4A3MH

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mH00
2K14A 4A93H 3CCLA 1KXLA 2VUMH 3M3YH 2FXQA 1RIPA 4DR2L 1HNZQ 5JJKA 5GAEC 1PHJA 2Q2TA 3HOZG 2I5HA 4DV5L 4GKKQ 2VY3A 2ALYB 4DNIA 5IYBG 4A3LG 4OX9L 4P73A 2ASBA 1CKNA 4X65L 4DV6Q 4JI4L 4GOPC 3S1NH 5H1SE 2IX1A 3A5UA 4K0KL 4A3GG 2N49A 3T1HQ 3HOWH 2UXCL 3HKZG 3J81c 1I94L 2JA6H 2E2JH 2UXDL 4MZ9A 1LTLA 5GAGC 2UXBL 2RHQB 1E7ZA 4XTCS 3A74A 2WFWA 5ELOA 3U50C 3J81j 5IP9G 1VQOA 1VQ9A 1A0IA 1C9OA 1UWVA 4WJ4A 4JI5Q 2R93H 3AEVA 4JBJA 1Q46A 4X66L 1W3SA 5GAHC 5C3EH 5AJ3Q 2I5MX 3F2BA 4H02A 5LMUL 4P75A 3I4MG 1HNWQ 1SROA 2E5LL 3J80c 4GN5A 4A3EG 4QGUA 3E9HA 3HFZB 2MQHA 3FKIG 2QA4A 3S1RH 3RN2A 1X9NA 1HNXQ 2F4VQ 3J81i 3JAMc 4LF9L 4HIOA 2ZTDA 4IPHA 4A3BG 4IJLA 4IPGA 4OWTB 4JI6L 4LNQA 1Z9FA 4UPAA 4LF5L 4AQYQ 2VS1A 3CCVA 2KCTA 2MNAA 3KLWA 5IYCH 2K75A 4JI1Q 3G71A 3J80i 4POFA 4JI7Q 3I4NG 3OTOL 3M4PA 2CQOA 4DV0Q 2OCEA 2D0PA 3CMEA 4C3IH 2QEXA 3JAMi 1L0WA 5M3FG 4GS3A 1OXUA 4J15A 3PO3G 1JB7A 4IOAA 1VQBA 4HJ9A 3KJPA 3PGZA 1I5FA 4L5TA 5FJ8H 1OTCA 1Y1WG 1J6QA 4A3FG 1YITA 4HJ5A 2PI2E 5FLXc 4Y7NH 4POGA 3AYHB 4AYBE 2PI2A 4X64L 3RNUA 1L1OA 2Q2UA 4JBMA 2EXDA 1XPUA 4ALPA 4DR4Q 5IWAL 4JI0L 4R4OA 3K0XA 3M9BA 4JC0A 3HOUH 2VQFL 1C0AA 3AFQA 4R4CA 4UP7A 2ATWA 5JJIA 1UE1A 3CD6A 3UDXA 4GN3B 4MNOA 3KDFA 4LF7Q 3RZOH 3UDIA 2R92H 4BXXH 3RLFA 3GTPH 3TEHB 1B8AA 1HJPA 2KHIA 4RMFA 1N8RC 2E2HH 1M1KC 2UUBL 1VQ8A 3W1BA 4X65Q 3CCJA 4NB3A 1FJGL 4DUZL 4JI4Q 4NPSA 5IYDH 5BR8L 4A3IH 1SFOH 1VQDA 2PQAA 1GM5A 4YWLA 5JJLA 4DAYB 1VQ7A 3CC7A 2BA0A 2A19A 3L7ZC 2OWOA 1VQEA 4O2DA 3W1GA 1IBML 4GNXC 2WB1E 2Z0SA 1YNXA 4Y52H 3PIPA 3H0GH 3CPWA 1NTGA 3EBEA 2B29A 2CKZB 4EQ5A 2JA8H 3PV0A 1YJ9A 3H3VI 4B3ML 2Z6KC 2E5LQ 4DAMA 1PYSB 1CSQA 1PV4A 4KHPL 3J7ZC 2JEAI 3GTKH 1Q12A 1NJIC 1JJCB 2YYZA 5FLMG 4L5SA 1VQGA 3CCSA 1VQHA 4HIDA 1CKNB 2VQEQ 2AHOB 2B63G 3RR5A 2JEBI 2WP8J 1X56A 1ASYA 1M90C 1KD1C 2YV5A 2K4KA 5HY6A 1XPOA 4PMWA 4PZ6A 4QIWE 4HJ8A 1EFWA 4L5RC 1Q8KA 3OTOQ 2HIVA 1A8VA 3M7NA 1WCMG 3DM3A 4DV7L 4DR5Q 3L0OA 2UUCQ 1XNRQ 3PUYA 4A3JH 2UUAQ 3PUVA 1H95A 3G48A 4LF8L 2K5HA 1JMCA 4A3KG 2LSSA 4YY3Q 4UP9A 4OWWB 4OO1G 3CP0A 1HZCA 1E22A 3LGJA 4RG1A 3A5ZB 4A3MG 4YHHL 1WYDA 3D0FA 2KENA 1OXXK 5C44H 1YBYA 2NVQH 4DR6Q 4A93G 1N32L 4C2MH 2WAQE 2VUMG 4BY7G 1EUJA 4LFBQ 1RL2A 4LFCQ 3HOYH 3CCQA 5ELNA 3G4SA 1PH3A 1KQSA 1KRTA 3F1ZA 4A3DG 4B3RL 1PH8A 4BBSH 4QL5A 1HR0L 4GN4B 1VQLA 4GKJQ 1KAWA 3JC66 3CCEA 4DR1Q 4DUYL 1D7QA 1TXYA 4X62L 4JI3Q 1VS0A 1I6HH 4JOIA 2WB1G 3TQYA 2JA6G 3I4OA 2I0QA 4GLVB 1N33L 5BR8Q 3J7A5 1GO3E 2C35B 3CC2A 2NN6I 2RHSB 3NELA 4JI8L 4A3CH 3W5OA 4B3SL 2JA5H 2R7FA 2BH8A 3HOXG 1L1OB 2F52A 1TWGH 5C3EG 4A3LH 3PCOB 4DV3L 1HR0W 4DR7Q 1SN8A 1EQQA 3I56A 4DR3L 4DV1Q 2CWAA 3I7FA 2HHHQ 4NXMQ 2K5VA 4BY1H 4DK3C 1Q82C 4A3GH 4HIKA 2YTXA 4IJHA 2ZJQA 5GROA 3MEFA 4C3HH 1K0RA 1VQMA 3PF4A 3KDFB 3H3VH 1VQAA 1TWHH 5IP9H 1XPRA 1JJ2A 3HOVH 1K8AC 2D62A 4LFAQ 3K8AA 1A62A 3EIVA 2ZM6L 4B3TQ 2CFMA 3KJOA 1OXTA 3I4MH 1S3OA 1VQIA 4GOPA 5IYCG 1EOVA 3CW2C 2N78A 3CAMA 1YZ6A 1QZGA 2PQAB 3BJUA 3STBD 3FP9A 4OWXB 4LF6Q 2Q2HA 2Y0SG 3NEMA 3T1YQ 2MO1A 1V43A 3S1MH 3M4QA 1IBLL 1XMOL 1XMQQ 1NMFA 5C0XG 1WI5A 4A3BH 1B7YB 1R9TH 1LUZA 3GO5A 3I2ZA 4ME3A 4R1JA 1JJGA 1PFSA 2NZOA 5FJ8G 4DPGA 3STBC 2UU9L 4NXNQ 5LMNL 3ER0A 3UE1A 3GTGH 1D8LA 2F3IA 3I4NH 4DR4L 2K52A 3KYHC 1N34L 4OXPA 5JEAG 3S24A 3ZJYC 3KFUA 1FL0A 3KOJA 1MIUA 4YCVA 1N36L 4JI2L 2GN5A 2VNUD 2VL6A 1SLJA 4DR2Q 2BA1A 2ID0A 1N9WA 2EQSA 1TWFH 5J3BA 2ZTEA 2K5NA 3PSIA 4KHZA 4DV5Q 4OO1I 2AWOA 4APVA 2N8NA 2R92G 4QJFA 1SMXA 2H5XA 1QVCA 5LMNW 1C7YA 4OX9Q 1PA6A 4LF4L 3I55A 2UUCL 4DR6L 1Q1EA 3E0EA 3ULLA 4R4IA 1PH1A 4K0KQ 1UE7A 4LUOA 4LUVA 1VQKA 2EIFA 1O7IA 4X62Q 5IYDG 1I94Q 2JA7H 4DK6C 5IT9c 2UXCQ 2UXDQ 1KL9A 1HNZL 1P8LA 2UXBQ 1IZ6A 1Q1BA 5DLQE 4GKKL 1G291 4BBRH 5M3MH 1FGUA 3S2HH 1Y14B 2IT1A 2N3SA 4GLXA 4X66Q 1Z47A 2OTJA 1T9HA 5LMUQ 4DV6L 4QY7A 3D31A 1VQJA 4P74A 4IPDA 2VW9A 1VQ6A 1JT8A 3E9IA 3T1HL 1WJJA 2RCNA 1BBUA 4DV3Q 5C4JH 2NVTH 4A4IA 1PH4A 3PUZA 1SE8A 3S16H 1KHIA 1TWCH 2D0OA 3U4VA 5IP7H 4LF9Q 1NY4A 4IO9A 1X3FA 1VQCA 4JI5L 3PUXA 4JI6Q 5AJ3L 4LF5Q 1HNWL 3F2DA 3HKZE 1K83H 1U5KA 2KCMA 4DV2L 1VQPA 1IBKL 3S1QH 2OTLA 3GTOH 3ICEA 1X54A 3AFPA 1EWIA 3SGIA 4UP8A 2CWPA 2MFIA 3PO2G 1NBWA 1HNXL 2F4VL 4AH6A 1Y1VH 2IY5B 2ZTCA 4AYBG 4JV5L 1WFQA 4UY8C 1U0LA 5FLMH 1EYGA 3GDEA 2R7ZH 4A3JG 5C4XH 4GNXA 2GVBA 4AQYL 3KF6A 3RZDH 1HZBA 2GVAA 2E8GA 3CPFA 2B63H 1MJCA 4JI1L 1K73C 1VCIA 4JI7L 2Z6KA 1BBWA 4X64Q 1J5EL 1QVGA 3GTQH 1CSPA 4O0AA 1SRUA 1I3QH 1P16A 3K80C 4FDBA 4IPCA 4EX5A 3OYYA 5IWAQ 2DUDA 5C0XI 1V1QA 4TQUS 5C0XJ 4JI0Q 2VQFQ 5C44G 3U58A 2LXKA 3BZCA 3OW2A 1X3GA 5HGQA 1N36Q 4QQBX 1I50H 4BA1I 2PNHA 2NZHA 3HOYG 2JA9A 4WJ3M 3Q8DA 4GOPB 5JEAJ 3A0JA 1K3RA 2LXJA 4A3KH 4MTNA 1YJWA 1SR3A 2AKWB 4R4QA 4YCWA 1V9PA 1X3EA 3ERSX 1AE3A 1YJNA 1UE5A 1LYLA 2UUBQ 4L5QA 1FJGQ 1OXSC 3HOWG 4DUZQ 3K81C 3S15H 4KI0A 1AE2A 2B3GA 3UE0A 4XIGS 4PG3A 4P71A 3NBHB 3FHWA 1QUQA 3HOZH 1YHBA 2I5LX 2L15A 4BY7H 4LF7L 4YWMA 4A3DH 2R93G 5IYBH 1TWAH 3GTMH 4A3CG 2JA5G 2OQ0A 1IL2A 1AH9A 1IBMQ 3G6EA 1EQRA 3NENA 1PYBA 4C3JH 2V1CC 3GTLH 2QGQA 2BH2A 2JQOA 1A63A 4B3MQ 3F2CA 1L2FA 4BY1G 1Q81C 1PH7A 1XJVA 4KHPQ 4DV4L 1GVPA 1B70B 1CKMA 1GD7A 3PIOA 2AWNA 4HIMA 3HOVG 4JCVE 1FVIA 1KC8C 2A8VA 3HOXH 3S14H 2K50A 1UEBA 3RLNA 4A3EH 3CCRA 1K9MC 2PMZE 3RN5A 4DV2Q 2ES2A 2R7DA 1IBKQ 3TRZA 1L1OC 2IHEA 2VZAA 3FKIH 3UDGA 1HZAA 3CF5A 3AQQA 3GD7A 3MXNB 1S72A 2OQKA 1W2BA 1EIYB 4IOCA 3TREA 5M5WH 4DV7Q 3CXCA 5GQOA 3K7UC 4JV5Q 1E3PA 2VQEL 4JYAL 4IFDG 1YEZA 4LF8Q 4AIMA 2WAQG 1PH2A 1VQNA 2Q2IA 1VQ4A 1XNQL 4PZ7A 1YIJA 3K7AH 3ULJA 1J5EQ 3HOUG 3RLOA 2HT1A 4YHHQ 4LUZA 4DR5L 2XGTA 1N32Q 5M3FH 5IY0A 1KIXA 1XNRL 2JK8A 4BA2I 2UUAL 3PO3H 3CC4A 3BU2A 3DLLA 1E1OA 1E1TA 1XTDA 4B3RQ 1X6OA 4JG2A 3CMAA 1Y1WH 5K36G 4A3FH 4P72A 2YTVA 4BXXG 2DGYA 2ZJPA 3IRBA 4YY3L 1HR0Q 1EIFA 2AMCB 2XTIA 4DUYQ 2E2IH 3HKSA 4YCUA 1K8GA 5M5XH 4A3IG 3S2DH 3WWVA 1DGSA 1KRSA 4LFBL 2CCZA 4LFCL 2JA7G 5E7NA 4GNXB 1NMGA 3KF6B 3VDYA 1N33Q 1HH2P 4BBRG 4JI8Q 3ULPA 4B3SQ 4GLAC 5M3MG 3H0GG 3B6YA 4JBKA 1X65A 4GKJL 5EAYA 4DR1L 1YHQA 2YU9H 2JA8G 1PH5A 2NN6G 4JI3L 3S17H 4DR3Q 2JJQA 4LW1A 3PUWA 1YI2A 1IYJB 1NE3A 1OXVA 1BVSA 3GTJH 1ASZA 4X6AH 1IXRA 4TVAB 1GKHA 1VQFA 5IP7G 4DV4Q 3KF8B 1YVCA 4LWCA 4YWKA 1YHAA 3TS0A 1MJEA 3H15A 2ZM6Q 4R4TA 4DR7L 3L2PA 1LM0A 2MO0A 1G6PA 4DV1L 5IE8A 2HHHL 4NXML 3BZKA 4HJ7A 1HZ9A 1Q86C 2HIXA 1UE6A 3EN2A 1QZHA 1QUQB 1Y1VG 3F8TA 4JBWA 3U4ZA 1QVFA 5GADC 3TS2A 1IBLQ 1XMOQ 1X55A 4LFAL 4KLKA 2R7ZG 4OONA 4B3TL 5C4XG 4A75A 2A1AA 3M4OH 1WOCA 2YTYA 5M5YH 1Q7YC 1PH9A 2UU9Q 4JYAQ 4PZ8A 1PH6A 5LMNQ 4DV0L 3M85A 2NVYH 1S40A 1VQ5A 4LF6L 3PO2H 2RF4A 1N34Q 1XNQQ 3T1YL 3CQZH 2KBNA 1WCMH 4IFDI 4JOIC 4A76A 4IFDJ 1XMQL 2HQLA 1CUKA 2KHJA 4JI2Q 4HJAA 1E24A 4DKAC 1BKBA 2IX0A 1CKOA 2JE6I 4NXNL 1JE5A 2ZJRA 4BBSG 3CCMA 2Y0SE 1G51A 3PF5A 2R6GA 4LF4Q 1PVOA 3UDFA 2NVXH 1MKHA 3CCUA 2IHFA 4A3MH
chains in the Genus database with same CATH superfamily
4A93H 1VMPA 3M3YH 4DR2L 1RIPA 2Q2TA 2I5HA 2AUKA 3MZ5A 4GKKQ 2ALYB 4CHTB 1A3UA 4A3LG 4P73A 4X65L 4JI4L 2R7ZB 3T1HQ 4DXFA 2RQXA 4DN4M 2BDOA 3U50C 1ET9A 3J81j 1VQOA 1UWVA 1HRJA 3BDCA 4JBJA 2Q8TA 2MGSA 2LY7A 2I5MX 4PNYA 3K58A 1HNWQ 4P75A 5J39A 2NZ1D 3QWNA 1F2LA 4KN4C 2QA4A 5IT9L 3JAMc 3DMUA 4LF9L 1V1PB 2ZTDA 4XQQA 4G7OC 1IW7C 2MP1A 2OT2A 4IJLA 1Q8IA 4QUCA 1Z9FA 4CJ0B 3S15B 1K28A 2K75A 2RA4A 1H9JA 1NAPA 1Q3LA 3D4RA 4DV0Q 4K8JA 2F0KA 2Q8RE 4J15A 3PO3G 3DEOA 1VQBA 4HJ9A 1I5FA 4L5TA 1Y1WG 4POGA 1B3AA 2Q2UA 2F0EA 4AYBE 4JBMA 4ALPA 3HOUH 1C0AA 2ZXRA 2ATWA 3ONAB 4N9TA 2F0QA 3V2TA 4BXXH 3TEHB 1SNCA 2KHIA 1D5MC 5BN4A 1M1KC 1A15A 3OIQA 1VQ8A 4X65Q 4JI4Q 3EVQA 4CJ2C 5BR8L 2LMCB 1GM5A 4YWLA 2BOSA 3EQLC 4OHJA 1IBML 2Z0SA 1YNXA 2RVLA 3OSOA 2CKZB 2JA8H 2WACA 4DA2A 1B9MA 4R8IA 3GTKH 4XT3B 1DOLA 1XWEA 5TSSA 1VQGA 4E6IA 1VQHA 5M5XB 3Q0AA 4RFBA 2B63G 3RR5A 2G9DA 1ASYA 2TMPA 2K4KA 5HY6A 1U4PA 1QCBD 2ZXPA 2B2TA 1WCMG 3DM3A 4DR5Q 2UUAQ 3FPUB 4CKCA 4ZKCB 2LSSA 4YY3Q 1QWYA 4OO1G 4OIKA 1HZCA 1E22A 1MHWC 4RG1A 1N32L 1EY5A 1EY0A 4N8FA 2VUMG 4LFBQ 4A3DG 5ELNA 3MVVA 3G4SA 1PH3A 1KRTA 1GUNA 2F0HA 2LKVA 3MXPA 2HCCA 1BCPC 3QB3A 3GTKB 5KIXA 3KLRA 3G7LA 4C3JG 4S3SA 2D9UA 4B9WA 3NE5B 3N52A 3P75A 3TQYA 4HSVA 1SXTA 1N33L 5BR8Q 2NN6I 3PO2B 2JA5H 1TIID 4FXKC 1WCMB 2HQEA 3HOXG 4AYBB 2F52A 3Q23A 1TWGH 3PCOB 1SE3A 1STEA 3C2PA 2DNCA 4DV1Q 1Q82C 4IJHA 2CHBD 4ZUJA 2ZJQA 3KDFB 1LTAD 4FYDA 1D2BA 5IP9H 2CVRA 1PXUA 4LFAQ 1K8AC 3K8AA 1G91A 3EIVA 1SEBD 3KJOA 1OXTA 1S3OA 1VQIA 5KGUA 5I9OA 1SNOA 3CW2C 1YZ6A 3STBD 3V96A 3CHBD 2Y0SG 4C3IG 1V43A 4RHSA 1IBLL 1XMQQ 4J8QA 1WI5A 4A3BH 2PCFB 1R9TH 3I2ZA 1JJGA 1PRTD 2NTSA 2NZOA 2VB2X 5FJ8G 5I2YA 5LMNL 5IGCA 1F2MA 1I4HA 2R93B 5I4DA 2ZXOA 1NUCA 2VNUD 3L3OC 5KRUA 1N9WA 3S1RB 4OO1I 5EBDA 1GUGA 4QJFA 5A2QE 1EU4A 4OX9Q 1PA6A 4LF4L 2UUCL 2UXCQ 1FNVA 1I94Q 4DK6C 1AZQA 2UXDQ 1P8LA 1IZ6A 1Q1BA 4IUPA 1G291 4BBRH 2Y0SB 1Y14B 4DV6L 1U4MA 1JT8A 3D31A 1GUWA 2NVTH 1BBUA 1LACA 3MA2B 4A4IA 1RJTA 1PH4A 5HGTA 1WTVA 1TWCH 3U4VA 5IP7H 3QO2A 1VQCA 1GOZA 4JI5L 3SR1A 3H91A 5AJ3L 4LF5Q 1K83H 1U5KA 2JN4A 1Y8OB 2OTLA 5CV7A 1H9SA 2RSNA 1HQMC 3RZOB 1HNXL 1O7ZA 1QOHA 1GHKA 2NBFA 1EIHA 3K5MA 1KNEA 3MAQA 1EYGA 4KKSA 5C4XH 1TT2A 1HZBA 3J80L 4JI1L 1QE6A 3KUPA 4X64Q 3C1EA 1QVGA 1CSPA 4BBRB 1V1QA 4TQUS 1J9OA 2VQFQ 1BUVT 1II3A 3BZCA 2A6HC 5CV8A 3J7AV 1I50H 4BA1I 1BCPB 2NVTB 3MHBA 4GOPB 4RKLA 5EKIA 1DM0B 2B2VC 2KEEA 1K3RA 3A0JA 3Q22A 2LXJA 2QCPX 2K04A 1SR3A 4DNTB 1V9PA 5M9OA 1FJGQ 3HOWG 3IL8A 4DUZQ 3X3MA 1WTHA 3A8IE 4JPBW 5C5MA 1LTSD 1QUQA 4BY7H 3NTHA 4Q5VA 5IYBH 5FKAC 1AH9A 4FF4A 5DM63 3J81E 2E2DC 3G6EA 4GZYC 1EYDA 1PYBA 1A63A 2QGQA 2XNAC 4B3MQ 2TSSA 4FXDA 1WD0A 3PQIA 4C3HG 4I7ZC 3WOFA 2L55A 3K6OA 5BN3A 4C2MB 2ICEC 4RCOA 3TP5A 3S14H 2K50A 3CCRA 2C9OA 1L1OC 3GD7A 3MXNB 2NUCA 1W2BA 4IOCA 1SBBB 5M5WH 1R4QB 2L0CA 4QB4A 1AZPA 4JYAL 4IFDG 3OPOA 4LF8Q 1K8OA 2WAQG 5CGKA 1O7YA 3E5SA 3NHHA 2Q2IA 5C4ZA 4KV6A 3PIP3 2DY8A 2F0UA 1ZYRC 4H13C 4FF1A 1H9MA 5IY0A 1XNRL 3CC4A 3BU2A 3K5OA 3OW7A 4A3GB 5C0XH 1F77A 5K36G 3A8KE 3CMAA 4K14A 4P72A 4C3HB 1HR0Q 3A54A 5E4XA 2CH4A 1DJRD 3G6JB 3OWEB 4FO2A 3WWVA 1BQQT 4LFCL 1ICFB 3TSSA 1EY9A 2K5WA 2EY5A 3H0GG 4JBKA 1AW7A 1F9PA 1PH5A 3S17H 4DR3Q 1IYJB 1OXVA 1S4ZA 3D4DA 3GTJH 5KNDA 3GTGB 1G2SA 1VQFA 3I73A 3I4NB 3F2UA 1YVCA 1Q90A 1YHAA 2E75C 3TS0A 1GUTA 5IIFA 1MJEA 1STBA 2ZM6Q 3A55A 1LM0A 2MO0A 4ILWA 2HHHL 1HZ9A 2HIXA 2K1BA 4ID6A 4PMBA 1QZHA 1Y1VG 3R3OA 1QVFA 4XT1B 2QILA 3VYUA 4B3TL 1DCZA 3GV6A 4A75A 1PH9A 1Q7YC 5EPLA 4JYAQ 3SXHA 2F0GA 1PH6A 3AU7A 2NVYH 1S40A 2RF4A 3S2HB 1TVXA 4IFDI 4MHEA 3T56B 4IFDJ 4A76A 2G5DA 1CUKA 4JI2Q 1CT1D 2B2UA 3TZDA 4DAYA 4K5VA 4XDXA 2L12A 4CDDC 3CCMA 4RH6A 2RSOA 1G51A 3PF5A 3KLSA 1MKHA 3CCUA 5EKLA 2K14A 4OIJA 3CCLA 4RKBA 4PV1C 1KXLA 3S1QB 1SNQA 5JJKA 2QW7A 4DV5L 1Y1VB 2QDLA 3S9WA 1PDQA 1CKNA 1SMYD 1JCKB 5CORA 1I4PA 1K3BC 5D65A 2IX1A 1ILPA 4K0KL 2FINB 1I4GA 3RZDB 3HKZG 3J81c 2JA6H 1MBYA 2E2JH 1LTLA 2UXBL 3RUZA 4XTCS 2N88A 3A74A 5ELOA 1A0IA 2NVYB 3AEVA 1S5FD 5C3EH 3F2BA 3I4MG 4FF3A 2IW3A 3HFZB 3FKIG 3RN2A 1X9NA 4IN3A 4A3KB 3NXWA 4HIOA 2IL8A 4ZLTF 4IPGA 2OEOA 4JI6L 5D3IB 3CKIB 4AQYQ 2VS1A 1PTOD 5D3DA 2MNAA 4CDEC 3KLWA 2OF1A 5IYCH 2L5TA 4U68A 4KTAA 3J80i 4RGOS 3OTOL 2K7VA 1CM9A 1ENAA 1L0WA 5M3FG 1EQVA 3BVZA 3DWAA 1JB7A 2G9HD 1NR2A 1OTCA 1J6QA 4HJ5A 5FLXc 5JAVA 1L1OA 3VA5A 2L9HA 2FFKB 2X6LA 4DR4Q 5IWAL 4R4OA 1I4XA 1BBXC 3NQIA 4UP7A 3BDOA 2GA4B 2EYMA 1LT5D 4DNRB 3FKIB 1TU2B 4GN3B 5L37A 4LF7Q 4PMCA 2KJXA 1IYUA 1HJPA 1N8RC 2UUBL 4RGTA 1KNAA 4NPSA 2A6ED 4A3IH 5JJLA 2PQAA 5E1FA 2BA0A 1JWMD 2A19A 3L7ZC 5CV4A 1PYWD 4O2DA 4GNXC 3ND9A 1ESFA 1NTGA 3PV0A 4RAUC 2ZT9C 3SK5A 3H3VI 1PYSB 1CSQA 3E3XA 1JJCB 2F1MA 1F2YA 1FNWA 4L5SA 3J7AF 1FYCA 4DFAA 1HTPA 2E2IB 4L8JA 2VQEQ 5DAUA 2EZVA 1LLRD 1TS2A 2YV5A 4N9PA 1XPOA 3LNNA 4HJ8A 3OTOQ 1KDAA 3I4LA 4DV7L 4L6TB 2NWGA 5G3LF 1NCVA 3M4YA 1ML0D 3PUVA 2PMZB 2K5HA 5CV5A 1JMCA 2XRSD 4NMZA 3C3LA 3CP0A 1E2VA 3LGJA 3A5ZB 1CZWA 2IPKD 4KN7C 1WYDA 5ELFA 1CQFA 1X3PA 3BYYB 4BWGB 5IGEA 4G7ZC 1SYCA 4A93G 1W6JA 4FNFA 2F0OA 1UAPA 3CCQA 1KQSA 4B3RL 1K0SA 2MHVA 4BBSH 2EXZA 2SNMA 4GKJQ 3R2TA 1WD1A 4M8AA 4DUYL 5LL6S 2QEJC 2WKCA 4XQJA 5C5LA 4B9XA 2I0QA 1HPCA 3J7A5 1GO3E 1U9RA 4XXEA 2RHSB 3NELA 2Z8LA 3D8GA 1DD2A 2EOTA 1AFPA 1PMRA 3W5OA 4LK1C 1SDFA 2VXWA 4A3LH 1U4RA 4DR7Q 1HTLD 2R61A 1SN8A 4RHRA 4NP5A 3I56A 4G7HC 3CU7A 2HDMA 3LX0A 2K5VA 5I6WA 1EY8A 2ENBA 1XX8A 3TN2A 4A93B 3J80E 1A62A 1EZ8A 2HD3A 3M3YB 1KAAA 1EOVA 2P5ZX 1LTBD 2N78A 2HDLA 4OWXB 2Q2HA 1Y8NB 2M00A 3S1MH 3V05A 1NSNS 1B7YB 3NBHA 1LUZA 2F0DA 4DPGA 4IUTA 3STBC 3UE1A 1D8LA 3U9SA 1N34L 4OXPA 3S24A 1W6KA 3ZJYC 2RCFA 4U673 1FL0A 4X3KA 1HXYD 4YCVA 1PRTC 3W3AA 1SLJA 4DR2Q 1AN8A 3PSIA 2K5NA 1G6ZA 2AWOA 4LAAA 4APVA 4KKTA 1ESRA 3TP8A 1MSHA 4DR6L 4WRDA 1IKMA 2JA7H 1UEAB 1HNZL 3T51B 2EYFA 5DLQE 5M3MH 1XTCD 2F3WA 2OTJA 3ERQA 2NN6H 1VQJA 1VQ6A 2LS01 3E9IA 4C56C 4NW2A 5C4JH 1SNDA 3PUZA 2F0VA 2NYZD 3S16H 1KHIA 4ZAIA 2D0OA 4LF9Q 5JJZA 4IO9A 3R2IA 4MN3A 1D5XC 1X3FA 1JOOA 5T1IA 3HOUB 3F2DA 1VQPA 3I91A 3A56A 3GTOH 1X54A 2AQ2B 2CWPA 2MFIA 3PO2G 2J7ZA 1NBWA 2F4VL 1DXMA 2F0TA 3QOJA 5EBCA 4AYBG 5F2DA 3NK9A 1U0LA 4OL7A 5AFWA 1F9SA 3OMCA 4GNXA 3QG1A 2XIWA 3KF6A 2B63H 1MJCA 4JI7L 1SNPA 1BCPF 1J5EL 4HMJA 1A6XA 3GTQH 1I3QH 2FHTA 4EX5A 4EQPA 3OYYA 5M3MB 3JAML 3NBIA 2JA8B 2NZHA 3AMUA 3MXUA 3OWFA 3KF8A 3Q8DA 2AKWB 3QOLA 1YJNA 1MGSA 4OO1H 1OXSC 2JXMB 3K81C 4KI0A 1AE2A 3UE0A 4LMQD 4XIGS 4PG3A 3HOZH 1YHBA 4KHVA 3M7GA 4A3DH 1GJXA 2R93G 2RDHA 1TWAH 3GTMH 3FRPB 2JA5G 2OQ0A 1IL2A 1IL8A 1IBMQ 1SYDA 3J7YW 4C3JH 3GTLH 2BH2A 3F2CA 1PZJD 1Q81C 1PH7A 4Q0FA 1WTWA 2K05A 2PW7A 3NQTA 4ULLA 1GVPA 4FXGC 1CKMA 1EY4A 3IFTA 4JCVE 1STGA 3FMCA 3HOXH 3SK8A 2JSOA 1Y69U 2A8VA 4A3EH 4G4KA 3RLNA 2HCIA 3RN5A 2ES2A 3UDGA 2B2YA 1HZAA 1WTRA 3H09A 1B3QA 4RWSC 3CXCA 5GQOA 3NPPA 1E3PA 1YEZA 4AIMA 2PZWA 4P2CB 3VR5A 4HEDA 1CI3M 4PZ7A 2JA5B 3K7AH 1PRTB 3ULJA 1J5EQ 1TWAB 3GTMB 1TWGB 2NB0A 2XGTA 4K5XA 4KJNA 1N32Q 1WTXA 2JK8A 4BA2I 3DLLA 4A3FH 3MXGA 1H9SB 2ZJPA 1CHPD 3P7JA 1EIFA 1AP0A 2SDFA 4YCUA 2J0TD 1SJED 3S2DH 1KRSA 3OHXC 4HMIA 1NMGA 2B2WC 1N33Q 5IODA 4BBRG 5T1GA 2F0NA 3ULPA 3R93A 1ILQA 1X65A 1B1ZA 5C3XA 5KYIA 4DR1L 2YU9H 1T5EA 4A3BB 4JI3L 2QKIC 1R9TB 3PUWA 3Q6SA 1NE3A 1BVSA 1GKHA 5IP7G 2B2UC 3SVMA 2A69C 1L0YB 3H15A 2V4DA 4G57A 4KY6A 3FPPA 1DOKA 4NXML 3BZKA 5ISRA 2KA7A 1IHZA 1UE6A 4IALA 3EN2A 3K59A 1QUQB 3F8TA 4JBWA 5ELBA 1JE4A 2DJFC 1IBLQ 5C4XG 4HTHA 5NUCA 3M4OH 1WOCA 4XQNA 4UDUC 4ZKBB 5LMNQ 3M85A 4LF6L 2EVBA 4IUUA 1DOMA 5ELCA 3T1YL 1MSGA 3CQZH 2KBNA 3RMHA 1MI2A 4JOIC 3OOCA 3NTIA 1KDBA 4CDCC 5JPMC 2JE6I 4NXNL 1JE5A 2ZJRA 1TWCB 4DK0A 3X3NA 4LF4Q 2CW0D 2NVXH 4A3MH 2IHFA 2F0MA 2UUCQ 1KABA 1K83B 2L11A 2A73B 5GAEC 2VY3A 4I65A 4DNIA 5IYBG 4F88A 3QJYA 2ASBA 3ITPA 4DV6Q 3S1NH 3GQBA 3A5UA 5C4XB 4A3GG 2N49A 1RD9D 3HOWH 3MTSA 1Z7TA 1A2TA 4MZ9A 5GAGC 2RHQB 1E7ZA 2WFWA 1PFBA 1VQ9A 1SMYC 4WJ4A 5E4WC 4JI5Q 2KCNA 5E3FA 1HHVA 4X66L 1DZ1A 5AJ3Q 5LMUL 5DNFA 1I50B 4QGUA 2FMMA 3IFDA 3HEJA 1HNXQ 1G2TA 2XN9C 3TMEA 3R8BA 1TR5A 4LNQA 4A3MB 3CCVA 1LTGD 4IQZA 4BY7B 4JI1Q 3I4NG 3IKJA 1EU3A 3TP6A 3M4PA 3K5NA 2CQOA 2OCEA 4TRDA 2Z4IA 3JAMi 3SDZA 2JP1A 4GS3A 3S1NB 1SYFA 2F0WA 4X3TA 4IFDH 2O5JC 4Y7NH 1FNUA 2PI2A 1PLFA 1EL0A 5JEAH 4JI0L 3K0XA 3M9BA 1X32A 2RBMA 4K6LA 3S14B 2FJ2A 5JJIA 4ZQ3A 3UDXA 4MNOA 3UDIA 2HUGA 2E76C 2R92H 1SSOA 4CJ1B 3GTPH 1B8AA 1M4VA 4RMFA 5M5WB 2E2HH 3DM1A 4HN7A 5IT9E 3W1BA 4HCSA 4NB3A 3H3VC 1RTNA 5IYDH 2A68D 2QF7A 1SFOH 1VQDA 4DAYB 2F0FA 2DY7A 3W1GA 2WB1E 4BS9A 4Y52H 3PIPA 3H0GH 2A6EC 5I9PA 2B29A 1JC7A 2VB3X 2Z6KC 1STHA 1PV4A 4KHPL 3J7ZC 2JEAI 2B2WA 1QG7A 2EY1A 5FLMG 1EFID 3U9OA 3I8ZA 1WTPA 3FVQA 1CKNB 2AHOB 1RKNA 1B2TA 2JEBI 2WP8J 1X56A 1M90C 1KD1C 2PQEA 4PMWA 2RDGA 1PZKD 4QIWE 4L5RC 2R92B 2HIVA 3M7NA 2SEBD 5KEEA 3L0OA 1YNJD 1XNRQ 3S17B 4A3JH 3L9AX 1E2ZA 3GTJB 2K33A 3PIO3 1HUMA 4A3KG 1SFOB 1E2WA 2PNRC 3H6MA 3HGBA 5K5PA 3WDNA 4X3UA 4YHHL 1RTOA 5C44H 3D0FA 2NVQH 1TY2A 1STNA 5KNCA 4M1UB 4LFCQ 3HOYH 5CV6A 1PTOH 1CZGA 4QF4A 4GN4B 2XVSA 1KAWA 2F3VA 3BYTB 1I6HH 1JQYD 2WB1G 4JOIA 3K57A 2JA6G 4GLVB 3NWSA 3CC2A 4JI8L 4A3CH 4JW0A 4B3SL 2B39A 2BH8A 1L1OB 5JVH3 5C3EG 4DV3L 1HR0W 5A2QL 2HHHQ 3CRLC 1BXTA 3I7FA 5FO8B 4A3JB 4BY1H 2H4OA 4HIKA 1D1KA 1B50A 5GROA 3MEFA 1VQMA 3PF4A 4F87A 1V8QA 3H3VH 1DONA 3I3CA 1TWHH 1XPRA 3HOVH 1Y8PB 4B3TQ 3I4MH 2NVQB 1BR9A 4ZK9B 5ELDA 1SAPA 5IYCG 2EYJA 3C46A 3JAME 4J6HA 2PQAB 3A7AB 2K32A 1GHJA 3NEMA 3M4QA 2D5DA 4IUNA 1XMOL 1NMFA 1O7LA 2EYLA 4UHVA 2WB1B 3GO5A 2JA6B 1YNND 2E2JB 1PFSA 1I6HB 2UU9L 5EKKA 3ER0A 3FDTA 3T13A 1UUPA 1QILA 5LL6X 5C3EB 3KOJA 2GN5A 5C4HA 3D4WA 2VL6A 1WVLA 2EQSA 1TWFH 2H1EA 2ZTEA 4DV5Q 4KHZA 1HA6A 2N8NA 1SMXA 2H5XA 5EJWA 1QNKA 3I55A 1Q1EA 1STAA 3ULLA 3HZXA 4R4IA 3NTKA 1PH1A 4K0KQ 1UE7A 4K2KA 4LUOA 4LUVA 5D14A 5IT9c 1BNZA 4TKOB 2UXBQ 1PZID 4GKKL 3SK4A 2IT1A 1T9HA 4P74A 4IPDA 3T1HL 1BF4A 2RCNA 4DV3Q 2F0JA 2PW5A 4FVMA 2Z6BA 1J8IA 2F0IA 3VYSA 4O42A 4JI6Q 3DWQA 1HNWL 1XYIA 2J4XA 2KCMA 1IBKL 3AFPA 3SGIA 1TS5A 4UP8A 1ET6A 1VDZA 3J81L 1D5ZC 1TWFB 1A3TA 4JV5L 1WFQA 2F4IA 2Q8IB 3P20A 5JPNC 2R7ZH 4MTKA 2GVBA 4R8NA 4A3IB 2E8GA 3CPFA 5FO7B 1EYAA 4F8MA 4FP5D 1K73C 1BBWA 2Z6KA 1B4OA 4K5WA 1SRUA 4IPCA 3K80C 2EDGA 1LTRD 5IWAQ 2DUDA 1C48A 2F03A 1O80A 3TZUA 3U58A 2O5IC 2LXKA 1F2ZA 5HGQA 2PNHA 1SE4A 5EPJA 2JA9A 4CDFC 4WJ3M 2IJ0A 4CKBA 4MTNA 1YJWA 1K8MA 4YCWA 3ERSX 1AE3A 5ELEA 1UE5A 1LYLA 1A3VA 2B2YC 2XWJB 2UUBQ 4DAVA 3S15H 1RODA 2B3GA 3NBHB 2EYHA 3FHWA 2I5LX 3NUCA 3CRKC 5FLXL 1X3QA 3T4AC 1UNSA 3AB9A 2Z1CA 3NENA 1EY7A 2V1CC 3Q24A 1L2FA 4KY7A 1AEXA 3DEPA 5COYA 2EY6A 1ZKOA 1XJVA 1SJHD 4DV4L 2RKSA 1GUSA 1OO9B 3EJIA 3C1FA 3IAYA 4EQOA 1FVIA 1KC8C 4FF2A 5EGTA 3MEHA 1IBKQ 2IHEA 2VZAA 3AQQA 1NNXA 1KLGD 2CH4W 4BBSB 4YIJA 1S72A 1EIYB 3TBIB 3TREA 4DV7Q 4V190 2L1BA 3K7UC 4JV5Q 3BG3A 1PRTF 1U4LA 2I07B 1VF5C 1PH2A 1VQ4A 4OEMB 1CFMA 1YIJA 1SYBA 3HOUG 2HT1A 4IUVA 1NR4A 4DR5L 2I46A 3K0YA 3P1HA 1KIXA 2UUAL 3PO3H 3EA6A 1ONLA 1E1TA 4B3RQ 1X6OA 4JG2A 1Y1WH 4BXXG 5J1ZA 1SYEA 3MWYW 4YY3L 2AMCB 4DUYQ 3HKSA 5LHY1 1K8GA 5M5XH 1DGSA 2XWBB 3HG9A 1KLUD 2JA7G 4LFBL 5E7NA 1HCZA 1O78A 1CQVA 3KF6B 2BE5D 4GNXB 1V1PA 1HH2P 4RCNA 4LJZC 3SK6A 5M3MG 3S1MB 5EAYA 2JA8G 1I6VC 2NN6G 3O13A 1ASZA 4X6AH 1IXRA 4TVAB 3VYRA 3RD4A 4F7XA 4DV4Q 3KF8B 4YWKA 5IGFA 1HFNA 4HAEA 2C5CA 4DV1L 1LV9A 3PO3B 1EWHA 1Q86C 1Y1WB 3VA7A 4XYOA 1LTTD 2WV6D 4H44C 4HCEA 4LFAL 1JOQA 4OONA 2A1AA 2JA7B 3DHQA 5M5YH 3SE0A 3PO2H 1N34Q 3N6RA 2QDBA 5FOBB 1WCMH 2K5QA 1XMQL 2KHJA 4HJAA 4C1NI 2BDNA 4K8IA 5C4JB 4DKAC 1BKBA 5HURA 2IX0A 5G3LD 4UAIA 3S16B 2Y0SE 2K6AA 3DUZA 1V1OA 2R6GA 1PVOA 3UDFA 4DR6Q 1EZ6A 4KJOA 3UI2A 2VUMH 1E0BA 1HQRD 4O1NA 4TSSA 3GTOB 2FXQA 1D6EC 1HNZQ 3HOZG 1PHJA 2WIIB 2CW0C 3D6CA 3FEWX 1G8ZD 5CC4A 4CBVA 4OX9L 4ZYSA 2Z4HA 4GOPC 5H1SE 1LT6D 3E6ZX 3KBXA 1KDCA 1STYA 1I94L 2B63B 2UXCL 3URYA 2UXDL 4J1MA 5M5YB 5IGBA 4H0LC 3GTQB 1I3QB 4WJWA 5IP9G 1C9OA 2K5DA 2R93H 3BVGA 4B08A 1Q46A 1W3SA 5GAHC 4H02A 1IW7D 1SROA 2E5LL 3J80c 4GN5A 4A3EG 4KY5A 3E9HA 2MQHA 3S1RH 1ICWA 1RHPA 2F4VQ 3J81i 4IPHA 2KEDA 1MD2D 4A3BG 4OWTB 2KQ3A 4UPAA 4LF5L 5FO9B 1EIGA 2KCTA 1BO0A 2VUMB 3HOZB 3G71A 2F0PA 4POFA 4JI7Q 4IZ8A 4A3DB 2D0PA 4RGNA 3CMEA 1SE2A 2M9VA 4EGVA 4C3IH 2QEXA 2XRQD 3SEBA 3H94A 4HR7B 4C3JB 3GTLB 1OXUA 1JORA 5KYLA 2E74C 4IOAA 3KJPA 3PGZA 5FJ8H 5EQ0A 4KD3A 4A3FG 1YITA 2PI2E 3AYHB 4X64L 2OXPA 3RNUA 1ENFA 2EXDA 1XPUA 3A8JE 4JC0A 2KECA 3NP8A 2VQFL 3HOXB 3AFQA 4R4CA 5IGGA 4A3EB 1R4PB 1UE1A 1JR0D 3CD6A 1C4QA 3PMFA 3KDFA 3RZOH 2NTTA 1ZXTA 5BN5A 2O2LD 3RLFA 5C3WA 2PZTA 3HP3A 5I6YA 4ABNA 3CCJA 1FJGL 3D6WA 4DUZL 1IYVA 2MPMA 1VQ7A 3CC7A 3K7AB 1HUNA 2OWOA 2WKDA 1VQEA 1FR3A 1Z6HA 4C3IB 3CPWA 2A68C 3EBEA 3T16A 4EQ5A 1LABA 1YJ9A 4B3ML 4NDXA 2E5LQ 1B53A 4DAMA 4A3FB 2K01A 1Q12A 2FMCA 4DXGA 1NJIC 2YYZA 3CCSA 2EE1A 4HIDA 3S2DB 3E0JA 2DJGC 1XXGA 1KTKA 4PZ6A 1EFWA 1Q8KA 1A8VA 4KMUC 2YU9B 2Z9HA 4CKEA 3KK7A 3PUYA 4QCLA 4K2LA 1H95A 3G48A 4LF8L 4V0BA 4CGYB 3D3RA 3DXJC 3DWPA 1CA6A 4OWWB 4UP9A 1BCPD 5CV9A 1YNJC 3ND8A 4A3MG 1S5DD 1FGBD 2KENA 1OXXK 1YBYA 3GV3A 2K28A 2X69A 4C2MH 1JB3A 2WAQE 4BY7G 1EUJA 1RL2A 3BVMA 1I4RA 1JOKA 2N55A 4KKUA 3F1ZA 3VR3A 2PYKA 1T5XD 1PH8A 2X6GA 4QL5A 3EFXD 1HR0L 1VQLA 3JC66 2WINB 3CCEA 4DR1Q 1D7QA 1TXYA 4X62L 4JI3Q 1VS0A 3M4OB 1D1IA 1M8AA 3I4OA 1TS4A 2C35B 5J22A 4RGMA 1CA5A 2EYOA 3CQZB 2R7FA 5CBAE 4X3SA 2XSCA 1WTOA 1QNUA 4ODGA 4DR3L 1EQQA 2CWAA 4NXMQ 1GXDC 4JVZA 4DK3C 4A3GH 2YTXA 1SYGA 4C3HH 1K0RA 1C8CA 1TQOA 1EEID 1VQAA 4PQXA 2NVXB 1EQTA 1SNMA 1JJ2A 2D62A 1PTOF 2M2LA 2ZM6L 2CFMA 5IOCA 4GOPA 1CK1A 3CAMA 1QZGA 1H9KA 3GP7A 3TP7A 2IWHA 3BJUA 4LF6Q 3FP9A 2MUYA 1PTOC 4N8X1 3T1YQ 2MO1A 3MFYA 4IUQA 5JOBA 5C0XG 3HOWB 4ME3A 1BDOA 2KOLA 4R1JA 1JICA 2EY2A 4NXNQ 1RF2D 3QR8A 2LFNA 4MIUA 3GTGH 2F3IA 3I4NH 2K52A 3KYHC 5JEAG 2EJMA 3WOEA 1EOTA 3KFUA 1MIUA 1YNNC 3I72A 1N36L 4JI2L 1JWSD 2BA1A 2ID0A 4DU9A 1GUOA 2KVMA 5J3BA 5FLXE 5K36H 1VF7A 3HS0C 1F9QA 2R92G 1I4QA 1QVCA 2A5HA 5LMNW 1C7YA 3TDQA 3E0EA 5JVG3 1FD7D 1VQKA 2EIFA 1O7IA 4X62Q 5IYDG 1KL9A 4WORA 3MXNA 2ICIA 4Z9CB 3SHLA 2SNSA 2F0SA 1FGUA 3KBGA 3S2HH 1B44D 2N3SA 4GLXA 4X66Q 1Z47A 5LMUQ 1A2UA 5EPKA 4QY7A 4XYQA 2VW9A 2B8GA 1WJJA 1H9RA 2A69D 1S5CD 1SE8A 2EJGC 2WAQB 4Y7NB 1RCVD 1NY4A 4HSPA 5I2XA 2IX3A 4DF7A 3PUXA 1TS3A 2RDFA 4C1NK 3HKZE 3T53B 4DV2L 3S1QH 3HRZC 3ICEA 1EWIA 2DNEA 2EYPA 3BDLA 4ZRZA 2PPBC 2PO4A 4AH6A 1Y1VH 2AQ1B 4IURA 3GTPB 2ZTCA 1ENCA 1ZEQX 2IY5B 2EPBA 5CMDA 2E2HB 2A74C 4UY8C 5FLMH 3GDEA 1S5ED 4EVOA 4A3JG 1F9RA 4AQYL 3RZDH 1CHQD 2GVAA 2A6HD 3QIAA 1VCIA 4O0AA 1IKLA 1P16A 4FDBA 5C0XI 4JI0Q 5C0XJ 3H0GB 3LWEA 5C44G 3OW2A 1X3GA 1N36Q 4QQBX 5CR3A 1TY0A 2F0LA 3HOYG 2DN8A 4JK1C 4WFN3 5JEAJ 1EEFD 4OGQC 4A3KH 4R4QA 4DR4L 1X3EA 4L5QA 3MFGA 3I90A 5CYUA 4L63B 4P71A 2L15A 4LF7L 4YWMA 1LTID 3BZDB 4A3CG 2MJ8A 1PFNA 4QMGA 2BCOA 1TKWB 1EQRA 1EWCA 3K5LA 2JQOA 3VR2A 4BY1G 1QB5D 3VYTA 5CBEE 4KHPQ 1B70B 1GD7A 3PIOA 2AWNA 2B8FA 4HIMA 5C44B 3HOVG 2B2VA 3OIPA 1EY6A 1UEBA 1K9MC 2PMZE 4DV2Q 3HOYB 2R7DA 3TRZA 3FKIH 1PTOB 3CF5A 3KLSX 1DYQA 2R3ZA 2L4NA 4KD4A 2OQKA 1EYCA 1LT4D 1ZYRD 2VQEL 4DGZA 1QJOA 1VQNA 4KK7A 3VR6A 1RDPD 1XNQL 2K03A 5DEHA 3NWTA 1B9NA 3OMGA 3RLOA 4YHHQ 4LUZA 5M3FH 2KCCA 2PZUA 5DM73 4BY1B 1E1OA 1XTDA 3HKZB 1WTQA 2YTVA 5C6AA 2AQ3B 2DGYA 3IRBA 4QIWB 2KUMA 2XTIA 4K6DA 1TWHB 4QUFA 3HOVB 2E2IH 3EROA 2AUJD 4A3IG 3I4MB 1LO5D 2CCZA 4ZCKA 1JWUD 3VDYA 1HA5A 2EJFC 5A35A 4OELB 4JI8Q 4B3SQ 4GLAC 3B6YA 4GKJL 4NKLA 5FK9C 1YHQA 2CQAA 3LWUA 3VR4A 2JJQA 4LW1A 2BE5C 1YI2A 1LT3D 3W2DA 2B2TC 4I7AA 4LWCA 1CTMA 4ME5A 4R4TA 2KHSA 4DR7L 5IGDA 3L2PA 5M3FB 4DK1A 1G6PA 5IE8A 2D2CC 1L0XB 4HJ7A 3I70A 3BS1A 1VMCA 3U4ZA 1HFGA 4ZUIA 5GADC 3TS2A 1XMOQ 1X55A 3ZYYX 4KLKA 3NSWA 2R7ZG 2JYOA 2YTYA 2UU9Q 2SOBA 4PZ8A 4EQNA 4DV0L 1VQ5A 1XNQQ 3MC0B 1PFMA 2O4XA 4DAPA 3A7LA 4H7BA 2HQLA 5KNBA 1E24A 1BOSA 1S5BD 1CKOA 4R9WA 4BBSG 4RA8A
chains in the Genus database with same CATH topology
2K14A 4A93H 3CCLA 1KXLA 2VUMH 3M3YH 2FXQA 1RIPA 4DR2L 1HNZQ 5JJKA 5GAEC 1PHJA 2Q2TA 3HOZG 2I5HA 4DV5L 4GKKQ 2VY3A 2ALYB 4DNIA 5IYBG 4A3LG 4OX9L 4P73A 2ASBA 1CKNA 4X65L 4DV6Q 4JI4L 4GOPC 3S1NH 5H1SE 2IX1A 3A5UA 4K0KL 4A3GG 2N49A 3T1HQ 3HOWH 2UXCL 3HKZG 3J81c 1I94L 2JA6H 2E2JH 2UXDL 4MZ9A 1LTLA 5GAGC 2UXBL 2RHQB 1E7ZA 4XTCS 3A74A 2WFWA 5ELOA 3U50C 3J81j 5IP9G 1VQOA 1VQ9A 1A0IA 1C9OA 1UWVA 4WJ4A 4JI5Q 2R93H 3AEVA 4JBJA 1Q46A 4X66L 1W3SA 5GAHC 5C3EH 5AJ3Q 2I5MX 3F2BA 4H02A 5LMUL 4P75A 3I4MG 1HNWQ 1SROA 2E5LL 3J80c 4GN5A 4A3EG 4QGUA 3E9HA 3HFZB 2MQHA 3FKIG 2QA4A 3S1RH 3RN2A 1X9NA 1HNXQ 2F4VQ 3J81i 3JAMc 4LF9L 4HIOA 2ZTDA 4IPHA 4A3BG 4IJLA 4IPGA 4OWTB 4JI6L 4LNQA 1Z9FA 4UPAA 4LF5L 4AQYQ 2VS1A 3CCVA 2KCTA 2MNAA 3KLWA 5IYCH 2K75A 4JI1Q 3G71A 3J80i 4POFA 4JI7Q 3I4NG 3OTOL 3M4PA 2CQOA 4DV0Q 2OCEA 2D0PA 3CMEA 4C3IH 2QEXA 3JAMi 1L0WA 5M3FG 4GS3A 1OXUA 4J15A 3PO3G 1JB7A 4IOAA 1VQBA 4HJ9A 3KJPA 3PGZA 1I5FA 4L5TA 5FJ8H 1OTCA 1Y1WG 1J6QA 4A3FG 1YITA 4HJ5A 2PI2E 5FLXc 4Y7NH 4POGA 3AYHB 4AYBE 2PI2A 4X64L 3RNUA 1L1OA 2Q2UA 4JBMA 2EXDA 1XPUA 4ALPA 4DR4Q 5IWAL 4JI0L 4R4OA 3K0XA 3M9BA 4JC0A 3HOUH 2VQFL 1C0AA 3AFQA 4R4CA 4UP7A 2ATWA 5JJIA 1UE1A 3CD6A 3UDXA 4GN3B 4MNOA 3KDFA 4LF7Q 3RZOH 3UDIA 2R92H 4BXXH 3RLFA 3GTPH 3TEHB 1B8AA 1HJPA 2KHIA 4RMFA 1N8RC 2E2HH 1M1KC 2UUBL 1VQ8A 3W1BA 4X65Q 3CCJA 4NB3A 1FJGL 4DUZL 4JI4Q 4NPSA 5IYDH 5BR8L 4A3IH 1SFOH 1VQDA 2PQAA 1GM5A 4YWLA 5JJLA 4DAYB 1VQ7A 3CC7A 2BA0A 2A19A 3L7ZC 2OWOA 1VQEA 4O2DA 3W1GA 1IBML 4GNXC 2WB1E 2Z0SA 1YNXA 4Y52H 3PIPA 3H0GH 3CPWA 1NTGA 3EBEA 2B29A 2CKZB 4EQ5A 2JA8H 3PV0A 1YJ9A 3H3VI 4B3ML 2Z6KC 2E5LQ 4DAMA 1PYSB 1CSQA 1PV4A 4KHPL 3J7ZC 2JEAI 3GTKH 1Q12A 1NJIC 1JJCB 2YYZA 5FLMG 4L5SA 1VQGA 3CCSA 1VQHA 4HIDA 1CKNB 2VQEQ 2AHOB 2B63G 3RR5A 2JEBI 2WP8J 1X56A 1ASYA 1M90C 1KD1C 2YV5A 2K4KA 5HY6A 1XPOA 4PMWA 4PZ6A 4QIWE 4HJ8A 1EFWA 4L5RC 1Q8KA 3OTOQ 2HIVA 1A8VA 3M7NA 1WCMG 3DM3A 4DV7L 4DR5Q 3L0OA 2UUCQ 1XNRQ 3PUYA 4A3JH 2UUAQ 3PUVA 1H95A 3G48A 4LF8L 2K5HA 1JMCA 4A3KG 2LSSA 4YY3Q 4UP9A 4OWWB 4OO1G 3CP0A 1HZCA 1E22A 3LGJA 4RG1A 3A5ZB 4A3MG 4YHHL 1WYDA 3D0FA 2KENA 1OXXK 5C44H 1YBYA 2NVQH 4DR6Q 4A93G 1N32L 4C2MH 2WAQE 2VUMG 4BY7G 1EUJA 4LFBQ 1RL2A 4LFCQ 3HOYH 3CCQA 5ELNA 3G4SA 1PH3A 1KQSA 1KRTA 3F1ZA 4A3DG 4B3RL 1PH8A 4BBSH 4QL5A 1HR0L 4GN4B 1VQLA 4GKJQ 1KAWA 3JC66 3CCEA 4DR1Q 4DUYL 1D7QA 1TXYA 4X62L 4JI3Q 1VS0A 1I6HH 4JOIA 2WB1G 3TQYA 2JA6G 3I4OA 2I0QA 4GLVB 1N33L 5BR8Q 3J7A5 1GO3E 2C35B 3CC2A 2NN6I 2RHSB 3NELA 4JI8L 4A3CH 3W5OA 4B3SL 2JA5H 2R7FA 2BH8A 3HOXG 1L1OB 2F52A 1TWGH 5C3EG 4A3LH 3PCOB 4DV3L 1HR0W 4DR7Q 1SN8A 1EQQA 3I56A 4DR3L 4DV1Q 2CWAA 3I7FA 2HHHQ 4NXMQ 2K5VA 4BY1H 4DK3C 1Q82C 4A3GH 4HIKA 2YTXA 4IJHA 2ZJQA 5GROA 3MEFA 4C3HH 1K0RA 1VQMA 3PF4A 3KDFB 3H3VH 1VQAA 1TWHH 5IP9H 1XPRA 1JJ2A 3HOVH 1K8AC 2D62A 4LFAQ 3K8AA 1A62A 3EIVA 2ZM6L 4B3TQ 2CFMA 3KJOA 1OXTA 3I4MH 1S3OA 1VQIA 4GOPA 5IYCG 1EOVA 3CW2C 2N78A 3CAMA 1YZ6A 1QZGA 2PQAB 3BJUA 3STBD 3FP9A 4OWXB 4LF6Q 2Q2HA 2Y0SG 3NEMA 3T1YQ 2MO1A 1V43A 3S1MH 3M4QA 1IBLL 1XMOL 1XMQQ 1NMFA 5C0XG 1WI5A 4A3BH 1B7YB 1R9TH 1LUZA 3GO5A 3I2ZA 4ME3A 4R1JA 1JJGA 1PFSA 2NZOA 5FJ8G 4DPGA 3STBC 2UU9L 4NXNQ 5LMNL 3ER0A 3UE1A 3GTGH 1D8LA 2F3IA 3I4NH 4DR4L 2K52A 3KYHC 1N34L 4OXPA 5JEAG 3S24A 3ZJYC 3KFUA 1FL0A 3KOJA 1MIUA 4YCVA 1N36L 4JI2L 2GN5A 2VNUD 2VL6A 1SLJA 4DR2Q 2BA1A 2ID0A 1N9WA 2EQSA 1TWFH 5J3BA 2ZTEA 2K5NA 3PSIA 4KHZA 4DV5Q 4OO1I 2AWOA 4APVA 2N8NA 2R92G 4QJFA 1SMXA 2H5XA 1QVCA 5LMNW 1C7YA 4OX9Q 1PA6A 4LF4L 3I55A 2UUCL 4DR6L 1Q1EA 3E0EA 3ULLA 4R4IA 1PH1A 4K0KQ 1UE7A 4LUOA 4LUVA 1VQKA 2EIFA 1O7IA 4X62Q 5IYDG 1I94Q 2JA7H 4DK6C 5IT9c 2UXCQ 2UXDQ 1KL9A 1HNZL 1P8LA 2UXBQ 1IZ6A 1Q1BA 5DLQE 4GKKL 1G291 4BBRH 5M3MH 1FGUA 3S2HH 1Y14B 2IT1A 2N3SA 4GLXA 4X66Q 1Z47A 2OTJA 1T9HA 5LMUQ 4DV6L 4QY7A 3D31A 1VQJA 4P74A 4IPDA 2VW9A 1VQ6A 1JT8A 3E9IA 3T1HL 1WJJA 2RCNA 1BBUA 4DV3Q 5C4JH 2NVTH 4A4IA 1PH4A 3PUZA 1SE8A 3S16H 1KHIA 1TWCH 2D0OA 3U4VA 5IP7H 4LF9Q 1NY4A 4IO9A 1X3FA 1VQCA 4JI5L 3PUXA 4JI6Q 5AJ3L 4LF5Q 1HNWL 3F2DA 3HKZE 1K83H 1U5KA 2KCMA 4DV2L 1VQPA 1IBKL 3S1QH 2OTLA 3GTOH 3ICEA 1X54A 3AFPA 1EWIA 3SGIA 4UP8A 2CWPA 2MFIA 3PO2G 1NBWA 1HNXL 2F4VL 4AH6A 1Y1VH 2IY5B 2ZTCA 4AYBG 4JV5L 1WFQA 4UY8C 1U0LA 5FLMH 1EYGA 3GDEA 2R7ZH 4A3JG 5C4XH 4GNXA 2GVBA 4AQYL 3KF6A 3RZDH 1HZBA 2GVAA 2E8GA 3CPFA 2B63H 1MJCA 4JI1L 1K73C 1VCIA 4JI7L 2Z6KA 1BBWA 4X64Q 1J5EL 1QVGA 3GTQH 1CSPA 4O0AA 1SRUA 1I3QH 1P16A 3K80C 4FDBA 4IPCA 4EX5A 3OYYA 5IWAQ 2DUDA 5C0XI 1V1QA 4TQUS 5C0XJ 4JI0Q 2VQFQ 5C44G 3U58A 2LXKA 3BZCA 3OW2A 1X3GA 5HGQA 1N36Q 4QQBX 1I50H 4BA1I 2PNHA 2NZHA 3HOYG 2JA9A 4WJ3M 3Q8DA 4GOPB 5JEAJ 3A0JA 1K3RA 2LXJA 4A3KH 4MTNA 1YJWA 1SR3A 2AKWB 4R4QA 4YCWA 1V9PA 1X3EA 3ERSX 1AE3A 1YJNA 1UE5A 1LYLA 2UUBQ 4L5QA 1FJGQ 1OXSC 3HOWG 4DUZQ 3K81C 3S15H 4KI0A 1AE2A 2B3GA 3UE0A 4XIGS 4PG3A 4P71A 3NBHB 3FHWA 1QUQA 3HOZH 1YHBA 2I5LX 2L15A 4BY7H 4LF7L 4YWMA 4A3DH 2R93G 5IYBH 1TWAH 3GTMH 4A3CG 2JA5G 2OQ0A 1IL2A 1AH9A 1IBMQ 3G6EA 1EQRA 3NENA 1PYBA 4C3JH 2V1CC 3GTLH 2QGQA 2BH2A 2JQOA 1A63A 4B3MQ 3F2CA 1L2FA 4BY1G 1Q81C 1PH7A 1XJVA 4KHPQ 4DV4L 1GVPA 1B70B 1CKMA 1GD7A 3PIOA 2AWNA 4HIMA 3HOVG 4JCVE 1FVIA 1KC8C 2A8VA 3HOXH 3S14H 2K50A 1UEBA 3RLNA 4A3EH 3CCRA 1K9MC 2PMZE 3RN5A 4DV2Q 2ES2A 2R7DA 1IBKQ 3TRZA 1L1OC 2IHEA 2VZAA 3FKIH 3UDGA 1HZAA 3CF5A 3AQQA 3GD7A 3MXNB 1S72A 2OQKA 1W2BA 1EIYB 4IOCA 3TREA 5M5WH 4DV7Q 3CXCA 5GQOA 3K7UC 4JV5Q 1E3PA 2VQEL 4JYAL 4IFDG 1YEZA 4LF8Q 4AIMA 2WAQG 1PH2A 1VQNA 2Q2IA 1VQ4A 1XNQL 4PZ7A 1YIJA 3K7AH 3ULJA 1J5EQ 3HOUG 3RLOA 2HT1A 4YHHQ 4LUZA 4DR5L 2XGTA 1N32Q 5M3FH 5IY0A 1KIXA 1XNRL 2JK8A 4BA2I 2UUAL 3PO3H 3CC4A 3BU2A 3DLLA 1E1OA 1E1TA 1XTDA 4B3RQ 1X6OA 4JG2A 3CMAA 1Y1WH 5K36G 4A3FH 4P72A 2YTVA 4BXXG 2DGYA 2ZJPA 3IRBA 4YY3L 1HR0Q 1EIFA 2AMCB 2XTIA 4DUYQ 2E2IH 3HKSA 4YCUA 1K8GA 5M5XH 4A3IG 3S2DH 3WWVA 1DGSA 1KRSA 4LFBL 2CCZA 4LFCL 2JA7G 5E7NA 4GNXB 1NMGA 3KF6B 3VDYA 1N33Q 1HH2P 4BBRG 4JI8Q 3ULPA 4B3SQ 4GLAC 5M3MG 3H0GG 3B6YA 4JBKA 1X65A 4GKJL 5EAYA 4DR1L 1YHQA 2YU9H 2JA8G 1PH5A 2NN6G 4JI3L 3S17H 4DR3Q 2JJQA 4LW1A 3PUWA 1YI2A 1IYJB 1NE3A 1OXVA 1BVSA 3GTJH 1ASZA 4X6AH 1IXRA 4TVAB 1GKHA 1VQFA 5IP7G 4DV4Q 3KF8B 1YVCA 4LWCA 4YWKA 1YHAA 3TS0A 1MJEA 3H15A 2ZM6Q 4R4TA 4DR7L 3L2PA 1LM0A 2MO0A 1G6PA 4DV1L 5IE8A 2HHHL 4NXML 3BZKA 4HJ7A 1HZ9A 1Q86C 2HIXA 1UE6A 3EN2A 1QZHA 1QUQB 1Y1VG 3F8TA 4JBWA 3U4ZA 1QVFA 5GADC 3TS2A 1IBLQ 1XMOQ 1X55A 4LFAL 4KLKA 2R7ZG 4OONA 4B3TL 5C4XG 4A75A 2A1AA 3M4OH 1WOCA 2YTYA 5M5YH 1Q7YC 1PH9A 2UU9Q 4JYAQ 4PZ8A 1PH6A 5LMNQ 4DV0L 3M85A 2NVYH 1S40A 1VQ5A 4LF6L 3PO2H 2RF4A 1N34Q 1XNQQ 3T1YL 3CQZH 2KBNA 1WCMH 4IFDI 4JOIC 4A76A 4IFDJ 1XMQL 2HQLA 1CUKA 2KHJA 4JI2Q 4HJAA 1E24A 4DKAC 1BKBA 2IX0A 1CKOA 2JE6I 4NXNL 1JE5A 2ZJRA 4BBSG 3CCMA 2Y0SE 1G51A 3PF5A 2R6GA 4LF4Q 1PVOA 3UDFA 2NVXH 1MKHA 3CCUA 2IHFA 4A3MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K14 A;  4A93 H;  3CCL A;  1KXL A;  2VUM H;  3M3Y H;  2FXQ A;  1RIP A;  4DR2 L;  1HNZ Q;  5JJK A;  5GAE C;  1PHJ A;  2Q2T A;  3HOZ G;  2I5H A;  4DV5 L;  4GKK Q;  2VY3 A;  2ALY B;  4DNI A;  5IYB G;  4A3L G;  4OX9 L;  4P73 A;  2ASB A;  1CKN A;  4X65 L;  4DV6 Q;  4JI4 L;  4GOP C;  3S1N H;  5H1S E;  2IX1 A;  3A5U A;  4K0K L;  4A3G G;  2N49 A;  3T1H Q;  3HOW H;  2UXC L;  3HKZ G;  3J81 c;  1I94 L;  2JA6 H;  2E2J H;  2UXD L;  4MZ9 A;  1LTL A;  5GAG C;  2UXB L;  2RHQ B;  1E7Z A;  4XTC S;  3A74 A;  2WFW A;  5ELO A;  3U50 C;  3J81 j;  5IP9 G;  1VQO A;  1VQ9 A;  1A0I A;  1C9O A;  1UWV A;  4WJ4 A;  4JI5 Q;  2R93 H;  3AEV A;  4JBJ A;  1Q46 A;  4X66 L;  1W3S A;  5GAH C;  5C3E H;  5AJ3 Q;  2I5M X;  3F2B A;  4H02 A;  5LMU L;  4P75 A;  3I4M G;  1HNW Q;  1SRO A;  2E5L L;  3J80 c;  4GN5 A;  4A3E G;  4QGU A;  3E9H A;  3HFZ B;  2MQH A;  3FKI G;  2QA4 A;  3S1R H;  3RN2 A;  1X9N A;  1HNX Q;  2F4V Q;  3J81 i;  3JAM c;  4LF9 L;  4HIO A;  2ZTD A;  4IPH A;  4A3B G;  4IJL A;  4IPG A;  4OWT B;  4JI6 L;  4LNQ A;  1Z9F A;  4UPA A;  4LF5 L;  4AQY Q;  2VS1 A;  3CCV A;  2KCT A;  2MNA A;  3KLW A;  5IYC H;  2K75 A;  4JI1 Q;  3G71 A;  3J80 i;  4POF A;  4JI7 Q;  3I4N G;  3OTO L;  3M4P A;  2CQO A;  4DV0 Q;  2OCE A;  2D0P A;  3CME A;  4C3I H;  2QEX A;  3JAM i;  1L0W A;  5M3F G;  4GS3 A;  1OXU A;  4J15 A;  3PO3 G;  1JB7 A;  4IOA A;  1VQB A;  4HJ9 A;  3KJP A;  3PGZ A;  1I5F A;  4L5T A;  5FJ8 H;  1OTC A;  1Y1W G;  1J6Q A;  4A3F G;  1YIT A;  4HJ5 A;  2PI2 E;  5FLX c;  4Y7N H;  4POG A;  3AYH B;  4AYB E;  2PI2 A;  4X64 L;  3RNU A;  1L1O A;  2Q2U A;  4JBM A;  2EXD A;  1XPU A;  4ALP A;  4DR4 Q;  5IWA L;  4JI0 L;  4R4O A;  3K0X A;  3M9B A;  4JC0 A;  3HOU H;  2VQF L;  1C0A A;  3AFQ A;  4R4C A;  4UP7 A;  2ATW A;  5JJI A;  1UE1 A;  3CD6 A;  3UDX A;  4GN3 B;  4MNO A;  3KDF A;  4LF7 Q;  3RZO H;  3UDI A;  2R92 H;  4BXX H;  3RLF A;  3GTP H;  3TEH B;  1B8A A;  1HJP A;  2KHI A;  4RMF A;  1N8R C;  2E2H H;  1M1K C;  2UUB L;  1VQ8 A;  3W1B A;  4X65 Q;  3CCJ A;  4NB3 A;  1FJG L;  4DUZ L;  4JI4 Q;  4NPS A;  5IYD H;  5BR8 L;  4A3I H;  1SFO H;  1VQD A;  2PQA A;  1GM5 A;  4YWL A;  5JJL A;  4DAY B;  1VQ7 A;  3CC7 A;  2BA0 A;  2A19 A;  3L7Z C;  2OWO A;  1VQE A;  4O2D A;  3W1G A;  1IBM L;  4GNX C;  2WB1 E;  2Z0S A;  1YNX A;  4Y52 H;  3PIP A;  3H0G H;  3CPW A;  1NTG A;  3EBE A;  2B29 A;  2CKZ B;  4EQ5 A;  2JA8 H;  3PV0 A;  1YJ9 A;  3H3V I;  4B3M L;  2Z6K C;  2E5L Q;  4DAM A;  1PYS B;  1CSQ A;  1PV4 A;  4KHP L;  3J7Z C;  2JEA I;  3GTK H;  1Q12 A;  1NJI C;  1JJC B;  2YYZ A;  5FLM G;  4L5S A;  1VQG A;  3CCS A;  1VQH A;  4HID A;  1CKN B;  2VQE Q;  2AHO B;  2B63 G;  3RR5 A;  2JEB I;  2WP8 J;  1X56 A;  1ASY A;  1M90 C;  1KD1 C;  2YV5 A;  2K4K A;  5HY6 A;  1XPO A;  4PMW A;  4PZ6 A;  4QIW E;  4HJ8 A;  1EFW A;  4L5R C;  1Q8K A;  3OTO Q;  2HIV A;  1A8V A;  3M7N A;  1WCM G;  3DM3 A;  4DV7 L;  4DR5 Q;  3L0O A;  2UUC Q;  1XNR Q;  3PUY A;  4A3J H;  2UUA Q;  3PUV A;  1H95 A;  3G48 A;  4LF8 L;  2K5H A;  1JMC A;  4A3K G;  2LSS A;  4YY3 Q;  4UP9 A;  4OWW B;  4OO1 G;  3CP0 A;  1HZC A;  1E22 A;  3LGJ A;  4RG1 A;  3A5Z B;  4A3M G;  4YHH L;  1WYD A;  3D0F A;  2KEN A;  1OXX K;  5C44 H;  1YBY A;  2NVQ H;  4DR6 Q;  4A93 G;  1N32 L;  4C2M H;  2WAQ E;  2VUM G;  4BY7 G;  1EUJ A;  4LFB Q;  1RL2 A;  4LFC Q;  3HOY H;  3CCQ A;  5ELN A;  3G4S A;  1PH3 A;  1KQS A;  1KRT A;  3F1Z A;  4A3D G;  4B3R L;  1PH8 A;  4BBS H;  4QL5 A;  1HR0 L;  4GN4 B;  1VQL A;  4GKJ Q;  1KAW A;  3JC6 6;  3CCE A;  4DR1 Q;  4DUY L;  1D7Q A;  1TXY A;  4X62 L;  4JI3 Q;  1VS0 A;  1I6H H;  4JOI A;  2WB1 G;  3TQY A;  2JA6 G;  3I4O A;  2I0Q A;  4GLV B;  1N33 L;  5BR8 Q;  3J7A 5;  1GO3 E;  2C35 B;  3CC2 A;  2NN6 I;  2RHS B;  3NEL A;  4JI8 L;  4A3C H;  3W5O A;  4B3S L;  2JA5 H;  2R7F A;  2BH8 A;  3HOX G;  1L1O B;  2F52 A;  1TWG H;  5C3E G;  4A3L H;  3PCO B;  4DV3 L;  1HR0 W;  4DR7 Q;  1SN8 A;  1EQQ A;  3I56 A;  4DR3 L;  4DV1 Q;  2CWA A;  3I7F A;  2HHH Q;  4NXM Q;  2K5V A;  4BY1 H;  4DK3 C;  1Q82 C;  4A3G H;  4HIK A;  2YTX A;  4IJH A;  2ZJQ A;  5GRO A;  3MEF A;  4C3H H;  1K0R A;  1VQM A;  3PF4 A;  3KDF B;  3H3V H;  1VQA A;  1TWH H;  5IP9 H;  1XPR A;  1JJ2 A;  3HOV H;  1K8A C;  2D62 A;  4LFA Q;  3K8A A;  1A62 A;  3EIV A;  2ZM6 L;  4B3T Q;  2CFM A;  3KJO A;  1OXT A;  3I4M H;  1S3O A;  1VQI A;  4GOP A;  5IYC G;  1EOV A;  3CW2 C;  2N78 A;  3CAM A;  1YZ6 A;  1QZG A;  2PQA B;  3BJU A;  3STB D;  3FP9 A;  4OWX B;  4LF6 Q;  2Q2H A;  2Y0S G;  3NEM A;  3T1Y Q;  2MO1 A;  1V43 A;  3S1M H;  3M4Q A;  1IBL L;  1XMO L;  1XMQ Q;  1NMF A;  5C0X G;  1WI5 A;  4A3B H;  1B7Y B;  1R9T H;  1LUZ A;  3GO5 A;  3I2Z A;  4ME3 A;  4R1J A;  1JJG A;  1PFS A;  2NZO A;  5FJ8 G;  4DPG A;  3STB C;  2UU9 L;  4NXN Q;  5LMN L;  3ER0 A;  3UE1 A;  3GTG H;  1D8L A;  2F3I A;  3I4N H;  4DR4 L;  2K52 A;  3KYH C;  1N34 L;  4OXP A;  5JEA G;  3S24 A;  3ZJY C;  3KFU A;  1FL0 A;  3KOJ A;  1MIU A;  4YCV A;  1N36 L;  4JI2 L;  2GN5 A;  2VNU D;  2VL6 A;  1SLJ A;  4DR2 Q;  2BA1 A;  2ID0 A;  1N9W A;  2EQS A;  1TWF H;  5J3B A;  2ZTE A;  2K5N A;  3PSI A;  4KHZ A;  4DV5 Q;  4OO1 I;  2AWO A;  4APV A;  2N8N A;  2R92 G;  4QJF A;  1SMX A;  2H5X A;  1QVC A;  5LMN W;  1C7Y A;  4OX9 Q;  1PA6 A;  4LF4 L;  3I55 A;  2UUC L;  4DR6 L;  1Q1E A;  3E0E A;  3ULL A;  4R4I A;  1PH1 A;  4K0K Q;  1UE7 A;  4LUO A;  4LUV A;  1VQK A;  2EIF A;  1O7I A;  4X62 Q;  5IYD G;  1I94 Q;  2JA7 H;  4DK6 C;  5IT9 c;  2UXC Q;  2UXD Q;  1KL9 A;  1HNZ L;  1P8L A;  2UXB Q;  1IZ6 A;  1Q1B A;  5DLQ E;  4GKK L;  1G29 1;  4BBR H;  5M3M H;  1FGU A;  3S2H H;  1Y14 B;  2IT1 A;  2N3S A;  4GLX A;  4X66 Q;  1Z47 A;  2OTJ A;  1T9H A;  5LMU Q;  4DV6 L;  4QY7 A;  3D31 A;  1VQJ A;  4P74 A;  4IPD A;  2VW9 A;  1VQ6 A;  1JT8 A;  3E9I A;  3T1H L;  1WJJ A;  2RCN A;  1BBU A;  4DV3 Q;  5C4J H;  2NVT H;  4A4I A;  1PH4 A;  3PUZ A;  1SE8 A;  3S16 H;  1KHI A;  1TWC H;  2D0O A;  3U4V A;  5IP7 H;  4LF9 Q;  1NY4 A;  4IO9 A;  1X3F A;  1VQC A;  4JI5 L;  3PUX A;  4JI6 Q;  5AJ3 L;  4LF5 Q;  1HNW L;  3F2D A;  3HKZ E;  1K83 H;  1U5K A;  2KCM A;  4DV2 L;  1VQP A;  1IBK L;  3S1Q H;  2OTL A;  3GTO H;  3ICE A;  1X54 A;  3AFP A;  1EWI A;  3SGI A;  4UP8 A;  2CWP A;  2MFI A;  3PO2 G;  1NBW A;  1HNX L;  2F4V L;  4AH6 A;  1Y1V H;  2IY5 B;  2ZTC A;  4AYB G;  4JV5 L;  1WFQ A;  4UY8 C;  1U0L A;  5FLM H;  1EYG A;  3GDE A;  2R7Z H;  4A3J G;  5C4X H;  4GNX A;  2GVB A;  4AQY L;  3KF6 A;  3RZD H;  1HZB A;  2GVA A;  2E8G A;  3CPF A;  2B63 H;  1MJC A;  4JI1 L;  1K73 C;  1VCI A;  4JI7 L;  2Z6K A;  1BBW A;  4X64 Q;  1J5E L;  1QVG A;  3GTQ H;  1CSP A;  4O0A A;  1SRU A;  1I3Q H;  1P16 A;  3K80 C;  4FDB A;  4IPC A;  4EX5 A;  3OYY A;  5IWA Q;  2DUD A;  5C0X I;  1V1Q A;  4TQU S;  5C0X J;  4JI0 Q;  2VQF Q;  5C44 G;  3U58 A;  2LXK A;  3BZC A;  3OW2 A;  1X3G A;  5HGQ A;  1N36 Q;  4QQB X;  1I50 H;  4BA1 I;  2PNH A;  2NZH A;  3HOY G;  2JA9 A;  4WJ3 M;  3Q8D A;  4GOP B;  5JEA J;  3A0J A;  1K3R A;  2LXJ A;  4A3K H;  4MTN A;  1YJW A;  1SR3 A;  2AKW B;  4R4Q A;  4YCW A;  1V9P A;  1X3E A;  3ERS X;  1AE3 A;  1YJN A;  1UE5 A;  1LYL A;  2UUB Q;  4L5Q A;  1FJG Q;  1OXS C;  3HOW G;  4DUZ Q;  3K81 C;  3S15 H;  4KI0 A;  1AE2 A;  2B3G A;  3UE0 A;  4XIG S;  4PG3 A;  4P71 A;  3NBH B;  3FHW A;  1QUQ A;  3HOZ H;  1YHB A;  2I5L X;  2L15 A;  4BY7 H;  4LF7 L;  4YWM A;  4A3D H;  2R93 G;  5IYB H;  1TWA H;  3GTM H;  4A3C G;  2JA5 G;  2OQ0 A;  1IL2 A;  1AH9 A;  1IBM Q;  3G6E A;  1EQR A;  3NEN A;  1PYB A;  4C3J H;  2V1C C;  3GTL H;  2QGQ A;  2BH2 A;  2JQO A;  1A63 A;  4B3M Q;  3F2C A;  1L2F A;  4BY1 G;  1Q81 C;  1PH7 A;  1XJV A;  4KHP Q;  4DV4 L;  1GVP A;  1B70 B;  1CKM A;  1GD7 A;  3PIO A;  2AWN A;  4HIM A;  3HOV G;  4JCV E;  1FVI A;  1KC8 C;  2A8V A;  3HOX H;  3S14 H;  2K50 A;  1UEB A;  3RLN A;  4A3E H;  3CCR A;  1K9M C;  2PMZ E;  3RN5 A;  4DV2 Q;  2ES2 A;  2R7D A;  1IBK Q;  3TRZ A;  1L1O C;  2IHE A;  2VZA A;  3FKI H;  3UDG A;  1HZA A;  3CF5 A;  3AQQ A;  3GD7 A;  3MXN B;  1S72 A;  2OQK A;  1W2B A;  1EIY B;  4IOC A;  3TRE A;  5M5W H;  4DV7 Q;  3CXC A;  5GQO A;  3K7U C;  4JV5 Q;  1E3P A;  2VQE L;  4JYA L;  4IFD G;  1YEZ A;  4LF8 Q;  4AIM A;  2WAQ G;  1PH2 A;  1VQN A;  2Q2I A;  1VQ4 A;  1XNQ L;  4PZ7 A;  1YIJ A;  3K7A H;  3ULJ A;  1J5E Q;  3HOU G;  3RLO A;  2HT1 A;  4YHH Q;  4LUZ A;  4DR5 L;  2XGT A;  1N32 Q;  5M3F H;  5IY0 A;  1KIX A;  1XNR L;  2JK8 A;  4BA2 I;  2UUA L;  3PO3 H;  3CC4 A;  3BU2 A;  3DLL A;  1E1O A;  1E1T A;  1XTD A;  4B3R Q;  1X6O A;  4JG2 A;  3CMA A;  1Y1W H;  5K36 G;  4A3F H;  4P72 A;  2YTV A;  4BXX G;  2DGY A;  2ZJP A;  3IRB A;  4YY3 L;  1HR0 Q;  1EIF A;  2AMC B;  2XTI A;  4DUY Q;  2E2I H;  3HKS A;  4YCU A;  1K8G A;  5M5X H;  4A3I G;  3S2D H;  3WWV A;  1DGS A;  1KRS A;  4LFB L;  2CCZ A;  4LFC L;  2JA7 G;  5E7N A;  4GNX B;  1NMG A;  3KF6 B;  3VDY A;  1N33 Q;  1HH2 P;  4BBR G;  4JI8 Q;  3ULP A;  4B3S Q;  4GLA C;  5M3M G;  3H0G G;  3B6Y A;  4JBK A;  1X65 A;  4GKJ L;  5EAY A;  4DR1 L;  1YHQ A;  2YU9 H;  2JA8 G;  1PH5 A;  2NN6 G;  4JI3 L;  3S17 H;  4DR3 Q;  2JJQ A;  4LW1 A;  3PUW A;  1YI2 A;  1IYJ B;  1NE3 A;  1OXV A;  1BVS A;  3GTJ H;  1ASZ A;  4X6A H;  1IXR A;  4TVA B;  1GKH A;  1VQF A;  5IP7 G;  4DV4 Q;  3KF8 B;  1YVC A;  4LWC A;  4YWK A;  1YHA A;  3TS0 A;  1MJE A;  3H15 A;  2ZM6 Q;  4R4T A;  4DR7 L;  3L2P A;  1LM0 A;  2MO0 A;  1G6P A;  4DV1 L;  5IE8 A;  2HHH L;  4NXM L;  3BZK A;  4HJ7 A;  1HZ9 A;  1Q86 C;  2HIX A;  1UE6 A;  3EN2 A;  1QZH A;  1QUQ B;  1Y1V G;  3F8T A;  4JBW A;  3U4Z A;  1QVF A;  5GAD C;  3TS2 A;  1IBL Q;  1XMO Q;  1X55 A;  4LFA L;  4KLK A;  2R7Z G;  4OON A;  4B3T L;  5C4X G;  4A75 A;  2A1A A;  3M4O H;  1WOC A;  2YTY A;  5M5Y H;  1Q7Y C;  1PH9 A;  2UU9 Q;  4JYA Q;  4PZ8 A;  1PH6 A;  5LMN Q;  4DV0 L;  3M85 A;  2NVY H;  1S40 A;  1VQ5 A;  4LF6 L;  3PO2 H;  2RF4 A;  1N34 Q;  1XNQ Q;  3T1Y L;  3CQZ H;  2KBN A;  1WCM H;  4IFD I;  4JOI C;  4A76 A;  4IFD J;  1XMQ L;  2HQL A;  1CUK A;  2KHJ A;  4JI2 Q;  4HJA A;  1E24 A;  4DKA C;  1BKB A;  2IX0 A;  1CKO A;  2JE6 I;  4NXN L;  1JE5 A;  2ZJR A;  4BBS G;  3CCM A;  2Y0S E;  1G51 A;  3PF5 A;  2R6G A;  4LF4 Q;  1PVO A;  3UDF A;  2NVX H;  1MKH A;  3CCU A;  2IHF A;  4A3M H; 
#chains in the Genus database with same CATH topology
 4A93 H;  1VMP A;  3M3Y H;  4DR2 L;  1RIP A;  2Q2T A;  2I5H A;  2AUK A;  3MZ5 A;  4GKK Q;  2ALY B;  4CHT B;  1A3U A;  4A3L G;  4P73 A;  4X65 L;  4JI4 L;  2R7Z B;  3T1H Q;  4DXF A;  2RQX A;  4DN4 M;  2BDO A;  3U50 C;  1ET9 A;  3J81 j;  1VQO A;  1UWV A;  1HRJ A;  3BDC A;  4JBJ A;  2Q8T A;  2MGS A;  2LY7 A;  2I5M X;  4PNY A;  3K58 A;  1HNW Q;  4P75 A;  5J39 A;  2NZ1 D;  3QWN A;  1F2L A;  4KN4 C;  2QA4 A;  5IT9 L;  3JAM c;  3DMU A;  4LF9 L;  1V1P B;  2ZTD A;  4XQQ A;  4G7O C;  1IW7 C;  2MP1 A;  2OT2 A;  4IJL A;  1Q8I A;  4QUC A;  1Z9F A;  4CJ0 B;  3S15 B;  1K28 A;  2K75 A;  2RA4 A;  1H9J A;  1NAP A;  1Q3L A;  3D4R A;  4DV0 Q;  4K8J A;  2F0K A;  2Q8R E;  4J15 A;  3PO3 G;  3DEO A;  1VQB A;  4HJ9 A;  1I5F A;  4L5T A;  1Y1W G;  4POG A;  1B3A A;  2Q2U A;  2F0E A;  4AYB E;  4JBM A;  4ALP A;  3HOU H;  1C0A A;  2ZXR A;  2ATW A;  3ONA B;  4N9T A;  2F0Q A;  3V2T A;  4BXX H;  3TEH B;  1SNC A;  2KHI A;  1D5M C;  5BN4 A;  1M1K C;  1A15 A;  3OIQ A;  1VQ8 A;  4X65 Q;  4JI4 Q;  3EVQ A;  4CJ2 C;  5BR8 L;  2LMC B;  1GM5 A;  4YWL A;  2BOS A;  3EQL C;  4OHJ A;  1IBM L;  2Z0S A;  1YNX A;  2RVL A;  3OSO A;  2CKZ B;  2JA8 H;  2WAC A;  4DA2 A;  1B9M A;  4R8I A;  3GTK H;  4XT3 B;  1DOL A;  1XWE A;  5TSS A;  1VQG A;  4E6I A;  1VQH A;  5M5X B;  3Q0A A;  4RFB A;  2B63 G;  3RR5 A;  2G9D A;  1ASY A;  2TMP A;  2K4K A;  5HY6 A;  1U4P A;  1QCB D;  2ZXP A;  2B2T A;  1WCM G;  3DM3 A;  4DR5 Q;  2UUA Q;  3FPU B;  4CKC A;  4ZKC B;  2LSS A;  4YY3 Q;  1QWY A;  4OO1 G;  4OIK A;  1HZC A;  1E22 A;  1MHW C;  4RG1 A;  1N32 L;  1EY5 A;  1EY0 A;  4N8F A;  2VUM G;  4LFB Q;  4A3D G;  5ELN A;  3MVV A;  3G4S A;  1PH3 A;  1KRT A;  1GUN A;  2F0H A;  2LKV A;  3MXP A;  2HCC A;  1BCP C;  3QB3 A;  3GTK B;  5KIX A;  3KLR A;  3G7L A;  4C3J G;  4S3S A;  2D9U A;  4B9W A;  3NE5 B;  3N52 A;  3P75 A;  3TQY A;  4HSV A;  1SXT A;  1N33 L;  5BR8 Q;  2NN6 I;  3PO2 B;  2JA5 H;  1TII D;  4FXK C;  1WCM B;  2HQE A;  3HOX G;  4AYB B;  2F52 A;  3Q23 A;  1TWG H;  3PCO B;  1SE3 A;  1STE A;  3C2P A;  2DNC A;  4DV1 Q;  1Q82 C;  4IJH A;  2CHB D;  4ZUJ A;  2ZJQ A;  3KDF B;  1LTA D;  4FYD A;  1D2B A;  5IP9 H;  2CVR A;  1PXU A;  4LFA Q;  1K8A C;  3K8A A;  1G91 A;  3EIV A;  1SEB D;  3KJO A;  1OXT A;  1S3O A;  1VQI A;  5KGU A;  5I9O A;  1SNO A;  3CW2 C;  1YZ6 A;  3STB D;  3V96 A;  3CHB D;  2Y0S G;  4C3I G;  1V43 A;  4RHS A;  1IBL L;  1XMQ Q;  4J8Q A;  1WI5 A;  4A3B H;  2PCF B;  1R9T H;  3I2Z A;  1JJG A;  1PRT D;  2NTS A;  2NZO A;  2VB2 X;  5FJ8 G;  5I2Y A;  5LMN L;  5IGC A;  1F2M A;  1I4H A;  2R93 B;  5I4D A;  2ZXO A;  1NUC A;  2VNU D;  3L3O C;  5KRU A;  1N9W A;  3S1R B;  4OO1 I;  5EBD A;  1GUG A;  4QJF A;  5A2Q E;  1EU4 A;  4OX9 Q;  1PA6 A;  4LF4 L;  2UUC L;  2UXC Q;  1FNV A;  1I94 Q;  4DK6 C;  1AZQ A;  2UXD Q;  1P8L A;  1IZ6 A;  1Q1B A;  4IUP A;  1G29 1;  4BBR H;  2Y0S B;  1Y14 B;  4DV6 L;  1U4M A;  1JT8 A;  3D31 A;  1GUW A;  2NVT H;  1BBU A;  1LAC A;  3MA2 B;  4A4I A;  1RJT A;  1PH4 A;  5HGT A;  1WTV A;  1TWC H;  3U4V A;  5IP7 H;  3QO2 A;  1VQC A;  1GOZ A;  4JI5 L;  3SR1 A;  3H91 A;  5AJ3 L;  4LF5 Q;  1K83 H;  1U5K A;  2JN4 A;  1Y8O B;  2OTL A;  5CV7 A;  1H9S A;  2RSN A;  1HQM C;  3RZO B;  1HNX L;  1O7Z A;  1QOH A;  1GHK A;  2NBF A;  1EIH A;  3K5M A;  1KNE A;  3MAQ A;  1EYG A;  4KKS A;  5C4X H;  1TT2 A;  1HZB A;  3J80 L;  4JI1 L;  1QE6 A;  3KUP A;  4X64 Q;  3C1E A;  1QVG A;  1CSP A;  4BBR B;  1V1Q A;  4TQU S;  1J9O A;  2VQF Q;  1BUV T;  1II3 A;  3BZC A;  2A6H C;  5CV8 A;  3J7A V;  1I50 H;  4BA1 I;  1BCP B;  2NVT B;  3MHB A;  4GOP B;  4RKL A;  5EKI A;  1DM0 B;  2B2V C;  2KEE A;  1K3R A;  3A0J A;  3Q22 A;  2LXJ A;  2QCP X;  2K04 A;  1SR3 A;  4DNT B;  1V9P A;  5M9O A;  1FJG Q;  3HOW G;  3IL8 A;  4DUZ Q;  3X3M A;  1WTH A;  3A8I E;  4JPB W;  5C5M A;  1LTS D;  1QUQ A;  4BY7 H;  3NTH A;  4Q5V A;  5IYB H;  5FKA C;  1AH9 A;  4FF4 A;  5DM6 3;  3J81 E;  2E2D C;  3G6E A;  4GZY C;  1EYD A;  1PYB A;  1A63 A;  2QGQ A;  2XNA C;  4B3M Q;  2TSS A;  4FXD A;  1WD0 A;  3PQI A;  4C3H G;  4I7Z C;  3WOF A;  2L55 A;  3K6O A;  5BN3 A;  4C2M B;  2ICE C;  4RCO A;  3TP5 A;  3S14 H;  2K50 A;  3CCR A;  2C9O A;  1L1O C;  3GD7 A;  3MXN B;  2NUC A;  1W2B A;  4IOC A;  1SBB B;  5M5W H;  1R4Q B;  2L0C A;  4QB4 A;  1AZP A;  4JYA L;  4IFD G;  3OPO A;  4LF8 Q;  1K8O A;  2WAQ G;  5CGK A;  1O7Y A;  3E5S A;  3NHH A;  2Q2I A;  5C4Z A;  4KV6 A;  3PIP 3;  2DY8 A;  2F0U A;  1ZYR C;  4H13 C;  4FF1 A;  1H9M A;  5IY0 A;  1XNR L;  3CC4 A;  3BU2 A;  3K5O A;  3OW7 A;  4A3G B;  5C0X H;  1F77 A;  5K36 G;  3A8K E;  3CMA A;  4K14 A;  4P72 A;  4C3H B;  1HR0 Q;  3A54 A;  5E4X A;  2CH4 A;  1DJR D;  3G6J B;  3OWE B;  4FO2 A;  3WWV A;  1BQQ T;  4LFC L;  1ICF B;  3TSS A;  1EY9 A;  2K5W A;  2EY5 A;  3H0G G;  4JBK A;  1AW7 A;  1F9P A;  1PH5 A;  3S17 H;  4DR3 Q;  1IYJ B;  1OXV A;  1S4Z A;  3D4D A;  3GTJ H;  5KND A;  3GTG B;  1G2S A;  1VQF A;  3I73 A;  3I4N B;  3F2U A;  1YVC A;  1Q90 A;  1YHA A;  2E75 C;  3TS0 A;  1GUT A;  5IIF A;  1MJE A;  1STB A;  2ZM6 Q;  3A55 A;  1LM0 A;  2MO0 A;  4ILW A;  2HHH L;  1HZ9 A;  2HIX A;  2K1B A;  4ID6 A;  4PMB A;  1QZH A;  1Y1V G;  3R3O A;  1QVF A;  4XT1 B;  2QIL A;  3VYU A;  4B3T L;  1DCZ A;  3GV6 A;  4A75 A;  1PH9 A;  1Q7Y C;  5EPL A;  4JYA Q;  3SXH A;  2F0G A;  1PH6 A;  3AU7 A;  2NVY H;  1S40 A;  2RF4 A;  3S2H B;  1TVX A;  4IFD I;  4MHE A;  3T56 B;  4IFD J;  4A76 A;  2G5D A;  1CUK A;  4JI2 Q;  1CT1 D;  2B2U A;  3TZD A;  4DAY A;  4K5V A;  4XDX A;  2L12 A;  4CDD C;  3CCM A;  4RH6 A;  2RSO A;  1G51 A;  3PF5 A;  3KLS A;  1MKH A;  3CCU A;  5EKL A;  2K14 A;  4OIJ A;  3CCL A;  4RKB A;  4PV1 C;  1KXL A;  3S1Q B;  1SNQ A;  5JJK A;  2QW7 A;  4DV5 L;  1Y1V B;  2QDL A;  3S9W A;  1PDQ A;  1CKN A;  1SMY D;  1JCK B;  5COR A;  1I4P A;  1K3B C;  5D65 A;  2IX1 A;  1ILP A;  4K0K L;  2FIN B;  1I4G A;  3RZD B;  3HKZ G;  3J81 c;  2JA6 H;  1MBY A;  2E2J H;  1LTL A;  2UXB L;  3RUZ A;  4XTC S;  2N88 A;  3A74 A;  5ELO A;  1A0I A;  2NVY B;  3AEV A;  1S5F D;  5C3E H;  3F2B A;  3I4M G;  4FF3 A;  2IW3 A;  3HFZ B;  3FKI G;  3RN2 A;  1X9N A;  4IN3 A;  4A3K B;  3NXW A;  4HIO A;  2IL8 A;  4ZLT F;  4IPG A;  2OEO A;  4JI6 L;  5D3I B;  3CKI B;  4AQY Q;  2VS1 A;  1PTO D;  5D3D A;  2MNA A;  4CDE C;  3KLW A;  2OF1 A;  5IYC H;  2L5T A;  4U68 A;  4KTA A;  3J80 i;  4RGO S;  3OTO L;  2K7V A;  1CM9 A;  1ENA A;  1L0W A;  5M3F G;  1EQV A;  3BVZ A;  3DWA A;  1JB7 A;  2G9H D;  1NR2 A;  1OTC A;  1J6Q A;  4HJ5 A;  5FLX c;  5JAV A;  1L1O A;  3VA5 A;  2L9H A;  2FFK B;  2X6L A;  4DR4 Q;  5IWA L;  4R4O A;  1I4X A;  1BBX C;  3NQI A;  4UP7 A;  3BDO A;  2GA4 B;  2EYM A;  1LT5 D;  4DNR B;  3FKI B;  1TU2 B;  4GN3 B;  5L37 A;  4LF7 Q;  4PMC A;  2KJX A;  1IYU A;  1HJP A;  1N8R C;  2UUB L;  4RGT A;  1KNA A;  4NPS A;  2A6E D;  4A3I H;  5JJL A;  2PQA A;  5E1F A;  2BA0 A;  1JWM D;  2A19 A;  3L7Z C;  5CV4 A;  1PYW D;  4O2D A;  4GNX C;  3ND9 A;  1ESF A;  1NTG A;  3PV0 A;  4RAU C;  2ZT9 C;  3SK5 A;  3H3V I;  1PYS B;  1CSQ A;  3E3X A;  1JJC B;  2F1M A;  1F2Y A;  1FNW A;  4L5S A;  3J7A F;  1FYC A;  4DFA A;  1HTP A;  2E2I B;  4L8J A;  2VQE Q;  5DAU A;  2EZV A;  1LLR D;  1TS2 A;  2YV5 A;  4N9P A;  1XPO A;  3LNN A;  4HJ8 A;  3OTO Q;  1KDA A;  3I4L A;  4DV7 L;  4L6T B;  2NWG A;  5G3L F;  1NCV A;  3M4Y A;  1ML0 D;  3PUV A;  2PMZ B;  2K5H A;  5CV5 A;  1JMC A;  2XRS D;  4NMZ A;  3C3L A;  3CP0 A;  1E2V A;  3LGJ A;  3A5Z B;  1CZW A;  2IPK D;  4KN7 C;  1WYD A;  5ELF A;  1CQF A;  1X3P A;  3BYY B;  4BWG B;  5IGE A;  4G7Z C;  1SYC A;  4A93 G;  1W6J A;  4FNF A;  2F0O A;  1UAP A;  3CCQ A;  1KQS A;  4B3R L;  1K0S A;  2MHV A;  4BBS H;  2EXZ A;  2SNM A;  4GKJ Q;  3R2T A;  1WD1 A;  4M8A A;  4DUY L;  5LL6 S;  2QEJ C;  2WKC A;  4XQJ A;  5C5L A;  4B9X A;  2I0Q A;  1HPC A;  3J7A 5;  1GO3 E;  1U9R A;  4XXE A;  2RHS B;  3NEL A;  2Z8L A;  3D8G A;  1DD2 A;  2EOT A;  1AFP A;  1PMR A;  3W5O A;  4LK1 C;  1SDF A;  2VXW A;  4A3L H;  1U4R A;  4DR7 Q;  1HTL D;  2R61 A;  1SN8 A;  4RHR A;  4NP5 A;  3I56 A;  4G7H C;  3CU7 A;  2HDM A;  3LX0 A;  2K5V A;  5I6W A;  1EY8 A;  2ENB A;  1XX8 A;  3TN2 A;  4A93 B;  3J80 E;  1A62 A;  1EZ8 A;  2HD3 A;  3M3Y B;  1KAA A;  1EOV A;  2P5Z X;  1LTB D;  2N78 A;  2HDL A;  4OWX B;  2Q2H A;  1Y8N B;  2M00 A;  3S1M H;  3V05 A;  1NSN S;  1B7Y B;  3NBH A;  1LUZ A;  2F0D A;  4DPG A;  4IUT A;  3STB C;  3UE1 A;  1D8L A;  3U9S A;  1N34 L;  4OXP A;  3S24 A;  1W6K A;  3ZJY C;  2RCF A;  4U67 3;  1FL0 A;  4X3K A;  1HXY D;  4YCV A;  1PRT C;  3W3A A;  1SLJ A;  4DR2 Q;  1AN8 A;  3PSI A;  2K5N A;  1G6Z A;  2AWO A;  4LAA A;  4APV A;  4KKT A;  1ESR A;  3TP8 A;  1MSH A;  4DR6 L;  4WRD A;  1IKM A;  2JA7 H;  1UEA B;  1HNZ L;  3T51 B;  2EYF A;  5DLQ E;  5M3M H;  1XTC D;  2F3W A;  2OTJ A;  3ERQ A;  2NN6 H;  1VQJ A;  1VQ6 A;  2LS0 1;  3E9I A;  4C56 C;  4NW2 A;  5C4J H;  1SND A;  3PUZ A;  2F0V A;  2NYZ D;  3S16 H;  1KHI A;  4ZAI A;  2D0O A;  4LF9 Q;  5JJZ A;  4IO9 A;  3R2I A;  4MN3 A;  1D5X C;  1X3F A;  1JOO A;  5T1I A;  3HOU B;  3F2D A;  1VQP A;  3I91 A;  3A56 A;  3GTO H;  1X54 A;  2AQ2 B;  2CWP A;  2MFI A;  3PO2 G;  2J7Z A;  1NBW A;  2F4V L;  1DXM A;  2F0T A;  3QOJ A;  5EBC A;  4AYB G;  5F2D A;  3NK9 A;  1U0L A;  4OL7 A;  5AFW A;  1F9S A;  3OMC A;  4GNX A;  3QG1 A;  2XIW A;  3KF6 A;  2B63 H;  1MJC A;  4JI7 L;  1SNP A;  1BCP F;  1J5E L;  4HMJ A;  1A6X A;  3GTQ H;  1I3Q H;  2FHT A;  4EX5 A;  4EQP A;  3OYY A;  5M3M B;  3JAM L;  3NBI A;  2JA8 B;  2NZH A;  3AMU A;  3MXU A;  3OWF A;  3KF8 A;  3Q8D A;  2AKW B;  3QOL A;  1YJN A;  1MGS A;  4OO1 H;  1OXS C;  2JXM B;  3K81 C;  4KI0 A;  1AE2 A;  3UE0 A;  4LMQ D;  4XIG S;  4PG3 A;  3HOZ H;  1YHB A;  4KHV A;  3M7G A;  4A3D H;  1GJX A;  2R93 G;  2RDH A;  1TWA H;  3GTM H;  3FRP B;  2JA5 G;  2OQ0 A;  1IL2 A;  1IL8 A;  1IBM Q;  1SYD A;  3J7Y W;  4C3J H;  3GTL H;  2BH2 A;  3F2C A;  1PZJ D;  1Q81 C;  1PH7 A;  4Q0F A;  1WTW A;  2K05 A;  2PW7 A;  3NQT A;  4ULL A;  1GVP A;  4FXG C;  1CKM A;  1EY4 A;  3IFT A;  4JCV E;  1STG A;  3FMC A;  3HOX H;  3SK8 A;  2JSO A;  1Y69 U;  2A8V A;  4A3E H;  4G4K A;  3RLN A;  2HCI A;  3RN5 A;  2ES2 A;  3UDG A;  2B2Y A;  1HZA A;  1WTR A;  3H09 A;  1B3Q A;  4RWS C;  3CXC A;  5GQO A;  3NPP A;  1E3P A;  1YEZ A;  4AIM A;  2PZW A;  4P2C B;  3VR5 A;  4HED A;  1CI3 M;  4PZ7 A;  2JA5 B;  3K7A H;  1PRT B;  3ULJ A;  1J5E Q;  1TWA B;  3GTM B;  1TWG B;  2NB0 A;  2XGT A;  4K5X A;  4KJN A;  1N32 Q;  1WTX A;  2JK8 A;  4BA2 I;  3DLL A;  4A3F H;  3MXG A;  1H9S B;  2ZJP A;  1CHP D;  3P7J A;  1EIF A;  1AP0 A;  2SDF A;  4YCU A;  2J0T D;  1SJE D;  3S2D H;  1KRS A;  3OHX C;  4HMI A;  1NMG A;  2B2W C;  1N33 Q;  5IOD A;  4BBR G;  5T1G A;  2F0N A;  3ULP A;  3R93 A;  1ILQ A;  1X65 A;  1B1Z A;  5C3X A;  5KYI A;  4DR1 L;  2YU9 H;  1T5E A;  4A3B B;  4JI3 L;  2QKI C;  1R9T B;  3PUW A;  3Q6S A;  1NE3 A;  1BVS A;  1GKH A;  5IP7 G;  2B2U C;  3SVM A;  2A69 C;  1L0Y B;  3H15 A;  2V4D A;  4G57 A;  4KY6 A;  3FPP A;  1DOK A;  4NXM L;  3BZK A;  5ISR A;  2KA7 A;  1IHZ A;  1UE6 A;  4IAL A;  3EN2 A;  3K59 A;  1QUQ B;  3F8T A;  4JBW A;  5ELB A;  1JE4 A;  2DJF C;  1IBL Q;  5C4X G;  4HTH A;  5NUC A;  3M4O H;  1WOC A;  4XQN A;  4UDU C;  4ZKB B;  5LMN Q;  3M85 A;  4LF6 L;  2EVB A;  4IUU A;  1DOM A;  5ELC A;  3T1Y L;  1MSG A;  3CQZ H;  2KBN A;  3RMH A;  1MI2 A;  4JOI C;  3OOC A;  3NTI A;  1KDB A;  4CDC C;  5JPM C;  2JE6 I;  4NXN L;  1JE5 A;  2ZJR A;  1TWC B;  4DK0 A;  3X3N A;  4LF4 Q;  2CW0 D;  2NVX H;  4A3M H;  2IHF A;  2F0M A;  2UUC Q;  1KAB A;  1K83 B;  2L11 A;  2A73 B;  5GAE C;  2VY3 A;  4I65 A;  4DNI A;  5IYB G;  4F88 A;  3QJY A;  2ASB A;  3ITP A;  4DV6 Q;  3S1N H;  3GQB A;  3A5U A;  5C4X B;  4A3G G;  2N49 A;  1RD9 D;  3HOW H;  3MTS A;  1Z7T A;  1A2T A;  4MZ9 A;  5GAG C;  2RHQ B;  1E7Z A;  2WFW A;  1PFB A;  1VQ9 A;  1SMY C;  4WJ4 A;  5E4W C;  4JI5 Q;  2KCN A;  5E3F A;  1HHV A;  4X66 L;  1DZ1 A;  5AJ3 Q;  5LMU L;  5DNF A;  1I50 B;  4QGU A;  2FMM A;  3IFD A;  3HEJ A;  1HNX Q;  1G2T A;  2XN9 C;  3TME A;  3R8B A;  1TR5 A;  4LNQ A;  4A3M B;  3CCV A;  1LTG D;  4IQZ A;  4BY7 B;  4JI1 Q;  3I4N G;  3IKJ A;  1EU3 A;  3TP6 A;  3M4P A;  3K5N A;  2CQO A;  2OCE A;  4TRD A;  2Z4I A;  3JAM i;  3SDZ A;  2JP1 A;  4GS3 A;  3S1N B;  1SYF A;  2F0W A;  4X3T A;  4IFD H;  2O5J C;  4Y7N H;  1FNU A;  2PI2 A;  1PLF A;  1EL0 A;  5JEA H;  4JI0 L;  3K0X A;  3M9B A;  1X32 A;  2RBM A;  4K6L A;  3S14 B;  2FJ2 A;  5JJI A;  4ZQ3 A;  3UDX A;  4MNO A;  3UDI A;  2HUG A;  2E76 C;  2R92 H;  1SSO A;  4CJ1 B;  3GTP H;  1B8A A;  1M4V A;  4RMF A;  5M5W B;  2E2H H;  3DM1 A;  4HN7 A;  5IT9 E;  3W1B A;  4HCS A;  4NB3 A;  3H3V C;  1RTN A;  5IYD H;  2A68 D;  2QF7 A;  1SFO H;  1VQD A;  4DAY B;  2F0F A;  2DY7 A;  3W1G A;  2WB1 E;  4BS9 A;  4Y52 H;  3PIP A;  3H0G H;  2A6E C;  5I9P A;  2B29 A;  1JC7 A;  2VB3 X;  2Z6K C;  1STH A;  1PV4 A;  4KHP L;  3J7Z C;  2JEA I;  2B2W A;  1QG7 A;  2EY1 A;  5FLM G;  1EFI D;  3U9O A;  3I8Z A;  1WTP A;  3FVQ A;  1CKN B;  2AHO B;  1RKN A;  1B2T A;  2JEB I;  2WP8 J;  1X56 A;  1M90 C;  1KD1 C;  2PQE A;  4PMW A;  2RDG A;  1PZK D;  4QIW E;  4L5R C;  2R92 B;  2HIV A;  3M7N A;  2SEB D;  5KEE A;  3L0O A;  1YNJ D;  1XNR Q;  3S17 B;  4A3J H;  3L9A X;  1E2Z A;  3GTJ B;  2K33 A;  3PIO 3;  1HUM A;  4A3K G;  1SFO B;  1E2W A;  2PNR C;  3H6M A;  3HGB A;  5K5P A;  3WDN A;  4X3U A;  4YHH L;  1RTO A;  5C44 H;  3D0F A;  2NVQ H;  1TY2 A;  1STN A;  5KNC A;  4M1U B;  4LFC Q;  3HOY H;  5CV6 A;  1PTO H;  1CZG A;  4QF4 A;  4GN4 B;  2XVS A;  1KAW A;  2F3V A;  3BYT B;  1I6H H;  1JQY D;  2WB1 G;  4JOI A;  3K57 A;  2JA6 G;  4GLV B;  3NWS A;  3CC2 A;  4JI8 L;  4A3C H;  4JW0 A;  4B3S L;  2B39 A;  2BH8 A;  1L1O B;  5JVH 3;  5C3E G;  4DV3 L;  1HR0 W;  5A2Q L;  2HHH Q;  3CRL C;  1BXT A;  3I7F A;  5FO8 B;  4A3J B;  4BY1 H;  2H4O A;  4HIK A;  1D1K A;  1B50 A;  5GRO A;  3MEF A;  1VQM A;  3PF4 A;  4F87 A;  1V8Q A;  3H3V H;  1DON A;  3I3C A;  1TWH H;  1XPR A;  3HOV H;  1Y8P B;  4B3T Q;  3I4M H;  2NVQ B;  1BR9 A;  4ZK9 B;  5ELD A;  1SAP A;  5IYC G;  2EYJ A;  3C46 A;  3JAM E;  4J6H A;  2PQA B;  3A7A B;  2K32 A;  1GHJ A;  3NEM A;  3M4Q A;  2D5D A;  4IUN A;  1XMO L;  1NMF A;  1O7L A;  2EYL A;  4UHV A;  2WB1 B;  3GO5 A;  2JA6 B;  1YNN D;  2E2J B;  1PFS A;  1I6H B;  2UU9 L;  5EKK A;  3ER0 A;  3FDT A;  3T13 A;  1UUP A;  1QIL A;  5LL6 X;  5C3E B;  3KOJ A;  2GN5 A;  5C4H A;  3D4W A;  2VL6 A;  1WVL A;  2EQS A;  1TWF H;  2H1E A;  2ZTE A;  4DV5 Q;  4KHZ A;  1HA6 A;  2N8N A;  1SMX A;  2H5X A;  5EJW A;  1QNK A;  3I55 A;  1Q1E A;  1STA A;  3ULL A;  3HZX A;  4R4I A;  3NTK A;  1PH1 A;  4K0K Q;  1UE7 A;  4K2K A;  4LUO A;  4LUV A;  5D14 A;  5IT9 c;  1BNZ A;  4TKO B;  2UXB Q;  1PZI D;  4GKK L;  3SK4 A;  2IT1 A;  1T9H A;  4P74 A;  4IPD A;  3T1H L;  1BF4 A;  2RCN A;  4DV3 Q;  2F0J A;  2PW5 A;  4FVM A;  2Z6B A;  1J8I A;  2F0I A;  3VYS A;  4O42 A;  4JI6 Q;  3DWQ A;  1HNW L;  1XYI A;  2J4X A;  2KCM A;  1IBK L;  3AFP A;  3SGI A;  1TS5 A;  4UP8 A;  1ET6 A;  1VDZ A;  3J81 L;  1D5Z C;  1TWF B;  1A3T A;  4JV5 L;  1WFQ A;  2F4I A;  2Q8I B;  3P20 A;  5JPN C;  2R7Z H;  4MTK A;  2GVB A;  4R8N A;  4A3I B;  2E8G A;  3CPF A;  5FO7 B;  1EYA A;  4F8M A;  4FP5 D;  1K73 C;  1BBW A;  2Z6K A;  1B4O A;  4K5W A;  1SRU A;  4IPC A;  3K80 C;  2EDG A;  1LTR D;  5IWA Q;  2DUD A;  1C48 A;  2F03 A;  1O80 A;  3TZU A;  3U58 A;  2O5I C;  2LXK A;  1F2Z A;  5HGQ A;  2PNH A;  1SE4 A;  5EPJ A;  2JA9 A;  4CDF C;  4WJ3 M;  2IJ0 A;  4CKB A;  4MTN A;  1YJW A;  1K8M A;  4YCW A;  3ERS X;  1AE3 A;  5ELE A;  1UE5 A;  1LYL A;  1A3V A;  2B2Y C;  2XWJ B;  2UUB Q;  4DAV A;  3S15 H;  1ROD A;  2B3G A;  3NBH B;  2EYH A;  3FHW A;  2I5L X;  3NUC A;  3CRK C;  5FLX L;  1X3Q A;  3T4A C;  1UNS A;  3AB9 A;  2Z1C A;  3NEN A;  1EY7 A;  2V1C C;  3Q24 A;  1L2F A;  4KY7 A;  1AEX A;  3DEP A;  5COY A;  2EY6 A;  1ZKO A;  1XJV A;  1SJH D;  4DV4 L;  2RKS A;  1GUS A;  1OO9 B;  3EJI A;  3C1F A;  3IAY A;  4EQO A;  1FVI A;  1KC8 C;  4FF2 A;  5EGT A;  3MEH A;  1IBK Q;  2IHE A;  2VZA A;  3AQQ A;  1NNX A;  1KLG D;  2CH4 W;  4BBS B;  4YIJ A;  1S72 A;  1EIY B;  3TBI B;  3TRE A;  4DV7 Q;  4V19 0;  2L1B A;  3K7U C;  4JV5 Q;  3BG3 A;  1PRT F;  1U4L A;  2I07 B;  1VF5 C;  1PH2 A;  1VQ4 A;  4OEM B;  1CFM A;  1YIJ A;  1SYB A;  3HOU G;  2HT1 A;  4IUV A;  1NR4 A;  4DR5 L;  2I46 A;  3K0Y A;  3P1H A;  1KIX A;  2UUA L;  3PO3 H;  3EA6 A;  1ONL A;  1E1T A;  4B3R Q;  1X6O A;  4JG2 A;  1Y1W H;  4BXX G;  5J1Z A;  1SYE A;  3MWY W;  4YY3 L;  2AMC B;  4DUY Q;  3HKS A;  5LHY 1;  1K8G A;  5M5X H;  1DGS A;  2XWB B;  3HG9 A;  1KLU D;  2JA7 G;  4LFB L;  5E7N A;  1HCZ A;  1O78 A;  1CQV A;  3KF6 B;  2BE5 D;  4GNX B;  1V1P A;  1HH2 P;  4RCN A;  4LJZ C;  3SK6 A;  5M3M G;  3S1M B;  5EAY A;  2JA8 G;  1I6V C;  2NN6 G;  3O13 A;  1ASZ A;  4X6A H;  1IXR A;  4TVA B;  3VYR A;  3RD4 A;  4F7X A;  4DV4 Q;  3KF8 B;  4YWK A;  5IGF A;  1HFN A;  4HAE A;  2C5C A;  4DV1 L;  1LV9 A;  3PO3 B;  1EWH A;  1Q86 C;  1Y1W B;  3VA7 A;  4XYO A;  1LTT D;  2WV6 D;  4H44 C;  4HCE A;  4LFA L;  1JOQ A;  4OON A;  2A1A A;  2JA7 B;  3DHQ A;  5M5Y H;  3SE0 A;  3PO2 H;  1N34 Q;  3N6R A;  2QDB A;  5FOB B;  1WCM H;  2K5Q A;  1XMQ L;  2KHJ A;  4HJA A;  4C1N I;  2BDN A;  4K8I A;  5C4J B;  4DKA C;  1BKB A;  5HUR A;  2IX0 A;  5G3L D;  4UAI A;  3S16 B;  2Y0S E;  2K6A A;  3DUZ A;  1V1O A;  2R6G A;  1PVO A;  3UDF A;  4DR6 Q;  1EZ6 A;  4KJO A;  3UI2 A;  2VUM H;  1E0B A;  1HQR D;  4O1N A;  4TSS A;  3GTO B;  2FXQ A;  1D6E C;  1HNZ Q;  3HOZ G;  1PHJ A;  2WII B;  2CW0 C;  3D6C A;  3FEW X;  1G8Z D;  5CC4 A;  4CBV A;  4OX9 L;  4ZYS A;  2Z4H A;  4GOP C;  5H1S E;  1LT6 D;  3E6Z X;  3KBX A;  1KDC A;  1STY A;  1I94 L;  2B63 B;  2UXC L;  3URY A;  2UXD L;  4J1M A;  5M5Y B;  5IGB A;  4H0L C;  3GTQ B;  1I3Q B;  4WJW A;  5IP9 G;  1C9O A;  2K5D A;  2R93 H;  3BVG A;  4B08 A;  1Q46 A;  1W3S A;  5GAH C;  4H02 A;  1IW7 D;  1SRO A;  2E5L L;  3J80 c;  4GN5 A;  4A3E G;  4KY5 A;  3E9H A;  2MQH A;  3S1R H;  1ICW A;  1RHP A;  2F4V Q;  3J81 i;  4IPH A;  2KED A;  1MD2 D;  4A3B G;  4OWT B;  2KQ3 A;  4UPA A;  4LF5 L;  5FO9 B;  1EIG A;  2KCT A;  1BO0 A;  2VUM B;  3HOZ B;  3G71 A;  2F0P A;  4POF A;  4JI7 Q;  4IZ8 A;  4A3D B;  2D0P A;  4RGN A;  3CME A;  1SE2 A;  2M9V A;  4EGV A;  4C3I H;  2QEX A;  2XRQ D;  3SEB A;  3H94 A;  4HR7 B;  4C3J B;  3GTL B;  1OXU A;  1JOR A;  5KYL A;  2E74 C;  4IOA A;  3KJP A;  3PGZ A;  5FJ8 H;  5EQ0 A;  4KD3 A;  4A3F G;  1YIT A;  2PI2 E;  3AYH B;  4X64 L;  2OXP A;  3RNU A;  1ENF A;  2EXD A;  1XPU A;  3A8J E;  4JC0 A;  2KEC A;  3NP8 A;  2VQF L;  3HOX B;  3AFQ A;  4R4C A;  5IGG A;  4A3E B;  1R4P B;  1UE1 A;  1JR0 D;  3CD6 A;  1C4Q A;  3PMF A;  3KDF A;  3RZO H;  2NTT A;  1ZXT A;  5BN5 A;  2O2L D;  3RLF A;  5C3W A;  2PZT A;  3HP3 A;  5I6Y A;  4ABN A;  3CCJ A;  1FJG L;  3D6W A;  4DUZ L;  1IYV A;  2MPM A;  1VQ7 A;  3CC7 A;  3K7A B;  1HUN A;  2OWO A;  2WKD A;  1VQE A;  1FR3 A;  1Z6H A;  4C3I B;  3CPW A;  2A68 C;  3EBE A;  3T16 A;  4EQ5 A;  1LAB A;  1YJ9 A;  4B3M L;  4NDX A;  2E5L Q;  1B53 A;  4DAM A;  4A3F B;  2K01 A;  1Q12 A;  2FMC A;  4DXG A;  1NJI C;  2YYZ A;  3CCS A;  2EE1 A;  4HID A;  3S2D B;  3E0J A;  2DJG C;  1XXG A;  1KTK A;  4PZ6 A;  1EFW A;  1Q8K A;  1A8V A;  4KMU C;  2YU9 B;  2Z9H A;  4CKE A;  3KK7 A;  3PUY A;  4QCL A;  4K2L A;  1H95 A;  3G48 A;  4LF8 L;  4V0B A;  4CGY B;  3D3R A;  3DXJ C;  3DWP A;  1CA6 A;  4OWW B;  4UP9 A;  1BCP D;  5CV9 A;  1YNJ C;  3ND8 A;  4A3M G;  1S5D D;  1FGB D;  2KEN A;  1OXX K;  1YBY A;  3GV3 A;  2K28 A;  2X69 A;  4C2M H;  1JB3 A;  2WAQ E;  4BY7 G;  1EUJ A;  1RL2 A;  3BVM A;  1I4R A;  1JOK A;  2N55 A;  4KKU A;  3F1Z A;  3VR3 A;  2PYK A;  1T5X D;  1PH8 A;  2X6G A;  4QL5 A;  3EFX D;  1HR0 L;  1VQL A;  3JC6 6;  2WIN B;  3CCE A;  4DR1 Q;  1D7Q A;  1TXY A;  4X62 L;  4JI3 Q;  1VS0 A;  3M4O B;  1D1I A;  1M8A A;  3I4O A;  1TS4 A;  2C35 B;  5J22 A;  4RGM A;  1CA5 A;  2EYO A;  3CQZ B;  2R7F A;  5CBA E;  4X3S A;  2XSC A;  1WTO A;  1QNU A;  4ODG A;  4DR3 L;  1EQQ A;  2CWA A;  4NXM Q;  1GXD C;  4JVZ A;  4DK3 C;  4A3G H;  2YTX A;  1SYG A;  4C3H H;  1K0R A;  1C8C A;  1TQO A;  1EEI D;  1VQA A;  4PQX A;  2NVX B;  1EQT A;  1SNM A;  1JJ2 A;  2D62 A;  1PTO F;  2M2L A;  2ZM6 L;  2CFM A;  5IOC A;  4GOP A;  1CK1 A;  3CAM A;  1QZG A;  1H9K A;  3GP7 A;  3TP7 A;  2IWH A;  3BJU A;  4LF6 Q;  3FP9 A;  2MUY A;  1PTO C;  4N8X 1;  3T1Y Q;  2MO1 A;  3MFY A;  4IUQ A;  5JOB A;  5C0X G;  3HOW B;  4ME3 A;  1BDO A;  2KOL A;  4R1J A;  1JIC A;  2EY2 A;  4NXN Q;  1RF2 D;  3QR8 A;  2LFN A;  4MIU A;  3GTG H;  2F3I A;  3I4N H;  2K52 A;  3KYH C;  5JEA G;  2EJM A;  3WOE A;  1EOT A;  3KFU A;  1MIU A;  1YNN C;  3I72 A;  1N36 L;  4JI2 L;  1JWS D;  2BA1 A;  2ID0 A;  4DU9 A;  1GUO A;  2KVM A;  5J3B A;  5FLX E;  5K36 H;  1VF7 A;  3HS0 C;  1F9Q A;  2R92 G;  1I4Q A;  1QVC A;  2A5H A;  5LMN W;  1C7Y A;  3TDQ A;  3E0E A;  5JVG 3;  1FD7 D;  1VQK A;  2EIF A;  1O7I A;  4X62 Q;  5IYD G;  1KL9 A;  4WOR A;  3MXN A;  2ICI A;  4Z9C B;  3SHL A;  2SNS A;  2F0S A;  1FGU A;  3KBG A;  3S2H H;  1B44 D;  2N3S A;  4GLX A;  4X66 Q;  1Z47 A;  5LMU Q;  1A2U A;  5EPK A;  4QY7 A;  4XYQ A;  2VW9 A;  2B8G A;  1WJJ A;  1H9R A;  2A69 D;  1S5C D;  1SE8 A;  2EJG C;  2WAQ B;  4Y7N B;  1RCV D;  1NY4 A;  4HSP A;  5I2X A;  2IX3 A;  4DF7 A;  3PUX A;  1TS3 A;  2RDF A;  4C1N K;  3HKZ E;  3T53 B;  4DV2 L;  3S1Q H;  3HRZ C;  3ICE A;  1EWI A;  2DNE A;  2EYP A;  3BDL A;  4ZRZ A;  2PPB C;  2PO4 A;  4AH6 A;  1Y1V H;  2AQ1 B;  4IUR A;  3GTP B;  2ZTC A;  1ENC A;  1ZEQ X;  2IY5 B;  2EPB A;  5CMD A;  2E2H B;  2A74 C;  4UY8 C;  5FLM H;  3GDE A;  1S5E D;  4EVO A;  4A3J G;  1F9R A;  4AQY L;  3RZD H;  1CHQ D;  2GVA A;  2A6H D;  3QIA A;  1VCI A;  4O0A A;  1IKL A;  1P16 A;  4FDB A;  5C0X I;  4JI0 Q;  5C0X J;  3H0G B;  3LWE A;  5C44 G;  3OW2 A;  1X3G A;  1N36 Q;  4QQB X;  5CR3 A;  1TY0 A;  2F0L A;  3HOY G;  2DN8 A;  4JK1 C;  4WFN 3;  5JEA J;  1EEF D;  4OGQ C;  4A3K H;  4R4Q A;  4DR4 L;  1X3E A;  4L5Q A;  3MFG A;  3I90 A;  5CYU A;  4L63 B;  4P71 A;  2L15 A;  4LF7 L;  4YWM A;  1LTI D;  3BZD B;  4A3C G;  2MJ8 A;  1PFN A;  4QMG A;  2BCO A;  1TKW B;  1EQR A;  1EWC A;  3K5L A;  2JQO A;  3VR2 A;  4BY1 G;  1QB5 D;  3VYT A;  5CBE E;  4KHP Q;  1B70 B;  1GD7 A;  3PIO A;  2AWN A;  2B8F A;  4HIM A;  5C44 B;  3HOV G;  2B2V A;  3OIP A;  1EY6 A;  1UEB A;  1K9M C;  2PMZ E;  4DV2 Q;  3HOY B;  2R7D A;  3TRZ A;  3FKI H;  1PTO B;  3CF5 A;  3KLS X;  1DYQ A;  2R3Z A;  2L4N A;  4KD4 A;  2OQK A;  1EYC A;  1LT4 D;  1ZYR D;  2VQE L;  4DGZ A;  1QJO A;  1VQN A;  4KK7 A;  3VR6 A;  1RDP D;  1XNQ L;  2K03 A;  5DEH A;  3NWT A;  1B9N A;  3OMG A;  3RLO A;  4YHH Q;  4LUZ A;  5M3F H;  2KCC A;  2PZU A;  5DM7 3;  4BY1 B;  1E1O A;  1XTD A;  3HKZ B;  1WTQ A;  2YTV A;  5C6A A;  2AQ3 B;  2DGY A;  3IRB A;  4QIW B;  2KUM A;  2XTI A;  4K6D A;  1TWH B;  4QUF A;  3HOV B;  2E2I H;  3ERO A;  2AUJ D;  4A3I G;  3I4M B;  1LO5 D;  2CCZ A;  4ZCK A;  1JWU D;  3VDY A;  1HA5 A;  2EJF C;  5A35 A;  4OEL B;  4JI8 Q;  4B3S Q;  4GLA C;  3B6Y A;  4GKJ L;  4NKL A;  5FK9 C;  1YHQ A;  2CQA A;  3LWU A;  3VR4 A;  2JJQ A;  4LW1 A;  2BE5 C;  1YI2 A;  1LT3 D;  3W2D A;  2B2T C;  4I7A A;  4LWC A;  1CTM A;  4ME5 A;  4R4T A;  2KHS A;  4DR7 L;  5IGD A;  3L2P A;  5M3F B;  4DK1 A;  1G6P A;  5IE8 A;  2D2C C;  1L0X B;  4HJ7 A;  3I70 A;  3BS1 A;  1VMC A;  3U4Z A;  1HFG A;  4ZUI A;  5GAD C;  3TS2 A;  1XMO Q;  1X55 A;  3ZYY X;  4KLK A;  3NSW A;  2R7Z G;  2JYO A;  2YTY A;  2UU9 Q;  2SOB A;  4PZ8 A;  4EQN A;  4DV0 L;  1VQ5 A;  1XNQ Q;  3MC0 B;  1PFM A;  2O4X A;  4DAP A;  3A7L A;  4H7B A;  2HQL A;  5KNB A;  1E24 A;  1BOS A;  1S5B D;  1CKO A;  4R9W A;  4BBS G;  4RA8 A; 
#chains in the Genus database with same CATH homology
 2K14 A;  4A93 H;  3CCL A;  1KXL A;  2VUM H;  3M3Y H;  2FXQ A;  1RIP A;  4DR2 L;  1HNZ Q;  5JJK A;  5GAE C;  1PHJ A;  2Q2T A;  3HOZ G;  2I5H A;  4DV5 L;  4GKK Q;  2VY3 A;  2ALY B;  4DNI A;  5IYB G;  4A3L G;  4OX9 L;  4P73 A;  2ASB A;  1CKN A;  4X65 L;  4DV6 Q;  4JI4 L;  4GOP C;  3S1N H;  5H1S E;  2IX1 A;  3A5U A;  4K0K L;  4A3G G;  2N49 A;  3T1H Q;  3HOW H;  2UXC L;  3HKZ G;  3J81 c;  1I94 L;  2JA6 H;  2E2J H;  2UXD L;  4MZ9 A;  1LTL A;  5GAG C;  2UXB L;  2RHQ B;  1E7Z A;  4XTC S;  3A74 A;  2WFW A;  5ELO A;  3U50 C;  3J81 j;  5IP9 G;  1VQO A;  1VQ9 A;  1A0I A;  1C9O A;  1UWV A;  4WJ4 A;  4JI5 Q;  2R93 H;  3AEV A;  4JBJ A;  1Q46 A;  4X66 L;  1W3S A;  5GAH C;  5C3E H;  5AJ3 Q;  2I5M X;  3F2B A;  4H02 A;  5LMU L;  4P75 A;  3I4M G;  1HNW Q;  1SRO A;  2E5L L;  3J80 c;  4GN5 A;  4A3E G;  4QGU A;  3E9H A;  3HFZ B;  2MQH A;  3FKI G;  2QA4 A;  3S1R H;  3RN2 A;  1X9N A;  1HNX Q;  2F4V Q;  3J81 i;  3JAM c;  4LF9 L;  4HIO A;  2ZTD A;  4IPH A;  4A3B G;  4IJL A;  4IPG A;  4OWT B;  4JI6 L;  4LNQ A;  1Z9F A;  4UPA A;  4LF5 L;  4AQY Q;  2VS1 A;  3CCV A;  2KCT A;  2MNA A;  3KLW A;  5IYC H;  2K75 A;  4JI1 Q;  3G71 A;  3J80 i;  4POF A;  4JI7 Q;  3I4N G;  3OTO L;  3M4P A;  2CQO A;  4DV0 Q;  2OCE A;  2D0P A;  3CME A;  4C3I H;  2QEX A;  3JAM i;  1L0W A;  5M3F G;  4GS3 A;  1OXU A;  4J15 A;  3PO3 G;  1JB7 A;  4IOA A;  1VQB A;  4HJ9 A;  3KJP A;  3PGZ A;  1I5F A;  4L5T A;  5FJ8 H;  1OTC A;  1Y1W G;  1J6Q A;  4A3F G;  1YIT A;  4HJ5 A;  2PI2 E;  5FLX c;  4Y7N H;  4POG A;  3AYH B;  4AYB E;  2PI2 A;  4X64 L;  3RNU A;  1L1O A;  2Q2U A;  4JBM A;  2EXD A;  1XPU A;  4ALP A;  4DR4 Q;  5IWA L;  4JI0 L;  4R4O A;  3K0X A;  3M9B A;  4JC0 A;  3HOU H;  2VQF L;  1C0A A;  3AFQ A;  4R4C A;  4UP7 A;  2ATW A;  5JJI A;  1UE1 A;  3CD6 A;  3UDX A;  4GN3 B;  4MNO A;  3KDF A;  4LF7 Q;  3RZO H;  3UDI A;  2R92 H;  4BXX H;  3RLF A;  3GTP H;  3TEH B;  1B8A A;  1HJP A;  2KHI A;  4RMF A;  1N8R C;  2E2H H;  1M1K C;  2UUB L;  1VQ8 A;  3W1B A;  4X65 Q;  3CCJ A;  4NB3 A;  1FJG L;  4DUZ L;  4JI4 Q;  4NPS A;  5IYD H;  5BR8 L;  4A3I H;  1SFO H;  1VQD A;  2PQA A;  1GM5 A;  4YWL A;  5JJL A;  4DAY B;  1VQ7 A;  3CC7 A;  2BA0 A;  2A19 A;  3L7Z C;  2OWO A;  1VQE A;  4O2D A;  3W1G A;  1IBM L;  4GNX C;  2WB1 E;  2Z0S A;  1YNX A;  4Y52 H;  3PIP A;  3H0G H;  3CPW A;  1NTG A;  3EBE A;  2B29 A;  2CKZ B;  4EQ5 A;  2JA8 H;  3PV0 A;  1YJ9 A;  3H3V I;  4B3M L;  2Z6K C;  2E5L Q;  4DAM A;  1PYS B;  1CSQ A;  1PV4 A;  4KHP L;  3J7Z C;  2JEA I;  3GTK H;  1Q12 A;  1NJI C;  1JJC B;  2YYZ A;  5FLM G;  4L5S A;  1VQG A;  3CCS A;  1VQH A;  4HID A;  1CKN B;  2VQE Q;  2AHO B;  2B63 G;  3RR5 A;  2JEB I;  2WP8 J;  1X56 A;  1ASY A;  1M90 C;  1KD1 C;  2YV5 A;  2K4K A;  5HY6 A;  1XPO A;  4PMW A;  4PZ6 A;  4QIW E;  4HJ8 A;  1EFW A;  4L5R C;  1Q8K A;  3OTO Q;  2HIV A;  1A8V A;  3M7N A;  1WCM G;  3DM3 A;  4DV7 L;  4DR5 Q;  3L0O A;  2UUC Q;  1XNR Q;  3PUY A;  4A3J H;  2UUA Q;  3PUV A;  1H95 A;  3G48 A;  4LF8 L;  2K5H A;  1JMC A;  4A3K G;  2LSS A;  4YY3 Q;  4UP9 A;  4OWW B;  4OO1 G;  3CP0 A;  1HZC A;  1E22 A;  3LGJ A;  4RG1 A;  3A5Z B;  4A3M G;  4YHH L;  1WYD A;  3D0F A;  2KEN A;  1OXX K;  5C44 H;  1YBY A;  2NVQ H;  4DR6 Q;  4A93 G;  1N32 L;  4C2M H;  2WAQ E;  2VUM G;  4BY7 G;  1EUJ A;  4LFB Q;  1RL2 A;  4LFC Q;  3HOY H;  3CCQ A;  5ELN A;  3G4S A;  1PH3 A;  1KQS A;  1KRT A;  3F1Z A;  4A3D G;  4B3R L;  1PH8 A;  4BBS H;  4QL5 A;  1HR0 L;  4GN4 B;  1VQL A;  4GKJ Q;  1KAW A;  3JC6 6;  3CCE A;  4DR1 Q;  4DUY L;  1D7Q A;  1TXY A;  4X62 L;  4JI3 Q;  1VS0 A;  1I6H H;  4JOI A;  2WB1 G;  3TQY A;  2JA6 G;  3I4O A;  2I0Q A;  4GLV B;  1N33 L;  5BR8 Q;  3J7A 5;  1GO3 E;  2C35 B;  3CC2 A;  2NN6 I;  2RHS B;  3NEL A;  4JI8 L;  4A3C H;  3W5O A;  4B3S L;  2JA5 H;  2R7F A;  2BH8 A;  3HOX G;  1L1O B;  2F52 A;  1TWG H;  5C3E G;  4A3L H;  3PCO B;  4DV3 L;  1HR0 W;  4DR7 Q;  1SN8 A;  1EQQ A;  3I56 A;  4DR3 L;  4DV1 Q;  2CWA A;  3I7F A;  2HHH Q;  4NXM Q;  2K5V A;  4BY1 H;  4DK3 C;  1Q82 C;  4A3G H;  4HIK A;  2YTX A;  4IJH A;  2ZJQ A;  5GRO A;  3MEF A;  4C3H H;  1K0R A;  1VQM A;  3PF4 A;  3KDF B;  3H3V H;  1VQA A;  1TWH H;  5IP9 H;  1XPR A;  1JJ2 A;  3HOV H;  1K8A C;  2D62 A;  4LFA Q;  3K8A A;  1A62 A;  3EIV A;  2ZM6 L;  4B3T Q;  2CFM A;  3KJO A;  1OXT A;  3I4M H;  1S3O A;  1VQI A;  4GOP A;  5IYC G;  1EOV A;  3CW2 C;  2N78 A;  3CAM A;  1YZ6 A;  1QZG A;  2PQA B;  3BJU A;  3STB D;  3FP9 A;  4OWX B;  4LF6 Q;  2Q2H A;  2Y0S G;  3NEM A;  3T1Y Q;  2MO1 A;  1V43 A;  3S1M H;  3M4Q A;  1IBL L;  1XMO L;  1XMQ Q;  1NMF A;  5C0X G;  1WI5 A;  4A3B H;  1B7Y B;  1R9T H;  1LUZ A;  3GO5 A;  3I2Z A;  4ME3 A;  4R1J A;  1JJG A;  1PFS A;  2NZO A;  5FJ8 G;  4DPG A;  3STB C;  2UU9 L;  4NXN Q;  5LMN L;  3ER0 A;  3UE1 A;  3GTG H;  1D8L A;  2F3I A;  3I4N H;  4DR4 L;  2K52 A;  3KYH C;  1N34 L;  4OXP A;  5JEA G;  3S24 A;  3ZJY C;  3KFU A;  1FL0 A;  3KOJ A;  1MIU A;  4YCV A;  1N36 L;  4JI2 L;  2GN5 A;  2VNU D;  2VL6 A;  1SLJ A;  4DR2 Q;  2BA1 A;  2ID0 A;  1N9W A;  2EQS A;  1TWF H;  5J3B A;  2ZTE A;  2K5N A;  3PSI A;  4KHZ A;  4DV5 Q;  4OO1 I;  2AWO A;  4APV A;  2N8N A;  2R92 G;  4QJF A;  1SMX A;  2H5X A;  1QVC A;  5LMN W;  1C7Y A;  4OX9 Q;  1PA6 A;  4LF4 L;  3I55 A;  2UUC L;  4DR6 L;  1Q1E A;  3E0E A;  3ULL A;  4R4I A;  1PH1 A;  4K0K Q;  1UE7 A;  4LUO A;  4LUV A;  1VQK A;  2EIF A;  1O7I A;  4X62 Q;  5IYD G;  1I94 Q;  2JA7 H;  4DK6 C;  5IT9 c;  2UXC Q;  2UXD Q;  1KL9 A;  1HNZ L;  1P8L A;  2UXB Q;  1IZ6 A;  1Q1B A;  5DLQ E;  4GKK L;  1G29 1;  4BBR H;  5M3M H;  1FGU A;  3S2H H;  1Y14 B;  2IT1 A;  2N3S A;  4GLX A;  4X66 Q;  1Z47 A;  2OTJ A;  1T9H A;  5LMU Q;  4DV6 L;  4QY7 A;  3D31 A;  1VQJ A;  4P74 A;  4IPD A;  2VW9 A;  1VQ6 A;  1JT8 A;  3E9I A;  3T1H L;  1WJJ A;  2RCN A;  1BBU A;  4DV3 Q;  5C4J H;  2NVT H;  4A4I A;  1PH4 A;  3PUZ A;  1SE8 A;  3S16 H;  1KHI A;  1TWC H;  2D0O A;  3U4V A;  5IP7 H;  4LF9 Q;  1NY4 A;  4IO9 A;  1X3F A;  1VQC A;  4JI5 L;  3PUX A;  4JI6 Q;  5AJ3 L;  4LF5 Q;  1HNW L;  3F2D A;  3HKZ E;  1K83 H;  1U5K A;  2KCM A;  4DV2 L;  1VQP A;  1IBK L;  3S1Q H;  2OTL A;  3GTO H;  3ICE A;  1X54 A;  3AFP A;  1EWI A;  3SGI A;  4UP8 A;  2CWP A;  2MFI A;  3PO2 G;  1NBW A;  1HNX L;  2F4V L;  4AH6 A;  1Y1V H;  2IY5 B;  2ZTC A;  4AYB G;  4JV5 L;  1WFQ A;  4UY8 C;  1U0L A;  5FLM H;  1EYG A;  3GDE A;  2R7Z H;  4A3J G;  5C4X H;  4GNX A;  2GVB A;  4AQY L;  3KF6 A;  3RZD H;  1HZB A;  2GVA A;  2E8G A;  3CPF A;  2B63 H;  1MJC A;  4JI1 L;  1K73 C;  1VCI A;  4JI7 L;  2Z6K A;  1BBW A;  4X64 Q;  1J5E L;  1QVG A;  3GTQ H;  1CSP A;  4O0A A;  1SRU A;  1I3Q H;  1P16 A;  3K80 C;  4FDB A;  4IPC A;  4EX5 A;  3OYY A;  5IWA Q;  2DUD A;  5C0X I;  1V1Q A;  4TQU S;  5C0X J;  4JI0 Q;  2VQF Q;  5C44 G;  3U58 A;  2LXK A;  3BZC A;  3OW2 A;  1X3G A;  5HGQ A;  1N36 Q;  4QQB X;  1I50 H;  4BA1 I;  2PNH A;  2NZH A;  3HOY G;  2JA9 A;  4WJ3 M;  3Q8D A;  4GOP B;  5JEA J;  3A0J A;  1K3R A;  2LXJ A;  4A3K H;  4MTN A;  1YJW A;  1SR3 A;  2AKW B;  4R4Q A;  4YCW A;  1V9P A;  1X3E A;  3ERS X;  1AE3 A;  1YJN A;  1UE5 A;  1LYL A;  2UUB Q;  4L5Q A;  1FJG Q;  1OXS C;  3HOW G;  4DUZ Q;  3K81 C;  3S15 H;  4KI0 A;  1AE2 A;  2B3G A;  3UE0 A;  4XIG S;  4PG3 A;  4P71 A;  3NBH B;  3FHW A;  1QUQ A;  3HOZ H;  1YHB A;  2I5L X;  2L15 A;  4BY7 H;  4LF7 L;  4YWM A;  4A3D H;  2R93 G;  5IYB H;  1TWA H;  3GTM H;  4A3C G;  2JA5 G;  2OQ0 A;  1IL2 A;  1AH9 A;  1IBM Q;  3G6E A;  1EQR A;  3NEN A;  1PYB A;  4C3J H;  2V1C C;  3GTL H;  2QGQ A;  2BH2 A;  2JQO A;  1A63 A;  4B3M Q;  3F2C A;  1L2F A;  4BY1 G;  1Q81 C;  1PH7 A;  1XJV A;  4KHP Q;  4DV4 L;  1GVP A;  1B70 B;  1CKM A;  1GD7 A;  3PIO A;  2AWN A;  4HIM A;  3HOV G;  4JCV E;  1FVI A;  1KC8 C;  2A8V A;  3HOX H;  3S14 H;  2K50 A;  1UEB A;  3RLN A;  4A3E H;  3CCR A;  1K9M C;  2PMZ E;  3RN5 A;  4DV2 Q;  2ES2 A;  2R7D A;  1IBK Q;  3TRZ A;  1L1O C;  2IHE A;  2VZA A;  3FKI H;  3UDG A;  1HZA A;  3CF5 A;  3AQQ A;  3GD7 A;  3MXN B;  1S72 A;  2OQK A;  1W2B A;  1EIY B;  4IOC A;  3TRE A;  5M5W H;  4DV7 Q;  3CXC A;  5GQO A;  3K7U C;  4JV5 Q;  1E3P A;  2VQE L;  4JYA L;  4IFD G;  1YEZ A;  4LF8 Q;  4AIM A;  2WAQ G;  1PH2 A;  1VQN A;  2Q2I A;  1VQ4 A;  1XNQ L;  4PZ7 A;  1YIJ A;  3K7A H;  3ULJ A;  1J5E Q;  3HOU G;  3RLO A;  2HT1 A;  4YHH Q;  4LUZ A;  4DR5 L;  2XGT A;  1N32 Q;  5M3F H;  5IY0 A;  1KIX A;  1XNR L;  2JK8 A;  4BA2 I;  2UUA L;  3PO3 H;  3CC4 A;  3BU2 A;  3DLL A;  1E1O A;  1E1T A;  1XTD A;  4B3R Q;  1X6O A;  4JG2 A;  3CMA A;  1Y1W H;  5K36 G;  4A3F H;  4P72 A;  2YTV A;  4BXX G;  2DGY A;  2ZJP A;  3IRB A;  4YY3 L;  1HR0 Q;  1EIF A;  2AMC B;  2XTI A;  4DUY Q;  2E2I H;  3HKS A;  4YCU A;  1K8G A;  5M5X H;  4A3I G;  3S2D H;  3WWV A;  1DGS A;  1KRS A;  4LFB L;  2CCZ A;  4LFC L;  2JA7 G;  5E7N A;  4GNX B;  1NMG A;  3KF6 B;  3VDY A;  1N33 Q;  1HH2 P;  4BBR G;  4JI8 Q;  3ULP A;  4B3S Q;  4GLA C;  5M3M G;  3H0G G;  3B6Y A;  4JBK A;  1X65 A;  4GKJ L;  5EAY A;  4DR1 L;  1YHQ A;  2YU9 H;  2JA8 G;  1PH5 A;  2NN6 G;  4JI3 L;  3S17 H;  4DR3 Q;  2JJQ A;  4LW1 A;  3PUW A;  1YI2 A;  1IYJ B;  1NE3 A;  1OXV A;  1BVS A;  3GTJ H;  1ASZ A;  4X6A H;  1IXR A;  4TVA B;  1GKH A;  1VQF A;  5IP7 G;  4DV4 Q;  3KF8 B;  1YVC A;  4LWC A;  4YWK A;  1YHA A;  3TS0 A;  1MJE A;  3H15 A;  2ZM6 Q;  4R4T A;  4DR7 L;  3L2P A;  1LM0 A;  2MO0 A;  1G6P A;  4DV1 L;  5IE8 A;  2HHH L;  4NXM L;  3BZK A;  4HJ7 A;  1HZ9 A;  1Q86 C;  2HIX A;  1UE6 A;  3EN2 A;  1QZH A;  1QUQ B;  1Y1V G;  3F8T A;  4JBW A;  3U4Z A;  1QVF A;  5GAD C;  3TS2 A;  1IBL Q;  1XMO Q;  1X55 A;  4LFA L;  4KLK A;  2R7Z G;  4OON A;  4B3T L;  5C4X G;  4A75 A;  2A1A A;  3M4O H;  1WOC A;  2YTY A;  5M5Y H;  1Q7Y C;  1PH9 A;  2UU9 Q;  4JYA Q;  4PZ8 A;  1PH6 A;  5LMN Q;  4DV0 L;  3M85 A;  2NVY H;  1S40 A;  1VQ5 A;  4LF6 L;  3PO2 H;  2RF4 A;  1N34 Q;  1XNQ Q;  3T1Y L;  3CQZ H;  2KBN A;  1WCM H;  4IFD I;  4JOI C;  4A76 A;  4IFD J;  1XMQ L;  2HQL A;  1CUK A;  2KHJ A;  4JI2 Q;  4HJA A;  1E24 A;  4DKA C;  1BKB A;  2IX0 A;  1CKO A;  2JE6 I;  4NXN L;  1JE5 A;  2ZJR A;  4BBS G;  3CCM A;  2Y0S E;  1G51 A;  3PF5 A;  2R6G A;  4LF4 Q;  1PVO A;  3UDF A;  2NVX H;  1MKH A;  3CCU A;  2IHF A;  4A3M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...