4A3MH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mH00
1E1OA 1MKHA 4DV4L 4UP8A 4LF5L 2UXBL 4NXMQ 3PO2H 2JE6I 4KLKA 2YYZA 4IOAA 1QUQB 1IYJB 3I4MG 2OTLA 3HOWG 2RHQB 1D8LA 3ERSX 3GTGH 3I4NG 4BY7G 4JYAL 1PH4A 3PUYA 5K36G 3KDFA 2NVTH 4X66Q 4LF8Q 4A3KH 4DR5Q 5JEAG 4X64L 1UE1A 1IBKQ 4X62Q 1Q81C 3JAMc 1PV4A 3PCOB 1XNQL 4GKJQ 2B63G 2MO0A 4A3BG 2JA7G 3KYHC 3CC7A 1L0WA 3TS0A 4BXXH 2JA8G 1BVSA 1YNXA 4IOCA 2UU9L 2QGQA 2WAQE 1K3RA 3I55A 2NVQH 4QY7A 1QZGA 2VUMG 4DV6L 1HZBA 1OXUA 2C35B 5IYDH 4R1JA 4YHHL 5FLXc 1I6HH 4DR7L 1BBWA 1AH9A 4A76A 5JEAJ 1K9MC 5C44G 2JA6G 3RLFA 2ZM6L 3HOZH 4MTNA 5HGQA 5C4JH 4BBRG 1VQCA 5BR8Q 3CCUA 1TWHH 2NN6I 3CAMA 2XGTA 4LFCL 1G51A 1OXVA 1VQPA 2OWOA 4BBSH 1EYGA 4LF5Q 4IJLA 3GTQH 3KF6A 4EX5A 4IFDG 3BU2A 4YY3Q 2BH8A 1WJJA 4OONA 1K8GA 1VQNA 1N32L 4HIMA 1GKHA 1SN8A 1K8AC 2IHEA 1M1KC 2EQSA 3K81C 2KCTA 4LUVA 3UDIA 3CPWA 3FP9A 3HOYG 3F1ZA 1PVOA 2F52A 4P75A 1PH3A 1E7ZA 4NXNL 1HZAA 2CWPA 4GNXA 1HNXL 1YBYA 1BBUA 3HOUH 4JI1L 1KL9A 5IYBH 4MNOA 2JJQA 1VQGA 1EQQA 1OTCA 1A0IA 4LFAL 3U4ZA 1NMGA 4A93H 5IY0A 1LUZA 1JMCA 1VQMA 1Q12A 3S15H 2UUCL 3DLLA 3K80C 1I94Q 1OXXK 1XPRA 1PH7A 4IFDJ 2CCZA 2IY5B 4XIGS 4LFBQ 4WJ3M 4DV2L 4A3FH 1PH2A 1N36L 1OXTA 3AQQA 4DK6C 3K0XA 4AIMA 1QUQA 3FKIG 4YWKA 3KJPA 2IX0A 4A3GH 4GOPB 1HH2P 3L7ZC 3W1BA 3H0GG 5JJIA 5C0XG 4HIOA 1Q7YC 1HNWL 3HOVG 3I2ZA 3KDFB 1PFSA 2QA4A 4HJ9A 1EFWA 3GTOH 1UWVA 3CCQA 3KLWA 5GAGC 4H02A 4A3JG 2UXCL 3CPFA 4IFDI 3HKSA 4R4TA 2R93G 3GTKH 3RLNA 2Z6KA 4DV7L 1Y1WH 2BH2A 1W2BA 2ATWA 2E2IH 4GLVB 3A0JA 3STBC 1JT8A 5FLMG 4OWTB 3CCVA 1B7YB 1UE6A 4IPDA 4A3EH 1HNZL 4DR6L 4NXNQ 2N8NA 3L0OA 5LMNL 1HJPA 1NE3A 1E1TA 1G291 4OX9Q 3UDXA 3CC2A 4JI1Q 1YI2A 1LM0A 1UE5A 1YJNA 3W1GA 4LF6Q 2VW9A 4A3IH 2CWAA 1YHAA 3TREA 5ELOA 4DR1L 4MZ9A 1PH9A 3CC4A 1P16A 2NVYH 3CD6A 3ULJA 5C3EG 2AWOA 3RZOH 3UDFA 4A3MG 4AQYL 1WYDA 1VQEA 1L1OC 4B3MQ 3G6EA 4K0KQ 4LWCA 2WB1G 2AKWB 4J15A 3H15A 1EIYB 2VS1A 4FDBA 3KF6B 3PUVA 3J80i 1VQOA 1KQSA 5C0XI 4JCVE 2R6GA 4LF4Q 1CKOA 4DAYB 3RN5A 5C4XG 1M90C 2WP8J 1EUJA 1S3OA 1VQFA 1TWFH 2K75A 4JI5Q 1U5KA 4DR4L 3E9IA 1FVIA 4GNXB 1PH5A 2UUBQ 4JI2L 3NENA 2OQ0A 4KHPL 4LF7Q 4JG2A 3PUXA 4L5TA 4EQ5A 1J5EL 2JA5G 5JJLA 3M4PA 2KBNA 3S16H 4ME3A 4DR2Q 4LUOA 3HOXH 3E9HA 4DUYL 3J7A5 4Y52H 2VQFL 1EOVA 5GADC 1V43A 1V1QA 3LGJA 1XPUA 2Z6KC 4HJ5A 5LMNQ 1CSQA 2A1AA 4IPGA 2CQOA 3RNUA 2K14A 3I4MH 4DUZL 4BY7H 1EWIA 3CMAA 1YJ9A 1P8LA 1KD1C 4KHZA 4GOPA 3G4SA 5DLQE 4B3RQ 4A3DG 1SLJA 2HHHL 3UDGA 1WCMG 2JEAI 1QZHA 4OWWB 1O7IA 1TXYA 4AQYQ 2QEXA 1SE8A 3AYHB 1K73C 3FHWA 2PNHA 2NZHA 2JA7H 1ASYA 5IP9H 1QVGA 4JV5L 4JI8L 1VQ8A 1YHQA 3OTOL 3HKZE 4PZ8A 5AJ3L 5JJKA 3M4QA 1VQBA 4DNIA 2PMZE 3CF5A 4L5RC 4OXPA 3ULLA 3GTJH 2F4VL 4A3CH 1PH1A 2VUMH 3M85A 4UPAA 3CP0A 3G71A 3K7UC 3CMEA 4JI6L 2JA6H 2A19A 2B29A 3PO2G 1T9HA 3KJOA 4LUZA 1XJVA 5GROA 2ASBA 3BJUA 1QVFA 2VQEL 2N49A 1HR0Q 2AHOB 4QGUA 1VQ5A 2MFIA 4RG1A 4DV3L 4IPHA 1N8RC 3TEHB 4DV1L 3JC66 4GKKQ 3PUWA 2NZOA 4BY1H 2LXJA 3GD7A 3F2CA 2CFMA 2R7ZG 1V9PA 2K5HA 3K7AH 1VQJA 3GDEA 4DV4Q 4HIKA 3ULPA 2MO1A 2UXBQ 3PO3H 2PQAB 1N33L 3H3VH 4UP7A 2R92H 3AFPA 3EBEA 3HOYH 1X3GA 4JYAQ 1A62A 4YCWA 4GOPC 4DV0L 1W3SA 3BZKA 1C0AA 1C7YA 3F8TA 3S1RH 4JOIA 2ES2A 2K5NA 4X64Q 5IYDG 1GO3E 1XNQQ 1VQ6A 1VQIA 3HOZG 1FJGL 1BKBA 5HY6A 2F4VQ 1AE2A 1X54A 1XNRL 4JI7L 5M5YH 1KXLA 2UU9Q 1WFQA 1RIPA 4QIWE 4POFA 4L5SA 1VS0A 2L15A 4DV6Q 3FKIH 3T1HL 4JI6Q 1JJCB 5IP7H 3E0EA 3H0GH 4YHHQ 2ALYB 4DR7Q 4OO1G 2JQOA 3STBD 3RR5A 2ZM6Q 2Y0SE 1Y1VH 3HOVH 1XMOL 3MXNB 1E3PA 2BA1A 4B3SL 1MIUA 4AYBG 4O2DA 2E2JH 4C3HH 1IBLL 2JK8A 1HZCA 1TWCH 5GAHC 5IE8A 2H5XA 4A3JH 4LFCQ 4PZ7A 3HOUG 2I5HA 4NB3A 1VQHA 3NELA 3T1YL 4NPSA 1IZ6A 5FJ8G 1RL2A 4A93G 1N33Q 1Q46A 1X56A 3GTMH 1N32Q 4O0AA 2IT1A 2LSSA 1E24A 4JBWA 2ZJRA 5LMNW 4GS3A 4B3TL 3CCSA 2E5LL 1K83H 2I5LX 2DUDA 1NJIC 1HNXQ 4DK3C 1X65A 2K4KA 1SRUA 4JOIC 4WJ4A 3OYYA 4R4IA 4LFAQ 4X65L 4DAMA 2UUAL 4GNXC 4A3GG 1A63A 3PGZA 1G6PA 1UE7A 3RLOA 1SR3A 1XNRQ 1CKNB 2KHJA 2Q2IA 1S40A 2MQHA 1VQKA 2UUCQ 4C3IH 2WAQG 1XPOA 3SGIA 1R9TH 1QVCA 3M7NA 1VQAA 4UP9A 3TQYA 4DV2Q 1X9NA 3I4OA 4LF9L 1YVCA 2HQLA 1N36Q 3GO5A 5E7NA 1VCIA 4JI3L 5M3FH 2PQAA 4OO1I 1CUKA 3J81i 2YTYA 5C4XH 5H1SE 2F3IA 4DV5L 4AH6A 1N34L 1ASZA 5IYCH 1IXRA 1HNWQ 4A3EG 3CCJA 3ICEA 2ZJPA 3PF5A 4NXML 4A3LG 1YHBA 3I56A 1JB7A 3S14H 3M9BA 1HR0W 3NEMA 4YWLA 3J80c 4DPGA 1KC8C 2UXCQ 2A8VA 4X66L 4LF8L 3S1NH 4DV7Q 4GLAC 4B3TQ 3B6YA 4RMFA 3EN2A 5M3MG 2B3GA 1JE5A 4X62L 1IBKL 1HNZQ 3UE0A 1VQ4A 2K5VA 4DR6Q 4GKJL 3GTLH 3HOWH 1GM5A 4A3DH 4JC0A 2UUAQ 3I4NH 1GD7A 4JI4L 3M4OH 4DR1Q 4ALPA 1I3QH 4PG3A 4LNQA 4L5QA 1L2FA 2K52A 3J7ZC 4R4QA 4UY8C 3BZCA 5LMUL 2B63H 2LXKA 5M5WH 4A3BH 4DR3L 2KCMA 2K50A 4PMWA 1VQLA 4AYBE 2UXDL 5BR8L 2I5MX 4DV5Q 4GN4B 2ZTEA 2JA8H 1N34Q 4IO9A 3S1QH 3A5UA 3S2HH 1FGUA 1SROA 3RZDH 4DR4Q 1NMFA 2MNAA 2JEBI 4QL5A 3HFZB 4YY3L 5C44H 3WWVA 4JI2Q 3JAMi 4KHPQ 2VL6A 4BBRH 1J5EQ 4TVAB 4XTCS 4GLXA 2DGYA 2ID0A 1CKNA 2GVAA 4DUYQ 1Y14B 2FXQA 4BA2I 1KRSA 2VQFQ 4JBMA 4QQBX 2R7ZH 2ZTCA 4A3KG 1XMQL 2IHFA 2CKZB 4QJFA 3J81j 5IP9G 1SMXA 4DUZQ 4P74A 3PSIA 4JI4Q 1I94L 4HIDA 3U58A 3DM3A 4A3CG 4HJ7A 2VNUD 2HHHQ 4BXXG 1C9OA 4LFBL 4YCVA 3VDYA 1TWGH 4C2MH 2WB1E 4YWMA 1PH8A 2VY3A 2NVXH 1TWAH 1OXSC 5LMUQ 1N9WA 4A75A 2JA9A 4DR3Q 2OCEA 3D31A 3L2PA 4JV5Q 4KI0A 2D0OA 4JI8Q 2UXDQ 4OWXB 3OTOQ 5AJ3Q 1VQ9A 5GAEC 2E2HH 2D0PA 1SFOH 2EXDA 1MJCA 5GQOA 1YITA 3G48A 4BY1G 1A8VA 4BBSG 4JI0L 2HT1A 2R7FA 2IX1A 1WOCA 3PO3G 4TQUS 2ZTDA 1Q8KA 2Q2UA 3S24A 2R92G 1PHJA 3F2DA 2VQEQ 2N78A 1KIXA 3KFUA 1YZ6A 4Y7NH 3Q8DA 4DV3Q 2D62A 4DV1Q 1KHIA 4R4CA 1GVPA 4OX9L 1XMQQ 4YCUA 5FJ8H 3CW2C 4LF6L 2OQKA 2ZJQA 5EAYA 2N3SA 5IWAL 5IYBG 3GTPH 4HJAA 2VZAA 1VQDA 2R93H 3AEVA 1KRTA 1I5FA 3PIPA 1YIJA 1HZ9A 1L1OA 1PA6A 5FLMH 1KAWA 1CKMA 4GN5A 4DV0Q 1IBML 4BA1I 4B3ML 1JJGA 1UEBA 4K0KL 3I7FA 3ER0A 2HIVA 1NTGA 4A3FG 3S2DH 5IP7G 4JBKA 2R7DA 3U4VA 4LF4L 3TRZA 1AE3A 2KENA 2Z0SA 2RF4A 2KHIA 3UE1A 1Y1VG 1Q1EA 3HKZG 5C3EH 2YU9H 1FJGQ 4IJHA 3CXCA 2XTIA 4A3MH 4JI7Q 4GN3B 4JI5L 1YJWA 3S1MH 2Q2HA 3CCRA 1LTLA 1X55A 2UUBL 4IPCA 2V1CC 4LF7L 3KOJA 3T1HQ 3NBHB 5ELNA 2Q2TA 4JI0Q 3TS2A 1EIFA 2PI2E 2RCNA 3AFQA 4P73A 3H3VI 1EQRA 2GVBA 4DR2L 1Z9FA 1MJEA 3PIOA 1VQ7A 4P71A 5C0XJ 1CSPA 2YTXA 1Y1WG 3OW2A 4JBJA 1XMOQ 4B3SQ 4X6AH 4A3LH 1J6QA 1D7QA 4R4OA 3U50C 1E22A 3IRBA 4LW1A 4C3JH 5IT9c 1IBLQ 3PV0A 1NY4A 2RHSB 1IL2A 2AMCB 1JJ2A 2EIFA 2AWNA 5IWAQ 1YEZA 5J3BA 3J81c 3T1YQ 2JA5H 4B3RL 1B70B 4A3IG 1X6OA 5M3MH 3D0FA 4DR5L 2OTJA 1DGSA 3S17H 3CCMA 1Q1BA 3ZJYC 2YTVA 1IBMQ 2E5LQ 2E8GA 1I50H 3PUZA 4APVA 1NBWA 3W5OA 1FL0A 1Q86C 2GN5A 1X3FA 4DKAC 5M3FG 3RN2A 3CCLA 2I0QA 3EIVA 1U0LA 4X65Q 1PH6A 1B8AA 1WCMH 1Z47A 3F2BA 5IYCG 3CCEA 3CQZH 2WFWA 4POGA 3PF4A 3M3YH 1S72A 2BA0A 1XTDA 1LYLA 4LF9Q 1H95A 1PYBA 3KF8B 3A5ZB 2YV5A 4P72A 4A4IA 4HJ8A 1HR0L 4JI3Q 3MEFA 1WI5A 1X3EA 1K0RA 2Y0SG 3A74A 3K8AA 4PZ6A 2NN6G 5M5XH 1L1OB 4GKKL 3HOXG 2HIXA 1PYSB 2PI2A 1Q82C
chains in the Genus database with same CATH superfamily
1MKHA 3K6OA 4IUUA 4NXMQ 3PO2H 2UXBL 3HOWG 2OTLA 4OELB 1I4RA 3ERSX 3I4NG 1MGSA 3T53B 4M8AA 5KNCA 2WB1B 4X66Q 1MD2D 3FPUB 5IGFA 4X64L 3ITPA 1W6KA 2JA7G 3KYHC 3R93A 1BVSA 4IOCA 1F9QA 2QGQA 2LS01 2WAQE 1QZGA 2VUMG 2HDLA 4R1JA 4YHHL 4DR7L 1BBWA 5ELCA 1RTOA 3RLFA 2JYOA 2XGTA 1VQPA 1KLUD 2B2UC 2CH4A 2B2TA 4IJLA 4OO1H 2QCPX 3D4RA 1VQNA 1WJJA 1N32L 3KUPA 4LAAA 3K57A 1K8AC 3K81C 1HFGA 3DWAA 1PVOA 3CPWA 2F52A 1PH3A 1F2YA 1EEID 4NXNL 1HZAA 2F0HA 1HNXL 2RDHA 1KL9A 4LFAL 1D1KA 3U4ZA 1NMGA 5IY0A 2F03A 1JMCA 3J81E 1LT4D 3KLSA 1VQMA 3S15H 1STEA 5KYLA 1I94Q 4KY5A 4XIGS 4KV6A 4WJ3M 3MZ5A 1N36L 3K0XA 5C0XG 4L8JA 1Q7YC 4BS9A 2A6HD 3KDFB 2F3VA 4HJ9A 1EFWA 4DNRB 3GTOH 4Q0FA 1UAPA 3CCQA 5GAGC 4H02A 3CPFA 4DGZA 4DV7L 1G2TA 1S5DD 2EJGC 3GV6A 1JT8A 1X3PA 3CHBD 1HJPA 1NE3A 1Q8IA 2CVRA 3W1GA 4A3IH 3TREA 3OOCA 2KVMA 1PH9A 1NR2A 2FHTA 4H13C 2MHVA 5C3EG 3CRKC 2AWOA 1GOZA 2KA7A 1L1OC 4C3IG 4B3MQ 4LWCA 2VXWA 2PCFB 4FDBA 1KQSA 4JCVE 4DAYB 4FF4A 5C4XG 2F0OA 5I2XA 2K75A 1U5KA 1CQVA 4I7AA 2F0JA 4GNXB 3SVMA 4KHPL 4JG2A 4RH6A 4E6IA 2KECA 2JA5G 3VR5A 5JJLA 4TKOB 3M4PA 2EZVA 4ME3A 4DUYL 3J7A5 1EOVA 1EL0A 3SR1A 5LMNQ 4H7BA 5E3FA 2CQOA 3RNUA 1S5ED 3N6RA 5EBCA 4DN4M 3ONAB 1VMPA 3G4SA 2WAQB 3TP6A 2CH4W 3UDGA 3GTOB 1WCMG 2JEAI 5I6YA 5LHY1 1SE8A 1A3TA 2PNHA 2JA7H 1ASYA 1VQ8A 2EYLA 1YHQA 1HCZA 3HKZE 5AJ3L 1F77A 1DZ1A 5IIFA 2VUMH 1ICWA 4ZUIA 4A3IB 3CP0A 3BYYB 3C46A 2K32A 5GROA 4RWSC 2VQEL 3CRLC 4GZYC 2AHOB 2MFIA 4IPHA 3QOLA 3JC66 2NZOA 1SNCA 1LT3D 3F2CA 2EYJA 2CFMA 4QF4A 2K5HA 4DV4Q 2MO1A 3T13A 1N33L 3H3VH 4UP7A 2A73B 5CV5A 3K5NA 2Q8RE 4GOPC 2PNRC 4KY6A 2Z4IA 1C0AA 2K33A 3S1RH 1PFNA 2ES2A 5IGEA 2XWBB 2K5NA 3NQTA 1QE6A 4KKSA 1VQ6A 1FJGL 1BKBA 2G9DA 5HY6A 3HP3A 5M5YH 2A68C 3HOWB 3MHBA 4DV6Q 1PTOH 3T1HL 1JJCB 3FEWX 4X3SA 5IP7H 5C0XH 1QCBD 1EWHA 3RR5A 4FXDA 1Y1VH 3VA5A 4QCLA 3MXNB 1MIUA 4AYBG 3J81L 2JA7B 2LFNA 2JK8A 2H5XA 4X3UA 4KHVA 4NB3A 3H3VC 1VQHA 3S1QB 4J1MA 4NPSA 2EYFA 2VUMB 3DUZA 1Q46A 3M7GA 3QB3A 4RCOA 1E24A 4JBWA 2GA4B 2QF7A 3CCSA 1F9RA 5ELBA 2DUDA 1NJIC 2AQ1B 2WINB 4XQJA 1WTVA 1JWUD 4R4IA 2Q8TA 1UE7A 2J7ZA 3RLOA 1XNRQ 1A2UA 2KHJA 2Q2IA 2UUCQ 1PTOC 3MXGA 4C3IH 1R9TH 3TQYA 1X9NA 1YVCA 5M3FH 2PQAA 2NWGA 5C4XH 1N34L 3GV3A 1IXRA 4LJZC 1EIHA 4A3EG 2B2WC 4FVMA 3FPPA 3PF5A 2A74C 2AQ2B 4C3JG 1HR0W 4YWLA 5M5YB 4NP5A 4DPGA 2B2VC 2UXCQ 2EXZA 2A8VA 3HGBA 1GUNA 2D9UA 1F2LA 2YU9H 3EN2A 5M3MG 1JE5A 4Z9CB 1VQ4A 2K5VA 2WACA 3HKZB 4K5VA 1EU3A 3GTLH 1IW7C 2F3WA 5IGDA 2Z4HA 5K36H 5CBEE 1SJHD 2AQ3B 1L0XB 3D6WA 1DYQA 3D4WA 3NK9A 2QW7A 3SK8A 1MSGA 4LNQA 3BDOA 4ULLA 5JEAH 1L2FA 2K52A 4RGNA 3J7ZC 3V2TA 1SDFA 2B63H 2LXKA 1QNKA 1TR5A 4JW0A 4MIUA 4A3BH 2K05A 4AYBE 1FNWA 2JA8H 3D6CA 3NP8A 3NWSA 3A5UA 3S2HH 1FGUA 5C3EB 2FFKB 2JEBI 4YY3L 5C44H 3JAMi 4EQNA 1HUNA 1ML0D 4C3IB 1R4QB 4TVAB 2ID0A 1Y14B 2JXMB 5M3FB 2VQFQ 4QQBX 3MVVA 5DM63 5C4XB 5KNBA 1GJXA 3IFTA 3J81j 1NCVA 1SMXA 2A68D 1CT1D 4CBVA 4HIDA 2B39A 3TDQA 2JA5B 1BBXC 1TWGH 4CKBA 3HEJA 2PQEA 2VY3A 1TWAH 4OHJA 3MAQA 5LMUQ 2JA9A 5C3XA 4DR3Q 3CKIB 4KI0A 2YU9B 4OWXB 1H9MA 1R4PB 2RA4A 2N88A 2HD3A 4K6LA 3TN2A 2D0PA 3GTLB 1SFOH 1MJCA 2L11A 5GQOA 4BY1G 1WCMB 1SSOA 3K5LA 1EYAA 3Q22A 2SEBD 2IX1A 5BN5A 4TQUS 2Q2UA 2R92G 5DNFA 1KIXA 4I7ZC 3NWTA 5JJZA 4DV1Q 4RGOS 4R4CA 1STHA 2B2YC 5IT9E 5IOCA 4YCUA 3CW2C 5IWAL 5IYBG 1WTXA 2EOTA 3GTPH 4HJAA 5EKKA 1VQDA 3V05A 3PIPA 1PTOD 2L5TA 1L1OA 1CKMA 4ID6A 2ZT9C 5C44B 1SNPA 4BA1I 4K0KL 2H1EA 3ER0A 4ILWA 5JVG3 3SK4A 3V96A 3WOEA 2R7DA 2X69A 4LF4L 3P1HA 3Q6SA 3TRZA 3CU7A 1AE3A 4FF1A 3UE1A 2TMPA 4KTAA 1ESRA 1CM9A 3CXCA 4JI5L 4LF7L 5ELNA 4JI0Q 1EIFA 4CDFC 3AFQA 4P73A 1Z9FA 1MJEA 1VF7A 3PIOA 1TWGB 4F88A 1TWAB 4IUNA 1XMOQ 4B3SQ 4JBJA 4CDEC 1IW7D 2EVBA 3U50C 1D7QA 1IBLQ 4C3JH 5IT9c 4RCNA 1RF2D 1JJ2A 1E2WA 2AWNA 5J3BA 3T1YQ 2N55A 2K1BA 1A6XA 1SFOB 3H09A 4FF2A 5CR3A 5M3MH 1FNUA 1DCZA 1DGSA 3S17H 1PDQA 2E5LQ 2E8GA 4AYBB 3PUZA 3CCLA 4DKAC 1U0LA 4X65Q 1B8AA 3LX0A 3A54A 5IYCG 3CCEA 3LWEA 3CQZH 4POGA 3GTPB 4C56C 3MC0B 1TIID 5BN3A 1SE4A 4IZ8A 3EQLC 5FLXE 1U4PA 3A5ZB 4P72A 4HJ8A 3MEFA 5T1IA 4ZK9B 1PZKD 3K8AA 4PZ6A 5M5XH 3HOXG 3NTIA 3BJUA 2PI2A 1Q82C 4UP8A 4LF5L 3BS1A 3ND9A 3GTGH 4BY7G 1AN8A 3AMUA 4LK1C 4LF8Q 2G9HD 4DR5Q 5I9OA 2E74C 1O7YA 3PCOB 1XNQL 4GKJQ 1LTRD 4A3EB 2XIWA 4U673 3CC7A 1EY9A 1EWCA 1MBYA 4C3JB 2IWHA 2HDMA 2UU9L 1CZWA 1K3RA 2NVQH 2JSOA 4QY7A 1HZBA 1OXUA 1HXYD 5IYDH 1AH9A 5FLXc 4A76A 5M3MB 1KDCA 2ZM6L 4MTNA 5HGQA 5C4JH 3S17B 5C6AA 2X6LA 1TWHH 4LFCL 5KIXA 1OXVA 1D2BA 4WFN3 3GTQH 3KF6A 2P5ZX 1YNJC 4IFDG 3BU2A 2BH8A 2HCCA 3CQZB 4OONA 4X3KA 1SN8A 4HAEA 4WRDA 3TZUA 1M1KC 1SAPA 2EQSA 2KCTA 3TMEA 4P75A 1E7ZA 1YBYA 4JI1L 5IYBH 5JVH3 3GP7A 1HQRD 1M4VA 4MNOA 3Q23A 1OTCA 4A93H 3KF8A 4K2KA 1LUZA 3P20A 3R2IA 5M5XB 1DM0B 2KCCA 1Q12A 3I4LA 4N9PA 3DLLA 3DWPA 4IFDJ 1PH7A 1XPRA 1JR0D 3OSOA 2IY5B 4K14A 1HRJA 4LFBQ 2VB2X 5EPJA 1XXGA 1LTBD 1OXTA 2E2DC 4YWKA 4WORA 2IX0A 1HH2P 3L7ZC 5IT9L 3W1BA 2ICEC 2HCIA 1HNWL 3HOVG 1BQQT 3I2ZA 1KDAA 3IL8A 2KOLA 3GTJB 1UWVA 3KLWA 4A3JG 4N8FA 2NVQB 2R93G 1ENFA 2Z6KA 1W2BA 4QUCA 1CI3M 5CV6A 2BDOA 2ATWA 3STBC 5FLMG 4DR6L 1HNZL 3VYTA 4NW2A 4NXNQ 2N8NA 1E1TA 4OX9Q 1BCPB 4ZKBB 2A69D 3URYA 2A6HC 2VW9A 1YHAA 1TWHB 4DR1L 3I90A 4BY1B 1EU4A 3CC4A 1P16A 3CD6A 3ULJA 1GUGA 4A3MG 1LV9A 4AQYL 5EGTA 1SYEA 2FINB 1VQEA 3A8KE 2R92B 5C3WA 2OEOA 2AKWB 3H15A 4HMIA 2VS1A 1VQOA 5C0XI 2R6GA 1I4XA 1AZQA 1M90C 1EUJA 3VA7A 1S3OA 1TWFH 4A93B 2PYKA 2XRSD 1PTOF 1FVIA 2UUBQ 1ILQA 4JI2L 1EY6A 2OQ0A 2DY8A 4H0LC 1I4QA 1D6EC 1Z6HA 1JCKB 1XWEA 3HOXH 2XN9C 3LGJA 1ZYRC 1XPUA 5I9PA 1CSQA 2A1AA 4IPGA 4BY7H 1EWIA 1P8LA 1GUSA 4B3RQ 5FLXL 1SLJA 1TQOA 2HHHL 1QZHA 1X3QA 1O7IA 1TXYA 3DM1A 1Q3LA 5KYIA 2RKSA 3AYHB 1K73C 3H6MA 3FHWA 1QG7A 4EGVA 4MN3A 4JV5L 4KD4A 4JI8L 2KJXA 1EZ8A 5JAVA 1RHPA 2J4XA 4PZ8A 1VQBA 4L5RC 2F4VL 1HQMC 3CF5A 4A3CH 3ULLA 1PH1A 4G7OC 3M85A 1B4OA 1QJOA 5FO8B 1O80A 1EY5A 1RTNA 1YNJD 2BDNA 3CMEA 1BNZA 4JI6L 2A19A 2RQXA 1T9HA 1XJVA 2ASBA 1GUOA 5IGGA 1QVFA 2N49A 2FJ2A 1U4LA 4QGUA 1N8RC 3J7AV 3TEHB 2XWJB 2PW7A 4GKKQ 2VB3X 1PLFA 3GD7A 2R7ZG 1NAPA 1V9PA 3K7AH 1SNQA 3ULPA 4K8JA 3MXUA 2PQAB 1EEFD 1RKNA 1TWFB 2EY1A 3T56B 1EFID 4JYAQ 4DV0L 4RHRA 3TP8A 4K2LA 4PQXA 2PZUA 4JOIA 2F0UA 4IALA 1SNOA 2KEEA 3HOXB 1GO3E 2QILA 1DOMA 3HOZG 1STGA 1X54A 1RJTA 4JI7L 2NBFA 4BY7B 1VF5C 4QIWE 4L5SA 3NQIA 1VS0A 3H91A 3J7YW 3IFDA 2ALYB 3STBD 1AEXA 2IX3A 4ZLTF 2Y0SE 3S9WA 3HOVH 2BA1A 1U9RA 1LABA 1FYCA 4HN7A 1HZCA 1TWCH 5GAHC 4A3JH 1E2VA 3HOUG 1KDBA 3AB9A 3OMCA 3M4YA 4YIJA 4EQOA 1N33Q 2EY2A 2F0SA 2IT1A 5COYA 1K83H 2I5LX 3C1EA 4CDDC 4KJOA 4DK3C 4CDCC 1SRUA 1IKLA 1PFBA 4WJ4A 2UUAL 4A3GG 4GNXC 5C5MA 3PGZA 1SJED 3K7AB 1VQKA 2F0PA 1XPOA 1QVCA 3WDNA 1VQAA 4DV2Q 2IL8A 2HQLA 1VCIA 4PMBA 1D5XC 3J81i 2YTYA 5H1SE 2F3IA 1ZYRD 5NUCA 4DV5L 4AH6A 5ISRA 1EQVA 3CCJA 1SE2A 2ZJPA 4NXML 4A3LG 3I56A 3TP5A 1B2TA 1QILA 4CGYB 4X66L 4V0BA 3SK6A 4RMFA 2B3GA 3UE0A 2R3ZA 3K59A 2F0IA 3HOVB 1B9MA 3HOWH 5C4HA 3I4NH 1SNMA 4JI4L 1V1PA 1TWCB 4ALPA 4A3JB 1W6JA 5CV7A 4XT1B 4L5QA 4R4QA 4UY8C 1VQLA 2K50A 5D3DA 4PMWA 1JWMD 2UXDL 1K83B 1N34Q 3KBGA 3C1FA 5EJWA 3S1QH 2FMMA 5EPLA 2NTTA 4HTHA 3OHXC 4DR4Q 1NMFA 2NZ1D 3HFZB 1FGBD 2OF1A 4A3MB 3ZYYX 2VL6A 3NXWA 1J5EQ 4XTCS 4GLXA 1CKNA 1NNXA 4PNYA 1AFPA 2R7ZH 3KLRA 5EBDA 1XMQL 1IYVA 2KCNA 3D8GA 3OWFA 4QJFA 3J7AF 5IP9G 4FF3A 4DUZQ 2MP1A 1I94L 4QIWB 4HJ7A 2VNUD 1C9OA 4YCVA 2SNMA 4YWMA 1CK1A 2NVXH 1BUVT 1OXSC 1S5FD 2Y0SB 4A75A 1DD2A 2OCEA 2D0OA 4N8X1 3BZDB 3OTOQ 2M00A 1BOSA 2C9OA 5GAEC 4HEDA 4KKTA 2XRQD 3I4NB 3G48A 1A8VA 2NB0A 3LWUA 2R7FA 1TKWB 2M2LA 3PO3G 4DF7A 3S24A 4JPBW 4G57A 4LMQD 4DV3Q 5G3LD 4XDXA 3VR2A 1GVPA 1QWYA 2ZJQA 5EAYA 2N3SA 4UAIA 5J22A 3QOJA 4GN5A 4Q5VA 1ZEQX 4B3ML 1NTGA 4A3FG 3BG3A 2NVTB 3U4VA 2KENA 1K28A 2R7ZB 5C3EH 1Q1EA 4F87A 4IJHA 5CGKA 2EY5A 3TZDA 3D4DA 1ICFB 2Q2TA 1LTID 1J8IA 2GVBA 2LY7A 5I6WA 5EQ0A 4P71A 2NVXB 1CSPA 1I4PA 3OW2A 4A3LH 1J6QA 3HOZB 1E22A 2SDFA 5FO7B 1LT5D 1S5BD 3PV0A 2RHSB 1TY2A 2EIFA 5IWAQ 2JA5H 5E4XA 1B70B 1TS3A 2X6GA 4G7HC 1HUMA 1PYWD 2YTVA 3N52A 4KJNA 1I50H 1IL8A 4ZRZA 1PRTB 3W5OA 4KK7A 2GN5A 2I0QA 1JICA 1RCVD 3HOUB 1WCMH 5C5LA 1AW7A 2LKVA 1C4QA 4IN3A 4XQNA 2WFWA 3PF4A 2F0NA 2F0VA 2BA0A 1H95A 4LF9Q 1LO5D 5I4DA 4UHVA 3KF8B 1SYBA 2YV5A 4A4IA 4JI3Q 4HCSA 1WI5A 1X3EA 2Q8IB 2QEJC 2B2UA 2NN6G 4A3GB 3AU7A 2BCOA 3H94A 5FKAC 3I3CA 1CHPD 1E1OA 4DV4L 4KLKA 2YYZA 4IOAA 1IYJB 1UUPA 3T4AC 1B50A 1PH4A 2O5JC 2L55A 3KDFA 4KN7C 2EPBA 1UE1A 1IBKQ 1A15A 4X62Q 3JAMc 3BYTB 3EFXD 5A2QE 4FXKC 2MO0A 5IODA 1L0WA 3TS0A 2MGSA 1XX8A 3K58A 3I55A 2EYOA 4DV6L 1CQFA 2C35B 3PIP3 1I6HH 1U4MA 1K9MC 2BOSA 3D3RA 4BBRG 5BR8Q 3CCUA 1I50B 1G51A 4CJ2C 4KN4C 4LF5Q 1O7ZA 3MFGA 1STBA 3I73A 4FXGC 4EX5A 4DAVA 4QB4A 1K8GA 1CZGA 1GKHA 4B9XA 3MTSA 3FP9A 3C2PA 1V1OA 3EROA 1VDZA 2CWPA 4GNXA 2HUGA 1TS2A 1F2ZA 2JJQA 3PMFA 1A0IA 1BXTA 3TP7A 1MSHA 2LMCB 2UUCL 1OXXK 1WTQA 2CCZA 1IYUA 4R8NA 2K5WA 1DONA 4A3FH 3BVZA 3AQQA 1QUQA 3FKIG 4KD3A 1K8OA 5JJIA 3H0GG 4HIOA 1IHZA 5JOBA 3X3MA 2QKIC 3MXPA 4C3HG 1HPCA 2ICIA 2UXCL 4IFDI 3HKSA 4R4TA 3Q24A 3GTKH 2L9HA 2BH2A 4RGMA 3HG9A 2E2IH 3A0JA 2OT2A 1EQTA 1I6HB 4A3EH 4HSVA 1B7YB 4IPDA 1O78A 1M8AA 3UDXA 5JPNC 4JI1Q 3CC2A 1UE5A 2MUYA 1YJNA 4LF6Q 5ELOA 2K5DA 4MZ9A 3OWEB 4L63B 4K5WA 1Y8NB 2NVYH 4N9TA 1ZXTA 3PO3B 3RZOH 3UDFA 1JOKA 2L4NA 3QG1A 2WB1G 5KGUA 2CW0C 2F0QA 4J15A 5G3LF 2B8FA 1HTPA 1EIYB 3J80i 3VR3A 1Q90A 1ONLA 2A69C 3RN5A 2WP8J 2PPBC 3VYRA 3KK7A 3T16A 1PH5A 3NENA 3SDZA 3I72A 1RODA 2RCFA 4EQ5A 3S16H 3QR8A 3KLSX 3JAML 4DR2Q 4LUOA 4A3FB 3E9HA 5EKLA 2VQFL 5GADC 5KNDA 1V43A 1V1QA 4OIJA 2Z8LA 3HZXA 4RAUC 4U68A 4HJ5A 1ET9A 2F1MA 3HRZC 4OEMB 3CMAA 1YJ9A 1KD1C 4KHZA 4GOPA 4TSSA 5DLQE 1H9SA 4OWWB 3U9SA 3VYSA 4AQYQ 2QEXA 1D1IA 4FNFA 3GTKB 2E2IB 2IW3A 2I46A 4DNIA 2E76C 2PMZE 4OXPA 3GTJH 1EY7A 5AFWA 3VR6A 2F0EA 3G71A 2ZXOA 2B29A 2NVYB 3PO2G 3KJOA 4LUZA 2WV6D 3RZOB 4O1NA 1HR0Q 4RG1A 5A2QL 1CFMA 4DV1L 3E5SA 4BY1H 2LXJA 1D5MC 1JWSD 1O7LA 2Z9HA 1VQJA 3GDEA 4HIKA 2UXBQ 1SE3A 3EVQA 2R92H 3EBEA 2MJ8A 1X3GA 2QDBA 3LNNA 2I07B 4YCWA 1WTRA 1ET6A 3HS0C 5ELFA 3BZKA 1F2MA 1C7YA 1EZ6A 4X64Q 3S16B 1VQIA 4C1NK 1UEAB 1GUTA 1DOKA 2F4VQ 1AE2A 1B9NA 1TS4A 1KXLA 2O5IC 4EVOA 1WFQA 2EJMA 4POFA 1OO9B 3FKIH 4JI6Q 5CYUA 2AUKA 3E0EA 3H0GH 4YHHQ 4DR7Q 4OO1G 4DA2A 1BCPC 1V1PB 2B2WA 4RKLA 1XMOL 4B3SL 1E3PA 4ZQ3A 5M9OA 4O2DA 3R3OA 2E2JH 4C3HH 1IBLL 5LL6X 2M9VA 5IE8A 2B2VA 4PZ7A 1DJRD 1I4HA 3T1YL 1HHVA 2NTSA 2RDFA 5FJ8G 1EYCA 3OIQA 1X56A 3GTMH 1N32Q 4O0AA 5E4WC 2LSSA 3QIAA 2ZJRA 5LMNW 4FP5D 4GS3A 4B3TL 3NSWA 1HFNA 1GUWA 2CW0D 2E5LL 4B08A 1HNXQ 2K4KA 3OYYA 4LFAQ 4X65L 5CORA 1NSNS 3ND8A 1A63A 4XQQA 1G6PA 1Y69U 1SR3A 5IGBA 1B53A 2C5CA 5CV4A 1CKNB 2WAQG 3MWYW 3SGIA 5TSSA 4CHTB 3NUCA 3M7NA 4DXGA 4UP9A 3DXJC 1N36Q 5E7NA 5FO9B 1CUKA 4C2MB 1ASZA 3KBXA 5IYCH 1ESFA 3WOFA 1G8ZD 3ICEA 5T1GA 1YHBA 4K6DA 1JB7A 3M9BA 3NEMA 1II3A 3R2TA 1PRTF 1STNA 4LF8L 3MEHA 4DV7Q 3FKIB 3Q0AA 1WTOA 1YNND 1J9OA 3B6YA 3ERQA 2XNAC 1HTLD 3H0GB 4CKEA 4GKJL 5EKIA 3FVQA 4Y7NB 2PMZB 4JC0A 2UUAQ 2E2JB 1Y8OB 4C3HB 3M4OH 1I3QH 3O13A 1H9JA 3GTMB 5CV8A 5M5WH 5CC4A 4K5XA 4DV5Q 1DOLA 4GN4B 4G7ZC 1SXTA 4IO9A 3S2DB 4XYQA 1GXDC 1SYGA 3RZDH 3I91A 1LLRD 1QNUA 1Z7TA 2DNCA 4KHPQ 5CBAE 2IPKD 4DU9A 2DGYA 2F0KA 2B2YA 3C3LA 1JOQA 4DUYQ 2A5HA 2FXQA 4BA2I 1KRSA 4JBMA 2ZTCA 4A3KG 1GHJA 2EY6A 2RBMA 4IFDH 1SNDA 3G6JB 3PSIA 1RD9D 5I2YA 1E0BA 4JI4Q 5FK9C 3DM3A 4BXXG 4LFBL 5E1FA 1PH8A 1BCPD 4RA8A 3A56A 1N9WA 2K5QA 1LTGD 2D5DA 2EYHA 3U9OA 2DN8A 2UXDQ 4TRDA 5AJ3Q 1VQ9A 2E2HH 1D5ZC 1G6ZA 4H44C 4NMZA 1YITA 2KHSA 1BDOA 4R9WA 3M4OB 4IUVA 4BBSG 4DFAA 1I3QB 2HT1A 1WOCA 1C8CA 1FD7D 1PHJA 3TBIB 3F2DA 2VQEQ 1JORA 1YZ6A 4KKUA 3Q8DA 1HA6A 2L12A 5M5WB 4OX9L 1KTKA 1XMQQ 5FJ8H 4B9WA 2OQKA 5D14A 2R93H 2VZAA 1PFMA 3DHQA 1I5FA 1YIJA 2RVLA 3PO2B 3RZDB 5FLMH 2KUMA 3DMUA 1TVXA 1IBML 1JJGA 1T5XD 3SEBA 2HIVA 5IP7G 2EJFC 4UDUC 4MHEA 3EA6A 2KHIA 1Y1VG 3E0JA 3HKZG 4ABNA 5L37A 1FJGQ 2XTIA 4A3MH 1PMRA 2L0CA 2BE5C 3S1MH 3NTHA 1ENCA 4J6HA 1X55A 2UUBL 4IPCA 3KOJA 3T1HQ 1SEBD 3TS2A 2PI2E 3SE0A 4ZUJA 2XSCA 1XYIA 2H4OA 5C0XJ 2YTXA 1Y1WG 4O42A 2O2LD 3NTKA 3IRBA 2JP1A 2XVSA 4G4KA 1IL2A 2AMCB 3J81c 1YEZA 2E2HB 4B3RL 1UNSA 2F4IA 1SYDA 3L9AX 1K8MA 1X6OA 4CJ0B 2OTJA 1BR9A 1Q1BA 3CCMA 3ZJYC 1SYCA 4APVA 3MA2B 1Q86C 1FL0A 4DK1A 5M3FG 1Z47A 3F2BA 3DEOA 2PO4A 3M3YH 4L6TB 2R93B 3OIPA 3S15B 4X3TA 3RUZA 1S72A 1XTDA 1XTCD 1PYBA 2EYMA 1B1ZA 3T51B 3A7LA 3F2UA 2DY7A 3A74A 4XT3B 4GKKL 1L1OB 2HIXA 1PYSB 1SYFA 2PZWA 2Z1CA 3P7JA 1JE4A 2JE6I 2RSOA 1B44D 1F9SA 1QUQB 3I4MG 2RHQB 1D8LA 4JYAL 3RD4A 3PUYA 3S1MB 2K01A 1KAAA 5K36G 4HSPA 4HR7B 4PMCA 2NVTH 4A3KH 5JEAG 1A3UA 1Q81C 1L0YB 3NBHA 5K5PA 1PV4A 2B63G 4A3BG 3NBIA 2QDLA 2WKDA 4BXXH 2JA8G 1YNXA 3A8JE 4JK1C 4DAPA 2ENBA 4OIKA 1ZKOA 3SXHA 2F0GA 5JEAJ 5C44G 2JA6G 1C48A 3HOZH 1VQCA 2NN6I 3CAMA 1LTAD 2OWOA 4BBSH 4CKCA 1EYGA 2EDGA 4OGQC 1E2ZA 4YY3Q 4HIMA 3M3YB 3K5OA 2IHEA 4LUVA 3UDIA 3HOYG 3F1ZA 3E6ZX 1Y8PB 1BBUA 3HOUH 2K28A 5J39A 1EQQA 1VQGA 2MPMA 4KY7A 2O4XA 2BE5D 1KLGD 3K80C 5HURA 2FMCA 4DV2L 1WD1A 1PH2A 4DK6C 4AIMA 1WTHA 3KJPA 4A3GH 3W3AA 4GOPB 4A3KB 2F0DA 2CHBD 4ZCKA 1H9SB 1DXMA 2L1BA 4C1NI 1A2TA 2QA4A 1PFSA 1U4RA 5JPMC 1LT6D 4IUTA 1PRTC 3RLNA 1Y1WH 1BCPF 4J8QA 4GLVB 4IUQA 2DJFC 3CCVA 4OWTB 1UE6A 5D65A 1QOHA 3L0OA 5LMNL 3TSSA 1CA6A 1G291 1YI2A 1LM0A 2CWAA 5BN4A 3PQIA 4BBSB 3DWQA 1H9KA 2K04A 4HCEA 1WYDA 3G6EA 4K0KQ 2Z6BA 3A7AB 3OMGA 2V4DA 3JAME 3S1RB 3KF6B 3PUVA 1G2SA 4LF4Q 1CKOA 1NR4A 1VQFA 4JI5Q 4DR4L 4IUPA 3E9IA 3FMCA 3OW7A 4LF7Q 3PUXA 4L5TA 4BWGB 4ZYSA 3X3NA 1J5EL 3A8IE 2KBNA 4R8IA 1PTOB 2HQEA 4Y52H 1BO0A 2RSNA 2Z6KC 1B3QA 1LTSD 3W2DA 3GQBA 1STAA 1Y1VB 1JOOA 1CA5A 1MI2A 2K14A 3I4MH 2SNSA 4DUZL 4ZAIA 3L3OC 2PW5A 5A35A 5KEEA 4A3DG 2B8GA 2K7VA 2ZXPA 1KABA 1V8QA 1Y1WB 2NZHA 5IP9H 1QVGA 1SBBB 3OTOL 5JJKA 3M4QA 2F0FA 3MFYA 3UI2A 4IQZA 2G5DA 4UPAA 5FOBB 3K7UC 1TS5A 1B3AA 4I65A 2JA6H 1WVLA 1QB5D 1F9PA 1R9TB 1G91A 1VQ5A 4DV3L 3PUWA 2KEDA 3NE5B 4QMGA 1AZPA 3BVMA 2F0LA 3PO3H 3AFPA 5EPKA 4IURA 4DAYA 3HOYH 4F8MA 1A62A 1W3SA 5DM73 2F0MA 3F8TA 1HA5A 5CV9A 5IYDG 3PIO3 2WKCA 1XNQQ 3BDLA 3BDCA 1XNRL 2NUCA 3I4MB 4WJWA 2UU9Q 1JC7A 1RIPA 2L15A 1PRTD 3K0YA 2JQOA 3EJIA 4NKLA 4FYDA 2ZM6Q 3P75A 4XYOA 2B63B 2IJ0A 4A3BB 4LFCQ 4OL7A 2JA8B 4RHSA 2CQAA 2I5HA 3NELA 4JVZA 1IZ6A 4A93G 1RL2A 3J80E 3S2HB 2B2TC 2JA6B 1AP0A 4DNTB 4NDXA 1RDPD 1X65A 4JOIC 4DAMA 1LACA 4S3SA 3IKJA 1S40A 5ELDA 2MQHA 2AUJD 4P2CB 4LF9L 3I4OA 3HOYB 1PZJD 3GO5A 4JI3L 2JN4A 4OO1I 3NHHA 5J1ZA 2F0TA 1EY8A 1HNWQ 4KMUC 4M1UB 2WIIB 3S14H 2E75C 3J80c 2OXPA 1CTMA 1KC8C 3BVGA 3S1NH 2NN6H 4GLAC 4B3TQ 2A6EC 1IBKL 4ODGA 4X62L 4DR6Q 1HNZQ 1LTTD 1MHWC 1GM5A 4A3DH 3IAYA 1GD7A 3K5MA 1IKMA 4DR1Q 3MXNA 4PG3A 4PV1C 1BF4A 1CHQD 2K6AA 1FNVA 3I8ZA 3BZCA 5LMUL 1WD0A 1YNNC 4DR3L 2KCMA 5BR8L 4RKBA 2I5MX 4K8IA 4V190 2ZTEA 1SMYC 1JB3A 1SROA 5F2DA 3E3XA 1TT2A 1KNAA 4QL5A 1EY4A 3VR4A 2MNAA 1K0SA 2R61A 3WWVA 4JI2Q 3G7LA 1PZID 4BBRH 2EE1A 2GVAA 1GHKA 2IHFA 1KNEA 2CKZB 3I70A 4P74A 3U58A 4A3CG 2HHHQ 3S14B 3VDYA 1TY0A 4C2MH 2WB1E 1FR3A 3OPOA 3S1NB 4JV5Q 3D31A 3L2PA 2F0WA 4JI8Q 4MTKA 1T5EA 4QUFA 3SHLA 5DAUA 2EXDA 2ZXRA 4A3DB 5IGCA 1H9RA 3FDTA 3QJYA 1EOTA 3R8BA 4JI0L 1S5CD 2ZTDA 1Q8KA 3FRPB 3SK5A 2KQ3A 2N78A 3KFUA 4Y7NH 2D62A 4ZKCB 1KHIA 5HGTA 3RMHA 4LF6L 3NPPA 3A55A 5CMDA 3AEVA 1KRTA 1WTPA 1STYA 1I6VC 1HZ9A 1PA6A 1KAWA 4RFBA 2DNEA 3QWNA 4DV0Q 3GTGB 1ILPA 1UEBA 4F7XA 3I7FA 4BBRB 1ENAA 3S2DH 4RGTA 4JBKA 2EYPA 1I4GA 3DEPA 2Z0SA 2RF4A 3J80L 4EQPA 4CJ1B 4JI7Q 4GN3B 1YJWA 2D2CC 2Q2HA 3CCRA 1LTLA 5D3IB 2V1CC 3NBHB 2RCNA 1TU2B 3H3VI 1EQRA 2A6ED 2J0TD 4DR2L 1VQ7A 1EYDA 4X6AH 4R4OA 4XXEA 1JQYD 1VMCA 4LW1A 3VYUA 5C4JB 1EY0A 1NY4A 5KRUA 5LL6S 2RDGA 2TSSA 4A3IG 3GTQB 3D0FA 4DR5L 1PXUA 3QO2A 1IBMQ 1NBWA 2K03A 5DEHA 3RN2A 1X3FA 1SMYD 3EIVA 1PH6A 1K3BC 2SOBA 1X32A 4DK0A 2NYZD 4HMJA 5C4ZA 1EIGA 1LYLA 1NUCA 1WTWA 4ME5A 1HR0L 5ELEA 4DXFA 1S4ZA 2PZTA 1K0RA 2Y0SG 4FO2A 2DJGC 1A3VA
chains in the Genus database with same CATH topology
1E1OA 1MKHA 4DV4L 4UP8A 4LF5L 2UXBL 4NXMQ 3PO2H 2JE6I 4KLKA 2YYZA 4IOAA 1QUQB 1IYJB 3I4MG 2OTLA 3HOWG 2RHQB 1D8LA 3ERSX 3GTGH 3I4NG 4BY7G 4JYAL 1PH4A 3PUYA 5K36G 3KDFA 2NVTH 4X66Q 4LF8Q 4A3KH 4DR5Q 5JEAG 4X64L 1UE1A 1IBKQ 4X62Q 1Q81C 3JAMc 1PV4A 3PCOB 1XNQL 4GKJQ 2B63G 2MO0A 4A3BG 2JA7G 3KYHC 3CC7A 1L0WA 3TS0A 4BXXH 2JA8G 1BVSA 1YNXA 4IOCA 2UU9L 2QGQA 2WAQE 1K3RA 3I55A 2NVQH 4QY7A 1QZGA 2VUMG 4DV6L 1HZBA 1OXUA 2C35B 5IYDH 4R1JA 4YHHL 5FLXc 1I6HH 4DR7L 1BBWA 1AH9A 4A76A 5JEAJ 1K9MC 5C44G 2JA6G 3RLFA 2ZM6L 3HOZH 4MTNA 5HGQA 5C4JH 4BBRG 1VQCA 5BR8Q 3CCUA 1TWHH 2NN6I 3CAMA 2XGTA 4LFCL 1G51A 1OXVA 1VQPA 2OWOA 4BBSH 1EYGA 4LF5Q 4IJLA 3GTQH 3KF6A 4EX5A 4IFDG 3BU2A 4YY3Q 2BH8A 1WJJA 4OONA 1K8GA 1VQNA 1N32L 4HIMA 1GKHA 1SN8A 1K8AC 2IHEA 1M1KC 2EQSA 3K81C 2KCTA 4LUVA 3UDIA 3CPWA 3FP9A 3HOYG 3F1ZA 1PVOA 2F52A 4P75A 1PH3A 1E7ZA 4NXNL 1HZAA 2CWPA 4GNXA 1HNXL 1YBYA 1BBUA 3HOUH 4JI1L 1KL9A 5IYBH 4MNOA 2JJQA 1VQGA 1EQQA 1OTCA 1A0IA 4LFAL 3U4ZA 1NMGA 4A93H 5IY0A 1LUZA 1JMCA 1VQMA 1Q12A 3S15H 2UUCL 3DLLA 3K80C 1I94Q 1OXXK 1XPRA 1PH7A 4IFDJ 2CCZA 2IY5B 4XIGS 4LFBQ 4WJ3M 4DV2L 4A3FH 1PH2A 1N36L 1OXTA 3AQQA 4DK6C 3K0XA 4AIMA 1QUQA 3FKIG 4YWKA 3KJPA 2IX0A 4A3GH 4GOPB 1HH2P 3L7ZC 3W1BA 3H0GG 5JJIA 5C0XG 4HIOA 1Q7YC 1HNWL 3HOVG 3I2ZA 3KDFB 1PFSA 2QA4A 4HJ9A 1EFWA 3GTOH 1UWVA 3CCQA 3KLWA 5GAGC 4H02A 4A3JG 2UXCL 3CPFA 4IFDI 3HKSA 4R4TA 2R93G 3GTKH 3RLNA 2Z6KA 4DV7L 1Y1WH 2BH2A 1W2BA 2ATWA 2E2IH 4GLVB 3A0JA 3STBC 1JT8A 5FLMG 4OWTB 3CCVA 1B7YB 1UE6A 4IPDA 4A3EH 1HNZL 4DR6L 4NXNQ 2N8NA 3L0OA 5LMNL 1HJPA 1NE3A 1E1TA 1G291 4OX9Q 3UDXA 3CC2A 4JI1Q 1YI2A 1LM0A 1UE5A 1YJNA 3W1GA 4LF6Q 2VW9A 4A3IH 2CWAA 1YHAA 3TREA 5ELOA 4DR1L 4MZ9A 1PH9A 3CC4A 1P16A 2NVYH 3CD6A 3ULJA 5C3EG 2AWOA 3RZOH 3UDFA 4A3MG 4AQYL 1WYDA 1VQEA 1L1OC 4B3MQ 3G6EA 4K0KQ 4LWCA 2WB1G 2AKWB 4J15A 3H15A 1EIYB 2VS1A 4FDBA 3KF6B 3PUVA 3J80i 1VQOA 1KQSA 5C0XI 4JCVE 2R6GA 4LF4Q 1CKOA 4DAYB 3RN5A 5C4XG 1M90C 2WP8J 1EUJA 1S3OA 1VQFA 1TWFH 2K75A 4JI5Q 1U5KA 4DR4L 3E9IA 1FVIA 4GNXB 1PH5A 2UUBQ 4JI2L 3NENA 2OQ0A 4KHPL 4LF7Q 4JG2A 3PUXA 4L5TA 4EQ5A 1J5EL 2JA5G 5JJLA 3M4PA 2KBNA 3S16H 4ME3A 4DR2Q 4LUOA 3HOXH 3E9HA 4DUYL 3J7A5 4Y52H 2VQFL 1EOVA 5GADC 1V43A 1V1QA 3LGJA 1XPUA 2Z6KC 4HJ5A 5LMNQ 1CSQA 2A1AA 4IPGA 2CQOA 3RNUA 2K14A 3I4MH 4DUZL 4BY7H 1EWIA 3CMAA 1YJ9A 1P8LA 1KD1C 4KHZA 4GOPA 3G4SA 5DLQE 4B3RQ 4A3DG 1SLJA 2HHHL 3UDGA 1WCMG 2JEAI 1QZHA 4OWWB 1O7IA 1TXYA 4AQYQ 2QEXA 1SE8A 3AYHB 1K73C 3FHWA 2PNHA 2NZHA 2JA7H 1ASYA 5IP9H 1QVGA 4JV5L 4JI8L 1VQ8A 1YHQA 3OTOL 3HKZE 4PZ8A 5AJ3L 5JJKA 3M4QA 1VQBA 4DNIA 2PMZE 3CF5A 4L5RC 4OXPA 3ULLA 3GTJH 2F4VL 4A3CH 1PH1A 2VUMH 3M85A 4UPAA 3CP0A 3G71A 3K7UC 3CMEA 4JI6L 2JA6H 2A19A 2B29A 3PO2G 1T9HA 3KJOA 4LUZA 1XJVA 5GROA 2ASBA 3BJUA 1QVFA 2VQEL 2N49A 1HR0Q 2AHOB 4QGUA 1VQ5A 2MFIA 4RG1A 4DV3L 4IPHA 1N8RC 3TEHB 4DV1L 3JC66 4GKKQ 3PUWA 2NZOA 4BY1H 2LXJA 3GD7A 3F2CA 2CFMA 2R7ZG 1V9PA 2K5HA 3K7AH 1VQJA 3GDEA 4DV4Q 4HIKA 3ULPA 2MO1A 2UXBQ 3PO3H 2PQAB 1N33L 3H3VH 4UP7A 2R92H 3AFPA 3EBEA 3HOYH 1X3GA 4JYAQ 1A62A 4YCWA 4GOPC 4DV0L 1W3SA 3BZKA 1C0AA 1C7YA 3F8TA 3S1RH 4JOIA 2ES2A 2K5NA 4X64Q 5IYDG 1GO3E 1XNQQ 1VQ6A 1VQIA 3HOZG 1FJGL 1BKBA 5HY6A 2F4VQ 1AE2A 1X54A 1XNRL 4JI7L 5M5YH 1KXLA 2UU9Q 1WFQA 1RIPA 4QIWE 4POFA 4L5SA 1VS0A 2L15A 4DV6Q 3FKIH 3T1HL 4JI6Q 1JJCB 5IP7H 3E0EA 3H0GH 4YHHQ 2ALYB 4DR7Q 4OO1G 2JQOA 3STBD 3RR5A 2ZM6Q 2Y0SE 1Y1VH 3HOVH 1XMOL 3MXNB 1E3PA 2BA1A 4B3SL 1MIUA 4AYBG 4O2DA 2E2JH 4C3HH 1IBLL 2JK8A 1HZCA 1TWCH 5GAHC 5IE8A 2H5XA 4A3JH 4LFCQ 4PZ7A 3HOUG 2I5HA 4NB3A 1VQHA 3NELA 3T1YL 4NPSA 1IZ6A 5FJ8G 1RL2A 4A93G 1N33Q 1Q46A 1X56A 3GTMH 1N32Q 4O0AA 2IT1A 2LSSA 1E24A 4JBWA 2ZJRA 5LMNW 4GS3A 4B3TL 3CCSA 2E5LL 1K83H 2I5LX 2DUDA 1NJIC 1HNXQ 4DK3C 1X65A 2K4KA 1SRUA 4JOIC 4WJ4A 3OYYA 4R4IA 4LFAQ 4X65L 4DAMA 2UUAL 4GNXC 4A3GG 1A63A 3PGZA 1G6PA 1UE7A 3RLOA 1SR3A 1XNRQ 1CKNB 2KHJA 2Q2IA 1S40A 2MQHA 1VQKA 2UUCQ 4C3IH 2WAQG 1XPOA 3SGIA 1R9TH 1QVCA 3M7NA 1VQAA 4UP9A 3TQYA 4DV2Q 1X9NA 3I4OA 4LF9L 1YVCA 2HQLA 1N36Q 3GO5A 5E7NA 1VCIA 4JI3L 5M3FH 2PQAA 4OO1I 1CUKA 3J81i 2YTYA 5C4XH 5H1SE 2F3IA 4DV5L 4AH6A 1N34L 1ASZA 5IYCH 1IXRA 1HNWQ 4A3EG 3CCJA 3ICEA 2ZJPA 3PF5A 4NXML 4A3LG 1YHBA 3I56A 1JB7A 3S14H 3M9BA 1HR0W 3NEMA 4YWLA 3J80c 4DPGA 1KC8C 2UXCQ 2A8VA 4X66L 4LF8L 3S1NH 4DV7Q 4GLAC 4B3TQ 3B6YA 4RMFA 3EN2A 5M3MG 2B3GA 1JE5A 4X62L 1IBKL 1HNZQ 3UE0A 1VQ4A 2K5VA 4DR6Q 4GKJL 3GTLH 3HOWH 1GM5A 4A3DH 4JC0A 2UUAQ 3I4NH 1GD7A 4JI4L 3M4OH 4DR1Q 4ALPA 1I3QH 4PG3A 4LNQA 4L5QA 1L2FA 2K52A 3J7ZC 4R4QA 4UY8C 3BZCA 5LMUL 2B63H 2LXKA 5M5WH 4A3BH 4DR3L 2KCMA 2K50A 4PMWA 1VQLA 4AYBE 2UXDL 5BR8L 2I5MX 4DV5Q 4GN4B 2ZTEA 2JA8H 1N34Q 4IO9A 3S1QH 3A5UA 3S2HH 1FGUA 1SROA 3RZDH 4DR4Q 1NMFA 2MNAA 2JEBI 4QL5A 3HFZB 4YY3L 5C44H 3WWVA 4JI2Q 3JAMi 4KHPQ 2VL6A 4BBRH 1J5EQ 4TVAB 4XTCS 4GLXA 2DGYA 2ID0A 1CKNA 2GVAA 4DUYQ 1Y14B 2FXQA 4BA2I 1KRSA 2VQFQ 4JBMA 4QQBX 2R7ZH 2ZTCA 4A3KG 1XMQL 2IHFA 2CKZB 4QJFA 3J81j 5IP9G 1SMXA 4DUZQ 4P74A 3PSIA 4JI4Q 1I94L 4HIDA 3U58A 3DM3A 4A3CG 4HJ7A 2VNUD 2HHHQ 4BXXG 1C9OA 4LFBL 4YCVA 3VDYA 1TWGH 4C2MH 2WB1E 4YWMA 1PH8A 2VY3A 2NVXH 1TWAH 1OXSC 5LMUQ 1N9WA 4A75A 2JA9A 4DR3Q 2OCEA 3D31A 3L2PA 4JV5Q 4KI0A 2D0OA 4JI8Q 2UXDQ 4OWXB 3OTOQ 5AJ3Q 1VQ9A 5GAEC 2E2HH 2D0PA 1SFOH 2EXDA 1MJCA 5GQOA 1YITA 3G48A 4BY1G 1A8VA 4BBSG 4JI0L 2HT1A 2R7FA 2IX1A 1WOCA 3PO3G 4TQUS 2ZTDA 1Q8KA 2Q2UA 3S24A 2R92G 1PHJA 3F2DA 2VQEQ 2N78A 1KIXA 3KFUA 1YZ6A 4Y7NH 3Q8DA 4DV3Q 2D62A 4DV1Q 1KHIA 4R4CA 1GVPA 4OX9L 1XMQQ 4YCUA 5FJ8H 3CW2C 4LF6L 2OQKA 2ZJQA 5EAYA 2N3SA 5IWAL 5IYBG 3GTPH 4HJAA 2VZAA 1VQDA 2R93H 3AEVA 1KRTA 1I5FA 3PIPA 1YIJA 1HZ9A 1L1OA 1PA6A 5FLMH 1KAWA 1CKMA 4GN5A 4DV0Q 1IBML 4BA1I 4B3ML 1JJGA 1UEBA 4K0KL 3I7FA 3ER0A 2HIVA 1NTGA 4A3FG 3S2DH 5IP7G 4JBKA 2R7DA 3U4VA 4LF4L 3TRZA 1AE3A 2KENA 2Z0SA 2RF4A 2KHIA 3UE1A 1Y1VG 1Q1EA 3HKZG 5C3EH 2YU9H 1FJGQ 4IJHA 3CXCA 2XTIA 4A3MH 4JI7Q 4GN3B 4JI5L 1YJWA 3S1MH 2Q2HA 3CCRA 1LTLA 1X55A 2UUBL 4IPCA 2V1CC 4LF7L 3KOJA 3T1HQ 3NBHB 5ELNA 2Q2TA 4JI0Q 3TS2A 1EIFA 2PI2E 2RCNA 3AFQA 4P73A 3H3VI 1EQRA 2GVBA 4DR2L 1Z9FA 1MJEA 3PIOA 1VQ7A 4P71A 5C0XJ 1CSPA 2YTXA 1Y1WG 3OW2A 4JBJA 1XMOQ 4B3SQ 4X6AH 4A3LH 1J6QA 1D7QA 4R4OA 3U50C 1E22A 3IRBA 4LW1A 4C3JH 5IT9c 1IBLQ 3PV0A 1NY4A 2RHSB 1IL2A 2AMCB 1JJ2A 2EIFA 2AWNA 5IWAQ 1YEZA 5J3BA 3J81c 3T1YQ 2JA5H 4B3RL 1B70B 4A3IG 1X6OA 5M3MH 3D0FA 4DR5L 2OTJA 1DGSA 3S17H 3CCMA 1Q1BA 3ZJYC 2YTVA 1IBMQ 2E5LQ 2E8GA 1I50H 3PUZA 4APVA 1NBWA 3W5OA 1FL0A 1Q86C 2GN5A 1X3FA 4DKAC 5M3FG 3RN2A 3CCLA 2I0QA 3EIVA 1U0LA 4X65Q 1PH6A 1B8AA 1WCMH 1Z47A 3F2BA 5IYCG 3CCEA 3CQZH 2WFWA 4POGA 3PF4A 3M3YH 1S72A 2BA0A 1XTDA 1LYLA 4LF9Q 1H95A 1PYBA 3KF8B 3A5ZB 2YV5A 4P72A 4A4IA 4HJ8A 1HR0L 4JI3Q 3MEFA 1WI5A 1X3EA 1K0RA 2Y0SG 3A74A 3K8AA 4PZ6A 2NN6G 5M5XH 1L1OB 4GKKL 3HOXG 2HIXA 1PYSB 2PI2A 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  1MKH A;  4DV4 L;  4UP8 A;  4LF5 L;  2UXB L;  4NXM Q;  3PO2 H;  2JE6 I;  4KLK A;  2YYZ A;  4IOA A;  1QUQ B;  1IYJ B;  3I4M G;  2OTL A;  3HOW G;  2RHQ B;  1D8L A;  3ERS X;  3GTG H;  3I4N G;  4BY7 G;  4JYA L;  1PH4 A;  3PUY A;  5K36 G;  3KDF A;  2NVT H;  4X66 Q;  4LF8 Q;  4A3K H;  4DR5 Q;  5JEA G;  4X64 L;  1UE1 A;  1IBK Q;  4X62 Q;  1Q81 C;  3JAM c;  1PV4 A;  3PCO B;  1XNQ L;  4GKJ Q;  2B63 G;  2MO0 A;  4A3B G;  2JA7 G;  3KYH C;  3CC7 A;  1L0W A;  3TS0 A;  4BXX H;  2JA8 G;  1BVS A;  1YNX A;  4IOC A;  2UU9 L;  2QGQ A;  2WAQ E;  1K3R A;  3I55 A;  2NVQ H;  4QY7 A;  1QZG A;  2VUM G;  4DV6 L;  1HZB A;  1OXU A;  2C35 B;  5IYD H;  4R1J A;  4YHH L;  5FLX c;  1I6H H;  4DR7 L;  1BBW A;  1AH9 A;  4A76 A;  5JEA J;  1K9M C;  5C44 G;  2JA6 G;  3RLF A;  2ZM6 L;  3HOZ H;  4MTN A;  5HGQ A;  5C4J H;  4BBR G;  1VQC A;  5BR8 Q;  3CCU A;  1TWH H;  2NN6 I;  3CAM A;  2XGT A;  4LFC L;  1G51 A;  1OXV A;  1VQP A;  2OWO A;  4BBS H;  1EYG A;  4LF5 Q;  4IJL A;  3GTQ H;  3KF6 A;  4EX5 A;  4IFD G;  3BU2 A;  4YY3 Q;  2BH8 A;  1WJJ A;  4OON A;  1K8G A;  1VQN A;  1N32 L;  4HIM A;  1GKH A;  1SN8 A;  1K8A C;  2IHE A;  1M1K C;  2EQS A;  3K81 C;  2KCT A;  4LUV A;  3UDI A;  3CPW A;  3FP9 A;  3HOY G;  3F1Z A;  1PVO A;  2F52 A;  4P75 A;  1PH3 A;  1E7Z A;  4NXN L;  1HZA A;  2CWP A;  4GNX A;  1HNX L;  1YBY A;  1BBU A;  3HOU H;  4JI1 L;  1KL9 A;  5IYB H;  4MNO A;  2JJQ A;  1VQG A;  1EQQ A;  1OTC A;  1A0I A;  4LFA L;  3U4Z A;  1NMG A;  4A93 H;  5IY0 A;  1LUZ A;  1JMC A;  1VQM A;  1Q12 A;  3S15 H;  2UUC L;  3DLL A;  3K80 C;  1I94 Q;  1OXX K;  1XPR A;  1PH7 A;  4IFD J;  2CCZ A;  2IY5 B;  4XIG S;  4LFB Q;  4WJ3 M;  4DV2 L;  4A3F H;  1PH2 A;  1N36 L;  1OXT A;  3AQQ A;  4DK6 C;  3K0X A;  4AIM A;  1QUQ A;  3FKI G;  4YWK A;  3KJP A;  2IX0 A;  4A3G H;  4GOP B;  1HH2 P;  3L7Z C;  3W1B A;  3H0G G;  5JJI A;  5C0X G;  4HIO A;  1Q7Y C;  1HNW L;  3HOV G;  3I2Z A;  3KDF B;  1PFS A;  2QA4 A;  4HJ9 A;  1EFW A;  3GTO H;  1UWV A;  3CCQ A;  3KLW A;  5GAG C;  4H02 A;  4A3J G;  2UXC L;  3CPF A;  4IFD I;  3HKS A;  4R4T A;  2R93 G;  3GTK H;  3RLN A;  2Z6K A;  4DV7 L;  1Y1W H;  2BH2 A;  1W2B A;  2ATW A;  2E2I H;  4GLV B;  3A0J A;  3STB C;  1JT8 A;  5FLM G;  4OWT B;  3CCV A;  1B7Y B;  1UE6 A;  4IPD A;  4A3E H;  1HNZ L;  4DR6 L;  4NXN Q;  2N8N A;  3L0O A;  5LMN L;  1HJP A;  1NE3 A;  1E1T A;  1G29 1;  4OX9 Q;  3UDX A;  3CC2 A;  4JI1 Q;  1YI2 A;  1LM0 A;  1UE5 A;  1YJN A;  3W1G A;  4LF6 Q;  2VW9 A;  4A3I H;  2CWA A;  1YHA A;  3TRE A;  5ELO A;  4DR1 L;  4MZ9 A;  1PH9 A;  3CC4 A;  1P16 A;  2NVY H;  3CD6 A;  3ULJ A;  5C3E G;  2AWO A;  3RZO H;  3UDF A;  4A3M G;  4AQY L;  1WYD A;  1VQE A;  1L1O C;  4B3M Q;  3G6E A;  4K0K Q;  4LWC A;  2WB1 G;  2AKW B;  4J15 A;  3H15 A;  1EIY B;  2VS1 A;  4FDB A;  3KF6 B;  3PUV A;  3J80 i;  1VQO A;  1KQS A;  5C0X I;  4JCV E;  2R6G A;  4LF4 Q;  1CKO A;  4DAY B;  3RN5 A;  5C4X G;  1M90 C;  2WP8 J;  1EUJ A;  1S3O A;  1VQF A;  1TWF H;  2K75 A;  4JI5 Q;  1U5K A;  4DR4 L;  3E9I A;  1FVI A;  4GNX B;  1PH5 A;  2UUB Q;  4JI2 L;  3NEN A;  2OQ0 A;  4KHP L;  4LF7 Q;  4JG2 A;  3PUX A;  4L5T A;  4EQ5 A;  1J5E L;  2JA5 G;  5JJL A;  3M4P A;  2KBN A;  3S16 H;  4ME3 A;  4DR2 Q;  4LUO A;  3HOX H;  3E9H A;  4DUY L;  3J7A 5;  4Y52 H;  2VQF L;  1EOV A;  5GAD C;  1V43 A;  1V1Q A;  3LGJ A;  1XPU A;  2Z6K C;  4HJ5 A;  5LMN Q;  1CSQ A;  2A1A A;  4IPG A;  2CQO A;  3RNU A;  2K14 A;  3I4M H;  4DUZ L;  4BY7 H;  1EWI A;  3CMA A;  1YJ9 A;  1P8L A;  1KD1 C;  4KHZ A;  4GOP A;  3G4S A;  5DLQ E;  4B3R Q;  4A3D G;  1SLJ A;  2HHH L;  3UDG A;  1WCM G;  2JEA I;  1QZH A;  4OWW B;  1O7I A;  1TXY A;  4AQY Q;  2QEX A;  1SE8 A;  3AYH B;  1K73 C;  3FHW A;  2PNH A;  2NZH A;  2JA7 H;  1ASY A;  5IP9 H;  1QVG A;  4JV5 L;  4JI8 L;  1VQ8 A;  1YHQ A;  3OTO L;  3HKZ E;  4PZ8 A;  5AJ3 L;  5JJK A;  3M4Q A;  1VQB A;  4DNI A;  2PMZ E;  3CF5 A;  4L5R C;  4OXP A;  3ULL A;  3GTJ H;  2F4V L;  4A3C H;  1PH1 A;  2VUM H;  3M85 A;  4UPA A;  3CP0 A;  3G71 A;  3K7U C;  3CME A;  4JI6 L;  2JA6 H;  2A19 A;  2B29 A;  3PO2 G;  1T9H A;  3KJO A;  4LUZ A;  1XJV A;  5GRO A;  2ASB A;  3BJU A;  1QVF A;  2VQE L;  2N49 A;  1HR0 Q;  2AHO B;  4QGU A;  1VQ5 A;  2MFI A;  4RG1 A;  4DV3 L;  4IPH A;  1N8R C;  3TEH B;  4DV1 L;  3JC6 6;  4GKK Q;  3PUW A;  2NZO A;  4BY1 H;  2LXJ A;  3GD7 A;  3F2C A;  2CFM A;  2R7Z G;  1V9P A;  2K5H A;  3K7A H;  1VQJ A;  3GDE A;  4DV4 Q;  4HIK A;  3ULP A;  2MO1 A;  2UXB Q;  3PO3 H;  2PQA B;  1N33 L;  3H3V H;  4UP7 A;  2R92 H;  3AFP A;  3EBE A;  3HOY H;  1X3G A;  4JYA Q;  1A62 A;  4YCW A;  4GOP C;  4DV0 L;  1W3S A;  3BZK A;  1C0A A;  1C7Y A;  3F8T A;  3S1R H;  4JOI A;  2ES2 A;  2K5N A;  4X64 Q;  5IYD G;  1GO3 E;  1XNQ Q;  1VQ6 A;  1VQI A;  3HOZ G;  1FJG L;  1BKB A;  5HY6 A;  2F4V Q;  1AE2 A;  1X54 A;  1XNR L;  4JI7 L;  5M5Y H;  1KXL A;  2UU9 Q;  1WFQ A;  1RIP A;  4QIW E;  4POF A;  4L5S A;  1VS0 A;  2L15 A;  4DV6 Q;  3FKI H;  3T1H L;  4JI6 Q;  1JJC B;  5IP7 H;  3E0E A;  3H0G H;  4YHH Q;  2ALY B;  4DR7 Q;  4OO1 G;  2JQO A;  3STB D;  3RR5 A;  2ZM6 Q;  2Y0S E;  1Y1V H;  3HOV H;  1XMO L;  3MXN B;  1E3P A;  2BA1 A;  4B3S L;  1MIU A;  4AYB G;  4O2D A;  2E2J H;  4C3H H;  1IBL L;  2JK8 A;  1HZC A;  1TWC H;  5GAH C;  5IE8 A;  2H5X A;  4A3J H;  4LFC Q;  4PZ7 A;  3HOU G;  2I5H A;  4NB3 A;  1VQH A;  3NEL A;  3T1Y L;  4NPS A;  1IZ6 A;  5FJ8 G;  1RL2 A;  4A93 G;  1N33 Q;  1Q46 A;  1X56 A;  3GTM H;  1N32 Q;  4O0A A;  2IT1 A;  2LSS A;  1E24 A;  4JBW A;  2ZJR A;  5LMN W;  4GS3 A;  4B3T L;  3CCS A;  2E5L L;  1K83 H;  2I5L X;  2DUD A;  1NJI C;  1HNX Q;  4DK3 C;  1X65 A;  2K4K A;  1SRU A;  4JOI C;  4WJ4 A;  3OYY A;  4R4I A;  4LFA Q;  4X65 L;  4DAM A;  2UUA L;  4GNX C;  4A3G G;  1A63 A;  3PGZ A;  1G6P A;  1UE7 A;  3RLO A;  1SR3 A;  1XNR Q;  1CKN B;  2KHJ A;  2Q2I A;  1S40 A;  2MQH A;  1VQK A;  2UUC Q;  4C3I H;  2WAQ G;  1XPO A;  3SGI A;  1R9T H;  1QVC A;  3M7N A;  1VQA A;  4UP9 A;  3TQY A;  4DV2 Q;  1X9N A;  3I4O A;  4LF9 L;  1YVC A;  2HQL A;  1N36 Q;  3GO5 A;  5E7N A;  1VCI A;  4JI3 L;  5M3F H;  2PQA A;  4OO1 I;  1CUK A;  3J81 i;  2YTY A;  5C4X H;  5H1S E;  2F3I A;  4DV5 L;  4AH6 A;  1N34 L;  1ASZ A;  5IYC H;  1IXR A;  1HNW Q;  4A3E G;  3CCJ A;  3ICE A;  2ZJP A;  3PF5 A;  4NXM L;  4A3L G;  1YHB A;  3I56 A;  1JB7 A;  3S14 H;  3M9B A;  1HR0 W;  3NEM A;  4YWL A;  3J80 c;  4DPG A;  1KC8 C;  2UXC Q;  2A8V A;  4X66 L;  4LF8 L;  3S1N H;  4DV7 Q;  4GLA C;  4B3T Q;  3B6Y A;  4RMF A;  3EN2 A;  5M3M G;  2B3G A;  1JE5 A;  4X62 L;  1IBK L;  1HNZ Q;  3UE0 A;  1VQ4 A;  2K5V A;  4DR6 Q;  4GKJ L;  3GTL H;  3HOW H;  1GM5 A;  4A3D H;  4JC0 A;  2UUA Q;  3I4N H;  1GD7 A;  4JI4 L;  3M4O H;  4DR1 Q;  4ALP A;  1I3Q H;  4PG3 A;  4LNQ A;  4L5Q A;  1L2F A;  2K52 A;  3J7Z C;  4R4Q A;  4UY8 C;  3BZC A;  5LMU L;  2B63 H;  2LXK A;  5M5W H;  4A3B H;  4DR3 L;  2KCM A;  2K50 A;  4PMW A;  1VQL A;  4AYB E;  2UXD L;  5BR8 L;  2I5M X;  4DV5 Q;  4GN4 B;  2ZTE A;  2JA8 H;  1N34 Q;  4IO9 A;  3S1Q H;  3A5U A;  3S2H H;  1FGU A;  1SRO A;  3RZD H;  4DR4 Q;  1NMF A;  2MNA A;  2JEB I;  4QL5 A;  3HFZ B;  4YY3 L;  5C44 H;  3WWV A;  4JI2 Q;  3JAM i;  4KHP Q;  2VL6 A;  4BBR H;  1J5E Q;  4TVA B;  4XTC S;  4GLX A;  2DGY A;  2ID0 A;  1CKN A;  2GVA A;  4DUY Q;  1Y14 B;  2FXQ A;  4BA2 I;  1KRS A;  2VQF Q;  4JBM A;  4QQB X;  2R7Z H;  2ZTC A;  4A3K G;  1XMQ L;  2IHF A;  2CKZ B;  4QJF A;  3J81 j;  5IP9 G;  1SMX A;  4DUZ Q;  4P74 A;  3PSI A;  4JI4 Q;  1I94 L;  4HID A;  3U58 A;  3DM3 A;  4A3C G;  4HJ7 A;  2VNU D;  2HHH Q;  4BXX G;  1C9O A;  4LFB L;  4YCV A;  3VDY A;  1TWG H;  4C2M H;  2WB1 E;  4YWM A;  1PH8 A;  2VY3 A;  2NVX H;  1TWA H;  1OXS C;  5LMU Q;  1N9W A;  4A75 A;  2JA9 A;  4DR3 Q;  2OCE A;  3D31 A;  3L2P A;  4JV5 Q;  4KI0 A;  2D0O A;  4JI8 Q;  2UXD Q;  4OWX B;  3OTO Q;  5AJ3 Q;  1VQ9 A;  5GAE C;  2E2H H;  2D0P A;  1SFO H;  2EXD A;  1MJC A;  5GQO A;  1YIT A;  3G48 A;  4BY1 G;  1A8V A;  4BBS G;  4JI0 L;  2HT1 A;  2R7F A;  2IX1 A;  1WOC A;  3PO3 G;  4TQU S;  2ZTD A;  1Q8K A;  2Q2U A;  3S24 A;  2R92 G;  1PHJ A;  3F2D A;  2VQE Q;  2N78 A;  1KIX A;  3KFU A;  1YZ6 A;  4Y7N H;  3Q8D A;  4DV3 Q;  2D62 A;  4DV1 Q;  1KHI A;  4R4C A;  1GVP A;  4OX9 L;  1XMQ Q;  4YCU A;  5FJ8 H;  3CW2 C;  4LF6 L;  2OQK A;  2ZJQ A;  5EAY A;  2N3S A;  5IWA L;  5IYB G;  3GTP H;  4HJA A;  2VZA A;  1VQD A;  2R93 H;  3AEV A;  1KRT A;  1I5F A;  3PIP A;  1YIJ A;  1HZ9 A;  1L1O A;  1PA6 A;  5FLM H;  1KAW A;  1CKM A;  4GN5 A;  4DV0 Q;  1IBM L;  4BA1 I;  4B3M L;  1JJG A;  1UEB A;  4K0K L;  3I7F A;  3ER0 A;  2HIV A;  1NTG A;  4A3F G;  3S2D H;  5IP7 G;  4JBK A;  2R7D A;  3U4V A;  4LF4 L;  3TRZ A;  1AE3 A;  2KEN A;  2Z0S A;  2RF4 A;  2KHI A;  3UE1 A;  1Y1V G;  1Q1E A;  3HKZ G;  5C3E H;  2YU9 H;  1FJG Q;  4IJH A;  3CXC A;  2XTI A;  4A3M H;  4JI7 Q;  4GN3 B;  4JI5 L;  1YJW A;  3S1M H;  2Q2H A;  3CCR A;  1LTL A;  1X55 A;  2UUB L;  4IPC A;  2V1C C;  4LF7 L;  3KOJ A;  3T1H Q;  3NBH B;  5ELN A;  2Q2T A;  4JI0 Q;  3TS2 A;  1EIF A;  2PI2 E;  2RCN A;  3AFQ A;  4P73 A;  3H3V I;  1EQR A;  2GVB A;  4DR2 L;  1Z9F A;  1MJE A;  3PIO A;  1VQ7 A;  4P71 A;  5C0X J;  1CSP A;  2YTX A;  1Y1W G;  3OW2 A;  4JBJ A;  1XMO Q;  4B3S Q;  4X6A H;  4A3L H;  1J6Q A;  1D7Q A;  4R4O A;  3U50 C;  1E22 A;  3IRB A;  4LW1 A;  4C3J H;  5IT9 c;  1IBL Q;  3PV0 A;  1NY4 A;  2RHS B;  1IL2 A;  2AMC B;  1JJ2 A;  2EIF A;  2AWN A;  5IWA Q;  1YEZ A;  5J3B A;  3J81 c;  3T1Y Q;  2JA5 H;  4B3R L;  1B70 B;  4A3I G;  1X6O A;  5M3M H;  3D0F A;  4DR5 L;  2OTJ A;  1DGS A;  3S17 H;  3CCM A;  1Q1B A;  3ZJY C;  2YTV A;  1IBM Q;  2E5L Q;  2E8G A;  1I50 H;  3PUZ A;  4APV A;  1NBW A;  3W5O A;  1FL0 A;  1Q86 C;  2GN5 A;  1X3F A;  4DKA C;  5M3F G;  3RN2 A;  3CCL A;  2I0Q A;  3EIV A;  1U0L A;  4X65 Q;  1PH6 A;  1B8A A;  1WCM H;  1Z47 A;  3F2B A;  5IYC G;  3CCE A;  3CQZ H;  2WFW A;  4POG A;  3PF4 A;  3M3Y H;  1S72 A;  2BA0 A;  1XTD A;  1LYL A;  4LF9 Q;  1H95 A;  1PYB A;  3KF8 B;  3A5Z B;  2YV5 A;  4P72 A;  4A4I A;  4HJ8 A;  1HR0 L;  4JI3 Q;  3MEF A;  1WI5 A;  1X3E A;  1K0R A;  2Y0S G;  3A74 A;  3K8A A;  4PZ6 A;  2NN6 G;  5M5X H;  1L1O B;  4GKK L;  3HOX G;  2HIX A;  1PYS B;  2PI2 A;  1Q82 C; 
#chains in the Genus database with same CATH topology
 1MKH A;  3K6O A;  4IUU A;  4NXM Q;  3PO2 H;  2UXB L;  3HOW G;  2OTL A;  4OEL B;  1I4R A;  3ERS X;  3I4N G;  1MGS A;  3T53 B;  4M8A A;  5KNC A;  2WB1 B;  4X66 Q;  1MD2 D;  3FPU B;  5IGF A;  4X64 L;  3ITP A;  1W6K A;  2JA7 G;  3KYH C;  3R93 A;  1BVS A;  4IOC A;  1F9Q A;  2QGQ A;  2LS0 1;  2WAQ E;  1QZG A;  2VUM G;  2HDL A;  4R1J A;  4YHH L;  4DR7 L;  1BBW A;  5ELC A;  1RTO A;  3RLF A;  2JYO A;  2XGT A;  1VQP A;  1KLU D;  2B2U C;  2CH4 A;  2B2T A;  4IJL A;  4OO1 H;  2QCP X;  3D4R A;  1VQN A;  1WJJ A;  1N32 L;  3KUP A;  4LAA A;  3K57 A;  1K8A C;  3K81 C;  1HFG A;  3DWA A;  1PVO A;  3CPW A;  2F52 A;  1PH3 A;  1F2Y A;  1EEI D;  4NXN L;  1HZA A;  2F0H A;  1HNX L;  2RDH A;  1KL9 A;  4LFA L;  1D1K A;  3U4Z A;  1NMG A;  5IY0 A;  2F03 A;  1JMC A;  3J81 E;  1LT4 D;  3KLS A;  1VQM A;  3S15 H;  1STE A;  5KYL A;  1I94 Q;  4KY5 A;  4XIG S;  4KV6 A;  4WJ3 M;  3MZ5 A;  1N36 L;  3K0X A;  5C0X G;  4L8J A;  1Q7Y C;  4BS9 A;  2A6H D;  3KDF B;  2F3V A;  4HJ9 A;  1EFW A;  4DNR B;  3GTO H;  4Q0F A;  1UAP A;  3CCQ A;  5GAG C;  4H02 A;  3CPF A;  4DGZ A;  4DV7 L;  1G2T A;  1S5D D;  2EJG C;  3GV6 A;  1JT8 A;  1X3P A;  3CHB D;  1HJP A;  1NE3 A;  1Q8I A;  2CVR A;  3W1G A;  4A3I H;  3TRE A;  3OOC A;  2KVM A;  1PH9 A;  1NR2 A;  2FHT A;  4H13 C;  2MHV A;  5C3E G;  3CRK C;  2AWO A;  1GOZ A;  2KA7 A;  1L1O C;  4C3I G;  4B3M Q;  4LWC A;  2VXW A;  2PCF B;  4FDB A;  1KQS A;  4JCV E;  4DAY B;  4FF4 A;  5C4X G;  2F0O A;  5I2X A;  2K75 A;  1U5K A;  1CQV A;  4I7A A;  2F0J A;  4GNX B;  3SVM A;  4KHP L;  4JG2 A;  4RH6 A;  4E6I A;  2KEC A;  2JA5 G;  3VR5 A;  5JJL A;  4TKO B;  3M4P A;  2EZV A;  4ME3 A;  4DUY L;  3J7A 5;  1EOV A;  1EL0 A;  3SR1 A;  5LMN Q;  4H7B A;  5E3F A;  2CQO A;  3RNU A;  1S5E D;  3N6R A;  5EBC A;  4DN4 M;  3ONA B;  1VMP A;  3G4S A;  2WAQ B;  3TP6 A;  2CH4 W;  3UDG A;  3GTO B;  1WCM G;  2JEA I;  5I6Y A;  5LHY 1;  1SE8 A;  1A3T A;  2PNH A;  2JA7 H;  1ASY A;  1VQ8 A;  2EYL A;  1YHQ A;  1HCZ A;  3HKZ E;  5AJ3 L;  1F77 A;  1DZ1 A;  5IIF A;  2VUM H;  1ICW A;  4ZUI A;  4A3I B;  3CP0 A;  3BYY B;  3C46 A;  2K32 A;  5GRO A;  4RWS C;  2VQE L;  3CRL C;  4GZY C;  2AHO B;  2MFI A;  4IPH A;  3QOL A;  3JC6 6;  2NZO A;  1SNC A;  1LT3 D;  3F2C A;  2EYJ A;  2CFM A;  4QF4 A;  2K5H A;  4DV4 Q;  2MO1 A;  3T13 A;  1N33 L;  3H3V H;  4UP7 A;  2A73 B;  5CV5 A;  3K5N A;  2Q8R E;  4GOP C;  2PNR C;  4KY6 A;  2Z4I A;  1C0A A;  2K33 A;  3S1R H;  1PFN A;  2ES2 A;  5IGE A;  2XWB B;  2K5N A;  3NQT A;  1QE6 A;  4KKS A;  1VQ6 A;  1FJG L;  1BKB A;  2G9D A;  5HY6 A;  3HP3 A;  5M5Y H;  2A68 C;  3HOW B;  3MHB A;  4DV6 Q;  1PTO H;  3T1H L;  1JJC B;  3FEW X;  4X3S A;  5IP7 H;  5C0X H;  1QCB D;  1EWH A;  3RR5 A;  4FXD A;  1Y1V H;  3VA5 A;  4QCL A;  3MXN B;  1MIU A;  4AYB G;  3J81 L;  2JA7 B;  2LFN A;  2JK8 A;  2H5X A;  4X3U A;  4KHV A;  4NB3 A;  3H3V C;  1VQH A;  3S1Q B;  4J1M A;  4NPS A;  2EYF A;  2VUM B;  3DUZ A;  1Q46 A;  3M7G A;  3QB3 A;  4RCO A;  1E24 A;  4JBW A;  2GA4 B;  2QF7 A;  3CCS A;  1F9R A;  5ELB A;  2DUD A;  1NJI C;  2AQ1 B;  2WIN B;  4XQJ A;  1WTV A;  1JWU D;  4R4I A;  2Q8T A;  1UE7 A;  2J7Z A;  3RLO A;  1XNR Q;  1A2U A;  2KHJ A;  2Q2I A;  2UUC Q;  1PTO C;  3MXG A;  4C3I H;  1R9T H;  3TQY A;  1X9N A;  1YVC A;  5M3F H;  2PQA A;  2NWG A;  5C4X H;  1N34 L;  3GV3 A;  1IXR A;  4LJZ C;  1EIH A;  4A3E G;  2B2W C;  4FVM A;  3FPP A;  3PF5 A;  2A74 C;  2AQ2 B;  4C3J G;  1HR0 W;  4YWL A;  5M5Y B;  4NP5 A;  4DPG A;  2B2V C;  2UXC Q;  2EXZ A;  2A8V A;  3HGB A;  1GUN A;  2D9U A;  1F2L A;  2YU9 H;  3EN2 A;  5M3M G;  1JE5 A;  4Z9C B;  1VQ4 A;  2K5V A;  2WAC A;  3HKZ B;  4K5V A;  1EU3 A;  3GTL H;  1IW7 C;  2F3W A;  5IGD A;  2Z4H A;  5K36 H;  5CBE E;  1SJH D;  2AQ3 B;  1L0X B;  3D6W A;  1DYQ A;  3D4W A;  3NK9 A;  2QW7 A;  3SK8 A;  1MSG A;  4LNQ A;  3BDO A;  4ULL A;  5JEA H;  1L2F A;  2K52 A;  4RGN A;  3J7Z C;  3V2T A;  1SDF A;  2B63 H;  2LXK A;  1QNK A;  1TR5 A;  4JW0 A;  4MIU A;  4A3B H;  2K05 A;  4AYB E;  1FNW A;  2JA8 H;  3D6C A;  3NP8 A;  3NWS A;  3A5U A;  3S2H H;  1FGU A;  5C3E B;  2FFK B;  2JEB I;  4YY3 L;  5C44 H;  3JAM i;  4EQN A;  1HUN A;  1ML0 D;  4C3I B;  1R4Q B;  4TVA B;  2ID0 A;  1Y14 B;  2JXM B;  5M3F B;  2VQF Q;  4QQB X;  3MVV A;  5DM6 3;  5C4X B;  5KNB A;  1GJX A;  3IFT A;  3J81 j;  1NCV A;  1SMX A;  2A68 D;  1CT1 D;  4CBV A;  4HID A;  2B39 A;  3TDQ A;  2JA5 B;  1BBX C;  1TWG H;  4CKB A;  3HEJ A;  2PQE A;  2VY3 A;  1TWA H;  4OHJ A;  3MAQ A;  5LMU Q;  2JA9 A;  5C3X A;  4DR3 Q;  3CKI B;  4KI0 A;  2YU9 B;  4OWX B;  1H9M A;  1R4P B;  2RA4 A;  2N88 A;  2HD3 A;  4K6L A;  3TN2 A;  2D0P A;  3GTL B;  1SFO H;  1MJC A;  2L11 A;  5GQO A;  4BY1 G;  1WCM B;  1SSO A;  3K5L A;  1EYA A;  3Q22 A;  2SEB D;  2IX1 A;  5BN5 A;  4TQU S;  2Q2U A;  2R92 G;  5DNF A;  1KIX A;  4I7Z C;  3NWT A;  5JJZ A;  4DV1 Q;  4RGO S;  4R4C A;  1STH A;  2B2Y C;  5IT9 E;  5IOC A;  4YCU A;  3CW2 C;  5IWA L;  5IYB G;  1WTX A;  2EOT A;  3GTP H;  4HJA A;  5EKK A;  1VQD A;  3V05 A;  3PIP A;  1PTO D;  2L5T A;  1L1O A;  1CKM A;  4ID6 A;  2ZT9 C;  5C44 B;  1SNP A;  4BA1 I;  4K0K L;  2H1E A;  3ER0 A;  4ILW A;  5JVG 3;  3SK4 A;  3V96 A;  3WOE A;  2R7D A;  2X69 A;  4LF4 L;  3P1H A;  3Q6S A;  3TRZ A;  3CU7 A;  1AE3 A;  4FF1 A;  3UE1 A;  2TMP A;  4KTA A;  1ESR A;  1CM9 A;  3CXC A;  4JI5 L;  4LF7 L;  5ELN A;  4JI0 Q;  1EIF A;  4CDF C;  3AFQ A;  4P73 A;  1Z9F A;  1MJE A;  1VF7 A;  3PIO A;  1TWG B;  4F88 A;  1TWA B;  4IUN A;  1XMO Q;  4B3S Q;  4JBJ A;  4CDE C;  1IW7 D;  2EVB A;  3U50 C;  1D7Q A;  1IBL Q;  4C3J H;  5IT9 c;  4RCN A;  1RF2 D;  1JJ2 A;  1E2W A;  2AWN A;  5J3B A;  3T1Y Q;  2N55 A;  2K1B A;  1A6X A;  1SFO B;  3H09 A;  4FF2 A;  5CR3 A;  5M3M H;  1FNU A;  1DCZ A;  1DGS A;  3S17 H;  1PDQ A;  2E5L Q;  2E8G A;  4AYB B;  3PUZ A;  3CCL A;  4DKA C;  1U0L A;  4X65 Q;  1B8A A;  3LX0 A;  3A54 A;  5IYC G;  3CCE A;  3LWE A;  3CQZ H;  4POG A;  3GTP B;  4C56 C;  3MC0 B;  1TII D;  5BN3 A;  1SE4 A;  4IZ8 A;  3EQL C;  5FLX E;  1U4P A;  3A5Z B;  4P72 A;  4HJ8 A;  3MEF A;  5T1I A;  4ZK9 B;  1PZK D;  3K8A A;  4PZ6 A;  5M5X H;  3HOX G;  3NTI A;  3BJU A;  2PI2 A;  1Q82 C;  4UP8 A;  4LF5 L;  3BS1 A;  3ND9 A;  3GTG H;  4BY7 G;  1AN8 A;  3AMU A;  4LK1 C;  4LF8 Q;  2G9H D;  4DR5 Q;  5I9O A;  2E74 C;  1O7Y A;  3PCO B;  1XNQ L;  4GKJ Q;  1LTR D;  4A3E B;  2XIW A;  4U67 3;  3CC7 A;  1EY9 A;  1EWC A;  1MBY A;  4C3J B;  2IWH A;  2HDM A;  2UU9 L;  1CZW A;  1K3R A;  2NVQ H;  2JSO A;  4QY7 A;  1HZB A;  1OXU A;  1HXY D;  5IYD H;  1AH9 A;  5FLX c;  4A76 A;  5M3M B;  1KDC A;  2ZM6 L;  4MTN A;  5HGQ A;  5C4J H;  3S17 B;  5C6A A;  2X6L A;  1TWH H;  4LFC L;  5KIX A;  1OXV A;  1D2B A;  4WFN 3;  3GTQ H;  3KF6 A;  2P5Z X;  1YNJ C;  4IFD G;  3BU2 A;  2BH8 A;  2HCC A;  3CQZ B;  4OON A;  4X3K A;  1SN8 A;  4HAE A;  4WRD A;  3TZU A;  1M1K C;  1SAP A;  2EQS A;  2KCT A;  3TME A;  4P75 A;  1E7Z A;  1YBY A;  4JI1 L;  5IYB H;  5JVH 3;  3GP7 A;  1HQR D;  1M4V A;  4MNO A;  3Q23 A;  1OTC A;  4A93 H;  3KF8 A;  4K2K A;  1LUZ A;  3P20 A;  3R2I A;  5M5X B;  1DM0 B;  2KCC A;  1Q12 A;  3I4L A;  4N9P A;  3DLL A;  3DWP A;  4IFD J;  1PH7 A;  1XPR A;  1JR0 D;  3OSO A;  2IY5 B;  4K14 A;  1HRJ A;  4LFB Q;  2VB2 X;  5EPJ A;  1XXG A;  1LTB D;  1OXT A;  2E2D C;  4YWK A;  4WOR A;  2IX0 A;  1HH2 P;  3L7Z C;  5IT9 L;  3W1B A;  2ICE C;  2HCI A;  1HNW L;  3HOV G;  1BQQ T;  3I2Z A;  1KDA A;  3IL8 A;  2KOL A;  3GTJ B;  1UWV A;  3KLW A;  4A3J G;  4N8F A;  2NVQ B;  2R93 G;  1ENF A;  2Z6K A;  1W2B A;  4QUC A;  1CI3 M;  5CV6 A;  2BDO A;  2ATW A;  3STB C;  5FLM G;  4DR6 L;  1HNZ L;  3VYT A;  4NW2 A;  4NXN Q;  2N8N A;  1E1T A;  4OX9 Q;  1BCP B;  4ZKB B;  2A69 D;  3URY A;  2A6H C;  2VW9 A;  1YHA A;  1TWH B;  4DR1 L;  3I90 A;  4BY1 B;  1EU4 A;  3CC4 A;  1P16 A;  3CD6 A;  3ULJ A;  1GUG A;  4A3M G;  1LV9 A;  4AQY L;  5EGT A;  1SYE A;  2FIN B;  1VQE A;  3A8K E;  2R92 B;  5C3W A;  2OEO A;  2AKW B;  3H15 A;  4HMI A;  2VS1 A;  1VQO A;  5C0X I;  2R6G A;  1I4X A;  1AZQ A;  1M90 C;  1EUJ A;  3VA7 A;  1S3O A;  1TWF H;  4A93 B;  2PYK A;  2XRS D;  1PTO F;  1FVI A;  2UUB Q;  1ILQ A;  4JI2 L;  1EY6 A;  2OQ0 A;  2DY8 A;  4H0L C;  1I4Q A;  1D6E C;  1Z6H A;  1JCK B;  1XWE A;  3HOX H;  2XN9 C;  3LGJ A;  1ZYR C;  1XPU A;  5I9P A;  1CSQ A;  2A1A A;  4IPG A;  4BY7 H;  1EWI A;  1P8L A;  1GUS A;  4B3R Q;  5FLX L;  1SLJ A;  1TQO A;  2HHH L;  1QZH A;  1X3Q A;  1O7I A;  1TXY A;  3DM1 A;  1Q3L A;  5KYI A;  2RKS A;  3AYH B;  1K73 C;  3H6M A;  3FHW A;  1QG7 A;  4EGV A;  4MN3 A;  4JV5 L;  4KD4 A;  4JI8 L;  2KJX A;  1EZ8 A;  5JAV A;  1RHP A;  2J4X A;  4PZ8 A;  1VQB A;  4L5R C;  2F4V L;  1HQM C;  3CF5 A;  4A3C H;  3ULL A;  1PH1 A;  4G7O C;  3M85 A;  1B4O A;  1QJO A;  5FO8 B;  1O80 A;  1EY5 A;  1RTN A;  1YNJ D;  2BDN A;  3CME A;  1BNZ A;  4JI6 L;  2A19 A;  2RQX A;  1T9H A;  1XJV A;  2ASB A;  1GUO A;  5IGG A;  1QVF A;  2N49 A;  2FJ2 A;  1U4L A;  4QGU A;  1N8R C;  3J7A V;  3TEH B;  2XWJ B;  2PW7 A;  4GKK Q;  2VB3 X;  1PLF A;  3GD7 A;  2R7Z G;  1NAP A;  1V9P A;  3K7A H;  1SNQ A;  3ULP A;  4K8J A;  3MXU A;  2PQA B;  1EEF D;  1RKN A;  1TWF B;  2EY1 A;  3T56 B;  1EFI D;  4JYA Q;  4DV0 L;  4RHR A;  3TP8 A;  4K2L A;  4PQX A;  2PZU A;  4JOI A;  2F0U A;  4IAL A;  1SNO A;  2KEE A;  3HOX B;  1GO3 E;  2QIL A;  1DOM A;  3HOZ G;  1STG A;  1X54 A;  1RJT A;  4JI7 L;  2NBF A;  4BY7 B;  1VF5 C;  4QIW E;  4L5S A;  3NQI A;  1VS0 A;  3H91 A;  3J7Y W;  3IFD A;  2ALY B;  3STB D;  1AEX A;  2IX3 A;  4ZLT F;  2Y0S E;  3S9W A;  3HOV H;  2BA1 A;  1U9R A;  1LAB A;  1FYC A;  4HN7 A;  1HZC A;  1TWC H;  5GAH C;  4A3J H;  1E2V A;  3HOU G;  1KDB A;  3AB9 A;  3OMC A;  3M4Y A;  4YIJ A;  4EQO A;  1N33 Q;  2EY2 A;  2F0S A;  2IT1 A;  5COY A;  1K83 H;  2I5L X;  3C1E A;  4CDD C;  4KJO A;  4DK3 C;  4CDC C;  1SRU A;  1IKL A;  1PFB A;  4WJ4 A;  2UUA L;  4A3G G;  4GNX C;  5C5M A;  3PGZ A;  1SJE D;  3K7A B;  1VQK A;  2F0P A;  1XPO A;  1QVC A;  3WDN A;  1VQA A;  4DV2 Q;  2IL8 A;  2HQL A;  1VCI A;  4PMB A;  1D5X C;  3J81 i;  2YTY A;  5H1S E;  2F3I A;  1ZYR D;  5NUC A;  4DV5 L;  4AH6 A;  5ISR A;  1EQV A;  3CCJ A;  1SE2 A;  2ZJP A;  4NXM L;  4A3L G;  3I56 A;  3TP5 A;  1B2T A;  1QIL A;  4CGY B;  4X66 L;  4V0B A;  3SK6 A;  4RMF A;  2B3G A;  3UE0 A;  2R3Z A;  3K59 A;  2F0I A;  3HOV B;  1B9M A;  3HOW H;  5C4H A;  3I4N H;  1SNM A;  4JI4 L;  1V1P A;  1TWC B;  4ALP A;  4A3J B;  1W6J A;  5CV7 A;  4XT1 B;  4L5Q A;  4R4Q A;  4UY8 C;  1VQL A;  2K50 A;  5D3D A;  4PMW A;  1JWM D;  2UXD L;  1K83 B;  1N34 Q;  3KBG A;  3C1F A;  5EJW A;  3S1Q H;  2FMM A;  5EPL A;  2NTT A;  4HTH A;  3OHX C;  4DR4 Q;  1NMF A;  2NZ1 D;  3HFZ B;  1FGB D;  2OF1 A;  4A3M B;  3ZYY X;  2VL6 A;  3NXW A;  1J5E Q;  4XTC S;  4GLX A;  1CKN A;  1NNX A;  4PNY A;  1AFP A;  2R7Z H;  3KLR A;  5EBD A;  1XMQ L;  1IYV A;  2KCN A;  3D8G A;  3OWF A;  4QJF A;  3J7A F;  5IP9 G;  4FF3 A;  4DUZ Q;  2MP1 A;  1I94 L;  4QIW B;  4HJ7 A;  2VNU D;  1C9O A;  4YCV A;  2SNM A;  4YWM A;  1CK1 A;  2NVX H;  1BUV T;  1OXS C;  1S5F D;  2Y0S B;  4A75 A;  1DD2 A;  2OCE A;  2D0O A;  4N8X 1;  3BZD B;  3OTO Q;  2M00 A;  1BOS A;  2C9O A;  5GAE C;  4HED A;  4KKT A;  2XRQ D;  3I4N B;  3G48 A;  1A8V A;  2NB0 A;  3LWU A;  2R7F A;  1TKW B;  2M2L A;  3PO3 G;  4DF7 A;  3S24 A;  4JPB W;  4G57 A;  4LMQ D;  4DV3 Q;  5G3L D;  4XDX A;  3VR2 A;  1GVP A;  1QWY A;  2ZJQ A;  5EAY A;  2N3S A;  4UAI A;  5J22 A;  3QOJ A;  4GN5 A;  4Q5V A;  1ZEQ X;  4B3M L;  1NTG A;  4A3F G;  3BG3 A;  2NVT B;  3U4V A;  2KEN A;  1K28 A;  2R7Z B;  5C3E H;  1Q1E A;  4F87 A;  4IJH A;  5CGK A;  2EY5 A;  3TZD A;  3D4D A;  1ICF B;  2Q2T A;  1LTI D;  1J8I A;  2GVB A;  2LY7 A;  5I6W A;  5EQ0 A;  4P71 A;  2NVX B;  1CSP A;  1I4P A;  3OW2 A;  4A3L H;  1J6Q A;  3HOZ B;  1E22 A;  2SDF A;  5FO7 B;  1LT5 D;  1S5B D;  3PV0 A;  2RHS B;  1TY2 A;  2EIF A;  5IWA Q;  2JA5 H;  5E4X A;  1B70 B;  1TS3 A;  2X6G A;  4G7H C;  1HUM A;  1PYW D;  2YTV A;  3N52 A;  4KJN A;  1I50 H;  1IL8 A;  4ZRZ A;  1PRT B;  3W5O A;  4KK7 A;  2GN5 A;  2I0Q A;  1JIC A;  1RCV D;  3HOU B;  1WCM H;  5C5L A;  1AW7 A;  2LKV A;  1C4Q A;  4IN3 A;  4XQN A;  2WFW A;  3PF4 A;  2F0N A;  2F0V A;  2BA0 A;  1H95 A;  4LF9 Q;  1LO5 D;  5I4D A;  4UHV A;  3KF8 B;  1SYB A;  2YV5 A;  4A4I A;  4JI3 Q;  4HCS A;  1WI5 A;  1X3E A;  2Q8I B;  2QEJ C;  2B2U A;  2NN6 G;  4A3G B;  3AU7 A;  2BCO A;  3H94 A;  5FKA C;  3I3C A;  1CHP D;  1E1O A;  4DV4 L;  4KLK A;  2YYZ A;  4IOA A;  1IYJ B;  1UUP A;  3T4A C;  1B50 A;  1PH4 A;  2O5J C;  2L55 A;  3KDF A;  4KN7 C;  2EPB A;  1UE1 A;  1IBK Q;  1A15 A;  4X62 Q;  3JAM c;  3BYT B;  3EFX D;  5A2Q E;  4FXK C;  2MO0 A;  5IOD A;  1L0W A;  3TS0 A;  2MGS A;  1XX8 A;  3K58 A;  3I55 A;  2EYO A;  4DV6 L;  1CQF A;  2C35 B;  3PIP 3;  1I6H H;  1U4M A;  1K9M C;  2BOS A;  3D3R A;  4BBR G;  5BR8 Q;  3CCU A;  1I50 B;  1G51 A;  4CJ2 C;  4KN4 C;  4LF5 Q;  1O7Z A;  3MFG A;  1STB A;  3I73 A;  4FXG C;  4EX5 A;  4DAV A;  4QB4 A;  1K8G A;  1CZG A;  1GKH A;  4B9X A;  3MTS A;  3FP9 A;  3C2P A;  1V1O A;  3ERO A;  1VDZ A;  2CWP A;  4GNX A;  2HUG A;  1TS2 A;  1F2Z A;  2JJQ A;  3PMF A;  1A0I A;  1BXT A;  3TP7 A;  1MSH A;  2LMC B;  2UUC L;  1OXX K;  1WTQ A;  2CCZ A;  1IYU A;  4R8N A;  2K5W A;  1DON A;  4A3F H;  3BVZ A;  3AQQ A;  1QUQ A;  3FKI G;  4KD3 A;  1K8O A;  5JJI A;  3H0G G;  4HIO A;  1IHZ A;  5JOB A;  3X3M A;  2QKI C;  3MXP A;  4C3H G;  1HPC A;  2ICI A;  2UXC L;  4IFD I;  3HKS A;  4R4T A;  3Q24 A;  3GTK H;  2L9H A;  2BH2 A;  4RGM A;  3HG9 A;  2E2I H;  3A0J A;  2OT2 A;  1EQT A;  1I6H B;  4A3E H;  4HSV A;  1B7Y B;  4IPD A;  1O78 A;  1M8A A;  3UDX A;  5JPN C;  4JI1 Q;  3CC2 A;  1UE5 A;  2MUY A;  1YJN A;  4LF6 Q;  5ELO A;  2K5D A;  4MZ9 A;  3OWE B;  4L63 B;  4K5W A;  1Y8N B;  2NVY H;  4N9T A;  1ZXT A;  3PO3 B;  3RZO H;  3UDF A;  1JOK A;  2L4N A;  3QG1 A;  2WB1 G;  5KGU A;  2CW0 C;  2F0Q A;  4J15 A;  5G3L F;  2B8F A;  1HTP A;  1EIY B;  3J80 i;  3VR3 A;  1Q90 A;  1ONL A;  2A69 C;  3RN5 A;  2WP8 J;  2PPB C;  3VYR A;  3KK7 A;  3T16 A;  1PH5 A;  3NEN A;  3SDZ A;  3I72 A;  1ROD A;  2RCF A;  4EQ5 A;  3S16 H;  3QR8 A;  3KLS X;  3JAM L;  4DR2 Q;  4LUO A;  4A3F B;  3E9H A;  5EKL A;  2VQF L;  5GAD C;  5KND A;  1V43 A;  1V1Q A;  4OIJ A;  2Z8L A;  3HZX A;  4RAU C;  4U68 A;  4HJ5 A;  1ET9 A;  2F1M A;  3HRZ C;  4OEM B;  3CMA A;  1YJ9 A;  1KD1 C;  4KHZ A;  4GOP A;  4TSS A;  5DLQ E;  1H9S A;  4OWW B;  3U9S A;  3VYS A;  4AQY Q;  2QEX A;  1D1I A;  4FNF A;  3GTK B;  2E2I B;  2IW3 A;  2I46 A;  4DNI A;  2E76 C;  2PMZ E;  4OXP A;  3GTJ H;  1EY7 A;  5AFW A;  3VR6 A;  2F0E A;  3G71 A;  2ZXO A;  2B29 A;  2NVY B;  3PO2 G;  3KJO A;  4LUZ A;  2WV6 D;  3RZO B;  4O1N A;  1HR0 Q;  4RG1 A;  5A2Q L;  1CFM A;  4DV1 L;  3E5S A;  4BY1 H;  2LXJ A;  1D5M C;  1JWS D;  1O7L A;  2Z9H A;  1VQJ A;  3GDE A;  4HIK A;  2UXB Q;  1SE3 A;  3EVQ A;  2R92 H;  3EBE A;  2MJ8 A;  1X3G A;  2QDB A;  3LNN A;  2I07 B;  4YCW A;  1WTR A;  1ET6 A;  3HS0 C;  5ELF A;  3BZK A;  1F2M A;  1C7Y A;  1EZ6 A;  4X64 Q;  3S16 B;  1VQI A;  4C1N K;  1UEA B;  1GUT A;  1DOK A;  2F4V Q;  1AE2 A;  1B9N A;  1TS4 A;  1KXL A;  2O5I C;  4EVO A;  1WFQ A;  2EJM A;  4POF A;  1OO9 B;  3FKI H;  4JI6 Q;  5CYU A;  2AUK A;  3E0E A;  3H0G H;  4YHH Q;  4DR7 Q;  4OO1 G;  4DA2 A;  1BCP C;  1V1P B;  2B2W A;  4RKL A;  1XMO L;  4B3S L;  1E3P A;  4ZQ3 A;  5M9O A;  4O2D A;  3R3O A;  2E2J H;  4C3H H;  1IBL L;  5LL6 X;  2M9V A;  5IE8 A;  2B2V A;  4PZ7 A;  1DJR D;  1I4H A;  3T1Y L;  1HHV A;  2NTS A;  2RDF A;  5FJ8 G;  1EYC A;  3OIQ A;  1X56 A;  3GTM H;  1N32 Q;  4O0A A;  5E4W C;  2LSS A;  3QIA A;  2ZJR A;  5LMN W;  4FP5 D;  4GS3 A;  4B3T L;  3NSW A;  1HFN A;  1GUW A;  2CW0 D;  2E5L L;  4B08 A;  1HNX Q;  2K4K A;  3OYY A;  4LFA Q;  4X65 L;  5COR A;  1NSN S;  3ND8 A;  1A63 A;  4XQQ A;  1G6P A;  1Y69 U;  1SR3 A;  5IGB A;  1B53 A;  2C5C A;  5CV4 A;  1CKN B;  2WAQ G;  3MWY W;  3SGI A;  5TSS A;  4CHT B;  3NUC A;  3M7N A;  4DXG A;  4UP9 A;  3DXJ C;  1N36 Q;  5E7N A;  5FO9 B;  1CUK A;  4C2M B;  1ASZ A;  3KBX A;  5IYC H;  1ESF A;  3WOF A;  1G8Z D;  3ICE A;  5T1G A;  1YHB A;  4K6D A;  1JB7 A;  3M9B A;  3NEM A;  1II3 A;  3R2T A;  1PRT F;  1STN A;  4LF8 L;  3MEH A;  4DV7 Q;  3FKI B;  3Q0A A;  1WTO A;  1YNN D;  1J9O A;  3B6Y A;  3ERQ A;  2XNA C;  1HTL D;  3H0G B;  4CKE A;  4GKJ L;  5EKI A;  3FVQ A;  4Y7N B;  2PMZ B;  4JC0 A;  2UUA Q;  2E2J B;  1Y8O B;  4C3H B;  3M4O H;  1I3Q H;  3O13 A;  1H9J A;  3GTM B;  5CV8 A;  5M5W H;  5CC4 A;  4K5X A;  4DV5 Q;  1DOL A;  4GN4 B;  4G7Z C;  1SXT A;  4IO9 A;  3S2D B;  4XYQ A;  1GXD C;  1SYG A;  3RZD H;  3I91 A;  1LLR D;  1QNU A;  1Z7T A;  2DNC A;  4KHP Q;  5CBA E;  2IPK D;  4DU9 A;  2DGY A;  2F0K A;  2B2Y A;  3C3L A;  1JOQ A;  4DUY Q;  2A5H A;  2FXQ A;  4BA2 I;  1KRS A;  4JBM A;  2ZTC A;  4A3K G;  1GHJ A;  2EY6 A;  2RBM A;  4IFD H;  1SND A;  3G6J B;  3PSI A;  1RD9 D;  5I2Y A;  1E0B A;  4JI4 Q;  5FK9 C;  3DM3 A;  4BXX G;  4LFB L;  5E1F A;  1PH8 A;  1BCP D;  4RA8 A;  3A56 A;  1N9W A;  2K5Q A;  1LTG D;  2D5D A;  2EYH A;  3U9O A;  2DN8 A;  2UXD Q;  4TRD A;  5AJ3 Q;  1VQ9 A;  2E2H H;  1D5Z C;  1G6Z A;  4H44 C;  4NMZ A;  1YIT A;  2KHS A;  1BDO A;  4R9W A;  3M4O B;  4IUV A;  4BBS G;  4DFA A;  1I3Q B;  2HT1 A;  1WOC A;  1C8C A;  1FD7 D;  1PHJ A;  3TBI B;  3F2D A;  2VQE Q;  1JOR A;  1YZ6 A;  4KKU A;  3Q8D A;  1HA6 A;  2L12 A;  5M5W B;  4OX9 L;  1KTK A;  1XMQ Q;  5FJ8 H;  4B9W A;  2OQK A;  5D14 A;  2R93 H;  2VZA A;  1PFM A;  3DHQ A;  1I5F A;  1YIJ A;  2RVL A;  3PO2 B;  3RZD B;  5FLM H;  2KUM A;  3DMU A;  1TVX A;  1IBM L;  1JJG A;  1T5X D;  3SEB A;  2HIV A;  5IP7 G;  2EJF C;  4UDU C;  4MHE A;  3EA6 A;  2KHI A;  1Y1V G;  3E0J A;  3HKZ G;  4ABN A;  5L37 A;  1FJG Q;  2XTI A;  4A3M H;  1PMR A;  2L0C A;  2BE5 C;  3S1M H;  3NTH A;  1ENC A;  4J6H A;  1X55 A;  2UUB L;  4IPC A;  3KOJ A;  3T1H Q;  1SEB D;  3TS2 A;  2PI2 E;  3SE0 A;  4ZUJ A;  2XSC A;  1XYI A;  2H4O A;  5C0X J;  2YTX A;  1Y1W G;  4O42 A;  2O2L D;  3NTK A;  3IRB A;  2JP1 A;  2XVS A;  4G4K A;  1IL2 A;  2AMC B;  3J81 c;  1YEZ A;  2E2H B;  4B3R L;  1UNS A;  2F4I A;  1SYD A;  3L9A X;  1K8M A;  1X6O A;  4CJ0 B;  2OTJ A;  1BR9 A;  1Q1B A;  3CCM A;  3ZJY C;  1SYC A;  4APV A;  3MA2 B;  1Q86 C;  1FL0 A;  4DK1 A;  5M3F G;  1Z47 A;  3F2B A;  3DEO A;  2PO4 A;  3M3Y H;  4L6T B;  2R93 B;  3OIP A;  3S15 B;  4X3T A;  3RUZ A;  1S72 A;  1XTD A;  1XTC D;  1PYB A;  2EYM A;  1B1Z A;  3T51 B;  3A7L A;  3F2U A;  2DY7 A;  3A74 A;  4XT3 B;  4GKK L;  1L1O B;  2HIX A;  1PYS B;  1SYF A;  2PZW A;  2Z1C A;  3P7J A;  1JE4 A;  2JE6 I;  2RSO A;  1B44 D;  1F9S A;  1QUQ B;  3I4M G;  2RHQ B;  1D8L A;  4JYA L;  3RD4 A;  3PUY A;  3S1M B;  2K01 A;  1KAA A;  5K36 G;  4HSP A;  4HR7 B;  4PMC A;  2NVT H;  4A3K H;  5JEA G;  1A3U A;  1Q81 C;  1L0Y B;  3NBH A;  5K5P A;  1PV4 A;  2B63 G;  4A3B G;  3NBI A;  2QDL A;  2WKD A;  4BXX H;  2JA8 G;  1YNX A;  3A8J E;  4JK1 C;  4DAP A;  2ENB A;  4OIK A;  1ZKO A;  3SXH A;  2F0G A;  5JEA J;  5C44 G;  2JA6 G;  1C48 A;  3HOZ H;  1VQC A;  2NN6 I;  3CAM A;  1LTA D;  2OWO A;  4BBS H;  4CKC A;  1EYG A;  2EDG A;  4OGQ C;  1E2Z A;  4YY3 Q;  4HIM A;  3M3Y B;  3K5O A;  2IHE A;  4LUV A;  3UDI A;  3HOY G;  3F1Z A;  3E6Z X;  1Y8P B;  1BBU A;  3HOU H;  2K28 A;  5J39 A;  1EQQ A;  1VQG A;  2MPM A;  4KY7 A;  2O4X A;  2BE5 D;  1KLG D;  3K80 C;  5HUR A;  2FMC A;  4DV2 L;  1WD1 A;  1PH2 A;  4DK6 C;  4AIM A;  1WTH A;  3KJP A;  4A3G H;  3W3A A;  4GOP B;  4A3K B;  2F0D A;  2CHB D;  4ZCK A;  1H9S B;  1DXM A;  2L1B A;  4C1N I;  1A2T A;  2QA4 A;  1PFS A;  1U4R A;  5JPM C;  1LT6 D;  4IUT A;  1PRT C;  3RLN A;  1Y1W H;  1BCP F;  4J8Q A;  4GLV B;  4IUQ A;  2DJF C;  3CCV A;  4OWT B;  1UE6 A;  5D65 A;  1QOH A;  3L0O A;  5LMN L;  3TSS A;  1CA6 A;  1G29 1;  1YI2 A;  1LM0 A;  2CWA A;  5BN4 A;  3PQI A;  4BBS B;  3DWQ A;  1H9K A;  2K04 A;  4HCE A;  1WYD A;  3G6E A;  4K0K Q;  2Z6B A;  3A7A B;  3OMG A;  2V4D A;  3JAM E;  3S1R B;  3KF6 B;  3PUV A;  1G2S A;  4LF4 Q;  1CKO A;  1NR4 A;  1VQF A;  4JI5 Q;  4DR4 L;  4IUP A;  3E9I A;  3FMC A;  3OW7 A;  4LF7 Q;  3PUX A;  4L5T A;  4BWG B;  4ZYS A;  3X3N A;  1J5E L;  3A8I E;  2KBN A;  4R8I A;  1PTO B;  2HQE A;  4Y52 H;  1BO0 A;  2RSN A;  2Z6K C;  1B3Q A;  1LTS D;  3W2D A;  3GQB A;  1STA A;  1Y1V B;  1JOO A;  1CA5 A;  1MI2 A;  2K14 A;  3I4M H;  2SNS A;  4DUZ L;  4ZAI A;  3L3O C;  2PW5 A;  5A35 A;  5KEE A;  4A3D G;  2B8G A;  2K7V A;  2ZXP A;  1KAB A;  1V8Q A;  1Y1W B;  2NZH A;  5IP9 H;  1QVG A;  1SBB B;  3OTO L;  5JJK A;  3M4Q A;  2F0F A;  3MFY A;  3UI2 A;  4IQZ A;  2G5D A;  4UPA A;  5FOB B;  3K7U C;  1TS5 A;  1B3A A;  4I65 A;  2JA6 H;  1WVL A;  1QB5 D;  1F9P A;  1R9T B;  1G91 A;  1VQ5 A;  4DV3 L;  3PUW A;  2KED A;  3NE5 B;  4QMG A;  1AZP A;  3BVM A;  2F0L A;  3PO3 H;  3AFP A;  5EPK A;  4IUR A;  4DAY A;  3HOY H;  4F8M A;  1A62 A;  1W3S A;  5DM7 3;  2F0M A;  3F8T A;  1HA5 A;  5CV9 A;  5IYD G;  3PIO 3;  2WKC A;  1XNQ Q;  3BDL A;  3BDC A;  1XNR L;  2NUC A;  3I4M B;  4WJW A;  2UU9 Q;  1JC7 A;  1RIP A;  2L15 A;  1PRT D;  3K0Y A;  2JQO A;  3EJI A;  4NKL A;  4FYD A;  2ZM6 Q;  3P75 A;  4XYO A;  2B63 B;  2IJ0 A;  4A3B B;  4LFC Q;  4OL7 A;  2JA8 B;  4RHS A;  2CQA A;  2I5H A;  3NEL A;  4JVZ A;  1IZ6 A;  4A93 G;  1RL2 A;  3J80 E;  3S2H B;  2B2T C;  2JA6 B;  1AP0 A;  4DNT B;  4NDX A;  1RDP D;  1X65 A;  4JOI C;  4DAM A;  1LAC A;  4S3S A;  3IKJ A;  1S40 A;  5ELD A;  2MQH A;  2AUJ D;  4P2C B;  4LF9 L;  3I4O A;  3HOY B;  1PZJ D;  3GO5 A;  4JI3 L;  2JN4 A;  4OO1 I;  3NHH A;  5J1Z A;  2F0T A;  1EY8 A;  1HNW Q;  4KMU C;  4M1U B;  2WII B;  3S14 H;  2E75 C;  3J80 c;  2OXP A;  1CTM A;  1KC8 C;  3BVG A;  3S1N H;  2NN6 H;  4GLA C;  4B3T Q;  2A6E C;  1IBK L;  4ODG A;  4X62 L;  4DR6 Q;  1HNZ Q;  1LTT D;  1MHW C;  1GM5 A;  4A3D H;  3IAY A;  1GD7 A;  3K5M A;  1IKM A;  4DR1 Q;  3MXN A;  4PG3 A;  4PV1 C;  1BF4 A;  1CHQ D;  2K6A A;  1FNV A;  3I8Z A;  3BZC A;  5LMU L;  1WD0 A;  1YNN C;  4DR3 L;  2KCM A;  5BR8 L;  4RKB A;  2I5M X;  4K8I A;  4V19 0;  2ZTE A;  1SMY C;  1JB3 A;  1SRO A;  5F2D A;  3E3X A;  1TT2 A;  1KNA A;  4QL5 A;  1EY4 A;  3VR4 A;  2MNA A;  1K0S A;  2R61 A;  3WWV A;  4JI2 Q;  3G7L A;  1PZI D;  4BBR H;  2EE1 A;  2GVA A;  1GHK A;  2IHF A;  1KNE A;  2CKZ B;  3I70 A;  4P74 A;  3U58 A;  4A3C G;  2HHH Q;  3S14 B;  3VDY A;  1TY0 A;  4C2M H;  2WB1 E;  1FR3 A;  3OPO A;  3S1N B;  4JV5 Q;  3D31 A;  3L2P A;  2F0W A;  4JI8 Q;  4MTK A;  1T5E A;  4QUF A;  3SHL A;  5DAU A;  2EXD A;  2ZXR A;  4A3D B;  5IGC A;  1H9R A;  3FDT A;  3QJY A;  1EOT A;  3R8B A;  4JI0 L;  1S5C D;  2ZTD A;  1Q8K A;  3FRP B;  3SK5 A;  2KQ3 A;  2N78 A;  3KFU A;  4Y7N H;  2D62 A;  4ZKC B;  1KHI A;  5HGT A;  3RMH A;  4LF6 L;  3NPP A;  3A55 A;  5CMD A;  3AEV A;  1KRT A;  1WTP A;  1STY A;  1I6V C;  1HZ9 A;  1PA6 A;  1KAW A;  4RFB A;  2DNE A;  3QWN A;  4DV0 Q;  3GTG B;  1ILP A;  1UEB A;  4F7X A;  3I7F A;  4BBR B;  1ENA A;  3S2D H;  4RGT A;  4JBK A;  2EYP A;  1I4G A;  3DEP A;  2Z0S A;  2RF4 A;  3J80 L;  4EQP A;  4CJ1 B;  4JI7 Q;  4GN3 B;  1YJW A;  2D2C C;  2Q2H A;  3CCR A;  1LTL A;  5D3I B;  2V1C C;  3NBH B;  2RCN A;  1TU2 B;  3H3V I;  1EQR A;  2A6E D;  2J0T D;  4DR2 L;  1VQ7 A;  1EYD A;  4X6A H;  4R4O A;  4XXE A;  1JQY D;  1VMC A;  4LW1 A;  3VYU A;  5C4J B;  1EY0 A;  1NY4 A;  5KRU A;  5LL6 S;  2RDG A;  2TSS A;  4A3I G;  3GTQ B;  3D0F A;  4DR5 L;  1PXU A;  3QO2 A;  1IBM Q;  1NBW A;  2K03 A;  5DEH A;  3RN2 A;  1X3F A;  1SMY D;  3EIV A;  1PH6 A;  1K3B C;  2SOB A;  1X32 A;  4DK0 A;  2NYZ D;  4HMJ A;  5C4Z A;  1EIG A;  1LYL A;  1NUC A;  1WTW A;  4ME5 A;  1HR0 L;  5ELE A;  4DXF A;  1S4Z A;  2PZT A;  1K0R A;  2Y0S G;  4FO2 A;  2DJG C;  1A3V A; 
#chains in the Genus database with same CATH homology
 1E1O A;  1MKH A;  4DV4 L;  4UP8 A;  4LF5 L;  2UXB L;  4NXM Q;  3PO2 H;  2JE6 I;  4KLK A;  2YYZ A;  4IOA A;  1QUQ B;  1IYJ B;  3I4M G;  2OTL A;  3HOW G;  2RHQ B;  1D8L A;  3ERS X;  3GTG H;  3I4N G;  4BY7 G;  4JYA L;  1PH4 A;  3PUY A;  5K36 G;  3KDF A;  2NVT H;  4X66 Q;  4LF8 Q;  4A3K H;  4DR5 Q;  5JEA G;  4X64 L;  1UE1 A;  1IBK Q;  4X62 Q;  1Q81 C;  3JAM c;  1PV4 A;  3PCO B;  1XNQ L;  4GKJ Q;  2B63 G;  2MO0 A;  4A3B G;  2JA7 G;  3KYH C;  3CC7 A;  1L0W A;  3TS0 A;  4BXX H;  2JA8 G;  1BVS A;  1YNX A;  4IOC A;  2UU9 L;  2QGQ A;  2WAQ E;  1K3R A;  3I55 A;  2NVQ H;  4QY7 A;  1QZG A;  2VUM G;  4DV6 L;  1HZB A;  1OXU A;  2C35 B;  5IYD H;  4R1J A;  4YHH L;  5FLX c;  1I6H H;  4DR7 L;  1BBW A;  1AH9 A;  4A76 A;  5JEA J;  1K9M C;  5C44 G;  2JA6 G;  3RLF A;  2ZM6 L;  3HOZ H;  4MTN A;  5HGQ A;  5C4J H;  4BBR G;  1VQC A;  5BR8 Q;  3CCU A;  1TWH H;  2NN6 I;  3CAM A;  2XGT A;  4LFC L;  1G51 A;  1OXV A;  1VQP A;  2OWO A;  4BBS H;  1EYG A;  4LF5 Q;  4IJL A;  3GTQ H;  3KF6 A;  4EX5 A;  4IFD G;  3BU2 A;  4YY3 Q;  2BH8 A;  1WJJ A;  4OON A;  1K8G A;  1VQN A;  1N32 L;  4HIM A;  1GKH A;  1SN8 A;  1K8A C;  2IHE A;  1M1K C;  2EQS A;  3K81 C;  2KCT A;  4LUV A;  3UDI A;  3CPW A;  3FP9 A;  3HOY G;  3F1Z A;  1PVO A;  2F52 A;  4P75 A;  1PH3 A;  1E7Z A;  4NXN L;  1HZA A;  2CWP A;  4GNX A;  1HNX L;  1YBY A;  1BBU A;  3HOU H;  4JI1 L;  1KL9 A;  5IYB H;  4MNO A;  2JJQ A;  1VQG A;  1EQQ A;  1OTC A;  1A0I A;  4LFA L;  3U4Z A;  1NMG A;  4A93 H;  5IY0 A;  1LUZ A;  1JMC A;  1VQM A;  1Q12 A;  3S15 H;  2UUC L;  3DLL A;  3K80 C;  1I94 Q;  1OXX K;  1XPR A;  1PH7 A;  4IFD J;  2CCZ A;  2IY5 B;  4XIG S;  4LFB Q;  4WJ3 M;  4DV2 L;  4A3F H;  1PH2 A;  1N36 L;  1OXT A;  3AQQ A;  4DK6 C;  3K0X A;  4AIM A;  1QUQ A;  3FKI G;  4YWK A;  3KJP A;  2IX0 A;  4A3G H;  4GOP B;  1HH2 P;  3L7Z C;  3W1B A;  3H0G G;  5JJI A;  5C0X G;  4HIO A;  1Q7Y C;  1HNW L;  3HOV G;  3I2Z A;  3KDF B;  1PFS A;  2QA4 A;  4HJ9 A;  1EFW A;  3GTO H;  1UWV A;  3CCQ A;  3KLW A;  5GAG C;  4H02 A;  4A3J G;  2UXC L;  3CPF A;  4IFD I;  3HKS A;  4R4T A;  2R93 G;  3GTK H;  3RLN A;  2Z6K A;  4DV7 L;  1Y1W H;  2BH2 A;  1W2B A;  2ATW A;  2E2I H;  4GLV B;  3A0J A;  3STB C;  1JT8 A;  5FLM G;  4OWT B;  3CCV A;  1B7Y B;  1UE6 A;  4IPD A;  4A3E H;  1HNZ L;  4DR6 L;  4NXN Q;  2N8N A;  3L0O A;  5LMN L;  1HJP A;  1NE3 A;  1E1T A;  1G29 1;  4OX9 Q;  3UDX A;  3CC2 A;  4JI1 Q;  1YI2 A;  1LM0 A;  1UE5 A;  1YJN A;  3W1G A;  4LF6 Q;  2VW9 A;  4A3I H;  2CWA A;  1YHA A;  3TRE A;  5ELO A;  4DR1 L;  4MZ9 A;  1PH9 A;  3CC4 A;  1P16 A;  2NVY H;  3CD6 A;  3ULJ A;  5C3E G;  2AWO A;  3RZO H;  3UDF A;  4A3M G;  4AQY L;  1WYD A;  1VQE A;  1L1O C;  4B3M Q;  3G6E A;  4K0K Q;  4LWC A;  2WB1 G;  2AKW B;  4J15 A;  3H15 A;  1EIY B;  2VS1 A;  4FDB A;  3KF6 B;  3PUV A;  3J80 i;  1VQO A;  1KQS A;  5C0X I;  4JCV E;  2R6G A;  4LF4 Q;  1CKO A;  4DAY B;  3RN5 A;  5C4X G;  1M90 C;  2WP8 J;  1EUJ A;  1S3O A;  1VQF A;  1TWF H;  2K75 A;  4JI5 Q;  1U5K A;  4DR4 L;  3E9I A;  1FVI A;  4GNX B;  1PH5 A;  2UUB Q;  4JI2 L;  3NEN A;  2OQ0 A;  4KHP L;  4LF7 Q;  4JG2 A;  3PUX A;  4L5T A;  4EQ5 A;  1J5E L;  2JA5 G;  5JJL A;  3M4P A;  2KBN A;  3S16 H;  4ME3 A;  4DR2 Q;  4LUO A;  3HOX H;  3E9H A;  4DUY L;  3J7A 5;  4Y52 H;  2VQF L;  1EOV A;  5GAD C;  1V43 A;  1V1Q A;  3LGJ A;  1XPU A;  2Z6K C;  4HJ5 A;  5LMN Q;  1CSQ A;  2A1A A;  4IPG A;  2CQO A;  3RNU A;  2K14 A;  3I4M H;  4DUZ L;  4BY7 H;  1EWI A;  3CMA A;  1YJ9 A;  1P8L A;  1KD1 C;  4KHZ A;  4GOP A;  3G4S A;  5DLQ E;  4B3R Q;  4A3D G;  1SLJ A;  2HHH L;  3UDG A;  1WCM G;  2JEA I;  1QZH A;  4OWW B;  1O7I A;  1TXY A;  4AQY Q;  2QEX A;  1SE8 A;  3AYH B;  1K73 C;  3FHW A;  2PNH A;  2NZH A;  2JA7 H;  1ASY A;  5IP9 H;  1QVG A;  4JV5 L;  4JI8 L;  1VQ8 A;  1YHQ A;  3OTO L;  3HKZ E;  4PZ8 A;  5AJ3 L;  5JJK A;  3M4Q A;  1VQB A;  4DNI A;  2PMZ E;  3CF5 A;  4L5R C;  4OXP A;  3ULL A;  3GTJ H;  2F4V L;  4A3C H;  1PH1 A;  2VUM H;  3M85 A;  4UPA A;  3CP0 A;  3G71 A;  3K7U C;  3CME A;  4JI6 L;  2JA6 H;  2A19 A;  2B29 A;  3PO2 G;  1T9H A;  3KJO A;  4LUZ A;  1XJV A;  5GRO A;  2ASB A;  3BJU A;  1QVF A;  2VQE L;  2N49 A;  1HR0 Q;  2AHO B;  4QGU A;  1VQ5 A;  2MFI A;  4RG1 A;  4DV3 L;  4IPH A;  1N8R C;  3TEH B;  4DV1 L;  3JC6 6;  4GKK Q;  3PUW A;  2NZO A;  4BY1 H;  2LXJ A;  3GD7 A;  3F2C A;  2CFM A;  2R7Z G;  1V9P A;  2K5H A;  3K7A H;  1VQJ A;  3GDE A;  4DV4 Q;  4HIK A;  3ULP A;  2MO1 A;  2UXB Q;  3PO3 H;  2PQA B;  1N33 L;  3H3V H;  4UP7 A;  2R92 H;  3AFP A;  3EBE A;  3HOY H;  1X3G A;  4JYA Q;  1A62 A;  4YCW A;  4GOP C;  4DV0 L;  1W3S A;  3BZK A;  1C0A A;  1C7Y A;  3F8T A;  3S1R H;  4JOI A;  2ES2 A;  2K5N A;  4X64 Q;  5IYD G;  1GO3 E;  1XNQ Q;  1VQ6 A;  1VQI A;  3HOZ G;  1FJG L;  1BKB A;  5HY6 A;  2F4V Q;  1AE2 A;  1X54 A;  1XNR L;  4JI7 L;  5M5Y H;  1KXL A;  2UU9 Q;  1WFQ A;  1RIP A;  4QIW E;  4POF A;  4L5S A;  1VS0 A;  2L15 A;  4DV6 Q;  3FKI H;  3T1H L;  4JI6 Q;  1JJC B;  5IP7 H;  3E0E A;  3H0G H;  4YHH Q;  2ALY B;  4DR7 Q;  4OO1 G;  2JQO A;  3STB D;  3RR5 A;  2ZM6 Q;  2Y0S E;  1Y1V H;  3HOV H;  1XMO L;  3MXN B;  1E3P A;  2BA1 A;  4B3S L;  1MIU A;  4AYB G;  4O2D A;  2E2J H;  4C3H H;  1IBL L;  2JK8 A;  1HZC A;  1TWC H;  5GAH C;  5IE8 A;  2H5X A;  4A3J H;  4LFC Q;  4PZ7 A;  3HOU G;  2I5H A;  4NB3 A;  1VQH A;  3NEL A;  3T1Y L;  4NPS A;  1IZ6 A;  5FJ8 G;  1RL2 A;  4A93 G;  1N33 Q;  1Q46 A;  1X56 A;  3GTM H;  1N32 Q;  4O0A A;  2IT1 A;  2LSS A;  1E24 A;  4JBW A;  2ZJR A;  5LMN W;  4GS3 A;  4B3T L;  3CCS A;  2E5L L;  1K83 H;  2I5L X;  2DUD A;  1NJI C;  1HNX Q;  4DK3 C;  1X65 A;  2K4K A;  1SRU A;  4JOI C;  4WJ4 A;  3OYY A;  4R4I A;  4LFA Q;  4X65 L;  4DAM A;  2UUA L;  4GNX C;  4A3G G;  1A63 A;  3PGZ A;  1G6P A;  1UE7 A;  3RLO A;  1SR3 A;  1XNR Q;  1CKN B;  2KHJ A;  2Q2I A;  1S40 A;  2MQH A;  1VQK A;  2UUC Q;  4C3I H;  2WAQ G;  1XPO A;  3SGI A;  1R9T H;  1QVC A;  3M7N A;  1VQA A;  4UP9 A;  3TQY A;  4DV2 Q;  1X9N A;  3I4O A;  4LF9 L;  1YVC A;  2HQL A;  1N36 Q;  3GO5 A;  5E7N A;  1VCI A;  4JI3 L;  5M3F H;  2PQA A;  4OO1 I;  1CUK A;  3J81 i;  2YTY A;  5C4X H;  5H1S E;  2F3I A;  4DV5 L;  4AH6 A;  1N34 L;  1ASZ A;  5IYC H;  1IXR A;  1HNW Q;  4A3E G;  3CCJ A;  3ICE A;  2ZJP A;  3PF5 A;  4NXM L;  4A3L G;  1YHB A;  3I56 A;  1JB7 A;  3S14 H;  3M9B A;  1HR0 W;  3NEM A;  4YWL A;  3J80 c;  4DPG A;  1KC8 C;  2UXC Q;  2A8V A;  4X66 L;  4LF8 L;  3S1N H;  4DV7 Q;  4GLA C;  4B3T Q;  3B6Y A;  4RMF A;  3EN2 A;  5M3M G;  2B3G A;  1JE5 A;  4X62 L;  1IBK L;  1HNZ Q;  3UE0 A;  1VQ4 A;  2K5V A;  4DR6 Q;  4GKJ L;  3GTL H;  3HOW H;  1GM5 A;  4A3D H;  4JC0 A;  2UUA Q;  3I4N H;  1GD7 A;  4JI4 L;  3M4O H;  4DR1 Q;  4ALP A;  1I3Q H;  4PG3 A;  4LNQ A;  4L5Q A;  1L2F A;  2K52 A;  3J7Z C;  4R4Q A;  4UY8 C;  3BZC A;  5LMU L;  2B63 H;  2LXK A;  5M5W H;  4A3B H;  4DR3 L;  2KCM A;  2K50 A;  4PMW A;  1VQL A;  4AYB E;  2UXD L;  5BR8 L;  2I5M X;  4DV5 Q;  4GN4 B;  2ZTE A;  2JA8 H;  1N34 Q;  4IO9 A;  3S1Q H;  3A5U A;  3S2H H;  1FGU A;  1SRO A;  3RZD H;  4DR4 Q;  1NMF A;  2MNA A;  2JEB I;  4QL5 A;  3HFZ B;  4YY3 L;  5C44 H;  3WWV A;  4JI2 Q;  3JAM i;  4KHP Q;  2VL6 A;  4BBR H;  1J5E Q;  4TVA B;  4XTC S;  4GLX A;  2DGY A;  2ID0 A;  1CKN A;  2GVA A;  4DUY Q;  1Y14 B;  2FXQ A;  4BA2 I;  1KRS A;  2VQF Q;  4JBM A;  4QQB X;  2R7Z H;  2ZTC A;  4A3K G;  1XMQ L;  2IHF A;  2CKZ B;  4QJF A;  3J81 j;  5IP9 G;  1SMX A;  4DUZ Q;  4P74 A;  3PSI A;  4JI4 Q;  1I94 L;  4HID A;  3U58 A;  3DM3 A;  4A3C G;  4HJ7 A;  2VNU D;  2HHH Q;  4BXX G;  1C9O A;  4LFB L;  4YCV A;  3VDY A;  1TWG H;  4C2M H;  2WB1 E;  4YWM A;  1PH8 A;  2VY3 A;  2NVX H;  1TWA H;  1OXS C;  5LMU Q;  1N9W A;  4A75 A;  2JA9 A;  4DR3 Q;  2OCE A;  3D31 A;  3L2P A;  4JV5 Q;  4KI0 A;  2D0O A;  4JI8 Q;  2UXD Q;  4OWX B;  3OTO Q;  5AJ3 Q;  1VQ9 A;  5GAE C;  2E2H H;  2D0P A;  1SFO H;  2EXD A;  1MJC A;  5GQO A;  1YIT A;  3G48 A;  4BY1 G;  1A8V A;  4BBS G;  4JI0 L;  2HT1 A;  2R7F A;  2IX1 A;  1WOC A;  3PO3 G;  4TQU S;  2ZTD A;  1Q8K A;  2Q2U A;  3S24 A;  2R92 G;  1PHJ A;  3F2D A;  2VQE Q;  2N78 A;  1KIX A;  3KFU A;  1YZ6 A;  4Y7N H;  3Q8D A;  4DV3 Q;  2D62 A;  4DV1 Q;  1KHI A;  4R4C A;  1GVP A;  4OX9 L;  1XMQ Q;  4YCU A;  5FJ8 H;  3CW2 C;  4LF6 L;  2OQK A;  2ZJQ A;  5EAY A;  2N3S A;  5IWA L;  5IYB G;  3GTP H;  4HJA A;  2VZA A;  1VQD A;  2R93 H;  3AEV A;  1KRT A;  1I5F A;  3PIP A;  1YIJ A;  1HZ9 A;  1L1O A;  1PA6 A;  5FLM H;  1KAW A;  1CKM A;  4GN5 A;  4DV0 Q;  1IBM L;  4BA1 I;  4B3M L;  1JJG A;  1UEB A;  4K0K L;  3I7F A;  3ER0 A;  2HIV A;  1NTG A;  4A3F G;  3S2D H;  5IP7 G;  4JBK A;  2R7D A;  3U4V A;  4LF4 L;  3TRZ A;  1AE3 A;  2KEN A;  2Z0S A;  2RF4 A;  2KHI A;  3UE1 A;  1Y1V G;  1Q1E A;  3HKZ G;  5C3E H;  2YU9 H;  1FJG Q;  4IJH A;  3CXC A;  2XTI A;  4A3M H;  4JI7 Q;  4GN3 B;  4JI5 L;  1YJW A;  3S1M H;  2Q2H A;  3CCR A;  1LTL A;  1X55 A;  2UUB L;  4IPC A;  2V1C C;  4LF7 L;  3KOJ A;  3T1H Q;  3NBH B;  5ELN A;  2Q2T A;  4JI0 Q;  3TS2 A;  1EIF A;  2PI2 E;  2RCN A;  3AFQ A;  4P73 A;  3H3V I;  1EQR A;  2GVB A;  4DR2 L;  1Z9F A;  1MJE A;  3PIO A;  1VQ7 A;  4P71 A;  5C0X J;  1CSP A;  2YTX A;  1Y1W G;  3OW2 A;  4JBJ A;  1XMO Q;  4B3S Q;  4X6A H;  4A3L H;  1J6Q A;  1D7Q A;  4R4O A;  3U50 C;  1E22 A;  3IRB A;  4LW1 A;  4C3J H;  5IT9 c;  1IBL Q;  3PV0 A;  1NY4 A;  2RHS B;  1IL2 A;  2AMC B;  1JJ2 A;  2EIF A;  2AWN A;  5IWA Q;  1YEZ A;  5J3B A;  3J81 c;  3T1Y Q;  2JA5 H;  4B3R L;  1B70 B;  4A3I G;  1X6O A;  5M3M H;  3D0F A;  4DR5 L;  2OTJ A;  1DGS A;  3S17 H;  3CCM A;  1Q1B A;  3ZJY C;  2YTV A;  1IBM Q;  2E5L Q;  2E8G A;  1I50 H;  3PUZ A;  4APV A;  1NBW A;  3W5O A;  1FL0 A;  1Q86 C;  2GN5 A;  1X3F A;  4DKA C;  5M3F G;  3RN2 A;  3CCL A;  2I0Q A;  3EIV A;  1U0L A;  4X65 Q;  1PH6 A;  1B8A A;  1WCM H;  1Z47 A;  3F2B A;  5IYC G;  3CCE A;  3CQZ H;  2WFW A;  4POG A;  3PF4 A;  3M3Y H;  1S72 A;  2BA0 A;  1XTD A;  1LYL A;  4LF9 Q;  1H95 A;  1PYB A;  3KF8 B;  3A5Z B;  2YV5 A;  4P72 A;  4A4I A;  4HJ8 A;  1HR0 L;  4JI3 Q;  3MEF A;  1WI5 A;  1X3E A;  1K0R A;  2Y0S G;  3A74 A;  3K8A A;  4PZ6 A;  2NN6 G;  5M5X H;  1L1O B;  4GKK L;  3HOX G;  2HIX A;  1PYS B;  2PI2 A;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...