2R93H

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
total genus 13
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93H00
3JAMi 3K7AH 2K52A 1LM0A 1YI2A 1JE5A 3HKZG 1FJGQ 1G51A 3CP0A 2F4VQ 1X65A 3M4OH 4JV5Q 2CCZA 3RLNA 2IX0A 4X64Q 1SROA 2C35B 3UE0A 1ASYA 1WJJA 4LF4Q 4LF5L 4YY3Q 1Q1EA 5M3MH 3I4MH 2MO0A 4BBSG 2WFWA 4YCUA 1SRUA 3UE1A 4A3MG 1VQMA 4A3JG 4LWCA 3S1NH 2BA0A 3EIVA 4LUOA 3CCQA 2K5VA 4GNXC 3PF5A 2I5MX 3CCJA 1PH8A 2JE6I 1EIYB 3S2DH 3S15H 2R6GA 3SGIA 3A0JA 4L5QA 4HIKA 5IYBH 1HZ9A 1KC8C 2OWOA 5JJKA 2LXJA 1HNWL 2E5LQ 4NXNQ 2UXCL 2ALYB 2OCEA 4K0KQ 1I50H 1Q46A 3U4VA 1V43A 1CUKA 1C7YA 1P16A 1Q81C 4LFCL 3J7ZC 2BA1A 4JI1Q 4JC0A 4HIDA 4A3KG 1PH2A 3UDGA 4IJLA 3CXCA 3T1HL 1U0LA 2Y0SE 3KDFA 4HIOA 4JI6Q 4P74A 1KHIA 4LF5Q 1VQCA 1A62A 3CPFA 4L5RC 1XNRL 3MXNB 4X6AH 1HNXQ 5IP9H 1YNXA 1TWGH 2Z0SA 3L7ZC 3T1YQ 2OTLA 1P8LA 1VQDA 2ZTDA 4DR3L 4A3DH 1X3FA 4R4OA 5FLXc 4A3JH 3OW2A 3W5OA 4LF8L 1PV4A 1N34Q 1LUZA 3RR5A 2K75A 5C0XJ 3F2DA 4QJFA 3E9IA 2E2HH 1B70B 1QUQB 1YBYA 1VQKA 1EQQA 4AIMA 1VQPA 1W2BA 3HOXG 2YV5A 1XNQQ 3H15A 1OTCA 2Q2TA 3KJOA 4LF6Q 2PNHA 2ZM6L 4PZ6A 2RCNA 1GVPA 3CCUA 1GKHA 1BKBA 2WAQE 4A3IH 5LMNQ 5C0XG 3GTKH 3A5UA 1IL2A 1R9TH 1ASZA 2AHOB 3A5ZB 3G48A 1U5KA 4IPHA 5LMNW 4DUYL 1KD1C 3HOXH 4FDBA 3S1RH 1UE6A 3PGZA 3K81C 5FJ8H 1VCIA 2I5HA 1B7YB 4JYAL 1V9PA 2YTYA 1Q8KA 3K8AA 2JEBI 4BA1I 1JMCA 2LSSA 3I4MG 1L0WA 4C3IH 5M5WH 4A3DG 1XMQL 1VQ7A 4EQ5A 1SLJA 5EAYA 4JI4L 3AYHB 3HOWH 2KHIA 4QQBX 2Q2IA 4DV7L 3KFUA 3TRZA 1IYJB 4JI5L 3TREA 2GVAA 3ULJA 1Z9FA 1FGUA 3F1ZA 3H0GG 3U58A 1YITA 4O0AA 2RHQB 4LFBL 2KCMA 5C0XI 1XMOQ 1VQ9A 2FXQA 4OXPA 1S40A 1K8AC 5IWAL 1PH5A 3T1YL 2NVXH 3CC4A 3ICEA 4JOIC 1XPRA 2JA8G 1VQAA 1EQRA 4GLAC 4RG1A 2K5NA 2PQAB 3DLLA 4PG3A 4C3JH 5LMUL 4HJ7A 4B3SQ 1IXRA 3D31A 1BBWA 2MNAA 4X66Q 3HKSA 4DUZL 1VQ6A 2EXDA 4P75A 2ASBA 4DV5Q 3U50C 2N49A 2D62A 5IYCH 2ATWA 4HJ8A 3M85A 1B8AA 2QEXA 4A93H 2YTXA 5C4XH 3CF5A 2Z6KC 4YY3L 3G6EA 3L2PA 1A0IA 2IX1A 2Z6KA 1YEZA 1K83H 4LF9L 2E2JH 1TXYA 2N78A 1WYDA 1C0AA 3PO3G 3FKIG 4DK6C 3K80C 1E3PA 1I94Q 3HOUH 1K0RA 2OQKA 3TS0A 1PYBA 1KL9A 4DR4L 5IP7G 4DR1Q 1QZHA 4A3BH 4R1JA 4DUYQ 4DUZQ 3PO2H 1E1TA 1NTGA 1TWAH 5BR8L 1IBMQ 2K50A 4LW1A 1YHBA 4K0KL 4WJ4A 5ELNA 4A76A 3UDXA 5M3FH 4A3CG 1K9MC 1J5EL 4AH6A 2JA9A 3CMAA 3KDFB 4GKJL 2ZTCA 1EUJA 2GN5A 4YWMA 3AQQA 4GOPC 2K4KA 4AYBE 2NZOA 4NB3A 2NN6G 4DV1L 3J81c 2JA7G 1EOVA 3HOWG 1EWIA 1EYGA 2R93H 4L5SA 2PQAA 2HHHQ 2VUMG 1VQBA 1OXVA 3TQYA 1XTDA 1K8GA 2KHJA 4GN4B 2JEAI 1VQJA 1Y1WH 1AE2A 3M4PA 3CC2A 1O7IA 4DR5Q 3PCOB 4R4QA 1QZGA 4B3TL 3GTMH 3K7UC 1X6OA 4JI3Q 2CKZB 3HOVG 2B3GA 3OTOL 4X65L 3AFQA 2QA4A 4XTCS 2E8GA 4A3FH 1FL0A 1VQFA 3RLOA 5IYBG 4OWXB 4A3IG 5FLMH 3HOZG 4JI7Q 4JI1L 4BY1H 1N33Q 4A3LH 4HIMA 3M7NA 2F3IA 3M9BA 4LF9Q 1YJWA 1YJNA 1Q1BA 3TEHB 4AYBG 2RF4A 4DV3Q 4JI0L 1SN8A 2OQ0A 3JAMc 3CCMA 4DAMA 1K3RA 4HJ5A 1I94L 4J15A 4JBKA 1PA6A 4DR5L 3KF6A 4DR1L 4JG2A 4BY7H 3ER0A 3IRBA 4LUZA 4DR2Q 2NVYH 1N36L 4UPAA 1X56A 4XIGS 4LF7L 1IBML 2VZAA 4AQYL 3KF8B 5GAEC 1IBLL 4IFDI 2HQLA 1PHJA 4BXXG 4TQUS 1MJCA 3JC66 4KHZA 2KBNA 2VNUD 1N9WA 5IYDG 3STBC 1E22A 1C9OA 3AEVA 2AWNA 4PZ7A 2UUBL 2GVBA 1VQ8A 4KHPL 3I4NG 5GADC 1PH3A 2UUAQ 3GD7A 2VW9A 3HFZB 4DV6L 3PUVA 3CD6A 4UP8A 4R4CA 5J3BA 3NEMA 4DV4L 1D8LA 2WP8J 1OXTA 1HR0L 1MIUA 1TWFH 5HY6A 3GTLH 1X9NA 1VQLA 3KOJA 1N36Q 1QVCA 1M90C 1G6PA 2D0PA 5LMNL 1GO3E 4NPSA 3PUZA 1KAWA 4AQYQ 1Y1WG 3J80i 3W1BA 4JI8L 4DR6Q 5HGQA 3PF4A 4YWLA 2NVTH 2JA5H 4B3TQ 1NBWA 2MO1A 3GTJH 4A3MH 2CWAA 4OO1G 4DV2Q 3OTOQ 1SMXA 1NY4A 2NN6I 4JI7L 2CQOA 2JA7H 3GTQH 4KLKA 5JEAJ 3AFPA 2EIFA 3RLFA 3J81i 2UUAL 2A1AA 2YU9H 1UE5A 4OX9Q 4Y52H 3EBEA 2BH2A 2ES2A 4YWKA 1L2FA 2UUCL 2ZJQA 1N33L 1VQGA 5H1SE 2YYZA 3CAMA 3K0XA 4BBRH 4JI0Q 5ELOA 2IY5B 4QGUA 5IWAQ 1IZ6A 1Q86C 1HZBA 1BVSA 2DGYA 3S14H 5E7NA 2DUDA 4GNXB 3GDEA 4LFBQ 3PUYA 4IFDJ 2VQFQ 1X55A 3J7A5 1PYSB 2D0OA 2I5LX 4BBRG 1Y14B 4PMWA 5C3EH 4A3LG 3FKIH 4YCWA 4LF8Q 3E9HA 4LNQA 2R7ZH 5AJ3Q 5FLMG 3I4OA 4DV0Q 2ZTEA 4LF7Q 1X3EA 1HZAA 2B63H 2PI2E 4JBWA 4DPGA 1VS0A 4Y7NH 1T9HA 3CMEA 1QVFA 4LUVA 2N3SA 4IOAA 4JBMA 2R92H 4A93G 2AMCB 4A3EG 2XTIA 5IYCG 2F4VL 4BA2I 1JT8A 4H02A 3MEFA 4A3GH 3BZKA 5GQOA 4DAYB 4YHHL 1FVIA 1SE8A 2PI2A 1XNRQ 4DV4Q 1LYLA 4POFA 4B3MQ 3CCEA 4UY8C 2Q2HA 3WWVA 2VQEQ 2JA6G 1UE1A 1YZ6A 2HIXA 3ZJYC 2VL6A 3I2ZA 3PIPA 1KXLA 1VQNA 5C3EG 3KF6B 2E2IH 5GROA 3CCLA 5C44H 3H3VH 3CQZH 1XMQQ 4JI4Q 3S1MH 2VS1A 5IYDH 1CSQA 3HKZE 1VQ4A 4LFAL 1NMGA 1N34L 3NBHB 1KRTA 3G71A 2UU9L 1XNQL 1PH4A 1HZCA 4A3BG 4R4IA 4BXXH 1H95A 2A19A 2VY3A 4MNOA 3HOYG 2XGTA 2R92G 4DR7L 1WCMH 5M5XH 3CCRA 1HNZQ 4GNXA 3F2BA 1XMOL 1PVOA 2AWOA 2KENA 3S2HH 3RN5A 1JB7A 3G4SA 3NELA 4GLXA 1JJGA 3ULLA 1WCMG 2WB1E 4MZ9A 1N8RC 1I6HH 3I55A 4IPCA 3W1GA 5GAGC 4OO1I 2UXDL 4DKAC 3HOYH 2JA5G 4IO9A 4OWTB 3S16H 3S1QH 3D0FA 1NJIC 1DGSA 1E1OA 1N32L 3CCSA 1EIFA 4BY1G 3I7FA 4LFAQ 1HR0W 5AJ3L 1CKNB 2OTJA 2JQOA 4P72A 4X65Q 3LGJA 1PH1A 4DR7Q 1IBKL 4JV5L 3GTGH 3ERSX 5IY0A 4DV6Q 5DLQE 2JA8H 3GTPH 2Y0SG 3M3YH 2HIVA 3PV0A 4UP9A 3UDFA 4HJ9A 4O2DA 3CPWA 4GKKQ 4A75A 4B3ML 4A3GG 1AH9A 4GS3A 4DK3C 1MKHA 3CC7A 1A8VA 1PH7A 4YCVA 4L5TA 4P73A 3J80c 2EQSA 1OXXK 1E7ZA 1Z47A 3L0OA 5IP9G 4B3RL 2VQEL 5JJIA 4OWWB 3OYYA 1S72A 4POGA 3FP9A 1I5FA 2QGQA 3FHWA 3NENA 5LMUQ 1IBLQ 4B3SL 1Y1VG 3J81j 4X62Q 4GKJQ 3KYHC 2R7ZG 5FJ8G 1AE3A 2MQHA 3RZDH 3F2CA 3GTOH 4NXNL 5GAHC 2WAQG 3BJUA 2E5LL 3H3VI 4GKKL 2JK8A 2B29A 2N8NA 1YJ9A 2JJQA 1OXUA 4IPDA 1KIXA 4JI6L 1UE7A 4JBJA 4UP7A 1HNZL 2NVQH 2NZHA 3S17H 1Y1VH 5JJLA 3RZOH 1HR0Q 1BBUA 1G291 4B3RQ 3EN2A 4JI8Q 3U4ZA 4DR6L 4KI0A 1CKMA 4JI3L 1PFSA 5K36G 4IFDG 1YVCA 2L15A 1HNXL 2RHSB 3E0EA 4GN3B 4RMFA 3PIOA 1UEBA 4BBSH 4DR4Q 1A63A 4X62L 2K5HA 4IPGA 3A74A 1KQSA 1KRSA 4DR3Q 5M3MG 1J5EQ 1CSPA 4X66L 1MJEA 3M4QA 3CCVA 2Q2UA 1XJVA 3Q8DA 2R93G 1SR3A 4JI2L 5C44G 3ULPA 4DV5L 1HNWQ 4DV1Q 1NE3A 3S24A 1K73C 2IHEA 1QUQA 4JOIA 1VQEA 3F8TA 3STBD 2IHFA 1E24A 4A3FG 4GOPA 5M3FG 2ZM6Q 4R4TA 2ZJRA 4A3CH 1Q7YC 1HH2P 3BU2A 4APVA 3TS2A 2PMZE 4EX5A 5M5YH 4A3KH 2AKWB 4NXML 2LXKA 4OONA 1Q12A 3PUXA 4TVAB 3RNUA 3VDYA 2UXBL 2CWPA 5JEAG 1L1OB 1RL2A 1J6QA 1NMFA 2CFMA 3I56A 1WFQA 5IT9c 1TWHH 2IT1A 2UU9Q 4JI2Q 3BZCA 4DV7Q 1M1KC 3GO5A 4KHPQ 2B63G 2YTVA 1XPOA 3UDIA 4X64L 1CKNA 4JCVE 1YHQA 4GOPB 4P71A 1W3SA 4HJAA 4BY7G 1FJGL 1X54A 2K14A 4JI5Q 2MFIA 1VQ5A 4LF6L 4LF4L 3KJPA 4IOCA 4DV3L 2BH8A 1CKOA 2HHHL 4IJHA 4YHHQ 2UXBQ 4WJ3M 2WB1G 4QIWE 5IP7H 4PZ8A 1VQIA 1D7QA 4C3HH 1RIPA 4QL5A 3HOUG 2ZJPA 4C2MH 2A8VA 1GD7A 3HOZH 3PO3H 4DV2L 5C4XG 1L1OC 1PH9A 5C4JH 2I0QA 2JA6H 2V1CC 4GN5A 4DNIA 1X3GA 2UXCQ 1IBKQ 1YHAA 4JYAQ 1L1OA 2UUBQ 2HT1A 1TWCH 5IE8A 3HOVH 2F52A 1EFWA 3B6YA 4QY7A 2UUCQ 3DM3A 4ALPA 2H5XA 1Q82C 4ME3A 3T1HQ 4MTNA 4A3EH 1VQOA 4LFCQ 1GM5A 2ID0A 2VUMH 2R7DA 4GLVB 2VQFL 1WOCA 2UXDQ 4A4IA 1LTLA 1VQHA 4NXMQ 2KCTA 1S3OA 3RN2A 1JJ2A 1JJCB 1V1QA 1WI5A 1SFOH 1N32Q 4DV0L 1I3QH 5BR8Q 1YIJA 2R7FA 1QVGA 4DR2L 3I4NH 3CW2C 1UWVA 3PSIA 1PH6A 3PUWA 1XPUA 1HJPA 3H0GH 3KLWA 1OXSC 4OX9L 3PO2G
chains in the Genus database with same CATH superfamily
3JAMi 3A56A 5BN5A 1G51A 3CP0A 4K5XA 3K57A 1YNNC 3BDCA 4X64Q 3PO3B 1SROA 1ASYA 5TSSA 4YY3Q 3LWEA 4K8JA 3S1NH 4RKBA 1I4HA 2BA0A 5C4XG 2MPMA 3EVQA 2JE6I 1DOLA 3SGIA 3A8JE 4L5QA 4EQPA 2OWOA 1QNUA 5IYBH 1KC8C 4G7ZC 3GTQB 1HNWL 2E5LQ 5ELFA 2UXCL 4FF2A 2OCEA 3PIO3 3K6OA 1C7YA 1KTKA 4LFCL 2TMPA 3LWUA 3CXCA 1ET9A 5KYIA 5KEEA 1VQCA 1H9JA 1B4OA 1YNXA 3T1YQ 2F0SA 3L7ZC 3GTPB 5KYLA 4KD4A 5E4XA 1X3FA 4C3IG 4R8NA 3OW2A 1EL0A 1LUZA 4ABNA 2Q8TA 1QG7A 4RHSA 2OF1A 1EQQA 4AIMA 1VQKA 4DAYA 1XNQQ 3H15A 1QILA 2SDFA 3MXPA 5ISRA 1OTCA 4LF6Q 1EYAA 2PNHA 3MVVA 5A2QE 1GVPA 3CCUA 1J9OA 2R93B 5LMNQ 3A5UA 2NTTA 3C1FA 2I46A 5LMNW 4DUYL 2NYZD 1LO5D 2EE1A 1IKMA 4DGZA 1TS5A 1B7YB 2TSSA 4JYAL 1SEBD 4K5WA 3K8AA 5DEHA 1I4XA 4JI4L 1SLJA 2NB0A 3AYHB 3BYTB 3C2PA 1EYCA 3TREA 4JI5L 2O5JC 3MA2B 2GVAA 1FGUA 3U58A 1YITA 4O0AA 2RHQB 2KCMA 2K5DA 5HURA 2NVXH 5IWAL 4E6IA 3T1YL 3MEHA 1PH5A 3ICEA 1VQAA 3FEWX 4RGOS 4X3SA 3D31A 1VQ6A 3SK5A 1AP0A 1I4PA 5IYCH 4K6LA 3GTGB 1LT3D 3M85A 1B8AA 4A93H 2M2LA 2YTXA 4HAEA 1F77A 3EFXD 4RGNA 1K83H 4LF9L 2N78A 2G5DA 3FKIG 4KKUA 3K80C 1E3PA 2EYFA 3TS0A 1STAA 1KL9A 2A6ED 4R1JA 4DXGA 3H91A 1E1TA 1E2WA 5JOBA 4A3MB 3T53B 5IGCA 2EY6A 2PPBC 2BE5D 2A68C 4J1MA 4RGTA 4FF3A 5M3FH 1K9MC 3S1RB 3SHLA 5AFWA 3HOXB 2NTSA 3AQQA 3QR8A 2NZOA 4NB3A 4DV1L 2A69D 1GJXA 1EOVA 4ODGA 3Q6SA 4L5SA 5LL6X 1CM9A 1VQBA 1XX8A 3C3LA 3GV6A 5M5YB 4GN4B 4F87A 2WACA 3GTOB 2DY8A 1AE2A 3M4PA 1Y1WH 1HA6A 3G7LA 2SEBD 3K7UC 1X6OA 2JP1A 2B3GA 3MHBA 4PQXA 1B1ZA 2AUKA 3QOLA 2QA4A 2E8GA 1F9PA 1FL0A 1VQFA 3RLOA 3KF8A 1N33Q 4A3LH 3W2DA 3TDQA 4WFN3 4LF9Q 2R7ZB 5IGFA 3T51B 3NWSA 3MAQA 2RF4A 1T5EA 1FYCA 1SN8A 3JAMc 1K3RA 3NK9A 4JBKA 1PA6A 1Y8NB 4DR5L 4BY7H 1V1PB 4DR1L 3OMCA 4UPAA 2PW7A 2VZAA 4IFDI 3KF8B 3I4NB 1PHJA 4TQUS 4FXKC 1B50A 5IYDG 4DA2A 4O42A 3V2TA 1E22A 4PZ7A 1EIGA 1VQ8A 3I4NG 2Z4IA 4DN4M 4A3EB 2XVSA 4UP8A 5C5LA 4DV4L 1HR0L 1JWMD 3I4MB 2MP1A 4XT1B 5CGKA 3GTLH 4ZAIA 1TIID 3KOJA 4AQYQ 2EXZA 4MIUA 2XIWA 4ID6A 1RDPD 2QCPX 3GTJH 3HZXA 4DV2Q 1SMXA 2MUYA 1NY4A 4JI7L 2NN6H 2JA7H 3GTQH 4KLKA 2WKCA 5DNFA 5JEAJ 1TT2A 3I3CA 3O13A 4G4KA 2K1BA 4OX9Q 3S16B 4Q5VA 2XN9C 3J80E 1EEFD 2YYZA 1ET6A 1GUGA 2IY5B 1ZYRD 5IWAQ 1IZ6A 1Q86C 1HZBA 1BVSA 3T56B 2F0HA 4BS9A 5LHY1 3NTKA 3JAME 3PUYA 4U673 2L11A 4A3LG 1F2YA 3MWYW 2NWGA 1TQOA 2LS01 5AJ3Q 4DV0Q 2ZTEA 1X32A 2F0MA 4JBWA 4Y7NH 4LUVA 3BVGA 2R92H 2I07B 4UHVA 3S1QB 4C2MB 3QWNA 1K83B 1FNVA 2HCIA 4CDDC 2K03A 4KY5A 1VMCA 2J7ZA 3ZJYC 1EZ6A 1KXLA 1VQNA 2E2IH 2D5DA 5GROA 3H3VH 4K2KA 5COYA 3S1MH 1CSQA 3HKZE 1VQ4A 4LFAL 1N34L 1XNQL 1H95A 1PH4A 2VY3A 3PO2B 3P1HA 3K59A 3SXHA 3JAML 1PVOA 2AWOA 2KENA 5CV8A 1BQQT 3NELA 1WCMG 3MFGA 2UXDL 3W1GA 1SYBA 4DKAC 2RA4A 1NJIC 4ZRZA 2QDBA 1EIFA 4BY1G 1SJED 1HR0W 2LFNA 2JQOA 4P72A 1F9QA 2L12A 1M8AA 2CH4W 5D3IB 3GTGH 3ERSX 4HR7B 1XYIA 2Y0SG 2HIVA 3UDFA 1JB3A 3FVQA 3NBHA 1EYDA 1AH9A 4GS3A 4DK3C 1MKHA 3CC7A 3WOEA 4HSPA 4YCVA 3X3MA 1I50B 1OXXK 1E7ZA 2QF7A 3L0OA 3OYYA 1I5FA 2QGQA 3FHWA 4B3SL 3NBIA 3OIQA 3J81j 4GKJQ 2R7ZG 1QJOA 3E6ZX 2E76C 3RZDH 1Y1WB 3OMGA 4KK7A 2WAQG 4GKKL 2KCCA 2N8NA 1OXUA 1LTAD 4UP7A 1SE4A 4H44C 4B3RQ 1G291 1CI3M 4JI3L 2BDOA 4IFDG 1YVCA 4H0LC 4M8AA 1EIHA 3ONAB 5LL6S 2HCCA 3PIOA 4BBSH 4DR4Q 1UEBA 5M3MG 1RF2D 1MJEA 1XJVA 2R93G 1CQVA 4JI2L 4DV5L 1HNWQ 4DV1Q 1K73C 1K8OA 1VQEA 4H7BA 1EOTA 2ZJRA 3U9SA 5IIFA 2X69A 3BU2A 4APVA 2PMZE 2QILA 5JJZA 2UXBL 2CWPA 1PTOD 1JC7A 3M4OB 4OELB 1L1OB 1RL2A 3I56A 1TWAB 2CHBD 1TWHH 3TN2A 4DV7Q 3OPOA 4KHPQ 4OHJA 3UDIA 4JCVE 1Z7TA 4HJAA 4R9WA 4BY7G 1IL8A 3U9OA 1EY8A 1VQ5A 4LF6L 2JYOA 4XYQA 1M4VA 3KJPA 4F88A 5CC4A 1CKOA 4IJHA 4YHHQ 4QIWE 5IP7H 1EY6A 1CA6A 3HOUG 1DCZA 1PTOF 2ZXOA 1GHJA 2F03A 1PH9A 3KBXA 2JA6H 4DNIA 4GN5A 5E4WC 4JYAQ 2HT1A 2NZ1D 2RSNA 4QY7A 2UUCQ 3DM3A 3A8KE 4ALPA 3LNNA 4MTNA 3TP8A 2VB3X 3EJIA 4GLVB 2UXDQ 4KY6A 1S3OA 2IW3A 1JJ2A 1F9RA 1RCVD 3D6CA 1WTXA 2N55A 2NBFA 1I3QH 1YIJA 2XWJB 1SYGA 2RDHA 4MN3A 1SE3A 1PH6A 5CYUA 3PUWA 2CW0C 3FMCA 3T4AC 3K7AH 2K52A 4XQJA 1JE5A 1MBYA 1E0BA 2F4VQ 1X65A 3M4OH 4JV5Q 3RLNA 3HOZB 3UE0A 1WJJA 4XYOA 3NP8A 1KABA 1FNUA 2M00A 2F0JA 4BBSG 4YCUA 3UE1A 4A3MG 5NUCA 4BY1B 1DM0B 1NR2A 1LT5D 1PH8A 1JWSD 2H4OA 3EA6A 3TZUA 5KNDA 2Q8IB 5D65A 1LTBD 1Q46A 3U4VA 1P16A 1PRTC 1Q81C 1G2SA 2BA1A 3K5LA 4HIDA 3MXNA 2WKDA 3UDGA 3NTHA 3T1HL 1U0LA 2Y0SE 4IUUA 4JI6Q 1DJRD 1J8IA 1B9MA 2EYMA 5IP9H 2OTLA 3M3YB 1GUWA 2ZTDA 4A3DH 4A3JH 3W5OA 1N34Q 4IALA 3RR5A 5C0XJ 3F2DA 5KIXA 4QJFA 2B2VC 3HOXG 2Q2TA 4EQOA 5ELEA 1GKHA 2WAQE 4A3IH 3G48A 3HOXH 1R4QB 1JORA 3K81C 2I5HA 3IFTA 4RFBA 4BA1I 2JEBI 2KECA 2LSSA 1L0WA 4C3IH 4RA8A 4A3DG 1XMQL 3R8BA 2PNRC 2KHIA 4BWGB 3KFUA 2EVBA 3TRZA 1IYJB 2R61A 3N52A 3H0GG 2N88A 1XXGA 1XMOQ 1HQMC 1SBBB 4ZK9B 1K8AC 1S5BD 1QB5D 1VDZA 2B2TC 1EQRA 4RG1A 5JPMC 5CV9A 4EGVA 4FNFA 3DLLA 4PG3A 3SEBA 5LMUL 1BBWA 3HKSA 4P2CB 2ASBA 3U50C 1JE4A 2N49A 4HJ8A 4I7ZC 5CMDA 1SE2A 2Z6KC 3QB3A 4YY3L 3G6EA 1GUTA 3NSWA 4N8X1 3L2PA 4BBRB 2IX1A 1TXYA 1WYDA 4L6TB 1LT6D 2F0PA 3D3RA 1I94Q 3HOUH 2OQKA 2OXPA 4C3HG 4DR4L 5IP7G 1QZHA 4DUZQ 2PW5A 1B44D 4Q0FA 4LW1A 2Q8RE 1YHBA 2LKVA 5FKAC 4Y7NB 2FINB 1LTTD 1ZYRC 2K28A 1HQRD 1SNPA 3HOWG 1EYGA 2VUMG 2PQAA 2F0FA 3ND8A 2HHHQ 3BS1A 3GTKB 1XTDA 3N6RA 2EDGA 2JEAI 3OHXC 1VQJA 5CV4A 4CJ2C 4DR5Q 1SNQA 1H9SB 1QZGA 2CKZB 5IGGA 3OTOL 1ESFA 3FRPB 4IUTA 4DF7A 1A2UA 4A3FH 2IPKD 2XSCA 4A3IG 1FD7D 2C9OA 5I6WA 4NMZA 1JICA 3M9BA 2A68D 2E2DC 1YJNA 4A3IB 4JI0L 3CCMA 4DAMA 5G3LF 3DXJC 4J15A 3VA7A 4CDEC 1TU2B 3ND9A 2K01A 4JG2A 3ER0A 4LUZA 3HP3A 2NVYH 1N36L 5E3FA 4AQYL 5GAEC 4BXXG 3JC66 4KHZA 4OO1H 2KBNA 2L55A 1ILPA 1N9WA 1C9OA 2AWNA 2UUBL 1GHKA 2GVBA 2EYHA 4ZUJA 1PH3A 2UUAQ 3CD6A 2AQ3B 1D2BA 4R4CA 3NEMA 1NSNS 1MIUA 2Z4HA 3OSOA 2R3ZA 5FOBB 4PMCA 4R8IA 1VQLA 3TMEA 1G6PA 2D0PA 3MXGA 5LMNL 4NPSA 4QUFA 3WOFA 1Y1WG 4G7HC 3J81E 1A3TA 3OWEB 2JA5H 2NVTH 2PMZB 4A3MH 4KN4C 2CVRA 1GOZA 1STGA 4IUNA 1JQYD 3RLFA 2F0GA 3J81i 1JOQA 1UE5A 5FLXE 1DZ1A 3EBEA 2ES2A 4EQNA 2UUCL 2ZJQA 1N33L 1VQGA 4JI0Q 3CAMA 3K0XA 4BBRH 3GP7A 2B2VA 1L0XB 1XTCD 3S14H 3GDEA 4IFDJ 1KLGD 2VQFQ 1Y14B 2F3WA 2PZUA 3K5OA 4YCWA 1U9RA 2QDLA 4LF8Q 2R7ZH 1RKNA 1HZAA 2PI2E 4LMQD 1T9HA 3CMEA 4B9WA 4IOAA 2RVLA 4A93G 4A3EG 4KKTA 2XTIA 5IYCG 1QNKA 2B8GA 4ZYSA 5FLXL 5I4DA 3MEFA 3SK8A 3BZKA 5IODA 1FVIA 1SE8A 1NR4A 2Q2HA 2JA6G 1YZ6A 2HIXA 3NQIA 3MXUA 1PDQA 3PIPA 3I2ZA 2A69C 4JW0A 1A6XA 1SNMA 5C44H 1SNOA 2QW7A 3CKIB 5CV7A 3G71A 2UU9L 1A3VA 4R4IA 3I4LA 5EBDA 4DR7L 3P7JA 4IURA 2R92G 1WCMH 5M5XH 1EZ8A 2PCFB 4CDFC 3S2HH 1SDFA 5JVH3 1ENAA 4QF4A 3ULLA 4MZ9A 1NUCA 4WJWA 5GAGC 2A6HC 2HQEA 2JA5G 4IO9A 4OGQC 4NP5A 2Y0SB 5FO7B 4N9TA 4JPBW 5KNCA 4LFAQ 5IGBA 5AJ3L 1CKNB 2BE5C 1K8MA 4KMUC 2F0DA 4CJ0B 4X65Q 1WD1A 1PH1A 2OTJA 2JA7B 1STHA 2B39A 2RCFA 4JV5L 3CRKC 4DV6Q 3OIPA 2F0OA 3KK7A 2EOTA 3CPWA 1KDBA 4A75A 4FF4A 4B3ML 4CDCC 1TWFB 1I4QA 2RDFA 5EBCA 1O80A 4L5TA 1QCBD 3M7GA 1SNCA 1MGSA 1U4PA 5IP9G 4B3RL 2VQEL 5JJIA 1I3QB 5ELCA 5DM63 2DJGC 4OWWB 3SE0A 3TZDA 3Q23A 3KYHC 3BDOA 5FJ8G 3NQTA 2E5LL 3BJUA 3H3VI 2B29A 1KIXA 2JJQA 4IPDA 4ZKCB 1UE7A 1HNZL 2M9VA 2NZHA 3DEOA 3I73A 1CKMA 1LTGD 3KBGA 1UEAB 4GN3B 3VR3A 1A63A 3DM1A 4A3FB 2Q2UA 3Q8DA 1SR3A 1UAPA 1EEID 3Q24A 3F8TA 3STBD 1E24A 2F0IA 2SNSA 3I91A 2ZM6Q 5M3FG 4GOPA 4A3FG 1EWHA 1I4GA 3TS2A 2GA4B 2F0EA 1TS2A 1B2TA 3J81L 2AQ1B 2D2CC 2IT1A 1TS4A 1R4PB 2IWHA 3GO5A 2B63G 1V8QA 1YHQA 1YNND 4IN3A 3R2TA 4JI5Q 2K14A 2MFIA 3A7LA 4OIKA 2HHHL 1I6HB 3AB9A 4PZ8A 4KN7C 1VQIA 4C3HH 2ICEC 4DAVA 2ZJPA 1GD7A 4KKSA 2JA6B 1ESRA 3RUZA 1L1OA 3DMUA 3MC0B 5C4ZA 5IE8A 2F52A 1EFWA 3HOVH 1PFNA 5FK9C 4OL7A 4TRDA 3FKIB 5J22A 1VQOA 4A3EH 1GM5A 4G7OC 2FMMA 2R7DA 1WOCA 4CKCA 4NXMQ 3RN2A 1WD0A 5K5PA 5T1GA 1V1QA 1WI5A 1SFOH 1N32Q 4DV0L 1QVGA 4DR2L 3AMUA 1QOHA 1UWVA 4QCLA 2EYJA 3HG9A 4HCSA 1LT4D 1BCPB 1KAAA 1XPUA 3H0GH 1OXSC 3WDNA 1PFMA 2CCZA 3H94A 2C35B 4LF4Q 5M3MH 1YNJC 4EVOA 2MO0A 1PZKD 3SDZA 2L4NA 4CBVA 4O1NA 1VQMA 4A3JG 2MGSA 1F2ZA 3EIVA 3CCQA 2K5VA 5T1IA 4GNXC 3PF5A 3HOUB 3R3OA 3S2DH 2R6GA 2F0KA 3A0JA 5JVG3 2K7VA 2E74C 1HZ9A 4NXNQ 1K0SA 2ALYB 1B3AA 5D3DA 1V43A 4G57A 3J7ZC 4A3KG 2NVTB 1PH2A 1BO0A 4RAUC 3VYRA 3KDFA 4P74A 1OO9B 4LF5Q 1A62A 2JXMB 3CPFA 4L5RC 1XNRL 4X6AH 1HNXQ 2Z0SA 1P8LA 1VQDA 4DR3L 4X3TA 5FLXc 1RTOA 4B9XA 4QMGA 4LF8L 2FJ2A 1PV4A 2E2HB 3KLRA 3H6MA 2E2HH 3E9IA 4TSSA 4FXDA 1JR0D 1NNXA 2B2WA 3BG3A 1FNWA 3EROA 5CV5A 5JAVA 3KJOA 3IKJA 2ZM6L 3A8IE 1SYCA 2PO4A 3URYA 3S9WA 3FDTA 4K6DA 1R9TH 1ASZA 3A5ZB 3K7AB 1U4MA 1U5KA 4FDBA 1UE6A 3PGZA 4KY7A 1VCIA 1QE6A 1UNSA 1V9PA 2YTYA 1Q8KA 5C4JB 4IZ8A 4NW2A 5M5WH 1VQ7A 4EQ5A 1SYEA 3HOWH 2Q2IA 4DV7L 5BN4A 1VF7A 4MHEA 2VB2X 3ULJA 1Z9FA 1HHVA 1MHWC 4IQZA 1G8ZD 2F4IA 1IW7C 1E2ZA 1H9SA 4K14A 4LFBL 2KEDA 1VQ9A 3KUPA 4QUCA 4OXPA 1S40A 1JCKB 3CHBD 4JOIC 1XPRA 2JA8G 1VF5C 2K5NA 2PQAB 1PTOC 4C3JH 5EKKA 2MNAA 4DUZL 1O78A 2DNEA 5C4HA 4P75A 2HUGA 4DV5Q 3PQIA 2ATWA 3I8ZA 2QEXA 3H3VC 5C4XH 2RDGA 3BVZA 3ITPA 4IFDH 1SYDA 2IL8A 2RSOA 4LAAA 1H9RA 2Z6KA 1YEZA 1MI2A 2KVMA 3PO3G 2Z9HA 3OWFA 3J7YW 1PYBA 4DR1Q 4RKLA 5HGTA 1WCMB 5M5XB 1NTGA 3VR5A 1TWAH 5BR8L 2B63B 1W6JA 1TWHB 3IL8A 4K0KL 4WJ4A 5ELNA 4V190 3UDXA 5CV6A 1HFGA 3NHHA 3H09A 2ZTCA 2GN5A 4YWMA 3GQBA 2NN6G 2JA7G 1EWIA 1D1IA 2R93H 4OIJA 2L0CA 2B2YC 3TQYA 5IOCA 2ZT9C 4A3KB 1K8GA 2KHJA 1LV9A 3CC2A 1AN8A 4B3TL 4R4QA 4X65L 4XTCS 2K04A 2OT2A 4HTHA 3P20A 4ILWA 4OWXB 3BZDB 4DXFA 5FLMH 1AFPA 4JI7Q 4BY1H 2KQ3A 3AU7A 4HIMA 1KNEA 3HGBA 2DJFC 2F3IA 1KLUD 1CQFA 4UAIA 1YJWA 3W3AA 3TEHB 1RODA 1LABA 4ZLTF 5I9OA 2EZVA 5D14A 1G2TA 3IRBA 4ZKBB 4XIGS 4LF7L 3V05A 3OW7A 4RCNA 1IBLL 2HQLA 1HUMA 2E75C 1LACA 4CGYB 1MJCA 2VNUD 5KNBA 4A3GB 4RCOA 1G6ZA 4DFAA 3D6WA 3G6JB 2B2YA 5GADC 3GD7A 2K5QA 3HFZB 4DV6L 3PUVA 5J3BA 5L37A 1RJTA 2K05A 4F8MA 2WP8J 1TWFH 1PYWD 1JWUD 1N36Q 3QIAA 5BN3A 1GO3E 2EJFC 2SNMA 3PUZA 1A3UA 1STBA 3MZ5A 1JOOA 2JSOA 3W1BA 5HGQA 4YWLA 2X6GA 2O2LD 1TY0A 1NBWA 2CWAA 3OTOQ 2EIFA 2UUAL 5K36H 4Y52H 2BH2A 4YWKA 2F0VA 1DYQA 3SK6A 5A35A 4A3DB 5ELOA 1CZWA 4QGUA 4RHRA 2DUDA 3J7A5 2D0OA 4BBRG 3EQLC 1BBXC 4PMWA 3K5MA 2JA5B 3FKIH 5FLMG 3I4OA 2CW0D 2B63H 3F2UA 2CH4A 3S1MB 4C56C 1QVFA 5I2YA 1SAPA 2N3SA 3RZDB 4YIJA 1O7LA 2AMCB 2CQAA 1HTPA 5EKLA 2HDMA 4BA2I 2EYOA 4H02A 1Y69U 4A3GH 3NPPA 1ICFB 5GQOA 4DAYB 1Q90A 1XNRQ 4UY8C 3CCEA 3WWVA 2VQEQ 1UE1A 2DY7A 4U68A 1EY5A 3A54A 3OOCA 5C3EG 3KF6B 3CCLA 1XMQQ 3DEPA 1F9SA 4FVMA 4L8JA 1Y1VB 4XQNA 3NBHB 4A3BG 1HZCA 1MSGA 4BXXH 1H9KA 2A19A 3HOYG 5C3EB 1HFNA 2KUMA 4C3JB 4CJ1B 1HNZQ 1XMOL 3L9AX 3RN5A 2X6LA 1JB7A 3G4SA 4GLXA 1JJGA 1I6HH 4IPCA 5EPJA 3HOYH 4OWTB 4ZQ3A 3T16A 3D0FA 4RWSC 4XDXA 1DGSA 2L1BA 1PRTD 3CCSA 1I6VC 5C0XH 3I7FA 2NUCA 2JN4A 1F2LA 4WORA 1BCPD 3E5SA 1AZQA 4KTAA 4DR7Q 2ENBA 1O7YA 5DLQE 3GTPH 5DM73 4UP9A 3E0JA 4HJ9A 1HA5A 1LLRD 2MHVA 4O2DA 4C1NI 4A3GG 4H13C 5A2QL 2B2TA 3S14B 4JK1C 3J80c 2EQSA 4V0BA 4IUPA 5IGEA 2F0UA 2G9HD 2KHSA 4HMIA 4POGA 3NENA 5LMUQ 1ZXTA 4X62Q 1V1OA 2A5HA 2EY2A 1AE3A 3K58A 2R92B 3CU7A 1KDCA 3GTOH 4DK0A 5GAHC 1YJ9A 1CZGA 1D1KA 3VR4A 5JJLA 1BBUA 4DK1A 3M4YA 3U4ZA 4KI0A 2A6HD 2MJ8A 4LK1C 5G3LD 2RHSB 3E0EA 4RMFA 1U4LA 3A55A 1UUPA 2VXWA 1KQSA 2P5ZX 4F7XA 3PIP3 3M4QA 5C44G 3ULPA 3HOYB 1FR3A 3BVMA 2IHFA 5ELBA 4A3CH 4R4TA 2LY7A 1Q7YC 1HH2P 4EX5A 2AKWB 5F2DA 4OONA 4A93B 1ZEQX 5C3WA 5JEAG 1K28A 1J6QA 2CFMA 3TP5A 1S5CD 1WFQA 2NVQB 2RQXA 1CK1A 2UU9Q 2EYPA 1M1KC 2YTVA 1XPOA 3ERQA 1STNA 4X64L 4GOPB 1PZID 1W3SA 4P71A 1TKWB 1FJGL 1EU3A 1X54A 1A15A 1KNAA 4IOCA 1WTHA 4DV3L 2BH8A 2J0TD 3SVMA 4KD3A 1RIPA 4QL5A 5EPLA 5C4XB 2EJMA 3HOZH 1V1PA 1L1OC 2ZXPA 4DU9A 5M3MB 5C4JH 1HTLD 2I0QA 1X3GA 2UXCQ 1IBKQ 1BXTA 2K6AA 1TWCH 5J1ZA 4J6HA 1ML0D 4PV1C 4X3UA 2JA8B 2H5XA 1ONLA 4ULLA 4ZUIA 1DOKA 4NKLA 4ME3A 3IAYA 2BCOA 4UDUC 1MD2D 2ID0A 1STYA 2VQFL 4PMBA 1DXMA 2WIIB 1LTLA 1VQHA 2KCTA 1SMYC 5JPNC 1JJCB 2BDNA 5BR8Q 2R7FA 5EKIA 3QO2A 1IKLA 2EJGC 5FO8B 3KLWA 1IHZA 4OX9L 3PO2G 1CTMA 1LM0A 4DNTB 1YI2A 1FJGQ 3HKZG 2C5CA 1FGBD 2IX0A 2FFKB 4QIWB 1Q1EA 4JVZA 3I4MH 4FYDA 2D9UA 2Z8LA 3VYTA 3S17B 5I2XA 5CR3A 2WFWA 4XXEA 1SRUA 4LWCA 3HRZC 4LUOA 3J80L 4LF5L 2I5MX 3CCJA 1EIYB 3LX0A 5FO9B 3S15H 3KLSA 5I9PA 4HIKA 1BCPC 5JJKA 2LXJA 4K0KQ 1I50H 2NVYB 1D5MC 1CUKA 1PFBA 1WTPA 2KOLA 3BYYB 4LJZC 4JI1Q 4JC0A 4IJLA 1SYFA 4HIOA 1KHIA 5C3XA 2KCNA 1CHPD 3MXNB 1TWGH 1Y8PB 1LTSD 4IUVA 4R4OA 1SMYD 3VA5A 1CHQD 2K75A 1B70B 1QUQB 1YBYA 2A73B 1HUNA 4ME5A 1VQPA 1W2BA 2AQ2B 1SFOB 1SSOA 2YV5A 2F0TA 3DUZA 3S15B 4PZ6A 4CKEA 3DHQA 4N8FA 2RCNA 1F2MA 1BKBA 4NDXA 1SXTA 4KJNA 5C0XG 3GTKH 2XRSD 1IL2A 2AHOB 3C1EA 3QJYA 3R2IA 4IPHA 5C6AA 1KD1C 3S1RH 1EWCA 1C8CA 1S5ED 5FJ8H 1S5DD 2L9HA 3CQZB 1JMCA 3I4MG 2DN8A 2KJXA 4ZCKA 3TSSA 2F3VA 5EAYA 3R93A 4QQBX 4A3BB 2EY1A 3F1ZA 1WTVA 3SR1A 1G91A 2RKSA 5C0XI 5C5MA 2OEOA 4S3SA 2FXQA 2B2UA 4BY7B 3CC4A 1BF4A 1LTID 4M1UB 4GLAC 2XRQD 4HJ7A 1ENCA 4B3SQ 1IXRA 2V4DA 4X66Q 2EXDA 1HPCA 2D62A 1PLFA 3I70A 2WINB 3X3NA 2EYLA 3CF5A 1Z6HA 1A0IA 2E2JH 4HMJA 2E2JB 1C0AA 3C46A 4K5VA 5CORA 4PNYA 4DK6C 1II3A 1D6EC 3S1NB 1K0RA 3HKZB 5JEAH 4A3BH 4DUYQ 3PO2H 1D5XC 3GTJB 3S2HB 1IBMQ 1ENFA 2K50A 4XQQA 5EQ0A 2PZWA 2ZXRA 1U4RA 2BOSA 4A76A 3BDLA 4A3CG 1J5EL 1CA5A 4AH6A 2JA9A 3CMAA 3KDFB 4GKJL 1EUJA 1TY2A 4GOPC 2K4KA 4AYBE 4HCEA 3J81c 1IW7D 1OXVA 5IT9L 1PZJD 4FP5D 2O5IC 1GUOA 2SOBA 2IX3A 3J7AF 2YU9B 3TP7A 3NE5B 1O7IA 3PCOB 1TS3A 3D4DA 3GTMH 3HOVG 4JI3Q 1DONA 1TVXA 3AFQA 4FO2A 5IYBG 1XWEA 5J39A 1BCPF 2PYKA 1BOSA 3HOZG 3VYSA 4JI1L 5I6YA 1WTOA 1X3PA 3M7NA 3FPPA 1SNDA 4BBSB 1Q1BA 3I90A 4AYBG 4HN7A 4DV3Q 1C48A 2OQ0A 3NXWA 1I94L 4HJ5A 3GTLB 5KRUA 5M3FB 3KF6A 4DR2Q 1ICWA 1X56A 4K8IA 1IBML 4KHVA 1GXDC 1W6KA 2PZTA 3UI2A 3STBC 5CBEE 3AEVA 1WTWA 3RMHA 4KHPL 3GTMB 1ZKOA 1BDOA 2HD3A 2VW9A 1D8LA 1EU4A 1OXTA 5HY6A 1NAPA 4B08A 1X9NA 4KJOA 1QVCA 3V96A 1M90C 5DAUA 1KAWA 3J80i 1S5FD 1CT1D 4JI8L 3VR2A 4DR6Q 3PF4A 2LMCB 4CHTB 5CBAE 4B3TQ 2MO1A 1Y8OB 4OO1G 2NN6I 1MSHA 2CQOA 2K5WA 3AFPA 1PTOH 2A1AA 2YU9H 3K5NA 1BR9A 3CRLC 1L2FA 5H1SE 3D8GA 3Q22A 2VUMB 1YNJD 4DAPA 2F0LA 2DGYA 3I72A 5E7NA 1PMRA 4GNXB 4LFBQ 1X55A 5E1FA 1IYVA 1PYSB 2I5LX 1SJHD 1EY4A 3L3OC 3GV3A 5C3EH 4FXGC 4HSVA 3PMFA 3E9HA 4LNQA 2WB1B 5EGTA 5C44B 1RHPA 1X3EA 5EJWA 4LF7Q 1GUSA 2XNAC 4DPGA 1VS0A 2KA7A 1HRJA 1ILQA 2XWBB 1R9TB 4JBMA 4C3HB 1WVLA 1D5ZC 4J8QA 1STEA 2F4VL 3QG1A 4I7AA 1JT8A 4YHHL 2PI2A 4DV4Q 1LYLA 1Q8IA 4POFA 4B3MQ 3HOWB 2EPBA 2VL6A 4HEDA 2F0WA 3CQZH 2B2UC 4JI4Q 1HCZA 1Q3LA 1LTRD 2VS1A 5IYDH 2B2WC 1NMGA 2QEJC 4Z9CB 3NUCA 3MTSA 1KRTA 2RBMA 3VR6A 4MNOA 2XGTA 3CCRA 4GNXA 1H9MA 3F2BA 2HDLA 1RTNA 4RH6A 2WB1E 1N8RC 1PTOB 2B8FA 1I4RA 3I55A 4OO1I 4AYBB 1IYUA 2EY5A 4XT3B 3S16H 3S1QH 1DOMA 1E1OA 1WTRA 1N32L 3FPUB 4K2LA 4QB4A 4A3JB 2ICIA 5IT9E 3TBIB 3IFDA 4KV6A 1WTQA 5M9OA 5M5WB 3LGJA 1IBKL 1AZPA 1AEXA 5EPKA 3VYUA 1B9NA 5IY0A 2Z6BA 2JA8H 3M3YH 2A74C 1NCVA 1TWGB 3PV0A 2Z1CA 4X3KA 4GKKQ 1A8VA 4I65A 1PH7A 1CFMA 2F1MA 4P73A 1JOKA 2KEEA 1Z47A 4L63B 1B3QA 2WAQB 1HXYD 1S72A 3FP9A 1EQTA 1IBLQ 1Y1VG 3Q0AA 3RD4A 2K32A 2MQHA 3F2CA 1PRTF 1TR5A 4NXNL 1VMPA 2JK8A 4JI6L 1EY0A 3P75A 4JBJA 2NVQH 3S17H 1Y1VH 4DNRB 3RZOH 1HR0Q 3RZOB 3EN2A 4JI8Q 1KDAA 4DR6L 1DD2A 3KLSX 1PFSA 5K36G 2F0NA 2L15A 4RGMA 1HNXL 3HS0C 3HEJA 2O4XA 1E2VA 4X62L 2K5HA 3E3XA 4IPGA 3A74A 3SK4A 3T13A 1KRSA 4DR3Q 1J5EQ 1RD9D 1CSPA 4X66L 3CCVA 4IUQA 3NWTA 1NE3A 3S24A 1EFID 2L5TA 2IHEA 1QUQA 2FHTA 3MFYA 4JOIA 2G9DA 1S4ZA 1C4QA 3D4WA 1K3BC 1A2TA 1EY7A 5M5YH 3NTIA 4A3KH 4NXML 2LXKA 4TVAB 1Q12A 2PQEA 3PUXA 3RNUA 3VDYA 3K0YA 1EQVA 1NMFA 1B53A 5IT9c 1QWYA 5KGUA 4JI2Q 4WRDA 1EY9A 3BZCA 4C1NK 4MTKA 3ZYYX 1CKNA 1BUVT 2FMCA 3TP6A 2H1EA 2K33A 4CKBA 4LF4L 4FF1A 2UXBQ 4WJ3M 2WB1G 1X3QA 1D7QA 1PXUA 4C2MH 2A8VA 2DNCA 5ELDA 3PO3H 4DV2L 1AW7A 2V1CC 2QKIC 1YHAA 3QOJA 5IGDA 1TWCB 2UUBQ 4GZYC 1PRTB 3H0GB 3D4RA 3B6YA 1O7ZA 1Q82C 3T1HQ 2E2IB 2IJ0A 4LFCQ 2VUMH 2WV6D 1L0YB 4A4IA 4OEMB 2NVXB 4C3JG 2A6EC 4TKOB 1BNZA 4N9PA 3I4NH 3S2DB 2J4XA 3CW2C 3DWPA 1T5XD 3PSIA 2F0QA 3A7AB 4C3IB 3DWQA 1GUNA 1HJPA 3DWAA 2AUJD 3HOVB 3J7AV
chains in the Genus database with same CATH topology
3JAMi 3K7AH 2K52A 1LM0A 1YI2A 1JE5A 3HKZG 1FJGQ 1G51A 3CP0A 2F4VQ 1X65A 3M4OH 4JV5Q 2CCZA 3RLNA 2IX0A 4X64Q 1SROA 2C35B 3UE0A 1ASYA 1WJJA 4LF4Q 4LF5L 4YY3Q 1Q1EA 5M3MH 3I4MH 2MO0A 4BBSG 2WFWA 4YCUA 1SRUA 3UE1A 4A3MG 1VQMA 4A3JG 4LWCA 3S1NH 2BA0A 3EIVA 4LUOA 3CCQA 2K5VA 4GNXC 3PF5A 2I5MX 3CCJA 1PH8A 2JE6I 1EIYB 3S2DH 3S15H 2R6GA 3SGIA 3A0JA 4L5QA 4HIKA 5IYBH 1HZ9A 1KC8C 2OWOA 5JJKA 2LXJA 1HNWL 2E5LQ 4NXNQ 2UXCL 2ALYB 2OCEA 4K0KQ 1I50H 1Q46A 3U4VA 1V43A 1CUKA 1C7YA 1P16A 1Q81C 4LFCL 3J7ZC 2BA1A 4JI1Q 4JC0A 4HIDA 4A3KG 1PH2A 3UDGA 4IJLA 3CXCA 3T1HL 1U0LA 2Y0SE 3KDFA 4HIOA 4JI6Q 4P74A 1KHIA 4LF5Q 1VQCA 1A62A 3CPFA 4L5RC 1XNRL 3MXNB 4X6AH 1HNXQ 5IP9H 1YNXA 1TWGH 2Z0SA 3L7ZC 3T1YQ 2OTLA 1P8LA 1VQDA 2ZTDA 4DR3L 4A3DH 1X3FA 4R4OA 5FLXc 4A3JH 3OW2A 3W5OA 4LF8L 1PV4A 1N34Q 1LUZA 3RR5A 2K75A 5C0XJ 3F2DA 4QJFA 3E9IA 2E2HH 1B70B 1QUQB 1YBYA 1VQKA 1EQQA 4AIMA 1VQPA 1W2BA 3HOXG 2YV5A 1XNQQ 3H15A 1OTCA 2Q2TA 3KJOA 4LF6Q 2PNHA 2ZM6L 4PZ6A 2RCNA 1GVPA 3CCUA 1GKHA 1BKBA 2WAQE 4A3IH 5LMNQ 5C0XG 3GTKH 3A5UA 1IL2A 1R9TH 1ASZA 2AHOB 3A5ZB 3G48A 1U5KA 4IPHA 5LMNW 4DUYL 1KD1C 3HOXH 4FDBA 3S1RH 1UE6A 3PGZA 3K81C 5FJ8H 1VCIA 2I5HA 1B7YB 4JYAL 1V9PA 2YTYA 1Q8KA 3K8AA 2JEBI 4BA1I 1JMCA 2LSSA 3I4MG 1L0WA 4C3IH 5M5WH 4A3DG 1XMQL 1VQ7A 4EQ5A 1SLJA 5EAYA 4JI4L 3AYHB 3HOWH 2KHIA 4QQBX 2Q2IA 4DV7L 3KFUA 3TRZA 1IYJB 4JI5L 3TREA 2GVAA 3ULJA 1Z9FA 1FGUA 3F1ZA 3H0GG 3U58A 1YITA 4O0AA 2RHQB 4LFBL 2KCMA 5C0XI 1XMOQ 1VQ9A 2FXQA 4OXPA 1S40A 1K8AC 5IWAL 1PH5A 3T1YL 2NVXH 3CC4A 3ICEA 4JOIC 1XPRA 2JA8G 1VQAA 1EQRA 4GLAC 4RG1A 2K5NA 2PQAB 3DLLA 4PG3A 4C3JH 5LMUL 4HJ7A 4B3SQ 1IXRA 3D31A 1BBWA 2MNAA 4X66Q 3HKSA 4DUZL 1VQ6A 2EXDA 4P75A 2ASBA 4DV5Q 3U50C 2N49A 2D62A 5IYCH 2ATWA 4HJ8A 3M85A 1B8AA 2QEXA 4A93H 2YTXA 5C4XH 3CF5A 2Z6KC 4YY3L 3G6EA 3L2PA 1A0IA 2IX1A 2Z6KA 1YEZA 1K83H 4LF9L 2E2JH 1TXYA 2N78A 1WYDA 1C0AA 3PO3G 3FKIG 4DK6C 3K80C 1E3PA 1I94Q 3HOUH 1K0RA 2OQKA 3TS0A 1PYBA 1KL9A 4DR4L 5IP7G 4DR1Q 1QZHA 4A3BH 4R1JA 4DUYQ 4DUZQ 3PO2H 1E1TA 1NTGA 1TWAH 5BR8L 1IBMQ 2K50A 4LW1A 1YHBA 4K0KL 4WJ4A 5ELNA 4A76A 3UDXA 5M3FH 4A3CG 1K9MC 1J5EL 4AH6A 2JA9A 3CMAA 3KDFB 4GKJL 2ZTCA 1EUJA 2GN5A 4YWMA 3AQQA 4GOPC 2K4KA 4AYBE 2NZOA 4NB3A 2NN6G 4DV1L 3J81c 2JA7G 1EOVA 3HOWG 1EWIA 1EYGA 2R93H 4L5SA 2PQAA 2HHHQ 2VUMG 1VQBA 1OXVA 3TQYA 1XTDA 1K8GA 2KHJA 4GN4B 2JEAI 1VQJA 1Y1WH 1AE2A 3M4PA 3CC2A 1O7IA 4DR5Q 3PCOB 4R4QA 1QZGA 4B3TL 3GTMH 3K7UC 1X6OA 4JI3Q 2CKZB 3HOVG 2B3GA 3OTOL 4X65L 3AFQA 2QA4A 4XTCS 2E8GA 4A3FH 1FL0A 1VQFA 3RLOA 5IYBG 4OWXB 4A3IG 5FLMH 3HOZG 4JI7Q 4JI1L 4BY1H 1N33Q 4A3LH 4HIMA 3M7NA 2F3IA 3M9BA 4LF9Q 1YJWA 1YJNA 1Q1BA 3TEHB 4AYBG 2RF4A 4DV3Q 4JI0L 1SN8A 2OQ0A 3JAMc 3CCMA 4DAMA 1K3RA 4HJ5A 1I94L 4J15A 4JBKA 1PA6A 4DR5L 3KF6A 4DR1L 4JG2A 4BY7H 3ER0A 3IRBA 4LUZA 4DR2Q 2NVYH 1N36L 4UPAA 1X56A 4XIGS 4LF7L 1IBML 2VZAA 4AQYL 3KF8B 5GAEC 1IBLL 4IFDI 2HQLA 1PHJA 4BXXG 4TQUS 1MJCA 3JC66 4KHZA 2KBNA 2VNUD 1N9WA 5IYDG 3STBC 1E22A 1C9OA 3AEVA 2AWNA 4PZ7A 2UUBL 2GVBA 1VQ8A 4KHPL 3I4NG 5GADC 1PH3A 2UUAQ 3GD7A 2VW9A 3HFZB 4DV6L 3PUVA 3CD6A 4UP8A 4R4CA 5J3BA 3NEMA 4DV4L 1D8LA 2WP8J 1OXTA 1HR0L 1MIUA 1TWFH 5HY6A 3GTLH 1X9NA 1VQLA 3KOJA 1N36Q 1QVCA 1M90C 1G6PA 2D0PA 5LMNL 1GO3E 4NPSA 3PUZA 1KAWA 4AQYQ 1Y1WG 3J80i 3W1BA 4JI8L 4DR6Q 5HGQA 3PF4A 4YWLA 2NVTH 2JA5H 4B3TQ 1NBWA 2MO1A 3GTJH 4A3MH 2CWAA 4OO1G 4DV2Q 3OTOQ 1SMXA 1NY4A 2NN6I 4JI7L 2CQOA 2JA7H 3GTQH 4KLKA 5JEAJ 3AFPA 2EIFA 3RLFA 3J81i 2UUAL 2A1AA 2YU9H 1UE5A 4OX9Q 4Y52H 3EBEA 2BH2A 2ES2A 4YWKA 1L2FA 2UUCL 2ZJQA 1N33L 1VQGA 5H1SE 2YYZA 3CAMA 3K0XA 4BBRH 4JI0Q 5ELOA 2IY5B 4QGUA 5IWAQ 1IZ6A 1Q86C 1HZBA 1BVSA 2DGYA 3S14H 5E7NA 2DUDA 4GNXB 3GDEA 4LFBQ 3PUYA 4IFDJ 2VQFQ 1X55A 3J7A5 1PYSB 2D0OA 2I5LX 4BBRG 1Y14B 4PMWA 5C3EH 4A3LG 3FKIH 4YCWA 4LF8Q 3E9HA 4LNQA 2R7ZH 5AJ3Q 5FLMG 3I4OA 4DV0Q 2ZTEA 4LF7Q 1X3EA 1HZAA 2B63H 2PI2E 4JBWA 4DPGA 1VS0A 4Y7NH 1T9HA 3CMEA 1QVFA 4LUVA 2N3SA 4IOAA 4JBMA 2R92H 4A93G 2AMCB 4A3EG 2XTIA 5IYCG 2F4VL 4BA2I 1JT8A 4H02A 3MEFA 4A3GH 3BZKA 5GQOA 4DAYB 4YHHL 1FVIA 1SE8A 2PI2A 1XNRQ 4DV4Q 1LYLA 4POFA 4B3MQ 3CCEA 4UY8C 2Q2HA 3WWVA 2VQEQ 2JA6G 1UE1A 1YZ6A 2HIXA 3ZJYC 2VL6A 3I2ZA 3PIPA 1KXLA 1VQNA 5C3EG 3KF6B 2E2IH 5GROA 3CCLA 5C44H 3H3VH 3CQZH 1XMQQ 4JI4Q 3S1MH 2VS1A 5IYDH 1CSQA 3HKZE 1VQ4A 4LFAL 1NMGA 1N34L 3NBHB 1KRTA 3G71A 2UU9L 1XNQL 1PH4A 1HZCA 4A3BG 4R4IA 4BXXH 1H95A 2A19A 2VY3A 4MNOA 3HOYG 2XGTA 2R92G 4DR7L 1WCMH 5M5XH 3CCRA 1HNZQ 4GNXA 3F2BA 1XMOL 1PVOA 2AWOA 2KENA 3S2HH 3RN5A 1JB7A 3G4SA 3NELA 4GLXA 1JJGA 3ULLA 1WCMG 2WB1E 4MZ9A 1N8RC 1I6HH 3I55A 4IPCA 3W1GA 5GAGC 4OO1I 2UXDL 4DKAC 3HOYH 2JA5G 4IO9A 4OWTB 3S16H 3S1QH 3D0FA 1NJIC 1DGSA 1E1OA 1N32L 3CCSA 1EIFA 4BY1G 3I7FA 4LFAQ 1HR0W 5AJ3L 1CKNB 2OTJA 2JQOA 4P72A 4X65Q 3LGJA 1PH1A 4DR7Q 1IBKL 4JV5L 3GTGH 3ERSX 5IY0A 4DV6Q 5DLQE 2JA8H 3GTPH 2Y0SG 3M3YH 2HIVA 3PV0A 4UP9A 3UDFA 4HJ9A 4O2DA 3CPWA 4GKKQ 4A75A 4B3ML 4A3GG 1AH9A 4GS3A 4DK3C 1MKHA 3CC7A 1A8VA 1PH7A 4YCVA 4L5TA 4P73A 3J80c 2EQSA 1OXXK 1E7ZA 1Z47A 3L0OA 5IP9G 4B3RL 2VQEL 5JJIA 4OWWB 3OYYA 1S72A 4POGA 3FP9A 1I5FA 2QGQA 3FHWA 3NENA 5LMUQ 1IBLQ 4B3SL 1Y1VG 3J81j 4X62Q 4GKJQ 3KYHC 2R7ZG 5FJ8G 1AE3A 2MQHA 3RZDH 3F2CA 3GTOH 4NXNL 5GAHC 2WAQG 3BJUA 2E5LL 3H3VI 4GKKL 2JK8A 2B29A 2N8NA 1YJ9A 2JJQA 1OXUA 4IPDA 1KIXA 4JI6L 1UE7A 4JBJA 4UP7A 1HNZL 2NVQH 2NZHA 3S17H 1Y1VH 5JJLA 3RZOH 1HR0Q 1BBUA 1G291 4B3RQ 3EN2A 4JI8Q 3U4ZA 4DR6L 4KI0A 1CKMA 4JI3L 1PFSA 5K36G 4IFDG 1YVCA 2L15A 1HNXL 2RHSB 3E0EA 4GN3B 4RMFA 3PIOA 1UEBA 4BBSH 4DR4Q 1A63A 4X62L 2K5HA 4IPGA 3A74A 1KQSA 1KRSA 4DR3Q 5M3MG 1J5EQ 1CSPA 4X66L 1MJEA 3M4QA 3CCVA 2Q2UA 1XJVA 3Q8DA 2R93G 1SR3A 4JI2L 5C44G 3ULPA 4DV5L 1HNWQ 4DV1Q 1NE3A 3S24A 1K73C 2IHEA 1QUQA 4JOIA 1VQEA 3F8TA 3STBD 2IHFA 1E24A 4A3FG 4GOPA 5M3FG 2ZM6Q 4R4TA 2ZJRA 4A3CH 1Q7YC 1HH2P 3BU2A 4APVA 3TS2A 2PMZE 4EX5A 5M5YH 4A3KH 2AKWB 4NXML 2LXKA 4OONA 1Q12A 3PUXA 4TVAB 3RNUA 3VDYA 2UXBL 2CWPA 5JEAG 1L1OB 1RL2A 1J6QA 1NMFA 2CFMA 3I56A 1WFQA 5IT9c 1TWHH 2IT1A 2UU9Q 4JI2Q 3BZCA 4DV7Q 1M1KC 3GO5A 4KHPQ 2B63G 2YTVA 1XPOA 3UDIA 4X64L 1CKNA 4JCVE 1YHQA 4GOPB 4P71A 1W3SA 4HJAA 4BY7G 1FJGL 1X54A 2K14A 4JI5Q 2MFIA 1VQ5A 4LF6L 4LF4L 3KJPA 4IOCA 4DV3L 2BH8A 1CKOA 2HHHL 4IJHA 4YHHQ 2UXBQ 4WJ3M 2WB1G 4QIWE 5IP7H 4PZ8A 1VQIA 1D7QA 4C3HH 1RIPA 4QL5A 3HOUG 2ZJPA 4C2MH 2A8VA 1GD7A 3HOZH 3PO3H 4DV2L 5C4XG 1L1OC 1PH9A 5C4JH 2I0QA 2JA6H 2V1CC 4GN5A 4DNIA 1X3GA 2UXCQ 1IBKQ 1YHAA 4JYAQ 1L1OA 2UUBQ 2HT1A 1TWCH 5IE8A 3HOVH 2F52A 1EFWA 3B6YA 4QY7A 2UUCQ 3DM3A 4ALPA 2H5XA 1Q82C 4ME3A 3T1HQ 4MTNA 4A3EH 1VQOA 4LFCQ 1GM5A 2ID0A 2VUMH 2R7DA 4GLVB 2VQFL 1WOCA 2UXDQ 4A4IA 1LTLA 1VQHA 4NXMQ 2KCTA 1S3OA 3RN2A 1JJ2A 1JJCB 1V1QA 1WI5A 1SFOH 1N32Q 4DV0L 1I3QH 5BR8Q 1YIJA 2R7FA 1QVGA 4DR2L 3I4NH 3CW2C 1UWVA 3PSIA 1PH6A 3PUWA 1XPUA 1HJPA 3H0GH 3KLWA 1OXSC 4OX9L 3PO2G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM i;  3K7A H;  2K52 A;  1LM0 A;  1YI2 A;  1JE5 A;  3HKZ G;  1FJG Q;  1G51 A;  3CP0 A;  2F4V Q;  1X65 A;  3M4O H;  4JV5 Q;  2CCZ A;  3RLN A;  2IX0 A;  4X64 Q;  1SRO A;  2C35 B;  3UE0 A;  1ASY A;  1WJJ A;  4LF4 Q;  4LF5 L;  4YY3 Q;  1Q1E A;  5M3M H;  3I4M H;  2MO0 A;  4BBS G;  2WFW A;  4YCU A;  1SRU A;  3UE1 A;  4A3M G;  1VQM A;  4A3J G;  4LWC A;  3S1N H;  2BA0 A;  3EIV A;  4LUO A;  3CCQ A;  2K5V A;  4GNX C;  3PF5 A;  2I5M X;  3CCJ A;  1PH8 A;  2JE6 I;  1EIY B;  3S2D H;  3S15 H;  2R6G A;  3SGI A;  3A0J A;  4L5Q A;  4HIK A;  5IYB H;  1HZ9 A;  1KC8 C;  2OWO A;  5JJK A;  2LXJ A;  1HNW L;  2E5L Q;  4NXN Q;  2UXC L;  2ALY B;  2OCE A;  4K0K Q;  1I50 H;  1Q46 A;  3U4V A;  1V43 A;  1CUK A;  1C7Y A;  1P16 A;  1Q81 C;  4LFC L;  3J7Z C;  2BA1 A;  4JI1 Q;  4JC0 A;  4HID A;  4A3K G;  1PH2 A;  3UDG A;  4IJL A;  3CXC A;  3T1H L;  1U0L A;  2Y0S E;  3KDF A;  4HIO A;  4JI6 Q;  4P74 A;  1KHI A;  4LF5 Q;  1VQC A;  1A62 A;  3CPF A;  4L5R C;  1XNR L;  3MXN B;  4X6A H;  1HNX Q;  5IP9 H;  1YNX A;  1TWG H;  2Z0S A;  3L7Z C;  3T1Y Q;  2OTL A;  1P8L A;  1VQD A;  2ZTD A;  4DR3 L;  4A3D H;  1X3F A;  4R4O A;  5FLX c;  4A3J H;  3OW2 A;  3W5O A;  4LF8 L;  1PV4 A;  1N34 Q;  1LUZ A;  3RR5 A;  2K75 A;  5C0X J;  3F2D A;  4QJF A;  3E9I A;  2E2H H;  1B70 B;  1QUQ B;  1YBY A;  1VQK A;  1EQQ A;  4AIM A;  1VQP A;  1W2B A;  3HOX G;  2YV5 A;  1XNQ Q;  3H15 A;  1OTC A;  2Q2T A;  3KJO A;  4LF6 Q;  2PNH A;  2ZM6 L;  4PZ6 A;  2RCN A;  1GVP A;  3CCU A;  1GKH A;  1BKB A;  2WAQ E;  4A3I H;  5LMN Q;  5C0X G;  3GTK H;  3A5U A;  1IL2 A;  1R9T H;  1ASZ A;  2AHO B;  3A5Z B;  3G48 A;  1U5K A;  4IPH A;  5LMN W;  4DUY L;  1KD1 C;  3HOX H;  4FDB A;  3S1R H;  1UE6 A;  3PGZ A;  3K81 C;  5FJ8 H;  1VCI A;  2I5H A;  1B7Y B;  4JYA L;  1V9P A;  2YTY A;  1Q8K A;  3K8A A;  2JEB I;  4BA1 I;  1JMC A;  2LSS A;  3I4M G;  1L0W A;  4C3I H;  5M5W H;  4A3D G;  1XMQ L;  1VQ7 A;  4EQ5 A;  1SLJ A;  5EAY A;  4JI4 L;  3AYH B;  3HOW H;  2KHI A;  4QQB X;  2Q2I A;  4DV7 L;  3KFU A;  3TRZ A;  1IYJ B;  4JI5 L;  3TRE A;  2GVA A;  3ULJ A;  1Z9F A;  1FGU A;  3F1Z A;  3H0G G;  3U58 A;  1YIT A;  4O0A A;  2RHQ B;  4LFB L;  2KCM A;  5C0X I;  1XMO Q;  1VQ9 A;  2FXQ A;  4OXP A;  1S40 A;  1K8A C;  5IWA L;  1PH5 A;  3T1Y L;  2NVX H;  3CC4 A;  3ICE A;  4JOI C;  1XPR A;  2JA8 G;  1VQA A;  1EQR A;  4GLA C;  4RG1 A;  2K5N A;  2PQA B;  3DLL A;  4PG3 A;  4C3J H;  5LMU L;  4HJ7 A;  4B3S Q;  1IXR A;  3D31 A;  1BBW A;  2MNA A;  4X66 Q;  3HKS A;  4DUZ L;  1VQ6 A;  2EXD A;  4P75 A;  2ASB A;  4DV5 Q;  3U50 C;  2N49 A;  2D62 A;  5IYC H;  2ATW A;  4HJ8 A;  3M85 A;  1B8A A;  2QEX A;  4A93 H;  2YTX A;  5C4X H;  3CF5 A;  2Z6K C;  4YY3 L;  3G6E A;  3L2P A;  1A0I A;  2IX1 A;  2Z6K A;  1YEZ A;  1K83 H;  4LF9 L;  2E2J H;  1TXY A;  2N78 A;  1WYD A;  1C0A A;  3PO3 G;  3FKI G;  4DK6 C;  3K80 C;  1E3P A;  1I94 Q;  3HOU H;  1K0R A;  2OQK A;  3TS0 A;  1PYB A;  1KL9 A;  4DR4 L;  5IP7 G;  4DR1 Q;  1QZH A;  4A3B H;  4R1J A;  4DUY Q;  4DUZ Q;  3PO2 H;  1E1T A;  1NTG A;  1TWA H;  5BR8 L;  1IBM Q;  2K50 A;  4LW1 A;  1YHB A;  4K0K L;  4WJ4 A;  5ELN A;  4A76 A;  3UDX A;  5M3F H;  4A3C G;  1K9M C;  1J5E L;  4AH6 A;  2JA9 A;  3CMA A;  3KDF B;  4GKJ L;  2ZTC A;  1EUJ A;  2GN5 A;  4YWM A;  3AQQ A;  4GOP C;  2K4K A;  4AYB E;  2NZO A;  4NB3 A;  2NN6 G;  4DV1 L;  3J81 c;  2JA7 G;  1EOV A;  3HOW G;  1EWI A;  1EYG A;  2R93 H;  4L5S A;  2PQA A;  2HHH Q;  2VUM G;  1VQB A;  1OXV A;  3TQY A;  1XTD A;  1K8G A;  2KHJ A;  4GN4 B;  2JEA I;  1VQJ A;  1Y1W H;  1AE2 A;  3M4P A;  3CC2 A;  1O7I A;  4DR5 Q;  3PCO B;  4R4Q A;  1QZG A;  4B3T L;  3GTM H;  3K7U C;  1X6O A;  4JI3 Q;  2CKZ B;  3HOV G;  2B3G A;  3OTO L;  4X65 L;  3AFQ A;  2QA4 A;  4XTC S;  2E8G A;  4A3F H;  1FL0 A;  1VQF A;  3RLO A;  5IYB G;  4OWX B;  4A3I G;  5FLM H;  3HOZ G;  4JI7 Q;  4JI1 L;  4BY1 H;  1N33 Q;  4A3L H;  4HIM A;  3M7N A;  2F3I A;  3M9B A;  4LF9 Q;  1YJW A;  1YJN A;  1Q1B A;  3TEH B;  4AYB G;  2RF4 A;  4DV3 Q;  4JI0 L;  1SN8 A;  2OQ0 A;  3JAM c;  3CCM A;  4DAM A;  1K3R A;  4HJ5 A;  1I94 L;  4J15 A;  4JBK A;  1PA6 A;  4DR5 L;  3KF6 A;  4DR1 L;  4JG2 A;  4BY7 H;  3ER0 A;  3IRB A;  4LUZ A;  4DR2 Q;  2NVY H;  1N36 L;  4UPA A;  1X56 A;  4XIG S;  4LF7 L;  1IBM L;  2VZA A;  4AQY L;  3KF8 B;  5GAE C;  1IBL L;  4IFD I;  2HQL A;  1PHJ A;  4BXX G;  4TQU S;  1MJC A;  3JC6 6;  4KHZ A;  2KBN A;  2VNU D;  1N9W A;  5IYD G;  3STB C;  1E22 A;  1C9O A;  3AEV A;  2AWN A;  4PZ7 A;  2UUB L;  2GVB A;  1VQ8 A;  4KHP L;  3I4N G;  5GAD C;  1PH3 A;  2UUA Q;  3GD7 A;  2VW9 A;  3HFZ B;  4DV6 L;  3PUV A;  3CD6 A;  4UP8 A;  4R4C A;  5J3B A;  3NEM A;  4DV4 L;  1D8L A;  2WP8 J;  1OXT A;  1HR0 L;  1MIU A;  1TWF H;  5HY6 A;  3GTL H;  1X9N A;  1VQL A;  3KOJ A;  1N36 Q;  1QVC A;  1M90 C;  1G6P A;  2D0P A;  5LMN L;  1GO3 E;  4NPS A;  3PUZ A;  1KAW A;  4AQY Q;  1Y1W G;  3J80 i;  3W1B A;  4JI8 L;  4DR6 Q;  5HGQ A;  3PF4 A;  4YWL A;  2NVT H;  2JA5 H;  4B3T Q;  1NBW A;  2MO1 A;  3GTJ H;  4A3M H;  2CWA A;  4OO1 G;  4DV2 Q;  3OTO Q;  1SMX A;  1NY4 A;  2NN6 I;  4JI7 L;  2CQO A;  2JA7 H;  3GTQ H;  4KLK A;  5JEA J;  3AFP A;  2EIF A;  3RLF A;  3J81 i;  2UUA L;  2A1A A;  2YU9 H;  1UE5 A;  4OX9 Q;  4Y52 H;  3EBE A;  2BH2 A;  2ES2 A;  4YWK A;  1L2F A;  2UUC L;  2ZJQ A;  1N33 L;  1VQG A;  5H1S E;  2YYZ A;  3CAM A;  3K0X A;  4BBR H;  4JI0 Q;  5ELO A;  2IY5 B;  4QGU A;  5IWA Q;  1IZ6 A;  1Q86 C;  1HZB A;  1BVS A;  2DGY A;  3S14 H;  5E7N A;  2DUD A;  4GNX B;  3GDE A;  4LFB Q;  3PUY A;  4IFD J;  2VQF Q;  1X55 A;  3J7A 5;  1PYS B;  2D0O A;  2I5L X;  4BBR G;  1Y14 B;  4PMW A;  5C3E H;  4A3L G;  3FKI H;  4YCW A;  4LF8 Q;  3E9H A;  4LNQ A;  2R7Z H;  5AJ3 Q;  5FLM G;  3I4O A;  4DV0 Q;  2ZTE A;  4LF7 Q;  1X3E A;  1HZA A;  2B63 H;  2PI2 E;  4JBW A;  4DPG A;  1VS0 A;  4Y7N H;  1T9H A;  3CME A;  1QVF A;  4LUV A;  2N3S A;  4IOA A;  4JBM A;  2R92 H;  4A93 G;  2AMC B;  4A3E G;  2XTI A;  5IYC G;  2F4V L;  4BA2 I;  1JT8 A;  4H02 A;  3MEF A;  4A3G H;  3BZK A;  5GQO A;  4DAY B;  4YHH L;  1FVI A;  1SE8 A;  2PI2 A;  1XNR Q;  4DV4 Q;  1LYL A;  4POF A;  4B3M Q;  3CCE A;  4UY8 C;  2Q2H A;  3WWV A;  2VQE Q;  2JA6 G;  1UE1 A;  1YZ6 A;  2HIX A;  3ZJY C;  2VL6 A;  3I2Z A;  3PIP A;  1KXL A;  1VQN A;  5C3E G;  3KF6 B;  2E2I H;  5GRO A;  3CCL A;  5C44 H;  3H3V H;  3CQZ H;  1XMQ Q;  4JI4 Q;  3S1M H;  2VS1 A;  5IYD H;  1CSQ A;  3HKZ E;  1VQ4 A;  4LFA L;  1NMG A;  1N34 L;  3NBH B;  1KRT A;  3G71 A;  2UU9 L;  1XNQ L;  1PH4 A;  1HZC A;  4A3B G;  4R4I A;  4BXX H;  1H95 A;  2A19 A;  2VY3 A;  4MNO A;  3HOY G;  2XGT A;  2R92 G;  4DR7 L;  1WCM H;  5M5X H;  3CCR A;  1HNZ Q;  4GNX A;  3F2B A;  1XMO L;  1PVO A;  2AWO A;  2KEN A;  3S2H H;  3RN5 A;  1JB7 A;  3G4S A;  3NEL A;  4GLX A;  1JJG A;  3ULL A;  1WCM G;  2WB1 E;  4MZ9 A;  1N8R C;  1I6H H;  3I55 A;  4IPC A;  3W1G A;  5GAG C;  4OO1 I;  2UXD L;  4DKA C;  3HOY H;  2JA5 G;  4IO9 A;  4OWT B;  3S16 H;  3S1Q H;  3D0F A;  1NJI C;  1DGS A;  1E1O A;  1N32 L;  3CCS A;  1EIF A;  4BY1 G;  3I7F A;  4LFA Q;  1HR0 W;  5AJ3 L;  1CKN B;  2OTJ A;  2JQO A;  4P72 A;  4X65 Q;  3LGJ A;  1PH1 A;  4DR7 Q;  1IBK L;  4JV5 L;  3GTG H;  3ERS X;  5IY0 A;  4DV6 Q;  5DLQ E;  2JA8 H;  3GTP H;  2Y0S G;  3M3Y H;  2HIV A;  3PV0 A;  4UP9 A;  3UDF A;  4HJ9 A;  4O2D A;  3CPW A;  4GKK Q;  4A75 A;  4B3M L;  4A3G G;  1AH9 A;  4GS3 A;  4DK3 C;  1MKH A;  3CC7 A;  1A8V A;  1PH7 A;  4YCV A;  4L5T A;  4P73 A;  3J80 c;  2EQS A;  1OXX K;  1E7Z A;  1Z47 A;  3L0O A;  5IP9 G;  4B3R L;  2VQE L;  5JJI A;  4OWW B;  3OYY A;  1S72 A;  4POG A;  3FP9 A;  1I5F A;  2QGQ A;  3FHW A;  3NEN A;  5LMU Q;  1IBL Q;  4B3S L;  1Y1V G;  3J81 j;  4X62 Q;  4GKJ Q;  3KYH C;  2R7Z G;  5FJ8 G;  1AE3 A;  2MQH A;  3RZD H;  3F2C A;  3GTO H;  4NXN L;  5GAH C;  2WAQ G;  3BJU A;  2E5L L;  3H3V I;  4GKK L;  2JK8 A;  2B29 A;  2N8N A;  1YJ9 A;  2JJQ A;  1OXU A;  4IPD A;  1KIX A;  4JI6 L;  1UE7 A;  4JBJ A;  4UP7 A;  1HNZ L;  2NVQ H;  2NZH A;  3S17 H;  1Y1V H;  5JJL A;  3RZO H;  1HR0 Q;  1BBU A;  1G29 1;  4B3R Q;  3EN2 A;  4JI8 Q;  3U4Z A;  4DR6 L;  4KI0 A;  1CKM A;  4JI3 L;  1PFS A;  5K36 G;  4IFD G;  1YVC A;  2L15 A;  1HNX L;  2RHS B;  3E0E A;  4GN3 B;  4RMF A;  3PIO A;  1UEB A;  4BBS H;  4DR4 Q;  1A63 A;  4X62 L;  2K5H A;  4IPG A;  3A74 A;  1KQS A;  1KRS A;  4DR3 Q;  5M3M G;  1J5E Q;  1CSP A;  4X66 L;  1MJE A;  3M4Q A;  3CCV A;  2Q2U A;  1XJV A;  3Q8D A;  2R93 G;  1SR3 A;  4JI2 L;  5C44 G;  3ULP A;  4DV5 L;  1HNW Q;  4DV1 Q;  1NE3 A;  3S24 A;  1K73 C;  2IHE A;  1QUQ A;  4JOI A;  1VQE A;  3F8T A;  3STB D;  2IHF A;  1E24 A;  4A3F G;  4GOP A;  5M3F G;  2ZM6 Q;  4R4T A;  2ZJR A;  4A3C H;  1Q7Y C;  1HH2 P;  3BU2 A;  4APV A;  3TS2 A;  2PMZ E;  4EX5 A;  5M5Y H;  4A3K H;  2AKW B;  4NXM L;  2LXK A;  4OON A;  1Q12 A;  3PUX A;  4TVA B;  3RNU A;  3VDY A;  2UXB L;  2CWP A;  5JEA G;  1L1O B;  1RL2 A;  1J6Q A;  1NMF A;  2CFM A;  3I56 A;  1WFQ A;  5IT9 c;  1TWH H;  2IT1 A;  2UU9 Q;  4JI2 Q;  3BZC A;  4DV7 Q;  1M1K C;  3GO5 A;  4KHP Q;  2B63 G;  2YTV A;  1XPO A;  3UDI A;  4X64 L;  1CKN A;  4JCV E;  1YHQ A;  4GOP B;  4P71 A;  1W3S A;  4HJA A;  4BY7 G;  1FJG L;  1X54 A;  2K14 A;  4JI5 Q;  2MFI A;  1VQ5 A;  4LF6 L;  4LF4 L;  3KJP A;  4IOC A;  4DV3 L;  2BH8 A;  1CKO A;  2HHH L;  4IJH A;  4YHH Q;  2UXB Q;  4WJ3 M;  2WB1 G;  4QIW E;  5IP7 H;  4PZ8 A;  1VQI A;  1D7Q A;  4C3H H;  1RIP A;  4QL5 A;  3HOU G;  2ZJP A;  4C2M H;  2A8V A;  1GD7 A;  3HOZ H;  3PO3 H;  4DV2 L;  5C4X G;  1L1O C;  1PH9 A;  5C4J H;  2I0Q A;  2JA6 H;  2V1C C;  4GN5 A;  4DNI A;  1X3G A;  2UXC Q;  1IBK Q;  1YHA A;  4JYA Q;  1L1O A;  2UUB Q;  2HT1 A;  1TWC H;  5IE8 A;  3HOV H;  2F52 A;  1EFW A;  3B6Y A;  4QY7 A;  2UUC Q;  3DM3 A;  4ALP A;  2H5X A;  1Q82 C;  4ME3 A;  3T1H Q;  4MTN A;  4A3E H;  1VQO A;  4LFC Q;  1GM5 A;  2ID0 A;  2VUM H;  2R7D A;  4GLV B;  2VQF L;  1WOC A;  2UXD Q;  4A4I A;  1LTL A;  1VQH A;  4NXM Q;  2KCT A;  1S3O A;  3RN2 A;  1JJ2 A;  1JJC B;  1V1Q A;  1WI5 A;  1SFO H;  1N32 Q;  4DV0 L;  1I3Q H;  5BR8 Q;  1YIJ A;  2R7F A;  1QVG A;  4DR2 L;  3I4N H;  3CW2 C;  1UWV A;  3PSI A;  1PH6 A;  3PUW A;  1XPU A;  1HJP A;  3H0G H;  3KLW A;  1OXS C;  4OX9 L;  3PO2 G; 
#chains in the Genus database with same CATH topology
 3JAM i;  3A56 A;  5BN5 A;  1G51 A;  3CP0 A;  4K5X A;  3K57 A;  1YNN C;  3BDC A;  4X64 Q;  3PO3 B;  1SRO A;  1ASY A;  5TSS A;  4YY3 Q;  3LWE A;  4K8J A;  3S1N H;  4RKB A;  1I4H A;  2BA0 A;  5C4X G;  2MPM A;  3EVQ A;  2JE6 I;  1DOL A;  3SGI A;  3A8J E;  4L5Q A;  4EQP A;  2OWO A;  1QNU A;  5IYB H;  1KC8 C;  4G7Z C;  3GTQ B;  1HNW L;  2E5L Q;  5ELF A;  2UXC L;  4FF2 A;  2OCE A;  3PIO 3;  3K6O A;  1C7Y A;  1KTK A;  4LFC L;  2TMP A;  3LWU A;  3CXC A;  1ET9 A;  5KYI A;  5KEE A;  1VQC A;  1H9J A;  1B4O A;  1YNX A;  3T1Y Q;  2F0S A;  3L7Z C;  3GTP B;  5KYL A;  4KD4 A;  5E4X A;  1X3F A;  4C3I G;  4R8N A;  3OW2 A;  1EL0 A;  1LUZ A;  4ABN A;  2Q8T A;  1QG7 A;  4RHS A;  2OF1 A;  1EQQ A;  4AIM A;  1VQK A;  4DAY A;  1XNQ Q;  3H15 A;  1QIL A;  2SDF A;  3MXP A;  5ISR A;  1OTC A;  4LF6 Q;  1EYA A;  2PNH A;  3MVV A;  5A2Q E;  1GVP A;  3CCU A;  1J9O A;  2R93 B;  5LMN Q;  3A5U A;  2NTT A;  3C1F A;  2I46 A;  5LMN W;  4DUY L;  2NYZ D;  1LO5 D;  2EE1 A;  1IKM A;  4DGZ A;  1TS5 A;  1B7Y B;  2TSS A;  4JYA L;  1SEB D;  4K5W A;  3K8A A;  5DEH A;  1I4X A;  4JI4 L;  1SLJ A;  2NB0 A;  3AYH B;  3BYT B;  3C2P A;  1EYC A;  3TRE A;  4JI5 L;  2O5J C;  3MA2 B;  2GVA A;  1FGU A;  3U58 A;  1YIT A;  4O0A A;  2RHQ B;  2KCM A;  2K5D A;  5HUR A;  2NVX H;  5IWA L;  4E6I A;  3T1Y L;  3MEH A;  1PH5 A;  3ICE A;  1VQA A;  3FEW X;  4RGO S;  4X3S A;  3D31 A;  1VQ6 A;  3SK5 A;  1AP0 A;  1I4P A;  5IYC H;  4K6L A;  3GTG B;  1LT3 D;  3M85 A;  1B8A A;  4A93 H;  2M2L A;  2YTX A;  4HAE A;  1F77 A;  3EFX D;  4RGN A;  1K83 H;  4LF9 L;  2N78 A;  2G5D A;  3FKI G;  4KKU A;  3K80 C;  1E3P A;  2EYF A;  3TS0 A;  1STA A;  1KL9 A;  2A6E D;  4R1J A;  4DXG A;  3H91 A;  1E1T A;  1E2W A;  5JOB A;  4A3M B;  3T53 B;  5IGC A;  2EY6 A;  2PPB C;  2BE5 D;  2A68 C;  4J1M A;  4RGT A;  4FF3 A;  5M3F H;  1K9M C;  3S1R B;  3SHL A;  5AFW A;  3HOX B;  2NTS A;  3AQQ A;  3QR8 A;  2NZO A;  4NB3 A;  4DV1 L;  2A69 D;  1GJX A;  1EOV A;  4ODG A;  3Q6S A;  4L5S A;  5LL6 X;  1CM9 A;  1VQB A;  1XX8 A;  3C3L A;  3GV6 A;  5M5Y B;  4GN4 B;  4F87 A;  2WAC A;  3GTO B;  2DY8 A;  1AE2 A;  3M4P A;  1Y1W H;  1HA6 A;  3G7L A;  2SEB D;  3K7U C;  1X6O A;  2JP1 A;  2B3G A;  3MHB A;  4PQX A;  1B1Z A;  2AUK A;  3QOL A;  2QA4 A;  2E8G A;  1F9P A;  1FL0 A;  1VQF A;  3RLO A;  3KF8 A;  1N33 Q;  4A3L H;  3W2D A;  3TDQ A;  4WFN 3;  4LF9 Q;  2R7Z B;  5IGF A;  3T51 B;  3NWS A;  3MAQ A;  2RF4 A;  1T5E A;  1FYC A;  1SN8 A;  3JAM c;  1K3R A;  3NK9 A;  4JBK A;  1PA6 A;  1Y8N B;  4DR5 L;  4BY7 H;  1V1P B;  4DR1 L;  3OMC A;  4UPA A;  2PW7 A;  2VZA A;  4IFD I;  3KF8 B;  3I4N B;  1PHJ A;  4TQU S;  4FXK C;  1B50 A;  5IYD G;  4DA2 A;  4O42 A;  3V2T A;  1E22 A;  4PZ7 A;  1EIG A;  1VQ8 A;  3I4N G;  2Z4I A;  4DN4 M;  4A3E B;  2XVS A;  4UP8 A;  5C5L A;  4DV4 L;  1HR0 L;  1JWM D;  3I4M B;  2MP1 A;  4XT1 B;  5CGK A;  3GTL H;  4ZAI A;  1TII D;  3KOJ A;  4AQY Q;  2EXZ A;  4MIU A;  2XIW A;  4ID6 A;  1RDP D;  2QCP X;  3GTJ H;  3HZX A;  4DV2 Q;  1SMX A;  2MUY A;  1NY4 A;  4JI7 L;  2NN6 H;  2JA7 H;  3GTQ H;  4KLK A;  2WKC A;  5DNF A;  5JEA J;  1TT2 A;  3I3C A;  3O13 A;  4G4K A;  2K1B A;  4OX9 Q;  3S16 B;  4Q5V A;  2XN9 C;  3J80 E;  1EEF D;  2YYZ A;  1ET6 A;  1GUG A;  2IY5 B;  1ZYR D;  5IWA Q;  1IZ6 A;  1Q86 C;  1HZB A;  1BVS A;  3T56 B;  2F0H A;  4BS9 A;  5LHY 1;  3NTK A;  3JAM E;  3PUY A;  4U67 3;  2L11 A;  4A3L G;  1F2Y A;  3MWY W;  2NWG A;  1TQO A;  2LS0 1;  5AJ3 Q;  4DV0 Q;  2ZTE A;  1X32 A;  2F0M A;  4JBW A;  4Y7N H;  4LUV A;  3BVG A;  2R92 H;  2I07 B;  4UHV A;  3S1Q B;  4C2M B;  3QWN A;  1K83 B;  1FNV A;  2HCI A;  4CDD C;  2K03 A;  4KY5 A;  1VMC A;  2J7Z A;  3ZJY C;  1EZ6 A;  1KXL A;  1VQN A;  2E2I H;  2D5D A;  5GRO A;  3H3V H;  4K2K A;  5COY A;  3S1M H;  1CSQ A;  3HKZ E;  1VQ4 A;  4LFA L;  1N34 L;  1XNQ L;  1H95 A;  1PH4 A;  2VY3 A;  3PO2 B;  3P1H A;  3K59 A;  3SXH A;  3JAM L;  1PVO A;  2AWO A;  2KEN A;  5CV8 A;  1BQQ T;  3NEL A;  1WCM G;  3MFG A;  2UXD L;  3W1G A;  1SYB A;  4DKA C;  2RA4 A;  1NJI C;  4ZRZ A;  2QDB A;  1EIF A;  4BY1 G;  1SJE D;  1HR0 W;  2LFN A;  2JQO A;  4P72 A;  1F9Q A;  2L12 A;  1M8A A;  2CH4 W;  5D3I B;  3GTG H;  3ERS X;  4HR7 B;  1XYI A;  2Y0S G;  2HIV A;  3UDF A;  1JB3 A;  3FVQ A;  3NBH A;  1EYD A;  1AH9 A;  4GS3 A;  4DK3 C;  1MKH A;  3CC7 A;  3WOE A;  4HSP A;  4YCV A;  3X3M A;  1I50 B;  1OXX K;  1E7Z A;  2QF7 A;  3L0O A;  3OYY A;  1I5F A;  2QGQ A;  3FHW A;  4B3S L;  3NBI A;  3OIQ A;  3J81 j;  4GKJ Q;  2R7Z G;  1QJO A;  3E6Z X;  2E76 C;  3RZD H;  1Y1W B;  3OMG A;  4KK7 A;  2WAQ G;  4GKK L;  2KCC A;  2N8N A;  1OXU A;  1LTA D;  4UP7 A;  1SE4 A;  4H44 C;  4B3R Q;  1G29 1;  1CI3 M;  4JI3 L;  2BDO A;  4IFD G;  1YVC A;  4H0L C;  4M8A A;  1EIH A;  3ONA B;  5LL6 S;  2HCC A;  3PIO A;  4BBS H;  4DR4 Q;  1UEB A;  5M3M G;  1RF2 D;  1MJE A;  1XJV A;  2R93 G;  1CQV A;  4JI2 L;  4DV5 L;  1HNW Q;  4DV1 Q;  1K73 C;  1K8O A;  1VQE A;  4H7B A;  1EOT A;  2ZJR A;  3U9S A;  5IIF A;  2X69 A;  3BU2 A;  4APV A;  2PMZ E;  2QIL A;  5JJZ A;  2UXB L;  2CWP A;  1PTO D;  1JC7 A;  3M4O B;  4OEL B;  1L1O B;  1RL2 A;  3I56 A;  1TWA B;  2CHB D;  1TWH H;  3TN2 A;  4DV7 Q;  3OPO A;  4KHP Q;  4OHJ A;  3UDI A;  4JCV E;  1Z7T A;  4HJA A;  4R9W A;  4BY7 G;  1IL8 A;  3U9O A;  1EY8 A;  1VQ5 A;  4LF6 L;  2JYO A;  4XYQ A;  1M4V A;  3KJP A;  4F88 A;  5CC4 A;  1CKO A;  4IJH A;  4YHH Q;  4QIW E;  5IP7 H;  1EY6 A;  1CA6 A;  3HOU G;  1DCZ A;  1PTO F;  2ZXO A;  1GHJ A;  2F03 A;  1PH9 A;  3KBX A;  2JA6 H;  4DNI A;  4GN5 A;  5E4W C;  4JYA Q;  2HT1 A;  2NZ1 D;  2RSN A;  4QY7 A;  2UUC Q;  3DM3 A;  3A8K E;  4ALP A;  3LNN A;  4MTN A;  3TP8 A;  2VB3 X;  3EJI A;  4GLV B;  2UXD Q;  4KY6 A;  1S3O A;  2IW3 A;  1JJ2 A;  1F9R A;  1RCV D;  3D6C A;  1WTX A;  2N55 A;  2NBF A;  1I3Q H;  1YIJ A;  2XWJ B;  1SYG A;  2RDH A;  4MN3 A;  1SE3 A;  1PH6 A;  5CYU A;  3PUW A;  2CW0 C;  3FMC A;  3T4A C;  3K7A H;  2K52 A;  4XQJ A;  1JE5 A;  1MBY A;  1E0B A;  2F4V Q;  1X65 A;  3M4O H;  4JV5 Q;  3RLN A;  3HOZ B;  3UE0 A;  1WJJ A;  4XYO A;  3NP8 A;  1KAB A;  1FNU A;  2M00 A;  2F0J A;  4BBS G;  4YCU A;  3UE1 A;  4A3M G;  5NUC A;  4BY1 B;  1DM0 B;  1NR2 A;  1LT5 D;  1PH8 A;  1JWS D;  2H4O A;  3EA6 A;  3TZU A;  5KND A;  2Q8I B;  5D65 A;  1LTB D;  1Q46 A;  3U4V A;  1P16 A;  1PRT C;  1Q81 C;  1G2S A;  2BA1 A;  3K5L A;  4HID A;  3MXN A;  2WKD A;  3UDG A;  3NTH A;  3T1H L;  1U0L A;  2Y0S E;  4IUU A;  4JI6 Q;  1DJR D;  1J8I A;  1B9M A;  2EYM A;  5IP9 H;  2OTL A;  3M3Y B;  1GUW A;  2ZTD A;  4A3D H;  4A3J H;  3W5O A;  1N34 Q;  4IAL A;  3RR5 A;  5C0X J;  3F2D A;  5KIX A;  4QJF A;  2B2V C;  3HOX G;  2Q2T A;  4EQO A;  5ELE A;  1GKH A;  2WAQ E;  4A3I H;  3G48 A;  3HOX H;  1R4Q B;  1JOR A;  3K81 C;  2I5H A;  3IFT A;  4RFB A;  4BA1 I;  2JEB I;  2KEC A;  2LSS A;  1L0W A;  4C3I H;  4RA8 A;  4A3D G;  1XMQ L;  3R8B A;  2PNR C;  2KHI A;  4BWG B;  3KFU A;  2EVB A;  3TRZ A;  1IYJ B;  2R61 A;  3N52 A;  3H0G G;  2N88 A;  1XXG A;  1XMO Q;  1HQM C;  1SBB B;  4ZK9 B;  1K8A C;  1S5B D;  1QB5 D;  1VDZ A;  2B2T C;  1EQR A;  4RG1 A;  5JPM C;  5CV9 A;  4EGV A;  4FNF A;  3DLL A;  4PG3 A;  3SEB A;  5LMU L;  1BBW A;  3HKS A;  4P2C B;  2ASB A;  3U50 C;  1JE4 A;  2N49 A;  4HJ8 A;  4I7Z C;  5CMD A;  1SE2 A;  2Z6K C;  3QB3 A;  4YY3 L;  3G6E A;  1GUT A;  3NSW A;  4N8X 1;  3L2P A;  4BBR B;  2IX1 A;  1TXY A;  1WYD A;  4L6T B;  1LT6 D;  2F0P A;  3D3R A;  1I94 Q;  3HOU H;  2OQK A;  2OXP A;  4C3H G;  4DR4 L;  5IP7 G;  1QZH A;  4DUZ Q;  2PW5 A;  1B44 D;  4Q0F A;  4LW1 A;  2Q8R E;  1YHB A;  2LKV A;  5FKA C;  4Y7N B;  2FIN B;  1LTT D;  1ZYR C;  2K28 A;  1HQR D;  1SNP A;  3HOW G;  1EYG A;  2VUM G;  2PQA A;  2F0F A;  3ND8 A;  2HHH Q;  3BS1 A;  3GTK B;  1XTD A;  3N6R A;  2EDG A;  2JEA I;  3OHX C;  1VQJ A;  5CV4 A;  4CJ2 C;  4DR5 Q;  1SNQ A;  1H9S B;  1QZG A;  2CKZ B;  5IGG A;  3OTO L;  1ESF A;  3FRP B;  4IUT A;  4DF7 A;  1A2U A;  4A3F H;  2IPK D;  2XSC A;  4A3I G;  1FD7 D;  2C9O A;  5I6W A;  4NMZ A;  1JIC A;  3M9B A;  2A68 D;  2E2D C;  1YJN A;  4A3I B;  4JI0 L;  3CCM A;  4DAM A;  5G3L F;  3DXJ C;  4J15 A;  3VA7 A;  4CDE C;  1TU2 B;  3ND9 A;  2K01 A;  4JG2 A;  3ER0 A;  4LUZ A;  3HP3 A;  2NVY H;  1N36 L;  5E3F A;  4AQY L;  5GAE C;  4BXX G;  3JC6 6;  4KHZ A;  4OO1 H;  2KBN A;  2L55 A;  1ILP A;  1N9W A;  1C9O A;  2AWN A;  2UUB L;  1GHK A;  2GVB A;  2EYH A;  4ZUJ A;  1PH3 A;  2UUA Q;  3CD6 A;  2AQ3 B;  1D2B A;  4R4C A;  3NEM A;  1NSN S;  1MIU A;  2Z4H A;  3OSO A;  2R3Z A;  5FOB B;  4PMC A;  4R8I A;  1VQL A;  3TME A;  1G6P A;  2D0P A;  3MXG A;  5LMN L;  4NPS A;  4QUF A;  3WOF A;  1Y1W G;  4G7H C;  3J81 E;  1A3T A;  3OWE B;  2JA5 H;  2NVT H;  2PMZ B;  4A3M H;  4KN4 C;  2CVR A;  1GOZ A;  1STG A;  4IUN A;  1JQY D;  3RLF A;  2F0G A;  3J81 i;  1JOQ A;  1UE5 A;  5FLX E;  1DZ1 A;  3EBE A;  2ES2 A;  4EQN A;  2UUC L;  2ZJQ A;  1N33 L;  1VQG A;  4JI0 Q;  3CAM A;  3K0X A;  4BBR H;  3GP7 A;  2B2V A;  1L0X B;  1XTC D;  3S14 H;  3GDE A;  4IFD J;  1KLG D;  2VQF Q;  1Y14 B;  2F3W A;  2PZU A;  3K5O A;  4YCW A;  1U9R A;  2QDL A;  4LF8 Q;  2R7Z H;  1RKN A;  1HZA A;  2PI2 E;  4LMQ D;  1T9H A;  3CME A;  4B9W A;  4IOA A;  2RVL A;  4A93 G;  4A3E G;  4KKT A;  2XTI A;  5IYC G;  1QNK A;  2B8G A;  4ZYS A;  5FLX L;  5I4D A;  3MEF A;  3SK8 A;  3BZK A;  5IOD A;  1FVI A;  1SE8 A;  1NR4 A;  2Q2H A;  2JA6 G;  1YZ6 A;  2HIX A;  3NQI A;  3MXU A;  1PDQ A;  3PIP A;  3I2Z A;  2A69 C;  4JW0 A;  1A6X A;  1SNM A;  5C44 H;  1SNO A;  2QW7 A;  3CKI B;  5CV7 A;  3G71 A;  2UU9 L;  1A3V A;  4R4I A;  3I4L A;  5EBD A;  4DR7 L;  3P7J A;  4IUR A;  2R92 G;  1WCM H;  5M5X H;  1EZ8 A;  2PCF B;  4CDF C;  3S2H H;  1SDF A;  5JVH 3;  1ENA A;  4QF4 A;  3ULL A;  4MZ9 A;  1NUC A;  4WJW A;  5GAG C;  2A6H C;  2HQE A;  2JA5 G;  4IO9 A;  4OGQ C;  4NP5 A;  2Y0S B;  5FO7 B;  4N9T A;  4JPB W;  5KNC A;  4LFA Q;  5IGB A;  5AJ3 L;  1CKN B;  2BE5 C;  1K8M A;  4KMU C;  2F0D A;  4CJ0 B;  4X65 Q;  1WD1 A;  1PH1 A;  2OTJ A;  2JA7 B;  1STH A;  2B39 A;  2RCF A;  4JV5 L;  3CRK C;  4DV6 Q;  3OIP A;  2F0O A;  3KK7 A;  2EOT A;  3CPW A;  1KDB A;  4A75 A;  4FF4 A;  4B3M L;  4CDC C;  1TWF B;  1I4Q A;  2RDF A;  5EBC A;  1O80 A;  4L5T A;  1QCB D;  3M7G A;  1SNC A;  1MGS A;  1U4P A;  5IP9 G;  4B3R L;  2VQE L;  5JJI A;  1I3Q B;  5ELC A;  5DM6 3;  2DJG C;  4OWW B;  3SE0 A;  3TZD A;  3Q23 A;  3KYH C;  3BDO A;  5FJ8 G;  3NQT A;  2E5L L;  3BJU A;  3H3V I;  2B29 A;  1KIX A;  2JJQ A;  4IPD A;  4ZKC B;  1UE7 A;  1HNZ L;  2M9V A;  2NZH A;  3DEO A;  3I73 A;  1CKM A;  1LTG D;  3KBG A;  1UEA B;  4GN3 B;  3VR3 A;  1A63 A;  3DM1 A;  4A3F B;  2Q2U A;  3Q8D A;  1SR3 A;  1UAP A;  1EEI D;  3Q24 A;  3F8T A;  3STB D;  1E24 A;  2F0I A;  2SNS A;  3I91 A;  2ZM6 Q;  5M3F G;  4GOP A;  4A3F G;  1EWH A;  1I4G A;  3TS2 A;  2GA4 B;  2F0E A;  1TS2 A;  1B2T A;  3J81 L;  2AQ1 B;  2D2C C;  2IT1 A;  1TS4 A;  1R4P B;  2IWH A;  3GO5 A;  2B63 G;  1V8Q A;  1YHQ A;  1YNN D;  4IN3 A;  3R2T A;  4JI5 Q;  2K14 A;  2MFI A;  3A7L A;  4OIK A;  2HHH L;  1I6H B;  3AB9 A;  4PZ8 A;  4KN7 C;  1VQI A;  4C3H H;  2ICE C;  4DAV A;  2ZJP A;  1GD7 A;  4KKS A;  2JA6 B;  1ESR A;  3RUZ A;  1L1O A;  3DMU A;  3MC0 B;  5C4Z A;  5IE8 A;  2F52 A;  1EFW A;  3HOV H;  1PFN A;  5FK9 C;  4OL7 A;  4TRD A;  3FKI B;  5J22 A;  1VQO A;  4A3E H;  1GM5 A;  4G7O C;  2FMM A;  2R7D A;  1WOC A;  4CKC A;  4NXM Q;  3RN2 A;  1WD0 A;  5K5P A;  5T1G A;  1V1Q A;  1WI5 A;  1SFO H;  1N32 Q;  4DV0 L;  1QVG A;  4DR2 L;  3AMU A;  1QOH A;  1UWV A;  4QCL A;  2EYJ A;  3HG9 A;  4HCS A;  1LT4 D;  1BCP B;  1KAA A;  1XPU A;  3H0G H;  1OXS C;  3WDN A;  1PFM A;  2CCZ A;  3H94 A;  2C35 B;  4LF4 Q;  5M3M H;  1YNJ C;  4EVO A;  2MO0 A;  1PZK D;  3SDZ A;  2L4N A;  4CBV A;  4O1N A;  1VQM A;  4A3J G;  2MGS A;  1F2Z A;  3EIV A;  3CCQ A;  2K5V A;  5T1I A;  4GNX C;  3PF5 A;  3HOU B;  3R3O A;  3S2D H;  2R6G A;  2F0K A;  3A0J A;  5JVG 3;  2K7V A;  2E74 C;  1HZ9 A;  4NXN Q;  1K0S A;  2ALY B;  1B3A A;  5D3D A;  1V43 A;  4G57 A;  3J7Z C;  4A3K G;  2NVT B;  1PH2 A;  1BO0 A;  4RAU C;  3VYR A;  3KDF A;  4P74 A;  1OO9 B;  4LF5 Q;  1A62 A;  2JXM B;  3CPF A;  4L5R C;  1XNR L;  4X6A H;  1HNX Q;  2Z0S A;  1P8L A;  1VQD A;  4DR3 L;  4X3T A;  5FLX c;  1RTO A;  4B9X A;  4QMG A;  4LF8 L;  2FJ2 A;  1PV4 A;  2E2H B;  3KLR A;  3H6M A;  2E2H H;  3E9I A;  4TSS A;  4FXD A;  1JR0 D;  1NNX A;  2B2W A;  3BG3 A;  1FNW A;  3ERO A;  5CV5 A;  5JAV A;  3KJO A;  3IKJ A;  2ZM6 L;  3A8I E;  1SYC A;  2PO4 A;  3URY A;  3S9W A;  3FDT A;  4K6D A;  1R9T H;  1ASZ A;  3A5Z B;  3K7A B;  1U4M A;  1U5K A;  4FDB A;  1UE6 A;  3PGZ A;  4KY7 A;  1VCI A;  1QE6 A;  1UNS A;  1V9P A;  2YTY A;  1Q8K A;  5C4J B;  4IZ8 A;  4NW2 A;  5M5W H;  1VQ7 A;  4EQ5 A;  1SYE A;  3HOW H;  2Q2I A;  4DV7 L;  5BN4 A;  1VF7 A;  4MHE A;  2VB2 X;  3ULJ A;  1Z9F A;  1HHV A;  1MHW C;  4IQZ A;  1G8Z D;  2F4I A;  1IW7 C;  1E2Z A;  1H9S A;  4K14 A;  4LFB L;  2KED A;  1VQ9 A;  3KUP A;  4QUC A;  4OXP A;  1S40 A;  1JCK B;  3CHB D;  4JOI C;  1XPR A;  2JA8 G;  1VF5 C;  2K5N A;  2PQA B;  1PTO C;  4C3J H;  5EKK A;  2MNA A;  4DUZ L;  1O78 A;  2DNE A;  5C4H A;  4P75 A;  2HUG A;  4DV5 Q;  3PQI A;  2ATW A;  3I8Z A;  2QEX A;  3H3V C;  5C4X H;  2RDG A;  3BVZ A;  3ITP A;  4IFD H;  1SYD A;  2IL8 A;  2RSO A;  4LAA A;  1H9R A;  2Z6K A;  1YEZ A;  1MI2 A;  2KVM A;  3PO3 G;  2Z9H A;  3OWF A;  3J7Y W;  1PYB A;  4DR1 Q;  4RKL A;  5HGT A;  1WCM B;  5M5X B;  1NTG A;  3VR5 A;  1TWA H;  5BR8 L;  2B63 B;  1W6J A;  1TWH B;  3IL8 A;  4K0K L;  4WJ4 A;  5ELN A;  4V19 0;  3UDX A;  5CV6 A;  1HFG A;  3NHH A;  3H09 A;  2ZTC A;  2GN5 A;  4YWM A;  3GQB A;  2NN6 G;  2JA7 G;  1EWI A;  1D1I A;  2R93 H;  4OIJ A;  2L0C A;  2B2Y C;  3TQY A;  5IOC A;  2ZT9 C;  4A3K B;  1K8G A;  2KHJ A;  1LV9 A;  3CC2 A;  1AN8 A;  4B3T L;  4R4Q A;  4X65 L;  4XTC S;  2K04 A;  2OT2 A;  4HTH A;  3P20 A;  4ILW A;  4OWX B;  3BZD B;  4DXF A;  5FLM H;  1AFP A;  4JI7 Q;  4BY1 H;  2KQ3 A;  3AU7 A;  4HIM A;  1KNE A;  3HGB A;  2DJF C;  2F3I A;  1KLU D;  1CQF A;  4UAI A;  1YJW A;  3W3A A;  3TEH B;  1ROD A;  1LAB A;  4ZLT F;  5I9O A;  2EZV A;  5D14 A;  1G2T A;  3IRB A;  4ZKB B;  4XIG S;  4LF7 L;  3V05 A;  3OW7 A;  4RCN A;  1IBL L;  2HQL A;  1HUM A;  2E75 C;  1LAC A;  4CGY B;  1MJC A;  2VNU D;  5KNB A;  4A3G B;  4RCO A;  1G6Z A;  4DFA A;  3D6W A;  3G6J B;  2B2Y A;  5GAD C;  3GD7 A;  2K5Q A;  3HFZ B;  4DV6 L;  3PUV A;  5J3B A;  5L37 A;  1RJT A;  2K05 A;  4F8M A;  2WP8 J;  1TWF H;  1PYW D;  1JWU D;  1N36 Q;  3QIA A;  5BN3 A;  1GO3 E;  2EJF C;  2SNM A;  3PUZ A;  1A3U A;  1STB A;  3MZ5 A;  1JOO A;  2JSO A;  3W1B A;  5HGQ A;  4YWL A;  2X6G A;  2O2L D;  1TY0 A;  1NBW A;  2CWA A;  3OTO Q;  2EIF A;  2UUA L;  5K36 H;  4Y52 H;  2BH2 A;  4YWK A;  2F0V A;  1DYQ A;  3SK6 A;  5A35 A;  4A3D B;  5ELO A;  1CZW A;  4QGU A;  4RHR A;  2DUD A;  3J7A 5;  2D0O A;  4BBR G;  3EQL C;  1BBX C;  4PMW A;  3K5M A;  2JA5 B;  3FKI H;  5FLM G;  3I4O A;  2CW0 D;  2B63 H;  3F2U A;  2CH4 A;  3S1M B;  4C56 C;  1QVF A;  5I2Y A;  1SAP A;  2N3S A;  3RZD B;  4YIJ A;  1O7L A;  2AMC B;  2CQA A;  1HTP A;  5EKL A;  2HDM A;  4BA2 I;  2EYO A;  4H02 A;  1Y69 U;  4A3G H;  3NPP A;  1ICF B;  5GQO A;  4DAY B;  1Q90 A;  1XNR Q;  4UY8 C;  3CCE A;  3WWV A;  2VQE Q;  1UE1 A;  2DY7 A;  4U68 A;  1EY5 A;  3A54 A;  3OOC A;  5C3E G;  3KF6 B;  3CCL A;  1XMQ Q;  3DEP A;  1F9S A;  4FVM A;  4L8J A;  1Y1V B;  4XQN A;  3NBH B;  4A3B G;  1HZC A;  1MSG A;  4BXX H;  1H9K A;  2A19 A;  3HOY G;  5C3E B;  1HFN A;  2KUM A;  4C3J B;  4CJ1 B;  1HNZ Q;  1XMO L;  3L9A X;  3RN5 A;  2X6L A;  1JB7 A;  3G4S A;  4GLX A;  1JJG A;  1I6H H;  4IPC A;  5EPJ A;  3HOY H;  4OWT B;  4ZQ3 A;  3T16 A;  3D0F A;  4RWS C;  4XDX A;  1DGS A;  2L1B A;  1PRT D;  3CCS A;  1I6V C;  5C0X H;  3I7F A;  2NUC A;  2JN4 A;  1F2L A;  4WOR A;  1BCP D;  3E5S A;  1AZQ A;  4KTA A;  4DR7 Q;  2ENB A;  1O7Y A;  5DLQ E;  3GTP H;  5DM7 3;  4UP9 A;  3E0J A;  4HJ9 A;  1HA5 A;  1LLR D;  2MHV A;  4O2D A;  4C1N I;  4A3G G;  4H13 C;  5A2Q L;  2B2T A;  3S14 B;  4JK1 C;  3J80 c;  2EQS A;  4V0B A;  4IUP A;  5IGE A;  2F0U A;  2G9H D;  2KHS A;  4HMI A;  4POG A;  3NEN A;  5LMU Q;  1ZXT A;  4X62 Q;  1V1O A;  2A5H A;  2EY2 A;  1AE3 A;  3K58 A;  2R92 B;  3CU7 A;  1KDC A;  3GTO H;  4DK0 A;  5GAH C;  1YJ9 A;  1CZG A;  1D1K A;  3VR4 A;  5JJL A;  1BBU A;  4DK1 A;  3M4Y A;  3U4Z A;  4KI0 A;  2A6H D;  2MJ8 A;  4LK1 C;  5G3L D;  2RHS B;  3E0E A;  4RMF A;  1U4L A;  3A55 A;  1UUP A;  2VXW A;  1KQS A;  2P5Z X;  4F7X A;  3PIP 3;  3M4Q A;  5C44 G;  3ULP A;  3HOY B;  1FR3 A;  3BVM A;  2IHF A;  5ELB A;  4A3C H;  4R4T A;  2LY7 A;  1Q7Y C;  1HH2 P;  4EX5 A;  2AKW B;  5F2D A;  4OON A;  4A93 B;  1ZEQ X;  5C3W A;  5JEA G;  1K28 A;  1J6Q A;  2CFM A;  3TP5 A;  1S5C D;  1WFQ A;  2NVQ B;  2RQX A;  1CK1 A;  2UU9 Q;  2EYP A;  1M1K C;  2YTV A;  1XPO A;  3ERQ A;  1STN A;  4X64 L;  4GOP B;  1PZI D;  1W3S A;  4P71 A;  1TKW B;  1FJG L;  1EU3 A;  1X54 A;  1A15 A;  1KNA A;  4IOC A;  1WTH A;  4DV3 L;  2BH8 A;  2J0T D;  3SVM A;  4KD3 A;  1RIP A;  4QL5 A;  5EPL A;  5C4X B;  2EJM A;  3HOZ H;  1V1P A;  1L1O C;  2ZXP A;  4DU9 A;  5M3M B;  5C4J H;  1HTL D;  2I0Q A;  1X3G A;  2UXC Q;  1IBK Q;  1BXT A;  2K6A A;  1TWC H;  5J1Z A;  4J6H A;  1ML0 D;  4PV1 C;  4X3U A;  2JA8 B;  2H5X A;  1ONL A;  4ULL A;  4ZUI A;  1DOK A;  4NKL A;  4ME3 A;  3IAY A;  2BCO A;  4UDU C;  1MD2 D;  2ID0 A;  1STY A;  2VQF L;  4PMB A;  1DXM A;  2WII B;  1LTL A;  1VQH A;  2KCT A;  1SMY C;  5JPN C;  1JJC B;  2BDN A;  5BR8 Q;  2R7F A;  5EKI A;  3QO2 A;  1IKL A;  2EJG C;  5FO8 B;  3KLW A;  1IHZ A;  4OX9 L;  3PO2 G;  1CTM A;  1LM0 A;  4DNT B;  1YI2 A;  1FJG Q;  3HKZ G;  2C5C A;  1FGB D;  2IX0 A;  2FFK B;  4QIW B;  1Q1E A;  4JVZ A;  3I4M H;  4FYD A;  2D9U A;  2Z8L A;  3VYT A;  3S17 B;  5I2X A;  5CR3 A;  2WFW A;  4XXE A;  1SRU A;  4LWC A;  3HRZ C;  4LUO A;  3J80 L;  4LF5 L;  2I5M X;  3CCJ A;  1EIY B;  3LX0 A;  5FO9 B;  3S15 H;  3KLS A;  5I9P A;  4HIK A;  1BCP C;  5JJK A;  2LXJ A;  4K0K Q;  1I50 H;  2NVY B;  1D5M C;  1CUK A;  1PFB A;  1WTP A;  2KOL A;  3BYY B;  4LJZ C;  4JI1 Q;  4JC0 A;  4IJL A;  1SYF A;  4HIO A;  1KHI A;  5C3X A;  2KCN A;  1CHP D;  3MXN B;  1TWG H;  1Y8P B;  1LTS D;  4IUV A;  4R4O A;  1SMY D;  3VA5 A;  1CHQ D;  2K75 A;  1B70 B;  1QUQ B;  1YBY A;  2A73 B;  1HUN A;  4ME5 A;  1VQP A;  1W2B A;  2AQ2 B;  1SFO B;  1SSO A;  2YV5 A;  2F0T A;  3DUZ A;  3S15 B;  4PZ6 A;  4CKE A;  3DHQ A;  4N8F A;  2RCN A;  1F2M A;  1BKB A;  4NDX A;  1SXT A;  4KJN A;  5C0X G;  3GTK H;  2XRS D;  1IL2 A;  2AHO B;  3C1E A;  3QJY A;  3R2I A;  4IPH A;  5C6A A;  1KD1 C;  3S1R H;  1EWC A;  1C8C A;  1S5E D;  5FJ8 H;  1S5D D;  2L9H A;  3CQZ B;  1JMC A;  3I4M G;  2DN8 A;  2KJX A;  4ZCK A;  3TSS A;  2F3V A;  5EAY A;  3R93 A;  4QQB X;  4A3B B;  2EY1 A;  3F1Z A;  1WTV A;  3SR1 A;  1G91 A;  2RKS A;  5C0X I;  5C5M A;  2OEO A;  4S3S A;  2FXQ A;  2B2U A;  4BY7 B;  3CC4 A;  1BF4 A;  1LTI D;  4M1U B;  4GLA C;  2XRQ D;  4HJ7 A;  1ENC A;  4B3S Q;  1IXR A;  2V4D A;  4X66 Q;  2EXD A;  1HPC A;  2D62 A;  1PLF A;  3I70 A;  2WIN B;  3X3N A;  2EYL A;  3CF5 A;  1Z6H A;  1A0I A;  2E2J H;  4HMJ A;  2E2J B;  1C0A A;  3C46 A;  4K5V A;  5COR A;  4PNY A;  4DK6 C;  1II3 A;  1D6E C;  3S1N B;  1K0R A;  3HKZ B;  5JEA H;  4A3B H;  4DUY Q;  3PO2 H;  1D5X C;  3GTJ B;  3S2H B;  1IBM Q;  1ENF A;  2K50 A;  4XQQ A;  5EQ0 A;  2PZW A;  2ZXR A;  1U4R A;  2BOS A;  4A76 A;  3BDL A;  4A3C G;  1J5E L;  1CA5 A;  4AH6 A;  2JA9 A;  3CMA A;  3KDF B;  4GKJ L;  1EUJ A;  1TY2 A;  4GOP C;  2K4K A;  4AYB E;  4HCE A;  3J81 c;  1IW7 D;  1OXV A;  5IT9 L;  1PZJ D;  4FP5 D;  2O5I C;  1GUO A;  2SOB A;  2IX3 A;  3J7A F;  2YU9 B;  3TP7 A;  3NE5 B;  1O7I A;  3PCO B;  1TS3 A;  3D4D A;  3GTM H;  3HOV G;  4JI3 Q;  1DON A;  1TVX A;  3AFQ A;  4FO2 A;  5IYB G;  1XWE A;  5J39 A;  1BCP F;  2PYK A;  1BOS A;  3HOZ G;  3VYS A;  4JI1 L;  5I6Y A;  1WTO A;  1X3P A;  3M7N A;  3FPP A;  1SND A;  4BBS B;  1Q1B A;  3I90 A;  4AYB G;  4HN7 A;  4DV3 Q;  1C48 A;  2OQ0 A;  3NXW A;  1I94 L;  4HJ5 A;  3GTL B;  5KRU A;  5M3F B;  3KF6 A;  4DR2 Q;  1ICW A;  1X56 A;  4K8I A;  1IBM L;  4KHV A;  1GXD C;  1W6K A;  2PZT A;  3UI2 A;  3STB C;  5CBE E;  3AEV A;  1WTW A;  3RMH A;  4KHP L;  3GTM B;  1ZKO A;  1BDO A;  2HD3 A;  2VW9 A;  1D8L A;  1EU4 A;  1OXT A;  5HY6 A;  1NAP A;  4B08 A;  1X9N A;  4KJO A;  1QVC A;  3V96 A;  1M90 C;  5DAU A;  1KAW A;  3J80 i;  1S5F D;  1CT1 D;  4JI8 L;  3VR2 A;  4DR6 Q;  3PF4 A;  2LMC B;  4CHT B;  5CBA E;  4B3T Q;  2MO1 A;  1Y8O B;  4OO1 G;  2NN6 I;  1MSH A;  2CQO A;  2K5W A;  3AFP A;  1PTO H;  2A1A A;  2YU9 H;  3K5N A;  1BR9 A;  3CRL C;  1L2F A;  5H1S E;  3D8G A;  3Q22 A;  2VUM B;  1YNJ D;  4DAP A;  2F0L A;  2DGY A;  3I72 A;  5E7N A;  1PMR A;  4GNX B;  4LFB Q;  1X55 A;  5E1F A;  1IYV A;  1PYS B;  2I5L X;  1SJH D;  1EY4 A;  3L3O C;  3GV3 A;  5C3E H;  4FXG C;  4HSV A;  3PMF A;  3E9H A;  4LNQ A;  2WB1 B;  5EGT A;  5C44 B;  1RHP A;  1X3E A;  5EJW A;  4LF7 Q;  1GUS A;  2XNA C;  4DPG A;  1VS0 A;  2KA7 A;  1HRJ A;  1ILQ A;  2XWB B;  1R9T B;  4JBM A;  4C3H B;  1WVL A;  1D5Z C;  4J8Q A;  1STE A;  2F4V L;  3QG1 A;  4I7A A;  1JT8 A;  4YHH L;  2PI2 A;  4DV4 Q;  1LYL A;  1Q8I A;  4POF A;  4B3M Q;  3HOW B;  2EPB A;  2VL6 A;  4HED A;  2F0W A;  3CQZ H;  2B2U C;  4JI4 Q;  1HCZ A;  1Q3L A;  1LTR D;  2VS1 A;  5IYD H;  2B2W C;  1NMG A;  2QEJ C;  4Z9C B;  3NUC A;  3MTS A;  1KRT A;  2RBM A;  3VR6 A;  4MNO A;  2XGT A;  3CCR A;  4GNX A;  1H9M A;  3F2B A;  2HDL A;  1RTN A;  4RH6 A;  2WB1 E;  1N8R C;  1PTO B;  2B8F A;  1I4R A;  3I55 A;  4OO1 I;  4AYB B;  1IYU A;  2EY5 A;  4XT3 B;  3S16 H;  3S1Q H;  1DOM A;  1E1O A;  1WTR A;  1N32 L;  3FPU B;  4K2L A;  4QB4 A;  4A3J B;  2ICI A;  5IT9 E;  3TBI B;  3IFD A;  4KV6 A;  1WTQ A;  5M9O A;  5M5W B;  3LGJ A;  1IBK L;  1AZP A;  1AEX A;  5EPK A;  3VYU A;  1B9N A;  5IY0 A;  2Z6B A;  2JA8 H;  3M3Y H;  2A74 C;  1NCV A;  1TWG B;  3PV0 A;  2Z1C A;  4X3K A;  4GKK Q;  1A8V A;  4I65 A;  1PH7 A;  1CFM A;  2F1M A;  4P73 A;  1JOK A;  2KEE A;  1Z47 A;  4L63 B;  1B3Q A;  2WAQ B;  1HXY D;  1S72 A;  3FP9 A;  1EQT A;  1IBL Q;  1Y1V G;  3Q0A A;  3RD4 A;  2K32 A;  2MQH A;  3F2C A;  1PRT F;  1TR5 A;  4NXN L;  1VMP A;  2JK8 A;  4JI6 L;  1EY0 A;  3P75 A;  4JBJ A;  2NVQ H;  3S17 H;  1Y1V H;  4DNR B;  3RZO H;  1HR0 Q;  3RZO B;  3EN2 A;  4JI8 Q;  1KDA A;  4DR6 L;  1DD2 A;  3KLS X;  1PFS A;  5K36 G;  2F0N A;  2L15 A;  4RGM A;  1HNX L;  3HS0 C;  3HEJ A;  2O4X A;  1E2V A;  4X62 L;  2K5H A;  3E3X A;  4IPG A;  3A74 A;  3SK4 A;  3T13 A;  1KRS A;  4DR3 Q;  1J5E Q;  1RD9 D;  1CSP A;  4X66 L;  3CCV A;  4IUQ A;  3NWT A;  1NE3 A;  3S24 A;  1EFI D;  2L5T A;  2IHE A;  1QUQ A;  2FHT A;  3MFY A;  4JOI A;  2G9D A;  1S4Z A;  1C4Q A;  3D4W A;  1K3B C;  1A2T A;  1EY7 A;  5M5Y H;  3NTI A;  4A3K H;  4NXM L;  2LXK A;  4TVA B;  1Q12 A;  2PQE A;  3PUX A;  3RNU A;  3VDY A;  3K0Y A;  1EQV A;  1NMF A;  1B53 A;  5IT9 c;  1QWY A;  5KGU A;  4JI2 Q;  4WRD A;  1EY9 A;  3BZC A;  4C1N K;  4MTK A;  3ZYY X;  1CKN A;  1BUV T;  2FMC A;  3TP6 A;  2H1E A;  2K33 A;  4CKB A;  4LF4 L;  4FF1 A;  2UXB Q;  4WJ3 M;  2WB1 G;  1X3Q A;  1D7Q A;  1PXU A;  4C2M H;  2A8V A;  2DNC A;  5ELD A;  3PO3 H;  4DV2 L;  1AW7 A;  2V1C C;  2QKI C;  1YHA A;  3QOJ A;  5IGD A;  1TWC B;  2UUB Q;  4GZY C;  1PRT B;  3H0G B;  3D4R A;  3B6Y A;  1O7Z A;  1Q82 C;  3T1H Q;  2E2I B;  2IJ0 A;  4LFC Q;  2VUM H;  2WV6 D;  1L0Y B;  4A4I A;  4OEM B;  2NVX B;  4C3J G;  2A6E C;  4TKO B;  1BNZ A;  4N9P A;  3I4N H;  3S2D B;  2J4X A;  3CW2 C;  3DWP A;  1T5X D;  3PSI A;  2F0Q A;  3A7A B;  4C3I B;  3DWQ A;  1GUN A;  1HJP A;  3DWA A;  2AUJ D;  3HOV B;  3J7A V; 
#chains in the Genus database with same CATH homology
 3JAM i;  3K7A H;  2K52 A;  1LM0 A;  1YI2 A;  1JE5 A;  3HKZ G;  1FJG Q;  1G51 A;  3CP0 A;  2F4V Q;  1X65 A;  3M4O H;  4JV5 Q;  2CCZ A;  3RLN A;  2IX0 A;  4X64 Q;  1SRO A;  2C35 B;  3UE0 A;  1ASY A;  1WJJ A;  4LF4 Q;  4LF5 L;  4YY3 Q;  1Q1E A;  5M3M H;  3I4M H;  2MO0 A;  4BBS G;  2WFW A;  4YCU A;  1SRU A;  3UE1 A;  4A3M G;  1VQM A;  4A3J G;  4LWC A;  3S1N H;  2BA0 A;  3EIV A;  4LUO A;  3CCQ A;  2K5V A;  4GNX C;  3PF5 A;  2I5M X;  3CCJ A;  1PH8 A;  2JE6 I;  1EIY B;  3S2D H;  3S15 H;  2R6G A;  3SGI A;  3A0J A;  4L5Q A;  4HIK A;  5IYB H;  1HZ9 A;  1KC8 C;  2OWO A;  5JJK A;  2LXJ A;  1HNW L;  2E5L Q;  4NXN Q;  2UXC L;  2ALY B;  2OCE A;  4K0K Q;  1I50 H;  1Q46 A;  3U4V A;  1V43 A;  1CUK A;  1C7Y A;  1P16 A;  1Q81 C;  4LFC L;  3J7Z C;  2BA1 A;  4JI1 Q;  4JC0 A;  4HID A;  4A3K G;  1PH2 A;  3UDG A;  4IJL A;  3CXC A;  3T1H L;  1U0L A;  2Y0S E;  3KDF A;  4HIO A;  4JI6 Q;  4P74 A;  1KHI A;  4LF5 Q;  1VQC A;  1A62 A;  3CPF A;  4L5R C;  1XNR L;  3MXN B;  4X6A H;  1HNX Q;  5IP9 H;  1YNX A;  1TWG H;  2Z0S A;  3L7Z C;  3T1Y Q;  2OTL A;  1P8L A;  1VQD A;  2ZTD A;  4DR3 L;  4A3D H;  1X3F A;  4R4O A;  5FLX c;  4A3J H;  3OW2 A;  3W5O A;  4LF8 L;  1PV4 A;  1N34 Q;  1LUZ A;  3RR5 A;  2K75 A;  5C0X J;  3F2D A;  4QJF A;  3E9I A;  2E2H H;  1B70 B;  1QUQ B;  1YBY A;  1VQK A;  1EQQ A;  4AIM A;  1VQP A;  1W2B A;  3HOX G;  2YV5 A;  1XNQ Q;  3H15 A;  1OTC A;  2Q2T A;  3KJO A;  4LF6 Q;  2PNH A;  2ZM6 L;  4PZ6 A;  2RCN A;  1GVP A;  3CCU A;  1GKH A;  1BKB A;  2WAQ E;  4A3I H;  5LMN Q;  5C0X G;  3GTK H;  3A5U A;  1IL2 A;  1R9T H;  1ASZ A;  2AHO B;  3A5Z B;  3G48 A;  1U5K A;  4IPH A;  5LMN W;  4DUY L;  1KD1 C;  3HOX H;  4FDB A;  3S1R H;  1UE6 A;  3PGZ A;  3K81 C;  5FJ8 H;  1VCI A;  2I5H A;  1B7Y B;  4JYA L;  1V9P A;  2YTY A;  1Q8K A;  3K8A A;  2JEB I;  4BA1 I;  1JMC A;  2LSS A;  3I4M G;  1L0W A;  4C3I H;  5M5W H;  4A3D G;  1XMQ L;  1VQ7 A;  4EQ5 A;  1SLJ A;  5EAY A;  4JI4 L;  3AYH B;  3HOW H;  2KHI A;  4QQB X;  2Q2I A;  4DV7 L;  3KFU A;  3TRZ A;  1IYJ B;  4JI5 L;  3TRE A;  2GVA A;  3ULJ A;  1Z9F A;  1FGU A;  3F1Z A;  3H0G G;  3U58 A;  1YIT A;  4O0A A;  2RHQ B;  4LFB L;  2KCM A;  5C0X I;  1XMO Q;  1VQ9 A;  2FXQ A;  4OXP A;  1S40 A;  1K8A C;  5IWA L;  1PH5 A;  3T1Y L;  2NVX H;  3CC4 A;  3ICE A;  4JOI C;  1XPR A;  2JA8 G;  1VQA A;  1EQR A;  4GLA C;  4RG1 A;  2K5N A;  2PQA B;  3DLL A;  4PG3 A;  4C3J H;  5LMU L;  4HJ7 A;  4B3S Q;  1IXR A;  3D31 A;  1BBW A;  2MNA A;  4X66 Q;  3HKS A;  4DUZ L;  1VQ6 A;  2EXD A;  4P75 A;  2ASB A;  4DV5 Q;  3U50 C;  2N49 A;  2D62 A;  5IYC H;  2ATW A;  4HJ8 A;  3M85 A;  1B8A A;  2QEX A;  4A93 H;  2YTX A;  5C4X H;  3CF5 A;  2Z6K C;  4YY3 L;  3G6E A;  3L2P A;  1A0I A;  2IX1 A;  2Z6K A;  1YEZ A;  1K83 H;  4LF9 L;  2E2J H;  1TXY A;  2N78 A;  1WYD A;  1C0A A;  3PO3 G;  3FKI G;  4DK6 C;  3K80 C;  1E3P A;  1I94 Q;  3HOU H;  1K0R A;  2OQK A;  3TS0 A;  1PYB A;  1KL9 A;  4DR4 L;  5IP7 G;  4DR1 Q;  1QZH A;  4A3B H;  4R1J A;  4DUY Q;  4DUZ Q;  3PO2 H;  1E1T A;  1NTG A;  1TWA H;  5BR8 L;  1IBM Q;  2K50 A;  4LW1 A;  1YHB A;  4K0K L;  4WJ4 A;  5ELN A;  4A76 A;  3UDX A;  5M3F H;  4A3C G;  1K9M C;  1J5E L;  4AH6 A;  2JA9 A;  3CMA A;  3KDF B;  4GKJ L;  2ZTC A;  1EUJ A;  2GN5 A;  4YWM A;  3AQQ A;  4GOP C;  2K4K A;  4AYB E;  2NZO A;  4NB3 A;  2NN6 G;  4DV1 L;  3J81 c;  2JA7 G;  1EOV A;  3HOW G;  1EWI A;  1EYG A;  2R93 H;  4L5S A;  2PQA A;  2HHH Q;  2VUM G;  1VQB A;  1OXV A;  3TQY A;  1XTD A;  1K8G A;  2KHJ A;  4GN4 B;  2JEA I;  1VQJ A;  1Y1W H;  1AE2 A;  3M4P A;  3CC2 A;  1O7I A;  4DR5 Q;  3PCO B;  4R4Q A;  1QZG A;  4B3T L;  3GTM H;  3K7U C;  1X6O A;  4JI3 Q;  2CKZ B;  3HOV G;  2B3G A;  3OTO L;  4X65 L;  3AFQ A;  2QA4 A;  4XTC S;  2E8G A;  4A3F H;  1FL0 A;  1VQF A;  3RLO A;  5IYB G;  4OWX B;  4A3I G;  5FLM H;  3HOZ G;  4JI7 Q;  4JI1 L;  4BY1 H;  1N33 Q;  4A3L H;  4HIM A;  3M7N A;  2F3I A;  3M9B A;  4LF9 Q;  1YJW A;  1YJN A;  1Q1B A;  3TEH B;  4AYB G;  2RF4 A;  4DV3 Q;  4JI0 L;  1SN8 A;  2OQ0 A;  3JAM c;  3CCM A;  4DAM A;  1K3R A;  4HJ5 A;  1I94 L;  4J15 A;  4JBK A;  1PA6 A;  4DR5 L;  3KF6 A;  4DR1 L;  4JG2 A;  4BY7 H;  3ER0 A;  3IRB A;  4LUZ A;  4DR2 Q;  2NVY H;  1N36 L;  4UPA A;  1X56 A;  4XIG S;  4LF7 L;  1IBM L;  2VZA A;  4AQY L;  3KF8 B;  5GAE C;  1IBL L;  4IFD I;  2HQL A;  1PHJ A;  4BXX G;  4TQU S;  1MJC A;  3JC6 6;  4KHZ A;  2KBN A;  2VNU D;  1N9W A;  5IYD G;  3STB C;  1E22 A;  1C9O A;  3AEV A;  2AWN A;  4PZ7 A;  2UUB L;  2GVB A;  1VQ8 A;  4KHP L;  3I4N G;  5GAD C;  1PH3 A;  2UUA Q;  3GD7 A;  2VW9 A;  3HFZ B;  4DV6 L;  3PUV A;  3CD6 A;  4UP8 A;  4R4C A;  5J3B A;  3NEM A;  4DV4 L;  1D8L A;  2WP8 J;  1OXT A;  1HR0 L;  1MIU A;  1TWF H;  5HY6 A;  3GTL H;  1X9N A;  1VQL A;  3KOJ A;  1N36 Q;  1QVC A;  1M90 C;  1G6P A;  2D0P A;  5LMN L;  1GO3 E;  4NPS A;  3PUZ A;  1KAW A;  4AQY Q;  1Y1W G;  3J80 i;  3W1B A;  4JI8 L;  4DR6 Q;  5HGQ A;  3PF4 A;  4YWL A;  2NVT H;  2JA5 H;  4B3T Q;  1NBW A;  2MO1 A;  3GTJ H;  4A3M H;  2CWA A;  4OO1 G;  4DV2 Q;  3OTO Q;  1SMX A;  1NY4 A;  2NN6 I;  4JI7 L;  2CQO A;  2JA7 H;  3GTQ H;  4KLK A;  5JEA J;  3AFP A;  2EIF A;  3RLF A;  3J81 i;  2UUA L;  2A1A A;  2YU9 H;  1UE5 A;  4OX9 Q;  4Y52 H;  3EBE A;  2BH2 A;  2ES2 A;  4YWK A;  1L2F A;  2UUC L;  2ZJQ A;  1N33 L;  1VQG A;  5H1S E;  2YYZ A;  3CAM A;  3K0X A;  4BBR H;  4JI0 Q;  5ELO A;  2IY5 B;  4QGU A;  5IWA Q;  1IZ6 A;  1Q86 C;  1HZB A;  1BVS A;  2DGY A;  3S14 H;  5E7N A;  2DUD A;  4GNX B;  3GDE A;  4LFB Q;  3PUY A;  4IFD J;  2VQF Q;  1X55 A;  3J7A 5;  1PYS B;  2D0O A;  2I5L X;  4BBR G;  1Y14 B;  4PMW A;  5C3E H;  4A3L G;  3FKI H;  4YCW A;  4LF8 Q;  3E9H A;  4LNQ A;  2R7Z H;  5AJ3 Q;  5FLM G;  3I4O A;  4DV0 Q;  2ZTE A;  4LF7 Q;  1X3E A;  1HZA A;  2B63 H;  2PI2 E;  4JBW A;  4DPG A;  1VS0 A;  4Y7N H;  1T9H A;  3CME A;  1QVF A;  4LUV A;  2N3S A;  4IOA A;  4JBM A;  2R92 H;  4A93 G;  2AMC B;  4A3E G;  2XTI A;  5IYC G;  2F4V L;  4BA2 I;  1JT8 A;  4H02 A;  3MEF A;  4A3G H;  3BZK A;  5GQO A;  4DAY B;  4YHH L;  1FVI A;  1SE8 A;  2PI2 A;  1XNR Q;  4DV4 Q;  1LYL A;  4POF A;  4B3M Q;  3CCE A;  4UY8 C;  2Q2H A;  3WWV A;  2VQE Q;  2JA6 G;  1UE1 A;  1YZ6 A;  2HIX A;  3ZJY C;  2VL6 A;  3I2Z A;  3PIP A;  1KXL A;  1VQN A;  5C3E G;  3KF6 B;  2E2I H;  5GRO A;  3CCL A;  5C44 H;  3H3V H;  3CQZ H;  1XMQ Q;  4JI4 Q;  3S1M H;  2VS1 A;  5IYD H;  1CSQ A;  3HKZ E;  1VQ4 A;  4LFA L;  1NMG A;  1N34 L;  3NBH B;  1KRT A;  3G71 A;  2UU9 L;  1XNQ L;  1PH4 A;  1HZC A;  4A3B G;  4R4I A;  4BXX H;  1H95 A;  2A19 A;  2VY3 A;  4MNO A;  3HOY G;  2XGT A;  2R92 G;  4DR7 L;  1WCM H;  5M5X H;  3CCR A;  1HNZ Q;  4GNX A;  3F2B A;  1XMO L;  1PVO A;  2AWO A;  2KEN A;  3S2H H;  3RN5 A;  1JB7 A;  3G4S A;  3NEL A;  4GLX A;  1JJG A;  3ULL A;  1WCM G;  2WB1 E;  4MZ9 A;  1N8R C;  1I6H H;  3I55 A;  4IPC A;  3W1G A;  5GAG C;  4OO1 I;  2UXD L;  4DKA C;  3HOY H;  2JA5 G;  4IO9 A;  4OWT B;  3S16 H;  3S1Q H;  3D0F A;  1NJI C;  1DGS A;  1E1O A;  1N32 L;  3CCS A;  1EIF A;  4BY1 G;  3I7F A;  4LFA Q;  1HR0 W;  5AJ3 L;  1CKN B;  2OTJ A;  2JQO A;  4P72 A;  4X65 Q;  3LGJ A;  1PH1 A;  4DR7 Q;  1IBK L;  4JV5 L;  3GTG H;  3ERS X;  5IY0 A;  4DV6 Q;  5DLQ E;  2JA8 H;  3GTP H;  2Y0S G;  3M3Y H;  2HIV A;  3PV0 A;  4UP9 A;  3UDF A;  4HJ9 A;  4O2D A;  3CPW A;  4GKK Q;  4A75 A;  4B3M L;  4A3G G;  1AH9 A;  4GS3 A;  4DK3 C;  1MKH A;  3CC7 A;  1A8V A;  1PH7 A;  4YCV A;  4L5T A;  4P73 A;  3J80 c;  2EQS A;  1OXX K;  1E7Z A;  1Z47 A;  3L0O A;  5IP9 G;  4B3R L;  2VQE L;  5JJI A;  4OWW B;  3OYY A;  1S72 A;  4POG A;  3FP9 A;  1I5F A;  2QGQ A;  3FHW A;  3NEN A;  5LMU Q;  1IBL Q;  4B3S L;  1Y1V G;  3J81 j;  4X62 Q;  4GKJ Q;  3KYH C;  2R7Z G;  5FJ8 G;  1AE3 A;  2MQH A;  3RZD H;  3F2C A;  3GTO H;  4NXN L;  5GAH C;  2WAQ G;  3BJU A;  2E5L L;  3H3V I;  4GKK L;  2JK8 A;  2B29 A;  2N8N A;  1YJ9 A;  2JJQ A;  1OXU A;  4IPD A;  1KIX A;  4JI6 L;  1UE7 A;  4JBJ A;  4UP7 A;  1HNZ L;  2NVQ H;  2NZH A;  3S17 H;  1Y1V H;  5JJL A;  3RZO H;  1HR0 Q;  1BBU A;  1G29 1;  4B3R Q;  3EN2 A;  4JI8 Q;  3U4Z A;  4DR6 L;  4KI0 A;  1CKM A;  4JI3 L;  1PFS A;  5K36 G;  4IFD G;  1YVC A;  2L15 A;  1HNX L;  2RHS B;  3E0E A;  4GN3 B;  4RMF A;  3PIO A;  1UEB A;  4BBS H;  4DR4 Q;  1A63 A;  4X62 L;  2K5H A;  4IPG A;  3A74 A;  1KQS A;  1KRS A;  4DR3 Q;  5M3M G;  1J5E Q;  1CSP A;  4X66 L;  1MJE A;  3M4Q A;  3CCV A;  2Q2U A;  1XJV A;  3Q8D A;  2R93 G;  1SR3 A;  4JI2 L;  5C44 G;  3ULP A;  4DV5 L;  1HNW Q;  4DV1 Q;  1NE3 A;  3S24 A;  1K73 C;  2IHE A;  1QUQ A;  4JOI A;  1VQE A;  3F8T A;  3STB D;  2IHF A;  1E24 A;  4A3F G;  4GOP A;  5M3F G;  2ZM6 Q;  4R4T A;  2ZJR A;  4A3C H;  1Q7Y C;  1HH2 P;  3BU2 A;  4APV A;  3TS2 A;  2PMZ E;  4EX5 A;  5M5Y H;  4A3K H;  2AKW B;  4NXM L;  2LXK A;  4OON A;  1Q12 A;  3PUX A;  4TVA B;  3RNU A;  3VDY A;  2UXB L;  2CWP A;  5JEA G;  1L1O B;  1RL2 A;  1J6Q A;  1NMF A;  2CFM A;  3I56 A;  1WFQ A;  5IT9 c;  1TWH H;  2IT1 A;  2UU9 Q;  4JI2 Q;  3BZC A;  4DV7 Q;  1M1K C;  3GO5 A;  4KHP Q;  2B63 G;  2YTV A;  1XPO A;  3UDI A;  4X64 L;  1CKN A;  4JCV E;  1YHQ A;  4GOP B;  4P71 A;  1W3S A;  4HJA A;  4BY7 G;  1FJG L;  1X54 A;  2K14 A;  4JI5 Q;  2MFI A;  1VQ5 A;  4LF6 L;  4LF4 L;  3KJP A;  4IOC A;  4DV3 L;  2BH8 A;  1CKO A;  2HHH L;  4IJH A;  4YHH Q;  2UXB Q;  4WJ3 M;  2WB1 G;  4QIW E;  5IP7 H;  4PZ8 A;  1VQI A;  1D7Q A;  4C3H H;  1RIP A;  4QL5 A;  3HOU G;  2ZJP A;  4C2M H;  2A8V A;  1GD7 A;  3HOZ H;  3PO3 H;  4DV2 L;  5C4X G;  1L1O C;  1PH9 A;  5C4J H;  2I0Q A;  2JA6 H;  2V1C C;  4GN5 A;  4DNI A;  1X3G A;  2UXC Q;  1IBK Q;  1YHA A;  4JYA Q;  1L1O A;  2UUB Q;  2HT1 A;  1TWC H;  5IE8 A;  3HOV H;  2F52 A;  1EFW A;  3B6Y A;  4QY7 A;  2UUC Q;  3DM3 A;  4ALP A;  2H5X A;  1Q82 C;  4ME3 A;  3T1H Q;  4MTN A;  4A3E H;  1VQO A;  4LFC Q;  1GM5 A;  2ID0 A;  2VUM H;  2R7D A;  4GLV B;  2VQF L;  1WOC A;  2UXD Q;  4A4I A;  1LTL A;  1VQH A;  4NXM Q;  2KCT A;  1S3O A;  3RN2 A;  1JJ2 A;  1JJC B;  1V1Q A;  1WI5 A;  1SFO H;  1N32 Q;  4DV0 L;  1I3Q H;  5BR8 Q;  1YIJ A;  2R7F A;  1QVG A;  4DR2 L;  3I4N H;  3CW2 C;  1UWV A;  3PSI A;  1PH6 A;  3PUW A;  1XPU A;  1HJP A;  3H0G H;  3KLW A;  1OXS C;  4OX9 L;  3PO2 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...