2HQLA

Crystal structure of a small single-stranded dna binding protein from mycoplasma pneumoniae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
b'MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEIWKTTIEIVKIFNPKNEIVIDYKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MG376 homolog
publication title Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Dna binding protein
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11506 DUF3217 Protein of unknown function (DUF3217)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hqlA01
3MXNB 5IE8A 3KJOA 1SR3A 1B7YB 1OXXK 4BXXG 2VQFL 4GOPA 4EX5A 1OTCA 4BA2I 3RR5A 1ASZA 5JJLA 2NZHA 4X66L 1X9NA 3EN2A 2NVQH 3M7NA 2YTVA 1S3OA 4YWLA 1KRSA 2OTLA 4YCVA 1AH9A 2A1AA 2B63H 3HOXG 2ZTCA 1QVFA 5C4XG 3PIOA 2UUBL 1J6QA 1SFOH 2Q2TA 2ZJRA 1A0IA 4DV4Q 1N32L 4IJHA 2XTIA 4APVA 2I0QA 3DM3A 1LM0A 2Z6KC 4DKAC 4JI2L 1GKHA 1W2BA 2I5HA 3HOUH 1NBWA 1NTGA 3AQQA 3NEMA 4OWXB 4C3JH 4JI6Q 1SROA 4OX9Q 2HQLA 3I7FA 4UP8A 4IFDG 4B3TL 3RNUA 4P73A 1D8LA 4JI1L 2LXJA 4GOPC 4HJAA 2UU9Q 1X54A 5M5WH 2CWPA 3F1ZA 4RG1A 1U0LA 3W5OA 5IP9G 2R93G 5IYBG 1PYSB 1NE3A 3KLWA 1J5EL 2R7ZH 3ER0A 3CW2C 1PH9A 4K0KQ 4NXNQ 4JYAL 1H95A 5LMNQ 4JG2A 4A3JH 1UE6A 3FKIG 3OTOL 4A3EG 4NB3A 4HJ7A 2JEAI 1VQOA 4UPAA 4X62L 1Q46A 1L2FA 1IZ6A 4LF9L 2JE6I 1KL9A 3RLOA 3TS2A 4UP9A 2F52A 3B6YA 4LF6Q 3TREA 1HNZQ 4LF5L 5BR8L 4A3DH 2K50A 4JI0Q 4KHZA 4QY7A 1SRUA 3T1HL 4BBRH 1KXLA 2QEXA 4DV5Q 1IBKL 1Y1VH 1OXUA 2Q2UA 3GTLH 3HOVH 4JI7Q 3HOZH 4DUYL 5HY6A 5AJ3Q 4A3MH 5M5XH 4NPSA 3UE0A 3I2ZA 1P16A 4LUOA 3AYHB 2KHJA 5C0XI 3PIPA 2YU9H 4LF8Q 1JJCB 4GN4B 3CCEA 2Q2HA 4DPGA 1A8VA 1T9HA 1BVSA 1HZCA 3KF6B 4DV0L 1WOCA 1TWFH 1I6HH 3WWVA 1JT8A 3CC4A 3U4VA 1X3GA 3S24A 3STBC 2E5LQ 3ERSX 3M4PA 2QGQA 2ATWA 2UXDL 2UUCL 1PYBA 3F8TA 5FLXc 1YI2A 4OO1I 1PV4A 5C4JH 3AFQA 4GNXC 1FJGQ 1N33L 4BBSH 1Z47A 2VQEL 1HR0W 1Y14B 1W3SA 1YJWA 3KDFB 1X55A 1S40A 1MJEA 5GAEC 3H3VH 4B3RQ 4JBJA 5GROA 4LFBL 1K73C 2AMCB 1K8AC 1I94L 3J81j 4PZ8A 2HIXA 3KYHC 3S1NH 2WAQE 1XMOQ 2IX0A 4R4OA 1VQ8A 3I4NH 2PI2A 2LXKA 2UXBQ 4QQBX 3PF5A 4IPGA 2F4VQ 1VCIA 3S1QH 2ZTDA 2E2JH 1HH2P 2Q2IA 1DGSA 5IP7G 1XMQQ 4PMWA 4QJFA 1K3RA 3DLLA 3RZOH 2A19A 1Q82C 1VQIA 1TXYA 1FGUA 2VQFQ 1YBYA 1YVCA 3CPFA 2CKZB 1AE2A 4X66Q 1SN8A 3RN5A 1PH4A 2OQ0A 4KLKA 5FLMG 1Y1WG 4DK3C 5C44H 2OWOA 2N78A 2RCNA 3S1MH 1BKBA 4YHHL 4DV7L 2K5HA 2UUBQ 3H0GH 4HIDA 2D0PA 5IWAL 2BA0A 3CC2A 2OQKA 2ASBA 3GO5A 1M90C 4OWTB 2IHEA 1KQSA 4JI2Q 4BXXH 2CQOA 3HKSA 3S16H 4GKKL 2WAQG 3NELA 1WI5A 1YHQA 1BBWA 1E3PA 4DV2L 3GTOH 1FVIA 1NJIC 4L5TA 5C4XH 1GO3E 1EFWA 2K14A 3ZJYC 2NZOA 3J80c 4B3TQ 4A3BG 4IFDJ 4JI3Q 2ZM6L 4X64L 3D0FA 1JB7A 1QZGA 1X56A 4DV3L 1OXSC 2VS1A 1YNXA 2ZJQA 4LF7L 4EQ5A 4POFA 4P74A 1J5EQ 3PO3H 1VQCA 4DR4L 2VY3A 3TQYA 5M3FG 4DR7L 4JYAQ 5H1SE 1M1KC 2I5LX 3K8AA 1CSPA 3OTOQ 1YIJA 5LMUQ 3NENA 1EYGA 4A3GG 2KBNA 2K4KA 3BU2A 1VQGA 4DV1L 4R4QA 2GVBA 4KI0A 4BA1I 3CD6A 3RLNA 2R93H 3GTPH 2JA6G 4LF5Q 1VQJA 1EOVA 5BR8Q 4GKJL 1FJGL 2KCTA 5IYDG 4DUZL 3CXCA 1XNRL 3J7A5 4A4IA 1G51A 3H15A 3FKIH 4A3EH 2PQAB 4J15A 1IBKQ 3M3YH 5C3EG 4DAMA 4IOCA 4A3KG 3RN2A 2WB1E 4C3IH 1UE5A 2JA7H 4Y7NH 4DUYQ 4DR5Q 1KHIA 2NN6G 3LGJA 4YCUA 2PMZE 4JBMA 3EIVA 2CFMA 4WJ3M 1A63A 2JA5G 1UWVA 1LTLA 2MO0A 2HT1A 3GTGH 1YHBA 1VQBA 4LFCL 3RLFA 2F3IA 3RZDH 1X3FA 1IBLL 4B3ML 3TS0A 1X3EA 2HIVA 3K7AH 1LUZA 4GNXB 4C3HH 1L1OA 2V1CC 1Q1BA 1VQEA 4XTCS 3HOYH 2MFIA 3E0EA 4B3SL 1SLJA 2UXDQ 2UUCQ 1Q8KA 4GLVB 1PH5A 1HR0L 1N33Q 3UDIA 2VQEQ 1XJVA 1EQQA 4JOIA 2B29A 4LFBQ 2JA8G 2WB1G 3A5UA 4BY1H 1I94Q 1G291 1X6OA 2K5VA 2CWAA 3STBD 1KIXA 5GAGC 2B63G 1HNWL 2IHFA 4NXML 2UXCL 4A3IH 2R7FA 2N3SA 3W1GA 3L2PA 4YCWA 4QL5A 4LF4L 4HJ5A 1VQ4A 1GM5A 1OXTA 4DNIA 1I50H 2HHHL 2PI2E 4AYBE 1VQPA 1QVGA 1GD7A 1P8LA 1PFSA 3I56A 3ULPA 3KFUA 2PNHA 2KENA 3S14H 4OO1G 4HIOA 1TWHH 2FXQA 3HFZB 3S1RH 4R4TA 2IT1A 1BBUA 4DV4L 4YHHQ 2A8VA 3M85A 4DV7Q 3F2BA 1QVCA 3I55A 2YTYA 1L0WA 4DR3L 4AQYL 4JI5Q 3A5ZB 1WJJA 2JK8A 5IWAQ 3CAMA 3CCJA 4IPHA 2AHOB 3J80i 4BY7G 5M3MG 4JI6L 4LW1A 4UP7A 3UDGA 4GKKQ 2NVYH 4DR1Q 1I5FA 4DK6C 4OONA 4A76A 1YZ6A 3J7ZC 3W1BA 5FLMH 3CCRA 4DV2Q 3PUWA 1LYLA 1QUQB 2AKWB 2EXDA 1VQHA 5GAHC 4FDBA 3L0OA 3T1YL 1WCMH 2ZJPA 1U5KA 1Q12A 2ZM6Q 1UE7A 4X64Q 4DR2L 1HNXL 1RL2A 1Z9FA 4AYBG 1JJ2A 4DV3Q 1PHJA 1KD1C 2E8GA 4PG3A 4LF7Q 2R92H 3L7ZC 4DR4Q 2K75A 3GD7A 1B70B 1CSQA 1VQ5A 1CKNB 3I4MG 4DR7Q 4YWMA 1CUKA 1IL2A 1VQMA 2I5MX 5IT9c 3CC7A 1XNQL 4A3BH 1PH7A 5JJKA 4A3MG 3KOJA 3PUXA 5FJ8G 3G6EA 4DV1Q 1Q81C 1CKOA 4A75A 3KF6A 1JE5A 4A3CG 4GKJQ 1MKHA 4GS3A 3U4ZA 4DAYB 1E1OA 1EQRA 3GDEA 4TQUS 4X65L 3PGZA 4LUZA 3E9IA 5M3FH 4DUZQ 1XNRQ 3PO2G 2YV5A 1N32Q 4IO9A 4A3LG 2E2IH 2WP8J 1V9PA 2RHQB 5AJ3L 1E24A 4GOPB 4JI4L 3TRZA 2R7DA 1TWCH 2VNUD 5GQOA 4HIMA 3AEVA 1KAWA 1EIYB 1N36L 2ALYB 3HOXH 1ASYA 2JA6H 2OTJA 4A3FG 4R4CA 4JI1Q 3KDFA 4BBSG 5IYDH 3PSIA 3M9BA 4L5SA 1WYDA 3K0XA 1YITA 5M5YH 4LFCQ 2VW9A 4PZ7A 4R4IA 5LMNW 1IBLQ 1WFQA 5C3EH 2VUMG 1NMGA 4O2DA 3PV0A 4MTNA 3CPWA 5IYCG 3H3VI 4YY3L 2D62A 4B3SQ 4X62Q 4GLXA 2JA5H 4LF9Q 1HR0Q 1E22A 2EIFA 5IP9H 1HZAA 5IYBH 3J81c 2RF4A 3PUZA 3CCVA 2JA9A 1K8GA 2K5NA 3IRBA 5E7NA 2Z6KA 3T1HQ 2BH2A 2F4VL 1HNWQ 5C0XJ 4DV6L 3HOWG 4KHPL 3F2CA 3JAMc 3CCMA 3H0GG 1N34L 4NXMQ 1IBML 3ULLA 2UXCQ 1OXVA 4LF4Q 2GVAA 3M4QA 4P72A 4JBWA 3CQZH 2HHHQ 3FP9A 1YJNA 2JA8H 4JCVE 4DV0Q 2OCEA 4DR6L 4ALPA 1C9OA 2GN5A 3KF8B 1R9TH 3PUVA 3ULJA 4JV5L 1PVOA 3VDYA 4MNOA 3BZKA 4P75A 4A93G 4AQYQ 4LWCA 4IJLA 4DR3Q 1KC8C 1SE8A 2JEBI 3PO3G 2RHSB 2XGTA 1PH3A 2YYZA 3ICEA 5JEAG 2ES2A 4L5RC 1Q7YC 1NMFA 1UE1A 4YWKA 1XPUA 2MQHA 2D0OA 2IY5B 4JI3L 1G6PA 3U58A 4MZ9A 1VQDA 2N49A 2K52A 5C0XG 3T1YQ 1YJ9A 4JI8L 2UUAL 1N9WA 4DR2Q 5ELNA 1HNXQ 3G71A 3BJUA 1E7ZA 4BY7H 2Y0SE 4HIKA 5M3MH 4LNQA 2N8NA 2NN6I 2C35B 4IFDI 2PQAA 1VQFA 5LMUL 3HOUG 1L1OC 3U50C 1K0RA 2JA7G 3D31A 3G48A 1V43A 1XNQQ 4LFAL 3OYYA 1S72A 1E1TA 1V1QA 4JBKA 1K9MC 3KJPA 1X65A 5EAYA 3S2HH 1NY4A 4JOIC 3F2DA 3S17H 3MEFA 1XPOA 4LFAQ 4X65Q 3M4OH 5IP7H 3CF5A 5ELOA 3I4MH 4P71A 4OXPA 1EWIA 2YTXA 4OX9L 2R7ZG 1VQLA 1JMCA 2R6GA 3GTQH 3PF4A 1IYJB 1EUJA 1TWAH 4GNXA 2NVXH 4RMFA 2B3GA 4A3JG 4AIMA 4DR5L 1SMXA 4JI4Q 5FJ8H 1VQ6A 5JJIA 3HOYG 1HZBA 1Y1WH 1VQKA 2UU9L 2Y0SG 1MJCA 1N36Q 3CCSA 5K36G 4A3CH 2BH8A 1MIUA 4GLAC 3UDXA 1PH8A 4A3DG 4HJ9A 3OW2A 1KRTA 3PO2H 1D7QA 2CCZA 4K0KL 4NXNL 4BY1G 5LMNL 4HJ8A 2JQOA 4A3LH 1I3QH 2LSSA 1K83H 3NBHB 4XIGS 4BBRG 1A62A 1FL0A 5J3BA 1Y1VG 1YEZA 4A3IG 3CMAA 3J81i 3HOVG 4C2MH 3HOZG 3CMEA 2NVTH 2H5XA 2ZTEA 4YY3Q 4A3FH 3SGIA 4POGA 1VQNA 3BZCA 3TEHB 4LF6L 1HNZL 1PH6A 1EIFA 3K81C 2BA1A 4GN5A 4JI0L 4OWWB 4L5QA 3JAMi 2EQSA 4O0AA 1AE3A 4IPCA 2L15A 1VQ7A 4DV5L 1XTDA 2KCMA 1VS0A 1C0AA 2VUMH 3E9HA 1TWGH 2Z0SA 3CCUA 4JI7L 1PA6A 4TVAB 3CCQA 5IYCH 4DV6Q 4UY8C 4A3GH 3GTMH 1N34Q 4KHPQ 1IBMQ 2MO1A 2WFWA 1XPRA 1CKMA 4JC0A 4LF8L 2IX1A 4QGUA 3GTKH 3HKZE 3GTJH 5HGQA 3S2DH 3UDFA 3S15H 1QUQA 3JC66 1B8AA 1VQAA 3Q8DA 2AWOA 4R1JA 3CP0A 2KHIA 4DR6Q 4H02A 2E2HH 1IXRA 1WCMG 3HOWH 3FHWA 4ME3A 2E5LL 4JI5L 5DLQE 1VQ9A 4IOAA 2DGYA 4B3MQ 1YHAA 4Y52H 1HZ9A 3UE1A 4A3KH 3I4NG 4JV5Q 1PH2A 3AFPA 3EBEA 4AH6A 3CCLA 1GVPA 2R92G 3A74A 4WJ4A 2QA4A 5GADC 1CKNA 1O7IA 4DR1L 1QZHA 1UEBA 4PZ6A 2DUDA 1N8RC 1PH1A 2ID0A 4B3RL 3G4SA 2AWNA 2MNAA 1C7YA 5JEAJ 4X6AH 3K80C 3PUYA 1HJPA 1RIPA 3K7UC 3A0JA 1XMOL 5IY0A 4IPDA 5C44G 4GN3B 4LUVA 1Q86C 1Q1EA 3HKZG 4JI8Q 4A93H 2UUAQ 2UXBL 1JJGA 3I4OA 2JJQA 2VL6A 2VZAA 4QIWE 3PCOB 1L1OB 1XMQL
chains in the Genus database with same CATH superfamily
3KJOA 2CHBD 2EDGA 1HA5A 1OTCA 3BYYB 5JJLA 3H94A 1X9NA 1S3OA 5C0XH 2A1AA 2EYLA 2ZTCA 3HOXG 5D14A 3H91A 1CZWA 2KA7A 1Y8NB 4DV4Q 3A7AB 3SK6A 5I6YA 2I0QA 1LM0A 2Z6KC 2TMPA 4K5XA 3TSSA 1NSNS 1HCZA 1O7YA 1JB3A 4OWXB 4C3JH 1SROA 2LY7A 2HQLA 3I7FA 4B3TL 1I4XA 4P73A 1NAPA 1D8LA 2F0SA 3N6RA 2A73B 1ENFA 4RG1A 1U0LA 5M5WB 2R93G 4N8FA 2C5CA 1Z6HA 1RODA 2F0UA 3TZDA 2HCIA 4K0KQ 1EY6A 2R7ZB 4A3JH 1IZ6A 2Y0SB 4K2KA 4LF6Q 4LF5L 1GUOA 2RSOA 1STAA 2K50A 4JI0Q 2A68C 1I4PA 1KXLA 4DV5Q 2F0QA 1BCPF 1Y1VH 1OXUA 3GV6A 4BBRB 4K8JA 4XYOA 3HOZH 2ZT9C 2DJFC 4NPSA 1P16A 3AYHB 4GN4B 3E0JA 2YU9B 4JK1C 1ILPA 1I4QA 1WOCA 1TWFH 5KNBA 1Y69U 1JT8A 4X3SA 3CC4A 1TWHB 3QWNA 5CBEE 5IODA 2QGQA 2ATWA 1PYBA 3F8TA 5FLXc 1YI2A 4BBSH 1Z47A 1YJWA 5C4JB 3KDFB 1X55A 1MJEA 5GAEC 4LFBL 4JBJA 1K8AC 1I94L 4FF3A 1SE2A 3DMUA 3ZYYX 2WAQE 3I4NH 1QNKA 1RJTA 2F4VQ 1HUMA 1VCIA 3IFDA 2F0LA 1HH2P 2QEJC 3QG1A 4QJFA 1K3RA 3KUPA 2E2JB 1BOSA 1SNMA 1TXYA 1SMYD 2VQFQ 5IIFA 2CKZB 1AE2A 4E6IA 1EY0A 5FLMG 2K28A 2XWBB 5C44B 4P2CB 4XT3B 2F0HA 3S1MB 1B9MA 4HIDA 4TKOB 1U4MA 2DJGC 4FXDA 2SEBD 4EQOA 1DONA 2ZXPA 4KJNA 3GTOH 1FVIA 5EPLA 1TWCB 1GO3E 5I9OA 3ZJYC 3J80c 4IFDJ 4JI3Q 2QILA 4FO2A 1X56A 2XNAC 1OXSC 1YNXA 2F0GA 2ZJQA 4FXKC 4EQ5A 3PO3H 2PW5A 4DF7A 1KNEA 3TQYA 5M3FG 5FOBB 3A54A 3C2PA 2I5LX 1EEFD 3K8AA 5LMUQ 4I7ZC 4WRDA 3IAYA 2K4KA 4DV1L 4BA1I 4KI0A 2NB0A 1YNJC 2R93H 2JA6G 5IYDG 3MXGA 3J81E 3CXCA 2PQEA 1G51A 1JC7A 2PQAB 3FKIB 1AW7A 1EQTA 3M3YB 1UE5A 3JAME 4Y7NH 4DUYQ 4DR5Q 4C3IB 4FF1A 2O4XA 1S5FD 2CFMA 4WJ3M 1LTLA 2MO0A 1YHBA 5ELCA 4LFCL 2F3IA 1X3FA 3E5SA 1I4GA 1IBLL 2MGSA 2X69A 3J81L 4XQNA 3EQLC 4C3HH 1L1OA 1Q1BA 2XRQD 2FINB 3C46A 3CRLC 3OPOA 1Q8KA 4GLVB 1EQVA 2CH4A 1N33Q 4IALA 1IW7D 5EKIA 2E74C 1EWCA 1PTOD 1X3PA 4K2LA 3C1EA 3STBD 2B63G 1JCKB 5ISRA 2SOBA 2JYOA 4NXML 2R7FA 3W1GA 4YCWA 5G3LD 1GXDC 4LMQD 5DEHA 1OXTA 1A6XA 2PI2E 1VQPA 1EZ6A 3TP5A 1ICWA 3SR1A 1RCVD 4OO1G 2WINB 1TWHH 3S1RH 1SYCA 2A8VA 3M85A 4DV7Q 1ET6A 2RDHA 2JK8A 5IWAQ 3J80i 2LMCB 4OEMB 3UDGA 4DK6C 1A3TA 5FLMH 1U4LA 3CCRA 2EXDA 3T1YL 5EPKA 1Q12A 3LX0A 2B2TA 4AYBG 1JJ2A 5ELDA 2R3ZA 4DR4Q 5NUCA 3AB9A 2QCPX 1VQMA 1PH7A 4EGVA 5FJ8G 4A3BB 1B3QA 1JE5A 4GKJQ 3P75A 4GS3A 4DAYB 4LFAL 1QWYA 2RA4A 4DUZQ 4TQUS 5M3FH 4LUZA 4OHJA 4X3UA 2WACA 4IUPA 5KNCA 3TRZA 1TWCH 4DAVA 1MBYA 2EYPA 3AEVA 2MHVA 1II3A 2KVMA 1N36L 1EIYB 2JA6H 2OTJA 2B2VA 2KCNA 4GZYC 3KDFA 2N55A 5IYDH 1SYGA 3PSIA 2Z8LA 3O13A 5IT9L 4ZLTF 4IZ8A 3CHBD 1SYBA 4DGZA 5LMNW 1EY5A 1PRTD 1R4QB 2WKDA 3H3VI 5IYCG 2D62A 3RUZA 4GLXA 1HR0Q 2IWHA 2JA5B 5IYBH 3CCVA 2B2VC 4TRDA 2H1EA 5CR3A 1NUCA 4FYDA 2KHSA 1IHZA 2Q8RE 5C0XJ 3VR3A 4ZCKA 4LF4Q 1CQFA 2EYOA 1ESFA 1U4PA 4IURA 1PTOB 3BDLA 4QUCA 1YJNA 3K58A 3NK9A 2OCEA 2EYFA 2G5DA 2GN5A 2WB1B 5BN5A 4DR6L 3KF8B 2JXMB 3H09A 1R9TH 1GUNA 1EY4A 1PVOA 4MNOA 2L4NA 4AQYQ 4LWCA 4DR3Q 5IOCA 1KC8C 1C8CA 2RHSB 1PH3A 1SSOA 3ICEA 1NMFA 3NSWA 2IY5B 4PMCA 4DXGA 2CVRA 1R4PB 1VQDA 2K52A 4JI8L 3R93A 4IFDI 1BO0A 2NN6I 2O5JC 1TS4A 3J7AF 2PQAA 5ELFA 5CV5A 1JWUD 3HOUG 4I65A 1K0RA 3NBIA 4ZQ3A 1EU3A 2K01A 3OYYA 1E1TA 1V1QA 4YIJA 3CU7A 4ABNA 3S2HH 1NY4A 4JOIC 1SYEA 3MEFA 2F0WA 4X65Q 5IP7H 3T53B 1BUVT 1H9SA 2EYJA 3PF4A 3I4MB 2NVXH 3KLRA 5KGUA 2B3GA 4AIMA 2MP1A 3D4WA 5FJ8H 4L63B 1D6EC 1MJCA 3GP7A 3D6WA 3UDXA 1PH8A 4A3DG 5LL6X 1KRTA 1D7QA 4K0KL 4UHVA 3R8BA 1I3QH 2LSSA 1STBA 2A6ED 5E4XA 3AU7A 1D5MC 3HOVG 4HR7B 2NVTH 2H5XA 2ZTEA 4YY3Q 1RTNA 4POGA 3BZCA 4LF6L 1PH6A 4OIJA 1EIFA 4A3FB 1PZJD 4JI0L 1AE3A 4IPCA 3PIO3 3BS1A 4DV5L 1XTDA 2KCMA 1NR2A 1BBXC 1ICFB 1PRTB 2EY2A 4RH6A 5FO8B 4TVAB 5IYCH 4RGTA 3GTMB 4B9XA 3K5MA 3HKZE 4B08A 4H44C 3TBIB 1H9JA 2B8FA 3UDFA 3GTJB 3TMEA 3S2DB 2VB2X 4FF2A 1KLUD 3CP0A 1JR0D 1EU4A 1YNND 4JI5L 1VQ9A 3HOWB 1YHAA 4Y52H 1HZ9A 4JV5Q 3AFPA 3EBEA 4AH6A 4N9TA 1T5XD 2QA4A 5GADC 1QZHA 4DR1L 4PZ6A 1XWEA 2DUDA 1SMYC 1JOKA 3FDTA 3K80C 2G9DA 1VF7A 2BOSA 5IY0A 4RKLA 1U4RA 4DAYA 3I4OA 3HEJA 4ZKBB 2VL6A 3PCOB 1A3VA 5HGTA 5ELBA 4LAAA 3QO2A 3MXNB 2Z4IA 5CGKA 2VQFL 4KD3A 4EX5A 3RR5A 2NZHA 3PIP3 3TP7A 2AUJD 1LTTD 5C4XG 1S4ZA 3PIOA 1J6QA 3GTPB 2EJMA 3DM3A 1GUTA 2L12A 2L55A 1STGA 1W2BA 2KCCA 3HOUH 4RHSA 3AQQA 3EVQA 5C4ZA 1HA6A 4C3JB 2RBMA 2F3VA 4IUQA 4JI1L 2LXJA 1X54A 3FEWX 1SEBD 1PYSB 4RHRA 1I4RA 3ER0A 3CW2C 1PH9A 2KJXA 3BDOA 1EY9A 1CTMA 5EKKA 1IKMA 4HJ7A 4A3JB 2B2UA 4X62L 4IUVA 3RLOA 1F9PA 2F52A 3K5LA 2QDLA 3TREA 4CKBA 1XYIA 4A3DH 1MSHA 2F0PA 4QY7A 3KF8A 2K5WA 2Q2UA 3HOVH 4M8AA 1Y1VB 4DK1A 4DUYL 4A3MH 3HOZB 3OWFA 5M5XH 2HDLA 1FNVA 3PIPA 5C0XI 4LF8Q 1Q90A 2IX3A 2B2UC 4L8JA 4H0LC 1A8VA 3KF6B 1I6HH 1IW7C 1EYDA 1FYCA 1G8ZD 1TQOA 1S5DD 3S24A 1HQMC 3STBC 2E5LQ 3TZUA 1KLGD 2WV6D 2L9HA 4GNXC 1N33L 2D5DA 5C6AA 1W3SA 5GROA 1K73C 4HAEA 4DFAA 4PZ8A 3KYHC 3S1NH 4J1MA 5IGDA 1WCMB 1VQ8A 2LXKA 3NPPA 4RGMA 3I4NB 1TKWB 3S1QH 1F9QA 2ZTDA 1WTOA 3DEOA 1DGSA 3NTIA 1WTPA 2A19A 1FGUA 5C4HA 3RN5A 4KLKA 1Y1WG 2RCNA 5I4DA 4DV7L 2K5HA 2UUBQ 3H0GH 1IYVA 5IWAL 2DNEA 3FRPB 1ML0D 4KKSA 4OWTB 2IHEA 4JI2Q 3HKSA 3S16H 2WAQG 3A8KE 2NBFA 1WI5A 1BBWA 2EOTA 5JPMC 3NTHA 5COYA 1NJIC 3GTOB 4L5TA 3TP8A 5C4XH 4MN3A 1EYAA 2KECA 1JB7A 2PZWA 3P1HA 2K1BA 1EY8A 3AMUA 1FNWA 4M1UB 4P74A 1JICA 1J5EQ 4DR4L 3PO3B 3I73A 1CSPA 3VYUA 1EYGA 4A3GG 1K0SA 2KBNA 3BU2A 4NW2A 4OIKA 2GVBA 1KNAA 1TY2A 1EEID 3GTPH 2IL8A 4ZUIA 3P20A 4GKJL 5BR8Q 2R93B 4DUZL 1ESRA 3H15A 4HMJA 4J15A 5EPJA 4DAMA 4IOCA 1G91A 4A3KG 2JA7H 4JPBW 2K05A 4G57A 1KHIA 4RA8A 1EYCA 5F2DA 5CC4A 4Y7NB 3LWEA 2F0FA 2HT1A 2PZTA 3RZDH 1XTCD 1ZYRD 4R8NA 2B39A 1SNCA 4WORA 3TS0A 1X3EA 4KV6A 2EE1A 2Z1CA 1RDPD 4JW0A 3HOYH 2MFIA 3MXNA 4C3HB 1PH5A 1HR0L 3KBGA 3RMHA 5D3IB 2VQEQ 3SE0A 5JOBA 3A5UA 2D9UA 4BY1H 1G291 4I7AA 4XQJA 5GAGC 1KIXA 2IHFA 4A3IH 2KQ3A 2N3SA 3MFGA 4LF4L 5KEEA 1GM5A 2N88A 4DNIA 2QKIC 1P8LA 1PFSA 1QILA 5DNFA 1NNXA 1A15A 3NQIA 3S14H 1STHA 3HFZB 1PZID 2IT1A 3S1RB 3F2BA 1QVCA 3ND8A 2YTYA 1L0WA 4DXFA 4DR3L 4AQYL 4JI5Q 1WJJA 4R8IA 3CAMA 3U9OA 3MA2B 5M3MG 2NVYH 4IUUA 1I5FA 1OO9B 4DR1Q 2X6GA 4A76A 4K5WA 3W1BA 4EQNA 3E3XA 4DV2Q 3PUWA 3I8ZA 1LTGD 4CJ0B 1WCMH 4KKUA 1WTVA 2HQEA 1UE7A 4X64Q 4DV3Q 4C1NI 2R92H 2F1MA 1CSQA 1V1PB 2I5MX 5IT9c 3CC7A 5JJKA 3G6EA 2F0EA 1CKOA 4A75A 3KF6A 4MTKA 4A3CG 1MKHA 4X65L 3U4ZA 1FJGQ 1EQRA 3GDEA 3E9IA 3G7LA 3PO2G 5M3FB 3ITPA 1LABA 3FVQA 1V9PA 2A69D 5AJ3L 2E2DC 2VNUD 1KAWA 1BF4A 3HOXH 2EY6A 4JI1Q 2JA6B 4J8QA 5M9OA 3M9BA 5FO9B 4L5SA 2NWGA 5M5YH 1BXTA 2VW9A 4R4IA 1WFQA 2E2HB 1HTPA 2NTTA 3C3LA 1NMGA 4FNFA 1G2SA 2WKCA 4CKEA 5KYLA 3CPWA 4YY3L 4B3SQ 4X62Q 2RF4A 2JA9A 3OIPA 1K8OA 2PNRC 3IRBA 5E7NA 3DWAA 1EY7A 1YNNC 3F2CA 3ULLA 1JQYD 2GVAA 3M4QA 4JBWA 2FJ2A 2HHHQ 1SJHD 1DOLA 4IUNA 4IN3A 2NVQB 4ALPA 1C9OA 1NCVA 1R9TB 1H9SB 4RGOS 4JV5L 2PMZB 4A93G 4P75A 4G7HC 3W3AA 1SE8A 2LS01 2PYKA 2XGTA 2YYZA 5A35A 5JEAG 2ES2A 1XX8A 4L5RC 3JAML 1EIGA 4YWKA 2D0OA 2MQHA 2DNCA 2O2LD 3WDNA 1RHPA 2Y0SE 5M3MH 4FP5D 1K8MA 4HN7A 1L1OC 1HFNA 3G48A 1V43A 1XNQQ 1S72A 4JBKA 1K9MC 3KJPA 2AQ3B 3OSOA 3F2DA 4AYBB 1RD9D 3S2HB 1JORA 3CF5A 4P71A 2YTXA 1BR9A 1ENAA 3DUZA 1JMCA 1IYJB 2K33A 2NVXB 3KLSA 1VQ6A 5JJIA 3A8JE 3QOJA 4RCOA 1ZEQX 5K36G 4A3CH 2MPMA 1LLRD 5C3WA 3A8IE 4KY5A 3PO2H 1ZKOA 5IGFA 2JQOA 4K14A 4XIGS 1A62A 1I3QB 4FXGC 3CMAA 1PTOF 4C2MH 1UEAB 1VQNA 3TEHB 1V1OA 3BG3A 2NVTB 4MHEA 5FLXE 4F87A 3PQIA 1S5BD 5G3LF 1VQ7A 1VS0A 1GOZA 2B2TC 3E9HA 2F0JA 1CHPD 5JVG3 1N34Q 1XPRA 3OW7A 3I72A 4LF8L 4QGUA 2IX1A 1L0YB 3S15H 3VA7A 1B8AA 3Q8DA 4R1JA 5FLXL 2R61A 2KHIA 4H02A 2E2HH 2K7VA 4ME3A 2E5LL 5CORA 2DGYA 3UE1A 3CCLA 3LNNA 1GVPA 3OHXC 1F2MA 4WJ4A 1V1PA 2VB3X 1FGBD 2K5DA 4ODGA 4X3KA 3J7YW 2ID0A 3DWPA 5D3DA 2HCCA 1L0XB 1EZ8A 2IJ0A 3PUYA 4X6AH 2EJGC 3T56B 4PMBA 3J80E 4A93H 1Q1EA 3HKZG 5E4WC 2VZAA 1D5XC 1ZXTA 3NWTA 5I2XA 3FPUB 1OXXK 1GHJA 1HPCA 3H6MA 4BXXG 4BA2I 5I2YA 2NVQH 3EN2A 2YTVA 5CBAE 2OTLA 1AH9A 2B63H 1QVFA 2E75C 2UUBL 1SFOH 2Q2TA 1A0IA 3BYTB 1CHQD 1N32L 2XTIA 1Y8PB 4APVA 1PXUA 2F0MA 4DKAC 4JI2L 1F9SA 1NBWA 4OX9Q 3RD4A 3HOUB 1D2BA 1DCZA 4UP8A 1QCBD 4FVMA 4IFDG 3RNUA 1A2TA 4OO1H 2B8GA 2UU9Q 2CWPA 3F1ZA 3W5OA 1PRTF 5IP9G 4R9WA 2J7ZA 4XYQA 1NE3A 1VMCA 2Z6BA 3KLWA 1J5EL 2F3WA 4JVZA 4JG2A 1WTRA 4HCEA 1UE6A 4A3EG 3QR8A 3QOLA 4LF9L 4QCLA 4UP9A 4KHVA 4DAPA 4HSVA 3B6YA 4BWGB 5BR8L 1EWHA 4UAIA 4A3DB 2ENBA 1SRUA 2QW7A 1B4OA 3Q22A 3T1HL 2QEXA 1I6VC 1ZYRC 5L37A 1ONLA 3D6CA 3GTLH 2M9VA 4CDDC 4JI7Q 3HOVB 5AJ3Q 4WFN3 3I2ZA 4LUOA 4A3MB 5C5LA 5M5XB 1SNOA 1BQQT 5KRUA 1BVSA 1HFGA 2A6HD 2BE5D 3FPPA 1I6HB 3VR6A 4LJZC 4XDXA 3ERSX 1WD1A 3M4PA 4F8MA 4NDXA 5DM73 4ZRZA 1PV4A 3AFQA 2VQEL 1HR0W 2EYMA 1Y14B 3H3VH 5KIXA 3J81j 5BN3A 2F0KA 2IX0A 3S1NB 1PYWD 5CYUA 2UXBQ 5T1GA 3PF5A 4QQBX 4IPGA 1STYA 4DNTB 1X3QA 2Q2IA 1XMQQ 3RZOH 2EY5A 3S1QB 3R2TA 1Q82C 1VQIA 4KMUC 5IGBA 5D65A 3K6OA 4G4KA 4X66Q 4KY6A 1PH4A 3OMGA 3SK5A 1J9OA 2N78A 3DEPA 1BKBA 2EVBA 2K6AA 5CV7A 2JP1A 2OQKA 3H0GB 3MEHA 3GO5A 4QUFA 4K5VA 4BXXH 4DA2A 3QIAA 4KD4A 1H9RA 3I91A 2E2IB 1YHQA 3S16B 1E3PA 4DV2L 2NZOA 2RDGA 5C4XB 1RKNA 4O42A 2MUYA 4X64L 3OWEB 5J39A 1GHKA 4DV3L 2VS1A 2F0VA 1CFMA 1VQCA 3W2DA 2VY3A 3HP3A 1CM9A 1O80A 4JYAQ 1Y8OB 2EPBA 5H1SE 1M1KC 2Z4HA 3OTOQ 4DN4M 3NENA 2A69C 3MC0B 4R4QA 4LK1C 2L1BA 1EOVA 2J0TD 1FJGL 2KCTA 1LTBD 1EIHA 2D2CC 4ME5A 4A3EH 4HMIA 1IBKQ 2LFNA 3VR2A 3PMFA 5C3EG 3IKJA 3MXUA 3RN2A 1CK1A 2WB1E 1E2WA 2JA7B 4L6TB 1KABA 1NR4A 3LGJA 4YCUA 3EIVA 3MVVA 3GTGH 1STEA 1PDQA 5IGEA 3RLFA 3V2TA 1B2TA 3K0YA 3RZDB 3DHQA 2HIVA 3K7AH 1LUZA 4V0BA 3SEBA 3BZDB 4XTCS 4B3SL 5ELEA 2I46A 2UXDQ 2UUCQ 3HOYB 4S3SA 4EVOA 2JA8G 5EQ0A 1X6OA 2CWAA 4BY1B 1IYUA 4KJOA 2PW7A 3L2PA 4A3IB 4QL5A 1H9MA 1S5ED 5DAUA 3A55A 4J6HA 1I50H 2HHHL 1QVGA 4C3JG 1GD7A 3ULPA 3I56A 1O7ZA 2KENA 3IL8A 4HIOA 2FXQA 3S14B 1PTOC 2ZXOA 4R4TA 2GA4B 1BBUA 4YHHQ 3I55A 2P5ZX 4IPHA 2IPKD 4BY7G 4JI6L 4LW1A 4UP7A 3HGBA 4GKKQ 1TWAB 2ICIA 4OONA 3LWUA 2RCFA 2NVYB 1LYLA 3L9AX 2F0IA 1VQHA 5GAHC 4FDBA 3L0OA 1U5KA 2ZM6Q 1VMPA 1K28A 1Z9FA 2DY8A 4PG3A 4LF7Q 4DU9A 1AP0A 1AFPA 2R92B 1O78A 4DR7Q 1CKNB 2WAQB 3P7JA 4YWMA 1CUKA 5IGCA 1XNQL 4CKCA 3PUXA 3ND9A 1Q81C 3SK4A 2EXZA 3A7LA 1W6KA 3TDQA 3OOCA 2QF7A 2FMCA 3PGZA 1N32Q 1T5EA 1XNRQ 5JAVA 5KYIA 4IO9A 2E2IH 1V8QA 3EA6A 3SXHA 4GOPB 5E1FA 2R7DA 5CMDA 4A3GB 3NWSA 2CW0D 3K5NA 4R4CA 1PFNA 3HOXB 4BBSG 1LTSD 2BDOA 1YITA 5JVH3 1K3BC 1FNUA 1GJXA 5M5YB 5BN4A 2K04A 5C3EH 1W6JA 3CKIB 3N52A 1D5ZC 2VUMG 4QIWB 2NUCA 4LF9Q 1E22A 2EIFA 3J81c 1SXTA 3PUZA 1EL0A 2CQAA 1LT3D 4HEDA 1E2ZA 2Z6KA 3T1HQ 3SDZA 2HUGA 1HNWQ 1QG7A 1B50A 3JAMc 3CCMA 2UXCQ 2AQ2B 3ERQA 1N34L 1OXVA 1PRTC 2K32A 3BVMA 3MHBA 3CQZH 1BCPD 2OF1A 4HCSA 5CV8A 2JA8H 3U9SA 3PUVA 5KNDA 2JSOA 2RKSA 3VDYA 4IQZA 2RSNA 4IJLA 3PO3G 1B53A 1H9KA 2WIIB 4NKLA 1Q7YC 2PO4A 1XPUA 5EBCA 2V4DA 3J7AV 1AEXA 4WJWA 2G9HD 4MZ9A 2N49A 1N9WA 4DR2Q 1TT2A 1HNXQ 3G71A 2EJFC 1E7ZA 3DWQA 4BY7H 3NE5B 4HIKA 4LNQA 3A56A 5M3MB 3FMCA 3HS0C 3U50C 3D31A 5T1IA 5J1ZA 3I3CA 2L0CA 5EAYA 1ILQA 3S17H 3M4OH 4XXEA 1IL8A 4OGQC 2KEEA 4OXPA 3WOFA 4OX9L 2R7ZG 1TY0A 1VQLA 2R6GA 5AFWA 3GTQH 1GUWA 1TWAH 1HHVA 4C3HG 4JI4Q 2SDFA 2Q8IB 3M7GA 1HZBA 1Y1WH 1VQKA 2UU9L 2Y0SG 1FR3A 1SBBB 4RCNA 1LTAD 3CCSA 1SE3A 3KLSX 2BH8A 1MIUA 1PFMA 3E6ZX 1LT4D 3OW2A 4H7BA 5I6WA 2A74C 1FD7D 3T51B 4KK7A 4HJ8A 3NBHB 3PO2B 1K83H 4BBRG 1FL0A 4CDFC 1YEZA 5CV9A 3J81i 1JE4A 4C2MB 3QJYA 5JJZA 3K81C 3R3OA 4OWWB 2K5QA 2EQSA 3JAMi 1WTHA 2M00A 2L15A 2A6HC 2BE5C 4ULLA 2VUMH 2Z0SA 4JI7L 1PA6A 4DV6Q 4ZYSA 3CCQA 4UY8C 4A3GH 4KHPQ 1IBMQ 2MO1A 2A6EC 2WFWA 1CKMA 2VXWA 4JC0A 3GTKH 3KK7A 5HGQA 3K5OA 3NQTA 1VF5C 1SE4A 3BVGA 4KY7A 4BS9A 3S15B 2AWOA 4G7ZC 2I07B 5DLQE 1SJED 1G2TA 4A3KH 4F7XA 1PH2A 3A74A 4EQPA 1BCPB 1CKNA 1N8RC 3G4SA 1C7YA 2KEDA 1RTOA 1LTID 1LT5D 4IPDA 1AZQA 3OMCA 5C44G 4GN3B 4LUVA 2UXBL 1JJGA 2UUAQ 1U9RA 4A93B 4QIWE 4DNRB 1XMQL 1WD0A 5IE8A 1J8IA 5HURA 1SR3A 1B1ZA 1B7YB 4GOPA 3DXJC 3Q23A 1ASZA 4X66L 2F03A 3M7NA 4YWLA 1KRSA 3QB3A 4YCVA 5J22A 1WTQA 2BCOA 2B63B 1X32A 3HG9A 2ZJRA 1SFOB 4FF4A 4IJHA 2Q8TA 1GKHA 3M4YA 1KDCA 1F9RA 2I5HA 1MSGA 1NTGA 3MTSA 3NEMA 4JI6Q 5EKLA 1A2UA 3NTKA 1HUNA 3I4LA 2DY7A 2XRSD 4GOPC 4HJAA 5M5WH 3NHHA 5IYBG 3I70A 5LHY1 4ZK9B 2R7ZH 3T13A 4NXNQ 4JYAL 1H95A 5LMNQ 5EGTA 3FKIG 4QF4A 3OTOL 1M4VA 1ENCA 4NB3A 2JEAI 1A3UA 2L11A 4UPAA 1VQOA 2FMMA 1Q46A 1L2FA 4C3IG 2JE6I 1KL9A 4CDCC 2RDFA 3TS2A 5CV4A 1HNZQ 2OXPA 4KHZA 4OL7A 2FFKB 1MGSA 1MI2A 3MAQA 2HDMA 1JOOA 4PQXA 4BBRH 1IBKL 2B2YA 1LACA 2HD3A 1AN8A 3GTLB 2A5HA 5HY6A 3GQBA 1SNQA 1B3AA 3UE0A 1D1KA 1SDFA 2KHJA 2YU9H 2NYZD 1JJCB 1CA6A 3CCEA 2Q2HA 2JN4A 4DPGA 1D1IA 1C48A 1T9HA 4U68A 1HZCA 4DV0L 3WWVA 3EROA 3U4VA 1PZKD 1X3GA 2F0NA 2SNSA 4PNYA 5C5MA 2UXDL 2UUCL 2B2YC 2RVLA 3TN2A 3MFYA 4ZKCB 4OO1I 2J4XA 2B2WA 5C4JH 4OELB 1S40A 4B3RQ 2AQ1B 2AMCB 3NUCA 2XIWA 2HIXA 1XMOQ 2DN8A 3KBXA 4R4OA 1CI3M 2PI2A 4F88A 3GV3A 2E2JH 5IP7G 4PMWA 3DLLA 2QDBA 3RZOB 3EFXD 4NP5A 1YBYA 1YVCA 3CPFA 1SN8A 2B2WC 4XQQA 2OQ0A 5IT9E 4DK3C 5C44H 2OWOA 2NTSA 3S1MH 4YHHL 3HKZB 1DOMA 4HSPA 2IW3A 2D0PA 2BA0A 3CC2A 2ASBA 1M90C 3NBHA 4CJ2C 1KQSA 2O5IC 2CQOA 4CHTB 4GKKL 1QE6A 3NELA 3T4AC 1WVLA 1EFWA 4B3TQ 2K14A 4A3BG 3VR5A 5TSSA 2ZM6L 1Z7TA 3D0FA 1QZGA 1CQVA 3C1FA 3WOEA 4LF7L 1PMRA 4ZAIA 3SK8A 4K6DA 1SAPA 4POFA 2H4OA 4DR7L 5JEAH 1YIJA 1XXGA 2XVSA 1TVXA 3ONAB 1VQGA 2CW0C 5CV6A 3CD6A 3RLNA 4LF5Q 1VQJA 1UUPA 2SNMA 3VYRA 3D4RA 3TP6A 1XNRL 3J7A5 3J80L 4A4IA 3HRZC 3FKIH 4C56C 4A3EB 2NZ1D 3M3YH 2PCFB 1BDOA 4C3IH 2OEOA 1DZ1A 3K59A 2NN6G 1KDAA 2PMZE 4JBMA 1A63A 2JA5G 1UWVA 4N9PA 3VR4A 2A68D 5EJWA 1PLFA 1VQBA 3URYA 3GTGB 4B3ML 3MZ5A 1S5CD 3VYSA 4GNXB 4V190 3K7AB 1CZGA 2V1CC 1GUGA 1VQEA 4N8X1 1HQRD 3E0EA 4RFBA 1HRJA 4RWSC 1SLJA 1B44D 2PPBC 4RGNA 5K36H 5EBDA 3UDIA 3SHLA 1XJVA 1BCPC 3V05A 4JOIA 1EQQA 2B29A 4O1NA 1UNSA 4LFBQ 4MIUA 2WB1G 1TS5A 1QOHA 1I94Q 1LV9A 4QB4A 2K5VA 3MWYW 1HNWL 2UXCL 5IGGA 4HJ5A 1VQ4A 1VDZA 2X6LA 2XWJB 5FK9C 4AYBE 3DM1A 1I50B 1STNA 1JOQA 3EJIA 2EY1A 3KFUA 1SYFA 1LT6D 2PNHA 1F2LA 3UI2A 4C1NK 4DV4L 1SYDA 4Q5VA 1TU2B 3A5ZB 3CCJA 2AHOB 1PFBA 1IKLA 4CBVA 1E2VA 1MD2D 1YZ6A 3J7ZC 3R2IA 1QUQB 2AKWB 2EZVA 1DD2A 2XSCA 3Q24A 2F0OA 1F2YA 2ZJPA 4DR2L 3S9WA 1HNXL 1RL2A 1PHJA 1KD1C 2E8GA 2EYHA 3L7ZC 5FKAC 2K75A 3GD7A 1B70B 1VQ5A 3I4MG 4ZUJA 1IL2A 4A3BH 5A2QE 3KOJA 4A3MG 4DV1Q 4TSSA 1TR5A 1HTLD 3CRKC 4H13C 1M8AA 1E1OA 1LTRD 1C0AA 2YV5A 1CA5A 4A3LG 1Q3LA 2WP8J 1QJOA 1TWGB 2RHQB 1E24A 4CDEC 4JI4L 5GQOA 4HIMA 4HTHA 1G6ZA 1YNJD 2ALYB 1ASYA 4A3FG 1RF2D 4K6LA 5A2QL 1WYDA 3K0XA 4LFCQ 4ILWA 4KN7C 3VA5A 4PZ7A 1IBLQ 2ZXRA 4UDUC 1DJRD 5C3EB 3D4DA 4O2DA 4IFDH 3PV0A 4MTNA 2NN6H 3G6JB 1KDBA 2TSSA 2JA5H 1TS2A 1B9NA 3F2UA 5IP9H 1DOKA 1HZAA 1JWMD 1LO5D 1K8GA 2K5NA 2BH2A 3X3MA 2F4VL 3H3VC 4U673 3HOWG 4DV6L 2RQXA 4KHPL 2Z9HA 4NXMQ 3H0GG 1IBML 4KKTA 1AZPA 5LL6S 1PTOH 4P72A 3IFTA 3FP9A 3CQZB 4JCVE 3NP8A 2F0DA 4DV0Q 3BDCA 2JA8B 4ID6A 4CGYB 1Q8IA 2PZUA 1WTWA 2L5TA 1EOTA 3ULJA 2BDNA 2AUKA 3BZKA 1GUSA 2M2LA 2JEBI 4CJ1B 1UE1A 3SVMA 4JI3L 2K03A 4G7OC 3U58A 1G6PA 4PV1C 4DK0A 5C0XG 3T1YQ 1YJ9A 2UUAL 5ELNA 1WTXA 1E0BA 3BJUA 3NXWA 5JPNC 2N8NA 2C35B 4Q0FA 5FO7B 4BY7B 1VQFA 3T16A 5LMUL 1CT1D 4RAUC 2JA7G 4QMGA 1DYQA 1UAPA 1X65A 4KN4C 4Z9CB 1ET9A 1DM0B 3I90A 1XPOA 1MHWC 4LFAQ 3S17B 3D8GA 2FHTA 5ELOA 3I4MH 1EWIA 3M4OB 2CH4W 1TS3A 1EUJA 4GNXA 4IUTA 4RMFA 4A3JG 5C3XA 4DR5L 1SMXA 3GTQB 3HOYG 1C4QA 1SNDA 2KOLA 2MJ8A 4KTAA 1QB5D 1N36Q 1Y1WB 3Q0AA 1EFID 1SNPA 4GLAC 1QNUA 4HJ9A 2LKVA 1TWFB 2E76C 2CCZA 1DXMA 4NXNL 4BY1G 5LMNL 4A3LH 2OT2A 4XT1B 2F0TA 5J3BA 1K83B 3K57A 1Y1VG 4A3IG 3X3NA 2F4IA 4X3TA 3HOZG 3CMEA 3L3OC 4A3FH 3SGIA 1HNZL 2BA1A 4GN5A 4BBSB 4L5QA 4O0AA 2XN9C 2KUMA 1KTKA 1TIID 2C9OA 1O7LA 1TWGH 3CCUA 2VUMB 5I9PA 4RKBA 3GTMH 4NMZA 3HZXA 3GTJH 4B9WA 3GTKB 3S2DH 1QUQA 3JC66 1VQAA 3MXPA 3D3RA 3Q6SA 5DM63 1F77A 4DR6Q 1I4HA 1IXRA 1WCMG 3HOWH 3FHWA 4IOAA 4B3MQ 3I4NG 1BNZA 4A3KB 2R92G 2ICEC 5K5PA 1O7IA 1KAAA 5E3FA 1UEBA 3BVZA 3OIQA 1PH1A 4B3RL 2AWNA 2MNAA 5JEAJ 1HJPA 1RIPA 3K7UC 3A0JA 4K8IA 1HXYD 1XMOL 3V96A 1JWSD 1Q86C 4JI8Q 3VYTA 1F2ZA 2JJQA 1L1OB
chains in the Genus database with same CATH topology
3MXNB 5IE8A 3KJOA 1SR3A 1B7YB 1OXXK 4BXXG 2VQFL 4GOPA 4EX5A 1OTCA 4BA2I 3RR5A 1ASZA 5JJLA 2NZHA 4X66L 1X9NA 3EN2A 2NVQH 3M7NA 2YTVA 1S3OA 4YWLA 1KRSA 2OTLA 4YCVA 1AH9A 2A1AA 2B63H 3HOXG 2ZTCA 1QVFA 5C4XG 3PIOA 2UUBL 1J6QA 1SFOH 2Q2TA 2ZJRA 1A0IA 4DV4Q 1N32L 4IJHA 2XTIA 4APVA 2I0QA 3DM3A 1LM0A 2Z6KC 4DKAC 4JI2L 1GKHA 1W2BA 2I5HA 3HOUH 1NBWA 1NTGA 3AQQA 3NEMA 4OWXB 4C3JH 4JI6Q 1SROA 4OX9Q 2HQLA 3I7FA 4UP8A 4IFDG 4B3TL 3RNUA 4P73A 1D8LA 4JI1L 2LXJA 4GOPC 4HJAA 2UU9Q 1X54A 5M5WH 2CWPA 3F1ZA 4RG1A 1U0LA 3W5OA 5IP9G 2R93G 5IYBG 1PYSB 1NE3A 3KLWA 1J5EL 2R7ZH 3ER0A 3CW2C 1PH9A 4K0KQ 4NXNQ 4JYAL 1H95A 5LMNQ 4JG2A 4A3JH 1UE6A 3FKIG 3OTOL 4A3EG 4NB3A 4HJ7A 2JEAI 1VQOA 4UPAA 4X62L 1Q46A 1L2FA 1IZ6A 4LF9L 2JE6I 1KL9A 3RLOA 3TS2A 4UP9A 2F52A 3B6YA 4LF6Q 3TREA 1HNZQ 4LF5L 5BR8L 4A3DH 2K50A 4JI0Q 4KHZA 4QY7A 1SRUA 3T1HL 4BBRH 1KXLA 2QEXA 4DV5Q 1IBKL 1Y1VH 1OXUA 2Q2UA 3GTLH 3HOVH 4JI7Q 3HOZH 4DUYL 5HY6A 5AJ3Q 4A3MH 5M5XH 4NPSA 3UE0A 3I2ZA 1P16A 4LUOA 3AYHB 2KHJA 5C0XI 3PIPA 2YU9H 4LF8Q 1JJCB 4GN4B 3CCEA 2Q2HA 4DPGA 1A8VA 1T9HA 1BVSA 1HZCA 3KF6B 4DV0L 1WOCA 1TWFH 1I6HH 3WWVA 1JT8A 3CC4A 3U4VA 1X3GA 3S24A 3STBC 2E5LQ 3ERSX 3M4PA 2QGQA 2ATWA 2UXDL 2UUCL 1PYBA 3F8TA 5FLXc 1YI2A 4OO1I 1PV4A 5C4JH 3AFQA 4GNXC 1FJGQ 1N33L 4BBSH 1Z47A 2VQEL 1HR0W 1Y14B 1W3SA 1YJWA 3KDFB 1X55A 1S40A 1MJEA 5GAEC 3H3VH 4B3RQ 4JBJA 5GROA 4LFBL 1K73C 2AMCB 1K8AC 1I94L 3J81j 4PZ8A 2HIXA 3KYHC 3S1NH 2WAQE 1XMOQ 2IX0A 4R4OA 1VQ8A 3I4NH 2PI2A 2LXKA 2UXBQ 4QQBX 3PF5A 4IPGA 2F4VQ 1VCIA 3S1QH 2ZTDA 2E2JH 1HH2P 2Q2IA 1DGSA 5IP7G 1XMQQ 4PMWA 4QJFA 1K3RA 3DLLA 3RZOH 2A19A 1Q82C 1VQIA 1TXYA 1FGUA 2VQFQ 1YBYA 1YVCA 3CPFA 2CKZB 1AE2A 4X66Q 1SN8A 3RN5A 1PH4A 2OQ0A 4KLKA 5FLMG 1Y1WG 4DK3C 5C44H 2OWOA 2N78A 2RCNA 3S1MH 1BKBA 4YHHL 4DV7L 2K5HA 2UUBQ 3H0GH 4HIDA 2D0PA 5IWAL 2BA0A 3CC2A 2OQKA 2ASBA 3GO5A 1M90C 4OWTB 2IHEA 1KQSA 4JI2Q 4BXXH 2CQOA 3HKSA 3S16H 4GKKL 2WAQG 3NELA 1WI5A 1YHQA 1BBWA 1E3PA 4DV2L 3GTOH 1FVIA 1NJIC 4L5TA 5C4XH 1GO3E 1EFWA 2K14A 3ZJYC 2NZOA 3J80c 4B3TQ 4A3BG 4IFDJ 4JI3Q 2ZM6L 4X64L 3D0FA 1JB7A 1QZGA 1X56A 4DV3L 1OXSC 2VS1A 1YNXA 2ZJQA 4LF7L 4EQ5A 4POFA 4P74A 1J5EQ 3PO3H 1VQCA 4DR4L 2VY3A 3TQYA 5M3FG 4DR7L 4JYAQ 5H1SE 1M1KC 2I5LX 3K8AA 1CSPA 3OTOQ 1YIJA 5LMUQ 3NENA 1EYGA 4A3GG 2KBNA 2K4KA 3BU2A 1VQGA 4DV1L 4R4QA 2GVBA 4KI0A 4BA1I 3CD6A 3RLNA 2R93H 3GTPH 2JA6G 4LF5Q 1VQJA 1EOVA 5BR8Q 4GKJL 1FJGL 2KCTA 5IYDG 4DUZL 3CXCA 1XNRL 3J7A5 4A4IA 1G51A 3H15A 3FKIH 4A3EH 2PQAB 4J15A 1IBKQ 3M3YH 5C3EG 4DAMA 4IOCA 4A3KG 3RN2A 2WB1E 4C3IH 1UE5A 2JA7H 4Y7NH 4DUYQ 4DR5Q 1KHIA 2NN6G 3LGJA 4YCUA 2PMZE 4JBMA 3EIVA 2CFMA 4WJ3M 1A63A 2JA5G 1UWVA 1LTLA 2MO0A 2HT1A 3GTGH 1YHBA 1VQBA 4LFCL 3RLFA 2F3IA 3RZDH 1X3FA 1IBLL 4B3ML 3TS0A 1X3EA 2HIVA 3K7AH 1LUZA 4GNXB 4C3HH 1L1OA 2V1CC 1Q1BA 1VQEA 4XTCS 3HOYH 2MFIA 3E0EA 4B3SL 1SLJA 2UXDQ 2UUCQ 1Q8KA 4GLVB 1PH5A 1HR0L 1N33Q 3UDIA 2VQEQ 1XJVA 1EQQA 4JOIA 2B29A 4LFBQ 2JA8G 2WB1G 3A5UA 4BY1H 1I94Q 1G291 1X6OA 2K5VA 2CWAA 3STBD 1KIXA 5GAGC 2B63G 1HNWL 2IHFA 4NXML 2UXCL 4A3IH 2R7FA 2N3SA 3W1GA 3L2PA 4YCWA 4QL5A 4LF4L 4HJ5A 1VQ4A 1GM5A 1OXTA 4DNIA 1I50H 2HHHL 2PI2E 4AYBE 1VQPA 1QVGA 1GD7A 1P8LA 1PFSA 3I56A 3ULPA 3KFUA 2PNHA 2KENA 3S14H 4OO1G 4HIOA 1TWHH 2FXQA 3HFZB 3S1RH 4R4TA 2IT1A 1BBUA 4DV4L 4YHHQ 2A8VA 3M85A 4DV7Q 3F2BA 1QVCA 3I55A 2YTYA 1L0WA 4DR3L 4AQYL 4JI5Q 3A5ZB 1WJJA 2JK8A 5IWAQ 3CAMA 3CCJA 4IPHA 2AHOB 3J80i 4BY7G 5M3MG 4JI6L 4LW1A 4UP7A 3UDGA 4GKKQ 2NVYH 4DR1Q 1I5FA 4DK6C 4OONA 4A76A 1YZ6A 3J7ZC 3W1BA 5FLMH 3CCRA 4DV2Q 3PUWA 1LYLA 1QUQB 2AKWB 2EXDA 1VQHA 5GAHC 4FDBA 3L0OA 3T1YL 1WCMH 2ZJPA 1U5KA 1Q12A 2ZM6Q 1UE7A 4X64Q 4DR2L 1HNXL 1RL2A 1Z9FA 4AYBG 1JJ2A 4DV3Q 1PHJA 1KD1C 2E8GA 4PG3A 4LF7Q 2R92H 3L7ZC 4DR4Q 2K75A 3GD7A 1B70B 1CSQA 1VQ5A 1CKNB 3I4MG 4DR7Q 4YWMA 1CUKA 1IL2A 1VQMA 2I5MX 5IT9c 3CC7A 1XNQL 4A3BH 1PH7A 5JJKA 4A3MG 3KOJA 3PUXA 5FJ8G 3G6EA 4DV1Q 1Q81C 1CKOA 4A75A 3KF6A 1JE5A 4A3CG 4GKJQ 1MKHA 4GS3A 3U4ZA 4DAYB 1E1OA 1EQRA 3GDEA 4TQUS 4X65L 3PGZA 4LUZA 3E9IA 5M3FH 4DUZQ 1XNRQ 3PO2G 2YV5A 1N32Q 4IO9A 4A3LG 2E2IH 2WP8J 1V9PA 2RHQB 5AJ3L 1E24A 4GOPB 4JI4L 3TRZA 2R7DA 1TWCH 2VNUD 5GQOA 4HIMA 3AEVA 1KAWA 1EIYB 1N36L 2ALYB 3HOXH 1ASYA 2JA6H 2OTJA 4A3FG 4R4CA 4JI1Q 3KDFA 4BBSG 5IYDH 3PSIA 3M9BA 4L5SA 1WYDA 3K0XA 1YITA 5M5YH 4LFCQ 2VW9A 4PZ7A 4R4IA 5LMNW 1IBLQ 1WFQA 5C3EH 2VUMG 1NMGA 4O2DA 3PV0A 4MTNA 3CPWA 5IYCG 3H3VI 4YY3L 2D62A 4B3SQ 4X62Q 4GLXA 2JA5H 4LF9Q 1HR0Q 1E22A 2EIFA 5IP9H 1HZAA 5IYBH 3J81c 2RF4A 3PUZA 3CCVA 2JA9A 1K8GA 2K5NA 3IRBA 5E7NA 2Z6KA 3T1HQ 2BH2A 2F4VL 1HNWQ 5C0XJ 4DV6L 3HOWG 4KHPL 3F2CA 3JAMc 3CCMA 3H0GG 1N34L 4NXMQ 1IBML 3ULLA 2UXCQ 1OXVA 4LF4Q 2GVAA 3M4QA 4P72A 4JBWA 3CQZH 2HHHQ 3FP9A 1YJNA 2JA8H 4JCVE 4DV0Q 2OCEA 4DR6L 4ALPA 1C9OA 2GN5A 3KF8B 1R9TH 3PUVA 3ULJA 4JV5L 1PVOA 3VDYA 4MNOA 3BZKA 4P75A 4A93G 4AQYQ 4LWCA 4IJLA 4DR3Q 1KC8C 1SE8A 2JEBI 3PO3G 2RHSB 2XGTA 1PH3A 2YYZA 3ICEA 5JEAG 2ES2A 4L5RC 1Q7YC 1NMFA 1UE1A 4YWKA 1XPUA 2MQHA 2D0OA 2IY5B 4JI3L 1G6PA 3U58A 4MZ9A 1VQDA 2N49A 2K52A 5C0XG 3T1YQ 1YJ9A 4JI8L 2UUAL 1N9WA 4DR2Q 5ELNA 1HNXQ 3G71A 3BJUA 1E7ZA 4BY7H 2Y0SE 4HIKA 5M3MH 4LNQA 2N8NA 2NN6I 2C35B 4IFDI 2PQAA 1VQFA 5LMUL 3HOUG 1L1OC 3U50C 1K0RA 2JA7G 3D31A 3G48A 1V43A 1XNQQ 4LFAL 3OYYA 1S72A 1E1TA 1V1QA 4JBKA 1K9MC 3KJPA 1X65A 5EAYA 3S2HH 1NY4A 4JOIC 3F2DA 3S17H 3MEFA 1XPOA 4LFAQ 4X65Q 3M4OH 5IP7H 3CF5A 5ELOA 3I4MH 4P71A 4OXPA 1EWIA 2YTXA 4OX9L 2R7ZG 1VQLA 1JMCA 2R6GA 3GTQH 3PF4A 1IYJB 1EUJA 1TWAH 4GNXA 2NVXH 4RMFA 2B3GA 4A3JG 4AIMA 4DR5L 1SMXA 4JI4Q 5FJ8H 1VQ6A 5JJIA 3HOYG 1HZBA 1Y1WH 1VQKA 2UU9L 2Y0SG 1MJCA 1N36Q 3CCSA 5K36G 4A3CH 2BH8A 1MIUA 4GLAC 3UDXA 1PH8A 4A3DG 4HJ9A 3OW2A 1KRTA 3PO2H 1D7QA 2CCZA 4K0KL 4NXNL 4BY1G 5LMNL 4HJ8A 2JQOA 4A3LH 1I3QH 2LSSA 1K83H 3NBHB 4XIGS 4BBRG 1A62A 1FL0A 5J3BA 1Y1VG 1YEZA 4A3IG 3CMAA 3J81i 3HOVG 4C2MH 3HOZG 3CMEA 2NVTH 2H5XA 2ZTEA 4YY3Q 4A3FH 3SGIA 4POGA 1VQNA 3BZCA 3TEHB 4LF6L 1HNZL 1PH6A 1EIFA 3K81C 2BA1A 4GN5A 4JI0L 4OWWB 4L5QA 3JAMi 2EQSA 4O0AA 1AE3A 4IPCA 2L15A 1VQ7A 4DV5L 1XTDA 2KCMA 1VS0A 1C0AA 2VUMH 3E9HA 1TWGH 2Z0SA 3CCUA 4JI7L 1PA6A 4TVAB 3CCQA 5IYCH 4DV6Q 4UY8C 4A3GH 3GTMH 1N34Q 4KHPQ 1IBMQ 2MO1A 2WFWA 1XPRA 1CKMA 4JC0A 4LF8L 2IX1A 4QGUA 3GTKH 3HKZE 3GTJH 5HGQA 3S2DH 3UDFA 3S15H 1QUQA 3JC66 1B8AA 1VQAA 3Q8DA 2AWOA 4R1JA 3CP0A 2KHIA 4DR6Q 4H02A 2E2HH 1IXRA 1WCMG 3HOWH 3FHWA 4ME3A 2E5LL 4JI5L 5DLQE 1VQ9A 4IOAA 2DGYA 4B3MQ 1YHAA 4Y52H 1HZ9A 3UE1A 4A3KH 3I4NG 4JV5Q 1PH2A 3AFPA 3EBEA 4AH6A 3CCLA 1GVPA 2R92G 3A74A 4WJ4A 2QA4A 5GADC 1CKNA 1O7IA 4DR1L 1QZHA 1UEBA 4PZ6A 2DUDA 1N8RC 1PH1A 2ID0A 4B3RL 3G4SA 2AWNA 2MNAA 1C7YA 5JEAJ 4X6AH 3K80C 3PUYA 1HJPA 1RIPA 3K7UC 3A0JA 1XMOL 5IY0A 4IPDA 5C44G 4GN3B 4LUVA 1Q86C 1Q1EA 3HKZG 4JI8Q 4A93H 2UUAQ 2UXBL 1JJGA 3I4OA 2JJQA 2VL6A 2VZAA 4QIWE 3PCOB 1L1OB 1XMQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXN B;  5IE8 A;  3KJO A;  1SR3 A;  1B7Y B;  1OXX K;  4BXX G;  2VQF L;  4GOP A;  4EX5 A;  1OTC A;  4BA2 I;  3RR5 A;  1ASZ A;  5JJL A;  2NZH A;  4X66 L;  1X9N A;  3EN2 A;  2NVQ H;  3M7N A;  2YTV A;  1S3O A;  4YWL A;  1KRS A;  2OTL A;  4YCV A;  1AH9 A;  2A1A A;  2B63 H;  3HOX G;  2ZTC A;  1QVF A;  5C4X G;  3PIO A;  2UUB L;  1J6Q A;  1SFO H;  2Q2T A;  2ZJR A;  1A0I A;  4DV4 Q;  1N32 L;  4IJH A;  2XTI A;  4APV A;  2I0Q A;  3DM3 A;  1LM0 A;  2Z6K C;  4DKA C;  4JI2 L;  1GKH A;  1W2B A;  2I5H A;  3HOU H;  1NBW A;  1NTG A;  3AQQ A;  3NEM A;  4OWX B;  4C3J H;  4JI6 Q;  1SRO A;  4OX9 Q;  2HQL A;  3I7F A;  4UP8 A;  4IFD G;  4B3T L;  3RNU A;  4P73 A;  1D8L A;  4JI1 L;  2LXJ A;  4GOP C;  4HJA A;  2UU9 Q;  1X54 A;  5M5W H;  2CWP A;  3F1Z A;  4RG1 A;  1U0L A;  3W5O A;  5IP9 G;  2R93 G;  5IYB G;  1PYS B;  1NE3 A;  3KLW A;  1J5E L;  2R7Z H;  3ER0 A;  3CW2 C;  1PH9 A;  4K0K Q;  4NXN Q;  4JYA L;  1H95 A;  5LMN Q;  4JG2 A;  4A3J H;  1UE6 A;  3FKI G;  3OTO L;  4A3E G;  4NB3 A;  4HJ7 A;  2JEA I;  1VQO A;  4UPA A;  4X62 L;  1Q46 A;  1L2F A;  1IZ6 A;  4LF9 L;  2JE6 I;  1KL9 A;  3RLO A;  3TS2 A;  4UP9 A;  2F52 A;  3B6Y A;  4LF6 Q;  3TRE A;  1HNZ Q;  4LF5 L;  5BR8 L;  4A3D H;  2K50 A;  4JI0 Q;  4KHZ A;  4QY7 A;  1SRU A;  3T1H L;  4BBR H;  1KXL A;  2QEX A;  4DV5 Q;  1IBK L;  1Y1V H;  1OXU A;  2Q2U A;  3GTL H;  3HOV H;  4JI7 Q;  3HOZ H;  4DUY L;  5HY6 A;  5AJ3 Q;  4A3M H;  5M5X H;  4NPS A;  3UE0 A;  3I2Z A;  1P16 A;  4LUO A;  3AYH B;  2KHJ A;  5C0X I;  3PIP A;  2YU9 H;  4LF8 Q;  1JJC B;  4GN4 B;  3CCE A;  2Q2H A;  4DPG A;  1A8V A;  1T9H A;  1BVS A;  1HZC A;  3KF6 B;  4DV0 L;  1WOC A;  1TWF H;  1I6H H;  3WWV A;  1JT8 A;  3CC4 A;  3U4V A;  1X3G A;  3S24 A;  3STB C;  2E5L Q;  3ERS X;  3M4P A;  2QGQ A;  2ATW A;  2UXD L;  2UUC L;  1PYB A;  3F8T A;  5FLX c;  1YI2 A;  4OO1 I;  1PV4 A;  5C4J H;  3AFQ A;  4GNX C;  1FJG Q;  1N33 L;  4BBS H;  1Z47 A;  2VQE L;  1HR0 W;  1Y14 B;  1W3S A;  1YJW A;  3KDF B;  1X55 A;  1S40 A;  1MJE A;  5GAE C;  3H3V H;  4B3R Q;  4JBJ A;  5GRO A;  4LFB L;  1K73 C;  2AMC B;  1K8A C;  1I94 L;  3J81 j;  4PZ8 A;  2HIX A;  3KYH C;  3S1N H;  2WAQ E;  1XMO Q;  2IX0 A;  4R4O A;  1VQ8 A;  3I4N H;  2PI2 A;  2LXK A;  2UXB Q;  4QQB X;  3PF5 A;  4IPG A;  2F4V Q;  1VCI A;  3S1Q H;  2ZTD A;  2E2J H;  1HH2 P;  2Q2I A;  1DGS A;  5IP7 G;  1XMQ Q;  4PMW A;  4QJF A;  1K3R A;  3DLL A;  3RZO H;  2A19 A;  1Q82 C;  1VQI A;  1TXY A;  1FGU A;  2VQF Q;  1YBY A;  1YVC A;  3CPF A;  2CKZ B;  1AE2 A;  4X66 Q;  1SN8 A;  3RN5 A;  1PH4 A;  2OQ0 A;  4KLK A;  5FLM G;  1Y1W G;  4DK3 C;  5C44 H;  2OWO A;  2N78 A;  2RCN A;  3S1M H;  1BKB A;  4YHH L;  4DV7 L;  2K5H A;  2UUB Q;  3H0G H;  4HID A;  2D0P A;  5IWA L;  2BA0 A;  3CC2 A;  2OQK A;  2ASB A;  3GO5 A;  1M90 C;  4OWT B;  2IHE A;  1KQS A;  4JI2 Q;  4BXX H;  2CQO A;  3HKS A;  3S16 H;  4GKK L;  2WAQ G;  3NEL A;  1WI5 A;  1YHQ A;  1BBW A;  1E3P A;  4DV2 L;  3GTO H;  1FVI A;  1NJI C;  4L5T A;  5C4X H;  1GO3 E;  1EFW A;  2K14 A;  3ZJY C;  2NZO A;  3J80 c;  4B3T Q;  4A3B G;  4IFD J;  4JI3 Q;  2ZM6 L;  4X64 L;  3D0F A;  1JB7 A;  1QZG A;  1X56 A;  4DV3 L;  1OXS C;  2VS1 A;  1YNX A;  2ZJQ A;  4LF7 L;  4EQ5 A;  4POF A;  4P74 A;  1J5E Q;  3PO3 H;  1VQC A;  4DR4 L;  2VY3 A;  3TQY A;  5M3F G;  4DR7 L;  4JYA Q;  5H1S E;  1M1K C;  2I5L X;  3K8A A;  1CSP A;  3OTO Q;  1YIJ A;  5LMU Q;  3NEN A;  1EYG A;  4A3G G;  2KBN A;  2K4K A;  3BU2 A;  1VQG A;  4DV1 L;  4R4Q A;  2GVB A;  4KI0 A;  4BA1 I;  3CD6 A;  3RLN A;  2R93 H;  3GTP H;  2JA6 G;  4LF5 Q;  1VQJ A;  1EOV A;  5BR8 Q;  4GKJ L;  1FJG L;  2KCT A;  5IYD G;  4DUZ L;  3CXC A;  1XNR L;  3J7A 5;  4A4I A;  1G51 A;  3H15 A;  3FKI H;  4A3E H;  2PQA B;  4J15 A;  1IBK Q;  3M3Y H;  5C3E G;  4DAM A;  4IOC A;  4A3K G;  3RN2 A;  2WB1 E;  4C3I H;  1UE5 A;  2JA7 H;  4Y7N H;  4DUY Q;  4DR5 Q;  1KHI A;  2NN6 G;  3LGJ A;  4YCU A;  2PMZ E;  4JBM A;  3EIV A;  2CFM A;  4WJ3 M;  1A63 A;  2JA5 G;  1UWV A;  1LTL A;  2MO0 A;  2HT1 A;  3GTG H;  1YHB A;  1VQB A;  4LFC L;  3RLF A;  2F3I A;  3RZD H;  1X3F A;  1IBL L;  4B3M L;  3TS0 A;  1X3E A;  2HIV A;  3K7A H;  1LUZ A;  4GNX B;  4C3H H;  1L1O A;  2V1C C;  1Q1B A;  1VQE A;  4XTC S;  3HOY H;  2MFI A;  3E0E A;  4B3S L;  1SLJ A;  2UXD Q;  2UUC Q;  1Q8K A;  4GLV B;  1PH5 A;  1HR0 L;  1N33 Q;  3UDI A;  2VQE Q;  1XJV A;  1EQQ A;  4JOI A;  2B29 A;  4LFB Q;  2JA8 G;  2WB1 G;  3A5U A;  4BY1 H;  1I94 Q;  1G29 1;  1X6O A;  2K5V A;  2CWA A;  3STB D;  1KIX A;  5GAG C;  2B63 G;  1HNW L;  2IHF A;  4NXM L;  2UXC L;  4A3I H;  2R7F A;  2N3S A;  3W1G A;  3L2P A;  4YCW A;  4QL5 A;  4LF4 L;  4HJ5 A;  1VQ4 A;  1GM5 A;  1OXT A;  4DNI A;  1I50 H;  2HHH L;  2PI2 E;  4AYB E;  1VQP A;  1QVG A;  1GD7 A;  1P8L A;  1PFS A;  3I56 A;  3ULP A;  3KFU A;  2PNH A;  2KEN A;  3S14 H;  4OO1 G;  4HIO A;  1TWH H;  2FXQ A;  3HFZ B;  3S1R H;  4R4T A;  2IT1 A;  1BBU A;  4DV4 L;  4YHH Q;  2A8V A;  3M85 A;  4DV7 Q;  3F2B A;  1QVC A;  3I55 A;  2YTY A;  1L0W A;  4DR3 L;  4AQY L;  4JI5 Q;  3A5Z B;  1WJJ A;  2JK8 A;  5IWA Q;  3CAM A;  3CCJ A;  4IPH A;  2AHO B;  3J80 i;  4BY7 G;  5M3M G;  4JI6 L;  4LW1 A;  4UP7 A;  3UDG A;  4GKK Q;  2NVY H;  4DR1 Q;  1I5F A;  4DK6 C;  4OON A;  4A76 A;  1YZ6 A;  3J7Z C;  3W1B A;  5FLM H;  3CCR A;  4DV2 Q;  3PUW A;  1LYL A;  1QUQ B;  2AKW B;  2EXD A;  1VQH A;  5GAH C;  4FDB A;  3L0O A;  3T1Y L;  1WCM H;  2ZJP A;  1U5K A;  1Q12 A;  2ZM6 Q;  1UE7 A;  4X64 Q;  4DR2 L;  1HNX L;  1RL2 A;  1Z9F A;  4AYB G;  1JJ2 A;  4DV3 Q;  1PHJ A;  1KD1 C;  2E8G A;  4PG3 A;  4LF7 Q;  2R92 H;  3L7Z C;  4DR4 Q;  2K75 A;  3GD7 A;  1B70 B;  1CSQ A;  1VQ5 A;  1CKN B;  3I4M G;  4DR7 Q;  4YWM A;  1CUK A;  1IL2 A;  1VQM A;  2I5M X;  5IT9 c;  3CC7 A;  1XNQ L;  4A3B H;  1PH7 A;  5JJK A;  4A3M G;  3KOJ A;  3PUX A;  5FJ8 G;  3G6E A;  4DV1 Q;  1Q81 C;  1CKO A;  4A75 A;  3KF6 A;  1JE5 A;  4A3C G;  4GKJ Q;  1MKH A;  4GS3 A;  3U4Z A;  4DAY B;  1E1O A;  1EQR A;  3GDE A;  4TQU S;  4X65 L;  3PGZ A;  4LUZ A;  3E9I A;  5M3F H;  4DUZ Q;  1XNR Q;  3PO2 G;  2YV5 A;  1N32 Q;  4IO9 A;  4A3L G;  2E2I H;  2WP8 J;  1V9P A;  2RHQ B;  5AJ3 L;  1E24 A;  4GOP B;  4JI4 L;  3TRZ A;  2R7D A;  1TWC H;  2VNU D;  5GQO A;  4HIM A;  3AEV A;  1KAW A;  1EIY B;  1N36 L;  2ALY B;  3HOX H;  1ASY A;  2JA6 H;  2OTJ A;  4A3F G;  4R4C A;  4JI1 Q;  3KDF A;  4BBS G;  5IYD H;  3PSI A;  3M9B A;  4L5S A;  1WYD A;  3K0X A;  1YIT A;  5M5Y H;  4LFC Q;  2VW9 A;  4PZ7 A;  4R4I A;  5LMN W;  1IBL Q;  1WFQ A;  5C3E H;  2VUM G;  1NMG A;  4O2D A;  3PV0 A;  4MTN A;  3CPW A;  5IYC G;  3H3V I;  4YY3 L;  2D62 A;  4B3S Q;  4X62 Q;  4GLX A;  2JA5 H;  4LF9 Q;  1HR0 Q;  1E22 A;  2EIF A;  5IP9 H;  1HZA A;  5IYB H;  3J81 c;  2RF4 A;  3PUZ A;  3CCV A;  2JA9 A;  1K8G A;  2K5N A;  3IRB A;  5E7N A;  2Z6K A;  3T1H Q;  2BH2 A;  2F4V L;  1HNW Q;  5C0X J;  4DV6 L;  3HOW G;  4KHP L;  3F2C A;  3JAM c;  3CCM A;  3H0G G;  1N34 L;  4NXM Q;  1IBM L;  3ULL A;  2UXC Q;  1OXV A;  4LF4 Q;  2GVA A;  3M4Q A;  4P72 A;  4JBW A;  3CQZ H;  2HHH Q;  3FP9 A;  1YJN A;  2JA8 H;  4JCV E;  4DV0 Q;  2OCE A;  4DR6 L;  4ALP A;  1C9O A;  2GN5 A;  3KF8 B;  1R9T H;  3PUV A;  3ULJ A;  4JV5 L;  1PVO A;  3VDY A;  4MNO A;  3BZK A;  4P75 A;  4A93 G;  4AQY Q;  4LWC A;  4IJL A;  4DR3 Q;  1KC8 C;  1SE8 A;  2JEB I;  3PO3 G;  2RHS B;  2XGT A;  1PH3 A;  2YYZ A;  3ICE A;  5JEA G;  2ES2 A;  4L5R C;  1Q7Y C;  1NMF A;  1UE1 A;  4YWK A;  1XPU A;  2MQH A;  2D0O A;  2IY5 B;  4JI3 L;  1G6P A;  3U58 A;  4MZ9 A;  1VQD A;  2N49 A;  2K52 A;  5C0X G;  3T1Y Q;  1YJ9 A;  4JI8 L;  2UUA L;  1N9W A;  4DR2 Q;  5ELN A;  1HNX Q;  3G71 A;  3BJU A;  1E7Z A;  4BY7 H;  2Y0S E;  4HIK A;  5M3M H;  4LNQ A;  2N8N A;  2NN6 I;  2C35 B;  4IFD I;  2PQA A;  1VQF A;  5LMU L;  3HOU G;  1L1O C;  3U50 C;  1K0R A;  2JA7 G;  3D31 A;  3G48 A;  1V43 A;  1XNQ Q;  4LFA L;  3OYY A;  1S72 A;  1E1T A;  1V1Q A;  4JBK A;  1K9M C;  3KJP A;  1X65 A;  5EAY A;  3S2H H;  1NY4 A;  4JOI C;  3F2D A;  3S17 H;  3MEF A;  1XPO A;  4LFA Q;  4X65 Q;  3M4O H;  5IP7 H;  3CF5 A;  5ELO A;  3I4M H;  4P71 A;  4OXP A;  1EWI A;  2YTX A;  4OX9 L;  2R7Z G;  1VQL A;  1JMC A;  2R6G A;  3GTQ H;  3PF4 A;  1IYJ B;  1EUJ A;  1TWA H;  4GNX A;  2NVX H;  4RMF A;  2B3G A;  4A3J G;  4AIM A;  4DR5 L;  1SMX A;  4JI4 Q;  5FJ8 H;  1VQ6 A;  5JJI A;  3HOY G;  1HZB A;  1Y1W H;  1VQK A;  2UU9 L;  2Y0S G;  1MJC A;  1N36 Q;  3CCS A;  5K36 G;  4A3C H;  2BH8 A;  1MIU A;  4GLA C;  3UDX A;  1PH8 A;  4A3D G;  4HJ9 A;  3OW2 A;  1KRT A;  3PO2 H;  1D7Q A;  2CCZ A;  4K0K L;  4NXN L;  4BY1 G;  5LMN L;  4HJ8 A;  2JQO A;  4A3L H;  1I3Q H;  2LSS A;  1K83 H;  3NBH B;  4XIG S;  4BBR G;  1A62 A;  1FL0 A;  5J3B A;  1Y1V G;  1YEZ A;  4A3I G;  3CMA A;  3J81 i;  3HOV G;  4C2M H;  3HOZ G;  3CME A;  2NVT H;  2H5X A;  2ZTE A;  4YY3 Q;  4A3F H;  3SGI A;  4POG A;  1VQN A;  3BZC A;  3TEH B;  4LF6 L;  1HNZ L;  1PH6 A;  1EIF A;  3K81 C;  2BA1 A;  4GN5 A;  4JI0 L;  4OWW B;  4L5Q A;  3JAM i;  2EQS A;  4O0A A;  1AE3 A;  4IPC A;  2L15 A;  1VQ7 A;  4DV5 L;  1XTD A;  2KCM A;  1VS0 A;  1C0A A;  2VUM H;  3E9H A;  1TWG H;  2Z0S A;  3CCU A;  4JI7 L;  1PA6 A;  4TVA B;  3CCQ A;  5IYC H;  4DV6 Q;  4UY8 C;  4A3G H;  3GTM H;  1N34 Q;  4KHP Q;  1IBM Q;  2MO1 A;  2WFW A;  1XPR A;  1CKM A;  4JC0 A;  4LF8 L;  2IX1 A;  4QGU A;  3GTK H;  3HKZ E;  3GTJ H;  5HGQ A;  3S2D H;  3UDF A;  3S15 H;  1QUQ A;  3JC6 6;  1B8A A;  1VQA A;  3Q8D A;  2AWO A;  4R1J A;  3CP0 A;  2KHI A;  4DR6 Q;  4H02 A;  2E2H H;  1IXR A;  1WCM G;  3HOW H;  3FHW A;  4ME3 A;  2E5L L;  4JI5 L;  5DLQ E;  1VQ9 A;  4IOA A;  2DGY A;  4B3M Q;  1YHA A;  4Y52 H;  1HZ9 A;  3UE1 A;  4A3K H;  3I4N G;  4JV5 Q;  1PH2 A;  3AFP A;  3EBE A;  4AH6 A;  3CCL A;  1GVP A;  2R92 G;  3A74 A;  4WJ4 A;  2QA4 A;  5GAD C;  1CKN A;  1O7I A;  4DR1 L;  1QZH A;  1UEB A;  4PZ6 A;  2DUD A;  1N8R C;  1PH1 A;  2ID0 A;  4B3R L;  3G4S A;  2AWN A;  2MNA A;  1C7Y A;  5JEA J;  4X6A H;  3K80 C;  3PUY A;  1HJP A;  1RIP A;  3K7U C;  3A0J A;  1XMO L;  5IY0 A;  4IPD A;  5C44 G;  4GN3 B;  4LUV A;  1Q86 C;  1Q1E A;  3HKZ G;  4JI8 Q;  4A93 H;  2UUA Q;  2UXB L;  1JJG A;  3I4O A;  2JJQ A;  2VL6 A;  2VZA A;  4QIW E;  3PCO B;  1L1O B;  1XMQ L; 
#chains in the Genus database with same CATH topology
 3KJO A;  2CHB D;  2EDG A;  1HA5 A;  1OTC A;  3BYY B;  5JJL A;  3H94 A;  1X9N A;  1S3O A;  5C0X H;  2A1A A;  2EYL A;  2ZTC A;  3HOX G;  5D14 A;  3H91 A;  1CZW A;  2KA7 A;  1Y8N B;  4DV4 Q;  3A7A B;  3SK6 A;  5I6Y A;  2I0Q A;  1LM0 A;  2Z6K C;  2TMP A;  4K5X A;  3TSS A;  1NSN S;  1HCZ A;  1O7Y A;  1JB3 A;  4OWX B;  4C3J H;  1SRO A;  2LY7 A;  2HQL A;  3I7F A;  4B3T L;  1I4X A;  4P73 A;  1NAP A;  1D8L A;  2F0S A;  3N6R A;  2A73 B;  1ENF A;  4RG1 A;  1U0L A;  5M5W B;  2R93 G;  4N8F A;  2C5C A;  1Z6H A;  1ROD A;  2F0U A;  3TZD A;  2HCI A;  4K0K Q;  1EY6 A;  2R7Z B;  4A3J H;  1IZ6 A;  2Y0S B;  4K2K A;  4LF6 Q;  4LF5 L;  1GUO A;  2RSO A;  1STA A;  2K50 A;  4JI0 Q;  2A68 C;  1I4P A;  1KXL A;  4DV5 Q;  2F0Q A;  1BCP F;  1Y1V H;  1OXU A;  3GV6 A;  4BBR B;  4K8J A;  4XYO A;  3HOZ H;  2ZT9 C;  2DJF C;  4NPS A;  1P16 A;  3AYH B;  4GN4 B;  3E0J A;  2YU9 B;  4JK1 C;  1ILP A;  1I4Q A;  1WOC A;  1TWF H;  5KNB A;  1Y69 U;  1JT8 A;  4X3S A;  3CC4 A;  1TWH B;  3QWN A;  5CBE E;  5IOD A;  2QGQ A;  2ATW A;  1PYB A;  3F8T A;  5FLX c;  1YI2 A;  4BBS H;  1Z47 A;  1YJW A;  5C4J B;  3KDF B;  1X55 A;  1MJE A;  5GAE C;  4LFB L;  4JBJ A;  1K8A C;  1I94 L;  4FF3 A;  1SE2 A;  3DMU A;  3ZYY X;  2WAQ E;  3I4N H;  1QNK A;  1RJT A;  2F4V Q;  1HUM A;  1VCI A;  3IFD A;  2F0L A;  1HH2 P;  2QEJ C;  3QG1 A;  4QJF A;  1K3R A;  3KUP A;  2E2J B;  1BOS A;  1SNM A;  1TXY A;  1SMY D;  2VQF Q;  5IIF A;  2CKZ B;  1AE2 A;  4E6I A;  1EY0 A;  5FLM G;  2K28 A;  2XWB B;  5C44 B;  4P2C B;  4XT3 B;  2F0H A;  3S1M B;  1B9M A;  4HID A;  4TKO B;  1U4M A;  2DJG C;  4FXD A;  2SEB D;  4EQO A;  1DON A;  2ZXP A;  4KJN A;  3GTO H;  1FVI A;  5EPL A;  1TWC B;  1GO3 E;  5I9O A;  3ZJY C;  3J80 c;  4IFD J;  4JI3 Q;  2QIL A;  4FO2 A;  1X56 A;  2XNA C;  1OXS C;  1YNX A;  2F0G A;  2ZJQ A;  4FXK C;  4EQ5 A;  3PO3 H;  2PW5 A;  4DF7 A;  1KNE A;  3TQY A;  5M3F G;  5FOB B;  3A54 A;  3C2P A;  2I5L X;  1EEF D;  3K8A A;  5LMU Q;  4I7Z C;  4WRD A;  3IAY A;  2K4K A;  4DV1 L;  4BA1 I;  4KI0 A;  2NB0 A;  1YNJ C;  2R93 H;  2JA6 G;  5IYD G;  3MXG A;  3J81 E;  3CXC A;  2PQE A;  1G51 A;  1JC7 A;  2PQA B;  3FKI B;  1AW7 A;  1EQT A;  3M3Y B;  1UE5 A;  3JAM E;  4Y7N H;  4DUY Q;  4DR5 Q;  4C3I B;  4FF1 A;  2O4X A;  1S5F D;  2CFM A;  4WJ3 M;  1LTL A;  2MO0 A;  1YHB A;  5ELC A;  4LFC L;  2F3I A;  1X3F A;  3E5S A;  1I4G A;  1IBL L;  2MGS A;  2X69 A;  3J81 L;  4XQN A;  3EQL C;  4C3H H;  1L1O A;  1Q1B A;  2XRQ D;  2FIN B;  3C46 A;  3CRL C;  3OPO A;  1Q8K A;  4GLV B;  1EQV A;  2CH4 A;  1N33 Q;  4IAL A;  1IW7 D;  5EKI A;  2E74 C;  1EWC A;  1PTO D;  1X3P A;  4K2L A;  3C1E A;  3STB D;  2B63 G;  1JCK B;  5ISR A;  2SOB A;  2JYO A;  4NXM L;  2R7F A;  3W1G A;  4YCW A;  5G3L D;  1GXD C;  4LMQ D;  5DEH A;  1OXT A;  1A6X A;  2PI2 E;  1VQP A;  1EZ6 A;  3TP5 A;  1ICW A;  3SR1 A;  1RCV D;  4OO1 G;  2WIN B;  1TWH H;  3S1R H;  1SYC A;  2A8V A;  3M85 A;  4DV7 Q;  1ET6 A;  2RDH A;  2JK8 A;  5IWA Q;  3J80 i;  2LMC B;  4OEM B;  3UDG A;  4DK6 C;  1A3T A;  5FLM H;  1U4L A;  3CCR A;  2EXD A;  3T1Y L;  5EPK A;  1Q12 A;  3LX0 A;  2B2T A;  4AYB G;  1JJ2 A;  5ELD A;  2R3Z A;  4DR4 Q;  5NUC A;  3AB9 A;  2QCP X;  1VQM A;  1PH7 A;  4EGV A;  5FJ8 G;  4A3B B;  1B3Q A;  1JE5 A;  4GKJ Q;  3P75 A;  4GS3 A;  4DAY B;  4LFA L;  1QWY A;  2RA4 A;  4DUZ Q;  4TQU S;  5M3F H;  4LUZ A;  4OHJ A;  4X3U A;  2WAC A;  4IUP A;  5KNC A;  3TRZ A;  1TWC H;  4DAV A;  1MBY A;  2EYP A;  3AEV A;  2MHV A;  1II3 A;  2KVM A;  1N36 L;  1EIY B;  2JA6 H;  2OTJ A;  2B2V A;  2KCN A;  4GZY C;  3KDF A;  2N55 A;  5IYD H;  1SYG A;  3PSI A;  2Z8L A;  3O13 A;  5IT9 L;  4ZLT F;  4IZ8 A;  3CHB D;  1SYB A;  4DGZ A;  5LMN W;  1EY5 A;  1PRT D;  1R4Q B;  2WKD A;  3H3V I;  5IYC G;  2D62 A;  3RUZ A;  4GLX A;  1HR0 Q;  2IWH A;  2JA5 B;  5IYB H;  3CCV A;  2B2V C;  4TRD A;  2H1E A;  5CR3 A;  1NUC A;  4FYD A;  2KHS A;  1IHZ A;  2Q8R E;  5C0X J;  3VR3 A;  4ZCK A;  4LF4 Q;  1CQF A;  2EYO A;  1ESF A;  1U4P A;  4IUR A;  1PTO B;  3BDL A;  4QUC A;  1YJN A;  3K58 A;  3NK9 A;  2OCE A;  2EYF A;  2G5D A;  2GN5 A;  2WB1 B;  5BN5 A;  4DR6 L;  3KF8 B;  2JXM B;  3H09 A;  1R9T H;  1GUN A;  1EY4 A;  1PVO A;  4MNO A;  2L4N A;  4AQY Q;  4LWC A;  4DR3 Q;  5IOC A;  1KC8 C;  1C8C A;  2RHS B;  1PH3 A;  1SSO A;  3ICE A;  1NMF A;  3NSW A;  2IY5 B;  4PMC A;  4DXG A;  2CVR A;  1R4P B;  1VQD A;  2K52 A;  4JI8 L;  3R93 A;  4IFD I;  1BO0 A;  2NN6 I;  2O5J C;  1TS4 A;  3J7A F;  2PQA A;  5ELF A;  5CV5 A;  1JWU D;  3HOU G;  4I65 A;  1K0R A;  3NBI A;  4ZQ3 A;  1EU3 A;  2K01 A;  3OYY A;  1E1T A;  1V1Q A;  4YIJ A;  3CU7 A;  4ABN A;  3S2H H;  1NY4 A;  4JOI C;  1SYE A;  3MEF A;  2F0W A;  4X65 Q;  5IP7 H;  3T53 B;  1BUV T;  1H9S A;  2EYJ A;  3PF4 A;  3I4M B;  2NVX H;  3KLR A;  5KGU A;  2B3G A;  4AIM A;  2MP1 A;  3D4W A;  5FJ8 H;  4L63 B;  1D6E C;  1MJC A;  3GP7 A;  3D6W A;  3UDX A;  1PH8 A;  4A3D G;  5LL6 X;  1KRT A;  1D7Q A;  4K0K L;  4UHV A;  3R8B A;  1I3Q H;  2LSS A;  1STB A;  2A6E D;  5E4X A;  3AU7 A;  1D5M C;  3HOV G;  4HR7 B;  2NVT H;  2H5X A;  2ZTE A;  4YY3 Q;  1RTN A;  4POG A;  3BZC A;  4LF6 L;  1PH6 A;  4OIJ A;  1EIF A;  4A3F B;  1PZJ D;  4JI0 L;  1AE3 A;  4IPC A;  3PIO 3;  3BS1 A;  4DV5 L;  1XTD A;  2KCM A;  1NR2 A;  1BBX C;  1ICF B;  1PRT B;  2EY2 A;  4RH6 A;  5FO8 B;  4TVA B;  5IYC H;  4RGT A;  3GTM B;  4B9X A;  3K5M A;  3HKZ E;  4B08 A;  4H44 C;  3TBI B;  1H9J A;  2B8F A;  3UDF A;  3GTJ B;  3TME A;  3S2D B;  2VB2 X;  4FF2 A;  1KLU D;  3CP0 A;  1JR0 D;  1EU4 A;  1YNN D;  4JI5 L;  1VQ9 A;  3HOW B;  1YHA A;  4Y52 H;  1HZ9 A;  4JV5 Q;  3AFP A;  3EBE A;  4AH6 A;  4N9T A;  1T5X D;  2QA4 A;  5GAD C;  1QZH A;  4DR1 L;  4PZ6 A;  1XWE A;  2DUD A;  1SMY C;  1JOK A;  3FDT A;  3K80 C;  2G9D A;  1VF7 A;  2BOS A;  5IY0 A;  4RKL A;  1U4R A;  4DAY A;  3I4O A;  3HEJ A;  4ZKB B;  2VL6 A;  3PCO B;  1A3V A;  5HGT A;  5ELB A;  4LAA A;  3QO2 A;  3MXN B;  2Z4I A;  5CGK A;  2VQF L;  4KD3 A;  4EX5 A;  3RR5 A;  2NZH A;  3PIP 3;  3TP7 A;  2AUJ D;  1LTT D;  5C4X G;  1S4Z A;  3PIO A;  1J6Q A;  3GTP B;  2EJM A;  3DM3 A;  1GUT A;  2L12 A;  2L55 A;  1STG A;  1W2B A;  2KCC A;  3HOU H;  4RHS A;  3AQQ A;  3EVQ A;  5C4Z A;  1HA6 A;  4C3J B;  2RBM A;  2F3V A;  4IUQ A;  4JI1 L;  2LXJ A;  1X54 A;  3FEW X;  1SEB D;  1PYS B;  4RHR A;  1I4R A;  3ER0 A;  3CW2 C;  1PH9 A;  2KJX A;  3BDO A;  1EY9 A;  1CTM A;  5EKK A;  1IKM A;  4HJ7 A;  4A3J B;  2B2U A;  4X62 L;  4IUV A;  3RLO A;  1F9P A;  2F52 A;  3K5L A;  2QDL A;  3TRE A;  4CKB A;  1XYI A;  4A3D H;  1MSH A;  2F0P A;  4QY7 A;  3KF8 A;  2K5W A;  2Q2U A;  3HOV H;  4M8A A;  1Y1V B;  4DK1 A;  4DUY L;  4A3M H;  3HOZ B;  3OWF A;  5M5X H;  2HDL A;  1FNV A;  3PIP A;  5C0X I;  4LF8 Q;  1Q90 A;  2IX3 A;  2B2U C;  4L8J A;  4H0L C;  1A8V A;  3KF6 B;  1I6H H;  1IW7 C;  1EYD A;  1FYC A;  1G8Z D;  1TQO A;  1S5D D;  3S24 A;  1HQM C;  3STB C;  2E5L Q;  3TZU A;  1KLG D;  2WV6 D;  2L9H A;  4GNX C;  1N33 L;  2D5D A;  5C6A A;  1W3S A;  5GRO A;  1K73 C;  4HAE A;  4DFA A;  4PZ8 A;  3KYH C;  3S1N H;  4J1M A;  5IGD A;  1WCM B;  1VQ8 A;  2LXK A;  3NPP A;  4RGM A;  3I4N B;  1TKW B;  3S1Q H;  1F9Q A;  2ZTD A;  1WTO A;  3DEO A;  1DGS A;  3NTI A;  1WTP A;  2A19 A;  1FGU A;  5C4H A;  3RN5 A;  4KLK A;  1Y1W G;  2RCN A;  5I4D A;  4DV7 L;  2K5H A;  2UUB Q;  3H0G H;  1IYV A;  5IWA L;  2DNE A;  3FRP B;  1ML0 D;  4KKS A;  4OWT B;  2IHE A;  4JI2 Q;  3HKS A;  3S16 H;  2WAQ G;  3A8K E;  2NBF A;  1WI5 A;  1BBW A;  2EOT A;  5JPM C;  3NTH A;  5COY A;  1NJI C;  3GTO B;  4L5T A;  3TP8 A;  5C4X H;  4MN3 A;  1EYA A;  2KEC A;  1JB7 A;  2PZW A;  3P1H A;  2K1B A;  1EY8 A;  3AMU A;  1FNW A;  4M1U B;  4P74 A;  1JIC A;  1J5E Q;  4DR4 L;  3PO3 B;  3I73 A;  1CSP A;  3VYU A;  1EYG A;  4A3G G;  1K0S A;  2KBN A;  3BU2 A;  4NW2 A;  4OIK A;  2GVB A;  1KNA A;  1TY2 A;  1EEI D;  3GTP H;  2IL8 A;  4ZUI A;  3P20 A;  4GKJ L;  5BR8 Q;  2R93 B;  4DUZ L;  1ESR A;  3H15 A;  4HMJ A;  4J15 A;  5EPJ A;  4DAM A;  4IOC A;  1G91 A;  4A3K G;  2JA7 H;  4JPB W;  2K05 A;  4G57 A;  1KHI A;  4RA8 A;  1EYC A;  5F2D A;  5CC4 A;  4Y7N B;  3LWE A;  2F0F A;  2HT1 A;  2PZT A;  3RZD H;  1XTC D;  1ZYR D;  4R8N A;  2B39 A;  1SNC A;  4WOR A;  3TS0 A;  1X3E A;  4KV6 A;  2EE1 A;  2Z1C A;  1RDP D;  4JW0 A;  3HOY H;  2MFI A;  3MXN A;  4C3H B;  1PH5 A;  1HR0 L;  3KBG A;  3RMH A;  5D3I B;  2VQE Q;  3SE0 A;  5JOB A;  3A5U A;  2D9U A;  4BY1 H;  1G29 1;  4I7A A;  4XQJ A;  5GAG C;  1KIX A;  2IHF A;  4A3I H;  2KQ3 A;  2N3S A;  3MFG A;  4LF4 L;  5KEE A;  1GM5 A;  2N88 A;  4DNI A;  2QKI C;  1P8L A;  1PFS A;  1QIL A;  5DNF A;  1NNX A;  1A15 A;  3NQI A;  3S14 H;  1STH A;  3HFZ B;  1PZI D;  2IT1 A;  3S1R B;  3F2B A;  1QVC A;  3ND8 A;  2YTY A;  1L0W A;  4DXF A;  4DR3 L;  4AQY L;  4JI5 Q;  1WJJ A;  4R8I A;  3CAM A;  3U9O A;  3MA2 B;  5M3M G;  2NVY H;  4IUU A;  1I5F A;  1OO9 B;  4DR1 Q;  2X6G A;  4A76 A;  4K5W A;  3W1B A;  4EQN A;  3E3X A;  4DV2 Q;  3PUW A;  3I8Z A;  1LTG D;  4CJ0 B;  1WCM H;  4KKU A;  1WTV A;  2HQE A;  1UE7 A;  4X64 Q;  4DV3 Q;  4C1N I;  2R92 H;  2F1M A;  1CSQ A;  1V1P B;  2I5M X;  5IT9 c;  3CC7 A;  5JJK A;  3G6E A;  2F0E A;  1CKO A;  4A75 A;  3KF6 A;  4MTK A;  4A3C G;  1MKH A;  4X65 L;  3U4Z A;  1FJG Q;  1EQR A;  3GDE A;  3E9I A;  3G7L A;  3PO2 G;  5M3F B;  3ITP A;  1LAB A;  3FVQ A;  1V9P A;  2A69 D;  5AJ3 L;  2E2D C;  2VNU D;  1KAW A;  1BF4 A;  3HOX H;  2EY6 A;  4JI1 Q;  2JA6 B;  4J8Q A;  5M9O A;  3M9B A;  5FO9 B;  4L5S A;  2NWG A;  5M5Y H;  1BXT A;  2VW9 A;  4R4I A;  1WFQ A;  2E2H B;  1HTP A;  2NTT A;  3C3L A;  1NMG A;  4FNF A;  1G2S A;  2WKC A;  4CKE A;  5KYL A;  3CPW A;  4YY3 L;  4B3S Q;  4X62 Q;  2RF4 A;  2JA9 A;  3OIP A;  1K8O A;  2PNR C;  3IRB A;  5E7N A;  3DWA A;  1EY7 A;  1YNN C;  3F2C A;  3ULL A;  1JQY D;  2GVA A;  3M4Q A;  4JBW A;  2FJ2 A;  2HHH Q;  1SJH D;  1DOL A;  4IUN A;  4IN3 A;  2NVQ B;  4ALP A;  1C9O A;  1NCV A;  1R9T B;  1H9S B;  4RGO S;  4JV5 L;  2PMZ B;  4A93 G;  4P75 A;  4G7H C;  3W3A A;  1SE8 A;  2LS0 1;  2PYK A;  2XGT A;  2YYZ A;  5A35 A;  5JEA G;  2ES2 A;  1XX8 A;  4L5R C;  3JAM L;  1EIG A;  4YWK A;  2D0O A;  2MQH A;  2DNC A;  2O2L D;  3WDN A;  1RHP A;  2Y0S E;  5M3M H;  4FP5 D;  1K8M A;  4HN7 A;  1L1O C;  1HFN A;  3G48 A;  1V43 A;  1XNQ Q;  1S72 A;  4JBK A;  1K9M C;  3KJP A;  2AQ3 B;  3OSO A;  3F2D A;  4AYB B;  1RD9 D;  3S2H B;  1JOR A;  3CF5 A;  4P71 A;  2YTX A;  1BR9 A;  1ENA A;  3DUZ A;  1JMC A;  1IYJ B;  2K33 A;  2NVX B;  3KLS A;  1VQ6 A;  5JJI A;  3A8J E;  3QOJ A;  4RCO A;  1ZEQ X;  5K36 G;  4A3C H;  2MPM A;  1LLR D;  5C3W A;  3A8I E;  4KY5 A;  3PO2 H;  1ZKO A;  5IGF A;  2JQO A;  4K14 A;  4XIG S;  1A62 A;  1I3Q B;  4FXG C;  3CMA A;  1PTO F;  4C2M H;  1UEA B;  1VQN A;  3TEH B;  1V1O A;  3BG3 A;  2NVT B;  4MHE A;  5FLX E;  4F87 A;  3PQI A;  1S5B D;  5G3L F;  1VQ7 A;  1VS0 A;  1GOZ A;  2B2T C;  3E9H A;  2F0J A;  1CHP D;  5JVG 3;  1N34 Q;  1XPR A;  3OW7 A;  3I72 A;  4LF8 L;  4QGU A;  2IX1 A;  1L0Y B;  3S15 H;  3VA7 A;  1B8A A;  3Q8D A;  4R1J A;  5FLX L;  2R61 A;  2KHI A;  4H02 A;  2E2H H;  2K7V A;  4ME3 A;  2E5L L;  5COR A;  2DGY A;  3UE1 A;  3CCL A;  3LNN A;  1GVP A;  3OHX C;  1F2M A;  4WJ4 A;  1V1P A;  2VB3 X;  1FGB D;  2K5D A;  4ODG A;  4X3K A;  3J7Y W;  2ID0 A;  3DWP A;  5D3D A;  2HCC A;  1L0X B;  1EZ8 A;  2IJ0 A;  3PUY A;  4X6A H;  2EJG C;  3T56 B;  4PMB A;  3J80 E;  4A93 H;  1Q1E A;  3HKZ G;  5E4W C;  2VZA A;  1D5X C;  1ZXT A;  3NWT A;  5I2X A;  3FPU B;  1OXX K;  1GHJ A;  1HPC A;  3H6M A;  4BXX G;  4BA2 I;  5I2Y A;  2NVQ H;  3EN2 A;  2YTV A;  5CBA E;  2OTL A;  1AH9 A;  2B63 H;  1QVF A;  2E75 C;  2UUB L;  1SFO H;  2Q2T A;  1A0I A;  3BYT B;  1CHQ D;  1N32 L;  2XTI A;  1Y8P B;  4APV A;  1PXU A;  2F0M A;  4DKA C;  4JI2 L;  1F9S A;  1NBW A;  4OX9 Q;  3RD4 A;  3HOU B;  1D2B A;  1DCZ A;  4UP8 A;  1QCB D;  4FVM A;  4IFD G;  3RNU A;  1A2T A;  4OO1 H;  2B8G A;  2UU9 Q;  2CWP A;  3F1Z A;  3W5O A;  1PRT F;  5IP9 G;  4R9W A;  2J7Z A;  4XYQ A;  1NE3 A;  1VMC A;  2Z6B A;  3KLW A;  1J5E L;  2F3W A;  4JVZ A;  4JG2 A;  1WTR A;  4HCE A;  1UE6 A;  4A3E G;  3QR8 A;  3QOL A;  4LF9 L;  4QCL A;  4UP9 A;  4KHV A;  4DAP A;  4HSV A;  3B6Y A;  4BWG B;  5BR8 L;  1EWH A;  4UAI A;  4A3D B;  2ENB A;  1SRU A;  2QW7 A;  1B4O A;  3Q22 A;  3T1H L;  2QEX A;  1I6V C;  1ZYR C;  5L37 A;  1ONL A;  3D6C A;  3GTL H;  2M9V A;  4CDD C;  4JI7 Q;  3HOV B;  5AJ3 Q;  4WFN 3;  3I2Z A;  4LUO A;  4A3M B;  5C5L A;  5M5X B;  1SNO A;  1BQQ T;  5KRU A;  1BVS A;  1HFG A;  2A6H D;  2BE5 D;  3FPP A;  1I6H B;  3VR6 A;  4LJZ C;  4XDX A;  3ERS X;  1WD1 A;  3M4P A;  4F8M A;  4NDX A;  5DM7 3;  4ZRZ A;  1PV4 A;  3AFQ A;  2VQE L;  1HR0 W;  2EYM A;  1Y14 B;  3H3V H;  5KIX A;  3J81 j;  5BN3 A;  2F0K A;  2IX0 A;  3S1N B;  1PYW D;  5CYU A;  2UXB Q;  5T1G A;  3PF5 A;  4QQB X;  4IPG A;  1STY A;  4DNT B;  1X3Q A;  2Q2I A;  1XMQ Q;  3RZO H;  2EY5 A;  3S1Q B;  3R2T A;  1Q82 C;  1VQI A;  4KMU C;  5IGB A;  5D65 A;  3K6O A;  4G4K A;  4X66 Q;  4KY6 A;  1PH4 A;  3OMG A;  3SK5 A;  1J9O A;  2N78 A;  3DEP A;  1BKB A;  2EVB A;  2K6A A;  5CV7 A;  2JP1 A;  2OQK A;  3H0G B;  3MEH A;  3GO5 A;  4QUF A;  4K5V A;  4BXX H;  4DA2 A;  3QIA A;  4KD4 A;  1H9R A;  3I91 A;  2E2I B;  1YHQ A;  3S16 B;  1E3P A;  4DV2 L;  2NZO A;  2RDG A;  5C4X B;  1RKN A;  4O42 A;  2MUY A;  4X64 L;  3OWE B;  5J39 A;  1GHK A;  4DV3 L;  2VS1 A;  2F0V A;  1CFM A;  1VQC A;  3W2D A;  2VY3 A;  3HP3 A;  1CM9 A;  1O80 A;  4JYA Q;  1Y8O B;  2EPB A;  5H1S E;  1M1K C;  2Z4H A;  3OTO Q;  4DN4 M;  3NEN A;  2A69 C;  3MC0 B;  4R4Q A;  4LK1 C;  2L1B A;  1EOV A;  2J0T D;  1FJG L;  2KCT A;  1LTB D;  1EIH A;  2D2C C;  4ME5 A;  4A3E H;  4HMI A;  1IBK Q;  2LFN A;  3VR2 A;  3PMF A;  5C3E G;  3IKJ A;  3MXU A;  3RN2 A;  1CK1 A;  2WB1 E;  1E2W A;  2JA7 B;  4L6T B;  1KAB A;  1NR4 A;  3LGJ A;  4YCU A;  3EIV A;  3MVV A;  3GTG H;  1STE A;  1PDQ A;  5IGE A;  3RLF A;  3V2T A;  1B2T A;  3K0Y A;  3RZD B;  3DHQ A;  2HIV A;  3K7A H;  1LUZ A;  4V0B A;  3SEB A;  3BZD B;  4XTC S;  4B3S L;  5ELE A;  2I46 A;  2UXD Q;  2UUC Q;  3HOY B;  4S3S A;  4EVO A;  2JA8 G;  5EQ0 A;  1X6O A;  2CWA A;  4BY1 B;  1IYU A;  4KJO A;  2PW7 A;  3L2P A;  4A3I B;  4QL5 A;  1H9M A;  1S5E D;  5DAU A;  3A55 A;  4J6H A;  1I50 H;  2HHH L;  1QVG A;  4C3J G;  1GD7 A;  3ULP A;  3I56 A;  1O7Z A;  2KEN A;  3IL8 A;  4HIO A;  2FXQ A;  3S14 B;  1PTO C;  2ZXO A;  4R4T A;  2GA4 B;  1BBU A;  4YHH Q;  3I55 A;  2P5Z X;  4IPH A;  2IPK D;  4BY7 G;  4JI6 L;  4LW1 A;  4UP7 A;  3HGB A;  4GKK Q;  1TWA B;  2ICI A;  4OON A;  3LWU A;  2RCF A;  2NVY B;  1LYL A;  3L9A X;  2F0I A;  1VQH A;  5GAH C;  4FDB A;  3L0O A;  1U5K A;  2ZM6 Q;  1VMP A;  1K28 A;  1Z9F A;  2DY8 A;  4PG3 A;  4LF7 Q;  4DU9 A;  1AP0 A;  1AFP A;  2R92 B;  1O78 A;  4DR7 Q;  1CKN B;  2WAQ B;  3P7J A;  4YWM A;  1CUK A;  5IGC A;  1XNQ L;  4CKC A;  3PUX A;  3ND9 A;  1Q81 C;  3SK4 A;  2EXZ A;  3A7L A;  1W6K A;  3TDQ A;  3OOC A;  2QF7 A;  2FMC A;  3PGZ A;  1N32 Q;  1T5E A;  1XNR Q;  5JAV A;  5KYI A;  4IO9 A;  2E2I H;  1V8Q A;  3EA6 A;  3SXH A;  4GOP B;  5E1F A;  2R7D A;  5CMD A;  4A3G B;  3NWS A;  2CW0 D;  3K5N A;  4R4C A;  1PFN A;  3HOX B;  4BBS G;  1LTS D;  2BDO A;  1YIT A;  5JVH 3;  1K3B C;  1FNU A;  1GJX A;  5M5Y B;  5BN4 A;  2K04 A;  5C3E H;  1W6J A;  3CKI B;  3N52 A;  1D5Z C;  2VUM G;  4QIW B;  2NUC A;  4LF9 Q;  1E22 A;  2EIF A;  3J81 c;  1SXT A;  3PUZ A;  1EL0 A;  2CQA A;  1LT3 D;  4HED A;  1E2Z A;  2Z6K A;  3T1H Q;  3SDZ A;  2HUG A;  1HNW Q;  1QG7 A;  1B50 A;  3JAM c;  3CCM A;  2UXC Q;  2AQ2 B;  3ERQ A;  1N34 L;  1OXV A;  1PRT C;  2K32 A;  3BVM A;  3MHB A;  3CQZ H;  1BCP D;  2OF1 A;  4HCS A;  5CV8 A;  2JA8 H;  3U9S A;  3PUV A;  5KND A;  2JSO A;  2RKS A;  3VDY A;  4IQZ A;  2RSN A;  4IJL A;  3PO3 G;  1B53 A;  1H9K A;  2WII B;  4NKL A;  1Q7Y C;  2PO4 A;  1XPU A;  5EBC A;  2V4D A;  3J7A V;  1AEX A;  4WJW A;  2G9H D;  4MZ9 A;  2N49 A;  1N9W A;  4DR2 Q;  1TT2 A;  1HNX Q;  3G71 A;  2EJF C;  1E7Z A;  3DWQ A;  4BY7 H;  3NE5 B;  4HIK A;  4LNQ A;  3A56 A;  5M3M B;  3FMC A;  3HS0 C;  3U50 C;  3D31 A;  5T1I A;  5J1Z A;  3I3C A;  2L0C A;  5EAY A;  1ILQ A;  3S17 H;  3M4O H;  4XXE A;  1IL8 A;  4OGQ C;  2KEE A;  4OXP A;  3WOF A;  4OX9 L;  2R7Z G;  1TY0 A;  1VQL A;  2R6G A;  5AFW A;  3GTQ H;  1GUW A;  1TWA H;  1HHV A;  4C3H G;  4JI4 Q;  2SDF A;  2Q8I B;  3M7G A;  1HZB A;  1Y1W H;  1VQK A;  2UU9 L;  2Y0S G;  1FR3 A;  1SBB B;  4RCN A;  1LTA D;  3CCS A;  1SE3 A;  3KLS X;  2BH8 A;  1MIU A;  1PFM A;  3E6Z X;  1LT4 D;  3OW2 A;  4H7B A;  5I6W A;  2A74 C;  1FD7 D;  3T51 B;  4KK7 A;  4HJ8 A;  3NBH B;  3PO2 B;  1K83 H;  4BBR G;  1FL0 A;  4CDF C;  1YEZ A;  5CV9 A;  3J81 i;  1JE4 A;  4C2M B;  3QJY A;  5JJZ A;  3K81 C;  3R3O A;  4OWW B;  2K5Q A;  2EQS A;  3JAM i;  1WTH A;  2M00 A;  2L15 A;  2A6H C;  2BE5 C;  4ULL A;  2VUM H;  2Z0S A;  4JI7 L;  1PA6 A;  4DV6 Q;  4ZYS A;  3CCQ A;  4UY8 C;  4A3G H;  4KHP Q;  1IBM Q;  2MO1 A;  2A6E C;  2WFW A;  1CKM A;  2VXW A;  4JC0 A;  3GTK H;  3KK7 A;  5HGQ A;  3K5O A;  3NQT A;  1VF5 C;  1SE4 A;  3BVG A;  4KY7 A;  4BS9 A;  3S15 B;  2AWO A;  4G7Z C;  2I07 B;  5DLQ E;  1SJE D;  1G2T A;  4A3K H;  4F7X A;  1PH2 A;  3A74 A;  4EQP A;  1BCP B;  1CKN A;  1N8R C;  3G4S A;  1C7Y A;  2KED A;  1RTO A;  1LTI D;  1LT5 D;  4IPD A;  1AZQ A;  3OMC A;  5C44 G;  4GN3 B;  4LUV A;  2UXB L;  1JJG A;  2UUA Q;  1U9R A;  4A93 B;  4QIW E;  4DNR B;  1XMQ L;  1WD0 A;  5IE8 A;  1J8I A;  5HUR A;  1SR3 A;  1B1Z A;  1B7Y B;  4GOP A;  3DXJ C;  3Q23 A;  1ASZ A;  4X66 L;  2F03 A;  3M7N A;  4YWL A;  1KRS A;  3QB3 A;  4YCV A;  5J22 A;  1WTQ A;  2BCO A;  2B63 B;  1X32 A;  3HG9 A;  2ZJR A;  1SFO B;  4FF4 A;  4IJH A;  2Q8T A;  1GKH A;  3M4Y A;  1KDC A;  1F9R A;  2I5H A;  1MSG A;  1NTG A;  3MTS A;  3NEM A;  4JI6 Q;  5EKL A;  1A2U A;  3NTK A;  1HUN A;  3I4L A;  2DY7 A;  2XRS D;  4GOP C;  4HJA A;  5M5W H;  3NHH A;  5IYB G;  3I70 A;  5LHY 1;  4ZK9 B;  2R7Z H;  3T13 A;  4NXN Q;  4JYA L;  1H95 A;  5LMN Q;  5EGT A;  3FKI G;  4QF4 A;  3OTO L;  1M4V A;  1ENC A;  4NB3 A;  2JEA I;  1A3U A;  2L11 A;  4UPA A;  1VQO A;  2FMM A;  1Q46 A;  1L2F A;  4C3I G;  2JE6 I;  1KL9 A;  4CDC C;  2RDF A;  3TS2 A;  5CV4 A;  1HNZ Q;  2OXP A;  4KHZ A;  4OL7 A;  2FFK B;  1MGS A;  1MI2 A;  3MAQ A;  2HDM A;  1JOO A;  4PQX A;  4BBR H;  1IBK L;  2B2Y A;  1LAC A;  2HD3 A;  1AN8 A;  3GTL B;  2A5H A;  5HY6 A;  3GQB A;  1SNQ A;  1B3A A;  3UE0 A;  1D1K A;  1SDF A;  2KHJ A;  2YU9 H;  2NYZ D;  1JJC B;  1CA6 A;  3CCE A;  2Q2H A;  2JN4 A;  4DPG A;  1D1I A;  1C48 A;  1T9H A;  4U68 A;  1HZC A;  4DV0 L;  3WWV A;  3ERO A;  3U4V A;  1PZK D;  1X3G A;  2F0N A;  2SNS A;  4PNY A;  5C5M A;  2UXD L;  2UUC L;  2B2Y C;  2RVL A;  3TN2 A;  3MFY A;  4ZKC B;  4OO1 I;  2J4X A;  2B2W A;  5C4J H;  4OEL B;  1S40 A;  4B3R Q;  2AQ1 B;  2AMC B;  3NUC A;  2XIW A;  2HIX A;  1XMO Q;  2DN8 A;  3KBX A;  4R4O A;  1CI3 M;  2PI2 A;  4F88 A;  3GV3 A;  2E2J H;  5IP7 G;  4PMW A;  3DLL A;  2QDB A;  3RZO B;  3EFX D;  4NP5 A;  1YBY A;  1YVC A;  3CPF A;  1SN8 A;  2B2W C;  4XQQ A;  2OQ0 A;  5IT9 E;  4DK3 C;  5C44 H;  2OWO A;  2NTS A;  3S1M H;  4YHH L;  3HKZ B;  1DOM A;  4HSP A;  2IW3 A;  2D0P A;  2BA0 A;  3CC2 A;  2ASB A;  1M90 C;  3NBH A;  4CJ2 C;  1KQS A;  2O5I C;  2CQO A;  4CHT B;  4GKK L;  1QE6 A;  3NEL A;  3T4A C;  1WVL A;  1EFW A;  4B3T Q;  2K14 A;  4A3B G;  3VR5 A;  5TSS A;  2ZM6 L;  1Z7T A;  3D0F A;  1QZG A;  1CQV A;  3C1F A;  3WOE A;  4LF7 L;  1PMR A;  4ZAI A;  3SK8 A;  4K6D A;  1SAP A;  4POF A;  2H4O A;  4DR7 L;  5JEA H;  1YIJ A;  1XXG A;  2XVS A;  1TVX A;  3ONA B;  1VQG A;  2CW0 C;  5CV6 A;  3CD6 A;  3RLN A;  4LF5 Q;  1VQJ A;  1UUP A;  2SNM A;  3VYR A;  3D4R A;  3TP6 A;  1XNR L;  3J7A 5;  3J80 L;  4A4I A;  3HRZ C;  3FKI H;  4C56 C;  4A3E B;  2NZ1 D;  3M3Y H;  2PCF B;  1BDO A;  4C3I H;  2OEO A;  1DZ1 A;  3K59 A;  2NN6 G;  1KDA A;  2PMZ E;  4JBM A;  1A63 A;  2JA5 G;  1UWV A;  4N9P A;  3VR4 A;  2A68 D;  5EJW A;  1PLF A;  1VQB A;  3URY A;  3GTG B;  4B3M L;  3MZ5 A;  1S5C D;  3VYS A;  4GNX B;  4V19 0;  3K7A B;  1CZG A;  2V1C C;  1GUG A;  1VQE A;  4N8X 1;  1HQR D;  3E0E A;  4RFB A;  1HRJ A;  4RWS C;  1SLJ A;  1B44 D;  2PPB C;  4RGN A;  5K36 H;  5EBD A;  3UDI A;  3SHL A;  1XJV A;  1BCP C;  3V05 A;  4JOI A;  1EQQ A;  2B29 A;  4O1N A;  1UNS A;  4LFB Q;  4MIU A;  2WB1 G;  1TS5 A;  1QOH A;  1I94 Q;  1LV9 A;  4QB4 A;  2K5V A;  3MWY W;  1HNW L;  2UXC L;  5IGG A;  4HJ5 A;  1VQ4 A;  1VDZ A;  2X6L A;  2XWJ B;  5FK9 C;  4AYB E;  3DM1 A;  1I50 B;  1STN A;  1JOQ A;  3EJI A;  2EY1 A;  3KFU A;  1SYF A;  1LT6 D;  2PNH A;  1F2L A;  3UI2 A;  4C1N K;  4DV4 L;  1SYD A;  4Q5V A;  1TU2 B;  3A5Z B;  3CCJ A;  2AHO B;  1PFB A;  1IKL A;  4CBV A;  1E2V A;  1MD2 D;  1YZ6 A;  3J7Z C;  3R2I A;  1QUQ B;  2AKW B;  2EZV A;  1DD2 A;  2XSC A;  3Q24 A;  2F0O A;  1F2Y A;  2ZJP A;  4DR2 L;  3S9W A;  1HNX L;  1RL2 A;  1PHJ A;  1KD1 C;  2E8G A;  2EYH A;  3L7Z C;  5FKA C;  2K75 A;  3GD7 A;  1B70 B;  1VQ5 A;  3I4M G;  4ZUJ A;  1IL2 A;  4A3B H;  5A2Q E;  3KOJ A;  4A3M G;  4DV1 Q;  4TSS A;  1TR5 A;  1HTL D;  3CRK C;  4H13 C;  1M8A A;  1E1O A;  1LTR D;  1C0A A;  2YV5 A;  1CA5 A;  4A3L G;  1Q3L A;  2WP8 J;  1QJO A;  1TWG B;  2RHQ B;  1E24 A;  4CDE C;  4JI4 L;  5GQO A;  4HIM A;  4HTH A;  1G6Z A;  1YNJ D;  2ALY B;  1ASY A;  4A3F G;  1RF2 D;  4K6L A;  5A2Q L;  1WYD A;  3K0X A;  4LFC Q;  4ILW A;  4KN7 C;  3VA5 A;  4PZ7 A;  1IBL Q;  2ZXR A;  4UDU C;  1DJR D;  5C3E B;  3D4D A;  4O2D A;  4IFD H;  3PV0 A;  4MTN A;  2NN6 H;  3G6J B;  1KDB A;  2TSS A;  2JA5 H;  1TS2 A;  1B9N A;  3F2U A;  5IP9 H;  1DOK A;  1HZA A;  1JWM D;  1LO5 D;  1K8G A;  2K5N A;  2BH2 A;  3X3M A;  2F4V L;  3H3V C;  4U67 3;  3HOW G;  4DV6 L;  2RQX A;  4KHP L;  2Z9H A;  4NXM Q;  3H0G G;  1IBM L;  4KKT A;  1AZP A;  5LL6 S;  1PTO H;  4P72 A;  3IFT A;  3FP9 A;  3CQZ B;  4JCV E;  3NP8 A;  2F0D A;  4DV0 Q;  3BDC A;  2JA8 B;  4ID6 A;  4CGY B;  1Q8I A;  2PZU A;  1WTW A;  2L5T A;  1EOT A;  3ULJ A;  2BDN A;  2AUK A;  3BZK A;  1GUS A;  2M2L A;  2JEB I;  4CJ1 B;  1UE1 A;  3SVM A;  4JI3 L;  2K03 A;  4G7O C;  3U58 A;  1G6P A;  4PV1 C;  4DK0 A;  5C0X G;  3T1Y Q;  1YJ9 A;  2UUA L;  5ELN A;  1WTX A;  1E0B A;  3BJU A;  3NXW A;  5JPN C;  2N8N A;  2C35 B;  4Q0F A;  5FO7 B;  4BY7 B;  1VQF A;  3T16 A;  5LMU L;  1CT1 D;  4RAU C;  2JA7 G;  4QMG A;  1DYQ A;  1UAP A;  1X65 A;  4KN4 C;  4Z9C B;  1ET9 A;  1DM0 B;  3I90 A;  1XPO A;  1MHW C;  4LFA Q;  3S17 B;  3D8G A;  2FHT A;  5ELO A;  3I4M H;  1EWI A;  3M4O B;  2CH4 W;  1TS3 A;  1EUJ A;  4GNX A;  4IUT A;  4RMF A;  4A3J G;  5C3X A;  4DR5 L;  1SMX A;  3GTQ B;  3HOY G;  1C4Q A;  1SND A;  2KOL A;  2MJ8 A;  4KTA A;  1QB5 D;  1N36 Q;  1Y1W B;  3Q0A A;  1EFI D;  1SNP A;  4GLA C;  1QNU A;  4HJ9 A;  2LKV A;  1TWF B;  2E76 C;  2CCZ A;  1DXM A;  4NXN L;  4BY1 G;  5LMN L;  4A3L H;  2OT2 A;  4XT1 B;  2F0T A;  5J3B A;  1K83 B;  3K57 A;  1Y1V G;  4A3I G;  3X3N A;  2F4I A;  4X3T A;  3HOZ G;  3CME A;  3L3O C;  4A3F H;  3SGI A;  1HNZ L;  2BA1 A;  4GN5 A;  4BBS B;  4L5Q A;  4O0A A;  2XN9 C;  2KUM A;  1KTK A;  1TII D;  2C9O A;  1O7L A;  1TWG H;  3CCU A;  2VUM B;  5I9P A;  4RKB A;  3GTM H;  4NMZ A;  3HZX A;  3GTJ H;  4B9W A;  3GTK B;  3S2D H;  1QUQ A;  3JC6 6;  1VQA A;  3MXP A;  3D3R A;  3Q6S A;  5DM6 3;  1F77 A;  4DR6 Q;  1I4H A;  1IXR A;  1WCM G;  3HOW H;  3FHW A;  4IOA A;  4B3M Q;  3I4N G;  1BNZ A;  4A3K B;  2R92 G;  2ICE C;  5K5P A;  1O7I A;  1KAA A;  5E3F A;  1UEB A;  3BVZ A;  3OIQ A;  1PH1 A;  4B3R L;  2AWN A;  2MNA A;  5JEA J;  1HJP A;  1RIP A;  3K7U C;  3A0J A;  4K8I A;  1HXY D;  1XMO L;  3V96 A;  1JWS D;  1Q86 C;  4JI8 Q;  3VYT A;  1F2Z A;  2JJQ A;  1L1O B; 
#chains in the Genus database with same CATH homology
 3MXN B;  5IE8 A;  3KJO A;  1SR3 A;  1B7Y B;  1OXX K;  4BXX G;  2VQF L;  4GOP A;  4EX5 A;  1OTC A;  4BA2 I;  3RR5 A;  1ASZ A;  5JJL A;  2NZH A;  4X66 L;  1X9N A;  3EN2 A;  2NVQ H;  3M7N A;  2YTV A;  1S3O A;  4YWL A;  1KRS A;  2OTL A;  4YCV A;  1AH9 A;  2A1A A;  2B63 H;  3HOX G;  2ZTC A;  1QVF A;  5C4X G;  3PIO A;  2UUB L;  1J6Q A;  1SFO H;  2Q2T A;  2ZJR A;  1A0I A;  4DV4 Q;  1N32 L;  4IJH A;  2XTI A;  4APV A;  2I0Q A;  3DM3 A;  1LM0 A;  2Z6K C;  4DKA C;  4JI2 L;  1GKH A;  1W2B A;  2I5H A;  3HOU H;  1NBW A;  1NTG A;  3AQQ A;  3NEM A;  4OWX B;  4C3J H;  4JI6 Q;  1SRO A;  4OX9 Q;  2HQL A;  3I7F A;  4UP8 A;  4IFD G;  4B3T L;  3RNU A;  4P73 A;  1D8L A;  4JI1 L;  2LXJ A;  4GOP C;  4HJA A;  2UU9 Q;  1X54 A;  5M5W H;  2CWP A;  3F1Z A;  4RG1 A;  1U0L A;  3W5O A;  5IP9 G;  2R93 G;  5IYB G;  1PYS B;  1NE3 A;  3KLW A;  1J5E L;  2R7Z H;  3ER0 A;  3CW2 C;  1PH9 A;  4K0K Q;  4NXN Q;  4JYA L;  1H95 A;  5LMN Q;  4JG2 A;  4A3J H;  1UE6 A;  3FKI G;  3OTO L;  4A3E G;  4NB3 A;  4HJ7 A;  2JEA I;  1VQO A;  4UPA A;  4X62 L;  1Q46 A;  1L2F A;  1IZ6 A;  4LF9 L;  2JE6 I;  1KL9 A;  3RLO A;  3TS2 A;  4UP9 A;  2F52 A;  3B6Y A;  4LF6 Q;  3TRE A;  1HNZ Q;  4LF5 L;  5BR8 L;  4A3D H;  2K50 A;  4JI0 Q;  4KHZ A;  4QY7 A;  1SRU A;  3T1H L;  4BBR H;  1KXL A;  2QEX A;  4DV5 Q;  1IBK L;  1Y1V H;  1OXU A;  2Q2U A;  3GTL H;  3HOV H;  4JI7 Q;  3HOZ H;  4DUY L;  5HY6 A;  5AJ3 Q;  4A3M H;  5M5X H;  4NPS A;  3UE0 A;  3I2Z A;  1P16 A;  4LUO A;  3AYH B;  2KHJ A;  5C0X I;  3PIP A;  2YU9 H;  4LF8 Q;  1JJC B;  4GN4 B;  3CCE A;  2Q2H A;  4DPG A;  1A8V A;  1T9H A;  1BVS A;  1HZC A;  3KF6 B;  4DV0 L;  1WOC A;  1TWF H;  1I6H H;  3WWV A;  1JT8 A;  3CC4 A;  3U4V A;  1X3G A;  3S24 A;  3STB C;  2E5L Q;  3ERS X;  3M4P A;  2QGQ A;  2ATW A;  2UXD L;  2UUC L;  1PYB A;  3F8T A;  5FLX c;  1YI2 A;  4OO1 I;  1PV4 A;  5C4J H;  3AFQ A;  4GNX C;  1FJG Q;  1N33 L;  4BBS H;  1Z47 A;  2VQE L;  1HR0 W;  1Y14 B;  1W3S A;  1YJW A;  3KDF B;  1X55 A;  1S40 A;  1MJE A;  5GAE C;  3H3V H;  4B3R Q;  4JBJ A;  5GRO A;  4LFB L;  1K73 C;  2AMC B;  1K8A C;  1I94 L;  3J81 j;  4PZ8 A;  2HIX A;  3KYH C;  3S1N H;  2WAQ E;  1XMO Q;  2IX0 A;  4R4O A;  1VQ8 A;  3I4N H;  2PI2 A;  2LXK A;  2UXB Q;  4QQB X;  3PF5 A;  4IPG A;  2F4V Q;  1VCI A;  3S1Q H;  2ZTD A;  2E2J H;  1HH2 P;  2Q2I A;  1DGS A;  5IP7 G;  1XMQ Q;  4PMW A;  4QJF A;  1K3R A;  3DLL A;  3RZO H;  2A19 A;  1Q82 C;  1VQI A;  1TXY A;  1FGU A;  2VQF Q;  1YBY A;  1YVC A;  3CPF A;  2CKZ B;  1AE2 A;  4X66 Q;  1SN8 A;  3RN5 A;  1PH4 A;  2OQ0 A;  4KLK A;  5FLM G;  1Y1W G;  4DK3 C;  5C44 H;  2OWO A;  2N78 A;  2RCN A;  3S1M H;  1BKB A;  4YHH L;  4DV7 L;  2K5H A;  2UUB Q;  3H0G H;  4HID A;  2D0P A;  5IWA L;  2BA0 A;  3CC2 A;  2OQK A;  2ASB A;  3GO5 A;  1M90 C;  4OWT B;  2IHE A;  1KQS A;  4JI2 Q;  4BXX H;  2CQO A;  3HKS A;  3S16 H;  4GKK L;  2WAQ G;  3NEL A;  1WI5 A;  1YHQ A;  1BBW A;  1E3P A;  4DV2 L;  3GTO H;  1FVI A;  1NJI C;  4L5T A;  5C4X H;  1GO3 E;  1EFW A;  2K14 A;  3ZJY C;  2NZO A;  3J80 c;  4B3T Q;  4A3B G;  4IFD J;  4JI3 Q;  2ZM6 L;  4X64 L;  3D0F A;  1JB7 A;  1QZG A;  1X56 A;  4DV3 L;  1OXS C;  2VS1 A;  1YNX A;  2ZJQ A;  4LF7 L;  4EQ5 A;  4POF A;  4P74 A;  1J5E Q;  3PO3 H;  1VQC A;  4DR4 L;  2VY3 A;  3TQY A;  5M3F G;  4DR7 L;  4JYA Q;  5H1S E;  1M1K C;  2I5L X;  3K8A A;  1CSP A;  3OTO Q;  1YIJ A;  5LMU Q;  3NEN A;  1EYG A;  4A3G G;  2KBN A;  2K4K A;  3BU2 A;  1VQG A;  4DV1 L;  4R4Q A;  2GVB A;  4KI0 A;  4BA1 I;  3CD6 A;  3RLN A;  2R93 H;  3GTP H;  2JA6 G;  4LF5 Q;  1VQJ A;  1EOV A;  5BR8 Q;  4GKJ L;  1FJG L;  2KCT A;  5IYD G;  4DUZ L;  3CXC A;  1XNR L;  3J7A 5;  4A4I A;  1G51 A;  3H15 A;  3FKI H;  4A3E H;  2PQA B;  4J15 A;  1IBK Q;  3M3Y H;  5C3E G;  4DAM A;  4IOC A;  4A3K G;  3RN2 A;  2WB1 E;  4C3I H;  1UE5 A;  2JA7 H;  4Y7N H;  4DUY Q;  4DR5 Q;  1KHI A;  2NN6 G;  3LGJ A;  4YCU A;  2PMZ E;  4JBM A;  3EIV A;  2CFM A;  4WJ3 M;  1A63 A;  2JA5 G;  1UWV A;  1LTL A;  2MO0 A;  2HT1 A;  3GTG H;  1YHB A;  1VQB A;  4LFC L;  3RLF A;  2F3I A;  3RZD H;  1X3F A;  1IBL L;  4B3M L;  3TS0 A;  1X3E A;  2HIV A;  3K7A H;  1LUZ A;  4GNX B;  4C3H H;  1L1O A;  2V1C C;  1Q1B A;  1VQE A;  4XTC S;  3HOY H;  2MFI A;  3E0E A;  4B3S L;  1SLJ A;  2UXD Q;  2UUC Q;  1Q8K A;  4GLV B;  1PH5 A;  1HR0 L;  1N33 Q;  3UDI A;  2VQE Q;  1XJV A;  1EQQ A;  4JOI A;  2B29 A;  4LFB Q;  2JA8 G;  2WB1 G;  3A5U A;  4BY1 H;  1I94 Q;  1G29 1;  1X6O A;  2K5V A;  2CWA A;  3STB D;  1KIX A;  5GAG C;  2B63 G;  1HNW L;  2IHF A;  4NXM L;  2UXC L;  4A3I H;  2R7F A;  2N3S A;  3W1G A;  3L2P A;  4YCW A;  4QL5 A;  4LF4 L;  4HJ5 A;  1VQ4 A;  1GM5 A;  1OXT A;  4DNI A;  1I50 H;  2HHH L;  2PI2 E;  4AYB E;  1VQP A;  1QVG A;  1GD7 A;  1P8L A;  1PFS A;  3I56 A;  3ULP A;  3KFU A;  2PNH A;  2KEN A;  3S14 H;  4OO1 G;  4HIO A;  1TWH H;  2FXQ A;  3HFZ B;  3S1R H;  4R4T A;  2IT1 A;  1BBU A;  4DV4 L;  4YHH Q;  2A8V A;  3M85 A;  4DV7 Q;  3F2B A;  1QVC A;  3I55 A;  2YTY A;  1L0W A;  4DR3 L;  4AQY L;  4JI5 Q;  3A5Z B;  1WJJ A;  2JK8 A;  5IWA Q;  3CAM A;  3CCJ A;  4IPH A;  2AHO B;  3J80 i;  4BY7 G;  5M3M G;  4JI6 L;  4LW1 A;  4UP7 A;  3UDG A;  4GKK Q;  2NVY H;  4DR1 Q;  1I5F A;  4DK6 C;  4OON A;  4A76 A;  1YZ6 A;  3J7Z C;  3W1B A;  5FLM H;  3CCR A;  4DV2 Q;  3PUW A;  1LYL A;  1QUQ B;  2AKW B;  2EXD A;  1VQH A;  5GAH C;  4FDB A;  3L0O A;  3T1Y L;  1WCM H;  2ZJP A;  1U5K A;  1Q12 A;  2ZM6 Q;  1UE7 A;  4X64 Q;  4DR2 L;  1HNX L;  1RL2 A;  1Z9F A;  4AYB G;  1JJ2 A;  4DV3 Q;  1PHJ A;  1KD1 C;  2E8G A;  4PG3 A;  4LF7 Q;  2R92 H;  3L7Z C;  4DR4 Q;  2K75 A;  3GD7 A;  1B70 B;  1CSQ A;  1VQ5 A;  1CKN B;  3I4M G;  4DR7 Q;  4YWM A;  1CUK A;  1IL2 A;  1VQM A;  2I5M X;  5IT9 c;  3CC7 A;  1XNQ L;  4A3B H;  1PH7 A;  5JJK A;  4A3M G;  3KOJ A;  3PUX A;  5FJ8 G;  3G6E A;  4DV1 Q;  1Q81 C;  1CKO A;  4A75 A;  3KF6 A;  1JE5 A;  4A3C G;  4GKJ Q;  1MKH A;  4GS3 A;  3U4Z A;  4DAY B;  1E1O A;  1EQR A;  3GDE A;  4TQU S;  4X65 L;  3PGZ A;  4LUZ A;  3E9I A;  5M3F H;  4DUZ Q;  1XNR Q;  3PO2 G;  2YV5 A;  1N32 Q;  4IO9 A;  4A3L G;  2E2I H;  2WP8 J;  1V9P A;  2RHQ B;  5AJ3 L;  1E24 A;  4GOP B;  4JI4 L;  3TRZ A;  2R7D A;  1TWC H;  2VNU D;  5GQO A;  4HIM A;  3AEV A;  1KAW A;  1EIY B;  1N36 L;  2ALY B;  3HOX H;  1ASY A;  2JA6 H;  2OTJ A;  4A3F G;  4R4C A;  4JI1 Q;  3KDF A;  4BBS G;  5IYD H;  3PSI A;  3M9B A;  4L5S A;  1WYD A;  3K0X A;  1YIT A;  5M5Y H;  4LFC Q;  2VW9 A;  4PZ7 A;  4R4I A;  5LMN W;  1IBL Q;  1WFQ A;  5C3E H;  2VUM G;  1NMG A;  4O2D A;  3PV0 A;  4MTN A;  3CPW A;  5IYC G;  3H3V I;  4YY3 L;  2D62 A;  4B3S Q;  4X62 Q;  4GLX A;  2JA5 H;  4LF9 Q;  1HR0 Q;  1E22 A;  2EIF A;  5IP9 H;  1HZA A;  5IYB H;  3J81 c;  2RF4 A;  3PUZ A;  3CCV A;  2JA9 A;  1K8G A;  2K5N A;  3IRB A;  5E7N A;  2Z6K A;  3T1H Q;  2BH2 A;  2F4V L;  1HNW Q;  5C0X J;  4DV6 L;  3HOW G;  4KHP L;  3F2C A;  3JAM c;  3CCM A;  3H0G G;  1N34 L;  4NXM Q;  1IBM L;  3ULL A;  2UXC Q;  1OXV A;  4LF4 Q;  2GVA A;  3M4Q A;  4P72 A;  4JBW A;  3CQZ H;  2HHH Q;  3FP9 A;  1YJN A;  2JA8 H;  4JCV E;  4DV0 Q;  2OCE A;  4DR6 L;  4ALP A;  1C9O A;  2GN5 A;  3KF8 B;  1R9T H;  3PUV A;  3ULJ A;  4JV5 L;  1PVO A;  3VDY A;  4MNO A;  3BZK A;  4P75 A;  4A93 G;  4AQY Q;  4LWC A;  4IJL A;  4DR3 Q;  1KC8 C;  1SE8 A;  2JEB I;  3PO3 G;  2RHS B;  2XGT A;  1PH3 A;  2YYZ A;  3ICE A;  5JEA G;  2ES2 A;  4L5R C;  1Q7Y C;  1NMF A;  1UE1 A;  4YWK A;  1XPU A;  2MQH A;  2D0O A;  2IY5 B;  4JI3 L;  1G6P A;  3U58 A;  4MZ9 A;  1VQD A;  2N49 A;  2K52 A;  5C0X G;  3T1Y Q;  1YJ9 A;  4JI8 L;  2UUA L;  1N9W A;  4DR2 Q;  5ELN A;  1HNX Q;  3G71 A;  3BJU A;  1E7Z A;  4BY7 H;  2Y0S E;  4HIK A;  5M3M H;  4LNQ A;  2N8N A;  2NN6 I;  2C35 B;  4IFD I;  2PQA A;  1VQF A;  5LMU L;  3HOU G;  1L1O C;  3U50 C;  1K0R A;  2JA7 G;  3D31 A;  3G48 A;  1V43 A;  1XNQ Q;  4LFA L;  3OYY A;  1S72 A;  1E1T A;  1V1Q A;  4JBK A;  1K9M C;  3KJP A;  1X65 A;  5EAY A;  3S2H H;  1NY4 A;  4JOI C;  3F2D A;  3S17 H;  3MEF A;  1XPO A;  4LFA Q;  4X65 Q;  3M4O H;  5IP7 H;  3CF5 A;  5ELO A;  3I4M H;  4P71 A;  4OXP A;  1EWI A;  2YTX A;  4OX9 L;  2R7Z G;  1VQL A;  1JMC A;  2R6G A;  3GTQ H;  3PF4 A;  1IYJ B;  1EUJ A;  1TWA H;  4GNX A;  2NVX H;  4RMF A;  2B3G A;  4A3J G;  4AIM A;  4DR5 L;  1SMX A;  4JI4 Q;  5FJ8 H;  1VQ6 A;  5JJI A;  3HOY G;  1HZB A;  1Y1W H;  1VQK A;  2UU9 L;  2Y0S G;  1MJC A;  1N36 Q;  3CCS A;  5K36 G;  4A3C H;  2BH8 A;  1MIU A;  4GLA C;  3UDX A;  1PH8 A;  4A3D G;  4HJ9 A;  3OW2 A;  1KRT A;  3PO2 H;  1D7Q A;  2CCZ A;  4K0K L;  4NXN L;  4BY1 G;  5LMN L;  4HJ8 A;  2JQO A;  4A3L H;  1I3Q H;  2LSS A;  1K83 H;  3NBH B;  4XIG S;  4BBR G;  1A62 A;  1FL0 A;  5J3B A;  1Y1V G;  1YEZ A;  4A3I G;  3CMA A;  3J81 i;  3HOV G;  4C2M H;  3HOZ G;  3CME A;  2NVT H;  2H5X A;  2ZTE A;  4YY3 Q;  4A3F H;  3SGI A;  4POG A;  1VQN A;  3BZC A;  3TEH B;  4LF6 L;  1HNZ L;  1PH6 A;  1EIF A;  3K81 C;  2BA1 A;  4GN5 A;  4JI0 L;  4OWW B;  4L5Q A;  3JAM i;  2EQS A;  4O0A A;  1AE3 A;  4IPC A;  2L15 A;  1VQ7 A;  4DV5 L;  1XTD A;  2KCM A;  1VS0 A;  1C0A A;  2VUM H;  3E9H A;  1TWG H;  2Z0S A;  3CCU A;  4JI7 L;  1PA6 A;  4TVA B;  3CCQ A;  5IYC H;  4DV6 Q;  4UY8 C;  4A3G H;  3GTM H;  1N34 Q;  4KHP Q;  1IBM Q;  2MO1 A;  2WFW A;  1XPR A;  1CKM A;  4JC0 A;  4LF8 L;  2IX1 A;  4QGU A;  3GTK H;  3HKZ E;  3GTJ H;  5HGQ A;  3S2D H;  3UDF A;  3S15 H;  1QUQ A;  3JC6 6;  1B8A A;  1VQA A;  3Q8D A;  2AWO A;  4R1J A;  3CP0 A;  2KHI A;  4DR6 Q;  4H02 A;  2E2H H;  1IXR A;  1WCM G;  3HOW H;  3FHW A;  4ME3 A;  2E5L L;  4JI5 L;  5DLQ E;  1VQ9 A;  4IOA A;  2DGY A;  4B3M Q;  1YHA A;  4Y52 H;  1HZ9 A;  3UE1 A;  4A3K H;  3I4N G;  4JV5 Q;  1PH2 A;  3AFP A;  3EBE A;  4AH6 A;  3CCL A;  1GVP A;  2R92 G;  3A74 A;  4WJ4 A;  2QA4 A;  5GAD C;  1CKN A;  1O7I A;  4DR1 L;  1QZH A;  1UEB A;  4PZ6 A;  2DUD A;  1N8R C;  1PH1 A;  2ID0 A;  4B3R L;  3G4S A;  2AWN A;  2MNA A;  1C7Y A;  5JEA J;  4X6A H;  3K80 C;  3PUY A;  1HJP A;  1RIP A;  3K7U C;  3A0J A;  1XMO L;  5IY0 A;  4IPD A;  5C44 G;  4GN3 B;  4LUV A;  1Q86 C;  1Q1E A;  3HKZ G;  4JI8 Q;  4A93 H;  2UUA Q;  2UXB L;  1JJG A;  3I4O A;  2JJQ A;  2VL6 A;  2VZA A;  4QIW E;  3PCO B;  1L1O B;  1XMQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...