2HQLA

Crystal structure of a small single-stranded dna binding protein from mycoplasma pneumoniae
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
104
structure length
104
Chain Sequence
MLNRVFLEGEIESSCWSVKKTGFLVTIKQMRFFGERLFTDYYVIYANGQLAYELEKHTKKYKTISIEGILRTYLERKSEIWKTTIEIVKIFNPKNEIVIDYKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a novel single-stranded DNA binding protein from Mycoplasma pneumoniae.
pubmed doi rcsb
source organism Mycoplasma pneumoniae
molecule tags Dna binding protein
molecule keywords Hypothetical protein MG376 homolog
total genus 14
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11506 DUF3217 Protein of unknown function (DUF3217)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hqlA01
5AJ3L 4JBMA 1YNXA 1YEZA 2K75A 1K83H 5IWAL 4GOPA 1A62A 2RCNA 3K7UC 4PG3A 1Y1WH 3STBC 1RL2A 4BA1I 4DV3L 1FVIA 4A75A 3RLNA 3RZDH 4PZ6A 1HNZL 4L5QA 1VQ9A 1KRTA 2F52A 2B63H 1UWVA 1Y1VG 1KIXA 2NVYH 2YTVA 2R7ZG 1VQFA 3I4MH 4GKJL 1SROA 4DUZL 2YTXA 2Z6KC 4LF9L 4XIGS 5AJ3Q 1VQPA 4LF9Q 1Q1EA 1W3SA 2N8NA 5IP7G 1Y1VH 1OXTA 1VQNA 1WI5A 1XMQL 2BH2A 4IOCA 3I55A 3OYYA 3I4OA 3ULLA 2R6GA 1KC8C 4GN4B 1VQJA 2GVBA 5GAEC 4A3KG 2NVTH 2VUMG 4HJ9A 2XGTA 4P71A 4GLXA 3KDFA 1IBLL 5FLXc 1L1OA 2AWNA 1L1OB 1LTLA 3F8TA 4JI8L 2UUAQ 1WJJA 4O2DA 4OX9L 4YCVA 4QQBX 2XTIA 2JA9A 3RR5A 1ASYA 4BXXH 3STBD 3HOUG 5M3FG 1NY4A 4GKJQ 1Z47A 3PV0A 3BZCA 4DV1L 4DR1L 1UE6A 3EBEA 1E3PA 4YWMA 4QJFA 1PH6A 3AYHB 2MNAA 4IPDA 3AFQA 3W1GA 1VQ8A 1JT8A 1CUKA 3RN2A 1EWIA 3S15H 1G291 4X65L 2DUDA 3M9BA 4L5TA 2R93H 1Y14B 1K73C 4R4CA 4X64L 4BY7G 4B3TL 4LNQA 1VQMA 2YTYA 4JYAL 1SMXA 4MZ9A 4A3KH 5E7NA 4BA2I 1BBWA 1WYDA 3TRZA 1T9HA 4JG2A 5IYDH 1QUQB 4J15A 1XPUA 3HKSA 5IYDG 1S3OA 4GS3A 4YHHL 1GKHA 2YU9H 1NMFA 4DKAC 4L5SA 3A74A 1CKNB 4OXPA 2VQEL 3CC4A 1EIYB 2QEXA 3UDIA 3PUVA 4DV4Q 2PQAB 4NXML 1D8LA 4YY3Q 1I6HH 3S16H 1VQEA 3G4SA 4BY7H 4A3LH 1FGUA 3CQZH 3L0OA 1VQOA 2KBNA 2KCTA 1NJIC 4X6AH 3OTOQ 4OWXB 2CFMA 4DR5L 3J81j 4KLKA 4HIOA 2WB1G 1G6PA 2ZTCA 4DV0L 3CC2A 4UP9A 4P72A 4GKKL 1OXSC 4JI3L 3BU2A 1MKHA 3TEHB 4HIMA 2UUBQ 4LFAL 3RNUA 1IBKQ 2OTJA 1N33Q 4X62Q 3VDYA 1Z9FA 1K8AC 1A63A 5DLQE 4B3ML 5C44G 4GLVB 3W5OA 1P16A 4JI1L 4A76A 1HZAA 2NZOA 2E2JH 3GTKH 1IBMQ 5JEAJ 4A3BH 5IYCG 1YHAA 2A19A 1B8AA 1EOVA 4GNXB 1VQ5A 5JJIA 1O7IA 1YBYA 1B70B 1X3EA 1VQDA 2MFIA 1G51A 5H1SE 5C3EH 2ATWA 5C0XI 4DUYQ 1PYSB 1I94L 2JA5G 3HOYH 3PUZA 1AH9A 1PH4A 4C3HH 3AFPA 3Q8DA 3UDFA 3GDEA 1N34L 2E5LL 3PIPA 3HFZB 5IP9H 2Q2HA 3CAMA 1XTDA 3F1ZA 1KAWA 2BA0A 2R7FA 4NXNL 4C3IH 2MO0A 5ELOA 4DV5L 4DR6Q 2OQ0A 4DR3Q 3HOXH 2V1CC 2QA4A 4B3MQ 3H3VI 4X65Q 1SLJA 2I5HA 1N8RC 4DPGA 4QGUA 1VQBA 3J80i 4B3SL 5FLMH 5LMNL 3KJPA 4LFAQ 3J7ZC 1EQRA 1YJNA 2UUBL 3K8AA 4A3DH 2JQOA 4Y52H 3LGJA 4WJ3M 2JA7H 2N3SA 4DV6L 3CD6A 4ME3A 4BY1H 4DAMA 2CCZA 2ID0A 4PMWA 4B3RL 1GO3E 4QIWE 1XPRA 1HR0Q 1V9PA 4OX9Q 1JJCB 3CCSA 4HJ7A 1HNWQ 3GTJH 4BBRG 5IE8A 3DLLA 4HIKA 4JI7L 1JB7A 1FJGL 3GTQH 5J3BA 4JI5L 2JA8H 1A0IA 4A3MH 1V43A 1YZ6A 2IT1A 1N34Q 3HOZH 2E5LQ 2VW9A 3U58A 1YJWA 2K50A 1KD1C 1JMCA 4LF6L 3RLFA 3ICEA 2K52A 4DR5Q 2WFWA 2K5NA 4A3CG 5ELNA 2K5VA 2OQKA 3TQYA 4POFA 2Q2TA 3CW2C 1CKMA 1EUJA 4JI6Q 3E9IA 2R92H 4AQYL 2CWPA 2OCEA 3PUWA 4GOPB 1X65A 2JK8A 3ERSX 1A8VA 2I0QA 4LF7L 1WCMH 3MEFA 2ALYB 3KLWA 3GTPH 3D31A 3AEVA 2VY3A 3L2PA 1VQ7A 1SR3A 2UUCL 4A3EH 3HOWH 5LMNW 2YV5A 3ULJA 1PH1A 1XMQQ 2UU9L 2E2IH 1KL9A 1UEBA 2VNUD 3S1RH 4IO9A 2GN5A 1UE7A 4IOAA 1WFQA 2ZTEA 1BKBA 3EIVA 1XJVA 1TWHH 2HQLA 2N49A 2HIXA 3K0XA 4PZ7A 4LF4L 3KYHC 1Q8KA 2K5HA 1L2FA 4P75A 1JJGA 1Q12A 3A0JA 3OTOL 5GROA 4P73A 5C4XH 1VQKA 3SGIA 3PUXA 3JC66 2WAQE 3WWVA 5M3FH 4KHPL 3M4QA 5BR8Q 3I4MG 4KHPQ 4NXNQ 4A3JG 4X66Q 1QVGA 1HNXQ 1CKNA 1X56A 4DNIA 3M85A 4A3FG 2WAQG 3KJOA 2MQHA 1N36L 4JC0A 1VQGA 1J5EL 4JI0L 3M4OH 1KXLA 1XNRL 2JA8G 2JJQA 1XMOL 4LF8Q 4AH6A 2ZJQA 3FP9A 5IYBH 4JV5Q 2Z6KA 3GTMH 2B3GA 1QZHA 3MXNB 2CKZB 4JI4L 3E9HA 4AYBG 2EQSA 2WB1E 4JCVE 5GADC 5IP7H 1E1TA 3I7FA 1MJEA 2UUCQ 4YY3L 2RF4A 1X6OA 3TREA 4B3RQ 2RHSB 1GM5A 4P74A 2Z0SA 5IYBG 3CCQA 2KHIA 2MO1A 3H15A 2B29A 1HNZQ 4IJHA 4DR2L 3T1YL 4JI3Q 5EAYA 2ES2A 1K3RA 4LUVA 4JI2L 4DV0Q 4DUZQ 1CSQA 2D62A 2AHOB 3GD7A 4QL5A 2LXKA 4X64Q 4JOIC 1Y1WG 4LFCQ 1J5EQ 4BBRH 4NB3A 1H95A 3L7ZC 3GTOH 1E1OA 4IPCA 3B6YA 1OXVA 4GN5A 5C0XG 2ZTDA 4UY8C 1YHBA 4YCWA 3KFUA 2Q2IA 1DGSA 4JI6L 1PYBA 2D0OA 3H0GH 2PMZE 4JI1Q 4IJLA 3H0GG 4TVAB 3KDFB 4XTCS 1HH2P 3G6EA 1M1KC 5M5XH 4DV7Q 3CP0A 3ULPA 4YHHQ 3CCJA 1I94Q 4DAYB 3CCEA 5IWAQ 3JAMi 2L15A 3PO3H 3PO3G 3I2ZA 4JI4Q 4KI0A 4DR4Q 1VQHA 4LW1A 3T1YQ 1TXYA 4HJAA 1PH9A 1XNQQ 4DR4L 4R4IA 3KF8B 3W1BA 1WCMG 4JI7Q 2R93G 2ZM6L 1VQCA 2QGQA 4MTNA 4TQUS 4EX5A 4LF6Q 1OTCA 3CMAA 1B7YB 4AIMA 1LUZA 3PCOB 1E7ZA 2LXJA 2ZJPA 4K0KQ 5GAGC 2D0PA 2A1AA 3RLOA 5HGQA 2R7ZH 4AQYQ 2E8GA 5C3EG 3CCMA 4BXXG 5FJ8G 5LMUQ 3ZJYC 3U4ZA 4LFBQ 2KHJA 1XNRQ 1VQ6A 3UE1A 1MJCA 5IT9c 2YYZA 4LFBL 2KENA 3RN5A 3UE0A 1C7YA 1K8GA 4POGA 1HZBA 1YI2A 1N32L 4UP7A 1S40A 1C9OA 1Q81C 1IBML 4GOPC 4A93G 3F2BA 3CF5A 3S17H 2H5XA 2EIFA 1VCIA 1WOCA 1CKOA 1PH2A 1TWAH 1FJGQ 1W2BA 1QVFA 4GNXC 2UXDQ 2RHQB 1L1OC 3GTGH 2UXDL 2AKWB 1VQAA 4AYBE 2ZM6Q 4JBJA 3A5UA 4DV6Q 2JE6I 1CSPA 4YCUA 4HJ8A 2NN6G 3UDXA 1XNQL 4OO1G 1VQ4A 3PF4A 1IYJB 1IZ6A 4GKKQ 4HJ5A 3HOVG 3HOVH 4YWLA 4DV1Q 2EXDA 3NENA 4DR1Q 1VS0A 3HOZG 2UXBL 2Q2UA 2KCMA 2CQOA 2ASBA 2VL6A 4IFDJ 1LYLA 2GVAA 5LMUL 1YVCA 3A5ZB 1SRUA 1UE1A 2HIVA 4A3GG 1N33L 2JA6G 1PHJA 4LF5Q 4BY1G 3PO2H 3HOWG 2JA5H 3HOYG 3FKIH 1KRSA 3K80C 2I5MX 4R4TA 4A93H 1HR0W 1K0RA 4OO1I 4DUYL 3BZKA 5HY6A 3I56A 3CCVA 4WJ4A 1QUQA 4A3EG 1YJ9A 3KF6B 4BBSH 4UP8A 2VUMH 2DGYA 3DM3A 1BVSA 1PH8A 2UU9Q 4JI5Q 2WP8J 3CXCA 3CCLA 3K7AH 5K36G 1X3GA 1U5KA 2C35B 2IHEA 2JEAI 2VQFQ 2A8VA 3S2HH 4A4IA 4DR3L 1ASZA 3IRBA 5C4XG 2NN6I 2F4VL 3J80c 3U4VA 4DV2Q 4A3CH 3FHWA 1GD7A 1EFWA 4JV5L 2BA1A 1VQLA 1AE3A 1I5FA 5GQOA 2K14A 3CMEA 1PH3A 1JE5A 1EYGA 3M3YH 1D7QA 1QVCA 2IX0A 4A3IG 1PH5A 2NVQH 3T1HL 4GLAC 4HIDA 3TS0A 1JJ2A 2B63G 5C4JH 4BBSG 2IY5B 3T1HQ 3U50C 3EN2A 1PA6A 4A3BG 2UUAL 3PUYA 3CPWA 1AE2A 1X54A 3D0FA 4C2MH 3S24A 3M7NA 4IPHA 3PIOA 1PV4A 4L5RC 2UXCQ 3PF5A 2UXCL 4IFDI 1IBLQ 2BH8A 1HR0L 2JA7G 1GVPA 1N9WA 4NPSA 3PGZA 3RZOH 2LSSA 2N78A 1YITA 1EQQA 1K9MC 2VZAA 2JA6H 1UE5A 3S1MH 1SFOH 4A3GH 3PSIA 2R92G 2I5LX 2JEBI 3ER0A 1EIFA 3BJUA 3E0EA 3S1QH 4C3JH 1Q7YC 1Q86C 1OXUA 4KHZA 4GN3B 4DR2Q 1V1QA 4LUOA 3J81c 1HZ9A 3GO5A 2FXQA 5IY0A 2R7DA 4RMFA 1R9TH 1C0AA 1PH7A 4JYAQ 4A3LG 2AWOA 3S2DH 5C0XJ 3S1NH 1N36Q 1QZGA 3M4PA 4JI0Q 3CPFA 3TS2A 4JBWA 5M5WH 4X62L 1HJPA 4DK6C 1YIJA 4GNXA 4LF7Q 3G48A 4LF5L 4EQ5A 5M3MG 3S14H 5C44H 1PFSA 4LFCL 2PI2E 5JEAG 4YWKA 3GTLH 1HZCA 4DV4L 4NXMQ 3PO2G 1YHQA 3KOJA 1KHIA 4DK3C 4B3SQ 4PZ8A 1SN8A 3F2DA 4ALPA 2K4KA 5IYCH 1P8LA 4LF4Q 1TWGH 1S72A 4FDBA 5FLMG 1I3QH 4OONA 4UPAA 5JJLA 1NE3A 4A3IH 1U0LA 2NVXH 5FJ8H 4JBKA 4R4OA 1PVOA 1NTGA 4A3FH 1LM0A 1OXXK 2OWOA 3G71A 4OWWB 2VQFL 1TWFH 4A3JH 4O0AA 5GAHC 2F3IA 2ZJRA 4OWTB 1MIUA 2OTLA 5JJKA 1IXRA 3F2CA 3JAMc 2IX1A 3AQQA 2HHHL 4DR7L 3KF6A 4MNOA 4JI2Q 1SE8A 3NBHB 1XPOA 3HOUH 2CWAA 3NEMA 1N32Q 1L0WA 2PQAA 2AMCB 4JOIA 3CCUA 4APVA 2Y0SE 3HKZG 5LMNQ 4A3MG 4Y7NH 1XMOQ 4LF8L 4LUZA 1I50H 4B3TQ 3J81i 4A3DG 4DV7L 2NZHA 2Y0SG 3HKZE 4JI8Q 3K81C 4DV3Q 3OW2A 1HNWL 3FKIG 4H02A 1KQSA 1NBWA 2PI2A 4QY7A 3CCRA 1X55A 2IHFA 3J7A5 1J6QA 2VQEQ 1Q1BA 1M90C 5M3MH 1RIPA 3CC7A 1IL2A 5M5YH 2VS1A 3I4NH 1VQIA 2E2HH 3HOXG 4IFDG 3UDGA 2HHHQ 4DR7Q 3H3VH 4R1JA 1FL0A 5BR8L 2F4VQ 1Q82C 1Q46A 4RG1A 4DV2L 2HT1A 1TWCH 3NELA 4K0KL 5IP9G 1X9NA 4IPGA 2PNHA 4LWCA 1BBUA 3I4NG 4DV5Q 4DR6L 4R4QA 1E22A 4X66L 1NMGA 1IBKL 1HNXL 1E24A 2UXBQ 1X3FA
chains in the Genus database with same CATH superfamily
1SNOA 4JBMA 2FINB 2K75A 1TY0A 2L1BA 5IWAL 1EZ8A 4GOPA 1A62A 1Y1WH 1HCZA 1RL2A 2KEEA 4DV3L 4A75A 2PZUA 3RLNA 1VQ9A 1KRTA 2Z4HA 5JVG3 3I4MH 5C44B 4RH6A 3RZDB 3J7AF 1F77A 3J81E 2FFKB 3DMUA 4XXEA 5AJ3Q 5IP7G 1VQNA 1TS3A 1WI5A 3HGBA 4DF7A 2BH2A 3OYYA 2R6GA 2NVTH 1VQJA 5FLXL 2R7ZB 4P71A 3KDFA 1IBLL 5FLXc 3AU7A 3EA6A 3F8TA 3K59A 1WJJA 3M3YB 2JA9A 3OMCA 2RSOA 3VA7A 3PV0A 4BS9A 4DV1L 1UE6A 1E3PA 4YWMA 3AYHB 2MNAA 3W1GA 2K33A 5AFWA 1VQ8A 2N88A 1CUKA 4LK1C 3RN2A 2KVMA 4KMUC 1EWIA 1G291 3M9BA 1K73C 4R4CA 1TIID 1Y8NB 2XIWA 4JYAL 5KGUA 4MZ9A 2EYMA 4BA2I 4NP5A 5IYDH 1PFBA 1G8ZD 4L5SA 2VQEL 1MI2A 4RWSC 4F87A 4DV4Q 3PUVA 1D8LA 4YY3Q 4BY7H 4A3LH 3CQZH 3L0OA 4ILWA 2KBNA 1H9SB 4DNTB 1VQOA 1NJIC 3R2TA 3OTOQ 1S5CD 4KLKA 2FJ2A 2B8FA 1F9PA 1E2VA 2RSNA 2QILA 3Q6SA 1HHVA 2F0TA 4LFAL 4CDCC 3TZUA 1N33Q 3I70A 2VUMB 3VDYA 1RHPA 4GLVB 1H9JA 3W5OA 1PZJD 4JI1L 1HZAA 4KY6A 3M4YA 3P75A 4HCEA 4GNXB 1VQ5A 5IGEA 3DWAA 1B70B 1X3EA 2CQAA 1VQDA 4RHRA 4E6IA 1K8MA 2MFIA 4DU9A 5JEAH 5H1SE 1R9TB 2QDBA 1DONA 3BG3A 5D3DA 3UDFA 3S1RB 3HOWB 2E5LL 1HA5A 2WACA 4IUUA 1KAWA 3D8GA 4C3IH 5ELOA 3T16A 4CJ1B 5T1GA 2QA4A 3MA2B 2JYOA 3EROA 1SLJA 4QGUA 2F0JA 2ICEC 5FLMH 5LMNL 2UUBL 4WJ3M 2F0EA 2O4XA 4DV6L 2BDNA 4BY1H 2CCZA 1BO0A 2B2UA 1F9SA 5IGFA 1EY8A 1HR0Q 4BBRB 1V9PA 2ZXRA 3GP7A 4HJ7A 4BBRG 3D4RA 4A3MH 3LWUA 1YJWA 2K50A 1PRTC 1WTQA 5CBAE 2EYHA 4LF6L 1O7ZA 5D65A 2K5NA 5ELNA 2F0VA 1MD2D 4CBVA 2Q2TA 2NVTB 1SNMA 5L37A 4AQYL 2OCEA 1X65A 2JK8A 2I0QA 1WCMH 1M8AA 3AEVA 3TP7A 4WORA 2UUCL 1KDAA 4A3EH 1BNZA 2E2IH 1KL9A 5C6AA 1UEBA 2VNUD 2XSCA 2A69D 2GN5A 4IO9A 4IOAA 1XJVA 4PZ7A 2EY2A 4P75A 1Q8KA 2K5HA 1L2FA 5GROA 4P73A 4RCOA 3JC66 2WAQE 5BR8Q 1PRTD 4X66Q 1CI3M 1CKNA 5DM63 1ZYRC 2WAQG 2MQHA 1N36L 4JC0A 2HQEA 4G7OC 1XNRL 2A6EC 3BS1A 4N8FA 2B3GA 3RZOB 1IW7D 1TWCB 4CKBA 2WB1E 5IP7H 1E1TA 3VR6A 2UUCQ 4YY3L 2RF4A 1X6OA 2A6HC 4B3RQ 1GM5A 4KY7A 2Z0SA 2F0MA 1HNZQ 4O42A 4IJHA 4NMZA 1ENFA 2F0PA 2AQ1B 1JC7A 3EQLC 3KLRA 1JOQA 4JI2L 4LUVA 2OT2A 4DUZQ 1DZ1A 2D62A 2AHOB 3ZYYX 1O7LA 4M1UB 1H95A 3GTOH 2F0SA 1E1OA 1PTOH 5TSSA 1EOTA 2LY7A 4JI1Q 2D0OA 1GUOA 3KDFB 1HH2P 1HQRD 2Q8RE 1B9MA 3A7LA 3I2ZA 3GTOB 3C1EA 1EQVA 4KI0A 1RTNA 1AW7A 4HJAA 1L0YB 1BCPC 2SDFA 3KF8B 5BN5A 2R93G 1PFNA 1EY0A 1STBA 1U4RA 1MSGA 4B08A 4K0KQ 3QG1A 5GAGC 1V1PA 1U4PA 2BOSA 3FPPA 1DM0B 2R61A 5FJ8G 1EY6A 1FNWA 2KHJA 1PYWD 1C48A 1C7YA 3MXGA 3SE0A 1K8GA 1HZBA 2I07B 4IUQA 1N32L 1Q81C 1EWCA 1R4QB 5J22A 2XN9C 3MXUA 1CKOA 1DCZA 3GTGH 1DOLA 4DV6Q 2JE6I 1CSPA 4OO1G 2NN6G 5I2YA 4IZ8A 1XWEA 4YWLA 2EYFA 4DV1Q 3OW7A 3NTHA 3HOZG 2Q2UA 2ASBA 4IFDJ 1AN8A 5EQ0A 1QILA 1YVCA 3WDNA 4A3GG 3KBGA 5FO8B 5I4DA 2NTTA 1PHJA 4LF5Q 4BY1G 3PO2H 3HOWG 1RF2D 3HOYG 5EJWA 2WIIB 1FNUA 1H9KA 4PQXA 3BZKA 1D1IA 1QUQA 1YJ9A 2VUMH 1U4MA 2O5JC 3CXCA 1A15A 5M9OA 1EIHA 1SNDA 2A8VA 1IYUA 1JR0D 3NTKA 3ND8A 2F4VL 2CVRA 1QNKA 1GD7A 1EFWA 4JV5L 1VQLA 1I5FA 2K14A 2PPBC 3TS0A 1JJ2A 1VF7A 3S16B 5C4JH 4BBSG 4MN3A 1EU3A 4A3BG 1PA6A 3A8IE 3D0FA 1ZEQX 4FF2A 4IPHA 4K5XA 4ULLA 3PF5A 2UXCL 1IBLQ 2JA7G 1GVPA 1N9WA 3MFGA 3PGZA 2EVBA 1YITA 1K9MC 3S1MH 1UE5A 2F0HA 1SFOH 1CFMA 1JWSD 3PSIA 3KLSA 3M4OB 1OXUA 3D3RA 2QCPX 1PTOC 2FXQA 3PIO3 2R7DA 3S2DH 2K5DA 2K7VA 4U673 4IFDH 5M5WH 4Q0FA 4ID6A 3G48A 3OIPA 3RUZA 5M3MG 3S14H 5C44H 1PFSA 2AUKA 4NXMQ 3DWQA 1RKNA 2X6LA 1KHIA 4CDFC 4B3SQ 3F2DA 1P8LA 1TWGH 4I65A 3I90A 1SMYD 2RVLA 4OONA 3IFDA 5JJLA 2G9HD 4A3IH 5FJ8H 3JAME 5EBDA 1R4PB 1NTGA 1Y1VB 1OXXK 4OWWB 1I3QB 2SNSA 2ZJRA 2K04A 4OWTB 5JJKA 1HA6A 1IXRA 3AQQA 1Q8IA 1PTOD 1XPOA 3V2TA 2F3VA 2IWHA 1N32Q 2PQAA 4JOIA 3CCUA 4UDUC 1V8QA 2L55A 3HKZG 5LMNQ 2JA8B 1I4HA 4K8JA 1B44D 4A3DG 3E6ZX 5C4XB 3C3LA 3HKZE 4JI8Q 2B2YA 3K5LA 4DV3Q 1HTPA 1KQSA 4QY7A 3CCRA 1X55A 4B9WA 2IHFA 1M90C 1PTOB 1RIPA 4ODGA 5LL6X 1EY9A 2EY1A 1EIGA 4QUCA 1LT4D 1SNCA 1VQIA 4IALA 2DN8A 4DR7Q 3H3VH 1UUPA 2F4VQ 1Q82C 2LS01 3PO2B 5IP9G 1I6HB 3SXHA 1LTSD 3I4NG 4X66L 2HD3A 4DNRB 3NP8A 5AJ3L 4HR7B 1YEZA 1LABA 1I4PA 1FYCA 1K83H 1STGA 2K32A 5IGBA 2RCNA 3K7UC 3STBC 4HMIA 4ZYSA 2O2LD 2EZVA 1HUNA 2RCFA 1DYQA 2J7ZA 4PZ6A 2VXWA 4AYBB 1Y1VG 1KIXA 4XYQA 4HSVA 4XYOA 2YTXA 2AQ3B 3GTQB 1Y1WB 1EU4A 1Q1EA 2N8NA 4F8MA 4A3FB 4KD3A 4IOCA 3I55A 1WTVA 4GN4B 1AEXA 2EJMA 4HJ9A 2XGTA 1LACA 2AWNA 4WRDA 1L1OB 4DAYA 2MGSA 4O2DA 1AZPA 4QQBX 2K03A 1WCMB 4V190 1ASYA 2BE5D 4Z9CB 3L3OC 5CV5A 3STBD 1Z47A 4DR1L 4K6DA 4C2MB 4QJFA 1X32A 2D5DA 2L12A 3AFQA 5ISRA 5M5XB 1II3A 3H0GB 1QWYA 5D3IB 3S15H 2JA7B 4X65L 1Y14B 4BY7G 4B3TL 3T56B 3SK5A 4A3MB 1BR9A 3O13A 1VQMA 4DAPA 1SMXA 5E7NA 1BBWA 1WYDA 2KA7A 4JG2A 5A2QE 1QUQB 1S3OA 4GS3A 1GKHA 4IUPA 2DJFC 1STNA 5T1IA 3UDIA 4NXML 4ZRZA 4K5VA 4RGTA 1VQEA 3G4SA 5CORA 1S5FD 4KV6A 4N9TA 2L11A 2KCTA 2CFMA 4G4KA 1EZ6A 2EYJA 2ZTCA 4GKKL 4JI3L 3BU2A 1CTMA 3FRPB 4HIMA 2UUBQ 1DXMA 5DAUA 1Z9FA 5DLQE 1PFMA 3P1HA 3A7AB 4A76A 2NZOA 4CJ0B 3ITPA 1FR3A 5JEAJ 1B50A 1MSHA 5JJIA 1BOSA 1Q3LA 5C0XI 2JA5G 1PYSB 5DNFA 2K5WA 3AFPA 2E2IB 4EVOA 2VB3X 1Z6HA 3HFZB 4HAEA 3A8JE 3MWYW 2Q2HA 3CAMA 3F1ZA 1A2TA 3A8KE 2NVXB 2OQ0A 2V1CC 4B3MQ 5C3XA 3NUCA 1ICFB 4A3IB 1N8RC 1BUVT 3J7ZC 3LGJA 5KNBA 4KJNA 3ONAB 2N3SA 3CD6A 3NQIA 1PRTF 2ID0A 3WOEA 4B3RL 4K8IA 4QIWE 2EJGC 3D6CA 1OO9B 3GTQH 4JI5L 2NUCA 2JA8H 4BY1B 1V43A 2IT1A 1N34Q 3HOZH 2VW9A 4QIWB 2LKVA 3ICEA 1ZKOA 2K52A 4DR5Q 4A3CG 2K5VA 1ILPA 2F0WA 1CKMA 2BDOA 4RKBA 5CV7A 3S1QB 2R92H 4A3GB 3PUWA 4GOPB 3ERSX 1A8VA 3MEFA 3GTPH 3D31A 2G5DA 1VQ7A 5LMNW 2YV5A 1I6VC 5CGKA 1WFQA 1LTAD 3EIVA 5E4WC 2B2TC 1TWHH 2HQLA 3LWEA 3SK4A 3K0XA 2G9DA 2HIXA 3KBXA 2WV6D 3KYHC 2EJFC 1JJGA 1Q12A 5DEHA 2SEBD 1STHA 3OTOL 3DUZA 3GTMB 3K5OA 3PMFA 5M3FH 4KHPL 1JB3A 3NWSA 4KHPQ 4ZQ3A 4NXNQ 3S9WA 1X56A 4DNIA 3M85A 4A3FG 4XQNA 1Y8OB 3M4OH 1XMOL 5IYBH 1QZHA 5IT9L 3S1MB 3MXNB 3I4LA 2A69C 4JCVE 2MJ8A 3TSSA 2KECA 4K6LA 3TREA 3MAQA 3CCQA 1TS2A 3NBHA 2YU9B 5ELDA 3VA5A 1BCPD 3T1YL 3R3OA 4XT3B 4DV0Q 1BQQT 1PZID 3UI2A 3GD7A 2E75C 3I4NB 4CHTB 1TWGB 2PZTA 2QKIC 4GN5A 2A68D 1YHBA 2Q2IA 3F2UA 1C8CA 3IL8A 4N9PA 4F88A 3G6EA 4TVAB 3H0GG 1M1KC 1VDZA 2PW5A 3AB9A 2TMPA 3NBIA 4DAYB 5C3WA 3JAMi 3RD4A 4FXKC 5J1ZA 4L8JA 4C1NK 3T1YQ 1TXYA 2QGQA 4EX5A 5E1FA 4LF6Q 5JVH3 3CMAA 1OTCA 1JE4A 1LUZA 1GOZA 2RQXA 2ZJPA 2A1AA 4A3EB 3RMHA 4AQYQ 2E8GA 1PXUA 4KY5A 1D5XC 4BXXG 2EYPA 3U4ZA 1VQ6A 1BCPF 4H7BA 2GA4B 1TU2B 3WOFA 2K01A 2SOBA 2PO4A 1C9OA 4A93G 3DHQA 1PLFA 3CF5A 3S17H 4ZAIA 2L5TA 1WOCA 2Z4IA 3PQIA 1TWAH 4KKUA 4K5WA 2PQEA 5I2XA 1RDPD 1VF5C 2AKWB 1NAPA 1VQAA 4AYBE 4JBJA 1E2ZA 2BCOA 1ENCA 3T4AC 3TP8A 1XNQL 3NXWA 1ML0D 2CW0D 2WINB 4ZUIA 1HFNA 5IODA 3HOVH 4DR1Q 2B2WA 3NENA 1SYFA 2AUJD 5FO9B 2KCMA 3CRLC 2MPMA 2WKDA 1LYLA 5LMUL 1TY2A 4FXGC 2FMCA 3A5ZB 4C3HB 2HIVA 1D5ZC 1N33L 3HOYB 2KQ3A 1T5XD 2JA6B 1AP0A 2N55A 4A93H 4OIKA 1K0RA 3I56A 3CCVA 4WJ4A 3KF6B 4BBSH 4UP8A 2H1EA 3DM3A 1BVSA 1PH8A 4JI5Q 3QOLA 4FO2A 2HCIA 4JVZA 2CH4A 1U5KA 2C35B 2JEAI 3S2HH 3IRBA 5C4XG 2NN6I 2A5HA 3H91A 2E2JB 4A3CH 3MZ5A 1I50B 3FHWA 3I3CA 5EKLA 1QJOA 1AE3A 1HUMA 3CMEA 1QE6A 2IX0A 4QF4A 1PH5A 2B63G 4KK7A 3U50C 2NYZD 2DNEA 3CPWA 1X54A 3M7NA 2KEDA 3OWFA 1SYGA 3S24A 4C2MH 2UXCQ 4L5RC 2IJ0A 4PMBA 1PTOF 1Y8PB 1HR0L 1U4LA 5ELCA 2N78A 1EQQA 2JA6H 1U9RA 4FP5D 5G3LD 1K8OA 2I5LX 2JEBI 3ER0A 2KJXA 2IL8A 5KNCA 1Q86C 3NTIA 4GN3B 1SE2A 3GO5A 5C3EB 1TR5A 3S1NH 1ZYRD 2Z1CA 3FEWX 5ELFA 4LMQD 1QZGA 4JI0Q 3TS2A 5JPMC 4DK6C 1EY4A 3GTKB 4EQNA 4LF7Q 3X3NA 4RFBA 1SJED 3HRZC 4YWKA 3GTLH 2Z9HA 2EE1A 3MC0B 4IN3A 3PO2G 1A6XA 1K0SA 5ELEA 4DK3C 3NWTA 4PZ8A 4LF4Q 4FDBA 5FLMG 4A3JB 1ZXTA 4IUVA 1EL0A 3K6OA 1NE3A 4TSSA 4G7HC 1NNXA 4KHVA 2SNMA 3URYA 2DY7A 1LM0A 4FF4A 2OEOA 2VQFL 2X6GA 2JN4A 2OTLA 3DEPA 4DR7L 3KF6A 1SE8A 3SDZA 3OSOA 2JP1A 4KN7C 2CWAA 1EY5A 3HOUH 1L0WA 2AMCB 5G3LF 4APVA 4Y7NH 5M3FB 1J9OA 2NZHA 2Y0SG 5LHY1 4OELB 3VYSA 3FKIG 4H02A 1NBWA 1I4RA 3J7A5 1LV9A 5M5YH 5KRUA 2E2HH 2HHHQ 2IW3A 2HT1A 1Q46A 1XX8A 5C4HA 1C4QA 1X9NA 1EY7A 2KCCA 4IPGA 4BY7B 4LAAA 1BBUA 4DV5Q 5CV6A 4R4QA 4S3SA 4WJWA 1IBKL 2E76C 2UXBQ 1IKLA 1SYEA 1E2WA 2ZXPA 2O5IC 1YNXA 5COYA 4F7XA 3HOVB 2EDGA 3I73A 5CV9A 1TT2A 1TS4A 1W6KA 1D5MC 2LMCB 2B2TA 4R8NA 1FVIA 2QW7A 2B63H 1UWVA 2YTVA 4A3DB 1F9QA 1VQFA 3L9AX 3S14B 1KTKA 1SROA 4DUZL 1L0XB 1VMCA 3H09A 1W3SA 4K2KA 5HGTA 1Y1VH 1OXTA 1XMQL 2RDGA 3I4OA 1KC8C 1ET9A 5GAEC 4A3KG 3BVZA 4DFAA 2E74C 1STAA 2A68C 3FMCA 3KLSX 4OX9L 4YCVA 5A2QL 4N8X1 3GTPB 3RR5A 3HOUG 5M3FG 1NY4A 1NR2A 1SE4A 4C1NI 1PH6A 2BE5C 3EBEA 1S4ZA 4MTKA 5IIFA 1FNVA 1BDOA 1HTLD 3HEJA 3TBIB 1EQTA 2DUDA 2R93H 3GTLB 4X64L 3JAML 1D6EC 4LNQA 4NDXA 3G6JB 2YTYA 4IURA 4A3KH 3HOXB 4J1MA 1RTOA 4J15A 1XPUA 2YU9H 1NMFA 4DKAC 3A74A 1CKNB 1CK1A 4OXPA 1EIYB 2M2LA 2QEXA 3TP5A 1I6HH 4I7ZC 3S16H 4NW2A 5NUCA 4CKCA 4HCSA 3I8ZA 3W3AA 3AMUA 4HIOA 2FMMA 2WB1B 4DV0L 3CC2A 4XT1B 1OXSC 3TEHB 1MKHA 1IBKQ 2OTJA 2WAQB 5K36H 4B3ML 1CA6A 4ME5A 2E2JH 4A3BH 1IBMQ 3MXNA 2B2VA 2A19A 1EOVA 2F0OA 4H13C 4IQZA 3I72A 2R93B 1G51A 2ZT9C 1CT1D 4M8AA 4YIJA 3VR2A 1I94L 3TDQA 5I6YA 2HDLA 1N34L 2CW0C 4KKSA 3NK9A 3PIPA 2IPKD 5IP9H 2QDLA 2D2CC 2A73B 1XTDA 4NXNL 1QNUA 2BA0A 5C4ZA 4FF3A 4DV5L 3HOXH 4X3SA 3BDCA 3DXJC 4X65Q 2F0UA 4DPGA 3J80i 3BZDB 3EVQA 1YJNA 1EQRA 1WTWA 3K8AA 4Y52H 4WFN3 4OL7A 2B2YC 4NKLA 1SJHD 4PMWA 1GO3E 1XPRA 1JJCB 1YNJD 3CCSA 1HNWQ 4DN4M 1JQYD 3GTJH 3DLLA 4JI7L 5JOBA 2K05A 3NE5B 1YZ6A 4L6TB 4R9WA 4QB4A 1KABA 1KD1C 3J7YW 1SEBD 3CHBD 4POFA 3TQYA 1EUJA 4JI6Q 3E9IA 1EYDA 3DM1A 3IAYA 1H9MA 1IHZA 3ERQA 2ALYB 3IKJA 3KLWA 5BN4A 1SR3A 3VR5A 2FHTA 2F4IA 2M00A 4KN4C 1XMQQ 1LTBD 4HN7A 3W2DA 5DM73 1BKBA 1HPCA 4QUFA 1EEID 5JPNC 2N49A 2RBMA 4LF4L 3E5SA 4CGYB 4B9XA 3A0JA 2F0FA 4JPBW 1VQKA 5C4XH 3PUXA 3WWVA 5FKAC 3M4QA 3J80E 3I4MG 3GTGB 3NHHA 4OHJA 4FNFA 3K5MA 4JI0L 3KK7A 2EY5A 3TMEA 4LF8Q 2AQ2B 2Z6KA 4FYDA 2C9OA 2J4XA 1AFPA 1MJEA 3GV6A 1NSNS 2RHSB 4P74A 5IYBG 1GHJA 1SDFA 3FDTA 3LX0A 4DR2L 4FXDA 4JI3Q 5EAYA 2ES2A 1CSQA 1H9SA 4QL5A 2LXKA 4X64Q 1Y1WG 4LFCQ 1J5EQ 3L7ZC 1LLRD 4IPCA 3J7AV 1OXVA 2ZTDA 4UY8C 3KFUA 3S15B 1DGSA 2A74C 1PYBA 3H0GH 4IJLA 4BBSB 5M5XH 3DWPA 4C3JB 1EEFD 4YHHQ 5IGDA 3CCJA 3CCEA 5IWAQ 2DNCA 2L15A 3PO3G 4JI4Q 4DR4Q 3CRKC 4LW1A 1YNNC 2MHVA 1XNQQ 4JK1C 4DR4L 1Q90A 4R4IA 3W1BA 4EQOA 3FKIB 4RCNA 3D4WA 3HG9A 1VQCA 1WD1A 1DD2A 3A56A 4AIMA 1JORA 3PCOB 1B1ZA 1E7ZA 1QCBD 1I4QA 3P7JA 3RLOA 2F0DA 3NQTA 3SEBA 3U9SA 5LMUQ 2RA4A 3ZJYC 1XNRQ 3UE1A 5IT9c 2E2HB 2KENA 1XTCD 3RN5A 3UE0A 5HURA 1ET6A 1YI2A 5M5YB 1IBML 5E3FA 4GOPC 1PDQA 3PIP3 1IW7C 1F2LA 2OF1A 2H5XA 2EIFA 1MBYA 1FJGQ 2RHQB 1L1OC 3Q24A 2UXDL 2F0KA 1EFID 2ZM6Q 3VYUA 2XRQD 4A3BB 4YCUA 3UDXA 4PNYA 2EOTA 1IYJB 1IZ6A 3HOVG 1S5DD 4Y7NB 2UXBL 1VS0A 2M9VA 2VL6A 2GVAA 2HCCA 1SRUA 1UE1A 2JSOA 1MGSA 2JA6G 2JA5H 5C5LA 3K80C 3LNNA 4DXGA 1SNPA 3P20A 4R4TA 1JWUD 1HR0W 2I46A 1UEAB 4DUYL 5HY6A 1CHQD 5F2DA 5KIXA 1LT5D 2UU9Q 3CCLA 5K5PA 1F2MA 2IHEA 3J80L 4C3JG 2MP1A 5EGTA 4A4IA 4DR3L 1ASZA 4PMCA 2Y0SB 4A93B 1B53A 3MHBA 5GQOA 1D7QA 2XWBB 1QVCA 3TN2A 4A3IG 3E0JA 2NVQH 3T1HL 4KJOA 1H9RA 2F0IA 5I9PA 5CBEE 3MVVA 3T1HQ 3Q23A 3EN2A 3NSWA 4CDDC 1KDBA 5FLXE 1LTGD 1UNSA 1ESFA 1E0BA 2BH8A 1WVLA 2VZAA 1JCKB 2JA5B 4A3GH 2F1MA 2R92G 3S1QH 3N6RA 4C3JH 3J81L 3R93A 1J8IA 1Q7YC 4KHZA 4DR2Q 1V1QA 4LUOA 4Q5VA 2F0NA 1R9TH 1C0AA 4HTHA 2RDHA 3M7GA 2WKCA 2Z6BA 2NN6H 3M4PA 1F2ZA 1HJPA 1XYIA 1YIJA 4GNXA 4LF5L 3R2IA 5EBCA 4EQ5A 2NWGA 4LFCL 1HZCA 1TWHB 2ZXOA 1SAPA 5C0XH 1GUGA 5KEEA 2B2VC 4ALPA 4RHSA 5IYCH 5JJZA 2F03A 1S72A 1LT3D 5CC4A 3MXPA 1X3QA 4J6HA 1GXDC 4JBKA 4C3IB 1PMRA 4R4OA 1PVOA 1SSOA 3EFXD 4A3JH 2E2DC 2B2WC 3H94A 1QOHA 2F3IA 1MIUA 2CHBD 3Q0AA 3VR4A 3F2CA 4CJ2C 2HHHL 4MNOA 4JI2Q 1BF4A 3NBHB 3NEMA 1WTXA 1HXYD 2B63B 5JAVA 1EWHA 2PW7A 4A3MG 1XMOQ 4EGVA 1G2SA 5FK9C 4DV7L 1ILQA 5FO7B 3K81C 1WTRA 1DOKA 3D4DA 4DAVA 2B39A 5C5MA 4MHEA 2PI2A 2HUGA 1RCVD 1M4VA 2VQEQ 3I91A 5IT9E 1ESRA 2EPBA 1GJXA 1O78A 3CC7A 2HDMA 4K14A 3HOXG 1G91A 1MHWC 3UDGA 1O80A 2XRSD 1WTOA 4R1JA 1FL0A 5BR8L 2TSSA 4RG1A 1KLUD 2RKSA 5CV8A 3QO2A 4H0LC 2PNHA 4DR6L 1E22A 4C3HG 1NMGA 1E24A 1TVXA 1S5BD 4G57A 1K28A 5HGQA 1TWFB 1TKWB 1SYDA 1SBBB 3EJIA 2Z8LA 2QF7A 1JWMD 4PG3A 5M5WB 4BA1I 3K57A 3S2DB 3RZDH 1HNZL 4L5QA 2F52A 2NVYH 2R7ZG 1IYVA 4RGOS 4GKJL 2Z6KC 3K58A 4HSPA 4LF9L 2NZ1D 4XIGS 1VQPA 1RJTA 2K28A 4LF9Q 3T53B 3BDLA 5LL6S 1B2TA 3NPPA 3ULLA 2VUMG 2GVBA 4GLXA 3ND9A 2LFNA 1L1OA 1HQMC 5I9OA 1LTLA 4JI8L 2UUAQ 1YNND 1CQFA 2XTIA 4BXXH 1BBXC 1T5EA 4GKJQ 3BZCA 4IPDA 1JT8A 4OEMB 1ONLA 1Z7TA 1HFGA 3S17B 2K1BA 2P5ZX 5A35A 4L5TA 2PMZB 2XNAC 3SK8A 3QOJA 3KF8A 3TRZA 1T9HA 4HEDA 5EPLA 3HKSA 5IYDG 4YHHL 1LT6D 4IUNA 3BYYB 3TP6A 3CC4A 3HOUB 2C5CA 2PQAB 1V1PB 1SE3A 2ICIA 1EYAA 2F3WA 1A3TA 1FGUA 3QR8A 4X6AH 1B9NA 4A3KB 4OWXB 4DR5L 3J81j 3PO3B 2WB1G 1G6PA 4UP9A 4P72A 4X3KA 1I4GA 2XWJB 3RNUA 4C56C 4X62Q 2NBFA 1K8AC 1A63A 2JXMB 5CR3A 5C44G 1P16A 1I4XA 3N52A 4LJZC 2L0CA 3GTKH 5IYCG 1YHAA 2PYKA 1B8AA 3S1NB 1O7IA 3OIQA 1YBYA 5E4XA 4UHVA 1FD7D 1IL8A 5IGGA 5C3EH 1HRJA 4EQPA 3GV3A 4DUYQ 2ATWA 3HOYH 3BVMA 3PUZA 1PH4A 4C3HH 4OIJA 3Q8DA 1AH9A 3GDEA 4DGZA 5KYIA 1S5ED 1AZQA 3VR3A 2V4DA 2R7FA 2MO0A 4DR6Q 4DR3Q 1QB5D 2QEJC 3H3VI 2I5HA 1VQBA 4B3SL 2X69A 1A3VA 1B3QA 3VYTA 3KJPA 4LFAQ 4A3DH 2F0GA 2JQOA 3E3XA 5IGCA 3QWNA 2PNRC 1G6ZA 2JA7H 4X3UA 1BCPB 4UAIA 4K2LA 4ME3A 4DAMA 4IUTA 1NCVA 2EYOA 4OX9Q 1FJGL 5IE8A 4HIKA 1D2BA 1LTTD 2DY8A 1D1KA 1JB7A 1PZKD 5J3BA 5FOBB 4FF1A 1A0IA 3TZDA 4ABNA 2E5LQ 3SK6A 3U58A 1JMCA 2VB2X 4DXFA 2J0TD 1G2TA 3RLFA 4PV1C 2WFWA 2OQKA 3MEHA 3CW2C 3QIAA 1SFOB 2CWPA 3OOCA 4LF7L 3G7LA 2VY3A 3L2PA 2K6AA 3HOWH 2PZWA 3ULJA 1PH1A 2UU9L 1WTHA 4MIUA 1SYCA 3S1RH 1UE7A 1YNJC 3VYRA 2ZTEA 3Q22A 3H6MA 3U9OA 2NVQB 3OWEB 4ZKCB 1B4OA 4L63B 1SMYC 3K0YA 1KDCA 3SGIA 2H4OA 1SYBA 4A3JG 4DA2A 3K7AB 1QVGA 1HNXQ 1ICWA 3T51B 3C46A 1TWAB 3KJOA 5CV4A 4V0BA 1J5EL 1VQGA 1KXLA 1NUCA 1RODA 2JJQA 2JA8G 4R8IA 4AH6A 2ZJQA 3FP9A 4JV5Q 3GTMH 2NTSA 1UAPA 4J8QA 1Y69U 2CKZB 4JI4L 3E9HA 4AYBG 2EQSA 3C1FA 3GQBA 5GADC 3I7FA 1QG7A 3A55A 2F0LA 2KHIA 2MO1A 3H15A 2B29A 5C4JB 1KAAA 3DEOA 4G7ZC 1K3RA 1CA5A 3K5NA 3CU7A 4RKLA 4OO1H 4JOIC 4BBRH 4NB3A 2B2UC 3B6YA 4GZYC 5M3MB 5C0XG 4YCWA 4JI6L 2NVYB 1NR4A 2PMZE 5D14A 4XTCS 4KKTA 4DV7Q 3CP0A 3SR1A 3ULPA 3HOZB 1I94Q 3PO3H 4O1NA 1CM9A 1VQHA 5J39A 1PH9A 3BVGA 1WCMG 1K83B 3T13A 4JI7Q 2ZM6L 4TQUS 4MTNA 2R92B 1B7YB 3MTSA 4CKEA 2IX3A 2LXJA 5CYUA 4ZCKA 1CHPD 2D0PA 2R7ZH 2EY6A 1GUNA 1JOOA 5C3EG 3CCMA 2EYLA 1PRTB 1CQVA 4LFBQ 1MJCA 2KUMA 1GUSA 2YYZA 4LFBL 1STYA 1CZGA 4POGA 4CDEC 1F9RA 4UP7A 1S40A 3F2BA 2Q8TA 1PH2A 3H3VC 1VCIA 1QVFA 3R8BA 2UXDQ 1W2BA 4GNXC 2Q8IB 4QMGA 5BN3A 3A5UA 1LTID 2ENBA 4HJ8A 2F0QA 1VQ4A 1RD9D 3PF4A 1W6JA 1X3PA 4GKKQ 4HJ5A 4H44C 4TKOB 3OMGA 2EXDA 1KNAA 2CQOA 1KNEA 1SXTA 4DK1A 2NB0A 5KNDA 2CH4W 3FKIH 1KRSA 3KUPA 2I5MX 1GHKA 5CMDA 4TRDA 2L4NA 4OO1I 4ZLTF 4U68A 1JOKA 4A3EG 1F2YA 2DGYA 2R3ZA 2WP8J 5IOCA 3K7AH 5K36G 1GUWA 1X3GA 2VQFQ 1TS5A 1B3AA 2PCFB 3J80c 3U4VA 5KYLA 4DV2Q 2MUYA 2BA1A 4ZK9B 3S2HB 2KCNA 1EYGA 1PH3A 2XVSA 3M3YH 1JE5A 1JICA 1STEA 3OHXC 5ELBA 4GLAC 4HIDA 1EYCA 1GUTA 2IY5B 3BYTB 4OGQC 4ZKBB 2UUAL 3PUYA 1TQOA 3FVQA 1AE2A 5EKIA 3PIOA 3FPUB 4ZUJA 1PV4A 4RA8A 4IFDI 4XQJA 3CQZB 4NPSA 3RZOH 2LSSA 3X3MA 1FGBD 1EIFA 3BJUA 3E0EA 2DJGC 3BDOA 1V1OA 3J81c 1HZ9A 5IY0A 3QJYA 4RMFA 3OPOA 1PH7A 4JYAQ 4A3LG 2AWOA 5C0XJ 1N36Q 1BXTA 3CPFA 4JW0A 3V96A 3QB3A 2EXZA 4JBWA 4X62L 1SNQA 4KD4A 3HP3A 4QCLA 5JEAG 2PI2E 3SVMA 1O7YA 4DV4L 5I6WA 1YHQA 3KOJA 1IKMA 1CZWA 1SN8A 1KLGD 2K4KA 4FVMA 3MFYA 1I3QH 4UPAA 2B8GA 2L9HA 1LO5D 4BWGB 1U0LA 2NVXH 1VMPA 1LTRD 4XQQA 4A3FH 2OWOA 3G71A 1TWFH 1K3BC 4O0AA 5GAHC 1DOMA 3SHLA 2D9UA 3JAMc 2IX1A 2A6ED 1DJRD 4HMJA 3C2PA 3IFTA 5EKKA 3HS0C 3D6WA 4X3TA 1XXGA 4RGMA 3HKZB 2Y0SE 4RGNA 4RAUC 2RDFA 4LF8L 4LUZA 1WD0A 1A2UA 1I50H 4B3TQ 3J81i 3GTJB 1WTPA 4XDXA 2A6HD 4P2CB 5EPKA 1ENAA 3OW2A 3I4MB 4DK0A 3CKIB 1HNWL 2K5QA 5EPJA 4C3IG 1J6QA 1Q1BA 1A3UA 5M3MH 1IL2A 2OXPA 2VS1A 3I4NH 3V05A 4IFDG 3HZXA 4DV2L 4KTAA 4K0KL 1TWCH 3NELA 2KOLA 3A54A 2KHSA 4LWCA 1HNXL 4I7AA 1X3FA
chains in the Genus database with same CATH topology
5AJ3L 4JBMA 1YNXA 1YEZA 2K75A 1K83H 5IWAL 4GOPA 1A62A 2RCNA 3K7UC 4PG3A 1Y1WH 3STBC 1RL2A 4BA1I 4DV3L 1FVIA 4A75A 3RLNA 3RZDH 4PZ6A 1HNZL 4L5QA 1VQ9A 1KRTA 2F52A 2B63H 1UWVA 1Y1VG 1KIXA 2NVYH 2YTVA 2R7ZG 1VQFA 3I4MH 4GKJL 1SROA 4DUZL 2YTXA 2Z6KC 4LF9L 4XIGS 5AJ3Q 1VQPA 4LF9Q 1Q1EA 1W3SA 2N8NA 5IP7G 1Y1VH 1OXTA 1VQNA 1WI5A 1XMQL 2BH2A 4IOCA 3I55A 3OYYA 3I4OA 3ULLA 2R6GA 1KC8C 4GN4B 1VQJA 2GVBA 5GAEC 4A3KG 2NVTH 2VUMG 4HJ9A 2XGTA 4P71A 4GLXA 3KDFA 1IBLL 5FLXc 1L1OA 2AWNA 1L1OB 1LTLA 3F8TA 4JI8L 2UUAQ 1WJJA 4O2DA 4OX9L 4YCVA 4QQBX 2XTIA 2JA9A 3RR5A 1ASYA 4BXXH 3STBD 3HOUG 5M3FG 1NY4A 4GKJQ 1Z47A 3PV0A 3BZCA 4DV1L 4DR1L 1UE6A 3EBEA 1E3PA 4YWMA 4QJFA 1PH6A 3AYHB 2MNAA 4IPDA 3AFQA 3W1GA 1VQ8A 1JT8A 1CUKA 3RN2A 1EWIA 3S15H 1G291 4X65L 2DUDA 3M9BA 4L5TA 2R93H 1Y14B 1K73C 4R4CA 4X64L 4BY7G 4B3TL 4LNQA 1VQMA 2YTYA 4JYAL 1SMXA 4MZ9A 4A3KH 5E7NA 4BA2I 1BBWA 1WYDA 3TRZA 1T9HA 4JG2A 5IYDH 1QUQB 4J15A 1XPUA 3HKSA 5IYDG 1S3OA 4GS3A 4YHHL 1GKHA 2YU9H 1NMFA 4DKAC 4L5SA 3A74A 1CKNB 4OXPA 2VQEL 3CC4A 1EIYB 2QEXA 3UDIA 3PUVA 4DV4Q 2PQAB 4NXML 1D8LA 4YY3Q 1I6HH 3S16H 1VQEA 3G4SA 4BY7H 4A3LH 1FGUA 3CQZH 3L0OA 1VQOA 2KBNA 2KCTA 1NJIC 4X6AH 3OTOQ 4OWXB 2CFMA 4DR5L 3J81j 4KLKA 4HIOA 2WB1G 1G6PA 2ZTCA 4DV0L 3CC2A 4UP9A 4P72A 4GKKL 1OXSC 4JI3L 3BU2A 1MKHA 3TEHB 4HIMA 2UUBQ 4LFAL 3RNUA 1IBKQ 2OTJA 1N33Q 4X62Q 3VDYA 1Z9FA 1K8AC 1A63A 5DLQE 4B3ML 5C44G 4GLVB 3W5OA 1P16A 4JI1L 4A76A 1HZAA 2NZOA 2E2JH 3GTKH 1IBMQ 5JEAJ 4A3BH 5IYCG 1YHAA 2A19A 1B8AA 1EOVA 4GNXB 1VQ5A 5JJIA 1O7IA 1YBYA 1B70B 1X3EA 1VQDA 2MFIA 1G51A 5H1SE 5C3EH 2ATWA 5C0XI 4DUYQ 1PYSB 1I94L 2JA5G 3HOYH 3PUZA 1AH9A 1PH4A 4C3HH 3AFPA 3Q8DA 3UDFA 3GDEA 1N34L 2E5LL 3PIPA 3HFZB 5IP9H 2Q2HA 3CAMA 1XTDA 3F1ZA 1KAWA 2BA0A 2R7FA 4NXNL 4C3IH 2MO0A 5ELOA 4DV5L 4DR6Q 2OQ0A 4DR3Q 3HOXH 2V1CC 2QA4A 4B3MQ 3H3VI 4X65Q 1SLJA 2I5HA 1N8RC 4DPGA 4QGUA 1VQBA 3J80i 4B3SL 5FLMH 5LMNL 3KJPA 4LFAQ 3J7ZC 1EQRA 1YJNA 2UUBL 3K8AA 4A3DH 2JQOA 4Y52H 3LGJA 4WJ3M 2JA7H 2N3SA 4DV6L 3CD6A 4ME3A 4BY1H 4DAMA 2CCZA 2ID0A 4PMWA 4B3RL 1GO3E 4QIWE 1XPRA 1HR0Q 1V9PA 4OX9Q 1JJCB 3CCSA 4HJ7A 1HNWQ 3GTJH 4BBRG 5IE8A 3DLLA 4HIKA 4JI7L 1JB7A 1FJGL 3GTQH 5J3BA 4JI5L 2JA8H 1A0IA 4A3MH 1V43A 1YZ6A 2IT1A 1N34Q 3HOZH 2E5LQ 2VW9A 3U58A 1YJWA 2K50A 1KD1C 1JMCA 4LF6L 3RLFA 3ICEA 2K52A 4DR5Q 2WFWA 2K5NA 4A3CG 5ELNA 2K5VA 2OQKA 3TQYA 4POFA 2Q2TA 3CW2C 1CKMA 1EUJA 4JI6Q 3E9IA 2R92H 4AQYL 2CWPA 2OCEA 3PUWA 4GOPB 1X65A 2JK8A 3ERSX 1A8VA 2I0QA 4LF7L 1WCMH 3MEFA 2ALYB 3KLWA 3GTPH 3D31A 3AEVA 2VY3A 3L2PA 1VQ7A 1SR3A 2UUCL 4A3EH 3HOWH 5LMNW 2YV5A 3ULJA 1PH1A 1XMQQ 2UU9L 2E2IH 1KL9A 1UEBA 2VNUD 3S1RH 4IO9A 2GN5A 1UE7A 4IOAA 1WFQA 2ZTEA 1BKBA 3EIVA 1XJVA 1TWHH 2HQLA 2N49A 2HIXA 3K0XA 4PZ7A 4LF4L 3KYHC 1Q8KA 2K5HA 1L2FA 4P75A 1JJGA 1Q12A 3A0JA 3OTOL 5GROA 4P73A 5C4XH 1VQKA 3SGIA 3PUXA 3JC66 2WAQE 3WWVA 5M3FH 4KHPL 3M4QA 5BR8Q 3I4MG 4KHPQ 4NXNQ 4A3JG 4X66Q 1QVGA 1HNXQ 1CKNA 1X56A 4DNIA 3M85A 4A3FG 2WAQG 3KJOA 2MQHA 1N36L 4JC0A 1VQGA 1J5EL 4JI0L 3M4OH 1KXLA 1XNRL 2JA8G 2JJQA 1XMOL 4LF8Q 4AH6A 2ZJQA 3FP9A 5IYBH 4JV5Q 2Z6KA 3GTMH 2B3GA 1QZHA 3MXNB 2CKZB 4JI4L 3E9HA 4AYBG 2EQSA 2WB1E 4JCVE 5GADC 5IP7H 1E1TA 3I7FA 1MJEA 2UUCQ 4YY3L 2RF4A 1X6OA 3TREA 4B3RQ 2RHSB 1GM5A 4P74A 2Z0SA 5IYBG 3CCQA 2KHIA 2MO1A 3H15A 2B29A 1HNZQ 4IJHA 4DR2L 3T1YL 4JI3Q 5EAYA 2ES2A 1K3RA 4LUVA 4JI2L 4DV0Q 4DUZQ 1CSQA 2D62A 2AHOB 3GD7A 4QL5A 2LXKA 4X64Q 4JOIC 1Y1WG 4LFCQ 1J5EQ 4BBRH 4NB3A 1H95A 3L7ZC 3GTOH 1E1OA 4IPCA 3B6YA 1OXVA 4GN5A 5C0XG 2ZTDA 4UY8C 1YHBA 4YCWA 3KFUA 2Q2IA 1DGSA 4JI6L 1PYBA 2D0OA 3H0GH 2PMZE 4JI1Q 4IJLA 3H0GG 4TVAB 3KDFB 4XTCS 1HH2P 3G6EA 1M1KC 5M5XH 4DV7Q 3CP0A 3ULPA 4YHHQ 3CCJA 1I94Q 4DAYB 3CCEA 5IWAQ 3JAMi 2L15A 3PO3H 3PO3G 3I2ZA 4JI4Q 4KI0A 4DR4Q 1VQHA 4LW1A 3T1YQ 1TXYA 4HJAA 1PH9A 1XNQQ 4DR4L 4R4IA 3KF8B 3W1BA 1WCMG 4JI7Q 2R93G 2ZM6L 1VQCA 2QGQA 4MTNA 4TQUS 4EX5A 4LF6Q 1OTCA 3CMAA 1B7YB 4AIMA 1LUZA 3PCOB 1E7ZA 2LXJA 2ZJPA 4K0KQ 5GAGC 2D0PA 2A1AA 3RLOA 5HGQA 2R7ZH 4AQYQ 2E8GA 5C3EG 3CCMA 4BXXG 5FJ8G 5LMUQ 3ZJYC 3U4ZA 4LFBQ 2KHJA 1XNRQ 1VQ6A 3UE1A 1MJCA 5IT9c 2YYZA 4LFBL 2KENA 3RN5A 3UE0A 1C7YA 1K8GA 4POGA 1HZBA 1YI2A 1N32L 4UP7A 1S40A 1C9OA 1Q81C 1IBML 4GOPC 4A93G 3F2BA 3CF5A 3S17H 2H5XA 2EIFA 1VCIA 1WOCA 1CKOA 1PH2A 1TWAH 1FJGQ 1W2BA 1QVFA 4GNXC 2UXDQ 2RHQB 1L1OC 3GTGH 2UXDL 2AKWB 1VQAA 4AYBE 2ZM6Q 4JBJA 3A5UA 4DV6Q 2JE6I 1CSPA 4YCUA 4HJ8A 2NN6G 3UDXA 1XNQL 4OO1G 1VQ4A 3PF4A 1IYJB 1IZ6A 4GKKQ 4HJ5A 3HOVG 3HOVH 4YWLA 4DV1Q 2EXDA 3NENA 4DR1Q 1VS0A 3HOZG 2UXBL 2Q2UA 2KCMA 2CQOA 2ASBA 2VL6A 4IFDJ 1LYLA 2GVAA 5LMUL 1YVCA 3A5ZB 1SRUA 1UE1A 2HIVA 4A3GG 1N33L 2JA6G 1PHJA 4LF5Q 4BY1G 3PO2H 3HOWG 2JA5H 3HOYG 3FKIH 1KRSA 3K80C 2I5MX 4R4TA 4A93H 1HR0W 1K0RA 4OO1I 4DUYL 3BZKA 5HY6A 3I56A 3CCVA 4WJ4A 1QUQA 4A3EG 1YJ9A 3KF6B 4BBSH 4UP8A 2VUMH 2DGYA 3DM3A 1BVSA 1PH8A 2UU9Q 4JI5Q 2WP8J 3CXCA 3CCLA 3K7AH 5K36G 1X3GA 1U5KA 2C35B 2IHEA 2JEAI 2VQFQ 2A8VA 3S2HH 4A4IA 4DR3L 1ASZA 3IRBA 5C4XG 2NN6I 2F4VL 3J80c 3U4VA 4DV2Q 4A3CH 3FHWA 1GD7A 1EFWA 4JV5L 2BA1A 1VQLA 1AE3A 1I5FA 5GQOA 2K14A 3CMEA 1PH3A 1JE5A 1EYGA 3M3YH 1D7QA 1QVCA 2IX0A 4A3IG 1PH5A 2NVQH 3T1HL 4GLAC 4HIDA 3TS0A 1JJ2A 2B63G 5C4JH 4BBSG 2IY5B 3T1HQ 3U50C 3EN2A 1PA6A 4A3BG 2UUAL 3PUYA 3CPWA 1AE2A 1X54A 3D0FA 4C2MH 3S24A 3M7NA 4IPHA 3PIOA 1PV4A 4L5RC 2UXCQ 3PF5A 2UXCL 4IFDI 1IBLQ 2BH8A 1HR0L 2JA7G 1GVPA 1N9WA 4NPSA 3PGZA 3RZOH 2LSSA 2N78A 1YITA 1EQQA 1K9MC 2VZAA 2JA6H 1UE5A 3S1MH 1SFOH 4A3GH 3PSIA 2R92G 2I5LX 2JEBI 3ER0A 1EIFA 3BJUA 3E0EA 3S1QH 4C3JH 1Q7YC 1Q86C 1OXUA 4KHZA 4GN3B 4DR2Q 1V1QA 4LUOA 3J81c 1HZ9A 3GO5A 2FXQA 5IY0A 2R7DA 4RMFA 1R9TH 1C0AA 1PH7A 4JYAQ 4A3LG 2AWOA 3S2DH 5C0XJ 3S1NH 1N36Q 1QZGA 3M4PA 4JI0Q 3CPFA 3TS2A 4JBWA 5M5WH 4X62L 1HJPA 4DK6C 1YIJA 4GNXA 4LF7Q 3G48A 4LF5L 4EQ5A 5M3MG 3S14H 5C44H 1PFSA 4LFCL 2PI2E 5JEAG 4YWKA 3GTLH 1HZCA 4DV4L 4NXMQ 3PO2G 1YHQA 3KOJA 1KHIA 4DK3C 4B3SQ 4PZ8A 1SN8A 3F2DA 4ALPA 2K4KA 5IYCH 1P8LA 4LF4Q 1TWGH 1S72A 4FDBA 5FLMG 1I3QH 4OONA 4UPAA 5JJLA 1NE3A 4A3IH 1U0LA 2NVXH 5FJ8H 4JBKA 4R4OA 1PVOA 1NTGA 4A3FH 1LM0A 1OXXK 2OWOA 3G71A 4OWWB 2VQFL 1TWFH 4A3JH 4O0AA 5GAHC 2F3IA 2ZJRA 4OWTB 1MIUA 2OTLA 5JJKA 1IXRA 3F2CA 3JAMc 2IX1A 3AQQA 2HHHL 4DR7L 3KF6A 4MNOA 4JI2Q 1SE8A 3NBHB 1XPOA 3HOUH 2CWAA 3NEMA 1N32Q 1L0WA 2PQAA 2AMCB 4JOIA 3CCUA 4APVA 2Y0SE 3HKZG 5LMNQ 4A3MG 4Y7NH 1XMOQ 4LF8L 4LUZA 1I50H 4B3TQ 3J81i 4A3DG 4DV7L 2NZHA 2Y0SG 3HKZE 4JI8Q 3K81C 4DV3Q 3OW2A 1HNWL 3FKIG 4H02A 1KQSA 1NBWA 2PI2A 4QY7A 3CCRA 1X55A 2IHFA 3J7A5 1J6QA 2VQEQ 1Q1BA 1M90C 5M3MH 1RIPA 3CC7A 1IL2A 5M5YH 2VS1A 3I4NH 1VQIA 2E2HH 3HOXG 4IFDG 3UDGA 2HHHQ 4DR7Q 3H3VH 4R1JA 1FL0A 5BR8L 2F4VQ 1Q82C 1Q46A 4RG1A 4DV2L 2HT1A 1TWCH 3NELA 4K0KL 5IP9G 1X9NA 4IPGA 2PNHA 4LWCA 1BBUA 3I4NG 4DV5Q 4DR6L 4R4QA 1E22A 4X66L 1NMGA 1IBKL 1HNXL 1E24A 2UXBQ 1X3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 L;  4JBM A;  1YNX A;  1YEZ A;  2K75 A;  1K83 H;  5IWA L;  4GOP A;  1A62 A;  2RCN A;  3K7U C;  4PG3 A;  1Y1W H;  3STB C;  1RL2 A;  4BA1 I;  4DV3 L;  1FVI A;  4A75 A;  3RLN A;  3RZD H;  4PZ6 A;  1HNZ L;  4L5Q A;  1VQ9 A;  1KRT A;  2F52 A;  2B63 H;  1UWV A;  1Y1V G;  1KIX A;  2NVY H;  2YTV A;  2R7Z G;  1VQF A;  3I4M H;  4GKJ L;  1SRO A;  4DUZ L;  2YTX A;  2Z6K C;  4LF9 L;  4XIG S;  5AJ3 Q;  1VQP A;  4LF9 Q;  1Q1E A;  1W3S A;  2N8N A;  5IP7 G;  1Y1V H;  1OXT A;  1VQN A;  1WI5 A;  1XMQ L;  2BH2 A;  4IOC A;  3I55 A;  3OYY A;  3I4O A;  3ULL A;  2R6G A;  1KC8 C;  4GN4 B;  1VQJ A;  2GVB A;  5GAE C;  4A3K G;  2NVT H;  2VUM G;  4HJ9 A;  2XGT A;  4P71 A;  4GLX A;  3KDF A;  1IBL L;  5FLX c;  1L1O A;  2AWN A;  1L1O B;  1LTL A;  3F8T A;  4JI8 L;  2UUA Q;  1WJJ A;  4O2D A;  4OX9 L;  4YCV A;  4QQB X;  2XTI A;  2JA9 A;  3RR5 A;  1ASY A;  4BXX H;  3STB D;  3HOU G;  5M3F G;  1NY4 A;  4GKJ Q;  1Z47 A;  3PV0 A;  3BZC A;  4DV1 L;  4DR1 L;  1UE6 A;  3EBE A;  1E3P A;  4YWM A;  4QJF A;  1PH6 A;  3AYH B;  2MNA A;  4IPD A;  3AFQ A;  3W1G A;  1VQ8 A;  1JT8 A;  1CUK A;  3RN2 A;  1EWI A;  3S15 H;  1G29 1;  4X65 L;  2DUD A;  3M9B A;  4L5T A;  2R93 H;  1Y14 B;  1K73 C;  4R4C A;  4X64 L;  4BY7 G;  4B3T L;  4LNQ A;  1VQM A;  2YTY A;  4JYA L;  1SMX A;  4MZ9 A;  4A3K H;  5E7N A;  4BA2 I;  1BBW A;  1WYD A;  3TRZ A;  1T9H A;  4JG2 A;  5IYD H;  1QUQ B;  4J15 A;  1XPU A;  3HKS A;  5IYD G;  1S3O A;  4GS3 A;  4YHH L;  1GKH A;  2YU9 H;  1NMF A;  4DKA C;  4L5S A;  3A74 A;  1CKN B;  4OXP A;  2VQE L;  3CC4 A;  1EIY B;  2QEX A;  3UDI A;  3PUV A;  4DV4 Q;  2PQA B;  4NXM L;  1D8L A;  4YY3 Q;  1I6H H;  3S16 H;  1VQE A;  3G4S A;  4BY7 H;  4A3L H;  1FGU A;  3CQZ H;  3L0O A;  1VQO A;  2KBN A;  2KCT A;  1NJI C;  4X6A H;  3OTO Q;  4OWX B;  2CFM A;  4DR5 L;  3J81 j;  4KLK A;  4HIO A;  2WB1 G;  1G6P A;  2ZTC A;  4DV0 L;  3CC2 A;  4UP9 A;  4P72 A;  4GKK L;  1OXS C;  4JI3 L;  3BU2 A;  1MKH A;  3TEH B;  4HIM A;  2UUB Q;  4LFA L;  3RNU A;  1IBK Q;  2OTJ A;  1N33 Q;  4X62 Q;  3VDY A;  1Z9F A;  1K8A C;  1A63 A;  5DLQ E;  4B3M L;  5C44 G;  4GLV B;  3W5O A;  1P16 A;  4JI1 L;  4A76 A;  1HZA A;  2NZO A;  2E2J H;  3GTK H;  1IBM Q;  5JEA J;  4A3B H;  5IYC G;  1YHA A;  2A19 A;  1B8A A;  1EOV A;  4GNX B;  1VQ5 A;  5JJI A;  1O7I A;  1YBY A;  1B70 B;  1X3E A;  1VQD A;  2MFI A;  1G51 A;  5H1S E;  5C3E H;  2ATW A;  5C0X I;  4DUY Q;  1PYS B;  1I94 L;  2JA5 G;  3HOY H;  3PUZ A;  1AH9 A;  1PH4 A;  4C3H H;  3AFP A;  3Q8D A;  3UDF A;  3GDE A;  1N34 L;  2E5L L;  3PIP A;  3HFZ B;  5IP9 H;  2Q2H A;  3CAM A;  1XTD A;  3F1Z A;  1KAW A;  2BA0 A;  2R7F A;  4NXN L;  4C3I H;  2MO0 A;  5ELO A;  4DV5 L;  4DR6 Q;  2OQ0 A;  4DR3 Q;  3HOX H;  2V1C C;  2QA4 A;  4B3M Q;  3H3V I;  4X65 Q;  1SLJ A;  2I5H A;  1N8R C;  4DPG A;  4QGU A;  1VQB A;  3J80 i;  4B3S L;  5FLM H;  5LMN L;  3KJP A;  4LFA Q;  3J7Z C;  1EQR A;  1YJN A;  2UUB L;  3K8A A;  4A3D H;  2JQO A;  4Y52 H;  3LGJ A;  4WJ3 M;  2JA7 H;  2N3S A;  4DV6 L;  3CD6 A;  4ME3 A;  4BY1 H;  4DAM A;  2CCZ A;  2ID0 A;  4PMW A;  4B3R L;  1GO3 E;  4QIW E;  1XPR A;  1HR0 Q;  1V9P A;  4OX9 Q;  1JJC B;  3CCS A;  4HJ7 A;  1HNW Q;  3GTJ H;  4BBR G;  5IE8 A;  3DLL A;  4HIK A;  4JI7 L;  1JB7 A;  1FJG L;  3GTQ H;  5J3B A;  4JI5 L;  2JA8 H;  1A0I A;  4A3M H;  1V43 A;  1YZ6 A;  2IT1 A;  1N34 Q;  3HOZ H;  2E5L Q;  2VW9 A;  3U58 A;  1YJW A;  2K50 A;  1KD1 C;  1JMC A;  4LF6 L;  3RLF A;  3ICE A;  2K52 A;  4DR5 Q;  2WFW A;  2K5N A;  4A3C G;  5ELN A;  2K5V A;  2OQK A;  3TQY A;  4POF A;  2Q2T A;  3CW2 C;  1CKM A;  1EUJ A;  4JI6 Q;  3E9I A;  2R92 H;  4AQY L;  2CWP A;  2OCE A;  3PUW A;  4GOP B;  1X65 A;  2JK8 A;  3ERS X;  1A8V A;  2I0Q A;  4LF7 L;  1WCM H;  3MEF A;  2ALY B;  3KLW A;  3GTP H;  3D31 A;  3AEV A;  2VY3 A;  3L2P A;  1VQ7 A;  1SR3 A;  2UUC L;  4A3E H;  3HOW H;  5LMN W;  2YV5 A;  3ULJ A;  1PH1 A;  1XMQ Q;  2UU9 L;  2E2I H;  1KL9 A;  1UEB A;  2VNU D;  3S1R H;  4IO9 A;  2GN5 A;  1UE7 A;  4IOA A;  1WFQ A;  2ZTE A;  1BKB A;  3EIV A;  1XJV A;  1TWH H;  2HQL A;  2N49 A;  2HIX A;  3K0X A;  4PZ7 A;  4LF4 L;  3KYH C;  1Q8K A;  2K5H A;  1L2F A;  4P75 A;  1JJG A;  1Q12 A;  3A0J A;  3OTO L;  5GRO A;  4P73 A;  5C4X H;  1VQK A;  3SGI A;  3PUX A;  3JC6 6;  2WAQ E;  3WWV A;  5M3F H;  4KHP L;  3M4Q A;  5BR8 Q;  3I4M G;  4KHP Q;  4NXN Q;  4A3J G;  4X66 Q;  1QVG A;  1HNX Q;  1CKN A;  1X56 A;  4DNI A;  3M85 A;  4A3F G;  2WAQ G;  3KJO A;  2MQH A;  1N36 L;  4JC0 A;  1VQG A;  1J5E L;  4JI0 L;  3M4O H;  1KXL A;  1XNR L;  2JA8 G;  2JJQ A;  1XMO L;  4LF8 Q;  4AH6 A;  2ZJQ A;  3FP9 A;  5IYB H;  4JV5 Q;  2Z6K A;  3GTM H;  2B3G A;  1QZH A;  3MXN B;  2CKZ B;  4JI4 L;  3E9H A;  4AYB G;  2EQS A;  2WB1 E;  4JCV E;  5GAD C;  5IP7 H;  1E1T A;  3I7F A;  1MJE A;  2UUC Q;  4YY3 L;  2RF4 A;  1X6O A;  3TRE A;  4B3R Q;  2RHS B;  1GM5 A;  4P74 A;  2Z0S A;  5IYB G;  3CCQ A;  2KHI A;  2MO1 A;  3H15 A;  2B29 A;  1HNZ Q;  4IJH A;  4DR2 L;  3T1Y L;  4JI3 Q;  5EAY A;  2ES2 A;  1K3R A;  4LUV A;  4JI2 L;  4DV0 Q;  4DUZ Q;  1CSQ A;  2D62 A;  2AHO B;  3GD7 A;  4QL5 A;  2LXK A;  4X64 Q;  4JOI C;  1Y1W G;  4LFC Q;  1J5E Q;  4BBR H;  4NB3 A;  1H95 A;  3L7Z C;  3GTO H;  1E1O A;  4IPC A;  3B6Y A;  1OXV A;  4GN5 A;  5C0X G;  2ZTD A;  4UY8 C;  1YHB A;  4YCW A;  3KFU A;  2Q2I A;  1DGS A;  4JI6 L;  1PYB A;  2D0O A;  3H0G H;  2PMZ E;  4JI1 Q;  4IJL A;  3H0G G;  4TVA B;  3KDF B;  4XTC S;  1HH2 P;  3G6E A;  1M1K C;  5M5X H;  4DV7 Q;  3CP0 A;  3ULP A;  4YHH Q;  3CCJ A;  1I94 Q;  4DAY B;  3CCE A;  5IWA Q;  3JAM i;  2L15 A;  3PO3 H;  3PO3 G;  3I2Z A;  4JI4 Q;  4KI0 A;  4DR4 Q;  1VQH A;  4LW1 A;  3T1Y Q;  1TXY A;  4HJA A;  1PH9 A;  1XNQ Q;  4DR4 L;  4R4I A;  3KF8 B;  3W1B A;  1WCM G;  4JI7 Q;  2R93 G;  2ZM6 L;  1VQC A;  2QGQ A;  4MTN A;  4TQU S;  4EX5 A;  4LF6 Q;  1OTC A;  3CMA A;  1B7Y B;  4AIM A;  1LUZ A;  3PCO B;  1E7Z A;  2LXJ A;  2ZJP A;  4K0K Q;  5GAG C;  2D0P A;  2A1A A;  3RLO A;  5HGQ A;  2R7Z H;  4AQY Q;  2E8G A;  5C3E G;  3CCM A;  4BXX G;  5FJ8 G;  5LMU Q;  3ZJY C;  3U4Z A;  4LFB Q;  2KHJ A;  1XNR Q;  1VQ6 A;  3UE1 A;  1MJC A;  5IT9 c;  2YYZ A;  4LFB L;  2KEN A;  3RN5 A;  3UE0 A;  1C7Y A;  1K8G A;  4POG A;  1HZB A;  1YI2 A;  1N32 L;  4UP7 A;  1S40 A;  1C9O A;  1Q81 C;  1IBM L;  4GOP C;  4A93 G;  3F2B A;  3CF5 A;  3S17 H;  2H5X A;  2EIF A;  1VCI A;  1WOC A;  1CKO A;  1PH2 A;  1TWA H;  1FJG Q;  1W2B A;  1QVF A;  4GNX C;  2UXD Q;  2RHQ B;  1L1O C;  3GTG H;  2UXD L;  2AKW B;  1VQA A;  4AYB E;  2ZM6 Q;  4JBJ A;  3A5U A;  4DV6 Q;  2JE6 I;  1CSP A;  4YCU A;  4HJ8 A;  2NN6 G;  3UDX A;  1XNQ L;  4OO1 G;  1VQ4 A;  3PF4 A;  1IYJ B;  1IZ6 A;  4GKK Q;  4HJ5 A;  3HOV G;  3HOV H;  4YWL A;  4DV1 Q;  2EXD A;  3NEN A;  4DR1 Q;  1VS0 A;  3HOZ G;  2UXB L;  2Q2U A;  2KCM A;  2CQO A;  2ASB A;  2VL6 A;  4IFD J;  1LYL A;  2GVA A;  5LMU L;  1YVC A;  3A5Z B;  1SRU A;  1UE1 A;  2HIV A;  4A3G G;  1N33 L;  2JA6 G;  1PHJ A;  4LF5 Q;  4BY1 G;  3PO2 H;  3HOW G;  2JA5 H;  3HOY G;  3FKI H;  1KRS A;  3K80 C;  2I5M X;  4R4T A;  4A93 H;  1HR0 W;  1K0R A;  4OO1 I;  4DUY L;  3BZK A;  5HY6 A;  3I56 A;  3CCV A;  4WJ4 A;  1QUQ A;  4A3E G;  1YJ9 A;  3KF6 B;  4BBS H;  4UP8 A;  2VUM H;  2DGY A;  3DM3 A;  1BVS A;  1PH8 A;  2UU9 Q;  4JI5 Q;  2WP8 J;  3CXC A;  3CCL A;  3K7A H;  5K36 G;  1X3G A;  1U5K A;  2C35 B;  2IHE A;  2JEA I;  2VQF Q;  2A8V A;  3S2H H;  4A4I A;  4DR3 L;  1ASZ A;  3IRB A;  5C4X G;  2NN6 I;  2F4V L;  3J80 c;  3U4V A;  4DV2 Q;  4A3C H;  3FHW A;  1GD7 A;  1EFW A;  4JV5 L;  2BA1 A;  1VQL A;  1AE3 A;  1I5F A;  5GQO A;  2K14 A;  3CME A;  1PH3 A;  1JE5 A;  1EYG A;  3M3Y H;  1D7Q A;  1QVC A;  2IX0 A;  4A3I G;  1PH5 A;  2NVQ H;  3T1H L;  4GLA C;  4HID A;  3TS0 A;  1JJ2 A;  2B63 G;  5C4J H;  4BBS G;  2IY5 B;  3T1H Q;  3U50 C;  3EN2 A;  1PA6 A;  4A3B G;  2UUA L;  3PUY A;  3CPW A;  1AE2 A;  1X54 A;  3D0F A;  4C2M H;  3S24 A;  3M7N A;  4IPH A;  3PIO A;  1PV4 A;  4L5R C;  2UXC Q;  3PF5 A;  2UXC L;  4IFD I;  1IBL Q;  2BH8 A;  1HR0 L;  2JA7 G;  1GVP A;  1N9W A;  4NPS A;  3PGZ A;  3RZO H;  2LSS A;  2N78 A;  1YIT A;  1EQQ A;  1K9M C;  2VZA A;  2JA6 H;  1UE5 A;  3S1M H;  1SFO H;  4A3G H;  3PSI A;  2R92 G;  2I5L X;  2JEB I;  3ER0 A;  1EIF A;  3BJU A;  3E0E A;  3S1Q H;  4C3J H;  1Q7Y C;  1Q86 C;  1OXU A;  4KHZ A;  4GN3 B;  4DR2 Q;  1V1Q A;  4LUO A;  3J81 c;  1HZ9 A;  3GO5 A;  2FXQ A;  5IY0 A;  2R7D A;  4RMF A;  1R9T H;  1C0A A;  1PH7 A;  4JYA Q;  4A3L G;  2AWO A;  3S2D H;  5C0X J;  3S1N H;  1N36 Q;  1QZG A;  3M4P A;  4JI0 Q;  3CPF A;  3TS2 A;  4JBW A;  5M5W H;  4X62 L;  1HJP A;  4DK6 C;  1YIJ A;  4GNX A;  4LF7 Q;  3G48 A;  4LF5 L;  4EQ5 A;  5M3M G;  3S14 H;  5C44 H;  1PFS A;  4LFC L;  2PI2 E;  5JEA G;  4YWK A;  3GTL H;  1HZC A;  4DV4 L;  4NXM Q;  3PO2 G;  1YHQ A;  3KOJ A;  1KHI A;  4DK3 C;  4B3S Q;  4PZ8 A;  1SN8 A;  3F2D A;  4ALP A;  2K4K A;  5IYC H;  1P8L A;  4LF4 Q;  1TWG H;  1S72 A;  4FDB A;  5FLM G;  1I3Q H;  4OON A;  4UPA A;  5JJL A;  1NE3 A;  4A3I H;  1U0L A;  2NVX H;  5FJ8 H;  4JBK A;  4R4O A;  1PVO A;  1NTG A;  4A3F H;  1LM0 A;  1OXX K;  2OWO A;  3G71 A;  4OWW B;  2VQF L;  1TWF H;  4A3J H;  4O0A A;  5GAH C;  2F3I A;  2ZJR A;  4OWT B;  1MIU A;  2OTL A;  5JJK A;  1IXR A;  3F2C A;  3JAM c;  2IX1 A;  3AQQ A;  2HHH L;  4DR7 L;  3KF6 A;  4MNO A;  4JI2 Q;  1SE8 A;  3NBH B;  1XPO A;  3HOU H;  2CWA A;  3NEM A;  1N32 Q;  1L0W A;  2PQA A;  2AMC B;  4JOI A;  3CCU A;  4APV A;  2Y0S E;  3HKZ G;  5LMN Q;  4A3M G;  4Y7N H;  1XMO Q;  4LF8 L;  4LUZ A;  1I50 H;  4B3T Q;  3J81 i;  4A3D G;  4DV7 L;  2NZH A;  2Y0S G;  3HKZ E;  4JI8 Q;  3K81 C;  4DV3 Q;  3OW2 A;  1HNW L;  3FKI G;  4H02 A;  1KQS A;  1NBW A;  2PI2 A;  4QY7 A;  3CCR A;  1X55 A;  2IHF A;  3J7A 5;  1J6Q A;  2VQE Q;  1Q1B A;  1M90 C;  5M3M H;  1RIP A;  3CC7 A;  1IL2 A;  5M5Y H;  2VS1 A;  3I4N H;  1VQI A;  2E2H H;  3HOX G;  4IFD G;  3UDG A;  2HHH Q;  4DR7 Q;  3H3V H;  4R1J A;  1FL0 A;  5BR8 L;  2F4V Q;  1Q82 C;  1Q46 A;  4RG1 A;  4DV2 L;  2HT1 A;  1TWC H;  3NEL A;  4K0K L;  5IP9 G;  1X9N A;  4IPG A;  2PNH A;  4LWC A;  1BBU A;  3I4N G;  4DV5 Q;  4DR6 L;  4R4Q A;  1E22 A;  4X66 L;  1NMG A;  1IBK L;  1HNX L;  1E24 A;  2UXB Q;  1X3F A; 
#chains in the Genus database with same CATH topology
 1SNO A;  4JBM A;  2FIN B;  2K75 A;  1TY0 A;  2L1B A;  5IWA L;  1EZ8 A;  4GOP A;  1A62 A;  1Y1W H;  1HCZ A;  1RL2 A;  2KEE A;  4DV3 L;  4A75 A;  2PZU A;  3RLN A;  1VQ9 A;  1KRT A;  2Z4H A;  5JVG 3;  3I4M H;  5C44 B;  4RH6 A;  3RZD B;  3J7A F;  1F77 A;  3J81 E;  2FFK B;  3DMU A;  4XXE A;  5AJ3 Q;  5IP7 G;  1VQN A;  1TS3 A;  1WI5 A;  3HGB A;  4DF7 A;  2BH2 A;  3OYY A;  2R6G A;  2NVT H;  1VQJ A;  5FLX L;  2R7Z B;  4P71 A;  3KDF A;  1IBL L;  5FLX c;  3AU7 A;  3EA6 A;  3F8T A;  3K59 A;  1WJJ A;  3M3Y B;  2JA9 A;  3OMC A;  2RSO A;  3VA7 A;  3PV0 A;  4BS9 A;  4DV1 L;  1UE6 A;  1E3P A;  4YWM A;  3AYH B;  2MNA A;  3W1G A;  2K33 A;  5AFW A;  1VQ8 A;  2N88 A;  1CUK A;  4LK1 C;  3RN2 A;  2KVM A;  4KMU C;  1EWI A;  1G29 1;  3M9B A;  1K73 C;  4R4C A;  1TII D;  1Y8N B;  2XIW A;  4JYA L;  5KGU A;  4MZ9 A;  2EYM A;  4BA2 I;  4NP5 A;  5IYD H;  1PFB A;  1G8Z D;  4L5S A;  2VQE L;  1MI2 A;  4RWS C;  4F87 A;  4DV4 Q;  3PUV A;  1D8L A;  4YY3 Q;  4BY7 H;  4A3L H;  3CQZ H;  3L0O A;  4ILW A;  2KBN A;  1H9S B;  4DNT B;  1VQO A;  1NJI C;  3R2T A;  3OTO Q;  1S5C D;  4KLK A;  2FJ2 A;  2B8F A;  1F9P A;  1E2V A;  2RSN A;  2QIL A;  3Q6S A;  1HHV A;  2F0T A;  4LFA L;  4CDC C;  3TZU A;  1N33 Q;  3I70 A;  2VUM B;  3VDY A;  1RHP A;  4GLV B;  1H9J A;  3W5O A;  1PZJ D;  4JI1 L;  1HZA A;  4KY6 A;  3M4Y A;  3P75 A;  4HCE A;  4GNX B;  1VQ5 A;  5IGE A;  3DWA A;  1B70 B;  1X3E A;  2CQA A;  1VQD A;  4RHR A;  4E6I A;  1K8M A;  2MFI A;  4DU9 A;  5JEA H;  5H1S E;  1R9T B;  2QDB A;  1DON A;  3BG3 A;  5D3D A;  3UDF A;  3S1R B;  3HOW B;  2E5L L;  1HA5 A;  2WAC A;  4IUU A;  1KAW A;  3D8G A;  4C3I H;  5ELO A;  3T16 A;  4CJ1 B;  5T1G A;  2QA4 A;  3MA2 B;  2JYO A;  3ERO A;  1SLJ A;  4QGU A;  2F0J A;  2ICE C;  5FLM H;  5LMN L;  2UUB L;  4WJ3 M;  2F0E A;  2O4X A;  4DV6 L;  2BDN A;  4BY1 H;  2CCZ A;  1BO0 A;  2B2U A;  1F9S A;  5IGF A;  1EY8 A;  1HR0 Q;  4BBR B;  1V9P A;  2ZXR A;  3GP7 A;  4HJ7 A;  4BBR G;  3D4R A;  4A3M H;  3LWU A;  1YJW A;  2K50 A;  1PRT C;  1WTQ A;  5CBA E;  2EYH A;  4LF6 L;  1O7Z A;  5D65 A;  2K5N A;  5ELN A;  2F0V A;  1MD2 D;  4CBV A;  2Q2T A;  2NVT B;  1SNM A;  5L37 A;  4AQY L;  2OCE A;  1X65 A;  2JK8 A;  2I0Q A;  1WCM H;  1M8A A;  3AEV A;  3TP7 A;  4WOR A;  2UUC L;  1KDA A;  4A3E H;  1BNZ A;  2E2I H;  1KL9 A;  5C6A A;  1UEB A;  2VNU D;  2XSC A;  2A69 D;  2GN5 A;  4IO9 A;  4IOA A;  1XJV A;  4PZ7 A;  2EY2 A;  4P75 A;  1Q8K A;  2K5H A;  1L2F A;  5GRO A;  4P73 A;  4RCO A;  3JC6 6;  2WAQ E;  5BR8 Q;  1PRT D;  4X66 Q;  1CI3 M;  1CKN A;  5DM6 3;  1ZYR C;  2WAQ G;  2MQH A;  1N36 L;  4JC0 A;  2HQE A;  4G7O C;  1XNR L;  2A6E C;  3BS1 A;  4N8F A;  2B3G A;  3RZO B;  1IW7 D;  1TWC B;  4CKB A;  2WB1 E;  5IP7 H;  1E1T A;  3VR6 A;  2UUC Q;  4YY3 L;  2RF4 A;  1X6O A;  2A6H C;  4B3R Q;  1GM5 A;  4KY7 A;  2Z0S A;  2F0M A;  1HNZ Q;  4O42 A;  4IJH A;  4NMZ A;  1ENF A;  2F0P A;  2AQ1 B;  1JC7 A;  3EQL C;  3KLR A;  1JOQ A;  4JI2 L;  4LUV A;  2OT2 A;  4DUZ Q;  1DZ1 A;  2D62 A;  2AHO B;  3ZYY X;  1O7L A;  4M1U B;  1H95 A;  3GTO H;  2F0S A;  1E1O A;  1PTO H;  5TSS A;  1EOT A;  2LY7 A;  4JI1 Q;  2D0O A;  1GUO A;  3KDF B;  1HH2 P;  1HQR D;  2Q8R E;  1B9M A;  3A7L A;  3I2Z A;  3GTO B;  3C1E A;  1EQV A;  4KI0 A;  1RTN A;  1AW7 A;  4HJA A;  1L0Y B;  1BCP C;  2SDF A;  3KF8 B;  5BN5 A;  2R93 G;  1PFN A;  1EY0 A;  1STB A;  1U4R A;  1MSG A;  4B08 A;  4K0K Q;  3QG1 A;  5GAG C;  1V1P A;  1U4P A;  2BOS A;  3FPP A;  1DM0 B;  2R61 A;  5FJ8 G;  1EY6 A;  1FNW A;  2KHJ A;  1PYW D;  1C48 A;  1C7Y A;  3MXG A;  3SE0 A;  1K8G A;  1HZB A;  2I07 B;  4IUQ A;  1N32 L;  1Q81 C;  1EWC A;  1R4Q B;  5J22 A;  2XN9 C;  3MXU A;  1CKO A;  1DCZ A;  3GTG H;  1DOL A;  4DV6 Q;  2JE6 I;  1CSP A;  4OO1 G;  2NN6 G;  5I2Y A;  4IZ8 A;  1XWE A;  4YWL A;  2EYF A;  4DV1 Q;  3OW7 A;  3NTH A;  3HOZ G;  2Q2U A;  2ASB A;  4IFD J;  1AN8 A;  5EQ0 A;  1QIL A;  1YVC A;  3WDN A;  4A3G G;  3KBG A;  5FO8 B;  5I4D A;  2NTT A;  1PHJ A;  4LF5 Q;  4BY1 G;  3PO2 H;  3HOW G;  1RF2 D;  3HOY G;  5EJW A;  2WII B;  1FNU A;  1H9K A;  4PQX A;  3BZK A;  1D1I A;  1QUQ A;  1YJ9 A;  2VUM H;  1U4M A;  2O5J C;  3CXC A;  1A15 A;  5M9O A;  1EIH A;  1SND A;  2A8V A;  1IYU A;  1JR0 D;  3NTK A;  3ND8 A;  2F4V L;  2CVR A;  1QNK A;  1GD7 A;  1EFW A;  4JV5 L;  1VQL A;  1I5F A;  2K14 A;  2PPB C;  3TS0 A;  1JJ2 A;  1VF7 A;  3S16 B;  5C4J H;  4BBS G;  4MN3 A;  1EU3 A;  4A3B G;  1PA6 A;  3A8I E;  3D0F A;  1ZEQ X;  4FF2 A;  4IPH A;  4K5X A;  4ULL A;  3PF5 A;  2UXC L;  1IBL Q;  2JA7 G;  1GVP A;  1N9W A;  3MFG A;  3PGZ A;  2EVB A;  1YIT A;  1K9M C;  3S1M H;  1UE5 A;  2F0H A;  1SFO H;  1CFM A;  1JWS D;  3PSI A;  3KLS A;  3M4O B;  1OXU A;  3D3R A;  2QCP X;  1PTO C;  2FXQ A;  3PIO 3;  2R7D A;  3S2D H;  2K5D A;  2K7V A;  4U67 3;  4IFD H;  5M5W H;  4Q0F A;  4ID6 A;  3G48 A;  3OIP A;  3RUZ A;  5M3M G;  3S14 H;  5C44 H;  1PFS A;  2AUK A;  4NXM Q;  3DWQ A;  1RKN A;  2X6L A;  1KHI A;  4CDF C;  4B3S Q;  3F2D A;  1P8L A;  1TWG H;  4I65 A;  3I90 A;  1SMY D;  2RVL A;  4OON A;  3IFD A;  5JJL A;  2G9H D;  4A3I H;  5FJ8 H;  3JAM E;  5EBD A;  1R4P B;  1NTG A;  1Y1V B;  1OXX K;  4OWW B;  1I3Q B;  2SNS A;  2ZJR A;  2K04 A;  4OWT B;  5JJK A;  1HA6 A;  1IXR A;  3AQQ A;  1Q8I A;  1PTO D;  1XPO A;  3V2T A;  2F3V A;  2IWH A;  1N32 Q;  2PQA A;  4JOI A;  3CCU A;  4UDU C;  1V8Q A;  2L55 A;  3HKZ G;  5LMN Q;  2JA8 B;  1I4H A;  4K8J A;  1B44 D;  4A3D G;  3E6Z X;  5C4X B;  3C3L A;  3HKZ E;  4JI8 Q;  2B2Y A;  3K5L A;  4DV3 Q;  1HTP A;  1KQS A;  4QY7 A;  3CCR A;  1X55 A;  4B9W A;  2IHF A;  1M90 C;  1PTO B;  1RIP A;  4ODG A;  5LL6 X;  1EY9 A;  2EY1 A;  1EIG A;  4QUC A;  1LT4 D;  1SNC A;  1VQI A;  4IAL A;  2DN8 A;  4DR7 Q;  3H3V H;  1UUP A;  2F4V Q;  1Q82 C;  2LS0 1;  3PO2 B;  5IP9 G;  1I6H B;  3SXH A;  1LTS D;  3I4N G;  4X66 L;  2HD3 A;  4DNR B;  3NP8 A;  5AJ3 L;  4HR7 B;  1YEZ A;  1LAB A;  1I4P A;  1FYC A;  1K83 H;  1STG A;  2K32 A;  5IGB A;  2RCN A;  3K7U C;  3STB C;  4HMI A;  4ZYS A;  2O2L D;  2EZV A;  1HUN A;  2RCF A;  1DYQ A;  2J7Z A;  4PZ6 A;  2VXW A;  4AYB B;  1Y1V G;  1KIX A;  4XYQ A;  4HSV A;  4XYO A;  2YTX A;  2AQ3 B;  3GTQ B;  1Y1W B;  1EU4 A;  1Q1E A;  2N8N A;  4F8M A;  4A3F B;  4KD3 A;  4IOC A;  3I55 A;  1WTV A;  4GN4 B;  1AEX A;  2EJM A;  4HJ9 A;  2XGT A;  1LAC A;  2AWN A;  4WRD A;  1L1O B;  4DAY A;  2MGS A;  4O2D A;  1AZP A;  4QQB X;  2K03 A;  1WCM B;  4V19 0;  1ASY A;  2BE5 D;  4Z9C B;  3L3O C;  5CV5 A;  3STB D;  1Z47 A;  4DR1 L;  4K6D A;  4C2M B;  4QJF A;  1X32 A;  2D5D A;  2L12 A;  3AFQ A;  5ISR A;  5M5X B;  1II3 A;  3H0G B;  1QWY A;  5D3I B;  3S15 H;  2JA7 B;  4X65 L;  1Y14 B;  4BY7 G;  4B3T L;  3T56 B;  3SK5 A;  4A3M B;  1BR9 A;  3O13 A;  1VQM A;  4DAP A;  1SMX A;  5E7N A;  1BBW A;  1WYD A;  2KA7 A;  4JG2 A;  5A2Q E;  1QUQ B;  1S3O A;  4GS3 A;  1GKH A;  4IUP A;  2DJF C;  1STN A;  5T1I A;  3UDI A;  4NXM L;  4ZRZ A;  4K5V A;  4RGT A;  1VQE A;  3G4S A;  5COR A;  1S5F D;  4KV6 A;  4N9T A;  2L11 A;  2KCT A;  2CFM A;  4G4K A;  1EZ6 A;  2EYJ A;  2ZTC A;  4GKK L;  4JI3 L;  3BU2 A;  1CTM A;  3FRP B;  4HIM A;  2UUB Q;  1DXM A;  5DAU A;  1Z9F A;  5DLQ E;  1PFM A;  3P1H A;  3A7A B;  4A76 A;  2NZO A;  4CJ0 B;  3ITP A;  1FR3 A;  5JEA J;  1B50 A;  1MSH A;  5JJI A;  1BOS A;  1Q3L A;  5C0X I;  2JA5 G;  1PYS B;  5DNF A;  2K5W A;  3AFP A;  2E2I B;  4EVO A;  2VB3 X;  1Z6H A;  3HFZ B;  4HAE A;  3A8J E;  3MWY W;  2Q2H A;  3CAM A;  3F1Z A;  1A2T A;  3A8K E;  2NVX B;  2OQ0 A;  2V1C C;  4B3M Q;  5C3X A;  3NUC A;  1ICF B;  4A3I B;  1N8R C;  1BUV T;  3J7Z C;  3LGJ A;  5KNB A;  4KJN A;  3ONA B;  2N3S A;  3CD6 A;  3NQI A;  1PRT F;  2ID0 A;  3WOE A;  4B3R L;  4K8I A;  4QIW E;  2EJG C;  3D6C A;  1OO9 B;  3GTQ H;  4JI5 L;  2NUC A;  2JA8 H;  4BY1 B;  1V43 A;  2IT1 A;  1N34 Q;  3HOZ H;  2VW9 A;  4QIW B;  2LKV A;  3ICE A;  1ZKO A;  2K52 A;  4DR5 Q;  4A3C G;  2K5V A;  1ILP A;  2F0W A;  1CKM A;  2BDO A;  4RKB A;  5CV7 A;  3S1Q B;  2R92 H;  4A3G B;  3PUW A;  4GOP B;  3ERS X;  1A8V A;  3MEF A;  3GTP H;  3D31 A;  2G5D A;  1VQ7 A;  5LMN W;  2YV5 A;  1I6V C;  5CGK A;  1WFQ A;  1LTA D;  3EIV A;  5E4W C;  2B2T C;  1TWH H;  2HQL A;  3LWE A;  3SK4 A;  3K0X A;  2G9D A;  2HIX A;  3KBX A;  2WV6 D;  3KYH C;  2EJF C;  1JJG A;  1Q12 A;  5DEH A;  2SEB D;  1STH A;  3OTO L;  3DUZ A;  3GTM B;  3K5O A;  3PMF A;  5M3F H;  4KHP L;  1JB3 A;  3NWS A;  4KHP Q;  4ZQ3 A;  4NXN Q;  3S9W A;  1X56 A;  4DNI A;  3M85 A;  4A3F G;  4XQN A;  1Y8O B;  3M4O H;  1XMO L;  5IYB H;  1QZH A;  5IT9 L;  3S1M B;  3MXN B;  3I4L A;  2A69 C;  4JCV E;  2MJ8 A;  3TSS A;  2KEC A;  4K6L A;  3TRE A;  3MAQ A;  3CCQ A;  1TS2 A;  3NBH A;  2YU9 B;  5ELD A;  3VA5 A;  1BCP D;  3T1Y L;  3R3O A;  4XT3 B;  4DV0 Q;  1BQQ T;  1PZI D;  3UI2 A;  3GD7 A;  2E75 C;  3I4N B;  4CHT B;  1TWG B;  2PZT A;  2QKI C;  4GN5 A;  2A68 D;  1YHB A;  2Q2I A;  3F2U A;  1C8C A;  3IL8 A;  4N9P A;  4F88 A;  3G6E A;  4TVA B;  3H0G G;  1M1K C;  1VDZ A;  2PW5 A;  3AB9 A;  2TMP A;  3NBI A;  4DAY B;  5C3W A;  3JAM i;  3RD4 A;  4FXK C;  5J1Z A;  4L8J A;  4C1N K;  3T1Y Q;  1TXY A;  2QGQ A;  4EX5 A;  5E1F A;  4LF6 Q;  5JVH 3;  3CMA A;  1OTC A;  1JE4 A;  1LUZ A;  1GOZ A;  2RQX A;  2ZJP A;  2A1A A;  4A3E B;  3RMH A;  4AQY Q;  2E8G A;  1PXU A;  4KY5 A;  1D5X C;  4BXX G;  2EYP A;  3U4Z A;  1VQ6 A;  1BCP F;  4H7B A;  2GA4 B;  1TU2 B;  3WOF A;  2K01 A;  2SOB A;  2PO4 A;  1C9O A;  4A93 G;  3DHQ A;  1PLF A;  3CF5 A;  3S17 H;  4ZAI A;  2L5T A;  1WOC A;  2Z4I A;  3PQI A;  1TWA H;  4KKU A;  4K5W A;  2PQE A;  5I2X A;  1RDP D;  1VF5 C;  2AKW B;  1NAP A;  1VQA A;  4AYB E;  4JBJ A;  1E2Z A;  2BCO A;  1ENC A;  3T4A C;  3TP8 A;  1XNQ L;  3NXW A;  1ML0 D;  2CW0 D;  2WIN B;  4ZUI A;  1HFN A;  5IOD A;  3HOV H;  4DR1 Q;  2B2W A;  3NEN A;  1SYF A;  2AUJ D;  5FO9 B;  2KCM A;  3CRL C;  2MPM A;  2WKD A;  1LYL A;  5LMU L;  1TY2 A;  4FXG C;  2FMC A;  3A5Z B;  4C3H B;  2HIV A;  1D5Z C;  1N33 L;  3HOY B;  2KQ3 A;  1T5X D;  2JA6 B;  1AP0 A;  2N55 A;  4A93 H;  4OIK A;  1K0R A;  3I56 A;  3CCV A;  4WJ4 A;  3KF6 B;  4BBS H;  4UP8 A;  2H1E A;  3DM3 A;  1BVS A;  1PH8 A;  4JI5 Q;  3QOL A;  4FO2 A;  2HCI A;  4JVZ A;  2CH4 A;  1U5K A;  2C35 B;  2JEA I;  3S2H H;  3IRB A;  5C4X G;  2NN6 I;  2A5H A;  3H91 A;  2E2J B;  4A3C H;  3MZ5 A;  1I50 B;  3FHW A;  3I3C A;  5EKL A;  1QJO A;  1AE3 A;  1HUM A;  3CME A;  1QE6 A;  2IX0 A;  4QF4 A;  1PH5 A;  2B63 G;  4KK7 A;  3U50 C;  2NYZ D;  2DNE A;  3CPW A;  1X54 A;  3M7N A;  2KED A;  3OWF A;  1SYG A;  3S24 A;  4C2M H;  2UXC Q;  4L5R C;  2IJ0 A;  4PMB A;  1PTO F;  1Y8P B;  1HR0 L;  1U4L A;  5ELC A;  2N78 A;  1EQQ A;  2JA6 H;  1U9R A;  4FP5 D;  5G3L D;  1K8O A;  2I5L X;  2JEB I;  3ER0 A;  2KJX A;  2IL8 A;  5KNC A;  1Q86 C;  3NTI A;  4GN3 B;  1SE2 A;  3GO5 A;  5C3E B;  1TR5 A;  3S1N H;  1ZYR D;  2Z1C A;  3FEW X;  5ELF A;  4LMQ D;  1QZG A;  4JI0 Q;  3TS2 A;  5JPM C;  4DK6 C;  1EY4 A;  3GTK B;  4EQN A;  4LF7 Q;  3X3N A;  4RFB A;  1SJE D;  3HRZ C;  4YWK A;  3GTL H;  2Z9H A;  2EE1 A;  3MC0 B;  4IN3 A;  3PO2 G;  1A6X A;  1K0S A;  5ELE A;  4DK3 C;  3NWT A;  4PZ8 A;  4LF4 Q;  4FDB A;  5FLM G;  4A3J B;  1ZXT A;  4IUV A;  1EL0 A;  3K6O A;  1NE3 A;  4TSS A;  4G7H C;  1NNX A;  4KHV A;  2SNM A;  3URY A;  2DY7 A;  1LM0 A;  4FF4 A;  2OEO A;  2VQF L;  2X6G A;  2JN4 A;  2OTL A;  3DEP A;  4DR7 L;  3KF6 A;  1SE8 A;  3SDZ A;  3OSO A;  2JP1 A;  4KN7 C;  2CWA A;  1EY5 A;  3HOU H;  1L0W A;  2AMC B;  5G3L F;  4APV A;  4Y7N H;  5M3F B;  1J9O A;  2NZH A;  2Y0S G;  5LHY 1;  4OEL B;  3VYS A;  3FKI G;  4H02 A;  1NBW A;  1I4R A;  3J7A 5;  1LV9 A;  5M5Y H;  5KRU A;  2E2H H;  2HHH Q;  2IW3 A;  2HT1 A;  1Q46 A;  1XX8 A;  5C4H A;  1C4Q A;  1X9N A;  1EY7 A;  2KCC A;  4IPG A;  4BY7 B;  4LAA A;  1BBU A;  4DV5 Q;  5CV6 A;  4R4Q A;  4S3S A;  4WJW A;  1IBK L;  2E76 C;  2UXB Q;  1IKL A;  1SYE A;  1E2W A;  2ZXP A;  2O5I C;  1YNX A;  5COY A;  4F7X A;  3HOV B;  2EDG A;  3I73 A;  5CV9 A;  1TT2 A;  1TS4 A;  1W6K A;  1D5M C;  2LMC B;  2B2T A;  4R8N A;  1FVI A;  2QW7 A;  2B63 H;  1UWV A;  2YTV A;  4A3D B;  1F9Q A;  1VQF A;  3L9A X;  3S14 B;  1KTK A;  1SRO A;  4DUZ L;  1L0X B;  1VMC A;  3H09 A;  1W3S A;  4K2K A;  5HGT A;  1Y1V H;  1OXT A;  1XMQ L;  2RDG A;  3I4O A;  1KC8 C;  1ET9 A;  5GAE C;  4A3K G;  3BVZ A;  4DFA A;  2E74 C;  1STA A;  2A68 C;  3FMC A;  3KLS X;  4OX9 L;  4YCV A;  5A2Q L;  4N8X 1;  3GTP B;  3RR5 A;  3HOU G;  5M3F G;  1NY4 A;  1NR2 A;  1SE4 A;  4C1N I;  1PH6 A;  2BE5 C;  3EBE A;  1S4Z A;  4MTK A;  5IIF A;  1FNV A;  1BDO A;  1HTL D;  3HEJ A;  3TBI B;  1EQT A;  2DUD A;  2R93 H;  3GTL B;  4X64 L;  3JAM L;  1D6E C;  4LNQ A;  4NDX A;  3G6J B;  2YTY A;  4IUR A;  4A3K H;  3HOX B;  4J1M A;  1RTO A;  4J15 A;  1XPU A;  2YU9 H;  1NMF A;  4DKA C;  3A74 A;  1CKN B;  1CK1 A;  4OXP A;  1EIY B;  2M2L A;  2QEX A;  3TP5 A;  1I6H H;  4I7Z C;  3S16 H;  4NW2 A;  5NUC A;  4CKC A;  4HCS A;  3I8Z A;  3W3A A;  3AMU A;  4HIO A;  2FMM A;  2WB1 B;  4DV0 L;  3CC2 A;  4XT1 B;  1OXS C;  3TEH B;  1MKH A;  1IBK Q;  2OTJ A;  2WAQ B;  5K36 H;  4B3M L;  1CA6 A;  4ME5 A;  2E2J H;  4A3B H;  1IBM Q;  3MXN A;  2B2V A;  2A19 A;  1EOV A;  2F0O A;  4H13 C;  4IQZ A;  3I72 A;  2R93 B;  1G51 A;  2ZT9 C;  1CT1 D;  4M8A A;  4YIJ A;  3VR2 A;  1I94 L;  3TDQ A;  5I6Y A;  2HDL A;  1N34 L;  2CW0 C;  4KKS A;  3NK9 A;  3PIP A;  2IPK D;  5IP9 H;  2QDL A;  2D2C C;  2A73 B;  1XTD A;  4NXN L;  1QNU A;  2BA0 A;  5C4Z A;  4FF3 A;  4DV5 L;  3HOX H;  4X3S A;  3BDC A;  3DXJ C;  4X65 Q;  2F0U A;  4DPG A;  3J80 i;  3BZD B;  3EVQ A;  1YJN A;  1EQR A;  1WTW A;  3K8A A;  4Y52 H;  4WFN 3;  4OL7 A;  2B2Y C;  4NKL A;  1SJH D;  4PMW A;  1GO3 E;  1XPR A;  1JJC B;  1YNJ D;  3CCS A;  1HNW Q;  4DN4 M;  1JQY D;  3GTJ H;  3DLL A;  4JI7 L;  5JOB A;  2K05 A;  3NE5 B;  1YZ6 A;  4L6T B;  4R9W A;  4QB4 A;  1KAB A;  1KD1 C;  3J7Y W;  1SEB D;  3CHB D;  4POF A;  3TQY A;  1EUJ A;  4JI6 Q;  3E9I A;  1EYD A;  3DM1 A;  3IAY A;  1H9M A;  1IHZ A;  3ERQ A;  2ALY B;  3IKJ A;  3KLW A;  5BN4 A;  1SR3 A;  3VR5 A;  2FHT A;  2F4I A;  2M00 A;  4KN4 C;  1XMQ Q;  1LTB D;  4HN7 A;  3W2D A;  5DM7 3;  1BKB A;  1HPC A;  4QUF A;  1EEI D;  5JPN C;  2N49 A;  2RBM A;  4LF4 L;  3E5S A;  4CGY B;  4B9X A;  3A0J A;  2F0F A;  4JPB W;  1VQK A;  5C4X H;  3PUX A;  3WWV A;  5FKA C;  3M4Q A;  3J80 E;  3I4M G;  3GTG B;  3NHH A;  4OHJ A;  4FNF A;  3K5M A;  4JI0 L;  3KK7 A;  2EY5 A;  3TME A;  4LF8 Q;  2AQ2 B;  2Z6K A;  4FYD A;  2C9O A;  2J4X A;  1AFP A;  1MJE A;  3GV6 A;  1NSN S;  2RHS B;  4P74 A;  5IYB G;  1GHJ A;  1SDF A;  3FDT A;  3LX0 A;  4DR2 L;  4FXD A;  4JI3 Q;  5EAY A;  2ES2 A;  1CSQ A;  1H9S A;  4QL5 A;  2LXK A;  4X64 Q;  1Y1W G;  4LFC Q;  1J5E Q;  3L7Z C;  1LLR D;  4IPC A;  3J7A V;  1OXV A;  2ZTD A;  4UY8 C;  3KFU A;  3S15 B;  1DGS A;  2A74 C;  1PYB A;  3H0G H;  4IJL A;  4BBS B;  5M5X H;  3DWP A;  4C3J B;  1EEF D;  4YHH Q;  5IGD A;  3CCJ A;  3CCE A;  5IWA Q;  2DNC A;  2L15 A;  3PO3 G;  4JI4 Q;  4DR4 Q;  3CRK C;  4LW1 A;  1YNN C;  2MHV A;  1XNQ Q;  4JK1 C;  4DR4 L;  1Q90 A;  4R4I A;  3W1B A;  4EQO A;  3FKI B;  4RCN A;  3D4W A;  3HG9 A;  1VQC A;  1WD1 A;  1DD2 A;  3A56 A;  4AIM A;  1JOR A;  3PCO B;  1B1Z A;  1E7Z A;  1QCB D;  1I4Q A;  3P7J A;  3RLO A;  2F0D A;  3NQT A;  3SEB A;  3U9S A;  5LMU Q;  2RA4 A;  3ZJY C;  1XNR Q;  3UE1 A;  5IT9 c;  2E2H B;  2KEN A;  1XTC D;  3RN5 A;  3UE0 A;  5HUR A;  1ET6 A;  1YI2 A;  5M5Y B;  1IBM L;  5E3F A;  4GOP C;  1PDQ A;  3PIP 3;  1IW7 C;  1F2L A;  2OF1 A;  2H5X A;  2EIF A;  1MBY A;  1FJG Q;  2RHQ B;  1L1O C;  3Q24 A;  2UXD L;  2F0K A;  1EFI D;  2ZM6 Q;  3VYU A;  2XRQ D;  4A3B B;  4YCU A;  3UDX A;  4PNY A;  2EOT A;  1IYJ B;  1IZ6 A;  3HOV G;  1S5D D;  4Y7N B;  2UXB L;  1VS0 A;  2M9V A;  2VL6 A;  2GVA A;  2HCC A;  1SRU A;  1UE1 A;  2JSO A;  1MGS A;  2JA6 G;  2JA5 H;  5C5L A;  3K80 C;  3LNN A;  4DXG A;  1SNP A;  3P20 A;  4R4T A;  1JWU D;  1HR0 W;  2I46 A;  1UEA B;  4DUY L;  5HY6 A;  1CHQ D;  5F2D A;  5KIX A;  1LT5 D;  2UU9 Q;  3CCL A;  5K5P A;  1F2M A;  2IHE A;  3J80 L;  4C3J G;  2MP1 A;  5EGT A;  4A4I A;  4DR3 L;  1ASZ A;  4PMC A;  2Y0S B;  4A93 B;  1B53 A;  3MHB A;  5GQO A;  1D7Q A;  2XWB B;  1QVC A;  3TN2 A;  4A3I G;  3E0J A;  2NVQ H;  3T1H L;  4KJO A;  1H9R A;  2F0I A;  5I9P A;  5CBE E;  3MVV A;  3T1H Q;  3Q23 A;  3EN2 A;  3NSW A;  4CDD C;  1KDB A;  5FLX E;  1LTG D;  1UNS A;  1ESF A;  1E0B A;  2BH8 A;  1WVL A;  2VZA A;  1JCK B;  2JA5 B;  4A3G H;  2F1M A;  2R92 G;  3S1Q H;  3N6R A;  4C3J H;  3J81 L;  3R93 A;  1J8I A;  1Q7Y C;  4KHZ A;  4DR2 Q;  1V1Q A;  4LUO A;  4Q5V A;  2F0N A;  1R9T H;  1C0A A;  4HTH A;  2RDH A;  3M7G A;  2WKC A;  2Z6B A;  2NN6 H;  3M4P A;  1F2Z A;  1HJP A;  1XYI A;  1YIJ A;  4GNX A;  4LF5 L;  3R2I A;  5EBC A;  4EQ5 A;  2NWG A;  4LFC L;  1HZC A;  1TWH B;  2ZXO A;  1SAP A;  5C0X H;  1GUG A;  5KEE A;  2B2V C;  4ALP A;  4RHS A;  5IYC H;  5JJZ A;  2F03 A;  1S72 A;  1LT3 D;  5CC4 A;  3MXP A;  1X3Q A;  4J6H A;  1GXD C;  4JBK A;  4C3I B;  1PMR A;  4R4O A;  1PVO A;  1SSO A;  3EFX D;  4A3J H;  2E2D C;  2B2W C;  3H94 A;  1QOH A;  2F3I A;  1MIU A;  2CHB D;  3Q0A A;  3VR4 A;  3F2C A;  4CJ2 C;  2HHH L;  4MNO A;  4JI2 Q;  1BF4 A;  3NBH B;  3NEM A;  1WTX A;  1HXY D;  2B63 B;  5JAV A;  1EWH A;  2PW7 A;  4A3M G;  1XMO Q;  4EGV A;  1G2S A;  5FK9 C;  4DV7 L;  1ILQ A;  5FO7 B;  3K81 C;  1WTR A;  1DOK A;  3D4D A;  4DAV A;  2B39 A;  5C5M A;  4MHE A;  2PI2 A;  2HUG A;  1RCV D;  1M4V A;  2VQE Q;  3I91 A;  5IT9 E;  1ESR A;  2EPB A;  1GJX A;  1O78 A;  3CC7 A;  2HDM A;  4K14 A;  3HOX G;  1G91 A;  1MHW C;  3UDG A;  1O80 A;  2XRS D;  1WTO A;  4R1J A;  1FL0 A;  5BR8 L;  2TSS A;  4RG1 A;  1KLU D;  2RKS A;  5CV8 A;  3QO2 A;  4H0L C;  2PNH A;  4DR6 L;  1E22 A;  4C3H G;  1NMG A;  1E24 A;  1TVX A;  1S5B D;  4G57 A;  1K28 A;  5HGQ A;  1TWF B;  1TKW B;  1SYD A;  1SBB B;  3EJI A;  2Z8L A;  2QF7 A;  1JWM D;  4PG3 A;  5M5W B;  4BA1 I;  3K57 A;  3S2D B;  3RZD H;  1HNZ L;  4L5Q A;  2F52 A;  2NVY H;  2R7Z G;  1IYV A;  4RGO S;  4GKJ L;  2Z6K C;  3K58 A;  4HSP A;  4LF9 L;  2NZ1 D;  4XIG S;  1VQP A;  1RJT A;  2K28 A;  4LF9 Q;  3T53 B;  3BDL A;  5LL6 S;  1B2T A;  3NPP A;  3ULL A;  2VUM G;  2GVB A;  4GLX A;  3ND9 A;  2LFN A;  1L1O A;  1HQM C;  5I9O A;  1LTL A;  4JI8 L;  2UUA Q;  1YNN D;  1CQF A;  2XTI A;  4BXX H;  1BBX C;  1T5E A;  4GKJ Q;  3BZC A;  4IPD A;  1JT8 A;  4OEM B;  1ONL A;  1Z7T A;  1HFG A;  3S17 B;  2K1B A;  2P5Z X;  5A35 A;  4L5T A;  2PMZ B;  2XNA C;  3SK8 A;  3QOJ A;  3KF8 A;  3TRZ A;  1T9H A;  4HED A;  5EPL A;  3HKS A;  5IYD G;  4YHH L;  1LT6 D;  4IUN A;  3BYY B;  3TP6 A;  3CC4 A;  3HOU B;  2C5C A;  2PQA B;  1V1P B;  1SE3 A;  2ICI A;  1EYA A;  2F3W A;  1A3T A;  1FGU A;  3QR8 A;  4X6A H;  1B9N A;  4A3K B;  4OWX B;  4DR5 L;  3J81 j;  3PO3 B;  2WB1 G;  1G6P A;  4UP9 A;  4P72 A;  4X3K A;  1I4G A;  2XWJ B;  3RNU A;  4C56 C;  4X62 Q;  2NBF A;  1K8A C;  1A63 A;  2JXM B;  5CR3 A;  5C44 G;  1P16 A;  1I4X A;  3N52 A;  4LJZ C;  2L0C A;  3GTK H;  5IYC G;  1YHA A;  2PYK A;  1B8A A;  3S1N B;  1O7I A;  3OIQ A;  1YBY A;  5E4X A;  4UHV A;  1FD7 D;  1IL8 A;  5IGG A;  5C3E H;  1HRJ A;  4EQP A;  3GV3 A;  4DUY Q;  2ATW A;  3HOY H;  3BVM A;  3PUZ A;  1PH4 A;  4C3H H;  4OIJ A;  3Q8D A;  1AH9 A;  3GDE A;  4DGZ A;  5KYI A;  1S5E D;  1AZQ A;  3VR3 A;  2V4D A;  2R7F A;  2MO0 A;  4DR6 Q;  4DR3 Q;  1QB5 D;  2QEJ C;  3H3V I;  2I5H A;  1VQB A;  4B3S L;  2X69 A;  1A3V A;  1B3Q A;  3VYT A;  3KJP A;  4LFA Q;  4A3D H;  2F0G A;  2JQO A;  3E3X A;  5IGC A;  3QWN A;  2PNR C;  1G6Z A;  2JA7 H;  4X3U A;  1BCP B;  4UAI A;  4K2L A;  4ME3 A;  4DAM A;  4IUT A;  1NCV A;  2EYO A;  4OX9 Q;  1FJG L;  5IE8 A;  4HIK A;  1D2B A;  1LTT D;  2DY8 A;  1D1K A;  1JB7 A;  1PZK D;  5J3B A;  5FOB B;  4FF1 A;  1A0I A;  3TZD A;  4ABN A;  2E5L Q;  3SK6 A;  3U58 A;  1JMC A;  2VB2 X;  4DXF A;  2J0T D;  1G2T A;  3RLF A;  4PV1 C;  2WFW A;  2OQK A;  3MEH A;  3CW2 C;  3QIA A;  1SFO B;  2CWP A;  3OOC A;  4LF7 L;  3G7L A;  2VY3 A;  3L2P A;  2K6A A;  3HOW H;  2PZW A;  3ULJ A;  1PH1 A;  2UU9 L;  1WTH A;  4MIU A;  1SYC A;  3S1R H;  1UE7 A;  1YNJ C;  3VYR A;  2ZTE A;  3Q22 A;  3H6M A;  3U9O A;  2NVQ B;  3OWE B;  4ZKC B;  1B4O A;  4L63 B;  1SMY C;  3K0Y A;  1KDC A;  3SGI A;  2H4O A;  1SYB A;  4A3J G;  4DA2 A;  3K7A B;  1QVG A;  1HNX Q;  1ICW A;  3T51 B;  3C46 A;  1TWA B;  3KJO A;  5CV4 A;  4V0B A;  1J5E L;  1VQG A;  1KXL A;  1NUC A;  1ROD A;  2JJQ A;  2JA8 G;  4R8I A;  4AH6 A;  2ZJQ A;  3FP9 A;  4JV5 Q;  3GTM H;  2NTS A;  1UAP A;  4J8Q A;  1Y69 U;  2CKZ B;  4JI4 L;  3E9H A;  4AYB G;  2EQS A;  3C1F A;  3GQB A;  5GAD C;  3I7F A;  1QG7 A;  3A55 A;  2F0L A;  2KHI A;  2MO1 A;  3H15 A;  2B29 A;  5C4J B;  1KAA A;  3DEO A;  4G7Z C;  1K3R A;  1CA5 A;  3K5N A;  3CU7 A;  4RKL A;  4OO1 H;  4JOI C;  4BBR H;  4NB3 A;  2B2U C;  3B6Y A;  4GZY C;  5M3M B;  5C0X G;  4YCW A;  4JI6 L;  2NVY B;  1NR4 A;  2PMZ E;  5D14 A;  4XTC S;  4KKT A;  4DV7 Q;  3CP0 A;  3SR1 A;  3ULP A;  3HOZ B;  1I94 Q;  3PO3 H;  4O1N A;  1CM9 A;  1VQH A;  5J39 A;  1PH9 A;  3BVG A;  1WCM G;  1K83 B;  3T13 A;  4JI7 Q;  2ZM6 L;  4TQU S;  4MTN A;  2R92 B;  1B7Y B;  3MTS A;  4CKE A;  2IX3 A;  2LXJ A;  5CYU A;  4ZCK A;  1CHP D;  2D0P A;  2R7Z H;  2EY6 A;  1GUN A;  1JOO A;  5C3E G;  3CCM A;  2EYL A;  1PRT B;  1CQV A;  4LFB Q;  1MJC A;  2KUM A;  1GUS A;  2YYZ A;  4LFB L;  1STY A;  1CZG A;  4POG A;  4CDE C;  1F9R A;  4UP7 A;  1S40 A;  3F2B A;  2Q8T A;  1PH2 A;  3H3V C;  1VCI A;  1QVF A;  3R8B A;  2UXD Q;  1W2B A;  4GNX C;  2Q8I B;  4QMG A;  5BN3 A;  3A5U A;  1LTI D;  2ENB A;  4HJ8 A;  2F0Q A;  1VQ4 A;  1RD9 D;  3PF4 A;  1W6J A;  1X3P A;  4GKK Q;  4HJ5 A;  4H44 C;  4TKO B;  3OMG A;  2EXD A;  1KNA A;  2CQO A;  1KNE A;  1SXT A;  4DK1 A;  2NB0 A;  5KND A;  2CH4 W;  3FKI H;  1KRS A;  3KUP A;  2I5M X;  1GHK A;  5CMD A;  4TRD A;  2L4N A;  4OO1 I;  4ZLT F;  4U68 A;  1JOK A;  4A3E G;  1F2Y A;  2DGY A;  2R3Z A;  2WP8 J;  5IOC A;  3K7A H;  5K36 G;  1GUW A;  1X3G A;  2VQF Q;  1TS5 A;  1B3A A;  2PCF B;  3J80 c;  3U4V A;  5KYL A;  4DV2 Q;  2MUY A;  2BA1 A;  4ZK9 B;  3S2H B;  2KCN A;  1EYG A;  1PH3 A;  2XVS A;  3M3Y H;  1JE5 A;  1JIC A;  1STE A;  3OHX C;  5ELB A;  4GLA C;  4HID A;  1EYC A;  1GUT A;  2IY5 B;  3BYT B;  4OGQ C;  4ZKB B;  2UUA L;  3PUY A;  1TQO A;  3FVQ A;  1AE2 A;  5EKI A;  3PIO A;  3FPU B;  4ZUJ A;  1PV4 A;  4RA8 A;  4IFD I;  4XQJ A;  3CQZ B;  4NPS A;  3RZO H;  2LSS A;  3X3M A;  1FGB D;  1EIF A;  3BJU A;  3E0E A;  2DJG C;  3BDO A;  1V1O A;  3J81 c;  1HZ9 A;  5IY0 A;  3QJY A;  4RMF A;  3OPO A;  1PH7 A;  4JYA Q;  4A3L G;  2AWO A;  5C0X J;  1N36 Q;  1BXT A;  3CPF A;  4JW0 A;  3V96 A;  3QB3 A;  2EXZ A;  4JBW A;  4X62 L;  1SNQ A;  4KD4 A;  3HP3 A;  4QCL A;  5JEA G;  2PI2 E;  3SVM A;  1O7Y A;  4DV4 L;  5I6W A;  1YHQ A;  3KOJ A;  1IKM A;  1CZW A;  1SN8 A;  1KLG D;  2K4K A;  4FVM A;  3MFY A;  1I3Q H;  4UPA A;  2B8G A;  2L9H A;  1LO5 D;  4BWG B;  1U0L A;  2NVX H;  1VMP A;  1LTR D;  4XQQ A;  4A3F H;  2OWO A;  3G71 A;  1TWF H;  1K3B C;  4O0A A;  5GAH C;  1DOM A;  3SHL A;  2D9U A;  3JAM c;  2IX1 A;  2A6E D;  1DJR D;  4HMJ A;  3C2P A;  3IFT A;  5EKK A;  3HS0 C;  3D6W A;  4X3T A;  1XXG A;  4RGM A;  3HKZ B;  2Y0S E;  4RGN A;  4RAU C;  2RDF A;  4LF8 L;  4LUZ A;  1WD0 A;  1A2U A;  1I50 H;  4B3T Q;  3J81 i;  3GTJ B;  1WTP A;  4XDX A;  2A6H D;  4P2C B;  5EPK A;  1ENA A;  3OW2 A;  3I4M B;  4DK0 A;  3CKI B;  1HNW L;  2K5Q A;  5EPJ A;  4C3I G;  1J6Q A;  1Q1B A;  1A3U A;  5M3M H;  1IL2 A;  2OXP A;  2VS1 A;  3I4N H;  3V05 A;  4IFD G;  3HZX A;  4DV2 L;  4KTA A;  4K0K L;  1TWC H;  3NEL A;  2KOL A;  3A54 A;  2KHS A;  4LWC A;  1HNX L;  4I7A A;  1X3F A; 
#chains in the Genus database with same CATH homology
 5AJ3 L;  4JBM A;  1YNX A;  1YEZ A;  2K75 A;  1K83 H;  5IWA L;  4GOP A;  1A62 A;  2RCN A;  3K7U C;  4PG3 A;  1Y1W H;  3STB C;  1RL2 A;  4BA1 I;  4DV3 L;  1FVI A;  4A75 A;  3RLN A;  3RZD H;  4PZ6 A;  1HNZ L;  4L5Q A;  1VQ9 A;  1KRT A;  2F52 A;  2B63 H;  1UWV A;  1Y1V G;  1KIX A;  2NVY H;  2YTV A;  2R7Z G;  1VQF A;  3I4M H;  4GKJ L;  1SRO A;  4DUZ L;  2YTX A;  2Z6K C;  4LF9 L;  4XIG S;  5AJ3 Q;  1VQP A;  4LF9 Q;  1Q1E A;  1W3S A;  2N8N A;  5IP7 G;  1Y1V H;  1OXT A;  1VQN A;  1WI5 A;  1XMQ L;  2BH2 A;  4IOC A;  3I55 A;  3OYY A;  3I4O A;  3ULL A;  2R6G A;  1KC8 C;  4GN4 B;  1VQJ A;  2GVB A;  5GAE C;  4A3K G;  2NVT H;  2VUM G;  4HJ9 A;  2XGT A;  4P71 A;  4GLX A;  3KDF A;  1IBL L;  5FLX c;  1L1O A;  2AWN A;  1L1O B;  1LTL A;  3F8T A;  4JI8 L;  2UUA Q;  1WJJ A;  4O2D A;  4OX9 L;  4YCV A;  4QQB X;  2XTI A;  2JA9 A;  3RR5 A;  1ASY A;  4BXX H;  3STB D;  3HOU G;  5M3F G;  1NY4 A;  4GKJ Q;  1Z47 A;  3PV0 A;  3BZC A;  4DV1 L;  4DR1 L;  1UE6 A;  3EBE A;  1E3P A;  4YWM A;  4QJF A;  1PH6 A;  3AYH B;  2MNA A;  4IPD A;  3AFQ A;  3W1G A;  1VQ8 A;  1JT8 A;  1CUK A;  3RN2 A;  1EWI A;  3S15 H;  1G29 1;  4X65 L;  2DUD A;  3M9B A;  4L5T A;  2R93 H;  1Y14 B;  1K73 C;  4R4C A;  4X64 L;  4BY7 G;  4B3T L;  4LNQ A;  1VQM A;  2YTY A;  4JYA L;  1SMX A;  4MZ9 A;  4A3K H;  5E7N A;  4BA2 I;  1BBW A;  1WYD A;  3TRZ A;  1T9H A;  4JG2 A;  5IYD H;  1QUQ B;  4J15 A;  1XPU A;  3HKS A;  5IYD G;  1S3O A;  4GS3 A;  4YHH L;  1GKH A;  2YU9 H;  1NMF A;  4DKA C;  4L5S A;  3A74 A;  1CKN B;  4OXP A;  2VQE L;  3CC4 A;  1EIY B;  2QEX A;  3UDI A;  3PUV A;  4DV4 Q;  2PQA B;  4NXM L;  1D8L A;  4YY3 Q;  1I6H H;  3S16 H;  1VQE A;  3G4S A;  4BY7 H;  4A3L H;  1FGU A;  3CQZ H;  3L0O A;  1VQO A;  2KBN A;  2KCT A;  1NJI C;  4X6A H;  3OTO Q;  4OWX B;  2CFM A;  4DR5 L;  3J81 j;  4KLK A;  4HIO A;  2WB1 G;  1G6P A;  2ZTC A;  4DV0 L;  3CC2 A;  4UP9 A;  4P72 A;  4GKK L;  1OXS C;  4JI3 L;  3BU2 A;  1MKH A;  3TEH B;  4HIM A;  2UUB Q;  4LFA L;  3RNU A;  1IBK Q;  2OTJ A;  1N33 Q;  4X62 Q;  3VDY A;  1Z9F A;  1K8A C;  1A63 A;  5DLQ E;  4B3M L;  5C44 G;  4GLV B;  3W5O A;  1P16 A;  4JI1 L;  4A76 A;  1HZA A;  2NZO A;  2E2J H;  3GTK H;  1IBM Q;  5JEA J;  4A3B H;  5IYC G;  1YHA A;  2A19 A;  1B8A A;  1EOV A;  4GNX B;  1VQ5 A;  5JJI A;  1O7I A;  1YBY A;  1B70 B;  1X3E A;  1VQD A;  2MFI A;  1G51 A;  5H1S E;  5C3E H;  2ATW A;  5C0X I;  4DUY Q;  1PYS B;  1I94 L;  2JA5 G;  3HOY H;  3PUZ A;  1AH9 A;  1PH4 A;  4C3H H;  3AFP A;  3Q8D A;  3UDF A;  3GDE A;  1N34 L;  2E5L L;  3PIP A;  3HFZ B;  5IP9 H;  2Q2H A;  3CAM A;  1XTD A;  3F1Z A;  1KAW A;  2BA0 A;  2R7F A;  4NXN L;  4C3I H;  2MO0 A;  5ELO A;  4DV5 L;  4DR6 Q;  2OQ0 A;  4DR3 Q;  3HOX H;  2V1C C;  2QA4 A;  4B3M Q;  3H3V I;  4X65 Q;  1SLJ A;  2I5H A;  1N8R C;  4DPG A;  4QGU A;  1VQB A;  3J80 i;  4B3S L;  5FLM H;  5LMN L;  3KJP A;  4LFA Q;  3J7Z C;  1EQR A;  1YJN A;  2UUB L;  3K8A A;  4A3D H;  2JQO A;  4Y52 H;  3LGJ A;  4WJ3 M;  2JA7 H;  2N3S A;  4DV6 L;  3CD6 A;  4ME3 A;  4BY1 H;  4DAM A;  2CCZ A;  2ID0 A;  4PMW A;  4B3R L;  1GO3 E;  4QIW E;  1XPR A;  1HR0 Q;  1V9P A;  4OX9 Q;  1JJC B;  3CCS A;  4HJ7 A;  1HNW Q;  3GTJ H;  4BBR G;  5IE8 A;  3DLL A;  4HIK A;  4JI7 L;  1JB7 A;  1FJG L;  3GTQ H;  5J3B A;  4JI5 L;  2JA8 H;  1A0I A;  4A3M H;  1V43 A;  1YZ6 A;  2IT1 A;  1N34 Q;  3HOZ H;  2E5L Q;  2VW9 A;  3U58 A;  1YJW A;  2K50 A;  1KD1 C;  1JMC A;  4LF6 L;  3RLF A;  3ICE A;  2K52 A;  4DR5 Q;  2WFW A;  2K5N A;  4A3C G;  5ELN A;  2K5V A;  2OQK A;  3TQY A;  4POF A;  2Q2T A;  3CW2 C;  1CKM A;  1EUJ A;  4JI6 Q;  3E9I A;  2R92 H;  4AQY L;  2CWP A;  2OCE A;  3PUW A;  4GOP B;  1X65 A;  2JK8 A;  3ERS X;  1A8V A;  2I0Q A;  4LF7 L;  1WCM H;  3MEF A;  2ALY B;  3KLW A;  3GTP H;  3D31 A;  3AEV A;  2VY3 A;  3L2P A;  1VQ7 A;  1SR3 A;  2UUC L;  4A3E H;  3HOW H;  5LMN W;  2YV5 A;  3ULJ A;  1PH1 A;  1XMQ Q;  2UU9 L;  2E2I H;  1KL9 A;  1UEB A;  2VNU D;  3S1R H;  4IO9 A;  2GN5 A;  1UE7 A;  4IOA A;  1WFQ A;  2ZTE A;  1BKB A;  3EIV A;  1XJV A;  1TWH H;  2HQL A;  2N49 A;  2HIX A;  3K0X A;  4PZ7 A;  4LF4 L;  3KYH C;  1Q8K A;  2K5H A;  1L2F A;  4P75 A;  1JJG A;  1Q12 A;  3A0J A;  3OTO L;  5GRO A;  4P73 A;  5C4X H;  1VQK A;  3SGI A;  3PUX A;  3JC6 6;  2WAQ E;  3WWV A;  5M3F H;  4KHP L;  3M4Q A;  5BR8 Q;  3I4M G;  4KHP Q;  4NXN Q;  4A3J G;  4X66 Q;  1QVG A;  1HNX Q;  1CKN A;  1X56 A;  4DNI A;  3M85 A;  4A3F G;  2WAQ G;  3KJO A;  2MQH A;  1N36 L;  4JC0 A;  1VQG A;  1J5E L;  4JI0 L;  3M4O H;  1KXL A;  1XNR L;  2JA8 G;  2JJQ A;  1XMO L;  4LF8 Q;  4AH6 A;  2ZJQ A;  3FP9 A;  5IYB H;  4JV5 Q;  2Z6K A;  3GTM H;  2B3G A;  1QZH A;  3MXN B;  2CKZ B;  4JI4 L;  3E9H A;  4AYB G;  2EQS A;  2WB1 E;  4JCV E;  5GAD C;  5IP7 H;  1E1T A;  3I7F A;  1MJE A;  2UUC Q;  4YY3 L;  2RF4 A;  1X6O A;  3TRE A;  4B3R Q;  2RHS B;  1GM5 A;  4P74 A;  2Z0S A;  5IYB G;  3CCQ A;  2KHI A;  2MO1 A;  3H15 A;  2B29 A;  1HNZ Q;  4IJH A;  4DR2 L;  3T1Y L;  4JI3 Q;  5EAY A;  2ES2 A;  1K3R A;  4LUV A;  4JI2 L;  4DV0 Q;  4DUZ Q;  1CSQ A;  2D62 A;  2AHO B;  3GD7 A;  4QL5 A;  2LXK A;  4X64 Q;  4JOI C;  1Y1W G;  4LFC Q;  1J5E Q;  4BBR H;  4NB3 A;  1H95 A;  3L7Z C;  3GTO H;  1E1O A;  4IPC A;  3B6Y A;  1OXV A;  4GN5 A;  5C0X G;  2ZTD A;  4UY8 C;  1YHB A;  4YCW A;  3KFU A;  2Q2I A;  1DGS A;  4JI6 L;  1PYB A;  2D0O A;  3H0G H;  2PMZ E;  4JI1 Q;  4IJL A;  3H0G G;  4TVA B;  3KDF B;  4XTC S;  1HH2 P;  3G6E A;  1M1K C;  5M5X H;  4DV7 Q;  3CP0 A;  3ULP A;  4YHH Q;  3CCJ A;  1I94 Q;  4DAY B;  3CCE A;  5IWA Q;  3JAM i;  2L15 A;  3PO3 H;  3PO3 G;  3I2Z A;  4JI4 Q;  4KI0 A;  4DR4 Q;  1VQH A;  4LW1 A;  3T1Y Q;  1TXY A;  4HJA A;  1PH9 A;  1XNQ Q;  4DR4 L;  4R4I A;  3KF8 B;  3W1B A;  1WCM G;  4JI7 Q;  2R93 G;  2ZM6 L;  1VQC A;  2QGQ A;  4MTN A;  4TQU S;  4EX5 A;  4LF6 Q;  1OTC A;  3CMA A;  1B7Y B;  4AIM A;  1LUZ A;  3PCO B;  1E7Z A;  2LXJ A;  2ZJP A;  4K0K Q;  5GAG C;  2D0P A;  2A1A A;  3RLO A;  5HGQ A;  2R7Z H;  4AQY Q;  2E8G A;  5C3E G;  3CCM A;  4BXX G;  5FJ8 G;  5LMU Q;  3ZJY C;  3U4Z A;  4LFB Q;  2KHJ A;  1XNR Q;  1VQ6 A;  3UE1 A;  1MJC A;  5IT9 c;  2YYZ A;  4LFB L;  2KEN A;  3RN5 A;  3UE0 A;  1C7Y A;  1K8G A;  4POG A;  1HZB A;  1YI2 A;  1N32 L;  4UP7 A;  1S40 A;  1C9O A;  1Q81 C;  1IBM L;  4GOP C;  4A93 G;  3F2B A;  3CF5 A;  3S17 H;  2H5X A;  2EIF A;  1VCI A;  1WOC A;  1CKO A;  1PH2 A;  1TWA H;  1FJG Q;  1W2B A;  1QVF A;  4GNX C;  2UXD Q;  2RHQ B;  1L1O C;  3GTG H;  2UXD L;  2AKW B;  1VQA A;  4AYB E;  2ZM6 Q;  4JBJ A;  3A5U A;  4DV6 Q;  2JE6 I;  1CSP A;  4YCU A;  4HJ8 A;  2NN6 G;  3UDX A;  1XNQ L;  4OO1 G;  1VQ4 A;  3PF4 A;  1IYJ B;  1IZ6 A;  4GKK Q;  4HJ5 A;  3HOV G;  3HOV H;  4YWL A;  4DV1 Q;  2EXD A;  3NEN A;  4DR1 Q;  1VS0 A;  3HOZ G;  2UXB L;  2Q2U A;  2KCM A;  2CQO A;  2ASB A;  2VL6 A;  4IFD J;  1LYL A;  2GVA A;  5LMU L;  1YVC A;  3A5Z B;  1SRU A;  1UE1 A;  2HIV A;  4A3G G;  1N33 L;  2JA6 G;  1PHJ A;  4LF5 Q;  4BY1 G;  3PO2 H;  3HOW G;  2JA5 H;  3HOY G;  3FKI H;  1KRS A;  3K80 C;  2I5M X;  4R4T A;  4A93 H;  1HR0 W;  1K0R A;  4OO1 I;  4DUY L;  3BZK A;  5HY6 A;  3I56 A;  3CCV A;  4WJ4 A;  1QUQ A;  4A3E G;  1YJ9 A;  3KF6 B;  4BBS H;  4UP8 A;  2VUM H;  2DGY A;  3DM3 A;  1BVS A;  1PH8 A;  2UU9 Q;  4JI5 Q;  2WP8 J;  3CXC A;  3CCL A;  3K7A H;  5K36 G;  1X3G A;  1U5K A;  2C35 B;  2IHE A;  2JEA I;  2VQF Q;  2A8V A;  3S2H H;  4A4I A;  4DR3 L;  1ASZ A;  3IRB A;  5C4X G;  2NN6 I;  2F4V L;  3J80 c;  3U4V A;  4DV2 Q;  4A3C H;  3FHW A;  1GD7 A;  1EFW A;  4JV5 L;  2BA1 A;  1VQL A;  1AE3 A;  1I5F A;  5GQO A;  2K14 A;  3CME A;  1PH3 A;  1JE5 A;  1EYG A;  3M3Y H;  1D7Q A;  1QVC A;  2IX0 A;  4A3I G;  1PH5 A;  2NVQ H;  3T1H L;  4GLA C;  4HID A;  3TS0 A;  1JJ2 A;  2B63 G;  5C4J H;  4BBS G;  2IY5 B;  3T1H Q;  3U50 C;  3EN2 A;  1PA6 A;  4A3B G;  2UUA L;  3PUY A;  3CPW A;  1AE2 A;  1X54 A;  3D0F A;  4C2M H;  3S24 A;  3M7N A;  4IPH A;  3PIO A;  1PV4 A;  4L5R C;  2UXC Q;  3PF5 A;  2UXC L;  4IFD I;  1IBL Q;  2BH8 A;  1HR0 L;  2JA7 G;  1GVP A;  1N9W A;  4NPS A;  3PGZ A;  3RZO H;  2LSS A;  2N78 A;  1YIT A;  1EQQ A;  1K9M C;  2VZA A;  2JA6 H;  1UE5 A;  3S1M H;  1SFO H;  4A3G H;  3PSI A;  2R92 G;  2I5L X;  2JEB I;  3ER0 A;  1EIF A;  3BJU A;  3E0E A;  3S1Q H;  4C3J H;  1Q7Y C;  1Q86 C;  1OXU A;  4KHZ A;  4GN3 B;  4DR2 Q;  1V1Q A;  4LUO A;  3J81 c;  1HZ9 A;  3GO5 A;  2FXQ A;  5IY0 A;  2R7D A;  4RMF A;  1R9T H;  1C0A A;  1PH7 A;  4JYA Q;  4A3L G;  2AWO A;  3S2D H;  5C0X J;  3S1N H;  1N36 Q;  1QZG A;  3M4P A;  4JI0 Q;  3CPF A;  3TS2 A;  4JBW A;  5M5W H;  4X62 L;  1HJP A;  4DK6 C;  1YIJ A;  4GNX A;  4LF7 Q;  3G48 A;  4LF5 L;  4EQ5 A;  5M3M G;  3S14 H;  5C44 H;  1PFS A;  4LFC L;  2PI2 E;  5JEA G;  4YWK A;  3GTL H;  1HZC A;  4DV4 L;  4NXM Q;  3PO2 G;  1YHQ A;  3KOJ A;  1KHI A;  4DK3 C;  4B3S Q;  4PZ8 A;  1SN8 A;  3F2D A;  4ALP A;  2K4K A;  5IYC H;  1P8L A;  4LF4 Q;  1TWG H;  1S72 A;  4FDB A;  5FLM G;  1I3Q H;  4OON A;  4UPA A;  5JJL A;  1NE3 A;  4A3I H;  1U0L A;  2NVX H;  5FJ8 H;  4JBK A;  4R4O A;  1PVO A;  1NTG A;  4A3F H;  1LM0 A;  1OXX K;  2OWO A;  3G71 A;  4OWW B;  2VQF L;  1TWF H;  4A3J H;  4O0A A;  5GAH C;  2F3I A;  2ZJR A;  4OWT B;  1MIU A;  2OTL A;  5JJK A;  1IXR A;  3F2C A;  3JAM c;  2IX1 A;  3AQQ A;  2HHH L;  4DR7 L;  3KF6 A;  4MNO A;  4JI2 Q;  1SE8 A;  3NBH B;  1XPO A;  3HOU H;  2CWA A;  3NEM A;  1N32 Q;  1L0W A;  2PQA A;  2AMC B;  4JOI A;  3CCU A;  4APV A;  2Y0S E;  3HKZ G;  5LMN Q;  4A3M G;  4Y7N H;  1XMO Q;  4LF8 L;  4LUZ A;  1I50 H;  4B3T Q;  3J81 i;  4A3D G;  4DV7 L;  2NZH A;  2Y0S G;  3HKZ E;  4JI8 Q;  3K81 C;  4DV3 Q;  3OW2 A;  1HNW L;  3FKI G;  4H02 A;  1KQS A;  1NBW A;  2PI2 A;  4QY7 A;  3CCR A;  1X55 A;  2IHF A;  3J7A 5;  1J6Q A;  2VQE Q;  1Q1B A;  1M90 C;  5M3M H;  1RIP A;  3CC7 A;  1IL2 A;  5M5Y H;  2VS1 A;  3I4N H;  1VQI A;  2E2H H;  3HOX G;  4IFD G;  3UDG A;  2HHH Q;  4DR7 Q;  3H3V H;  4R1J A;  1FL0 A;  5BR8 L;  2F4V Q;  1Q82 C;  1Q46 A;  4RG1 A;  4DV2 L;  2HT1 A;  1TWC H;  3NEL A;  4K0K L;  5IP9 G;  1X9N A;  4IPG A;  2PNH A;  4LWC A;  1BBU A;  3I4N G;  4DV5 Q;  4DR6 L;  4R4Q A;  1E22 A;  4X66 L;  1NMG A;  1IBK L;  1HNX L;  1E24 A;  2UXB Q;  1X3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...