4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
4B3ML 1N8RC 2KCMA 1JMCA 1PA6A 4JI4L 5ELOA 4JG2A 2NVYH 3I4OA 4JC0A 1WCMH 2IX1A 3E9HA 5FJ8H 1P8LA 1IBKQ 2KCTA 2KHJA 1TWGH 2K14A 1JB7A 4LF7Q 3M7NA 3I2ZA 4BA1I 1S72A 1B70B 2RF4A 2IT1A 1SLJA 1EIYB 1XNQL 3TS2A 1SROA 1K83H 3CP0A 5K36G 4IO9A 4HIMA 4UP7A 1HNWQ 3OYYA 1SE8A 4LFBL 4KHPL 3PUZA 1NBWA 4OXPA 4HJAA 3CXCA 2HQLA 4DPGA 3AQQA 4DV4Q 4BY7H 3GD7A 3T1HQ 4LF6Q 2UXBL 4DV2Q 1NTGA 1K8AC 3WWVA 3CCUA 4PG3A 1FJGL 4GKKL 1E24A 1FVIA 4JI5Q 2F52A 2K50A 4DR7L 2WFWA 1OXVA 2HIXA 4RMFA 1HNZL 2JEAI 4P74A 1VQFA 1Y1VH 1TWAH 3EN2A 3CCJA 4DV5Q 4A75A 3CPWA 3H3VI 4X65L 4P73A 4DV3L 1Q46A 2ASBA 3T1YQ 2Q2HA 4OWWB 4IOAA 1O7IA 1VQJA 5AJ3Q 3KJPA 1V1QA 4DV6L 1PH9A 1EYGA 4AYBG 2UXDQ 4YY3L 2UXCL 2ZM6Q 1N36L 5C4XH 2JA8G 1XTDA 3TEHB 1D8LA 4JOIA 3U4VA 4OWTB 4APVA 2CFMA 4NXML 2CWAA 4XIGS 1N9WA 2PQAB 4DK3C 1V43A 1QZHA 2CQOA 4AH6A 4YWLA 2BA0A 3BZKA 1R9TH 3CCLA 2NZOA 2NVQH 2VW9A 1KHIA 2AWOA 4OWXB 3KLWA 4X62L 4LFBQ 4MNOA 4BBRH 4JI6L 3UDGA 1HH2P 3EIVA 4LFCL 1HZBA 2I5LX 3J81i 2UUBL 1W3SA 1MKHA 4BY1G 4PZ6A 2VQFL 2JA6H 2LXJA 1EWIA 5C0XG 4DNIA 4DR5Q 2VUMH 4LF8L 4JI0Q 4JI2Q 1VQBA 4NXNQ 3GO5A 3KF8B 5M3MG 1YI2A 1Q82C 2QA4A 4IPGA 2CCZA 1XPUA 1X9NA 3I4NH 4JYAQ 1Y1WG 5H1SE 3AFQA 4GLAC 4AQYQ 4B3SL 2VZAA 3B6YA 1WOCA 2Q2TA 2N49A 4KI0A 1UE5A 4A3JG 3TQYA 1QVFA 4DV7L 2ATWA 1N34L 4GN5A 1VQ7A 5GROA 3NELA 4GKJQ 3FHWA 1A8VA 4IOCA 3RZDH 4JBKA 4IJHA 4OO1G 2NN6I 2ZTDA 3PO3H 4A3EH 1OXTA 2BA1A 3HFZB 4J15A 1I50H 1NY4A 4KHZA 3PIOA 2I5MX 1A0IA 1AE2A 3J80i 4AYBE 3S2DH 3RR5A 4R4QA 4JBWA 3GTQH 5IY0A 4GNXB 2KENA 3SGIA 3L2PA 4DKAC 4QGUA 1RIPA 3G4SA 4LF7L 5C0XI 4LUZA 5HY6A 4UP8A 1B7YB 3H0GG 4C3HH 4LNQA 1Q86C 3HOWH 1YJWA 3AEVA 2JJQA 4DR1Q 4RG1A 3HOVH 1HNWL 2K75A 5EAYA 4IJLA 2F3IA 1YZ6A 1I5FA 2UUAQ 3U50C 3A74A 2UUCQ 2R92H 4A3CH 4JI7Q 1VCIA 4DV4L 2R6GA 2AHOB 5M3FH 5IYCG 2YTYA 3T1HL 1M1KC 4DV2L 4LF6L 4POGA 1FGUA 1U0LA 4GNXC 4EQ5A 1S40A 2OTLA 3G71A 2YU9H 4JI3Q 4L5RC 5J3BA 4HJ5A 4JI5L 4A3LG 5IP7G 2Q2UA 1WI5A 1TXYA 5JEAG 1GKHA 2JEBI 3OTOQ 2RHSB 2D0PA 1HJPA 4A3KH 1DGSA 1PYBA 4DV5L 4HJ9A 5LMUQ 2JE6I 3PO2G 3CCEA 3OW2A 4GLVB 1L0WA 3CMAA 3T1YL 1IBLQ 2E2IH 1JJGA 1BKBA 2MFIA 2UXDL 5AJ3L 1OXXK 4YWMA 2MQHA 4K0KQ 1MJCA 5IT9c 2ZM6L 5IP9H 3I4MG 3F2CA 4UPAA 4IPCA 1IYJB 5M5WH 1VQ9A 3KFUA 4A3DG 5GAHC 4IFDJ 5C3EG 4A3IH 3RN2A 2FXQA 1XMOL 4DV0Q 3J81j 1Q1BA 4UY8C 1GVPA 1PVOA 1H95A 1Y14B 3JAMc 5C44H 4OX9Q 3HOUG 3J7A5 4PZ8A 1YJNA 2AMCB 3BU2A 1UE6A 5IYDH 3NBHB 1OXSC 1YEZA 1VQDA 3KDFB 4DV1Q 3LGJA 2YTXA 1YHAA 1KD1C 3W1GA 1ASYA 3W1BA 1CKOA 1U5KA 1JJ2A 2R7FA 2E2JH 4DR4Q 2AWNA 2D0OA 3NEMA 4LFAQ 4LW1A 3PF4A 4DUZQ 3FP9A 2ZJQA 4GOPB 4DR5L 4JI0L 4BXXH 4JI2L 4NXNL 4R4TA 1OTCA 1HZ9A 3CPFA 5M5XH 2K52A 2JQOA 3CCMA 5FLXc 4HIKA 4LF4Q 1YHQA 4LF5Q 4JYAL 4AQYL 1WCMG 1VQEA 3ERSX 5FJ8G 2R7ZH 1VQ8A 2JA7H 3K0XA 3L7ZC 2EQSA 1L1OB 3K7AH 4GLXA 1PYSB 4JI8Q 1X54A 3HKSA 1E22A 1VQGA 5IYBH 4L5SA 4LWCA 2K5VA 2N8NA 1PH4A 1KIXA 4GKJL 1YJ9A 1X6OA 3STBC 5ELNA 1XPRA 5GADC 1TWFH 3GTLH 1IL2A 4DUYQ 1UWVA 2B63H 2Y0SG 1XMOQ 1S3OA 1YNXA 3FKIG 3TRZA 2E8GA 2JA5H 1WYDA 4BY7G 1AE3A 2RCNA 4NB3A 1QUQB 4UP9A 1N33Q 1L1OC 3RZOH 3A0JA 2R93H 3S14H 2E5LQ 1GD7A 1BBUA 4HIDA 3E9IA 2VNUD 2NN6G 1Y1VG 4HJ8A 1MIUA 2A1AA 1X3GA 1K3RA 4DR1L 3Q8DA 3STBD 3CD6A 2I0QA 1G6PA 4GNXA 2UUAL 2UUCL 2VL6A 1Q12A 3GDEA 4JI7L 3M9BA 2F4VQ 2BH8A 4A3MH 2GN5A 3GTMH 4BA2I 1CKNB 1HR0W 4WJ3M 2Z0SA 3BZCA 3S15H 4BBSH 4JI3L 3IRBA 4AIMA 4LF9Q 5C4XG 5HGQA 1SN8A 2EIFA 3ZJYC 1NMFA 1JJCB 4LUVA 5FLMH 1NJIC 1XNRQ 4WJ4A 1N32Q 1KXLA 3OTOL 1X3EA 1KRSA 4OONA 5E7NA 1UEBA 2ZTEA 1LM0A 3KYHC 1PH5A 2A8VA 5LMUL 5M5YH 1NE3A 2ZTCA 1XJVA 4P71A 1VQCA 2RHQB 2HHHQ 3W5OA 1IBLL 2OCEA 4GN4B 3EBEA 1PH1A 1VQLA 4X66Q 4YWKA 2IHFA 2V1CC 3ULPA 4K0KL 4BBRG 4DK6C 3J81c 3S1QH 4JCVE 4QQBX 2A19A 4A3BH 4O2DA 4EX5A 2UU9Q 4JBMA 1VQNA 3F8TA 3PGZA 4JV5Q 4DV0L 1VQ5A 2PMZE 1X56A 1EIFA 1J6QA 1TWHH 2EXDA 1K8GA 2JA6G 4MTNA 5IWAQ 2VQEQ 3ICEA 2VUMG 2VS1A 2Y0SE 4OX9L 1X55A 3HOYH 2WB1G 4B3TL 4YCUA 1YBYA 3ULJA 3M3YH 1D7QA 3I4NG 2CKZB 2VY3A 3L0OA 4DV1L 2GVAA 1XMQQ 1PV4A 2NVTH 1KL9A 1YHBA 1JT8A 2IY5B 5LMNW 3JC66 4DR2L 1PH7A 4QY7A 1VQ4A 4DR4L 4LFAL 2JA9A 5IE8A 1HR0Q 4DUZL 4GN3B 2N78A 4A3FH 3HOZH 4NPSA 3J80c 1X3FA 3PUWA 5GAEC 2WAQE 1Q7YC 4A3EG 3ULLA 3CCQA 1EUJA 4LF5L 4LF4L 3S1NH 2K5NA 4IFDI 3G6EA 1WFQA 3CCVA 5DLQE 4GOPA 1QZGA 4GS3A 2IHEA 1LYLA 1HNXQ 4JI8L 4C3IH 4A93G 2HIVA 4HIOA 4ALPA 5JJLA 3J7ZC 1C9OA 2E2HH 5C0XJ 2NVXH 1QVGA 3HOVG 2PI2E 1NMGA 2LXKA 4R1JA 4DUYL 2R92G 4A3CG 1IBMQ 3UDIA 3GTJH 1L1OA 3HOXG 1VQHA 3RNUA 3PUVA 2I5HA 5M3FG 2YYZA 4LUOA 3KF6B 4QJFA 1A62A 1N33L 4PZ7A 4C3JH 4B3TQ 1VS0A 1IZ6A 1EOVA 3HKZE 2K4KA 3K80C 4YCWA 1AH9A 1A63A 4JI1Q 2E5LL 3S16H 4HJ7A 3A5UA 1Q8KA 4A3KG 1VQ6A 1P16A 2PQAA 4A3GG 1GO3E 4POFA 3CMEA 1TWCH 5LMNQ 4DR2Q 2DUDA 3CQZH 2WB1E 1KRTA 1QUQA 2Q2IA 1BVSA 3A5ZB 3K8AA 2F4VL 4B3RL 2CWPA 3G48A 1YIJA 4L5TA 2ES2A 1X65A 3PUXA 5IP9G 1PHJA 3U58A 4LF9L 2MNAA 2K5HA 1XNRL 1VQOA 1PH3A 1L2FA 1SRUA 4A3IG 2JA8H 4TQUS 1EQRA 1N32L 1E1TA 3ER0A 5JJIA 3UE0A 3S17H 3PSIA 1OXUA 2GVBA 1CKNA 1HZCA 3RLFA 3I56A 4C2MH 4H02A 3AYHB 1VQAA 3I7FA 3FKIH 5C44G 4GOPC 1MJEA 2HHHL 1Q81C 4X6AH 4P75A 3S24A 4Y52H 2OQKA 1B8AA 5IYDG 4X66L 5BR8Q 3CC2A 4DR3Q 2L15A 2ZJRA 3M85A 3NENA 3KJOA 1Q1EA 4Y7NH 4KLKA 2JK8A 1CSQA 3BJUA 3U4ZA 4YHHQ 2XTIA 1PFSA 5JEAJ 2UU9L 4IPHA 4JV5L 4X64Q 1JE5A 3F2BA 1LTLA 4A76A 3UE1A 4DR6Q 1CSPA 5IWAL 2VQEL 1I94Q 1J5EQ 3CAMA 1XPOA 3F2DA 4BY1H 4BXXG 1EQQA 1YITA 4B3MQ 4JI4Q 2NZHA 3GTPH 1XMQL 3K81C 3D0FA 5M3MH 3VDYA 1LUZA 1E7ZA 2R7ZG 2JA7G 2D62A 1HZAA 1V9PA 2WAQG 1Y1WH 3S1MH 2MO0A 4B3RQ 5IYBG 1HR0L 1E1OA 4A3JH 2ZJPA 1PH8A 4L5QA 1E3PA 2Z6KA 2BH2A 1RL2A 1KAWA 4P72A 1VQMA 1XNQQ 3CCRA 2B63G 3PUYA 4DAYB 2AKWB 4KHPQ 3PCOB 2JA5G 1SFOH 4XTCS 3RLOA 5JJKA 4QIWE 2R93G 1HNXL 2UXBQ 2XGTA 3CC4A 2LSSA 1FJGQ 3I55A 3M4OH 2OQ0A 3CW2C 4GKKQ 3RN5A 4DR7Q 1G51A 3H0GH 3HKZG 4IFDG 1HNZQ 1G291 1I6HH 2MO1A 1T9HA 3M4PA 4R4OA 4DAMA 1IBML 1K9MC 1VQKA 3GTOH 3F1ZA 2PI2A 4A3MG 4TVAB 3S1RH 4R4CA 4X65Q 4FDBA 4DV3Q 1KC8C 2B3GA 4BBSG 3KOJA 4JBJA 1Z47A 1K0RA 5IYCH 2OWOA 2B29A 4DV6Q 4JI1L 4YY3Q 5FLMG 2UXCQ 2QGQA 3K7UC 4A3LH 1N36Q 2YV5A 3CC7A 5IP7H 4R4IA 5C4JH 1YVCA 5GQOA 5LMNL 3AFPA 4NXMQ 1WJJA 3UDFA 1Z9FA 2OTJA 3KF6A 2IX0A 2KBNA 4IPDA 3RLNA 1C0AA 3H15A 4JOIC 3PF5A 3UDXA 1GM5A 3PO2H 2PNHA 2DGYA 4A4IA 3KDFA 1IBKL 1K73C 2N3SA 1ASZA 2ID0A 2KHIA 3D31A 3PO3G 4X62Q 4A93H 3GTGH 2Z6KC 1I3QH 1VQIA 4PMWA 1W2BA 1PH2A 4A3BG 4JI6Q 2R7DA 5GAGC 3S2HH 1PH6A 1QVCA 3PV0A 3I4MH 1M90C 4A3DH 4LFCQ 2HT1A 3PIPA 3H3VH 2C35B 4YCVA 5C3EH 1BBWA 3CF5A 2UUBQ 2WP8J 1UE7A 3MXNB 3HOXH 2VQFQ 3TS0A 3HOYG 3HOWG 2ALYB 4QL5A 1IXRA 3DM3A 2QEXA 1CUKA 5BR8L 3DLLA 1KQSA 4DR3L 4LF8Q 3HOUH 3GTKH 1CKMA 2YTVA 1FL0A 4O0AA 3CCSA 4B3SQ 4OO1I 4MZ9A 4YHHL 3JAMi 3E0EA 1VQPA 1SR3A 4X64L 4A3GH 3TREA 1EFWA 2H5XA 4DV7Q 4DR6L 1N34Q 1UE1A 3M4QA 3MEFA 4ME3A 4A3FG 1J5EL 1I94L 1C7YA 3HOZG 1SMXA
chains in the Genus database with same CATH superfamily
3RMHA 4QMGA 2KCMA 4B3ML 1F9QA 1D1KA 1W6JA 3T16A 3GV3A 4BBRB 3I4OA 4C3IG 4JW0A 1WD1A 2K14A 1JB7A 2FJ2A 4U68A 1EIYB 3NK9A 4R8NA 3V2TA 3VR3A 3HGBA 1PDQA 3MWYW 1HNWQ 3OYYA 5T1GA 1NBWA 1PXUA 4OXPA 4HJAA 2B2YA 4C3JG 1DOKA 1TT2A 4BY7H 2UXBL 4DV2Q 1NTGA 1PTOF 3WWVA 1FJGL 4JK1C 1M8AA 1BO0A 5IODA 1TY0A 4DXGA 2K50A 4FF1A 1OXVA 2B2VC 3EN2A 1GUTA 3CCJA 2OXPA 3E6ZX 4A75A 2QCPX 2A69D 3J80E 4P73A 3VR5A 4M1UB 4IOAA 1O7IA 2WIIB 2UXDQ 2L9HA 1D8LA 2K6AA 3S2HB 4OWTB 4NXML 4A3DB 1N9WA 5CMDA 4DK3C 2CQOA 1AW7A 4AH6A 3TP6A 1T5EA 1SXTA 2NVQH 1SJHD 3GTKB 3D8GA 4KN4C 1XYIA 2K28A 4I65A 2O2LD 3Q24A 1HH2P 3EIVA 2L4NA 3J81i 3G6JB 2VUMH 4N8FA 2IPKD 4JI2Q 1VQBA 2XWBB 4IPGA 1XPUA 3I4NH 5H1SE 4GLAC 1EU4A 1L0XB 3B6YA 2Q2TA 2RCFA 4ZAIA 1YNJD 3K5MA 3BVZA 4KKTA 4GN5A 1N34L 2QKIC 4IJHA 4OO1G 5CV8A 1H9KA 4K6DA 3K58A 2ZTDA 3PO3H 3I91A 4J15A 1IW7D 2Y0SB 3VYTA 1A0IA 3S2DH 3HS0C 4R4QA 1MSHA 3GTQH 4WJWA 4BY7B 1Q90A 3SGIA 1JE4A 3G4SA 4QGUA 1ZEQX 4UP8A 1B7YB 4C3HH 2G9HD 1YJWA 1BBXC 5D3DA 1O7YA 3PIO3 1HNWL 2K75A 1B1ZA 4ZCKA 3SK8A 1JOQA 1VCIA 4X3TA 2AHOB 5M3FH 1BCPC 1F9PA 4DV2L 2Q8IB 4GNXC 3NHHA 3G71A 1EYAA 5J3BA 4HJ5A 2BCOA 4ZKBB 1GKHA 4A3KH 4DA2A 3DXJC 1DGSA 2X69A 1I4GA 5IT9L 2RDFA 3OW2A 1BQQT 5C3WA 3BDCA 1JJGA 2E2IH 5A35A 2UXDL 2NVQB 1OXXK 4YWMA 4K0KQ 3I4MG 1LT5D 4UPAA 4IPCA 1IYJB 5GAHC 2FXQA 3J81j 3VA7A 4OIKA 1PVOA 2LY7A 1V8QA 4A3MB 1HQRD 1ZXTA 1KDAA 5C44H 3HOUG 3J7A5 3CHBD 3KLSX 4PZ8A 3BU2A 1TS5A 4DV1Q 1KD1C 1YHAA 4C1NK 3I4NB 2JSOA 1U5KA 1B9NA 1JJ2A 3VYUA 2PW5A 2D0OA 4LMQD 2MUYA 4C56C 5EPLA 3URYA 1CHPD 4JI2L 1E0BA 1OTCA 5I6WA 3CPFA 3OIQA 1Q8IA 2K52A 4HIKA 3PO3B 3OMGA 3ERSX 4WFN3 2R7ZH 3GTQB 4GLXA 1LTBD 1X54A 3HKSA 4L8JA 2K5VA 1PH4A 1TS3A 1F9SA 4C3HB 2ZXRA 1IL2A 1UWVA 1S3OA 2FINB 1K8OA 1YNXA 3ONAB 1WYDA 4DK0A 3KK7A 5M3FB 4NB3A 1G6ZA 5IGGA 1BBUA 4HIDA 1FNUA 2NN6G 4A3KB 3SK5A 1G6PA 4LJZC 4MN3A 2BH8A 4K6LA 3BZCA 3DM1A 2E2IB 4AIMA 5HGQA 2EIFA 2LFNA 3ZJYC 5E7NA 2ZXOA 4OONA 1UEBA 2ZTEA 3BVMA 5M5YH 2JP1A 1XJVA 1VQCA 1YNNC 1PH1A 4X66Q 4YWKA 3ULPA 2A6HC 4K0KL 4KY7A 4BBRG 4DK6C 3EROA 2A19A 4CKCA 4O2DA 2UU9Q 3LWUA 1VQNA 2B2TA 1X3QA 3FVQA 3LX0A 4OIJA 2LKVA 2VS1A 2WB1G 4YCUA 1YBYA 2CKZB 2VY3A 4DV1L 1XMQQ 2GVAA 1KL9A 1EY8A 2IY5B 2RVLA 1CFMA 4IUQA 4DR2L 2R7ZB 2DNCA 4ABNA 2TSSA 1JWSD 3PUWA 4ZLTF 1EQVA 3ULLA 3QIAA 1JOKA 1D5MC 3WOFA 2SEBD 3G6EA 4IFDI 5ELFA 3CCVA 1LYLA 4C3IH 4BS9A 5ELEA 1DONA 1VF5C 4X3SA 2NVXH 5FO7B 2ZT9C 3HOVG 2PI2E 5I4DA 2EVBA 2EYHA 2R92G 1JQYD 3GTJH 1VQHA 5IIFA 1IL8A 2I5HA 3SK4A 4C3JH 4EQPA 1AH9A 3K80C 3BVGA 1A63A 4JI1Q 3S16H 2F0GA 1Z6HA 4MTKA 1TQOA 1PYWD 3J7AF 1W6KA 1VQ6A 3CMEA 1KDBA 2DUDA 2B2UA 2DY7A 5M5YB 4XQQA 2KCCA 4B3RL 1BF4A 2CWPA 3CU7A 1LO5D 5IGBA 3R2IA 3E5SA 5IP9G 1LT3D 4DK1A 4J6HA 1G8ZD 3I90A 4V190 1L2FA 1TS4A 2FMCA 3SE0A 3ER0A 3TZDA 3UE0A 5JJIA 5IGEA 4FVMA 1CKNA 3RLFA 3I56A 2K5QA 3I7FA 3FKIH 1B4OA 1Q3LA 3S24A 4X66L 4KV6A 2K04A 3NENA 4KLKA 3U4ZA 2UU9L 1PFSA 2HCCA 1JE5A 1LTLA 2PZUA 1CTMA 1XPOA 3VA5A 3K5NA 1YITA 4XT3B 2NZHA 1O80A 3VYRA 1XMQL 4KD3A 1HZAA 2DJGC 1EY9A 5C3EB 4C3IB 2EYFA 3UI2A 2Z6KA 1B3AA 1WVLA 2NVXB 4PQXA 1VQMA 2K01A 2B63G 2OEOA 5ELBA 3X3MA 4KHPQ 3PCOB 4FF3A 1SFOH 3GTJB 2P5ZX 3JAME 3KBXA 2WKCA 2XGTA 4C3JB 3CC4A 4ZUJA 3I55A 2B2YC 3RN5A 1IYVA 3S16B 4DR7Q 1HUNA 1HNZQ 2QW7A 4HEDA 3GTOH 2F03A 4A3MG 4TVAB 3S1RH 4R4CA 4X65Q 2LS01 2B3GA 2EE1A 1K0RA 2SOBA 2B29A 4JI1L 2UXCQ 4FYDA 2KEEA 3K7UC 2EXZA 1STHA 2OTJA 1I4QA 4IUUA 2K03A 3FKIB 2MGSA 1GM5A 3NTKA 1IBKL 3K6OA 2PQEA 2N3SA 2AQ1B 2F0QA 4OGQC 5C6AA 1ASZA 3D31A 3Q6SA 4X62Q 2L55A 3PO3G 3CKIB 1CK1A 1I3QH 1W2BA 1PH2A 5D3IB 3I4MH 2BDNA 3KLSA 4LFCQ 3PIPA 2HT1A 1IKMA 2UUBQ 3MXNB 2VQFQ 2N88A 3TS0A 1TU2B 1SE3A 3DLLA 3HOUH 3G7LA 4O0AA 4MZ9A 5M9OA 1STEA 1F2YA 1SR3A 4RFBA 4MIUA 1EOTA 3M4QA 2Z4IA 3MEFA 3HOZG 4R8IA 3GP7A 5TSSA 1GJXA 2NWGA 1N8RC 1WTVA 1PA6A 5KRUA 4CJ1B 3A8IE 2NVYH 1SFOB 2IX1A 3NTHA 4G4KA 1EYDA 2RSOA 1VDZA 4I7AA 2R61A 4IN3A 3M7NA 1S72A 1HCZA 1B70B 2RF4A 5ISRA 2OF1A 1H9MA 1QJOA 3TS2A 1SROA 4OELB 5K36G 1IKLA 4UP7A 4KHPL 3PUZA 3GTOB 2A68C 3S1RB 4K8IA 4DPGA 3I72A 3FPPA 1BNZA 3OMCA 1K8AC 1MSGA 2CVRA 3NSWA 2WV6D 4CHTB 2Z9HA 2F52A 2EYJA 4BWGB 4DR7L 2EPBA 2NN6H 1AEXA 1JWUD 2HIXA 1HNZL 2CQAA 4P74A 1TWAH 1PRTB 3CPWA 1DM0B 1F2LA 3EQLC 2PNRC 2L12A 3MC0B 4X65L 5EGTA 5LHY1 1Q46A 4OWWB 3KJPA 1EY0A 2UXCL 1F9RA 1I3QB 3NWSA 2EY6A 3I4MB 2K1BA 1I6VC 1CQFA 1HXYD 5C4ZA 1R9TH 2VB3X 3OWFA 4X62L 3HOUB 1AZPA 1T5XD 1SNOA 1SMYC 5D65A 3TBIB 2IL8A 4MNOA 2EJFC 4BBRH 1SE2A 3UDGA 4B08A 4LFCL 1HZBA 2I5LX 1M4VA 3H3VC 2UUBL 3D4DA 1ONLA 2VQFL 2LXJA 4DNIA 3QO2A 1ENFA 4NXNQ 2DY8A 3GO5A 1YI2A 5M3MG 2CCZA 4KTAA 3AFQA 4AQYQ 2NVYB 3F2UA 1WTHA 3C46A 1UE5A 1G2SA 1QVFA 1VQ7A 5GROA 3NELA 2IWHA 4GKJQ 1KNEA 1V1PB 3C1EA 4HN7A 4IOCA 4JBKA 4FF4A 1A2TA 4RCNA 3HG9A 1RODA 2BA1A 1I50H 3PIOA 2I5MX 4AYBE 2F0SA 1BCPB 1C48A 4GNXB 3L2PA 1S5BD 5C0XI 4FO2A 1SYBA 2N55A 3AEVA 2JJQA 4DR1Q 4CGYB 1TWAB 5CC4A 3HOVH 5K5PA 1YZ6A 2R92H 3U50C 2UUCQ 4FXKC 3NBIA 1O7LA 1FGUA 1U0LA 4JI3Q 4A3LG 4NP5A 2EYLA 3K5OA 4R9WA 2KOLA 3AMUA 1F2ZA 5LL6X 1TWFB 3PO2G 3P20A 3CCEA 1UNSA 1A6XA 1ILPA 4GLVB 1LV9A 1B9MA 1R9TB 5G3LF 2MFIA 4F87A 2MQHA 1MJCA 5IT9c 1XXGA 5IP9H 3KFUA 1B50A 3QB3A 5C3EG 5CORA 3A54A 1Q1BA 2F0PA 1HA5A 1ZYRC 4KJOA 1LLRD 3FDTA 2Q8TA 4OX9Q 1FNVA 4IALA 4WORA 2WB1B 1YEZA 4H44C 3LGJA 1D5XC 1QG7A 1CKOA 4Q5VA 2R7FA 4LFAQ 3PF4A 2JYOA 2Z8LA 3FP9A 4GOPB 5JVH3 2C5CA 5KGUA 1CZGA 1PMRA 4K5XA 4NXNL 2H4OA 3ND9A 4ZQ3A 2XIWA 5FLXc 4XYQA 4IZ8A 4AQYL 1ESRA 1WCMG 1I50B 4A3BB 3NE5B 4JI8Q 1VQGA 3HP3A 4LWCA 4GKJL 3KF8A 1D2BA 5HGTA 1X6OA 2L5TA 1XPRA 3K57A 2B63H 3CRLC 3HOVB 3FKIG 4DGZA 1PRTC 2R92B 1U4LA 2RCNA 4L63B 2KEDA 1Y8NB 1QUQB 1N33Q 1K8MA 3A0JA 2WINB 2EOTA 3E9IA 2VNUD 1Y1VG 4HJ8A 1QOHA 4LK1C 2A1AA 3A56A 1K3RA 4RGOS 4DR1L 3MXUA 3STBD 2F0MA 2UUCL 2VL6A 3M9BA 4PMBA 1MHWC 1CZWA 2GN5A 4A3MH 2F4VQ 1HR0W 4WJ3M 5IT9E 5DM63 4JI3L 3T53B 1NUCA 3T51B 4QIWB 1KRSA 1PTOD 1PZKD 2G5DA 3DWPA 3KYHC 3L9AX 5IOCA 4BA2I 1CA6A 3A8JE 4P71A 4ULLA 2HHHQ 3EBEA 2IHFA 4HMJA 5EPKA 1K0SA 2F0VA 4E6IA 5CGKA 2A6ED 1VQ5A 1UAPA 3KUPA 3OIPA 2JA6G 2VQEQ 5FO9B 2E2DC 2Y0SE 3DWAA 4DFAA 4XT1B 4OX9L 1GHKA 2A5HA 2O5IC 1WTRA 4G7HC 3L0OA 5CV6A 2NYZD 5LMNW 1PZJD 4DF7A 1FYCA 3TN2A 1PH7A 3A7AB 1VQ4A 4LFAL 1XX8A 1LT4D 4MHEA 2N78A 3HOZH 3NBHA 1Q7YC 4A3EG 2F0WA 3CCQA 1EUJA 2B63B 2PYKA 3T13A 1Y8OB 4DNTB 5DLQE 3TZUA 2MJ8A 3VYSA 1HNXQ 4JI8L 4G7OC 3SK6A 4FNFA 4HIOA 3J7ZC 1C9OA 2E2HH 5C0XJ 2F0OA 4H7BA 4QF4A 2L0CA 2LXKA 2QDBA 5K36H 4RHSA 3PMFA 3BS1A 1IBMQ 1GUGA 1L1OA 3PUVA 4HCSA 3LWEA 2YYZA 4LUOA 3KF6B 2L1BA 1LT6D 4PZ7A 1ICFB 1N33L 1VS0A 1IZ6A 1EOVA 2K4KA 5J1ZA 5C4HA 1H9JA 1P16A 2PQAA 1CHQD 1GO3E 4POFA 4DR2Q 2BE5D 1XWEA 1KRTA 5JOBA 1ENCA 2Q2IA 2CW0C 2M00A 3A5ZB 5FLXL 2F4VL 1K28A 1BOSA 3PUXA 1PHJA 2K33A 2FHTA 2OT2A 1SRUA 4A3IG 1EQRA 3S17H 1ZKOA 4ODGA 5KEEA 4H02A 2HDMA 4GOPC 2HHHL 1Q81C 4H0LC 4P75A 4Y52H 2OQKA 1SYCA 4DR3Q 1A2UA 3KJOA 4PNYA 2XTIA 5JEAJ 1SSOA 1NR2A 4X64Q 4NW2A 2F0IA 2KCNA 2VQEL 1J5EQ 3F2DA 3HOZB 3H91A 4FXDA 4CBVA 3NWTA 3K81C 4K2KA 2G9DA 5M3MH 1LUZA 1E7ZA 2F0KA 2E75C 4B3RQ 1TKWB 5IYBG 3K59A 1BR9A 1S5CD 1EEFD 2NZ1D 3VR6A 2E2HB 1RL2A 4P72A 1HTPA 2F0UA 3MFYA 1I4HA 2AKWB 5JVG3 2JA5G 2KA7A 1SYEA 4CJ2C 3OOCA 5JJKA 2R93G 1HNXL 3AU7A 4ME5A 3M4OH 2OQ0A 3CW2C 5F2DA 3DEPA 2SDFA 1STGA 1G291 1I6HH 4IQZA 1T9HA 1IBML 3MA2B 1JC7A 4DU9A 2AUJD 1RHPA 4DV6Q 5FLMG 5KNBA 1SEBD 4A3LH 1N36Q 3OPOA 2YV5A 1QNUA 5C4JH 1CQVA 2F0FA 1K83B 4KY6A 3S17B 1E2ZA 1MBYA 3RLNA 1C0AA 3HEJA 1DD2A 4KK7A 4KMUC 1EWHA 2D2CC 3PO2H 2DGYA 4A4IA 3KDFA 1AZQA 2ID0A 3QG1A 2KHIA 1PLFA 1EY5A 2HCIA 4A93H 2KHSA 1RCVD 1SNMA 1D6EC 4A3BG 4JI6Q 5GAGC 1PH6A 2JN4A 3PV0A 3Q0AA 2CH4W 5CYUA 1TVXA 3H3VH 4QB4A 4TKOB 5C3EH 1BBWA 3HOXH 3D3RA 5CV7A 2ALYB 1C8CA 3SR1A 1IXRA 2QEXA 4DR3L 3SEBA 2YTVA 5M3MB 1GXDC 5BN4A 4B3SQ 4OO1I 4KKSA 4X64L 3TREA 1EFWA 1HPCA 5E3FA 1J5EL 1SMXA 5ELOA 3BYTB 4JG2A 1GOZA 5EBDA 3T4AC 4JC0A 1DOLA 1WCMH 5KNDA 3IAYA 2SNSA 2I07B 3EVQA 1P8LA 1IBKQ 2KCTA 1LTSD 1TWGH 2KHJA 5BN3A 4OEMB 3Q23A 4LF7Q 3M4OB 3I2ZA 3R3OA 4HAEA 1II3A 1PRTF 4HIMA 3P75A 4UAIA 1I6HB 2A74C 2A69C 4LFBL 2HQLA 4DV4Q 3GD7A 2NTSA 3CCUA 4PG3A 2AUKA 1HRJA 1FVIA 4JI5Q 4DAYA 2WFWA 4RMFA 5C4JB 1VQFA 1Y1VH 4IUPA 1FR3A 4DV5Q 5I9OA 3PO2B 1BUVT 2XVSA 2ASBA 3CRKC 3T1YQ 1DXMA 3EA6A 4ZKCB 5AJ3Q 1EYGA 4DV6L 3GQBA 1PH9A 4A93B 2ZM6Q 3D6WA 1N36L 2JA8G 1XTDA 1RKNA 3R2TA 1LTRD 2TMPA 4APVA 2CFMA 2CWAA 4XIGS 2PQAB 5ELDA 1QZHA 3NPPA 3QR8A 2F0JA 2BA0A 4YWLA 3HOXB 2VW9A 1KHIA 1PFMA 3DWQA 2B8FA 3KLWA 5E4WC 1UEAB 2M9VA 4K2LA 4JI6L 1YNJC 4IFDH 1KNAA 5NUCA 1MKHA 2JA6H 2EYMA 1S4ZA 5C0XG 3MXPA 1PRTD 1KLGD 3I73A 1QB5D 1IW7C 1ML0D 2A73B 5IGCA 1X9NA 1BCPF 2M2LA 1Y1WG 4B3SL 3E3XA 2J0TD 1WCMB 2N49A 4KI0A 5JPMC 4ZK9B 2ATWA 1TWGB 5EKLA 1H9RA 1DYQA 1JOOA 3FHWA 1U9RA 1A8VA 3RZDH 2DNEA 5FK9C 2NN6I 5L37A 4A3EH 1OXTA 1KQSA 4KHZA 1LACA 3RR5A 5IY0A 1Y69U 1RIPA 3IL8A 4LF7L 1EL0A 3H0GG 4G57A 1SE4A 1TY2A 1Y1VB 2KQ3A 4RG1A 1WTXA 5EAYA 3TSSA 2F3IA 1I5FA 3A74A 4JI7Q 1E2VA 4DV4L 1M1KC 2YTYA 4F88A 1S40A 2OTLA 4EQ5A 4L5RC 2F3WA 4JI5L 2Q2UA 1WI5A 1EZ8A 1TXYA 5JEAG 3GV6A 3OTOQ 2RHSB 2D0PA 4U673 1PYBA 4DV5L 4HJ9A 4RKLA 2JE6I 4FP5D 1IBLQ 3T1YL 1HHVA 3IKJA 5AJ3L 1HFNA 2E76C 4K14A 1BCPD 3P7JA 2ZM6L 1SBBB 3F2CA 1CI3M 5M5WH 4IFDJ 4A3IH 3RN2A 1XMOL 4UY8C 1H95A 2JA6B 1CM9A 5A2QE 2QDLA 5EKIA 2AMCB 1UE6A 3C2PA 3KDFB 2YTXA 4KKUA 1ASYA 2AQ3B 2J7ZA 2E2JH 2AWNA 1JWMD 3NEMA 4LW1A 2ZJQA 1STYA 4F7XA 3RZDB 1ILQA 1SNCA 2JQOA 4A3EB 3W3AA 1VQEA 2EY2A 2DN8A 4EGVA 5FJ8G 1VQ8A 2EQSA 5CV9A 2F0DA 2IX3A 1PYSB 4EVOA 1E22A 5IYBH 1KIXA 1O78A 4ILWA 2XSCA 3GTLH 5GADC 1TWFH 4DUYQ 5I9PA 2RA4A 3TDQA 2JA5H 1AE3A 3T56B 4K5VA 4UP9A 3RZOH 1L1OC 2R93H 3S14H 2E5LQ 3N6RA 2Z1CA 3MTSA 4XXEA 3Q8DA 2DJFC 3CD6A 5A2QL 3J7YW 4JI7L 3GTMH 4DNRB 1CKNB 3MEHA 3S15H 1RDPD 4OL7A 5C4XG 5FLMH 4LUVA 1NJIC 1XNRQ 4WJ4A 4S3SA 1N32Q 2MHVA 5M5WB 3OTOL 1KXLA 4A3IB 1PH5A 1LM0A 2ENBA 5FO8B 2ZTCA 3W5OA 2XRSD 1IBLL 1NNXA 4P2CB 2PMZB 3S1QH 4QQBX 1RTNA 1PFBA 1HUMA 4A3BH 4EX5A 1D1IA 3F8TA 4JV5Q 2E2JB 2PMZE 1K8GA 3SXHA 1J6QA 2EXDA 3C3LA 4MTNA 2NUCA 2F0EA 2VXWA 3S9WA 4B3TL 4NMZA 3ULJA 1YNND 1PV4A 2EYPA 5DAUA 1YHBA 2AQ2B 2A6HD 1JT8A 1JR0D 2B39A 2X6LA 1HR0Q 4GN3B 2L11A 1AP0A 3R8BA 4NPSA 3J80c 5GAEC 5IGFA 2F0HA 3GTLB 1DOMA 3X3NA 4NDXA 1GUOA 2RDGA 2JA5B 4A93G 1I4XA 3RZOB 2HIVA 4ALPA 4HCEA 3S14B 2R93B 1STBA 4TRDA 3RD4A 1STNA 1SNDA 1QVGA 5JPNC 5CBEE 1GHJA 4DUYL 4A3CG 3HOXG 3RNUA 2ICEC 1EY7A 3GTMB 4IUTA 2B2TC 4QJFA 1R4PB 1UUPA 2CH4A 4ZUIA 3S15B 2E5LL 1PFNA 2F0TA 1Q8KA 4RH6A 5LMNQ 2HUGA 1TWCH 3OSOA 3PQIA 1A15A 2WB1E 1I4RA 3KLRA 1BVSA 1QILA 3K8AA 5CV5A 3MAQA 2B2WA 1YIJA 2FFKB 2ES2A 1X65A 3S1QB 3DEOA 4XQJA 2K5HA 1XNRL 4KHVA 2JA8H 1N32L 1B3QA 1E1TA 3VR4A 3PSIA 1GUNA 1HZCA 5C3XA 4X6AH 4Z9CB 2IW3A 4F8MA 1B8AA 5IYDG 5BR8Q 4DN4M 3MXGA 5KYLA 3M85A 1Q1EA 3D4WA 4NKLA 4WRDA 1QCBD 4YHHQ 5G3LD 4TSSA 4IPHA 4JV5L 4IUVA 3K0YA 3F2BA 4A76A 5DEHA 3UE1A 4DR6Q 1WD0A 1CSPA 1NSNS 1BXTA 5JAVA 4BXXG 4GZYC 4EQNA 1EQQA 5C0XH 4RGTA 4JI4Q 1H9SA 3D0FA 4C1NI 3R93A 5KYIA 2JA7G 2D62A 2WAQG 1Y1WH 4HMIA 2J4XA 3FEWX 2B2UC 4ZRZA 1HR0L 1E1OA 1X3PA 4L5QA 2BH2A 1XNQQ 3CCRA 3MFGA 2O5JC 1PZID 2D5DA 4UDUC 4QIWE 2LSSA 4GKKQ 2MP1A 1ET6A 3D4RA 3H0GH 3HKZG 4IFDG 3WOEA 1TIID 2MO1A 1TWCB 4K5WA 1K9MC 1VQKA 1E2WA 1U4MA 2PI2A 4DV3Q 1SNQA 4HR7B 1KC8C 1VMPA 4BBSG 3KOJA 4JBJA 1Z47A 2OWOA 5FLXE 3N52A 4I7ZC 3V96A 4YY3Q 1LTAD 2QGQA 1Z7TA 1XTCD 4R4IA 3I4LA 5GQOA 5LMNL 2JA8B 5JEAH 3J80L 4CDFC 3A55A 1Z9FA 2KBNA 3PF5A 3UDXA 3RUZA 5COYA 1SAPA 3GTGH 5I2XA 1PTOH 2Z6KC 1VQIA 2R7DA 3M7GA 4KJNA 4N9PA 1EEID 4Q0FA 2C35B 4ID6A 3CF5A 4FF2A 2WP8J 1UE7A 4ZYSA 3HOYG 2EYOA 4QL5A 4LF8Q 1CUKA 5BR8L 4EQOA 1FL0A 1MGSA 3SHLA 3CCSA 4YHHL 4YIJA 1ESFA 1Y1WB 1SYGA 4A3GH 3D6CA 4RGMA 4DV7Q 3KBGA 4DR6L 4A3FG 5EPJA 2PZWA 1VQ9A 4JI4L 1JMCA 3ERQA 1B44D 2PZTA 3IFDA 2EZVA 3E9HA 5FJ8H 5KIXA 5C5LA 4BA1I 1C4QA 1KAAA 5T1IA 2IT1A 2VUMB 1SLJA 1XNQL 5E1FA 1K83H 3CP0A 3H0GB 4IO9A 3TP8A 5JJZA 1LABA 4KD4A 2EY1A 1SE8A 1VMCA 5DNFA 1NAPA 4RWSC 2BOSA 3CXCA 3I8ZA 3AQQA 4HTHA 1A3UA 3T1HQ 4LF6Q 4CDCC 4GKKL 3WDNA 1E24A 1IYUA 3NXWA 1EIHA 2JEAI 2QEJC 5IGDA 3H3VI 1WTQA 3EJIA 1L0YB 2F4IA 4DV3L 3S2DB 2A68D 2Q2HA 1VQJA 1V1QA 3MHBA 5FOBB 4AYBG 4YY3L 3H94A 3GTGB 1PTOB 5C4XH 1JICA 3NP8A 1SNPA 3TEHB 4JOIA 3U4VA 2WACA 2K5WA 1V43A 1LTID 3BZKA 3CCLA 2NZOA 2AWOA 2NB0A 4OWXB 4LFBQ 3QWNA 2XN9C 2Z6BA 4A3GB 1KABA 1W3SA 4BY1G 4PZ6A 1U4PA 1EWIA 1LTTD 4DR5Q 4LF8L 4JI0Q 2PO4A 3QJYA 1B2TA 3KF8B 4M8AA 1Q82C 2QA4A 3H09A 4JYAQ 4PMCA 1SMYD 2VZAA 2K32A 4QUFA 1FD7D 1WOCA 1EU3A 3MXNA 4RHRA 4A3JG 3FPUB 3TQYA 4DV7L 2VB2X 4JPBW 1S5DD 5AFWA 2RBMA 4HSPA 5C44B 3HRZC 2ICIA 5DM73 3HFZB 1NY4A 1DJRD 1H9SB 1AE2A 3J80i 4JBWA 3J7AV 2KENA 3BZDB 4DKAC 1F77A 4LUZA 5HY6A 4LNQA 4X3KA 1Q86C 3HOWH 1HA6A 4CJ0B 4IJLA 2UUAQ 3HZXA 4A3CH 4RGNA 2R6GA 1KLUD 5IYCG 3T1HL 4LF6L 4POGA 1LTGD 2B2VA 1KDCA 2YU9H 5IP7G 1WTPA 5C4XB 5J39A 3NQTA 2JEBI 1HJPA 4B9XA 5LMUQ 5J22A 1EWCA 4O1NA 1L0WA 3CMAA 2H1EA 1AFPA 1BKBA 3BDLA 4O42A 1JB3A 2RQXA 1QNKA 3OHXC 1SDFA 4A3DG 1NR4A 4DV0Q 3W2DA 1TS2A 1GVPA 1Y14B 1QWYA 3DMUA 4N8X1 3JAMc 1STAA 1RF2D 1YJNA 1G2TA 5IYDH 3NBHB 1OXSC 1VQDA 2RSNA 3FRPB 3W1GA 3W1BA 2KUMA 4DR4Q 1GUSA 2EJGC 4DUZQ 2BDOA 4DR5L 4JI0L 4BXXH 1S5ED 2XNAC 1ZYRD 3ITPA 1EY6A 4R4TA 1WTOA 1HZ9A 5M5XH 3CCMA 4LF4Q 4LF5Q 4JYAL 1YHQA 1K3BC 5CR3A 4IUNA 2PPBC 3U9SA 2JA7H 3K0XA 3L7ZC 3K7AH 1L1OB 1GUWA 2K5DA 4L5SA 4CDEC 2N8NA 3SVMA 1YJ9A 3STBC 5CBAE 5ELNA 3HOWB 1J9OA 4CDDC 3ZYYX 2Y0SG 4DAPA 1XMOQ 3TRZA 2E8GA 4LAAA 3E0JA 3EFXD 4BY7G 2WKDA 3IFTA 1V1PA 1MD2D 1JORA 2HQEA 1EQTA 3OW7A 2YU9B 2MPMA 1GD7A 1PTOC 5E4XA 1MIUA 2B8GA 1X3GA 2LMCB 1EFID 2I46A 2I0QA 2KJXA 4GNXA 2UUAL 2O4XA 1Q12A 3NTIA 3GDEA 3V05A 5EKKA 2Z0SA 4KY5A 4BBSH 4N9TA 1EYCA 4L6TB 3IRBA 3SDZA 5I6YA 4LF9Q 1SN8A 2A6EC 2B2WC 3ND8A 1NMFA 1JJCB 2JXMB 1X3EA 3L3OC 4OO1H 2A8VA 5LMUL 1NE3A 4G7ZC 3C1FA 2RHQB 5I2YA 3A7LA 2OCEA 4GN4B 1VQLA 1SYFA 2XRQD 3H6MA 2V1CC 2PCFB 3J81c 4JCVE 4JBMA 3PGZA 1RJTA 3OWEB 4DV0L 1X56A 1EIFA 1TWHH 1J8IA 2Q8RE 1A3TA 4OHJA 5IWAQ 3ICEA 2VUMG 3NQIA 1X55A 2QF7A 3HOYH 1D7QA 3M3YH 2RKSA 1X32A 2C9OA 3I4NG 2NVTH 5M5XB 1JCKB 2GA4B 1R4QB 3JC66 4QY7A 1HTLD 2JA7B 2WAQB 4DR4L 3K7AB 2JA9A 2EY5A 5HURA 5IE8A 4DUZL 1I4PA 4QCLA 1EY4A 4A3FH 1DZ1A 1X3FA 2WAQE 3BYYB 4J1MA 1Y8PB 4LF5L 4LF4L 3S1NH 2K5NA 3NUCA 4PV1C 3TP5A 1WFQA 3BDOA 4GOPA 1QZGA 4GS3A 1OO9B 2IHEA 1ENAA 1G91A 5JJLA 4C3HG 1CA5A 2F3VA 2BE5C 4RKBA 4V0BA 3JAML 1NMGA 4R1JA 3HKZB 3UDIA 5M3FG 4UHVA 2D9UA 1A62A 2ZXPA 1V1OA 4CKEA 2KVMA 3HKZE 4B3TQ 4YCWA 4BBSB 1HFGA 4RAUC 4IURA 4RA8A 3A5UA 4HJ7A 4QUCA 4A3KG 4A3GG 3O13A 1FGBD 1F2MA 5D14A 4DXFA 4XYOA 3CQZH 4B9WA 1QUQA 4K8JA 1RTOA 4X3UA 3K5LA 3G48A 4L5TA 4J8QA 3J81E 3U58A 4LF9L 2MNAA 1VQOA 3DUZA 1PH3A 4TQUS 4XQNA 1OXUA 2GVBA 1HQMC 1TWHB 3VR2A 4C2MH 1MJEA 3AYHB 1VQAA 2E74C 5C44G 2CW0D 3I3CA 3HOYB 2K7VA 3CC2A 2L15A 3M3YB 1BDOA 2ZJRA 2NVTB 4RCOA 1DCZA 4Y7NH 2JK8A 1QE6A 1B53A 1CSQA 3BJUA 3I70A 2CHBD 3P1HA 5IWAL 1I94Q 3CAMA 1VF7A 2NTTA 4BY1H 4A3FB 3QOJA 1KTKA 2HD3A 4H13C 4B3MQ 3GTPH 2K05A 1AN8A 2IJ0A 1ICWA 3VDYA 3S1NB 2R7ZG 2V4DA 1V9PA 3S1MH 2MO0A 2F0LA 2KECA 4A3JH 2ZJPA 2NBFA 1PH8A 2X6GA 1E3PA 4JVZA 1KAWA 1IHZA 1SYDA 3PUYA 4DAYB 4HSVA 5CV4A 1MI2A 3J81L 3DHQA 1SJED 4XTCS 3RLOA 5EJWA 2XWJB 2UXBQ 1TR5A 1FJGQ 1FNWA 1G51A 5C5MA 3M4PA 4R4OA 4DAMA 1RD9D 3CQZB 3F1ZA 5ELCA 2HDLA 4FDBA 1EIGA 1NCVA 5IYCH 2PW7A 3LNNA 4AYBB 3CC7A 5IP7H 1YVCA 3AFPA 5KNCA 1WJJA 3UDFA 4NXMQ 4DAVA 3A8KE 3KF6A 2IX0A 2RDHA 4IPDA 1O7ZA 3H15A 4JOIC 4C2MB 2PNHA 5EBCA 2SNMA 5EQ0A 3QOLA 2EJMA 1K73C 1D5ZC 1S5FD 5BN5A 3FMCA 4PMWA 1EZ6A 4Y7NB 3S2HH 1A3VA 1QVCA 2Z4HA 1M90C 4FXGC 4A3DH 3U9OA 4YCVA 2R3ZA 2QILA 3M4YA 2F1MA 4XDXA 5LL6S 4KN7C 3HOWG 1CT1D 4BY1B 3DM3A 3GTKH 1CKMA 3GTPB 3TP7A 4CKBA 3MZ5A 2F0NA 3JAMi 3PIP3 2EDGA 3S1MB 3E0EA 1VQPA 3AB9A 1U4RA 3BG3A 2H5XA 2FMMA 3MVVA 5FKAC 3Q22A 1UE1A 1ET9A 4ME3A 4A3JB 1WTWA 1N34Q 1I94L 1C7YA 3TMEA
chains in the Genus database with same CATH topology
4B3ML 1N8RC 2KCMA 1JMCA 1PA6A 4JI4L 5ELOA 4JG2A 2NVYH 3I4OA 4JC0A 1WCMH 2IX1A 3E9HA 5FJ8H 1P8LA 1IBKQ 2KCTA 2KHJA 1TWGH 2K14A 1JB7A 4LF7Q 3M7NA 3I2ZA 4BA1I 1S72A 1B70B 2RF4A 2IT1A 1SLJA 1EIYB 1XNQL 3TS2A 1SROA 1K83H 3CP0A 5K36G 4IO9A 4HIMA 4UP7A 1HNWQ 3OYYA 1SE8A 4LFBL 4KHPL 3PUZA 1NBWA 4OXPA 4HJAA 3CXCA 2HQLA 4DPGA 3AQQA 4DV4Q 4BY7H 3GD7A 3T1HQ 4LF6Q 2UXBL 4DV2Q 1NTGA 1K8AC 3WWVA 3CCUA 4PG3A 1FJGL 4GKKL 1E24A 1FVIA 4JI5Q 2F52A 2K50A 4DR7L 2WFWA 1OXVA 2HIXA 4RMFA 1HNZL 2JEAI 4P74A 1VQFA 1Y1VH 1TWAH 3EN2A 3CCJA 4DV5Q 4A75A 3CPWA 3H3VI 4X65L 4P73A 4DV3L 1Q46A 2ASBA 3T1YQ 2Q2HA 4OWWB 4IOAA 1O7IA 1VQJA 5AJ3Q 3KJPA 1V1QA 4DV6L 1PH9A 1EYGA 4AYBG 2UXDQ 4YY3L 2UXCL 2ZM6Q 1N36L 5C4XH 2JA8G 1XTDA 3TEHB 1D8LA 4JOIA 3U4VA 4OWTB 4APVA 2CFMA 4NXML 2CWAA 4XIGS 1N9WA 2PQAB 4DK3C 1V43A 1QZHA 2CQOA 4AH6A 4YWLA 2BA0A 3BZKA 1R9TH 3CCLA 2NZOA 2NVQH 2VW9A 1KHIA 2AWOA 4OWXB 3KLWA 4X62L 4LFBQ 4MNOA 4BBRH 4JI6L 3UDGA 1HH2P 3EIVA 4LFCL 1HZBA 2I5LX 3J81i 2UUBL 1W3SA 1MKHA 4BY1G 4PZ6A 2VQFL 2JA6H 2LXJA 1EWIA 5C0XG 4DNIA 4DR5Q 2VUMH 4LF8L 4JI0Q 4JI2Q 1VQBA 4NXNQ 3GO5A 3KF8B 5M3MG 1YI2A 1Q82C 2QA4A 4IPGA 2CCZA 1XPUA 1X9NA 3I4NH 4JYAQ 1Y1WG 5H1SE 3AFQA 4GLAC 4AQYQ 4B3SL 2VZAA 3B6YA 1WOCA 2Q2TA 2N49A 4KI0A 1UE5A 4A3JG 3TQYA 1QVFA 4DV7L 2ATWA 1N34L 4GN5A 1VQ7A 5GROA 3NELA 4GKJQ 3FHWA 1A8VA 4IOCA 3RZDH 4JBKA 4IJHA 4OO1G 2NN6I 2ZTDA 3PO3H 4A3EH 1OXTA 2BA1A 3HFZB 4J15A 1I50H 1NY4A 4KHZA 3PIOA 2I5MX 1A0IA 1AE2A 3J80i 4AYBE 3S2DH 3RR5A 4R4QA 4JBWA 3GTQH 5IY0A 4GNXB 2KENA 3SGIA 3L2PA 4DKAC 4QGUA 1RIPA 3G4SA 4LF7L 5C0XI 4LUZA 5HY6A 4UP8A 1B7YB 3H0GG 4C3HH 4LNQA 1Q86C 3HOWH 1YJWA 3AEVA 2JJQA 4DR1Q 4RG1A 3HOVH 1HNWL 2K75A 5EAYA 4IJLA 2F3IA 1YZ6A 1I5FA 2UUAQ 3U50C 3A74A 2UUCQ 2R92H 4A3CH 4JI7Q 1VCIA 4DV4L 2R6GA 2AHOB 5M3FH 5IYCG 2YTYA 3T1HL 1M1KC 4DV2L 4LF6L 4POGA 1FGUA 1U0LA 4GNXC 4EQ5A 1S40A 2OTLA 3G71A 2YU9H 4JI3Q 4L5RC 5J3BA 4HJ5A 4JI5L 4A3LG 5IP7G 2Q2UA 1WI5A 1TXYA 5JEAG 1GKHA 2JEBI 3OTOQ 2RHSB 2D0PA 1HJPA 4A3KH 1DGSA 1PYBA 4DV5L 4HJ9A 5LMUQ 2JE6I 3PO2G 3CCEA 3OW2A 4GLVB 1L0WA 3CMAA 3T1YL 1IBLQ 2E2IH 1JJGA 1BKBA 2MFIA 2UXDL 5AJ3L 1OXXK 4YWMA 2MQHA 4K0KQ 1MJCA 5IT9c 2ZM6L 5IP9H 3I4MG 3F2CA 4UPAA 4IPCA 1IYJB 5M5WH 1VQ9A 3KFUA 4A3DG 5GAHC 4IFDJ 5C3EG 4A3IH 3RN2A 2FXQA 1XMOL 4DV0Q 3J81j 1Q1BA 4UY8C 1GVPA 1PVOA 1H95A 1Y14B 3JAMc 5C44H 4OX9Q 3HOUG 3J7A5 4PZ8A 1YJNA 2AMCB 3BU2A 1UE6A 5IYDH 3NBHB 1OXSC 1YEZA 1VQDA 3KDFB 4DV1Q 3LGJA 2YTXA 1YHAA 1KD1C 3W1GA 1ASYA 3W1BA 1CKOA 1U5KA 1JJ2A 2R7FA 2E2JH 4DR4Q 2AWNA 2D0OA 3NEMA 4LFAQ 4LW1A 3PF4A 4DUZQ 3FP9A 2ZJQA 4GOPB 4DR5L 4JI0L 4BXXH 4JI2L 4NXNL 4R4TA 1OTCA 1HZ9A 3CPFA 5M5XH 2K52A 2JQOA 3CCMA 5FLXc 4HIKA 4LF4Q 1YHQA 4LF5Q 4JYAL 4AQYL 1WCMG 1VQEA 3ERSX 5FJ8G 2R7ZH 1VQ8A 2JA7H 3K0XA 3L7ZC 2EQSA 1L1OB 3K7AH 4GLXA 1PYSB 4JI8Q 1X54A 3HKSA 1E22A 1VQGA 5IYBH 4L5SA 4LWCA 2K5VA 2N8NA 1PH4A 1KIXA 4GKJL 1YJ9A 1X6OA 3STBC 5ELNA 1XPRA 5GADC 1TWFH 3GTLH 1IL2A 4DUYQ 1UWVA 2B63H 2Y0SG 1XMOQ 1S3OA 1YNXA 3FKIG 3TRZA 2E8GA 2JA5H 1WYDA 4BY7G 1AE3A 2RCNA 4NB3A 1QUQB 4UP9A 1N33Q 1L1OC 3RZOH 3A0JA 2R93H 3S14H 2E5LQ 1GD7A 1BBUA 4HIDA 3E9IA 2VNUD 2NN6G 1Y1VG 4HJ8A 1MIUA 2A1AA 1X3GA 1K3RA 4DR1L 3Q8DA 3STBD 3CD6A 2I0QA 1G6PA 4GNXA 2UUAL 2UUCL 2VL6A 1Q12A 3GDEA 4JI7L 3M9BA 2F4VQ 2BH8A 4A3MH 2GN5A 3GTMH 4BA2I 1CKNB 1HR0W 4WJ3M 2Z0SA 3BZCA 3S15H 4BBSH 4JI3L 3IRBA 4AIMA 4LF9Q 5C4XG 5HGQA 1SN8A 2EIFA 3ZJYC 1NMFA 1JJCB 4LUVA 5FLMH 1NJIC 1XNRQ 4WJ4A 1N32Q 1KXLA 3OTOL 1X3EA 1KRSA 4OONA 5E7NA 1UEBA 2ZTEA 1LM0A 3KYHC 1PH5A 2A8VA 5LMUL 5M5YH 1NE3A 2ZTCA 1XJVA 4P71A 1VQCA 2RHQB 2HHHQ 3W5OA 1IBLL 2OCEA 4GN4B 3EBEA 1PH1A 1VQLA 4X66Q 4YWKA 2IHFA 2V1CC 3ULPA 4K0KL 4BBRG 4DK6C 3J81c 3S1QH 4JCVE 4QQBX 2A19A 4A3BH 4O2DA 4EX5A 2UU9Q 4JBMA 1VQNA 3F8TA 3PGZA 4JV5Q 4DV0L 1VQ5A 2PMZE 1X56A 1EIFA 1J6QA 1TWHH 2EXDA 1K8GA 2JA6G 4MTNA 5IWAQ 2VQEQ 3ICEA 2VUMG 2VS1A 2Y0SE 4OX9L 1X55A 3HOYH 2WB1G 4B3TL 4YCUA 1YBYA 3ULJA 3M3YH 1D7QA 3I4NG 2CKZB 2VY3A 3L0OA 4DV1L 2GVAA 1XMQQ 1PV4A 2NVTH 1KL9A 1YHBA 1JT8A 2IY5B 5LMNW 3JC66 4DR2L 1PH7A 4QY7A 1VQ4A 4DR4L 4LFAL 2JA9A 5IE8A 1HR0Q 4DUZL 4GN3B 2N78A 4A3FH 3HOZH 4NPSA 3J80c 1X3FA 3PUWA 5GAEC 2WAQE 1Q7YC 4A3EG 3ULLA 3CCQA 1EUJA 4LF5L 4LF4L 3S1NH 2K5NA 4IFDI 3G6EA 1WFQA 3CCVA 5DLQE 4GOPA 1QZGA 4GS3A 2IHEA 1LYLA 1HNXQ 4JI8L 4C3IH 4A93G 2HIVA 4HIOA 4ALPA 5JJLA 3J7ZC 1C9OA 2E2HH 5C0XJ 2NVXH 1QVGA 3HOVG 2PI2E 1NMGA 2LXKA 4R1JA 4DUYL 2R92G 4A3CG 1IBMQ 3UDIA 3GTJH 1L1OA 3HOXG 1VQHA 3RNUA 3PUVA 2I5HA 5M3FG 2YYZA 4LUOA 3KF6B 4QJFA 1A62A 1N33L 4PZ7A 4C3JH 4B3TQ 1VS0A 1IZ6A 1EOVA 3HKZE 2K4KA 3K80C 4YCWA 1AH9A 1A63A 4JI1Q 2E5LL 3S16H 4HJ7A 3A5UA 1Q8KA 4A3KG 1VQ6A 1P16A 2PQAA 4A3GG 1GO3E 4POFA 3CMEA 1TWCH 5LMNQ 4DR2Q 2DUDA 3CQZH 2WB1E 1KRTA 1QUQA 2Q2IA 1BVSA 3A5ZB 3K8AA 2F4VL 4B3RL 2CWPA 3G48A 1YIJA 4L5TA 2ES2A 1X65A 3PUXA 5IP9G 1PHJA 3U58A 4LF9L 2MNAA 2K5HA 1XNRL 1VQOA 1PH3A 1L2FA 1SRUA 4A3IG 2JA8H 4TQUS 1EQRA 1N32L 1E1TA 3ER0A 5JJIA 3UE0A 3S17H 3PSIA 1OXUA 2GVBA 1CKNA 1HZCA 3RLFA 3I56A 4C2MH 4H02A 3AYHB 1VQAA 3I7FA 3FKIH 5C44G 4GOPC 1MJEA 2HHHL 1Q81C 4X6AH 4P75A 3S24A 4Y52H 2OQKA 1B8AA 5IYDG 4X66L 5BR8Q 3CC2A 4DR3Q 2L15A 2ZJRA 3M85A 3NENA 3KJOA 1Q1EA 4Y7NH 4KLKA 2JK8A 1CSQA 3BJUA 3U4ZA 4YHHQ 2XTIA 1PFSA 5JEAJ 2UU9L 4IPHA 4JV5L 4X64Q 1JE5A 3F2BA 1LTLA 4A76A 3UE1A 4DR6Q 1CSPA 5IWAL 2VQEL 1I94Q 1J5EQ 3CAMA 1XPOA 3F2DA 4BY1H 4BXXG 1EQQA 1YITA 4B3MQ 4JI4Q 2NZHA 3GTPH 1XMQL 3K81C 3D0FA 5M3MH 3VDYA 1LUZA 1E7ZA 2R7ZG 2JA7G 2D62A 1HZAA 1V9PA 2WAQG 1Y1WH 3S1MH 2MO0A 4B3RQ 5IYBG 1HR0L 1E1OA 4A3JH 2ZJPA 1PH8A 4L5QA 1E3PA 2Z6KA 2BH2A 1RL2A 1KAWA 4P72A 1VQMA 1XNQQ 3CCRA 2B63G 3PUYA 4DAYB 2AKWB 4KHPQ 3PCOB 2JA5G 1SFOH 4XTCS 3RLOA 5JJKA 4QIWE 2R93G 1HNXL 2UXBQ 2XGTA 3CC4A 2LSSA 1FJGQ 3I55A 3M4OH 2OQ0A 3CW2C 4GKKQ 3RN5A 4DR7Q 1G51A 3H0GH 3HKZG 4IFDG 1HNZQ 1G291 1I6HH 2MO1A 1T9HA 3M4PA 4R4OA 4DAMA 1IBML 1K9MC 1VQKA 3GTOH 3F1ZA 2PI2A 4A3MG 4TVAB 3S1RH 4R4CA 4X65Q 4FDBA 4DV3Q 1KC8C 2B3GA 4BBSG 3KOJA 4JBJA 1Z47A 1K0RA 5IYCH 2OWOA 2B29A 4DV6Q 4JI1L 4YY3Q 5FLMG 2UXCQ 2QGQA 3K7UC 4A3LH 1N36Q 2YV5A 3CC7A 5IP7H 4R4IA 5C4JH 1YVCA 5GQOA 5LMNL 3AFPA 4NXMQ 1WJJA 3UDFA 1Z9FA 2OTJA 3KF6A 2IX0A 2KBNA 4IPDA 3RLNA 1C0AA 3H15A 4JOIC 3PF5A 3UDXA 1GM5A 3PO2H 2PNHA 2DGYA 4A4IA 3KDFA 1IBKL 1K73C 2N3SA 1ASZA 2ID0A 2KHIA 3D31A 3PO3G 4X62Q 4A93H 3GTGH 2Z6KC 1I3QH 1VQIA 4PMWA 1W2BA 1PH2A 4A3BG 4JI6Q 2R7DA 5GAGC 3S2HH 1PH6A 1QVCA 3PV0A 3I4MH 1M90C 4A3DH 4LFCQ 2HT1A 3PIPA 3H3VH 2C35B 4YCVA 5C3EH 1BBWA 3CF5A 2UUBQ 2WP8J 1UE7A 3MXNB 3HOXH 2VQFQ 3TS0A 3HOYG 3HOWG 2ALYB 4QL5A 1IXRA 3DM3A 2QEXA 1CUKA 5BR8L 3DLLA 1KQSA 4DR3L 4LF8Q 3HOUH 3GTKH 1CKMA 2YTVA 1FL0A 4O0AA 3CCSA 4B3SQ 4OO1I 4MZ9A 4YHHL 3JAMi 3E0EA 1VQPA 1SR3A 4X64L 4A3GH 3TREA 1EFWA 2H5XA 4DV7Q 4DR6L 1N34Q 1UE1A 3M4QA 3MEFA 4ME3A 4A3FG 1J5EL 1I94L 1C7YA 3HOZG 1SMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M L;  1N8R C;  2KCM A;  1JMC A;  1PA6 A;  4JI4 L;  5ELO A;  4JG2 A;  2NVY H;  3I4O A;  4JC0 A;  1WCM H;  2IX1 A;  3E9H A;  5FJ8 H;  1P8L A;  1IBK Q;  2KCT A;  2KHJ A;  1TWG H;  2K14 A;  1JB7 A;  4LF7 Q;  3M7N A;  3I2Z A;  4BA1 I;  1S72 A;  1B70 B;  2RF4 A;  2IT1 A;  1SLJ A;  1EIY B;  1XNQ L;  3TS2 A;  1SRO A;  1K83 H;  3CP0 A;  5K36 G;  4IO9 A;  4HIM A;  4UP7 A;  1HNW Q;  3OYY A;  1SE8 A;  4LFB L;  4KHP L;  3PUZ A;  1NBW A;  4OXP A;  4HJA A;  3CXC A;  2HQL A;  4DPG A;  3AQQ A;  4DV4 Q;  4BY7 H;  3GD7 A;  3T1H Q;  4LF6 Q;  2UXB L;  4DV2 Q;  1NTG A;  1K8A C;  3WWV A;  3CCU A;  4PG3 A;  1FJG L;  4GKK L;  1E24 A;  1FVI A;  4JI5 Q;  2F52 A;  2K50 A;  4DR7 L;  2WFW A;  1OXV A;  2HIX A;  4RMF A;  1HNZ L;  2JEA I;  4P74 A;  1VQF A;  1Y1V H;  1TWA H;  3EN2 A;  3CCJ A;  4DV5 Q;  4A75 A;  3CPW A;  3H3V I;  4X65 L;  4P73 A;  4DV3 L;  1Q46 A;  2ASB A;  3T1Y Q;  2Q2H A;  4OWW B;  4IOA A;  1O7I A;  1VQJ A;  5AJ3 Q;  3KJP A;  1V1Q A;  4DV6 L;  1PH9 A;  1EYG A;  4AYB G;  2UXD Q;  4YY3 L;  2UXC L;  2ZM6 Q;  1N36 L;  5C4X H;  2JA8 G;  1XTD A;  3TEH B;  1D8L A;  4JOI A;  3U4V A;  4OWT B;  4APV A;  2CFM A;  4NXM L;  2CWA A;  4XIG S;  1N9W A;  2PQA B;  4DK3 C;  1V43 A;  1QZH A;  2CQO A;  4AH6 A;  4YWL A;  2BA0 A;  3BZK A;  1R9T H;  3CCL A;  2NZO A;  2NVQ H;  2VW9 A;  1KHI A;  2AWO A;  4OWX B;  3KLW A;  4X62 L;  4LFB Q;  4MNO A;  4BBR H;  4JI6 L;  3UDG A;  1HH2 P;  3EIV A;  4LFC L;  1HZB A;  2I5L X;  3J81 i;  2UUB L;  1W3S A;  1MKH A;  4BY1 G;  4PZ6 A;  2VQF L;  2JA6 H;  2LXJ A;  1EWI A;  5C0X G;  4DNI A;  4DR5 Q;  2VUM H;  4LF8 L;  4JI0 Q;  4JI2 Q;  1VQB A;  4NXN Q;  3GO5 A;  3KF8 B;  5M3M G;  1YI2 A;  1Q82 C;  2QA4 A;  4IPG A;  2CCZ A;  1XPU A;  1X9N A;  3I4N H;  4JYA Q;  1Y1W G;  5H1S E;  3AFQ A;  4GLA C;  4AQY Q;  4B3S L;  2VZA A;  3B6Y A;  1WOC A;  2Q2T A;  2N49 A;  4KI0 A;  1UE5 A;  4A3J G;  3TQY A;  1QVF A;  4DV7 L;  2ATW A;  1N34 L;  4GN5 A;  1VQ7 A;  5GRO A;  3NEL A;  4GKJ Q;  3FHW A;  1A8V A;  4IOC A;  3RZD H;  4JBK A;  4IJH A;  4OO1 G;  2NN6 I;  2ZTD A;  3PO3 H;  4A3E H;  1OXT A;  2BA1 A;  3HFZ B;  4J15 A;  1I50 H;  1NY4 A;  4KHZ A;  3PIO A;  2I5M X;  1A0I A;  1AE2 A;  3J80 i;  4AYB E;  3S2D H;  3RR5 A;  4R4Q A;  4JBW A;  3GTQ H;  5IY0 A;  4GNX B;  2KEN A;  3SGI A;  3L2P A;  4DKA C;  4QGU A;  1RIP A;  3G4S A;  4LF7 L;  5C0X I;  4LUZ A;  5HY6 A;  4UP8 A;  1B7Y B;  3H0G G;  4C3H H;  4LNQ A;  1Q86 C;  3HOW H;  1YJW A;  3AEV A;  2JJQ A;  4DR1 Q;  4RG1 A;  3HOV H;  1HNW L;  2K75 A;  5EAY A;  4IJL A;  2F3I A;  1YZ6 A;  1I5F A;  2UUA Q;  3U50 C;  3A74 A;  2UUC Q;  2R92 H;  4A3C H;  4JI7 Q;  1VCI A;  4DV4 L;  2R6G A;  2AHO B;  5M3F H;  5IYC G;  2YTY A;  3T1H L;  1M1K C;  4DV2 L;  4LF6 L;  4POG A;  1FGU A;  1U0L A;  4GNX C;  4EQ5 A;  1S40 A;  2OTL A;  3G71 A;  2YU9 H;  4JI3 Q;  4L5R C;  5J3B A;  4HJ5 A;  4JI5 L;  4A3L G;  5IP7 G;  2Q2U A;  1WI5 A;  1TXY A;  5JEA G;  1GKH A;  2JEB I;  3OTO Q;  2RHS B;  2D0P A;  1HJP A;  4A3K H;  1DGS A;  1PYB A;  4DV5 L;  4HJ9 A;  5LMU Q;  2JE6 I;  3PO2 G;  3CCE A;  3OW2 A;  4GLV B;  1L0W A;  3CMA A;  3T1Y L;  1IBL Q;  2E2I H;  1JJG A;  1BKB A;  2MFI A;  2UXD L;  5AJ3 L;  1OXX K;  4YWM A;  2MQH A;  4K0K Q;  1MJC A;  5IT9 c;  2ZM6 L;  5IP9 H;  3I4M G;  3F2C A;  4UPA A;  4IPC A;  1IYJ B;  5M5W H;  1VQ9 A;  3KFU A;  4A3D G;  5GAH C;  4IFD J;  5C3E G;  4A3I H;  3RN2 A;  2FXQ A;  1XMO L;  4DV0 Q;  3J81 j;  1Q1B A;  4UY8 C;  1GVP A;  1PVO A;  1H95 A;  1Y14 B;  3JAM c;  5C44 H;  4OX9 Q;  3HOU G;  3J7A 5;  4PZ8 A;  1YJN A;  2AMC B;  3BU2 A;  1UE6 A;  5IYD H;  3NBH B;  1OXS C;  1YEZ A;  1VQD A;  3KDF B;  4DV1 Q;  3LGJ A;  2YTX A;  1YHA A;  1KD1 C;  3W1G A;  1ASY A;  3W1B A;  1CKO A;  1U5K A;  1JJ2 A;  2R7F A;  2E2J H;  4DR4 Q;  2AWN A;  2D0O A;  3NEM A;  4LFA Q;  4LW1 A;  3PF4 A;  4DUZ Q;  3FP9 A;  2ZJQ A;  4GOP B;  4DR5 L;  4JI0 L;  4BXX H;  4JI2 L;  4NXN L;  4R4T A;  1OTC A;  1HZ9 A;  3CPF A;  5M5X H;  2K52 A;  2JQO A;  3CCM A;  5FLX c;  4HIK A;  4LF4 Q;  1YHQ A;  4LF5 Q;  4JYA L;  4AQY L;  1WCM G;  1VQE A;  3ERS X;  5FJ8 G;  2R7Z H;  1VQ8 A;  2JA7 H;  3K0X A;  3L7Z C;  2EQS A;  1L1O B;  3K7A H;  4GLX A;  1PYS B;  4JI8 Q;  1X54 A;  3HKS A;  1E22 A;  1VQG A;  5IYB H;  4L5S A;  4LWC A;  2K5V A;  2N8N A;  1PH4 A;  1KIX A;  4GKJ L;  1YJ9 A;  1X6O A;  3STB C;  5ELN A;  1XPR A;  5GAD C;  1TWF H;  3GTL H;  1IL2 A;  4DUY Q;  1UWV A;  2B63 H;  2Y0S G;  1XMO Q;  1S3O A;  1YNX A;  3FKI G;  3TRZ A;  2E8G A;  2JA5 H;  1WYD A;  4BY7 G;  1AE3 A;  2RCN A;  4NB3 A;  1QUQ B;  4UP9 A;  1N33 Q;  1L1O C;  3RZO H;  3A0J A;  2R93 H;  3S14 H;  2E5L Q;  1GD7 A;  1BBU A;  4HID A;  3E9I A;  2VNU D;  2NN6 G;  1Y1V G;  4HJ8 A;  1MIU A;  2A1A A;  1X3G A;  1K3R A;  4DR1 L;  3Q8D A;  3STB D;  3CD6 A;  2I0Q A;  1G6P A;  4GNX A;  2UUA L;  2UUC L;  2VL6 A;  1Q12 A;  3GDE A;  4JI7 L;  3M9B A;  2F4V Q;  2BH8 A;  4A3M H;  2GN5 A;  3GTM H;  4BA2 I;  1CKN B;  1HR0 W;  4WJ3 M;  2Z0S A;  3BZC A;  3S15 H;  4BBS H;  4JI3 L;  3IRB A;  4AIM A;  4LF9 Q;  5C4X G;  5HGQ A;  1SN8 A;  2EIF A;  3ZJY C;  1NMF A;  1JJC B;  4LUV A;  5FLM H;  1NJI C;  1XNR Q;  4WJ4 A;  1N32 Q;  1KXL A;  3OTO L;  1X3E A;  1KRS A;  4OON A;  5E7N A;  1UEB A;  2ZTE A;  1LM0 A;  3KYH C;  1PH5 A;  2A8V A;  5LMU L;  5M5Y H;  1NE3 A;  2ZTC A;  1XJV A;  4P71 A;  1VQC A;  2RHQ B;  2HHH Q;  3W5O A;  1IBL L;  2OCE A;  4GN4 B;  3EBE A;  1PH1 A;  1VQL A;  4X66 Q;  4YWK A;  2IHF A;  2V1C C;  3ULP A;  4K0K L;  4BBR G;  4DK6 C;  3J81 c;  3S1Q H;  4JCV E;  4QQB X;  2A19 A;  4A3B H;  4O2D A;  4EX5 A;  2UU9 Q;  4JBM A;  1VQN A;  3F8T A;  3PGZ A;  4JV5 Q;  4DV0 L;  1VQ5 A;  2PMZ E;  1X56 A;  1EIF A;  1J6Q A;  1TWH H;  2EXD A;  1K8G A;  2JA6 G;  4MTN A;  5IWA Q;  2VQE Q;  3ICE A;  2VUM G;  2VS1 A;  2Y0S E;  4OX9 L;  1X55 A;  3HOY H;  2WB1 G;  4B3T L;  4YCU A;  1YBY A;  3ULJ A;  3M3Y H;  1D7Q A;  3I4N G;  2CKZ B;  2VY3 A;  3L0O A;  4DV1 L;  2GVA A;  1XMQ Q;  1PV4 A;  2NVT H;  1KL9 A;  1YHB A;  1JT8 A;  2IY5 B;  5LMN W;  3JC6 6;  4DR2 L;  1PH7 A;  4QY7 A;  1VQ4 A;  4DR4 L;  4LFA L;  2JA9 A;  5IE8 A;  1HR0 Q;  4DUZ L;  4GN3 B;  2N78 A;  4A3F H;  3HOZ H;  4NPS A;  3J80 c;  1X3F A;  3PUW A;  5GAE C;  2WAQ E;  1Q7Y C;  4A3E G;  3ULL A;  3CCQ A;  1EUJ A;  4LF5 L;  4LF4 L;  3S1N H;  2K5N A;  4IFD I;  3G6E A;  1WFQ A;  3CCV A;  5DLQ E;  4GOP A;  1QZG A;  4GS3 A;  2IHE A;  1LYL A;  1HNX Q;  4JI8 L;  4C3I H;  4A93 G;  2HIV A;  4HIO A;  4ALP A;  5JJL A;  3J7Z C;  1C9O A;  2E2H H;  5C0X J;  2NVX H;  1QVG A;  3HOV G;  2PI2 E;  1NMG A;  2LXK A;  4R1J A;  4DUY L;  2R92 G;  4A3C G;  1IBM Q;  3UDI A;  3GTJ H;  1L1O A;  3HOX G;  1VQH A;  3RNU A;  3PUV A;  2I5H A;  5M3F G;  2YYZ A;  4LUO A;  3KF6 B;  4QJF A;  1A62 A;  1N33 L;  4PZ7 A;  4C3J H;  4B3T Q;  1VS0 A;  1IZ6 A;  1EOV A;  3HKZ E;  2K4K A;  3K80 C;  4YCW A;  1AH9 A;  1A63 A;  4JI1 Q;  2E5L L;  3S16 H;  4HJ7 A;  3A5U A;  1Q8K A;  4A3K G;  1VQ6 A;  1P16 A;  2PQA A;  4A3G G;  1GO3 E;  4POF A;  3CME A;  1TWC H;  5LMN Q;  4DR2 Q;  2DUD A;  3CQZ H;  2WB1 E;  1KRT A;  1QUQ A;  2Q2I A;  1BVS A;  3A5Z B;  3K8A A;  2F4V L;  4B3R L;  2CWP A;  3G48 A;  1YIJ A;  4L5T A;  2ES2 A;  1X65 A;  3PUX A;  5IP9 G;  1PHJ A;  3U58 A;  4LF9 L;  2MNA A;  2K5H A;  1XNR L;  1VQO A;  1PH3 A;  1L2F A;  1SRU A;  4A3I G;  2JA8 H;  4TQU S;  1EQR A;  1N32 L;  1E1T A;  3ER0 A;  5JJI A;  3UE0 A;  3S17 H;  3PSI A;  1OXU A;  2GVB A;  1CKN A;  1HZC A;  3RLF A;  3I56 A;  4C2M H;  4H02 A;  3AYH B;  1VQA A;  3I7F A;  3FKI H;  5C44 G;  4GOP C;  1MJE A;  2HHH L;  1Q81 C;  4X6A H;  4P75 A;  3S24 A;  4Y52 H;  2OQK A;  1B8A A;  5IYD G;  4X66 L;  5BR8 Q;  3CC2 A;  4DR3 Q;  2L15 A;  2ZJR A;  3M85 A;  3NEN A;  3KJO A;  1Q1E A;  4Y7N H;  4KLK A;  2JK8 A;  1CSQ A;  3BJU A;  3U4Z A;  4YHH Q;  2XTI A;  1PFS A;  5JEA J;  2UU9 L;  4IPH A;  4JV5 L;  4X64 Q;  1JE5 A;  3F2B A;  1LTL A;  4A76 A;  3UE1 A;  4DR6 Q;  1CSP A;  5IWA L;  2VQE L;  1I94 Q;  1J5E Q;  3CAM A;  1XPO A;  3F2D A;  4BY1 H;  4BXX G;  1EQQ A;  1YIT A;  4B3M Q;  4JI4 Q;  2NZH A;  3GTP H;  1XMQ L;  3K81 C;  3D0F A;  5M3M H;  3VDY A;  1LUZ A;  1E7Z A;  2R7Z G;  2JA7 G;  2D62 A;  1HZA A;  1V9P A;  2WAQ G;  1Y1W H;  3S1M H;  2MO0 A;  4B3R Q;  5IYB G;  1HR0 L;  1E1O A;  4A3J H;  2ZJP A;  1PH8 A;  4L5Q A;  1E3P A;  2Z6K A;  2BH2 A;  1RL2 A;  1KAW A;  4P72 A;  1VQM A;  1XNQ Q;  3CCR A;  2B63 G;  3PUY A;  4DAY B;  2AKW B;  4KHP Q;  3PCO B;  2JA5 G;  1SFO H;  4XTC S;  3RLO A;  5JJK A;  4QIW E;  2R93 G;  1HNX L;  2UXB Q;  2XGT A;  3CC4 A;  2LSS A;  1FJG Q;  3I55 A;  3M4O H;  2OQ0 A;  3CW2 C;  4GKK Q;  3RN5 A;  4DR7 Q;  1G51 A;  3H0G H;  3HKZ G;  4IFD G;  1HNZ Q;  1G29 1;  1I6H H;  2MO1 A;  1T9H A;  3M4P A;  4R4O A;  4DAM A;  1IBM L;  1K9M C;  1VQK A;  3GTO H;  3F1Z A;  2PI2 A;  4A3M G;  4TVA B;  3S1R H;  4R4C A;  4X65 Q;  4FDB A;  4DV3 Q;  1KC8 C;  2B3G A;  4BBS G;  3KOJ A;  4JBJ A;  1Z47 A;  1K0R A;  5IYC H;  2OWO A;  2B29 A;  4DV6 Q;  4JI1 L;  4YY3 Q;  5FLM G;  2UXC Q;  2QGQ A;  3K7U C;  4A3L H;  1N36 Q;  2YV5 A;  3CC7 A;  5IP7 H;  4R4I A;  5C4J H;  1YVC A;  5GQO A;  5LMN L;  3AFP A;  4NXM Q;  1WJJ A;  3UDF A;  1Z9F A;  2OTJ A;  3KF6 A;  2IX0 A;  2KBN A;  4IPD A;  3RLN A;  1C0A A;  3H15 A;  4JOI C;  3PF5 A;  3UDX A;  1GM5 A;  3PO2 H;  2PNH A;  2DGY A;  4A4I A;  3KDF A;  1IBK L;  1K73 C;  2N3S A;  1ASZ A;  2ID0 A;  2KHI A;  3D31 A;  3PO3 G;  4X62 Q;  4A93 H;  3GTG H;  2Z6K C;  1I3Q H;  1VQI A;  4PMW A;  1W2B A;  1PH2 A;  4A3B G;  4JI6 Q;  2R7D A;  5GAG C;  3S2H H;  1PH6 A;  1QVC A;  3PV0 A;  3I4M H;  1M90 C;  4A3D H;  4LFC Q;  2HT1 A;  3PIP A;  3H3V H;  2C35 B;  4YCV A;  5C3E H;  1BBW A;  3CF5 A;  2UUB Q;  2WP8 J;  1UE7 A;  3MXN B;  3HOX H;  2VQF Q;  3TS0 A;  3HOY G;  3HOW G;  2ALY B;  4QL5 A;  1IXR A;  3DM3 A;  2QEX A;  1CUK A;  5BR8 L;  3DLL A;  1KQS A;  4DR3 L;  4LF8 Q;  3HOU H;  3GTK H;  1CKM A;  2YTV A;  1FL0 A;  4O0A A;  3CCS A;  4B3S Q;  4OO1 I;  4MZ9 A;  4YHH L;  3JAM i;  3E0E A;  1VQP A;  1SR3 A;  4X64 L;  4A3G H;  3TRE A;  1EFW A;  2H5X A;  4DV7 Q;  4DR6 L;  1N34 Q;  1UE1 A;  3M4Q A;  3MEF A;  4ME3 A;  4A3F G;  1J5E L;  1I94 L;  1C7Y A;  3HOZ G;  1SMX A; 
#chains in the Genus database with same CATH topology
 3RMH A;  4QMG A;  2KCM A;  4B3M L;  1F9Q A;  1D1K A;  1W6J A;  3T16 A;  3GV3 A;  4BBR B;  3I4O A;  4C3I G;  4JW0 A;  1WD1 A;  2K14 A;  1JB7 A;  2FJ2 A;  4U68 A;  1EIY B;  3NK9 A;  4R8N A;  3V2T A;  3VR3 A;  3HGB A;  1PDQ A;  3MWY W;  1HNW Q;  3OYY A;  5T1G A;  1NBW A;  1PXU A;  4OXP A;  4HJA A;  2B2Y A;  4C3J G;  1DOK A;  1TT2 A;  4BY7 H;  2UXB L;  4DV2 Q;  1NTG A;  1PTO F;  3WWV A;  1FJG L;  4JK1 C;  1M8A A;  1BO0 A;  5IOD A;  1TY0 A;  4DXG A;  2K50 A;  4FF1 A;  1OXV A;  2B2V C;  3EN2 A;  1GUT A;  3CCJ A;  2OXP A;  3E6Z X;  4A75 A;  2QCP X;  2A69 D;  3J80 E;  4P73 A;  3VR5 A;  4M1U B;  4IOA A;  1O7I A;  2WII B;  2UXD Q;  2L9H A;  1D8L A;  2K6A A;  3S2H B;  4OWT B;  4NXM L;  4A3D B;  1N9W A;  5CMD A;  4DK3 C;  2CQO A;  1AW7 A;  4AH6 A;  3TP6 A;  1T5E A;  1SXT A;  2NVQ H;  1SJH D;  3GTK B;  3D8G A;  4KN4 C;  1XYI A;  2K28 A;  4I65 A;  2O2L D;  3Q24 A;  1HH2 P;  3EIV A;  2L4N A;  3J81 i;  3G6J B;  2VUM H;  4N8F A;  2IPK D;  4JI2 Q;  1VQB A;  2XWB B;  4IPG A;  1XPU A;  3I4N H;  5H1S E;  4GLA C;  1EU4 A;  1L0X B;  3B6Y A;  2Q2T A;  2RCF A;  4ZAI A;  1YNJ D;  3K5M A;  3BVZ A;  4KKT A;  4GN5 A;  1N34 L;  2QKI C;  4IJH A;  4OO1 G;  5CV8 A;  1H9K A;  4K6D A;  3K58 A;  2ZTD A;  3PO3 H;  3I91 A;  4J15 A;  1IW7 D;  2Y0S B;  3VYT A;  1A0I A;  3S2D H;  3HS0 C;  4R4Q A;  1MSH A;  3GTQ H;  4WJW A;  4BY7 B;  1Q90 A;  3SGI A;  1JE4 A;  3G4S A;  4QGU A;  1ZEQ X;  4UP8 A;  1B7Y B;  4C3H H;  2G9H D;  1YJW A;  1BBX C;  5D3D A;  1O7Y A;  3PIO 3;  1HNW L;  2K75 A;  1B1Z A;  4ZCK A;  3SK8 A;  1JOQ A;  1VCI A;  4X3T A;  2AHO B;  5M3F H;  1BCP C;  1F9P A;  4DV2 L;  2Q8I B;  4GNX C;  3NHH A;  3G71 A;  1EYA A;  5J3B A;  4HJ5 A;  2BCO A;  4ZKB B;  1GKH A;  4A3K H;  4DA2 A;  3DXJ C;  1DGS A;  2X69 A;  1I4G A;  5IT9 L;  2RDF A;  3OW2 A;  1BQQ T;  5C3W A;  3BDC A;  1JJG A;  2E2I H;  5A35 A;  2UXD L;  2NVQ B;  1OXX K;  4YWM A;  4K0K Q;  3I4M G;  1LT5 D;  4UPA A;  4IPC A;  1IYJ B;  5GAH C;  2FXQ A;  3J81 j;  3VA7 A;  4OIK A;  1PVO A;  2LY7 A;  1V8Q A;  4A3M B;  1HQR D;  1ZXT A;  1KDA A;  5C44 H;  3HOU G;  3J7A 5;  3CHB D;  3KLS X;  4PZ8 A;  3BU2 A;  1TS5 A;  4DV1 Q;  1KD1 C;  1YHA A;  4C1N K;  3I4N B;  2JSO A;  1U5K A;  1B9N A;  1JJ2 A;  3VYU A;  2PW5 A;  2D0O A;  4LMQ D;  2MUY A;  4C56 C;  5EPL A;  3URY A;  1CHP D;  4JI2 L;  1E0B A;  1OTC A;  5I6W A;  3CPF A;  3OIQ A;  1Q8I A;  2K52 A;  4HIK A;  3PO3 B;  3OMG A;  3ERS X;  4WFN 3;  2R7Z H;  3GTQ B;  4GLX A;  1LTB D;  1X54 A;  3HKS A;  4L8J A;  2K5V A;  1PH4 A;  1TS3 A;  1F9S A;  4C3H B;  2ZXR A;  1IL2 A;  1UWV A;  1S3O A;  2FIN B;  1K8O A;  1YNX A;  3ONA B;  1WYD A;  4DK0 A;  3KK7 A;  5M3F B;  4NB3 A;  1G6Z A;  5IGG A;  1BBU A;  4HID A;  1FNU A;  2NN6 G;  4A3K B;  3SK5 A;  1G6P A;  4LJZ C;  4MN3 A;  2BH8 A;  4K6L A;  3BZC A;  3DM1 A;  2E2I B;  4AIM A;  5HGQ A;  2EIF A;  2LFN A;  3ZJY C;  5E7N A;  2ZXO A;  4OON A;  1UEB A;  2ZTE A;  3BVM A;  5M5Y H;  2JP1 A;  1XJV A;  1VQC A;  1YNN C;  1PH1 A;  4X66 Q;  4YWK A;  3ULP A;  2A6H C;  4K0K L;  4KY7 A;  4BBR G;  4DK6 C;  3ERO A;  2A19 A;  4CKC A;  4O2D A;  2UU9 Q;  3LWU A;  1VQN A;  2B2T A;  1X3Q A;  3FVQ A;  3LX0 A;  4OIJ A;  2LKV A;  2VS1 A;  2WB1 G;  4YCU A;  1YBY A;  2CKZ B;  2VY3 A;  4DV1 L;  1XMQ Q;  2GVA A;  1KL9 A;  1EY8 A;  2IY5 B;  2RVL A;  1CFM A;  4IUQ A;  4DR2 L;  2R7Z B;  2DNC A;  4ABN A;  2TSS A;  1JWS D;  3PUW A;  4ZLT F;  1EQV A;  3ULL A;  3QIA A;  1JOK A;  1D5M C;  3WOF A;  2SEB D;  3G6E A;  4IFD I;  5ELF A;  3CCV A;  1LYL A;  4C3I H;  4BS9 A;  5ELE A;  1DON A;  1VF5 C;  4X3S A;  2NVX H;  5FO7 B;  2ZT9 C;  3HOV G;  2PI2 E;  5I4D A;  2EVB A;  2EYH A;  2R92 G;  1JQY D;  3GTJ H;  1VQH A;  5IIF A;  1IL8 A;  2I5H A;  3SK4 A;  4C3J H;  4EQP A;  1AH9 A;  3K80 C;  3BVG A;  1A63 A;  4JI1 Q;  3S16 H;  2F0G A;  1Z6H A;  4MTK A;  1TQO A;  1PYW D;  3J7A F;  1W6K A;  1VQ6 A;  3CME A;  1KDB A;  2DUD A;  2B2U A;  2DY7 A;  5M5Y B;  4XQQ A;  2KCC A;  4B3R L;  1BF4 A;  2CWP A;  3CU7 A;  1LO5 D;  5IGB A;  3R2I A;  3E5S A;  5IP9 G;  1LT3 D;  4DK1 A;  4J6H A;  1G8Z D;  3I90 A;  4V19 0;  1L2F A;  1TS4 A;  2FMC A;  3SE0 A;  3ER0 A;  3TZD A;  3UE0 A;  5JJI A;  5IGE A;  4FVM A;  1CKN A;  3RLF A;  3I56 A;  2K5Q A;  3I7F A;  3FKI H;  1B4O A;  1Q3L A;  3S24 A;  4X66 L;  4KV6 A;  2K04 A;  3NEN A;  4KLK A;  3U4Z A;  2UU9 L;  1PFS A;  2HCC A;  1JE5 A;  1LTL A;  2PZU A;  1CTM A;  1XPO A;  3VA5 A;  3K5N A;  1YIT A;  4XT3 B;  2NZH A;  1O80 A;  3VYR A;  1XMQ L;  4KD3 A;  1HZA A;  2DJG C;  1EY9 A;  5C3E B;  4C3I B;  2EYF A;  3UI2 A;  2Z6K A;  1B3A A;  1WVL A;  2NVX B;  4PQX A;  1VQM A;  2K01 A;  2B63 G;  2OEO A;  5ELB A;  3X3M A;  4KHP Q;  3PCO B;  4FF3 A;  1SFO H;  3GTJ B;  2P5Z X;  3JAM E;  3KBX A;  2WKC A;  2XGT A;  4C3J B;  3CC4 A;  4ZUJ A;  3I55 A;  2B2Y C;  3RN5 A;  1IYV A;  3S16 B;  4DR7 Q;  1HUN A;  1HNZ Q;  2QW7 A;  4HED A;  3GTO H;  2F03 A;  4A3M G;  4TVA B;  3S1R H;  4R4C A;  4X65 Q;  2LS0 1;  2B3G A;  2EE1 A;  1K0R A;  2SOB A;  2B29 A;  4JI1 L;  2UXC Q;  4FYD A;  2KEE A;  3K7U C;  2EXZ A;  1STH A;  2OTJ A;  1I4Q A;  4IUU A;  2K03 A;  3FKI B;  2MGS A;  1GM5 A;  3NTK A;  1IBK L;  3K6O A;  2PQE A;  2N3S A;  2AQ1 B;  2F0Q A;  4OGQ C;  5C6A A;  1ASZ A;  3D31 A;  3Q6S A;  4X62 Q;  2L55 A;  3PO3 G;  3CKI B;  1CK1 A;  1I3Q H;  1W2B A;  1PH2 A;  5D3I B;  3I4M H;  2BDN A;  3KLS A;  4LFC Q;  3PIP A;  2HT1 A;  1IKM A;  2UUB Q;  3MXN B;  2VQF Q;  2N88 A;  3TS0 A;  1TU2 B;  1SE3 A;  3DLL A;  3HOU H;  3G7L A;  4O0A A;  4MZ9 A;  5M9O A;  1STE A;  1F2Y A;  1SR3 A;  4RFB A;  4MIU A;  1EOT A;  3M4Q A;  2Z4I A;  3MEF A;  3HOZ G;  4R8I A;  3GP7 A;  5TSS A;  1GJX A;  2NWG A;  1N8R C;  1WTV A;  1PA6 A;  5KRU A;  4CJ1 B;  3A8I E;  2NVY H;  1SFO B;  2IX1 A;  3NTH A;  4G4K A;  1EYD A;  2RSO A;  1VDZ A;  4I7A A;  2R61 A;  4IN3 A;  3M7N A;  1S72 A;  1HCZ A;  1B70 B;  2RF4 A;  5ISR A;  2OF1 A;  1H9M A;  1QJO A;  3TS2 A;  1SRO A;  4OEL B;  5K36 G;  1IKL A;  4UP7 A;  4KHP L;  3PUZ A;  3GTO B;  2A68 C;  3S1R B;  4K8I A;  4DPG A;  3I72 A;  3FPP A;  1BNZ A;  3OMC A;  1K8A C;  1MSG A;  2CVR A;  3NSW A;  2WV6 D;  4CHT B;  2Z9H A;  2F52 A;  2EYJ A;  4BWG B;  4DR7 L;  2EPB A;  2NN6 H;  1AEX A;  1JWU D;  2HIX A;  1HNZ L;  2CQA A;  4P74 A;  1TWA H;  1PRT B;  3CPW A;  1DM0 B;  1F2L A;  3EQL C;  2PNR C;  2L12 A;  3MC0 B;  4X65 L;  5EGT A;  5LHY 1;  1Q46 A;  4OWW B;  3KJP A;  1EY0 A;  2UXC L;  1F9R A;  1I3Q B;  3NWS A;  2EY6 A;  3I4M B;  2K1B A;  1I6V C;  1CQF A;  1HXY D;  5C4Z A;  1R9T H;  2VB3 X;  3OWF A;  4X62 L;  3HOU B;  1AZP A;  1T5X D;  1SNO A;  1SMY C;  5D65 A;  3TBI B;  2IL8 A;  4MNO A;  2EJF C;  4BBR H;  1SE2 A;  3UDG A;  4B08 A;  4LFC L;  1HZB A;  2I5L X;  1M4V A;  3H3V C;  2UUB L;  3D4D A;  1ONL A;  2VQF L;  2LXJ A;  4DNI A;  3QO2 A;  1ENF A;  4NXN Q;  2DY8 A;  3GO5 A;  1YI2 A;  5M3M G;  2CCZ A;  4KTA A;  3AFQ A;  4AQY Q;  2NVY B;  3F2U A;  1WTH A;  3C46 A;  1UE5 A;  1G2S A;  1QVF A;  1VQ7 A;  5GRO A;  3NEL A;  2IWH A;  4GKJ Q;  1KNE A;  1V1P B;  3C1E A;  4HN7 A;  4IOC A;  4JBK A;  4FF4 A;  1A2T A;  4RCN A;  3HG9 A;  1ROD A;  2BA1 A;  1I50 H;  3PIO A;  2I5M X;  4AYB E;  2F0S A;  1BCP B;  1C48 A;  4GNX B;  3L2P A;  1S5B D;  5C0X I;  4FO2 A;  1SYB A;  2N55 A;  3AEV A;  2JJQ A;  4DR1 Q;  4CGY B;  1TWA B;  5CC4 A;  3HOV H;  5K5P A;  1YZ6 A;  2R92 H;  3U50 C;  2UUC Q;  4FXK C;  3NBI A;  1O7L A;  1FGU A;  1U0L A;  4JI3 Q;  4A3L G;  4NP5 A;  2EYL A;  3K5O A;  4R9W A;  2KOL A;  3AMU A;  1F2Z A;  5LL6 X;  1TWF B;  3PO2 G;  3P20 A;  3CCE A;  1UNS A;  1A6X A;  1ILP A;  4GLV B;  1LV9 A;  1B9M A;  1R9T B;  5G3L F;  2MFI A;  4F87 A;  2MQH A;  1MJC A;  5IT9 c;  1XXG A;  5IP9 H;  3KFU A;  1B50 A;  3QB3 A;  5C3E G;  5COR A;  3A54 A;  1Q1B A;  2F0P A;  1HA5 A;  1ZYR C;  4KJO A;  1LLR D;  3FDT A;  2Q8T A;  4OX9 Q;  1FNV A;  4IAL A;  4WOR A;  2WB1 B;  1YEZ A;  4H44 C;  3LGJ A;  1D5X C;  1QG7 A;  1CKO A;  4Q5V A;  2R7F A;  4LFA Q;  3PF4 A;  2JYO A;  2Z8L A;  3FP9 A;  4GOP B;  5JVH 3;  2C5C A;  5KGU A;  1CZG A;  1PMR A;  4K5X A;  4NXN L;  2H4O A;  3ND9 A;  4ZQ3 A;  2XIW A;  5FLX c;  4XYQ A;  4IZ8 A;  4AQY L;  1ESR A;  1WCM G;  1I50 B;  4A3B B;  3NE5 B;  4JI8 Q;  1VQG A;  3HP3 A;  4LWC A;  4GKJ L;  3KF8 A;  1D2B A;  5HGT A;  1X6O A;  2L5T A;  1XPR A;  3K57 A;  2B63 H;  3CRL C;  3HOV B;  3FKI G;  4DGZ A;  1PRT C;  2R92 B;  1U4L A;  2RCN A;  4L63 B;  2KED A;  1Y8N B;  1QUQ B;  1N33 Q;  1K8M A;  3A0J A;  2WIN B;  2EOT A;  3E9I A;  2VNU D;  1Y1V G;  4HJ8 A;  1QOH A;  4LK1 C;  2A1A A;  3A56 A;  1K3R A;  4RGO S;  4DR1 L;  3MXU A;  3STB D;  2F0M A;  2UUC L;  2VL6 A;  3M9B A;  4PMB A;  1MHW C;  1CZW A;  2GN5 A;  4A3M H;  2F4V Q;  1HR0 W;  4WJ3 M;  5IT9 E;  5DM6 3;  4JI3 L;  3T53 B;  1NUC A;  3T51 B;  4QIW B;  1KRS A;  1PTO D;  1PZK D;  2G5D A;  3DWP A;  3KYH C;  3L9A X;  5IOC A;  4BA2 I;  1CA6 A;  3A8J E;  4P71 A;  4ULL A;  2HHH Q;  3EBE A;  2IHF A;  4HMJ A;  5EPK A;  1K0S A;  2F0V A;  4E6I A;  5CGK A;  2A6E D;  1VQ5 A;  1UAP A;  3KUP A;  3OIP A;  2JA6 G;  2VQE Q;  5FO9 B;  2E2D C;  2Y0S E;  3DWA A;  4DFA A;  4XT1 B;  4OX9 L;  1GHK A;  2A5H A;  2O5I C;  1WTR A;  4G7H C;  3L0O A;  5CV6 A;  2NYZ D;  5LMN W;  1PZJ D;  4DF7 A;  1FYC A;  3TN2 A;  1PH7 A;  3A7A B;  1VQ4 A;  4LFA L;  1XX8 A;  1LT4 D;  4MHE A;  2N78 A;  3HOZ H;  3NBH A;  1Q7Y C;  4A3E G;  2F0W A;  3CCQ A;  1EUJ A;  2B63 B;  2PYK A;  3T13 A;  1Y8O B;  4DNT B;  5DLQ E;  3TZU A;  2MJ8 A;  3VYS A;  1HNX Q;  4JI8 L;  4G7O C;  3SK6 A;  4FNF A;  4HIO A;  3J7Z C;  1C9O A;  2E2H H;  5C0X J;  2F0O A;  4H7B A;  4QF4 A;  2L0C A;  2LXK A;  2QDB A;  5K36 H;  4RHS A;  3PMF A;  3BS1 A;  1IBM Q;  1GUG A;  1L1O A;  3PUV A;  4HCS A;  3LWE A;  2YYZ A;  4LUO A;  3KF6 B;  2L1B A;  1LT6 D;  4PZ7 A;  1ICF B;  1N33 L;  1VS0 A;  1IZ6 A;  1EOV A;  2K4K A;  5J1Z A;  5C4H A;  1H9J A;  1P16 A;  2PQA A;  1CHQ D;  1GO3 E;  4POF A;  4DR2 Q;  2BE5 D;  1XWE A;  1KRT A;  5JOB A;  1ENC A;  2Q2I A;  2CW0 C;  2M00 A;  3A5Z B;  5FLX L;  2F4V L;  1K28 A;  1BOS A;  3PUX A;  1PHJ A;  2K33 A;  2FHT A;  2OT2 A;  1SRU A;  4A3I G;  1EQR A;  3S17 H;  1ZKO A;  4ODG A;  5KEE A;  4H02 A;  2HDM A;  4GOP C;  2HHH L;  1Q81 C;  4H0L C;  4P75 A;  4Y52 H;  2OQK A;  1SYC A;  4DR3 Q;  1A2U A;  3KJO A;  4PNY A;  2XTI A;  5JEA J;  1SSO A;  1NR2 A;  4X64 Q;  4NW2 A;  2F0I A;  2KCN A;  2VQE L;  1J5E Q;  3F2D A;  3HOZ B;  3H91 A;  4FXD A;  4CBV A;  3NWT A;  3K81 C;  4K2K A;  2G9D A;  5M3M H;  1LUZ A;  1E7Z A;  2F0K A;  2E75 C;  4B3R Q;  1TKW B;  5IYB G;  3K59 A;  1BR9 A;  1S5C D;  1EEF D;  2NZ1 D;  3VR6 A;  2E2H B;  1RL2 A;  4P72 A;  1HTP A;  2F0U A;  3MFY A;  1I4H A;  2AKW B;  5JVG 3;  2JA5 G;  2KA7 A;  1SYE A;  4CJ2 C;  3OOC A;  5JJK A;  2R93 G;  1HNX L;  3AU7 A;  4ME5 A;  3M4O H;  2OQ0 A;  3CW2 C;  5F2D A;  3DEP A;  2SDF A;  1STG A;  1G29 1;  1I6H H;  4IQZ A;  1T9H A;  1IBM L;  3MA2 B;  1JC7 A;  4DU9 A;  2AUJ D;  1RHP A;  4DV6 Q;  5FLM G;  5KNB A;  1SEB D;  4A3L H;  1N36 Q;  3OPO A;  2YV5 A;  1QNU A;  5C4J H;  1CQV A;  2F0F A;  1K83 B;  4KY6 A;  3S17 B;  1E2Z A;  1MBY A;  3RLN A;  1C0A A;  3HEJ A;  1DD2 A;  4KK7 A;  4KMU C;  1EWH A;  2D2C C;  3PO2 H;  2DGY A;  4A4I A;  3KDF A;  1AZQ A;  2ID0 A;  3QG1 A;  2KHI A;  1PLF A;  1EY5 A;  2HCI A;  4A93 H;  2KHS A;  1RCV D;  1SNM A;  1D6E C;  4A3B G;  4JI6 Q;  5GAG C;  1PH6 A;  2JN4 A;  3PV0 A;  3Q0A A;  2CH4 W;  5CYU A;  1TVX A;  3H3V H;  4QB4 A;  4TKO B;  5C3E H;  1BBW A;  3HOX H;  3D3R A;  5CV7 A;  2ALY B;  1C8C A;  3SR1 A;  1IXR A;  2QEX A;  4DR3 L;  3SEB A;  2YTV A;  5M3M B;  1GXD C;  5BN4 A;  4B3S Q;  4OO1 I;  4KKS A;  4X64 L;  3TRE A;  1EFW A;  1HPC A;  5E3F A;  1J5E L;  1SMX A;  5ELO A;  3BYT B;  4JG2 A;  1GOZ A;  5EBD A;  3T4A C;  4JC0 A;  1DOL A;  1WCM H;  5KND A;  3IAY A;  2SNS A;  2I07 B;  3EVQ A;  1P8L A;  1IBK Q;  2KCT A;  1LTS D;  1TWG H;  2KHJ A;  5BN3 A;  4OEM B;  3Q23 A;  4LF7 Q;  3M4O B;  3I2Z A;  3R3O A;  4HAE A;  1II3 A;  1PRT F;  4HIM A;  3P75 A;  4UAI A;  1I6H B;  2A74 C;  2A69 C;  4LFB L;  2HQL A;  4DV4 Q;  3GD7 A;  2NTS A;  3CCU A;  4PG3 A;  2AUK A;  1HRJ A;  1FVI A;  4JI5 Q;  4DAY A;  2WFW A;  4RMF A;  5C4J B;  1VQF A;  1Y1V H;  4IUP A;  1FR3 A;  4DV5 Q;  5I9O A;  3PO2 B;  1BUV T;  2XVS A;  2ASB A;  3CRK C;  3T1Y Q;  1DXM A;  3EA6 A;  4ZKC B;  5AJ3 Q;  1EYG A;  4DV6 L;  3GQB A;  1PH9 A;  4A93 B;  2ZM6 Q;  3D6W A;  1N36 L;  2JA8 G;  1XTD A;  1RKN A;  3R2T A;  1LTR D;  2TMP A;  4APV A;  2CFM A;  2CWA A;  4XIG S;  2PQA B;  5ELD A;  1QZH A;  3NPP A;  3QR8 A;  2F0J A;  2BA0 A;  4YWL A;  3HOX B;  2VW9 A;  1KHI A;  1PFM A;  3DWQ A;  2B8F A;  3KLW A;  5E4W C;  1UEA B;  2M9V A;  4K2L A;  4JI6 L;  1YNJ C;  4IFD H;  1KNA A;  5NUC A;  1MKH A;  2JA6 H;  2EYM A;  1S4Z A;  5C0X G;  3MXP A;  1PRT D;  1KLG D;  3I73 A;  1QB5 D;  1IW7 C;  1ML0 D;  2A73 B;  5IGC A;  1X9N A;  1BCP F;  2M2L A;  1Y1W G;  4B3S L;  3E3X A;  2J0T D;  1WCM B;  2N49 A;  4KI0 A;  5JPM C;  4ZK9 B;  2ATW A;  1TWG B;  5EKL A;  1H9R A;  1DYQ A;  1JOO A;  3FHW A;  1U9R A;  1A8V A;  3RZD H;  2DNE A;  5FK9 C;  2NN6 I;  5L37 A;  4A3E H;  1OXT A;  1KQS A;  4KHZ A;  1LAC A;  3RR5 A;  5IY0 A;  1Y69 U;  1RIP A;  3IL8 A;  4LF7 L;  1EL0 A;  3H0G G;  4G57 A;  1SE4 A;  1TY2 A;  1Y1V B;  2KQ3 A;  4RG1 A;  1WTX A;  5EAY A;  3TSS A;  2F3I A;  1I5F A;  3A74 A;  4JI7 Q;  1E2V A;  4DV4 L;  1M1K C;  2YTY A;  4F88 A;  1S40 A;  2OTL A;  4EQ5 A;  4L5R C;  2F3W A;  4JI5 L;  2Q2U A;  1WI5 A;  1EZ8 A;  1TXY A;  5JEA G;  3GV6 A;  3OTO Q;  2RHS B;  2D0P A;  4U67 3;  1PYB A;  4DV5 L;  4HJ9 A;  4RKL A;  2JE6 I;  4FP5 D;  1IBL Q;  3T1Y L;  1HHV A;  3IKJ A;  5AJ3 L;  1HFN A;  2E76 C;  4K14 A;  1BCP D;  3P7J A;  2ZM6 L;  1SBB B;  3F2C A;  1CI3 M;  5M5W H;  4IFD J;  4A3I H;  3RN2 A;  1XMO L;  4UY8 C;  1H95 A;  2JA6 B;  1CM9 A;  5A2Q E;  2QDL A;  5EKI A;  2AMC B;  1UE6 A;  3C2P A;  3KDF B;  2YTX A;  4KKU A;  1ASY A;  2AQ3 B;  2J7Z A;  2E2J H;  2AWN A;  1JWM D;  3NEM A;  4LW1 A;  2ZJQ A;  1STY A;  4F7X A;  3RZD B;  1ILQ A;  1SNC A;  2JQO A;  4A3E B;  3W3A A;  1VQE A;  2EY2 A;  2DN8 A;  4EGV A;  5FJ8 G;  1VQ8 A;  2EQS A;  5CV9 A;  2F0D A;  2IX3 A;  1PYS B;  4EVO A;  1E22 A;  5IYB H;  1KIX A;  1O78 A;  4ILW A;  2XSC A;  3GTL H;  5GAD C;  1TWF H;  4DUY Q;  5I9P A;  2RA4 A;  3TDQ A;  2JA5 H;  1AE3 A;  3T56 B;  4K5V A;  4UP9 A;  3RZO H;  1L1O C;  2R93 H;  3S14 H;  2E5L Q;  3N6R A;  2Z1C A;  3MTS A;  4XXE A;  3Q8D A;  2DJF C;  3CD6 A;  5A2Q L;  3J7Y W;  4JI7 L;  3GTM H;  4DNR B;  1CKN B;  3MEH A;  3S15 H;  1RDP D;  4OL7 A;  5C4X G;  5FLM H;  4LUV A;  1NJI C;  1XNR Q;  4WJ4 A;  4S3S A;  1N32 Q;  2MHV A;  5M5W B;  3OTO L;  1KXL A;  4A3I B;  1PH5 A;  1LM0 A;  2ENB A;  5FO8 B;  2ZTC A;  3W5O A;  2XRS D;  1IBL L;  1NNX A;  4P2C B;  2PMZ B;  3S1Q H;  4QQB X;  1RTN A;  1PFB A;  1HUM A;  4A3B H;  4EX5 A;  1D1I A;  3F8T A;  4JV5 Q;  2E2J B;  2PMZ E;  1K8G A;  3SXH A;  1J6Q A;  2EXD A;  3C3L A;  4MTN A;  2NUC A;  2F0E A;  2VXW A;  3S9W A;  4B3T L;  4NMZ A;  3ULJ A;  1YNN D;  1PV4 A;  2EYP A;  5DAU A;  1YHB A;  2AQ2 B;  2A6H D;  1JT8 A;  1JR0 D;  2B39 A;  2X6L A;  1HR0 Q;  4GN3 B;  2L11 A;  1AP0 A;  3R8B A;  4NPS A;  3J80 c;  5GAE C;  5IGF A;  2F0H A;  3GTL B;  1DOM A;  3X3N A;  4NDX A;  1GUO A;  2RDG A;  2JA5 B;  4A93 G;  1I4X A;  3RZO B;  2HIV A;  4ALP A;  4HCE A;  3S14 B;  2R93 B;  1STB A;  4TRD A;  3RD4 A;  1STN A;  1SND A;  1QVG A;  5JPN C;  5CBE E;  1GHJ A;  4DUY L;  4A3C G;  3HOX G;  3RNU A;  2ICE C;  1EY7 A;  3GTM B;  4IUT A;  2B2T C;  4QJF A;  1R4P B;  1UUP A;  2CH4 A;  4ZUI A;  3S15 B;  2E5L L;  1PFN A;  2F0T A;  1Q8K A;  4RH6 A;  5LMN Q;  2HUG A;  1TWC H;  3OSO A;  3PQI A;  1A15 A;  2WB1 E;  1I4R A;  3KLR A;  1BVS A;  1QIL A;  3K8A A;  5CV5 A;  3MAQ A;  2B2W A;  1YIJ A;  2FFK B;  2ES2 A;  1X65 A;  3S1Q B;  3DEO A;  4XQJ A;  2K5H A;  1XNR L;  4KHV A;  2JA8 H;  1N32 L;  1B3Q A;  1E1T A;  3VR4 A;  3PSI A;  1GUN A;  1HZC A;  5C3X A;  4X6A H;  4Z9C B;  2IW3 A;  4F8M A;  1B8A A;  5IYD G;  5BR8 Q;  4DN4 M;  3MXG A;  5KYL A;  3M85 A;  1Q1E A;  3D4W A;  4NKL A;  4WRD A;  1QCB D;  4YHH Q;  5G3L D;  4TSS A;  4IPH A;  4JV5 L;  4IUV A;  3K0Y A;  3F2B A;  4A76 A;  5DEH A;  3UE1 A;  4DR6 Q;  1WD0 A;  1CSP A;  1NSN S;  1BXT A;  5JAV A;  4BXX G;  4GZY C;  4EQN A;  1EQQ A;  5C0X H;  4RGT A;  4JI4 Q;  1H9S A;  3D0F A;  4C1N I;  3R93 A;  5KYI A;  2JA7 G;  2D62 A;  2WAQ G;  1Y1W H;  4HMI A;  2J4X A;  3FEW X;  2B2U C;  4ZRZ A;  1HR0 L;  1E1O A;  1X3P A;  4L5Q A;  2BH2 A;  1XNQ Q;  3CCR A;  3MFG A;  2O5J C;  1PZI D;  2D5D A;  4UDU C;  4QIW E;  2LSS A;  4GKK Q;  2MP1 A;  1ET6 A;  3D4R A;  3H0G H;  3HKZ G;  4IFD G;  3WOE A;  1TII D;  2MO1 A;  1TWC B;  4K5W A;  1K9M C;  1VQK A;  1E2W A;  1U4M A;  2PI2 A;  4DV3 Q;  1SNQ A;  4HR7 B;  1KC8 C;  1VMP A;  4BBS G;  3KOJ A;  4JBJ A;  1Z47 A;  2OWO A;  5FLX E;  3N52 A;  4I7Z C;  3V96 A;  4YY3 Q;  1LTA D;  2QGQ A;  1Z7T A;  1XTC D;  4R4I A;  3I4L A;  5GQO A;  5LMN L;  2JA8 B;  5JEA H;  3J80 L;  4CDF C;  3A55 A;  1Z9F A;  2KBN A;  3PF5 A;  3UDX A;  3RUZ A;  5COY A;  1SAP A;  3GTG H;  5I2X A;  1PTO H;  2Z6K C;  1VQI A;  2R7D A;  3M7G A;  4KJN A;  4N9P A;  1EEI D;  4Q0F A;  2C35 B;  4ID6 A;  3CF5 A;  4FF2 A;  2WP8 J;  1UE7 A;  4ZYS A;  3HOY G;  2EYO A;  4QL5 A;  4LF8 Q;  1CUK A;  5BR8 L;  4EQO A;  1FL0 A;  1MGS A;  3SHL A;  3CCS A;  4YHH L;  4YIJ A;  1ESF A;  1Y1W B;  1SYG A;  4A3G H;  3D6C A;  4RGM A;  4DV7 Q;  3KBG A;  4DR6 L;  4A3F G;  5EPJ A;  2PZW A;  1VQ9 A;  4JI4 L;  1JMC A;  3ERQ A;  1B44 D;  2PZT A;  3IFD A;  2EZV A;  3E9H A;  5FJ8 H;  5KIX A;  5C5L A;  4BA1 I;  1C4Q A;  1KAA A;  5T1I A;  2IT1 A;  2VUM B;  1SLJ A;  1XNQ L;  5E1F A;  1K83 H;  3CP0 A;  3H0G B;  4IO9 A;  3TP8 A;  5JJZ A;  1LAB A;  4KD4 A;  2EY1 A;  1SE8 A;  1VMC A;  5DNF A;  1NAP A;  4RWS C;  2BOS A;  3CXC A;  3I8Z A;  3AQQ A;  4HTH A;  1A3U A;  3T1H Q;  4LF6 Q;  4CDC C;  4GKK L;  3WDN A;  1E24 A;  1IYU A;  3NXW A;  1EIH A;  2JEA I;  2QEJ C;  5IGD A;  3H3V I;  1WTQ A;  3EJI A;  1L0Y B;  2F4I A;  4DV3 L;  3S2D B;  2A68 D;  2Q2H A;  1VQJ A;  1V1Q A;  3MHB A;  5FOB B;  4AYB G;  4YY3 L;  3H94 A;  3GTG B;  1PTO B;  5C4X H;  1JIC A;  3NP8 A;  1SNP A;  3TEH B;  4JOI A;  3U4V A;  2WAC A;  2K5W A;  1V43 A;  1LTI D;  3BZK A;  3CCL A;  2NZO A;  2AWO A;  2NB0 A;  4OWX B;  4LFB Q;  3QWN A;  2XN9 C;  2Z6B A;  4A3G B;  1KAB A;  1W3S A;  4BY1 G;  4PZ6 A;  1U4P A;  1EWI A;  1LTT D;  4DR5 Q;  4LF8 L;  4JI0 Q;  2PO4 A;  3QJY A;  1B2T A;  3KF8 B;  4M8A A;  1Q82 C;  2QA4 A;  3H09 A;  4JYA Q;  4PMC A;  1SMY D;  2VZA A;  2K32 A;  4QUF A;  1FD7 D;  1WOC A;  1EU3 A;  3MXN A;  4RHR A;  4A3J G;  3FPU B;  3TQY A;  4DV7 L;  2VB2 X;  4JPB W;  1S5D D;  5AFW A;  2RBM A;  4HSP A;  5C44 B;  3HRZ C;  2ICI A;  5DM7 3;  3HFZ B;  1NY4 A;  1DJR D;  1H9S B;  1AE2 A;  3J80 i;  4JBW A;  3J7A V;  2KEN A;  3BZD B;  4DKA C;  1F77 A;  4LUZ A;  5HY6 A;  4LNQ A;  4X3K A;  1Q86 C;  3HOW H;  1HA6 A;  4CJ0 B;  4IJL A;  2UUA Q;  3HZX A;  4A3C H;  4RGN A;  2R6G A;  1KLU D;  5IYC G;  3T1H L;  4LF6 L;  4POG A;  1LTG D;  2B2V A;  1KDC A;  2YU9 H;  5IP7 G;  1WTP A;  5C4X B;  5J39 A;  3NQT A;  2JEB I;  1HJP A;  4B9X A;  5LMU Q;  5J22 A;  1EWC A;  4O1N A;  1L0W A;  3CMA A;  2H1E A;  1AFP A;  1BKB A;  3BDL A;  4O42 A;  1JB3 A;  2RQX A;  1QNK A;  3OHX C;  1SDF A;  4A3D G;  1NR4 A;  4DV0 Q;  3W2D A;  1TS2 A;  1GVP A;  1Y14 B;  1QWY A;  3DMU A;  4N8X 1;  3JAM c;  1STA A;  1RF2 D;  1YJN A;  1G2T A;  5IYD H;  3NBH B;  1OXS C;  1VQD A;  2RSN A;  3FRP B;  3W1G A;  3W1B A;  2KUM A;  4DR4 Q;  1GUS A;  2EJG C;  4DUZ Q;  2BDO A;  4DR5 L;  4JI0 L;  4BXX H;  1S5E D;  2XNA C;  1ZYR D;  3ITP A;  1EY6 A;  4R4T A;  1WTO A;  1HZ9 A;  5M5X H;  3CCM A;  4LF4 Q;  4LF5 Q;  4JYA L;  1YHQ A;  1K3B C;  5CR3 A;  4IUN A;  2PPB C;  3U9S A;  2JA7 H;  3K0X A;  3L7Z C;  3K7A H;  1L1O B;  1GUW A;  2K5D A;  4L5S A;  4CDE C;  2N8N A;  3SVM A;  1YJ9 A;  3STB C;  5CBA E;  5ELN A;  3HOW B;  1J9O A;  4CDD C;  3ZYY X;  2Y0S G;  4DAP A;  1XMO Q;  3TRZ A;  2E8G A;  4LAA A;  3E0J A;  3EFX D;  4BY7 G;  2WKD A;  3IFT A;  1V1P A;  1MD2 D;  1JOR A;  2HQE A;  1EQT A;  3OW7 A;  2YU9 B;  2MPM A;  1GD7 A;  1PTO C;  5E4X A;  1MIU A;  2B8G A;  1X3G A;  2LMC B;  1EFI D;  2I46 A;  2I0Q A;  2KJX A;  4GNX A;  2UUA L;  2O4X A;  1Q12 A;  3NTI A;  3GDE A;  3V05 A;  5EKK A;  2Z0S A;  4KY5 A;  4BBS H;  4N9T A;  1EYC A;  4L6T B;  3IRB A;  3SDZ A;  5I6Y A;  4LF9 Q;  1SN8 A;  2A6E C;  2B2W C;  3ND8 A;  1NMF A;  1JJC B;  2JXM B;  1X3E A;  3L3O C;  4OO1 H;  2A8V A;  5LMU L;  1NE3 A;  4G7Z C;  3C1F A;  2RHQ B;  5I2Y A;  3A7L A;  2OCE A;  4GN4 B;  1VQL A;  1SYF A;  2XRQ D;  3H6M A;  2V1C C;  2PCF B;  3J81 c;  4JCV E;  4JBM A;  3PGZ A;  1RJT A;  3OWE B;  4DV0 L;  1X56 A;  1EIF A;  1TWH H;  1J8I A;  2Q8R E;  1A3T A;  4OHJ A;  5IWA Q;  3ICE A;  2VUM G;  3NQI A;  1X55 A;  2QF7 A;  3HOY H;  1D7Q A;  3M3Y H;  2RKS A;  1X32 A;  2C9O A;  3I4N G;  2NVT H;  5M5X B;  1JCK B;  2GA4 B;  1R4Q B;  3JC6 6;  4QY7 A;  1HTL D;  2JA7 B;  2WAQ B;  4DR4 L;  3K7A B;  2JA9 A;  2EY5 A;  5HUR A;  5IE8 A;  4DUZ L;  1I4P A;  4QCL A;  1EY4 A;  4A3F H;  1DZ1 A;  1X3F A;  2WAQ E;  3BYY B;  4J1M A;  1Y8P B;  4LF5 L;  4LF4 L;  3S1N H;  2K5N A;  3NUC A;  4PV1 C;  3TP5 A;  1WFQ A;  3BDO A;  4GOP A;  1QZG A;  4GS3 A;  1OO9 B;  2IHE A;  1ENA A;  1G91 A;  5JJL A;  4C3H G;  1CA5 A;  2F3V A;  2BE5 C;  4RKB A;  4V0B A;  3JAM L;  1NMG A;  4R1J A;  3HKZ B;  3UDI A;  5M3F G;  4UHV A;  2D9U A;  1A62 A;  2ZXP A;  1V1O A;  4CKE A;  2KVM A;  3HKZ E;  4B3T Q;  4YCW A;  4BBS B;  1HFG A;  4RAU C;  4IUR A;  4RA8 A;  3A5U A;  4HJ7 A;  4QUC A;  4A3K G;  4A3G G;  3O13 A;  1FGB D;  1F2M A;  5D14 A;  4DXF A;  4XYO A;  3CQZ H;  4B9W A;  1QUQ A;  4K8J A;  1RTO A;  4X3U A;  3K5L A;  3G48 A;  4L5T A;  4J8Q A;  3J81 E;  3U58 A;  4LF9 L;  2MNA A;  1VQO A;  3DUZ A;  1PH3 A;  4TQU S;  4XQN A;  1OXU A;  2GVB A;  1HQM C;  1TWH B;  3VR2 A;  4C2M H;  1MJE A;  3AYH B;  1VQA A;  2E74 C;  5C44 G;  2CW0 D;  3I3C A;  3HOY B;  2K7V A;  3CC2 A;  2L15 A;  3M3Y B;  1BDO A;  2ZJR A;  2NVT B;  4RCO A;  1DCZ A;  4Y7N H;  2JK8 A;  1QE6 A;  1B53 A;  1CSQ A;  3BJU A;  3I70 A;  2CHB D;  3P1H A;  5IWA L;  1I94 Q;  3CAM A;  1VF7 A;  2NTT A;  4BY1 H;  4A3F B;  3QOJ A;  1KTK A;  2HD3 A;  4H13 C;  4B3M Q;  3GTP H;  2K05 A;  1AN8 A;  2IJ0 A;  1ICW A;  3VDY A;  3S1N B;  2R7Z G;  2V4D A;  1V9P A;  3S1M H;  2MO0 A;  2F0L A;  2KEC A;  4A3J H;  2ZJP A;  2NBF A;  1PH8 A;  2X6G A;  1E3P A;  4JVZ A;  1KAW A;  1IHZ A;  1SYD A;  3PUY A;  4DAY B;  4HSV A;  5CV4 A;  1MI2 A;  3J81 L;  3DHQ A;  1SJE D;  4XTC S;  3RLO A;  5EJW A;  2XWJ B;  2UXB Q;  1TR5 A;  1FJG Q;  1FNW A;  1G51 A;  5C5M A;  3M4P A;  4R4O A;  4DAM A;  1RD9 D;  3CQZ B;  3F1Z A;  5ELC A;  2HDL A;  4FDB A;  1EIG A;  1NCV A;  5IYC H;  2PW7 A;  3LNN A;  4AYB B;  3CC7 A;  5IP7 H;  1YVC A;  3AFP A;  5KNC A;  1WJJ A;  3UDF A;  4NXM Q;  4DAV A;  3A8K E;  3KF6 A;  2IX0 A;  2RDH A;  4IPD A;  1O7Z A;  3H15 A;  4JOI C;  4C2M B;  2PNH A;  5EBC A;  2SNM A;  5EQ0 A;  3QOL A;  2EJM A;  1K73 C;  1D5Z C;  1S5F D;  5BN5 A;  3FMC A;  4PMW A;  1EZ6 A;  4Y7N B;  3S2H H;  1A3V A;  1QVC A;  2Z4H A;  1M90 C;  4FXG C;  4A3D H;  3U9O A;  4YCV A;  2R3Z A;  2QIL A;  3M4Y A;  2F1M A;  4XDX A;  5LL6 S;  4KN7 C;  3HOW G;  1CT1 D;  4BY1 B;  3DM3 A;  3GTK H;  1CKM A;  3GTP B;  3TP7 A;  4CKB A;  3MZ5 A;  2F0N A;  3JAM i;  3PIP 3;  2EDG A;  3S1M B;  3E0E A;  1VQP A;  3AB9 A;  1U4R A;  3BG3 A;  2H5X A;  2FMM A;  3MVV A;  5FKA C;  3Q22 A;  1UE1 A;  1ET9 A;  4ME3 A;  4A3J B;  1WTW A;  1N34 Q;  1I94 L;  1C7Y A;  3TME A; 
#chains in the Genus database with same CATH homology
 4B3M L;  1N8R C;  2KCM A;  1JMC A;  1PA6 A;  4JI4 L;  5ELO A;  4JG2 A;  2NVY H;  3I4O A;  4JC0 A;  1WCM H;  2IX1 A;  3E9H A;  5FJ8 H;  1P8L A;  1IBK Q;  2KCT A;  2KHJ A;  1TWG H;  2K14 A;  1JB7 A;  4LF7 Q;  3M7N A;  3I2Z A;  4BA1 I;  1S72 A;  1B70 B;  2RF4 A;  2IT1 A;  1SLJ A;  1EIY B;  1XNQ L;  3TS2 A;  1SRO A;  1K83 H;  3CP0 A;  5K36 G;  4IO9 A;  4HIM A;  4UP7 A;  1HNW Q;  3OYY A;  1SE8 A;  4LFB L;  4KHP L;  3PUZ A;  1NBW A;  4OXP A;  4HJA A;  3CXC A;  2HQL A;  4DPG A;  3AQQ A;  4DV4 Q;  4BY7 H;  3GD7 A;  3T1H Q;  4LF6 Q;  2UXB L;  4DV2 Q;  1NTG A;  1K8A C;  3WWV A;  3CCU A;  4PG3 A;  1FJG L;  4GKK L;  1E24 A;  1FVI A;  4JI5 Q;  2F52 A;  2K50 A;  4DR7 L;  2WFW A;  1OXV A;  2HIX A;  4RMF A;  1HNZ L;  2JEA I;  4P74 A;  1VQF A;  1Y1V H;  1TWA H;  3EN2 A;  3CCJ A;  4DV5 Q;  4A75 A;  3CPW A;  3H3V I;  4X65 L;  4P73 A;  4DV3 L;  1Q46 A;  2ASB A;  3T1Y Q;  2Q2H A;  4OWW B;  4IOA A;  1O7I A;  1VQJ A;  5AJ3 Q;  3KJP A;  1V1Q A;  4DV6 L;  1PH9 A;  1EYG A;  4AYB G;  2UXD Q;  4YY3 L;  2UXC L;  2ZM6 Q;  1N36 L;  5C4X H;  2JA8 G;  1XTD A;  3TEH B;  1D8L A;  4JOI A;  3U4V A;  4OWT B;  4APV A;  2CFM A;  4NXM L;  2CWA A;  4XIG S;  1N9W A;  2PQA B;  4DK3 C;  1V43 A;  1QZH A;  2CQO A;  4AH6 A;  4YWL A;  2BA0 A;  3BZK A;  1R9T H;  3CCL A;  2NZO A;  2NVQ H;  2VW9 A;  1KHI A;  2AWO A;  4OWX B;  3KLW A;  4X62 L;  4LFB Q;  4MNO A;  4BBR H;  4JI6 L;  3UDG A;  1HH2 P;  3EIV A;  4LFC L;  1HZB A;  2I5L X;  3J81 i;  2UUB L;  1W3S A;  1MKH A;  4BY1 G;  4PZ6 A;  2VQF L;  2JA6 H;  2LXJ A;  1EWI A;  5C0X G;  4DNI A;  4DR5 Q;  2VUM H;  4LF8 L;  4JI0 Q;  4JI2 Q;  1VQB A;  4NXN Q;  3GO5 A;  3KF8 B;  5M3M G;  1YI2 A;  1Q82 C;  2QA4 A;  4IPG A;  2CCZ A;  1XPU A;  1X9N A;  3I4N H;  4JYA Q;  1Y1W G;  5H1S E;  3AFQ A;  4GLA C;  4AQY Q;  4B3S L;  2VZA A;  3B6Y A;  1WOC A;  2Q2T A;  2N49 A;  4KI0 A;  1UE5 A;  4A3J G;  3TQY A;  1QVF A;  4DV7 L;  2ATW A;  1N34 L;  4GN5 A;  1VQ7 A;  5GRO A;  3NEL A;  4GKJ Q;  3FHW A;  1A8V A;  4IOC A;  3RZD H;  4JBK A;  4IJH A;  4OO1 G;  2NN6 I;  2ZTD A;  3PO3 H;  4A3E H;  1OXT A;  2BA1 A;  3HFZ B;  4J15 A;  1I50 H;  1NY4 A;  4KHZ A;  3PIO A;  2I5M X;  1A0I A;  1AE2 A;  3J80 i;  4AYB E;  3S2D H;  3RR5 A;  4R4Q A;  4JBW A;  3GTQ H;  5IY0 A;  4GNX B;  2KEN A;  3SGI A;  3L2P A;  4DKA C;  4QGU A;  1RIP A;  3G4S A;  4LF7 L;  5C0X I;  4LUZ A;  5HY6 A;  4UP8 A;  1B7Y B;  3H0G G;  4C3H H;  4LNQ A;  1Q86 C;  3HOW H;  1YJW A;  3AEV A;  2JJQ A;  4DR1 Q;  4RG1 A;  3HOV H;  1HNW L;  2K75 A;  5EAY A;  4IJL A;  2F3I A;  1YZ6 A;  1I5F A;  2UUA Q;  3U50 C;  3A74 A;  2UUC Q;  2R92 H;  4A3C H;  4JI7 Q;  1VCI A;  4DV4 L;  2R6G A;  2AHO B;  5M3F H;  5IYC G;  2YTY A;  3T1H L;  1M1K C;  4DV2 L;  4LF6 L;  4POG A;  1FGU A;  1U0L A;  4GNX C;  4EQ5 A;  1S40 A;  2OTL A;  3G71 A;  2YU9 H;  4JI3 Q;  4L5R C;  5J3B A;  4HJ5 A;  4JI5 L;  4A3L G;  5IP7 G;  2Q2U A;  1WI5 A;  1TXY A;  5JEA G;  1GKH A;  2JEB I;  3OTO Q;  2RHS B;  2D0P A;  1HJP A;  4A3K H;  1DGS A;  1PYB A;  4DV5 L;  4HJ9 A;  5LMU Q;  2JE6 I;  3PO2 G;  3CCE A;  3OW2 A;  4GLV B;  1L0W A;  3CMA A;  3T1Y L;  1IBL Q;  2E2I H;  1JJG A;  1BKB A;  2MFI A;  2UXD L;  5AJ3 L;  1OXX K;  4YWM A;  2MQH A;  4K0K Q;  1MJC A;  5IT9 c;  2ZM6 L;  5IP9 H;  3I4M G;  3F2C A;  4UPA A;  4IPC A;  1IYJ B;  5M5W H;  1VQ9 A;  3KFU A;  4A3D G;  5GAH C;  4IFD J;  5C3E G;  4A3I H;  3RN2 A;  2FXQ A;  1XMO L;  4DV0 Q;  3J81 j;  1Q1B A;  4UY8 C;  1GVP A;  1PVO A;  1H95 A;  1Y14 B;  3JAM c;  5C44 H;  4OX9 Q;  3HOU G;  3J7A 5;  4PZ8 A;  1YJN A;  2AMC B;  3BU2 A;  1UE6 A;  5IYD H;  3NBH B;  1OXS C;  1YEZ A;  1VQD A;  3KDF B;  4DV1 Q;  3LGJ A;  2YTX A;  1YHA A;  1KD1 C;  3W1G A;  1ASY A;  3W1B A;  1CKO A;  1U5K A;  1JJ2 A;  2R7F A;  2E2J H;  4DR4 Q;  2AWN A;  2D0O A;  3NEM A;  4LFA Q;  4LW1 A;  3PF4 A;  4DUZ Q;  3FP9 A;  2ZJQ A;  4GOP B;  4DR5 L;  4JI0 L;  4BXX H;  4JI2 L;  4NXN L;  4R4T A;  1OTC A;  1HZ9 A;  3CPF A;  5M5X H;  2K52 A;  2JQO A;  3CCM A;  5FLX c;  4HIK A;  4LF4 Q;  1YHQ A;  4LF5 Q;  4JYA L;  4AQY L;  1WCM G;  1VQE A;  3ERS X;  5FJ8 G;  2R7Z H;  1VQ8 A;  2JA7 H;  3K0X A;  3L7Z C;  2EQS A;  1L1O B;  3K7A H;  4GLX A;  1PYS B;  4JI8 Q;  1X54 A;  3HKS A;  1E22 A;  1VQG A;  5IYB H;  4L5S A;  4LWC A;  2K5V A;  2N8N A;  1PH4 A;  1KIX A;  4GKJ L;  1YJ9 A;  1X6O A;  3STB C;  5ELN A;  1XPR A;  5GAD C;  1TWF H;  3GTL H;  1IL2 A;  4DUY Q;  1UWV A;  2B63 H;  2Y0S G;  1XMO Q;  1S3O A;  1YNX A;  3FKI G;  3TRZ A;  2E8G A;  2JA5 H;  1WYD A;  4BY7 G;  1AE3 A;  2RCN A;  4NB3 A;  1QUQ B;  4UP9 A;  1N33 Q;  1L1O C;  3RZO H;  3A0J A;  2R93 H;  3S14 H;  2E5L Q;  1GD7 A;  1BBU A;  4HID A;  3E9I A;  2VNU D;  2NN6 G;  1Y1V G;  4HJ8 A;  1MIU A;  2A1A A;  1X3G A;  1K3R A;  4DR1 L;  3Q8D A;  3STB D;  3CD6 A;  2I0Q A;  1G6P A;  4GNX A;  2UUA L;  2UUC L;  2VL6 A;  1Q12 A;  3GDE A;  4JI7 L;  3M9B A;  2F4V Q;  2BH8 A;  4A3M H;  2GN5 A;  3GTM H;  4BA2 I;  1CKN B;  1HR0 W;  4WJ3 M;  2Z0S A;  3BZC A;  3S15 H;  4BBS H;  4JI3 L;  3IRB A;  4AIM A;  4LF9 Q;  5C4X G;  5HGQ A;  1SN8 A;  2EIF A;  3ZJY C;  1NMF A;  1JJC B;  4LUV A;  5FLM H;  1NJI C;  1XNR Q;  4WJ4 A;  1N32 Q;  1KXL A;  3OTO L;  1X3E A;  1KRS A;  4OON A;  5E7N A;  1UEB A;  2ZTE A;  1LM0 A;  3KYH C;  1PH5 A;  2A8V A;  5LMU L;  5M5Y H;  1NE3 A;  2ZTC A;  1XJV A;  4P71 A;  1VQC A;  2RHQ B;  2HHH Q;  3W5O A;  1IBL L;  2OCE A;  4GN4 B;  3EBE A;  1PH1 A;  1VQL A;  4X66 Q;  4YWK A;  2IHF A;  2V1C C;  3ULP A;  4K0K L;  4BBR G;  4DK6 C;  3J81 c;  3S1Q H;  4JCV E;  4QQB X;  2A19 A;  4A3B H;  4O2D A;  4EX5 A;  2UU9 Q;  4JBM A;  1VQN A;  3F8T A;  3PGZ A;  4JV5 Q;  4DV0 L;  1VQ5 A;  2PMZ E;  1X56 A;  1EIF A;  1J6Q A;  1TWH H;  2EXD A;  1K8G A;  2JA6 G;  4MTN A;  5IWA Q;  2VQE Q;  3ICE A;  2VUM G;  2VS1 A;  2Y0S E;  4OX9 L;  1X55 A;  3HOY H;  2WB1 G;  4B3T L;  4YCU A;  1YBY A;  3ULJ A;  3M3Y H;  1D7Q A;  3I4N G;  2CKZ B;  2VY3 A;  3L0O A;  4DV1 L;  2GVA A;  1XMQ Q;  1PV4 A;  2NVT H;  1KL9 A;  1YHB A;  1JT8 A;  2IY5 B;  5LMN W;  3JC6 6;  4DR2 L;  1PH7 A;  4QY7 A;  1VQ4 A;  4DR4 L;  4LFA L;  2JA9 A;  5IE8 A;  1HR0 Q;  4DUZ L;  4GN3 B;  2N78 A;  4A3F H;  3HOZ H;  4NPS A;  3J80 c;  1X3F A;  3PUW A;  5GAE C;  2WAQ E;  1Q7Y C;  4A3E G;  3ULL A;  3CCQ A;  1EUJ A;  4LF5 L;  4LF4 L;  3S1N H;  2K5N A;  4IFD I;  3G6E A;  1WFQ A;  3CCV A;  5DLQ E;  4GOP A;  1QZG A;  4GS3 A;  2IHE A;  1LYL A;  1HNX Q;  4JI8 L;  4C3I H;  4A93 G;  2HIV A;  4HIO A;  4ALP A;  5JJL A;  3J7Z C;  1C9O A;  2E2H H;  5C0X J;  2NVX H;  1QVG A;  3HOV G;  2PI2 E;  1NMG A;  2LXK A;  4R1J A;  4DUY L;  2R92 G;  4A3C G;  1IBM Q;  3UDI A;  3GTJ H;  1L1O A;  3HOX G;  1VQH A;  3RNU A;  3PUV A;  2I5H A;  5M3F G;  2YYZ A;  4LUO A;  3KF6 B;  4QJF A;  1A62 A;  1N33 L;  4PZ7 A;  4C3J H;  4B3T Q;  1VS0 A;  1IZ6 A;  1EOV A;  3HKZ E;  2K4K A;  3K80 C;  4YCW A;  1AH9 A;  1A63 A;  4JI1 Q;  2E5L L;  3S16 H;  4HJ7 A;  3A5U A;  1Q8K A;  4A3K G;  1VQ6 A;  1P16 A;  2PQA A;  4A3G G;  1GO3 E;  4POF A;  3CME A;  1TWC H;  5LMN Q;  4DR2 Q;  2DUD A;  3CQZ H;  2WB1 E;  1KRT A;  1QUQ A;  2Q2I A;  1BVS A;  3A5Z B;  3K8A A;  2F4V L;  4B3R L;  2CWP A;  3G48 A;  1YIJ A;  4L5T A;  2ES2 A;  1X65 A;  3PUX A;  5IP9 G;  1PHJ A;  3U58 A;  4LF9 L;  2MNA A;  2K5H A;  1XNR L;  1VQO A;  1PH3 A;  1L2F A;  1SRU A;  4A3I G;  2JA8 H;  4TQU S;  1EQR A;  1N32 L;  1E1T A;  3ER0 A;  5JJI A;  3UE0 A;  3S17 H;  3PSI A;  1OXU A;  2GVB A;  1CKN A;  1HZC A;  3RLF A;  3I56 A;  4C2M H;  4H02 A;  3AYH B;  1VQA A;  3I7F A;  3FKI H;  5C44 G;  4GOP C;  1MJE A;  2HHH L;  1Q81 C;  4X6A H;  4P75 A;  3S24 A;  4Y52 H;  2OQK A;  1B8A A;  5IYD G;  4X66 L;  5BR8 Q;  3CC2 A;  4DR3 Q;  2L15 A;  2ZJR A;  3M85 A;  3NEN A;  3KJO A;  1Q1E A;  4Y7N H;  4KLK A;  2JK8 A;  1CSQ A;  3BJU A;  3U4Z A;  4YHH Q;  2XTI A;  1PFS A;  5JEA J;  2UU9 L;  4IPH A;  4JV5 L;  4X64 Q;  1JE5 A;  3F2B A;  1LTL A;  4A76 A;  3UE1 A;  4DR6 Q;  1CSP A;  5IWA L;  2VQE L;  1I94 Q;  1J5E Q;  3CAM A;  1XPO A;  3F2D A;  4BY1 H;  4BXX G;  1EQQ A;  1YIT A;  4B3M Q;  4JI4 Q;  2NZH A;  3GTP H;  1XMQ L;  3K81 C;  3D0F A;  5M3M H;  3VDY A;  1LUZ A;  1E7Z A;  2R7Z G;  2JA7 G;  2D62 A;  1HZA A;  1V9P A;  2WAQ G;  1Y1W H;  3S1M H;  2MO0 A;  4B3R Q;  5IYB G;  1HR0 L;  1E1O A;  4A3J H;  2ZJP A;  1PH8 A;  4L5Q A;  1E3P A;  2Z6K A;  2BH2 A;  1RL2 A;  1KAW A;  4P72 A;  1VQM A;  1XNQ Q;  3CCR A;  2B63 G;  3PUY A;  4DAY B;  2AKW B;  4KHP Q;  3PCO B;  2JA5 G;  1SFO H;  4XTC S;  3RLO A;  5JJK A;  4QIW E;  2R93 G;  1HNX L;  2UXB Q;  2XGT A;  3CC4 A;  2LSS A;  1FJG Q;  3I55 A;  3M4O H;  2OQ0 A;  3CW2 C;  4GKK Q;  3RN5 A;  4DR7 Q;  1G51 A;  3H0G H;  3HKZ G;  4IFD G;  1HNZ Q;  1G29 1;  1I6H H;  2MO1 A;  1T9H A;  3M4P A;  4R4O A;  4DAM A;  1IBM L;  1K9M C;  1VQK A;  3GTO H;  3F1Z A;  2PI2 A;  4A3M G;  4TVA B;  3S1R H;  4R4C A;  4X65 Q;  4FDB A;  4DV3 Q;  1KC8 C;  2B3G A;  4BBS G;  3KOJ A;  4JBJ A;  1Z47 A;  1K0R A;  5IYC H;  2OWO A;  2B29 A;  4DV6 Q;  4JI1 L;  4YY3 Q;  5FLM G;  2UXC Q;  2QGQ A;  3K7U C;  4A3L H;  1N36 Q;  2YV5 A;  3CC7 A;  5IP7 H;  4R4I A;  5C4J H;  1YVC A;  5GQO A;  5LMN L;  3AFP A;  4NXM Q;  1WJJ A;  3UDF A;  1Z9F A;  2OTJ A;  3KF6 A;  2IX0 A;  2KBN A;  4IPD A;  3RLN A;  1C0A A;  3H15 A;  4JOI C;  3PF5 A;  3UDX A;  1GM5 A;  3PO2 H;  2PNH A;  2DGY A;  4A4I A;  3KDF A;  1IBK L;  1K73 C;  2N3S A;  1ASZ A;  2ID0 A;  2KHI A;  3D31 A;  3PO3 G;  4X62 Q;  4A93 H;  3GTG H;  2Z6K C;  1I3Q H;  1VQI A;  4PMW A;  1W2B A;  1PH2 A;  4A3B G;  4JI6 Q;  2R7D A;  5GAG C;  3S2H H;  1PH6 A;  1QVC A;  3PV0 A;  3I4M H;  1M90 C;  4A3D H;  4LFC Q;  2HT1 A;  3PIP A;  3H3V H;  2C35 B;  4YCV A;  5C3E H;  1BBW A;  3CF5 A;  2UUB Q;  2WP8 J;  1UE7 A;  3MXN B;  3HOX H;  2VQF Q;  3TS0 A;  3HOY G;  3HOW G;  2ALY B;  4QL5 A;  1IXR A;  3DM3 A;  2QEX A;  1CUK A;  5BR8 L;  3DLL A;  1KQS A;  4DR3 L;  4LF8 Q;  3HOU H;  3GTK H;  1CKM A;  2YTV A;  1FL0 A;  4O0A A;  3CCS A;  4B3S Q;  4OO1 I;  4MZ9 A;  4YHH L;  3JAM i;  3E0E A;  1VQP A;  1SR3 A;  4X64 L;  4A3G H;  3TRE A;  1EFW A;  2H5X A;  4DV7 Q;  4DR6 L;  1N34 Q;  1UE1 A;  3M4Q A;  3MEF A;  4ME3 A;  4A3F G;  1J5E L;  1I94 L;  1C7Y A;  3HOZ G;  1SMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...