2HQLA

Crystal structure of a small single-stranded dna binding protein from mycoplasma pneumoniae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEIWKTTIEIVKIFNPKNEIVIDYKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MG376 homolog
publication title Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Dna binding protein
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11506 DUF3217 Protein of unknown function (DUF3217)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hqlA01
1KRTA 1TWFH 4PG3A 3HOZG 3S17H 3S1QH 3HKZG 1JJ2A 5C3EH 3A0JA 1N34Q 4XTCS 5IE8A 2KENA 4ME3A 1YBYA 5M5WH 2Q2UA 1N34L 4MNOA 3NELA 4GN5A 3W5OA 4DV0Q 4OWXB 3M4OH 2R6GA 4UPAA 1HJPA 4DV0L 3G4SA 3J80c 3HKZE 4AIMA 4LFCQ 4JYAQ 1E1OA 1PV4A 1VQMA 1E3PA 3MXNB 3KDFB 2BH8A 1BBUA 4LFCL 4JYAL 4GLAC 2WFWA 1KD1C 3S1NH 1QUQA 4GS3A 4DV6L 5C4XG 4FDBA 3HOZH 1VQ8A 1VS0A 1JJCB 1S3OA 2N49A 1JB7A 3F2BA 1MJCA 2V1CC 4OWTB 3JAMc 3I4NG 4JI0L 1HR0Q 3G48A 4A75A 4IPCA 1Y1WG 1KHIA 3D0FA 1X54A 4JBWA 5M3MG 1HR0L 1FGUA 1I94L 5GAHC 4B3TQ 3KFUA 1MKHA 1U0LA 2VUMG 4BY1H 4JI8Q 1YEZA 1Z47A 2Q2TA 4OWWB 3AFQA 4HJ9A 1JMCA 4JI8L 1UE1A 2HIXA 4DNIA 3RR5A 4A3KG 3CCRA 4GKKQ 4JBKA 2DUDA 4OX9Q 5C4XH 5M5XH 4P74A 3S24A 2JA7H 4GKKL 4JI7Q 1IXRA 3CQZH 3H0GG 4A3LG 1EQRA 3TEHB 2YTVA 4P73A 2E5LL 2R93H 2K5NA 4NXMQ 1PFSA 1NMFA 1ASYA 3I4NH 2R7DA 4IFDG 4NXML 4OONA 1Y1WH 3CC4A 1VQNA 3HKSA 3H15A 2NVQH 4P72A 5M3MH 4MZ9A 1KQSA 1EUJA 2WB1E 1RIPA 3TRZA 4QL5A 2VUMH 2NN6I 1YNXA 1O7IA 4NPSA 3HOWG 5E7NA 3ULPA 1WYDA 4YWKA 2JA9A 2NZHA 1UEBA 1Q46A 2KCTA 3FP9A 2K4KA 4BBSG 3I4MG 3JAMi 3J81i 3S15H 1WFQA 4HIDA 1PH2A 1VQ6A 4A3LH 4QGUA 1XTDA 2F52A 3H3VI 3HOYH 1X3GA 4QQBX 1L1OB 1A0IA 3CMAA 4IFDJ 2CCZA 1M90C 1KL9A 2I0QA 4HJ5A 4LF9L 1FL0A 1KRSA 1XJVA 2GVAA 4BY7G 4GOPC 1G6PA 1VQJA 3CCEA 4A3JH 2DGYA 2MQHA 4YY3Q 2UXDQ 1HNZL 4NXNQ 3K81C 3OTOL 2OCEA 3HOWH 4X65Q 1YIJA 3TREA 1TWHH 1SR3A 1LUZA 2OQKA 1HZ9A 1GO3E 4LUVA 2UXCQ 4X65L 1TWCH 2UXCL 2L15A 2IX0A 4GN4B 4HIMA 4BBSH 3CW2C 4PZ8A 5LMUL 1IBKQ 3CD6A 2R92H 3HOXG 1YZ6A 3PGZA 2ES2A 2ZJRA 3CCSA 3ERSX 4GOPA 2PI2A 1N36Q 5IWAQ 4IOAA 3MEFA 3E9HA 3KLWA 4B3RQ 1N36L 4DR4Q 2PMZE 5IWAL 4DV1Q 2E2IH 4AQYQ 1Q1BA 4DR4L 4B3RL 1C0AA 4DV1L 4AQYL 1XMOQ 2RHSB 1EIYB 1K8AC 3CF5A 4YCUA 2IT1A 1NTGA 4DV4Q 2K50A 1EQQA 3PO2G 1GD7A 5ELOA 4DV4L 2ID0A 1YJNA 1CKNB 3B6YA 1GVPA 3J7ZC 4RMFA 3U4ZA 5M5YH 1YVCA 4JG2A 3HOXH 4A3EH 1VQ7A 4JI4L 1H95A 1IZ6A 2C35B 1J6QA 2R7ZG 3NEMA 3S2HH 1Z9FA 4TQUS 5FLMG 3PIPA 1PVOA 3M4QA 3HOUH 1T9HA 4L5SA 4WJ4A 1J5EQ 3PUWA 3RNUA 1R9TH 1XMQQ 2B63G 2D0PA 4DV7Q 3U50C 1K9MC 1VQAA 3J81j 2PI2E 3CXCA 4QY7A 1E22A 4DV7L 3RZDH 2ATWA 2OTLA 4P71A 2K5VA 2JA6H 2UU9Q 1NJIC 3PO2H 3F2DA 4GKJQ 1VQGA 5EAYA 3RN2A 4J15A 3CMEA 2JA5H 4A4IA 2UU9L 4GKJL 1NE3A 2JE6I 2AHOB 2ZTDA 1PH4A 2R7ZH 4A3FG 4BA1I 1SE8A 3BJUA 2JA5G 1MIUA 4ALPA 2CFMA 5GROA 3E0EA 2JK8A 1Y14B 2LSSA 2N8NA 1HZBA 2K5HA 2B63H 3BZCA 3H3VH 3ULJA 1LYLA 2E2JH 1Q82C 3E9IA 4DV6Q 1OXTA 1QVCA 4R4CA 4DPGA 4BXXG 5M3FG 1PA6A 4A3CG 1WOCA 2AKWB 2H5XA 3BU2A 3UDIA 1X65A 4DAMA 2QA4A 2UXBL 1IBLL 1B7YB 1PH5A 2VL6A 4JI0Q 2CWAA 5IYDG 4R1JA 1SRUA 2K52A 3KF8B 4A3FH 4GNXB 3A5UA 4HIOA 1I94Q 2OTJA 3EN2A 3PSIA 1IYJB 1TWAH 1VQCA 2I5MX 4KLKA 4YWLA 5IP7G 1N32Q 1S40A 5BR8L 2NZOA 3ZJYC 2YU9H 1N32L 1X9NA 1XNQQ 2UUBL 1XNQL 1EYGA 1PH8A 4OO1I 2LXKA 3CCLA 3PUXA 3S14H 1OXVA 2WP8J 4R4IA 2NVYH 4POGA 4BXXH 1SMXA 2BA0A 4LF8Q 2E5LQ 1WCMG 3F8TA 4UP7A 3CCJA 1IBMQ 1W3SA 3F2CA 4LF8L 4UP9A 3CCUA 2WB1G 1IBML 1QUQB 4BA2I 4LF5L 3GTLH 1K83H 3J80i 3AEVA 4YHHQ 1FVIA 1QZHA 4JBMA 5IP7H 4YHHL 1CKMA 1RL2A 1SLJA 5GAGC 5C44G 3UE1A 1V1QA 2F3IA 4JC0A 4A3IG 3A5ZB 1L2FA 4A3KH 2CWPA 5JJIA 2JA8G 4O2DA 1ASZA 3G71A 2VQFQ 1BVSA 3H0GH 3ICEA 2AWNA 1VQ9A 3Q8DA 2D0OA 3W1BA 2VQFL 3D31A 4A3DG 2EXDA 4LWCA 4QIWE 2HIVA 4LF9Q 1YHQA 4JOIA 4B3SQ 1JJGA 2R7FA 3RLOA 2YYZA 3L2PA 2QGQA 1C9OA 1KAWA 4B3SL 1CUKA 5C44H 4BBRG 1E24A 1HNZQ 3OTOQ 1YHAA 1PH3A 1C7YA 3PV0A 1VQOA 4LF6L 2Z6KA 2XTIA 2PQAB 4R4QA 4DR7Q 1JT8A 5LMUQ 1UE6A 1AE3A 1XPOA 3CC2A 2Z0SA 5DLQE 1M1KC 1VQ5A 3I4MH 4DR7L 3L7ZC 3HOVG 4A93G 3J7A5 3PO3G 4HJAA 1VQPA 2FXQA 2I5LX 4EX5A 3T1YQ 4LF7Q 1K3RA 2K75A 4L5TA 4PMWA 4HJ7A 4IO9A 2GVBA 2IHFA 3I55A 1PYBA 3T1YL 4LF7L 1GKHA 4DR6L 4BY7H 1E1TA 4LFBQ 1WJJA 5LMNW 1YITA 2UUAQ 1VQEA 4BBRH 1BKBA 3SGIA 5IYCG 2UUAL 1VQDA 3AFPA 3GO5A 1PH6A 4LFBL 4KHPL 1CKNA 1SFOH 5LMNL 1K73C 3GTMH 2AMCB 3CAMA 2UUCQ 4APVA 2B3GA 2VQEQ 3GTGH 4JCVE 1TXYA 2UUCL 3S1RH 4JI4Q 2VQEL 1EIFA 2AWOA 3KJOA 1HNWQ 3AYHB 3UE0A 3HOVH 2EIFA 1U5KA 2NN6G 4L5QA 1UE5A 2YTXA 4IPDA 1HNWL 1A63A 3FHWA 4DR6Q 4X66Q 1QVGA 1Y1VG 2E8GA 2N78A 4X66L 1A8VA 1X3EA 1PH1A 1S72A 2JEAI 2GN5A 3AQQA 4RG1A 1B70B 4X62Q 3CC7A 1XPUA 3KOJA 3PUZA 3VDYA 4JV5L 5IYCH 3M85A 1LTLA 4X62L 5GADC 4GOPB 1WI5A 1D8LA 2BH2A 1YJWA 2ALYB 2VY3A 1BBWA 5AJ3L 2HT1A 4KI0A 1EFWA 2JQOA 4HJ8A 4Y52H 2K14A 1V43A 1V9PA 1N33L 1MJEA 2IX1A 3GDEA 3UDXA 3CCMA 1DGSA 2Q2IA 3TS0A 1X55A 5IY0A 1EWIA 2EQSA 2WAQE 5C3EG 3I4OA 4NB3A 5C4JH 1OXUA 3IRBA 1N9WA 3KDFA 5FLMH 1OTCA 3GTKH 4AYBE 1I50H 2ZJPA 4JBJA 4AH6A 4DK3C 2F4VL 1I5FA 1K8GA 4X64Q 3NBHB 4X64L 1D7QA 3DLLA 5IYBG 1HZAA 1IL2A 1OXSC 2MNAA 2UXBQ 4GNXA 4JI6Q 1GM5A 1IBLQ 3S1MH 2VZAA 2YTYA 4B3ML 4JI6L 1G51A 2BA1A 3KF6B 1L0WA 1VQ4A 3RLFA 3PUYA 3A74A 1Q12A 2A19A 4DV2Q 3STBC 3RN5A 1VQBA 4MTNA 5BR8Q 4HIKA 4DV2L 3EIVA 5JEAG 1UE7A 4GLVB 1KXLA 1XPRA 1Q86C 2HHHQ 4OO1G 3K7AH 2UUBQ 4X6AH 2ASBA 1PH7A 4BY1G 2HHHL 4IJHA 2QEXA 3F1ZA 4LFAQ 5JJKA 5C0XI 1PYSB 2KCMA 4UY8C 3S2DH 2VS1A 5IYBH 4LFAL 4LW1A 2ZTCA 1YJ9A 5M3FH 4A3CH 3RZOH 2JEBI 3KJPA 2JA7G 4DUYQ 3HFZB 1L1OC 4A3MG 1NMGA 5FJ8G 3FKIG 4DUYL 3OW2A 4LF5Q 1QVFA 2R93G 3K80C 1HR0W 2VW9A 4P75A 5IYDH 2A8VA 4R4OA 4GN3B 3J81c 4IPGA 4KHZA 4JI2Q 4LUZA 4XIGS 5JEAJ 4JI2L 4DR1Q 1XNRQ 1HNXQ 1X6OA 2A1AA 2LXJA 3ULLA 1X3FA 2D62A 4DR1L 3L0OA 3M4PA 4JOIC 3U58A 1HNXL 4B3TL 1XNRL 3CPFA 4POFA 3CPWA 1YI2A 1I6HH 4A76A 1P16A 1Q7YC 2RHQB 3KYHC 3S16H 1L1OA 4DV5Q 5GQOA 3GTQH 3M3YH 4YWMA 2NVTH 5K36G 3PUVA 4DV5L 4A3GG 2OQ0A 1W2BA 1WCMH 4OX9L 4A3MH 4JI1Q 1Q8KA 3BZKA 4DK6C 5FJ8H 2Z6KC 3FKIH 4PZ7A 3HOYG 4JI7L 4LF4Q 4JI1L 4C3JH 4C3HH 2PNHA 1HH2P 2ZTEA 4LF4L 1A62A 3PF4A 4K0KQ 4TVAB 1E7ZA 3GTOH 4PZ6A 4K0KL 3WWVA 5GAEC 2PQAA 1CSPA 3PIOA 4Y7NH 4UP8A 4A3JG 4LF6Q 1B8AA 2ZM6Q 4A3IH 1VCIA 1OXXK 4DR5Q 2Y0SG 5H1SE 2ZM6L 4O0AA 5IT9c 4A3BG 4DUZQ 2JA8H 4DR5L 4A3GH 2MO0A 4DUZL 3K0XA 5ELNA 2N3SA 5IP9G 4DV3Q 2R92G 5C0XG 4A3DH 3JC66 2Y0SE 4DV3L 2CQOA 4LNQA 2VNUD 2KHIA 1X56A 1EOVA 4DR3Q 3ER0A 3GD7A 2YV5A 4QJFA 4KHPQ 4IJLA 4DR3L 4R4TA 2CKZB 5LMNQ 3STBD 2MO1A 4YCWA 4WJ3M 4YY3L 1TWGH 2UXDL 2B29A 1HZCA 1PHJA 4NXNL 1UWVA 4A3BH 3I2ZA 3TS2A 4GLXA 1VQLA 4C3IH 1Q81C 1Q1EA 4L5RC 1YHBA 4YCVA 3PCOB 4A93H 1AE2A 5IP9H 4A3EG 1NBWA 5FLXc 5C0XJ 5HGQA 3W1GA 4DR2Q 1KIXA 3GTPH 3PO3H 3K7UC 1IBKL 2NVXH 2KHJA 3LGJA 4DR2L 3I7FA 5J3BA 5JJLA 1QZGA 3CCVA 1SROA 2Q2HA 5HY6A 4JV5Q 2I5HA 3PF5A 3HOUG 3UDFA 1K0RA 3EBEA 1FJGQ 2RF4A 5AJ3Q 3CCQA 1VQHA 3TQYA 3M9BA 1FJGL 4IOCA 1PH9A 3I56A 1XMOL 3NENA 2WAQG 4C2MH 3M7NA 1N33Q 3OYYA 2JA6G 2E2HH 1CSQA 1P8LA 4AYBG 4LUOA 3DM3A 3UDGA 3U4VA 1KC8C 2KBNA 1SN8A 2MFIA 3GTJH 4GNXC 1I3QH 1G291 1Y1VH 2ZJQA 1VQKA 1AH9A 4JI3Q 2F4VQ 3T1HQ 3RLNA 1N8RC 3CP0A 4EQ5A 4JI3L 4JI5Q 2IHEA 1VQFA 4IPHA 3T1HL 1NY4A 2HQLA 4JI5L 1J5EL 1JE5A 3G6EA 1VQIA 3K8AA 1XMQL 1CKOA 2IY5B 2XGTA 3KF6A 2RCNA 2JJQA 2OWOA 4OXPA 4DAYB 1LM0A 4IFDI 4DKAC 4B3MQ 4H02A
chains in the Genus database with same CATH superfamily
3S2DB 2F0EA 1ESRA 4ZUJA 3S17H 3S1QH 3HKZG 3MTSA 1JOKA 2KENA 1YBYA 4MNOA 3W5OA 2EY6A 1WTWA 2R6GA 3NWSA 3VR3A 2EYOA 4AIMA 1LT3D 1VQMA 1E3PA 4HEDA 3KDFB 2QW7A 3K5NA 5DM73 1DD2A 5C4XG 4FDBA 1YNJC 1HTLD 3HOZH 3M3YB 1VQ8A 1GUTA 2CH4W 4N9PA 5DM63 3TZUA 2JYOA 1HR0Q 1FGBD 1X54A 5GAHC 3P75A 2EYJA 3PQIA 2VUMG 3GTOB 1KNAA 1YEZA 2Q2TA 4OWWB 1JMCA 4HJ9A 2HIXA 4Y7NB 4DNIA 4A3KG 4GKKQ 1EYCA 4KMUC 5T1GA 4JI7Q 3CQZH 4A3LG 1CM9A 2JA8B 4A3GB 4NXMQ 2B8FA 2X69A 4G4KA 1ASYA 2IW3A 4OONA 1VQNA 3HKSA 4P72A 5M3MH 1KQSA 2WB1E 4XT3B 3NBIA 1B1ZA 1PRTB 1RKNA 2NN6I 2Q8TA 2K33A 1O7IA 3R8BA 1BQQT 3C2PA 3PIO3 2NZHA 4WJ4A 3I4MG 4HIDA 2J7ZA 2F52A 1LTSD 1X3GA 1LTGD 1ZKOA 4C3IB 2XWBB 2XRQD 1BCPF 2I0QA 1EY9A 1XJVA 1GUGA 2GVAA 2NVXB 4XYQA 1GXDC 4A3JH 4FYDA 5IGCA 3A56A 2RCFA 4EQOA 1PRTD 1SR3A 1GO3E 3J80L 1TWCH 2UXCL 1U4LA 2L15A 1YNND 4GN4B 1G6ZA 2OEOA 1Z7TA 4PZ8A 2R92H 1YZ6A 3ERSX 4IALA 4GOPA 1DJRD 1DONA 1BO0A 1EWHA 2DNCA 3MEFA 3NWTA 4ZK9B 2IX3A 1N36L 1ZEQX 5IWAL 1BBXC 1Y1VB 4AQYQ 2PYKA 3JAML 2MHVA 4UDUC 2IT1A 1NTGA 3EQLC 4DV4Q 1EQQA 2KEEA 5CV7A 1KDCA 3PO2G 2L5TA 3D6CA 4A3EH 2JA5G 2EY1A 4HSPA 1YVCA 4JG2A 4ILWA 1IZ6A 4OHJA 1J6QA 2M00A 2DN8A 2R7ZG 3J7YW 5CC4A 3NEMA 3I73A 1MD2D 3R2TA 1EYDA 2A6ED 4NMZA 1EYAA 5CV6A 3C1FA 4F88A 5C3EB 3M4QA 1X3QA 2NWGA 1T9HA 2WIIB 4L5SA 3PUWA 1XMQQ 1R4PB 2V4DA 4MTKA 4KD4A 5EBDA 4DV7Q 1XTCD 3J81j 3CXCA 1Q3LA 1U4PA 1NJIC 1PZJD 1ICWA 1VQGA 5EAYA 5CGKA 3RN2A 3BZDB 3S1NB 4KJNA 2IWHA 3DHQA 2JE6I 1PH4A 1V1OA 1MIUA 3QG1A 3E0EA 4K8IA 1J9OA 2B63H 5CV4A 1MBYA 5A2QL 1Q82C 3AMUA 4DV6Q 3Q6SA 5M3FG 4A3CG 1WOCA 3BU2A 2X6GA 4ZUIA 2QA4A 2FHTA 3HRZC 1EY4A 4FNFA 1HHVA 3VR5A 2CWAA 2RSNA 1XXGA 2K52A 4R1JA 3R93A 3A5UA 5IGDA 3FKIB 1I94Q 2R93B 3EN2A 3PSIA 1IYJB 2E2DC 5CR3A 1S40A 3I4NB 2NZOA 4IURA 2K04A 1GUSA 1XNQL 4QF4A 1OXVA 2NVYH 3M4YA 1JORA 2MPMA 3CCJA 3F2CA 1CK1A 4LF5L 2LS01 3HOYB 3DUZA 3VYUA 1FVIA 1WD0A 1NUCA 4YHHL 1PFNA 3MXGA 4HCEA 5CORA 3UE1A 1AEXA 4DU9A 1D5XC 1NR2A 1HCZA 1MSGA 4WFN3 4F87A 5JJIA 3MA2B 1ASZA 4K5VA 2F0GA 2VQFQ 1EZ8A 1BVSA 3R3OA 3ICEA 2AWNA 1VQ9A 5FKAC 3Q8DA 1TY2A 3D31A 1F9QA 1K3BC 4BBSB 5LHY1 1G91A 1TT2A 1JJGA 3L2PA 4B3SL 2Z4IA 5C44H 1AW7A 1E24A 3DEPA 1C7YA 4TRDA 4G7ZC 4BWGB 1VQOA 3P20A 1K8OA 2Z6KA 1JT8A 2PQAB 1X3PA 1UE6A 3BVGA 4IUNA 3AB9A 3CC2A 3J7A5 1FNVA 3NTHA 4HJAA 1VQPA 4LF7Q 2K75A 4PMWA 4OO1G 4DR6Q 4IO9A 3T1YL 5M5YB 4ZRZA 3OHXC 5LMNW 5CBAE 2VB3X 3S2HB 1HTPA 3V05A 3SGIA 4ZKBB 2UUAL 3AFPA 1PH6A 1WTPA 4L8JA 1K73C 2AMCB 3T13A 1SDFA 3GTGH 2UUCL 3KBGA 2F3WA 2VQEL 3RZDB 2AWOA 3UE0A 3HOVH 1UE5A 1A63A 2K1BA 3FHWA 3RD4A 2E8GA 1F2MA 1X3EA 2HCIA 2RDFA 4LJZC 3J7AV 4QUFA 3VDYA 2QDLA 2NZ1D 4GOPB 2NTSA 3M4OB 2EYMA 3HZXA 4IUPA 3Q24A 1I4XA 3K57A 1EFWA 4HJ8A 1TIID 3BDCA 3GDEA 5KIXA 1DGSA 2J0TD 4XXEA 2F0NA 1L0XB 1H9SA 1C8CA 4CKCA 4V190 5FK9C 1OXUA 1N9WA 1SYFA 3HKZB 2L12A 2ZJPA 1STGA 2F4VL 1I5FA 1K8GA 1B2TA 2F0FA 4X64Q 1AN8A 2EJMA 1IYUA 2R61A 2JSOA 2D5DA 5IYBG 1QOHA 4GNXA 4DA2A 1G51A 2BA1A 4ULLA 4CDFC 1Z6HA 1I4QA 3A74A 1Q12A 3RN5A 3T53B 3GV3A 5BR8Q 2DJFC 1SNCA 4GLVB 1PRTC 1XPRA 2F0MA 3FMCA 2CW0D 1YNNC 5KNBA 2QEXA 2HHHL 5C0XI 1PYSB 4UY8C 3I8ZA 1LV9A 1STAA 2ZTCA 3RZOH 2QILA 4A3KB 4E6IA 1HA5A 3OW2A 4DK1A 2EJFC 2DY8A 3ITPA 1G2TA 3J81c 4KHZA 1OO9B 5JEAJ 4KY6A 1CHPD 2D62A 4JOIC 1HNXL 1VDZA 4A76A 2RHQB 1L1OA 1DCZA 4YWMA 1S4ZA 1LO5D 4DV5L 4A3GG 2B2WA 3PMFA 5J1ZA 4A3MH 4JI1Q 2A6EC 3BZKA 4DK6C 4KD3A 4PZ7A 4JI7L 4C3HH 4B9XA 3I4MB 2PNHA 2Z6BA 2ZTEA 1BOSA 3PF4A 4K0KQ 2ICIA 3LX0A 4PZ6A 4GZYC 2EY2A 1B53A 3IFDA 1SNQA 1XX8A 2BCOA 4IUTA 3PIOA 4A3JG 2ZM6Q 4A3IH 4BBRB 2Y0SG 5H1SE 5IT9c 4CDCC 3KLRA 4YIJA 4DUZL 2F0UA 3K0XA 2N3SA 1FNUA 1QG7A 2R92G 2ZXRA 3UI2A 2A69D 2K32A 3URYA 1TQOA 2F4IA 2KHIA 3N52A 2PMZB 1EOVA 2TMPA 3ER0A 4KY5A 4QJFA 3MAQA 4KHPQ 4IJLA 4DR3L 2CKZB 3AU7A 3STBD 2KUMA 2MO1A 2RVLA 4OIJA 1HZCA 2B8GA 5FO7B 1Q1EA 4YCVA 3PCOB 1SE3A 1ENCA 4A3EG 1DOLA 1KIXA 3W1GA 4KTAA 3PO3H 3GTPH 1EIGA 5ELDA 5J3BA 2KEDA 1SROA 2K03A 3MFGA 4JW0A 4ID6A 1K0RA 1FJGQ 2BDNA 5AJ3Q 4DGZA 3TQYA 4IOCA 3DWPA 1IW7D 1V8QA 3QO2A 3SE0A 4N9TA 4X3SA 1P8LA 5BN3A 3UDGA 1EU4A 2FFKB 2OF1A 4IN3A 1QWYA 1JQYD 2ZJQA 3ERQA 1FNWA 1AH9A 2M2LA 4I7ZC 3CP0A 4JI3L 4JI5Q 1VQFA 3G6EA 1VQIA 3K8AA 1XMQL 2XGTA 3KF6A 2JJQA 3K7AB 4OXPA 2YU9B 4B3MQ 3MXPA 1KRTA 4O42A 1CQFA 5M3FB 4LAAA 1JJ2A 3A0JA 4ME3A 3EROA 1SYBA 5M5WH 1N34L 1LTTD 3NELA 4DV0Q 4OWXB 2EYPA 2QKIC 1SBBB 1HJPA 2SOBA 2OXPA 2NBFA 3MXNB 4LFCL 4JYAL 2WFWA 2EYLA 3D4RA 4GS3A 4DV6L 1CI3M 3EA6A 1Q90A 3S16B 1E2ZA 4IUQA 1TKWB 4MN3A 3GTQB 2KOLA 4LK1C 3F2BA 2V1CC 5D3IB 3I4NG 1HXYD 1O7YA 2NYZD 4IPCA 5IGGA 5FLXL 1NR4A 1FGUA 1I94L 5DAUA 3KFUA 1MKHA 1U0LA 1RCVD 4BY1H 4JI8Q 1Z47A 1SEBD 1I6VC 2TSSA 3AFQA 1UE1A 4R8IA 3TP5A 4P74A 2JA7H 1IXRA 2F0IA 3LWEA 4QIWB 1FR3A 1EQRA 1NCVA 2MP1A 1PFSA 5NUCA 1Y1WH 5I6YA 2NVQH 1U4RA 4MZ9A 5EKKA 3TP6A 4RFBA 1RIPA 3QWNA 3A55A 2L1BA 1YNXA 4NPSA 5E7NA 5JVH3 4HMIA 2HUGA 4YWKA 2JA9A 4CHTB 5K36H 1Q46A 1S5FD 2KCTA 1TWGB 4BBSG 3S15H 4U68A 4RHRA 4QGUA 4A3BB 1XTDA 2CVRA 5C4HA 2A5HA 1L1OB 1M90C 1W6KA 4KN4C 4CDDC 4GOPC 4R9WA 1A15A 1G6PA 1VQJA 3CCEA 4YY3Q 3H3VC 4NXNQ 3K81C 3HOWH 1YIJA 1PDQA 1TWHH 2EY5A 4LUVA 2B2YA 4X65L 1VF5C 1K0SA 3CW2C 4C2MB 4DNRB 2ZJRA 3CCSA 3K5LA 4IOAA 5FO8B 2CW0C 3GTJB 1I3QB 4B3RQ 4DV1Q 2EZVA 2E2IH 1Q1BA 4DR4L 2L55A 3BS1A 3GTKB 1UAPA 1XMOQ 1B50A 1WVLA 4KN7C 4CKEA 2K50A 2ID0A 1YJNA 2OWOA 5JAVA 3U4ZA 3I90A 3HOXH 1KABA 1H95A 3S1MB 4B08A 2F1MA 1Z9FA 3S17B 4PQXA 2K28A 3S1QB 2PW5A 1UUPA 4KKTA 1R9TH 3M7GA 3U50C 1CA5A 1VQAA 2ENBA 4ME5A 1LT5D 2UU9Q 3KLSX 1C4QA 4GKJQ 1NE3A 2I07B 1M8AA 4RA8A 1SE8A 1SAPA 2JN4A 3HOZB 2EPBA 4L63B 2KVMA 4UHVA 2E2JH 1EY7A 4K6LA 4NW2A 1OXTA 1EEID 4HSVA 2A69C 4DPGA 4BXXG 2F0KA 1CZGA 1AZQA 1KLGD 4BS9A 2BE5D 1PH5A 2VL6A 1GUOA 3LWUA 4A3FH 3CQZB 2F0DA 4QMGA 4HIOA 1TWAH 2I5MX 3Q23A 5IP7G 1N32Q 2QEJC 5BR8L 4FF2A 5EPJA 1SYCA 5M3MB 1IYVA 1PH8A 3CCLA 4POGA 1SMXA 4MIUA 1IBMQ 4LF8L 3A7LA 4UP9A 3C1EA 4C3HG 3GTLH 1WTHA 5CV8A 4H7BA 3S9WA 5JJZA 4JBMA 4XYOA 1GUWA 1STYA 1IW7C 1SLJA 3MXUA 3BG3A 1LABA 4A3IG 3A5ZB 2CWPA 4A3JB 4O2DA 3G71A 3H0GH 2Y0SB 3ND8A 1DXMA 2D0OA 3W1BA 1TWCB 2HIVA 4IFDH 1PMRA 2R92B 2E76C 1ENFA 1SJHD 3TDQA 4BBRG 2AUKA 1YHAA 1PH3A 2B39A 2KECA 3E5SA 1U4MA 4DR7Q 4NP5A 1TR5A 1EY5A 1R4QB 1O80A 1WTVA 3PO3G 2FJ2A 3A8IE 4HJ7A 4L5TA 3I55A 4A3EB 1PYBA 4FXDA 1GKHA 3MVVA 5IGFA 1B9NA 1YITA 4LFBL 3QJYA 5IYCG 1CTMA 1VQDA 4KHPL 2XSCA 1CKNA 5KGUA 3GTMH 2A68D 1TXYA 3NQIA 3S1RH 5ISRA 4JI4Q 1EIFA 2IL8A 3KJOA 1HNWQ 5CV5A 2EIFA 1KDBA 2B2UC 4X66Q 4OIKA 1PH1A 1QNUA 1UNSA 1KLUD 1BCPB 3AQQA 3CC7A 1XPUA 3EFXD 2HDMA 1LTLA 4X62L 5GADC 3K59A 1D8LA 1YJWA 1EY0A 2ALYB 2SDFA 1BBWA 2VY3A 5AJ3L 1UEAB 3OOCA 2B63B 1TY0A 2JQOA 3TMEA 2K6AA 1V43A 1V9PA 3UDXA 2Q2IA 3TS0A 1X55A 2NN6H 5IY0A 3VYRA 5C4JH 4NB3A 3JAME 3J81E 5FLMH 1RDPD 1I50H 4JBJA 4AH6A 1HFNA 1BCPD 1ZXTA 3E6ZX 4X3UA 1OXSC 2MNAA 4JI6Q 1ML0D 3H09A 2VZAA 3SEBA 4B3ML 1L0WA 3RLFA 2H4OA 2NVYB 2A19A 1ESFA 3QIAA 3IKJA 3Q22A 4MTNA 4DV2L 5L37A 1HQRD 3OWEB 2UUBQ 1QE6A 2CH4A 4KKUA 1PH7A 4BY1G 4FXKC 4IJHA 4LFAQ 3RUZA 5JJKA 4FVMA 2KCMA 3D4WA 2VS1A 5AFWA 5IT9E 1NAPA 3KUPA 1SYDA 2JEBI 2JA7G 2HCCA 1B3AA 3HFZB 4L6TB 1L1OC 1JWSD 2KQ3A 4DUYQ 3TZDA 3K80C 2VW9A 1EOTA 1U9RA 2B2WC 4R4OA 4GN3B 4HR7B 3NE5B 2A8VA 1I4RA 4XIGS 1KDAA 4JI2L 4DR1Q 1XNRQ 1EQVA 3ULLA 2EE1A 3M4PA 1KNEA 1AZPA 3CPFA 3CPWA 1I6HH 3OIQA 2EOTA 1Q7YC 2RKSA 3KYHC 5C44B 2K01A 2RDGA 5GQOA 1S5BD 2NVTH 4DFAA 2AQ1B 5K36G 2OQ0A 1W2BA 1WCMH 5FJ8H 3FKIH 2MUYA 2XN9C 2PPBC 1FYCA 3N6RA 1RTOA 4C3JH 1VMCA 4LF4L 1A62A 2AQ2B 1E7ZA 4M8AA 2JP1A 2IJ0A 1KTKA 1HQMC 4UP8A 2B2TA 4FF3A 3QB3A 4UAIA 1OXXK 4I65A 4A3BG 3OWFA 2EYFA 4DR5L 3SR1A 1A3TA 5BN5A 1PZID 3OW7A 5IP9G 2Z4HA 1D1KA 2M9VA 3GTGB 1F2ZA 4A3DH 4DV3L 1PXUA 3HOVB 1DOKA 2YV5A 4R4TA 5LMNQ 1F2LA 4KHVA 4LMQD 4YCWA 1HUMA 4YY3L 1BF4A 2JXMB 4NXNL 3TS2A 3U9OA 2F0LA 5COYA 4A93H 2PW7A 3OMCA 5C3WA 4DR2Q 2VB2X 3KK7A 3I7FA 4FO2A 1H9RA 3I91A 1MSHA 4CBVA 5E4XA 1XMOL 2E74C 1EWCA 2NTTA 1ILQA 3HGBA 5KRUA 2E2HH 2G5DA 5D3DA 3U4VA 1KC8C 2PO4A 3FRPB 3NBHA 3P1HA 2C9OA 5KEEA 4EQ5A 1PTOF 3T1HL 4HAEA 1NY4A 2HQLA 1TS4A 1H9KA 1JE5A 2IY5B 4RWSC 2RCNA 3TSSA 3BDOA 3KF8A 4DKAC 4H02A 5EBCA 1IKMA 4H44C 1TWFH 4PG3A 3HOZG 5KYIA 5M9OA 3RZOB 3MC0B 5IE8A 4ZCKA 4DF7A 3M4OH 1EY8A 5J22A 3VYSA 3HKZE 3J80c 1D5MC 1E1OA 1WTQA 1PV4A 3TN2A 3WOEA 1M4VA 2IPKD 1SE2A 4R8NA 4V0BA 5C5MA 1QUQA 1TS5A 1LLRD 3I72A 5IGBA 1VS0A 1JJCB 2N49A 3CU7A 3SK5A 4DNTB 1MJCA 4OWTB 3T56B 3JAMc 4A3MB 3G48A 1KHIA 3D0FA 5IGEA 1HR0L 4C3HB 2PNRC 4FP5D 5M3MG 2G9HD 2A68C 2N88A 2VXWA 4HCSA 3VA5A 3RR5A 3A7AB 2DUDA 1IHZA 5A35A 5C4XH 5M5XH 4J8QA 4A3IB 1EY6A 4GKKL 3H0GG 4OGQC 3TEHB 1J8IA 5DNFA 4F8MA 2K5NA 1NMFA 2R7DA 4IFDG 4NXML 3CC4A 3H15A 1PTOH 1PFMA 4N8FA 1T5EA 2VUMH 1HPCA 1MHWC 3LNNA 1PTOD 5I9OA 1IKLA 3D3RA 4ABNA 3FP9A 3QOLA 4JK1C 2K4KA 3JAMi 3J81i 1WFQA 4A3LH 1PH2A 1KAAA 2WACA 4QQBX 4XQQA 3V2TA 1E2WA 2K5QA 1KL9A 1BCPC 2O5JC 3PO3B 4HJ5A 3GTPB 1FL0A 2MGSA 1CHQD 1V1PA 2L4NA 2DGYA 4K6DA 3A54A 4K2LA 3TREA 2OQKA 1LUZA 1SNPA 1HZ9A 2UXCQ 3K58A 2IX0A 4HIMA 2C5CA 1EEFD 1IBKQ 3CD6A 3PGZA 5C0XH 4FF1A 1JR0D 1N36Q 1YNJD 5IWAQ 3E9HA 2RDHA 2PMZE 4RGMA 4XQNA 4RKBA 1C0AA 4C1NI 1Y8OB 4AQYL 2RHSB 4RGNA 2F0VA 3CF5A 4YCUA 2XVSA 1DM0B 3HS0C 5ELOA 4DV4L 2WAQB 3B6YA 1Y8NB 4JI4L 2K5DA 2WINB 4TSSA 4OL7A 4AYBB 2O4XA 1NNXA 4TQUS 1S5ED 5FLMG 2X6LA 4DAYA 3HOUH 1O7ZA 5M5WB 3RNUA 2A6HD 3IL8A 2B63G 4C56C 1Y69U 2D2CC 2Q8IB 1I4PA 4ZQ3A 2PI2E 4DV7L 2K5VA 2JA6H 1SJED 3PO2H 3HEJA 3K6OA 3CMEA 2JA5H 1LACA 3OMGA 4A4IA 4WORA 1BXTA 2ZTDA 2R7ZH 4BA1I 4ALPA 1PLFA 3HP3A 4IUVA 2LSSA 2N8NA 1HZBA 2K5HA 1H9SB 3BZCA 3ULJA 2ICEC 5D65A 4DXGA 3E9IA 5JVG3 4BY1B 1PA6A 1QB5D 4DAMA 1WTXA 1B7YB 4OELB 1ET9A 4JI0Q 1G8ZD 1SRUA 2JA7B 3KF8B 5IIFA 4GNXB 2OTJA 1LT6D 2XIWA 4YWLA 1VQCA 4PMCA 3ZJYC 1Y1WB 2YU9H 1F9SA 1XNQQ 2FINB 2UUBL 4QCLA 3CKIB 4OO1I 3S14H 4R4IA 2WP8J 2BA0A 2E5LQ 1WCMG 5JPMC 1X32A 1W3SA 3MEHA 3BDLA 1T5XD 2BOSA 1QUQB 4BA2I 3S15B 1K83H 3H94A 4YHHQ 5C4ZA 1B3QA 1CKMA 5C44G 1V1QA 2F3IA 2DNEA 3TP7A 1L2FA 5FO9B 3SK4A 1TWHB 5I2XA 2R3ZA 5FLXE 4XQJA 2VQFL 3NQTA 4A3DG 2EXDA 4LWCA 4QIWE 4LF9Q 5E1FA 4JOIA 5C6AA 4B3SQ 2R7FA 3RLOA 3SDZA 2YYZA 1EQTA 4G7OC 2QGQA 1KAWA 1CUKA 1HNZQ 3OTOQ 1H9MA 1PZKD 1BDOA 2E2IB 1F9RA 2AQ3B 5CBEE 2XTIA 5LMUQ 4A93G 2Z0SA 1VQ5A 5BN4A 1A2UA 3HOVG 2FXQA 2I5LX 4EX5A 3T1YQ 5E4WC 2IHFA 4X3KA 1FD7D 3IAYA 3HOXB 4LF7L 4DR6L 1GUNA 4BY7H 1PYWD 2UUAQ 2J4XA 1SYEA 2F0HA 5CMDA 1SFOH 5LMNL 3NHHA 1RD9D 2UUCQ 1R9TB 4APVA 2B3GA 3X3NA 2VQEQ 4JCVE 4HN7A 4ZLTF 1B44D 4M1UB 1U5KA 2YTXA 2LMCB 5I9PA 2XRSD 2N78A 3FEWX 1II3A 1QJOA 5I6WA 4DN4M 2JEAI 2GN5A 2K05A 2Z9HA 3KOJA 3PUZA 3M85A 2XWJB 1WI5A 1CFMA 3PIP3 1E2VA 2HT1A 5ELCA 2E2JB 4DK0A 4Y52H 2IX1A 3C3LA 2QCPX 4C1NK 2EQSA 2F0WA 3GTKH 5ELEA 4DK3C 4A3FB 3MHBA 3NP8A 4RHSA 1TWAB 4NDXA 1BUVT 3QOJA 4X64L 1D7QA 3NUCA 3DLLA 2UXBQ 4G7HC 1GM5A 1IBLQ 3S1MH 1D6EC 2HDLA 2YTYA 3DXJC 3KF6B 2PZWA 2CQAA 4OEMB 1LTID 4IZ8A 3STBC 3QR8A 1WD1A 1VQBA 4HIKA 3EIVA 3Q0AA 1PRTF 1RJTA 2F03A 3GTLB 2HHHQ 4KV6A 4X6AH 4CGYB 2MJ8A 3GV6A 3S2DH 5IYBH 4LW1A 1YJ9A 1CA6A 3KJPA 3L9AX 2RSOA 4A3MG 1NMGA 3MWYW 1QVFA 3VYTA 5IYDH 1HR0W 1TU2B 1EL0A 4O1NA 3H0GB 4IPGA 4LUZA 2WB1B 1JC7A 3G6JB 1HNXQ 1X6OA 3BVMA 1WTRA 3L0OA 3U58A 3K5OA 3VR4A 1P16A 2LKVA 1K28A 3W2DA 4DV5Q 3M3YH 2B2TC 4ZYSA 5CYUA 3PUVA 3P7JA 1Q8KA 2Z1CA 2Z6KC 3NXWA 2XNAC 4JI1L 2EJGC 5EPLA 1JOQA 2A6HC 2AUJD 3GQBA 1S5CD 3GTOH 4K0KL 2PQAA 2GA4B 1SNDA 4Y7NH 4LF6Q 2A74C 1JB3A 5HGTA 3BVZA 2ZM6L 4O0AA 3BYYB 4DUZQ 2JA8H 4A3GH 2MO0A 3GTMB 5C5LA 2O5IC 2EDGA 5C0XG 3S1RB 2Y0SE 1MGSA 4J6HA 2CQOA 5F2DA 4XDXA 4DR3Q 3GD7A 3F2UA 4K2KA 5IODA 1JICA 3SXHA 1ET6A 3SVMA 4Q0FA 1RF2D 4ZKCB 1UWVA 4C3IH 3FVQA 2L9HA 4L5RC 1CZWA 1AE2A 1NBWA 4H0LC 5FLXc 5HGQA 1GOZA 3K7UC 1IBKL 2NVXH 2KHJA 3LGJA 1ILPA 5ELFA 2A73B 3OIPA 5D14A 2Q2HA 5HY6A 4JV5Q 2I5HA 3HOUG 5C4JB 2Q8RE 3EBEA 3J81L 3J80E 2KA7A 1SSOA 1I50B 1FJGL 1B9MA 3I56A 1GJXA 2WAQG 1N33Q 3OYYA 2JA6G 4PMBA 1RHPA 4AYBG 4LUOA 5EPKA 2KBNA 3X3MA 1ENAA 4GNXC 1Y1VH 1XWEA 4JI3Q 1N8RC 4IPHA 2OT2A 3KLSA 4JI5L 2B2VA 1CKOA 2LFNA 2PZTA 1F9PA 3WDNA 5IOCA 1LM0A 2WKDA 3A8KE 1I4HA 3E0JA 4I7AA 2NUCA 4IUUA 5IT9L 5C3EH 1N34Q 4XTCS 2Q2UA 4S3SA 2Z8LA 4GN5A 4CJ1B 3K5MA 4UPAA 4DV0L 3G4SA 3WOFA 4LFCQ 4JYAQ 2DJGC 2FMCA 2WV6D 3NTIA 5CV9A 2BH8A 1BBUA 3OPOA 4GLAC 1KD1C 3S1NH 1ZYRD 1I6HB 3KBXA 5KYLA 1ICFB 1QCBD 2NVTB 3DMUA 1S3OA 3DEOA 1JB7A 1WCMB 4JI0L 4A75A 1Y1WG 2EXZA 4JBWA 5JOBA 3C46A 3EVQA 4C3JB 5JEAH 5A2QE 1SNOA 4B3TQ 4CKBA 1CQVA 4KY7A 4RH6A 2H1EA 4JI8L 3CCRA 4JBKA 4OX9Q 3RMHA 3S24A 2L11A 3MZ5A 2YTVA 4P73A 2E5LL 2R93H 3ZYYX 3I4NH 4A3DB 4CDEC 4X3TA 1EUJA 3D8GA 2RQXA 4H13C 4QL5A 3TRZA 5EJWA 3HOWG 2KCNA 3ULPA 1WYDA 1UEBA 3NTKA 4K5WA 1VQ6A 3H3VI 3HOYH 3OSOA 1A0IA 3CMAA 4IFDJ 1W6JA 4A93B 2CCZA 4LF9L 1KRSA 1AP0A 4IQZA 4BY7G 4DAVA 2MQHA 1LTRD 5ELBA 2UXDQ 4RAUC 1HNZL 4CJ2C 3OTOL 2OCEA 4X65Q 1SXTA 2L0CA 2BE5C 5KNDA 1E0BA 4BBSH 4ZAIA 5LMUL 3HOXG 2ES2A 2E2HB 2PI2A 2HQEA 3KLWA 4EVOA 4DR4Q 2PZUA 4B3RL 4DV1L 2G9DA 1EIYB 1K8AC 3DWQA 3HG9A 3R2IA 1L0YB 1IL8A 3U9SA 1GD7A 1C48A 1CKNB 1GVPA 3J7ZC 4RMFA 5M5YH 1VQ7A 2C35B 4JPBW 3VA7A 1EFID 2HD3A 3S2HH 1TWFB 1LT4D 5EGTA 3PIPA 4QUCA 1PVOA 4EQPA 4P2CB 1J5EQ 2ZXPA 1JCKB 1VMPA 2D0PA 1K9MC 1PFBA 1B4OA 4J1MA 3RZDH 2ATWA 4QY7A 1E22A 2OTLA 4P71A 3SK6A 3F2DA 2B2UA 2F0TA 4J15A 2UU9L 4GKJL 3MFYA 1HFGA 2AHOB 2F0JA 4A3FG 3BJUA 3MXNA 3T51B 1DZ1A 2CFMA 5GROA 2JK8A 1Y14B 2QDBA 1HRJA 3H3VH 3E3XA 4DAPA 5G3LF 1LYLA 1QVCA 4HTHA 4XT1B 4R4CA 2AKWB 2H5XA 3UDIA 2UXBL 1X65A 1IBLL 1SNMA 5C4XB 5M5XB 5IYDG 4KK7A 2ZXOA 4KLKA 1SMYD 3ONAB 1STNA 2P5ZX 1N32L 1X9NA 2F0QA 1PTOB 3SHLA 2K5WA 5EQ0A 1EYGA 2LXKA 2VUMB 3PUXA 4BXXH 4LF8Q 1EU3A 3F8TA 3ND9A 4UP7A 3CCUA 2WB1G 1IBML 3J80i 1MI2A 3AEVA 1GHJA 1QZHA 1D2BA 5IP7H 1RL2A 3DM1A 5GAGC 1DOMA 4JC0A 4RGOS 2SNMA 4KKSA 3I3CA 4A3KH 2JA8G 5TSSA 1RODA 2KCCA 1DYQA 1VF7A 2B2YC 1A3VA 4U673 5DEHA 4WRDA 1YHQA 1JOOA 2K7VA 3IFTA 1C9OA 3NPPA 1H9JA 2D9UA 3PV0A 3H6MA 4LF6L 2ZT9C 1O78A 4RKLA 4F7XA 5G3LD 4R4QA 5JPNC 2KHSA 4C3IG 1AE3A 1XPOA 3I4MH 5DLQE 1M1KC 4DR7L 3L7ZC 5LL6S 2F0SA 2RA4A 1K3RA 3L3OC 1TS2A 2GVBA 4K5XA 1E1TA 3D6WA 1SE4A 1WJJA 4LFBQ 1VQEA 1EZ6A 4BBRH 1BKBA 1ZYRC 3GO5A 3H91A 4RCNA 1K8MA 1JWUD 3HOUB 2NB0A 2KJXA 3CAMA 2CHBD 3GP7A 1HUNA 4Z9CB 3AYHB 5EKIA 4MHEA 2NN6G 2JA6B 4L5QA 4IPDA 1HNWL 4K8JA 1F2YA 3PO2B 1QVGA 2EYHA 2JA5B 1Y1VG 4X66L 1A8VA 1S72A 4RG1A 1B70B 1TS3A 4X62Q 3CRLC 2R7ZB 4JV5L 5IYCH 1F77A 2BH2A 2WKCA 3A8JE 2E75C 4KI0A 2K14A 3DWAA 1N33L 1MJEA 5FOBB 3CCMA 3K0YA 1A6XA 1Y8PB 5KNCA 1EWIA 1CT1D 2WAQE 5C3EG 3I4OA 2I46A 1QILA 3IRBA 3KDFA 1OTCA 2F0PA 4AYBE 1SYGA 1WTOA 3I70A 5T1IA 3NBHB 2SEBD 5E3FA 1JE4A 1HZAA 1IL2A 1AFPA 4CJ0B 4JI6L 3S14B 4Q5VA 1VQ4A 3PUYA 3VR2A 4DV2Q 2LY7A 1STEA 2N55A 3O13A 3FPUB 1UE7A 5JEAG 1KXLA 1K83B 1Q86C 3K7AH 2ASBA 2NVQB 2RBMA 3F1ZA 5K5PA 3VR6A 4LFAL 3CHBD 3TBIB 1Q8IA 5M3FH 3EJIA 3TP8A 4A3CH 4RCOA 3FKIG 4G57A 5FJ8G 4DUYL 4LF5Q 1STHA 2R93G 4K14A 4P75A 4C3JG 1JWMD 4PNYA 4FXGC 3J7AF 4KJOA 4JI2Q 4PV1C 2A1AA 2LXJA 1X3FA 4DR1L 1XNRL 4B3TL 4FF4A 5J39A 4POFA 1STBA 1LTBD 1YI2A 3G7LA 1BNZA 3S16H 3GTQH 3HOWB 4OX9L 1A3UA 4DXFA 1HA6A 3HOYG 4LF4Q 5EKLA 1HH2P 3T4AC 4TVAB 4TKOB 4RGTA 3WWVA 5GAEC 3NSWA 1CSPA 1B8AA 2BDOA 4BY7B 3I4LA 1I4GA 1LTAD 1VCIA 4ODGA 4DR5Q 2PCFB 2F3VA 1G2SA 1SFOB 3FDTA 5ELNA 4DV3Q 1D5ZC 3JC66 1QNKA 4LNQA 2EVBA 2VNUD 1EIHA 1X56A 2QF7A 5C3XA 1RTNA 3SK8A 3W3AA 4JVZA 1A2TA 5I4DA 3CRKC 4WJ3M 1TWGH 3D4DA 2UXDL 2B29A 1PHJA 2FMMA 1V1PB 5LL6X 1S5DD 1BR9A 1D1IA 3I2ZA 3T16A 4A3BH 4GLXA 1VQLA 1Q81C 1YHBA 1GHKA 5IP9H 5HURA 5C0XJ 1TVXA 1SMYC 2O2LD 4DR2L 4OO1H 5JJLA 1QZGA 3CCVA 4NKLA 4HMJA 4EQNA 3PF5A 3UDFA 2RF4A 3CCQA 2DY7A 1VQHA 1ONLA 3M9BA 4B9WA 1PH9A 3NENA 3M7NA 4C2MH 2B2VC 1CSQA 1O7LA 3BYTB 4QB4A 3DM3A 3FPPA 1SN8A 2MFIA 3NK9A 3GTJH 1I3QH 1NSNS 1G291 1VQKA 2F0OA 2F4VQ 3T1HQ 3RLNA 4EGVA 2IHEA 1PTOC 1XYIA 1J5EL 2PQEA 2SNSA 5I2YA 4DAYB 4WJWA 4IFDI 4N8X1 3V96A
chains in the Genus database with same CATH topology
1KRTA 1TWFH 4PG3A 3HOZG 3S17H 3S1QH 3HKZG 1JJ2A 5C3EH 3A0JA 1N34Q 4XTCS 5IE8A 2KENA 4ME3A 1YBYA 5M5WH 2Q2UA 1N34L 4MNOA 3NELA 4GN5A 3W5OA 4DV0Q 4OWXB 3M4OH 2R6GA 4UPAA 1HJPA 4DV0L 3G4SA 3J80c 3HKZE 4AIMA 4LFCQ 4JYAQ 1E1OA 1PV4A 1VQMA 1E3PA 3MXNB 3KDFB 2BH8A 1BBUA 4LFCL 4JYAL 4GLAC 2WFWA 1KD1C 3S1NH 1QUQA 4GS3A 4DV6L 5C4XG 4FDBA 3HOZH 1VQ8A 1VS0A 1JJCB 1S3OA 2N49A 1JB7A 3F2BA 1MJCA 2V1CC 4OWTB 3JAMc 3I4NG 4JI0L 1HR0Q 3G48A 4A75A 4IPCA 1Y1WG 1KHIA 3D0FA 1X54A 4JBWA 5M3MG 1HR0L 1FGUA 1I94L 5GAHC 4B3TQ 3KFUA 1MKHA 1U0LA 2VUMG 4BY1H 4JI8Q 1YEZA 1Z47A 2Q2TA 4OWWB 3AFQA 4HJ9A 1JMCA 4JI8L 1UE1A 2HIXA 4DNIA 3RR5A 4A3KG 3CCRA 4GKKQ 4JBKA 2DUDA 4OX9Q 5C4XH 5M5XH 4P74A 3S24A 2JA7H 4GKKL 4JI7Q 1IXRA 3CQZH 3H0GG 4A3LG 1EQRA 3TEHB 2YTVA 4P73A 2E5LL 2R93H 2K5NA 4NXMQ 1PFSA 1NMFA 1ASYA 3I4NH 2R7DA 4IFDG 4NXML 4OONA 1Y1WH 3CC4A 1VQNA 3HKSA 3H15A 2NVQH 4P72A 5M3MH 4MZ9A 1KQSA 1EUJA 2WB1E 1RIPA 3TRZA 4QL5A 2VUMH 2NN6I 1YNXA 1O7IA 4NPSA 3HOWG 5E7NA 3ULPA 1WYDA 4YWKA 2JA9A 2NZHA 1UEBA 1Q46A 2KCTA 3FP9A 2K4KA 4BBSG 3I4MG 3JAMi 3J81i 3S15H 1WFQA 4HIDA 1PH2A 1VQ6A 4A3LH 4QGUA 1XTDA 2F52A 3H3VI 3HOYH 1X3GA 4QQBX 1L1OB 1A0IA 3CMAA 4IFDJ 2CCZA 1M90C 1KL9A 2I0QA 4HJ5A 4LF9L 1FL0A 1KRSA 1XJVA 2GVAA 4BY7G 4GOPC 1G6PA 1VQJA 3CCEA 4A3JH 2DGYA 2MQHA 4YY3Q 2UXDQ 1HNZL 4NXNQ 3K81C 3OTOL 2OCEA 3HOWH 4X65Q 1YIJA 3TREA 1TWHH 1SR3A 1LUZA 2OQKA 1HZ9A 1GO3E 4LUVA 2UXCQ 4X65L 1TWCH 2UXCL 2L15A 2IX0A 4GN4B 4HIMA 4BBSH 3CW2C 4PZ8A 5LMUL 1IBKQ 3CD6A 2R92H 3HOXG 1YZ6A 3PGZA 2ES2A 2ZJRA 3CCSA 3ERSX 4GOPA 2PI2A 1N36Q 5IWAQ 4IOAA 3MEFA 3E9HA 3KLWA 4B3RQ 1N36L 4DR4Q 2PMZE 5IWAL 4DV1Q 2E2IH 4AQYQ 1Q1BA 4DR4L 4B3RL 1C0AA 4DV1L 4AQYL 1XMOQ 2RHSB 1EIYB 1K8AC 3CF5A 4YCUA 2IT1A 1NTGA 4DV4Q 2K50A 1EQQA 3PO2G 1GD7A 5ELOA 4DV4L 2ID0A 1YJNA 1CKNB 3B6YA 1GVPA 3J7ZC 4RMFA 3U4ZA 5M5YH 1YVCA 4JG2A 3HOXH 4A3EH 1VQ7A 4JI4L 1H95A 1IZ6A 2C35B 1J6QA 2R7ZG 3NEMA 3S2HH 1Z9FA 4TQUS 5FLMG 3PIPA 1PVOA 3M4QA 3HOUH 1T9HA 4L5SA 4WJ4A 1J5EQ 3PUWA 3RNUA 1R9TH 1XMQQ 2B63G 2D0PA 4DV7Q 3U50C 1K9MC 1VQAA 3J81j 2PI2E 3CXCA 4QY7A 1E22A 4DV7L 3RZDH 2ATWA 2OTLA 4P71A 2K5VA 2JA6H 2UU9Q 1NJIC 3PO2H 3F2DA 4GKJQ 1VQGA 5EAYA 3RN2A 4J15A 3CMEA 2JA5H 4A4IA 2UU9L 4GKJL 1NE3A 2JE6I 2AHOB 2ZTDA 1PH4A 2R7ZH 4A3FG 4BA1I 1SE8A 3BJUA 2JA5G 1MIUA 4ALPA 2CFMA 5GROA 3E0EA 2JK8A 1Y14B 2LSSA 2N8NA 1HZBA 2K5HA 2B63H 3BZCA 3H3VH 3ULJA 1LYLA 2E2JH 1Q82C 3E9IA 4DV6Q 1OXTA 1QVCA 4R4CA 4DPGA 4BXXG 5M3FG 1PA6A 4A3CG 1WOCA 2AKWB 2H5XA 3BU2A 3UDIA 1X65A 4DAMA 2QA4A 2UXBL 1IBLL 1B7YB 1PH5A 2VL6A 4JI0Q 2CWAA 5IYDG 4R1JA 1SRUA 2K52A 3KF8B 4A3FH 4GNXB 3A5UA 4HIOA 1I94Q 2OTJA 3EN2A 3PSIA 1IYJB 1TWAH 1VQCA 2I5MX 4KLKA 4YWLA 5IP7G 1N32Q 1S40A 5BR8L 2NZOA 3ZJYC 2YU9H 1N32L 1X9NA 1XNQQ 2UUBL 1XNQL 1EYGA 1PH8A 4OO1I 2LXKA 3CCLA 3PUXA 3S14H 1OXVA 2WP8J 4R4IA 2NVYH 4POGA 4BXXH 1SMXA 2BA0A 4LF8Q 2E5LQ 1WCMG 3F8TA 4UP7A 3CCJA 1IBMQ 1W3SA 3F2CA 4LF8L 4UP9A 3CCUA 2WB1G 1IBML 1QUQB 4BA2I 4LF5L 3GTLH 1K83H 3J80i 3AEVA 4YHHQ 1FVIA 1QZHA 4JBMA 5IP7H 4YHHL 1CKMA 1RL2A 1SLJA 5GAGC 5C44G 3UE1A 1V1QA 2F3IA 4JC0A 4A3IG 3A5ZB 1L2FA 4A3KH 2CWPA 5JJIA 2JA8G 4O2DA 1ASZA 3G71A 2VQFQ 1BVSA 3H0GH 3ICEA 2AWNA 1VQ9A 3Q8DA 2D0OA 3W1BA 2VQFL 3D31A 4A3DG 2EXDA 4LWCA 4QIWE 2HIVA 4LF9Q 1YHQA 4JOIA 4B3SQ 1JJGA 2R7FA 3RLOA 2YYZA 3L2PA 2QGQA 1C9OA 1KAWA 4B3SL 1CUKA 5C44H 4BBRG 1E24A 1HNZQ 3OTOQ 1YHAA 1PH3A 1C7YA 3PV0A 1VQOA 4LF6L 2Z6KA 2XTIA 2PQAB 4R4QA 4DR7Q 1JT8A 5LMUQ 1UE6A 1AE3A 1XPOA 3CC2A 2Z0SA 5DLQE 1M1KC 1VQ5A 3I4MH 4DR7L 3L7ZC 3HOVG 4A93G 3J7A5 3PO3G 4HJAA 1VQPA 2FXQA 2I5LX 4EX5A 3T1YQ 4LF7Q 1K3RA 2K75A 4L5TA 4PMWA 4HJ7A 4IO9A 2GVBA 2IHFA 3I55A 1PYBA 3T1YL 4LF7L 1GKHA 4DR6L 4BY7H 1E1TA 4LFBQ 1WJJA 5LMNW 1YITA 2UUAQ 1VQEA 4BBRH 1BKBA 3SGIA 5IYCG 2UUAL 1VQDA 3AFPA 3GO5A 1PH6A 4LFBL 4KHPL 1CKNA 1SFOH 5LMNL 1K73C 3GTMH 2AMCB 3CAMA 2UUCQ 4APVA 2B3GA 2VQEQ 3GTGH 4JCVE 1TXYA 2UUCL 3S1RH 4JI4Q 2VQEL 1EIFA 2AWOA 3KJOA 1HNWQ 3AYHB 3UE0A 3HOVH 2EIFA 1U5KA 2NN6G 4L5QA 1UE5A 2YTXA 4IPDA 1HNWL 1A63A 3FHWA 4DR6Q 4X66Q 1QVGA 1Y1VG 2E8GA 2N78A 4X66L 1A8VA 1X3EA 1PH1A 1S72A 2JEAI 2GN5A 3AQQA 4RG1A 1B70B 4X62Q 3CC7A 1XPUA 3KOJA 3PUZA 3VDYA 4JV5L 5IYCH 3M85A 1LTLA 4X62L 5GADC 4GOPB 1WI5A 1D8LA 2BH2A 1YJWA 2ALYB 2VY3A 1BBWA 5AJ3L 2HT1A 4KI0A 1EFWA 2JQOA 4HJ8A 4Y52H 2K14A 1V43A 1V9PA 1N33L 1MJEA 2IX1A 3GDEA 3UDXA 3CCMA 1DGSA 2Q2IA 3TS0A 1X55A 5IY0A 1EWIA 2EQSA 2WAQE 5C3EG 3I4OA 4NB3A 5C4JH 1OXUA 3IRBA 1N9WA 3KDFA 5FLMH 1OTCA 3GTKH 4AYBE 1I50H 2ZJPA 4JBJA 4AH6A 4DK3C 2F4VL 1I5FA 1K8GA 4X64Q 3NBHB 4X64L 1D7QA 3DLLA 5IYBG 1HZAA 1IL2A 1OXSC 2MNAA 2UXBQ 4GNXA 4JI6Q 1GM5A 1IBLQ 3S1MH 2VZAA 2YTYA 4B3ML 4JI6L 1G51A 2BA1A 3KF6B 1L0WA 1VQ4A 3RLFA 3PUYA 3A74A 1Q12A 2A19A 4DV2Q 3STBC 3RN5A 1VQBA 4MTNA 5BR8Q 4HIKA 4DV2L 3EIVA 5JEAG 1UE7A 4GLVB 1KXLA 1XPRA 1Q86C 2HHHQ 4OO1G 3K7AH 2UUBQ 4X6AH 2ASBA 1PH7A 4BY1G 2HHHL 4IJHA 2QEXA 3F1ZA 4LFAQ 5JJKA 5C0XI 1PYSB 2KCMA 4UY8C 3S2DH 2VS1A 5IYBH 4LFAL 4LW1A 2ZTCA 1YJ9A 5M3FH 4A3CH 3RZOH 2JEBI 3KJPA 2JA7G 4DUYQ 3HFZB 1L1OC 4A3MG 1NMGA 5FJ8G 3FKIG 4DUYL 3OW2A 4LF5Q 1QVFA 2R93G 3K80C 1HR0W 2VW9A 4P75A 5IYDH 2A8VA 4R4OA 4GN3B 3J81c 4IPGA 4KHZA 4JI2Q 4LUZA 4XIGS 5JEAJ 4JI2L 4DR1Q 1XNRQ 1HNXQ 1X6OA 2A1AA 2LXJA 3ULLA 1X3FA 2D62A 4DR1L 3L0OA 3M4PA 4JOIC 3U58A 1HNXL 4B3TL 1XNRL 3CPFA 4POFA 3CPWA 1YI2A 1I6HH 4A76A 1P16A 1Q7YC 2RHQB 3KYHC 3S16H 1L1OA 4DV5Q 5GQOA 3GTQH 3M3YH 4YWMA 2NVTH 5K36G 3PUVA 4DV5L 4A3GG 2OQ0A 1W2BA 1WCMH 4OX9L 4A3MH 4JI1Q 1Q8KA 3BZKA 4DK6C 5FJ8H 2Z6KC 3FKIH 4PZ7A 3HOYG 4JI7L 4LF4Q 4JI1L 4C3JH 4C3HH 2PNHA 1HH2P 2ZTEA 4LF4L 1A62A 3PF4A 4K0KQ 4TVAB 1E7ZA 3GTOH 4PZ6A 4K0KL 3WWVA 5GAEC 2PQAA 1CSPA 3PIOA 4Y7NH 4UP8A 4A3JG 4LF6Q 1B8AA 2ZM6Q 4A3IH 1VCIA 1OXXK 4DR5Q 2Y0SG 5H1SE 2ZM6L 4O0AA 5IT9c 4A3BG 4DUZQ 2JA8H 4DR5L 4A3GH 2MO0A 4DUZL 3K0XA 5ELNA 2N3SA 5IP9G 4DV3Q 2R92G 5C0XG 4A3DH 3JC66 2Y0SE 4DV3L 2CQOA 4LNQA 2VNUD 2KHIA 1X56A 1EOVA 4DR3Q 3ER0A 3GD7A 2YV5A 4QJFA 4KHPQ 4IJLA 4DR3L 4R4TA 2CKZB 5LMNQ 3STBD 2MO1A 4YCWA 4WJ3M 4YY3L 1TWGH 2UXDL 2B29A 1HZCA 1PHJA 4NXNL 1UWVA 4A3BH 3I2ZA 3TS2A 4GLXA 1VQLA 4C3IH 1Q81C 1Q1EA 4L5RC 1YHBA 4YCVA 3PCOB 4A93H 1AE2A 5IP9H 4A3EG 1NBWA 5FLXc 5C0XJ 5HGQA 3W1GA 4DR2Q 1KIXA 3GTPH 3PO3H 3K7UC 1IBKL 2NVXH 2KHJA 3LGJA 4DR2L 3I7FA 5J3BA 5JJLA 1QZGA 3CCVA 1SROA 2Q2HA 5HY6A 4JV5Q 2I5HA 3PF5A 3HOUG 3UDFA 1K0RA 3EBEA 1FJGQ 2RF4A 5AJ3Q 3CCQA 1VQHA 3TQYA 3M9BA 1FJGL 4IOCA 1PH9A 3I56A 1XMOL 3NENA 2WAQG 4C2MH 3M7NA 1N33Q 3OYYA 2JA6G 2E2HH 1CSQA 1P8LA 4AYBG 4LUOA 3DM3A 3UDGA 3U4VA 1KC8C 2KBNA 1SN8A 2MFIA 3GTJH 4GNXC 1I3QH 1G291 1Y1VH 2ZJQA 1VQKA 1AH9A 4JI3Q 2F4VQ 3T1HQ 3RLNA 1N8RC 3CP0A 4EQ5A 4JI3L 4JI5Q 2IHEA 1VQFA 4IPHA 3T1HL 1NY4A 2HQLA 4JI5L 1J5EL 1JE5A 3G6EA 1VQIA 3K8AA 1XMQL 1CKOA 2IY5B 2XGTA 3KF6A 2RCNA 2JJQA 2OWOA 4OXPA 4DAYB 1LM0A 4IFDI 4DKAC 4B3MQ 4H02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRT A;  1TWF H;  4PG3 A;  3HOZ G;  3S17 H;  3S1Q H;  3HKZ G;  1JJ2 A;  5C3E H;  3A0J A;  1N34 Q;  4XTC S;  5IE8 A;  2KEN A;  4ME3 A;  1YBY A;  5M5W H;  2Q2U A;  1N34 L;  4MNO A;  3NEL A;  4GN5 A;  3W5O A;  4DV0 Q;  4OWX B;  3M4O H;  2R6G A;  4UPA A;  1HJP A;  4DV0 L;  3G4S A;  3J80 c;  3HKZ E;  4AIM A;  4LFC Q;  4JYA Q;  1E1O A;  1PV4 A;  1VQM A;  1E3P A;  3MXN B;  3KDF B;  2BH8 A;  1BBU A;  4LFC L;  4JYA L;  4GLA C;  2WFW A;  1KD1 C;  3S1N H;  1QUQ A;  4GS3 A;  4DV6 L;  5C4X G;  4FDB A;  3HOZ H;  1VQ8 A;  1VS0 A;  1JJC B;  1S3O A;  2N49 A;  1JB7 A;  3F2B A;  1MJC A;  2V1C C;  4OWT B;  3JAM c;  3I4N G;  4JI0 L;  1HR0 Q;  3G48 A;  4A75 A;  4IPC A;  1Y1W G;  1KHI A;  3D0F A;  1X54 A;  4JBW A;  5M3M G;  1HR0 L;  1FGU A;  1I94 L;  5GAH C;  4B3T Q;  3KFU A;  1MKH A;  1U0L A;  2VUM G;  4BY1 H;  4JI8 Q;  1YEZ A;  1Z47 A;  2Q2T A;  4OWW B;  3AFQ A;  4HJ9 A;  1JMC A;  4JI8 L;  1UE1 A;  2HIX A;  4DNI A;  3RR5 A;  4A3K G;  3CCR A;  4GKK Q;  4JBK A;  2DUD A;  4OX9 Q;  5C4X H;  5M5X H;  4P74 A;  3S24 A;  2JA7 H;  4GKK L;  4JI7 Q;  1IXR A;  3CQZ H;  3H0G G;  4A3L G;  1EQR A;  3TEH B;  2YTV A;  4P73 A;  2E5L L;  2R93 H;  2K5N A;  4NXM Q;  1PFS A;  1NMF A;  1ASY A;  3I4N H;  2R7D A;  4IFD G;  4NXM L;  4OON A;  1Y1W H;  3CC4 A;  1VQN A;  3HKS A;  3H15 A;  2NVQ H;  4P72 A;  5M3M H;  4MZ9 A;  1KQS A;  1EUJ A;  2WB1 E;  1RIP A;  3TRZ A;  4QL5 A;  2VUM H;  2NN6 I;  1YNX A;  1O7I A;  4NPS A;  3HOW G;  5E7N A;  3ULP A;  1WYD A;  4YWK A;  2JA9 A;  2NZH A;  1UEB A;  1Q46 A;  2KCT A;  3FP9 A;  2K4K A;  4BBS G;  3I4M G;  3JAM i;  3J81 i;  3S15 H;  1WFQ A;  4HID A;  1PH2 A;  1VQ6 A;  4A3L H;  4QGU A;  1XTD A;  2F52 A;  3H3V I;  3HOY H;  1X3G A;  4QQB X;  1L1O B;  1A0I A;  3CMA A;  4IFD J;  2CCZ A;  1M90 C;  1KL9 A;  2I0Q A;  4HJ5 A;  4LF9 L;  1FL0 A;  1KRS A;  1XJV A;  2GVA A;  4BY7 G;  4GOP C;  1G6P A;  1VQJ A;  3CCE A;  4A3J H;  2DGY A;  2MQH A;  4YY3 Q;  2UXD Q;  1HNZ L;  4NXN Q;  3K81 C;  3OTO L;  2OCE A;  3HOW H;  4X65 Q;  1YIJ A;  3TRE A;  1TWH H;  1SR3 A;  1LUZ A;  2OQK A;  1HZ9 A;  1GO3 E;  4LUV A;  2UXC Q;  4X65 L;  1TWC H;  2UXC L;  2L15 A;  2IX0 A;  4GN4 B;  4HIM A;  4BBS H;  3CW2 C;  4PZ8 A;  5LMU L;  1IBK Q;  3CD6 A;  2R92 H;  3HOX G;  1YZ6 A;  3PGZ A;  2ES2 A;  2ZJR A;  3CCS A;  3ERS X;  4GOP A;  2PI2 A;  1N36 Q;  5IWA Q;  4IOA A;  3MEF A;  3E9H A;  3KLW A;  4B3R Q;  1N36 L;  4DR4 Q;  2PMZ E;  5IWA L;  4DV1 Q;  2E2I H;  4AQY Q;  1Q1B A;  4DR4 L;  4B3R L;  1C0A A;  4DV1 L;  4AQY L;  1XMO Q;  2RHS B;  1EIY B;  1K8A C;  3CF5 A;  4YCU A;  2IT1 A;  1NTG A;  4DV4 Q;  2K50 A;  1EQQ A;  3PO2 G;  1GD7 A;  5ELO A;  4DV4 L;  2ID0 A;  1YJN A;  1CKN B;  3B6Y A;  1GVP A;  3J7Z C;  4RMF A;  3U4Z A;  5M5Y H;  1YVC A;  4JG2 A;  3HOX H;  4A3E H;  1VQ7 A;  4JI4 L;  1H95 A;  1IZ6 A;  2C35 B;  1J6Q A;  2R7Z G;  3NEM A;  3S2H H;  1Z9F A;  4TQU S;  5FLM G;  3PIP A;  1PVO A;  3M4Q A;  3HOU H;  1T9H A;  4L5S A;  4WJ4 A;  1J5E Q;  3PUW A;  3RNU A;  1R9T H;  1XMQ Q;  2B63 G;  2D0P A;  4DV7 Q;  3U50 C;  1K9M C;  1VQA A;  3J81 j;  2PI2 E;  3CXC A;  4QY7 A;  1E22 A;  4DV7 L;  3RZD H;  2ATW A;  2OTL A;  4P71 A;  2K5V A;  2JA6 H;  2UU9 Q;  1NJI C;  3PO2 H;  3F2D A;  4GKJ Q;  1VQG A;  5EAY A;  3RN2 A;  4J15 A;  3CME A;  2JA5 H;  4A4I A;  2UU9 L;  4GKJ L;  1NE3 A;  2JE6 I;  2AHO B;  2ZTD A;  1PH4 A;  2R7Z H;  4A3F G;  4BA1 I;  1SE8 A;  3BJU A;  2JA5 G;  1MIU A;  4ALP A;  2CFM A;  5GRO A;  3E0E A;  2JK8 A;  1Y14 B;  2LSS A;  2N8N A;  1HZB A;  2K5H A;  2B63 H;  3BZC A;  3H3V H;  3ULJ A;  1LYL A;  2E2J H;  1Q82 C;  3E9I A;  4DV6 Q;  1OXT A;  1QVC A;  4R4C A;  4DPG A;  4BXX G;  5M3F G;  1PA6 A;  4A3C G;  1WOC A;  2AKW B;  2H5X A;  3BU2 A;  3UDI A;  1X65 A;  4DAM A;  2QA4 A;  2UXB L;  1IBL L;  1B7Y B;  1PH5 A;  2VL6 A;  4JI0 Q;  2CWA A;  5IYD G;  4R1J A;  1SRU A;  2K52 A;  3KF8 B;  4A3F H;  4GNX B;  3A5U A;  4HIO A;  1I94 Q;  2OTJ A;  3EN2 A;  3PSI A;  1IYJ B;  1TWA H;  1VQC A;  2I5M X;  4KLK A;  4YWL A;  5IP7 G;  1N32 Q;  1S40 A;  5BR8 L;  2NZO A;  3ZJY C;  2YU9 H;  1N32 L;  1X9N A;  1XNQ Q;  2UUB L;  1XNQ L;  1EYG A;  1PH8 A;  4OO1 I;  2LXK A;  3CCL A;  3PUX A;  3S14 H;  1OXV A;  2WP8 J;  4R4I A;  2NVY H;  4POG A;  4BXX H;  1SMX A;  2BA0 A;  4LF8 Q;  2E5L Q;  1WCM G;  3F8T A;  4UP7 A;  3CCJ A;  1IBM Q;  1W3S A;  3F2C A;  4LF8 L;  4UP9 A;  3CCU A;  2WB1 G;  1IBM L;  1QUQ B;  4BA2 I;  4LF5 L;  3GTL H;  1K83 H;  3J80 i;  3AEV A;  4YHH Q;  1FVI A;  1QZH A;  4JBM A;  5IP7 H;  4YHH L;  1CKM A;  1RL2 A;  1SLJ A;  5GAG C;  5C44 G;  3UE1 A;  1V1Q A;  2F3I A;  4JC0 A;  4A3I G;  3A5Z B;  1L2F A;  4A3K H;  2CWP A;  5JJI A;  2JA8 G;  4O2D A;  1ASZ A;  3G71 A;  2VQF Q;  1BVS A;  3H0G H;  3ICE A;  2AWN A;  1VQ9 A;  3Q8D A;  2D0O A;  3W1B A;  2VQF L;  3D31 A;  4A3D G;  2EXD A;  4LWC A;  4QIW E;  2HIV A;  4LF9 Q;  1YHQ A;  4JOI A;  4B3S Q;  1JJG A;  2R7F A;  3RLO A;  2YYZ A;  3L2P A;  2QGQ A;  1C9O A;  1KAW A;  4B3S L;  1CUK A;  5C44 H;  4BBR G;  1E24 A;  1HNZ Q;  3OTO Q;  1YHA A;  1PH3 A;  1C7Y A;  3PV0 A;  1VQO A;  4LF6 L;  2Z6K A;  2XTI A;  2PQA B;  4R4Q A;  4DR7 Q;  1JT8 A;  5LMU Q;  1UE6 A;  1AE3 A;  1XPO A;  3CC2 A;  2Z0S A;  5DLQ E;  1M1K C;  1VQ5 A;  3I4M H;  4DR7 L;  3L7Z C;  3HOV G;  4A93 G;  3J7A 5;  3PO3 G;  4HJA A;  1VQP A;  2FXQ A;  2I5L X;  4EX5 A;  3T1Y Q;  4LF7 Q;  1K3R A;  2K75 A;  4L5T A;  4PMW A;  4HJ7 A;  4IO9 A;  2GVB A;  2IHF A;  3I55 A;  1PYB A;  3T1Y L;  4LF7 L;  1GKH A;  4DR6 L;  4BY7 H;  1E1T A;  4LFB Q;  1WJJ A;  5LMN W;  1YIT A;  2UUA Q;  1VQE A;  4BBR H;  1BKB A;  3SGI A;  5IYC G;  2UUA L;  1VQD A;  3AFP A;  3GO5 A;  1PH6 A;  4LFB L;  4KHP L;  1CKN A;  1SFO H;  5LMN L;  1K73 C;  3GTM H;  2AMC B;  3CAM A;  2UUC Q;  4APV A;  2B3G A;  2VQE Q;  3GTG H;  4JCV E;  1TXY A;  2UUC L;  3S1R H;  4JI4 Q;  2VQE L;  1EIF A;  2AWO A;  3KJO A;  1HNW Q;  3AYH B;  3UE0 A;  3HOV H;  2EIF A;  1U5K A;  2NN6 G;  4L5Q A;  1UE5 A;  2YTX A;  4IPD A;  1HNW L;  1A63 A;  3FHW A;  4DR6 Q;  4X66 Q;  1QVG A;  1Y1V G;  2E8G A;  2N78 A;  4X66 L;  1A8V A;  1X3E A;  1PH1 A;  1S72 A;  2JEA I;  2GN5 A;  3AQQ A;  4RG1 A;  1B70 B;  4X62 Q;  3CC7 A;  1XPU A;  3KOJ A;  3PUZ A;  3VDY A;  4JV5 L;  5IYC H;  3M85 A;  1LTL A;  4X62 L;  5GAD C;  4GOP B;  1WI5 A;  1D8L A;  2BH2 A;  1YJW A;  2ALY B;  2VY3 A;  1BBW A;  5AJ3 L;  2HT1 A;  4KI0 A;  1EFW A;  2JQO A;  4HJ8 A;  4Y52 H;  2K14 A;  1V43 A;  1V9P A;  1N33 L;  1MJE A;  2IX1 A;  3GDE A;  3UDX A;  3CCM A;  1DGS A;  2Q2I A;  3TS0 A;  1X55 A;  5IY0 A;  1EWI A;  2EQS A;  2WAQ E;  5C3E G;  3I4O A;  4NB3 A;  5C4J H;  1OXU A;  3IRB A;  1N9W A;  3KDF A;  5FLM H;  1OTC A;  3GTK H;  4AYB E;  1I50 H;  2ZJP A;  4JBJ A;  4AH6 A;  4DK3 C;  2F4V L;  1I5F A;  1K8G A;  4X64 Q;  3NBH B;  4X64 L;  1D7Q A;  3DLL A;  5IYB G;  1HZA A;  1IL2 A;  1OXS C;  2MNA A;  2UXB Q;  4GNX A;  4JI6 Q;  1GM5 A;  1IBL Q;  3S1M H;  2VZA A;  2YTY A;  4B3M L;  4JI6 L;  1G51 A;  2BA1 A;  3KF6 B;  1L0W A;  1VQ4 A;  3RLF A;  3PUY A;  3A74 A;  1Q12 A;  2A19 A;  4DV2 Q;  3STB C;  3RN5 A;  1VQB A;  4MTN A;  5BR8 Q;  4HIK A;  4DV2 L;  3EIV A;  5JEA G;  1UE7 A;  4GLV B;  1KXL A;  1XPR A;  1Q86 C;  2HHH Q;  4OO1 G;  3K7A H;  2UUB Q;  4X6A H;  2ASB A;  1PH7 A;  4BY1 G;  2HHH L;  4IJH A;  2QEX A;  3F1Z A;  4LFA Q;  5JJK A;  5C0X I;  1PYS B;  2KCM A;  4UY8 C;  3S2D H;  2VS1 A;  5IYB H;  4LFA L;  4LW1 A;  2ZTC A;  1YJ9 A;  5M3F H;  4A3C H;  3RZO H;  2JEB I;  3KJP A;  2JA7 G;  4DUY Q;  3HFZ B;  1L1O C;  4A3M G;  1NMG A;  5FJ8 G;  3FKI G;  4DUY L;  3OW2 A;  4LF5 Q;  1QVF A;  2R93 G;  3K80 C;  1HR0 W;  2VW9 A;  4P75 A;  5IYD H;  2A8V A;  4R4O A;  4GN3 B;  3J81 c;  4IPG A;  4KHZ A;  4JI2 Q;  4LUZ A;  4XIG S;  5JEA J;  4JI2 L;  4DR1 Q;  1XNR Q;  1HNX Q;  1X6O A;  2A1A A;  2LXJ A;  3ULL A;  1X3F A;  2D62 A;  4DR1 L;  3L0O A;  3M4P A;  4JOI C;  3U58 A;  1HNX L;  4B3T L;  1XNR L;  3CPF A;  4POF A;  3CPW A;  1YI2 A;  1I6H H;  4A76 A;  1P16 A;  1Q7Y C;  2RHQ B;  3KYH C;  3S16 H;  1L1O A;  4DV5 Q;  5GQO A;  3GTQ H;  3M3Y H;  4YWM A;  2NVT H;  5K36 G;  3PUV A;  4DV5 L;  4A3G G;  2OQ0 A;  1W2B A;  1WCM H;  4OX9 L;  4A3M H;  4JI1 Q;  1Q8K A;  3BZK A;  4DK6 C;  5FJ8 H;  2Z6K C;  3FKI H;  4PZ7 A;  3HOY G;  4JI7 L;  4LF4 Q;  4JI1 L;  4C3J H;  4C3H H;  2PNH A;  1HH2 P;  2ZTE A;  4LF4 L;  1A62 A;  3PF4 A;  4K0K Q;  4TVA B;  1E7Z A;  3GTO H;  4PZ6 A;  4K0K L;  3WWV A;  5GAE C;  2PQA A;  1CSP A;  3PIO A;  4Y7N H;  4UP8 A;  4A3J G;  4LF6 Q;  1B8A A;  2ZM6 Q;  4A3I H;  1VCI A;  1OXX K;  4DR5 Q;  2Y0S G;  5H1S E;  2ZM6 L;  4O0A A;  5IT9 c;  4A3B G;  4DUZ Q;  2JA8 H;  4DR5 L;  4A3G H;  2MO0 A;  4DUZ L;  3K0X A;  5ELN A;  2N3S A;  5IP9 G;  4DV3 Q;  2R92 G;  5C0X G;  4A3D H;  3JC6 6;  2Y0S E;  4DV3 L;  2CQO A;  4LNQ A;  2VNU D;  2KHI A;  1X56 A;  1EOV A;  4DR3 Q;  3ER0 A;  3GD7 A;  2YV5 A;  4QJF A;  4KHP Q;  4IJL A;  4DR3 L;  4R4T A;  2CKZ B;  5LMN Q;  3STB D;  2MO1 A;  4YCW A;  4WJ3 M;  4YY3 L;  1TWG H;  2UXD L;  2B29 A;  1HZC A;  1PHJ A;  4NXN L;  1UWV A;  4A3B H;  3I2Z A;  3TS2 A;  4GLX A;  1VQL A;  4C3I H;  1Q81 C;  1Q1E A;  4L5R C;  1YHB A;  4YCV A;  3PCO B;  4A93 H;  1AE2 A;  5IP9 H;  4A3E G;  1NBW A;  5FLX c;  5C0X J;  5HGQ A;  3W1G A;  4DR2 Q;  1KIX A;  3GTP H;  3PO3 H;  3K7U C;  1IBK L;  2NVX H;  2KHJ A;  3LGJ A;  4DR2 L;  3I7F A;  5J3B A;  5JJL A;  1QZG A;  3CCV A;  1SRO A;  2Q2H A;  5HY6 A;  4JV5 Q;  2I5H A;  3PF5 A;  3HOU G;  3UDF A;  1K0R A;  3EBE A;  1FJG Q;  2RF4 A;  5AJ3 Q;  3CCQ A;  1VQH A;  3TQY A;  3M9B A;  1FJG L;  4IOC A;  1PH9 A;  3I56 A;  1XMO L;  3NEN A;  2WAQ G;  4C2M H;  3M7N A;  1N33 Q;  3OYY A;  2JA6 G;  2E2H H;  1CSQ A;  1P8L A;  4AYB G;  4LUO A;  3DM3 A;  3UDG A;  3U4V A;  1KC8 C;  2KBN A;  1SN8 A;  2MFI A;  3GTJ H;  4GNX C;  1I3Q H;  1G29 1;  1Y1V H;  2ZJQ A;  1VQK A;  1AH9 A;  4JI3 Q;  2F4V Q;  3T1H Q;  3RLN A;  1N8R C;  3CP0 A;  4EQ5 A;  4JI3 L;  4JI5 Q;  2IHE A;  1VQF A;  4IPH A;  3T1H L;  1NY4 A;  2HQL A;  4JI5 L;  1J5E L;  1JE5 A;  3G6E A;  1VQI A;  3K8A A;  1XMQ L;  1CKO A;  2IY5 B;  2XGT A;  3KF6 A;  2RCN A;  2JJQ A;  2OWO A;  4OXP A;  4DAY B;  1LM0 A;  4IFD I;  4DKA C;  4B3M Q;  4H02 A; 
#chains in the Genus database with same CATH topology
 3S2D B;  2F0E A;  1ESR A;  4ZUJ A;  3S17 H;  3S1Q H;  3HKZ G;  3MTS A;  1JOK A;  2KEN A;  1YBY A;  4MNO A;  3W5O A;  2EY6 A;  1WTW A;  2R6G A;  3NWS A;  3VR3 A;  2EYO A;  4AIM A;  1LT3 D;  1VQM A;  1E3P A;  4HED A;  3KDF B;  2QW7 A;  3K5N A;  5DM7 3;  1DD2 A;  5C4X G;  4FDB A;  1YNJ C;  1HTL D;  3HOZ H;  3M3Y B;  1VQ8 A;  1GUT A;  2CH4 W;  4N9P A;  5DM6 3;  3TZU A;  2JYO A;  1HR0 Q;  1FGB D;  1X54 A;  5GAH C;  3P75 A;  2EYJ A;  3PQI A;  2VUM G;  3GTO B;  1KNA A;  1YEZ A;  2Q2T A;  4OWW B;  1JMC A;  4HJ9 A;  2HIX A;  4Y7N B;  4DNI A;  4A3K G;  4GKK Q;  1EYC A;  4KMU C;  5T1G A;  4JI7 Q;  3CQZ H;  4A3L G;  1CM9 A;  2JA8 B;  4A3G B;  4NXM Q;  2B8F A;  2X69 A;  4G4K A;  1ASY A;  2IW3 A;  4OON A;  1VQN A;  3HKS A;  4P72 A;  5M3M H;  1KQS A;  2WB1 E;  4XT3 B;  3NBI A;  1B1Z A;  1PRT B;  1RKN A;  2NN6 I;  2Q8T A;  2K33 A;  1O7I A;  3R8B A;  1BQQ T;  3C2P A;  3PIO 3;  2NZH A;  4WJ4 A;  3I4M G;  4HID A;  2J7Z A;  2F52 A;  1LTS D;  1X3G A;  1LTG D;  1ZKO A;  4C3I B;  2XWB B;  2XRQ D;  1BCP F;  2I0Q A;  1EY9 A;  1XJV A;  1GUG A;  2GVA A;  2NVX B;  4XYQ A;  1GXD C;  4A3J H;  4FYD A;  5IGC A;  3A56 A;  2RCF A;  4EQO A;  1PRT D;  1SR3 A;  1GO3 E;  3J80 L;  1TWC H;  2UXC L;  1U4L A;  2L15 A;  1YNN D;  4GN4 B;  1G6Z A;  2OEO A;  1Z7T A;  4PZ8 A;  2R92 H;  1YZ6 A;  3ERS X;  4IAL A;  4GOP A;  1DJR D;  1DON A;  1BO0 A;  1EWH A;  2DNC A;  3MEF A;  3NWT A;  4ZK9 B;  2IX3 A;  1N36 L;  1ZEQ X;  5IWA L;  1BBX C;  1Y1V B;  4AQY Q;  2PYK A;  3JAM L;  2MHV A;  4UDU C;  2IT1 A;  1NTG A;  3EQL C;  4DV4 Q;  1EQQ A;  2KEE A;  5CV7 A;  1KDC A;  3PO2 G;  2L5T A;  3D6C A;  4A3E H;  2JA5 G;  2EY1 A;  4HSP A;  1YVC A;  4JG2 A;  4ILW A;  1IZ6 A;  4OHJ A;  1J6Q A;  2M00 A;  2DN8 A;  2R7Z G;  3J7Y W;  5CC4 A;  3NEM A;  3I73 A;  1MD2 D;  3R2T A;  1EYD A;  2A6E D;  4NMZ A;  1EYA A;  5CV6 A;  3C1F A;  4F88 A;  5C3E B;  3M4Q A;  1X3Q A;  2NWG A;  1T9H A;  2WII B;  4L5S A;  3PUW A;  1XMQ Q;  1R4P B;  2V4D A;  4MTK A;  4KD4 A;  5EBD A;  4DV7 Q;  1XTC D;  3J81 j;  3CXC A;  1Q3L A;  1U4P A;  1NJI C;  1PZJ D;  1ICW A;  1VQG A;  5EAY A;  5CGK A;  3RN2 A;  3BZD B;  3S1N B;  4KJN A;  2IWH A;  3DHQ A;  2JE6 I;  1PH4 A;  1V1O A;  1MIU A;  3QG1 A;  3E0E A;  4K8I A;  1J9O A;  2B63 H;  5CV4 A;  1MBY A;  5A2Q L;  1Q82 C;  3AMU A;  4DV6 Q;  3Q6S A;  5M3F G;  4A3C G;  1WOC A;  3BU2 A;  2X6G A;  4ZUI A;  2QA4 A;  2FHT A;  3HRZ C;  1EY4 A;  4FNF A;  1HHV A;  3VR5 A;  2CWA A;  2RSN A;  1XXG A;  2K52 A;  4R1J A;  3R93 A;  3A5U A;  5IGD A;  3FKI B;  1I94 Q;  2R93 B;  3EN2 A;  3PSI A;  1IYJ B;  2E2D C;  5CR3 A;  1S40 A;  3I4N B;  2NZO A;  4IUR A;  2K04 A;  1GUS A;  1XNQ L;  4QF4 A;  1OXV A;  2NVY H;  3M4Y A;  1JOR A;  2MPM A;  3CCJ A;  3F2C A;  1CK1 A;  4LF5 L;  2LS0 1;  3HOY B;  3DUZ A;  3VYU A;  1FVI A;  1WD0 A;  1NUC A;  4YHH L;  1PFN A;  3MXG A;  4HCE A;  5COR A;  3UE1 A;  1AEX A;  4DU9 A;  1D5X C;  1NR2 A;  1HCZ A;  1MSG A;  4WFN 3;  4F87 A;  5JJI A;  3MA2 B;  1ASZ A;  4K5V A;  2F0G A;  2VQF Q;  1EZ8 A;  1BVS A;  3R3O A;  3ICE A;  2AWN A;  1VQ9 A;  5FKA C;  3Q8D A;  1TY2 A;  3D31 A;  1F9Q A;  1K3B C;  4BBS B;  5LHY 1;  1G91 A;  1TT2 A;  1JJG A;  3L2P A;  4B3S L;  2Z4I A;  5C44 H;  1AW7 A;  1E24 A;  3DEP A;  1C7Y A;  4TRD A;  4G7Z C;  4BWG B;  1VQO A;  3P20 A;  1K8O A;  2Z6K A;  1JT8 A;  2PQA B;  1X3P A;  1UE6 A;  3BVG A;  4IUN A;  3AB9 A;  3CC2 A;  3J7A 5;  1FNV A;  3NTH A;  4HJA A;  1VQP A;  4LF7 Q;  2K75 A;  4PMW A;  4OO1 G;  4DR6 Q;  4IO9 A;  3T1Y L;  5M5Y B;  4ZRZ A;  3OHX C;  5LMN W;  5CBA E;  2VB3 X;  3S2H B;  1HTP A;  3V05 A;  3SGI A;  4ZKB B;  2UUA L;  3AFP A;  1PH6 A;  1WTP A;  4L8J A;  1K73 C;  2AMC B;  3T13 A;  1SDF A;  3GTG H;  2UUC L;  3KBG A;  2F3W A;  2VQE L;  3RZD B;  2AWO A;  3UE0 A;  3HOV H;  1UE5 A;  1A63 A;  2K1B A;  3FHW A;  3RD4 A;  2E8G A;  1F2M A;  1X3E A;  2HCI A;  2RDF A;  4LJZ C;  3J7A V;  4QUF A;  3VDY A;  2QDL A;  2NZ1 D;  4GOP B;  2NTS A;  3M4O B;  2EYM A;  3HZX A;  4IUP A;  3Q24 A;  1I4X A;  3K57 A;  1EFW A;  4HJ8 A;  1TII D;  3BDC A;  3GDE A;  5KIX A;  1DGS A;  2J0T D;  4XXE A;  2F0N A;  1L0X B;  1H9S A;  1C8C A;  4CKC A;  4V19 0;  5FK9 C;  1OXU A;  1N9W A;  1SYF A;  3HKZ B;  2L12 A;  2ZJP A;  1STG A;  2F4V L;  1I5F A;  1K8G A;  1B2T A;  2F0F A;  4X64 Q;  1AN8 A;  2EJM A;  1IYU A;  2R61 A;  2JSO A;  2D5D A;  5IYB G;  1QOH A;  4GNX A;  4DA2 A;  1G51 A;  2BA1 A;  4ULL A;  4CDF C;  1Z6H A;  1I4Q A;  3A74 A;  1Q12 A;  3RN5 A;  3T53 B;  3GV3 A;  5BR8 Q;  2DJF C;  1SNC A;  4GLV B;  1PRT C;  1XPR A;  2F0M A;  3FMC A;  2CW0 D;  1YNN C;  5KNB A;  2QEX A;  2HHH L;  5C0X I;  1PYS B;  4UY8 C;  3I8Z A;  1LV9 A;  1STA A;  2ZTC A;  3RZO H;  2QIL A;  4A3K B;  4E6I A;  1HA5 A;  3OW2 A;  4DK1 A;  2EJF C;  2DY8 A;  3ITP A;  1G2T A;  3J81 c;  4KHZ A;  1OO9 B;  5JEA J;  4KY6 A;  1CHP D;  2D62 A;  4JOI C;  1HNX L;  1VDZ A;  4A76 A;  2RHQ B;  1L1O A;  1DCZ A;  4YWM A;  1S4Z A;  1LO5 D;  4DV5 L;  4A3G G;  2B2W A;  3PMF A;  5J1Z A;  4A3M H;  4JI1 Q;  2A6E C;  3BZK A;  4DK6 C;  4KD3 A;  4PZ7 A;  4JI7 L;  4C3H H;  4B9X A;  3I4M B;  2PNH A;  2Z6B A;  2ZTE A;  1BOS A;  3PF4 A;  4K0K Q;  2ICI A;  3LX0 A;  4PZ6 A;  4GZY C;  2EY2 A;  1B53 A;  3IFD A;  1SNQ A;  1XX8 A;  2BCO A;  4IUT A;  3PIO A;  4A3J G;  2ZM6 Q;  4A3I H;  4BBR B;  2Y0S G;  5H1S E;  5IT9 c;  4CDC C;  3KLR A;  4YIJ A;  4DUZ L;  2F0U A;  3K0X A;  2N3S A;  1FNU A;  1QG7 A;  2R92 G;  2ZXR A;  3UI2 A;  2A69 D;  2K32 A;  3URY A;  1TQO A;  2F4I A;  2KHI A;  3N52 A;  2PMZ B;  1EOV A;  2TMP A;  3ER0 A;  4KY5 A;  4QJF A;  3MAQ A;  4KHP Q;  4IJL A;  4DR3 L;  2CKZ B;  3AU7 A;  3STB D;  2KUM A;  2MO1 A;  2RVL A;  4OIJ A;  1HZC A;  2B8G A;  5FO7 B;  1Q1E A;  4YCV A;  3PCO B;  1SE3 A;  1ENC A;  4A3E G;  1DOL A;  1KIX A;  3W1G A;  4KTA A;  3PO3 H;  3GTP H;  1EIG A;  5ELD A;  5J3B A;  2KED A;  1SRO A;  2K03 A;  3MFG A;  4JW0 A;  4ID6 A;  1K0R A;  1FJG Q;  2BDN A;  5AJ3 Q;  4DGZ A;  3TQY A;  4IOC A;  3DWP A;  1IW7 D;  1V8Q A;  3QO2 A;  3SE0 A;  4N9T A;  4X3S A;  1P8L A;  5BN3 A;  3UDG A;  1EU4 A;  2FFK B;  2OF1 A;  4IN3 A;  1QWY A;  1JQY D;  2ZJQ A;  3ERQ A;  1FNW A;  1AH9 A;  2M2L A;  4I7Z C;  3CP0 A;  4JI3 L;  4JI5 Q;  1VQF A;  3G6E A;  1VQI A;  3K8A A;  1XMQ L;  2XGT A;  3KF6 A;  2JJQ A;  3K7A B;  4OXP A;  2YU9 B;  4B3M Q;  3MXP A;  1KRT A;  4O42 A;  1CQF A;  5M3F B;  4LAA A;  1JJ2 A;  3A0J A;  4ME3 A;  3ERO A;  1SYB A;  5M5W H;  1N34 L;  1LTT D;  3NEL A;  4DV0 Q;  4OWX B;  2EYP A;  2QKI C;  1SBB B;  1HJP A;  2SOB A;  2OXP A;  2NBF A;  3MXN B;  4LFC L;  4JYA L;  2WFW A;  2EYL A;  3D4R A;  4GS3 A;  4DV6 L;  1CI3 M;  3EA6 A;  1Q90 A;  3S16 B;  1E2Z A;  4IUQ A;  1TKW B;  4MN3 A;  3GTQ B;  2KOL A;  4LK1 C;  3F2B A;  2V1C C;  5D3I B;  3I4N G;  1HXY D;  1O7Y A;  2NYZ D;  4IPC A;  5IGG A;  5FLX L;  1NR4 A;  1FGU A;  1I94 L;  5DAU A;  3KFU A;  1MKH A;  1U0L A;  1RCV D;  4BY1 H;  4JI8 Q;  1Z47 A;  1SEB D;  1I6V C;  2TSS A;  3AFQ A;  1UE1 A;  4R8I A;  3TP5 A;  4P74 A;  2JA7 H;  1IXR A;  2F0I A;  3LWE A;  4QIW B;  1FR3 A;  1EQR A;  1NCV A;  2MP1 A;  1PFS A;  5NUC A;  1Y1W H;  5I6Y A;  2NVQ H;  1U4R A;  4MZ9 A;  5EKK A;  3TP6 A;  4RFB A;  1RIP A;  3QWN A;  3A55 A;  2L1B A;  1YNX A;  4NPS A;  5E7N A;  5JVH 3;  4HMI A;  2HUG A;  4YWK A;  2JA9 A;  4CHT B;  5K36 H;  1Q46 A;  1S5F D;  2KCT A;  1TWG B;  4BBS G;  3S15 H;  4U68 A;  4RHR A;  4QGU A;  4A3B B;  1XTD A;  2CVR A;  5C4H A;  2A5H A;  1L1O B;  1M90 C;  1W6K A;  4KN4 C;  4CDD C;  4GOP C;  4R9W A;  1A15 A;  1G6P A;  1VQJ A;  3CCE A;  4YY3 Q;  3H3V C;  4NXN Q;  3K81 C;  3HOW H;  1YIJ A;  1PDQ A;  1TWH H;  2EY5 A;  4LUV A;  2B2Y A;  4X65 L;  1VF5 C;  1K0S A;  3CW2 C;  4C2M B;  4DNR B;  2ZJR A;  3CCS A;  3K5L A;  4IOA A;  5FO8 B;  2CW0 C;  3GTJ B;  1I3Q B;  4B3R Q;  4DV1 Q;  2EZV A;  2E2I H;  1Q1B A;  4DR4 L;  2L55 A;  3BS1 A;  3GTK B;  1UAP A;  1XMO Q;  1B50 A;  1WVL A;  4KN7 C;  4CKE A;  2K50 A;  2ID0 A;  1YJN A;  2OWO A;  5JAV A;  3U4Z A;  3I90 A;  3HOX H;  1KAB A;  1H95 A;  3S1M B;  4B08 A;  2F1M A;  1Z9F A;  3S17 B;  4PQX A;  2K28 A;  3S1Q B;  2PW5 A;  1UUP A;  4KKT A;  1R9T H;  3M7G A;  3U50 C;  1CA5 A;  1VQA A;  2ENB A;  4ME5 A;  1LT5 D;  2UU9 Q;  3KLS X;  1C4Q A;  4GKJ Q;  1NE3 A;  2I07 B;  1M8A A;  4RA8 A;  1SE8 A;  1SAP A;  2JN4 A;  3HOZ B;  2EPB A;  4L63 B;  2KVM A;  4UHV A;  2E2J H;  1EY7 A;  4K6L A;  4NW2 A;  1OXT A;  1EEI D;  4HSV A;  2A69 C;  4DPG A;  4BXX G;  2F0K A;  1CZG A;  1AZQ A;  1KLG D;  4BS9 A;  2BE5 D;  1PH5 A;  2VL6 A;  1GUO A;  3LWU A;  4A3F H;  3CQZ B;  2F0D A;  4QMG A;  4HIO A;  1TWA H;  2I5M X;  3Q23 A;  5IP7 G;  1N32 Q;  2QEJ C;  5BR8 L;  4FF2 A;  5EPJ A;  1SYC A;  5M3M B;  1IYV A;  1PH8 A;  3CCL A;  4POG A;  1SMX A;  4MIU A;  1IBM Q;  4LF8 L;  3A7L A;  4UP9 A;  3C1E A;  4C3H G;  3GTL H;  1WTH A;  5CV8 A;  4H7B A;  3S9W A;  5JJZ A;  4JBM A;  4XYO A;  1GUW A;  1STY A;  1IW7 C;  1SLJ A;  3MXU A;  3BG3 A;  1LAB A;  4A3I G;  3A5Z B;  2CWP A;  4A3J B;  4O2D A;  3G71 A;  3H0G H;  2Y0S B;  3ND8 A;  1DXM A;  2D0O A;  3W1B A;  1TWC B;  2HIV A;  4IFD H;  1PMR A;  2R92 B;  2E76 C;  1ENF A;  1SJH D;  3TDQ A;  4BBR G;  2AUK A;  1YHA A;  1PH3 A;  2B39 A;  2KEC A;  3E5S A;  1U4M A;  4DR7 Q;  4NP5 A;  1TR5 A;  1EY5 A;  1R4Q B;  1O80 A;  1WTV A;  3PO3 G;  2FJ2 A;  3A8I E;  4HJ7 A;  4L5T A;  3I55 A;  4A3E B;  1PYB A;  4FXD A;  1GKH A;  3MVV A;  5IGF A;  1B9N A;  1YIT A;  4LFB L;  3QJY A;  5IYC G;  1CTM A;  1VQD A;  4KHP L;  2XSC A;  1CKN A;  5KGU A;  3GTM H;  2A68 D;  1TXY A;  3NQI A;  3S1R H;  5ISR A;  4JI4 Q;  1EIF A;  2IL8 A;  3KJO A;  1HNW Q;  5CV5 A;  2EIF A;  1KDB A;  2B2U C;  4X66 Q;  4OIK A;  1PH1 A;  1QNU A;  1UNS A;  1KLU D;  1BCP B;  3AQQ A;  3CC7 A;  1XPU A;  3EFX D;  2HDM A;  1LTL A;  4X62 L;  5GAD C;  3K59 A;  1D8L A;  1YJW A;  1EY0 A;  2ALY B;  2SDF A;  1BBW A;  2VY3 A;  5AJ3 L;  1UEA B;  3OOC A;  2B63 B;  1TY0 A;  2JQO A;  3TME A;  2K6A A;  1V43 A;  1V9P A;  3UDX A;  2Q2I A;  3TS0 A;  1X55 A;  2NN6 H;  5IY0 A;  3VYR A;  5C4J H;  4NB3 A;  3JAM E;  3J81 E;  5FLM H;  1RDP D;  1I50 H;  4JBJ A;  4AH6 A;  1HFN A;  1BCP D;  1ZXT A;  3E6Z X;  4X3U A;  1OXS C;  2MNA A;  4JI6 Q;  1ML0 D;  3H09 A;  2VZA A;  3SEB A;  4B3M L;  1L0W A;  3RLF A;  2H4O A;  2NVY B;  2A19 A;  1ESF A;  3QIA A;  3IKJ A;  3Q22 A;  4MTN A;  4DV2 L;  5L37 A;  1HQR D;  3OWE B;  2UUB Q;  1QE6 A;  2CH4 A;  4KKU A;  1PH7 A;  4BY1 G;  4FXK C;  4IJH A;  4LFA Q;  3RUZ A;  5JJK A;  4FVM A;  2KCM A;  3D4W A;  2VS1 A;  5AFW A;  5IT9 E;  1NAP A;  3KUP A;  1SYD A;  2JEB I;  2JA7 G;  2HCC A;  1B3A A;  3HFZ B;  4L6T B;  1L1O C;  1JWS D;  2KQ3 A;  4DUY Q;  3TZD A;  3K80 C;  2VW9 A;  1EOT A;  1U9R A;  2B2W C;  4R4O A;  4GN3 B;  4HR7 B;  3NE5 B;  2A8V A;  1I4R A;  4XIG S;  1KDA A;  4JI2 L;  4DR1 Q;  1XNR Q;  1EQV A;  3ULL A;  2EE1 A;  3M4P A;  1KNE A;  1AZP A;  3CPF A;  3CPW A;  1I6H H;  3OIQ A;  2EOT A;  1Q7Y C;  2RKS A;  3KYH C;  5C44 B;  2K01 A;  2RDG A;  5GQO A;  1S5B D;  2NVT H;  4DFA A;  2AQ1 B;  5K36 G;  2OQ0 A;  1W2B A;  1WCM H;  5FJ8 H;  3FKI H;  2MUY A;  2XN9 C;  2PPB C;  1FYC A;  3N6R A;  1RTO A;  4C3J H;  1VMC A;  4LF4 L;  1A62 A;  2AQ2 B;  1E7Z A;  4M8A A;  2JP1 A;  2IJ0 A;  1KTK A;  1HQM C;  4UP8 A;  2B2T A;  4FF3 A;  3QB3 A;  4UAI A;  1OXX K;  4I65 A;  4A3B G;  3OWF A;  2EYF A;  4DR5 L;  3SR1 A;  1A3T A;  5BN5 A;  1PZI D;  3OW7 A;  5IP9 G;  2Z4H A;  1D1K A;  2M9V A;  3GTG B;  1F2Z A;  4A3D H;  4DV3 L;  1PXU A;  3HOV B;  1DOK A;  2YV5 A;  4R4T A;  5LMN Q;  1F2L A;  4KHV A;  4LMQ D;  4YCW A;  1HUM A;  4YY3 L;  1BF4 A;  2JXM B;  4NXN L;  3TS2 A;  3U9O A;  2F0L A;  5COY A;  4A93 H;  2PW7 A;  3OMC A;  5C3W A;  4DR2 Q;  2VB2 X;  3KK7 A;  3I7F A;  4FO2 A;  1H9R A;  3I91 A;  1MSH A;  4CBV A;  5E4X A;  1XMO L;  2E74 C;  1EWC A;  2NTT A;  1ILQ A;  3HGB A;  5KRU A;  2E2H H;  2G5D A;  5D3D A;  3U4V A;  1KC8 C;  2PO4 A;  3FRP B;  3NBH A;  3P1H A;  2C9O A;  5KEE A;  4EQ5 A;  1PTO F;  3T1H L;  4HAE A;  1NY4 A;  2HQL A;  1TS4 A;  1H9K A;  1JE5 A;  2IY5 B;  4RWS C;  2RCN A;  3TSS A;  3BDO A;  3KF8 A;  4DKA C;  4H02 A;  5EBC A;  1IKM A;  4H44 C;  1TWF H;  4PG3 A;  3HOZ G;  5KYI A;  5M9O A;  3RZO B;  3MC0 B;  5IE8 A;  4ZCK A;  4DF7 A;  3M4O H;  1EY8 A;  5J22 A;  3VYS A;  3HKZ E;  3J80 c;  1D5M C;  1E1O A;  1WTQ A;  1PV4 A;  3TN2 A;  3WOE A;  1M4V A;  2IPK D;  1SE2 A;  4R8N A;  4V0B A;  5C5M A;  1QUQ A;  1TS5 A;  1LLR D;  3I72 A;  5IGB A;  1VS0 A;  1JJC B;  2N49 A;  3CU7 A;  3SK5 A;  4DNT B;  1MJC A;  4OWT B;  3T56 B;  3JAM c;  4A3M B;  3G48 A;  1KHI A;  3D0F A;  5IGE A;  1HR0 L;  4C3H B;  2PNR C;  4FP5 D;  5M3M G;  2G9H D;  2A68 C;  2N88 A;  2VXW A;  4HCS A;  3VA5 A;  3RR5 A;  3A7A B;  2DUD A;  1IHZ A;  5A35 A;  5C4X H;  5M5X H;  4J8Q A;  4A3I B;  1EY6 A;  4GKK L;  3H0G G;  4OGQ C;  3TEH B;  1J8I A;  5DNF A;  4F8M A;  2K5N A;  1NMF A;  2R7D A;  4IFD G;  4NXM L;  3CC4 A;  3H15 A;  1PTO H;  1PFM A;  4N8F A;  1T5E A;  2VUM H;  1HPC A;  1MHW C;  3LNN A;  1PTO D;  5I9O A;  1IKL A;  3D3R A;  4ABN A;  3FP9 A;  3QOL A;  4JK1 C;  2K4K A;  3JAM i;  3J81 i;  1WFQ A;  4A3L H;  1PH2 A;  1KAA A;  2WAC A;  4QQB X;  4XQQ A;  3V2T A;  1E2W A;  2K5Q A;  1KL9 A;  1BCP C;  2O5J C;  3PO3 B;  4HJ5 A;  3GTP B;  1FL0 A;  2MGS A;  1CHQ D;  1V1P A;  2L4N A;  2DGY A;  4K6D A;  3A54 A;  4K2L A;  3TRE A;  2OQK A;  1LUZ A;  1SNP A;  1HZ9 A;  2UXC Q;  3K58 A;  2IX0 A;  4HIM A;  2C5C A;  1EEF D;  1IBK Q;  3CD6 A;  3PGZ A;  5C0X H;  4FF1 A;  1JR0 D;  1N36 Q;  1YNJ D;  5IWA Q;  3E9H A;  2RDH A;  2PMZ E;  4RGM A;  4XQN A;  4RKB A;  1C0A A;  4C1N I;  1Y8O B;  4AQY L;  2RHS B;  4RGN A;  2F0V A;  3CF5 A;  4YCU A;  2XVS A;  1DM0 B;  3HS0 C;  5ELO A;  4DV4 L;  2WAQ B;  3B6Y A;  1Y8N B;  4JI4 L;  2K5D A;  2WIN B;  4TSS A;  4OL7 A;  4AYB B;  2O4X A;  1NNX A;  4TQU S;  1S5E D;  5FLM G;  2X6L A;  4DAY A;  3HOU H;  1O7Z A;  5M5W B;  3RNU A;  2A6H D;  3IL8 A;  2B63 G;  4C56 C;  1Y69 U;  2D2C C;  2Q8I B;  1I4P A;  4ZQ3 A;  2PI2 E;  4DV7 L;  2K5V A;  2JA6 H;  1SJE D;  3PO2 H;  3HEJ A;  3K6O A;  3CME A;  2JA5 H;  1LAC A;  3OMG A;  4A4I A;  4WOR A;  1BXT A;  2ZTD A;  2R7Z H;  4BA1 I;  4ALP A;  1PLF A;  3HP3 A;  4IUV A;  2LSS A;  2N8N A;  1HZB A;  2K5H A;  1H9S B;  3BZC A;  3ULJ A;  2ICE C;  5D65 A;  4DXG A;  3E9I A;  5JVG 3;  4BY1 B;  1PA6 A;  1QB5 D;  4DAM A;  1WTX A;  1B7Y B;  4OEL B;  1ET9 A;  4JI0 Q;  1G8Z D;  1SRU A;  2JA7 B;  3KF8 B;  5IIF A;  4GNX B;  2OTJ A;  1LT6 D;  2XIW A;  4YWL A;  1VQC A;  4PMC A;  3ZJY C;  1Y1W B;  2YU9 H;  1F9S A;  1XNQ Q;  2FIN B;  2UUB L;  4QCL A;  3CKI B;  4OO1 I;  3S14 H;  4R4I A;  2WP8 J;  2BA0 A;  2E5L Q;  1WCM G;  5JPM C;  1X32 A;  1W3S A;  3MEH A;  3BDL A;  1T5X D;  2BOS A;  1QUQ B;  4BA2 I;  3S15 B;  1K83 H;  3H94 A;  4YHH Q;  5C4Z A;  1B3Q A;  1CKM A;  5C44 G;  1V1Q A;  2F3I A;  2DNE A;  3TP7 A;  1L2F A;  5FO9 B;  3SK4 A;  1TWH B;  5I2X A;  2R3Z A;  5FLX E;  4XQJ A;  2VQF L;  3NQT A;  4A3D G;  2EXD A;  4LWC A;  4QIW E;  4LF9 Q;  5E1F A;  4JOI A;  5C6A A;  4B3S Q;  2R7F A;  3RLO A;  3SDZ A;  2YYZ A;  1EQT A;  4G7O C;  2QGQ A;  1KAW A;  1CUK A;  1HNZ Q;  3OTO Q;  1H9M A;  1PZK D;  1BDO A;  2E2I B;  1F9R A;  2AQ3 B;  5CBE E;  2XTI A;  5LMU Q;  4A93 G;  2Z0S A;  1VQ5 A;  5BN4 A;  1A2U A;  3HOV G;  2FXQ A;  2I5L X;  4EX5 A;  3T1Y Q;  5E4W C;  2IHF A;  4X3K A;  1FD7 D;  3IAY A;  3HOX B;  4LF7 L;  4DR6 L;  1GUN A;  4BY7 H;  1PYW D;  2UUA Q;  2J4X A;  1SYE A;  2F0H A;  5CMD A;  1SFO H;  5LMN L;  3NHH A;  1RD9 D;  2UUC Q;  1R9T B;  4APV A;  2B3G A;  3X3N A;  2VQE Q;  4JCV E;  4HN7 A;  4ZLT F;  1B44 D;  4M1U B;  1U5K A;  2YTX A;  2LMC B;  5I9P A;  2XRS D;  2N78 A;  3FEW X;  1II3 A;  1QJO A;  5I6W A;  4DN4 M;  2JEA I;  2GN5 A;  2K05 A;  2Z9H A;  3KOJ A;  3PUZ A;  3M85 A;  2XWJ B;  1WI5 A;  1CFM A;  3PIP 3;  1E2V A;  2HT1 A;  5ELC A;  2E2J B;  4DK0 A;  4Y52 H;  2IX1 A;  3C3L A;  2QCP X;  4C1N K;  2EQS A;  2F0W A;  3GTK H;  5ELE A;  4DK3 C;  4A3F B;  3MHB A;  3NP8 A;  4RHS A;  1TWA B;  4NDX A;  1BUV T;  3QOJ A;  4X64 L;  1D7Q A;  3NUC A;  3DLL A;  2UXB Q;  4G7H C;  1GM5 A;  1IBL Q;  3S1M H;  1D6E C;  2HDL A;  2YTY A;  3DXJ C;  3KF6 B;  2PZW A;  2CQA A;  4OEM B;  1LTI D;  4IZ8 A;  3STB C;  3QR8 A;  1WD1 A;  1VQB A;  4HIK A;  3EIV A;  3Q0A A;  1PRT F;  1RJT A;  2F03 A;  3GTL B;  2HHH Q;  4KV6 A;  4X6A H;  4CGY B;  2MJ8 A;  3GV6 A;  3S2D H;  5IYB H;  4LW1 A;  1YJ9 A;  1CA6 A;  3KJP A;  3L9A X;  2RSO A;  4A3M G;  1NMG A;  3MWY W;  1QVF A;  3VYT A;  5IYD H;  1HR0 W;  1TU2 B;  1EL0 A;  4O1N A;  3H0G B;  4IPG A;  4LUZ A;  2WB1 B;  1JC7 A;  3G6J B;  1HNX Q;  1X6O A;  3BVM A;  1WTR A;  3L0O A;  3U58 A;  3K5O A;  3VR4 A;  1P16 A;  2LKV A;  1K28 A;  3W2D A;  4DV5 Q;  3M3Y H;  2B2T C;  4ZYS A;  5CYU A;  3PUV A;  3P7J A;  1Q8K A;  2Z1C A;  2Z6K C;  3NXW A;  2XNA C;  4JI1 L;  2EJG C;  5EPL A;  1JOQ A;  2A6H C;  2AUJ D;  3GQB A;  1S5C D;  3GTO H;  4K0K L;  2PQA A;  2GA4 B;  1SND A;  4Y7N H;  4LF6 Q;  2A74 C;  1JB3 A;  5HGT A;  3BVZ A;  2ZM6 L;  4O0A A;  3BYY B;  4DUZ Q;  2JA8 H;  4A3G H;  2MO0 A;  3GTM B;  5C5L A;  2O5I C;  2EDG A;  5C0X G;  3S1R B;  2Y0S E;  1MGS A;  4J6H A;  2CQO A;  5F2D A;  4XDX A;  4DR3 Q;  3GD7 A;  3F2U A;  4K2K A;  5IOD A;  1JIC A;  3SXH A;  1ET6 A;  3SVM A;  4Q0F A;  1RF2 D;  4ZKC B;  1UWV A;  4C3I H;  3FVQ A;  2L9H A;  4L5R C;  1CZW A;  1AE2 A;  1NBW A;  4H0L C;  5FLX c;  5HGQ A;  1GOZ A;  3K7U C;  1IBK L;  2NVX H;  2KHJ A;  3LGJ A;  1ILP A;  5ELF A;  2A73 B;  3OIP A;  5D14 A;  2Q2H A;  5HY6 A;  4JV5 Q;  2I5H A;  3HOU G;  5C4J B;  2Q8R E;  3EBE A;  3J81 L;  3J80 E;  2KA7 A;  1SSO A;  1I50 B;  1FJG L;  1B9M A;  3I56 A;  1GJX A;  2WAQ G;  1N33 Q;  3OYY A;  2JA6 G;  4PMB A;  1RHP A;  4AYB G;  4LUO A;  5EPK A;  2KBN A;  3X3M A;  1ENA A;  4GNX C;  1Y1V H;  1XWE A;  4JI3 Q;  1N8R C;  4IPH A;  2OT2 A;  3KLS A;  4JI5 L;  2B2V A;  1CKO A;  2LFN A;  2PZT A;  1F9P A;  3WDN A;  5IOC A;  1LM0 A;  2WKD A;  3A8K E;  1I4H A;  3E0J A;  4I7A A;  2NUC A;  4IUU A;  5IT9 L;  5C3E H;  1N34 Q;  4XTC S;  2Q2U A;  4S3S A;  2Z8L A;  4GN5 A;  4CJ1 B;  3K5M A;  4UPA A;  4DV0 L;  3G4S A;  3WOF A;  4LFC Q;  4JYA Q;  2DJG C;  2FMC A;  2WV6 D;  3NTI A;  5CV9 A;  2BH8 A;  1BBU A;  3OPO A;  4GLA C;  1KD1 C;  3S1N H;  1ZYR D;  1I6H B;  3KBX A;  5KYL A;  1ICF B;  1QCB D;  2NVT B;  3DMU A;  1S3O A;  3DEO A;  1JB7 A;  1WCM B;  4JI0 L;  4A75 A;  1Y1W G;  2EXZ A;  4JBW A;  5JOB A;  3C46 A;  3EVQ A;  4C3J B;  5JEA H;  5A2Q E;  1SNO A;  4B3T Q;  4CKB A;  1CQV A;  4KY7 A;  4RH6 A;  2H1E A;  4JI8 L;  3CCR A;  4JBK A;  4OX9 Q;  3RMH A;  3S24 A;  2L11 A;  3MZ5 A;  2YTV A;  4P73 A;  2E5L L;  2R93 H;  3ZYY X;  3I4N H;  4A3D B;  4CDE C;  4X3T A;  1EUJ A;  3D8G A;  2RQX A;  4H13 C;  4QL5 A;  3TRZ A;  5EJW A;  3HOW G;  2KCN A;  3ULP A;  1WYD A;  1UEB A;  3NTK A;  4K5W A;  1VQ6 A;  3H3V I;  3HOY H;  3OSO A;  1A0I A;  3CMA A;  4IFD J;  1W6J A;  4A93 B;  2CCZ A;  4LF9 L;  1KRS A;  1AP0 A;  4IQZ A;  4BY7 G;  4DAV A;  2MQH A;  1LTR D;  5ELB A;  2UXD Q;  4RAU C;  1HNZ L;  4CJ2 C;  3OTO L;  2OCE A;  4X65 Q;  1SXT A;  2L0C A;  2BE5 C;  5KND A;  1E0B A;  4BBS H;  4ZAI A;  5LMU L;  3HOX G;  2ES2 A;  2E2H B;  2PI2 A;  2HQE A;  3KLW A;  4EVO A;  4DR4 Q;  2PZU A;  4B3R L;  4DV1 L;  2G9D A;  1EIY B;  1K8A C;  3DWQ A;  3HG9 A;  3R2I A;  1L0Y B;  1IL8 A;  3U9S A;  1GD7 A;  1C48 A;  1CKN B;  1GVP A;  3J7Z C;  4RMF A;  5M5Y H;  1VQ7 A;  2C35 B;  4JPB W;  3VA7 A;  1EFI D;  2HD3 A;  3S2H H;  1TWF B;  1LT4 D;  5EGT A;  3PIP A;  4QUC A;  1PVO A;  4EQP A;  4P2C B;  1J5E Q;  2ZXP A;  1JCK B;  1VMP A;  2D0P A;  1K9M C;  1PFB A;  1B4O A;  4J1M A;  3RZD H;  2ATW A;  4QY7 A;  1E22 A;  2OTL A;  4P71 A;  3SK6 A;  3F2D A;  2B2U A;  2F0T A;  4J15 A;  2UU9 L;  4GKJ L;  3MFY A;  1HFG A;  2AHO B;  2F0J A;  4A3F G;  3BJU A;  3MXN A;  3T51 B;  1DZ1 A;  2CFM A;  5GRO A;  2JK8 A;  1Y14 B;  2QDB A;  1HRJ A;  3H3V H;  3E3X A;  4DAP A;  5G3L F;  1LYL A;  1QVC A;  4HTH A;  4XT1 B;  4R4C A;  2AKW B;  2H5X A;  3UDI A;  2UXB L;  1X65 A;  1IBL L;  1SNM A;  5C4X B;  5M5X B;  5IYD G;  4KK7 A;  2ZXO A;  4KLK A;  1SMY D;  3ONA B;  1STN A;  2P5Z X;  1N32 L;  1X9N A;  2F0Q A;  1PTO B;  3SHL A;  2K5W A;  5EQ0 A;  1EYG A;  2LXK A;  2VUM B;  3PUX A;  4BXX H;  4LF8 Q;  1EU3 A;  3F8T A;  3ND9 A;  4UP7 A;  3CCU A;  2WB1 G;  1IBM L;  3J80 i;  1MI2 A;  3AEV A;  1GHJ A;  1QZH A;  1D2B A;  5IP7 H;  1RL2 A;  3DM1 A;  5GAG C;  1DOM A;  4JC0 A;  4RGO S;  2SNM A;  4KKS A;  3I3C A;  4A3K H;  2JA8 G;  5TSS A;  1ROD A;  2KCC A;  1DYQ A;  1VF7 A;  2B2Y C;  1A3V A;  4U67 3;  5DEH A;  4WRD A;  1YHQ A;  1JOO A;  2K7V A;  3IFT A;  1C9O A;  3NPP A;  1H9J A;  2D9U A;  3PV0 A;  3H6M A;  4LF6 L;  2ZT9 C;  1O78 A;  4RKL A;  4F7X A;  5G3L D;  4R4Q A;  5JPN C;  2KHS A;  4C3I G;  1AE3 A;  1XPO A;  3I4M H;  5DLQ E;  1M1K C;  4DR7 L;  3L7Z C;  5LL6 S;  2F0S A;  2RA4 A;  1K3R A;  3L3O C;  1TS2 A;  2GVB A;  4K5X A;  1E1T A;  3D6W A;  1SE4 A;  1WJJ A;  4LFB Q;  1VQE A;  1EZ6 A;  4BBR H;  1BKB A;  1ZYR C;  3GO5 A;  3H91 A;  4RCN A;  1K8M A;  1JWU D;  3HOU B;  2NB0 A;  2KJX A;  3CAM A;  2CHB D;  3GP7 A;  1HUN A;  4Z9C B;  3AYH B;  5EKI A;  4MHE A;  2NN6 G;  2JA6 B;  4L5Q A;  4IPD A;  1HNW L;  4K8J A;  1F2Y A;  3PO2 B;  1QVG A;  2EYH A;  2JA5 B;  1Y1V G;  4X66 L;  1A8V A;  1S72 A;  4RG1 A;  1B70 B;  1TS3 A;  4X62 Q;  3CRL C;  2R7Z B;  4JV5 L;  5IYC H;  1F77 A;  2BH2 A;  2WKC A;  3A8J E;  2E75 C;  4KI0 A;  2K14 A;  3DWA A;  1N33 L;  1MJE A;  5FOB B;  3CCM A;  3K0Y A;  1A6X A;  1Y8P B;  5KNC A;  1EWI A;  1CT1 D;  2WAQ E;  5C3E G;  3I4O A;  2I46 A;  1QIL A;  3IRB A;  3KDF A;  1OTC A;  2F0P A;  4AYB E;  1SYG A;  1WTO A;  3I70 A;  5T1I A;  3NBH B;  2SEB D;  5E3F A;  1JE4 A;  1HZA A;  1IL2 A;  1AFP A;  4CJ0 B;  4JI6 L;  3S14 B;  4Q5V A;  1VQ4 A;  3PUY A;  3VR2 A;  4DV2 Q;  2LY7 A;  1STE A;  2N55 A;  3O13 A;  3FPU B;  1UE7 A;  5JEA G;  1KXL A;  1K83 B;  1Q86 C;  3K7A H;  2ASB A;  2NVQ B;  2RBM A;  3F1Z A;  5K5P A;  3VR6 A;  4LFA L;  3CHB D;  3TBI B;  1Q8I A;  5M3F H;  3EJI A;  3TP8 A;  4A3C H;  4RCO A;  3FKI G;  4G57 A;  5FJ8 G;  4DUY L;  4LF5 Q;  1STH A;  2R93 G;  4K14 A;  4P75 A;  4C3J G;  1JWM D;  4PNY A;  4FXG C;  3J7A F;  4KJO A;  4JI2 Q;  4PV1 C;  2A1A A;  2LXJ A;  1X3F A;  4DR1 L;  1XNR L;  4B3T L;  4FF4 A;  5J39 A;  4POF A;  1STB A;  1LTB D;  1YI2 A;  3G7L A;  1BNZ A;  3S16 H;  3GTQ H;  3HOW B;  4OX9 L;  1A3U A;  4DXF A;  1HA6 A;  3HOY G;  4LF4 Q;  5EKL A;  1HH2 P;  3T4A C;  4TVA B;  4TKO B;  4RGT A;  3WWV A;  5GAE C;  3NSW A;  1CSP A;  1B8A A;  2BDO A;  4BY7 B;  3I4L A;  1I4G A;  1LTA D;  1VCI A;  4ODG A;  4DR5 Q;  2PCF B;  2F3V A;  1G2S A;  1SFO B;  3FDT A;  5ELN A;  4DV3 Q;  1D5Z C;  3JC6 6;  1QNK A;  4LNQ A;  2EVB A;  2VNU D;  1EIH A;  1X56 A;  2QF7 A;  5C3X A;  1RTN A;  3SK8 A;  3W3A A;  4JVZ A;  1A2T A;  5I4D A;  3CRK C;  4WJ3 M;  1TWG H;  3D4D A;  2UXD L;  2B29 A;  1PHJ A;  2FMM A;  1V1P B;  5LL6 X;  1S5D D;  1BR9 A;  1D1I A;  3I2Z A;  3T16 A;  4A3B H;  4GLX A;  1VQL A;  1Q81 C;  1YHB A;  1GHK A;  5IP9 H;  5HUR A;  5C0X J;  1TVX A;  1SMY C;  2O2L D;  4DR2 L;  4OO1 H;  5JJL A;  1QZG A;  3CCV A;  4NKL A;  4HMJ A;  4EQN A;  3PF5 A;  3UDF A;  2RF4 A;  3CCQ A;  2DY7 A;  1VQH A;  1ONL A;  3M9B A;  4B9W A;  1PH9 A;  3NEN A;  3M7N A;  4C2M H;  2B2V C;  1CSQ A;  1O7L A;  3BYT B;  4QB4 A;  3DM3 A;  3FPP A;  1SN8 A;  2MFI A;  3NK9 A;  3GTJ H;  1I3Q H;  1NSN S;  1G29 1;  1VQK A;  2F0O A;  2F4V Q;  3T1H Q;  3RLN A;  4EGV A;  2IHE A;  1PTO C;  1XYI A;  1J5E L;  2PQE A;  2SNS A;  5I2Y A;  4DAY B;  4WJW A;  4IFD I;  4N8X 1;  3V96 A; 
#chains in the Genus database with same CATH homology
 1KRT A;  1TWF H;  4PG3 A;  3HOZ G;  3S17 H;  3S1Q H;  3HKZ G;  1JJ2 A;  5C3E H;  3A0J A;  1N34 Q;  4XTC S;  5IE8 A;  2KEN A;  4ME3 A;  1YBY A;  5M5W H;  2Q2U A;  1N34 L;  4MNO A;  3NEL A;  4GN5 A;  3W5O A;  4DV0 Q;  4OWX B;  3M4O H;  2R6G A;  4UPA A;  1HJP A;  4DV0 L;  3G4S A;  3J80 c;  3HKZ E;  4AIM A;  4LFC Q;  4JYA Q;  1E1O A;  1PV4 A;  1VQM A;  1E3P A;  3MXN B;  3KDF B;  2BH8 A;  1BBU A;  4LFC L;  4JYA L;  4GLA C;  2WFW A;  1KD1 C;  3S1N H;  1QUQ A;  4GS3 A;  4DV6 L;  5C4X G;  4FDB A;  3HOZ H;  1VQ8 A;  1VS0 A;  1JJC B;  1S3O A;  2N49 A;  1JB7 A;  3F2B A;  1MJC A;  2V1C C;  4OWT B;  3JAM c;  3I4N G;  4JI0 L;  1HR0 Q;  3G48 A;  4A75 A;  4IPC A;  1Y1W G;  1KHI A;  3D0F A;  1X54 A;  4JBW A;  5M3M G;  1HR0 L;  1FGU A;  1I94 L;  5GAH C;  4B3T Q;  3KFU A;  1MKH A;  1U0L A;  2VUM G;  4BY1 H;  4JI8 Q;  1YEZ A;  1Z47 A;  2Q2T A;  4OWW B;  3AFQ A;  4HJ9 A;  1JMC A;  4JI8 L;  1UE1 A;  2HIX A;  4DNI A;  3RR5 A;  4A3K G;  3CCR A;  4GKK Q;  4JBK A;  2DUD A;  4OX9 Q;  5C4X H;  5M5X H;  4P74 A;  3S24 A;  2JA7 H;  4GKK L;  4JI7 Q;  1IXR A;  3CQZ H;  3H0G G;  4A3L G;  1EQR A;  3TEH B;  2YTV A;  4P73 A;  2E5L L;  2R93 H;  2K5N A;  4NXM Q;  1PFS A;  1NMF A;  1ASY A;  3I4N H;  2R7D A;  4IFD G;  4NXM L;  4OON A;  1Y1W H;  3CC4 A;  1VQN A;  3HKS A;  3H15 A;  2NVQ H;  4P72 A;  5M3M H;  4MZ9 A;  1KQS A;  1EUJ A;  2WB1 E;  1RIP A;  3TRZ A;  4QL5 A;  2VUM H;  2NN6 I;  1YNX A;  1O7I A;  4NPS A;  3HOW G;  5E7N A;  3ULP A;  1WYD A;  4YWK A;  2JA9 A;  2NZH A;  1UEB A;  1Q46 A;  2KCT A;  3FP9 A;  2K4K A;  4BBS G;  3I4M G;  3JAM i;  3J81 i;  3S15 H;  1WFQ A;  4HID A;  1PH2 A;  1VQ6 A;  4A3L H;  4QGU A;  1XTD A;  2F52 A;  3H3V I;  3HOY H;  1X3G A;  4QQB X;  1L1O B;  1A0I A;  3CMA A;  4IFD J;  2CCZ A;  1M90 C;  1KL9 A;  2I0Q A;  4HJ5 A;  4LF9 L;  1FL0 A;  1KRS A;  1XJV A;  2GVA A;  4BY7 G;  4GOP C;  1G6P A;  1VQJ A;  3CCE A;  4A3J H;  2DGY A;  2MQH A;  4YY3 Q;  2UXD Q;  1HNZ L;  4NXN Q;  3K81 C;  3OTO L;  2OCE A;  3HOW H;  4X65 Q;  1YIJ A;  3TRE A;  1TWH H;  1SR3 A;  1LUZ A;  2OQK A;  1HZ9 A;  1GO3 E;  4LUV A;  2UXC Q;  4X65 L;  1TWC H;  2UXC L;  2L15 A;  2IX0 A;  4GN4 B;  4HIM A;  4BBS H;  3CW2 C;  4PZ8 A;  5LMU L;  1IBK Q;  3CD6 A;  2R92 H;  3HOX G;  1YZ6 A;  3PGZ A;  2ES2 A;  2ZJR A;  3CCS A;  3ERS X;  4GOP A;  2PI2 A;  1N36 Q;  5IWA Q;  4IOA A;  3MEF A;  3E9H A;  3KLW A;  4B3R Q;  1N36 L;  4DR4 Q;  2PMZ E;  5IWA L;  4DV1 Q;  2E2I H;  4AQY Q;  1Q1B A;  4DR4 L;  4B3R L;  1C0A A;  4DV1 L;  4AQY L;  1XMO Q;  2RHS B;  1EIY B;  1K8A C;  3CF5 A;  4YCU A;  2IT1 A;  1NTG A;  4DV4 Q;  2K50 A;  1EQQ A;  3PO2 G;  1GD7 A;  5ELO A;  4DV4 L;  2ID0 A;  1YJN A;  1CKN B;  3B6Y A;  1GVP A;  3J7Z C;  4RMF A;  3U4Z A;  5M5Y H;  1YVC A;  4JG2 A;  3HOX H;  4A3E H;  1VQ7 A;  4JI4 L;  1H95 A;  1IZ6 A;  2C35 B;  1J6Q A;  2R7Z G;  3NEM A;  3S2H H;  1Z9F A;  4TQU S;  5FLM G;  3PIP A;  1PVO A;  3M4Q A;  3HOU H;  1T9H A;  4L5S A;  4WJ4 A;  1J5E Q;  3PUW A;  3RNU A;  1R9T H;  1XMQ Q;  2B63 G;  2D0P A;  4DV7 Q;  3U50 C;  1K9M C;  1VQA A;  3J81 j;  2PI2 E;  3CXC A;  4QY7 A;  1E22 A;  4DV7 L;  3RZD H;  2ATW A;  2OTL A;  4P71 A;  2K5V A;  2JA6 H;  2UU9 Q;  1NJI C;  3PO2 H;  3F2D A;  4GKJ Q;  1VQG A;  5EAY A;  3RN2 A;  4J15 A;  3CME A;  2JA5 H;  4A4I A;  2UU9 L;  4GKJ L;  1NE3 A;  2JE6 I;  2AHO B;  2ZTD A;  1PH4 A;  2R7Z H;  4A3F G;  4BA1 I;  1SE8 A;  3BJU A;  2JA5 G;  1MIU A;  4ALP A;  2CFM A;  5GRO A;  3E0E A;  2JK8 A;  1Y14 B;  2LSS A;  2N8N A;  1HZB A;  2K5H A;  2B63 H;  3BZC A;  3H3V H;  3ULJ A;  1LYL A;  2E2J H;  1Q82 C;  3E9I A;  4DV6 Q;  1OXT A;  1QVC A;  4R4C A;  4DPG A;  4BXX G;  5M3F G;  1PA6 A;  4A3C G;  1WOC A;  2AKW B;  2H5X A;  3BU2 A;  3UDI A;  1X65 A;  4DAM A;  2QA4 A;  2UXB L;  1IBL L;  1B7Y B;  1PH5 A;  2VL6 A;  4JI0 Q;  2CWA A;  5IYD G;  4R1J A;  1SRU A;  2K52 A;  3KF8 B;  4A3F H;  4GNX B;  3A5U A;  4HIO A;  1I94 Q;  2OTJ A;  3EN2 A;  3PSI A;  1IYJ B;  1TWA H;  1VQC A;  2I5M X;  4KLK A;  4YWL A;  5IP7 G;  1N32 Q;  1S40 A;  5BR8 L;  2NZO A;  3ZJY C;  2YU9 H;  1N32 L;  1X9N A;  1XNQ Q;  2UUB L;  1XNQ L;  1EYG A;  1PH8 A;  4OO1 I;  2LXK A;  3CCL A;  3PUX A;  3S14 H;  1OXV A;  2WP8 J;  4R4I A;  2NVY H;  4POG A;  4BXX H;  1SMX A;  2BA0 A;  4LF8 Q;  2E5L Q;  1WCM G;  3F8T A;  4UP7 A;  3CCJ A;  1IBM Q;  1W3S A;  3F2C A;  4LF8 L;  4UP9 A;  3CCU A;  2WB1 G;  1IBM L;  1QUQ B;  4BA2 I;  4LF5 L;  3GTL H;  1K83 H;  3J80 i;  3AEV A;  4YHH Q;  1FVI A;  1QZH A;  4JBM A;  5IP7 H;  4YHH L;  1CKM A;  1RL2 A;  1SLJ A;  5GAG C;  5C44 G;  3UE1 A;  1V1Q A;  2F3I A;  4JC0 A;  4A3I G;  3A5Z B;  1L2F A;  4A3K H;  2CWP A;  5JJI A;  2JA8 G;  4O2D A;  1ASZ A;  3G71 A;  2VQF Q;  1BVS A;  3H0G H;  3ICE A;  2AWN A;  1VQ9 A;  3Q8D A;  2D0O A;  3W1B A;  2VQF L;  3D31 A;  4A3D G;  2EXD A;  4LWC A;  4QIW E;  2HIV A;  4LF9 Q;  1YHQ A;  4JOI A;  4B3S Q;  1JJG A;  2R7F A;  3RLO A;  2YYZ A;  3L2P A;  2QGQ A;  1C9O A;  1KAW A;  4B3S L;  1CUK A;  5C44 H;  4BBR G;  1E24 A;  1HNZ Q;  3OTO Q;  1YHA A;  1PH3 A;  1C7Y A;  3PV0 A;  1VQO A;  4LF6 L;  2Z6K A;  2XTI A;  2PQA B;  4R4Q A;  4DR7 Q;  1JT8 A;  5LMU Q;  1UE6 A;  1AE3 A;  1XPO A;  3CC2 A;  2Z0S A;  5DLQ E;  1M1K C;  1VQ5 A;  3I4M H;  4DR7 L;  3L7Z C;  3HOV G;  4A93 G;  3J7A 5;  3PO3 G;  4HJA A;  1VQP A;  2FXQ A;  2I5L X;  4EX5 A;  3T1Y Q;  4LF7 Q;  1K3R A;  2K75 A;  4L5T A;  4PMW A;  4HJ7 A;  4IO9 A;  2GVB A;  2IHF A;  3I55 A;  1PYB A;  3T1Y L;  4LF7 L;  1GKH A;  4DR6 L;  4BY7 H;  1E1T A;  4LFB Q;  1WJJ A;  5LMN W;  1YIT A;  2UUA Q;  1VQE A;  4BBR H;  1BKB A;  3SGI A;  5IYC G;  2UUA L;  1VQD A;  3AFP A;  3GO5 A;  1PH6 A;  4LFB L;  4KHP L;  1CKN A;  1SFO H;  5LMN L;  1K73 C;  3GTM H;  2AMC B;  3CAM A;  2UUC Q;  4APV A;  2B3G A;  2VQE Q;  3GTG H;  4JCV E;  1TXY A;  2UUC L;  3S1R H;  4JI4 Q;  2VQE L;  1EIF A;  2AWO A;  3KJO A;  1HNW Q;  3AYH B;  3UE0 A;  3HOV H;  2EIF A;  1U5K A;  2NN6 G;  4L5Q A;  1UE5 A;  2YTX A;  4IPD A;  1HNW L;  1A63 A;  3FHW A;  4DR6 Q;  4X66 Q;  1QVG A;  1Y1V G;  2E8G A;  2N78 A;  4X66 L;  1A8V A;  1X3E A;  1PH1 A;  1S72 A;  2JEA I;  2GN5 A;  3AQQ A;  4RG1 A;  1B70 B;  4X62 Q;  3CC7 A;  1XPU A;  3KOJ A;  3PUZ A;  3VDY A;  4JV5 L;  5IYC H;  3M85 A;  1LTL A;  4X62 L;  5GAD C;  4GOP B;  1WI5 A;  1D8L A;  2BH2 A;  1YJW A;  2ALY B;  2VY3 A;  1BBW A;  5AJ3 L;  2HT1 A;  4KI0 A;  1EFW A;  2JQO A;  4HJ8 A;  4Y52 H;  2K14 A;  1V43 A;  1V9P A;  1N33 L;  1MJE A;  2IX1 A;  3GDE A;  3UDX A;  3CCM A;  1DGS A;  2Q2I A;  3TS0 A;  1X55 A;  5IY0 A;  1EWI A;  2EQS A;  2WAQ E;  5C3E G;  3I4O A;  4NB3 A;  5C4J H;  1OXU A;  3IRB A;  1N9W A;  3KDF A;  5FLM H;  1OTC A;  3GTK H;  4AYB E;  1I50 H;  2ZJP A;  4JBJ A;  4AH6 A;  4DK3 C;  2F4V L;  1I5F A;  1K8G A;  4X64 Q;  3NBH B;  4X64 L;  1D7Q A;  3DLL A;  5IYB G;  1HZA A;  1IL2 A;  1OXS C;  2MNA A;  2UXB Q;  4GNX A;  4JI6 Q;  1GM5 A;  1IBL Q;  3S1M H;  2VZA A;  2YTY A;  4B3M L;  4JI6 L;  1G51 A;  2BA1 A;  3KF6 B;  1L0W A;  1VQ4 A;  3RLF A;  3PUY A;  3A74 A;  1Q12 A;  2A19 A;  4DV2 Q;  3STB C;  3RN5 A;  1VQB A;  4MTN A;  5BR8 Q;  4HIK A;  4DV2 L;  3EIV A;  5JEA G;  1UE7 A;  4GLV B;  1KXL A;  1XPR A;  1Q86 C;  2HHH Q;  4OO1 G;  3K7A H;  2UUB Q;  4X6A H;  2ASB A;  1PH7 A;  4BY1 G;  2HHH L;  4IJH A;  2QEX A;  3F1Z A;  4LFA Q;  5JJK A;  5C0X I;  1PYS B;  2KCM A;  4UY8 C;  3S2D H;  2VS1 A;  5IYB H;  4LFA L;  4LW1 A;  2ZTC A;  1YJ9 A;  5M3F H;  4A3C H;  3RZO H;  2JEB I;  3KJP A;  2JA7 G;  4DUY Q;  3HFZ B;  1L1O C;  4A3M G;  1NMG A;  5FJ8 G;  3FKI G;  4DUY L;  3OW2 A;  4LF5 Q;  1QVF A;  2R93 G;  3K80 C;  1HR0 W;  2VW9 A;  4P75 A;  5IYD H;  2A8V A;  4R4O A;  4GN3 B;  3J81 c;  4IPG A;  4KHZ A;  4JI2 Q;  4LUZ A;  4XIG S;  5JEA J;  4JI2 L;  4DR1 Q;  1XNR Q;  1HNX Q;  1X6O A;  2A1A A;  2LXJ A;  3ULL A;  1X3F A;  2D62 A;  4DR1 L;  3L0O A;  3M4P A;  4JOI C;  3U58 A;  1HNX L;  4B3T L;  1XNR L;  3CPF A;  4POF A;  3CPW A;  1YI2 A;  1I6H H;  4A76 A;  1P16 A;  1Q7Y C;  2RHQ B;  3KYH C;  3S16 H;  1L1O A;  4DV5 Q;  5GQO A;  3GTQ H;  3M3Y H;  4YWM A;  2NVT H;  5K36 G;  3PUV A;  4DV5 L;  4A3G G;  2OQ0 A;  1W2B A;  1WCM H;  4OX9 L;  4A3M H;  4JI1 Q;  1Q8K A;  3BZK A;  4DK6 C;  5FJ8 H;  2Z6K C;  3FKI H;  4PZ7 A;  3HOY G;  4JI7 L;  4LF4 Q;  4JI1 L;  4C3J H;  4C3H H;  2PNH A;  1HH2 P;  2ZTE A;  4LF4 L;  1A62 A;  3PF4 A;  4K0K Q;  4TVA B;  1E7Z A;  3GTO H;  4PZ6 A;  4K0K L;  3WWV A;  5GAE C;  2PQA A;  1CSP A;  3PIO A;  4Y7N H;  4UP8 A;  4A3J G;  4LF6 Q;  1B8A A;  2ZM6 Q;  4A3I H;  1VCI A;  1OXX K;  4DR5 Q;  2Y0S G;  5H1S E;  2ZM6 L;  4O0A A;  5IT9 c;  4A3B G;  4DUZ Q;  2JA8 H;  4DR5 L;  4A3G H;  2MO0 A;  4DUZ L;  3K0X A;  5ELN A;  2N3S A;  5IP9 G;  4DV3 Q;  2R92 G;  5C0X G;  4A3D H;  3JC6 6;  2Y0S E;  4DV3 L;  2CQO A;  4LNQ A;  2VNU D;  2KHI A;  1X56 A;  1EOV A;  4DR3 Q;  3ER0 A;  3GD7 A;  2YV5 A;  4QJF A;  4KHP Q;  4IJL A;  4DR3 L;  4R4T A;  2CKZ B;  5LMN Q;  3STB D;  2MO1 A;  4YCW A;  4WJ3 M;  4YY3 L;  1TWG H;  2UXD L;  2B29 A;  1HZC A;  1PHJ A;  4NXN L;  1UWV A;  4A3B H;  3I2Z A;  3TS2 A;  4GLX A;  1VQL A;  4C3I H;  1Q81 C;  1Q1E A;  4L5R C;  1YHB A;  4YCV A;  3PCO B;  4A93 H;  1AE2 A;  5IP9 H;  4A3E G;  1NBW A;  5FLX c;  5C0X J;  5HGQ A;  3W1G A;  4DR2 Q;  1KIX A;  3GTP H;  3PO3 H;  3K7U C;  1IBK L;  2NVX H;  2KHJ A;  3LGJ A;  4DR2 L;  3I7F A;  5J3B A;  5JJL A;  1QZG A;  3CCV A;  1SRO A;  2Q2H A;  5HY6 A;  4JV5 Q;  2I5H A;  3PF5 A;  3HOU G;  3UDF A;  1K0R A;  3EBE A;  1FJG Q;  2RF4 A;  5AJ3 Q;  3CCQ A;  1VQH A;  3TQY A;  3M9B A;  1FJG L;  4IOC A;  1PH9 A;  3I56 A;  1XMO L;  3NEN A;  2WAQ G;  4C2M H;  3M7N A;  1N33 Q;  3OYY A;  2JA6 G;  2E2H H;  1CSQ A;  1P8L A;  4AYB G;  4LUO A;  3DM3 A;  3UDG A;  3U4V A;  1KC8 C;  2KBN A;  1SN8 A;  2MFI A;  3GTJ H;  4GNX C;  1I3Q H;  1G29 1;  1Y1V H;  2ZJQ A;  1VQK A;  1AH9 A;  4JI3 Q;  2F4V Q;  3T1H Q;  3RLN A;  1N8R C;  3CP0 A;  4EQ5 A;  4JI3 L;  4JI5 Q;  2IHE A;  1VQF A;  4IPH A;  3T1H L;  1NY4 A;  2HQL A;  4JI5 L;  1J5E L;  1JE5 A;  3G6E A;  1VQI A;  3K8A A;  1XMQ L;  1CKO A;  2IY5 B;  2XGT A;  3KF6 A;  2RCN A;  2JJQ A;  2OWO A;  4OXP A;  4DAY B;  1LM0 A;  4IFD I;  4DKA C;  4B3M Q;  4H02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...