4Y52H

Crystal structure of 5-carboxycytosine recognition by rna polymerase ii during transcription elongation.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for 5-carboxycytosine recognition by RNA polymerase II elongation complex.
pubmed doi rcsb
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2015-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4y52H00
4A3GG 3OTOL 4RMFA 4JBMA 2UUCQ 2HT1A 3PUVA 1C0AA 1E22A 2PI2A 4PZ6A 1VQFA 4B3SL 3GTGH 4LNQA 4GKKQ 2E2JH 4BBSG 5GQOA 1L1OA 1HZBA 2JQOA 3ZJYC 1QZHA 2CQOA 3PF4A 3W5OA 3J7A5 2VQFL 4LUVA 3HOZG 3E9HA 3TRZA 5C0XG 4A3CH 4OO1I 1Z47A 2IX0A 3K80C 1TXYA 4P73A 4DV4Q 4UPAA 4LFCL 3I4MH 3KF6A 1HNZL 2LSSA 1VQOA 3CC7A 4OX9Q 4JOIA 1YNXA 1IBLL 1PH3A 3PV0A 1HZCA 4DR4Q 4DR6Q 3S16H 1JT8A 2UXDL 4JI6Q 3HKZG 2ZJQA 4BY7G 1MKHA 1QVFA 4OWXB 3S1MH 1CKNB 4GN5A 1PH7A 4YWKA 4KHZA 3S1RH 1VQPA 1KRSA 4NB3A 4DV7Q 4B3SQ 1JB7A 3H3VI 2I5MX 3GTQH 2Y0SE 4JI8L 1ASYA 2QGQA 4YCUA 2B29A 1K8AC 2R7ZG 5GROA 4JI1Q 4IPDA 2JA7G 3G4SA 4A3FG 4YY3Q 2K5NA 4OONA 1WYDA 2OTJA 3I56A 4BY7H 1OXSC 1EWIA 3CPFA 2RHQB 2ZJPA 1BBUA 1Q12A 1TWAH 1Y1VG 2N49A 2EXDA 2DGYA 5J3BA 2JA9A 5LMNL 4HJ5A 1JJ2A 2K14A 2BH2A 4JYAQ 1UEBA 2R7DA 1AE2A 1MJCA 4R4CA 1EQQA 3K0XA 4JC0A 2Q2IA 3MEFA 4X64L 5C44H 3RNUA 4JI8Q 4GNXA 1VCIA 4DR7Q 2WB1E 4X66Q 1HNXL 4LF6L 1UE6A 5K36G 2IT1A 1HJPA 1YBYA 1OXXK 1WFQA 5IP7G 4A3IG 2R6GA 3AYHB 5LMUL 1Q8KA 3HOWG 2YTXA 2IY5B 4A3FH 1CSQA 4QY7A 1RL2A 3UDIA 4IOCA 3OTOQ 2NVYH 1N36Q 3RLOA 1FJGL 1EQRA 2NVQH 1YVCA 2BA0A 4MNOA 3ULPA 3KOJA 1VQ6A 3U4VA 4IJHA 2Q2TA 4A76A 2OQKA 3I4MG 3AFQA 4A3JH 1TWFH 1NE3A 5M3MG 4HJ8A 1N34Q 3S15H 3W1BA 4MTNA 2CWPA 4J15A 3J80c 4GS3A 1XNRL 1BBWA 1Y14B 3I7FA 1Q1EA 4O0AA 3HOXG 4JYAL 5FJ8H 1YZ6A 5IYDH 5IYCG 4B3RL 2N8NA 2PI2E 4JV5L 4JI2Q 3T1HQ 5IT9c 1E1OA 2VUMH 2EIFA 4A3MH 4QL5A 3F1ZA 4LF4Q 4JV5Q 2NZOA 1V43A 1KIXA 4PG3A 1J5EL 2JK8A 4AYBG 1K8GA 3JAMc 3KLWA 4DV7L 4LFAQ 1PH4A 3LGJA 1X6OA 2D0OA 1T9HA 3KJOA 2KCTA 3HOUH 4DK3C 1OXVA 1YHBA 4JI3L 2K50A 3T1YQ 4JBWA 4JBJA 1XNRQ 2MO1A 2I5LX 2Z6KA 2WAQE 3GTPH 3T1YL 3S24A 1FL0A 4GLAC 2ZM6Q 3NENA 1VQ8A 2ZTDA 3K8AA 1I94L 4KLKA 2ASBA 1YEZA 4ALPA 1PHJA 1HNWL 5IYCH 4LUOA 4P71A 2MNAA 1K73C 4IPGA 2ATWA 1HZ9A 4GKKL 3GTKH 4B3ML 2HHHQ 2E2IH 2NVXH 3GTOH 3M7NA 5IYBG 3PUWA 1YITA 1CKMA 5JJIA 1V1QA 5C4XH 5IP9G 2UUAQ 2F4VL 1SE8A 4IJLA 5C0XJ 4OX9L 2B63H 1KL9A 2WFWA 1X3GA 2C35B 3TEHB 1I94Q 1Z9FA 2IHEA 3PSIA 4JBKA 2JA6G 3G6EA 5M5YH 3J7ZC 2JE6I 3S2HH 4RG1A 4JI7L 3M4QA 1X56A 5IWAL 3EIVA 5C44G 1XMQQ 2UXCQ 2HHHL 1X54A 3CCUA 2N78A 1PV4A 4GOPA 2HQLA 3STBC 3CCLA 1I5FA 4LFAL 3RN5A 1M90C 3J81c 1GVPA 1BKBA 3KF8B 1QVGA 1X3EA 4LWCA 1S72A 2E5LL 3S14H 3PO3G 1I50H 1FVIA 3HOXH 4DV6Q 4JI2L 1VQBA 2R7FA 2JJQA 2NN6G 4JI5Q 1R9TH 3RLFA 1S40A 4YWMA 4C3JH 3KF6B 4YCWA 1VQKA 1LUZA 1OTCA 3F8TA 4PMWA 4IFDI 3NELA 1JJGA 4HIKA 3W1GA 1QZGA 1XNQL 4FDBA 4QIWE 2VW9A 3DLLA 4LF9Q 1L1OB 2F4VQ 5JJLA 3CPWA 2QEXA 3CXCA 2ES2A 4L5RC 4BXXH 3JAMi 5FLMG 4BXXG 2A19A 2UXBQ 1LYLA 3AFPA 3AQQA 1PYBA 2NN6I 3EBEA 1VQDA 2MFIA 1HR0Q 1BVSA 3E0EA 1EIFA 2VQEL 2AMCB 3SGIA 3ULJA 4DAYB 3TREA 3M4PA 1K9MC 5M3FG 4L5SA 1PH9A 3CMAA 2KBNA 2UUBQ 1WOCA 3HOZH 1L1OC 4GLVB 3A0JA 1KHIA 1HR0W 3EN2A 3WWVA 5ELOA 2PMZE 3TS0A 1XPUA 2JA8G 1YIJA 4EX5A 1PH1A 2RHSB 2KCMA 4JI4Q 1IBKL 4BA2I 1GO3E 5LMNQ 4JI5L 4P75A 4TVAB 2D0PA 1TWHH 4C3HH 3F2DA 1IBML 1X65A 3CC4A 4A3DG 3B6YA 3CCSA 4DV0Q 2GN5A 5C3EG 1EFWA 1E3PA 2RCNA 3Q8DA 4K0KQ 1VQCA 1Y1VH 1VQHA 2XGTA 3ERSX 3HOWH 3RZOH 3A74A 2JA6H 5M3MH 1KC8C 2UUCL 4X64Q 4DR5L 1SRUA 3AEVA 4LF7L 3UDXA 2R92H 3KJPA 5LMNW 1XPOA 1PH6A 1O7IA 1HNXQ 3ICEA 3S17H 5GAEC 1N32L 4LF9L 3HKSA 2A1AA 4LFBQ 2OQ0A 4DV5L 2KHJA 4A3KG 1MJEA 3CF5A 2ZM6L 4A3MG 1N34L 4DV5Q 1VQEA 3J81i 4DV4L 2Q2HA 2I5HA 3KYHC 1LM0A 1OXUA 1A0IA 4UY8C 4ME3A 3CP0A 3CD6A 3S1NH 4UP7A 2OWOA 4A3GH 2MQHA 1E1TA 5C0XI 3UE1A 4NXML 3L2PA 3GO5A 4R4QA 3GD7A 4HIMA 5FLXc 2PNHA 3DM3A 1E24A 1YHAA 3CAMA 4LW1A 3RR5A 3MXNB 4YHHQ 2JA7H 1HR0L 4IFDJ 4X65Q 1WCMH 2E2HH 3STBD 4DV3L 4A3KH 2LXJA 4WJ4A 1TWCH 1K3RA 4LF8Q 1IBKQ 3I4NH 1SLJA 3OYYA 5H1SE 4XIGS 1XMQL 4LFBL 1P8LA 3BU2A 3A5ZB 3VDYA 4OO1G 1N33Q 3PUXA 4L5TA 5AJ3Q 4DV2Q 5JEAG 2IHFA 1B7YB 4R4TA 3KFUA 3CW2C 4A3CG 1Y1WG 2JA8H 4YHHL 4APVA 4LF4L 2UU9L 3H15A 1J6QA 1VQIA 3FHWA 3GTJH 1UE5A 3F2BA 4DR2L 3K7UC 1YI2A 1PA6A 1J5EQ 4XTCS 4B3TQ 3BZKA 3PGZA 2VY3A 4OWTB 3JC66 1SFOH 3OW2A 2UXDQ 2FXQA 3GDEA 2K5VA 5GAGC 3U58A 5JJKA 4R1JA 2NZHA 2YV5A 1PYSB 4HJAA 2IX1A 1H95A 1VQ9A 3FP9A 2UXBL 4DR4L 4NXNL 4GKJQ 4GOPC 3PO2G 2YU9H 2MO0A 4IOAA 2AHOB 1UE1A 4PZ7A 5IP9H 3RN2A 5C4XG 2VQFQ 4IO9A 4X65L 3TQYA 2LXKA 4LF7Q 2K5HA 3H0GH 4KHPL 1NMGA 3PUZA 4GN4B 2I0QA 4POFA 1YJWA 3CQZH 2GVBA 1IBMQ 5IE8A 3CCVA 1PH8A 1IZ6A 4BBSH 4B3RQ 3L7ZC 3S1QH 3PIPA 1PH5A 5HY6A 2VL6A 1JJCB 4NXNQ 4GKJL 4AYBE 1PVOA 4TQUS 5DLQE 1GM5A 3BZCA 4X6AH 1IL2A 3CCJA 2R7ZH 3HFZB 3PO2H 1U5KA 4H02A 5M5WH 4QJFA 2NVTH 1I6HH 5E7NA 4YY3L 2CCZA 3F2CA 4IPCA 1N36L 4R4IA 2QA4A 4BA1I 4DR5Q 1XPRA 4HIOA 4A3BG 2F3IA 4A4IA 4DR2Q 2CKZB 2Z6KC 4X62L 1Q86C 2Y0SG 3L0OA 3BJUA 2CFMA 1N8RC 1HH2P 4X62Q 1ASZA 4AQYL 3J80i 3CCRA 4OXPA 5IY0A 2H5XA 4DV0L 1A63A 5C3EH 2K4KA 5FJ8G 1VQLA 2AWNA 4BBRH 4DR6L 1Y1WH 2B63G 2ZJRA 2K75A 2ID0A 4JG2A 2JA5G 4YCVA 1Q81C 1XNQQ 2VUMG 4R4OA 1AH9A 3G48A 2RF4A 3A5UA 5M5XH 1XJVA 4O2DA 5IYBH 4KI0A 4EQ5A 3ULLA 1SROA 2N3SA 4OWWB 1V9PA 5BR8Q 1G6PA 2V1CC 1X9NA 4AIMA 4BY1H 3K81C 4C2MH 1W2BA 1E7ZA 1KD1C 4LUZA 2VQEQ 4B3TL 4KHPQ 1FGUA 3RLNA 1I3QH 1K0RA 1Q7YC 4LF6Q 1GKHA 4DKAC 2JEBI 4HJ9A 3I4NG 4DV1L 4DR1Q 1G51A 5ELNA 5LMUQ 1VQJA 4JI0L 1UWVA 2CWAA 4NPSA 1L0WA 3CC2A 2UXCL 3U50C 5AJ3L 1W3SA 1B70B 4DR3L 2XTIA 3HOUG 1B8AA 4BY1G 1XTDA 1XMOL 5IP7H 4A75A 1VQMA 2GVAA 4GN3B 3U4ZA 1A8VA 1YJNA 1Q82C 4P74A 2B3GA 1CKOA 3TS2A 1XMOQ 2VNUD 1L2FA 1RIPA 4GNXC 1CUKA 3H3VH 4GOPB 1KQSA 1KAWA 1TWGH 1KXLA 1SR3A 4C3IH 1N9WA 1EIYB 3UE0A 3FKIG 2ALYB 5C4JH 3ER0A 1NTGA 1VQGA 3M3YH 3H0GG 4A3BH 4HJ7A 4A3JG 4L5QA 3T1HL 4P72A 3PIOA 3KDFA 3CCEA 3D0FA 4DK6C 3M4OH 1WI5A 4QQBX 4DUYL 3UDGA 5M3FH 4WJ3M 4QGUA 1VS0A 1X3FA 4JI6L 1WCMG 2Q2UA 4JI7Q 1HNWQ 4K0KL 2L15A 4GNXB 1VQ4A 2R93H 5BR8L 5IWAQ 1KRTA 3GTLH 1S3OA 4LF8L 4JCVE 4A3IH 1A62A 2HIXA 4JI4L 4DV3Q 1QVCA 2PQAB 1EUJA 2AKWB 3I4OA 4DR3Q 4A3EH 1HNZQ 2HIVA 1IXRA 3I55A 1CKNA 2Z0SA 1NJIC 4POGA 3CMEA 4A93H 4A93G 3D31A 1JE5A 1G291 4BBRG 2BH8A 2UUAL 3HOYH 3PCOB 1FJGQ 3CCMA 1GD7A 2UU9Q 2JEAI 4JOIC 1M1KC 4A3LG 4A3LH 1CSPA 4GLXA 4DV1Q 4DR1L 1QUQA 3M9BA 1QUQB 1NBWA 3PUYA 4X66L 4DV2L 1YJ9A 4B3MQ 2EQSA 3I2ZA 1IYJB 5EAYA 3J81j 1D8LA 3G71A 4A3EG 2ZTEA 2R92G 2WB1G 4Y52H 1IBLQ 4PZ8A 4LF5Q 3HKZE 2BA1A 5GAHC 1DGSA 1LTLA 4UP8A 2KENA 2YTVA 2PQAA 1X55A 2VS1A 2WP8J 3PF5A 2YTYA 3K7AH 1VQ7A 4A3DH 1NY4A 3HOVH 2OCEA 4Y7NH 4DV6L 1UE7A 4DUYQ 1AE3A 2UUBL 4JI1L 4DAMA 4AH6A 1VQAA 3FKIH 1JMCA 1U0LA 3CCQA 3M85A 4JI0Q 1K83H 4AQYQ 2YYZA 2ZTCA 4DUZL 4UP9A 3UDFA 1YHQA 2JA5H 2A8VA 4DR7L 1PFSA 4NXMQ 3KDFB 4YWLA 2F52A 3S2DH 3PO3H 1C9OA 4DUZQ 3GTMH 2OTLA 1N33L 4IFDG 4IPHA 1Q46A 2KHIA 1HZAA 1OXTA 5IYDG 1WJJA 5GADC 1SN8A 3HOYG 1VQ5A 2VZAA 5JEAJ 1EYGA 2DUDA 1PH2A 5HGQA 3E9IA 3RZDH 1EOVA 1P16A 2K52A 1Q1BA 4HIDA 3IRBA 4MZ9A 1MIUA 2E8GA 4JI3Q 4DNIA 1SMXA 4LF5L 4LFCQ 3HOVG 1D7QA 3NBHB 1C7YA 3NEMA 5FLMH 2E5LQ 2D62A 4DPGA 2AWOA 1VQNA 1N32Q 2R93G 1NMFA 2WAQG
chains in the Genus database with same CATH superfamily
5LL6X 2UUCQ 2K1BA 5C3EB 1T5EA 5COYA 1E22A 3RUZA 3GTGH 3AU7A 1HZBA 3ZJYC 3PF4A 1ENFA 3W5OA 4DU9A 4ZUIA 1QWYA 4OO1I 4DV4Q 2LKVA 3CC7A 1YNND 3K57A 4JOIA 1YNXA 4X3SA 1UUPA 1HZCA 3PV0A 2UXDL 3HKZG 4RHRA 1QVFA 3KF8A 3S1MH 2PCFB 1KRSA 1LABA 4KKUA 3ZYYX 1EY6A 3H3VI 3OMGA 4JI8L 1ASYA 1FR3A 2QGQA 3A56A 3NSWA 5GROA 3I73A 4JI1Q 5BN5A 2JA7G 5I4DA 4YY3Q 1PLFA 2K5NA 5IIFA 1AP0A 2RHQB 1EWIA 4TRDA 1Q12A 2DJFC 4HJ5A 1JJ2A 1LTGD 5J3BA 2NBFA 2K03A 1WTHA 4JK1C 4BBSB 1MJCA 4R4CA 5DNFA 3K0XA 1SYBA 2N55A 4R8NA 3EA6A 5DM63 3M3YB 5FK9C 2CW0C 2PQEA 2WB1E 4X66Q 4HR7B 4B9WA 5FLXL 4A3IG 2R6GA 5IGBA 2YTXA 3K0YA 4IOCA 3VR6A 3K5OA 4RGMA 3OTOQ 2CHBD 1FJGL 1EQRA 3KBGA 3ULPA 1BUVT 2HDMA 1VQ6A 1N34Q 3BYTB 3CRKC 4B9XA 5IODA 4G4KA 1BCPD 5CR3A 1JORA 1NR4A 4GS3A 1XNRL 3SVMA 1Y14B 1H9JA 2VUMH 4A3MH 3T16A 2QDLA 1V43A 4AYBG 1SNMA 3KLWA 3Q0AA 2KCTA 4JI3L 2K50A 4JBWA 1A2UA 2Z6KA 1R4PB 2PZUA 1VQ8A 3S24A 5EBDA 2ZTDA 5JVG3 4ALPA 4NW2A 4CKBA 5JVH3 5CBEE 2EYFA 1K73C 3GTKH 2A73B 1JR0D 3TZDA 3PUWA 5KIXA 4PMBA 5JJIA 1V1QA 1O7YA 2B63H 1VMCA 1DYQA 4KN4C 1KL9A 4QF4A 2WFWA 2H4OA 3HOUB 3TEHB 1I94Q 1V1PA 5M5YH 3M4QA 1K28A 1X56A 5IWAL 5C44G 3VYUA 2N78A 4LFAL 2HQLA 3STBC 1GVPA 1QVGA 1X3EA 4LWCA 2KHSA 2E5LL 4RCOA 3S14H 2JN4A 1I50H 2O5IC 5KNDA 3I8ZA 3HOXH 2ZXPA 1SNDA 1VQBA 1S40A 1E0BA 4YWMA 3KF6B 4YCWA 1OTCA 4PMWA 1BCPF 1JC7A 1TS2A 4LMQD 3EROA 3DLLA 1L1OB 4JW0A 3CXCA 1W6KA 1I3QB 1LYLA 3AFPA 3AQQA 2DNCA 1VQDA 3EBEA 3SGIA 4DAYA 2B2VA 2MHVA 1I50B 1K9MC 3MAQA 1MBYA 5C6AA 1BDOA 4GLVB 3A0JA 1KHIA 4C3JB 3WWVA 5ELOA 1XPUA 3D8GA 1PH1A 3K5NA 2RHSB 2KCMA 4C3IB 3MXPA 3TMEA 1DCZA 4A3BB 2J7ZA 1QJOA 2GN5A 5M5XB 1STHA 1SYDA 2RCNA 3Q8DA 3ERSX 2XGTA 3A74A 1SYFA 3NQTA 1TWCB 5M3MH 1ESRA 2PW7A 1IHZA 4X64Q 2UUCL 1SRUA 1GUTA 5M5YB 3UDXA 4RKBA 2R92H 3FDTA 3KJPA 1E2WA 4I65A 1XPOA 1O7IA 1PH6A 1HNXQ 1N32L 2MP1A 4LF9L 2A1AA 1CM9A 3O13A 4HN7A 1MJEA 3MEHA 2F0WA 1VQEA 3QWNA 5I2XA 3J81i 4DV4L 2I5HA 1ICWA 1K83B 4ME3A 3HGBA 4FXKC 4CDCC 4A3GH 3ITPA 3UE1A 2L55A 5FLXc 2KEDA 4KK7A 3DM3A 4YHHQ 4Q5VA 2JA7H 3MXNB 4IFDJ 4X65Q 3STBD 1Q8IA 4A3KH 5D3IB 1SE3A 1TWCH 1BXTA 4ZK9B 5EBCA 5C5LA 2JP1A 4LFBL 1J9OA 2CH4W 5ELBA 3VDYA 1EZ8A 4FF3A 2F0FA 2FJ2A 4L5TA 1IW7D 3T53B 3CW2C 5LL6S 2JA8H 4APVA 2UU9L 3W3AA 1VQIA 1YI2A 4RGNA 4XTCS 4B3TQ 2R7ZB 5DAUA 2QF7A 3JC66 1SFOH 4YIJA 5FO7B 1K8MA 1DXMA 4R1JA 5C3XA 1PYSB 2B39A 4RKLA 2IX1A 5C3WA 3IFDA 4GKJQ 3AB9A 2YU9H 2F1MA 3FMCA 4NMZA 3K58A 2MO0A 4IOAA 4PZ7A 3DXJC 5C4XG 2C9OA 4MTKA 3TQYA 1HRJA 3MFGA 4KHPL 4GN4B 1JB3A 2B2UC 2F0LA 1YJWA 4HSPA 2XSCA 4HCSA 2TMPA 4BBSH 3GV3A 1RCVD 2XRSD 2VL6A 4GKJL 4E6IA 5CC4A 4TQUS 1LT5D 1PTOB 4PNYA 1D1KA 3VA7A 2F0VA 2NVTB 1WTRA 5M5WH 2RCFA 4I7AA 1PRTC 2CCZA 4CDDC 3QOLA 4XT3B 4R4IA 2QA4A 2NVQB 4X62L 3NWTA 4OIKA 3SHLA 1HH2P 4X62Q 1JE4A 2A74C 5IGDA 5C3EH 4EQNA 2AWNA 4DR6L 2RDGA 4KKSA 1LT3D 5IGEA 4JG2A 3N52A 2O4XA 1XNQQ 2VUMG 1U4RA 1AH9A 4H44C 5IYBH 4KI0A 1HCZA 2O2LD 2N3SA 5E4WC 5CV6A 5BR8Q 4CDFC 1G6PA 4ZCKA 3QJYA 1X9NA 3D3RA 1ILQA 2B2YA 4AIMA 2EOTA 3R2TA 2VQEQ 1BBXC 4K5VA 1EL0A 1GOZA 1GKHA 4JI0L 5ELNA 1VQJA 2L12A 3L9AX 1GHKA 2CWAA 1L0WA 3CC2A 4LJZC 3G6JB 2J0TD 4RCNA 2RSNA 2C5CA 3OHXC 3NBHA 3NWSA 2B2UA 4A75A 3HOXB 1F9QA 1QILA 1A8VA 1YJNA 1CKOA 2PZWA 1L2FA 1ZEQX 4GNXC 2IX3A 1KQSA 1GUSA 1STYA 1KXLA 3VR4A 3UE0A 5C4JH 3I4LA 3F2UA 3M3YH 4HJ7A 1XWEA 1V1OA 1RTOA 1EY5A 1WI5A 4K5XA 4QCLA 4WJ3M 1WCMG 3BDLA 5D14A 1QNUA 1VQ4A 1QB5D 1SJHD 3I72A 3A8IE 2A5HA 3SK8A 2F0JA 2G9HD 3P1HA 2E2DC 2HIXA 4JI4L 3HOWH 4A3DB 3I4OA 4A3EH 1SNQA 1F2ZA 1NJIC 4BBRG 1JE5A 2BH8A 2F0UA 1S5BD 2UUAL 3DMUA 1FJGQ 2M2LA 3CCMA 1GD7A 2UU9Q 5A2QE 3T13A 1CSPA 1V8QA 4GLXA 4DV1Q 3S2DH 1EQVA 3PUYA 1F2MA 1QUQB 4B3MQ 5EAYA 3G71A 3EJIA 2R92G 1CTMA 2A6ED 1QNKA 2JA6B 2CH4A 2K33A 2LY7A 1DGSA 4UP8A 2RA4A 1X55A 4HMJA 4ZKBB 2H1EA 2YTYA 1VQ7A 4A3DH 1I4QA 1QG7A 3K5MA 4Y7NH 2ICIA 3EFXD 4DUYQ 1AE3A 1VQAA 1MGSA 3FKIH 1DJRD 1KNEA 3CCQA 5IGFA 1YHQA 1LTID 3Q6SA 2F0OA 4NXMQ 4H0LC 2A6HD 1C9OA 3QG1A 3GTMB 1SDFA 1HZAA 2KHIA 1GHJA 1SN8A 5E4XA 2SNMA 3PIO3 5C4JB 2HD3A 1PH2A 3E9IA 2RDFA 3KLSX 3ONAB 4N8X1 2OEOA 1EU3A 4HIDA 4MZ9A 4WJWA 1HA6A 3BYYB 3NEMA 4DF7A 5FLMH 3OPOA 3FKIB 2WAQG 2FINB 2FFKB 3PUVA 1TR5A 5E3FA 2IW3A 2OXPA 3HOWB 4B3SL 3VR3A 4GKKQ 4G57A 4BBSG 5GQOA 1QZHA 2JQOA 4LUVA 5C0XG 3K80C 2Q8TA 4FF1A 3U9SA 4UPAA 3I4MH 1HNZL 2RBMA 3M7GA 4K5WA 2AQ2B 1LLRD 4DR4Q 3S16H 1JT8A 2ZJQA 1MKHA 4U673 3S1MB 4GN5A 2TSSA 3MHBA 3S1RH 4JVZA 1VQPA 1PTOF 4NB3A 2FMMA 1MSGA 4YCUA 3QIAA 1K8AC 3S15B 4IALA 3GTGB 2JSOA 4A3FG 4OONA 3C2PA 4BY7H 1I4GA 2UXBL 4R8IA 2RQXA 2K14A 4ZAIA 2R7DA 1AE2A 4S3SA 1EQQA 4JC0A 2RSOA 1U9RA 2Q2IA 2F0KA 2V4DA 3DEPA 4KHVA 4X3UA 4CDEC 2KA7A 2IT1A 3DEOA 1YBYA 1OXXK 3WDNA 5IP7G 2E2HB 1I6VC 5LMUL 3J7AV 2IY5B 1NNXA 5FKAC 1CSQA 4QY7A 4A3FB 1YNJD 2NVQH 1D5MC 4MNOA 1LTSD 4XQNA 1CFMA 4IJHA 4IUUA 3U4VA 3M4YA 2HDLA 3AFQA 4A3JH 1TWFH 3S15H 2M9VA 2NVXB 2CWPA 1DOKA 2EXZA 3I7FA 1Q1EA 4JYAL 5CMDA 3GTJB 4UDUC 4WRDA 1BCPB 1CZWA 1XTCD 1RD9D 2PNRC 2Z4IA 4JV5L 4CJ1B 5IT9c 1E1OA 3F1ZA 4JV5Q 2KVMA 5CBAE 2KEEA 1PH4A 1X6OA 2E75C 3X3NA 2F0GA 1TT2A 4DK3C 1OXVA 3T1YQ 1XNRQ 4JBJA 3GTPH 1I4PA 4GLAC 3NENA 1VMPA 2ASBA 1YEZA 3H0GB 1SXTA 1HNWL 5IYCH 2B8GA 2N88A 2JXMB 1D6EC 4HMIA 2MNAA 1PMRA 2K28A 4ZRZA 1DZ1A 2FHTA 3H09A 3CKIB 4B3ML 1JWUD 1LTRD 5D3DA 2NVXH 1GUGA 5IYBG 3SXHA 4KV6A 2UUAQ 1V1PB 5JEAH 5C0XJ 4OX9L 1LTBD 4FYDA 2C35B 5JOBA 5I2YA 1Z9FA 1SFOB 4RG1A 3S2HB 1ONLA 3FPUB 3DWPA 4JI7L 5I9PA 1MI2A 3EIVA 2HHHL 1X54A 1B1ZA 4GOPA 3CCLA 3D4RA 1PRTF 3RN5A 1B53A 4A3EB 5KNBA 1RJTA 4KD4A 1ZYRD 4DV6Q 2JJQA 2NN6H 3RLFA 2F0NA 4EGVA 5CGKA 1DOMA 4KY5A 4HIKA 1HUMA 4FDBA 1YNJC 2VW9A 2A68C 2ES2A 5JJZA 4BXXH 1PFMA 2A19A 4BXXG 2NN6I 3HOVB 1DM0B 1EIFA 2R93B 3ULJA 4C3HG 4L5SA 5M3FG 5HURA 3CMAA 4C3JG 2SNSA 4KY7A 1DD2A 2PMZE 2M00A 1K8OA 1GO3E 4P75A 3CC4A 3P75A 1IBML 4X3TA 2ENBA 4DV0Q 1EFWA 1SMYD 5DEHA 3IKJA 4RHSA 4DFAA 1ESFA 4KD3A 1MSHA 1JICA 4DR5L 1TS5A 3MTSA 4LFBQ 1HPCA 2KHJA 3NP8A 2ZM6L 5K36H 4A3MG 1N34L 1Y8PB 4DV5Q 4A93B 2Q2HA 1H9RA 2JA5B 4EQPA 1LM0A 1OXUA 2R3ZA 1B50A 3CP0A 5BN4A 4UP7A 2OWOA 2L11A 2MQHA 5C0XI 3S16B 1LTAD 3GD7A 4HIMA 2EJMA 2PNHA 1E2VA 1YHAA 4EQOA 4R9WA 1HR0L 1D5XC 4XXEA 1K3RA 3H91A 2BOSA 1STBA 3OYYA 5H1SE 4XIGS 3AMUA 1I4RA 4OO1G 2IJ0A 5F2DA 5AJ3Q 2B8FA 2Q8RE 1B7YB 1FNWA 1A3VA 2EYJA 1J6QA 4LF6Q 4DR2L 5C4XB 3K7UC 3Q24A 3IL8A 3PGZA 2VXWA 1EEID 2E74C 1EY9A 3I4MB 2UXDQ 5GAGC 3PMFA 1I4XA 2YV5A 4HJAA 5CV7A 5EKLA 1Y69U 1VQ9A 3TZUA 1VDZA 1BOSA 2A6EC 3DHQA 2RKSA 3GTQB 2AHOB 3QB3A 5IP9H 2VQFQ 4IO9A 4ODGA 4X65L 3NPPA 4LF7Q 1KTKA 2PYKA 1NMGA 1CHQD 1TWAB 3W2DA 2I0QA 2NZ1D 1NUCA 2XNAC 3CQZH 1PH8A 3L7ZC 3S1QH 3PIPA 5HY6A 4NXNQ 3KUPA 3S1NB 5JPNC 4BY1B 4G7ZC 1IL2A 3A54A 4J6HA 2R7ZH 5M5WB 4KTAA 1U5KA 4H02A 4QJFA 1CQFA 3GTPB 5E7NA 1N36L 4DR5Q 1XPRA 4F87A 4HIOA 4A3BG 2F3IA 2ZXRA 2CKZB 2Y0SG 4QUFA 2EPBA 2YU9B 2EE1A 4IUTA 4AQYL 4DV0L 2SOBA 1SSOA 1A63A 1PZKD 3I90A 1J8IA 4U68A 2B63G 2ZJRA 2K75A 2ID0A 5J39A 4YCVA 5I9OA 1NSNS 3NBIA 2RF4A 4IQZA 1XJVA 1RTNA 4EQ5A 4ILWA 1EYCA 1HQMC 1V9PA 1SE2A 4C2MB 4BY1H 1CT1D 1C4QA 4LUZA 2L5TA 4KHPQ 3RLNA 1I3QH 1SNCA 2AUJD 4DKAC 1CA6A 2Y0SB 1SNPA 1UWVA 3GV6A 4K2KA 1O7ZA 1KDCA 2UXCL 1JOOA 5AJ3L 1B70B 4DR3L 2F0MA 1XTDA 4GN3B 3U4ZA 3QO2A 2VB3X 2DN8A 4P74A 2VNUD 1RIPA 1EY8A 4GOPB 1KAWA 2NUCA 1EEFD 1O80A 1SR3A 4KJOA 4O42A 4C3IH 2MUYA 2ALYB 1NTGA 1VQGA 3NQIA 3H0GG 3R2IA 4A3BH 4ZQ3A 5KNCA 3LNNA 3PIOA 1C48A 2EYPA 4DK6C 3M4OH 4QQBX 4DUYL 5M3FH 1A3TA 3V05A 1BO0A 4JI6L 4JI7Q 4K0KL 1B3AA 2EVBA 2L15A 4IURA 5KGUA 3RD4A 5BR8L 5IWAQ 1S3OA 2LMCB 3J7AF 4A3IH 1A62A 4UHVA 1EWHA 2PQAB 1EUJA 1HQRD 2HIVA 2Z0SA 4A3JB 3CMEA 3D31A 3K5LA 2JEAI 4FXGC 4A3LG 4DN4M 5JPMC 4DR1L 3M9BA 4X66L 1DOLA 1NBWA 2WKCA 3E0JA 1YJ9A 3I2ZA 1IYJB 4DGZA 1GUOA 1UAPA 4A3EG 4N8FA 1TS4A 4PMCA 1IBLQ 1SJED 4PZ8A 3HKZE 4RGOS 2BA1A 1LTLA 1KNAA 2KENA 2F3VA 2PQAA 2VS1A 3PF5A 3MZ5A 3HOVH 3FVQA 2OCEA 3UI2A 4FF4A 1F2LA 4JI1L 1EY4A 4DAMA 1D2BA 3DWAA 5IGCA 2YYZA 2ZTCA 2A68D 2K05A 3UDFA 1KLGD 4DUZL 5EPJA 1PFSA 5TSSA 4YWLA 1PDQA 2F52A 2Z8LA 4DUZQ 3GTMH 3TN2A 1N33L 3DUZA 1STAA 5IYDG 1WJJA 3CRLC 3QR8A 3VYTA 3CHBD 2K52A 2Z4HA 3IRBA 4JI3Q 2E8GA 4F88A 4LF5L 2F0SA 3BVGA 2AWOA 3FPPA 2WAQB 4K6DA 3OTOL 4N9PA 4RMFA 2EZVA 2HT1A 2WB1B 1EU4A 3OIPA 2XVSA 4CKEA 1VQFA 3VR2A 2K5WA 2CQOA 2WIIB 1ET9A 3J7A5 3I70A 2F0DA 4TSSA 2XWJB 2B2VC 1TXYA 4QMGA 4LFCL 5EJWA 1FNUA 2LSSA 5L37A 1IBLL 4Q0FA 4DR6Q 1Z7TA 2QW7A 1IKMA 2X69A 4HEDA 1S5ED 4OWXB 1CKNB 4KHZA 2EYMA 4DV7Q 1U4MA 1JB7A 3GTQH 2Y0SE 3BS1A 2L1BA 4L8JA 3G4SA 4AYBB 1AZPA 3HP3A 1QCBD 1TY0A 2K5QA 2OTJA 1A15A 3CPFA 5LMNL 2N49A 1Y1VG 2DGYA 2JA9A 2NYZD 2BH2A 1KABA 1H9KA 3MVVA 1VF5C 4KMUC 4A3GB 4DK1A 3R3OA 3MEFA 5C44H 4DR7Q 1HNXL 1UE6A 3KK7A 1HUNA 4UAIA 1RHPA 2BCOA 3AYHB 3J80L 1Q8KA 4M8AA 4A3FH 2KJXA 3V2TA 1H9MA 1YVCA 1FYCA 1II3A 3KOJA 2Q2TA 4A76A 3I4MG 2A6HC 1NE3A 5M3MG 4DAVA 2ZXOA 4MTNA 4J15A 3J80c 1SMYC 4O0AA 1ET6A 1YZ6A 5IYDH 4B3RL 2PI2E 4FNFA 4DNTB 3T1HQ 4QL5A 2NZOA 3ND8A 1KIXA 4PG3A 1J5EL 1K8GA 3JAMc 1NAPA 4DV7L 4LFAQ 2D0OA 1T9HA 2F0HA 4QB4A 3KJOA 1AFPA 1NR2A 4IUVA 2MO1A 2WAQE 2EY5A 1WTQA 1FL0A 2ZM6Q 3K8AA 1JQYD 1I94L 4O1NA 4P71A 1WTPA 2ATWA 4FXDA 2HHHQ 3GTOH 2BDNA 2KUMA 2RDHA 4IZ8A 5C4XH 2EYOA 3MC0B 3EQLC 2F4VL 4IJLA 4C1NI 3JAML 2B2WA 3T4AC 5AFWA 3PSIA 4JBKA 4JPBW 3G6EA 2JE6I 3S2HH 4J1MA 4F7XA 3KLSA 4BS9A 1XMQQ 4PQXA 2UXCQ 1BF4A 3P20A 3CCUA 1PFBA 1PV4A 3EVQA 1I5FA 4DNRB 1BKBA 3A7LA 1S72A 1I4HA 3PQIA 2FMCA 3SK4A 1FVIA 3BZDB 5ELCA 4C56C 4WORA 2NN6G 2P5ZX 1VQKA 1LUZA 5EPKA 3RZOB 3F8TA 4IFDI 1S5CD 3NELA 1XXGA 3W1GA 4LF9Q 4QIWE 4XQJA 3GQBA 1SYCA 1TKWB 1BNZA 5JJLA 2K7VA 4L5RC 3JAMi 5FLMG 3C1EA 2DY7A 1PYBA 3HG9A 1JOKA 1HR0Q 1H9SA 3E0EA 2VQEL 1A3UA 5EKKA 3G7LA 5CORA 1SYGA 3M4PA 3TREA 2Z9HA 1PH9A 1WOCA 1L1OC 1M4VA 3TS0A 2EJFC 1AEXA 5A2QL 4K8IA 4OELB 3HOYB 4BA2I 5ISRA 5LMNQ 1X3QA 4C3HH 2K5DA 2EY6A 1MHWC 1TWHH 2D0PA 2HUGA 4A3DG 3B6YA 3CCSA 3GP7A 1CHPD 4G7HC 1SNOA 4K0KQ 1VQHA 3RZOH 1IW7C 1KC8C 4HSVA 4QUCA 1EZ6A 3AEVA 4LF7L 3I4NB 5LMNW 3ICEA 5GAEC 2F0IA 2MJ8A 3HKSA 2OQ0A 4DV5L 2MGSA 1Q90A 1X3PA 4K6LA 5E1FA 5KRUA 1UEAB 1ILPA 1RDPD 1TWHB 3T51B 1A0IA 4UY8C 3D4WA 1T5XD 3CD6A 1ZKOA 3S1NH 3H6MA 4R4QA 3NTIA 2JA7B 1EIGA 2JYOA 1E24A 3CAMA 4MHEA 3NTKA 2IL8A 1WCMH 2E2HH 3RZDB 2HQEA 4BWGB 2LXJA 1X32A 1O7LA 4LF8Q 3BU2A 3A5ZB 3BVMA 3GTKB 1N33Q 3OSOA 4DV2Q 5JEAG 2IHFA 3NE5B 4WFN3 3KFUA 1Y1WG 3H15A 3F2BA 3GTJH 1EFID 1PA6A 4G7OC 3A55A 3OW2A 1CQVA 2B2TC 2FXQA 2K5VA 3GDEA 4J8QA 3SR1A 3S2DB 5JJKA 2RVLA 1H95A 2E76C 4GOPC 3PO2G 3Q23A 1UE1A 2G9DA 5I6YA 1Y1WB 2LXKA 1SBBB 2K5HA 3H0GH 3WOFA 4Y7NB 4X3KA 3LX0A 1HXYD 3K59A 2CQAA 1B9MA 5EQ0A 2GVBA 5IE8A 3LWEA 2PW5A 5JAVA 1EQTA 1IZ6A 3RMHA 4B3RQ 3MWYW 1G91A 1GUNA 1JJCB 4AYBE 1PVOA 1GM5A 1ICFB 3LWUA 3CCJA 5EPLA 4CGYB 2J4XA 3J80E 3PO2B 1I6HH 1O78A 2R61A 4YY3L 3F2CA 4IPCA 2F03A 4KKTA 1KLUD 2XIWA 2EJGC 5I6WA 3N6RA 4A4IA 4IUQA 1Q3LA 1Q86C 3SEBA 3Q22A 2NVYB 3BJUA 1L0YB 1N8RC 3J80i 5IOCA 1SE4A 2QILA 3GTOB 1QOHA 2K4KA 1VQLA 4RH6A 1PRTB 2JA5G 1Q81C 4R4OA 3G48A 1OO9B 5M5XH 3HZXA 5CV9A 3ULLA 1SROA 4A3MB 4OWWB 3NTHA 5M3MB 1WD0A 4CHTB 2XRQD 3K81C 1W2BA 4IN3A 4B3TL 1FGUA 1K0SA 1Q7YC 2JEBI 3TP5A 4HJ9A 4DR1Q 3I4NG 1G51A 5LMUQ 2XN9C 4NPSA 1W3SA 3WOEA 3HOUG 4ZUJA 2GVAA 2A69D 2B3GA 3TS2A 2QDBA 1XMOQ 1CUKA 3SK6A 1TWGH 1F77A 1G6ZA 1N9WA 1EIYB 2ICEC 5IT9L 4A3JG 5CYUA 4L5QA 3T56B 2X6LA 2KECA 1BCPC 3UDGA 4QGUA 1X3FA 1R4QB 5FOBB 1HNWQ 1K3BC 4GNXB 2R93H 3GTLH 3K6OA 2K04A 1EY7A 4DV3Q 2VB2X 4IUNA 1HNZQ 2DJGC 3MXNA 1XX8A 1CKNA 4A93H 2WV6D 1G291 3HOYH 3IFTA 3PCOB 2EY2A 4H7BA 4JOIC 4A3LH 1WVLA 4XT1B 1QUQA 4DV2L 4IUPA 5CV8A 3D4DA 4Y52H 5BN3A 4CJ0B 5M3FB 2ZTEA 2WB1G 4OO1H 1WTXA 2ZT9C 4LF5Q 1TY2A 1IKLA 3S17B 4CJ2C 2YTVA 2KCNA 1TU2B 3K7AH 1F2YA 5NUCA 5HGTA 4HTHA 2SEBD 3GTLB 1JMCA 3M85A 1F9PA 4JI0Q 4RFBA 1HTLD 4AQYQ 2JA5H 1ENCA 4UP9A 4DR7L 3PO3H 2OTLA 2IWHA 4IFDG 1OXTA 5GADC 2OF1A 3HOYG 2VZAA 1UNSA 4KY6A 5JEAJ 5C0XH 1EYGA 3RZDH 1JOQA 1P16A 4FP5D 1GXDC 1LT4D 1RKNA 1SMXA 4TKOB 4LFCQ 1B3QA 4RWSC 3HOVG 3NBHB 1CI3M 1G8ZD 2D62A 4DPGA 3A7AB 4FO2A 1VQNA 3TBIB 2R93G 1TVXA 3HRZC 2EXDA 4A3GG 4JBMA 4OHJA 1C0AA 2PI2A 4PZ6A 3PO3B 4LNQA 4M1UB 2E2JH 1L1OA 1HFNA 2VQFL 3HOZG 3TRZA 3E9HA 4A3CH 1B2TA 1Z47A 2IX0A 1AZQA 4B08A 1SYEA 4MIUA 4P73A 5ELEA 1GJXA 2NTTA 3KF6A 1VQOA 4OX9Q 4DXFA 1PH3A 4H13C 4ABNA 3OIQA 4JI6Q 3BG3A 4BY7G 4GZYC 3S1RB 1PH7A 1B9NA 4YWKA 4B3SQ 4KN7C 2I5MX 2B29A 3NK9A 2R7ZG 4IPDA 2L4NA 2PO4A 1WYDA 5ELDA 3I56A 1OXSC 2ZJPA 1BBUA 1TWAH 1XMQL 4JYAQ 1UEBA 3J7YW 3HKZB 5K5PA 4Z9CB 5G3LF 4RA8A 3HEJA 4CBVA 3SE0A 4X64L 5IT9E 3RNUA 3IAYA 4JI8Q 4GNXA 1VCIA 4LF6L 5K36G 1HJPA 2A69C 1HHVA 1WFQA 4OEMB 3SK5A 2B2WC 1EOTA 3HOWG 5FO9B 1RL2A 3MXGA 3UDIA 2NVYH 1M8AA 1N36Q 3RLOA 5G3LD 2BA0A 5CV5A 2HCIA 2OQKA 1F9SA 4HJ8A 3W1BA 2E2IB 3C1FA 2B2YC 1BBWA 3HOXG 4V190 5FJ8H 5IYCG 2N8NA 3TP8A 4XYQA 1MD2D 2F0EA 4JI2Q 2EIFA 4LF4Q 3H3VC 1ZYRC 3JAME 3MFYA 2LS01 2JK8A 3LGJA 1B4OA 5ELFA 3VR5A 2EYHA 2G5DA 4ULLA 3HOUH 1YHBA 1E2ZA 2I5LX 4NKLA 3T1YL 3S14B 4KLKA 1PHJA 2BDOA 5J22A 4LUOA 3I3CA 1STGA 4IPGA 4P2CB 1GUWA 1HZ9A 1TWGB 2F4IA 3C3LA 4GKKL 2KOLA 4BBRB 2QEJC 2E2IH 3S1QB 2Q8IB 1D5ZC 3M7NA 1SEBD 1YITA 1TS3A 2PZTA 1CKMA 4HCEA 5IP9G 1SE8A 4OL7A 1WD1A 2SDFA 2B63B 1X3GA 2IHEA 2JA6G 1PXUA 3J7ZC 3ERQA 1S5FD 4EVOA 1JWSD 4XDXA 1M90C 3J81c 2QCPX 1STNA 3KF8B 3PO3G 1LO5D 2PMZB 4IFDH 4JI2L 2R7FA 4FF2A 4JI5Q 1EYDA 1R9TH 4C3JH 5A35A 3KBXA 3ND9A 1JJGA 1QZGA 1XNQL 4I7ZC 1PRTD 1EIHA 2F4VQ 3CPWA 2QEXA 3FRPB 2UXBQ 5KEEA 2CVRA 1ENAA 2MFIA 1PZID 1BVSA 1CK1A 2AMCB 4DAYB 2R92B 3L3OC 2KBNA 2UUBQ 3HOZH 2F3WA 1R9TB 1HR0W 3EN2A 3TSSA 3S9WA 2JA8G 1IYVA 1YIJA 4EX5A 4OIJA 4XQQA 1IYUA 4FVMA 4JI4Q 1IBKL 2DY8A 1WTOA 4JI5L 3F2DA 4TVAB 1X65A 2D9UA 5C3EG 1QE6A 4HAEA 1E3PA 2O5JC 1VQCA 1Y1VH 2L9HA 5EGTA 1CZGA 4L6TB 2JA6H 1HFGA 2WINB 3S17H 2Z6BA 4CKCA 1PYWD 2KQ3A 3R8BA 3U9OA 4NP5A 4A3KG 3CF5A 4F8MA 2D5DA 1DONA 2JA8B 3P7JA 4L63B 3BVZA 3KYHC 2QKIC 1LTTD 2VUMB 3V96A 1C8CA 1IL8A 5FO8B 1WTWA 1E1TA 4NXML 3L2PA 3GO5A 3E5SA 4C3HB 3RR5A 2AQ3B 4LW1A 2GA4B 3SDZA 4DV3L 2NB0A 3J81L 1NCVA 5C5MA 4A3KB 3OW7A 4WJ4A 1PFNA 1IBKQ 3I4NH 1SLJA 4K2LA 4V0BA 1BR9A 1P8LA 4QIWB 1TWFB 3PUXA 4A3IB 4R4TA 3C46A 4A3CG 5DM73 4YHHL 3I91A 5C4HA 4LF4L 4ZKCB 3FHWA 1UE5A 1J5EQ 3DWQA 4PV1C 3BZKA 3OWFA 2VY3A 4OWTB 3QOJA 5EKIA 3U58A 4DK0A 2EDGA 3TP6A 1Y1VB 2NZHA 3KLRA 1KDAA 3FP9A 1EWCA 4DR4L 4MN3A 1JWMD 1F9RA 3DM1A 4NXNL 2F0TA 2HCCA 1CA5A 3RN2A 3MA2B 2F0QA 2K6AA 1FNVA 4ZLTF 3VA5A 4BY7B 3CU7A 3PUZA 4POFA 1AW7A 2WKDA 3R93A 1IBMQ 4LK1C 3CCVA 3CQZB 1ML0D 3TDQA 3OOCA 1PTOD 2EYLA 1PZJD 1S4ZA 2I46A 1EY0A 1PH5A 1PTOC 5DLQE 3BZCA 3E6ZX 4X6AH 3A8KE 4K14A 2NTSA 3H94A 3BDOA 3HFZB 3PO2H 2WACA 1I6HB 2NVTH 3D6WA 3MXUA 1L0XB 4BA1I 4NDXA 4DR2Q 2KCCA 2Z6KC 3VYSA 4ZYSA 1BQQT 3L0OA 2CFMA 3BDCA 1U4LA 1ASZA 1Y8OB 3CCRA 4OXPA 5IY0A 2H5XA 4XYOA 5FJ8G 1A6XA 4BBRH 1Y1WH 3A8JE 1XYIA 1VF7A 2E2JB 3A5UA 5C44B 4O2DA 1LV9A 2DNEA 4DA2A 5T1GA 2V1CC 2L0CA 1STEA 4LAAA 4C2MH 1KD1C 1E7ZA 1S5DD 1K0RA 4DV1L 3OWEB 2AQ1B 4C1NK 3U50C 3NHHA 2XTIA 3PIP3 1B8AA 4BY1G 1XMOL 1FD7D 5IP7H 1VQMA 5KYIA 3HS0C 1Q82C 2CW0D 3H3VH 5M9OA 2BE5C 2NWGA 4DAPA 1SAPA 1G2TA 3FKIG 2BE5D 1KAAA 3ER0A 1A2TA 5T1IA 4RAUC 3T1HL 4P72A 3KDFA 5CV4A 3CCEA 3D0FA 2Z1CA 3M4OB 2LFNA 3NUCA 2B2TA 1VS0A 5IGGA 2Q2UA 2K01A 2OT2A 2XWBB 2K32A 1KRTA 1EYAA 1H9SB 2MPMA 3X3MA 4LF8L 4JCVE 2AUKA 2X6GA 3FEWX 1B44D 1QVCA 4DR3Q 2AKWB 1FGBD 2D2CC 2I07B 1IXRA 5LHY1 3I55A 4POGA 3TP7A 4A93G 4C3IG 4N9TA 1KDBA 1YNNC 1M1KC 3OMCA 2F0PA 5J1ZA 1U4PA 1Z6HA 3E3XA 2EQSA 5D65A 3J81j 1D8LA 3URYA 2PPBC 3J81E 4RGTA 5GAHC 3NXWA 1WCMB 2IPKD 4ID6A 1TIID 4DXGA 1LACA 2WP8J 1NY4A 1RF2D 1ZXTA 4DV6L 1UE7A 4OGQC 2EY1A 2UUBL 4AH6A 5KYLA 1U0LA 1K83H 2A8VA 1RODA 3KDFB 3HOZB 1HTPA 5C4ZA 1G2SA 1TQOA 1W6JA 4KJNA 4ME5A 1HA5A 4IPHA 1PTOH 1Q46A 1AN8A 1D1IA 3VYRA 1VQ5A 4K8JA 2DUDA 5HGQA 1EOVA 3D6CA 1Q1BA 3K7AB 1MIUA 1D7QA 1Y8NB 4DNIA 5FLXE 1JCKB 1C7YA 1LT6D 1WTVA 2E5LQ 1N32Q 1NMFA
chains in the Genus database with same CATH topology
4A3GG 3OTOL 4RMFA 4JBMA 2UUCQ 2HT1A 3PUVA 1C0AA 1E22A 2PI2A 4PZ6A 1VQFA 4B3SL 3GTGH 4LNQA 4GKKQ 2E2JH 4BBSG 5GQOA 1L1OA 1HZBA 2JQOA 3ZJYC 1QZHA 2CQOA 3PF4A 3W5OA 3J7A5 2VQFL 4LUVA 3HOZG 3E9HA 3TRZA 5C0XG 4A3CH 4OO1I 1Z47A 2IX0A 3K80C 1TXYA 4P73A 4DV4Q 4UPAA 4LFCL 3I4MH 3KF6A 1HNZL 2LSSA 1VQOA 3CC7A 4OX9Q 4JOIA 1YNXA 1IBLL 1PH3A 3PV0A 1HZCA 4DR4Q 4DR6Q 3S16H 1JT8A 2UXDL 4JI6Q 3HKZG 2ZJQA 4BY7G 1MKHA 1QVFA 4OWXB 3S1MH 1CKNB 4GN5A 1PH7A 4YWKA 4KHZA 3S1RH 1VQPA 1KRSA 4NB3A 4DV7Q 4B3SQ 1JB7A 3H3VI 2I5MX 3GTQH 2Y0SE 4JI8L 1ASYA 2QGQA 4YCUA 2B29A 1K8AC 2R7ZG 5GROA 4JI1Q 4IPDA 2JA7G 3G4SA 4A3FG 4YY3Q 2K5NA 4OONA 1WYDA 2OTJA 3I56A 4BY7H 1OXSC 1EWIA 3CPFA 2RHQB 2ZJPA 1BBUA 1Q12A 1TWAH 1Y1VG 2N49A 2EXDA 2DGYA 5J3BA 2JA9A 5LMNL 4HJ5A 1JJ2A 2K14A 2BH2A 4JYAQ 1UEBA 2R7DA 1AE2A 1MJCA 4R4CA 1EQQA 3K0XA 4JC0A 2Q2IA 3MEFA 4X64L 5C44H 3RNUA 4JI8Q 4GNXA 1VCIA 4DR7Q 2WB1E 4X66Q 1HNXL 4LF6L 1UE6A 5K36G 2IT1A 1HJPA 1YBYA 1OXXK 1WFQA 5IP7G 4A3IG 2R6GA 3AYHB 5LMUL 1Q8KA 3HOWG 2YTXA 2IY5B 4A3FH 1CSQA 4QY7A 1RL2A 3UDIA 4IOCA 3OTOQ 2NVYH 1N36Q 3RLOA 1FJGL 1EQRA 2NVQH 1YVCA 2BA0A 4MNOA 3ULPA 3KOJA 1VQ6A 3U4VA 4IJHA 2Q2TA 4A76A 2OQKA 3I4MG 3AFQA 4A3JH 1TWFH 1NE3A 5M3MG 4HJ8A 1N34Q 3S15H 3W1BA 4MTNA 2CWPA 4J15A 3J80c 4GS3A 1XNRL 1BBWA 1Y14B 3I7FA 1Q1EA 4O0AA 3HOXG 4JYAL 5FJ8H 1YZ6A 5IYDH 5IYCG 4B3RL 2N8NA 2PI2E 4JV5L 4JI2Q 3T1HQ 5IT9c 1E1OA 2VUMH 2EIFA 4A3MH 4QL5A 3F1ZA 4LF4Q 4JV5Q 2NZOA 1V43A 1KIXA 4PG3A 1J5EL 2JK8A 4AYBG 1K8GA 3JAMc 3KLWA 4DV7L 4LFAQ 1PH4A 3LGJA 1X6OA 2D0OA 1T9HA 3KJOA 2KCTA 3HOUH 4DK3C 1OXVA 1YHBA 4JI3L 2K50A 3T1YQ 4JBWA 4JBJA 1XNRQ 2MO1A 2I5LX 2Z6KA 2WAQE 3GTPH 3T1YL 3S24A 1FL0A 4GLAC 2ZM6Q 3NENA 1VQ8A 2ZTDA 3K8AA 1I94L 4KLKA 2ASBA 1YEZA 4ALPA 1PHJA 1HNWL 5IYCH 4LUOA 4P71A 2MNAA 1K73C 4IPGA 2ATWA 1HZ9A 4GKKL 3GTKH 4B3ML 2HHHQ 2E2IH 2NVXH 3GTOH 3M7NA 5IYBG 3PUWA 1YITA 1CKMA 5JJIA 1V1QA 5C4XH 5IP9G 2UUAQ 2F4VL 1SE8A 4IJLA 5C0XJ 4OX9L 2B63H 1KL9A 2WFWA 1X3GA 2C35B 3TEHB 1I94Q 1Z9FA 2IHEA 3PSIA 4JBKA 2JA6G 3G6EA 5M5YH 3J7ZC 2JE6I 3S2HH 4RG1A 4JI7L 3M4QA 1X56A 5IWAL 3EIVA 5C44G 1XMQQ 2UXCQ 2HHHL 1X54A 3CCUA 2N78A 1PV4A 4GOPA 2HQLA 3STBC 3CCLA 1I5FA 4LFAL 3RN5A 1M90C 3J81c 1GVPA 1BKBA 3KF8B 1QVGA 1X3EA 4LWCA 1S72A 2E5LL 3S14H 3PO3G 1I50H 1FVIA 3HOXH 4DV6Q 4JI2L 1VQBA 2R7FA 2JJQA 2NN6G 4JI5Q 1R9TH 3RLFA 1S40A 4YWMA 4C3JH 3KF6B 4YCWA 1VQKA 1LUZA 1OTCA 3F8TA 4PMWA 4IFDI 3NELA 1JJGA 4HIKA 3W1GA 1QZGA 1XNQL 4FDBA 4QIWE 2VW9A 3DLLA 4LF9Q 1L1OB 2F4VQ 5JJLA 3CPWA 2QEXA 3CXCA 2ES2A 4L5RC 4BXXH 3JAMi 5FLMG 4BXXG 2A19A 2UXBQ 1LYLA 3AFPA 3AQQA 1PYBA 2NN6I 3EBEA 1VQDA 2MFIA 1HR0Q 1BVSA 3E0EA 1EIFA 2VQEL 2AMCB 3SGIA 3ULJA 4DAYB 3TREA 3M4PA 1K9MC 5M3FG 4L5SA 1PH9A 3CMAA 2KBNA 2UUBQ 1WOCA 3HOZH 1L1OC 4GLVB 3A0JA 1KHIA 1HR0W 3EN2A 3WWVA 5ELOA 2PMZE 3TS0A 1XPUA 2JA8G 1YIJA 4EX5A 1PH1A 2RHSB 2KCMA 4JI4Q 1IBKL 4BA2I 1GO3E 5LMNQ 4JI5L 4P75A 4TVAB 2D0PA 1TWHH 4C3HH 3F2DA 1IBML 1X65A 3CC4A 4A3DG 3B6YA 3CCSA 4DV0Q 2GN5A 5C3EG 1EFWA 1E3PA 2RCNA 3Q8DA 4K0KQ 1VQCA 1Y1VH 1VQHA 2XGTA 3ERSX 3HOWH 3RZOH 3A74A 2JA6H 5M3MH 1KC8C 2UUCL 4X64Q 4DR5L 1SRUA 3AEVA 4LF7L 3UDXA 2R92H 3KJPA 5LMNW 1XPOA 1PH6A 1O7IA 1HNXQ 3ICEA 3S17H 5GAEC 1N32L 4LF9L 3HKSA 2A1AA 4LFBQ 2OQ0A 4DV5L 2KHJA 4A3KG 1MJEA 3CF5A 2ZM6L 4A3MG 1N34L 4DV5Q 1VQEA 3J81i 4DV4L 2Q2HA 2I5HA 3KYHC 1LM0A 1OXUA 1A0IA 4UY8C 4ME3A 3CP0A 3CD6A 3S1NH 4UP7A 2OWOA 4A3GH 2MQHA 1E1TA 5C0XI 3UE1A 4NXML 3L2PA 3GO5A 4R4QA 3GD7A 4HIMA 5FLXc 2PNHA 3DM3A 1E24A 1YHAA 3CAMA 4LW1A 3RR5A 3MXNB 4YHHQ 2JA7H 1HR0L 4IFDJ 4X65Q 1WCMH 2E2HH 3STBD 4DV3L 4A3KH 2LXJA 4WJ4A 1TWCH 1K3RA 4LF8Q 1IBKQ 3I4NH 1SLJA 3OYYA 5H1SE 4XIGS 1XMQL 4LFBL 1P8LA 3BU2A 3A5ZB 3VDYA 4OO1G 1N33Q 3PUXA 4L5TA 5AJ3Q 4DV2Q 5JEAG 2IHFA 1B7YB 4R4TA 3KFUA 3CW2C 4A3CG 1Y1WG 2JA8H 4YHHL 4APVA 4LF4L 2UU9L 3H15A 1J6QA 1VQIA 3FHWA 3GTJH 1UE5A 3F2BA 4DR2L 3K7UC 1YI2A 1PA6A 1J5EQ 4XTCS 4B3TQ 3BZKA 3PGZA 2VY3A 4OWTB 3JC66 1SFOH 3OW2A 2UXDQ 2FXQA 3GDEA 2K5VA 5GAGC 3U58A 5JJKA 4R1JA 2NZHA 2YV5A 1PYSB 4HJAA 2IX1A 1H95A 1VQ9A 3FP9A 2UXBL 4DR4L 4NXNL 4GKJQ 4GOPC 3PO2G 2YU9H 2MO0A 4IOAA 2AHOB 1UE1A 4PZ7A 5IP9H 3RN2A 5C4XG 2VQFQ 4IO9A 4X65L 3TQYA 2LXKA 4LF7Q 2K5HA 3H0GH 4KHPL 1NMGA 3PUZA 4GN4B 2I0QA 4POFA 1YJWA 3CQZH 2GVBA 1IBMQ 5IE8A 3CCVA 1PH8A 1IZ6A 4BBSH 4B3RQ 3L7ZC 3S1QH 3PIPA 1PH5A 5HY6A 2VL6A 1JJCB 4NXNQ 4GKJL 4AYBE 1PVOA 4TQUS 5DLQE 1GM5A 3BZCA 4X6AH 1IL2A 3CCJA 2R7ZH 3HFZB 3PO2H 1U5KA 4H02A 5M5WH 4QJFA 2NVTH 1I6HH 5E7NA 4YY3L 2CCZA 3F2CA 4IPCA 1N36L 4R4IA 2QA4A 4BA1I 4DR5Q 1XPRA 4HIOA 4A3BG 2F3IA 4A4IA 4DR2Q 2CKZB 2Z6KC 4X62L 1Q86C 2Y0SG 3L0OA 3BJUA 2CFMA 1N8RC 1HH2P 4X62Q 1ASZA 4AQYL 3J80i 3CCRA 4OXPA 5IY0A 2H5XA 4DV0L 1A63A 5C3EH 2K4KA 5FJ8G 1VQLA 2AWNA 4BBRH 4DR6L 1Y1WH 2B63G 2ZJRA 2K75A 2ID0A 4JG2A 2JA5G 4YCVA 1Q81C 1XNQQ 2VUMG 4R4OA 1AH9A 3G48A 2RF4A 3A5UA 5M5XH 1XJVA 4O2DA 5IYBH 4KI0A 4EQ5A 3ULLA 1SROA 2N3SA 4OWWB 1V9PA 5BR8Q 1G6PA 2V1CC 1X9NA 4AIMA 4BY1H 3K81C 4C2MH 1W2BA 1E7ZA 1KD1C 4LUZA 2VQEQ 4B3TL 4KHPQ 1FGUA 3RLNA 1I3QH 1K0RA 1Q7YC 4LF6Q 1GKHA 4DKAC 2JEBI 4HJ9A 3I4NG 4DV1L 4DR1Q 1G51A 5ELNA 5LMUQ 1VQJA 4JI0L 1UWVA 2CWAA 4NPSA 1L0WA 3CC2A 2UXCL 3U50C 5AJ3L 1W3SA 1B70B 4DR3L 2XTIA 3HOUG 1B8AA 4BY1G 1XTDA 1XMOL 5IP7H 4A75A 1VQMA 2GVAA 4GN3B 3U4ZA 1A8VA 1YJNA 1Q82C 4P74A 2B3GA 1CKOA 3TS2A 1XMOQ 2VNUD 1L2FA 1RIPA 4GNXC 1CUKA 3H3VH 4GOPB 1KQSA 1KAWA 1TWGH 1KXLA 1SR3A 4C3IH 1N9WA 1EIYB 3UE0A 3FKIG 2ALYB 5C4JH 3ER0A 1NTGA 1VQGA 3M3YH 3H0GG 4A3BH 4HJ7A 4A3JG 4L5QA 3T1HL 4P72A 3PIOA 3KDFA 3CCEA 3D0FA 4DK6C 3M4OH 1WI5A 4QQBX 4DUYL 3UDGA 5M3FH 4WJ3M 4QGUA 1VS0A 1X3FA 4JI6L 1WCMG 2Q2UA 4JI7Q 1HNWQ 4K0KL 2L15A 4GNXB 1VQ4A 2R93H 5BR8L 5IWAQ 1KRTA 3GTLH 1S3OA 4LF8L 4JCVE 4A3IH 1A62A 2HIXA 4JI4L 4DV3Q 1QVCA 2PQAB 1EUJA 2AKWB 3I4OA 4DR3Q 4A3EH 1HNZQ 2HIVA 1IXRA 3I55A 1CKNA 2Z0SA 1NJIC 4POGA 3CMEA 4A93H 4A93G 3D31A 1JE5A 1G291 4BBRG 2BH8A 2UUAL 3HOYH 3PCOB 1FJGQ 3CCMA 1GD7A 2UU9Q 2JEAI 4JOIC 1M1KC 4A3LG 4A3LH 1CSPA 4GLXA 4DV1Q 4DR1L 1QUQA 3M9BA 1QUQB 1NBWA 3PUYA 4X66L 4DV2L 1YJ9A 4B3MQ 2EQSA 3I2ZA 1IYJB 5EAYA 3J81j 1D8LA 3G71A 4A3EG 2ZTEA 2R92G 2WB1G 4Y52H 1IBLQ 4PZ8A 4LF5Q 3HKZE 2BA1A 5GAHC 1DGSA 1LTLA 4UP8A 2KENA 2YTVA 2PQAA 1X55A 2VS1A 2WP8J 3PF5A 2YTYA 3K7AH 1VQ7A 4A3DH 1NY4A 3HOVH 2OCEA 4Y7NH 4DV6L 1UE7A 4DUYQ 1AE3A 2UUBL 4JI1L 4DAMA 4AH6A 1VQAA 3FKIH 1JMCA 1U0LA 3CCQA 3M85A 4JI0Q 1K83H 4AQYQ 2YYZA 2ZTCA 4DUZL 4UP9A 3UDFA 1YHQA 2JA5H 2A8VA 4DR7L 1PFSA 4NXMQ 3KDFB 4YWLA 2F52A 3S2DH 3PO3H 1C9OA 4DUZQ 3GTMH 2OTLA 1N33L 4IFDG 4IPHA 1Q46A 2KHIA 1HZAA 1OXTA 5IYDG 1WJJA 5GADC 1SN8A 3HOYG 1VQ5A 2VZAA 5JEAJ 1EYGA 2DUDA 1PH2A 5HGQA 3E9IA 3RZDH 1EOVA 1P16A 2K52A 1Q1BA 4HIDA 3IRBA 4MZ9A 1MIUA 2E8GA 4JI3Q 4DNIA 1SMXA 4LF5L 4LFCQ 3HOVG 1D7QA 3NBHB 1C7YA 3NEMA 5FLMH 2E5LQ 2D62A 4DPGA 2AWOA 1VQNA 1N32Q 2R93G 1NMFA 2WAQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G G;  3OTO L;  4RMF A;  4JBM A;  2UUC Q;  2HT1 A;  3PUV A;  1C0A A;  1E22 A;  2PI2 A;  4PZ6 A;  1VQF A;  4B3S L;  3GTG H;  4LNQ A;  4GKK Q;  2E2J H;  4BBS G;  5GQO A;  1L1O A;  1HZB A;  2JQO A;  3ZJY C;  1QZH A;  2CQO A;  3PF4 A;  3W5O A;  3J7A 5;  2VQF L;  4LUV A;  3HOZ G;  3E9H A;  3TRZ A;  5C0X G;  4A3C H;  4OO1 I;  1Z47 A;  2IX0 A;  3K80 C;  1TXY A;  4P73 A;  4DV4 Q;  4UPA A;  4LFC L;  3I4M H;  3KF6 A;  1HNZ L;  2LSS A;  1VQO A;  3CC7 A;  4OX9 Q;  4JOI A;  1YNX A;  1IBL L;  1PH3 A;  3PV0 A;  1HZC A;  4DR4 Q;  4DR6 Q;  3S16 H;  1JT8 A;  2UXD L;  4JI6 Q;  3HKZ G;  2ZJQ A;  4BY7 G;  1MKH A;  1QVF A;  4OWX B;  3S1M H;  1CKN B;  4GN5 A;  1PH7 A;  4YWK A;  4KHZ A;  3S1R H;  1VQP A;  1KRS A;  4NB3 A;  4DV7 Q;  4B3S Q;  1JB7 A;  3H3V I;  2I5M X;  3GTQ H;  2Y0S E;  4JI8 L;  1ASY A;  2QGQ A;  4YCU A;  2B29 A;  1K8A C;  2R7Z G;  5GRO A;  4JI1 Q;  4IPD A;  2JA7 G;  3G4S A;  4A3F G;  4YY3 Q;  2K5N A;  4OON A;  1WYD A;  2OTJ A;  3I56 A;  4BY7 H;  1OXS C;  1EWI A;  3CPF A;  2RHQ B;  2ZJP A;  1BBU A;  1Q12 A;  1TWA H;  1Y1V G;  2N49 A;  2EXD A;  2DGY A;  5J3B A;  2JA9 A;  5LMN L;  4HJ5 A;  1JJ2 A;  2K14 A;  2BH2 A;  4JYA Q;  1UEB A;  2R7D A;  1AE2 A;  1MJC A;  4R4C A;  1EQQ A;  3K0X A;  4JC0 A;  2Q2I A;  3MEF A;  4X64 L;  5C44 H;  3RNU A;  4JI8 Q;  4GNX A;  1VCI A;  4DR7 Q;  2WB1 E;  4X66 Q;  1HNX L;  4LF6 L;  1UE6 A;  5K36 G;  2IT1 A;  1HJP A;  1YBY A;  1OXX K;  1WFQ A;  5IP7 G;  4A3I G;  2R6G A;  3AYH B;  5LMU L;  1Q8K A;  3HOW G;  2YTX A;  2IY5 B;  4A3F H;  1CSQ A;  4QY7 A;  1RL2 A;  3UDI A;  4IOC A;  3OTO Q;  2NVY H;  1N36 Q;  3RLO A;  1FJG L;  1EQR A;  2NVQ H;  1YVC A;  2BA0 A;  4MNO A;  3ULP A;  3KOJ A;  1VQ6 A;  3U4V A;  4IJH A;  2Q2T A;  4A76 A;  2OQK A;  3I4M G;  3AFQ A;  4A3J H;  1TWF H;  1NE3 A;  5M3M G;  4HJ8 A;  1N34 Q;  3S15 H;  3W1B A;  4MTN A;  2CWP A;  4J15 A;  3J80 c;  4GS3 A;  1XNR L;  1BBW A;  1Y14 B;  3I7F A;  1Q1E A;  4O0A A;  3HOX G;  4JYA L;  5FJ8 H;  1YZ6 A;  5IYD H;  5IYC G;  4B3R L;  2N8N A;  2PI2 E;  4JV5 L;  4JI2 Q;  3T1H Q;  5IT9 c;  1E1O A;  2VUM H;  2EIF A;  4A3M H;  4QL5 A;  3F1Z A;  4LF4 Q;  4JV5 Q;  2NZO A;  1V43 A;  1KIX A;  4PG3 A;  1J5E L;  2JK8 A;  4AYB G;  1K8G A;  3JAM c;  3KLW A;  4DV7 L;  4LFA Q;  1PH4 A;  3LGJ A;  1X6O A;  2D0O A;  1T9H A;  3KJO A;  2KCT A;  3HOU H;  4DK3 C;  1OXV A;  1YHB A;  4JI3 L;  2K50 A;  3T1Y Q;  4JBW A;  4JBJ A;  1XNR Q;  2MO1 A;  2I5L X;  2Z6K A;  2WAQ E;  3GTP H;  3T1Y L;  3S24 A;  1FL0 A;  4GLA C;  2ZM6 Q;  3NEN A;  1VQ8 A;  2ZTD A;  3K8A A;  1I94 L;  4KLK A;  2ASB A;  1YEZ A;  4ALP A;  1PHJ A;  1HNW L;  5IYC H;  4LUO A;  4P71 A;  2MNA A;  1K73 C;  4IPG A;  2ATW A;  1HZ9 A;  4GKK L;  3GTK H;  4B3M L;  2HHH Q;  2E2I H;  2NVX H;  3GTO H;  3M7N A;  5IYB G;  3PUW A;  1YIT A;  1CKM A;  5JJI A;  1V1Q A;  5C4X H;  5IP9 G;  2UUA Q;  2F4V L;  1SE8 A;  4IJL A;  5C0X J;  4OX9 L;  2B63 H;  1KL9 A;  2WFW A;  1X3G A;  2C35 B;  3TEH B;  1I94 Q;  1Z9F A;  2IHE A;  3PSI A;  4JBK A;  2JA6 G;  3G6E A;  5M5Y H;  3J7Z C;  2JE6 I;  3S2H H;  4RG1 A;  4JI7 L;  3M4Q A;  1X56 A;  5IWA L;  3EIV A;  5C44 G;  1XMQ Q;  2UXC Q;  2HHH L;  1X54 A;  3CCU A;  2N78 A;  1PV4 A;  4GOP A;  2HQL A;  3STB C;  3CCL A;  1I5F A;  4LFA L;  3RN5 A;  1M90 C;  3J81 c;  1GVP A;  1BKB A;  3KF8 B;  1QVG A;  1X3E A;  4LWC A;  1S72 A;  2E5L L;  3S14 H;  3PO3 G;  1I50 H;  1FVI A;  3HOX H;  4DV6 Q;  4JI2 L;  1VQB A;  2R7F A;  2JJQ A;  2NN6 G;  4JI5 Q;  1R9T H;  3RLF A;  1S40 A;  4YWM A;  4C3J H;  3KF6 B;  4YCW A;  1VQK A;  1LUZ A;  1OTC A;  3F8T A;  4PMW A;  4IFD I;  3NEL A;  1JJG A;  4HIK A;  3W1G A;  1QZG A;  1XNQ L;  4FDB A;  4QIW E;  2VW9 A;  3DLL A;  4LF9 Q;  1L1O B;  2F4V Q;  5JJL A;  3CPW A;  2QEX A;  3CXC A;  2ES2 A;  4L5R C;  4BXX H;  3JAM i;  5FLM G;  4BXX G;  2A19 A;  2UXB Q;  1LYL A;  3AFP A;  3AQQ A;  1PYB A;  2NN6 I;  3EBE A;  1VQD A;  2MFI A;  1HR0 Q;  1BVS A;  3E0E A;  1EIF A;  2VQE L;  2AMC B;  3SGI A;  3ULJ A;  4DAY B;  3TRE A;  3M4P A;  1K9M C;  5M3F G;  4L5S A;  1PH9 A;  3CMA A;  2KBN A;  2UUB Q;  1WOC A;  3HOZ H;  1L1O C;  4GLV B;  3A0J A;  1KHI A;  1HR0 W;  3EN2 A;  3WWV A;  5ELO A;  2PMZ E;  3TS0 A;  1XPU A;  2JA8 G;  1YIJ A;  4EX5 A;  1PH1 A;  2RHS B;  2KCM A;  4JI4 Q;  1IBK L;  4BA2 I;  1GO3 E;  5LMN Q;  4JI5 L;  4P75 A;  4TVA B;  2D0P A;  1TWH H;  4C3H H;  3F2D A;  1IBM L;  1X65 A;  3CC4 A;  4A3D G;  3B6Y A;  3CCS A;  4DV0 Q;  2GN5 A;  5C3E G;  1EFW A;  1E3P A;  2RCN A;  3Q8D A;  4K0K Q;  1VQC A;  1Y1V H;  1VQH A;  2XGT A;  3ERS X;  3HOW H;  3RZO H;  3A74 A;  2JA6 H;  5M3M H;  1KC8 C;  2UUC L;  4X64 Q;  4DR5 L;  1SRU A;  3AEV A;  4LF7 L;  3UDX A;  2R92 H;  3KJP A;  5LMN W;  1XPO A;  1PH6 A;  1O7I A;  1HNX Q;  3ICE A;  3S17 H;  5GAE C;  1N32 L;  4LF9 L;  3HKS A;  2A1A A;  4LFB Q;  2OQ0 A;  4DV5 L;  2KHJ A;  4A3K G;  1MJE A;  3CF5 A;  2ZM6 L;  4A3M G;  1N34 L;  4DV5 Q;  1VQE A;  3J81 i;  4DV4 L;  2Q2H A;  2I5H A;  3KYH C;  1LM0 A;  1OXU A;  1A0I A;  4UY8 C;  4ME3 A;  3CP0 A;  3CD6 A;  3S1N H;  4UP7 A;  2OWO A;  4A3G H;  2MQH A;  1E1T A;  5C0X I;  3UE1 A;  4NXM L;  3L2P A;  3GO5 A;  4R4Q A;  3GD7 A;  4HIM A;  5FLX c;  2PNH A;  3DM3 A;  1E24 A;  1YHA A;  3CAM A;  4LW1 A;  3RR5 A;  3MXN B;  4YHH Q;  2JA7 H;  1HR0 L;  4IFD J;  4X65 Q;  1WCM H;  2E2H H;  3STB D;  4DV3 L;  4A3K H;  2LXJ A;  4WJ4 A;  1TWC H;  1K3R A;  4LF8 Q;  1IBK Q;  3I4N H;  1SLJ A;  3OYY A;  5H1S E;  4XIG S;  1XMQ L;  4LFB L;  1P8L A;  3BU2 A;  3A5Z B;  3VDY A;  4OO1 G;  1N33 Q;  3PUX A;  4L5T A;  5AJ3 Q;  4DV2 Q;  5JEA G;  2IHF A;  1B7Y B;  4R4T A;  3KFU A;  3CW2 C;  4A3C G;  1Y1W G;  2JA8 H;  4YHH L;  4APV A;  4LF4 L;  2UU9 L;  3H15 A;  1J6Q A;  1VQI A;  3FHW A;  3GTJ H;  1UE5 A;  3F2B A;  4DR2 L;  3K7U C;  1YI2 A;  1PA6 A;  1J5E Q;  4XTC S;  4B3T Q;  3BZK A;  3PGZ A;  2VY3 A;  4OWT B;  3JC6 6;  1SFO H;  3OW2 A;  2UXD Q;  2FXQ A;  3GDE A;  2K5V A;  5GAG C;  3U58 A;  5JJK A;  4R1J A;  2NZH A;  2YV5 A;  1PYS B;  4HJA A;  2IX1 A;  1H95 A;  1VQ9 A;  3FP9 A;  2UXB L;  4DR4 L;  4NXN L;  4GKJ Q;  4GOP C;  3PO2 G;  2YU9 H;  2MO0 A;  4IOA A;  2AHO B;  1UE1 A;  4PZ7 A;  5IP9 H;  3RN2 A;  5C4X G;  2VQF Q;  4IO9 A;  4X65 L;  3TQY A;  2LXK A;  4LF7 Q;  2K5H A;  3H0G H;  4KHP L;  1NMG A;  3PUZ A;  4GN4 B;  2I0Q A;  4POF A;  1YJW A;  3CQZ H;  2GVB A;  1IBM Q;  5IE8 A;  3CCV A;  1PH8 A;  1IZ6 A;  4BBS H;  4B3R Q;  3L7Z C;  3S1Q H;  3PIP A;  1PH5 A;  5HY6 A;  2VL6 A;  1JJC B;  4NXN Q;  4GKJ L;  4AYB E;  1PVO A;  4TQU S;  5DLQ E;  1GM5 A;  3BZC A;  4X6A H;  1IL2 A;  3CCJ A;  2R7Z H;  3HFZ B;  3PO2 H;  1U5K A;  4H02 A;  5M5W H;  4QJF A;  2NVT H;  1I6H H;  5E7N A;  4YY3 L;  2CCZ A;  3F2C A;  4IPC A;  1N36 L;  4R4I A;  2QA4 A;  4BA1 I;  4DR5 Q;  1XPR A;  4HIO A;  4A3B G;  2F3I A;  4A4I A;  4DR2 Q;  2CKZ B;  2Z6K C;  4X62 L;  1Q86 C;  2Y0S G;  3L0O A;  3BJU A;  2CFM A;  1N8R C;  1HH2 P;  4X62 Q;  1ASZ A;  4AQY L;  3J80 i;  3CCR A;  4OXP A;  5IY0 A;  2H5X A;  4DV0 L;  1A63 A;  5C3E H;  2K4K A;  5FJ8 G;  1VQL A;  2AWN A;  4BBR H;  4DR6 L;  1Y1W H;  2B63 G;  2ZJR A;  2K75 A;  2ID0 A;  4JG2 A;  2JA5 G;  4YCV A;  1Q81 C;  1XNQ Q;  2VUM G;  4R4O A;  1AH9 A;  3G48 A;  2RF4 A;  3A5U A;  5M5X H;  1XJV A;  4O2D A;  5IYB H;  4KI0 A;  4EQ5 A;  3ULL A;  1SRO A;  2N3S A;  4OWW B;  1V9P A;  5BR8 Q;  1G6P A;  2V1C C;  1X9N A;  4AIM A;  4BY1 H;  3K81 C;  4C2M H;  1W2B A;  1E7Z A;  1KD1 C;  4LUZ A;  2VQE Q;  4B3T L;  4KHP Q;  1FGU A;  3RLN A;  1I3Q H;  1K0R A;  1Q7Y C;  4LF6 Q;  1GKH A;  4DKA C;  2JEB I;  4HJ9 A;  3I4N G;  4DV1 L;  4DR1 Q;  1G51 A;  5ELN A;  5LMU Q;  1VQJ A;  4JI0 L;  1UWV A;  2CWA A;  4NPS A;  1L0W A;  3CC2 A;  2UXC L;  3U50 C;  5AJ3 L;  1W3S A;  1B70 B;  4DR3 L;  2XTI A;  3HOU G;  1B8A A;  4BY1 G;  1XTD A;  1XMO L;  5IP7 H;  4A75 A;  1VQM A;  2GVA A;  4GN3 B;  3U4Z A;  1A8V A;  1YJN A;  1Q82 C;  4P74 A;  2B3G A;  1CKO A;  3TS2 A;  1XMO Q;  2VNU D;  1L2F A;  1RIP A;  4GNX C;  1CUK A;  3H3V H;  4GOP B;  1KQS A;  1KAW A;  1TWG H;  1KXL A;  1SR3 A;  4C3I H;  1N9W A;  1EIY B;  3UE0 A;  3FKI G;  2ALY B;  5C4J H;  3ER0 A;  1NTG A;  1VQG A;  3M3Y H;  3H0G G;  4A3B H;  4HJ7 A;  4A3J G;  4L5Q A;  3T1H L;  4P72 A;  3PIO A;  3KDF A;  3CCE A;  3D0F A;  4DK6 C;  3M4O H;  1WI5 A;  4QQB X;  4DUY L;  3UDG A;  5M3F H;  4WJ3 M;  4QGU A;  1VS0 A;  1X3F A;  4JI6 L;  1WCM G;  2Q2U A;  4JI7 Q;  1HNW Q;  4K0K L;  2L15 A;  4GNX B;  1VQ4 A;  2R93 H;  5BR8 L;  5IWA Q;  1KRT A;  3GTL H;  1S3O A;  4LF8 L;  4JCV E;  4A3I H;  1A62 A;  2HIX A;  4JI4 L;  4DV3 Q;  1QVC A;  2PQA B;  1EUJ A;  2AKW B;  3I4O A;  4DR3 Q;  4A3E H;  1HNZ Q;  2HIV A;  1IXR A;  3I55 A;  1CKN A;  2Z0S A;  1NJI C;  4POG A;  3CME A;  4A93 H;  4A93 G;  3D31 A;  1JE5 A;  1G29 1;  4BBR G;  2BH8 A;  2UUA L;  3HOY H;  3PCO B;  1FJG Q;  3CCM A;  1GD7 A;  2UU9 Q;  2JEA I;  4JOI C;  1M1K C;  4A3L G;  4A3L H;  1CSP A;  4GLX A;  4DV1 Q;  4DR1 L;  1QUQ A;  3M9B A;  1QUQ B;  1NBW A;  3PUY A;  4X66 L;  4DV2 L;  1YJ9 A;  4B3M Q;  2EQS A;  3I2Z A;  1IYJ B;  5EAY A;  3J81 j;  1D8L A;  3G71 A;  4A3E G;  2ZTE A;  2R92 G;  2WB1 G;  4Y52 H;  1IBL Q;  4PZ8 A;  4LF5 Q;  3HKZ E;  2BA1 A;  5GAH C;  1DGS A;  1LTL A;  4UP8 A;  2KEN A;  2YTV A;  2PQA A;  1X55 A;  2VS1 A;  2WP8 J;  3PF5 A;  2YTY A;  3K7A H;  1VQ7 A;  4A3D H;  1NY4 A;  3HOV H;  2OCE A;  4Y7N H;  4DV6 L;  1UE7 A;  4DUY Q;  1AE3 A;  2UUB L;  4JI1 L;  4DAM A;  4AH6 A;  1VQA A;  3FKI H;  1JMC A;  1U0L A;  3CCQ A;  3M85 A;  4JI0 Q;  1K83 H;  4AQY Q;  2YYZ A;  2ZTC A;  4DUZ L;  4UP9 A;  3UDF A;  1YHQ A;  2JA5 H;  2A8V A;  4DR7 L;  1PFS A;  4NXM Q;  3KDF B;  4YWL A;  2F52 A;  3S2D H;  3PO3 H;  1C9O A;  4DUZ Q;  3GTM H;  2OTL A;  1N33 L;  4IFD G;  4IPH A;  1Q46 A;  2KHI A;  1HZA A;  1OXT A;  5IYD G;  1WJJ A;  5GAD C;  1SN8 A;  3HOY G;  1VQ5 A;  2VZA A;  5JEA J;  1EYG A;  2DUD A;  1PH2 A;  5HGQ A;  3E9I A;  3RZD H;  1EOV A;  1P16 A;  2K52 A;  1Q1B A;  4HID A;  3IRB A;  4MZ9 A;  1MIU A;  2E8G A;  4JI3 Q;  4DNI A;  1SMX A;  4LF5 L;  4LFC Q;  3HOV G;  1D7Q A;  3NBH B;  1C7Y A;  3NEM A;  5FLM H;  2E5L Q;  2D62 A;  4DPG A;  2AWO A;  1VQN A;  1N32 Q;  2R93 G;  1NMF A;  2WAQ G; 
#chains in the Genus database with same CATH topology
 5LL6 X;  2UUC Q;  2K1B A;  5C3E B;  1T5E A;  5COY A;  1E22 A;  3RUZ A;  3GTG H;  3AU7 A;  1HZB A;  3ZJY C;  3PF4 A;  1ENF A;  3W5O A;  4DU9 A;  4ZUI A;  1QWY A;  4OO1 I;  4DV4 Q;  2LKV A;  3CC7 A;  1YNN D;  3K57 A;  4JOI A;  1YNX A;  4X3S A;  1UUP A;  1HZC A;  3PV0 A;  2UXD L;  3HKZ G;  4RHR A;  1QVF A;  3KF8 A;  3S1M H;  2PCF B;  1KRS A;  1LAB A;  4KKU A;  3ZYY X;  1EY6 A;  3H3V I;  3OMG A;  4JI8 L;  1ASY A;  1FR3 A;  2QGQ A;  3A56 A;  3NSW A;  5GRO A;  3I73 A;  4JI1 Q;  5BN5 A;  2JA7 G;  5I4D A;  4YY3 Q;  1PLF A;  2K5N A;  5IIF A;  1AP0 A;  2RHQ B;  1EWI A;  4TRD A;  1Q12 A;  2DJF C;  4HJ5 A;  1JJ2 A;  1LTG D;  5J3B A;  2NBF A;  2K03 A;  1WTH A;  4JK1 C;  4BBS B;  1MJC A;  4R4C A;  5DNF A;  3K0X A;  1SYB A;  2N55 A;  4R8N A;  3EA6 A;  5DM6 3;  3M3Y B;  5FK9 C;  2CW0 C;  2PQE A;  2WB1 E;  4X66 Q;  4HR7 B;  4B9W A;  5FLX L;  4A3I G;  2R6G A;  5IGB A;  2YTX A;  3K0Y A;  4IOC A;  3VR6 A;  3K5O A;  4RGM A;  3OTO Q;  2CHB D;  1FJG L;  1EQR A;  3KBG A;  3ULP A;  1BUV T;  2HDM A;  1VQ6 A;  1N34 Q;  3BYT B;  3CRK C;  4B9X A;  5IOD A;  4G4K A;  1BCP D;  5CR3 A;  1JOR A;  1NR4 A;  4GS3 A;  1XNR L;  3SVM A;  1Y14 B;  1H9J A;  2VUM H;  4A3M H;  3T16 A;  2QDL A;  1V43 A;  4AYB G;  1SNM A;  3KLW A;  3Q0A A;  2KCT A;  4JI3 L;  2K50 A;  4JBW A;  1A2U A;  2Z6K A;  1R4P B;  2PZU A;  1VQ8 A;  3S24 A;  5EBD A;  2ZTD A;  5JVG 3;  4ALP A;  4NW2 A;  4CKB A;  5JVH 3;  5CBE E;  2EYF A;  1K73 C;  3GTK H;  2A73 B;  1JR0 D;  3TZD A;  3PUW A;  5KIX A;  4PMB A;  5JJI A;  1V1Q A;  1O7Y A;  2B63 H;  1VMC A;  1DYQ A;  4KN4 C;  1KL9 A;  4QF4 A;  2WFW A;  2H4O A;  3HOU B;  3TEH B;  1I94 Q;  1V1P A;  5M5Y H;  3M4Q A;  1K28 A;  1X56 A;  5IWA L;  5C44 G;  3VYU A;  2N78 A;  4LFA L;  2HQL A;  3STB C;  1GVP A;  1QVG A;  1X3E A;  4LWC A;  2KHS A;  2E5L L;  4RCO A;  3S14 H;  2JN4 A;  1I50 H;  2O5I C;  5KND A;  3I8Z A;  3HOX H;  2ZXP A;  1SND A;  1VQB A;  1S40 A;  1E0B A;  4YWM A;  3KF6 B;  4YCW A;  1OTC A;  4PMW A;  1BCP F;  1JC7 A;  1TS2 A;  4LMQ D;  3ERO A;  3DLL A;  1L1O B;  4JW0 A;  3CXC A;  1W6K A;  1I3Q B;  1LYL A;  3AFP A;  3AQQ A;  2DNC A;  1VQD A;  3EBE A;  3SGI A;  4DAY A;  2B2V A;  2MHV A;  1I50 B;  1K9M C;  3MAQ A;  1MBY A;  5C6A A;  1BDO A;  4GLV B;  3A0J A;  1KHI A;  4C3J B;  3WWV A;  5ELO A;  1XPU A;  3D8G A;  1PH1 A;  3K5N A;  2RHS B;  2KCM A;  4C3I B;  3MXP A;  3TME A;  1DCZ A;  4A3B B;  2J7Z A;  1QJO A;  2GN5 A;  5M5X B;  1STH A;  1SYD A;  2RCN A;  3Q8D A;  3ERS X;  2XGT A;  3A74 A;  1SYF A;  3NQT A;  1TWC B;  5M3M H;  1ESR A;  2PW7 A;  1IHZ A;  4X64 Q;  2UUC L;  1SRU A;  1GUT A;  5M5Y B;  3UDX A;  4RKB A;  2R92 H;  3FDT A;  3KJP A;  1E2W A;  4I65 A;  1XPO A;  1O7I A;  1PH6 A;  1HNX Q;  1N32 L;  2MP1 A;  4LF9 L;  2A1A A;  1CM9 A;  3O13 A;  4HN7 A;  1MJE A;  3MEH A;  2F0W A;  1VQE A;  3QWN A;  5I2X A;  3J81 i;  4DV4 L;  2I5H A;  1ICW A;  1K83 B;  4ME3 A;  3HGB A;  4FXK C;  4CDC C;  4A3G H;  3ITP A;  3UE1 A;  2L55 A;  5FLX c;  2KED A;  4KK7 A;  3DM3 A;  4YHH Q;  4Q5V A;  2JA7 H;  3MXN B;  4IFD J;  4X65 Q;  3STB D;  1Q8I A;  4A3K H;  5D3I B;  1SE3 A;  1TWC H;  1BXT A;  4ZK9 B;  5EBC A;  5C5L A;  2JP1 A;  4LFB L;  1J9O A;  2CH4 W;  5ELB A;  3VDY A;  1EZ8 A;  4FF3 A;  2F0F A;  2FJ2 A;  4L5T A;  1IW7 D;  3T53 B;  3CW2 C;  5LL6 S;  2JA8 H;  4APV A;  2UU9 L;  3W3A A;  1VQI A;  1YI2 A;  4RGN A;  4XTC S;  4B3T Q;  2R7Z B;  5DAU A;  2QF7 A;  3JC6 6;  1SFO H;  4YIJ A;  5FO7 B;  1K8M A;  1DXM A;  4R1J A;  5C3X A;  1PYS B;  2B39 A;  4RKL A;  2IX1 A;  5C3W A;  3IFD A;  4GKJ Q;  3AB9 A;  2YU9 H;  2F1M A;  3FMC A;  4NMZ A;  3K58 A;  2MO0 A;  4IOA A;  4PZ7 A;  3DXJ C;  5C4X G;  2C9O A;  4MTK A;  3TQY A;  1HRJ A;  3MFG A;  4KHP L;  4GN4 B;  1JB3 A;  2B2U C;  2F0L A;  1YJW A;  4HSP A;  2XSC A;  4HCS A;  2TMP A;  4BBS H;  3GV3 A;  1RCV D;  2XRS D;  2VL6 A;  4GKJ L;  4E6I A;  5CC4 A;  4TQU S;  1LT5 D;  1PTO B;  4PNY A;  1D1K A;  3VA7 A;  2F0V A;  2NVT B;  1WTR A;  5M5W H;  2RCF A;  4I7A A;  1PRT C;  2CCZ A;  4CDD C;  3QOL A;  4XT3 B;  4R4I A;  2QA4 A;  2NVQ B;  4X62 L;  3NWT A;  4OIK A;  3SHL A;  1HH2 P;  4X62 Q;  1JE4 A;  2A74 C;  5IGD A;  5C3E H;  4EQN A;  2AWN A;  4DR6 L;  2RDG A;  4KKS A;  1LT3 D;  5IGE A;  4JG2 A;  3N52 A;  2O4X A;  1XNQ Q;  2VUM G;  1U4R A;  1AH9 A;  4H44 C;  5IYB H;  4KI0 A;  1HCZ A;  2O2L D;  2N3S A;  5E4W C;  5CV6 A;  5BR8 Q;  4CDF C;  1G6P A;  4ZCK A;  3QJY A;  1X9N A;  3D3R A;  1ILQ A;  2B2Y A;  4AIM A;  2EOT A;  3R2T A;  2VQE Q;  1BBX C;  4K5V A;  1EL0 A;  1GOZ A;  1GKH A;  4JI0 L;  5ELN A;  1VQJ A;  2L12 A;  3L9A X;  1GHK A;  2CWA A;  1L0W A;  3CC2 A;  4LJZ C;  3G6J B;  2J0T D;  4RCN A;  2RSN A;  2C5C A;  3OHX C;  3NBH A;  3NWS A;  2B2U A;  4A75 A;  3HOX B;  1F9Q A;  1QIL A;  1A8V A;  1YJN A;  1CKO A;  2PZW A;  1L2F A;  1ZEQ X;  4GNX C;  2IX3 A;  1KQS A;  1GUS A;  1STY A;  1KXL A;  3VR4 A;  3UE0 A;  5C4J H;  3I4L A;  3F2U A;  3M3Y H;  4HJ7 A;  1XWE A;  1V1O A;  1RTO A;  1EY5 A;  1WI5 A;  4K5X A;  4QCL A;  4WJ3 M;  1WCM G;  3BDL A;  5D14 A;  1QNU A;  1VQ4 A;  1QB5 D;  1SJH D;  3I72 A;  3A8I E;  2A5H A;  3SK8 A;  2F0J A;  2G9H D;  3P1H A;  2E2D C;  2HIX A;  4JI4 L;  3HOW H;  4A3D B;  3I4O A;  4A3E H;  1SNQ A;  1F2Z A;  1NJI C;  4BBR G;  1JE5 A;  2BH8 A;  2F0U A;  1S5B D;  2UUA L;  3DMU A;  1FJG Q;  2M2L A;  3CCM A;  1GD7 A;  2UU9 Q;  5A2Q E;  3T13 A;  1CSP A;  1V8Q A;  4GLX A;  4DV1 Q;  3S2D H;  1EQV A;  3PUY A;  1F2M A;  1QUQ B;  4B3M Q;  5EAY A;  3G71 A;  3EJI A;  2R92 G;  1CTM A;  2A6E D;  1QNK A;  2JA6 B;  2CH4 A;  2K33 A;  2LY7 A;  1DGS A;  4UP8 A;  2RA4 A;  1X55 A;  4HMJ A;  4ZKB B;  2H1E A;  2YTY A;  1VQ7 A;  4A3D H;  1I4Q A;  1QG7 A;  3K5M A;  4Y7N H;  2ICI A;  3EFX D;  4DUY Q;  1AE3 A;  1VQA A;  1MGS A;  3FKI H;  1DJR D;  1KNE A;  3CCQ A;  5IGF A;  1YHQ A;  1LTI D;  3Q6S A;  2F0O A;  4NXM Q;  4H0L C;  2A6H D;  1C9O A;  3QG1 A;  3GTM B;  1SDF A;  1HZA A;  2KHI A;  1GHJ A;  1SN8 A;  5E4X A;  2SNM A;  3PIO 3;  5C4J B;  2HD3 A;  1PH2 A;  3E9I A;  2RDF A;  3KLS X;  3ONA B;  4N8X 1;  2OEO A;  1EU3 A;  4HID A;  4MZ9 A;  4WJW A;  1HA6 A;  3BYY B;  3NEM A;  4DF7 A;  5FLM H;  3OPO A;  3FKI B;  2WAQ G;  2FIN B;  2FFK B;  3PUV A;  1TR5 A;  5E3F A;  2IW3 A;  2OXP A;  3HOW B;  4B3S L;  3VR3 A;  4GKK Q;  4G57 A;  4BBS G;  5GQO A;  1QZH A;  2JQO A;  4LUV A;  5C0X G;  3K80 C;  2Q8T A;  4FF1 A;  3U9S A;  4UPA A;  3I4M H;  1HNZ L;  2RBM A;  3M7G A;  4K5W A;  2AQ2 B;  1LLR D;  4DR4 Q;  3S16 H;  1JT8 A;  2ZJQ A;  1MKH A;  4U67 3;  3S1M B;  4GN5 A;  2TSS A;  3MHB A;  3S1R H;  4JVZ A;  1VQP A;  1PTO F;  4NB3 A;  2FMM A;  1MSG A;  4YCU A;  3QIA A;  1K8A C;  3S15 B;  4IAL A;  3GTG B;  2JSO A;  4A3F G;  4OON A;  3C2P A;  4BY7 H;  1I4G A;  2UXB L;  4R8I A;  2RQX A;  2K14 A;  4ZAI A;  2R7D A;  1AE2 A;  4S3S A;  1EQQ A;  4JC0 A;  2RSO A;  1U9R A;  2Q2I A;  2F0K A;  2V4D A;  3DEP A;  4KHV A;  4X3U A;  4CDE C;  2KA7 A;  2IT1 A;  3DEO A;  1YBY A;  1OXX K;  3WDN A;  5IP7 G;  2E2H B;  1I6V C;  5LMU L;  3J7A V;  2IY5 B;  1NNX A;  5FKA C;  1CSQ A;  4QY7 A;  4A3F B;  1YNJ D;  2NVQ H;  1D5M C;  4MNO A;  1LTS D;  4XQN A;  1CFM A;  4IJH A;  4IUU A;  3U4V A;  3M4Y A;  2HDL A;  3AFQ A;  4A3J H;  1TWF H;  3S15 H;  2M9V A;  2NVX B;  2CWP A;  1DOK A;  2EXZ A;  3I7F A;  1Q1E A;  4JYA L;  5CMD A;  3GTJ B;  4UDU C;  4WRD A;  1BCP B;  1CZW A;  1XTC D;  1RD9 D;  2PNR C;  2Z4I A;  4JV5 L;  4CJ1 B;  5IT9 c;  1E1O A;  3F1Z A;  4JV5 Q;  2KVM A;  5CBA E;  2KEE A;  1PH4 A;  1X6O A;  2E75 C;  3X3N A;  2F0G A;  1TT2 A;  4DK3 C;  1OXV A;  3T1Y Q;  1XNR Q;  4JBJ A;  3GTP H;  1I4P A;  4GLA C;  3NEN A;  1VMP A;  2ASB A;  1YEZ A;  3H0G B;  1SXT A;  1HNW L;  5IYC H;  2B8G A;  2N88 A;  2JXM B;  1D6E C;  4HMI A;  2MNA A;  1PMR A;  2K28 A;  4ZRZ A;  1DZ1 A;  2FHT A;  3H09 A;  3CKI B;  4B3M L;  1JWU D;  1LTR D;  5D3D A;  2NVX H;  1GUG A;  5IYB G;  3SXH A;  4KV6 A;  2UUA Q;  1V1P B;  5JEA H;  5C0X J;  4OX9 L;  1LTB D;  4FYD A;  2C35 B;  5JOB A;  5I2Y A;  1Z9F A;  1SFO B;  4RG1 A;  3S2H B;  1ONL A;  3FPU B;  3DWP A;  4JI7 L;  5I9P A;  1MI2 A;  3EIV A;  2HHH L;  1X54 A;  1B1Z A;  4GOP A;  3CCL A;  3D4R A;  1PRT F;  3RN5 A;  1B53 A;  4A3E B;  5KNB A;  1RJT A;  4KD4 A;  1ZYR D;  4DV6 Q;  2JJQ A;  2NN6 H;  3RLF A;  2F0N A;  4EGV A;  5CGK A;  1DOM A;  4KY5 A;  4HIK A;  1HUM A;  4FDB A;  1YNJ C;  2VW9 A;  2A68 C;  2ES2 A;  5JJZ A;  4BXX H;  1PFM A;  2A19 A;  4BXX G;  2NN6 I;  3HOV B;  1DM0 B;  1EIF A;  2R93 B;  3ULJ A;  4C3H G;  4L5S A;  5M3F G;  5HUR A;  3CMA A;  4C3J G;  2SNS A;  4KY7 A;  1DD2 A;  2PMZ E;  2M00 A;  1K8O A;  1GO3 E;  4P75 A;  3CC4 A;  3P75 A;  1IBM L;  4X3T A;  2ENB A;  4DV0 Q;  1EFW A;  1SMY D;  5DEH A;  3IKJ A;  4RHS A;  4DFA A;  1ESF A;  4KD3 A;  1MSH A;  1JIC A;  4DR5 L;  1TS5 A;  3MTS A;  4LFB Q;  1HPC A;  2KHJ A;  3NP8 A;  2ZM6 L;  5K36 H;  4A3M G;  1N34 L;  1Y8P B;  4DV5 Q;  4A93 B;  2Q2H A;  1H9R A;  2JA5 B;  4EQP A;  1LM0 A;  1OXU A;  2R3Z A;  1B50 A;  3CP0 A;  5BN4 A;  4UP7 A;  2OWO A;  2L11 A;  2MQH A;  5C0X I;  3S16 B;  1LTA D;  3GD7 A;  4HIM A;  2EJM A;  2PNH A;  1E2V A;  1YHA A;  4EQO A;  4R9W A;  1HR0 L;  1D5X C;  4XXE A;  1K3R A;  3H91 A;  2BOS A;  1STB A;  3OYY A;  5H1S E;  4XIG S;  3AMU A;  1I4R A;  4OO1 G;  2IJ0 A;  5F2D A;  5AJ3 Q;  2B8F A;  2Q8R E;  1B7Y B;  1FNW A;  1A3V A;  2EYJ A;  1J6Q A;  4LF6 Q;  4DR2 L;  5C4X B;  3K7U C;  3Q24 A;  3IL8 A;  3PGZ A;  2VXW A;  1EEI D;  2E74 C;  1EY9 A;  3I4M B;  2UXD Q;  5GAG C;  3PMF A;  1I4X A;  2YV5 A;  4HJA A;  5CV7 A;  5EKL A;  1Y69 U;  1VQ9 A;  3TZU A;  1VDZ A;  1BOS A;  2A6E C;  3DHQ A;  2RKS A;  3GTQ B;  2AHO B;  3QB3 A;  5IP9 H;  2VQF Q;  4IO9 A;  4ODG A;  4X65 L;  3NPP A;  4LF7 Q;  1KTK A;  2PYK A;  1NMG A;  1CHQ D;  1TWA B;  3W2D A;  2I0Q A;  2NZ1 D;  1NUC A;  2XNA C;  3CQZ H;  1PH8 A;  3L7Z C;  3S1Q H;  3PIP A;  5HY6 A;  4NXN Q;  3KUP A;  3S1N B;  5JPN C;  4BY1 B;  4G7Z C;  1IL2 A;  3A54 A;  4J6H A;  2R7Z H;  5M5W B;  4KTA A;  1U5K A;  4H02 A;  4QJF A;  1CQF A;  3GTP B;  5E7N A;  1N36 L;  4DR5 Q;  1XPR A;  4F87 A;  4HIO A;  4A3B G;  2F3I A;  2ZXR A;  2CKZ B;  2Y0S G;  4QUF A;  2EPB A;  2YU9 B;  2EE1 A;  4IUT A;  4AQY L;  4DV0 L;  2SOB A;  1SSO A;  1A63 A;  1PZK D;  3I90 A;  1J8I A;  4U68 A;  2B63 G;  2ZJR A;  2K75 A;  2ID0 A;  5J39 A;  4YCV A;  5I9O A;  1NSN S;  3NBI A;  2RF4 A;  4IQZ A;  1XJV A;  1RTN A;  4EQ5 A;  4ILW A;  1EYC A;  1HQM C;  1V9P A;  1SE2 A;  4C2M B;  4BY1 H;  1CT1 D;  1C4Q A;  4LUZ A;  2L5T A;  4KHP Q;  3RLN A;  1I3Q H;  1SNC A;  2AUJ D;  4DKA C;  1CA6 A;  2Y0S B;  1SNP A;  1UWV A;  3GV6 A;  4K2K A;  1O7Z A;  1KDC A;  2UXC L;  1JOO A;  5AJ3 L;  1B70 B;  4DR3 L;  2F0M A;  1XTD A;  4GN3 B;  3U4Z A;  3QO2 A;  2VB3 X;  2DN8 A;  4P74 A;  2VNU D;  1RIP A;  1EY8 A;  4GOP B;  1KAW A;  2NUC A;  1EEF D;  1O80 A;  1SR3 A;  4KJO A;  4O42 A;  4C3I H;  2MUY A;  2ALY B;  1NTG A;  1VQG A;  3NQI A;  3H0G G;  3R2I A;  4A3B H;  4ZQ3 A;  5KNC A;  3LNN A;  3PIO A;  1C48 A;  2EYP A;  4DK6 C;  3M4O H;  4QQB X;  4DUY L;  5M3F H;  1A3T A;  3V05 A;  1BO0 A;  4JI6 L;  4JI7 Q;  4K0K L;  1B3A A;  2EVB A;  2L15 A;  4IUR A;  5KGU A;  3RD4 A;  5BR8 L;  5IWA Q;  1S3O A;  2LMC B;  3J7A F;  4A3I H;  1A62 A;  4UHV A;  1EWH A;  2PQA B;  1EUJ A;  1HQR D;  2HIV A;  2Z0S A;  4A3J B;  3CME A;  3D31 A;  3K5L A;  2JEA I;  4FXG C;  4A3L G;  4DN4 M;  5JPM C;  4DR1 L;  3M9B A;  4X66 L;  1DOL A;  1NBW A;  2WKC A;  3E0J A;  1YJ9 A;  3I2Z A;  1IYJ B;  4DGZ A;  1GUO A;  1UAP A;  4A3E G;  4N8F A;  1TS4 A;  4PMC A;  1IBL Q;  1SJE D;  4PZ8 A;  3HKZ E;  4RGO S;  2BA1 A;  1LTL A;  1KNA A;  2KEN A;  2F3V A;  2PQA A;  2VS1 A;  3PF5 A;  3MZ5 A;  3HOV H;  3FVQ A;  2OCE A;  3UI2 A;  4FF4 A;  1F2L A;  4JI1 L;  1EY4 A;  4DAM A;  1D2B A;  3DWA A;  5IGC A;  2YYZ A;  2ZTC A;  2A68 D;  2K05 A;  3UDF A;  1KLG D;  4DUZ L;  5EPJ A;  1PFS A;  5TSS A;  4YWL A;  1PDQ A;  2F52 A;  2Z8L A;  4DUZ Q;  3GTM H;  3TN2 A;  1N33 L;  3DUZ A;  1STA A;  5IYD G;  1WJJ A;  3CRL C;  3QR8 A;  3VYT A;  3CHB D;  2K52 A;  2Z4H A;  3IRB A;  4JI3 Q;  2E8G A;  4F88 A;  4LF5 L;  2F0S A;  3BVG A;  2AWO A;  3FPP A;  2WAQ B;  4K6D A;  3OTO L;  4N9P A;  4RMF A;  2EZV A;  2HT1 A;  2WB1 B;  1EU4 A;  3OIP A;  2XVS A;  4CKE A;  1VQF A;  3VR2 A;  2K5W A;  2CQO A;  2WII B;  1ET9 A;  3J7A 5;  3I70 A;  2F0D A;  4TSS A;  2XWJ B;  2B2V C;  1TXY A;  4QMG A;  4LFC L;  5EJW A;  1FNU A;  2LSS A;  5L37 A;  1IBL L;  4Q0F A;  4DR6 Q;  1Z7T A;  2QW7 A;  1IKM A;  2X69 A;  4HED A;  1S5E D;  4OWX B;  1CKN B;  4KHZ A;  2EYM A;  4DV7 Q;  1U4M A;  1JB7 A;  3GTQ H;  2Y0S E;  3BS1 A;  2L1B A;  4L8J A;  3G4S A;  4AYB B;  1AZP A;  3HP3 A;  1QCB D;  1TY0 A;  2K5Q A;  2OTJ A;  1A15 A;  3CPF A;  5LMN L;  2N49 A;  1Y1V G;  2DGY A;  2JA9 A;  2NYZ D;  2BH2 A;  1KAB A;  1H9K A;  3MVV A;  1VF5 C;  4KMU C;  4A3G B;  4DK1 A;  3R3O A;  3MEF A;  5C44 H;  4DR7 Q;  1HNX L;  1UE6 A;  3KK7 A;  1HUN A;  4UAI A;  1RHP A;  2BCO A;  3AYH B;  3J80 L;  1Q8K A;  4M8A A;  4A3F H;  2KJX A;  3V2T A;  1H9M A;  1YVC A;  1FYC A;  1II3 A;  3KOJ A;  2Q2T A;  4A76 A;  3I4M G;  2A6H C;  1NE3 A;  5M3M G;  4DAV A;  2ZXO A;  4MTN A;  4J15 A;  3J80 c;  1SMY C;  4O0A A;  1ET6 A;  1YZ6 A;  5IYD H;  4B3R L;  2PI2 E;  4FNF A;  4DNT B;  3T1H Q;  4QL5 A;  2NZO A;  3ND8 A;  1KIX A;  4PG3 A;  1J5E L;  1K8G A;  3JAM c;  1NAP A;  4DV7 L;  4LFA Q;  2D0O A;  1T9H A;  2F0H A;  4QB4 A;  3KJO A;  1AFP A;  1NR2 A;  4IUV A;  2MO1 A;  2WAQ E;  2EY5 A;  1WTQ A;  1FL0 A;  2ZM6 Q;  3K8A A;  1JQY D;  1I94 L;  4O1N A;  4P71 A;  1WTP A;  2ATW A;  4FXD A;  2HHH Q;  3GTO H;  2BDN A;  2KUM A;  2RDH A;  4IZ8 A;  5C4X H;  2EYO A;  3MC0 B;  3EQL C;  2F4V L;  4IJL A;  4C1N I;  3JAM L;  2B2W A;  3T4A C;  5AFW A;  3PSI A;  4JBK A;  4JPB W;  3G6E A;  2JE6 I;  3S2H H;  4J1M A;  4F7X A;  3KLS A;  4BS9 A;  1XMQ Q;  4PQX A;  2UXC Q;  1BF4 A;  3P20 A;  3CCU A;  1PFB A;  1PV4 A;  3EVQ A;  1I5F A;  4DNR B;  1BKB A;  3A7L A;  1S72 A;  1I4H A;  3PQI A;  2FMC A;  3SK4 A;  1FVI A;  3BZD B;  5ELC A;  4C56 C;  4WOR A;  2NN6 G;  2P5Z X;  1VQK A;  1LUZ A;  5EPK A;  3RZO B;  3F8T A;  4IFD I;  1S5C D;  3NEL A;  1XXG A;  3W1G A;  4LF9 Q;  4QIW E;  4XQJ A;  3GQB A;  1SYC A;  1TKW B;  1BNZ A;  5JJL A;  2K7V A;  4L5R C;  3JAM i;  5FLM G;  3C1E A;  2DY7 A;  1PYB A;  3HG9 A;  1JOK A;  1HR0 Q;  1H9S A;  3E0E A;  2VQE L;  1A3U A;  5EKK A;  3G7L A;  5COR A;  1SYG A;  3M4P A;  3TRE A;  2Z9H A;  1PH9 A;  1WOC A;  1L1O C;  1M4V A;  3TS0 A;  2EJF C;  1AEX A;  5A2Q L;  4K8I A;  4OEL B;  3HOY B;  4BA2 I;  5ISR A;  5LMN Q;  1X3Q A;  4C3H H;  2K5D A;  2EY6 A;  1MHW C;  1TWH H;  2D0P A;  2HUG A;  4A3D G;  3B6Y A;  3CCS A;  3GP7 A;  1CHP D;  4G7H C;  1SNO A;  4K0K Q;  1VQH A;  3RZO H;  1IW7 C;  1KC8 C;  4HSV A;  4QUC A;  1EZ6 A;  3AEV A;  4LF7 L;  3I4N B;  5LMN W;  3ICE A;  5GAE C;  2F0I A;  2MJ8 A;  3HKS A;  2OQ0 A;  4DV5 L;  2MGS A;  1Q90 A;  1X3P A;  4K6L A;  5E1F A;  5KRU A;  1UEA B;  1ILP A;  1RDP D;  1TWH B;  3T51 B;  1A0I A;  4UY8 C;  3D4W A;  1T5X D;  3CD6 A;  1ZKO A;  3S1N H;  3H6M A;  4R4Q A;  3NTI A;  2JA7 B;  1EIG A;  2JYO A;  1E24 A;  3CAM A;  4MHE A;  3NTK A;  2IL8 A;  1WCM H;  2E2H H;  3RZD B;  2HQE A;  4BWG B;  2LXJ A;  1X32 A;  1O7L A;  4LF8 Q;  3BU2 A;  3A5Z B;  3BVM A;  3GTK B;  1N33 Q;  3OSO A;  4DV2 Q;  5JEA G;  2IHF A;  3NE5 B;  4WFN 3;  3KFU A;  1Y1W G;  3H15 A;  3F2B A;  3GTJ H;  1EFI D;  1PA6 A;  4G7O C;  3A55 A;  3OW2 A;  1CQV A;  2B2T C;  2FXQ A;  2K5V A;  3GDE A;  4J8Q A;  3SR1 A;  3S2D B;  5JJK A;  2RVL A;  1H95 A;  2E76 C;  4GOP C;  3PO2 G;  3Q23 A;  1UE1 A;  2G9D A;  5I6Y A;  1Y1W B;  2LXK A;  1SBB B;  2K5H A;  3H0G H;  3WOF A;  4Y7N B;  4X3K A;  3LX0 A;  1HXY D;  3K59 A;  2CQA A;  1B9M A;  5EQ0 A;  2GVB A;  5IE8 A;  3LWE A;  2PW5 A;  5JAV A;  1EQT A;  1IZ6 A;  3RMH A;  4B3R Q;  3MWY W;  1G91 A;  1GUN A;  1JJC B;  4AYB E;  1PVO A;  1GM5 A;  1ICF B;  3LWU A;  3CCJ A;  5EPL A;  4CGY B;  2J4X A;  3J80 E;  3PO2 B;  1I6H H;  1O78 A;  2R61 A;  4YY3 L;  3F2C A;  4IPC A;  2F03 A;  4KKT A;  1KLU D;  2XIW A;  2EJG C;  5I6W A;  3N6R A;  4A4I A;  4IUQ A;  1Q3L A;  1Q86 C;  3SEB A;  3Q22 A;  2NVY B;  3BJU A;  1L0Y B;  1N8R C;  3J80 i;  5IOC A;  1SE4 A;  2QIL A;  3GTO B;  1QOH A;  2K4K A;  1VQL A;  4RH6 A;  1PRT B;  2JA5 G;  1Q81 C;  4R4O A;  3G48 A;  1OO9 B;  5M5X H;  3HZX A;  5CV9 A;  3ULL A;  1SRO A;  4A3M B;  4OWW B;  3NTH A;  5M3M B;  1WD0 A;  4CHT B;  2XRQ D;  3K81 C;  1W2B A;  4IN3 A;  4B3T L;  1FGU A;  1K0S A;  1Q7Y C;  2JEB I;  3TP5 A;  4HJ9 A;  4DR1 Q;  3I4N G;  1G51 A;  5LMU Q;  2XN9 C;  4NPS A;  1W3S A;  3WOE A;  3HOU G;  4ZUJ A;  2GVA A;  2A69 D;  2B3G A;  3TS2 A;  2QDB A;  1XMO Q;  1CUK A;  3SK6 A;  1TWG H;  1F77 A;  1G6Z A;  1N9W A;  1EIY B;  2ICE C;  5IT9 L;  4A3J G;  5CYU A;  4L5Q A;  3T56 B;  2X6L A;  2KEC A;  1BCP C;  3UDG A;  4QGU A;  1X3F A;  1R4Q B;  5FOB B;  1HNW Q;  1K3B C;  4GNX B;  2R93 H;  3GTL H;  3K6O A;  2K04 A;  1EY7 A;  4DV3 Q;  2VB2 X;  4IUN A;  1HNZ Q;  2DJG C;  3MXN A;  1XX8 A;  1CKN A;  4A93 H;  2WV6 D;  1G29 1;  3HOY H;  3IFT A;  3PCO B;  2EY2 A;  4H7B A;  4JOI C;  4A3L H;  1WVL A;  4XT1 B;  1QUQ A;  4DV2 L;  4IUP A;  5CV8 A;  3D4D A;  4Y52 H;  5BN3 A;  4CJ0 B;  5M3F B;  2ZTE A;  2WB1 G;  4OO1 H;  1WTX A;  2ZT9 C;  4LF5 Q;  1TY2 A;  1IKL A;  3S17 B;  4CJ2 C;  2YTV A;  2KCN A;  1TU2 B;  3K7A H;  1F2Y A;  5NUC A;  5HGT A;  4HTH A;  2SEB D;  3GTL B;  1JMC A;  3M85 A;  1F9P A;  4JI0 Q;  4RFB A;  1HTL D;  4AQY Q;  2JA5 H;  1ENC A;  4UP9 A;  4DR7 L;  3PO3 H;  2OTL A;  2IWH A;  4IFD G;  1OXT A;  5GAD C;  2OF1 A;  3HOY G;  2VZA A;  1UNS A;  4KY6 A;  5JEA J;  5C0X H;  1EYG A;  3RZD H;  1JOQ A;  1P16 A;  4FP5 D;  1GXD C;  1LT4 D;  1RKN A;  1SMX A;  4TKO B;  4LFC Q;  1B3Q A;  4RWS C;  3HOV G;  3NBH B;  1CI3 M;  1G8Z D;  2D62 A;  4DPG A;  3A7A B;  4FO2 A;  1VQN A;  3TBI B;  2R93 G;  1TVX A;  3HRZ C;  2EXD A;  4A3G G;  4JBM A;  4OHJ A;  1C0A A;  2PI2 A;  4PZ6 A;  3PO3 B;  4LNQ A;  4M1U B;  2E2J H;  1L1O A;  1HFN A;  2VQF L;  3HOZ G;  3TRZ A;  3E9H A;  4A3C H;  1B2T A;  1Z47 A;  2IX0 A;  1AZQ A;  4B08 A;  1SYE A;  4MIU A;  4P73 A;  5ELE A;  1GJX A;  2NTT A;  3KF6 A;  1VQO A;  4OX9 Q;  4DXF A;  1PH3 A;  4H13 C;  4ABN A;  3OIQ A;  4JI6 Q;  3BG3 A;  4BY7 G;  4GZY C;  3S1R B;  1PH7 A;  1B9N A;  4YWK A;  4B3S Q;  4KN7 C;  2I5M X;  2B29 A;  3NK9 A;  2R7Z G;  4IPD A;  2L4N A;  2PO4 A;  1WYD A;  5ELD A;  3I56 A;  1OXS C;  2ZJP A;  1BBU A;  1TWA H;  1XMQ L;  4JYA Q;  1UEB A;  3J7Y W;  3HKZ B;  5K5P A;  4Z9C B;  5G3L F;  4RA8 A;  3HEJ A;  4CBV A;  3SE0 A;  4X64 L;  5IT9 E;  3RNU A;  3IAY A;  4JI8 Q;  4GNX A;  1VCI A;  4LF6 L;  5K36 G;  1HJP A;  2A69 C;  1HHV A;  1WFQ A;  4OEM B;  3SK5 A;  2B2W C;  1EOT A;  3HOW G;  5FO9 B;  1RL2 A;  3MXG A;  3UDI A;  2NVY H;  1M8A A;  1N36 Q;  3RLO A;  5G3L D;  2BA0 A;  5CV5 A;  2HCI A;  2OQK A;  1F9S A;  4HJ8 A;  3W1B A;  2E2I B;  3C1F A;  2B2Y C;  1BBW A;  3HOX G;  4V19 0;  5FJ8 H;  5IYC G;  2N8N A;  3TP8 A;  4XYQ A;  1MD2 D;  2F0E A;  4JI2 Q;  2EIF A;  4LF4 Q;  3H3V C;  1ZYR C;  3JAM E;  3MFY A;  2LS0 1;  2JK8 A;  3LGJ A;  1B4O A;  5ELF A;  3VR5 A;  2EYH A;  2G5D A;  4ULL A;  3HOU H;  1YHB A;  1E2Z A;  2I5L X;  4NKL A;  3T1Y L;  3S14 B;  4KLK A;  1PHJ A;  2BDO A;  5J22 A;  4LUO A;  3I3C A;  1STG A;  4IPG A;  4P2C B;  1GUW A;  1HZ9 A;  1TWG B;  2F4I A;  3C3L A;  4GKK L;  2KOL A;  4BBR B;  2QEJ C;  2E2I H;  3S1Q B;  2Q8I B;  1D5Z C;  3M7N A;  1SEB D;  1YIT A;  1TS3 A;  2PZT A;  1CKM A;  4HCE A;  5IP9 G;  1SE8 A;  4OL7 A;  1WD1 A;  2SDF A;  2B63 B;  1X3G A;  2IHE A;  2JA6 G;  1PXU A;  3J7Z C;  3ERQ A;  1S5F D;  4EVO A;  1JWS D;  4XDX A;  1M90 C;  3J81 c;  2QCP X;  1STN A;  3KF8 B;  3PO3 G;  1LO5 D;  2PMZ B;  4IFD H;  4JI2 L;  2R7F A;  4FF2 A;  4JI5 Q;  1EYD A;  1R9T H;  4C3J H;  5A35 A;  3KBX A;  3ND9 A;  1JJG A;  1QZG A;  1XNQ L;  4I7Z C;  1PRT D;  1EIH A;  2F4V Q;  3CPW A;  2QEX A;  3FRP B;  2UXB Q;  5KEE A;  2CVR A;  1ENA A;  2MFI A;  1PZI D;  1BVS A;  1CK1 A;  2AMC B;  4DAY B;  2R92 B;  3L3O C;  2KBN A;  2UUB Q;  3HOZ H;  2F3W A;  1R9T B;  1HR0 W;  3EN2 A;  3TSS A;  3S9W A;  2JA8 G;  1IYV A;  1YIJ A;  4EX5 A;  4OIJ A;  4XQQ A;  1IYU A;  4FVM A;  4JI4 Q;  1IBK L;  2DY8 A;  1WTO A;  4JI5 L;  3F2D A;  4TVA B;  1X65 A;  2D9U A;  5C3E G;  1QE6 A;  4HAE A;  1E3P A;  2O5J C;  1VQC A;  1Y1V H;  2L9H A;  5EGT A;  1CZG A;  4L6T B;  2JA6 H;  1HFG A;  2WIN B;  3S17 H;  2Z6B A;  4CKC A;  1PYW D;  2KQ3 A;  3R8B A;  3U9O A;  4NP5 A;  4A3K G;  3CF5 A;  4F8M A;  2D5D A;  1DON A;  2JA8 B;  3P7J A;  4L63 B;  3BVZ A;  3KYH C;  2QKI C;  1LTT D;  2VUM B;  3V96 A;  1C8C A;  1IL8 A;  5FO8 B;  1WTW A;  1E1T A;  4NXM L;  3L2P A;  3GO5 A;  3E5S A;  4C3H B;  3RR5 A;  2AQ3 B;  4LW1 A;  2GA4 B;  3SDZ A;  4DV3 L;  2NB0 A;  3J81 L;  1NCV A;  5C5M A;  4A3K B;  3OW7 A;  4WJ4 A;  1PFN A;  1IBK Q;  3I4N H;  1SLJ A;  4K2L A;  4V0B A;  1BR9 A;  1P8L A;  4QIW B;  1TWF B;  3PUX A;  4A3I B;  4R4T A;  3C46 A;  4A3C G;  5DM7 3;  4YHH L;  3I91 A;  5C4H A;  4LF4 L;  4ZKC B;  3FHW A;  1UE5 A;  1J5E Q;  3DWQ A;  4PV1 C;  3BZK A;  3OWF A;  2VY3 A;  4OWT B;  3QOJ A;  5EKI A;  3U58 A;  4DK0 A;  2EDG A;  3TP6 A;  1Y1V B;  2NZH A;  3KLR A;  1KDA A;  3FP9 A;  1EWC A;  4DR4 L;  4MN3 A;  1JWM D;  1F9R A;  3DM1 A;  4NXN L;  2F0T A;  2HCC A;  1CA5 A;  3RN2 A;  3MA2 B;  2F0Q A;  2K6A A;  1FNV A;  4ZLT F;  3VA5 A;  4BY7 B;  3CU7 A;  3PUZ A;  4POF A;  1AW7 A;  2WKD A;  3R93 A;  1IBM Q;  4LK1 C;  3CCV A;  3CQZ B;  1ML0 D;  3TDQ A;  3OOC A;  1PTO D;  2EYL A;  1PZJ D;  1S4Z A;  2I46 A;  1EY0 A;  1PH5 A;  1PTO C;  5DLQ E;  3BZC A;  3E6Z X;  4X6A H;  3A8K E;  4K14 A;  2NTS A;  3H94 A;  3BDO A;  3HFZ B;  3PO2 H;  2WAC A;  1I6H B;  2NVT H;  3D6W A;  3MXU A;  1L0X B;  4BA1 I;  4NDX A;  4DR2 Q;  2KCC A;  2Z6K C;  3VYS A;  4ZYS A;  1BQQ T;  3L0O A;  2CFM A;  3BDC A;  1U4L A;  1ASZ A;  1Y8O B;  3CCR A;  4OXP A;  5IY0 A;  2H5X A;  4XYO A;  5FJ8 G;  1A6X A;  4BBR H;  1Y1W H;  3A8J E;  1XYI A;  1VF7 A;  2E2J B;  3A5U A;  5C44 B;  4O2D A;  1LV9 A;  2DNE A;  4DA2 A;  5T1G A;  2V1C C;  2L0C A;  1STE A;  4LAA A;  4C2M H;  1KD1 C;  1E7Z A;  1S5D D;  1K0R A;  4DV1 L;  3OWE B;  2AQ1 B;  4C1N K;  3U50 C;  3NHH A;  2XTI A;  3PIP 3;  1B8A A;  4BY1 G;  1XMO L;  1FD7 D;  5IP7 H;  1VQM A;  5KYI A;  3HS0 C;  1Q82 C;  2CW0 D;  3H3V H;  5M9O A;  2BE5 C;  2NWG A;  4DAP A;  1SAP A;  1G2T A;  3FKI G;  2BE5 D;  1KAA A;  3ER0 A;  1A2T A;  5T1I A;  4RAU C;  3T1H L;  4P72 A;  3KDF A;  5CV4 A;  3CCE A;  3D0F A;  2Z1C A;  3M4O B;  2LFN A;  3NUC A;  2B2T A;  1VS0 A;  5IGG A;  2Q2U A;  2K01 A;  2OT2 A;  2XWB B;  2K32 A;  1KRT A;  1EYA A;  1H9S B;  2MPM A;  3X3M A;  4LF8 L;  4JCV E;  2AUK A;  2X6G A;  3FEW X;  1B44 D;  1QVC A;  4DR3 Q;  2AKW B;  1FGB D;  2D2C C;  2I07 B;  1IXR A;  5LHY 1;  3I55 A;  4POG A;  3TP7 A;  4A93 G;  4C3I G;  4N9T A;  1KDB A;  1YNN C;  1M1K C;  3OMC A;  2F0P A;  5J1Z A;  1U4P A;  1Z6H A;  3E3X A;  2EQS A;  5D65 A;  3J81 j;  1D8L A;  3URY A;  2PPB C;  3J81 E;  4RGT A;  5GAH C;  3NXW A;  1WCM B;  2IPK D;  4ID6 A;  1TII D;  4DXG A;  1LAC A;  2WP8 J;  1NY4 A;  1RF2 D;  1ZXT A;  4DV6 L;  1UE7 A;  4OGQ C;  2EY1 A;  2UUB L;  4AH6 A;  5KYL A;  1U0L A;  1K83 H;  2A8V A;  1ROD A;  3KDF B;  3HOZ B;  1HTP A;  5C4Z A;  1G2S A;  1TQO A;  1W6J A;  4KJN A;  4ME5 A;  1HA5 A;  4IPH A;  1PTO H;  1Q46 A;  1AN8 A;  1D1I A;  3VYR A;  1VQ5 A;  4K8J A;  2DUD A;  5HGQ A;  1EOV A;  3D6C A;  1Q1B A;  3K7A B;  1MIU A;  1D7Q A;  1Y8N B;  4DNI A;  5FLX E;  1JCK B;  1C7Y A;  1LT6 D;  1WTV A;  2E5L Q;  1N32 Q;  1NMF A; 
#chains in the Genus database with same CATH homology
 4A3G G;  3OTO L;  4RMF A;  4JBM A;  2UUC Q;  2HT1 A;  3PUV A;  1C0A A;  1E22 A;  2PI2 A;  4PZ6 A;  1VQF A;  4B3S L;  3GTG H;  4LNQ A;  4GKK Q;  2E2J H;  4BBS G;  5GQO A;  1L1O A;  1HZB A;  2JQO A;  3ZJY C;  1QZH A;  2CQO A;  3PF4 A;  3W5O A;  3J7A 5;  2VQF L;  4LUV A;  3HOZ G;  3E9H A;  3TRZ A;  5C0X G;  4A3C H;  4OO1 I;  1Z47 A;  2IX0 A;  3K80 C;  1TXY A;  4P73 A;  4DV4 Q;  4UPA A;  4LFC L;  3I4M H;  3KF6 A;  1HNZ L;  2LSS A;  1VQO A;  3CC7 A;  4OX9 Q;  4JOI A;  1YNX A;  1IBL L;  1PH3 A;  3PV0 A;  1HZC A;  4DR4 Q;  4DR6 Q;  3S16 H;  1JT8 A;  2UXD L;  4JI6 Q;  3HKZ G;  2ZJQ A;  4BY7 G;  1MKH A;  1QVF A;  4OWX B;  3S1M H;  1CKN B;  4GN5 A;  1PH7 A;  4YWK A;  4KHZ A;  3S1R H;  1VQP A;  1KRS A;  4NB3 A;  4DV7 Q;  4B3S Q;  1JB7 A;  3H3V I;  2I5M X;  3GTQ H;  2Y0S E;  4JI8 L;  1ASY A;  2QGQ A;  4YCU A;  2B29 A;  1K8A C;  2R7Z G;  5GRO A;  4JI1 Q;  4IPD A;  2JA7 G;  3G4S A;  4A3F G;  4YY3 Q;  2K5N A;  4OON A;  1WYD A;  2OTJ A;  3I56 A;  4BY7 H;  1OXS C;  1EWI A;  3CPF A;  2RHQ B;  2ZJP A;  1BBU A;  1Q12 A;  1TWA H;  1Y1V G;  2N49 A;  2EXD A;  2DGY A;  5J3B A;  2JA9 A;  5LMN L;  4HJ5 A;  1JJ2 A;  2K14 A;  2BH2 A;  4JYA Q;  1UEB A;  2R7D A;  1AE2 A;  1MJC A;  4R4C A;  1EQQ A;  3K0X A;  4JC0 A;  2Q2I A;  3MEF A;  4X64 L;  5C44 H;  3RNU A;  4JI8 Q;  4GNX A;  1VCI A;  4DR7 Q;  2WB1 E;  4X66 Q;  1HNX L;  4LF6 L;  1UE6 A;  5K36 G;  2IT1 A;  1HJP A;  1YBY A;  1OXX K;  1WFQ A;  5IP7 G;  4A3I G;  2R6G A;  3AYH B;  5LMU L;  1Q8K A;  3HOW G;  2YTX A;  2IY5 B;  4A3F H;  1CSQ A;  4QY7 A;  1RL2 A;  3UDI A;  4IOC A;  3OTO Q;  2NVY H;  1N36 Q;  3RLO A;  1FJG L;  1EQR A;  2NVQ H;  1YVC A;  2BA0 A;  4MNO A;  3ULP A;  3KOJ A;  1VQ6 A;  3U4V A;  4IJH A;  2Q2T A;  4A76 A;  2OQK A;  3I4M G;  3AFQ A;  4A3J H;  1TWF H;  1NE3 A;  5M3M G;  4HJ8 A;  1N34 Q;  3S15 H;  3W1B A;  4MTN A;  2CWP A;  4J15 A;  3J80 c;  4GS3 A;  1XNR L;  1BBW A;  1Y14 B;  3I7F A;  1Q1E A;  4O0A A;  3HOX G;  4JYA L;  5FJ8 H;  1YZ6 A;  5IYD H;  5IYC G;  4B3R L;  2N8N A;  2PI2 E;  4JV5 L;  4JI2 Q;  3T1H Q;  5IT9 c;  1E1O A;  2VUM H;  2EIF A;  4A3M H;  4QL5 A;  3F1Z A;  4LF4 Q;  4JV5 Q;  2NZO A;  1V43 A;  1KIX A;  4PG3 A;  1J5E L;  2JK8 A;  4AYB G;  1K8G A;  3JAM c;  3KLW A;  4DV7 L;  4LFA Q;  1PH4 A;  3LGJ A;  1X6O A;  2D0O A;  1T9H A;  3KJO A;  2KCT A;  3HOU H;  4DK3 C;  1OXV A;  1YHB A;  4JI3 L;  2K50 A;  3T1Y Q;  4JBW A;  4JBJ A;  1XNR Q;  2MO1 A;  2I5L X;  2Z6K A;  2WAQ E;  3GTP H;  3T1Y L;  3S24 A;  1FL0 A;  4GLA C;  2ZM6 Q;  3NEN A;  1VQ8 A;  2ZTD A;  3K8A A;  1I94 L;  4KLK A;  2ASB A;  1YEZ A;  4ALP A;  1PHJ A;  1HNW L;  5IYC H;  4LUO A;  4P71 A;  2MNA A;  1K73 C;  4IPG A;  2ATW A;  1HZ9 A;  4GKK L;  3GTK H;  4B3M L;  2HHH Q;  2E2I H;  2NVX H;  3GTO H;  3M7N A;  5IYB G;  3PUW A;  1YIT A;  1CKM A;  5JJI A;  1V1Q A;  5C4X H;  5IP9 G;  2UUA Q;  2F4V L;  1SE8 A;  4IJL A;  5C0X J;  4OX9 L;  2B63 H;  1KL9 A;  2WFW A;  1X3G A;  2C35 B;  3TEH B;  1I94 Q;  1Z9F A;  2IHE A;  3PSI A;  4JBK A;  2JA6 G;  3G6E A;  5M5Y H;  3J7Z C;  2JE6 I;  3S2H H;  4RG1 A;  4JI7 L;  3M4Q A;  1X56 A;  5IWA L;  3EIV A;  5C44 G;  1XMQ Q;  2UXC Q;  2HHH L;  1X54 A;  3CCU A;  2N78 A;  1PV4 A;  4GOP A;  2HQL A;  3STB C;  3CCL A;  1I5F A;  4LFA L;  3RN5 A;  1M90 C;  3J81 c;  1GVP A;  1BKB A;  3KF8 B;  1QVG A;  1X3E A;  4LWC A;  1S72 A;  2E5L L;  3S14 H;  3PO3 G;  1I50 H;  1FVI A;  3HOX H;  4DV6 Q;  4JI2 L;  1VQB A;  2R7F A;  2JJQ A;  2NN6 G;  4JI5 Q;  1R9T H;  3RLF A;  1S40 A;  4YWM A;  4C3J H;  3KF6 B;  4YCW A;  1VQK A;  1LUZ A;  1OTC A;  3F8T A;  4PMW A;  4IFD I;  3NEL A;  1JJG A;  4HIK A;  3W1G A;  1QZG A;  1XNQ L;  4FDB A;  4QIW E;  2VW9 A;  3DLL A;  4LF9 Q;  1L1O B;  2F4V Q;  5JJL A;  3CPW A;  2QEX A;  3CXC A;  2ES2 A;  4L5R C;  4BXX H;  3JAM i;  5FLM G;  4BXX G;  2A19 A;  2UXB Q;  1LYL A;  3AFP A;  3AQQ A;  1PYB A;  2NN6 I;  3EBE A;  1VQD A;  2MFI A;  1HR0 Q;  1BVS A;  3E0E A;  1EIF A;  2VQE L;  2AMC B;  3SGI A;  3ULJ A;  4DAY B;  3TRE A;  3M4P A;  1K9M C;  5M3F G;  4L5S A;  1PH9 A;  3CMA A;  2KBN A;  2UUB Q;  1WOC A;  3HOZ H;  1L1O C;  4GLV B;  3A0J A;  1KHI A;  1HR0 W;  3EN2 A;  3WWV A;  5ELO A;  2PMZ E;  3TS0 A;  1XPU A;  2JA8 G;  1YIJ A;  4EX5 A;  1PH1 A;  2RHS B;  2KCM A;  4JI4 Q;  1IBK L;  4BA2 I;  1GO3 E;  5LMN Q;  4JI5 L;  4P75 A;  4TVA B;  2D0P A;  1TWH H;  4C3H H;  3F2D A;  1IBM L;  1X65 A;  3CC4 A;  4A3D G;  3B6Y A;  3CCS A;  4DV0 Q;  2GN5 A;  5C3E G;  1EFW A;  1E3P A;  2RCN A;  3Q8D A;  4K0K Q;  1VQC A;  1Y1V H;  1VQH A;  2XGT A;  3ERS X;  3HOW H;  3RZO H;  3A74 A;  2JA6 H;  5M3M H;  1KC8 C;  2UUC L;  4X64 Q;  4DR5 L;  1SRU A;  3AEV A;  4LF7 L;  3UDX A;  2R92 H;  3KJP A;  5LMN W;  1XPO A;  1PH6 A;  1O7I A;  1HNX Q;  3ICE A;  3S17 H;  5GAE C;  1N32 L;  4LF9 L;  3HKS A;  2A1A A;  4LFB Q;  2OQ0 A;  4DV5 L;  2KHJ A;  4A3K G;  1MJE A;  3CF5 A;  2ZM6 L;  4A3M G;  1N34 L;  4DV5 Q;  1VQE A;  3J81 i;  4DV4 L;  2Q2H A;  2I5H A;  3KYH C;  1LM0 A;  1OXU A;  1A0I A;  4UY8 C;  4ME3 A;  3CP0 A;  3CD6 A;  3S1N H;  4UP7 A;  2OWO A;  4A3G H;  2MQH A;  1E1T A;  5C0X I;  3UE1 A;  4NXM L;  3L2P A;  3GO5 A;  4R4Q A;  3GD7 A;  4HIM A;  5FLX c;  2PNH A;  3DM3 A;  1E24 A;  1YHA A;  3CAM A;  4LW1 A;  3RR5 A;  3MXN B;  4YHH Q;  2JA7 H;  1HR0 L;  4IFD J;  4X65 Q;  1WCM H;  2E2H H;  3STB D;  4DV3 L;  4A3K H;  2LXJ A;  4WJ4 A;  1TWC H;  1K3R A;  4LF8 Q;  1IBK Q;  3I4N H;  1SLJ A;  3OYY A;  5H1S E;  4XIG S;  1XMQ L;  4LFB L;  1P8L A;  3BU2 A;  3A5Z B;  3VDY A;  4OO1 G;  1N33 Q;  3PUX A;  4L5T A;  5AJ3 Q;  4DV2 Q;  5JEA G;  2IHF A;  1B7Y B;  4R4T A;  3KFU A;  3CW2 C;  4A3C G;  1Y1W G;  2JA8 H;  4YHH L;  4APV A;  4LF4 L;  2UU9 L;  3H15 A;  1J6Q A;  1VQI A;  3FHW A;  3GTJ H;  1UE5 A;  3F2B A;  4DR2 L;  3K7U C;  1YI2 A;  1PA6 A;  1J5E Q;  4XTC S;  4B3T Q;  3BZK A;  3PGZ A;  2VY3 A;  4OWT B;  3JC6 6;  1SFO H;  3OW2 A;  2UXD Q;  2FXQ A;  3GDE A;  2K5V A;  5GAG C;  3U58 A;  5JJK A;  4R1J A;  2NZH A;  2YV5 A;  1PYS B;  4HJA A;  2IX1 A;  1H95 A;  1VQ9 A;  3FP9 A;  2UXB L;  4DR4 L;  4NXN L;  4GKJ Q;  4GOP C;  3PO2 G;  2YU9 H;  2MO0 A;  4IOA A;  2AHO B;  1UE1 A;  4PZ7 A;  5IP9 H;  3RN2 A;  5C4X G;  2VQF Q;  4IO9 A;  4X65 L;  3TQY A;  2LXK A;  4LF7 Q;  2K5H A;  3H0G H;  4KHP L;  1NMG A;  3PUZ A;  4GN4 B;  2I0Q A;  4POF A;  1YJW A;  3CQZ H;  2GVB A;  1IBM Q;  5IE8 A;  3CCV A;  1PH8 A;  1IZ6 A;  4BBS H;  4B3R Q;  3L7Z C;  3S1Q H;  3PIP A;  1PH5 A;  5HY6 A;  2VL6 A;  1JJC B;  4NXN Q;  4GKJ L;  4AYB E;  1PVO A;  4TQU S;  5DLQ E;  1GM5 A;  3BZC A;  4X6A H;  1IL2 A;  3CCJ A;  2R7Z H;  3HFZ B;  3PO2 H;  1U5K A;  4H02 A;  5M5W H;  4QJF A;  2NVT H;  1I6H H;  5E7N A;  4YY3 L;  2CCZ A;  3F2C A;  4IPC A;  1N36 L;  4R4I A;  2QA4 A;  4BA1 I;  4DR5 Q;  1XPR A;  4HIO A;  4A3B G;  2F3I A;  4A4I A;  4DR2 Q;  2CKZ B;  2Z6K C;  4X62 L;  1Q86 C;  2Y0S G;  3L0O A;  3BJU A;  2CFM A;  1N8R C;  1HH2 P;  4X62 Q;  1ASZ A;  4AQY L;  3J80 i;  3CCR A;  4OXP A;  5IY0 A;  2H5X A;  4DV0 L;  1A63 A;  5C3E H;  2K4K A;  5FJ8 G;  1VQL A;  2AWN A;  4BBR H;  4DR6 L;  1Y1W H;  2B63 G;  2ZJR A;  2K75 A;  2ID0 A;  4JG2 A;  2JA5 G;  4YCV A;  1Q81 C;  1XNQ Q;  2VUM G;  4R4O A;  1AH9 A;  3G48 A;  2RF4 A;  3A5U A;  5M5X H;  1XJV A;  4O2D A;  5IYB H;  4KI0 A;  4EQ5 A;  3ULL A;  1SRO A;  2N3S A;  4OWW B;  1V9P A;  5BR8 Q;  1G6P A;  2V1C C;  1X9N A;  4AIM A;  4BY1 H;  3K81 C;  4C2M H;  1W2B A;  1E7Z A;  1KD1 C;  4LUZ A;  2VQE Q;  4B3T L;  4KHP Q;  1FGU A;  3RLN A;  1I3Q H;  1K0R A;  1Q7Y C;  4LF6 Q;  1GKH A;  4DKA C;  2JEB I;  4HJ9 A;  3I4N G;  4DV1 L;  4DR1 Q;  1G51 A;  5ELN A;  5LMU Q;  1VQJ A;  4JI0 L;  1UWV A;  2CWA A;  4NPS A;  1L0W A;  3CC2 A;  2UXC L;  3U50 C;  5AJ3 L;  1W3S A;  1B70 B;  4DR3 L;  2XTI A;  3HOU G;  1B8A A;  4BY1 G;  1XTD A;  1XMO L;  5IP7 H;  4A75 A;  1VQM A;  2GVA A;  4GN3 B;  3U4Z A;  1A8V A;  1YJN A;  1Q82 C;  4P74 A;  2B3G A;  1CKO A;  3TS2 A;  1XMO Q;  2VNU D;  1L2F A;  1RIP A;  4GNX C;  1CUK A;  3H3V H;  4GOP B;  1KQS A;  1KAW A;  1TWG H;  1KXL A;  1SR3 A;  4C3I H;  1N9W A;  1EIY B;  3UE0 A;  3FKI G;  2ALY B;  5C4J H;  3ER0 A;  1NTG A;  1VQG A;  3M3Y H;  3H0G G;  4A3B H;  4HJ7 A;  4A3J G;  4L5Q A;  3T1H L;  4P72 A;  3PIO A;  3KDF A;  3CCE A;  3D0F A;  4DK6 C;  3M4O H;  1WI5 A;  4QQB X;  4DUY L;  3UDG A;  5M3F H;  4WJ3 M;  4QGU A;  1VS0 A;  1X3F A;  4JI6 L;  1WCM G;  2Q2U A;  4JI7 Q;  1HNW Q;  4K0K L;  2L15 A;  4GNX B;  1VQ4 A;  2R93 H;  5BR8 L;  5IWA Q;  1KRT A;  3GTL H;  1S3O A;  4LF8 L;  4JCV E;  4A3I H;  1A62 A;  2HIX A;  4JI4 L;  4DV3 Q;  1QVC A;  2PQA B;  1EUJ A;  2AKW B;  3I4O A;  4DR3 Q;  4A3E H;  1HNZ Q;  2HIV A;  1IXR A;  3I55 A;  1CKN A;  2Z0S A;  1NJI C;  4POG A;  3CME A;  4A93 H;  4A93 G;  3D31 A;  1JE5 A;  1G29 1;  4BBR G;  2BH8 A;  2UUA L;  3HOY H;  3PCO B;  1FJG Q;  3CCM A;  1GD7 A;  2UU9 Q;  2JEA I;  4JOI C;  1M1K C;  4A3L G;  4A3L H;  1CSP A;  4GLX A;  4DV1 Q;  4DR1 L;  1QUQ A;  3M9B A;  1QUQ B;  1NBW A;  3PUY A;  4X66 L;  4DV2 L;  1YJ9 A;  4B3M Q;  2EQS A;  3I2Z A;  1IYJ B;  5EAY A;  3J81 j;  1D8L A;  3G71 A;  4A3E G;  2ZTE A;  2R92 G;  2WB1 G;  4Y52 H;  1IBL Q;  4PZ8 A;  4LF5 Q;  3HKZ E;  2BA1 A;  5GAH C;  1DGS A;  1LTL A;  4UP8 A;  2KEN A;  2YTV A;  2PQA A;  1X55 A;  2VS1 A;  2WP8 J;  3PF5 A;  2YTY A;  3K7A H;  1VQ7 A;  4A3D H;  1NY4 A;  3HOV H;  2OCE A;  4Y7N H;  4DV6 L;  1UE7 A;  4DUY Q;  1AE3 A;  2UUB L;  4JI1 L;  4DAM A;  4AH6 A;  1VQA A;  3FKI H;  1JMC A;  1U0L A;  3CCQ A;  3M85 A;  4JI0 Q;  1K83 H;  4AQY Q;  2YYZ A;  2ZTC A;  4DUZ L;  4UP9 A;  3UDF A;  1YHQ A;  2JA5 H;  2A8V A;  4DR7 L;  1PFS A;  4NXM Q;  3KDF B;  4YWL A;  2F52 A;  3S2D H;  3PO3 H;  1C9O A;  4DUZ Q;  3GTM H;  2OTL A;  1N33 L;  4IFD G;  4IPH A;  1Q46 A;  2KHI A;  1HZA A;  1OXT A;  5IYD G;  1WJJ A;  5GAD C;  1SN8 A;  3HOY G;  1VQ5 A;  2VZA A;  5JEA J;  1EYG A;  2DUD A;  1PH2 A;  5HGQ A;  3E9I A;  3RZD H;  1EOV A;  1P16 A;  2K52 A;  1Q1B A;  4HID A;  3IRB A;  4MZ9 A;  1MIU A;  2E8G A;  4JI3 Q;  4DNI A;  1SMX A;  4LF5 L;  4LFC Q;  3HOV G;  1D7Q A;  3NBH B;  1C7Y A;  3NEM A;  5FLM H;  2E5L Q;  2D62 A;  4DPG A;  2AWO A;  1VQN A;  1N32 Q;  2R93 G;  1NMF A;  2WAQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...