 3OW7A 3S1QB 2VUMB 4CHTB 2FJ2A 3NE5B 1LTGD 2ICIA 1VQ8A 3W2DA 1EEID 4JI6L 1EQRA 4A3FH 1DOMA 5M3MB 2CCZA 5ELBA 1JT8A 1ET6A 2F0WA 4JI7L 2K6AA 5E4XA 1SEBD 1V1QA 4N8FA 2EY5A 1F9SA 3I4NG 1UE5A 1TWFB 2R7ZB 1MSGA 3UDIA 3A8JE 4A3IH 2KCCA 2R93B 2YTYA 3PUVA 3ULPA 4JI3Q 1Q12A 5F2DA 5LL6S 5LMNW 2DJGC 2N3SA 2K33A 1JJCB 3GTLB 2ZTCA 1DYQA 4FO2A 3R3OA 3NWSA 4HIDA 1TIID 3D8GA 3M4PA 4FF1A 4G7ZC 5M3MG 3UE1A 3EIVA 2E76C 4WFN3 4A3BB 1TY0A 5LMUQ 4JC0A 5IP9G 2JA7H 3T53B 4A3MB 1M8AA 2EJFC 2L0CA 2R7ZG 2F4IA 4OXPA 1IKLA 1XX8A 4IALA 5AFWA 1K73C 3J80i 5EBDA 3LGJA 4A3GG 1E22A 5GAHC 4DV5Q 1LTAD 4P75A 4G57A 1GHKA 2ES2A 2YU9B 4GKKQ 1EY7A 4MN3A 4MHEA 1ICFB 1STBA 5JVH3 4DV3L 2NVYH 2SNSA 1W2BA 2K01A 1I4QA 3D6CA 4OIKA 1DD2A 4A3BG 2NB0A 1AE3A 1EY0A 1L0WA 4B3TQ 3BDOA 2A69D 1BVSA 1AP0A 3CP0A 4A3MG 5JJKA 4PMCA 4EGVA 3HRZC 1S5CD 4DUYQ 1EL0A 4DFAA 1E2WA 4LF8Q 4WORA 2O5JC 4KK7A 3VA7A 1K8OA 1XNRQ 2E5LQ 1G6PA 1K8GA 2K52A 4QQBX 2JA6H 4FF4A 1LYLA 1IKMA 2H1EA 1V43A 2OQ0A 1CSQA 4HN7A 3CPFA 1O7ZA 3MXGA 3RNUA 5IGEA 3HOZH 4NB3A 1T5EA 2ICEC 2XRSD 1MSHA 1LTBD 5BN5A 2CKZB 3J7ZC 1KXLA 1GOZA 1C48A 3V2TA 4QL5A 2WP8J 3W5OA 2ASBA 4L5RC 3ERQA 2N88A 1A2TA 2J4XA 1HR0Q 3RZDH 3H6MA 1J5EL 1V8QA 1O7YA 3H0GB 5D3DA 4DNRB 5HGQA 4PZ6A 4B3RQ 3NTHA 4A3LH 2FMCA 4RGNA 1N33L 1R9TH 1BBWA 2A6HD 1O80A 2F1MA 4A3JB 1XYIA 4DAMA 3CMAA 3KF8B 4J15A 1B3QA 1MJEA 5BR8L 3HOYB 1Z6HA 3M4OH 2F0TA 1GXDC 1PRTF 1TT2A 1HZCA 3OMGA 1VQMA 1OXUA 1UE7A 5IGCA 3UDXA 4BBSB 1SNOA 1EYAA 4ZCKA 2VQEQ 4QB4A 2PW5A 4HMJA 1C0AA 2F0PA 5EKKA 2WB1G 5JVG3 1JOKA 2UXCQ 4AYBE 3L2PA 3BVMA 3D6WA 3TEHB 4ABNA 1YIJA 1WD0A 3GO5A 1I4RA 5CV7A 4HMIA 4EQPA 2E2JH 1B1ZA 3DM1A 3E3XA 1UE6A 4XYQA 3MZ5A 2B63B 4UP9A 3BYTB 1H9SA 1X65A 2AQ1B 1FVIA 1N32Q 3D4RA 4XQNA 1WTHA 5EJWA 3H15A 1KABA 5C3XA 1RTNA 4B3MQ 2MFIA 3EBEA 3K59A 3I2ZA 1FNWA 4FYDA 3G6EA 2BH8A 5IWAQ 3RZOH 2Z6KC 1SROA 3J80c 2LY7A 2CH4A 4TKOB 3GTQB 4V0BA 1NBWA 3CHBD 2OTJA 2L11A 3LNNA 2B63G 4IUUA 1S5DD 4K6DA 3ZJYC 3S1MH 3EQLC 3G71A 4DV7Q 4X3UA 2O5IC 1U4PA 1YNXA 3PO2B 1PVOA 4H44C 4KKSA 4HJ7A 3JC66 1GVPA 2ZTEA 1TWGB 2KCNA 2B2WA 5M3MH 1CKNB 4KMUC 2WKDA 1VQBA 1I3QH 1X56A 1FGUA 1SFOB 2BE5C 2R7ZH 1E1OA 1YNJC 4P73A 3C2PA 1D5XC 1NMGA 1I4HA 1JOQA 1KDAA 5CV9A 3FP9A 4A3GH 1TWHB 3GTLH 1LABA 1XMQL 1EIHA 1IW7C 4PMBA 1PH3A 1J8IA 1D6EC 2HUGA 2K7VA 4A93B 3M4QA 4OONA 1RCVD 4BBRG 2F0HA 4RHRA 1SYGA 4LF9L 1PH1A 2HCCA 2E8GA 3BVZA 3KF6B 3QOLA 4A3BH 1U0LA 1A2UA 2J0TD 4A3MH 4Q0FA 1IYJB 2JJQA 3NK9A 3S15B 4IPDA 4NXNQ 1JE5A 1K83B 3GTJB 2UXBQ 1UNSA 4UY8C 1RHPA 1ZEQX 2PZTA 4Y7NH 3GTGH 3QJYA 1BCPB 4RGMA 2LKVA 4NDXA 5JPNC 1VQ4A 4F87A 1BBUA 2YU9H 3H3VC 1PH2A 3M7GA 1SN8A 4DK1A 2H4OA 3OPOA 1Z47A 2YTXA 2A8VA 3TMEA 4S3SA 2RF4A 2RCFA 3W1GA 1ASYA 1DONA 1QVFA 1WTWA 1E1TA 1UUPA 2UUBQ 1EYCA 3BS1A 4FNFA 3A74A 3BJUA 1VQFA 1GD7A 1RF2D 3MXPA 4R8IA 1L0XB 4FF2A 5IGBA 1CSPA 2L15A 2WAQB 1HUMA 3S2HB 1BF4A 1BCPC 5T1GA 1SMXA 4F8MA 4A3EB 3IAYA 1MJCA 1SNMA 4LFBL 1EOVA 4HJ5A 1HQMC 1SSOA 2JXMB 2VL6A 3QOJA 3NENA 1VQ5A 1QG7A 2K03A 1G2TA 3C46A 5C3EG 1SNQA 2F3IA 3W1BA 2L1BA 4NPSA 5IODA 1WTQA 3TS2A 1SE3A 1PV4A 1C4QA 2EYOA 2VB3X 5COYA 2VY3A 4X62Q 1PTOB 4NMZA 1CKOA 1PA6A 1V9PA 3WDNA 3VR2A 1NR4A 3NELA 4JI5Q 4RGTA 2RHSB 3PUXA 5KNCA 3PF4A 5KYLA 1EU3A 1IBKL 1A15A 3CC7A 4K8JA 2YYZA 1Y1VB 1ENCA 4KN7C 4QY7A 2Q8TA 1JB3A 3RUZA 5GQOA 3EN2A 4H02A 1CZWA 4K0KQ 3F2BA 1L1OB 3D0FA 1XMOQ 4A75A 1PTOC 4M8AA 1JOOA 3PQIA 1NMFA 1XXGA 1HNZL 1PH9A 3I70A 2Q2TA 2K5NA 2TSSA 5IOCA 4KY7A 4BY7G 1C9OA 1I4GA 2EJGC 3I55A 3HS0C 4WJ3M 2ALYB 5IY0A 2HT1A 4RKLA 4A3IB 2F3WA 3J7A5 5CYUA 2AUJD 1GM5A 3CCVA 3AYHB 1NNXA 1SYCA 3CCSA 5KNBA 1K3RA 2B63H 4JYAQ 4XQQA 5M5YH 1VQAA 1K8MA 2GVAA 1MHWC 4KY6A 5AJ3L 2QA4A 3HOXB 2NTTA 5HGTA 2F4VL 1CHQD 2F0QA 4DV2L 5IGDA 2PI2A 2F0VA 1AFPA 1II3A 4AIMA 4JBJA 5DNFA 1KNAA 4JOIC 2JK8A 4OIJA 2JA7B 2VB2X 1AZPA 4DV1Q 5C0XG 1X3GA 3SK4A 4EVOA 1VQHA 4O1NA 1V1OA 4RAUC 2BDNA 2KCTA 2KENA 3DLLA 4POFA 4DR5L 3AEVA 5CORA 1H9SB 2RDFA 1JWSD 1G51A 1O7IA 2HHHQ 1EY5A 4P71A 4ME5A 2R3ZA 2NN6H 1PZID 4JBWA 4YWKA 1STEA 1SYEA 3S1RB 1YHBA 1PH5A 4JI4Q 1IBLQ 3DUZA 1JCKB 1TWGH 1QCBD 2EPBA 1B50A 1D5ZC 1KAAA 1E2ZA 1TR5A 1FYCA 1HFNA 3M9BA 4HEDA 3CD6A 1VF7A 3NP8A 4OWWB 1BCPF 4C3JB 1F2YA 2RVLA 2JA6B 3A5UA 2ENBA 2EJMA 2E2IH 1PZKD 4X3TA 1PFNA 1WOCA 1EWCA 4A93H 3KF8A 2B29A 1G91A 4R9WA 1GKHA 1I5FA 3EFXD 2WKCA 4YY3L 3H3VH 3MXNB 2RQXA 3AMUA 1IL8A 5FO9B 1T9HA 3QWNA 3T16A 5I2YA 5FLMG 2EYJA 4B9XA 4LF7L 3PUWA 2N8NA 3RZDB 3K80C 5FOBB 2Q2IA 1UWVA 1Q1BA 2A69C 5C4JB 3NEMA 1R9TB 3KFUA 4GLVB 4IJHA 2K5VA 1MKHA 5C44B 5J22A 4IUVA 4TQUS 3E5SA 2EY1A 2Z6KA 1SNCA 2UUAL 4X65Q 4UHVA 3GQBA 1PTOF 4JI1Q 4CKEA 5C3EH 1EWIA 1FL0A 4JI2Q 2Y0SE 4I7AA 3FKIG 4KKUA 3D4DA 3NTIA 3K6OA 3A55A 5CBEE 1LT6D 1PH7A 4GOPC 1KLGD 1PFSA 1ESRA 5C44G 1VQLA 3VR6A 1LTTD 3TSSA 4CGYB 3A54A 3MFYA 2E2JB 5CV6A 1I4PA 4C1NK 2XVSA 3W3AA 4JV5L 4BWGB 3K8AA 5GADC 5J3BA 2A6HC 5K5PA 1KL9A 1KC8C 3ERSX 1YNND 2OTLA 1PMRA 2SDFA 5EPLA 2B2TC 4RA8A 3U4VA 1SBBB 2E74C 3NHHA 3EVQA 1PTOH 5CBAE 4DK0A 3RZOB 1F9QA 1F77A 4KJOA 4H7BA 2IWHA 4RG1A 4CKBA 1PHJA 1BDOA 2Z1CA 1Z9FA 1CKNA 4P2CB 1K0RA 1PFMA 3LX0A 2D0PA 4BY7H 3TZUA 1MD2D 3I4NB 5IYCG 1JQYD 1HA5A 3IKJA 1A0IA 3CQZH 4DV0L 4CBVA 1N36Q 3AB9A 4LFAQ 3BYYB 2EYLA 1JICA 3S1MB 3A8IE 1U4MA 3QO2A 4K5XA 1VS0A 3ULLA 3ICEA 2O2LD 5E3FA 3DEPA 5C4HA 4KTAA 1CT1D 5GAEC 1NTGA 1IBMQ 2F0DA 4ZUIA 2EQSA 1D1IA 1I3QB 1VQGA 4ZLTF 4DAYB 2DJFC 3TBIB 1TS4A 2CQOA 3KF6A 4NP5A 3U9OA 5JJIA 4LJZC 1F9RA 3J81j 2DY7A 5KGUA 2CFMA 3TP5A 4LF6L 4RGOS 1S5FD 2KA7A 1YEZA 2C5CA 2M00A 2KCMA 4A3GB 4UAIA 3A5ZB 4LNQA 3HOUG 3HOXH 2OEOA 1STHA 2E2DC 3N6RA 3RMHA 3JAML 1MIUA 4PZ7A 5I6YA 5IP7G 4K2LA 3PIP3 4GKJQ 5C4XG 4ZUJA 3ER0A 4ZYSA 1R4PB 1EWHA 4LK1C 1OTCA 3S1NH 4IN3A 4IFDI 4YCWA 4DNTB 1RODA 3BZCA 3ZYYX 4G4KA 4IQZA 4K14A 3SK5A 1RTOA 3J7AV 2VNUD 4Y7NB 3A0JA 5KRUA 3GTGB 2PPBC 4A3DB 1N34L 1Q8KA 1SJHD 2IW3A 2NYZD 4A76A 5C5MA 1SR3A 2K5WA 1VQ6A 3KK7A 5CGKA 3S1RH 3NWTA 1Y69U 1H9MA 2PNHA 1F9PA 2JN4A 4X6AH 3OIQA 5M3FG 2PCFB 1I94Q 1HNXL 3S17B 3F1ZA 2JA8G 2B2UC 3LWEA 1K9MC 1PDQA 1HNWL 3NBHB 4KI0A 3J81L 3S24A 3HKZE 5FLMH 3K58A 3BDLA 4IPCA 4C2MB 4C3JH 2R92G 4UP8A 4QCLA 4A3DG 1LM0A 2I07B 3MWYW 3I72A 3MTSA 2EXDA 4C1NI 3ONAB 3OWFA 2K50A 3CPWA 2R6GA 3CCUA 3RLOA 1HPCA 4DK6C 3HOWB 1YJNA 5CC4A 3C3LA 3IL8A 5C0XJ 1L0YB 2NUCA 2WAQE 3DXJC 4OWXB 3HEJA 2F03A 1STYA 1B70B 2OF1A 2XIWA 3TP8A
chains in the Genus database with same CATH topology
3FKIH 2HHHL 1L1OA 3KF6B 4BA1I 1JJ2A 4GN4B 4A3BH 4OO1G 3JAMc 1U0LA 1RL2A 2K4KA 4A3MH 1NY4A 1IYJB 2JJQA 4DR1L 5C4JH 4OX9L 1VQEA 4JI4L 4X64Q 1IBLL 1E24A 1Y1WG 3AFPA 1XNQQ 5C44H 3CMEA 4GLAC 5IYDH 4IPDA 3BU2A 2AWNA 4JOIA 5LMNL 1JE5A 3U58A 2KHIA 4NXNQ 3ULJA 2UXBQ 5M5WH 3TREA 4A3IG 5FJ8H 2KBNA 4UY8C 4Y7NH 3HOWG 3E9HA 1QVGA 3GTGH 3GTQH 2CWAA 4DV6Q 3STBC 2K5HA 1VQ4A 2YU9H 1BBUA 4JI0L 4MNOA 1PH2A 1HR0W 1SN8A 2AHOB 4OX9Q 4YWLA 1XPRA 1Z47A 2BA1A 3GDEA 2YTXA 4LF4L 5E7NA 2A8VA 3HOXG 2RF4A 3I4MG 1M90C 1J5EQ 4JI3L 2AMCB 3W1GA 1ASYA 2ZTDA 1QVFA 1E1TA 4DR1Q 2UUBQ 4DV0Q 5C0XI 1N33Q 3PO2H 3GTMH 2ID0A 1VCIA 4XIGS 3CCJA 1KIXA 2QEXA 3A74A 3K81C 3BJUA 4GNXA 1VQFA 1GD7A 1CKMA 3OTOQ 5LMNQ 4DR2Q 2OQKA 2JA7G 2Q2HA 2IT1A 4IFDG 2GVBA 1CSPA 2L15A 1U5KA 2JA5G 1SFOH 5IYCH 4X62L 5BR8Q 3CCMA 4APVA 1VQOA 1YITA 3J81c 2JQOA 3STBD 3CC2A 3RN5A 1SMXA 1TWCH 1VQKA 4BY1H 1PH8A 1MJCA 2HIXA 4JI5L 4LFBL 1EOVA 3HOVH 3CW2C 4HJ5A 1XPUA 3GTPH 3AFQA 1KD1C 1WI5A 4NXML 5DLQE 4UPAA 1WFQA 4DR6Q 4LF4Q 2VL6A 3CF5A 1VQ5A 3NENA 1OXXK 4LF5L 1TWHH 1P8LA 5IYBH 1EIFA 5C3EG 1ASZA 2F3IA 4KHPL 1HZ9A 3W1BA 2VS1A 4JI8L 1JMCA 4LF6Q 3T1YL 3CCRA 1Q1EA 3PCOB 1QUQB 4NPSA 4OWTB 4C3IH 2A19A 4LFCQ 1GO3E 3TS2A 4GN3B 3F8TA 3TQYA 1PV4A 2VUMG 4X65L 4A3KH 4DV5L 1YJ9A 3OW2A 2MO0A 2VY3A 1XMOL 3K7AH 4X62Q 1VQNA 4JCVE 4JI1L 1I50H 4BXXH 3I4NH 1CKOA 2YV5A 4DPGA 5GAGC 1V9PA 1PA6A 3NELA 4JI5Q 1QVCA 4LFBQ 2RHSB 3PUXA 4JI2L 5JEAG 1X3FA 3S15H 4BA2I 3HFZB 4NXMQ 2K14A 2Z0SA 3PF4A 1YBYA 2NVQH 4DV4L 1A8VA 1E3PA 3K0XA 4B3TL 1OXVA 2ZM6L 1K83H 5ELOA 2I0QA 3GTJH 2JA6G 4DR3L 1IBKL 2R93G 3GD7A 3CC7A 4KHPQ 1C7YA 2YYZA 2IHEA 4JI8Q 3T1YQ 3HOUH 1XJVA 4O2DA 1WJJA 2ZJRA 4QY7A 4HJ9A 2WFWA 4LF8L 4WJ4A 5IP7H 5GQOA 1PYBA 3EN2A 4JYAL 2QGQA 4H02A 5C4XH 4IOAA 4K0KQ 3F2BA 1L1OB 3D0FA 5H1SE 4R4IA 1XMOQ 1Q82C 4A75A 2E5LL 2Q2UA 1UE1A 2PQAB 1NE3A 3M7NA 1NMFA 5IP9H 2MO1A 2A1AA 3TS0A 1HNZL 1PH9A 1YVCA 1EUJA 2Q2TA 2K5NA 2VQFL 1S3OA 4BY7G 1PH4A 2BA0A 3KLWA 1C9OA 3WWVA 3I55A 4WJ3M 1WCMH 1M1KC 2ALYB 5IY0A 2HT1A 2IY5B 3U4ZA 1X9NA 1OXTA 4DR3Q 4A3LG 4DV1L 4JBKA 3J7A5 3KYHC 1GM5A 1E7ZA 3RR5A 3S2HH 3CCVA 1IXRA 4MTNA 3AYHB 4AQYL 5IE8A 1HNWQ 4A3EH 4AH6A 3CCSA 1K3RA 2B63H 4A4IA 2I5LX 5M5YH 1FJGQ 4P74A 4JYAQ 1VQAA 4DUZL 4DNIA 1HR0L 4B3SL 5M3FH 3S2DH 2GVAA 5AJ3L 2QA4A 1B7YB 4X66L 3KJPA 1P16A 2F4VL 4B3RL 4R4TA 1HNZQ 1LTLA 2DUDA 4DV2L 2RCNA 4GN5A 4LW1A 3PF5A 1QZHA 1N36L 2JA8H 4DR7Q 1LUZA 2PI2A 4DR4L 4LFAL 2JEAI 1KRSA 4JBJA 4AIMA 1SE8A 4EX5A 4JOIC 1VQ7A 2JK8A 4LUZA 4DV1Q 2OCEA 2R92H 1XMQQ 5C0XG 1X3GA 1KRTA 1VQHA 4AQYQ 1IBML 4A3DH 2KCTA 4L5TA 3E0EA 2KENA 4YHHL 3AQQA 3DLLA 3K7UC 3FHWA 4POFA 4DR5L 4QJFA 3AEVA 4DUZQ 4B3SQ 3PO3H 3F2DA 4LF9Q 2E2HH 1N9WA 1AE2A 4XTCS 1G51A 1O7IA 2HHHQ 2ZJQA 2HQLA 4QIWE 2I5MX 4X66Q 2F4VQ 1HZAA 1W3SA 4P71A 2VQEL 2ZJPA 4IOCA 2NN6I 1PH6A 1H95A 3PUYA 2H5XA 4RMFA 3DM3A 4JBWA 4YWKA 3S17H 4DR4Q 3U50C 1Y1VH 4IPGA 1YHBA 4GNXC 1Q7YC 1PH5A 1KHIA 1A63A 4JI4Q 1IBLQ 1TWGH 1Q46A 1VQ8A 4A3CG 4OO1I 4C2MH 4JI6L 1EQRA 3M9BA 4A3FH 3CD6A 2BH2A 3GTOH 2CCZA 4POGA 4OWWB 4HIOA 5HY6A 1JT8A 2LSSA 4GKJL 4JI0Q 1X54A 4JI7L 5IT9c 1Y1WH 3MEFA 1V1QA 2C35B 4HJAA 4BXXG 2OWOA 3I4NG 1UE5A 1Y14B 3IRBA 5M5XH 4EQ5A 5LMUL 3TRZA 4B3ML 3H0GG 3UDIA 1XTDA 2XGTA 3A5UA 4A3IH 2YTYA 3PUVA 3ULPA 4JI3Q 3HOWH 2Y0SG 2E2IH 1IL2A 1HZBA 1Q12A 4A3JG 5LMNW 2N3SA 1WOCA 1JJCB 4A93H 2ZTCA 2B29A 2N78A 1GKHA 1I5FA 4R4CA 3H3VI 2RHQB 4YY3L 3H3VH 3MXNB 2VW9A 2IX1A 3HOYG 4HIDA 3I4OA 3I4MH 1T9HA 2R7DA 1VQIA 1G291 3B6YA 3M4PA 4O0AA 5M3MG 1EFWA 4GKKL 3UE1A 5FLMG 3EIVA 4LF7L 3PUWA 2N8NA 1I94L 3K80C 5LMUQ 4JC0A 5IP9G 2JA7H 2Q2IA 1UWVA 3KDFA 1AH9A 4BBSG 4LF5Q 1Q1BA 2JA5H 3PSIA 4OXPA 3PIOA 3NEMA 2R7ZG 3KFUA 1VQPA 1X55A 4GLVB 4IJHA 4TVAB 4YWMA 2K5VA 1MKHA 1K73C 4QGUA 4DUYL 1EIYB 3J80i 3PUZA 2LXKA 4TQUS 3LGJA 3OYYA 4A3GG 2NVXH 2Z6KA 2UUAL 1E22A 4X65Q 5GAHC 1XNRL 4DV5Q 3CCLA 4P75A 1SLJA 4JI1Q 2ES2A 4GS3A 4LUOA 1WYDA 1A62A 5C3EH 1YI2A 4GKKQ 1EWIA 4DV3L 2ATWA 2NVYH 1FL0A 1Q86C 1W2BA 4JI2Q 2Y0SE 1RIPA 3FKIG 3BZKA 1DGSA 3S1QH 4DV4Q 2VUMH 4FDBA 4A3BG 1AE3A 1L0WA 4B3TQ 2ZM6Q 1BVSA 2XTIA 2VZAA 3CP0A 1PH7A 4A3MG 5JJKA 4GOPC 1IBKQ 2UU9L 1CUKA 4PG3A 2R7FA 2NVTH 1QUQA 2CWPA 1PFSA 3UE0A 4GOPA 4DUYQ 5C44G 1VQLA 2I5HA 4LF8Q 5IYDG 4KLKA 4JG2A 3G4SA 1XNRQ 3RLNA 5FJ8G 3T1HL 3L7ZC 1Q81C 1TWFH 2E5LQ 1G6PA 3M3YH 1K8GA 2K52A 2F52A 4QQBX 2JA6H 2R93H 1LYLA 3CCQA 1V43A 2HIVA 2OQ0A 1CSQA 4JV5L 5GADC 3K8AA 2GN5A 5J3BA 3PV0A 1K8AC 3CPFA 4DKAC 4ALPA 4Y52H 4PZ8A 2VQFQ 4GNXB 1KL9A 3RNUA 1KC8C 3HOZH 3ERSX 3I7FA 4NB3A 2UXBL 1I6HH 4L5QA 2NN6G 2OTLA 2CKZB 3E9IA 3J7ZC 1KXLA 3U4VA 2UU9Q 4DV6L 5ELNA 3PO2G 2AKWB 2WP8J 4QL5A 3W5OA 4AYBG 1YJWA 4L5RC 2ASBA 4PMWA 1EYGA 1PHJA 1X3EA 4RG1A 1Z9FA 1CKNA 1IZ6A 3I56A 1L2FA 1K0RA 3CCEA 2D0PA 4BY7H 1S72A 1HR0Q 3T1HQ 4A3FG 3RZDH 2PQAA 3S14H 3JAMi 5IYCG 1J5EL 1UEBA 5AJ3Q 1D7QA 5HGQA 4A3LH 4B3RQ 4PZ6A 1A0IA 1JB7A 3CQZH 4BY1G 5FLXc 4DV0L 2UUBL 4DV2Q 1R9TH 1N33L 1N36Q 4JV5Q 1BBWA 1X6OA 3HOVG 4DAMA 3CMAA 2UXCL 4LFAQ 1QZGA 3KF8B 3OTOL 4DR2L 2AWOA 4J15A 5GROA 4HIMA 4BBRH 3GTKH 3CAMA 4R4QA 1VS0A 4HJ8A 1MJEA 3ULLA 5BR8L 3CC4A 3ICEA 5IYBG 4IFDJ 3M4OH 2PMZE 5GAEC 1NTGA 1IBMQ 4A93G 5JJLA 4YHHQ 2EQSA 2JEBI 3SGIA 4DR5Q 1PYSB 1HZCA 4DR6L 1VQGA 4DAYB 4A3KG 1N32L 1TXYA 2PI2E 3D31A 3KDFB 4C3HH 2IHFA 1OXUA 1UE7A 2CQOA 3KF6A 3UDXA 1VQMA 5JJIA 4YCVA 3J81j 1VQDA 2VQEQ 4GLXA 2CFMA 4LF6L 3UDGA 1C0AA 2WB1G 4ME3A 4LUVA 1YEZA 2UXCQ 4LFCL 5IWAL 4L5SA 1JJGA 4AYBE 3G48A 2KCMA 3L2PA 1BKBA 2FXQA 3TEHB 1YIJA 1J6QA 2JA9A 3VDYA 3A5ZB 4LNQA 3HKSA 3GO5A 3J81i 2D0OA 2E2JH 3HOUG 4JI6Q 1UE6A 4DK3C 2K75A 3HOXH 3HKZG 1MIUA 4PZ7A 4UP9A 5IP7G 1X65A 3KOJA 5JEAJ 4GKJQ 1FVIA 5C4XG 1N32Q 4JI7Q 4IO9A 3ER0A 3H15A 1OTCA 3S1NH 4IFDI 4B3MQ 1YHAA 2MFIA 2NZOA 4A3CH 4IJLA 4DV7L 3EBEA 4YCWA 3I2ZA 2MNAA 4R4OA 1VQCA 3G6EA 4GOPB 2BH8A 3BZCA 1SRUA 5IWAQ 3RZOH 4JBMA 3PIPA 1KAWA 4YCUA 1WCMG 1OXSC 4K0KL 2Z6KC 1SROA 3J80c 2VNUD 2WAQG 1YHQA 3F2CA 5EAYA 3A0JA 4YY3Q 4UP7A 2UXDL 4IPHA 1N34L 1Q8KA 1NBWA 3H0GH 4KHZA 1S40A 3RLFA 4A76A 2OTJA 1SR3A 4R1JA 4A3EG 1EQQA 4HIKA 1VQ6A 2B63G 4A3JH 3S1RH 2WB1E 2PNHA 3ZJYC 4LF7Q 2UUCL 4X6AH 3M85A 5M3FG 2YTVA 1XPOA 1I94Q 3S1MH 4MZ9A 3G71A 3RN2A 1HNXL 3HOYH 3F1ZA 4DV7Q 2JA8G 3Q8DA 5K36G 1PVOA 1YNXA 1K9MC 4HJ7A 1HNWL 3JC66 3NBHB 1GVPA 2ZTEA 4KI0A 2MQHA 3HOZG 1HH2P 3S24A 5M3MH 1FJGL 3HKZE 1CKNB 5FLMH 3S16H 1VQBA 1I3QH 1X56A 3CXCA 4IPCA 1FGUA 1VQJA 4C3JH 2R92G 2D62A 1N8RC 2UXDQ 4UP8A 2UUAQ 1N34Q 2IX0A 1KQSA 3PGZA 4BBSH 4DR7L 2EIFA 2R7ZH 4A3DG 1B8AA 1D8LA 1LM0A 2N49A 1E1OA 2B3GA 3L0OA 4P73A 1VQ9A 2EXDA 4LWCA 1YZ6A 3UDFA 4DV3Q 2K50A 4X64L 3PO3G 1NMGA 3CPWA 2R6GA 2UUCQ 1TWAH 1XNQL 2V1CC 3FP9A 3CCUA 3RLOA 2JE6I 4DK6C 4A3GH 2KHJA 1NJIC 4NXNL 3GTLH 1YJNA 2NZHA 1XMQL 1HNXQ 2LXJA 5C0XJ 2WAQE 1PH3A 1Y1VG 4OWXB 2DGYA 1HJPA 3KJOA 3M4QA 4OONA 4BBRG 1L1OC 4P72A 4LF9L 1B70B 1PH1A 2E8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI H;  2HHH L;  1L1O A;  3KF6 B;  4BA1 I;  1JJ2 A;  4GN4 B;  4A3B H;  4OO1 G;  3JAM c;  1U0L A;  1RL2 A;  2K4K A;  4A3M H;  1NY4 A;  1IYJ B;  2JJQ A;  4DR1 L;  5C4J H;  4OX9 L;  1VQE A;  4JI4 L;  4X64 Q;  1IBL L;  1E24 A;  1Y1W G;  3AFP A;  1XNQ Q;  5C44 H;  3CME A;  4GLA C;  5IYD H;  4IPD A;  3BU2 A;  2AWN A;  4JOI A;  5LMN L;  1JE5 A;  3U58 A;  2KHI A;  4NXN Q;  3ULJ A;  2UXB Q;  5M5W H;  3TRE A;  4A3I G;  5FJ8 H;  2KBN A;  4UY8 C;  4Y7N H;  3HOW G;  3E9H A;  1QVG A;  3GTG H;  3GTQ H;  2CWA A;  4DV6 Q;  3STB C;  2K5H A;  1VQ4 A;  2YU9 H;  1BBU A;  4JI0 L;  4MNO A;  1PH2 A;  1HR0 W;  1SN8 A;  2AHO B;  4OX9 Q;  4YWL A;  1XPR A;  1Z47 A;  2BA1 A;  3GDE A;  2YTX A;  4LF4 L;  5E7N A;  2A8V A;  3HOX G;  2RF4 A;  3I4M G;  1M90 C;  1J5E Q;  4JI3 L;  2AMC B;  3W1G A;  1ASY A;  2ZTD A;  1QVF A;  1E1T A;  4DR1 Q;  2UUB Q;  4DV0 Q;  5C0X I;  1N33 Q;  3PO2 H;  3GTM H;  2ID0 A;  1VCI A;  4XIG S;  3CCJ A;  1KIX A;  2QEX A;  3A74 A;  3K81 C;  3BJU A;  4GNX A;  1VQF A;  1GD7 A;  1CKM A;  3OTO Q;  5LMN Q;  4DR2 Q;  2OQK A;  2JA7 G;  2Q2H A;  2IT1 A;  4IFD G;  2GVB A;  1CSP A;  2L15 A;  1U5K A;  2JA5 G;  1SFO H;  5IYC H;  4X62 L;  5BR8 Q;  3CCM A;  4APV A;  1VQO A;  1YIT A;  3J81 c;  2JQO A;  3STB D;  3CC2 A;  3RN5 A;  1SMX A;  1TWC H;  1VQK A;  4BY1 H;  1PH8 A;  1MJC A;  2HIX A;  4JI5 L;  4LFB L;  1EOV A;  3HOV H;  3CW2 C;  4HJ5 A;  1XPU A;  3GTP H;  3AFQ A;  1KD1 C;  1WI5 A;  4NXM L;  5DLQ E;  4UPA A;  1WFQ A;  4DR6 Q;  4LF4 Q;  2VL6 A;  3CF5 A;  1VQ5 A;  3NEN A;  1OXX K;  4LF5 L;  1TWH H;  1P8L A;  5IYB H;  1EIF A;  5C3E G;  1ASZ A;  2F3I A;  4KHP L;  1HZ9 A;  3W1B A;  2VS1 A;  4JI8 L;  1JMC A;  4LF6 Q;  3T1Y L;  3CCR A;  1Q1E A;  3PCO B;  1QUQ B;  4NPS A;  4OWT B;  4C3I H;  2A19 A;  4LFC Q;  1GO3 E;  3TS2 A;  4GN3 B;  3F8T A;  3TQY A;  1PV4 A;  2VUM G;  4X65 L;  4A3K H;  4DV5 L;  1YJ9 A;  3OW2 A;  2MO0 A;  2VY3 A;  1XMO L;  3K7A H;  4X62 Q;  1VQN A;  4JCV E;  4JI1 L;  1I50 H;  4BXX H;  3I4N H;  1CKO A;  2YV5 A;  4DPG A;  5GAG C;  1V9P A;  1PA6 A;  3NEL A;  4JI5 Q;  1QVC A;  4LFB Q;  2RHS B;  3PUX A;  4JI2 L;  5JEA G;  1X3F A;  3S15 H;  4BA2 I;  3HFZ B;  4NXM Q;  2K14 A;  2Z0S A;  3PF4 A;  1YBY A;  2NVQ H;  4DV4 L;  1A8V A;  1E3P A;  3K0X A;  4B3T L;  1OXV A;  2ZM6 L;  1K83 H;  5ELO A;  2I0Q A;  3GTJ H;  2JA6 G;  4DR3 L;  1IBK L;  2R93 G;  3GD7 A;  3CC7 A;  4KHP Q;  1C7Y A;  2YYZ A;  2IHE A;  4JI8 Q;  3T1Y Q;  3HOU H;  1XJV A;  4O2D A;  1WJJ A;  2ZJR A;  4QY7 A;  4HJ9 A;  2WFW A;  4LF8 L;  4WJ4 A;  5IP7 H;  5GQO A;  1PYB A;  3EN2 A;  4JYA L;  2QGQ A;  4H02 A;  5C4X H;  4IOA A;  4K0K Q;  3F2B A;  1L1O B;  3D0F A;  5H1S E;  4R4I A;  1XMO Q;  1Q82 C;  4A75 A;  2E5L L;  2Q2U A;  1UE1 A;  2PQA B;  1NE3 A;  3M7N A;  1NMF A;  5IP9 H;  2MO1 A;  2A1A A;  3TS0 A;  1HNZ L;  1PH9 A;  1YVC A;  1EUJ A;  2Q2T A;  2K5N A;  2VQF L;  1S3O A;  4BY7 G;  1PH4 A;  2BA0 A;  3KLW A;  1C9O A;  3WWV A;  3I55 A;  4WJ3 M;  1WCM H;  1M1K C;  2ALY B;  5IY0 A;  2HT1 A;  2IY5 B;  3U4Z A;  1X9N A;  1OXT A;  4DR3 Q;  4A3L G;  4DV1 L;  4JBK A;  3J7A 5;  3KYH C;  1GM5 A;  1E7Z A;  3RR5 A;  3S2H H;  3CCV A;  1IXR A;  4MTN A;  3AYH B;  4AQY L;  5IE8 A;  1HNW Q;  4A3E H;  4AH6 A;  3CCS A;  1K3R A;  2B63 H;  4A4I A;  2I5L X;  5M5Y H;  1FJG Q;  4P74 A;  4JYA Q;  1VQA A;  4DUZ L;  4DNI A;  1HR0 L;  4B3S L;  5M3F H;  3S2D H;  2GVA A;  5AJ3 L;  2QA4 A;  1B7Y B;  4X66 L;  3KJP A;  1P16 A;  2F4V L;  4B3R L;  4R4T A;  1HNZ Q;  1LTL A;  2DUD A;  4DV2 L;  2RCN A;  4GN5 A;  4LW1 A;  3PF5 A;  1QZH A;  1N36 L;  2JA8 H;  4DR7 Q;  1LUZ A;  2PI2 A;  4DR4 L;  4LFA L;  2JEA I;  1KRS A;  4JBJ A;  4AIM A;  1SE8 A;  4EX5 A;  4JOI C;  1VQ7 A;  2JK8 A;  4LUZ A;  4DV1 Q;  2OCE A;  2R92 H;  1XMQ Q;  5C0X G;  1X3G A;  1KRT A;  1VQH A;  4AQY Q;  1IBM L;  4A3D H;  2KCT A;  4L5T A;  3E0E A;  2KEN A;  4YHH L;  3AQQ A;  3DLL A;  3K7U C;  3FHW A;  4POF A;  4DR5 L;  4QJF A;  3AEV A;  4DUZ Q;  4B3S Q;  3PO3 H;  3F2D A;  4LF9 Q;  2E2H H;  1N9W A;  1AE2 A;  4XTC S;  1G51 A;  1O7I A;  2HHH Q;  2ZJQ A;  2HQL A;  4QIW E;  2I5M X;  4X66 Q;  2F4V Q;  1HZA A;  1W3S A;  4P71 A;  2VQE L;  2ZJP A;  4IOC A;  2NN6 I;  1PH6 A;  1H95 A;  3PUY A;  2H5X A;  4RMF A;  3DM3 A;  4JBW A;  4YWK A;  3S17 H;  4DR4 Q;  3U50 C;  1Y1V H;  4IPG A;  1YHB A;  4GNX C;  1Q7Y C;  1PH5 A;  1KHI A;  1A63 A;  4JI4 Q;  1IBL Q;  1TWG H;  1Q46 A;  1VQ8 A;  4A3C G;  4OO1 I;  4C2M H;  4JI6 L;  1EQR A;  3M9B A;  4A3F H;  3CD6 A;  2BH2 A;  3GTO H;  2CCZ A;  4POG A;  4OWW B;  4HIO A;  5HY6 A;  1JT8 A;  2LSS A;  4GKJ L;  4JI0 Q;  1X54 A;  4JI7 L;  5IT9 c;  1Y1W H;  3MEF A;  1V1Q A;  2C35 B;  4HJA A;  4BXX G;  2OWO A;  3I4N G;  1UE5 A;  1Y14 B;  3IRB A;  5M5X H;  4EQ5 A;  5LMU L;  3TRZ A;  4B3M L;  3H0G G;  3UDI A;  1XTD A;  2XGT A;  3A5U A;  4A3I H;  2YTY A;  3PUV A;  3ULP A;  4JI3 Q;  3HOW H;  2Y0S G;  2E2I H;  1IL2 A;  1HZB A;  1Q12 A;  4A3J G;  5LMN W;  2N3S A;  1WOC A;  1JJC B;  4A93 H;  2ZTC A;  2B29 A;  2N78 A;  1GKH A;  1I5F A;  4R4C A;  3H3V I;  2RHQ B;  4YY3 L;  3H3V H;  3MXN B;  2VW9 A;  2IX1 A;  3HOY G;  4HID A;  3I4O A;  3I4M H;  1T9H A;  2R7D A;  1VQI A;  1G29 1;  3B6Y A;  3M4P A;  4O0A A;  5M3M G;  1EFW A;  4GKK L;  3UE1 A;  5FLM G;  3EIV A;  4LF7 L;  3PUW A;  2N8N A;  1I94 L;  3K80 C;  5LMU Q;  4JC0 A;  5IP9 G;  2JA7 H;  2Q2I A;  1UWV A;  3KDF A;  1AH9 A;  4BBS G;  4LF5 Q;  1Q1B A;  2JA5 H;  3PSI A;  4OXP A;  3PIO A;  3NEM A;  2R7Z G;  3KFU A;  1VQP A;  1X55 A;  4GLV B;  4IJH A;  4TVA B;  4YWM A;  2K5V A;  1MKH A;  1K73 C;  4QGU A;  4DUY L;  1EIY B;  3J80 i;  3PUZ A;  2LXK A;  4TQU S;  3LGJ A;  3OYY A;  4A3G G;  2NVX H;  2Z6K A;  2UUA L;  1E22 A;  4X65 Q;  5GAH C;  1XNR L;  4DV5 Q;  3CCL A;  4P75 A;  1SLJ A;  4JI1 Q;  2ES2 A;  4GS3 A;  4LUO A;  1WYD A;  1A62 A;  5C3E H;  1YI2 A;  4GKK Q;  1EWI A;  4DV3 L;  2ATW A;  2NVY H;  1FL0 A;  1Q86 C;  1W2B A;  4JI2 Q;  2Y0S E;  1RIP A;  3FKI G;  3BZK A;  1DGS A;  3S1Q H;  4DV4 Q;  2VUM H;  4FDB A;  4A3B G;  1AE3 A;  1L0W A;  4B3T Q;  2ZM6 Q;  1BVS A;  2XTI A;  2VZA A;  3CP0 A;  1PH7 A;  4A3M G;  5JJK A;  4GOP C;  1IBK Q;  2UU9 L;  1CUK A;  4PG3 A;  2R7F A;  2NVT H;  1QUQ A;  2CWP A;  1PFS A;  3UE0 A;  4GOP A;  4DUY Q;  5C44 G;  1VQL A;  2I5H A;  4LF8 Q;  5IYD G;  4KLK A;  4JG2 A;  3G4S A;  1XNR Q;  3RLN A;  5FJ8 G;  3T1H L;  3L7Z C;  1Q81 C;  1TWF H;  2E5L Q;  1G6P A;  3M3Y H;  1K8G A;  2K52 A;  2F52 A;  4QQB X;  2JA6 H;  2R93 H;  1LYL A;  3CCQ A;  1V43 A;  2HIV A;  2OQ0 A;  1CSQ A;  4JV5 L;  5GAD C;  3K8A A;  2GN5 A;  5J3B A;  3PV0 A;  1K8A C;  3CPF A;  4DKA C;  4ALP A;  4Y52 H;  4PZ8 A;  2VQF Q;  4GNX B;  1KL9 A;  3RNU A;  1KC8 C;  3HOZ H;  3ERS X;  3I7F A;  4NB3 A;  2UXB L;  1I6H H;  4L5Q A;  2NN6 G;  2OTL A;  2CKZ B;  3E9I A;  3J7Z C;  1KXL A;  3U4V A;  2UU9 Q;  4DV6 L;  5ELN A;  3PO2 G;  2AKW B;  2WP8 J;  4QL5 A;  3W5O A;  4AYB G;  1YJW A;  4L5R C;  2ASB A;  4PMW A;  1EYG A;  1PHJ A;  1X3E A;  4RG1 A;  1Z9F A;  1CKN A;  1IZ6 A;  3I56 A;  1L2F A;  1K0R A;  3CCE A;  2D0P A;  4BY7 H;  1S72 A;  1HR0 Q;  3T1H Q;  4A3F G;  3RZD H;  2PQA A;  3S14 H;  3JAM i;  5IYC G;  1J5E L;  1UEB A;  5AJ3 Q;  1D7Q A;  5HGQ A;  4A3L H;  4B3R Q;  4PZ6 A;  1A0I A;  1JB7 A;  3CQZ H;  4BY1 G;  5FLX c;  4DV0 L;  2UUB L;  4DV2 Q;  1R9T H;  1N33 L;  1N36 Q;  4JV5 Q;  1BBW A;  1X6O A;  3HOV G;  4DAM A;  3CMA A;  2UXC L;  4LFA Q;  1QZG A;  3KF8 B;  3OTO L;  4DR2 L;  2AWO A;  4J15 A;  5GRO A;  4HIM A;  4BBR H;  3GTK H;  3CAM A;  4R4Q A;  1VS0 A;  4HJ8 A;  1MJE A;  3ULL A;  5BR8 L;  3CC4 A;  3ICE A;  5IYB G;  4IFD J;  3M4O H;  2PMZ E;  5GAE C;  1NTG A;  1IBM Q;  4A93 G;  5JJL A;  4YHH Q;  2EQS A;  2JEB I;  3SGI A;  4DR5 Q;  1PYS B;  1HZC A;  4DR6 L;  1VQG A;  4DAY B;  4A3K G;  1N32 L;  1TXY A;  2PI2 E;  3D31 A;  3KDF B;  4C3H H;  2IHF A;  1OXU A;  1UE7 A;  2CQO A;  3KF6 A;  3UDX A;  1VQM A;  5JJI A;  4YCV A;  3J81 j;  1VQD A;  2VQE Q;  4GLX A;  2CFM A;  4LF6 L;  3UDG A;  1C0A A;  2WB1 G;  4ME3 A;  4LUV A;  1YEZ A;  2UXC Q;  4LFC L;  5IWA L;  4L5S A;  1JJG A;  4AYB E;  3G48 A;  2KCM A;  3L2P A;  1BKB A;  2FXQ A;  3TEH B;  1YIJ A;  1J6Q A;  2JA9 A;  3VDY A;  3A5Z B;  4LNQ A;  3HKS A;  3GO5 A;  3J81 i;  2D0O A;  2E2J H;  3HOU G;  4JI6 Q;  1UE6 A;  4DK3 C;  2K75 A;  3HOX H;  3HKZ G;  1MIU A;  4PZ7 A;  4UP9 A;  5IP7 G;  1X65 A;  3KOJ A;  5JEA J;  4GKJ Q;  1FVI A;  5C4X G;  1N32 Q;  4JI7 Q;  4IO9 A;  3ER0 A;  3H15 A;  1OTC A;  3S1N H;  4IFD I;  4B3M Q;  1YHA A;  2MFI A;  2NZO A;  4A3C H;  4IJL A;  4DV7 L;  3EBE A;  4YCW A;  3I2Z A;  2MNA A;  4R4O A;  1VQC A;  3G6E A;  4GOP B;  2BH8 A;  3BZC A;  1SRU A;  5IWA Q;  3RZO H;  4JBM A;  3PIP A;  1KAW A;  4YCU A;  1WCM G;  1OXS C;  4K0K L;  2Z6K C;  1SRO A;  3J80 c;  2VNU D;  2WAQ G;  1YHQ A;  3F2C A;  5EAY A;  3A0J A;  4YY3 Q;  4UP7 A;  2UXD L;  4IPH A;  1N34 L;  1Q8K A;  1NBW A;  3H0G H;  4KHZ A;  1S40 A;  3RLF A;  4A76 A;  2OTJ A;  1SR3 A;  4R1J A;  4A3E G;  1EQQ A;  4HIK A;  1VQ6 A;  2B63 G;  4A3J H;  3S1R H;  2WB1 E;  2PNH A;  3ZJY C;  4LF7 Q;  2UUC L;  4X6A H;  3M85 A;  5M3F G;  2YTV A;  1XPO A;  1I94 Q;  3S1M H;  4MZ9 A;  3G71 A;  3RN2 A;  1HNX L;  3HOY H;  3F1Z A;  4DV7 Q;  2JA8 G;  3Q8D A;  5K36 G;  1PVO A;  1YNX A;  1K9M C;  4HJ7 A;  1HNW L;  3JC6 6;  3NBH B;  1GVP A;  2ZTE A;  4KI0 A;  2MQH A;  3HOZ G;  1HH2 P;  3S24 A;  5M3M H;  1FJG L;  3HKZ E;  1CKN B;  5FLM H;  3S16 H;  1VQB A;  1I3Q H;  1X56 A;  3CXC A;  4IPC A;  1FGU A;  1VQJ A;  4C3J H;  2R92 G;  2D62 A;  1N8R C;  2UXD Q;  4UP8 A;  2UUA Q;  1N34 Q;  2IX0 A;  1KQS A;  3PGZ A;  4BBS H;  4DR7 L;  2EIF A;  2R7Z H;  4A3D G;  1B8A A;  1D8L A;  1LM0 A;  2N49 A;  1E1O A;  2B3G A;  3L0O A;  4P73 A;  1VQ9 A;  2EXD A;  4LWC A;  1YZ6 A;  3UDF A;  4DV3 Q;  2K50 A;  4X64 L;  3PO3 G;  1NMG A;  3CPW A;  2R6G A;  2UUC Q;  1TWA H;  1XNQ L;  2V1C C;  3FP9 A;  3CCU A;  3RLO A;  2JE6 I;  4DK6 C;  4A3G H;  2KHJ A;  1NJI C;  4NXN L;  3GTL H;  1YJN A;  2NZH A;  1XMQ L;  1HNX Q;  2LXJ A;  5C0X J;  2WAQ E;  1PH3 A;  1Y1V G;  4OWX B;  2DGY A;  1HJP A;  3KJO A;  3M4Q A;  4OON A;  4BBR G;  1L1O C;  4P72 A;  4LF9 L;  1B70 B;  1PH1 A;  2E8G A; 
#chains in the Genus database with same CATH topology
 3FKI H;  1L1O A;  3MVV A;  1DCZ A;  1U4R A;  2B2Y C;  4OO1 G;  2K4K A;  2CQA A;  2WB1 B;  5C4J H;  2WII B;  3CKI B;  3HP3 A;  3AFP A;  5C44 H;  4JOI A;  5LMN L;  4N9P A;  4NKL A;  2XWJ B;  2KBN A;  3HOW G;  1RD9 D;  4DV6 Q;  2QCP X;  1HR0 W;  1Z7T A;  1VDZ A;  2BA1 A;  1BNZ A;  5E7N A;  5IGG A;  1M90 C;  4JI3 L;  4EQN A;  2ZTD A;  4IUN A;  3GTM H;  3CCJ A;  4DAP A;  3OTO Q;  4DR2 Q;  1Y8N B;  2Q2H A;  2IT1 A;  2GVB A;  1U5K A;  3C1E A;  3KBG A;  5IYC H;  2NVT B;  4J8Q A;  5T1I A;  1GUS A;  2HIX A;  4G7O C;  2F0I A;  5LL6 X;  1X32 A;  1CTM A;  1STG A;  3CW2 C;  5M5Y B;  3AFQ A;  4NXM L;  1DM0 B;  4UPA A;  4DR6 Q;  3CF5 A;  3K57 A;  4OGQ C;  4E6I A;  1LV9 A;  2A6E D;  1SYB A;  2FIN B;  4TRD A;  3TDQ A;  1JMC A;  3T1Y L;  3CCR A;  3BDC A;  4OWT B;  2IJ0 A;  4LFC Q;  2A73 B;  3F8T A;  4DV5 L;  1YJ9 A;  3OW2 A;  1S5E D;  3K7A H;  1H9R A;  1PRT D;  5ELF A;  1I50 H;  4HSP A;  3I4N H;  1NCV A;  3HGB A;  4K8I A;  5ISR A;  4LFB Q;  4QIW B;  1X3F A;  4LAA A;  2K5Q A;  1YBY A;  2NVQ H;  1E3P A;  1SE2 A;  3K0X A;  4B3T L;  1X3Q A;  4ILW A;  3MAQ A;  4DR3 L;  2SOB A;  4IUQ A;  3HOU H;  1XJV A;  1WJJ A;  2RA4 A;  4BBR B;  4LF8 L;  5IP7 H;  1R4Q B;  1GUN A;  1PYB A;  2F0S A;  5A2Q L;  3BVG A;  5C4X H;  5EKI A;  5H1S E;  3QG1 A;  1Q82 C;  4R4I A;  2E5L L;  2Q2U A;  3MA2 B;  5IT9 L;  4WRD A;  3MXN A;  5IP9 H;  3KLS X;  3MXU A;  3TP6 A;  5D3I B;  3OHX C;  1EUJ A;  3KLW A;  4C3H B;  5E1F A;  3V05 A;  3WOF A;  1D5M C;  4HCE A;  4HCS A;  1BXT A;  2F0G A;  4JBK A;  1E7Z A;  4RFB A;  2E2I B;  1IXR A;  1RJT A;  4MTN A;  4RCN A;  3MEH A;  5IE8 A;  2SEB D;  1LO5 D;  4AH6 A;  2XN9 C;  1E0B A;  4A4I A;  1FJG Q;  4K6L A;  4DUZ L;  4B3S L;  1KNE A;  1HR0 L;  2P5Z X;  1EY8 A;  2X6L A;  5M3F H;  4B3R L;  1P16 A;  1HNZ Q;  1LTL A;  2RCN A;  4LW1 A;  3PF5 A;  1HCZ A;  2JA8 H;  4DR7 Q;  4DR4 L;  4CDC C;  1IHZ A;  2M2L A;  1ILP A;  2A74 C;  1VQ7 A;  4C3H G;  4R8N A;  1EOT A;  4LUZ A;  4KY5 A;  2R92 H;  2B2T A;  1KRT A;  4OEM B;  4A3D H;  1GUW A;  4U67 3;  4JK1 C;  1NSN S;  4QJF A;  3JAM E;  1W6K A;  3SHL A;  3F2D A;  2KHS A;  3FEW X;  3NQI A;  3H91 A;  2F4V Q;  2VQE L;  2NN6 I;  5JOB A;  3PUY A;  5C3E B;  3S17 H;  4GNX C;  1Q7Y C;  1A63 A;  5J1Z A;  1ENA A;  1EIG A;  3QIA A;  1IYU A;  3SEB A;  1O7L A;  4IUP A;  4C2M H;  2MUY A;  1NR2 A;  4RHS A;  4OO1 H;  1FNU A;  2MP1 A;  2JP1 A;  3HG9 A;  4RKB A;  2EYH A;  3P7J A;  4JI0 Q;  5CV8 A;  4BXX G;  2OWO A;  1Y14 B;  5M5X H;  4EQ5 A;  4B3M L;  2XGT A;  1B3A A;  3HOW H;  2HCI A;  1IL2 A;  1HZB A;  1FD7 D;  5KND A;  4U68 A;  3FMC A;  3FDT A;  1STN A;  3J81 E;  4QMG A;  3NXW A;  4R4C A;  3H3V I;  2RHQ B;  1KLU D;  2EDG A;  4MIU A;  3I4O A;  3PIO 3;  1AW7 A;  2F3V A;  1VQI A;  2DNE A;  1G29 1;  4O0A A;  1UEA B;  2KQ3 A;  1EFW A;  5FLX L;  2K1B A;  4BY7 B;  1TU2 B;  4DAY A;  4KN4 C;  2L9H A;  5J39 A;  1IYV A;  2B39 A;  4LF5 Q;  4IZ8 A;  3CQZ B;  2KUM A;  1Q3L A;  2RSN A;  1X55 A;  3R2I A;  4TVA B;  1GJX A;  4QGU A;  5EQ0 A;  3SDZ A;  2LXK A;  5M5W B;  3OYY A;  2QKI C;  3CCL A;  3RD4 A;  1S5B D;  3E0J A;  4GS3 A;  1WYD A;  1A62 A;  3G7L A;  1YI2 A;  4B9W A;  2ATW A;  5NUC A;  1STA A;  1RIP A;  1BUV T;  3FVQ A;  1DGS A;  3BZK A;  4X3S A;  2IPK D;  5FKA C;  2R61 A;  1QOH A;  4DV4 Q;  2LMC B;  1AEX A;  2ZM6 Q;  3P1H A;  1YNN C;  2AQ3 B;  2VZA A;  2XTI A;  3K5M A;  2UU9 L;  1CUK A;  2B2U A;  2NVT H;  3ERO A;  5I4D A;  2CWP A;  3UE0 A;  3HZX A;  1G8Z D;  2OXP A;  3OWE B;  4JG2 A;  4G7H C;  2MPM A;  3T1H L;  3L7Z C;  4JVZ A;  3BG3 A;  3J7A F;  3M3Y H;  4V19 0;  3UI2 A;  2PYK A;  2GN5 A;  4KV6 A;  3PV0 A;  4MTK A;  4DKA C;  4Y52 H;  4PZ8 A;  2A68 D;  3ND8 A;  2VQF Q;  2UXB L;  4L5Q A;  1I6V C;  3S1N B;  1EY9 A;  3E9I A;  2RBM A;  5G3L F;  5ELN A;  2L4N A;  2E75 C;  4Z9C B;  2AKW B;  1YJW A;  4AYB G;  5C5L A;  3NBH A;  4PMW A;  1WTP A;  1EYG A;  5EGT A;  1BBX C;  5FO7 B;  5CR3 A;  1IZ6 A;  1L2F A;  3IFD A;  4A3F G;  2PQA A;  3S14 H;  3JAM i;  1UEB A;  2F0F A;  1D7Q A;  2B2Y A;  4DN4 M;  4BY1 G;  2UUB L;  3K5L A;  1PXU A;  3KLR A;  4JV5 Q;  1X6O A;  3HOV G;  1QZG A;  2AWO A;  3MFG A;  4BBR H;  3GTK H;  1HQR D;  2ZXP A;  4HJ8 A;  1HXY D;  1HTP A;  1A3T A;  5TSS A;  1WTO A;  4C3I G;  4YHH Q;  2JEB I;  4QF4 A;  4CKC A;  2EZV A;  4A3K G;  1B44 D;  2PI2 E;  3D31 A;  3KDF B;  4C3H H;  4CJ1 B;  4CJ2 C;  4LMQ D;  1KDB A;  3UDG A;  1SXT A;  4LUV A;  4XYO A;  4L5S A;  2BOS A;  1JJG A;  1H9J A;  2QF7 A;  1BKB A;  2RKS A;  4K5W A;  5A2Q E;  1K0S A;  3HKS A;  3J81 i;  2KVM A;  4I65 A;  1TQO A;  5IT9 E;  4JI6 Q;  4DK3 C;  2K28 A;  4H0L C;  1ESF A;  1T5X D;  1BQQ T;  3I91 A;  3FKI B;  3NSW A;  4JI7 Q;  2CW0 D;  2NZO A;  1Q8I A;  1O78 A;  4IJL A;  1SYF A;  2MNA A;  1VQC A;  4GOP B;  1LTS D;  2AUK A;  1FGB D;  3PIP A;  3KUP A;  4K0K L;  2A5H A;  2KED A;  4WJW A;  3VYS A;  1BR9 A;  2PMZ B;  1YHQ A;  5EAY A;  2UXD L;  4IPH A;  5ELE A;  1D2B A;  2WV6 D;  4FVM A;  1S40 A;  3RLF A;  2RSO A;  1SNP A;  3I73 A;  4L8J A;  2E2H B;  2WB1 E;  2UUC L;  1B9M A;  1X3P A;  2YTV A;  3GV3 A;  3CRK C;  3OSO A;  3A8K E;  4MZ9 A;  1NUC A;  3RN2 A;  5K36 G;  3Q8D A;  4QUF A;  1DOK A;  1CA6 A;  3GTM B;  1EQV A;  3HOZ G;  1HH2 P;  1GUG A;  3S16 H;  5I9P A;  3VR3 A;  3CXC A;  3SE0 A;  1VQJ A;  1N8R C;  1KTK A;  1N34 Q;  1ENF A;  2IX0 A;  1KQS A;  2N49 A;  3L0O A;  2B3G A;  4K2K A;  2Z6B A;  4DF7 A;  4DV3 Q;  3PO3 G;  4X64 L;  2PQE A;  1SE4 A;  1XNQ L;  1HTL D;  3R2T A;  4XT3 B;  1NJI C;  2F0J A;  1HNX Q;  3VR4 A;  2DGY A;  4RWS C;  4KD3 A;  4P72 A;  4OX9 L;  2HHH L;  2ZT9 C;  3M4Y A;  3K7A B;  1JJ2 A;  2Q8R E;  1I50 B;  3JAM c;  1SDF A;  2DN8 A;  1NY4 A;  4DR1 L;  3QB3 A;  1VQE A;  4JI4 L;  1IBL L;  1E24 A;  1Y1W G;  2NVQ B;  4GLA C;  2EYF A;  2AWN A;  3ULJ A;  5M5W H;  3TRE A;  1XTC D;  3VA5 A;  3P75 A;  1AZQ A;  3E9H A;  1QVG A;  4ZRZ A;  1EZ6 A;  3HOU B;  2CWA A;  3T13 A;  1A3U A;  2AHO B;  5FLX E;  5C4X B;  4YWL A;  1XPR A;  1RDP D;  4LF4 L;  3O13 A;  2HDL A;  2FFK B;  4X3K A;  3I4M G;  2F0U A;  5C3W A;  2A6E C;  3Q23 A;  1J5E Q;  2K04 A;  3URY A;  2AMC B;  4DGZ A;  4B08 A;  1N33 Q;  2ID0 A;  1VCI A;  3DEO A;  4XIG S;  5C0X H;  1KIX A;  1FNV A;  3K81 C;  3NUC A;  1PYW D;  4GNX A;  2C9O A;  1LT3 D;  1CKM A;  5LMN Q;  2OQK A;  4IFD G;  2JA5 G;  3CCM A;  5BR8 Q;  1PRT C;  1YIT A;  2CHB D;  3J81 c;  3STB D;  3EJI A;  3RN5 A;  2D2C C;  1TWC H;  4BY1 H;  1PH8 A;  3HOV H;  1XPU A;  3GTP H;  1CQV A;  1KD1 C;  2AQ2 B;  5M3F B;  1AN8 A;  3MHB A;  4ZK9 B;  2B8G A;  1EQT A;  3EA6 A;  3VYT A;  2EYP A;  1I4X A;  1P8L A;  4FXG C;  2JA8 B;  1EIF A;  1ASZ A;  4KHP L;  2L55 A;  4JI8 L;  1A6X A;  1Q1E A;  1VMC A;  4C3I H;  1I6H B;  1A3V A;  4GN3 B;  3TQY A;  1VMP A;  2VUM G;  4X65 L;  4A3K H;  1F2M A;  2R92 B;  2MO0 A;  1VQN A;  1V1P B;  4JCV E;  4JI1 L;  4DPG A;  2HDM A;  4KJN A;  1QVC A;  1TS5 A;  3MC0 B;  4JI2 L;  5JEA G;  5M9O A;  3HFZ B;  4NXM Q;  2K14 A;  2LS0 1;  1A8V A;  3ND9 A;  3T51 B;  1OXV A;  2PZW A;  4PQX A;  2KJX A;  3I90 A;  2I0Q A;  2EVB A;  2R93 G;  3GD7 A;  1C7Y A;  2IHE A;  3T1Y Q;  2L12 A;  2ZJR A;  3SXH A;  1MGS A;  2RDG A;  2WFW A;  5CV5 A;  3NPP A;  2F0L A;  1W6J A;  4F7X A;  4OL7 A;  5JPM C;  2D9U A;  1B4O A;  2PQA B;  1EY4 A;  1NE3 A;  3U9S A;  3AU7 A;  2A1A A;  1ONL A;  1EFI D;  5BN3 A;  3D3R A;  4HR7 B;  1PH4 A;  2B2V C;  3IFT A;  4K5V A;  5M5X B;  2IY5 B;  4JW0 A;  1OXT A;  4DR3 Q;  4CDE C;  5BN4 A;  2IX3 A;  1QIL A;  5EBC A;  5ELC A;  1SMY D;  4AQY L;  2XWB B;  1K3B C;  4I7Z C;  3S2D H;  1WTR A;  1S4Z A;  1QE6 A;  1B7Y B;  4X66 L;  1DZ1 A;  1QZH A;  4GN5 A;  1N36 L;  5K36 H;  3PMF A;  4LFA L;  1M4V A;  1KRS A;  2NWG A;  1SE8 A;  4EX5 A;  2M9V A;  3FPU B;  1SAP A;  1XMQ Q;  1CQF A;  2NBF A;  1IBM L;  3E0E A;  1ZYR D;  1TVX A;  5L37 A;  2BDO A;  3A56 A;  4DUZ Q;  4B3S Q;  3PO3 H;  4LF9 Q;  5LHY 1;  1N9W A;  1AE2 A;  2EE1 A;  2E2H H;  2K32 A;  4Q5V A;  4OHJ A;  1HZA A;  3K0Y A;  4IUT A;  5EPK A;  2ZJP A;  5ELD A;  1PH6 A;  2K5D A;  2Y0S B;  3G6J B;  2H5X A;  4RMF A;  3V96 A;  4DR4 Q;  4IPG A;  1KHI A;  4M1U B;  1CHP D;  3H09 A;  1QWY A;  2EXZ A;  1Q46 A;  4XQJ A;  5JAV A;  3CRL C;  3VR5 A;  4IUR A;  4A3C G;  4OO1 I;  1ICW A;  2JSO A;  2BH2 A;  4UDU C;  3NBI A;  3GTO H;  1SND A;  4POG A;  4HIO A;  3NTK A;  3I3C A;  5HY6 A;  1F2Z A;  2LSS A;  3KBX A;  4GKJ L;  1ILQ A;  1JE4 A;  1X54 A;  2WIN B;  5IT9 c;  1Y1W H;  3MEF A;  4HJA A;  2C35 B;  5LMU L;  1EY6 A;  3IRB A;  3TRZ A;  3M3Y B;  3R8B A;  3H0G G;  1HRJ A;  1XTD A;  2CVR A;  3DWQ A;  2Y0S G;  1CI3 M;  3C1F A;  1TWA B;  4A3J G;  1SYD A;  2N78 A;  3H94 A;  1HUN A;  5KYI A;  2DNC A;  2HD3 A;  2VW9 A;  2KEE A;  2IX1 A;  3HOY G;  3I4M H;  2R7D A;  4L63 B;  1F2L A;  3B6Y A;  2FHT A;  1NAP A;  4GKK L;  1EU4 A;  1PLF A;  3X3M A;  1EZ8 A;  1I94 L;  3S14 B;  4N9T A;  4PV1 C;  3KDF A;  1AH9 A;  3LWU A;  4BBS G;  4IFD H;  2JA5 H;  3PSI A;  4XXE A;  3WOE A;  3PIO A;  1VQP A;  1JC7 A;  1QNU A;  2EY6 A;  4YWM A;  1WTX A;  4HSV A;  4DUY L;  1EIY B;  3PUZ A;  5DM6 3;  3GTK B;  2SNM A;  2NVX H;  2ZXR A;  1XNR L;  1SLJ A;  4LUO A;  4C56 C;  2B8F A;  1Q86 C;  2MHV A;  2XSC A;  2A68 C;  1SJE D;  3S1Q H;  2VUM H;  1RKN A;  4FDB A;  4DXG A;  4XDX A;  1IBK Q;  3QR8 A;  4PG3 A;  2R7F A;  3I4L A;  1QUQ A;  3Q22 A;  5FK9 C;  4GOP A;  1JWM D;  2I5H A;  2NTS A;  5JEA H;  5IYD G;  4KLK A;  3G4S A;  3RLN A;  5FJ8 G;  1Q81 C;  1TWF H;  2F52 A;  3F2U A;  3SK8 A;  2R93 H;  5CV4 A;  3CCQ A;  2HIV A;  1GHJ A;  1K8A C;  2Z8L A;  4ALP A;  4GNX B;  3KLS A;  3I7F A;  2XRQ D;  1I6H H;  2NN6 G;  4DXF A;  3J80 L;  3DWP A;  4FF3 A;  2UU9 Q;  4DV6 L;  3PO2 G;  1OO9 B;  1CFM A;  2G9D A;  3X3N A;  1X3E A;  4DAV A;  5EKL A;  3CCE A;  3I56 A;  4ZKB B;  1QJO A;  1LAC A;  1S72 A;  3T1H Q;  4O42 A;  2QEJ C;  5AJ3 Q;  1JR0 D;  2Q8I B;  3FRP B;  1JB7 A;  5FLX c;  4DV2 Q;  5D65 A;  2UXC L;  3L9A X;  1H9K A;  2ZXO A;  3OTO L;  4DR2 L;  5GRO A;  3DWA A;  4HIM A;  3TP7 A;  2I46 A;  3CAM A;  4R4Q A;  3S9W A;  4IFD J;  1HHV A;  3CC4 A;  5IYB G;  2XNA C;  3HKZ B;  4J1M A;  4ODG A;  2PMZ E;  4A93 G;  5JJL A;  3S16 B;  1DXM A;  2LFN A;  3SGI A;  4DR5 Q;  1PYS B;  4DR6 L;  1N32 L;  1TXY A;  2L5T A;  3N52 A;  2IHF A;  2CW0 C;  4YCV A;  1VQD A;  4GLX A;  4ME3 A;  2K05 A;  4FXK C;  1WCM B;  4LFC L;  5IWA L;  2G5D A;  3G48 A;  4KHV A;  2FXQ A;  2Z4H A;  1J6Q A;  2JA9 A;  3VDY A;  5FO8 B;  2V4D A;  5E4W C;  2D0O A;  2F0M A;  2K75 A;  4XT1 B;  3HKZ G;  4QUC A;  1KDC A;  2KEC A;  3GP7 A;  3KOJ A;  3TZD A;  5JEA J;  1LTI D;  4IO9 A;  4ULL A;  2PZU A;  2N55 A;  5C6A A;  1YHA A;  4A3C H;  4DV7 L;  1Y8O B;  3DMU A;  4R4O A;  2NZ1 D;  1SRU A;  5HUR A;  4JBM A;  1KAW A;  4YCU A;  1WCM G;  1OXS C;  1FR3 A;  4ID6 A;  4OEL B;  5EPJ A;  2WAQ G;  3F2C A;  3R93 A;  4YY3 Q;  4UP7 A;  3K5O A;  4KHZ A;  3H0G H;  4HAE A;  4A3E G;  4R1J A;  1EQQ A;  4HIK A;  1B53 A;  1G2S A;  4A3J H;  4LF7 Q;  3M85 A;  1XPO A;  4DA2 A;  3NQT A;  2FMM A;  2QDL A;  3HOY H;  1QNK A;  2BCO A;  4RH6 A;  4AYB B;  2MQH A;  3OMC A;  3SVM A;  1FJG L;  2KOL A;  2EOT A;  2F0K A;  4L6T B;  4A3F B;  2D62 A;  2UXD Q;  2UUA Q;  1JOR A;  2QW7 A;  5D14 A;  1V1P A;  4BBS H;  3PGZ A;  1BOS A;  1MI2 A;  2EIF A;  4DR7 L;  4BY1 B;  1B8A A;  1TWC B;  1D8L A;  2F0N A;  1VQ9 A;  3K5N A;  3HOV B;  2HQE A;  1YZ6 A;  4LWC A;  3UDF A;  4CDF C;  5C4Z A;  5I6W A;  3GTP B;  2UUC Q;  1LLR D;  1TWA H;  2V1C C;  2B2V A;  4RCO A;  2JE6 I;  2KHJ A;  4NXN L;  2MJ8 A;  2JYO A;  2NZH A;  2RDH A;  2LXJ A;  3P20 A;  1Y1V G;  1HJP A;  1D1K A;  1E2V A;  3KJO A;  4C3I B;  4NW2 A;  2WAC A;  1L1O C;  4A3K B;  2D5D A;  1HFG A;  2BE5 D;  4BA1 I;  4GN4 B;  1GUO A;  1QB5 D;  2PNR C;  1WTV A;  2PW7 A;  5I2X A;  1RL2 A;  1YNJ D;  1TY2 A;  1C8C A;  4X64 Q;  2IL8 A;  4BS9 A;  1XNQ Q;  1TS3 A;  3CME A;  5IYD H;  3BU2 A;  1PZJ D;  3U58 A;  3OIP A;  2KHI A;  1IW7 D;  1CZG A;  4A3I G;  5FJ8 H;  1ET9 A;  3GTQ H;  1DJR D;  1LTR D;  2K5H A;  3STB C;  4DU9 A;  4JI0 L;  3DHQ A;  2J7Z A;  4MNO A;  3VYU A;  4OX9 Q;  3Q0A A;  3GDE A;  4FP5 D;  3HOX G;  1J9O A;  4N8X 1;  3SK6 A;  1XWE A;  2NVY B;  4DR1 Q;  4DV0 Q;  5C0X I;  1ML0 D;  3PO2 H;  2GA4 B;  2QEX A;  1DOL A;  5G3L D;  3ITP A;  2JA7 G;  4HTH A;  1K28 A;  1Q90 A;  2F0E A;  5IGF A;  3T56 B;  4JPB W;  1SFO H;  4X62 L;  4APV A;  1VQO A;  4TSS A;  3CC2 A;  2JQO A;  1VQK A;  4JI5 L;  1PFB A;  3Q6S A;  2QDB A;  2OT2 A;  1WI5 A;  5DLQ E;  1WFQ A;  3S2D B;  1U9R A;  4PNY A;  4LF4 Q;  1OXX K;  4LF5 L;  1TWH H;  5IIF A;  5IYB H;  3BZD B;  1HZ9 A;  1ZXT A;  2VS1 A;  4LF6 Q;  5DM7 3;  3PCO B;  4ZAI A;  1QUQ B;  2F0O A;  3HOZ B;  2X6G A;  2A19 A;  1GO3 E;  1ZKO A;  4J6H A;  2CH4 W;  1XMO L;  2TMP A;  4BXX H;  1BCP D;  5CMD A;  2YV5 A;  5GAG C;  3D4W A;  3Q24 A;  3S15 H;  4BA2 I;  3PO3 B;  1HA6 A;  4KD4 A;  4C3J G;  2Z0S A;  1LT5 D;  4DV4 L;  2EYM A;  4GZY C;  1UAP A;  2ZM6 L;  3E6Z X;  4EQO A;  3VYR A;  5I9O A;  1K83 H;  5ELO A;  3GTJ H;  2JA6 G;  4KHP Q;  4JI8 Q;  3J80 E;  1BO0 A;  2B2W C;  2X69 A;  4O2D A;  3I8Z A;  1SMY C;  4HJ9 A;  4WJ4 A;  1B2T A;  4ZKC B;  4JYA L;  2QGQ A;  3FPP A;  4ZQ3 A;  4IOA A;  3M4O B;  3A7L A;  4CDD C;  1UE1 A;  2O4X A;  3M7N A;  1WVL A;  3GTO B;  2MO1 A;  3TS0 A;  2Z9H A;  3GV6 A;  5KIX A;  3J7Y W;  1CA5 A;  2VXW A;  1VF5 C;  5JJZ A;  3TN2 A;  1YVC A;  4FXD A;  2VQF L;  1S3O A;  1Y1W B;  2BA0 A;  3WWV A;  2QIL A;  1WCM H;  1M1K C;  2DY8 A;  4CJ0 B;  3U4Z A;  1X9N A;  4A3L G;  3CU7 A;  4DV1 L;  3KYH C;  3RR5 A;  4YIJ A;  3S2H H;  1HNW Q;  4A3E H;  5KEE A;  1ZYR C;  5DEH A;  2I5L X;  4P74 A;  4DNI A;  1TS2 A;  1PTO D;  4F88 A;  3OOC A;  3I4M B;  3KJP A;  4R4T A;  2DUD A;  1LUZ A;  2JEA I;  1CK1 A;  1LT4 D;  2MGS A;  2Z4I A;  4H13 C;  2PO4 A;  3A7A B;  2JA5 B;  2OCE A;  1WD1 A;  1EEF D;  4AQY Q;  4L5T A;  1PRT B;  4YHH L;  3AQQ A;  3K7U C;  3FHW A;  1G6Z A;  1U4L A;  1GUT A;  3T4A C;  3SR1 A;  2NVX B;  4XTC S;  2EY2 A;  2G9H D;  2ZJQ A;  3L3O C;  2HQL A;  4QIW E;  1Y8P B;  2I5M X;  5A35 A;  4X66 Q;  1W3S A;  4IOC A;  1H95 A;  3DM3 A;  1CM9 A;  1B9N A;  1EYD A;  1TKW B;  3U50 C;  1Y1V H;  4KKT A;  5DAU A;  1JWU D;  1MBY A;  3OW7 A;  3S1Q B;  2VUM B;  4CHT B;  2FJ2 A;  3NE5 B;  1LTG D;  2ICI A;  1VQ8 A;  3W2D A;  1EEI D;  4JI6 L;  1EQR A;  4A3F H;  1DOM A;  5M3M B;  2CCZ A;  5ELB A;  1JT8 A;  1ET6 A;  2F0W A;  4JI7 L;  2K6A A;  5E4X A;  1SEB D;  1V1Q A;  4N8F A;  2EY5 A;  1F9S A;  3I4N G;  1UE5 A;  1TWF B;  2R7Z B;  1MSG A;  3UDI A;  3A8J E;  4A3I H;  2KCC A;  2R93 B;  2YTY A;  3PUV A;  3ULP A;  4JI3 Q;  1Q12 A;  5F2D A;  5LL6 S;  5LMN W;  2DJG C;  2N3S A;  2K33 A;  1JJC B;  3GTL B;  2ZTC A;  1DYQ A;  4FO2 A;  3R3O A;  3NWS A;  4HID A;  1TII D;  3D8G A;  3M4P A;  4FF1 A;  4G7Z C;  5M3M G;  3UE1 A;  3EIV A;  2E76 C;  4WFN 3;  4A3B B;  1TY0 A;  5LMU Q;  4JC0 A;  5IP9 G;  2JA7 H;  3T53 B;  4A3M B;  1M8A A;  2EJF C;  2L0C A;  2R7Z G;  2F4I A;  4OXP A;  1IKL A;  1XX8 A;  4IAL A;  5AFW A;  1K73 C;  3J80 i;  5EBD A;  3LGJ A;  4A3G G;  1E22 A;  5GAH C;  4DV5 Q;  1LTA D;  4P75 A;  4G57 A;  1GHK A;  2ES2 A;  2YU9 B;  4GKK Q;  1EY7 A;  4MN3 A;  4MHE A;  1ICF B;  1STB A;  5JVH 3;  4DV3 L;  2NVY H;  2SNS A;  1W2B A;  2K01 A;  1I4Q A;  3D6C A;  4OIK A;  1DD2 A;  4A3B G;  2NB0 A;  1AE3 A;  1EY0 A;  1L0W A;  4B3T Q;  3BDO A;  2A69 D;  1BVS A;  1AP0 A;  3CP0 A;  4A3M G;  5JJK A;  4PMC A;  4EGV A;  3HRZ C;  1S5C D;  4DUY Q;  1EL0 A;  4DFA A;  1E2W A;  4LF8 Q;  4WOR A;  2O5J C;  4KK7 A;  3VA7 A;  1K8O A;  1XNR Q;  2E5L Q;  1G6P A;  1K8G A;  2K52 A;  4QQB X;  2JA6 H;  4FF4 A;  1LYL A;  1IKM A;  2H1E A;  1V43 A;  2OQ0 A;  1CSQ A;  4HN7 A;  3CPF A;  1O7Z A;  3MXG A;  3RNU A;  5IGE A;  3HOZ H;  4NB3 A;  1T5E A;  2ICE C;  2XRS D;  1MSH A;  1LTB D;  5BN5 A;  2CKZ B;  3J7Z C;  1KXL A;  1GOZ A;  1C48 A;  3V2T A;  4QL5 A;  2WP8 J;  3W5O A;  2ASB A;  4L5R C;  3ERQ A;  2N88 A;  1A2T A;  2J4X A;  1HR0 Q;  3RZD H;  3H6M A;  1J5E L;  1V8Q A;  1O7Y A;  3H0G B;  5D3D A;  4DNR B;  5HGQ A;  4PZ6 A;  4B3R Q;  3NTH A;  4A3L H;  2FMC A;  4RGN A;  1N33 L;  1R9T H;  1BBW A;  2A6H D;  1O80 A;  2F1M A;  4A3J B;  1XYI A;  4DAM A;  3CMA A;  3KF8 B;  4J15 A;  1B3Q A;  1MJE A;  5BR8 L;  3HOY B;  1Z6H A;  3M4O H;  2F0T A;  1GXD C;  1PRT F;  1TT2 A;  1HZC A;  3OMG A;  1VQM A;  1OXU A;  1UE7 A;  5IGC A;  3UDX A;  4BBS B;  1SNO A;  1EYA A;  4ZCK A;  2VQE Q;  4QB4 A;  2PW5 A;  4HMJ A;  1C0A A;  2F0P A;  5EKK A;  2WB1 G;  5JVG 3;  1JOK A;  2UXC Q;  4AYB E;  3L2P A;  3BVM A;  3D6W A;  3TEH B;  4ABN A;  1YIJ A;  1WD0 A;  3GO5 A;  1I4R A;  5CV7 A;  4HMI A;  4EQP A;  2E2J H;  1B1Z A;  3DM1 A;  3E3X A;  1UE6 A;  4XYQ A;  3MZ5 A;  2B63 B;  4UP9 A;  3BYT B;  1H9S A;  1X65 A;  2AQ1 B;  1FVI A;  1N32 Q;  3D4R A;  4XQN A;  1WTH A;  5EJW A;  3H15 A;  1KAB A;  5C3X A;  1RTN A;  4B3M Q;  2MFI A;  3EBE A;  3K59 A;  3I2Z A;  1FNW A;  4FYD A;  3G6E A;  2BH8 A;  5IWA Q;  3RZO H;  2Z6K C;  1SRO A;  3J80 c;  2LY7 A;  2CH4 A;  4TKO B;  3GTQ B;  4V0B A;  1NBW A;  3CHB D;  2OTJ A;  2L11 A;  3LNN A;  2B63 G;  4IUU A;  1S5D D;  4K6D A;  3ZJY C;  3S1M H;  3EQL C;  3G71 A;  4DV7 Q;  4X3U A;  2O5I C;  1U4P A;  1YNX A;  3PO2 B;  1PVO A;  4H44 C;  4KKS A;  4HJ7 A;  3JC6 6;  1GVP A;  2ZTE A;  1TWG B;  2KCN A;  2B2W A;  5M3M H;  1CKN B;  4KMU C;  2WKD A;  1VQB A;  1I3Q H;  1X56 A;  1FGU A;  1SFO B;  2BE5 C;  2R7Z H;  1E1O A;  1YNJ C;  4P73 A;  3C2P A;  1D5X C;  1NMG A;  1I4H A;  1JOQ A;  1KDA A;  5CV9 A;  3FP9 A;  4A3G H;  1TWH B;  3GTL H;  1LAB A;  1XMQ L;  1EIH A;  1IW7 C;  4PMB A;  1PH3 A;  1J8I A;  1D6E C;  2HUG A;  2K7V A;  4A93 B;  3M4Q A;  4OON A;  1RCV D;  4BBR G;  2F0H A;  4RHR A;  1SYG A;  4LF9 L;  1PH1 A;  2HCC A;  2E8G A;  3BVZ A;  3KF6 B;  3QOL A;  4A3B H;  1U0L A;  1A2U A;  2J0T D;  4A3M H;  4Q0F A;  1IYJ B;  2JJQ A;  3NK9 A;  3S15 B;  4IPD A;  4NXN Q;  1JE5 A;  1K83 B;  3GTJ B;  2UXB Q;  1UNS A;  4UY8 C;  1RHP A;  1ZEQ X;  2PZT A;  4Y7N H;  3GTG H;  3QJY A;  1BCP B;  4RGM A;  2LKV A;  4NDX A;  5JPN C;  1VQ4 A;  4F87 A;  1BBU A;  2YU9 H;  3H3V C;  1PH2 A;  3M7G A;  1SN8 A;  4DK1 A;  2H4O A;  3OPO A;  1Z47 A;  2YTX A;  2A8V A;  3TME A;  4S3S A;  2RF4 A;  2RCF A;  3W1G A;  1ASY A;  1DON A;  1QVF A;  1WTW A;  1E1T A;  1UUP A;  2UUB Q;  1EYC A;  3BS1 A;  4FNF A;  3A74 A;  3BJU A;  1VQF A;  1GD7 A;  1RF2 D;  3MXP A;  4R8I A;  1L0X B;  4FF2 A;  5IGB A;  1CSP A;  2L15 A;  2WAQ B;  1HUM A;  3S2H B;  1BF4 A;  1BCP C;  5T1G A;  1SMX A;  4F8M A;  4A3E B;  3IAY A;  1MJC A;  1SNM A;  4LFB L;  1EOV A;  4HJ5 A;  1HQM C;  1SSO A;  2JXM B;  2VL6 A;  3QOJ A;  3NEN A;  1VQ5 A;  1QG7 A;  2K03 A;  1G2T A;  3C46 A;  5C3E G;  1SNQ A;  2F3I A;  3W1B A;  2L1B A;  4NPS A;  5IOD A;  1WTQ A;  3TS2 A;  1SE3 A;  1PV4 A;  1C4Q A;  2EYO A;  2VB3 X;  5COY A;  2VY3 A;  4X62 Q;  1PTO B;  4NMZ A;  1CKO A;  1PA6 A;  1V9P A;  3WDN A;  3VR2 A;  1NR4 A;  3NEL A;  4JI5 Q;  4RGT A;  2RHS B;  3PUX A;  5KNC A;  3PF4 A;  5KYL A;  1EU3 A;  1IBK L;  1A15 A;  3CC7 A;  4K8J A;  2YYZ A;  1Y1V B;  1ENC A;  4KN7 C;  4QY7 A;  2Q8T A;  1JB3 A;  3RUZ A;  5GQO A;  3EN2 A;  4H02 A;  1CZW A;  4K0K Q;  3F2B A;  1L1O B;  3D0F A;  1XMO Q;  4A75 A;  1PTO C;  4M8A A;  1JOO A;  3PQI A;  1NMF A;  1XXG A;  1HNZ L;  1PH9 A;  3I70 A;  2Q2T A;  2K5N A;  2TSS A;  5IOC A;  4KY7 A;  4BY7 G;  1C9O A;  1I4G A;  2EJG C;  3I55 A;  3HS0 C;  4WJ3 M;  2ALY B;  5IY0 A;  2HT1 A;  4RKL A;  4A3I B;  2F3W A;  3J7A 5;  5CYU A;  2AUJ D;  1GM5 A;  3CCV A;  3AYH B;  1NNX A;  1SYC A;  3CCS A;  5KNB A;  1K3R A;  2B63 H;  4JYA Q;  4XQQ A;  5M5Y H;  1VQA A;  1K8M A;  2GVA A;  1MHW C;  4KY6 A;  5AJ3 L;  2QA4 A;  3HOX B;  2NTT A;  5HGT A;  2F4V L;  1CHQ D;  2F0Q A;  4DV2 L;  5IGD A;  2PI2 A;  2F0V A;  1AFP A;  1II3 A;  4AIM A;  4JBJ A;  5DNF A;  1KNA A;  4JOI C;  2JK8 A;  4OIJ A;  2JA7 B;  2VB2 X;  1AZP A;  4DV1 Q;  5C0X G;  1X3G A;  3SK4 A;  4EVO A;  1VQH A;  4O1N A;  1V1O A;  4RAU C;  2BDN A;  2KCT A;  2KEN A;  3DLL A;  4POF A;  4DR5 L;  3AEV A;  5COR A;  1H9S B;  2RDF A;  1JWS D;  1G51 A;  1O7I A;  2HHH Q;  1EY5 A;  4P71 A;  4ME5 A;  2R3Z A;  2NN6 H;  1PZI D;  4JBW A;  4YWK A;  1STE A;  1SYE A;  3S1R B;  1YHB A;  1PH5 A;  4JI4 Q;  1IBL Q;  3DUZ A;  1JCK B;  1TWG H;  1QCB D;  2EPB A;  1B50 A;  1D5Z C;  1KAA A;  1E2Z A;  1TR5 A;  1FYC A;  1HFN A;  3M9B A;  4HED A;  3CD6 A;  1VF7 A;  3NP8 A;  4OWW B;  1BCP F;  4C3J B;  1F2Y A;  2RVL A;  2JA6 B;  3A5U A;  2ENB A;  2EJM A;  2E2I H;  1PZK D;  4X3T A;  1PFN A;  1WOC A;  1EWC A;  4A93 H;  3KF8 A;  2B29 A;  1G91 A;  4R9W A;  1GKH A;  1I5F A;  3EFX D;  2WKC A;  4YY3 L;  3H3V H;  3MXN B;  2RQX A;  3AMU A;  1IL8 A;  5FO9 B;  1T9H A;  3QWN A;  3T16 A;  5I2Y A;  5FLM G;  2EYJ A;  4B9X A;  4LF7 L;  3PUW A;  2N8N A;  3RZD B;  3K80 C;  5FOB B;  2Q2I A;  1UWV A;  1Q1B A;  2A69 C;  5C4J B;  3NEM A;  1R9T B;  3KFU A;  4GLV B;  4IJH A;  2K5V A;  1MKH A;  5C44 B;  5J22 A;  4IUV A;  4TQU S;  3E5S A;  2EY1 A;  2Z6K A;  1SNC A;  2UUA L;  4X65 Q;  4UHV A;  3GQB A;  1PTO F;  4JI1 Q;  4CKE A;  5C3E H;  1EWI A;  1FL0 A;  4JI2 Q;  2Y0S E;  4I7A A;  3FKI G;  4KKU A;  3D4D A;  3NTI A;  3K6O A;  3A55 A;  5CBE E;  1LT6 D;  1PH7 A;  4GOP C;  1KLG D;  1PFS A;  1ESR A;  5C44 G;  1VQL A;  3VR6 A;  1LTT D;  3TSS A;  4CGY B;  3A54 A;  3MFY A;  2E2J B;  5CV6 A;  1I4P A;  4C1N K;  2XVS A;  3W3A A;  4JV5 L;  4BWG B;  3K8A A;  5GAD C;  5J3B A;  2A6H C;  5K5P A;  1KL9 A;  1KC8 C;  3ERS X;  1YNN D;  2OTL A;  1PMR A;  2SDF A;  5EPL A;  2B2T C;  4RA8 A;  3U4V A;  1SBB B;  2E74 C;  3NHH A;  3EVQ A;  1PTO H;  5CBA E;  4DK0 A;  3RZO B;  1F9Q A;  1F77 A;  4KJO A;  4H7B A;  2IWH A;  4RG1 A;  4CKB A;  1PHJ A;  1BDO A;  2Z1C A;  1Z9F A;  1CKN A;  4P2C B;  1K0R A;  1PFM A;  3LX0 A;  2D0P A;  4BY7 H;  3TZU A;  1MD2 D;  3I4N B;  5IYC G;  1JQY D;  1HA5 A;  3IKJ A;  1A0I A;  3CQZ H;  4DV0 L;  4CBV A;  1N36 Q;  3AB9 A;  4LFA Q;  3BYY B;  2EYL A;  1JIC A;  3S1M B;  3A8I E;  1U4M A;  3QO2 A;  4K5X A;  1VS0 A;  3ULL A;  3ICE A;  2O2L D;  5E3F A;  3DEP A;  5C4H A;  4KTA A;  1CT1 D;  5GAE C;  1NTG A;  1IBM Q;  2F0D A;  4ZUI A;  2EQS A;  1D1I A;  1I3Q B;  1VQG A;  4ZLT F;  4DAY B;  2DJF C;  3TBI B;  1TS4 A;  2CQO A;  3KF6 A;  4NP5 A;  3U9O A;  5JJI A;  4LJZ C;  1F9R A;  3J81 j;  2DY7 A;  5KGU A;  2CFM A;  3TP5 A;  4LF6 L;  4RGO S;  1S5F D;  2KA7 A;  1YEZ A;  2C5C A;  2M00 A;  2KCM A;  4A3G B;  4UAI A;  3A5Z B;  4LNQ A;  3HOU G;  3HOX H;  2OEO A;  1STH A;  2E2D C;  3N6R A;  3RMH A;  3JAM L;  1MIU A;  4PZ7 A;  5I6Y A;  5IP7 G;  4K2L A;  3PIP 3;  4GKJ Q;  5C4X G;  4ZUJ A;  3ER0 A;  4ZYS A;  1R4P B;  1EWH A;  4LK1 C;  1OTC A;  3S1N H;  4IN3 A;  4IFD I;  4YCW A;  4DNT B;  1ROD A;  3BZC A;  3ZYY X;  4G4K A;  4IQZ A;  4K14 A;  3SK5 A;  1RTO A;  3J7A V;  2VNU D;  4Y7N B;  3A0J A;  5KRU A;  3GTG B;  2PPB C;  4A3D B;  1N34 L;  1Q8K A;  1SJH D;  2IW3 A;  2NYZ D;  4A76 A;  5C5M A;  1SR3 A;  2K5W A;  1VQ6 A;  3KK7 A;  5CGK A;  3S1R H;  3NWT A;  1Y69 U;  1H9M A;  2PNH A;  1F9P A;  2JN4 A;  4X6A H;  3OIQ A;  5M3F G;  2PCF B;  1I94 Q;  1HNX L;  3S17 B;  3F1Z A;  2JA8 G;  2B2U C;  3LWE A;  1K9M C;  1PDQ A;  1HNW L;  3NBH B;  4KI0 A;  3J81 L;  3S24 A;  3HKZ E;  5FLM H;  3K58 A;  3BDL A;  4IPC A;  4C2M B;  4C3J H;  2R92 G;  4UP8 A;  4QCL A;  4A3D G;  1LM0 A;  2I07 B;  3MWY W;  3I72 A;  3MTS A;  2EXD A;  4C1N I;  3ONA B;  3OWF A;  2K50 A;  3CPW A;  2R6G A;  3CCU A;  3RLO A;  1HPC A;  4DK6 C;  3HOW B;  1YJN A;  5CC4 A;  3C3L A;  3IL8 A;  5C0X J;  1L0Y B;  2NUC A;  2WAQ E;  3DXJ C;  4OWX B;  3HEJ A;  2F03 A;  1STY A;  1B70 B;  2OF1 A;  2XIW A;  3TP8 A; 
#chains in the Genus database with same CATH homology
 3FKI H;  2HHH L;  1L1O A;  3KF6 B;  4BA1 I;  1JJ2 A;  4GN4 B;  4A3B H;  4OO1 G;  3JAM c;  1U0L A;  1RL2 A;  2K4K A;  4A3M H;  1NY4 A;  1IYJ B;  2JJQ A;  4DR1 L;  5C4J H;  4OX9 L;  1VQE A;  4JI4 L;  4X64 Q;  1IBL L;  1E24 A;  1Y1W G;  3AFP A;  1XNQ Q;  5C44 H;  3CME A;  4GLA C;  5IYD H;  4IPD A;  3BU2 A;  2AWN A;  4JOI A;  5LMN L;  1JE5 A;  3U58 A;  2KHI A;  4NXN Q;  3ULJ A;  2UXB Q;  5M5W H;  3TRE A;  4A3I G;  5FJ8 H;  2KBN A;  4UY8 C;  4Y7N H;  3HOW G;  3E9H A;  1QVG A;  3GTG H;  3GTQ H;  2CWA A;  4DV6 Q;  3STB C;  2K5H A;  1VQ4 A;  2YU9 H;  1BBU A;  4JI0 L;  4MNO A;  1PH2 A;  1HR0 W;  1SN8 A;  2AHO B;  4OX9 Q;  4YWL A;  1XPR A;  1Z47 A;  2BA1 A;  3GDE A;  2YTX A;  4LF4 L;  5E7N A;  2A8V A;  3HOX G;  2RF4 A;  3I4M G;  1M90 C;  1J5E Q;  4JI3 L;  2AMC B;  3W1G A;  1ASY A;  2ZTD A;  1QVF A;  1E1T A;  4DR1 Q;  2UUB Q;  4DV0 Q;  5C0X I;  1N33 Q;  3PO2 H;  3GTM H;  2ID0 A;  1VCI A;  4XIG S;  3CCJ A;  1KIX A;  2QEX A;  3A74 A;  3K81 C;  3BJU A;  4GNX A;  1VQF A;  1GD7 A;  1CKM A;  3OTO Q;  5LMN Q;  4DR2 Q;  2OQK A;  2JA7 G;  2Q2H A;  2IT1 A;  4IFD G;  2GVB A;  1CSP A;  2L15 A;  1U5K A;  2JA5 G;  1SFO H;  5IYC H;  4X62 L;  5BR8 Q;  3CCM A;  4APV A;  1VQO A;  1YIT A;  3J81 c;  2JQO A;  3STB D;  3CC2 A;  3RN5 A;  1SMX A;  1TWC H;  1VQK A;  4BY1 H;  1PH8 A;  1MJC A;  2HIX A;  4JI5 L;  4LFB L;  1EOV A;  3HOV H;  3CW2 C;  4HJ5 A;  1XPU A;  3GTP H;  3AFQ A;  1KD1 C;  1WI5 A;  4NXM L;  5DLQ E;  4UPA A;  1WFQ A;  4DR6 Q;  4LF4 Q;  2VL6 A;  3CF5 A;  1VQ5 A;  3NEN A;  1OXX K;  4LF5 L;  1TWH H;  1P8L A;  5IYB H;  1EIF A;  5C3E G;  1ASZ A;  2F3I A;  4KHP L;  1HZ9 A;  3W1B A;  2VS1 A;  4JI8 L;  1JMC A;  4LF6 Q;  3T1Y L;  3CCR A;  1Q1E A;  3PCO B;  1QUQ B;  4NPS A;  4OWT B;  4C3I H;  2A19 A;  4LFC Q;  1GO3 E;  3TS2 A;  4GN3 B;  3F8T A;  3TQY A;  1PV4 A;  2VUM G;  4X65 L;  4A3K H;  4DV5 L;  1YJ9 A;  3OW2 A;  2MO0 A;  2VY3 A;  1XMO L;  3K7A H;  4X62 Q;  1VQN A;  4JCV E;  4JI1 L;  1I50 H;  4BXX H;  3I4N H;  1CKO A;  2YV5 A;  4DPG A;  5GAG C;  1V9P A;  1PA6 A;  3NEL A;  4JI5 Q;  1QVC A;  4LFB Q;  2RHS B;  3PUX A;  4JI2 L;  5JEA G;  1X3F A;  3S15 H;  4BA2 I;  3HFZ B;  4NXM Q;  2K14 A;  2Z0S A;  3PF4 A;  1YBY A;  2NVQ H;  4DV4 L;  1A8V A;  1E3P A;  3K0X A;  4B3T L;  1OXV A;  2ZM6 L;  1K83 H;  5ELO A;  2I0Q A;  3GTJ H;  2JA6 G;  4DR3 L;  1IBK L;  2R93 G;  3GD7 A;  3CC7 A;  4KHP Q;  1C7Y A;  2YYZ A;  2IHE A;  4JI8 Q;  3T1Y Q;  3HOU H;  1XJV A;  4O2D A;  1WJJ A;  2ZJR A;  4QY7 A;  4HJ9 A;  2WFW A;  4LF8 L;  4WJ4 A;  5IP7 H;  5GQO A;  1PYB A;  3EN2 A;  4JYA L;  2QGQ A;  4H02 A;  5C4X H;  4IOA A;  4K0K Q;  3F2B A;  1L1O B;  3D0F A;  5H1S E;  4R4I A;  1XMO Q;  1Q82 C;  4A75 A;  2E5L L;  2Q2U A;  1UE1 A;  2PQA B;  1NE3 A;  3M7N A;  1NMF A;  5IP9 H;  2MO1 A;  2A1A A;  3TS0 A;  1HNZ L;  1PH9 A;  1YVC A;  1EUJ A;  2Q2T A;  2K5N A;  2VQF L;  1S3O A;  4BY7 G;  1PH4 A;  2BA0 A;  3KLW A;  1C9O A;  3WWV A;  3I55 A;  4WJ3 M;  1WCM H;  1M1K C;  2ALY B;  5IY0 A;  2HT1 A;  2IY5 B;  3U4Z A;  1X9N A;  1OXT A;  4DR3 Q;  4A3L G;  4DV1 L;  4JBK A;  3J7A 5;  3KYH C;  1GM5 A;  1E7Z A;  3RR5 A;  3S2H H;  3CCV A;  1IXR A;  4MTN A;  3AYH B;  4AQY L;  5IE8 A;  1HNW Q;  4A3E H;  4AH6 A;  3CCS A;  1K3R A;  2B63 H;  4A4I A;  2I5L X;  5M5Y H;  1FJG Q;  4P74 A;  4JYA Q;  1VQA A;  4DUZ L;  4DNI A;  1HR0 L;  4B3S L;  5M3F H;  3S2D H;  2GVA A;  5AJ3 L;  2QA4 A;  1B7Y B;  4X66 L;  3KJP A;  1P16 A;  2F4V L;  4B3R L;  4R4T A;  1HNZ Q;  1LTL A;  2DUD A;  4DV2 L;  2RCN A;  4GN5 A;  4LW1 A;  3PF5 A;  1QZH A;  1N36 L;  2JA8 H;  4DR7 Q;  1LUZ A;  2PI2 A;  4DR4 L;  4LFA L;  2JEA I;  1KRS A;  4JBJ A;  4AIM A;  1SE8 A;  4EX5 A;  4JOI C;  1VQ7 A;  2JK8 A;  4LUZ A;  4DV1 Q;  2OCE A;  2R92 H;  1XMQ Q;  5C0X G;  1X3G A;  1KRT A;  1VQH A;  4AQY Q;  1IBM L;  4A3D H;  2KCT A;  4L5T A;  3E0E A;  2KEN A;  4YHH L;  3AQQ A;  3DLL A;  3K7U C;  3FHW A;  4POF A;  4DR5 L;  4QJF A;  3AEV A;  4DUZ Q;  4B3S Q;  3PO3 H;  3F2D A;  4LF9 Q;  2E2H H;  1N9W A;  1AE2 A;  4XTC S;  1G51 A;  1O7I A;  2HHH Q;  2ZJQ A;  2HQL A;  4QIW E;  2I5M X;  4X66 Q;  2F4V Q;  1HZA A;  1W3S A;  4P71 A;  2VQE L;  2ZJP A;  4IOC A;  2NN6 I;  1PH6 A;  1H95 A;  3PUY A;  2H5X A;  4RMF A;  3DM3 A;  4JBW A;  4YWK A;  3S17 H;  4DR4 Q;  3U50 C;  1Y1V H;  4IPG A;  1YHB A;  4GNX C;  1Q7Y C;  1PH5 A;  1KHI A;  1A63 A;  4JI4 Q;  1IBL Q;  1TWG H;  1Q46 A;  1VQ8 A;  4A3C G;  4OO1 I;  4C2M H;  4JI6 L;  1EQR A;  3M9B A;  4A3F H;  3CD6 A;  2BH2 A;  3GTO H;  2CCZ A;  4POG A;  4OWW B;  4HIO A;  5HY6 A;  1JT8 A;  2LSS A;  4GKJ L;  4JI0 Q;  1X54 A;  4JI7 L;  5IT9 c;  1Y1W H;  3MEF A;  1V1Q A;  2C35 B;  4HJA A;  4BXX G;  2OWO A;  3I4N G;  1UE5 A;  1Y14 B;  3IRB A;  5M5X H;  4EQ5 A;  5LMU L;  3TRZ A;  4B3M L;  3H0G G;  3UDI A;  1XTD A;  2XGT A;  3A5U A;  4A3I H;  2YTY A;  3PUV A;  3ULP A;  4JI3 Q;  3HOW H;  2Y0S G;  2E2I H;  1IL2 A;  1HZB A;  1Q12 A;  4A3J G;  5LMN W;  2N3S A;  1WOC A;  1JJC B;  4A93 H;  2ZTC A;  2B29 A;  2N78 A;  1GKH A;  1I5F A;  4R4C A;  3H3V I;  2RHQ B;  4YY3 L;  3H3V H;  3MXN B;  2VW9 A;  2IX1 A;  3HOY G;  4HID A;  3I4O A;  3I4M H;  1T9H A;  2R7D A;  1VQI A;  1G29 1;  3B6Y A;  3M4P A;  4O0A A;  5M3M G;  1EFW A;  4GKK L;  3UE1 A;  5FLM G;  3EIV A;  4LF7 L;  3PUW A;  2N8N A;  1I94 L;  3K80 C;  5LMU Q;  4JC0 A;  5IP9 G;  2JA7 H;  2Q2I A;  1UWV A;  3KDF A;  1AH9 A;  4BBS G;  4LF5 Q;  1Q1B A;  2JA5 H;  3PSI A;  4OXP A;  3PIO A;  3NEM A;  2R7Z G;  3KFU A;  1VQP A;  1X55 A;  4GLV B;  4IJH A;  4TVA B;  4YWM A;  2K5V A;  1MKH A;  1K73 C;  4QGU A;  4DUY L;  1EIY B;  3J80 i;  3PUZ A;  2LXK A;  4TQU S;  3LGJ A;  3OYY A;  4A3G G;  2NVX H;  2Z6K A;  2UUA L;  1E22 A;  4X65 Q;  5GAH C;  1XNR L;  4DV5 Q;  3CCL A;  4P75 A;  1SLJ A;  4JI1 Q;  2ES2 A;  4GS3 A;  4LUO A;  1WYD A;  1A62 A;  5C3E H;  1YI2 A;  4GKK Q;  1EWI A;  4DV3 L;  2ATW A;  2NVY H;  1FL0 A;  1Q86 C;  1W2B A;  4JI2 Q;  2Y0S E;  1RIP A;  3FKI G;  3BZK A;  1DGS A;  3S1Q H;  4DV4 Q;  2VUM H;  4FDB A;  4A3B G;  1AE3 A;  1L0W A;  4B3T Q;  2ZM6 Q;  1BVS A;  2XTI A;  2VZA A;  3CP0 A;  1PH7 A;  4A3M G;  5JJK A;  4GOP C;  1IBK Q;  2UU9 L;  1CUK A;  4PG3 A;  2R7F A;  2NVT H;  1QUQ A;  2CWP A;  1PFS A;  3UE0 A;  4GOP A;  4DUY Q;  5C44 G;  1VQL A;  2I5H A;  4LF8 Q;  5IYD G;  4KLK A;  4JG2 A;  3G4S A;  1XNR Q;  3RLN A;  5FJ8 G;  3T1H L;  3L7Z C;  1Q81 C;  1TWF H;  2E5L Q;  1G6P A;  3M3Y H;  1K8G A;  2K52 A;  2F52 A;  4QQB X;  2JA6 H;  2R93 H;  1LYL A;  3CCQ A;  1V43 A;  2HIV A;  2OQ0 A;  1CSQ A;  4JV5 L;  5GAD C;  3K8A A;  2GN5 A;  5J3B A;  3PV0 A;  1K8A C;  3CPF A;  4DKA C;  4ALP A;  4Y52 H;  4PZ8 A;  2VQF Q;  4GNX B;  1KL9 A;  3RNU A;  1KC8 C;  3HOZ H;  3ERS X;  3I7F A;  4NB3 A;  2UXB L;  1I6H H;  4L5Q A;  2NN6 G;  2OTL A;  2CKZ B;  3E9I A;  3J7Z C;  1KXL A;  3U4V A;  2UU9 Q;  4DV6 L;  5ELN A;  3PO2 G;  2AKW B;  2WP8 J;  4QL5 A;  3W5O A;  4AYB G;  1YJW A;  4L5R C;  2ASB A;  4PMW A;  1EYG A;  1PHJ A;  1X3E A;  4RG1 A;  1Z9F A;  1CKN A;  1IZ6 A;  3I56 A;  1L2F A;  1K0R A;  3CCE A;  2D0P A;  4BY7 H;  1S72 A;  1HR0 Q;  3T1H Q;  4A3F G;  3RZD H;  2PQA A;  3S14 H;  3JAM i;  5IYC G;  1J5E L;  1UEB A;  5AJ3 Q;  1D7Q A;  5HGQ A;  4A3L H;  4B3R Q;  4PZ6 A;  1A0I A;  1JB7 A;  3CQZ H;  4BY1 G;  5FLX c;  4DV0 L;  2UUB L;  4DV2 Q;  1R9T H;  1N33 L;  1N36 Q;  4JV5 Q;  1BBW A;  1X6O A;  3HOV G;  4DAM A;  3CMA A;  2UXC L;  4LFA Q;  1QZG A;  3KF8 B;  3OTO L;  4DR2 L;  2AWO A;  4J15 A;  5GRO A;  4HIM A;  4BBR H;  3GTK H;  3CAM A;  4R4Q A;  1VS0 A;  4HJ8 A;  1MJE A;  3ULL A;  5BR8 L;  3CC4 A;  3ICE A;  5IYB G;  4IFD J;  3M4O H;  2PMZ E;  5GAE C;  1NTG A;  1IBM Q;  4A93 G;  5JJL A;  4YHH Q;  2EQS A;  2JEB I;  3SGI A;  4DR5 Q;  1PYS B;  1HZC A;  4DR6 L;  1VQG A;  4DAY B;  4A3K G;  1N32 L;  1TXY A;  2PI2 E;  3D31 A;  3KDF B;  4C3H H;  2IHF A;  1OXU A;  1UE7 A;  2CQO A;  3KF6 A;  3UDX A;  1VQM A;  5JJI A;  4YCV A;  3J81 j;  1VQD A;  2VQE Q;  4GLX A;  2CFM A;  4LF6 L;  3UDG A;  1C0A A;  2WB1 G;  4ME3 A;  4LUV A;  1YEZ A;  2UXC Q;  4LFC L;  5IWA L;  4L5S A;  1JJG A;  4AYB E;  3G48 A;  2KCM A;  3L2P A;  1BKB A;  2FXQ A;  3TEH B;  1YIJ A;  1J6Q A;  2JA9 A;  3VDY A;  3A5Z B;  4LNQ A;  3HKS A;  3GO5 A;  3J81 i;  2D0O A;  2E2J H;  3HOU G;  4JI6 Q;  1UE6 A;  4DK3 C;  2K75 A;  3HOX H;  3HKZ G;  1MIU A;  4PZ7 A;  4UP9 A;  5IP7 G;  1X65 A;  3KOJ A;  5JEA J;  4GKJ Q;  1FVI A;  5C4X G;  1N32 Q;  4JI7 Q;  4IO9 A;  3ER0 A;  3H15 A;  1OTC A;  3S1N H;  4IFD I;  4B3M Q;  1YHA A;  2MFI A;  2NZO A;  4A3C H;  4IJL A;  4DV7 L;  3EBE A;  4YCW A;  3I2Z A;  2MNA A;  4R4O A;  1VQC A;  3G6E A;  4GOP B;  2BH8 A;  3BZC A;  1SRU A;  5IWA Q;  3RZO H;  4JBM A;  3PIP A;  1KAW A;  4YCU A;  1WCM G;  1OXS C;  4K0K L;  2Z6K C;  1SRO A;  3J80 c;  2VNU D;  2WAQ G;  1YHQ A;  3F2C A;  5EAY A;  3A0J A;  4YY3 Q;  4UP7 A;  2UXD L;  4IPH A;  1N34 L;  1Q8K A;  1NBW A;  3H0G H;  4KHZ A;  1S40 A;  3RLF A;  4A76 A;  2OTJ A;  1SR3 A;  4R1J A;  4A3E G;  1EQQ A;  4HIK A;  1VQ6 A;  2B63 G;  4A3J H;  3S1R H;  2WB1 E;  2PNH A;  3ZJY C;  4LF7 Q;  2UUC L;  4X6A H;  3M85 A;  5M3F G;  2YTV A;  1XPO A;  1I94 Q;  3S1M H;  4MZ9 A;  3G71 A;  3RN2 A;  1HNX L;  3HOY H;  3F1Z A;  4DV7 Q;  2JA8 G;  3Q8D A;  5K36 G;  1PVO A;  1YNX A;  1K9M C;  4HJ7 A;  1HNW L;  3JC6 6;  3NBH B;  1GVP A;  2ZTE A;  4KI0 A;  2MQH A;  3HOZ G;  1HH2 P;  3S24 A;  5M3M H;  1FJG L;  3HKZ E;  1CKN B;  5FLM H;  3S16 H;  1VQB A;  1I3Q H;  1X56 A;  3CXC A;  4IPC A;  1FGU A;  1VQJ A;  4C3J H;  2R92 G;  2D62 A;  1N8R C;  2UXD Q;  4UP8 A;  2UUA Q;  1N34 Q;  2IX0 A;  1KQS A;  3PGZ A;  4BBS H;  4DR7 L;  2EIF A;  2R7Z H;  4A3D G;  1B8A A;  1D8L A;  1LM0 A;  2N49 A;  1E1O A;  2B3G A;  3L0O A;  4P73 A;  1VQ9 A;  2EXD A;  4LWC A;  1YZ6 A;  3UDF A;  4DV3 Q;  2K50 A;  4X64 L;  3PO3 G;  1NMG A;  3CPW A;  2R6G A;  2UUC Q;  1TWA H;  1XNQ L;  2V1C C;  3FP9 A;  3CCU A;  3RLO A;  2JE6 I;  4DK6 C;  4A3G H;  2KHJ A;  1NJI C;  4NXN L;  3GTL H;  1YJN A;  2NZH A;  1XMQ L;  1HNX Q;  2LXJ A;  5C0X J;  2WAQ E;  1PH3 A;  1Y1V G;  4OWX B;  2DGY A;  1HJP A;  3KJO A;  3M4Q A;  4OON A;  4BBR G;  1L1O C;  4P72 A;  4LF9 L;  1B70 B;  1PH1 A;  2E8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...