2JQOA

Nmr solution structure of bacillus subtilis yoba 21-120: northeast structural genomics consortium target sr547
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELLLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
molecule keywords Hypothetical protein yobA
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jqoA01
1Y1WH 4A3LG 1VQGA 1YHQA 1WOCA 5C44H 3PO3G 2OTLA 2IT1A 3D31A 3OTOQ 4LF7L 3U4ZA 4HJ8A 1PHJA 3HOZH 1VQDA 1YNXA 2KHIA 1X55A 1WYDA 1VQ9A 1Q12A 1W2BA 2NVQH 4KHPL 3BU2A 1E22A 4DAMA 3RZDH 4JI6L 1VQIA 3KLWA 1Q8KA 3RLFA 4OO1I 1G6PA 1QUQA 3F2CA 1T9HA 4HJ5A 4DR2Q 2MFIA 1IYJB 1HZ9A 5DLQE 4L5SA 3PO3H 4X6AH 4YY3Q 3RN5A 4A3GH 3S17H 1CKNB 1HZCA 1LUZA 2Y0SG 3CAMA 5ELOA 4NXML 1IL2A 1PYSB 3HOVG 5GAEC 5C4XH 4DV6L 4DV5L 1Q82C 4JI4Q 3MXNB 4A3FG 1O7IA 4IFDG 2GN5A 1YHBA 3K80C 4GKJL 3KDFA 2EIFA 4MZ9A 4A3EG 2B3GA 4LUOA 1SR3A 2HIVA 1BVSA 1G291 5IYCH 3HOXH 3CPWA 1KC8C 1PA6A 1VQ5A 1XNRL 3FKIH 4A3JG 3GD7A 1YZ6A 4LF8L 4OX9Q 3RLNA 4DV4Q 2NVYH 1VQNA 4AYBE 3A5UA 3CCRA 2ID0A 1X6OA 4X66L 5C0XI 3K8AA 1SRUA 5LMNW 2AMCB 5C3EH 4APVA 2IX1A 3ER0A 1MKHA 1KIXA 4DR3L 3CC7A 4IPDA 4GS3A 2YU9H 4DV1Q 2YYZA 4DV2Q 4JBKA 1ASZA 2HHHL 4B3TQ 1CKOA 4MNOA 4GLVB 5EAYA 2A8VA 1Y1WG 3HOYG 4A3LH 4O2DA 1V43A 4JI2Q 1OXSC 4A3BH 1HR0W 5AJ3Q 4DV7L 1X3FA 3AYHB 2F3IA 1VQJA 1K0RA 1TWAH 2E5LQ 3CC2A 1XJVA 2NN6G 3M4PA 1FGUA 2K14A 1VQEA 1Q86C 4A3KH 4IFDJ 2CKZB 3W1BA 3G6EA 4B3SQ 1VQOA 1VQ7A 1KD1C 1XNQL 4GNXA 4P71A 4BBRG 3ULPA 5GAGC 4A3MG 2BH2A 5M3MH 4K0KL 3HOYH 4DR4Q 2RF4A 2AWOA 2PNHA 4JI6Q 4NPSA 4UPAA 1VQ6A 1UEBA 1VQCA 1JJ2A 4R4TA 5IT9c 3TEHB 2K4KA 4JI5Q 4LFCL 4POFA 4DK6C 4A3IG 2UUAL 2OTJA 1FJGL 4GOPC 3CP0A 1BBUA 1Y1VH 4HIKA 4YY3L 2R7ZH 4BY7G 4C3HH 4DV3L 2ATWA 1C0AA 1GD7A 1I94L 1LM0A 4DR7Q 3PUXA 2JJQA 2JA8G 3KFUA 1HNWQ 4PZ8A 2NVTH 2WB1E 3UE0A 4DR1Q 2JA5G 3HOVH 5IYDH 3HOUH 3HOXG 4X64Q 3H3VH 4RG1A 4DUZL 1X3GA 2VL6A 1Y1VG 2KCMA 4X62L 2OQ0A 3MEFA 1YVCA 3CW2C 3E9IA 3U50C 3F2DA 4HJ7A 2UUCQ 3S24A 4C3JH 1J5EL 2JA7H 4C2MH 2RCNA 3F1ZA 3PUZA 1PH4A 4A3CH 4A75A 2BA0A 3TQYA 4KHPQ 1MJEA 1I50H 2BH8A 2UUBL 1SE8A 3CCVA 4DR3Q 1PH5A 2E2IH 5JJLA 4LUZA 2WFWA 2E8GA 2DUDA 4IOCA 2D0PA 1MIUA 3HOZG 2BA1A 4YCWA 2N49A 4HJ9A 4UY8C 2JEBI 4HJAA 1LTLA 1KL9A 1YJWA 1QVGA 3K7AH 2JA5H 3GTKH 4OXPA 1K83H 3G71A 4L5RC 5K36G 4TQUS 2VY3A 3J81c 5IE8A 2WP8J 3HKZE 4JI1L 2D62A 2IHEA 2A1AA 2I5MX 2KENA 4IPGA 2K50A 2MNAA 3G4SA 1YHAA 1HNXL 3ICEA 2UXCQ 2LXKA 3GTGH 4BA1I 4GNXC 4PZ6A 1QVCA 3IRBA 2R7FA 1FL0A 5IP7G 3AFQA 1NMGA 3RNUA 1Q81C 3UDGA 4LF4Q 1N33Q 1XPUA 1BKBA 3KDFB 3GO5A 4GNXB 5GQOA 5M3MG 4JBJA 4WJ4A 4JI5L 4LFCQ 3J7A5 2UXBL 4DV0Q 1N36L 2DGYA 4JBWA 1PH2A 3H3VI 2HIXA 4JG2A 1U0LA 4L5TA 3RZOH 4JI0L 2F4VQ 3A0JA 3A74A 1Q1EA 4QL5A 1LYLA 4XIGS 5IYCG 4DV3Q 1I94Q 4JBMA 4DR7L 1SFOH 4AQYL 4EX5A 1WI5A 3CCSA 3PF5A 3NELA 1NY4A 1PVOA 2B63H 3UDFA 4R4QA 1VS0A 3I7FA 4X64L 1VQFA 1D8LA 4DUZQ 1N9WA 4A93H 2LSSA 3KF6A 1L0WA 2UUCL 5IP9G 4JV5L 4UP7A 2NZHA 3S1QH 3W5OA 1J5EQ 2R93H 1XPRA 2Q2IA 1SN8A 1XMOL 4AH6A 1CKMA 1J6QA 4GKKL 1A8VA 1E1OA 3I2ZA 4DK3C 1GM5A 2KBNA 4EQ5A 3OTOL 4LF7Q 2OQKA 3GTQH 4RMFA 3CCQA 4IJHA 1A0IA 4QGUA 5IYBG 1SROA 3FHWA 3CMAA 2Z6KC 1K73C 3FKIG 4DAYB 4A3JH 4A3KG 4IO9A 1EQQA 4BY1H 3AEVA 3UDXA 1W3SA 4P73A 4B3RL 1E1TA 5HGQA 3PUWA 1P8LA 3DLLA 1VQHA 1JB7A 2UU9L 3S14H 1EYGA 5BR8Q 3J80i 2Z0SA 4OWWB 3S1NH 2UXDQ 4R4OA 3J7ZC 2HT1A 5IWAL 2ZM6L 2VUMH 5FJ8G 2WAQE 4JI1Q 5IP9H 1IBMQ 3K0XA 5LMUL 2JA8H 4OWTB 3I4NG 4A3BG 1X3EA 3PV0A 1PH9A 3CCLA 4IFDI 3UE1A 4BY1G 4KI0A 1C7YA 4JI4L 3JAMc 4FDBA 1AH9A 3CCUA 4A76A 1VQPA 3PSIA 4A3IH 1VQ8A 5M5XH 3CMEA 4LFAL 4BBSG 3G48A 2N3SA 3NEMA 4O0AA 4KHZA 1Z47A 3KJOA 1VCIA 1G51A 3EN2A 1TWCH 2XTIA 2R92H 3HOWH 1HNZL 4DR6Q 3PIOA 2D0OA 2UXBQ 1Q7YC 4LF8Q 4DPGA 3RN2A 4DV4L 4LF9Q 2ZTEA 3T1HL 1N34L 4QQBX 4IJLA 1CUKA 2AWNA 1RL2A 2ZJQA 1IBKL 4BA2I 2JA6G 1XMQQ 4A3CG 1V9PA 1L1OA 3TRZA 2ALYB 1CSPA 2F52A 3OW2A 2IX0A 2MQHA 1JT8A 2EQSA 4P72A 3B6YA 4QY7A 4GOPA 1K8GA 4JI3L 2R7DA 2R93G 5GADC 2VW9A 4B3TL 3M3YH 3KF6B 3HKSA 3W1GA 3U58A 3LGJA 1KXLA 4X65L 2E2JH 3F2BA 2C35B 2Q2HA 5J3BA 2E2HH 3S2DH 1ASYA 1AE3A 1XMOQ 3KF8B 5GROA 2I0QA 2R6GA 2QEXA 1X54A 2PMZE 1HZAA 4ME3A 2JA6H 4YWKA 2R92G 2LXJA 3CF5A 4BY7H 1UE5A 4B3SL 4UP8A 2QA4A 1UWVA 1KHIA 5M3FG 1QZGA 3S2HH 1PH3A 2VZAA 3GTPH 2RHSB 4TVAB 3TREA 3J80c 4AIMA 4Y7NH 4HIDA 1PV4A 2UU9Q 3AQQA 4LFBQ 5BR8L 2UXDL 5IP7H 1X9NA 1BBWA 2VQEQ 2UUAQ 5JJKA 2ZM6Q 2V1CC 1KAWA 4GN5A 5JEAG 2VQFQ 1IBML 4WJ3M 5C4XG 2N78A 5LMUQ 3L7ZC 2JE6I 4JI7Q 3I4NH 3D0FA 1V1QA 1K9MC 1HNWL 3PGZA 5LMNQ 1WJJA 2QGQA 2CQOA 4XTCS 2HQLA 5IY0A 4A3FH 1PH8A 3M85A 2VS1A 5C0XJ 1EQRA 1E3PA 4DR1L 1SLJA 2YTXA 4LF6Q 2ASBA 1CSQA 2PI2A 1EUJA 2IY5B 3GTLH 3F8TA 2Y0SE 4X62Q 1HNZQ 1S3OA 3I56A 1N32L 1B70B 4DR6L 4YWLA 2EXDA 1YI2A 2L15A 4J15A 3ZJYC 5M3FH 1NJIC 3E9HA 1HJPA 3ERSX 1MJCA 4JYAL 2VNUD 1N34Q 4DR2L 4JI8Q 5FLMH 3H15A 1JJCB 1L1OB 3EIVA 1IBKQ 2K52A 1U5KA 4A93G 3HOUG 2JEAI 1VQKA 1S40A 1UE6A 1PH1A 3CCMA 2K5VA 3JC66 1GKHA 1B8AA 1L1OC 1E24A 1WFQA 1QVFA 3S15H 3PUYA 1Z9FA 1PYBA 5C0XG 4B3ML 4C3IH 4AYBG 2ZTCA 5FLXc 3JAMi 1TWHH 2GVAA 4GOPB 4X65Q 1PH7A 1HR0L 2PQAA 3OYYA 5FJ8H 2Q2UA 1XNRQ 3RR5A 4YHHL 3J81j 3I4MG 4A3DH 1HH2P 1TWGH 2PI2E 2Q2TA 4R1JA 4IPHA 4JOIC 1CKNA 1Q46A 1YEZA 4QIWE 4YWMA 4HIOA 3S1RH 4PZ7A 4JOIA 3GTOH 1EIFA 4X66Q 4JC0A 4BXXH 4BBRH 1VQLA 3M7NA 2I5LX 5JEAJ 1EIYB 1P16A 4KLKA 1R9TH 4POGA 1JE5A 2NN6I 3HKZG 4DR5Q 2HHHQ 4LUVA 1I5FA 3HOWG 4GN3B 5JJIA 3S16H 2H5XA 4LFBL 3WWVA 4BBSH 1Y14B 4DV7Q 4A3MH 1XPOA 2AKWB 3K81C 2VQFL 3NBHB 3SGIA 2NVXH 2IHFA 1YITA 1NBWA 4BXXG 2E5LL 4PG3A 4Y52H 3T1YQ 2XGTA 3A5ZB 4JI7L 1YBYA 1YJNA 3HFZB 2ZTDA 5LMNL 2VUMG 2ZJRA 3H0GH 2N8NA 2JA9A 3TS0A 4QJFA 1EOVA 3I4OA 3UDIA 5C4JH 1YIJA 4P75A 1XNQQ 4YCUA 5C3EG 4LF6L 4K0KQ 1DGSA 3ULJA 4DR4L 2RHQB 3M9BA 5GAHC 4NXNQ 1PFSA 1IBLQ 2CWAA 3RLOA 4LF5L 2K5NA 3S1MH 1PH6A 1TWFH 1EFWA 2Z6KA 1SMXA 4JYAQ 3EBEA 4JI8L 1FJGQ 3GTMH 2WB1G 3GTJH 4GKKQ 3L2PA 1N8RC 4YCVA 4H02A 1VQ4A 1M1KC 4GLAC 5FLMG 4A3EH 2ZJPA 3CC4A 2OWOA 4DKAC 5H1SE 4LNQA 2YV5A 3K7UC 4L5QA 3I4MH 4GLXA 1FVIA 4A3DG 3PO2G 4B3MQ 4B3RQ 4HIMA 1C9OA 4A4IA 1IXRA 1JJGA 3AFPA 1HZBA 1HR0Q 1B7YB 1NE3A 1NMFA 3NENA 4YHHQ 4GN4B 2I5HA 1OXUA 5IWAQ 1OXTA 1GVPA 1JMCA 1UE7A 4IOAA 2CWPA 4DUYQ 1I6HH 2CCZA 4OWXB 2FXQA 1IZ6A 2R7ZG 3KJPA 3PO2H 1L2FA 2UUBQ 3M4OH 3U4VA 1H95A 1TXYA 5IYBH 2WAQG 3KOJA 5ELNA 1AE2A 2B29A 4LFAQ 3CCEA 4DR5L 1VQMA 1A63A 5C44G 5M5YH 3CD6A 3BJUA 1X65A 3PUVA 1OXVA 1I3QH 2CFMA 4P74A 4DNIA 3M4QA 1N32Q 4MTNA 2JQOA 4LF9L 2JA7G 1VQAA 2YTVA 3T1HQ 5HY6A 4R4IA 3BZKA 1WCMH 3PIPA 3T1YL 1OTCA 4R4CA 3J81i 4LWCA 4ALPA 1XMQL 5IYDG 4NXMQ 1HNXQ 2UXCL 1NTGA 2AHOB 3H0GG 4DV5Q 4DV6Q 4JI3Q 3VDYA 1N33L 4GKJQ 5E7NA 1E7ZA 4LF4L 2PQAB 4NXNL 3CXCA 1IBLL 2OCEA 2MO1A 2K5HA 3GDEA 4LF5Q 3Q8DA 2B63G 1WCMG 1KRSA 3DM3A 3TS2A 3I55A 1Q1BA 2ES2A 3E0EA 4DV0L 1S72A 1N36Q 4OX9L 1KRTA 1A62A 3STBD 2K75A 4JI0Q 2F4VL 2KCTA 1RIPA 3CCJA 2YTYA 1VQBA 4AQYQ 1D7QA 3CQZH 1M90C 4LW1A 1QZHA 4PMWA 1YJ9A 4JCVE 4DV1L 2NZOA 4DV2L 3CPFA 3PCOB 3BZCA 3PF4A 1KQSA 1OXXK 3STBC 1X56A 5M5WH 3L0OA 3ULLA 4IPCA 4OONA 4JI2L 4A3GG 4JV5Q 2MO0A 5AJ3L 2VQEL 1QUQB 1UE1A 2A19A 2KHJA 3KYHC 4OO1G 1EWIA 1XTDA 3FP9A 1K8AC 2JK8A 4DUYL 1GO3E 4UP9A 2GVBA 4NB3A 1K3RA
chains in the Genus database with same CATH superfamily
3D6CA 4A3LG 3D31A 3OTOQ 1TWHB 4QMGA 1PHJA 1VQDA 1S5DD 3H0GB 4C1NI 3BU2A 2JP1A 3RZDH 2HUGA 1M8AA 1Q8KA 4O42A 3RLFA 4OO1I 3T53B 2JA7B 2L12A 2IJ0A 2MFIA 1HZ9A 4L5SA 5EPKA 3PO3H 2ICEC 1LUZA 3DHQA 3CAMA 4DU9A 1PYSB 5EBCA 3A55A 4DV5L 3MXNB 2Y0SB 5FO7B 1GUOA 4MZ9A 2B2YA 2HIVA 1BVSA 4XYQA 3CPWA 1VQ5A 5KRUA 3A8JE 1XNRL 1ICWA 4LK1C 4ZK9B 3LX0A 3RLNA 2G5DA 1NCVA 3A5UA 1SNDA 3CCRA 2ID0A 5C0XI 1CTMA 2LMCB 2O2LD 3ER0A 1STYA 3S15B 4G7OC 3F2UA 2HHHL 2M2LA 5CMDA 4MNOA 4GLVB 2P5ZX 1IKMA 4MIUA 3AYHB 5C6AA 2F3IA 2E5LQ 3CC2A 2PZUA 5I9OA 4FO2A 4HCSA 2CKZB 3G6EA 1VQ7A 1KD1C 5K36H 5K5PA 2SDFA 3ULPA 5M3MH 1NUCA 1U9RA 4NPSA 1K3BC 2KEEA 2B2TC 5C5LA 5C3WA 4C3JG 4JI5Q 4LFCL 4POFA 1SJED 4DK6C 4A3IG 2UUAL 3MTSA 4GOPC 1S5FD 2R7ZH 4BY7G 4LJZC 1GD7A 1NR2A 2F0NA 3IFDA 2JJQA 2WB1E 3UE0A 2RBMA 3HOUH 4X64Q 4BY7B 3RD4A 2VL6A 4X3SA 3S2HB 1YVCA 3CW2C 4B9WA 1WD0A 4C3JH 4C2MH 1ML0D 2K32A 3MXPA 4IUQA 2EJGC 2KUMA 1HHVA 2A6ED 2UUBL 1I50H 2BH8A 2LS01 1SE8A 3CCVA 1H9KA 4DR3Q 1FR3A 5JJLA 2DUDA 3SEBA 2AUKA 5ELEA 1IYUA 1LTLA 1YJWA 3A8IE 4L63B 4ZQ3A 4OXPA 3G71A 5K36G 1SNCA 5I6WA 3CRKC 3J81c 5IE8A 4JI1L 5M3FB 2WKDA 1YHAA 2N88A 3BG3A 4BA1I 2Z1CA 3SXHA 5JEAH 4PZ6A 1QVCA 4GNXC 1SE2A 1N33Q 4JVZA 3GV6A 2KEDA 1BCPF 4JBJA 1X3PA 4JI5L 4LFCQ 2A74C 2UXBL 4DV0Q 1S5ED 1EY7A 4JBWA 2E75C 1SNMA 4L5TA 1JOKA 2F4VQ 4JBMA 3S2DB 5JJZA 4AQYL 4EX5A 1BF4A 1WI5A 3CCSA 1NY4A 4RH6A 1L0XB 3I7FA 2FJ2A 3HKZB 4X64L 3T16A 2LSSA 2M9VA 1L0WA 1S5CD 2NZHA 3W5OA 2AQ2B 1J5EQ 4DAVA 1EQVA 1XPRA 3GTJB 1E1OA 4CJ2C 4EQ5A 1JICA 1I6VC 1DZ1A 2F4IA 5I2YA 4IJHA 4DNTB 5IYBG 5G3LF 1I4QA 4WRDA 3FHWA 3CMAA 4A3KG 4RGTA 4IO9A 4KHPQ 1M4VA 4L8JA 2D5DA 5HGQA 1BUVT 1P8LA 4YIJA 1JB7A 5CYUA 3N52A 5BR8Q 3J80i 4K5VA 2UXDQ 5FO9B 4R4OA 1ILPA 4HN7A 1LTID 5DNFA 1E2WA 5C3EB 5KNDA 1IBMQ 4JI1Q 3K0XA 5LMUL 1X3EA 1PH9A 3FVQA 5COYA 4BY1G 4IQZA 3CCUA 3DMUA 4RHSA 3CMEA 3G48A 2N3SA 3T51B 3EN2A 3C1EA 1HNZL 2E74C 3HEJA 3D3RA 3I73A 4OHJA 2UXBQ 1HA6A 4QQBX 3S1MB 2WIIB 3K7AB 4CHTB 3EQLC 1XMQQ 4A3CG 1L1OA 1CSPA 4UDUC 3OPOA 4V0BA 3B6YA 1K8GA 2R93G 1D5ZC 3PMFA 3KF6B 4HSVA 3LGJA 1EFID 1AEXA 2Q2HA 2E2HH 2R6GA 2QEXA 1HZAA 1PFMA 2B2UA 4B3SL 4A93B 4DAYA 4UP8A 2QA4A 5M3FG 3S2HH 4H0LC 2VZAA 2K33A 2RHSB 4TVAB 3TREA 5DM73 2BDNA 1LACA 3A7AB 4CBVA 5ISRA 5BR8L 2UXDL 3I8ZA 1MHWC 1VF5C 5D14A 3E6ZX 5LMUQ 4K6DA 4DXFA 3I4NH 1EEFD 2NN6H 3D0FA 1STHA 1BXTA 1HNWL 1PH8A 4OGQC 2VS1A 1R4PB 5C0XJ 4DR1L 1SLJA 4PMCA 3K59A 2B2UC 2YTXA 2XSCA 1K28A 4X62Q 3I56A 1D2BA 4IFDG 5M3FH 3OSOA 1IW7D 3H91A 1MJCA 3E0JA 4JI8Q 5FLMH 1CK1A 1U5KA 5JVG3 4IN3A 1JC7A 1UE6A 1EZ6A 2MP1A 4IUUA 3JC66 1PH1A 1GKHA 2R92B 1RF2D 4XQNA 1LT3D 1V8QA 2JN4A 1NNXA 1Z9FA 2DNCA 1SYGA 3MEHA 1PH7A 1HR0L 3SK8A 2PQAA 3OYYA 5FJ8H 5KGUA 4CKEA 3DWAA 1TWGH 2PI2E 1ILQA 3GTOB 1SFOB 4JOIC 4QIWE 4HIOA 4FF4A 1ZYRC 1QG7A 3FPPA 4H7BA 4DK0A 4QIWB 4O1NA 4KLKA 1V1PB 1JE5A 1GUGA 2NN6I 3HKZG 3I70A 5IOCA 1IYVA 1TS2A 2O4XA 1G2TA 4UHVA 3MA2B 4A3MH 3SGIA 2IPKD 2IHFA 3KLRA 1YITA 2F0IA 2E5LL 4BXXG 5KYIA 3EJIA 4JI7L 3QWNA 2B2VA 1YJNA 1HUNA 1FNVA 3ERQA 1EOVA 3UDIA 5C4JH 1YIJA 4P75A 3I72A 4LAAA 3RZDB 4C1NK 1KDBA 3TMEA 1LTTD 1PFSA 1IBLQ 2NUCA 4LF5L 3S1MH 1TWFH 4AYBB 2BE5C 3EBEA 4JI8L 2QEJC 3GTMH 1EOTA 2WB1G 3TN2A 4GKKQ 1JORA 4H44C 1VQ4A 1M1KC 1CZGA 4GLAC 1HXYD 2ZJPA 1VMPA 4DKAC 5A35A 3K7UC 4L5QA 3PO2G 1IHZA 4B3RQ 4HIMA 4A4IA 2DY7A 5LHY1 3GTPB 2X6GA 2EYLA 3T56B 1HZBA 1HR0Q 1B3AA 1B7YB 1NE3A 4G4KA 3QO2A 1AN8A 5C0XH 1E2VA 4GN4B 2I5HA 5IWAQ 1OXTA 4K5XA 4DUYQ 1I6HH 4OWXB 1EY9A 3AMUA 3L9AX 3OWFA 4PV1C 3TZDA 1H95A 4LFAQ 4DR5L 3CCEA 1AE2A 1VQMA 1B50A 3VYRA 1OXVA 4P74A 2EYOA 4ZKCB 5DAUA 4MTNA 2JQOA 3I90A 3T1HQ 4FF1A 1RDPD 4R4IA 3BZKA 3HS0C 3PIPA 2KCCA 2NWGA 5IYDG 4NXMQ 2EJFC 4XT3B 1Y8OB 3KBGA 1HNXQ 2QKIC 3TBIB 2UXCL 2AHOB 4DV6Q 4KJNA 5JAVA 5J22A 4JI3Q 1I3QB 3VYUA 3BVZA 2HDLA 4DK1A 2K5HA 4LF5Q 2CH4A 3DM3A 2K6AA 1I4XA 3I55A 3TSSA 2V4DA 2F4VL 1LLRD 4ODGA 2YTYA 4AQYQ 4KJOA 4LW1A 4DV1L 4DV2L 3CPFA 4C3IB 2FHTA 4OONA 1EQTA 1QJOA 1ZXTA 2KHJA 3S1RB 3P7JA 3FDTA 3C2PA 3J7AF 1K83B 3FP9A 1TY2A 1GO3E 1MIUA 1K3RA 1Y1WH 1YHQA 1WOCA 1I4RA 3VA5A 3U4ZA 2K28A 4FXDA 2KHIA 3P75A 1Q12A 1VQ9A 1E22A 1F9PA 1F2LA 4DNRB 4JI6L 1O7LA 1QILA 4R8IA 3J80L 4X3UA 1QUQA 4K2LA 5A2QL 3UI2A 4HJ5A 1VF7A 1IYJB 1CT1D 4X6AH 1E0BA 4YY3Q 3OIQA 2Y0SG 4NXML 1PDQA 2XWJB 3D6WA 5GAEC 4DV6L 1WTOA 1FYCA 4IUPA 1EZ8A 2C9OA 2YU9B 1SYCA 5JPNC 3SK6A 5C4XB 1TY0A 3A54A 5CV4A 4LF8L 1O7YA 2EY6A 1VQNA 4AYBE 4X66L 1SRUA 5C3EH 5IT9E 1GUWA 1XWEA 2YYZA 1BNZA 3AB9A 3MAQA 5EAYA 4JI2Q 1V43A 1C48A 1HR0W 3QG1A 4M1UB 5AJ3Q 5C3XA 2XWBB 1CFMA 1VQJA 2CH4W 1TWAH 2RKSA 1G91A 1XJVA 2NN6G 2FINB 2WACA 1FGUA 1ZEQX 1VQEA 4A3KH 4IFDJ 3W1BA 1VQOA 3K58A 2B2TA 1XNQL 1K8MA 2EYPA 4GNXA 3VA7A 4ID6A 4DR4Q 4JI6Q 2AQ3B 4UPAA 5ELDA 3GQBA 3TEHB 2PPBC 1A2TA 1JQYD 2OTJA 1FJGL 1BBUA 4HIKA 5E1FA 4YY3L 4C3HH 4NMZA 4DV3L 2ATWA 1C0AA 4DR7Q 2X6LA 3HG9A 2BE5D 3TP6A 1WTRA 4X3KA 1ESRA 2NVTH 2JA5G 3I3CA 3HOVH 5IYDH 2CW0C 1ENCA 2PW5A 1X3GA 4DUZL 1Y1VG 4X62L 3F2DA 2OQ0A 3MEFA 5A2QE 3E9IA 3K5MA 3UDGA 1CA6A 2UUCQ 3GTMB 2X69A 1I4HA 4FXKC 5F2DA 1HPCA 3PUZA 4ILWA 4KTAA 1JE4A 4IOCA 1EL0A 1SYBA 2N49A 4HJAA 5J1ZA 1TR5A 3K7AH 5C4JB 2F0EA 1PRTD 3ND9A 2E76C 2MHVA 4TQUS 4RCOA 4DGZA 1QE6A 3VR4A 2WP8J 3HKZE 2D62A 4IPGA 4EQNA 1H9JA 3G4SA 3MFYA 1GXDC 5M5YB 3GTGH 1STNA 1Q81C 1NMGA 1XPUA 3K5NA 2NBFA 1LO5D 1B53A 3GO5A 1D5MC 4KV6A 4TRDA 3BZDB 2F1MA 4KKTA 4N9TA 1BR9A 5EQ0A 3H3VI 3KBXA 2Z4HA 4JI0L 4FXGC 3A0JA 4CDDC 4QL5A 1LYLA 4DFAA 4XQJA 5IYCG 4DV3Q 1TS3A 1I94Q 3NBIA 2BOSA 5D3IB 5EKIA 3HGBA 1SFOH 2L1BA 5T1GA 1PVOA 4R4QA 1VS0A 4KHVA 1U4LA 1WTWA 2B2WC 1Z7TA 1N9WA 3J7AV 1S4ZA 4UP7A 1AZQA 3S17B 1J8IA 1XX8A 2Q2IA 1SN8A 1CKMA 1D5XC 1A8VA 4RKLA 4DK3C 2QDBA 3IAYA 3OTOL 2OQKA 5D3DA 3R2TA 3PIO3 1A0IA 2B63B 1SROA 1K73C 2Z6KC 2K04A 3FKIG 3WOFA 4A3JH 3AEVA 4A3BB 2RDGA 4B3RL 4ZAIA 3PUWA 1CQFA 2F0MA 1F9QA 5IGFA 1EYGA 3S1NH 3J7ZC 2HT1A 1PFNA 5CR3A 5IGEA 5IWAL 3WDNA 5FJ8G 5IP9H 3FKIB 4A3BG 3TZUA 1Y1VB 1II3A 2PCFB 1GJXA 3CCLA 4IFDI 1Q8IA 5T1IA 1AH9A 4A76A 3VR5A 1VQPA 1VQ8A 4A3IH 1ONLA 1HTLD 4BBSG 4KHZA 2XTIA 3K5LA 4M8AA 1HFNA 3PIOA 2B8GA 2D0OA 4C3HB 1Q7YC 4DPGA 3RN2A 1QNUA 2ZTEA 5ELCA 1F9RA 1RTOA 1RL2A 4F7XA 1DYQA 1KLUD 1X3QA 2F0GA 1JT8A 4P72A 4RHRA 4B3TL 2PO4A 5C44B 3HKSA 3W1GA 4WORA 5D65A 1PZID 4X65L 1ASYA 5HGTA 2I0QA 5EKKA 4EQOA 2JA6H 3WOEA 4X3TA 2R92G 1JOQA 1U4RA 1UE5A 1H9SA 5BN3A 3LNNA 5CORA 1PH3A 4KKSA 3GTPH 4Y7NH 1SE4A 3M4OB 4DAPA 2UU9Q 5KEEA 1X9NA 4XQQA 1C8CA 2UUAQ 1RHPA 4KN4C 3I91A 5C4XG 1PRTF 4G7ZC 1QCBD 3P20A 1TWFB 3LWUA 1K9MC 4WJWA 3M85A 3OMGA 1E3PA 3BYTB 4BWGB 2ASBA 1CSQA 2PI2A 2R3ZA 3X3NA 2Y0SE 2EXDA 3ZJYC 4J15A 4B9XA 2CVRA 2K5QA 3ERSX 1N34Q 3KLSA 1L1OB 3EIVA 2K52A 3A7LA 2JYOA 4G7HC 4ZLTF 4QF4A 1PYBA 3G7LA 4TSSA 4AYBG 4E6IA 5FLXc 4X65Q 3I4MG 4A3DH 3M7GA 4U68A 4CJ1B 1UEAB 2Q2TA 1GUSA 1F77A 4IPHA 1EU3A 1CKNA 1IKLA 2DNEA 3S1RH 3NSWA 4JOIA 3GTOH 2GA4B 2B39A 3HOXB 4HAEA 4JC0A 4BXXH 1VQLA 3M7NA 4FYDA 3I4MB 5FO8B 1EIYB 1UNSA 1QWYA 2HQEA 4GN3B 5JJIA 4LFBL 4BBSH 1ZYRD 4DV7Q 1OO9B 2CQAA 3K81C 2VQFL 3NP8A 1PLFA 2DJGC 4PG3A 3T1YQ 2MJ8A 2RSNA 2XGTA 3A5ZB 3BDLA 1YBYA 3KLSX 4I7AA 1BOSA 4V190 3HFZB 1STAA 3ITPA 2ZJRA 3H0GH 2N8NA 3CRLC 4QJFA 3QR8A 4JW0A 5C3EG 4LF6L 3ULJA 3M9BA 1GOZA 4FNFA 2K5NA 1R4QB 1EFWA 1SMXA 1FJGQ 4DA2A 3GTJH 2OXPA 1DXMA 1LTBD 2NVYB 1Y1WB 4NKLA 1FGBD 5CBAE 3CC4A 5I2XA 3BS1A 2QF7A 4LNQA 2YV5A 4NDXA 4GLXA 3CQZB 1H9SB 4BBRB 4NP5A 2A6HC 1IXRA 4KK7A 1A3UA 3NHHA 1G6ZA 5M5XB 3OOCA 1OXUA 1GVPA 1UE7A 2CWPA 1B9MA 2CCZA 2L9HA 1A3TA 2WV6D 1L2FA 1A3VA 3M4OH 4A3DB 2BDOA 3S14B 3OWEB 5ELNA 2VB2X 1A63A 4CDFC 5C44G 4DNIA 3C46A 1I3QH 3Q23A 5G3LD 1TU2B 3W2DA 1WVLA 5IODA 1VQAA 2YTVA 1OTCA 3T1YL 4R4CA 2K1BA 4K14A 4LWCA 3V2TA 3H0GG 3IKJA 3VDYA 2EDGA 2PQAB 5JOBA 4NXNL 1KDCA 2MO1A 3GDEA 2Q8RE 3Q8DA 2KHSA 2F0FA 1CHQD 3NE5B 1AW7A 1Q1BA 3GV3A 3STBD 2K75A 3VR6A 3NUCA 4A3MB 2QW7A 2KCTA 2PZTA 2RDHA 4OELB 1TWCB 3HOWB 1D7QA 3CQZH 1JCKB 4PMWA 4JCVE 1B4OA 2NZOA 1KAAA 4RCNA 3PF4A 2ICIA 2HDMA 1NSNS 1KQSA 1O80A 1SMYD 3L0OA 3ULLA 4JV5Q 3RUZA 3PO3B 2A19A 5C4ZA 2F0SA 3EFXD 3CXCA 1WCMB 2I07B 1VQGA 4HSPA 3H09A 3PO3G 3EVQA 3DWPA 2NB0A 3HOZH 1YNXA 3RZOB 3ZYYX 1EU4A 1RJTA 1WYDA 1V1OA 4HMIA 4L6TB 4DAMA 1VQIA 2BCOA 4FF3A 3KLWA 2F0LA 1G6PA 3F2CA 1RCVD 3T4AC 4DR2Q 5DLQE 2XRQD 5IIFA 1FNWA 3AU7A 3S17H 4OEMB 5M9OA 3HOVG 3HOVB 5C4XH 2B2WA 4A3FG 3KDFA 2EIFA 2F0TA 4A3EG 2B3GA 4LUOA 1SR3A 1G291 3HOXH 1KC8C 1Q90A 1HUMA 1R9TB 4OX9Q 4DV4Q 2NVYH 5TSSA 2G9HD 1ZKOA 3K57A 3K8AA 1EIGA 2AMCB 3G6JB 2KA7A 4DR3L 1JB3A 2Z6BA 4GS3A 4RGMA 5FK9C 5CC4A 1PZJD 2XNAC 3A56A 4B3TQ 1CKOA 4Q0FA 4PNYA 4F88A 3A8KE 2A8VA 4A3LH 3TDQA 2SNMA 4O2DA 4A3JB 1CA5A 4A3BH 1EYDA 2LKVA 1JR0D 5FLXL 5CV8A 2D9UA 1K0RA 1MGSA 4HCEA 2K14A 1TS4A 4K6LA 2A69D 4QUCA 3S16B 1EIHA 4BBRG 5GAGC 1PZKD 3R8BA 4A3MG 3HOYH 4F87A 5EJWA 5L37A 1VQ6A 1VQCA 1JJ2A 4R4TA 5EPJA 1S5BD 2K4KA 2PMZB 3ONAB 3JAME 2K05A 5ELBA 3NWSA 1LM0A 3PUXA 1CZWA 2O5IC 3KFUA 1JWSD 2JSOA 2NZ1D 5DM63 1T5EA 2K7VA 4BY1B 2K01A 2KCMA 1HQRD 3U50C 4HJ7A 3S24A 1G8ZD 1J5EL 1KDAA 2RCNA 2A6HD 1QOHA 2A68D 2TSSA 3CHBD 2WKCA 2BA0A 4ZKBB 1MJEA 1PH5A 3S1QB 3T13A 2WFWA 2E8GA 2D0PA 4FVMA 2BA1A 4HJ9A 3SR1A 1KL9A 4A3FB 2ZXOA 3GTKH 1K83H 4L5RC 2H1EA 1PYWD 1UAPA 2J4XA 2VY3A 2OT2A 2EY2A 1K0SA 2F0UA 4NW2A 2A1AA 3J81L 2K50A 1F2ZA 1HNXL 2UXCQ 4ZUJA 2XRSD 3IRBA 2R7FA 5KIXA 1FL0A 5IP7G 4LF4Q 3RNUA 3KDFB 4GNXB 5M3MG 3D4RA 4WJ4A 2PYKA 2HIXA 1U0LA 1MD2D 2AQ1B 3A74A 4KY7A 1Q1EA 4XIGS 4QCLA 3QIAA 1PTOH 4GZYC 2WB1B 3PF5A 4XDXA 3NELA 5DEHA 2B63H 2SEBD 4J8QA 1VQFA 4A93H 3KF6A 3HOZB 3S1QH 2D2CC 2Z9HA 2R93H 5CV5A 1XMOL 4IUNA 3MXGA 3BYYB 1YNND 2KBNA 3ND8A 4C2MB 4LF7Q 3MVVA 3GTQH 4ABNA 1LTGD 5BN4A 3CCQA 1C4QA 3NQIA 4QGUA 3M4YA 3EROA 2R93B 1QB5D 1TT2A 1JOOA 4DAYB 1EQQA 4BY1H 4K8IA 1W3SA 1E1TA 3HP3A 3BDCA 2Z0SA 1BBXC 2M00A 1LT6D 2VUMH 4ZUIA 4P2CB 2JA8H 4OWTB 1SYFA 1C7YA 4KI0A 4JI4L 4FDBA 2L4NA 3PSIA 3K5OA 1KLGD 3NEMA 5IGGA 2WAQB 1V1PA 1VCIA 4IUTA 1U4MA 2R92H 1BQQT 1A2UA 2JA6B 1SEBD 4DR6Q 4LF8Q 2IX3A 2E2DC 5E4XA 4RFBA 4BA2I 2JA6G 5E4WC 1V9PA 2ALYB 5NUCA 2F52A 3QJYA 3OW2A 2EQSA 4QY7A 3J7YW 1ENAA 5IGBA 3GTQB 1KXLA 2E2JH 4I65A 5J3BA 1AE3A 3I4NB 1XMOQ 2J7ZA 5GROA 1X54A 2PMZE 3D4WA 4YWKA 1SSOA 3W3AA 3CF5A 3FEWX 5EGTA 1ENFA 1CI3M 1B44D 1PRTB 2N55A 1QZGA 4IFDH 3J80c 2XN9C 4AIMA 4HIDA 4MTKA 4Q5VA 1AP0A 3OHXC 2F3WA 2A69C 5IP7H 2FMCA 1BBWA 2I46A 5JJKA 2V1CC 1KAWA 5JEAG 2F03A 1IBML 2B2VC 4WJ3M 2N78A 3L7ZC 1U4PA 4JI7Q 1FD7D 4QB4A 1FNUA 2QGQA 2CQOA 4XTCS 5IY0A 4ZYSA 1EQRA 1A15A 4CKCA 1EUJA 2HCCA 1N32L 4MN3A 1HNZQ 2DJFC 1YI2A 4DR6L 1NJIC 3LWEA 4BS9A 3E9HA 2WINB 4G57A 4JYAL 1F2MA 2VNUD 4DR2L 1SYEA 3Q0AA 2PNRC 3HOUG 1VQKA 1S40A 3CU7A 3CCMA 2K5VA 1E24A 4FP5D 4B3ML 3JAMi 1TWHH 1STBA 2Q2UA 1XNRQ 3RR5A 1HH2P 3E5SA 3O13A 2JA8B 1E2ZA 1EIFA 4KMUC 1PRTC 3VYSA 4BBRH 2I5LX 5JEAJ 4POGA 3GTGB 1R9TH 2HHHQ 4DXGA 4DR5Q 3X3MA 4LUVA 1I5FA 2LY7A 1KNEA 2VXWA 4RWSC 3WWVA 1Y14B 2GVBA 2RQXA 2AKWB 2XVSA 1Y69U 3NBHB 2NVXH 3J81E 1TQOA 2L11A 4Y52H 2E2JB 1MI2A 1DM0B 2ZTDA 2VUMG 2F0OA 2JA9A 3TS0A 3I4OA 2JA5B 1J9OA 4RAUC 4RGOS 1DGSA 2NYZD 2CWAA 3VYTA 1GUNA 4JYAQ 1H9MA 1Y8NB 2G9DA 1N8RC 4YCVA 4H02A 1W6KA 4R9WA 4A3EH 4LMQD 5CV7A 2OWOA 3VR3A 1CM9A 3I4MH 4A3DG 1YNNC 4B3MQ 1F2YA 1JJGA 4KKUA 1HA5A 1NMFA 4CDCC 4KY5A 4IOAA 3U9OA 1Q3LA 1IZ6A 3DUZA 3PO2H 2UUBQ 1F9SA 3K6OA 4UAIA 3U4VA 5IYBH 2WAQG 2B29A 5JVH3 5M5YH 2FMMA 3CD6A 3PUVA 3C3LA 2JA7G 4LF9L 5HY6A 4OIKA 3J81i 4ALPA 3NBHA 4C3JB 5FLXE 1B3QA 3V05A 2EYJA 1D6EC 1N33L 4LF4L 2F0WA 4MHEA 3D8GA 2E2IB 1IBLL 2OCEA 2B63G 1WCMG 1NR4A 3TS2A 3H3VC 1DCZA 3E0EA 5EBDA 4DV0L 1S72A 1KRTA 1RIPA 3S1NB 3CCJA 2EJMA 4EQPA 1DJRD 5EKLA 1YJ9A 3P1HA 3PCOB 3BZCA 3URYA 4CDEC 1X56A 4A3GG 4JI2L 2MO0A 4B08A 5AJ3L 1QUQB 1UE1A 2VQEL 2EYHA 5KYLA 4J1MA 1EWIA 1XTDA 2JK8A 4IUVA 4DUYL 4UP9A 3GTKB 3NTHA 1Z6HA 4XYOA 2RA4A 5C44H 2OTLA 4K8JA 2TMPA 2IT1A 4LF7L 2F3VA 1XXGA 4F8MA 3M3YB 3C1FA 4HJ8A 2E2HB 1RODA 1X55A 1SJHD 2NVQH 1W2BA 4KHPL 4ZRZA 1MSHA 4ZCKA 2EOTA 1WTQA 1WTPA 1T9HA 1TWAB 1I50B 1BCPD 2IL8A 3RN5A 1EY8A 4A3GH 1CKNB 1HZCA 5C4HA 5ELOA 2L0CA 1I4PA 3TP8A 1IL2A 1Q82C 4JI4Q 2PQEA 1X32A 2HD3A 1O7IA 2GN5A 1YHBA 3K80C 2RVLA 5IYCH 1EY0A 1WD1A 1PA6A 2NTSA 3FKIH 4A3JG 5FKAC 3GD7A 3R2IA 4XT1B 1YZ6A 2Z4IA 3OW7A 1L0YB 1X6OA 3NPPA 5HURA 4ME5A 1SNOA 4ULLA 2VUMB 3Q6SA 4APVA 2IX1A 3HOYB 1MKHA 1KIXA 3CC7A 4IPDA 4HMJA 4DV1Q 4DV2Q 1JWMD 2YU9H 1ASZA 4JBKA 1EY5A 4RA8A 3K0YA 1O7ZA 4Z9CB 3HOYG 1Y1WG 1LTAD 2KVMA 1OXSC 4DV7L 1X3FA 3TP7A 1DOMA 1BDOA 1GHJA 3M4PA 2NVXB 1K8OA 1Q86C 4KY6A 2F0KA 1LTSD 1PTOF 4B3SQ 5J39A 4H13C 2NVQB 2NTTA 1PMRA 4P71A 2BH2A 5CV6A 4K0KL 3MC0B 2FFKB 2RF4A 1DONA 2AWOA 2PNHA 1KTKA 1STEA 1UEBA 5IT9c 3SDZA 1GHKA 1PTOB 3CP0A 1Y1VH 4U673 2MUYA 2XIWA 1BCPB 3KF8A 4C3IG 1I94L 2JA8G 1HNWQ 4PZ8A 2PZWA 3HOUB 1SDFA 1BO0A 4DF7A 4DR1Q 1EYAA 1T5XD 1CQVA 2MGSA 3HOXG 3H3VH 1DOKA 1GUTA 4RG1A 3TP5A 4HTHA 1N32Q 3MZ5A 1G2SA 5I4DA 2JA7H 2R7ZB 2RDFA 3F1ZA 3OMCA 1PH4A 4A3CH 3BVMA 3MFGA 4A75A 1LTRD 3TQYA 3S9WA 2OEOA 1WTXA 2E2IH 3R3OA 4LUZA 3NXWA 3MXUA 1HQMC 3HOZG 1HTPA 4YCWA 4CJ0B 4UY8C 1SNPA 1PFBA 2JEBI 1PXUA 1QVGA 2JA5H 3SHLA 3EA6A 5ELFA 4EVOA 1AFPA 3NQTA 2IHEA 2CHBD 2I5MX 2KENA 2MNAA 1SBBB 3NWTA 3ICEA 2LXKA 2F0HA 3FPUB 3MXNA 3Q22A 4GKJL 3AFQA 1BKBA 5GQOA 1PTOC 1B2TA 1Y8PB 4CGYB 2Z8LA 2Q8IB 1QNKA 1N36L 2DGYA 2IWHA 1PH2A 3J7A5 4JG2A 2KJXA 5E3FA 4CKBA 1EY4A 4DR7L 1EEID 2A73B 3CKIB 1TWGB 2F0PA 3UDFA 1D1KA 1D8LA 2KCNA 4DUZQ 2K5WA 3IFTA 2UUCL 4JV5L 5IP9G 4JPBW 4OIJA 2EE1A 4KN7C 4AH6A 3I4LA 1B9NA 1J6QA 4GKKL 3I2ZA 1SMYC 1GM5A 1LABA 1KABA 1XTCD 3J80E 3KUPA 4K5WA 5CGKA 4RMFA 1HCZA 2EXZA 4K2KA 4RGNA 2QCPX 4KD4A 3RZOH 1RKNA 3DXJC 3UDXA 4P73A 3V96A 4IZ8A 3DLLA 1DD2A 1VQHA 2UU9L 3S14H 4OWWB 1CHPD 2ZM6L 3N6RA 2WAQE 3I4NG 3H6MA 3OIPA 2ZXPA 3PV0A 2MPMA 3UE1A 3JAMc 2DY8A 2O5JC 4WFN3 3JAML 4EGVA 1BCPC 5M5XH 2SOBA 4LFAL 2NVTB 3RMHA 1STGA 4O0AA 3BVGA 1Z47A 3KJOA 1G51A 1TWCH 3HOWH 1RD9D 2B8FA 3H94A 4A3KB 2K5DA 2RSOA 4C56C 4LF9Q 4DV4L 1YNJD 3T1HL 1N34L 4IJLA 1CUKA 1SXTA 2AWNA 2ZJQA 1IBKL 3TRZA 1MBYA 2IX0A 2MQHA 4XXEA 4GOPA 3R93A 4JI3L 1VMCA 2R7DA 1TVXA 5GADC 2VW9A 5FOBB 3M3YH 3U58A 4N8X1 4RKBA 1XYIA 3F2BA 2C35B 3QB3A 3S2DH 3KF8B 4ME3A 3FMCA 2IW3A 2C5CA 1I6HB 2EY5A 1RTNA 5IT9L 4TKOB 2LXJA 2OF1A 3DEOA 1SNQA 4BY7H 1MSGA 4J6HA 2ZXRA 1UWVA 1KHIA 1LT5D 5M5WB 1PV4A 1TS5A 3AQQA 4LFBQ 3IL8A 1W6JA 2VQEQ 5AFWA 4HEDA 2ZM6Q 2VQFQ 4GN5A 1AZPA 5IGCA 2JE6I 4IURA 2KECA 1IW7C 2R61A 1V1QA 2A5HA 3PGZA 5LMNQ 1WJJA 4A3FH 2HQLA 4PQXA 2F0DA 2DN8A 4LF6Q 3HRZC 3QOLA 2IY5B 4PMBA 3DM1A 3F8TA 4C3HG 3GTLH 1S3OA 3DEPA 1B70B 4FF2A 1B1ZA 4YWLA 2B2YC 2L15A 4KD3A 2KQ3A 1HJPA 5LL6S 5KNCA 1DOLA 3H15A 1JJCB 1NAPA 1IBKQ 3GTLB 2F0QA 4A93G 2JEAI 3VR2A 1JWUD 1L1OC 1B8AA 2A68C 1SAPA 3D4DA 1WFQA 1QVFA 3S15H 4OO1H 3PUYA 5C0XG 4C3IH 2ZTCA 4A3IB 2GVAA 4GOPB 4JK1C 3BDOA 4YHHL 3J81j 1EWCA 1ICFB 4R1JA 1Q46A 2RCFA 3PQIA 1YEZA 4YWMA 1ESFA 4PZ7A 5CBEE 4X66Q 4BBSB 1EY6A 3MWYW 5CV9A 3SK4A 1P16A 1TIID 3HOWG 1I4GA 1WTVA 1LT4D 3S16H 2H5XA 2ENBA 4I7ZC 1XPOA 2K03A 4IALA 5JPMC 2QILA 1NBWA 1D1IA 2KOLA 1O78A 1PTOD 4R8NA 2ZT9C 5LMNL 1EYCA 3QOJA 2Q8TA 1XNQQ 4YCUA 4K0KQ 5KNBA 4DR4L 2RHQB 5GAHC 4NXNQ 5C5MA 2QDLA 1KNAA 3RLOA 3SE0A 1VDZA 1PH6A 2H4OA 2HCIA 2Z6KA 4QUFA 1TKWB 3L2PA 3FRPB 2CW0D 5EPLA 5FLMG 2SNSA 3NTKA 3SK5A 5H1SE 1FVIA 3KK7A 5LL6X 1C9OA 3AFPA 3PO2B 2A6EC 3NENA 4YHHQ 4A3EB 2VB3X 1JMCA 2FXQA 4OL7A 1H9RA 2R7ZG 3KJPA 2EVBA 4N9PA 5I9PA 1TXYA 2F0VA 3KOJA 1EWHA 3BJUA 1X65A 2CFMA 3DWQA 5M3MB 3Q24A 3M4QA 1HRJA 5I6YA 4A3GB 1WCMH 1WTHA 3HZXA 1XMQL 1SYDA 1SE3A 4HR7B 1LV9A 3MHBA 2EYFA 2EPBA 3NK9A 1NTGA 1YNJC 2EYMA 2L55A 4DV5Q 1HFGA 4DN4M 2L5TA 4GKJQ 5E7NA 1E7ZA 5BN5A 1A6XA 2JXMB 2J0TD 1KRSA 3SVMA 2ES2A 1N36Q 2AUJD 4OX9L 1A62A 1UUPA 4JI0Q 1ET6A 2F0JA 2EZVA 1VQBA 1ET9A 3GP7A 1M90C 1QZHA 3L3OC 3U9SA 4S3SA 4N8FA 3PIP3 4Y7NB 1OXXK 3STBC 5M5WH 4IPCA 2LFNA 4OO1G 3KYHC 1IL8A 2EY1A 3E3XA 3NTIA 1K8AC 5IGDA 5LMNW 2PW7A 4NB3A
chains in the Genus database with same CATH topology
1Y1WH 4A3LG 1VQGA 1YHQA 1WOCA 5C44H 3PO3G 2OTLA 2IT1A 3D31A 3OTOQ 4LF7L 3U4ZA 4HJ8A 1PHJA 3HOZH 1VQDA 1YNXA 2KHIA 1X55A 1WYDA 1VQ9A 1Q12A 1W2BA 2NVQH 4KHPL 3BU2A 1E22A 4DAMA 3RZDH 4JI6L 1VQIA 3KLWA 1Q8KA 3RLFA 4OO1I 1G6PA 1QUQA 3F2CA 1T9HA 4HJ5A 4DR2Q 2MFIA 1IYJB 1HZ9A 5DLQE 4L5SA 3PO3H 4X6AH 4YY3Q 3RN5A 4A3GH 3S17H 1CKNB 1HZCA 1LUZA 2Y0SG 3CAMA 5ELOA 4NXML 1IL2A 1PYSB 3HOVG 5GAEC 5C4XH 4DV6L 4DV5L 1Q82C 4JI4Q 3MXNB 4A3FG 1O7IA 4IFDG 2GN5A 1YHBA 3K80C 4GKJL 3KDFA 2EIFA 4MZ9A 4A3EG 2B3GA 4LUOA 1SR3A 2HIVA 1BVSA 1G291 5IYCH 3HOXH 3CPWA 1KC8C 1PA6A 1VQ5A 1XNRL 3FKIH 4A3JG 3GD7A 1YZ6A 4LF8L 4OX9Q 3RLNA 4DV4Q 2NVYH 1VQNA 4AYBE 3A5UA 3CCRA 2ID0A 1X6OA 4X66L 5C0XI 3K8AA 1SRUA 5LMNW 2AMCB 5C3EH 4APVA 2IX1A 3ER0A 1MKHA 1KIXA 4DR3L 3CC7A 4IPDA 4GS3A 2YU9H 4DV1Q 2YYZA 4DV2Q 4JBKA 1ASZA 2HHHL 4B3TQ 1CKOA 4MNOA 4GLVB 5EAYA 2A8VA 1Y1WG 3HOYG 4A3LH 4O2DA 1V43A 4JI2Q 1OXSC 4A3BH 1HR0W 5AJ3Q 4DV7L 1X3FA 3AYHB 2F3IA 1VQJA 1K0RA 1TWAH 2E5LQ 3CC2A 1XJVA 2NN6G 3M4PA 1FGUA 2K14A 1VQEA 1Q86C 4A3KH 4IFDJ 2CKZB 3W1BA 3G6EA 4B3SQ 1VQOA 1VQ7A 1KD1C 1XNQL 4GNXA 4P71A 4BBRG 3ULPA 5GAGC 4A3MG 2BH2A 5M3MH 4K0KL 3HOYH 4DR4Q 2RF4A 2AWOA 2PNHA 4JI6Q 4NPSA 4UPAA 1VQ6A 1UEBA 1VQCA 1JJ2A 4R4TA 5IT9c 3TEHB 2K4KA 4JI5Q 4LFCL 4POFA 4DK6C 4A3IG 2UUAL 2OTJA 1FJGL 4GOPC 3CP0A 1BBUA 1Y1VH 4HIKA 4YY3L 2R7ZH 4BY7G 4C3HH 4DV3L 2ATWA 1C0AA 1GD7A 1I94L 1LM0A 4DR7Q 3PUXA 2JJQA 2JA8G 3KFUA 1HNWQ 4PZ8A 2NVTH 2WB1E 3UE0A 4DR1Q 2JA5G 3HOVH 5IYDH 3HOUH 3HOXG 4X64Q 3H3VH 4RG1A 4DUZL 1X3GA 2VL6A 1Y1VG 2KCMA 4X62L 2OQ0A 3MEFA 1YVCA 3CW2C 3E9IA 3U50C 3F2DA 4HJ7A 2UUCQ 3S24A 4C3JH 1J5EL 2JA7H 4C2MH 2RCNA 3F1ZA 3PUZA 1PH4A 4A3CH 4A75A 2BA0A 3TQYA 4KHPQ 1MJEA 1I50H 2BH8A 2UUBL 1SE8A 3CCVA 4DR3Q 1PH5A 2E2IH 5JJLA 4LUZA 2WFWA 2E8GA 2DUDA 4IOCA 2D0PA 1MIUA 3HOZG 2BA1A 4YCWA 2N49A 4HJ9A 4UY8C 2JEBI 4HJAA 1LTLA 1KL9A 1YJWA 1QVGA 3K7AH 2JA5H 3GTKH 4OXPA 1K83H 3G71A 4L5RC 5K36G 4TQUS 2VY3A 3J81c 5IE8A 2WP8J 3HKZE 4JI1L 2D62A 2IHEA 2A1AA 2I5MX 2KENA 4IPGA 2K50A 2MNAA 3G4SA 1YHAA 1HNXL 3ICEA 2UXCQ 2LXKA 3GTGH 4BA1I 4GNXC 4PZ6A 1QVCA 3IRBA 2R7FA 1FL0A 5IP7G 3AFQA 1NMGA 3RNUA 1Q81C 3UDGA 4LF4Q 1N33Q 1XPUA 1BKBA 3KDFB 3GO5A 4GNXB 5GQOA 5M3MG 4JBJA 4WJ4A 4JI5L 4LFCQ 3J7A5 2UXBL 4DV0Q 1N36L 2DGYA 4JBWA 1PH2A 3H3VI 2HIXA 4JG2A 1U0LA 4L5TA 3RZOH 4JI0L 2F4VQ 3A0JA 3A74A 1Q1EA 4QL5A 1LYLA 4XIGS 5IYCG 4DV3Q 1I94Q 4JBMA 4DR7L 1SFOH 4AQYL 4EX5A 1WI5A 3CCSA 3PF5A 3NELA 1NY4A 1PVOA 2B63H 3UDFA 4R4QA 1VS0A 3I7FA 4X64L 1VQFA 1D8LA 4DUZQ 1N9WA 4A93H 2LSSA 3KF6A 1L0WA 2UUCL 5IP9G 4JV5L 4UP7A 2NZHA 3S1QH 3W5OA 1J5EQ 2R93H 1XPRA 2Q2IA 1SN8A 1XMOL 4AH6A 1CKMA 1J6QA 4GKKL 1A8VA 1E1OA 3I2ZA 4DK3C 1GM5A 2KBNA 4EQ5A 3OTOL 4LF7Q 2OQKA 3GTQH 4RMFA 3CCQA 4IJHA 1A0IA 4QGUA 5IYBG 1SROA 3FHWA 3CMAA 2Z6KC 1K73C 3FKIG 4DAYB 4A3JH 4A3KG 4IO9A 1EQQA 4BY1H 3AEVA 3UDXA 1W3SA 4P73A 4B3RL 1E1TA 5HGQA 3PUWA 1P8LA 3DLLA 1VQHA 1JB7A 2UU9L 3S14H 1EYGA 5BR8Q 3J80i 2Z0SA 4OWWB 3S1NH 2UXDQ 4R4OA 3J7ZC 2HT1A 5IWAL 2ZM6L 2VUMH 5FJ8G 2WAQE 4JI1Q 5IP9H 1IBMQ 3K0XA 5LMUL 2JA8H 4OWTB 3I4NG 4A3BG 1X3EA 3PV0A 1PH9A 3CCLA 4IFDI 3UE1A 4BY1G 4KI0A 1C7YA 4JI4L 3JAMc 4FDBA 1AH9A 3CCUA 4A76A 1VQPA 3PSIA 4A3IH 1VQ8A 5M5XH 3CMEA 4LFAL 4BBSG 3G48A 2N3SA 3NEMA 4O0AA 4KHZA 1Z47A 3KJOA 1VCIA 1G51A 3EN2A 1TWCH 2XTIA 2R92H 3HOWH 1HNZL 4DR6Q 3PIOA 2D0OA 2UXBQ 1Q7YC 4LF8Q 4DPGA 3RN2A 4DV4L 4LF9Q 2ZTEA 3T1HL 1N34L 4QQBX 4IJLA 1CUKA 2AWNA 1RL2A 2ZJQA 1IBKL 4BA2I 2JA6G 1XMQQ 4A3CG 1V9PA 1L1OA 3TRZA 2ALYB 1CSPA 2F52A 3OW2A 2IX0A 2MQHA 1JT8A 2EQSA 4P72A 3B6YA 4QY7A 4GOPA 1K8GA 4JI3L 2R7DA 2R93G 5GADC 2VW9A 4B3TL 3M3YH 3KF6B 3HKSA 3W1GA 3U58A 3LGJA 1KXLA 4X65L 2E2JH 3F2BA 2C35B 2Q2HA 5J3BA 2E2HH 3S2DH 1ASYA 1AE3A 1XMOQ 3KF8B 5GROA 2I0QA 2R6GA 2QEXA 1X54A 2PMZE 1HZAA 4ME3A 2JA6H 4YWKA 2R92G 2LXJA 3CF5A 4BY7H 1UE5A 4B3SL 4UP8A 2QA4A 1UWVA 1KHIA 5M3FG 1QZGA 3S2HH 1PH3A 2VZAA 3GTPH 2RHSB 4TVAB 3TREA 3J80c 4AIMA 4Y7NH 4HIDA 1PV4A 2UU9Q 3AQQA 4LFBQ 5BR8L 2UXDL 5IP7H 1X9NA 1BBWA 2VQEQ 2UUAQ 5JJKA 2ZM6Q 2V1CC 1KAWA 4GN5A 5JEAG 2VQFQ 1IBML 4WJ3M 5C4XG 2N78A 5LMUQ 3L7ZC 2JE6I 4JI7Q 3I4NH 3D0FA 1V1QA 1K9MC 1HNWL 3PGZA 5LMNQ 1WJJA 2QGQA 2CQOA 4XTCS 2HQLA 5IY0A 4A3FH 1PH8A 3M85A 2VS1A 5C0XJ 1EQRA 1E3PA 4DR1L 1SLJA 2YTXA 4LF6Q 2ASBA 1CSQA 2PI2A 1EUJA 2IY5B 3GTLH 3F8TA 2Y0SE 4X62Q 1HNZQ 1S3OA 3I56A 1N32L 1B70B 4DR6L 4YWLA 2EXDA 1YI2A 2L15A 4J15A 3ZJYC 5M3FH 1NJIC 3E9HA 1HJPA 3ERSX 1MJCA 4JYAL 2VNUD 1N34Q 4DR2L 4JI8Q 5FLMH 3H15A 1JJCB 1L1OB 3EIVA 1IBKQ 2K52A 1U5KA 4A93G 3HOUG 2JEAI 1VQKA 1S40A 1UE6A 1PH1A 3CCMA 2K5VA 3JC66 1GKHA 1B8AA 1L1OC 1E24A 1WFQA 1QVFA 3S15H 3PUYA 1Z9FA 1PYBA 5C0XG 4B3ML 4C3IH 4AYBG 2ZTCA 5FLXc 3JAMi 1TWHH 2GVAA 4GOPB 4X65Q 1PH7A 1HR0L 2PQAA 3OYYA 5FJ8H 2Q2UA 1XNRQ 3RR5A 4YHHL 3J81j 3I4MG 4A3DH 1HH2P 1TWGH 2PI2E 2Q2TA 4R1JA 4IPHA 4JOIC 1CKNA 1Q46A 1YEZA 4QIWE 4YWMA 4HIOA 3S1RH 4PZ7A 4JOIA 3GTOH 1EIFA 4X66Q 4JC0A 4BXXH 4BBRH 1VQLA 3M7NA 2I5LX 5JEAJ 1EIYB 1P16A 4KLKA 1R9TH 4POGA 1JE5A 2NN6I 3HKZG 4DR5Q 2HHHQ 4LUVA 1I5FA 3HOWG 4GN3B 5JJIA 3S16H 2H5XA 4LFBL 3WWVA 4BBSH 1Y14B 4DV7Q 4A3MH 1XPOA 2AKWB 3K81C 2VQFL 3NBHB 3SGIA 2NVXH 2IHFA 1YITA 1NBWA 4BXXG 2E5LL 4PG3A 4Y52H 3T1YQ 2XGTA 3A5ZB 4JI7L 1YBYA 1YJNA 3HFZB 2ZTDA 5LMNL 2VUMG 2ZJRA 3H0GH 2N8NA 2JA9A 3TS0A 4QJFA 1EOVA 3I4OA 3UDIA 5C4JH 1YIJA 4P75A 1XNQQ 4YCUA 5C3EG 4LF6L 4K0KQ 1DGSA 3ULJA 4DR4L 2RHQB 3M9BA 5GAHC 4NXNQ 1PFSA 1IBLQ 2CWAA 3RLOA 4LF5L 2K5NA 3S1MH 1PH6A 1TWFH 1EFWA 2Z6KA 1SMXA 4JYAQ 3EBEA 4JI8L 1FJGQ 3GTMH 2WB1G 3GTJH 4GKKQ 3L2PA 1N8RC 4YCVA 4H02A 1VQ4A 1M1KC 4GLAC 5FLMG 4A3EH 2ZJPA 3CC4A 2OWOA 4DKAC 5H1SE 4LNQA 2YV5A 3K7UC 4L5QA 3I4MH 4GLXA 1FVIA 4A3DG 3PO2G 4B3MQ 4B3RQ 4HIMA 1C9OA 4A4IA 1IXRA 1JJGA 3AFPA 1HZBA 1HR0Q 1B7YB 1NE3A 1NMFA 3NENA 4YHHQ 4GN4B 2I5HA 1OXUA 5IWAQ 1OXTA 1GVPA 1JMCA 1UE7A 4IOAA 2CWPA 4DUYQ 1I6HH 2CCZA 4OWXB 2FXQA 1IZ6A 2R7ZG 3KJPA 3PO2H 1L2FA 2UUBQ 3M4OH 3U4VA 1H95A 1TXYA 5IYBH 2WAQG 3KOJA 5ELNA 1AE2A 2B29A 4LFAQ 3CCEA 4DR5L 1VQMA 1A63A 5C44G 5M5YH 3CD6A 3BJUA 1X65A 3PUVA 1OXVA 1I3QH 2CFMA 4P74A 4DNIA 3M4QA 1N32Q 4MTNA 2JQOA 4LF9L 2JA7G 1VQAA 2YTVA 3T1HQ 5HY6A 4R4IA 3BZKA 1WCMH 3PIPA 3T1YL 1OTCA 4R4CA 3J81i 4LWCA 4ALPA 1XMQL 5IYDG 4NXMQ 1HNXQ 2UXCL 1NTGA 2AHOB 3H0GG 4DV5Q 4DV6Q 4JI3Q 3VDYA 1N33L 4GKJQ 5E7NA 1E7ZA 4LF4L 2PQAB 4NXNL 3CXCA 1IBLL 2OCEA 2MO1A 2K5HA 3GDEA 4LF5Q 3Q8DA 2B63G 1WCMG 1KRSA 3DM3A 3TS2A 3I55A 1Q1BA 2ES2A 3E0EA 4DV0L 1S72A 1N36Q 4OX9L 1KRTA 1A62A 3STBD 2K75A 4JI0Q 2F4VL 2KCTA 1RIPA 3CCJA 2YTYA 1VQBA 4AQYQ 1D7QA 3CQZH 1M90C 4LW1A 1QZHA 4PMWA 1YJ9A 4JCVE 4DV1L 2NZOA 4DV2L 3CPFA 3PCOB 3BZCA 3PF4A 1KQSA 1OXXK 3STBC 1X56A 5M5WH 3L0OA 3ULLA 4IPCA 4OONA 4JI2L 4A3GG 4JV5Q 2MO0A 5AJ3L 2VQEL 1QUQB 1UE1A 2A19A 2KHJA 3KYHC 4OO1G 1EWIA 1XTDA 3FP9A 1K8AC 2JK8A 4DUYL 1GO3E 4UP9A 2GVBA 4NB3A 1K3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1W H;  4A3L G;  1VQG A;  1YHQ A;  1WOC A;  5C44 H;  3PO3 G;  2OTL A;  2IT1 A;  3D31 A;  3OTO Q;  4LF7 L;  3U4Z A;  4HJ8 A;  1PHJ A;  3HOZ H;  1VQD A;  1YNX A;  2KHI A;  1X55 A;  1WYD A;  1VQ9 A;  1Q12 A;  1W2B A;  2NVQ H;  4KHP L;  3BU2 A;  1E22 A;  4DAM A;  3RZD H;  4JI6 L;  1VQI A;  3KLW A;  1Q8K A;  3RLF A;  4OO1 I;  1G6P A;  1QUQ A;  3F2C A;  1T9H A;  4HJ5 A;  4DR2 Q;  2MFI A;  1IYJ B;  1HZ9 A;  5DLQ E;  4L5S A;  3PO3 H;  4X6A H;  4YY3 Q;  3RN5 A;  4A3G H;  3S17 H;  1CKN B;  1HZC A;  1LUZ A;  2Y0S G;  3CAM A;  5ELO A;  4NXM L;  1IL2 A;  1PYS B;  3HOV G;  5GAE C;  5C4X H;  4DV6 L;  4DV5 L;  1Q82 C;  4JI4 Q;  3MXN B;  4A3F G;  1O7I A;  4IFD G;  2GN5 A;  1YHB A;  3K80 C;  4GKJ L;  3KDF A;  2EIF A;  4MZ9 A;  4A3E G;  2B3G A;  4LUO A;  1SR3 A;  2HIV A;  1BVS A;  1G29 1;  5IYC H;  3HOX H;  3CPW A;  1KC8 C;  1PA6 A;  1VQ5 A;  1XNR L;  3FKI H;  4A3J G;  3GD7 A;  1YZ6 A;  4LF8 L;  4OX9 Q;  3RLN A;  4DV4 Q;  2NVY H;  1VQN A;  4AYB E;  3A5U A;  3CCR A;  2ID0 A;  1X6O A;  4X66 L;  5C0X I;  3K8A A;  1SRU A;  5LMN W;  2AMC B;  5C3E H;  4APV A;  2IX1 A;  3ER0 A;  1MKH A;  1KIX A;  4DR3 L;  3CC7 A;  4IPD A;  4GS3 A;  2YU9 H;  4DV1 Q;  2YYZ A;  4DV2 Q;  4JBK A;  1ASZ A;  2HHH L;  4B3T Q;  1CKO A;  4MNO A;  4GLV B;  5EAY A;  2A8V A;  1Y1W G;  3HOY G;  4A3L H;  4O2D A;  1V43 A;  4JI2 Q;  1OXS C;  4A3B H;  1HR0 W;  5AJ3 Q;  4DV7 L;  1X3F A;  3AYH B;  2F3I A;  1VQJ A;  1K0R A;  1TWA H;  2E5L Q;  3CC2 A;  1XJV A;  2NN6 G;  3M4P A;  1FGU A;  2K14 A;  1VQE A;  1Q86 C;  4A3K H;  4IFD J;  2CKZ B;  3W1B A;  3G6E A;  4B3S Q;  1VQO A;  1VQ7 A;  1KD1 C;  1XNQ L;  4GNX A;  4P71 A;  4BBR G;  3ULP A;  5GAG C;  4A3M G;  2BH2 A;  5M3M H;  4K0K L;  3HOY H;  4DR4 Q;  2RF4 A;  2AWO A;  2PNH A;  4JI6 Q;  4NPS A;  4UPA A;  1VQ6 A;  1UEB A;  1VQC A;  1JJ2 A;  4R4T A;  5IT9 c;  3TEH B;  2K4K A;  4JI5 Q;  4LFC L;  4POF A;  4DK6 C;  4A3I G;  2UUA L;  2OTJ A;  1FJG L;  4GOP C;  3CP0 A;  1BBU A;  1Y1V H;  4HIK A;  4YY3 L;  2R7Z H;  4BY7 G;  4C3H H;  4DV3 L;  2ATW A;  1C0A A;  1GD7 A;  1I94 L;  1LM0 A;  4DR7 Q;  3PUX A;  2JJQ A;  2JA8 G;  3KFU A;  1HNW Q;  4PZ8 A;  2NVT H;  2WB1 E;  3UE0 A;  4DR1 Q;  2JA5 G;  3HOV H;  5IYD H;  3HOU H;  3HOX G;  4X64 Q;  3H3V H;  4RG1 A;  4DUZ L;  1X3G A;  2VL6 A;  1Y1V G;  2KCM A;  4X62 L;  2OQ0 A;  3MEF A;  1YVC A;  3CW2 C;  3E9I A;  3U50 C;  3F2D A;  4HJ7 A;  2UUC Q;  3S24 A;  4C3J H;  1J5E L;  2JA7 H;  4C2M H;  2RCN A;  3F1Z A;  3PUZ A;  1PH4 A;  4A3C H;  4A75 A;  2BA0 A;  3TQY A;  4KHP Q;  1MJE A;  1I50 H;  2BH8 A;  2UUB L;  1SE8 A;  3CCV A;  4DR3 Q;  1PH5 A;  2E2I H;  5JJL A;  4LUZ A;  2WFW A;  2E8G A;  2DUD A;  4IOC A;  2D0P A;  1MIU A;  3HOZ G;  2BA1 A;  4YCW A;  2N49 A;  4HJ9 A;  4UY8 C;  2JEB I;  4HJA A;  1LTL A;  1KL9 A;  1YJW A;  1QVG A;  3K7A H;  2JA5 H;  3GTK H;  4OXP A;  1K83 H;  3G71 A;  4L5R C;  5K36 G;  4TQU S;  2VY3 A;  3J81 c;  5IE8 A;  2WP8 J;  3HKZ E;  4JI1 L;  2D62 A;  2IHE A;  2A1A A;  2I5M X;  2KEN A;  4IPG A;  2K50 A;  2MNA A;  3G4S A;  1YHA A;  1HNX L;  3ICE A;  2UXC Q;  2LXK A;  3GTG H;  4BA1 I;  4GNX C;  4PZ6 A;  1QVC A;  3IRB A;  2R7F A;  1FL0 A;  5IP7 G;  3AFQ A;  1NMG A;  3RNU A;  1Q81 C;  3UDG A;  4LF4 Q;  1N33 Q;  1XPU A;  1BKB A;  3KDF B;  3GO5 A;  4GNX B;  5GQO A;  5M3M G;  4JBJ A;  4WJ4 A;  4JI5 L;  4LFC Q;  3J7A 5;  2UXB L;  4DV0 Q;  1N36 L;  2DGY A;  4JBW A;  1PH2 A;  3H3V I;  2HIX A;  4JG2 A;  1U0L A;  4L5T A;  3RZO H;  4JI0 L;  2F4V Q;  3A0J A;  3A74 A;  1Q1E A;  4QL5 A;  1LYL A;  4XIG S;  5IYC G;  4DV3 Q;  1I94 Q;  4JBM A;  4DR7 L;  1SFO H;  4AQY L;  4EX5 A;  1WI5 A;  3CCS A;  3PF5 A;  3NEL A;  1NY4 A;  1PVO A;  2B63 H;  3UDF A;  4R4Q A;  1VS0 A;  3I7F A;  4X64 L;  1VQF A;  1D8L A;  4DUZ Q;  1N9W A;  4A93 H;  2LSS A;  3KF6 A;  1L0W A;  2UUC L;  5IP9 G;  4JV5 L;  4UP7 A;  2NZH A;  3S1Q H;  3W5O A;  1J5E Q;  2R93 H;  1XPR A;  2Q2I A;  1SN8 A;  1XMO L;  4AH6 A;  1CKM A;  1J6Q A;  4GKK L;  1A8V A;  1E1O A;  3I2Z A;  4DK3 C;  1GM5 A;  2KBN A;  4EQ5 A;  3OTO L;  4LF7 Q;  2OQK A;  3GTQ H;  4RMF A;  3CCQ A;  4IJH A;  1A0I A;  4QGU A;  5IYB G;  1SRO A;  3FHW A;  3CMA A;  2Z6K C;  1K73 C;  3FKI G;  4DAY B;  4A3J H;  4A3K G;  4IO9 A;  1EQQ A;  4BY1 H;  3AEV A;  3UDX A;  1W3S A;  4P73 A;  4B3R L;  1E1T A;  5HGQ A;  3PUW A;  1P8L A;  3DLL A;  1VQH A;  1JB7 A;  2UU9 L;  3S14 H;  1EYG A;  5BR8 Q;  3J80 i;  2Z0S A;  4OWW B;  3S1N H;  2UXD Q;  4R4O A;  3J7Z C;  2HT1 A;  5IWA L;  2ZM6 L;  2VUM H;  5FJ8 G;  2WAQ E;  4JI1 Q;  5IP9 H;  1IBM Q;  3K0X A;  5LMU L;  2JA8 H;  4OWT B;  3I4N G;  4A3B G;  1X3E A;  3PV0 A;  1PH9 A;  3CCL A;  4IFD I;  3UE1 A;  4BY1 G;  4KI0 A;  1C7Y A;  4JI4 L;  3JAM c;  4FDB A;  1AH9 A;  3CCU A;  4A76 A;  1VQP A;  3PSI A;  4A3I H;  1VQ8 A;  5M5X H;  3CME A;  4LFA L;  4BBS G;  3G48 A;  2N3S A;  3NEM A;  4O0A A;  4KHZ A;  1Z47 A;  3KJO A;  1VCI A;  1G51 A;  3EN2 A;  1TWC H;  2XTI A;  2R92 H;  3HOW H;  1HNZ L;  4DR6 Q;  3PIO A;  2D0O A;  2UXB Q;  1Q7Y C;  4LF8 Q;  4DPG A;  3RN2 A;  4DV4 L;  4LF9 Q;  2ZTE A;  3T1H L;  1N34 L;  4QQB X;  4IJL A;  1CUK A;  2AWN A;  1RL2 A;  2ZJQ A;  1IBK L;  4BA2 I;  2JA6 G;  1XMQ Q;  4A3C G;  1V9P A;  1L1O A;  3TRZ A;  2ALY B;  1CSP A;  2F52 A;  3OW2 A;  2IX0 A;  2MQH A;  1JT8 A;  2EQS A;  4P72 A;  3B6Y A;  4QY7 A;  4GOP A;  1K8G A;  4JI3 L;  2R7D A;  2R93 G;  5GAD C;  2VW9 A;  4B3T L;  3M3Y H;  3KF6 B;  3HKS A;  3W1G A;  3U58 A;  3LGJ A;  1KXL A;  4X65 L;  2E2J H;  3F2B A;  2C35 B;  2Q2H A;  5J3B A;  2E2H H;  3S2D H;  1ASY A;  1AE3 A;  1XMO Q;  3KF8 B;  5GRO A;  2I0Q A;  2R6G A;  2QEX A;  1X54 A;  2PMZ E;  1HZA A;  4ME3 A;  2JA6 H;  4YWK A;  2R92 G;  2LXJ A;  3CF5 A;  4BY7 H;  1UE5 A;  4B3S L;  4UP8 A;  2QA4 A;  1UWV A;  1KHI A;  5M3F G;  1QZG A;  3S2H H;  1PH3 A;  2VZA A;  3GTP H;  2RHS B;  4TVA B;  3TRE A;  3J80 c;  4AIM A;  4Y7N H;  4HID A;  1PV4 A;  2UU9 Q;  3AQQ A;  4LFB Q;  5BR8 L;  2UXD L;  5IP7 H;  1X9N A;  1BBW A;  2VQE Q;  2UUA Q;  5JJK A;  2ZM6 Q;  2V1C C;  1KAW A;  4GN5 A;  5JEA G;  2VQF Q;  1IBM L;  4WJ3 M;  5C4X G;  2N78 A;  5LMU Q;  3L7Z C;  2JE6 I;  4JI7 Q;  3I4N H;  3D0F A;  1V1Q A;  1K9M C;  1HNW L;  3PGZ A;  5LMN Q;  1WJJ A;  2QGQ A;  2CQO A;  4XTC S;  2HQL A;  5IY0 A;  4A3F H;  1PH8 A;  3M85 A;  2VS1 A;  5C0X J;  1EQR A;  1E3P A;  4DR1 L;  1SLJ A;  2YTX A;  4LF6 Q;  2ASB A;  1CSQ A;  2PI2 A;  1EUJ A;  2IY5 B;  3GTL H;  3F8T A;  2Y0S E;  4X62 Q;  1HNZ Q;  1S3O A;  3I56 A;  1N32 L;  1B70 B;  4DR6 L;  4YWL A;  2EXD A;  1YI2 A;  2L15 A;  4J15 A;  3ZJY C;  5M3F H;  1NJI C;  3E9H A;  1HJP A;  3ERS X;  1MJC A;  4JYA L;  2VNU D;  1N34 Q;  4DR2 L;  4JI8 Q;  5FLM H;  3H15 A;  1JJC B;  1L1O B;  3EIV A;  1IBK Q;  2K52 A;  1U5K A;  4A93 G;  3HOU G;  2JEA I;  1VQK A;  1S40 A;  1UE6 A;  1PH1 A;  3CCM A;  2K5V A;  3JC6 6;  1GKH A;  1B8A A;  1L1O C;  1E24 A;  1WFQ A;  1QVF A;  3S15 H;  3PUY A;  1Z9F A;  1PYB A;  5C0X G;  4B3M L;  4C3I H;  4AYB G;  2ZTC A;  5FLX c;  3JAM i;  1TWH H;  2GVA A;  4GOP B;  4X65 Q;  1PH7 A;  1HR0 L;  2PQA A;  3OYY A;  5FJ8 H;  2Q2U A;  1XNR Q;  3RR5 A;  4YHH L;  3J81 j;  3I4M G;  4A3D H;  1HH2 P;  1TWG H;  2PI2 E;  2Q2T A;  4R1J A;  4IPH A;  4JOI C;  1CKN A;  1Q46 A;  1YEZ A;  4QIW E;  4YWM A;  4HIO A;  3S1R H;  4PZ7 A;  4JOI A;  3GTO H;  1EIF A;  4X66 Q;  4JC0 A;  4BXX H;  4BBR H;  1VQL A;  3M7N A;  2I5L X;  5JEA J;  1EIY B;  1P16 A;  4KLK A;  1R9T H;  4POG A;  1JE5 A;  2NN6 I;  3HKZ G;  4DR5 Q;  2HHH Q;  4LUV A;  1I5F A;  3HOW G;  4GN3 B;  5JJI A;  3S16 H;  2H5X A;  4LFB L;  3WWV A;  4BBS H;  1Y14 B;  4DV7 Q;  4A3M H;  1XPO A;  2AKW B;  3K81 C;  2VQF L;  3NBH B;  3SGI A;  2NVX H;  2IHF A;  1YIT A;  1NBW A;  4BXX G;  2E5L L;  4PG3 A;  4Y52 H;  3T1Y Q;  2XGT A;  3A5Z B;  4JI7 L;  1YBY A;  1YJN A;  3HFZ B;  2ZTD A;  5LMN L;  2VUM G;  2ZJR A;  3H0G H;  2N8N A;  2JA9 A;  3TS0 A;  4QJF A;  1EOV A;  3I4O A;  3UDI A;  5C4J H;  1YIJ A;  4P75 A;  1XNQ Q;  4YCU A;  5C3E G;  4LF6 L;  4K0K Q;  1DGS A;  3ULJ A;  4DR4 L;  2RHQ B;  3M9B A;  5GAH C;  4NXN Q;  1PFS A;  1IBL Q;  2CWA A;  3RLO A;  4LF5 L;  2K5N A;  3S1M H;  1PH6 A;  1TWF H;  1EFW A;  2Z6K A;  1SMX A;  4JYA Q;  3EBE A;  4JI8 L;  1FJG Q;  3GTM H;  2WB1 G;  3GTJ H;  4GKK Q;  3L2P A;  1N8R C;  4YCV A;  4H02 A;  1VQ4 A;  1M1K C;  4GLA C;  5FLM G;  4A3E H;  2ZJP A;  3CC4 A;  2OWO A;  4DKA C;  5H1S E;  4LNQ A;  2YV5 A;  3K7U C;  4L5Q A;  3I4M H;  4GLX A;  1FVI A;  4A3D G;  3PO2 G;  4B3M Q;  4B3R Q;  4HIM A;  1C9O A;  4A4I A;  1IXR A;  1JJG A;  3AFP A;  1HZB A;  1HR0 Q;  1B7Y B;  1NE3 A;  1NMF A;  3NEN A;  4YHH Q;  4GN4 B;  2I5H A;  1OXU A;  5IWA Q;  1OXT A;  1GVP A;  1JMC A;  1UE7 A;  4IOA A;  2CWP A;  4DUY Q;  1I6H H;  2CCZ A;  4OWX B;  2FXQ A;  1IZ6 A;  2R7Z G;  3KJP A;  3PO2 H;  1L2F A;  2UUB Q;  3M4O H;  3U4V A;  1H95 A;  1TXY A;  5IYB H;  2WAQ G;  3KOJ A;  5ELN A;  1AE2 A;  2B29 A;  4LFA Q;  3CCE A;  4DR5 L;  1VQM A;  1A63 A;  5C44 G;  5M5Y H;  3CD6 A;  3BJU A;  1X65 A;  3PUV A;  1OXV A;  1I3Q H;  2CFM A;  4P74 A;  4DNI A;  3M4Q A;  1N32 Q;  4MTN A;  2JQO A;  4LF9 L;  2JA7 G;  1VQA A;  2YTV A;  3T1H Q;  5HY6 A;  4R4I A;  3BZK A;  1WCM H;  3PIP A;  3T1Y L;  1OTC A;  4R4C A;  3J81 i;  4LWC A;  4ALP A;  1XMQ L;  5IYD G;  4NXM Q;  1HNX Q;  2UXC L;  1NTG A;  2AHO B;  3H0G G;  4DV5 Q;  4DV6 Q;  4JI3 Q;  3VDY A;  1N33 L;  4GKJ Q;  5E7N A;  1E7Z A;  4LF4 L;  2PQA B;  4NXN L;  3CXC A;  1IBL L;  2OCE A;  2MO1 A;  2K5H A;  3GDE A;  4LF5 Q;  3Q8D A;  2B63 G;  1WCM G;  1KRS A;  3DM3 A;  3TS2 A;  3I55 A;  1Q1B A;  2ES2 A;  3E0E A;  4DV0 L;  1S72 A;  1N36 Q;  4OX9 L;  1KRT A;  1A62 A;  3STB D;  2K75 A;  4JI0 Q;  2F4V L;  2KCT A;  1RIP A;  3CCJ A;  2YTY A;  1VQB A;  4AQY Q;  1D7Q A;  3CQZ H;  1M90 C;  4LW1 A;  1QZH A;  4PMW A;  1YJ9 A;  4JCV E;  4DV1 L;  2NZO A;  4DV2 L;  3CPF A;  3PCO B;  3BZC A;  3PF4 A;  1KQS A;  1OXX K;  3STB C;  1X56 A;  5M5W H;  3L0O A;  3ULL A;  4IPC A;  4OON A;  4JI2 L;  4A3G G;  4JV5 Q;  2MO0 A;  5AJ3 L;  2VQE L;  1QUQ B;  1UE1 A;  2A19 A;  2KHJ A;  3KYH C;  4OO1 G;  1EWI A;  1XTD A;  3FP9 A;  1K8A C;  2JK8 A;  4DUY L;  1GO3 E;  4UP9 A;  2GVB A;  4NB3 A;  1K3R A; 
#chains in the Genus database with same CATH topology
 3D6C A;  4A3L G;  3D31 A;  3OTO Q;  1TWH B;  4QMG A;  1PHJ A;  1VQD A;  1S5D D;  3H0G B;  4C1N I;  3BU2 A;  2JP1 A;  3RZD H;  2HUG A;  1M8A A;  1Q8K A;  4O42 A;  3RLF A;  4OO1 I;  3T53 B;  2JA7 B;  2L12 A;  2IJ0 A;  2MFI A;  1HZ9 A;  4L5S A;  5EPK A;  3PO3 H;  2ICE C;  1LUZ A;  3DHQ A;  3CAM A;  4DU9 A;  1PYS B;  5EBC A;  3A55 A;  4DV5 L;  3MXN B;  2Y0S B;  5FO7 B;  1GUO A;  4MZ9 A;  2B2Y A;  2HIV A;  1BVS A;  4XYQ A;  3CPW A;  1VQ5 A;  5KRU A;  3A8J E;  1XNR L;  1ICW A;  4LK1 C;  4ZK9 B;  3LX0 A;  3RLN A;  2G5D A;  1NCV A;  3A5U A;  1SND A;  3CCR A;  2ID0 A;  5C0X I;  1CTM A;  2LMC B;  2O2L D;  3ER0 A;  1STY A;  3S15 B;  4G7O C;  3F2U A;  2HHH L;  2M2L A;  5CMD A;  4MNO A;  4GLV B;  2P5Z X;  1IKM A;  4MIU A;  3AYH B;  5C6A A;  2F3I A;  2E5L Q;  3CC2 A;  2PZU A;  5I9O A;  4FO2 A;  4HCS A;  2CKZ B;  3G6E A;  1VQ7 A;  1KD1 C;  5K36 H;  5K5P A;  2SDF A;  3ULP A;  5M3M H;  1NUC A;  1U9R A;  4NPS A;  1K3B C;  2KEE A;  2B2T C;  5C5L A;  5C3W A;  4C3J G;  4JI5 Q;  4LFC L;  4POF A;  1SJE D;  4DK6 C;  4A3I G;  2UUA L;  3MTS A;  4GOP C;  1S5F D;  2R7Z H;  4BY7 G;  4LJZ C;  1GD7 A;  1NR2 A;  2F0N A;  3IFD A;  2JJQ A;  2WB1 E;  3UE0 A;  2RBM A;  3HOU H;  4X64 Q;  4BY7 B;  3RD4 A;  2VL6 A;  4X3S A;  3S2H B;  1YVC A;  3CW2 C;  4B9W A;  1WD0 A;  4C3J H;  4C2M H;  1ML0 D;  2K32 A;  3MXP A;  4IUQ A;  2EJG C;  2KUM A;  1HHV A;  2A6E D;  2UUB L;  1I50 H;  2BH8 A;  2LS0 1;  1SE8 A;  3CCV A;  1H9K A;  4DR3 Q;  1FR3 A;  5JJL A;  2DUD A;  3SEB A;  2AUK A;  5ELE A;  1IYU A;  1LTL A;  1YJW A;  3A8I E;  4L63 B;  4ZQ3 A;  4OXP A;  3G71 A;  5K36 G;  1SNC A;  5I6W A;  3CRK C;  3J81 c;  5IE8 A;  4JI1 L;  5M3F B;  2WKD A;  1YHA A;  2N88 A;  3BG3 A;  4BA1 I;  2Z1C A;  3SXH A;  5JEA H;  4PZ6 A;  1QVC A;  4GNX C;  1SE2 A;  1N33 Q;  4JVZ A;  3GV6 A;  2KED A;  1BCP F;  4JBJ A;  1X3P A;  4JI5 L;  4LFC Q;  2A74 C;  2UXB L;  4DV0 Q;  1S5E D;  1EY7 A;  4JBW A;  2E75 C;  1SNM A;  4L5T A;  1JOK A;  2F4V Q;  4JBM A;  3S2D B;  5JJZ A;  4AQY L;  4EX5 A;  1BF4 A;  1WI5 A;  3CCS A;  1NY4 A;  4RH6 A;  1L0X B;  3I7F A;  2FJ2 A;  3HKZ B;  4X64 L;  3T16 A;  2LSS A;  2M9V A;  1L0W A;  1S5C D;  2NZH A;  3W5O A;  2AQ2 B;  1J5E Q;  4DAV A;  1EQV A;  1XPR A;  3GTJ B;  1E1O A;  4CJ2 C;  4EQ5 A;  1JIC A;  1I6V C;  1DZ1 A;  2F4I A;  5I2Y A;  4IJH A;  4DNT B;  5IYB G;  5G3L F;  1I4Q A;  4WRD A;  3FHW A;  3CMA A;  4A3K G;  4RGT A;  4IO9 A;  4KHP Q;  1M4V A;  4L8J A;  2D5D A;  5HGQ A;  1BUV T;  1P8L A;  4YIJ A;  1JB7 A;  5CYU A;  3N52 A;  5BR8 Q;  3J80 i;  4K5V A;  2UXD Q;  5FO9 B;  4R4O A;  1ILP A;  4HN7 A;  1LTI D;  5DNF A;  1E2W A;  5C3E B;  5KND A;  1IBM Q;  4JI1 Q;  3K0X A;  5LMU L;  1X3E A;  1PH9 A;  3FVQ A;  5COY A;  4BY1 G;  4IQZ A;  3CCU A;  3DMU A;  4RHS A;  3CME A;  3G48 A;  2N3S A;  3T51 B;  3EN2 A;  3C1E A;  1HNZ L;  2E74 C;  3HEJ A;  3D3R A;  3I73 A;  4OHJ A;  2UXB Q;  1HA6 A;  4QQB X;  3S1M B;  2WII B;  3K7A B;  4CHT B;  3EQL C;  1XMQ Q;  4A3C G;  1L1O A;  1CSP A;  4UDU C;  3OPO A;  4V0B A;  3B6Y A;  1K8G A;  2R93 G;  1D5Z C;  3PMF A;  3KF6 B;  4HSV A;  3LGJ A;  1EFI D;  1AEX A;  2Q2H A;  2E2H H;  2R6G A;  2QEX A;  1HZA A;  1PFM A;  2B2U A;  4B3S L;  4A93 B;  4DAY A;  4UP8 A;  2QA4 A;  5M3F G;  3S2H H;  4H0L C;  2VZA A;  2K33 A;  2RHS B;  4TVA B;  3TRE A;  5DM7 3;  2BDN A;  1LAC A;  3A7A B;  4CBV A;  5ISR A;  5BR8 L;  2UXD L;  3I8Z A;  1MHW C;  1VF5 C;  5D14 A;  3E6Z X;  5LMU Q;  4K6D A;  4DXF A;  3I4N H;  1EEF D;  2NN6 H;  3D0F A;  1STH A;  1BXT A;  1HNW L;  1PH8 A;  4OGQ C;  2VS1 A;  1R4P B;  5C0X J;  4DR1 L;  1SLJ A;  4PMC A;  3K59 A;  2B2U C;  2YTX A;  2XSC A;  1K28 A;  4X62 Q;  3I56 A;  1D2B A;  4IFD G;  5M3F H;  3OSO A;  1IW7 D;  3H91 A;  1MJC A;  3E0J A;  4JI8 Q;  5FLM H;  1CK1 A;  1U5K A;  5JVG 3;  4IN3 A;  1JC7 A;  1UE6 A;  1EZ6 A;  2MP1 A;  4IUU A;  3JC6 6;  1PH1 A;  1GKH A;  2R92 B;  1RF2 D;  4XQN A;  1LT3 D;  1V8Q A;  2JN4 A;  1NNX A;  1Z9F A;  2DNC A;  1SYG A;  3MEH A;  1PH7 A;  1HR0 L;  3SK8 A;  2PQA A;  3OYY A;  5FJ8 H;  5KGU A;  4CKE A;  3DWA A;  1TWG H;  2PI2 E;  1ILQ A;  3GTO B;  1SFO B;  4JOI C;  4QIW E;  4HIO A;  4FF4 A;  1ZYR C;  1QG7 A;  3FPP A;  4H7B A;  4DK0 A;  4QIW B;  4O1N A;  4KLK A;  1V1P B;  1JE5 A;  1GUG A;  2NN6 I;  3HKZ G;  3I70 A;  5IOC A;  1IYV A;  1TS2 A;  2O4X A;  1G2T A;  4UHV A;  3MA2 B;  4A3M H;  3SGI A;  2IPK D;  2IHF A;  3KLR A;  1YIT A;  2F0I A;  2E5L L;  4BXX G;  5KYI A;  3EJI A;  4JI7 L;  3QWN A;  2B2V A;  1YJN A;  1HUN A;  1FNV A;  3ERQ A;  1EOV A;  3UDI A;  5C4J H;  1YIJ A;  4P75 A;  3I72 A;  4LAA A;  3RZD B;  4C1N K;  1KDB A;  3TME A;  1LTT D;  1PFS A;  1IBL Q;  2NUC A;  4LF5 L;  3S1M H;  1TWF H;  4AYB B;  2BE5 C;  3EBE A;  4JI8 L;  2QEJ C;  3GTM H;  1EOT A;  2WB1 G;  3TN2 A;  4GKK Q;  1JOR A;  4H44 C;  1VQ4 A;  1M1K C;  1CZG A;  4GLA C;  1HXY D;  2ZJP A;  1VMP A;  4DKA C;  5A35 A;  3K7U C;  4L5Q A;  3PO2 G;  1IHZ A;  4B3R Q;  4HIM A;  4A4I A;  2DY7 A;  5LHY 1;  3GTP B;  2X6G A;  2EYL A;  3T56 B;  1HZB A;  1HR0 Q;  1B3A A;  1B7Y B;  1NE3 A;  4G4K A;  3QO2 A;  1AN8 A;  5C0X H;  1E2V A;  4GN4 B;  2I5H A;  5IWA Q;  1OXT A;  4K5X A;  4DUY Q;  1I6H H;  4OWX B;  1EY9 A;  3AMU A;  3L9A X;  3OWF A;  4PV1 C;  3TZD A;  1H95 A;  4LFA Q;  4DR5 L;  3CCE A;  1AE2 A;  1VQM A;  1B50 A;  3VYR A;  1OXV A;  4P74 A;  2EYO A;  4ZKC B;  5DAU A;  4MTN A;  2JQO A;  3I90 A;  3T1H Q;  4FF1 A;  1RDP D;  4R4I A;  3BZK A;  3HS0 C;  3PIP A;  2KCC A;  2NWG A;  5IYD G;  4NXM Q;  2EJF C;  4XT3 B;  1Y8O B;  3KBG A;  1HNX Q;  2QKI C;  3TBI B;  2UXC L;  2AHO B;  4DV6 Q;  4KJN A;  5JAV A;  5J22 A;  4JI3 Q;  1I3Q B;  3VYU A;  3BVZ A;  2HDL A;  4DK1 A;  2K5H A;  4LF5 Q;  2CH4 A;  3DM3 A;  2K6A A;  1I4X A;  3I55 A;  3TSS A;  2V4D A;  2F4V L;  1LLR D;  4ODG A;  2YTY A;  4AQY Q;  4KJO A;  4LW1 A;  4DV1 L;  4DV2 L;  3CPF A;  4C3I B;  2FHT A;  4OON A;  1EQT A;  1QJO A;  1ZXT A;  2KHJ A;  3S1R B;  3P7J A;  3FDT A;  3C2P A;  3J7A F;  1K83 B;  3FP9 A;  1TY2 A;  1GO3 E;  1MIU A;  1K3R A;  1Y1W H;  1YHQ A;  1WOC A;  1I4R A;  3VA5 A;  3U4Z A;  2K28 A;  4FXD A;  2KHI A;  3P75 A;  1Q12 A;  1VQ9 A;  1E22 A;  1F9P A;  1F2L A;  4DNR B;  4JI6 L;  1O7L A;  1QIL A;  4R8I A;  3J80 L;  4X3U A;  1QUQ A;  4K2L A;  5A2Q L;  3UI2 A;  4HJ5 A;  1VF7 A;  1IYJ B;  1CT1 D;  4X6A H;  1E0B A;  4YY3 Q;  3OIQ A;  2Y0S G;  4NXM L;  1PDQ A;  2XWJ B;  3D6W A;  5GAE C;  4DV6 L;  1WTO A;  1FYC A;  4IUP A;  1EZ8 A;  2C9O A;  2YU9 B;  1SYC A;  5JPN C;  3SK6 A;  5C4X B;  1TY0 A;  3A54 A;  5CV4 A;  4LF8 L;  1O7Y A;  2EY6 A;  1VQN A;  4AYB E;  4X66 L;  1SRU A;  5C3E H;  5IT9 E;  1GUW A;  1XWE A;  2YYZ A;  1BNZ A;  3AB9 A;  3MAQ A;  5EAY A;  4JI2 Q;  1V43 A;  1C48 A;  1HR0 W;  3QG1 A;  4M1U B;  5AJ3 Q;  5C3X A;  2XWB B;  1CFM A;  1VQJ A;  2CH4 W;  1TWA H;  2RKS A;  1G91 A;  1XJV A;  2NN6 G;  2FIN B;  2WAC A;  1FGU A;  1ZEQ X;  1VQE A;  4A3K H;  4IFD J;  3W1B A;  1VQO A;  3K58 A;  2B2T A;  1XNQ L;  1K8M A;  2EYP A;  4GNX A;  3VA7 A;  4ID6 A;  4DR4 Q;  4JI6 Q;  2AQ3 B;  4UPA A;  5ELD A;  3GQB A;  3TEH B;  2PPB C;  1A2T A;  1JQY D;  2OTJ A;  1FJG L;  1BBU A;  4HIK A;  5E1F A;  4YY3 L;  4C3H H;  4NMZ A;  4DV3 L;  2ATW A;  1C0A A;  4DR7 Q;  2X6L A;  3HG9 A;  2BE5 D;  3TP6 A;  1WTR A;  4X3K A;  1ESR A;  2NVT H;  2JA5 G;  3I3C A;  3HOV H;  5IYD H;  2CW0 C;  1ENC A;  2PW5 A;  1X3G A;  4DUZ L;  1Y1V G;  4X62 L;  3F2D A;  2OQ0 A;  3MEF A;  5A2Q E;  3E9I A;  3K5M A;  3UDG A;  1CA6 A;  2UUC Q;  3GTM B;  2X69 A;  1I4H A;  4FXK C;  5F2D A;  1HPC A;  3PUZ A;  4ILW A;  4KTA A;  1JE4 A;  4IOC A;  1EL0 A;  1SYB A;  2N49 A;  4HJA A;  5J1Z A;  1TR5 A;  3K7A H;  5C4J B;  2F0E A;  1PRT D;  3ND9 A;  2E76 C;  2MHV A;  4TQU S;  4RCO A;  4DGZ A;  1QE6 A;  3VR4 A;  2WP8 J;  3HKZ E;  2D62 A;  4IPG A;  4EQN A;  1H9J A;  3G4S A;  3MFY A;  1GXD C;  5M5Y B;  3GTG H;  1STN A;  1Q81 C;  1NMG A;  1XPU A;  3K5N A;  2NBF A;  1LO5 D;  1B53 A;  3GO5 A;  1D5M C;  4KV6 A;  4TRD A;  3BZD B;  2F1M A;  4KKT A;  4N9T A;  1BR9 A;  5EQ0 A;  3H3V I;  3KBX A;  2Z4H A;  4JI0 L;  4FXG C;  3A0J A;  4CDD C;  4QL5 A;  1LYL A;  4DFA A;  4XQJ A;  5IYC G;  4DV3 Q;  1TS3 A;  1I94 Q;  3NBI A;  2BOS A;  5D3I B;  5EKI A;  3HGB A;  1SFO H;  2L1B A;  5T1G A;  1PVO A;  4R4Q A;  1VS0 A;  4KHV A;  1U4L A;  1WTW A;  2B2W C;  1Z7T A;  1N9W A;  3J7A V;  1S4Z A;  4UP7 A;  1AZQ A;  3S17 B;  1J8I A;  1XX8 A;  2Q2I A;  1SN8 A;  1CKM A;  1D5X C;  1A8V A;  4RKL A;  4DK3 C;  2QDB A;  3IAY A;  3OTO L;  2OQK A;  5D3D A;  3R2T A;  3PIO 3;  1A0I A;  2B63 B;  1SRO A;  1K73 C;  2Z6K C;  2K04 A;  3FKI G;  3WOF A;  4A3J H;  3AEV A;  4A3B B;  2RDG A;  4B3R L;  4ZAI A;  3PUW A;  1CQF A;  2F0M A;  1F9Q A;  5IGF A;  1EYG A;  3S1N H;  3J7Z C;  2HT1 A;  1PFN A;  5CR3 A;  5IGE A;  5IWA L;  3WDN A;  5FJ8 G;  5IP9 H;  3FKI B;  4A3B G;  3TZU A;  1Y1V B;  1II3 A;  2PCF B;  1GJX A;  3CCL A;  4IFD I;  1Q8I A;  5T1I A;  1AH9 A;  4A76 A;  3VR5 A;  1VQP A;  1VQ8 A;  4A3I H;  1ONL A;  1HTL D;  4BBS G;  4KHZ A;  2XTI A;  3K5L A;  4M8A A;  1HFN A;  3PIO A;  2B8G A;  2D0O A;  4C3H B;  1Q7Y C;  4DPG A;  3RN2 A;  1QNU A;  2ZTE A;  5ELC A;  1F9R A;  1RTO A;  1RL2 A;  4F7X A;  1DYQ A;  1KLU D;  1X3Q A;  2F0G A;  1JT8 A;  4P72 A;  4RHR A;  4B3T L;  2PO4 A;  5C44 B;  3HKS A;  3W1G A;  4WOR A;  5D65 A;  1PZI D;  4X65 L;  1ASY A;  5HGT A;  2I0Q A;  5EKK A;  4EQO A;  2JA6 H;  3WOE A;  4X3T A;  2R92 G;  1JOQ A;  1U4R A;  1UE5 A;  1H9S A;  5BN3 A;  3LNN A;  5COR A;  1PH3 A;  4KKS A;  3GTP H;  4Y7N H;  1SE4 A;  3M4O B;  4DAP A;  2UU9 Q;  5KEE A;  1X9N A;  4XQQ A;  1C8C A;  2UUA Q;  1RHP A;  4KN4 C;  3I91 A;  5C4X G;  1PRT F;  4G7Z C;  1QCB D;  3P20 A;  1TWF B;  3LWU A;  1K9M C;  4WJW A;  3M85 A;  3OMG A;  1E3P A;  3BYT B;  4BWG B;  2ASB A;  1CSQ A;  2PI2 A;  2R3Z A;  3X3N A;  2Y0S E;  2EXD A;  3ZJY C;  4J15 A;  4B9X A;  2CVR A;  2K5Q A;  3ERS X;  1N34 Q;  3KLS A;  1L1O B;  3EIV A;  2K52 A;  3A7L A;  2JYO A;  4G7H C;  4ZLT F;  4QF4 A;  1PYB A;  3G7L A;  4TSS A;  4AYB G;  4E6I A;  5FLX c;  4X65 Q;  3I4M G;  4A3D H;  3M7G A;  4U68 A;  4CJ1 B;  1UEA B;  2Q2T A;  1GUS A;  1F77 A;  4IPH A;  1EU3 A;  1CKN A;  1IKL A;  2DNE A;  3S1R H;  3NSW A;  4JOI A;  3GTO H;  2GA4 B;  2B39 A;  3HOX B;  4HAE A;  4JC0 A;  4BXX H;  1VQL A;  3M7N A;  4FYD A;  3I4M B;  5FO8 B;  1EIY B;  1UNS A;  1QWY A;  2HQE A;  4GN3 B;  5JJI A;  4LFB L;  4BBS H;  1ZYR D;  4DV7 Q;  1OO9 B;  2CQA A;  3K81 C;  2VQF L;  3NP8 A;  1PLF A;  2DJG C;  4PG3 A;  3T1Y Q;  2MJ8 A;  2RSN A;  2XGT A;  3A5Z B;  3BDL A;  1YBY A;  3KLS X;  4I7A A;  1BOS A;  4V19 0;  3HFZ B;  1STA A;  3ITP A;  2ZJR A;  3H0G H;  2N8N A;  3CRL C;  4QJF A;  3QR8 A;  4JW0 A;  5C3E G;  4LF6 L;  3ULJ A;  3M9B A;  1GOZ A;  4FNF A;  2K5N A;  1R4Q B;  1EFW A;  1SMX A;  1FJG Q;  4DA2 A;  3GTJ H;  2OXP A;  1DXM A;  1LTB D;  2NVY B;  1Y1W B;  4NKL A;  1FGB D;  5CBA E;  3CC4 A;  5I2X A;  3BS1 A;  2QF7 A;  4LNQ A;  2YV5 A;  4NDX A;  4GLX A;  3CQZ B;  1H9S B;  4BBR B;  4NP5 A;  2A6H C;  1IXR A;  4KK7 A;  1A3U A;  3NHH A;  1G6Z A;  5M5X B;  3OOC A;  1OXU A;  1GVP A;  1UE7 A;  2CWP A;  1B9M A;  2CCZ A;  2L9H A;  1A3T A;  2WV6 D;  1L2F A;  1A3V A;  3M4O H;  4A3D B;  2BDO A;  3S14 B;  3OWE B;  5ELN A;  2VB2 X;  1A63 A;  4CDF C;  5C44 G;  4DNI A;  3C46 A;  1I3Q H;  3Q23 A;  5G3L D;  1TU2 B;  3W2D A;  1WVL A;  5IOD A;  1VQA A;  2YTV A;  1OTC A;  3T1Y L;  4R4C A;  2K1B A;  4K14 A;  4LWC A;  3V2T A;  3H0G G;  3IKJ A;  3VDY A;  2EDG A;  2PQA B;  5JOB A;  4NXN L;  1KDC A;  2MO1 A;  3GDE A;  2Q8R E;  3Q8D A;  2KHS A;  2F0F A;  1CHQ D;  3NE5 B;  1AW7 A;  1Q1B A;  3GV3 A;  3STB D;  2K75 A;  3VR6 A;  3NUC A;  4A3M B;  2QW7 A;  2KCT A;  2PZT A;  2RDH A;  4OEL B;  1TWC B;  3HOW B;  1D7Q A;  3CQZ H;  1JCK B;  4PMW A;  4JCV E;  1B4O A;  2NZO A;  1KAA A;  4RCN A;  3PF4 A;  2ICI A;  2HDM A;  1NSN S;  1KQS A;  1O80 A;  1SMY D;  3L0O A;  3ULL A;  4JV5 Q;  3RUZ A;  3PO3 B;  2A19 A;  5C4Z A;  2F0S A;  3EFX D;  3CXC A;  1WCM B;  2I07 B;  1VQG A;  4HSP A;  3H09 A;  3PO3 G;  3EVQ A;  3DWP A;  2NB0 A;  3HOZ H;  1YNX A;  3RZO B;  3ZYY X;  1EU4 A;  1RJT A;  1WYD A;  1V1O A;  4HMI A;  4L6T B;  4DAM A;  1VQI A;  2BCO A;  4FF3 A;  3KLW A;  2F0L A;  1G6P A;  3F2C A;  1RCV D;  3T4A C;  4DR2 Q;  5DLQ E;  2XRQ D;  5IIF A;  1FNW A;  3AU7 A;  3S17 H;  4OEM B;  5M9O A;  3HOV G;  3HOV B;  5C4X H;  2B2W A;  4A3F G;  3KDF A;  2EIF A;  2F0T A;  4A3E G;  2B3G A;  4LUO A;  1SR3 A;  1G29 1;  3HOX H;  1KC8 C;  1Q90 A;  1HUM A;  1R9T B;  4OX9 Q;  4DV4 Q;  2NVY H;  5TSS A;  2G9H D;  1ZKO A;  3K57 A;  3K8A A;  1EIG A;  2AMC B;  3G6J B;  2KA7 A;  4DR3 L;  1JB3 A;  2Z6B A;  4GS3 A;  4RGM A;  5FK9 C;  5CC4 A;  1PZJ D;  2XNA C;  3A56 A;  4B3T Q;  1CKO A;  4Q0F A;  4PNY A;  4F88 A;  3A8K E;  2A8V A;  4A3L H;  3TDQ A;  2SNM A;  4O2D A;  4A3J B;  1CA5 A;  4A3B H;  1EYD A;  2LKV A;  1JR0 D;  5FLX L;  5CV8 A;  2D9U A;  1K0R A;  1MGS A;  4HCE A;  2K14 A;  1TS4 A;  4K6L A;  2A69 D;  4QUC A;  3S16 B;  1EIH A;  4BBR G;  5GAG C;  1PZK D;  3R8B A;  4A3M G;  3HOY H;  4F87 A;  5EJW A;  5L37 A;  1VQ6 A;  1VQC A;  1JJ2 A;  4R4T A;  5EPJ A;  1S5B D;  2K4K A;  2PMZ B;  3ONA B;  3JAM E;  2K05 A;  5ELB A;  3NWS A;  1LM0 A;  3PUX A;  1CZW A;  2O5I C;  3KFU A;  1JWS D;  2JSO A;  2NZ1 D;  5DM6 3;  1T5E A;  2K7V A;  4BY1 B;  2K01 A;  2KCM A;  1HQR D;  3U50 C;  4HJ7 A;  3S24 A;  1G8Z D;  1J5E L;  1KDA A;  2RCN A;  2A6H D;  1QOH A;  2A68 D;  2TSS A;  3CHB D;  2WKC A;  2BA0 A;  4ZKB B;  1MJE A;  1PH5 A;  3S1Q B;  3T13 A;  2WFW A;  2E8G A;  2D0P A;  4FVM A;  2BA1 A;  4HJ9 A;  3SR1 A;  1KL9 A;  4A3F B;  2ZXO A;  3GTK H;  1K83 H;  4L5R C;  2H1E A;  1PYW D;  1UAP A;  2J4X A;  2VY3 A;  2OT2 A;  2EY2 A;  1K0S A;  2F0U A;  4NW2 A;  2A1A A;  3J81 L;  2K50 A;  1F2Z A;  1HNX L;  2UXC Q;  4ZUJ A;  2XRS D;  3IRB A;  2R7F A;  5KIX A;  1FL0 A;  5IP7 G;  4LF4 Q;  3RNU A;  3KDF B;  4GNX B;  5M3M G;  3D4R A;  4WJ4 A;  2PYK A;  2HIX A;  1U0L A;  1MD2 D;  2AQ1 B;  3A74 A;  4KY7 A;  1Q1E A;  4XIG S;  4QCL A;  3QIA A;  1PTO H;  4GZY C;  2WB1 B;  3PF5 A;  4XDX A;  3NEL A;  5DEH A;  2B63 H;  2SEB D;  4J8Q A;  1VQF A;  4A93 H;  3KF6 A;  3HOZ B;  3S1Q H;  2D2C C;  2Z9H A;  2R93 H;  5CV5 A;  1XMO L;  4IUN A;  3MXG A;  3BYY B;  1YNN D;  2KBN A;  3ND8 A;  4C2M B;  4LF7 Q;  3MVV A;  3GTQ H;  4ABN A;  1LTG D;  5BN4 A;  3CCQ A;  1C4Q A;  3NQI A;  4QGU A;  3M4Y A;  3ERO A;  2R93 B;  1QB5 D;  1TT2 A;  1JOO A;  4DAY B;  1EQQ A;  4BY1 H;  4K8I A;  1W3S A;  1E1T A;  3HP3 A;  3BDC A;  2Z0S A;  1BBX C;  2M00 A;  1LT6 D;  2VUM H;  4ZUI A;  4P2C B;  2JA8 H;  4OWT B;  1SYF A;  1C7Y A;  4KI0 A;  4JI4 L;  4FDB A;  2L4N A;  3PSI A;  3K5O A;  1KLG D;  3NEM A;  5IGG A;  2WAQ B;  1V1P A;  1VCI A;  4IUT A;  1U4M A;  2R92 H;  1BQQ T;  1A2U A;  2JA6 B;  1SEB D;  4DR6 Q;  4LF8 Q;  2IX3 A;  2E2D C;  5E4X A;  4RFB A;  4BA2 I;  2JA6 G;  5E4W C;  1V9P A;  2ALY B;  5NUC A;  2F52 A;  3QJY A;  3OW2 A;  2EQS A;  4QY7 A;  3J7Y W;  1ENA A;  5IGB A;  3GTQ B;  1KXL A;  2E2J H;  4I65 A;  5J3B A;  1AE3 A;  3I4N B;  1XMO Q;  2J7Z A;  5GRO A;  1X54 A;  2PMZ E;  3D4W A;  4YWK A;  1SSO A;  3W3A A;  3CF5 A;  3FEW X;  5EGT A;  1ENF A;  1CI3 M;  1B44 D;  1PRT B;  2N55 A;  1QZG A;  4IFD H;  3J80 c;  2XN9 C;  4AIM A;  4HID A;  4MTK A;  4Q5V A;  1AP0 A;  3OHX C;  2F3W A;  2A69 C;  5IP7 H;  2FMC A;  1BBW A;  2I46 A;  5JJK A;  2V1C C;  1KAW A;  5JEA G;  2F03 A;  1IBM L;  2B2V C;  4WJ3 M;  2N78 A;  3L7Z C;  1U4P A;  4JI7 Q;  1FD7 D;  4QB4 A;  1FNU A;  2QGQ A;  2CQO A;  4XTC S;  5IY0 A;  4ZYS A;  1EQR A;  1A15 A;  4CKC A;  1EUJ A;  2HCC A;  1N32 L;  4MN3 A;  1HNZ Q;  2DJF C;  1YI2 A;  4DR6 L;  1NJI C;  3LWE A;  4BS9 A;  3E9H A;  2WIN B;  4G57 A;  4JYA L;  1F2M A;  2VNU D;  4DR2 L;  1SYE A;  3Q0A A;  2PNR C;  3HOU G;  1VQK A;  1S40 A;  3CU7 A;  3CCM A;  2K5V A;  1E24 A;  4FP5 D;  4B3M L;  3JAM i;  1TWH H;  1STB A;  2Q2U A;  1XNR Q;  3RR5 A;  1HH2 P;  3E5S A;  3O13 A;  2JA8 B;  1E2Z A;  1EIF A;  4KMU C;  1PRT C;  3VYS A;  4BBR H;  2I5L X;  5JEA J;  4POG A;  3GTG B;  1R9T H;  2HHH Q;  4DXG A;  4DR5 Q;  3X3M A;  4LUV A;  1I5F A;  2LY7 A;  1KNE A;  2VXW A;  4RWS C;  3WWV A;  1Y14 B;  2GVB A;  2RQX A;  2AKW B;  2XVS A;  1Y69 U;  3NBH B;  2NVX H;  3J81 E;  1TQO A;  2L11 A;  4Y52 H;  2E2J B;  1MI2 A;  1DM0 B;  2ZTD A;  2VUM G;  2F0O A;  2JA9 A;  3TS0 A;  3I4O A;  2JA5 B;  1J9O A;  4RAU C;  4RGO S;  1DGS A;  2NYZ D;  2CWA A;  3VYT A;  1GUN A;  4JYA Q;  1H9M A;  1Y8N B;  2G9D A;  1N8R C;  4YCV A;  4H02 A;  1W6K A;  4R9W A;  4A3E H;  4LMQ D;  5CV7 A;  2OWO A;  3VR3 A;  1CM9 A;  3I4M H;  4A3D G;  1YNN C;  4B3M Q;  1F2Y A;  1JJG A;  4KKU A;  1HA5 A;  1NMF A;  4CDC C;  4KY5 A;  4IOA A;  3U9O A;  1Q3L A;  1IZ6 A;  3DUZ A;  3PO2 H;  2UUB Q;  1F9S A;  3K6O A;  4UAI A;  3U4V A;  5IYB H;  2WAQ G;  2B29 A;  5JVH 3;  5M5Y H;  2FMM A;  3CD6 A;  3PUV A;  3C3L A;  2JA7 G;  4LF9 L;  5HY6 A;  4OIK A;  3J81 i;  4ALP A;  3NBH A;  4C3J B;  5FLX E;  1B3Q A;  3V05 A;  2EYJ A;  1D6E C;  1N33 L;  4LF4 L;  2F0W A;  4MHE A;  3D8G A;  2E2I B;  1IBL L;  2OCE A;  2B63 G;  1WCM G;  1NR4 A;  3TS2 A;  3H3V C;  1DCZ A;  3E0E A;  5EBD A;  4DV0 L;  1S72 A;  1KRT A;  1RIP A;  3S1N B;  3CCJ A;  2EJM A;  4EQP A;  1DJR D;  5EKL A;  1YJ9 A;  3P1H A;  3PCO B;  3BZC A;  3URY A;  4CDE C;  1X56 A;  4A3G G;  4JI2 L;  2MO0 A;  4B08 A;  5AJ3 L;  1QUQ B;  1UE1 A;  2VQE L;  2EYH A;  5KYL A;  4J1M A;  1EWI A;  1XTD A;  2JK8 A;  4IUV A;  4DUY L;  4UP9 A;  3GTK B;  3NTH A;  1Z6H A;  4XYO A;  2RA4 A;  5C44 H;  2OTL A;  4K8J A;  2TMP A;  2IT1 A;  4LF7 L;  2F3V A;  1XXG A;  4F8M A;  3M3Y B;  3C1F A;  4HJ8 A;  2E2H B;  1ROD A;  1X55 A;  1SJH D;  2NVQ H;  1W2B A;  4KHP L;  4ZRZ A;  1MSH A;  4ZCK A;  2EOT A;  1WTQ A;  1WTP A;  1T9H A;  1TWA B;  1I50 B;  1BCP D;  2IL8 A;  3RN5 A;  1EY8 A;  4A3G H;  1CKN B;  1HZC A;  5C4H A;  5ELO A;  2L0C A;  1I4P A;  3TP8 A;  1IL2 A;  1Q82 C;  4JI4 Q;  2PQE A;  1X32 A;  2HD3 A;  1O7I A;  2GN5 A;  1YHB A;  3K80 C;  2RVL A;  5IYC H;  1EY0 A;  1WD1 A;  1PA6 A;  2NTS A;  3FKI H;  4A3J G;  5FKA C;  3GD7 A;  3R2I A;  4XT1 B;  1YZ6 A;  2Z4I A;  3OW7 A;  1L0Y B;  1X6O A;  3NPP A;  5HUR A;  4ME5 A;  1SNO A;  4ULL A;  2VUM B;  3Q6S A;  4APV A;  2IX1 A;  3HOY B;  1MKH A;  1KIX A;  3CC7 A;  4IPD A;  4HMJ A;  4DV1 Q;  4DV2 Q;  1JWM D;  2YU9 H;  1ASZ A;  4JBK A;  1EY5 A;  4RA8 A;  3K0Y A;  1O7Z A;  4Z9C B;  3HOY G;  1Y1W G;  1LTA D;  2KVM A;  1OXS C;  4DV7 L;  1X3F A;  3TP7 A;  1DOM A;  1BDO A;  1GHJ A;  3M4P A;  2NVX B;  1K8O A;  1Q86 C;  4KY6 A;  2F0K A;  1LTS D;  1PTO F;  4B3S Q;  5J39 A;  4H13 C;  2NVQ B;  2NTT A;  1PMR A;  4P71 A;  2BH2 A;  5CV6 A;  4K0K L;  3MC0 B;  2FFK B;  2RF4 A;  1DON A;  2AWO A;  2PNH A;  1KTK A;  1STE A;  1UEB A;  5IT9 c;  3SDZ A;  1GHK A;  1PTO B;  3CP0 A;  1Y1V H;  4U67 3;  2MUY A;  2XIW A;  1BCP B;  3KF8 A;  4C3I G;  1I94 L;  2JA8 G;  1HNW Q;  4PZ8 A;  2PZW A;  3HOU B;  1SDF A;  1BO0 A;  4DF7 A;  4DR1 Q;  1EYA A;  1T5X D;  1CQV A;  2MGS A;  3HOX G;  3H3V H;  1DOK A;  1GUT A;  4RG1 A;  3TP5 A;  4HTH A;  1N32 Q;  3MZ5 A;  1G2S A;  5I4D A;  2JA7 H;  2R7Z B;  2RDF A;  3F1Z A;  3OMC A;  1PH4 A;  4A3C H;  3BVM A;  3MFG A;  4A75 A;  1LTR D;  3TQY A;  3S9W A;  2OEO A;  1WTX A;  2E2I H;  3R3O A;  4LUZ A;  3NXW A;  3MXU A;  1HQM C;  3HOZ G;  1HTP A;  4YCW A;  4CJ0 B;  4UY8 C;  1SNP A;  1PFB A;  2JEB I;  1PXU A;  1QVG A;  2JA5 H;  3SHL A;  3EA6 A;  5ELF A;  4EVO A;  1AFP A;  3NQT A;  2IHE A;  2CHB D;  2I5M X;  2KEN A;  2MNA A;  1SBB B;  3NWT A;  3ICE A;  2LXK A;  2F0H A;  3FPU B;  3MXN A;  3Q22 A;  4GKJ L;  3AFQ A;  1BKB A;  5GQO A;  1PTO C;  1B2T A;  1Y8P B;  4CGY B;  2Z8L A;  2Q8I B;  1QNK A;  1N36 L;  2DGY A;  2IWH A;  1PH2 A;  3J7A 5;  4JG2 A;  2KJX A;  5E3F A;  4CKB A;  1EY4 A;  4DR7 L;  1EEI D;  2A73 B;  3CKI B;  1TWG B;  2F0P A;  3UDF A;  1D1K A;  1D8L A;  2KCN A;  4DUZ Q;  2K5W A;  3IFT A;  2UUC L;  4JV5 L;  5IP9 G;  4JPB W;  4OIJ A;  2EE1 A;  4KN7 C;  4AH6 A;  3I4L A;  1B9N A;  1J6Q A;  4GKK L;  3I2Z A;  1SMY C;  1GM5 A;  1LAB A;  1KAB A;  1XTC D;  3J80 E;  3KUP A;  4K5W A;  5CGK A;  4RMF A;  1HCZ A;  2EXZ A;  4K2K A;  4RGN A;  2QCP X;  4KD4 A;  3RZO H;  1RKN A;  3DXJ C;  3UDX A;  4P73 A;  3V96 A;  4IZ8 A;  3DLL A;  1DD2 A;  1VQH A;  2UU9 L;  3S14 H;  4OWW B;  1CHP D;  2ZM6 L;  3N6R A;  2WAQ E;  3I4N G;  3H6M A;  3OIP A;  2ZXP A;  3PV0 A;  2MPM A;  3UE1 A;  3JAM c;  2DY8 A;  2O5J C;  4WFN 3;  3JAM L;  4EGV A;  1BCP C;  5M5X H;  2SOB A;  4LFA L;  2NVT B;  3RMH A;  1STG A;  4O0A A;  3BVG A;  1Z47 A;  3KJO A;  1G51 A;  1TWC H;  3HOW H;  1RD9 D;  2B8F A;  3H94 A;  4A3K B;  2K5D A;  2RSO A;  4C56 C;  4LF9 Q;  4DV4 L;  1YNJ D;  3T1H L;  1N34 L;  4IJL A;  1CUK A;  1SXT A;  2AWN A;  2ZJQ A;  1IBK L;  3TRZ A;  1MBY A;  2IX0 A;  2MQH A;  4XXE A;  4GOP A;  3R93 A;  4JI3 L;  1VMC A;  2R7D A;  1TVX A;  5GAD C;  2VW9 A;  5FOB B;  3M3Y H;  3U58 A;  4N8X 1;  4RKB A;  1XYI A;  3F2B A;  2C35 B;  3QB3 A;  3S2D H;  3KF8 B;  4ME3 A;  3FMC A;  2IW3 A;  2C5C A;  1I6H B;  2EY5 A;  1RTN A;  5IT9 L;  4TKO B;  2LXJ A;  2OF1 A;  3DEO A;  1SNQ A;  4BY7 H;  1MSG A;  4J6H A;  2ZXR A;  1UWV A;  1KHI A;  1LT5 D;  5M5W B;  1PV4 A;  1TS5 A;  3AQQ A;  4LFB Q;  3IL8 A;  1W6J A;  2VQE Q;  5AFW A;  4HED A;  2ZM6 Q;  2VQF Q;  4GN5 A;  1AZP A;  5IGC A;  2JE6 I;  4IUR A;  2KEC A;  1IW7 C;  2R61 A;  1V1Q A;  2A5H A;  3PGZ A;  5LMN Q;  1WJJ A;  4A3F H;  2HQL A;  4PQX A;  2F0D A;  2DN8 A;  4LF6 Q;  3HRZ C;  3QOL A;  2IY5 B;  4PMB A;  3DM1 A;  3F8T A;  4C3H G;  3GTL H;  1S3O A;  3DEP A;  1B70 B;  4FF2 A;  1B1Z A;  4YWL A;  2B2Y C;  2L15 A;  4KD3 A;  2KQ3 A;  1HJP A;  5LL6 S;  5KNC A;  1DOL A;  3H15 A;  1JJC B;  1NAP A;  1IBK Q;  3GTL B;  2F0Q A;  4A93 G;  2JEA I;  3VR2 A;  1JWU D;  1L1O C;  1B8A A;  2A68 C;  1SAP A;  3D4D A;  1WFQ A;  1QVF A;  3S15 H;  4OO1 H;  3PUY A;  5C0X G;  4C3I H;  2ZTC A;  4A3I B;  2GVA A;  4GOP B;  4JK1 C;  3BDO A;  4YHH L;  3J81 j;  1EWC A;  1ICF B;  4R1J A;  1Q46 A;  2RCF A;  3PQI A;  1YEZ A;  4YWM A;  1ESF A;  4PZ7 A;  5CBE E;  4X66 Q;  4BBS B;  1EY6 A;  3MWY W;  5CV9 A;  3SK4 A;  1P16 A;  1TII D;  3HOW G;  1I4G A;  1WTV A;  1LT4 D;  3S16 H;  2H5X A;  2ENB A;  4I7Z C;  1XPO A;  2K03 A;  4IAL A;  5JPM C;  2QIL A;  1NBW A;  1D1I A;  2KOL A;  1O78 A;  1PTO D;  4R8N A;  2ZT9 C;  5LMN L;  1EYC A;  3QOJ A;  2Q8T A;  1XNQ Q;  4YCU A;  4K0K Q;  5KNB A;  4DR4 L;  2RHQ B;  5GAH C;  4NXN Q;  5C5M A;  2QDL A;  1KNA A;  3RLO A;  3SE0 A;  1VDZ A;  1PH6 A;  2H4O A;  2HCI A;  2Z6K A;  4QUF A;  1TKW B;  3L2P A;  3FRP B;  2CW0 D;  5EPL A;  5FLM G;  2SNS A;  3NTK A;  3SK5 A;  5H1S E;  1FVI A;  3KK7 A;  5LL6 X;  1C9O A;  3AFP A;  3PO2 B;  2A6E C;  3NEN A;  4YHH Q;  4A3E B;  2VB3 X;  1JMC A;  2FXQ A;  4OL7 A;  1H9R A;  2R7Z G;  3KJP A;  2EVB A;  4N9P A;  5I9P A;  1TXY A;  2F0V A;  3KOJ A;  1EWH A;  3BJU A;  1X65 A;  2CFM A;  3DWQ A;  5M3M B;  3Q24 A;  3M4Q A;  1HRJ A;  5I6Y A;  4A3G B;  1WCM H;  1WTH A;  3HZX A;  1XMQ L;  1SYD A;  1SE3 A;  4HR7 B;  1LV9 A;  3MHB A;  2EYF A;  2EPB A;  3NK9 A;  1NTG A;  1YNJ C;  2EYM A;  2L55 A;  4DV5 Q;  1HFG A;  4DN4 M;  2L5T A;  4GKJ Q;  5E7N A;  1E7Z A;  5BN5 A;  1A6X A;  2JXM B;  2J0T D;  1KRS A;  3SVM A;  2ES2 A;  1N36 Q;  2AUJ D;  4OX9 L;  1A62 A;  1UUP A;  4JI0 Q;  1ET6 A;  2F0J A;  2EZV A;  1VQB A;  1ET9 A;  3GP7 A;  1M90 C;  1QZH A;  3L3O C;  3U9S A;  4S3S A;  4N8F A;  3PIP 3;  4Y7N B;  1OXX K;  3STB C;  5M5W H;  4IPC A;  2LFN A;  4OO1 G;  3KYH C;  1IL8 A;  2EY1 A;  3E3X A;  3NTI A;  1K8A C;  5IGD A;  5LMN W;  2PW7 A;  4NB3 A; 
#chains in the Genus database with same CATH homology
 1Y1W H;  4A3L G;  1VQG A;  1YHQ A;  1WOC A;  5C44 H;  3PO3 G;  2OTL A;  2IT1 A;  3D31 A;  3OTO Q;  4LF7 L;  3U4Z A;  4HJ8 A;  1PHJ A;  3HOZ H;  1VQD A;  1YNX A;  2KHI A;  1X55 A;  1WYD A;  1VQ9 A;  1Q12 A;  1W2B A;  2NVQ H;  4KHP L;  3BU2 A;  1E22 A;  4DAM A;  3RZD H;  4JI6 L;  1VQI A;  3KLW A;  1Q8K A;  3RLF A;  4OO1 I;  1G6P A;  1QUQ A;  3F2C A;  1T9H A;  4HJ5 A;  4DR2 Q;  2MFI A;  1IYJ B;  1HZ9 A;  5DLQ E;  4L5S A;  3PO3 H;  4X6A H;  4YY3 Q;  3RN5 A;  4A3G H;  3S17 H;  1CKN B;  1HZC A;  1LUZ A;  2Y0S G;  3CAM A;  5ELO A;  4NXM L;  1IL2 A;  1PYS B;  3HOV G;  5GAE C;  5C4X H;  4DV6 L;  4DV5 L;  1Q82 C;  4JI4 Q;  3MXN B;  4A3F G;  1O7I A;  4IFD G;  2GN5 A;  1YHB A;  3K80 C;  4GKJ L;  3KDF A;  2EIF A;  4MZ9 A;  4A3E G;  2B3G A;  4LUO A;  1SR3 A;  2HIV A;  1BVS A;  1G29 1;  5IYC H;  3HOX H;  3CPW A;  1KC8 C;  1PA6 A;  1VQ5 A;  1XNR L;  3FKI H;  4A3J G;  3GD7 A;  1YZ6 A;  4LF8 L;  4OX9 Q;  3RLN A;  4DV4 Q;  2NVY H;  1VQN A;  4AYB E;  3A5U A;  3CCR A;  2ID0 A;  1X6O A;  4X66 L;  5C0X I;  3K8A A;  1SRU A;  5LMN W;  2AMC B;  5C3E H;  4APV A;  2IX1 A;  3ER0 A;  1MKH A;  1KIX A;  4DR3 L;  3CC7 A;  4IPD A;  4GS3 A;  2YU9 H;  4DV1 Q;  2YYZ A;  4DV2 Q;  4JBK A;  1ASZ A;  2HHH L;  4B3T Q;  1CKO A;  4MNO A;  4GLV B;  5EAY A;  2A8V A;  1Y1W G;  3HOY G;  4A3L H;  4O2D A;  1V43 A;  4JI2 Q;  1OXS C;  4A3B H;  1HR0 W;  5AJ3 Q;  4DV7 L;  1X3F A;  3AYH B;  2F3I A;  1VQJ A;  1K0R A;  1TWA H;  2E5L Q;  3CC2 A;  1XJV A;  2NN6 G;  3M4P A;  1FGU A;  2K14 A;  1VQE A;  1Q86 C;  4A3K H;  4IFD J;  2CKZ B;  3W1B A;  3G6E A;  4B3S Q;  1VQO A;  1VQ7 A;  1KD1 C;  1XNQ L;  4GNX A;  4P71 A;  4BBR G;  3ULP A;  5GAG C;  4A3M G;  2BH2 A;  5M3M H;  4K0K L;  3HOY H;  4DR4 Q;  2RF4 A;  2AWO A;  2PNH A;  4JI6 Q;  4NPS A;  4UPA A;  1VQ6 A;  1UEB A;  1VQC A;  1JJ2 A;  4R4T A;  5IT9 c;  3TEH B;  2K4K A;  4JI5 Q;  4LFC L;  4POF A;  4DK6 C;  4A3I G;  2UUA L;  2OTJ A;  1FJG L;  4GOP C;  3CP0 A;  1BBU A;  1Y1V H;  4HIK A;  4YY3 L;  2R7Z H;  4BY7 G;  4C3H H;  4DV3 L;  2ATW A;  1C0A A;  1GD7 A;  1I94 L;  1LM0 A;  4DR7 Q;  3PUX A;  2JJQ A;  2JA8 G;  3KFU A;  1HNW Q;  4PZ8 A;  2NVT H;  2WB1 E;  3UE0 A;  4DR1 Q;  2JA5 G;  3HOV H;  5IYD H;  3HOU H;  3HOX G;  4X64 Q;  3H3V H;  4RG1 A;  4DUZ L;  1X3G A;  2VL6 A;  1Y1V G;  2KCM A;  4X62 L;  2OQ0 A;  3MEF A;  1YVC A;  3CW2 C;  3E9I A;  3U50 C;  3F2D A;  4HJ7 A;  2UUC Q;  3S24 A;  4C3J H;  1J5E L;  2JA7 H;  4C2M H;  2RCN A;  3F1Z A;  3PUZ A;  1PH4 A;  4A3C H;  4A75 A;  2BA0 A;  3TQY A;  4KHP Q;  1MJE A;  1I50 H;  2BH8 A;  2UUB L;  1SE8 A;  3CCV A;  4DR3 Q;  1PH5 A;  2E2I H;  5JJL A;  4LUZ A;  2WFW A;  2E8G A;  2DUD A;  4IOC A;  2D0P A;  1MIU A;  3HOZ G;  2BA1 A;  4YCW A;  2N49 A;  4HJ9 A;  4UY8 C;  2JEB I;  4HJA A;  1LTL A;  1KL9 A;  1YJW A;  1QVG A;  3K7A H;  2JA5 H;  3GTK H;  4OXP A;  1K83 H;  3G71 A;  4L5R C;  5K36 G;  4TQU S;  2VY3 A;  3J81 c;  5IE8 A;  2WP8 J;  3HKZ E;  4JI1 L;  2D62 A;  2IHE A;  2A1A A;  2I5M X;  2KEN A;  4IPG A;  2K50 A;  2MNA A;  3G4S A;  1YHA A;  1HNX L;  3ICE A;  2UXC Q;  2LXK A;  3GTG H;  4BA1 I;  4GNX C;  4PZ6 A;  1QVC A;  3IRB A;  2R7F A;  1FL0 A;  5IP7 G;  3AFQ A;  1NMG A;  3RNU A;  1Q81 C;  3UDG A;  4LF4 Q;  1N33 Q;  1XPU A;  1BKB A;  3KDF B;  3GO5 A;  4GNX B;  5GQO A;  5M3M G;  4JBJ A;  4WJ4 A;  4JI5 L;  4LFC Q;  3J7A 5;  2UXB L;  4DV0 Q;  1N36 L;  2DGY A;  4JBW A;  1PH2 A;  3H3V I;  2HIX A;  4JG2 A;  1U0L A;  4L5T A;  3RZO H;  4JI0 L;  2F4V Q;  3A0J A;  3A74 A;  1Q1E A;  4QL5 A;  1LYL A;  4XIG S;  5IYC G;  4DV3 Q;  1I94 Q;  4JBM A;  4DR7 L;  1SFO H;  4AQY L;  4EX5 A;  1WI5 A;  3CCS A;  3PF5 A;  3NEL A;  1NY4 A;  1PVO A;  2B63 H;  3UDF A;  4R4Q A;  1VS0 A;  3I7F A;  4X64 L;  1VQF A;  1D8L A;  4DUZ Q;  1N9W A;  4A93 H;  2LSS A;  3KF6 A;  1L0W A;  2UUC L;  5IP9 G;  4JV5 L;  4UP7 A;  2NZH A;  3S1Q H;  3W5O A;  1J5E Q;  2R93 H;  1XPR A;  2Q2I A;  1SN8 A;  1XMO L;  4AH6 A;  1CKM A;  1J6Q A;  4GKK L;  1A8V A;  1E1O A;  3I2Z A;  4DK3 C;  1GM5 A;  2KBN A;  4EQ5 A;  3OTO L;  4LF7 Q;  2OQK A;  3GTQ H;  4RMF A;  3CCQ A;  4IJH A;  1A0I A;  4QGU A;  5IYB G;  1SRO A;  3FHW A;  3CMA A;  2Z6K C;  1K73 C;  3FKI G;  4DAY B;  4A3J H;  4A3K G;  4IO9 A;  1EQQ A;  4BY1 H;  3AEV A;  3UDX A;  1W3S A;  4P73 A;  4B3R L;  1E1T A;  5HGQ A;  3PUW A;  1P8L A;  3DLL A;  1VQH A;  1JB7 A;  2UU9 L;  3S14 H;  1EYG A;  5BR8 Q;  3J80 i;  2Z0S A;  4OWW B;  3S1N H;  2UXD Q;  4R4O A;  3J7Z C;  2HT1 A;  5IWA L;  2ZM6 L;  2VUM H;  5FJ8 G;  2WAQ E;  4JI1 Q;  5IP9 H;  1IBM Q;  3K0X A;  5LMU L;  2JA8 H;  4OWT B;  3I4N G;  4A3B G;  1X3E A;  3PV0 A;  1PH9 A;  3CCL A;  4IFD I;  3UE1 A;  4BY1 G;  4KI0 A;  1C7Y A;  4JI4 L;  3JAM c;  4FDB A;  1AH9 A;  3CCU A;  4A76 A;  1VQP A;  3PSI A;  4A3I H;  1VQ8 A;  5M5X H;  3CME A;  4LFA L;  4BBS G;  3G48 A;  2N3S A;  3NEM A;  4O0A A;  4KHZ A;  1Z47 A;  3KJO A;  1VCI A;  1G51 A;  3EN2 A;  1TWC H;  2XTI A;  2R92 H;  3HOW H;  1HNZ L;  4DR6 Q;  3PIO A;  2D0O A;  2UXB Q;  1Q7Y C;  4LF8 Q;  4DPG A;  3RN2 A;  4DV4 L;  4LF9 Q;  2ZTE A;  3T1H L;  1N34 L;  4QQB X;  4IJL A;  1CUK A;  2AWN A;  1RL2 A;  2ZJQ A;  1IBK L;  4BA2 I;  2JA6 G;  1XMQ Q;  4A3C G;  1V9P A;  1L1O A;  3TRZ A;  2ALY B;  1CSP A;  2F52 A;  3OW2 A;  2IX0 A;  2MQH A;  1JT8 A;  2EQS A;  4P72 A;  3B6Y A;  4QY7 A;  4GOP A;  1K8G A;  4JI3 L;  2R7D A;  2R93 G;  5GAD C;  2VW9 A;  4B3T L;  3M3Y H;  3KF6 B;  3HKS A;  3W1G A;  3U58 A;  3LGJ A;  1KXL A;  4X65 L;  2E2J H;  3F2B A;  2C35 B;  2Q2H A;  5J3B A;  2E2H H;  3S2D H;  1ASY A;  1AE3 A;  1XMO Q;  3KF8 B;  5GRO A;  2I0Q A;  2R6G A;  2QEX A;  1X54 A;  2PMZ E;  1HZA A;  4ME3 A;  2JA6 H;  4YWK A;  2R92 G;  2LXJ A;  3CF5 A;  4BY7 H;  1UE5 A;  4B3S L;  4UP8 A;  2QA4 A;  1UWV A;  1KHI A;  5M3F G;  1QZG A;  3S2H H;  1PH3 A;  2VZA A;  3GTP H;  2RHS B;  4TVA B;  3TRE A;  3J80 c;  4AIM A;  4Y7N H;  4HID A;  1PV4 A;  2UU9 Q;  3AQQ A;  4LFB Q;  5BR8 L;  2UXD L;  5IP7 H;  1X9N A;  1BBW A;  2VQE Q;  2UUA Q;  5JJK A;  2ZM6 Q;  2V1C C;  1KAW A;  4GN5 A;  5JEA G;  2VQF Q;  1IBM L;  4WJ3 M;  5C4X G;  2N78 A;  5LMU Q;  3L7Z C;  2JE6 I;  4JI7 Q;  3I4N H;  3D0F A;  1V1Q A;  1K9M C;  1HNW L;  3PGZ A;  5LMN Q;  1WJJ A;  2QGQ A;  2CQO A;  4XTC S;  2HQL A;  5IY0 A;  4A3F H;  1PH8 A;  3M85 A;  2VS1 A;  5C0X J;  1EQR A;  1E3P A;  4DR1 L;  1SLJ A;  2YTX A;  4LF6 Q;  2ASB A;  1CSQ A;  2PI2 A;  1EUJ A;  2IY5 B;  3GTL H;  3F8T A;  2Y0S E;  4X62 Q;  1HNZ Q;  1S3O A;  3I56 A;  1N32 L;  1B70 B;  4DR6 L;  4YWL A;  2EXD A;  1YI2 A;  2L15 A;  4J15 A;  3ZJY C;  5M3F H;  1NJI C;  3E9H A;  1HJP A;  3ERS X;  1MJC A;  4JYA L;  2VNU D;  1N34 Q;  4DR2 L;  4JI8 Q;  5FLM H;  3H15 A;  1JJC B;  1L1O B;  3EIV A;  1IBK Q;  2K52 A;  1U5K A;  4A93 G;  3HOU G;  2JEA I;  1VQK A;  1S40 A;  1UE6 A;  1PH1 A;  3CCM A;  2K5V A;  3JC6 6;  1GKH A;  1B8A A;  1L1O C;  1E24 A;  1WFQ A;  1QVF A;  3S15 H;  3PUY A;  1Z9F A;  1PYB A;  5C0X G;  4B3M L;  4C3I H;  4AYB G;  2ZTC A;  5FLX c;  3JAM i;  1TWH H;  2GVA A;  4GOP B;  4X65 Q;  1PH7 A;  1HR0 L;  2PQA A;  3OYY A;  5FJ8 H;  2Q2U A;  1XNR Q;  3RR5 A;  4YHH L;  3J81 j;  3I4M G;  4A3D H;  1HH2 P;  1TWG H;  2PI2 E;  2Q2T A;  4R1J A;  4IPH A;  4JOI C;  1CKN A;  1Q46 A;  1YEZ A;  4QIW E;  4YWM A;  4HIO A;  3S1R H;  4PZ7 A;  4JOI A;  3GTO H;  1EIF A;  4X66 Q;  4JC0 A;  4BXX H;  4BBR H;  1VQL A;  3M7N A;  2I5L X;  5JEA J;  1EIY B;  1P16 A;  4KLK A;  1R9T H;  4POG A;  1JE5 A;  2NN6 I;  3HKZ G;  4DR5 Q;  2HHH Q;  4LUV A;  1I5F A;  3HOW G;  4GN3 B;  5JJI A;  3S16 H;  2H5X A;  4LFB L;  3WWV A;  4BBS H;  1Y14 B;  4DV7 Q;  4A3M H;  1XPO A;  2AKW B;  3K81 C;  2VQF L;  3NBH B;  3SGI A;  2NVX H;  2IHF A;  1YIT A;  1NBW A;  4BXX G;  2E5L L;  4PG3 A;  4Y52 H;  3T1Y Q;  2XGT A;  3A5Z B;  4JI7 L;  1YBY A;  1YJN A;  3HFZ B;  2ZTD A;  5LMN L;  2VUM G;  2ZJR A;  3H0G H;  2N8N A;  2JA9 A;  3TS0 A;  4QJF A;  1EOV A;  3I4O A;  3UDI A;  5C4J H;  1YIJ A;  4P75 A;  1XNQ Q;  4YCU A;  5C3E G;  4LF6 L;  4K0K Q;  1DGS A;  3ULJ A;  4DR4 L;  2RHQ B;  3M9B A;  5GAH C;  4NXN Q;  1PFS A;  1IBL Q;  2CWA A;  3RLO A;  4LF5 L;  2K5N A;  3S1M H;  1PH6 A;  1TWF H;  1EFW A;  2Z6K A;  1SMX A;  4JYA Q;  3EBE A;  4JI8 L;  1FJG Q;  3GTM H;  2WB1 G;  3GTJ H;  4GKK Q;  3L2P A;  1N8R C;  4YCV A;  4H02 A;  1VQ4 A;  1M1K C;  4GLA C;  5FLM G;  4A3E H;  2ZJP A;  3CC4 A;  2OWO A;  4DKA C;  5H1S E;  4LNQ A;  2YV5 A;  3K7U C;  4L5Q A;  3I4M H;  4GLX A;  1FVI A;  4A3D G;  3PO2 G;  4B3M Q;  4B3R Q;  4HIM A;  1C9O A;  4A4I A;  1IXR A;  1JJG A;  3AFP A;  1HZB A;  1HR0 Q;  1B7Y B;  1NE3 A;  1NMF A;  3NEN A;  4YHH Q;  4GN4 B;  2I5H A;  1OXU A;  5IWA Q;  1OXT A;  1GVP A;  1JMC A;  1UE7 A;  4IOA A;  2CWP A;  4DUY Q;  1I6H H;  2CCZ A;  4OWX B;  2FXQ A;  1IZ6 A;  2R7Z G;  3KJP A;  3PO2 H;  1L2F A;  2UUB Q;  3M4O H;  3U4V A;  1H95 A;  1TXY A;  5IYB H;  2WAQ G;  3KOJ A;  5ELN A;  1AE2 A;  2B29 A;  4LFA Q;  3CCE A;  4DR5 L;  1VQM A;  1A63 A;  5C44 G;  5M5Y H;  3CD6 A;  3BJU A;  1X65 A;  3PUV A;  1OXV A;  1I3Q H;  2CFM A;  4P74 A;  4DNI A;  3M4Q A;  1N32 Q;  4MTN A;  2JQO A;  4LF9 L;  2JA7 G;  1VQA A;  2YTV A;  3T1H Q;  5HY6 A;  4R4I A;  3BZK A;  1WCM H;  3PIP A;  3T1Y L;  1OTC A;  4R4C A;  3J81 i;  4LWC A;  4ALP A;  1XMQ L;  5IYD G;  4NXM Q;  1HNX Q;  2UXC L;  1NTG A;  2AHO B;  3H0G G;  4DV5 Q;  4DV6 Q;  4JI3 Q;  3VDY A;  1N33 L;  4GKJ Q;  5E7N A;  1E7Z A;  4LF4 L;  2PQA B;  4NXN L;  3CXC A;  1IBL L;  2OCE A;  2MO1 A;  2K5H A;  3GDE A;  4LF5 Q;  3Q8D A;  2B63 G;  1WCM G;  1KRS A;  3DM3 A;  3TS2 A;  3I55 A;  1Q1B A;  2ES2 A;  3E0E A;  4DV0 L;  1S72 A;  1N36 Q;  4OX9 L;  1KRT A;  1A62 A;  3STB D;  2K75 A;  4JI0 Q;  2F4V L;  2KCT A;  1RIP A;  3CCJ A;  2YTY A;  1VQB A;  4AQY Q;  1D7Q A;  3CQZ H;  1M90 C;  4LW1 A;  1QZH A;  4PMW A;  1YJ9 A;  4JCV E;  4DV1 L;  2NZO A;  4DV2 L;  3CPF A;  3PCO B;  3BZC A;  3PF4 A;  1KQS A;  1OXX K;  3STB C;  1X56 A;  5M5W H;  3L0O A;  3ULL A;  4IPC A;  4OON A;  4JI2 L;  4A3G G;  4JV5 Q;  2MO0 A;  5AJ3 L;  2VQE L;  1QUQ B;  1UE1 A;  2A19 A;  2KHJ A;  3KYH C;  4OO1 G;  1EWI A;  1XTD A;  3FP9 A;  1K8A C;  2JK8 A;  4DUY L;  1GO3 E;  4UP9 A;  2GVB A;  4NB3 A;  1K3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...