2JQOA

Nmr solution structure of bacillus subtilis yoba 21-120: northeast structural genomics consortium target sr547
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'MNKNEQNGDETKMQSLVGYVVLKDNERAILITDTKAPGKEDYNLSEGQLMNKFKNNIVIVGLSEIDNTDDLKRGEKIKVWFHTRKESNPPSATIQKYELLLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yobA
publication title NMR solution structure of Bacillus subtilis YobA 21-120: Northeast Structural Genomics Consortium target SR547
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics
total genus 19
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11518 DUF3221 Protein of unknown function (DUF3221)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jqoA01
3LGJA 3STBC 5IYBG 3CCVA 1I94Q 3PO3H 1Q46A 3M85A 3M4QA 4DV6Q 4A3KH 1HH2P 2JA8H 4J15A 3U50C 1WJJA 3S2DH 1J6QA 4NXML 1VQBA 1NMGA 4LF4Q 3S1NH 4R4TA 5LMNL 1HNXL 3GTMH 4OO1I 2YV5A 4IPDA 4DR4Q 5C0XG 1E1OA 1JMCA 3KF8B 4DV4L 1YHQA 1U5KA 4IOAA 1K73C 4IFDG 3M4OH 1XPUA 2BH2A 1KAWA 4NXMQ 4A76A 1HNXQ 5LMNQ 2OTJA 4A3EG 1VQPA 2VL6A 3DLLA 4GKKL 1BKBA 1CKMA 3HOYG 3S1RH 4OO1G 2K5VA 1SLJA 3W1GA 3CCQA 2JEBI 4DV4Q 1PH9A 4BY7G 4A3JG 2YU9H 4Y52H 3J81c 1XMOL 4GLXA 1L1OC 4JI0L 4NB3A 4DR6L 1QZHA 3PIPA 4JI7L 3B6YA 1AE2A 1PH6A 5M3MG 4BXXH 2K50A 4OWTB 4GNXA 3TS0A 4GKKQ 3E9HA 4C3JH 2LSSA 3EIVA 1JB7A 4H02A 2JA6G 4A3GG 2PMZE 1WCMG 2GVBA 1XMOQ 1JJGA 4A4IA 2VZAA 4DR5L 4DR6Q 1S72A 3J7A5 4JI7Q 3RN2A 2DGYA 5GAGC 5M5YH 1VQ5A 2C35B 2K5NA 1CKOA 4K0KL 4YCWA 2Z0SA 2VUMH 5E7NA 4BY1H 4JBMA 4P74A 1V43A 4DR5Q 3ULPA 3CCMA 2JJQA 2QGQA 1Y1VH 3TREA 5M3FG 1XMQL 2E5LL 3HOUG 2UUAL 1YJNA 1Q12A 1O7IA 3T1HL 2AMCB 3K80C 2XTIA 3TEHB 2NN6G 3RZOH 3S2HH 3K81C 4KHPQ 4GNXB 2E2HH 4K0KQ 2K4KA 4QQBX 3FHWA 2IHFA 1CSPA 2NVXH 1TWFH 2ASBA 1UE1A 3CMEA 1N34L 3CP0A 1C0AA 2E5LQ 3S14H 2Y0SG 3PF4A 2UUAQ 1B8AA 1N8RC 3T1YL 3T1HQ 3JC66 2F4VL 1KD1C 4IPHA 3M4PA 3I4OA 1SRUA 4KI0A 5IYCG 1HNZL 1PVOA 1GM5A 1EFWA 3I4NG 4A3LG 2YTYA 3RLNA 1N32L 3HOZH 4RMFA 1P16A 4POFA 1M1KC 3T1YQ 4A3FG 5FLXc 3HFZB 4YWMA 2QA4A 3ERSX 2ZJPA 2VS1A 4C3IH 1HNZQ 4A75A 2QEXA 3D31A 3CCSA 1VS0A 5IP9H 4IPGA 1X3EA 2Y0SE 4KLKA 3HOXH 2JA5G 2B63G 1N32Q 4DR1L 3PO3G 2HHHL 4JI2L 4YWKA 5FJ8H 4Y7NH 4A3KG 2K75A 4R4QA 2JA8G 3AEVA 1IYJB 5FLMH 3M3YH 2D62A 3HKSA 1EQQA 2JA7H 2MQHA 2V1CC 3RR5A 1VQMA 1HZBA 2ZTEA 4TVAB 2ZJRA 4DR1Q 1X3FA 1QVCA 4JI2Q 2HIVA 1JE5A 4IOCA 2HHHQ 1EYGA 4RG1A 4X65L 4GOPA 2NVQH 1PYBA 3RLFA 1VQJA 2EIFA 3K0XA 3JAMi 2UU9Q 4POGA 2ZJQA 2DUDA 4XIGS 3KFUA 4XTCS 2IX0A 3HKZG 2F52A 1L0WA 4DUZL 5IWAQ 2BA0A 4X65Q 1XJVA 4DR7L 2RHSB 4LF6L 4JYAL 1MJCA 1B70B 1BVSA 1A8VA 4UY8C 4BXXG 2PQAB 2RF4A 3UE0A 1U0LA 4DAYB 1BBWA 4YCVA 1L2FA 3FP9A 3AFPA 3GTGH 4DV7L 5C3EH 3PUZA 4DUZQ 2RHQB 5ELNA 2IT1A 3KF6B 5C4XH 1QZGA 4B3SL 4LF8L 4DR7Q 1G6PA 4GOPB 2Z6KC 4LF6Q 1I94L 1GKHA 1HNWL 3HKZE 1FGUA 1H95A 2EQSA 1P8LA 2OQKA 1A63A 1S40A 4GLVB 1JT8A 2WB1G 2VUMG 2JQOA 4BY1G 4QGUA 4DV7Q 4R4CA 5JJKA 4L5SA 4B3SQ 4LF8Q 3TS2A 1A0IA 3K7AH 4L5RC 1E24A 3STBD 1YJ9A 4DNIA 2A8VA 1HNWQ 2KHJA 2MO1A 3TRZA 1LTLA 3E9IA 4A3CH 2VNUD 1OXUA 1PH3A 2BH8A 4BBSH 3BU2A 1KL9A 1QVGA 1WOCA 2N49A 4ME3A 4TQUS 1KQSA 1YBYA 4LFAL 2L15A 2RCNA 1I3QH 3S24A 1ASZA 3A74A 5M5WH 3M9BA 4OONA 2VQEL 3UE1A 1MKHA 1R9TH 1HR0L 1DGSA 1KIXA 4DR2L 2ES2A 3HOZG 4MNOA 2H5XA 4LFAQ 1VQ7A 3WWVA 3ZJYC 3HOVH 4A3IH 2VQEQ 2I5LX 1Q1BA 4QL5A 1HR0Q 5IP9G 4JI4L 4YCUA 2D0PA 2MNAA 3HOXG 3CC7A 4DR2Q 1M90C 3CCLA 5JJIA 4IO9A 1VQAA 2PI2E 4QJFA 5JEAG 3BZCA 5FJ8G 1UEBA 3L2PA 1PHJA 4HJ5A 1E22A 4IJHA 1VQ8A 2ZTCA 5FLMG 1X65A 3RN5A 2JA7G 3Q8DA 5IY0A 4JI4Q 4AH6A 1PH5A 3S1QH 2OWOA 3GTLH 2ZM6L 4JOIC 4KHPL 4APVA 5JJLA 3CQZH 1S3OA 3GD7A 3JAMc 1J5EL 1NMFA 1VQHA 3G4SA 1L1OA 5DLQE 3U58A 5GROA 3EBEA 5LMUL 3CW2C 1OXSC 1FL0A 1SR3A 1PH1A 2I0QA 2ZM6Q 4OX9Q 4PZ6A 3UDIA 5GAHC 1QUQA 1J5EQ 4DV2L 4PZ8A 2UXCL 1VQGA 1PH4A 1NJIC 4KHZA 3GTOH 2A19A 5LMUQ 2YTVA 4JBWA 2E2JH 2R93H 1OXTA 2WP8J 4P72A 2CQOA 1KHIA 5C3EG 2OTLA 1IBKL 5C4XG 1VQLA 1XTDA 4DV2Q 2UXCQ 4R4IA 3OTOL 4NPSA 1C7YA 4X6AH 3L7ZC 2VW9A 1LM0A 4UP8A 5C44H 2LXKA 4HIOA 1K8AC 3G48A 4A93H 1N33L 4UP9A 2AWOA 1N36L 4A3BG 3I7FA 1PH7A 1MJEA 3CCEA 2NVTH 1IBKQ 3UDXA 1I5FA 3OTOQ 2WFWA 4LUVA 2UXDL 4O2DA 2AKWB 1E3PA 4BBRH 3PF5A 4A3CG 4JI1L 3BJUA 2R6GA 4OXPA 3GTQH 3PUYA 1N36Q 1N33Q 2GVAA 4BBSG 1GD7A 1K9MC 3TQYA 4QY7A 2VQFL 3K8AA 2UU9L 4A3EH 3KJOA 3D0FA 1Q1EA 2I5HA 3HOYH 2UXDQ 1YITA 4GN4B 2R7ZH 4JI1Q 5IWAL 2N78A 3PSIA 4BA1I 3CC4A 1CUKA 3AYHB 3I2ZA 1NTGA 1Z47A 2VQFQ 1TWHH 4JI6L 1VQFA 4NXNL 1Q86C 1OTCA 4GN3B 2N8NA 4LW1A 5IT9c 2I5MX 3FKIH 4A3IG 3HOVG 2Q2TA 3SGIA 1JJ2A 4UPAA 3KOJA 4C2MH 2ID0A 1WCMH 4DAMA 1PV4A 4LWCA 2JEAI 1OXVA 2NZHA 3PIOA 1JJCB 1LUZA 3CXCA 2KHIA 4DV5L 1RIPA 1YZ6A 3PCOB 4JI6Q 1T9HA 3A5UA 4B3TL 3PGZA 4NXNQ 3RNUA 1VQKA 1Z9FA 1V9PA 2K14A 1XPOA 2CWPA 3RZDH 1VQ4A 1X3GA 1HZCA 2CWAA 3OYYA 5M3FH 3PO2H 2UUBL 3HOUH 4DV5Q 1VQ6A 1UWVA 1MIUA 4B3TQ 2UXBL 1FJGQ 2D0OA 1EOVA 1A62A 3I4MH 5GQOA 1Y1VG 4AQYQ 4DK3C 1Y14B 1I6HH 3KJPA 4DV0Q 4P71A 2UUBQ 2R92H 1G51A 2UXBQ 5K36G 4LFBQ 3J80i 3AFQA 3J81j 2CKZB 2KENA 3W5OA 5JEAJ 4AIMA 2MO0A 2Z6KA 3PUWA 3GTPH 1Y1WH 3KDFA 2R93G 2WB1E 2B3GA 4JI3L 1VQOA 1VQCA 1YVCA 4HJ7A 2OQ0A 5C0XI 4UP7A 3U4ZA 1WI5A 3I55A 4IFDI 5C44G 3GTJH 2JA9A 4O0AA 5IYDH 3K7UC 5ELOA 1NBWA 1XNQL 1EIYB 1SN8A 4JI3Q 1SMXA 2JE6I 4A93G 1K83H 2N3SA 3GDEA 4MTNA 4ALPA 5M5XH 1AE3A 5BR8L 2WAQG 3M7NA 4BA2I 4JCVE 4B3RL 2IY5B 4GNXC 3KYHC 4LF7L 4BBRG 4DKAC 1W3SA 3MXNB 1I50H 2HQLA 1B7YB 4L5TA 1XNQQ 3S1MH 2NVYH 3KDFB 1GVPA 2ALYB 1HZAA 1C9OA 3GO5A 3W1BA 5BR8Q 4EX5A 2F3IA 2KBNA 4HIKA 4B3RQ 3CPWA 3CAMA 2R7FA 4JG2A 3BZKA 4LF7Q 4OWWB 2XGTA 4OX9L 1VQ9A 1UE5A 3NENA 2R7ZG 4LFCL 3ER0A 4A3DH 2KCMA 1PH8A 3H15A 1TWAH 3CCJA 1HJPA 2WAQE 4HJ8A 1WFQA 1EIFA 3ULLA 2LXJA 1ASYA 1G291 2Q2HA 1E1TA 4GS3A 4EQ5A 2FXQA 3H0GH 3NELA 4A3MH 1WYDA 2CFMA 4DPGA 1K3RA 2MFIA 3FKIG 4GLAC 5HGQA 5IE8A 4LFCQ 3HOWH 1V1QA 1YHAA 3PUXA 4JI0Q 4DR3L 1QVFA 4HIDA 1NE3A 5IP7H 4DV3L 3G71A 2NN6I 4IPCA 2E8GA 1KRSA 4JOIA 4DV1L 2Q2IA 4OWXB 4C3HH 1PYSB 2GN5A 2R7DA 3F8TA 1KRTA 4DR3Q 2Q2UA 2IX1A 1PFSA 2ATWA 3PO2G 1L1OB 4DV3Q 3EN2A 2JK8A 2UUCL 5IYBH 1Q81C 1YIJA 1YEZA 5C4JH 3NBHB 3IRBA 4YY3L 4DV1Q 3UDFA 2YTXA 1X56A 2K52A 2NZOA 3ULJA 1XPRA 4JC0A 1Q7YC 2A1AA 2B29A 1IBML 3I4MG 3S16H 5J3BA 3A5ZB 3S15H 1QUQB 2PNHA 3E0EA 3OW2A 1XMQQ 5HY6A 4PZ7A 2CCZA 1EWIA 4HJ9A 3H3VI 3CCRA 1YJWA 2UUCQ 2HT1A 4LF5L 2R92G 1D7QA 3J80c 4P75A 1PA6A 1VQIA 4YY3Q 4MZ9A 1AH9A 1YHBA 4X66L 3GTKH 1IBMQ 2BA1A 4PG3A 4P73A 4HIMA 5GADC 1LYLA 1UE6A 1N34Q 2VY3A 1Y1WG 4R1JA 4B3ML 1NY4A 4LF5Q 3CC2A 4BY7H 1SFOH 5EAYA 4PMWA 2F4VQ 2KCTA 1IXRA 1TXYA 4GOPC 4A3JH 4X66Q 3PUVA 3J81i 5LMNW 1TWGH 1D8LA 1UE7A 2EXDA 1VQDA 5M3MH 5IYDG 4LF9L 1X54A 5AJ3L 4B3MQ 3RLOA 3I56A 3S17H 3MEFA 1GO3E 4A3GH 4JBKA 2JA6H 4JBJA 1HR0W 4LNQA 2HIXA 2PQAA 3J7ZC 4WJ3M 1PH2A 1FVIA 2YYZA 4JI5L 4X62L 4L5QA 1K8GA 1IBLL 3NEMA 1X55A 4LF9Q 1W2BA 1FJGL 1RL2A 2K5HA 2AHOB 3KF6A 5AJ3Q 4YWLA 3CPFA 1CKNA 1Q8KA 5GAEC 3UDGA 4GN5A 3DM3A 4AQYL 3CMAA 3CD6A 1IBLQ 4JI5Q 1EUJA 1X6OA 4X62Q 5H1SE 4DV0L 1KC8C 3CCUA 1OXXK 2E2IH 4AYBG 4LUZA 4DUYL 1K0RA 1IZ6A 2PI2A 3ICEA 4A3DG 3KLWA 3PV0A 4LFBL 4JI8L 4DK6C 2ZTDA 4X64L 1N9WA 1BBUA 4IJLA 1VCIA 3F2BA 3F2CA 4A3MG 3H0GG 1CSQA 1YNXA 4LUOA 4GKJL 1Q82C 1XNRL 4YHHL 4R4OA 4DUYQ 1VQEA 4HJAA 3A0JA 1HZ9A 4QIWE 5IYCH 3VDYA 1YI2A 1TWCH 3HOWG 4FDBA 4JI8Q 4X64Q 3CF5A 3I4NH 4A3LH 1X9NA 1CKNB 5C0XJ 5IP7G 4AYBE 4JV5L 4JYAQ 4GKJQ 4DV6L 1SROA 1XNRQ 4IFDJ 4A3FH 1KXLA 4YHHQ 1EQRA 3U4VA 3H3VH 3F1ZA 3L0OA 1IL2A 3F2DA 3G6EA 3AQQA 4A3BH 4WJ4A 1E7ZA 4LF4L 2IHEA 2AWNA 1VQNA 1SE8A 2JA5H 2B63H 4DR4L 2OCEA 4JV5Q
chains in the Genus database with same CATH superfamily
3STBC 1I94Q 4A3KH 5D14A 3HOYB 3U50C 2RDGA 1VQBA 1NMGA 4I7AA 4OO1I 2XN9C 4IPDA 4DR4Q 1JMCA 4K5WA 3KF8B 3W3AA 1DYQA 4IFDG 1D6EC 3M4OH 2EY6A 1U4PA 3E3XA 1NR2A 1HXYD 5ELFA 1VQPA 1BKBA 3HOYG 2K5VA 5I6YA 2KECA 3O13A 1PH9A 1D2BA 2J7ZA 1LTSD 4Y52H 4JI0L 4IALA 4DR6L 1KTKA 3PIPA 2F0VA 5LL6S 2XRQD 4GNXA 5M3FB 3E9HA 3HOUB 3EIVA 1EEID 2GVBA 1XMOQ 2VZAA 4EGVA 1HTPA 2DNEA 3KLSX 1O7YA 1EY4A 2VUMH 2QDBA 3HG9A 4BY1H 2B2YC 5M3FG 1XMQL 2O5IC 3A7AB 3HOUG 3I90A 1YJNA 5CV8A 5ELCA 1F9PA 2AMCB 2QEJC 2O5JC 3S2HH 3AU7A 4DGZA 3TN2A 1TWFH 1UE1A 3DUZA 1FYCA 3H09A 2UUAQ 5IGFA 5C3XA 1Y8PB 1KD1C 3HS0C 3I4NG 3MVVA 1B1ZA 3RLNA 3S1NB 3T51B 4YWMA 1EOTA 3A8JE 5D65A 2H4OA 4M1UB 2ZJPA 1JWSD 1I50B 3FRPB 3CCSA 2NVYB 4DAVA 3NWSA 2Y0SE 1ENAA 1LLRD 4KLKA 3HOXH 1UAPA 3RMHA 2HHHL 5FJ8H 4R4QA 3V05A 2JA8G 2VXWA 2JA7H 1HZBA 2ZTEA 4QCLA 4A3MB 1X3FA 1QVCA 1RD9D 4JI2Q 1JE5A 3NXWA 2NVQH 1IKLA 3SEBA 2EIFA 3K0XA 5CV5A 2ZJQA 5EKLA 4XTCS 1A3UA 1HCZA 1MGSA 1LTRD 1V1PA 4HSPA 1ZXTA 1B70B 3IFDA 4DAYB 1BBWA 3FP9A 1G2SA 3AFPA 2RHQB 4LF8L 2IT1A 1DOLA 2L5TA 1F2ZA 3SXHA 3EJIA 1E0BA 4NDXA 5EPLA 2E76C 3VR4A 3SHLA 3D3RA 1BCPD 1JT8A 2WB1G 5F2DA 5CR3A 4B3SQ 1A0IA 3TP5A 4Q5VA 4L5RC 3S9WA 2Q8RE 1HFGA 2KHJA 3E9IA 2VNUD 4G7ZC 2XSCA 4BBSH 1LTTD 1AN8A 2KA7A 2IX3A 3K5LA 1QVGA 2N49A 4B08A 1YBYA 5I9OA 1Q8IA 3ND8A 1ASZA 3M9BA 4OONA 1HR0L 1KIXA 2ES2A 3H91A 3M3YB 3HOZG 1S4ZA 1ZYRD 1BQQT 1TY0A 1RF2D 2I5LX 1Q1BA 4QL5A 3GV3A 1CFMA 4YCUA 2MNAA 4IURA 3CC7A 4DR2Q 1M90C 1GUWA 4IO9A 4CDEC 5IGGA 3DHQA 3L2PA 5EBCA 2F0QA 4M8AA 5DNFA 5FLMG 5CV7A 1X65A 2EYMA 1EY6A 4JI4Q 1JCKB 4AH6A 3NBIA 3OWFA 4FNFA 2ZM6L 4JOIC 4QMGA 4APVA 2L0CA 1SYCA 3N6RA 3JAMc 4ZLTF 1L1OA 3U58A 1PRTC 3EBEA 3CW2C 3NBHA 1PH1A 1U4LA 4OGQC 3UDIA 2KOLA 2UXCL 1VQGA 1PH4A 4KHZA 2A19A 5IODA 2E2JH 1OXTA 2WP8J 4P72A 2CQOA 3VR3A 2KCNA 4K6LA 3LX0A 1XTDA 1H9JA 4NPSA 2VW9A 3GTMB 5FOBB 1LM0A 4UP8A 4HIOA 2E75C 4Q0FA 1SYEA 4IUQA 1SE4A 3U9SA 1QWYA 1MJEA 1Y8NB 4IUTA 1R9TB 2IL8A 2WFWA 4CDFC 4O2DA 1HUNA 2AKWB 4BBRH 3BJUA 4HSVA 4OXPA 2LS01 3PUYA 5FKAC 2VQFL 1DD2A 4A3EH 2UXDQ 1YITA 3PSIA 4BA1I 4ZAIA 3MEHA 1NTGA 1TWHH 1LT4D 1Q86C 1OTCA 4LW1A 5IT9c 4A3IG 3AMUA 3SGIA 1MI2A 4C2MH 3VYTA 1OXVA 4K14A 5CMDA 1I6VC 2K01A 2KHIA 1Y1VB 4JI6Q 3RNUA 1B53A 1I4RA 1X3GA 2CWAA 5IGEA 2J0TD 3FMCA 1SNPA 2UUBL 1VQ6A 1UWVA 2GA4B 3PMFA 3I8ZA 2HDLA 4B3TQ 2UXBL 1FJGQ 1EOVA 2NN6H 2G5DA 3NQTA 3T53B 4N9TA 1D5ZC 1Y1VG 1LTGD 4DK3C 1Y14B 5EQ0A 4IUPA 2R92H 1CQVA 1QJOA 2I07B 1G51A 5CORA 3T4AC 5K36G 1IW7D 1NAPA 3DXJC 3QR8A 1ET9A 3NTIA 1HQMC 3KF8A 5JEAJ 2MO0A 2NVTB 1TKWB 3PUWA 1E2ZA 4UHVA 1B3QA 3NPPA 2L55A 2WB1E 2B3GA 1SNMA 1SSOA 2EZVA 4Y7NB 4HJ7A 3MHBA 4ABNA 3I55A 1PTOC 3GTJH 3SE0A 5ELOA 3FDTA 4JVZA 4JI3Q 4A93G 4MTNA 1WVLA 5M5XH 2NTSA 1CT1D 1TS2A 1J9OA 1EYDA 3KYHC 4LF7L 1SE3A 1B7YB 5DAUA 2F3IA 1BCPB 3CPWA 3VR5A 4OWWB 2FHTA 1DCZA 2KCMA 1PH8A 3CCJA 2WAQE 1SAPA 5KRUA 3J81E 1ASYA 4GS3A 3BDOA 2JN4A 1BBXC 4DPGA 5BN4A 5D3DA 4GLAC 5HGQA 2Z1CA 5IE8A 4LFCQ 3HOWH 2BE5C 3PUXA 2SEBD 4DR3L 1QVFA 1STGA 2Z4HA 3NQIA 2NN6I 4IPCA 2E8GA 3N52A 2B2WC 2Q2IA 2G9HD 2N55A 1PYSB 1RODA 2Q2UA 2PZWA 2RSNA 3NTHA 2XWBB 2UUCL 4R8NA 1E2VA 5C4JH 3ND9A 4DV1Q 3GTPB 2YTXA 2WINB 1Y8OB 3I4MG 1LABA 1QUQB 3Q0AA 3OW2A 3BVMA 1EWIA 5C0XH 5A35A 1PA6A 1VQIA 1QB5D 3GTKH 2F0LA 1B2TA 2K5WA 4HIMA 1UE6A 1F2MA 4F87A 3OWEB 1IL8A 3SVMA 4LF5Q 3R2IA 4C1NK 1D1IA 2KCTA 1TT2A 4GOPC 4A3JH 2K33A 3S1MB 1LT5D 4LK1C 3K5MA 1UE7A 3QIAA 2EXDA 1H9RA 1VQDA 2B2VA 2FJ2A 5M3MH 1XTCD 3BVZA 3NTKA 5IYDG 5AJ3L 4G4KA 3S17H 4A3GH 4XQJA 3FPUB 2CW0C 2FMMA 2HIXA 2PQEA 3QOJA 1FVIA 3MAQA 4L5QA 1STEA 1FNUA 3EVQA 3H0GB 2MUYA 1AZQA 4GN5A 4AQYL 1CTMA 1IBLQ 4DV0L 2E2IH 1SEBD 4ZCKA 2F0FA 1RHPA 4I7ZC 3ICEA 4A3DG 2R93B 2PW5A 2SNSA 3WDNA 1BBUA 4IJLA 1VCIA 3WOFA 5KIXA 3H0GG 2NUCA 4YHHL 4KY7A 4R4OA 4HJAA 3A0JA 1JC7A 5IYCH 4RKLA 3TP8A 4JI8Q 3P20A 1X9NA 1EZ6A 5IP7G 3L3OC 1KXLA 4A3FH 3H3VH 2V4DA 1SDFA 4CDCC 1F2YA 1EY0A 3AQQA 4A3BH 1E7ZA 2IHEA 2AWNA 2B8FA 2B63H 4DR4L 1B44D 2QDLA 3LGJA 5IYBG 2QILA 3CCVA 5ELDA 1T5EA 3M4QA 3Q23A 1HH2P 4J15A 4ZRZA 1J6QA 4BY7B 4ZUJA 2RVLA 4LF4Q 4R4TA 5IOCA 1BUVT 1C48A 2YV5A 1YHQA 3JAML 1KAWA 3TMEA 4A76A 4NXMQ 2CVRA 1W6KA 4P2CB 4OO1G 3CCQA 4BY7G 2DJGC 2JEBI 2WKCA 1CM9A 1XMOL 2BCOA 4NB3A 1QZHA 2IW3A 2F4IA 1VF7A 4BXXH 3R2TA 4GKKQ 4OWTB 3TS0A 2K5DA 4H13C 3PO2B 4C3JH 5CBAE 1T5XD 2JA6G 1JWMD 1F9QA 1SYDA 2PPBC 5J1ZA 1S72A 4HCEA 4K6DA 3RN2A 4JI7Q 4RGTA 2EE1A 5M5YH 1VQ5A 3DWAA 2C35B 2Y0SB 1CKOA 4FXKC 3QWNA 2Z0SA 4XQQA 1V43A 2BDOA 2PCFB 1TWCB 2FINB 4RGOS 4WJWA 2F0TA 2UUAL 1O7IA 4ZK9B 4XQNA 3TEHB 3RZOH 2A6ED 2E2HH 2IHFA 5I2YA 3CMEA 1QE6A 2Y0SG 4DFAA 5LL6X 3PF4A 3T1HQ 3JC66 4IPHA 3M4PA 1SRUA 4DNRB 1PVOA 1EFWA 3GV6A 3OIQA 4C56C 4RMFA 1P16A 5IT9L 5KNBA 1M1KC 3D4WA 3VR6A 3T1YQ 5FLXc 2QA4A 5E4XA 1QG7A 4IQZA 1HNZQ 1Z7TA 4IPGA 2JA5G 1S5BD 2A5HA 4JI2L 4HCSA 4YWKA 4A3KG 3ERQA 2RKSA 4S3SA 2D62A 1EQQA 1TWAB 1VQMA 1Q90A 2A68D 4DR1Q 1BOSA 1MSHA 1Z6HA 4RG1A 3KUPA 4KHVA 1G2TA 5C3WA 1ILPA 1S5FD 1VQJA 3JAMi 3BYTB 5CV9A 1C8CA 1W6JA 1G6ZA 2DUDA 2PYKA 2L9HA 3NHHA 3KFUA 4NP5A 4L63B 5IGCA 2F52A 1L0WA 2F0IA 5IWAQ 1XJVA 1M8AA 1SNDA 2E74C 4C3HB 2VUMB 4JYAL 1BVSA 1JR0D 1LTAD 2PQAB 2RF4A 1EY9A 4JK1C 1PDQA 3DMUA 3E6ZX 3FPPA 1FNVA 1L2FA 1WTRA 2RDFA 4DU9A 3GTGH 5C3EH 3PUZA 1AP0A 5ELNA 5C4XH 4B3SL 3KF6B 3S2HB 1G6PA 3PIO3 1XWEA 5KEEA 4GOPB 3S16B 1H95A 3HKZE 1I4GA 5E4WC 2EQSA 1A63A 4GLVB 1LTBD 2VUMG 4BY1G 4DV7Q 5JJKA 1FD7D 4L5SA 1SJED 3NSWA 3A8KE 3K7AH 3STBD 4FYDA 1SXTA 2A8VA 4KMUC 1LTLA 1OXUA 2CQAA 2BH8A 3BU2A 4ODGA 1WOCA 4KV6A 4TQUS 2DY7A 1I3QH 2ZXRA 1TWGB 5M5WH 5A2QL 1TS4A 3I91A 5JAVA 1MKHA 4DR2L 2JYOA 3CHBD 2JA7B 4V0BA 4LFAQ 3LWUA 3WWVA 3HOVH 2VQEQ 3K6OA 4JI4L 3CCLA 3HOXG 1KNEA 1VQAA 2PI2E 3LWEA 5FJ8G 1UEBA 4HJ5A 3OMCA 2F3VA 2JA7G 3Q8DA 5IY0A 3GTLH 3VR2A 1K28A 4KHPL 4FO2A 1K3BC 5DLQE 2EOTA 3I4NB 4RHSA 1B9NA 4OX9Q 1PYWD 5GAHC 1QUQA 4DK1A 4PZ8A 2F0EA 1H9SB 2VB2X 1KHIA 3U9OA 2OTLA 2JA8B 4BBSB 1EQVA 5JJZA 4X6AH 3OHXC 5C44H 4UP9A 1IKMA 1PH7A 2MHVA 3T13A 1IBKQ 3OTOQ 1AEXA 2UXDL 3PF5A 4BBSG 1KDCA 4R8IA 4QY7A 2UU9L 2CH4W 1GJXA 3IFTA 2Z4IA 3MA2B 3D0FA 1Q1EA 3HOYH 4GN4B 1PFMA 3I2ZA 1EIGA 2BOSA 2AUKA 1Z47A 2B39A 2J4XA 2RCFA 3FEWX 4JI6L 5J39A 1EY7A 2ID0A 3IAYA 2WB1B 3KBXA 3CXCA 4C1NI 1JJCB 1LUZA 3URYA 2EXZA 4NXNQ 4B3TL 3PGZA 1PFBA 4KY6A 2K14A 1VQ4A 3OYYA 3C1EA 2NVXB 5M3FH 2QKIC 4N8X1 3HOUH 3J7AV 2KCCA 1LO5D 2D0OA 4ZQ3A 2F3WA 1ET6A 1RDPD 2F0SA 4G57A 5EBDA 3KJPA 4P71A 3HOZB 1JORA 4WRDA 3QJYA 3AFQA 3J81j 2CKZB 4MTKA 2WKDA 2PZTA 5COYA 2Z6KA 3MZ5A 2WAQB 2MPMA 4JI3L 1VQCA 2XRSD 1SMYD 4UP7A 2HUGA 1WI5A 1DM0B 1PZKD 4IFDI 2JA9A 4O0AA 3GDEA 5ISRA 2WIIB 2WAQG 3M7NA 4CJ0B 4GNXC 1JQYD 3H3VC 4BBRG 1W3SA 3MXNB 1I50H 1HFNA 4L5TA 2NVYH 3VYUA 1I4PA 3KDFB 2HD3A 1GVPA 2ALYB 3W1BA 4HIKA 3K5OA 2R7FA 4X3SA 4L6TB 5FK9C 3BYYB 3NENA 4LFCL 3ER0A 3MFYA 4J6HA 3HZXA 4HJ8A 1A2UA 1HQRD 2Q2HA 1G291 1PXUA 2A6HC 4A3MH 1WYDA 2NZ1D 4XYOA 2R3ZA 4RCOA 1V1QA 1KLGD 4JI0Q 4HIDA 1ONLA 1NE3A 2F0MA 1F2LA 3KBGA 4F8MA 5FLXL 3L9AX 1RKNA 1KRSA 4F7XA 4DV1L 1SYBA 2R92B 2K1BA 2Q8TA 2O4XA 1ICWA 2R7DA 1PFSA 2ATWA 1L0YB 4DV3Q 3EN2A 3HP3A 1IYVA 1Q81C 1C4QA 1CHPD 3IRBA 3UDFA 3ULJA 1Q7YC 4JC0A 1KABA 2B29A 2MJ8A 4H0LC 4QUFA 3E0EA 1XMQQ 5HY6A 3CCRA 1YJWA 2R92G 4LF5L 4P75A 4TRDA 1AH9A 5EPKA 3J80E 2BA1A 1QCBD 1QILA 2EYFA 4A3IB 1G91A 1GUTA 1WTHA 2VY3A 1HA5A 3D4RA 2K05A 4LJZC 1IXRA 4DA2A 3PUVA 2F0PA 5LMNW 2JSOA 1HTLD 3S1QB 3J7AF 1SNQA 4B3MQ 4JBKA 4JBJA 1HR0W 3CQZB 2PQAA 2X6LA 4WORA 1IBLL 3TSSA 4TSSA 3TZDA 1W2BA 2K5HA 2AHOB 1EEFD 2K32A 3KF6A 3CPFA 1CKNA 5LHY1 4RA8A 3CD6A 4JI5Q 4IZ8A 4X62Q 5H1SE 4FXGC 5D3IB 3CCUA 1KC8C 1YNND 4K8JA 1WTPA 3KLWA 3PV0A 3K0YA 4IUUA 4JI8L 4DK6C 2ZTDA 4DXGA 4LFBL 1N9WA 1YNJD 3I3CA 1CSQA 4LUOA 4BS9A 5CYUA 1R4QB 1VQEA 3MXUA 3VDYA 3HOWG 3OIPA 5C4JB 4A93B 4X64Q 3CF5A 4A3LH 4R9WA 5DEHA 5C0XJ 4AYBE 4MN3A 3BDLA 1XNRQ 5EJWA 1TY2A 1DOMA 3U4VA 3F1ZA 4O42A 4XT1B 3F2DA 4WJ4A 3GTQB 4LF4L 4FVMA 1VQNA 1NNXA 4JV5Q 4IUVA 3PO3H 1Q46A 4DV6Q 2F0JA 1BF4A 2RSOA 3S2DH 4NXML 1IW7C 2DJFC 3GTMH 2SDFA 4KY5A 1B50A 5C0XG 1E1OA 3V2TA 4DAPA 1K73C 5M3MB 1XPUA 3I72A 2BH2A 3S17B 1HNXQ 5LMNQ 1WCMB 2VL6A 3DLLA 4GKKL 1CKMA 3S1RH 4DV4Q 1SLJA 2WV6D 3W1GA 4A3JG 2YU9H 3KLSA 1KDBA 1L1OC 4ULLA 4ID6A 2XWJB 4JI7L 1AE2A 3B6YA 5M3MG 4FF4A 3SK5A 2LSSA 1JB7A 4A3GG 4H02A 1H9SA 2PMZE 1WCMG 1JJGA 3P1HA 4K5VA 4J8QA 1X3QA 3I4MB 2EYJA 2L4NA 5JOBA 4YCWA 2ZXOA 3K58A 5E7NA 1EY5A 4P74A 2X69A 4DR5Q 3CCMA 1S5CD 2QGQA 1Y1VH 3TREA 5E3FA 3T1HL 1X3PA 2XTIA 3D8GA 4K0KQ 3K81C 4GNXB 2K4KA 3NP8A 4A3FB 5K36H 4GZYC 2ASBA 2JXMB 3K59A 1N34L 4I65A 2E5LQ 3S14H 3HEJA 1B8AA 1N8RC 3T1YL 2IPKD 1BCPF 2F4VL 5IYCG 3I4OA 1HNZL 4B9XA 1FR3A 3DWPA 5FO8B 3SDZA 1PRTB 4A3FG 5NUCA 3HFZB 1EWCA 2VS1A 4C3IH 1IHZA 5IP9H 2B63G 3D6CA 1N32Q 2IJ0A 4DR1L 5JEAH 1EZ8A 1KDAA 4Y7NH 2C5CA 4J1MA 3NK9A 4A3DB 2FMCA 3HKZB 3TBIB 2WACA 2MQHA 4DAYA 2ZJRA 1AFPA 3EFXD 2A69D 1EYGA 4C3JB 1PYBA 3RLFA 1A3VA 1BNZA 3K5NA 2RBMA 4POGA 2NBFA 3HKZG 5IT9E 4X65Q 3C2PA 5C5MA 1MJCA 1A8VA 3E0JA 4BXXG 3UE0A 1U0LA 4C3JG 5M9OA 1QNUA 4DV7L 4DUZQ 2F0KA 4DR7Q 2E2HB 4LF6Q 5C6AA 3S15B 1I94L 1FGUA 2ZT9C 4QGUA 2EY1A 1O78A 2L1BA 1E24A 1YJ9A 2RA4A 4DNIA 4LMQD 1HNWQ 1HRJA 2MO1A 1K8MA 3TRZA 4A3CH 3MFGA 4DNTB 1SFOB 1STYA 4XDXA 4ME3A 4DF7A 3MXNA 4LFAL 3QO2A 2L15A 1QNKA 2EYOA 2VQEL 1DGSA 2B2TA 4KN7C 3OOCA 4N8FA 2JA6B 4FXDA 2DN8A 3MWYW 3P75A 1OO9B 1VMCA 2H5XA 2M2LA 1GUGA 1VQ7A 4X3UA 1WTQA 4XXEA 5JJIA 5EGTA 1CZGA 5C5LA 3BZCA 1PHJA 1VQ8A 2ZTCA 2NB0A 2F0HA 1PH5A 4UDUC 1XYIA 2OWOA 1HPCA 1XX8A 2Z8LA 1EFID 1PTOB 1S3OA 4Z9CB 4NW2A 1NMFA 1VQHA 1RTOA 2QW7A 2KEEA 5C3EB 3BS1A 1OXSC 1FL0A 1SR3A 2I0QA 1KLUD 3J7YW 4RHRA 3K57A 1J5EQ 3M4YA 3GTOH 4PQXA 5LMUQ 1FNWA 2JA5B 3K7AB 2R93H 4XT3B 2HCIA 4H44C 5C3EG 4A3KB 1IBKL 5C4XG 3NWTA 4JPBW 4DV2Q 4ZYSA 2D9UA 5C4ZA 3OTOL 1C7YA 2AQ1B 3CRLC 1K8AC 3G48A 2AWOA 3OW7A 3M4OB 3UDXA 5HGTA 1PZID 5HURA 2B2VC 5KYIA 2EY5A 1UUPA 2R6GA 1N33Q 1N36Q 1GD7A 3G7LA 1A3TA 1K9MC 3K8AA 3KJOA 2I5HA 2ICIA 1GHKA 2R7ZH 4JI1Q 3ONAB 1BXTA 3CC4A 1CUKA 1GXDC 1UEAB 3C1FA 3TDQA 3SK6A 1VQFA 4NXNL 2N8NA 3HOVG 3FKIH 2Q2TA 4UPAA 4BY1B 3X3NA 3PIOA 2M00A 1YZ6A 3DWQA 1T9HA 3A5UA 1VQKA 1XPOA 2CWPA 3RZDH 5ELEA 1PFNA 1TWFB 3PO2H 2OT2A 2E2DC 4DV5Q 4FF2A 3Q24A 1HHVA 1PLFA 5KNCA 1A62A 3V96A 5GQOA 4AQYQ 3IL8A 1I6HH 4DV0Q 1J8IA 5EPJA 3LNNA 4HN7A 1STAA 5C44B 3W5OA 1EU4A 2F03A 3GQBA 3HOXB 1Y1WH 2F0WA 1VQOA 4HTHA 1CA6A 1GOZA 1YVCA 1H9MA 5FO7B 1A6XA 2OQ0A 5KYLA 4KD4A 4B9WA 3U4ZA 5IGDA 5C44G 1NBWA 4KK7A 1EIYB 4CHTB 1K83H 1MD2D 4RGNA 3SK4A 2N3SA 3BZDB 1AE3A 2NVQB 3G6JB 4BA2I 4JCVE 2EYLA 1A15A 4DKAC 1XNQQ 1LACA 2HDMA 3X3MA 3FVQA 2X6GA 2Z9HA 5CBEE 1HZAA 5BR8Q 4B3RQ 1JE4A 4HR7B 3QB3A 2M9VA 1X32A 3A54A 3BZKA 1VF5C 4CJ1B 5T1GA 5JPNC 3H15A 1TWAH 1HJPA 1HUMA 1WFQA 2JEAI 1E1TA 1KAAA 1CHQD 1DZ1A 2MFIA 4QUCA 3DEOA 3H6MA 4H7BA 4X3KA 1YHAA 4KKSA 3PIP3 4DV3L 1ENCA 3MC0B 4JOIA 4RH6A 5KGUA 2A73B 3Q6SA 4ZKCB 4C3HH 4OL7A 5EKIA 2A74C 1HA6A 1F77A 3A7LA 1RCVD 1LT6D 1YEZA 4U68A 1EQTA 2K52A 4V190 1XPRA 3A56A 3H94A 4KKTA 2A1AA 5JVH3 3S16H 1NUCA 1F9RA 4HJ9A 2SOBA 2HT1A 3J80c 4YY3Q 4MZ9A 4IFDH 1YHBA 1SJHD 3C3LA 1IBMQ 2HQEA 4PG3A 4CDDC 5GADC 1LYLA 4U673 4CKCA 4B3ML 3CC2A 5T1IA 5FLXE 4X66Q 1IYUA 4YIJA 1TWGH 4FP5D 1D8LA 3NE5B 2DNCA 3I73A 1X54A 3RLOA 3I56A 1EY8A 3MEFA 4AYBB 4LNQA 4WJ3M 4JI5L 3A55A 4X62L 2F0OA 3NEMA 3MXGA 1ZEQX 4BWGB 4LF9Q 1FJGL 1RL2A 4YWLA 3UDGA 4NKLA 3W2DA 4F88A 4DN4M 2O2LD 2RQXA 1X6OA 1OXXK 4AYBG 2K5QA 1F9SA 1K0RA 1IZ6A 2PI2A 1JOOA 2E2JB 5CV4A 4X64L 3F2BA 2AQ3B 3T16A 4A3MG 2AUJD 1XNRL 2VB3X 4XYQA 2KHSA 5I9PA 4DUYQ 2XVSA 4QIWE 2K03A 2LMCB 3I4NH 5C4HA 4JV5L 1II3A 4QB4A 4JYAQ 3DM1A 5J22A 4GKJQ 4MHEA 4DV6L 3E5SA 1EQRA 4EQOA 3L0OA 4BBRB 1BCPC 1B3AA 3G6EA 2FFKB 2IWHA 1MBYA 5FO9B 1JB3A 2OCEA 1ESRA 2PMZB 4LAAA 3M85A 4A3EB 3OMGA 1H9KA 2JA8H 1WJJA 2NYZD 1DXMA 4K5XA 3S1NH 1HNXL 5LMNL 4EQPA 1JICA 1PMRA 2F0UA 4ME5A 4DV4L 1U5KA 1TWHB 3MTSA 4IOAA 1O80A 1I4XA 4X3TA 4C2MB 3VA7A 1BO0A 4A3EG 2OTJA 5CV6A 1SMYC 2K04A 2EDGA 1ZYRC 3J81c 4KD3A 4GLXA 1PRTD 1ILQA 2A6HD 4K2KA 1PH6A 1SYFA 2K50A 1EIHA 3T56B 2I46A 4CGYB 1QOHA 4CJ2C 4A4IA 4DR5L 4DR6Q 3J7A5 2DGYA 2EJFC 5GAGC 2OXPA 1SE2A 2K5NA 4K0KL 2LFNA 2B2UA 1U9RA 1TR5A 4JBMA 3ULPA 4E6IA 1ZKOA 2JJQA 2E5LL 1Q12A 1V8QA 2SNMA 4ZUIA 3K80C 1CZWA 2NN6G 4KHPQ 4QQBX 1S5ED 3FHWA 2NVXH 1CSPA 2H1EA 3D6WA 2L11A 3CP0A 4TKOB 1C0AA 2PW7A 4KJNA 1I4QA 4PNYA 4KI0A 3GTJB 4PMCA 2B2WA 3PO3B 1GM5A 3R93A 1CI3M 4A3LG 3A8IE 2YTYA 3S2DB 1N32L 5M5XB 3HOZH 4POFA 2OEOA 4FF1A 3VYSA 3ZYYX 4HAEA 3ERSX 4RCNA 2QEXA 1NSNS 2NWGA 3D31A 1VS0A 4A75A 1X3EA 3PO3G 1NR4A 1U4MA 2K75A 3S1RB 3AEVA 1IYJB 5FLMH 3M3YH 4K8IA 3HKSA 2YU9B 4O1NA 2V1CC 3RR5A 3BG3A 4TVAB 2F0GA 2K7VA 2HHHQ 2HIVA 4IOCA 4FF3A 5ELBA 4X65L 4GOPA 3HOWB 3OSOA 2F0DA 2UU9Q 2EYHA 4PMBA 4XIGS 2B8GA 4KN4C 2IX0A 1TU2B 4DUZL 2BA0A 4DR7L 4EVOA 2QCPX 1D5XC 2RHSB 4LF6L 5DM63 4UY8C 1U4RA 1I4HA 3TP7A 4YCVA 2EPBA 3OPOA 1CK1A 1B9MA 1QZGA 1WD1A 1MSGA 1GUNA 2Z6KC 3R3OA 1GKHA 1HNWL 2OQKA 1P8LA 2ZXPA 3S14B 1YNNC 1S40A 2JQOA 4KJOA 4R4CA 2EYPA 1E2WA 4LF8Q 3GTKB 3TS2A 5EKKA 5G3LD 1PTOD 1YNJC 1EYAA 4JW0A 1PH3A 2KJXA 1KL9A 4A3JB 3EA6A 1JOKA 4C3IB 1KQSA 3S24A 2RCNA 3A74A 4IUNA 2OF1A 4KTAA 3UE1A 1MHWC 1BR9A 1R9TH 1GHJA 4A3GB 1L0XB 4MNOA 2MGSA 1STHA 3ZJYC 4CKEA 4A3IH 2XIWA 4RFBA 4C3IG 1ENFA 4OELB 1HR0Q 5IP9G 1WD0A 4QF4A 3I4LA 2D0PA 2DY8A 4QJFA 5JEAG 5CGKA 2E2IB 2P5ZX 1SNCA 1E22A 2BE5D 4IJHA 5I6WA 1EWHA 3RN5A 4N9PA 2AQ2B 3S1QH 1GUSA 3UI2A 4HEDA 1LT3D 4CKBA 5JJLA 2B2UC 2KQ3A 3CQZH 3GD7A 2MP1A 1J5EL 3G4SA 3JAME 2QF7A 4HMJA 5GROA 5LMUL 4NMZA 4DXFA 3J80L 1WTOA 3KK7A 2ZM6Q 4PZ6A 1O7ZA 3RD4A 4ILWA 4DV2L 1SYGA 2ENBA 2F1MA 1NJIC 4A3BB 4PV1C 4IN3A 1Y69U 5I2XA 2B63B 2YTVA 4JBWA 1VQLA 1PZJD 1D1KA 5BN5A 2XNAC 2UXCQ 1RJTA 3HRZC 2EVBA 5TSSA 4R4IA 3L7ZC 2LXKA 1XXGA 4A93H 2LKVA 1N36L 1N33L 4A3BG 3I7FA 1GUOA 3CCEA 2NVTH 4G7HC 2KUMA 2PO4A 1I5FA 4LUVA 1E3PA 3D4DA 4A3CG 4JI1L 2D5DA 3GTQH 2GVAA 2CW0D 1S5DD 3TQYA 2G9DA 3F2UA 1WTWA 3QG1A 3SR1A 1TS3A 3KLRA 5IWAL 2N78A 3AYHB 4DK0A 1D5MC 2VQFQ 3Q22A 4GN3B 2I5MX 5M5YB 3C46A 1TVXA 3VYRA 1JJ2A 3KOJA 2EJMA 1JOQA 1WCMH 2K6AA 4DAMA 1PV4A 4CBVA 4LWCA 2Z6BA 3DEPA 2NZHA 4DV5L 3PCOB 1RIPA 2F0NA 1B4OA 4L8JA 1Z9FA 1V9PA 3TZUA 1PRTF 1CQFA 2A69C 3RZOB 1HZCA 1RTNA 3QOLA 3WOEA 3GTOB 1MIUA 1WTXA 3I4MH 5L37A 1V1PB 5E1FA 2UUBQ 3M7GA 2UXBQ 1TIID 4LFBQ 1LV9A 3J80i 2BDNA 2KENA 3NUCA 4AIMA 1SNOA 2LY7A 3GTPH 3KDFA 2R93G 3AB9A 2NTTA 3J81L 2L12A 5C0XI 2K28A 4KKUA 1R4PB 1O7LA 5IYDH 2PNRC 1TQOA 3K7UC 1XNQL 1SN8A 1SMXA 2JE6I 2C9OA 2TMPA 1EYCA 5JPMC 4ALPA 2R7ZB 4HMIA 4OEMB 5BR8L 4B3RL 2IY5B 3P7JA 1EL0A 2HQLA 3S1MH 3FKIB 4EX5A 1C9OA 3GO5A 2KBNA 5I4DA 3CAMA 4JG2A 2RDHA 4LF7Q 2XGTA 4OX9L 1VQ9A 1UE5A 2R7ZG 4A3DH 5A2QE 3GTGB 1EIFA 3ULLA 1ML0D 2LXJA 3R8BA 4EQ5A 3NELA 2FXQA 3H0GH 2CHBD 2CFMA 3RZDB 5C4XB 1K0SA 1K3RA 3FKIG 3I70A 1NCVA 2TSSA 1TS5A 1STBA 2R61A 5IP7H 1K8OA 1Q3LA 3G71A 1EU3A 3VA5A 2JP1A 1KNAA 2EJGC 1I6HB 3CKIB 4OWXB 4OIJA 1WTVA 2GN5A 2HCCA 3F8TA 1KRTA 2B2YA 4DR3Q 2IX1A 3EQLC 5DM73 3IKJA 1L1OB 5AFWA 3PO2G 2JK8A 5IYBH 1YIJA 2KEDA 3ITPA 3NBHB 4YY3L 1I3QB 1Y1WB 1X56A 2NZOA 5M5WB 1IBML 2A6EC 5J3BA 3A5ZB 3S15H 2PNHA 2CCZA 1JWUD 3H3VI 4PZ7A 1A2TA 4K2LA 3GP7A 3SK8A 2UUCQ 1D7QA 4OIKA 4X66L 3HOVB 1AZPA 2ICEC 1K83B 5G3LF 1PTOF 4P73A 1N34Q 1Y1WG 4R1JA 4OO1H 5K5PA 1NY4A 3MXPA 4BY7H 1SFOH 5EAYA 4PMWA 2F4VQ 1TXYA 4WFN3 1UNSA 1DOKA 5IGBA 3J81i 4G7OC 3EROA 1DJRD 3PQIA 3CU7A 4QIWB 1DONA 3GTLB 4LF9L 1STNA 4OHJA 1GO3E 2JA6H 1BDOA 3BVGA 3J7ZC 1PH2A 2YYZA 1K8GA 4ZKBB 1X55A 2Q8IB 1LTID 2PZUA 2D2CC 2A68C 5AJ3Q 1Q8KA 4RGMA 5GAEC 4RWSC 1ESFA 3TP6A 3DM3A 5BN3A 3CMAA 1EUJA 1FGBD 1G8ZD 4LUZA 4DUYL 4RKBA 3RUZA 1M4VA 2CH4A 4UAIA 3BDCA 1V1OA 3F2CA 1YNXA 5JVG3 4GKJL 1Q82C 2KVMA 2EY2A 1PTOH 1HZ9A 2N88A 3CRKC 3HGBA 1YI2A 1TWCH 5IIFA 1SBBB 4FDBA 5KNDA 1AW7A 1CKNB 1ICFB 1SROA 4IFDJ 4YHHQ 1VMPA 5CC4A 4MIUA 4C3HG 1IL2A 1CA5A 2B2TC 4RAUC 1SE8A 2JA5H 1VDZA 4EQNA
chains in the Genus database with same CATH topology
3LGJA 3STBC 5IYBG 3CCVA 1I94Q 3PO3H 1Q46A 3M85A 3M4QA 4DV6Q 4A3KH 1HH2P 2JA8H 4J15A 3U50C 1WJJA 3S2DH 1J6QA 4NXML 1VQBA 1NMGA 4LF4Q 3S1NH 4R4TA 5LMNL 1HNXL 3GTMH 4OO1I 2YV5A 4IPDA 4DR4Q 5C0XG 1E1OA 1JMCA 3KF8B 4DV4L 1YHQA 1U5KA 4IOAA 1K73C 4IFDG 3M4OH 1XPUA 2BH2A 1KAWA 4NXMQ 4A76A 1HNXQ 5LMNQ 2OTJA 4A3EG 1VQPA 2VL6A 3DLLA 4GKKL 1BKBA 1CKMA 3HOYG 3S1RH 4OO1G 2K5VA 1SLJA 3W1GA 3CCQA 2JEBI 4DV4Q 1PH9A 4BY7G 4A3JG 2YU9H 4Y52H 3J81c 1XMOL 4GLXA 1L1OC 4JI0L 4NB3A 4DR6L 1QZHA 3PIPA 4JI7L 3B6YA 1AE2A 1PH6A 5M3MG 4BXXH 2K50A 4OWTB 4GNXA 3TS0A 4GKKQ 3E9HA 4C3JH 2LSSA 3EIVA 1JB7A 4H02A 2JA6G 4A3GG 2PMZE 1WCMG 2GVBA 1XMOQ 1JJGA 4A4IA 2VZAA 4DR5L 4DR6Q 1S72A 3J7A5 4JI7Q 3RN2A 2DGYA 5GAGC 5M5YH 1VQ5A 2C35B 2K5NA 1CKOA 4K0KL 4YCWA 2Z0SA 2VUMH 5E7NA 4BY1H 4JBMA 4P74A 1V43A 4DR5Q 3ULPA 3CCMA 2JJQA 2QGQA 1Y1VH 3TREA 5M3FG 1XMQL 2E5LL 3HOUG 2UUAL 1YJNA 1Q12A 1O7IA 3T1HL 2AMCB 3K80C 2XTIA 3TEHB 2NN6G 3RZOH 3S2HH 3K81C 4KHPQ 4GNXB 2E2HH 4K0KQ 2K4KA 4QQBX 3FHWA 2IHFA 1CSPA 2NVXH 1TWFH 2ASBA 1UE1A 3CMEA 1N34L 3CP0A 1C0AA 2E5LQ 3S14H 2Y0SG 3PF4A 2UUAQ 1B8AA 1N8RC 3T1YL 3T1HQ 3JC66 2F4VL 1KD1C 4IPHA 3M4PA 3I4OA 1SRUA 4KI0A 5IYCG 1HNZL 1PVOA 1GM5A 1EFWA 3I4NG 4A3LG 2YTYA 3RLNA 1N32L 3HOZH 4RMFA 1P16A 4POFA 1M1KC 3T1YQ 4A3FG 5FLXc 3HFZB 4YWMA 2QA4A 3ERSX 2ZJPA 2VS1A 4C3IH 1HNZQ 4A75A 2QEXA 3D31A 3CCSA 1VS0A 5IP9H 4IPGA 1X3EA 2Y0SE 4KLKA 3HOXH 2JA5G 2B63G 1N32Q 4DR1L 3PO3G 2HHHL 4JI2L 4YWKA 5FJ8H 4Y7NH 4A3KG 2K75A 4R4QA 2JA8G 3AEVA 1IYJB 5FLMH 3M3YH 2D62A 3HKSA 1EQQA 2JA7H 2MQHA 2V1CC 3RR5A 1VQMA 1HZBA 2ZTEA 4TVAB 2ZJRA 4DR1Q 1X3FA 1QVCA 4JI2Q 2HIVA 1JE5A 4IOCA 2HHHQ 1EYGA 4RG1A 4X65L 4GOPA 2NVQH 1PYBA 3RLFA 1VQJA 2EIFA 3K0XA 3JAMi 2UU9Q 4POGA 2ZJQA 2DUDA 4XIGS 3KFUA 4XTCS 2IX0A 3HKZG 2F52A 1L0WA 4DUZL 5IWAQ 2BA0A 4X65Q 1XJVA 4DR7L 2RHSB 4LF6L 4JYAL 1MJCA 1B70B 1BVSA 1A8VA 4UY8C 4BXXG 2PQAB 2RF4A 3UE0A 1U0LA 4DAYB 1BBWA 4YCVA 1L2FA 3FP9A 3AFPA 3GTGH 4DV7L 5C3EH 3PUZA 4DUZQ 2RHQB 5ELNA 2IT1A 3KF6B 5C4XH 1QZGA 4B3SL 4LF8L 4DR7Q 1G6PA 4GOPB 2Z6KC 4LF6Q 1I94L 1GKHA 1HNWL 3HKZE 1FGUA 1H95A 2EQSA 1P8LA 2OQKA 1A63A 1S40A 4GLVB 1JT8A 2WB1G 2VUMG 2JQOA 4BY1G 4QGUA 4DV7Q 4R4CA 5JJKA 4L5SA 4B3SQ 4LF8Q 3TS2A 1A0IA 3K7AH 4L5RC 1E24A 3STBD 1YJ9A 4DNIA 2A8VA 1HNWQ 2KHJA 2MO1A 3TRZA 1LTLA 3E9IA 4A3CH 2VNUD 1OXUA 1PH3A 2BH8A 4BBSH 3BU2A 1KL9A 1QVGA 1WOCA 2N49A 4ME3A 4TQUS 1KQSA 1YBYA 4LFAL 2L15A 2RCNA 1I3QH 3S24A 1ASZA 3A74A 5M5WH 3M9BA 4OONA 2VQEL 3UE1A 1MKHA 1R9TH 1HR0L 1DGSA 1KIXA 4DR2L 2ES2A 3HOZG 4MNOA 2H5XA 4LFAQ 1VQ7A 3WWVA 3ZJYC 3HOVH 4A3IH 2VQEQ 2I5LX 1Q1BA 4QL5A 1HR0Q 5IP9G 4JI4L 4YCUA 2D0PA 2MNAA 3HOXG 3CC7A 4DR2Q 1M90C 3CCLA 5JJIA 4IO9A 1VQAA 2PI2E 4QJFA 5JEAG 3BZCA 5FJ8G 1UEBA 3L2PA 1PHJA 4HJ5A 1E22A 4IJHA 1VQ8A 2ZTCA 5FLMG 1X65A 3RN5A 2JA7G 3Q8DA 5IY0A 4JI4Q 4AH6A 1PH5A 3S1QH 2OWOA 3GTLH 2ZM6L 4JOIC 4KHPL 4APVA 5JJLA 3CQZH 1S3OA 3GD7A 3JAMc 1J5EL 1NMFA 1VQHA 3G4SA 1L1OA 5DLQE 3U58A 5GROA 3EBEA 5LMUL 3CW2C 1OXSC 1FL0A 1SR3A 1PH1A 2I0QA 2ZM6Q 4OX9Q 4PZ6A 3UDIA 5GAHC 1QUQA 1J5EQ 4DV2L 4PZ8A 2UXCL 1VQGA 1PH4A 1NJIC 4KHZA 3GTOH 2A19A 5LMUQ 2YTVA 4JBWA 2E2JH 2R93H 1OXTA 2WP8J 4P72A 2CQOA 1KHIA 5C3EG 2OTLA 1IBKL 5C4XG 1VQLA 1XTDA 4DV2Q 2UXCQ 4R4IA 3OTOL 4NPSA 1C7YA 4X6AH 3L7ZC 2VW9A 1LM0A 4UP8A 5C44H 2LXKA 4HIOA 1K8AC 3G48A 4A93H 1N33L 4UP9A 2AWOA 1N36L 4A3BG 3I7FA 1PH7A 1MJEA 3CCEA 2NVTH 1IBKQ 3UDXA 1I5FA 3OTOQ 2WFWA 4LUVA 2UXDL 4O2DA 2AKWB 1E3PA 4BBRH 3PF5A 4A3CG 4JI1L 3BJUA 2R6GA 4OXPA 3GTQH 3PUYA 1N36Q 1N33Q 2GVAA 4BBSG 1GD7A 1K9MC 3TQYA 4QY7A 2VQFL 3K8AA 2UU9L 4A3EH 3KJOA 3D0FA 1Q1EA 2I5HA 3HOYH 2UXDQ 1YITA 4GN4B 2R7ZH 4JI1Q 5IWAL 2N78A 3PSIA 4BA1I 3CC4A 1CUKA 3AYHB 3I2ZA 1NTGA 1Z47A 2VQFQ 1TWHH 4JI6L 1VQFA 4NXNL 1Q86C 1OTCA 4GN3B 2N8NA 4LW1A 5IT9c 2I5MX 3FKIH 4A3IG 3HOVG 2Q2TA 3SGIA 1JJ2A 4UPAA 3KOJA 4C2MH 2ID0A 1WCMH 4DAMA 1PV4A 4LWCA 2JEAI 1OXVA 2NZHA 3PIOA 1JJCB 1LUZA 3CXCA 2KHIA 4DV5L 1RIPA 1YZ6A 3PCOB 4JI6Q 1T9HA 3A5UA 4B3TL 3PGZA 4NXNQ 3RNUA 1VQKA 1Z9FA 1V9PA 2K14A 1XPOA 2CWPA 3RZDH 1VQ4A 1X3GA 1HZCA 2CWAA 3OYYA 5M3FH 3PO2H 2UUBL 3HOUH 4DV5Q 1VQ6A 1UWVA 1MIUA 4B3TQ 2UXBL 1FJGQ 2D0OA 1EOVA 1A62A 3I4MH 5GQOA 1Y1VG 4AQYQ 4DK3C 1Y14B 1I6HH 3KJPA 4DV0Q 4P71A 2UUBQ 2R92H 1G51A 2UXBQ 5K36G 4LFBQ 3J80i 3AFQA 3J81j 2CKZB 2KENA 3W5OA 5JEAJ 4AIMA 2MO0A 2Z6KA 3PUWA 3GTPH 1Y1WH 3KDFA 2R93G 2WB1E 2B3GA 4JI3L 1VQOA 1VQCA 1YVCA 4HJ7A 2OQ0A 5C0XI 4UP7A 3U4ZA 1WI5A 3I55A 4IFDI 5C44G 3GTJH 2JA9A 4O0AA 5IYDH 3K7UC 5ELOA 1NBWA 1XNQL 1EIYB 1SN8A 4JI3Q 1SMXA 2JE6I 4A93G 1K83H 2N3SA 3GDEA 4MTNA 4ALPA 5M5XH 1AE3A 5BR8L 2WAQG 3M7NA 4BA2I 4JCVE 4B3RL 2IY5B 4GNXC 3KYHC 4LF7L 4BBRG 4DKAC 1W3SA 3MXNB 1I50H 2HQLA 1B7YB 4L5TA 1XNQQ 3S1MH 2NVYH 3KDFB 1GVPA 2ALYB 1HZAA 1C9OA 3GO5A 3W1BA 5BR8Q 4EX5A 2F3IA 2KBNA 4HIKA 4B3RQ 3CPWA 3CAMA 2R7FA 4JG2A 3BZKA 4LF7Q 4OWWB 2XGTA 4OX9L 1VQ9A 1UE5A 3NENA 2R7ZG 4LFCL 3ER0A 4A3DH 2KCMA 1PH8A 3H15A 1TWAH 3CCJA 1HJPA 2WAQE 4HJ8A 1WFQA 1EIFA 3ULLA 2LXJA 1ASYA 1G291 2Q2HA 1E1TA 4GS3A 4EQ5A 2FXQA 3H0GH 3NELA 4A3MH 1WYDA 2CFMA 4DPGA 1K3RA 2MFIA 3FKIG 4GLAC 5HGQA 5IE8A 4LFCQ 3HOWH 1V1QA 1YHAA 3PUXA 4JI0Q 4DR3L 1QVFA 4HIDA 1NE3A 5IP7H 4DV3L 3G71A 2NN6I 4IPCA 2E8GA 1KRSA 4JOIA 4DV1L 2Q2IA 4OWXB 4C3HH 1PYSB 2GN5A 2R7DA 3F8TA 1KRTA 4DR3Q 2Q2UA 2IX1A 1PFSA 2ATWA 3PO2G 1L1OB 4DV3Q 3EN2A 2JK8A 2UUCL 5IYBH 1Q81C 1YIJA 1YEZA 5C4JH 3NBHB 3IRBA 4YY3L 4DV1Q 3UDFA 2YTXA 1X56A 2K52A 2NZOA 3ULJA 1XPRA 4JC0A 1Q7YC 2A1AA 2B29A 1IBML 3I4MG 3S16H 5J3BA 3A5ZB 3S15H 1QUQB 2PNHA 3E0EA 3OW2A 1XMQQ 5HY6A 4PZ7A 2CCZA 1EWIA 4HJ9A 3H3VI 3CCRA 1YJWA 2UUCQ 2HT1A 4LF5L 2R92G 1D7QA 3J80c 4P75A 1PA6A 1VQIA 4YY3Q 4MZ9A 1AH9A 1YHBA 4X66L 3GTKH 1IBMQ 2BA1A 4PG3A 4P73A 4HIMA 5GADC 1LYLA 1UE6A 1N34Q 2VY3A 1Y1WG 4R1JA 4B3ML 1NY4A 4LF5Q 3CC2A 4BY7H 1SFOH 5EAYA 4PMWA 2F4VQ 2KCTA 1IXRA 1TXYA 4GOPC 4A3JH 4X66Q 3PUVA 3J81i 5LMNW 1TWGH 1D8LA 1UE7A 2EXDA 1VQDA 5M3MH 5IYDG 4LF9L 1X54A 5AJ3L 4B3MQ 3RLOA 3I56A 3S17H 3MEFA 1GO3E 4A3GH 4JBKA 2JA6H 4JBJA 1HR0W 4LNQA 2HIXA 2PQAA 3J7ZC 4WJ3M 1PH2A 1FVIA 2YYZA 4JI5L 4X62L 4L5QA 1K8GA 1IBLL 3NEMA 1X55A 4LF9Q 1W2BA 1FJGL 1RL2A 2K5HA 2AHOB 3KF6A 5AJ3Q 4YWLA 3CPFA 1CKNA 1Q8KA 5GAEC 3UDGA 4GN5A 3DM3A 4AQYL 3CMAA 3CD6A 1IBLQ 4JI5Q 1EUJA 1X6OA 4X62Q 5H1SE 4DV0L 1KC8C 3CCUA 1OXXK 2E2IH 4AYBG 4LUZA 4DUYL 1K0RA 1IZ6A 2PI2A 3ICEA 4A3DG 3KLWA 3PV0A 4LFBL 4JI8L 4DK6C 2ZTDA 4X64L 1N9WA 1BBUA 4IJLA 1VCIA 3F2BA 3F2CA 4A3MG 3H0GG 1CSQA 1YNXA 4LUOA 4GKJL 1Q82C 1XNRL 4YHHL 4R4OA 4DUYQ 1VQEA 4HJAA 3A0JA 1HZ9A 4QIWE 5IYCH 3VDYA 1YI2A 1TWCH 3HOWG 4FDBA 4JI8Q 4X64Q 3CF5A 3I4NH 4A3LH 1X9NA 1CKNB 5C0XJ 5IP7G 4AYBE 4JV5L 4JYAQ 4GKJQ 4DV6L 1SROA 1XNRQ 4IFDJ 4A3FH 1KXLA 4YHHQ 1EQRA 3U4VA 3H3VH 3F1ZA 3L0OA 1IL2A 3F2DA 3G6EA 3AQQA 4A3BH 4WJ4A 1E7ZA 4LF4L 2IHEA 2AWNA 1VQNA 1SE8A 2JA5H 2B63H 4DR4L 2OCEA 4JV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGJ A;  3STB C;  5IYB G;  3CCV A;  1I94 Q;  3PO3 H;  1Q46 A;  3M85 A;  3M4Q A;  4DV6 Q;  4A3K H;  1HH2 P;  2JA8 H;  4J15 A;  3U50 C;  1WJJ A;  3S2D H;  1J6Q A;  4NXM L;  1VQB A;  1NMG A;  4LF4 Q;  3S1N H;  4R4T A;  5LMN L;  1HNX L;  3GTM H;  4OO1 I;  2YV5 A;  4IPD A;  4DR4 Q;  5C0X G;  1E1O A;  1JMC A;  3KF8 B;  4DV4 L;  1YHQ A;  1U5K A;  4IOA A;  1K73 C;  4IFD G;  3M4O H;  1XPU A;  2BH2 A;  1KAW A;  4NXM Q;  4A76 A;  1HNX Q;  5LMN Q;  2OTJ A;  4A3E G;  1VQP A;  2VL6 A;  3DLL A;  4GKK L;  1BKB A;  1CKM A;  3HOY G;  3S1R H;  4OO1 G;  2K5V A;  1SLJ A;  3W1G A;  3CCQ A;  2JEB I;  4DV4 Q;  1PH9 A;  4BY7 G;  4A3J G;  2YU9 H;  4Y52 H;  3J81 c;  1XMO L;  4GLX A;  1L1O C;  4JI0 L;  4NB3 A;  4DR6 L;  1QZH A;  3PIP A;  4JI7 L;  3B6Y A;  1AE2 A;  1PH6 A;  5M3M G;  4BXX H;  2K50 A;  4OWT B;  4GNX A;  3TS0 A;  4GKK Q;  3E9H A;  4C3J H;  2LSS A;  3EIV A;  1JB7 A;  4H02 A;  2JA6 G;  4A3G G;  2PMZ E;  1WCM G;  2GVB A;  1XMO Q;  1JJG A;  4A4I A;  2VZA A;  4DR5 L;  4DR6 Q;  1S72 A;  3J7A 5;  4JI7 Q;  3RN2 A;  2DGY A;  5GAG C;  5M5Y H;  1VQ5 A;  2C35 B;  2K5N A;  1CKO A;  4K0K L;  4YCW A;  2Z0S A;  2VUM H;  5E7N A;  4BY1 H;  4JBM A;  4P74 A;  1V43 A;  4DR5 Q;  3ULP A;  3CCM A;  2JJQ A;  2QGQ A;  1Y1V H;  3TRE A;  5M3F G;  1XMQ L;  2E5L L;  3HOU G;  2UUA L;  1YJN A;  1Q12 A;  1O7I A;  3T1H L;  2AMC B;  3K80 C;  2XTI A;  3TEH B;  2NN6 G;  3RZO H;  3S2H H;  3K81 C;  4KHP Q;  4GNX B;  2E2H H;  4K0K Q;  2K4K A;  4QQB X;  3FHW A;  2IHF A;  1CSP A;  2NVX H;  1TWF H;  2ASB A;  1UE1 A;  3CME A;  1N34 L;  3CP0 A;  1C0A A;  2E5L Q;  3S14 H;  2Y0S G;  3PF4 A;  2UUA Q;  1B8A A;  1N8R C;  3T1Y L;  3T1H Q;  3JC6 6;  2F4V L;  1KD1 C;  4IPH A;  3M4P A;  3I4O A;  1SRU A;  4KI0 A;  5IYC G;  1HNZ L;  1PVO A;  1GM5 A;  1EFW A;  3I4N G;  4A3L G;  2YTY A;  3RLN A;  1N32 L;  3HOZ H;  4RMF A;  1P16 A;  4POF A;  1M1K C;  3T1Y Q;  4A3F G;  5FLX c;  3HFZ B;  4YWM A;  2QA4 A;  3ERS X;  2ZJP A;  2VS1 A;  4C3I H;  1HNZ Q;  4A75 A;  2QEX A;  3D31 A;  3CCS A;  1VS0 A;  5IP9 H;  4IPG A;  1X3E A;  2Y0S E;  4KLK A;  3HOX H;  2JA5 G;  2B63 G;  1N32 Q;  4DR1 L;  3PO3 G;  2HHH L;  4JI2 L;  4YWK A;  5FJ8 H;  4Y7N H;  4A3K G;  2K75 A;  4R4Q A;  2JA8 G;  3AEV A;  1IYJ B;  5FLM H;  3M3Y H;  2D62 A;  3HKS A;  1EQQ A;  2JA7 H;  2MQH A;  2V1C C;  3RR5 A;  1VQM A;  1HZB A;  2ZTE A;  4TVA B;  2ZJR A;  4DR1 Q;  1X3F A;  1QVC A;  4JI2 Q;  2HIV A;  1JE5 A;  4IOC A;  2HHH Q;  1EYG A;  4RG1 A;  4X65 L;  4GOP A;  2NVQ H;  1PYB A;  3RLF A;  1VQJ A;  2EIF A;  3K0X A;  3JAM i;  2UU9 Q;  4POG A;  2ZJQ A;  2DUD A;  4XIG S;  3KFU A;  4XTC S;  2IX0 A;  3HKZ G;  2F52 A;  1L0W A;  4DUZ L;  5IWA Q;  2BA0 A;  4X65 Q;  1XJV A;  4DR7 L;  2RHS B;  4LF6 L;  4JYA L;  1MJC A;  1B70 B;  1BVS A;  1A8V A;  4UY8 C;  4BXX G;  2PQA B;  2RF4 A;  3UE0 A;  1U0L A;  4DAY B;  1BBW A;  4YCV A;  1L2F A;  3FP9 A;  3AFP A;  3GTG H;  4DV7 L;  5C3E H;  3PUZ A;  4DUZ Q;  2RHQ B;  5ELN A;  2IT1 A;  3KF6 B;  5C4X H;  1QZG A;  4B3S L;  4LF8 L;  4DR7 Q;  1G6P A;  4GOP B;  2Z6K C;  4LF6 Q;  1I94 L;  1GKH A;  1HNW L;  3HKZ E;  1FGU A;  1H95 A;  2EQS A;  1P8L A;  2OQK A;  1A63 A;  1S40 A;  4GLV B;  1JT8 A;  2WB1 G;  2VUM G;  2JQO A;  4BY1 G;  4QGU A;  4DV7 Q;  4R4C A;  5JJK A;  4L5S A;  4B3S Q;  4LF8 Q;  3TS2 A;  1A0I A;  3K7A H;  4L5R C;  1E24 A;  3STB D;  1YJ9 A;  4DNI A;  2A8V A;  1HNW Q;  2KHJ A;  2MO1 A;  3TRZ A;  1LTL A;  3E9I A;  4A3C H;  2VNU D;  1OXU A;  1PH3 A;  2BH8 A;  4BBS H;  3BU2 A;  1KL9 A;  1QVG A;  1WOC A;  2N49 A;  4ME3 A;  4TQU S;  1KQS A;  1YBY A;  4LFA L;  2L15 A;  2RCN A;  1I3Q H;  3S24 A;  1ASZ A;  3A74 A;  5M5W H;  3M9B A;  4OON A;  2VQE L;  3UE1 A;  1MKH A;  1R9T H;  1HR0 L;  1DGS A;  1KIX A;  4DR2 L;  2ES2 A;  3HOZ G;  4MNO A;  2H5X A;  4LFA Q;  1VQ7 A;  3WWV A;  3ZJY C;  3HOV H;  4A3I H;  2VQE Q;  2I5L X;  1Q1B A;  4QL5 A;  1HR0 Q;  5IP9 G;  4JI4 L;  4YCU A;  2D0P A;  2MNA A;  3HOX G;  3CC7 A;  4DR2 Q;  1M90 C;  3CCL A;  5JJI A;  4IO9 A;  1VQA A;  2PI2 E;  4QJF A;  5JEA G;  3BZC A;  5FJ8 G;  1UEB A;  3L2P A;  1PHJ A;  4HJ5 A;  1E22 A;  4IJH A;  1VQ8 A;  2ZTC A;  5FLM G;  1X65 A;  3RN5 A;  2JA7 G;  3Q8D A;  5IY0 A;  4JI4 Q;  4AH6 A;  1PH5 A;  3S1Q H;  2OWO A;  3GTL H;  2ZM6 L;  4JOI C;  4KHP L;  4APV A;  5JJL A;  3CQZ H;  1S3O A;  3GD7 A;  3JAM c;  1J5E L;  1NMF A;  1VQH A;  3G4S A;  1L1O A;  5DLQ E;  3U58 A;  5GRO A;  3EBE A;  5LMU L;  3CW2 C;  1OXS C;  1FL0 A;  1SR3 A;  1PH1 A;  2I0Q A;  2ZM6 Q;  4OX9 Q;  4PZ6 A;  3UDI A;  5GAH C;  1QUQ A;  1J5E Q;  4DV2 L;  4PZ8 A;  2UXC L;  1VQG A;  1PH4 A;  1NJI C;  4KHZ A;  3GTO H;  2A19 A;  5LMU Q;  2YTV A;  4JBW A;  2E2J H;  2R93 H;  1OXT A;  2WP8 J;  4P72 A;  2CQO A;  1KHI A;  5C3E G;  2OTL A;  1IBK L;  5C4X G;  1VQL A;  1XTD A;  4DV2 Q;  2UXC Q;  4R4I A;  3OTO L;  4NPS A;  1C7Y A;  4X6A H;  3L7Z C;  2VW9 A;  1LM0 A;  4UP8 A;  5C44 H;  2LXK A;  4HIO A;  1K8A C;  3G48 A;  4A93 H;  1N33 L;  4UP9 A;  2AWO A;  1N36 L;  4A3B G;  3I7F A;  1PH7 A;  1MJE A;  3CCE A;  2NVT H;  1IBK Q;  3UDX A;  1I5F A;  3OTO Q;  2WFW A;  4LUV A;  2UXD L;  4O2D A;  2AKW B;  1E3P A;  4BBR H;  3PF5 A;  4A3C G;  4JI1 L;  3BJU A;  2R6G A;  4OXP A;  3GTQ H;  3PUY A;  1N36 Q;  1N33 Q;  2GVA A;  4BBS G;  1GD7 A;  1K9M C;  3TQY A;  4QY7 A;  2VQF L;  3K8A A;  2UU9 L;  4A3E H;  3KJO A;  3D0F A;  1Q1E A;  2I5H A;  3HOY H;  2UXD Q;  1YIT A;  4GN4 B;  2R7Z H;  4JI1 Q;  5IWA L;  2N78 A;  3PSI A;  4BA1 I;  3CC4 A;  1CUK A;  3AYH B;  3I2Z A;  1NTG A;  1Z47 A;  2VQF Q;  1TWH H;  4JI6 L;  1VQF A;  4NXN L;  1Q86 C;  1OTC A;  4GN3 B;  2N8N A;  4LW1 A;  5IT9 c;  2I5M X;  3FKI H;  4A3I G;  3HOV G;  2Q2T A;  3SGI A;  1JJ2 A;  4UPA A;  3KOJ A;  4C2M H;  2ID0 A;  1WCM H;  4DAM A;  1PV4 A;  4LWC A;  2JEA I;  1OXV A;  2NZH A;  3PIO A;  1JJC B;  1LUZ A;  3CXC A;  2KHI A;  4DV5 L;  1RIP A;  1YZ6 A;  3PCO B;  4JI6 Q;  1T9H A;  3A5U A;  4B3T L;  3PGZ A;  4NXN Q;  3RNU A;  1VQK A;  1Z9F A;  1V9P A;  2K14 A;  1XPO A;  2CWP A;  3RZD H;  1VQ4 A;  1X3G A;  1HZC A;  2CWA A;  3OYY A;  5M3F H;  3PO2 H;  2UUB L;  3HOU H;  4DV5 Q;  1VQ6 A;  1UWV A;  1MIU A;  4B3T Q;  2UXB L;  1FJG Q;  2D0O A;  1EOV A;  1A62 A;  3I4M H;  5GQO A;  1Y1V G;  4AQY Q;  4DK3 C;  1Y14 B;  1I6H H;  3KJP A;  4DV0 Q;  4P71 A;  2UUB Q;  2R92 H;  1G51 A;  2UXB Q;  5K36 G;  4LFB Q;  3J80 i;  3AFQ A;  3J81 j;  2CKZ B;  2KEN A;  3W5O A;  5JEA J;  4AIM A;  2MO0 A;  2Z6K A;  3PUW A;  3GTP H;  1Y1W H;  3KDF A;  2R93 G;  2WB1 E;  2B3G A;  4JI3 L;  1VQO A;  1VQC A;  1YVC A;  4HJ7 A;  2OQ0 A;  5C0X I;  4UP7 A;  3U4Z A;  1WI5 A;  3I55 A;  4IFD I;  5C44 G;  3GTJ H;  2JA9 A;  4O0A A;  5IYD H;  3K7U C;  5ELO A;  1NBW A;  1XNQ L;  1EIY B;  1SN8 A;  4JI3 Q;  1SMX A;  2JE6 I;  4A93 G;  1K83 H;  2N3S A;  3GDE A;  4MTN A;  4ALP A;  5M5X H;  1AE3 A;  5BR8 L;  2WAQ G;  3M7N A;  4BA2 I;  4JCV E;  4B3R L;  2IY5 B;  4GNX C;  3KYH C;  4LF7 L;  4BBR G;  4DKA C;  1W3S A;  3MXN B;  1I50 H;  2HQL A;  1B7Y B;  4L5T A;  1XNQ Q;  3S1M H;  2NVY H;  3KDF B;  1GVP A;  2ALY B;  1HZA A;  1C9O A;  3GO5 A;  3W1B A;  5BR8 Q;  4EX5 A;  2F3I A;  2KBN A;  4HIK A;  4B3R Q;  3CPW A;  3CAM A;  2R7F A;  4JG2 A;  3BZK A;  4LF7 Q;  4OWW B;  2XGT A;  4OX9 L;  1VQ9 A;  1UE5 A;  3NEN A;  2R7Z G;  4LFC L;  3ER0 A;  4A3D H;  2KCM A;  1PH8 A;  3H15 A;  1TWA H;  3CCJ A;  1HJP A;  2WAQ E;  4HJ8 A;  1WFQ A;  1EIF A;  3ULL A;  2LXJ A;  1ASY A;  1G29 1;  2Q2H A;  1E1T A;  4GS3 A;  4EQ5 A;  2FXQ A;  3H0G H;  3NEL A;  4A3M H;  1WYD A;  2CFM A;  4DPG A;  1K3R A;  2MFI A;  3FKI G;  4GLA C;  5HGQ A;  5IE8 A;  4LFC Q;  3HOW H;  1V1Q A;  1YHA A;  3PUX A;  4JI0 Q;  4DR3 L;  1QVF A;  4HID A;  1NE3 A;  5IP7 H;  4DV3 L;  3G71 A;  2NN6 I;  4IPC A;  2E8G A;  1KRS A;  4JOI A;  4DV1 L;  2Q2I A;  4OWX B;  4C3H H;  1PYS B;  2GN5 A;  2R7D A;  3F8T A;  1KRT A;  4DR3 Q;  2Q2U A;  2IX1 A;  1PFS A;  2ATW A;  3PO2 G;  1L1O B;  4DV3 Q;  3EN2 A;  2JK8 A;  2UUC L;  5IYB H;  1Q81 C;  1YIJ A;  1YEZ A;  5C4J H;  3NBH B;  3IRB A;  4YY3 L;  4DV1 Q;  3UDF A;  2YTX A;  1X56 A;  2K52 A;  2NZO A;  3ULJ A;  1XPR A;  4JC0 A;  1Q7Y C;  2A1A A;  2B29 A;  1IBM L;  3I4M G;  3S16 H;  5J3B A;  3A5Z B;  3S15 H;  1QUQ B;  2PNH A;  3E0E A;  3OW2 A;  1XMQ Q;  5HY6 A;  4PZ7 A;  2CCZ A;  1EWI A;  4HJ9 A;  3H3V I;  3CCR A;  1YJW A;  2UUC Q;  2HT1 A;  4LF5 L;  2R92 G;  1D7Q A;  3J80 c;  4P75 A;  1PA6 A;  1VQI A;  4YY3 Q;  4MZ9 A;  1AH9 A;  1YHB A;  4X66 L;  3GTK H;  1IBM Q;  2BA1 A;  4PG3 A;  4P73 A;  4HIM A;  5GAD C;  1LYL A;  1UE6 A;  1N34 Q;  2VY3 A;  1Y1W G;  4R1J A;  4B3M L;  1NY4 A;  4LF5 Q;  3CC2 A;  4BY7 H;  1SFO H;  5EAY A;  4PMW A;  2F4V Q;  2KCT A;  1IXR A;  1TXY A;  4GOP C;  4A3J H;  4X66 Q;  3PUV A;  3J81 i;  5LMN W;  1TWG H;  1D8L A;  1UE7 A;  2EXD A;  1VQD A;  5M3M H;  5IYD G;  4LF9 L;  1X54 A;  5AJ3 L;  4B3M Q;  3RLO A;  3I56 A;  3S17 H;  3MEF A;  1GO3 E;  4A3G H;  4JBK A;  2JA6 H;  4JBJ A;  1HR0 W;  4LNQ A;  2HIX A;  2PQA A;  3J7Z C;  4WJ3 M;  1PH2 A;  1FVI A;  2YYZ A;  4JI5 L;  4X62 L;  4L5Q A;  1K8G A;  1IBL L;  3NEM A;  1X55 A;  4LF9 Q;  1W2B A;  1FJG L;  1RL2 A;  2K5H A;  2AHO B;  3KF6 A;  5AJ3 Q;  4YWL A;  3CPF A;  1CKN A;  1Q8K A;  5GAE C;  3UDG A;  4GN5 A;  3DM3 A;  4AQY L;  3CMA A;  3CD6 A;  1IBL Q;  4JI5 Q;  1EUJ A;  1X6O A;  4X62 Q;  5H1S E;  4DV0 L;  1KC8 C;  3CCU A;  1OXX K;  2E2I H;  4AYB G;  4LUZ A;  4DUY L;  1K0R A;  1IZ6 A;  2PI2 A;  3ICE A;  4A3D G;  3KLW A;  3PV0 A;  4LFB L;  4JI8 L;  4DK6 C;  2ZTD A;  4X64 L;  1N9W A;  1BBU A;  4IJL A;  1VCI A;  3F2B A;  3F2C A;  4A3M G;  3H0G G;  1CSQ A;  1YNX A;  4LUO A;  4GKJ L;  1Q82 C;  1XNR L;  4YHH L;  4R4O A;  4DUY Q;  1VQE A;  4HJA A;  3A0J A;  1HZ9 A;  4QIW E;  5IYC H;  3VDY A;  1YI2 A;  1TWC H;  3HOW G;  4FDB A;  4JI8 Q;  4X64 Q;  3CF5 A;  3I4N H;  4A3L H;  1X9N A;  1CKN B;  5C0X J;  5IP7 G;  4AYB E;  4JV5 L;  4JYA Q;  4GKJ Q;  4DV6 L;  1SRO A;  1XNR Q;  4IFD J;  4A3F H;  1KXL A;  4YHH Q;  1EQR A;  3U4V A;  3H3V H;  3F1Z A;  3L0O A;  1IL2 A;  3F2D A;  3G6E A;  3AQQ A;  4A3B H;  4WJ4 A;  1E7Z A;  4LF4 L;  2IHE A;  2AWN A;  1VQN A;  1SE8 A;  2JA5 H;  2B63 H;  4DR4 L;  2OCE A;  4JV5 Q; 
#chains in the Genus database with same CATH topology
 3STB C;  1I94 Q;  4A3K H;  5D14 A;  3HOY B;  3U50 C;  2RDG A;  1VQB A;  1NMG A;  4I7A A;  4OO1 I;  2XN9 C;  4IPD A;  4DR4 Q;  1JMC A;  4K5W A;  3KF8 B;  3W3A A;  1DYQ A;  4IFD G;  1D6E C;  3M4O H;  2EY6 A;  1U4P A;  3E3X A;  1NR2 A;  1HXY D;  5ELF A;  1VQP A;  1BKB A;  3HOY G;  2K5V A;  5I6Y A;  2KEC A;  3O13 A;  1PH9 A;  1D2B A;  2J7Z A;  1LTS D;  4Y52 H;  4JI0 L;  4IAL A;  4DR6 L;  1KTK A;  3PIP A;  2F0V A;  5LL6 S;  2XRQ D;  4GNX A;  5M3F B;  3E9H A;  3HOU B;  3EIV A;  1EEI D;  2GVB A;  1XMO Q;  2VZA A;  4EGV A;  1HTP A;  2DNE A;  3KLS X;  1O7Y A;  1EY4 A;  2VUM H;  2QDB A;  3HG9 A;  4BY1 H;  2B2Y C;  5M3F G;  1XMQ L;  2O5I C;  3A7A B;  3HOU G;  3I90 A;  1YJN A;  5CV8 A;  5ELC A;  1F9P A;  2AMC B;  2QEJ C;  2O5J C;  3S2H H;  3AU7 A;  4DGZ A;  3TN2 A;  1TWF H;  1UE1 A;  3DUZ A;  1FYC A;  3H09 A;  2UUA Q;  5IGF A;  5C3X A;  1Y8P B;  1KD1 C;  3HS0 C;  3I4N G;  3MVV A;  1B1Z A;  3RLN A;  3S1N B;  3T51 B;  4YWM A;  1EOT A;  3A8J E;  5D65 A;  2H4O A;  4M1U B;  2ZJP A;  1JWS D;  1I50 B;  3FRP B;  3CCS A;  2NVY B;  4DAV A;  3NWS A;  2Y0S E;  1ENA A;  1LLR D;  4KLK A;  3HOX H;  1UAP A;  3RMH A;  2HHH L;  5FJ8 H;  4R4Q A;  3V05 A;  2JA8 G;  2VXW A;  2JA7 H;  1HZB A;  2ZTE A;  4QCL A;  4A3M B;  1X3F A;  1QVC A;  1RD9 D;  4JI2 Q;  1JE5 A;  3NXW A;  2NVQ H;  1IKL A;  3SEB A;  2EIF A;  3K0X A;  5CV5 A;  2ZJQ A;  5EKL A;  4XTC S;  1A3U A;  1HCZ A;  1MGS A;  1LTR D;  1V1P A;  4HSP A;  1ZXT A;  1B70 B;  3IFD A;  4DAY B;  1BBW A;  3FP9 A;  1G2S A;  3AFP A;  2RHQ B;  4LF8 L;  2IT1 A;  1DOL A;  2L5T A;  1F2Z A;  3SXH A;  3EJI A;  1E0B A;  4NDX A;  5EPL A;  2E76 C;  3VR4 A;  3SHL A;  3D3R A;  1BCP D;  1JT8 A;  2WB1 G;  5F2D A;  5CR3 A;  4B3S Q;  1A0I A;  3TP5 A;  4Q5V A;  4L5R C;  3S9W A;  2Q8R E;  1HFG A;  2KHJ A;  3E9I A;  2VNU D;  4G7Z C;  2XSC A;  4BBS H;  1LTT D;  1AN8 A;  2KA7 A;  2IX3 A;  3K5L A;  1QVG A;  2N49 A;  4B08 A;  1YBY A;  5I9O A;  1Q8I A;  3ND8 A;  1ASZ A;  3M9B A;  4OON A;  1HR0 L;  1KIX A;  2ES2 A;  3H91 A;  3M3Y B;  3HOZ G;  1S4Z A;  1ZYR D;  1BQQ T;  1TY0 A;  1RF2 D;  2I5L X;  1Q1B A;  4QL5 A;  3GV3 A;  1CFM A;  4YCU A;  2MNA A;  4IUR A;  3CC7 A;  4DR2 Q;  1M90 C;  1GUW A;  4IO9 A;  4CDE C;  5IGG A;  3DHQ A;  3L2P A;  5EBC A;  2F0Q A;  4M8A A;  5DNF A;  5FLM G;  5CV7 A;  1X65 A;  2EYM A;  1EY6 A;  4JI4 Q;  1JCK B;  4AH6 A;  3NBI A;  3OWF A;  4FNF A;  2ZM6 L;  4JOI C;  4QMG A;  4APV A;  2L0C A;  1SYC A;  3N6R A;  3JAM c;  4ZLT F;  1L1O A;  3U58 A;  1PRT C;  3EBE A;  3CW2 C;  3NBH A;  1PH1 A;  1U4L A;  4OGQ C;  3UDI A;  2KOL A;  2UXC L;  1VQG A;  1PH4 A;  4KHZ A;  2A19 A;  5IOD A;  2E2J H;  1OXT A;  2WP8 J;  4P72 A;  2CQO A;  3VR3 A;  2KCN A;  4K6L A;  3LX0 A;  1XTD A;  1H9J A;  4NPS A;  2VW9 A;  3GTM B;  5FOB B;  1LM0 A;  4UP8 A;  4HIO A;  2E75 C;  4Q0F A;  1SYE A;  4IUQ A;  1SE4 A;  3U9S A;  1QWY A;  1MJE A;  1Y8N B;  4IUT A;  1R9T B;  2IL8 A;  2WFW A;  4CDF C;  4O2D A;  1HUN A;  2AKW B;  4BBR H;  3BJU A;  4HSV A;  4OXP A;  2LS0 1;  3PUY A;  5FKA C;  2VQF L;  1DD2 A;  4A3E H;  2UXD Q;  1YIT A;  3PSI A;  4BA1 I;  4ZAI A;  3MEH A;  1NTG A;  1TWH H;  1LT4 D;  1Q86 C;  1OTC A;  4LW1 A;  5IT9 c;  4A3I G;  3AMU A;  3SGI A;  1MI2 A;  4C2M H;  3VYT A;  1OXV A;  4K14 A;  5CMD A;  1I6V C;  2K01 A;  2KHI A;  1Y1V B;  4JI6 Q;  3RNU A;  1B53 A;  1I4R A;  1X3G A;  2CWA A;  5IGE A;  2J0T D;  3FMC A;  1SNP A;  2UUB L;  1VQ6 A;  1UWV A;  2GA4 B;  3PMF A;  3I8Z A;  2HDL A;  4B3T Q;  2UXB L;  1FJG Q;  1EOV A;  2NN6 H;  2G5D A;  3NQT A;  3T53 B;  4N9T A;  1D5Z C;  1Y1V G;  1LTG D;  4DK3 C;  1Y14 B;  5EQ0 A;  4IUP A;  2R92 H;  1CQV A;  1QJO A;  2I07 B;  1G51 A;  5COR A;  3T4A C;  5K36 G;  1IW7 D;  1NAP A;  3DXJ C;  3QR8 A;  1ET9 A;  3NTI A;  1HQM C;  3KF8 A;  5JEA J;  2MO0 A;  2NVT B;  1TKW B;  3PUW A;  1E2Z A;  4UHV A;  1B3Q A;  3NPP A;  2L55 A;  2WB1 E;  2B3G A;  1SNM A;  1SSO A;  2EZV A;  4Y7N B;  4HJ7 A;  3MHB A;  4ABN A;  3I55 A;  1PTO C;  3GTJ H;  3SE0 A;  5ELO A;  3FDT A;  4JVZ A;  4JI3 Q;  4A93 G;  4MTN A;  1WVL A;  5M5X H;  2NTS A;  1CT1 D;  1TS2 A;  1J9O A;  1EYD A;  3KYH C;  4LF7 L;  1SE3 A;  1B7Y B;  5DAU A;  2F3I A;  1BCP B;  3CPW A;  3VR5 A;  4OWW B;  2FHT A;  1DCZ A;  2KCM A;  1PH8 A;  3CCJ A;  2WAQ E;  1SAP A;  5KRU A;  3J81 E;  1ASY A;  4GS3 A;  3BDO A;  2JN4 A;  1BBX C;  4DPG A;  5BN4 A;  5D3D A;  4GLA C;  5HGQ A;  2Z1C A;  5IE8 A;  4LFC Q;  3HOW H;  2BE5 C;  3PUX A;  2SEB D;  4DR3 L;  1QVF A;  1STG A;  2Z4H A;  3NQI A;  2NN6 I;  4IPC A;  2E8G A;  3N52 A;  2B2W C;  2Q2I A;  2G9H D;  2N55 A;  1PYS B;  1ROD A;  2Q2U A;  2PZW A;  2RSN A;  3NTH A;  2XWB B;  2UUC L;  4R8N A;  1E2V A;  5C4J H;  3ND9 A;  4DV1 Q;  3GTP B;  2YTX A;  2WIN B;  1Y8O B;  3I4M G;  1LAB A;  1QUQ B;  3Q0A A;  3OW2 A;  3BVM A;  1EWI A;  5C0X H;  5A35 A;  1PA6 A;  1VQI A;  1QB5 D;  3GTK H;  2F0L A;  1B2T A;  2K5W A;  4HIM A;  1UE6 A;  1F2M A;  4F87 A;  3OWE B;  1IL8 A;  3SVM A;  4LF5 Q;  3R2I A;  4C1N K;  1D1I A;  2KCT A;  1TT2 A;  4GOP C;  4A3J H;  2K33 A;  3S1M B;  1LT5 D;  4LK1 C;  3K5M A;  1UE7 A;  3QIA A;  2EXD A;  1H9R A;  1VQD A;  2B2V A;  2FJ2 A;  5M3M H;  1XTC D;  3BVZ A;  3NTK A;  5IYD G;  5AJ3 L;  4G4K A;  3S17 H;  4A3G H;  4XQJ A;  3FPU B;  2CW0 C;  2FMM A;  2HIX A;  2PQE A;  3QOJ A;  1FVI A;  3MAQ A;  4L5Q A;  1STE A;  1FNU A;  3EVQ A;  3H0G B;  2MUY A;  1AZQ A;  4GN5 A;  4AQY L;  1CTM A;  1IBL Q;  4DV0 L;  2E2I H;  1SEB D;  4ZCK A;  2F0F A;  1RHP A;  4I7Z C;  3ICE A;  4A3D G;  2R93 B;  2PW5 A;  2SNS A;  3WDN A;  1BBU A;  4IJL A;  1VCI A;  3WOF A;  5KIX A;  3H0G G;  2NUC A;  4YHH L;  4KY7 A;  4R4O A;  4HJA A;  3A0J A;  1JC7 A;  5IYC H;  4RKL A;  3TP8 A;  4JI8 Q;  3P20 A;  1X9N A;  1EZ6 A;  5IP7 G;  3L3O C;  1KXL A;  4A3F H;  3H3V H;  2V4D A;  1SDF A;  4CDC C;  1F2Y A;  1EY0 A;  3AQQ A;  4A3B H;  1E7Z A;  2IHE A;  2AWN A;  2B8F A;  2B63 H;  4DR4 L;  1B44 D;  2QDL A;  3LGJ A;  5IYB G;  2QIL A;  3CCV A;  5ELD A;  1T5E A;  3M4Q A;  3Q23 A;  1HH2 P;  4J15 A;  4ZRZ A;  1J6Q A;  4BY7 B;  4ZUJ A;  2RVL A;  4LF4 Q;  4R4T A;  5IOC A;  1BUV T;  1C48 A;  2YV5 A;  1YHQ A;  3JAM L;  1KAW A;  3TME A;  4A76 A;  4NXM Q;  2CVR A;  1W6K A;  4P2C B;  4OO1 G;  3CCQ A;  4BY7 G;  2DJG C;  2JEB I;  2WKC A;  1CM9 A;  1XMO L;  2BCO A;  4NB3 A;  1QZH A;  2IW3 A;  2F4I A;  1VF7 A;  4BXX H;  3R2T A;  4GKK Q;  4OWT B;  3TS0 A;  2K5D A;  4H13 C;  3PO2 B;  4C3J H;  5CBA E;  1T5X D;  2JA6 G;  1JWM D;  1F9Q A;  1SYD A;  2PPB C;  5J1Z A;  1S72 A;  4HCE A;  4K6D A;  3RN2 A;  4JI7 Q;  4RGT A;  2EE1 A;  5M5Y H;  1VQ5 A;  3DWA A;  2C35 B;  2Y0S B;  1CKO A;  4FXK C;  3QWN A;  2Z0S A;  4XQQ A;  1V43 A;  2BDO A;  2PCF B;  1TWC B;  2FIN B;  4RGO S;  4WJW A;  2F0T A;  2UUA L;  1O7I A;  4ZK9 B;  4XQN A;  3TEH B;  3RZO H;  2A6E D;  2E2H H;  2IHF A;  5I2Y A;  3CME A;  1QE6 A;  2Y0S G;  4DFA A;  5LL6 X;  3PF4 A;  3T1H Q;  3JC6 6;  4IPH A;  3M4P A;  1SRU A;  4DNR B;  1PVO A;  1EFW A;  3GV6 A;  3OIQ A;  4C56 C;  4RMF A;  1P16 A;  5IT9 L;  5KNB A;  1M1K C;  3D4W A;  3VR6 A;  3T1Y Q;  5FLX c;  2QA4 A;  5E4X A;  1QG7 A;  4IQZ A;  1HNZ Q;  1Z7T A;  4IPG A;  2JA5 G;  1S5B D;  2A5H A;  4JI2 L;  4HCS A;  4YWK A;  4A3K G;  3ERQ A;  2RKS A;  4S3S A;  2D62 A;  1EQQ A;  1TWA B;  1VQM A;  1Q90 A;  2A68 D;  4DR1 Q;  1BOS A;  1MSH A;  1Z6H A;  4RG1 A;  3KUP A;  4KHV A;  1G2T A;  5C3W A;  1ILP A;  1S5F D;  1VQJ A;  3JAM i;  3BYT B;  5CV9 A;  1C8C A;  1W6J A;  1G6Z A;  2DUD A;  2PYK A;  2L9H A;  3NHH A;  3KFU A;  4NP5 A;  4L63 B;  5IGC A;  2F52 A;  1L0W A;  2F0I A;  5IWA Q;  1XJV A;  1M8A A;  1SND A;  2E74 C;  4C3H B;  2VUM B;  4JYA L;  1BVS A;  1JR0 D;  1LTA D;  2PQA B;  2RF4 A;  1EY9 A;  4JK1 C;  1PDQ A;  3DMU A;  3E6Z X;  3FPP A;  1FNV A;  1L2F A;  1WTR A;  2RDF A;  4DU9 A;  3GTG H;  5C3E H;  3PUZ A;  1AP0 A;  5ELN A;  5C4X H;  4B3S L;  3KF6 B;  3S2H B;  1G6P A;  3PIO 3;  1XWE A;  5KEE A;  4GOP B;  3S16 B;  1H95 A;  3HKZ E;  1I4G A;  5E4W C;  2EQS A;  1A63 A;  4GLV B;  1LTB D;  2VUM G;  4BY1 G;  4DV7 Q;  5JJK A;  1FD7 D;  4L5S A;  1SJE D;  3NSW A;  3A8K E;  3K7A H;  3STB D;  4FYD A;  1SXT A;  2A8V A;  4KMU C;  1LTL A;  1OXU A;  2CQA A;  2BH8 A;  3BU2 A;  4ODG A;  1WOC A;  4KV6 A;  4TQU S;  2DY7 A;  1I3Q H;  2ZXR A;  1TWG B;  5M5W H;  5A2Q L;  1TS4 A;  3I91 A;  5JAV A;  1MKH A;  4DR2 L;  2JYO A;  3CHB D;  2JA7 B;  4V0B A;  4LFA Q;  3LWU A;  3WWV A;  3HOV H;  2VQE Q;  3K6O A;  4JI4 L;  3CCL A;  3HOX G;  1KNE A;  1VQA A;  2PI2 E;  3LWE A;  5FJ8 G;  1UEB A;  4HJ5 A;  3OMC A;  2F3V A;  2JA7 G;  3Q8D A;  5IY0 A;  3GTL H;  3VR2 A;  1K28 A;  4KHP L;  4FO2 A;  1K3B C;  5DLQ E;  2EOT A;  3I4N B;  4RHS A;  1B9N A;  4OX9 Q;  1PYW D;  5GAH C;  1QUQ A;  4DK1 A;  4PZ8 A;  2F0E A;  1H9S B;  2VB2 X;  1KHI A;  3U9O A;  2OTL A;  2JA8 B;  4BBS B;  1EQV A;  5JJZ A;  4X6A H;  3OHX C;  5C44 H;  4UP9 A;  1IKM A;  1PH7 A;  2MHV A;  3T13 A;  1IBK Q;  3OTO Q;  1AEX A;  2UXD L;  3PF5 A;  4BBS G;  1KDC A;  4R8I A;  4QY7 A;  2UU9 L;  2CH4 W;  1GJX A;  3IFT A;  2Z4I A;  3MA2 B;  3D0F A;  1Q1E A;  3HOY H;  4GN4 B;  1PFM A;  3I2Z A;  1EIG A;  2BOS A;  2AUK A;  1Z47 A;  2B39 A;  2J4X A;  2RCF A;  3FEW X;  4JI6 L;  5J39 A;  1EY7 A;  2ID0 A;  3IAY A;  2WB1 B;  3KBX A;  3CXC A;  4C1N I;  1JJC B;  1LUZ A;  3URY A;  2EXZ A;  4NXN Q;  4B3T L;  3PGZ A;  1PFB A;  4KY6 A;  2K14 A;  1VQ4 A;  3OYY A;  3C1E A;  2NVX B;  5M3F H;  2QKI C;  4N8X 1;  3HOU H;  3J7A V;  2KCC A;  1LO5 D;  2D0O A;  4ZQ3 A;  2F3W A;  1ET6 A;  1RDP D;  2F0S A;  4G57 A;  5EBD A;  3KJP A;  4P71 A;  3HOZ B;  1JOR A;  4WRD A;  3QJY A;  3AFQ A;  3J81 j;  2CKZ B;  4MTK A;  2WKD A;  2PZT A;  5COY A;  2Z6K A;  3MZ5 A;  2WAQ B;  2MPM A;  4JI3 L;  1VQC A;  2XRS D;  1SMY D;  4UP7 A;  2HUG A;  1WI5 A;  1DM0 B;  1PZK D;  4IFD I;  2JA9 A;  4O0A A;  3GDE A;  5ISR A;  2WII B;  2WAQ G;  3M7N A;  4CJ0 B;  4GNX C;  1JQY D;  3H3V C;  4BBR G;  1W3S A;  3MXN B;  1I50 H;  1HFN A;  4L5T A;  2NVY H;  3VYU A;  1I4P A;  3KDF B;  2HD3 A;  1GVP A;  2ALY B;  3W1B A;  4HIK A;  3K5O A;  2R7F A;  4X3S A;  4L6T B;  5FK9 C;  3BYY B;  3NEN A;  4LFC L;  3ER0 A;  3MFY A;  4J6H A;  3HZX A;  4HJ8 A;  1A2U A;  1HQR D;  2Q2H A;  1G29 1;  1PXU A;  2A6H C;  4A3M H;  1WYD A;  2NZ1 D;  4XYO A;  2R3Z A;  4RCO A;  1V1Q A;  1KLG D;  4JI0 Q;  4HID A;  1ONL A;  1NE3 A;  2F0M A;  1F2L A;  3KBG A;  4F8M A;  5FLX L;  3L9A X;  1RKN A;  1KRS A;  4F7X A;  4DV1 L;  1SYB A;  2R92 B;  2K1B A;  2Q8T A;  2O4X A;  1ICW A;  2R7D A;  1PFS A;  2ATW A;  1L0Y B;  4DV3 Q;  3EN2 A;  3HP3 A;  1IYV A;  1Q81 C;  1C4Q A;  1CHP D;  3IRB A;  3UDF A;  3ULJ A;  1Q7Y C;  4JC0 A;  1KAB A;  2B29 A;  2MJ8 A;  4H0L C;  4QUF A;  3E0E A;  1XMQ Q;  5HY6 A;  3CCR A;  1YJW A;  2R92 G;  4LF5 L;  4P75 A;  4TRD A;  1AH9 A;  5EPK A;  3J80 E;  2BA1 A;  1QCB D;  1QIL A;  2EYF A;  4A3I B;  1G91 A;  1GUT A;  1WTH A;  2VY3 A;  1HA5 A;  3D4R A;  2K05 A;  4LJZ C;  1IXR A;  4DA2 A;  3PUV A;  2F0P A;  5LMN W;  2JSO A;  1HTL D;  3S1Q B;  3J7A F;  1SNQ A;  4B3M Q;  4JBK A;  4JBJ A;  1HR0 W;  3CQZ B;  2PQA A;  2X6L A;  4WOR A;  1IBL L;  3TSS A;  4TSS A;  3TZD A;  1W2B A;  2K5H A;  2AHO B;  1EEF D;  2K32 A;  3KF6 A;  3CPF A;  1CKN A;  5LHY 1;  4RA8 A;  3CD6 A;  4JI5 Q;  4IZ8 A;  4X62 Q;  5H1S E;  4FXG C;  5D3I B;  3CCU A;  1KC8 C;  1YNN D;  4K8J A;  1WTP A;  3KLW A;  3PV0 A;  3K0Y A;  4IUU A;  4JI8 L;  4DK6 C;  2ZTD A;  4DXG A;  4LFB L;  1N9W A;  1YNJ D;  3I3C A;  1CSQ A;  4LUO A;  4BS9 A;  5CYU A;  1R4Q B;  1VQE A;  3MXU A;  3VDY A;  3HOW G;  3OIP A;  5C4J B;  4A93 B;  4X64 Q;  3CF5 A;  4A3L H;  4R9W A;  5DEH A;  5C0X J;  4AYB E;  4MN3 A;  3BDL A;  1XNR Q;  5EJW A;  1TY2 A;  1DOM A;  3U4V A;  3F1Z A;  4O42 A;  4XT1 B;  3F2D A;  4WJ4 A;  3GTQ B;  4LF4 L;  4FVM A;  1VQN A;  1NNX A;  4JV5 Q;  4IUV A;  3PO3 H;  1Q46 A;  4DV6 Q;  2F0J A;  1BF4 A;  2RSO A;  3S2D H;  4NXM L;  1IW7 C;  2DJF C;  3GTM H;  2SDF A;  4KY5 A;  1B50 A;  5C0X G;  1E1O A;  3V2T A;  4DAP A;  1K73 C;  5M3M B;  1XPU A;  3I72 A;  2BH2 A;  3S17 B;  1HNX Q;  5LMN Q;  1WCM B;  2VL6 A;  3DLL A;  4GKK L;  1CKM A;  3S1R H;  4DV4 Q;  1SLJ A;  2WV6 D;  3W1G A;  4A3J G;  2YU9 H;  3KLS A;  1KDB A;  1L1O C;  4ULL A;  4ID6 A;  2XWJ B;  4JI7 L;  1AE2 A;  3B6Y A;  5M3M G;  4FF4 A;  3SK5 A;  2LSS A;  1JB7 A;  4A3G G;  4H02 A;  1H9S A;  2PMZ E;  1WCM G;  1JJG A;  3P1H A;  4K5V A;  4J8Q A;  1X3Q A;  3I4M B;  2EYJ A;  2L4N A;  5JOB A;  4YCW A;  2ZXO A;  3K58 A;  5E7N A;  1EY5 A;  4P74 A;  2X69 A;  4DR5 Q;  3CCM A;  1S5C D;  2QGQ A;  1Y1V H;  3TRE A;  5E3F A;  3T1H L;  1X3P A;  2XTI A;  3D8G A;  4K0K Q;  3K81 C;  4GNX B;  2K4K A;  3NP8 A;  4A3F B;  5K36 H;  4GZY C;  2ASB A;  2JXM B;  3K59 A;  1N34 L;  4I65 A;  2E5L Q;  3S14 H;  3HEJ A;  1B8A A;  1N8R C;  3T1Y L;  2IPK D;  1BCP F;  2F4V L;  5IYC G;  3I4O A;  1HNZ L;  4B9X A;  1FR3 A;  3DWP A;  5FO8 B;  3SDZ A;  1PRT B;  4A3F G;  5NUC A;  3HFZ B;  1EWC A;  2VS1 A;  4C3I H;  1IHZ A;  5IP9 H;  2B63 G;  3D6C A;  1N32 Q;  2IJ0 A;  4DR1 L;  5JEA H;  1EZ8 A;  1KDA A;  4Y7N H;  2C5C A;  4J1M A;  3NK9 A;  4A3D B;  2FMC A;  3HKZ B;  3TBI B;  2WAC A;  2MQH A;  4DAY A;  2ZJR A;  1AFP A;  3EFX D;  2A69 D;  1EYG A;  4C3J B;  1PYB A;  3RLF A;  1A3V A;  1BNZ A;  3K5N A;  2RBM A;  4POG A;  2NBF A;  3HKZ G;  5IT9 E;  4X65 Q;  3C2P A;  5C5M A;  1MJC A;  1A8V A;  3E0J A;  4BXX G;  3UE0 A;  1U0L A;  4C3J G;  5M9O A;  1QNU A;  4DV7 L;  4DUZ Q;  2F0K A;  4DR7 Q;  2E2H B;  4LF6 Q;  5C6A A;  3S15 B;  1I94 L;  1FGU A;  2ZT9 C;  4QGU A;  2EY1 A;  1O78 A;  2L1B A;  1E24 A;  1YJ9 A;  2RA4 A;  4DNI A;  4LMQ D;  1HNW Q;  1HRJ A;  2MO1 A;  1K8M A;  3TRZ A;  4A3C H;  3MFG A;  4DNT B;  1SFO B;  1STY A;  4XDX A;  4ME3 A;  4DF7 A;  3MXN A;  4LFA L;  3QO2 A;  2L15 A;  1QNK A;  2EYO A;  2VQE L;  1DGS A;  2B2T A;  4KN7 C;  3OOC A;  4N8F A;  2JA6 B;  4FXD A;  2DN8 A;  3MWY W;  3P75 A;  1OO9 B;  1VMC A;  2H5X A;  2M2L A;  1GUG A;  1VQ7 A;  4X3U A;  1WTQ A;  4XXE A;  5JJI A;  5EGT A;  1CZG A;  5C5L A;  3BZC A;  1PHJ A;  1VQ8 A;  2ZTC A;  2NB0 A;  2F0H A;  1PH5 A;  4UDU C;  1XYI A;  2OWO A;  1HPC A;  1XX8 A;  2Z8L A;  1EFI D;  1PTO B;  1S3O A;  4Z9C B;  4NW2 A;  1NMF A;  1VQH A;  1RTO A;  2QW7 A;  2KEE A;  5C3E B;  3BS1 A;  1OXS C;  1FL0 A;  1SR3 A;  2I0Q A;  1KLU D;  3J7Y W;  4RHR A;  3K57 A;  1J5E Q;  3M4Y A;  3GTO H;  4PQX A;  5LMU Q;  1FNW A;  2JA5 B;  3K7A B;  2R93 H;  4XT3 B;  2HCI A;  4H44 C;  5C3E G;  4A3K B;  1IBK L;  5C4X G;  3NWT A;  4JPB W;  4DV2 Q;  4ZYS A;  2D9U A;  5C4Z A;  3OTO L;  1C7Y A;  2AQ1 B;  3CRL C;  1K8A C;  3G48 A;  2AWO A;  3OW7 A;  3M4O B;  3UDX A;  5HGT A;  1PZI D;  5HUR A;  2B2V C;  5KYI A;  2EY5 A;  1UUP A;  2R6G A;  1N33 Q;  1N36 Q;  1GD7 A;  3G7L A;  1A3T A;  1K9M C;  3K8A A;  3KJO A;  2I5H A;  2ICI A;  1GHK A;  2R7Z H;  4JI1 Q;  3ONA B;  1BXT A;  3CC4 A;  1CUK A;  1GXD C;  1UEA B;  3C1F A;  3TDQ A;  3SK6 A;  1VQF A;  4NXN L;  2N8N A;  3HOV G;  3FKI H;  2Q2T A;  4UPA A;  4BY1 B;  3X3N A;  3PIO A;  2M00 A;  1YZ6 A;  3DWQ A;  1T9H A;  3A5U A;  1VQK A;  1XPO A;  2CWP A;  3RZD H;  5ELE A;  1PFN A;  1TWF B;  3PO2 H;  2OT2 A;  2E2D C;  4DV5 Q;  4FF2 A;  3Q24 A;  1HHV A;  1PLF A;  5KNC A;  1A62 A;  3V96 A;  5GQO A;  4AQY Q;  3IL8 A;  1I6H H;  4DV0 Q;  1J8I A;  5EPJ A;  3LNN A;  4HN7 A;  1STA A;  5C44 B;  3W5O A;  1EU4 A;  2F03 A;  3GQB A;  3HOX B;  1Y1W H;  2F0W A;  1VQO A;  4HTH A;  1CA6 A;  1GOZ A;  1YVC A;  1H9M A;  5FO7 B;  1A6X A;  2OQ0 A;  5KYL A;  4KD4 A;  4B9W A;  3U4Z A;  5IGD A;  5C44 G;  1NBW A;  4KK7 A;  1EIY B;  4CHT B;  1K83 H;  1MD2 D;  4RGN A;  3SK4 A;  2N3S A;  3BZD B;  1AE3 A;  2NVQ B;  3G6J B;  4BA2 I;  4JCV E;  2EYL A;  1A15 A;  4DKA C;  1XNQ Q;  1LAC A;  2HDM A;  3X3M A;  3FVQ A;  2X6G A;  2Z9H A;  5CBE E;  1HZA A;  5BR8 Q;  4B3R Q;  1JE4 A;  4HR7 B;  3QB3 A;  2M9V A;  1X32 A;  3A54 A;  3BZK A;  1VF5 C;  4CJ1 B;  5T1G A;  5JPN C;  3H15 A;  1TWA H;  1HJP A;  1HUM A;  1WFQ A;  2JEA I;  1E1T A;  1KAA A;  1CHQ D;  1DZ1 A;  2MFI A;  4QUC A;  3DEO A;  3H6M A;  4H7B A;  4X3K A;  1YHA A;  4KKS A;  3PIP 3;  4DV3 L;  1ENC A;  3MC0 B;  4JOI A;  4RH6 A;  5KGU A;  2A73 B;  3Q6S A;  4ZKC B;  4C3H H;  4OL7 A;  5EKI A;  2A74 C;  1HA6 A;  1F77 A;  3A7L A;  1RCV D;  1LT6 D;  1YEZ A;  4U68 A;  1EQT A;  2K52 A;  4V19 0;  1XPR A;  3A56 A;  3H94 A;  4KKT A;  2A1A A;  5JVH 3;  3S16 H;  1NUC A;  1F9R A;  4HJ9 A;  2SOB A;  2HT1 A;  3J80 c;  4YY3 Q;  4MZ9 A;  4IFD H;  1YHB A;  1SJH D;  3C3L A;  1IBM Q;  2HQE A;  4PG3 A;  4CDD C;  5GAD C;  1LYL A;  4U67 3;  4CKC A;  4B3M L;  3CC2 A;  5T1I A;  5FLX E;  4X66 Q;  1IYU A;  4YIJ A;  1TWG H;  4FP5 D;  1D8L A;  3NE5 B;  2DNC A;  3I73 A;  1X54 A;  3RLO A;  3I56 A;  1EY8 A;  3MEF A;  4AYB B;  4LNQ A;  4WJ3 M;  4JI5 L;  3A55 A;  4X62 L;  2F0O A;  3NEM A;  3MXG A;  1ZEQ X;  4BWG B;  4LF9 Q;  1FJG L;  1RL2 A;  4YWL A;  3UDG A;  4NKL A;  3W2D A;  4F88 A;  4DN4 M;  2O2L D;  2RQX A;  1X6O A;  1OXX K;  4AYB G;  2K5Q A;  1F9S A;  1K0R A;  1IZ6 A;  2PI2 A;  1JOO A;  2E2J B;  5CV4 A;  4X64 L;  3F2B A;  2AQ3 B;  3T16 A;  4A3M G;  2AUJ D;  1XNR L;  2VB3 X;  4XYQ A;  2KHS A;  5I9P A;  4DUY Q;  2XVS A;  4QIW E;  2K03 A;  2LMC B;  3I4N H;  5C4H A;  4JV5 L;  1II3 A;  4QB4 A;  4JYA Q;  3DM1 A;  5J22 A;  4GKJ Q;  4MHE A;  4DV6 L;  3E5S A;  1EQR A;  4EQO A;  3L0O A;  4BBR B;  1BCP C;  1B3A A;  3G6E A;  2FFK B;  2IWH A;  1MBY A;  5FO9 B;  1JB3 A;  2OCE A;  1ESR A;  2PMZ B;  4LAA A;  3M85 A;  4A3E B;  3OMG A;  1H9K A;  2JA8 H;  1WJJ A;  2NYZ D;  1DXM A;  4K5X A;  3S1N H;  1HNX L;  5LMN L;  4EQP A;  1JIC A;  1PMR A;  2F0U A;  4ME5 A;  4DV4 L;  1U5K A;  1TWH B;  3MTS A;  4IOA A;  1O80 A;  1I4X A;  4X3T A;  4C2M B;  3VA7 A;  1BO0 A;  4A3E G;  2OTJ A;  5CV6 A;  1SMY C;  2K04 A;  2EDG A;  1ZYR C;  3J81 c;  4KD3 A;  4GLX A;  1PRT D;  1ILQ A;  2A6H D;  4K2K A;  1PH6 A;  1SYF A;  2K50 A;  1EIH A;  3T56 B;  2I46 A;  4CGY B;  1QOH A;  4CJ2 C;  4A4I A;  4DR5 L;  4DR6 Q;  3J7A 5;  2DGY A;  2EJF C;  5GAG C;  2OXP A;  1SE2 A;  2K5N A;  4K0K L;  2LFN A;  2B2U A;  1U9R A;  1TR5 A;  4JBM A;  3ULP A;  4E6I A;  1ZKO A;  2JJQ A;  2E5L L;  1Q12 A;  1V8Q A;  2SNM A;  4ZUI A;  3K80 C;  1CZW A;  2NN6 G;  4KHP Q;  4QQB X;  1S5E D;  3FHW A;  2NVX H;  1CSP A;  2H1E A;  3D6W A;  2L11 A;  3CP0 A;  4TKO B;  1C0A A;  2PW7 A;  4KJN A;  1I4Q A;  4PNY A;  4KI0 A;  3GTJ B;  4PMC A;  2B2W A;  3PO3 B;  1GM5 A;  3R93 A;  1CI3 M;  4A3L G;  3A8I E;  2YTY A;  3S2D B;  1N32 L;  5M5X B;  3HOZ H;  4POF A;  2OEO A;  4FF1 A;  3VYS A;  3ZYY X;  4HAE A;  3ERS X;  4RCN A;  2QEX A;  1NSN S;  2NWG A;  3D31 A;  1VS0 A;  4A75 A;  1X3E A;  3PO3 G;  1NR4 A;  1U4M A;  2K75 A;  3S1R B;  3AEV A;  1IYJ B;  5FLM H;  3M3Y H;  4K8I A;  3HKS A;  2YU9 B;  4O1N A;  2V1C C;  3RR5 A;  3BG3 A;  4TVA B;  2F0G A;  2K7V A;  2HHH Q;  2HIV A;  4IOC A;  4FF3 A;  5ELB A;  4X65 L;  4GOP A;  3HOW B;  3OSO A;  2F0D A;  2UU9 Q;  2EYH A;  4PMB A;  4XIG S;  2B8G A;  4KN4 C;  2IX0 A;  1TU2 B;  4DUZ L;  2BA0 A;  4DR7 L;  4EVO A;  2QCP X;  1D5X C;  2RHS B;  4LF6 L;  5DM6 3;  4UY8 C;  1U4R A;  1I4H A;  3TP7 A;  4YCV A;  2EPB A;  3OPO A;  1CK1 A;  1B9M A;  1QZG A;  1WD1 A;  1MSG A;  1GUN A;  2Z6K C;  3R3O A;  1GKH A;  1HNW L;  2OQK A;  1P8L A;  2ZXP A;  3S14 B;  1YNN C;  1S40 A;  2JQO A;  4KJO A;  4R4C A;  2EYP A;  1E2W A;  4LF8 Q;  3GTK B;  3TS2 A;  5EKK A;  5G3L D;  1PTO D;  1YNJ C;  1EYA A;  4JW0 A;  1PH3 A;  2KJX A;  1KL9 A;  4A3J B;  3EA6 A;  1JOK A;  4C3I B;  1KQS A;  3S24 A;  2RCN A;  3A74 A;  4IUN A;  2OF1 A;  4KTA A;  3UE1 A;  1MHW C;  1BR9 A;  1R9T H;  1GHJ A;  4A3G B;  1L0X B;  4MNO A;  2MGS A;  1STH A;  3ZJY C;  4CKE A;  4A3I H;  2XIW A;  4RFB A;  4C3I G;  1ENF A;  4OEL B;  1HR0 Q;  5IP9 G;  1WD0 A;  4QF4 A;  3I4L A;  2D0P A;  2DY8 A;  4QJF A;  5JEA G;  5CGK A;  2E2I B;  2P5Z X;  1SNC A;  1E22 A;  2BE5 D;  4IJH A;  5I6W A;  1EWH A;  3RN5 A;  4N9P A;  2AQ2 B;  3S1Q H;  1GUS A;  3UI2 A;  4HED A;  1LT3 D;  4CKB A;  5JJL A;  2B2U C;  2KQ3 A;  3CQZ H;  3GD7 A;  2MP1 A;  1J5E L;  3G4S A;  3JAM E;  2QF7 A;  4HMJ A;  5GRO A;  5LMU L;  4NMZ A;  4DXF A;  3J80 L;  1WTO A;  3KK7 A;  2ZM6 Q;  4PZ6 A;  1O7Z A;  3RD4 A;  4ILW A;  4DV2 L;  1SYG A;  2ENB A;  2F1M A;  1NJI C;  4A3B B;  4PV1 C;  4IN3 A;  1Y69 U;  5I2X A;  2B63 B;  2YTV A;  4JBW A;  1VQL A;  1PZJ D;  1D1K A;  5BN5 A;  2XNA C;  2UXC Q;  1RJT A;  3HRZ C;  2EVB A;  5TSS A;  4R4I A;  3L7Z C;  2LXK A;  1XXG A;  4A93 H;  2LKV A;  1N36 L;  1N33 L;  4A3B G;  3I7F A;  1GUO A;  3CCE A;  2NVT H;  4G7H C;  2KUM A;  2PO4 A;  1I5F A;  4LUV A;  1E3P A;  3D4D A;  4A3C G;  4JI1 L;  2D5D A;  3GTQ H;  2GVA A;  2CW0 D;  1S5D D;  3TQY A;  2G9D A;  3F2U A;  1WTW A;  3QG1 A;  3SR1 A;  1TS3 A;  3KLR A;  5IWA L;  2N78 A;  3AYH B;  4DK0 A;  1D5M C;  2VQF Q;  3Q22 A;  4GN3 B;  2I5M X;  5M5Y B;  3C46 A;  1TVX A;  3VYR A;  1JJ2 A;  3KOJ A;  2EJM A;  1JOQ A;  1WCM H;  2K6A A;  4DAM A;  1PV4 A;  4CBV A;  4LWC A;  2Z6B A;  3DEP A;  2NZH A;  4DV5 L;  3PCO B;  1RIP A;  2F0N A;  1B4O A;  4L8J A;  1Z9F A;  1V9P A;  3TZU A;  1PRT F;  1CQF A;  2A69 C;  3RZO B;  1HZC A;  1RTN A;  3QOL A;  3WOE A;  3GTO B;  1MIU A;  1WTX A;  3I4M H;  5L37 A;  1V1P B;  5E1F A;  2UUB Q;  3M7G A;  2UXB Q;  1TII D;  4LFB Q;  1LV9 A;  3J80 i;  2BDN A;  2KEN A;  3NUC A;  4AIM A;  1SNO A;  2LY7 A;  3GTP H;  3KDF A;  2R93 G;  3AB9 A;  2NTT A;  3J81 L;  2L12 A;  5C0X I;  2K28 A;  4KKU A;  1R4P B;  1O7L A;  5IYD H;  2PNR C;  1TQO A;  3K7U C;  1XNQ L;  1SN8 A;  1SMX A;  2JE6 I;  2C9O A;  2TMP A;  1EYC A;  5JPM C;  4ALP A;  2R7Z B;  4HMI A;  4OEM B;  5BR8 L;  4B3R L;  2IY5 B;  3P7J A;  1EL0 A;  2HQL A;  3S1M H;  3FKI B;  4EX5 A;  1C9O A;  3GO5 A;  2KBN A;  5I4D A;  3CAM A;  4JG2 A;  2RDH A;  4LF7 Q;  2XGT A;  4OX9 L;  1VQ9 A;  1UE5 A;  2R7Z G;  4A3D H;  5A2Q E;  3GTG B;  1EIF A;  3ULL A;  1ML0 D;  2LXJ A;  3R8B A;  4EQ5 A;  3NEL A;  2FXQ A;  3H0G H;  2CHB D;  2CFM A;  3RZD B;  5C4X B;  1K0S A;  1K3R A;  3FKI G;  3I70 A;  1NCV A;  2TSS A;  1TS5 A;  1STB A;  2R61 A;  5IP7 H;  1K8O A;  1Q3L A;  3G71 A;  1EU3 A;  3VA5 A;  2JP1 A;  1KNA A;  2EJG C;  1I6H B;  3CKI B;  4OWX B;  4OIJ A;  1WTV A;  2GN5 A;  2HCC A;  3F8T A;  1KRT A;  2B2Y A;  4DR3 Q;  2IX1 A;  3EQL C;  5DM7 3;  3IKJ A;  1L1O B;  5AFW A;  3PO2 G;  2JK8 A;  5IYB H;  1YIJ A;  2KED A;  3ITP A;  3NBH B;  4YY3 L;  1I3Q B;  1Y1W B;  1X56 A;  2NZO A;  5M5W B;  1IBM L;  2A6E C;  5J3B A;  3A5Z B;  3S15 H;  2PNH A;  2CCZ A;  1JWU D;  3H3V I;  4PZ7 A;  1A2T A;  4K2L A;  3GP7 A;  3SK8 A;  2UUC Q;  1D7Q A;  4OIK A;  4X66 L;  3HOV B;  1AZP A;  2ICE C;  1K83 B;  5G3L F;  1PTO F;  4P73 A;  1N34 Q;  1Y1W G;  4R1J A;  4OO1 H;  5K5P A;  1NY4 A;  3MXP A;  4BY7 H;  1SFO H;  5EAY A;  4PMW A;  2F4V Q;  1TXY A;  4WFN 3;  1UNS A;  1DOK A;  5IGB A;  3J81 i;  4G7O C;  3ERO A;  1DJR D;  3PQI A;  3CU7 A;  4QIW B;  1DON A;  3GTL B;  4LF9 L;  1STN A;  4OHJ A;  1GO3 E;  2JA6 H;  1BDO A;  3BVG A;  3J7Z C;  1PH2 A;  2YYZ A;  1K8G A;  4ZKB B;  1X55 A;  2Q8I B;  1LTI D;  2PZU A;  2D2C C;  2A68 C;  5AJ3 Q;  1Q8K A;  4RGM A;  5GAE C;  4RWS C;  1ESF A;  3TP6 A;  3DM3 A;  5BN3 A;  3CMA A;  1EUJ A;  1FGB D;  1G8Z D;  4LUZ A;  4DUY L;  4RKB A;  3RUZ A;  1M4V A;  2CH4 A;  4UAI A;  3BDC A;  1V1O A;  3F2C A;  1YNX A;  5JVG 3;  4GKJ L;  1Q82 C;  2KVM A;  2EY2 A;  1PTO H;  1HZ9 A;  2N88 A;  3CRK C;  3HGB A;  1YI2 A;  1TWC H;  5IIF A;  1SBB B;  4FDB A;  5KND A;  1AW7 A;  1CKN B;  1ICF B;  1SRO A;  4IFD J;  4YHH Q;  1VMP A;  5CC4 A;  4MIU A;  4C3H G;  1IL2 A;  1CA5 A;  2B2T C;  4RAU C;  1SE8 A;  2JA5 H;  1VDZ A;  4EQN A; 
#chains in the Genus database with same CATH homology
 3LGJ A;  3STB C;  5IYB G;  3CCV A;  1I94 Q;  3PO3 H;  1Q46 A;  3M85 A;  3M4Q A;  4DV6 Q;  4A3K H;  1HH2 P;  2JA8 H;  4J15 A;  3U50 C;  1WJJ A;  3S2D H;  1J6Q A;  4NXM L;  1VQB A;  1NMG A;  4LF4 Q;  3S1N H;  4R4T A;  5LMN L;  1HNX L;  3GTM H;  4OO1 I;  2YV5 A;  4IPD A;  4DR4 Q;  5C0X G;  1E1O A;  1JMC A;  3KF8 B;  4DV4 L;  1YHQ A;  1U5K A;  4IOA A;  1K73 C;  4IFD G;  3M4O H;  1XPU A;  2BH2 A;  1KAW A;  4NXM Q;  4A76 A;  1HNX Q;  5LMN Q;  2OTJ A;  4A3E G;  1VQP A;  2VL6 A;  3DLL A;  4GKK L;  1BKB A;  1CKM A;  3HOY G;  3S1R H;  4OO1 G;  2K5V A;  1SLJ A;  3W1G A;  3CCQ A;  2JEB I;  4DV4 Q;  1PH9 A;  4BY7 G;  4A3J G;  2YU9 H;  4Y52 H;  3J81 c;  1XMO L;  4GLX A;  1L1O C;  4JI0 L;  4NB3 A;  4DR6 L;  1QZH A;  3PIP A;  4JI7 L;  3B6Y A;  1AE2 A;  1PH6 A;  5M3M G;  4BXX H;  2K50 A;  4OWT B;  4GNX A;  3TS0 A;  4GKK Q;  3E9H A;  4C3J H;  2LSS A;  3EIV A;  1JB7 A;  4H02 A;  2JA6 G;  4A3G G;  2PMZ E;  1WCM G;  2GVB A;  1XMO Q;  1JJG A;  4A4I A;  2VZA A;  4DR5 L;  4DR6 Q;  1S72 A;  3J7A 5;  4JI7 Q;  3RN2 A;  2DGY A;  5GAG C;  5M5Y H;  1VQ5 A;  2C35 B;  2K5N A;  1CKO A;  4K0K L;  4YCW A;  2Z0S A;  2VUM H;  5E7N A;  4BY1 H;  4JBM A;  4P74 A;  1V43 A;  4DR5 Q;  3ULP A;  3CCM A;  2JJQ A;  2QGQ A;  1Y1V H;  3TRE A;  5M3F G;  1XMQ L;  2E5L L;  3HOU G;  2UUA L;  1YJN A;  1Q12 A;  1O7I A;  3T1H L;  2AMC B;  3K80 C;  2XTI A;  3TEH B;  2NN6 G;  3RZO H;  3S2H H;  3K81 C;  4KHP Q;  4GNX B;  2E2H H;  4K0K Q;  2K4K A;  4QQB X;  3FHW A;  2IHF A;  1CSP A;  2NVX H;  1TWF H;  2ASB A;  1UE1 A;  3CME A;  1N34 L;  3CP0 A;  1C0A A;  2E5L Q;  3S14 H;  2Y0S G;  3PF4 A;  2UUA Q;  1B8A A;  1N8R C;  3T1Y L;  3T1H Q;  3JC6 6;  2F4V L;  1KD1 C;  4IPH A;  3M4P A;  3I4O A;  1SRU A;  4KI0 A;  5IYC G;  1HNZ L;  1PVO A;  1GM5 A;  1EFW A;  3I4N G;  4A3L G;  2YTY A;  3RLN A;  1N32 L;  3HOZ H;  4RMF A;  1P16 A;  4POF A;  1M1K C;  3T1Y Q;  4A3F G;  5FLX c;  3HFZ B;  4YWM A;  2QA4 A;  3ERS X;  2ZJP A;  2VS1 A;  4C3I H;  1HNZ Q;  4A75 A;  2QEX A;  3D31 A;  3CCS A;  1VS0 A;  5IP9 H;  4IPG A;  1X3E A;  2Y0S E;  4KLK A;  3HOX H;  2JA5 G;  2B63 G;  1N32 Q;  4DR1 L;  3PO3 G;  2HHH L;  4JI2 L;  4YWK A;  5FJ8 H;  4Y7N H;  4A3K G;  2K75 A;  4R4Q A;  2JA8 G;  3AEV A;  1IYJ B;  5FLM H;  3M3Y H;  2D62 A;  3HKS A;  1EQQ A;  2JA7 H;  2MQH A;  2V1C C;  3RR5 A;  1VQM A;  1HZB A;  2ZTE A;  4TVA B;  2ZJR A;  4DR1 Q;  1X3F A;  1QVC A;  4JI2 Q;  2HIV A;  1JE5 A;  4IOC A;  2HHH Q;  1EYG A;  4RG1 A;  4X65 L;  4GOP A;  2NVQ H;  1PYB A;  3RLF A;  1VQJ A;  2EIF A;  3K0X A;  3JAM i;  2UU9 Q;  4POG A;  2ZJQ A;  2DUD A;  4XIG S;  3KFU A;  4XTC S;  2IX0 A;  3HKZ G;  2F52 A;  1L0W A;  4DUZ L;  5IWA Q;  2BA0 A;  4X65 Q;  1XJV A;  4DR7 L;  2RHS B;  4LF6 L;  4JYA L;  1MJC A;  1B70 B;  1BVS A;  1A8V A;  4UY8 C;  4BXX G;  2PQA B;  2RF4 A;  3UE0 A;  1U0L A;  4DAY B;  1BBW A;  4YCV A;  1L2F A;  3FP9 A;  3AFP A;  3GTG H;  4DV7 L;  5C3E H;  3PUZ A;  4DUZ Q;  2RHQ B;  5ELN A;  2IT1 A;  3KF6 B;  5C4X H;  1QZG A;  4B3S L;  4LF8 L;  4DR7 Q;  1G6P A;  4GOP B;  2Z6K C;  4LF6 Q;  1I94 L;  1GKH A;  1HNW L;  3HKZ E;  1FGU A;  1H95 A;  2EQS A;  1P8L A;  2OQK A;  1A63 A;  1S40 A;  4GLV B;  1JT8 A;  2WB1 G;  2VUM G;  2JQO A;  4BY1 G;  4QGU A;  4DV7 Q;  4R4C A;  5JJK A;  4L5S A;  4B3S Q;  4LF8 Q;  3TS2 A;  1A0I A;  3K7A H;  4L5R C;  1E24 A;  3STB D;  1YJ9 A;  4DNI A;  2A8V A;  1HNW Q;  2KHJ A;  2MO1 A;  3TRZ A;  1LTL A;  3E9I A;  4A3C H;  2VNU D;  1OXU A;  1PH3 A;  2BH8 A;  4BBS H;  3BU2 A;  1KL9 A;  1QVG A;  1WOC A;  2N49 A;  4ME3 A;  4TQU S;  1KQS A;  1YBY A;  4LFA L;  2L15 A;  2RCN A;  1I3Q H;  3S24 A;  1ASZ A;  3A74 A;  5M5W H;  3M9B A;  4OON A;  2VQE L;  3UE1 A;  1MKH A;  1R9T H;  1HR0 L;  1DGS A;  1KIX A;  4DR2 L;  2ES2 A;  3HOZ G;  4MNO A;  2H5X A;  4LFA Q;  1VQ7 A;  3WWV A;  3ZJY C;  3HOV H;  4A3I H;  2VQE Q;  2I5L X;  1Q1B A;  4QL5 A;  1HR0 Q;  5IP9 G;  4JI4 L;  4YCU A;  2D0P A;  2MNA A;  3HOX G;  3CC7 A;  4DR2 Q;  1M90 C;  3CCL A;  5JJI A;  4IO9 A;  1VQA A;  2PI2 E;  4QJF A;  5JEA G;  3BZC A;  5FJ8 G;  1UEB A;  3L2P A;  1PHJ A;  4HJ5 A;  1E22 A;  4IJH A;  1VQ8 A;  2ZTC A;  5FLM G;  1X65 A;  3RN5 A;  2JA7 G;  3Q8D A;  5IY0 A;  4JI4 Q;  4AH6 A;  1PH5 A;  3S1Q H;  2OWO A;  3GTL H;  2ZM6 L;  4JOI C;  4KHP L;  4APV A;  5JJL A;  3CQZ H;  1S3O A;  3GD7 A;  3JAM c;  1J5E L;  1NMF A;  1VQH A;  3G4S A;  1L1O A;  5DLQ E;  3U58 A;  5GRO A;  3EBE A;  5LMU L;  3CW2 C;  1OXS C;  1FL0 A;  1SR3 A;  1PH1 A;  2I0Q A;  2ZM6 Q;  4OX9 Q;  4PZ6 A;  3UDI A;  5GAH C;  1QUQ A;  1J5E Q;  4DV2 L;  4PZ8 A;  2UXC L;  1VQG A;  1PH4 A;  1NJI C;  4KHZ A;  3GTO H;  2A19 A;  5LMU Q;  2YTV A;  4JBW A;  2E2J H;  2R93 H;  1OXT A;  2WP8 J;  4P72 A;  2CQO A;  1KHI A;  5C3E G;  2OTL A;  1IBK L;  5C4X G;  1VQL A;  1XTD A;  4DV2 Q;  2UXC Q;  4R4I A;  3OTO L;  4NPS A;  1C7Y A;  4X6A H;  3L7Z C;  2VW9 A;  1LM0 A;  4UP8 A;  5C44 H;  2LXK A;  4HIO A;  1K8A C;  3G48 A;  4A93 H;  1N33 L;  4UP9 A;  2AWO A;  1N36 L;  4A3B G;  3I7F A;  1PH7 A;  1MJE A;  3CCE A;  2NVT H;  1IBK Q;  3UDX A;  1I5F A;  3OTO Q;  2WFW A;  4LUV A;  2UXD L;  4O2D A;  2AKW B;  1E3P A;  4BBR H;  3PF5 A;  4A3C G;  4JI1 L;  3BJU A;  2R6G A;  4OXP A;  3GTQ H;  3PUY A;  1N36 Q;  1N33 Q;  2GVA A;  4BBS G;  1GD7 A;  1K9M C;  3TQY A;  4QY7 A;  2VQF L;  3K8A A;  2UU9 L;  4A3E H;  3KJO A;  3D0F A;  1Q1E A;  2I5H A;  3HOY H;  2UXD Q;  1YIT A;  4GN4 B;  2R7Z H;  4JI1 Q;  5IWA L;  2N78 A;  3PSI A;  4BA1 I;  3CC4 A;  1CUK A;  3AYH B;  3I2Z A;  1NTG A;  1Z47 A;  2VQF Q;  1TWH H;  4JI6 L;  1VQF A;  4NXN L;  1Q86 C;  1OTC A;  4GN3 B;  2N8N A;  4LW1 A;  5IT9 c;  2I5M X;  3FKI H;  4A3I G;  3HOV G;  2Q2T A;  3SGI A;  1JJ2 A;  4UPA A;  3KOJ A;  4C2M H;  2ID0 A;  1WCM H;  4DAM A;  1PV4 A;  4LWC A;  2JEA I;  1OXV A;  2NZH A;  3PIO A;  1JJC B;  1LUZ A;  3CXC A;  2KHI A;  4DV5 L;  1RIP A;  1YZ6 A;  3PCO B;  4JI6 Q;  1T9H A;  3A5U A;  4B3T L;  3PGZ A;  4NXN Q;  3RNU A;  1VQK A;  1Z9F A;  1V9P A;  2K14 A;  1XPO A;  2CWP A;  3RZD H;  1VQ4 A;  1X3G A;  1HZC A;  2CWA A;  3OYY A;  5M3F H;  3PO2 H;  2UUB L;  3HOU H;  4DV5 Q;  1VQ6 A;  1UWV A;  1MIU A;  4B3T Q;  2UXB L;  1FJG Q;  2D0O A;  1EOV A;  1A62 A;  3I4M H;  5GQO A;  1Y1V G;  4AQY Q;  4DK3 C;  1Y14 B;  1I6H H;  3KJP A;  4DV0 Q;  4P71 A;  2UUB Q;  2R92 H;  1G51 A;  2UXB Q;  5K36 G;  4LFB Q;  3J80 i;  3AFQ A;  3J81 j;  2CKZ B;  2KEN A;  3W5O A;  5JEA J;  4AIM A;  2MO0 A;  2Z6K A;  3PUW A;  3GTP H;  1Y1W H;  3KDF A;  2R93 G;  2WB1 E;  2B3G A;  4JI3 L;  1VQO A;  1VQC A;  1YVC A;  4HJ7 A;  2OQ0 A;  5C0X I;  4UP7 A;  3U4Z A;  1WI5 A;  3I55 A;  4IFD I;  5C44 G;  3GTJ H;  2JA9 A;  4O0A A;  5IYD H;  3K7U C;  5ELO A;  1NBW A;  1XNQ L;  1EIY B;  1SN8 A;  4JI3 Q;  1SMX A;  2JE6 I;  4A93 G;  1K83 H;  2N3S A;  3GDE A;  4MTN A;  4ALP A;  5M5X H;  1AE3 A;  5BR8 L;  2WAQ G;  3M7N A;  4BA2 I;  4JCV E;  4B3R L;  2IY5 B;  4GNX C;  3KYH C;  4LF7 L;  4BBR G;  4DKA C;  1W3S A;  3MXN B;  1I50 H;  2HQL A;  1B7Y B;  4L5T A;  1XNQ Q;  3S1M H;  2NVY H;  3KDF B;  1GVP A;  2ALY B;  1HZA A;  1C9O A;  3GO5 A;  3W1B A;  5BR8 Q;  4EX5 A;  2F3I A;  2KBN A;  4HIK A;  4B3R Q;  3CPW A;  3CAM A;  2R7F A;  4JG2 A;  3BZK A;  4LF7 Q;  4OWW B;  2XGT A;  4OX9 L;  1VQ9 A;  1UE5 A;  3NEN A;  2R7Z G;  4LFC L;  3ER0 A;  4A3D H;  2KCM A;  1PH8 A;  3H15 A;  1TWA H;  3CCJ A;  1HJP A;  2WAQ E;  4HJ8 A;  1WFQ A;  1EIF A;  3ULL A;  2LXJ A;  1ASY A;  1G29 1;  2Q2H A;  1E1T A;  4GS3 A;  4EQ5 A;  2FXQ A;  3H0G H;  3NEL A;  4A3M H;  1WYD A;  2CFM A;  4DPG A;  1K3R A;  2MFI A;  3FKI G;  4GLA C;  5HGQ A;  5IE8 A;  4LFC Q;  3HOW H;  1V1Q A;  1YHA A;  3PUX A;  4JI0 Q;  4DR3 L;  1QVF A;  4HID A;  1NE3 A;  5IP7 H;  4DV3 L;  3G71 A;  2NN6 I;  4IPC A;  2E8G A;  1KRS A;  4JOI A;  4DV1 L;  2Q2I A;  4OWX B;  4C3H H;  1PYS B;  2GN5 A;  2R7D A;  3F8T A;  1KRT A;  4DR3 Q;  2Q2U A;  2IX1 A;  1PFS A;  2ATW A;  3PO2 G;  1L1O B;  4DV3 Q;  3EN2 A;  2JK8 A;  2UUC L;  5IYB H;  1Q81 C;  1YIJ A;  1YEZ A;  5C4J H;  3NBH B;  3IRB A;  4YY3 L;  4DV1 Q;  3UDF A;  2YTX A;  1X56 A;  2K52 A;  2NZO A;  3ULJ A;  1XPR A;  4JC0 A;  1Q7Y C;  2A1A A;  2B29 A;  1IBM L;  3I4M G;  3S16 H;  5J3B A;  3A5Z B;  3S15 H;  1QUQ B;  2PNH A;  3E0E A;  3OW2 A;  1XMQ Q;  5HY6 A;  4PZ7 A;  2CCZ A;  1EWI A;  4HJ9 A;  3H3V I;  3CCR A;  1YJW A;  2UUC Q;  2HT1 A;  4LF5 L;  2R92 G;  1D7Q A;  3J80 c;  4P75 A;  1PA6 A;  1VQI A;  4YY3 Q;  4MZ9 A;  1AH9 A;  1YHB A;  4X66 L;  3GTK H;  1IBM Q;  2BA1 A;  4PG3 A;  4P73 A;  4HIM A;  5GAD C;  1LYL A;  1UE6 A;  1N34 Q;  2VY3 A;  1Y1W G;  4R1J A;  4B3M L;  1NY4 A;  4LF5 Q;  3CC2 A;  4BY7 H;  1SFO H;  5EAY A;  4PMW A;  2F4V Q;  2KCT A;  1IXR A;  1TXY A;  4GOP C;  4A3J H;  4X66 Q;  3PUV A;  3J81 i;  5LMN W;  1TWG H;  1D8L A;  1UE7 A;  2EXD A;  1VQD A;  5M3M H;  5IYD G;  4LF9 L;  1X54 A;  5AJ3 L;  4B3M Q;  3RLO A;  3I56 A;  3S17 H;  3MEF A;  1GO3 E;  4A3G H;  4JBK A;  2JA6 H;  4JBJ A;  1HR0 W;  4LNQ A;  2HIX A;  2PQA A;  3J7Z C;  4WJ3 M;  1PH2 A;  1FVI A;  2YYZ A;  4JI5 L;  4X62 L;  4L5Q A;  1K8G A;  1IBL L;  3NEM A;  1X55 A;  4LF9 Q;  1W2B A;  1FJG L;  1RL2 A;  2K5H A;  2AHO B;  3KF6 A;  5AJ3 Q;  4YWL A;  3CPF A;  1CKN A;  1Q8K A;  5GAE C;  3UDG A;  4GN5 A;  3DM3 A;  4AQY L;  3CMA A;  3CD6 A;  1IBL Q;  4JI5 Q;  1EUJ A;  1X6O A;  4X62 Q;  5H1S E;  4DV0 L;  1KC8 C;  3CCU A;  1OXX K;  2E2I H;  4AYB G;  4LUZ A;  4DUY L;  1K0R A;  1IZ6 A;  2PI2 A;  3ICE A;  4A3D G;  3KLW A;  3PV0 A;  4LFB L;  4JI8 L;  4DK6 C;  2ZTD A;  4X64 L;  1N9W A;  1BBU A;  4IJL A;  1VCI A;  3F2B A;  3F2C A;  4A3M G;  3H0G G;  1CSQ A;  1YNX A;  4LUO A;  4GKJ L;  1Q82 C;  1XNR L;  4YHH L;  4R4O A;  4DUY Q;  1VQE A;  4HJA A;  3A0J A;  1HZ9 A;  4QIW E;  5IYC H;  3VDY A;  1YI2 A;  1TWC H;  3HOW G;  4FDB A;  4JI8 Q;  4X64 Q;  3CF5 A;  3I4N H;  4A3L H;  1X9N A;  1CKN B;  5C0X J;  5IP7 G;  4AYB E;  4JV5 L;  4JYA Q;  4GKJ Q;  4DV6 L;  1SRO A;  1XNR Q;  4IFD J;  4A3F H;  1KXL A;  4YHH Q;  1EQR A;  3U4V A;  3H3V H;  3F1Z A;  3L0O A;  1IL2 A;  3F2D A;  3G6E A;  3AQQ A;  4A3B H;  4WJ4 A;  1E7Z A;  4LF4 L;  2IHE A;  2AWN A;  1VQN A;  1SE8 A;  2JA5 H;  2B63 H;  4DR4 L;  2OCE A;  4JV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...