4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
4R1JA 1WCMH 3M4QA 3JAMi 1FL0A 2ZM6L 2E5LQ 4NXMQ 2NVQH 2ZTDA 3E9HA 4DV0Q 2JEBI 3G48A 4LF4L 5IP9G 3TEHB 1N33L 4DR5L 3PO2H 1GVPA 1N34Q 4JYAQ 2OTJA 1K0RA 1N32L 4NXML 4GNXB 1Q81C 3S24A 1V43A 2K50A 1X6OA 1U5KA 3CCEA 1IBLQ 2R7ZH 1Q82C 4ALPA 4DV7L 3G71A 2V1CC 4L5SA 4J15A 4TQUS 4LF5Q 2B63H 1J5EL 1OXTA 1YITA 1X55A 1IYJB 1YVCA 2NZHA 4BBRG 5H1SE 5IYDH 4A3IH 1XTDA 4KI0A 1A62A 5LMNQ 3NBHB 1YBYA 5GROA 3H3VH 3CCMA 4LF8Q 2QA4A 1W2BA 4JI1L 4P75A 1IXRA 4JI2Q 3ZJYC 4DPGA 3U58A 1R9TH 3CCSA 4DV4Q 4LF7L 4AIMA 5IYDG 2Q2UA 2R93G 4PZ6A 2MQHA 4NXNQ 4OWWB 2ZJQA 2B63G 1G6PA 1PH1A 1CKNA 2N78A 4A3LG 2JA8H 1SE8A 4DV2Q 2OTLA 4LF7Q 1YI2A 1NMGA 5IYBH 5GAEC 3AQQA 1YJ9A 4RMFA 3ULPA 4DUYL 1VQFA 4B3TL 4HIOA 1YHAA 3HOVH 3SGIA 5FJ8H 4DR6L 4BY1H 1PYBA 4APVA 4BBSG 4KHPQ 3UE0A 1G51A 4P71A 2ID0A 4JI7Q 1CSPA 2JA6H 4IOAA 4HJ5A 3GTPH 4A3DH 2UUAQ 3RR5A 4LF5L 1PH6A 3WWVA 1J5EQ 1WCMG 4JBMA 5FJ8G 3H15A 3CP0A 3CCLA 5LMNL 2ASBA 1K3RA 1A63A 1CKOA 1VCIA 2AKWB 4XTCS 2I5HA 1PH3A 5C4XG 2EQSA 3HKSA 3M9BA 3I56A 1IBLL 3GTGH 1TWFH 4NPSA 1FVIA 3S2DH 5IY0A 4AQYL 1Y1VH 2JE6I 3CC7A 4A4IA 3K81C 3J7ZC 3W1GA 1A8VA 3CCJA 3ULJA 1Y1VG 4HIMA 1JB7A 3EN2A 2OQKA 2I5LX 5FLMG 2UXDL 4A3GH 2R7FA 3PUVA 1LUZA 2PI2A 5C3EG 1L1OC 1Q7YC 1TWCH 2NZOA 4JCVE 2VL6A 1KAWA 1QVCA 5ELNA 5J3BA 1X3FA 1KRSA 4DV5Q 3BZCA 1S3OA 4JV5Q 3CAMA 1PFSA 2D62A 1HNXL 1L2FA 2UUAL 2BH2A 5M3FG 4DR2Q 2IX1A 3CD6A 2B29A 1XNRL 3A0JA 4HJ7A 1HZAA 2ALYB 2UUBQ 4R4CA 4DV6Q 3L2PA 2R92G 3S1MH 4HIDA 1WFQA 4LW1A 2XTIA 4YHHQ 4BBSH 1N9WA 4JC0A 5M5YH 4Y52H 4C3HH 1XPUA 4DR4L 2HT1A 1I94L 4JBJA 1I3QH 5C44G 4A3EG 3M4PA 4DUZL 4BBRH 4A93G 5AJ3L 1WOCA 1X3GA 4GLAC 3CXCA 1Z9FA 1EQQA 4HIKA 2UXCQ 3PUZA 2AMCB 5IT9c 4X65L 2WAQG 4QQBX 1Q1EA 3PO3G 4GKJL 3RZOH 4DUZQ 1RIPA 1OXVA 5M3MH 1P8LA 5DLQE 2JJQA 5K36G 1UE1A 3B6YA 3OW2A 2E2HH 3S1NH 4A3DG 1SN8A 1IBML 1YEZA 2I5MX 4GS3A 4DV3L 5FLXc 3GDEA 1PH2A 4YWMA 3S17H 4JI1Q 3CC2A 1QUQB 2JA5G 2CWPA 4BA1I 1BKBA 3JAMc 1AE3A 2F52A 5EAYA 1HJPA 5M3MG 1JJ2A 3H0GH 2JK8A 4IFDI 4DNIA 1YHBA 3ER0A 4DV6L 4LUVA 1EIYB 2NVXH 1Q12A 3CCRA 1O7IA 1VQNA 1N36L 2A8VA 2VUMG 2B3GA 3F2DA 5LMNW 2JA5H 3KDFA 1KC8C 1AH9A 1NMFA 3AEVA 3KJOA 1VQ4A 1IBKL 4JV5L 1QVFA 3T1YQ 2KHJA 4DR7Q 5IP9H 1JT8A 4KHPL 1XMQQ 1BBUA 4UP9A 4JI7L 3ICEA 3L0OA 4XIGS 4KLKA 4HJAA 4WJ4A 3DM3A 1EUJA 3T1YL 2MFIA 3PUWA 4OONA 3J80c 3RN2A 4B3RL 1N8RC 1HR0Q 4LFCL 1VQDA 1XMOL 4DAYB 3GD7A 1WI5A 4FDBA 3U4VA 2JA7G 3HOUG 5JJIA 1KL9A 4LFAL 1MIUA 3UDIA 3CCQA 2OQ0A 3T1HL 1CUKA 1UE5A 3J81j 2NVTH 3A74A 3E9IA 2KCMA 1QZHA 1UEBA 3W5OA 3F1ZA 1GD7A 3ERSX 4X62Q 1VQEA 3GTMH 1IZ6A 4PZ7A 3RN5A 1X65A 5HGQA 3GTJH 5IWAQ 5M3FH 2UXDQ 1QZGA 3CW2C 4DV1Q 2HHHL 4H02A 1L1OA 2BA0A 3AFPA 3EBEA 5BR8Q 4B3ML 2JEAI 1WJJA 2FXQA 4MNOA 3RLNA 1YIJA 4A3JH 1YJNA 1PH9A 5C0XJ 1XMQL 3I4MH 3D31A 3TS2A 4A3BG 5BR8L 4A3MG 1S72A 4B3MQ 4LFBQ 2GN5A 3I55A 4DR3Q 1M90C 3FP9A 2EIFA 2RCNA 1VQMA 1KRTA 1ASYA 4JYAL 3U50C 2WFWA 3PV0A 1C9OA 5C0XG 1IBKQ 4LF6L 1YNXA 3PIOA 4GKKL 2WP8J 2R92H 4A3FH 4GN4B 1HR0W 2YYZA 4LF9Q 2AWNA 1VQKA 4BXXH 4X66L 4OO1G 2MO1A 3S1RH 4JI6Q 3FKIG 4GOPA 5IYBG 4TVAB 1VQBA 2CKZB 1I6HH 1X9NA 3GTOH 4AYBE 1JJGA 1K8GA 3OYYA 1VQHA 1LYLA 2JQOA 4EX5A 4DR5Q 1S40A 1HNZQ 4QL5A 4LFAQ 3STBC 1CKNB 3J81c 4DV7Q 3DLLA 1BBWA 1PVOA 1P16A 4A76A 4UP8A 4DR1L 1Q46A 5M5XH 2Q2TA 1FJGL 4NXNL 3HOVG 3HKZE 1HZCA 3HOYH 4LFBL 4OWXB 4A3IG 1LTLA 1EYGA 3M4OH 4DR3L 5IWAL 1NE3A 2UU9L 3HOWG 2K5NA 5IYCG 1Y1WH 1TWAH 2HIVA 3TS0A 4AH6A 4BA2I 2Y0SE 1HZBA 4GOPC 1PH7A 1XNRQ 2R7ZG 4X6AH 4P73A 4GLVB 2F4VL 5GAHC 3I2ZA 5C0XI 1HH2P 3KJPA 1PV4A 2UUCQ 3F2CA 3GTLH 1PH5A 1Q1BA 3W1BA 3S14H 4IPDA 2RHQB 4GNXA 4KHZA 2YTYA 1VQCA 4GN5A 1UE7A 4DR6Q 4K0KQ 1SLJA 1YZ6A 4YY3Q 2UUCL 4JOIA 5GADC 1JE5A 2ZJRA 1M1KC 1LM0A 2D0OA 1KHIA 1N34L 1W3SA 4OX9L 4PMWA 2VQEQ 2RF4A 2UXCL 2HIXA 4IJLA 1Z47A 3RLFA 4LUZA 2CQOA 2DUDA 1E1TA 3NELA 4P74A 2UXBQ 3A5ZB 5JJKA 4JI8L 2BA1A 1K83H 2N8NA 1EWIA 4IJHA 2CFMA 3F2BA 4X64L 4OWTB 2PQAB 3S15H 4QY7A 1I50H 3K8AA 3K7UC 4A75A 3PUXA 1MKHA 1VQLA 2C35B 5GQOA 3HOZH 4BY7H 4POGA 1NTGA 5M5WH 2KHIA 5IE8A 2N3SA 2VQFL 1NJIC 2K52A 2N49A 2CCZA 2PMZE 2PQAA 5C44H 4MTNA 1XPOA 2Z6KC 2E2JH 3TRZA 4LNQA 2DGYA 3CPWA 3HKZG 4A3KH 1XJVA 2YTVA 4P72A 4JI4L 3PCOB 3I4NG 2AHOB 4IFDG 2NN6G 1BVSA 3NENA 3TQYA 4DV5L 4DUYQ 2ES2A 4O0AA 1DGSA 1JJCB 4IPGA 2WB1E 2IX0A 1KD1C 2YU9H 3PO2G 4LF6Q 1Q8KA 2A1AA 5JEAG 1Q86C 2Y0SG 1E22A 5AJ3Q 2LXKA 3STBD 3KF6B 3RNUA 1KIXA 3CCVA 2K5VA 1U0LA 3G6EA 4AQYQ 1Y1WG 4GKJQ 4LF8L 5C4XH 4OX9Q 4ME3A 4O2DA 4QIWE 4HJ9A 1YJWA 1IL2A 3H3VI 4UY8C 4GOPB 4A93H 2IHEA 1I94Q 2L15A 2A19A 3I7FA 5C4JH 1XPRA 1JMCA 1WYDA 1TWGH 2KCTA 1Y14B 1QUQA 1VQJA 4GLXA 2Z6KA 2VQFQ 1ASZA 2K4KA 1MJCA 3UDGA 1VQ9A 3UDFA 2I0QA 3ULLA 4JI3Q 3J80i 1SROA 2R7DA 4GN3B 1HNXQ 2IHFA 4B3SQ 5LMUQ 3BU2A 4QJFA 3RZDH 5E7NA 1VQPA 3KLWA 1PH4A 2PNHA 2YV5A 4C2MH 1CKMA 3CMAA 1B7YB 4DK3C 1L1OB 2NN6I 2R93H 1SFOH 5FLMH 1OTCA 1EOVA 3TREA 2VW9A 4JI4Q 3G4SA 4DV0L 1PA6A 1N36Q 1EQRA 1N33Q 3CF5A 1UE6A 4L5QA 4RG1A 2UUBL 2OWOA 1N32Q 4JOIC 1TWHH 3MXNB 1GKHA 1VQ5A 3M3YH 1CSQA 2K5HA 3CQZH 2R6GA 4DAMA 2WB1G 2E2IH 2LXJA 1VQ7A 1K9MC 1C7YA 3HOZG 5ELOA 4BY7G 4DV3Q 4YWLA 4QGUA 2IT1A 1I5FA 4JI8Q 1RL2A 4UP7A 2F3IA 2MO0A 3A5UA 2Q2HA 1X56A 1FJGQ 4JI5L 3KYHC 1J6QA 4IOCA 4DV4L 2HQLA 2K75A 1B8AA 3OTOQ 2KBNA 1SR3A 1E3PA 4HJ8A 1MJEA 2XGTA 3LGJA 3CC4A 1YHQA 4B3SL 1VQ6A 1X3EA 2Q2IA 4DV2L 5HY6A 4A3LH 3CMEA 2IY5B 1VQIA 2HHHQ 3HOWH 3M7NA 4A3GG 4DR4Q 3GO5A 5JEAJ 1OXXK 3UE1A 1KQSA 4DR2L 4L5TA 3FHWA 1TXYA 1VQAA 4K0KL 1NBWA 4X66Q 1VQGA 3KF8B 4AYBG 4YY3L 1H95A 4YHHL 4JI6L 2QEXA 3PSIA 4EQ5A 1A0IA 3MEFA 3T1HQ 1VS0A 2AWOA 4L5RC 4A3CH 4YCVA 5IP7G 4GKKQ 1E24A 1IBMQ 3AFQA 1D8LA 3JC66 4LFCQ 3E0EA 3FKIH 1SRUA 1C0AA 3HFZB 3HOXH 4X65Q 4JBKA 1OXUA 1XMOQ 4DKAC 3L7ZC 4BXXG 4OO1I 5C3EH 1B70B 4C3JH 4IPCA 1GO3E 2VS1A 4X64Q 2EXDA 4A3FG 2JA6G 4DV1L 3GTKH 2KENA 3OTOL 4R4IA 4JI2L 3S2HH 3K0XA 3CPFA 2WAQE 1AE2A 3EIVA 4UPAA 1QVGA 3VDYA 3I4NH 3AYHB 4LWCA 1PYSB 3BZKA 1L0WA 4X62L 2MNAA 1K8AC 1HNWL 4JI5Q 2QGQA 3M85A 5JJLA 3KOJA 3S1QH 3Q8DA 4DR7L 1SMXA 1K73C 5LMUL 4Y7NH 4JG2A 4JI0L 2ATWA 2GVBA 3UDXA 3KFUA 4A3CG 2D0PA 4A3JG 3I4MG 1HNWQ 2ZTCA 1XNQQ 4A3EH 3KDFB 1PHJA 3I4OA 2OCEA 4YCUA 2ZJPA 3S16H 2RHSB 2PI2E 1FGUA 4IO9A 4NB3A 4PZ8A 1GM5A 1EFWA 4LF9L 4R4QA 1D7QA 4C3IH 2VY3A 4YCWA 3F8TA 3K80C 3K7AH 2GVAA 4JBWA 4PG3A 4A3BH 2ZM6Q 2E5LL 2VNUD 4A3KG 4B3RQ 3BJUA 3J81i 2BH8A 4OXPA 4R4TA 4DK6C 3PIPA 2JA9A 1HR0L 4B3TQ 1KXLA 4POFA 2UXBL 2JA8G 3NEMA 4IFDJ 1T9HA 2Z0SA 3RLOA 4DR1Q 2E8GA 3KF6A 4LUOA 3CCUA 4GNXC 4YWKA 4WJ3M 2VQEL 3GTQH 1NY4A 4IPHA 3D0FA 3PF5A 1X54A 3PUYA 1OXSC 1UWVA 3U4ZA 2CWAA 1HNZL 2K14A 4BY1G 4MZ9A 3PF4A 3HOXG 1G291 4JI3L 2NVYH 2ZTEA 1XNQL 5GAGC 1PH8A 3PO3H 2JA7H 1VQOA 1V9PA 1EIFA 3IRBA 3HOUH 4A3MH 3J7A5 2VZAA 5IP7H 5IYCH 1V1QA 3PGZA 2VUMH 2F4VQ 1HZ9A 2YTXA 1E1OA 4LF4Q 1VQ8A 4JI0Q 3HOYG 2UU9Q 4R4OA 2LSSA 3H0GG 1E7ZA 2H5XA
chains in the Genus database with same CATH superfamily
2DNEA 1WCMH 4R1JA 1FL0A 2E5LQ 4HCEA 1PTOD 2QF7A 4DR5L 1EEFD 5I2XA 3HOUB 1Q81C 3S24A 2R7ZH 1Q82C 4ALPA 4RWSC 4L5SA 4J15A 4ZLTF 1OXTA 3K5MA 1YITA 1IYJB 4A3IH 2EJGC 3KK7A 5GROA 4KY7A 1PTOB 5DEHA 4ZCKA 3CCMA 1PDQA 1J8IA 2EZVA 4JI1L 4JI2Q 3ZJYC 3OW7A 1RD9D 1EEID 2K03A 4LF7L 5IYDG 4PZ6A 3TSSA 3CQZB 4ZUJA 3Q0AA 2JA8H 2B2TA 4LF7Q 5IT9L 1YJ9A 2Z4HA 1VQFA 4DF7A 4B3TL 3K5LA 3HOVH 1JC7A 1XXGA 3KBGA 1PYBA 1B1ZA 5IOCA 3UE0A 5G3LD 4P71A 4F87A 1HA6A 1XYIA 1CSPA 3EFXD 1K83B 2A5HA 3RR5A 3TP5A 3WWVA 2DJFC 3A7AB 1EY9A 3FVQA 3O13A 1SNCA 1G91A 1PH3A 2AKWB 3R93A 2AUJD 3GTGH 1TWFH 3OOCA 5CV8A 4NPSA 3S2DH 5IY0A 3VYSA 4BBSB 4U673 3S14B 3OIQA 3ULJA 5JVH3 2K5QA 1KNEA 2I5LX 5FLMG 4A3GH 3I4NB 1Q7YC 1JICA 5CV9A 2F0UA 2MGSA 1KRSA 1MSGA 2BH2A 1HNXL 4CJ1B 3IAYA 5M3FG 4DR2Q 3HOXB 2R93B 2B29A 1HZAA 1SYFA 2R92G 1I4PA 3RMHA 3C3LA 3V2TA 1PXUA 2NTSA 2IPKD 4JBJA 4TRDA 4DUZL 4BBRH 4DAVA 1X3GA 4FF4A 1Z9FA 4V190 2AMCB 2XRQD 3SVMA 3RZOH 5M3MH 3NBHA 1P8LA 2EYJA 1GXDC 3DEOA 5CR3A 1UE1A 4WORA 2E2HH 2X6GA 3H91A 5D3IB 1SN8A 1IBML 3GDEA 1KLUD 4YWMA 4LK1C 3S17H 3PIP3 1QUQB 1BKBA 3JAMc 2O4XA 2AQ2B 1O7LA 4A3JB 1B3AA 1N36L 2VUMG 4RAUC 4A3BB 3KDFA 1KC8C 2QILA 3I4LA 4J6HA 1QVFA 3T1YQ 1JT8A 2A6EC 4KY6A 3EJIA 4FXDA 3RN2A 4KJOA 1TVXA 3N52A 3A8IE 1VQDA 3L3OC 3GD7A 3U4VA 5JJIA 4KY5A 1BR9A 1MIUA 3CCQA 2OQ0A 3LNNA 1IHZA 4MN3A 2NYZD 4G7ZC 1LABA 3MEHA 4QUCA 4R9WA 4WFN3 4PZ7A 1C48A 3TP7A 4DV1Q 4H02A 1KNAA 1F2YA 1I6HB 2FXQA 5A2QE 1YIJA 1EYAA 3I4MH 1PH9A 1XMQL 2K7VA 3M7GA 3TS2A 4A3MG 2Z9HA 5IT9E 1PZID 3NUCA 3I55A 4ID6A 2EIFA 1VQMA 3GV6A 2D9UA 1A3TA 4C1NK 1RJTA 3PIOA 5FLXL 1ONLA 4A3FH 1A3VA 3HOZB 1QE6A 4LF9Q 2AWNA 1VQKA 4X66L 2D5DA 4GOPA 2N55A 1TS5A 1V1OA 3SHLA 1CKNB 3J81c 3OWFA 4NDXA 1PVOA 2G9DA 4UP8A 5M5XH 4DR1L 2Q2TA 5DAUA 1BCPF 1F9QA 5HURA 5CV4A 1NE3A 2B63B 4IZ8A 3TS0A 1VMPA 4BA2I 3HOVB 1HZBA 1XNRQ 4X6AH 3HS0C 2MJ8A 5GAHC 3GTLH 3F2CA 1MD2D 2EY1A 1G2TA 3P20A 4K0KQ 1UE7A 4BBRB 2QDLA 3K7AB 3BYTB 3K5NA 1LM0A 1LTAD 4PMWA 1J9OA 4S3SA 5I2YA 1SNOA 1HQRD 3RLFA 3NELA 4JI8L 2KVMA 2BA1A 1AZPA 4IJHA 3F2BA 3N6RA 3K8AA 3K7UC 2C35B 3HOZH 1KABA 2KHIA 4KTAA 2K52A 5CV5A 3F2UA 3TRZA 4LNQA 3X3MA 3TN2A 3HKZG 4JI4L 3PCOB 4C3HB 4IFDG 3TQYA 4DV5L 2KUMA 3HP3A 4B3TQ 3K6OA 4CKCA 1DGSA 4IPGA 2ES2A 4LF6Q 4IFDH 1Q8KA 1PFNA 2A1AA 2Y0SG 3T13A 5AJ3Q 3Q23A 2EY2A 1K8MA 4CHTB 1EL0A 3CCVA 2K5VA 3G6EA 4DAPA 4GKJQ 3NE5B 4LF8L 3S1NB 1I4QA 3MXUA 1YJWA 3W2DA 1JMCA 3TP8A 5EPLA 4GLXA 2Z6KA 2VQFQ 4ZKBB 1EQTA 4RFBA 3J80i 1SROA 2L55A 4XQNA 4X3SA 2OEOA 4XT3B 2F0TA 3R8BA 3K57A 1I4XA 4KD3A 1TQOA 1PH4A 3VA7A 5J39A 4M1UB 1CT1D 3MXNA 5CC4A 4PMBA 1SFOH 1UEAB 1H9JA 3TMEA 4A3FB 2PYKA 5COYA 1JOQA 3MHBA 1DYQA 1N33Q 1UE6A 4L5QA 2E2HB 5M5WB 3M3YH 1DXMA 1JWMD 4F88A 3TZUA 2ICEC 5ELOA 1CZWA 1DZ1A 2IT1A 1I5FA 3VR3A 2K5DA 2PZTA 4RKBA 1EY8A 3D4DA 3KYHC 3NBIA 1S5DD 2EYFA 2L11A 3QOJA 1ML0D 2BE5C 2HUGA 1MJEA 4Y7NB 3SXHA 4DXGA 4A3LH 1YHQA 1K28A 3G6JB 3GTLB 2HHHQ 4A3GG 3UE1A 1IKMA 1F77A 2KQ3A 2C9OA 4ABNA 1FNUA 4DAYA 1GHJA 4X66Q 1H95A 2AQ3B 4ZK9B 4EQ5A 3MEFA 1MBYA 1D1KA 3UI2A 1CHPD 3TP6A 1GUWA 2B2TC 4DNRB 3FKIH 4LJZC 3HFZB 2A68D 2KEDA 5IGGA 4RGTA 1IKLA 3L7ZC 5EBCA 4DKAC 5J22A 2VS1A 2EY6A 5C4ZA 3K0XA 3I4NH 4FP5D 3AYHB 1CI3M 1PYSB 5J1ZA 4RCOA 4KKSA 2B2VC 3KOJA 1O78A 2ATWA 1F2MA 2GVBA 2WACA 4HTHA 4A3CG 5BN5A 4A3JG 4OO1H 1XNQQ 3KDFB 5FLXE 5EGTA 2OCEA 2ZJPA 2RHSB 1E2WA 1EFWA 4R4QA 4K2LA 2HD3A 1F9PA 3F8TA 3K80C 5KYLA 3K7AH 3A7LA 4PG3A 2ZM6Q 5ELFA 1E2VA 3AB9A 2XIWA 2BH8A 4OXPA 1JWUD 2EYHA 4R4TA 3KBXA 1SSOA 3QB3A 2UXBL 1LT5D 4QB4A 2Z0SA 3RLOA 3I90A 4YWKA 5EQ0A 4IPHA 4CKEA 1A2UA 3GTKB 3KLRA 5IIFA 1UWVA 3U4ZA 2CWAA 1HNZL 1G291 4JI3L 3D8GA 4RA8A 3HOYB 2K33A 1XNQL 5FKAC 2B2UC 2JA7H 4R8NA 3IRBA 2EYOA 1T5EA 3J7A5 2PO4A 1V1QA 3QWNA 4V0BA 2KCCA 3NPPA 5JAVA 3A55A 2RQXA 1QWYA 3NSWA 3JAMi 3EVQA 5M5YB 3E3XA 2ZM6L 4NXMQ 2NVQH 3E9HA 3G48A 4A3DB 4NW2A 1N34Q 4RKLA 3PO3B 4JYAQ 1XX8A 1MGSA 3P1HA 4GNXB 1A6XA 2FMMA 1ICWA 1V1PA 4EQNA 4DV7L 1G6ZA 5FO7B 1LTTD 2ZT9C 1B44D 1J5EL 3J7AV 4RGOS 2LKVA 2NZHA 3MTSA 5IYDH 1PYWD 3SE0A 3NBHB 1YBYA 5EBDA 1L0XB 4NMZA 4B08A 1TR5A 2XWBB 5TSSA 4P75A 1R9TH 4DPGA 1CQVA 4CKBA 3CCSA 1GOZA 2WINB 1BCPD 3TZDA 4NXNQ 1PH1A 3OSOA 1SE8A 2RKSA 4I65A 2KECA 4DUYL 3SGIA 4DR6L 4APVA 3SK4A 1I50B 3A8JE 1G51A 3OMGA 4JI7Q 2F0IA 2UUAQ 4LF5L 1PH6A 2KJXA 4JBMA 5FJ8G 3H15A 2PCFB 3CCLA 4RCNA 2ASBA 2IW3A 3FKIB 1NCVA 2FFKB 1DD2A 1UUPA 2EYPA 4X3KA 2QW7A 1R4QB 2JE6I 5C3XA 5D65A 1A8VA 2ENBA 1JB7A 4HCSA 2OQKA 2UXDL 2TMPA 3OPOA 3URYA 2R7FA 1TIID 5C3EG 3CRLC 1L1OC 4RHRA 2L9HA 4JCVE 3CKIB 1TWAB 2VL6A 4DV5Q 1QVCA 2CH4W 3BG3A 3NQTA 4JV5Q 1RTOA 4HR7B 2H4OA 3JAML 1QB5D 4DV6Q 3S2DB 1TS2A 3D3RA 1PMRA 4IALA 4K5XA 4JK1C 4HIDA 3S1MH 4LW1A 4L6TB 1FD7D 2QCPX 2VXWA 4YHHQ 4BBSH 5M5YH 4C3HH 4DK1A 1X3QA 1SE3A 2VB3X 1I94L 5AJ3L 2F0KA 1QJOA 2M00A 3NTHA 4HIKA 3S1RB 4X65L 4PQXA 2WAQG 3PO3G 1K3BC 5EJWA 1OXVA 3S1NH 4A3DG 1DCZA 4GS3A 2IWHA 1CM9A 3CC2A 1QNKA 2CWPA 4BA1I 2B2UA 4FYDA 1AE3A 1HJPA 1JJ2A 5CV7A 2JK8A 1DONA 1WTWA 1WTRA 4DNIA 2F0MA 4IFDI 1PRTD 3CCRA 3I4MB 2A8VA 2B3GA 3F2DA 2JA5H 2RA4A 1NMFA 3BDOA 3AEVA 1IBKL 1HTLD 2E2DC 2E2JB 3GTMB 4NKLA 4KHPL 4UP9A 3ICEA 3L0OA 5FOBB 4HJAA 1STAA 3DM3A 1N8RC 4LFCL 2NUCA 4H44C 2F0GA 2PNRC 1X3PA 4FDBA 2JA7G 2OXPA 1KL9A 1RKNA 1ZKOA 2EY5A 2Y0SB 5JVG3 2EDGA 2NVTH 3DUZA 1I4HA 4G57A 3D6CA 1VQEA 2O5JC 2JP1A 1C8CA 1YNJC 2UXDQ 5BR8Q 2BA0A 2F0DA 3M4YA 1WJJA 3T4AC 3EQLC 3MXPA 4A3BG 1SNMA 1B3QA 4LFBQ 1YNNC 5ELBA 4DR3Q 1M90C 2PW7A 1KRTA 1PZJD 4X3UA 2Q8TA 1WTVA 2WFWA 5C0XG 4HMIA 1E0BA 1U9RA 2ZXPA 4GKKL 2WAQB 2R92H 3OHXC 3M4OB 1U4PA 1GUSA 2YYZA 4O42A 3S15B 1EZ6A 5IYBG 1BCPC 1PLFA 4TVAB 3T53B 2JA8B 1I6HH 1X9NA 3FEWX 1LV9A 1K8GA 3X3NA 1U4RA 2NZ1D 1RODA 1BBWA 4OELB 1Q46A 3E6ZX 1FJGL 4DN4M 1K0SA 1UAPA 1HZCA 4LFBL 3PQIA 2PPBC 5KEEA 2K5NA 2B8GA 3HGBA 3K0YA 5IYCG 1Y1WH 1SE4A 3FPUB 1Y8PB 3KJPA 1HH2P 2UUCQ 2K6AA 3QIAA 2F0JA 2YTYA 4GN5A 4DR6Q 1N32L 5I4DA 1SLJA 4M8AA 1M1KC 2D0OA 2EJFC 4QMGA 1SDFA 1KHIA 1R9TB 1N34L 4OX9L 2RF4A 5CBAE 1Z47A 2LFNA 2O2LD 4H7BA 1A2TA 2DUDA 2MPMA 2XVSA 1IYVA 3BYYB 1AW7A 3S17B 1LT6D 4FF3A 1K83H 4ZQ3A 3J80L 2CFMA 4CDFC 3S15H 4QY7A 1I50H 4A75A 3PUXA 2X6LA 5GQOA 1SYEA 4POGA 2XRSD 3V96A 5IE8A 2SNSA 1O7ZA 4ME5A 2PMZE 2HDLA 5LL6S 3CPWA 4RHSA 1XJVA 3I72A 2YTVA 2AHOB 2WKDA 4KN7C 1JJCB 4IURA 1Q86C 2L5TA 1OO9B 3GTJB 1E22A 4HSVA 3NQIA 2RDFA 2XWJB 3KF6B 3LWUA 2CHBD 2NVTB 1IL2A 4ME3A 4O2DA 3MWYW 4QIWE 4HJ9A 3H3VI 4A93H 4GOPB 1I94Q 3I7FA 4ZUIA 5A2QL 1XPRA 1WYDA 2KCTA 1Y14B 1TS4A 5CYUA 3JAME 3PO2B 2DNCA 1VQ9A 2PMZB 3Q22A 4EVOA 4KJNA 2FHTA 3W3AA 1B4OA 4GN3B 5LMUQ 3BU2A 5KYIA 3RZDH 5E7NA 3KLWA 4A3MB 5C4HA 1CK1A 2JA5B 2PNHA 3FPPA 4C2MH 1CKMA 1STNA 2KEEA 3G7LA 4DK3C 4R8IA 3MAQA 2NN6I 4A3IB 1LLRD 5FLMH 3T16A 5C4JB 2H1EA 2VW9A 1N36Q 2K1BA 5G3LF 5C0XH 5EPKA 3CF5A 1IW7C 1TWCB 3KUPA 1CFMA 4OIKA 4QCLA 1CSQA 2EPBA 4DAMA 3CQZH 2R6GA 2WB1G 2LXJA 1VQ7A 1F2ZA 1SFOB 1C7YA 4HN7A 4IUTA 4BY7G 3WDNA 1IL8A 4ZAIA 5JEAH 4UP7A 1LTRD 1F2LA 3MZ5A 1JR0D 2MO0A 3A5UA 1WTHA 1X56A 4G7OC 1SNDA 4ULLA 1BOSA 1W6KA 3SR1A 4KKUA 2HQLA 1B50A 3FMCA 3OTOQ 2KA7A 1O7YA 3LGJA 3NK9A 1X32A 1X3EA 2Q2IA 4DV2L 2IY5B 1VQIA 3GO5A 1HUNA 2RBMA 1KQSA 4DR2L 3AU7A 5D14A 3FHWA 1HTPA 1BUVT 2B2VA 4K0KL 4AYBG 4JVZA 3PSIA 1A0IA 2M9VA 1HFNA 3OWEB 5M5XB 3T1HQ 4A3CH 4YCVA 1SE2A 3RZDB 1D8LA 3JC66 2DN8A 1SRUA 1ZYRD 3HOXH 4BXXG 5C3EH 2F0SA 4A3EB 1GO3E 4X64Q 3GTKH 2KENA 3J80E 4R4IA 4JI2L 4KK7A 2TSSA 1H9SA 4UPAA 1AE2A 3VDYA 1U4LA 3BZKA 1L0WA 4X62L 1K8AC 1SNPA 4JI5Q 3M85A 2CH4A 4ILWA 2R92B 3Q8DA 3PIO3 1ESFA 1SMXA 3UDXA 3SK6A 2D0PA 3I4MG 1BCPB 4WRDA 3I4OA 3IFTA 1PHJA 1D5XC 2L4NA 1FGUA 4NB3A 1GM5A 4LF9L 4CDDC 1CTMA 1II3A 2GVAA 1JOKA 4KKTA 2E5LL 4XYOA 2VNUD 4B3RQ 2BCOA 1H9MA 2JA9A 1HRJA 2G5DA 3H94A 2JA8G 4TKOB 2X69A 2MHVA 4P2CB 5ISRA 2E8GA 3EROA 4LUOA 4GNXC 4DA2A 3D0FA 1X54A 3PUYA 1OXSC 4FNFA 2RDGA 2NVYH 1VDZA 1CA5A 3HOUH 1V9PA 1EIFA 4PMCA 4A3MH 5IP7H 2Q8IB 4PNYA 1HZ9A 2L1BA 3VR5A 3NWTA 3ND9A 1VQ8A 3HOYG 4R4OA 2LSSA 3H0GG 1E7ZA 2H5XA 3S16B 3M4QA 1WVLA 2HCIA 4DV0Q 4LF4L 5IP9G 1N33L 1GHKA 1GVPA 1K0RA 3SDZA 4PV1C 3BS1A 1EIHA 1EZ8A 2JXMB 2A69C 2LS01 4LF5Q 1X55A 1VMCA 1YVCA 5H1SE 1XTDA 5LMNQ 4U68A 4K5VA 2QA4A 1IXRA 3DMUA 4DGZA 5KNCA 2RDHA 2P5ZX 2KCNA 4DV4Q 1Y8OB 5IGCA 2R93G 4K6DA 2HQEA 1M4VA 2BE5D 4XXEA 2MQHA 4OWWB 4WJWA 3SEBA 4A3LG 2N78A 4DV2Q 2OTLA 5IYBH 5GAEC 3ULPA 1YHAA 5FJ8H 2IX3A 1JE4A 4BY1H 4BBSG 4KHPQ 3LWEA 3S2HB 3QO2A 4E6IA 4HJ5A 4OEMB 3LX0A 1WCMG 4EQOA 1K3RA 1CKOA 1VCIA 5C4XG 2I5HA 3I56A 3HKSA 1IBLL 1FVIA 1EFID 3CU7A 1EIGA 1Q8IA 1Y1VH 3ERQA 5EKKA 4Z9CB 1G8ZD 4A3KB 5ELEA 4A4IA 2B2WA 3K81C 1STBA 1Y1VG 4HIMA 1O80A 3NTIA 3PUVA 5FO8B 2PI2A 1CZGA 1MSHA 1TWCH 2FJ2A 2NZOA 3I91A 3HOWB 5J3BA 3BDLA 1X3FA 1EU4A 1HUMA 3BZCA 1PFSA 2HDMA 4I7ZC 3CD6A 2C5CA 4C56C 2ALYB 2UUBQ 4R4CA 1WFQA 1KDCA 2F0WA 1N9WA 4JC0A 3MFGA 1NR4A 1JORA 3VYUA 3T56B 1PRTF 1EOTA 5C44G 2A6HD 1WOCA 3CXCA 1EQQA 2UXCQ 1ZEQX 1RIPA 5DLQE 1NNXA 5K36G 3B6YA 3OW2A 4ODGA 5KIXA 1YEZA 3GTQB 1PH2A 2PW5A 1RDPD 4C3JG 4JI1Q 1LTID 5E4XA 2JA5G 4A3GB 2F52A 3H0GH 4IUUA 3D6WA 1YHBA 4DV6L 2NVXH 4LUVA 1F9RA 1I6VC 1Q12A 2B8FA 1O7IA 1VQNA 5E1FA 1EYCA 4YIJA 5LMNW 1I4RA 4DR7Q 1NSNS 1WTQA 1SAPA 4IN3A 1BBUA 4XIGS 4K2KA 3J81L 2BOSA 1EUJA 2MFIA 5I9PA 1HR0Q 1Y69U 2PZUA 2XNAC 2CVRA 1HA5A 5CORA 4A93B 1CQFA 3QJYA 5C4XB 4OIJA 1B9MA 2PQEA 3HOUG 1AN8A 3UDIA 4JW0A 2NBFA 4K14A 3RZOB 1CUKA 1UE5A 3J81j 1WCMB 3A74A 1ZXTA 3E9IA 2KCMA 1QZHA 1PFBA 1BQQT 2KHSA 4X62Q 1LTGD 3NP8A 1IZ6A 1A15A 2NN6H 3RN5A 5HGQA 3GTJH 5IWAQ 5M3FH 2ZXRA 3CW2C 5IGDA 1L1OA 3AFPA 3EBEA 1BBXC 1D1IA 4UHVA 4B3ML 2JEAI 4MNOA 1HXYD 1YJNA 5C0XJ 4B9XA 3H09A 5BR8L 4B3MQ 4FF2A 2SNMA 1PTOF 2E74C 5I6YA 1EU3A 4N9TA 2A74C 1S5BD 3KLSA 2JYOA 1Z6HA 2WP8J 3R2IA 2GA4B 4GN4B 5C3WA 4BXXH 4OO1G 1I4GA 1CHQD 4JI6Q 3FKIG 3ONAB 2AUKA 1W6JA 1JCKB 4AYBB 5BN3A 4H13C 4AYBE 2F0NA 3C1FA 4ZYSA 2F03A 3OYYA 1PFMA 1LYLA 1VQHA 3KF8A 3OIPA 4EX5A 1HNZQ 1XTCD 4LFAQ 5KGUA 5C44B 3DLLA 4A76A 4NXNL 2EE1A 1SYDA 3HKZE 3HKZB 5IODA 1B53A 1KDAA 4OWXB 1KDBA 1LTLA 1EYGA 1Y8NB 5IWAL 4DR3L 3M4OH 2F0OA 1TWAH 4O1NA 2HIVA 4IUVA 4QIWB 1Z7TA 2RSNA 4K6LA 2Y0SE 1PH7A 2FINB 2R7ZG 3D4RA 4GLVB 4Q5VA 2K05A 1PV4A 3HZXA 1Q1BA 3W1BA 5DM73 1ET9A 1QNUA 3S14H 4IPDA 4X3TA 2AQ1B 4KHZA 4GNXA 1GUNA 1YZ6A 2EXZA 2UUCL 5GADC 2ZJRA 1JE5A 4CDEC 3TBIB 3NXWA 3NTKA 2UXCL 1LT4D 5FO9B 4P74A 2UXBQ 2LY7A 2RSOA 3I3CA 3RD4A 3A5ZB 5ELCA 4C3IG 1EWIA 1F9SA 1BO0A 4X64L 4OWTB 5IGEA 1D5MC 1MKHA 1VQLA 3R3OA 1NJIC 1YNJD 1LO5D 3DEPA 2PQAA 5C44H 2E2JH 2DGYA 4TSSA 1PTOC 5A35A 1Q3LA 1BVSA 3C2PA 2YU9H 5C5LA 2IX0A 5K5PA 3S9WA 2G9HD 2J4XA 5JEAG 1JB3A 2LXKA 3M3YB 3STBD 4N9PA 3RNUA 1KIXA 4AQYQ 1Y1WB 4OX9Q 5CV6A 1QILA 2E76C 2L15A 2F3WA 2CQAA 1TKWB 1TWGH 1BNZA 3KLSX 1QUQA 1VQJA 5KNBA 2Z8LA 4OHJA 3C46A 1ASZA 1DM0B 1LACA 3VYTA 3UDFA 2I0QA 3DWPA 4K8JA 3ULLA 3HG9A 3J7AF 1HNXQ 2F0VA 2NWGA 1WD0A 2CW0D 1NAPA 1GUGA 3E0JA 1HQMC 5DM63 4QJFA 4J8QA 5EKLA 1VQPA 1SJHD 2JSOA 3CMAA 1B7YB 1RTNA 3QR8A 2R93H 3IL8A 3TREA 1ILQA 4F8MA 2ICIA 4RG1A 2UUBL 4BY1B 2OWOA 4JOIC 3MXNB 1PRTC 3I73A 4BS9A 2K5HA 1E2ZA 2E2IH 2BDOA 1SBBB 4KHVA 3HOZG 4YWLA 4QGUA 3I70A 4C3HG 1FGBD 4FVMA 1RL2A 2SEBD 1HPCA 5HGTA 2Q2HA 1FJGQ 1FNWA 3DWAA 1J6QA 4IOCA 4DV4L 2VB2X 5M9OA 1M8AA 4LMQD 2KBNA 1SR3A 1TT2A 4HJ8A 2XGTA 4B3SL 5LL6X 5HY6A 1B2TA 1EY6A 3HOWH 3M7NA 1ILPA 3MFYA 5JEAJ 2F0PA 1S4ZA 4L5TA 2NVQB 4C3JB 3KF8B 1DOMA 4JI6L 1H9SB 2HCCA 4GZYC 3AFQA 3WOEA 4MIUA 1C0AA 4X65Q 1OXUA 1XMOQ 3Q24A 3H3VC 5CBEE 1STHA 4A3FG 3R2TA 2JA6G 1HFGA 3S2HH 3EIVA 2V4DA 4LWCA 4XYQA 2QGQA 3S1QH 4EQPA 5LMUL 4JG2A 2PZWA 3Q6SA 4N8FA 4A3EH 1VF7A 2A6ED 4IQZA 4YCUA 2K28A 4IO9A 4OL7A 2SDFA 2KOLA 1D7QA 4C3IH 2MP1A 4YCWA 2F0FA 4A3BH 1ENFA 1S5ED 3PIPA 4DK6C 1KXLA 5E4WC 2EYMA 4IFDJ 1SEBD 4DR1Q 3KF6A 1DOLA 3GTQH 1KLGD 5D3DA 3PF5A 1YNND 4G4KA 5T1GA 4BWGB 2OT2A 2K14A 3VR2A 4BY1G 2XSCA 3PF4A 5GAGC 2A6HC 1VQOA 4HEDA 4EGVA 3PGZA 1WD1A 3MVVA 2YTXA 4XDXA 4DR5Q 1BXTA 2ZTDA 2NVYB 3TDQA 2JEBI 4KMUC 2L0CA 3TEHB 3PO2H 2JA7B 2OTJA 3IKJA 1L0YB 4NXML 1V43A 2K50A 1X6OA 1U5KA 4FXGC 3CCEA 1IBLQ 3I8ZA 3G71A 2V1CC 4ZRZA 4TQUS 2B63H 1EY7A 4BBRG 4KI0A 1A62A 3H3VH 3OMCA 4LF8Q 1W2BA 4KD4A 3U58A 4AIMA 2Q2UA 1A3UA 1SXTA 3CRKC 5EPJA 2ZJQA 2B63G 1G6PA 1AEXA 1CKNA 5FK9C 2QKIC 1T5XD 1YI2A 1NMGA 3AQQA 4RMFA 2IL8A 3E5SA 4HIOA 1TWGB 5M3MB 2I07B 2EVBA 1IYUA 2JA6B 2ID0A 2JA6H 4IOAA 4A3DH 3GTPH 1TY2A 4C1NI 1J5EQ 2R61A 3CP0A 2RCFA 5LMNL 4C3IB 4XTCS 4CGYB 2EQSA 4DK0A 2R3ZA 3M9BA 1MHWC 2ZXOA 4IUQA 5L37A 4AQYL 1QOHA 3PMFA 3GTOB 1QCBD 3CC7A 1SJED 3J7ZC 3W1GA 5F2DA 3CCJA 3EN2A 3ND8A 1LUZA 5JPNC 3QOLA 1HHVA 3J81E 3DM1A 1KAWA 5ELNA 5E3FA 5C6AA 1S3OA 3CAMA 2D62A 3A56A 1L2FA 2UUAL 2IX1A 1B9NA 2M2LA 3A0JA 1XNRL 4HJ7A 3L2PA 2A73B 1EWCA 3BZDB 2XTIA 5LHY1 4Y52H 1XWEA 4K8IA 1G2SA 1XPUA 4DR4L 2HT1A 1I3QH 1QG7A 2E75C 1SMYC 2SOBA 2WIIB 3HRZC 3M4PA 5T1IA 4A3EG 4A93G 4GLAC 4UAIA 3PUZA 2FMCA 5IT9c 4QQBX 1GUOA 1Q1EA 4GKJL 4DUZQ 4HMJA 3BVMA 2JJQA 4RGNA 2F0QA 3QG1A 1ZYRC 2I5MX 4DV3L 5FLXc 3VR6A 4XT1B 1SYBA 3A54A 5EAYA 4CBVA 5M3MG 2NTTA 4FXKC 3ER0A 1EIYB 2JN4A 2A68C 3VR4A 1JOOA 4F7XA 1FNVA 4C2MB 1KAAA 1AH9A 3KJOA 1VQ4A 4JV5L 2KHJA 5IP9H 1K8OA 3VYRA 1XMQQ 4J1MA 3NWSA 4JI7L 2K01A 4KLKA 4WJ4A 1JWSD 4DNTB 3T1YL 3PUWA 4OONA 3J80c 4B3RL 2DJGC 3GV3A 4CJ2C 4DFAA 2XN9C 1XMOL 4DAYB 1WI5A 3U9SA 1ESRA 3DXJC 5JOBA 4LFAL 3MC0B 3T1HL 3P7JA 1WTPA 1UEBA 3W5OA 3F1ZA 1GD7A 1RCVD 2J0TD 3ERSX 3GTMH 1DOKA 4G7HC 1X65A 2VUMB 2Z4IA 1QZGA 2HHHL 1PRTB 3RLNA 1V1PB 4A3JH 3D31A 4XQJA 4JPBW 1S72A 1ET6A 2GN5A 3FP9A 2RCNA 1ASYA 4JYAL 3U50C 3GP7A 3PV0A 1C4QA 1C9OA 1SNQA 1IBKQ 4LF6L 1YNXA 4B9WA 1LTBD 4I7AA 3EA6A 4BY7B 1HR0W 3K59A 4CDCC 2MO1A 4N8X1 2CW0C 3S1RH 1JQYD 4XQQA 1VQBA 2CKZB 3GTOH 1JJGA 1LTSD 2JQOA 3WOFA 1S40A 1TWFB 4QL5A 3HEJA 3STBC 1WTOA 4DV7Q 3BVGA 1P16A 1DJRD 3HOVG 1VF5C 3H0GB 3SK5A 3HOYH 4A3IG 3HOWG 2UU9L 1SYCA 5NUCA 1BDOA 4KN4C 2WV6D 4AH6A 2R7ZB 3SK8A 5I6WA 4FF1A 4GOPC 1WTXA 4Q0FA 4P73A 1TS3A 2F4VL 3I2ZA 5C0XI 2DY7A 1ENAA 2J7ZA 1PH5A 2NB0A 1MI2A 2Z6BA 2RHQB 1VQCA 1Y1VB 5IGFA 1SYGA 4DU9A 4MTKA 4YY3Q 4NP5A 4JOIA 4L8JA 5KRUA 5K36H 3AMUA 5KNDA 1W3SA 2B39A 3P75A 2VQEQ 2HIXA 3ITPA 2K5WA 5CMDA 4IJLA 1IW7D 2O5IC 4LUZA 4L63B 2CQOA 1E1TA 5JJKA 4UDUC 2N8NA 1H9RA 3GTPB 2LMCB 3DHQA 1D2BA 2PQAB 1AP0A 3V05A 1RHPA 1R4PB 4K5WA 4BY7H 1GJXA 1TWHB 1NTGA 5M5WH 2VQFL 2N3SA 2F3VA 2N49A 2CCZA 5ELDA 4MTNA 5JPMC 1XPOA 1ICFB 2Z6KC 3CHBD 4IUNA 4HAEA 4A3KH 4P72A 3I4NG 1TU2B 2NN6G 3NENA 1HCZA 4DUYQ 4O0AA 1KD1C 5DNFA 3PO2G 2WB1E 2WB1B 1D5ZC 2IJ0A 3GQBA 4RH6A 5C5MA 4HSPA 1SMYD 2F0EA 3IFDA 1U0LA 1Y1WG 5C4XH 1AFPA 2MUYA 1GUTA 4UY8C 1EYDA 2IHEA 4DXFA 2A19A 5C4JH 2D2CC 3A8KE 2K4KA 1MJCA 3UDGA 3MA2B 1FR3A 3L9AX 3K58A 2DY8A 4JI3Q 1EY5A 1NUCA 5M3FB 2R7DA 1CA6A 3GTGB 2IHFA 4B3SQ 3C1EA 4OGQC 2B2YA 1H9KA 3D4WA 3H6MA 2YV5A 1L1OB 3FDTA 1OTCA 1EOVA 2B2WC 4JI4Q 3G4SA 4DV0L 1PA6A 1EQRA 2K04A 1EY4A 5BN4A 2K32A 1N32Q 1TWHH 1GKHA 1VQ5A 2BDNA 1EWHA 1K9MC 3BVZA 4DV3Q 3RUZA 4JI8Q 2F3IA 1TY0A 1STYA 1V8QA 1I3QB 5JJZA 4JI5L 2EOTA 2EYLA 2F4IA 5IGBA 2QEJC 2K75A 3ZYYX 1B8AA 1E3PA 3NHHA 3CC4A 1VQ6A 1Q90A 3CMEA 4KV6A 4DR4Q 2Q8RE 1OXXK 3BDCA 4QF4A 1TXYA 4RGMA 1VQAA 1D6EC 1NBWA 1VQGA 2Z1CA 4YY3L 5C3EB 4YHHL 2QDBA 2QEXA 3K5OA 2F1MA 1VS0A 2AWOA 4LAAA 4L5RC 5IP7G 5CGKA 2N88A 4GKKQ 1E24A 1IBMQ 3S1MB 2RVLA 3E0EA 4LFCQ 2EJMA 4MHEA 4JBKA 1ENCA 4CJ0B 4ZKCB 4OO1I 1B70B 1LT3D 4C3JH 4IPCA 2EXDA 4DV1L 3T51B 1FYCA 3OTOL 1STGA 1UNSA 3VA5A 3CPFA 2WAQE 1QVGA 1AZQA 1STEA 4FO2A 2B2YC 2MNAA 1PZKD 1KTKA 2OF1A 1HNWL 5JJLA 2F0HA 4DR7L 1K73C 2F0LA 4Y7NH 4JI0L 3KFUA 1S5FD 3U9OA 1HNWQ 2ZTCA 3MXGA 3S16H 2PI2E 4PZ8A 1U4MA 2L12A 1RF2D 2YU9B 2VY3A 1EY0A 1S5CD 1PTOH 1EQVA 4JBWA 3J7YW 1NR2A 4A3KG 3BJUA 5EKIA 4QUFA 3J81i 2E2IB 1HR0L 2NVXB 4H0LC 4POFA 3S1QB 2I46A 3NEMA 1BF4A 1T9HA 3CCUA 4WJ3M 2VQEL 1NY4A 4IUPA 4MZ9A 3HOXG 3DWQA 2ZTEA 5AFWA 5I9OA 1PH8A 3PO3H 1A63A 2A69D 2VZAA 5IYCH 2WKCA 2F4VQ 2VUMH 3FRPB 1E1OA 4LF4Q 4JI0Q 2UU9Q
chains in the Genus database with same CATH topology
4R1JA 1WCMH 3M4QA 3JAMi 1FL0A 2ZM6L 2E5LQ 4NXMQ 2NVQH 2ZTDA 3E9HA 4DV0Q 2JEBI 3G48A 4LF4L 5IP9G 3TEHB 1N33L 4DR5L 3PO2H 1GVPA 1N34Q 4JYAQ 2OTJA 1K0RA 1N32L 4NXML 4GNXB 1Q81C 3S24A 1V43A 2K50A 1X6OA 1U5KA 3CCEA 1IBLQ 2R7ZH 1Q82C 4ALPA 4DV7L 3G71A 2V1CC 4L5SA 4J15A 4TQUS 4LF5Q 2B63H 1J5EL 1OXTA 1YITA 1X55A 1IYJB 1YVCA 2NZHA 4BBRG 5H1SE 5IYDH 4A3IH 1XTDA 4KI0A 1A62A 5LMNQ 3NBHB 1YBYA 5GROA 3H3VH 3CCMA 4LF8Q 2QA4A 1W2BA 4JI1L 4P75A 1IXRA 4JI2Q 3ZJYC 4DPGA 3U58A 1R9TH 3CCSA 4DV4Q 4LF7L 4AIMA 5IYDG 2Q2UA 2R93G 4PZ6A 2MQHA 4NXNQ 4OWWB 2ZJQA 2B63G 1G6PA 1PH1A 1CKNA 2N78A 4A3LG 2JA8H 1SE8A 4DV2Q 2OTLA 4LF7Q 1YI2A 1NMGA 5IYBH 5GAEC 3AQQA 1YJ9A 4RMFA 3ULPA 4DUYL 1VQFA 4B3TL 4HIOA 1YHAA 3HOVH 3SGIA 5FJ8H 4DR6L 4BY1H 1PYBA 4APVA 4BBSG 4KHPQ 3UE0A 1G51A 4P71A 2ID0A 4JI7Q 1CSPA 2JA6H 4IOAA 4HJ5A 3GTPH 4A3DH 2UUAQ 3RR5A 4LF5L 1PH6A 3WWVA 1J5EQ 1WCMG 4JBMA 5FJ8G 3H15A 3CP0A 3CCLA 5LMNL 2ASBA 1K3RA 1A63A 1CKOA 1VCIA 2AKWB 4XTCS 2I5HA 1PH3A 5C4XG 2EQSA 3HKSA 3M9BA 3I56A 1IBLL 3GTGH 1TWFH 4NPSA 1FVIA 3S2DH 5IY0A 4AQYL 1Y1VH 2JE6I 3CC7A 4A4IA 3K81C 3J7ZC 3W1GA 1A8VA 3CCJA 3ULJA 1Y1VG 4HIMA 1JB7A 3EN2A 2OQKA 2I5LX 5FLMG 2UXDL 4A3GH 2R7FA 3PUVA 1LUZA 2PI2A 5C3EG 1L1OC 1Q7YC 1TWCH 2NZOA 4JCVE 2VL6A 1KAWA 1QVCA 5ELNA 5J3BA 1X3FA 1KRSA 4DV5Q 3BZCA 1S3OA 4JV5Q 3CAMA 1PFSA 2D62A 1HNXL 1L2FA 2UUAL 2BH2A 5M3FG 4DR2Q 2IX1A 3CD6A 2B29A 1XNRL 3A0JA 4HJ7A 1HZAA 2ALYB 2UUBQ 4R4CA 4DV6Q 3L2PA 2R92G 3S1MH 4HIDA 1WFQA 4LW1A 2XTIA 4YHHQ 4BBSH 1N9WA 4JC0A 5M5YH 4Y52H 4C3HH 1XPUA 4DR4L 2HT1A 1I94L 4JBJA 1I3QH 5C44G 4A3EG 3M4PA 4DUZL 4BBRH 4A93G 5AJ3L 1WOCA 1X3GA 4GLAC 3CXCA 1Z9FA 1EQQA 4HIKA 2UXCQ 3PUZA 2AMCB 5IT9c 4X65L 2WAQG 4QQBX 1Q1EA 3PO3G 4GKJL 3RZOH 4DUZQ 1RIPA 1OXVA 5M3MH 1P8LA 5DLQE 2JJQA 5K36G 1UE1A 3B6YA 3OW2A 2E2HH 3S1NH 4A3DG 1SN8A 1IBML 1YEZA 2I5MX 4GS3A 4DV3L 5FLXc 3GDEA 1PH2A 4YWMA 3S17H 4JI1Q 3CC2A 1QUQB 2JA5G 2CWPA 4BA1I 1BKBA 3JAMc 1AE3A 2F52A 5EAYA 1HJPA 5M3MG 1JJ2A 3H0GH 2JK8A 4IFDI 4DNIA 1YHBA 3ER0A 4DV6L 4LUVA 1EIYB 2NVXH 1Q12A 3CCRA 1O7IA 1VQNA 1N36L 2A8VA 2VUMG 2B3GA 3F2DA 5LMNW 2JA5H 3KDFA 1KC8C 1AH9A 1NMFA 3AEVA 3KJOA 1VQ4A 1IBKL 4JV5L 1QVFA 3T1YQ 2KHJA 4DR7Q 5IP9H 1JT8A 4KHPL 1XMQQ 1BBUA 4UP9A 4JI7L 3ICEA 3L0OA 4XIGS 4KLKA 4HJAA 4WJ4A 3DM3A 1EUJA 3T1YL 2MFIA 3PUWA 4OONA 3J80c 3RN2A 4B3RL 1N8RC 1HR0Q 4LFCL 1VQDA 1XMOL 4DAYB 3GD7A 1WI5A 4FDBA 3U4VA 2JA7G 3HOUG 5JJIA 1KL9A 4LFAL 1MIUA 3UDIA 3CCQA 2OQ0A 3T1HL 1CUKA 1UE5A 3J81j 2NVTH 3A74A 3E9IA 2KCMA 1QZHA 1UEBA 3W5OA 3F1ZA 1GD7A 3ERSX 4X62Q 1VQEA 3GTMH 1IZ6A 4PZ7A 3RN5A 1X65A 5HGQA 3GTJH 5IWAQ 5M3FH 2UXDQ 1QZGA 3CW2C 4DV1Q 2HHHL 4H02A 1L1OA 2BA0A 3AFPA 3EBEA 5BR8Q 4B3ML 2JEAI 1WJJA 2FXQA 4MNOA 3RLNA 1YIJA 4A3JH 1YJNA 1PH9A 5C0XJ 1XMQL 3I4MH 3D31A 3TS2A 4A3BG 5BR8L 4A3MG 1S72A 4B3MQ 4LFBQ 2GN5A 3I55A 4DR3Q 1M90C 3FP9A 2EIFA 2RCNA 1VQMA 1KRTA 1ASYA 4JYAL 3U50C 2WFWA 3PV0A 1C9OA 5C0XG 1IBKQ 4LF6L 1YNXA 3PIOA 4GKKL 2WP8J 2R92H 4A3FH 4GN4B 1HR0W 2YYZA 4LF9Q 2AWNA 1VQKA 4BXXH 4X66L 4OO1G 2MO1A 3S1RH 4JI6Q 3FKIG 4GOPA 5IYBG 4TVAB 1VQBA 2CKZB 1I6HH 1X9NA 3GTOH 4AYBE 1JJGA 1K8GA 3OYYA 1VQHA 1LYLA 2JQOA 4EX5A 4DR5Q 1S40A 1HNZQ 4QL5A 4LFAQ 3STBC 1CKNB 3J81c 4DV7Q 3DLLA 1BBWA 1PVOA 1P16A 4A76A 4UP8A 4DR1L 1Q46A 5M5XH 2Q2TA 1FJGL 4NXNL 3HOVG 3HKZE 1HZCA 3HOYH 4LFBL 4OWXB 4A3IG 1LTLA 1EYGA 3M4OH 4DR3L 5IWAL 1NE3A 2UU9L 3HOWG 2K5NA 5IYCG 1Y1WH 1TWAH 2HIVA 3TS0A 4AH6A 4BA2I 2Y0SE 1HZBA 4GOPC 1PH7A 1XNRQ 2R7ZG 4X6AH 4P73A 4GLVB 2F4VL 5GAHC 3I2ZA 5C0XI 1HH2P 3KJPA 1PV4A 2UUCQ 3F2CA 3GTLH 1PH5A 1Q1BA 3W1BA 3S14H 4IPDA 2RHQB 4GNXA 4KHZA 2YTYA 1VQCA 4GN5A 1UE7A 4DR6Q 4K0KQ 1SLJA 1YZ6A 4YY3Q 2UUCL 4JOIA 5GADC 1JE5A 2ZJRA 1M1KC 1LM0A 2D0OA 1KHIA 1N34L 1W3SA 4OX9L 4PMWA 2VQEQ 2RF4A 2UXCL 2HIXA 4IJLA 1Z47A 3RLFA 4LUZA 2CQOA 2DUDA 1E1TA 3NELA 4P74A 2UXBQ 3A5ZB 5JJKA 4JI8L 2BA1A 1K83H 2N8NA 1EWIA 4IJHA 2CFMA 3F2BA 4X64L 4OWTB 2PQAB 3S15H 4QY7A 1I50H 3K8AA 3K7UC 4A75A 3PUXA 1MKHA 1VQLA 2C35B 5GQOA 3HOZH 4BY7H 4POGA 1NTGA 5M5WH 2KHIA 5IE8A 2N3SA 2VQFL 1NJIC 2K52A 2N49A 2CCZA 2PMZE 2PQAA 5C44H 4MTNA 1XPOA 2Z6KC 2E2JH 3TRZA 4LNQA 2DGYA 3CPWA 3HKZG 4A3KH 1XJVA 2YTVA 4P72A 4JI4L 3PCOB 3I4NG 2AHOB 4IFDG 2NN6G 1BVSA 3NENA 3TQYA 4DV5L 4DUYQ 2ES2A 4O0AA 1DGSA 1JJCB 4IPGA 2WB1E 2IX0A 1KD1C 2YU9H 3PO2G 4LF6Q 1Q8KA 2A1AA 5JEAG 1Q86C 2Y0SG 1E22A 5AJ3Q 2LXKA 3STBD 3KF6B 3RNUA 1KIXA 3CCVA 2K5VA 1U0LA 3G6EA 4AQYQ 1Y1WG 4GKJQ 4LF8L 5C4XH 4OX9Q 4ME3A 4O2DA 4QIWE 4HJ9A 1YJWA 1IL2A 3H3VI 4UY8C 4GOPB 4A93H 2IHEA 1I94Q 2L15A 2A19A 3I7FA 5C4JH 1XPRA 1JMCA 1WYDA 1TWGH 2KCTA 1Y14B 1QUQA 1VQJA 4GLXA 2Z6KA 2VQFQ 1ASZA 2K4KA 1MJCA 3UDGA 1VQ9A 3UDFA 2I0QA 3ULLA 4JI3Q 3J80i 1SROA 2R7DA 4GN3B 1HNXQ 2IHFA 4B3SQ 5LMUQ 3BU2A 4QJFA 3RZDH 5E7NA 1VQPA 3KLWA 1PH4A 2PNHA 2YV5A 4C2MH 1CKMA 3CMAA 1B7YB 4DK3C 1L1OB 2NN6I 2R93H 1SFOH 5FLMH 1OTCA 1EOVA 3TREA 2VW9A 4JI4Q 3G4SA 4DV0L 1PA6A 1N36Q 1EQRA 1N33Q 3CF5A 1UE6A 4L5QA 4RG1A 2UUBL 2OWOA 1N32Q 4JOIC 1TWHH 3MXNB 1GKHA 1VQ5A 3M3YH 1CSQA 2K5HA 3CQZH 2R6GA 4DAMA 2WB1G 2E2IH 2LXJA 1VQ7A 1K9MC 1C7YA 3HOZG 5ELOA 4BY7G 4DV3Q 4YWLA 4QGUA 2IT1A 1I5FA 4JI8Q 1RL2A 4UP7A 2F3IA 2MO0A 3A5UA 2Q2HA 1X56A 1FJGQ 4JI5L 3KYHC 1J6QA 4IOCA 4DV4L 2HQLA 2K75A 1B8AA 3OTOQ 2KBNA 1SR3A 1E3PA 4HJ8A 1MJEA 2XGTA 3LGJA 3CC4A 1YHQA 4B3SL 1VQ6A 1X3EA 2Q2IA 4DV2L 5HY6A 4A3LH 3CMEA 2IY5B 1VQIA 2HHHQ 3HOWH 3M7NA 4A3GG 4DR4Q 3GO5A 5JEAJ 1OXXK 3UE1A 1KQSA 4DR2L 4L5TA 3FHWA 1TXYA 1VQAA 4K0KL 1NBWA 4X66Q 1VQGA 3KF8B 4AYBG 4YY3L 1H95A 4YHHL 4JI6L 2QEXA 3PSIA 4EQ5A 1A0IA 3MEFA 3T1HQ 1VS0A 2AWOA 4L5RC 4A3CH 4YCVA 5IP7G 4GKKQ 1E24A 1IBMQ 3AFQA 1D8LA 3JC66 4LFCQ 3E0EA 3FKIH 1SRUA 1C0AA 3HFZB 3HOXH 4X65Q 4JBKA 1OXUA 1XMOQ 4DKAC 3L7ZC 4BXXG 4OO1I 5C3EH 1B70B 4C3JH 4IPCA 1GO3E 2VS1A 4X64Q 2EXDA 4A3FG 2JA6G 4DV1L 3GTKH 2KENA 3OTOL 4R4IA 4JI2L 3S2HH 3K0XA 3CPFA 2WAQE 1AE2A 3EIVA 4UPAA 1QVGA 3VDYA 3I4NH 3AYHB 4LWCA 1PYSB 3BZKA 1L0WA 4X62L 2MNAA 1K8AC 1HNWL 4JI5Q 2QGQA 3M85A 5JJLA 3KOJA 3S1QH 3Q8DA 4DR7L 1SMXA 1K73C 5LMUL 4Y7NH 4JG2A 4JI0L 2ATWA 2GVBA 3UDXA 3KFUA 4A3CG 2D0PA 4A3JG 3I4MG 1HNWQ 2ZTCA 1XNQQ 4A3EH 3KDFB 1PHJA 3I4OA 2OCEA 4YCUA 2ZJPA 3S16H 2RHSB 2PI2E 1FGUA 4IO9A 4NB3A 4PZ8A 1GM5A 1EFWA 4LF9L 4R4QA 1D7QA 4C3IH 2VY3A 4YCWA 3F8TA 3K80C 3K7AH 2GVAA 4JBWA 4PG3A 4A3BH 2ZM6Q 2E5LL 2VNUD 4A3KG 4B3RQ 3BJUA 3J81i 2BH8A 4OXPA 4R4TA 4DK6C 3PIPA 2JA9A 1HR0L 4B3TQ 1KXLA 4POFA 2UXBL 2JA8G 3NEMA 4IFDJ 1T9HA 2Z0SA 3RLOA 4DR1Q 2E8GA 3KF6A 4LUOA 3CCUA 4GNXC 4YWKA 4WJ3M 2VQEL 3GTQH 1NY4A 4IPHA 3D0FA 3PF5A 1X54A 3PUYA 1OXSC 1UWVA 3U4ZA 2CWAA 1HNZL 2K14A 4BY1G 4MZ9A 3PF4A 3HOXG 1G291 4JI3L 2NVYH 2ZTEA 1XNQL 5GAGC 1PH8A 3PO3H 2JA7H 1VQOA 1V9PA 1EIFA 3IRBA 3HOUH 4A3MH 3J7A5 2VZAA 5IP7H 5IYCH 1V1QA 3PGZA 2VUMH 2F4VQ 1HZ9A 2YTXA 1E1OA 4LF4Q 1VQ8A 4JI0Q 3HOYG 2UU9Q 4R4OA 2LSSA 3H0GG 1E7ZA 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1J A;  1WCM H;  3M4Q A;  3JAM i;  1FL0 A;  2ZM6 L;  2E5L Q;  4NXM Q;  2NVQ H;  2ZTD A;  3E9H A;  4DV0 Q;  2JEB I;  3G48 A;  4LF4 L;  5IP9 G;  3TEH B;  1N33 L;  4DR5 L;  3PO2 H;  1GVP A;  1N34 Q;  4JYA Q;  2OTJ A;  1K0R A;  1N32 L;  4NXM L;  4GNX B;  1Q81 C;  3S24 A;  1V43 A;  2K50 A;  1X6O A;  1U5K A;  3CCE A;  1IBL Q;  2R7Z H;  1Q82 C;  4ALP A;  4DV7 L;  3G71 A;  2V1C C;  4L5S A;  4J15 A;  4TQU S;  4LF5 Q;  2B63 H;  1J5E L;  1OXT A;  1YIT A;  1X55 A;  1IYJ B;  1YVC A;  2NZH A;  4BBR G;  5H1S E;  5IYD H;  4A3I H;  1XTD A;  4KI0 A;  1A62 A;  5LMN Q;  3NBH B;  1YBY A;  5GRO A;  3H3V H;  3CCM A;  4LF8 Q;  2QA4 A;  1W2B A;  4JI1 L;  4P75 A;  1IXR A;  4JI2 Q;  3ZJY C;  4DPG A;  3U58 A;  1R9T H;  3CCS A;  4DV4 Q;  4LF7 L;  4AIM A;  5IYD G;  2Q2U A;  2R93 G;  4PZ6 A;  2MQH A;  4NXN Q;  4OWW B;  2ZJQ A;  2B63 G;  1G6P A;  1PH1 A;  1CKN A;  2N78 A;  4A3L G;  2JA8 H;  1SE8 A;  4DV2 Q;  2OTL A;  4LF7 Q;  1YI2 A;  1NMG A;  5IYB H;  5GAE C;  3AQQ A;  1YJ9 A;  4RMF A;  3ULP A;  4DUY L;  1VQF A;  4B3T L;  4HIO A;  1YHA A;  3HOV H;  3SGI A;  5FJ8 H;  4DR6 L;  4BY1 H;  1PYB A;  4APV A;  4BBS G;  4KHP Q;  3UE0 A;  1G51 A;  4P71 A;  2ID0 A;  4JI7 Q;  1CSP A;  2JA6 H;  4IOA A;  4HJ5 A;  3GTP H;  4A3D H;  2UUA Q;  3RR5 A;  4LF5 L;  1PH6 A;  3WWV A;  1J5E Q;  1WCM G;  4JBM A;  5FJ8 G;  3H15 A;  3CP0 A;  3CCL A;  5LMN L;  2ASB A;  1K3R A;  1A63 A;  1CKO A;  1VCI A;  2AKW B;  4XTC S;  2I5H A;  1PH3 A;  5C4X G;  2EQS A;  3HKS A;  3M9B A;  3I56 A;  1IBL L;  3GTG H;  1TWF H;  4NPS A;  1FVI A;  3S2D H;  5IY0 A;  4AQY L;  1Y1V H;  2JE6 I;  3CC7 A;  4A4I A;  3K81 C;  3J7Z C;  3W1G A;  1A8V A;  3CCJ A;  3ULJ A;  1Y1V G;  4HIM A;  1JB7 A;  3EN2 A;  2OQK A;  2I5L X;  5FLM G;  2UXD L;  4A3G H;  2R7F A;  3PUV A;  1LUZ A;  2PI2 A;  5C3E G;  1L1O C;  1Q7Y C;  1TWC H;  2NZO A;  4JCV E;  2VL6 A;  1KAW A;  1QVC A;  5ELN A;  5J3B A;  1X3F A;  1KRS A;  4DV5 Q;  3BZC A;  1S3O A;  4JV5 Q;  3CAM A;  1PFS A;  2D62 A;  1HNX L;  1L2F A;  2UUA L;  2BH2 A;  5M3F G;  4DR2 Q;  2IX1 A;  3CD6 A;  2B29 A;  1XNR L;  3A0J A;  4HJ7 A;  1HZA A;  2ALY B;  2UUB Q;  4R4C A;  4DV6 Q;  3L2P A;  2R92 G;  3S1M H;  4HID A;  1WFQ A;  4LW1 A;  2XTI A;  4YHH Q;  4BBS H;  1N9W A;  4JC0 A;  5M5Y H;  4Y52 H;  4C3H H;  1XPU A;  4DR4 L;  2HT1 A;  1I94 L;  4JBJ A;  1I3Q H;  5C44 G;  4A3E G;  3M4P A;  4DUZ L;  4BBR H;  4A93 G;  5AJ3 L;  1WOC A;  1X3G A;  4GLA C;  3CXC A;  1Z9F A;  1EQQ A;  4HIK A;  2UXC Q;  3PUZ A;  2AMC B;  5IT9 c;  4X65 L;  2WAQ G;  4QQB X;  1Q1E A;  3PO3 G;  4GKJ L;  3RZO H;  4DUZ Q;  1RIP A;  1OXV A;  5M3M H;  1P8L A;  5DLQ E;  2JJQ A;  5K36 G;  1UE1 A;  3B6Y A;  3OW2 A;  2E2H H;  3S1N H;  4A3D G;  1SN8 A;  1IBM L;  1YEZ A;  2I5M X;  4GS3 A;  4DV3 L;  5FLX c;  3GDE A;  1PH2 A;  4YWM A;  3S17 H;  4JI1 Q;  3CC2 A;  1QUQ B;  2JA5 G;  2CWP A;  4BA1 I;  1BKB A;  3JAM c;  1AE3 A;  2F52 A;  5EAY A;  1HJP A;  5M3M G;  1JJ2 A;  3H0G H;  2JK8 A;  4IFD I;  4DNI A;  1YHB A;  3ER0 A;  4DV6 L;  4LUV A;  1EIY B;  2NVX H;  1Q12 A;  3CCR A;  1O7I A;  1VQN A;  1N36 L;  2A8V A;  2VUM G;  2B3G A;  3F2D A;  5LMN W;  2JA5 H;  3KDF A;  1KC8 C;  1AH9 A;  1NMF A;  3AEV A;  3KJO A;  1VQ4 A;  1IBK L;  4JV5 L;  1QVF A;  3T1Y Q;  2KHJ A;  4DR7 Q;  5IP9 H;  1JT8 A;  4KHP L;  1XMQ Q;  1BBU A;  4UP9 A;  4JI7 L;  3ICE A;  3L0O A;  4XIG S;  4KLK A;  4HJA A;  4WJ4 A;  3DM3 A;  1EUJ A;  3T1Y L;  2MFI A;  3PUW A;  4OON A;  3J80 c;  3RN2 A;  4B3R L;  1N8R C;  1HR0 Q;  4LFC L;  1VQD A;  1XMO L;  4DAY B;  3GD7 A;  1WI5 A;  4FDB A;  3U4V A;  2JA7 G;  3HOU G;  5JJI A;  1KL9 A;  4LFA L;  1MIU A;  3UDI A;  3CCQ A;  2OQ0 A;  3T1H L;  1CUK A;  1UE5 A;  3J81 j;  2NVT H;  3A74 A;  3E9I A;  2KCM A;  1QZH A;  1UEB A;  3W5O A;  3F1Z A;  1GD7 A;  3ERS X;  4X62 Q;  1VQE A;  3GTM H;  1IZ6 A;  4PZ7 A;  3RN5 A;  1X65 A;  5HGQ A;  3GTJ H;  5IWA Q;  5M3F H;  2UXD Q;  1QZG A;  3CW2 C;  4DV1 Q;  2HHH L;  4H02 A;  1L1O A;  2BA0 A;  3AFP A;  3EBE A;  5BR8 Q;  4B3M L;  2JEA I;  1WJJ A;  2FXQ A;  4MNO A;  3RLN A;  1YIJ A;  4A3J H;  1YJN A;  1PH9 A;  5C0X J;  1XMQ L;  3I4M H;  3D31 A;  3TS2 A;  4A3B G;  5BR8 L;  4A3M G;  1S72 A;  4B3M Q;  4LFB Q;  2GN5 A;  3I55 A;  4DR3 Q;  1M90 C;  3FP9 A;  2EIF A;  2RCN A;  1VQM A;  1KRT A;  1ASY A;  4JYA L;  3U50 C;  2WFW A;  3PV0 A;  1C9O A;  5C0X G;  1IBK Q;  4LF6 L;  1YNX A;  3PIO A;  4GKK L;  2WP8 J;  2R92 H;  4A3F H;  4GN4 B;  1HR0 W;  2YYZ A;  4LF9 Q;  2AWN A;  1VQK A;  4BXX H;  4X66 L;  4OO1 G;  2MO1 A;  3S1R H;  4JI6 Q;  3FKI G;  4GOP A;  5IYB G;  4TVA B;  1VQB A;  2CKZ B;  1I6H H;  1X9N A;  3GTO H;  4AYB E;  1JJG A;  1K8G A;  3OYY A;  1VQH A;  1LYL A;  2JQO A;  4EX5 A;  4DR5 Q;  1S40 A;  1HNZ Q;  4QL5 A;  4LFA Q;  3STB C;  1CKN B;  3J81 c;  4DV7 Q;  3DLL A;  1BBW A;  1PVO A;  1P16 A;  4A76 A;  4UP8 A;  4DR1 L;  1Q46 A;  5M5X H;  2Q2T A;  1FJG L;  4NXN L;  3HOV G;  3HKZ E;  1HZC A;  3HOY H;  4LFB L;  4OWX B;  4A3I G;  1LTL A;  1EYG A;  3M4O H;  4DR3 L;  5IWA L;  1NE3 A;  2UU9 L;  3HOW G;  2K5N A;  5IYC G;  1Y1W H;  1TWA H;  2HIV A;  3TS0 A;  4AH6 A;  4BA2 I;  2Y0S E;  1HZB A;  4GOP C;  1PH7 A;  1XNR Q;  2R7Z G;  4X6A H;  4P73 A;  4GLV B;  2F4V L;  5GAH C;  3I2Z A;  5C0X I;  1HH2 P;  3KJP A;  1PV4 A;  2UUC Q;  3F2C A;  3GTL H;  1PH5 A;  1Q1B A;  3W1B A;  3S14 H;  4IPD A;  2RHQ B;  4GNX A;  4KHZ A;  2YTY A;  1VQC A;  4GN5 A;  1UE7 A;  4DR6 Q;  4K0K Q;  1SLJ A;  1YZ6 A;  4YY3 Q;  2UUC L;  4JOI A;  5GAD C;  1JE5 A;  2ZJR A;  1M1K C;  1LM0 A;  2D0O A;  1KHI A;  1N34 L;  1W3S A;  4OX9 L;  4PMW A;  2VQE Q;  2RF4 A;  2UXC L;  2HIX A;  4IJL A;  1Z47 A;  3RLF A;  4LUZ A;  2CQO A;  2DUD A;  1E1T A;  3NEL A;  4P74 A;  2UXB Q;  3A5Z B;  5JJK A;  4JI8 L;  2BA1 A;  1K83 H;  2N8N A;  1EWI A;  4IJH A;  2CFM A;  3F2B A;  4X64 L;  4OWT B;  2PQA B;  3S15 H;  4QY7 A;  1I50 H;  3K8A A;  3K7U C;  4A75 A;  3PUX A;  1MKH A;  1VQL A;  2C35 B;  5GQO A;  3HOZ H;  4BY7 H;  4POG A;  1NTG A;  5M5W H;  2KHI A;  5IE8 A;  2N3S A;  2VQF L;  1NJI C;  2K52 A;  2N49 A;  2CCZ A;  2PMZ E;  2PQA A;  5C44 H;  4MTN A;  1XPO A;  2Z6K C;  2E2J H;  3TRZ A;  4LNQ A;  2DGY A;  3CPW A;  3HKZ G;  4A3K H;  1XJV A;  2YTV A;  4P72 A;  4JI4 L;  3PCO B;  3I4N G;  2AHO B;  4IFD G;  2NN6 G;  1BVS A;  3NEN A;  3TQY A;  4DV5 L;  4DUY Q;  2ES2 A;  4O0A A;  1DGS A;  1JJC B;  4IPG A;  2WB1 E;  2IX0 A;  1KD1 C;  2YU9 H;  3PO2 G;  4LF6 Q;  1Q8K A;  2A1A A;  5JEA G;  1Q86 C;  2Y0S G;  1E22 A;  5AJ3 Q;  2LXK A;  3STB D;  3KF6 B;  3RNU A;  1KIX A;  3CCV A;  2K5V A;  1U0L A;  3G6E A;  4AQY Q;  1Y1W G;  4GKJ Q;  4LF8 L;  5C4X H;  4OX9 Q;  4ME3 A;  4O2D A;  4QIW E;  4HJ9 A;  1YJW A;  1IL2 A;  3H3V I;  4UY8 C;  4GOP B;  4A93 H;  2IHE A;  1I94 Q;  2L15 A;  2A19 A;  3I7F A;  5C4J H;  1XPR A;  1JMC A;  1WYD A;  1TWG H;  2KCT A;  1Y14 B;  1QUQ A;  1VQJ A;  4GLX A;  2Z6K A;  2VQF Q;  1ASZ A;  2K4K A;  1MJC A;  3UDG A;  1VQ9 A;  3UDF A;  2I0Q A;  3ULL A;  4JI3 Q;  3J80 i;  1SRO A;  2R7D A;  4GN3 B;  1HNX Q;  2IHF A;  4B3S Q;  5LMU Q;  3BU2 A;  4QJF A;  3RZD H;  5E7N A;  1VQP A;  3KLW A;  1PH4 A;  2PNH A;  2YV5 A;  4C2M H;  1CKM A;  3CMA A;  1B7Y B;  4DK3 C;  1L1O B;  2NN6 I;  2R93 H;  1SFO H;  5FLM H;  1OTC A;  1EOV A;  3TRE A;  2VW9 A;  4JI4 Q;  3G4S A;  4DV0 L;  1PA6 A;  1N36 Q;  1EQR A;  1N33 Q;  3CF5 A;  1UE6 A;  4L5Q A;  4RG1 A;  2UUB L;  2OWO A;  1N32 Q;  4JOI C;  1TWH H;  3MXN B;  1GKH A;  1VQ5 A;  3M3Y H;  1CSQ A;  2K5H A;  3CQZ H;  2R6G A;  4DAM A;  2WB1 G;  2E2I H;  2LXJ A;  1VQ7 A;  1K9M C;  1C7Y A;  3HOZ G;  5ELO A;  4BY7 G;  4DV3 Q;  4YWL A;  4QGU A;  2IT1 A;  1I5F A;  4JI8 Q;  1RL2 A;  4UP7 A;  2F3I A;  2MO0 A;  3A5U A;  2Q2H A;  1X56 A;  1FJG Q;  4JI5 L;  3KYH C;  1J6Q A;  4IOC A;  4DV4 L;  2HQL A;  2K75 A;  1B8A A;  3OTO Q;  2KBN A;  1SR3 A;  1E3P A;  4HJ8 A;  1MJE A;  2XGT A;  3LGJ A;  3CC4 A;  1YHQ A;  4B3S L;  1VQ6 A;  1X3E A;  2Q2I A;  4DV2 L;  5HY6 A;  4A3L H;  3CME A;  2IY5 B;  1VQI A;  2HHH Q;  3HOW H;  3M7N A;  4A3G G;  4DR4 Q;  3GO5 A;  5JEA J;  1OXX K;  3UE1 A;  1KQS A;  4DR2 L;  4L5T A;  3FHW A;  1TXY A;  1VQA A;  4K0K L;  1NBW A;  4X66 Q;  1VQG A;  3KF8 B;  4AYB G;  4YY3 L;  1H95 A;  4YHH L;  4JI6 L;  2QEX A;  3PSI A;  4EQ5 A;  1A0I A;  3MEF A;  3T1H Q;  1VS0 A;  2AWO A;  4L5R C;  4A3C H;  4YCV A;  5IP7 G;  4GKK Q;  1E24 A;  1IBM Q;  3AFQ A;  1D8L A;  3JC6 6;  4LFC Q;  3E0E A;  3FKI H;  1SRU A;  1C0A A;  3HFZ B;  3HOX H;  4X65 Q;  4JBK A;  1OXU A;  1XMO Q;  4DKA C;  3L7Z C;  4BXX G;  4OO1 I;  5C3E H;  1B70 B;  4C3J H;  4IPC A;  1GO3 E;  2VS1 A;  4X64 Q;  2EXD A;  4A3F G;  2JA6 G;  4DV1 L;  3GTK H;  2KEN A;  3OTO L;  4R4I A;  4JI2 L;  3S2H H;  3K0X A;  3CPF A;  2WAQ E;  1AE2 A;  3EIV A;  4UPA A;  1QVG A;  3VDY A;  3I4N H;  3AYH B;  4LWC A;  1PYS B;  3BZK A;  1L0W A;  4X62 L;  2MNA A;  1K8A C;  1HNW L;  4JI5 Q;  2QGQ A;  3M85 A;  5JJL A;  3KOJ A;  3S1Q H;  3Q8D A;  4DR7 L;  1SMX A;  1K73 C;  5LMU L;  4Y7N H;  4JG2 A;  4JI0 L;  2ATW A;  2GVB A;  3UDX A;  3KFU A;  4A3C G;  2D0P A;  4A3J G;  3I4M G;  1HNW Q;  2ZTC A;  1XNQ Q;  4A3E H;  3KDF B;  1PHJ A;  3I4O A;  2OCE A;  4YCU A;  2ZJP A;  3S16 H;  2RHS B;  2PI2 E;  1FGU A;  4IO9 A;  4NB3 A;  4PZ8 A;  1GM5 A;  1EFW A;  4LF9 L;  4R4Q A;  1D7Q A;  4C3I H;  2VY3 A;  4YCW A;  3F8T A;  3K80 C;  3K7A H;  2GVA A;  4JBW A;  4PG3 A;  4A3B H;  2ZM6 Q;  2E5L L;  2VNU D;  4A3K G;  4B3R Q;  3BJU A;  3J81 i;  2BH8 A;  4OXP A;  4R4T A;  4DK6 C;  3PIP A;  2JA9 A;  1HR0 L;  4B3T Q;  1KXL A;  4POF A;  2UXB L;  2JA8 G;  3NEM A;  4IFD J;  1T9H A;  2Z0S A;  3RLO A;  4DR1 Q;  2E8G A;  3KF6 A;  4LUO A;  3CCU A;  4GNX C;  4YWK A;  4WJ3 M;  2VQE L;  3GTQ H;  1NY4 A;  4IPH A;  3D0F A;  3PF5 A;  1X54 A;  3PUY A;  1OXS C;  1UWV A;  3U4Z A;  2CWA A;  1HNZ L;  2K14 A;  4BY1 G;  4MZ9 A;  3PF4 A;  3HOX G;  1G29 1;  4JI3 L;  2NVY H;  2ZTE A;  1XNQ L;  5GAG C;  1PH8 A;  3PO3 H;  2JA7 H;  1VQO A;  1V9P A;  1EIF A;  3IRB A;  3HOU H;  4A3M H;  3J7A 5;  2VZA A;  5IP7 H;  5IYC H;  1V1Q A;  3PGZ A;  2VUM H;  2F4V Q;  1HZ9 A;  2YTX A;  1E1O A;  4LF4 Q;  1VQ8 A;  4JI0 Q;  3HOY G;  2UU9 Q;  4R4O A;  2LSS A;  3H0G G;  1E7Z A;  2H5X A; 
#chains in the Genus database with same CATH topology
 2DNE A;  1WCM H;  4R1J A;  1FL0 A;  2E5L Q;  4HCE A;  1PTO D;  2QF7 A;  4DR5 L;  1EEF D;  5I2X A;  3HOU B;  1Q81 C;  3S24 A;  2R7Z H;  1Q82 C;  4ALP A;  4RWS C;  4L5S A;  4J15 A;  4ZLT F;  1OXT A;  3K5M A;  1YIT A;  1IYJ B;  4A3I H;  2EJG C;  3KK7 A;  5GRO A;  4KY7 A;  1PTO B;  5DEH A;  4ZCK A;  3CCM A;  1PDQ A;  1J8I A;  2EZV A;  4JI1 L;  4JI2 Q;  3ZJY C;  3OW7 A;  1RD9 D;  1EEI D;  2K03 A;  4LF7 L;  5IYD G;  4PZ6 A;  3TSS A;  3CQZ B;  4ZUJ A;  3Q0A A;  2JA8 H;  2B2T A;  4LF7 Q;  5IT9 L;  1YJ9 A;  2Z4H A;  1VQF A;  4DF7 A;  4B3T L;  3K5L A;  3HOV H;  1JC7 A;  1XXG A;  3KBG A;  1PYB A;  1B1Z A;  5IOC A;  3UE0 A;  5G3L D;  4P71 A;  4F87 A;  1HA6 A;  1XYI A;  1CSP A;  3EFX D;  1K83 B;  2A5H A;  3RR5 A;  3TP5 A;  3WWV A;  2DJF C;  3A7A B;  1EY9 A;  3FVQ A;  3O13 A;  1SNC A;  1G91 A;  1PH3 A;  2AKW B;  3R93 A;  2AUJ D;  3GTG H;  1TWF H;  3OOC A;  5CV8 A;  4NPS A;  3S2D H;  5IY0 A;  3VYS A;  4BBS B;  4U67 3;  3S14 B;  3OIQ A;  3ULJ A;  5JVH 3;  2K5Q A;  1KNE A;  2I5L X;  5FLM G;  4A3G H;  3I4N B;  1Q7Y C;  1JIC A;  5CV9 A;  2F0U A;  2MGS A;  1KRS A;  1MSG A;  2BH2 A;  1HNX L;  4CJ1 B;  3IAY A;  5M3F G;  4DR2 Q;  3HOX B;  2R93 B;  2B29 A;  1HZA A;  1SYF A;  2R92 G;  1I4P A;  3RMH A;  3C3L A;  3V2T A;  1PXU A;  2NTS A;  2IPK D;  4JBJ A;  4TRD A;  4DUZ L;  4BBR H;  4DAV A;  1X3G A;  4FF4 A;  1Z9F A;  4V19 0;  2AMC B;  2XRQ D;  3SVM A;  3RZO H;  5M3M H;  3NBH A;  1P8L A;  2EYJ A;  1GXD C;  3DEO A;  5CR3 A;  1UE1 A;  4WOR A;  2E2H H;  2X6G A;  3H91 A;  5D3I B;  1SN8 A;  1IBM L;  3GDE A;  1KLU D;  4YWM A;  4LK1 C;  3S17 H;  3PIP 3;  1QUQ B;  1BKB A;  3JAM c;  2O4X A;  2AQ2 B;  1O7L A;  4A3J B;  1B3A A;  1N36 L;  2VUM G;  4RAU C;  4A3B B;  3KDF A;  1KC8 C;  2QIL A;  3I4L A;  4J6H A;  1QVF A;  3T1Y Q;  1JT8 A;  2A6E C;  4KY6 A;  3EJI A;  4FXD A;  3RN2 A;  4KJO A;  1TVX A;  3N52 A;  3A8I E;  1VQD A;  3L3O C;  3GD7 A;  3U4V A;  5JJI A;  4KY5 A;  1BR9 A;  1MIU A;  3CCQ A;  2OQ0 A;  3LNN A;  1IHZ A;  4MN3 A;  2NYZ D;  4G7Z C;  1LAB A;  3MEH A;  4QUC A;  4R9W A;  4WFN 3;  4PZ7 A;  1C48 A;  3TP7 A;  4DV1 Q;  4H02 A;  1KNA A;  1F2Y A;  1I6H B;  2FXQ A;  5A2Q E;  1YIJ A;  1EYA A;  3I4M H;  1PH9 A;  1XMQ L;  2K7V A;  3M7G A;  3TS2 A;  4A3M G;  2Z9H A;  5IT9 E;  1PZI D;  3NUC A;  3I55 A;  4ID6 A;  2EIF A;  1VQM A;  3GV6 A;  2D9U A;  1A3T A;  4C1N K;  1RJT A;  3PIO A;  5FLX L;  1ONL A;  4A3F H;  1A3V A;  3HOZ B;  1QE6 A;  4LF9 Q;  2AWN A;  1VQK A;  4X66 L;  2D5D A;  4GOP A;  2N55 A;  1TS5 A;  1V1O A;  3SHL A;  1CKN B;  3J81 c;  3OWF A;  4NDX A;  1PVO A;  2G9D A;  4UP8 A;  5M5X H;  4DR1 L;  2Q2T A;  5DAU A;  1BCP F;  1F9Q A;  5HUR A;  5CV4 A;  1NE3 A;  2B63 B;  4IZ8 A;  3TS0 A;  1VMP A;  4BA2 I;  3HOV B;  1HZB A;  1XNR Q;  4X6A H;  3HS0 C;  2MJ8 A;  5GAH C;  3GTL H;  3F2C A;  1MD2 D;  2EY1 A;  1G2T A;  3P20 A;  4K0K Q;  1UE7 A;  4BBR B;  2QDL A;  3K7A B;  3BYT B;  3K5N A;  1LM0 A;  1LTA D;  4PMW A;  1J9O A;  4S3S A;  5I2Y A;  1SNO A;  1HQR D;  3RLF A;  3NEL A;  4JI8 L;  2KVM A;  2BA1 A;  1AZP A;  4IJH A;  3F2B A;  3N6R A;  3K8A A;  3K7U C;  2C35 B;  3HOZ H;  1KAB A;  2KHI A;  4KTA A;  2K52 A;  5CV5 A;  3F2U A;  3TRZ A;  4LNQ A;  3X3M A;  3TN2 A;  3HKZ G;  4JI4 L;  3PCO B;  4C3H B;  4IFD G;  3TQY A;  4DV5 L;  2KUM A;  3HP3 A;  4B3T Q;  3K6O A;  4CKC A;  1DGS A;  4IPG A;  2ES2 A;  4LF6 Q;  4IFD H;  1Q8K A;  1PFN A;  2A1A A;  2Y0S G;  3T13 A;  5AJ3 Q;  3Q23 A;  2EY2 A;  1K8M A;  4CHT B;  1EL0 A;  3CCV A;  2K5V A;  3G6E A;  4DAP A;  4GKJ Q;  3NE5 B;  4LF8 L;  3S1N B;  1I4Q A;  3MXU A;  1YJW A;  3W2D A;  1JMC A;  3TP8 A;  5EPL A;  4GLX A;  2Z6K A;  2VQF Q;  4ZKB B;  1EQT A;  4RFB A;  3J80 i;  1SRO A;  2L55 A;  4XQN A;  4X3S A;  2OEO A;  4XT3 B;  2F0T A;  3R8B A;  3K57 A;  1I4X A;  4KD3 A;  1TQO A;  1PH4 A;  3VA7 A;  5J39 A;  4M1U B;  1CT1 D;  3MXN A;  5CC4 A;  4PMB A;  1SFO H;  1UEA B;  1H9J A;  3TME A;  4A3F B;  2PYK A;  5COY A;  1JOQ A;  3MHB A;  1DYQ A;  1N33 Q;  1UE6 A;  4L5Q A;  2E2H B;  5M5W B;  3M3Y H;  1DXM A;  1JWM D;  4F88 A;  3TZU A;  2ICE C;  5ELO A;  1CZW A;  1DZ1 A;  2IT1 A;  1I5F A;  3VR3 A;  2K5D A;  2PZT A;  4RKB A;  1EY8 A;  3D4D A;  3KYH C;  3NBI A;  1S5D D;  2EYF A;  2L11 A;  3QOJ A;  1ML0 D;  2BE5 C;  2HUG A;  1MJE A;  4Y7N B;  3SXH A;  4DXG A;  4A3L H;  1YHQ A;  1K28 A;  3G6J B;  3GTL B;  2HHH Q;  4A3G G;  3UE1 A;  1IKM A;  1F77 A;  2KQ3 A;  2C9O A;  4ABN A;  1FNU A;  4DAY A;  1GHJ A;  4X66 Q;  1H95 A;  2AQ3 B;  4ZK9 B;  4EQ5 A;  3MEF A;  1MBY A;  1D1K A;  3UI2 A;  1CHP D;  3TP6 A;  1GUW A;  2B2T C;  4DNR B;  3FKI H;  4LJZ C;  3HFZ B;  2A68 D;  2KED A;  5IGG A;  4RGT A;  1IKL A;  3L7Z C;  5EBC A;  4DKA C;  5J22 A;  2VS1 A;  2EY6 A;  5C4Z A;  3K0X A;  3I4N H;  4FP5 D;  3AYH B;  1CI3 M;  1PYS B;  5J1Z A;  4RCO A;  4KKS A;  2B2V C;  3KOJ A;  1O78 A;  2ATW A;  1F2M A;  2GVB A;  2WAC A;  4HTH A;  4A3C G;  5BN5 A;  4A3J G;  4OO1 H;  1XNQ Q;  3KDF B;  5FLX E;  5EGT A;  2OCE A;  2ZJP A;  2RHS B;  1E2W A;  1EFW A;  4R4Q A;  4K2L A;  2HD3 A;  1F9P A;  3F8T A;  3K80 C;  5KYL A;  3K7A H;  3A7L A;  4PG3 A;  2ZM6 Q;  5ELF A;  1E2V A;  3AB9 A;  2XIW A;  2BH8 A;  4OXP A;  1JWU D;  2EYH A;  4R4T A;  3KBX A;  1SSO A;  3QB3 A;  2UXB L;  1LT5 D;  4QB4 A;  2Z0S A;  3RLO A;  3I90 A;  4YWK A;  5EQ0 A;  4IPH A;  4CKE A;  1A2U A;  3GTK B;  3KLR A;  5IIF A;  1UWV A;  3U4Z A;  2CWA A;  1HNZ L;  1G29 1;  4JI3 L;  3D8G A;  4RA8 A;  3HOY B;  2K33 A;  1XNQ L;  5FKA C;  2B2U C;  2JA7 H;  4R8N A;  3IRB A;  2EYO A;  1T5E A;  3J7A 5;  2PO4 A;  1V1Q A;  3QWN A;  4V0B A;  2KCC A;  3NPP A;  5JAV A;  3A55 A;  2RQX A;  1QWY A;  3NSW A;  3JAM i;  3EVQ A;  5M5Y B;  3E3X A;  2ZM6 L;  4NXM Q;  2NVQ H;  3E9H A;  3G48 A;  4A3D B;  4NW2 A;  1N34 Q;  4RKL A;  3PO3 B;  4JYA Q;  1XX8 A;  1MGS A;  3P1H A;  4GNX B;  1A6X A;  2FMM A;  1ICW A;  1V1P A;  4EQN A;  4DV7 L;  1G6Z A;  5FO7 B;  1LTT D;  2ZT9 C;  1B44 D;  1J5E L;  3J7A V;  4RGO S;  2LKV A;  2NZH A;  3MTS A;  5IYD H;  1PYW D;  3SE0 A;  3NBH B;  1YBY A;  5EBD A;  1L0X B;  4NMZ A;  4B08 A;  1TR5 A;  2XWB B;  5TSS A;  4P75 A;  1R9T H;  4DPG A;  1CQV A;  4CKB A;  3CCS A;  1GOZ A;  2WIN B;  1BCP D;  3TZD A;  4NXN Q;  1PH1 A;  3OSO A;  1SE8 A;  2RKS A;  4I65 A;  2KEC A;  4DUY L;  3SGI A;  4DR6 L;  4APV A;  3SK4 A;  1I50 B;  3A8J E;  1G51 A;  3OMG A;  4JI7 Q;  2F0I A;  2UUA Q;  4LF5 L;  1PH6 A;  2KJX A;  4JBM A;  5FJ8 G;  3H15 A;  2PCF B;  3CCL A;  4RCN A;  2ASB A;  2IW3 A;  3FKI B;  1NCV A;  2FFK B;  1DD2 A;  1UUP A;  2EYP A;  4X3K A;  2QW7 A;  1R4Q B;  2JE6 I;  5C3X A;  5D65 A;  1A8V A;  2ENB A;  1JB7 A;  4HCS A;  2OQK A;  2UXD L;  2TMP A;  3OPO A;  3URY A;  2R7F A;  1TII D;  5C3E G;  3CRL C;  1L1O C;  4RHR A;  2L9H A;  4JCV E;  3CKI B;  1TWA B;  2VL6 A;  4DV5 Q;  1QVC A;  2CH4 W;  3BG3 A;  3NQT A;  4JV5 Q;  1RTO A;  4HR7 B;  2H4O A;  3JAM L;  1QB5 D;  4DV6 Q;  3S2D B;  1TS2 A;  3D3R A;  1PMR A;  4IAL A;  4K5X A;  4JK1 C;  4HID A;  3S1M H;  4LW1 A;  4L6T B;  1FD7 D;  2QCP X;  2VXW A;  4YHH Q;  4BBS H;  5M5Y H;  4C3H H;  4DK1 A;  1X3Q A;  1SE3 A;  2VB3 X;  1I94 L;  5AJ3 L;  2F0K A;  1QJO A;  2M00 A;  3NTH A;  4HIK A;  3S1R B;  4X65 L;  4PQX A;  2WAQ G;  3PO3 G;  1K3B C;  5EJW A;  1OXV A;  3S1N H;  4A3D G;  1DCZ A;  4GS3 A;  2IWH A;  1CM9 A;  3CC2 A;  1QNK A;  2CWP A;  4BA1 I;  2B2U A;  4FYD A;  1AE3 A;  1HJP A;  1JJ2 A;  5CV7 A;  2JK8 A;  1DON A;  1WTW A;  1WTR A;  4DNI A;  2F0M A;  4IFD I;  1PRT D;  3CCR A;  3I4M B;  2A8V A;  2B3G A;  3F2D A;  2JA5 H;  2RA4 A;  1NMF A;  3BDO A;  3AEV A;  1IBK L;  1HTL D;  2E2D C;  2E2J B;  3GTM B;  4NKL A;  4KHP L;  4UP9 A;  3ICE A;  3L0O A;  5FOB B;  4HJA A;  1STA A;  3DM3 A;  1N8R C;  4LFC L;  2NUC A;  4H44 C;  2F0G A;  2PNR C;  1X3P A;  4FDB A;  2JA7 G;  2OXP A;  1KL9 A;  1RKN A;  1ZKO A;  2EY5 A;  2Y0S B;  5JVG 3;  2EDG A;  2NVT H;  3DUZ A;  1I4H A;  4G57 A;  3D6C A;  1VQE A;  2O5J C;  2JP1 A;  1C8C A;  1YNJ C;  2UXD Q;  5BR8 Q;  2BA0 A;  2F0D A;  3M4Y A;  1WJJ A;  3T4A C;  3EQL C;  3MXP A;  4A3B G;  1SNM A;  1B3Q A;  4LFB Q;  1YNN C;  5ELB A;  4DR3 Q;  1M90 C;  2PW7 A;  1KRT A;  1PZJ D;  4X3U A;  2Q8T A;  1WTV A;  2WFW A;  5C0X G;  4HMI A;  1E0B A;  1U9R A;  2ZXP A;  4GKK L;  2WAQ B;  2R92 H;  3OHX C;  3M4O B;  1U4P A;  1GUS A;  2YYZ A;  4O42 A;  3S15 B;  1EZ6 A;  5IYB G;  1BCP C;  1PLF A;  4TVA B;  3T53 B;  2JA8 B;  1I6H H;  1X9N A;  3FEW X;  1LV9 A;  1K8G A;  3X3N A;  1U4R A;  2NZ1 D;  1ROD A;  1BBW A;  4OEL B;  1Q46 A;  3E6Z X;  1FJG L;  4DN4 M;  1K0S A;  1UAP A;  1HZC A;  4LFB L;  3PQI A;  2PPB C;  5KEE A;  2K5N A;  2B8G A;  3HGB A;  3K0Y A;  5IYC G;  1Y1W H;  1SE4 A;  3FPU B;  1Y8P B;  3KJP A;  1HH2 P;  2UUC Q;  2K6A A;  3QIA A;  2F0J A;  2YTY A;  4GN5 A;  4DR6 Q;  1N32 L;  5I4D A;  1SLJ A;  4M8A A;  1M1K C;  2D0O A;  2EJF C;  4QMG A;  1SDF A;  1KHI A;  1R9T B;  1N34 L;  4OX9 L;  2RF4 A;  5CBA E;  1Z47 A;  2LFN A;  2O2L D;  4H7B A;  1A2T A;  2DUD A;  2MPM A;  2XVS A;  1IYV A;  3BYY B;  1AW7 A;  3S17 B;  1LT6 D;  4FF3 A;  1K83 H;  4ZQ3 A;  3J80 L;  2CFM A;  4CDF C;  3S15 H;  4QY7 A;  1I50 H;  4A75 A;  3PUX A;  2X6L A;  5GQO A;  1SYE A;  4POG A;  2XRS D;  3V96 A;  5IE8 A;  2SNS A;  1O7Z A;  4ME5 A;  2PMZ E;  2HDL A;  5LL6 S;  3CPW A;  4RHS A;  1XJV A;  3I72 A;  2YTV A;  2AHO B;  2WKD A;  4KN7 C;  1JJC B;  4IUR A;  1Q86 C;  2L5T A;  1OO9 B;  3GTJ B;  1E22 A;  4HSV A;  3NQI A;  2RDF A;  2XWJ B;  3KF6 B;  3LWU A;  2CHB D;  2NVT B;  1IL2 A;  4ME3 A;  4O2D A;  3MWY W;  4QIW E;  4HJ9 A;  3H3V I;  4A93 H;  4GOP B;  1I94 Q;  3I7F A;  4ZUI A;  5A2Q L;  1XPR A;  1WYD A;  2KCT A;  1Y14 B;  1TS4 A;  5CYU A;  3JAM E;  3PO2 B;  2DNC A;  1VQ9 A;  2PMZ B;  3Q22 A;  4EVO A;  4KJN A;  2FHT A;  3W3A A;  1B4O A;  4GN3 B;  5LMU Q;  3BU2 A;  5KYI A;  3RZD H;  5E7N A;  3KLW A;  4A3M B;  5C4H A;  1CK1 A;  2JA5 B;  2PNH A;  3FPP A;  4C2M H;  1CKM A;  1STN A;  2KEE A;  3G7L A;  4DK3 C;  4R8I A;  3MAQ A;  2NN6 I;  4A3I B;  1LLR D;  5FLM H;  3T16 A;  5C4J B;  2H1E A;  2VW9 A;  1N36 Q;  2K1B A;  5G3L F;  5C0X H;  5EPK A;  3CF5 A;  1IW7 C;  1TWC B;  3KUP A;  1CFM A;  4OIK A;  4QCL A;  1CSQ A;  2EPB A;  4DAM A;  3CQZ H;  2R6G A;  2WB1 G;  2LXJ A;  1VQ7 A;  1F2Z A;  1SFO B;  1C7Y A;  4HN7 A;  4IUT A;  4BY7 G;  3WDN A;  1IL8 A;  4ZAI A;  5JEA H;  4UP7 A;  1LTR D;  1F2L A;  3MZ5 A;  1JR0 D;  2MO0 A;  3A5U A;  1WTH A;  1X56 A;  4G7O C;  1SND A;  4ULL A;  1BOS A;  1W6K A;  3SR1 A;  4KKU A;  2HQL A;  1B50 A;  3FMC A;  3OTO Q;  2KA7 A;  1O7Y A;  3LGJ A;  3NK9 A;  1X32 A;  1X3E A;  2Q2I A;  4DV2 L;  2IY5 B;  1VQI A;  3GO5 A;  1HUN A;  2RBM A;  1KQS A;  4DR2 L;  3AU7 A;  5D14 A;  3FHW A;  1HTP A;  1BUV T;  2B2V A;  4K0K L;  4AYB G;  4JVZ A;  3PSI A;  1A0I A;  2M9V A;  1HFN A;  3OWE B;  5M5X B;  3T1H Q;  4A3C H;  4YCV A;  1SE2 A;  3RZD B;  1D8L A;  3JC6 6;  2DN8 A;  1SRU A;  1ZYR D;  3HOX H;  4BXX G;  5C3E H;  2F0S A;  4A3E B;  1GO3 E;  4X64 Q;  3GTK H;  2KEN A;  3J80 E;  4R4I A;  4JI2 L;  4KK7 A;  2TSS A;  1H9S A;  4UPA A;  1AE2 A;  3VDY A;  1U4L A;  3BZK A;  1L0W A;  4X62 L;  1K8A C;  1SNP A;  4JI5 Q;  3M85 A;  2CH4 A;  4ILW A;  2R92 B;  3Q8D A;  3PIO 3;  1ESF A;  1SMX A;  3UDX A;  3SK6 A;  2D0P A;  3I4M G;  1BCP B;  4WRD A;  3I4O A;  3IFT A;  1PHJ A;  1D5X C;  2L4N A;  1FGU A;  4NB3 A;  1GM5 A;  4LF9 L;  4CDD C;  1CTM A;  1II3 A;  2GVA A;  1JOK A;  4KKT A;  2E5L L;  4XYO A;  2VNU D;  4B3R Q;  2BCO A;  1H9M A;  2JA9 A;  1HRJ A;  2G5D A;  3H94 A;  2JA8 G;  4TKO B;  2X69 A;  2MHV A;  4P2C B;  5ISR A;  2E8G A;  3ERO A;  4LUO A;  4GNX C;  4DA2 A;  3D0F A;  1X54 A;  3PUY A;  1OXS C;  4FNF A;  2RDG A;  2NVY H;  1VDZ A;  1CA5 A;  3HOU H;  1V9P A;  1EIF A;  4PMC A;  4A3M H;  5IP7 H;  2Q8I B;  4PNY A;  1HZ9 A;  2L1B A;  3VR5 A;  3NWT A;  3ND9 A;  1VQ8 A;  3HOY G;  4R4O A;  2LSS A;  3H0G G;  1E7Z A;  2H5X A;  3S16 B;  3M4Q A;  1WVL A;  2HCI A;  4DV0 Q;  4LF4 L;  5IP9 G;  1N33 L;  1GHK A;  1GVP A;  1K0R A;  3SDZ A;  4PV1 C;  3BS1 A;  1EIH A;  1EZ8 A;  2JXM B;  2A69 C;  2LS0 1;  4LF5 Q;  1X55 A;  1VMC A;  1YVC A;  5H1S E;  1XTD A;  5LMN Q;  4U68 A;  4K5V A;  2QA4 A;  1IXR A;  3DMU A;  4DGZ A;  5KNC A;  2RDH A;  2P5Z X;  2KCN A;  4DV4 Q;  1Y8O B;  5IGC A;  2R93 G;  4K6D A;  2HQE A;  1M4V A;  2BE5 D;  4XXE A;  2MQH A;  4OWW B;  4WJW A;  3SEB A;  4A3L G;  2N78 A;  4DV2 Q;  2OTL A;  5IYB H;  5GAE C;  3ULP A;  1YHA A;  5FJ8 H;  2IX3 A;  1JE4 A;  4BY1 H;  4BBS G;  4KHP Q;  3LWE A;  3S2H B;  3QO2 A;  4E6I A;  4HJ5 A;  4OEM B;  3LX0 A;  1WCM G;  4EQO A;  1K3R A;  1CKO A;  1VCI A;  5C4X G;  2I5H A;  3I56 A;  3HKS A;  1IBL L;  1FVI A;  1EFI D;  3CU7 A;  1EIG A;  1Q8I A;  1Y1V H;  3ERQ A;  5EKK A;  4Z9C B;  1G8Z D;  4A3K B;  5ELE A;  4A4I A;  2B2W A;  3K81 C;  1STB A;  1Y1V G;  4HIM A;  1O80 A;  3NTI A;  3PUV A;  5FO8 B;  2PI2 A;  1CZG A;  1MSH A;  1TWC H;  2FJ2 A;  2NZO A;  3I91 A;  3HOW B;  5J3B A;  3BDL A;  1X3F A;  1EU4 A;  1HUM A;  3BZC A;  1PFS A;  2HDM A;  4I7Z C;  3CD6 A;  2C5C A;  4C56 C;  2ALY B;  2UUB Q;  4R4C A;  1WFQ A;  1KDC A;  2F0W A;  1N9W A;  4JC0 A;  3MFG A;  1NR4 A;  1JOR A;  3VYU A;  3T56 B;  1PRT F;  1EOT A;  5C44 G;  2A6H D;  1WOC A;  3CXC A;  1EQQ A;  2UXC Q;  1ZEQ X;  1RIP A;  5DLQ E;  1NNX A;  5K36 G;  3B6Y A;  3OW2 A;  4ODG A;  5KIX A;  1YEZ A;  3GTQ B;  1PH2 A;  2PW5 A;  1RDP D;  4C3J G;  4JI1 Q;  1LTI D;  5E4X A;  2JA5 G;  4A3G B;  2F52 A;  3H0G H;  4IUU A;  3D6W A;  1YHB A;  4DV6 L;  2NVX H;  4LUV A;  1F9R A;  1I6V C;  1Q12 A;  2B8F A;  1O7I A;  1VQN A;  5E1F A;  1EYC A;  4YIJ A;  5LMN W;  1I4R A;  4DR7 Q;  1NSN S;  1WTQ A;  1SAP A;  4IN3 A;  1BBU A;  4XIG S;  4K2K A;  3J81 L;  2BOS A;  1EUJ A;  2MFI A;  5I9P A;  1HR0 Q;  1Y69 U;  2PZU A;  2XNA C;  2CVR A;  1HA5 A;  5COR A;  4A93 B;  1CQF A;  3QJY A;  5C4X B;  4OIJ A;  1B9M A;  2PQE A;  3HOU G;  1AN8 A;  3UDI A;  4JW0 A;  2NBF A;  4K14 A;  3RZO B;  1CUK A;  1UE5 A;  3J81 j;  1WCM B;  3A74 A;  1ZXT A;  3E9I A;  2KCM A;  1QZH A;  1PFB A;  1BQQ T;  2KHS A;  4X62 Q;  1LTG D;  3NP8 A;  1IZ6 A;  1A15 A;  2NN6 H;  3RN5 A;  5HGQ A;  3GTJ H;  5IWA Q;  5M3F H;  2ZXR A;  3CW2 C;  5IGD A;  1L1O A;  3AFP A;  3EBE A;  1BBX C;  1D1I A;  4UHV A;  4B3M L;  2JEA I;  4MNO A;  1HXY D;  1YJN A;  5C0X J;  4B9X A;  3H09 A;  5BR8 L;  4B3M Q;  4FF2 A;  2SNM A;  1PTO F;  2E74 C;  5I6Y A;  1EU3 A;  4N9T A;  2A74 C;  1S5B D;  3KLS A;  2JYO A;  1Z6H A;  2WP8 J;  3R2I A;  2GA4 B;  4GN4 B;  5C3W A;  4BXX H;  4OO1 G;  1I4G A;  1CHQ D;  4JI6 Q;  3FKI G;  3ONA B;  2AUK A;  1W6J A;  1JCK B;  4AYB B;  5BN3 A;  4H13 C;  4AYB E;  2F0N A;  3C1F A;  4ZYS A;  2F03 A;  3OYY A;  1PFM A;  1LYL A;  1VQH A;  3KF8 A;  3OIP A;  4EX5 A;  1HNZ Q;  1XTC D;  4LFA Q;  5KGU A;  5C44 B;  3DLL A;  4A76 A;  4NXN L;  2EE1 A;  1SYD A;  3HKZ E;  3HKZ B;  5IOD A;  1B53 A;  1KDA A;  4OWX B;  1KDB A;  1LTL A;  1EYG A;  1Y8N B;  5IWA L;  4DR3 L;  3M4O H;  2F0O A;  1TWA H;  4O1N A;  2HIV A;  4IUV A;  4QIW B;  1Z7T A;  2RSN A;  4K6L A;  2Y0S E;  1PH7 A;  2FIN B;  2R7Z G;  3D4R A;  4GLV B;  4Q5V A;  2K05 A;  1PV4 A;  3HZX A;  1Q1B A;  3W1B A;  5DM7 3;  1ET9 A;  1QNU A;  3S14 H;  4IPD A;  4X3T A;  2AQ1 B;  4KHZ A;  4GNX A;  1GUN A;  1YZ6 A;  2EXZ A;  2UUC L;  5GAD C;  2ZJR A;  1JE5 A;  4CDE C;  3TBI B;  3NXW A;  3NTK A;  2UXC L;  1LT4 D;  5FO9 B;  4P74 A;  2UXB Q;  2LY7 A;  2RSO A;  3I3C A;  3RD4 A;  3A5Z B;  5ELC A;  4C3I G;  1EWI A;  1F9S A;  1BO0 A;  4X64 L;  4OWT B;  5IGE A;  1D5M C;  1MKH A;  1VQL A;  3R3O A;  1NJI C;  1YNJ D;  1LO5 D;  3DEP A;  2PQA A;  5C44 H;  2E2J H;  2DGY A;  4TSS A;  1PTO C;  5A35 A;  1Q3L A;  1BVS A;  3C2P A;  2YU9 H;  5C5L A;  2IX0 A;  5K5P A;  3S9W A;  2G9H D;  2J4X A;  5JEA G;  1JB3 A;  2LXK A;  3M3Y B;  3STB D;  4N9P A;  3RNU A;  1KIX A;  4AQY Q;  1Y1W B;  4OX9 Q;  5CV6 A;  1QIL A;  2E76 C;  2L15 A;  2F3W A;  2CQA A;  1TKW B;  1TWG H;  1BNZ A;  3KLS X;  1QUQ A;  1VQJ A;  5KNB A;  2Z8L A;  4OHJ A;  3C46 A;  1ASZ A;  1DM0 B;  1LAC A;  3VYT A;  3UDF A;  2I0Q A;  3DWP A;  4K8J A;  3ULL A;  3HG9 A;  3J7A F;  1HNX Q;  2F0V A;  2NWG A;  1WD0 A;  2CW0 D;  1NAP A;  1GUG A;  3E0J A;  1HQM C;  5DM6 3;  4QJF A;  4J8Q A;  5EKL A;  1VQP A;  1SJH D;  2JSO A;  3CMA A;  1B7Y B;  1RTN A;  3QR8 A;  2R93 H;  3IL8 A;  3TRE A;  1ILQ A;  4F8M A;  2ICI A;  4RG1 A;  2UUB L;  4BY1 B;  2OWO A;  4JOI C;  3MXN B;  1PRT C;  3I73 A;  4BS9 A;  2K5H A;  1E2Z A;  2E2I H;  2BDO A;  1SBB B;  4KHV A;  3HOZ G;  4YWL A;  4QGU A;  3I70 A;  4C3H G;  1FGB D;  4FVM A;  1RL2 A;  2SEB D;  1HPC A;  5HGT A;  2Q2H A;  1FJG Q;  1FNW A;  3DWA A;  1J6Q A;  4IOC A;  4DV4 L;  2VB2 X;  5M9O A;  1M8A A;  4LMQ D;  2KBN A;  1SR3 A;  1TT2 A;  4HJ8 A;  2XGT A;  4B3S L;  5LL6 X;  5HY6 A;  1B2T A;  1EY6 A;  3HOW H;  3M7N A;  1ILP A;  3MFY A;  5JEA J;  2F0P A;  1S4Z A;  4L5T A;  2NVQ B;  4C3J B;  3KF8 B;  1DOM A;  4JI6 L;  1H9S B;  2HCC A;  4GZY C;  3AFQ A;  3WOE A;  4MIU A;  1C0A A;  4X65 Q;  1OXU A;  1XMO Q;  3Q24 A;  3H3V C;  5CBE E;  1STH A;  4A3F G;  3R2T A;  2JA6 G;  1HFG A;  3S2H H;  3EIV A;  2V4D A;  4LWC A;  4XYQ A;  2QGQ A;  3S1Q H;  4EQP A;  5LMU L;  4JG2 A;  2PZW A;  3Q6S A;  4N8F A;  4A3E H;  1VF7 A;  2A6E D;  4IQZ A;  4YCU A;  2K28 A;  4IO9 A;  4OL7 A;  2SDF A;  2KOL A;  1D7Q A;  4C3I H;  2MP1 A;  4YCW A;  2F0F A;  4A3B H;  1ENF A;  1S5E D;  3PIP A;  4DK6 C;  1KXL A;  5E4W C;  2EYM A;  4IFD J;  1SEB D;  4DR1 Q;  3KF6 A;  1DOL A;  3GTQ H;  1KLG D;  5D3D A;  3PF5 A;  1YNN D;  4G4K A;  5T1G A;  4BWG B;  2OT2 A;  2K14 A;  3VR2 A;  4BY1 G;  2XSC A;  3PF4 A;  5GAG C;  2A6H C;  1VQO A;  4HED A;  4EGV A;  3PGZ A;  1WD1 A;  3MVV A;  2YTX A;  4XDX A;  4DR5 Q;  1BXT A;  2ZTD A;  2NVY B;  3TDQ A;  2JEB I;  4KMU C;  2L0C A;  3TEH B;  3PO2 H;  2JA7 B;  2OTJ A;  3IKJ A;  1L0Y B;  4NXM L;  1V43 A;  2K50 A;  1X6O A;  1U5K A;  4FXG C;  3CCE A;  1IBL Q;  3I8Z A;  3G71 A;  2V1C C;  4ZRZ A;  4TQU S;  2B63 H;  1EY7 A;  4BBR G;  4KI0 A;  1A62 A;  3H3V H;  3OMC A;  4LF8 Q;  1W2B A;  4KD4 A;  3U58 A;  4AIM A;  2Q2U A;  1A3U A;  1SXT A;  3CRK C;  5EPJ A;  2ZJQ A;  2B63 G;  1G6P A;  1AEX A;  1CKN A;  5FK9 C;  2QKI C;  1T5X D;  1YI2 A;  1NMG A;  3AQQ A;  4RMF A;  2IL8 A;  3E5S A;  4HIO A;  1TWG B;  5M3M B;  2I07 B;  2EVB A;  1IYU A;  2JA6 B;  2ID0 A;  2JA6 H;  4IOA A;  4A3D H;  3GTP H;  1TY2 A;  4C1N I;  1J5E Q;  2R61 A;  3CP0 A;  2RCF A;  5LMN L;  4C3I B;  4XTC S;  4CGY B;  2EQS A;  4DK0 A;  2R3Z A;  3M9B A;  1MHW C;  2ZXO A;  4IUQ A;  5L37 A;  4AQY L;  1QOH A;  3PMF A;  3GTO B;  1QCB D;  3CC7 A;  1SJE D;  3J7Z C;  3W1G A;  5F2D A;  3CCJ A;  3EN2 A;  3ND8 A;  1LUZ A;  5JPN C;  3QOL A;  1HHV A;  3J81 E;  3DM1 A;  1KAW A;  5ELN A;  5E3F A;  5C6A A;  1S3O A;  3CAM A;  2D62 A;  3A56 A;  1L2F A;  2UUA L;  2IX1 A;  1B9N A;  2M2L A;  3A0J A;  1XNR L;  4HJ7 A;  3L2P A;  2A73 B;  1EWC A;  3BZD B;  2XTI A;  5LHY 1;  4Y52 H;  1XWE A;  4K8I A;  1G2S A;  1XPU A;  4DR4 L;  2HT1 A;  1I3Q H;  1QG7 A;  2E75 C;  1SMY C;  2SOB A;  2WII B;  3HRZ C;  3M4P A;  5T1I A;  4A3E G;  4A93 G;  4GLA C;  4UAI A;  3PUZ A;  2FMC A;  5IT9 c;  4QQB X;  1GUO A;  1Q1E A;  4GKJ L;  4DUZ Q;  4HMJ A;  3BVM A;  2JJQ A;  4RGN A;  2F0Q A;  3QG1 A;  1ZYR C;  2I5M X;  4DV3 L;  5FLX c;  3VR6 A;  4XT1 B;  1SYB A;  3A54 A;  5EAY A;  4CBV A;  5M3M G;  2NTT A;  4FXK C;  3ER0 A;  1EIY B;  2JN4 A;  2A68 C;  3VR4 A;  1JOO A;  4F7X A;  1FNV A;  4C2M B;  1KAA A;  1AH9 A;  3KJO A;  1VQ4 A;  4JV5 L;  2KHJ A;  5IP9 H;  1K8O A;  3VYR A;  1XMQ Q;  4J1M A;  3NWS A;  4JI7 L;  2K01 A;  4KLK A;  4WJ4 A;  1JWS D;  4DNT B;  3T1Y L;  3PUW A;  4OON A;  3J80 c;  4B3R L;  2DJG C;  3GV3 A;  4CJ2 C;  4DFA A;  2XN9 C;  1XMO L;  4DAY B;  1WI5 A;  3U9S A;  1ESR A;  3DXJ C;  5JOB A;  4LFA L;  3MC0 B;  3T1H L;  3P7J A;  1WTP A;  1UEB A;  3W5O A;  3F1Z A;  1GD7 A;  1RCV D;  2J0T D;  3ERS X;  3GTM H;  1DOK A;  4G7H C;  1X65 A;  2VUM B;  2Z4I A;  1QZG A;  2HHH L;  1PRT B;  3RLN A;  1V1P B;  4A3J H;  3D31 A;  4XQJ A;  4JPB W;  1S72 A;  1ET6 A;  2GN5 A;  3FP9 A;  2RCN A;  1ASY A;  4JYA L;  3U50 C;  3GP7 A;  3PV0 A;  1C4Q A;  1C9O A;  1SNQ A;  1IBK Q;  4LF6 L;  1YNX A;  4B9W A;  1LTB D;  4I7A A;  3EA6 A;  4BY7 B;  1HR0 W;  3K59 A;  4CDC C;  2MO1 A;  4N8X 1;  2CW0 C;  3S1R H;  1JQY D;  4XQQ A;  1VQB A;  2CKZ B;  3GTO H;  1JJG A;  1LTS D;  2JQO A;  3WOF A;  1S40 A;  1TWF B;  4QL5 A;  3HEJ A;  3STB C;  1WTO A;  4DV7 Q;  3BVG A;  1P16 A;  1DJR D;  3HOV G;  1VF5 C;  3H0G B;  3SK5 A;  3HOY H;  4A3I G;  3HOW G;  2UU9 L;  1SYC A;  5NUC A;  1BDO A;  4KN4 C;  2WV6 D;  4AH6 A;  2R7Z B;  3SK8 A;  5I6W A;  4FF1 A;  4GOP C;  1WTX A;  4Q0F A;  4P73 A;  1TS3 A;  2F4V L;  3I2Z A;  5C0X I;  2DY7 A;  1ENA A;  2J7Z A;  1PH5 A;  2NB0 A;  1MI2 A;  2Z6B A;  2RHQ B;  1VQC A;  1Y1V B;  5IGF A;  1SYG A;  4DU9 A;  4MTK A;  4YY3 Q;  4NP5 A;  4JOI A;  4L8J A;  5KRU A;  5K36 H;  3AMU A;  5KND A;  1W3S A;  2B39 A;  3P75 A;  2VQE Q;  2HIX A;  3ITP A;  2K5W A;  5CMD A;  4IJL A;  1IW7 D;  2O5I C;  4LUZ A;  4L63 B;  2CQO A;  1E1T A;  5JJK A;  4UDU C;  2N8N A;  1H9R A;  3GTP B;  2LMC B;  3DHQ A;  1D2B A;  2PQA B;  1AP0 A;  3V05 A;  1RHP A;  1R4P B;  4K5W A;  4BY7 H;  1GJX A;  1TWH B;  1NTG A;  5M5W H;  2VQF L;  2N3S A;  2F3V A;  2N49 A;  2CCZ A;  5ELD A;  4MTN A;  5JPM C;  1XPO A;  1ICF B;  2Z6K C;  3CHB D;  4IUN A;  4HAE A;  4A3K H;  4P72 A;  3I4N G;  1TU2 B;  2NN6 G;  3NEN A;  1HCZ A;  4DUY Q;  4O0A A;  1KD1 C;  5DNF A;  3PO2 G;  2WB1 E;  2WB1 B;  1D5Z C;  2IJ0 A;  3GQB A;  4RH6 A;  5C5M A;  4HSP A;  1SMY D;  2F0E A;  3IFD A;  1U0L A;  1Y1W G;  5C4X H;  1AFP A;  2MUY A;  1GUT A;  4UY8 C;  1EYD A;  2IHE A;  4DXF A;  2A19 A;  5C4J H;  2D2C C;  3A8K E;  2K4K A;  1MJC A;  3UDG A;  3MA2 B;  1FR3 A;  3L9A X;  3K58 A;  2DY8 A;  4JI3 Q;  1EY5 A;  1NUC A;  5M3F B;  2R7D A;  1CA6 A;  3GTG B;  2IHF A;  4B3S Q;  3C1E A;  4OGQ C;  2B2Y A;  1H9K A;  3D4W A;  3H6M A;  2YV5 A;  1L1O B;  3FDT A;  1OTC A;  1EOV A;  2B2W C;  4JI4 Q;  3G4S A;  4DV0 L;  1PA6 A;  1EQR A;  2K04 A;  1EY4 A;  5BN4 A;  2K32 A;  1N32 Q;  1TWH H;  1GKH A;  1VQ5 A;  2BDN A;  1EWH A;  1K9M C;  3BVZ A;  4DV3 Q;  3RUZ A;  4JI8 Q;  2F3I A;  1TY0 A;  1STY A;  1V8Q A;  1I3Q B;  5JJZ A;  4JI5 L;  2EOT A;  2EYL A;  2F4I A;  5IGB A;  2QEJ C;  2K75 A;  3ZYY X;  1B8A A;  1E3P A;  3NHH A;  3CC4 A;  1VQ6 A;  1Q90 A;  3CME A;  4KV6 A;  4DR4 Q;  2Q8R E;  1OXX K;  3BDC A;  4QF4 A;  1TXY A;  4RGM A;  1VQA A;  1D6E C;  1NBW A;  1VQG A;  2Z1C A;  4YY3 L;  5C3E B;  4YHH L;  2QDB A;  2QEX A;  3K5O A;  2F1M A;  1VS0 A;  2AWO A;  4LAA A;  4L5R C;  5IP7 G;  5CGK A;  2N88 A;  4GKK Q;  1E24 A;  1IBM Q;  3S1M B;  2RVL A;  3E0E A;  4LFC Q;  2EJM A;  4MHE A;  4JBK A;  1ENC A;  4CJ0 B;  4ZKC B;  4OO1 I;  1B70 B;  1LT3 D;  4C3J H;  4IPC A;  2EXD A;  4DV1 L;  3T51 B;  1FYC A;  3OTO L;  1STG A;  1UNS A;  3VA5 A;  3CPF A;  2WAQ E;  1QVG A;  1AZQ A;  1STE A;  4FO2 A;  2B2Y C;  2MNA A;  1PZK D;  1KTK A;  2OF1 A;  1HNW L;  5JJL A;  2F0H A;  4DR7 L;  1K73 C;  2F0L A;  4Y7N H;  4JI0 L;  3KFU A;  1S5F D;  3U9O A;  1HNW Q;  2ZTC A;  3MXG A;  3S16 H;  2PI2 E;  4PZ8 A;  1U4M A;  2L12 A;  1RF2 D;  2YU9 B;  2VY3 A;  1EY0 A;  1S5C D;  1PTO H;  1EQV A;  4JBW A;  3J7Y W;  1NR2 A;  4A3K G;  3BJU A;  5EKI A;  4QUF A;  3J81 i;  2E2I B;  1HR0 L;  2NVX B;  4H0L C;  4POF A;  3S1Q B;  2I46 A;  3NEM A;  1BF4 A;  1T9H A;  3CCU A;  4WJ3 M;  2VQE L;  1NY4 A;  4IUP A;  4MZ9 A;  3HOX G;  3DWQ A;  2ZTE A;  5AFW A;  5I9O A;  1PH8 A;  3PO3 H;  1A63 A;  2A69 D;  2VZA A;  5IYC H;  2WKC A;  2F4V Q;  2VUM H;  3FRP B;  1E1O A;  4LF4 Q;  4JI0 Q;  2UU9 Q; 
#chains in the Genus database with same CATH homology
 4R1J A;  1WCM H;  3M4Q A;  3JAM i;  1FL0 A;  2ZM6 L;  2E5L Q;  4NXM Q;  2NVQ H;  2ZTD A;  3E9H A;  4DV0 Q;  2JEB I;  3G48 A;  4LF4 L;  5IP9 G;  3TEH B;  1N33 L;  4DR5 L;  3PO2 H;  1GVP A;  1N34 Q;  4JYA Q;  2OTJ A;  1K0R A;  1N32 L;  4NXM L;  4GNX B;  1Q81 C;  3S24 A;  1V43 A;  2K50 A;  1X6O A;  1U5K A;  3CCE A;  1IBL Q;  2R7Z H;  1Q82 C;  4ALP A;  4DV7 L;  3G71 A;  2V1C C;  4L5S A;  4J15 A;  4TQU S;  4LF5 Q;  2B63 H;  1J5E L;  1OXT A;  1YIT A;  1X55 A;  1IYJ B;  1YVC A;  2NZH A;  4BBR G;  5H1S E;  5IYD H;  4A3I H;  1XTD A;  4KI0 A;  1A62 A;  5LMN Q;  3NBH B;  1YBY A;  5GRO A;  3H3V H;  3CCM A;  4LF8 Q;  2QA4 A;  1W2B A;  4JI1 L;  4P75 A;  1IXR A;  4JI2 Q;  3ZJY C;  4DPG A;  3U58 A;  1R9T H;  3CCS A;  4DV4 Q;  4LF7 L;  4AIM A;  5IYD G;  2Q2U A;  2R93 G;  4PZ6 A;  2MQH A;  4NXN Q;  4OWW B;  2ZJQ A;  2B63 G;  1G6P A;  1PH1 A;  1CKN A;  2N78 A;  4A3L G;  2JA8 H;  1SE8 A;  4DV2 Q;  2OTL A;  4LF7 Q;  1YI2 A;  1NMG A;  5IYB H;  5GAE C;  3AQQ A;  1YJ9 A;  4RMF A;  3ULP A;  4DUY L;  1VQF A;  4B3T L;  4HIO A;  1YHA A;  3HOV H;  3SGI A;  5FJ8 H;  4DR6 L;  4BY1 H;  1PYB A;  4APV A;  4BBS G;  4KHP Q;  3UE0 A;  1G51 A;  4P71 A;  2ID0 A;  4JI7 Q;  1CSP A;  2JA6 H;  4IOA A;  4HJ5 A;  3GTP H;  4A3D H;  2UUA Q;  3RR5 A;  4LF5 L;  1PH6 A;  3WWV A;  1J5E Q;  1WCM G;  4JBM A;  5FJ8 G;  3H15 A;  3CP0 A;  3CCL A;  5LMN L;  2ASB A;  1K3R A;  1A63 A;  1CKO A;  1VCI A;  2AKW B;  4XTC S;  2I5H A;  1PH3 A;  5C4X G;  2EQS A;  3HKS A;  3M9B A;  3I56 A;  1IBL L;  3GTG H;  1TWF H;  4NPS A;  1FVI A;  3S2D H;  5IY0 A;  4AQY L;  1Y1V H;  2JE6 I;  3CC7 A;  4A4I A;  3K81 C;  3J7Z C;  3W1G A;  1A8V A;  3CCJ A;  3ULJ A;  1Y1V G;  4HIM A;  1JB7 A;  3EN2 A;  2OQK A;  2I5L X;  5FLM G;  2UXD L;  4A3G H;  2R7F A;  3PUV A;  1LUZ A;  2PI2 A;  5C3E G;  1L1O C;  1Q7Y C;  1TWC H;  2NZO A;  4JCV E;  2VL6 A;  1KAW A;  1QVC A;  5ELN A;  5J3B A;  1X3F A;  1KRS A;  4DV5 Q;  3BZC A;  1S3O A;  4JV5 Q;  3CAM A;  1PFS A;  2D62 A;  1HNX L;  1L2F A;  2UUA L;  2BH2 A;  5M3F G;  4DR2 Q;  2IX1 A;  3CD6 A;  2B29 A;  1XNR L;  3A0J A;  4HJ7 A;  1HZA A;  2ALY B;  2UUB Q;  4R4C A;  4DV6 Q;  3L2P A;  2R92 G;  3S1M H;  4HID A;  1WFQ A;  4LW1 A;  2XTI A;  4YHH Q;  4BBS H;  1N9W A;  4JC0 A;  5M5Y H;  4Y52 H;  4C3H H;  1XPU A;  4DR4 L;  2HT1 A;  1I94 L;  4JBJ A;  1I3Q H;  5C44 G;  4A3E G;  3M4P A;  4DUZ L;  4BBR H;  4A93 G;  5AJ3 L;  1WOC A;  1X3G A;  4GLA C;  3CXC A;  1Z9F A;  1EQQ A;  4HIK A;  2UXC Q;  3PUZ A;  2AMC B;  5IT9 c;  4X65 L;  2WAQ G;  4QQB X;  1Q1E A;  3PO3 G;  4GKJ L;  3RZO H;  4DUZ Q;  1RIP A;  1OXV A;  5M3M H;  1P8L A;  5DLQ E;  2JJQ A;  5K36 G;  1UE1 A;  3B6Y A;  3OW2 A;  2E2H H;  3S1N H;  4A3D G;  1SN8 A;  1IBM L;  1YEZ A;  2I5M X;  4GS3 A;  4DV3 L;  5FLX c;  3GDE A;  1PH2 A;  4YWM A;  3S17 H;  4JI1 Q;  3CC2 A;  1QUQ B;  2JA5 G;  2CWP A;  4BA1 I;  1BKB A;  3JAM c;  1AE3 A;  2F52 A;  5EAY A;  1HJP A;  5M3M G;  1JJ2 A;  3H0G H;  2JK8 A;  4IFD I;  4DNI A;  1YHB A;  3ER0 A;  4DV6 L;  4LUV A;  1EIY B;  2NVX H;  1Q12 A;  3CCR A;  1O7I A;  1VQN A;  1N36 L;  2A8V A;  2VUM G;  2B3G A;  3F2D A;  5LMN W;  2JA5 H;  3KDF A;  1KC8 C;  1AH9 A;  1NMF A;  3AEV A;  3KJO A;  1VQ4 A;  1IBK L;  4JV5 L;  1QVF A;  3T1Y Q;  2KHJ A;  4DR7 Q;  5IP9 H;  1JT8 A;  4KHP L;  1XMQ Q;  1BBU A;  4UP9 A;  4JI7 L;  3ICE A;  3L0O A;  4XIG S;  4KLK A;  4HJA A;  4WJ4 A;  3DM3 A;  1EUJ A;  3T1Y L;  2MFI A;  3PUW A;  4OON A;  3J80 c;  3RN2 A;  4B3R L;  1N8R C;  1HR0 Q;  4LFC L;  1VQD A;  1XMO L;  4DAY B;  3GD7 A;  1WI5 A;  4FDB A;  3U4V A;  2JA7 G;  3HOU G;  5JJI A;  1KL9 A;  4LFA L;  1MIU A;  3UDI A;  3CCQ A;  2OQ0 A;  3T1H L;  1CUK A;  1UE5 A;  3J81 j;  2NVT H;  3A74 A;  3E9I A;  2KCM A;  1QZH A;  1UEB A;  3W5O A;  3F1Z A;  1GD7 A;  3ERS X;  4X62 Q;  1VQE A;  3GTM H;  1IZ6 A;  4PZ7 A;  3RN5 A;  1X65 A;  5HGQ A;  3GTJ H;  5IWA Q;  5M3F H;  2UXD Q;  1QZG A;  3CW2 C;  4DV1 Q;  2HHH L;  4H02 A;  1L1O A;  2BA0 A;  3AFP A;  3EBE A;  5BR8 Q;  4B3M L;  2JEA I;  1WJJ A;  2FXQ A;  4MNO A;  3RLN A;  1YIJ A;  4A3J H;  1YJN A;  1PH9 A;  5C0X J;  1XMQ L;  3I4M H;  3D31 A;  3TS2 A;  4A3B G;  5BR8 L;  4A3M G;  1S72 A;  4B3M Q;  4LFB Q;  2GN5 A;  3I55 A;  4DR3 Q;  1M90 C;  3FP9 A;  2EIF A;  2RCN A;  1VQM A;  1KRT A;  1ASY A;  4JYA L;  3U50 C;  2WFW A;  3PV0 A;  1C9O A;  5C0X G;  1IBK Q;  4LF6 L;  1YNX A;  3PIO A;  4GKK L;  2WP8 J;  2R92 H;  4A3F H;  4GN4 B;  1HR0 W;  2YYZ A;  4LF9 Q;  2AWN A;  1VQK A;  4BXX H;  4X66 L;  4OO1 G;  2MO1 A;  3S1R H;  4JI6 Q;  3FKI G;  4GOP A;  5IYB G;  4TVA B;  1VQB A;  2CKZ B;  1I6H H;  1X9N A;  3GTO H;  4AYB E;  1JJG A;  1K8G A;  3OYY A;  1VQH A;  1LYL A;  2JQO A;  4EX5 A;  4DR5 Q;  1S40 A;  1HNZ Q;  4QL5 A;  4LFA Q;  3STB C;  1CKN B;  3J81 c;  4DV7 Q;  3DLL A;  1BBW A;  1PVO A;  1P16 A;  4A76 A;  4UP8 A;  4DR1 L;  1Q46 A;  5M5X H;  2Q2T A;  1FJG L;  4NXN L;  3HOV G;  3HKZ E;  1HZC A;  3HOY H;  4LFB L;  4OWX B;  4A3I G;  1LTL A;  1EYG A;  3M4O H;  4DR3 L;  5IWA L;  1NE3 A;  2UU9 L;  3HOW G;  2K5N A;  5IYC G;  1Y1W H;  1TWA H;  2HIV A;  3TS0 A;  4AH6 A;  4BA2 I;  2Y0S E;  1HZB A;  4GOP C;  1PH7 A;  1XNR Q;  2R7Z G;  4X6A H;  4P73 A;  4GLV B;  2F4V L;  5GAH C;  3I2Z A;  5C0X I;  1HH2 P;  3KJP A;  1PV4 A;  2UUC Q;  3F2C A;  3GTL H;  1PH5 A;  1Q1B A;  3W1B A;  3S14 H;  4IPD A;  2RHQ B;  4GNX A;  4KHZ A;  2YTY A;  1VQC A;  4GN5 A;  1UE7 A;  4DR6 Q;  4K0K Q;  1SLJ A;  1YZ6 A;  4YY3 Q;  2UUC L;  4JOI A;  5GAD C;  1JE5 A;  2ZJR A;  1M1K C;  1LM0 A;  2D0O A;  1KHI A;  1N34 L;  1W3S A;  4OX9 L;  4PMW A;  2VQE Q;  2RF4 A;  2UXC L;  2HIX A;  4IJL A;  1Z47 A;  3RLF A;  4LUZ A;  2CQO A;  2DUD A;  1E1T A;  3NEL A;  4P74 A;  2UXB Q;  3A5Z B;  5JJK A;  4JI8 L;  2BA1 A;  1K83 H;  2N8N A;  1EWI A;  4IJH A;  2CFM A;  3F2B A;  4X64 L;  4OWT B;  2PQA B;  3S15 H;  4QY7 A;  1I50 H;  3K8A A;  3K7U C;  4A75 A;  3PUX A;  1MKH A;  1VQL A;  2C35 B;  5GQO A;  3HOZ H;  4BY7 H;  4POG A;  1NTG A;  5M5W H;  2KHI A;  5IE8 A;  2N3S A;  2VQF L;  1NJI C;  2K52 A;  2N49 A;  2CCZ A;  2PMZ E;  2PQA A;  5C44 H;  4MTN A;  1XPO A;  2Z6K C;  2E2J H;  3TRZ A;  4LNQ A;  2DGY A;  3CPW A;  3HKZ G;  4A3K H;  1XJV A;  2YTV A;  4P72 A;  4JI4 L;  3PCO B;  3I4N G;  2AHO B;  4IFD G;  2NN6 G;  1BVS A;  3NEN A;  3TQY A;  4DV5 L;  4DUY Q;  2ES2 A;  4O0A A;  1DGS A;  1JJC B;  4IPG A;  2WB1 E;  2IX0 A;  1KD1 C;  2YU9 H;  3PO2 G;  4LF6 Q;  1Q8K A;  2A1A A;  5JEA G;  1Q86 C;  2Y0S G;  1E22 A;  5AJ3 Q;  2LXK A;  3STB D;  3KF6 B;  3RNU A;  1KIX A;  3CCV A;  2K5V A;  1U0L A;  3G6E A;  4AQY Q;  1Y1W G;  4GKJ Q;  4LF8 L;  5C4X H;  4OX9 Q;  4ME3 A;  4O2D A;  4QIW E;  4HJ9 A;  1YJW A;  1IL2 A;  3H3V I;  4UY8 C;  4GOP B;  4A93 H;  2IHE A;  1I94 Q;  2L15 A;  2A19 A;  3I7F A;  5C4J H;  1XPR A;  1JMC A;  1WYD A;  1TWG H;  2KCT A;  1Y14 B;  1QUQ A;  1VQJ A;  4GLX A;  2Z6K A;  2VQF Q;  1ASZ A;  2K4K A;  1MJC A;  3UDG A;  1VQ9 A;  3UDF A;  2I0Q A;  3ULL A;  4JI3 Q;  3J80 i;  1SRO A;  2R7D A;  4GN3 B;  1HNX Q;  2IHF A;  4B3S Q;  5LMU Q;  3BU2 A;  4QJF A;  3RZD H;  5E7N A;  1VQP A;  3KLW A;  1PH4 A;  2PNH A;  2YV5 A;  4C2M H;  1CKM A;  3CMA A;  1B7Y B;  4DK3 C;  1L1O B;  2NN6 I;  2R93 H;  1SFO H;  5FLM H;  1OTC A;  1EOV A;  3TRE A;  2VW9 A;  4JI4 Q;  3G4S A;  4DV0 L;  1PA6 A;  1N36 Q;  1EQR A;  1N33 Q;  3CF5 A;  1UE6 A;  4L5Q A;  4RG1 A;  2UUB L;  2OWO A;  1N32 Q;  4JOI C;  1TWH H;  3MXN B;  1GKH A;  1VQ5 A;  3M3Y H;  1CSQ A;  2K5H A;  3CQZ H;  2R6G A;  4DAM A;  2WB1 G;  2E2I H;  2LXJ A;  1VQ7 A;  1K9M C;  1C7Y A;  3HOZ G;  5ELO A;  4BY7 G;  4DV3 Q;  4YWL A;  4QGU A;  2IT1 A;  1I5F A;  4JI8 Q;  1RL2 A;  4UP7 A;  2F3I A;  2MO0 A;  3A5U A;  2Q2H A;  1X56 A;  1FJG Q;  4JI5 L;  3KYH C;  1J6Q A;  4IOC A;  4DV4 L;  2HQL A;  2K75 A;  1B8A A;  3OTO Q;  2KBN A;  1SR3 A;  1E3P A;  4HJ8 A;  1MJE A;  2XGT A;  3LGJ A;  3CC4 A;  1YHQ A;  4B3S L;  1VQ6 A;  1X3E A;  2Q2I A;  4DV2 L;  5HY6 A;  4A3L H;  3CME A;  2IY5 B;  1VQI A;  2HHH Q;  3HOW H;  3M7N A;  4A3G G;  4DR4 Q;  3GO5 A;  5JEA J;  1OXX K;  3UE1 A;  1KQS A;  4DR2 L;  4L5T A;  3FHW A;  1TXY A;  1VQA A;  4K0K L;  1NBW A;  4X66 Q;  1VQG A;  3KF8 B;  4AYB G;  4YY3 L;  1H95 A;  4YHH L;  4JI6 L;  2QEX A;  3PSI A;  4EQ5 A;  1A0I A;  3MEF A;  3T1H Q;  1VS0 A;  2AWO A;  4L5R C;  4A3C H;  4YCV A;  5IP7 G;  4GKK Q;  1E24 A;  1IBM Q;  3AFQ A;  1D8L A;  3JC6 6;  4LFC Q;  3E0E A;  3FKI H;  1SRU A;  1C0A A;  3HFZ B;  3HOX H;  4X65 Q;  4JBK A;  1OXU A;  1XMO Q;  4DKA C;  3L7Z C;  4BXX G;  4OO1 I;  5C3E H;  1B70 B;  4C3J H;  4IPC A;  1GO3 E;  2VS1 A;  4X64 Q;  2EXD A;  4A3F G;  2JA6 G;  4DV1 L;  3GTK H;  2KEN A;  3OTO L;  4R4I A;  4JI2 L;  3S2H H;  3K0X A;  3CPF A;  2WAQ E;  1AE2 A;  3EIV A;  4UPA A;  1QVG A;  3VDY A;  3I4N H;  3AYH B;  4LWC A;  1PYS B;  3BZK A;  1L0W A;  4X62 L;  2MNA A;  1K8A C;  1HNW L;  4JI5 Q;  2QGQ A;  3M85 A;  5JJL A;  3KOJ A;  3S1Q H;  3Q8D A;  4DR7 L;  1SMX A;  1K73 C;  5LMU L;  4Y7N H;  4JG2 A;  4JI0 L;  2ATW A;  2GVB A;  3UDX A;  3KFU A;  4A3C G;  2D0P A;  4A3J G;  3I4M G;  1HNW Q;  2ZTC A;  1XNQ Q;  4A3E H;  3KDF B;  1PHJ A;  3I4O A;  2OCE A;  4YCU A;  2ZJP A;  3S16 H;  2RHS B;  2PI2 E;  1FGU A;  4IO9 A;  4NB3 A;  4PZ8 A;  1GM5 A;  1EFW A;  4LF9 L;  4R4Q A;  1D7Q A;  4C3I H;  2VY3 A;  4YCW A;  3F8T A;  3K80 C;  3K7A H;  2GVA A;  4JBW A;  4PG3 A;  4A3B H;  2ZM6 Q;  2E5L L;  2VNU D;  4A3K G;  4B3R Q;  3BJU A;  3J81 i;  2BH8 A;  4OXP A;  4R4T A;  4DK6 C;  3PIP A;  2JA9 A;  1HR0 L;  4B3T Q;  1KXL A;  4POF A;  2UXB L;  2JA8 G;  3NEM A;  4IFD J;  1T9H A;  2Z0S A;  3RLO A;  4DR1 Q;  2E8G A;  3KF6 A;  4LUO A;  3CCU A;  4GNX C;  4YWK A;  4WJ3 M;  2VQE L;  3GTQ H;  1NY4 A;  4IPH A;  3D0F A;  3PF5 A;  1X54 A;  3PUY A;  1OXS C;  1UWV A;  3U4Z A;  2CWA A;  1HNZ L;  2K14 A;  4BY1 G;  4MZ9 A;  3PF4 A;  3HOX G;  1G29 1;  4JI3 L;  2NVY H;  2ZTE A;  1XNQ L;  5GAG C;  1PH8 A;  3PO3 H;  2JA7 H;  1VQO A;  1V9P A;  1EIF A;  3IRB A;  3HOU H;  4A3M H;  3J7A 5;  2VZA A;  5IP7 H;  5IYC H;  1V1Q A;  3PGZ A;  2VUM H;  2F4V Q;  1HZ9 A;  2YTX A;  1E1O A;  4LF4 Q;  1VQ8 A;  4JI0 Q;  3HOY G;  2UU9 Q;  4R4O A;  2LSS A;  3H0G G;  1E7Z A;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...