2HQLA

Crystal structure of a small single-stranded dna binding protein from mycoplasma pneumoniae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEIWKTTIEIVKIFNPKNEIVIDYKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MG376 homolog
publication title Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Dna binding protein
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11506 DUF3217 Protein of unknown function (DUF3217)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hqlA01
4H02A 2IX1A 5ELNA 3HOVH 2NZOA 4X65Q 2Y0SG 1P8LA 2VY3A 1RL2A 4GOPB 4OONA 4IFDG 1W2BA 1CKNA 2K5VA 3KDFA 4POGA 1QUQB 4LFBQ 4GN3B 3AFPA 4B3SQ 2JEAI 1VQ5A 3KOJA 4JI4Q 1GD7A 4DV4Q 4GLXA 3RN5A 1Q86C 3H3VH 1A63A 1PH7A 4O0AA 4LF5L 4PZ7A 2PNHA 1V43A 4DPGA 3PUWA 4P73A 5M3FG 3T1YL 2NVXH 1X9NA 1I3QH 4DUYQ 2E8GA 1YHAA 4IJHA 4GNXA 5M3FH 1UEBA 3J7ZC 1E7ZA 5M5XH 3M3YH 5LMUL 1QZGA 4GKJQ 4MTNA 1N36L 5IYDH 3JAMc 2N78A 3I2ZA 3G6EA 4DR7Q 3KFUA 4IJLA 3HOZH 2K75A 3OYYA 2Q2HA 3NEMA 1X65A 2QEXA 1YZ6A 4JI0Q 4LF5Q 4A3CH 3RN2A 4PZ6A 2YU9H 2N8NA 1FL0A 4GS3A 4KHPL 4DR2L 3K7AH 1OXVA 2UU9L 4HJ5A 3HKSA 4LF7Q 4GN4B 2JA7G 3A5ZB 1YNXA 3DLLA 1UE1A 1I94L 4JI6Q 1CSPA 3CMEA 3A5UA 5LMUQ 1BBUA 2MO1A 4A75A 1CUKA 1HJPA 5LMNW 2L15A 1N36Q 4YWKA 4DR3Q 5IE8A 4R4TA 4NXMQ 4GLAC 3S1MH 3HOUG 4LF4L 4OXPA 1VQ8A 2Q2TA 4LWCA 2VUMG 1C9OA 4JBWA 5GAHC 1K8GA 5IT9c 4AYBG 1PA6A 2E5LL 4JC0A 3HOUH 4L5TA 4DV0L 4KHPQ 3GTJH 2YYZA 1EIFA 4DR2Q 3CCVA 1LUZA 4KI0A 4GOPC 3ERSX 2B63G 4X64L 4Y7NH 4C2MH 3RLNA 1I94Q 2EIFA 4XTCS 3UE0A 3OTOL 1IL2A 1Z9FA 1E3PA 1JE5A 3I55A 1X3FA 4LF8Q 1J6QA 3PUZA 1KIXA 4OWTB 3H15A 1HR0L 1PH6A 3AEVA 4AIMA 4JI8L 1WCMG 2BH8A 2R7DA 4R4IA 4JI1Q 3ULJA 4Y52H 2CQOA 2Z6KA 1VQNA 3M4PA 1IBLL 4BY1H 2V1CC 1WCMH 3G4SA 5LMNL 4DV7L 3I56A 1VQOA 3I4OA 4LW1A 1KC8C 4WJ3M 4LUOA 3UDIA 3MEFA 1J5EL 1VQGA 3HKZE 4X64Q 2B3GA 5C3EG 5IYCG 3W5OA 4O2DA 5JEAG 2F3IA 4EX5A 2NZHA 5FJ8G 3K80C 1YJWA 3CCLA 4LF9L 4DR6L 5IYCH 1K83H 1E1TA 3CW2C 1HR0Q 1N33L 2JA8G 1V9PA 4YHHL 2GVBA 4A3DH 2K4KA 4JI8Q 4OWWB 1HNXL 2JJQA 1FGUA 2JA8H 1S3OA 1IBLQ 5LMNQ 4DV7Q 3CCMA 1IBML 1NMFA 4BA1I 2N3SA 1MKHA 4B3ML 2R7ZH 2WAQE 4HJ7A 3B6YA 3WWVA 1IBKQ 1C0AA 4A3LH 3GO5A 1QZHA 2JA9A 2KBNA 2OTJA 1PH9A 3F8TA 1PV4A 5GAEC 1UE5A 4DR1Q 4LF6Q 3S15H 2ES2A 1CKMA 5GADC 3G71A 1I6HH 2MO0A 1YJNA 1GO3E 1HNXQ 4OX9Q 1BVSA 1A8VA 3PUXA 1L1OB 1G51A 2RF4A 3PCOB 5GAGC 1N34L 1IBMQ 2XGTA 1X56A 4YCVA 5IWAQ 1UE7A 3GTMH 3FKIG 1HNWL 3ER0A 4UY8C 1E24A 4B3MQ 2LXKA 2ZJPA 2RCNA 3FKIH 3W1BA 3GTGH 3J81c 4JI2L 1SRUA 2AWNA 2JQOA 4UP9A 1CSQA 1VQ6A 5M3MG 4BXXG 3PUYA 1GM5A 2FXQA 1E1OA 1G291 4BXXH 2WFWA 3FP9A 2R92H 2VQFL 3KF6A 3NBHB 1OXXK 4JI3Q 1TWFH 2YTVA 4DV5L 2MQHA 5BR8Q 1N34Q 2PI2E 2VL6A 5C0XG 1M1KC 3I4MG 1HNWQ 2WB1E 3SGIA 4BBSG 4EQ5A 1ASZA 2JA6G 1YVCA 4DUZL 5M5YH 3I4MH 3A74A 2E2JH 4BBSH 2JA6H 4PG3A 4JI7L 3CQZH 1HNZL 1SROA 4R4OA 3STBC 1PH2A 2A8VA 1KRSA 1SMXA 2UUAL 1EFWA 3U50C 1FVIA 1X3GA 5JJIA 2OCEA 1Q12A 4JCVE 4DV5Q 1OTCA 1XJVA 1PHJA 4LUZA 3CP0A 4A76A 3S1NH 1JJGA 1K3RA 2PQAB 3CPWA 1YIJA 1RIPA 2BA0A 4XIGS 2VW9A 2UUCL 4JYAL 4IPHA 1IYJB 2I5MX 1XPUA 2EXDA 2ZTCA 2UUAQ 2QGQA 2ZTDA 1NBWA 4P71A 4KHZA 2KENA 5IYBG 3RNUA 3TQYA 1K0RA 5IYDG 3L7ZC 5IYBH 4BA2I 3Q8DA 1HZ9A 1X3EA 3S1QH 3HOZG 5C4JH 5GQOA 2NN6I 1NMGA 1JMCA 1CKOA 1HZBA 4A3CG 3HOWH 2UUCQ 3GTPH 1XMQL 4PZ8A 1OXSC 1VQAA 1Y14B 4HIKA 3VDYA 4NB3A 4HJ9A 2IHEA 3T1YQ 2K5HA 3S16H 4IOAA 4HJ8A 1HR0W 2UXCL 1QVCA 1VQPA 4RG1A 3NELA 2LXJA 3F2BA 4GKKL 1X55A 3PUVA 2I5HA 1VCIA 2E2HH 1FJGL 1N32L 3BZCA 1PH3A 3UDGA 4IFDI 3PV0A 2ID0A 2VZAA 4NXNL 2NVTH 1XMQQ 3PO3G 1A0IA 2JEBI 2R6GA 2XTIA 4LUVA 4IO9A 5IP7H 2F4VL 1VQCA 1VQMA 3CC4A 2UU9Q 3PO3H 3I7FA 4DV1L 1YHBA 2CWAA 2UXCQ 2BH2A 3HKZG 4OWXB 5EAYA 1EQQA 2DGYA 1TXYA 3S17H 1VQIA 2GVAA 4BY1G 5C44H 4A3MG 3ZJYC 1WYDA 1M90C 1FJGQ 3CCRA 3GTOH 1NE3A 4LF4Q 3HOYG 4NXNQ 2OQ0A 4JG2A 4A3MH 4A3KG 4LFAL 4GN5A 1JB7A 3L2PA 4GOPA 2IX0A 3TREA 2N49A 4A3EH 2IHFA 1Q7YC 3S24A 1QUQA 4DV0Q 2DUDA 3CCSA 4A3KH 2F4VQ 3HOYH 4DV2L 1D8LA 1JJCB 1KAWA 4DV1Q 3TRZA 5JJLA 2H5XA 2WAQG 4GLVB 1N8RC 3PIOA 2VQEL 1Q8KA 3OTOQ 3M7NA 4A3DG 4QJFA 4AH6A 1AE2A 1PYSB 1VQ4A 1T9HA 4A3JG 1PH4A 3CCJA 1NTGA 4ALPA 4LFAQ 4RMFA 4QGUA 4IOCA 4A3JH 2R7ZG 1I5FA 1TWHH 4DKAC 4A3LG 4TVAB 4OO1G 4DV2Q 1B8AA 2AKWB 4QQBX 2HHHL 2RHQB 1J5EQ 5IP9H 1W3SA 2UUBL 5JJKA 1VQDA 3GTLH 3AQQA 3EN2A 1VS0A 4DV6L 2NVQH 4LF9Q 3M4OH 4DR6Q 4AQYL 4DR5L 3RLFA 1CKNB 3KDFB 4YHHQ 1N33Q 2HT1A 3TS2A 1JT8A 1TWAH 2AMCB 3UE1A 3KF8B 3NENA 4A3FG 1XPRA 1JJ2A 1V1QA 2MNAA 2UXBL 2HIXA 4A3FH 1KRTA 2HQLA 2PMZE 2WB1G 2Z0SA 4JBKA 2ASBA 4DR4L 3RR5A 2E5LQ 3S14H 2UUBQ 1VQJA 2NVYH 4GNXB 4DV6Q 5DLQE 2R92G 4NPSA 5E7NA 2JK8A 3J81j 4AQYQ 4FDBA 4DR5Q 4A3IH 4DR7L 4JOIC 2VNUD 4J15A 2KCTA 3J7A5 2I5LX 4A93H 1YITA 3E9HA 2E2IH 3AYHB 3FHWA 4TQUS 4LNQA 4A3BG 1OXUA 3PSIA 1S40A 4QIWE 4R4QA 1E22A 4A3BH 1XPOA 3MXNB 4JI2Q 1SLJA 1NY4A 1TWGH 4IFDJ 3PO2G 1VQ7A 4MNOA 3S1RH 5ELOA 1TWCH 1K9MC 1S72A 3PO2H 1U5KA 2VQFQ 1KQSA 2AWOA 3CD6A 1GVPA 3A0JA 1YEZA 3IRBA 3GDEA 4X66L 1ASYA 3I4NH 4IPGA 4BY7G 1D7QA 2IT1A 1OXTA 4BY7H 2R7FA 2CWPA 2AHOB 1PVOA 4PMWA 4A3GG 3CF5A 1YI2A 1P16A 4LFBL 4DUZQ 2ALYB 3CMAA 1EQRA 3CCEA 4A3GH 4B3RL 5FLMH 4JI4L 1HNZQ 4JI7Q 4JBJA 5IY0A 1L1OC 1A62A 3DM3A 2LSSA 2YV5A 1O7IA 3E9IA 4C3JH 2MFIA 1HZCA 2C35B 1UE6A 2K50A 3D0FA 1K8AC 2ATWA 3HOWG 4GNXC 4GKJL 3CAMA 1HZAA 3D31A 5HY6A 4JYAQ 5C0XI 1WJJA 3K7UC 3KYHC 1IZ6A 4B3RQ 2K5NA 4P75A 1B70B 1L1OA 2D0OA 4UP7A 2OTLA 2EQSA 4IPCA 4JI0L 3HFZB 3GTQH 1MIUA 1XTDA 1X54A 4KLKA 4LF7L 2ZTEA 3PIPA 2Y0SE 4JI6L 1PH5A 2JA5G 1I50H 1KL9A 3BJUA 1Q46A 1VQKA 4YY3L 5H1SE 2YTXA 1Y1VG 2B29A 1Z47A 3PGZA 3CPFA 3EBEA 2JA5H 1KD1C 4DR3L 3H3VI 1Q82C 3M4QA 3H0GG 1Y1VH 2A1AA 5IP7G 4NXML 2OQKA 4LFCL 1Q1EA 3CXCA 3H0GH 2D62A 1SFOH 1XNQL 1YHQA 1LYLA 2KHJA 1SN8A 4P74A 4HIMA 1C7YA 3ICEA 2BA1A 3J81i 3STBD 4JBMA 5C44G 4GKKQ 4ME3A 3J80i 3UDFA 4HJAA 2JA7H 3U4ZA 4QY7A 4YY3Q 1VQLA 1N32Q 4DR4Q 2D0PA 1NJIC 4A3EG 4LF8L 1UWVA 1SE8A 4DNIA 3E0EA 4LFCQ 1PH1A 4JI1L 5JEAJ 3UDXA 3RZDH 1WI5A 4DK6C 3F2DA 4K0KQ 1VQBA 3GD7A 3JC66 4R4CA 2UXDL 1LTLA 2PQAA 2Z6KC 1XNQQ 2VUMH 4X62L 5GROA 3PF4A 1KHIA 1X6OA 1MJEA 3KF6B 3T1HL 3G48A 1DGSA 2B63H 1WFQA 1QVGA 4C3HH 3EIVA 4UP8A 2PI2A 5FLXc 1VQFA 3CCUA 1QVFA 1HH2P 3F2CA 2IY5B 4APVA 2VS1A 2CFMA 1YJ9A 2K14A 1YBYA 3RLOA 3W1GA 1PYBA 1Q81C 2I0QA 5IP9G 4AYBE 4YCWA 4HIOA 2UXDQ 4JV5L 1AH9A 3S2HH 3L0OA 2ZJQA 3LGJA 4X62Q 2Q2IA 1SR3A 3K0XA 2VQEQ 3BU2A 1IBKL 4WJ4A 4P72A 5J3BA 3T1HQ 4MZ9A 5K36G 2OWOA 4DR1L 1AE3A 1K73C 4L5RC 4LF6L 1R9TH 5C3EH 2GN5A 2KCMA 1EYGA 4DV3L 5FJ8H 3TS0A 2WP8J 2KHIA 4OX9L 2F52A 4YWMA 3M9BA 1Y1WG 1U0LA 2A19A 3JAMi 3KJOA 4QL5A 4JV5Q 5IWAL 5AJ3L 3KJPA 4HIDA 1Y1WH 2HHHQ 4B3TL 3CCQA 1GKHA 1EWIA 2K52A 3K81C 3S2DH 1VQ9A 4A3IG 5C0XJ 3U4VA 1PFSA 1B7YB 2CCZA 4A93G 4L5SA 5HGQA 2RHSB 2YTYA 4JI5L 4DV3Q 2ZJRA 1WOCA 2CKZB 4YCUA 2UXBQ 4JI3L 3ULPA 3M85A 3BZKA 4R1JA 4DK3C 2JE6I 5BR8L 3OW2A 1L2FA 3TEHB 2Q2UA 4X6AH 1H95A 1N9WA 5AJ3Q 1L0WA 4B3TQ 1XNRL 1VQEA 5C4XG 4OO1I 4JOIA 5C4XH 1IXRA 1KXLA 4DAYB 4A4IA 3I4NG 3RZOH 3J80c 1XMOL 1G6PA 4BBRG 1PH8A 3AFQA 4K0KL 5M3MH 1EIYB 4C3IH 3PF5A 4JI5Q 2ZM6L 4BBRH 2NN6G 4X65L 3GTKH 3F1ZA 4UPAA 3U58A 4L5QA 5FLMG 1EUJA 1XNRQ 4POFA 4B3SL 3K8AA 4DV4L 1VQHA 1BKBA 2HIVA 3KLWA 1BBWA 1MJCA 1LM0A 1Q1BA 3ULLA 3HOXG 4DAMA 1EOVA 3CC2A 4IPDA 3HOXH 1XMOQ 2R93G 5M5WH 3CC7A 3HOVG 4YWLA 4X66Q 4DUYL 2QA4A 2R93H 2ZM6Q
chains in the Genus database with same CATH superfamily
4H02A 2IX1A 5ELNA 4WFN3 5D65A 4X65Q 2K01A 4FNFA 4A3IB 2VY3A 1RL2A 2MUYA 4IFDG 5JOBA 1W2BA 4GN3B 4A93B 4DR7L 1VQ5A 1B4OA 1ZKOA 3TP6A 1PH7A 4HSVA 4PZ7A 2QKIC 4P73A 1KABA 4EQOA 2E8GA 5C3XA 3A8KE 2NB0A 1TWCB 3JAMc 2KVMA 4C3IB 3I2ZA 4DR7Q 3KFUA 4IJLA 4O1NA 3HOZH 1H9SB 4G7OC 3FDTA 4JI0Q 2KA7A 1SE4A 3L3OC 2N8NA 3H91A 3J81L 3N6RA 4IUUA 3MXNA 2JA7G 3DLLA 4K8IA 3I73A 1STEA 1GUTA 2F0WA 4C3JB 5M5WB 2L12A 3SDZA 2C5CA 4R4TA 4GLAC 3S1MH 4LF4L 4OXPA 4QIWB 1MSGA 2L1BA 4DR4L 2RKSA 1PA6A 4JC0A 2YYZA 4C3HG 3DWAA 2EIFA 3TMEA 1Z9FA 1TR5A 3I55A 3SXHA 1X3FA 4LF8Q 2Z6BA 4WJWA 1WCMG 1TY0A 5M5XB 2R7DA 4R4IA 3M3YB 4NP5A 4J8QA 4HCEA 5LMNL 1CZWA 3I4OA 1F2ZA 1XYIA 3U9OA 2G5DA 1YNND 5C3EG 5J22A 5IYCG 1LTAD 1X32A 3K80C 3CCLA 4DR6L 3CW2C 5JEAH 1N33L 1V9PA 5E4WC 4OWWB 3MXGA 2JA7B 2JA8H 1S3OA 2O2LD 5LMNQ 3CCMA 4FXGC 1VDZA 4BA1I 1IHZA 3RZDB 2R7ZH 5DM63 4HJ7A 2KJXA 4A3LH 2IPKD 3GO5A 2JA9A 1QZHA 2L4NA 2OTJA 1I4GA 5GAEC 4DR1Q 4LF6Q 1JWSD 3A8IE 5GADC 1AN8A 1YJNA 3MXUA 4C3HB 1L1OB 2HDMA 1N34L 3QG1A 1X56A 3FPPA 3GTMH 1UE7A 3V2TA 3X3NA 1HNWL 4HR7B 1SXTA 3K5OA 3W1BA 2HUGA 1WCMB 4U673 2AWNA 3J81c 1IW7C 4JI2L 1VQ6A 1F2YA 3R2IA 5CV5A 5M3MG 1GM5A 1LT3D 1EU4A 4BS9A 2WFWA 1GUSA 5ELDA 4XYQA 2YTVA 1O7ZA 2MQHA 5C3EB 1N34Q 1TVXA 1Y69U 3I4MG 1HNWQ 3IFDA 4ULLA 4L6TB 1DCZA 5HURA 1PH2A 4R8NA 1LV9A 1KRSA 1Q8IA 2K05A 4CKBA 1FGBD 1HQMC 1HUMA 4CBVA 5JJIA 1EY7A 2OCEA 1Q12A 1S5CD 3K59A 2XSCA 4O42A 1KDBA 2PQAB 3CPWA 2VW9A 1CM9A 4XIGS 2DY8A 1IYJB 4IPHA 4TKOB 1HTLD 2I46A 2ICEC 2ZTCA 5E1FA 2QGQA 5J39A 3DWQA 3RNUA 3CRLC 3DEPA 1GXDC 3S1QH 3TSSA 1E2ZA 3HOZG 5M3MB 3MHBA 1EYDA 5KEEA 1CKOA 1HZBA 3HOWH 1QE6A 1D6EC 5F2DA 1OO9B 5CV7A 3T1YQ 1G8ZD 5CBEE 2NBFA 3NELA 3F2BA 2A6HD 4KK7A 4RGOS 3ONAB 3PUVA 1LT4D 2A69D 3UDGA 1JE4A 1K3BC 2JEBI 1VQMA 1AEXA 1C48A 2A6ED 4NKLA 2B8GA 1EQQA 4QB4A 3BVZA 1GHJA 4ODGA 3S15H 1ZYRD 4A3MH 4A3KG 4LFAL 4GOPA 3TREA 1D7QA 2IHFA 3S24A 4DV0Q 3CCSA 3HOZB 2MJ8A 1KAWA 5JJLA 2Q8IB 3IAYA 2WAQG 1DZ1A 5BN5A 1E2VA 3NPPA 1CQFA 1DONA 3CRKC 4X3TA 1NTGA 4LFAQ 3BYTB 4A3JH 5EBCA 2R7ZG 1I5FA 4RGTA 4A3LG 2AKWB 3S1MB 4QQBX 1B50A 4ZYSA 4Q5VA 3OWFA 3K5LA 4DV6L 2NVQH 3PQIA 4LF9Q 5IGBA 4AQYL 3KDFB 3UE1A 3KF8B 3NENA 1XPRA 3OMCA 5IGFA 2UXBL 3BDLA 3NTIA 5EPJA 2PMZE 2Z0SA 1RDPD 5I9PA 2IW3A 3RR5A 3HG9A 2NVYH 5DM73 4KD4A 4DV6Q 4A3KB 5DLQE 1TU2B 3J81j 4AQYQ 2WKCA 1AW7A 4V190 3J7A5 4BWGB 2WAQB 3AYHB 4A3BG 5DAUA 1XPOA 2K04A 1SLJA 3DM1A 3PO2G 2SNMA 3S1RH 5IODA 2R7ZB 1K9MC 1S72A 2F4IA 1A3TA 2L5TA 3IRBA 3K0YA 3I4NH 2IT1A 4BY7H 2CWPA 3D8GA 1TS5A 3CF5A 1YI2A 2JP1A 4JI4L 1AP0A 3GTMB 2EYFA 5IY0A 1SNOA 2F1MA 1ET9A 2ZXOA 2OEOA 3D6CA 5EPLA 3HOWG 3TZUA 2CHBD 1PRTC 4OEMB 1L0YB 3K7UC 2K5NA 1ENCA 2EQSA 4A3BB 4KLKA 4QUCA 1BO0A 1LTGD 1STNA 1QCBD 1VQKA 3PO2B 4YY3L 2YTXA 1RKNA 3NBHA 3H3VI 3VYSA 3H0GG 1Y1VH 2CQAA 2EYHA 4CKCA 2MGSA 1SJHD 5FK9C 1LYLA 4HIMA 1SN8A 4JBMA 2A68D 1PYWD 4ME3A 3J80i 3MZ5A 3U4ZA 1WTPA 4YY3Q 1HPCA 1UWVA 2ZXRA 4DNIA 3S1QB 1TS2A 3F2DA 1XXGA 2E76C 1WTRA 1VQBA 3GD7A 1EY0A 2SOBA 3HOWB 2UXDL 3I8ZA 5JPNC 3DHQA 3SK5A 2D2CC 1KHIA 1X6OA 5DNFA 3G48A 1J9OA 3IFTA 3RD4A 3T1HL 3EIVA 5FLXc 3GP7A 1HH2P 1S4ZA 3FVQA 2CFMA 2DJFC 2I0QA 5CGKA 4YCWA 3TP8A 4HIOA 2UXDQ 1AH9A 2A73B 1K8MA 4ZCKA 3LGJA 1SR3A 3K0XA 4WJ4A 3T1HQ 3NWTA 4MZ9A 1AE3A 2GN5A 1NSNS 2EYJA 4DN4M 4RA8A 4OX9L 2KHIA 1B53A 4DK0A 3KJOA 3S15B 2HHHQ 4HIDA 1Y1WH 4ZKCB 2F0DA 3CCQA 1T5EA 1QNUA 1VQ9A 5KYLA 3U4VA 2DN8A 3HP3A 2CCZA 3J80E 2PZWA 1JWUD 2CKZB 4RFBA 1CFMA 3OWEB 3M85A 4QMGA 4R1JA 4UDUC 3TEHB 3OW2A 2Q2UA 1H95A 4JW0A 4E6IA 1SYGA 2ZXPA 3I4NG 3QJYA 1XMOL 1XWEA 3NQIA 1J8IA 3AFQA 1HA5A 4OELB 4C3IH 1EYAA 2RDFA 4L5QA 3QO2A 4XT1B 1VQHA 1BNZA 1MJCA 2RVLA 3SHLA 1EOVA 3M4YA 4IPDA 1XMOQ 2R93G 5M5WH 2EYPA 2NVYB 3HOVG 4X66Q 4DUYL 1MGSA 1EEID 3EQLC 1ZXTA 1A3UA 2K6AA 4K2LA 4LFBQ 2JSOA 1CKNA 4POGA 1QUQB 3SR1A 4IFDH 4KHVA 1A6XA 1GD7A 3RN5A 4GLXA 3H3VH 4DFAA 1U4MA 4DPGA 3PUWA 1TY2A 4N8X1 1GOZA 4DUYQ 4IJHA 1YHAA 4GNXA 2MP1A 3S1RB 3VR3A 5M5XH 3M3YH 4GKJQ 1WD1A 2LFNA 1N36L 3I4NB 5IYDH 3G6EA 4UHVA 4HEDA 3OYYA 2Q2HA 3VA5A 1X65A 1YZ6A 1BDOA 3RN2A 1TQOA 4PZ6A 5IT9E 4GS3A 4KHPL 2F0PA 1CZGA 3K7AH 4LF7Q 4HJ5A 3HKSA 4GN4B 3A5ZB 4JI6Q 3CMEA 1BBUA 1PTOB 1HJPA 1N36Q 4YWKA 1BUVT 5IE8A 2R93B 3HOVB 5FO7B 1YNJC 1HCZA 3HOUG 1NR2A 2Q2TA 1C9OA 3Q6SA 5GAHC 2X69A 2E5LL 4AYBG 2R61A 4HAEA 5T1GA 4KHPQ 3GTJH 1EIFA 4GOPC 4X64L 1QG7A 4C2MH 4Y7NH 1IKMA 4XTCS 3UE0A 3TP5A 2LY7A 5CBAE 3OTOL 1E3PA 5C6AA 3PUZA 1HR0L 3H15A 1PH6A 4JI8L 4K6DA 2V4DA 4JI1Q 3ULJA 1VQNA 4BY1H 1STYA 1WCMH 4JVZA 5G3LD 2ICIA 1VQOA 1KC8C 3UDIA 3MEFA 3HKZE 4X64Q 1SMYD 4IQZA 1PZJD 4EX5A 3NQTA 5CR3A 5IYCH 4P2CB 1JOQA 1HR0Q 1KLUD 1E0BA 4YHHL 2FFKB 2GVBA 2K4KA 4JI8Q 1BXTA 2JJQA 4CDFC 3JAML 2F0NA 2N3SA 3P75A 5ISRA 5E3FA 3J7AV 1IYUA 1HFNA 1STAA 3B6YA 1C0AA 1B9MA 4DXFA 4IALA 4DNRB 3HOUB 3A55A 2QW7A 4AYBB 2L55A 1CKMA 2MO0A 1IKLA 4DXGA 2XWJB 1LO5D 1G51A 3PCOB 3C1EA 3DMUA 3FKIG 4IURA 2B2VA 2LXKA 1PFMA 3I72A 1MD2D 2RCNA 3GTGH 2Q8TA 1SRUA 4LJZC 4UP9A 5ELCA 1I4HA 2DJGC 1TT2A 1I4RA 3E3XA 4KKSA 3EFXD 4DU9A 1HRJA 3FP9A 1U4PA 4IUNA 2VQFL 1GUOA 1SNMA 1OXXK 1XTCD 3X3MA 4EGVA 4JI3Q 1QILA 1TWFH 2PI2E 2G9HD 1MHWC 3SGIA 4EQ5A 1A2UA 3I4MH 3A74A 5EPKA 1HNZL 2A8VA 3STBC 3U50C 1FVIA 2H1EA 2E2DC 2BDNA 1V1PA 2EY2A 1PHJA 3NHHA 4A76A 1JJGA 3VR6A 1K3RA 1YIJA 1AZPA 1RIPA 1GUNA 3MTSA 3AMUA 4P71A 3A56A 3FKIB 5IYBG 3TQYA 1K0RA 2PPBC 5IYDG 3L7ZC 3Q8DA 5C4JH 4DAVA 4K14A 1JMCA 3K57A 4B9XA 3PIO3 3VDYA 2IHEA 2K5HA 4IOAA 2RBMA 1HR0W 2UXCL 1WTHA 4PNYA 4DAYA 2M00A 4GKKL 2D9UA 5D3DA 2X6LA 2RSOA 1FJGL 1N32L 1TS3A 1PH3A 5K5PA 3PV0A 5FO8B 4NXNL 5A2QL 1PXUA 2B2UA 4ME5A 3PO3G 2XTIA 3I7FA 1GUGA 4DV1L 5TSSA 2CWAA 2UXCQ 2HDLA 4OWXB 1D5ZC 5EQ0A 2Z4HA 3D6WA 1U9RA 4JK1C 4KY6A 1EWCA 4BY1G 5C44H 1FJGQ 3ZJYC 1WYDA 2HCCA 3GTOH 4CJ2C 3C3LA 1JQYD 1NE3A 4LF4Q 3HOYG 3NSWA 4NXNQ 4GN5A 4DR4Q 3L2PA 4A3EH 1Q7YC 4A3KH 2DUDA 3GV6A 4ZUJA 4DV2L 4FF3A 4DV1Q 3TRZA 4RAUC 2H5XA 1BCPB 3PIOA 2XWBB 1U4LA 3K7AB 1VQ4A 5LL6X 2J4XA 1EWHA 3I70A 4ALPA 1JC7A 1Q90A 3RMHA 5FKAC 4KV6A 3V05A 1ENAA 1WTOA 2AQ1B 4DV2Q 4K5WA 4DF7A 1H9SA 2UUBL 1GUWA 1VQDA 3AQQA 3GTJB 3PO3B 4DR6Q 1N33Q 3TS2A 4Y7NB 4C2MB 2HT1A 1JT8A 1TWAH 2AMCB 2JN4A 2K03A 1SSOA 2HIXA 4ID6A 4ZK9B 4BY1B 2UUBQ 1VQJA 3S1NB 2PNRC 4F7XA 1ENFA 4FDBA 4J15A 2KCTA 3E9HA 5I9OA 3FHWA 3U9SA 2E2IH 4LNQA 4C1NK 4N9TA 1E22A 4A3BH 2QCPX 2NWGA 3ITPA 4JI2Q 1B3QA 2BOSA 5ELOA 2A6HC 3PO2H 4RHSA 4K8JA 1OXTA 3M4OB 2AHOB 1PVOA 2XIWA 4A3GG 2ALYB 3CMAA 4DAPA 4B3RL 1RTNA 1SE3A 4C1NI 4JBJA 3LWUA 4CDCC 1A62A 2YV5A 3GTGB 2EXZA 1ONLA 3DXJC 2MFIA 3MVVA 1HZCA 2K50A 1K8AC 1ZYRC 4FF1A 4GNXC 2A74C 3D31A 1TWFB 3NWSA 5C0XI 4B3RQ 1B3AA 1B2TA 4ZKBB 1L1OA 4IPCA 4QCLA 1QWYA 3T53B 3I4MB 1EY9A 4RCNA 2DNCA 3M7GA 1TWGB 2Y0SE 3BJUA 3PGZA 3EBEA 4X3SA 4DR3L 1Q82C 1UNSA 1FYCA 4XDXA 4NXML 1D2BA 2OQKA 2PYKA 3CXCA 3H0GH 3VR5A 1BOSA 2AQ3B 1XNQL 5C5LA 1YHQA 4A3GB 4M8AA 1C7YA 1B1ZA 3J81i 5C44G 1HUNA 3UDFA 1RD9D 5A35A 4QY7A 3N52A 4JPBW 1VQLA 1CTMA 2D0PA 4A3EG 3E0EA 5C4JB 3UDXA 1WI5A 4DK6C 3K6OA 1NR4A 1LTLA 2PQAA 1XNQQ 2VUMH 3NTHA 1MJEA 3P20A 3KF6B 3GTQB 5ELFA 4HN7A 2B63H 1MI2A 2NZ1D 3F2CA 1W6KA 3NXWA 3QR8A 2VS1A 4F8MA 1D5MC 1YBYA 3RLOA 1EOTA 3BVMA 2WINB 3MFYA 1Q81C 1SNDA 4DGZA 2ZJQA 3NP8A 3V96A 1IBKL 5K36G 1DXMA 2OWOA 2Q8RE 4H0LC 2R3ZA 4IUPA 2KCMA 3OOCA 5AFWA 1EYGA 1IL8A 1F9RA 2F52A 4R8IA 3M9BA 3SVMA 5C44B 1MSHA 3P1HA 3GTOB 2O5IC 2G9DA 4QL5A 4UAIA 5IWAL 5AJ3L 4ZUIA 2FMMA 1GKHA 4KKUA 4A3EB 3K81C 2B2VC 3A7LA 3SK6A 2KEEA 1ESFA 5C0XJ 3J81E 1B7YB 2BDOA 2RHSB 1KDAA 1SYCA 4JI5L 2ZJRA 1WOCA 2UXBQ 2SDFA 3ULPA 5BR8L 1L2FA 4X6AH 5AJ3Q 1VQEA 5C4XG 2XVSA 4OO1I 4EQNA 3P7JA 4JOIA 5JJZA 4A4IA 3RZOH 3FEWX 3TZDA 3J80c 1G6PA 4BBRG 1PH8A 4K0KL 4RKBA 1Z6HA 2B2YC 2F3VA 2PMZB 4JI5Q 5C4ZA 1JOOA 5FLXL 3GTKH 3F1ZA 3ND9A 3OW7A 1TWAB 1R9TB 1CK1A 3S9WA 3NBIA 5D14A 4POFA 4DV4L 3KLWA 1LM0A 1JR0D 3CC2A 4FXDA 1PTOD 3BG3A 1PTOH 3I4LA 4ZQ3A 4F88A 2F0KA 4PMCA 4K0KQ 1F9QA 2R93H 3HOVH 3KLSX 2X6GA 2Z8LA 1P8LA 2WACA 4OONA 4HCSA 2K5VA 3KDFA 3QOJA 4IUQA 3AFPA 3KF8A 2JEAI 4JI4Q 4DV4Q 1UAPA 2E2IB 1X3PA 4O0AA 4CJ0B 3R2TA 4LF5L 2PNHA 4KD3A 5KNDA 5M3FG 2NVXH 1I3QH 1R4PB 1UEBA 2PCFB 3J7ZC 2OXPA 4PV1C 4MTNA 4BBRB 2K75A 4V0BA 1E2WA 1DOLA 1D1KA 3BDCA 5JAVA 4LF5Q 4A3CH 4IZ8A 1DD2A 3AU7A 3DUZA 1RJTA 4DR2L 1OXVA 2B2UC 2UU9L 3VA7A 1YNXA 3EA6A 3OIPA 1CSPA 3FPUB 1H9JA 1G6ZA 1CUKA 2L15A 1S5FD 4XQNA 3FMCA 3HEJA 2VUMG 4LWCA 1SYFA 5IT9c 1HQRD 3HOUH 4L5TA 2HQEA 4DR2Q 3CCVA 1LUZA 4KI0A 3ERSX 2B63G 4IUVA 1EY6A 4G7ZC 1CT1D 2B2TA 1IL2A 1JE5A 2EDGA 2I07B 1KIXA 5M3FB 2BH8A 3TP7A 2CQOA 2Z6KA 2CW0C 3M4PA 5JVH3 1IBLL 1Q3LA 3G4SA 4DV7L 2NTTA 1PRTD 3D4RA 1WTWA 2F0OA 4WJ3M 3K58A 2CVRA 1J5EL 2QF7A 3H0GB 1Y8OB 3W5OA 2BE5C 4O2DA 2YU9B 2F3IA 1EZ6A 2NZHA 5NUCA 1YJWA 1U4RA 4A3DH 1B9NA 1I4QA 1HNXL 2KECA 1IBLQ 4DV7Q 2F0GA 2EOTA 1MKHA 4B3ML 4F87A 4FXKC 3WWVA 2NTSA 4NDXA 4CDEC 3I91A 5EKLA 3F8TA 2VUMB 2TSSA 2ES2A 4LMQD 3G71A 2H4OA 1HNXQ 4OX9Q 2B63B 1A2TA 3TBIB 1A8VA 3PUXA 2RQXA 5GAGC 5KNBA 3IKJA 2XGTA 2IJ0A 3BYYB 1EYCA 2EVBA 3CKIB 4KN7C 1E24A 3LWEA 5CORA 4B3MQ 2ZJPA 3FKIH 3MA2B 5IIFA 1SAPA 2JQOA 5KNCA 4BXXG 2QDBA 2XN9C 2R92H 1II3A 2VB2X 3QB3A 2VL6A 5C0XG 1M1KC 1AZQA 1I4XA 2WB1E 4TSSA 2JA6G 4BBSG 2F0JA 1YVCA 4DUZL 5M5YH 2E2JH 1SNQA 4JI7L 4R4OA 4N9PA 5FO9B 1A15A 2UUAL 1WTVA 3CU7A 1SYDA 3MXPA 1OTCA 1I6HB 1DOMA 3A8JE 2BA0A 4I7ZC 4JYAL 1STGA 1XPUA 2I5MX 3GQBA 3D4WA 2UUAQ 2RDHA 2KENA 1LTBD 3C2PA 3RZOB 2K5DA 5IYBH 4BA2I 4ZAIA 2NN6I 1NMGA 1PZKD 4DA2A 3GTKB 4A3CG 1BCPD 3MAQA 1OXSC 1VQAA 1Z7TA 3Q23A 4NB3A 4HJ9A 2L9HA 3S16H 2WKDA 5C4HA 2JA6B 4BBSB 1QVCA 4RG1A 3SK4A 4L8JA 1X55A 4QUFA 1B44D 1VCIA 3BZCA 4MHEA 2ID0A 3R8BA 3DEOA 4MN3A 1A0IA 2R6GA 5IP7H 5T1IA 1VQCA 3CC4A 3AB9A 3PO3H 1YHBA 2EY5A 3HKZG 1KLGD 2FMCA 2NVXB 1I3QB 3S17H 2GVAA 1FNVA 4HMJA 3QOLA 3DWPA 2IX0A 4CGYB 2E5LQ 3HOYH 3S1NH 1QUQA 4KJNA 3W2DA 1JJCB 2F03A 2GA4B 2PW7A 2VQEL 3OTOQ 2K33A 4A3DG 4QJFA 2LMCB 1RODA 1PYSB 4OIKA 4B08A 4RHRA 5CV8A 1S5BD 4RMFA 4QGUA 4OL7A 4IOCA 3C46A 4G4KA 5CYUA 4TRDA 2QDLA 4TVAB 2JXMB 4OO1G 2F0TA 2RSNA 1VF5C 2B2WA 2NVTB 1W3SA 5JJKA 5IGEA 4RKLA 2O4XA 3M4OH 4CDDC 3RLFA 4DR5L 4YHHQ 4LAAA 1LTSD 4A3FG 2M2LA 1JJ2A 1V1QA 3HKZB 1ESRA 1DJRD 5CV6A 4G57A 2ASBA 4JBKA 2OT2A 2F0HA 1YNJD 1C8CA 1I6VC 1O7LA 1PRTB 2R92G 5E7NA 2XNAC 4DR5Q 1NUCA 1EFID 4JOIC 1RHPA 2ZT9C 2LS01 1UUPA 4CJ1B 1YITA 3HGBA 3BZDB 4A3DB 2M9VA 4TQUS 1OXUA 4QIWE 4R4QA 2EY6A 3R3OA 5CV4A 3FRPB 1HTPA 3MXNB 3URYA 1TWHB 1NY4A 1TWGH 1EEFD 5EBDA 2PQEA 1VQ7A 3WOEA 1GHKA 1U5KA 2VQFQ 2F0EA 2AWOA 3CD6A 1GVPA 1ASYA 1BF4A 4IPGA 2EYOA 5I2XA 3J7AF 2KQ3A 5I4DA 1EQRA 4A3GH 4I7AA 2D5DA 5FLMH 1HNZQ 1GJXA 4KN4C 2LSSA 1VMCA 1WD0A 3BDOA 1S5DD 1UE6A 1CHPD 2ATWA 2R92B 3CAMA 5HY6A 1K0SA 1WTXA 1WJJA 3KYHC 4P75A 2D0OA 4UP7A 1YNNC 2FJ2A 2OTLA 1BCPF 4JI0L 3GTQH 5M5YB 1MIUA 1XTDA 1BQQT 3H6MA 2E2JB 1X54A 1STBA 3KLRA 5M9OA 4EVOA 2EY1A 2RCFA 1PH5A 2K5QA 2JA5G 1I50H 1KL9A 1LTID 1Q46A 1ICWA 5EGTA 3CPFA 1DM0B 1KD1C 5IP7G 4J6HA 3OPOA 1LABA 5E4XA 4I65A 1LLRD 3ICEA 4WRDA 2BA1A 1I4PA 1QB5D 3STBD 4GKKQ 3K5MA 4HJAA 4OIJA 1N32Q 4YIJA 4LF8L 2B2TC 1SE8A 5LHY1 3MC0B 1PDQA 5KGUA 5JEAJ 1PH1A 4PQXA 4ZLTF 4R4CA 1V1OA 3T51B 2Z6KC 5G3LF 1EY8A 2IL8A 4X62L 5GROA 3PF4A 1H9KA 1DGSA 3S16B 1HHVA 2PI2A 3CCUA 1QVFA 2DNEA 2KCNA 2N55A 5IOCA 2IY5B 4APVA 3LX0A 1YJ9A 2K14A 3W1GA 1PYBA 1SNPA 1X3QA 1CQVA 2JA5B 4JV5L 1Y8PB 3S2HH 4X62Q 2Q2IA 3D4DA 2E74C 3BU2A 4P72A 4FP5D 1SFOB 2PZUA 4DR1L 4LF6L 1DOKA 2F0VA 3NTKA 1R9TH 5K36H 4CKEA 1QNKA 5FJ8H 4DV3L 1IYVA 3T56B 3S17B 2WP8J 3A54A 1ICFB 1U0LA 4K5XA 2A19A 3JAMi 2BCOA 4JV5Q 2RDGA 3KJPA 2KHSA 1HXYD 1PFBA 1V8QA 2K52A 3HOYB 3S2DH 1QJOA 2RA4A 3NUCA 1KDCA 5IGCA 4DV3Q 2L11A 2KEDA 2L0CA 1NNXA 4DK3C 4M1UB 2AUJD 1L0WA 1STHA 2K5WA 3J7YW 5C4XH 2EZVA 1KXLA 4RCOA 3C1FA 3G6JB 2A69C 4Z9CB 4BBRH 2NN6G 3U58A 5FLMG 1EUJA 4B3SL 1DYQA 3K8AA 1BKBA 2A6EC 1BBWA 1EU3A 1Q1BA 3HOXG 4RGMA 3CC7A 2NZOA 2Y0SG 2F0FA 4RWSC 4C56C 4GOPB 2AQ2B 3JAME 1L0XB 3HRZC 4B3SQ 3KOJA 1Q86C 1A63A 1FD7D 1V43A 3HS0C 3G7LA 3T1YL 1X9NA 1IW7D 3ZYYX 5M3FH 4R9WA 1E7ZA 1LT6D 5LMUL 1QZGA 4CHTB 1FNWA 2KCCA 4QF4A 2N78A 2B39A 1SBBB 3NEMA 2QEXA 4MIUA 2YU9H 1FL0A 1RTOA 3H94A 1SYBA 3J80L 1UE1A 1I94L 2P5ZX 5JVG3 3A5UA 5LMUQ 3HOXB 2MO1A 2ENBA 4A75A 5LMNW 4DR3Q 4NXMQ 3VR4A 3PMFA 1VQ8A 5KRUA 4JBWA 1K8GA 2Y0SB 4S3SA 4DV0L 2ZM6Q 5JPMC 1I94Q 3RLNA 4XXEA 1JCKB 2EJMA 1KAAA 2KUMA 1J6QA 1K28A 4OWTB 2F0SA 3AEVA 2VB3X 4HSPA 4AIMA 1I50B 4Y52H 2V1CC 3EROA 3I56A 4LW1A 2F0MA 4LUOA 1VQGA 5J1ZA 1H9MA 2B3GA 2B2WC 1JICA 5JEAG 1G2SA 3BVGA 3R93A 5FJ8G 2HD3A 4LF9L 1E1TA 1K83H 2EJGC 2JA8G 3OHXC 1KNAA 1FGUA 1H9RA 1IBML 3OSOA 1NMFA 1PTOC 1LTRD 2WAQE 4MTKA 1IBKQ 3SEBA 2KBNA 3UI2A 1PH9A 1PV4A 1UE5A 2K7VA 1I6HH 1GO3E 1SJED 1BVSA 4LK1C 1R4QB 2RF4A 1IBMQ 4XT3B 4YCVA 2TMPA 5IWAQ 1ILPA 2OF1A 2K1BA 3ER0A 4UY8C 5IT9L 5A2QE 2QILA 3I3CA 1CSQA 3S2HB 3PUYA 2FXQA 1PZID 1WTQA 2B8FA 1E1OA 1G291 4BXXH 3KF6A 3NBHB 1JB3A 4DV5L 5BR8Q 2J0TD 5KYIA 3W3AA 1ASZA 4RGNA 5C0XH 1RF2D 2JA8B 4BBSH 1JOKA 2JA6H 4PG3A 3CQZH 1SROA 2N88A 2A68C 2DY7A 1SMXA 5HGTA 1EFWA 3S2DB 1X3GA 2K28A 5I6YA 4JCVE 2HCIA 3HZXA 3EJIA 4DV5Q 5LL6S 4IN3A 1XJVA 4FYDA 4LUZA 3CP0A 1D5XC 1K8OA 3F2UA 2UUCL 2F0QA 2Z4IA 2EXDA 4OGQC 2ZTDA 1NBWA 1F9SA 4KHZA 1SE2A 5C4XB 1WVLA 5CC4A 2QA4A 4XQQA 1CI3M 3GV3A 1HZ9A 1X3EA 2EYLA 5GQOA 2PZTA 2VXWA 2UUCQ 2NUCA 3GTPH 1XMQL 4PZ8A 1KNEA 1Y14B 4HIKA 3SE0A 4HJ8A 1XX8A 4KKTA 1VQPA 2LXJA 3Q24A 4KTAA 2I5HA 4HTHA 2E2HH 1LACA 1C4QA 4IFDI 2VZAA 2F0LA 2NVTH 1XMQQ 3T4AC 4LUVA 4FVMA 2QEJC 4IO9A 2F4VL 1JWMD 2UU9Q 1ZEQX 3EVQA 2BH2A 5EAYA 1FR3A 2DGYA 1F77A 4K5VA 1TXYA 3MFGA 1VQIA 1UEAB 4NW2A 4A3MG 1M90C 3CCRA 4K2KA 2OQ0A 4JG2A 1T5XD 1JB7A 2N49A 2WV6D 2F4VQ 1D8LA 1F2MA 4GLVB 1N8RC 1HFGA 3M7NA 1Q8KA 4AH6A 1AE2A 5DEHA 1G91A 5L37A 1T9HA 1EZ8A 4A3JG 1PH4A 3CCJA 4N8FA 2FHTA 1EY5A 1TWHH 2CH4W 2SNSA 4OHJA 1FNUA 4DKAC 1B8AA 2HHHL 2RHQB 1J5EQ 5IP9H 4OO1H 3GTLH 3EN2A 1VS0A 5KIXA 1CKNB 3H3VC 5IGDA 3ERQA 2MNAA 4ABNA 2IX3A 1EQTA 4A3FH 2WIIB 1KRTA 1G2TA 4KJOA 2HQLA 2WB1G 4A3MB 3S14H 4ILWA 1PLFA 4GNXB 4NPSA 4KMUC 2JK8A 4XQJA 4A3IH 3KBXA 2VNUD 4DK1A 2I5LX 4A93H 1M4VA 1TS4A 1BCPC 1K83B 5BN4A 1LTTD 4FO2A 1VF7A 2JYOA 3PSIA 1KTKA 1S40A 3Q22A 3I90A 3MWYW 2CW0D 4A3JB 3E0JA 4IFDJ 2J7ZA 3PIP3 3SK8A 4MNOA 1PTOF 1SEBD 1TWCH 1A3VA 1KQSA 3KBGA 1SDFA 3A0JA 1YEZA 5CV9A 3GDEA 4X66L 4G7HC 4BY7G 2NVQB 2BE5D 2R7FA 2Z1CA 2FINB 1CA6A 4RH6A 3OIQA 5C5MA 4PMWA 1P16A 4LFBL 1Y8NB 4DUZQ 3VYRA 2K32A 4FF4A 4EQPA 4X3UA 3CCEA 4JI7Q 2PO4A 1L1OC 3D3RA 3DM3A 2XRSD 1O7IA 3E9IA 4U68A 4C3JH 2WB1B 3Q0AA 5ELEA 2C35B 1NCVA 3D0FA 4K6LA 2A5HA 1EL0A 4L63B 4GKJL 4FF2A 3O13A 1HZAA 1HA6A 2AUKA 4JYAQ 1IZ6A 4J1MA 1B70B 1SMYC 1EIHA 3HFZB 2NYZD 5ELBA 1ILQA 1TIID 3CQZB 4LF7L 1QOHA 2ZTEA 3PIPA 5D3IB 1EY4A 3BS1A 1CHQD 4JI6L 1PFNA 2EE1A 3E6ZX 5H1SE 3WOFA 1Y1VG 2B29A 1Z47A 2JA5H 2KOLA 3M4QA 3NE5B 2A1AA 1NAPA 4LFCL 4BY7B 1Q1EA 3H09A 2D62A 3E5SA 1SFOH 4XYOA 1S5ED 2KHJA 3CHBD 4P74A 4X3KA 1TKWB 5EKKA 2JA7H 2Z9HA 2O5JC 5FLXE 1NJIC 1SNCA 5EKIA 2IWHA 4LFCQ 1PMRA 4JI1L 3RZDH 3OMGA 1AFPA 5BN3A 1F9PA 5FOBB 3JC66 1PRTF 1CA5A 3GTPB 4NMZA 3KK7A 5C3WA 4H7BA 1O7YA 1WFQA 1QVGA 4C3HH 4UP8A 1MBYA 3T13A 1VQFA 3T16A 4B9WA 2MHVA 1EQVA 4H44C 3IL8A 3VYTA 5IP9G 4AYBE 3L9AX 2E2HB 2F0IA 5I6WA 1SYEA 2C9OA 1F2LA 1BR9A 3TDQA 3VYUA 3LNNA 3KLSA 1Y1VB 3L0OA 1ET6A 2MPMA 2EJFC 2VQEQ 1LT5D 2F0UA 5J3BA 5CMDA 1V1PB 1O78A 2EYMA 1JORA 1K73C 4L5RC 5C3EH 4Q0FA 4GZYC 3TS0A 3K5NA 4YWMA 1Y1WG 5COYA 3KUPA 2LKVA 4B3TL 2E75C 1EWIA 1M8AA 1BBXC 4A3IG 1EIGA 1PFSA 4A93G 4L5SA 5HGQA 3WDNA 1RCVD 2YTYA 2PW5A 4YCUA 1VMPA 4JI3L 4ZRZA 3BZKA 4KY5A 1ML0D 2JE6I 5I2YA 2SEBD 1N9WA 4B3TQ 1XNRL 5EJWA 2CH4A 3A7AB 4H13C 2XRQD 1IXRA 4HMIA 4PMBA 3VR2A 4DAYB 4C3IG 3NK9A 4KY7A 3GTLB 5M3MH 4IUTA 1EIYB 3PF5A 2ZM6L 5IGGA 4X65L 1W6JA 4UPAA 1D1IA 3RUZA 2NN6H 3ND8A 1O80A 3QWNA 1XNRQ 2EPBA 3QIAA 2HIVA 4A3FB 3ULLA 4DAMA 4C3JG 1Y1WB 3HOXH 2B2YA 4WORA 3S14B 4DNTB 4YWLA 2F3WA 3MEHA 3TN2A
chains in the Genus database with same CATH topology
4H02A 2IX1A 5ELNA 3HOVH 2NZOA 4X65Q 2Y0SG 1P8LA 2VY3A 1RL2A 4GOPB 4OONA 4IFDG 1W2BA 1CKNA 2K5VA 3KDFA 4POGA 1QUQB 4LFBQ 4GN3B 3AFPA 4B3SQ 2JEAI 1VQ5A 3KOJA 4JI4Q 1GD7A 4DV4Q 4GLXA 3RN5A 1Q86C 3H3VH 1A63A 1PH7A 4O0AA 4LF5L 4PZ7A 2PNHA 1V43A 4DPGA 3PUWA 4P73A 5M3FG 3T1YL 2NVXH 1X9NA 1I3QH 4DUYQ 2E8GA 1YHAA 4IJHA 4GNXA 5M3FH 1UEBA 3J7ZC 1E7ZA 5M5XH 3M3YH 5LMUL 1QZGA 4GKJQ 4MTNA 1N36L 5IYDH 3JAMc 2N78A 3I2ZA 3G6EA 4DR7Q 3KFUA 4IJLA 3HOZH 2K75A 3OYYA 2Q2HA 3NEMA 1X65A 2QEXA 1YZ6A 4JI0Q 4LF5Q 4A3CH 3RN2A 4PZ6A 2YU9H 2N8NA 1FL0A 4GS3A 4KHPL 4DR2L 3K7AH 1OXVA 2UU9L 4HJ5A 3HKSA 4LF7Q 4GN4B 2JA7G 3A5ZB 1YNXA 3DLLA 1UE1A 1I94L 4JI6Q 1CSPA 3CMEA 3A5UA 5LMUQ 1BBUA 2MO1A 4A75A 1CUKA 1HJPA 5LMNW 2L15A 1N36Q 4YWKA 4DR3Q 5IE8A 4R4TA 4NXMQ 4GLAC 3S1MH 3HOUG 4LF4L 4OXPA 1VQ8A 2Q2TA 4LWCA 2VUMG 1C9OA 4JBWA 5GAHC 1K8GA 5IT9c 4AYBG 1PA6A 2E5LL 4JC0A 3HOUH 4L5TA 4DV0L 4KHPQ 3GTJH 2YYZA 1EIFA 4DR2Q 3CCVA 1LUZA 4KI0A 4GOPC 3ERSX 2B63G 4X64L 4Y7NH 4C2MH 3RLNA 1I94Q 2EIFA 4XTCS 3UE0A 3OTOL 1IL2A 1Z9FA 1E3PA 1JE5A 3I55A 1X3FA 4LF8Q 1J6QA 3PUZA 1KIXA 4OWTB 3H15A 1HR0L 1PH6A 3AEVA 4AIMA 4JI8L 1WCMG 2BH8A 2R7DA 4R4IA 4JI1Q 3ULJA 4Y52H 2CQOA 2Z6KA 1VQNA 3M4PA 1IBLL 4BY1H 2V1CC 1WCMH 3G4SA 5LMNL 4DV7L 3I56A 1VQOA 3I4OA 4LW1A 1KC8C 4WJ3M 4LUOA 3UDIA 3MEFA 1J5EL 1VQGA 3HKZE 4X64Q 2B3GA 5C3EG 5IYCG 3W5OA 4O2DA 5JEAG 2F3IA 4EX5A 2NZHA 5FJ8G 3K80C 1YJWA 3CCLA 4LF9L 4DR6L 5IYCH 1K83H 1E1TA 3CW2C 1HR0Q 1N33L 2JA8G 1V9PA 4YHHL 2GVBA 4A3DH 2K4KA 4JI8Q 4OWWB 1HNXL 2JJQA 1FGUA 2JA8H 1S3OA 1IBLQ 5LMNQ 4DV7Q 3CCMA 1IBML 1NMFA 4BA1I 2N3SA 1MKHA 4B3ML 2R7ZH 2WAQE 4HJ7A 3B6YA 3WWVA 1IBKQ 1C0AA 4A3LH 3GO5A 1QZHA 2JA9A 2KBNA 2OTJA 1PH9A 3F8TA 1PV4A 5GAEC 1UE5A 4DR1Q 4LF6Q 3S15H 2ES2A 1CKMA 5GADC 3G71A 1I6HH 2MO0A 1YJNA 1GO3E 1HNXQ 4OX9Q 1BVSA 1A8VA 3PUXA 1L1OB 1G51A 2RF4A 3PCOB 5GAGC 1N34L 1IBMQ 2XGTA 1X56A 4YCVA 5IWAQ 1UE7A 3GTMH 3FKIG 1HNWL 3ER0A 4UY8C 1E24A 4B3MQ 2LXKA 2ZJPA 2RCNA 3FKIH 3W1BA 3GTGH 3J81c 4JI2L 1SRUA 2AWNA 2JQOA 4UP9A 1CSQA 1VQ6A 5M3MG 4BXXG 3PUYA 1GM5A 2FXQA 1E1OA 1G291 4BXXH 2WFWA 3FP9A 2R92H 2VQFL 3KF6A 3NBHB 1OXXK 4JI3Q 1TWFH 2YTVA 4DV5L 2MQHA 5BR8Q 1N34Q 2PI2E 2VL6A 5C0XG 1M1KC 3I4MG 1HNWQ 2WB1E 3SGIA 4BBSG 4EQ5A 1ASZA 2JA6G 1YVCA 4DUZL 5M5YH 3I4MH 3A74A 2E2JH 4BBSH 2JA6H 4PG3A 4JI7L 3CQZH 1HNZL 1SROA 4R4OA 3STBC 1PH2A 2A8VA 1KRSA 1SMXA 2UUAL 1EFWA 3U50C 1FVIA 1X3GA 5JJIA 2OCEA 1Q12A 4JCVE 4DV5Q 1OTCA 1XJVA 1PHJA 4LUZA 3CP0A 4A76A 3S1NH 1JJGA 1K3RA 2PQAB 3CPWA 1YIJA 1RIPA 2BA0A 4XIGS 2VW9A 2UUCL 4JYAL 4IPHA 1IYJB 2I5MX 1XPUA 2EXDA 2ZTCA 2UUAQ 2QGQA 2ZTDA 1NBWA 4P71A 4KHZA 2KENA 5IYBG 3RNUA 3TQYA 1K0RA 5IYDG 3L7ZC 5IYBH 4BA2I 3Q8DA 1HZ9A 1X3EA 3S1QH 3HOZG 5C4JH 5GQOA 2NN6I 1NMGA 1JMCA 1CKOA 1HZBA 4A3CG 3HOWH 2UUCQ 3GTPH 1XMQL 4PZ8A 1OXSC 1VQAA 1Y14B 4HIKA 3VDYA 4NB3A 4HJ9A 2IHEA 3T1YQ 2K5HA 3S16H 4IOAA 4HJ8A 1HR0W 2UXCL 1QVCA 1VQPA 4RG1A 3NELA 2LXJA 3F2BA 4GKKL 1X55A 3PUVA 2I5HA 1VCIA 2E2HH 1FJGL 1N32L 3BZCA 1PH3A 3UDGA 4IFDI 3PV0A 2ID0A 2VZAA 4NXNL 2NVTH 1XMQQ 3PO3G 1A0IA 2JEBI 2R6GA 2XTIA 4LUVA 4IO9A 5IP7H 2F4VL 1VQCA 1VQMA 3CC4A 2UU9Q 3PO3H 3I7FA 4DV1L 1YHBA 2CWAA 2UXCQ 2BH2A 3HKZG 4OWXB 5EAYA 1EQQA 2DGYA 1TXYA 3S17H 1VQIA 2GVAA 4BY1G 5C44H 4A3MG 3ZJYC 1WYDA 1M90C 1FJGQ 3CCRA 3GTOH 1NE3A 4LF4Q 3HOYG 4NXNQ 2OQ0A 4JG2A 4A3MH 4A3KG 4LFAL 4GN5A 1JB7A 3L2PA 4GOPA 2IX0A 3TREA 2N49A 4A3EH 2IHFA 1Q7YC 3S24A 1QUQA 4DV0Q 2DUDA 3CCSA 4A3KH 2F4VQ 3HOYH 4DV2L 1D8LA 1JJCB 1KAWA 4DV1Q 3TRZA 5JJLA 2H5XA 2WAQG 4GLVB 1N8RC 3PIOA 2VQEL 1Q8KA 3OTOQ 3M7NA 4A3DG 4QJFA 4AH6A 1AE2A 1PYSB 1VQ4A 1T9HA 4A3JG 1PH4A 3CCJA 1NTGA 4ALPA 4LFAQ 4RMFA 4QGUA 4IOCA 4A3JH 2R7ZG 1I5FA 1TWHH 4DKAC 4A3LG 4TVAB 4OO1G 4DV2Q 1B8AA 2AKWB 4QQBX 2HHHL 2RHQB 1J5EQ 5IP9H 1W3SA 2UUBL 5JJKA 1VQDA 3GTLH 3AQQA 3EN2A 1VS0A 4DV6L 2NVQH 4LF9Q 3M4OH 4DR6Q 4AQYL 4DR5L 3RLFA 1CKNB 3KDFB 4YHHQ 1N33Q 2HT1A 3TS2A 1JT8A 1TWAH 2AMCB 3UE1A 3KF8B 3NENA 4A3FG 1XPRA 1JJ2A 1V1QA 2MNAA 2UXBL 2HIXA 4A3FH 1KRTA 2HQLA 2PMZE 2WB1G 2Z0SA 4JBKA 2ASBA 4DR4L 3RR5A 2E5LQ 3S14H 2UUBQ 1VQJA 2NVYH 4GNXB 4DV6Q 5DLQE 2R92G 4NPSA 5E7NA 2JK8A 3J81j 4AQYQ 4FDBA 4DR5Q 4A3IH 4DR7L 4JOIC 2VNUD 4J15A 2KCTA 3J7A5 2I5LX 4A93H 1YITA 3E9HA 2E2IH 3AYHB 3FHWA 4TQUS 4LNQA 4A3BG 1OXUA 3PSIA 1S40A 4QIWE 4R4QA 1E22A 4A3BH 1XPOA 3MXNB 4JI2Q 1SLJA 1NY4A 1TWGH 4IFDJ 3PO2G 1VQ7A 4MNOA 3S1RH 5ELOA 1TWCH 1K9MC 1S72A 3PO2H 1U5KA 2VQFQ 1KQSA 2AWOA 3CD6A 1GVPA 3A0JA 1YEZA 3IRBA 3GDEA 4X66L 1ASYA 3I4NH 4IPGA 4BY7G 1D7QA 2IT1A 1OXTA 4BY7H 2R7FA 2CWPA 2AHOB 1PVOA 4PMWA 4A3GG 3CF5A 1YI2A 1P16A 4LFBL 4DUZQ 2ALYB 3CMAA 1EQRA 3CCEA 4A3GH 4B3RL 5FLMH 4JI4L 1HNZQ 4JI7Q 4JBJA 5IY0A 1L1OC 1A62A 3DM3A 2LSSA 2YV5A 1O7IA 3E9IA 4C3JH 2MFIA 1HZCA 2C35B 1UE6A 2K50A 3D0FA 1K8AC 2ATWA 3HOWG 4GNXC 4GKJL 3CAMA 1HZAA 3D31A 5HY6A 4JYAQ 5C0XI 1WJJA 3K7UC 3KYHC 1IZ6A 4B3RQ 2K5NA 4P75A 1B70B 1L1OA 2D0OA 4UP7A 2OTLA 2EQSA 4IPCA 4JI0L 3HFZB 3GTQH 1MIUA 1XTDA 1X54A 4KLKA 4LF7L 2ZTEA 3PIPA 2Y0SE 4JI6L 1PH5A 2JA5G 1I50H 1KL9A 3BJUA 1Q46A 1VQKA 4YY3L 5H1SE 2YTXA 1Y1VG 2B29A 1Z47A 3PGZA 3CPFA 3EBEA 2JA5H 1KD1C 4DR3L 3H3VI 1Q82C 3M4QA 3H0GG 1Y1VH 2A1AA 5IP7G 4NXML 2OQKA 4LFCL 1Q1EA 3CXCA 3H0GH 2D62A 1SFOH 1XNQL 1YHQA 1LYLA 2KHJA 1SN8A 4P74A 4HIMA 1C7YA 3ICEA 2BA1A 3J81i 3STBD 4JBMA 5C44G 4GKKQ 4ME3A 3J80i 3UDFA 4HJAA 2JA7H 3U4ZA 4QY7A 4YY3Q 1VQLA 1N32Q 4DR4Q 2D0PA 1NJIC 4A3EG 4LF8L 1UWVA 1SE8A 4DNIA 3E0EA 4LFCQ 1PH1A 4JI1L 5JEAJ 3UDXA 3RZDH 1WI5A 4DK6C 3F2DA 4K0KQ 1VQBA 3GD7A 3JC66 4R4CA 2UXDL 1LTLA 2PQAA 2Z6KC 1XNQQ 2VUMH 4X62L 5GROA 3PF4A 1KHIA 1X6OA 1MJEA 3KF6B 3T1HL 3G48A 1DGSA 2B63H 1WFQA 1QVGA 4C3HH 3EIVA 4UP8A 2PI2A 5FLXc 1VQFA 3CCUA 1QVFA 1HH2P 3F2CA 2IY5B 4APVA 2VS1A 2CFMA 1YJ9A 2K14A 1YBYA 3RLOA 3W1GA 1PYBA 1Q81C 2I0QA 5IP9G 4AYBE 4YCWA 4HIOA 2UXDQ 4JV5L 1AH9A 3S2HH 3L0OA 2ZJQA 3LGJA 4X62Q 2Q2IA 1SR3A 3K0XA 2VQEQ 3BU2A 1IBKL 4WJ4A 4P72A 5J3BA 3T1HQ 4MZ9A 5K36G 2OWOA 4DR1L 1AE3A 1K73C 4L5RC 4LF6L 1R9TH 5C3EH 2GN5A 2KCMA 1EYGA 4DV3L 5FJ8H 3TS0A 2WP8J 2KHIA 4OX9L 2F52A 4YWMA 3M9BA 1Y1WG 1U0LA 2A19A 3JAMi 3KJOA 4QL5A 4JV5Q 5IWAL 5AJ3L 3KJPA 4HIDA 1Y1WH 2HHHQ 4B3TL 3CCQA 1GKHA 1EWIA 2K52A 3K81C 3S2DH 1VQ9A 4A3IG 5C0XJ 3U4VA 1PFSA 1B7YB 2CCZA 4A93G 4L5SA 5HGQA 2RHSB 2YTYA 4JI5L 4DV3Q 2ZJRA 1WOCA 2CKZB 4YCUA 2UXBQ 4JI3L 3ULPA 3M85A 3BZKA 4R1JA 4DK3C 2JE6I 5BR8L 3OW2A 1L2FA 3TEHB 2Q2UA 4X6AH 1H95A 1N9WA 5AJ3Q 1L0WA 4B3TQ 1XNRL 1VQEA 5C4XG 4OO1I 4JOIA 5C4XH 1IXRA 1KXLA 4DAYB 4A4IA 3I4NG 3RZOH 3J80c 1XMOL 1G6PA 4BBRG 1PH8A 3AFQA 4K0KL 5M3MH 1EIYB 4C3IH 3PF5A 4JI5Q 2ZM6L 4BBRH 2NN6G 4X65L 3GTKH 3F1ZA 4UPAA 3U58A 4L5QA 5FLMG 1EUJA 1XNRQ 4POFA 4B3SL 3K8AA 4DV4L 1VQHA 1BKBA 2HIVA 3KLWA 1BBWA 1MJCA 1LM0A 1Q1BA 3ULLA 3HOXG 4DAMA 1EOVA 3CC2A 4IPDA 3HOXH 1XMOQ 2R93G 5M5WH 3CC7A 3HOVG 4YWLA 4X66Q 4DUYL 2QA4A 2R93H 2ZM6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  2IX1 A;  5ELN A;  3HOV H;  2NZO A;  4X65 Q;  2Y0S G;  1P8L A;  2VY3 A;  1RL2 A;  4GOP B;  4OON A;  4IFD G;  1W2B A;  1CKN A;  2K5V A;  3KDF A;  4POG A;  1QUQ B;  4LFB Q;  4GN3 B;  3AFP A;  4B3S Q;  2JEA I;  1VQ5 A;  3KOJ A;  4JI4 Q;  1GD7 A;  4DV4 Q;  4GLX A;  3RN5 A;  1Q86 C;  3H3V H;  1A63 A;  1PH7 A;  4O0A A;  4LF5 L;  4PZ7 A;  2PNH A;  1V43 A;  4DPG A;  3PUW A;  4P73 A;  5M3F G;  3T1Y L;  2NVX H;  1X9N A;  1I3Q H;  4DUY Q;  2E8G A;  1YHA A;  4IJH A;  4GNX A;  5M3F H;  1UEB A;  3J7Z C;  1E7Z A;  5M5X H;  3M3Y H;  5LMU L;  1QZG A;  4GKJ Q;  4MTN A;  1N36 L;  5IYD H;  3JAM c;  2N78 A;  3I2Z A;  3G6E A;  4DR7 Q;  3KFU A;  4IJL A;  3HOZ H;  2K75 A;  3OYY A;  2Q2H A;  3NEM A;  1X65 A;  2QEX A;  1YZ6 A;  4JI0 Q;  4LF5 Q;  4A3C H;  3RN2 A;  4PZ6 A;  2YU9 H;  2N8N A;  1FL0 A;  4GS3 A;  4KHP L;  4DR2 L;  3K7A H;  1OXV A;  2UU9 L;  4HJ5 A;  3HKS A;  4LF7 Q;  4GN4 B;  2JA7 G;  3A5Z B;  1YNX A;  3DLL A;  1UE1 A;  1I94 L;  4JI6 Q;  1CSP A;  3CME A;  3A5U A;  5LMU Q;  1BBU A;  2MO1 A;  4A75 A;  1CUK A;  1HJP A;  5LMN W;  2L15 A;  1N36 Q;  4YWK A;  4DR3 Q;  5IE8 A;  4R4T A;  4NXM Q;  4GLA C;  3S1M H;  3HOU G;  4LF4 L;  4OXP A;  1VQ8 A;  2Q2T A;  4LWC A;  2VUM G;  1C9O A;  4JBW A;  5GAH C;  1K8G A;  5IT9 c;  4AYB G;  1PA6 A;  2E5L L;  4JC0 A;  3HOU H;  4L5T A;  4DV0 L;  4KHP Q;  3GTJ H;  2YYZ A;  1EIF A;  4DR2 Q;  3CCV A;  1LUZ A;  4KI0 A;  4GOP C;  3ERS X;  2B63 G;  4X64 L;  4Y7N H;  4C2M H;  3RLN A;  1I94 Q;  2EIF A;  4XTC S;  3UE0 A;  3OTO L;  1IL2 A;  1Z9F A;  1E3P A;  1JE5 A;  3I55 A;  1X3F A;  4LF8 Q;  1J6Q A;  3PUZ A;  1KIX A;  4OWT B;  3H15 A;  1HR0 L;  1PH6 A;  3AEV A;  4AIM A;  4JI8 L;  1WCM G;  2BH8 A;  2R7D A;  4R4I A;  4JI1 Q;  3ULJ A;  4Y52 H;  2CQO A;  2Z6K A;  1VQN A;  3M4P A;  1IBL L;  4BY1 H;  2V1C C;  1WCM H;  3G4S A;  5LMN L;  4DV7 L;  3I56 A;  1VQO A;  3I4O A;  4LW1 A;  1KC8 C;  4WJ3 M;  4LUO A;  3UDI A;  3MEF A;  1J5E L;  1VQG A;  3HKZ E;  4X64 Q;  2B3G A;  5C3E G;  5IYC G;  3W5O A;  4O2D A;  5JEA G;  2F3I A;  4EX5 A;  2NZH A;  5FJ8 G;  3K80 C;  1YJW A;  3CCL A;  4LF9 L;  4DR6 L;  5IYC H;  1K83 H;  1E1T A;  3CW2 C;  1HR0 Q;  1N33 L;  2JA8 G;  1V9P A;  4YHH L;  2GVB A;  4A3D H;  2K4K A;  4JI8 Q;  4OWW B;  1HNX L;  2JJQ A;  1FGU A;  2JA8 H;  1S3O A;  1IBL Q;  5LMN Q;  4DV7 Q;  3CCM A;  1IBM L;  1NMF A;  4BA1 I;  2N3S A;  1MKH A;  4B3M L;  2R7Z H;  2WAQ E;  4HJ7 A;  3B6Y A;  3WWV A;  1IBK Q;  1C0A A;  4A3L H;  3GO5 A;  1QZH A;  2JA9 A;  2KBN A;  2OTJ A;  1PH9 A;  3F8T A;  1PV4 A;  5GAE C;  1UE5 A;  4DR1 Q;  4LF6 Q;  3S15 H;  2ES2 A;  1CKM A;  5GAD C;  3G71 A;  1I6H H;  2MO0 A;  1YJN A;  1GO3 E;  1HNX Q;  4OX9 Q;  1BVS A;  1A8V A;  3PUX A;  1L1O B;  1G51 A;  2RF4 A;  3PCO B;  5GAG C;  1N34 L;  1IBM Q;  2XGT A;  1X56 A;  4YCV A;  5IWA Q;  1UE7 A;  3GTM H;  3FKI G;  1HNW L;  3ER0 A;  4UY8 C;  1E24 A;  4B3M Q;  2LXK A;  2ZJP A;  2RCN A;  3FKI H;  3W1B A;  3GTG H;  3J81 c;  4JI2 L;  1SRU A;  2AWN A;  2JQO A;  4UP9 A;  1CSQ A;  1VQ6 A;  5M3M G;  4BXX G;  3PUY A;  1GM5 A;  2FXQ A;  1E1O A;  1G29 1;  4BXX H;  2WFW A;  3FP9 A;  2R92 H;  2VQF L;  3KF6 A;  3NBH B;  1OXX K;  4JI3 Q;  1TWF H;  2YTV A;  4DV5 L;  2MQH A;  5BR8 Q;  1N34 Q;  2PI2 E;  2VL6 A;  5C0X G;  1M1K C;  3I4M G;  1HNW Q;  2WB1 E;  3SGI A;  4BBS G;  4EQ5 A;  1ASZ A;  2JA6 G;  1YVC A;  4DUZ L;  5M5Y H;  3I4M H;  3A74 A;  2E2J H;  4BBS H;  2JA6 H;  4PG3 A;  4JI7 L;  3CQZ H;  1HNZ L;  1SRO A;  4R4O A;  3STB C;  1PH2 A;  2A8V A;  1KRS A;  1SMX A;  2UUA L;  1EFW A;  3U50 C;  1FVI A;  1X3G A;  5JJI A;  2OCE A;  1Q12 A;  4JCV E;  4DV5 Q;  1OTC A;  1XJV A;  1PHJ A;  4LUZ A;  3CP0 A;  4A76 A;  3S1N H;  1JJG A;  1K3R A;  2PQA B;  3CPW A;  1YIJ A;  1RIP A;  2BA0 A;  4XIG S;  2VW9 A;  2UUC L;  4JYA L;  4IPH A;  1IYJ B;  2I5M X;  1XPU A;  2EXD A;  2ZTC A;  2UUA Q;  2QGQ A;  2ZTD A;  1NBW A;  4P71 A;  4KHZ A;  2KEN A;  5IYB G;  3RNU A;  3TQY A;  1K0R A;  5IYD G;  3L7Z C;  5IYB H;  4BA2 I;  3Q8D A;  1HZ9 A;  1X3E A;  3S1Q H;  3HOZ G;  5C4J H;  5GQO A;  2NN6 I;  1NMG A;  1JMC A;  1CKO A;  1HZB A;  4A3C G;  3HOW H;  2UUC Q;  3GTP H;  1XMQ L;  4PZ8 A;  1OXS C;  1VQA A;  1Y14 B;  4HIK A;  3VDY A;  4NB3 A;  4HJ9 A;  2IHE A;  3T1Y Q;  2K5H A;  3S16 H;  4IOA A;  4HJ8 A;  1HR0 W;  2UXC L;  1QVC A;  1VQP A;  4RG1 A;  3NEL A;  2LXJ A;  3F2B A;  4GKK L;  1X55 A;  3PUV A;  2I5H A;  1VCI A;  2E2H H;  1FJG L;  1N32 L;  3BZC A;  1PH3 A;  3UDG A;  4IFD I;  3PV0 A;  2ID0 A;  2VZA A;  4NXN L;  2NVT H;  1XMQ Q;  3PO3 G;  1A0I A;  2JEB I;  2R6G A;  2XTI A;  4LUV A;  4IO9 A;  5IP7 H;  2F4V L;  1VQC A;  1VQM A;  3CC4 A;  2UU9 Q;  3PO3 H;  3I7F A;  4DV1 L;  1YHB A;  2CWA A;  2UXC Q;  2BH2 A;  3HKZ G;  4OWX B;  5EAY A;  1EQQ A;  2DGY A;  1TXY A;  3S17 H;  1VQI A;  2GVA A;  4BY1 G;  5C44 H;  4A3M G;  3ZJY C;  1WYD A;  1M90 C;  1FJG Q;  3CCR A;  3GTO H;  1NE3 A;  4LF4 Q;  3HOY G;  4NXN Q;  2OQ0 A;  4JG2 A;  4A3M H;  4A3K G;  4LFA L;  4GN5 A;  1JB7 A;  3L2P A;  4GOP A;  2IX0 A;  3TRE A;  2N49 A;  4A3E H;  2IHF A;  1Q7Y C;  3S24 A;  1QUQ A;  4DV0 Q;  2DUD A;  3CCS A;  4A3K H;  2F4V Q;  3HOY H;  4DV2 L;  1D8L A;  1JJC B;  1KAW A;  4DV1 Q;  3TRZ A;  5JJL A;  2H5X A;  2WAQ G;  4GLV B;  1N8R C;  3PIO A;  2VQE L;  1Q8K A;  3OTO Q;  3M7N A;  4A3D G;  4QJF A;  4AH6 A;  1AE2 A;  1PYS B;  1VQ4 A;  1T9H A;  4A3J G;  1PH4 A;  3CCJ A;  1NTG A;  4ALP A;  4LFA Q;  4RMF A;  4QGU A;  4IOC A;  4A3J H;  2R7Z G;  1I5F A;  1TWH H;  4DKA C;  4A3L G;  4TVA B;  4OO1 G;  4DV2 Q;  1B8A A;  2AKW B;  4QQB X;  2HHH L;  2RHQ B;  1J5E Q;  5IP9 H;  1W3S A;  2UUB L;  5JJK A;  1VQD A;  3GTL H;  3AQQ A;  3EN2 A;  1VS0 A;  4DV6 L;  2NVQ H;  4LF9 Q;  3M4O H;  4DR6 Q;  4AQY L;  4DR5 L;  3RLF A;  1CKN B;  3KDF B;  4YHH Q;  1N33 Q;  2HT1 A;  3TS2 A;  1JT8 A;  1TWA H;  2AMC B;  3UE1 A;  3KF8 B;  3NEN A;  4A3F G;  1XPR A;  1JJ2 A;  1V1Q A;  2MNA A;  2UXB L;  2HIX A;  4A3F H;  1KRT A;  2HQL A;  2PMZ E;  2WB1 G;  2Z0S A;  4JBK A;  2ASB A;  4DR4 L;  3RR5 A;  2E5L Q;  3S14 H;  2UUB Q;  1VQJ A;  2NVY H;  4GNX B;  4DV6 Q;  5DLQ E;  2R92 G;  4NPS A;  5E7N A;  2JK8 A;  3J81 j;  4AQY Q;  4FDB A;  4DR5 Q;  4A3I H;  4DR7 L;  4JOI C;  2VNU D;  4J15 A;  2KCT A;  3J7A 5;  2I5L X;  4A93 H;  1YIT A;  3E9H A;  2E2I H;  3AYH B;  3FHW A;  4TQU S;  4LNQ A;  4A3B G;  1OXU A;  3PSI A;  1S40 A;  4QIW E;  4R4Q A;  1E22 A;  4A3B H;  1XPO A;  3MXN B;  4JI2 Q;  1SLJ A;  1NY4 A;  1TWG H;  4IFD J;  3PO2 G;  1VQ7 A;  4MNO A;  3S1R H;  5ELO A;  1TWC H;  1K9M C;  1S72 A;  3PO2 H;  1U5K A;  2VQF Q;  1KQS A;  2AWO A;  3CD6 A;  1GVP A;  3A0J A;  1YEZ A;  3IRB A;  3GDE A;  4X66 L;  1ASY A;  3I4N H;  4IPG A;  4BY7 G;  1D7Q A;  2IT1 A;  1OXT A;  4BY7 H;  2R7F A;  2CWP A;  2AHO B;  1PVO A;  4PMW A;  4A3G G;  3CF5 A;  1YI2 A;  1P16 A;  4LFB L;  4DUZ Q;  2ALY B;  3CMA A;  1EQR A;  3CCE A;  4A3G H;  4B3R L;  5FLM H;  4JI4 L;  1HNZ Q;  4JI7 Q;  4JBJ A;  5IY0 A;  1L1O C;  1A62 A;  3DM3 A;  2LSS A;  2YV5 A;  1O7I A;  3E9I A;  4C3J H;  2MFI A;  1HZC A;  2C35 B;  1UE6 A;  2K50 A;  3D0F A;  1K8A C;  2ATW A;  3HOW G;  4GNX C;  4GKJ L;  3CAM A;  1HZA A;  3D31 A;  5HY6 A;  4JYA Q;  5C0X I;  1WJJ A;  3K7U C;  3KYH C;  1IZ6 A;  4B3R Q;  2K5N A;  4P75 A;  1B70 B;  1L1O A;  2D0O A;  4UP7 A;  2OTL A;  2EQS A;  4IPC A;  4JI0 L;  3HFZ B;  3GTQ H;  1MIU A;  1XTD A;  1X54 A;  4KLK A;  4LF7 L;  2ZTE A;  3PIP A;  2Y0S E;  4JI6 L;  1PH5 A;  2JA5 G;  1I50 H;  1KL9 A;  3BJU A;  1Q46 A;  1VQK A;  4YY3 L;  5H1S E;  2YTX A;  1Y1V G;  2B29 A;  1Z47 A;  3PGZ A;  3CPF A;  3EBE A;  2JA5 H;  1KD1 C;  4DR3 L;  3H3V I;  1Q82 C;  3M4Q A;  3H0G G;  1Y1V H;  2A1A A;  5IP7 G;  4NXM L;  2OQK A;  4LFC L;  1Q1E A;  3CXC A;  3H0G H;  2D62 A;  1SFO H;  1XNQ L;  1YHQ A;  1LYL A;  2KHJ A;  1SN8 A;  4P74 A;  4HIM A;  1C7Y A;  3ICE A;  2BA1 A;  3J81 i;  3STB D;  4JBM A;  5C44 G;  4GKK Q;  4ME3 A;  3J80 i;  3UDF A;  4HJA A;  2JA7 H;  3U4Z A;  4QY7 A;  4YY3 Q;  1VQL A;  1N32 Q;  4DR4 Q;  2D0P A;  1NJI C;  4A3E G;  4LF8 L;  1UWV A;  1SE8 A;  4DNI A;  3E0E A;  4LFC Q;  1PH1 A;  4JI1 L;  5JEA J;  3UDX A;  3RZD H;  1WI5 A;  4DK6 C;  3F2D A;  4K0K Q;  1VQB A;  3GD7 A;  3JC6 6;  4R4C A;  2UXD L;  1LTL A;  2PQA A;  2Z6K C;  1XNQ Q;  2VUM H;  4X62 L;  5GRO A;  3PF4 A;  1KHI A;  1X6O A;  1MJE A;  3KF6 B;  3T1H L;  3G48 A;  1DGS A;  2B63 H;  1WFQ A;  1QVG A;  4C3H H;  3EIV A;  4UP8 A;  2PI2 A;  5FLX c;  1VQF A;  3CCU A;  1QVF A;  1HH2 P;  3F2C A;  2IY5 B;  4APV A;  2VS1 A;  2CFM A;  1YJ9 A;  2K14 A;  1YBY A;  3RLO A;  3W1G A;  1PYB A;  1Q81 C;  2I0Q A;  5IP9 G;  4AYB E;  4YCW A;  4HIO A;  2UXD Q;  4JV5 L;  1AH9 A;  3S2H H;  3L0O A;  2ZJQ A;  3LGJ A;  4X62 Q;  2Q2I A;  1SR3 A;  3K0X A;  2VQE Q;  3BU2 A;  1IBK L;  4WJ4 A;  4P72 A;  5J3B A;  3T1H Q;  4MZ9 A;  5K36 G;  2OWO A;  4DR1 L;  1AE3 A;  1K73 C;  4L5R C;  4LF6 L;  1R9T H;  5C3E H;  2GN5 A;  2KCM A;  1EYG A;  4DV3 L;  5FJ8 H;  3TS0 A;  2WP8 J;  2KHI A;  4OX9 L;  2F52 A;  4YWM A;  3M9B A;  1Y1W G;  1U0L A;  2A19 A;  3JAM i;  3KJO A;  4QL5 A;  4JV5 Q;  5IWA L;  5AJ3 L;  3KJP A;  4HID A;  1Y1W H;  2HHH Q;  4B3T L;  3CCQ A;  1GKH A;  1EWI A;  2K52 A;  3K81 C;  3S2D H;  1VQ9 A;  4A3I G;  5C0X J;  3U4V A;  1PFS A;  1B7Y B;  2CCZ A;  4A93 G;  4L5S A;  5HGQ A;  2RHS B;  2YTY A;  4JI5 L;  4DV3 Q;  2ZJR A;  1WOC A;  2CKZ B;  4YCU A;  2UXB Q;  4JI3 L;  3ULP A;  3M85 A;  3BZK A;  4R1J A;  4DK3 C;  2JE6 I;  5BR8 L;  3OW2 A;  1L2F A;  3TEH B;  2Q2U A;  4X6A H;  1H95 A;  1N9W A;  5AJ3 Q;  1L0W A;  4B3T Q;  1XNR L;  1VQE A;  5C4X G;  4OO1 I;  4JOI A;  5C4X H;  1IXR A;  1KXL A;  4DAY B;  4A4I A;  3I4N G;  3RZO H;  3J80 c;  1XMO L;  1G6P A;  4BBR G;  1PH8 A;  3AFQ A;  4K0K L;  5M3M H;  1EIY B;  4C3I H;  3PF5 A;  4JI5 Q;  2ZM6 L;  4BBR H;  2NN6 G;  4X65 L;  3GTK H;  3F1Z A;  4UPA A;  3U58 A;  4L5Q A;  5FLM G;  1EUJ A;  1XNR Q;  4POF A;  4B3S L;  3K8A A;  4DV4 L;  1VQH A;  1BKB A;  2HIV A;  3KLW A;  1BBW A;  1MJC A;  1LM0 A;  1Q1B A;  3ULL A;  3HOX G;  4DAM A;  1EOV A;  3CC2 A;  4IPD A;  3HOX H;  1XMO Q;  2R93 G;  5M5W H;  3CC7 A;  3HOV G;  4YWL A;  4X66 Q;  4DUY L;  2QA4 A;  2R93 H;  2ZM6 Q; 
#chains in the Genus database with same CATH topology
 4H02 A;  2IX1 A;  5ELN A;  4WFN 3;  5D65 A;  4X65 Q;  2K01 A;  4FNF A;  4A3I B;  2VY3 A;  1RL2 A;  2MUY A;  4IFD G;  5JOB A;  1W2B A;  4GN3 B;  4A93 B;  4DR7 L;  1VQ5 A;  1B4O A;  1ZKO A;  3TP6 A;  1PH7 A;  4HSV A;  4PZ7 A;  2QKI C;  4P73 A;  1KAB A;  4EQO A;  2E8G A;  5C3X A;  3A8K E;  2NB0 A;  1TWC B;  3JAM c;  2KVM A;  4C3I B;  3I2Z A;  4DR7 Q;  3KFU A;  4IJL A;  4O1N A;  3HOZ H;  1H9S B;  4G7O C;  3FDT A;  4JI0 Q;  2KA7 A;  1SE4 A;  3L3O C;  2N8N A;  3H91 A;  3J81 L;  3N6R A;  4IUU A;  3MXN A;  2JA7 G;  3DLL A;  4K8I A;  3I73 A;  1STE A;  1GUT A;  2F0W A;  4C3J B;  5M5W B;  2L12 A;  3SDZ A;  2C5C A;  4R4T A;  4GLA C;  3S1M H;  4LF4 L;  4OXP A;  4QIW B;  1MSG A;  2L1B A;  4DR4 L;  2RKS A;  1PA6 A;  4JC0 A;  2YYZ A;  4C3H G;  3DWA A;  2EIF A;  3TME A;  1Z9F A;  1TR5 A;  3I55 A;  3SXH A;  1X3F A;  4LF8 Q;  2Z6B A;  4WJW A;  1WCM G;  1TY0 A;  5M5X B;  2R7D A;  4R4I A;  3M3Y B;  4NP5 A;  4J8Q A;  4HCE A;  5LMN L;  1CZW A;  3I4O A;  1F2Z A;  1XYI A;  3U9O A;  2G5D A;  1YNN D;  5C3E G;  5J22 A;  5IYC G;  1LTA D;  1X32 A;  3K80 C;  3CCL A;  4DR6 L;  3CW2 C;  5JEA H;  1N33 L;  1V9P A;  5E4W C;  4OWW B;  3MXG A;  2JA7 B;  2JA8 H;  1S3O A;  2O2L D;  5LMN Q;  3CCM A;  4FXG C;  1VDZ A;  4BA1 I;  1IHZ A;  3RZD B;  2R7Z H;  5DM6 3;  4HJ7 A;  2KJX A;  4A3L H;  2IPK D;  3GO5 A;  2JA9 A;  1QZH A;  2L4N A;  2OTJ A;  1I4G A;  5GAE C;  4DR1 Q;  4LF6 Q;  1JWS D;  3A8I E;  5GAD C;  1AN8 A;  1YJN A;  3MXU A;  4C3H B;  1L1O B;  2HDM A;  1N34 L;  3QG1 A;  1X56 A;  3FPP A;  3GTM H;  1UE7 A;  3V2T A;  3X3N A;  1HNW L;  4HR7 B;  1SXT A;  3K5O A;  3W1B A;  2HUG A;  1WCM B;  4U67 3;  2AWN A;  3J81 c;  1IW7 C;  4JI2 L;  1VQ6 A;  1F2Y A;  3R2I A;  5CV5 A;  5M3M G;  1GM5 A;  1LT3 D;  1EU4 A;  4BS9 A;  2WFW A;  1GUS A;  5ELD A;  4XYQ A;  2YTV A;  1O7Z A;  2MQH A;  5C3E B;  1N34 Q;  1TVX A;  1Y69 U;  3I4M G;  1HNW Q;  3IFD A;  4ULL A;  4L6T B;  1DCZ A;  5HUR A;  1PH2 A;  4R8N A;  1LV9 A;  1KRS A;  1Q8I A;  2K05 A;  4CKB A;  1FGB D;  1HQM C;  1HUM A;  4CBV A;  5JJI A;  1EY7 A;  2OCE A;  1Q12 A;  1S5C D;  3K59 A;  2XSC A;  4O42 A;  1KDB A;  2PQA B;  3CPW A;  2VW9 A;  1CM9 A;  4XIG S;  2DY8 A;  1IYJ B;  4IPH A;  4TKO B;  1HTL D;  2I46 A;  2ICE C;  2ZTC A;  5E1F A;  2QGQ A;  5J39 A;  3DWQ A;  3RNU A;  3CRL C;  3DEP A;  1GXD C;  3S1Q H;  3TSS A;  1E2Z A;  3HOZ G;  5M3M B;  3MHB A;  1EYD A;  5KEE A;  1CKO A;  1HZB A;  3HOW H;  1QE6 A;  1D6E C;  5F2D A;  1OO9 B;  5CV7 A;  3T1Y Q;  1G8Z D;  5CBE E;  2NBF A;  3NEL A;  3F2B A;  2A6H D;  4KK7 A;  4RGO S;  3ONA B;  3PUV A;  1LT4 D;  2A69 D;  3UDG A;  1JE4 A;  1K3B C;  2JEB I;  1VQM A;  1AEX A;  1C48 A;  2A6E D;  4NKL A;  2B8G A;  1EQQ A;  4QB4 A;  3BVZ A;  1GHJ A;  4ODG A;  3S15 H;  1ZYR D;  4A3M H;  4A3K G;  4LFA L;  4GOP A;  3TRE A;  1D7Q A;  2IHF A;  3S24 A;  4DV0 Q;  3CCS A;  3HOZ B;  2MJ8 A;  1KAW A;  5JJL A;  2Q8I B;  3IAY A;  2WAQ G;  1DZ1 A;  5BN5 A;  1E2V A;  3NPP A;  1CQF A;  1DON A;  3CRK C;  4X3T A;  1NTG A;  4LFA Q;  3BYT B;  4A3J H;  5EBC A;  2R7Z G;  1I5F A;  4RGT A;  4A3L G;  2AKW B;  3S1M B;  4QQB X;  1B50 A;  4ZYS A;  4Q5V A;  3OWF A;  3K5L A;  4DV6 L;  2NVQ H;  3PQI A;  4LF9 Q;  5IGB A;  4AQY L;  3KDF B;  3UE1 A;  3KF8 B;  3NEN A;  1XPR A;  3OMC A;  5IGF A;  2UXB L;  3BDL A;  3NTI A;  5EPJ A;  2PMZ E;  2Z0S A;  1RDP D;  5I9P A;  2IW3 A;  3RR5 A;  3HG9 A;  2NVY H;  5DM7 3;  4KD4 A;  4DV6 Q;  4A3K B;  5DLQ E;  1TU2 B;  3J81 j;  4AQY Q;  2WKC A;  1AW7 A;  4V19 0;  3J7A 5;  4BWG B;  2WAQ B;  3AYH B;  4A3B G;  5DAU A;  1XPO A;  2K04 A;  1SLJ A;  3DM1 A;  3PO2 G;  2SNM A;  3S1R H;  5IOD A;  2R7Z B;  1K9M C;  1S72 A;  2F4I A;  1A3T A;  2L5T A;  3IRB A;  3K0Y A;  3I4N H;  2IT1 A;  4BY7 H;  2CWP A;  3D8G A;  1TS5 A;  3CF5 A;  1YI2 A;  2JP1 A;  4JI4 L;  1AP0 A;  3GTM B;  2EYF A;  5IY0 A;  1SNO A;  2F1M A;  1ET9 A;  2ZXO A;  2OEO A;  3D6C A;  5EPL A;  3HOW G;  3TZU A;  2CHB D;  1PRT C;  4OEM B;  1L0Y B;  3K7U C;  2K5N A;  1ENC A;  2EQS A;  4A3B B;  4KLK A;  4QUC A;  1BO0 A;  1LTG D;  1STN A;  1QCB D;  1VQK A;  3PO2 B;  4YY3 L;  2YTX A;  1RKN A;  3NBH A;  3H3V I;  3VYS A;  3H0G G;  1Y1V H;  2CQA A;  2EYH A;  4CKC A;  2MGS A;  1SJH D;  5FK9 C;  1LYL A;  4HIM A;  1SN8 A;  4JBM A;  2A68 D;  1PYW D;  4ME3 A;  3J80 i;  3MZ5 A;  3U4Z A;  1WTP A;  4YY3 Q;  1HPC A;  1UWV A;  2ZXR A;  4DNI A;  3S1Q B;  1TS2 A;  3F2D A;  1XXG A;  2E76 C;  1WTR A;  1VQB A;  3GD7 A;  1EY0 A;  2SOB A;  3HOW B;  2UXD L;  3I8Z A;  5JPN C;  3DHQ A;  3SK5 A;  2D2C C;  1KHI A;  1X6O A;  5DNF A;  3G48 A;  1J9O A;  3IFT A;  3RD4 A;  3T1H L;  3EIV A;  5FLX c;  3GP7 A;  1HH2 P;  1S4Z A;  3FVQ A;  2CFM A;  2DJF C;  2I0Q A;  5CGK A;  4YCW A;  3TP8 A;  4HIO A;  2UXD Q;  1AH9 A;  2A73 B;  1K8M A;  4ZCK A;  3LGJ A;  1SR3 A;  3K0X A;  4WJ4 A;  3T1H Q;  3NWT A;  4MZ9 A;  1AE3 A;  2GN5 A;  1NSN S;  2EYJ A;  4DN4 M;  4RA8 A;  4OX9 L;  2KHI A;  1B53 A;  4DK0 A;  3KJO A;  3S15 B;  2HHH Q;  4HID A;  1Y1W H;  4ZKC B;  2F0D A;  3CCQ A;  1T5E A;  1QNU A;  1VQ9 A;  5KYL A;  3U4V A;  2DN8 A;  3HP3 A;  2CCZ A;  3J80 E;  2PZW A;  1JWU D;  2CKZ B;  4RFB A;  1CFM A;  3OWE B;  3M85 A;  4QMG A;  4R1J A;  4UDU C;  3TEH B;  3OW2 A;  2Q2U A;  1H95 A;  4JW0 A;  4E6I A;  1SYG A;  2ZXP A;  3I4N G;  3QJY A;  1XMO L;  1XWE A;  3NQI A;  1J8I A;  3AFQ A;  1HA5 A;  4OEL B;  4C3I H;  1EYA A;  2RDF A;  4L5Q A;  3QO2 A;  4XT1 B;  1VQH A;  1BNZ A;  1MJC A;  2RVL A;  3SHL A;  1EOV A;  3M4Y A;  4IPD A;  1XMO Q;  2R93 G;  5M5W H;  2EYP A;  2NVY B;  3HOV G;  4X66 Q;  4DUY L;  1MGS A;  1EEI D;  3EQL C;  1ZXT A;  1A3U A;  2K6A A;  4K2L A;  4LFB Q;  2JSO A;  1CKN A;  4POG A;  1QUQ B;  3SR1 A;  4IFD H;  4KHV A;  1A6X A;  1GD7 A;  3RN5 A;  4GLX A;  3H3V H;  4DFA A;  1U4M A;  4DPG A;  3PUW A;  1TY2 A;  4N8X 1;  1GOZ A;  4DUY Q;  4IJH A;  1YHA A;  4GNX A;  2MP1 A;  3S1R B;  3VR3 A;  5M5X H;  3M3Y H;  4GKJ Q;  1WD1 A;  2LFN A;  1N36 L;  3I4N B;  5IYD H;  3G6E A;  4UHV A;  4HED A;  3OYY A;  2Q2H A;  3VA5 A;  1X65 A;  1YZ6 A;  1BDO A;  3RN2 A;  1TQO A;  4PZ6 A;  5IT9 E;  4GS3 A;  4KHP L;  2F0P A;  1CZG A;  3K7A H;  4LF7 Q;  4HJ5 A;  3HKS A;  4GN4 B;  3A5Z B;  4JI6 Q;  3CME A;  1BBU A;  1PTO B;  1HJP A;  1N36 Q;  4YWK A;  1BUV T;  5IE8 A;  2R93 B;  3HOV B;  5FO7 B;  1YNJ C;  1HCZ A;  3HOU G;  1NR2 A;  2Q2T A;  1C9O A;  3Q6S A;  5GAH C;  2X69 A;  2E5L L;  4AYB G;  2R61 A;  4HAE A;  5T1G A;  4KHP Q;  3GTJ H;  1EIF A;  4GOP C;  4X64 L;  1QG7 A;  4C2M H;  4Y7N H;  1IKM A;  4XTC S;  3UE0 A;  3TP5 A;  2LY7 A;  5CBA E;  3OTO L;  1E3P A;  5C6A A;  3PUZ A;  1HR0 L;  3H15 A;  1PH6 A;  4JI8 L;  4K6D A;  2V4D A;  4JI1 Q;  3ULJ A;  1VQN A;  4BY1 H;  1STY A;  1WCM H;  4JVZ A;  5G3L D;  2ICI A;  1VQO A;  1KC8 C;  3UDI A;  3MEF A;  3HKZ E;  4X64 Q;  1SMY D;  4IQZ A;  1PZJ D;  4EX5 A;  3NQT A;  5CR3 A;  5IYC H;  4P2C B;  1JOQ A;  1HR0 Q;  1KLU D;  1E0B A;  4YHH L;  2FFK B;  2GVB A;  2K4K A;  4JI8 Q;  1BXT A;  2JJQ A;  4CDF C;  3JAM L;  2F0N A;  2N3S A;  3P75 A;  5ISR A;  5E3F A;  3J7A V;  1IYU A;  1HFN A;  1STA A;  3B6Y A;  1C0A A;  1B9M A;  4DXF A;  4IAL A;  4DNR B;  3HOU B;  3A55 A;  2QW7 A;  4AYB B;  2L55 A;  1CKM A;  2MO0 A;  1IKL A;  4DXG A;  2XWJ B;  1LO5 D;  1G51 A;  3PCO B;  3C1E A;  3DMU A;  3FKI G;  4IUR A;  2B2V A;  2LXK A;  1PFM A;  3I72 A;  1MD2 D;  2RCN A;  3GTG H;  2Q8T A;  1SRU A;  4LJZ C;  4UP9 A;  5ELC A;  1I4H A;  2DJG C;  1TT2 A;  1I4R A;  3E3X A;  4KKS A;  3EFX D;  4DU9 A;  1HRJ A;  3FP9 A;  1U4P A;  4IUN A;  2VQF L;  1GUO A;  1SNM A;  1OXX K;  1XTC D;  3X3M A;  4EGV A;  4JI3 Q;  1QIL A;  1TWF H;  2PI2 E;  2G9H D;  1MHW C;  3SGI A;  4EQ5 A;  1A2U A;  3I4M H;  3A74 A;  5EPK A;  1HNZ L;  2A8V A;  3STB C;  3U50 C;  1FVI A;  2H1E A;  2E2D C;  2BDN A;  1V1P A;  2EY2 A;  1PHJ A;  3NHH A;  4A76 A;  1JJG A;  3VR6 A;  1K3R A;  1YIJ A;  1AZP A;  1RIP A;  1GUN A;  3MTS A;  3AMU A;  4P71 A;  3A56 A;  3FKI B;  5IYB G;  3TQY A;  1K0R A;  2PPB C;  5IYD G;  3L7Z C;  3Q8D A;  5C4J H;  4DAV A;  4K14 A;  1JMC A;  3K57 A;  4B9X A;  3PIO 3;  3VDY A;  2IHE A;  2K5H A;  4IOA A;  2RBM A;  1HR0 W;  2UXC L;  1WTH A;  4PNY A;  4DAY A;  2M00 A;  4GKK L;  2D9U A;  5D3D A;  2X6L A;  2RSO A;  1FJG L;  1N32 L;  1TS3 A;  1PH3 A;  5K5P A;  3PV0 A;  5FO8 B;  4NXN L;  5A2Q L;  1PXU A;  2B2U A;  4ME5 A;  3PO3 G;  2XTI A;  3I7F A;  1GUG A;  4DV1 L;  5TSS A;  2CWA A;  2UXC Q;  2HDL A;  4OWX B;  1D5Z C;  5EQ0 A;  2Z4H A;  3D6W A;  1U9R A;  4JK1 C;  4KY6 A;  1EWC A;  4BY1 G;  5C44 H;  1FJG Q;  3ZJY C;  1WYD A;  2HCC A;  3GTO H;  4CJ2 C;  3C3L A;  1JQY D;  1NE3 A;  4LF4 Q;  3HOY G;  3NSW A;  4NXN Q;  4GN5 A;  4DR4 Q;  3L2P A;  4A3E H;  1Q7Y C;  4A3K H;  2DUD A;  3GV6 A;  4ZUJ A;  4DV2 L;  4FF3 A;  4DV1 Q;  3TRZ A;  4RAU C;  2H5X A;  1BCP B;  3PIO A;  2XWB B;  1U4L A;  3K7A B;  1VQ4 A;  5LL6 X;  2J4X A;  1EWH A;  3I70 A;  4ALP A;  1JC7 A;  1Q90 A;  3RMH A;  5FKA C;  4KV6 A;  3V05 A;  1ENA A;  1WTO A;  2AQ1 B;  4DV2 Q;  4K5W A;  4DF7 A;  1H9S A;  2UUB L;  1GUW A;  1VQD A;  3AQQ A;  3GTJ B;  3PO3 B;  4DR6 Q;  1N33 Q;  3TS2 A;  4Y7N B;  4C2M B;  2HT1 A;  1JT8 A;  1TWA H;  2AMC B;  2JN4 A;  2K03 A;  1SSO A;  2HIX A;  4ID6 A;  4ZK9 B;  4BY1 B;  2UUB Q;  1VQJ A;  3S1N B;  2PNR C;  4F7X A;  1ENF A;  4FDB A;  4J15 A;  2KCT A;  3E9H A;  5I9O A;  3FHW A;  3U9S A;  2E2I H;  4LNQ A;  4C1N K;  4N9T A;  1E22 A;  4A3B H;  2QCP X;  2NWG A;  3ITP A;  4JI2 Q;  1B3Q A;  2BOS A;  5ELO A;  2A6H C;  3PO2 H;  4RHS A;  4K8J A;  1OXT A;  3M4O B;  2AHO B;  1PVO A;  2XIW A;  4A3G G;  2ALY B;  3CMA A;  4DAP A;  4B3R L;  1RTN A;  1SE3 A;  4C1N I;  4JBJ A;  3LWU A;  4CDC C;  1A62 A;  2YV5 A;  3GTG B;  2EXZ A;  1ONL A;  3DXJ C;  2MFI A;  3MVV A;  1HZC A;  2K50 A;  1K8A C;  1ZYR C;  4FF1 A;  4GNX C;  2A74 C;  3D31 A;  1TWF B;  3NWS A;  5C0X I;  4B3R Q;  1B3A A;  1B2T A;  4ZKB B;  1L1O A;  4IPC A;  4QCL A;  1QWY A;  3T53 B;  3I4M B;  1EY9 A;  4RCN A;  2DNC A;  3M7G A;  1TWG B;  2Y0S E;  3BJU A;  3PGZ A;  3EBE A;  4X3S A;  4DR3 L;  1Q82 C;  1UNS A;  1FYC A;  4XDX A;  4NXM L;  1D2B A;  2OQK A;  2PYK A;  3CXC A;  3H0G H;  3VR5 A;  1BOS A;  2AQ3 B;  1XNQ L;  5C5L A;  1YHQ A;  4A3G B;  4M8A A;  1C7Y A;  1B1Z A;  3J81 i;  5C44 G;  1HUN A;  3UDF A;  1RD9 D;  5A35 A;  4QY7 A;  3N52 A;  4JPB W;  1VQL A;  1CTM A;  2D0P A;  4A3E G;  3E0E A;  5C4J B;  3UDX A;  1WI5 A;  4DK6 C;  3K6O A;  1NR4 A;  1LTL A;  2PQA A;  1XNQ Q;  2VUM H;  3NTH A;  1MJE A;  3P20 A;  3KF6 B;  3GTQ B;  5ELF A;  4HN7 A;  2B63 H;  1MI2 A;  2NZ1 D;  3F2C A;  1W6K A;  3NXW A;  3QR8 A;  2VS1 A;  4F8M A;  1D5M C;  1YBY A;  3RLO A;  1EOT A;  3BVM A;  2WIN B;  3MFY A;  1Q81 C;  1SND A;  4DGZ A;  2ZJQ A;  3NP8 A;  3V96 A;  1IBK L;  5K36 G;  1DXM A;  2OWO A;  2Q8R E;  4H0L C;  2R3Z A;  4IUP A;  2KCM A;  3OOC A;  5AFW A;  1EYG A;  1IL8 A;  1F9R A;  2F52 A;  4R8I A;  3M9B A;  3SVM A;  5C44 B;  1MSH A;  3P1H A;  3GTO B;  2O5I C;  2G9D A;  4QL5 A;  4UAI A;  5IWA L;  5AJ3 L;  4ZUI A;  2FMM A;  1GKH A;  4KKU A;  4A3E B;  3K81 C;  2B2V C;  3A7L A;  3SK6 A;  2KEE A;  1ESF A;  5C0X J;  3J81 E;  1B7Y B;  2BDO A;  2RHS B;  1KDA A;  1SYC A;  4JI5 L;  2ZJR A;  1WOC A;  2UXB Q;  2SDF A;  3ULP A;  5BR8 L;  1L2F A;  4X6A H;  5AJ3 Q;  1VQE A;  5C4X G;  2XVS A;  4OO1 I;  4EQN A;  3P7J A;  4JOI A;  5JJZ A;  4A4I A;  3RZO H;  3FEW X;  3TZD A;  3J80 c;  1G6P A;  4BBR G;  1PH8 A;  4K0K L;  4RKB A;  1Z6H A;  2B2Y C;  2F3V A;  2PMZ B;  4JI5 Q;  5C4Z A;  1JOO A;  5FLX L;  3GTK H;  3F1Z A;  3ND9 A;  3OW7 A;  1TWA B;  1R9T B;  1CK1 A;  3S9W A;  3NBI A;  5D14 A;  4POF A;  4DV4 L;  3KLW A;  1LM0 A;  1JR0 D;  3CC2 A;  4FXD A;  1PTO D;  3BG3 A;  1PTO H;  3I4L A;  4ZQ3 A;  4F88 A;  2F0K A;  4PMC A;  4K0K Q;  1F9Q A;  2R93 H;  3HOV H;  3KLS X;  2X6G A;  2Z8L A;  1P8L A;  2WAC A;  4OON A;  4HCS A;  2K5V A;  3KDF A;  3QOJ A;  4IUQ A;  3AFP A;  3KF8 A;  2JEA I;  4JI4 Q;  4DV4 Q;  1UAP A;  2E2I B;  1X3P A;  4O0A A;  4CJ0 B;  3R2T A;  4LF5 L;  2PNH A;  4KD3 A;  5KND A;  5M3F G;  2NVX H;  1I3Q H;  1R4P B;  1UEB A;  2PCF B;  3J7Z C;  2OXP A;  4PV1 C;  4MTN A;  4BBR B;  2K75 A;  4V0B A;  1E2W A;  1DOL A;  1D1K A;  3BDC A;  5JAV A;  4LF5 Q;  4A3C H;  4IZ8 A;  1DD2 A;  3AU7 A;  3DUZ A;  1RJT A;  4DR2 L;  1OXV A;  2B2U C;  2UU9 L;  3VA7 A;  1YNX A;  3EA6 A;  3OIP A;  1CSP A;  3FPU B;  1H9J A;  1G6Z A;  1CUK A;  2L15 A;  1S5F D;  4XQN A;  3FMC A;  3HEJ A;  2VUM G;  4LWC A;  1SYF A;  5IT9 c;  1HQR D;  3HOU H;  4L5T A;  2HQE A;  4DR2 Q;  3CCV A;  1LUZ A;  4KI0 A;  3ERS X;  2B63 G;  4IUV A;  1EY6 A;  4G7Z C;  1CT1 D;  2B2T A;  1IL2 A;  1JE5 A;  2EDG A;  2I07 B;  1KIX A;  5M3F B;  2BH8 A;  3TP7 A;  2CQO A;  2Z6K A;  2CW0 C;  3M4P A;  5JVH 3;  1IBL L;  1Q3L A;  3G4S A;  4DV7 L;  2NTT A;  1PRT D;  3D4R A;  1WTW A;  2F0O A;  4WJ3 M;  3K58 A;  2CVR A;  1J5E L;  2QF7 A;  3H0G B;  1Y8O B;  3W5O A;  2BE5 C;  4O2D A;  2YU9 B;  2F3I A;  1EZ6 A;  2NZH A;  5NUC A;  1YJW A;  1U4R A;  4A3D H;  1B9N A;  1I4Q A;  1HNX L;  2KEC A;  1IBL Q;  4DV7 Q;  2F0G A;  2EOT A;  1MKH A;  4B3M L;  4F87 A;  4FXK C;  3WWV A;  2NTS A;  4NDX A;  4CDE C;  3I91 A;  5EKL A;  3F8T A;  2VUM B;  2TSS A;  2ES2 A;  4LMQ D;  3G71 A;  2H4O A;  1HNX Q;  4OX9 Q;  2B63 B;  1A2T A;  3TBI B;  1A8V A;  3PUX A;  2RQX A;  5GAG C;  5KNB A;  3IKJ A;  2XGT A;  2IJ0 A;  3BYY B;  1EYC A;  2EVB A;  3CKI B;  4KN7 C;  1E24 A;  3LWE A;  5COR A;  4B3M Q;  2ZJP A;  3FKI H;  3MA2 B;  5IIF A;  1SAP A;  2JQO A;  5KNC A;  4BXX G;  2QDB A;  2XN9 C;  2R92 H;  1II3 A;  2VB2 X;  3QB3 A;  2VL6 A;  5C0X G;  1M1K C;  1AZQ A;  1I4X A;  2WB1 E;  4TSS A;  2JA6 G;  4BBS G;  2F0J A;  1YVC A;  4DUZ L;  5M5Y H;  2E2J H;  1SNQ A;  4JI7 L;  4R4O A;  4N9P A;  5FO9 B;  1A15 A;  2UUA L;  1WTV A;  3CU7 A;  1SYD A;  3MXP A;  1OTC A;  1I6H B;  1DOM A;  3A8J E;  2BA0 A;  4I7Z C;  4JYA L;  1STG A;  1XPU A;  2I5M X;  3GQB A;  3D4W A;  2UUA Q;  2RDH A;  2KEN A;  1LTB D;  3C2P A;  3RZO B;  2K5D A;  5IYB H;  4BA2 I;  4ZAI A;  2NN6 I;  1NMG A;  1PZK D;  4DA2 A;  3GTK B;  4A3C G;  1BCP D;  3MAQ A;  1OXS C;  1VQA A;  1Z7T A;  3Q23 A;  4NB3 A;  4HJ9 A;  2L9H A;  3S16 H;  2WKD A;  5C4H A;  2JA6 B;  4BBS B;  1QVC A;  4RG1 A;  3SK4 A;  4L8J A;  1X55 A;  4QUF A;  1B44 D;  1VCI A;  3BZC A;  4MHE A;  2ID0 A;  3R8B A;  3DEO A;  4MN3 A;  1A0I A;  2R6G A;  5IP7 H;  5T1I A;  1VQC A;  3CC4 A;  3AB9 A;  3PO3 H;  1YHB A;  2EY5 A;  3HKZ G;  1KLG D;  2FMC A;  2NVX B;  1I3Q B;  3S17 H;  2GVA A;  1FNV A;  4HMJ A;  3QOL A;  3DWP A;  2IX0 A;  4CGY B;  2E5L Q;  3HOY H;  3S1N H;  1QUQ A;  4KJN A;  3W2D A;  1JJC B;  2F03 A;  2GA4 B;  2PW7 A;  2VQE L;  3OTO Q;  2K33 A;  4A3D G;  4QJF A;  2LMC B;  1ROD A;  1PYS B;  4OIK A;  4B08 A;  4RHR A;  5CV8 A;  1S5B D;  4RMF A;  4QGU A;  4OL7 A;  4IOC A;  3C46 A;  4G4K A;  5CYU A;  4TRD A;  2QDL A;  4TVA B;  2JXM B;  4OO1 G;  2F0T A;  2RSN A;  1VF5 C;  2B2W A;  2NVT B;  1W3S A;  5JJK A;  5IGE A;  4RKL A;  2O4X A;  3M4O H;  4CDD C;  3RLF A;  4DR5 L;  4YHH Q;  4LAA A;  1LTS D;  4A3F G;  2M2L A;  1JJ2 A;  1V1Q A;  3HKZ B;  1ESR A;  1DJR D;  5CV6 A;  4G57 A;  2ASB A;  4JBK A;  2OT2 A;  2F0H A;  1YNJ D;  1C8C A;  1I6V C;  1O7L A;  1PRT B;  2R92 G;  5E7N A;  2XNA C;  4DR5 Q;  1NUC A;  1EFI D;  4JOI C;  1RHP A;  2ZT9 C;  2LS0 1;  1UUP A;  4CJ1 B;  1YIT A;  3HGB A;  3BZD B;  4A3D B;  2M9V A;  4TQU S;  1OXU A;  4QIW E;  4R4Q A;  2EY6 A;  3R3O A;  5CV4 A;  3FRP B;  1HTP A;  3MXN B;  3URY A;  1TWH B;  1NY4 A;  1TWG H;  1EEF D;  5EBD A;  2PQE A;  1VQ7 A;  3WOE A;  1GHK A;  1U5K A;  2VQF Q;  2F0E A;  2AWO A;  3CD6 A;  1GVP A;  1ASY A;  1BF4 A;  4IPG A;  2EYO A;  5I2X A;  3J7A F;  2KQ3 A;  5I4D A;  1EQR A;  4A3G H;  4I7A A;  2D5D A;  5FLM H;  1HNZ Q;  1GJX A;  4KN4 C;  2LSS A;  1VMC A;  1WD0 A;  3BDO A;  1S5D D;  1UE6 A;  1CHP D;  2ATW A;  2R92 B;  3CAM A;  5HY6 A;  1K0S A;  1WTX A;  1WJJ A;  3KYH C;  4P75 A;  2D0O A;  4UP7 A;  1YNN C;  2FJ2 A;  2OTL A;  1BCP F;  4JI0 L;  3GTQ H;  5M5Y B;  1MIU A;  1XTD A;  1BQQ T;  3H6M A;  2E2J B;  1X54 A;  1STB A;  3KLR A;  5M9O A;  4EVO A;  2EY1 A;  2RCF A;  1PH5 A;  2K5Q A;  2JA5 G;  1I50 H;  1KL9 A;  1LTI D;  1Q46 A;  1ICW A;  5EGT A;  3CPF A;  1DM0 B;  1KD1 C;  5IP7 G;  4J6H A;  3OPO A;  1LAB A;  5E4X A;  4I65 A;  1LLR D;  3ICE A;  4WRD A;  2BA1 A;  1I4P A;  1QB5 D;  3STB D;  4GKK Q;  3K5M A;  4HJA A;  4OIJ A;  1N32 Q;  4YIJ A;  4LF8 L;  2B2T C;  1SE8 A;  5LHY 1;  3MC0 B;  1PDQ A;  5KGU A;  5JEA J;  1PH1 A;  4PQX A;  4ZLT F;  4R4C A;  1V1O A;  3T51 B;  2Z6K C;  5G3L F;  1EY8 A;  2IL8 A;  4X62 L;  5GRO A;  3PF4 A;  1H9K A;  1DGS A;  3S16 B;  1HHV A;  2PI2 A;  3CCU A;  1QVF A;  2DNE A;  2KCN A;  2N55 A;  5IOC A;  2IY5 B;  4APV A;  3LX0 A;  1YJ9 A;  2K14 A;  3W1G A;  1PYB A;  1SNP A;  1X3Q A;  1CQV A;  2JA5 B;  4JV5 L;  1Y8P B;  3S2H H;  4X62 Q;  2Q2I A;  3D4D A;  2E74 C;  3BU2 A;  4P72 A;  4FP5 D;  1SFO B;  2PZU A;  4DR1 L;  4LF6 L;  1DOK A;  2F0V A;  3NTK A;  1R9T H;  5K36 H;  4CKE A;  1QNK A;  5FJ8 H;  4DV3 L;  1IYV A;  3T56 B;  3S17 B;  2WP8 J;  3A54 A;  1ICF B;  1U0L A;  4K5X A;  2A19 A;  3JAM i;  2BCO A;  4JV5 Q;  2RDG A;  3KJP A;  2KHS A;  1HXY D;  1PFB A;  1V8Q A;  2K52 A;  3HOY B;  3S2D H;  1QJO A;  2RA4 A;  3NUC A;  1KDC A;  5IGC A;  4DV3 Q;  2L11 A;  2KED A;  2L0C A;  1NNX A;  4DK3 C;  4M1U B;  2AUJ D;  1L0W A;  1STH A;  2K5W A;  3J7Y W;  5C4X H;  2EZV A;  1KXL A;  4RCO A;  3C1F A;  3G6J B;  2A69 C;  4Z9C B;  4BBR H;  2NN6 G;  3U58 A;  5FLM G;  1EUJ A;  4B3S L;  1DYQ A;  3K8A A;  1BKB A;  2A6E C;  1BBW A;  1EU3 A;  1Q1B A;  3HOX G;  4RGM A;  3CC7 A;  2NZO A;  2Y0S G;  2F0F A;  4RWS C;  4C56 C;  4GOP B;  2AQ2 B;  3JAM E;  1L0X B;  3HRZ C;  4B3S Q;  3KOJ A;  1Q86 C;  1A63 A;  1FD7 D;  1V43 A;  3HS0 C;  3G7L A;  3T1Y L;  1X9N A;  1IW7 D;  3ZYY X;  5M3F H;  4R9W A;  1E7Z A;  1LT6 D;  5LMU L;  1QZG A;  4CHT B;  1FNW A;  2KCC A;  4QF4 A;  2N78 A;  2B39 A;  1SBB B;  3NEM A;  2QEX A;  4MIU A;  2YU9 H;  1FL0 A;  1RTO A;  3H94 A;  1SYB A;  3J80 L;  1UE1 A;  1I94 L;  2P5Z X;  5JVG 3;  3A5U A;  5LMU Q;  3HOX B;  2MO1 A;  2ENB A;  4A75 A;  5LMN W;  4DR3 Q;  4NXM Q;  3VR4 A;  3PMF A;  1VQ8 A;  5KRU A;  4JBW A;  1K8G A;  2Y0S B;  4S3S A;  4DV0 L;  2ZM6 Q;  5JPM C;  1I94 Q;  3RLN A;  4XXE A;  1JCK B;  2EJM A;  1KAA A;  2KUM A;  1J6Q A;  1K28 A;  4OWT B;  2F0S A;  3AEV A;  2VB3 X;  4HSP A;  4AIM A;  1I50 B;  4Y52 H;  2V1C C;  3ERO A;  3I56 A;  4LW1 A;  2F0M A;  4LUO A;  1VQG A;  5J1Z A;  1H9M A;  2B3G A;  2B2W C;  1JIC A;  5JEA G;  1G2S A;  3BVG A;  3R93 A;  5FJ8 G;  2HD3 A;  4LF9 L;  1E1T A;  1K83 H;  2EJG C;  2JA8 G;  3OHX C;  1KNA A;  1FGU A;  1H9R A;  1IBM L;  3OSO A;  1NMF A;  1PTO C;  1LTR D;  2WAQ E;  4MTK A;  1IBK Q;  3SEB A;  2KBN A;  3UI2 A;  1PH9 A;  1PV4 A;  1UE5 A;  2K7V A;  1I6H H;  1GO3 E;  1SJE D;  1BVS A;  4LK1 C;  1R4Q B;  2RF4 A;  1IBM Q;  4XT3 B;  4YCV A;  2TMP A;  5IWA Q;  1ILP A;  2OF1 A;  2K1B A;  3ER0 A;  4UY8 C;  5IT9 L;  5A2Q E;  2QIL A;  3I3C A;  1CSQ A;  3S2H B;  3PUY A;  2FXQ A;  1PZI D;  1WTQ A;  2B8F A;  1E1O A;  1G29 1;  4BXX H;  3KF6 A;  3NBH B;  1JB3 A;  4DV5 L;  5BR8 Q;  2J0T D;  5KYI A;  3W3A A;  1ASZ A;  4RGN A;  5C0X H;  1RF2 D;  2JA8 B;  4BBS H;  1JOK A;  2JA6 H;  4PG3 A;  3CQZ H;  1SRO A;  2N88 A;  2A68 C;  2DY7 A;  1SMX A;  5HGT A;  1EFW A;  3S2D B;  1X3G A;  2K28 A;  5I6Y A;  4JCV E;  2HCI A;  3HZX A;  3EJI A;  4DV5 Q;  5LL6 S;  4IN3 A;  1XJV A;  4FYD A;  4LUZ A;  3CP0 A;  1D5X C;  1K8O A;  3F2U A;  2UUC L;  2F0Q A;  2Z4I A;  2EXD A;  4OGQ C;  2ZTD A;  1NBW A;  1F9S A;  4KHZ A;  1SE2 A;  5C4X B;  1WVL A;  5CC4 A;  2QA4 A;  4XQQ A;  1CI3 M;  3GV3 A;  1HZ9 A;  1X3E A;  2EYL A;  5GQO A;  2PZT A;  2VXW A;  2UUC Q;  2NUC A;  3GTP H;  1XMQ L;  4PZ8 A;  1KNE A;  1Y14 B;  4HIK A;  3SE0 A;  4HJ8 A;  1XX8 A;  4KKT A;  1VQP A;  2LXJ A;  3Q24 A;  4KTA A;  2I5H A;  4HTH A;  2E2H H;  1LAC A;  1C4Q A;  4IFD I;  2VZA A;  2F0L A;  2NVT H;  1XMQ Q;  3T4A C;  4LUV A;  4FVM A;  2QEJ C;  4IO9 A;  2F4V L;  1JWM D;  2UU9 Q;  1ZEQ X;  3EVQ A;  2BH2 A;  5EAY A;  1FR3 A;  2DGY A;  1F77 A;  4K5V A;  1TXY A;  3MFG A;  1VQI A;  1UEA B;  4NW2 A;  4A3M G;  1M90 C;  3CCR A;  4K2K A;  2OQ0 A;  4JG2 A;  1T5X D;  1JB7 A;  2N49 A;  2WV6 D;  2F4V Q;  1D8L A;  1F2M A;  4GLV B;  1N8R C;  1HFG A;  3M7N A;  1Q8K A;  4AH6 A;  1AE2 A;  5DEH A;  1G91 A;  5L37 A;  1T9H A;  1EZ8 A;  4A3J G;  1PH4 A;  3CCJ A;  4N8F A;  2FHT A;  1EY5 A;  1TWH H;  2CH4 W;  2SNS A;  4OHJ A;  1FNU A;  4DKA C;  1B8A A;  2HHH L;  2RHQ B;  1J5E Q;  5IP9 H;  4OO1 H;  3GTL H;  3EN2 A;  1VS0 A;  5KIX A;  1CKN B;  3H3V C;  5IGD A;  3ERQ A;  2MNA A;  4ABN A;  2IX3 A;  1EQT A;  4A3F H;  2WII B;  1KRT A;  1G2T A;  4KJO A;  2HQL A;  2WB1 G;  4A3M B;  3S14 H;  4ILW A;  1PLF A;  4GNX B;  4NPS A;  4KMU C;  2JK8 A;  4XQJ A;  4A3I H;  3KBX A;  2VNU D;  4DK1 A;  2I5L X;  4A93 H;  1M4V A;  1TS4 A;  1BCP C;  1K83 B;  5BN4 A;  1LTT D;  4FO2 A;  1VF7 A;  2JYO A;  3PSI A;  1KTK A;  1S40 A;  3Q22 A;  3I90 A;  3MWY W;  2CW0 D;  4A3J B;  3E0J A;  4IFD J;  2J7Z A;  3PIP 3;  3SK8 A;  4MNO A;  1PTO F;  1SEB D;  1TWC H;  1A3V A;  1KQS A;  3KBG A;  1SDF A;  3A0J A;  1YEZ A;  5CV9 A;  3GDE A;  4X66 L;  4G7H C;  4BY7 G;  2NVQ B;  2BE5 D;  2R7F A;  2Z1C A;  2FIN B;  1CA6 A;  4RH6 A;  3OIQ A;  5C5M A;  4PMW A;  1P16 A;  4LFB L;  1Y8N B;  4DUZ Q;  3VYR A;  2K32 A;  4FF4 A;  4EQP A;  4X3U A;  3CCE A;  4JI7 Q;  2PO4 A;  1L1O C;  3D3R A;  3DM3 A;  2XRS D;  1O7I A;  3E9I A;  4U68 A;  4C3J H;  2WB1 B;  3Q0A A;  5ELE A;  2C35 B;  1NCV A;  3D0F A;  4K6L A;  2A5H A;  1EL0 A;  4L63 B;  4GKJ L;  4FF2 A;  3O13 A;  1HZA A;  1HA6 A;  2AUK A;  4JYA Q;  1IZ6 A;  4J1M A;  1B70 B;  1SMY C;  1EIH A;  3HFZ B;  2NYZ D;  5ELB A;  1ILQ A;  1TII D;  3CQZ B;  4LF7 L;  1QOH A;  2ZTE A;  3PIP A;  5D3I B;  1EY4 A;  3BS1 A;  1CHQ D;  4JI6 L;  1PFN A;  2EE1 A;  3E6Z X;  5H1S E;  3WOF A;  1Y1V G;  2B29 A;  1Z47 A;  2JA5 H;  2KOL A;  3M4Q A;  3NE5 B;  2A1A A;  1NAP A;  4LFC L;  4BY7 B;  1Q1E A;  3H09 A;  2D62 A;  3E5S A;  1SFO H;  4XYO A;  1S5E D;  2KHJ A;  3CHB D;  4P74 A;  4X3K A;  1TKW B;  5EKK A;  2JA7 H;  2Z9H A;  2O5J C;  5FLX E;  1NJI C;  1SNC A;  5EKI A;  2IWH A;  4LFC Q;  1PMR A;  4JI1 L;  3RZD H;  3OMG A;  1AFP A;  5BN3 A;  1F9P A;  5FOB B;  3JC6 6;  1PRT F;  1CA5 A;  3GTP B;  4NMZ A;  3KK7 A;  5C3W A;  4H7B A;  1O7Y A;  1WFQ A;  1QVG A;  4C3H H;  4UP8 A;  1MBY A;  3T13 A;  1VQF A;  3T16 A;  4B9W A;  2MHV A;  1EQV A;  4H44 C;  3IL8 A;  3VYT A;  5IP9 G;  4AYB E;  3L9A X;  2E2H B;  2F0I A;  5I6W A;  1SYE A;  2C9O A;  1F2L A;  1BR9 A;  3TDQ A;  3VYU A;  3LNN A;  3KLS A;  1Y1V B;  3L0O A;  1ET6 A;  2MPM A;  2EJF C;  2VQE Q;  1LT5 D;  2F0U A;  5J3B A;  5CMD A;  1V1P B;  1O78 A;  2EYM A;  1JOR A;  1K73 C;  4L5R C;  5C3E H;  4Q0F A;  4GZY C;  3TS0 A;  3K5N A;  4YWM A;  1Y1W G;  5COY A;  3KUP A;  2LKV A;  4B3T L;  2E75 C;  1EWI A;  1M8A A;  1BBX C;  4A3I G;  1EIG A;  1PFS A;  4A93 G;  4L5S A;  5HGQ A;  3WDN A;  1RCV D;  2YTY A;  2PW5 A;  4YCU A;  1VMP A;  4JI3 L;  4ZRZ A;  3BZK A;  4KY5 A;  1ML0 D;  2JE6 I;  5I2Y A;  2SEB D;  1N9W A;  4B3T Q;  1XNR L;  5EJW A;  2CH4 A;  3A7A B;  4H13 C;  2XRQ D;  1IXR A;  4HMI A;  4PMB A;  3VR2 A;  4DAY B;  4C3I G;  3NK9 A;  4KY7 A;  3GTL B;  5M3M H;  4IUT A;  1EIY B;  3PF5 A;  2ZM6 L;  5IGG A;  4X65 L;  1W6J A;  4UPA A;  1D1I A;  3RUZ A;  2NN6 H;  3ND8 A;  1O80 A;  3QWN A;  1XNR Q;  2EPB A;  3QIA A;  2HIV A;  4A3F B;  3ULL A;  4DAM A;  4C3J G;  1Y1W B;  3HOX H;  2B2Y A;  4WOR A;  3S14 B;  4DNT B;  4YWL A;  2F3W A;  3MEH A;  3TN2 A; 
#chains in the Genus database with same CATH homology
 4H02 A;  2IX1 A;  5ELN A;  3HOV H;  2NZO A;  4X65 Q;  2Y0S G;  1P8L A;  2VY3 A;  1RL2 A;  4GOP B;  4OON A;  4IFD G;  1W2B A;  1CKN A;  2K5V A;  3KDF A;  4POG A;  1QUQ B;  4LFB Q;  4GN3 B;  3AFP A;  4B3S Q;  2JEA I;  1VQ5 A;  3KOJ A;  4JI4 Q;  1GD7 A;  4DV4 Q;  4GLX A;  3RN5 A;  1Q86 C;  3H3V H;  1A63 A;  1PH7 A;  4O0A A;  4LF5 L;  4PZ7 A;  2PNH A;  1V43 A;  4DPG A;  3PUW A;  4P73 A;  5M3F G;  3T1Y L;  2NVX H;  1X9N A;  1I3Q H;  4DUY Q;  2E8G A;  1YHA A;  4IJH A;  4GNX A;  5M3F H;  1UEB A;  3J7Z C;  1E7Z A;  5M5X H;  3M3Y H;  5LMU L;  1QZG A;  4GKJ Q;  4MTN A;  1N36 L;  5IYD H;  3JAM c;  2N78 A;  3I2Z A;  3G6E A;  4DR7 Q;  3KFU A;  4IJL A;  3HOZ H;  2K75 A;  3OYY A;  2Q2H A;  3NEM A;  1X65 A;  2QEX A;  1YZ6 A;  4JI0 Q;  4LF5 Q;  4A3C H;  3RN2 A;  4PZ6 A;  2YU9 H;  2N8N A;  1FL0 A;  4GS3 A;  4KHP L;  4DR2 L;  3K7A H;  1OXV A;  2UU9 L;  4HJ5 A;  3HKS A;  4LF7 Q;  4GN4 B;  2JA7 G;  3A5Z B;  1YNX A;  3DLL A;  1UE1 A;  1I94 L;  4JI6 Q;  1CSP A;  3CME A;  3A5U A;  5LMU Q;  1BBU A;  2MO1 A;  4A75 A;  1CUK A;  1HJP A;  5LMN W;  2L15 A;  1N36 Q;  4YWK A;  4DR3 Q;  5IE8 A;  4R4T A;  4NXM Q;  4GLA C;  3S1M H;  3HOU G;  4LF4 L;  4OXP A;  1VQ8 A;  2Q2T A;  4LWC A;  2VUM G;  1C9O A;  4JBW A;  5GAH C;  1K8G A;  5IT9 c;  4AYB G;  1PA6 A;  2E5L L;  4JC0 A;  3HOU H;  4L5T A;  4DV0 L;  4KHP Q;  3GTJ H;  2YYZ A;  1EIF A;  4DR2 Q;  3CCV A;  1LUZ A;  4KI0 A;  4GOP C;  3ERS X;  2B63 G;  4X64 L;  4Y7N H;  4C2M H;  3RLN A;  1I94 Q;  2EIF A;  4XTC S;  3UE0 A;  3OTO L;  1IL2 A;  1Z9F A;  1E3P A;  1JE5 A;  3I55 A;  1X3F A;  4LF8 Q;  1J6Q A;  3PUZ A;  1KIX A;  4OWT B;  3H15 A;  1HR0 L;  1PH6 A;  3AEV A;  4AIM A;  4JI8 L;  1WCM G;  2BH8 A;  2R7D A;  4R4I A;  4JI1 Q;  3ULJ A;  4Y52 H;  2CQO A;  2Z6K A;  1VQN A;  3M4P A;  1IBL L;  4BY1 H;  2V1C C;  1WCM H;  3G4S A;  5LMN L;  4DV7 L;  3I56 A;  1VQO A;  3I4O A;  4LW1 A;  1KC8 C;  4WJ3 M;  4LUO A;  3UDI A;  3MEF A;  1J5E L;  1VQG A;  3HKZ E;  4X64 Q;  2B3G A;  5C3E G;  5IYC G;  3W5O A;  4O2D A;  5JEA G;  2F3I A;  4EX5 A;  2NZH A;  5FJ8 G;  3K80 C;  1YJW A;  3CCL A;  4LF9 L;  4DR6 L;  5IYC H;  1K83 H;  1E1T A;  3CW2 C;  1HR0 Q;  1N33 L;  2JA8 G;  1V9P A;  4YHH L;  2GVB A;  4A3D H;  2K4K A;  4JI8 Q;  4OWW B;  1HNX L;  2JJQ A;  1FGU A;  2JA8 H;  1S3O A;  1IBL Q;  5LMN Q;  4DV7 Q;  3CCM A;  1IBM L;  1NMF A;  4BA1 I;  2N3S A;  1MKH A;  4B3M L;  2R7Z H;  2WAQ E;  4HJ7 A;  3B6Y A;  3WWV A;  1IBK Q;  1C0A A;  4A3L H;  3GO5 A;  1QZH A;  2JA9 A;  2KBN A;  2OTJ A;  1PH9 A;  3F8T A;  1PV4 A;  5GAE C;  1UE5 A;  4DR1 Q;  4LF6 Q;  3S15 H;  2ES2 A;  1CKM A;  5GAD C;  3G71 A;  1I6H H;  2MO0 A;  1YJN A;  1GO3 E;  1HNX Q;  4OX9 Q;  1BVS A;  1A8V A;  3PUX A;  1L1O B;  1G51 A;  2RF4 A;  3PCO B;  5GAG C;  1N34 L;  1IBM Q;  2XGT A;  1X56 A;  4YCV A;  5IWA Q;  1UE7 A;  3GTM H;  3FKI G;  1HNW L;  3ER0 A;  4UY8 C;  1E24 A;  4B3M Q;  2LXK A;  2ZJP A;  2RCN A;  3FKI H;  3W1B A;  3GTG H;  3J81 c;  4JI2 L;  1SRU A;  2AWN A;  2JQO A;  4UP9 A;  1CSQ A;  1VQ6 A;  5M3M G;  4BXX G;  3PUY A;  1GM5 A;  2FXQ A;  1E1O A;  1G29 1;  4BXX H;  2WFW A;  3FP9 A;  2R92 H;  2VQF L;  3KF6 A;  3NBH B;  1OXX K;  4JI3 Q;  1TWF H;  2YTV A;  4DV5 L;  2MQH A;  5BR8 Q;  1N34 Q;  2PI2 E;  2VL6 A;  5C0X G;  1M1K C;  3I4M G;  1HNW Q;  2WB1 E;  3SGI A;  4BBS G;  4EQ5 A;  1ASZ A;  2JA6 G;  1YVC A;  4DUZ L;  5M5Y H;  3I4M H;  3A74 A;  2E2J H;  4BBS H;  2JA6 H;  4PG3 A;  4JI7 L;  3CQZ H;  1HNZ L;  1SRO A;  4R4O A;  3STB C;  1PH2 A;  2A8V A;  1KRS A;  1SMX A;  2UUA L;  1EFW A;  3U50 C;  1FVI A;  1X3G A;  5JJI A;  2OCE A;  1Q12 A;  4JCV E;  4DV5 Q;  1OTC A;  1XJV A;  1PHJ A;  4LUZ A;  3CP0 A;  4A76 A;  3S1N H;  1JJG A;  1K3R A;  2PQA B;  3CPW A;  1YIJ A;  1RIP A;  2BA0 A;  4XIG S;  2VW9 A;  2UUC L;  4JYA L;  4IPH A;  1IYJ B;  2I5M X;  1XPU A;  2EXD A;  2ZTC A;  2UUA Q;  2QGQ A;  2ZTD A;  1NBW A;  4P71 A;  4KHZ A;  2KEN A;  5IYB G;  3RNU A;  3TQY A;  1K0R A;  5IYD G;  3L7Z C;  5IYB H;  4BA2 I;  3Q8D A;  1HZ9 A;  1X3E A;  3S1Q H;  3HOZ G;  5C4J H;  5GQO A;  2NN6 I;  1NMG A;  1JMC A;  1CKO A;  1HZB A;  4A3C G;  3HOW H;  2UUC Q;  3GTP H;  1XMQ L;  4PZ8 A;  1OXS C;  1VQA A;  1Y14 B;  4HIK A;  3VDY A;  4NB3 A;  4HJ9 A;  2IHE A;  3T1Y Q;  2K5H A;  3S16 H;  4IOA A;  4HJ8 A;  1HR0 W;  2UXC L;  1QVC A;  1VQP A;  4RG1 A;  3NEL A;  2LXJ A;  3F2B A;  4GKK L;  1X55 A;  3PUV A;  2I5H A;  1VCI A;  2E2H H;  1FJG L;  1N32 L;  3BZC A;  1PH3 A;  3UDG A;  4IFD I;  3PV0 A;  2ID0 A;  2VZA A;  4NXN L;  2NVT H;  1XMQ Q;  3PO3 G;  1A0I A;  2JEB I;  2R6G A;  2XTI A;  4LUV A;  4IO9 A;  5IP7 H;  2F4V L;  1VQC A;  1VQM A;  3CC4 A;  2UU9 Q;  3PO3 H;  3I7F A;  4DV1 L;  1YHB A;  2CWA A;  2UXC Q;  2BH2 A;  3HKZ G;  4OWX B;  5EAY A;  1EQQ A;  2DGY A;  1TXY A;  3S17 H;  1VQI A;  2GVA A;  4BY1 G;  5C44 H;  4A3M G;  3ZJY C;  1WYD A;  1M90 C;  1FJG Q;  3CCR A;  3GTO H;  1NE3 A;  4LF4 Q;  3HOY G;  4NXN Q;  2OQ0 A;  4JG2 A;  4A3M H;  4A3K G;  4LFA L;  4GN5 A;  1JB7 A;  3L2P A;  4GOP A;  2IX0 A;  3TRE A;  2N49 A;  4A3E H;  2IHF A;  1Q7Y C;  3S24 A;  1QUQ A;  4DV0 Q;  2DUD A;  3CCS A;  4A3K H;  2F4V Q;  3HOY H;  4DV2 L;  1D8L A;  1JJC B;  1KAW A;  4DV1 Q;  3TRZ A;  5JJL A;  2H5X A;  2WAQ G;  4GLV B;  1N8R C;  3PIO A;  2VQE L;  1Q8K A;  3OTO Q;  3M7N A;  4A3D G;  4QJF A;  4AH6 A;  1AE2 A;  1PYS B;  1VQ4 A;  1T9H A;  4A3J G;  1PH4 A;  3CCJ A;  1NTG A;  4ALP A;  4LFA Q;  4RMF A;  4QGU A;  4IOC A;  4A3J H;  2R7Z G;  1I5F A;  1TWH H;  4DKA C;  4A3L G;  4TVA B;  4OO1 G;  4DV2 Q;  1B8A A;  2AKW B;  4QQB X;  2HHH L;  2RHQ B;  1J5E Q;  5IP9 H;  1W3S A;  2UUB L;  5JJK A;  1VQD A;  3GTL H;  3AQQ A;  3EN2 A;  1VS0 A;  4DV6 L;  2NVQ H;  4LF9 Q;  3M4O H;  4DR6 Q;  4AQY L;  4DR5 L;  3RLF A;  1CKN B;  3KDF B;  4YHH Q;  1N33 Q;  2HT1 A;  3TS2 A;  1JT8 A;  1TWA H;  2AMC B;  3UE1 A;  3KF8 B;  3NEN A;  4A3F G;  1XPR A;  1JJ2 A;  1V1Q A;  2MNA A;  2UXB L;  2HIX A;  4A3F H;  1KRT A;  2HQL A;  2PMZ E;  2WB1 G;  2Z0S A;  4JBK A;  2ASB A;  4DR4 L;  3RR5 A;  2E5L Q;  3S14 H;  2UUB Q;  1VQJ A;  2NVY H;  4GNX B;  4DV6 Q;  5DLQ E;  2R92 G;  4NPS A;  5E7N A;  2JK8 A;  3J81 j;  4AQY Q;  4FDB A;  4DR5 Q;  4A3I H;  4DR7 L;  4JOI C;  2VNU D;  4J15 A;  2KCT A;  3J7A 5;  2I5L X;  4A93 H;  1YIT A;  3E9H A;  2E2I H;  3AYH B;  3FHW A;  4TQU S;  4LNQ A;  4A3B G;  1OXU A;  3PSI A;  1S40 A;  4QIW E;  4R4Q A;  1E22 A;  4A3B H;  1XPO A;  3MXN B;  4JI2 Q;  1SLJ A;  1NY4 A;  1TWG H;  4IFD J;  3PO2 G;  1VQ7 A;  4MNO A;  3S1R H;  5ELO A;  1TWC H;  1K9M C;  1S72 A;  3PO2 H;  1U5K A;  2VQF Q;  1KQS A;  2AWO A;  3CD6 A;  1GVP A;  3A0J A;  1YEZ A;  3IRB A;  3GDE A;  4X66 L;  1ASY A;  3I4N H;  4IPG A;  4BY7 G;  1D7Q A;  2IT1 A;  1OXT A;  4BY7 H;  2R7F A;  2CWP A;  2AHO B;  1PVO A;  4PMW A;  4A3G G;  3CF5 A;  1YI2 A;  1P16 A;  4LFB L;  4DUZ Q;  2ALY B;  3CMA A;  1EQR A;  3CCE A;  4A3G H;  4B3R L;  5FLM H;  4JI4 L;  1HNZ Q;  4JI7 Q;  4JBJ A;  5IY0 A;  1L1O C;  1A62 A;  3DM3 A;  2LSS A;  2YV5 A;  1O7I A;  3E9I A;  4C3J H;  2MFI A;  1HZC A;  2C35 B;  1UE6 A;  2K50 A;  3D0F A;  1K8A C;  2ATW A;  3HOW G;  4GNX C;  4GKJ L;  3CAM A;  1HZA A;  3D31 A;  5HY6 A;  4JYA Q;  5C0X I;  1WJJ A;  3K7U C;  3KYH C;  1IZ6 A;  4B3R Q;  2K5N A;  4P75 A;  1B70 B;  1L1O A;  2D0O A;  4UP7 A;  2OTL A;  2EQS A;  4IPC A;  4JI0 L;  3HFZ B;  3GTQ H;  1MIU A;  1XTD A;  1X54 A;  4KLK A;  4LF7 L;  2ZTE A;  3PIP A;  2Y0S E;  4JI6 L;  1PH5 A;  2JA5 G;  1I50 H;  1KL9 A;  3BJU A;  1Q46 A;  1VQK A;  4YY3 L;  5H1S E;  2YTX A;  1Y1V G;  2B29 A;  1Z47 A;  3PGZ A;  3CPF A;  3EBE A;  2JA5 H;  1KD1 C;  4DR3 L;  3H3V I;  1Q82 C;  3M4Q A;  3H0G G;  1Y1V H;  2A1A A;  5IP7 G;  4NXM L;  2OQK A;  4LFC L;  1Q1E A;  3CXC A;  3H0G H;  2D62 A;  1SFO H;  1XNQ L;  1YHQ A;  1LYL A;  2KHJ A;  1SN8 A;  4P74 A;  4HIM A;  1C7Y A;  3ICE A;  2BA1 A;  3J81 i;  3STB D;  4JBM A;  5C44 G;  4GKK Q;  4ME3 A;  3J80 i;  3UDF A;  4HJA A;  2JA7 H;  3U4Z A;  4QY7 A;  4YY3 Q;  1VQL A;  1N32 Q;  4DR4 Q;  2D0P A;  1NJI C;  4A3E G;  4LF8 L;  1UWV A;  1SE8 A;  4DNI A;  3E0E A;  4LFC Q;  1PH1 A;  4JI1 L;  5JEA J;  3UDX A;  3RZD H;  1WI5 A;  4DK6 C;  3F2D A;  4K0K Q;  1VQB A;  3GD7 A;  3JC6 6;  4R4C A;  2UXD L;  1LTL A;  2PQA A;  2Z6K C;  1XNQ Q;  2VUM H;  4X62 L;  5GRO A;  3PF4 A;  1KHI A;  1X6O A;  1MJE A;  3KF6 B;  3T1H L;  3G48 A;  1DGS A;  2B63 H;  1WFQ A;  1QVG A;  4C3H H;  3EIV A;  4UP8 A;  2PI2 A;  5FLX c;  1VQF A;  3CCU A;  1QVF A;  1HH2 P;  3F2C A;  2IY5 B;  4APV A;  2VS1 A;  2CFM A;  1YJ9 A;  2K14 A;  1YBY A;  3RLO A;  3W1G A;  1PYB A;  1Q81 C;  2I0Q A;  5IP9 G;  4AYB E;  4YCW A;  4HIO A;  2UXD Q;  4JV5 L;  1AH9 A;  3S2H H;  3L0O A;  2ZJQ A;  3LGJ A;  4X62 Q;  2Q2I A;  1SR3 A;  3K0X A;  2VQE Q;  3BU2 A;  1IBK L;  4WJ4 A;  4P72 A;  5J3B A;  3T1H Q;  4MZ9 A;  5K36 G;  2OWO A;  4DR1 L;  1AE3 A;  1K73 C;  4L5R C;  4LF6 L;  1R9T H;  5C3E H;  2GN5 A;  2KCM A;  1EYG A;  4DV3 L;  5FJ8 H;  3TS0 A;  2WP8 J;  2KHI A;  4OX9 L;  2F52 A;  4YWM A;  3M9B A;  1Y1W G;  1U0L A;  2A19 A;  3JAM i;  3KJO A;  4QL5 A;  4JV5 Q;  5IWA L;  5AJ3 L;  3KJP A;  4HID A;  1Y1W H;  2HHH Q;  4B3T L;  3CCQ A;  1GKH A;  1EWI A;  2K52 A;  3K81 C;  3S2D H;  1VQ9 A;  4A3I G;  5C0X J;  3U4V A;  1PFS A;  1B7Y B;  2CCZ A;  4A93 G;  4L5S A;  5HGQ A;  2RHS B;  2YTY A;  4JI5 L;  4DV3 Q;  2ZJR A;  1WOC A;  2CKZ B;  4YCU A;  2UXB Q;  4JI3 L;  3ULP A;  3M85 A;  3BZK A;  4R1J A;  4DK3 C;  2JE6 I;  5BR8 L;  3OW2 A;  1L2F A;  3TEH B;  2Q2U A;  4X6A H;  1H95 A;  1N9W A;  5AJ3 Q;  1L0W A;  4B3T Q;  1XNR L;  1VQE A;  5C4X G;  4OO1 I;  4JOI A;  5C4X H;  1IXR A;  1KXL A;  4DAY B;  4A4I A;  3I4N G;  3RZO H;  3J80 c;  1XMO L;  1G6P A;  4BBR G;  1PH8 A;  3AFQ A;  4K0K L;  5M3M H;  1EIY B;  4C3I H;  3PF5 A;  4JI5 Q;  2ZM6 L;  4BBR H;  2NN6 G;  4X65 L;  3GTK H;  3F1Z A;  4UPA A;  3U58 A;  4L5Q A;  5FLM G;  1EUJ A;  1XNR Q;  4POF A;  4B3S L;  3K8A A;  4DV4 L;  1VQH A;  1BKB A;  2HIV A;  3KLW A;  1BBW A;  1MJC A;  1LM0 A;  1Q1B A;  3ULL A;  3HOX G;  4DAM A;  1EOV A;  3CC2 A;  4IPD A;  3HOX H;  1XMO Q;  2R93 G;  5M5W H;  3CC7 A;  3HOV G;  4YWL A;  4X66 Q;  4DUY L;  2QA4 A;  2R93 H;  2ZM6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...