4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
1YEZA 4B3MQ 3CW2C 4IJLA 3HOUH 4A3LG 1SFOH 2OCEA 3S1QH 2B3GA 4OONA 2QA4A 1E3PA 2F4VQ 1Q8KA 3E9IA 1N36Q 1VQPA 2OTLA 3AFPA 4JI5Q 2E8GA 2RHSB 4TQUS 1P16A 1JE5A 4JI1L 4JYAQ 1GKHA 1HZAA 5M3MH 1PYBA 1HR0L 4GNXB 4JBKA 3K81C 2JEAI 1K73C 2YV5A 3H3VH 4A93H 4A3FH 3RZDH 2K50A 3J81j 2VQFQ 3S1RH 2A19A 3E9HA 4A3GG 3JAMi 3CP0A 3CPWA 1WCMG 2IT1A 1YZ6A 3CCMA 1W3SA 1X65A 1Y1WG 1VQ8A 4BY1H 4P74A 4HIMA 1PYSB 2JA8G 4X62L 2JJQA 1L0WA 3RR5A 5LMNL 4B3SL 3ERSX 4PG3A 1XNRQ 5C3EG 3GTOH 1A0IA 3PUWA 3A0JA 2VUMH 4OX9Q 4YHHL 4DV5Q 4AH6A 2I5MX 3I56A 4A4IA 2QEXA 1LM0A 4DR3Q 2N8NA 2NVQH 4JOIA 3HOYG 4JV5L 1D8LA 4WJ4A 4K0KQ 1ASZA 2VL6A 5IWAL 3M3YH 1N32Q 1SE8A 2Z0SA 4AQYL 4P75A 1HNZL 3S17H 4DV6L 3FHWA 1Q1EA 4LF4L 1HZ9A 2NVTH 3NELA 1JT8A 4EQ5A 1JJ2A 4DR4Q 2AWOA 1I6HH 1EIYB 3D31A 2JA9A 4GOPA 2K5HA 3W1GA 2K52A 2NZHA 2IX0A 4DUYQ 3KYHC 1HH2P 1PVOA 2MO0A 1QVCA 4QQBX 4JI0Q 4JI4Q 3M9BA 1YITA 2UU9L 3ZJYC 4LFAQ 1XJVA 2JA5G 4LF7Q 1B70B 1VQEA 2AMCB 2K5NA 5C0XI 5C44G 4HIKA 3PO2G 2GN5A 4A3CG 2HHHL 1CUKA 5ELOA 3GTMH 4GN4B 4X64Q 1KAWA 3H0GH 5C4XG 4JBWA 3CCSA 4A3DG 2JEBI 5E7NA 3E0EA 1PH7A 2R7DA 4PZ6A 3UDGA 1YJWA 3KDFB 4UP7A 1Q1BA 3U4ZA 1NTGA 4GNXC 2UUAL 1OXXK 1AE2A 3J81i 1GD7A 1IXRA 1VCIA 3A74A 3U58A 3S14H 1ASYA 2LSSA 2VS1A 4IFDJ 3ULLA 2VY3A 1Z9FA 1I50H 4BBRG 2ZM6L 3B6YA 2ZTEA 3STBD 2ALYB 1XTDA 3L0OA 4R4QA 1VQ4A 1EQRA 4NXNL 4DAYB 2VW9A 1YJNA 1I94Q 3AFQA 2CWPA 3EN2A 4B3ML 3OTOQ 2NVXH 1EYGA 1X55A 4JG2A 1G51A 2YTVA 4BA2I 2F4VL 1N36L 2E2IH 3OW2A 1SROA 5GAEC 2GVBA 2E2HH 4MNOA 4GN3B 4UP9A 1QZHA 4AQYQ 1PH8A 5IE8A 1HNZQ 4JI6Q 1UWVA 3BU2A 4A3BG 3I4NG 3GD7A 1S3OA 2JA7G 2AWNA 3PGZA 2VQFL 1OXUA 2UXDQ 1QUQA 2NN6G 5M3MG 5JEAG 1EWIA 3G4SA 3M4QA 4DR1Q 4A93G 1K83H 4DV1Q 1PFSA 1N8RC 2UU9Q 1XNRL 4LNQA 2RCNA 3KF6B 1PH1A 1N34Q 1GVPA 2R93G 4X66Q 2I5LX 5IYCH 3PUZA 3DLLA 3BZCA 1KHIA 1UEBA 1VQ9A 2HHHQ 2ES2A 4OX9L 4C3JH 3J7A5 1XMOL 3I4MH 5JJLA 4DR3L 1TWFH 3G6EA 1T9HA 3WWVA 4ALPA 1OXVA 1Q86C 3PV0A 4A3MG 4K0KL 2I5HA 2JQOA 2VUMG 4DV3Q 2ZTDA 1WFQA 5DLQE 4WJ3M 3HOWG 1Y1VG 1N32L 3G48A 2F3IA 3F2DA 2IHFA 3UE0A 3CC2A 1TWHH 4DV4L 4LW1A 4IFDG 1I3QH 4QJFA 3TREA 1DGSA 4MTNA 1E1OA 4QL5A 4DR4L 3HOXG 1EIFA 1IBKQ 1C0AA 4TVAB 2IX1A 4YWLA 4DUYL 5GADC 1KC8C 4A3KG 3OYYA 2KCTA 4JI4L 1Q82C 2NN6I 3L7ZC 2YU9H 4DR7Q 2QGQA 4LFAL 2R7FA 4LF7L 1KXLA 3F1ZA 1NMGA 1I5FA 1L1OB 1VQ7A 2B29A 1E1TA 4PZ7A 4BY7H 3M4OH 4YCVA 4OO1G 4KI0A 4DKAC 4X64L 1XPOA 1IYJB 3CAMA 1PH9A 1RIPA 3Q8DA 4A76A 3K0XA 4POFA 4OWWB 4OWXB 4GLXA 4L5SA 1K9MC 3S2DH 3F8TA 3HFZB 1OXSC 2PQAB 5IYBH 4Y7NH 3PIPA 3CMAA 4BXXH 4YWMA 3ICEA 2KCMA 2JA6G 2PMZE 3F2CA 3PO3H 1SMXA 4Y52H 4LWCA 4LF6Q 5M3FH 4GKJQ 1BBWA 1CSPA 1Q46A 1X3FA 2D0PA 3ULPA 3VDYA 2B63H 1CKNB 4IFDI 3KF8B 1E22A 1YNXA 2D0OA 4DV0Q 1C7YA 2R92G 3S2HH 3TS0A 2CWAA 4DV7Q 1BKBA 1YHBA 1M1KC 1I94L 3TRZA 3T1YQ 1X54A 2XGTA 3OTOL 1HNXQ 4LFCL 1K3RA 1SN8A 5J3BA 1XMOQ 4UPAA 4IOCA 1PH5A 1X6OA 3UDXA 5FLMH 3RN2A 1E24A 4J15A 2EQSA 3S24A 5IP9G 1Y14B 3J80i 3G71A 2BH8A 2WAQE 4JI6L 2WAQG 1EOVA 2JK8A 4DV4Q 3W1BA 4HIOA 2K75A 1FGUA 3ER0A 4HJ7A 2UXDL 3I55A 2R7ZH 4DNIA 1PH2A 1YHAA 4JI8Q 4HJ9A 1HZCA 2E5LQ 3J7ZC 1WJJA 5JEAJ 1G291 1NE3A 4DR1L 1VQ5A 4JBMA 4DV1L 1VQJA 2AHOB 3CCVA 1N34L 3EIVA 1L1OC 2FXQA 1EQQA 4X66L 3RN5A 2ZJQA 4LF9Q 3CQZH 3KFUA 3AYHB 5HY6A 3BJUA 3CCJA 2IHEA 2D62A 4RG1A 1J5EL 3CC7A 5IYDH 2PNHA 2MFIA 5IT9c 4NPSA 4DV3L 4R4IA 4C3IH 1EUJA 3I2ZA 1C9OA 4A3LH 4LF8L 2HIXA 3IRBA 3CC4A 4ME3A 1O7IA 3HKSA 2GVAA 3PUXA 4A3IG 4BBSH 4IPCA 4JI3Q 1IBKL 4L5QA 5GQOA 3CMEA 4GNXA 1JB7A 3H15A 1X9NA 4EX5A 2VQEL 2MQHA 4A3EH 3SGIA 1M90C 4DR7L 1MJEA 2EIFA 4O2DA 2WFWA 4R4TA 3I7FA 2A1AA 5HGQA 1U0LA 1LYLA 4LFCQ 4HJ8A 1VQMA 4DK3C 3K80C 3GTGH 4NXMQ 1JJCB 4A3GH 4P73A 1WCMH 1KIXA 4X6AH 4B3TQ 5EAYA 2JA8H 3HOUG 1VQLA 1VQHA 1W2BA 1XNQL 4BY7G 4B3RL 4YY3Q 1S72A 2UXCL 5C3EH 1GM5A 2OTJA 4RMFA 5K36G 2DGYA 2ZJRA 3M7NA 1SLJA 1D7QA 4DR5Q 2KHIA 1X56A 3FP9A 4LF6L 4GKJL 2HQLA 3GTKH 1X3GA 2YTXA 4A3JH 4A3FG 2OQKA 5M5YH 4YCWA 5IP7H 4L5TA 2MNAA 4DV0L 3PO3G 3M85A 2C35B 1L2FA 2Q2HA 4JI2Q 4DV7L 4BY1G 1OTCA 4HIDA 4QIWE 3T1YL 2B63G 1HNXL 1MIUA 1TWGH 1J5EQ 2BA1A 1HNWL 4XTCS 4UY8C 4PMWA 3TS2A 3FKIH 4YCUA 2BH2A 2JA5H 3KOJA 1LTLA 3PO2H 1FJGQ 4FDBA 4LFBL 2ZTCA 2I0QA 1BBUA 1V43A 3KDFA 1XMQQ 4R1JA 2XTIA 3PCOB 2HIVA 1TXYA 4JI8L 2Z6KC 4A3DH 2WB1E 1QVFA 3HOVH 1TWAH 2E5LL 4UP8A 4OXPA 4NB3A 2VQEQ 1NBWA 2PI2A 1P8LA 3JAMc 1YI2A 3STBC 3S1NH 1MKHA 3S1MH 1CKMA 2ID0A 2R7ZG 1VQKA 1VS0A 3PIOA 4IPHA 3HOZH 4GKKQ 3H3VI 2WP8J 4JI0L 1VQAA 4LF9L 3MXNB 3W5OA 2K14A 4R4OA 4GOPB 2R6GA 2R93H 2UUBQ 2H5XA 3M4PA 3UDFA 3RNUA 3GTPH 1CSQA 1PHJA 1XNQQ 3AEVA 1Q12A 3CD6A 3GTJH 1K8AC 1FL0A 4DPGA 4B3RQ 4XIGS 2UXCQ 2YTYA 4DK6C 1PH4A 2KENA 3H0GG 2N49A 3NENA 4GLVB 4AIMA 4GLAC 1UE5A 1A8VA 2UUCQ 5AJ3Q 1IBLQ 2ASBA 2RF4A 4KHPQ 4DUZL 1VQBA 1LUZA 4JI3L 2Y0SE 2Y0SG 2DUDA 4DR2Q 4C2MH 2LXJA 5LMUQ 1FVIA 1OXTA 2OQ0A 1NMFA 1WOCA 4A3BH 4IJHA 3UE1A 4LUVA 3I4NH 4BBSG 2CKZB 2Q2IA 4HJAA 1QZGA 2JA7H 1AE3A 4JI7Q 1V1QA 4A3EG 5GAGC 4NXML 5FJ8H 1HNWQ 1UE7A 1YBYA 2PI2E 3KF6A 2Q2UA 4B3TL 4DR6Q 5M5XH 4LF5Q 1MJCA 4OO1I 3PUVA 2KBNA 1VQGA 4YY3L 5BR8Q 2A8VA 4LFBQ 4AYBE 4AYBG 5C0XG 3T1HL 4A75A 1V9PA 1U5KA 1GO3E 4H02A 2VZAA 3KJPA 4JOIC 1N33Q 2UXBQ 1VQIA 3J81c 4DR5L 1VQNA 3K8AA 1H95A 1HJPA 3CPFA 1A62A 1UE6A 4GN5A 1S40A 1Y1VH 3HOWH 4P71A 1HR0W 2K5VA 4JI2L 4R4CA 4LUOA 4A3JG 1NY4A 1QUQB 3TEHB 2N3SA 4GOPC 4X65Q 1NJIC 2CCZA 5IP7G 3ULJA 1IBMQ 3HOXH 4PZ8A 4C3HH 3I4OA 5FLXc 3A5UA 1K8GA 5IYCG 1QVGA 3DM3A 1L1OA 4A3KH 4IOAA 5LMNW 4DV2L 3I4MG 2MO1A 4A3MH 3PSIA 1FJGL 4YWKA 1PV4A 1SR3A 4DUZQ 1XMQL 3FKIG 4LF8Q 3KJOA 4HJ5A 3S15H 1B7YB 3CCUA 2F52A 2PQAA 1WYDA 4JBJA 2CFMA 3RLOA 1RL2A 1TWCH 3EBEA 1CKOA 1J6QA 3PF5A 4POGA 4GKKL 3HOVG 1VQ6A 5ELNA 3L2PA 4P72A 2JA6H 1CKNA 4JI1Q 4QY7A 1PA6A 5JJKA 4KHZA 3RLNA 2UUBL 2EXDA 1VQFA 2NVYH 2JE6I 5H1SE 1KRSA 4QGUA 1Y1WH 1HR0Q 3HOZG 2R92H 4IPGA 3CCEA 4BA1I 1SRUA 4JC0A 4APVA 3T1HQ 2UUCL 1YVCA 5GAHC 4IPDA 5AJ3L 4X62Q 1IBLL 4KLKA 1YHQA 1KD1C 5LMNQ 4B3SQ 4KHPL 3D0FA 4JCVE 3HOYH 5IYBG 1PH6A 3RZOH 2V1CC 1B8AA 4GS3A 1KRTA 4BXXG 2N78A 2RHQB 5IP9H 4YHHQ 4DR2L 5LMUL 1VQCA 5M3FG 4JV5Q 3GDEA 4JI5L 3GTLH 2HT1A 3CCQA 1G6PA 2ATWA 5IWAQ 2KHJA 3U50C 4IO9A 4JI7L 4OWTB 1JMCA 3NEMA 1PH3A 3CF5A 4LUZA 1R9TH 3LGJA 5M5WH 4JYAL 3TQYA 4DV6Q 1KQSA 4LF4Q 4DR6L 1JJGA 4LF5L 1HZBA 4DV2Q 1Z47A 3K7UC 4DAMA 3K7AH 1IL2A 5FLMG 5BR8L 5FJ8G 5C44H 1Q81C 4A3CH 2ZJPA 1K0RA 3NBHB 1VQOA 3MEFA 3F2BA 3GTQH 1EFWA 1N33L 2UXBL 1E7ZA 1N9WA 5C4XH 5C0XJ 2AKWB 5GROA 1YJ9A 2WB1G 5IY0A 2L15A 1IZ6A 3S16H 3UDIA 2LXKA 2NZOA 4DV5L 2OWOA 1A63A 3BZKA 2E2JH 1XPUA 2Z6KA 3CCRA 4X65L 3GO5A 2UUAQ 2YYZA 3RLFA 3AQQA 3KLWA 3CXCA 4A3IH 1IBML 3PF4A 1AH9A 2Q2TA 1YIJA 3U4VA 4BBRH 5C4JH 4O0AA 2VNUD 1BVSA 1VQDA 1KL9A 1XPRA 3A5ZB 1UE1A 2K4KA 1Q7YC 5JJIA 4L5RC 2IY5B 1X3EA 5IYDG 2BA0A 2ZM6Q 2CQOA 1WI5A 3PUYA 3J80c 3HKZE 3HKZG 3JC66 3CCLA 4MZ9A 4NXNQ
chains in the Genus database with same CATH superfamily
1YEZA 4B3MQ 1XWEA 1L0YB 1JQYD 4OONA 1E3PA 1N36Q 2E8GA 2RHSB 4TQUS 1ZYRD 5CV9A 1PFMA 4JI1L 3D3RA 4K6DA 1HA5A 1K8MA 1PYBA 1SNDA 2B2TC 2YV5A 3H3VH 2K50A 2VQFQ 1VDZA 4A3GG 1KDAA 2K05A 3CPWA 1YZ6A 1X65A 4WORA 2A68D 3ND9A 3RR5A 1RKNA 3BDOA 4X3SA 1HFNA 1A0IA 2VUMH 1A15A 1II3A 4DV5Q 4AH6A 1SYCA 2N8NA 2R7ZB 2NVQH 3P7JA 3MAQA 4EVOA 1DOLA 2Z0SA 2FINB 1BQQT 3FHWA 1Q1EA 1EQTA 5IGBA 4EQ5A 1JJ2A 1BF4A 3MXNA 2AWOA 4DR4Q 1EIYB 3D31A 4KY5A 2WV6D 4GOPA 2Z6BA 2CHBD 2WINB 1PVOA 1HH2P 1KLUD 2MO0A 2H1EA 5TSSA 3M9BA 1R4PB 3ZJYC 2JA5G 3PO2G 1VQEA 2AMCB 2K5NA 5C44G 1QNKA 2A6HC 3GTMH 4GN4B 4BBSB 1PH7A 3RMHA 4IUPA 1YJWA 1U4RA 2UUAL 3GP7A 3U4ZA 3JAME 1IXRA 1VCIA 3A74A 5I2XA 3AU7A 1HUNA 4FYDA 1SE4A 4IFDJ 4KMUC 2VY3A 2DY7A 2ZM6L 1IKLA 4RFBA 3STBD 3C2PA 4LMQD 3IFDA 4DAYB 2VW9A 4RGMA 3AFQA 2CWPA 4CHTB 1AZQA 1X55A 1JWSD 1H9JA 1GUOA 5CGKA 3BZDB 2E2IH 4K5WA 2OT2A 4A3JB 4MNOA 2DY8A 4UP9A 1QZHA 1PH8A 3I4NG 3GD7A 1EY0A 3MHBA 2A69D 3C3LA 1B2TA 1TWGB 2F3WA 1EWIA 3PIP3 3L3OC 4DR1Q 1PFSA 2A6ED 4H0LC 1XNRL 2RCNA 3KF6B 4R8NA 3D8GA 1B9NA 3DLLA 2ES2A 3W2DA 3J7A5 1SBBB 5IGCA 1XMOL 2M00A 3I4MH 3G6EA 3WWVA 4ALPA 4A3DB 2VUMG 2ZTDA 3A8KE 1WFQA 3G48A 2F3IA 3NUCA 4IFDG 2E75C 2F0GA 2WACA 1DGSA 1E1OA 4ILWA 4QL5A 1IYUA 4TVAB 1PRTF 5ISRA 3GTPB 1K3BC 4A3KG 2EZVA 3OYYA 4JI4L 1Q82C 4LF7L 3BDCA 2O5IC 1NMGA 1I5FA 1VQ7A 1E1TA 2O2LD 3NXWA 1CI3M 2VXWA 4KI0A 3R93A 4DKAC 1XPOA 3BVMA 4DK0A 1Q3LA 3K0XA 4OWWB 4GLXA 4L5SA 1K9MC 3F8TA 5IYBH 1JOOA 4YWMA 2PPBC 1YNNC 3NE5B 1FR3A 1MSGA 3VR3A 4LF6Q 1BBWA 1Q46A 5E3FA 4IFDI 1CKNB 1C7YA 2D0OA 2QILA 5F2DA 5M5XB 4DV7Q 5C3XA 1YHBA 2L11A 3EROA 3OTOL 3NBHA 4KN4C 1K3RA 3TP5A 1XMOQ 5IGGA 4IOCA 1E24A 2B2UA 1D1IA 3G71A 4KY6A 2WAQG 1EY4A 1F9RA 1QNUA 1QOHA 1FGUA 3ONAB 4HJ7A 3I55A 2R7ZH 2F0MA 4DNIA 2B2VC 1HZCA 2E5LQ 1WJJA 5JEAJ 1PRTD 4HCSA 2AHOB 2F0IA 4A3MB 3EIVA 2FXQA 4X66L 2K5QA 2Z1CA 3CCJA 2IHEA 1S5BD 1NUCA 5JVG3 2J4XA 3DWPA 3S15B 2A74C 4NPSA 1CM9A 3K5OA 5AFWA 1JOQA 5I6WA 3IFTA 4A3LH 5I2YA 4KK7A 4LF8L 3IRBA 2JA6B 1LTRD 3PUXA 4BBSH 1AP0A 4XT3B 1Y1WB 4GNXA 2J0TD 1X9NA 4EX5A 1ZEQX 2VQEL 3SGIA 2X69A 4R4TA 1PMRA 3I7FA 5D3DA 5C0XH 1SEBD 3GV6A 5G3LD 2ZXOA 4YY3Q 1STYA 1S72A 2UXCL 2B39A 2ZJRA 5C4HA 1QWYA 3M7NA 1SLJA 3K6OA 1NR4A 3NTHA 3FP9A 5DM63 1R9TB 4A3JH 5A35A 1UAPA 5IP7H 4DV0L 1WTRA 3EVQA 1V1PA 5L37A 1JICA 4JI2Q 5ELCA 3QR8A 5IGFA 4LK1C 3T1YL 1KNAA 1HNXL 1MIUA 1TWGH 5C4XB 3AMUA 4HSVA 1HNWL 4UY8C 1VF7A 2F0LA 1FJGQ 1VMCA 4LFBL 3Q6SA 3FEWX 1V43A 2F0PA 2KEEA 1XMQQ 4R1JA 2HIVA 4A3DH 3TP6A 2WB1E 2F0WA 2QDBA 1HQMC 2VQEQ 1YI2A 1H9SA 2R7ZG 1VQKA 1VS0A 4IPHA 3T16A 1SYBA 1VQAA 1BUVT 1TY2A 1Y8PB 4ZQ3A 2PZUA 3GTPH 1LTAD 1PHJA 1Q12A 3HOUB 1SFOB 4KV6A 1BCPB 2UXCQ 1KDCA 1PH4A 3K5LA 1LTBD 3NSWA 4GLVB 2WKDA 1LLRD 2UUCQ 1HFGA 4H7BA 4KHPQ 2HDMA 3EFXD 5C3WA 1MD2D 4DR2Q 1J9OA 4BBSG 1NMFA 2DJGC 3UE1A 4LUVA 2R93B 4HJAA 4BY1B 3MWYW 1TS5A 1MBYA 1O7ZA 1TIID 3QOLA 1HNWQ 3VR2A 2L5TA 4B3TL 4DR6Q 4L8JA 5M5XH 4K2LA 4OO1I 2K04A 4LFBQ 5C0XG 3T1HL 4A75A 1V9PA 3KJPA 1N33Q 5M9OA 4LJZC 1EZ6A 3J81c 4MN3A 1VQNA 1EWCA 1SNOA 5ELEA 1DOMA 3K8AA 4HTHA 3S17B 2M2LA 3CPFA 4GN5A 2N88A 5E1FA 1I6HB 1HR0W 2K5VA 4A3JG 3KLSX 5KGUA 1QUQB 4GOPC 2CCZA 5IP7G 3H91A 3ULJA 1IBMQ 1TY0A 5FLXc 4EQOA 1I6VC 3TP7A 1QVGA 5LMNW 4C3JG 3A8IE 4A3MH 2K5DA 3H0GB 1SSOA 3TZUA 3I90A 4HMIA 1PV4A 1UUPA 3KJOA 4HJ5A 3S15H 1B7YB 2RSOA 3CCUA 3RLOA 1CKOA 2XWJB 4DN4M 3L2PA 4P72A 2JA6H 3VR5A 3G6JB 4J1MA 2UUBL 2EXDA 1Y1WH 1HR0Q 2JE6I 2R61A 1S5CD 4FF1A 2NVXB 4IPGA 3TBIB 5K5PA 1SRUA 3T1HQ 5FO7B 1RD9D 3DEPA 4OELB 5GAHC 4KLKA 1YHQA 2QW7A 5CR3A 5LMNQ 3D0FA 4ZAIA 4BXXG 1B8AA 3X3MA 2KHSA 2RHQB 5IP9H 2ZXPA 1VQCA 4JI5L 1M8AA 2HT1A 2SOBA 2KHJA 3U50C 4CJ2C 1R9TH 3LGJA 3TQYA 1Y8OB 1Z47A 4A3CH 2UXBL 1E7ZA 5C4XH 2AKWB 2E74C 3FKIB 1KABA 1EY9A 1IZ6A 1DJRD 3UDIA 3T13A 1I3QB 2NB0A 1HHVA 1PLFA 2KJXA 2OWOA 2E2JH 3FRPB 4Z9CB 3NWTA 4X65L 1NNXA 1LO5D 2QF7A 2YYZA 3AQQA 3RLFA 3OSOA 1UNSA 5CMDA 5COYA 1KL9A 4ZUIA 4R9WA 4BY7B 2K4KA 4KJNA 5KNDA 5JJIA 5IYDG 1NAPA 1EL0A 2CQOA 3J80c 5IT9E 4EQNA 3S2DB 4HJ8A 4JI0L 1I4QA 1B50A 4A3MG 2LKVA 5EKIA 4IJLA 3HOUH 1SFOH 2F4VQ 1W6KA 1Q8KA 2BE5C 3E9IA 4JI5Q 3J80L 5M3FB 5K36H 2PO4A 4K5VA 3M4YA 1GKHA 1HZAA 3K81C 1GUWA 2A19A 3SXHA 2B8GA 1Y1WG 4BY1H 3CCMA 2R93H 2JA8G 2O4XA 1AN8A 1CA5A 2B2UC 5C3EG 2WB1B 4NMZA 2EYOA 4OX9Q 2L1BA 4CDEC 4YHHL 2B2WA 3I56A 1AZPA 1LM0A 4DR3Q 3VA7A 5E4WC 1D8LA 4WJ4A 4K0KQ 3N52A 2EJFC 3I3CA 1N32Q 1SE8A 4AQYL 4P75A 3S17H 4LF4L 1JT8A 2CH4W 1I6HH 2JA9A 2NBFA 4DFAA 4DUYQ 4JI0Q 5HGTA 1XJVA 4K14A 4HIKA 1HA6A 4A3CG 4XYOA 5ELOA 5C4XG 3H0GH 3CCSA 2JEBI 3E0EA 1PYWD 4PZ6A 1EIHA 1VMPA 4V190 1KTKA 5CV7A 1ZYRC 4GNXC 1AE2A 3SK5A 3J81i 3U58A 1HQRD 3ULLA 1WCMB 1ESFA 2OXPA 3B6YA 1G2TA 1XTDA 4R4QA 2PCFB 4B3ML 1SYEA 1YJNA 2O5JC 2NVXH 1EYGA 2GA4B 1G51A 1BCPF 1N36L 3GTKB 4CDDC 1X32A 2IW3A 5M5YB 4AQYQ 4WJWA 1SMYD 2N55A 4CDCC 4F8MA 2AQ2B 3OMGA 3PGZA 2VQFL 2UXDQ 2B8FA 3M4QA 3T51B 1CFMA 2EY1A 3MFYA 2JP1A 1CQFA 3D4RA 3P75A 1PH1A 2R93G 5IYCH 5JJKA 3PUZA 4K5XA 1UEBA 4RHRA 1VQ9A 5JJLA 4EGVA 4U68A 1Q86C 1TS2A 1OXVA 3WOEA 3PV0A 3VYTA 1TWAB 1PZID 2JQOA 2BDNA 4DV3Q 1DM0B 5IGEA 3HOWG 4CDFC 2IHFA 3CC2A 3VYUA 1SDFA 2DNCA 4LW1A 1I3QH 2MUYA 4QUFA 3FDTA 4DR4L 1YNJC 1O80A 4PNYA 4YWLA 4ZCKA 2IX1A 2M9VA 1F9PA 1TVXA 3MXGA 3GV3A 3C1EA 1KXLA 2R7FA 5EPKA 1STHA 1ENAA 2B29A 4PZ7A 4BY7H 2EY2A 1BR9A 3OHXC 4HEDA 1JOKA 1JCKB 3S2DH 4OHJA 1OXSC 1U4LA 4FO2A 4A3BB 3CMAA 2KECA 3FPPA 5EJWA 4RKBA 2JA7B 1KDBA 2A69C 4Y52H 1CZGA 5M3FH 1SXTA 1CSPA 3ULPA 1W6JA 2D0PA 2MP1A 1KLGD 4DA2A 1F2MA 2R92G 1SNCA 3HP3A 3TN2A 1AEXA 2A6EC 3TRZA 1B1ZA 2XGTA 2F3VA 1PH5A 1X6OA 5FLMH 4X3KA 4DXGA 3NWSA 1G6ZA 2EQSA 3J80i 2BH8A 3MFGA 1Y1VB 2X6GA 3Q23A 1R4QB 3N6RA 2KA7A 2PNRC 5D14A 2LFNA 5J22A 1U4MA 2KCCA 2PZWA 1K0SA 1YHAA 3HOXB 4C3HB 5JOBA 3E0JA 1VQ5A 4DR1L 1Q90A 1VQJA 3CCVA 5I9PA 1EQQA 4LF9Q 5CC4A 2F0KA 2D62A 4KY7A 1J5EL 1BBXC 1QILA 2PNHA 1PXUA 1TWCB 4R4IA 1FNUA 5T1IA 4FF3A 1ILQA 1WTPA 2HIXA 3CC4A 2L4NA 2PMZB 3HKSA 2HCIA 4IPCA 4JI3Q 3V96A 5GQOA 3CMEA 1JB7A 4L63B 1EY7A 3NBIA 4FXKC 2EIFA 2A1AA 5HGQA 3D4WA 4RGOS 3TMEA 2NZ1D 4DK3C 4NXMQ 4P73A 1WCMH 3VR4A 1KIXA 3HOYB 5EAYA 1VQLA 3PIO3 5DEHA 4BY7G 4CJ1B 1SE3A 3E6ZX 2D5DA 3BS1A 2JXMB 3A54A 1I4XA 1D6EC 3MTSA 4DNRB 3HEJA 2KHIA 3I73A 4LF6L 3QIAA 4WRDA 3GTKH 1X3GA 3URYA 3IKJA 2OQKA 5M5YH 4L5TA 4GZYC 1L2FA 4DV7L 4HIDA 2DJFC 1F9QA 1J5EQ 1FGBD 3HRZC 1DD2A 4XT1B 4PMWA 3K5MA 4YCUA 5KRUA 3KOJA 3J7AF 1EU4A 2ZTCA 1PFNA 2XSCA 1BBUA 3KDFA 2XRQD 5FO8B 4A3IB 1TWAH 2E5LL 4BBRB 5CORA 4NB3A 1P8LA 3JAMc 2H4OA 1MKHA 4RWSC 4GKKQ 3H3VI 1ET6A 3MXNB 2K14A 1XXGA 4GOPB 2AUKA 3NQIA 2XWBB 3OWEB 3UDFA 4ID6A 3JAML 1CSQA 4YIJA 3AEVA 3CD6A 3QO2A 4DAPA 3CHBD 5C4ZA 4DK1A 3S1QB 2IWHA 2N49A 2K33A 5AJ3Q 1TKWB 4IZ8A 2F4IA 1LUZA 5M3MB 1CTMA 3R2TA 2A6HD 4A3FB 2LXJA 2EY5A 4TSSA 4A3BH 1WOCA 2Q2IA 2SDFA 2JA7H 1V1QA 4XQJA 5EPLA 2NN6H 3Q0AA 5FJ8H 5JEAH 1UE7A 2AUJD 3UI2A 2NTTA 1MJCA 1S5ED 1LT5D 4YY3L 4FF4A 2A8VA 2SNMA 2B2WC 2L9HA 2BCOA 1TT2A 4H02A 3AB9A 1LT3D 3M3YB 3R2IA 1WTXA 5E4XA 5EGTA 1H95A 1WD0A 4K8JA 1HJPA 3SEBA 1UE6A 1Y1VH 1BNZA 1XTCD 4JI2L 3QG1A 3TEHB 3K59A 2N3SA 2HCCA 3HOXH 4C3HH 4RA8A 3E3XA 3DM3A 1L1OA 1EU3A 5KNBA 1FYCA 2MO1A 3I4MG 3PSIA 1FJGL 5HURA 4ZYSA 1BO0A 4YWKA 1SR3A 1XMQL 4I7ZC 2PQAA 2CFMA 4FXGC 3D6CA 1RL2A 1TWCH 3S14B 3EA6A 5ELNA 3VYSA 3KF8A 4O1NA 5FKAC 4QB4A 3MC0B 4BA1I 4DF7A 2UUCL 4QF4A 4IPDA 4X62Q 4KHPL 4B3SQ 4JCVE 1STBA 5IYBG 4DGZA 1SE2A 2EJMA 1PH6A 3HOYH 2FFKB 5EQ0A 3KK7A 3FVQA 4DR2L 3P1HA 4JV5Q 3OIPA 3CCQA 1G6PA 2BOSA 5IWAQ 4OWTB 1JMCA 5C5MA 1K83B 4DV6Q 1L0XB 1KQSA 2JN4A 3NTIA 2A73B 4DR6L 1JJGA 2EYJA 1GJXA 1IL2A 4DAMA 1ICFB 5FK9C 4KJOA 1TWFB 5EBCA 5FJ8G 1Q81C 3NBHB 1UEAB 1N33L 4OEMB 5C0XJ 3MA2B 5GROA 1D5XC 2F03A 2L15A 4G4KA 2NZOA 1IL8A 1A63A 2P5ZX 2Z6KA 3VYRA 3GO5A 3RD4A 4A3IH 3KLWA 1AH9A 1IBML 2YU9B 3CKIB 3U4VA 4RCNA 4BBRH 1BVSA 1VQDA 3A5ZB 3M4OB 1PZJD 1Q7YC 1F2ZA 2F0FA 2IY5B 1RODA 3QWNA 2JYOA 4RAUC 5CV6A 3HKZE 1EY8A 1HXYD 4B9WA 2RDHA 3CCLA 4MZ9A 4NXNQ 3W3AA 4Y7NB 4KHVA 4A3LG 3NQTA 2OCEA 3S1QH 3PO3B 2WKCA 1VQPA 4RGTA 3X3NA 5JPMC 2B63B 3A55A 1C4QA 1Q8IA 5M3MH 3S2HB 5KNCA 4HN7A 1HR0L 4GNXB 1B9MA 2TSSA 1K73C 2JEAI 2KUMA 4A3FH 3A56A 3E9HA 2F0QA 3JAMi 3CP0A 2IT1A 1Y69U 5ELDA 4P74A 1PYSB 5A2QL 1HRJA 2JJQA 5LMNL 5I9OA 4XQQA 3D6WA 3PUWA 4ZRZA 5T1GA 4BWGB 4G7ZC 5DNFA 4JOIA 3HOYG 2F0UA 2Z4IA 4TKOB 3J81L 1ASZA 2AQ3B 3M3YH 4TRDA 1Z7TA 1I4RA 4JW0A 4PQXA 1FNWA 3BVZA 2R3ZA 1V1PB 4NW2A 1JWUD 2K5HA 4F87A 2K52A 2NZHA 1GUNA 2SEBD 5LL6X 1QVCA 5FLXL 4QQBX 4C3IB 4LFAQ 1IKMA 4H44C 1B70B 3LX0A 5C0XI 1OO9B 2GN5A 1ET9A 2Q8TA 4X64Q 1KAWA 4A3DG 4NKLA 3UDGA 2EE1A 1CHQD 5KYIA 4UP7A 1Q1BA 1NTGA 1OXXK 1GD7A 3S14H 3I70A 1H9SB 1WD1A 4ZKBB 2VS1A 2QEJC 4A3GB 4J6HA 5BN3A 4BBRG 2ZTEA 1TS3A 4PV1C 2ALYB 1VQ4A 1EQRA 1I94Q 3OW7A 4JG2A 2YTVA 4BA2I 2F4VL 2XIWA 4K6LA 4CGYB 2NTSA 5GAEC 4GN3B 2IPKD 5IE8A 2IL8A 4JI6Q 1UWVA 3BU2A 2ZXRA 4P2CB 2LS01 2J7ZA 4PMCA 2AWNA 2PW7A 1DCZA 1OXUA 2HUGA 1RTOA 4DU9A 1H9MA 5M3MG 2KCNA 3G4SA 1EY5A 2RCFA 1K83H 4DV1Q 1N8RC 3PMFA 4LNQA 1N34Q 1GVPA 2JA5B 3PO2B 4OX9L 4DR3L 1TWFH 3VA5A 3BG3A 4K0KL 2I5HA 2TMPA 3SK8A 2BDOA 1N32L 3S1NB 3UE0A 1BXTA 3GQBA 4DV4L 3HOZB 3HS0C 4B08A 4MTNA 2RVLA 1IBKQ 4QMGA 3TDQA 2XN9C 4DUYL 5GADC 1AW7A 3L7ZC 2YU9H 4DR7Q 3DWAA 5C5LA 2RBMA 1MHWC 3M4OH 3I8ZA 4YCVA 1V8QA 1PH9A 1RIPA 1PTOC 4A76A 4C2MB 2RQXA 1B3AA 4Y7NH 1CQVA 3PIPA 4FP5D 3I4NB 1EYCA 3ICEA 2KCMA 4EQPA 5BN5A 2PMZE 2JA6G 1A6XA 4PMBA 3PO3H 1SMXA 3K58A 4GKJQ 1STGA 4NDXA 1A3TA 1EEFD 1X3FA 3LNNA 3VDYA 2B63H 1E22A 3S2HH 2K6AA 2CWAA 4N8X1 4V0BA 3T4AC 1X54A 1SN8A 3UDXA 3CRLC 2KEDA 1EEID 4HAEA 3G7LA 3S24A 5IP9G 4S3SA 4G7HC 1CHPD 1RTNA 1EOVA 3MEHA 4DV4Q 2JSOA 4HIOA 1Y8NB 2ICEC 3ER0A 2UXDL 2CW0C 2PZTA 1PH2A 4HJ9A 4JI8Q 4OIKA 1IW7C 1NE3A 2F0SA 5D65A 4JBMA 4A3KB 2Z8LA 3HKZB 4IQZA 1L1OC 1B3QA 1NCVA 3RN5A 2ZJQA 3TSSA 2HDLA 1WTWA 3KFUA 5ELBA 5HY6A 4RG1A 3CC7A 1O7LA 2OEOA 2MFIA 5IT9c 4DV3L 2ENBA 1GOZA 2CH4A 2HD3A 4C3IH 1EUJA 2RA4A 2AQ1B 1J8IA 3WDNA 1ENCA 1F2LA 4ME3A 1O7IA 2GVAA 5IT9L 2F0VA 2NVYB 2ZT9C 3ND8A 3SR1A 3H15A 1D5ZC 2MQHA 1SNPA 2A68C 4C1NK 4O2DA 3U9SA 2F0OA 1LYLA 1TQOA 4A3GH 3A8JE 4X6AH 4RHSA 3RZOB 3HOUG 1VQHA 4B3RL 1LT6D 1GM5A 4G57A 2WAQB 2OTJA 2Z4HA 3KLRA 5K36G 3GTLB 4IUTA 1D7QA 5CBEE 4DR5Q 2IX3A 5J39A 1X56A 4KD4A 2HQLA 2YTXA 3I4LA 4QUCA 1NSNS 4Q0FA 3PO3G 3M85A 2C35B 2Q2HA 2RSNA 4BY1G 4QIWE 3GTQB 2B63G 2BA1A 3NK9A 3H09A 4CBVA 3SHLA 2MGSA 3S16B 4UHVA 3TS2A 1KAAA 3FKIH 2BH2A 4ULLA 2JA5H 3C46A 1LTLA 3PO2H 4FDBA 2L55A 2I0QA 1H9KA 2XTIA 3PCOB 1TXYA 2Z6KC 1QVFA 1ESRA 4UP8A 2F0EA 1STEA 1HUMA 2PI2A 3S1NH 3STBC 1IYVA 1CKMA 2ID0A 5IOCA 3D4DA 3HOZH 4F7XA 4B9XA 2WP8J 4LF9L 3A7AB 2R6GA 3LWEA 2L0CA 2H5XA 3M4PA 3IL8A 1BCPD 2FMCA 4DAYA 2E2DC 1PDQA 2K1BA 1FL0A 4DPGA 1K8AC 4XIGS 4B3RQ 2CQAA 2YTYA 1HTLD 4DK6C 3H0GG 3NENA 4GLAC 1IBLQ 2ASBA 4JI3L 1STAA 2Y0SE 1GUTA 2DUDA 2EVBA 4A93B 4C2MH 3RZDB 5LMUQ 5CV4A 1OXTA 2OQ0A 3S1RB 3I4NH 1QZGA 2Z9HA 1AE3A 4JI7Q 3FPUB 2OF1A 4NXML 3GTOB 1YBYA 5IIFA 3KF6A 4LF5Q 4IUVA 2K32A 3HGBA 3PUVA 1RHPA 1VQGA 1ZKOA 5BR8Q 1Z6HA 1SNMA 3NP8A 4AYBE 4Q5VA 1S5DD 4JOIC 1VQIA 2PQEA 3E5SA 3F2UA 2NVTB 1I4HA 2QDLA 3KBGA 4IFDH 4M1UB 5LHY1 1GHJA 4PZ8A 1EYDA 3I4OA 1HPCA 3SK6A 2F0DA 5EBDA 3A5UA 1K8GA 5IYCG 3I72A 4IOAA 4A3KH 1EIGA 4HCEA 2EYLA 1RDPD 3FKIG 4LF8Q 2F52A 1WYDA 3H3VC 3L9AX 1FNVA 5CYUA 4CKBA 3IAYA 3R8BA 1SYDA 1CK1A 1MI2A 5FOBB 5I4DA 4POGA 2C9OA 4GKKL 1I50B 1CKNA 4JI1Q 3RLNA 1VQFA 2EYMA 2NVYH 3U9OA 3HOZG 2EDGA 1C48A 3A7LA 1YNJD 2KQ3A 1YVCA 5AJ3L 5DM73 1LABA 3EJIA 1WTHA 2E2HB 2EYHA 2WIIB 3RZOH 1KRTA 3V2TA 1SNQA 1B4OA 1D1KA 1QB5D 1PRTC 1T5XD 5M3FG 3GDEA 4FVMA 3GTLH 2EYFA 4JVZA 5EKLA 2L12A 2ATWA 3NEMA 4MTKA 1GUSA 1ML0D 3QOJA 4JYAL 5KIXA 5LL6S 2D9UA 4C3JB 5FLMG 3GTQH 2G9DA 3MEFA 3F2BA 1EFWA 2E76C 2QKIC 1S5FD 2WB1G 2PYKA 5IY0A 2DNEA 1TWHB 3S16H 2LXKA 1MSHA 2G5DA 1EOTA 3BZKA 1XPUA 3CCRA 2UUAQ 4CKEA 1WTOA 1TR5A 1E2WA 2Q2TA 1SYFA 1XPRA 2QCPX 1UE1A 2B2YA 5D3IB 3ERQA 1O7YA 2I07B 1DZ1A 1G91A 3BYTB 2ZM6Q 1WI5A 3PUYA 3HKZG 4HMJA 3JC66 3CW2C 2G9HD 2PW5A 2XNAC 2B3GA 1GXDC 4ABNA 2QA4A 4U673 2OTLA 3AFPA 1B53A 5CV5A 4QIWB 1P16A 1JE5A 5CV8A 4N9PA 4JYAQ 3K0YA 4JBKA 4KKTA 4FXDA 4A93H 2EXZA 3RZDH 3TP8A 3J81j 3K57A 2EOTA 3S1RH 5DAUA 5KYLA 4K8IA 4N8FA 1WCMG 1EQVA 1MGSA 1W3SA 1VQ8A 4HIMA 1H9RA 4X62L 1L0WA 4B3SL 3ERSX 4PG3A 1STNA 2A5HA 1XNRQ 3GTOH 3NTKA 3A0JA 3S9WA 2QEXA 2I5MX 4A4IA 4KKSA 4JV5L 5G3LF 2VL6A 5IWAL 2VB3X 1C8CA 1DYQA 1HNZL 4OL7A 4DV6L 2NVTH 1HZ9A 3NELA 3CQZB 1KNEA 3W1GA 1EWHA 2IX0A 3KYHC 4OO1H 1CA6A 4JI4Q 1YITA 2UU9L 4JK1C 4HR7B 4XYQA 4LF7Q 3MZ5A 2Y0SB 2HHHL 2Q8IB 1CUKA 4JBWA 5E7NA 1FD7D 2R7DA 3T53B 2C5CA 3KDFB 4A3EB 4MHEA 3OWFA 4XDXA 1JE4A 1ASYA 1JC7A 1ONLA 2LSSA 5J1ZA 3GTGB 1TS4A 1F2YA 1SYGA 1Z9FA 1I50H 4AYBB 2JA8B 3L0OA 4BS9A 4NXNL 3J7AV 5C3EB 3EN2A 3OTOQ 4KN7C 2Q8RE 3OW2A 1SROA 2SNSA 2GVBA 4I65A 1PTOB 2E2HH 5JPNC 4O42A 1WVLA 3NHHA 1HNZQ 4A3BG 1YNND 1M4VA 4RKLA 1S3OA 1E2VA 2JA7G 1QUQA 3ZYYX 1LTTD 2NN6G 3KLSA 4DAVA 5JEAG 5A2QE 4A93G 2F0HA 2EJGC 1U9RA 2UU9Q 3T56B 4X66Q 2X6LA 2I5LX 2HHHQ 3BZCA 1KHIA 4ZLTF 3P20A 3KBXA 4C3JH 1LT4D 1T9HA 3J81E 1DXMA 3HOVB 1I4PA 2MPMA 5DLQE 4WJ3M 1Y1VG 1T5EA 5KEEA 3F2DA 3DM1A 3S1MB 1TWHH 1B44D 2E2JB 4QJFA 3DEOA 3TREA 4KKUA 1VF5C 3O13A 3MXPA 3HOXG 2DN8A 4C3HG 1EIFA 1C0AA 3H6MA 4RGNA 1KC8C 5FLXE 2KCTA 3GTJB 2NN6I 3SK4A 2QGQA 4LFAL 4X3TA 5FO9B 2F0NA 3F1ZA 1L1OB 1EZ8A 1X3PA 4OO1G 3PQIA 3QJYA 4X64L 1IYJB 3CAMA 3KUPA 4FNFA 3Q8DA 4POFA 4OWXB 4CJ0B 4ME5A 3HFZB 2PQAB 4I7AA 3DUZA 4BXXH 2D2CC 1E2ZA 2K7VA 1QJOA 3HG9A 3F2CA 4LWCA 1CT1D 3H94A 4LAAA 3KF8B 1YNXA 4DV0Q 2B2TA 3TS0A 3BYYB 1BKBA 3FMCA 1M1KC 1I94L 2K28A 3T1YQ 5BN4A 1IHZA 1HNXQ 4LFCL 5J3BA 1ILPA 4UPAA 4RH6A 3RN2A 4J15A 1A3VA 1DONA 1Y14B 4L6TB 4ZKCB 2WAQE 3HOWB 4JI6L 2RDFA 2JK8A 3W1BA 3J7YW 2K75A 4DNTB 2XVSA 5IODA 3J7ZC 1G291 1QG7A 4DV1L 1D2BA 1N34L 1DOKA 3HZXA 3CQZH 2NYZD 3AYHB 3BJUA 4IURA 1NR2A 1LTID 5IYDH 4UDUC 1LTSD 3I2ZA 1C9OA 3OIQA 3OMCA 1GHKA 4A3IG 1WTVA 3QB3A 1CZWA 4UAIA 1IBKL 4XQNA 4L5QA 4DXFA 1SAPA 3R3OA 4OIJA 4A3EH 1I4GA 2R92B 1M90C 4DR7L 1MJEA 3V05A 1G2SA 2WFWA 1U0LA 4LFCQ 1VQMA 3K80C 1WTQA 3J80E 3GTGH 1JJCB 4K2KA 4B3TQ 2JA8H 1A2UA 1W2BA 3MXUA 1XNQL 1SJED 5C3EH 4RMFA 2EY6A 2DGYA 4QCLA 1A2TA 1PFBA 4GKJL 1ZXTA 5M5WB 3RUZA 3BDLA 1PTOH 3M7GA 4IUNA 4A3FG 4IUQA 4C56C 2MNAA 4YCWA 1LTGD 3K7AB 1OTCA 5C44B 2I46A 4H13C 4WFN3 1F9SA 1X3QA 2CVRA 3DHQA 4HSPA 2LY7A 4XTCS 1EYAA 1HTPA 3NPPA 5IGDA 3SDZA 4G7OC 2K5WA 4J8QA 5I6YA 2NWGA 3Q22A 4JI8L 2K03A 3HOVH 4OGQC 5C4JB 1K8OA 4OXPA 1NBWA 3CU7A 2V4DA 4IUUA 1ENFA 3S1MH 4C1NI 3PIOA 2B2YC 4MIUA 1LACA 5EKKA 3W5OA 2VB2X 4R4OA 2UUBQ 3RNUA 1JORA 1LV9A 1XNQQ 3GTJH 1D5MC 1K28A 1XX8A 1RCVD 2KENA 4AIMA 3MVVA 1SMYC 1UE5A 1A8VA 1QE6A 4RCOA 2RF4A 4DUZL 1VQBA 3I91A 4XXEA 1O78A 2Y0SG 2F1MA 2EPBA 1EY6A 1FVIA 4IJHA 2CKZB 2LMCB 4A3EG 5GAGC 2FMMA 1TU2B 2PI2E 2Q2UA 4F88A 1GUGA 2VUMB 2KBNA 2IJ0A 2KOLA 4FF2A 2NVQB 4AYBG 2F0TA 1U5KA 1GO3E 1ICWA 2VZAA 2UXBQ 4DR5L 3DXJC 4CKCA 1RJTA 1A62A 1EFID 1PTOF 1S40A 3HOWH 2MJ8A 2NUCA 4P71A 1PRTB 4ZUJA 4R4CA 4LUOA 1NY4A 2MHVA 1E0BA 1NJIC 2B2VA 4X65Q 1F77A 5JVH3 1BDOA 4M8AA 3DWQA 1BCPC 2KVMA 3K5NA 1BOSA 5CBAE 4DV2L 3TZDA 3GTMB 4IALA 4DUZQ 4KTAA 1G8ZD 1PZKD 4JBJA 1A3UA 1JB3A 1U4PA 3C1FA 3EBEA 1XYIA 4IN3A 1J6QA 4N9TA 3PF5A 4X3UA 3HOVG 1VQ6A 1SJHD 2FJ2A 3ITPA 1PA6A 2ICIA 4NP5A 4QY7A 2RDGA 4KHZA 3WOFA 4JPBW 5H1SE 1KRSA 4QGUA 3OPOA 2EYPA 2R92H 4R8IA 3CCEA 3DMUA 1V1OA 4JC0A 4APVA 2E2IB 1S4ZA 1IBLL 1KD1C 3SE0A 2FHTA 1RF2D 3Q24A 2V1CC 4GS3A 5ELFA 2N78A 1AFPA 5JAVA 4YHHQ 2BE5D 5LMUL 2F0JA 1PTOD 4ODGA 3OOCA 4IO9A 4JI7L 1PH3A 3CF5A 4LUZA 5M5WH 1QCBD 3VR6A 2K01A 2XRSD 4LF4Q 4LF5L 1HZBA 4DV2Q 1HCZA 3K7UC 3K7AH 3I4MB 5BR8L 5C44H 2ZJPA 1K0RA 1VQOA 4ZK9B 3LWUA 5EPJA 1N9WA 1YJ9A 4E6IA 5NUCA 4DV5L 1JWMD 3CXCA 4KD3A 5C6AA 3PF4A 1YIJA 5JJZA 5C4JH 4O0AA 2VNUD 3CRKC 1JR0D 2CW0D 3EQLC 4L5RC 3BVGA 1X3EA 2RKSA 1IW7D 2BA0A 3SVMA 4C3IG 2HQEA
chains in the Genus database with same CATH topology
1YEZA 4B3MQ 3CW2C 4IJLA 3HOUH 4A3LG 1SFOH 2OCEA 3S1QH 2B3GA 4OONA 2QA4A 1E3PA 2F4VQ 1Q8KA 3E9IA 1N36Q 1VQPA 2OTLA 3AFPA 4JI5Q 2E8GA 2RHSB 4TQUS 1P16A 1JE5A 4JI1L 4JYAQ 1GKHA 1HZAA 5M3MH 1PYBA 1HR0L 4GNXB 4JBKA 3K81C 2JEAI 1K73C 2YV5A 3H3VH 4A93H 4A3FH 3RZDH 2K50A 3J81j 2VQFQ 3S1RH 2A19A 3E9HA 4A3GG 3JAMi 3CP0A 3CPWA 1WCMG 2IT1A 1YZ6A 3CCMA 1W3SA 1X65A 1Y1WG 1VQ8A 4BY1H 4P74A 4HIMA 1PYSB 2JA8G 4X62L 2JJQA 1L0WA 3RR5A 5LMNL 4B3SL 3ERSX 4PG3A 1XNRQ 5C3EG 3GTOH 1A0IA 3PUWA 3A0JA 2VUMH 4OX9Q 4YHHL 4DV5Q 4AH6A 2I5MX 3I56A 4A4IA 2QEXA 1LM0A 4DR3Q 2N8NA 2NVQH 4JOIA 3HOYG 4JV5L 1D8LA 4WJ4A 4K0KQ 1ASZA 2VL6A 5IWAL 3M3YH 1N32Q 1SE8A 2Z0SA 4AQYL 4P75A 1HNZL 3S17H 4DV6L 3FHWA 1Q1EA 4LF4L 1HZ9A 2NVTH 3NELA 1JT8A 4EQ5A 1JJ2A 4DR4Q 2AWOA 1I6HH 1EIYB 3D31A 2JA9A 4GOPA 2K5HA 3W1GA 2K52A 2NZHA 2IX0A 4DUYQ 3KYHC 1HH2P 1PVOA 2MO0A 1QVCA 4QQBX 4JI0Q 4JI4Q 3M9BA 1YITA 2UU9L 3ZJYC 4LFAQ 1XJVA 2JA5G 4LF7Q 1B70B 1VQEA 2AMCB 2K5NA 5C0XI 5C44G 4HIKA 3PO2G 2GN5A 4A3CG 2HHHL 1CUKA 5ELOA 3GTMH 4GN4B 4X64Q 1KAWA 3H0GH 5C4XG 4JBWA 3CCSA 4A3DG 2JEBI 5E7NA 3E0EA 1PH7A 2R7DA 4PZ6A 3UDGA 1YJWA 3KDFB 4UP7A 1Q1BA 3U4ZA 1NTGA 4GNXC 2UUAL 1OXXK 1AE2A 3J81i 1GD7A 1IXRA 1VCIA 3A74A 3U58A 3S14H 1ASYA 2LSSA 2VS1A 4IFDJ 3ULLA 2VY3A 1Z9FA 1I50H 4BBRG 2ZM6L 3B6YA 2ZTEA 3STBD 2ALYB 1XTDA 3L0OA 4R4QA 1VQ4A 1EQRA 4NXNL 4DAYB 2VW9A 1YJNA 1I94Q 3AFQA 2CWPA 3EN2A 4B3ML 3OTOQ 2NVXH 1EYGA 1X55A 4JG2A 1G51A 2YTVA 4BA2I 2F4VL 1N36L 2E2IH 3OW2A 1SROA 5GAEC 2GVBA 2E2HH 4MNOA 4GN3B 4UP9A 1QZHA 4AQYQ 1PH8A 5IE8A 1HNZQ 4JI6Q 1UWVA 3BU2A 4A3BG 3I4NG 3GD7A 1S3OA 2JA7G 2AWNA 3PGZA 2VQFL 1OXUA 2UXDQ 1QUQA 2NN6G 5M3MG 5JEAG 1EWIA 3G4SA 3M4QA 4DR1Q 4A93G 1K83H 4DV1Q 1PFSA 1N8RC 2UU9Q 1XNRL 4LNQA 2RCNA 3KF6B 1PH1A 1N34Q 1GVPA 2R93G 4X66Q 2I5LX 5IYCH 3PUZA 3DLLA 3BZCA 1KHIA 1UEBA 1VQ9A 2HHHQ 2ES2A 4OX9L 4C3JH 3J7A5 1XMOL 3I4MH 5JJLA 4DR3L 1TWFH 3G6EA 1T9HA 3WWVA 4ALPA 1OXVA 1Q86C 3PV0A 4A3MG 4K0KL 2I5HA 2JQOA 2VUMG 4DV3Q 2ZTDA 1WFQA 5DLQE 4WJ3M 3HOWG 1Y1VG 1N32L 3G48A 2F3IA 3F2DA 2IHFA 3UE0A 3CC2A 1TWHH 4DV4L 4LW1A 4IFDG 1I3QH 4QJFA 3TREA 1DGSA 4MTNA 1E1OA 4QL5A 4DR4L 3HOXG 1EIFA 1IBKQ 1C0AA 4TVAB 2IX1A 4YWLA 4DUYL 5GADC 1KC8C 4A3KG 3OYYA 2KCTA 4JI4L 1Q82C 2NN6I 3L7ZC 2YU9H 4DR7Q 2QGQA 4LFAL 2R7FA 4LF7L 1KXLA 3F1ZA 1NMGA 1I5FA 1L1OB 1VQ7A 2B29A 1E1TA 4PZ7A 4BY7H 3M4OH 4YCVA 4OO1G 4KI0A 4DKAC 4X64L 1XPOA 1IYJB 3CAMA 1PH9A 1RIPA 3Q8DA 4A76A 3K0XA 4POFA 4OWWB 4OWXB 4GLXA 4L5SA 1K9MC 3S2DH 3F8TA 3HFZB 1OXSC 2PQAB 5IYBH 4Y7NH 3PIPA 3CMAA 4BXXH 4YWMA 3ICEA 2KCMA 2JA6G 2PMZE 3F2CA 3PO3H 1SMXA 4Y52H 4LWCA 4LF6Q 5M3FH 4GKJQ 1BBWA 1CSPA 1Q46A 1X3FA 2D0PA 3ULPA 3VDYA 2B63H 1CKNB 4IFDI 3KF8B 1E22A 1YNXA 2D0OA 4DV0Q 1C7YA 2R92G 3S2HH 3TS0A 2CWAA 4DV7Q 1BKBA 1YHBA 1M1KC 1I94L 3TRZA 3T1YQ 1X54A 2XGTA 3OTOL 1HNXQ 4LFCL 1K3RA 1SN8A 5J3BA 1XMOQ 4UPAA 4IOCA 1PH5A 1X6OA 3UDXA 5FLMH 3RN2A 1E24A 4J15A 2EQSA 3S24A 5IP9G 1Y14B 3J80i 3G71A 2BH8A 2WAQE 4JI6L 2WAQG 1EOVA 2JK8A 4DV4Q 3W1BA 4HIOA 2K75A 1FGUA 3ER0A 4HJ7A 2UXDL 3I55A 2R7ZH 4DNIA 1PH2A 1YHAA 4JI8Q 4HJ9A 1HZCA 2E5LQ 3J7ZC 1WJJA 5JEAJ 1G291 1NE3A 4DR1L 1VQ5A 4JBMA 4DV1L 1VQJA 2AHOB 3CCVA 1N34L 3EIVA 1L1OC 2FXQA 1EQQA 4X66L 3RN5A 2ZJQA 4LF9Q 3CQZH 3KFUA 3AYHB 5HY6A 3BJUA 3CCJA 2IHEA 2D62A 4RG1A 1J5EL 3CC7A 5IYDH 2PNHA 2MFIA 5IT9c 4NPSA 4DV3L 4R4IA 4C3IH 1EUJA 3I2ZA 1C9OA 4A3LH 4LF8L 2HIXA 3IRBA 3CC4A 4ME3A 1O7IA 3HKSA 2GVAA 3PUXA 4A3IG 4BBSH 4IPCA 4JI3Q 1IBKL 4L5QA 5GQOA 3CMEA 4GNXA 1JB7A 3H15A 1X9NA 4EX5A 2VQEL 2MQHA 4A3EH 3SGIA 1M90C 4DR7L 1MJEA 2EIFA 4O2DA 2WFWA 4R4TA 3I7FA 2A1AA 5HGQA 1U0LA 1LYLA 4LFCQ 4HJ8A 1VQMA 4DK3C 3K80C 3GTGH 4NXMQ 1JJCB 4A3GH 4P73A 1WCMH 1KIXA 4X6AH 4B3TQ 5EAYA 2JA8H 3HOUG 1VQLA 1VQHA 1W2BA 1XNQL 4BY7G 4B3RL 4YY3Q 1S72A 2UXCL 5C3EH 1GM5A 2OTJA 4RMFA 5K36G 2DGYA 2ZJRA 3M7NA 1SLJA 1D7QA 4DR5Q 2KHIA 1X56A 3FP9A 4LF6L 4GKJL 2HQLA 3GTKH 1X3GA 2YTXA 4A3JH 4A3FG 2OQKA 5M5YH 4YCWA 5IP7H 4L5TA 2MNAA 4DV0L 3PO3G 3M85A 2C35B 1L2FA 2Q2HA 4JI2Q 4DV7L 4BY1G 1OTCA 4HIDA 4QIWE 3T1YL 2B63G 1HNXL 1MIUA 1TWGH 1J5EQ 2BA1A 1HNWL 4XTCS 4UY8C 4PMWA 3TS2A 3FKIH 4YCUA 2BH2A 2JA5H 3KOJA 1LTLA 3PO2H 1FJGQ 4FDBA 4LFBL 2ZTCA 2I0QA 1BBUA 1V43A 3KDFA 1XMQQ 4R1JA 2XTIA 3PCOB 2HIVA 1TXYA 4JI8L 2Z6KC 4A3DH 2WB1E 1QVFA 3HOVH 1TWAH 2E5LL 4UP8A 4OXPA 4NB3A 2VQEQ 1NBWA 2PI2A 1P8LA 3JAMc 1YI2A 3STBC 3S1NH 1MKHA 3S1MH 1CKMA 2ID0A 2R7ZG 1VQKA 1VS0A 3PIOA 4IPHA 3HOZH 4GKKQ 3H3VI 2WP8J 4JI0L 1VQAA 4LF9L 3MXNB 3W5OA 2K14A 4R4OA 4GOPB 2R6GA 2R93H 2UUBQ 2H5XA 3M4PA 3UDFA 3RNUA 3GTPH 1CSQA 1PHJA 1XNQQ 3AEVA 1Q12A 3CD6A 3GTJH 1K8AC 1FL0A 4DPGA 4B3RQ 4XIGS 2UXCQ 2YTYA 4DK6C 1PH4A 2KENA 3H0GG 2N49A 3NENA 4GLVB 4AIMA 4GLAC 1UE5A 1A8VA 2UUCQ 5AJ3Q 1IBLQ 2ASBA 2RF4A 4KHPQ 4DUZL 1VQBA 1LUZA 4JI3L 2Y0SE 2Y0SG 2DUDA 4DR2Q 4C2MH 2LXJA 5LMUQ 1FVIA 1OXTA 2OQ0A 1NMFA 1WOCA 4A3BH 4IJHA 3UE1A 4LUVA 3I4NH 4BBSG 2CKZB 2Q2IA 4HJAA 1QZGA 2JA7H 1AE3A 4JI7Q 1V1QA 4A3EG 5GAGC 4NXML 5FJ8H 1HNWQ 1UE7A 1YBYA 2PI2E 3KF6A 2Q2UA 4B3TL 4DR6Q 5M5XH 4LF5Q 1MJCA 4OO1I 3PUVA 2KBNA 1VQGA 4YY3L 5BR8Q 2A8VA 4LFBQ 4AYBE 4AYBG 5C0XG 3T1HL 4A75A 1V9PA 1U5KA 1GO3E 4H02A 2VZAA 3KJPA 4JOIC 1N33Q 2UXBQ 1VQIA 3J81c 4DR5L 1VQNA 3K8AA 1H95A 1HJPA 3CPFA 1A62A 1UE6A 4GN5A 1S40A 1Y1VH 3HOWH 4P71A 1HR0W 2K5VA 4JI2L 4R4CA 4LUOA 4A3JG 1NY4A 1QUQB 3TEHB 2N3SA 4GOPC 4X65Q 1NJIC 2CCZA 5IP7G 3ULJA 1IBMQ 3HOXH 4PZ8A 4C3HH 3I4OA 5FLXc 3A5UA 1K8GA 5IYCG 1QVGA 3DM3A 1L1OA 4A3KH 4IOAA 5LMNW 4DV2L 3I4MG 2MO1A 4A3MH 3PSIA 1FJGL 4YWKA 1PV4A 1SR3A 4DUZQ 1XMQL 3FKIG 4LF8Q 3KJOA 4HJ5A 3S15H 1B7YB 3CCUA 2F52A 2PQAA 1WYDA 4JBJA 2CFMA 3RLOA 1RL2A 1TWCH 3EBEA 1CKOA 1J6QA 3PF5A 4POGA 4GKKL 3HOVG 1VQ6A 5ELNA 3L2PA 4P72A 2JA6H 1CKNA 4JI1Q 4QY7A 1PA6A 5JJKA 4KHZA 3RLNA 2UUBL 2EXDA 1VQFA 2NVYH 2JE6I 5H1SE 1KRSA 4QGUA 1Y1WH 1HR0Q 3HOZG 2R92H 4IPGA 3CCEA 4BA1I 1SRUA 4JC0A 4APVA 3T1HQ 2UUCL 1YVCA 5GAHC 4IPDA 5AJ3L 4X62Q 1IBLL 4KLKA 1YHQA 1KD1C 5LMNQ 4B3SQ 4KHPL 3D0FA 4JCVE 3HOYH 5IYBG 1PH6A 3RZOH 2V1CC 1B8AA 4GS3A 1KRTA 4BXXG 2N78A 2RHQB 5IP9H 4YHHQ 4DR2L 5LMUL 1VQCA 5M3FG 4JV5Q 3GDEA 4JI5L 3GTLH 2HT1A 3CCQA 1G6PA 2ATWA 5IWAQ 2KHJA 3U50C 4IO9A 4JI7L 4OWTB 1JMCA 3NEMA 1PH3A 3CF5A 4LUZA 1R9TH 3LGJA 5M5WH 4JYAL 3TQYA 4DV6Q 1KQSA 4LF4Q 4DR6L 1JJGA 4LF5L 1HZBA 4DV2Q 1Z47A 3K7UC 4DAMA 3K7AH 1IL2A 5FLMG 5BR8L 5FJ8G 5C44H 1Q81C 4A3CH 2ZJPA 1K0RA 3NBHB 1VQOA 3MEFA 3F2BA 3GTQH 1EFWA 1N33L 2UXBL 1E7ZA 1N9WA 5C4XH 5C0XJ 2AKWB 5GROA 1YJ9A 2WB1G 5IY0A 2L15A 1IZ6A 3S16H 3UDIA 2LXKA 2NZOA 4DV5L 2OWOA 1A63A 3BZKA 2E2JH 1XPUA 2Z6KA 3CCRA 4X65L 3GO5A 2UUAQ 2YYZA 3RLFA 3AQQA 3KLWA 3CXCA 4A3IH 1IBML 3PF4A 1AH9A 2Q2TA 1YIJA 3U4VA 4BBRH 5C4JH 4O0AA 2VNUD 1BVSA 1VQDA 1KL9A 1XPRA 3A5ZB 1UE1A 2K4KA 1Q7YC 5JJIA 4L5RC 2IY5B 1X3EA 5IYDG 2BA0A 2ZM6Q 2CQOA 1WI5A 3PUYA 3J80c 3HKZE 3HKZG 3JC66 3CCLA 4MZ9A 4NXNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEZ A;  4B3M Q;  3CW2 C;  4IJL A;  3HOU H;  4A3L G;  1SFO H;  2OCE A;  3S1Q H;  2B3G A;  4OON A;  2QA4 A;  1E3P A;  2F4V Q;  1Q8K A;  3E9I A;  1N36 Q;  1VQP A;  2OTL A;  3AFP A;  4JI5 Q;  2E8G A;  2RHS B;  4TQU S;  1P16 A;  1JE5 A;  4JI1 L;  4JYA Q;  1GKH A;  1HZA A;  5M3M H;  1PYB A;  1HR0 L;  4GNX B;  4JBK A;  3K81 C;  2JEA I;  1K73 C;  2YV5 A;  3H3V H;  4A93 H;  4A3F H;  3RZD H;  2K50 A;  3J81 j;  2VQF Q;  3S1R H;  2A19 A;  3E9H A;  4A3G G;  3JAM i;  3CP0 A;  3CPW A;  1WCM G;  2IT1 A;  1YZ6 A;  3CCM A;  1W3S A;  1X65 A;  1Y1W G;  1VQ8 A;  4BY1 H;  4P74 A;  4HIM A;  1PYS B;  2JA8 G;  4X62 L;  2JJQ A;  1L0W A;  3RR5 A;  5LMN L;  4B3S L;  3ERS X;  4PG3 A;  1XNR Q;  5C3E G;  3GTO H;  1A0I A;  3PUW A;  3A0J A;  2VUM H;  4OX9 Q;  4YHH L;  4DV5 Q;  4AH6 A;  2I5M X;  3I56 A;  4A4I A;  2QEX A;  1LM0 A;  4DR3 Q;  2N8N A;  2NVQ H;  4JOI A;  3HOY G;  4JV5 L;  1D8L A;  4WJ4 A;  4K0K Q;  1ASZ A;  2VL6 A;  5IWA L;  3M3Y H;  1N32 Q;  1SE8 A;  2Z0S A;  4AQY L;  4P75 A;  1HNZ L;  3S17 H;  4DV6 L;  3FHW A;  1Q1E A;  4LF4 L;  1HZ9 A;  2NVT H;  3NEL A;  1JT8 A;  4EQ5 A;  1JJ2 A;  4DR4 Q;  2AWO A;  1I6H H;  1EIY B;  3D31 A;  2JA9 A;  4GOP A;  2K5H A;  3W1G A;  2K52 A;  2NZH A;  2IX0 A;  4DUY Q;  3KYH C;  1HH2 P;  1PVO A;  2MO0 A;  1QVC A;  4QQB X;  4JI0 Q;  4JI4 Q;  3M9B A;  1YIT A;  2UU9 L;  3ZJY C;  4LFA Q;  1XJV A;  2JA5 G;  4LF7 Q;  1B70 B;  1VQE A;  2AMC B;  2K5N A;  5C0X I;  5C44 G;  4HIK A;  3PO2 G;  2GN5 A;  4A3C G;  2HHH L;  1CUK A;  5ELO A;  3GTM H;  4GN4 B;  4X64 Q;  1KAW A;  3H0G H;  5C4X G;  4JBW A;  3CCS A;  4A3D G;  2JEB I;  5E7N A;  3E0E A;  1PH7 A;  2R7D A;  4PZ6 A;  3UDG A;  1YJW A;  3KDF B;  4UP7 A;  1Q1B A;  3U4Z A;  1NTG A;  4GNX C;  2UUA L;  1OXX K;  1AE2 A;  3J81 i;  1GD7 A;  1IXR A;  1VCI A;  3A74 A;  3U58 A;  3S14 H;  1ASY A;  2LSS A;  2VS1 A;  4IFD J;  3ULL A;  2VY3 A;  1Z9F A;  1I50 H;  4BBR G;  2ZM6 L;  3B6Y A;  2ZTE A;  3STB D;  2ALY B;  1XTD A;  3L0O A;  4R4Q A;  1VQ4 A;  1EQR A;  4NXN L;  4DAY B;  2VW9 A;  1YJN A;  1I94 Q;  3AFQ A;  2CWP A;  3EN2 A;  4B3M L;  3OTO Q;  2NVX H;  1EYG A;  1X55 A;  4JG2 A;  1G51 A;  2YTV A;  4BA2 I;  2F4V L;  1N36 L;  2E2I H;  3OW2 A;  1SRO A;  5GAE C;  2GVB A;  2E2H H;  4MNO A;  4GN3 B;  4UP9 A;  1QZH A;  4AQY Q;  1PH8 A;  5IE8 A;  1HNZ Q;  4JI6 Q;  1UWV A;  3BU2 A;  4A3B G;  3I4N G;  3GD7 A;  1S3O A;  2JA7 G;  2AWN A;  3PGZ A;  2VQF L;  1OXU A;  2UXD Q;  1QUQ A;  2NN6 G;  5M3M G;  5JEA G;  1EWI A;  3G4S A;  3M4Q A;  4DR1 Q;  4A93 G;  1K83 H;  4DV1 Q;  1PFS A;  1N8R C;  2UU9 Q;  1XNR L;  4LNQ A;  2RCN A;  3KF6 B;  1PH1 A;  1N34 Q;  1GVP A;  2R93 G;  4X66 Q;  2I5L X;  5IYC H;  3PUZ A;  3DLL A;  3BZC A;  1KHI A;  1UEB A;  1VQ9 A;  2HHH Q;  2ES2 A;  4OX9 L;  4C3J H;  3J7A 5;  1XMO L;  3I4M H;  5JJL A;  4DR3 L;  1TWF H;  3G6E A;  1T9H A;  3WWV A;  4ALP A;  1OXV A;  1Q86 C;  3PV0 A;  4A3M G;  4K0K L;  2I5H A;  2JQO A;  2VUM G;  4DV3 Q;  2ZTD A;  1WFQ A;  5DLQ E;  4WJ3 M;  3HOW G;  1Y1V G;  1N32 L;  3G48 A;  2F3I A;  3F2D A;  2IHF A;  3UE0 A;  3CC2 A;  1TWH H;  4DV4 L;  4LW1 A;  4IFD G;  1I3Q H;  4QJF A;  3TRE A;  1DGS A;  4MTN A;  1E1O A;  4QL5 A;  4DR4 L;  3HOX G;  1EIF A;  1IBK Q;  1C0A A;  4TVA B;  2IX1 A;  4YWL A;  4DUY L;  5GAD C;  1KC8 C;  4A3K G;  3OYY A;  2KCT A;  4JI4 L;  1Q82 C;  2NN6 I;  3L7Z C;  2YU9 H;  4DR7 Q;  2QGQ A;  4LFA L;  2R7F A;  4LF7 L;  1KXL A;  3F1Z A;  1NMG A;  1I5F A;  1L1O B;  1VQ7 A;  2B29 A;  1E1T A;  4PZ7 A;  4BY7 H;  3M4O H;  4YCV A;  4OO1 G;  4KI0 A;  4DKA C;  4X64 L;  1XPO A;  1IYJ B;  3CAM A;  1PH9 A;  1RIP A;  3Q8D A;  4A76 A;  3K0X A;  4POF A;  4OWW B;  4OWX B;  4GLX A;  4L5S A;  1K9M C;  3S2D H;  3F8T A;  3HFZ B;  1OXS C;  2PQA B;  5IYB H;  4Y7N H;  3PIP A;  3CMA A;  4BXX H;  4YWM A;  3ICE A;  2KCM A;  2JA6 G;  2PMZ E;  3F2C A;  3PO3 H;  1SMX A;  4Y52 H;  4LWC A;  4LF6 Q;  5M3F H;  4GKJ Q;  1BBW A;  1CSP A;  1Q46 A;  1X3F A;  2D0P A;  3ULP A;  3VDY A;  2B63 H;  1CKN B;  4IFD I;  3KF8 B;  1E22 A;  1YNX A;  2D0O A;  4DV0 Q;  1C7Y A;  2R92 G;  3S2H H;  3TS0 A;  2CWA A;  4DV7 Q;  1BKB A;  1YHB A;  1M1K C;  1I94 L;  3TRZ A;  3T1Y Q;  1X54 A;  2XGT A;  3OTO L;  1HNX Q;  4LFC L;  1K3R A;  1SN8 A;  5J3B A;  1XMO Q;  4UPA A;  4IOC A;  1PH5 A;  1X6O A;  3UDX A;  5FLM H;  3RN2 A;  1E24 A;  4J15 A;  2EQS A;  3S24 A;  5IP9 G;  1Y14 B;  3J80 i;  3G71 A;  2BH8 A;  2WAQ E;  4JI6 L;  2WAQ G;  1EOV A;  2JK8 A;  4DV4 Q;  3W1B A;  4HIO A;  2K75 A;  1FGU A;  3ER0 A;  4HJ7 A;  2UXD L;  3I55 A;  2R7Z H;  4DNI A;  1PH2 A;  1YHA A;  4JI8 Q;  4HJ9 A;  1HZC A;  2E5L Q;  3J7Z C;  1WJJ A;  5JEA J;  1G29 1;  1NE3 A;  4DR1 L;  1VQ5 A;  4JBM A;  4DV1 L;  1VQJ A;  2AHO B;  3CCV A;  1N34 L;  3EIV A;  1L1O C;  2FXQ A;  1EQQ A;  4X66 L;  3RN5 A;  2ZJQ A;  4LF9 Q;  3CQZ H;  3KFU A;  3AYH B;  5HY6 A;  3BJU A;  3CCJ A;  2IHE A;  2D62 A;  4RG1 A;  1J5E L;  3CC7 A;  5IYD H;  2PNH A;  2MFI A;  5IT9 c;  4NPS A;  4DV3 L;  4R4I A;  4C3I H;  1EUJ A;  3I2Z A;  1C9O A;  4A3L H;  4LF8 L;  2HIX A;  3IRB A;  3CC4 A;  4ME3 A;  1O7I A;  3HKS A;  2GVA A;  3PUX A;  4A3I G;  4BBS H;  4IPC A;  4JI3 Q;  1IBK L;  4L5Q A;  5GQO A;  3CME A;  4GNX A;  1JB7 A;  3H15 A;  1X9N A;  4EX5 A;  2VQE L;  2MQH A;  4A3E H;  3SGI A;  1M90 C;  4DR7 L;  1MJE A;  2EIF A;  4O2D A;  2WFW A;  4R4T A;  3I7F A;  2A1A A;  5HGQ A;  1U0L A;  1LYL A;  4LFC Q;  4HJ8 A;  1VQM A;  4DK3 C;  3K80 C;  3GTG H;  4NXM Q;  1JJC B;  4A3G H;  4P73 A;  1WCM H;  1KIX A;  4X6A H;  4B3T Q;  5EAY A;  2JA8 H;  3HOU G;  1VQL A;  1VQH A;  1W2B A;  1XNQ L;  4BY7 G;  4B3R L;  4YY3 Q;  1S72 A;  2UXC L;  5C3E H;  1GM5 A;  2OTJ A;  4RMF A;  5K36 G;  2DGY A;  2ZJR A;  3M7N A;  1SLJ A;  1D7Q A;  4DR5 Q;  2KHI A;  1X56 A;  3FP9 A;  4LF6 L;  4GKJ L;  2HQL A;  3GTK H;  1X3G A;  2YTX A;  4A3J H;  4A3F G;  2OQK A;  5M5Y H;  4YCW A;  5IP7 H;  4L5T A;  2MNA A;  4DV0 L;  3PO3 G;  3M85 A;  2C35 B;  1L2F A;  2Q2H A;  4JI2 Q;  4DV7 L;  4BY1 G;  1OTC A;  4HID A;  4QIW E;  3T1Y L;  2B63 G;  1HNX L;  1MIU A;  1TWG H;  1J5E Q;  2BA1 A;  1HNW L;  4XTC S;  4UY8 C;  4PMW A;  3TS2 A;  3FKI H;  4YCU A;  2BH2 A;  2JA5 H;  3KOJ A;  1LTL A;  3PO2 H;  1FJG Q;  4FDB A;  4LFB L;  2ZTC A;  2I0Q A;  1BBU A;  1V43 A;  3KDF A;  1XMQ Q;  4R1J A;  2XTI A;  3PCO B;  2HIV A;  1TXY A;  4JI8 L;  2Z6K C;  4A3D H;  2WB1 E;  1QVF A;  3HOV H;  1TWA H;  2E5L L;  4UP8 A;  4OXP A;  4NB3 A;  2VQE Q;  1NBW A;  2PI2 A;  1P8L A;  3JAM c;  1YI2 A;  3STB C;  3S1N H;  1MKH A;  3S1M H;  1CKM A;  2ID0 A;  2R7Z G;  1VQK A;  1VS0 A;  3PIO A;  4IPH A;  3HOZ H;  4GKK Q;  3H3V I;  2WP8 J;  4JI0 L;  1VQA A;  4LF9 L;  3MXN B;  3W5O A;  2K14 A;  4R4O A;  4GOP B;  2R6G A;  2R93 H;  2UUB Q;  2H5X A;  3M4P A;  3UDF A;  3RNU A;  3GTP H;  1CSQ A;  1PHJ A;  1XNQ Q;  3AEV A;  1Q12 A;  3CD6 A;  3GTJ H;  1K8A C;  1FL0 A;  4DPG A;  4B3R Q;  4XIG S;  2UXC Q;  2YTY A;  4DK6 C;  1PH4 A;  2KEN A;  3H0G G;  2N49 A;  3NEN A;  4GLV B;  4AIM A;  4GLA C;  1UE5 A;  1A8V A;  2UUC Q;  5AJ3 Q;  1IBL Q;  2ASB A;  2RF4 A;  4KHP Q;  4DUZ L;  1VQB A;  1LUZ A;  4JI3 L;  2Y0S E;  2Y0S G;  2DUD A;  4DR2 Q;  4C2M H;  2LXJ A;  5LMU Q;  1FVI A;  1OXT A;  2OQ0 A;  1NMF A;  1WOC A;  4A3B H;  4IJH A;  3UE1 A;  4LUV A;  3I4N H;  4BBS G;  2CKZ B;  2Q2I A;  4HJA A;  1QZG A;  2JA7 H;  1AE3 A;  4JI7 Q;  1V1Q A;  4A3E G;  5GAG C;  4NXM L;  5FJ8 H;  1HNW Q;  1UE7 A;  1YBY A;  2PI2 E;  3KF6 A;  2Q2U A;  4B3T L;  4DR6 Q;  5M5X H;  4LF5 Q;  1MJC A;  4OO1 I;  3PUV A;  2KBN A;  1VQG A;  4YY3 L;  5BR8 Q;  2A8V A;  4LFB Q;  4AYB E;  4AYB G;  5C0X G;  3T1H L;  4A75 A;  1V9P A;  1U5K A;  1GO3 E;  4H02 A;  2VZA A;  3KJP A;  4JOI C;  1N33 Q;  2UXB Q;  1VQI A;  3J81 c;  4DR5 L;  1VQN A;  3K8A A;  1H95 A;  1HJP A;  3CPF A;  1A62 A;  1UE6 A;  4GN5 A;  1S40 A;  1Y1V H;  3HOW H;  4P71 A;  1HR0 W;  2K5V A;  4JI2 L;  4R4C A;  4LUO A;  4A3J G;  1NY4 A;  1QUQ B;  3TEH B;  2N3S A;  4GOP C;  4X65 Q;  1NJI C;  2CCZ A;  5IP7 G;  3ULJ A;  1IBM Q;  3HOX H;  4PZ8 A;  4C3H H;  3I4O A;  5FLX c;  3A5U A;  1K8G A;  5IYC G;  1QVG A;  3DM3 A;  1L1O A;  4A3K H;  4IOA A;  5LMN W;  4DV2 L;  3I4M G;  2MO1 A;  4A3M H;  3PSI A;  1FJG L;  4YWK A;  1PV4 A;  1SR3 A;  4DUZ Q;  1XMQ L;  3FKI G;  4LF8 Q;  3KJO A;  4HJ5 A;  3S15 H;  1B7Y B;  3CCU A;  2F52 A;  2PQA A;  1WYD A;  4JBJ A;  2CFM A;  3RLO A;  1RL2 A;  1TWC H;  3EBE A;  1CKO A;  1J6Q A;  3PF5 A;  4POG A;  4GKK L;  3HOV G;  1VQ6 A;  5ELN A;  3L2P A;  4P72 A;  2JA6 H;  1CKN A;  4JI1 Q;  4QY7 A;  1PA6 A;  5JJK A;  4KHZ A;  3RLN A;  2UUB L;  2EXD A;  1VQF A;  2NVY H;  2JE6 I;  5H1S E;  1KRS A;  4QGU A;  1Y1W H;  1HR0 Q;  3HOZ G;  2R92 H;  4IPG A;  3CCE A;  4BA1 I;  1SRU A;  4JC0 A;  4APV A;  3T1H Q;  2UUC L;  1YVC A;  5GAH C;  4IPD A;  5AJ3 L;  4X62 Q;  1IBL L;  4KLK A;  1YHQ A;  1KD1 C;  5LMN Q;  4B3S Q;  4KHP L;  3D0F A;  4JCV E;  3HOY H;  5IYB G;  1PH6 A;  3RZO H;  2V1C C;  1B8A A;  4GS3 A;  1KRT A;  4BXX G;  2N78 A;  2RHQ B;  5IP9 H;  4YHH Q;  4DR2 L;  5LMU L;  1VQC A;  5M3F G;  4JV5 Q;  3GDE A;  4JI5 L;  3GTL H;  2HT1 A;  3CCQ A;  1G6P A;  2ATW A;  5IWA Q;  2KHJ A;  3U50 C;  4IO9 A;  4JI7 L;  4OWT B;  1JMC A;  3NEM A;  1PH3 A;  3CF5 A;  4LUZ A;  1R9T H;  3LGJ A;  5M5W H;  4JYA L;  3TQY A;  4DV6 Q;  1KQS A;  4LF4 Q;  4DR6 L;  1JJG A;  4LF5 L;  1HZB A;  4DV2 Q;  1Z47 A;  3K7U C;  4DAM A;  3K7A H;  1IL2 A;  5FLM G;  5BR8 L;  5FJ8 G;  5C44 H;  1Q81 C;  4A3C H;  2ZJP A;  1K0R A;  3NBH B;  1VQO A;  3MEF A;  3F2B A;  3GTQ H;  1EFW A;  1N33 L;  2UXB L;  1E7Z A;  1N9W A;  5C4X H;  5C0X J;  2AKW B;  5GRO A;  1YJ9 A;  2WB1 G;  5IY0 A;  2L15 A;  1IZ6 A;  3S16 H;  3UDI A;  2LXK A;  2NZO A;  4DV5 L;  2OWO A;  1A63 A;  3BZK A;  2E2J H;  1XPU A;  2Z6K A;  3CCR A;  4X65 L;  3GO5 A;  2UUA Q;  2YYZ A;  3RLF A;  3AQQ A;  3KLW A;  3CXC A;  4A3I H;  1IBM L;  3PF4 A;  1AH9 A;  2Q2T A;  1YIJ A;  3U4V A;  4BBR H;  5C4J H;  4O0A A;  2VNU D;  1BVS A;  1VQD A;  1KL9 A;  1XPR A;  3A5Z B;  1UE1 A;  2K4K A;  1Q7Y C;  5JJI A;  4L5R C;  2IY5 B;  1X3E A;  5IYD G;  2BA0 A;  2ZM6 Q;  2CQO A;  1WI5 A;  3PUY A;  3J80 c;  3HKZ E;  3HKZ G;  3JC6 6;  3CCL A;  4MZ9 A;  4NXN Q; 
#chains in the Genus database with same CATH topology
 1YEZ A;  4B3M Q;  1XWE A;  1L0Y B;  1JQY D;  4OON A;  1E3P A;  1N36 Q;  2E8G A;  2RHS B;  4TQU S;  1ZYR D;  5CV9 A;  1PFM A;  4JI1 L;  3D3R A;  4K6D A;  1HA5 A;  1K8M A;  1PYB A;  1SND A;  2B2T C;  2YV5 A;  3H3V H;  2K50 A;  2VQF Q;  1VDZ A;  4A3G G;  1KDA A;  2K05 A;  3CPW A;  1YZ6 A;  1X65 A;  4WOR A;  2A68 D;  3ND9 A;  3RR5 A;  1RKN A;  3BDO A;  4X3S A;  1HFN A;  1A0I A;  2VUM H;  1A15 A;  1II3 A;  4DV5 Q;  4AH6 A;  1SYC A;  2N8N A;  2R7Z B;  2NVQ H;  3P7J A;  3MAQ A;  4EVO A;  1DOL A;  2Z0S A;  2FIN B;  1BQQ T;  3FHW A;  1Q1E A;  1EQT A;  5IGB A;  4EQ5 A;  1JJ2 A;  1BF4 A;  3MXN A;  2AWO A;  4DR4 Q;  1EIY B;  3D31 A;  4KY5 A;  2WV6 D;  4GOP A;  2Z6B A;  2CHB D;  2WIN B;  1PVO A;  1HH2 P;  1KLU D;  2MO0 A;  2H1E A;  5TSS A;  3M9B A;  1R4P B;  3ZJY C;  2JA5 G;  3PO2 G;  1VQE A;  2AMC B;  2K5N A;  5C44 G;  1QNK A;  2A6H C;  3GTM H;  4GN4 B;  4BBS B;  1PH7 A;  3RMH A;  4IUP A;  1YJW A;  1U4R A;  2UUA L;  3GP7 A;  3U4Z A;  3JAM E;  1IXR A;  1VCI A;  3A74 A;  5I2X A;  3AU7 A;  1HUN A;  4FYD A;  1SE4 A;  4IFD J;  4KMU C;  2VY3 A;  2DY7 A;  2ZM6 L;  1IKL A;  4RFB A;  3STB D;  3C2P A;  4LMQ D;  3IFD A;  4DAY B;  2VW9 A;  4RGM A;  3AFQ A;  2CWP A;  4CHT B;  1AZQ A;  1X55 A;  1JWS D;  1H9J A;  1GUO A;  5CGK A;  3BZD B;  2E2I H;  4K5W A;  2OT2 A;  4A3J B;  4MNO A;  2DY8 A;  4UP9 A;  1QZH A;  1PH8 A;  3I4N G;  3GD7 A;  1EY0 A;  3MHB A;  2A69 D;  3C3L A;  1B2T A;  1TWG B;  2F3W A;  1EWI A;  3PIP 3;  3L3O C;  4DR1 Q;  1PFS A;  2A6E D;  4H0L C;  1XNR L;  2RCN A;  3KF6 B;  4R8N A;  3D8G A;  1B9N A;  3DLL A;  2ES2 A;  3W2D A;  3J7A 5;  1SBB B;  5IGC A;  1XMO L;  2M00 A;  3I4M H;  3G6E A;  3WWV A;  4ALP A;  4A3D B;  2VUM G;  2ZTD A;  3A8K E;  1WFQ A;  3G48 A;  2F3I A;  3NUC A;  4IFD G;  2E75 C;  2F0G A;  2WAC A;  1DGS A;  1E1O A;  4ILW A;  4QL5 A;  1IYU A;  4TVA B;  1PRT F;  5ISR A;  3GTP B;  1K3B C;  4A3K G;  2EZV A;  3OYY A;  4JI4 L;  1Q82 C;  4LF7 L;  3BDC A;  2O5I C;  1NMG A;  1I5F A;  1VQ7 A;  1E1T A;  2O2L D;  3NXW A;  1CI3 M;  2VXW A;  4KI0 A;  3R93 A;  4DKA C;  1XPO A;  3BVM A;  4DK0 A;  1Q3L A;  3K0X A;  4OWW B;  4GLX A;  4L5S A;  1K9M C;  3F8T A;  5IYB H;  1JOO A;  4YWM A;  2PPB C;  1YNN C;  3NE5 B;  1FR3 A;  1MSG A;  3VR3 A;  4LF6 Q;  1BBW A;  1Q46 A;  5E3F A;  4IFD I;  1CKN B;  1C7Y A;  2D0O A;  2QIL A;  5F2D A;  5M5X B;  4DV7 Q;  5C3X A;  1YHB A;  2L11 A;  3ERO A;  3OTO L;  3NBH A;  4KN4 C;  1K3R A;  3TP5 A;  1XMO Q;  5IGG A;  4IOC A;  1E24 A;  2B2U A;  1D1I A;  3G71 A;  4KY6 A;  2WAQ G;  1EY4 A;  1F9R A;  1QNU A;  1QOH A;  1FGU A;  3ONA B;  4HJ7 A;  3I55 A;  2R7Z H;  2F0M A;  4DNI A;  2B2V C;  1HZC A;  2E5L Q;  1WJJ A;  5JEA J;  1PRT D;  4HCS A;  2AHO B;  2F0I A;  4A3M B;  3EIV A;  2FXQ A;  4X66 L;  2K5Q A;  2Z1C A;  3CCJ A;  2IHE A;  1S5B D;  1NUC A;  5JVG 3;  2J4X A;  3DWP A;  3S15 B;  2A74 C;  4NPS A;  1CM9 A;  3K5O A;  5AFW A;  1JOQ A;  5I6W A;  3IFT A;  4A3L H;  5I2Y A;  4KK7 A;  4LF8 L;  3IRB A;  2JA6 B;  1LTR D;  3PUX A;  4BBS H;  1AP0 A;  4XT3 B;  1Y1W B;  4GNX A;  2J0T D;  1X9N A;  4EX5 A;  1ZEQ X;  2VQE L;  3SGI A;  2X69 A;  4R4T A;  1PMR A;  3I7F A;  5D3D A;  5C0X H;  1SEB D;  3GV6 A;  5G3L D;  2ZXO A;  4YY3 Q;  1STY A;  1S72 A;  2UXC L;  2B39 A;  2ZJR A;  5C4H A;  1QWY A;  3M7N A;  1SLJ A;  3K6O A;  1NR4 A;  3NTH A;  3FP9 A;  5DM6 3;  1R9T B;  4A3J H;  5A35 A;  1UAP A;  5IP7 H;  4DV0 L;  1WTR A;  3EVQ A;  1V1P A;  5L37 A;  1JIC A;  4JI2 Q;  5ELC A;  3QR8 A;  5IGF A;  4LK1 C;  3T1Y L;  1KNA A;  1HNX L;  1MIU A;  1TWG H;  5C4X B;  3AMU A;  4HSV A;  1HNW L;  4UY8 C;  1VF7 A;  2F0L A;  1FJG Q;  1VMC A;  4LFB L;  3Q6S A;  3FEW X;  1V43 A;  2F0P A;  2KEE A;  1XMQ Q;  4R1J A;  2HIV A;  4A3D H;  3TP6 A;  2WB1 E;  2F0W A;  2QDB A;  1HQM C;  2VQE Q;  1YI2 A;  1H9S A;  2R7Z G;  1VQK A;  1VS0 A;  4IPH A;  3T16 A;  1SYB A;  1VQA A;  1BUV T;  1TY2 A;  1Y8P B;  4ZQ3 A;  2PZU A;  3GTP H;  1LTA D;  1PHJ A;  1Q12 A;  3HOU B;  1SFO B;  4KV6 A;  1BCP B;  2UXC Q;  1KDC A;  1PH4 A;  3K5L A;  1LTB D;  3NSW A;  4GLV B;  2WKD A;  1LLR D;  2UUC Q;  1HFG A;  4H7B A;  4KHP Q;  2HDM A;  3EFX D;  5C3W A;  1MD2 D;  4DR2 Q;  1J9O A;  4BBS G;  1NMF A;  2DJG C;  3UE1 A;  4LUV A;  2R93 B;  4HJA A;  4BY1 B;  3MWY W;  1TS5 A;  1MBY A;  1O7Z A;  1TII D;  3QOL A;  1HNW Q;  3VR2 A;  2L5T A;  4B3T L;  4DR6 Q;  4L8J A;  5M5X H;  4K2L A;  4OO1 I;  2K04 A;  4LFB Q;  5C0X G;  3T1H L;  4A75 A;  1V9P A;  3KJP A;  1N33 Q;  5M9O A;  4LJZ C;  1EZ6 A;  3J81 c;  4MN3 A;  1VQN A;  1EWC A;  1SNO A;  5ELE A;  1DOM A;  3K8A A;  4HTH A;  3S17 B;  2M2L A;  3CPF A;  4GN5 A;  2N88 A;  5E1F A;  1I6H B;  1HR0 W;  2K5V A;  4A3J G;  3KLS X;  5KGU A;  1QUQ B;  4GOP C;  2CCZ A;  5IP7 G;  3H91 A;  3ULJ A;  1IBM Q;  1TY0 A;  5FLX c;  4EQO A;  1I6V C;  3TP7 A;  1QVG A;  5LMN W;  4C3J G;  3A8I E;  4A3M H;  2K5D A;  3H0G B;  1SSO A;  3TZU A;  3I90 A;  4HMI A;  1PV4 A;  1UUP A;  3KJO A;  4HJ5 A;  3S15 H;  1B7Y B;  2RSO A;  3CCU A;  3RLO A;  1CKO A;  2XWJ B;  4DN4 M;  3L2P A;  4P72 A;  2JA6 H;  3VR5 A;  3G6J B;  4J1M A;  2UUB L;  2EXD A;  1Y1W H;  1HR0 Q;  2JE6 I;  2R61 A;  1S5C D;  4FF1 A;  2NVX B;  4IPG A;  3TBI B;  5K5P A;  1SRU A;  3T1H Q;  5FO7 B;  1RD9 D;  3DEP A;  4OEL B;  5GAH C;  4KLK A;  1YHQ A;  2QW7 A;  5CR3 A;  5LMN Q;  3D0F A;  4ZAI A;  4BXX G;  1B8A A;  3X3M A;  2KHS A;  2RHQ B;  5IP9 H;  2ZXP A;  1VQC A;  4JI5 L;  1M8A A;  2HT1 A;  2SOB A;  2KHJ A;  3U50 C;  4CJ2 C;  1R9T H;  3LGJ A;  3TQY A;  1Y8O B;  1Z47 A;  4A3C H;  2UXB L;  1E7Z A;  5C4X H;  2AKW B;  2E74 C;  3FKI B;  1KAB A;  1EY9 A;  1IZ6 A;  1DJR D;  3UDI A;  3T13 A;  1I3Q B;  2NB0 A;  1HHV A;  1PLF A;  2KJX A;  2OWO A;  2E2J H;  3FRP B;  4Z9C B;  3NWT A;  4X65 L;  1NNX A;  1LO5 D;  2QF7 A;  2YYZ A;  3AQQ A;  3RLF A;  3OSO A;  1UNS A;  5CMD A;  5COY A;  1KL9 A;  4ZUI A;  4R9W A;  4BY7 B;  2K4K A;  4KJN A;  5KND A;  5JJI A;  5IYD G;  1NAP A;  1EL0 A;  2CQO A;  3J80 c;  5IT9 E;  4EQN A;  3S2D B;  4HJ8 A;  4JI0 L;  1I4Q A;  1B50 A;  4A3M G;  2LKV A;  5EKI A;  4IJL A;  3HOU H;  1SFO H;  2F4V Q;  1W6K A;  1Q8K A;  2BE5 C;  3E9I A;  4JI5 Q;  3J80 L;  5M3F B;  5K36 H;  2PO4 A;  4K5V A;  3M4Y A;  1GKH A;  1HZA A;  3K81 C;  1GUW A;  2A19 A;  3SXH A;  2B8G A;  1Y1W G;  4BY1 H;  3CCM A;  2R93 H;  2JA8 G;  2O4X A;  1AN8 A;  1CA5 A;  2B2U C;  5C3E G;  2WB1 B;  4NMZ A;  2EYO A;  4OX9 Q;  2L1B A;  4CDE C;  4YHH L;  2B2W A;  3I56 A;  1AZP A;  1LM0 A;  4DR3 Q;  3VA7 A;  5E4W C;  1D8L A;  4WJ4 A;  4K0K Q;  3N52 A;  2EJF C;  3I3C A;  1N32 Q;  1SE8 A;  4AQY L;  4P75 A;  3S17 H;  4LF4 L;  1JT8 A;  2CH4 W;  1I6H H;  2JA9 A;  2NBF A;  4DFA A;  4DUY Q;  4JI0 Q;  5HGT A;  1XJV A;  4K14 A;  4HIK A;  1HA6 A;  4A3C G;  4XYO A;  5ELO A;  5C4X G;  3H0G H;  3CCS A;  2JEB I;  3E0E A;  1PYW D;  4PZ6 A;  1EIH A;  1VMP A;  4V19 0;  1KTK A;  5CV7 A;  1ZYR C;  4GNX C;  1AE2 A;  3SK5 A;  3J81 i;  3U58 A;  1HQR D;  3ULL A;  1WCM B;  1ESF A;  2OXP A;  3B6Y A;  1G2T A;  1XTD A;  4R4Q A;  2PCF B;  4B3M L;  1SYE A;  1YJN A;  2O5J C;  2NVX H;  1EYG A;  2GA4 B;  1G51 A;  1BCP F;  1N36 L;  3GTK B;  4CDD C;  1X32 A;  2IW3 A;  5M5Y B;  4AQY Q;  4WJW A;  1SMY D;  2N55 A;  4CDC C;  4F8M A;  2AQ2 B;  3OMG A;  3PGZ A;  2VQF L;  2UXD Q;  2B8F A;  3M4Q A;  3T51 B;  1CFM A;  2EY1 A;  3MFY A;  2JP1 A;  1CQF A;  3D4R A;  3P75 A;  1PH1 A;  2R93 G;  5IYC H;  5JJK A;  3PUZ A;  4K5X A;  1UEB A;  4RHR A;  1VQ9 A;  5JJL A;  4EGV A;  4U68 A;  1Q86 C;  1TS2 A;  1OXV A;  3WOE A;  3PV0 A;  3VYT A;  1TWA B;  1PZI D;  2JQO A;  2BDN A;  4DV3 Q;  1DM0 B;  5IGE A;  3HOW G;  4CDF C;  2IHF A;  3CC2 A;  3VYU A;  1SDF A;  2DNC A;  4LW1 A;  1I3Q H;  2MUY A;  4QUF A;  3FDT A;  4DR4 L;  1YNJ C;  1O80 A;  4PNY A;  4YWL A;  4ZCK A;  2IX1 A;  2M9V A;  1F9P A;  1TVX A;  3MXG A;  3GV3 A;  3C1E A;  1KXL A;  2R7F A;  5EPK A;  1STH A;  1ENA A;  2B29 A;  4PZ7 A;  4BY7 H;  2EY2 A;  1BR9 A;  3OHX C;  4HED A;  1JOK A;  1JCK B;  3S2D H;  4OHJ A;  1OXS C;  1U4L A;  4FO2 A;  4A3B B;  3CMA A;  2KEC A;  3FPP A;  5EJW A;  4RKB A;  2JA7 B;  1KDB A;  2A69 C;  4Y52 H;  1CZG A;  5M3F H;  1SXT A;  1CSP A;  3ULP A;  1W6J A;  2D0P A;  2MP1 A;  1KLG D;  4DA2 A;  1F2M A;  2R92 G;  1SNC A;  3HP3 A;  3TN2 A;  1AEX A;  2A6E C;  3TRZ A;  1B1Z A;  2XGT A;  2F3V A;  1PH5 A;  1X6O A;  5FLM H;  4X3K A;  4DXG A;  3NWS A;  1G6Z A;  2EQS A;  3J80 i;  2BH8 A;  3MFG A;  1Y1V B;  2X6G A;  3Q23 A;  1R4Q B;  3N6R A;  2KA7 A;  2PNR C;  5D14 A;  2LFN A;  5J22 A;  1U4M A;  2KCC A;  2PZW A;  1K0S A;  1YHA A;  3HOX B;  4C3H B;  5JOB A;  3E0J A;  1VQ5 A;  4DR1 L;  1Q90 A;  1VQJ A;  3CCV A;  5I9P A;  1EQQ A;  4LF9 Q;  5CC4 A;  2F0K A;  2D62 A;  4KY7 A;  1J5E L;  1BBX C;  1QIL A;  2PNH A;  1PXU A;  1TWC B;  4R4I A;  1FNU A;  5T1I A;  4FF3 A;  1ILQ A;  1WTP A;  2HIX A;  3CC4 A;  2L4N A;  2PMZ B;  3HKS A;  2HCI A;  4IPC A;  4JI3 Q;  3V96 A;  5GQO A;  3CME A;  1JB7 A;  4L63 B;  1EY7 A;  3NBI A;  4FXK C;  2EIF A;  2A1A A;  5HGQ A;  3D4W A;  4RGO S;  3TME A;  2NZ1 D;  4DK3 C;  4NXM Q;  4P73 A;  1WCM H;  3VR4 A;  1KIX A;  3HOY B;  5EAY A;  1VQL A;  3PIO 3;  5DEH A;  4BY7 G;  4CJ1 B;  1SE3 A;  3E6Z X;  2D5D A;  3BS1 A;  2JXM B;  3A54 A;  1I4X A;  1D6E C;  3MTS A;  4DNR B;  3HEJ A;  2KHI A;  3I73 A;  4LF6 L;  3QIA A;  4WRD A;  3GTK H;  1X3G A;  3URY A;  3IKJ A;  2OQK A;  5M5Y H;  4L5T A;  4GZY C;  1L2F A;  4DV7 L;  4HID A;  2DJF C;  1F9Q A;  1J5E Q;  1FGB D;  3HRZ C;  1DD2 A;  4XT1 B;  4PMW A;  3K5M A;  4YCU A;  5KRU A;  3KOJ A;  3J7A F;  1EU4 A;  2ZTC A;  1PFN A;  2XSC A;  1BBU A;  3KDF A;  2XRQ D;  5FO8 B;  4A3I B;  1TWA H;  2E5L L;  4BBR B;  5COR A;  4NB3 A;  1P8L A;  3JAM c;  2H4O A;  1MKH A;  4RWS C;  4GKK Q;  3H3V I;  1ET6 A;  3MXN B;  2K14 A;  1XXG A;  4GOP B;  2AUK A;  3NQI A;  2XWB B;  3OWE B;  3UDF A;  4ID6 A;  3JAM L;  1CSQ A;  4YIJ A;  3AEV A;  3CD6 A;  3QO2 A;  4DAP A;  3CHB D;  5C4Z A;  4DK1 A;  3S1Q B;  2IWH A;  2N49 A;  2K33 A;  5AJ3 Q;  1TKW B;  4IZ8 A;  2F4I A;  1LUZ A;  5M3M B;  1CTM A;  3R2T A;  2A6H D;  4A3F B;  2LXJ A;  2EY5 A;  4TSS A;  4A3B H;  1WOC A;  2Q2I A;  2SDF A;  2JA7 H;  1V1Q A;  4XQJ A;  5EPL A;  2NN6 H;  3Q0A A;  5FJ8 H;  5JEA H;  1UE7 A;  2AUJ D;  3UI2 A;  2NTT A;  1MJC A;  1S5E D;  1LT5 D;  4YY3 L;  4FF4 A;  2A8V A;  2SNM A;  2B2W C;  2L9H A;  2BCO A;  1TT2 A;  4H02 A;  3AB9 A;  1LT3 D;  3M3Y B;  3R2I A;  1WTX A;  5E4X A;  5EGT A;  1H95 A;  1WD0 A;  4K8J A;  1HJP A;  3SEB A;  1UE6 A;  1Y1V H;  1BNZ A;  1XTC D;  4JI2 L;  3QG1 A;  3TEH B;  3K59 A;  2N3S A;  2HCC A;  3HOX H;  4C3H H;  4RA8 A;  3E3X A;  3DM3 A;  1L1O A;  1EU3 A;  5KNB A;  1FYC A;  2MO1 A;  3I4M G;  3PSI A;  1FJG L;  5HUR A;  4ZYS A;  1BO0 A;  4YWK A;  1SR3 A;  1XMQ L;  4I7Z C;  2PQA A;  2CFM A;  4FXG C;  3D6C A;  1RL2 A;  1TWC H;  3S14 B;  3EA6 A;  5ELN A;  3VYS A;  3KF8 A;  4O1N A;  5FKA C;  4QB4 A;  3MC0 B;  4BA1 I;  4DF7 A;  2UUC L;  4QF4 A;  4IPD A;  4X62 Q;  4KHP L;  4B3S Q;  4JCV E;  1STB A;  5IYB G;  4DGZ A;  1SE2 A;  2EJM A;  1PH6 A;  3HOY H;  2FFK B;  5EQ0 A;  3KK7 A;  3FVQ A;  4DR2 L;  3P1H A;  4JV5 Q;  3OIP A;  3CCQ A;  1G6P A;  2BOS A;  5IWA Q;  4OWT B;  1JMC A;  5C5M A;  1K83 B;  4DV6 Q;  1L0X B;  1KQS A;  2JN4 A;  3NTI A;  2A73 B;  4DR6 L;  1JJG A;  2EYJ A;  1GJX A;  1IL2 A;  4DAM A;  1ICF B;  5FK9 C;  4KJO A;  1TWF B;  5EBC A;  5FJ8 G;  1Q81 C;  3NBH B;  1UEA B;  1N33 L;  4OEM B;  5C0X J;  3MA2 B;  5GRO A;  1D5X C;  2F03 A;  2L15 A;  4G4K A;  2NZO A;  1IL8 A;  1A63 A;  2P5Z X;  2Z6K A;  3VYR A;  3GO5 A;  3RD4 A;  4A3I H;  3KLW A;  1AH9 A;  1IBM L;  2YU9 B;  3CKI B;  3U4V A;  4RCN A;  4BBR H;  1BVS A;  1VQD A;  3A5Z B;  3M4O B;  1PZJ D;  1Q7Y C;  1F2Z A;  2F0F A;  2IY5 B;  1ROD A;  3QWN A;  2JYO A;  4RAU C;  5CV6 A;  3HKZ E;  1EY8 A;  1HXY D;  4B9W A;  2RDH A;  3CCL A;  4MZ9 A;  4NXN Q;  3W3A A;  4Y7N B;  4KHV A;  4A3L G;  3NQT A;  2OCE A;  3S1Q H;  3PO3 B;  2WKC A;  1VQP A;  4RGT A;  3X3N A;  5JPM C;  2B63 B;  3A55 A;  1C4Q A;  1Q8I A;  5M3M H;  3S2H B;  5KNC A;  4HN7 A;  1HR0 L;  4GNX B;  1B9M A;  2TSS A;  1K73 C;  2JEA I;  2KUM A;  4A3F H;  3A56 A;  3E9H A;  2F0Q A;  3JAM i;  3CP0 A;  2IT1 A;  1Y69 U;  5ELD A;  4P74 A;  1PYS B;  5A2Q L;  1HRJ A;  2JJQ A;  5LMN L;  5I9O A;  4XQQ A;  3D6W A;  3PUW A;  4ZRZ A;  5T1G A;  4BWG B;  4G7Z C;  5DNF A;  4JOI A;  3HOY G;  2F0U A;  2Z4I A;  4TKO B;  3J81 L;  1ASZ A;  2AQ3 B;  3M3Y H;  4TRD A;  1Z7T A;  1I4R A;  4JW0 A;  4PQX A;  1FNW A;  3BVZ A;  2R3Z A;  1V1P B;  4NW2 A;  1JWU D;  2K5H A;  4F87 A;  2K52 A;  2NZH A;  1GUN A;  2SEB D;  5LL6 X;  1QVC A;  5FLX L;  4QQB X;  4C3I B;  4LFA Q;  1IKM A;  4H44 C;  1B70 B;  3LX0 A;  5C0X I;  1OO9 B;  2GN5 A;  1ET9 A;  2Q8T A;  4X64 Q;  1KAW A;  4A3D G;  4NKL A;  3UDG A;  2EE1 A;  1CHQ D;  5KYI A;  4UP7 A;  1Q1B A;  1NTG A;  1OXX K;  1GD7 A;  3S14 H;  3I70 A;  1H9S B;  1WD1 A;  4ZKB B;  2VS1 A;  2QEJ C;  4A3G B;  4J6H A;  5BN3 A;  4BBR G;  2ZTE A;  1TS3 A;  4PV1 C;  2ALY B;  1VQ4 A;  1EQR A;  1I94 Q;  3OW7 A;  4JG2 A;  2YTV A;  4BA2 I;  2F4V L;  2XIW A;  4K6L A;  4CGY B;  2NTS A;  5GAE C;  4GN3 B;  2IPK D;  5IE8 A;  2IL8 A;  4JI6 Q;  1UWV A;  3BU2 A;  2ZXR A;  4P2C B;  2LS0 1;  2J7Z A;  4PMC A;  2AWN A;  2PW7 A;  1DCZ A;  1OXU A;  2HUG A;  1RTO A;  4DU9 A;  1H9M A;  5M3M G;  2KCN A;  3G4S A;  1EY5 A;  2RCF A;  1K83 H;  4DV1 Q;  1N8R C;  3PMF A;  4LNQ A;  1N34 Q;  1GVP A;  2JA5 B;  3PO2 B;  4OX9 L;  4DR3 L;  1TWF H;  3VA5 A;  3BG3 A;  4K0K L;  2I5H A;  2TMP A;  3SK8 A;  2BDO A;  1N32 L;  3S1N B;  3UE0 A;  1BXT A;  3GQB A;  4DV4 L;  3HOZ B;  3HS0 C;  4B08 A;  4MTN A;  2RVL A;  1IBK Q;  4QMG A;  3TDQ A;  2XN9 C;  4DUY L;  5GAD C;  1AW7 A;  3L7Z C;  2YU9 H;  4DR7 Q;  3DWA A;  5C5L A;  2RBM A;  1MHW C;  3M4O H;  3I8Z A;  4YCV A;  1V8Q A;  1PH9 A;  1RIP A;  1PTO C;  4A76 A;  4C2M B;  2RQX A;  1B3A A;  4Y7N H;  1CQV A;  3PIP A;  4FP5 D;  3I4N B;  1EYC A;  3ICE A;  2KCM A;  4EQP A;  5BN5 A;  2PMZ E;  2JA6 G;  1A6X A;  4PMB A;  3PO3 H;  1SMX A;  3K58 A;  4GKJ Q;  1STG A;  4NDX A;  1A3T A;  1EEF D;  1X3F A;  3LNN A;  3VDY A;  2B63 H;  1E22 A;  3S2H H;  2K6A A;  2CWA A;  4N8X 1;  4V0B A;  3T4A C;  1X54 A;  1SN8 A;  3UDX A;  3CRL C;  2KED A;  1EEI D;  4HAE A;  3G7L A;  3S24 A;  5IP9 G;  4S3S A;  4G7H C;  1CHP D;  1RTN A;  1EOV A;  3MEH A;  4DV4 Q;  2JSO A;  4HIO A;  1Y8N B;  2ICE C;  3ER0 A;  2UXD L;  2CW0 C;  2PZT A;  1PH2 A;  4HJ9 A;  4JI8 Q;  4OIK A;  1IW7 C;  1NE3 A;  2F0S A;  5D65 A;  4JBM A;  4A3K B;  2Z8L A;  3HKZ B;  4IQZ A;  1L1O C;  1B3Q A;  1NCV A;  3RN5 A;  2ZJQ A;  3TSS A;  2HDL A;  1WTW A;  3KFU A;  5ELB A;  5HY6 A;  4RG1 A;  3CC7 A;  1O7L A;  2OEO A;  2MFI A;  5IT9 c;  4DV3 L;  2ENB A;  1GOZ A;  2CH4 A;  2HD3 A;  4C3I H;  1EUJ A;  2RA4 A;  2AQ1 B;  1J8I A;  3WDN A;  1ENC A;  1F2L A;  4ME3 A;  1O7I A;  2GVA A;  5IT9 L;  2F0V A;  2NVY B;  2ZT9 C;  3ND8 A;  3SR1 A;  3H15 A;  1D5Z C;  2MQH A;  1SNP A;  2A68 C;  4C1N K;  4O2D A;  3U9S A;  2F0O A;  1LYL A;  1TQO A;  4A3G H;  3A8J E;  4X6A H;  4RHS A;  3RZO B;  3HOU G;  1VQH A;  4B3R L;  1LT6 D;  1GM5 A;  4G57 A;  2WAQ B;  2OTJ A;  2Z4H A;  3KLR A;  5K36 G;  3GTL B;  4IUT A;  1D7Q A;  5CBE E;  4DR5 Q;  2IX3 A;  5J39 A;  1X56 A;  4KD4 A;  2HQL A;  2YTX A;  3I4L A;  4QUC A;  1NSN S;  4Q0F A;  3PO3 G;  3M85 A;  2C35 B;  2Q2H A;  2RSN A;  4BY1 G;  4QIW E;  3GTQ B;  2B63 G;  2BA1 A;  3NK9 A;  3H09 A;  4CBV A;  3SHL A;  2MGS A;  3S16 B;  4UHV A;  3TS2 A;  1KAA A;  3FKI H;  2BH2 A;  4ULL A;  2JA5 H;  3C46 A;  1LTL A;  3PO2 H;  4FDB A;  2L55 A;  2I0Q A;  1H9K A;  2XTI A;  3PCO B;  1TXY A;  2Z6K C;  1QVF A;  1ESR A;  4UP8 A;  2F0E A;  1STE A;  1HUM A;  2PI2 A;  3S1N H;  3STB C;  1IYV A;  1CKM A;  2ID0 A;  5IOC A;  3D4D A;  3HOZ H;  4F7X A;  4B9X A;  2WP8 J;  4LF9 L;  3A7A B;  2R6G A;  3LWE A;  2L0C A;  2H5X A;  3M4P A;  3IL8 A;  1BCP D;  2FMC A;  4DAY A;  2E2D C;  1PDQ A;  2K1B A;  1FL0 A;  4DPG A;  1K8A C;  4XIG S;  4B3R Q;  2CQA A;  2YTY A;  1HTL D;  4DK6 C;  3H0G G;  3NEN A;  4GLA C;  1IBL Q;  2ASB A;  4JI3 L;  1STA A;  2Y0S E;  1GUT A;  2DUD A;  2EVB A;  4A93 B;  4C2M H;  3RZD B;  5LMU Q;  5CV4 A;  1OXT A;  2OQ0 A;  3S1R B;  3I4N H;  1QZG A;  2Z9H A;  1AE3 A;  4JI7 Q;  3FPU B;  2OF1 A;  4NXM L;  3GTO B;  1YBY A;  5IIF A;  3KF6 A;  4LF5 Q;  4IUV A;  2K32 A;  3HGB A;  3PUV A;  1RHP A;  1VQG A;  1ZKO A;  5BR8 Q;  1Z6H A;  1SNM A;  3NP8 A;  4AYB E;  4Q5V A;  1S5D D;  4JOI C;  1VQI A;  2PQE A;  3E5S A;  3F2U A;  2NVT B;  1I4H A;  2QDL A;  3KBG A;  4IFD H;  4M1U B;  5LHY 1;  1GHJ A;  4PZ8 A;  1EYD A;  3I4O A;  1HPC A;  3SK6 A;  2F0D A;  5EBD A;  3A5U A;  1K8G A;  5IYC G;  3I72 A;  4IOA A;  4A3K H;  1EIG A;  4HCE A;  2EYL A;  1RDP D;  3FKI G;  4LF8 Q;  2F52 A;  1WYD A;  3H3V C;  3L9A X;  1FNV A;  5CYU A;  4CKB A;  3IAY A;  3R8B A;  1SYD A;  1CK1 A;  1MI2 A;  5FOB B;  5I4D A;  4POG A;  2C9O A;  4GKK L;  1I50 B;  1CKN A;  4JI1 Q;  3RLN A;  1VQF A;  2EYM A;  2NVY H;  3U9O A;  3HOZ G;  2EDG A;  1C48 A;  3A7L A;  1YNJ D;  2KQ3 A;  1YVC A;  5AJ3 L;  5DM7 3;  1LAB A;  3EJI A;  1WTH A;  2E2H B;  2EYH A;  2WII B;  3RZO H;  1KRT A;  3V2T A;  1SNQ A;  1B4O A;  1D1K A;  1QB5 D;  1PRT C;  1T5X D;  5M3F G;  3GDE A;  4FVM A;  3GTL H;  2EYF A;  4JVZ A;  5EKL A;  2L12 A;  2ATW A;  3NEM A;  4MTK A;  1GUS A;  1ML0 D;  3QOJ A;  4JYA L;  5KIX A;  5LL6 S;  2D9U A;  4C3J B;  5FLM G;  3GTQ H;  2G9D A;  3MEF A;  3F2B A;  1EFW A;  2E76 C;  2QKI C;  1S5F D;  2WB1 G;  2PYK A;  5IY0 A;  2DNE A;  1TWH B;  3S16 H;  2LXK A;  1MSH A;  2G5D A;  1EOT A;  3BZK A;  1XPU A;  3CCR A;  2UUA Q;  4CKE A;  1WTO A;  1TR5 A;  1E2W A;  2Q2T A;  1SYF A;  1XPR A;  2QCP X;  1UE1 A;  2B2Y A;  5D3I B;  3ERQ A;  1O7Y A;  2I07 B;  1DZ1 A;  1G91 A;  3BYT B;  2ZM6 Q;  1WI5 A;  3PUY A;  3HKZ G;  4HMJ A;  3JC6 6;  3CW2 C;  2G9H D;  2PW5 A;  2XNA C;  2B3G A;  1GXD C;  4ABN A;  2QA4 A;  4U67 3;  2OTL A;  3AFP A;  1B53 A;  5CV5 A;  4QIW B;  1P16 A;  1JE5 A;  5CV8 A;  4N9P A;  4JYA Q;  3K0Y A;  4JBK A;  4KKT A;  4FXD A;  4A93 H;  2EXZ A;  3RZD H;  3TP8 A;  3J81 j;  3K57 A;  2EOT A;  3S1R H;  5DAU A;  5KYL A;  4K8I A;  4N8F A;  1WCM G;  1EQV A;  1MGS A;  1W3S A;  1VQ8 A;  4HIM A;  1H9R A;  4X62 L;  1L0W A;  4B3S L;  3ERS X;  4PG3 A;  1STN A;  2A5H A;  1XNR Q;  3GTO H;  3NTK A;  3A0J A;  3S9W A;  2QEX A;  2I5M X;  4A4I A;  4KKS A;  4JV5 L;  5G3L F;  2VL6 A;  5IWA L;  2VB3 X;  1C8C A;  1DYQ A;  1HNZ L;  4OL7 A;  4DV6 L;  2NVT H;  1HZ9 A;  3NEL A;  3CQZ B;  1KNE A;  3W1G A;  1EWH A;  2IX0 A;  3KYH C;  4OO1 H;  1CA6 A;  4JI4 Q;  1YIT A;  2UU9 L;  4JK1 C;  4HR7 B;  4XYQ A;  4LF7 Q;  3MZ5 A;  2Y0S B;  2HHH L;  2Q8I B;  1CUK A;  4JBW A;  5E7N A;  1FD7 D;  2R7D A;  3T53 B;  2C5C A;  3KDF B;  4A3E B;  4MHE A;  3OWF A;  4XDX A;  1JE4 A;  1ASY A;  1JC7 A;  1ONL A;  2LSS A;  5J1Z A;  3GTG B;  1TS4 A;  1F2Y A;  1SYG A;  1Z9F A;  1I50 H;  4AYB B;  2JA8 B;  3L0O A;  4BS9 A;  4NXN L;  3J7A V;  5C3E B;  3EN2 A;  3OTO Q;  4KN7 C;  2Q8R E;  3OW2 A;  1SRO A;  2SNS A;  2GVB A;  4I65 A;  1PTO B;  2E2H H;  5JPN C;  4O42 A;  1WVL A;  3NHH A;  1HNZ Q;  4A3B G;  1YNN D;  1M4V A;  4RKL A;  1S3O A;  1E2V A;  2JA7 G;  1QUQ A;  3ZYY X;  1LTT D;  2NN6 G;  3KLS A;  4DAV A;  5JEA G;  5A2Q E;  4A93 G;  2F0H A;  2EJG C;  1U9R A;  2UU9 Q;  3T56 B;  4X66 Q;  2X6L A;  2I5L X;  2HHH Q;  3BZC A;  1KHI A;  4ZLT F;  3P20 A;  3KBX A;  4C3J H;  1LT4 D;  1T9H A;  3J81 E;  1DXM A;  3HOV B;  1I4P A;  2MPM A;  5DLQ E;  4WJ3 M;  1Y1V G;  1T5E A;  5KEE A;  3F2D A;  3DM1 A;  3S1M B;  1TWH H;  1B44 D;  2E2J B;  4QJF A;  3DEO A;  3TRE A;  4KKU A;  1VF5 C;  3O13 A;  3MXP A;  3HOX G;  2DN8 A;  4C3H G;  1EIF A;  1C0A A;  3H6M A;  4RGN A;  1KC8 C;  5FLX E;  2KCT A;  3GTJ B;  2NN6 I;  3SK4 A;  2QGQ A;  4LFA L;  4X3T A;  5FO9 B;  2F0N A;  3F1Z A;  1L1O B;  1EZ8 A;  1X3P A;  4OO1 G;  3PQI A;  3QJY A;  4X64 L;  1IYJ B;  3CAM A;  3KUP A;  4FNF A;  3Q8D A;  4POF A;  4OWX B;  4CJ0 B;  4ME5 A;  3HFZ B;  2PQA B;  4I7A A;  3DUZ A;  4BXX H;  2D2C C;  1E2Z A;  2K7V A;  1QJO A;  3HG9 A;  3F2C A;  4LWC A;  1CT1 D;  3H94 A;  4LAA A;  3KF8 B;  1YNX A;  4DV0 Q;  2B2T A;  3TS0 A;  3BYY B;  1BKB A;  3FMC A;  1M1K C;  1I94 L;  2K28 A;  3T1Y Q;  5BN4 A;  1IHZ A;  1HNX Q;  4LFC L;  5J3B A;  1ILP A;  4UPA A;  4RH6 A;  3RN2 A;  4J15 A;  1A3V A;  1DON A;  1Y14 B;  4L6T B;  4ZKC B;  2WAQ E;  3HOW B;  4JI6 L;  2RDF A;  2JK8 A;  3W1B A;  3J7Y W;  2K75 A;  4DNT B;  2XVS A;  5IOD A;  3J7Z C;  1G29 1;  1QG7 A;  4DV1 L;  1D2B A;  1N34 L;  1DOK A;  3HZX A;  3CQZ H;  2NYZ D;  3AYH B;  3BJU A;  4IUR A;  1NR2 A;  1LTI D;  5IYD H;  4UDU C;  1LTS D;  3I2Z A;  1C9O A;  3OIQ A;  3OMC A;  1GHK A;  4A3I G;  1WTV A;  3QB3 A;  1CZW A;  4UAI A;  1IBK L;  4XQN A;  4L5Q A;  4DXF A;  1SAP A;  3R3O A;  4OIJ A;  4A3E H;  1I4G A;  2R92 B;  1M90 C;  4DR7 L;  1MJE A;  3V05 A;  1G2S A;  2WFW A;  1U0L A;  4LFC Q;  1VQM A;  3K80 C;  1WTQ A;  3J80 E;  3GTG H;  1JJC B;  4K2K A;  4B3T Q;  2JA8 H;  1A2U A;  1W2B A;  3MXU A;  1XNQ L;  1SJE D;  5C3E H;  4RMF A;  2EY6 A;  2DGY A;  4QCL A;  1A2T A;  1PFB A;  4GKJ L;  1ZXT A;  5M5W B;  3RUZ A;  3BDL A;  1PTO H;  3M7G A;  4IUN A;  4A3F G;  4IUQ A;  4C56 C;  2MNA A;  4YCW A;  1LTG D;  3K7A B;  1OTC A;  5C44 B;  2I46 A;  4H13 C;  4WFN 3;  1F9S A;  1X3Q A;  2CVR A;  3DHQ A;  4HSP A;  2LY7 A;  4XTC S;  1EYA A;  1HTP A;  3NPP A;  5IGD A;  3SDZ A;  4G7O C;  2K5W A;  4J8Q A;  5I6Y A;  2NWG A;  3Q22 A;  4JI8 L;  2K03 A;  3HOV H;  4OGQ C;  5C4J B;  1K8O A;  4OXP A;  1NBW A;  3CU7 A;  2V4D A;  4IUU A;  1ENF A;  3S1M H;  4C1N I;  3PIO A;  2B2Y C;  4MIU A;  1LAC A;  5EKK A;  3W5O A;  2VB2 X;  4R4O A;  2UUB Q;  3RNU A;  1JOR A;  1LV9 A;  1XNQ Q;  3GTJ H;  1D5M C;  1K28 A;  1XX8 A;  1RCV D;  2KEN A;  4AIM A;  3MVV A;  1SMY C;  1UE5 A;  1A8V A;  1QE6 A;  4RCO A;  2RF4 A;  4DUZ L;  1VQB A;  3I91 A;  4XXE A;  1O78 A;  2Y0S G;  2F1M A;  2EPB A;  1EY6 A;  1FVI A;  4IJH A;  2CKZ B;  2LMC B;  4A3E G;  5GAG C;  2FMM A;  1TU2 B;  2PI2 E;  2Q2U A;  4F88 A;  1GUG A;  2VUM B;  2KBN A;  2IJ0 A;  2KOL A;  4FF2 A;  2NVQ B;  4AYB G;  2F0T A;  1U5K A;  1GO3 E;  1ICW A;  2VZA A;  2UXB Q;  4DR5 L;  3DXJ C;  4CKC A;  1RJT A;  1A62 A;  1EFI D;  1PTO F;  1S40 A;  3HOW H;  2MJ8 A;  2NUC A;  4P71 A;  1PRT B;  4ZUJ A;  4R4C A;  4LUO A;  1NY4 A;  2MHV A;  1E0B A;  1NJI C;  2B2V A;  4X65 Q;  1F77 A;  5JVH 3;  1BDO A;  4M8A A;  3DWQ A;  1BCP C;  2KVM A;  3K5N A;  1BOS A;  5CBA E;  4DV2 L;  3TZD A;  3GTM B;  4IAL A;  4DUZ Q;  4KTA A;  1G8Z D;  1PZK D;  4JBJ A;  1A3U A;  1JB3 A;  1U4P A;  3C1F A;  3EBE A;  1XYI A;  4IN3 A;  1J6Q A;  4N9T A;  3PF5 A;  4X3U A;  3HOV G;  1VQ6 A;  1SJH D;  2FJ2 A;  3ITP A;  1PA6 A;  2ICI A;  4NP5 A;  4QY7 A;  2RDG A;  4KHZ A;  3WOF A;  4JPB W;  5H1S E;  1KRS A;  4QGU A;  3OPO A;  2EYP A;  2R92 H;  4R8I A;  3CCE A;  3DMU A;  1V1O A;  4JC0 A;  4APV A;  2E2I B;  1S4Z A;  1IBL L;  1KD1 C;  3SE0 A;  2FHT A;  1RF2 D;  3Q24 A;  2V1C C;  4GS3 A;  5ELF A;  2N78 A;  1AFP A;  5JAV A;  4YHH Q;  2BE5 D;  5LMU L;  2F0J A;  1PTO D;  4ODG A;  3OOC A;  4IO9 A;  4JI7 L;  1PH3 A;  3CF5 A;  4LUZ A;  5M5W H;  1QCB D;  3VR6 A;  2K01 A;  2XRS D;  4LF4 Q;  4LF5 L;  1HZB A;  4DV2 Q;  1HCZ A;  3K7U C;  3K7A H;  3I4M B;  5BR8 L;  5C44 H;  2ZJP A;  1K0R A;  1VQO A;  4ZK9 B;  3LWU A;  5EPJ A;  1N9W A;  1YJ9 A;  4E6I A;  5NUC A;  4DV5 L;  1JWM D;  3CXC A;  4KD3 A;  5C6A A;  3PF4 A;  1YIJ A;  5JJZ A;  5C4J H;  4O0A A;  2VNU D;  3CRK C;  1JR0 D;  2CW0 D;  3EQL C;  4L5R C;  3BVG A;  1X3E A;  2RKS A;  1IW7 D;  2BA0 A;  3SVM A;  4C3I G;  2HQE A; 
#chains in the Genus database with same CATH homology
 1YEZ A;  4B3M Q;  3CW2 C;  4IJL A;  3HOU H;  4A3L G;  1SFO H;  2OCE A;  3S1Q H;  2B3G A;  4OON A;  2QA4 A;  1E3P A;  2F4V Q;  1Q8K A;  3E9I A;  1N36 Q;  1VQP A;  2OTL A;  3AFP A;  4JI5 Q;  2E8G A;  2RHS B;  4TQU S;  1P16 A;  1JE5 A;  4JI1 L;  4JYA Q;  1GKH A;  1HZA A;  5M3M H;  1PYB A;  1HR0 L;  4GNX B;  4JBK A;  3K81 C;  2JEA I;  1K73 C;  2YV5 A;  3H3V H;  4A93 H;  4A3F H;  3RZD H;  2K50 A;  3J81 j;  2VQF Q;  3S1R H;  2A19 A;  3E9H A;  4A3G G;  3JAM i;  3CP0 A;  3CPW A;  1WCM G;  2IT1 A;  1YZ6 A;  3CCM A;  1W3S A;  1X65 A;  1Y1W G;  1VQ8 A;  4BY1 H;  4P74 A;  4HIM A;  1PYS B;  2JA8 G;  4X62 L;  2JJQ A;  1L0W A;  3RR5 A;  5LMN L;  4B3S L;  3ERS X;  4PG3 A;  1XNR Q;  5C3E G;  3GTO H;  1A0I A;  3PUW A;  3A0J A;  2VUM H;  4OX9 Q;  4YHH L;  4DV5 Q;  4AH6 A;  2I5M X;  3I56 A;  4A4I A;  2QEX A;  1LM0 A;  4DR3 Q;  2N8N A;  2NVQ H;  4JOI A;  3HOY G;  4JV5 L;  1D8L A;  4WJ4 A;  4K0K Q;  1ASZ A;  2VL6 A;  5IWA L;  3M3Y H;  1N32 Q;  1SE8 A;  2Z0S A;  4AQY L;  4P75 A;  1HNZ L;  3S17 H;  4DV6 L;  3FHW A;  1Q1E A;  4LF4 L;  1HZ9 A;  2NVT H;  3NEL A;  1JT8 A;  4EQ5 A;  1JJ2 A;  4DR4 Q;  2AWO A;  1I6H H;  1EIY B;  3D31 A;  2JA9 A;  4GOP A;  2K5H A;  3W1G A;  2K52 A;  2NZH A;  2IX0 A;  4DUY Q;  3KYH C;  1HH2 P;  1PVO A;  2MO0 A;  1QVC A;  4QQB X;  4JI0 Q;  4JI4 Q;  3M9B A;  1YIT A;  2UU9 L;  3ZJY C;  4LFA Q;  1XJV A;  2JA5 G;  4LF7 Q;  1B70 B;  1VQE A;  2AMC B;  2K5N A;  5C0X I;  5C44 G;  4HIK A;  3PO2 G;  2GN5 A;  4A3C G;  2HHH L;  1CUK A;  5ELO A;  3GTM H;  4GN4 B;  4X64 Q;  1KAW A;  3H0G H;  5C4X G;  4JBW A;  3CCS A;  4A3D G;  2JEB I;  5E7N A;  3E0E A;  1PH7 A;  2R7D A;  4PZ6 A;  3UDG A;  1YJW A;  3KDF B;  4UP7 A;  1Q1B A;  3U4Z A;  1NTG A;  4GNX C;  2UUA L;  1OXX K;  1AE2 A;  3J81 i;  1GD7 A;  1IXR A;  1VCI A;  3A74 A;  3U58 A;  3S14 H;  1ASY A;  2LSS A;  2VS1 A;  4IFD J;  3ULL A;  2VY3 A;  1Z9F A;  1I50 H;  4BBR G;  2ZM6 L;  3B6Y A;  2ZTE A;  3STB D;  2ALY B;  1XTD A;  3L0O A;  4R4Q A;  1VQ4 A;  1EQR A;  4NXN L;  4DAY B;  2VW9 A;  1YJN A;  1I94 Q;  3AFQ A;  2CWP A;  3EN2 A;  4B3M L;  3OTO Q;  2NVX H;  1EYG A;  1X55 A;  4JG2 A;  1G51 A;  2YTV A;  4BA2 I;  2F4V L;  1N36 L;  2E2I H;  3OW2 A;  1SRO A;  5GAE C;  2GVB A;  2E2H H;  4MNO A;  4GN3 B;  4UP9 A;  1QZH A;  4AQY Q;  1PH8 A;  5IE8 A;  1HNZ Q;  4JI6 Q;  1UWV A;  3BU2 A;  4A3B G;  3I4N G;  3GD7 A;  1S3O A;  2JA7 G;  2AWN A;  3PGZ A;  2VQF L;  1OXU A;  2UXD Q;  1QUQ A;  2NN6 G;  5M3M G;  5JEA G;  1EWI A;  3G4S A;  3M4Q A;  4DR1 Q;  4A93 G;  1K83 H;  4DV1 Q;  1PFS A;  1N8R C;  2UU9 Q;  1XNR L;  4LNQ A;  2RCN A;  3KF6 B;  1PH1 A;  1N34 Q;  1GVP A;  2R93 G;  4X66 Q;  2I5L X;  5IYC H;  3PUZ A;  3DLL A;  3BZC A;  1KHI A;  1UEB A;  1VQ9 A;  2HHH Q;  2ES2 A;  4OX9 L;  4C3J H;  3J7A 5;  1XMO L;  3I4M H;  5JJL A;  4DR3 L;  1TWF H;  3G6E A;  1T9H A;  3WWV A;  4ALP A;  1OXV A;  1Q86 C;  3PV0 A;  4A3M G;  4K0K L;  2I5H A;  2JQO A;  2VUM G;  4DV3 Q;  2ZTD A;  1WFQ A;  5DLQ E;  4WJ3 M;  3HOW G;  1Y1V G;  1N32 L;  3G48 A;  2F3I A;  3F2D A;  2IHF A;  3UE0 A;  3CC2 A;  1TWH H;  4DV4 L;  4LW1 A;  4IFD G;  1I3Q H;  4QJF A;  3TRE A;  1DGS A;  4MTN A;  1E1O A;  4QL5 A;  4DR4 L;  3HOX G;  1EIF A;  1IBK Q;  1C0A A;  4TVA B;  2IX1 A;  4YWL A;  4DUY L;  5GAD C;  1KC8 C;  4A3K G;  3OYY A;  2KCT A;  4JI4 L;  1Q82 C;  2NN6 I;  3L7Z C;  2YU9 H;  4DR7 Q;  2QGQ A;  4LFA L;  2R7F A;  4LF7 L;  1KXL A;  3F1Z A;  1NMG A;  1I5F A;  1L1O B;  1VQ7 A;  2B29 A;  1E1T A;  4PZ7 A;  4BY7 H;  3M4O H;  4YCV A;  4OO1 G;  4KI0 A;  4DKA C;  4X64 L;  1XPO A;  1IYJ B;  3CAM A;  1PH9 A;  1RIP A;  3Q8D A;  4A76 A;  3K0X A;  4POF A;  4OWW B;  4OWX B;  4GLX A;  4L5S A;  1K9M C;  3S2D H;  3F8T A;  3HFZ B;  1OXS C;  2PQA B;  5IYB H;  4Y7N H;  3PIP A;  3CMA A;  4BXX H;  4YWM A;  3ICE A;  2KCM A;  2JA6 G;  2PMZ E;  3F2C A;  3PO3 H;  1SMX A;  4Y52 H;  4LWC A;  4LF6 Q;  5M3F H;  4GKJ Q;  1BBW A;  1CSP A;  1Q46 A;  1X3F A;  2D0P A;  3ULP A;  3VDY A;  2B63 H;  1CKN B;  4IFD I;  3KF8 B;  1E22 A;  1YNX A;  2D0O A;  4DV0 Q;  1C7Y A;  2R92 G;  3S2H H;  3TS0 A;  2CWA A;  4DV7 Q;  1BKB A;  1YHB A;  1M1K C;  1I94 L;  3TRZ A;  3T1Y Q;  1X54 A;  2XGT A;  3OTO L;  1HNX Q;  4LFC L;  1K3R A;  1SN8 A;  5J3B A;  1XMO Q;  4UPA A;  4IOC A;  1PH5 A;  1X6O A;  3UDX A;  5FLM H;  3RN2 A;  1E24 A;  4J15 A;  2EQS A;  3S24 A;  5IP9 G;  1Y14 B;  3J80 i;  3G71 A;  2BH8 A;  2WAQ E;  4JI6 L;  2WAQ G;  1EOV A;  2JK8 A;  4DV4 Q;  3W1B A;  4HIO A;  2K75 A;  1FGU A;  3ER0 A;  4HJ7 A;  2UXD L;  3I55 A;  2R7Z H;  4DNI A;  1PH2 A;  1YHA A;  4JI8 Q;  4HJ9 A;  1HZC A;  2E5L Q;  3J7Z C;  1WJJ A;  5JEA J;  1G29 1;  1NE3 A;  4DR1 L;  1VQ5 A;  4JBM A;  4DV1 L;  1VQJ A;  2AHO B;  3CCV A;  1N34 L;  3EIV A;  1L1O C;  2FXQ A;  1EQQ A;  4X66 L;  3RN5 A;  2ZJQ A;  4LF9 Q;  3CQZ H;  3KFU A;  3AYH B;  5HY6 A;  3BJU A;  3CCJ A;  2IHE A;  2D62 A;  4RG1 A;  1J5E L;  3CC7 A;  5IYD H;  2PNH A;  2MFI A;  5IT9 c;  4NPS A;  4DV3 L;  4R4I A;  4C3I H;  1EUJ A;  3I2Z A;  1C9O A;  4A3L H;  4LF8 L;  2HIX A;  3IRB A;  3CC4 A;  4ME3 A;  1O7I A;  3HKS A;  2GVA A;  3PUX A;  4A3I G;  4BBS H;  4IPC A;  4JI3 Q;  1IBK L;  4L5Q A;  5GQO A;  3CME A;  4GNX A;  1JB7 A;  3H15 A;  1X9N A;  4EX5 A;  2VQE L;  2MQH A;  4A3E H;  3SGI A;  1M90 C;  4DR7 L;  1MJE A;  2EIF A;  4O2D A;  2WFW A;  4R4T A;  3I7F A;  2A1A A;  5HGQ A;  1U0L A;  1LYL A;  4LFC Q;  4HJ8 A;  1VQM A;  4DK3 C;  3K80 C;  3GTG H;  4NXM Q;  1JJC B;  4A3G H;  4P73 A;  1WCM H;  1KIX A;  4X6A H;  4B3T Q;  5EAY A;  2JA8 H;  3HOU G;  1VQL A;  1VQH A;  1W2B A;  1XNQ L;  4BY7 G;  4B3R L;  4YY3 Q;  1S72 A;  2UXC L;  5C3E H;  1GM5 A;  2OTJ A;  4RMF A;  5K36 G;  2DGY A;  2ZJR A;  3M7N A;  1SLJ A;  1D7Q A;  4DR5 Q;  2KHI A;  1X56 A;  3FP9 A;  4LF6 L;  4GKJ L;  2HQL A;  3GTK H;  1X3G A;  2YTX A;  4A3J H;  4A3F G;  2OQK A;  5M5Y H;  4YCW A;  5IP7 H;  4L5T A;  2MNA A;  4DV0 L;  3PO3 G;  3M85 A;  2C35 B;  1L2F A;  2Q2H A;  4JI2 Q;  4DV7 L;  4BY1 G;  1OTC A;  4HID A;  4QIW E;  3T1Y L;  2B63 G;  1HNX L;  1MIU A;  1TWG H;  1J5E Q;  2BA1 A;  1HNW L;  4XTC S;  4UY8 C;  4PMW A;  3TS2 A;  3FKI H;  4YCU A;  2BH2 A;  2JA5 H;  3KOJ A;  1LTL A;  3PO2 H;  1FJG Q;  4FDB A;  4LFB L;  2ZTC A;  2I0Q A;  1BBU A;  1V43 A;  3KDF A;  1XMQ Q;  4R1J A;  2XTI A;  3PCO B;  2HIV A;  1TXY A;  4JI8 L;  2Z6K C;  4A3D H;  2WB1 E;  1QVF A;  3HOV H;  1TWA H;  2E5L L;  4UP8 A;  4OXP A;  4NB3 A;  2VQE Q;  1NBW A;  2PI2 A;  1P8L A;  3JAM c;  1YI2 A;  3STB C;  3S1N H;  1MKH A;  3S1M H;  1CKM A;  2ID0 A;  2R7Z G;  1VQK A;  1VS0 A;  3PIO A;  4IPH A;  3HOZ H;  4GKK Q;  3H3V I;  2WP8 J;  4JI0 L;  1VQA A;  4LF9 L;  3MXN B;  3W5O A;  2K14 A;  4R4O A;  4GOP B;  2R6G A;  2R93 H;  2UUB Q;  2H5X A;  3M4P A;  3UDF A;  3RNU A;  3GTP H;  1CSQ A;  1PHJ A;  1XNQ Q;  3AEV A;  1Q12 A;  3CD6 A;  3GTJ H;  1K8A C;  1FL0 A;  4DPG A;  4B3R Q;  4XIG S;  2UXC Q;  2YTY A;  4DK6 C;  1PH4 A;  2KEN A;  3H0G G;  2N49 A;  3NEN A;  4GLV B;  4AIM A;  4GLA C;  1UE5 A;  1A8V A;  2UUC Q;  5AJ3 Q;  1IBL Q;  2ASB A;  2RF4 A;  4KHP Q;  4DUZ L;  1VQB A;  1LUZ A;  4JI3 L;  2Y0S E;  2Y0S G;  2DUD A;  4DR2 Q;  4C2M H;  2LXJ A;  5LMU Q;  1FVI A;  1OXT A;  2OQ0 A;  1NMF A;  1WOC A;  4A3B H;  4IJH A;  3UE1 A;  4LUV A;  3I4N H;  4BBS G;  2CKZ B;  2Q2I A;  4HJA A;  1QZG A;  2JA7 H;  1AE3 A;  4JI7 Q;  1V1Q A;  4A3E G;  5GAG C;  4NXM L;  5FJ8 H;  1HNW Q;  1UE7 A;  1YBY A;  2PI2 E;  3KF6 A;  2Q2U A;  4B3T L;  4DR6 Q;  5M5X H;  4LF5 Q;  1MJC A;  4OO1 I;  3PUV A;  2KBN A;  1VQG A;  4YY3 L;  5BR8 Q;  2A8V A;  4LFB Q;  4AYB E;  4AYB G;  5C0X G;  3T1H L;  4A75 A;  1V9P A;  1U5K A;  1GO3 E;  4H02 A;  2VZA A;  3KJP A;  4JOI C;  1N33 Q;  2UXB Q;  1VQI A;  3J81 c;  4DR5 L;  1VQN A;  3K8A A;  1H95 A;  1HJP A;  3CPF A;  1A62 A;  1UE6 A;  4GN5 A;  1S40 A;  1Y1V H;  3HOW H;  4P71 A;  1HR0 W;  2K5V A;  4JI2 L;  4R4C A;  4LUO A;  4A3J G;  1NY4 A;  1QUQ B;  3TEH B;  2N3S A;  4GOP C;  4X65 Q;  1NJI C;  2CCZ A;  5IP7 G;  3ULJ A;  1IBM Q;  3HOX H;  4PZ8 A;  4C3H H;  3I4O A;  5FLX c;  3A5U A;  1K8G A;  5IYC G;  1QVG A;  3DM3 A;  1L1O A;  4A3K H;  4IOA A;  5LMN W;  4DV2 L;  3I4M G;  2MO1 A;  4A3M H;  3PSI A;  1FJG L;  4YWK A;  1PV4 A;  1SR3 A;  4DUZ Q;  1XMQ L;  3FKI G;  4LF8 Q;  3KJO A;  4HJ5 A;  3S15 H;  1B7Y B;  3CCU A;  2F52 A;  2PQA A;  1WYD A;  4JBJ A;  2CFM A;  3RLO A;  1RL2 A;  1TWC H;  3EBE A;  1CKO A;  1J6Q A;  3PF5 A;  4POG A;  4GKK L;  3HOV G;  1VQ6 A;  5ELN A;  3L2P A;  4P72 A;  2JA6 H;  1CKN A;  4JI1 Q;  4QY7 A;  1PA6 A;  5JJK A;  4KHZ A;  3RLN A;  2UUB L;  2EXD A;  1VQF A;  2NVY H;  2JE6 I;  5H1S E;  1KRS A;  4QGU A;  1Y1W H;  1HR0 Q;  3HOZ G;  2R92 H;  4IPG A;  3CCE A;  4BA1 I;  1SRU A;  4JC0 A;  4APV A;  3T1H Q;  2UUC L;  1YVC A;  5GAH C;  4IPD A;  5AJ3 L;  4X62 Q;  1IBL L;  4KLK A;  1YHQ A;  1KD1 C;  5LMN Q;  4B3S Q;  4KHP L;  3D0F A;  4JCV E;  3HOY H;  5IYB G;  1PH6 A;  3RZO H;  2V1C C;  1B8A A;  4GS3 A;  1KRT A;  4BXX G;  2N78 A;  2RHQ B;  5IP9 H;  4YHH Q;  4DR2 L;  5LMU L;  1VQC A;  5M3F G;  4JV5 Q;  3GDE A;  4JI5 L;  3GTL H;  2HT1 A;  3CCQ A;  1G6P A;  2ATW A;  5IWA Q;  2KHJ A;  3U50 C;  4IO9 A;  4JI7 L;  4OWT B;  1JMC A;  3NEM A;  1PH3 A;  3CF5 A;  4LUZ A;  1R9T H;  3LGJ A;  5M5W H;  4JYA L;  3TQY A;  4DV6 Q;  1KQS A;  4LF4 Q;  4DR6 L;  1JJG A;  4LF5 L;  1HZB A;  4DV2 Q;  1Z47 A;  3K7U C;  4DAM A;  3K7A H;  1IL2 A;  5FLM G;  5BR8 L;  5FJ8 G;  5C44 H;  1Q81 C;  4A3C H;  2ZJP A;  1K0R A;  3NBH B;  1VQO A;  3MEF A;  3F2B A;  3GTQ H;  1EFW A;  1N33 L;  2UXB L;  1E7Z A;  1N9W A;  5C4X H;  5C0X J;  2AKW B;  5GRO A;  1YJ9 A;  2WB1 G;  5IY0 A;  2L15 A;  1IZ6 A;  3S16 H;  3UDI A;  2LXK A;  2NZO A;  4DV5 L;  2OWO A;  1A63 A;  3BZK A;  2E2J H;  1XPU A;  2Z6K A;  3CCR A;  4X65 L;  3GO5 A;  2UUA Q;  2YYZ A;  3RLF A;  3AQQ A;  3KLW A;  3CXC A;  4A3I H;  1IBM L;  3PF4 A;  1AH9 A;  2Q2T A;  1YIJ A;  3U4V A;  4BBR H;  5C4J H;  4O0A A;  2VNU D;  1BVS A;  1VQD A;  1KL9 A;  1XPR A;  3A5Z B;  1UE1 A;  2K4K A;  1Q7Y C;  5JJI A;  4L5R C;  2IY5 B;  1X3E A;  5IYD G;  2BA0 A;  2ZM6 Q;  2CQO A;  1WI5 A;  3PUY A;  3J80 c;  3HKZ E;  3HKZ G;  3JC6 6;  3CCL A;  4MZ9 A;  4NXN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...