2R93H

Elongation complex of rna polymerase ii with a hepatitis delta virus-derived rna stem loop
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
145
structure length
135
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*AP*UP*UP*CP*UP*CP*UP*AP*UP*CP*GP*GP*AP*AP*U
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 13
structure length 135
sequence length 145
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r93H00
1HZCA 1Q7YC 4L5QA 4DR4L 2F3IA 5HGQA 4ME3A 3BZKA 4Y52H 2JA5H 1C0AA 3WWVA 2N78A 4C3IH 1I94L 5IP7H 3HOZG 1VQLA 5AJ3Q 2CWAA 4JI3Q 2Z6KA 4A3GG 1XMOL 2GVAA 4EQ5A 1HNZQ 2R6GA 3E0EA 5IYDH 1S40A 3W5OA 3PV0A 2E2JH 1A63A 1UWVA 2B3GA 1Q82C 3NBHB 4IFDJ 2PQAA 1I5FA 4K0KQ 2ID0A 4BY7G 4GLXA 1KXLA 4GNXC 4HJAA 3L0OA 3M85A 1IBML 1VQ6A 3CCUA 2R93G 1HNWQ 1X3EA 1IBLQ 2YTXA 3A5ZB 3SGIA 4BA1I 3PF4A 4DV7Q 4GS3A 4A3FH 4WJ4A 2UUCL 4GN4B 3S15H 1WI5A 2K52A 2UXDQ 4P72A 1WJJA 3CC7A 4MTNA 4IPCA 2NN6G 4XIGS 4JI6L 1QUQA 4OX9Q 1JJ2A 1K3RA 1KL9A 2YTYA 4NPSA 3RLFA 3UDIA 5IYBH 3AFQA 3J80c 4BBSG 2QGQA 3EIVA 3KJOA 3F2DA 2F4VL 5C44G 4JI8L 3RN2A 4HJ8A 3GTKH 2IY5B 4B3MQ 3CCQA 4JYAQ 1CSQA 4JI7Q 2VUMG 1CKNA 1BBUA 4YWLA 4DR3L 1Y14B 2WP8J 4UP8A 3T1YL 3CC4A 4LF5L 2NVTH 3TS0A 2RHQB 2R7DA 3KF6B 2JK8A 3PIOA 1NE3A 1UE6A 1A8VA 1VQBA 4X65L 5IYDG 3S16H 5JJKA 4X64Q 1I50H 4POGA 3K7UC 2CFMA 5C3EH 4YWKA 5IYCG 1FJGQ 1SFOH 3TEHB 3S17H 1VQNA 1VS0A 3AFPA 2QA4A 4HJ5A 1K8AC 4L5TA 1JB7A 2YTVA 2VL6A 3M4QA 1YJWA 5JJIA 2I0QA 3OYYA 4AYBG 4BBRH 3A74A 1M90C 1N32Q 1VQOA 1ASZA 1VQGA 1NTGA 2N3SA 1P8LA 1PH6A 1VCIA 4DR2L 3KOJA 2JA6H 2DUDA 2K75A 3J81i 4DR6Q 4B3TL 3UE0A 1J6QA 3M9BA 5GAGC 1N34Q 4DR7Q 1M1KC 2R7ZH 3H3VH 4QL5A 4A3IG 2CCZA 1V43A 2YYZA 1K73C 4DK6C 1X55A 1WCMH 5LMNW 5AJ3L 4JI3L 1L1OB 1WYDA 2NZHA 4LF6Q 1X9NA 5M3MG 4A76A 1YI2A 1PYSB 4HIMA 1Z47A 4DAYB 1PH9A 1HR0L 1X65A 2WAQG 5C0XG 2E5LL 3TS2A 2Q2IA 4DKAC 1SE8A 2OWOA 4LF9Q 1IL2A 3PO3G 3M3YH 2EXDA 3CP0A 4JCVE 4GKJQ 1UE7A 4A3JG 2VW9A 3GTLH 4IOCA 1V9PA 2AHOB 1HNWL 3ERSX 1MIUA 4IPGA 1VQPA 5C4XG 1L0WA 3GO5A 4NXML 4DV7L 3U58A 1EUJA 4YHHL 2UXDL 4DV2L 4DV5L 1L1OC 4IO9A 1N33Q 2OCEA 4B3RQ 1VQAA 3K7AH 3CCEA 2IT1A 4OX9L 4C3JH 2KCTA 2VZAA 4A3BG 4AYBE 2JA8G 1K9MC 1P16A 5ELOA 2ZTCA 5BR8Q 1Y1WG 3S1MH 2RHSB 1G51A 1GKHA 5LMNQ 3RLOA 3OTOQ 1EOVA 1X56A 3S1RH 4P73A 2VQFQ 2RF4A 3PF5A 2D0OA 3CCVA 1VQ9A 2N49A 1S72A 1Q1EA 5DLQE 3A0JA 2JJQA 4JC0A 5FJ8G 4R4CA 3PO2G 4JI4L 1E1OA 4OWWB 4YCVA 4LFBL 4R4IA 2WAQE 4X64L 5C44H 2MNAA 4UPAA 3H15A 3S1NH 1FJGL 4DK3C 1GVPA 4DUZQ 3UDXA 1LUZA 2F52A 4R4QA 4X66L 2VUMH 4JI0Q 2BA1A 1SLJA 3J7A5 4JG2A 2KCMA 3GTMH 4NXNQ 2Q2TA 3CF5A 3F2BA 1B70B 1QZHA 2NVYH 3FP9A 2ZM6Q 4DNIA 3CMAA 1E3PA 2JA9A 3TREA 4DR6L 2VQEL 1N32L 2OTJA 3UDFA 1N34L 1LYLA 4LW1A 4DUYL 1RL2A 3GTJH 2K5HA 3U50C 1PV4A 3S2HH 4A3MG 5IYCH 2CWPA 1IBKQ 3GTGH 1BVSA 3HKZE 3K0XA 3GDEA 1D7QA 5J3BA 2A8VA 3JAMi 1XPUA 1BKBA 3BZCA 1QZGA 4A3DG 2Z6KC 4GNXA 4P74A 4LF9L 5C0XJ 3G6EA 1XPOA 1LTLA 1Q1BA 1QUQB 4X6AH 5C0XI 1XNQL 5HY6A 3I4MG 3KJPA 3I55A 4DV0Q 1D8LA 1OXVA 3B6YA 1EWIA 4QJFA 1E22A 2ZJRA 3NEMA 1IXRA 4KLKA 1MJEA 1WOCA 4BA2I 1IZ6A 3GTOH 4A3CG 2JA8H 4A3IH 2JEAI 4A75A 4A3KH 4A3LH 1XNRL 1N33L 4LUZA 4OO1I 4GOPB 1IYJB 5M3MH 3CXCA 4HJ7A 2K50A 4IPDA 4DR5Q 4KI0A 2GN5A 3AQQA 1AE3A 2Z0SA 2UUAL 2C35B 1E24A 1Q81C 3FKIG 3BJUA 4YY3Q 1CKMA 3CD6A 3PO3H 3KF8B 1NMFA 4A3JH 4LF4L 4OWTB 3GD7A 3K8AA 1XJVA 2HT1A 1MJCA 1OXUA 5C4XH 1V1QA 2R7FA 4R4OA 1YHBA 1SMXA 1TWGH 3G4SA 4GOPC 3KDFB 1PH5A 1VQ5A 1WFQA 4YWMA 3PCOB 2JQOA 3F8TA 4DV1L 4AQYL 4JBWA 5IWAQ 1XMQQ 2KBNA 4O0AA 3I4NH 4L5RC 4DV4L 3PUYA 3Q8DA 4A3BH 2BH2A 1EQRA 4IJHA 1GD7A 3HOUG 2MQHA 1Y1WH 1N8RC 2XTIA 4DUZL 1G6PA 3ULJA 4X62Q 1Y1VG 1JJCB 2UXBQ 3W1GA 3I56A 1JT8A 2KHJA 3HOWG 4JI0L 2PI2E 1PH2A 5ELNA 2UU9Q 4LF7Q 3ZJYC 2VNUD 4P71A 4TQUS 3CCRA 2L15A 3MEFA 3H0GG 4LFAQ 5FJ8H 1SRUA 1VQHA 3K80C 4A3KG 2ES2A 3GTQH 3PO2H 1XPRA 4A3LG 4UY8C 1KD1C 2ZM6L 4IJLA 4XTCS 1YEZA 1HNZL 3S1QH 5M3FG 4TVAB 2R92G 2JE6I 1SN8A 2E8GA 2NZOA 4DR4Q 1HNXQ 4QQBX 4K0KL 1E1TA 1OXSC 3CW2C 2HIXA 2I5LX 1O7IA 4LUOA 3UE1A 1PH3A 3L7ZC 2NVQH 1PVOA 4AH6A 3HOXG 1X3FA 1IBLL 4OO1G 2B29A 4GN5A 4YCUA 4PZ8A 3D31A 3KLWA 3E9IA 2OQ0A 1CKOA 2GVBA 4HIDA 2ALYB 3S14H 1VQCA 1ASYA 1QVGA 2YU9H 4DV6Q 4DV0L 1U5KA 2E2HH 2K5NA 2IX1A 1Q46A 3HOVH 3I4NG 4A3CH 3PGZA 4LWCA 1VQFA 3JAMc 4A3MH 1PH4A 1W3SA 1OTCA 1NBWA 1YBYA 5GROA 4APVA 3HKZG 4B3ML 4L5SA 4JYAL 4P75A 3GTPH 4JOIA 3U4VA 3ER0A 4JI7L 1J5EQ 2ZTEA 3FHWA 1R9TH 2B63G 4A3DH 1KAWA 4DR1Q 4YY3L 1YNXA 4JV5Q 3EN2A 2JA7H 4O2DA 2WFWA 3E9HA 4JBJA 5M5WH 4JI5Q 2QEXA 2PI2A 3DM3A 2XGTA 3HFZB 4ALPA 1JMCA 1EIYB 3HOYG 4Y7NH 3OW2A 1NMGA 4A3EH 1HZAA 4AIMA 1PYBA 3T1YQ 3KYHC 4DR3Q 2I5MX 4LF5Q 3RZOH 1GO3E 1C9OA 1SROA 4UP7A 1XMQL 4MZ9A 3G71A 4LFCQ 3W1BA 3I7FA 1Q12A 3FKIH 4X65Q 1PH1A 3ULLA 4PZ7A 5IE8A 4JI1Q 3UDGA 4C3HH 4PG3A 1AE2A 2BA0A 1YITA 1PH7A 3CC2A 1LM0A 5GAEC 2UXBL 4FDBA 1K0RA 5GAHC 3CPWA 2PQAB 4R1JA 3AEVA 3HOVG 2IX0A 4DR7L 1EYGA 4DAMA 2HHHQ 4KHZA 1YJNA 4LNQA 4QGUA 1OXTA 4LF6L 5EAYA 4DR2Q 1VQ8A 3HOUH 1PA6A 4B3TQ 2IHEA 1HNXL 3J81c 4DPGA 4KHPQ 1VQ4A 1VQDA 1Y1VH 4GKJL 1QVCA 2UXCQ 4EX5A 4PZ6A 1K83H 4GLAC 2EIFA 2K5VA 4OXPA 2JA7G 5GQOA 3HOWH 3K81C 4RG1A 4GKKQ 2NVXH 4BY1G 4HJ9A 3RLNA 4R4TA 4A3EG 1HR0Q 3H0GH 4PMWA 2E5LQ 1KRTA 1X6OA 4B3RL 4IFDI 2LXJA 3D0FA 1N36Q 4BXXH 1HZBA 4DV6L 1L2FA 1K8GA 1CKNB 2LSSA 5M3FH 2R92H 4RMFA 1HJPA 1VQ7A 2YV5A 1N9WA 2AWNA 4IPHA 2Q2HA 3M4PA 1XTDA 3RN5A 1KC8C 1I6HH 2PNHA 4NXMQ 1I3QH 2MO1A 3HKSA 2VS1A 2VY3A 3STBD 5FLXc 2OQKA 5JEAG 5BR8L 4YHHQ 1X54A 1UE5A 2PMZE 4DV2Q 1UEBA 3HOXH 4DV5Q 5LMNL 3OTOL 3RZDH 1J5EL 2E2IH 2VQFL 2OTLA 4DR1L 1H95A 1CUKA 1HH2P 4LF8Q 1Q86C 4B3SL 4JV5L 5FLMG 1KHIA 5M5YH 4UP9A 4JI5L 2R93H 2LXKA 4WJ3M 1MKHA 2UUBQ 4GOPA 4JI2Q 1KQSA 5IP9G 4JBKA 1OXXK 3TRZA 3M7NA 3G48A 5JJLA 2I5HA 1DGSA 1VQMA 2JA5G 2MO0A 2Y0SG 4POFA 3CCMA 1NY4A 2AKWB 3PUZA 4IOAA 1A62A 1Q8KA 2K14A 3KF6A 3JC66 4LFCL 5IP7G 1YHQA 2B63H 4JI4Q 1EIFA 2KENA 1AH9A 1BBWA 1CSPA 4DV3Q 2RCNA 4NXNL 4LFBQ 1JJGA 4JI1L 1YVCA 1TXYA 2EQSA 1FGUA 1FVIA 1YIJA 3HOYH 3DLLA 5LMUQ 3KDFA 4BXXG 3H3VI 1C7YA 2A1AA 4X66Q 3PIPA 3S2DH 4QY7A 4MNOA 4HIOA 2HHHL 1NJIC 1IBKL 4A3FG 2ATWA 3CCSA 1HZ9A 1I94Q 5IT9c 1FL0A 1YZ6A 3PUVA 2H5XA 5GADC 3KFUA 1XMOQ 3T1HQ 2KHIA 3M4OH 2VQEQ 2Q2UA 2K4KA 3CQZH 2ZTDA 4IFDG 5IYBG 4DUYQ 4KHPL 3ICEA 3L2PA 3PSIA 1B7YB 2UXCL 1E7ZA 1U0LA 3PUXA 4H02A 4QIWE 3J7ZC 2ZJPA 2N8NA 3J80i 3T1HL 1W2BA 2WB1G 4A93H 4OONA 4GKKL 1IBMQ 1TWAH 5IY0A 3EBEA 4GLVB 1L1OA 1VQKA 2CKZB 3I2ZA 3AYHB 2BH8A 5M5XH 4C2MH 1UE1A 3F2CA 2JEBI 2AWOA 4J15A 2UUCQ 1N36L 2Y0SE 3BU2A 3IRBA 3S24A 3MXNB 4A4IA 3CCJA 1QVFA 1XNQQ 4DR5L 2D62A 1PH8A 3CCLA 4JI6Q 1SR3A 4B3SQ 3RNUA 1A0IA 1VQIA 2HIVA 1B8AA 1EQQA 1EFWA 3CAMA 3PUWA 3I4OA 1G291 2F4VQ 4LUVA 3RR5A 1XNRQ 2FXQA 1TWHH 4JI8Q 5C4JH 4JBMA 3HOZH 5JEAJ 5C3EG 4A3GH 4BY1H 1JE5A 3CPFA 3CMEA 3VDYA 1GM5A 4LF8L 1VQEA 2NN6I 1X3GA 3NELA 2A19A 4JOIC 3J81j 2UUAQ 5K36G 5H1SE 4BY7H 4BBRG 4YCWA 5IWAL 2DGYA 4LF4Q 1YHAA 2V1CC 2UUBL 2AMCB 4JI2L 4OWXB 1HR0W 2ASBA 3I4MH 2HQLA 4HIKA 1YJ9A 2JA6G 3A5UA 1KRSA 3ULPA 3U4ZA 2IHFA 4X62L 2R7ZG 4DV1Q 4AQYQ 1WCMG 2ZJQA 2WB1E 3LGJA 4NB3A 4BBSH 1T9HA 1PFSA 4DV3L 4DV4Q 1TWCH 1PHJA 2UU9L 4LF7L 4A93G 2D0PA 3F1ZA 5FLMH 2MFIA 4LFAL 3TQYA 4GN3B 5E7NA 3STBC 2CQOA 1TWFH 1S3OA 1Z9FA 5LMUL 1VQJA 5IP9H 1KIXA 4GNXB 3NENA 1RIPA
chains in the Genus database with same CATH superfamily
4RCOA 1A3UA 3CKIB 4ME3A 2EYOA 4Y52H 2KEDA 4KKSA 1B4OA 4C3IH 5JAVA 2EYPA 2NVXB 1GHJA 4K6DA 5FOBB 2R6GA 3A7AB 3W5OA 3PV0A 4HR7B 4EQOA 1UWVA 1HXYD 4IFDJ 2PQAA 4M8AA 4GNXC 1HNWQ 1IBLQ 5IODA 1Q3LA 3SGIA 2A6ED 5ELBA 3S15H 4ILWA 1WJJA 5DM63 1IYVA 4MTNA 4IPCA 3FEWX 1JJ2A 2YTYA 3UDIA 3J80c 4OELB 3EIVA 3MHBA 5IT9E 2F0QA 4LJZC 4DNTB 3A7LA 4B3MQ 4F7XA 4JYAQ 2K1BA 3GV3A 3CC4A 1BBUA 1H9JA 3V2TA 4DR3L 1FR3A 3QB3A 2JK8A 1SJHD 1D5ZC 1UE6A 1A8VA 2SOBA 1K28A 5IYDG 2WV6D 2XRSD 4X64Q 4POGA 4N8X1 2L4NA 5C3EH 2F0WA 2CVRA 3AFPA 1IW7D 2PZTA 2AUJD 1YJWA 4IUQA 5G3LD 1M90C 2OT2A 4ZQ3A 1ASZA 2PW5A 4CKBA 3SE0A 2K75A 2PMZB 3UE0A 3A54A 3NWSA 1A2TA 1B1ZA 2MUYA 4OEMB 4A3IG 3HOVB 4DK6C 1X55A 2KUMA 1ZEQX 4JI3L 1L1OB 4A3MB 2EDGA 5FO8B 3BS1A 3I73A 3BZDB 4A76A 1PYSB 2F4IA 4DAYB 1X65A 3NTHA 3RMHA 2E5LL 4DNRB 4DKAC 3OMCA 1IL2A 1CI3M 1GJXA 1Q90A 2EXDA 5C3WA 5EQ0A 3GTLH 2EYLA 1V9PA 1PZID 5M5WB 4NXML 5CYUA 3U58A 1EUJA 4DV2L 1N33Q 3QWNA 4A3EB 4DXGA 2IT1A 2R3ZA 3NUCA 2P5ZX 2ZTCA 2FMCA 4NW2A 2RHSB 5ISRA 4O42A 5KNBA 1GKHA 2KCNA 5LMNQ 3C46A 3MXNA 2RF4A 2N49A 2LY7A 1S72A 3A0JA 3VA5A 1E1OA 2DJFC 2F0LA 4OWWB 1TWFB 4KN4C 4LFBL 5FLXE 2WAQE 5LHY1 5C44H 3H15A 1ENCA 4DUZQ 4C3JB 3UDXA 1WTVA 1D1KA 1HUMA 1PFBA 4R4QA 2VUMH 1GUNA 2A68C 2Y0SB 2MP1A 4RGNA 3J7A5 3ND9A 2Q2TA 2E74C 3CF5A 2KCCA 1B70B 2B2TC 2NVYH 2ZM6Q 1SAPA 3CMAA 4HN7A 1N32L 4LW1A 3S2HH 3GTJH 3NWTA 4A3MG 5IGDA 1IBKQ 3T16A 3GDEA 3PMFA 3BG3A 1QCBD 3M7GA 3GV6A 3JAMi 1XPUA 3S15B 1QZGA 4K2KA 2M2LA 1RTNA 4LF9L 3QOJA 3V05A 1JR0D 1EFID 1QUQB 3I4MG 3KJPA 3I55A 1EU4A 1A3VA 1D8LA 3B6YA 1EWIA 2PYKA 4HAEA 5KNCA 3QR8A 4A3KH 2Q8RE 1XNRL 3EA6A 2K6AA 4A3LH 5M3MH 2EZVA 4IPDA 4FNFA 2KJXA 2GN5A 1K3BC 5C0XH 1AE3A 3IAYA 2UUAL 1E24A 1Q81C 1T5EA 3CD6A 3OIPA 1NMFA 2JXMB 4LF4L 3GD7A 1G2SA 1HTLD 3K8AA 1MJCA 1V1QA 2K33A 3E0JA 4ZUJA 1KAAA 1SMXA 1J9OA 1B9NA 2IJ0A 3KDFB 1WFQA 4YWMA 2NYZD 3PCOB 2XVSA 1CT1D 5D3DA 1XMQQ 4DV4L 3PUYA 1EY7A 1EQRA 1GD7A 1S5ED 3NBIA 1LT5D 1G6PA 3GP7A 3L3OC 5L37A 2UXBQ 3I56A 4IUTA 2NTSA 5J22A 4HSPA 2PI2E 4JI0L 4LAAA 5ELNA 3ZJYC 5KNDA 4P71A 4A93B 1VDZA 3MEFA 5FJ8H 3PO2H 1SRUA 1Y69U 4XTCS 2XSCA 1SBBB 2R92G 3T56B 2NZOA 1HNXQ 3GTLB 1E1TA 1OXSC 3UE1A 5I6YA 2EYFA 1IBLL 4OO1G 3HOZB 4GN5A 1TWHB 1M4VA 4PZ8A 3E9IA 4HIDA 2ALYB 3S14H 1SYFA 2YU9H 4DV6Q 2R93G 2K5NA 1Q46A 4FXGC 1WVLA 4BY7B 4CDEC 2MHVA 3VR6A 1W3SA 1II3A 1OTCA 1PRTC 2IX3A 4B3ML 4JYAL 3GTPH 3OW7A 4JOIA 4A3DH 1SYBA 2ZTEA 1R9TH 5I6WA 1FYCA 2JA7H 1STBA 1PRTF 1DXMA 3OIQA 4U673 1EIYB 5C44B 1JICA 3E3XA 4ME5A 1HZAA 1PYBA 4N9TA 2K01A 2I5MX 2HQEA 2VUMB 1I4XA 1C9OA 1SROA 5EPJA 2L12A 3MFYA 3W1BA 3I7FA 2XNAC 3LWUA 3IFDA 1PH1A 1EZ6A 2B2VA 2NVYB 4C3HH 4PG3A 1PH7A 4H44C 1AFPA 3GTJB 2PQAB 2EVBA 2B39A 4PV1C 4DAMA 2HHHQ 4QMGA 4LNQA 1OXTA 5EAYA 5JPMC 3NXWA 2RSOA 5J39A 1PA6A 4B3TQ 3HOUH 1ICFB 2D5DA 3EROA 2O2LD 2X6LA 1I4GA 3TDQA 1Z6HA 4EX5A 4PZ6A 4GLAC 1LABA 4FXDA 3K81C 3OWFA 4RG1A 2F0FA 4BY1G 2F0GA 4R4TA 1HR0Q 5EPLA 5M3MB 2QDLA 4I7AA 1NSNS 4IFDI 2LXJA 4BXXH 4B08A 5M3FH 4RMFA 2YV5A 1N9WA 2Q2HA 3RN5A 1I6HH 3MXUA 2PO4A 1I3QH 2VY3A 3Q6SA 5FLXc 1A15A 5JEAG 1X54A 3HOXH 5LMNL 2PQEA 1VMCA 2E2IH 4FF4A 1HH2P 1KTKA 1Q86C 1SNQA 2CW0C 2NZ1D 5A2QE 2Z8LA 2L9HA 3G48A 5JJLA 2R61A 1GUSA 4POFA 1A62A 1KABA 1Q8KA 2O4XA 5IP7G 1YHQA 2R7ZB 1EIFA 1AH9A 3PO2B 2IWHA 2RCNA 4IN3A 1YVCA 2EQSA 4Z9CB 1IKLA 3HOYH 1B44D 3H3VI 1IYUA 3H6MA 1JQYD 2A1AA 5EKLA 3ND8A 5DAUA 3S2DH 4K2LA 4MNOA 1IBKL 2G9DA 1HZ9A 3TP8A 5IGBA 1PXUA 4OIKA 2VQEQ 1JCKB 2K4KA 2ZTDA 3CQZH 4RGOS 2YU9B 3ICEA 4EGVA 3L2PA 1B7YB 2UXCL 4QIWE 3J7ZC 3LWEA 1W2BA 2WB1G 1TWAH 2EYJA 1L1OA 3I2ZA 3GTPB 1UE1A 4A3DB 4J15A 3K59A 4DGZA 1R9TB 1ILPA 3MXNB 4A4IA 1XNQQ 1BXTA 2D62A 4J8QA 3RNUA 1B8AA 3UI2A 2FXQA 4JBMA 5CV8A 2XWBB 3K57A 3C2PA 1PTOC 1VQEA 3NELA 1D1IA 3J81j 4JOIC 4KY7A 5H1SE 3DWAA 4YCWA 2DGYA 4XYQA 2UUBL 4OWXB 1HR0W 4C3HB 4LMQD 1YJ9A 3ULPA 1PTOF 4CDDC 2R7ZG 2O5JC 1LACA 4AQYQ 1WTXA 1T9HA 1PFSA 4DV3L 2D0PA 1B9MA 2CQOA 1S3OA 1SSOA 5A2QL 3HOUB 2B2VC 2D9UA 1QB5D 5IP9H 1RIPA 2K7VA 5HGQA 4RGMA 4UDUC 5C6AA 1EU3A 2JA5H 4CDCC 3NSWA 1VQLA 4JI3Q 5IYDH 5C5MA 4G4KA 1Q82C 1ESRA 2F0KA 1I5FA 1OO9B 3WOEA 2ID0A 3NPPA 1CTMA 4GLXA 1BOSA 4FYDA 1I6HB 3L0OA 1I3QB 1B3AA 1F2YA 4Q5VA 1BBXC 5D3IB 4R8IA 2YTXA 3HOXB 3PF4A 4GS3A 5EBDA 2UUCL 3CC7A 4XIGS 3W3AA 4JPBW 1QUQA 4IFDH 3VA7A 5IYBH 1U4LA 3AFQA 3F2DA 3I4NB 4HJ8A 1BCPB 1CSQA 1STAA 3HKZB 1YNNC 1CKNA 2H4OA 5IIFA 3IKJA 2NVTH 4ODGA 3TS0A 1GXDC 1NE3A 5CV6A 5JVG3 1PFNA 2J7ZA 1BNZA 3HOYB 1D2BA 2EXZA 2CFMA 5IYCG 4L63B 1SFOH 3TEHB 3S17H 1MHWC 1RDPD 1VS0A 3TP6A 3S2DB 4L5TA 1FNUA 2IW3A 2NVQB 2VL6A 5JJIA 4C1NI 5K36H 2I0QA 4K6LA 4AYBG 3A74A 2KVMA 4XDXA 1VQOA 1P8LA 1VCIA 2XWJB 2DUDA 2JA6H 3I72A 4B3TL 1J6QA 3M9BA 4L8JA 2RSNA 4DR7Q 3H3VH 3SR1A 2F3VA 4ZAIA 1TWAB 1K73C 4N8FA 2E2DC 3TBIB 1LTSD 1XYIA 1HR0L 1Z47A 1EY0A 1ONLA 3MC0B 4NDXA 2Q2IA 2OWOA 4LF9Q 3PO3G 1PDQA 4JCVE 3OSOA 5CMDA 1STGA 4IOCA 2AHOB 1MIUA 1QNUA 3GO5A 4DV7L 1L1OC 4XQJA 4B3RQ 3CCEA 4P2CB 1MI2A 4WJWA 4OX9L 4MN3A 1K8OA 3KUPA 1EOTA 4C3JH 2EY2A 1DJRD 1DM0B 5BR8Q 3CHBD 1G51A 4P73A 3DM1A 2L55A 1VQ9A 2K5QA 1Q1EA 1KDBA 2EY6A 2F0UA 5I2XA 4YCVA 3P7JA 5M9OA 1SJED 1FJGL 2LKVA 3VR4A 3AMUA 1ZYRD 2JA5B 1D6EC 4JI0Q 1K83B 3DEPA 2GA4B 2KCMA 2OF1A 3I90A 5CORA 3VR5A 4ZLTF 3R3OA 2WINB 3F2BA 2RVLA 3TP5A 1SYCA 3FP9A 2F0VA 3WDNA 4DNIA 2F0SA 2JA9A 3TREA 1E2WA 2VQEL 1B53A 3UDFA 1N34L 2IL8A 2F03A 4A3CG 1RL2A 2F3WA 2B2WC 3U50C 3TMEA 3GTGH 1BVSA 3K0XA 4RHRA 2A8VA 1EY8A 5CV9A 1AEXA 1BKBA 4J6HA 2EOTA 2SNSA 2SEBD 1X32A 5C0XI 1XNQL 4J1MA 5HY6A 3VYUA 2JYOA 3T1HQ 2ZJRA 2PCFB 3TN2A 3GTOH 3FRPB 2JA8H 4A75A 4K14A 3NQTA 3NBHA 3CXCA 4HJ7A 2NVTB 4DR5Q 4KI0A 1LT6D 1FD7D 3AQQA 5HURA 2C35B 3FKIG 1JORA 1CKMA 2HDLA 4QF4A 5ELDA 4A3JH 3SXHA 1AW7A 4R9WA 3A8IE 2MGSA 2PZWA 5C4XH 2R7FA 5CC4A 3S17B 1TWGH 1GUOA 2EYMA 3F8TA 4AQYL 5IWAQ 3J81L 5CBEE 3NE5B 4L5RC 3Q8DA 4A3BH 4IJHA 4F8MA 2MQHA 1Y1WH 1N8RC 2JA6B 1Y1VG 3W1GA 1ENFA 4NP5A 2LMCB 2UU9Q 4TQUS 2ES2A 1CM9A 1TVXA 1F9SA 1XPRA 2BE5D 1GOZA 2Z9HA 3S1QH 2FJ2A 1PZJD 3CW2C 2I5LX 1O7IA 1PVOA 1PH3A 3F2UA 1RF2D 2B29A 1T5XD 4A3GB 3D31A 2KOLA 2EYHA 1LTRD 3KLWA 2GVBA 2F0HA 5IGFA 1S4ZA 1VQCA 4DV0L 2K05A 4FVMA 1VQFA 3NTIA 2JSOA 1KNAA 2F0EA 1SNDA 3KLSX 4YY3L 1YNXA 1TIID 3MTSA 4BBSB 4O2DA 4TRDA 3DM3A 2JN4A 4Y7NH 5IT9L 1ESFA 2A5HA 3T1YQ 5D65A 4LF5Q 1GO3E 4R8NA 4MZ9A 2A73B 1UAPA 1BUVT 5EPKA 3ZYYX 2OEOA 4C3IB 4X65Q 3ULLA 5IE8A 2BCOA 1AE2A 1B3QA 2K5DA 1WTRA 5EBCA 1CHQD 4MTKA 5GAHC 1QE6A 4IUVA 3ONAB 3HOVG 2HD3A 3GTGB 4DR7L 1PFMA 1EYGA 5EGTA 2HCCA 4X3SA 3V96A 2IHEA 5EKKA 3J81c 4DPGA 2K28A 2UXCQ 2WIIB 2ZXRA 3HOWH 4FXKC 5I9PA 3DHQA 4KJNA 4HJ9A 2KECA 4TSSA 3CRLC 4A3EG 3H0GH 5EKIA 4MIUA 1X6OA 4B3RL 1GUTA 3D0FA 2WAQB 1HZBA 4CJ0B 1CKNB 3RD4A 1HJPA 1XX8A 4IPHA 4A3JB 1XTDA 4G7OC 2RBMA 3A8KE 4KD3A 2VS1A 5C4XB 1SE2A 1ZKOA 3STBD 2A6HD 4DU9A 5BR8L 4YHHQ 3UDGA 1UE5A 4DV5Q 3RZDH 1TWGB 1SNPA 1YNJC 1DZ1A 2OTLA 1JWSD 4G57A 5C3EB 2EY1A 4DR1L 1CK1A 3P20A 1SYEA 3I3CA 3MWYW 1KHIA 5M5YH 5FLMG 4KV6A 4UP9A 4JI5L 4KKTA 1F2LA 1NR2A 3VYRA 1MKHA 2UUBQ 4GOPA 1SNOA 3K58A 4L6TB 3SK4A 2NUCA 4C3JG 2X6GA 4RH6A 3M7NA 2I5HA 1H9MA 5TSSA 3Q22A 2Y0SG 3BYTB 3I70A 3PUZA 4C3IG 4IOAA 2B63H 4HCEA 4DN4M 1G91A 4JI4Q 1CHPD 1WTQA 4DV3Q 1JJGA 3EFXD 3SK8A 4HSVA 1TXYA 1YIJA 3QO2A 5FLXL 1C7YA 4XT1B 3OWEB 4X66Q 4X3UA 1H9RA 3HRZC 4QY7A 1NJIC 3ERQA 4OIJA 4ULLA 1LO5D 5IT9c 1U4PA 2H5XA 5GADC 4UAIA 4RKBA 3M4OH 4DUYQ 4KHPL 3BDLA 3PSIA 4H02A 3K5OA 1SEBD 2N8NA 3HGBA 3J80i 3T1HL 4OONA 4GLVB 5KEEA 2L11A 1O7YA 2VXWA 5M5XH 4IQZA 2K32A 4C2MH 2UUCQ 2JEBI 2AWOA 1N36L 1ILQA 3S24A 4DR5L 3CCLA 1I4QA 2MPMA 4B3SQ 3RUZA 1HUNA 1NR4A 1C48A 2CH4A 3RR5A 5JEAJ 5E4XA 1NNXA 5C3EG 1DCZA 1JE5A 3CPFA 3CMEA 1GM5A 1X3GA 2A19A 1EQTA 3J7AF 5IWAL 2VB2X 3HP3A 2AMCB 4JI2L 4EQNA 1WD1A 2D2CC 1NAPA 3SK5A 2IHFA 4QB4A 5ELEA 3S2HB 2WB1E 2EE1A 2K5WA 4KD4A 4A93G 2UU9L 1A3TA 1TWCH 3VR2A 4QUCA 2I07B 1SXTA 4GN3B 2ENBA 5E7NA 5LMUL 4XQQA 1VQJA 5E1FA 2VB3X 3NENA 1Q7YC 3A55A 3DEOA 2F3IA 4L5QA 4V190 3HOWB 2N78A 3HOZG 1GUGA 2EJMA 2GVAA 3H0GB 4A3KB 3E0EA 1DONA 3A56A 4K5VA 3NBHB 4BY7G 4RWSC 3M85A 1EY4A 1ZXTA 4FF2A 1VQ6A 3CCUA 1PZKD 3A5ZB 4DV7Q 4A3FH 2FMMA 3M4YA 5I2YA 4P72A 4K5XA 3OMGA 2NN6G 2L1BA 4JI6L 1KLGD 4OX9Q 2A68D 3NQIA 4ID6A 1K3RA 4NPSA 5M5YB 3K6OA 3HEJA 3T53B 2QGQA 2F4VL 5C44G 4JI8L 1SYDA 3RN2A 3GTKH 4RFBA 1RHPA 1TY2A 2IY5B 3CCQA 4JI7Q 4DA2A 2VUMG 4YWLA 3T1YL 1Y14B 4UP8A 4LF5L 3C1EA 2B63B 2RHQB 1EYAA 3PIOA 4CJ2C 2CHBD 3JAME 4X65L 2IPKD 2ICEC 1SMYC 2AQ3B 3S16H 1I50H 1W6JA 3K7UC 5DM73 1FJGQ 1BCPC 1H9KA 1VQNA 3AB9A 1JB7A 2YTVA 1HFNA 1TT2A 4BBRH 3FVQA 5JPNC 1VQGA 1NTGA 3M4OB 1PH6A 1SE3A 4H13C 1BCPF 1DYQA 3J81i 2WKDA 1EEFD 3S14B 3LX0A 1N34Q 1M1KC 1HPCA 4H0LC 4QL5A 1V43A 2YYZA 3NTKA 1WCMH 5AJ3L 1WYDA 2NZHA 4LF6Q 3K5MA 1X9NA 5M3MG 5M5XB 2XRQD 4C2MB 2A69C 2K03A 4ZKBB 1YI2A 4DK0A 3H09A 1PH9A 5C0XG 3QG1A 3TS2A 3M3YH 1SE8A 3CP0A 2LS01 3ERSX 3BYYB 4IPGA 2JA7B 1I6VC 2X69A 4YHHL 2ZXOA 2UXDL 4DV5L 1VQAA 4N9PA 5BN3A 1J8IA 2RDHA 4OL7A 3R93A 1KLUD 2RCFA 3IL8A 4FP5D 5IOCA 2KCTA 4AYBE 2FHTA 2A74C 1K9MC 5ELOA 2QEJC 3S1MH 2DNCA 3T4AC 3RLOA 3OTOQ 1EOVA 1HCZA 1X56A 3S1RH 2VQFQ 2D0OA 1M8AA 3PQIA 3CCVA 4ZCKA 1F9RA 1TWCB 5FJ8G 3PO2G 4JI4L 2L5TA 4KJOA 4DFAA 4X3KA 4R4IA 4HCSA 2MNAA 2A6EC 3BDOA 4UPAA 4WRDA 3S1NH 1KNEA 4CKCA 3HZXA 1MSHA 1WTHA 3D6CA 4X66L 4IALA 1SLJA 1PLFA 4NXNQ 3GTMH 1PRTD 3O13A 3JAML 2EJFC 3D4RA 1E3PA 4DR6L 3DXJC 1B50A 2OTJA 1LYLA 2PNRC 2L0CA 2XN9C 4DUYL 2K5HA 1WTOA 5M3FB 4DF7A 1F77A 5C5LA 1TS2A 3HKZE 1D7QA 4A3FB 5COYA 5BN4A 4A3DG 4GNXA 1EEID 2E2IB 1HHVA 3G6EA 4X6AH 2BDNA 3SHLA 2C5CA 2M9VA 4CBVA 4DV0Q 4B3SL 4HMJA 4BA2I 1EL0A 1IW7C 3G7LA 3GTKB 4A3IH 3AU7A 4H7BA 4OO1I 4GOPB 1IYJB 1EYDA 1EWCA 5C4HA 5E3FA 1HFGA 2LFNA 2RQXA 2Z0SA 4KY5A 3BJUA 4YY3Q 3KF8B 5CV5A 5G3LF 4C3HG 2HDMA 1XJVA 3S16B 3P1HA 4C1NK 1I50B 2G9HD 1YHBA 3G4SA 5I4DA 1VQ5A 2JQOA 1LV9A 4JBWA 4O0AA 1U4RA 4XT3B 1EY6A 2BH2A 1F2MA 3NP8A 3HOUG 4PQXA 1E0BA 2XTIA 3ULJA 1UEAB 3CQZB 1LT3D 3MA2B 4XYOA 1WCMB 4LF7Q 2Z4HA 3CCRA 2L15A 4IZ8A 1STHA 3GTQH 1RJTA 3CU7A 2V4DA 3M3YB 5M3FG 4TVAB 3J7AV 1I4RA 2F0PA 4DR4Q 4XQNA 4QQBX 1PYWD 1K0SA 4LUOA 2CW0D 3H3VC 4XXEA 3I4LA 2DN8A 3HOXG 1X3QA 4CKEA 1STEA 1MSGA 1F9PA 2BOSA 5KGUA 2OQ0A 3NK9A 5IGCA 4CHTB 1JOOA 2NWGA 2NBFA 4IURA 1QVGA 1VF7A 2E2HH 1U5KA 5DNFA 3HOVH 2QKIC 3HS0C 3I4NG 3PGZA 3OOCA 3JAMc 4A3MH 1PH4A 1E2ZA 3C3LA 1YBYA 1QWYA 3TP7A 4CGYB 1HQRD 3HKZG 1CFMA 3GQBA 4P75A 4JI7L 3ER0A 4X3TA 4DR1Q 4Q0FA 5E4WC 3D4DA 3EN2A 4K8IA 2WFWA 3E9HA 4JBJA 5M5WH 4JI5Q 3I4MH 2PI2A 3HFZB 1JMCA 3HOYG 4RHSA 3S1NB 1NMGA 1FGBD 4A3EH 5FKAC 3MZ5A 3KYHC 3EVQA 1HRJA 4KK7A 3RZOH 2E75C 4DK1A 1GHKA 3G71A 4YIJA 4OHJA 1GUWA 1Q12A 3BVMA 2F0DA 1LM0A 5GAEC 2OXPA 4R1JA 3AEVA 5CBAE 2IX0A 4DXFA 2EY5A 2FINB 2KA7A 4KHZA 1R4QB 4QGUA 4LF6L 1E2VA 1CZWA 1RD9D 3EJIA 3MXGA 3VR3A 4DR2Q 3SDZA 1IL8A 1F9QA 3LNNA 1VQ8A 1PTOD 4IUPA 4KHPQ 2EIFA 3BDCA 1TQOA 4A3IB 1HTPA 1D5MC 1B2TA 4PMWA 2JP1A 1KRTA 3E6ZX 2O5IC 1N36Q 3TZDA 2R92H 1VQ7A 1KC8C 3M4PA 2SDFA 1SNMA 3VYSA 2OQKA 4KHVA 2PMZE 1UEBA 3OTOL 4OO1H 1J5EL 2F0TA 2VQFL 1SFOB 2AUKA 2E76C 4JV5L 4V0BA 2R93H 2F0MA 4E6IA 1I4PA 4JI2Q 1KQSA 5IP9G 4JBKA 1TY0A 1VQMA 2JA5G 2MO0A 3CCMA 1NY4A 2AKWB 4F87A 2K14A 4LFCL 2KENA 1QNKA 1BBWA 1CSPA 5CV4A 1ICWA 4KN7C 4NXNL 3GTQB 4JI1L 1HA5A 3QJYA 2Q8TA 3I91A 5ELFA 5LMUQ 3K5NA 3DWPA 3PIPA 3TSSA 3EQLC 5CR3A 1SE4A 3PUVA 3KFUA 1YNND 2KHIA 2KHSA 4IFDG 2XIWA 2AQ2B 5IYBG 2E2HB 1V8QA 2J4XA 1E7ZA 3PUXA 2Z1CA 4HTHA 4A93H 4GKKL 5DEHA 1EQVA 5IY0A 1QILA 1EY5A 3F2CA 1V1OA 2Y0SE 3IRBA 1QVFA 3R2IA 3QOLA 1XWEA 4JI6Q 5I9OA 1SR3A 3IFTA 2HIVA 3I4MB 1EFWA 4NKLA 1FNVA 3CAMA 1G291 2F4VQ 3HOZH 1TWHH 4JI8Q 5C4JH 1O78A 3J7YW 4BY1H 3VDYA 3RZOB 4LF8L 2ZT9C 1STYA 5K36G 2AQ1B 4BY7H 2TMPA 1YHAA 3BVZA 4FF1A 4RGTA 2HQLA 2JA6G 2ZXPA 5JEAH 2KEEA 2NN6H 1U4MA 4DV1Q 3X3NA 4K5WA 3LGJA 3G6JB 2RKSA 1PHJA 4LF7L 1JE4A 2DY7A 3R2TA 2MJ8A 3TQYA 2PPBC 1LTBD 1BF4A 4GNXB 4LK1C 1HZCA 4DR4L 3BZKA 3FDTA 1C0AA 3WWVA 1I94L 4JW0A 5IP7H 3ITPA 3MEHA 3K5LA 5AJ3Q 2CWAA 3GTOB 2Z6KA 2JA8B 1LTAD 2H1EA 5A35A 1XMOL 4A3GG 4EQ5A 1HNZQ 1LLRD 1AN8A 1S40A 2E2JH 1A63A 1PMRA 2B3GA 2R92B 1NCVA 4K0KQ 4HJAA 1IBML 1X3EA 4KMUC 2Z4IA 4M1UB 4BA1I 4WJ4A 1VF5C 4G7ZC 5LL6X 2QW7A 4GN4B 2UXDQ 1WI5A 2K52A 1UNSA 2F1MA 1KL9A 4ZK9B 5D14A 1RKNA 3RLFA 2NB0A 3HG9A 3PIO3 2DY8A 1AZQA 4BBSG 2R93B 1LT4D 3KJOA 3Q23A 2QILA 4A3BB 4B9WA 1MD2D 4I65A 1QJOA 1K8MA 3KLRA 1SYGA 4HMIA 3OPOA 1Y1WB 4DAPA 1C8CA 2WP8J 1A2UA 3KF6B 2R7DA 1CZGA 1TR5A 2B2YA 3KF8A 1S5CD 4WFN3 3I8ZA 1VQBA 1WD0A 5JJKA 3H94A 3S1QB 4YWKA 1VMPA 1FNWA 4HJ5A 1K8AC 2QA4A 1IKMA 2TSSA 3KBGA 3M4QA 4ZUIA 3OYYA 5CV7A 1XTCD 3CRKC 1RODA 2N3SA 4DR2L 3KOJA 3FPUB 5EJWA 1H9SB 4DR6Q 3N52A 3TZUA 5GAGC 2R7ZH 2CCZA 2JA8G 5LMNW 1LTGD 4CJ1B 2QDBA 3DMUA 3QIAA 2HCIA 4HIMA 1QG7A 2N55A 2WAQG 3MXPA 4GKJQ 1UE7A 1RTOA 4A3JG 2VW9A 5FO9B 1HNWL 4IUUA 5C4XG 3R8BA 1VQPA 1L0WA 5C4JB 4ZYSA 3BVGA 4BY1B 4Y7NB 4IO9A 2OCEA 1LTTD 3K7AH 1G8ZD 5JOBA 2J0TD 2Q8IB 2F0IA 2VZAA 4A3BG 2I46A 1ML0D 1P16A 1Y1WG 2WKCA 1CQVA 1JOQA 4PMCA 3PF5A 3KBXA 1TS5A 2BDOA 3SK6A 5DLQE 2DNEA 2JJQA 4JC0A 1Y8OB 2Z6BA 4R4CA 1S5BD 1V1PB 4S3SA 1S5FD 1I4HA 5HGTA 4X64L 4ZRZA 4DK3C 1GVPA 5C4ZA 5KRUA 1LUZA 2PZUA 1L0XB 2F52A 2FFKB 1O7ZA 1STNA 3D8GA 2BA1A 1ET9A 4JG2A 1QZHA 1EWHA 2E2JB 1Y8PB 4PNYA 1PV4A 5T1GA 2ICIA 1ENAA 5IYCH 2CWPA 2F0NA 5J3BA 2G5DA 3BZCA 3URYA 2Z6KC 3E5SA 4P74A 3RZDB 5C0XJ 1XPOA 1LTLA 1Q1BA 2F0OA 1OXVA 4QJFA 1KXLA 1E22A 3NEMA 1IXRA 4KLKA 1MJEA 1WOCA 1IZ6A 2WB1B 2JEAI 1AP0A 1N33L 4LUZA 2RDGA 1HQMC 5KIXA 1NUCA 2K50A 4WORA 1SNCA 3PO3H 1F2ZA 3MAQA 4OWTB 4DAVA 3H91A 2B8GA 1L0YB 2HT1A 1OXUA 4R4OA 3U9OA 5JJZA 1CA5A 4BWGB 1Y8NB 2RDFA 4GOPC 1PH5A 1G6ZA 4DV1L 3D4WA 2KBNA 3I4NH 4JK1C 4RA8A 2B2YC 4C56C 1BQQT 1EY9A 3VYTA 4DUZL 4X62Q 1JJCB 4RAUC 1JT8A 2KHJA 3HOWG 1U9RA 1PH2A 5C3XA 3C1FA 2VNUD 2HUGA 4LFAQ 3H0GG 4A3KG 4A3LG 1IHZA 1VQHA 3K80C 4UY8C 1KD1C 2ZM6L 4IJLA 1YEZA 1HNZL 4JVZA 1YNJD 2RA4A 1MBYA 2JE6I 1SN8A 2E8GA 2F0JA 4K0KL 2HIXA 4BS9A 2NVQH 3L7ZC 2QCPX 3FMCA 1PRTB 2N88A 4AH6A 5FK9C 5K5PA 4QUFA 4K8JA 1X3FA 1DOKA 1LTID 4YCUA 2NTTA 3K7AB 1CKOA 4QCLA 1EIHA 2B2UA 1ASYA 1EYCA 3X3MA 1G2TA 2IX1A 4TKOB 5IGEA 4GZYC 4A3CH 1XXGA 1ZYRC 4LWCA 1CA6A 3P75A 1D5XC 1NBWA 4F88A 1BO0A 4DAYA 5GROA 4APVA 3KLSA 4L5SA 1PTOH 1AZPA 2CQAA 3U4VA 1ET6A 1J5EQ 3FHWA 2B63G 4U68A 1KAWA 4JV5Q 1BDOA 4G7HC 1JWMD 2QEXA 3N6RA 2XGTA 4ALPA 3DWQA 4QIWB 1DOMA 3OW2A 3WOFA 4AIMA 4KTAA 4DR3Q 2QF7A 4UP7A 1XMQL 5AFWA 3J80E 4LFCQ 4IUNA 4EVOA 3FKIH 1JWUD 4PZ7A 4JI1Q 1YITA 2BA0A 1WTWA 3CC2A 1R4PB 2UXBL 4FDBA 1K0RA 4B9XA 3CPWA 1JC7A 3D3RA 5NUCA 2SNMA 1YJNA 4AYBB 2B2WA 3W2DA 4FF3A 1HNXL 5FO7B 1VQ4A 1VQDA 1Y1VH 4GKJL 1QVCA 2EPBA 1K83H 3L9AX 2K5VA 4OXPA 5T1IA 2JA7G 5GQOA 4GKKQ 2NVXH 5ELCA 3RLNA 1DOLA 4ZKCB 1Z7TA 2E5LQ 4DV6L 1L2FA 2PW7A 3MVVA 2LSSA 1K8GA 3PO3B 3U9SA 2AWNA 4O1NA 3Q0AA 2PNHA 4NXMQ 3HKSA 2KQ3A 2MO1A 4MHEA 3A8JE 4DV2Q 5IGGA 2BE5C 1EZ8A 1CQFA 1X3PA 5F2DA 1Q8IA 1H95A 1CUKA 3T13A 4LF8Q 2CH4W 4I7ZC 4FO2A 1KDAA 4HEDA 1DD2A 2LXKA 1WTPA 4WJ3M 4ABNA 4BBRB 2B8FA 2K04A 1OXXK 1HA6A 3TRZA 1DGSA 1C4QA 3D6WA 1SDFA 3PIP3 3Q24A 4RCNA 3KF6A 3JC66 1TU2B 4KY6A 4LFBQ 3KK7A 1FGUA 1FVIA 3T51B 1JB3A 3OHXC 3DLLA 3KDFA 4BXXG 3K0YA 5KYIA 4OGQC 4HIOA 2HHHL 2ATWA 4A3FG 3J80L 3CCSA 1I94Q 1FL0A 1YZ6A 4NMZA 1W6KA 1XMOQ 5CGKA 1O7LA 1TS4A 2Q2UA 1N32Q 4RKLA 1H9SA 1MGSA 4CDFC 1EIGA 1U0LA 2WACA 2ZJPA 1IBMQ 3EBEA 1VQKA 3S1MB 2CKZB 1SMYD 3AYHB 2BH8A 1BR9A 1PTOB 1UUPA 1BCPD 3BU2A 3CCJA 1S5DD 3S1RB 1PH8A 3DUZA 3SVMA 2B2UC 1KDCA 1A0IA 1VQIA 1EQQA 3PUWA 3I4OA 5J1ZA 1TS3A 4LUVA 1XNRQ 4A3GH 4EQPA 1QOHA 3J81E 1RCVD 2NN6I 2UUAQ 1O80A 1TKWB 4BBRG 3FPPA 4LF4Q 3FKIB 2V1CC 3GTMB 5KYLA 2A69D 3NHHA 4HIKA 2C9OA 2ASBA 3SEBA 1KRSA 3A5UA 3U4ZA 2M00A 5JVH3 4X62L 5BN5A 4UHVA 1WCMG 2ZJQA 1JOKA 2EJGC 4NB3A 4BBSH 4DV4Q 1A6XA 1V1PA 2B2TA 3F1ZA 5FLMH 2MFIA 4PMBA 3S9WA 4LFAL 3MFGA 4KKUA 3STBC 2A6HC 1TWFH 1Z9FA 2DJGC 5LL6S 1KIXA 1Y1VB
chains in the Genus database with same CATH topology
1HZCA 1Q7YC 4L5QA 4DR4L 2F3IA 5HGQA 4ME3A 3BZKA 4Y52H 2JA5H 1C0AA 3WWVA 2N78A 4C3IH 1I94L 5IP7H 3HOZG 1VQLA 5AJ3Q 2CWAA 4JI3Q 2Z6KA 4A3GG 1XMOL 2GVAA 4EQ5A 1HNZQ 2R6GA 3E0EA 5IYDH 1S40A 3W5OA 3PV0A 2E2JH 1A63A 1UWVA 2B3GA 1Q82C 3NBHB 4IFDJ 2PQAA 1I5FA 4K0KQ 2ID0A 4BY7G 4GLXA 1KXLA 4GNXC 4HJAA 3L0OA 3M85A 1IBML 1VQ6A 3CCUA 2R93G 1HNWQ 1X3EA 1IBLQ 2YTXA 3A5ZB 3SGIA 4BA1I 3PF4A 4DV7Q 4GS3A 4A3FH 4WJ4A 2UUCL 4GN4B 3S15H 1WI5A 2K52A 2UXDQ 4P72A 1WJJA 3CC7A 4MTNA 4IPCA 2NN6G 4XIGS 4JI6L 1QUQA 4OX9Q 1JJ2A 1K3RA 1KL9A 2YTYA 4NPSA 3RLFA 3UDIA 5IYBH 3AFQA 3J80c 4BBSG 2QGQA 3EIVA 3KJOA 3F2DA 2F4VL 5C44G 4JI8L 3RN2A 4HJ8A 3GTKH 2IY5B 4B3MQ 3CCQA 4JYAQ 1CSQA 4JI7Q 2VUMG 1CKNA 1BBUA 4YWLA 4DR3L 1Y14B 2WP8J 4UP8A 3T1YL 3CC4A 4LF5L 2NVTH 3TS0A 2RHQB 2R7DA 3KF6B 2JK8A 3PIOA 1NE3A 1UE6A 1A8VA 1VQBA 4X65L 5IYDG 3S16H 5JJKA 4X64Q 1I50H 4POGA 3K7UC 2CFMA 5C3EH 4YWKA 5IYCG 1FJGQ 1SFOH 3TEHB 3S17H 1VQNA 1VS0A 3AFPA 2QA4A 4HJ5A 1K8AC 4L5TA 1JB7A 2YTVA 2VL6A 3M4QA 1YJWA 5JJIA 2I0QA 3OYYA 4AYBG 4BBRH 3A74A 1M90C 1N32Q 1VQOA 1ASZA 1VQGA 1NTGA 2N3SA 1P8LA 1PH6A 1VCIA 4DR2L 3KOJA 2JA6H 2DUDA 2K75A 3J81i 4DR6Q 4B3TL 3UE0A 1J6QA 3M9BA 5GAGC 1N34Q 4DR7Q 1M1KC 2R7ZH 3H3VH 4QL5A 4A3IG 2CCZA 1V43A 2YYZA 1K73C 4DK6C 1X55A 1WCMH 5LMNW 5AJ3L 4JI3L 1L1OB 1WYDA 2NZHA 4LF6Q 1X9NA 5M3MG 4A76A 1YI2A 1PYSB 4HIMA 1Z47A 4DAYB 1PH9A 1HR0L 1X65A 2WAQG 5C0XG 2E5LL 3TS2A 2Q2IA 4DKAC 1SE8A 2OWOA 4LF9Q 1IL2A 3PO3G 3M3YH 2EXDA 3CP0A 4JCVE 4GKJQ 1UE7A 4A3JG 2VW9A 3GTLH 4IOCA 1V9PA 2AHOB 1HNWL 3ERSX 1MIUA 4IPGA 1VQPA 5C4XG 1L0WA 3GO5A 4NXML 4DV7L 3U58A 1EUJA 4YHHL 2UXDL 4DV2L 4DV5L 1L1OC 4IO9A 1N33Q 2OCEA 4B3RQ 1VQAA 3K7AH 3CCEA 2IT1A 4OX9L 4C3JH 2KCTA 2VZAA 4A3BG 4AYBE 2JA8G 1K9MC 1P16A 5ELOA 2ZTCA 5BR8Q 1Y1WG 3S1MH 2RHSB 1G51A 1GKHA 5LMNQ 3RLOA 3OTOQ 1EOVA 1X56A 3S1RH 4P73A 2VQFQ 2RF4A 3PF5A 2D0OA 3CCVA 1VQ9A 2N49A 1S72A 1Q1EA 5DLQE 3A0JA 2JJQA 4JC0A 5FJ8G 4R4CA 3PO2G 4JI4L 1E1OA 4OWWB 4YCVA 4LFBL 4R4IA 2WAQE 4X64L 5C44H 2MNAA 4UPAA 3H15A 3S1NH 1FJGL 4DK3C 1GVPA 4DUZQ 3UDXA 1LUZA 2F52A 4R4QA 4X66L 2VUMH 4JI0Q 2BA1A 1SLJA 3J7A5 4JG2A 2KCMA 3GTMH 4NXNQ 2Q2TA 3CF5A 3F2BA 1B70B 1QZHA 2NVYH 3FP9A 2ZM6Q 4DNIA 3CMAA 1E3PA 2JA9A 3TREA 4DR6L 2VQEL 1N32L 2OTJA 3UDFA 1N34L 1LYLA 4LW1A 4DUYL 1RL2A 3GTJH 2K5HA 3U50C 1PV4A 3S2HH 4A3MG 5IYCH 2CWPA 1IBKQ 3GTGH 1BVSA 3HKZE 3K0XA 3GDEA 1D7QA 5J3BA 2A8VA 3JAMi 1XPUA 1BKBA 3BZCA 1QZGA 4A3DG 2Z6KC 4GNXA 4P74A 4LF9L 5C0XJ 3G6EA 1XPOA 1LTLA 1Q1BA 1QUQB 4X6AH 5C0XI 1XNQL 5HY6A 3I4MG 3KJPA 3I55A 4DV0Q 1D8LA 1OXVA 3B6YA 1EWIA 4QJFA 1E22A 2ZJRA 3NEMA 1IXRA 4KLKA 1MJEA 1WOCA 4BA2I 1IZ6A 3GTOH 4A3CG 2JA8H 4A3IH 2JEAI 4A75A 4A3KH 4A3LH 1XNRL 1N33L 4LUZA 4OO1I 4GOPB 1IYJB 5M3MH 3CXCA 4HJ7A 2K50A 4IPDA 4DR5Q 4KI0A 2GN5A 3AQQA 1AE3A 2Z0SA 2UUAL 2C35B 1E24A 1Q81C 3FKIG 3BJUA 4YY3Q 1CKMA 3CD6A 3PO3H 3KF8B 1NMFA 4A3JH 4LF4L 4OWTB 3GD7A 3K8AA 1XJVA 2HT1A 1MJCA 1OXUA 5C4XH 1V1QA 2R7FA 4R4OA 1YHBA 1SMXA 1TWGH 3G4SA 4GOPC 3KDFB 1PH5A 1VQ5A 1WFQA 4YWMA 3PCOB 2JQOA 3F8TA 4DV1L 4AQYL 4JBWA 5IWAQ 1XMQQ 2KBNA 4O0AA 3I4NH 4L5RC 4DV4L 3PUYA 3Q8DA 4A3BH 2BH2A 1EQRA 4IJHA 1GD7A 3HOUG 2MQHA 1Y1WH 1N8RC 2XTIA 4DUZL 1G6PA 3ULJA 4X62Q 1Y1VG 1JJCB 2UXBQ 3W1GA 3I56A 1JT8A 2KHJA 3HOWG 4JI0L 2PI2E 1PH2A 5ELNA 2UU9Q 4LF7Q 3ZJYC 2VNUD 4P71A 4TQUS 3CCRA 2L15A 3MEFA 3H0GG 4LFAQ 5FJ8H 1SRUA 1VQHA 3K80C 4A3KG 2ES2A 3GTQH 3PO2H 1XPRA 4A3LG 4UY8C 1KD1C 2ZM6L 4IJLA 4XTCS 1YEZA 1HNZL 3S1QH 5M3FG 4TVAB 2R92G 2JE6I 1SN8A 2E8GA 2NZOA 4DR4Q 1HNXQ 4QQBX 4K0KL 1E1TA 1OXSC 3CW2C 2HIXA 2I5LX 1O7IA 4LUOA 3UE1A 1PH3A 3L7ZC 2NVQH 1PVOA 4AH6A 3HOXG 1X3FA 1IBLL 4OO1G 2B29A 4GN5A 4YCUA 4PZ8A 3D31A 3KLWA 3E9IA 2OQ0A 1CKOA 2GVBA 4HIDA 2ALYB 3S14H 1VQCA 1ASYA 1QVGA 2YU9H 4DV6Q 4DV0L 1U5KA 2E2HH 2K5NA 2IX1A 1Q46A 3HOVH 3I4NG 4A3CH 3PGZA 4LWCA 1VQFA 3JAMc 4A3MH 1PH4A 1W3SA 1OTCA 1NBWA 1YBYA 5GROA 4APVA 3HKZG 4B3ML 4L5SA 4JYAL 4P75A 3GTPH 4JOIA 3U4VA 3ER0A 4JI7L 1J5EQ 2ZTEA 3FHWA 1R9TH 2B63G 4A3DH 1KAWA 4DR1Q 4YY3L 1YNXA 4JV5Q 3EN2A 2JA7H 4O2DA 2WFWA 3E9HA 4JBJA 5M5WH 4JI5Q 2QEXA 2PI2A 3DM3A 2XGTA 3HFZB 4ALPA 1JMCA 1EIYB 3HOYG 4Y7NH 3OW2A 1NMGA 4A3EH 1HZAA 4AIMA 1PYBA 3T1YQ 3KYHC 4DR3Q 2I5MX 4LF5Q 3RZOH 1GO3E 1C9OA 1SROA 4UP7A 1XMQL 4MZ9A 3G71A 4LFCQ 3W1BA 3I7FA 1Q12A 3FKIH 4X65Q 1PH1A 3ULLA 4PZ7A 5IE8A 4JI1Q 3UDGA 4C3HH 4PG3A 1AE2A 2BA0A 1YITA 1PH7A 3CC2A 1LM0A 5GAEC 2UXBL 4FDBA 1K0RA 5GAHC 3CPWA 2PQAB 4R1JA 3AEVA 3HOVG 2IX0A 4DR7L 1EYGA 4DAMA 2HHHQ 4KHZA 1YJNA 4LNQA 4QGUA 1OXTA 4LF6L 5EAYA 4DR2Q 1VQ8A 3HOUH 1PA6A 4B3TQ 2IHEA 1HNXL 3J81c 4DPGA 4KHPQ 1VQ4A 1VQDA 1Y1VH 4GKJL 1QVCA 2UXCQ 4EX5A 4PZ6A 1K83H 4GLAC 2EIFA 2K5VA 4OXPA 2JA7G 5GQOA 3HOWH 3K81C 4RG1A 4GKKQ 2NVXH 4BY1G 4HJ9A 3RLNA 4R4TA 4A3EG 1HR0Q 3H0GH 4PMWA 2E5LQ 1KRTA 1X6OA 4B3RL 4IFDI 2LXJA 3D0FA 1N36Q 4BXXH 1HZBA 4DV6L 1L2FA 1K8GA 1CKNB 2LSSA 5M3FH 2R92H 4RMFA 1HJPA 1VQ7A 2YV5A 1N9WA 2AWNA 4IPHA 2Q2HA 3M4PA 1XTDA 3RN5A 1KC8C 1I6HH 2PNHA 4NXMQ 1I3QH 2MO1A 3HKSA 2VS1A 2VY3A 3STBD 5FLXc 2OQKA 5JEAG 5BR8L 4YHHQ 1X54A 1UE5A 2PMZE 4DV2Q 1UEBA 3HOXH 4DV5Q 5LMNL 3OTOL 3RZDH 1J5EL 2E2IH 2VQFL 2OTLA 4DR1L 1H95A 1CUKA 1HH2P 4LF8Q 1Q86C 4B3SL 4JV5L 5FLMG 1KHIA 5M5YH 4UP9A 4JI5L 2R93H 2LXKA 4WJ3M 1MKHA 2UUBQ 4GOPA 4JI2Q 1KQSA 5IP9G 4JBKA 1OXXK 3TRZA 3M7NA 3G48A 5JJLA 2I5HA 1DGSA 1VQMA 2JA5G 2MO0A 2Y0SG 4POFA 3CCMA 1NY4A 2AKWB 3PUZA 4IOAA 1A62A 1Q8KA 2K14A 3KF6A 3JC66 4LFCL 5IP7G 1YHQA 2B63H 4JI4Q 1EIFA 2KENA 1AH9A 1BBWA 1CSPA 4DV3Q 2RCNA 4NXNL 4LFBQ 1JJGA 4JI1L 1YVCA 1TXYA 2EQSA 1FGUA 1FVIA 1YIJA 3HOYH 3DLLA 5LMUQ 3KDFA 4BXXG 3H3VI 1C7YA 2A1AA 4X66Q 3PIPA 3S2DH 4QY7A 4MNOA 4HIOA 2HHHL 1NJIC 1IBKL 4A3FG 2ATWA 3CCSA 1HZ9A 1I94Q 5IT9c 1FL0A 1YZ6A 3PUVA 2H5XA 5GADC 3KFUA 1XMOQ 3T1HQ 2KHIA 3M4OH 2VQEQ 2Q2UA 2K4KA 3CQZH 2ZTDA 4IFDG 5IYBG 4DUYQ 4KHPL 3ICEA 3L2PA 3PSIA 1B7YB 2UXCL 1E7ZA 1U0LA 3PUXA 4H02A 4QIWE 3J7ZC 2ZJPA 2N8NA 3J80i 3T1HL 1W2BA 2WB1G 4A93H 4OONA 4GKKL 1IBMQ 1TWAH 5IY0A 3EBEA 4GLVB 1L1OA 1VQKA 2CKZB 3I2ZA 3AYHB 2BH8A 5M5XH 4C2MH 1UE1A 3F2CA 2JEBI 2AWOA 4J15A 2UUCQ 1N36L 2Y0SE 3BU2A 3IRBA 3S24A 3MXNB 4A4IA 3CCJA 1QVFA 1XNQQ 4DR5L 2D62A 1PH8A 3CCLA 4JI6Q 1SR3A 4B3SQ 3RNUA 1A0IA 1VQIA 2HIVA 1B8AA 1EQQA 1EFWA 3CAMA 3PUWA 3I4OA 1G291 2F4VQ 4LUVA 3RR5A 1XNRQ 2FXQA 1TWHH 4JI8Q 5C4JH 4JBMA 3HOZH 5JEAJ 5C3EG 4A3GH 4BY1H 1JE5A 3CPFA 3CMEA 3VDYA 1GM5A 4LF8L 1VQEA 2NN6I 1X3GA 3NELA 2A19A 4JOIC 3J81j 2UUAQ 5K36G 5H1SE 4BY7H 4BBRG 4YCWA 5IWAL 2DGYA 4LF4Q 1YHAA 2V1CC 2UUBL 2AMCB 4JI2L 4OWXB 1HR0W 2ASBA 3I4MH 2HQLA 4HIKA 1YJ9A 2JA6G 3A5UA 1KRSA 3ULPA 3U4ZA 2IHFA 4X62L 2R7ZG 4DV1Q 4AQYQ 1WCMG 2ZJQA 2WB1E 3LGJA 4NB3A 4BBSH 1T9HA 1PFSA 4DV3L 4DV4Q 1TWCH 1PHJA 2UU9L 4LF7L 4A93G 2D0PA 3F1ZA 5FLMH 2MFIA 4LFAL 3TQYA 4GN3B 5E7NA 3STBC 2CQOA 1TWFH 1S3OA 1Z9FA 5LMUL 1VQJA 5IP9H 1KIXA 4GNXB 3NENA 1RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZC A;  1Q7Y C;  4L5Q A;  4DR4 L;  2F3I A;  5HGQ A;  4ME3 A;  3BZK A;  4Y52 H;  2JA5 H;  1C0A A;  3WWV A;  2N78 A;  4C3I H;  1I94 L;  5IP7 H;  3HOZ G;  1VQL A;  5AJ3 Q;  2CWA A;  4JI3 Q;  2Z6K A;  4A3G G;  1XMO L;  2GVA A;  4EQ5 A;  1HNZ Q;  2R6G A;  3E0E A;  5IYD H;  1S40 A;  3W5O A;  3PV0 A;  2E2J H;  1A63 A;  1UWV A;  2B3G A;  1Q82 C;  3NBH B;  4IFD J;  2PQA A;  1I5F A;  4K0K Q;  2ID0 A;  4BY7 G;  4GLX A;  1KXL A;  4GNX C;  4HJA A;  3L0O A;  3M85 A;  1IBM L;  1VQ6 A;  3CCU A;  2R93 G;  1HNW Q;  1X3E A;  1IBL Q;  2YTX A;  3A5Z B;  3SGI A;  4BA1 I;  3PF4 A;  4DV7 Q;  4GS3 A;  4A3F H;  4WJ4 A;  2UUC L;  4GN4 B;  3S15 H;  1WI5 A;  2K52 A;  2UXD Q;  4P72 A;  1WJJ A;  3CC7 A;  4MTN A;  4IPC A;  2NN6 G;  4XIG S;  4JI6 L;  1QUQ A;  4OX9 Q;  1JJ2 A;  1K3R A;  1KL9 A;  2YTY A;  4NPS A;  3RLF A;  3UDI A;  5IYB H;  3AFQ A;  3J80 c;  4BBS G;  2QGQ A;  3EIV A;  3KJO A;  3F2D A;  2F4V L;  5C44 G;  4JI8 L;  3RN2 A;  4HJ8 A;  3GTK H;  2IY5 B;  4B3M Q;  3CCQ A;  4JYA Q;  1CSQ A;  4JI7 Q;  2VUM G;  1CKN A;  1BBU A;  4YWL A;  4DR3 L;  1Y14 B;  2WP8 J;  4UP8 A;  3T1Y L;  3CC4 A;  4LF5 L;  2NVT H;  3TS0 A;  2RHQ B;  2R7D A;  3KF6 B;  2JK8 A;  3PIO A;  1NE3 A;  1UE6 A;  1A8V A;  1VQB A;  4X65 L;  5IYD G;  3S16 H;  5JJK A;  4X64 Q;  1I50 H;  4POG A;  3K7U C;  2CFM A;  5C3E H;  4YWK A;  5IYC G;  1FJG Q;  1SFO H;  3TEH B;  3S17 H;  1VQN A;  1VS0 A;  3AFP A;  2QA4 A;  4HJ5 A;  1K8A C;  4L5T A;  1JB7 A;  2YTV A;  2VL6 A;  3M4Q A;  1YJW A;  5JJI A;  2I0Q A;  3OYY A;  4AYB G;  4BBR H;  3A74 A;  1M90 C;  1N32 Q;  1VQO A;  1ASZ A;  1VQG A;  1NTG A;  2N3S A;  1P8L A;  1PH6 A;  1VCI A;  4DR2 L;  3KOJ A;  2JA6 H;  2DUD A;  2K75 A;  3J81 i;  4DR6 Q;  4B3T L;  3UE0 A;  1J6Q A;  3M9B A;  5GAG C;  1N34 Q;  4DR7 Q;  1M1K C;  2R7Z H;  3H3V H;  4QL5 A;  4A3I G;  2CCZ A;  1V43 A;  2YYZ A;  1K73 C;  4DK6 C;  1X55 A;  1WCM H;  5LMN W;  5AJ3 L;  4JI3 L;  1L1O B;  1WYD A;  2NZH A;  4LF6 Q;  1X9N A;  5M3M G;  4A76 A;  1YI2 A;  1PYS B;  4HIM A;  1Z47 A;  4DAY B;  1PH9 A;  1HR0 L;  1X65 A;  2WAQ G;  5C0X G;  2E5L L;  3TS2 A;  2Q2I A;  4DKA C;  1SE8 A;  2OWO A;  4LF9 Q;  1IL2 A;  3PO3 G;  3M3Y H;  2EXD A;  3CP0 A;  4JCV E;  4GKJ Q;  1UE7 A;  4A3J G;  2VW9 A;  3GTL H;  4IOC A;  1V9P A;  2AHO B;  1HNW L;  3ERS X;  1MIU A;  4IPG A;  1VQP A;  5C4X G;  1L0W A;  3GO5 A;  4NXM L;  4DV7 L;  3U58 A;  1EUJ A;  4YHH L;  2UXD L;  4DV2 L;  4DV5 L;  1L1O C;  4IO9 A;  1N33 Q;  2OCE A;  4B3R Q;  1VQA A;  3K7A H;  3CCE A;  2IT1 A;  4OX9 L;  4C3J H;  2KCT A;  2VZA A;  4A3B G;  4AYB E;  2JA8 G;  1K9M C;  1P16 A;  5ELO A;  2ZTC A;  5BR8 Q;  1Y1W G;  3S1M H;  2RHS B;  1G51 A;  1GKH A;  5LMN Q;  3RLO A;  3OTO Q;  1EOV A;  1X56 A;  3S1R H;  4P73 A;  2VQF Q;  2RF4 A;  3PF5 A;  2D0O A;  3CCV A;  1VQ9 A;  2N49 A;  1S72 A;  1Q1E A;  5DLQ E;  3A0J A;  2JJQ A;  4JC0 A;  5FJ8 G;  4R4C A;  3PO2 G;  4JI4 L;  1E1O A;  4OWW B;  4YCV A;  4LFB L;  4R4I A;  2WAQ E;  4X64 L;  5C44 H;  2MNA A;  4UPA A;  3H15 A;  3S1N H;  1FJG L;  4DK3 C;  1GVP A;  4DUZ Q;  3UDX A;  1LUZ A;  2F52 A;  4R4Q A;  4X66 L;  2VUM H;  4JI0 Q;  2BA1 A;  1SLJ A;  3J7A 5;  4JG2 A;  2KCM A;  3GTM H;  4NXN Q;  2Q2T A;  3CF5 A;  3F2B A;  1B70 B;  1QZH A;  2NVY H;  3FP9 A;  2ZM6 Q;  4DNI A;  3CMA A;  1E3P A;  2JA9 A;  3TRE A;  4DR6 L;  2VQE L;  1N32 L;  2OTJ A;  3UDF A;  1N34 L;  1LYL A;  4LW1 A;  4DUY L;  1RL2 A;  3GTJ H;  2K5H A;  3U50 C;  1PV4 A;  3S2H H;  4A3M G;  5IYC H;  2CWP A;  1IBK Q;  3GTG H;  1BVS A;  3HKZ E;  3K0X A;  3GDE A;  1D7Q A;  5J3B A;  2A8V A;  3JAM i;  1XPU A;  1BKB A;  3BZC A;  1QZG A;  4A3D G;  2Z6K C;  4GNX A;  4P74 A;  4LF9 L;  5C0X J;  3G6E A;  1XPO A;  1LTL A;  1Q1B A;  1QUQ B;  4X6A H;  5C0X I;  1XNQ L;  5HY6 A;  3I4M G;  3KJP A;  3I55 A;  4DV0 Q;  1D8L A;  1OXV A;  3B6Y A;  1EWI A;  4QJF A;  1E22 A;  2ZJR A;  3NEM A;  1IXR A;  4KLK A;  1MJE A;  1WOC A;  4BA2 I;  1IZ6 A;  3GTO H;  4A3C G;  2JA8 H;  4A3I H;  2JEA I;  4A75 A;  4A3K H;  4A3L H;  1XNR L;  1N33 L;  4LUZ A;  4OO1 I;  4GOP B;  1IYJ B;  5M3M H;  3CXC A;  4HJ7 A;  2K50 A;  4IPD A;  4DR5 Q;  4KI0 A;  2GN5 A;  3AQQ A;  1AE3 A;  2Z0S A;  2UUA L;  2C35 B;  1E24 A;  1Q81 C;  3FKI G;  3BJU A;  4YY3 Q;  1CKM A;  3CD6 A;  3PO3 H;  3KF8 B;  1NMF A;  4A3J H;  4LF4 L;  4OWT B;  3GD7 A;  3K8A A;  1XJV A;  2HT1 A;  1MJC A;  1OXU A;  5C4X H;  1V1Q A;  2R7F A;  4R4O A;  1YHB A;  1SMX A;  1TWG H;  3G4S A;  4GOP C;  3KDF B;  1PH5 A;  1VQ5 A;  1WFQ A;  4YWM A;  3PCO B;  2JQO A;  3F8T A;  4DV1 L;  4AQY L;  4JBW A;  5IWA Q;  1XMQ Q;  2KBN A;  4O0A A;  3I4N H;  4L5R C;  4DV4 L;  3PUY A;  3Q8D A;  4A3B H;  2BH2 A;  1EQR A;  4IJH A;  1GD7 A;  3HOU G;  2MQH A;  1Y1W H;  1N8R C;  2XTI A;  4DUZ L;  1G6P A;  3ULJ A;  4X62 Q;  1Y1V G;  1JJC B;  2UXB Q;  3W1G A;  3I56 A;  1JT8 A;  2KHJ A;  3HOW G;  4JI0 L;  2PI2 E;  1PH2 A;  5ELN A;  2UU9 Q;  4LF7 Q;  3ZJY C;  2VNU D;  4P71 A;  4TQU S;  3CCR A;  2L15 A;  3MEF A;  3H0G G;  4LFA Q;  5FJ8 H;  1SRU A;  1VQH A;  3K80 C;  4A3K G;  2ES2 A;  3GTQ H;  3PO2 H;  1XPR A;  4A3L G;  4UY8 C;  1KD1 C;  2ZM6 L;  4IJL A;  4XTC S;  1YEZ A;  1HNZ L;  3S1Q H;  5M3F G;  4TVA B;  2R92 G;  2JE6 I;  1SN8 A;  2E8G A;  2NZO A;  4DR4 Q;  1HNX Q;  4QQB X;  4K0K L;  1E1T A;  1OXS C;  3CW2 C;  2HIX A;  2I5L X;  1O7I A;  4LUO A;  3UE1 A;  1PH3 A;  3L7Z C;  2NVQ H;  1PVO A;  4AH6 A;  3HOX G;  1X3F A;  1IBL L;  4OO1 G;  2B29 A;  4GN5 A;  4YCU A;  4PZ8 A;  3D31 A;  3KLW A;  3E9I A;  2OQ0 A;  1CKO A;  2GVB A;  4HID A;  2ALY B;  3S14 H;  1VQC A;  1ASY A;  1QVG A;  2YU9 H;  4DV6 Q;  4DV0 L;  1U5K A;  2E2H H;  2K5N A;  2IX1 A;  1Q46 A;  3HOV H;  3I4N G;  4A3C H;  3PGZ A;  4LWC A;  1VQF A;  3JAM c;  4A3M H;  1PH4 A;  1W3S A;  1OTC A;  1NBW A;  1YBY A;  5GRO A;  4APV A;  3HKZ G;  4B3M L;  4L5S A;  4JYA L;  4P75 A;  3GTP H;  4JOI A;  3U4V A;  3ER0 A;  4JI7 L;  1J5E Q;  2ZTE A;  3FHW A;  1R9T H;  2B63 G;  4A3D H;  1KAW A;  4DR1 Q;  4YY3 L;  1YNX A;  4JV5 Q;  3EN2 A;  2JA7 H;  4O2D A;  2WFW A;  3E9H A;  4JBJ A;  5M5W H;  4JI5 Q;  2QEX A;  2PI2 A;  3DM3 A;  2XGT A;  3HFZ B;  4ALP A;  1JMC A;  1EIY B;  3HOY G;  4Y7N H;  3OW2 A;  1NMG A;  4A3E H;  1HZA A;  4AIM A;  1PYB A;  3T1Y Q;  3KYH C;  4DR3 Q;  2I5M X;  4LF5 Q;  3RZO H;  1GO3 E;  1C9O A;  1SRO A;  4UP7 A;  1XMQ L;  4MZ9 A;  3G71 A;  4LFC Q;  3W1B A;  3I7F A;  1Q12 A;  3FKI H;  4X65 Q;  1PH1 A;  3ULL A;  4PZ7 A;  5IE8 A;  4JI1 Q;  3UDG A;  4C3H H;  4PG3 A;  1AE2 A;  2BA0 A;  1YIT A;  1PH7 A;  3CC2 A;  1LM0 A;  5GAE C;  2UXB L;  4FDB A;  1K0R A;  5GAH C;  3CPW A;  2PQA B;  4R1J A;  3AEV A;  3HOV G;  2IX0 A;  4DR7 L;  1EYG A;  4DAM A;  2HHH Q;  4KHZ A;  1YJN A;  4LNQ A;  4QGU A;  1OXT A;  4LF6 L;  5EAY A;  4DR2 Q;  1VQ8 A;  3HOU H;  1PA6 A;  4B3T Q;  2IHE A;  1HNX L;  3J81 c;  4DPG A;  4KHP Q;  1VQ4 A;  1VQD A;  1Y1V H;  4GKJ L;  1QVC A;  2UXC Q;  4EX5 A;  4PZ6 A;  1K83 H;  4GLA C;  2EIF A;  2K5V A;  4OXP A;  2JA7 G;  5GQO A;  3HOW H;  3K81 C;  4RG1 A;  4GKK Q;  2NVX H;  4BY1 G;  4HJ9 A;  3RLN A;  4R4T A;  4A3E G;  1HR0 Q;  3H0G H;  4PMW A;  2E5L Q;  1KRT A;  1X6O A;  4B3R L;  4IFD I;  2LXJ A;  3D0F A;  1N36 Q;  4BXX H;  1HZB A;  4DV6 L;  1L2F A;  1K8G A;  1CKN B;  2LSS A;  5M3F H;  2R92 H;  4RMF A;  1HJP A;  1VQ7 A;  2YV5 A;  1N9W A;  2AWN A;  4IPH A;  2Q2H A;  3M4P A;  1XTD A;  3RN5 A;  1KC8 C;  1I6H H;  2PNH A;  4NXM Q;  1I3Q H;  2MO1 A;  3HKS A;  2VS1 A;  2VY3 A;  3STB D;  5FLX c;  2OQK A;  5JEA G;  5BR8 L;  4YHH Q;  1X54 A;  1UE5 A;  2PMZ E;  4DV2 Q;  1UEB A;  3HOX H;  4DV5 Q;  5LMN L;  3OTO L;  3RZD H;  1J5E L;  2E2I H;  2VQF L;  2OTL A;  4DR1 L;  1H95 A;  1CUK A;  1HH2 P;  4LF8 Q;  1Q86 C;  4B3S L;  4JV5 L;  5FLM G;  1KHI A;  5M5Y H;  4UP9 A;  4JI5 L;  2R93 H;  2LXK A;  4WJ3 M;  1MKH A;  2UUB Q;  4GOP A;  4JI2 Q;  1KQS A;  5IP9 G;  4JBK A;  1OXX K;  3TRZ A;  3M7N A;  3G48 A;  5JJL A;  2I5H A;  1DGS A;  1VQM A;  2JA5 G;  2MO0 A;  2Y0S G;  4POF A;  3CCM A;  1NY4 A;  2AKW B;  3PUZ A;  4IOA A;  1A62 A;  1Q8K A;  2K14 A;  3KF6 A;  3JC6 6;  4LFC L;  5IP7 G;  1YHQ A;  2B63 H;  4JI4 Q;  1EIF A;  2KEN A;  1AH9 A;  1BBW A;  1CSP A;  4DV3 Q;  2RCN A;  4NXN L;  4LFB Q;  1JJG A;  4JI1 L;  1YVC A;  1TXY A;  2EQS A;  1FGU A;  1FVI A;  1YIJ A;  3HOY H;  3DLL A;  5LMU Q;  3KDF A;  4BXX G;  3H3V I;  1C7Y A;  2A1A A;  4X66 Q;  3PIP A;  3S2D H;  4QY7 A;  4MNO A;  4HIO A;  2HHH L;  1NJI C;  1IBK L;  4A3F G;  2ATW A;  3CCS A;  1HZ9 A;  1I94 Q;  5IT9 c;  1FL0 A;  1YZ6 A;  3PUV A;  2H5X A;  5GAD C;  3KFU A;  1XMO Q;  3T1H Q;  2KHI A;  3M4O H;  2VQE Q;  2Q2U A;  2K4K A;  3CQZ H;  2ZTD A;  4IFD G;  5IYB G;  4DUY Q;  4KHP L;  3ICE A;  3L2P A;  3PSI A;  1B7Y B;  2UXC L;  1E7Z A;  1U0L A;  3PUX A;  4H02 A;  4QIW E;  3J7Z C;  2ZJP A;  2N8N A;  3J80 i;  3T1H L;  1W2B A;  2WB1 G;  4A93 H;  4OON A;  4GKK L;  1IBM Q;  1TWA H;  5IY0 A;  3EBE A;  4GLV B;  1L1O A;  1VQK A;  2CKZ B;  3I2Z A;  3AYH B;  2BH8 A;  5M5X H;  4C2M H;  1UE1 A;  3F2C A;  2JEB I;  2AWO A;  4J15 A;  2UUC Q;  1N36 L;  2Y0S E;  3BU2 A;  3IRB A;  3S24 A;  3MXN B;  4A4I A;  3CCJ A;  1QVF A;  1XNQ Q;  4DR5 L;  2D62 A;  1PH8 A;  3CCL A;  4JI6 Q;  1SR3 A;  4B3S Q;  3RNU A;  1A0I A;  1VQI A;  2HIV A;  1B8A A;  1EQQ A;  1EFW A;  3CAM A;  3PUW A;  3I4O A;  1G29 1;  2F4V Q;  4LUV A;  3RR5 A;  1XNR Q;  2FXQ A;  1TWH H;  4JI8 Q;  5C4J H;  4JBM A;  3HOZ H;  5JEA J;  5C3E G;  4A3G H;  4BY1 H;  1JE5 A;  3CPF A;  3CME A;  3VDY A;  1GM5 A;  4LF8 L;  1VQE A;  2NN6 I;  1X3G A;  3NEL A;  2A19 A;  4JOI C;  3J81 j;  2UUA Q;  5K36 G;  5H1S E;  4BY7 H;  4BBR G;  4YCW A;  5IWA L;  2DGY A;  4LF4 Q;  1YHA A;  2V1C C;  2UUB L;  2AMC B;  4JI2 L;  4OWX B;  1HR0 W;  2ASB A;  3I4M H;  2HQL A;  4HIK A;  1YJ9 A;  2JA6 G;  3A5U A;  1KRS A;  3ULP A;  3U4Z A;  2IHF A;  4X62 L;  2R7Z G;  4DV1 Q;  4AQY Q;  1WCM G;  2ZJQ A;  2WB1 E;  3LGJ A;  4NB3 A;  4BBS H;  1T9H A;  1PFS A;  4DV3 L;  4DV4 Q;  1TWC H;  1PHJ A;  2UU9 L;  4LF7 L;  4A93 G;  2D0P A;  3F1Z A;  5FLM H;  2MFI A;  4LFA L;  3TQY A;  4GN3 B;  5E7N A;  3STB C;  2CQO A;  1TWF H;  1S3O A;  1Z9F A;  5LMU L;  1VQJ A;  5IP9 H;  1KIX A;  4GNX B;  3NEN A;  1RIP A; 
#chains in the Genus database with same CATH topology
 4RCO A;  1A3U A;  3CKI B;  4ME3 A;  2EYO A;  4Y52 H;  2KED A;  4KKS A;  1B4O A;  4C3I H;  5JAV A;  2EYP A;  2NVX B;  1GHJ A;  4K6D A;  5FOB B;  2R6G A;  3A7A B;  3W5O A;  3PV0 A;  4HR7 B;  4EQO A;  1UWV A;  1HXY D;  4IFD J;  2PQA A;  4M8A A;  4GNX C;  1HNW Q;  1IBL Q;  5IOD A;  1Q3L A;  3SGI A;  2A6E D;  5ELB A;  3S15 H;  4ILW A;  1WJJ A;  5DM6 3;  1IYV A;  4MTN A;  4IPC A;  3FEW X;  1JJ2 A;  2YTY A;  3UDI A;  3J80 c;  4OEL B;  3EIV A;  3MHB A;  5IT9 E;  2F0Q A;  4LJZ C;  4DNT B;  3A7L A;  4B3M Q;  4F7X A;  4JYA Q;  2K1B A;  3GV3 A;  3CC4 A;  1BBU A;  1H9J A;  3V2T A;  4DR3 L;  1FR3 A;  3QB3 A;  2JK8 A;  1SJH D;  1D5Z C;  1UE6 A;  1A8V A;  2SOB A;  1K28 A;  5IYD G;  2WV6 D;  2XRS D;  4X64 Q;  4POG A;  4N8X 1;  2L4N A;  5C3E H;  2F0W A;  2CVR A;  3AFP A;  1IW7 D;  2PZT A;  2AUJ D;  1YJW A;  4IUQ A;  5G3L D;  1M90 C;  2OT2 A;  4ZQ3 A;  1ASZ A;  2PW5 A;  4CKB A;  3SE0 A;  2K75 A;  2PMZ B;  3UE0 A;  3A54 A;  3NWS A;  1A2T A;  1B1Z A;  2MUY A;  4OEM B;  4A3I G;  3HOV B;  4DK6 C;  1X55 A;  2KUM A;  1ZEQ X;  4JI3 L;  1L1O B;  4A3M B;  2EDG A;  5FO8 B;  3BS1 A;  3I73 A;  3BZD B;  4A76 A;  1PYS B;  2F4I A;  4DAY B;  1X65 A;  3NTH A;  3RMH A;  2E5L L;  4DNR B;  4DKA C;  3OMC A;  1IL2 A;  1CI3 M;  1GJX A;  1Q90 A;  2EXD A;  5C3W A;  5EQ0 A;  3GTL H;  2EYL A;  1V9P A;  1PZI D;  5M5W B;  4NXM L;  5CYU A;  3U58 A;  1EUJ A;  4DV2 L;  1N33 Q;  3QWN A;  4A3E B;  4DXG A;  2IT1 A;  2R3Z A;  3NUC A;  2P5Z X;  2ZTC A;  2FMC A;  4NW2 A;  2RHS B;  5ISR A;  4O42 A;  5KNB A;  1GKH A;  2KCN A;  5LMN Q;  3C46 A;  3MXN A;  2RF4 A;  2N49 A;  2LY7 A;  1S72 A;  3A0J A;  3VA5 A;  1E1O A;  2DJF C;  2F0L A;  4OWW B;  1TWF B;  4KN4 C;  4LFB L;  5FLX E;  2WAQ E;  5LHY 1;  5C44 H;  3H15 A;  1ENC A;  4DUZ Q;  4C3J B;  3UDX A;  1WTV A;  1D1K A;  1HUM A;  1PFB A;  4R4Q A;  2VUM H;  1GUN A;  2A68 C;  2Y0S B;  2MP1 A;  4RGN A;  3J7A 5;  3ND9 A;  2Q2T A;  2E74 C;  3CF5 A;  2KCC A;  1B70 B;  2B2T C;  2NVY H;  2ZM6 Q;  1SAP A;  3CMA A;  4HN7 A;  1N32 L;  4LW1 A;  3S2H H;  3GTJ H;  3NWT A;  4A3M G;  5IGD A;  1IBK Q;  3T16 A;  3GDE A;  3PMF A;  3BG3 A;  1QCB D;  3M7G A;  3GV6 A;  3JAM i;  1XPU A;  3S15 B;  1QZG A;  4K2K A;  2M2L A;  1RTN A;  4LF9 L;  3QOJ A;  3V05 A;  1JR0 D;  1EFI D;  1QUQ B;  3I4M G;  3KJP A;  3I55 A;  1EU4 A;  1A3V A;  1D8L A;  3B6Y A;  1EWI A;  2PYK A;  4HAE A;  5KNC A;  3QR8 A;  4A3K H;  2Q8R E;  1XNR L;  3EA6 A;  2K6A A;  4A3L H;  5M3M H;  2EZV A;  4IPD A;  4FNF A;  2KJX A;  2GN5 A;  1K3B C;  5C0X H;  1AE3 A;  3IAY A;  2UUA L;  1E24 A;  1Q81 C;  1T5E A;  3CD6 A;  3OIP A;  1NMF A;  2JXM B;  4LF4 L;  3GD7 A;  1G2S A;  1HTL D;  3K8A A;  1MJC A;  1V1Q A;  2K33 A;  3E0J A;  4ZUJ A;  1KAA A;  1SMX A;  1J9O A;  1B9N A;  2IJ0 A;  3KDF B;  1WFQ A;  4YWM A;  2NYZ D;  3PCO B;  2XVS A;  1CT1 D;  5D3D A;  1XMQ Q;  4DV4 L;  3PUY A;  1EY7 A;  1EQR A;  1GD7 A;  1S5E D;  3NBI A;  1LT5 D;  1G6P A;  3GP7 A;  3L3O C;  5L37 A;  2UXB Q;  3I56 A;  4IUT A;  2NTS A;  5J22 A;  4HSP A;  2PI2 E;  4JI0 L;  4LAA A;  5ELN A;  3ZJY C;  5KND A;  4P71 A;  4A93 B;  1VDZ A;  3MEF A;  5FJ8 H;  3PO2 H;  1SRU A;  1Y69 U;  4XTC S;  2XSC A;  1SBB B;  2R92 G;  3T56 B;  2NZO A;  1HNX Q;  3GTL B;  1E1T A;  1OXS C;  3UE1 A;  5I6Y A;  2EYF A;  1IBL L;  4OO1 G;  3HOZ B;  4GN5 A;  1TWH B;  1M4V A;  4PZ8 A;  3E9I A;  4HID A;  2ALY B;  3S14 H;  1SYF A;  2YU9 H;  4DV6 Q;  2R93 G;  2K5N A;  1Q46 A;  4FXG C;  1WVL A;  4BY7 B;  4CDE C;  2MHV A;  3VR6 A;  1W3S A;  1II3 A;  1OTC A;  1PRT C;  2IX3 A;  4B3M L;  4JYA L;  3GTP H;  3OW7 A;  4JOI A;  4A3D H;  1SYB A;  2ZTE A;  1R9T H;  5I6W A;  1FYC A;  2JA7 H;  1STB A;  1PRT F;  1DXM A;  3OIQ A;  4U67 3;  1EIY B;  5C44 B;  1JIC A;  3E3X A;  4ME5 A;  1HZA A;  1PYB A;  4N9T A;  2K01 A;  2I5M X;  2HQE A;  2VUM B;  1I4X A;  1C9O A;  1SRO A;  5EPJ A;  2L12 A;  3MFY A;  3W1B A;  3I7F A;  2XNA C;  3LWU A;  3IFD A;  1PH1 A;  1EZ6 A;  2B2V A;  2NVY B;  4C3H H;  4PG3 A;  1PH7 A;  4H44 C;  1AFP A;  3GTJ B;  2PQA B;  2EVB A;  2B39 A;  4PV1 C;  4DAM A;  2HHH Q;  4QMG A;  4LNQ A;  1OXT A;  5EAY A;  5JPM C;  3NXW A;  2RSO A;  5J39 A;  1PA6 A;  4B3T Q;  3HOU H;  1ICF B;  2D5D A;  3ERO A;  2O2L D;  2X6L A;  1I4G A;  3TDQ A;  1Z6H A;  4EX5 A;  4PZ6 A;  4GLA C;  1LAB A;  4FXD A;  3K81 C;  3OWF A;  4RG1 A;  2F0F A;  4BY1 G;  2F0G A;  4R4T A;  1HR0 Q;  5EPL A;  5M3M B;  2QDL A;  4I7A A;  1NSN S;  4IFD I;  2LXJ A;  4BXX H;  4B08 A;  5M3F H;  4RMF A;  2YV5 A;  1N9W A;  2Q2H A;  3RN5 A;  1I6H H;  3MXU A;  2PO4 A;  1I3Q H;  2VY3 A;  3Q6S A;  5FLX c;  1A15 A;  5JEA G;  1X54 A;  3HOX H;  5LMN L;  2PQE A;  1VMC A;  2E2I H;  4FF4 A;  1HH2 P;  1KTK A;  1Q86 C;  1SNQ A;  2CW0 C;  2NZ1 D;  5A2Q E;  2Z8L A;  2L9H A;  3G48 A;  5JJL A;  2R61 A;  1GUS A;  4POF A;  1A62 A;  1KAB A;  1Q8K A;  2O4X A;  5IP7 G;  1YHQ A;  2R7Z B;  1EIF A;  1AH9 A;  3PO2 B;  2IWH A;  2RCN A;  4IN3 A;  1YVC A;  2EQS A;  4Z9C B;  1IKL A;  3HOY H;  1B44 D;  3H3V I;  1IYU A;  3H6M A;  1JQY D;  2A1A A;  5EKL A;  3ND8 A;  5DAU A;  3S2D H;  4K2L A;  4MNO A;  1IBK L;  2G9D A;  1HZ9 A;  3TP8 A;  5IGB A;  1PXU A;  4OIK A;  2VQE Q;  1JCK B;  2K4K A;  2ZTD A;  3CQZ H;  4RGO S;  2YU9 B;  3ICE A;  4EGV A;  3L2P A;  1B7Y B;  2UXC L;  4QIW E;  3J7Z C;  3LWE A;  1W2B A;  2WB1 G;  1TWA H;  2EYJ A;  1L1O A;  3I2Z A;  3GTP B;  1UE1 A;  4A3D B;  4J15 A;  3K59 A;  4DGZ A;  1R9T B;  1ILP A;  3MXN B;  4A4I A;  1XNQ Q;  1BXT A;  2D62 A;  4J8Q A;  3RNU A;  1B8A A;  3UI2 A;  2FXQ A;  4JBM A;  5CV8 A;  2XWB B;  3K57 A;  3C2P A;  1PTO C;  1VQE A;  3NEL A;  1D1I A;  3J81 j;  4JOI C;  4KY7 A;  5H1S E;  3DWA A;  4YCW A;  2DGY A;  4XYQ A;  2UUB L;  4OWX B;  1HR0 W;  4C3H B;  4LMQ D;  1YJ9 A;  3ULP A;  1PTO F;  4CDD C;  2R7Z G;  2O5J C;  1LAC A;  4AQY Q;  1WTX A;  1T9H A;  1PFS A;  4DV3 L;  2D0P A;  1B9M A;  2CQO A;  1S3O A;  1SSO A;  5A2Q L;  3HOU B;  2B2V C;  2D9U A;  1QB5 D;  5IP9 H;  1RIP A;  2K7V A;  5HGQ A;  4RGM A;  4UDU C;  5C6A A;  1EU3 A;  2JA5 H;  4CDC C;  3NSW A;  1VQL A;  4JI3 Q;  5IYD H;  5C5M A;  4G4K A;  1Q82 C;  1ESR A;  2F0K A;  1I5F A;  1OO9 B;  3WOE A;  2ID0 A;  3NPP A;  1CTM A;  4GLX A;  1BOS A;  4FYD A;  1I6H B;  3L0O A;  1I3Q B;  1B3A A;  1F2Y A;  4Q5V A;  1BBX C;  5D3I B;  4R8I A;  2YTX A;  3HOX B;  3PF4 A;  4GS3 A;  5EBD A;  2UUC L;  3CC7 A;  4XIG S;  3W3A A;  4JPB W;  1QUQ A;  4IFD H;  3VA7 A;  5IYB H;  1U4L A;  3AFQ A;  3F2D A;  3I4N B;  4HJ8 A;  1BCP B;  1CSQ A;  1STA A;  3HKZ B;  1YNN C;  1CKN A;  2H4O A;  5IIF A;  3IKJ A;  2NVT H;  4ODG A;  3TS0 A;  1GXD C;  1NE3 A;  5CV6 A;  5JVG 3;  1PFN A;  2J7Z A;  1BNZ A;  3HOY B;  1D2B A;  2EXZ A;  2CFM A;  5IYC G;  4L63 B;  1SFO H;  3TEH B;  3S17 H;  1MHW C;  1RDP D;  1VS0 A;  3TP6 A;  3S2D B;  4L5T A;  1FNU A;  2IW3 A;  2NVQ B;  2VL6 A;  5JJI A;  4C1N I;  5K36 H;  2I0Q A;  4K6L A;  4AYB G;  3A74 A;  2KVM A;  4XDX A;  1VQO A;  1P8L A;  1VCI A;  2XWJ B;  2DUD A;  2JA6 H;  3I72 A;  4B3T L;  1J6Q A;  3M9B A;  4L8J A;  2RSN A;  4DR7 Q;  3H3V H;  3SR1 A;  2F3V A;  4ZAI A;  1TWA B;  1K73 C;  4N8F A;  2E2D C;  3TBI B;  1LTS D;  1XYI A;  1HR0 L;  1Z47 A;  1EY0 A;  1ONL A;  3MC0 B;  4NDX A;  2Q2I A;  2OWO A;  4LF9 Q;  3PO3 G;  1PDQ A;  4JCV E;  3OSO A;  5CMD A;  1STG A;  4IOC A;  2AHO B;  1MIU A;  1QNU A;  3GO5 A;  4DV7 L;  1L1O C;  4XQJ A;  4B3R Q;  3CCE A;  4P2C B;  1MI2 A;  4WJW A;  4OX9 L;  4MN3 A;  1K8O A;  3KUP A;  1EOT A;  4C3J H;  2EY2 A;  1DJR D;  1DM0 B;  5BR8 Q;  3CHB D;  1G51 A;  4P73 A;  3DM1 A;  2L55 A;  1VQ9 A;  2K5Q A;  1Q1E A;  1KDB A;  2EY6 A;  2F0U A;  5I2X A;  4YCV A;  3P7J A;  5M9O A;  1SJE D;  1FJG L;  2LKV A;  3VR4 A;  3AMU A;  1ZYR D;  2JA5 B;  1D6E C;  4JI0 Q;  1K83 B;  3DEP A;  2GA4 B;  2KCM A;  2OF1 A;  3I90 A;  5COR A;  3VR5 A;  4ZLT F;  3R3O A;  2WIN B;  3F2B A;  2RVL A;  3TP5 A;  1SYC A;  3FP9 A;  2F0V A;  3WDN A;  4DNI A;  2F0S A;  2JA9 A;  3TRE A;  1E2W A;  2VQE L;  1B53 A;  3UDF A;  1N34 L;  2IL8 A;  2F03 A;  4A3C G;  1RL2 A;  2F3W A;  2B2W C;  3U50 C;  3TME A;  3GTG H;  1BVS A;  3K0X A;  4RHR A;  2A8V A;  1EY8 A;  5CV9 A;  1AEX A;  1BKB A;  4J6H A;  2EOT A;  2SNS A;  2SEB D;  1X32 A;  5C0X I;  1XNQ L;  4J1M A;  5HY6 A;  3VYU A;  2JYO A;  3T1H Q;  2ZJR A;  2PCF B;  3TN2 A;  3GTO H;  3FRP B;  2JA8 H;  4A75 A;  4K14 A;  3NQT A;  3NBH A;  3CXC A;  4HJ7 A;  2NVT B;  4DR5 Q;  4KI0 A;  1LT6 D;  1FD7 D;  3AQQ A;  5HUR A;  2C35 B;  3FKI G;  1JOR A;  1CKM A;  2HDL A;  4QF4 A;  5ELD A;  4A3J H;  3SXH A;  1AW7 A;  4R9W A;  3A8I E;  2MGS A;  2PZW A;  5C4X H;  2R7F A;  5CC4 A;  3S17 B;  1TWG H;  1GUO A;  2EYM A;  3F8T A;  4AQY L;  5IWA Q;  3J81 L;  5CBE E;  3NE5 B;  4L5R C;  3Q8D A;  4A3B H;  4IJH A;  4F8M A;  2MQH A;  1Y1W H;  1N8R C;  2JA6 B;  1Y1V G;  3W1G A;  1ENF A;  4NP5 A;  2LMC B;  2UU9 Q;  4TQU S;  2ES2 A;  1CM9 A;  1TVX A;  1F9S A;  1XPR A;  2BE5 D;  1GOZ A;  2Z9H A;  3S1Q H;  2FJ2 A;  1PZJ D;  3CW2 C;  2I5L X;  1O7I A;  1PVO A;  1PH3 A;  3F2U A;  1RF2 D;  2B29 A;  1T5X D;  4A3G B;  3D31 A;  2KOL A;  2EYH A;  1LTR D;  3KLW A;  2GVB A;  2F0H A;  5IGF A;  1S4Z A;  1VQC A;  4DV0 L;  2K05 A;  4FVM A;  1VQF A;  3NTI A;  2JSO A;  1KNA A;  2F0E A;  1SND A;  3KLS X;  4YY3 L;  1YNX A;  1TII D;  3MTS A;  4BBS B;  4O2D A;  4TRD A;  3DM3 A;  2JN4 A;  4Y7N H;  5IT9 L;  1ESF A;  2A5H A;  3T1Y Q;  5D65 A;  4LF5 Q;  1GO3 E;  4R8N A;  4MZ9 A;  2A73 B;  1UAP A;  1BUV T;  5EPK A;  3ZYY X;  2OEO A;  4C3I B;  4X65 Q;  3ULL A;  5IE8 A;  2BCO A;  1AE2 A;  1B3Q A;  2K5D A;  1WTR A;  5EBC A;  1CHQ D;  4MTK A;  5GAH C;  1QE6 A;  4IUV A;  3ONA B;  3HOV G;  2HD3 A;  3GTG B;  4DR7 L;  1PFM A;  1EYG A;  5EGT A;  2HCC A;  4X3S A;  3V96 A;  2IHE A;  5EKK A;  3J81 c;  4DPG A;  2K28 A;  2UXC Q;  2WII B;  2ZXR A;  3HOW H;  4FXK C;  5I9P A;  3DHQ A;  4KJN A;  4HJ9 A;  2KEC A;  4TSS A;  3CRL C;  4A3E G;  3H0G H;  5EKI A;  4MIU A;  1X6O A;  4B3R L;  1GUT A;  3D0F A;  2WAQ B;  1HZB A;  4CJ0 B;  1CKN B;  3RD4 A;  1HJP A;  1XX8 A;  4IPH A;  4A3J B;  1XTD A;  4G7O C;  2RBM A;  3A8K E;  4KD3 A;  2VS1 A;  5C4X B;  1SE2 A;  1ZKO A;  3STB D;  2A6H D;  4DU9 A;  5BR8 L;  4YHH Q;  3UDG A;  1UE5 A;  4DV5 Q;  3RZD H;  1TWG B;  1SNP A;  1YNJ C;  1DZ1 A;  2OTL A;  1JWS D;  4G57 A;  5C3E B;  2EY1 A;  4DR1 L;  1CK1 A;  3P20 A;  1SYE A;  3I3C A;  3MWY W;  1KHI A;  5M5Y H;  5FLM G;  4KV6 A;  4UP9 A;  4JI5 L;  4KKT A;  1F2L A;  1NR2 A;  3VYR A;  1MKH A;  2UUB Q;  4GOP A;  1SNO A;  3K58 A;  4L6T B;  3SK4 A;  2NUC A;  4C3J G;  2X6G A;  4RH6 A;  3M7N A;  2I5H A;  1H9M A;  5TSS A;  3Q22 A;  2Y0S G;  3BYT B;  3I70 A;  3PUZ A;  4C3I G;  4IOA A;  2B63 H;  4HCE A;  4DN4 M;  1G91 A;  4JI4 Q;  1CHP D;  1WTQ A;  4DV3 Q;  1JJG A;  3EFX D;  3SK8 A;  4HSV A;  1TXY A;  1YIJ A;  3QO2 A;  5FLX L;  1C7Y A;  4XT1 B;  3OWE B;  4X66 Q;  4X3U A;  1H9R A;  3HRZ C;  4QY7 A;  1NJI C;  3ERQ A;  4OIJ A;  4ULL A;  1LO5 D;  5IT9 c;  1U4P A;  2H5X A;  5GAD C;  4UAI A;  4RKB A;  3M4O H;  4DUY Q;  4KHP L;  3BDL A;  3PSI A;  4H02 A;  3K5O A;  1SEB D;  2N8N A;  3HGB A;  3J80 i;  3T1H L;  4OON A;  4GLV B;  5KEE A;  2L11 A;  1O7Y A;  2VXW A;  5M5X H;  4IQZ A;  2K32 A;  4C2M H;  2UUC Q;  2JEB I;  2AWO A;  1N36 L;  1ILQ A;  3S24 A;  4DR5 L;  3CCL A;  1I4Q A;  2MPM A;  4B3S Q;  3RUZ A;  1HUN A;  1NR4 A;  1C48 A;  2CH4 A;  3RR5 A;  5JEA J;  5E4X A;  1NNX A;  5C3E G;  1DCZ A;  1JE5 A;  3CPF A;  3CME A;  1GM5 A;  1X3G A;  2A19 A;  1EQT A;  3J7A F;  5IWA L;  2VB2 X;  3HP3 A;  2AMC B;  4JI2 L;  4EQN A;  1WD1 A;  2D2C C;  1NAP A;  3SK5 A;  2IHF A;  4QB4 A;  5ELE A;  3S2H B;  2WB1 E;  2EE1 A;  2K5W A;  4KD4 A;  4A93 G;  2UU9 L;  1A3T A;  1TWC H;  3VR2 A;  4QUC A;  2I07 B;  1SXT A;  4GN3 B;  2ENB A;  5E7N A;  5LMU L;  4XQQ A;  1VQJ A;  5E1F A;  2VB3 X;  3NEN A;  1Q7Y C;  3A55 A;  3DEO A;  2F3I A;  4L5Q A;  4V19 0;  3HOW B;  2N78 A;  3HOZ G;  1GUG A;  2EJM A;  2GVA A;  3H0G B;  4A3K B;  3E0E A;  1DON A;  3A56 A;  4K5V A;  3NBH B;  4BY7 G;  4RWS C;  3M85 A;  1EY4 A;  1ZXT A;  4FF2 A;  1VQ6 A;  3CCU A;  1PZK D;  3A5Z B;  4DV7 Q;  4A3F H;  2FMM A;  3M4Y A;  5I2Y A;  4P72 A;  4K5X A;  3OMG A;  2NN6 G;  2L1B A;  4JI6 L;  1KLG D;  4OX9 Q;  2A68 D;  3NQI A;  4ID6 A;  1K3R A;  4NPS A;  5M5Y B;  3K6O A;  3HEJ A;  3T53 B;  2QGQ A;  2F4V L;  5C44 G;  4JI8 L;  1SYD A;  3RN2 A;  3GTK H;  4RFB A;  1RHP A;  1TY2 A;  2IY5 B;  3CCQ A;  4JI7 Q;  4DA2 A;  2VUM G;  4YWL A;  3T1Y L;  1Y14 B;  4UP8 A;  4LF5 L;  3C1E A;  2B63 B;  2RHQ B;  1EYA A;  3PIO A;  4CJ2 C;  2CHB D;  3JAM E;  4X65 L;  2IPK D;  2ICE C;  1SMY C;  2AQ3 B;  3S16 H;  1I50 H;  1W6J A;  3K7U C;  5DM7 3;  1FJG Q;  1BCP C;  1H9K A;  1VQN A;  3AB9 A;  1JB7 A;  2YTV A;  1HFN A;  1TT2 A;  4BBR H;  3FVQ A;  5JPN C;  1VQG A;  1NTG A;  3M4O B;  1PH6 A;  1SE3 A;  4H13 C;  1BCP F;  1DYQ A;  3J81 i;  2WKD A;  1EEF D;  3S14 B;  3LX0 A;  1N34 Q;  1M1K C;  1HPC A;  4H0L C;  4QL5 A;  1V43 A;  2YYZ A;  3NTK A;  1WCM H;  5AJ3 L;  1WYD A;  2NZH A;  4LF6 Q;  3K5M A;  1X9N A;  5M3M G;  5M5X B;  2XRQ D;  4C2M B;  2A69 C;  2K03 A;  4ZKB B;  1YI2 A;  4DK0 A;  3H09 A;  1PH9 A;  5C0X G;  3QG1 A;  3TS2 A;  3M3Y H;  1SE8 A;  3CP0 A;  2LS0 1;  3ERS X;  3BYY B;  4IPG A;  2JA7 B;  1I6V C;  2X69 A;  4YHH L;  2ZXO A;  2UXD L;  4DV5 L;  1VQA A;  4N9P A;  5BN3 A;  1J8I A;  2RDH A;  4OL7 A;  3R93 A;  1KLU D;  2RCF A;  3IL8 A;  4FP5 D;  5IOC A;  2KCT A;  4AYB E;  2FHT A;  2A74 C;  1K9M C;  5ELO A;  2QEJ C;  3S1M H;  2DNC A;  3T4A C;  3RLO A;  3OTO Q;  1EOV A;  1HCZ A;  1X56 A;  3S1R H;  2VQF Q;  2D0O A;  1M8A A;  3PQI A;  3CCV A;  4ZCK A;  1F9R A;  1TWC B;  5FJ8 G;  3PO2 G;  4JI4 L;  2L5T A;  4KJO A;  4DFA A;  4X3K A;  4R4I A;  4HCS A;  2MNA A;  2A6E C;  3BDO A;  4UPA A;  4WRD A;  3S1N H;  1KNE A;  4CKC A;  3HZX A;  1MSH A;  1WTH A;  3D6C A;  4X66 L;  4IAL A;  1SLJ A;  1PLF A;  4NXN Q;  3GTM H;  1PRT D;  3O13 A;  3JAM L;  2EJF C;  3D4R A;  1E3P A;  4DR6 L;  3DXJ C;  1B50 A;  2OTJ A;  1LYL A;  2PNR C;  2L0C A;  2XN9 C;  4DUY L;  2K5H A;  1WTO A;  5M3F B;  4DF7 A;  1F77 A;  5C5L A;  1TS2 A;  3HKZ E;  1D7Q A;  4A3F B;  5COY A;  5BN4 A;  4A3D G;  4GNX A;  1EEI D;  2E2I B;  1HHV A;  3G6E A;  4X6A H;  2BDN A;  3SHL A;  2C5C A;  2M9V A;  4CBV A;  4DV0 Q;  4B3S L;  4HMJ A;  4BA2 I;  1EL0 A;  1IW7 C;  3G7L A;  3GTK B;  4A3I H;  3AU7 A;  4H7B A;  4OO1 I;  4GOP B;  1IYJ B;  1EYD A;  1EWC A;  5C4H A;  5E3F A;  1HFG A;  2LFN A;  2RQX A;  2Z0S A;  4KY5 A;  3BJU A;  4YY3 Q;  3KF8 B;  5CV5 A;  5G3L F;  4C3H G;  2HDM A;  1XJV A;  3S16 B;  3P1H A;  4C1N K;  1I50 B;  2G9H D;  1YHB A;  3G4S A;  5I4D A;  1VQ5 A;  2JQO A;  1LV9 A;  4JBW A;  4O0A A;  1U4R A;  4XT3 B;  1EY6 A;  2BH2 A;  1F2M A;  3NP8 A;  3HOU G;  4PQX A;  1E0B A;  2XTI A;  3ULJ A;  1UEA B;  3CQZ B;  1LT3 D;  3MA2 B;  4XYO A;  1WCM B;  4LF7 Q;  2Z4H A;  3CCR A;  2L15 A;  4IZ8 A;  1STH A;  3GTQ H;  1RJT A;  3CU7 A;  2V4D A;  3M3Y B;  5M3F G;  4TVA B;  3J7A V;  1I4R A;  2F0P A;  4DR4 Q;  4XQN A;  4QQB X;  1PYW D;  1K0S A;  4LUO A;  2CW0 D;  3H3V C;  4XXE A;  3I4L A;  2DN8 A;  3HOX G;  1X3Q A;  4CKE A;  1STE A;  1MSG A;  1F9P A;  2BOS A;  5KGU A;  2OQ0 A;  3NK9 A;  5IGC A;  4CHT B;  1JOO A;  2NWG A;  2NBF A;  4IUR A;  1QVG A;  1VF7 A;  2E2H H;  1U5K A;  5DNF A;  3HOV H;  2QKI C;  3HS0 C;  3I4N G;  3PGZ A;  3OOC A;  3JAM c;  4A3M H;  1PH4 A;  1E2Z A;  3C3L A;  1YBY A;  1QWY A;  3TP7 A;  4CGY B;  1HQR D;  3HKZ G;  1CFM A;  3GQB A;  4P75 A;  4JI7 L;  3ER0 A;  4X3T A;  4DR1 Q;  4Q0F A;  5E4W C;  3D4D A;  3EN2 A;  4K8I A;  2WFW A;  3E9H A;  4JBJ A;  5M5W H;  4JI5 Q;  3I4M H;  2PI2 A;  3HFZ B;  1JMC A;  3HOY G;  4RHS A;  3S1N B;  1NMG A;  1FGB D;  4A3E H;  5FKA C;  3MZ5 A;  3KYH C;  3EVQ A;  1HRJ A;  4KK7 A;  3RZO H;  2E75 C;  4DK1 A;  1GHK A;  3G71 A;  4YIJ A;  4OHJ A;  1GUW A;  1Q12 A;  3BVM A;  2F0D A;  1LM0 A;  5GAE C;  2OXP A;  4R1J A;  3AEV A;  5CBA E;  2IX0 A;  4DXF A;  2EY5 A;  2FIN B;  2KA7 A;  4KHZ A;  1R4Q B;  4QGU A;  4LF6 L;  1E2V A;  1CZW A;  1RD9 D;  3EJI A;  3MXG A;  3VR3 A;  4DR2 Q;  3SDZ A;  1IL8 A;  1F9Q A;  3LNN A;  1VQ8 A;  1PTO D;  4IUP A;  4KHP Q;  2EIF A;  3BDC A;  1TQO A;  4A3I B;  1HTP A;  1D5M C;  1B2T A;  4PMW A;  2JP1 A;  1KRT A;  3E6Z X;  2O5I C;  1N36 Q;  3TZD A;  2R92 H;  1VQ7 A;  1KC8 C;  3M4P A;  2SDF A;  1SNM A;  3VYS A;  2OQK A;  4KHV A;  2PMZ E;  1UEB A;  3OTO L;  4OO1 H;  1J5E L;  2F0T A;  2VQF L;  1SFO B;  2AUK A;  2E76 C;  4JV5 L;  4V0B A;  2R93 H;  2F0M A;  4E6I A;  1I4P A;  4JI2 Q;  1KQS A;  5IP9 G;  4JBK A;  1TY0 A;  1VQM A;  2JA5 G;  2MO0 A;  3CCM A;  1NY4 A;  2AKW B;  4F87 A;  2K14 A;  4LFC L;  2KEN A;  1QNK A;  1BBW A;  1CSP A;  5CV4 A;  1ICW A;  4KN7 C;  4NXN L;  3GTQ B;  4JI1 L;  1HA5 A;  3QJY A;  2Q8T A;  3I91 A;  5ELF A;  5LMU Q;  3K5N A;  3DWP A;  3PIP A;  3TSS A;  3EQL C;  5CR3 A;  1SE4 A;  3PUV A;  3KFU A;  1YNN D;  2KHI A;  2KHS A;  4IFD G;  2XIW A;  2AQ2 B;  5IYB G;  2E2H B;  1V8Q A;  2J4X A;  1E7Z A;  3PUX A;  2Z1C A;  4HTH A;  4A93 H;  4GKK L;  5DEH A;  1EQV A;  5IY0 A;  1QIL A;  1EY5 A;  3F2C A;  1V1O A;  2Y0S E;  3IRB A;  1QVF A;  3R2I A;  3QOL A;  1XWE A;  4JI6 Q;  5I9O A;  1SR3 A;  3IFT A;  2HIV A;  3I4M B;  1EFW A;  4NKL A;  1FNV A;  3CAM A;  1G29 1;  2F4V Q;  3HOZ H;  1TWH H;  4JI8 Q;  5C4J H;  1O78 A;  3J7Y W;  4BY1 H;  3VDY A;  3RZO B;  4LF8 L;  2ZT9 C;  1STY A;  5K36 G;  2AQ1 B;  4BY7 H;  2TMP A;  1YHA A;  3BVZ A;  4FF1 A;  4RGT A;  2HQL A;  2JA6 G;  2ZXP A;  5JEA H;  2KEE A;  2NN6 H;  1U4M A;  4DV1 Q;  3X3N A;  4K5W A;  3LGJ A;  3G6J B;  2RKS A;  1PHJ A;  4LF7 L;  1JE4 A;  2DY7 A;  3R2T A;  2MJ8 A;  3TQY A;  2PPB C;  1LTB D;  1BF4 A;  4GNX B;  4LK1 C;  1HZC A;  4DR4 L;  3BZK A;  3FDT A;  1C0A A;  3WWV A;  1I94 L;  4JW0 A;  5IP7 H;  3ITP A;  3MEH A;  3K5L A;  5AJ3 Q;  2CWA A;  3GTO B;  2Z6K A;  2JA8 B;  1LTA D;  2H1E A;  5A35 A;  1XMO L;  4A3G G;  4EQ5 A;  1HNZ Q;  1LLR D;  1AN8 A;  1S40 A;  2E2J H;  1A63 A;  1PMR A;  2B3G A;  2R92 B;  1NCV A;  4K0K Q;  4HJA A;  1IBM L;  1X3E A;  4KMU C;  2Z4I A;  4M1U B;  4BA1 I;  4WJ4 A;  1VF5 C;  4G7Z C;  5LL6 X;  2QW7 A;  4GN4 B;  2UXD Q;  1WI5 A;  2K52 A;  1UNS A;  2F1M A;  1KL9 A;  4ZK9 B;  5D14 A;  1RKN A;  3RLF A;  2NB0 A;  3HG9 A;  3PIO 3;  2DY8 A;  1AZQ A;  4BBS G;  2R93 B;  1LT4 D;  3KJO A;  3Q23 A;  2QIL A;  4A3B B;  4B9W A;  1MD2 D;  4I65 A;  1QJO A;  1K8M A;  3KLR A;  1SYG A;  4HMI A;  3OPO A;  1Y1W B;  4DAP A;  1C8C A;  2WP8 J;  1A2U A;  3KF6 B;  2R7D A;  1CZG A;  1TR5 A;  2B2Y A;  3KF8 A;  1S5C D;  4WFN 3;  3I8Z A;  1VQB A;  1WD0 A;  5JJK A;  3H94 A;  3S1Q B;  4YWK A;  1VMP A;  1FNW A;  4HJ5 A;  1K8A C;  2QA4 A;  1IKM A;  2TSS A;  3KBG A;  3M4Q A;  4ZUI A;  3OYY A;  5CV7 A;  1XTC D;  3CRK C;  1ROD A;  2N3S A;  4DR2 L;  3KOJ A;  3FPU B;  5EJW A;  1H9S B;  4DR6 Q;  3N52 A;  3TZU A;  5GAG C;  2R7Z H;  2CCZ A;  2JA8 G;  5LMN W;  1LTG D;  4CJ1 B;  2QDB A;  3DMU A;  3QIA A;  2HCI A;  4HIM A;  1QG7 A;  2N55 A;  2WAQ G;  3MXP A;  4GKJ Q;  1UE7 A;  1RTO A;  4A3J G;  2VW9 A;  5FO9 B;  1HNW L;  4IUU A;  5C4X G;  3R8B A;  1VQP A;  1L0W A;  5C4J B;  4ZYS A;  3BVG A;  4BY1 B;  4Y7N B;  4IO9 A;  2OCE A;  1LTT D;  3K7A H;  1G8Z D;  5JOB A;  2J0T D;  2Q8I B;  2F0I A;  2VZA A;  4A3B G;  2I46 A;  1ML0 D;  1P16 A;  1Y1W G;  2WKC A;  1CQV A;  1JOQ A;  4PMC A;  3PF5 A;  3KBX A;  1TS5 A;  2BDO A;  3SK6 A;  5DLQ E;  2DNE A;  2JJQ A;  4JC0 A;  1Y8O B;  2Z6B A;  4R4C A;  1S5B D;  1V1P B;  4S3S A;  1S5F D;  1I4H A;  5HGT A;  4X64 L;  4ZRZ A;  4DK3 C;  1GVP A;  5C4Z A;  5KRU A;  1LUZ A;  2PZU A;  1L0X B;  2F52 A;  2FFK B;  1O7Z A;  1STN A;  3D8G A;  2BA1 A;  1ET9 A;  4JG2 A;  1QZH A;  1EWH A;  2E2J B;  1Y8P B;  4PNY A;  1PV4 A;  5T1G A;  2ICI A;  1ENA A;  5IYC H;  2CWP A;  2F0N A;  5J3B A;  2G5D A;  3BZC A;  3URY A;  2Z6K C;  3E5S A;  4P74 A;  3RZD B;  5C0X J;  1XPO A;  1LTL A;  1Q1B A;  2F0O A;  1OXV A;  4QJF A;  1KXL A;  1E22 A;  3NEM A;  1IXR A;  4KLK A;  1MJE A;  1WOC A;  1IZ6 A;  2WB1 B;  2JEA I;  1AP0 A;  1N33 L;  4LUZ A;  2RDG A;  1HQM C;  5KIX A;  1NUC A;  2K50 A;  4WOR A;  1SNC A;  3PO3 H;  1F2Z A;  3MAQ A;  4OWT B;  4DAV A;  3H91 A;  2B8G A;  1L0Y B;  2HT1 A;  1OXU A;  4R4O A;  3U9O A;  5JJZ A;  1CA5 A;  4BWG B;  1Y8N B;  2RDF A;  4GOP C;  1PH5 A;  1G6Z A;  4DV1 L;  3D4W A;  2KBN A;  3I4N H;  4JK1 C;  4RA8 A;  2B2Y C;  4C56 C;  1BQQ T;  1EY9 A;  3VYT A;  4DUZ L;  4X62 Q;  1JJC B;  4RAU C;  1JT8 A;  2KHJ A;  3HOW G;  1U9R A;  1PH2 A;  5C3X A;  3C1F A;  2VNU D;  2HUG A;  4LFA Q;  3H0G G;  4A3K G;  4A3L G;  1IHZ A;  1VQH A;  3K80 C;  4UY8 C;  1KD1 C;  2ZM6 L;  4IJL A;  1YEZ A;  1HNZ L;  4JVZ A;  1YNJ D;  2RA4 A;  1MBY A;  2JE6 I;  1SN8 A;  2E8G A;  2F0J A;  4K0K L;  2HIX A;  4BS9 A;  2NVQ H;  3L7Z C;  2QCP X;  3FMC A;  1PRT B;  2N88 A;  4AH6 A;  5FK9 C;  5K5P A;  4QUF A;  4K8J A;  1X3F A;  1DOK A;  1LTI D;  4YCU A;  2NTT A;  3K7A B;  1CKO A;  4QCL A;  1EIH A;  2B2U A;  1ASY A;  1EYC A;  3X3M A;  1G2T A;  2IX1 A;  4TKO B;  5IGE A;  4GZY C;  4A3C H;  1XXG A;  1ZYR C;  4LWC A;  1CA6 A;  3P75 A;  1D5X C;  1NBW A;  4F88 A;  1BO0 A;  4DAY A;  5GRO A;  4APV A;  3KLS A;  4L5S A;  1PTO H;  1AZP A;  2CQA A;  3U4V A;  1ET6 A;  1J5E Q;  3FHW A;  2B63 G;  4U68 A;  1KAW A;  4JV5 Q;  1BDO A;  4G7H C;  1JWM D;  2QEX A;  3N6R A;  2XGT A;  4ALP A;  3DWQ A;  4QIW B;  1DOM A;  3OW2 A;  3WOF A;  4AIM A;  4KTA A;  4DR3 Q;  2QF7 A;  4UP7 A;  1XMQ L;  5AFW A;  3J80 E;  4LFC Q;  4IUN A;  4EVO A;  3FKI H;  1JWU D;  4PZ7 A;  4JI1 Q;  1YIT A;  2BA0 A;  1WTW A;  3CC2 A;  1R4P B;  2UXB L;  4FDB A;  1K0R A;  4B9X A;  3CPW A;  1JC7 A;  3D3R A;  5NUC A;  2SNM A;  1YJN A;  4AYB B;  2B2W A;  3W2D A;  4FF3 A;  1HNX L;  5FO7 B;  1VQ4 A;  1VQD A;  1Y1V H;  4GKJ L;  1QVC A;  2EPB A;  1K83 H;  3L9A X;  2K5V A;  4OXP A;  5T1I A;  2JA7 G;  5GQO A;  4GKK Q;  2NVX H;  5ELC A;  3RLN A;  1DOL A;  4ZKC B;  1Z7T A;  2E5L Q;  4DV6 L;  1L2F A;  2PW7 A;  3MVV A;  2LSS A;  1K8G A;  3PO3 B;  3U9S A;  2AWN A;  4O1N A;  3Q0A A;  2PNH A;  4NXM Q;  3HKS A;  2KQ3 A;  2MO1 A;  4MHE A;  3A8J E;  4DV2 Q;  5IGG A;  2BE5 C;  1EZ8 A;  1CQF A;  1X3P A;  5F2D A;  1Q8I A;  1H95 A;  1CUK A;  3T13 A;  4LF8 Q;  2CH4 W;  4I7Z C;  4FO2 A;  1KDA A;  4HED A;  1DD2 A;  2LXK A;  1WTP A;  4WJ3 M;  4ABN A;  4BBR B;  2B8F A;  2K04 A;  1OXX K;  1HA6 A;  3TRZ A;  1DGS A;  1C4Q A;  3D6W A;  1SDF A;  3PIP 3;  3Q24 A;  4RCN A;  3KF6 A;  3JC6 6;  1TU2 B;  4KY6 A;  4LFB Q;  3KK7 A;  1FGU A;  1FVI A;  3T51 B;  1JB3 A;  3OHX C;  3DLL A;  3KDF A;  4BXX G;  3K0Y A;  5KYI A;  4OGQ C;  4HIO A;  2HHH L;  2ATW A;  4A3F G;  3J80 L;  3CCS A;  1I94 Q;  1FL0 A;  1YZ6 A;  4NMZ A;  1W6K A;  1XMO Q;  5CGK A;  1O7L A;  1TS4 A;  2Q2U A;  1N32 Q;  4RKL A;  1H9S A;  1MGS A;  4CDF C;  1EIG A;  1U0L A;  2WAC A;  2ZJP A;  1IBM Q;  3EBE A;  1VQK A;  3S1M B;  2CKZ B;  1SMY D;  3AYH B;  2BH8 A;  1BR9 A;  1PTO B;  1UUP A;  1BCP D;  3BU2 A;  3CCJ A;  1S5D D;  3S1R B;  1PH8 A;  3DUZ A;  3SVM A;  2B2U C;  1KDC A;  1A0I A;  1VQI A;  1EQQ A;  3PUW A;  3I4O A;  5J1Z A;  1TS3 A;  4LUV A;  1XNR Q;  4A3G H;  4EQP A;  1QOH A;  3J81 E;  1RCV D;  2NN6 I;  2UUA Q;  1O80 A;  1TKW B;  4BBR G;  3FPP A;  4LF4 Q;  3FKI B;  2V1C C;  3GTM B;  5KYL A;  2A69 D;  3NHH A;  4HIK A;  2C9O A;  2ASB A;  3SEB A;  1KRS A;  3A5U A;  3U4Z A;  2M00 A;  5JVH 3;  4X62 L;  5BN5 A;  4UHV A;  1WCM G;  2ZJQ A;  1JOK A;  2EJG C;  4NB3 A;  4BBS H;  4DV4 Q;  1A6X A;  1V1P A;  2B2T A;  3F1Z A;  5FLM H;  2MFI A;  4PMB A;  3S9W A;  4LFA L;  3MFG A;  4KKU A;  3STB C;  2A6H C;  1TWF H;  1Z9F A;  2DJG C;  5LL6 S;  1KIX A;  1Y1V B; 
#chains in the Genus database with same CATH homology
 1HZC A;  1Q7Y C;  4L5Q A;  4DR4 L;  2F3I A;  5HGQ A;  4ME3 A;  3BZK A;  4Y52 H;  2JA5 H;  1C0A A;  3WWV A;  2N78 A;  4C3I H;  1I94 L;  5IP7 H;  3HOZ G;  1VQL A;  5AJ3 Q;  2CWA A;  4JI3 Q;  2Z6K A;  4A3G G;  1XMO L;  2GVA A;  4EQ5 A;  1HNZ Q;  2R6G A;  3E0E A;  5IYD H;  1S40 A;  3W5O A;  3PV0 A;  2E2J H;  1A63 A;  1UWV A;  2B3G A;  1Q82 C;  3NBH B;  4IFD J;  2PQA A;  1I5F A;  4K0K Q;  2ID0 A;  4BY7 G;  4GLX A;  1KXL A;  4GNX C;  4HJA A;  3L0O A;  3M85 A;  1IBM L;  1VQ6 A;  3CCU A;  2R93 G;  1HNW Q;  1X3E A;  1IBL Q;  2YTX A;  3A5Z B;  3SGI A;  4BA1 I;  3PF4 A;  4DV7 Q;  4GS3 A;  4A3F H;  4WJ4 A;  2UUC L;  4GN4 B;  3S15 H;  1WI5 A;  2K52 A;  2UXD Q;  4P72 A;  1WJJ A;  3CC7 A;  4MTN A;  4IPC A;  2NN6 G;  4XIG S;  4JI6 L;  1QUQ A;  4OX9 Q;  1JJ2 A;  1K3R A;  1KL9 A;  2YTY A;  4NPS A;  3RLF A;  3UDI A;  5IYB H;  3AFQ A;  3J80 c;  4BBS G;  2QGQ A;  3EIV A;  3KJO A;  3F2D A;  2F4V L;  5C44 G;  4JI8 L;  3RN2 A;  4HJ8 A;  3GTK H;  2IY5 B;  4B3M Q;  3CCQ A;  4JYA Q;  1CSQ A;  4JI7 Q;  2VUM G;  1CKN A;  1BBU A;  4YWL A;  4DR3 L;  1Y14 B;  2WP8 J;  4UP8 A;  3T1Y L;  3CC4 A;  4LF5 L;  2NVT H;  3TS0 A;  2RHQ B;  2R7D A;  3KF6 B;  2JK8 A;  3PIO A;  1NE3 A;  1UE6 A;  1A8V A;  1VQB A;  4X65 L;  5IYD G;  3S16 H;  5JJK A;  4X64 Q;  1I50 H;  4POG A;  3K7U C;  2CFM A;  5C3E H;  4YWK A;  5IYC G;  1FJG Q;  1SFO H;  3TEH B;  3S17 H;  1VQN A;  1VS0 A;  3AFP A;  2QA4 A;  4HJ5 A;  1K8A C;  4L5T A;  1JB7 A;  2YTV A;  2VL6 A;  3M4Q A;  1YJW A;  5JJI A;  2I0Q A;  3OYY A;  4AYB G;  4BBR H;  3A74 A;  1M90 C;  1N32 Q;  1VQO A;  1ASZ A;  1VQG A;  1NTG A;  2N3S A;  1P8L A;  1PH6 A;  1VCI A;  4DR2 L;  3KOJ A;  2JA6 H;  2DUD A;  2K75 A;  3J81 i;  4DR6 Q;  4B3T L;  3UE0 A;  1J6Q A;  3M9B A;  5GAG C;  1N34 Q;  4DR7 Q;  1M1K C;  2R7Z H;  3H3V H;  4QL5 A;  4A3I G;  2CCZ A;  1V43 A;  2YYZ A;  1K73 C;  4DK6 C;  1X55 A;  1WCM H;  5LMN W;  5AJ3 L;  4JI3 L;  1L1O B;  1WYD A;  2NZH A;  4LF6 Q;  1X9N A;  5M3M G;  4A76 A;  1YI2 A;  1PYS B;  4HIM A;  1Z47 A;  4DAY B;  1PH9 A;  1HR0 L;  1X65 A;  2WAQ G;  5C0X G;  2E5L L;  3TS2 A;  2Q2I A;  4DKA C;  1SE8 A;  2OWO A;  4LF9 Q;  1IL2 A;  3PO3 G;  3M3Y H;  2EXD A;  3CP0 A;  4JCV E;  4GKJ Q;  1UE7 A;  4A3J G;  2VW9 A;  3GTL H;  4IOC A;  1V9P A;  2AHO B;  1HNW L;  3ERS X;  1MIU A;  4IPG A;  1VQP A;  5C4X G;  1L0W A;  3GO5 A;  4NXM L;  4DV7 L;  3U58 A;  1EUJ A;  4YHH L;  2UXD L;  4DV2 L;  4DV5 L;  1L1O C;  4IO9 A;  1N33 Q;  2OCE A;  4B3R Q;  1VQA A;  3K7A H;  3CCE A;  2IT1 A;  4OX9 L;  4C3J H;  2KCT A;  2VZA A;  4A3B G;  4AYB E;  2JA8 G;  1K9M C;  1P16 A;  5ELO A;  2ZTC A;  5BR8 Q;  1Y1W G;  3S1M H;  2RHS B;  1G51 A;  1GKH A;  5LMN Q;  3RLO A;  3OTO Q;  1EOV A;  1X56 A;  3S1R H;  4P73 A;  2VQF Q;  2RF4 A;  3PF5 A;  2D0O A;  3CCV A;  1VQ9 A;  2N49 A;  1S72 A;  1Q1E A;  5DLQ E;  3A0J A;  2JJQ A;  4JC0 A;  5FJ8 G;  4R4C A;  3PO2 G;  4JI4 L;  1E1O A;  4OWW B;  4YCV A;  4LFB L;  4R4I A;  2WAQ E;  4X64 L;  5C44 H;  2MNA A;  4UPA A;  3H15 A;  3S1N H;  1FJG L;  4DK3 C;  1GVP A;  4DUZ Q;  3UDX A;  1LUZ A;  2F52 A;  4R4Q A;  4X66 L;  2VUM H;  4JI0 Q;  2BA1 A;  1SLJ A;  3J7A 5;  4JG2 A;  2KCM A;  3GTM H;  4NXN Q;  2Q2T A;  3CF5 A;  3F2B A;  1B70 B;  1QZH A;  2NVY H;  3FP9 A;  2ZM6 Q;  4DNI A;  3CMA A;  1E3P A;  2JA9 A;  3TRE A;  4DR6 L;  2VQE L;  1N32 L;  2OTJ A;  3UDF A;  1N34 L;  1LYL A;  4LW1 A;  4DUY L;  1RL2 A;  3GTJ H;  2K5H A;  3U50 C;  1PV4 A;  3S2H H;  4A3M G;  5IYC H;  2CWP A;  1IBK Q;  3GTG H;  1BVS A;  3HKZ E;  3K0X A;  3GDE A;  1D7Q A;  5J3B A;  2A8V A;  3JAM i;  1XPU A;  1BKB A;  3BZC A;  1QZG A;  4A3D G;  2Z6K C;  4GNX A;  4P74 A;  4LF9 L;  5C0X J;  3G6E A;  1XPO A;  1LTL A;  1Q1B A;  1QUQ B;  4X6A H;  5C0X I;  1XNQ L;  5HY6 A;  3I4M G;  3KJP A;  3I55 A;  4DV0 Q;  1D8L A;  1OXV A;  3B6Y A;  1EWI A;  4QJF A;  1E22 A;  2ZJR A;  3NEM A;  1IXR A;  4KLK A;  1MJE A;  1WOC A;  4BA2 I;  1IZ6 A;  3GTO H;  4A3C G;  2JA8 H;  4A3I H;  2JEA I;  4A75 A;  4A3K H;  4A3L H;  1XNR L;  1N33 L;  4LUZ A;  4OO1 I;  4GOP B;  1IYJ B;  5M3M H;  3CXC A;  4HJ7 A;  2K50 A;  4IPD A;  4DR5 Q;  4KI0 A;  2GN5 A;  3AQQ A;  1AE3 A;  2Z0S A;  2UUA L;  2C35 B;  1E24 A;  1Q81 C;  3FKI G;  3BJU A;  4YY3 Q;  1CKM A;  3CD6 A;  3PO3 H;  3KF8 B;  1NMF A;  4A3J H;  4LF4 L;  4OWT B;  3GD7 A;  3K8A A;  1XJV A;  2HT1 A;  1MJC A;  1OXU A;  5C4X H;  1V1Q A;  2R7F A;  4R4O A;  1YHB A;  1SMX A;  1TWG H;  3G4S A;  4GOP C;  3KDF B;  1PH5 A;  1VQ5 A;  1WFQ A;  4YWM A;  3PCO B;  2JQO A;  3F8T A;  4DV1 L;  4AQY L;  4JBW A;  5IWA Q;  1XMQ Q;  2KBN A;  4O0A A;  3I4N H;  4L5R C;  4DV4 L;  3PUY A;  3Q8D A;  4A3B H;  2BH2 A;  1EQR A;  4IJH A;  1GD7 A;  3HOU G;  2MQH A;  1Y1W H;  1N8R C;  2XTI A;  4DUZ L;  1G6P A;  3ULJ A;  4X62 Q;  1Y1V G;  1JJC B;  2UXB Q;  3W1G A;  3I56 A;  1JT8 A;  2KHJ A;  3HOW G;  4JI0 L;  2PI2 E;  1PH2 A;  5ELN A;  2UU9 Q;  4LF7 Q;  3ZJY C;  2VNU D;  4P71 A;  4TQU S;  3CCR A;  2L15 A;  3MEF A;  3H0G G;  4LFA Q;  5FJ8 H;  1SRU A;  1VQH A;  3K80 C;  4A3K G;  2ES2 A;  3GTQ H;  3PO2 H;  1XPR A;  4A3L G;  4UY8 C;  1KD1 C;  2ZM6 L;  4IJL A;  4XTC S;  1YEZ A;  1HNZ L;  3S1Q H;  5M3F G;  4TVA B;  2R92 G;  2JE6 I;  1SN8 A;  2E8G A;  2NZO A;  4DR4 Q;  1HNX Q;  4QQB X;  4K0K L;  1E1T A;  1OXS C;  3CW2 C;  2HIX A;  2I5L X;  1O7I A;  4LUO A;  3UE1 A;  1PH3 A;  3L7Z C;  2NVQ H;  1PVO A;  4AH6 A;  3HOX G;  1X3F A;  1IBL L;  4OO1 G;  2B29 A;  4GN5 A;  4YCU A;  4PZ8 A;  3D31 A;  3KLW A;  3E9I A;  2OQ0 A;  1CKO A;  2GVB A;  4HID A;  2ALY B;  3S14 H;  1VQC A;  1ASY A;  1QVG A;  2YU9 H;  4DV6 Q;  4DV0 L;  1U5K A;  2E2H H;  2K5N A;  2IX1 A;  1Q46 A;  3HOV H;  3I4N G;  4A3C H;  3PGZ A;  4LWC A;  1VQF A;  3JAM c;  4A3M H;  1PH4 A;  1W3S A;  1OTC A;  1NBW A;  1YBY A;  5GRO A;  4APV A;  3HKZ G;  4B3M L;  4L5S A;  4JYA L;  4P75 A;  3GTP H;  4JOI A;  3U4V A;  3ER0 A;  4JI7 L;  1J5E Q;  2ZTE A;  3FHW A;  1R9T H;  2B63 G;  4A3D H;  1KAW A;  4DR1 Q;  4YY3 L;  1YNX A;  4JV5 Q;  3EN2 A;  2JA7 H;  4O2D A;  2WFW A;  3E9H A;  4JBJ A;  5M5W H;  4JI5 Q;  2QEX A;  2PI2 A;  3DM3 A;  2XGT A;  3HFZ B;  4ALP A;  1JMC A;  1EIY B;  3HOY G;  4Y7N H;  3OW2 A;  1NMG A;  4A3E H;  1HZA A;  4AIM A;  1PYB A;  3T1Y Q;  3KYH C;  4DR3 Q;  2I5M X;  4LF5 Q;  3RZO H;  1GO3 E;  1C9O A;  1SRO A;  4UP7 A;  1XMQ L;  4MZ9 A;  3G71 A;  4LFC Q;  3W1B A;  3I7F A;  1Q12 A;  3FKI H;  4X65 Q;  1PH1 A;  3ULL A;  4PZ7 A;  5IE8 A;  4JI1 Q;  3UDG A;  4C3H H;  4PG3 A;  1AE2 A;  2BA0 A;  1YIT A;  1PH7 A;  3CC2 A;  1LM0 A;  5GAE C;  2UXB L;  4FDB A;  1K0R A;  5GAH C;  3CPW A;  2PQA B;  4R1J A;  3AEV A;  3HOV G;  2IX0 A;  4DR7 L;  1EYG A;  4DAM A;  2HHH Q;  4KHZ A;  1YJN A;  4LNQ A;  4QGU A;  1OXT A;  4LF6 L;  5EAY A;  4DR2 Q;  1VQ8 A;  3HOU H;  1PA6 A;  4B3T Q;  2IHE A;  1HNX L;  3J81 c;  4DPG A;  4KHP Q;  1VQ4 A;  1VQD A;  1Y1V H;  4GKJ L;  1QVC A;  2UXC Q;  4EX5 A;  4PZ6 A;  1K83 H;  4GLA C;  2EIF A;  2K5V A;  4OXP A;  2JA7 G;  5GQO A;  3HOW H;  3K81 C;  4RG1 A;  4GKK Q;  2NVX H;  4BY1 G;  4HJ9 A;  3RLN A;  4R4T A;  4A3E G;  1HR0 Q;  3H0G H;  4PMW A;  2E5L Q;  1KRT A;  1X6O A;  4B3R L;  4IFD I;  2LXJ A;  3D0F A;  1N36 Q;  4BXX H;  1HZB A;  4DV6 L;  1L2F A;  1K8G A;  1CKN B;  2LSS A;  5M3F H;  2R92 H;  4RMF A;  1HJP A;  1VQ7 A;  2YV5 A;  1N9W A;  2AWN A;  4IPH A;  2Q2H A;  3M4P A;  1XTD A;  3RN5 A;  1KC8 C;  1I6H H;  2PNH A;  4NXM Q;  1I3Q H;  2MO1 A;  3HKS A;  2VS1 A;  2VY3 A;  3STB D;  5FLX c;  2OQK A;  5JEA G;  5BR8 L;  4YHH Q;  1X54 A;  1UE5 A;  2PMZ E;  4DV2 Q;  1UEB A;  3HOX H;  4DV5 Q;  5LMN L;  3OTO L;  3RZD H;  1J5E L;  2E2I H;  2VQF L;  2OTL A;  4DR1 L;  1H95 A;  1CUK A;  1HH2 P;  4LF8 Q;  1Q86 C;  4B3S L;  4JV5 L;  5FLM G;  1KHI A;  5M5Y H;  4UP9 A;  4JI5 L;  2R93 H;  2LXK A;  4WJ3 M;  1MKH A;  2UUB Q;  4GOP A;  4JI2 Q;  1KQS A;  5IP9 G;  4JBK A;  1OXX K;  3TRZ A;  3M7N A;  3G48 A;  5JJL A;  2I5H A;  1DGS A;  1VQM A;  2JA5 G;  2MO0 A;  2Y0S G;  4POF A;  3CCM A;  1NY4 A;  2AKW B;  3PUZ A;  4IOA A;  1A62 A;  1Q8K A;  2K14 A;  3KF6 A;  3JC6 6;  4LFC L;  5IP7 G;  1YHQ A;  2B63 H;  4JI4 Q;  1EIF A;  2KEN A;  1AH9 A;  1BBW A;  1CSP A;  4DV3 Q;  2RCN A;  4NXN L;  4LFB Q;  1JJG A;  4JI1 L;  1YVC A;  1TXY A;  2EQS A;  1FGU A;  1FVI A;  1YIJ A;  3HOY H;  3DLL A;  5LMU Q;  3KDF A;  4BXX G;  3H3V I;  1C7Y A;  2A1A A;  4X66 Q;  3PIP A;  3S2D H;  4QY7 A;  4MNO A;  4HIO A;  2HHH L;  1NJI C;  1IBK L;  4A3F G;  2ATW A;  3CCS A;  1HZ9 A;  1I94 Q;  5IT9 c;  1FL0 A;  1YZ6 A;  3PUV A;  2H5X A;  5GAD C;  3KFU A;  1XMO Q;  3T1H Q;  2KHI A;  3M4O H;  2VQE Q;  2Q2U A;  2K4K A;  3CQZ H;  2ZTD A;  4IFD G;  5IYB G;  4DUY Q;  4KHP L;  3ICE A;  3L2P A;  3PSI A;  1B7Y B;  2UXC L;  1E7Z A;  1U0L A;  3PUX A;  4H02 A;  4QIW E;  3J7Z C;  2ZJP A;  2N8N A;  3J80 i;  3T1H L;  1W2B A;  2WB1 G;  4A93 H;  4OON A;  4GKK L;  1IBM Q;  1TWA H;  5IY0 A;  3EBE A;  4GLV B;  1L1O A;  1VQK A;  2CKZ B;  3I2Z A;  3AYH B;  2BH8 A;  5M5X H;  4C2M H;  1UE1 A;  3F2C A;  2JEB I;  2AWO A;  4J15 A;  2UUC Q;  1N36 L;  2Y0S E;  3BU2 A;  3IRB A;  3S24 A;  3MXN B;  4A4I A;  3CCJ A;  1QVF A;  1XNQ Q;  4DR5 L;  2D62 A;  1PH8 A;  3CCL A;  4JI6 Q;  1SR3 A;  4B3S Q;  3RNU A;  1A0I A;  1VQI A;  2HIV A;  1B8A A;  1EQQ A;  1EFW A;  3CAM A;  3PUW A;  3I4O A;  1G29 1;  2F4V Q;  4LUV A;  3RR5 A;  1XNR Q;  2FXQ A;  1TWH H;  4JI8 Q;  5C4J H;  4JBM A;  3HOZ H;  5JEA J;  5C3E G;  4A3G H;  4BY1 H;  1JE5 A;  3CPF A;  3CME A;  3VDY A;  1GM5 A;  4LF8 L;  1VQE A;  2NN6 I;  1X3G A;  3NEL A;  2A19 A;  4JOI C;  3J81 j;  2UUA Q;  5K36 G;  5H1S E;  4BY7 H;  4BBR G;  4YCW A;  5IWA L;  2DGY A;  4LF4 Q;  1YHA A;  2V1C C;  2UUB L;  2AMC B;  4JI2 L;  4OWX B;  1HR0 W;  2ASB A;  3I4M H;  2HQL A;  4HIK A;  1YJ9 A;  2JA6 G;  3A5U A;  1KRS A;  3ULP A;  3U4Z A;  2IHF A;  4X62 L;  2R7Z G;  4DV1 Q;  4AQY Q;  1WCM G;  2ZJQ A;  2WB1 E;  3LGJ A;  4NB3 A;  4BBS H;  1T9H A;  1PFS A;  4DV3 L;  4DV4 Q;  1TWC H;  1PHJ A;  2UU9 L;  4LF7 L;  4A93 G;  2D0P A;  3F1Z A;  5FLM H;  2MFI A;  4LFA L;  3TQY A;  4GN3 B;  5E7N A;  3STB C;  2CQO A;  1TWF H;  1S3O A;  1Z9F A;  5LMU L;  1VQJ A;  5IP9 H;  1KIX A;  4GNX B;  3NEN A;  1RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...