4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
1PH4A 1PA6A 4JBJA 3CD6A 1VQBA 5C0XJ 4PMWA 1MKHA 4IOCA 4GOPB 3HOUG 5M5YH 5IWAQ 2E2JH 2OWOA 3MXNB 4JI8L 2GVAA 3JC66 4BA1I 3CCJA 4IO9A 4JI1Q 4WJ4A 4BBSH 1WCMH 1HZ9A 4LFAL 4JI4Q 4NXML 1Y1VH 2UXDL 3NEMA 4DV4L 2ZJRA 4JBWA 5LMNQ 4A3CG 1HR0W 1X56A 1VQ8A 4KLKA 4LF8L 4IFDG 2JA8G 3J80i 4KHZA 4DUYQ 4B3TQ 2ZTDA 3UDXA 4YCUA 2N49A 2ZTEA 3KF8B 2DGYA 4X66Q 5IYCH 1N33Q 2QA4A 5IP7G 5C3EG 4DR6Q 3H15A 4OO1I 2I5HA 1K0RA 1QVCA 4NXNL 4IPGA 3WWVA 2EQSA 2IX0A 4DR4Q 1IBLQ 1XNRQ 4B3SQ 3W1GA 1G6PA 2A19A 3CCUA 4DV3Q 1R9TH 1IBML 1Q81C 1EQQA 3AFPA 1UE1A 1HZBA 2R93G 3CCSA 1VQ4A 1BVSA 4LF9Q 1FL0A 4XTCS 1N32L 1PV4A 4DV1Q 1U0LA 2UUCQ 4X62Q 1N36L 2JA5H 2I5LX 1C0AA 1K83H 3F8TA 3J7A5 2K52A 5GQOA 3HKZE 4IPCA 4DV5L 2UUBL 2PQAB 3HOWH 2EXDA 1HZAA 1K8AC 3L7ZC 3S1MH 3S24A 1B8AA 1KC8C 3J81j 4A3KG 1EIFA 4OX9L 3CAMA 4YCVA 3UE1A 3G6EA 2GN5A 5EAYA 2D0OA 4DV7L 4LUVA 1K3RA 2YTYA 4R4QA 3DLLA 3TRZA 2UXBQ 1YEZA 4B3ML 4BXXG 4BY1H 5H1SE 1XMQL 3HOYH 1EIYB 3TS2A 1Q86C 5C0XI 1S40A 3PO2H 4LWCA 3I4MH 2JK8A 1WOCA 3KDFB 1FJGQ 2K14A 4YY3L 2K4KA 1XMOL 4JI5L 4POGA 2K5VA 2JA7H 3PO3G 2AMCB 5DLQE 3J81i 2VS1A 2R7ZG 4UP7A 4DAMA 1WCMG 4BBSG 2WAQG 3ERSX 4GKKQ 2CFMA 4JBKA 3GO5A 1SN8A 3H0GH 4FDBA 2UUAL 5J3BA 4PG3A 1B70B 1Y1VG 1X3GA 5BR8L 1J5EL 2A8VA 3GTPH 3ULJA 3RLNA 1L2FA 1SFOH 5FJ8H 1CUKA 4JI3Q 1SMXA 3E9HA 1GVPA 1PYBA 5GAGC 3JAMi 5IYCG 4L5TA 1L1OA 2VQEQ 5JJLA 1I50H 1E3PA 2IT1A 3PUXA 4O2DA 1AE2A 1MIUA 4DUZL 4PZ6A 5C3EH 1HNXL 4DV0Q 3RN2A 4A3LG 4IPDA 4HJ5A 1A62A 4A3DH 4X65L 4YHHL 1BBWA 1VQLA 2YTXA 4EX5A 4LW1A 2HIXA 1KD1C 1AE3A 1HNWL 3ER0A 5M5XH 5FLMG 4NB3A 1GM5A 1A8VA 1OXTA 2IX1A 2DUDA 2KHJA 3NENA 4YCWA 5C4JH 4X64Q 1DGSA 4LF4L 2JA5G 3PCOB 3CCVA 4X6AH 1TWFH 1PH2A 1C9OA 1QVFA 2F4VL 4A93H 3FHWA 1TWGH 3I7FA 5IP9H 1HNZL 4OO1G 2F52A 4JYAL 3K80C 1TXYA 1E24A 3OTOL 3CCMA 4JV5Q 1E7ZA 4C3HH 1Q7YC 4LFBQ 2KCTA 2I0QA 4JG2A 4LFAQ 4NXMQ 3EBEA 4HJ7A 2NVTH 4DV4Q 2UXDQ 5GROA 2E8GA 2ZTCA 3G48A 4DPGA 4OONA 4LF8Q 4HIKA 4GNXC 3A5UA 1VQ9A 2WB1E 3S15H 3M85A 1YIJA 3PO2G 4A3BG 4BXXH 1VQGA 4A76A 3I4MG 3S2DH 1E22A 3U4VA 1VQMA 4NXNQ 2JA7G 5JEAG 1IYJB 2E5LQ 1Q1EA 3KF6B 3ICEA 3M4QA 4DR3Q 2Q2HA 1PH6A 4GS3A 2ZM6L 4HIMA 3PO3H 5ELOA 1IBMQ 1EFWA 2R7ZH 3H0GG 4GN4B 3A0JA 5LMUL 3A74A 2FXQA 2WB1G 1YZ6A 2NN6I 4PZ7A 3K8AA 2VY3A 4DR7L 5JJIA 1JJGA 2ES2A 1CSPA 4JI7L 5FJ8G 4DR1L 1PH8A 3S1RH 2B29A 1N36Q 1EQRA 2LXKA 3T1YL 3GTQH 5C0XG 1HR0L 1X9NA 3CCRA 4GKJL 1Y1WH 1YITA 4POFA 1IBKL 3CPFA 2N8NA 4OXPA 4UY8C 1V1QA 1MJEA 4OX9Q 5IYDH 1VQNA 4A3DG 1MJCA 2UXCL 3CQZH 3NBHB 1AH9A 4A3LH 4DV7Q 4A3GG 3K81C 2IHEA 1QZGA 1NTGA 2R92H 3GTMH 1PH1A 5C4XH 1KQSA 1E1TA 2B3GA 2KCMA 2Z6KA 1XMQQ 3BZKA 4A3JH 3HOXH 3GTKH 1Q82C 1KL9A 3EIVA 1L1OC 2I5MX 4DV2L 2KBNA 4JOIA 4LF6L 5FLMH 3CMAA 4QIWE 4UP9A 1K8GA 4KHPL 4YY3Q 2EIFA 5M3FH 1XMOQ 3AQQA 3RLFA 4GNXB 1PH5A 1WFQA 1N34Q 1Q46A 4JI5Q 4A93G 1H95A 5IP9G 1OXVA 4K0KL 1I3QH 4JI2L 2OTJA 3RNUA 1XPUA 1XNRL 3ULLA 4DKAC 1PH3A 1Z9FA 3BZCA 2UUAQ 2BA1A 4UP8A 3KLWA 1EYGA 3KFUA 3S14H 1A63A 5BR8Q 5IE8A 4BBRH 5IWAL 1UE5A 2KHIA 3SGIA 1JMCA 4EQ5A 1KRTA 4APVA 1HZCA 1ASZA 2CQOA 2CCZA 3ULPA 2VUMH 2WAQE 2UU9Q 4LF7L 1VQ6A 1EOVA 4LUOA 1VQCA 5LMNW 2VQFL 2HHHL 3I4NH 3CCLA 1QVGA 4RG1A 4JI4L 1N9WA 4QL5A 4AYBE 5LMNL 4DUZQ 1GO3E 4A3BH 4L5SA 2JE6I 2WP8J 1VQJA 1HJPA 2CWAA 1I94L 1IZ6A 3CPWA 4B3TL 1LUZA 1SROA 3TQYA 4X65Q 4YHHQ 1XTDA 1XPRA 1CKNA 3PUWA 1VQPA 2Z0SA 1X65A 1HNWQ 4MNOA 1WJJA 1X55A 2XTIA 3PIPA 4DR4L 4PZ8A 4AYBG 3KOJA 4B3RL 1XNQQ 2PI2E 1T9HA 3F2CA 1PYSB 4DR2L 3OW2A 2F4VQ 4OWXB 3GDEA 4JI0L 2LSSA 1Y1WG 4JYAQ 1L1OB 2NZHA 1PH9A 2OTLA 3OTOQ 2JA6H 3EN2A 3PUVA 2MNAA 1CSQA 1GKHA 3PIOA 3RZDH 2UUCL 1D7QA 1KHIA 2D0PA 3DM3A 4IJLA 1L0WA 5IT9c 2ZJPA 1W2BA 1IXRA 2ALYB 1LTLA 3M7NA 1PHJA 2R92G 1P8LA 5C4XG 3GTLH 2RHQB 2Q2UA 2Q2IA 2NN6G 4A3JG 3HOXG 4P72A 4C3IH 4A3GH 3HFZB 5IY0A 1BBUA 4DR5Q 4A3IG 4HJ8A 5AJ3Q 2RHSB 2Y0SE 5IYDG 5M5WH 1OXUA 4LFCL 4J15A 5M3FG 4LF5L 3AEVA 3GTGH 2UXBL 3LGJA 1XJVA 1QUQB 1VCIA 2H5XA 4JI8Q 3J7ZC 3I55A 3CMEA 1ASYA 1CKMA 1KIXA 3S16H 4TQUS 2JA9A 1OTCA 5LMUQ 4R4IA 4AH6A 3Q8DA 4YWKA 3E0EA 1Y14B 4A3EH 3CP0A 4BBRG 1FJGL 2Z6KC 3STBC 1W3SA 1UWVA 4JI7Q 2L15A 2Y0SG 4DR1Q 4TVAB 3RN5A 4RMFA 4GLXA 2CWPA 1PVOA 2VUMG 2ASBA 2MFIA 2VL6A 2BH8A 1TWAH 3T1YQ 1WYDA 2NZOA 5E7NA 1HR0Q 1PH7A 4KI0A 3I4NG 3I4OA 4R1JA 5GAEC 2IY5B 1IBKQ 1Q12A 2N78A 4LUZA 3U4ZA 2CKZB 2OQ0A 3G71A 1X6OA 4A3MG 4BY7G 4MZ9A 1JE5A 2JJQA 1YJ9A 1OXXK 3S1QH 2D62A 2YYZA 1VQEA 4R4OA 3PF4A 2N3SA 2ZJQA 1UEBA 3OYYA 2Q2TA 2AWOA 2LXJA 4L5QA 3M3YH 2WFWA 2MQHA 4JC0A 1VQHA 4UPAA 4GN5A 1FGUA 1NBWA 1UE7A 5HY6A 5GAHC 3F2DA 4DV2Q 4KHPQ 2YTVA 1YHBA 1N32Q 3H3VI 4A3FH 1G51A 1CKOA 3CC7A 4K0KQ 4JI2Q 2JA6G 2VW9A 1YBYA 4R4TA 4IFDJ 4DV5Q 1NJIC 2UUBQ 3HOZG 3E9IA 1BKBA 4IJHA 4X64L 1S3OA 4XIGS 3KF6A 4HJ9A 4GOPA 4IPHA 1HH2P 2PMZE 1B7YB 1YI2A 3KYHC 3UDFA 4LF7Q 4JV5L 1FVIA 2MO0A 4AQYL 4IOAA 2VNUD 2K50A 1D8LA 4B3MQ 3I2ZA 2HHHQ 2VQFQ 4LFBL 3RLOA 3W1BA 3PUYA 4JI6L 4DV6L 4JBMA 3S2HH 3A5ZB 1V9PA 4A3IH 3L2PA 1VQ5A 4A4IA 4DK3C 2ID0A 5IYBH 1VS0A 4GLAC 3H3VH 3UDGA 1VQAA 4A75A 1I94Q 1O7IA 3PV0A 2AHOB 3CF5A 1U5KA 4YWLA 4O0AA 3T1HL 2PI2A 2OCEA 4QQBX 4A3EG 3TEHB 1GD7A 2RF4A 2E5LL 2JQOA 4DR3L 1J5EQ 1YJWA 4HIOA 4B3RQ 4DAYB 2R6GA 3FKIG 3KJOA 3GD7A 4P74A 4DR2Q 1N8RC 4MTNA 4JI1L 2IHFA 4H02A 4JI0Q 4L5RC 4Y7NH 3W5OA 1G291 3U58A 2K5NA 3BJUA 2HT1A 3J80c 1HNXQ 4GNXA 1A0IA 2OQKA 1P16A 2QGQA 3B6YA 5M3MH 3M4OH 5K36G 1KAWA 3CC4A 2KENA 3HOVH 1KRSA 1NMGA 3F2BA 4DUYL 4A3MH 1M90C 4BY7H 1CKNB 2AKWB 2PQAA 1TWCH 1N33L 4X66L 4DR6L 4LNQA 4DK6C 1TWHH 1VQKA 1WI5A 3GTJH 1NMFA 4ME3A 1I6HH 4LFCQ 1SLJA 3PSIA 4QY7A 2QEXA 3PGZA 3K0XA 3CXCA 1IBLL 4A3FG 1V43A 4B3SL 4LF4Q 4LF5Q 2JEAI 4DV3L 3RZOH 5GADC 1K9MC 1KXLA 2PNHA 3HKZG 5C44H 4IFDI 1EUJA 2NVYH 4OWTB 3TS0A 1C7YA 3I56A 1HNZQ 1X3FA 2B63H 1S72A 1J6QA 1IL2A 5ELNA 3KDFA 3STBD 4LF9L 1N34L 3D31A 3HOZH 3CC2A 3KJPA 3CCEA 4DV1L 1LM0A 4X62L 3HOUH 1VQDA 1K73C 4WJ3M 3FP9A 3S17H 3HKSA 1X54A 1VQOA 3K7UC 1EWIA 4QGUA 4HJAA 3PUZA 3MEFA 1YHQA 5HGQA 2YV5A 3RR5A 2V1CC 3AYHB 2K5HA 1XPOA 5IYBG 4AIMA 1SR3A 1LYLA 4A3CH 1PFSA 2R7DA 1QZHA 2UU9L 4P73A 4GOPC 3M4PA 2BA0A 1VQ7A 2ZM6Q 2BH2A 1E1OA 2RCNA 1I5FA 4C3JH 2JA8H 1NY4A 2R7FA 4GN3B 2ATWA 2NVQH 3M9BA 3J81c 3UE0A 5IP7H 1VQIA 1YHAA 4DR7Q 1VQFA 4C2MH 1Q1BA 3VDYA 3BU2A 1OXSC 1RL2A 2HQLA 1M1KC 3U50C 4JOIC 4ALPA 1Z47A 3FKIH 4NPSA 3G4SA 4BA2I 4P75A 2F3IA 4GKKL 3UDIA 2K75A 1YVCA 4QJFA 2YU9H 4GKJQ 3CCQA 3TREA 2NVXH 2R93H 1JT8A 4GLVB 1JJCB 3PF5A 2C35B 5M3MG 2MO1A 3JAMc 2GVBA 3CW2C 3NELA 4JI3L 1XNQL 5FLXc 2UXCQ 4P71A 1Q8KA 1QUQA 1X3EA 2A1AA 2E2HH 3HOVG 3HOWG 1YNXA 3F1ZA 5JEAJ 4DNIA 2VQEL 2VZAA 4HIDA 4YWMA 4AQYQ 1UE6A 4R4CA 3ZJYC 1JB7A 1SE8A 4OWWB 1RIPA 4DV6Q 4JI6Q 3S1NH 5JJKA 3IRBA 4DV0L 4A3KH 2HIVA 4LF6Q 1JJ2A 3AFQA 3L0OA 1NE3A 2JEBI 2E2IH 5C44G 4BY1G 2XGTA 4JCVE 4DR5L 3HOYG 4Y52H 1YJNA 3K7AH 1SRUA 2B63G 3T1HQ 3GTOH 2AWNA 3D0FA 5AJ3L
chains in the Genus database with same CATH superfamily
1LTRD 4QMGA 4IOCA 3S1RB 3O13A 4AYBB 5M5YH 4H44C 4BWGB 3WOEA 3MXNB 2A5HA 4N9PA 2F03A 2GVAA 3Q22A 4RKBA 4BBSH 1WCMH 3HS0C 2PZUA 2CW0D 1JE4A 2JP1A 4NXML 4DV4L 3CQZB 4LF8L 3QB3A 2OXPA 4KY6A 3M4OH 3GTKB 1LTID 1SE4A 4OO1I 3H15A 2I5HA 1MHWC 1QVCA 4NXNL 5IODA 1XNRQ 3W1GA 1G6PA 1R9TH 1EQQA 3AFPA 1AZPA 1XWEA 1HZBA 3URYA 1VQ4A 4TRDA 2EDGA 4LF9Q 4BBRB 1SYCA 4DN4M 1U0LA 4X62Q 5EBCA 1C0AA 2CVRA 5E4XA 1A2UA 1K83H 5GQOA 1NR4A 2DY7A 2IPKD 1XX8A 2PNRC 5DNFA 3UE1A 4IALA 1D5ZC 2O2LD 2CH4W 1GHKA 2UXBQ 5H1SE 1EIYB 3A8KE 4UAIA 3EQLC 1SNQA 3I4MH 3T51B 4YY3L 1XMOL 4POGA 3PO3G 5DAUA 5K5PA 4DU9A 2EVBA 4UP7A 5CC4A 2X6LA 2CFMA 3I4LA 3GO5A 1TKWB 1Y1VG 1X3GA 5BR8L 3PIO3 1J5EL 1TU2B 3GTPH 4XYQA 1SFOH 1CUKA 3EJIA 3E9HA 2A6ED 2PW7A 5A35A 1L1OA 2VQEQ 1B50A 4RAUC 3PUXA 4O2DA 1SAPA 1A6XA 4V190 4DK0A 2PZWA 4HJ5A 3LWUA 1WD0A 1A62A 1KDAA 1BBWA 2QEJC 1VQLA 2PMZB 3MA2B 1PFBA 1CZWA 1JWSD 4I7AA 1C4QA 1AE3A 3VA5A 1HNWL 3BDOA 5LL6X 1F77A 5FLMG 4NB3A 3FPUB 4A3EB 1A8VA 4YCWA 1WTRA 1DGSA 2A73B 3PCOB 1C9OA 4A93H 5CV4A 1HNZL 4OO1G 4JYAL 1E7ZA 3NWTA 2KCTA 1SDFA 4LFAQ 3QIAA 3FVQA 2ZTCA 3G48A 2WV6D 4HIKA 3KLSX 3A5UA 3FEWX 3S15H 1LLRD 3S2DH 3SVMA 1VQMA 3R8BA 2EJFC 5JAVA 2JA7G 2B2YA 1Q1EA 4YIJA 3M4QA 4JK1C 2ZM6L 3GTOB 4HIMA 3PO3H 1O7LA 4K6LA 3D3RA 1SE2A 2DJFC 3H0GG 2GA4B 2WB1G 3A74A 1YZ6A 4PZ7A 4DR7L 1CSPA 4JI7L 1WTPA 5M5YB 2XVSA 4DR1L 1S5ED 1K8MA 1GXDC 4CBVA 5LHY1 2V4DA 1I4GA 1MSHA 1HR0L 3DWAA 4ZK9B 4ABNA 4IN3A 1IBKL 3S2HB 1KNAA 3MC0B 4OX9Q 1VQNA 4A3DG 3D4DA 3MXNA 5JPNC 5D65A 4ILWA 1KQSA 4FVMA 2Z6KA 2QF7A 3CRLC 4L63B 3OWEB 1KLUD 3VR6A 5FLMH 3CMAA 1K8GA 4UP9A 1N34Q 4CHTB 4F88A 1R9TB 2ZXRA 1Q46A 2A68C 1XYIA 1C48A 1I3QH 2OTJA 3RNUA 2HDMA 1XPUA 3ULLA 4DKAC 1Z9FA 4Y7NB 1KLGD 4UP8A 1CK1A 5DEHA 4DXGA 1UE5A 4O42A 3U9OA 3MFGA 1AZQA 1X3PA 1GOZA 2CCZA 2F0FA 5DM73 2VUMH 2UU9Q 1EOVA 2VQFL 3I4NH 3CCLA 4RG1A 1N9WA 4QL5A 1RODA 4AYBE 4DUZQ 1I6HB 5CR3A 2JE6I 1CZGA 3MAQA 1I94L 3CPWA 2C9OA 4YHHQ 1XTDA 3DUZA 3U9SA 1EIHA 2L55A 4FXKC 2IWHA 3HG9A 4KKTA 2EY6A 1YNND 1SJED 2G9DA 1XNQQ 3F2CA 3S17B 4OWXB 5F2DA 1Y1WG 3OTOQ 3EN2A 2MNAA 3GTPB 3PIOA 1SFOB 3J80E 4HCSA 1L0WA 4H13C 1QILA 2ALYB 1LTLA 5IGCA 1P8LA 2RHQB 4RA8A 3HOXG 1B9NA 1BBUA 4A3IG 2OF1A 2ZXOA 3TZUA 4PNYA 3K57A 1SNMA 5EQ0A 1LT5D 2RA4A 1FNVA 3LGJA 2UXBL 1XJVA 4JI8Q 1ASYA 1SBBB 4OELB 2KHSA 4K8JA 2JA9A 3AMUA 1Y14B 3STBC 1W3SA 3V05A 2Y0SG 4RMFA 4B9XA 3E5SA 4ZRZA 2QILA 5ELFA 2VL6A 1WYDA 5CV5A 1Y69U 1BCPD 2NZOA 4DAPA 4KI0A 1Q90A 4R1JA 5GAEC 2IY5B 4LUZA 4EQPA 3MHBA 1E0BA 4QIWB 4JW0A 2I46A 4MZ9A 1JE5A 4QF4A 1FD7D 3LNNA 1YJ9A 5K36H 2D62A 3KLRA 1PRTC 3SK4A 2EYMA 3OYYA 3DMUA 2MQHA 4JC0A 1VQHA 4JPBW 4X3KA 1H9SB 1R4PB 4DV2Q 3VYRA 1NBWA 3J7AV 5JJZA 2EY1A 2E2JB 2YTVA 3PO3B 2D5DA 3CU7A 2X69A 3CC7A 2JA6G 2PQEA 5COYA 1YBYA 4R4TA 1NJIC 3E9IA 3PMFA 4IJHA 1S3OA 1Y1VB 4HJ9A 4GOPA 2RCFA 1JQYD 2PMZE 4HMJA 1YI2A 3KYHC 3C46A 3KBXA 4MTKA 4RHSA 4AQYL 4IOAA 2VNUD 4ZUIA 3RLOA 2L12A 4JI6L 1EU3A 3VA7A 4A3IH 3L2PA 3WOFA 4X3TA 3UDGA 1Z7TA 2AHOB 4FNFA 3T1HL 2PI2A 3C1FA 4K2KA 2OCEA 1LABA 3TEHB 1K0SA 1X3QA 2N88A 2ICIA 3I70A 4KV6A 3BDLA 2RSOA 1LACA 4KMUC 4P74A 1PRTB 4DR2Q 4JI1L 4JI0Q 4L5RC 3QOLA 3S1MB 1G291 1HNXQ 1I4XA 2SNMA 1P16A 1NR2A 3HOVH 1VMPA 1CKNB 5KNBA 1N33L 4LNQA 1TWHH 3QWNA 3GTJH 1NMFA 4ME3A 1SLJA 2JA7B 3PGZA 4B3SL 1PMRA 3NE5B 2PNHA 4OWTB 3HZXA 3VYTA 1C7YA 1QOHA 3H0GB 2WB1B 2F0MA 1IL2A 1N34L 3D31A 3KJPA 4KN4C 2EZVA 2Z1CA 1K8OA 1E2WA 5I6YA 4G7HC 1MBYA 5IGEA 1VQOA 3TP8A 5I9OA 4QGUA 3PUZA 1I50B 2YV5A 2O4XA 2V1CC 1XPOA 2RDHA 2QDLA 4A3CH 4A3DB 3K5NA 4XT1B 4CDCC 1QZHA 2UU9L 4P73A 1JWMD 1CQFA 1E1OA 2JA8H 1I5FA 3X3MA 2K05A 1IKLA 2R7FA 4GN3B 3BYYB 1WVLA 5M5XB 3M9BA 3QOJA 5J39A 1VQIA 1VQFA 3VDYA 3BU2A 2F0HA 1WTXA 1RL2A 2HQLA 4BA2I 1NUCA 3UDIA 5G3LF 2NUCA 2YU9H 4GKJQ 2R93H 1IW7D 3SEBA 2NVTB 3H91A 1SNOA 1IYUA 3Q24A 1XNQL 5FLXc 1F2LA 3R2IA 2MGSA 1UE6A 3BG3A 4R4CA 1TT2A 1ET6A 1JB7A 4KK7A 2BOSA 4LJZC 4DV0L 5JJKA 2D2CC 4LF6Q 2F0JA 2E2IH 3HOYG 1XTCD 1AN8A 1VF7A 3K7AH 2B63G 2A6HC 2AWNA 3IFDA 3TBIB 1F2ZA 2Z6BA 1VQBA 3J80L 1LTSD 1SMYD 5IWAQ 1ZYRC 1ET9A 4JI8L 1SYFA 1TS2A 3JC66 3D4WA 4BA1I 1Y1WB 2K01A 5IGGA 4JI4Q 2UXDL 5LMNQ 1HR0W 4RCNA 1X56A 3I3CA 1TY2A 1BOSA 4KHZA 4DUYQ 2NWGA 3H6MA 1WTOA 3NK9A 4DNRB 2N49A 4X66Q 1H9JA 4XQQA 5NUCA 3HOXB 2Q8RE 4DFAA 1K0RA 4IPGA 2F1MA 3WWVA 4HSVA 1IBLQ 1GUSA 2AQ1B 3CCUA 3IFTA 2SOBA 1LTGD 3S14B 2R61A 2LKVA 1FL0A 4L8JA 4DV1Q 2Y0SB 1UEAB 4H0LC 2JA5H 2I5LX 2XN9C 5KGUA 1PZKD 2K52A 5EKLA 2PQAB 5LL6S 2EXDA 1K8AC 2RKSA 1WTWA 3L7ZC 4FP5D 1E2VA 1Y8PB 1KC8C 3CAMA 2F3WA 5EAYA 2D0OA 4DV7L 1K3RA 2YTYA 4R4QA 3TRZA 1YEZA 1XMQL 3HOYH 1J9OA 1Q86C 5I6WA 2JK8A 3KDFB 4F8MA 4JI5L 5JEAH 2AMCB 5DLQE 2R7ZG 2JN4A 4BBSG 1WCMG 1LT6D 2JA6B 4GKKQ 3OIPA 4JBKA 4FDBA 2VB3X 3Q6SA 4PG3A 5IGBA 2A8VA 3CKIB 3RLNA 1L2FA 5FJ8H 4JI3Q 1SMXA 1GVPA 1PYBA 5GAGC 3DWPA 4HMIA 5JJLA 5C0XH 1S5BD 2ZT9C 1E3PA 2IT1A 4ZKCB 5KNDA 1HHVA 1HNXL 1MIUA 4FF2A 4PZ6A 1JR0D 4IPDA 2QKIC 4QB4A 1JORA 4X65L 3H09A 4EX5A 2F0EA 2HIXA 3E0JA 4LW1A 1KD1C 1JICA 2F0UA 5FO9B 1GM5A 1KDCA 1OXTA 1H9MA 2F0PA 1I4PA 1GUWA 4X64Q 2F4IA 3CCVA 2KA7A 3I8ZA 1TVXA 4FXGC 2LY7A 3FHWA 5ELEA 5IP9H 4C1NI 3K80C 2IJ0A 4C3HH 1Q7YC 4LFBQ 1W6JA 1EFID 4JG2A 3V96A 3EBEA 4HJ7A 2E8GA 1D1IA 4DNTB 1E2ZA 3S1QB 1HXYD 2B2UC 4OONA 4GNXC 1WTQA 1VQ9A 2WB1E 1A3UA 1PTOF 2LS01 1YIJA 4A3BG 1VQGA 3I4MG 3M3YB 1E22A 3U4VA 1IYJB 3ICEA 3A8JE 2O5IC 4GS3A 1IBMQ 2R7ZH 5LMUL 5JOBA 3W3AA 4CKBA 2VY3A 1IYVA 2J0TD 3DM1A 1PH8A 2A68D 2NTSA 4MHEA 1N36Q 2LXKA 2J7ZA 4GKJL 3NQTA 2N8NA 2VB2X 3MFYA 4RGOS 1V1QA 1MJCA 3NBHB 5E3FA 3TP7A 4R8NA 4C3IG 2IHEA 1NTGA 2R92H 5C4XH 3N52A 1E1TA 1KDBA 4K14A 2NN6H 3BZKA 5EPLA 2I07B 4A3JH 1KL9A 2I5MX 3NTIA 4LF6L 1V1OA 2QCPX 5IYDH 5M3FH 3I72A 1PH5A 3RLFA 3FPPA 4GNXB 4A93G 1H95A 3OOCA 2M9VA 3LWEA 4K0KL 4QCLA 4K6DA 5EPJA 3BZCA 2UUAQ 3KFUA 1STAA 4OGQC 5IWAL 1JMCA 2B39A 2KHIA 4EQ5A 4DAYA 5KYIA 1HTPA 1ASZA 1HZCA 2WAQE 4LF7L 2KEEA 1VQ6A 1TWCB 4R8IA 1VQCA 4WFN3 4JI4L 3FMCA 2XRQD 5LMNL 4A3BH 2WP8J 2CWAA 4WRDA 1LUZA 1SROA 2Z8LA 3HOYB 1PTOC 2B63B 1FNWA 2NYZD 2Z0SA 1SJHD 1X65A 3OMCA 4B3RL 1G6ZA 1T9HA 1PYSB 2F4VQ 1BXTA 2NZHA 3FRPB 1PH9A 3PUVA 1ONLA 3RZDH 1ZKOA 2NZ1D 4HTHA 3BVMA 3DM3A 4IJLA 3UI2A 2ZJPA 4BS9A 1D5XC 1QCBD 4TSSA 2K28A 2Q2IA 4C3IH 5IY0A 2SNSA 4FF4A 2Q8IB 2RHSB 5D3DA 2Y0SE 4C2MB 5M5WH 2MPMA 2MHVA 5ELDA 3GTGH 1LTTD 3NPPA 1DXMA 2B2VC 2H5XA 1T5EA 1CKMA 3EFXD 1KIXA 5ELBA 4AH6A 2DN8A 5FO7B 4YWKA 2NVXB 2FFKB 5C5MA 1V1PA 2B2WC 2MUYA 1PTOB 1PVOA 2E2HB 5CV7A 2VUMG 2ASBA 3T1YQ 4RCOA 1TWAH 1GUOA 1F2MA 3I4NG 3I4OA 1Q12A 3S1NB 2AUKA 1U4LA 2WKDA 5CV6A 4A3MG 4F7XA 2JJQA 2H1EA 1OXXK 1PFNA 2MJ8A 2YYZA 3HKZB 1BUVT 3T53B 2ZJQA 1ILPA 2Q2TA 1IKMA 3T13A 2WFWA 5C6AA 4LK1C 4UPAA 4KHPQ 4IUNA 3NUCA 1ENCA 3M7GA 4ZCKA 4A3FH 2EYHA 5E1FA 2R7ZB 4BBSB 1WCMB 4JI2Q 3K58A 3VYUA 4DV5Q 2UUBQ 1BKBA 4X64L 4XIGS 1STYA 2O5JC 5JVG3 4F87A 1QE6A 4IUTA 1S5FD 1STNA 1NNXA 3M4OB 1ILQA 3HRZC 3I2ZA 3OPOA 2HHHQ 5C4HA 4LFBL 3W1BA 2BCOA 1DCZA 1VQ5A 4DK3C 5IYBH 3H3VH 4N8X1 4C3JG 2BE5C 1U5KA 4OHJA 1NAPA 4HN7A 5DM63 4QQBX 1MD2D 1Q8IA 4EQOA 1R4QB 4KY7A 4HIOA 3D4RA 3KJOA 3FKIG 1K83B 1TS4A 1N8RC 4MTNA 2IHFA 5JVH3 1RD9D 2CW0C 2K5NA 2B2UA 1PRTF 4GNXA 5M3MH 5K36G 1G2SA 3R2TA 1KRSA 3A7LA 1EOTA 4A3MH 2AKWB 1M90C 1V8QA 4A3BB 1VQKA 3I4MB 4LFCQ 3PSIA 4RHRA 4LF5Q 1XNRL 4PMBA 3RZOH 1V43A 4LF4Q 3N6RA 5C44H 5J22A 3KBGA 3VR5A 2LMCB 2NVYH 4R9WA 2A69D 4LF9L 4ZKBB 3CC2A 3CCEA 1LM0A 4X62L 4ZUJA 3HOUH 3TP6A 1EWIA 4MIUA 1K28A 4UDUC 1I4HA 4MN3A 5I2YA 4AIMA 1SR3A 1BQQT 1LYLA 2R7DA 2L9HA 2WKCA 2BA0A 1CTMA 3M4PA 1VQ7A 5M9OA 2RCNA 4IFDH 4C3JH 1NY4A 4KD3A 1W6KA 5C5LA 2E74C 2NVQH 2K32A 5CBEE 3J81c 3UE0A 2B2TC 5IP7H 5M5WB 3EVQA 2HD3A 1Q1BA 2BDOA 4EVOA 1EY8A 1M1KC 4A93B 3U50C 4B9WA 4JOIC 4ALPA 1Z47A 3FKIH 4P75A 1YVCA 4QJFA 3EROA 3TREA 3CCQA 1JT8A 4GLVB 1ENAA 1JJCB 5FK9C 1PYWD 2MO1A 2KOLA 3JAMc 2GVBA 3CW2C 4CDDC 2UXCQ 4P71A 1Q8KA 3HOVG 3IL8A 5C4ZA 3HOWG 3H3VC 2A6EC 4DK1A 5JEAJ 1O7ZA 4DXFA 2HUGA 2VQEL 4HIDA 3S15B 1EL0A 3ZJYC 3S2DB 4OWWB 4DV6Q 2HCCA 4A3KH 2TMPA 1JJ2A 3AFQA 3L0OA 2JEBI 1CHQD 1YJNA 1SRUA 3D0FA 5I4DA 1PH4A 1PA6A 4JBJA 5I9PA 5C0XJ 4PMWA 1MKHA 3KLSA 1X32A 1EYDA 2PPBC 3T16A 1YNJD 3CCJA 4IO9A 4WJ4A 2XIWA 3EA6A 5HGTA 4FF1A 1CQVA 3DEOA 4I65A 4LFAL 3NEMA 4A3CG 2ZJRA 4JBWA 2EXZA 1VQ8A 1TS5A 5G3LD 2JA8G 2PW5A 3K5LA 2PZTA 4NMZA 3UDXA 3KF8B 2DGYA 5IYCH 4DR6Q 1CM9A 2QA4A 3LX0A 1JOOA 2AQ2B 4DR4Q 3SK6A 2A19A 4DV3Q 4XYOA 4DA2A 1EQVA 1I3QB 1Q81C 1UUPA 1DOLA 3HEJA 3OSOA 4JVZA 1A2TA 2R93G 4XTCS 1PV4A 3J7A5 2VUMB 3HKZE 4IPCA 2G9HD 4H7BA 4DV5L 1EQTA 2UUBL 3HOWH 1HZAA 1HQMC 3I4NB 1B8AA 4UHVA 1G8ZD 3J81j 4OX9L 4YCVA 3G6EA 2SDFA 2EYOA 3IAYA 4FYDA 4OIJA 4OL7A 1TY0A 4A3MB 4LUVA 3DLLA 4XQJA 4BXXG 3TS2A 4K5VA 2FHTA 5CV9A 5C0XI 1B1ZA 3PO2H 1EWCA 1FJGQ 5IIFA 3A7AB 3HGBA 3NTHA 1SYDA 2K14A 2K5VA 2K5WA 3J81i 5TSSA 4J8QA 1JOQA 3ERSX 1IL8A 1JOKA 3SK8A 1SN8A 2K04A 4DGZA 1B70B 2Z9HA 3OWFA 4N9TA 3NXWA 1WTVA 3JAMi 4L5TA 3H94A 1BBXC 2EJMA 4DUZL 3RN2A 4A3LG 1HPCA 1U9RA 4YHHL 4C3JB 2YTXA 1OO9B 2RDFA 3ER0A 3MZ5A 2DUDA 3NENA 2KHJA 3D6WA 1M8AA 1IHZA 1U4RA 1RTOA 4LF4L 4KJNA 2JA5G 4X6AH 3DHQA 1YNNC 1PH2A 4X3UA 1ICFB 5EBDA 2L4NA 1TWGH 3I7FA 2EYFA 2ICEC 3OTOL 4JV5Q 3CCMA 5IOCA 3G7LA 4NXMQ 4L6TB 4DV4Q 1PDQA 4LF8Q 4CDEC 2MP1A 2K5QA 2F0VA 3M85A 4BXXH 4RGMA 4NXNQ 1A3TA 2OT2A 5JEAG 1HRJA 1Y8NB 3KF6B 4DR3Q 1PH6A 2Q2HA 3DXJC 3P1HA 5ELOA 2F0TA 5KNCA 2FXQA 2NN6I 3J81E 1JJGA 2ES2A 1H9SA 1VMCA 5FJ8G 2EE1A 3S1RH 4IUUA 5C3XA 4Q0FA 1BCPC 5C0XG 1CFMA 1X9NA 1HCZA 4POFA 3CPFA 4OXPA 3SR1A 4A3IB 1HA5A 2UXCL 1EIGA 3JAME 3CQZH 4A3LH 1F9QA 4A3GG 2B2TA 1C8CA 1PH1A 2B3GA 2KCMA 5CORA 3GTKH 3TMEA 1Q82C 3EIVA 1L1OC 3P75A 1QVFA 4DV2L 4JOIA 4QIWE 4YY3Q 1XMOQ 2WACA 1WFQA 2R3ZA 1PTOD 2TSSA 5IP9G 2EY2A 4OIKA 1UAPA 1PH3A 2DNCA 4C3HG 2B8FA 3NHHA 1EYGA 2K03A 1BDOA 5BR8Q 1WD1A 1RTNA 4ULLA 4BBRH 3DEPA 4APVA 3NQIA 3RMHA 3HOVB 3FDTA 3ULPA 3HOWB 2F0DA 3NBIA 3AU7A 4K2LA 5KEEA 4LUOA 4WJWA 3VR3A 1TWHB 3TP5A 3GTJB 1GO3E 3SXHA 1HJPA 1BCPB 1IZ6A 1I6VC 1XPRA 1CKNA 3PUWA 4ME5A 1ICWA 4IUPA 1HNWQ 2KEDA 2L0CA 4MNOA 4J6HA 1WJJA 2KQ3A 2XTIA 4DR4L 3MTSA 4PZ8A 3BS1A 2B2YC 4DR2L 3OW2A 4JI0L 4JYAQ 1L1OB 2OTLA 4XXEA 1J8IA 1B44D 4V0BA 1EEFD 1D7QA 5IT9c 1DM0B 3SE0A 1PHJA 2R92G 1BO0A 2JA8B 3GTLH 5C4XG 3IKJA 2Q2UA 5T1GA 2NN6G 4A3JG 4HR7B 4A3GH 3HFZB 4B08A 3C3LA 4IUQA 5IYDG 5M3FG 3AEVA 1PFMA 3GQBA 1QG7A 2F0NA 1QUQB 3J7ZC 4KKUA 4TQUS 3J7AF 4R4IA 2YU9B 3Q8DA 2R93B 3E0EA 4QUFA 4A3EH 3CP0A 1FJGL 2Z6KC 1B9MA 1UWVA 4JI7Q 4DR1Q 4TVAB 5CYUA 2CWPA 4K5WA 5FOBB 2BH8A 1HR0Q 5E7NA 1B3AA 2X6GA 4KJOA 1IBKQ 2N78A 3U4ZA 2OQ0A 1RHPA 2KCNA 4J1MA 3D6CA 4ZYSA 1LTAD 1X6OA 2E2IB 4BY7G 4K8IA 2RDGA 3K7AB 3K5OA 1VQEA 3CHBD 4R4OA 2ZXPA 2N3SA 4IQZA 3Q23A 1UEBA 1BF4A 1KNEA 2LXJA 4L5QA 1RDPD 3D8GA 3BYTB 1G2TA 1FGUA 5HY6A 3F2DA 1QWYA 2F3VA 1N32Q 3H3VI 4XQNA 1G51A 1CKOA 4K5XA 4LAAA 1TIID 2VW9A 3P7JA 3T56B 4IFDJ 3HOZG 2M00A 1IW7C 1DD2A 3KF6A 2RSNA 1HH2P 1KABA 1PXUA 5FLXE 1B7YB 4JV5L 1FVIA 2MO0A 2K50A 3GP7A 4B3MQ 2VQFQ 4RH6A 4KD4A 5D3IB 3KK7A 1SNPA 3A5ZB 1V9PA 3S2HH 4OEMB 4KN7C 2ID0A 1VS0A 4TKOB 1VQAA 4A75A 1I94Q 1O7IA 3PV0A 4P2CB 3RUZA 4YWLA 4CKEA 2K1BA 4EGVA 1ENFA 1STGA 2EYJA 4DR3L 1YJWA 1QJOA 1SMYC 4NW2A 2JA5B 1GJXA 2FMCA 4H02A 3KUPA 2JSOA 4Y7NH 3W5OA 3U58A 3BJUA 2HT1A 5ISRA 3J80c 3SHLA 3L9AX 1HA6A 2OQKA 2QGQA 1O7YA 3A56A 1HUNA 1KAWA 3CC4A 3F2BA 1Q3LA 4DUYL 4BY7H 2PQAA 3CRKC 3SDZA 4X66L 3MVVA 3HP3A 4DK6C 3J81L 1WI5A 1I6HH 1IBLL 2QEXA 3CXCA 4A3FG 5GADC 1K9MC 2XRSD 4IFDI 1CA6A 1JCKB 1X3FA 4CDFC 2FMMA 2XNAC 5ELNA 4RWSC 3KDFA 3STBD 3HOZH 3JAML 4DV1L 2H4OA 2JYOA 1K73C 3S17H 3HKSA 1X54A 1Y8OB 3K7UC 5CBAE 4HJAA 3MEFA 2E2DC 5HGQA 3RR5A 1QB5D 3V2TA 2K5HA 1AFPA 5IYBG 1PFSA 5IGDA 3GTLB 2WINB 4GOPC 1EWHA 4A3GB 3BDCA 1DOMA 2PYKA 1PRTD 1QNUA 2CH4A 3R93A 1AW7A 4C1NK 3K0YA 2G5DA 1OXSC 3W2DA 2F0OA 4NPSA 3G4SA 2F3IA 2EYPA 4GKKL 2K75A 4C3HB 4ID6A 3PF5A 5M3MG 2CQAA 4JI3L 3WDNA 1RJTA 3X3NA 2A1AA 1QUQA 1X3EA 1YNXA 3F1ZA 1SXTA 2P5ZX 2KVMA 4DNIA 1STHA 4AQYQ 4YWMA 1S4ZA 4JI6Q 2HIVA 1TR5A 5IT9E 5C44G 4BY1G 2XGTA 4JCVE 3T1HQ 1I4RA 2NBFA 2RVLA 1GHJA 4RGNA 2KUMA 4IUVA 3CD6A 3K59A 1KTKA 3BVGA 4GOPB 3HOUG 1HQRD 2E2JH 2OWOA 2F0LA 1GUTA 2A74C 4JI1Q 4CGYB 1HZ9A 4G7ZC 1Y1VH 1L0YB 3OIQA 2AUJD 4Q5VA 4IFDG 4KLKA 1EEID 4CKCA 3J80i 4B3TQ 2R92B 1SNCA 2ZTDA 5C4XB 4RGTA 1B53A 4YCUA 2ZTEA 4HCEA 4A3JB 1N33Q 1AP0A 5IP7G 2HDLA 5C3EG 5EKKA 3I73A 1O78A 2EQSA 1EZ8A 4KKSA 2IX0A 5M3FB 3I90A 1VDZA 4B3SQ 3NBHA 5EJWA 1EY6A 1IBML 2XWBB 2RBMA 1UE1A 3CCSA 4HAEA 1BVSA 2KECA 1HUMA 1N32L 2UUCQ 2F0WA 2N55A 1N36L 3F8TA 3MXUA 4OO1H 2KJXA 3S1MH 3S24A 4A3KG 1EIFA 1U4PA 2GN5A 1DJRD 1AEXA 1DZ1A 4BY7B 2OEOA 4B3ML 3A8IE 3QR8A 4BY1H 1ZXTA 1S40A 4LWCA 3PIP3 1WOCA 3ERQA 5EGTA 5AFWA 2K4KA 2JA7H 5FLXL 4M1UB 2EPBA 5J1ZA 2VS1A 4DAMA 2WAQG 4IURA 2DJGC 3ITPA 3H0GH 2UUAL 3HOZB 5J3BA 3RZDB 4IZ8A 3ULJA 1B3QA 1EY0A 2QW7A 4NKLA 3SK5A 3K6OA 1D5MC 2EY5A 1S5CD 5T1IA 4C56C 5IYCG 4C3IB 1F9SA 2D9UA 1TQOA 1I50H 2XWJB 1ML0D 1AE2A 3MEHA 5C3EH 4DV0Q 3TZDA 3GTGB 3TDQA 4A3DH 5CMDA 2A6HD 1STBA 1HFGA 5M5XH 4X3SA 1I4QA 2IX1A 1EZ6A 3BVZA 1FNUA 1F2YA 5C4JH 1ZYRD 1TWFH 2F4VL 1TWAB 1MI2A 4GZYC 4PMCA 2XSCA 3M4YA 1FYCA 2F52A 2EOTA 1SSOA 4ZLTF 1TXYA 1E24A 1SEBD 4EQNA 2I0QA 2UXDQ 2NVTH 1LO5D 5GROA 4CJ1B 2LFNA 4KY5A 4DPGA 2ENBA 3OMGA 2HQEA 3PO2G 3RD4A 4G57A 1BR9A 4A76A 1A15A 1CHPD 3NWSA 2E5LQ 1Z6HA 3R3OA 5BN3A 4A3FB 1EY5A 1EFWA 1DONA 2NTTA 4XT3B 4GN4B 3A0JA 2PO4A 1EYCA 3K8AA 1T5XD 1WTHA 1G91A 4N8FA 1NCVA 2B29A 5KYLA 3F2UA 1EQRA 3T1YL 5BN5A 3ONAB 3GTQH 4LMQD 4G7OC 4PQXA 1KAAA 2F0IA 3CCRA 2J4XA 3BZDB 4RKLA 1Y1WH 1YITA 2EJGC 4UY8C 1MJEA 2C5CA 2B2VA 5BN4A 1AH9A 4DV7Q 1FR3A 1HTLD 3K81C 1GUNA 1QZGA 3GTMH 1D6EC 1XMQQ 4CJ2C 2B2WA 3HOXH 3NSWA 1EY9A 3A54A 2KBNA 4KHPL 4HSPA 5EKIA 2EIFA 3AQQA 4JI5Q 3J7YW 4U68A 3OW7A 1OXVA 4DAVA 4JI2L 3NP8A 3VR4A 2HCIA 2BA1A 3MWYW 3KLWA 3S14H 1A63A 5IE8A 5IT9L 1BNZA 3SGIA 5M3MB 3ZYYX 2K5DA 2SEBD 1KRTA 2CQOA 1F9PA 3VYSA 5LMNW 2HHHL 3AB9A 1QVGA 1S5DD 1PZID 4FF3A 2BDNA 4L5SA 1JC7A 1VQJA 3RZOB 5CV8A 4B3TL 4X65Q 3TQYA 5C44B 4BY1B 3P20A 2NVYB 5KRUA 4O1NA 1VQPA 3C2PA 5A2QE 2IW3A 1B2TA 1BCPF 4RFBA 1H9KA 1X55A 3PIPA 4AYBG 3KOJA 3HOUB 1EU4A 2WIIB 4U673 2PI2E 2IL8A 3GDEA 1L0XB 1A3VA 2LSSA 1CT1D 3PQIA 2JA6H 1II3A 1CSQA 1GKHA 1RCVD 2UUCL 1KHIA 2D0PA 2L11A 5JPMC 1W2BA 5D14A 1IXRA 5I2XA 3M7NA 1DYQA 2L5TA 1K3BC 4P72A 2E76C 2NVQB 4I7ZC 4DR5Q 5C3EB 4HJ8A 5AJ3Q 4XDXA 4S3SA 3MXGA 1OXUA 3MXPA 4J15A 3L3OC 4LFCL 4LF5L 1RKNA 2PCFB 3I55A 1VCIA 3FKIB 3CMEA 3Q0AA 3S16H 5EPKA 1OTCA 5LMUQ 2A69C 4E6IA 5C4JB 4BBRG 3G6JB 2L15A 1TWFB 5C3WA 3RN5A 4GLXA 2MFIA 2DNEA 1JWUD 1PH7A 3TN2A 2AQ3B 2M2LA 2F0SA 1SE3A 4QUCA 5CGKA 4CJ0B 1LT4D 2CKZB 4A3KB 3G71A 2F0QA 5HURA 2Z4HA 1D2BA 3E6ZX 2B8GA 3S1QH 4DF7A 2K33A 2RQXA 3PF4A 2AWOA 3M3YH 2IX3A 1SNDA 1UE7A 4GN5A 5GAHC 1XXGA 1YHBA 2FINB 2VXWA 3TSSA 4K0KQ 3NTKA 5KIXA 2WAQB 1O80A 2NB0A 3S9WA 4IPHA 3I91A 1F9RA 5ELCA 3GTQB 1UNSA 4NP5A 3UDFA 4LF7Q 1D8LA 1MGSA 4NDXA 4WORA 3PUYA 3QJYA 2E75C 4DV6L 4JBMA 1EY4A 1SYEA 1VF5C 1RF2D 3C1EA 3GV3A 4A4IA 1GUGA 4GLAC 3GTMB 3CF5A 2F0GA 4O0AA 2Q8TA 1CA5A 4FO2A 3KF8A 4A3EG 2FJ2A 1GD7A 2RF4A 2E5LL 2JQOA 4ODGA 1J5EQ 3OHXC 4B3RQ 4DAYB 2R6GA 1H9RA 3GD7A 1YNJC 1LT3D 1LTBD 1HFNA 1SYBA 2DY8A 2QDBA 5FO8B 1ESRA 3K5MA 4Z9CB 1A0IA 1LV9A 3B6YA 1QNKA 2KENA 1NMGA 3A55A 1STEA 3T4AC 1TWCH 4DR6L 1CI3M 2KCCA 3QG1A 3PO2B 3E3XA 1NSNS 4QY7A 4KHVA 3K0XA 2EYLA 3VR2A 2JEAI 4DV3L 1KXLA 3HKZG 2JXMB 1EUJA 3TS0A 1EYAA 3I56A 1HNZQ 2B63H 4KTAA 4ZAIA 1J6QA 1S72A 2K7VA 1VQDA 4WJ3M 3FP9A 1EY7A 4ZQ3A 1YHQA 2K6AA 1B4OA 3AYHB 1PLFA 1ZEQX 1MSGA 1PZJD 5JJIA 2ZM6Q 2BH2A 3QO2A 2ATWA 1ESFA 1YHAA 1V1PB 2CHBD 4C2MH 4DR7Q 1JB3A 2Z4IA 3S16B 1TWGB 4M8AA 4FXDA 1SYGA 5L37A 2NVXH 1U4MA 2C35B 5FKAC 2F0KA 3NELA 3ND9A 1FGBD 1DOKA 4PV1C 1PTOH 2L1BA 2E2HH 1M4VA 5E4WC 5A2QL 2VZAA 4G4KA 1SE8A 3DWQA 1D1KA 1RIPA 3S1NH 3IRBA 1TS3A 3GV6A 1NE3A 3ND8A 4HEDA 4Y52H 2BE5D 3GTOH 5IGFA 4DR5L 5AJ3L
chains in the Genus database with same CATH topology
1PH4A 1PA6A 4JBJA 3CD6A 1VQBA 5C0XJ 4PMWA 1MKHA 4IOCA 4GOPB 3HOUG 5M5YH 5IWAQ 2E2JH 2OWOA 3MXNB 4JI8L 2GVAA 3JC66 4BA1I 3CCJA 4IO9A 4JI1Q 4WJ4A 4BBSH 1WCMH 1HZ9A 4LFAL 4JI4Q 4NXML 1Y1VH 2UXDL 3NEMA 4DV4L 2ZJRA 4JBWA 5LMNQ 4A3CG 1HR0W 1X56A 1VQ8A 4KLKA 4LF8L 4IFDG 2JA8G 3J80i 4KHZA 4DUYQ 4B3TQ 2ZTDA 3UDXA 4YCUA 2N49A 2ZTEA 3KF8B 2DGYA 4X66Q 5IYCH 1N33Q 2QA4A 5IP7G 5C3EG 4DR6Q 3H15A 4OO1I 2I5HA 1K0RA 1QVCA 4NXNL 4IPGA 3WWVA 2EQSA 2IX0A 4DR4Q 1IBLQ 1XNRQ 4B3SQ 3W1GA 1G6PA 2A19A 3CCUA 4DV3Q 1R9TH 1IBML 1Q81C 1EQQA 3AFPA 1UE1A 1HZBA 2R93G 3CCSA 1VQ4A 1BVSA 4LF9Q 1FL0A 4XTCS 1N32L 1PV4A 4DV1Q 1U0LA 2UUCQ 4X62Q 1N36L 2JA5H 2I5LX 1C0AA 1K83H 3F8TA 3J7A5 2K52A 5GQOA 3HKZE 4IPCA 4DV5L 2UUBL 2PQAB 3HOWH 2EXDA 1HZAA 1K8AC 3L7ZC 3S1MH 3S24A 1B8AA 1KC8C 3J81j 4A3KG 1EIFA 4OX9L 3CAMA 4YCVA 3UE1A 3G6EA 2GN5A 5EAYA 2D0OA 4DV7L 4LUVA 1K3RA 2YTYA 4R4QA 3DLLA 3TRZA 2UXBQ 1YEZA 4B3ML 4BXXG 4BY1H 5H1SE 1XMQL 3HOYH 1EIYB 3TS2A 1Q86C 5C0XI 1S40A 3PO2H 4LWCA 3I4MH 2JK8A 1WOCA 3KDFB 1FJGQ 2K14A 4YY3L 2K4KA 1XMOL 4JI5L 4POGA 2K5VA 2JA7H 3PO3G 2AMCB 5DLQE 3J81i 2VS1A 2R7ZG 4UP7A 4DAMA 1WCMG 4BBSG 2WAQG 3ERSX 4GKKQ 2CFMA 4JBKA 3GO5A 1SN8A 3H0GH 4FDBA 2UUAL 5J3BA 4PG3A 1B70B 1Y1VG 1X3GA 5BR8L 1J5EL 2A8VA 3GTPH 3ULJA 3RLNA 1L2FA 1SFOH 5FJ8H 1CUKA 4JI3Q 1SMXA 3E9HA 1GVPA 1PYBA 5GAGC 3JAMi 5IYCG 4L5TA 1L1OA 2VQEQ 5JJLA 1I50H 1E3PA 2IT1A 3PUXA 4O2DA 1AE2A 1MIUA 4DUZL 4PZ6A 5C3EH 1HNXL 4DV0Q 3RN2A 4A3LG 4IPDA 4HJ5A 1A62A 4A3DH 4X65L 4YHHL 1BBWA 1VQLA 2YTXA 4EX5A 4LW1A 2HIXA 1KD1C 1AE3A 1HNWL 3ER0A 5M5XH 5FLMG 4NB3A 1GM5A 1A8VA 1OXTA 2IX1A 2DUDA 2KHJA 3NENA 4YCWA 5C4JH 4X64Q 1DGSA 4LF4L 2JA5G 3PCOB 3CCVA 4X6AH 1TWFH 1PH2A 1C9OA 1QVFA 2F4VL 4A93H 3FHWA 1TWGH 3I7FA 5IP9H 1HNZL 4OO1G 2F52A 4JYAL 3K80C 1TXYA 1E24A 3OTOL 3CCMA 4JV5Q 1E7ZA 4C3HH 1Q7YC 4LFBQ 2KCTA 2I0QA 4JG2A 4LFAQ 4NXMQ 3EBEA 4HJ7A 2NVTH 4DV4Q 2UXDQ 5GROA 2E8GA 2ZTCA 3G48A 4DPGA 4OONA 4LF8Q 4HIKA 4GNXC 3A5UA 1VQ9A 2WB1E 3S15H 3M85A 1YIJA 3PO2G 4A3BG 4BXXH 1VQGA 4A76A 3I4MG 3S2DH 1E22A 3U4VA 1VQMA 4NXNQ 2JA7G 5JEAG 1IYJB 2E5LQ 1Q1EA 3KF6B 3ICEA 3M4QA 4DR3Q 2Q2HA 1PH6A 4GS3A 2ZM6L 4HIMA 3PO3H 5ELOA 1IBMQ 1EFWA 2R7ZH 3H0GG 4GN4B 3A0JA 5LMUL 3A74A 2FXQA 2WB1G 1YZ6A 2NN6I 4PZ7A 3K8AA 2VY3A 4DR7L 5JJIA 1JJGA 2ES2A 1CSPA 4JI7L 5FJ8G 4DR1L 1PH8A 3S1RH 2B29A 1N36Q 1EQRA 2LXKA 3T1YL 3GTQH 5C0XG 1HR0L 1X9NA 3CCRA 4GKJL 1Y1WH 1YITA 4POFA 1IBKL 3CPFA 2N8NA 4OXPA 4UY8C 1V1QA 1MJEA 4OX9Q 5IYDH 1VQNA 4A3DG 1MJCA 2UXCL 3CQZH 3NBHB 1AH9A 4A3LH 4DV7Q 4A3GG 3K81C 2IHEA 1QZGA 1NTGA 2R92H 3GTMH 1PH1A 5C4XH 1KQSA 1E1TA 2B3GA 2KCMA 2Z6KA 1XMQQ 3BZKA 4A3JH 3HOXH 3GTKH 1Q82C 1KL9A 3EIVA 1L1OC 2I5MX 4DV2L 2KBNA 4JOIA 4LF6L 5FLMH 3CMAA 4QIWE 4UP9A 1K8GA 4KHPL 4YY3Q 2EIFA 5M3FH 1XMOQ 3AQQA 3RLFA 4GNXB 1PH5A 1WFQA 1N34Q 1Q46A 4JI5Q 4A93G 1H95A 5IP9G 1OXVA 4K0KL 1I3QH 4JI2L 2OTJA 3RNUA 1XPUA 1XNRL 3ULLA 4DKAC 1PH3A 1Z9FA 3BZCA 2UUAQ 2BA1A 4UP8A 3KLWA 1EYGA 3KFUA 3S14H 1A63A 5BR8Q 5IE8A 4BBRH 5IWAL 1UE5A 2KHIA 3SGIA 1JMCA 4EQ5A 1KRTA 4APVA 1HZCA 1ASZA 2CQOA 2CCZA 3ULPA 2VUMH 2WAQE 2UU9Q 4LF7L 1VQ6A 1EOVA 4LUOA 1VQCA 5LMNW 2VQFL 2HHHL 3I4NH 3CCLA 1QVGA 4RG1A 4JI4L 1N9WA 4QL5A 4AYBE 5LMNL 4DUZQ 1GO3E 4A3BH 4L5SA 2JE6I 2WP8J 1VQJA 1HJPA 2CWAA 1I94L 1IZ6A 3CPWA 4B3TL 1LUZA 1SROA 3TQYA 4X65Q 4YHHQ 1XTDA 1XPRA 1CKNA 3PUWA 1VQPA 2Z0SA 1X65A 1HNWQ 4MNOA 1WJJA 1X55A 2XTIA 3PIPA 4DR4L 4PZ8A 4AYBG 3KOJA 4B3RL 1XNQQ 2PI2E 1T9HA 3F2CA 1PYSB 4DR2L 3OW2A 2F4VQ 4OWXB 3GDEA 4JI0L 2LSSA 1Y1WG 4JYAQ 1L1OB 2NZHA 1PH9A 2OTLA 3OTOQ 2JA6H 3EN2A 3PUVA 2MNAA 1CSQA 1GKHA 3PIOA 3RZDH 2UUCL 1D7QA 1KHIA 2D0PA 3DM3A 4IJLA 1L0WA 5IT9c 2ZJPA 1W2BA 1IXRA 2ALYB 1LTLA 3M7NA 1PHJA 2R92G 1P8LA 5C4XG 3GTLH 2RHQB 2Q2UA 2Q2IA 2NN6G 4A3JG 3HOXG 4P72A 4C3IH 4A3GH 3HFZB 5IY0A 1BBUA 4DR5Q 4A3IG 4HJ8A 5AJ3Q 2RHSB 2Y0SE 5IYDG 5M5WH 1OXUA 4LFCL 4J15A 5M3FG 4LF5L 3AEVA 3GTGH 2UXBL 3LGJA 1XJVA 1QUQB 1VCIA 2H5XA 4JI8Q 3J7ZC 3I55A 3CMEA 1ASYA 1CKMA 1KIXA 3S16H 4TQUS 2JA9A 1OTCA 5LMUQ 4R4IA 4AH6A 3Q8DA 4YWKA 3E0EA 1Y14B 4A3EH 3CP0A 4BBRG 1FJGL 2Z6KC 3STBC 1W3SA 1UWVA 4JI7Q 2L15A 2Y0SG 4DR1Q 4TVAB 3RN5A 4RMFA 4GLXA 2CWPA 1PVOA 2VUMG 2ASBA 2MFIA 2VL6A 2BH8A 1TWAH 3T1YQ 1WYDA 2NZOA 5E7NA 1HR0Q 1PH7A 4KI0A 3I4NG 3I4OA 4R1JA 5GAEC 2IY5B 1IBKQ 1Q12A 2N78A 4LUZA 3U4ZA 2CKZB 2OQ0A 3G71A 1X6OA 4A3MG 4BY7G 4MZ9A 1JE5A 2JJQA 1YJ9A 1OXXK 3S1QH 2D62A 2YYZA 1VQEA 4R4OA 3PF4A 2N3SA 2ZJQA 1UEBA 3OYYA 2Q2TA 2AWOA 2LXJA 4L5QA 3M3YH 2WFWA 2MQHA 4JC0A 1VQHA 4UPAA 4GN5A 1FGUA 1NBWA 1UE7A 5HY6A 5GAHC 3F2DA 4DV2Q 4KHPQ 2YTVA 1YHBA 1N32Q 3H3VI 4A3FH 1G51A 1CKOA 3CC7A 4K0KQ 4JI2Q 2JA6G 2VW9A 1YBYA 4R4TA 4IFDJ 4DV5Q 1NJIC 2UUBQ 3HOZG 3E9IA 1BKBA 4IJHA 4X64L 1S3OA 4XIGS 3KF6A 4HJ9A 4GOPA 4IPHA 1HH2P 2PMZE 1B7YB 1YI2A 3KYHC 3UDFA 4LF7Q 4JV5L 1FVIA 2MO0A 4AQYL 4IOAA 2VNUD 2K50A 1D8LA 4B3MQ 3I2ZA 2HHHQ 2VQFQ 4LFBL 3RLOA 3W1BA 3PUYA 4JI6L 4DV6L 4JBMA 3S2HH 3A5ZB 1V9PA 4A3IH 3L2PA 1VQ5A 4A4IA 4DK3C 2ID0A 5IYBH 1VS0A 4GLAC 3H3VH 3UDGA 1VQAA 4A75A 1I94Q 1O7IA 3PV0A 2AHOB 3CF5A 1U5KA 4YWLA 4O0AA 3T1HL 2PI2A 2OCEA 4QQBX 4A3EG 3TEHB 1GD7A 2RF4A 2E5LL 2JQOA 4DR3L 1J5EQ 1YJWA 4HIOA 4B3RQ 4DAYB 2R6GA 3FKIG 3KJOA 3GD7A 4P74A 4DR2Q 1N8RC 4MTNA 4JI1L 2IHFA 4H02A 4JI0Q 4L5RC 4Y7NH 3W5OA 1G291 3U58A 2K5NA 3BJUA 2HT1A 3J80c 1HNXQ 4GNXA 1A0IA 2OQKA 1P16A 2QGQA 3B6YA 5M3MH 3M4OH 5K36G 1KAWA 3CC4A 2KENA 3HOVH 1KRSA 1NMGA 3F2BA 4DUYL 4A3MH 1M90C 4BY7H 1CKNB 2AKWB 2PQAA 1TWCH 1N33L 4X66L 4DR6L 4LNQA 4DK6C 1TWHH 1VQKA 1WI5A 3GTJH 1NMFA 4ME3A 1I6HH 4LFCQ 1SLJA 3PSIA 4QY7A 2QEXA 3PGZA 3K0XA 3CXCA 1IBLL 4A3FG 1V43A 4B3SL 4LF4Q 4LF5Q 2JEAI 4DV3L 3RZOH 5GADC 1K9MC 1KXLA 2PNHA 3HKZG 5C44H 4IFDI 1EUJA 2NVYH 4OWTB 3TS0A 1C7YA 3I56A 1HNZQ 1X3FA 2B63H 1S72A 1J6QA 1IL2A 5ELNA 3KDFA 3STBD 4LF9L 1N34L 3D31A 3HOZH 3CC2A 3KJPA 3CCEA 4DV1L 1LM0A 4X62L 3HOUH 1VQDA 1K73C 4WJ3M 3FP9A 3S17H 3HKSA 1X54A 1VQOA 3K7UC 1EWIA 4QGUA 4HJAA 3PUZA 3MEFA 1YHQA 5HGQA 2YV5A 3RR5A 2V1CC 3AYHB 2K5HA 1XPOA 5IYBG 4AIMA 1SR3A 1LYLA 4A3CH 1PFSA 2R7DA 1QZHA 2UU9L 4P73A 4GOPC 3M4PA 2BA0A 1VQ7A 2ZM6Q 2BH2A 1E1OA 2RCNA 1I5FA 4C3JH 2JA8H 1NY4A 2R7FA 4GN3B 2ATWA 2NVQH 3M9BA 3J81c 3UE0A 5IP7H 1VQIA 1YHAA 4DR7Q 1VQFA 4C2MH 1Q1BA 3VDYA 3BU2A 1OXSC 1RL2A 2HQLA 1M1KC 3U50C 4JOIC 4ALPA 1Z47A 3FKIH 4NPSA 3G4SA 4BA2I 4P75A 2F3IA 4GKKL 3UDIA 2K75A 1YVCA 4QJFA 2YU9H 4GKJQ 3CCQA 3TREA 2NVXH 2R93H 1JT8A 4GLVB 1JJCB 3PF5A 2C35B 5M3MG 2MO1A 3JAMc 2GVBA 3CW2C 3NELA 4JI3L 1XNQL 5FLXc 2UXCQ 4P71A 1Q8KA 1QUQA 1X3EA 2A1AA 2E2HH 3HOVG 3HOWG 1YNXA 3F1ZA 5JEAJ 4DNIA 2VQEL 2VZAA 4HIDA 4YWMA 4AQYQ 1UE6A 4R4CA 3ZJYC 1JB7A 1SE8A 4OWWB 1RIPA 4DV6Q 4JI6Q 3S1NH 5JJKA 3IRBA 4DV0L 4A3KH 2HIVA 4LF6Q 1JJ2A 3AFQA 3L0OA 1NE3A 2JEBI 2E2IH 5C44G 4BY1G 2XGTA 4JCVE 4DR5L 3HOYG 4Y52H 1YJNA 3K7AH 1SRUA 2B63G 3T1HQ 3GTOH 2AWNA 3D0FA 5AJ3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH4 A;  1PA6 A;  4JBJ A;  3CD6 A;  1VQB A;  5C0X J;  4PMW A;  1MKH A;  4IOC A;  4GOP B;  3HOU G;  5M5Y H;  5IWA Q;  2E2J H;  2OWO A;  3MXN B;  4JI8 L;  2GVA A;  3JC6 6;  4BA1 I;  3CCJ A;  4IO9 A;  4JI1 Q;  4WJ4 A;  4BBS H;  1WCM H;  1HZ9 A;  4LFA L;  4JI4 Q;  4NXM L;  1Y1V H;  2UXD L;  3NEM A;  4DV4 L;  2ZJR A;  4JBW A;  5LMN Q;  4A3C G;  1HR0 W;  1X56 A;  1VQ8 A;  4KLK A;  4LF8 L;  4IFD G;  2JA8 G;  3J80 i;  4KHZ A;  4DUY Q;  4B3T Q;  2ZTD A;  3UDX A;  4YCU A;  2N49 A;  2ZTE A;  3KF8 B;  2DGY A;  4X66 Q;  5IYC H;  1N33 Q;  2QA4 A;  5IP7 G;  5C3E G;  4DR6 Q;  3H15 A;  4OO1 I;  2I5H A;  1K0R A;  1QVC A;  4NXN L;  4IPG A;  3WWV A;  2EQS A;  2IX0 A;  4DR4 Q;  1IBL Q;  1XNR Q;  4B3S Q;  3W1G A;  1G6P A;  2A19 A;  3CCU A;  4DV3 Q;  1R9T H;  1IBM L;  1Q81 C;  1EQQ A;  3AFP A;  1UE1 A;  1HZB A;  2R93 G;  3CCS A;  1VQ4 A;  1BVS A;  4LF9 Q;  1FL0 A;  4XTC S;  1N32 L;  1PV4 A;  4DV1 Q;  1U0L A;  2UUC Q;  4X62 Q;  1N36 L;  2JA5 H;  2I5L X;  1C0A A;  1K83 H;  3F8T A;  3J7A 5;  2K52 A;  5GQO A;  3HKZ E;  4IPC A;  4DV5 L;  2UUB L;  2PQA B;  3HOW H;  2EXD A;  1HZA A;  1K8A C;  3L7Z C;  3S1M H;  3S24 A;  1B8A A;  1KC8 C;  3J81 j;  4A3K G;  1EIF A;  4OX9 L;  3CAM A;  4YCV A;  3UE1 A;  3G6E A;  2GN5 A;  5EAY A;  2D0O A;  4DV7 L;  4LUV A;  1K3R A;  2YTY A;  4R4Q A;  3DLL A;  3TRZ A;  2UXB Q;  1YEZ A;  4B3M L;  4BXX G;  4BY1 H;  5H1S E;  1XMQ L;  3HOY H;  1EIY B;  3TS2 A;  1Q86 C;  5C0X I;  1S40 A;  3PO2 H;  4LWC A;  3I4M H;  2JK8 A;  1WOC A;  3KDF B;  1FJG Q;  2K14 A;  4YY3 L;  2K4K A;  1XMO L;  4JI5 L;  4POG A;  2K5V A;  2JA7 H;  3PO3 G;  2AMC B;  5DLQ E;  3J81 i;  2VS1 A;  2R7Z G;  4UP7 A;  4DAM A;  1WCM G;  4BBS G;  2WAQ G;  3ERS X;  4GKK Q;  2CFM A;  4JBK A;  3GO5 A;  1SN8 A;  3H0G H;  4FDB A;  2UUA L;  5J3B A;  4PG3 A;  1B70 B;  1Y1V G;  1X3G A;  5BR8 L;  1J5E L;  2A8V A;  3GTP H;  3ULJ A;  3RLN A;  1L2F A;  1SFO H;  5FJ8 H;  1CUK A;  4JI3 Q;  1SMX A;  3E9H A;  1GVP A;  1PYB A;  5GAG C;  3JAM i;  5IYC G;  4L5T A;  1L1O A;  2VQE Q;  5JJL A;  1I50 H;  1E3P A;  2IT1 A;  3PUX A;  4O2D A;  1AE2 A;  1MIU A;  4DUZ L;  4PZ6 A;  5C3E H;  1HNX L;  4DV0 Q;  3RN2 A;  4A3L G;  4IPD A;  4HJ5 A;  1A62 A;  4A3D H;  4X65 L;  4YHH L;  1BBW A;  1VQL A;  2YTX A;  4EX5 A;  4LW1 A;  2HIX A;  1KD1 C;  1AE3 A;  1HNW L;  3ER0 A;  5M5X H;  5FLM G;  4NB3 A;  1GM5 A;  1A8V A;  1OXT A;  2IX1 A;  2DUD A;  2KHJ A;  3NEN A;  4YCW A;  5C4J H;  4X64 Q;  1DGS A;  4LF4 L;  2JA5 G;  3PCO B;  3CCV A;  4X6A H;  1TWF H;  1PH2 A;  1C9O A;  1QVF A;  2F4V L;  4A93 H;  3FHW A;  1TWG H;  3I7F A;  5IP9 H;  1HNZ L;  4OO1 G;  2F52 A;  4JYA L;  3K80 C;  1TXY A;  1E24 A;  3OTO L;  3CCM A;  4JV5 Q;  1E7Z A;  4C3H H;  1Q7Y C;  4LFB Q;  2KCT A;  2I0Q A;  4JG2 A;  4LFA Q;  4NXM Q;  3EBE A;  4HJ7 A;  2NVT H;  4DV4 Q;  2UXD Q;  5GRO A;  2E8G A;  2ZTC A;  3G48 A;  4DPG A;  4OON A;  4LF8 Q;  4HIK A;  4GNX C;  3A5U A;  1VQ9 A;  2WB1 E;  3S15 H;  3M85 A;  1YIJ A;  3PO2 G;  4A3B G;  4BXX H;  1VQG A;  4A76 A;  3I4M G;  3S2D H;  1E22 A;  3U4V A;  1VQM A;  4NXN Q;  2JA7 G;  5JEA G;  1IYJ B;  2E5L Q;  1Q1E A;  3KF6 B;  3ICE A;  3M4Q A;  4DR3 Q;  2Q2H A;  1PH6 A;  4GS3 A;  2ZM6 L;  4HIM A;  3PO3 H;  5ELO A;  1IBM Q;  1EFW A;  2R7Z H;  3H0G G;  4GN4 B;  3A0J A;  5LMU L;  3A74 A;  2FXQ A;  2WB1 G;  1YZ6 A;  2NN6 I;  4PZ7 A;  3K8A A;  2VY3 A;  4DR7 L;  5JJI A;  1JJG A;  2ES2 A;  1CSP A;  4JI7 L;  5FJ8 G;  4DR1 L;  1PH8 A;  3S1R H;  2B29 A;  1N36 Q;  1EQR A;  2LXK A;  3T1Y L;  3GTQ H;  5C0X G;  1HR0 L;  1X9N A;  3CCR A;  4GKJ L;  1Y1W H;  1YIT A;  4POF A;  1IBK L;  3CPF A;  2N8N A;  4OXP A;  4UY8 C;  1V1Q A;  1MJE A;  4OX9 Q;  5IYD H;  1VQN A;  4A3D G;  1MJC A;  2UXC L;  3CQZ H;  3NBH B;  1AH9 A;  4A3L H;  4DV7 Q;  4A3G G;  3K81 C;  2IHE A;  1QZG A;  1NTG A;  2R92 H;  3GTM H;  1PH1 A;  5C4X H;  1KQS A;  1E1T A;  2B3G A;  2KCM A;  2Z6K A;  1XMQ Q;  3BZK A;  4A3J H;  3HOX H;  3GTK H;  1Q82 C;  1KL9 A;  3EIV A;  1L1O C;  2I5M X;  4DV2 L;  2KBN A;  4JOI A;  4LF6 L;  5FLM H;  3CMA A;  4QIW E;  4UP9 A;  1K8G A;  4KHP L;  4YY3 Q;  2EIF A;  5M3F H;  1XMO Q;  3AQQ A;  3RLF A;  4GNX B;  1PH5 A;  1WFQ A;  1N34 Q;  1Q46 A;  4JI5 Q;  4A93 G;  1H95 A;  5IP9 G;  1OXV A;  4K0K L;  1I3Q H;  4JI2 L;  2OTJ A;  3RNU A;  1XPU A;  1XNR L;  3ULL A;  4DKA C;  1PH3 A;  1Z9F A;  3BZC A;  2UUA Q;  2BA1 A;  4UP8 A;  3KLW A;  1EYG A;  3KFU A;  3S14 H;  1A63 A;  5BR8 Q;  5IE8 A;  4BBR H;  5IWA L;  1UE5 A;  2KHI A;  3SGI A;  1JMC A;  4EQ5 A;  1KRT A;  4APV A;  1HZC A;  1ASZ A;  2CQO A;  2CCZ A;  3ULP A;  2VUM H;  2WAQ E;  2UU9 Q;  4LF7 L;  1VQ6 A;  1EOV A;  4LUO A;  1VQC A;  5LMN W;  2VQF L;  2HHH L;  3I4N H;  3CCL A;  1QVG A;  4RG1 A;  4JI4 L;  1N9W A;  4QL5 A;  4AYB E;  5LMN L;  4DUZ Q;  1GO3 E;  4A3B H;  4L5S A;  2JE6 I;  2WP8 J;  1VQJ A;  1HJP A;  2CWA A;  1I94 L;  1IZ6 A;  3CPW A;  4B3T L;  1LUZ A;  1SRO A;  3TQY A;  4X65 Q;  4YHH Q;  1XTD A;  1XPR A;  1CKN A;  3PUW A;  1VQP A;  2Z0S A;  1X65 A;  1HNW Q;  4MNO A;  1WJJ A;  1X55 A;  2XTI A;  3PIP A;  4DR4 L;  4PZ8 A;  4AYB G;  3KOJ A;  4B3R L;  1XNQ Q;  2PI2 E;  1T9H A;  3F2C A;  1PYS B;  4DR2 L;  3OW2 A;  2F4V Q;  4OWX B;  3GDE A;  4JI0 L;  2LSS A;  1Y1W G;  4JYA Q;  1L1O B;  2NZH A;  1PH9 A;  2OTL A;  3OTO Q;  2JA6 H;  3EN2 A;  3PUV A;  2MNA A;  1CSQ A;  1GKH A;  3PIO A;  3RZD H;  2UUC L;  1D7Q A;  1KHI A;  2D0P A;  3DM3 A;  4IJL A;  1L0W A;  5IT9 c;  2ZJP A;  1W2B A;  1IXR A;  2ALY B;  1LTL A;  3M7N A;  1PHJ A;  2R92 G;  1P8L A;  5C4X G;  3GTL H;  2RHQ B;  2Q2U A;  2Q2I A;  2NN6 G;  4A3J G;  3HOX G;  4P72 A;  4C3I H;  4A3G H;  3HFZ B;  5IY0 A;  1BBU A;  4DR5 Q;  4A3I G;  4HJ8 A;  5AJ3 Q;  2RHS B;  2Y0S E;  5IYD G;  5M5W H;  1OXU A;  4LFC L;  4J15 A;  5M3F G;  4LF5 L;  3AEV A;  3GTG H;  2UXB L;  3LGJ A;  1XJV A;  1QUQ B;  1VCI A;  2H5X A;  4JI8 Q;  3J7Z C;  3I55 A;  3CME A;  1ASY A;  1CKM A;  1KIX A;  3S16 H;  4TQU S;  2JA9 A;  1OTC A;  5LMU Q;  4R4I A;  4AH6 A;  3Q8D A;  4YWK A;  3E0E A;  1Y14 B;  4A3E H;  3CP0 A;  4BBR G;  1FJG L;  2Z6K C;  3STB C;  1W3S A;  1UWV A;  4JI7 Q;  2L15 A;  2Y0S G;  4DR1 Q;  4TVA B;  3RN5 A;  4RMF A;  4GLX A;  2CWP A;  1PVO A;  2VUM G;  2ASB A;  2MFI A;  2VL6 A;  2BH8 A;  1TWA H;  3T1Y Q;  1WYD A;  2NZO A;  5E7N A;  1HR0 Q;  1PH7 A;  4KI0 A;  3I4N G;  3I4O A;  4R1J A;  5GAE C;  2IY5 B;  1IBK Q;  1Q12 A;  2N78 A;  4LUZ A;  3U4Z A;  2CKZ B;  2OQ0 A;  3G71 A;  1X6O A;  4A3M G;  4BY7 G;  4MZ9 A;  1JE5 A;  2JJQ A;  1YJ9 A;  1OXX K;  3S1Q H;  2D62 A;  2YYZ A;  1VQE A;  4R4O A;  3PF4 A;  2N3S A;  2ZJQ A;  1UEB A;  3OYY A;  2Q2T A;  2AWO A;  2LXJ A;  4L5Q A;  3M3Y H;  2WFW A;  2MQH A;  4JC0 A;  1VQH A;  4UPA A;  4GN5 A;  1FGU A;  1NBW A;  1UE7 A;  5HY6 A;  5GAH C;  3F2D A;  4DV2 Q;  4KHP Q;  2YTV A;  1YHB A;  1N32 Q;  3H3V I;  4A3F H;  1G51 A;  1CKO A;  3CC7 A;  4K0K Q;  4JI2 Q;  2JA6 G;  2VW9 A;  1YBY A;  4R4T A;  4IFD J;  4DV5 Q;  1NJI C;  2UUB Q;  3HOZ G;  3E9I A;  1BKB A;  4IJH A;  4X64 L;  1S3O A;  4XIG S;  3KF6 A;  4HJ9 A;  4GOP A;  4IPH A;  1HH2 P;  2PMZ E;  1B7Y B;  1YI2 A;  3KYH C;  3UDF A;  4LF7 Q;  4JV5 L;  1FVI A;  2MO0 A;  4AQY L;  4IOA A;  2VNU D;  2K50 A;  1D8L A;  4B3M Q;  3I2Z A;  2HHH Q;  2VQF Q;  4LFB L;  3RLO A;  3W1B A;  3PUY A;  4JI6 L;  4DV6 L;  4JBM A;  3S2H H;  3A5Z B;  1V9P A;  4A3I H;  3L2P A;  1VQ5 A;  4A4I A;  4DK3 C;  2ID0 A;  5IYB H;  1VS0 A;  4GLA C;  3H3V H;  3UDG A;  1VQA A;  4A75 A;  1I94 Q;  1O7I A;  3PV0 A;  2AHO B;  3CF5 A;  1U5K A;  4YWL A;  4O0A A;  3T1H L;  2PI2 A;  2OCE A;  4QQB X;  4A3E G;  3TEH B;  1GD7 A;  2RF4 A;  2E5L L;  2JQO A;  4DR3 L;  1J5E Q;  1YJW A;  4HIO A;  4B3R Q;  4DAY B;  2R6G A;  3FKI G;  3KJO A;  3GD7 A;  4P74 A;  4DR2 Q;  1N8R C;  4MTN A;  4JI1 L;  2IHF A;  4H02 A;  4JI0 Q;  4L5R C;  4Y7N H;  3W5O A;  1G29 1;  3U58 A;  2K5N A;  3BJU A;  2HT1 A;  3J80 c;  1HNX Q;  4GNX A;  1A0I A;  2OQK A;  1P16 A;  2QGQ A;  3B6Y A;  5M3M H;  3M4O H;  5K36 G;  1KAW A;  3CC4 A;  2KEN A;  3HOV H;  1KRS A;  1NMG A;  3F2B A;  4DUY L;  4A3M H;  1M90 C;  4BY7 H;  1CKN B;  2AKW B;  2PQA A;  1TWC H;  1N33 L;  4X66 L;  4DR6 L;  4LNQ A;  4DK6 C;  1TWH H;  1VQK A;  1WI5 A;  3GTJ H;  1NMF A;  4ME3 A;  1I6H H;  4LFC Q;  1SLJ A;  3PSI A;  4QY7 A;  2QEX A;  3PGZ A;  3K0X A;  3CXC A;  1IBL L;  4A3F G;  1V43 A;  4B3S L;  4LF4 Q;  4LF5 Q;  2JEA I;  4DV3 L;  3RZO H;  5GAD C;  1K9M C;  1KXL A;  2PNH A;  3HKZ G;  5C44 H;  4IFD I;  1EUJ A;  2NVY H;  4OWT B;  3TS0 A;  1C7Y A;  3I56 A;  1HNZ Q;  1X3F A;  2B63 H;  1S72 A;  1J6Q A;  1IL2 A;  5ELN A;  3KDF A;  3STB D;  4LF9 L;  1N34 L;  3D31 A;  3HOZ H;  3CC2 A;  3KJP A;  3CCE A;  4DV1 L;  1LM0 A;  4X62 L;  3HOU H;  1VQD A;  1K73 C;  4WJ3 M;  3FP9 A;  3S17 H;  3HKS A;  1X54 A;  1VQO A;  3K7U C;  1EWI A;  4QGU A;  4HJA A;  3PUZ A;  3MEF A;  1YHQ A;  5HGQ A;  2YV5 A;  3RR5 A;  2V1C C;  3AYH B;  2K5H A;  1XPO A;  5IYB G;  4AIM A;  1SR3 A;  1LYL A;  4A3C H;  1PFS A;  2R7D A;  1QZH A;  2UU9 L;  4P73 A;  4GOP C;  3M4P A;  2BA0 A;  1VQ7 A;  2ZM6 Q;  2BH2 A;  1E1O A;  2RCN A;  1I5F A;  4C3J H;  2JA8 H;  1NY4 A;  2R7F A;  4GN3 B;  2ATW A;  2NVQ H;  3M9B A;  3J81 c;  3UE0 A;  5IP7 H;  1VQI A;  1YHA A;  4DR7 Q;  1VQF A;  4C2M H;  1Q1B A;  3VDY A;  3BU2 A;  1OXS C;  1RL2 A;  2HQL A;  1M1K C;  3U50 C;  4JOI C;  4ALP A;  1Z47 A;  3FKI H;  4NPS A;  3G4S A;  4BA2 I;  4P75 A;  2F3I A;  4GKK L;  3UDI A;  2K75 A;  1YVC A;  4QJF A;  2YU9 H;  4GKJ Q;  3CCQ A;  3TRE A;  2NVX H;  2R93 H;  1JT8 A;  4GLV B;  1JJC B;  3PF5 A;  2C35 B;  5M3M G;  2MO1 A;  3JAM c;  2GVB A;  3CW2 C;  3NEL A;  4JI3 L;  1XNQ L;  5FLX c;  2UXC Q;  4P71 A;  1Q8K A;  1QUQ A;  1X3E A;  2A1A A;  2E2H H;  3HOV G;  3HOW G;  1YNX A;  3F1Z A;  5JEA J;  4DNI A;  2VQE L;  2VZA A;  4HID A;  4YWM A;  4AQY Q;  1UE6 A;  4R4C A;  3ZJY C;  1JB7 A;  1SE8 A;  4OWW B;  1RIP A;  4DV6 Q;  4JI6 Q;  3S1N H;  5JJK A;  3IRB A;  4DV0 L;  4A3K H;  2HIV A;  4LF6 Q;  1JJ2 A;  3AFQ A;  3L0O A;  1NE3 A;  2JEB I;  2E2I H;  5C44 G;  4BY1 G;  2XGT A;  4JCV E;  4DR5 L;  3HOY G;  4Y52 H;  1YJN A;  3K7A H;  1SRU A;  2B63 G;  3T1H Q;  3GTO H;  2AWN A;  3D0F A;  5AJ3 L; 
#chains in the Genus database with same CATH topology
 1LTR D;  4QMG A;  4IOC A;  3S1R B;  3O13 A;  4AYB B;  5M5Y H;  4H44 C;  4BWG B;  3WOE A;  3MXN B;  2A5H A;  4N9P A;  2F03 A;  2GVA A;  3Q22 A;  4RKB A;  4BBS H;  1WCM H;  3HS0 C;  2PZU A;  2CW0 D;  1JE4 A;  2JP1 A;  4NXM L;  4DV4 L;  3CQZ B;  4LF8 L;  3QB3 A;  2OXP A;  4KY6 A;  3M4O H;  3GTK B;  1LTI D;  1SE4 A;  4OO1 I;  3H15 A;  2I5H A;  1MHW C;  1QVC A;  4NXN L;  5IOD A;  1XNR Q;  3W1G A;  1G6P A;  1R9T H;  1EQQ A;  3AFP A;  1AZP A;  1XWE A;  1HZB A;  3URY A;  1VQ4 A;  4TRD A;  2EDG A;  4LF9 Q;  4BBR B;  1SYC A;  4DN4 M;  1U0L A;  4X62 Q;  5EBC A;  1C0A A;  2CVR A;  5E4X A;  1A2U A;  1K83 H;  5GQO A;  1NR4 A;  2DY7 A;  2IPK D;  1XX8 A;  2PNR C;  5DNF A;  3UE1 A;  4IAL A;  1D5Z C;  2O2L D;  2CH4 W;  1GHK A;  2UXB Q;  5H1S E;  1EIY B;  3A8K E;  4UAI A;  3EQL C;  1SNQ A;  3I4M H;  3T51 B;  4YY3 L;  1XMO L;  4POG A;  3PO3 G;  5DAU A;  5K5P A;  4DU9 A;  2EVB A;  4UP7 A;  5CC4 A;  2X6L A;  2CFM A;  3I4L A;  3GO5 A;  1TKW B;  1Y1V G;  1X3G A;  5BR8 L;  3PIO 3;  1J5E L;  1TU2 B;  3GTP H;  4XYQ A;  1SFO H;  1CUK A;  3EJI A;  3E9H A;  2A6E D;  2PW7 A;  5A35 A;  1L1O A;  2VQE Q;  1B50 A;  4RAU C;  3PUX A;  4O2D A;  1SAP A;  1A6X A;  4V19 0;  4DK0 A;  2PZW A;  4HJ5 A;  3LWU A;  1WD0 A;  1A62 A;  1KDA A;  1BBW A;  2QEJ C;  1VQL A;  2PMZ B;  3MA2 B;  1PFB A;  1CZW A;  1JWS D;  4I7A A;  1C4Q A;  1AE3 A;  3VA5 A;  1HNW L;  3BDO A;  5LL6 X;  1F77 A;  5FLM G;  4NB3 A;  3FPU B;  4A3E B;  1A8V A;  4YCW A;  1WTR A;  1DGS A;  2A73 B;  3PCO B;  1C9O A;  4A93 H;  5CV4 A;  1HNZ L;  4OO1 G;  4JYA L;  1E7Z A;  3NWT A;  2KCT A;  1SDF A;  4LFA Q;  3QIA A;  3FVQ A;  2ZTC A;  3G48 A;  2WV6 D;  4HIK A;  3KLS X;  3A5U A;  3FEW X;  3S15 H;  1LLR D;  3S2D H;  3SVM A;  1VQM A;  3R8B A;  2EJF C;  5JAV A;  2JA7 G;  2B2Y A;  1Q1E A;  4YIJ A;  3M4Q A;  4JK1 C;  2ZM6 L;  3GTO B;  4HIM A;  3PO3 H;  1O7L A;  4K6L A;  3D3R A;  1SE2 A;  2DJF C;  3H0G G;  2GA4 B;  2WB1 G;  3A74 A;  1YZ6 A;  4PZ7 A;  4DR7 L;  1CSP A;  4JI7 L;  1WTP A;  5M5Y B;  2XVS A;  4DR1 L;  1S5E D;  1K8M A;  1GXD C;  4CBV A;  5LHY 1;  2V4D A;  1I4G A;  1MSH A;  1HR0 L;  3DWA A;  4ZK9 B;  4ABN A;  4IN3 A;  1IBK L;  3S2H B;  1KNA A;  3MC0 B;  4OX9 Q;  1VQN A;  4A3D G;  3D4D A;  3MXN A;  5JPN C;  5D65 A;  4ILW A;  1KQS A;  4FVM A;  2Z6K A;  2QF7 A;  3CRL C;  4L63 B;  3OWE B;  1KLU D;  3VR6 A;  5FLM H;  3CMA A;  1K8G A;  4UP9 A;  1N34 Q;  4CHT B;  4F88 A;  1R9T B;  2ZXR A;  1Q46 A;  2A68 C;  1XYI A;  1C48 A;  1I3Q H;  2OTJ A;  3RNU A;  2HDM A;  1XPU A;  3ULL A;  4DKA C;  1Z9F A;  4Y7N B;  1KLG D;  4UP8 A;  1CK1 A;  5DEH A;  4DXG A;  1UE5 A;  4O42 A;  3U9O A;  3MFG A;  1AZQ A;  1X3P A;  1GOZ A;  2CCZ A;  2F0F A;  5DM7 3;  2VUM H;  2UU9 Q;  1EOV A;  2VQF L;  3I4N H;  3CCL A;  4RG1 A;  1N9W A;  4QL5 A;  1ROD A;  4AYB E;  4DUZ Q;  1I6H B;  5CR3 A;  2JE6 I;  1CZG A;  3MAQ A;  1I94 L;  3CPW A;  2C9O A;  4YHH Q;  1XTD A;  3DUZ A;  3U9S A;  1EIH A;  2L55 A;  4FXK C;  2IWH A;  3HG9 A;  4KKT A;  2EY6 A;  1YNN D;  1SJE D;  2G9D A;  1XNQ Q;  3F2C A;  3S17 B;  4OWX B;  5F2D A;  1Y1W G;  3OTO Q;  3EN2 A;  2MNA A;  3GTP B;  3PIO A;  1SFO B;  3J80 E;  4HCS A;  1L0W A;  4H13 C;  1QIL A;  2ALY B;  1LTL A;  5IGC A;  1P8L A;  2RHQ B;  4RA8 A;  3HOX G;  1B9N A;  1BBU A;  4A3I G;  2OF1 A;  2ZXO A;  3TZU A;  4PNY A;  3K57 A;  1SNM A;  5EQ0 A;  1LT5 D;  2RA4 A;  1FNV A;  3LGJ A;  2UXB L;  1XJV A;  4JI8 Q;  1ASY A;  1SBB B;  4OEL B;  2KHS A;  4K8J A;  2JA9 A;  3AMU A;  1Y14 B;  3STB C;  1W3S A;  3V05 A;  2Y0S G;  4RMF A;  4B9X A;  3E5S A;  4ZRZ A;  2QIL A;  5ELF A;  2VL6 A;  1WYD A;  5CV5 A;  1Y69 U;  1BCP D;  2NZO A;  4DAP A;  4KI0 A;  1Q90 A;  4R1J A;  5GAE C;  2IY5 B;  4LUZ A;  4EQP A;  3MHB A;  1E0B A;  4QIW B;  4JW0 A;  2I46 A;  4MZ9 A;  1JE5 A;  4QF4 A;  1FD7 D;  3LNN A;  1YJ9 A;  5K36 H;  2D62 A;  3KLR A;  1PRT C;  3SK4 A;  2EYM A;  3OYY A;  3DMU A;  2MQH A;  4JC0 A;  1VQH A;  4JPB W;  4X3K A;  1H9S B;  1R4P B;  4DV2 Q;  3VYR A;  1NBW A;  3J7A V;  5JJZ A;  2EY1 A;  2E2J B;  2YTV A;  3PO3 B;  2D5D A;  3CU7 A;  2X69 A;  3CC7 A;  2JA6 G;  2PQE A;  5COY A;  1YBY A;  4R4T A;  1NJI C;  3E9I A;  3PMF A;  4IJH A;  1S3O A;  1Y1V B;  4HJ9 A;  4GOP A;  2RCF A;  1JQY D;  2PMZ E;  4HMJ A;  1YI2 A;  3KYH C;  3C46 A;  3KBX A;  4MTK A;  4RHS A;  4AQY L;  4IOA A;  2VNU D;  4ZUI A;  3RLO A;  2L12 A;  4JI6 L;  1EU3 A;  3VA7 A;  4A3I H;  3L2P A;  3WOF A;  4X3T A;  3UDG A;  1Z7T A;  2AHO B;  4FNF A;  3T1H L;  2PI2 A;  3C1F A;  4K2K A;  2OCE A;  1LAB A;  3TEH B;  1K0S A;  1X3Q A;  2N88 A;  2ICI A;  3I70 A;  4KV6 A;  3BDL A;  2RSO A;  1LAC A;  4KMU C;  4P74 A;  1PRT B;  4DR2 Q;  4JI1 L;  4JI0 Q;  4L5R C;  3QOL A;  3S1M B;  1G29 1;  1HNX Q;  1I4X A;  2SNM A;  1P16 A;  1NR2 A;  3HOV H;  1VMP A;  1CKN B;  5KNB A;  1N33 L;  4LNQ A;  1TWH H;  3QWN A;  3GTJ H;  1NMF A;  4ME3 A;  1SLJ A;  2JA7 B;  3PGZ A;  4B3S L;  1PMR A;  3NE5 B;  2PNH A;  4OWT B;  3HZX A;  3VYT A;  1C7Y A;  1QOH A;  3H0G B;  2WB1 B;  2F0M A;  1IL2 A;  1N34 L;  3D31 A;  3KJP A;  4KN4 C;  2EZV A;  2Z1C A;  1K8O A;  1E2W A;  5I6Y A;  4G7H C;  1MBY A;  5IGE A;  1VQO A;  3TP8 A;  5I9O A;  4QGU A;  3PUZ A;  1I50 B;  2YV5 A;  2O4X A;  2V1C C;  1XPO A;  2RDH A;  2QDL A;  4A3C H;  4A3D B;  3K5N A;  4XT1 B;  4CDC C;  1QZH A;  2UU9 L;  4P73 A;  1JWM D;  1CQF A;  1E1O A;  2JA8 H;  1I5F A;  3X3M A;  2K05 A;  1IKL A;  2R7F A;  4GN3 B;  3BYY B;  1WVL A;  5M5X B;  3M9B A;  3QOJ A;  5J39 A;  1VQI A;  1VQF A;  3VDY A;  3BU2 A;  2F0H A;  1WTX A;  1RL2 A;  2HQL A;  4BA2 I;  1NUC A;  3UDI A;  5G3L F;  2NUC A;  2YU9 H;  4GKJ Q;  2R93 H;  1IW7 D;  3SEB A;  2NVT B;  3H91 A;  1SNO A;  1IYU A;  3Q24 A;  1XNQ L;  5FLX c;  1F2L A;  3R2I A;  2MGS A;  1UE6 A;  3BG3 A;  4R4C A;  1TT2 A;  1ET6 A;  1JB7 A;  4KK7 A;  2BOS A;  4LJZ C;  4DV0 L;  5JJK A;  2D2C C;  4LF6 Q;  2F0J A;  2E2I H;  3HOY G;  1XTC D;  1AN8 A;  1VF7 A;  3K7A H;  2B63 G;  2A6H C;  2AWN A;  3IFD A;  3TBI B;  1F2Z A;  2Z6B A;  1VQB A;  3J80 L;  1LTS D;  1SMY D;  5IWA Q;  1ZYR C;  1ET9 A;  4JI8 L;  1SYF A;  1TS2 A;  3JC6 6;  3D4W A;  4BA1 I;  1Y1W B;  2K01 A;  5IGG A;  4JI4 Q;  2UXD L;  5LMN Q;  1HR0 W;  4RCN A;  1X56 A;  3I3C A;  1TY2 A;  1BOS A;  4KHZ A;  4DUY Q;  2NWG A;  3H6M A;  1WTO A;  3NK9 A;  4DNR B;  2N49 A;  4X66 Q;  1H9J A;  4XQQ A;  5NUC A;  3HOX B;  2Q8R E;  4DFA A;  1K0R A;  4IPG A;  2F1M A;  3WWV A;  4HSV A;  1IBL Q;  1GUS A;  2AQ1 B;  3CCU A;  3IFT A;  2SOB A;  1LTG D;  3S14 B;  2R61 A;  2LKV A;  1FL0 A;  4L8J A;  4DV1 Q;  2Y0S B;  1UEA B;  4H0L C;  2JA5 H;  2I5L X;  2XN9 C;  5KGU A;  1PZK D;  2K52 A;  5EKL A;  2PQA B;  5LL6 S;  2EXD A;  1K8A C;  2RKS A;  1WTW A;  3L7Z C;  4FP5 D;  1E2V A;  1Y8P B;  1KC8 C;  3CAM A;  2F3W A;  5EAY A;  2D0O A;  4DV7 L;  1K3R A;  2YTY A;  4R4Q A;  3TRZ A;  1YEZ A;  1XMQ L;  3HOY H;  1J9O A;  1Q86 C;  5I6W A;  2JK8 A;  3KDF B;  4F8M A;  4JI5 L;  5JEA H;  2AMC B;  5DLQ E;  2R7Z G;  2JN4 A;  4BBS G;  1WCM G;  1LT6 D;  2JA6 B;  4GKK Q;  3OIP A;  4JBK A;  4FDB A;  2VB3 X;  3Q6S A;  4PG3 A;  5IGB A;  2A8V A;  3CKI B;  3RLN A;  1L2F A;  5FJ8 H;  4JI3 Q;  1SMX A;  1GVP A;  1PYB A;  5GAG C;  3DWP A;  4HMI A;  5JJL A;  5C0X H;  1S5B D;  2ZT9 C;  1E3P A;  2IT1 A;  4ZKC B;  5KND A;  1HHV A;  1HNX L;  1MIU A;  4FF2 A;  4PZ6 A;  1JR0 D;  4IPD A;  2QKI C;  4QB4 A;  1JOR A;  4X65 L;  3H09 A;  4EX5 A;  2F0E A;  2HIX A;  3E0J A;  4LW1 A;  1KD1 C;  1JIC A;  2F0U A;  5FO9 B;  1GM5 A;  1KDC A;  1OXT A;  1H9M A;  2F0P A;  1I4P A;  1GUW A;  4X64 Q;  2F4I A;  3CCV A;  2KA7 A;  3I8Z A;  1TVX A;  4FXG C;  2LY7 A;  3FHW A;  5ELE A;  5IP9 H;  4C1N I;  3K80 C;  2IJ0 A;  4C3H H;  1Q7Y C;  4LFB Q;  1W6J A;  1EFI D;  4JG2 A;  3V96 A;  3EBE A;  4HJ7 A;  2E8G A;  1D1I A;  4DNT B;  1E2Z A;  3S1Q B;  1HXY D;  2B2U C;  4OON A;  4GNX C;  1WTQ A;  1VQ9 A;  2WB1 E;  1A3U A;  1PTO F;  2LS0 1;  1YIJ A;  4A3B G;  1VQG A;  3I4M G;  3M3Y B;  1E22 A;  3U4V A;  1IYJ B;  3ICE A;  3A8J E;  2O5I C;  4GS3 A;  1IBM Q;  2R7Z H;  5LMU L;  5JOB A;  3W3A A;  4CKB A;  2VY3 A;  1IYV A;  2J0T D;  3DM1 A;  1PH8 A;  2A68 D;  2NTS A;  4MHE A;  1N36 Q;  2LXK A;  2J7Z A;  4GKJ L;  3NQT A;  2N8N A;  2VB2 X;  3MFY A;  4RGO S;  1V1Q A;  1MJC A;  3NBH B;  5E3F A;  3TP7 A;  4R8N A;  4C3I G;  2IHE A;  1NTG A;  2R92 H;  5C4X H;  3N52 A;  1E1T A;  1KDB A;  4K14 A;  2NN6 H;  3BZK A;  5EPL A;  2I07 B;  4A3J H;  1KL9 A;  2I5M X;  3NTI A;  4LF6 L;  1V1O A;  2QCP X;  5IYD H;  5M3F H;  3I72 A;  1PH5 A;  3RLF A;  3FPP A;  4GNX B;  4A93 G;  1H95 A;  3OOC A;  2M9V A;  3LWE A;  4K0K L;  4QCL A;  4K6D A;  5EPJ A;  3BZC A;  2UUA Q;  3KFU A;  1STA A;  4OGQ C;  5IWA L;  1JMC A;  2B39 A;  2KHI A;  4EQ5 A;  4DAY A;  5KYI A;  1HTP A;  1ASZ A;  1HZC A;  2WAQ E;  4LF7 L;  2KEE A;  1VQ6 A;  1TWC B;  4R8I A;  1VQC A;  4WFN 3;  4JI4 L;  3FMC A;  2XRQ D;  5LMN L;  4A3B H;  2WP8 J;  2CWA A;  4WRD A;  1LUZ A;  1SRO A;  2Z8L A;  3HOY B;  1PTO C;  2B63 B;  1FNW A;  2NYZ D;  2Z0S A;  1SJH D;  1X65 A;  3OMC A;  4B3R L;  1G6Z A;  1T9H A;  1PYS B;  2F4V Q;  1BXT A;  2NZH A;  3FRP B;  1PH9 A;  3PUV A;  1ONL A;  3RZD H;  1ZKO A;  2NZ1 D;  4HTH A;  3BVM A;  3DM3 A;  4IJL A;  3UI2 A;  2ZJP A;  4BS9 A;  1D5X C;  1QCB D;  4TSS A;  2K28 A;  2Q2I A;  4C3I H;  5IY0 A;  2SNS A;  4FF4 A;  2Q8I B;  2RHS B;  5D3D A;  2Y0S E;  4C2M B;  5M5W H;  2MPM A;  2MHV A;  5ELD A;  3GTG H;  1LTT D;  3NPP A;  1DXM A;  2B2V C;  2H5X A;  1T5E A;  1CKM A;  3EFX D;  1KIX A;  5ELB A;  4AH6 A;  2DN8 A;  5FO7 B;  4YWK A;  2NVX B;  2FFK B;  5C5M A;  1V1P A;  2B2W C;  2MUY A;  1PTO B;  1PVO A;  2E2H B;  5CV7 A;  2VUM G;  2ASB A;  3T1Y Q;  4RCO A;  1TWA H;  1GUO A;  1F2M A;  3I4N G;  3I4O A;  1Q12 A;  3S1N B;  2AUK A;  1U4L A;  2WKD A;  5CV6 A;  4A3M G;  4F7X A;  2JJQ A;  2H1E A;  1OXX K;  1PFN A;  2MJ8 A;  2YYZ A;  3HKZ B;  1BUV T;  3T53 B;  2ZJQ A;  1ILP A;  2Q2T A;  1IKM A;  3T13 A;  2WFW A;  5C6A A;  4LK1 C;  4UPA A;  4KHP Q;  4IUN A;  3NUC A;  1ENC A;  3M7G A;  4ZCK A;  4A3F H;  2EYH A;  5E1F A;  2R7Z B;  4BBS B;  1WCM B;  4JI2 Q;  3K58 A;  3VYU A;  4DV5 Q;  2UUB Q;  1BKB A;  4X64 L;  4XIG S;  1STY A;  2O5J C;  5JVG 3;  4F87 A;  1QE6 A;  4IUT A;  1S5F D;  1STN A;  1NNX A;  3M4O B;  1ILQ A;  3HRZ C;  3I2Z A;  3OPO A;  2HHH Q;  5C4H A;  4LFB L;  3W1B A;  2BCO A;  1DCZ A;  1VQ5 A;  4DK3 C;  5IYB H;  3H3V H;  4N8X 1;  4C3J G;  2BE5 C;  1U5K A;  4OHJ A;  1NAP A;  4HN7 A;  5DM6 3;  4QQB X;  1MD2 D;  1Q8I A;  4EQO A;  1R4Q B;  4KY7 A;  4HIO A;  3D4R A;  3KJO A;  3FKI G;  1K83 B;  1TS4 A;  1N8R C;  4MTN A;  2IHF A;  5JVH 3;  1RD9 D;  2CW0 C;  2K5N A;  2B2U A;  1PRT F;  4GNX A;  5M3M H;  5K36 G;  1G2S A;  3R2T A;  1KRS A;  3A7L A;  1EOT A;  4A3M H;  2AKW B;  1M90 C;  1V8Q A;  4A3B B;  1VQK A;  3I4M B;  4LFC Q;  3PSI A;  4RHR A;  4LF5 Q;  1XNR L;  4PMB A;  3RZO H;  1V43 A;  4LF4 Q;  3N6R A;  5C44 H;  5J22 A;  3KBG A;  3VR5 A;  2LMC B;  2NVY H;  4R9W A;  2A69 D;  4LF9 L;  4ZKB B;  3CC2 A;  3CCE A;  1LM0 A;  4X62 L;  4ZUJ A;  3HOU H;  3TP6 A;  1EWI A;  4MIU A;  1K28 A;  4UDU C;  1I4H A;  4MN3 A;  5I2Y A;  4AIM A;  1SR3 A;  1BQQ T;  1LYL A;  2R7D A;  2L9H A;  2WKC A;  2BA0 A;  1CTM A;  3M4P A;  1VQ7 A;  5M9O A;  2RCN A;  4IFD H;  4C3J H;  1NY4 A;  4KD3 A;  1W6K A;  5C5L A;  2E74 C;  2NVQ H;  2K32 A;  5CBE E;  3J81 c;  3UE0 A;  2B2T C;  5IP7 H;  5M5W B;  3EVQ A;  2HD3 A;  1Q1B A;  2BDO A;  4EVO A;  1EY8 A;  1M1K C;  4A93 B;  3U50 C;  4B9W A;  4JOI C;  4ALP A;  1Z47 A;  3FKI H;  4P75 A;  1YVC A;  4QJF A;  3ERO A;  3TRE A;  3CCQ A;  1JT8 A;  4GLV B;  1ENA A;  1JJC B;  5FK9 C;  1PYW D;  2MO1 A;  2KOL A;  3JAM c;  2GVB A;  3CW2 C;  4CDD C;  2UXC Q;  4P71 A;  1Q8K A;  3HOV G;  3IL8 A;  5C4Z A;  3HOW G;  3H3V C;  2A6E C;  4DK1 A;  5JEA J;  1O7Z A;  4DXF A;  2HUG A;  2VQE L;  4HID A;  3S15 B;  1EL0 A;  3ZJY C;  3S2D B;  4OWW B;  4DV6 Q;  2HCC A;  4A3K H;  2TMP A;  1JJ2 A;  3AFQ A;  3L0O A;  2JEB I;  1CHQ D;  1YJN A;  1SRU A;  3D0F A;  5I4D A;  1PH4 A;  1PA6 A;  4JBJ A;  5I9P A;  5C0X J;  4PMW A;  1MKH A;  3KLS A;  1X32 A;  1EYD A;  2PPB C;  3T16 A;  1YNJ D;  3CCJ A;  4IO9 A;  4WJ4 A;  2XIW A;  3EA6 A;  5HGT A;  4FF1 A;  1CQV A;  3DEO A;  4I65 A;  4LFA L;  3NEM A;  4A3C G;  2ZJR A;  4JBW A;  2EXZ A;  1VQ8 A;  1TS5 A;  5G3L D;  2JA8 G;  2PW5 A;  3K5L A;  2PZT A;  4NMZ A;  3UDX A;  3KF8 B;  2DGY A;  5IYC H;  4DR6 Q;  1CM9 A;  2QA4 A;  3LX0 A;  1JOO A;  2AQ2 B;  4DR4 Q;  3SK6 A;  2A19 A;  4DV3 Q;  4XYO A;  4DA2 A;  1EQV A;  1I3Q B;  1Q81 C;  1UUP A;  1DOL A;  3HEJ A;  3OSO A;  4JVZ A;  1A2T A;  2R93 G;  4XTC S;  1PV4 A;  3J7A 5;  2VUM B;  3HKZ E;  4IPC A;  2G9H D;  4H7B A;  4DV5 L;  1EQT A;  2UUB L;  3HOW H;  1HZA A;  1HQM C;  3I4N B;  1B8A A;  4UHV A;  1G8Z D;  3J81 j;  4OX9 L;  4YCV A;  3G6E A;  2SDF A;  2EYO A;  3IAY A;  4FYD A;  4OIJ A;  4OL7 A;  1TY0 A;  4A3M B;  4LUV A;  3DLL A;  4XQJ A;  4BXX G;  3TS2 A;  4K5V A;  2FHT A;  5CV9 A;  5C0X I;  1B1Z A;  3PO2 H;  1EWC A;  1FJG Q;  5IIF A;  3A7A B;  3HGB A;  3NTH A;  1SYD A;  2K14 A;  2K5V A;  2K5W A;  3J81 i;  5TSS A;  4J8Q A;  1JOQ A;  3ERS X;  1IL8 A;  1JOK A;  3SK8 A;  1SN8 A;  2K04 A;  4DGZ A;  1B70 B;  2Z9H A;  3OWF A;  4N9T A;  3NXW A;  1WTV A;  3JAM i;  4L5T A;  3H94 A;  1BBX C;  2EJM A;  4DUZ L;  3RN2 A;  4A3L G;  1HPC A;  1U9R A;  4YHH L;  4C3J B;  2YTX A;  1OO9 B;  2RDF A;  3ER0 A;  3MZ5 A;  2DUD A;  3NEN A;  2KHJ A;  3D6W A;  1M8A A;  1IHZ A;  1U4R A;  1RTO A;  4LF4 L;  4KJN A;  2JA5 G;  4X6A H;  3DHQ A;  1YNN C;  1PH2 A;  4X3U A;  1ICF B;  5EBD A;  2L4N A;  1TWG H;  3I7F A;  2EYF A;  2ICE C;  3OTO L;  4JV5 Q;  3CCM A;  5IOC A;  3G7L A;  4NXM Q;  4L6T B;  4DV4 Q;  1PDQ A;  4LF8 Q;  4CDE C;  2MP1 A;  2K5Q A;  2F0V A;  3M85 A;  4BXX H;  4RGM A;  4NXN Q;  1A3T A;  2OT2 A;  5JEA G;  1HRJ A;  1Y8N B;  3KF6 B;  4DR3 Q;  1PH6 A;  2Q2H A;  3DXJ C;  3P1H A;  5ELO A;  2F0T A;  5KNC A;  2FXQ A;  2NN6 I;  3J81 E;  1JJG A;  2ES2 A;  1H9S A;  1VMC A;  5FJ8 G;  2EE1 A;  3S1R H;  4IUU A;  5C3X A;  4Q0F A;  1BCP C;  5C0X G;  1CFM A;  1X9N A;  1HCZ A;  4POF A;  3CPF A;  4OXP A;  3SR1 A;  4A3I B;  1HA5 A;  2UXC L;  1EIG A;  3JAM E;  3CQZ H;  4A3L H;  1F9Q A;  4A3G G;  2B2T A;  1C8C A;  1PH1 A;  2B3G A;  2KCM A;  5COR A;  3GTK H;  3TME A;  1Q82 C;  3EIV A;  1L1O C;  3P75 A;  1QVF A;  4DV2 L;  4JOI A;  4QIW E;  4YY3 Q;  1XMO Q;  2WAC A;  1WFQ A;  2R3Z A;  1PTO D;  2TSS A;  5IP9 G;  2EY2 A;  4OIK A;  1UAP A;  1PH3 A;  2DNC A;  4C3H G;  2B8F A;  3NHH A;  1EYG A;  2K03 A;  1BDO A;  5BR8 Q;  1WD1 A;  1RTN A;  4ULL A;  4BBR H;  3DEP A;  4APV A;  3NQI A;  3RMH A;  3HOV B;  3FDT A;  3ULP A;  3HOW B;  2F0D A;  3NBI A;  3AU7 A;  4K2L A;  5KEE A;  4LUO A;  4WJW A;  3VR3 A;  1TWH B;  3TP5 A;  3GTJ B;  1GO3 E;  3SXH A;  1HJP A;  1BCP B;  1IZ6 A;  1I6V C;  1XPR A;  1CKN A;  3PUW A;  4ME5 A;  1ICW A;  4IUP A;  1HNW Q;  2KED A;  2L0C A;  4MNO A;  4J6H A;  1WJJ A;  2KQ3 A;  2XTI A;  4DR4 L;  3MTS A;  4PZ8 A;  3BS1 A;  2B2Y C;  4DR2 L;  3OW2 A;  4JI0 L;  4JYA Q;  1L1O B;  2OTL A;  4XXE A;  1J8I A;  1B44 D;  4V0B A;  1EEF D;  1D7Q A;  5IT9 c;  1DM0 B;  3SE0 A;  1PHJ A;  2R92 G;  1BO0 A;  2JA8 B;  3GTL H;  5C4X G;  3IKJ A;  2Q2U A;  5T1G A;  2NN6 G;  4A3J G;  4HR7 B;  4A3G H;  3HFZ B;  4B08 A;  3C3L A;  4IUQ A;  5IYD G;  5M3F G;  3AEV A;  1PFM A;  3GQB A;  1QG7 A;  2F0N A;  1QUQ B;  3J7Z C;  4KKU A;  4TQU S;  3J7A F;  4R4I A;  2YU9 B;  3Q8D A;  2R93 B;  3E0E A;  4QUF A;  4A3E H;  3CP0 A;  1FJG L;  2Z6K C;  1B9M A;  1UWV A;  4JI7 Q;  4DR1 Q;  4TVA B;  5CYU A;  2CWP A;  4K5W A;  5FOB B;  2BH8 A;  1HR0 Q;  5E7N A;  1B3A A;  2X6G A;  4KJO A;  1IBK Q;  2N78 A;  3U4Z A;  2OQ0 A;  1RHP A;  2KCN A;  4J1M A;  3D6C A;  4ZYS A;  1LTA D;  1X6O A;  2E2I B;  4BY7 G;  4K8I A;  2RDG A;  3K7A B;  3K5O A;  1VQE A;  3CHB D;  4R4O A;  2ZXP A;  2N3S A;  4IQZ A;  3Q23 A;  1UEB A;  1BF4 A;  1KNE A;  2LXJ A;  4L5Q A;  1RDP D;  3D8G A;  3BYT B;  1G2T A;  1FGU A;  5HY6 A;  3F2D A;  1QWY A;  2F3V A;  1N32 Q;  3H3V I;  4XQN A;  1G51 A;  1CKO A;  4K5X A;  4LAA A;  1TII D;  2VW9 A;  3P7J A;  3T56 B;  4IFD J;  3HOZ G;  2M00 A;  1IW7 C;  1DD2 A;  3KF6 A;  2RSN A;  1HH2 P;  1KAB A;  1PXU A;  5FLX E;  1B7Y B;  4JV5 L;  1FVI A;  2MO0 A;  2K50 A;  3GP7 A;  4B3M Q;  2VQF Q;  4RH6 A;  4KD4 A;  5D3I B;  3KK7 A;  1SNP A;  3A5Z B;  1V9P A;  3S2H H;  4OEM B;  4KN7 C;  2ID0 A;  1VS0 A;  4TKO B;  1VQA A;  4A75 A;  1I94 Q;  1O7I A;  3PV0 A;  4P2C B;  3RUZ A;  4YWL A;  4CKE A;  2K1B A;  4EGV A;  1ENF A;  1STG A;  2EYJ A;  4DR3 L;  1YJW A;  1QJO A;  1SMY C;  4NW2 A;  2JA5 B;  1GJX A;  2FMC A;  4H02 A;  3KUP A;  2JSO A;  4Y7N H;  3W5O A;  3U58 A;  3BJU A;  2HT1 A;  5ISR A;  3J80 c;  3SHL A;  3L9A X;  1HA6 A;  2OQK A;  2QGQ A;  1O7Y A;  3A56 A;  1HUN A;  1KAW A;  3CC4 A;  3F2B A;  1Q3L A;  4DUY L;  4BY7 H;  2PQA A;  3CRK C;  3SDZ A;  4X66 L;  3MVV A;  3HP3 A;  4DK6 C;  3J81 L;  1WI5 A;  1I6H H;  1IBL L;  2QEX A;  3CXC A;  4A3F G;  5GAD C;  1K9M C;  2XRS D;  4IFD I;  1CA6 A;  1JCK B;  1X3F A;  4CDF C;  2FMM A;  2XNA C;  5ELN A;  4RWS C;  3KDF A;  3STB D;  3HOZ H;  3JAM L;  4DV1 L;  2H4O A;  2JYO A;  1K73 C;  3S17 H;  3HKS A;  1X54 A;  1Y8O B;  3K7U C;  5CBA E;  4HJA A;  3MEF A;  2E2D C;  5HGQ A;  3RR5 A;  1QB5 D;  3V2T A;  2K5H A;  1AFP A;  5IYB G;  1PFS A;  5IGD A;  3GTL B;  2WIN B;  4GOP C;  1EWH A;  4A3G B;  3BDC A;  1DOM A;  2PYK A;  1PRT D;  1QNU A;  2CH4 A;  3R93 A;  1AW7 A;  4C1N K;  3K0Y A;  2G5D A;  1OXS C;  3W2D A;  2F0O A;  4NPS A;  3G4S A;  2F3I A;  2EYP A;  4GKK L;  2K75 A;  4C3H B;  4ID6 A;  3PF5 A;  5M3M G;  2CQA A;  4JI3 L;  3WDN A;  1RJT A;  3X3N A;  2A1A A;  1QUQ A;  1X3E A;  1YNX A;  3F1Z A;  1SXT A;  2P5Z X;  2KVM A;  4DNI A;  1STH A;  4AQY Q;  4YWM A;  1S4Z A;  4JI6 Q;  2HIV A;  1TR5 A;  5IT9 E;  5C44 G;  4BY1 G;  2XGT A;  4JCV E;  3T1H Q;  1I4R A;  2NBF A;  2RVL A;  1GHJ A;  4RGN A;  2KUM A;  4IUV A;  3CD6 A;  3K59 A;  1KTK A;  3BVG A;  4GOP B;  3HOU G;  1HQR D;  2E2J H;  2OWO A;  2F0L A;  1GUT A;  2A74 C;  4JI1 Q;  4CGY B;  1HZ9 A;  4G7Z C;  1Y1V H;  1L0Y B;  3OIQ A;  2AUJ D;  4Q5V A;  4IFD G;  4KLK A;  1EEI D;  4CKC A;  3J80 i;  4B3T Q;  2R92 B;  1SNC A;  2ZTD A;  5C4X B;  4RGT A;  1B53 A;  4YCU A;  2ZTE A;  4HCE A;  4A3J B;  1N33 Q;  1AP0 A;  5IP7 G;  2HDL A;  5C3E G;  5EKK A;  3I73 A;  1O78 A;  2EQS A;  1EZ8 A;  4KKS A;  2IX0 A;  5M3F B;  3I90 A;  1VDZ A;  4B3S Q;  3NBH A;  5EJW A;  1EY6 A;  1IBM L;  2XWB B;  2RBM A;  1UE1 A;  3CCS A;  4HAE A;  1BVS A;  2KEC A;  1HUM A;  1N32 L;  2UUC Q;  2F0W A;  2N55 A;  1N36 L;  3F8T A;  3MXU A;  4OO1 H;  2KJX A;  3S1M H;  3S24 A;  4A3K G;  1EIF A;  1U4P A;  2GN5 A;  1DJR D;  1AEX A;  1DZ1 A;  4BY7 B;  2OEO A;  4B3M L;  3A8I E;  3QR8 A;  4BY1 H;  1ZXT A;  1S40 A;  4LWC A;  3PIP 3;  1WOC A;  3ERQ A;  5EGT A;  5AFW A;  2K4K A;  2JA7 H;  5FLX L;  4M1U B;  2EPB A;  5J1Z A;  2VS1 A;  4DAM A;  2WAQ G;  4IUR A;  2DJG C;  3ITP A;  3H0G H;  2UUA L;  3HOZ B;  5J3B A;  3RZD B;  4IZ8 A;  3ULJ A;  1B3Q A;  1EY0 A;  2QW7 A;  4NKL A;  3SK5 A;  3K6O A;  1D5M C;  2EY5 A;  1S5C D;  5T1I A;  4C56 C;  5IYC G;  4C3I B;  1F9S A;  2D9U A;  1TQO A;  1I50 H;  2XWJ B;  1ML0 D;  1AE2 A;  3MEH A;  5C3E H;  4DV0 Q;  3TZD A;  3GTG B;  3TDQ A;  4A3D H;  5CMD A;  2A6H D;  1STB A;  1HFG A;  5M5X H;  4X3S A;  1I4Q A;  2IX1 A;  1EZ6 A;  3BVZ A;  1FNU A;  1F2Y A;  5C4J H;  1ZYR D;  1TWF H;  2F4V L;  1TWA B;  1MI2 A;  4GZY C;  4PMC A;  2XSC A;  3M4Y A;  1FYC A;  2F52 A;  2EOT A;  1SSO A;  4ZLT F;  1TXY A;  1E24 A;  1SEB D;  4EQN A;  2I0Q A;  2UXD Q;  2NVT H;  1LO5 D;  5GRO A;  4CJ1 B;  2LFN A;  4KY5 A;  4DPG A;  2ENB A;  3OMG A;  2HQE A;  3PO2 G;  3RD4 A;  4G57 A;  1BR9 A;  4A76 A;  1A15 A;  1CHP D;  3NWS A;  2E5L Q;  1Z6H A;  3R3O A;  5BN3 A;  4A3F B;  1EY5 A;  1EFW A;  1DON A;  2NTT A;  4XT3 B;  4GN4 B;  3A0J A;  2PO4 A;  1EYC A;  3K8A A;  1T5X D;  1WTH A;  1G91 A;  4N8F A;  1NCV A;  2B29 A;  5KYL A;  3F2U A;  1EQR A;  3T1Y L;  5BN5 A;  3ONA B;  3GTQ H;  4LMQ D;  4G7O C;  4PQX A;  1KAA A;  2F0I A;  3CCR A;  2J4X A;  3BZD B;  4RKL A;  1Y1W H;  1YIT A;  2EJG C;  4UY8 C;  1MJE A;  2C5C A;  2B2V A;  5BN4 A;  1AH9 A;  4DV7 Q;  1FR3 A;  1HTL D;  3K81 C;  1GUN A;  1QZG A;  3GTM H;  1D6E C;  1XMQ Q;  4CJ2 C;  2B2W A;  3HOX H;  3NSW A;  1EY9 A;  3A54 A;  2KBN A;  4KHP L;  4HSP A;  5EKI A;  2EIF A;  3AQQ A;  4JI5 Q;  3J7Y W;  4U68 A;  3OW7 A;  1OXV A;  4DAV A;  4JI2 L;  3NP8 A;  3VR4 A;  2HCI A;  2BA1 A;  3MWY W;  3KLW A;  3S14 H;  1A63 A;  5IE8 A;  5IT9 L;  1BNZ A;  3SGI A;  5M3M B;  3ZYY X;  2K5D A;  2SEB D;  1KRT A;  2CQO A;  1F9P A;  3VYS A;  5LMN W;  2HHH L;  3AB9 A;  1QVG A;  1S5D D;  1PZI D;  4FF3 A;  2BDN A;  4L5S A;  1JC7 A;  1VQJ A;  3RZO B;  5CV8 A;  4B3T L;  4X65 Q;  3TQY A;  5C44 B;  4BY1 B;  3P20 A;  2NVY B;  5KRU A;  4O1N A;  1VQP A;  3C2P A;  5A2Q E;  2IW3 A;  1B2T A;  1BCP F;  4RFB A;  1H9K A;  1X55 A;  3PIP A;  4AYB G;  3KOJ A;  3HOU B;  1EU4 A;  2WII B;  4U67 3;  2PI2 E;  2IL8 A;  3GDE A;  1L0X B;  1A3V A;  2LSS A;  1CT1 D;  3PQI A;  2JA6 H;  1II3 A;  1CSQ A;  1GKH A;  1RCV D;  2UUC L;  1KHI A;  2D0P A;  2L11 A;  5JPM C;  1W2B A;  5D14 A;  1IXR A;  5I2X A;  3M7N A;  1DYQ A;  2L5T A;  1K3B C;  4P72 A;  2E76 C;  2NVQ B;  4I7Z C;  4DR5 Q;  5C3E B;  4HJ8 A;  5AJ3 Q;  4XDX A;  4S3S A;  3MXG A;  1OXU A;  3MXP A;  4J15 A;  3L3O C;  4LFC L;  4LF5 L;  1RKN A;  2PCF B;  3I55 A;  1VCI A;  3FKI B;  3CME A;  3Q0A A;  3S16 H;  5EPK A;  1OTC A;  5LMU Q;  2A69 C;  4E6I A;  5C4J B;  4BBR G;  3G6J B;  2L15 A;  1TWF B;  5C3W A;  3RN5 A;  4GLX A;  2MFI A;  2DNE A;  1JWU D;  1PH7 A;  3TN2 A;  2AQ3 B;  2M2L A;  2F0S A;  1SE3 A;  4QUC A;  5CGK A;  4CJ0 B;  1LT4 D;  2CKZ B;  4A3K B;  3G71 A;  2F0Q A;  5HUR A;  2Z4H A;  1D2B A;  3E6Z X;  2B8G A;  3S1Q H;  4DF7 A;  2K33 A;  2RQX A;  3PF4 A;  2AWO A;  3M3Y H;  2IX3 A;  1SND A;  1UE7 A;  4GN5 A;  5GAH C;  1XXG A;  1YHB A;  2FIN B;  2VXW A;  3TSS A;  4K0K Q;  3NTK A;  5KIX A;  2WAQ B;  1O80 A;  2NB0 A;  3S9W A;  4IPH A;  3I91 A;  1F9R A;  5ELC A;  3GTQ B;  1UNS A;  4NP5 A;  3UDF A;  4LF7 Q;  1D8L A;  1MGS A;  4NDX A;  4WOR A;  3PUY A;  3QJY A;  2E75 C;  4DV6 L;  4JBM A;  1EY4 A;  1SYE A;  1VF5 C;  1RF2 D;  3C1E A;  3GV3 A;  4A4I A;  1GUG A;  4GLA C;  3GTM B;  3CF5 A;  2F0G A;  4O0A A;  2Q8T A;  1CA5 A;  4FO2 A;  3KF8 A;  4A3E G;  2FJ2 A;  1GD7 A;  2RF4 A;  2E5L L;  2JQO A;  4ODG A;  1J5E Q;  3OHX C;  4B3R Q;  4DAY B;  2R6G A;  1H9R A;  3GD7 A;  1YNJ C;  1LT3 D;  1LTB D;  1HFN A;  1SYB A;  2DY8 A;  2QDB A;  5FO8 B;  1ESR A;  3K5M A;  4Z9C B;  1A0I A;  1LV9 A;  3B6Y A;  1QNK A;  2KEN A;  1NMG A;  3A55 A;  1STE A;  3T4A C;  1TWC H;  4DR6 L;  1CI3 M;  2KCC A;  3QG1 A;  3PO2 B;  3E3X A;  1NSN S;  4QY7 A;  4KHV A;  3K0X A;  2EYL A;  3VR2 A;  2JEA I;  4DV3 L;  1KXL A;  3HKZ G;  2JXM B;  1EUJ A;  3TS0 A;  1EYA A;  3I56 A;  1HNZ Q;  2B63 H;  4KTA A;  4ZAI A;  1J6Q A;  1S72 A;  2K7V A;  1VQD A;  4WJ3 M;  3FP9 A;  1EY7 A;  4ZQ3 A;  1YHQ A;  2K6A A;  1B4O A;  3AYH B;  1PLF A;  1ZEQ X;  1MSG A;  1PZJ D;  5JJI A;  2ZM6 Q;  2BH2 A;  3QO2 A;  2ATW A;  1ESF A;  1YHA A;  1V1P B;  2CHB D;  4C2M H;  4DR7 Q;  1JB3 A;  2Z4I A;  3S16 B;  1TWG B;  4M8A A;  4FXD A;  1SYG A;  5L37 A;  2NVX H;  1U4M A;  2C35 B;  5FKA C;  2F0K A;  3NEL A;  3ND9 A;  1FGB D;  1DOK A;  4PV1 C;  1PTO H;  2L1B A;  2E2H H;  1M4V A;  5E4W C;  5A2Q L;  2VZA A;  4G4K A;  1SE8 A;  3DWQ A;  1D1K A;  1RIP A;  3S1N H;  3IRB A;  1TS3 A;  3GV6 A;  1NE3 A;  3ND8 A;  4HED A;  4Y52 H;  2BE5 D;  3GTO H;  5IGF A;  4DR5 L;  5AJ3 L; 
#chains in the Genus database with same CATH homology
 1PH4 A;  1PA6 A;  4JBJ A;  3CD6 A;  1VQB A;  5C0X J;  4PMW A;  1MKH A;  4IOC A;  4GOP B;  3HOU G;  5M5Y H;  5IWA Q;  2E2J H;  2OWO A;  3MXN B;  4JI8 L;  2GVA A;  3JC6 6;  4BA1 I;  3CCJ A;  4IO9 A;  4JI1 Q;  4WJ4 A;  4BBS H;  1WCM H;  1HZ9 A;  4LFA L;  4JI4 Q;  4NXM L;  1Y1V H;  2UXD L;  3NEM A;  4DV4 L;  2ZJR A;  4JBW A;  5LMN Q;  4A3C G;  1HR0 W;  1X56 A;  1VQ8 A;  4KLK A;  4LF8 L;  4IFD G;  2JA8 G;  3J80 i;  4KHZ A;  4DUY Q;  4B3T Q;  2ZTD A;  3UDX A;  4YCU A;  2N49 A;  2ZTE A;  3KF8 B;  2DGY A;  4X66 Q;  5IYC H;  1N33 Q;  2QA4 A;  5IP7 G;  5C3E G;  4DR6 Q;  3H15 A;  4OO1 I;  2I5H A;  1K0R A;  1QVC A;  4NXN L;  4IPG A;  3WWV A;  2EQS A;  2IX0 A;  4DR4 Q;  1IBL Q;  1XNR Q;  4B3S Q;  3W1G A;  1G6P A;  2A19 A;  3CCU A;  4DV3 Q;  1R9T H;  1IBM L;  1Q81 C;  1EQQ A;  3AFP A;  1UE1 A;  1HZB A;  2R93 G;  3CCS A;  1VQ4 A;  1BVS A;  4LF9 Q;  1FL0 A;  4XTC S;  1N32 L;  1PV4 A;  4DV1 Q;  1U0L A;  2UUC Q;  4X62 Q;  1N36 L;  2JA5 H;  2I5L X;  1C0A A;  1K83 H;  3F8T A;  3J7A 5;  2K52 A;  5GQO A;  3HKZ E;  4IPC A;  4DV5 L;  2UUB L;  2PQA B;  3HOW H;  2EXD A;  1HZA A;  1K8A C;  3L7Z C;  3S1M H;  3S24 A;  1B8A A;  1KC8 C;  3J81 j;  4A3K G;  1EIF A;  4OX9 L;  3CAM A;  4YCV A;  3UE1 A;  3G6E A;  2GN5 A;  5EAY A;  2D0O A;  4DV7 L;  4LUV A;  1K3R A;  2YTY A;  4R4Q A;  3DLL A;  3TRZ A;  2UXB Q;  1YEZ A;  4B3M L;  4BXX G;  4BY1 H;  5H1S E;  1XMQ L;  3HOY H;  1EIY B;  3TS2 A;  1Q86 C;  5C0X I;  1S40 A;  3PO2 H;  4LWC A;  3I4M H;  2JK8 A;  1WOC A;  3KDF B;  1FJG Q;  2K14 A;  4YY3 L;  2K4K A;  1XMO L;  4JI5 L;  4POG A;  2K5V A;  2JA7 H;  3PO3 G;  2AMC B;  5DLQ E;  3J81 i;  2VS1 A;  2R7Z G;  4UP7 A;  4DAM A;  1WCM G;  4BBS G;  2WAQ G;  3ERS X;  4GKK Q;  2CFM A;  4JBK A;  3GO5 A;  1SN8 A;  3H0G H;  4FDB A;  2UUA L;  5J3B A;  4PG3 A;  1B70 B;  1Y1V G;  1X3G A;  5BR8 L;  1J5E L;  2A8V A;  3GTP H;  3ULJ A;  3RLN A;  1L2F A;  1SFO H;  5FJ8 H;  1CUK A;  4JI3 Q;  1SMX A;  3E9H A;  1GVP A;  1PYB A;  5GAG C;  3JAM i;  5IYC G;  4L5T A;  1L1O A;  2VQE Q;  5JJL A;  1I50 H;  1E3P A;  2IT1 A;  3PUX A;  4O2D A;  1AE2 A;  1MIU A;  4DUZ L;  4PZ6 A;  5C3E H;  1HNX L;  4DV0 Q;  3RN2 A;  4A3L G;  4IPD A;  4HJ5 A;  1A62 A;  4A3D H;  4X65 L;  4YHH L;  1BBW A;  1VQL A;  2YTX A;  4EX5 A;  4LW1 A;  2HIX A;  1KD1 C;  1AE3 A;  1HNW L;  3ER0 A;  5M5X H;  5FLM G;  4NB3 A;  1GM5 A;  1A8V A;  1OXT A;  2IX1 A;  2DUD A;  2KHJ A;  3NEN A;  4YCW A;  5C4J H;  4X64 Q;  1DGS A;  4LF4 L;  2JA5 G;  3PCO B;  3CCV A;  4X6A H;  1TWF H;  1PH2 A;  1C9O A;  1QVF A;  2F4V L;  4A93 H;  3FHW A;  1TWG H;  3I7F A;  5IP9 H;  1HNZ L;  4OO1 G;  2F52 A;  4JYA L;  3K80 C;  1TXY A;  1E24 A;  3OTO L;  3CCM A;  4JV5 Q;  1E7Z A;  4C3H H;  1Q7Y C;  4LFB Q;  2KCT A;  2I0Q A;  4JG2 A;  4LFA Q;  4NXM Q;  3EBE A;  4HJ7 A;  2NVT H;  4DV4 Q;  2UXD Q;  5GRO A;  2E8G A;  2ZTC A;  3G48 A;  4DPG A;  4OON A;  4LF8 Q;  4HIK A;  4GNX C;  3A5U A;  1VQ9 A;  2WB1 E;  3S15 H;  3M85 A;  1YIJ A;  3PO2 G;  4A3B G;  4BXX H;  1VQG A;  4A76 A;  3I4M G;  3S2D H;  1E22 A;  3U4V A;  1VQM A;  4NXN Q;  2JA7 G;  5JEA G;  1IYJ B;  2E5L Q;  1Q1E A;  3KF6 B;  3ICE A;  3M4Q A;  4DR3 Q;  2Q2H A;  1PH6 A;  4GS3 A;  2ZM6 L;  4HIM A;  3PO3 H;  5ELO A;  1IBM Q;  1EFW A;  2R7Z H;  3H0G G;  4GN4 B;  3A0J A;  5LMU L;  3A74 A;  2FXQ A;  2WB1 G;  1YZ6 A;  2NN6 I;  4PZ7 A;  3K8A A;  2VY3 A;  4DR7 L;  5JJI A;  1JJG A;  2ES2 A;  1CSP A;  4JI7 L;  5FJ8 G;  4DR1 L;  1PH8 A;  3S1R H;  2B29 A;  1N36 Q;  1EQR A;  2LXK A;  3T1Y L;  3GTQ H;  5C0X G;  1HR0 L;  1X9N A;  3CCR A;  4GKJ L;  1Y1W H;  1YIT A;  4POF A;  1IBK L;  3CPF A;  2N8N A;  4OXP A;  4UY8 C;  1V1Q A;  1MJE A;  4OX9 Q;  5IYD H;  1VQN A;  4A3D G;  1MJC A;  2UXC L;  3CQZ H;  3NBH B;  1AH9 A;  4A3L H;  4DV7 Q;  4A3G G;  3K81 C;  2IHE A;  1QZG A;  1NTG A;  2R92 H;  3GTM H;  1PH1 A;  5C4X H;  1KQS A;  1E1T A;  2B3G A;  2KCM A;  2Z6K A;  1XMQ Q;  3BZK A;  4A3J H;  3HOX H;  3GTK H;  1Q82 C;  1KL9 A;  3EIV A;  1L1O C;  2I5M X;  4DV2 L;  2KBN A;  4JOI A;  4LF6 L;  5FLM H;  3CMA A;  4QIW E;  4UP9 A;  1K8G A;  4KHP L;  4YY3 Q;  2EIF A;  5M3F H;  1XMO Q;  3AQQ A;  3RLF A;  4GNX B;  1PH5 A;  1WFQ A;  1N34 Q;  1Q46 A;  4JI5 Q;  4A93 G;  1H95 A;  5IP9 G;  1OXV A;  4K0K L;  1I3Q H;  4JI2 L;  2OTJ A;  3RNU A;  1XPU A;  1XNR L;  3ULL A;  4DKA C;  1PH3 A;  1Z9F A;  3BZC A;  2UUA Q;  2BA1 A;  4UP8 A;  3KLW A;  1EYG A;  3KFU A;  3S14 H;  1A63 A;  5BR8 Q;  5IE8 A;  4BBR H;  5IWA L;  1UE5 A;  2KHI A;  3SGI A;  1JMC A;  4EQ5 A;  1KRT A;  4APV A;  1HZC A;  1ASZ A;  2CQO A;  2CCZ A;  3ULP A;  2VUM H;  2WAQ E;  2UU9 Q;  4LF7 L;  1VQ6 A;  1EOV A;  4LUO A;  1VQC A;  5LMN W;  2VQF L;  2HHH L;  3I4N H;  3CCL A;  1QVG A;  4RG1 A;  4JI4 L;  1N9W A;  4QL5 A;  4AYB E;  5LMN L;  4DUZ Q;  1GO3 E;  4A3B H;  4L5S A;  2JE6 I;  2WP8 J;  1VQJ A;  1HJP A;  2CWA A;  1I94 L;  1IZ6 A;  3CPW A;  4B3T L;  1LUZ A;  1SRO A;  3TQY A;  4X65 Q;  4YHH Q;  1XTD A;  1XPR A;  1CKN A;  3PUW A;  1VQP A;  2Z0S A;  1X65 A;  1HNW Q;  4MNO A;  1WJJ A;  1X55 A;  2XTI A;  3PIP A;  4DR4 L;  4PZ8 A;  4AYB G;  3KOJ A;  4B3R L;  1XNQ Q;  2PI2 E;  1T9H A;  3F2C A;  1PYS B;  4DR2 L;  3OW2 A;  2F4V Q;  4OWX B;  3GDE A;  4JI0 L;  2LSS A;  1Y1W G;  4JYA Q;  1L1O B;  2NZH A;  1PH9 A;  2OTL A;  3OTO Q;  2JA6 H;  3EN2 A;  3PUV A;  2MNA A;  1CSQ A;  1GKH A;  3PIO A;  3RZD H;  2UUC L;  1D7Q A;  1KHI A;  2D0P A;  3DM3 A;  4IJL A;  1L0W A;  5IT9 c;  2ZJP A;  1W2B A;  1IXR A;  2ALY B;  1LTL A;  3M7N A;  1PHJ A;  2R92 G;  1P8L A;  5C4X G;  3GTL H;  2RHQ B;  2Q2U A;  2Q2I A;  2NN6 G;  4A3J G;  3HOX G;  4P72 A;  4C3I H;  4A3G H;  3HFZ B;  5IY0 A;  1BBU A;  4DR5 Q;  4A3I G;  4HJ8 A;  5AJ3 Q;  2RHS B;  2Y0S E;  5IYD G;  5M5W H;  1OXU A;  4LFC L;  4J15 A;  5M3F G;  4LF5 L;  3AEV A;  3GTG H;  2UXB L;  3LGJ A;  1XJV A;  1QUQ B;  1VCI A;  2H5X A;  4JI8 Q;  3J7Z C;  3I55 A;  3CME A;  1ASY A;  1CKM A;  1KIX A;  3S16 H;  4TQU S;  2JA9 A;  1OTC A;  5LMU Q;  4R4I A;  4AH6 A;  3Q8D A;  4YWK A;  3E0E A;  1Y14 B;  4A3E H;  3CP0 A;  4BBR G;  1FJG L;  2Z6K C;  3STB C;  1W3S A;  1UWV A;  4JI7 Q;  2L15 A;  2Y0S G;  4DR1 Q;  4TVA B;  3RN5 A;  4RMF A;  4GLX A;  2CWP A;  1PVO A;  2VUM G;  2ASB A;  2MFI A;  2VL6 A;  2BH8 A;  1TWA H;  3T1Y Q;  1WYD A;  2NZO A;  5E7N A;  1HR0 Q;  1PH7 A;  4KI0 A;  3I4N G;  3I4O A;  4R1J A;  5GAE C;  2IY5 B;  1IBK Q;  1Q12 A;  2N78 A;  4LUZ A;  3U4Z A;  2CKZ B;  2OQ0 A;  3G71 A;  1X6O A;  4A3M G;  4BY7 G;  4MZ9 A;  1JE5 A;  2JJQ A;  1YJ9 A;  1OXX K;  3S1Q H;  2D62 A;  2YYZ A;  1VQE A;  4R4O A;  3PF4 A;  2N3S A;  2ZJQ A;  1UEB A;  3OYY A;  2Q2T A;  2AWO A;  2LXJ A;  4L5Q A;  3M3Y H;  2WFW A;  2MQH A;  4JC0 A;  1VQH A;  4UPA A;  4GN5 A;  1FGU A;  1NBW A;  1UE7 A;  5HY6 A;  5GAH C;  3F2D A;  4DV2 Q;  4KHP Q;  2YTV A;  1YHB A;  1N32 Q;  3H3V I;  4A3F H;  1G51 A;  1CKO A;  3CC7 A;  4K0K Q;  4JI2 Q;  2JA6 G;  2VW9 A;  1YBY A;  4R4T A;  4IFD J;  4DV5 Q;  1NJI C;  2UUB Q;  3HOZ G;  3E9I A;  1BKB A;  4IJH A;  4X64 L;  1S3O A;  4XIG S;  3KF6 A;  4HJ9 A;  4GOP A;  4IPH A;  1HH2 P;  2PMZ E;  1B7Y B;  1YI2 A;  3KYH C;  3UDF A;  4LF7 Q;  4JV5 L;  1FVI A;  2MO0 A;  4AQY L;  4IOA A;  2VNU D;  2K50 A;  1D8L A;  4B3M Q;  3I2Z A;  2HHH Q;  2VQF Q;  4LFB L;  3RLO A;  3W1B A;  3PUY A;  4JI6 L;  4DV6 L;  4JBM A;  3S2H H;  3A5Z B;  1V9P A;  4A3I H;  3L2P A;  1VQ5 A;  4A4I A;  4DK3 C;  2ID0 A;  5IYB H;  1VS0 A;  4GLA C;  3H3V H;  3UDG A;  1VQA A;  4A75 A;  1I94 Q;  1O7I A;  3PV0 A;  2AHO B;  3CF5 A;  1U5K A;  4YWL A;  4O0A A;  3T1H L;  2PI2 A;  2OCE A;  4QQB X;  4A3E G;  3TEH B;  1GD7 A;  2RF4 A;  2E5L L;  2JQO A;  4DR3 L;  1J5E Q;  1YJW A;  4HIO A;  4B3R Q;  4DAY B;  2R6G A;  3FKI G;  3KJO A;  3GD7 A;  4P74 A;  4DR2 Q;  1N8R C;  4MTN A;  4JI1 L;  2IHF A;  4H02 A;  4JI0 Q;  4L5R C;  4Y7N H;  3W5O A;  1G29 1;  3U58 A;  2K5N A;  3BJU A;  2HT1 A;  3J80 c;  1HNX Q;  4GNX A;  1A0I A;  2OQK A;  1P16 A;  2QGQ A;  3B6Y A;  5M3M H;  3M4O H;  5K36 G;  1KAW A;  3CC4 A;  2KEN A;  3HOV H;  1KRS A;  1NMG A;  3F2B A;  4DUY L;  4A3M H;  1M90 C;  4BY7 H;  1CKN B;  2AKW B;  2PQA A;  1TWC H;  1N33 L;  4X66 L;  4DR6 L;  4LNQ A;  4DK6 C;  1TWH H;  1VQK A;  1WI5 A;  3GTJ H;  1NMF A;  4ME3 A;  1I6H H;  4LFC Q;  1SLJ A;  3PSI A;  4QY7 A;  2QEX A;  3PGZ A;  3K0X A;  3CXC A;  1IBL L;  4A3F G;  1V43 A;  4B3S L;  4LF4 Q;  4LF5 Q;  2JEA I;  4DV3 L;  3RZO H;  5GAD C;  1K9M C;  1KXL A;  2PNH A;  3HKZ G;  5C44 H;  4IFD I;  1EUJ A;  2NVY H;  4OWT B;  3TS0 A;  1C7Y A;  3I56 A;  1HNZ Q;  1X3F A;  2B63 H;  1S72 A;  1J6Q A;  1IL2 A;  5ELN A;  3KDF A;  3STB D;  4LF9 L;  1N34 L;  3D31 A;  3HOZ H;  3CC2 A;  3KJP A;  3CCE A;  4DV1 L;  1LM0 A;  4X62 L;  3HOU H;  1VQD A;  1K73 C;  4WJ3 M;  3FP9 A;  3S17 H;  3HKS A;  1X54 A;  1VQO A;  3K7U C;  1EWI A;  4QGU A;  4HJA A;  3PUZ A;  3MEF A;  1YHQ A;  5HGQ A;  2YV5 A;  3RR5 A;  2V1C C;  3AYH B;  2K5H A;  1XPO A;  5IYB G;  4AIM A;  1SR3 A;  1LYL A;  4A3C H;  1PFS A;  2R7D A;  1QZH A;  2UU9 L;  4P73 A;  4GOP C;  3M4P A;  2BA0 A;  1VQ7 A;  2ZM6 Q;  2BH2 A;  1E1O A;  2RCN A;  1I5F A;  4C3J H;  2JA8 H;  1NY4 A;  2R7F A;  4GN3 B;  2ATW A;  2NVQ H;  3M9B A;  3J81 c;  3UE0 A;  5IP7 H;  1VQI A;  1YHA A;  4DR7 Q;  1VQF A;  4C2M H;  1Q1B A;  3VDY A;  3BU2 A;  1OXS C;  1RL2 A;  2HQL A;  1M1K C;  3U50 C;  4JOI C;  4ALP A;  1Z47 A;  3FKI H;  4NPS A;  3G4S A;  4BA2 I;  4P75 A;  2F3I A;  4GKK L;  3UDI A;  2K75 A;  1YVC A;  4QJF A;  2YU9 H;  4GKJ Q;  3CCQ A;  3TRE A;  2NVX H;  2R93 H;  1JT8 A;  4GLV B;  1JJC B;  3PF5 A;  2C35 B;  5M3M G;  2MO1 A;  3JAM c;  2GVB A;  3CW2 C;  3NEL A;  4JI3 L;  1XNQ L;  5FLX c;  2UXC Q;  4P71 A;  1Q8K A;  1QUQ A;  1X3E A;  2A1A A;  2E2H H;  3HOV G;  3HOW G;  1YNX A;  3F1Z A;  5JEA J;  4DNI A;  2VQE L;  2VZA A;  4HID A;  4YWM A;  4AQY Q;  1UE6 A;  4R4C A;  3ZJY C;  1JB7 A;  1SE8 A;  4OWW B;  1RIP A;  4DV6 Q;  4JI6 Q;  3S1N H;  5JJK A;  3IRB A;  4DV0 L;  4A3K H;  2HIV A;  4LF6 Q;  1JJ2 A;  3AFQ A;  3L0O A;  1NE3 A;  2JEB I;  2E2I H;  5C44 G;  4BY1 G;  2XGT A;  4JCV E;  4DR5 L;  3HOY G;  4Y52 H;  1YJN A;  3K7A H;  1SRU A;  2B63 G;  3T1H Q;  3GTO H;  2AWN A;  3D0F A;  5AJ3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...