4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
1K8GA 1IBKQ 3M85A 5IYDH 2PQAB 4DK3C 4DNIA 2N8NA 4HIKA 4IFDJ 1L2FA 1CSQA 1QVCA 4BA2I 3HOWG 2AHOB 2K14A 2AWOA 2R7DA 4UP9A 4YHHL 3ULPA 1KQSA 2AMCB 1N9WA 2DUDA 3M4PA 5H1SE 4OX9Q 4GKKL 4A76A 1XPRA 1VQNA 5M5WH 1N32Q 2Z6KA 2K50A 1UE5A 1SE8A 3PV0A 4DR1L 2RCNA 2VQFQ 4B3MQ 2PI2A 1CKNB 5M3FH 1PH9A 2ATWA 3KF6A 3S17H 1Y1VG 3NENA 1I94Q 4BXXG 4LF6L 3G4SA 1A0IA 1IYJB 3GD7A 4DUYL 2CWAA 1YJNA 4HJ8A 1VQ9A 2K52A 4C3JH 2OTJA 3PO2G 3EBEA 5JEAJ 5C4JH 2E2IH 2CWPA 3J81j 2UUCQ 4DR6Q 1U0LA 4HIDA 4JI5Q 1TWGH 1IBMQ 1J5EL 4BY1G 2JA8H 3CCUA 2NZHA 2QGQA 3CP0A 3HKZE 3HOZH 2I5LX 5GQOA 1QZGA 3I7FA 1SR3A 3AQQA 4KI0A 2MNAA 3OTOQ 2UU9Q 1YVCA 4AYBG 2A19A 3TEHB 1VQKA 4A3EH 2JK8A 2PNHA 4PZ6A 3CC2A 4JBMA 1WFQA 1CUKA 3I4MG 1BBUA 4JI3L 1C9OA 3FHWA 4MZ9A 3F8TA 4PG3A 3AYHB 4X65Q 2JA9A 4RG1A 3T1HQ 4LF5L 2XTIA 3S2DH 4OO1G 3H0GG 4DV7L 4A3LH 4IPCA 2R7ZH 3U4VA 5LMUQ 4JI4Q 1HZCA 1M90C 3KYHC 1YNXA 4JI1L 4R4OA 4DV1Q 4YWLA 1XPUA 4BBSH 4K0KQ 5IP7H 1WCMG 4IJHA 1SLJA 5LMNQ 4JBJA 3UE1A 1NE3A 4POFA 3CCRA 4JCVE 5M5XH 1N8RC 1O7IA 2KCMA 3JAMc 3BJUA 2PQAA 1Y1WG 1KRSA 3CPWA 1HNWQ 4DV3L 4HIOA 2JA7G 4X6AH 2B63G 4J15A 1PH2A 1L1OC 1HNZQ 4B3RQ 4JI8Q 2I5MX 4LWCA 1NMFA 4LW1A 4A3FH 1FJGQ 4JOIC 4YY3L 1XNQL 2F52A 2XGTA 1PH6A 4A4IA 3HKSA 4P72A 3KLWA 4OO1I 4GOPC 2DGYA 2JE6I 3CC7A 4A3MG 5FLMH 5AJ3L 1PH7A 4BXXH 1CKNA 3Q8DA 3CCVA 2E2JH 1HZAA 2FXQA 4DV0Q 1I6HH 1PHJA 4GN5A 3K0XA 1EUJA 1UE7A 4NB3A 2JA6H 4A3BH 1VQHA 3HOXG 1IBLL 1PFSA 1B8AA 1K0RA 1K3RA 1XJVA 4GLAC 4LFAL 1Q7YC 4L5RC 3RZOH 3K7UC 4P74A 1X56A 1PH1A 4LF9Q 4A3DH 4JI2L 4A93G 2NVQH 1XMOQ 3CMAA 3S1MH 3UE0A 1X65A 4A75A 1U5KA 4JI6Q 4NXNL 1M1KC 1Q1BA 2PMZE 4L5TA 1B7YB 1PVOA 2MO0A 4X64L 1RIPA 2YV5A 1JE5A 4FDBA 4X66Q 4LF7L 3M4OH 1QZHA 1HH2P 5FJ8H 1JMCA 1X3FA 3HFZB 1S40A 1K9MC 4DKAC 4JV5L 1N33L 1Q1EA 2NN6G 4DV2L 1HNXQ 4X62L 4AYBE 2F4VQ 4BBRH 3RLNA 5JJIA 1Q46A 3GTMH 4GN4B 3J81i 2ZJPA 4OWXB 4DV6L 3I4NG 4XIGS 1E24A 1OXUA 4GNXC 3S14H 4JYAL 2UXCL 2HHHL 1X9NA 1HZBA 2YU9H 1QUQB 3J7A5 4DR3Q 1GM5A 4GKJQ 1UEBA 5C4XH 4JBKA 1NBWA 3CQZH 4JG2A 1VQ8A 3S1QH 2KHIA 2R93G 1VQ6A 1XTDA 4DV5L 3SGIA 1W3SA 2IT1A 1Y1WH 1PV4A 4LFCQ 1YBYA 2JA7H 1VQ4A 4LF8L 3CW2C 4JC0A 4APVA 1KD1C 3CF5A 1JJ2A 3UDFA 5IYBH 3EIVA 1GKHA 3A74A 3F1ZA 1KIXA 2HT1A 2HIVA 5IY0A 3KDFB 2NN6I 3WWVA 3CPFA 3CCSA 2UUBQ 3HOYH 2F3IA 3PUXA 4MNOA 1L0WA 1LTLA 3CXCA 3OW2A 3T1YQ 4A3MH 2ZTDA 2LSSA 1WYDA 1FVIA 4QIWE 2JEBI 2Y0SG 3H15A 3MEFA 4DUZL 3UDGA 4UP7A 1VQFA 3HOVH 5BR8Q 3VDYA 4KHPL 1KHIA 1OXXK 5IYCG 2ZJRA 1L1OB 4YCWA 1YHBA 1BBWA 4A3GH 3BU2A 1VS0A 4NPSA 1EOVA 1XPOA 3M7NA 2JA5G 3S15H 2ES2A 3B6YA 3HOUG 3LGJA 1Q86C 3PCOB 2UXDQ 5DLQE 4GOPB 3PIOA 1VQLA 4A3JG 4WJ3M 2ZJQA 1YJWA 3M3YH 1VQCA 1Z47A 5EAYA 4ME3A 1AE3A 2ZM6L 1VQMA 4A3CH 1G51A 4A3KH 1B70B 5C3EG 1VQGA 3M4QA 4GLVB 1NMGA 1JB7A 2ZTEA 5IWAL 1TWCH 2VQEL 3KJOA 4A3IH 1PYBA 3K7AH 5GAEC 1HZ9A 1YHAA 2UXBQ 1D8LA 3G48A 3PUYA 4HJ7A 4B3SL 1X3EA 5C0XG 1YHQA 2KBNA 2NVTH 4IOAA 2LXKA 3FKIH 1Q8KA 1MIUA 1AH9A 2RHQB 4JBWA 4DV4L 1MJCA 3CMEA 4IO9A 2B3GA 3GTGH 1N36L 4YHHQ 2UUAL 3K8AA 2OQKA 4GKKQ 4Y52H 1MKHA 4GS3A 2ID0A 2K75A 3PUVA 4PZ8A 4DR1Q 4DR5L 1QUQA 1IL2A 5K36G 1UWVA 4YCVA 2KHJA 1A8VA 2QA4A 1EWIA 4LF4L 3UDIA 2Q2TA 2R92G 1R9TH 2RHSB 4LF6Q 4DUYQ 4HJAA 4AQYL 3H3VI 1NY4A 1UE1A 2N3SA 4DR2L 1T9HA 1VQBA 4GN3B 3GTOH 2OQ0A 3HOWH 2WAQG 4O2DA 5C0XI 4P73A 2PI2E 4LFBL 1LM0A 1S3OA 1J5EQ 3U50C 3PF4A 4YWKA 3PO3H 3KDFA 3KJPA 2I5HA 4UP8A 4C3HH 1VQ5A 2IY5B 1XMQL 2CCZA 1KC8C 1K73C 3CCEA 1Y1VH 1I50H 2MO1A 1VQEA 3FP9A 1E1TA 3CCLA 1L1OA 5J3BA 3E9IA 3ICEA 3GTJH 3KFUA 3G71A 2VL6A 4X66L 3PO2H 2KCTA 3GDEA 4EQ5A 4JOIA 3U58A 1XNRL 3IRBA 4MTNA 2JJQA 1I3QH 2RF4A 5HY6A 5FLMG 2Y0SE 1VQOA 4JI3Q 4BA1I 2VUMG 2Q2HA 1CKMA 4HIMA 4GOPA 4BY1H 2CFMA 1YEZA 4B3TL 2OCEA 4LF5Q 2QEXA 2E5LL 5M3MG 5C3EH 4DV7Q 3ZJYC 4KHZA 1HR0L 4C2MH 3RLFA 4JI0L 1I5FA 1E1OA 2B29A 3F2CA 3K81C 4Y7NH 4NXML 3PO3G 4QY7A 4DR7L 3PUZA 4JI1Q 1HR0W 3ULJA 2R6GA 3J80i 3TS0A 2GN5A 2WFWA 4LUOA 4R4QA 3G6EA 4IOCA 2VNUD 2K4KA 4UY8C 1E7ZA 2VW9A 1YZ6A 1OTCA 1IXRA 3RN2A 4QJFA 3I4MH 1KAWA 5IE8A 4IFDG 5M3FG 4QQBX 4DR4L 2IX0A 2EXDA 1RL2A 4DV3Q 1IBKL 1VQJA 1EQRA 3H0GH 1BKBA 1G291 1SRUA 2AKWB 2K5HA 2R7FA 3JAMi 4L5SA 4YY3Q 2HQLA 3TQYA 5JEAG 1MJEA 1DGSA 1VQAA 2GVAA 1Z9FA 1XNQQ 4C3IH 5IT9c 4DAYB 1EIFA 1SROA 2GVBA 4OX9L 1C0AA 1VQ7A 2R92H 2JA8G 3F2BA 5AJ3Q 1HJPA 1N32L 4IFDI 2IX1A 1X3GA 3HOZG 1WCMH 4TQUS 3STBC 1OXSC 2YYZA 2CKZB 5JJKA 4HJ5A 2L15A 2VQFL 4GLXA 2Q2UA 4B3ML 1GD7A 2D0PA 1V43A 1IBLQ 1LUZA 1JJCB 2AWNA 1I94L 4LFAQ 2WB1G 4GNXA 4KLKA 1PA6A 2B63H 4A3EG 1H95A 5FLXc 1JJGA 3BZCA 4YWMA 1YI2A 2YTXA 4OXPA 1NTGA 4PZ7A 3PIPA 5GADC 2UUCL 2IHEA 2BH8A 4BY7G 1K83H 4NXNQ 4JI5L 1IBML 3K80C 3RNUA 4DR6L 3GTPH 4X64Q 2WAQE 4A3LG 4LF7Q 2R7ZG 1GVPA 3NELA 3OTOL 2VS1A 2IHFA 3HOXH 2UU9L 4JV5Q 4YCUA 4QL5A 3OYYA 3CCJA 1N33Q 3L2PA 4DV2Q 2VUMH 4BBSG 5IP7G 2BH2A 1VCIA 2Z6KC 4ALPA 4X62Q 1W2BA 2EQSA 3AFQA 4H02A 5M3MH 2JEAI 3ERSX 3I2ZA 3TS2A 4A93H 1A62A 4QGUA 4IPHA 4DV6Q 3PGZA 3ER0A 2HIXA 4R4CA 4X65L 4JYAQ 3PSIA 2UXCQ 2HHHQ 3T1HL 1GO3E 3CCMA 1WJJA 2H5XA 3PUWA 4A3FG 1SN8A 5LMUL 1ASYA 4JI4L 4WJ4A 4DV5Q 1KXLA 1A63A 2OWOA 2YTYA 4DV1L 2N78A 1VQPA 4K0KL 1AE2A 1E22A 3J7ZC 5M5YH 1X6OA 4LF8Q 2NZOA 2N49A 3I4OA 3DLLA 5LMNL 1TWAH 5IP9G 1K8AC 2JA6G 3A0JA 1EFWA 4A3BG 5LMNW 2NVXH 2VZAA 3AEVA 1PYSB 3I4NH 1HNWL 3CCQA 5E7NA 4JI2Q 1N34Q 1HNZL 1JT8A 4JI7Q 3JC66 4LUZA 5C44G 1EYGA 2Z0SA 2BA0A 4DUZQ 4JI8L 4P71A 4DK6C 1E3PA 2E2HH 3GTQH 4B3RL 1FJGL 3TRZA 4A3DG 4KHPQ 2R93H 3S2HH 1EIYB 4XTCS 4DPGA 2ALYB 2KENA 4IPGA 5ELOA 3CC4A 3S24A 3S16H 3E0EA 3U4ZA 3W1BA 1YJ9A 4DV0L 4GNXB 4UPAA 5FJ8G 1Q81C 2ZTCA 3NBHB 3L7ZC 4POGA 4R1JA 2ZM6Q 4BY7H 4OWWB 3CAMA 2MFIA 1BVSA 3UDXA 3J80c 1V9PA 1KL9A 5IWAQ 5IYCH 2VQEQ 2V1CC 1SMXA 2WB1E 3M9BA 4BBRG 4LF9L 2YTVA 1XMOL 1Q12A 4JI6L 4TVAB 1TWFH 4B3SQ 1OXVA 4EX5A 4AIMA 2JQOA 1S72A 1PH3A 2JA5H 3GTKH 3HOUH 4JI7L 5C4XG 3E9HA 1KRTA 1OXTA 1PH5A 1Q82C 2A8VA 4DV4Q 4A3JH 1IZ6A 1N36Q 1TWHH 3RZDH 2UUAQ 3GTLH 3A5ZB 3GO5A 5IYDG 4DAMA 3J81c 1CSPA 1EQQA 2I0QA 1YITA 1HNXL 2F4VL 5IYBG 3I55A 3H3VH 2NVYH 4LNQA 1NJIC 1FL0A 2A1AA 4DR5Q 4L5QA 5GAHC 3HOYG 4LF4Q 5ELNA 4IJLA 2K5NA 4OONA 1QVFA 3CD6A 5C0XJ 3RLOA 4HJ9A 1PH4A 3S1NH 4DR3L 3RR5A 4AQYQ 1VQDA 4GKJL 3KF6B 3HOVG 1V1QA 4DR2Q 3I56A 1UE6A 5IP9H 1N34L 2OTLA 3HKZG 3MXNB 4PMWA 4A3GG 1SFOH 4LFCL 4LFBQ 4P75A 1VQIA 2ASBA 5GAGC 2LXJA 3F2DA 5HGQA 5C44H 2EIFA 1ASZA 3TREA 2Q2IA 3D31A 3D0FA 1XMQQ 4OWTB 3PF5A 4IPDA 2UUBL 1G6PA 3RN5A 2VY3A 1LYLA 3T1YL 1FGUA 2E8GA 4A3KG 1PH8A 4A3CG 4O0AA 2D62A 1TXYA 4RMFA 5BR8L 3W1GA 3AFPA 4A3IG 3A5UA 1X55A 1CKOA 1XNRQ 1C7YA 4AH6A 3NEMA 4R4TA 1YIJA 3DM3A 4B3TQ 2MQHA 2CQOA 1P16A 1P8LA 1WOCA 4R4IA 3L0OA 3W5OA 1X54A 2K5VA 3FKIG 2E5LQ 3KOJA 2UXDL 1QVGA 3ULLA 1HR0Q 4JI0Q 5JJLA 2C35B 4DR7Q 4NXMQ 2BA1A 1WI5A 3BZKA 3KF8B 5GROA 3EN2A 1Y14B 3S1RH 1D7QA 2WP8J 3STBD 1J6QA 4DR4Q 4LUVA 2D0OA 2UXBL
chains in the Genus database with same CATH superfamily
4IZ8A 3FVQA 5CV8A 3NBIA 4IQZA 4DK3C 1LV9A 4IFDJ 4Z9CB 4L63B 1WTHA 2R7DA 3M4PA 4A76A 2L11A 1VQNA 4ZYSA 4CDFC 1PDQA 1SE8A 3SDZA 3PV0A 4LJZC 3S1MB 5FK9C 2PI2A 2B8FA 1PH9A 1ENAA 3S17H 3R8BA 1A0IA 1IYJB 2WKDA 1Q8IA 1VQ9A 3DWQA 4C3JH 3PO2G 2WAQB 1HUNA 5JEAJ 1LTBD 2CWPA 2RDFA 3J81j 3TDQA 1U0LA 4HIDA 4JI5Q 4BY1G 5C6AA 3BS1A 1TKWB 3J80L 3CP0A 3O13A 2I5LX 5GQOA 4BBRB 2N88A 2CVRA 4C56C 3OMGA 3AQQA 3OTOQ 3BG3A 3S1RB 2RSNA 3HEJA 4JBMA 1A3TA 2XRSD 3D6WA 4RCNA 2L4NA 3SK8A 1IHZA 5BN5A 1U4RA 2ENBA 4R9WA 3FHWA 3AYHB 2KJXA 4RGOS 3T1HQ 1AZQA 3H0GG 1EQTA 3H6MA 4CJ2C 4A3LH 2TMPA 3E0JA 3KF8A 5CMDA 3VA7A 2B2UA 1HZCA 4JI1L 1G91A 4K14A 4I65A 2F0MA 4DV1Q 4G7OC 4YWLA 2WV6D 5IP7H 4G57A 5IOCA 4ILWA 1JCKB 1WCMG 5M3FB 3UE1A 1NE3A 3C46A 1F9QA 4A3GB 1O7IA 4PQXA 1AN8A 1HNWQ 4HIOA 4KN7C 2O5JC 4J15A 1IL8A 4RGNA 2I5MX 2RQXA 2E2IB 1NMFA 1K28A 3A8JE 1TWGB 1BNZA 2JA8B 1UNSA 2A6ED 4OO1I 4A3MG 4BXXH 5AJ3L 4C1NI 4K6LA 2F0WA 1PHJA 3AB9A 1EUJA 2KCCA 3A55A 3HOXG 1B8AA 1WVLA 4H0LC 1JOOA 4P74A 3G7LA 1X56A 2F0PA 1QCBD 2DJGC 3CMAA 3S1MH 4NMZA 4JI6Q 4NXNL 3D6CA 2PMZE 1LT4D 4FDBA 4X3SA 3M4OH 1EL0A 1HH2P 5IGCA 5FJ8H 4JV5L 1N33L 1CHQD 4X3TA 1HNXQ 3GTOB 4OO1H 4C1NK 4BBRH 3RLNA 1SYEA 3GTMH 3J81i 4DV6L 3E3XA 1XX8A 1RKNA 1OXUA 4IUNA 1X9NA 1QUQB 3J7A5 1GM5A 1UEBA 1NBWA 1ZKOA 1Y1WH 3MVVA 5FKAC 1B50A 1YBYA 4QUCA 2JA7H 3K5OA 1TVXA 2JSOA 1I6HB 5CORA 2JA6B 3CF5A 3UDFA 5IYBH 5JOBA 1GKHA 3A74A 5IGDA 2B2WA 2HT1A 2HIVA 4QF4A 2NN6I 2UUBQ 3PUXA 5I6WA 4MNOA 1LTLA 4JI2L 2JEBI 4A3DB 4DUZL 1VQFA 5BR8Q 3VDYA 1LACA 2ZJRA 4YCWA 4DU9A 4A3GH 1UEAB 4WJWA 3JAME 3I4MB 5DLQE 4OIKA 3J81E 1EY0A 3PIO3 4A3JG 2ZJQA 1JC7A 1Z47A 5J39A 1KNEA 1M4VA 1SE4A 1B70B 4Q0FA 1VQGA 5C3EG 3T56B 2F0TA 2ZTEA 1QOHA 3KJOA 2UXBQ 4HJ7A 3MAQA 5C0XG 3CQZB 2KBNA 2NVTH 1STEA 4IOAA 1V1PA 3IFDA 2EJFC 2LXKA 1X3PA 3FKIH 3GV6A 1TIID 4JBWA 1X3QA 1MJCA 4DV4L 3MZ5A 3GTGH 1EIGA 3AMUA 3NUCA 5HURA 2XWBB 1M8AA 1F77A 1IL2A 3NK9A 5K36G 1UWVA 4BS9A 2RKSA 2EE1A 1A8VA 2KHJA 2Q2TA 3GTPB 4ZKBB 2RHSB 3W2DA 4AQYL 2ZXOA 1UE1A 3GTOH 4GN3B 2WAQG 2Q8RE 4P73A 1KLUD 3DHQA 3PF4A 3OWFA 2F0DA 4UP8A 1NR4A 1S5CD 1B3AA 2EYFA 1K73C 3CCEA 3U9SA 2MO1A 2PQEA 3K7AB 3GDEA 2EXZA 2WACA 4EQ5A 1PXUA 2RF4A 5HY6A 5FLMG 3LWEA 1LTID 1XXGA 1CKMA 4OIJA 1U4LA 2OCEA 2J7ZA 2QEXA 4FF3A 4WORA 4KHZA 1HR0L 3F2CA 2P5ZX 3K81C 4NXML 1GUTA 4JI1Q 1PLFA 4PMCA 4EGVA 2R6GA 2FJ2A 2WFWA 4R4QA 2BOSA 2VNUD 2VW9A 2QCPX 1OTCA 3I4MH 2Z4IA 1QG7A 5M3FG 3UI2A 2O5IC 1IBKL 2KECA 1EQRA 3HOWB 1SRUA 2AKWB 2R7FA 1PFBA 4L5SA 5E3FA 1MJEA 1LT6D 1Z9FA 5IT9c 4OX9L 2B2YC 1SNPA 3PO3B 4FYDA 2R92H 1H9KA 2Y0SB 4IUVA 4N8FA 5AJ3Q 5CV5A 2JA8G 2EJGC 4TQUS 1OXSC 4HJ5A 2VQFL 3Q22A 1V43A 4EVOA 2M9VA 1BOSA 2JA5B 1H95A 4QUFA 5IGFA 2FINB 1WTRA 1PZID 3R2IA 1PZKD 2BDNA 4PZ7A 3PIP3 4BY7G 3I73A 4NXNQ 2K7VA 3GTPH 2WAQE 4C2MB 5F2DA 4HCSA 3FEWX 2XSCA 2VS1A 3HGBA 5DAUA 4JV5Q 4QL5A 1GHKA 1N33Q 3ITPA 4FXDA 4ALPA 4XQNA 2EQSA 3AFQA 4H02A 5HGTA 1LTAD 2F3WA 4QGUA 4DAVA 4DV6Q 3PGZA 3ER0A 2HIXA 1D1KA 2X69A 2D2CC 3PSIA 4X65L 1GO3E 3MXGA 1EEFD 4UDUC 4C3IB 5LMUL 4JI4L 3X3MA 2KEDA 1JQYD 2UXBL 1LT5D 1FNWA 2EY6A 3QIAA 4KY7A 1HQRD 2SNMA 2JA6G 1R4QB 3AEVA 3X3NA 2A69D 5E7NA 4JI2Q 1JT8A 4HCEA 4DUZQ 4DAYA 4P71A 4DK6C 1E3PA 3TRZA 4A3DG 2RDHA 2R93H 4RH6A 3S2HH 1K83B 4UAIA 2ALYB 3CC4A 3OIPA 1XWEA 3W1BA 3Q24A 1Q81C 2VUMB 3NQTA 4N9PA 5I4DA 4POGA 1B4OA 2F0JA 5JJZA 4OWWB 1BVSA 1ESRA 3M9BA 1C0AA 1EY4A 3OMCA 1Q12A 1MBYA 2JA5H 5C4XG 4RHSA 3QJYA 3HOUH 3E9HA 1KRTA 2F0HA 4DV4Q 1JOQA 1K8MA 3RZDH 4LAAA 5LL6X 1CSPA 1EQQA 4GZYC 1B3QA 3CU7A 1A15A 3A8IE 3QB3A 5C4JB 3H3VH 4CBVA 4L5QA 1CM9A 3HOYG 4IURA 4OONA 3GTQB 5DNFA 4AQYQ 4ABNA 4GKJL 1FD7D 3I56A 1UE6A 1U4MA 2H1EA 2WB1B 4A3EB 1I4PA 4P75A 5C5LA 2LXJA 4HR7B 2KHSA 5C44H 2DY8A 1EYAA 1S4ZA 2Z8LA 4RGMA 1SMYD 1BDOA 4K2KA 1G6PA 1STNA 2VY3A 2DJFC 2EJMA 3QWNA 3E6ZX 1QJOA 2D62A 1TXYA 3W1GA 3AFPA 1SE3A 1TWFB 4I7ZC 3DM3A 2MQHA 2F0LA 3TBIB 1WOCA 3NBHA 4CKCA 5M5XB 1QILA 1HR0Q 1TWHB 5JJLA 4NXMQ 2MPMA 5CR3A 3VR3A 1WI5A 3MXUA 1E0BA 3T16A 2VXWA 4KKUA 2NVYB 5D3DA 1D7QA 3V2TA 1TS4A 1J6QA 3SK5A 2D0OA 1IBKQ 2KUMA 2XWJB 1F9SA 1LABA 3TN2A 2ZXRA 1BR9A 4A3BB 4IFDH 1J9OA 1QVCA 3HOWG 2RSOA 2F03A 1SFOB 4Q5VA 3FPUB 1KQSA 4CJ1B 3ULPA 2DUDA 2EYMA 4CKBA 2B2VC 4OX9Q 3RZOB 4NDXA 2Z6KA 5BN4A 2K50A 1UE5A 2NVQB 1BBXC 4DR1L 1XYIA 2VQFQ 1CKNB 4LF6L 2MP1A 3G4SA 4DUYL 4DF7A 5J22A 3MXNA 4HJ8A 2K52A 1JE4A 1PMRA 3EBEA 2KVMA 5C4JH 5JEAH 4FF4A 4ZUIA 2NZHA 3ERQA 3I7FA 4KI0A 2MNAA 1BUVT 3S14B 3C1FA 1TT2A 4KTAA 4A3EH 2PNHA 1K0SA 4MN3A 3R93A 4NKLA 4O42A 4HTHA 4X65Q 4PG3A 4IUTA 4JK1C 1EYCA 2XTIA 4PNYA 2BCOA 4KY5A 5LMUQ 5CBAE 1MHWC 2LY7A 4JI4Q 1PTOC 4BBSH 1HPCA 5L37A 1SLJA 1H9SA 3QG1A 1DM0B 1CQFA 1EWHA 4JCVE 2F0SA 5M5XH 5T1IA 1KRSA 1DCZA 3CPWA 4DV3L 4X6AH 5EPJA 2B63G 4C3JB 1L1OC 2KOLA 1PH2A 4IN3A 5CYUA 2GA4B 4A3FH 1PFMA 4YY3L 2F52A 4A4IA 3HKSA 3KLWA 3GV3A 1CZGA 1HCZA 1VDZA 1I4HA 2IW3A 3K57A 4GOPC 1PH7A 3WOFA 2E2JH 1HZAA 2A68D 4GN5A 4A3BH 3K58A 4NP5A 1YNNC 1XJVA 4GLAC 2F0EA 4L5RC 1SYFA 3RZOH 2M2LA 2B2TC 1IKLA 1F2LA 2Z9HA 4U673 1PH1A 2NVQH 3HRZC 1Q1BA 1B7YB 3I72A 2CH4W 2YV5A 1JWMD 4LF7L 2ICIA 1S40A 3BVMA 3V96A 3RUZA 3TP5A 3VYSA 1SNMA 5C4HA 4L8JA 4OWXB 3I4NG 1E24A 3S14H 2UXCL 4GKJQ 3NWTA 3URYA 3LX0A 1VQ8A 3S1QH 1XTDA 1Y1VB 3SGIA 1W3SA 2R61A 1D2BA 1VQ4A 4CKEA 4LF8L 3CW2C 4K5WA 4APVA 4KD3A 2K33A 1PTOB 3EIVA 1I3QB 1GUGA 4M1UB 3P7JA 3KDFB 2IX3A 3J80E 3VA5A 3MXPA 3TSSA 4DNRB 5JVH3 2RDGA 4A3MH 1N34L 1WYDA 1FVIA 3H15A 3PQIA 1O7LA 4KHPL 1G2SA 4KD4A 1L1OB 4XQQA 3J7AV 1BBWA 4LK1C 3VR4A 5IODA 1XPOA 1EOVA 3EVQA 3M4OB 2NBFA 2ES2A 4GOPB 3BDLA 1VQLA 3RMHA 1E2VA 1YJWA 1F9PA 1AE3A 1DYQA 4ME3A 4XDXA 1G51A 1VQMA 1F9RA 2JP1A 2EYJA 3SXHA 3GTMB 4IUQA 1TWCH 2VQEL 1WTOA 4EQPA 4A3IH 5GAEC 1D8LA 4FXKC 4G4KA 4B3SL 1YHQA 3ND8A 3HP3A 1CI3M 1Q8KA 3SE0A 1Y1WB 4IO9A 2JA7B 2UUAL 1L0XB 2OQKA 1VMCA 1MKHA 4GS3A 1D5ZC 1IKMA 3PUVA 4DR1Q 1QUQA 2O2LD 1CA6A 4LF6Q 3CKIB 3FPPA 4DUYQ 2F0VA 4DR2L 1I4QA 3HKZB 3OWEB 1S5BD 1I4XA 2NUCA 5C0XI 1S3OA 1RHPA 4A93B 4C3HH 2CCZA 1Y1VH 1I50H 5C3WA 1PYWD 2NZ1D 1E1TA 3ICEA 2PW5A 3G71A 4X66L 2KCTA 3U58A 4MTNA 1PTOH 3H09A 1I3QH 1VQOA 1EZ6A 2NVTB 1IYUA 4HIMA 1BCPC 3FKIB 2E5LL 5M3MG 5C3EH 2F0FA 4WRDA 3GTGB 3RLFA 1I5FA 1Y8OB 3I3CA 4Y7NH 2NWGA 4QY7A 1HR0W 2H4OA 3BZDB 3G6EA 4IOCA 2K1BA 3GQBA 1E7ZA 3ZYYX 4QJFA 1V8QA 4QQBX 1A2UA 4DV3Q 3L3OC 1VQJA 3EJIA 4C3JG 3JAMi 5KYIA 2QEJC 4YY3Q 1JR0D 1RD9D 2EYHA 1DGSA 1VQAA 4KV6A 2Q8IB 2SOBA 2OXPA 5BN3A 3STBC 3QOLA 1QNUA 4B3ML 4V0BA 1GD7A 2SDFA 3SK4A 4HEDA 1I94L 1JJGA 1YI2A 2YTXA 1NTGA 3GTLB 1D5XC 5GADC 1IBML 3RNUA 1VF7A 2IJ0A 2K04A 1JORA 4A3LG 4LF7Q 3FRPB 3NELA 4R8IA 4AYBB 2IHFA 2UU9L 1S5FD 5ISRA 1EZ8A 3EQLC 2A6HC 2F0GA 3T51B 5IP7G 1ET9A 1A3UA 1W2BA 1HRJA 3SR1A 1A2TA 2A73B 4A93H 4IPHA 4EQNA 4ZQ3A 2UXCQ 2MGSA 1PTOF 3HG9A 1UUPA 1WJJA 2H5XA 1MD2D 1ASYA 1BCPB 1KXLA 1A63A 2OWOA 2R92B 4FXGC 1ICWA 2F0QA 2YTYA 1O78A 2N78A 3F2UA 1FR3A 2NN6H 5FOBB 1VQPA 4K0KL 5M5YH 4LF8Q 2NZOA 4RAUC 1DXMA 3I4OA 1HFNA 3DLLA 1GUSA 5LMNL 1TWAH 5IP9G 3A0JA 2NVXH 2VZAA 3D8GA 3I70A 3CCQA 1N34Q 1B9NA 1SSOA 3JC66 3P20A 4DN4M 1PRTC 2E2HH 4KHPQ 1FJGL 1EIYB 1ONLA 1ENFA 3MEHA 4DPGA 3OPOA 4X3KA 4RA8A 1YJ9A 4DV0L 4UPAA 5FJ8G 3H3VC 1LTGD 4BY7H 2RVLA 1EIHA 1B1ZA 1EU4A 5IYCH 2VQEQ 4LF9L 4BBRG 2L5TA 1B2TA 1FYCA 4DA2A 2F0IA 4TVAB 4B3SQ 4EX5A 3DEOA 4AIMA 5IGGA 1IZ6A 5FO7B 4CDDC 2UUAQ 3GTLH 5IYDG 4DAMA 3J81c 5KYLA 1YITA 2JXMB 2F4VL 5IYBG 3I55A 5IT9L 3ONAB 2E76C 2K5NA 5C0XJ 4DR3L 2R93B 4JVZA 3KF6B 4PMBA 1SBBB 3S2HB 4DR2Q 3VR6A 3HKZG 1EU3A 4A3GG 2EPBA 2NB0A 4LFCL 2CW0C 1VQIA 5GAGC 3F2DA 3A54A 3D4WA 5HGQA 2KEEA 1BCPD 2EIFA 1WTVA 3D31A 3D0FA 4B9WA 1DJRD 1SDFA 1Y69U 3D4RA 3RN5A 1SNCA 1FGUA 2LS01 2R7ZB 4O0AA 4L6TB 4KY6A 4RMFA 3J7YW 3A5UA 1KNAA 1CKOA 4B9XA 2L12A 4AH6A 5I2YA 3NEMA 1PRTB 1TS5A 2B2YA 3HOUB 4R4IA 2E5LQ 3OW7A 3W5OA 1X54A 2K5VA 3FKIG 1QVGA 3FDTA 3RZDB 1JB3A 5KIXA 2F0KA 1Y14B 2WP8J 3STBD 2PZTA 1KTKA 2KQ3A 4EQOA 1WTWA 1U9RA 1CT1D 2PQAB 3KBGA 4DNIA 4KJNA 4BA2I 2AHOB 2K14A 2G5DA 1I6VC 4UP9A 4YHHL 5H1SE 5C44B 1XPRA 5M5WH 4QB4A 1TR5A 1HFGA 4RHRA 3K5NA 1SAPA 4B3MQ 2RCNA 3KLSA 5ELCA 2ATWA 1I94Q 3HS0C 2CWAA 3KUPA 1YJNA 1RF2D 2CH4A 4V190 5E1FA 3R3OA 1RTNA 4M8AA 1IBMQ 1J5EL 2ZXPA 3TZDA 5I9OA 3HOZH 3HKZE 2D9UA 5C5MA 3QR8A 1SR3A 4F87A 2UU9Q 1YVCA 4RGTA 4AYBG 2A19A 2TSSA 2JK8A 4PZ6A 1BCPF 2L9HA 3MWYW 5DM73 2PW7A 3I4MG 1NR2A 1BBUA 4TRDA 4JI3L 1FGBD 4MZ9A 3F8TA 1HQMC 5J1ZA 2JA9A 3NE5B 3S2DH 1LTTD 2B39A 4DV7L 2R7ZH 2K5DA 3U4VA 1PRTD 3G6JB 1M90C 4NW2A 4DXGA 3KYHC 1YNXA 4R4OA 1JWSD 4K0KQ 1XPUA 4CDEC 4IJHA 5LMNQ 4JBJA 2WKCA 4POFA 1RODA 5FLXE 1N8RC 4J8QA 2KCMA 3PMFA 3D3RA 4G7ZC 2XRQD 3FMCA 1DOKA 5KGUA 1FJGQ 4JOIC 1PH6A 4P72A 3C3LA 4A3KB 2DGYA 3EA6A 2F4IA 1CKNA 3Q8DA 4DV0Q 4DK0A 1UE7A 5E4XA 2L1BA 2SNSA 2E2DC 5D65A 2DY7A 1GJXA 4LF9Q 1LT3D 4DAPA 3UE0A 1X65A 2ZT9C 2C9OA 3V05A 2MO0A 4X64L 5ELFA 4MHEA 1QZHA 1JMCA 3HFZB 3A7AB 1PFNA 4HMIA 4BBSB 1STHA 3L9AX 4DV2L 5CV6A 2CW0D 1HUMA 4X62L 3C1EA 4AYBE 2F0OA 2F4VQ 1HTPA 4GN4B 5FO8B 2K05A 4XIGS 4GNXC 2HHHL 5EKIA 4DR3Q 4A3FB 4JBKA 4JPBW 1AEXA 2R93G 2KHIA 4E6IA 1LO5D 4DV5L 3BVZA 4KK7A 4LFCQ 2E2JB 3SEBA 1AP0A 4JC0A 1KD1C 1PRTF 4K2LA 1KIXA 5IY0A 3WWVA 3OOCA 4FNFA 5I2XA 1L0WA 3CXCA 3OW2A 3PO3G 2LSSA 2Y0SG 3MEFA 3HOVH 2F3VA 4UP7A 1KHIA 2OT2A 5AFWA 1YHBA 3TZUA 1KABA 4O1NA 2QKIC 2B2VA 5KNDA 2LKVA 5A35A 1LTSD 2JA5G 3S15H 3HOUG 4XYOA 3LGJA 1Q3LA 4WJ3M 3CHBD 3M3YH 1VQCA 2ZM6L 5EAYA 4I7AA 2HQEA 3H0GB 4A3KH 4A3CH 1RJTA 4KJOA 1D6EC 3M4QA 1JB7A 1GUWA 5JVG3 1DOMA 1VF5C 1MSGA 1HZ9A 1EY5A 3PUYA 1X3EA 3S9WA 3NHHA 3S1QB 5EKKA 1MIUA 1UAPA 2M00A 3CMEA 5ELEA 2B3GA 1N36L 4YHHQ 2AUJD 3MFGA 5EKLA 4Y52H 4OHJA 2RBMA 4PZ8A 4DR5L 4C3IG 4A3MB 4LF4L 2QA4A 1EWIA 1FNVA 3UDIA 4HJAA 2K5WA 1NY4A 1ZYRC 3WDNA 2N3SA 1VQBA 3N6RA 2D5DA 3K0YA 1F2ZA 4O2DA 1G6ZA 3M4YA 1LM0A 1QE6A 1J5EQ 4YWKA 3KDFA 4BWGB 1CTMA 3KJPA 2I5HA 2K01A 1VQ5A 1XMQL 2A5HA 1KC8C 2L55A 4H44C 1VQEA 1AW7A 1I4GA 4ID6A 1L1OA 4J6HA 1TWCB 3N52A 3GTJH 4K5XA 4A3IB 4FO2A 1RTOA 1C48A 2FMCA 3PO2H 1XNRL 2JJQA 1GUOA 1J8IA 2Y0SE 4JI3Q 2VUMG 4GOPA 4BY1H 2CFMA 5JPNC 4DV7Q 2J4XA 3ZJYC 4IFDG 4JI0L 1E1OA 2B29A 4DR7L 2PO4A 5IGEA 3ULJA 3J80i 2KA7A 4LUOA 2FFKB 2B2TA 5EPLA 1YZ6A 1IXRA 3E5SA 3OIQA 1KAWA 2L0CA 1ILQA 1C4QA 2EXDA 2RA4A 3T13A 3A8KE 3QO2A 1XTCD 3H0GH 1BKBA 1CA5A 2HQLA 5JEAG 5CV4A 2HCCA 3K59A 5EQ0A 1SROA 2GVBA 4KMUC 5EPKA 1D5MC 1EOTA 1NNXA 1HJPA 1N32L 2IX1A 3J7AF 1WCMH 4C3HB 3Q6SA 5JJKA 2L15A 4GLXA 1I50B 1VMPA 1JJCB 1TY2A 2DNEA 1V1OA 2WB1G 4A3EG 3BZCA 4A3JB 1GHJA 4U68A 4DK1A 4OXPA 5DM63 2CQAA 2UUCL 2IHEA 2BH8A 4DR6L 5A2QL 2QILA 3K80C 5C3EB 1S5ED 1X32A 1ET6A 4X64Q 3VR2A 4MIUA 4Y7NB 1GVPA 1GUNA 3P75A 3HOXH 4N9TA 1OO9B 4RKBA 3OYYA 3CCJA 4BBSG 4DV2Q 1TQOA 3I4LA 2BH2A 1CHPD 4X62Q 5M3MH 2WIIB 2K03A 3ERSX 3I2ZA 4K8JA 2PPBC 3WOEA 1EY6A 2HHHQ 1CZWA 1SYBA 3CCMA 5KEEA 1EY7A 3VR5A 3PUWA 1CK1A 4A3FG 1EY8A 4N8X1 4WJ4A 3MA2B 4DV5Q 4F8MA 5G3LD 3J7ZC 1X6OA 4CHTB 1DONA 4QIWB 1BO0A 5KNBA 1Z6HA 5CBEE 4A3BG 5LMNW 4TKOB 1PYSB 4ZUJA 1HNZL 2Z0SA 2BA0A 4G7HC 4JI8L 4B3RL 3BDCA 4CJ0B 1O7YA 5ELOA 1DZ1A 3E0EA 3U4ZA 4FF1A 2B2UC 2I46A 1EWCA 3NTKA 3L7ZC 4R1JA 2ZM6Q 2K32A 2VB3X 3CAMA 2MHVA 3UDXA 1MSHA 3J80c 1V9PA 1KL9A 5D3IB 4KKTA 1ZXTA 2V1CC 2WB1E 4KHVA 4ME5A 2YTVA 1XMOL 1OXVA 1PTOD 2JQOA 1S72A 1PH3A 3KLSX 3ND9A 4WFN3 1PH5A 1ZYRD 3BVGA 2A8VA 4A3JH 1N36Q 5M5YB 3GO5A 2I0QA 2EY1A 1TWAB 2AQ2B 3VYTA 1TY0A 2NVXB 1NJIC 1FL0A 2A1AA 4DR5Q 3H91A 5GAHC 4LF4Q 4IJLA 1QVFA 3S1NH 5C0XH 1PH4A 2E2HB 1VQDA 1F2YA 5IP9H 1Y8NB 2HD3A 1YNND 5LHY1 1WTPA 3MFYA 4XT1B 2QDLA 1XMQQ 3GTKB 5K36H 4BY7B 4OWTB 4IPDA 4UHVA 5G3LF 3T1YL 4ZRZA 2J0TD 4H7BA 5IIFA 4ZK9B 4A3IG 1XNRQ 1X55A 1HA6A 5FO9B 4OL7A 1C7YA 5T1GA 3EROA 4R4TA 1JOKA 2AUKA 1YIJA 2I07B 1JICA 1E2ZA 2CQOA 1WD0A 1P8LA 5ELDA 2UXDL 3KOJA 3ULLA 4JI0Q 4DR7Q 3DM1A 3NTHA 4HSPA 3BZKA 3K6OA 1T5EA 3KF8B 5EGTA 1NUCA 1D1IA 3EN2A 3S1RH 2K5QA 1K8OA 2B2WC 3DUZA 5C3XA 5FLMH 3TS2A 4RFBA 1K8GA 2EY5A 3M85A 5IYDH 3TP7A 4X3UA 2N8NA 4HIKA 1L2FA 1CSQA 3NP8A 1H9MA 2AWOA 2AMCB 1N9WA 3CRKC 1SNDA 3SHLA 4GKKL 4H13C 1N32Q 3EFXD 1FNUA 4HAEA 4C3HG 2AQ3B 2AQ1B 1STAA 3SVMA 5M3FH 1SE2A 3KF6A 1Y1VG 3NENA 2HDMA 4BXXG 1DD2A 3GD7A 3IKJA 4OGQC 3Q23A 4F7XA 2OTJA 2E2IH 2UUCQ 1DOLA 2A69C 2IWHA 4DR6Q 1TWGH 2JA8H 3CCUA 2QGQA 5TSSA 3DWPA 1QZGA 1PZJD 2PNRC 1H9JA 3TEHB 2YU9B 1VQKA 5C4XB 3DXJC 2JYOA 3MTSA 3CC2A 1WFQA 2F0NA 2XN9C 1CUKA 3JAML 1ICFB 2RCFA 3DMUA 3J81L 1C9OA 4RG1A 4LF5L 5IT9E 1NAPA 4OO1G 1QNKA 4IPCA 1SYDA 3LNNA 2QW7A 3HOYB 2X6GA 4PV1C 4ULLA 5M5WB 1I4RA 2Q8TA 3I91A 3CCRA 1LLRD 1IW7C 2E74C 5DEHA 3BJUA 1YNJC 2PQAA 3JAMc 2DNCA 1Y1WG 4DNTB 3W3AA 2JA7G 1HNZQ 4B3RQ 1K3BC 4LWCA 4JI8Q 4LW1A 1HXYD 1XNQL 2XGTA 2Z6BA 3HOZB 4RKLA 2JE6I 3CC7A 2C5CA 3CCVA 1EFID 4ZCKA 5M9OA 2FXQA 4J1MA 1I6HH 3K0XA 1QB5D 4DFAA 2JA6H 4NB3A 1VQHA 1IBLL 1PFSA 1K0RA 1K3RA 2BE5C 2F1MA 4LFAL 1Q7YC 5CV9A 3K7UC 2PZWA 1JWUD 1W6KA 4A3DH 1SMYC 3MC0B 4A93G 1XMOQ 4A75A 1U5KA 2B8GA 5D14A 5I6YA 3S2DB 1M1KC 4L5TA 1STGA 1PVOA 2KCNA 1RIPA 1JE5A 1Y8PB 4X66Q 3KK7A 3IL8A 1X3FA 1B53A 3RD4A 1K9MC 1V1PB 4K6DA 1KDAA 4DKAC 4XQJA 1R9TB 4HMJA 1Q1EA 2EY2A 2NN6G 3K5LA 2R3ZA 1RDPD 4IALA 5JJIA 5CV7A 1Q46A 3TP6A 2ZJPA 4JYAL 1HZBA 2YU9H 1IYVA 1KDBA 5C4XH 4KKSA 3CQZH 4JG2A 1VQ6A 4HSVA 2XIWA 2IT1A 3P1HA 4IUPA 2QF7A 1PV4A 1MGSA 4K8IA 1JJ2A 5NUCA 3QOJA 3C2PA 3F1ZA 1AZPA 3CCSA 3CPFA 3HOYH 2F3IA 4S3SA 2FMMA 3T1YQ 2ZTDA 4QIWE 3UDGA 4JI7L 1MI2A 1HA5A 3IAYA 1OXXK 3OHXC 5IYCG 1LTRD 3BU2A 1KAAA 2NTTA 2A6HD 1VS0A 4NPSA 3M7NA 2HDLA 3TMEA 3B6YA 1Q86C 3KLRA 3PCOB 2UXDQ 3PIOA 1O7ZA 2EDGA 3KBXA 4CGYB 5E4WC 1SNQA 3NQIA 2MJ8A 2X6LA 3I90A 1CQVA 1B44D 1NMGA 4GLVB 5IWAL 1HHVA 1PYBA 3K7AH 5K5PA 5KNCA 1YHAA 3G48A 4TSSA 2K28A 4ZLTF 1AH9A 2RHQB 1O80A 3H94A 2PZUA 2B63B 3K8AA 4GKKQ 3VYUA 4MTKA 2ID0A 2K75A 1Z7TA 1G2TA 1EY9A 4YCVA 2E75C 2R92G 1R9TH 1W6JA 3HOVB 3DEPA 1WD1A 3H3VI 4RCOA 1WTXA 1T9HA 4ZKCB 2OQ0A 3HOWH 1NSNS 1EQVA 1II3A 3BDOA 2PI2E 2EYPA 4LFBL 3S15B 3A56A 3U50C 3R2TA 3PO3H 2K6AA 2FHTA 3M3YB 2IY5B 5I9PA 1STYA 5LL6S 1TS2A 1F2MA 3FP9A 3HZXA 3CCLA 4IUUA 2A68C 3E9IA 5J3BA 3NPPA 3KFUA 2VL6A 4CDCC 5EJWA 2F0UA 4JOIA 3IRBA 1QWYA 1B9MA 4BA1I 1IW7D 2Q2HA 1SJED 1YNJD 1R4PB 3AU7A 1YEZA 4B3TL 4LF5Q 2JN4A 4C2MH 4XYQA 3I4NB 3PUZA 1WTQA 3TS0A 4XT3B 2GN5A 2K4KA 4UY8C 1T5XD 3RN2A 1SEBD 5IE8A 4DR4L 4P2CB 2IX0A 4DGZA 1RL2A 3S16B 5FLXL 2BE5D 2LMCB 2OF1A 3BYYB 1G291 2K5HA 3Q0AA 3TQYA 1XNQQ 2GVAA 4C3IH 4DAYB 1EIFA 4B08A 2EYLA 1VQ7A 3F2BA 1Q90A 4IFDI 3HOZG 1X3GA 2YYZA 2CKZB 4YIJA 2Q2UA 2D0PA 3BYTB 1IBLQ 2BDOA 1LUZA 1NCVA 2N55A 2AWNA 4LFAQ 3LWUA 2DN8A 4GNXA 4KLKA 2EZVA 1PA6A 3GTJB 1H9RA 4JW0A 5FLXc 4FVMA 2B63H 2PMZB 1SJHD 3PO2B 4YWMA 3IFTA 5EBCA 2XVSA 1ENCA 3PIPA 4BY1B 1K83H 4KN4C 4JI5L 1SYCA 1GXDC 1A6XA 3VYRA 4F88A 2R7ZG 2IL8A 3OTOL 4YCUA 5JAVA 2QDBA 1SXTA 3U9OA 2VUMH 3L2PA 2HUGA 1VCIA 2Z6KC 2HCIA 1BF4A 2JEAI 4XXEA 4FF2A 1A62A 2MUYA 4QCLA 4R4CA 4JYAQ 3T1HL 3M7GA 2EOTA 4ZAIA 5EBDA 1ML0D 1SN8A 4DV1L 1AE2A 1E22A 1WCMB 2N49A 4RWSC 1CFMA 1HTLD 3GP7A 1K8AC 1EFWA 2WINB 1STBA 2V4DA 3I4NH 3K5MA 1HNWL 4JI7Q 4LUZA 5C44G 1EYGA 3GTQH 1EYDA 2G9DA 3T4AC 4XTCS 1C8CA 2KENA 4IPGA 3S24A 5CGKA 3NXWA 1RCVD 3S16H 5COYA 3OSOA 2VB2X 2CHBD 2IPKD 2Z1CA 4GNXB 3HOXB 3SK6A 2ZTCA 1EEID 3NBHB 1BXTA 1S5DD 5M3MB 2MFIA 2SEBD 3NTIA 5IWAQ 1KLGD 1GOZA 1SMXA 1ZEQX 4DXFA 1SNOA 2A6EC 4JI6L 1TWFH 2PCFB 1SYGA 3GTKH 4QMGA 4OEMB 1BQQT 1OXTA 1Q82C 2NYZD 3S17B 1TWHH 3A5ZB 5KRUA 2ICEC 1HNXL 4R8NA 4HN7A 2G9HD 3NWSA 2NVYH 4LNQA 5ELNA 1ESFA 1TU2B 5ELBA 3CD6A 2Z4HA 3RLOA 4HJ9A 3RR5A 3D4DA 3HOVG 1V1QA 2EYOA 4LMQD 1G8ZD 2OTLA 2O4XA 3MXNB 1ILPA 4PMWA 1SFOH 4LFBQ 2ASBA 4ODGA 2A74C 3CRLC 1ASZA 3TREA 2Q2IA 3DWAA 5A2QE 4FP5D 2UUBL 3PF5A 1LYLA 4A3CG 2E8GA 4A3KG 1PH8A 5CC4A 5IGBA 1TS3A 5BR8L 2NTSA 4K5VA 3TP8A 2PYKA 3I8ZA 1E2WA 4B3TQ 5C4ZA 1U4PA 2EVBA 1P16A 3L0OA 2C35B 2BA1A 3T53B 1AFPA 5GROA 1A3VA 3NSWA 3MHBA 4OELB 3A7LA 2LFNA 4DR4Q 2OEOA 2XNAC 4LUVA 3S1NB 5JPMC 1KDCA 1H9SB 1L0YB
chains in the Genus database with same CATH topology
1K8GA 1IBKQ 3M85A 5IYDH 2PQAB 4DK3C 4DNIA 2N8NA 4HIKA 4IFDJ 1L2FA 1CSQA 1QVCA 4BA2I 3HOWG 2AHOB 2K14A 2AWOA 2R7DA 4UP9A 4YHHL 3ULPA 1KQSA 2AMCB 1N9WA 2DUDA 3M4PA 5H1SE 4OX9Q 4GKKL 4A76A 1XPRA 1VQNA 5M5WH 1N32Q 2Z6KA 2K50A 1UE5A 1SE8A 3PV0A 4DR1L 2RCNA 2VQFQ 4B3MQ 2PI2A 1CKNB 5M3FH 1PH9A 2ATWA 3KF6A 3S17H 1Y1VG 3NENA 1I94Q 4BXXG 4LF6L 3G4SA 1A0IA 1IYJB 3GD7A 4DUYL 2CWAA 1YJNA 4HJ8A 1VQ9A 2K52A 4C3JH 2OTJA 3PO2G 3EBEA 5JEAJ 5C4JH 2E2IH 2CWPA 3J81j 2UUCQ 4DR6Q 1U0LA 4HIDA 4JI5Q 1TWGH 1IBMQ 1J5EL 4BY1G 2JA8H 3CCUA 2NZHA 2QGQA 3CP0A 3HKZE 3HOZH 2I5LX 5GQOA 1QZGA 3I7FA 1SR3A 3AQQA 4KI0A 2MNAA 3OTOQ 2UU9Q 1YVCA 4AYBG 2A19A 3TEHB 1VQKA 4A3EH 2JK8A 2PNHA 4PZ6A 3CC2A 4JBMA 1WFQA 1CUKA 3I4MG 1BBUA 4JI3L 1C9OA 3FHWA 4MZ9A 3F8TA 4PG3A 3AYHB 4X65Q 2JA9A 4RG1A 3T1HQ 4LF5L 2XTIA 3S2DH 4OO1G 3H0GG 4DV7L 4A3LH 4IPCA 2R7ZH 3U4VA 5LMUQ 4JI4Q 1HZCA 1M90C 3KYHC 1YNXA 4JI1L 4R4OA 4DV1Q 4YWLA 1XPUA 4BBSH 4K0KQ 5IP7H 1WCMG 4IJHA 1SLJA 5LMNQ 4JBJA 3UE1A 1NE3A 4POFA 3CCRA 4JCVE 5M5XH 1N8RC 1O7IA 2KCMA 3JAMc 3BJUA 2PQAA 1Y1WG 1KRSA 3CPWA 1HNWQ 4DV3L 4HIOA 2JA7G 4X6AH 2B63G 4J15A 1PH2A 1L1OC 1HNZQ 4B3RQ 4JI8Q 2I5MX 4LWCA 1NMFA 4LW1A 4A3FH 1FJGQ 4JOIC 4YY3L 1XNQL 2F52A 2XGTA 1PH6A 4A4IA 3HKSA 4P72A 3KLWA 4OO1I 4GOPC 2DGYA 2JE6I 3CC7A 4A3MG 5FLMH 5AJ3L 1PH7A 4BXXH 1CKNA 3Q8DA 3CCVA 2E2JH 1HZAA 2FXQA 4DV0Q 1I6HH 1PHJA 4GN5A 3K0XA 1EUJA 1UE7A 4NB3A 2JA6H 4A3BH 1VQHA 3HOXG 1IBLL 1PFSA 1B8AA 1K0RA 1K3RA 1XJVA 4GLAC 4LFAL 1Q7YC 4L5RC 3RZOH 3K7UC 4P74A 1X56A 1PH1A 4LF9Q 4A3DH 4JI2L 4A93G 2NVQH 1XMOQ 3CMAA 3S1MH 3UE0A 1X65A 4A75A 1U5KA 4JI6Q 4NXNL 1M1KC 1Q1BA 2PMZE 4L5TA 1B7YB 1PVOA 2MO0A 4X64L 1RIPA 2YV5A 1JE5A 4FDBA 4X66Q 4LF7L 3M4OH 1QZHA 1HH2P 5FJ8H 1JMCA 1X3FA 3HFZB 1S40A 1K9MC 4DKAC 4JV5L 1N33L 1Q1EA 2NN6G 4DV2L 1HNXQ 4X62L 4AYBE 2F4VQ 4BBRH 3RLNA 5JJIA 1Q46A 3GTMH 4GN4B 3J81i 2ZJPA 4OWXB 4DV6L 3I4NG 4XIGS 1E24A 1OXUA 4GNXC 3S14H 4JYAL 2UXCL 2HHHL 1X9NA 1HZBA 2YU9H 1QUQB 3J7A5 4DR3Q 1GM5A 4GKJQ 1UEBA 5C4XH 4JBKA 1NBWA 3CQZH 4JG2A 1VQ8A 3S1QH 2KHIA 2R93G 1VQ6A 1XTDA 4DV5L 3SGIA 1W3SA 2IT1A 1Y1WH 1PV4A 4LFCQ 1YBYA 2JA7H 1VQ4A 4LF8L 3CW2C 4JC0A 4APVA 1KD1C 3CF5A 1JJ2A 3UDFA 5IYBH 3EIVA 1GKHA 3A74A 3F1ZA 1KIXA 2HT1A 2HIVA 5IY0A 3KDFB 2NN6I 3WWVA 3CPFA 3CCSA 2UUBQ 3HOYH 2F3IA 3PUXA 4MNOA 1L0WA 1LTLA 3CXCA 3OW2A 3T1YQ 4A3MH 2ZTDA 2LSSA 1WYDA 1FVIA 4QIWE 2JEBI 2Y0SG 3H15A 3MEFA 4DUZL 3UDGA 4UP7A 1VQFA 3HOVH 5BR8Q 3VDYA 4KHPL 1KHIA 1OXXK 5IYCG 2ZJRA 1L1OB 4YCWA 1YHBA 1BBWA 4A3GH 3BU2A 1VS0A 4NPSA 1EOVA 1XPOA 3M7NA 2JA5G 3S15H 2ES2A 3B6YA 3HOUG 3LGJA 1Q86C 3PCOB 2UXDQ 5DLQE 4GOPB 3PIOA 1VQLA 4A3JG 4WJ3M 2ZJQA 1YJWA 3M3YH 1VQCA 1Z47A 5EAYA 4ME3A 1AE3A 2ZM6L 1VQMA 4A3CH 1G51A 4A3KH 1B70B 5C3EG 1VQGA 3M4QA 4GLVB 1NMGA 1JB7A 2ZTEA 5IWAL 1TWCH 2VQEL 3KJOA 4A3IH 1PYBA 3K7AH 5GAEC 1HZ9A 1YHAA 2UXBQ 1D8LA 3G48A 3PUYA 4HJ7A 4B3SL 1X3EA 5C0XG 1YHQA 2KBNA 2NVTH 4IOAA 2LXKA 3FKIH 1Q8KA 1MIUA 1AH9A 2RHQB 4JBWA 4DV4L 1MJCA 3CMEA 4IO9A 2B3GA 3GTGH 1N36L 4YHHQ 2UUAL 3K8AA 2OQKA 4GKKQ 4Y52H 1MKHA 4GS3A 2ID0A 2K75A 3PUVA 4PZ8A 4DR1Q 4DR5L 1QUQA 1IL2A 5K36G 1UWVA 4YCVA 2KHJA 1A8VA 2QA4A 1EWIA 4LF4L 3UDIA 2Q2TA 2R92G 1R9TH 2RHSB 4LF6Q 4DUYQ 4HJAA 4AQYL 3H3VI 1NY4A 1UE1A 2N3SA 4DR2L 1T9HA 1VQBA 4GN3B 3GTOH 2OQ0A 3HOWH 2WAQG 4O2DA 5C0XI 4P73A 2PI2E 4LFBL 1LM0A 1S3OA 1J5EQ 3U50C 3PF4A 4YWKA 3PO3H 3KDFA 3KJPA 2I5HA 4UP8A 4C3HH 1VQ5A 2IY5B 1XMQL 2CCZA 1KC8C 1K73C 3CCEA 1Y1VH 1I50H 2MO1A 1VQEA 3FP9A 1E1TA 3CCLA 1L1OA 5J3BA 3E9IA 3ICEA 3GTJH 3KFUA 3G71A 2VL6A 4X66L 3PO2H 2KCTA 3GDEA 4EQ5A 4JOIA 3U58A 1XNRL 3IRBA 4MTNA 2JJQA 1I3QH 2RF4A 5HY6A 5FLMG 2Y0SE 1VQOA 4JI3Q 4BA1I 2VUMG 2Q2HA 1CKMA 4HIMA 4GOPA 4BY1H 2CFMA 1YEZA 4B3TL 2OCEA 4LF5Q 2QEXA 2E5LL 5M3MG 5C3EH 4DV7Q 3ZJYC 4KHZA 1HR0L 4C2MH 3RLFA 4JI0L 1I5FA 1E1OA 2B29A 3F2CA 3K81C 4Y7NH 4NXML 3PO3G 4QY7A 4DR7L 3PUZA 4JI1Q 1HR0W 3ULJA 2R6GA 3J80i 3TS0A 2GN5A 2WFWA 4LUOA 4R4QA 3G6EA 4IOCA 2VNUD 2K4KA 4UY8C 1E7ZA 2VW9A 1YZ6A 1OTCA 1IXRA 3RN2A 4QJFA 3I4MH 1KAWA 5IE8A 4IFDG 5M3FG 4QQBX 4DR4L 2IX0A 2EXDA 1RL2A 4DV3Q 1IBKL 1VQJA 1EQRA 3H0GH 1BKBA 1G291 1SRUA 2AKWB 2K5HA 2R7FA 3JAMi 4L5SA 4YY3Q 2HQLA 3TQYA 5JEAG 1MJEA 1DGSA 1VQAA 2GVAA 1Z9FA 1XNQQ 4C3IH 5IT9c 4DAYB 1EIFA 1SROA 2GVBA 4OX9L 1C0AA 1VQ7A 2R92H 2JA8G 3F2BA 5AJ3Q 1HJPA 1N32L 4IFDI 2IX1A 1X3GA 3HOZG 1WCMH 4TQUS 3STBC 1OXSC 2YYZA 2CKZB 5JJKA 4HJ5A 2L15A 2VQFL 4GLXA 2Q2UA 4B3ML 1GD7A 2D0PA 1V43A 1IBLQ 1LUZA 1JJCB 2AWNA 1I94L 4LFAQ 2WB1G 4GNXA 4KLKA 1PA6A 2B63H 4A3EG 1H95A 5FLXc 1JJGA 3BZCA 4YWMA 1YI2A 2YTXA 4OXPA 1NTGA 4PZ7A 3PIPA 5GADC 2UUCL 2IHEA 2BH8A 4BY7G 1K83H 4NXNQ 4JI5L 1IBML 3K80C 3RNUA 4DR6L 3GTPH 4X64Q 2WAQE 4A3LG 4LF7Q 2R7ZG 1GVPA 3NELA 3OTOL 2VS1A 2IHFA 3HOXH 2UU9L 4JV5Q 4YCUA 4QL5A 3OYYA 3CCJA 1N33Q 3L2PA 4DV2Q 2VUMH 4BBSG 5IP7G 2BH2A 1VCIA 2Z6KC 4ALPA 4X62Q 1W2BA 2EQSA 3AFQA 4H02A 5M3MH 2JEAI 3ERSX 3I2ZA 3TS2A 4A93H 1A62A 4QGUA 4IPHA 4DV6Q 3PGZA 3ER0A 2HIXA 4R4CA 4X65L 4JYAQ 3PSIA 2UXCQ 2HHHQ 3T1HL 1GO3E 3CCMA 1WJJA 2H5XA 3PUWA 4A3FG 1SN8A 5LMUL 1ASYA 4JI4L 4WJ4A 4DV5Q 1KXLA 1A63A 2OWOA 2YTYA 4DV1L 2N78A 1VQPA 4K0KL 1AE2A 1E22A 3J7ZC 5M5YH 1X6OA 4LF8Q 2NZOA 2N49A 3I4OA 3DLLA 5LMNL 1TWAH 5IP9G 1K8AC 2JA6G 3A0JA 1EFWA 4A3BG 5LMNW 2NVXH 2VZAA 3AEVA 1PYSB 3I4NH 1HNWL 3CCQA 5E7NA 4JI2Q 1N34Q 1HNZL 1JT8A 4JI7Q 3JC66 4LUZA 5C44G 1EYGA 2Z0SA 2BA0A 4DUZQ 4JI8L 4P71A 4DK6C 1E3PA 2E2HH 3GTQH 4B3RL 1FJGL 3TRZA 4A3DG 4KHPQ 2R93H 3S2HH 1EIYB 4XTCS 4DPGA 2ALYB 2KENA 4IPGA 5ELOA 3CC4A 3S24A 3S16H 3E0EA 3U4ZA 3W1BA 1YJ9A 4DV0L 4GNXB 4UPAA 5FJ8G 1Q81C 2ZTCA 3NBHB 3L7ZC 4POGA 4R1JA 2ZM6Q 4BY7H 4OWWB 3CAMA 2MFIA 1BVSA 3UDXA 3J80c 1V9PA 1KL9A 5IWAQ 5IYCH 2VQEQ 2V1CC 1SMXA 2WB1E 3M9BA 4BBRG 4LF9L 2YTVA 1XMOL 1Q12A 4JI6L 4TVAB 1TWFH 4B3SQ 1OXVA 4EX5A 4AIMA 2JQOA 1S72A 1PH3A 2JA5H 3GTKH 3HOUH 4JI7L 5C4XG 3E9HA 1KRTA 1OXTA 1PH5A 1Q82C 2A8VA 4DV4Q 4A3JH 1IZ6A 1N36Q 1TWHH 3RZDH 2UUAQ 3GTLH 3A5ZB 3GO5A 5IYDG 4DAMA 3J81c 1CSPA 1EQQA 2I0QA 1YITA 1HNXL 2F4VL 5IYBG 3I55A 3H3VH 2NVYH 4LNQA 1NJIC 1FL0A 2A1AA 4DR5Q 4L5QA 5GAHC 3HOYG 4LF4Q 5ELNA 4IJLA 2K5NA 4OONA 1QVFA 3CD6A 5C0XJ 3RLOA 4HJ9A 1PH4A 3S1NH 4DR3L 3RR5A 4AQYQ 1VQDA 4GKJL 3KF6B 3HOVG 1V1QA 4DR2Q 3I56A 1UE6A 5IP9H 1N34L 2OTLA 3HKZG 3MXNB 4PMWA 4A3GG 1SFOH 4LFCL 4LFBQ 4P75A 1VQIA 2ASBA 5GAGC 2LXJA 3F2DA 5HGQA 5C44H 2EIFA 1ASZA 3TREA 2Q2IA 3D31A 3D0FA 1XMQQ 4OWTB 3PF5A 4IPDA 2UUBL 1G6PA 3RN5A 2VY3A 1LYLA 3T1YL 1FGUA 2E8GA 4A3KG 1PH8A 4A3CG 4O0AA 2D62A 1TXYA 4RMFA 5BR8L 3W1GA 3AFPA 4A3IG 3A5UA 1X55A 1CKOA 1XNRQ 1C7YA 4AH6A 3NEMA 4R4TA 1YIJA 3DM3A 4B3TQ 2MQHA 2CQOA 1P16A 1P8LA 1WOCA 4R4IA 3L0OA 3W5OA 1X54A 2K5VA 3FKIG 2E5LQ 3KOJA 2UXDL 1QVGA 3ULLA 1HR0Q 4JI0Q 5JJLA 2C35B 4DR7Q 4NXMQ 2BA1A 1WI5A 3BZKA 3KF8B 5GROA 3EN2A 1Y14B 3S1RH 1D7QA 2WP8J 3STBD 1J6QA 4DR4Q 4LUVA 2D0OA 2UXBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8G A;  1IBK Q;  3M85 A;  5IYD H;  2PQA B;  4DK3 C;  4DNI A;  2N8N A;  4HIK A;  4IFD J;  1L2F A;  1CSQ A;  1QVC A;  4BA2 I;  3HOW G;  2AHO B;  2K14 A;  2AWO A;  2R7D A;  4UP9 A;  4YHH L;  3ULP A;  1KQS A;  2AMC B;  1N9W A;  2DUD A;  3M4P A;  5H1S E;  4OX9 Q;  4GKK L;  4A76 A;  1XPR A;  1VQN A;  5M5W H;  1N32 Q;  2Z6K A;  2K50 A;  1UE5 A;  1SE8 A;  3PV0 A;  4DR1 L;  2RCN A;  2VQF Q;  4B3M Q;  2PI2 A;  1CKN B;  5M3F H;  1PH9 A;  2ATW A;  3KF6 A;  3S17 H;  1Y1V G;  3NEN A;  1I94 Q;  4BXX G;  4LF6 L;  3G4S A;  1A0I A;  1IYJ B;  3GD7 A;  4DUY L;  2CWA A;  1YJN A;  4HJ8 A;  1VQ9 A;  2K52 A;  4C3J H;  2OTJ A;  3PO2 G;  3EBE A;  5JEA J;  5C4J H;  2E2I H;  2CWP A;  3J81 j;  2UUC Q;  4DR6 Q;  1U0L A;  4HID A;  4JI5 Q;  1TWG H;  1IBM Q;  1J5E L;  4BY1 G;  2JA8 H;  3CCU A;  2NZH A;  2QGQ A;  3CP0 A;  3HKZ E;  3HOZ H;  2I5L X;  5GQO A;  1QZG A;  3I7F A;  1SR3 A;  3AQQ A;  4KI0 A;  2MNA A;  3OTO Q;  2UU9 Q;  1YVC A;  4AYB G;  2A19 A;  3TEH B;  1VQK A;  4A3E H;  2JK8 A;  2PNH A;  4PZ6 A;  3CC2 A;  4JBM A;  1WFQ A;  1CUK A;  3I4M G;  1BBU A;  4JI3 L;  1C9O A;  3FHW A;  4MZ9 A;  3F8T A;  4PG3 A;  3AYH B;  4X65 Q;  2JA9 A;  4RG1 A;  3T1H Q;  4LF5 L;  2XTI A;  3S2D H;  4OO1 G;  3H0G G;  4DV7 L;  4A3L H;  4IPC A;  2R7Z H;  3U4V A;  5LMU Q;  4JI4 Q;  1HZC A;  1M90 C;  3KYH C;  1YNX A;  4JI1 L;  4R4O A;  4DV1 Q;  4YWL A;  1XPU A;  4BBS H;  4K0K Q;  5IP7 H;  1WCM G;  4IJH A;  1SLJ A;  5LMN Q;  4JBJ A;  3UE1 A;  1NE3 A;  4POF A;  3CCR A;  4JCV E;  5M5X H;  1N8R C;  1O7I A;  2KCM A;  3JAM c;  3BJU A;  2PQA A;  1Y1W G;  1KRS A;  3CPW A;  1HNW Q;  4DV3 L;  4HIO A;  2JA7 G;  4X6A H;  2B63 G;  4J15 A;  1PH2 A;  1L1O C;  1HNZ Q;  4B3R Q;  4JI8 Q;  2I5M X;  4LWC A;  1NMF A;  4LW1 A;  4A3F H;  1FJG Q;  4JOI C;  4YY3 L;  1XNQ L;  2F52 A;  2XGT A;  1PH6 A;  4A4I A;  3HKS A;  4P72 A;  3KLW A;  4OO1 I;  4GOP C;  2DGY A;  2JE6 I;  3CC7 A;  4A3M G;  5FLM H;  5AJ3 L;  1PH7 A;  4BXX H;  1CKN A;  3Q8D A;  3CCV A;  2E2J H;  1HZA A;  2FXQ A;  4DV0 Q;  1I6H H;  1PHJ A;  4GN5 A;  3K0X A;  1EUJ A;  1UE7 A;  4NB3 A;  2JA6 H;  4A3B H;  1VQH A;  3HOX G;  1IBL L;  1PFS A;  1B8A A;  1K0R A;  1K3R A;  1XJV A;  4GLA C;  4LFA L;  1Q7Y C;  4L5R C;  3RZO H;  3K7U C;  4P74 A;  1X56 A;  1PH1 A;  4LF9 Q;  4A3D H;  4JI2 L;  4A93 G;  2NVQ H;  1XMO Q;  3CMA A;  3S1M H;  3UE0 A;  1X65 A;  4A75 A;  1U5K A;  4JI6 Q;  4NXN L;  1M1K C;  1Q1B A;  2PMZ E;  4L5T A;  1B7Y B;  1PVO A;  2MO0 A;  4X64 L;  1RIP A;  2YV5 A;  1JE5 A;  4FDB A;  4X66 Q;  4LF7 L;  3M4O H;  1QZH A;  1HH2 P;  5FJ8 H;  1JMC A;  1X3F A;  3HFZ B;  1S40 A;  1K9M C;  4DKA C;  4JV5 L;  1N33 L;  1Q1E A;  2NN6 G;  4DV2 L;  1HNX Q;  4X62 L;  4AYB E;  2F4V Q;  4BBR H;  3RLN A;  5JJI A;  1Q46 A;  3GTM H;  4GN4 B;  3J81 i;  2ZJP A;  4OWX B;  4DV6 L;  3I4N G;  4XIG S;  1E24 A;  1OXU A;  4GNX C;  3S14 H;  4JYA L;  2UXC L;  2HHH L;  1X9N A;  1HZB A;  2YU9 H;  1QUQ B;  3J7A 5;  4DR3 Q;  1GM5 A;  4GKJ Q;  1UEB A;  5C4X H;  4JBK A;  1NBW A;  3CQZ H;  4JG2 A;  1VQ8 A;  3S1Q H;  2KHI A;  2R93 G;  1VQ6 A;  1XTD A;  4DV5 L;  3SGI A;  1W3S A;  2IT1 A;  1Y1W H;  1PV4 A;  4LFC Q;  1YBY A;  2JA7 H;  1VQ4 A;  4LF8 L;  3CW2 C;  4JC0 A;  4APV A;  1KD1 C;  3CF5 A;  1JJ2 A;  3UDF A;  5IYB H;  3EIV A;  1GKH A;  3A74 A;  3F1Z A;  1KIX A;  2HT1 A;  2HIV A;  5IY0 A;  3KDF B;  2NN6 I;  3WWV A;  3CPF A;  3CCS A;  2UUB Q;  3HOY H;  2F3I A;  3PUX A;  4MNO A;  1L0W A;  1LTL A;  3CXC A;  3OW2 A;  3T1Y Q;  4A3M H;  2ZTD A;  2LSS A;  1WYD A;  1FVI A;  4QIW E;  2JEB I;  2Y0S G;  3H15 A;  3MEF A;  4DUZ L;  3UDG A;  4UP7 A;  1VQF A;  3HOV H;  5BR8 Q;  3VDY A;  4KHP L;  1KHI A;  1OXX K;  5IYC G;  2ZJR A;  1L1O B;  4YCW A;  1YHB A;  1BBW A;  4A3G H;  3BU2 A;  1VS0 A;  4NPS A;  1EOV A;  1XPO A;  3M7N A;  2JA5 G;  3S15 H;  2ES2 A;  3B6Y A;  3HOU G;  3LGJ A;  1Q86 C;  3PCO B;  2UXD Q;  5DLQ E;  4GOP B;  3PIO A;  1VQL A;  4A3J G;  4WJ3 M;  2ZJQ A;  1YJW A;  3M3Y H;  1VQC A;  1Z47 A;  5EAY A;  4ME3 A;  1AE3 A;  2ZM6 L;  1VQM A;  4A3C H;  1G51 A;  4A3K H;  1B70 B;  5C3E G;  1VQG A;  3M4Q A;  4GLV B;  1NMG A;  1JB7 A;  2ZTE A;  5IWA L;  1TWC H;  2VQE L;  3KJO A;  4A3I H;  1PYB A;  3K7A H;  5GAE C;  1HZ9 A;  1YHA A;  2UXB Q;  1D8L A;  3G48 A;  3PUY A;  4HJ7 A;  4B3S L;  1X3E A;  5C0X G;  1YHQ A;  2KBN A;  2NVT H;  4IOA A;  2LXK A;  3FKI H;  1Q8K A;  1MIU A;  1AH9 A;  2RHQ B;  4JBW A;  4DV4 L;  1MJC A;  3CME A;  4IO9 A;  2B3G A;  3GTG H;  1N36 L;  4YHH Q;  2UUA L;  3K8A A;  2OQK A;  4GKK Q;  4Y52 H;  1MKH A;  4GS3 A;  2ID0 A;  2K75 A;  3PUV A;  4PZ8 A;  4DR1 Q;  4DR5 L;  1QUQ A;  1IL2 A;  5K36 G;  1UWV A;  4YCV A;  2KHJ A;  1A8V A;  2QA4 A;  1EWI A;  4LF4 L;  3UDI A;  2Q2T A;  2R92 G;  1R9T H;  2RHS B;  4LF6 Q;  4DUY Q;  4HJA A;  4AQY L;  3H3V I;  1NY4 A;  1UE1 A;  2N3S A;  4DR2 L;  1T9H A;  1VQB A;  4GN3 B;  3GTO H;  2OQ0 A;  3HOW H;  2WAQ G;  4O2D A;  5C0X I;  4P73 A;  2PI2 E;  4LFB L;  1LM0 A;  1S3O A;  1J5E Q;  3U50 C;  3PF4 A;  4YWK A;  3PO3 H;  3KDF A;  3KJP A;  2I5H A;  4UP8 A;  4C3H H;  1VQ5 A;  2IY5 B;  1XMQ L;  2CCZ A;  1KC8 C;  1K73 C;  3CCE A;  1Y1V H;  1I50 H;  2MO1 A;  1VQE A;  3FP9 A;  1E1T A;  3CCL A;  1L1O A;  5J3B A;  3E9I A;  3ICE A;  3GTJ H;  3KFU A;  3G71 A;  2VL6 A;  4X66 L;  3PO2 H;  2KCT A;  3GDE A;  4EQ5 A;  4JOI A;  3U58 A;  1XNR L;  3IRB A;  4MTN A;  2JJQ A;  1I3Q H;  2RF4 A;  5HY6 A;  5FLM G;  2Y0S E;  1VQO A;  4JI3 Q;  4BA1 I;  2VUM G;  2Q2H A;  1CKM A;  4HIM A;  4GOP A;  4BY1 H;  2CFM A;  1YEZ A;  4B3T L;  2OCE A;  4LF5 Q;  2QEX A;  2E5L L;  5M3M G;  5C3E H;  4DV7 Q;  3ZJY C;  4KHZ A;  1HR0 L;  4C2M H;  3RLF A;  4JI0 L;  1I5F A;  1E1O A;  2B29 A;  3F2C A;  3K81 C;  4Y7N H;  4NXM L;  3PO3 G;  4QY7 A;  4DR7 L;  3PUZ A;  4JI1 Q;  1HR0 W;  3ULJ A;  2R6G A;  3J80 i;  3TS0 A;  2GN5 A;  2WFW A;  4LUO A;  4R4Q A;  3G6E A;  4IOC A;  2VNU D;  2K4K A;  4UY8 C;  1E7Z A;  2VW9 A;  1YZ6 A;  1OTC A;  1IXR A;  3RN2 A;  4QJF A;  3I4M H;  1KAW A;  5IE8 A;  4IFD G;  5M3F G;  4QQB X;  4DR4 L;  2IX0 A;  2EXD A;  1RL2 A;  4DV3 Q;  1IBK L;  1VQJ A;  1EQR A;  3H0G H;  1BKB A;  1G29 1;  1SRU A;  2AKW B;  2K5H A;  2R7F A;  3JAM i;  4L5S A;  4YY3 Q;  2HQL A;  3TQY A;  5JEA G;  1MJE A;  1DGS A;  1VQA A;  2GVA A;  1Z9F A;  1XNQ Q;  4C3I H;  5IT9 c;  4DAY B;  1EIF A;  1SRO A;  2GVB A;  4OX9 L;  1C0A A;  1VQ7 A;  2R92 H;  2JA8 G;  3F2B A;  5AJ3 Q;  1HJP A;  1N32 L;  4IFD I;  2IX1 A;  1X3G A;  3HOZ G;  1WCM H;  4TQU S;  3STB C;  1OXS C;  2YYZ A;  2CKZ B;  5JJK A;  4HJ5 A;  2L15 A;  2VQF L;  4GLX A;  2Q2U A;  4B3M L;  1GD7 A;  2D0P A;  1V43 A;  1IBL Q;  1LUZ A;  1JJC B;  2AWN A;  1I94 L;  4LFA Q;  2WB1 G;  4GNX A;  4KLK A;  1PA6 A;  2B63 H;  4A3E G;  1H95 A;  5FLX c;  1JJG A;  3BZC A;  4YWM A;  1YI2 A;  2YTX A;  4OXP A;  1NTG A;  4PZ7 A;  3PIP A;  5GAD C;  2UUC L;  2IHE A;  2BH8 A;  4BY7 G;  1K83 H;  4NXN Q;  4JI5 L;  1IBM L;  3K80 C;  3RNU A;  4DR6 L;  3GTP H;  4X64 Q;  2WAQ E;  4A3L G;  4LF7 Q;  2R7Z G;  1GVP A;  3NEL A;  3OTO L;  2VS1 A;  2IHF A;  3HOX H;  2UU9 L;  4JV5 Q;  4YCU A;  4QL5 A;  3OYY A;  3CCJ A;  1N33 Q;  3L2P A;  4DV2 Q;  2VUM H;  4BBS G;  5IP7 G;  2BH2 A;  1VCI A;  2Z6K C;  4ALP A;  4X62 Q;  1W2B A;  2EQS A;  3AFQ A;  4H02 A;  5M3M H;  2JEA I;  3ERS X;  3I2Z A;  3TS2 A;  4A93 H;  1A62 A;  4QGU A;  4IPH A;  4DV6 Q;  3PGZ A;  3ER0 A;  2HIX A;  4R4C A;  4X65 L;  4JYA Q;  3PSI A;  2UXC Q;  2HHH Q;  3T1H L;  1GO3 E;  3CCM A;  1WJJ A;  2H5X A;  3PUW A;  4A3F G;  1SN8 A;  5LMU L;  1ASY A;  4JI4 L;  4WJ4 A;  4DV5 Q;  1KXL A;  1A63 A;  2OWO A;  2YTY A;  4DV1 L;  2N78 A;  1VQP A;  4K0K L;  1AE2 A;  1E22 A;  3J7Z C;  5M5Y H;  1X6O A;  4LF8 Q;  2NZO A;  2N49 A;  3I4O A;  3DLL A;  5LMN L;  1TWA H;  5IP9 G;  1K8A C;  2JA6 G;  3A0J A;  1EFW A;  4A3B G;  5LMN W;  2NVX H;  2VZA A;  3AEV A;  1PYS B;  3I4N H;  1HNW L;  3CCQ A;  5E7N A;  4JI2 Q;  1N34 Q;  1HNZ L;  1JT8 A;  4JI7 Q;  3JC6 6;  4LUZ A;  5C44 G;  1EYG A;  2Z0S A;  2BA0 A;  4DUZ Q;  4JI8 L;  4P71 A;  4DK6 C;  1E3P A;  2E2H H;  3GTQ H;  4B3R L;  1FJG L;  3TRZ A;  4A3D G;  4KHP Q;  2R93 H;  3S2H H;  1EIY B;  4XTC S;  4DPG A;  2ALY B;  2KEN A;  4IPG A;  5ELO A;  3CC4 A;  3S24 A;  3S16 H;  3E0E A;  3U4Z A;  3W1B A;  1YJ9 A;  4DV0 L;  4GNX B;  4UPA A;  5FJ8 G;  1Q81 C;  2ZTC A;  3NBH B;  3L7Z C;  4POG A;  4R1J A;  2ZM6 Q;  4BY7 H;  4OWW B;  3CAM A;  2MFI A;  1BVS A;  3UDX A;  3J80 c;  1V9P A;  1KL9 A;  5IWA Q;  5IYC H;  2VQE Q;  2V1C C;  1SMX A;  2WB1 E;  3M9B A;  4BBR G;  4LF9 L;  2YTV A;  1XMO L;  1Q12 A;  4JI6 L;  4TVA B;  1TWF H;  4B3S Q;  1OXV A;  4EX5 A;  4AIM A;  2JQO A;  1S72 A;  1PH3 A;  2JA5 H;  3GTK H;  3HOU H;  4JI7 L;  5C4X G;  3E9H A;  1KRT A;  1OXT A;  1PH5 A;  1Q82 C;  2A8V A;  4DV4 Q;  4A3J H;  1IZ6 A;  1N36 Q;  1TWH H;  3RZD H;  2UUA Q;  3GTL H;  3A5Z B;  3GO5 A;  5IYD G;  4DAM A;  3J81 c;  1CSP A;  1EQQ A;  2I0Q A;  1YIT A;  1HNX L;  2F4V L;  5IYB G;  3I55 A;  3H3V H;  2NVY H;  4LNQ A;  1NJI C;  1FL0 A;  2A1A A;  4DR5 Q;  4L5Q A;  5GAH C;  3HOY G;  4LF4 Q;  5ELN A;  4IJL A;  2K5N A;  4OON A;  1QVF A;  3CD6 A;  5C0X J;  3RLO A;  4HJ9 A;  1PH4 A;  3S1N H;  4DR3 L;  3RR5 A;  4AQY Q;  1VQD A;  4GKJ L;  3KF6 B;  3HOV G;  1V1Q A;  4DR2 Q;  3I56 A;  1UE6 A;  5IP9 H;  1N34 L;  2OTL A;  3HKZ G;  3MXN B;  4PMW A;  4A3G G;  1SFO H;  4LFC L;  4LFB Q;  4P75 A;  1VQI A;  2ASB A;  5GAG C;  2LXJ A;  3F2D A;  5HGQ A;  5C44 H;  2EIF A;  1ASZ A;  3TRE A;  2Q2I A;  3D31 A;  3D0F A;  1XMQ Q;  4OWT B;  3PF5 A;  4IPD A;  2UUB L;  1G6P A;  3RN5 A;  2VY3 A;  1LYL A;  3T1Y L;  1FGU A;  2E8G A;  4A3K G;  1PH8 A;  4A3C G;  4O0A A;  2D62 A;  1TXY A;  4RMF A;  5BR8 L;  3W1G A;  3AFP A;  4A3I G;  3A5U A;  1X55 A;  1CKO A;  1XNR Q;  1C7Y A;  4AH6 A;  3NEM A;  4R4T A;  1YIJ A;  3DM3 A;  4B3T Q;  2MQH A;  2CQO A;  1P16 A;  1P8L A;  1WOC A;  4R4I A;  3L0O A;  3W5O A;  1X54 A;  2K5V A;  3FKI G;  2E5L Q;  3KOJ A;  2UXD L;  1QVG A;  3ULL A;  1HR0 Q;  4JI0 Q;  5JJL A;  2C35 B;  4DR7 Q;  4NXM Q;  2BA1 A;  1WI5 A;  3BZK A;  3KF8 B;  5GRO A;  3EN2 A;  1Y14 B;  3S1R H;  1D7Q A;  2WP8 J;  3STB D;  1J6Q A;  4DR4 Q;  4LUV A;  2D0O A;  2UXB L; 
#chains in the Genus database with same CATH topology
 4IZ8 A;  3FVQ A;  5CV8 A;  3NBI A;  4IQZ A;  4DK3 C;  1LV9 A;  4IFD J;  4Z9C B;  4L63 B;  1WTH A;  2R7D A;  3M4P A;  4A76 A;  2L11 A;  1VQN A;  4ZYS A;  4CDF C;  1PDQ A;  1SE8 A;  3SDZ A;  3PV0 A;  4LJZ C;  3S1M B;  5FK9 C;  2PI2 A;  2B8F A;  1PH9 A;  1ENA A;  3S17 H;  3R8B A;  1A0I A;  1IYJ B;  2WKD A;  1Q8I A;  1VQ9 A;  3DWQ A;  4C3J H;  3PO2 G;  2WAQ B;  1HUN A;  5JEA J;  1LTB D;  2CWP A;  2RDF A;  3J81 j;  3TDQ A;  1U0L A;  4HID A;  4JI5 Q;  4BY1 G;  5C6A A;  3BS1 A;  1TKW B;  3J80 L;  3CP0 A;  3O13 A;  2I5L X;  5GQO A;  4BBR B;  2N88 A;  2CVR A;  4C56 C;  3OMG A;  3AQQ A;  3OTO Q;  3BG3 A;  3S1R B;  2RSN A;  3HEJ A;  4JBM A;  1A3T A;  2XRS D;  3D6W A;  4RCN A;  2L4N A;  3SK8 A;  1IHZ A;  5BN5 A;  1U4R A;  2ENB A;  4R9W A;  3FHW A;  3AYH B;  2KJX A;  4RGO S;  3T1H Q;  1AZQ A;  3H0G G;  1EQT A;  3H6M A;  4CJ2 C;  4A3L H;  2TMP A;  3E0J A;  3KF8 A;  5CMD A;  3VA7 A;  2B2U A;  1HZC A;  4JI1 L;  1G91 A;  4K14 A;  4I65 A;  2F0M A;  4DV1 Q;  4G7O C;  4YWL A;  2WV6 D;  5IP7 H;  4G57 A;  5IOC A;  4ILW A;  1JCK B;  1WCM G;  5M3F B;  3UE1 A;  1NE3 A;  3C46 A;  1F9Q A;  4A3G B;  1O7I A;  4PQX A;  1AN8 A;  1HNW Q;  4HIO A;  4KN7 C;  2O5J C;  4J15 A;  1IL8 A;  4RGN A;  2I5M X;  2RQX A;  2E2I B;  1NMF A;  1K28 A;  3A8J E;  1TWG B;  1BNZ A;  2JA8 B;  1UNS A;  2A6E D;  4OO1 I;  4A3M G;  4BXX H;  5AJ3 L;  4C1N I;  4K6L A;  2F0W A;  1PHJ A;  3AB9 A;  1EUJ A;  2KCC A;  3A55 A;  3HOX G;  1B8A A;  1WVL A;  4H0L C;  1JOO A;  4P74 A;  3G7L A;  1X56 A;  2F0P A;  1QCB D;  2DJG C;  3CMA A;  3S1M H;  4NMZ A;  4JI6 Q;  4NXN L;  3D6C A;  2PMZ E;  1LT4 D;  4FDB A;  4X3S A;  3M4O H;  1EL0 A;  1HH2 P;  5IGC A;  5FJ8 H;  4JV5 L;  1N33 L;  1CHQ D;  4X3T A;  1HNX Q;  3GTO B;  4OO1 H;  4C1N K;  4BBR H;  3RLN A;  1SYE A;  3GTM H;  3J81 i;  4DV6 L;  3E3X A;  1XX8 A;  1RKN A;  1OXU A;  4IUN A;  1X9N A;  1QUQ B;  3J7A 5;  1GM5 A;  1UEB A;  1NBW A;  1ZKO A;  1Y1W H;  3MVV A;  5FKA C;  1B50 A;  1YBY A;  4QUC A;  2JA7 H;  3K5O A;  1TVX A;  2JSO A;  1I6H B;  5COR A;  2JA6 B;  3CF5 A;  3UDF A;  5IYB H;  5JOB A;  1GKH A;  3A74 A;  5IGD A;  2B2W A;  2HT1 A;  2HIV A;  4QF4 A;  2NN6 I;  2UUB Q;  3PUX A;  5I6W A;  4MNO A;  1LTL A;  4JI2 L;  2JEB I;  4A3D B;  4DUZ L;  1VQF A;  5BR8 Q;  3VDY A;  1LAC A;  2ZJR A;  4YCW A;  4DU9 A;  4A3G H;  1UEA B;  4WJW A;  3JAM E;  3I4M B;  5DLQ E;  4OIK A;  3J81 E;  1EY0 A;  3PIO 3;  4A3J G;  2ZJQ A;  1JC7 A;  1Z47 A;  5J39 A;  1KNE A;  1M4V A;  1SE4 A;  1B70 B;  4Q0F A;  1VQG A;  5C3E G;  3T56 B;  2F0T A;  2ZTE A;  1QOH A;  3KJO A;  2UXB Q;  4HJ7 A;  3MAQ A;  5C0X G;  3CQZ B;  2KBN A;  2NVT H;  1STE A;  4IOA A;  1V1P A;  3IFD A;  2EJF C;  2LXK A;  1X3P A;  3FKI H;  3GV6 A;  1TII D;  4JBW A;  1X3Q A;  1MJC A;  4DV4 L;  3MZ5 A;  3GTG H;  1EIG A;  3AMU A;  3NUC A;  5HUR A;  2XWB B;  1M8A A;  1F77 A;  1IL2 A;  3NK9 A;  5K36 G;  1UWV A;  4BS9 A;  2RKS A;  2EE1 A;  1A8V A;  2KHJ A;  2Q2T A;  3GTP B;  4ZKB B;  2RHS B;  3W2D A;  4AQY L;  2ZXO A;  1UE1 A;  3GTO H;  4GN3 B;  2WAQ G;  2Q8R E;  4P73 A;  1KLU D;  3DHQ A;  3PF4 A;  3OWF A;  2F0D A;  4UP8 A;  1NR4 A;  1S5C D;  1B3A A;  2EYF A;  1K73 C;  3CCE A;  3U9S A;  2MO1 A;  2PQE A;  3K7A B;  3GDE A;  2EXZ A;  2WAC A;  4EQ5 A;  1PXU A;  2RF4 A;  5HY6 A;  5FLM G;  3LWE A;  1LTI D;  1XXG A;  1CKM A;  4OIJ A;  1U4L A;  2OCE A;  2J7Z A;  2QEX A;  4FF3 A;  4WOR A;  4KHZ A;  1HR0 L;  3F2C A;  2P5Z X;  3K81 C;  4NXM L;  1GUT A;  4JI1 Q;  1PLF A;  4PMC A;  4EGV A;  2R6G A;  2FJ2 A;  2WFW A;  4R4Q A;  2BOS A;  2VNU D;  2VW9 A;  2QCP X;  1OTC A;  3I4M H;  2Z4I A;  1QG7 A;  5M3F G;  3UI2 A;  2O5I C;  1IBK L;  2KEC A;  1EQR A;  3HOW B;  1SRU A;  2AKW B;  2R7F A;  1PFB A;  4L5S A;  5E3F A;  1MJE A;  1LT6 D;  1Z9F A;  5IT9 c;  4OX9 L;  2B2Y C;  1SNP A;  3PO3 B;  4FYD A;  2R92 H;  1H9K A;  2Y0S B;  4IUV A;  4N8F A;  5AJ3 Q;  5CV5 A;  2JA8 G;  2EJG C;  4TQU S;  1OXS C;  4HJ5 A;  2VQF L;  3Q22 A;  1V43 A;  4EVO A;  2M9V A;  1BOS A;  2JA5 B;  1H95 A;  4QUF A;  5IGF A;  2FIN B;  1WTR A;  1PZI D;  3R2I A;  1PZK D;  2BDN A;  4PZ7 A;  3PIP 3;  4BY7 G;  3I73 A;  4NXN Q;  2K7V A;  3GTP H;  2WAQ E;  4C2M B;  5F2D A;  4HCS A;  3FEW X;  2XSC A;  2VS1 A;  3HGB A;  5DAU A;  4JV5 Q;  4QL5 A;  1GHK A;  1N33 Q;  3ITP A;  4FXD A;  4ALP A;  4XQN A;  2EQS A;  3AFQ A;  4H02 A;  5HGT A;  1LTA D;  2F3W A;  4QGU A;  4DAV A;  4DV6 Q;  3PGZ A;  3ER0 A;  2HIX A;  1D1K A;  2X69 A;  2D2C C;  3PSI A;  4X65 L;  1GO3 E;  3MXG A;  1EEF D;  4UDU C;  4C3I B;  5LMU L;  4JI4 L;  3X3M A;  2KED A;  1JQY D;  2UXB L;  1LT5 D;  1FNW A;  2EY6 A;  3QIA A;  4KY7 A;  1HQR D;  2SNM A;  2JA6 G;  1R4Q B;  3AEV A;  3X3N A;  2A69 D;  5E7N A;  4JI2 Q;  1JT8 A;  4HCE A;  4DUZ Q;  4DAY A;  4P71 A;  4DK6 C;  1E3P A;  3TRZ A;  4A3D G;  2RDH A;  2R93 H;  4RH6 A;  3S2H H;  1K83 B;  4UAI A;  2ALY B;  3CC4 A;  3OIP A;  1XWE A;  3W1B A;  3Q24 A;  1Q81 C;  2VUM B;  3NQT A;  4N9P A;  5I4D A;  4POG A;  1B4O A;  2F0J A;  5JJZ A;  4OWW B;  1BVS A;  1ESR A;  3M9B A;  1C0A A;  1EY4 A;  3OMC A;  1Q12 A;  1MBY A;  2JA5 H;  5C4X G;  4RHS A;  3QJY A;  3HOU H;  3E9H A;  1KRT A;  2F0H A;  4DV4 Q;  1JOQ A;  1K8M A;  3RZD H;  4LAA A;  5LL6 X;  1CSP A;  1EQQ A;  4GZY C;  1B3Q A;  3CU7 A;  1A15 A;  3A8I E;  3QB3 A;  5C4J B;  3H3V H;  4CBV A;  4L5Q A;  1CM9 A;  3HOY G;  4IUR A;  4OON A;  3GTQ B;  5DNF A;  4AQY Q;  4ABN A;  4GKJ L;  1FD7 D;  3I56 A;  1UE6 A;  1U4M A;  2H1E A;  2WB1 B;  4A3E B;  1I4P A;  4P75 A;  5C5L A;  2LXJ A;  4HR7 B;  2KHS A;  5C44 H;  2DY8 A;  1EYA A;  1S4Z A;  2Z8L A;  4RGM A;  1SMY D;  1BDO A;  4K2K A;  1G6P A;  1STN A;  2VY3 A;  2DJF C;  2EJM A;  3QWN A;  3E6Z X;  1QJO A;  2D62 A;  1TXY A;  3W1G A;  3AFP A;  1SE3 A;  1TWF B;  4I7Z C;  3DM3 A;  2MQH A;  2F0L A;  3TBI B;  1WOC A;  3NBH A;  4CKC A;  5M5X B;  1QIL A;  1HR0 Q;  1TWH B;  5JJL A;  4NXM Q;  2MPM A;  5CR3 A;  3VR3 A;  1WI5 A;  3MXU A;  1E0B A;  3T16 A;  2VXW A;  4KKU A;  2NVY B;  5D3D A;  1D7Q A;  3V2T A;  1TS4 A;  1J6Q A;  3SK5 A;  2D0O A;  1IBK Q;  2KUM A;  2XWJ B;  1F9S A;  1LAB A;  3TN2 A;  2ZXR A;  1BR9 A;  4A3B B;  4IFD H;  1J9O A;  1QVC A;  3HOW G;  2RSO A;  2F03 A;  1SFO B;  4Q5V A;  3FPU B;  1KQS A;  4CJ1 B;  3ULP A;  2DUD A;  2EYM A;  4CKB A;  2B2V C;  4OX9 Q;  3RZO B;  4NDX A;  2Z6K A;  5BN4 A;  2K50 A;  1UE5 A;  2NVQ B;  1BBX C;  4DR1 L;  1XYI A;  2VQF Q;  1CKN B;  4LF6 L;  2MP1 A;  3G4S A;  4DUY L;  4DF7 A;  5J22 A;  3MXN A;  4HJ8 A;  2K52 A;  1JE4 A;  1PMR A;  3EBE A;  2KVM A;  5C4J H;  5JEA H;  4FF4 A;  4ZUI A;  2NZH A;  3ERQ A;  3I7F A;  4KI0 A;  2MNA A;  1BUV T;  3S14 B;  3C1F A;  1TT2 A;  4KTA A;  4A3E H;  2PNH A;  1K0S A;  4MN3 A;  3R93 A;  4NKL A;  4O42 A;  4HTH A;  4X65 Q;  4PG3 A;  4IUT A;  4JK1 C;  1EYC A;  2XTI A;  4PNY A;  2BCO A;  4KY5 A;  5LMU Q;  5CBA E;  1MHW C;  2LY7 A;  4JI4 Q;  1PTO C;  4BBS H;  1HPC A;  5L37 A;  1SLJ A;  1H9S A;  3QG1 A;  1DM0 B;  1CQF A;  1EWH A;  4JCV E;  2F0S A;  5M5X H;  5T1I A;  1KRS A;  1DCZ A;  3CPW A;  4DV3 L;  4X6A H;  5EPJ A;  2B63 G;  4C3J B;  1L1O C;  2KOL A;  1PH2 A;  4IN3 A;  5CYU A;  2GA4 B;  4A3F H;  1PFM A;  4YY3 L;  2F52 A;  4A4I A;  3HKS A;  3KLW A;  3GV3 A;  1CZG A;  1HCZ A;  1VDZ A;  1I4H A;  2IW3 A;  3K57 A;  4GOP C;  1PH7 A;  3WOF A;  2E2J H;  1HZA A;  2A68 D;  4GN5 A;  4A3B H;  3K58 A;  4NP5 A;  1YNN C;  1XJV A;  4GLA C;  2F0E A;  4L5R C;  1SYF A;  3RZO H;  2M2L A;  2B2T C;  1IKL A;  1F2L A;  2Z9H A;  4U67 3;  1PH1 A;  2NVQ H;  3HRZ C;  1Q1B A;  1B7Y B;  3I72 A;  2CH4 W;  2YV5 A;  1JWM D;  4LF7 L;  2ICI A;  1S40 A;  3BVM A;  3V96 A;  3RUZ A;  3TP5 A;  3VYS A;  1SNM A;  5C4H A;  4L8J A;  4OWX B;  3I4N G;  1E24 A;  3S14 H;  2UXC L;  4GKJ Q;  3NWT A;  3URY A;  3LX0 A;  1VQ8 A;  3S1Q H;  1XTD A;  1Y1V B;  3SGI A;  1W3S A;  2R61 A;  1D2B A;  1VQ4 A;  4CKE A;  4LF8 L;  3CW2 C;  4K5W A;  4APV A;  4KD3 A;  2K33 A;  1PTO B;  3EIV A;  1I3Q B;  1GUG A;  4M1U B;  3P7J A;  3KDF B;  2IX3 A;  3J80 E;  3VA5 A;  3MXP A;  3TSS A;  4DNR B;  5JVH 3;  2RDG A;  4A3M H;  1N34 L;  1WYD A;  1FVI A;  3H15 A;  3PQI A;  1O7L A;  4KHP L;  1G2S A;  4KD4 A;  1L1O B;  4XQQ A;  3J7A V;  1BBW A;  4LK1 C;  3VR4 A;  5IOD A;  1XPO A;  1EOV A;  3EVQ A;  3M4O B;  2NBF A;  2ES2 A;  4GOP B;  3BDL A;  1VQL A;  3RMH A;  1E2V A;  1YJW A;  1F9P A;  1AE3 A;  1DYQ A;  4ME3 A;  4XDX A;  1G51 A;  1VQM A;  1F9R A;  2JP1 A;  2EYJ A;  3SXH A;  3GTM B;  4IUQ A;  1TWC H;  2VQE L;  1WTO A;  4EQP A;  4A3I H;  5GAE C;  1D8L A;  4FXK C;  4G4K A;  4B3S L;  1YHQ A;  3ND8 A;  3HP3 A;  1CI3 M;  1Q8K A;  3SE0 A;  1Y1W B;  4IO9 A;  2JA7 B;  2UUA L;  1L0X B;  2OQK A;  1VMC A;  1MKH A;  4GS3 A;  1D5Z C;  1IKM A;  3PUV A;  4DR1 Q;  1QUQ A;  2O2L D;  1CA6 A;  4LF6 Q;  3CKI B;  3FPP A;  4DUY Q;  2F0V A;  4DR2 L;  1I4Q A;  3HKZ B;  3OWE B;  1S5B D;  1I4X A;  2NUC A;  5C0X I;  1S3O A;  1RHP A;  4A93 B;  4C3H H;  2CCZ A;  1Y1V H;  1I50 H;  5C3W A;  1PYW D;  2NZ1 D;  1E1T A;  3ICE A;  2PW5 A;  3G71 A;  4X66 L;  2KCT A;  3U58 A;  4MTN A;  1PTO H;  3H09 A;  1I3Q H;  1VQO A;  1EZ6 A;  2NVT B;  1IYU A;  4HIM A;  1BCP C;  3FKI B;  2E5L L;  5M3M G;  5C3E H;  2F0F A;  4WRD A;  3GTG B;  3RLF A;  1I5F A;  1Y8O B;  3I3C A;  4Y7N H;  2NWG A;  4QY7 A;  1HR0 W;  2H4O A;  3BZD B;  3G6E A;  4IOC A;  2K1B A;  3GQB A;  1E7Z A;  3ZYY X;  4QJF A;  1V8Q A;  4QQB X;  1A2U A;  4DV3 Q;  3L3O C;  1VQJ A;  3EJI A;  4C3J G;  3JAM i;  5KYI A;  2QEJ C;  4YY3 Q;  1JR0 D;  1RD9 D;  2EYH A;  1DGS A;  1VQA A;  4KV6 A;  2Q8I B;  2SOB A;  2OXP A;  5BN3 A;  3STB C;  3QOL A;  1QNU A;  4B3M L;  4V0B A;  1GD7 A;  2SDF A;  3SK4 A;  4HED A;  1I94 L;  1JJG A;  1YI2 A;  2YTX A;  1NTG A;  3GTL B;  1D5X C;  5GAD C;  1IBM L;  3RNU A;  1VF7 A;  2IJ0 A;  2K04 A;  1JOR A;  4A3L G;  4LF7 Q;  3FRP B;  3NEL A;  4R8I A;  4AYB B;  2IHF A;  2UU9 L;  1S5F D;  5ISR A;  1EZ8 A;  3EQL C;  2A6H C;  2F0G A;  3T51 B;  5IP7 G;  1ET9 A;  1A3U A;  1W2B A;  1HRJ A;  3SR1 A;  1A2T A;  2A73 B;  4A93 H;  4IPH A;  4EQN A;  4ZQ3 A;  2UXC Q;  2MGS A;  1PTO F;  3HG9 A;  1UUP A;  1WJJ A;  2H5X A;  1MD2 D;  1ASY A;  1BCP B;  1KXL A;  1A63 A;  2OWO A;  2R92 B;  4FXG C;  1ICW A;  2F0Q A;  2YTY A;  1O78 A;  2N78 A;  3F2U A;  1FR3 A;  2NN6 H;  5FOB B;  1VQP A;  4K0K L;  5M5Y H;  4LF8 Q;  2NZO A;  4RAU C;  1DXM A;  3I4O A;  1HFN A;  3DLL A;  1GUS A;  5LMN L;  1TWA H;  5IP9 G;  3A0J A;  2NVX H;  2VZA A;  3D8G A;  3I70 A;  3CCQ A;  1N34 Q;  1B9N A;  1SSO A;  3JC6 6;  3P20 A;  4DN4 M;  1PRT C;  2E2H H;  4KHP Q;  1FJG L;  1EIY B;  1ONL A;  1ENF A;  3MEH A;  4DPG A;  3OPO A;  4X3K A;  4RA8 A;  1YJ9 A;  4DV0 L;  4UPA A;  5FJ8 G;  3H3V C;  1LTG D;  4BY7 H;  2RVL A;  1EIH A;  1B1Z A;  1EU4 A;  5IYC H;  2VQE Q;  4LF9 L;  4BBR G;  2L5T A;  1B2T A;  1FYC A;  4DA2 A;  2F0I A;  4TVA B;  4B3S Q;  4EX5 A;  3DEO A;  4AIM A;  5IGG A;  1IZ6 A;  5FO7 B;  4CDD C;  2UUA Q;  3GTL H;  5IYD G;  4DAM A;  3J81 c;  5KYL A;  1YIT A;  2JXM B;  2F4V L;  5IYB G;  3I55 A;  5IT9 L;  3ONA B;  2E76 C;  2K5N A;  5C0X J;  4DR3 L;  2R93 B;  4JVZ A;  3KF6 B;  4PMB A;  1SBB B;  3S2H B;  4DR2 Q;  3VR6 A;  3HKZ G;  1EU3 A;  4A3G G;  2EPB A;  2NB0 A;  4LFC L;  2CW0 C;  1VQI A;  5GAG C;  3F2D A;  3A54 A;  3D4W A;  5HGQ A;  2KEE A;  1BCP D;  2EIF A;  1WTV A;  3D31 A;  3D0F A;  4B9W A;  1DJR D;  1SDF A;  1Y69 U;  3D4R A;  3RN5 A;  1SNC A;  1FGU A;  2LS0 1;  2R7Z B;  4O0A A;  4L6T B;  4KY6 A;  4RMF A;  3J7Y W;  3A5U A;  1KNA A;  1CKO A;  4B9X A;  2L12 A;  4AH6 A;  5I2Y A;  3NEM A;  1PRT B;  1TS5 A;  2B2Y A;  3HOU B;  4R4I A;  2E5L Q;  3OW7 A;  3W5O A;  1X54 A;  2K5V A;  3FKI G;  1QVG A;  3FDT A;  3RZD B;  1JB3 A;  5KIX A;  2F0K A;  1Y14 B;  2WP8 J;  3STB D;  2PZT A;  1KTK A;  2KQ3 A;  4EQO A;  1WTW A;  1U9R A;  1CT1 D;  2PQA B;  3KBG A;  4DNI A;  4KJN A;  4BA2 I;  2AHO B;  2K14 A;  2G5D A;  1I6V C;  4UP9 A;  4YHH L;  5H1S E;  5C44 B;  1XPR A;  5M5W H;  4QB4 A;  1TR5 A;  1HFG A;  4RHR A;  3K5N A;  1SAP A;  4B3M Q;  2RCN A;  3KLS A;  5ELC A;  2ATW A;  1I94 Q;  3HS0 C;  2CWA A;  3KUP A;  1YJN A;  1RF2 D;  2CH4 A;  4V19 0;  5E1F A;  3R3O A;  1RTN A;  4M8A A;  1IBM Q;  1J5E L;  2ZXP A;  3TZD A;  5I9O A;  3HOZ H;  3HKZ E;  2D9U A;  5C5M A;  3QR8 A;  1SR3 A;  4F87 A;  2UU9 Q;  1YVC A;  4RGT A;  4AYB G;  2A19 A;  2TSS A;  2JK8 A;  4PZ6 A;  1BCP F;  2L9H A;  3MWY W;  5DM7 3;  2PW7 A;  3I4M G;  1NR2 A;  1BBU A;  4TRD A;  4JI3 L;  1FGB D;  4MZ9 A;  3F8T A;  1HQM C;  5J1Z A;  2JA9 A;  3NE5 B;  3S2D H;  1LTT D;  2B39 A;  4DV7 L;  2R7Z H;  2K5D A;  3U4V A;  1PRT D;  3G6J B;  1M90 C;  4NW2 A;  4DXG A;  3KYH C;  1YNX A;  4R4O A;  1JWS D;  4K0K Q;  1XPU A;  4CDE C;  4IJH A;  5LMN Q;  4JBJ A;  2WKC A;  4POF A;  1ROD A;  5FLX E;  1N8R C;  4J8Q A;  2KCM A;  3PMF A;  3D3R A;  4G7Z C;  2XRQ D;  3FMC A;  1DOK A;  5KGU A;  1FJG Q;  4JOI C;  1PH6 A;  4P72 A;  3C3L A;  4A3K B;  2DGY A;  3EA6 A;  2F4I A;  1CKN A;  3Q8D A;  4DV0 Q;  4DK0 A;  1UE7 A;  5E4X A;  2L1B A;  2SNS A;  2E2D C;  5D65 A;  2DY7 A;  1GJX A;  4LF9 Q;  1LT3 D;  4DAP A;  3UE0 A;  1X65 A;  2ZT9 C;  2C9O A;  3V05 A;  2MO0 A;  4X64 L;  5ELF A;  4MHE A;  1QZH A;  1JMC A;  3HFZ B;  3A7A B;  1PFN A;  4HMI A;  4BBS B;  1STH A;  3L9A X;  4DV2 L;  5CV6 A;  2CW0 D;  1HUM A;  4X62 L;  3C1E A;  4AYB E;  2F0O A;  2F4V Q;  1HTP A;  4GN4 B;  5FO8 B;  2K05 A;  4XIG S;  4GNX C;  2HHH L;  5EKI A;  4DR3 Q;  4A3F B;  4JBK A;  4JPB W;  1AEX A;  2R93 G;  2KHI A;  4E6I A;  1LO5 D;  4DV5 L;  3BVZ A;  4KK7 A;  4LFC Q;  2E2J B;  3SEB A;  1AP0 A;  4JC0 A;  1KD1 C;  1PRT F;  4K2L A;  1KIX A;  5IY0 A;  3WWV A;  3OOC A;  4FNF A;  5I2X A;  1L0W A;  3CXC A;  3OW2 A;  3PO3 G;  2LSS A;  2Y0S G;  3MEF A;  3HOV H;  2F3V A;  4UP7 A;  1KHI A;  2OT2 A;  5AFW A;  1YHB A;  3TZU A;  1KAB A;  4O1N A;  2QKI C;  2B2V A;  5KND A;  2LKV A;  5A35 A;  1LTS D;  2JA5 G;  3S15 H;  3HOU G;  4XYO A;  3LGJ A;  1Q3L A;  4WJ3 M;  3CHB D;  3M3Y H;  1VQC A;  2ZM6 L;  5EAY A;  4I7A A;  2HQE A;  3H0G B;  4A3K H;  4A3C H;  1RJT A;  4KJO A;  1D6E C;  3M4Q A;  1JB7 A;  1GUW A;  5JVG 3;  1DOM A;  1VF5 C;  1MSG A;  1HZ9 A;  1EY5 A;  3PUY A;  1X3E A;  3S9W A;  3NHH A;  3S1Q B;  5EKK A;  1MIU A;  1UAP A;  2M00 A;  3CME A;  5ELE A;  2B3G A;  1N36 L;  4YHH Q;  2AUJ D;  3MFG A;  5EKL A;  4Y52 H;  4OHJ A;  2RBM A;  4PZ8 A;  4DR5 L;  4C3I G;  4A3M B;  4LF4 L;  2QA4 A;  1EWI A;  1FNV A;  3UDI A;  4HJA A;  2K5W A;  1NY4 A;  1ZYR C;  3WDN A;  2N3S A;  1VQB A;  3N6R A;  2D5D A;  3K0Y A;  1F2Z A;  4O2D A;  1G6Z A;  3M4Y A;  1LM0 A;  1QE6 A;  1J5E Q;  4YWK A;  3KDF A;  4BWG B;  1CTM A;  3KJP A;  2I5H A;  2K01 A;  1VQ5 A;  1XMQ L;  2A5H A;  1KC8 C;  2L55 A;  4H44 C;  1VQE A;  1AW7 A;  1I4G A;  4ID6 A;  1L1O A;  4J6H A;  1TWC B;  3N52 A;  3GTJ H;  4K5X A;  4A3I B;  4FO2 A;  1RTO A;  1C48 A;  2FMC A;  3PO2 H;  1XNR L;  2JJQ A;  1GUO A;  1J8I A;  2Y0S E;  4JI3 Q;  2VUM G;  4GOP A;  4BY1 H;  2CFM A;  5JPN C;  4DV7 Q;  2J4X A;  3ZJY C;  4IFD G;  4JI0 L;  1E1O A;  2B29 A;  4DR7 L;  2PO4 A;  5IGE A;  3ULJ A;  3J80 i;  2KA7 A;  4LUO A;  2FFK B;  2B2T A;  5EPL A;  1YZ6 A;  1IXR A;  3E5S A;  3OIQ A;  1KAW A;  2L0C A;  1ILQ A;  1C4Q A;  2EXD A;  2RA4 A;  3T13 A;  3A8K E;  3QO2 A;  1XTC D;  3H0G H;  1BKB A;  1CA5 A;  2HQL A;  5JEA G;  5CV4 A;  2HCC A;  3K59 A;  5EQ0 A;  1SRO A;  2GVB A;  4KMU C;  5EPK A;  1D5M C;  1EOT A;  1NNX A;  1HJP A;  1N32 L;  2IX1 A;  3J7A F;  1WCM H;  4C3H B;  3Q6S A;  5JJK A;  2L15 A;  4GLX A;  1I50 B;  1VMP A;  1JJC B;  1TY2 A;  2DNE A;  1V1O A;  2WB1 G;  4A3E G;  3BZC A;  4A3J B;  1GHJ A;  4U68 A;  4DK1 A;  4OXP A;  5DM6 3;  2CQA A;  2UUC L;  2IHE A;  2BH8 A;  4DR6 L;  5A2Q L;  2QIL A;  3K80 C;  5C3E B;  1S5E D;  1X32 A;  1ET6 A;  4X64 Q;  3VR2 A;  4MIU A;  4Y7N B;  1GVP A;  1GUN A;  3P75 A;  3HOX H;  4N9T A;  1OO9 B;  4RKB A;  3OYY A;  3CCJ A;  4BBS G;  4DV2 Q;  1TQO A;  3I4L A;  2BH2 A;  1CHP D;  4X62 Q;  5M3M H;  2WII B;  2K03 A;  3ERS X;  3I2Z A;  4K8J A;  2PPB C;  3WOE A;  1EY6 A;  2HHH Q;  1CZW A;  1SYB A;  3CCM A;  5KEE A;  1EY7 A;  3VR5 A;  3PUW A;  1CK1 A;  4A3F G;  1EY8 A;  4N8X 1;  4WJ4 A;  3MA2 B;  4DV5 Q;  4F8M A;  5G3L D;  3J7Z C;  1X6O A;  4CHT B;  1DON A;  4QIW B;  1BO0 A;  5KNB A;  1Z6H A;  5CBE E;  4A3B G;  5LMN W;  4TKO B;  1PYS B;  4ZUJ A;  1HNZ L;  2Z0S A;  2BA0 A;  4G7H C;  4JI8 L;  4B3R L;  3BDC A;  4CJ0 B;  1O7Y A;  5ELO A;  1DZ1 A;  3E0E A;  3U4Z A;  4FF1 A;  2B2U C;  2I46 A;  1EWC A;  3NTK A;  3L7Z C;  4R1J A;  2ZM6 Q;  2K32 A;  2VB3 X;  3CAM A;  2MHV A;  3UDX A;  1MSH A;  3J80 c;  1V9P A;  1KL9 A;  5D3I B;  4KKT A;  1ZXT A;  2V1C C;  2WB1 E;  4KHV A;  4ME5 A;  2YTV A;  1XMO L;  1OXV A;  1PTO D;  2JQO A;  1S72 A;  1PH3 A;  3KLS X;  3ND9 A;  4WFN 3;  1PH5 A;  1ZYR D;  3BVG A;  2A8V A;  4A3J H;  1N36 Q;  5M5Y B;  3GO5 A;  2I0Q A;  2EY1 A;  1TWA B;  2AQ2 B;  3VYT A;  1TY0 A;  2NVX B;  1NJI C;  1FL0 A;  2A1A A;  4DR5 Q;  3H91 A;  5GAH C;  4LF4 Q;  4IJL A;  1QVF A;  3S1N H;  5C0X H;  1PH4 A;  2E2H B;  1VQD A;  1F2Y A;  5IP9 H;  1Y8N B;  2HD3 A;  1YNN D;  5LHY 1;  1WTP A;  3MFY A;  4XT1 B;  2QDL A;  1XMQ Q;  3GTK B;  5K36 H;  4BY7 B;  4OWT B;  4IPD A;  4UHV A;  5G3L F;  3T1Y L;  4ZRZ A;  2J0T D;  4H7B A;  5IIF A;  4ZK9 B;  4A3I G;  1XNR Q;  1X55 A;  1HA6 A;  5FO9 B;  4OL7 A;  1C7Y A;  5T1G A;  3ERO A;  4R4T A;  1JOK A;  2AUK A;  1YIJ A;  2I07 B;  1JIC A;  1E2Z A;  2CQO A;  1WD0 A;  1P8L A;  5ELD A;  2UXD L;  3KOJ A;  3ULL A;  4JI0 Q;  4DR7 Q;  3DM1 A;  3NTH A;  4HSP A;  3BZK A;  3K6O A;  1T5E A;  3KF8 B;  5EGT A;  1NUC A;  1D1I A;  3EN2 A;  3S1R H;  2K5Q A;  1K8O A;  2B2W C;  3DUZ A;  5C3X A;  5FLM H;  3TS2 A;  4RFB A;  1K8G A;  2EY5 A;  3M85 A;  5IYD H;  3TP7 A;  4X3U A;  2N8N A;  4HIK A;  1L2F A;  1CSQ A;  3NP8 A;  1H9M A;  2AWO A;  2AMC B;  1N9W A;  3CRK C;  1SND A;  3SHL A;  4GKK L;  4H13 C;  1N32 Q;  3EFX D;  1FNU A;  4HAE A;  4C3H G;  2AQ3 B;  2AQ1 B;  1STA A;  3SVM A;  5M3F H;  1SE2 A;  3KF6 A;  1Y1V G;  3NEN A;  2HDM A;  4BXX G;  1DD2 A;  3GD7 A;  3IKJ A;  4OGQ C;  3Q23 A;  4F7X A;  2OTJ A;  2E2I H;  2UUC Q;  1DOL A;  2A69 C;  2IWH A;  4DR6 Q;  1TWG H;  2JA8 H;  3CCU A;  2QGQ A;  5TSS A;  3DWP A;  1QZG A;  1PZJ D;  2PNR C;  1H9J A;  3TEH B;  2YU9 B;  1VQK A;  5C4X B;  3DXJ C;  2JYO A;  3MTS A;  3CC2 A;  1WFQ A;  2F0N A;  2XN9 C;  1CUK A;  3JAM L;  1ICF B;  2RCF A;  3DMU A;  3J81 L;  1C9O A;  4RG1 A;  4LF5 L;  5IT9 E;  1NAP A;  4OO1 G;  1QNK A;  4IPC A;  1SYD A;  3LNN A;  2QW7 A;  3HOY B;  2X6G A;  4PV1 C;  4ULL A;  5M5W B;  1I4R A;  2Q8T A;  3I91 A;  3CCR A;  1LLR D;  1IW7 C;  2E74 C;  5DEH A;  3BJU A;  1YNJ C;  2PQA A;  3JAM c;  2DNC A;  1Y1W G;  4DNT B;  3W3A A;  2JA7 G;  1HNZ Q;  4B3R Q;  1K3B C;  4LWC A;  4JI8 Q;  4LW1 A;  1HXY D;  1XNQ L;  2XGT A;  2Z6B A;  3HOZ B;  4RKL A;  2JE6 I;  3CC7 A;  2C5C A;  3CCV A;  1EFI D;  4ZCK A;  5M9O A;  2FXQ A;  4J1M A;  1I6H H;  3K0X A;  1QB5 D;  4DFA A;  2JA6 H;  4NB3 A;  1VQH A;  1IBL L;  1PFS A;  1K0R A;  1K3R A;  2BE5 C;  2F1M A;  4LFA L;  1Q7Y C;  5CV9 A;  3K7U C;  2PZW A;  1JWU D;  1W6K A;  4A3D H;  1SMY C;  3MC0 B;  4A93 G;  1XMO Q;  4A75 A;  1U5K A;  2B8G A;  5D14 A;  5I6Y A;  3S2D B;  1M1K C;  4L5T A;  1STG A;  1PVO A;  2KCN A;  1RIP A;  1JE5 A;  1Y8P B;  4X66 Q;  3KK7 A;  3IL8 A;  1X3F A;  1B53 A;  3RD4 A;  1K9M C;  1V1P B;  4K6D A;  1KDA A;  4DKA C;  4XQJ A;  1R9T B;  4HMJ A;  1Q1E A;  2EY2 A;  2NN6 G;  3K5L A;  2R3Z A;  1RDP D;  4IAL A;  5JJI A;  5CV7 A;  1Q46 A;  3TP6 A;  2ZJP A;  4JYA L;  1HZB A;  2YU9 H;  1IYV A;  1KDB A;  5C4X H;  4KKS A;  3CQZ H;  4JG2 A;  1VQ6 A;  4HSV A;  2XIW A;  2IT1 A;  3P1H A;  4IUP A;  2QF7 A;  1PV4 A;  1MGS A;  4K8I A;  1JJ2 A;  5NUC A;  3QOJ A;  3C2P A;  3F1Z A;  1AZP A;  3CCS A;  3CPF A;  3HOY H;  2F3I A;  4S3S A;  2FMM A;  3T1Y Q;  2ZTD A;  4QIW E;  3UDG A;  4JI7 L;  1MI2 A;  1HA5 A;  3IAY A;  1OXX K;  3OHX C;  5IYC G;  1LTR D;  3BU2 A;  1KAA A;  2NTT A;  2A6H D;  1VS0 A;  4NPS A;  3M7N A;  2HDL A;  3TME A;  3B6Y A;  1Q86 C;  3KLR A;  3PCO B;  2UXD Q;  3PIO A;  1O7Z A;  2EDG A;  3KBX A;  4CGY B;  5E4W C;  1SNQ A;  3NQI A;  2MJ8 A;  2X6L A;  3I90 A;  1CQV A;  1B44 D;  1NMG A;  4GLV B;  5IWA L;  1HHV A;  1PYB A;  3K7A H;  5K5P A;  5KNC A;  1YHA A;  3G48 A;  4TSS A;  2K28 A;  4ZLT F;  1AH9 A;  2RHQ B;  1O80 A;  3H94 A;  2PZU A;  2B63 B;  3K8A A;  4GKK Q;  3VYU A;  4MTK A;  2ID0 A;  2K75 A;  1Z7T A;  1G2T A;  1EY9 A;  4YCV A;  2E75 C;  2R92 G;  1R9T H;  1W6J A;  3HOV B;  3DEP A;  1WD1 A;  3H3V I;  4RCO A;  1WTX A;  1T9H A;  4ZKC B;  2OQ0 A;  3HOW H;  1NSN S;  1EQV A;  1II3 A;  3BDO A;  2PI2 E;  2EYP A;  4LFB L;  3S15 B;  3A56 A;  3U50 C;  3R2T A;  3PO3 H;  2K6A A;  2FHT A;  3M3Y B;  2IY5 B;  5I9P A;  1STY A;  5LL6 S;  1TS2 A;  1F2M A;  3FP9 A;  3HZX A;  3CCL A;  4IUU A;  2A68 C;  3E9I A;  5J3B A;  3NPP A;  3KFU A;  2VL6 A;  4CDC C;  5EJW A;  2F0U A;  4JOI A;  3IRB A;  1QWY A;  1B9M A;  4BA1 I;  1IW7 D;  2Q2H A;  1SJE D;  1YNJ D;  1R4P B;  3AU7 A;  1YEZ A;  4B3T L;  4LF5 Q;  2JN4 A;  4C2M H;  4XYQ A;  3I4N B;  3PUZ A;  1WTQ A;  3TS0 A;  4XT3 B;  2GN5 A;  2K4K A;  4UY8 C;  1T5X D;  3RN2 A;  1SEB D;  5IE8 A;  4DR4 L;  4P2C B;  2IX0 A;  4DGZ A;  1RL2 A;  3S16 B;  5FLX L;  2BE5 D;  2LMC B;  2OF1 A;  3BYY B;  1G29 1;  2K5H A;  3Q0A A;  3TQY A;  1XNQ Q;  2GVA A;  4C3I H;  4DAY B;  1EIF A;  4B08 A;  2EYL A;  1VQ7 A;  3F2B A;  1Q90 A;  4IFD I;  3HOZ G;  1X3G A;  2YYZ A;  2CKZ B;  4YIJ A;  2Q2U A;  2D0P A;  3BYT B;  1IBL Q;  2BDO A;  1LUZ A;  1NCV A;  2N55 A;  2AWN A;  4LFA Q;  3LWU A;  2DN8 A;  4GNX A;  4KLK A;  2EZV A;  1PA6 A;  3GTJ B;  1H9R A;  4JW0 A;  5FLX c;  4FVM A;  2B63 H;  2PMZ B;  1SJH D;  3PO2 B;  4YWM A;  3IFT A;  5EBC A;  2XVS A;  1ENC A;  3PIP A;  4BY1 B;  1K83 H;  4KN4 C;  4JI5 L;  1SYC A;  1GXD C;  1A6X A;  3VYR A;  4F88 A;  2R7Z G;  2IL8 A;  3OTO L;  4YCU A;  5JAV A;  2QDB A;  1SXT A;  3U9O A;  2VUM H;  3L2P A;  2HUG A;  1VCI A;  2Z6K C;  2HCI A;  1BF4 A;  2JEA I;  4XXE A;  4FF2 A;  1A62 A;  2MUY A;  4QCL A;  4R4C A;  4JYA Q;  3T1H L;  3M7G A;  2EOT A;  4ZAI A;  5EBD A;  1ML0 D;  1SN8 A;  4DV1 L;  1AE2 A;  1E22 A;  1WCM B;  2N49 A;  4RWS C;  1CFM A;  1HTL D;  3GP7 A;  1K8A C;  1EFW A;  2WIN B;  1STB A;  2V4D A;  3I4N H;  3K5M A;  1HNW L;  4JI7 Q;  4LUZ A;  5C44 G;  1EYG A;  3GTQ H;  1EYD A;  2G9D A;  3T4A C;  4XTC S;  1C8C A;  2KEN A;  4IPG A;  3S24 A;  5CGK A;  3NXW A;  1RCV D;  3S16 H;  5COY A;  3OSO A;  2VB2 X;  2CHB D;  2IPK D;  2Z1C A;  4GNX B;  3HOX B;  3SK6 A;  2ZTC A;  1EEI D;  3NBH B;  1BXT A;  1S5D D;  5M3M B;  2MFI A;  2SEB D;  3NTI A;  5IWA Q;  1KLG D;  1GOZ A;  1SMX A;  1ZEQ X;  4DXF A;  1SNO A;  2A6E C;  4JI6 L;  1TWF H;  2PCF B;  1SYG A;  3GTK H;  4QMG A;  4OEM B;  1BQQ T;  1OXT A;  1Q82 C;  2NYZ D;  3S17 B;  1TWH H;  3A5Z B;  5KRU A;  2ICE C;  1HNX L;  4R8N A;  4HN7 A;  2G9H D;  3NWS A;  2NVY H;  4LNQ A;  5ELN A;  1ESF A;  1TU2 B;  5ELB A;  3CD6 A;  2Z4H A;  3RLO A;  4HJ9 A;  3RR5 A;  3D4D A;  3HOV G;  1V1Q A;  2EYO A;  4LMQ D;  1G8Z D;  2OTL A;  2O4X A;  3MXN B;  1ILP A;  4PMW A;  1SFO H;  4LFB Q;  2ASB A;  4ODG A;  2A74 C;  3CRL C;  1ASZ A;  3TRE A;  2Q2I A;  3DWA A;  5A2Q E;  4FP5 D;  2UUB L;  3PF5 A;  1LYL A;  4A3C G;  2E8G A;  4A3K G;  1PH8 A;  5CC4 A;  5IGB A;  1TS3 A;  5BR8 L;  2NTS A;  4K5V A;  3TP8 A;  2PYK A;  3I8Z A;  1E2W A;  4B3T Q;  5C4Z A;  1U4P A;  2EVB A;  1P16 A;  3L0O A;  2C35 B;  2BA1 A;  3T53 B;  1AFP A;  5GRO A;  1A3V A;  3NSW A;  3MHB A;  4OEL B;  3A7L A;  2LFN A;  4DR4 Q;  2OEO A;  2XNA C;  4LUV A;  3S1N B;  5JPM C;  1KDC A;  1H9S B;  1L0Y B; 
#chains in the Genus database with same CATH homology
 1K8G A;  1IBK Q;  3M85 A;  5IYD H;  2PQA B;  4DK3 C;  4DNI A;  2N8N A;  4HIK A;  4IFD J;  1L2F A;  1CSQ A;  1QVC A;  4BA2 I;  3HOW G;  2AHO B;  2K14 A;  2AWO A;  2R7D A;  4UP9 A;  4YHH L;  3ULP A;  1KQS A;  2AMC B;  1N9W A;  2DUD A;  3M4P A;  5H1S E;  4OX9 Q;  4GKK L;  4A76 A;  1XPR A;  1VQN A;  5M5W H;  1N32 Q;  2Z6K A;  2K50 A;  1UE5 A;  1SE8 A;  3PV0 A;  4DR1 L;  2RCN A;  2VQF Q;  4B3M Q;  2PI2 A;  1CKN B;  5M3F H;  1PH9 A;  2ATW A;  3KF6 A;  3S17 H;  1Y1V G;  3NEN A;  1I94 Q;  4BXX G;  4LF6 L;  3G4S A;  1A0I A;  1IYJ B;  3GD7 A;  4DUY L;  2CWA A;  1YJN A;  4HJ8 A;  1VQ9 A;  2K52 A;  4C3J H;  2OTJ A;  3PO2 G;  3EBE A;  5JEA J;  5C4J H;  2E2I H;  2CWP A;  3J81 j;  2UUC Q;  4DR6 Q;  1U0L A;  4HID A;  4JI5 Q;  1TWG H;  1IBM Q;  1J5E L;  4BY1 G;  2JA8 H;  3CCU A;  2NZH A;  2QGQ A;  3CP0 A;  3HKZ E;  3HOZ H;  2I5L X;  5GQO A;  1QZG A;  3I7F A;  1SR3 A;  3AQQ A;  4KI0 A;  2MNA A;  3OTO Q;  2UU9 Q;  1YVC A;  4AYB G;  2A19 A;  3TEH B;  1VQK A;  4A3E H;  2JK8 A;  2PNH A;  4PZ6 A;  3CC2 A;  4JBM A;  1WFQ A;  1CUK A;  3I4M G;  1BBU A;  4JI3 L;  1C9O A;  3FHW A;  4MZ9 A;  3F8T A;  4PG3 A;  3AYH B;  4X65 Q;  2JA9 A;  4RG1 A;  3T1H Q;  4LF5 L;  2XTI A;  3S2D H;  4OO1 G;  3H0G G;  4DV7 L;  4A3L H;  4IPC A;  2R7Z H;  3U4V A;  5LMU Q;  4JI4 Q;  1HZC A;  1M90 C;  3KYH C;  1YNX A;  4JI1 L;  4R4O A;  4DV1 Q;  4YWL A;  1XPU A;  4BBS H;  4K0K Q;  5IP7 H;  1WCM G;  4IJH A;  1SLJ A;  5LMN Q;  4JBJ A;  3UE1 A;  1NE3 A;  4POF A;  3CCR A;  4JCV E;  5M5X H;  1N8R C;  1O7I A;  2KCM A;  3JAM c;  3BJU A;  2PQA A;  1Y1W G;  1KRS A;  3CPW A;  1HNW Q;  4DV3 L;  4HIO A;  2JA7 G;  4X6A H;  2B63 G;  4J15 A;  1PH2 A;  1L1O C;  1HNZ Q;  4B3R Q;  4JI8 Q;  2I5M X;  4LWC A;  1NMF A;  4LW1 A;  4A3F H;  1FJG Q;  4JOI C;  4YY3 L;  1XNQ L;  2F52 A;  2XGT A;  1PH6 A;  4A4I A;  3HKS A;  4P72 A;  3KLW A;  4OO1 I;  4GOP C;  2DGY A;  2JE6 I;  3CC7 A;  4A3M G;  5FLM H;  5AJ3 L;  1PH7 A;  4BXX H;  1CKN A;  3Q8D A;  3CCV A;  2E2J H;  1HZA A;  2FXQ A;  4DV0 Q;  1I6H H;  1PHJ A;  4GN5 A;  3K0X A;  1EUJ A;  1UE7 A;  4NB3 A;  2JA6 H;  4A3B H;  1VQH A;  3HOX G;  1IBL L;  1PFS A;  1B8A A;  1K0R A;  1K3R A;  1XJV A;  4GLA C;  4LFA L;  1Q7Y C;  4L5R C;  3RZO H;  3K7U C;  4P74 A;  1X56 A;  1PH1 A;  4LF9 Q;  4A3D H;  4JI2 L;  4A93 G;  2NVQ H;  1XMO Q;  3CMA A;  3S1M H;  3UE0 A;  1X65 A;  4A75 A;  1U5K A;  4JI6 Q;  4NXN L;  1M1K C;  1Q1B A;  2PMZ E;  4L5T A;  1B7Y B;  1PVO A;  2MO0 A;  4X64 L;  1RIP A;  2YV5 A;  1JE5 A;  4FDB A;  4X66 Q;  4LF7 L;  3M4O H;  1QZH A;  1HH2 P;  5FJ8 H;  1JMC A;  1X3F A;  3HFZ B;  1S40 A;  1K9M C;  4DKA C;  4JV5 L;  1N33 L;  1Q1E A;  2NN6 G;  4DV2 L;  1HNX Q;  4X62 L;  4AYB E;  2F4V Q;  4BBR H;  3RLN A;  5JJI A;  1Q46 A;  3GTM H;  4GN4 B;  3J81 i;  2ZJP A;  4OWX B;  4DV6 L;  3I4N G;  4XIG S;  1E24 A;  1OXU A;  4GNX C;  3S14 H;  4JYA L;  2UXC L;  2HHH L;  1X9N A;  1HZB A;  2YU9 H;  1QUQ B;  3J7A 5;  4DR3 Q;  1GM5 A;  4GKJ Q;  1UEB A;  5C4X H;  4JBK A;  1NBW A;  3CQZ H;  4JG2 A;  1VQ8 A;  3S1Q H;  2KHI A;  2R93 G;  1VQ6 A;  1XTD A;  4DV5 L;  3SGI A;  1W3S A;  2IT1 A;  1Y1W H;  1PV4 A;  4LFC Q;  1YBY A;  2JA7 H;  1VQ4 A;  4LF8 L;  3CW2 C;  4JC0 A;  4APV A;  1KD1 C;  3CF5 A;  1JJ2 A;  3UDF A;  5IYB H;  3EIV A;  1GKH A;  3A74 A;  3F1Z A;  1KIX A;  2HT1 A;  2HIV A;  5IY0 A;  3KDF B;  2NN6 I;  3WWV A;  3CPF A;  3CCS A;  2UUB Q;  3HOY H;  2F3I A;  3PUX A;  4MNO A;  1L0W A;  1LTL A;  3CXC A;  3OW2 A;  3T1Y Q;  4A3M H;  2ZTD A;  2LSS A;  1WYD A;  1FVI A;  4QIW E;  2JEB I;  2Y0S G;  3H15 A;  3MEF A;  4DUZ L;  3UDG A;  4UP7 A;  1VQF A;  3HOV H;  5BR8 Q;  3VDY A;  4KHP L;  1KHI A;  1OXX K;  5IYC G;  2ZJR A;  1L1O B;  4YCW A;  1YHB A;  1BBW A;  4A3G H;  3BU2 A;  1VS0 A;  4NPS A;  1EOV A;  1XPO A;  3M7N A;  2JA5 G;  3S15 H;  2ES2 A;  3B6Y A;  3HOU G;  3LGJ A;  1Q86 C;  3PCO B;  2UXD Q;  5DLQ E;  4GOP B;  3PIO A;  1VQL A;  4A3J G;  4WJ3 M;  2ZJQ A;  1YJW A;  3M3Y H;  1VQC A;  1Z47 A;  5EAY A;  4ME3 A;  1AE3 A;  2ZM6 L;  1VQM A;  4A3C H;  1G51 A;  4A3K H;  1B70 B;  5C3E G;  1VQG A;  3M4Q A;  4GLV B;  1NMG A;  1JB7 A;  2ZTE A;  5IWA L;  1TWC H;  2VQE L;  3KJO A;  4A3I H;  1PYB A;  3K7A H;  5GAE C;  1HZ9 A;  1YHA A;  2UXB Q;  1D8L A;  3G48 A;  3PUY A;  4HJ7 A;  4B3S L;  1X3E A;  5C0X G;  1YHQ A;  2KBN A;  2NVT H;  4IOA A;  2LXK A;  3FKI H;  1Q8K A;  1MIU A;  1AH9 A;  2RHQ B;  4JBW A;  4DV4 L;  1MJC A;  3CME A;  4IO9 A;  2B3G A;  3GTG H;  1N36 L;  4YHH Q;  2UUA L;  3K8A A;  2OQK A;  4GKK Q;  4Y52 H;  1MKH A;  4GS3 A;  2ID0 A;  2K75 A;  3PUV A;  4PZ8 A;  4DR1 Q;  4DR5 L;  1QUQ A;  1IL2 A;  5K36 G;  1UWV A;  4YCV A;  2KHJ A;  1A8V A;  2QA4 A;  1EWI A;  4LF4 L;  3UDI A;  2Q2T A;  2R92 G;  1R9T H;  2RHS B;  4LF6 Q;  4DUY Q;  4HJA A;  4AQY L;  3H3V I;  1NY4 A;  1UE1 A;  2N3S A;  4DR2 L;  1T9H A;  1VQB A;  4GN3 B;  3GTO H;  2OQ0 A;  3HOW H;  2WAQ G;  4O2D A;  5C0X I;  4P73 A;  2PI2 E;  4LFB L;  1LM0 A;  1S3O A;  1J5E Q;  3U50 C;  3PF4 A;  4YWK A;  3PO3 H;  3KDF A;  3KJP A;  2I5H A;  4UP8 A;  4C3H H;  1VQ5 A;  2IY5 B;  1XMQ L;  2CCZ A;  1KC8 C;  1K73 C;  3CCE A;  1Y1V H;  1I50 H;  2MO1 A;  1VQE A;  3FP9 A;  1E1T A;  3CCL A;  1L1O A;  5J3B A;  3E9I A;  3ICE A;  3GTJ H;  3KFU A;  3G71 A;  2VL6 A;  4X66 L;  3PO2 H;  2KCT A;  3GDE A;  4EQ5 A;  4JOI A;  3U58 A;  1XNR L;  3IRB A;  4MTN A;  2JJQ A;  1I3Q H;  2RF4 A;  5HY6 A;  5FLM G;  2Y0S E;  1VQO A;  4JI3 Q;  4BA1 I;  2VUM G;  2Q2H A;  1CKM A;  4HIM A;  4GOP A;  4BY1 H;  2CFM A;  1YEZ A;  4B3T L;  2OCE A;  4LF5 Q;  2QEX A;  2E5L L;  5M3M G;  5C3E H;  4DV7 Q;  3ZJY C;  4KHZ A;  1HR0 L;  4C2M H;  3RLF A;  4JI0 L;  1I5F A;  1E1O A;  2B29 A;  3F2C A;  3K81 C;  4Y7N H;  4NXM L;  3PO3 G;  4QY7 A;  4DR7 L;  3PUZ A;  4JI1 Q;  1HR0 W;  3ULJ A;  2R6G A;  3J80 i;  3TS0 A;  2GN5 A;  2WFW A;  4LUO A;  4R4Q A;  3G6E A;  4IOC A;  2VNU D;  2K4K A;  4UY8 C;  1E7Z A;  2VW9 A;  1YZ6 A;  1OTC A;  1IXR A;  3RN2 A;  4QJF A;  3I4M H;  1KAW A;  5IE8 A;  4IFD G;  5M3F G;  4QQB X;  4DR4 L;  2IX0 A;  2EXD A;  1RL2 A;  4DV3 Q;  1IBK L;  1VQJ A;  1EQR A;  3H0G H;  1BKB A;  1G29 1;  1SRU A;  2AKW B;  2K5H A;  2R7F A;  3JAM i;  4L5S A;  4YY3 Q;  2HQL A;  3TQY A;  5JEA G;  1MJE A;  1DGS A;  1VQA A;  2GVA A;  1Z9F A;  1XNQ Q;  4C3I H;  5IT9 c;  4DAY B;  1EIF A;  1SRO A;  2GVB A;  4OX9 L;  1C0A A;  1VQ7 A;  2R92 H;  2JA8 G;  3F2B A;  5AJ3 Q;  1HJP A;  1N32 L;  4IFD I;  2IX1 A;  1X3G A;  3HOZ G;  1WCM H;  4TQU S;  3STB C;  1OXS C;  2YYZ A;  2CKZ B;  5JJK A;  4HJ5 A;  2L15 A;  2VQF L;  4GLX A;  2Q2U A;  4B3M L;  1GD7 A;  2D0P A;  1V43 A;  1IBL Q;  1LUZ A;  1JJC B;  2AWN A;  1I94 L;  4LFA Q;  2WB1 G;  4GNX A;  4KLK A;  1PA6 A;  2B63 H;  4A3E G;  1H95 A;  5FLX c;  1JJG A;  3BZC A;  4YWM A;  1YI2 A;  2YTX A;  4OXP A;  1NTG A;  4PZ7 A;  3PIP A;  5GAD C;  2UUC L;  2IHE A;  2BH8 A;  4BY7 G;  1K83 H;  4NXN Q;  4JI5 L;  1IBM L;  3K80 C;  3RNU A;  4DR6 L;  3GTP H;  4X64 Q;  2WAQ E;  4A3L G;  4LF7 Q;  2R7Z G;  1GVP A;  3NEL A;  3OTO L;  2VS1 A;  2IHF A;  3HOX H;  2UU9 L;  4JV5 Q;  4YCU A;  4QL5 A;  3OYY A;  3CCJ A;  1N33 Q;  3L2P A;  4DV2 Q;  2VUM H;  4BBS G;  5IP7 G;  2BH2 A;  1VCI A;  2Z6K C;  4ALP A;  4X62 Q;  1W2B A;  2EQS A;  3AFQ A;  4H02 A;  5M3M H;  2JEA I;  3ERS X;  3I2Z A;  3TS2 A;  4A93 H;  1A62 A;  4QGU A;  4IPH A;  4DV6 Q;  3PGZ A;  3ER0 A;  2HIX A;  4R4C A;  4X65 L;  4JYA Q;  3PSI A;  2UXC Q;  2HHH Q;  3T1H L;  1GO3 E;  3CCM A;  1WJJ A;  2H5X A;  3PUW A;  4A3F G;  1SN8 A;  5LMU L;  1ASY A;  4JI4 L;  4WJ4 A;  4DV5 Q;  1KXL A;  1A63 A;  2OWO A;  2YTY A;  4DV1 L;  2N78 A;  1VQP A;  4K0K L;  1AE2 A;  1E22 A;  3J7Z C;  5M5Y H;  1X6O A;  4LF8 Q;  2NZO A;  2N49 A;  3I4O A;  3DLL A;  5LMN L;  1TWA H;  5IP9 G;  1K8A C;  2JA6 G;  3A0J A;  1EFW A;  4A3B G;  5LMN W;  2NVX H;  2VZA A;  3AEV A;  1PYS B;  3I4N H;  1HNW L;  3CCQ A;  5E7N A;  4JI2 Q;  1N34 Q;  1HNZ L;  1JT8 A;  4JI7 Q;  3JC6 6;  4LUZ A;  5C44 G;  1EYG A;  2Z0S A;  2BA0 A;  4DUZ Q;  4JI8 L;  4P71 A;  4DK6 C;  1E3P A;  2E2H H;  3GTQ H;  4B3R L;  1FJG L;  3TRZ A;  4A3D G;  4KHP Q;  2R93 H;  3S2H H;  1EIY B;  4XTC S;  4DPG A;  2ALY B;  2KEN A;  4IPG A;  5ELO A;  3CC4 A;  3S24 A;  3S16 H;  3E0E A;  3U4Z A;  3W1B A;  1YJ9 A;  4DV0 L;  4GNX B;  4UPA A;  5FJ8 G;  1Q81 C;  2ZTC A;  3NBH B;  3L7Z C;  4POG A;  4R1J A;  2ZM6 Q;  4BY7 H;  4OWW B;  3CAM A;  2MFI A;  1BVS A;  3UDX A;  3J80 c;  1V9P A;  1KL9 A;  5IWA Q;  5IYC H;  2VQE Q;  2V1C C;  1SMX A;  2WB1 E;  3M9B A;  4BBR G;  4LF9 L;  2YTV A;  1XMO L;  1Q12 A;  4JI6 L;  4TVA B;  1TWF H;  4B3S Q;  1OXV A;  4EX5 A;  4AIM A;  2JQO A;  1S72 A;  1PH3 A;  2JA5 H;  3GTK H;  3HOU H;  4JI7 L;  5C4X G;  3E9H A;  1KRT A;  1OXT A;  1PH5 A;  1Q82 C;  2A8V A;  4DV4 Q;  4A3J H;  1IZ6 A;  1N36 Q;  1TWH H;  3RZD H;  2UUA Q;  3GTL H;  3A5Z B;  3GO5 A;  5IYD G;  4DAM A;  3J81 c;  1CSP A;  1EQQ A;  2I0Q A;  1YIT A;  1HNX L;  2F4V L;  5IYB G;  3I55 A;  3H3V H;  2NVY H;  4LNQ A;  1NJI C;  1FL0 A;  2A1A A;  4DR5 Q;  4L5Q A;  5GAH C;  3HOY G;  4LF4 Q;  5ELN A;  4IJL A;  2K5N A;  4OON A;  1QVF A;  3CD6 A;  5C0X J;  3RLO A;  4HJ9 A;  1PH4 A;  3S1N H;  4DR3 L;  3RR5 A;  4AQY Q;  1VQD A;  4GKJ L;  3KF6 B;  3HOV G;  1V1Q A;  4DR2 Q;  3I56 A;  1UE6 A;  5IP9 H;  1N34 L;  2OTL A;  3HKZ G;  3MXN B;  4PMW A;  4A3G G;  1SFO H;  4LFC L;  4LFB Q;  4P75 A;  1VQI A;  2ASB A;  5GAG C;  2LXJ A;  3F2D A;  5HGQ A;  5C44 H;  2EIF A;  1ASZ A;  3TRE A;  2Q2I A;  3D31 A;  3D0F A;  1XMQ Q;  4OWT B;  3PF5 A;  4IPD A;  2UUB L;  1G6P A;  3RN5 A;  2VY3 A;  1LYL A;  3T1Y L;  1FGU A;  2E8G A;  4A3K G;  1PH8 A;  4A3C G;  4O0A A;  2D62 A;  1TXY A;  4RMF A;  5BR8 L;  3W1G A;  3AFP A;  4A3I G;  3A5U A;  1X55 A;  1CKO A;  1XNR Q;  1C7Y A;  4AH6 A;  3NEM A;  4R4T A;  1YIJ A;  3DM3 A;  4B3T Q;  2MQH A;  2CQO A;  1P16 A;  1P8L A;  1WOC A;  4R4I A;  3L0O A;  3W5O A;  1X54 A;  2K5V A;  3FKI G;  2E5L Q;  3KOJ A;  2UXD L;  1QVG A;  3ULL A;  1HR0 Q;  4JI0 Q;  5JJL A;  2C35 B;  4DR7 Q;  4NXM Q;  2BA1 A;  1WI5 A;  3BZK A;  3KF8 B;  5GRO A;  3EN2 A;  1Y14 B;  3S1R H;  1D7Q A;  2WP8 J;  3STB D;  1J6Q A;  4DR4 Q;  4LUV A;  2D0O A;  2UXB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...