2JQOA

Nmr solution structure of bacillus subtilis yoba 21-120: northeast structural genomics consortium target sr547
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics
molecule keywords Hypothetical protein yobA
publication title NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547
rcsb
source organism Bacillus subtilis
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jqoA01
4YCWA 4DV4Q 1HZCA 1Q1EA 4R4CA 2K5NA 3BZCA 1HNZL 1N32L 2ZJRA 3M4OH 2JA6G 2UXDL 1I3QH 3J81j 1PVOA 4GLVB 2I5MX 2QA4A 2UUCQ 1JJCB 3HKZE 1GM5A 4YCUA 1VQ9A 5JEAJ 3KYHC 1R9TH 2BH2A 3H15A 1V43A 4LFCQ 1Y1VG 1EWIA 3K81C 2A19A 5ELOA 2AMCB 1YIJA 2JEBI 3AFQA 4JI4Q 2ALYB 2PQAA 4X6AH 1BKBA 1A63A 2DUDA 1CKMA 1K8AC 3I55A 4LF9L 1YJWA 3K7AH 3S15H 1YNXA 2EXDA 3AQQA 2D62A 3CP0A 4H02A 3GO5A 2NN6G 5LMNL 2CKZB 4JI7L 4JBKA 1SFOH 5C0XJ 3F2DA 1OXUA 1HZAA 2KCMA 3CCVA 1HJPA 1EQQA 1KD1C 1L1OA 2FXQA 1NJIC 1BBUA 3Q8DA 2GVBA 1XMQQ 3RLNA 2UUBL 2R7ZH 4JI0Q 1XMOQ 3S17H 2MO1A 4B3ML 1X54A 4BA1I 1PV4A 4GOPC 5M3FH 1HNZQ 2OCEA 2JE6I 4GLAC 4K0KQ 1VQPA 2K52A 5HY6A 1LUZA 5IYBH 4LFBL 2HIXA 2YV5A 1UE7A 2WP8J 1VQNA 2JA7G 4GKKL 1NE3A 3PCOB 1QUQA 4L5RC 3IRBA 2JA9A 5C0XI 2ES2A 1VQ6A 5C4XG 2K75A 3UE0A 3H0GH 4OX9Q 1VQOA 2EQSA 2JEAI 4LF9Q 4UP8A 4JC0A 2CQOA 4QL5A 1OXVA 2VY3A 1M1KC 1H95A 4IFDI 2R7ZG 4A93H 2UU9Q 5M5WH 3W1BA 4PG3A 2K5HA 3G48A 4IPGA 4DUYQ 4Y52H 2YTVA 4A3MG 2MO0A 2UUAL 4A4IA 1TWGH 5GAEC 4DV5Q 3AEVA 4JBJA 4JI5Q 4B3MQ 1VQHA 4DAYB 1KHIA 1KL9A 1YJ9A 1P8LA 2F4VL 5BR8Q 2ID0A 4JOIA 3CAMA 3RR5A 4LFAL 1E7ZA 1QVGA 2NVTH 1QZGA 3KJPA 4A3EG 2IHFA 4UP7A 1LTLA 1QVCA 4DKAC 4LF7L 4YWKA 2VL6A 3S24A 4GKKQ 1TWCH 4KHPQ 4DR7L 1W2BA 3KDFB 1PH6A 3AYHB 4ME3A 2JJQA 4A93G 1J5EL 2AWNA 3I56A 2YTXA 1TXYA 5JEAG 2NZHA 1PH8A 1Q1BA 4QGUA 5ELNA 1X3FA 3U4VA 3OYYA 4DPGA 4DV2Q 4L5QA 4BA2I 4R4OA 4GNXA 4IOAA 1E22A 1HH2P 3CW2C 2N3SA 3UDXA 5C3EH 1K0RA 2N8NA 4JCVE 4JI2L 3PV0A 1O7IA 1TWAH 1KRSA 3S1QH 2KHIA 3PUYA 1NBWA 4IPDA 3U58A 1L2FA 1I94Q 5J3BA 2UUAQ 3I4MH 3RLFA 2UXCL 2IY5B 3F8TA 3CC2A 3S2DH 1UE5A 1SLJA 5LMNW 1AH9A 3CC7A 3U50C 3H3VI 3GTQH 4DR6L 1OTCA 2Q2HA 3HOZH 1MJCA 1Q86C 1EYGA 3CCMA 1UE6A 1K73C 5IWAL 4R4QA 2JA8H 2F4VQ 3I7FA 1U5KA 3RZOH 4GS3A 4LFAQ 2VUMH 1HR0L 3GTOH 4QQBX 4BY7H 2R7DA 1AE2A 1HZ9A 3DM3A 3ULJA 4X65L 1IYJB 4A3BH 4IOCA 1SR3A 4LW1A 4DAMA 5LMUL 3HOUH 4DR7Q 2KBNA 4HJ5A 5EAYA 1WJJA 4PMWA 1J5EQ 3F1ZA 1DGSA 3T1YL 4LF6L 1KC8C 4C3HH 1N8RC 3HOYG 4OWXB 4X66L 4HIMA 2LXJA 4B3RQ 1EQRA 3CCRA 4DV1Q 1CSPA 1NMGA 1X3EA 3B6YA 2RF4A 3KOJA 4A3IH 1VQEA 1PH9A 4R4TA 1Z9FA 4YCVA 4A3LH 2CWPA 4B3TQ 1EIFA 1PYSB 3HOZG 3LGJA 2ZTDA 1VQ8A 3H3VH 1V1QA 1IXRA 4GOPB 1PA6A 3M3YH 3PO3H 1HNWL 3A0JA 2PMZE 2IT1A 3MEFA 3ULPA 2VUMG 4LUOA 3GDEA 3K80C 4O0AA 4QIWE 2DGYA 4X64L 1PH3A 4UY8C 4DR6Q 1IL2A 4JI3L 3J7A5 1VQGA 4A3BG 2OWOA 5IWAQ 3HOUG 1PH1A 1VQCA 1NMFA 4LNQA 4DR3Q 3AFPA 2HT1A 3K0XA 1HR0Q 3PO2G 2OQ0A 3CMAA 3HOXH 1B8AA 1U0LA 3GTPH 4B3RL 4LF4L 4BY1H 1UE1A 4IPCA 5AJ3Q 1FJGL 3J80c 4C2MH 5E7NA 3CCQA 2R93H 2RHQB 4JI6L 3OW2A 4JBMA 1X56A 3F2BA 1JMCA 4A3LG 4A76A 1IBML 4OO1G 2CFMA 3M4QA 1YHQA 4IFDJ 4LF6Q 4OXPA 4HJ9A 3CF5A 3CMEA 3KFUA 3L7ZC 1WCMH 1GO3E 5HGQA 1G51A 2R6GA 4AYBE 4DR5L 1N32Q 5IYCH 2UXDQ 3M9BA 3VDYA 4DV6L 2YYZA 3NENA 4A3GH 1CKNA 4JG2A 1EUJA 2EIFA 1SRUA 4IJLA 2WFWA 1HNWQ 2R7FA 3PGZA 1XNQL 3OTOL 3E9HA 4JOIC 3KF6A 4IO9A 1YEZA 3G4SA 2Z0SA 3HOWH 4XTCS 2JK8A 2Z6KA 4X64Q 2WAQE 1D8LA 1VQMA 4JI3Q 2MNAA 4L5SA 4LF8L 5IYDH 4C3IH 5C44H 1EFWA 4A3CH 1GKHA 1C0AA 1CSQA 1G6PA 5C4JH 1E1TA 5LMNQ 3U4ZA 4HJ7A 1Y1WH 4JI7Q 3PUWA 3TS0A 3CD6A 2UXBL 2JQOA 2D0PA 1X55A 2VW9A 1VS0A 4DV3L 4LUZA 2VNUD 4DR4L 1YJNA 5M3FG 3PUVA 1IBKL 5JJIA 4GNXC 1KIXA 4JI6Q 4NXML 5IYCG 3M7NA 4JV5L 4NPSA 2UUBQ 4P75A 2GVAA 1HR0W 3CCSA 3F2CA 4A3GG 3TREA 5IYBG 2KCTA 1I6HH 4A75A 1A8VA 3NBHB 3PF4A 1NY4A 1PFSA 1OXTA 4JI8L 4YY3L 1MKHA 4LUVA 4DR5Q 3J81i 1OXXK 1JE5A 3H0GG 2OTLA 1C9OA 3FKIH 3I4NH 3HOWG 4DR2L 4PZ8A 4DV6Q 2Q2UA 2K14A 4MNOA 3CQZH 4LFBQ 1Q12A 2I5HA 5IYDG 1KAWA 2A1AA 2K5VA 4P71A 5C44G 1W3SA 3HOVH 4YWLA 2ZJPA 3OTOQ 4DV0L 4PZ6A 2HHHL 3NELA 4POGA 1N33L 2PQAB 4HIKA 1OXSC 3D31A 3UE1A 3J81c 1KQSA 1FVIA 2IHEA 4DV7L 1X9NA 4LF8Q 1Q46A 5JJLA 3PF5A 2KHJA 2R92H 4RMFA 5IP7H 4GN5A 4A3FH 4Y7NH 1VQJA 3JC66 5FLXc 4YHHL 3ICEA 3GTGH 2UXBQ 1MIUA 3PSIA 1L0WA 4AQYL 1K9MC 3K8AA 3EN2A 1L1OB 1YZ6A 4NXNL 1VQ7A 5IP9H 1VCIA 2HIVA 1TWHH 4LWCA 4AH6A 4JI1L 4B3SL 1VQKA 1XJVA 4JV5Q 3FKIG 1K83H 4KI0A 2B29A 1XTDA 5FLMH 1UWVA 5C0XG 1C7YA 1GD7A 1LYLA 4YWMA 1Q81C 1LM0A 1X3GA 3DLLA 1E24A 4QY7A 3UDGA 2OQKA 2A8VA 4JI8Q 2VQEL 2F52A 4BBRH 4DV4L 3RN5A 1SE8A 3KJOA 1ASYA 1QVFA 2AHOB 4BBSH 4BXXH 2NN6I 4IFDG 2B63H 2JA5H 1N36L 2I5LX 2K4KA 3FP9A 4LF7Q 1K3RA 3A5UA 2UUCL 1XPUA 1QUQB 1WOCA 2HHHQ 3KF6B 2Y0SG 2QGQA 2ZTCA 4LFCL 3ZJYC 5C3EG 1N9WA 4WJ3M 4FDBA 3W1GA 2N78A 1L1OC 1IZ6A 2ATWA 2JA6H 5IP9G 4MTNA 2ZTEA 1Z47A 3I2ZA 3I4MG 3E9IA 2RCNA 1JJGA 4YHHQ 4AQYQ 2E2HH 1Y1VH 3BU2A 3KF8B 1XNRL 4JI2Q 1B7YB 2NVYH 1VQBA 3CCJA 1I5FA 4DR1L 1Q82C 2JA8G 5IY0A 3TQYA 2UXCQ 4BBRG 4PZ7A 2ASBA 4KHZA 2V1CC 4BBSG 2CCZA 2PI2E 4BY7G 1P16A 1GVPA 3J80i 2JA5G 3G6EA 3ER0A 2B3GA 4GKJL 2XTIA 2Y0SE 3UDIA 4AYBG 4X62L 1XMOL 4WJ4A 1T9HA 1JT8A 2VQEQ 4XIGS 2IX0A 5FJ8H 4RG1A 1TWFH 4OWTB 4R1JA 4TVAB 2Z6KC 1VQ4A 1WI5A 1N36Q 3S14H 4K0KL 4UPAA 4X65Q 2VQFL 1I50H 3S1RH 4LF5L 5LMUQ 2BH8A 2PNHA 4L5TA 4DK6C 1XPOA 2WAQG 3CCUA 4A3IG 1Y14B 4JBWA 4C3JH 3KDFA 5GROA 4ALPA 3T1YQ 1E3PA 1HZBA 2K50A 4OX9L 4QJFA 4X66Q 5GADC 1Q7YC 3S16H 1KRTA 3PO3G 4DK3C 3RLOA 5M5YH 4GNXB 1YBYA 2JA7H 4HIOA 3K7UC 1B70B 4AIMA 5C4XH 1XNRQ 1VQLA 1J6QA 4P72A 1XPRA 1N34L 2UU9L 4DR1Q 1PHJA 1IBLL 2BA0A 4A3JH 1S72A 4DUYL 1ASZA 1CUKA 4NB3A 5FJ8G 3FHWA 3CPFA 4P73A 1JB7A 2YU9H 2NZOA 1HNXL 4R4IA 4DV5L 4GKJQ 3HOXG 4X62Q 4JI5L 5M5XH 3RN2A 3D0FA 2OTJA 2R93G 4APVA 2E2IH 3JAMi 4A3MH 2AKWB 1A62A 2AWOA 5BR8L 3CCEA 1M90C 1X65A 3PIPA 1PH4A 4EQ5A 1YHAA 2Q2IA 4GLXA 1VQ5A 4IJHA 4KLKA 1YI2A 2E2JH 2VQFQ 4LF4Q 2VS1A 1X6OA 1YITA 4LF5Q 1WCMG 3HFZB 1FJGQ 3TEHB 4OWWB 1BBWA 4HJ8A 2D0OA 3CCLA 3BJUA 4KHPL 1IBMQ 5GAGC 2RHSB 5JJKA 2C35B 3JAMc 4A3DH 4J15A 3L0OA 1KXLA 4A3JG 1VQAA 4A3EH 1VQIA 3CXCA 4A3KH 2KENA 2L15A 4DUZL 4DV2L 3CPWA 3RNUA 3SGIA 1G291 2ZM6L 2YTYA 3EIVA 1PH2A 3STBD 1N34Q 3MXNB 1E1OA 1IBLQ 1EOVA 2XGTA 3PUXA 1XNQQ 3TRZA 4OONA 4HIDA 4GOPA 1Y1WG 1I94L 3GTLH 1HNXQ 3T1HL 5IE8A 3W5OA 3S1NH 1QZHA 3A74A 2H5XA 3UDFA 3G71A 3ULLA 3GTJH 4GN3B 2Q2TA 5IT9c 2I0QA 3GTKH 2BA1A 3PIOA 2NVQH 3A5ZB 2N49A 4UP9A 4A3DG 1S3OA 3STBC 4DV3Q 1CKOA 1YVCA 4O2DA 4DR4Q 1IBKQ 2LXKA 1A0IA 4A3KG 1D7QA 4NXMQ 3TS2A 4JYAL 1SMXA 4TQUS 4EX5A 3I4NG 2CWAA 3GD7A 2GN5A 2MQHA 3S1MH 3M85A 3ERSX 1UEBA 2F3IA 4YY3Q 2E5LL 4DUZQ 1S40A 3HOVG 4POFA 1FL0A 2E8GA 2ZJQA 3E0EA 2PI2A 3EBEA 3BZKA 3L2PA 2QEXA 4DV1L 3J7ZC 4DR2Q 1EIYB 2ZM6Q 1BVSA 1CKNB 5M3MH 1K8GA 4A3CG 1V9PA 4B3TL 2R92G 3HOYH 5IP7G 4DV0Q 2VZAA 1PYBA 4A3FG 3PUZA 1N33Q 3GTMH 2IX1A 2HQLA 2WB1G 3T1HQ 3RZDH 1Q8KA 1YHBA 4OO1I 4DNIA 1JJ2A 5GQOA 4DV7Q 4JI4L 3M4PA 1PH7A 1MJEA 1VQDA 3I4OA 3NEMA 3S2HH 1WFQA 2LSSA 3HKSA 5GAHC 1FGUA 4GN4B 5FLMG 4HJAA 5DLQE 3HKZG 1VQFA 4DR3L 1PH5A 2NVXH 1RL2A 4NXNQ 4JI1Q 4P74A 4MZ9A 4B3SQ 4JYAQ 5AJ3L 4BY1G 5H1SE 4BXXG 2B63G 1SN8A 5M3MG 3KLWA 1XMQL 1RIPA 2WB1E 3WWVA 4JI0L 3PO2H 5K36G 3CC4A 1NTGA 2MFIA 1AE3A 1SROA 1WYDA 2E5LQ 4IPHA
chains in the Genus database with same CATH superfamily
5C4ZA 3C46A 3NE5B 4DV4Q 1DD2A 3LWUA 1B2TA 1HNZL 3AB9A 2JA6G 1QCBD 1I3QH 5EJWA 2I5MX 4RHRA 1GM5A 5I2XA 2BH2A 2B2YA 1UEAB 1V43A 5ELOA 1EWIA 3NPPA 3D4DA 2JEBI 3AFQA 2ALYB 1M8AA 2F4IA 1BKBA 2B8FA 1PTOB 1SNDA 1STBA 2EZVA 4P2CB 1V1PA 4JI7L 4JBKA 1STAA 2K1BA 5K5PA 1L1OA 2E75C 2FXQA 5G3LF 5FK9C 2HD3A 4L63B 3I3CA 1SMYD 1NNXA 2R7ZH 5C3XA 3HS0C 1X54A 4KD3A 1Q8IA 4QIWB 4XYOA 4C3JG 1TU2B 4DXFA 1HNZQ 4DXGA 1V1OA 2Y0SB 4MN3A 2NTSA 2XRQD 2K52A 1D5XC 5HY6A 3C1FA 5EPJA 5LHY1 3VA7A 1QUQA 1RD9D 2SEBD 3X3NA 2EQSA 2CH4A 3CU7A 4JC0A 4ZQ3A 4QL5A 1OXVA 2VY3A 1H95A 1CQFA 4I65A 2VUMB 1EZ6A 4A93H 4BY7B 1STHA 2UU9Q 3E3XA 4PG3A 5JEAH 4IPGA 4A3BB 2MO0A 4A4IA 5GAEC 1BF4A 3AEVA 4C3HB 3T4AC 3TBIB 2F0OA 1RTNA 5BR8Q 2WAQB 1EWCA 2F0VA 1D5MC 1E7ZA 1ICWA 3T56B 4XQJA 4HMIA 1QVCA 1Y8OB 4YWKA 2A6ED 2F3VA 4DR7L 2NYZD 4GZYC 4ME3A 1J5EL 2WKCA 5ELNA 2PZUA 1E22A 1HH2P 2N3SA 5C3EH 3GTPB 1KRSA 1TWAH 1EY9A 5FOBB 2R93B 4C2MB 3U58A 1L2FA 5IGEA 3F8TA 3S2DH 4KKSA 2EY5A 3HZXA 3GTQH 2Q2HA 2JSOA 3J80L 1KABA 1S5FD 3SXHA 5CV7A 3GTOH 4QQBX 1AE2A 1HZ9A 2F0IA 3DM3A 3ULJA 4X65L 1IYJB 3HOUH 3MHBA 4DR7Q 4HJ5A 1WJJA 4N8X1 1STYA 1J5EQ 3K57A 1DGSA 1I4QA 3SDZA 1STNA 1CSPA 1ZYRC 1NMGA 2RCFA 5C4JB 4A3IH 1E2VA 1PH9A 2CWPA 2F0WA 1VQ8A 2ZTDA 2PCFB 3SR1A 1V1QA 1RHPA 3M3YH 2RA4A 2PMZE 3F2UA 3PMFA 5I6YA 4X64L 1NCVA 5KIXA 1VQGA 4QCLA 2OWOA 2B8GA 5I4DA 1NMFA 1PMRA 3AFPA 2L4NA 3CMAA 4PMBA 3HOXH 4CJ0B 1O80A 2ICIA 1X56A 2E2DC 1JOOA 1IBML 5I6WA 3KFUA 5JAVA 2FHTA 4AYBE 4DR5L 1N32Q 2O4XA 2PZTA 4BWGB 3QG1A 4A3GH 2F0UA 4JG2A 1LT3D 4J1MA 3CKIB 1SYFA 2R7FA 1XNQL 3OTOL 2K01A 2NUCA 4IO9A 2Z4IA 3HKZB 4X64Q 2Z6KA 3HOWH 2EY2A 5IYDH 1SE2A 3VYTA 1WTRA 1S4ZA 3QO2A 1GKHA 1PRTF 1JWMD 3MVVA 5KRUA 2B63B 2AUKA 4DV3L 4JVZA 3BYTB 4LUZA 4DR4L 3WOEA 5JJIA 3LX0A 3VR4A 4NXML 4NPSA 5ELFA 2GVAA 5IYBG 2KCTA 3J7AF 2JYOA 2EJFC 3RD4A 2VB3X 1NY4A 1CA5A 4DR5Q 5I9OA 4DR2L 2K14A 4MNOA 5IGFA 3MFYA 4YWLA 4RKBA 3OTOQ 1WTWA 4POGA 1QE6A 1N33L 1TY0A 4HIKA 1OXSC 3D31A 1FVIA 4KJOA 3A54A 1Q46A 1EL0A 3PF5A 2LY7A 4A3FH 4Y7NH 1V1PB 3VR6A 4AQYL 2K04A 3K8AA 1L1OB 1VCIA 3I70A 4LWCA 4S3SA 3V2TA 4NKLA 2B29A 2RKSA 5TSSA 4WFN3 1Q81C 1LM0A 3DLLA 4K5VA 1E24A 2G9DA 3P75A 5NUCA 3UDGA 2OQKA 2Z1CA 1ASYA 1QVFA 1SE8A 4IFDG 5C4XB 4BBSH 4IUPA 2JA5H 1N36L 2WACA 3K0YA 4TKOB 3UI2A 4LF7Q 2UUCL 1QUQB 1EYAA 2NTTA 3KF6B 2Y0SG 2QGQA 3ZJYC 1F9SA 2F0EA 3W1GA 5M5XB 2DNEA 3T16A 2JA6H 1U4LA 1Z47A 2QDBA 4A3MB 3DXJC 4N9TA 4AQYQ 2E2HH 3ONAB 2OXPA 3C3LA 2NVYH 3LWEA 2HCIA 2MUYA 5EKIA 1QNUA 4KHZA 4BY7G 3G7LA 3J80i 4GKJL 3G6EA 3ER0A 2FMCA 4X62L 1TQOA 4IUVA 1K28A 3HEJA 4DAYA 4O1NA 2IX0A 5FJ8H 1EZ8A 1PZKD 4OWTB 1WD1A 3BDLA 2Z6KC 2FINB 1VQ4A 1N36Q 4R8IA 3SHLA 4UPAA 1I50H 3S1RH 5LMUQ 5KEEA 3SE0A 2WAQG 2F0JA 4C3JH 1S5ED 3D8GA 5DAUA 5GROA 3T1YQ 1QNKA 1HZBA 3BG3A 4OX9L 1AEXA 2DJFC 4X66Q 5A35A 1KRTA 2K05A 3RLOA 2B2VA 1RF2D 2WB1B 2ICEC 4AIMA 1B70B 1A6XA 2WINB 1VQLA 1ILPA 1XPRA 2NVTB 3GP7A 1DCZA 1CUKA 4NB3A 1K3BC 3FHWA 3O13A 4DFAA 2YU9H 2G9HD 4DV5L 4GKJQ 4WRDA 4X62Q 2OTJA 2R93G 4XDXA 2E2IH 2CHBD 4BY1B 1LT6D 2AKWB 3L3OC 4UHVA 4NW2A 1EEFD 2Q2IA 4IJHA 4KLKA 4X3TA 2E2JH 1YITA 3HOYB 2KCCA 3A7AB 3BJUA 4KHPL 5JJKA 3JAMc 1BO0A 4YIJA 4J15A 4KV6A 5CV4A 3NP8A 3W2DA 2KENA 4L6TB 3NBIA 2BE5D 2EVBA 1E1OA 4DK0A 5I9PA 3T13A 1HQMC 3PUXA 3TRZA 1I94L 3T1HL 4EQOA 3W5OA 4OIJA 4FF2A 2EY1A 1D1IA 1EY7A 3U9SA 1CHPD 5IODA 2I0QA 4QB4A 3QIAA 4WJWA 3PIOA 2N49A 5EBDA 3STBC 5CV9A 2MJ8A 1IBKQ 2LXKA 1D7QA 3NTKA 1R9TB 1EY8A 1SMXA 4TQUS 3GD7A 3NHHA 2GN5A 1RDPD 3H91A 4JPBW 1EEID 3TZDA 2A69C 4DK1A 3K7AB 1UEBA 4F7XA 4ZYSA 3OWEB 4K8IA 3J7ZC 3CRKC 5M3MH 1SFOB 1K8GA 1DZ1A 1A2TA 4DV0Q 2VZAA 4IQZA 3GTMH 3PUZA 1K0SA 2RSNA 2IX1A 2HQLA 3T1HQ 3RZDH 1BCPC 1MJEA 3TMEA 1WFQA 3HKSA 3GV6A 4GN4B 1ZYRD 2F1MA 2F0FA 1VQFA 3HKZG 2NVXH 1D1KA 1RL2A 4HEDA 1YNNC 4P74A 3DHQA 5AJ3L 5HURA 3H0GB 2B63G 5K36G 2EJGC 1I4GA 4O42A 2K28A 4L8JA 3N52A 1JCKB 1HZCA 1V8QA 4R4CA 2K5NA 4OHJA 3NTIA 3K5LA 2UXDL 1SJED 4GLVB 5DM63 2QA4A 1JJCB 4F8MA 2C9OA 5CORA 4RH6A 3SK8A 1IW7C 1GUOA 3H15A 4LFCQ 1TWGB 4OL7A 1SYDA 3Q0AA 1NR2A 1RODA 3MXGA 2DUDA 1FGBD 3I55A 3V05A 1YJWA 2A73B 3TDQA 3S15H 3TP8A 2EXDA 1GUGA 5EGTA 1J8IA 2D62A 3FKIB 3OW7A 3GO5A 4H02A 2NN6G 1BUVT 1OXUA 2KCMA 3CCVA 1HJPA 2KEDA 1TWCB 1BBUA 2GVBA 3VA5A 1XMOQ 1KNEA 2MO1A 1ENFA 1KDAA 4ID6A 1PV4A 5CV8A 1DM0B 1EWHA 3SVMA 3RUZA 1LUZA 5IYBH 3S1QB 4LFBL 2YV5A 1PTOC 3FMCA 1SNQA 1TWHB 3BZDB 4GKKL 3NQTA 3I4MB 4L5RC 3IRBA 2JA9A 5C0XI 1VQ6A 5C4XG 2K75A 2RBMA 3UE0A 4BS9A 4TRDA 1VQOA 4I7AA 3A56A 2V4DA 4UP8A 2KVMA 2JA8B 3TP7A 1JWSD 3RZOB 4BBRB 2F0PA 5JOBA 4FO2A 3GQBA 2Z6BA 2K5HA 2LFNA 3G48A 4Y52H 4X3KA 3E6ZX 4A3MG 2M9VA 4ZRZA 1QJOA 1GHKA 3VYSA 1K8OA 4JI5Q 1AW7A 1VQHA 4DAYB 1C4QA 1KHIA 1PTOH 2F4VL 2K6AA 4JOIA 1F2MA 4LFAL 1LO5D 2LKVA 3MC0B 3U9OA 2IHFA 4UP7A 1LTLA 2FFKB 4DKAC 3PO3B 2VL6A 4GKKQ 1FNVA 1PRTB 4IUUA 1W2BA 5CMDA 3AYHB 4IFDH 2YTXA 1F9RA 4OELB 2RVLA 4BA2I 3U4VA 4DPGA 4QMGA 4GNXA 3DEOA 3CW2C 2N8NA 4JI2L 1U4RA 1O7IA 4IZ8A 2KHIA 4IPDA 3MAQA 2UXCL 1B3AA 5LMNW 4UDUC 1TY2A 3EROA 3U50C 5FO7B 3H3VC 4DR6L 1Q86C 1B9MA 1WCMB 2M00A 2F4VQ 1U5KA 3DWQA 4LFAQ 2VUMH 4BY7H 5C6AA 4A3BH 4IOCA 3DM1A 2HQEA 1RJTA 3A7LA 3ERQA 5EAYA 1GUNA 4F88A 3F1ZA 3HOYG 1TT2A 4C3HH 1KC8C 3CCRA 3J80E 1Y1WB 2A74C 4OO1H 4YCVA 4A3LH 1EIGA 3HOZG 3H3VH 3MXNA 1HNWL 3BVZA 1SJHD 2QW7A 3ULPA 1O7YA 3GDEA 4QIWE 2CH4W 4DR6Q 4A3DB 1IL2A 2EPBA 1O7LA 4V190 4RGNA 2MGSA 2XVSA 5EPLA 3A8KE 4RHSA 5JJZA 2HT1A 1EQTA 1G2TA 1BOSA 1BDOA 3GTPH 4LF4L 4IPCA 3J80c 4C2MH 3HOVB 2R93H 2KQ3A 1HTLD 3F2BA 5J39A 1IL8A 4MTKA 2C5CA 1YHQA 1XTCD 4IFDJ 4OXPA 1ZEQX 3SK4A 3CMEA 3L7ZC 1GO3E 1T5XD 1IYUA 3VDYA 4DV6L 1GUSA 4I7ZC 4IJLA 1HNWQ 3DEPA 1SBBB 2B2UA 3E9HA 4JOIC 4CDCC 2KECA 3KF6A 4DF7A 4KN7C 2Z0SA 2WAQE 1D8LA 2MNAA 4DGZA 3S1MB 2B2WA 3C2PA 1EFWA 1XX8A 1CSQA 3BDCA 4ZAIA 5C4JH 1G6PA 4JI7Q 3CD6A 3V96A 1H9SB 1UNSA 1X55A 1Q90A 1DOLA 2SNMA 4GNXC 5IYCG 3I8ZA 1HR0W 1DONA 3CCSA 3BVGA 3F2CA 1A8VA 2L1BA 3PF4A 1PFSA 1OXTA 1HTPA 4YY3L 1DOMA 3J81i 3H0GG 1Y1VB 4HSPA 4PZ8A 4DV6Q 2I5HA 1PZID 1A2UA 4C3IG 4P71A 2K5VA 5C44G 1W3SA 4A3CG 3Q24A 3NELA 1O7ZA 2SDFA 3UE1A 2IHEA 5JJLA 1X9NA 3E5SA 4XXEA 2EYHA 1EYCA 2L5TA 1LLRD 4GN5A 3EQLC 1VQJA 1PFBA 1TWFB 3ICEA 4DAPA 3PSIA 3S14B 4EQPA 2XWBB 1LABA 3DUZA 2XSCA 1H9RA 4NXNL 1VQ7A 5IP9H 2HIVA 4AH6A 3BDOA 3FKIG 4KI0A 1UWVA 1CA6A 1GD7A 1LYLA 1BCPD 1X3GA 3S16B 4QY7A 2B2YC 2A8VA 5M5YB 2F52A 1KLGD 4MIUA 3HG9A 3T53B 2B63H 2I5LX 5K36H 3FP9A 3QR8A 1Z7TA 3TZUA 3BYYB 4DNRB 5CBEE 4FXKC 4H13C 1B3QA 3NWSA 5E4WC 1L1OC 1IZ6A 2ATWA 4MTNA 2ZTEA 3I91A 4XT1B 3I2ZA 3I4MG 3E9IA 2RCNA 1JE4A 3BU2A 2F0NA 1B7YB 4PV1C 3CCJA 4DR1L 1LACA 2JA8G 5IY0A 4XT3B 3TQYA 4BBRG 4PZ7A 2NN6H 1TVXA 3UDIA 4WJ4A 2OEOA 5KGUA 5IGCA 1YNJD 4B9WA 1JICA 1IKMA 4A93B 4K0KL 4X65Q 2VQFL 2B2WC 2QCPX 4J6HA 4DK6C 2RQXA 2CW0C 1LTAD 4JBWA 2ENBA 4F87A 3TSSA 2PZWA 2K5DA 3PO3G 1HUNA 1ONLA 4GNXB 3I72A 4FF1A 4ULLA 2NVQB 5C4XH 3IFDA 2HDLA 1J6QA 4P72A 4X3SA 4DR1Q 1PHJA 1IBLL 2BA0A 4DUYL 5IT9L 3CPFA 4P73A 2NZOA 1HNXL 1U4MA 1SNMA 4IALA 1WTPA 3EJIA 5M5XH 3H6MA 4A3MH 3BVMA 2SNSA 1A62A 1M90C 1G6ZA 2NWGA 1R4QB 1YHAA 2VQFQ 2VS1A 1WCMG 3TEHB 3CCLA 1ET9A 1IBMQ 5GAGC 2PPBC 2AQ2B 2C35B 2K03A 4HAEA 1KXLA 3L0OA 3GTQB 4A3JG 4A3KH 4DV2L 2ZM6L 3OSOA 2YTYA 1BNZA 2CVRA 3MXNB 4IN3A 1IBLQ 2XGTA 1SE4A 1XNQQ 3GV3A 4HIDA 1Y1WG 1HNXQ 2DN8A 5IE8A 3PO2B 2MP1A 3A74A 3UDFA 4DA2A 3URYA 4RFBA 2Q2TA 1SYCA 2I07B 3IKJA 2BA1A 1A3UA 2PYKA 3M4OB 1W6KA 4A3DG 4DV3Q 4DR4Q 4NXMQ 5JPNC 3TS2A 3M3YB 4EX5A 4V0BA 2JN4A 1CHQD 3HOVG 4HSVA 1S40A 3FRPB 5IGBA 3E0EA 2PI2A 3EBEA 2QEXA 4HMJA 1EIYB 4DAVA 4DV1L 4DR2Q 4BY1H 2ZM6Q 3KBXA 4NMZA 4XYQA 1V9PA 3A8IE 4B3TL 3HOYH 4XQQA 1TR5A 2JP1A 1N33Q 1WD0A 1YHBA 2F0HA 2R3ZA 4DNIA 1JJ2A 3S17B 3K58A 4OO1I 1WTVA 3I4OA 3NEMA 3HRZC 1GHJA 4OGQC 5M3FB 5FLMG 5KNCA 4G7HC 3Q6SA 4DR3L 1D6EC 4A3GB 4G4KA 2KHSA 4PNYA 4MZ9A 4LAAA 5IGGA 5H1SE 4FF4A 3NTHA 4BXXG 2WB1E 1F2LA 1NTGA 2MFIA 3S9WA 1TS4A 1B44D 2ZJRA 5M5WB 5C3WA 1PVOA 2QDLA 5HGTA 2UUCQ 4YCUA 3KYHC 1R9TH 1ICFB 4DNTB 1Y1VG 2TSSA 1W6JA 1YIJA 2AMCB 5E3FA 3ND8A 3K7AH 2F3WA 4K6LA 3R2TA 3TP6A 3CP0A 1K8MA 1UUPA 5LMNL 1SFOH 5C0XJ 2DJGC 4EGVA 1KD1C 3D3RA 4RGTA 1FD7D 2UUBL 1B53A 1EY6A 1PDQA 3RLNA 1BXTA 4BA1I 3Q23A 2Q8TA 2OCEA 2JE6I 4GLAC 4CKEA 4ZKCB 1VQPA 1Y69U 2WP8J 1VQNA 1E2WA 1NE3A 3PCOB 3R2IA 1PYWD 1NAPA 3H0GH 4OX9Q 2O2LD 1SMYC 3HOZB 3P20A 3K5OA 2EYFA 4PMCA 3VR2A 2R7ZG 4RCOA 1VMPA 3KF8A 2KEEA 3W1BA 2JA5B 3J81E 5KNDA 1TWGH 4G57A 3D6CA 4DV5Q 1B9NA 4JBJA 5FLXE 1BBXC 5ELBA 1II3A 5FO9B 1JB3A 4KN4C 2IPKD 2WV6D 1HRJA 5ISRA 3CAMA 1QVGA 2FMMA 1LTSD 1QZGA 1PZJD 1L0YB 1SNOA 3CRLC 3QB3A 3KJPA 2Z9HA 2BDOA 3S24A 4KHPQ 1TWCH 1U9RA 4U673 4IUQA 3T51B 2JXMB 4A93G 5JEAG 4LMQD 1X3FA 4L5QA 4R4OA 2QEJC 3J7AV 1EIHA 3S1QH 3WOFA 1X3PA 3L9AX 1NBWA 3N6RA 3PUYA 1I94Q 5JVG3 2IY5B 3I4MH 4KKUA 3RLFA 3CC2A 5D3IB 1SLJA 2PW5A 1AH9A 1VDZA 1SYGA 2IX3A 3CCMA 2JA8H 5IWAL 2ZXRA 2H1EA 3I7FA 1PRTC 3RZOH 4GS3A 2OF1A 1HR0L 2EYLA 2R7DA 4KKTA 1H9SA 1AFPA 3EVQA 2B2VC 1SR3A 4CBVA 2KBNA 4ZKBB 4PMWA 2EXZA 2EYMA 4U68A 3MFGA 4LF6L 1N8RC 4OWXB 4C3IB 5C44B 5EPKA 2LXJA 1EQRA 4KY5A 3B6YA 1AZQA 2RF4A 5J1ZA 1PYSB 1IXRA 1JR0D 5ELEA 3PO3H 3AMUA 2SOBA 4ME5A 4FYDA 3MEFA 2IT1A 4G7OC 4LUOA 4KK7A 1MBYA 2DGYA 2PNRC 1L0XB 1I6HB 4UY8C 3J7A5 1DXMA 4M8AA 5IWAQ 3HOUG 3PIO3 2F03A 1PH1A 1VQCA 3I4NB 2A5HA 4ZUIA 3PO2G 1HR0Q 3CQZB 3R93A 3I4LA 5M9OA 2RSOA 1B8AA 1U0LA 2KOLA 5AJ3Q 1FJGL 3CCQA 1CT1D 2RHQB 2F0QA 3OW2A 1JMCA 4A76A 2CFMA 4LF6Q 2R92B 1WCMH 4JK1C 4EVOA 2R6GA 3I73A 3GTGB 1CM9A 2UXDQ 3M9BA 3J81L 2DNCA 2YYZA 3NENA 1CKNA 1XWEA 4RAUC 1SRUA 5BN4A 3PGZA 5FLXL 1K83B 1KDBA 2EOTA 3MWYW 4NP5A 4JW0A 4L5SA 2ZXOA 2F0GA 2F0DA 1A15A 2N88A 4K2KA 1Y1WH 2UXBL 3U4ZA 1T5EA 3PUWA 3TS0A 3NSWA 2JQOA 4PQXA 3HP3A 3TP5A 1KAAA 1VS0A 5CGKA 5M3FG 1KDCA 3PUVA 2QKIC 1KIXA 2Z4HA 3M7NA 1EQVA 4A3GG 3TREA 1G8ZD 2J4XA 4LUVA 1LT4D 1C9OA 1XYIA 4RWSC 2EYOA 3HOWG 2Q2UA 4KMUC 1X32A 4LFBQ 1Q12A 5EKKA 5IYDG 2GA4B 2IL8A 4CHTB 1KAWA 3EFXD 5G3LD 1FNUA 3HOVH 2ZJPA 3KBGA 3Q22A 4PZ6A 1TS3A 2A68C 4DV7L 2KHJA 4RA8A 3NXWA 2FJ2A 1G91A 2UXBQ 1IKLA 1MIUA 2VB2X 3QWNA 4K14A 1K9MC 2IWHA 5E4XA 4HCSA 4JI1L 1IYVA 4B3SL 1VQKA 5C0XG 5FLMH 1C7YA 4YWMA 2L0CA 3C1EA 1AZPA 2Q8IB 2KUMA 3PIP3 2JA7B 4DV4L 3RN5A 1E2ZA 2IW3A 4BXXH 1PXUA 1I4XA 4CDDC 3A5UA 4A3JB 1XPUA 4FXDA 3IAYA 1MHWC 3SK5A 2ZTCA 1N9WA 4WJ3M 4HN7A 5E1FA 1MD2D 4ZK9B 1JJGA 2F0MA 3TN2A 1Y8PB 1Y1VH 2D5DA 3KF8B 1XNRL 4JI2Q 3SEBA 1MGSA 3FEWX 1I5FA 4OEMB 4RCNA 1Q82C 2UXCQ 5JVH3 3NQIA 4BBSG 2CCZA 1GVPA 2JA5G 1F2YA 2XTIA 2Y0SE 3M7GA 1KTKA 3KLRA 4A3EB 1T9HA 3VYRA 5BN3A 2KJXA 1FR3A 1TWFH 1DYQA 1ENCA 4R1JA 2J0TD 2L11A 2DY7A 3S14H 2OT2A 3P7JA 1SYEA 2PNHA 2WKDA 3VYUA 3A55A 3GTLB 4N8FA 4KD4A 1Y14B 3CCUA 3S1NB 3KDFA 1TIID 1E3PA 2AQ1B 5C5MA 4QJFA 5GADC 1Q7YC 3S16H 3OPOA 5M5YH 3GTJB 1I4RA 4FVMA 2MHVA 3K59A 3GTKB 3K7UC 1XNRQ 2UU9L 1EY5A 1QILA 4QUCA 1RCVD 5FJ8G 3D4RA 1JB7A 1HA6A 1SYBA 3ZYYX 3MTSA 1S5CD 3RN2A 1ESFA 3D0FA 3NUCA 1CI3M 1DJRD 3JAMi 4ZCKA 3CCEA 5BR8L 1X65A 5KYLA 1PH4A 4H0LC 5T1IA 4GLXA 1YI2A 4LF4Q 1X6OA 3HFZB 4ZUJA 3P1HA 4H44C 4LJZC 5IT9E 3S2HB 2EE1A 1VQIA 3RNUA 4CJ2C 5KYIA 3SGIA 3CPWA 1E0BA 1G291 4QUFA 1IHZA 4ABNA 4X3UA 1C8CA 3STBD 1EOVA 3OWFA 3K5MA 4OIKA 4GOPA 4ZLTF 1H9JA 2A69D 1QZHA 5A2QE 5C5LA 3ULLA 3FPPA 2O5JC 5IT9c 2BE5C 2NVQH 1I3QB 4M1UB 5ELCA 1AN8A 2RDHA 4RGOS 1YVCA 1F9QA 1A0IA 5DNFA 2Z8LA 4JYAL 5FKAC 3I4NG 2E76C 2CWAA 4FXGC 1F77A 2MQHA 1SAPA 3M85A 3ERSX 3R3OA 4YY3Q 2E5LL 2E8GA 2ZJQA 2ASBA 1PRTD 1EY0A 3VR5A 1CKNB 2R92G 1YNND 2NB0A 3R8BA 3FDTA 4KY7A 5IP7G 1PYBA 2TMPA 4J8QA 1HA5A 2R7ZB 4JI4L 1I4HA 3DMUA 1PH7A 1VQDA 2CQAA 1FGUA 1Y8NB 4R8NA 1HFNA 4HJAA 2F0TA 4TSSA 2BOSA 5DLQE 2D2CC 3OOCA 4NXNQ 1F9PA 2LMCB 1NSNS 2QF7A 4FNFA 1IW7D 4JYAQ 5M3MG 1XMQL 3PO2H 3WWVA 4JI0L 1WYDA 2E5LQ 3FPUB 4IPHA 3NBHA 2B2UC 4YCWA 3E0JA 1EU4A 4UAIA 1Q1EA 2A6HC 3BZCA 1N32L 3M4OH 3J81j 3NK9A 3HKZE 3QOLA 1VQ9A 5JEAJ 5CR3A 5L37A 2BDNA 1KLUD 1B1ZA 3K81C 2A19A 5AFWA 4JI4Q 2PQAA 4X6AH 3KK7A 1A63A 1CKMA 1K8AC 4LF9L 1ILQA 1Q3LA 1YNXA 1ET6A 1D2BA 1QB5D 3AQQA 4MHEA 2XRSD 3DWAA 2CKZB 4CKBA 5IIFA 3F2DA 1HZAA 1EQQA 1PTOD 3ND9A 1NJIC 3Q8DA 4C1NK 4FP5D 1XMQQ 1HUMA 3WDNA 4JI0Q 3S17H 4B3ML 2KA7A 2PMZB 4GOPC 5M3FH 5C3EB 1ML0D 2EYPA 4K0KQ 4EQNA 1STEA 1TWAB 2HIXA 1UE7A 2JA7G 1TS2A 2L9HA 1CZWA 1R4PB 2ES2A 1D5ZC 1J9OA 2I46A 5CV6A 5A2QL 2DY8A 3S2DB 1RTOA 1GUTA 1BCPF 1WTHA 2B39A 3AU7A 4LF9Q 2JEAI 4FF3A 2CQOA 4NDXA 1M1KC 4KTAA 4IFDI 3GTOB 5F2DA 2NZ1D 4ILWA 5M5WH 3H09A 3IL8A 1FYCA 4AYBB 4DUYQ 2YTVA 2WIIB 3HOUB 1RKNA 1I6VC 2UUAL 2A68D 4B3MQ 1EFID 3K6OA 1KL9A 1YJ9A 1P8LA 2ID0A 4A3IB 3RR5A 4E6IA 5C0XH 5IGDA 1VF5C 2NVTH 5LL6S 3X3MA 4A3EG 1EU3A 4LF7L 1LV9A 3KDFB 1PH6A 5I2YA 2B2TA 2JJQA 5CYUA 2MPMA 2AWNA 3I56A 1TXYA 2NZHA 1PH8A 1Q1BA 4QGUA 1LTGD 4DV2Q 3OYYA 1XXGA 1SNPA 2M2LA 4K2LA 4IOAA 3UDXA 1K0RA 4JCVE 3HOXB 3PV0A 2K33A 4KHVA 4HR7B 4WORA 5KNBA 1PLFA 3OIPA 4K8JA 5J3BA 2UUAQ 2NBFA 3KLSX 1UE5A 1ZKOA 2QILA 3RMHA 2PO4A 3CC7A 3H3VI 1OTCA 3HOZH 1MJCA 3QOJA 1BQQT 4HTHA 1K73C 1UE6A 2EJMA 1EYGA 2K5QA 4R4QA 3MXUA 4DU9A 2LS01 5FO8B 4IUNA 2D9UA 5EKLA 3MXPA 1PTOF 4LW1A 5ELDA 4DAMA 2E74C 3G6JB 1F2ZA 3OHXC 5LMUL 1JOQA 3HOWB 1PFNA 4CKCA 3T1YL 3M4YA 4HIMA 4X66L 5LL6X 4B3RQ 4DV1Q 1WTQA 1X3EA 3KOJA 4CDFC 1VQEA 5DM73 4R4TA 1Z9FA 4HCEA 1AP0A 2HCCA 4B3TQ 1EIFA 3LGJA 1STGA 3MZ5A 4GOPB 1PA6A 3A0JA 2VUMG 3K80C 4O0AA 3KLSA 1PH3A 4JI3L 4A3BG 4A3KB 4K6DA 5EBCA 1SXTA 4LNQA 4KJNA 4DR3Q 2PW7A 3K0XA 2OQ0A 1SE3A 5J22A 4C3HG 2R61A 1EYDA 4B3RL 1UE1A 3IFTA 5E7NA 3EA6A 4B9XA 4JI6L 3A8JE 4JBMA 1NR4A 4A3LG 4OO1G 1SNCA 3M4QA 4HJ9A 3CF5A 1HFGA 3HGBA 5HGQA 1G51A 4Y7NB 4A3FB 5IYCH 3SK6A 1B4OA 1EUJA 2EIFA 3JAME 2WFWA 1MSGA 1H9KA 1SSOA 1YEZA 2HDMA 3G4SA 4XTCS 2JK8A 1CK1A 1VQMA 4JI3Q 4LF8L 2N55A 4C3IH 5C44H 3OMCA 4A3CH 1QG7A 1C0AA 2B2TC 1GUWA 1E1TA 5LMNQ 4HJ7A 4BBSB 1B50A 1DOKA 2D0PA 1LT5D 2VW9A 1EOTA 2XWJB 2VNUD 2EYJA 1YJNA 4CDEC 2AUJD 1IBKL 4JI6Q 1QOHA 4JV5L 2UUBQ 4CGYB 4P75A 4B08A 1NUCA 2XN9C 2JA6B 4A75A 1I6HH 3NBHB 1MI2A 4JI8L 2L55A 1MKHA 1U4PA 1OXXK 1JE5A 3OMGA 2OTLA 2E2HB 3FKIH 3I4NH 2NVYB 3CQZH 2IJ0A 4R9WA 2A1AA 5D65A 1CQVA 2AQ3B 4H7BA 1TKWB 2X69A 4DV0L 2HHHL 4DN4M 1HPCA 2BCOA 2PQAB 4ODGA 3J81c 1H9MA 1KQSA 4LF8Q 2R92H 4RMFA 5IP7H 1HHVA 3JC66 5FLXc 4YHHL 3GTGH 1L0WA 3EN2A 1VF7A 3FVQA 1YZ6A 1I50B 1UAPA 5COYA 1X3QA 3QJYA 3S1RB 1TWHH 2A6EC 5CC4A 1XJVA 4C3JB 4JV5Q 1K83H 1XTDA 4QF4A 2G5DA 5CBAE 1LTTD 5D3DA 2J7ZA 1I4PA 4JI8Q 2VQEL 4BBRH 1SDFA 3KJOA 2AHOB 2NN6I 3D4WA 2K4KA 1K3RA 5IOCA 1WOCA 4RKLA 1S5BD 2HHHQ 2YU9B 5C3EG 4LFCL 4FDBA 2N78A 3K5NA 5IP9G 4RGMA 2E2IB 1HQRD 3J7YW 4YHHQ 2A6HD 4Q0FA 1SEBD 2E2JB 1JOKA 1VQBA 4K5WA 3W3AA 1WTXA 2HUGA 2CW0D 5BN5A 2V1CC 2PI2E 1P16A 4IURA 4LK1C 2B3GA 4AYBG 2F0LA 5T1GA 1XMOL 1CTMA 1JT8A 2VQEQ 4XIGS 4Q5VA 4RG1A 3JAML 4TVAB 1WI5A 1GXDC 2X6LA 4LF5L 2BH8A 4L5TA 1XPOA 4A3IG 2RDFA 1ENAA 4ALPA 1CFMA 2K50A 1C48A 4DK3C 1YNJC 1YBYA 4XQNA 3ITPA 2JA7H 4HIOA 3BS1A 1N34L 3VR3A 4KY6A 4C56C 3MA2B 4A3JH 1S72A 1ASZA 2F0KA 1ZXTA 2ZXPA 3I90A 3MEHA 4R4IA 3HOXG 5JPMC 5C4HA 3H94A 4JI5L 5DEHA 1EY4A 2H4OA 1HXYD 3DWPA 4APVA 2AWOA 1S5DD 3PIPA 5M3MB 4EQ5A 1VQ5A 1FJGQ 2XIWA 4LF5Q 1BR9A 4OWWB 3GTMB 1BBWA 2KCNA 4N9PA 1HCZA 2D0OA 4HJ8A 2Q8RE 1GJXA 3RZDB 2RHSB 1QWYA 5D14A 2EDGA 4A3DH 1VQAA 4A3EH 3CXCA 2L15A 4DUZL 2O5IC 3OIQA 1JWUD 3EIVA 2NVXB 3D6WA 1PH2A 1N34Q 2PQEA 1LTBD 4OONA 3PQIA 3GTLH 4G7ZC 3S1NH 3G71A 2H5XA 1O78A 1Z6HA 2K7VA 3GTJH 4GN3B 1G2SA 1KNAA 2L12A 2F0SA 3GTKH 3A5ZB 1BCPB 4UP9A 1S3OA 1CKOA 3LNNA 4O2DA 2K5WA 4A3KG 1LTRD 1M4VA 2XNAC 1LTID 1WTOA 1CZGA 3S1MH 3S15B 2F3IA 3NWTA 4DUZQ 4POFA 1FL0A 2RDGA 4IUTA 1A3TA 1JQYD 3L2PA 3BZKA 1BVSA 4CJ1B 1PFMA 2K32A 5CV5A 4A3FG 2ZT9C 2WB1G 1Q8KA 2P5ZX 1MSHA 1GOZA 5GQOA 4DV7Q 3M4PA 4K5XA 3S2HH 2LSSA 5GAHC 2EY6A 1FNWA 2VXWA 4Z9CB 1JC7A 1OO9B 1WVLA 1PH5A 5EQ0A 3CHBD 1TS5A 4JI1Q 1A3VA 4B3SQ 4BY1G 2X6GA 1ESRA 4C1NI 3KUPA 1SN8A 3KLWA 1JORA 1RIPA 3CC4A 1VMCA 1AE3A 1SROA
chains in the Genus database with same CATH topology
4YCWA 4DV4Q 1HZCA 1Q1EA 4R4CA 2K5NA 3BZCA 1HNZL 1N32L 2ZJRA 3M4OH 2JA6G 2UXDL 1I3QH 3J81j 1PVOA 4GLVB 2I5MX 2QA4A 2UUCQ 1JJCB 3HKZE 1GM5A 4YCUA 1VQ9A 5JEAJ 3KYHC 1R9TH 2BH2A 3H15A 1V43A 4LFCQ 1Y1VG 1EWIA 3K81C 2A19A 5ELOA 2AMCB 1YIJA 2JEBI 3AFQA 4JI4Q 2ALYB 2PQAA 4X6AH 1BKBA 1A63A 2DUDA 1CKMA 1K8AC 3I55A 4LF9L 1YJWA 3K7AH 3S15H 1YNXA 2EXDA 3AQQA 2D62A 3CP0A 4H02A 3GO5A 2NN6G 5LMNL 2CKZB 4JI7L 4JBKA 1SFOH 5C0XJ 3F2DA 1OXUA 1HZAA 2KCMA 3CCVA 1HJPA 1EQQA 1KD1C 1L1OA 2FXQA 1NJIC 1BBUA 3Q8DA 2GVBA 1XMQQ 3RLNA 2UUBL 2R7ZH 4JI0Q 1XMOQ 3S17H 2MO1A 4B3ML 1X54A 4BA1I 1PV4A 4GOPC 5M3FH 1HNZQ 2OCEA 2JE6I 4GLAC 4K0KQ 1VQPA 2K52A 5HY6A 1LUZA 5IYBH 4LFBL 2HIXA 2YV5A 1UE7A 2WP8J 1VQNA 2JA7G 4GKKL 1NE3A 3PCOB 1QUQA 4L5RC 3IRBA 2JA9A 5C0XI 2ES2A 1VQ6A 5C4XG 2K75A 3UE0A 3H0GH 4OX9Q 1VQOA 2EQSA 2JEAI 4LF9Q 4UP8A 4JC0A 2CQOA 4QL5A 1OXVA 2VY3A 1M1KC 1H95A 4IFDI 2R7ZG 4A93H 2UU9Q 5M5WH 3W1BA 4PG3A 2K5HA 3G48A 4IPGA 4DUYQ 4Y52H 2YTVA 4A3MG 2MO0A 2UUAL 4A4IA 1TWGH 5GAEC 4DV5Q 3AEVA 4JBJA 4JI5Q 4B3MQ 1VQHA 4DAYB 1KHIA 1KL9A 1YJ9A 1P8LA 2F4VL 5BR8Q 2ID0A 4JOIA 3CAMA 3RR5A 4LFAL 1E7ZA 1QVGA 2NVTH 1QZGA 3KJPA 4A3EG 2IHFA 4UP7A 1LTLA 1QVCA 4DKAC 4LF7L 4YWKA 2VL6A 3S24A 4GKKQ 1TWCH 4KHPQ 4DR7L 1W2BA 3KDFB 1PH6A 3AYHB 4ME3A 2JJQA 4A93G 1J5EL 2AWNA 3I56A 2YTXA 1TXYA 5JEAG 2NZHA 1PH8A 1Q1BA 4QGUA 5ELNA 1X3FA 3U4VA 3OYYA 4DPGA 4DV2Q 4L5QA 4BA2I 4R4OA 4GNXA 4IOAA 1E22A 1HH2P 3CW2C 2N3SA 3UDXA 5C3EH 1K0RA 2N8NA 4JCVE 4JI2L 3PV0A 1O7IA 1TWAH 1KRSA 3S1QH 2KHIA 3PUYA 1NBWA 4IPDA 3U58A 1L2FA 1I94Q 5J3BA 2UUAQ 3I4MH 3RLFA 2UXCL 2IY5B 3F8TA 3CC2A 3S2DH 1UE5A 1SLJA 5LMNW 1AH9A 3CC7A 3U50C 3H3VI 3GTQH 4DR6L 1OTCA 2Q2HA 3HOZH 1MJCA 1Q86C 1EYGA 3CCMA 1UE6A 1K73C 5IWAL 4R4QA 2JA8H 2F4VQ 3I7FA 1U5KA 3RZOH 4GS3A 4LFAQ 2VUMH 1HR0L 3GTOH 4QQBX 4BY7H 2R7DA 1AE2A 1HZ9A 3DM3A 3ULJA 4X65L 1IYJB 4A3BH 4IOCA 1SR3A 4LW1A 4DAMA 5LMUL 3HOUH 4DR7Q 2KBNA 4HJ5A 5EAYA 1WJJA 4PMWA 1J5EQ 3F1ZA 1DGSA 3T1YL 4LF6L 1KC8C 4C3HH 1N8RC 3HOYG 4OWXB 4X66L 4HIMA 2LXJA 4B3RQ 1EQRA 3CCRA 4DV1Q 1CSPA 1NMGA 1X3EA 3B6YA 2RF4A 3KOJA 4A3IH 1VQEA 1PH9A 4R4TA 1Z9FA 4YCVA 4A3LH 2CWPA 4B3TQ 1EIFA 1PYSB 3HOZG 3LGJA 2ZTDA 1VQ8A 3H3VH 1V1QA 1IXRA 4GOPB 1PA6A 3M3YH 3PO3H 1HNWL 3A0JA 2PMZE 2IT1A 3MEFA 3ULPA 2VUMG 4LUOA 3GDEA 3K80C 4O0AA 4QIWE 2DGYA 4X64L 1PH3A 4UY8C 4DR6Q 1IL2A 4JI3L 3J7A5 1VQGA 4A3BG 2OWOA 5IWAQ 3HOUG 1PH1A 1VQCA 1NMFA 4LNQA 4DR3Q 3AFPA 2HT1A 3K0XA 1HR0Q 3PO2G 2OQ0A 3CMAA 3HOXH 1B8AA 1U0LA 3GTPH 4B3RL 4LF4L 4BY1H 1UE1A 4IPCA 5AJ3Q 1FJGL 3J80c 4C2MH 5E7NA 3CCQA 2R93H 2RHQB 4JI6L 3OW2A 4JBMA 1X56A 3F2BA 1JMCA 4A3LG 4A76A 1IBML 4OO1G 2CFMA 3M4QA 1YHQA 4IFDJ 4LF6Q 4OXPA 4HJ9A 3CF5A 3CMEA 3KFUA 3L7ZC 1WCMH 1GO3E 5HGQA 1G51A 2R6GA 4AYBE 4DR5L 1N32Q 5IYCH 2UXDQ 3M9BA 3VDYA 4DV6L 2YYZA 3NENA 4A3GH 1CKNA 4JG2A 1EUJA 2EIFA 1SRUA 4IJLA 2WFWA 1HNWQ 2R7FA 3PGZA 1XNQL 3OTOL 3E9HA 4JOIC 3KF6A 4IO9A 1YEZA 3G4SA 2Z0SA 3HOWH 4XTCS 2JK8A 2Z6KA 4X64Q 2WAQE 1D8LA 1VQMA 4JI3Q 2MNAA 4L5SA 4LF8L 5IYDH 4C3IH 5C44H 1EFWA 4A3CH 1GKHA 1C0AA 1CSQA 1G6PA 5C4JH 1E1TA 5LMNQ 3U4ZA 4HJ7A 1Y1WH 4JI7Q 3PUWA 3TS0A 3CD6A 2UXBL 2JQOA 2D0PA 1X55A 2VW9A 1VS0A 4DV3L 4LUZA 2VNUD 4DR4L 1YJNA 5M3FG 3PUVA 1IBKL 5JJIA 4GNXC 1KIXA 4JI6Q 4NXML 5IYCG 3M7NA 4JV5L 4NPSA 2UUBQ 4P75A 2GVAA 1HR0W 3CCSA 3F2CA 4A3GG 3TREA 5IYBG 2KCTA 1I6HH 4A75A 1A8VA 3NBHB 3PF4A 1NY4A 1PFSA 1OXTA 4JI8L 4YY3L 1MKHA 4LUVA 4DR5Q 3J81i 1OXXK 1JE5A 3H0GG 2OTLA 1C9OA 3FKIH 3I4NH 3HOWG 4DR2L 4PZ8A 4DV6Q 2Q2UA 2K14A 4MNOA 3CQZH 4LFBQ 1Q12A 2I5HA 5IYDG 1KAWA 2A1AA 2K5VA 4P71A 5C44G 1W3SA 3HOVH 4YWLA 2ZJPA 3OTOQ 4DV0L 4PZ6A 2HHHL 3NELA 4POGA 1N33L 2PQAB 4HIKA 1OXSC 3D31A 3UE1A 3J81c 1KQSA 1FVIA 2IHEA 4DV7L 1X9NA 4LF8Q 1Q46A 5JJLA 3PF5A 2KHJA 2R92H 4RMFA 5IP7H 4GN5A 4A3FH 4Y7NH 1VQJA 3JC66 5FLXc 4YHHL 3ICEA 3GTGH 2UXBQ 1MIUA 3PSIA 1L0WA 4AQYL 1K9MC 3K8AA 3EN2A 1L1OB 1YZ6A 4NXNL 1VQ7A 5IP9H 1VCIA 2HIVA 1TWHH 4LWCA 4AH6A 4JI1L 4B3SL 1VQKA 1XJVA 4JV5Q 3FKIG 1K83H 4KI0A 2B29A 1XTDA 5FLMH 1UWVA 5C0XG 1C7YA 1GD7A 1LYLA 4YWMA 1Q81C 1LM0A 1X3GA 3DLLA 1E24A 4QY7A 3UDGA 2OQKA 2A8VA 4JI8Q 2VQEL 2F52A 4BBRH 4DV4L 3RN5A 1SE8A 3KJOA 1ASYA 1QVFA 2AHOB 4BBSH 4BXXH 2NN6I 4IFDG 2B63H 2JA5H 1N36L 2I5LX 2K4KA 3FP9A 4LF7Q 1K3RA 3A5UA 2UUCL 1XPUA 1QUQB 1WOCA 2HHHQ 3KF6B 2Y0SG 2QGQA 2ZTCA 4LFCL 3ZJYC 5C3EG 1N9WA 4WJ3M 4FDBA 3W1GA 2N78A 1L1OC 1IZ6A 2ATWA 2JA6H 5IP9G 4MTNA 2ZTEA 1Z47A 3I2ZA 3I4MG 3E9IA 2RCNA 1JJGA 4YHHQ 4AQYQ 2E2HH 1Y1VH 3BU2A 3KF8B 1XNRL 4JI2Q 1B7YB 2NVYH 1VQBA 3CCJA 1I5FA 4DR1L 1Q82C 2JA8G 5IY0A 3TQYA 2UXCQ 4BBRG 4PZ7A 2ASBA 4KHZA 2V1CC 4BBSG 2CCZA 2PI2E 4BY7G 1P16A 1GVPA 3J80i 2JA5G 3G6EA 3ER0A 2B3GA 4GKJL 2XTIA 2Y0SE 3UDIA 4AYBG 4X62L 1XMOL 4WJ4A 1T9HA 1JT8A 2VQEQ 4XIGS 2IX0A 5FJ8H 4RG1A 1TWFH 4OWTB 4R1JA 4TVAB 2Z6KC 1VQ4A 1WI5A 1N36Q 3S14H 4K0KL 4UPAA 4X65Q 2VQFL 1I50H 3S1RH 4LF5L 5LMUQ 2BH8A 2PNHA 4L5TA 4DK6C 1XPOA 2WAQG 3CCUA 4A3IG 1Y14B 4JBWA 4C3JH 3KDFA 5GROA 4ALPA 3T1YQ 1E3PA 1HZBA 2K50A 4OX9L 4QJFA 4X66Q 5GADC 1Q7YC 3S16H 1KRTA 3PO3G 4DK3C 3RLOA 5M5YH 4GNXB 1YBYA 2JA7H 4HIOA 3K7UC 1B70B 4AIMA 5C4XH 1XNRQ 1VQLA 1J6QA 4P72A 1XPRA 1N34L 2UU9L 4DR1Q 1PHJA 1IBLL 2BA0A 4A3JH 1S72A 4DUYL 1ASZA 1CUKA 4NB3A 5FJ8G 3FHWA 3CPFA 4P73A 1JB7A 2YU9H 2NZOA 1HNXL 4R4IA 4DV5L 4GKJQ 3HOXG 4X62Q 4JI5L 5M5XH 3RN2A 3D0FA 2OTJA 2R93G 4APVA 2E2IH 3JAMi 4A3MH 2AKWB 1A62A 2AWOA 5BR8L 3CCEA 1M90C 1X65A 3PIPA 1PH4A 4EQ5A 1YHAA 2Q2IA 4GLXA 1VQ5A 4IJHA 4KLKA 1YI2A 2E2JH 2VQFQ 4LF4Q 2VS1A 1X6OA 1YITA 4LF5Q 1WCMG 3HFZB 1FJGQ 3TEHB 4OWWB 1BBWA 4HJ8A 2D0OA 3CCLA 3BJUA 4KHPL 1IBMQ 5GAGC 2RHSB 5JJKA 2C35B 3JAMc 4A3DH 4J15A 3L0OA 1KXLA 4A3JG 1VQAA 4A3EH 1VQIA 3CXCA 4A3KH 2KENA 2L15A 4DUZL 4DV2L 3CPWA 3RNUA 3SGIA 1G291 2ZM6L 2YTYA 3EIVA 1PH2A 3STBD 1N34Q 3MXNB 1E1OA 1IBLQ 1EOVA 2XGTA 3PUXA 1XNQQ 3TRZA 4OONA 4HIDA 4GOPA 1Y1WG 1I94L 3GTLH 1HNXQ 3T1HL 5IE8A 3W5OA 3S1NH 1QZHA 3A74A 2H5XA 3UDFA 3G71A 3ULLA 3GTJH 4GN3B 2Q2TA 5IT9c 2I0QA 3GTKH 2BA1A 3PIOA 2NVQH 3A5ZB 2N49A 4UP9A 4A3DG 1S3OA 3STBC 4DV3Q 1CKOA 1YVCA 4O2DA 4DR4Q 1IBKQ 2LXKA 1A0IA 4A3KG 1D7QA 4NXMQ 3TS2A 4JYAL 1SMXA 4TQUS 4EX5A 3I4NG 2CWAA 3GD7A 2GN5A 2MQHA 3S1MH 3M85A 3ERSX 1UEBA 2F3IA 4YY3Q 2E5LL 4DUZQ 1S40A 3HOVG 4POFA 1FL0A 2E8GA 2ZJQA 3E0EA 2PI2A 3EBEA 3BZKA 3L2PA 2QEXA 4DV1L 3J7ZC 4DR2Q 1EIYB 2ZM6Q 1BVSA 1CKNB 5M3MH 1K8GA 4A3CG 1V9PA 4B3TL 2R92G 3HOYH 5IP7G 4DV0Q 2VZAA 1PYBA 4A3FG 3PUZA 1N33Q 3GTMH 2IX1A 2HQLA 2WB1G 3T1HQ 3RZDH 1Q8KA 1YHBA 4OO1I 4DNIA 1JJ2A 5GQOA 4DV7Q 4JI4L 3M4PA 1PH7A 1MJEA 1VQDA 3I4OA 3NEMA 3S2HH 1WFQA 2LSSA 3HKSA 5GAHC 1FGUA 4GN4B 5FLMG 4HJAA 5DLQE 3HKZG 1VQFA 4DR3L 1PH5A 2NVXH 1RL2A 4NXNQ 4JI1Q 4P74A 4MZ9A 4B3SQ 4JYAQ 5AJ3L 4BY1G 5H1SE 4BXXG 2B63G 1SN8A 5M3MG 3KLWA 1XMQL 1RIPA 2WB1E 3WWVA 4JI0L 3PO2H 5K36G 3CC4A 1NTGA 2MFIA 1AE3A 1SROA 1WYDA 2E5LQ 4IPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCW A;  4DV4 Q;  1HZC A;  1Q1E A;  4R4C A;  2K5N A;  3BZC A;  1HNZ L;  1N32 L;  2ZJR A;  3M4O H;  2JA6 G;  2UXD L;  1I3Q H;  3J81 j;  1PVO A;  4GLV B;  2I5M X;  2QA4 A;  2UUC Q;  1JJC B;  3HKZ E;  1GM5 A;  4YCU A;  1VQ9 A;  5JEA J;  3KYH C;  1R9T H;  2BH2 A;  3H15 A;  1V43 A;  4LFC Q;  1Y1V G;  1EWI A;  3K81 C;  2A19 A;  5ELO A;  2AMC B;  1YIJ A;  2JEB I;  3AFQ A;  4JI4 Q;  2ALY B;  2PQA A;  4X6A H;  1BKB A;  1A63 A;  2DUD A;  1CKM A;  1K8A C;  3I55 A;  4LF9 L;  1YJW A;  3K7A H;  3S15 H;  1YNX A;  2EXD A;  3AQQ A;  2D62 A;  3CP0 A;  4H02 A;  3GO5 A;  2NN6 G;  5LMN L;  2CKZ B;  4JI7 L;  4JBK A;  1SFO H;  5C0X J;  3F2D A;  1OXU A;  1HZA A;  2KCM A;  3CCV A;  1HJP A;  1EQQ A;  1KD1 C;  1L1O A;  2FXQ A;  1NJI C;  1BBU A;  3Q8D A;  2GVB A;  1XMQ Q;  3RLN A;  2UUB L;  2R7Z H;  4JI0 Q;  1XMO Q;  3S17 H;  2MO1 A;  4B3M L;  1X54 A;  4BA1 I;  1PV4 A;  4GOP C;  5M3F H;  1HNZ Q;  2OCE A;  2JE6 I;  4GLA C;  4K0K Q;  1VQP A;  2K52 A;  5HY6 A;  1LUZ A;  5IYB H;  4LFB L;  2HIX A;  2YV5 A;  1UE7 A;  2WP8 J;  1VQN A;  2JA7 G;  4GKK L;  1NE3 A;  3PCO B;  1QUQ A;  4L5R C;  3IRB A;  2JA9 A;  5C0X I;  2ES2 A;  1VQ6 A;  5C4X G;  2K75 A;  3UE0 A;  3H0G H;  4OX9 Q;  1VQO A;  2EQS A;  2JEA I;  4LF9 Q;  4UP8 A;  4JC0 A;  2CQO A;  4QL5 A;  1OXV A;  2VY3 A;  1M1K C;  1H95 A;  4IFD I;  2R7Z G;  4A93 H;  2UU9 Q;  5M5W H;  3W1B A;  4PG3 A;  2K5H A;  3G48 A;  4IPG A;  4DUY Q;  4Y52 H;  2YTV A;  4A3M G;  2MO0 A;  2UUA L;  4A4I A;  1TWG H;  5GAE C;  4DV5 Q;  3AEV A;  4JBJ A;  4JI5 Q;  4B3M Q;  1VQH A;  4DAY B;  1KHI A;  1KL9 A;  1YJ9 A;  1P8L A;  2F4V L;  5BR8 Q;  2ID0 A;  4JOI A;  3CAM A;  3RR5 A;  4LFA L;  1E7Z A;  1QVG A;  2NVT H;  1QZG A;  3KJP A;  4A3E G;  2IHF A;  4UP7 A;  1LTL A;  1QVC A;  4DKA C;  4LF7 L;  4YWK A;  2VL6 A;  3S24 A;  4GKK Q;  1TWC H;  4KHP Q;  4DR7 L;  1W2B A;  3KDF B;  1PH6 A;  3AYH B;  4ME3 A;  2JJQ A;  4A93 G;  1J5E L;  2AWN A;  3I56 A;  2YTX A;  1TXY A;  5JEA G;  2NZH A;  1PH8 A;  1Q1B A;  4QGU A;  5ELN A;  1X3F A;  3U4V A;  3OYY A;  4DPG A;  4DV2 Q;  4L5Q A;  4BA2 I;  4R4O A;  4GNX A;  4IOA A;  1E22 A;  1HH2 P;  3CW2 C;  2N3S A;  3UDX A;  5C3E H;  1K0R A;  2N8N A;  4JCV E;  4JI2 L;  3PV0 A;  1O7I A;  1TWA H;  1KRS A;  3S1Q H;  2KHI A;  3PUY A;  1NBW A;  4IPD A;  3U58 A;  1L2F A;  1I94 Q;  5J3B A;  2UUA Q;  3I4M H;  3RLF A;  2UXC L;  2IY5 B;  3F8T A;  3CC2 A;  3S2D H;  1UE5 A;  1SLJ A;  5LMN W;  1AH9 A;  3CC7 A;  3U50 C;  3H3V I;  3GTQ H;  4DR6 L;  1OTC A;  2Q2H A;  3HOZ H;  1MJC A;  1Q86 C;  1EYG A;  3CCM A;  1UE6 A;  1K73 C;  5IWA L;  4R4Q A;  2JA8 H;  2F4V Q;  3I7F A;  1U5K A;  3RZO H;  4GS3 A;  4LFA Q;  2VUM H;  1HR0 L;  3GTO H;  4QQB X;  4BY7 H;  2R7D A;  1AE2 A;  1HZ9 A;  3DM3 A;  3ULJ A;  4X65 L;  1IYJ B;  4A3B H;  4IOC A;  1SR3 A;  4LW1 A;  4DAM A;  5LMU L;  3HOU H;  4DR7 Q;  2KBN A;  4HJ5 A;  5EAY A;  1WJJ A;  4PMW A;  1J5E Q;  3F1Z A;  1DGS A;  3T1Y L;  4LF6 L;  1KC8 C;  4C3H H;  1N8R C;  3HOY G;  4OWX B;  4X66 L;  4HIM A;  2LXJ A;  4B3R Q;  1EQR A;  3CCR A;  4DV1 Q;  1CSP A;  1NMG A;  1X3E A;  3B6Y A;  2RF4 A;  3KOJ A;  4A3I H;  1VQE A;  1PH9 A;  4R4T A;  1Z9F A;  4YCV A;  4A3L H;  2CWP A;  4B3T Q;  1EIF A;  1PYS B;  3HOZ G;  3LGJ A;  2ZTD A;  1VQ8 A;  3H3V H;  1V1Q A;  1IXR A;  4GOP B;  1PA6 A;  3M3Y H;  3PO3 H;  1HNW L;  3A0J A;  2PMZ E;  2IT1 A;  3MEF A;  3ULP A;  2VUM G;  4LUO A;  3GDE A;  3K80 C;  4O0A A;  4QIW E;  2DGY A;  4X64 L;  1PH3 A;  4UY8 C;  4DR6 Q;  1IL2 A;  4JI3 L;  3J7A 5;  1VQG A;  4A3B G;  2OWO A;  5IWA Q;  3HOU G;  1PH1 A;  1VQC A;  1NMF A;  4LNQ A;  4DR3 Q;  3AFP A;  2HT1 A;  3K0X A;  1HR0 Q;  3PO2 G;  2OQ0 A;  3CMA A;  3HOX H;  1B8A A;  1U0L A;  3GTP H;  4B3R L;  4LF4 L;  4BY1 H;  1UE1 A;  4IPC A;  5AJ3 Q;  1FJG L;  3J80 c;  4C2M H;  5E7N A;  3CCQ A;  2R93 H;  2RHQ B;  4JI6 L;  3OW2 A;  4JBM A;  1X56 A;  3F2B A;  1JMC A;  4A3L G;  4A76 A;  1IBM L;  4OO1 G;  2CFM A;  3M4Q A;  1YHQ A;  4IFD J;  4LF6 Q;  4OXP A;  4HJ9 A;  3CF5 A;  3CME A;  3KFU A;  3L7Z C;  1WCM H;  1GO3 E;  5HGQ A;  1G51 A;  2R6G A;  4AYB E;  4DR5 L;  1N32 Q;  5IYC H;  2UXD Q;  3M9B A;  3VDY A;  4DV6 L;  2YYZ A;  3NEN A;  4A3G H;  1CKN A;  4JG2 A;  1EUJ A;  2EIF A;  1SRU A;  4IJL A;  2WFW A;  1HNW Q;  2R7F A;  3PGZ A;  1XNQ L;  3OTO L;  3E9H A;  4JOI C;  3KF6 A;  4IO9 A;  1YEZ A;  3G4S A;  2Z0S A;  3HOW H;  4XTC S;  2JK8 A;  2Z6K A;  4X64 Q;  2WAQ E;  1D8L A;  1VQM A;  4JI3 Q;  2MNA A;  4L5S A;  4LF8 L;  5IYD H;  4C3I H;  5C44 H;  1EFW A;  4A3C H;  1GKH A;  1C0A A;  1CSQ A;  1G6P A;  5C4J H;  1E1T A;  5LMN Q;  3U4Z A;  4HJ7 A;  1Y1W H;  4JI7 Q;  3PUW A;  3TS0 A;  3CD6 A;  2UXB L;  2JQO A;  2D0P A;  1X55 A;  2VW9 A;  1VS0 A;  4DV3 L;  4LUZ A;  2VNU D;  4DR4 L;  1YJN A;  5M3F G;  3PUV A;  1IBK L;  5JJI A;  4GNX C;  1KIX A;  4JI6 Q;  4NXM L;  5IYC G;  3M7N A;  4JV5 L;  4NPS A;  2UUB Q;  4P75 A;  2GVA A;  1HR0 W;  3CCS A;  3F2C A;  4A3G G;  3TRE A;  5IYB G;  2KCT A;  1I6H H;  4A75 A;  1A8V A;  3NBH B;  3PF4 A;  1NY4 A;  1PFS A;  1OXT A;  4JI8 L;  4YY3 L;  1MKH A;  4LUV A;  4DR5 Q;  3J81 i;  1OXX K;  1JE5 A;  3H0G G;  2OTL A;  1C9O A;  3FKI H;  3I4N H;  3HOW G;  4DR2 L;  4PZ8 A;  4DV6 Q;  2Q2U A;  2K14 A;  4MNO A;  3CQZ H;  4LFB Q;  1Q12 A;  2I5H A;  5IYD G;  1KAW A;  2A1A A;  2K5V A;  4P71 A;  5C44 G;  1W3S A;  3HOV H;  4YWL A;  2ZJP A;  3OTO Q;  4DV0 L;  4PZ6 A;  2HHH L;  3NEL A;  4POG A;  1N33 L;  2PQA B;  4HIK A;  1OXS C;  3D31 A;  3UE1 A;  3J81 c;  1KQS A;  1FVI A;  2IHE A;  4DV7 L;  1X9N A;  4LF8 Q;  1Q46 A;  5JJL A;  3PF5 A;  2KHJ A;  2R92 H;  4RMF A;  5IP7 H;  4GN5 A;  4A3F H;  4Y7N H;  1VQJ A;  3JC6 6;  5FLX c;  4YHH L;  3ICE A;  3GTG H;  2UXB Q;  1MIU A;  3PSI A;  1L0W A;  4AQY L;  1K9M C;  3K8A A;  3EN2 A;  1L1O B;  1YZ6 A;  4NXN L;  1VQ7 A;  5IP9 H;  1VCI A;  2HIV A;  1TWH H;  4LWC A;  4AH6 A;  4JI1 L;  4B3S L;  1VQK A;  1XJV A;  4JV5 Q;  3FKI G;  1K83 H;  4KI0 A;  2B29 A;  1XTD A;  5FLM H;  1UWV A;  5C0X G;  1C7Y A;  1GD7 A;  1LYL A;  4YWM A;  1Q81 C;  1LM0 A;  1X3G A;  3DLL A;  1E24 A;  4QY7 A;  3UDG A;  2OQK A;  2A8V A;  4JI8 Q;  2VQE L;  2F52 A;  4BBR H;  4DV4 L;  3RN5 A;  1SE8 A;  3KJO A;  1ASY A;  1QVF A;  2AHO B;  4BBS H;  4BXX H;  2NN6 I;  4IFD G;  2B63 H;  2JA5 H;  1N36 L;  2I5L X;  2K4K A;  3FP9 A;  4LF7 Q;  1K3R A;  3A5U A;  2UUC L;  1XPU A;  1QUQ B;  1WOC A;  2HHH Q;  3KF6 B;  2Y0S G;  2QGQ A;  2ZTC A;  4LFC L;  3ZJY C;  5C3E G;  1N9W A;  4WJ3 M;  4FDB A;  3W1G A;  2N78 A;  1L1O C;  1IZ6 A;  2ATW A;  2JA6 H;  5IP9 G;  4MTN A;  2ZTE A;  1Z47 A;  3I2Z A;  3I4M G;  3E9I A;  2RCN A;  1JJG A;  4YHH Q;  4AQY Q;  2E2H H;  1Y1V H;  3BU2 A;  3KF8 B;  1XNR L;  4JI2 Q;  1B7Y B;  2NVY H;  1VQB A;  3CCJ A;  1I5F A;  4DR1 L;  1Q82 C;  2JA8 G;  5IY0 A;  3TQY A;  2UXC Q;  4BBR G;  4PZ7 A;  2ASB A;  4KHZ A;  2V1C C;  4BBS G;  2CCZ A;  2PI2 E;  4BY7 G;  1P16 A;  1GVP A;  3J80 i;  2JA5 G;  3G6E A;  3ER0 A;  2B3G A;  4GKJ L;  2XTI A;  2Y0S E;  3UDI A;  4AYB G;  4X62 L;  1XMO L;  4WJ4 A;  1T9H A;  1JT8 A;  2VQE Q;  4XIG S;  2IX0 A;  5FJ8 H;  4RG1 A;  1TWF H;  4OWT B;  4R1J A;  4TVA B;  2Z6K C;  1VQ4 A;  1WI5 A;  1N36 Q;  3S14 H;  4K0K L;  4UPA A;  4X65 Q;  2VQF L;  1I50 H;  3S1R H;  4LF5 L;  5LMU Q;  2BH8 A;  2PNH A;  4L5T A;  4DK6 C;  1XPO A;  2WAQ G;  3CCU A;  4A3I G;  1Y14 B;  4JBW A;  4C3J H;  3KDF A;  5GRO A;  4ALP A;  3T1Y Q;  1E3P A;  1HZB A;  2K50 A;  4OX9 L;  4QJF A;  4X66 Q;  5GAD C;  1Q7Y C;  3S16 H;  1KRT A;  3PO3 G;  4DK3 C;  3RLO A;  5M5Y H;  4GNX B;  1YBY A;  2JA7 H;  4HIO A;  3K7U C;  1B70 B;  4AIM A;  5C4X H;  1XNR Q;  1VQL A;  1J6Q A;  4P72 A;  1XPR A;  1N34 L;  2UU9 L;  4DR1 Q;  1PHJ A;  1IBL L;  2BA0 A;  4A3J H;  1S72 A;  4DUY L;  1ASZ A;  1CUK A;  4NB3 A;  5FJ8 G;  3FHW A;  3CPF A;  4P73 A;  1JB7 A;  2YU9 H;  2NZO A;  1HNX L;  4R4I A;  4DV5 L;  4GKJ Q;  3HOX G;  4X62 Q;  4JI5 L;  5M5X H;  3RN2 A;  3D0F A;  2OTJ A;  2R93 G;  4APV A;  2E2I H;  3JAM i;  4A3M H;  2AKW B;  1A62 A;  2AWO A;  5BR8 L;  3CCE A;  1M90 C;  1X65 A;  3PIP A;  1PH4 A;  4EQ5 A;  1YHA A;  2Q2I A;  4GLX A;  1VQ5 A;  4IJH A;  4KLK A;  1YI2 A;  2E2J H;  2VQF Q;  4LF4 Q;  2VS1 A;  1X6O A;  1YIT A;  4LF5 Q;  1WCM G;  3HFZ B;  1FJG Q;  3TEH B;  4OWW B;  1BBW A;  4HJ8 A;  2D0O A;  3CCL A;  3BJU A;  4KHP L;  1IBM Q;  5GAG C;  2RHS B;  5JJK A;  2C35 B;  3JAM c;  4A3D H;  4J15 A;  3L0O A;  1KXL A;  4A3J G;  1VQA A;  4A3E H;  1VQI A;  3CXC A;  4A3K H;  2KEN A;  2L15 A;  4DUZ L;  4DV2 L;  3CPW A;  3RNU A;  3SGI A;  1G29 1;  2ZM6 L;  2YTY A;  3EIV A;  1PH2 A;  3STB D;  1N34 Q;  3MXN B;  1E1O A;  1IBL Q;  1EOV A;  2XGT A;  3PUX A;  1XNQ Q;  3TRZ A;  4OON A;  4HID A;  4GOP A;  1Y1W G;  1I94 L;  3GTL H;  1HNX Q;  3T1H L;  5IE8 A;  3W5O A;  3S1N H;  1QZH A;  3A74 A;  2H5X A;  3UDF A;  3G71 A;  3ULL A;  3GTJ H;  4GN3 B;  2Q2T A;  5IT9 c;  2I0Q A;  3GTK H;  2BA1 A;  3PIO A;  2NVQ H;  3A5Z B;  2N49 A;  4UP9 A;  4A3D G;  1S3O A;  3STB C;  4DV3 Q;  1CKO A;  1YVC A;  4O2D A;  4DR4 Q;  1IBK Q;  2LXK A;  1A0I A;  4A3K G;  1D7Q A;  4NXM Q;  3TS2 A;  4JYA L;  1SMX A;  4TQU S;  4EX5 A;  3I4N G;  2CWA A;  3GD7 A;  2GN5 A;  2MQH A;  3S1M H;  3M85 A;  3ERS X;  1UEB A;  2F3I A;  4YY3 Q;  2E5L L;  4DUZ Q;  1S40 A;  3HOV G;  4POF A;  1FL0 A;  2E8G A;  2ZJQ A;  3E0E A;  2PI2 A;  3EBE A;  3BZK A;  3L2P A;  2QEX A;  4DV1 L;  3J7Z C;  4DR2 Q;  1EIY B;  2ZM6 Q;  1BVS A;  1CKN B;  5M3M H;  1K8G A;  4A3C G;  1V9P A;  4B3T L;  2R92 G;  3HOY H;  5IP7 G;  4DV0 Q;  2VZA A;  1PYB A;  4A3F G;  3PUZ A;  1N33 Q;  3GTM H;  2IX1 A;  2HQL A;  2WB1 G;  3T1H Q;  3RZD H;  1Q8K A;  1YHB A;  4OO1 I;  4DNI A;  1JJ2 A;  5GQO A;  4DV7 Q;  4JI4 L;  3M4P A;  1PH7 A;  1MJE A;  1VQD A;  3I4O A;  3NEM A;  3S2H H;  1WFQ A;  2LSS A;  3HKS A;  5GAH C;  1FGU A;  4GN4 B;  5FLM G;  4HJA A;  5DLQ E;  3HKZ G;  1VQF A;  4DR3 L;  1PH5 A;  2NVX H;  1RL2 A;  4NXN Q;  4JI1 Q;  4P74 A;  4MZ9 A;  4B3S Q;  4JYA Q;  5AJ3 L;  4BY1 G;  5H1S E;  4BXX G;  2B63 G;  1SN8 A;  5M3M G;  3KLW A;  1XMQ L;  1RIP A;  2WB1 E;  3WWV A;  4JI0 L;  3PO2 H;  5K36 G;  3CC4 A;  1NTG A;  2MFI A;  1AE3 A;  1SRO A;  1WYD A;  2E5L Q;  4IPH A; 
#chains in the Genus database with same CATH topology
 5C4Z A;  3C46 A;  3NE5 B;  4DV4 Q;  1DD2 A;  3LWU A;  1B2T A;  1HNZ L;  3AB9 A;  2JA6 G;  1QCB D;  1I3Q H;  5EJW A;  2I5M X;  4RHR A;  1GM5 A;  5I2X A;  2BH2 A;  2B2Y A;  1UEA B;  1V43 A;  5ELO A;  1EWI A;  3NPP A;  3D4D A;  2JEB I;  3AFQ A;  2ALY B;  1M8A A;  2F4I A;  1BKB A;  2B8F A;  1PTO B;  1SND A;  1STB A;  2EZV A;  4P2C B;  1V1P A;  4JI7 L;  4JBK A;  1STA A;  2K1B A;  5K5P A;  1L1O A;  2E75 C;  2FXQ A;  5G3L F;  5FK9 C;  2HD3 A;  4L63 B;  3I3C A;  1SMY D;  1NNX A;  2R7Z H;  5C3X A;  3HS0 C;  1X54 A;  4KD3 A;  1Q8I A;  4QIW B;  4XYO A;  4C3J G;  1TU2 B;  4DXF A;  1HNZ Q;  4DXG A;  1V1O A;  2Y0S B;  4MN3 A;  2NTS A;  2XRQ D;  2K52 A;  1D5X C;  5HY6 A;  3C1F A;  5EPJ A;  5LHY 1;  3VA7 A;  1QUQ A;  1RD9 D;  2SEB D;  3X3N A;  2EQS A;  2CH4 A;  3CU7 A;  4JC0 A;  4ZQ3 A;  4QL5 A;  1OXV A;  2VY3 A;  1H95 A;  1CQF A;  4I65 A;  2VUM B;  1EZ6 A;  4A93 H;  4BY7 B;  1STH A;  2UU9 Q;  3E3X A;  4PG3 A;  5JEA H;  4IPG A;  4A3B B;  2MO0 A;  4A4I A;  5GAE C;  1BF4 A;  3AEV A;  4C3H B;  3T4A C;  3TBI B;  2F0O A;  1RTN A;  5BR8 Q;  2WAQ B;  1EWC A;  2F0V A;  1D5M C;  1E7Z A;  1ICW A;  3T56 B;  4XQJ A;  4HMI A;  1QVC A;  1Y8O B;  4YWK A;  2A6E D;  2F3V A;  4DR7 L;  2NYZ D;  4GZY C;  4ME3 A;  1J5E L;  2WKC A;  5ELN A;  2PZU A;  1E22 A;  1HH2 P;  2N3S A;  5C3E H;  3GTP B;  1KRS A;  1TWA H;  1EY9 A;  5FOB B;  2R93 B;  4C2M B;  3U58 A;  1L2F A;  5IGE A;  3F8T A;  3S2D H;  4KKS A;  2EY5 A;  3HZX A;  3GTQ H;  2Q2H A;  2JSO A;  3J80 L;  1KAB A;  1S5F D;  3SXH A;  5CV7 A;  3GTO H;  4QQB X;  1AE2 A;  1HZ9 A;  2F0I A;  3DM3 A;  3ULJ A;  4X65 L;  1IYJ B;  3HOU H;  3MHB A;  4DR7 Q;  4HJ5 A;  1WJJ A;  4N8X 1;  1STY A;  1J5E Q;  3K57 A;  1DGS A;  1I4Q A;  3SDZ A;  1STN A;  1CSP A;  1ZYR C;  1NMG A;  2RCF A;  5C4J B;  4A3I H;  1E2V A;  1PH9 A;  2CWP A;  2F0W A;  1VQ8 A;  2ZTD A;  2PCF B;  3SR1 A;  1V1Q A;  1RHP A;  3M3Y H;  2RA4 A;  2PMZ E;  3F2U A;  3PMF A;  5I6Y A;  4X64 L;  1NCV A;  5KIX A;  1VQG A;  4QCL A;  2OWO A;  2B8G A;  5I4D A;  1NMF A;  1PMR A;  3AFP A;  2L4N A;  3CMA A;  4PMB A;  3HOX H;  4CJ0 B;  1O80 A;  2ICI A;  1X56 A;  2E2D C;  1JOO A;  1IBM L;  5I6W A;  3KFU A;  5JAV A;  2FHT A;  4AYB E;  4DR5 L;  1N32 Q;  2O4X A;  2PZT A;  4BWG B;  3QG1 A;  4A3G H;  2F0U A;  4JG2 A;  1LT3 D;  4J1M A;  3CKI B;  1SYF A;  2R7F A;  1XNQ L;  3OTO L;  2K01 A;  2NUC A;  4IO9 A;  2Z4I A;  3HKZ B;  4X64 Q;  2Z6K A;  3HOW H;  2EY2 A;  5IYD H;  1SE2 A;  3VYT A;  1WTR A;  1S4Z A;  3QO2 A;  1GKH A;  1PRT F;  1JWM D;  3MVV A;  5KRU A;  2B63 B;  2AUK A;  4DV3 L;  4JVZ A;  3BYT B;  4LUZ A;  4DR4 L;  3WOE A;  5JJI A;  3LX0 A;  3VR4 A;  4NXM L;  4NPS A;  5ELF A;  2GVA A;  5IYB G;  2KCT A;  3J7A F;  2JYO A;  2EJF C;  3RD4 A;  2VB3 X;  1NY4 A;  1CA5 A;  4DR5 Q;  5I9O A;  4DR2 L;  2K14 A;  4MNO A;  5IGF A;  3MFY A;  4YWL A;  4RKB A;  3OTO Q;  1WTW A;  4POG A;  1QE6 A;  1N33 L;  1TY0 A;  4HIK A;  1OXS C;  3D31 A;  1FVI A;  4KJO A;  3A54 A;  1Q46 A;  1EL0 A;  3PF5 A;  2LY7 A;  4A3F H;  4Y7N H;  1V1P B;  3VR6 A;  4AQY L;  2K04 A;  3K8A A;  1L1O B;  1VCI A;  3I70 A;  4LWC A;  4S3S A;  3V2T A;  4NKL A;  2B29 A;  2RKS A;  5TSS A;  4WFN 3;  1Q81 C;  1LM0 A;  3DLL A;  4K5V A;  1E24 A;  2G9D A;  3P75 A;  5NUC A;  3UDG A;  2OQK A;  2Z1C A;  1ASY A;  1QVF A;  1SE8 A;  4IFD G;  5C4X B;  4BBS H;  4IUP A;  2JA5 H;  1N36 L;  2WAC A;  3K0Y A;  4TKO B;  3UI2 A;  4LF7 Q;  2UUC L;  1QUQ B;  1EYA A;  2NTT A;  3KF6 B;  2Y0S G;  2QGQ A;  3ZJY C;  1F9S A;  2F0E A;  3W1G A;  5M5X B;  2DNE A;  3T16 A;  2JA6 H;  1U4L A;  1Z47 A;  2QDB A;  4A3M B;  3DXJ C;  4N9T A;  4AQY Q;  2E2H H;  3ONA B;  2OXP A;  3C3L A;  2NVY H;  3LWE A;  2HCI A;  2MUY A;  5EKI A;  1QNU A;  4KHZ A;  4BY7 G;  3G7L A;  3J80 i;  4GKJ L;  3G6E A;  3ER0 A;  2FMC A;  4X62 L;  1TQO A;  4IUV A;  1K28 A;  3HEJ A;  4DAY A;  4O1N A;  2IX0 A;  5FJ8 H;  1EZ8 A;  1PZK D;  4OWT B;  1WD1 A;  3BDL A;  2Z6K C;  2FIN B;  1VQ4 A;  1N36 Q;  4R8I A;  3SHL A;  4UPA A;  1I50 H;  3S1R H;  5LMU Q;  5KEE A;  3SE0 A;  2WAQ G;  2F0J A;  4C3J H;  1S5E D;  3D8G A;  5DAU A;  5GRO A;  3T1Y Q;  1QNK A;  1HZB A;  3BG3 A;  4OX9 L;  1AEX A;  2DJF C;  4X66 Q;  5A35 A;  1KRT A;  2K05 A;  3RLO A;  2B2V A;  1RF2 D;  2WB1 B;  2ICE C;  4AIM A;  1B70 B;  1A6X A;  2WIN B;  1VQL A;  1ILP A;  1XPR A;  2NVT B;  3GP7 A;  1DCZ A;  1CUK A;  4NB3 A;  1K3B C;  3FHW A;  3O13 A;  4DFA A;  2YU9 H;  2G9H D;  4DV5 L;  4GKJ Q;  4WRD A;  4X62 Q;  2OTJ A;  2R93 G;  4XDX A;  2E2I H;  2CHB D;  4BY1 B;  1LT6 D;  2AKW B;  3L3O C;  4UHV A;  4NW2 A;  1EEF D;  2Q2I A;  4IJH A;  4KLK A;  4X3T A;  2E2J H;  1YIT A;  3HOY B;  2KCC A;  3A7A B;  3BJU A;  4KHP L;  5JJK A;  3JAM c;  1BO0 A;  4YIJ A;  4J15 A;  4KV6 A;  5CV4 A;  3NP8 A;  3W2D A;  2KEN A;  4L6T B;  3NBI A;  2BE5 D;  2EVB A;  1E1O A;  4DK0 A;  5I9P A;  3T13 A;  1HQM C;  3PUX A;  3TRZ A;  1I94 L;  3T1H L;  4EQO A;  3W5O A;  4OIJ A;  4FF2 A;  2EY1 A;  1D1I A;  1EY7 A;  3U9S A;  1CHP D;  5IOD A;  2I0Q A;  4QB4 A;  3QIA A;  4WJW A;  3PIO A;  2N49 A;  5EBD A;  3STB C;  5CV9 A;  2MJ8 A;  1IBK Q;  2LXK A;  1D7Q A;  3NTK A;  1R9T B;  1EY8 A;  1SMX A;  4TQU S;  3GD7 A;  3NHH A;  2GN5 A;  1RDP D;  3H91 A;  4JPB W;  1EEI D;  3TZD A;  2A69 C;  4DK1 A;  3K7A B;  1UEB A;  4F7X A;  4ZYS A;  3OWE B;  4K8I A;  3J7Z C;  3CRK C;  5M3M H;  1SFO B;  1K8G A;  1DZ1 A;  1A2T A;  4DV0 Q;  2VZA A;  4IQZ A;  3GTM H;  3PUZ A;  1K0S A;  2RSN A;  2IX1 A;  2HQL A;  3T1H Q;  3RZD H;  1BCP C;  1MJE A;  3TME A;  1WFQ A;  3HKS A;  3GV6 A;  4GN4 B;  1ZYR D;  2F1M A;  2F0F A;  1VQF A;  3HKZ G;  2NVX H;  1D1K A;  1RL2 A;  4HED A;  1YNN C;  4P74 A;  3DHQ A;  5AJ3 L;  5HUR A;  3H0G B;  2B63 G;  5K36 G;  2EJG C;  1I4G A;  4O42 A;  2K28 A;  4L8J A;  3N52 A;  1JCK B;  1HZC A;  1V8Q A;  4R4C A;  2K5N A;  4OHJ A;  3NTI A;  3K5L A;  2UXD L;  1SJE D;  4GLV B;  5DM6 3;  2QA4 A;  1JJC B;  4F8M A;  2C9O A;  5COR A;  4RH6 A;  3SK8 A;  1IW7 C;  1GUO A;  3H15 A;  4LFC Q;  1TWG B;  4OL7 A;  1SYD A;  3Q0A A;  1NR2 A;  1ROD A;  3MXG A;  2DUD A;  1FGB D;  3I55 A;  3V05 A;  1YJW A;  2A73 B;  3TDQ A;  3S15 H;  3TP8 A;  2EXD A;  1GUG A;  5EGT A;  1J8I A;  2D62 A;  3FKI B;  3OW7 A;  3GO5 A;  4H02 A;  2NN6 G;  1BUV T;  1OXU A;  2KCM A;  3CCV A;  1HJP A;  2KED A;  1TWC B;  1BBU A;  2GVB A;  3VA5 A;  1XMO Q;  1KNE A;  2MO1 A;  1ENF A;  1KDA A;  4ID6 A;  1PV4 A;  5CV8 A;  1DM0 B;  1EWH A;  3SVM A;  3RUZ A;  1LUZ A;  5IYB H;  3S1Q B;  4LFB L;  2YV5 A;  1PTO C;  3FMC A;  1SNQ A;  1TWH B;  3BZD B;  4GKK L;  3NQT A;  3I4M B;  4L5R C;  3IRB A;  2JA9 A;  5C0X I;  1VQ6 A;  5C4X G;  2K75 A;  2RBM A;  3UE0 A;  4BS9 A;  4TRD A;  1VQO A;  4I7A A;  3A56 A;  2V4D A;  4UP8 A;  2KVM A;  2JA8 B;  3TP7 A;  1JWS D;  3RZO B;  4BBR B;  2F0P A;  5JOB A;  4FO2 A;  3GQB A;  2Z6B A;  2K5H A;  2LFN A;  3G48 A;  4Y52 H;  4X3K A;  3E6Z X;  4A3M G;  2M9V A;  4ZRZ A;  1QJO A;  1GHK A;  3VYS A;  1K8O A;  4JI5 Q;  1AW7 A;  1VQH A;  4DAY B;  1C4Q A;  1KHI A;  1PTO H;  2F4V L;  2K6A A;  4JOI A;  1F2M A;  4LFA L;  1LO5 D;  2LKV A;  3MC0 B;  3U9O A;  2IHF A;  4UP7 A;  1LTL A;  2FFK B;  4DKA C;  3PO3 B;  2VL6 A;  4GKK Q;  1FNV A;  1PRT B;  4IUU A;  1W2B A;  5CMD A;  3AYH B;  4IFD H;  2YTX A;  1F9R A;  4OEL B;  2RVL A;  4BA2 I;  3U4V A;  4DPG A;  4QMG A;  4GNX A;  3DEO A;  3CW2 C;  2N8N A;  4JI2 L;  1U4R A;  1O7I A;  4IZ8 A;  2KHI A;  4IPD A;  3MAQ A;  2UXC L;  1B3A A;  5LMN W;  4UDU C;  1TY2 A;  3ERO A;  3U50 C;  5FO7 B;  3H3V C;  4DR6 L;  1Q86 C;  1B9M A;  1WCM B;  2M00 A;  2F4V Q;  1U5K A;  3DWQ A;  4LFA Q;  2VUM H;  4BY7 H;  5C6A A;  4A3B H;  4IOC A;  3DM1 A;  2HQE A;  1RJT A;  3A7L A;  3ERQ A;  5EAY A;  1GUN A;  4F88 A;  3F1Z A;  3HOY G;  1TT2 A;  4C3H H;  1KC8 C;  3CCR A;  3J80 E;  1Y1W B;  2A74 C;  4OO1 H;  4YCV A;  4A3L H;  1EIG A;  3HOZ G;  3H3V H;  3MXN A;  1HNW L;  3BVZ A;  1SJH D;  2QW7 A;  3ULP A;  1O7Y A;  3GDE A;  4QIW E;  2CH4 W;  4DR6 Q;  4A3D B;  1IL2 A;  2EPB A;  1O7L A;  4V19 0;  4RGN A;  2MGS A;  2XVS A;  5EPL A;  3A8K E;  4RHS A;  5JJZ A;  2HT1 A;  1EQT A;  1G2T A;  1BOS A;  1BDO A;  3GTP H;  4LF4 L;  4IPC A;  3J80 c;  4C2M H;  3HOV B;  2R93 H;  2KQ3 A;  1HTL D;  3F2B A;  5J39 A;  1IL8 A;  4MTK A;  2C5C A;  1YHQ A;  1XTC D;  4IFD J;  4OXP A;  1ZEQ X;  3SK4 A;  3CME A;  3L7Z C;  1GO3 E;  1T5X D;  1IYU A;  3VDY A;  4DV6 L;  1GUS A;  4I7Z C;  4IJL A;  1HNW Q;  3DEP A;  1SBB B;  2B2U A;  3E9H A;  4JOI C;  4CDC C;  2KEC A;  3KF6 A;  4DF7 A;  4KN7 C;  2Z0S A;  2WAQ E;  1D8L A;  2MNA A;  4DGZ A;  3S1M B;  2B2W A;  3C2P A;  1EFW A;  1XX8 A;  1CSQ A;  3BDC A;  4ZAI A;  5C4J H;  1G6P A;  4JI7 Q;  3CD6 A;  3V96 A;  1H9S B;  1UNS A;  1X55 A;  1Q90 A;  1DOL A;  2SNM A;  4GNX C;  5IYC G;  3I8Z A;  1HR0 W;  1DON A;  3CCS A;  3BVG A;  3F2C A;  1A8V A;  2L1B A;  3PF4 A;  1PFS A;  1OXT A;  1HTP A;  4YY3 L;  1DOM A;  3J81 i;  3H0G G;  1Y1V B;  4HSP A;  4PZ8 A;  4DV6 Q;  2I5H A;  1PZI D;  1A2U A;  4C3I G;  4P71 A;  2K5V A;  5C44 G;  1W3S A;  4A3C G;  3Q24 A;  3NEL A;  1O7Z A;  2SDF A;  3UE1 A;  2IHE A;  5JJL A;  1X9N A;  3E5S A;  4XXE A;  2EYH A;  1EYC A;  2L5T A;  1LLR D;  4GN5 A;  3EQL C;  1VQJ A;  1PFB A;  1TWF B;  3ICE A;  4DAP A;  3PSI A;  3S14 B;  4EQP A;  2XWB B;  1LAB A;  3DUZ A;  2XSC A;  1H9R A;  4NXN L;  1VQ7 A;  5IP9 H;  2HIV A;  4AH6 A;  3BDO A;  3FKI G;  4KI0 A;  1UWV A;  1CA6 A;  1GD7 A;  1LYL A;  1BCP D;  1X3G A;  3S16 B;  4QY7 A;  2B2Y C;  2A8V A;  5M5Y B;  2F52 A;  1KLG D;  4MIU A;  3HG9 A;  3T53 B;  2B63 H;  2I5L X;  5K36 H;  3FP9 A;  3QR8 A;  1Z7T A;  3TZU A;  3BYY B;  4DNR B;  5CBE E;  4FXK C;  4H13 C;  1B3Q A;  3NWS A;  5E4W C;  1L1O C;  1IZ6 A;  2ATW A;  4MTN A;  2ZTE A;  3I91 A;  4XT1 B;  3I2Z A;  3I4M G;  3E9I A;  2RCN A;  1JE4 A;  3BU2 A;  2F0N A;  1B7Y B;  4PV1 C;  3CCJ A;  4DR1 L;  1LAC A;  2JA8 G;  5IY0 A;  4XT3 B;  3TQY A;  4BBR G;  4PZ7 A;  2NN6 H;  1TVX A;  3UDI A;  4WJ4 A;  2OEO A;  5KGU A;  5IGC A;  1YNJ D;  4B9W A;  1JIC A;  1IKM A;  4A93 B;  4K0K L;  4X65 Q;  2VQF L;  2B2W C;  2QCP X;  4J6H A;  4DK6 C;  2RQX A;  2CW0 C;  1LTA D;  4JBW A;  2ENB A;  4F87 A;  3TSS A;  2PZW A;  2K5D A;  3PO3 G;  1HUN A;  1ONL A;  4GNX B;  3I72 A;  4FF1 A;  4ULL A;  2NVQ B;  5C4X H;  3IFD A;  2HDL A;  1J6Q A;  4P72 A;  4X3S A;  4DR1 Q;  1PHJ A;  1IBL L;  2BA0 A;  4DUY L;  5IT9 L;  3CPF A;  4P73 A;  2NZO A;  1HNX L;  1U4M A;  1SNM A;  4IAL A;  1WTP A;  3EJI A;  5M5X H;  3H6M A;  4A3M H;  3BVM A;  2SNS A;  1A62 A;  1M90 C;  1G6Z A;  2NWG A;  1R4Q B;  1YHA A;  2VQF Q;  2VS1 A;  1WCM G;  3TEH B;  3CCL A;  1ET9 A;  1IBM Q;  5GAG C;  2PPB C;  2AQ2 B;  2C35 B;  2K03 A;  4HAE A;  1KXL A;  3L0O A;  3GTQ B;  4A3J G;  4A3K H;  4DV2 L;  2ZM6 L;  3OSO A;  2YTY A;  1BNZ A;  2CVR A;  3MXN B;  4IN3 A;  1IBL Q;  2XGT A;  1SE4 A;  1XNQ Q;  3GV3 A;  4HID A;  1Y1W G;  1HNX Q;  2DN8 A;  5IE8 A;  3PO2 B;  2MP1 A;  3A74 A;  3UDF A;  4DA2 A;  3URY A;  4RFB A;  2Q2T A;  1SYC A;  2I07 B;  3IKJ A;  2BA1 A;  1A3U A;  2PYK A;  3M4O B;  1W6K A;  4A3D G;  4DV3 Q;  4DR4 Q;  4NXM Q;  5JPN C;  3TS2 A;  3M3Y B;  4EX5 A;  4V0B A;  2JN4 A;  1CHQ D;  3HOV G;  4HSV A;  1S40 A;  3FRP B;  5IGB A;  3E0E A;  2PI2 A;  3EBE A;  2QEX A;  4HMJ A;  1EIY B;  4DAV A;  4DV1 L;  4DR2 Q;  4BY1 H;  2ZM6 Q;  3KBX A;  4NMZ A;  4XYQ A;  1V9P A;  3A8I E;  4B3T L;  3HOY H;  4XQQ A;  1TR5 A;  2JP1 A;  1N33 Q;  1WD0 A;  1YHB A;  2F0H A;  2R3Z A;  4DNI A;  1JJ2 A;  3S17 B;  3K58 A;  4OO1 I;  1WTV A;  3I4O A;  3NEM A;  3HRZ C;  1GHJ A;  4OGQ C;  5M3F B;  5FLM G;  5KNC A;  4G7H C;  3Q6S A;  4DR3 L;  1D6E C;  4A3G B;  4G4K A;  2KHS A;  4PNY A;  4MZ9 A;  4LAA A;  5IGG A;  5H1S E;  4FF4 A;  3NTH A;  4BXX G;  2WB1 E;  1F2L A;  1NTG A;  2MFI A;  3S9W A;  1TS4 A;  1B44 D;  2ZJR A;  5M5W B;  5C3W A;  1PVO A;  2QDL A;  5HGT A;  2UUC Q;  4YCU A;  3KYH C;  1R9T H;  1ICF B;  4DNT B;  1Y1V G;  2TSS A;  1W6J A;  1YIJ A;  2AMC B;  5E3F A;  3ND8 A;  3K7A H;  2F3W A;  4K6L A;  3R2T A;  3TP6 A;  3CP0 A;  1K8M A;  1UUP A;  5LMN L;  1SFO H;  5C0X J;  2DJG C;  4EGV A;  1KD1 C;  3D3R A;  4RGT A;  1FD7 D;  2UUB L;  1B53 A;  1EY6 A;  1PDQ A;  3RLN A;  1BXT A;  4BA1 I;  3Q23 A;  2Q8T A;  2OCE A;  2JE6 I;  4GLA C;  4CKE A;  4ZKC B;  1VQP A;  1Y69 U;  2WP8 J;  1VQN A;  1E2W A;  1NE3 A;  3PCO B;  3R2I A;  1PYW D;  1NAP A;  3H0G H;  4OX9 Q;  2O2L D;  1SMY C;  3HOZ B;  3P20 A;  3K5O A;  2EYF A;  4PMC A;  3VR2 A;  2R7Z G;  4RCO A;  1VMP A;  3KF8 A;  2KEE A;  3W1B A;  2JA5 B;  3J81 E;  5KND A;  1TWG H;  4G57 A;  3D6C A;  4DV5 Q;  1B9N A;  4JBJ A;  5FLX E;  1BBX C;  5ELB A;  1II3 A;  5FO9 B;  1JB3 A;  4KN4 C;  2IPK D;  2WV6 D;  1HRJ A;  5ISR A;  3CAM A;  1QVG A;  2FMM A;  1LTS D;  1QZG A;  1PZJ D;  1L0Y B;  1SNO A;  3CRL C;  3QB3 A;  3KJP A;  2Z9H A;  2BDO A;  3S24 A;  4KHP Q;  1TWC H;  1U9R A;  4U67 3;  4IUQ A;  3T51 B;  2JXM B;  4A93 G;  5JEA G;  4LMQ D;  1X3F A;  4L5Q A;  4R4O A;  2QEJ C;  3J7A V;  1EIH A;  3S1Q H;  3WOF A;  1X3P A;  3L9A X;  1NBW A;  3N6R A;  3PUY A;  1I94 Q;  5JVG 3;  2IY5 B;  3I4M H;  4KKU A;  3RLF A;  3CC2 A;  5D3I B;  1SLJ A;  2PW5 A;  1AH9 A;  1VDZ A;  1SYG A;  2IX3 A;  3CCM A;  2JA8 H;  5IWA L;  2ZXR A;  2H1E A;  3I7F A;  1PRT C;  3RZO H;  4GS3 A;  2OF1 A;  1HR0 L;  2EYL A;  2R7D A;  4KKT A;  1H9S A;  1AFP A;  3EVQ A;  2B2V C;  1SR3 A;  4CBV A;  2KBN A;  4ZKB B;  4PMW A;  2EXZ A;  2EYM A;  4U68 A;  3MFG A;  4LF6 L;  1N8R C;  4OWX B;  4C3I B;  5C44 B;  5EPK A;  2LXJ A;  1EQR A;  4KY5 A;  3B6Y A;  1AZQ A;  2RF4 A;  5J1Z A;  1PYS B;  1IXR A;  1JR0 D;  5ELE A;  3PO3 H;  3AMU A;  2SOB A;  4ME5 A;  4FYD A;  3MEF A;  2IT1 A;  4G7O C;  4LUO A;  4KK7 A;  1MBY A;  2DGY A;  2PNR C;  1L0X B;  1I6H B;  4UY8 C;  3J7A 5;  1DXM A;  4M8A A;  5IWA Q;  3HOU G;  3PIO 3;  2F03 A;  1PH1 A;  1VQC A;  3I4N B;  2A5H A;  4ZUI A;  3PO2 G;  1HR0 Q;  3CQZ B;  3R93 A;  3I4L A;  5M9O A;  2RSO A;  1B8A A;  1U0L A;  2KOL A;  5AJ3 Q;  1FJG L;  3CCQ A;  1CT1 D;  2RHQ B;  2F0Q A;  3OW2 A;  1JMC A;  4A76 A;  2CFM A;  4LF6 Q;  2R92 B;  1WCM H;  4JK1 C;  4EVO A;  2R6G A;  3I73 A;  3GTG B;  1CM9 A;  2UXD Q;  3M9B A;  3J81 L;  2DNC A;  2YYZ A;  3NEN A;  1CKN A;  1XWE A;  4RAU C;  1SRU A;  5BN4 A;  3PGZ A;  5FLX L;  1K83 B;  1KDB A;  2EOT A;  3MWY W;  4NP5 A;  4JW0 A;  4L5S A;  2ZXO A;  2F0G A;  2F0D A;  1A15 A;  2N88 A;  4K2K A;  1Y1W H;  2UXB L;  3U4Z A;  1T5E A;  3PUW A;  3TS0 A;  3NSW A;  2JQO A;  4PQX A;  3HP3 A;  3TP5 A;  1KAA A;  1VS0 A;  5CGK A;  5M3F G;  1KDC A;  3PUV A;  2QKI C;  1KIX A;  2Z4H A;  3M7N A;  1EQV A;  4A3G G;  3TRE A;  1G8Z D;  2J4X A;  4LUV A;  1LT4 D;  1C9O A;  1XYI A;  4RWS C;  2EYO A;  3HOW G;  2Q2U A;  4KMU C;  1X32 A;  4LFB Q;  1Q12 A;  5EKK A;  5IYD G;  2GA4 B;  2IL8 A;  4CHT B;  1KAW A;  3EFX D;  5G3L D;  1FNU A;  3HOV H;  2ZJP A;  3KBG A;  3Q22 A;  4PZ6 A;  1TS3 A;  2A68 C;  4DV7 L;  2KHJ A;  4RA8 A;  3NXW A;  2FJ2 A;  1G91 A;  2UXB Q;  1IKL A;  1MIU A;  2VB2 X;  3QWN A;  4K14 A;  1K9M C;  2IWH A;  5E4X A;  4HCS A;  4JI1 L;  1IYV A;  4B3S L;  1VQK A;  5C0X G;  5FLM H;  1C7Y A;  4YWM A;  2L0C A;  3C1E A;  1AZP A;  2Q8I B;  2KUM A;  3PIP 3;  2JA7 B;  4DV4 L;  3RN5 A;  1E2Z A;  2IW3 A;  4BXX H;  1PXU A;  1I4X A;  4CDD C;  3A5U A;  4A3J B;  1XPU A;  4FXD A;  3IAY A;  1MHW C;  3SK5 A;  2ZTC A;  1N9W A;  4WJ3 M;  4HN7 A;  5E1F A;  1MD2 D;  4ZK9 B;  1JJG A;  2F0M A;  3TN2 A;  1Y8P B;  1Y1V H;  2D5D A;  3KF8 B;  1XNR L;  4JI2 Q;  3SEB A;  1MGS A;  3FEW X;  1I5F A;  4OEM B;  4RCN A;  1Q82 C;  2UXC Q;  5JVH 3;  3NQI A;  4BBS G;  2CCZ A;  1GVP A;  2JA5 G;  1F2Y A;  2XTI A;  2Y0S E;  3M7G A;  1KTK A;  3KLR A;  4A3E B;  1T9H A;  3VYR A;  5BN3 A;  2KJX A;  1FR3 A;  1TWF H;  1DYQ A;  1ENC A;  4R1J A;  2J0T D;  2L11 A;  2DY7 A;  3S14 H;  2OT2 A;  3P7J A;  1SYE A;  2PNH A;  2WKD A;  3VYU A;  3A55 A;  3GTL B;  4N8F A;  4KD4 A;  1Y14 B;  3CCU A;  3S1N B;  3KDF A;  1TII D;  1E3P A;  2AQ1 B;  5C5M A;  4QJF A;  5GAD C;  1Q7Y C;  3S16 H;  3OPO A;  5M5Y H;  3GTJ B;  1I4R A;  4FVM A;  2MHV A;  3K59 A;  3GTK B;  3K7U C;  1XNR Q;  2UU9 L;  1EY5 A;  1QIL A;  4QUC A;  1RCV D;  5FJ8 G;  3D4R A;  1JB7 A;  1HA6 A;  1SYB A;  3ZYY X;  3MTS A;  1S5C D;  3RN2 A;  1ESF A;  3D0F A;  3NUC A;  1CI3 M;  1DJR D;  3JAM i;  4ZCK A;  3CCE A;  5BR8 L;  1X65 A;  5KYL A;  1PH4 A;  4H0L C;  5T1I A;  4GLX A;  1YI2 A;  4LF4 Q;  1X6O A;  3HFZ B;  4ZUJ A;  3P1H A;  4H44 C;  4LJZ C;  5IT9 E;  3S2H B;  2EE1 A;  1VQI A;  3RNU A;  4CJ2 C;  5KYI A;  3SGI A;  3CPW A;  1E0B A;  1G29 1;  4QUF A;  1IHZ A;  4ABN A;  4X3U A;  1C8C A;  3STB D;  1EOV A;  3OWF A;  3K5M A;  4OIK A;  4GOP A;  4ZLT F;  1H9J A;  2A69 D;  1QZH A;  5A2Q E;  5C5L A;  3ULL A;  3FPP A;  2O5J C;  5IT9 c;  2BE5 C;  2NVQ H;  1I3Q B;  4M1U B;  5ELC A;  1AN8 A;  2RDH A;  4RGO S;  1YVC A;  1F9Q A;  1A0I A;  5DNF A;  2Z8L A;  4JYA L;  5FKA C;  3I4N G;  2E76 C;  2CWA A;  4FXG C;  1F77 A;  2MQH A;  1SAP A;  3M85 A;  3ERS X;  3R3O A;  4YY3 Q;  2E5L L;  2E8G A;  2ZJQ A;  2ASB A;  1PRT D;  1EY0 A;  3VR5 A;  1CKN B;  2R92 G;  1YNN D;  2NB0 A;  3R8B A;  3FDT A;  4KY7 A;  5IP7 G;  1PYB A;  2TMP A;  4J8Q A;  1HA5 A;  2R7Z B;  4JI4 L;  1I4H A;  3DMU A;  1PH7 A;  1VQD A;  2CQA A;  1FGU A;  1Y8N B;  4R8N A;  1HFN A;  4HJA A;  2F0T A;  4TSS A;  2BOS A;  5DLQ E;  2D2C C;  3OOC A;  4NXN Q;  1F9P A;  2LMC B;  1NSN S;  2QF7 A;  4FNF A;  1IW7 D;  4JYA Q;  5M3M G;  1XMQ L;  3PO2 H;  3WWV A;  4JI0 L;  1WYD A;  2E5L Q;  3FPU B;  4IPH A;  3NBH A;  2B2U C;  4YCW A;  3E0J A;  1EU4 A;  4UAI A;  1Q1E A;  2A6H C;  3BZC A;  1N32 L;  3M4O H;  3J81 j;  3NK9 A;  3HKZ E;  3QOL A;  1VQ9 A;  5JEA J;  5CR3 A;  5L37 A;  2BDN A;  1KLU D;  1B1Z A;  3K81 C;  2A19 A;  5AFW A;  4JI4 Q;  2PQA A;  4X6A H;  3KK7 A;  1A63 A;  1CKM A;  1K8A C;  4LF9 L;  1ILQ A;  1Q3L A;  1YNX A;  1ET6 A;  1D2B A;  1QB5 D;  3AQQ A;  4MHE A;  2XRS D;  3DWA A;  2CKZ B;  4CKB A;  5IIF A;  3F2D A;  1HZA A;  1EQQ A;  1PTO D;  3ND9 A;  1NJI C;  3Q8D A;  4C1N K;  4FP5 D;  1XMQ Q;  1HUM A;  3WDN A;  4JI0 Q;  3S17 H;  4B3M L;  2KA7 A;  2PMZ B;  4GOP C;  5M3F H;  5C3E B;  1ML0 D;  2EYP A;  4K0K Q;  4EQN A;  1STE A;  1TWA B;  2HIX A;  1UE7 A;  2JA7 G;  1TS2 A;  2L9H A;  1CZW A;  1R4P B;  2ES2 A;  1D5Z C;  1J9O A;  2I46 A;  5CV6 A;  5A2Q L;  2DY8 A;  3S2D B;  1RTO A;  1GUT A;  1BCP F;  1WTH A;  2B39 A;  3AU7 A;  4LF9 Q;  2JEA I;  4FF3 A;  2CQO A;  4NDX A;  1M1K C;  4KTA A;  4IFD I;  3GTO B;  5F2D A;  2NZ1 D;  4ILW A;  5M5W H;  3H09 A;  3IL8 A;  1FYC A;  4AYB B;  4DUY Q;  2YTV A;  2WII B;  3HOU B;  1RKN A;  1I6V C;  2UUA L;  2A68 D;  4B3M Q;  1EFI D;  3K6O A;  1KL9 A;  1YJ9 A;  1P8L A;  2ID0 A;  4A3I B;  3RR5 A;  4E6I A;  5C0X H;  5IGD A;  1VF5 C;  2NVT H;  5LL6 S;  3X3M A;  4A3E G;  1EU3 A;  4LF7 L;  1LV9 A;  3KDF B;  1PH6 A;  5I2Y A;  2B2T A;  2JJQ A;  5CYU A;  2MPM A;  2AWN A;  3I56 A;  1TXY A;  2NZH A;  1PH8 A;  1Q1B A;  4QGU A;  1LTG D;  4DV2 Q;  3OYY A;  1XXG A;  1SNP A;  2M2L A;  4K2L A;  4IOA A;  3UDX A;  1K0R A;  4JCV E;  3HOX B;  3PV0 A;  2K33 A;  4KHV A;  4HR7 B;  4WOR A;  5KNB A;  1PLF A;  3OIP A;  4K8J A;  5J3B A;  2UUA Q;  2NBF A;  3KLS X;  1UE5 A;  1ZKO A;  2QIL A;  3RMH A;  2PO4 A;  3CC7 A;  3H3V I;  1OTC A;  3HOZ H;  1MJC A;  3QOJ A;  1BQQ T;  4HTH A;  1K73 C;  1UE6 A;  2EJM A;  1EYG A;  2K5Q A;  4R4Q A;  3MXU A;  4DU9 A;  2LS0 1;  5FO8 B;  4IUN A;  2D9U A;  5EKL A;  3MXP A;  1PTO F;  4LW1 A;  5ELD A;  4DAM A;  2E74 C;  3G6J B;  1F2Z A;  3OHX C;  5LMU L;  1JOQ A;  3HOW B;  1PFN A;  4CKC A;  3T1Y L;  3M4Y A;  4HIM A;  4X66 L;  5LL6 X;  4B3R Q;  4DV1 Q;  1WTQ A;  1X3E A;  3KOJ A;  4CDF C;  1VQE A;  5DM7 3;  4R4T A;  1Z9F A;  4HCE A;  1AP0 A;  2HCC A;  4B3T Q;  1EIF A;  3LGJ A;  1STG A;  3MZ5 A;  4GOP B;  1PA6 A;  3A0J A;  2VUM G;  3K80 C;  4O0A A;  3KLS A;  1PH3 A;  4JI3 L;  4A3B G;  4A3K B;  4K6D A;  5EBC A;  1SXT A;  4LNQ A;  4KJN A;  4DR3 Q;  2PW7 A;  3K0X A;  2OQ0 A;  1SE3 A;  5J22 A;  4C3H G;  2R61 A;  1EYD A;  4B3R L;  1UE1 A;  3IFT A;  5E7N A;  3EA6 A;  4B9X A;  4JI6 L;  3A8J E;  4JBM A;  1NR4 A;  4A3L G;  4OO1 G;  1SNC A;  3M4Q A;  4HJ9 A;  3CF5 A;  1HFG A;  3HGB A;  5HGQ A;  1G51 A;  4Y7N B;  4A3F B;  5IYC H;  3SK6 A;  1B4O A;  1EUJ A;  2EIF A;  3JAM E;  2WFW A;  1MSG A;  1H9K A;  1SSO A;  1YEZ A;  2HDM A;  3G4S A;  4XTC S;  2JK8 A;  1CK1 A;  1VQM A;  4JI3 Q;  4LF8 L;  2N55 A;  4C3I H;  5C44 H;  3OMC A;  4A3C H;  1QG7 A;  1C0A A;  2B2T C;  1GUW A;  1E1T A;  5LMN Q;  4HJ7 A;  4BBS B;  1B50 A;  1DOK A;  2D0P A;  1LT5 D;  2VW9 A;  1EOT A;  2XWJ B;  2VNU D;  2EYJ A;  1YJN A;  4CDE C;  2AUJ D;  1IBK L;  4JI6 Q;  1QOH A;  4JV5 L;  2UUB Q;  4CGY B;  4P75 A;  4B08 A;  1NUC A;  2XN9 C;  2JA6 B;  4A75 A;  1I6H H;  3NBH B;  1MI2 A;  4JI8 L;  2L55 A;  1MKH A;  1U4P A;  1OXX K;  1JE5 A;  3OMG A;  2OTL A;  2E2H B;  3FKI H;  3I4N H;  2NVY B;  3CQZ H;  2IJ0 A;  4R9W A;  2A1A A;  5D65 A;  1CQV A;  2AQ3 B;  4H7B A;  1TKW B;  2X69 A;  4DV0 L;  2HHH L;  4DN4 M;  1HPC A;  2BCO A;  2PQA B;  4ODG A;  3J81 c;  1H9M A;  1KQS A;  4LF8 Q;  2R92 H;  4RMF A;  5IP7 H;  1HHV A;  3JC6 6;  5FLX c;  4YHH L;  3GTG H;  1L0W A;  3EN2 A;  1VF7 A;  3FVQ A;  1YZ6 A;  1I50 B;  1UAP A;  5COY A;  1X3Q A;  3QJY A;  3S1R B;  1TWH H;  2A6E C;  5CC4 A;  1XJV A;  4C3J B;  4JV5 Q;  1K83 H;  1XTD A;  4QF4 A;  2G5D A;  5CBA E;  1LTT D;  5D3D A;  2J7Z A;  1I4P A;  4JI8 Q;  2VQE L;  4BBR H;  1SDF A;  3KJO A;  2AHO B;  2NN6 I;  3D4W A;  2K4K A;  1K3R A;  5IOC A;  1WOC A;  4RKL A;  1S5B D;  2HHH Q;  2YU9 B;  5C3E G;  4LFC L;  4FDB A;  2N78 A;  3K5N A;  5IP9 G;  4RGM A;  2E2I B;  1HQR D;  3J7Y W;  4YHH Q;  2A6H D;  4Q0F A;  1SEB D;  2E2J B;  1JOK A;  1VQB A;  4K5W A;  3W3A A;  1WTX A;  2HUG A;  2CW0 D;  5BN5 A;  2V1C C;  2PI2 E;  1P16 A;  4IUR A;  4LK1 C;  2B3G A;  4AYB G;  2F0L A;  5T1G A;  1XMO L;  1CTM A;  1JT8 A;  2VQE Q;  4XIG S;  4Q5V A;  4RG1 A;  3JAM L;  4TVA B;  1WI5 A;  1GXD C;  2X6L A;  4LF5 L;  2BH8 A;  4L5T A;  1XPO A;  4A3I G;  2RDF A;  1ENA A;  4ALP A;  1CFM A;  2K50 A;  1C48 A;  4DK3 C;  1YNJ C;  1YBY A;  4XQN A;  3ITP A;  2JA7 H;  4HIO A;  3BS1 A;  1N34 L;  3VR3 A;  4KY6 A;  4C56 C;  3MA2 B;  4A3J H;  1S72 A;  1ASZ A;  2F0K A;  1ZXT A;  2ZXP A;  3I90 A;  3MEH A;  4R4I A;  3HOX G;  5JPM C;  5C4H A;  3H94 A;  4JI5 L;  5DEH A;  1EY4 A;  2H4O A;  1HXY D;  3DWP A;  4APV A;  2AWO A;  1S5D D;  3PIP A;  5M3M B;  4EQ5 A;  1VQ5 A;  1FJG Q;  2XIW A;  4LF5 Q;  1BR9 A;  4OWW B;  3GTM B;  1BBW A;  2KCN A;  4N9P A;  1HCZ A;  2D0O A;  4HJ8 A;  2Q8R E;  1GJX A;  3RZD B;  2RHS B;  1QWY A;  5D14 A;  2EDG A;  4A3D H;  1VQA A;  4A3E H;  3CXC A;  2L15 A;  4DUZ L;  2O5I C;  3OIQ A;  1JWU D;  3EIV A;  2NVX B;  3D6W A;  1PH2 A;  1N34 Q;  2PQE A;  1LTB D;  4OON A;  3PQI A;  3GTL H;  4G7Z C;  3S1N H;  3G71 A;  2H5X A;  1O78 A;  1Z6H A;  2K7V A;  3GTJ H;  4GN3 B;  1G2S A;  1KNA A;  2L12 A;  2F0S A;  3GTK H;  3A5Z B;  1BCP B;  4UP9 A;  1S3O A;  1CKO A;  3LNN A;  4O2D A;  2K5W A;  4A3K G;  1LTR D;  1M4V A;  2XNA C;  1LTI D;  1WTO A;  1CZG A;  3S1M H;  3S15 B;  2F3I A;  3NWT A;  4DUZ Q;  4POF A;  1FL0 A;  2RDG A;  4IUT A;  1A3T A;  1JQY D;  3L2P A;  3BZK A;  1BVS A;  4CJ1 B;  1PFM A;  2K32 A;  5CV5 A;  4A3F G;  2ZT9 C;  2WB1 G;  1Q8K A;  2P5Z X;  1MSH A;  1GOZ A;  5GQO A;  4DV7 Q;  3M4P A;  4K5X A;  3S2H H;  2LSS A;  5GAH C;  2EY6 A;  1FNW A;  2VXW A;  4Z9C B;  1JC7 A;  1OO9 B;  1WVL A;  1PH5 A;  5EQ0 A;  3CHB D;  1TS5 A;  4JI1 Q;  1A3V A;  4B3S Q;  4BY1 G;  2X6G A;  1ESR A;  4C1N I;  3KUP A;  1SN8 A;  3KLW A;  1JOR A;  1RIP A;  3CC4 A;  1VMC A;  1AE3 A;  1SRO A; 
#chains in the Genus database with same CATH homology
 4YCW A;  4DV4 Q;  1HZC A;  1Q1E A;  4R4C A;  2K5N A;  3BZC A;  1HNZ L;  1N32 L;  2ZJR A;  3M4O H;  2JA6 G;  2UXD L;  1I3Q H;  3J81 j;  1PVO A;  4GLV B;  2I5M X;  2QA4 A;  2UUC Q;  1JJC B;  3HKZ E;  1GM5 A;  4YCU A;  1VQ9 A;  5JEA J;  3KYH C;  1R9T H;  2BH2 A;  3H15 A;  1V43 A;  4LFC Q;  1Y1V G;  1EWI A;  3K81 C;  2A19 A;  5ELO A;  2AMC B;  1YIJ A;  2JEB I;  3AFQ A;  4JI4 Q;  2ALY B;  2PQA A;  4X6A H;  1BKB A;  1A63 A;  2DUD A;  1CKM A;  1K8A C;  3I55 A;  4LF9 L;  1YJW A;  3K7A H;  3S15 H;  1YNX A;  2EXD A;  3AQQ A;  2D62 A;  3CP0 A;  4H02 A;  3GO5 A;  2NN6 G;  5LMN L;  2CKZ B;  4JI7 L;  4JBK A;  1SFO H;  5C0X J;  3F2D A;  1OXU A;  1HZA A;  2KCM A;  3CCV A;  1HJP A;  1EQQ A;  1KD1 C;  1L1O A;  2FXQ A;  1NJI C;  1BBU A;  3Q8D A;  2GVB A;  1XMQ Q;  3RLN A;  2UUB L;  2R7Z H;  4JI0 Q;  1XMO Q;  3S17 H;  2MO1 A;  4B3M L;  1X54 A;  4BA1 I;  1PV4 A;  4GOP C;  5M3F H;  1HNZ Q;  2OCE A;  2JE6 I;  4GLA C;  4K0K Q;  1VQP A;  2K52 A;  5HY6 A;  1LUZ A;  5IYB H;  4LFB L;  2HIX A;  2YV5 A;  1UE7 A;  2WP8 J;  1VQN A;  2JA7 G;  4GKK L;  1NE3 A;  3PCO B;  1QUQ A;  4L5R C;  3IRB A;  2JA9 A;  5C0X I;  2ES2 A;  1VQ6 A;  5C4X G;  2K75 A;  3UE0 A;  3H0G H;  4OX9 Q;  1VQO A;  2EQS A;  2JEA I;  4LF9 Q;  4UP8 A;  4JC0 A;  2CQO A;  4QL5 A;  1OXV A;  2VY3 A;  1M1K C;  1H95 A;  4IFD I;  2R7Z G;  4A93 H;  2UU9 Q;  5M5W H;  3W1B A;  4PG3 A;  2K5H A;  3G48 A;  4IPG A;  4DUY Q;  4Y52 H;  2YTV A;  4A3M G;  2MO0 A;  2UUA L;  4A4I A;  1TWG H;  5GAE C;  4DV5 Q;  3AEV A;  4JBJ A;  4JI5 Q;  4B3M Q;  1VQH A;  4DAY B;  1KHI A;  1KL9 A;  1YJ9 A;  1P8L A;  2F4V L;  5BR8 Q;  2ID0 A;  4JOI A;  3CAM A;  3RR5 A;  4LFA L;  1E7Z A;  1QVG A;  2NVT H;  1QZG A;  3KJP A;  4A3E G;  2IHF A;  4UP7 A;  1LTL A;  1QVC A;  4DKA C;  4LF7 L;  4YWK A;  2VL6 A;  3S24 A;  4GKK Q;  1TWC H;  4KHP Q;  4DR7 L;  1W2B A;  3KDF B;  1PH6 A;  3AYH B;  4ME3 A;  2JJQ A;  4A93 G;  1J5E L;  2AWN A;  3I56 A;  2YTX A;  1TXY A;  5JEA G;  2NZH A;  1PH8 A;  1Q1B A;  4QGU A;  5ELN A;  1X3F A;  3U4V A;  3OYY A;  4DPG A;  4DV2 Q;  4L5Q A;  4BA2 I;  4R4O A;  4GNX A;  4IOA A;  1E22 A;  1HH2 P;  3CW2 C;  2N3S A;  3UDX A;  5C3E H;  1K0R A;  2N8N A;  4JCV E;  4JI2 L;  3PV0 A;  1O7I A;  1TWA H;  1KRS A;  3S1Q H;  2KHI A;  3PUY A;  1NBW A;  4IPD A;  3U58 A;  1L2F A;  1I94 Q;  5J3B A;  2UUA Q;  3I4M H;  3RLF A;  2UXC L;  2IY5 B;  3F8T A;  3CC2 A;  3S2D H;  1UE5 A;  1SLJ A;  5LMN W;  1AH9 A;  3CC7 A;  3U50 C;  3H3V I;  3GTQ H;  4DR6 L;  1OTC A;  2Q2H A;  3HOZ H;  1MJC A;  1Q86 C;  1EYG A;  3CCM A;  1UE6 A;  1K73 C;  5IWA L;  4R4Q A;  2JA8 H;  2F4V Q;  3I7F A;  1U5K A;  3RZO H;  4GS3 A;  4LFA Q;  2VUM H;  1HR0 L;  3GTO H;  4QQB X;  4BY7 H;  2R7D A;  1AE2 A;  1HZ9 A;  3DM3 A;  3ULJ A;  4X65 L;  1IYJ B;  4A3B H;  4IOC A;  1SR3 A;  4LW1 A;  4DAM A;  5LMU L;  3HOU H;  4DR7 Q;  2KBN A;  4HJ5 A;  5EAY A;  1WJJ A;  4PMW A;  1J5E Q;  3F1Z A;  1DGS A;  3T1Y L;  4LF6 L;  1KC8 C;  4C3H H;  1N8R C;  3HOY G;  4OWX B;  4X66 L;  4HIM A;  2LXJ A;  4B3R Q;  1EQR A;  3CCR A;  4DV1 Q;  1CSP A;  1NMG A;  1X3E A;  3B6Y A;  2RF4 A;  3KOJ A;  4A3I H;  1VQE A;  1PH9 A;  4R4T A;  1Z9F A;  4YCV A;  4A3L H;  2CWP A;  4B3T Q;  1EIF A;  1PYS B;  3HOZ G;  3LGJ A;  2ZTD A;  1VQ8 A;  3H3V H;  1V1Q A;  1IXR A;  4GOP B;  1PA6 A;  3M3Y H;  3PO3 H;  1HNW L;  3A0J A;  2PMZ E;  2IT1 A;  3MEF A;  3ULP A;  2VUM G;  4LUO A;  3GDE A;  3K80 C;  4O0A A;  4QIW E;  2DGY A;  4X64 L;  1PH3 A;  4UY8 C;  4DR6 Q;  1IL2 A;  4JI3 L;  3J7A 5;  1VQG A;  4A3B G;  2OWO A;  5IWA Q;  3HOU G;  1PH1 A;  1VQC A;  1NMF A;  4LNQ A;  4DR3 Q;  3AFP A;  2HT1 A;  3K0X A;  1HR0 Q;  3PO2 G;  2OQ0 A;  3CMA A;  3HOX H;  1B8A A;  1U0L A;  3GTP H;  4B3R L;  4LF4 L;  4BY1 H;  1UE1 A;  4IPC A;  5AJ3 Q;  1FJG L;  3J80 c;  4C2M H;  5E7N A;  3CCQ A;  2R93 H;  2RHQ B;  4JI6 L;  3OW2 A;  4JBM A;  1X56 A;  3F2B A;  1JMC A;  4A3L G;  4A76 A;  1IBM L;  4OO1 G;  2CFM A;  3M4Q A;  1YHQ A;  4IFD J;  4LF6 Q;  4OXP A;  4HJ9 A;  3CF5 A;  3CME A;  3KFU A;  3L7Z C;  1WCM H;  1GO3 E;  5HGQ A;  1G51 A;  2R6G A;  4AYB E;  4DR5 L;  1N32 Q;  5IYC H;  2UXD Q;  3M9B A;  3VDY A;  4DV6 L;  2YYZ A;  3NEN A;  4A3G H;  1CKN A;  4JG2 A;  1EUJ A;  2EIF A;  1SRU A;  4IJL A;  2WFW A;  1HNW Q;  2R7F A;  3PGZ A;  1XNQ L;  3OTO L;  3E9H A;  4JOI C;  3KF6 A;  4IO9 A;  1YEZ A;  3G4S A;  2Z0S A;  3HOW H;  4XTC S;  2JK8 A;  2Z6K A;  4X64 Q;  2WAQ E;  1D8L A;  1VQM A;  4JI3 Q;  2MNA A;  4L5S A;  4LF8 L;  5IYD H;  4C3I H;  5C44 H;  1EFW A;  4A3C H;  1GKH A;  1C0A A;  1CSQ A;  1G6P A;  5C4J H;  1E1T A;  5LMN Q;  3U4Z A;  4HJ7 A;  1Y1W H;  4JI7 Q;  3PUW A;  3TS0 A;  3CD6 A;  2UXB L;  2JQO A;  2D0P A;  1X55 A;  2VW9 A;  1VS0 A;  4DV3 L;  4LUZ A;  2VNU D;  4DR4 L;  1YJN A;  5M3F G;  3PUV A;  1IBK L;  5JJI A;  4GNX C;  1KIX A;  4JI6 Q;  4NXM L;  5IYC G;  3M7N A;  4JV5 L;  4NPS A;  2UUB Q;  4P75 A;  2GVA A;  1HR0 W;  3CCS A;  3F2C A;  4A3G G;  3TRE A;  5IYB G;  2KCT A;  1I6H H;  4A75 A;  1A8V A;  3NBH B;  3PF4 A;  1NY4 A;  1PFS A;  1OXT A;  4JI8 L;  4YY3 L;  1MKH A;  4LUV A;  4DR5 Q;  3J81 i;  1OXX K;  1JE5 A;  3H0G G;  2OTL A;  1C9O A;  3FKI H;  3I4N H;  3HOW G;  4DR2 L;  4PZ8 A;  4DV6 Q;  2Q2U A;  2K14 A;  4MNO A;  3CQZ H;  4LFB Q;  1Q12 A;  2I5H A;  5IYD G;  1KAW A;  2A1A A;  2K5V A;  4P71 A;  5C44 G;  1W3S A;  3HOV H;  4YWL A;  2ZJP A;  3OTO Q;  4DV0 L;  4PZ6 A;  2HHH L;  3NEL A;  4POG A;  1N33 L;  2PQA B;  4HIK A;  1OXS C;  3D31 A;  3UE1 A;  3J81 c;  1KQS A;  1FVI A;  2IHE A;  4DV7 L;  1X9N A;  4LF8 Q;  1Q46 A;  5JJL A;  3PF5 A;  2KHJ A;  2R92 H;  4RMF A;  5IP7 H;  4GN5 A;  4A3F H;  4Y7N H;  1VQJ A;  3JC6 6;  5FLX c;  4YHH L;  3ICE A;  3GTG H;  2UXB Q;  1MIU A;  3PSI A;  1L0W A;  4AQY L;  1K9M C;  3K8A A;  3EN2 A;  1L1O B;  1YZ6 A;  4NXN L;  1VQ7 A;  5IP9 H;  1VCI A;  2HIV A;  1TWH H;  4LWC A;  4AH6 A;  4JI1 L;  4B3S L;  1VQK A;  1XJV A;  4JV5 Q;  3FKI G;  1K83 H;  4KI0 A;  2B29 A;  1XTD A;  5FLM H;  1UWV A;  5C0X G;  1C7Y A;  1GD7 A;  1LYL A;  4YWM A;  1Q81 C;  1LM0 A;  1X3G A;  3DLL A;  1E24 A;  4QY7 A;  3UDG A;  2OQK A;  2A8V A;  4JI8 Q;  2VQE L;  2F52 A;  4BBR H;  4DV4 L;  3RN5 A;  1SE8 A;  3KJO A;  1ASY A;  1QVF A;  2AHO B;  4BBS H;  4BXX H;  2NN6 I;  4IFD G;  2B63 H;  2JA5 H;  1N36 L;  2I5L X;  2K4K A;  3FP9 A;  4LF7 Q;  1K3R A;  3A5U A;  2UUC L;  1XPU A;  1QUQ B;  1WOC A;  2HHH Q;  3KF6 B;  2Y0S G;  2QGQ A;  2ZTC A;  4LFC L;  3ZJY C;  5C3E G;  1N9W A;  4WJ3 M;  4FDB A;  3W1G A;  2N78 A;  1L1O C;  1IZ6 A;  2ATW A;  2JA6 H;  5IP9 G;  4MTN A;  2ZTE A;  1Z47 A;  3I2Z A;  3I4M G;  3E9I A;  2RCN A;  1JJG A;  4YHH Q;  4AQY Q;  2E2H H;  1Y1V H;  3BU2 A;  3KF8 B;  1XNR L;  4JI2 Q;  1B7Y B;  2NVY H;  1VQB A;  3CCJ A;  1I5F A;  4DR1 L;  1Q82 C;  2JA8 G;  5IY0 A;  3TQY A;  2UXC Q;  4BBR G;  4PZ7 A;  2ASB A;  4KHZ A;  2V1C C;  4BBS G;  2CCZ A;  2PI2 E;  4BY7 G;  1P16 A;  1GVP A;  3J80 i;  2JA5 G;  3G6E A;  3ER0 A;  2B3G A;  4GKJ L;  2XTI A;  2Y0S E;  3UDI A;  4AYB G;  4X62 L;  1XMO L;  4WJ4 A;  1T9H A;  1JT8 A;  2VQE Q;  4XIG S;  2IX0 A;  5FJ8 H;  4RG1 A;  1TWF H;  4OWT B;  4R1J A;  4TVA B;  2Z6K C;  1VQ4 A;  1WI5 A;  1N36 Q;  3S14 H;  4K0K L;  4UPA A;  4X65 Q;  2VQF L;  1I50 H;  3S1R H;  4LF5 L;  5LMU Q;  2BH8 A;  2PNH A;  4L5T A;  4DK6 C;  1XPO A;  2WAQ G;  3CCU A;  4A3I G;  1Y14 B;  4JBW A;  4C3J H;  3KDF A;  5GRO A;  4ALP A;  3T1Y Q;  1E3P A;  1HZB A;  2K50 A;  4OX9 L;  4QJF A;  4X66 Q;  5GAD C;  1Q7Y C;  3S16 H;  1KRT A;  3PO3 G;  4DK3 C;  3RLO A;  5M5Y H;  4GNX B;  1YBY A;  2JA7 H;  4HIO A;  3K7U C;  1B70 B;  4AIM A;  5C4X H;  1XNR Q;  1VQL A;  1J6Q A;  4P72 A;  1XPR A;  1N34 L;  2UU9 L;  4DR1 Q;  1PHJ A;  1IBL L;  2BA0 A;  4A3J H;  1S72 A;  4DUY L;  1ASZ A;  1CUK A;  4NB3 A;  5FJ8 G;  3FHW A;  3CPF A;  4P73 A;  1JB7 A;  2YU9 H;  2NZO A;  1HNX L;  4R4I A;  4DV5 L;  4GKJ Q;  3HOX G;  4X62 Q;  4JI5 L;  5M5X H;  3RN2 A;  3D0F A;  2OTJ A;  2R93 G;  4APV A;  2E2I H;  3JAM i;  4A3M H;  2AKW B;  1A62 A;  2AWO A;  5BR8 L;  3CCE A;  1M90 C;  1X65 A;  3PIP A;  1PH4 A;  4EQ5 A;  1YHA A;  2Q2I A;  4GLX A;  1VQ5 A;  4IJH A;  4KLK A;  1YI2 A;  2E2J H;  2VQF Q;  4LF4 Q;  2VS1 A;  1X6O A;  1YIT A;  4LF5 Q;  1WCM G;  3HFZ B;  1FJG Q;  3TEH B;  4OWW B;  1BBW A;  4HJ8 A;  2D0O A;  3CCL A;  3BJU A;  4KHP L;  1IBM Q;  5GAG C;  2RHS B;  5JJK A;  2C35 B;  3JAM c;  4A3D H;  4J15 A;  3L0O A;  1KXL A;  4A3J G;  1VQA A;  4A3E H;  1VQI A;  3CXC A;  4A3K H;  2KEN A;  2L15 A;  4DUZ L;  4DV2 L;  3CPW A;  3RNU A;  3SGI A;  1G29 1;  2ZM6 L;  2YTY A;  3EIV A;  1PH2 A;  3STB D;  1N34 Q;  3MXN B;  1E1O A;  1IBL Q;  1EOV A;  2XGT A;  3PUX A;  1XNQ Q;  3TRZ A;  4OON A;  4HID A;  4GOP A;  1Y1W G;  1I94 L;  3GTL H;  1HNX Q;  3T1H L;  5IE8 A;  3W5O A;  3S1N H;  1QZH A;  3A74 A;  2H5X A;  3UDF A;  3G71 A;  3ULL A;  3GTJ H;  4GN3 B;  2Q2T A;  5IT9 c;  2I0Q A;  3GTK H;  2BA1 A;  3PIO A;  2NVQ H;  3A5Z B;  2N49 A;  4UP9 A;  4A3D G;  1S3O A;  3STB C;  4DV3 Q;  1CKO A;  1YVC A;  4O2D A;  4DR4 Q;  1IBK Q;  2LXK A;  1A0I A;  4A3K G;  1D7Q A;  4NXM Q;  3TS2 A;  4JYA L;  1SMX A;  4TQU S;  4EX5 A;  3I4N G;  2CWA A;  3GD7 A;  2GN5 A;  2MQH A;  3S1M H;  3M85 A;  3ERS X;  1UEB A;  2F3I A;  4YY3 Q;  2E5L L;  4DUZ Q;  1S40 A;  3HOV G;  4POF A;  1FL0 A;  2E8G A;  2ZJQ A;  3E0E A;  2PI2 A;  3EBE A;  3BZK A;  3L2P A;  2QEX A;  4DV1 L;  3J7Z C;  4DR2 Q;  1EIY B;  2ZM6 Q;  1BVS A;  1CKN B;  5M3M H;  1K8G A;  4A3C G;  1V9P A;  4B3T L;  2R92 G;  3HOY H;  5IP7 G;  4DV0 Q;  2VZA A;  1PYB A;  4A3F G;  3PUZ A;  1N33 Q;  3GTM H;  2IX1 A;  2HQL A;  2WB1 G;  3T1H Q;  3RZD H;  1Q8K A;  1YHB A;  4OO1 I;  4DNI A;  1JJ2 A;  5GQO A;  4DV7 Q;  4JI4 L;  3M4P A;  1PH7 A;  1MJE A;  1VQD A;  3I4O A;  3NEM A;  3S2H H;  1WFQ A;  2LSS A;  3HKS A;  5GAH C;  1FGU A;  4GN4 B;  5FLM G;  4HJA A;  5DLQ E;  3HKZ G;  1VQF A;  4DR3 L;  1PH5 A;  2NVX H;  1RL2 A;  4NXN Q;  4JI1 Q;  4P74 A;  4MZ9 A;  4B3S Q;  4JYA Q;  5AJ3 L;  4BY1 G;  5H1S E;  4BXX G;  2B63 G;  1SN8 A;  5M3M G;  3KLW A;  1XMQ L;  1RIP A;  2WB1 E;  3WWV A;  4JI0 L;  3PO2 H;  5K36 G;  3CC4 A;  1NTG A;  2MFI A;  1AE3 A;  1SRO A;  1WYD A;  2E5L Q;  4IPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...