2R93H

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 13
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93H00
3L2PA 2AMCB 3GTLH 1JT8A 5IYBH 4JG2A 4KHPL 1NE3A 1SROA 3MEFA 1VQGA 3PF5A 1N36L 4HIMA 3ER0A 4Y7NH 4B3TL 3E0EA 2GVBA 2YTYA 2ZM6Q 2OWOA 4XTCS 1TWCH 1KRTA 1VQOA 2NZHA 2R92G 1TWAH 1FJGL 4C3HH 1XNRL 4DK6C 2D62A 1O7IA 4YCUA 5K36G 1Q46A 4R4QA 4JI2L 2E2JH 1J6QA 2K50A 1G51A 2VUMH 3I4NG 4A3BG 5JJLA 2K5NA 4YWKA 3JAMi 5C0XI 4TVAB 3UE1A 3KF6B 2HIXA 1P8LA 1AH9A 4BY1G 1Y1WH 5M3MG 4BBRG 5H1SE 4JI5L 2VS1A 5IYCH 2R93G 3S24A 4MZ9A 1C7YA 2UU9L 3GD7A 1XPRA 4DAMA 2RHSB 2JA8H 3K0XA 4ME3A 4BBSG 1VQAA 3PUZA 2ZJRA 2HT1A 2GVAA 2K52A 2ZTEA 3DM3A 3KLWA 2R7DA 5M5XH 4HJAA 4JI3Q 4LF9L 1KXLA 4JI0L 4DR2Q 1DGSA 3UDXA 4UPAA 2WB1G 3CCVA 1HR0Q 3FP9A 5IP7G 1X56A 1OXTA 1TWHH 4JYAL 1EIFA 4QGUA 1H95A 1XJVA 1N9WA 3AFQA 4YHHQ 4NXNQ 4X66Q 4LF8L 3PSIA 1I94Q 4A3DG 4JV5Q 3PUWA 4DUYQ 4A3LG 3FHWA 2N49A 4A75A 4A3MG 1YZ6A 1K83H 1QZGA 1WYDA 3NEMA 5M5WH 3AYHB 4R1JA 4DV3L 2KHJA 4IJHA 5HY6A 4GNXC 2JEAI 3AEVA 4WJ3M 3L7ZC 3I55A 3HOXG 1L2FA 2JK8A 5LMUQ 2K75A 4BXXH 2E5LQ 3HKSA 3M7NA 4GLVB 1WI5A 3CC2A 5AJ3Q 1XPOA 4UY8C 2WP8J 3CXCA 5JEAG 3PCOB 3GTQH 2EQSA 3NELA 1IBMQ 1PYSB 1NTGA 4OWTB 2YV5A 4DAYB 4B3ML 3H0GH 2LXJA 4DR5L 1MJEA 4JI6Q 4JI1L 3CAMA 3CCQA 2ASBA 2JA6G 4YY3L 3HOWH 1AE3A 1NJIC 1VQJA 4PMWA 4LF5L 1L1OB 3W5OA 2RCNA 1YEZA 3PF4A 3A0JA 2F3IA 4GNXA 4LF6L 3LGJA 4X65Q 1U0LA 3STBC 3HOZG 4UP9A 1VQIA 5C0XG 5LMNQ 1VQKA 4WJ4A 1TXYA 4DV0L 2MFIA 3I2ZA 4PZ6A 3AFPA 5C4XH 3I4OA 3K7AH 5IY0A 4B3SQ 3OTOL 3I56A 1IYJB 1AE2A 1N34L 1EYGA 4DR7Q 2R7FA 3GTOH 2YTXA 1UE5A 4LUOA 1Y1VH 1Y14B 1VQ7A 3A5UA 4P74A 1PVOA 2K5HA 5IE8A 3VDYA 2JA9A 3L0OA 1Q1EA 1HNWQ 2ALYB 3S1RH 4DV2Q 1VQEA 2LSSA 3DLLA 2ZJQA 3PO2H 4IPHA 1WJJA 2JEBI 1N33L 3M9BA 2CWAA 1S72A 4IOAA 4JI8L 3PUXA 3J81i 4AYBG 4J15A 4A3JH 5IP9H 5BR8Q 1E3PA 5EAYA 2MO0A 1Q81C 1PFSA 1IBKL 2HHHQ 1K3RA 3S1NH 2B3GA 4X64Q 3RLNA 2A1AA 1HZBA 3U4VA 1XMQQ 3HOYG 1V1QA 1Q86C 2AKWB 5IWAL 1XPUA 3U50C 1VQ4A 4DR4L 1L0WA 1PH9A 4AYBE 2N3SA 4LF7Q 4LFAL 3I4MH 1E1TA 1IBLL 2VY3A 2ATWA 1X65A 4NB3A 2Y0SG 2Z6KC 5FJ8H 2F52A 5DLQE 2B63H 4A3EH 4OWXB 2R7ZG 4DPGA 3PO3H 1HH2P 3UDGA 2VW9A 1PH7A 3TS2A 4A3GG 1PH5A 1NY4A 5JEAJ 3CC7A 3UDFA 4IOCA 4L5RC 1FGUA 1VQBA 1BBUA 1C0AA 4POFA 1WCMH 2L15A 2ZM6L 1C9OA 1M90C 2PQAB 1YVCA 3KJOA 1HZCA 3J80c 1XMOQ 3BZKA 3KF6A 1VQ5A 5IYDH 3TREA 1CSPA 1LM0A 1W3SA 2K4KA 4C3JH 5HGQA 3T1YQ 2CFMA 3T1HQ 1KD1C 5M3FH 2VQFQ 4R4OA 1V9PA 1VQMA 3J7A5 3STBD 2Z6KA 2K14A 3HKZG 2UUCQ 1B8AA 1IXRA 1K0RA 1X9NA 4KI0A 2KBNA 3PO2G 2PI2E 1J5EQ 2OTLA 2MNAA 4DV4Q 3CC4A 3PV0A 1BKBA 4QY7A 3ULLA 4POGA 3CCEA 2BH2A 4OO1G 5GADC 5GROA 4EQ5A 1JJCB 1X54A 3HKZE 1YHQA 4JBWA 4DV6Q 4IFDI 1JB7A 2IHEA 4P75A 4JI3L 1OXSC 2B29A 1QUQB 2PI2A 2VNUD 4JBMA 3MXNB 4PZ8A 4DR2L 1PH6A 1SFOH 4DR3Q 3FKIG 3KFUA 2ID0A 1KQSA 1HR0L 4DUZQ 1A63A 2YTVA 4GOPB 4A3FG 4A3KG 1VQ8A 3EBEA 4MNOA 3U4ZA 4TQUS 4KHPQ 4YHHL 2H5XA 4A93H 4GS3A 3PIOA 1I94L 4JV5L 4QIWE 4IJLA 4GN4B 1Z47A 4DUYL 3GDEA 4KLKA 1HNXQ 2NVXH 2UUBQ 4BY7H 1E7ZA 3S2DH 3HOUG 4B3TQ 4DV5Q 2LXKA 2I5HA 1SLJA 2HQLA 3ZJYC 1EFWA 3CMEA 4JI7Q 1JJGA 2GN5A 4OONA 2QGQA 4HJ8A 1UEBA 1YNXA 1Z9FA 2VUMG 1GVPA 3GTMH 1BVSA 4DNIA 5IYBG 1FL0A 2WB1E 2I5MX 3ERSX 1OXVA 5LMUL 3GTJH 2E5LL 3J7ZC 4HJ5A 4IPCA 5ELOA 3GTGH 1RL2A 1NBWA 4JOIC 1YIJA 5AJ3L 4OWWB 1RIPA 3Q8DA 2QEXA 4A3IH 1IBML 5ELNA 3SGIA 2RF4A 4JI6L 4GKKQ 2YYZA 1PHJA 1XNQQ 2HIVA 3CCRA 1UE1A 1K9MC 5C4JH 1M1KC 3M85A 2IHFA 1IL2A 3CMAA 4R4CA 1JMCA 2XTIA 1HR0W 4QQBX 3PIPA 1ASYA 4X65L 1KL9A 5IT9c 3J81j 1Y1WG 4UP8A 2Q2TA 5LMNL 1X6OA 5IYCG 2JA7H 2Q2IA 1Q7YC 1U5KA 4LW1A 3S1QH 4JOIA 4B3SL 2JA8G 3E9HA 4DK3C 3W1GA 1N32Q 3CPFA 4OX9Q 3RZOH 4DR7L 1R9TH 1YJNA 1GD7A 1NMGA 4DKAC 3CCSA 4AQYQ 1PH2A 2EXDA 1VQ9A 4XIGS 2A19A 5C3EH 1KIXA 1HNWL 2CWPA 4X6AH 2VQEQ 4DV2L 1SMXA 1MKHA 1VQDA 4EX5A 4AIMA 4OXPA 4H02A 1OXUA 3S17H 1YJWA 1CKNB 2F4VQ 1X3GA 4NXMQ 2A8VA 3CCLA 5JJKA 1HNZQ 4X62Q 5C44H 4A4IA 1HZ9A 5BR8L 3W1BA 4IO9A 2VL6A 3IRBA 2E2HH 2HHHL 4MTNA 4X64L 1G6PA 2Z0SA 1B7YB 3PUYA 4DV7Q 1XMQL 1JJ2A 3HOVG 4YWLA 5GAGC 3NENA 3M3YH 2NN6I 3CPWA 2Q2UA 1VQCA 2NZOA 1YJ9A 4LF7L 4BXXG 2I0QA 4RG1A 3CP0A 5LMNW 2IT1A 2KCMA 1EUJA 1XTDA 4AH6A 2PQAA 2V1CC 3OYYA 3RN2A 1K8AC 3M4QA 4JI4Q 2K5VA 2UXCL 2JQOA 3H0GG 4YWMA 4DV0Q 1CSQA 5GAEC 3GTKH 3HOVH 3KYHC 1YITA 3HOWG 2UXDQ 3JC66 4GLAC 4GKJQ 2AWNA 4LWCA 1XMOL 2OCEA 2DUDA 3I4NH 4A3BH 3ULPA 1SRUA 3T1YL 1NMFA 3T1HL 2BA1A 4P71A 3ICEA 2UUAQ 2VQFL 2Y0SE 5JJIA 1X3EA 4HIDA 4DR1Q 4BY1H 2RHQB 5M3MH 1B70B 4BBRH 3G6EA 3E9IA 5C4XG 3BZCA 3K7UC 3K80C 3S16H 2R93H 3NBHB 1YHAA 2ZJPA 2WFWA 3M4PA 4DV4L 4LFBQ 4JBKA 4BBSH 1BBWA 1YHBA 1Y1VG 3A5ZB 4GOPA 5C0XJ 4DV6L 1UWVA 2Q2HA 1QVGA 3I7FA 3S15H 4PZ7A 1E24A 3WWVA 5IP7H 1A8VA 4DR3L 4O0AA 4A3DH 2UXBQ 4DUZL 4K0KQ 1S3OA 1KRSA 4DV1Q 4A3JG 5IP9G 1E1OA 2OQ0A 4HIOA 4APVA 3S14H 4A3MH 4A3LH 1Q82C 1OTCA 4B3RQ 2CCZA 3CQZH 3K81C 3RZDH 4LFCQ 4DR6Q 2UUBL 4LF4Q 1S40A 4GN5A 4IPGA 2N78A 1HNXL 3UE0A 3ULJA 4DV5L 3I4MG 3U58A 3F2DA 4R4TA 4JI7L 1L1OC 1EWIA 1HZAA 3HOXH 4NXNL 5FJ8G 1VQHA 3KDFB 4X66L 1YI2A 1I5FA 2B63G 2NN6G 4A3EG 2WAQG 3PO3G 2KHIA 1N36Q 2YU9H 4L5QA 3G48A 1PV4A 4YCVA 3J80i 1W2BA 4LUZA 1T9HA 1FJGQ 4P72A 1LYLA 1XNRQ 1WCMG 1A62A 1Q8KA 4JCVE 3TQYA 2WAQE 5GAHC 1VQNA 1QVCA 3G71A 4JI2Q 5IYDG 2QA4A 4FDBA 2E8GA 2ES2A 2JJQA 2JA6H 4GKKL 3BJUA 1IZ6A 1XNQL 1EOVA 3TS0A 1QZHA 3D0FA 1KC8C 5FLMH 3F8TA 1QVFA 3KJPA 5M3FG 4BA1I 2D0OA 1L1OA 3HOZH 3D31A 2NVTH 1X55A 4JI5Q 4P73A 1EQQA 1Q1BA 1X3FA 5E7NA 3CF5A 4GLXA 2UU9Q 3RLFA 1PYBA 4JBJA 1N8RC 2FXQA 3KF8B 4BA2I 2IX1A 1PH1A 3RLOA 1D7QA 2C35B 2XGTA 4LF9Q 3S1MH 4HJ9A 4JI0Q 1N32L 1SR3A 3H15A 4OX9L 1CUKA 2DGYA 1CKNA 3GO5A 4ALPA 4AQYL 3EIVA 1PH4A 4JYAQ 2IY5B 5J3BA 1KAWA 2D0PA 4LF8Q 3CCUA 2AHOB 1MIUA 3F1ZA 1G291 2VQEL 1I6HH 2KCTA 2JA5H 4A3CH 2JE6I 4A93G 1MJCA 1OXXK 2F4VL 1TWFH 4NXML 4RMFA 4IFDG 3G4SA 2ZTCA 1HNZL 4X62L 4DV3Q 4BY7G 3KOJA 2ZTDA 1VCIA 3J81c 1K8GA 3HOYH 4R4IA 1PA6A 4QJFA 3PGZA 1VQPA 4LNQA 3AQQA 5FLXc 3RNUA 5GQOA 4DV7L 3K8AA 3TEHB 2R7ZH 4JC0A 3F2CA 1A0IA 5FLMG 1I50H 4B3MQ 3TRZA 1FVIA 3BU2A 4A3GH 3EN2A 4DR5Q 1GM5A 4HJ7A 1WOCA 4JI1Q 4A3IG 2OTJA 1VQFA 2VZAA 1KHIA 4YY3Q 4JI4L 1CKOA 4LUVA 4LF5Q 3M4OH 4C3IH 3GTPH 2I5LX 2NVYH 4LF6Q 4OO1I 1VQLA 2UXDL 2BA0A 3CCJA 4QL5A 2R6GA 1EIYB 4Y52H 2N8NA 2EIFA 4GKJL 3H3VI 4L5SA 1D8LA 4UP7A 4PG3A 2CQOA 2IX0A 1VQ6A 1UE7A 1SN8A 1YBYA 4GN3B 2R92H 4HIKA 3OTOQ 1ASZA 4GNXB 4GOPC 2UUAL 4YCWA 1E22A 1N34Q 2JA7G 2E2IH 4DR1L 4A76A 1P16A 3CW2C 3UDIA 2NVQH 2PNHA 1Q12A 1HJPA 3F2BA 1GO3E 3OW2A 3CD6A 4L5TA 2JA5G 1PH3A 4A3CG 4LFBL 3HFZB 4KHZA 3H3VH 1I3QH 2AWOA 4NPSA 3RR5A 1CKMA 1GKHA 3RN5A 3CCMA 5C3EG 3A74A 2BH8A 2UUCL 1N33Q 2OQKA 5M5YH 3JAMc 3FKIH 1J5EL 4JI8Q 1LTLA 4A3FH 1QUQA 4A3KH 1V43A 1VS0A 1TWGH 1JE5A 4O2DA 3PUVA 1EQRA 1IBKQ 1PH8A 2UXBL 3B6YA 4K0KL 1UE6A 2PMZE 5C44G 4DV1L 1WFQA 3S2HH 4IPDA 4IFDJ 4C2MH 5IWAQ 3HOUH 4DR4Q 3KDFA 4B3RL 2MQHA 2UXCQ 4LFAQ 1SE8A 4LFCL 4DR6L 1IBLQ 1K73C 1LUZA 2KENA 2MO1A 2CKZB 4LF4L
chains in the Genus database with same CATH superfamily
4U673 2NTTA 3GTLH 5D65A 3S1MB 1SDFA 1HXYD 4KHPL 2B2TA 2H4OA 3MEFA 3PF5A 5EBDA 3DEOA 4FXGC 4BWGB 3C3LA 1F9RA 4Y7NH 3URYA 5EPLA 2OWOA 3DMUA 1B50A 3SEBA 4K6LA 3FPUB 3TZUA 4JI2L 1J6QA 3TP6A 5A2QL 2PW5A 5JJLA 3U9OA 4N8X1 1P8LA 5DEHA 4BY1G 1Y1WH 5M3MG 2EYOA 1WTHA 4QMGA 5FLXE 5C44B 4DAMA 1O7LA 2RHSB 3K0XA 2ZJRA 2HT1A 2GVAA 1C48A 5ELEA 1DGSA 1MBYA 2WB1G 3OSOA 5BN3A 1X56A 1EIFA 4QGUA 4IUUA 3MVVA 1N9WA 1H95A 2B8GA 4X66Q 3PSIA 4HMIA 1LTAD 2V4DA 3D8GA 1QWYA 1YZ6A 1QZGA 3MHBA 1Q8IA 3WOEA 4GNXC 4K8IA 3AEVA 2NVQB 5KGUA 3L7ZC 5TSSA 2JK8A 3I4NB 4DAPA 4UY8C 2B2YA 5JEAG 1IKMA 3MC0B 3NTKA 2N55A 2X6GA 4QIWB 4FF1A 3NWSA 2LXJA 2MGSA 4NMZA 1S4ZA 5JOBA 3VR4A 1GUTA 1AE3A 1NJIC 2A6HC 4LF5L 2RCNA 2L5TA 2A5HA 2D5DA 1DM0B 3K57A 5CR3A 3HOUB 3STBC 4UP9A 1VQIA 2PW7A 1STGA 3V05A 5I6YA 4A3DB 3I2ZA 4PZ6A 3HG9A 4IUPA 4B3SQ 4HAEA 1G2SA 1IYJB 4OIJA 3I56A 1N34L 1EYGA 2DY7A 1SNMA 4ZRZA 2F0DA 4LUOA 1STBA 1A3TA 1ONLA 3L0OA 2ALYB 3KK7A 3S1RH 5DM63 4DV2Q 1ZYRC 1WJJA 2JEBI 3IL8A 1S5BD 2QILA 4H13C 2XIWA 2CWAA 1D1KA 3J81i 3PUXA 3T13A 3V96A 3OWFA 4J15A 2E2JB 5IP9H 5BR8Q 1E3PA 5EAYA 1AW7A 1I4XA 2CHBD 2F0HA 1Q81C 1PFSA 1QOHA 3S1NH 2RDGA 1HZBA 4YIJA 1XMQQ 1Q86C 5IWAL 4DR4L 3BDLA 4RCNA 2ATWA 2C5CA 4DPGA 3UDGA 2VW9A 3DWAA 2NVTB 4A3GG 1PH5A 5JEAJ 5CMDA 4L5RC 1VQBA 5KYIA 1C0AA 1Y8OB 2B2WA 1QCBD 4HMJA 1C9OA 1M90C 1VF5C 1QJOA 3TREA 1KTKA 2A6HD 1LM0A 2L55A 3R2TA 2K4KA 1BR9A 1KD1C 4X3KA 3MXUA 1V9PA 3J7A5 3STBD 3MWYW 4RGMA 2UUCQ 1B8AA 1IXRA 4OGQC 1PZID 2PI2E 1J5EQ 2MNAA 1SNCA 1EEFD 2NZ1D 4ABNA 4OO1G 1I4PA 1H9SB 1X54A 3HOYB 4IFDI 1TS4A 2FJ2A 4P75A 3N52A 4JI3L 1OXSC 3J7AF 1QUQB 5G3LD 2PI2A 2VNUD 1PH6A 4PZ8A 1ZYRD 5KNCA 4DUZQ 2YTVA 4A3KG 1CT1D 3EBEA 2R7ZB 1X3QA 2AQ2B 1I94L 4JV5L 4QIWE 4GN4B 1Z47A 4DUYL 3GDEA 4KLKA 1D5MC 3S2DH 3HOUG 2I07B 2LXKA 1JJGA 2GN5A 4RFBA 2QGQA 4HR7B 1YNXA 2NVYB 5HGTA 1BVSA 1Y69U 1PRTB 4RAUC 1Y1VB 1F2MA 5ELOA 2KEDA 1NBWA 1DCZA 1TT2A 5AJ3L 1YIJA 4OWWB 3PO2B 4NKLA 3T53B 3QIAA 3G6JB 4QUCA 3SGIA 1AEXA 4JI6L 1BCPB 4GKKQ 5EKLA 3M85A 4PMBA 1IL2A 1JMCA 4F88A 3K5NA 3PIPA 5M5YB 2WACA 5IT9c 4RGTA 3MFYA 1B2TA 5F2DA 1U5KA 3BVGA 3BZDB 3MXPA 2WINB 3E9HA 4OX9Q 3RZOH 4DR7L 1NMGA 3T4AC 3TP5A 2A19A 1HNWL 2H1EA 5LL6X 2F1MA 1OXUA 1YJWA 4ZUIA 4C3JB 2A8VA 2EYPA 1CQFA 2OXPA 1MI2A 4X62Q 2EY1A 1HZ9A 4Y7NB 2WIIB 2XWBB 2E2HH 2HHHL 4MTNA 4X64L 1G6PA 2Z0SA 4DV7Q 1JJ2A 2D2CC 4M1UB 5EQ0A 4K2LA 4BXXG 2A69C 4RG1A 5IODA 2IT1A 1EUJA 1Y1WB 3LNNA 3OYYA 2K5VA 1PFBA 4DV0Q 4MHEA 1CSQA 2NB0A 3GTKH 2MPMA 2XN9C 1V1PB 3JC66 4GKJQ 2AWNA 2NBFA 2CVRA 4BY7B 2OT2A 3T1YL 1NMFA 4FYDA 2UUAQ 2VQFL 4FO2A 4HIDA 4BY1H 2RHQB 5M3MH 3EROA 1H9SA 3E9IA 3BZCA 1YHAA 2K32A 1IL8A 1BNZA 4JVZA 1Y1VG 2EY6A 3A5ZB 2Q8TA 1ZEQX 4DV6L 1QVGA 2F0KA 3WWVA 1PFMA 2OEOA 1ICWA 1IHZA 4APVA 1Q82C 2M00A 2MJ8A 4DR6Q 1T5EA 2UUBL 4LF4Q 1HNXL 2L4NA 4GN5A 4IPGA 1HHVA 3I4LA 3BS1A 3I4MG 2F3VA 3U58A 1SNQA 5FJ8G 4X66L 1YI2A 1V1OA 2G9DA 3SK4A 4CKCA 2EYJA 2A69D 2KHIA 3NQTA 2YU9H 1PV4A 5JEAH 4YCVA 3J80i 2PMZB 2CW0C 3OMCA 3TBIB 1TR5A 1A62A 1Q8KA 2B39A 4JI2Q 5IYDG 4FDBA 2E8GA 4B08A 2JJQA 3BJUA 4RKBA 1QZHA 1KC8C 3KJPA 3S1RB 5D3IB 1L1OA 4CKEA 4P73A 1E2VA 1WTQA 5ELBA 3CF5A 4DFAA 1N8RC 3KF8B 1FNUA 1ENFA 1QILA 2IX1A 2C35B 3S1NB 2XGTA 4F8MA 2PQEA 3S1MH 4HJ9A 1SMYC 1RHPA 2F0NA 2QEJC 3S9WA 1FYCA 2F0WA 1PH4A 2IY5B 3A8IE 3HOVB 5D3DA 3F1ZA 1HQRD 1RD9D 2VQEL 1JWUD 3VYTA 1GXDC 3EJIA 1HPCA 2F4VL 3GV6A 4NXML 4RMFA 4BY7G 3KOJA 1WVLA 1KDCA 1VCIA 5BN5A 4BBRB 1EYAA 1VQPA 4LNQA 3S16B 3Q0AA 1T5XD 3TEHB 2PO4A 1WTVA 4A3GH 5DNFA 3BU2A 2CW0D 5I6WA 1VQFA 4EQOA 4JI4L 4LF5Q 1E0BA 2E2DC 3QOLA 2B2UA 3CCJA 1EIYB 4V0BA 3O13A 1D8LA 5JVG3 2JP1A 1YBYA 5J39A 2QW7A 1E22A 1N34Q 2JA7G 1P16A 3UDIA 2NVQH 1JB3A 3P7JA 4FF4A 1RODA 1Q12A 3F2BA 3NWTA 3OW2A 4OO1H 2VB3X 5LL6S 3CD6A 4OEMB 2QCPX 1CKMA 5C3XA 3D4DA 1EQVA 1K8MA 2UUCL 2B2TC 4EVOA 1J5EL 4KY5A 4A3KH 1V43A 1D1IA 1TWGH 3PUVA 3X3MA 3SR1A 1PH8A 4K0KL 2PMZE 4X3TA 5EBCA 1MD2D 5IWAQ 3HOZB 3HOUH 4DR4Q 4B3RL 4CDDC 2MQHA 2QDBA 3SK6A 1B70B 3I70A 5FO8B 1JT8A 2F0GA 2F0IA 4DK0A 4JPBW 3D6CA 1Q3LA 2K1BA 1N36L 2AUJD 5FKAC 3M4YA 3ER0A 1EZ8A 5G3LF 1PZJD 3N6RA 1CZGA 1VQOA 1XNRL 3RZOB 4YCUA 2JA5B 4R4QA 3KBXA 2E2JH 1TWFB 5C0XI 3KF8A 4HCSA 2HIXA 1JOOA 3J81E 4BBRG 2RA4A 2VXWA 2VS1A 2Z9HA 3C2PA 3GD7A 4MN3A 2DNEA 4WORA 1QG7A 4ME3A 4BBSG 1VQAA 2K52A 3KLWA 4JI3Q 2R7DA 5M5XH 4LF9L 1KXLA 3FRPB 4JI0L 3CCVA 2HDLA 3FP9A 4DK1A 4JYAL 3GTPB 1XJVA 4NXNQ 1I94Q 4JV5Q 5FO9B 4DUYQ 4A3LG 4A75A 1D5XC 1LO5D 1K83H 1BUVT 1QE6A 3HKZB 3AYHB 1YNND 4R1JA 4N9TA 1B4OA 2KHJA 1K3BC 4IJHA 5HY6A 2JEAI 4QCLA 1L2FA 2IPKD 5C6AA 2K75A 4BXXH 2X6LA 3M7NA 4GLVB 2FMMA 1WI5A 2MP1A 3NXWA 1I3QB 5AJ3Q 3MAQA 3CXCA 1M8AA 4BY1B 2EQSA 2DNCA 2YV5A 4JI6Q 1MJEA 4DR5L 4DU9A 4JI1L 1EZ6A 3CAMA 4KD3A 3CCQA 2ASBA 2JA6G 3E6ZX 2J4XA 1TS5A 3I3CA 4LF6L 3LGJA 2WB1B 5CV9A 3HOZG 5CORA 5C0XG 4WJ4A 1SNPA 2FFKB 4DV0L 5JJZA 3AFPA 5IY0A 3I4OA 4ZKCB 5A2QE 4DR7Q 1SXTA 2TMPA 2O5JC 5I9OA 1Y1VH 1VQ7A 1HA5A 2K5HA 1EFID 2JA9A 4IZ8A 2EY2A 1HNWQ 1CHQD 2R61A 1VQEA 2ZJQA 3PO2H 1S72A 5EPKA 2YU9B 3E0JA 2E75C 1IBKL 2HHHQ 1K3RA 2B3GA 4TSSA 4X64Q 1JOQA 2A1AA 2K04A 5A35A 3I4MH 4LFAL 3TZDA 2VY3A 1UAPA 4NB3A 5FJ8H 1PTOD 3VR5A 4B9WA 4DXGA 1PH7A 5FO7B 1TKWB 1DD2A 1KLUD 1BBUA 2ZM6L 2PQAB 5IYDH 1HZCA 2K03A 4CBVA 3BZKA 1VQ5A 3EQLC 4C3JH 3T1YQ 2NTSA 1F77A 2VQFQ 4R4OA 4LMQD 2XVSA 2Z6KA 2EYLA 2K14A 3HKZG 1EL0A 1X9NA 4DGZA 2O2LD 5FOBB 1ENAA 1VMCA 3TSSA 3CC4A 1BKBA 3ULLA 5IGGA 1UNSA 3CCEA 1WD1A 2BH2A 5GADC 3HKZE 4DV6Q 2SOBA 2D9UA 1JWMD 3MFGA 1TVXA 4JBMA 3VR6A 1SFOH 3K5OA 2EZVA 1HR0L 1F2YA 1A63A 4L6TB 1GUGA 3KUPA 2MUYA 3U4ZA 5IGCA 4A3GB 4YHHL 4GS3A 5AFWA 2UUBQ 1HNXQ 2R3ZA 4C1NI 1E7ZA 4BY7H 4R9WA 2VUMG 1UEBA 1MHWC 4KKSA 3GTMH 4IQZA 2K33A 2WB1E 1OXVA 4HSVA 3NP8A 4XYOA 2E5LL 5I2XA 3RUZA 1RIPA 3Q8DA 2QEXA 3K6OA 1IBML 3IAYA 3SXHA 2RF4A 1I4QA 3CCRA 4ZKBB 3L9AX 3D4RA 4E6IA 2FINB 4QQBX 4X65L 2F0LA 2K5QA 4ZAIA 4WRDA 3SVMA 4A3KB 2Q2TA 1TWGB 2AQ3B 2JA7H 2F4IA 1Q7YC 1JR0D 1SYDA 4JOIA 2WAQB 3QWNA 3W1GA 3CPFA 3BVZA 4Z9CB 1A2TA 4L63B 2I46A 1QNUA 2SDFA 3TMEA 3CCSA 1PH2A 2EXDA 3OPOA 4X6AH 2ZT9C 2VQEQ 3S17H 1J8IA 1MKHA 1B9NA 2EYMA 4OXPA 1STYA 4XT1B 2LS01 5IT9L 1HFGA 1CKNB 2F4VQ 3J80E 1LTSD 2ICIA 4NXMQ 5M3FB 4KMUC 1SYBA 2VL6A 4MIUA 5CV6A 3PUYA 4YWLA 3SE0A 4HSPA 4XYQA 2L9HA 1ENCA 1XX8A 5CBAE 2KCMA 2MHVA 4AH6A 2PQAA 5FLXL 1K8AC 2CH4W 4JI4Q 4O1NA 3H0GG 2E74C 4YWMA 1NSNS 1EWCA 3HOVH 3MTSA 3HOWG 2NN6H 3QG1A 4GLAC 2LKVA 1EQTA 5M5XB 1XMOL 4LWCA 2OCEA 1BDOA 3ULPA 3T1HL 3QO2A 4BS9A 2BA1A 1X3EA 1L0XB 1EY6A 4BBRH 3G6EA 3S16H 1JCKB 1ESRA 3NBHB 4DV4L 3FEWX 1PRTC 1K83B 4BBSH 4CHTB 1YHBA 1HTPA 3GTGB 2HD3A 3OIQA 4XT3B 3RMHA 1UWVA 1LLRD 1LTGD 3DEPA 1B9MA 4UDUC 1BCPC 3IFDA 4DR3L 5C4JB 1U4RA 4K0KQ 1KRSA 4J6HA 3M7GA 3H3VC 1L0YB 4A3LH 3P20A 4FXDA 1OTCA 3JAML 4B3RQ 3CQZH 3ND9A 4RA8A 5ISRA 2RCFA 1S40A 3DUZA 3ULJA 3E3XA 4JI7L 1L1OC 1HZAA 4NXNL 3KLSX 1EY0A 1I5FA 1R9TB 2WAQG 1N36Q 1LTRD 3LWUA 1W2BA 1JORA 4LUZA 1XNRQ 1WCMG 3TQYA 1H9MA 2WAQE 5GAHC 1LTBD 1QVCA 5DAUA 4FF3A 4L8JA 2JA6H 1TIID 1XNQL 1KABA 3D0FA 1SJED 4RH6A 5FLMH 3F8TA 1QVFA 5M3FG 1A6XA 2D0OA 4FF2A 3HOZH 5C0XH 2KUMA 3IKJA 1F9SA 1ILQA 3W3AA 1ILPA 4JBJA 3OOCA 4DN4M 3RLOA 4KK7A 1LT3D 3BDCA 4LF9Q 4JI0Q 1SR3A 4WJWA 3MZ5A 2F0TA 3I4MB 1CKNA 4JYAQ 5KEEA 3DXJC 2AHOB 2RBMA 1BCPD 1WD0A 1G291 1TY2A 2KCTA 2JA5H 2JE6I 4A93G 1OXXK 1EWHA 4I7ZC 1TWFH 4CDCC 4IFDG 1SJHD 2QF7A 2B2UC 1K8GA 1AZPA 5FLXc 3H09A 4RKLA 4C56C 4PNYA 3GV3A 3F2CA 1A0IA 4J1MA 4DR5Q 4HJ7A 1WOCA 4JI1Q 3VYUA 2AUKA 2OTJA 3NE5B 1Q90A 4KY7A 3GTPH 2I5LX 5CV4A 4LF6Q 1F2LA 1VQLA 3S14B 2BA0A 4A3MB 2UXDL 2R6GA 2PPBC 1U4LA 2N8NA 1CQVA 3H3VI 4L5SA 3EFXD 1SFOB 4GN3B 1CTMA 1ASZA 1STEA 4GOPC 4YCWA 4PMCA 4DR1L 1EYCA 2LY7A 1FNVA 1CFMA 2PNHA 1HJPA 1PTOF 3LWEA 1PH3A 4A3CG 4LFBL 4KHZA 1NUCA 1I3QH 2C9OA 1Z7TA 3RR5A 3RN5A 2KECA 1QNKA 3GTMB 4OHJA 3JAMc 1HRJA 1LTLA 1QUQA 3R8BA 1W6JA 1RTNA 1IBKQ 3B6YA 5DM73 2F0FA 1WFQA 4KJOA 4IPDA 4IFDJ 4O42A 1STAA 4NP5A 4LFAQ 4HCEA 1K73C 1LUZA 2KENA 2CKZB 2VUMH 3NPPA 4XQQA 2AMCB 4ZCKA 2PNRC 1B1ZA 4JG2A 3A8KE 1NE3A 1SROA 5T1IA 3I91A 4CJ1B 1V8QA 3E0EA 5EJWA 3WOFA 2JA7B 2GVBA 2YTYA 2ZM6Q 2ZXRA 4XTCS 1KRTA 2NZHA 4S3SA 2R92G 1TWAH 1FR3A 4DK6C 2D62A 1O7IA 5K36G 1Q46A 1B44D 4I65A 4CDEC 4H7BA 1G51A 4A3BG 2K5NA 1RKNA 2PZUA 3JAMi 4TVAB 2HDMA 3S17B 3OHXC 1D6EC 3NUCA 3TDQA 3R3OA 2R93G 3S24A 2G9HD 4MZ9A 4UAIA 2UU9L 3DM1A 3TP7A 3DM3A 3DWQA 4HJAA 1GOZA 1PTOH 3UDXA 1HR0Q 2K5DA 3MXGA 2CQAA 1R4PB 1TWHH 3M4OB 3HGBA 3AFQA 4YHHQ 4LF8L 3PUWA 4FVMA 4A3MG 4ZK9B 1B53A 4PV1C 2F0VA 1XXGA 2KVMA 1WYDA 1SE2A 1U4MA 2QKIC 3EVQA 2E2IB 4WJ3M 2F0JA 2E5LQ 2EDGA 3CC2A 3ONAB 5J22A 2WP8J 1IKLA 1BF4A 1IBMQ 1PYSB 4B3ML 1GUSA 3H0GH 1LT4D 2BOSA 4BBSB 4YY3L 3HOWH 4V190 4CJ0B 1DOLA 4KKTA 1YEZA 3PF4A 2F3IA 5T1GA 4X65Q 1SE3A 3MA2B 2B8FA 1V1PA 1U0LA 1DONA 5IGEA 1FD7D 4Q0FA 5ELFA 2XSCA 2EJMA 4QF4A 4ZUJA 3OTOL 1CHPD 4PQXA 3GTOH 2YTXA 3CQZB 1Y14B 3A5UA 4P74A 2KEEA 5IE8A 1K8OA 2LSSA 2F0EA 3DLLA 4IPHA 4XDXA 2KJXA 4X3SA 3TP8A 1BBXC 1S5DD 1SMYD 2MO0A 2EJFC 5CGKA 3RLNA 3U4VA 2F0UA 4IUTA 3U50C 1VQ4A 2JA6B 1ICFB 4JW0A 1PH9A 2N3SA 1BXTA 2EOTA 1IBLL 1O7ZA 2JA8B 1B3AA 2Y0SG 2Z6KC 1VDZA 2F52A 5DLQE 4OWXB 2L12A 3TS2A 4K8JA 1NY4A 3CC7A 3UDFA 3VR2A 4IUNA 1A2UA 4POFA 1WCMH 2L15A 3I8ZA 2Z4IA 3NTHA 1AN8A 4JK1C 5E3FA 3GQBA 1KAAA 4C3IG 1XMOQ 1O80A 4IUQA 1CSPA 1W3SA 4LJZC 3T1HQ 5M3FH 2DJGC 1VQMA 1S5FD 4MTKA 1M4VA 5HURA 2KBNA 2RVLA 2OTLA 4DV4Q 4POGA 5GROA 4EQ5A 1JJCB 1YHQA 4JBWA 3GTQB 2FHTA 1JB7A 4CKBA 3FDTA 3VYRA 1G6ZA 4C1NK 1K0SA 1BO0A 3IFTA 3MXNB 4DR2L 4DR3Q 3KFUA 1E2ZA 1KQSA 2KA7A 4A3FG 1UEAB 3I73A 3NSWA 1BQQT 4TQUS 3K58A 2O4XA 4A93H 4H0LC 3GP7A 5E1FA 3PIOA 4IJLA 4IFDH 4B3TQ 1X32A 1SLJA 1EFWA 1EY7A 2B2YC 4JI7Q 1DXMA 1EU4A 3K7AB 1D5ZC 5FK9C 1GVPA 4DNIA 2BCOA 5IYBG 1FL0A 5LMUL 4EQNA 4ILWA 3J7ZC 4HJ5A 4IPCA 3GTGH 4JOIC 4RGOS 4FP5D 3L3OC 1WTXA 1DYQA 2PZTA 4C3HG 2YYZA 1ML0D 1EEID 1XNQQ 3BG3A 4A3JB 1SYCA 1K9MC 5C4JH 1M1KC 1HR0W 1XWEA 1ASYA 5KIXA 1KL9A 4XXEA 3J81j 4UP8A 3VA7A 5LMNL 5IYCG 4Q5VA 4LW1A 2OF1A 2JA8G 4A3EB 2KCNA 1R9TH 1YJNA 2IL8A 1GD7A 1SYFA 2KCCA 1HTLD 1VQ9A 2VUMB 2JSOA 1KIXA 2CWPA 1I4RA 5CV8A 1FGBD 1SMXA 1VQDA 4EX5A 4AIMA 2JXMB 1WTPA 4WFN3 3E5SA 2L1BA 5K5PA 1TWAB 1R4QB 5GAGC 1ZKOA 1Y8PB 3NENA 4LF7L 2Q2UA 4F87A 1VQCA 2NZOA 1YJ9A 3M3YH 2B2WC 2WV6D 3V2TA 3J81L 3CP0A 1HUNA 1PXUA 3AB9A 2PYKA 1ET6A 2V1CC 4RGNA 2Z1CA 3OMGA 2B2VA 2JQOA 5GAEC 2PCFB 1ESFA 2SNMA 3KYHC 2IJ0A 2HUGA 4G57A 3R93A 1YITA 2UXDQ 5K36H 4K5XA 4CJ2C 4XQJA 1PTOB 2TSSA 5CV7A 4A3BH 1SRUA 2L11A 4J8QA 4ZYSA 2NVXB 3FVQA 1MSHA 2EJGC 5JJIA 3U9SA 3ICEA 2X69A 3BDOA 1TWHB 1WTWA 1U9RA 3H6MA 4DR1Q 5C4XG 3K7UC 3K80C 4DA2A 2R93H 3M4PA 4LFBQ 4JBKA 3GTJB 3MXNA 4FNFA 2F0SA 5C0XJ 4TRDA 3F2UA 3A55A 1O78A 3I7FA 3S15H 3CRKC 4X3UA 4A3JG 1F9PA 1E1OA 2EYFA 3T56B 3S14H 4A3MH 1I4HA 3PQIA 3BYYB 3H0GB 3K81C 3RZDH 1HUMA 2N78A 5IT9E 3UE0A 4DV5L 3HOWB 1HA6A 1XTCD 3F2DA 3S1QB 1EWIA 1VQHA 3KDFB 2Q8RE 2B63G 5C5LA 3G7LA 4A3EG 3ZYYX 3PO3G 5C4ZA 4L5QA 1SNDA 2BE5C 5C3EB 1T9HA 4TKOB 4P72A 1LYLA 4ZLTF 5JPNC 4KTAA 3GTOB 3G71A 2ES2A 1EY9A 2G5DA 5I2YA 4BA1I 3RD4A 3OIPA 3NTIA 1X55A 2BDNA 1JWSD 1X3FA 3VR3A 5E7NA 4GLXA 2UU9Q 1EIHA 1PYBA 4KV6A 4BA2I 2FXQA 5JPMC 3Q23A 1N32L 2EYHA 3D3RA 3H15A 3PIO3 1CA5A 3K59A 1CUKA 2DGYA 4AQYL 4DNRB 5J3BA 5IGDA 4LF8Q 3OWEB 4ODGA 1MIUA 2RKSA 1I6HH 1MJCA 1PFNA 3A7AB 3G4SA 1HNZL 1WCMB 2ZTDA 4GZYC 3J81c 1HFNA 4ME5A 5IGBA 4K14A 2BDOA 3JAME 4RCOA 2SNSA 3QR8A 1PDQA 4B3MQ 1FVIA 3MEHA 2BE5D 1PMRA 1GM5A 4A3IG 4K6DA 2VZAA 1KHIA 4YY3Q 3I90A 4G4KA 1CKOA 4LUVA 4N9PA 3M4OH 4C3IH 1WTRA 4CGYB 3WDNA 4DF7A 4OO1I 2EIFA 1CA6A 4QB4A 4UP7A 4PG3A 1VQ6A 3SDZA 1SEBD 1UE7A 1ET9A 3OTOQ 4HIKA 1Y8NB 3R2IA 4GNXB 5IGFA 2E2IH 3HOXB 4N8FA 4A93B 5C3WA 1A3UA 1GO3E 4L5TA 1RTOA 1EY4A 1A15A 4XQNA 3ND8A 1GKHA 1DOKA 5C3EG 1CM9A 1CZWA 2OQKA 2F0QA 3H91A 1LTTD 4A3FH 1GUNA 2WKCA 1VS0A 1EQRA 2UXBL 2F3WA 1UE6A 5C44G 4DV1L 4C2MH 1VF7A 1EIGA 3J7YW 3KDFA 2UXCQ 1G2TA 4LFCL 1IBLQ 1EYDA 1JE4A 5JVH3 3L2PA 5IYBH 4K5VA 5IOCA 2IW3A 2QDLA 1VQGA 2CH4A 1KNAA 3CRLC 5C4HA 4IUVA 4HIMA 4B3TL 3CKIB 1TWCH 4OIKA 1FJGL 4C3HH 4H44C 3ERQA 5E4WC 2HCCA 1PZKD 2L0CA 4AYBB 2K50A 3P75A 1SNOA 3I4NG 4YWKA 4DAVA 3UE1A 3KF6B 1AH9A 3J80L 4ZQ3A 5H1SE 2EXZA 1B3QA 4JI5L 5IYCH 5I4DA 3FPPA 1C7YA 1XPRA 2JA8H 3PUZA 4KD4A 2EPBA 2ZTEA 1I50B 2XWJB 2EVBA 5COYA 4DR2Q 5KRUA 1H9KA 4UPAA 1NR4A 1H9RA 3M3YB 1E2WA 5IP7G 1OXTA 3C1FA 4A3DG 1PRTD 3FHWA 2N49A 3HRZC 2IWHA 5M5WH 3NEMA 2R92B 4DV3L 1CI3M 1II3A 5J1ZA 3VYSA 3I55A 3HOXG 4UHVA 5LMUQ 4A3BB 1G8ZD 2Z8LA 2ZXPA 3HKSA 2RQXA 2O5IC 1HQMC 3TN2A 3A8JE 1XPOA 1AZQA 3PCOB 2VB2X 3GTQH 3NELA 1NTGA 4OWTB 4DAYB 3FKIB 2R93B 1JQYD 3HZXA 1IYVA 3EA6A 3HP3A 1VQJA 4PMWA 5M9OA 1L1OB 3W5OA 1LV9A 1D2BA 3A0JA 1O7YA 3S2HB 4GNXA 4EQPA 2PZWA 3S15B 1CK1A 5CBEE 5LMNQ 1VQKA 1PLFA 4IALA 1TXYA 2MFIA 4KY6A 5C4XH 1KNEA 3K7AH 3GTLB 5E4XA 1AE2A 4EGVA 4OL7A 2R7FA 1UE5A 3RZDB 3NBHA 1PVOA 5LHY1 3VDYA 1Q1EA 1OO9B 3J7AV 4F7XA 1N33L 3M9BA 3HS0C 4IOAA 4JI8L 4A3JH 4AYBG 1C8CA 2A6EC 3D4WA 4CDFC 1WTOA 2K28A 3HOYG 1V1QA 1XPUA 2AKWB 1C4QA 2NWGA 1NAPA 1L0WA 4AYBE 4LF7Q 1E1TA 1IYUA 1X65A 2ENBA 4B9XA 2B63H 4NW2A 2A73B 5JAVA 4A3EH 2R7ZG 3PO3H 1HH2P 2A68C 1AFPA 4HEDA 1JOKA 4DNTB 2M2LA 4IOCA 1FGUA 1JC7A 1Z6HA 4KHVA 5KNDA 1YNJC 3BVMA 1YVCA 3KJOA 3J80c 5EKKA 3KF6A 5HGQA 2CFMA 5D14A 3NBIA 3VA5A 1K0RA 4KI0A 1I6HB 3PO2G 1I4GA 4DXFA 2K7VA 3PV0A 4QY7A 3KBGA 3Q22A 1STHA 2DY8A 3K5MA 2M9VA 2J0TD 2IHEA 1S5ED 2B29A 3W2DA 3LX0A 2JYOA 4G7OC 3FKIG 2ID0A 2Y0SB 4GOPB 1VQ8A 4MNOA 3OW7A 4KHPQ 1FNWA 2H5XA 3KLRA 5EGTA 2NVXH 2A6ED 2EE1A 2A74C 4DV5Q 2I5HA 2HQLA 1AP0A 3ZJYC 3CMEA 4C3IB 4OONA 4HJ8A 2FMCA 1Z9FA 1GHKA 2SEBD 3Q24A 3ERSX 2I5MX 4DAYA 1MGSA 3GTJH 2A68D 4C3JG 4P2CB 1RL2A 4A3IH 3A54A 3SHLA 5ELNA 1YNJD 1TS3A 1PHJA 1PYWD 2Z6BA 1A3VA 2HIVA 2IX3A 1UE1A 2HCIA 2K5WA 2IHFA 1NNXA 3CMAA 4R4CA 2XTIA 2F0MA 3P1HA 1Y1WG 4A3FB 1X6OA 1EU3A 4R8NA 2Q2IA 3S1QH 1DJRD 5BN4A 4B3SL 4DK3C 1N32Q 4C2MB 3HEJA 1NR2A 4DKAC 4AQYQ 4G7HC 5ELCA 1LT6D 1TS2A 4XIGS 5C3EH 5EKIA 2DN8A 4DV2L 4H02A 5CC4A 1LT5D 1X3GA 2B2VC 3CCLA 1MSGA 1W6KA 1RF2D 1HNZQ 5JJKA 4FXKC 2ICEC 4A4IA 5C44H 4NDXA 3W1BA 5BR8L 4IO9A 5ELDA 1TWCB 3SK8A 3IRBA 1BOSA 4C3HB 1B7YB 2GA4B 3PIP3 1XMQL 1LACA 1SYEA 1J9OA 2K05A 2NN6I 3CPWA 2DJFC 2F0PA 1STNA 3T51B 2I0QA 1JICA 2K6AA 4KJNA 1SBBB 5LMNW 2RSOA 1XTDA 3RN2A 3M4QA 2UXCL 3CHBD 4I7AA 4KN7C 1HCZA 1DZ1A 3QB3A 5L37A 1TQOA 1GHJA 2Z4HA 3I72A 1KDBA 2DUDA 3I4NH 2XRSD 3S2DB 1SSOA 1TU2B 2RDFA 4P71A 5EPJA 1ZXTA 2Y0SE 5C5MA 1QB5D 5IIFA 2ZJPA 2WFWA 1BBWA 4IN3A 5M5WB 4HN7A 1KLGD 4LAAA 5I9PA 4GOPA 4G7ZC 1IW7C 4KN4C 2Q2HA 3UI2A 2EY5A 3A7LA 1YNNC 1KDAA 1NCVA 4PZ7A 1E24A 5IP7H 1A8VA 4O0AA 4A3DH 2UXBQ 4DUZL 1S3OA 3PMFA 4DV1Q 5IP9G 2OQ0A 4HTHA 4HIOA 1GUWA 3C1EA 2CCZA 4LFCQ 2F03A 3SK5A 1GJXA 1DOMA 3DWPA 4R4TA 3HOVG 3HOXH 2NN6G 2AQ1B 5KNBA 3ITPA 3G48A 1SE4A 4RHSA 3QOJA 5C4XB 1FJGQ 4JCVE 3K0YA 1VQNA 1S5CD 2QA4A 4GKKL 1PRTF 1IZ6A 1EOVA 3TS0A 3A56A 1F9QA 2WKDA 3X3NA 2E2HB 3D31A 2NVTH 4JI5Q 3DHQA 1EQQA 1Q1BA 2NUCA 2Q8IB 5KYLA 1BCPF 3RLFA 1D7QA 1PH1A 3T16A 2KQ3A 4OX9L 1GUOA 3GO5A 4ALPA 1IW7D 3EIVA 3NQIA 3GTKB 1KAWA 2D0PA 2B63B 3CCUA 3PO3B 4QUFA 4KKUA 4A3CH 1U4PA 1PTOC 3NK9A 3FMCA 1RDPD 4LK1C 2K01A 2ZTCA 4X62L 4DV3Q 2LFNA 3K5LA 4R8IA 3HOYH 2JN4A 5M3MB 4R4IA 1PA6A 4QJFA 3PGZA 3AQQA 3RNUA 2KOLA 5GQOA 1K28A 4DV7L 4M8AA 4K2KA 3D6WA 2KHSA 3K8AA 1XYIA 2R7ZH 3H94A 4JC0A 2RDHA 1I50H 5FLMG 3TRZA 4U68A 3EN2A 4K5WA 1X3PA 4ULLA 2J7ZA 2N88A 1F2ZA 2LMCB 1SAPA 4RWSC 2NVYH 2E76C 4QL5A 3BYTB 4IURA 1EY8A 1EOTA 4ID6A 4GKJL 4Y52H 2CQOA 2IX0A 1H9JA 5CV5A 1SN8A 2R92H 2RSNA 2UUAL 1VMPA 1RCVD 3CU7A 4A76A 4RHRA 3CW2C 2P5ZX 2HQEA 2ZXOA 2XNAC 2JA5G 3HFZB 3H3VH 2NYZD 2AWOA 4NPSA 3CCMA 3AMUA 3A74A 3C46A 2BH8A 1N33Q 3AU7A 5CYUA 5M5YH 3FKIH 4OELB 3KLSA 4JI8Q 1LTID 1EY5A 1JE5A 3Q6SA 4O2DA 5NUCA 1G91A 1UUPA 3S2HH 1SYGA 1RJTA 4A3IB 2F0OA 3QJYA 1TY0A 1LABA 3NHHA 1SE8A 2XRQD 4DR6L 1I6VC 4LF4L 2MO1A
chains in the Genus database with same CATH topology
3L2PA 2AMCB 3GTLH 1JT8A 5IYBH 4JG2A 4KHPL 1NE3A 1SROA 3MEFA 1VQGA 3PF5A 1N36L 4HIMA 3ER0A 4Y7NH 4B3TL 3E0EA 2GVBA 2YTYA 2ZM6Q 2OWOA 4XTCS 1TWCH 1KRTA 1VQOA 2NZHA 2R92G 1TWAH 1FJGL 4C3HH 1XNRL 4DK6C 2D62A 1O7IA 4YCUA 5K36G 1Q46A 4R4QA 4JI2L 2E2JH 1J6QA 2K50A 1G51A 2VUMH 3I4NG 4A3BG 5JJLA 2K5NA 4YWKA 3JAMi 5C0XI 4TVAB 3UE1A 3KF6B 2HIXA 1P8LA 1AH9A 4BY1G 1Y1WH 5M3MG 4BBRG 5H1SE 4JI5L 2VS1A 5IYCH 2R93G 3S24A 4MZ9A 1C7YA 2UU9L 3GD7A 1XPRA 4DAMA 2RHSB 2JA8H 3K0XA 4ME3A 4BBSG 1VQAA 3PUZA 2ZJRA 2HT1A 2GVAA 2K52A 2ZTEA 3DM3A 3KLWA 2R7DA 5M5XH 4HJAA 4JI3Q 4LF9L 1KXLA 4JI0L 4DR2Q 1DGSA 3UDXA 4UPAA 2WB1G 3CCVA 1HR0Q 3FP9A 5IP7G 1X56A 1OXTA 1TWHH 4JYAL 1EIFA 4QGUA 1H95A 1XJVA 1N9WA 3AFQA 4YHHQ 4NXNQ 4X66Q 4LF8L 3PSIA 1I94Q 4A3DG 4JV5Q 3PUWA 4DUYQ 4A3LG 3FHWA 2N49A 4A75A 4A3MG 1YZ6A 1K83H 1QZGA 1WYDA 3NEMA 5M5WH 3AYHB 4R1JA 4DV3L 2KHJA 4IJHA 5HY6A 4GNXC 2JEAI 3AEVA 4WJ3M 3L7ZC 3I55A 3HOXG 1L2FA 2JK8A 5LMUQ 2K75A 4BXXH 2E5LQ 3HKSA 3M7NA 4GLVB 1WI5A 3CC2A 5AJ3Q 1XPOA 4UY8C 2WP8J 3CXCA 5JEAG 3PCOB 3GTQH 2EQSA 3NELA 1IBMQ 1PYSB 1NTGA 4OWTB 2YV5A 4DAYB 4B3ML 3H0GH 2LXJA 4DR5L 1MJEA 4JI6Q 4JI1L 3CAMA 3CCQA 2ASBA 2JA6G 4YY3L 3HOWH 1AE3A 1NJIC 1VQJA 4PMWA 4LF5L 1L1OB 3W5OA 2RCNA 1YEZA 3PF4A 3A0JA 2F3IA 4GNXA 4LF6L 3LGJA 4X65Q 1U0LA 3STBC 3HOZG 4UP9A 1VQIA 5C0XG 5LMNQ 1VQKA 4WJ4A 1TXYA 4DV0L 2MFIA 3I2ZA 4PZ6A 3AFPA 5C4XH 3I4OA 3K7AH 5IY0A 4B3SQ 3OTOL 3I56A 1IYJB 1AE2A 1N34L 1EYGA 4DR7Q 2R7FA 3GTOH 2YTXA 1UE5A 4LUOA 1Y1VH 1Y14B 1VQ7A 3A5UA 4P74A 1PVOA 2K5HA 5IE8A 3VDYA 2JA9A 3L0OA 1Q1EA 1HNWQ 2ALYB 3S1RH 4DV2Q 1VQEA 2LSSA 3DLLA 2ZJQA 3PO2H 4IPHA 1WJJA 2JEBI 1N33L 3M9BA 2CWAA 1S72A 4IOAA 4JI8L 3PUXA 3J81i 4AYBG 4J15A 4A3JH 5IP9H 5BR8Q 1E3PA 5EAYA 2MO0A 1Q81C 1PFSA 1IBKL 2HHHQ 1K3RA 3S1NH 2B3GA 4X64Q 3RLNA 2A1AA 1HZBA 3U4VA 1XMQQ 3HOYG 1V1QA 1Q86C 2AKWB 5IWAL 1XPUA 3U50C 1VQ4A 4DR4L 1L0WA 1PH9A 4AYBE 2N3SA 4LF7Q 4LFAL 3I4MH 1E1TA 1IBLL 2VY3A 2ATWA 1X65A 4NB3A 2Y0SG 2Z6KC 5FJ8H 2F52A 5DLQE 2B63H 4A3EH 4OWXB 2R7ZG 4DPGA 3PO3H 1HH2P 3UDGA 2VW9A 1PH7A 3TS2A 4A3GG 1PH5A 1NY4A 5JEAJ 3CC7A 3UDFA 4IOCA 4L5RC 1FGUA 1VQBA 1BBUA 1C0AA 4POFA 1WCMH 2L15A 2ZM6L 1C9OA 1M90C 2PQAB 1YVCA 3KJOA 1HZCA 3J80c 1XMOQ 3BZKA 3KF6A 1VQ5A 5IYDH 3TREA 1CSPA 1LM0A 1W3SA 2K4KA 4C3JH 5HGQA 3T1YQ 2CFMA 3T1HQ 1KD1C 5M3FH 2VQFQ 4R4OA 1V9PA 1VQMA 3J7A5 3STBD 2Z6KA 2K14A 3HKZG 2UUCQ 1B8AA 1IXRA 1K0RA 1X9NA 4KI0A 2KBNA 3PO2G 2PI2E 1J5EQ 2OTLA 2MNAA 4DV4Q 3CC4A 3PV0A 1BKBA 4QY7A 3ULLA 4POGA 3CCEA 2BH2A 4OO1G 5GADC 5GROA 4EQ5A 1JJCB 1X54A 3HKZE 1YHQA 4JBWA 4DV6Q 4IFDI 1JB7A 2IHEA 4P75A 4JI3L 1OXSC 2B29A 1QUQB 2PI2A 2VNUD 4JBMA 3MXNB 4PZ8A 4DR2L 1PH6A 1SFOH 4DR3Q 3FKIG 3KFUA 2ID0A 1KQSA 1HR0L 4DUZQ 1A63A 2YTVA 4GOPB 4A3FG 4A3KG 1VQ8A 3EBEA 4MNOA 3U4ZA 4TQUS 4KHPQ 4YHHL 2H5XA 4A93H 4GS3A 3PIOA 1I94L 4JV5L 4QIWE 4IJLA 4GN4B 1Z47A 4DUYL 3GDEA 4KLKA 1HNXQ 2NVXH 2UUBQ 4BY7H 1E7ZA 3S2DH 3HOUG 4B3TQ 4DV5Q 2LXKA 2I5HA 1SLJA 2HQLA 3ZJYC 1EFWA 3CMEA 4JI7Q 1JJGA 2GN5A 4OONA 2QGQA 4HJ8A 1UEBA 1YNXA 1Z9FA 2VUMG 1GVPA 3GTMH 1BVSA 4DNIA 5IYBG 1FL0A 2WB1E 2I5MX 3ERSX 1OXVA 5LMUL 3GTJH 2E5LL 3J7ZC 4HJ5A 4IPCA 5ELOA 3GTGH 1RL2A 1NBWA 4JOIC 1YIJA 5AJ3L 4OWWB 1RIPA 3Q8DA 2QEXA 4A3IH 1IBML 5ELNA 3SGIA 2RF4A 4JI6L 4GKKQ 2YYZA 1PHJA 1XNQQ 2HIVA 3CCRA 1UE1A 1K9MC 5C4JH 1M1KC 3M85A 2IHFA 1IL2A 3CMAA 4R4CA 1JMCA 2XTIA 1HR0W 4QQBX 3PIPA 1ASYA 4X65L 1KL9A 5IT9c 3J81j 1Y1WG 4UP8A 2Q2TA 5LMNL 1X6OA 5IYCG 2JA7H 2Q2IA 1Q7YC 1U5KA 4LW1A 3S1QH 4JOIA 4B3SL 2JA8G 3E9HA 4DK3C 3W1GA 1N32Q 3CPFA 4OX9Q 3RZOH 4DR7L 1R9TH 1YJNA 1GD7A 1NMGA 4DKAC 3CCSA 4AQYQ 1PH2A 2EXDA 1VQ9A 4XIGS 2A19A 5C3EH 1KIXA 1HNWL 2CWPA 4X6AH 2VQEQ 4DV2L 1SMXA 1MKHA 1VQDA 4EX5A 4AIMA 4OXPA 4H02A 1OXUA 3S17H 1YJWA 1CKNB 2F4VQ 1X3GA 4NXMQ 2A8VA 3CCLA 5JJKA 1HNZQ 4X62Q 5C44H 4A4IA 1HZ9A 5BR8L 3W1BA 4IO9A 2VL6A 3IRBA 2E2HH 2HHHL 4MTNA 4X64L 1G6PA 2Z0SA 1B7YB 3PUYA 4DV7Q 1XMQL 1JJ2A 3HOVG 4YWLA 5GAGC 3NENA 3M3YH 2NN6I 3CPWA 2Q2UA 1VQCA 2NZOA 1YJ9A 4LF7L 4BXXG 2I0QA 4RG1A 3CP0A 5LMNW 2IT1A 2KCMA 1EUJA 1XTDA 4AH6A 2PQAA 2V1CC 3OYYA 3RN2A 1K8AC 3M4QA 4JI4Q 2K5VA 2UXCL 2JQOA 3H0GG 4YWMA 4DV0Q 1CSQA 5GAEC 3GTKH 3HOVH 3KYHC 1YITA 3HOWG 2UXDQ 3JC66 4GLAC 4GKJQ 2AWNA 4LWCA 1XMOL 2OCEA 2DUDA 3I4NH 4A3BH 3ULPA 1SRUA 3T1YL 1NMFA 3T1HL 2BA1A 4P71A 3ICEA 2UUAQ 2VQFL 2Y0SE 5JJIA 1X3EA 4HIDA 4DR1Q 4BY1H 2RHQB 5M3MH 1B70B 4BBRH 3G6EA 3E9IA 5C4XG 3BZCA 3K7UC 3K80C 3S16H 2R93H 3NBHB 1YHAA 2ZJPA 2WFWA 3M4PA 4DV4L 4LFBQ 4JBKA 4BBSH 1BBWA 1YHBA 1Y1VG 3A5ZB 4GOPA 5C0XJ 4DV6L 1UWVA 2Q2HA 1QVGA 3I7FA 3S15H 4PZ7A 1E24A 3WWVA 5IP7H 1A8VA 4DR3L 4O0AA 4A3DH 2UXBQ 4DUZL 4K0KQ 1S3OA 1KRSA 4DV1Q 4A3JG 5IP9G 1E1OA 2OQ0A 4HIOA 4APVA 3S14H 4A3MH 4A3LH 1Q82C 1OTCA 4B3RQ 2CCZA 3CQZH 3K81C 3RZDH 4LFCQ 4DR6Q 2UUBL 4LF4Q 1S40A 4GN5A 4IPGA 2N78A 1HNXL 3UE0A 3ULJA 4DV5L 3I4MG 3U58A 3F2DA 4R4TA 4JI7L 1L1OC 1EWIA 1HZAA 3HOXH 4NXNL 5FJ8G 1VQHA 3KDFB 4X66L 1YI2A 1I5FA 2B63G 2NN6G 4A3EG 2WAQG 3PO3G 2KHIA 1N36Q 2YU9H 4L5QA 3G48A 1PV4A 4YCVA 3J80i 1W2BA 4LUZA 1T9HA 1FJGQ 4P72A 1LYLA 1XNRQ 1WCMG 1A62A 1Q8KA 4JCVE 3TQYA 2WAQE 5GAHC 1VQNA 1QVCA 3G71A 4JI2Q 5IYDG 2QA4A 4FDBA 2E8GA 2ES2A 2JJQA 2JA6H 4GKKL 3BJUA 1IZ6A 1XNQL 1EOVA 3TS0A 1QZHA 3D0FA 1KC8C 5FLMH 3F8TA 1QVFA 3KJPA 5M3FG 4BA1I 2D0OA 1L1OA 3HOZH 3D31A 2NVTH 1X55A 4JI5Q 4P73A 1EQQA 1Q1BA 1X3FA 5E7NA 3CF5A 4GLXA 2UU9Q 3RLFA 1PYBA 4JBJA 1N8RC 2FXQA 3KF8B 4BA2I 2IX1A 1PH1A 3RLOA 1D7QA 2C35B 2XGTA 4LF9Q 3S1MH 4HJ9A 4JI0Q 1N32L 1SR3A 3H15A 4OX9L 1CUKA 2DGYA 1CKNA 3GO5A 4ALPA 4AQYL 3EIVA 1PH4A 4JYAQ 2IY5B 5J3BA 1KAWA 2D0PA 4LF8Q 3CCUA 2AHOB 1MIUA 3F1ZA 1G291 2VQEL 1I6HH 2KCTA 2JA5H 4A3CH 2JE6I 4A93G 1MJCA 1OXXK 2F4VL 1TWFH 4NXML 4RMFA 4IFDG 3G4SA 2ZTCA 1HNZL 4X62L 4DV3Q 4BY7G 3KOJA 2ZTDA 1VCIA 3J81c 1K8GA 3HOYH 4R4IA 1PA6A 4QJFA 3PGZA 1VQPA 4LNQA 3AQQA 5FLXc 3RNUA 5GQOA 4DV7L 3K8AA 3TEHB 2R7ZH 4JC0A 3F2CA 1A0IA 5FLMG 1I50H 4B3MQ 3TRZA 1FVIA 3BU2A 4A3GH 3EN2A 4DR5Q 1GM5A 4HJ7A 1WOCA 4JI1Q 4A3IG 2OTJA 1VQFA 2VZAA 1KHIA 4YY3Q 4JI4L 1CKOA 4LUVA 4LF5Q 3M4OH 4C3IH 3GTPH 2I5LX 2NVYH 4LF6Q 4OO1I 1VQLA 2UXDL 2BA0A 3CCJA 4QL5A 2R6GA 1EIYB 4Y52H 2N8NA 2EIFA 4GKJL 3H3VI 4L5SA 1D8LA 4UP7A 4PG3A 2CQOA 2IX0A 1VQ6A 1UE7A 1SN8A 1YBYA 4GN3B 2R92H 4HIKA 3OTOQ 1ASZA 4GNXB 4GOPC 2UUAL 4YCWA 1E22A 1N34Q 2JA7G 2E2IH 4DR1L 4A76A 1P16A 3CW2C 3UDIA 2NVQH 2PNHA 1Q12A 1HJPA 3F2BA 1GO3E 3OW2A 3CD6A 4L5TA 2JA5G 1PH3A 4A3CG 4LFBL 3HFZB 4KHZA 3H3VH 1I3QH 2AWOA 4NPSA 3RR5A 1CKMA 1GKHA 3RN5A 3CCMA 5C3EG 3A74A 2BH8A 2UUCL 1N33Q 2OQKA 5M5YH 3JAMc 3FKIH 1J5EL 4JI8Q 1LTLA 4A3FH 1QUQA 4A3KH 1V43A 1VS0A 1TWGH 1JE5A 4O2DA 3PUVA 1EQRA 1IBKQ 1PH8A 2UXBL 3B6YA 4K0KL 1UE6A 2PMZE 5C44G 4DV1L 1WFQA 3S2HH 4IPDA 4IFDJ 4C2MH 5IWAQ 3HOUH 4DR4Q 3KDFA 4B3RL 2MQHA 2UXCQ 4LFAQ 1SE8A 4LFCL 4DR6L 1IBLQ 1K73C 1LUZA 2KENA 2MO1A 2CKZB 4LF4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2P A;  2AMC B;  3GTL H;  1JT8 A;  5IYB H;  4JG2 A;  4KHP L;  1NE3 A;  1SRO A;  3MEF A;  1VQG A;  3PF5 A;  1N36 L;  4HIM A;  3ER0 A;  4Y7N H;  4B3T L;  3E0E A;  2GVB A;  2YTY A;  2ZM6 Q;  2OWO A;  4XTC S;  1TWC H;  1KRT A;  1VQO A;  2NZH A;  2R92 G;  1TWA H;  1FJG L;  4C3H H;  1XNR L;  4DK6 C;  2D62 A;  1O7I A;  4YCU A;  5K36 G;  1Q46 A;  4R4Q A;  4JI2 L;  2E2J H;  1J6Q A;  2K50 A;  1G51 A;  2VUM H;  3I4N G;  4A3B G;  5JJL A;  2K5N A;  4YWK A;  3JAM i;  5C0X I;  4TVA B;  3UE1 A;  3KF6 B;  2HIX A;  1P8L A;  1AH9 A;  4BY1 G;  1Y1W H;  5M3M G;  4BBR G;  5H1S E;  4JI5 L;  2VS1 A;  5IYC H;  2R93 G;  3S24 A;  4MZ9 A;  1C7Y A;  2UU9 L;  3GD7 A;  1XPR A;  4DAM A;  2RHS B;  2JA8 H;  3K0X A;  4ME3 A;  4BBS G;  1VQA A;  3PUZ A;  2ZJR A;  2HT1 A;  2GVA A;  2K52 A;  2ZTE A;  3DM3 A;  3KLW A;  2R7D A;  5M5X H;  4HJA A;  4JI3 Q;  4LF9 L;  1KXL A;  4JI0 L;  4DR2 Q;  1DGS A;  3UDX A;  4UPA A;  2WB1 G;  3CCV A;  1HR0 Q;  3FP9 A;  5IP7 G;  1X56 A;  1OXT A;  1TWH H;  4JYA L;  1EIF A;  4QGU A;  1H95 A;  1XJV A;  1N9W A;  3AFQ A;  4YHH Q;  4NXN Q;  4X66 Q;  4LF8 L;  3PSI A;  1I94 Q;  4A3D G;  4JV5 Q;  3PUW A;  4DUY Q;  4A3L G;  3FHW A;  2N49 A;  4A75 A;  4A3M G;  1YZ6 A;  1K83 H;  1QZG A;  1WYD A;  3NEM A;  5M5W H;  3AYH B;  4R1J A;  4DV3 L;  2KHJ A;  4IJH A;  5HY6 A;  4GNX C;  2JEA I;  3AEV A;  4WJ3 M;  3L7Z C;  3I55 A;  3HOX G;  1L2F A;  2JK8 A;  5LMU Q;  2K75 A;  4BXX H;  2E5L Q;  3HKS A;  3M7N A;  4GLV B;  1WI5 A;  3CC2 A;  5AJ3 Q;  1XPO A;  4UY8 C;  2WP8 J;  3CXC A;  5JEA G;  3PCO B;  3GTQ H;  2EQS A;  3NEL A;  1IBM Q;  1PYS B;  1NTG A;  4OWT B;  2YV5 A;  4DAY B;  4B3M L;  3H0G H;  2LXJ A;  4DR5 L;  1MJE A;  4JI6 Q;  4JI1 L;  3CAM A;  3CCQ A;  2ASB A;  2JA6 G;  4YY3 L;  3HOW H;  1AE3 A;  1NJI C;  1VQJ A;  4PMW A;  4LF5 L;  1L1O B;  3W5O A;  2RCN A;  1YEZ A;  3PF4 A;  3A0J A;  2F3I A;  4GNX A;  4LF6 L;  3LGJ A;  4X65 Q;  1U0L A;  3STB C;  3HOZ G;  4UP9 A;  1VQI A;  5C0X G;  5LMN Q;  1VQK A;  4WJ4 A;  1TXY A;  4DV0 L;  2MFI A;  3I2Z A;  4PZ6 A;  3AFP A;  5C4X H;  3I4O A;  3K7A H;  5IY0 A;  4B3S Q;  3OTO L;  3I56 A;  1IYJ B;  1AE2 A;  1N34 L;  1EYG A;  4DR7 Q;  2R7F A;  3GTO H;  2YTX A;  1UE5 A;  4LUO A;  1Y1V H;  1Y14 B;  1VQ7 A;  3A5U A;  4P74 A;  1PVO A;  2K5H A;  5IE8 A;  3VDY A;  2JA9 A;  3L0O A;  1Q1E A;  1HNW Q;  2ALY B;  3S1R H;  4DV2 Q;  1VQE A;  2LSS A;  3DLL A;  2ZJQ A;  3PO2 H;  4IPH A;  1WJJ A;  2JEB I;  1N33 L;  3M9B A;  2CWA A;  1S72 A;  4IOA A;  4JI8 L;  3PUX A;  3J81 i;  4AYB G;  4J15 A;  4A3J H;  5IP9 H;  5BR8 Q;  1E3P A;  5EAY A;  2MO0 A;  1Q81 C;  1PFS A;  1IBK L;  2HHH Q;  1K3R A;  3S1N H;  2B3G A;  4X64 Q;  3RLN A;  2A1A A;  1HZB A;  3U4V A;  1XMQ Q;  3HOY G;  1V1Q A;  1Q86 C;  2AKW B;  5IWA L;  1XPU A;  3U50 C;  1VQ4 A;  4DR4 L;  1L0W A;  1PH9 A;  4AYB E;  2N3S A;  4LF7 Q;  4LFA L;  3I4M H;  1E1T A;  1IBL L;  2VY3 A;  2ATW A;  1X65 A;  4NB3 A;  2Y0S G;  2Z6K C;  5FJ8 H;  2F52 A;  5DLQ E;  2B63 H;  4A3E H;  4OWX B;  2R7Z G;  4DPG A;  3PO3 H;  1HH2 P;  3UDG A;  2VW9 A;  1PH7 A;  3TS2 A;  4A3G G;  1PH5 A;  1NY4 A;  5JEA J;  3CC7 A;  3UDF A;  4IOC A;  4L5R C;  1FGU A;  1VQB A;  1BBU A;  1C0A A;  4POF A;  1WCM H;  2L15 A;  2ZM6 L;  1C9O A;  1M90 C;  2PQA B;  1YVC A;  3KJO A;  1HZC A;  3J80 c;  1XMO Q;  3BZK A;  3KF6 A;  1VQ5 A;  5IYD H;  3TRE A;  1CSP A;  1LM0 A;  1W3S A;  2K4K A;  4C3J H;  5HGQ A;  3T1Y Q;  2CFM A;  3T1H Q;  1KD1 C;  5M3F H;  2VQF Q;  4R4O A;  1V9P A;  1VQM A;  3J7A 5;  3STB D;  2Z6K A;  2K14 A;  3HKZ G;  2UUC Q;  1B8A A;  1IXR A;  1K0R A;  1X9N A;  4KI0 A;  2KBN A;  3PO2 G;  2PI2 E;  1J5E Q;  2OTL A;  2MNA A;  4DV4 Q;  3CC4 A;  3PV0 A;  1BKB A;  4QY7 A;  3ULL A;  4POG A;  3CCE A;  2BH2 A;  4OO1 G;  5GAD C;  5GRO A;  4EQ5 A;  1JJC B;  1X54 A;  3HKZ E;  1YHQ A;  4JBW A;  4DV6 Q;  4IFD I;  1JB7 A;  2IHE A;  4P75 A;  4JI3 L;  1OXS C;  2B29 A;  1QUQ B;  2PI2 A;  2VNU D;  4JBM A;  3MXN B;  4PZ8 A;  4DR2 L;  1PH6 A;  1SFO H;  4DR3 Q;  3FKI G;  3KFU A;  2ID0 A;  1KQS A;  1HR0 L;  4DUZ Q;  1A63 A;  2YTV A;  4GOP B;  4A3F G;  4A3K G;  1VQ8 A;  3EBE A;  4MNO A;  3U4Z A;  4TQU S;  4KHP Q;  4YHH L;  2H5X A;  4A93 H;  4GS3 A;  3PIO A;  1I94 L;  4JV5 L;  4QIW E;  4IJL A;  4GN4 B;  1Z47 A;  4DUY L;  3GDE A;  4KLK A;  1HNX Q;  2NVX H;  2UUB Q;  4BY7 H;  1E7Z A;  3S2D H;  3HOU G;  4B3T Q;  4DV5 Q;  2LXK A;  2I5H A;  1SLJ A;  2HQL A;  3ZJY C;  1EFW A;  3CME A;  4JI7 Q;  1JJG A;  2GN5 A;  4OON A;  2QGQ A;  4HJ8 A;  1UEB A;  1YNX A;  1Z9F A;  2VUM G;  1GVP A;  3GTM H;  1BVS A;  4DNI A;  5IYB G;  1FL0 A;  2WB1 E;  2I5M X;  3ERS X;  1OXV A;  5LMU L;  3GTJ H;  2E5L L;  3J7Z C;  4HJ5 A;  4IPC A;  5ELO A;  3GTG H;  1RL2 A;  1NBW A;  4JOI C;  1YIJ A;  5AJ3 L;  4OWW B;  1RIP A;  3Q8D A;  2QEX A;  4A3I H;  1IBM L;  5ELN A;  3SGI A;  2RF4 A;  4JI6 L;  4GKK Q;  2YYZ A;  1PHJ A;  1XNQ Q;  2HIV A;  3CCR A;  1UE1 A;  1K9M C;  5C4J H;  1M1K C;  3M85 A;  2IHF A;  1IL2 A;  3CMA A;  4R4C A;  1JMC A;  2XTI A;  1HR0 W;  4QQB X;  3PIP A;  1ASY A;  4X65 L;  1KL9 A;  5IT9 c;  3J81 j;  1Y1W G;  4UP8 A;  2Q2T A;  5LMN L;  1X6O A;  5IYC G;  2JA7 H;  2Q2I A;  1Q7Y C;  1U5K A;  4LW1 A;  3S1Q H;  4JOI A;  4B3S L;  2JA8 G;  3E9H A;  4DK3 C;  3W1G A;  1N32 Q;  3CPF A;  4OX9 Q;  3RZO H;  4DR7 L;  1R9T H;  1YJN A;  1GD7 A;  1NMG A;  4DKA C;  3CCS A;  4AQY Q;  1PH2 A;  2EXD A;  1VQ9 A;  4XIG S;  2A19 A;  5C3E H;  1KIX A;  1HNW L;  2CWP A;  4X6A H;  2VQE Q;  4DV2 L;  1SMX A;  1MKH A;  1VQD A;  4EX5 A;  4AIM A;  4OXP A;  4H02 A;  1OXU A;  3S17 H;  1YJW A;  1CKN B;  2F4V Q;  1X3G A;  4NXM Q;  2A8V A;  3CCL A;  5JJK A;  1HNZ Q;  4X62 Q;  5C44 H;  4A4I A;  1HZ9 A;  5BR8 L;  3W1B A;  4IO9 A;  2VL6 A;  3IRB A;  2E2H H;  2HHH L;  4MTN A;  4X64 L;  1G6P A;  2Z0S A;  1B7Y B;  3PUY A;  4DV7 Q;  1XMQ L;  1JJ2 A;  3HOV G;  4YWL A;  5GAG C;  3NEN A;  3M3Y H;  2NN6 I;  3CPW A;  2Q2U A;  1VQC A;  2NZO A;  1YJ9 A;  4LF7 L;  4BXX G;  2I0Q A;  4RG1 A;  3CP0 A;  5LMN W;  2IT1 A;  2KCM A;  1EUJ A;  1XTD A;  4AH6 A;  2PQA A;  2V1C C;  3OYY A;  3RN2 A;  1K8A C;  3M4Q A;  4JI4 Q;  2K5V A;  2UXC L;  2JQO A;  3H0G G;  4YWM A;  4DV0 Q;  1CSQ A;  5GAE C;  3GTK H;  3HOV H;  3KYH C;  1YIT A;  3HOW G;  2UXD Q;  3JC6 6;  4GLA C;  4GKJ Q;  2AWN A;  4LWC A;  1XMO L;  2OCE A;  2DUD A;  3I4N H;  4A3B H;  3ULP A;  1SRU A;  3T1Y L;  1NMF A;  3T1H L;  2BA1 A;  4P71 A;  3ICE A;  2UUA Q;  2VQF L;  2Y0S E;  5JJI A;  1X3E A;  4HID A;  4DR1 Q;  4BY1 H;  2RHQ B;  5M3M H;  1B70 B;  4BBR H;  3G6E A;  3E9I A;  5C4X G;  3BZC A;  3K7U C;  3K80 C;  3S16 H;  2R93 H;  3NBH B;  1YHA A;  2ZJP A;  2WFW A;  3M4P A;  4DV4 L;  4LFB Q;  4JBK A;  4BBS H;  1BBW A;  1YHB A;  1Y1V G;  3A5Z B;  4GOP A;  5C0X J;  4DV6 L;  1UWV A;  2Q2H A;  1QVG A;  3I7F A;  3S15 H;  4PZ7 A;  1E24 A;  3WWV A;  5IP7 H;  1A8V A;  4DR3 L;  4O0A A;  4A3D H;  2UXB Q;  4DUZ L;  4K0K Q;  1S3O A;  1KRS A;  4DV1 Q;  4A3J G;  5IP9 G;  1E1O A;  2OQ0 A;  4HIO A;  4APV A;  3S14 H;  4A3M H;  4A3L H;  1Q82 C;  1OTC A;  4B3R Q;  2CCZ A;  3CQZ H;  3K81 C;  3RZD H;  4LFC Q;  4DR6 Q;  2UUB L;  4LF4 Q;  1S40 A;  4GN5 A;  4IPG A;  2N78 A;  1HNX L;  3UE0 A;  3ULJ A;  4DV5 L;  3I4M G;  3U58 A;  3F2D A;  4R4T A;  4JI7 L;  1L1O C;  1EWI A;  1HZA A;  3HOX H;  4NXN L;  5FJ8 G;  1VQH A;  3KDF B;  4X66 L;  1YI2 A;  1I5F A;  2B63 G;  2NN6 G;  4A3E G;  2WAQ G;  3PO3 G;  2KHI A;  1N36 Q;  2YU9 H;  4L5Q A;  3G48 A;  1PV4 A;  4YCV A;  3J80 i;  1W2B A;  4LUZ A;  1T9H A;  1FJG Q;  4P72 A;  1LYL A;  1XNR Q;  1WCM G;  1A62 A;  1Q8K A;  4JCV E;  3TQY A;  2WAQ E;  5GAH C;  1VQN A;  1QVC A;  3G71 A;  4JI2 Q;  5IYD G;  2QA4 A;  4FDB A;  2E8G A;  2ES2 A;  2JJQ A;  2JA6 H;  4GKK L;  3BJU A;  1IZ6 A;  1XNQ L;  1EOV A;  3TS0 A;  1QZH A;  3D0F A;  1KC8 C;  5FLM H;  3F8T A;  1QVF A;  3KJP A;  5M3F G;  4BA1 I;  2D0O A;  1L1O A;  3HOZ H;  3D31 A;  2NVT H;  1X55 A;  4JI5 Q;  4P73 A;  1EQQ A;  1Q1B A;  1X3F A;  5E7N A;  3CF5 A;  4GLX A;  2UU9 Q;  3RLF A;  1PYB A;  4JBJ A;  1N8R C;  2FXQ A;  3KF8 B;  4BA2 I;  2IX1 A;  1PH1 A;  3RLO A;  1D7Q A;  2C35 B;  2XGT A;  4LF9 Q;  3S1M H;  4HJ9 A;  4JI0 Q;  1N32 L;  1SR3 A;  3H15 A;  4OX9 L;  1CUK A;  2DGY A;  1CKN A;  3GO5 A;  4ALP A;  4AQY L;  3EIV A;  1PH4 A;  4JYA Q;  2IY5 B;  5J3B A;  1KAW A;  2D0P A;  4LF8 Q;  3CCU A;  2AHO B;  1MIU A;  3F1Z A;  1G29 1;  2VQE L;  1I6H H;  2KCT A;  2JA5 H;  4A3C H;  2JE6 I;  4A93 G;  1MJC A;  1OXX K;  2F4V L;  1TWF H;  4NXM L;  4RMF A;  4IFD G;  3G4S A;  2ZTC A;  1HNZ L;  4X62 L;  4DV3 Q;  4BY7 G;  3KOJ A;  2ZTD A;  1VCI A;  3J81 c;  1K8G A;  3HOY H;  4R4I A;  1PA6 A;  4QJF A;  3PGZ A;  1VQP A;  4LNQ A;  3AQQ A;  5FLX c;  3RNU A;  5GQO A;  4DV7 L;  3K8A A;  3TEH B;  2R7Z H;  4JC0 A;  3F2C A;  1A0I A;  5FLM G;  1I50 H;  4B3M Q;  3TRZ A;  1FVI A;  3BU2 A;  4A3G H;  3EN2 A;  4DR5 Q;  1GM5 A;  4HJ7 A;  1WOC A;  4JI1 Q;  4A3I G;  2OTJ A;  1VQF A;  2VZA A;  1KHI A;  4YY3 Q;  4JI4 L;  1CKO A;  4LUV A;  4LF5 Q;  3M4O H;  4C3I H;  3GTP H;  2I5L X;  2NVY H;  4LF6 Q;  4OO1 I;  1VQL A;  2UXD L;  2BA0 A;  3CCJ A;  4QL5 A;  2R6G A;  1EIY B;  4Y52 H;  2N8N A;  2EIF A;  4GKJ L;  3H3V I;  4L5S A;  1D8L A;  4UP7 A;  4PG3 A;  2CQO A;  2IX0 A;  1VQ6 A;  1UE7 A;  1SN8 A;  1YBY A;  4GN3 B;  2R92 H;  4HIK A;  3OTO Q;  1ASZ A;  4GNX B;  4GOP C;  2UUA L;  4YCW A;  1E22 A;  1N34 Q;  2JA7 G;  2E2I H;  4DR1 L;  4A76 A;  1P16 A;  3CW2 C;  3UDI A;  2NVQ H;  2PNH A;  1Q12 A;  1HJP A;  3F2B A;  1GO3 E;  3OW2 A;  3CD6 A;  4L5T A;  2JA5 G;  1PH3 A;  4A3C G;  4LFB L;  3HFZ B;  4KHZ A;  3H3V H;  1I3Q H;  2AWO A;  4NPS A;  3RR5 A;  1CKM A;  1GKH A;  3RN5 A;  3CCM A;  5C3E G;  3A74 A;  2BH8 A;  2UUC L;  1N33 Q;  2OQK A;  5M5Y H;  3JAM c;  3FKI H;  1J5E L;  4JI8 Q;  1LTL A;  4A3F H;  1QUQ A;  4A3K H;  1V43 A;  1VS0 A;  1TWG H;  1JE5 A;  4O2D A;  3PUV A;  1EQR A;  1IBK Q;  1PH8 A;  2UXB L;  3B6Y A;  4K0K L;  1UE6 A;  2PMZ E;  5C44 G;  4DV1 L;  1WFQ A;  3S2H H;  4IPD A;  4IFD J;  4C2M H;  5IWA Q;  3HOU H;  4DR4 Q;  3KDF A;  4B3R L;  2MQH A;  2UXC Q;  4LFA Q;  1SE8 A;  4LFC L;  4DR6 L;  1IBL Q;  1K73 C;  1LUZ A;  2KEN A;  2MO1 A;  2CKZ B;  4LF4 L; 
#chains in the Genus database with same CATH topology
 4U67 3;  2NTT A;  3GTL H;  5D65 A;  3S1M B;  1SDF A;  1HXY D;  4KHP L;  2B2T A;  2H4O A;  3MEF A;  3PF5 A;  5EBD A;  3DEO A;  4FXG C;  4BWG B;  3C3L A;  1F9R A;  4Y7N H;  3URY A;  5EPL A;  2OWO A;  3DMU A;  1B50 A;  3SEB A;  4K6L A;  3FPU B;  3TZU A;  4JI2 L;  1J6Q A;  3TP6 A;  5A2Q L;  2PW5 A;  5JJL A;  3U9O A;  4N8X 1;  1P8L A;  5DEH A;  4BY1 G;  1Y1W H;  5M3M G;  2EYO A;  1WTH A;  4QMG A;  5FLX E;  5C44 B;  4DAM A;  1O7L A;  2RHS B;  3K0X A;  2ZJR A;  2HT1 A;  2GVA A;  1C48 A;  5ELE A;  1DGS A;  1MBY A;  2WB1 G;  3OSO A;  5BN3 A;  1X56 A;  1EIF A;  4QGU A;  4IUU A;  3MVV A;  1N9W A;  1H95 A;  2B8G A;  4X66 Q;  3PSI A;  4HMI A;  1LTA D;  2V4D A;  3D8G A;  1QWY A;  1YZ6 A;  1QZG A;  3MHB A;  1Q8I A;  3WOE A;  4GNX C;  4K8I A;  3AEV A;  2NVQ B;  5KGU A;  3L7Z C;  5TSS A;  2JK8 A;  3I4N B;  4DAP A;  4UY8 C;  2B2Y A;  5JEA G;  1IKM A;  3MC0 B;  3NTK A;  2N55 A;  2X6G A;  4QIW B;  4FF1 A;  3NWS A;  2LXJ A;  2MGS A;  4NMZ A;  1S4Z A;  5JOB A;  3VR4 A;  1GUT A;  1AE3 A;  1NJI C;  2A6H C;  4LF5 L;  2RCN A;  2L5T A;  2A5H A;  2D5D A;  1DM0 B;  3K57 A;  5CR3 A;  3HOU B;  3STB C;  4UP9 A;  1VQI A;  2PW7 A;  1STG A;  3V05 A;  5I6Y A;  4A3D B;  3I2Z A;  4PZ6 A;  3HG9 A;  4IUP A;  4B3S Q;  4HAE A;  1G2S A;  1IYJ B;  4OIJ A;  3I56 A;  1N34 L;  1EYG A;  2DY7 A;  1SNM A;  4ZRZ A;  2F0D A;  4LUO A;  1STB A;  1A3T A;  1ONL A;  3L0O A;  2ALY B;  3KK7 A;  3S1R H;  5DM6 3;  4DV2 Q;  1ZYR C;  1WJJ A;  2JEB I;  3IL8 A;  1S5B D;  2QIL A;  4H13 C;  2XIW A;  2CWA A;  1D1K A;  3J81 i;  3PUX A;  3T13 A;  3V96 A;  3OWF A;  4J15 A;  2E2J B;  5IP9 H;  5BR8 Q;  1E3P A;  5EAY A;  1AW7 A;  1I4X A;  2CHB D;  2F0H A;  1Q81 C;  1PFS A;  1QOH A;  3S1N H;  2RDG A;  1HZB A;  4YIJ A;  1XMQ Q;  1Q86 C;  5IWA L;  4DR4 L;  3BDL A;  4RCN A;  2ATW A;  2C5C A;  4DPG A;  3UDG A;  2VW9 A;  3DWA A;  2NVT B;  4A3G G;  1PH5 A;  5JEA J;  5CMD A;  4L5R C;  1VQB A;  5KYI A;  1C0A A;  1Y8O B;  2B2W A;  1QCB D;  4HMJ A;  1C9O A;  1M90 C;  1VF5 C;  1QJO A;  3TRE A;  1KTK A;  2A6H D;  1LM0 A;  2L55 A;  3R2T A;  2K4K A;  1BR9 A;  1KD1 C;  4X3K A;  3MXU A;  1V9P A;  3J7A 5;  3STB D;  3MWY W;  4RGM A;  2UUC Q;  1B8A A;  1IXR A;  4OGQ C;  1PZI D;  2PI2 E;  1J5E Q;  2MNA A;  1SNC A;  1EEF D;  2NZ1 D;  4ABN A;  4OO1 G;  1I4P A;  1H9S B;  1X54 A;  3HOY B;  4IFD I;  1TS4 A;  2FJ2 A;  4P75 A;  3N52 A;  4JI3 L;  1OXS C;  3J7A F;  1QUQ B;  5G3L D;  2PI2 A;  2VNU D;  1PH6 A;  4PZ8 A;  1ZYR D;  5KNC A;  4DUZ Q;  2YTV A;  4A3K G;  1CT1 D;  3EBE A;  2R7Z B;  1X3Q A;  2AQ2 B;  1I94 L;  4JV5 L;  4QIW E;  4GN4 B;  1Z47 A;  4DUY L;  3GDE A;  4KLK A;  1D5M C;  3S2D H;  3HOU G;  2I07 B;  2LXK A;  1JJG A;  2GN5 A;  4RFB A;  2QGQ A;  4HR7 B;  1YNX A;  2NVY B;  5HGT A;  1BVS A;  1Y69 U;  1PRT B;  4RAU C;  1Y1V B;  1F2M A;  5ELO A;  2KED A;  1NBW A;  1DCZ A;  1TT2 A;  5AJ3 L;  1YIJ A;  4OWW B;  3PO2 B;  4NKL A;  3T53 B;  3QIA A;  3G6J B;  4QUC A;  3SGI A;  1AEX A;  4JI6 L;  1BCP B;  4GKK Q;  5EKL A;  3M85 A;  4PMB A;  1IL2 A;  1JMC A;  4F88 A;  3K5N A;  3PIP A;  5M5Y B;  2WAC A;  5IT9 c;  4RGT A;  3MFY A;  1B2T A;  5F2D A;  1U5K A;  3BVG A;  3BZD B;  3MXP A;  2WIN B;  3E9H A;  4OX9 Q;  3RZO H;  4DR7 L;  1NMG A;  3T4A C;  3TP5 A;  2A19 A;  1HNW L;  2H1E A;  5LL6 X;  2F1M A;  1OXU A;  1YJW A;  4ZUI A;  4C3J B;  2A8V A;  2EYP A;  1CQF A;  2OXP A;  1MI2 A;  4X62 Q;  2EY1 A;  1HZ9 A;  4Y7N B;  2WII B;  2XWB B;  2E2H H;  2HHH L;  4MTN A;  4X64 L;  1G6P A;  2Z0S A;  4DV7 Q;  1JJ2 A;  2D2C C;  4M1U B;  5EQ0 A;  4K2L A;  4BXX G;  2A69 C;  4RG1 A;  5IOD A;  2IT1 A;  1EUJ A;  1Y1W B;  3LNN A;  3OYY A;  2K5V A;  1PFB A;  4DV0 Q;  4MHE A;  1CSQ A;  2NB0 A;  3GTK H;  2MPM A;  2XN9 C;  1V1P B;  3JC6 6;  4GKJ Q;  2AWN A;  2NBF A;  2CVR A;  4BY7 B;  2OT2 A;  3T1Y L;  1NMF A;  4FYD A;  2UUA Q;  2VQF L;  4FO2 A;  4HID A;  4BY1 H;  2RHQ B;  5M3M H;  3ERO A;  1H9S A;  3E9I A;  3BZC A;  1YHA A;  2K32 A;  1IL8 A;  1BNZ A;  4JVZ A;  1Y1V G;  2EY6 A;  3A5Z B;  2Q8T A;  1ZEQ X;  4DV6 L;  1QVG A;  2F0K A;  3WWV A;  1PFM A;  2OEO A;  1ICW A;  1IHZ A;  4APV A;  1Q82 C;  2M00 A;  2MJ8 A;  4DR6 Q;  1T5E A;  2UUB L;  4LF4 Q;  1HNX L;  2L4N A;  4GN5 A;  4IPG A;  1HHV A;  3I4L A;  3BS1 A;  3I4M G;  2F3V A;  3U58 A;  1SNQ A;  5FJ8 G;  4X66 L;  1YI2 A;  1V1O A;  2G9D A;  3SK4 A;  4CKC A;  2EYJ A;  2A69 D;  2KHI A;  3NQT A;  2YU9 H;  1PV4 A;  5JEA H;  4YCV A;  3J80 i;  2PMZ B;  2CW0 C;  3OMC A;  3TBI B;  1TR5 A;  1A62 A;  1Q8K A;  2B39 A;  4JI2 Q;  5IYD G;  4FDB A;  2E8G A;  4B08 A;  2JJQ A;  3BJU A;  4RKB A;  1QZH A;  1KC8 C;  3KJP A;  3S1R B;  5D3I B;  1L1O A;  4CKE A;  4P73 A;  1E2V A;  1WTQ A;  5ELB A;  3CF5 A;  4DFA A;  1N8R C;  3KF8 B;  1FNU A;  1ENF A;  1QIL A;  2IX1 A;  2C35 B;  3S1N B;  2XGT A;  4F8M A;  2PQE A;  3S1M H;  4HJ9 A;  1SMY C;  1RHP A;  2F0N A;  2QEJ C;  3S9W A;  1FYC A;  2F0W A;  1PH4 A;  2IY5 B;  3A8I E;  3HOV B;  5D3D A;  3F1Z A;  1HQR D;  1RD9 D;  2VQE L;  1JWU D;  3VYT A;  1GXD C;  3EJI A;  1HPC A;  2F4V L;  3GV6 A;  4NXM L;  4RMF A;  4BY7 G;  3KOJ A;  1WVL A;  1KDC A;  1VCI A;  5BN5 A;  4BBR B;  1EYA A;  1VQP A;  4LNQ A;  3S16 B;  3Q0A A;  1T5X D;  3TEH B;  2PO4 A;  1WTV A;  4A3G H;  5DNF A;  3BU2 A;  2CW0 D;  5I6W A;  1VQF A;  4EQO A;  4JI4 L;  4LF5 Q;  1E0B A;  2E2D C;  3QOL A;  2B2U A;  3CCJ A;  1EIY B;  4V0B A;  3O13 A;  1D8L A;  5JVG 3;  2JP1 A;  1YBY A;  5J39 A;  2QW7 A;  1E22 A;  1N34 Q;  2JA7 G;  1P16 A;  3UDI A;  2NVQ H;  1JB3 A;  3P7J A;  4FF4 A;  1ROD A;  1Q12 A;  3F2B A;  3NWT A;  3OW2 A;  4OO1 H;  2VB3 X;  5LL6 S;  3CD6 A;  4OEM B;  2QCP X;  1CKM A;  5C3X A;  3D4D A;  1EQV A;  1K8M A;  2UUC L;  2B2T C;  4EVO A;  1J5E L;  4KY5 A;  4A3K H;  1V43 A;  1D1I A;  1TWG H;  3PUV A;  3X3M A;  3SR1 A;  1PH8 A;  4K0K L;  2PMZ E;  4X3T A;  5EBC A;  1MD2 D;  5IWA Q;  3HOZ B;  3HOU H;  4DR4 Q;  4B3R L;  4CDD C;  2MQH A;  2QDB A;  3SK6 A;  1B70 B;  3I70 A;  5FO8 B;  1JT8 A;  2F0G A;  2F0I A;  4DK0 A;  4JPB W;  3D6C A;  1Q3L A;  2K1B A;  1N36 L;  2AUJ D;  5FKA C;  3M4Y A;  3ER0 A;  1EZ8 A;  5G3L F;  1PZJ D;  3N6R A;  1CZG A;  1VQO A;  1XNR L;  3RZO B;  4YCU A;  2JA5 B;  4R4Q A;  3KBX A;  2E2J H;  1TWF B;  5C0X I;  3KF8 A;  4HCS A;  2HIX A;  1JOO A;  3J81 E;  4BBR G;  2RA4 A;  2VXW A;  2VS1 A;  2Z9H A;  3C2P A;  3GD7 A;  4MN3 A;  2DNE A;  4WOR A;  1QG7 A;  4ME3 A;  4BBS G;  1VQA A;  2K52 A;  3KLW A;  4JI3 Q;  2R7D A;  5M5X H;  4LF9 L;  1KXL A;  3FRP B;  4JI0 L;  3CCV A;  2HDL A;  3FP9 A;  4DK1 A;  4JYA L;  3GTP B;  1XJV A;  4NXN Q;  1I94 Q;  4JV5 Q;  5FO9 B;  4DUY Q;  4A3L G;  4A75 A;  1D5X C;  1LO5 D;  1K83 H;  1BUV T;  1QE6 A;  3HKZ B;  3AYH B;  1YNN D;  4R1J A;  4N9T A;  1B4O A;  2KHJ A;  1K3B C;  4IJH A;  5HY6 A;  2JEA I;  4QCL A;  1L2F A;  2IPK D;  5C6A A;  2K75 A;  4BXX H;  2X6L A;  3M7N A;  4GLV B;  2FMM A;  1WI5 A;  2MP1 A;  3NXW A;  1I3Q B;  5AJ3 Q;  3MAQ A;  3CXC A;  1M8A A;  4BY1 B;  2EQS A;  2DNC A;  2YV5 A;  4JI6 Q;  1MJE A;  4DR5 L;  4DU9 A;  4JI1 L;  1EZ6 A;  3CAM A;  4KD3 A;  3CCQ A;  2ASB A;  2JA6 G;  3E6Z X;  2J4X A;  1TS5 A;  3I3C A;  4LF6 L;  3LGJ A;  2WB1 B;  5CV9 A;  3HOZ G;  5COR A;  5C0X G;  4WJ4 A;  1SNP A;  2FFK B;  4DV0 L;  5JJZ A;  3AFP A;  5IY0 A;  3I4O A;  4ZKC B;  5A2Q E;  4DR7 Q;  1SXT A;  2TMP A;  2O5J C;  5I9O A;  1Y1V H;  1VQ7 A;  1HA5 A;  2K5H A;  1EFI D;  2JA9 A;  4IZ8 A;  2EY2 A;  1HNW Q;  1CHQ D;  2R61 A;  1VQE A;  2ZJQ A;  3PO2 H;  1S72 A;  5EPK A;  2YU9 B;  3E0J A;  2E75 C;  1IBK L;  2HHH Q;  1K3R A;  2B3G A;  4TSS A;  4X64 Q;  1JOQ A;  2A1A A;  2K04 A;  5A35 A;  3I4M H;  4LFA L;  3TZD A;  2VY3 A;  1UAP A;  4NB3 A;  5FJ8 H;  1PTO D;  3VR5 A;  4B9W A;  4DXG A;  1PH7 A;  5FO7 B;  1TKW B;  1DD2 A;  1KLU D;  1BBU A;  2ZM6 L;  2PQA B;  5IYD H;  1HZC A;  2K03 A;  4CBV A;  3BZK A;  1VQ5 A;  3EQL C;  4C3J H;  3T1Y Q;  2NTS A;  1F77 A;  2VQF Q;  4R4O A;  4LMQ D;  2XVS A;  2Z6K A;  2EYL A;  2K14 A;  3HKZ G;  1EL0 A;  1X9N A;  4DGZ A;  2O2L D;  5FOB B;  1ENA A;  1VMC A;  3TSS A;  3CC4 A;  1BKB A;  3ULL A;  5IGG A;  1UNS A;  3CCE A;  1WD1 A;  2BH2 A;  5GAD C;  3HKZ E;  4DV6 Q;  2SOB A;  2D9U A;  1JWM D;  3MFG A;  1TVX A;  4JBM A;  3VR6 A;  1SFO H;  3K5O A;  2EZV A;  1HR0 L;  1F2Y A;  1A63 A;  4L6T B;  1GUG A;  3KUP A;  2MUY A;  3U4Z A;  5IGC A;  4A3G B;  4YHH L;  4GS3 A;  5AFW A;  2UUB Q;  1HNX Q;  2R3Z A;  4C1N I;  1E7Z A;  4BY7 H;  4R9W A;  2VUM G;  1UEB A;  1MHW C;  4KKS A;  3GTM H;  4IQZ A;  2K33 A;  2WB1 E;  1OXV A;  4HSV A;  3NP8 A;  4XYO A;  2E5L L;  5I2X A;  3RUZ A;  1RIP A;  3Q8D A;  2QEX A;  3K6O A;  1IBM L;  3IAY A;  3SXH A;  2RF4 A;  1I4Q A;  3CCR A;  4ZKB B;  3L9A X;  3D4R A;  4E6I A;  2FIN B;  4QQB X;  4X65 L;  2F0L A;  2K5Q A;  4ZAI A;  4WRD A;  3SVM A;  4A3K B;  2Q2T A;  1TWG B;  2AQ3 B;  2JA7 H;  2F4I A;  1Q7Y C;  1JR0 D;  1SYD A;  4JOI A;  2WAQ B;  3QWN A;  3W1G A;  3CPF A;  3BVZ A;  4Z9C B;  1A2T A;  4L63 B;  2I46 A;  1QNU A;  2SDF A;  3TME A;  3CCS A;  1PH2 A;  2EXD A;  3OPO A;  4X6A H;  2ZT9 C;  2VQE Q;  3S17 H;  1J8I A;  1MKH A;  1B9N A;  2EYM A;  4OXP A;  1STY A;  4XT1 B;  2LS0 1;  5IT9 L;  1HFG A;  1CKN B;  2F4V Q;  3J80 E;  1LTS D;  2ICI A;  4NXM Q;  5M3F B;  4KMU C;  1SYB A;  2VL6 A;  4MIU A;  5CV6 A;  3PUY A;  4YWL A;  3SE0 A;  4HSP A;  4XYQ A;  2L9H A;  1ENC A;  1XX8 A;  5CBA E;  2KCM A;  2MHV A;  4AH6 A;  2PQA A;  5FLX L;  1K8A C;  2CH4 W;  4JI4 Q;  4O1N A;  3H0G G;  2E74 C;  4YWM A;  1NSN S;  1EWC A;  3HOV H;  3MTS A;  3HOW G;  2NN6 H;  3QG1 A;  4GLA C;  2LKV A;  1EQT A;  5M5X B;  1XMO L;  4LWC A;  2OCE A;  1BDO A;  3ULP A;  3T1H L;  3QO2 A;  4BS9 A;  2BA1 A;  1X3E A;  1L0X B;  1EY6 A;  4BBR H;  3G6E A;  3S16 H;  1JCK B;  1ESR A;  3NBH B;  4DV4 L;  3FEW X;  1PRT C;  1K83 B;  4BBS H;  4CHT B;  1YHB A;  1HTP A;  3GTG B;  2HD3 A;  3OIQ A;  4XT3 B;  3RMH A;  1UWV A;  1LLR D;  1LTG D;  3DEP A;  1B9M A;  4UDU C;  1BCP C;  3IFD A;  4DR3 L;  5C4J B;  1U4R A;  4K0K Q;  1KRS A;  4J6H A;  3M7G A;  3H3V C;  1L0Y B;  4A3L H;  3P20 A;  4FXD A;  1OTC A;  3JAM L;  4B3R Q;  3CQZ H;  3ND9 A;  4RA8 A;  5ISR A;  2RCF A;  1S40 A;  3DUZ A;  3ULJ A;  3E3X A;  4JI7 L;  1L1O C;  1HZA A;  4NXN L;  3KLS X;  1EY0 A;  1I5F A;  1R9T B;  2WAQ G;  1N36 Q;  1LTR D;  3LWU A;  1W2B A;  1JOR A;  4LUZ A;  1XNR Q;  1WCM G;  3TQY A;  1H9M A;  2WAQ E;  5GAH C;  1LTB D;  1QVC A;  5DAU A;  4FF3 A;  4L8J A;  2JA6 H;  1TII D;  1XNQ L;  1KAB A;  3D0F A;  1SJE D;  4RH6 A;  5FLM H;  3F8T A;  1QVF A;  5M3F G;  1A6X A;  2D0O A;  4FF2 A;  3HOZ H;  5C0X H;  2KUM A;  3IKJ A;  1F9S A;  1ILQ A;  3W3A A;  1ILP A;  4JBJ A;  3OOC A;  4DN4 M;  3RLO A;  4KK7 A;  1LT3 D;  3BDC A;  4LF9 Q;  4JI0 Q;  1SR3 A;  4WJW A;  3MZ5 A;  2F0T A;  3I4M B;  1CKN A;  4JYA Q;  5KEE A;  3DXJ C;  2AHO B;  2RBM A;  1BCP D;  1WD0 A;  1G29 1;  1TY2 A;  2KCT A;  2JA5 H;  2JE6 I;  4A93 G;  1OXX K;  1EWH A;  4I7Z C;  1TWF H;  4CDC C;  4IFD G;  1SJH D;  2QF7 A;  2B2U C;  1K8G A;  1AZP A;  5FLX c;  3H09 A;  4RKL A;  4C56 C;  4PNY A;  3GV3 A;  3F2C A;  1A0I A;  4J1M A;  4DR5 Q;  4HJ7 A;  1WOC A;  4JI1 Q;  3VYU A;  2AUK A;  2OTJ A;  3NE5 B;  1Q90 A;  4KY7 A;  3GTP H;  2I5L X;  5CV4 A;  4LF6 Q;  1F2L A;  1VQL A;  3S14 B;  2BA0 A;  4A3M B;  2UXD L;  2R6G A;  2PPB C;  1U4L A;  2N8N A;  1CQV A;  3H3V I;  4L5S A;  3EFX D;  1SFO B;  4GN3 B;  1CTM A;  1ASZ A;  1STE A;  4GOP C;  4YCW A;  4PMC A;  4DR1 L;  1EYC A;  2LY7 A;  1FNV A;  1CFM A;  2PNH A;  1HJP A;  1PTO F;  3LWE A;  1PH3 A;  4A3C G;  4LFB L;  4KHZ A;  1NUC A;  1I3Q H;  2C9O A;  1Z7T A;  3RR5 A;  3RN5 A;  2KEC A;  1QNK A;  3GTM B;  4OHJ A;  3JAM c;  1HRJ A;  1LTL A;  1QUQ A;  3R8B A;  1W6J A;  1RTN A;  1IBK Q;  3B6Y A;  5DM7 3;  2F0F A;  1WFQ A;  4KJO A;  4IPD A;  4IFD J;  4O42 A;  1STA A;  4NP5 A;  4LFA Q;  4HCE A;  1K73 C;  1LUZ A;  2KEN A;  2CKZ B;  2VUM H;  3NPP A;  4XQQ A;  2AMC B;  4ZCK A;  2PNR C;  1B1Z A;  4JG2 A;  3A8K E;  1NE3 A;  1SRO A;  5T1I A;  3I91 A;  4CJ1 B;  1V8Q A;  3E0E A;  5EJW A;  3WOF A;  2JA7 B;  2GVB A;  2YTY A;  2ZM6 Q;  2ZXR A;  4XTC S;  1KRT A;  2NZH A;  4S3S A;  2R92 G;  1TWA H;  1FR3 A;  4DK6 C;  2D62 A;  1O7I A;  5K36 G;  1Q46 A;  1B44 D;  4I65 A;  4CDE C;  4H7B A;  1G51 A;  4A3B G;  2K5N A;  1RKN A;  2PZU A;  3JAM i;  4TVA B;  2HDM A;  3S17 B;  3OHX C;  1D6E C;  3NUC A;  3TDQ A;  3R3O A;  2R93 G;  3S24 A;  2G9H D;  4MZ9 A;  4UAI A;  2UU9 L;  3DM1 A;  3TP7 A;  3DM3 A;  3DWQ A;  4HJA A;  1GOZ A;  1PTO H;  3UDX A;  1HR0 Q;  2K5D A;  3MXG A;  2CQA A;  1R4P B;  1TWH H;  3M4O B;  3HGB A;  3AFQ A;  4YHH Q;  4LF8 L;  3PUW A;  4FVM A;  4A3M G;  4ZK9 B;  1B53 A;  4PV1 C;  2F0V A;  1XXG A;  2KVM A;  1WYD A;  1SE2 A;  1U4M A;  2QKI C;  3EVQ A;  2E2I B;  4WJ3 M;  2F0J A;  2E5L Q;  2EDG A;  3CC2 A;  3ONA B;  5J22 A;  2WP8 J;  1IKL A;  1BF4 A;  1IBM Q;  1PYS B;  4B3M L;  1GUS A;  3H0G H;  1LT4 D;  2BOS A;  4BBS B;  4YY3 L;  3HOW H;  4V19 0;  4CJ0 B;  1DOL A;  4KKT A;  1YEZ A;  3PF4 A;  2F3I A;  5T1G A;  4X65 Q;  1SE3 A;  3MA2 B;  2B8F A;  1V1P A;  1U0L A;  1DON A;  5IGE A;  1FD7 D;  4Q0F A;  5ELF A;  2XSC A;  2EJM A;  4QF4 A;  4ZUJ A;  3OTO L;  1CHP D;  4PQX A;  3GTO H;  2YTX A;  3CQZ B;  1Y14 B;  3A5U A;  4P74 A;  2KEE A;  5IE8 A;  1K8O A;  2LSS A;  2F0E A;  3DLL A;  4IPH A;  4XDX A;  2KJX A;  4X3S A;  3TP8 A;  1BBX C;  1S5D D;  1SMY D;  2MO0 A;  2EJF C;  5CGK A;  3RLN A;  3U4V A;  2F0U A;  4IUT A;  3U50 C;  1VQ4 A;  2JA6 B;  1ICF B;  4JW0 A;  1PH9 A;  2N3S A;  1BXT A;  2EOT A;  1IBL L;  1O7Z A;  2JA8 B;  1B3A A;  2Y0S G;  2Z6K C;  1VDZ A;  2F52 A;  5DLQ E;  4OWX B;  2L12 A;  3TS2 A;  4K8J A;  1NY4 A;  3CC7 A;  3UDF A;  3VR2 A;  4IUN A;  1A2U A;  4POF A;  1WCM H;  2L15 A;  3I8Z A;  2Z4I A;  3NTH A;  1AN8 A;  4JK1 C;  5E3F A;  3GQB A;  1KAA A;  4C3I G;  1XMO Q;  1O80 A;  4IUQ A;  1CSP A;  1W3S A;  4LJZ C;  3T1H Q;  5M3F H;  2DJG C;  1VQM A;  1S5F D;  4MTK A;  1M4V A;  5HUR A;  2KBN A;  2RVL A;  2OTL A;  4DV4 Q;  4POG A;  5GRO A;  4EQ5 A;  1JJC B;  1YHQ A;  4JBW A;  3GTQ B;  2FHT A;  1JB7 A;  4CKB A;  3FDT A;  3VYR A;  1G6Z A;  4C1N K;  1K0S A;  1BO0 A;  3IFT A;  3MXN B;  4DR2 L;  4DR3 Q;  3KFU A;  1E2Z A;  1KQS A;  2KA7 A;  4A3F G;  1UEA B;  3I73 A;  3NSW A;  1BQQ T;  4TQU S;  3K58 A;  2O4X A;  4A93 H;  4H0L C;  3GP7 A;  5E1F A;  3PIO A;  4IJL A;  4IFD H;  4B3T Q;  1X32 A;  1SLJ A;  1EFW A;  1EY7 A;  2B2Y C;  4JI7 Q;  1DXM A;  1EU4 A;  3K7A B;  1D5Z C;  5FK9 C;  1GVP A;  4DNI A;  2BCO A;  5IYB G;  1FL0 A;  5LMU L;  4EQN A;  4ILW A;  3J7Z C;  4HJ5 A;  4IPC A;  3GTG H;  4JOI C;  4RGO S;  4FP5 D;  3L3O C;  1WTX A;  1DYQ A;  2PZT A;  4C3H G;  2YYZ A;  1ML0 D;  1EEI D;  1XNQ Q;  3BG3 A;  4A3J B;  1SYC A;  1K9M C;  5C4J H;  1M1K C;  1HR0 W;  1XWE A;  1ASY A;  5KIX A;  1KL9 A;  4XXE A;  3J81 j;  4UP8 A;  3VA7 A;  5LMN L;  5IYC G;  4Q5V A;  4LW1 A;  2OF1 A;  2JA8 G;  4A3E B;  2KCN A;  1R9T H;  1YJN A;  2IL8 A;  1GD7 A;  1SYF A;  2KCC A;  1HTL D;  1VQ9 A;  2VUM B;  2JSO A;  1KIX A;  2CWP A;  1I4R A;  5CV8 A;  1FGB D;  1SMX A;  1VQD A;  4EX5 A;  4AIM A;  2JXM B;  1WTP A;  4WFN 3;  3E5S A;  2L1B A;  5K5P A;  1TWA B;  1R4Q B;  5GAG C;  1ZKO A;  1Y8P B;  3NEN A;  4LF7 L;  2Q2U A;  4F87 A;  1VQC A;  2NZO A;  1YJ9 A;  3M3Y H;  2B2W C;  2WV6 D;  3V2T A;  3J81 L;  3CP0 A;  1HUN A;  1PXU A;  3AB9 A;  2PYK A;  1ET6 A;  2V1C C;  4RGN A;  2Z1C A;  3OMG A;  2B2V A;  2JQO A;  5GAE C;  2PCF B;  1ESF A;  2SNM A;  3KYH C;  2IJ0 A;  2HUG A;  4G57 A;  3R93 A;  1YIT A;  2UXD Q;  5K36 H;  4K5X A;  4CJ2 C;  4XQJ A;  1PTO B;  2TSS A;  5CV7 A;  4A3B H;  1SRU A;  2L11 A;  4J8Q A;  4ZYS A;  2NVX B;  3FVQ A;  1MSH A;  2EJG C;  5JJI A;  3U9S A;  3ICE A;  2X69 A;  3BDO A;  1TWH B;  1WTW A;  1U9R A;  3H6M A;  4DR1 Q;  5C4X G;  3K7U C;  3K80 C;  4DA2 A;  2R93 H;  3M4P A;  4LFB Q;  4JBK A;  3GTJ B;  3MXN A;  4FNF A;  2F0S A;  5C0X J;  4TRD A;  3F2U A;  3A55 A;  1O78 A;  3I7F A;  3S15 H;  3CRK C;  4X3U A;  4A3J G;  1F9P A;  1E1O A;  2EYF A;  3T56 B;  3S14 H;  4A3M H;  1I4H A;  3PQI A;  3BYY B;  3H0G B;  3K81 C;  3RZD H;  1HUM A;  2N78 A;  5IT9 E;  3UE0 A;  4DV5 L;  3HOW B;  1HA6 A;  1XTC D;  3F2D A;  3S1Q B;  1EWI A;  1VQH A;  3KDF B;  2Q8R E;  2B63 G;  5C5L A;  3G7L A;  4A3E G;  3ZYY X;  3PO3 G;  5C4Z A;  4L5Q A;  1SND A;  2BE5 C;  5C3E B;  1T9H A;  4TKO B;  4P72 A;  1LYL A;  4ZLT F;  5JPN C;  4KTA A;  3GTO B;  3G71 A;  2ES2 A;  1EY9 A;  2G5D A;  5I2Y A;  4BA1 I;  3RD4 A;  3OIP A;  3NTI A;  1X55 A;  2BDN A;  1JWS D;  1X3F A;  3VR3 A;  5E7N A;  4GLX A;  2UU9 Q;  1EIH A;  1PYB A;  4KV6 A;  4BA2 I;  2FXQ A;  5JPM C;  3Q23 A;  1N32 L;  2EYH A;  3D3R A;  3H15 A;  3PIO 3;  1CA5 A;  3K59 A;  1CUK A;  2DGY A;  4AQY L;  4DNR B;  5J3B A;  5IGD A;  4LF8 Q;  3OWE B;  4ODG A;  1MIU A;  2RKS A;  1I6H H;  1MJC A;  1PFN A;  3A7A B;  3G4S A;  1HNZ L;  1WCM B;  2ZTD A;  4GZY C;  3J81 c;  1HFN A;  4ME5 A;  5IGB A;  4K14 A;  2BDO A;  3JAM E;  4RCO A;  2SNS A;  3QR8 A;  1PDQ A;  4B3M Q;  1FVI A;  3MEH A;  2BE5 D;  1PMR A;  1GM5 A;  4A3I G;  4K6D A;  2VZA A;  1KHI A;  4YY3 Q;  3I90 A;  4G4K A;  1CKO A;  4LUV A;  4N9P A;  3M4O H;  4C3I H;  1WTR A;  4CGY B;  3WDN A;  4DF7 A;  4OO1 I;  2EIF A;  1CA6 A;  4QB4 A;  4UP7 A;  4PG3 A;  1VQ6 A;  3SDZ A;  1SEB D;  1UE7 A;  1ET9 A;  3OTO Q;  4HIK A;  1Y8N B;  3R2I A;  4GNX B;  5IGF A;  2E2I H;  3HOX B;  4N8F A;  4A93 B;  5C3W A;  1A3U A;  1GO3 E;  4L5T A;  1RTO A;  1EY4 A;  1A15 A;  4XQN A;  3ND8 A;  1GKH A;  1DOK A;  5C3E G;  1CM9 A;  1CZW A;  2OQK A;  2F0Q A;  3H91 A;  1LTT D;  4A3F H;  1GUN A;  2WKC A;  1VS0 A;  1EQR A;  2UXB L;  2F3W A;  1UE6 A;  5C44 G;  4DV1 L;  4C2M H;  1VF7 A;  1EIG A;  3J7Y W;  3KDF A;  2UXC Q;  1G2T A;  4LFC L;  1IBL Q;  1EYD A;  1JE4 A;  5JVH 3;  3L2P A;  5IYB H;  4K5V A;  5IOC A;  2IW3 A;  2QDL A;  1VQG A;  2CH4 A;  1KNA A;  3CRL C;  5C4H A;  4IUV A;  4HIM A;  4B3T L;  3CKI B;  1TWC H;  4OIK A;  1FJG L;  4C3H H;  4H44 C;  3ERQ A;  5E4W C;  2HCC A;  1PZK D;  2L0C A;  4AYB B;  2K50 A;  3P75 A;  1SNO A;  3I4N G;  4YWK A;  4DAV A;  3UE1 A;  3KF6 B;  1AH9 A;  3J80 L;  4ZQ3 A;  5H1S E;  2EXZ A;  1B3Q A;  4JI5 L;  5IYC H;  5I4D A;  3FPP A;  1C7Y A;  1XPR A;  2JA8 H;  3PUZ A;  4KD4 A;  2EPB A;  2ZTE A;  1I50 B;  2XWJ B;  2EVB A;  5COY A;  4DR2 Q;  5KRU A;  1H9K A;  4UPA A;  1NR4 A;  1H9R A;  3M3Y B;  1E2W A;  5IP7 G;  1OXT A;  3C1F A;  4A3D G;  1PRT D;  3FHW A;  2N49 A;  3HRZ C;  2IWH A;  5M5W H;  3NEM A;  2R92 B;  4DV3 L;  1CI3 M;  1II3 A;  5J1Z A;  3VYS A;  3I55 A;  3HOX G;  4UHV A;  5LMU Q;  4A3B B;  1G8Z D;  2Z8L A;  2ZXP A;  3HKS A;  2RQX A;  2O5I C;  1HQM C;  3TN2 A;  3A8J E;  1XPO A;  1AZQ A;  3PCO B;  2VB2 X;  3GTQ H;  3NEL A;  1NTG A;  4OWT B;  4DAY B;  3FKI B;  2R93 B;  1JQY D;  3HZX A;  1IYV A;  3EA6 A;  3HP3 A;  1VQJ A;  4PMW A;  5M9O A;  1L1O B;  3W5O A;  1LV9 A;  1D2B A;  3A0J A;  1O7Y A;  3S2H B;  4GNX A;  4EQP A;  2PZW A;  3S15 B;  1CK1 A;  5CBE E;  5LMN Q;  1VQK A;  1PLF A;  4IAL A;  1TXY A;  2MFI A;  4KY6 A;  5C4X H;  1KNE A;  3K7A H;  3GTL B;  5E4X A;  1AE2 A;  4EGV A;  4OL7 A;  2R7F A;  1UE5 A;  3RZD B;  3NBH A;  1PVO A;  5LHY 1;  3VDY A;  1Q1E A;  1OO9 B;  3J7A V;  4F7X A;  1N33 L;  3M9B A;  3HS0 C;  4IOA A;  4JI8 L;  4A3J H;  4AYB G;  1C8C A;  2A6E C;  3D4W A;  4CDF C;  1WTO A;  2K28 A;  3HOY G;  1V1Q A;  1XPU A;  2AKW B;  1C4Q A;  2NWG A;  1NAP A;  1L0W A;  4AYB E;  4LF7 Q;  1E1T A;  1IYU A;  1X65 A;  2ENB A;  4B9X A;  2B63 H;  4NW2 A;  2A73 B;  5JAV A;  4A3E H;  2R7Z G;  3PO3 H;  1HH2 P;  2A68 C;  1AFP A;  4HED A;  1JOK A;  4DNT B;  2M2L A;  4IOC A;  1FGU A;  1JC7 A;  1Z6H A;  4KHV A;  5KND A;  1YNJ C;  3BVM A;  1YVC A;  3KJO A;  3J80 c;  5EKK A;  3KF6 A;  5HGQ A;  2CFM A;  5D14 A;  3NBI A;  3VA5 A;  1K0R A;  4KI0 A;  1I6H B;  3PO2 G;  1I4G A;  4DXF A;  2K7V A;  3PV0 A;  4QY7 A;  3KBG A;  3Q22 A;  1STH A;  2DY8 A;  3K5M A;  2M9V A;  2J0T D;  2IHE A;  1S5E D;  2B29 A;  3W2D A;  3LX0 A;  2JYO A;  4G7O C;  3FKI G;  2ID0 A;  2Y0S B;  4GOP B;  1VQ8 A;  4MNO A;  3OW7 A;  4KHP Q;  1FNW A;  2H5X A;  3KLR A;  5EGT A;  2NVX H;  2A6E D;  2EE1 A;  2A74 C;  4DV5 Q;  2I5H A;  2HQL A;  1AP0 A;  3ZJY C;  3CME A;  4C3I B;  4OON A;  4HJ8 A;  2FMC A;  1Z9F A;  1GHK A;  2SEB D;  3Q24 A;  3ERS X;  2I5M X;  4DAY A;  1MGS A;  3GTJ H;  2A68 D;  4C3J G;  4P2C B;  1RL2 A;  4A3I H;  3A54 A;  3SHL A;  5ELN A;  1YNJ D;  1TS3 A;  1PHJ A;  1PYW D;  2Z6B A;  1A3V A;  2HIV A;  2IX3 A;  1UE1 A;  2HCI A;  2K5W A;  2IHF A;  1NNX A;  3CMA A;  4R4C A;  2XTI A;  2F0M A;  3P1H A;  1Y1W G;  4A3F B;  1X6O A;  1EU3 A;  4R8N A;  2Q2I A;  3S1Q H;  1DJR D;  5BN4 A;  4B3S L;  4DK3 C;  1N32 Q;  4C2M B;  3HEJ A;  1NR2 A;  4DKA C;  4AQY Q;  4G7H C;  5ELC A;  1LT6 D;  1TS2 A;  4XIG S;  5C3E H;  5EKI A;  2DN8 A;  4DV2 L;  4H02 A;  5CC4 A;  1LT5 D;  1X3G A;  2B2V C;  3CCL A;  1MSG A;  1W6K A;  1RF2 D;  1HNZ Q;  5JJK A;  4FXK C;  2ICE C;  4A4I A;  5C44 H;  4NDX A;  3W1B A;  5BR8 L;  4IO9 A;  5ELD A;  1TWC B;  3SK8 A;  3IRB A;  1BOS A;  4C3H B;  1B7Y B;  2GA4 B;  3PIP 3;  1XMQ L;  1LAC A;  1SYE A;  1J9O A;  2K05 A;  2NN6 I;  3CPW A;  2DJF C;  2F0P A;  1STN A;  3T51 B;  2I0Q A;  1JIC A;  2K6A A;  4KJN A;  1SBB B;  5LMN W;  2RSO A;  1XTD A;  3RN2 A;  3M4Q A;  2UXC L;  3CHB D;  4I7A A;  4KN7 C;  1HCZ A;  1DZ1 A;  3QB3 A;  5L37 A;  1TQO A;  1GHJ A;  2Z4H A;  3I72 A;  1KDB A;  2DUD A;  3I4N H;  2XRS D;  3S2D B;  1SSO A;  1TU2 B;  2RDF A;  4P71 A;  5EPJ A;  1ZXT A;  2Y0S E;  5C5M A;  1QB5 D;  5IIF A;  2ZJP A;  2WFW A;  1BBW A;  4IN3 A;  5M5W B;  4HN7 A;  1KLG D;  4LAA A;  5I9P A;  4GOP A;  4G7Z C;  1IW7 C;  4KN4 C;  2Q2H A;  3UI2 A;  2EY5 A;  3A7L A;  1YNN C;  1KDA A;  1NCV A;  4PZ7 A;  1E24 A;  5IP7 H;  1A8V A;  4O0A A;  4A3D H;  2UXB Q;  4DUZ L;  1S3O A;  3PMF A;  4DV1 Q;  5IP9 G;  2OQ0 A;  4HTH A;  4HIO A;  1GUW A;  3C1E A;  2CCZ A;  4LFC Q;  2F03 A;  3SK5 A;  1GJX A;  1DOM A;  3DWP A;  4R4T A;  3HOV G;  3HOX H;  2NN6 G;  2AQ1 B;  5KNB A;  3ITP A;  3G48 A;  1SE4 A;  4RHS A;  3QOJ A;  5C4X B;  1FJG Q;  4JCV E;  3K0Y A;  1VQN A;  1S5C D;  2QA4 A;  4GKK L;  1PRT F;  1IZ6 A;  1EOV A;  3TS0 A;  3A56 A;  1F9Q A;  2WKD A;  3X3N A;  2E2H B;  3D31 A;  2NVT H;  4JI5 Q;  3DHQ A;  1EQQ A;  1Q1B A;  2NUC A;  2Q8I B;  5KYL A;  1BCP F;  3RLF A;  1D7Q A;  1PH1 A;  3T16 A;  2KQ3 A;  4OX9 L;  1GUO A;  3GO5 A;  4ALP A;  1IW7 D;  3EIV A;  3NQI A;  3GTK B;  1KAW A;  2D0P A;  2B63 B;  3CCU A;  3PO3 B;  4QUF A;  4KKU A;  4A3C H;  1U4P A;  1PTO C;  3NK9 A;  3FMC A;  1RDP D;  4LK1 C;  2K01 A;  2ZTC A;  4X62 L;  4DV3 Q;  2LFN A;  3K5L A;  4R8I A;  3HOY H;  2JN4 A;  5M3M B;  4R4I A;  1PA6 A;  4QJF A;  3PGZ A;  3AQQ A;  3RNU A;  2KOL A;  5GQO A;  1K28 A;  4DV7 L;  4M8A A;  4K2K A;  3D6W A;  2KHS A;  3K8A A;  1XYI A;  2R7Z H;  3H94 A;  4JC0 A;  2RDH A;  1I50 H;  5FLM G;  3TRZ A;  4U68 A;  3EN2 A;  4K5W A;  1X3P A;  4ULL A;  2J7Z A;  2N88 A;  1F2Z A;  2LMC B;  1SAP A;  4RWS C;  2NVY H;  2E76 C;  4QL5 A;  3BYT B;  4IUR A;  1EY8 A;  1EOT A;  4ID6 A;  4GKJ L;  4Y52 H;  2CQO A;  2IX0 A;  1H9J A;  5CV5 A;  1SN8 A;  2R92 H;  2RSN A;  2UUA L;  1VMP A;  1RCV D;  3CU7 A;  4A76 A;  4RHR A;  3CW2 C;  2P5Z X;  2HQE A;  2ZXO A;  2XNA C;  2JA5 G;  3HFZ B;  3H3V H;  2NYZ D;  2AWO A;  4NPS A;  3CCM A;  3AMU A;  3A74 A;  3C46 A;  2BH8 A;  1N33 Q;  3AU7 A;  5CYU A;  5M5Y H;  3FKI H;  4OEL B;  3KLS A;  4JI8 Q;  1LTI D;  1EY5 A;  1JE5 A;  3Q6S A;  4O2D A;  5NUC A;  1G91 A;  1UUP A;  3S2H H;  1SYG A;  1RJT A;  4A3I B;  2F0O A;  3QJY A;  1TY0 A;  1LAB A;  3NHH A;  1SE8 A;  2XRQ D;  4DR6 L;  1I6V C;  4LF4 L;  2MO1 A; 
#chains in the Genus database with same CATH homology
 3L2P A;  2AMC B;  3GTL H;  1JT8 A;  5IYB H;  4JG2 A;  4KHP L;  1NE3 A;  1SRO A;  3MEF A;  1VQG A;  3PF5 A;  1N36 L;  4HIM A;  3ER0 A;  4Y7N H;  4B3T L;  3E0E A;  2GVB A;  2YTY A;  2ZM6 Q;  2OWO A;  4XTC S;  1TWC H;  1KRT A;  1VQO A;  2NZH A;  2R92 G;  1TWA H;  1FJG L;  4C3H H;  1XNR L;  4DK6 C;  2D62 A;  1O7I A;  4YCU A;  5K36 G;  1Q46 A;  4R4Q A;  4JI2 L;  2E2J H;  1J6Q A;  2K50 A;  1G51 A;  2VUM H;  3I4N G;  4A3B G;  5JJL A;  2K5N A;  4YWK A;  3JAM i;  5C0X I;  4TVA B;  3UE1 A;  3KF6 B;  2HIX A;  1P8L A;  1AH9 A;  4BY1 G;  1Y1W H;  5M3M G;  4BBR G;  5H1S E;  4JI5 L;  2VS1 A;  5IYC H;  2R93 G;  3S24 A;  4MZ9 A;  1C7Y A;  2UU9 L;  3GD7 A;  1XPR A;  4DAM A;  2RHS B;  2JA8 H;  3K0X A;  4ME3 A;  4BBS G;  1VQA A;  3PUZ A;  2ZJR A;  2HT1 A;  2GVA A;  2K52 A;  2ZTE A;  3DM3 A;  3KLW A;  2R7D A;  5M5X H;  4HJA A;  4JI3 Q;  4LF9 L;  1KXL A;  4JI0 L;  4DR2 Q;  1DGS A;  3UDX A;  4UPA A;  2WB1 G;  3CCV A;  1HR0 Q;  3FP9 A;  5IP7 G;  1X56 A;  1OXT A;  1TWH H;  4JYA L;  1EIF A;  4QGU A;  1H95 A;  1XJV A;  1N9W A;  3AFQ A;  4YHH Q;  4NXN Q;  4X66 Q;  4LF8 L;  3PSI A;  1I94 Q;  4A3D G;  4JV5 Q;  3PUW A;  4DUY Q;  4A3L G;  3FHW A;  2N49 A;  4A75 A;  4A3M G;  1YZ6 A;  1K83 H;  1QZG A;  1WYD A;  3NEM A;  5M5W H;  3AYH B;  4R1J A;  4DV3 L;  2KHJ A;  4IJH A;  5HY6 A;  4GNX C;  2JEA I;  3AEV A;  4WJ3 M;  3L7Z C;  3I55 A;  3HOX G;  1L2F A;  2JK8 A;  5LMU Q;  2K75 A;  4BXX H;  2E5L Q;  3HKS A;  3M7N A;  4GLV B;  1WI5 A;  3CC2 A;  5AJ3 Q;  1XPO A;  4UY8 C;  2WP8 J;  3CXC A;  5JEA G;  3PCO B;  3GTQ H;  2EQS A;  3NEL A;  1IBM Q;  1PYS B;  1NTG A;  4OWT B;  2YV5 A;  4DAY B;  4B3M L;  3H0G H;  2LXJ A;  4DR5 L;  1MJE A;  4JI6 Q;  4JI1 L;  3CAM A;  3CCQ A;  2ASB A;  2JA6 G;  4YY3 L;  3HOW H;  1AE3 A;  1NJI C;  1VQJ A;  4PMW A;  4LF5 L;  1L1O B;  3W5O A;  2RCN A;  1YEZ A;  3PF4 A;  3A0J A;  2F3I A;  4GNX A;  4LF6 L;  3LGJ A;  4X65 Q;  1U0L A;  3STB C;  3HOZ G;  4UP9 A;  1VQI A;  5C0X G;  5LMN Q;  1VQK A;  4WJ4 A;  1TXY A;  4DV0 L;  2MFI A;  3I2Z A;  4PZ6 A;  3AFP A;  5C4X H;  3I4O A;  3K7A H;  5IY0 A;  4B3S Q;  3OTO L;  3I56 A;  1IYJ B;  1AE2 A;  1N34 L;  1EYG A;  4DR7 Q;  2R7F A;  3GTO H;  2YTX A;  1UE5 A;  4LUO A;  1Y1V H;  1Y14 B;  1VQ7 A;  3A5U A;  4P74 A;  1PVO A;  2K5H A;  5IE8 A;  3VDY A;  2JA9 A;  3L0O A;  1Q1E A;  1HNW Q;  2ALY B;  3S1R H;  4DV2 Q;  1VQE A;  2LSS A;  3DLL A;  2ZJQ A;  3PO2 H;  4IPH A;  1WJJ A;  2JEB I;  1N33 L;  3M9B A;  2CWA A;  1S72 A;  4IOA A;  4JI8 L;  3PUX A;  3J81 i;  4AYB G;  4J15 A;  4A3J H;  5IP9 H;  5BR8 Q;  1E3P A;  5EAY A;  2MO0 A;  1Q81 C;  1PFS A;  1IBK L;  2HHH Q;  1K3R A;  3S1N H;  2B3G A;  4X64 Q;  3RLN A;  2A1A A;  1HZB A;  3U4V A;  1XMQ Q;  3HOY G;  1V1Q A;  1Q86 C;  2AKW B;  5IWA L;  1XPU A;  3U50 C;  1VQ4 A;  4DR4 L;  1L0W A;  1PH9 A;  4AYB E;  2N3S A;  4LF7 Q;  4LFA L;  3I4M H;  1E1T A;  1IBL L;  2VY3 A;  2ATW A;  1X65 A;  4NB3 A;  2Y0S G;  2Z6K C;  5FJ8 H;  2F52 A;  5DLQ E;  2B63 H;  4A3E H;  4OWX B;  2R7Z G;  4DPG A;  3PO3 H;  1HH2 P;  3UDG A;  2VW9 A;  1PH7 A;  3TS2 A;  4A3G G;  1PH5 A;  1NY4 A;  5JEA J;  3CC7 A;  3UDF A;  4IOC A;  4L5R C;  1FGU A;  1VQB A;  1BBU A;  1C0A A;  4POF A;  1WCM H;  2L15 A;  2ZM6 L;  1C9O A;  1M90 C;  2PQA B;  1YVC A;  3KJO A;  1HZC A;  3J80 c;  1XMO Q;  3BZK A;  3KF6 A;  1VQ5 A;  5IYD H;  3TRE A;  1CSP A;  1LM0 A;  1W3S A;  2K4K A;  4C3J H;  5HGQ A;  3T1Y Q;  2CFM A;  3T1H Q;  1KD1 C;  5M3F H;  2VQF Q;  4R4O A;  1V9P A;  1VQM A;  3J7A 5;  3STB D;  2Z6K A;  2K14 A;  3HKZ G;  2UUC Q;  1B8A A;  1IXR A;  1K0R A;  1X9N A;  4KI0 A;  2KBN A;  3PO2 G;  2PI2 E;  1J5E Q;  2OTL A;  2MNA A;  4DV4 Q;  3CC4 A;  3PV0 A;  1BKB A;  4QY7 A;  3ULL A;  4POG A;  3CCE A;  2BH2 A;  4OO1 G;  5GAD C;  5GRO A;  4EQ5 A;  1JJC B;  1X54 A;  3HKZ E;  1YHQ A;  4JBW A;  4DV6 Q;  4IFD I;  1JB7 A;  2IHE A;  4P75 A;  4JI3 L;  1OXS C;  2B29 A;  1QUQ B;  2PI2 A;  2VNU D;  4JBM A;  3MXN B;  4PZ8 A;  4DR2 L;  1PH6 A;  1SFO H;  4DR3 Q;  3FKI G;  3KFU A;  2ID0 A;  1KQS A;  1HR0 L;  4DUZ Q;  1A63 A;  2YTV A;  4GOP B;  4A3F G;  4A3K G;  1VQ8 A;  3EBE A;  4MNO A;  3U4Z A;  4TQU S;  4KHP Q;  4YHH L;  2H5X A;  4A93 H;  4GS3 A;  3PIO A;  1I94 L;  4JV5 L;  4QIW E;  4IJL A;  4GN4 B;  1Z47 A;  4DUY L;  3GDE A;  4KLK A;  1HNX Q;  2NVX H;  2UUB Q;  4BY7 H;  1E7Z A;  3S2D H;  3HOU G;  4B3T Q;  4DV5 Q;  2LXK A;  2I5H A;  1SLJ A;  2HQL A;  3ZJY C;  1EFW A;  3CME A;  4JI7 Q;  1JJG A;  2GN5 A;  4OON A;  2QGQ A;  4HJ8 A;  1UEB A;  1YNX A;  1Z9F A;  2VUM G;  1GVP A;  3GTM H;  1BVS A;  4DNI A;  5IYB G;  1FL0 A;  2WB1 E;  2I5M X;  3ERS X;  1OXV A;  5LMU L;  3GTJ H;  2E5L L;  3J7Z C;  4HJ5 A;  4IPC A;  5ELO A;  3GTG H;  1RL2 A;  1NBW A;  4JOI C;  1YIJ A;  5AJ3 L;  4OWW B;  1RIP A;  3Q8D A;  2QEX A;  4A3I H;  1IBM L;  5ELN A;  3SGI A;  2RF4 A;  4JI6 L;  4GKK Q;  2YYZ A;  1PHJ A;  1XNQ Q;  2HIV A;  3CCR A;  1UE1 A;  1K9M C;  5C4J H;  1M1K C;  3M85 A;  2IHF A;  1IL2 A;  3CMA A;  4R4C A;  1JMC A;  2XTI A;  1HR0 W;  4QQB X;  3PIP A;  1ASY A;  4X65 L;  1KL9 A;  5IT9 c;  3J81 j;  1Y1W G;  4UP8 A;  2Q2T A;  5LMN L;  1X6O A;  5IYC G;  2JA7 H;  2Q2I A;  1Q7Y C;  1U5K A;  4LW1 A;  3S1Q H;  4JOI A;  4B3S L;  2JA8 G;  3E9H A;  4DK3 C;  3W1G A;  1N32 Q;  3CPF A;  4OX9 Q;  3RZO H;  4DR7 L;  1R9T H;  1YJN A;  1GD7 A;  1NMG A;  4DKA C;  3CCS A;  4AQY Q;  1PH2 A;  2EXD A;  1VQ9 A;  4XIG S;  2A19 A;  5C3E H;  1KIX A;  1HNW L;  2CWP A;  4X6A H;  2VQE Q;  4DV2 L;  1SMX A;  1MKH A;  1VQD A;  4EX5 A;  4AIM A;  4OXP A;  4H02 A;  1OXU A;  3S17 H;  1YJW A;  1CKN B;  2F4V Q;  1X3G A;  4NXM Q;  2A8V A;  3CCL A;  5JJK A;  1HNZ Q;  4X62 Q;  5C44 H;  4A4I A;  1HZ9 A;  5BR8 L;  3W1B A;  4IO9 A;  2VL6 A;  3IRB A;  2E2H H;  2HHH L;  4MTN A;  4X64 L;  1G6P A;  2Z0S A;  1B7Y B;  3PUY A;  4DV7 Q;  1XMQ L;  1JJ2 A;  3HOV G;  4YWL A;  5GAG C;  3NEN A;  3M3Y H;  2NN6 I;  3CPW A;  2Q2U A;  1VQC A;  2NZO A;  1YJ9 A;  4LF7 L;  4BXX G;  2I0Q A;  4RG1 A;  3CP0 A;  5LMN W;  2IT1 A;  2KCM A;  1EUJ A;  1XTD A;  4AH6 A;  2PQA A;  2V1C C;  3OYY A;  3RN2 A;  1K8A C;  3M4Q A;  4JI4 Q;  2K5V A;  2UXC L;  2JQO A;  3H0G G;  4YWM A;  4DV0 Q;  1CSQ A;  5GAE C;  3GTK H;  3HOV H;  3KYH C;  1YIT A;  3HOW G;  2UXD Q;  3JC6 6;  4GLA C;  4GKJ Q;  2AWN A;  4LWC A;  1XMO L;  2OCE A;  2DUD A;  3I4N H;  4A3B H;  3ULP A;  1SRU A;  3T1Y L;  1NMF A;  3T1H L;  2BA1 A;  4P71 A;  3ICE A;  2UUA Q;  2VQF L;  2Y0S E;  5JJI A;  1X3E A;  4HID A;  4DR1 Q;  4BY1 H;  2RHQ B;  5M3M H;  1B70 B;  4BBR H;  3G6E A;  3E9I A;  5C4X G;  3BZC A;  3K7U C;  3K80 C;  3S16 H;  2R93 H;  3NBH B;  1YHA A;  2ZJP A;  2WFW A;  3M4P A;  4DV4 L;  4LFB Q;  4JBK A;  4BBS H;  1BBW A;  1YHB A;  1Y1V G;  3A5Z B;  4GOP A;  5C0X J;  4DV6 L;  1UWV A;  2Q2H A;  1QVG A;  3I7F A;  3S15 H;  4PZ7 A;  1E24 A;  3WWV A;  5IP7 H;  1A8V A;  4DR3 L;  4O0A A;  4A3D H;  2UXB Q;  4DUZ L;  4K0K Q;  1S3O A;  1KRS A;  4DV1 Q;  4A3J G;  5IP9 G;  1E1O A;  2OQ0 A;  4HIO A;  4APV A;  3S14 H;  4A3M H;  4A3L H;  1Q82 C;  1OTC A;  4B3R Q;  2CCZ A;  3CQZ H;  3K81 C;  3RZD H;  4LFC Q;  4DR6 Q;  2UUB L;  4LF4 Q;  1S40 A;  4GN5 A;  4IPG A;  2N78 A;  1HNX L;  3UE0 A;  3ULJ A;  4DV5 L;  3I4M G;  3U58 A;  3F2D A;  4R4T A;  4JI7 L;  1L1O C;  1EWI A;  1HZA A;  3HOX H;  4NXN L;  5FJ8 G;  1VQH A;  3KDF B;  4X66 L;  1YI2 A;  1I5F A;  2B63 G;  2NN6 G;  4A3E G;  2WAQ G;  3PO3 G;  2KHI A;  1N36 Q;  2YU9 H;  4L5Q A;  3G48 A;  1PV4 A;  4YCV A;  3J80 i;  1W2B A;  4LUZ A;  1T9H A;  1FJG Q;  4P72 A;  1LYL A;  1XNR Q;  1WCM G;  1A62 A;  1Q8K A;  4JCV E;  3TQY A;  2WAQ E;  5GAH C;  1VQN A;  1QVC A;  3G71 A;  4JI2 Q;  5IYD G;  2QA4 A;  4FDB A;  2E8G A;  2ES2 A;  2JJQ A;  2JA6 H;  4GKK L;  3BJU A;  1IZ6 A;  1XNQ L;  1EOV A;  3TS0 A;  1QZH A;  3D0F A;  1KC8 C;  5FLM H;  3F8T A;  1QVF A;  3KJP A;  5M3F G;  4BA1 I;  2D0O A;  1L1O A;  3HOZ H;  3D31 A;  2NVT H;  1X55 A;  4JI5 Q;  4P73 A;  1EQQ A;  1Q1B A;  1X3F A;  5E7N A;  3CF5 A;  4GLX A;  2UU9 Q;  3RLF A;  1PYB A;  4JBJ A;  1N8R C;  2FXQ A;  3KF8 B;  4BA2 I;  2IX1 A;  1PH1 A;  3RLO A;  1D7Q A;  2C35 B;  2XGT A;  4LF9 Q;  3S1M H;  4HJ9 A;  4JI0 Q;  1N32 L;  1SR3 A;  3H15 A;  4OX9 L;  1CUK A;  2DGY A;  1CKN A;  3GO5 A;  4ALP A;  4AQY L;  3EIV A;  1PH4 A;  4JYA Q;  2IY5 B;  5J3B A;  1KAW A;  2D0P A;  4LF8 Q;  3CCU A;  2AHO B;  1MIU A;  3F1Z A;  1G29 1;  2VQE L;  1I6H H;  2KCT A;  2JA5 H;  4A3C H;  2JE6 I;  4A93 G;  1MJC A;  1OXX K;  2F4V L;  1TWF H;  4NXM L;  4RMF A;  4IFD G;  3G4S A;  2ZTC A;  1HNZ L;  4X62 L;  4DV3 Q;  4BY7 G;  3KOJ A;  2ZTD A;  1VCI A;  3J81 c;  1K8G A;  3HOY H;  4R4I A;  1PA6 A;  4QJF A;  3PGZ A;  1VQP A;  4LNQ A;  3AQQ A;  5FLX c;  3RNU A;  5GQO A;  4DV7 L;  3K8A A;  3TEH B;  2R7Z H;  4JC0 A;  3F2C A;  1A0I A;  5FLM G;  1I50 H;  4B3M Q;  3TRZ A;  1FVI A;  3BU2 A;  4A3G H;  3EN2 A;  4DR5 Q;  1GM5 A;  4HJ7 A;  1WOC A;  4JI1 Q;  4A3I G;  2OTJ A;  1VQF A;  2VZA A;  1KHI A;  4YY3 Q;  4JI4 L;  1CKO A;  4LUV A;  4LF5 Q;  3M4O H;  4C3I H;  3GTP H;  2I5L X;  2NVY H;  4LF6 Q;  4OO1 I;  1VQL A;  2UXD L;  2BA0 A;  3CCJ A;  4QL5 A;  2R6G A;  1EIY B;  4Y52 H;  2N8N A;  2EIF A;  4GKJ L;  3H3V I;  4L5S A;  1D8L A;  4UP7 A;  4PG3 A;  2CQO A;  2IX0 A;  1VQ6 A;  1UE7 A;  1SN8 A;  1YBY A;  4GN3 B;  2R92 H;  4HIK A;  3OTO Q;  1ASZ A;  4GNX B;  4GOP C;  2UUA L;  4YCW A;  1E22 A;  1N34 Q;  2JA7 G;  2E2I H;  4DR1 L;  4A76 A;  1P16 A;  3CW2 C;  3UDI A;  2NVQ H;  2PNH A;  1Q12 A;  1HJP A;  3F2B A;  1GO3 E;  3OW2 A;  3CD6 A;  4L5T A;  2JA5 G;  1PH3 A;  4A3C G;  4LFB L;  3HFZ B;  4KHZ A;  3H3V H;  1I3Q H;  2AWO A;  4NPS A;  3RR5 A;  1CKM A;  1GKH A;  3RN5 A;  3CCM A;  5C3E G;  3A74 A;  2BH8 A;  2UUC L;  1N33 Q;  2OQK A;  5M5Y H;  3JAM c;  3FKI H;  1J5E L;  4JI8 Q;  1LTL A;  4A3F H;  1QUQ A;  4A3K H;  1V43 A;  1VS0 A;  1TWG H;  1JE5 A;  4O2D A;  3PUV A;  1EQR A;  1IBK Q;  1PH8 A;  2UXB L;  3B6Y A;  4K0K L;  1UE6 A;  2PMZ E;  5C44 G;  4DV1 L;  1WFQ A;  3S2H H;  4IPD A;  4IFD J;  4C2M H;  5IWA Q;  3HOU H;  4DR4 Q;  3KDF A;  4B3R L;  2MQH A;  2UXC Q;  4LFA Q;  1SE8 A;  4LFC L;  4DR6 L;  1IBL Q;  1K73 C;  1LUZ A;  2KEN A;  2MO1 A;  2CKZ B;  4LF4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...