4BBRH

Structure of rna polymerase ii-tfiib complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structure and Function of the Initially Transcribing RNA Polymerase II-TFIIB Complex
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 134
sequence length 145
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4bbrH00
1IL2A 1N33L 5JJLA 1A63A 5ELNA 5J3BA 3JC66 1NMGA 1SLJA 4DAMA 2R7FA 4DV2L 4BBSH 4HIMA 1VQ6A 2JK8A 3RLOA 1OXSC 3CCMA 2Z6KA 1OTCA 5GROA 4A3IH 1VQKA 4PZ8A 3H0GG 1PV4A 1HR0W 4DAYB 1WCMH 1AH9A 2R92H 1UE7A 3U58A 1Q81C 4GNXA 5IWAQ 3HOZH 4KHPL 1V1QA 3A74A 2BH8A 1HNWQ 2ES2A 1XMQL 4A3FG 5K36G 1SE8A 4LFAL 3HKZE 1PYSB 4JI0L 4K0KQ 2L15A 3PUZA 3HKZG 2GN5A 1VQGA 3J7A5 3S1QH 4DNIA 1YJWA 4NB3A 3G4SA 3PIPA 3FKIG 2GVBA 2MFIA 3J81j 1E1TA 2UXCQ 3CC2A 2VZAA 2NVTH 1L1OA 1XNQQ 3RR5A 4PG3A 5FJ8H 1XPUA 2MO0A 4HJAA 4A3BH 2JE6I 2VQEL 1YJNA 2UU9Q 4QGUA 4B3SQ 4LF8Q 4BBRH 1SR3A 3PCOB 4A3IG 3KFUA 5HY6A 4JI4L 2A1AA 5M3FH 1WCMG 2R92G 3KJOA 1X6OA 1KXLA 1RL2A 4TQUS 5ELOA 3J80c 3W1GA 3AFPA 4LF7L 3HOZG 3TS2A 5C0XI 2EIFA 4LFBL 4UY8C 2JA5H 4DR1L 2N49A 1EOVA 2AMCB 1TWFH 3GTLH 3T1YQ 4IOAA 2K14A 2JJQA 3CF5A 4GKKQ 2R93H 2F52A 1GM5A 1SMXA 2JEBI 3TREA 4GLXA 1Q86C 3CXCA 4X64L 2CWPA 3BJUA 4DR5Q 4ALPA 1E24A 2CQOA 3E0EA 2N8NA 5IYBG 4B3MQ 2JA9A 2PQAB 5FJ8G 1HNZL 1R9TH 3S16H 1G6PA 1GVPA 3I56A 1SFOH 3K7AH 4IPDA 2XTIA 3EN2A 4YCVA 5M3FG 5C44G 4IO9A 1T9HA 2MO1A 4DV3L 2JQOA 4A3KG 2LSSA 2E2HH 1X9NA 1A0IA 3PGZA 4DV5L 2JA5G 1M1KC 4AYBG 1IBMQ 4BBSG 2UUCQ 1XMQQ 3ICEA 2F3IA 3A5ZB 1C9OA 3ULPA 4L5SA 1FGUA 1YVCA 4C3JH 1JMCA 4PMWA 4BY7G 1WI5A 1EQRA 3MXNB 2JA7G 4DR7L 3EBEA 1UEBA 3HOWH 3OYYA 2N3SA 3RN2A 1N32L 1KC8C 4A3LH 1HH2P 3G6EA 4LFCL 2KHJA 1VQLA 3KOJA 1Q46A 2RHSB 3D31A 4GOPC 3I55A 4A3MH 2Q2UA 2NN6I 1OXXK 2KCMA 2NZOA 1FVIA 4HJ8A 1L2FA 4DV0Q 2D0PA 1KHIA 2YU9H 1CUKA 1QUQA 2WB1E 4JBMA 4IPCA 3I7FA 4Y7NH 3PSIA 3UDFA 4DR4L 2WB1G 1JT8A 1O7IA 5IWAL 1HNWL 4LF6Q 4QQBX 4A3EH 3ER0A 1A8VA 3M9BA 3DLLA 3OTOQ 3HOWG 2K5NA 3A0JA 1PH3A 4K0KL 3CAMA 1DGSA 2OQKA 1N8RC 3J81c 3F1ZA 1IYJB 2Z0SA 3STBD 2Q2HA 2B3GA 3F2DA 3GTKH 4A3LG 2ASBA 5IP9H 1J5EQ 1KIXA 2UXCL 4A3MG 1YBYA 1JJ2A 3CCQA 1XNQL 1VQ8A 3RZOH 2MNAA 2IY5B 2ZTDA 1HZ9A 3HOYH 1PHJA 1Q1BA 4DR5L 5C0XJ 2UU9L 4B3SL 4LF8L 2OTLA 3S2HH 2C35B 1PH1A 4A3JH 4DV1Q 3PF5A 5BR8Q 2ZJQA 3Q8DA 1BKBA 4JOIA 1QVGA 1CKMA 5LMUQ 3J80i 4DV6Q 3KF6B 4IFDI 2JA8H 4DV7Q 4MZ9A 4JI2Q 2B29A 3RLFA 2K4KA 3CC4A 1AE2A 1P16A 1GKHA 2HQLA 1MJCA 3M4PA 4H02A 3G71A 4BXXH 4GKKL 2K5VA 4JV5Q 2KHIA 2BA1A 5E7NA 3TRZA 5LMNQ 1QZGA 3PUWA 4JBWA 4O0AA 4YY3Q 3JAMc 5C0XG 4B3ML 1ASZA 2WAQG 1JB7A 4YWLA 4GOPA 2PMZE 3K8AA 4DK3C 1VQ4A 4A4IA 4BA1I 1Q7YC 4JI1Q 2UUBQ 4YCWA 1BBWA 3S17H 4Y52H 4A3DH 2Q2IA 1PH9A 1WJJA 3UDXA 2JA8G 4DR4Q 4DR6Q 2F4VQ 1Y1VH 3KDFB 1YZ6A 1IBML 2UUCL 2VUMG 3S1NH 3HKSA 2OQ0A 2RCNA 3S15H 4R4CA 1AE3A 4BXXG 1VQEA 1N34Q 4LF9Q 2PI2E 1SN8A 1N36Q 1M90C 2PNHA 4QY7A 4R4IA 1YHBA 5JJIA 3I2ZA 3HOXH 1B8AA 3GD7A 3PUXA 1PH6A 1FJGQ 1TWCH 4X62L 4X66Q 4OO1I 2I5MX 3EIVA 4J15A 1MKHA 4A93H 5C4JH 3CPWA 1PVOA 3K7UC 4GS3A 2BH2A 5GADC 1RIPA 5M5YH 1G291 1MJEA 1ASYA 1C0AA 2D0OA 3GO5A 2JA6H 1U5KA 4A3DG 4DV0L 1NY4A 4IJHA 1HZBA 2HHHQ 1K8AC 1XMOQ 3BZCA 4JI3Q 1CSQA 1VQPA 1H95A 4LF6L 4HIOA 3PIOA 3PO3H 2NN6G 3PUVA 1Q82C 2ZJRA 1FL0A 2IX0A 3OTOL 3HOXG 1I50H 4AH6A 1PH4A 4NXMQ 2Y0SG 2CCZA 4UP7A 3J81i 2UXBQ 3M3YH 1PFSA 4HIKA 4JCVE 4GLAC 1PH7A 2FXQA 4A3BG 1J5EL 1XNRQ 1OXTA 3KLWA 2YYZA 1YHQA 2DGYA 4BBRG 1P8LA 1VQIA 2IHFA 4GLVB 3TEHB 3GTJH 5IYCH 2JA6G 4IFDJ 1S40A 4LF4Q 4DR3Q 4IPGA 4DV1L 5BR8L 4AYBE 3GTQH 5LMUL 4DUYQ 3U4VA 4DV6L 5M3MH 3RN5A 3CCEA 4DV7L 4LF5Q 1GO3E 1X65A 3PO3G 1WOCA 4JI2L 2OTJA 1YIJA 2UUAQ 4OONA 5M5WH 1TWHH 4GN3B 4MTNA 3RZDH 4R4TA 4JV5L 5FLXc 4C2MH 3A5UA 1JJCB 3CCVA 3PO2H 1B70B 4X62Q 4R4QA 5LMNL 1V43A 1TXYA 1YHAA 4YCUA 3CP0A 3SGIA 4IFDG 3JAMi 1CKNB 1BBUA 4YY3L 1X3FA 3UDIA 2AHOB 3AQQA 1LUZA 4LWCA 4WJ4A 3GDEA 2N78A 2YV5A 3E9IA 2ZTEA 4JI1L 3CW2C 4DUZQ 2UUBL 4GKJQ 4OWXB 1OXVA 5M3MG 1NE3A 1W2BA 4DR6L 5AJ3Q 2F4VL 1TWGH 1CSPA 2PQAA 2ZM6Q 5GAEC 1KL9A 1IXRA 1EQQA 1PH5A 1X54A 2IX1A 4PZ7A 1QVCA 4KI0A 5H1SE 2GVAA 1VQJA 2WFWA 3AYHB 2ZJPA 3KF8B 4P71A 1N34L 4LF9L 1VQAA 1N36L 4DR2Q 4RMFA 1IBLQ 4QL5A 3J7ZC 2QGQA 3RLNA 1HZCA 4JI6Q 2VS1A 3F2CA 1FJGL 1VQCA 1X3EA 2JEAI 1N9WA 1LYLA 4X66L 4JG2A 3IRBA 3W5OA 1XJVA 2B63H 4YWKA 2I0QA 1VQDA 2EXDA 5IY0A 1JE5A 3K80C 1UE1A 4LUOA 4JBJA 4P75A 3PF4A 5C4XH 3NELA 3U4ZA 1HNXQ 4XIGS 4OX9Q 1HZAA 2LXKA 3M85A 4JYAQ 1KAWA 1UE5A 2HHHL 2HIVA 4P73A 1C7YA 3AEVA 4UP9A 4MNOA 2XGTA 1XMOL 4OO1G 4A3EG 4JI3L 3W1BA 3BZKA 1E22A 1WYDA 4R1JA 5GAHC 1UE6A 3G48A 4LW1A 4DKAC 4DV4Q 4GNXB 3S1RH 2VQFQ 1Y1WH 1KD1C 4IJLA 4APVA 3UDGA 4NXML 4LUZA 1Q8KA 5IP9G 2UXBL 3L0OA 2CWAA 2B63G 3S1MH 3S14H 1NMFA 2WAQE 3FP9A 1TWAH 4IPHA 1K9MC 4HIDA 1EIYB 1XNRL 3HOYG 3MEFA 4P74A 1VQ5A 1I94Q 3D0FA 4JI5L 4A3JG 3H0GH 3L7ZC 3L2PA 1VQNA 1L1OB 4LF4L 2K52A 3ZJYC 3CMAA 4DR3L 2UXDQ 2KCTA 3I4NH 4UP8A 4A3FH 2QEXA 4YHHQ 1EFWA 4DUYL 1X3GA 4NXNQ 4OWWB 2AWOA 1U0LA 2ALYB 3F2BA 4LF5L 1YI2A 1Z9FA 3NENA 4L5QA 1EIFA 2CKZB 2K5HA 4NPSA 1K73C 3CCRA 1D8LA 1HR0Q 2R93G 2UUAL 3HOVH 1VS0A 3FKIH 2VW9A 4JI7Q 1EWIA 1NJIC 1W3SA 3ULLA 4A3GH 4X6AH 2CFMA 4DPGA 4P72A 1VCIA 3KF6A 4GN5A 1E1OA 3M4QA 1QZHA 4WJ3M 1QVFA 1UWVA 1K3RA 2YTYA 4QIWE 2YTXA 2WP8J 3WWVA 4HJ7A 4AQYL 1VQOA 2ZTCA 3UE0A 2RF4A 3H3VH 4GKJL 1OXUA 4IOCA 4B3TQ 4DUZL 3I4NG 4A3CH 2E5LQ 1Y1VG 2DUDA 1IBKQ 4DK6C 1KRSA 1LTLA 1Y14B 4KLKA 2A8VA 1CKOA 3STBC 4PZ6A 5AJ3L 2E2IH 1SROA 1EUJA 2ZM6L 3M7NA 4XTCS 4L5RC 1VQ9A 2I5LX 1Q1EA 1JJGA 3K0XA 1BVSA 1PA6A 3HOVG 1VQMA 2Y0SE 4A3GG 1S3OA 4QJFA 4A76A 4X65Q 3ULJA 3T1HQ 4DR2L 5IYBH 3DM3A 4A75A 1IBLL 3GTPH 5JJKA 1K0RA 1NBWA 4JI6L 1KRTA 1K83H 2A19A 3KDFA 3LGJA 3CC7A 1VQFA 4A93G 3CD6A 3GTOH 2E8GA 2BA0A 2VNUD 5C44H 4A3KH 4B3RQ 4JI5Q 1IZ6A 3I4OA 1S72A 3CCLA 3HOUH 1E3PA 3I4MH 5FLMH 1HNXL 2KBNA 1PYBA 4A3CG 4OX9L 4R4OA 3OW2A 4OWTB 4JYAL 4JI8Q 4HJ9A 3NEMA 1B7YB 4BY7H 1X55A 3B6YA 1QUQB 2AWNA 2VY3A 3NBHB 3PUYA 2JA7H 1E7ZA 1SRUA 3KYHC 4DV4L 4OXPA 3CPFA 4JBKA 1N33Q 2VQFL 4JC0A 2R7DA 4DV2Q 1GD7A 1I5FA 4L5TA 2OCEA 1WFQA 3M4OH 4JOIC 1XPRA 4ME3A 5IYCG 2VL6A 3HOUG 3I4MG 3K81C 1LM0A 1I94L 4AQYQ 4UPAA 5FLMG 4KHPQ 5IYDH 2LXJA 2HIXA 5IT9c 4AIMA 2RHQB 2NVQH 1I6HH 5GQOA 2D62A 3CQZH 3S24A 4EQ5A 2QA4A 2UXDL 4LFAQ 1L0WA 4JI0Q 3GTMH 3FHWA 4NXNL 4YHHL 2MQHA 4KHZA 4RG1A 3BU2A 5IP7H 3S2DH 3H3VI 2IHEA 3F8TA 4HJ5A 3U50C 1PH8A 3ERSX 2ID0A 4O2DA 1HR0L 4LNQA 4JI7L 3VDYA 2OWOA 2R7ZH 2AKWB 3PO2G 2VQEQ 1Z47A 4C3IH 3KJPA 1J6QA 1Q12A 2Z6KC 3UE1A 4JI4Q 1VQBA 1HJPA 5GAGC 3GTGH 4BY1H 5IYDG 1K8GA 5DLQE 4GNXC 4LF7Q 3H15A 4LFBQ 4DR1Q 2H5XA 2HT1A 1PH2A 3CCSA 2I5HA 4B3TL 5HGQA 2E2JH 2E5LL 4GOPB 2ATWA 5JEAJ 1IBKL 4BA2I 3AFQA 2NVYH 2KENA 3TQYA 2Q2TA 5IP7G 3CMEA 2NVXH 5IE8A 1CKNA 4X64Q 1I3QH 1V9PA 1L1OC 2R7ZG 2V1CC 5C3EH 1YITA 1HNZQ 2IT1A 2K75A 4YWMA 4X65L 3CCJA 3T1HL 1VQ7A 4FDBA 1EYGA 3CCUA 1YNXA 4DV3Q 4EX5A 4TVAB 4BY1G 4POGA 3PV0A 1YJ9A 5C4XG 5M5XH 5EAYA 4DV5Q 4B3RL 3RNUA 5JEAG 1XPOA 1MIUA 1XTDA 1VQHA 5LMNW 2R6GA 4C3HH 2YTVA 2NZHA 2VUMH 4JI8L 4POFA 4GN4B 3T1YL 2EQSA 1D7QA 1A62A 1KQSA 4DR7Q 1X56A 2K50A 1YEZA 3TS0A 2PI2A 3E9HA 1N32Q 1Y1WG 4LUVA 4LFCQ 1NTGA 5C3EG 1G51A 3HFZB
chains in the Genus database with same CATH superfamily
3KLRA 3VYUA 2HCCA 4ZKBB 4CJ2C 3CHBD 3GTPB 4PZ8A 4DAYB 2EE1A 1PDQA 1UE7A 4G4KA 3U58A 5IWAQ 3D6WA 2Z8LA 4A3FG 4ZRZA 4LFAL 3HKZE 1PYSB 2L5TA 1JWSD 3HKZG 2GN5A 1VQGA 1ZXTA 4KJNA 2K5QA 2MFIA 5A35A 1E1TA 2KCNA 1B3QA 3CC2A 1Z6HA 2NVTH 1SYCA 4PG3A 3KBGA 3RR5A 1BO0A 2MO0A 4X3TA 3WDNA 1XPUA 5DM63 2UU9Q 4B3SQ 2EYFA 3PCOB 4JI4L 4OELB 3S9WA 4FF4A 3KJOA 2R92G 1DOKA 1RL2A 4OGQC 4LF7L 3W1GA 3AFPA 4H7BA 3M4OB 4RWSC 1TWFH 3GTLH 1SNQA 4PMCA 2JJQA 5D14A 2BOSA 2ICEC 3TREA 1WTPA 2G9DA 4DR5Q 1RKNA 3HS0C 1RHPA 4K2LA 5IYBG 1TS4A 5FJ8G 1HNZL 3NBIA 5IGEA 3S16H 1GVPA 3I56A 2XTIA 1DYQA 5C44G 4A3KG 4DV3L 1HRJA 1SBBB 1PTOC 5IT9L 3IKJA 1IBMQ 2F3IA 2RVLA 5I2XA 1C9OA 5C4XB 1PYWD 1YVCA 2EPBA 1JMCA 1B3AA 1EQRA 3MXNB 1H9JA 4DR7L 3CU7A 3MFGA 1ENAA 3GP7A 3OYYA 2BDOA 2CHBD 2N3SA 4LK1C 1N32L 4A3LH 1QNKA 2KHJA 3C46A 1Q46A 3BG3A 3D31A 4A3MH 1GHKA 1Y1WB 3PQIA 2KCMA 3N52A 2A5HA 5KNDA 3NBHA 2XSCA 4Y7NH 4FF2A 1TIID 1GXDC 3A7AB 3T4AC 5M5XB 1BR9A 2TSSA 1HNWL 4LF6Q 3QOLA 2J7ZA 1ZEQX 3H91A 1H9SB 3HOWG 4C3HB 3KBXA 2OQKA 1FNUA 3F1ZA 2Z0SA 3STBD 3F2DA 3UI2A 2IX3A 2ASBA 1J5EQ 1PZID 1QB5D 1VQ8A 1KNEA 4RGOS 2DJFC 1Q1BA 2C35B 4A3JH 2ZJQA 2PCFB 1LTTD 5KGUA 1PFMA 5D3DA 2F0HA 4U68A 4MZ9A 5EPJA 1WCMB 3HOZB 3CC4A 4GKKL 2HQLA 3NXWA 3K58A 2KHIA 1ONLA 3TRZA 1QZGA 5CV8A 1FR3A 5DEHA 4JBWA 3S1QB 3JAMc 1JB7A 1TS3A 1F9QA 4GOPA 4DK3C 4A4IA 4BA1I 1Q7YC 1SJHD 3MXGA 5IT9E 4HCEA 4Y52H 2Q2IA 3DEPA 3UDXA 2JA8G 2EJGC 4DR4Q 5EBDA 2LY7A 3KDFB 4K8IA 1LO5D 1YZ6A 2K03A 2Q8IB 3BS1A 2OQ0A 4HSPA 1AE3A 1GUOA 1M90C 4QY7A 1YHBA 3I2ZA 4DXFA 1B8AA 3GD7A 4BY7B 4X62L 4OO1I 2I5MX 4J15A 3CPWA 3NE5B 5I9OA 4GS3A 3A7LA 5GADC 1RIPA 1MJEA 5ISRA 3J7YW 3GO5A 4A3DG 2L0CA 4CKBA 4IJHA 1HZBA 5ELFA 5FOBB 1C8CA 2SOBA 3DMUA 1EY4A 1LTRD 3PUVA 2NTSA 1FL0A 3OTOL 1PH4A 4AH6A 5J22A 5JVG3 1I4HA 2UXBQ 3GTMB 1F2MA 5LHY1 4HIKA 1KNAA 2FJ2A 4BBRG 1WTVA 1VQIA 2IHFA 1RJTA 4IUTA 2JA6G 1F2LA 2AUKA 4IPGA 2O4XA 4GZYC 1B53A 4DV1L 3T53B 1DXMA 1NSNS 3IL8A 4DV6L 1F2YA 4BY1B 1GO3E 3M7GA 4WFN3 2BDNA 4OONA 2EDGA 4R4TA 1EYCA 1HUNA 2KOLA 1O7LA 4R4QA 2NVXB 3G6JB 1CKNB 1BBUA 2RQXA 4YY3L 2K01A 1W6KA 4CJ1B 2AHOB 4WJ4A 4GKJQ 2N78A 3E9IA 4JI1L 4CJ0B 1EWCA 2Z6BA 1BCPC 1OXVA 4CDDC 1HA5A 2F4VL 2F0KA 2EYPA 1SYEA 1EQQA 2IX1A 3AYHB 1SYDA 1CHPD 3FPPA 1N34L 4LF9L 2F0IA 1N36L 1IBLQ 1CQVA 3Q24A 4JI6Q 1BCPB 1HQMC 2VS1A 3F2CA 1FJGL 1QJOA 1DCZA 1LYLA 3W5OA 4YWKA 1IW7D 2EXDA 4DAVA 1JE5A 3K80C 4LUOA 1UNSA 5C4XH 1A3UA 1HNXQ 3K6OA 4OX9Q 1HZAA 2LXKA 5CBAE 4JYAQ 3D4RA 4IUNA 2L4NA 4MNOA 1XMOL 4OO1G 2MGSA 3FDTA 3W1BA 2EJMA 1AN8A 1KDAA 1WYDA 3SK4A 2Z4IA 1D5XC 1Y1WH 4IJLA 5EKLA 3P7JA 1K0SA 4EQNA 1Q8KA 3L0OA 2B63G 4IPHA 1KDCA 3HOXB 2CH4W 3EJIA 5AFWA 3TBIB 4IURA 1ML0D 4ME5A 4A3BB 3L7ZC 1BQQT 3ZJYC 4RAUC 4DR3L 2KA7A 2KCTA 3J7AF 1VMPA 1MSHA 1BBXC 1X3GA 4UHVA 4ZUIA 2AWOA 1A6XA 2RBMA 4NPSA 1HUMA 3NTHA 4JI7Q 4EQPA 1W3SA 3G7LA 3PO3B 1I4PA 3KF6A 1CI3M 5HURA 1U4RA 1D5MC 4V0BA 4K6LA 1NR2A 1D6EC 3VA5A 4AQYL 1R9TB 3X3MA 3K7AB 4B3TQ 4DUZL 1IBKQ 1B50A 4DK6C 2A8VA 4KLKA 1CKOA 2WIIB 5AJ3L 1SE4A 1U9RA 1JJGA 5M3MB 3HOVG 3MEHA 2L9HA 3T1HQ 1O78A 4DR2L 3DM3A 1RF2D 2K7VA 1EOTA 1NBWA 2RSNA 4RCNA 4DNRB 2A19A 4A93G 1VQFA 1VDZA 3HRZC 2BA0A 4JI5Q 3I4MH 5CORA 1S72A 3CCLA 4QB4A 2KBNA 2F0NA 5E4XA 5DNFA 3P1HA 2HQEA 3NEMA 2YU9B 1B7YB 4BY7H 3OPOA 1LTID 2VY3A 3D8GA 4O42A 3KYHC 4DV4L 2XWBB 3CPFA 4NDXA 5FO7B 2R7DA 4DV2Q 1GD7A 1EY9A 2OCEA 4HSVA 5IGCA 4JOIC 3TP6A 4ME3A 2VL6A 3K57A 3KK7A 1STHA 2A68C 3RZOB 4AIMA 2RHQB 2NTTA 3HOYB 3S2HB 3S24A 3D6CA 2QA4A 3W2DA 2UXDL 3GTMH 2PZWA 2SDFA 1D2BA 5C6AA 2HDLA 5IP7H 1HHVA 3SK6A 3H3VI 4HJ5A 4LNQA 1SJED 1IKMA 3PO2G 1STGA 2VQEQ 3KJPA 3S1RB 1Q12A 1F77A 2WKCA 5GAGC 4K5XA 3WOFA 4BY1H 1K8GA 4KKUA 1TWAB 3U9OA 2M2LA 1GUNA 2XN9C 1PH2A 2C5CA 3CCSA 2E5LL 3V05A 5D3IB 3AFQA 2Q2TA 2KENA 3TQYA 3CMEA 2NVXH 2F0TA 1Y1VB 1WTWA 3H6MA 1L1OC 4IALA 1PFNA 5E3FA 5TSSA 3S1NB 1I4GA 1QILA 5C3EH 3PIO3 4C3IG 3CCJA 3FRPB 4FDBA 1YNXA 4A3GB 1E0BA 3PV0A 4R8NA 4UDUC 4B3RL 3KUPA 2KVMA 1B2TA 1X32A 1MIUA 1PZJD 2EY1A 5K5PA 3I90A 5M5YB 1ET6A 2NZHA 4JI8L 5K36H 1KQSA 2P5ZX 3I8ZA 2PZTA 3E9HA 4K6DA 5C3XA 3MEFA 1NTGA 5M9OA 4DR5L 1QE6A 1IL2A 5CGKA 1SLJA 4N9TA 4BBSH 1I50B 5DAUA 2EY6A 1OXSC 4N9PA 3URYA 4A3IH 4BWGB 3H0GG 1HR0W 4RKLA 4BS9A 4GNXA 3A74A 2BH8A 3HOUB 4JI0L 3SR1A 4NB3A 1IL8A 1EY5A 3FKIG 2EYMA 2UXCQ 1FNVA 2F0OA 4A3BH 1YJNA 4QGUA 2J0TD 4XT3B 4C2MB 1EQVA 3KFUA 5M3FH 3BYYB 2F0VA 1KXLA 1X6OA 4KHVA 4LFBL 2A73B 1HTLD 1DM0B 2E2DC 2JA5H 4IOAA 3FEWX 2F52A 4TSSA 4KJOA 3CXCA 4X64L 3BJUA 1EYDA 1TWGB 4ZK9B 4FXGC 1E2VA 2CQOA 3E0EA 2N8NA 2E74C 3EFXD 3GV3A 4B3MQ 3S2DB 1FD7D 5LL6S 2B2YA 5CC4A 1R9TH 3K7AH 4IPDA 2R7ZB 4IO9A 1T9HA 1HXYD 2E76C 1Q90A 1X9NA 1A0IA 4DV5L 3D3RA 1M1KC 4AYBG 3A5ZB 1MHWC 4C3JH 5CV9A 5T1GA 3EBEA 1UEBA 1R4PB 3G6EA 1VQLA 3KOJA 2OEOA 3ND8A 4E6IA 1I3QB 3I55A 2EYLA 1OXXK 4DV0Q 2YU9H 1QUQA 2WB1E 3PSIA 1S5BD 4DR4L 2WB1G 4KKTA 3OWEB 5KNCA 4QQBX 1YNJD 3EROA 1U4PA 4NKLA 2HCIA 3V96A 5FKAC 1I4RA 2VXWA 4K0KL 1DGSA 3J81c 4A3FB 1IYJB 4A3LG 4RHSA 5ELBA 4OIJA 5IGBA 5IP9H 1YNND 4A3MG 3HKZB 1JJ2A 1XNQL 3RZOH 2BE5D 1HZ9A 2DNCA 3HOYH 3S2HH 4LF8L 1ENFA 3PF5A 2PPBC 1BKBA 5LMUQ 3J80i 1SYFA 3OMGA 4HMIA 4OL7A 4XYOA 2R92B 3RUZA 1P16A 2IW3A 5I6YA 1H9MA 3G71A 4JV5Q 2BA1A 5E7NA 2B8FA 1E2ZA 3HEJA 1ASZA 2WAQG 1ZYRD 4YWLA 1WTXA 3D4DA 1VQ4A 2FMCA 2IWHA 2D9UA 2UUBQ 4V190 1BBWA 5D65A 2GA4B 5ELEA 1PH9A 5IGFA 4KD4A 3GTOB 1Y1VH 4CHTB 5C44B 1L0YB 4A3KB 2UUCL 2VUMG 3S1NH 1SNMA 1EFID 2NN6H 4CKEA 4R4IA 4J1MA 4KD3A 3PUXA 3SVMA 1F2ZA 4X66Q 3EIVA 4RA8A 3MWYW 2F4IA 2NWGA 2BH2A 3E5SA 5M5YH 1U4MA 1G291 2DY8A 2PZUA 4FO2A 4QUCA 3MC0B 1HFGA 1V1PB 4NW2A 5IOCA 2HHHQ 1CSQA 3TN2A 5JPMC 2LMCB 4HIOA 3PIOA 1Q82C 2ZJRA 4NXMQ 1I50H 4I65A 2Y0SG 1L0XB 3NTKA 1PFSA 2KECA 3HOWB 3MHBA 1OXTA 1LT3D 1YHQA 2YYZA 1CZGA 1I4QA 3TEHB 5IYCH 2XVSA 1EEFD 4M1UB 5BR8L 4IUVA 3TSSA 3GTGB 4R8IA 3U4VA 3RN5A 2A74C 4DV7L 1PRTD 1EY7A 4JI2L 2OTJA 2UUAQ 2B2TC 5KRUA 3K59A 4GN3B 4MTNA 5FK9C 5FLXc 4C2MH 4ZCKA 5E1FA 5LMNL 1V43A 1TXYA 3Q0AA 3CP0A 1ENCA 3SGIA 5F2DA 3GTKB 2JXMB 3UDIA 1STEA 2SNSA 4WJWA 1JE4A 3P75A 1EZ6A 3CW2C 4OWXB 1KABA 4DR6L 1TWGH 2PQAA 2ZM6Q 1KL9A 1IXRA 5H1SE 2WFWA 4P71A 4RMFA 3A8IE 4QL5A 1VQCA 3IRBA 2I0QA 2TMPA 4P75A 4JBJA 1BDOA 1EZ8A 2A69D 2L11A 1KAWA 3CKIB 3IFTA 3AEVA 4UP9A 3S17B 2XGTA 4A3EG 4JI3L 1B9MA 1O7YA 1E22A 4R1JA 4LAAA 1KLUD 5GAHC 3VA7A 2VQFQ 1KD1C 4APVA 1XYIA 3JAML 3S1MH 3MXUA 3S14H 1K8OA 4HIDA 2QDLA 2ZXPA 1XNRL 4P74A 4J6HA 1VQ5A 3A54A 4JI5L 1XXGA 3MFYA 5J39A 2K52A 4LF4L 4I7ZC 4BBRB 2JA6B 4UP8A 4A3FH 4YHHQ 4DUYL 5I6WA 5CV6A 2ALYB 4XXEA 4LF5L 1YI2A 4L5QA 2R93G 2CKZB 2K5HA 1HR0Q 2VW9A 1PRTB 3ULLA 4X6AH 2B2WC 4DPGA 4P72A 2QF7A 1VCIA 1E1OA 2PW7A 4WJ3M 2EYJA 3VYSA 1TT2A 1UWVA 1K3RA 2F0LA 2JP1A 4QIWE 2YTXA 1Z7TA 2WP8J 3WWVA 2ZTCA 4KTAA 2RF4A 1G2SA 3UE0A 1SFOB 4IOCA 4A3CH 3R93A 5JAVA 1IKLA 3STBC 3BDOA 2E2IH 3SK5A 1EUJA 1KDBA 1BVSA 3OHXC 1S3OA 4QJFA 4A76A 4X65Q 4ID6A 5IYBH 3GTPH 1TWHB 3BYTB 3LGJA 4IUPA 3GTOH 1R4QB 5C44H 4A3KH 1IZ6A 1E3PA 3SHLA 4R4OA 3T51B 4HJ9A 1Q3LA 3TDQA 2AWNA 3NBHB 3PUYA 1SRUA 4JC0A 3JAME 1QCBD 1I5FA 1LT4D 2J4XA 1A2UA 3E3XA 3M4OH 4KMUC 1XPRA 4L63B 3I4MG 1I94L 2B63B 4UPAA 3R2IA 2LXJA 2HIXA 2L12A 1S5ED 1F9RA 5GQOA 3HP3A 4LFAQ 1Y8NB 3NQTA 4RGTA 4NXNL 2MQHA 3VR3A 4RKBA 4RG1A 3BU2A 2K1BA 1AP0A 1G2TA 2IHEA 3U50C 4CGYB 2ID0A 4O2DA 2XWJB 1DJRD 2OF1A 2OWOA 3MAQA 4WORA 3IAYA 2Z6KC 3UE1A 1ICWA 1TQOA 4JI4Q 2F0SA 1HJPA 2OT2A 1EIHA 3GTGH 1GUTA 3RD4A 5BN4A 5DLQE 5CMDA 4LF7Q 1ET9A 3VR6A 3K5MA 2HT1A 4FP5D 1QOHA 2I5HA 1A3VA 4GOPB 2ATWA 4BA2I 1OO9B 5IP7G 3FPUB 2D2CC 4KKSA 5IE8A 2Z1CA 1CTMA 1AZPA 3I3CA 3ND9A 4PV1C 1YITA 1HNZQ 3S15B 3NPPA 3QR8A 4YWMA 2H1EA 3HOVB 4FNFA 4DV3Q 4ABNA 1QWYA 3FMCA 4BY1G 4F88A 1SNDA 1YJ9A 1S5DD 5M5XH 2CQAA 3RNUA 4A93B 5C4JB 3R8BA 3KF8A 2R6GA 4C3HH 2F0MA 5JJZA 4GN4B 2EZVA 2CH4A 1D7QA 3AMUA 4DR7Q 1PRTF 2PI2A 1N32Q 4B9XA 5C3EG 3I4LA 3RN2A 2EVBA 1N33L 4DA2A 2LS01 5ELNA 5J3BA 3JC66 1NMGA 1DONA 2R7FA 2ENBA 1WTHA 1PLFA 5EKKA 2JK8A 3RLOA 2F0UA 3CCMA 1OTCA 1VQKA 1TR5A 1WCMH 1K83B 4KHPL 3HOZH 1HNWQ 3GTJB 2K6AA 3BVMA 5K36G 1SE8A 1Y69U 3TP5A 5EKIA 2L15A 3S1QH 1YJWA 2GVBA 1IW7C 3J81j 3OW7A 2VZAA 1JCKB 1L1OA 1XX8A 4KN4C 4BBSG 4HJAA 1JOKA 2JE6I 4NP5A 1V8QA 2M00A 4BBRH 1SR3A 1Q8IA 4A3IG 2IPKD 3QB3A 5HY6A 3PO2B 1ZKOA 3V2TA 2ICIA 4R9WA 5ELOA 1ILPA 2LFNA 5EPKA 5C0XI 4PMBA 4DR1L 4G57A 5C5LA 1STYA 3VYRA 4L8JA 3CF5A 4GKKQ 5ELDA 4K2KA 2NVQB 2DNEA 3QOJA 1SMXA 4JK1C 4N8X1 1GM5A 4GLXA 1Q86C 1J8IA 1II3A 1JORA 1E24A 4TKOB 2F0GA 2QILA 1D5ZC 2JA9A 3NWTA 1HQRD 1SFOH 3D4WA 3I72A 4YCVA 1X3PA 3EN2A 3NSWA 5M3FG 2MO1A 2JQOA 4C3IB 2LSSA 4RFBA 2JA5G 1XMQQ 3ICEA 1JQYD 2FHTA 1TVXA 4PMWA 1QG7A 4DNTB 1WI5A 1SMYD 2JA7G 2E2JB 1LTSD 5EPLA 1RTNA 4H0LC 5EGTA 1B9NA 3A56A 5DM73 4LFCL 2Q2UA 2NN6I 1GJXA 4RGMA 2NZOA 1FVIA 4HJ8A 1L2FA 1WTQA 5LL6X 2EJFC 5HGTA 4JBMA 4IPCA 3I7FA 3UDFA 1JT8A 4DFAA 1LACA 1O7IA 1A15A 5IWAL 4C3JG 3H0GB 4JVZA 4OO1H 3ER0A 1A8VA 3SEBA 3L3OC 5CBEE 3OTOQ 3A0JA 3DEOA 3I4NB 1N8RC 1S5CD 1LLRD 4EVOA 5FO8B 1KIXA 1I6VC 1EY8A 2ZXRA 1YBYA 2A6HD 3CCQA 2IY5B 4EGVA 2MNAA 2ZTDA 3WOEA 5KYLA 3FKIB 1EYAA 1PHJA 2UU9L 5C0XJ 4B3SL 1SXTA 1CZWA 1PH1A 4DV1Q 3NUCA 3QO2A 3Q8DA 1QVGA 2BCOA 3KF6B 4DV6Q 1WTRA 2B2VC 2NZ1D 4KY5A 4ZYSA 2B29A 1DZ1A 1AE2A 1MJCA 4BXXH 4HTHA 1O80A 5FO9B 3DWPA 4YY3Q 5C0XG 3LWUA 3BZDB 2PMZE 5IGDA 2A6ED 4MHEA 4JI1Q 1ILQA 4YCWA 1SEBD 1WJJA 3OWFA 2DN8A 2F4VQ 1IBML 1WD0A 1KTKA 2K04A 2RCNA 3S15H 4R4CA 4JPBW 1VQEA 1N34Q 4AYBB 4LF9Q 2PI2E 1SN8A 1N36Q 2IL8A 2HDMA 3HOXH 2PYKA 1FJGQ 4XT1B 2D5DA 4L6TB 4A93H 5C4JH 4JW0A 1PVOA 3K7UC 4KV6A 3VR5A 1ASYA 3C1FA 1C0AA 3J7AV 2D0OA 1U5KA 3S16B 3PMFA 1U4LA 1NY4A 4MTKA 1BNZA 4K14A 1K8AC 1XMOQ 3BZCA 1VQPA 4FXKC 4DK1A 2F03A 3LWEA 4LF6L 1CFMA 3T56B 2CW0D 3PO3H 2NN6G 2WB1B 4H44C 1I6HB 1H95A 2IX0A 3CQZB 3HG9A 4UP7A 4F8MA 4DAYA 1MGSA 1PH7A 4JCVE 2RDGA 2KCCA 3HGBA 2FXQA 1J5EL 1NNXA 3KLWA 4IFDH 4GLVB 2KHSA 3F2UA 3GTJH 4A3MB 4DR3Q 4IQZA 5ELCA 4AYBE 2NUCA 4WRDA 5M3MH 3CCEA 1X65A 4IUQA 1WOCA 1YIJA 3A5UA 3MA2B 3CCVA 2MHVA 3PO2H 2QDBA 3NTIA 1YHAA 3H94A 1G6ZA 4YCUA 3SE0A 3JAMi 2FMMA 4G7HC 4LWCA 4XQJA 4DUZQ 2R3ZA 2WAQB 3E6ZX 1NE3A 5AJ3Q 2X6GA 4KN7C 1PH5A 1X54A 3RMHA 1QVCA 1RCVD 4KI0A 2GVAA 1VQJA 2NB0A 2NBFA 3J81L 1VQAA 2VUMB 4DR2Q 1ESRA 2QGQA 1WTOA 4Q0FA 1T5EA 1X3EA 2JEAI 1UEAB 1N9WA 4ZAIA 1AZQA 4JG2A 2FINB 3PIP3 1BXTA 1SNPA 1VQDA 2JSOA 1CA6A 1H9RA 5IY0A 1UE1A 1LTGD 1SSOA 1EIGA 3NELA 3U4ZA 4XIGS 3MXNA 2HD3A 1EQTA 1PXUA 1UE5A 4M8AA 3BZKA 1BOSA 2Q8RE 1UE6A 4LW1A 4DKAC 4DV4Q 1ICFB 4GNXB 5EBCA 3S1RH 3C3LA 3UDGA 2B2TA 1SDFA 4LUZA 2UXBL 2EYHA 4U673 4F87A 2WAQE 1K9MC 1TWAH 2B8GA 1EIYB 3EA6A 2Y0SB 3D0FA 4KK7A 4A3JG 3H0GH 1EU4A 1H9SA 3NK9A 3L2PA 1VQNA 4DGZA 5C4ZA 2UXDQ 3I4NH 1EU3A 2QEXA 1EFWA 4DU9A 1PTOD 4OWWB 5KIXA 3ITPA 1U0LA 1Z9FA 3O13A 4IUUA 1EIFA 2RCFA 1HFNA 2JN4A 1D8LA 2B2UC 1VS0A 2B2YC 3P20A 1M8AA 2WKDA 3FKIH 3KLSX 1G91A 3TP7A 4A3GH 2CFMA 4Q5VA 2F0PA 4K8JA 2WV6D 2K33A 1QVFA 2YTYA 2EYOA 2FFKB 3ZYYX 1YNJC 1VQOA 3H3VH 4GKJL 1JWUD 2E5LQ 1LTLA 1Y14B 2WINB 2SEBD 4PZ6A 2E2HB 2Q8TA 3M7NA 2CVRA 1YNNC 3L9AX 4XTCS 1VQ9A 1Q1EA 3DHQA 3K0XA 3J81E 1MSGA 1PA6A 2BE5C 1VQMA 2Y0SE 5C5MA 1AW7A 4RH6A 1RODA 1WVLA 1UAPA 3ULJA 5KEEA 1IBLL 5JJKA 4JI6L 3KDFA 3CC7A 5I2YA 4G7OC 4B3RQ 4CDEC 3HOUH 1VF5C 3TMEA 5COYA 5FLMH 1HNXL 4A3CG 1PYBA 4OX9L 4OWTB 3MXPA 4JYAL 1VMCA 4JI8Q 4LJZC 3AB9A 1F9PA 5JVH3 2X69A 1LT5D 1QUQB 3K5OA 4C1NI 5FLXL 1E7ZA 4OXPA 1ZYRC 4JBKA 1B4OA 4A3EB 2AQ3B 4UAIA 1CHQD 2I46A 1HTPA 2B2WA 4L5TA 1S5FD 4DXGA 2X6LA 5IYDH 5IT9c 4KY6A 4C56C 1I6HH 2NYZD 3CQZH 4EQ5A 1L0WA 3X3NA 4JI0Q 3FHWA 3SDZA 3MZ5A 3T13A 3S2DH 4ZQ3A 2JA8B 1PTOB 5G3LD 1PH8A 2F0DA 4JI7L 3VDYA 4DN4M 2R7ZH 4CDCC 1Z47A 2QEJC 4FYDA 2R93B 1J6QA 2G9HD 1VQBA 4OHJA 3KLSA 4LFBQ 3H15A 1J9OA 4G7ZC 5JEAH 4B3TL 1IBKL 4FVMA 4A3DB 4QIWB 3IFDA 3OSOA 1CKNA 2AQ2B 2AQ1B 4X64Q 3MTSA 1GUSA 1I3QH 1E2WA 2V1CC 2N88A 3BDCA 3T1HL 1EYGA 4EX5A 4S3SA 4HR7B 4TVAB 4POGA 1TWCB 4XQQA 5C4XG 5EQ0A 4DV5Q 1JWMD 1NAPA 3EVQA 1PRTC 1AFPA 1XTDA 1VQHA 2YTVA 2VUMH 4POFA 2EQSA 2K50A 3TS0A 5BN3A 2RSOA 5FLXE 1Y1WG 1SNOA 3C1EA 1STNA 2K5WA 5JJLA 1A63A 2KQ3A 1B1ZA 4DAMA 4DV2L 5C3WA 4HIMA 2DJGC 3A55A 1VQ6A 5I4DA 3DXJC 2Z6KA 3M3YB 4K5WA 5GROA 1PV4A 1AH9A 2R92H 1Q81C 4C3HG 1V1QA 1H9KA 2ES2A 1XMQL 2N55A 3I4MB 1O7ZA 1HPCA 1LABA 4K0KQ 1BCPD 3PUZA 4DAPA 3GTQB 3J7A5 1KAAA 4DNIA 1CK1A 3G4SA 3PIPA 3I91A 2RA4A 1JICA 1XNQQ 1EEID 1F9SA 2A69C 5FJ8H 4PQXA 5M5WB 4QUFA 2VQEL 3RZDB 4LF8Q 1JR0D 2DY7A 2A1AA 3J80L 1WCMG 3BVGA 4ODGA 4TQUS 3J80c 3HOZG 1TS2A 4HAEA 2EIFA 4CKCA 4UY8C 2N49A 1EOVA 2XRQD 2AMCB 4RCOA 5I9PA 3T1YQ 2K14A 2VB3X 2JEBI 3ONAB 1W6JA 2CWPA 2K05A 4ALPA 1GOZA 1X3QA 1C4QA 1K3BC 1RD9D 2PQAB 1G6PA 4H13C 4QMGA 3QG1A 1G8ZD 3SK8A 4ZUJA 2G5DA 1CM9A 4X3SA 2E2HH 1B44D 1BUVT 3PGZA 3A8KE 4PNYA 2UUCQ 3ULPA 4L5SA 1FGUA 1PTOF 4BY7G 5IODA 2XRSD 5A2QL 2O5IC 3HOWH 1K28A 2EY2A 4FXDA 1KC8C 1HH2P 2RHSB 4GOPC 2PW5A 5CV4A 5C3EB 4CBVA 2D0PA 1KHIA 4OIKA 1CUKA 2M9VA 4N8FA 3ERQA 1V1OA 4I7AA 2RKSA 3NQIA 4FF1A 4IZ8A 5J1ZA 4A3EH 3M9BA 4O1NA 3DLLA 3BDLA 2K5NA 1PH3A 2PNRC 3CAMA 4QF4A 2K5DA 3GTKH 3E0JA 2Q2HA 2B3GA 5CV5A 5KNBA 1LTBD 2UXCL 1T5XD 5CV7A 1I4XA 3CRKC 4X3UA 4XDXA 2OTLA 3J80E 5BR8Q 4BBSB 4JOIA 1CKMA 2V4DA 4LMQD 1TS5A 3K5NA 4IFDI 2JA8H 2F0WA 4DV7Q 1PTOH 2F0JA 4A3IB 1LV9A 4JI2Q 4J8QA 3RLFA 3TS2A 2K4KA 1GKHA 2R93H 4H02A 3M4PA 2C9OA 2K5VA 3Q22A 3HZXA 5LMNQ 5NUCA 1Y8PB 3PUWA 4O0AA 4B3ML 3K8AA 5IIFA 3DUZA 3S17H 4A3DH 1FYCA 2H4OA 4DR6Q 5M3FB 3OMCA 1RTOA 2KEEA 3HKSA 3NHHA 1TU2B 1EWHA 2A68D 5T1IA 5A2QE 1DOMA 2JA5B 4BXXG 2PNHA 5JJIA 1STAA 5G3LF 1PH6A 1TWCH 2JA7B 1MKHA 4ZKCB 1D1IA 4CDFC 2O5JC 1SNCA 3GV6A 2JA6H 2JYOA 4DV0L 1JOOA 2R61A 5KYIA 2MP1A 4JI3Q 1NCVA 2B2VA 2QW7A 1GHJA 2F0FA 2QKIC 3EQLC 2F0EA 4RHRA 3HOXG 4C3JB 2CCZA 4DF7A 3J81i 1GUGA 3M3YH 1DD2A 4GLAC 1GUWA 4A3BG 4MN3A 1XNRQ 2DGYA 3A8JE 1P8LA 4B9WA 4IFDJ 1S40A 3W3AA 4LF4Q 2F3VA 1PZKD 3GTQH 5LMUL 4DUYQ 4LF5Q 4ILWA 4YIJA 4K5VA 2MUYA 1A2TA 3PO3G 4Z9CB 3NWSA 4HMJA 5M5WH 1TWHH 3RZDH 4JV5L 4MIUA 1JJCB 2NVYB 1B70B 2ZT9C 4X62Q 2EOTA 4IFDG 3VR2A 1X3FA 1STBA 3AQQA 4P2CB 3R3OA 1LUZA 3GDEA 2YV5A 2ZTEA 2Z4HA 2UUBL 3VYTA 5M3MG 4XYQA 1W2BA 4C1NK 2PMZB 1CSPA 5GAEC 2E75C 4PZ7A 1BCPF 3BVZA 2ZJPA 3KF8B 3J7ZC 4KY7A 3RLNA 5C4HA 1HZCA 2XNAC 3NP8A 3R2TA 4X66L 2B63H 1RDPD 1XJVA 5CR3A 3H3VC 1IYVA 3QWNA 2VB2X 1HCZA 3PF4A 1JB3A 3M85A 3Q23A 3C2PA 2SNMA 3Q6SA 2HHHL 2HIVA 4P73A 1BF4A 1C7YA 3OIPA 4FF3A 1ESFA 5IGGA 3G48A 1PFBA 1SE3A 2QCPX 4X3KA 4NXML 1NR4A 5IP9G 2CWAA 1NMFA 1WD1A 3FP9A 1UUPA 3TZUA 1CA5A 3HOYG 5E4WC 1I94Q 2NVTB 4HEDA 4HCSA 1L1OB 3H09A 3CMAA 1SMYC 4DK0A 4RGNA 4NXNQ 3F2BA 1EY6A 2B39A 3NENA 1NUCA 1K73C 3CCRA 2UUAL 3HOVH 1TWFB 3GTLB 1EWIA 1QNUA 1NJIC 1CT1D 1IYUA 4GN5A 3VR4A 3M4QA 1QZHA 2HUGA 4ULLA 1AEXA 4HJ7A 3MVVA 3K0YA 2KJXA 1OXUA 3I4NG 1Y1VG 2DUDA 1KRSA 1S4ZA 2EY5A 2I07B 1XTCD 1SROA 2ZM6L 4L5RC 2I5LX 2A6HC 3DM1A 1XWEA 1LTAD 4A3GG 1JOQA 3AU7A 1SAPA 4A75A 1K0RA 1KRTA 1CQFA 2O2LD 1K83H 5EJWA 1FGBD 3U9SA 3CD6A 2VNUD 1TY2A 2E8GA 3I4OA 4B08A 3OW2A 3DWQA 1M4VA 2LKVA 2F1MA 4QCLA 4Y7NB 1X55A 3B6YA 2JA7H 2K28A 2MPMA 2RDHA 4EQOA 1N33Q 2VQFL 4OEMB 2IJ0A 2MJ8A 1V1PA 2B2UA 2A6EC 1MI2A 1PMRA 3TP8A 1WFQA 3TZDA 1A3TA 5IYCG 3HOUG 2Z9HA 3K81C 1IHZA 1LM0A 4AQYQ 5FLMG 4KHPQ 2WACA 3FVQA 2EXZA 2AUJD 5JOBA 1KLGD 5L37A 2D62A 2NVQH 1SYBA 2XIWA 4XQNA 3QIAA 2F0QA 4A3JB 1C48A 4YHHL 4KHZA 3DWAA 3SXHA 2OXPA 3F8TA 3ERSX 2RDFA 2L1BA 1HR0L 2KEDA 3K5LA 1MBYA 2AKWB 1DOLA 2PQEA 1JC7A 3OOCA 3GQBA 1HA6A 4C3IH 5JPNC 3I70A 3LNNA 3LX0A 3N6RA 1FNWA 1TY0A 2F3WA 3S1MB 1Y8OB 5IYDG 3S14B 4GNXC 4DR1Q 2H5XA 2CW0C 5HGQA 2E2JH 5JEAJ 2NVYH 2PO4A 3M4YA 1V9PA 3QJYA 4HN7A 4IN3A 5CYUA 1D1KA 2R7ZG 4ZLTF 2IT1A 2K75A 4X65L 2K32A 2ZXOA 5BN5A 5C0XH 1VQ7A 1MD2D 1VF7A 3T16A 3CCUA 4TRDA 2KUMA 1TKWB 1EY0A 5EAYA 1EL0A 3CRLC 1SE2A 2L55A 5JEAG 1XPOA 5LMNW 4NMZA 3OIQA 3T1YL 4F7XA 1LT6D 1A62A 3I73A 1X56A 1YEZA 4LUVA 4LFCQ 1K8MA 2E2IB 1SYGA 1G51A 3HFZB
chains in the Genus database with same CATH topology
1IL2A 1N33L 5JJLA 1A63A 5ELNA 5J3BA 3JC66 1NMGA 1SLJA 4DAMA 2R7FA 4DV2L 4BBSH 4HIMA 1VQ6A 2JK8A 3RLOA 1OXSC 3CCMA 2Z6KA 1OTCA 5GROA 4A3IH 1VQKA 4PZ8A 3H0GG 1PV4A 1HR0W 4DAYB 1WCMH 1AH9A 2R92H 1UE7A 3U58A 1Q81C 4GNXA 5IWAQ 3HOZH 4KHPL 1V1QA 3A74A 2BH8A 1HNWQ 2ES2A 1XMQL 4A3FG 5K36G 1SE8A 4LFAL 3HKZE 1PYSB 4JI0L 4K0KQ 2L15A 3PUZA 3HKZG 2GN5A 1VQGA 3J7A5 3S1QH 4DNIA 1YJWA 4NB3A 3G4SA 3PIPA 3FKIG 2GVBA 2MFIA 3J81j 1E1TA 2UXCQ 3CC2A 2VZAA 2NVTH 1L1OA 1XNQQ 3RR5A 4PG3A 5FJ8H 1XPUA 2MO0A 4HJAA 4A3BH 2JE6I 2VQEL 1YJNA 2UU9Q 4QGUA 4B3SQ 4LF8Q 4BBRH 1SR3A 3PCOB 4A3IG 3KFUA 5HY6A 4JI4L 2A1AA 5M3FH 1WCMG 2R92G 3KJOA 1X6OA 1KXLA 1RL2A 4TQUS 5ELOA 3J80c 3W1GA 3AFPA 4LF7L 3HOZG 3TS2A 5C0XI 2EIFA 4LFBL 4UY8C 2JA5H 4DR1L 2N49A 1EOVA 2AMCB 1TWFH 3GTLH 3T1YQ 4IOAA 2K14A 2JJQA 3CF5A 4GKKQ 2R93H 2F52A 1GM5A 1SMXA 2JEBI 3TREA 4GLXA 1Q86C 3CXCA 4X64L 2CWPA 3BJUA 4DR5Q 4ALPA 1E24A 2CQOA 3E0EA 2N8NA 5IYBG 4B3MQ 2JA9A 2PQAB 5FJ8G 1HNZL 1R9TH 3S16H 1G6PA 1GVPA 3I56A 1SFOH 3K7AH 4IPDA 2XTIA 3EN2A 4YCVA 5M3FG 5C44G 4IO9A 1T9HA 2MO1A 4DV3L 2JQOA 4A3KG 2LSSA 2E2HH 1X9NA 1A0IA 3PGZA 4DV5L 2JA5G 1M1KC 4AYBG 1IBMQ 4BBSG 2UUCQ 1XMQQ 3ICEA 2F3IA 3A5ZB 1C9OA 3ULPA 4L5SA 1FGUA 1YVCA 4C3JH 1JMCA 4PMWA 4BY7G 1WI5A 1EQRA 3MXNB 2JA7G 4DR7L 3EBEA 1UEBA 3HOWH 3OYYA 2N3SA 3RN2A 1N32L 1KC8C 4A3LH 1HH2P 3G6EA 4LFCL 2KHJA 1VQLA 3KOJA 1Q46A 2RHSB 3D31A 4GOPC 3I55A 4A3MH 2Q2UA 2NN6I 1OXXK 2KCMA 2NZOA 1FVIA 4HJ8A 1L2FA 4DV0Q 2D0PA 1KHIA 2YU9H 1CUKA 1QUQA 2WB1E 4JBMA 4IPCA 3I7FA 4Y7NH 3PSIA 3UDFA 4DR4L 2WB1G 1JT8A 1O7IA 5IWAL 1HNWL 4LF6Q 4QQBX 4A3EH 3ER0A 1A8VA 3M9BA 3DLLA 3OTOQ 3HOWG 2K5NA 3A0JA 1PH3A 4K0KL 3CAMA 1DGSA 2OQKA 1N8RC 3J81c 3F1ZA 1IYJB 2Z0SA 3STBD 2Q2HA 2B3GA 3F2DA 3GTKH 4A3LG 2ASBA 5IP9H 1J5EQ 1KIXA 2UXCL 4A3MG 1YBYA 1JJ2A 3CCQA 1XNQL 1VQ8A 3RZOH 2MNAA 2IY5B 2ZTDA 1HZ9A 3HOYH 1PHJA 1Q1BA 4DR5L 5C0XJ 2UU9L 4B3SL 4LF8L 2OTLA 3S2HH 2C35B 1PH1A 4A3JH 4DV1Q 3PF5A 5BR8Q 2ZJQA 3Q8DA 1BKBA 4JOIA 1QVGA 1CKMA 5LMUQ 3J80i 4DV6Q 3KF6B 4IFDI 2JA8H 4DV7Q 4MZ9A 4JI2Q 2B29A 3RLFA 2K4KA 3CC4A 1AE2A 1P16A 1GKHA 2HQLA 1MJCA 3M4PA 4H02A 3G71A 4BXXH 4GKKL 2K5VA 4JV5Q 2KHIA 2BA1A 5E7NA 3TRZA 5LMNQ 1QZGA 3PUWA 4JBWA 4O0AA 4YY3Q 3JAMc 5C0XG 4B3ML 1ASZA 2WAQG 1JB7A 4YWLA 4GOPA 2PMZE 3K8AA 4DK3C 1VQ4A 4A4IA 4BA1I 1Q7YC 4JI1Q 2UUBQ 4YCWA 1BBWA 3S17H 4Y52H 4A3DH 2Q2IA 1PH9A 1WJJA 3UDXA 2JA8G 4DR4Q 4DR6Q 2F4VQ 1Y1VH 3KDFB 1YZ6A 1IBML 2UUCL 2VUMG 3S1NH 3HKSA 2OQ0A 2RCNA 3S15H 4R4CA 1AE3A 4BXXG 1VQEA 1N34Q 4LF9Q 2PI2E 1SN8A 1N36Q 1M90C 2PNHA 4QY7A 4R4IA 1YHBA 5JJIA 3I2ZA 3HOXH 1B8AA 3GD7A 3PUXA 1PH6A 1FJGQ 1TWCH 4X62L 4X66Q 4OO1I 2I5MX 3EIVA 4J15A 1MKHA 4A93H 5C4JH 3CPWA 1PVOA 3K7UC 4GS3A 2BH2A 5GADC 1RIPA 5M5YH 1G291 1MJEA 1ASYA 1C0AA 2D0OA 3GO5A 2JA6H 1U5KA 4A3DG 4DV0L 1NY4A 4IJHA 1HZBA 2HHHQ 1K8AC 1XMOQ 3BZCA 4JI3Q 1CSQA 1VQPA 1H95A 4LF6L 4HIOA 3PIOA 3PO3H 2NN6G 3PUVA 1Q82C 2ZJRA 1FL0A 2IX0A 3OTOL 3HOXG 1I50H 4AH6A 1PH4A 4NXMQ 2Y0SG 2CCZA 4UP7A 3J81i 2UXBQ 3M3YH 1PFSA 4HIKA 4JCVE 4GLAC 1PH7A 2FXQA 4A3BG 1J5EL 1XNRQ 1OXTA 3KLWA 2YYZA 1YHQA 2DGYA 4BBRG 1P8LA 1VQIA 2IHFA 4GLVB 3TEHB 3GTJH 5IYCH 2JA6G 4IFDJ 1S40A 4LF4Q 4DR3Q 4IPGA 4DV1L 5BR8L 4AYBE 3GTQH 5LMUL 4DUYQ 3U4VA 4DV6L 5M3MH 3RN5A 3CCEA 4DV7L 4LF5Q 1GO3E 1X65A 3PO3G 1WOCA 4JI2L 2OTJA 1YIJA 2UUAQ 4OONA 5M5WH 1TWHH 4GN3B 4MTNA 3RZDH 4R4TA 4JV5L 5FLXc 4C2MH 3A5UA 1JJCB 3CCVA 3PO2H 1B70B 4X62Q 4R4QA 5LMNL 1V43A 1TXYA 1YHAA 4YCUA 3CP0A 3SGIA 4IFDG 3JAMi 1CKNB 1BBUA 4YY3L 1X3FA 3UDIA 2AHOB 3AQQA 1LUZA 4LWCA 4WJ4A 3GDEA 2N78A 2YV5A 3E9IA 2ZTEA 4JI1L 3CW2C 4DUZQ 2UUBL 4GKJQ 4OWXB 1OXVA 5M3MG 1NE3A 1W2BA 4DR6L 5AJ3Q 2F4VL 1TWGH 1CSPA 2PQAA 2ZM6Q 5GAEC 1KL9A 1IXRA 1EQQA 1PH5A 1X54A 2IX1A 4PZ7A 1QVCA 4KI0A 5H1SE 2GVAA 1VQJA 2WFWA 3AYHB 2ZJPA 3KF8B 4P71A 1N34L 4LF9L 1VQAA 1N36L 4DR2Q 4RMFA 1IBLQ 4QL5A 3J7ZC 2QGQA 3RLNA 1HZCA 4JI6Q 2VS1A 3F2CA 1FJGL 1VQCA 1X3EA 2JEAI 1N9WA 1LYLA 4X66L 4JG2A 3IRBA 3W5OA 1XJVA 2B63H 4YWKA 2I0QA 1VQDA 2EXDA 5IY0A 1JE5A 3K80C 1UE1A 4LUOA 4JBJA 4P75A 3PF4A 5C4XH 3NELA 3U4ZA 1HNXQ 4XIGS 4OX9Q 1HZAA 2LXKA 3M85A 4JYAQ 1KAWA 1UE5A 2HHHL 2HIVA 4P73A 1C7YA 3AEVA 4UP9A 4MNOA 2XGTA 1XMOL 4OO1G 4A3EG 4JI3L 3W1BA 3BZKA 1E22A 1WYDA 4R1JA 5GAHC 1UE6A 3G48A 4LW1A 4DKAC 4DV4Q 4GNXB 3S1RH 2VQFQ 1Y1WH 1KD1C 4IJLA 4APVA 3UDGA 4NXML 4LUZA 1Q8KA 5IP9G 2UXBL 3L0OA 2CWAA 2B63G 3S1MH 3S14H 1NMFA 2WAQE 3FP9A 1TWAH 4IPHA 1K9MC 4HIDA 1EIYB 1XNRL 3HOYG 3MEFA 4P74A 1VQ5A 1I94Q 3D0FA 4JI5L 4A3JG 3H0GH 3L7ZC 3L2PA 1VQNA 1L1OB 4LF4L 2K52A 3ZJYC 3CMAA 4DR3L 2UXDQ 2KCTA 3I4NH 4UP8A 4A3FH 2QEXA 4YHHQ 1EFWA 4DUYL 1X3GA 4NXNQ 4OWWB 2AWOA 1U0LA 2ALYB 3F2BA 4LF5L 1YI2A 1Z9FA 3NENA 4L5QA 1EIFA 2CKZB 2K5HA 4NPSA 1K73C 3CCRA 1D8LA 1HR0Q 2R93G 2UUAL 3HOVH 1VS0A 3FKIH 2VW9A 4JI7Q 1EWIA 1NJIC 1W3SA 3ULLA 4A3GH 4X6AH 2CFMA 4DPGA 4P72A 1VCIA 3KF6A 4GN5A 1E1OA 3M4QA 1QZHA 4WJ3M 1QVFA 1UWVA 1K3RA 2YTYA 4QIWE 2YTXA 2WP8J 3WWVA 4HJ7A 4AQYL 1VQOA 2ZTCA 3UE0A 2RF4A 3H3VH 4GKJL 1OXUA 4IOCA 4B3TQ 4DUZL 3I4NG 4A3CH 2E5LQ 1Y1VG 2DUDA 1IBKQ 4DK6C 1KRSA 1LTLA 1Y14B 4KLKA 2A8VA 1CKOA 3STBC 4PZ6A 5AJ3L 2E2IH 1SROA 1EUJA 2ZM6L 3M7NA 4XTCS 4L5RC 1VQ9A 2I5LX 1Q1EA 1JJGA 3K0XA 1BVSA 1PA6A 3HOVG 1VQMA 2Y0SE 4A3GG 1S3OA 4QJFA 4A76A 4X65Q 3ULJA 3T1HQ 4DR2L 5IYBH 3DM3A 4A75A 1IBLL 3GTPH 5JJKA 1K0RA 1NBWA 4JI6L 1KRTA 1K83H 2A19A 3KDFA 3LGJA 3CC7A 1VQFA 4A93G 3CD6A 3GTOH 2E8GA 2BA0A 2VNUD 5C44H 4A3KH 4B3RQ 4JI5Q 1IZ6A 3I4OA 1S72A 3CCLA 3HOUH 1E3PA 3I4MH 5FLMH 1HNXL 2KBNA 1PYBA 4A3CG 4OX9L 4R4OA 3OW2A 4OWTB 4JYAL 4JI8Q 4HJ9A 3NEMA 1B7YB 4BY7H 1X55A 3B6YA 1QUQB 2AWNA 2VY3A 3NBHB 3PUYA 2JA7H 1E7ZA 1SRUA 3KYHC 4DV4L 4OXPA 3CPFA 4JBKA 1N33Q 2VQFL 4JC0A 2R7DA 4DV2Q 1GD7A 1I5FA 4L5TA 2OCEA 1WFQA 3M4OH 4JOIC 1XPRA 4ME3A 5IYCG 2VL6A 3HOUG 3I4MG 3K81C 1LM0A 1I94L 4AQYQ 4UPAA 5FLMG 4KHPQ 5IYDH 2LXJA 2HIXA 5IT9c 4AIMA 2RHQB 2NVQH 1I6HH 5GQOA 2D62A 3CQZH 3S24A 4EQ5A 2QA4A 2UXDL 4LFAQ 1L0WA 4JI0Q 3GTMH 3FHWA 4NXNL 4YHHL 2MQHA 4KHZA 4RG1A 3BU2A 5IP7H 3S2DH 3H3VI 2IHEA 3F8TA 4HJ5A 3U50C 1PH8A 3ERSX 2ID0A 4O2DA 1HR0L 4LNQA 4JI7L 3VDYA 2OWOA 2R7ZH 2AKWB 3PO2G 2VQEQ 1Z47A 4C3IH 3KJPA 1J6QA 1Q12A 2Z6KC 3UE1A 4JI4Q 1VQBA 1HJPA 5GAGC 3GTGH 4BY1H 5IYDG 1K8GA 5DLQE 4GNXC 4LF7Q 3H15A 4LFBQ 4DR1Q 2H5XA 2HT1A 1PH2A 3CCSA 2I5HA 4B3TL 5HGQA 2E2JH 2E5LL 4GOPB 2ATWA 5JEAJ 1IBKL 4BA2I 3AFQA 2NVYH 2KENA 3TQYA 2Q2TA 5IP7G 3CMEA 2NVXH 5IE8A 1CKNA 4X64Q 1I3QH 1V9PA 1L1OC 2R7ZG 2V1CC 5C3EH 1YITA 1HNZQ 2IT1A 2K75A 4YWMA 4X65L 3CCJA 3T1HL 1VQ7A 4FDBA 1EYGA 3CCUA 1YNXA 4DV3Q 4EX5A 4TVAB 4BY1G 4POGA 3PV0A 1YJ9A 5C4XG 5M5XH 5EAYA 4DV5Q 4B3RL 3RNUA 5JEAG 1XPOA 1MIUA 1XTDA 1VQHA 5LMNW 2R6GA 4C3HH 2YTVA 2NZHA 2VUMH 4JI8L 4POFA 4GN4B 3T1YL 2EQSA 1D7QA 1A62A 1KQSA 4DR7Q 1X56A 2K50A 1YEZA 3TS0A 2PI2A 3E9HA 1N32Q 1Y1WG 4LUVA 4LFCQ 1NTGA 5C3EG 1G51A 3HFZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL2 A;  1N33 L;  5JJL A;  1A63 A;  5ELN A;  5J3B A;  3JC6 6;  1NMG A;  1SLJ A;  4DAM A;  2R7F A;  4DV2 L;  4BBS H;  4HIM A;  1VQ6 A;  2JK8 A;  3RLO A;  1OXS C;  3CCM A;  2Z6K A;  1OTC A;  5GRO A;  4A3I H;  1VQK A;  4PZ8 A;  3H0G G;  1PV4 A;  1HR0 W;  4DAY B;  1WCM H;  1AH9 A;  2R92 H;  1UE7 A;  3U58 A;  1Q81 C;  4GNX A;  5IWA Q;  3HOZ H;  4KHP L;  1V1Q A;  3A74 A;  2BH8 A;  1HNW Q;  2ES2 A;  1XMQ L;  4A3F G;  5K36 G;  1SE8 A;  4LFA L;  3HKZ E;  1PYS B;  4JI0 L;  4K0K Q;  2L15 A;  3PUZ A;  3HKZ G;  2GN5 A;  1VQG A;  3J7A 5;  3S1Q H;  4DNI A;  1YJW A;  4NB3 A;  3G4S A;  3PIP A;  3FKI G;  2GVB A;  2MFI A;  3J81 j;  1E1T A;  2UXC Q;  3CC2 A;  2VZA A;  2NVT H;  1L1O A;  1XNQ Q;  3RR5 A;  4PG3 A;  5FJ8 H;  1XPU A;  2MO0 A;  4HJA A;  4A3B H;  2JE6 I;  2VQE L;  1YJN A;  2UU9 Q;  4QGU A;  4B3S Q;  4LF8 Q;  4BBR H;  1SR3 A;  3PCO B;  4A3I G;  3KFU A;  5HY6 A;  4JI4 L;  2A1A A;  5M3F H;  1WCM G;  2R92 G;  3KJO A;  1X6O A;  1KXL A;  1RL2 A;  4TQU S;  5ELO A;  3J80 c;  3W1G A;  3AFP A;  4LF7 L;  3HOZ G;  3TS2 A;  5C0X I;  2EIF A;  4LFB L;  4UY8 C;  2JA5 H;  4DR1 L;  2N49 A;  1EOV A;  2AMC B;  1TWF H;  3GTL H;  3T1Y Q;  4IOA A;  2K14 A;  2JJQ A;  3CF5 A;  4GKK Q;  2R93 H;  2F52 A;  1GM5 A;  1SMX A;  2JEB I;  3TRE A;  4GLX A;  1Q86 C;  3CXC A;  4X64 L;  2CWP A;  3BJU A;  4DR5 Q;  4ALP A;  1E24 A;  2CQO A;  3E0E A;  2N8N A;  5IYB G;  4B3M Q;  2JA9 A;  2PQA B;  5FJ8 G;  1HNZ L;  1R9T H;  3S16 H;  1G6P A;  1GVP A;  3I56 A;  1SFO H;  3K7A H;  4IPD A;  2XTI A;  3EN2 A;  4YCV A;  5M3F G;  5C44 G;  4IO9 A;  1T9H A;  2MO1 A;  4DV3 L;  2JQO A;  4A3K G;  2LSS A;  2E2H H;  1X9N A;  1A0I A;  3PGZ A;  4DV5 L;  2JA5 G;  1M1K C;  4AYB G;  1IBM Q;  4BBS G;  2UUC Q;  1XMQ Q;  3ICE A;  2F3I A;  3A5Z B;  1C9O A;  3ULP A;  4L5S A;  1FGU A;  1YVC A;  4C3J H;  1JMC A;  4PMW A;  4BY7 G;  1WI5 A;  1EQR A;  3MXN B;  2JA7 G;  4DR7 L;  3EBE A;  1UEB A;  3HOW H;  3OYY A;  2N3S A;  3RN2 A;  1N32 L;  1KC8 C;  4A3L H;  1HH2 P;  3G6E A;  4LFC L;  2KHJ A;  1VQL A;  3KOJ A;  1Q46 A;  2RHS B;  3D31 A;  4GOP C;  3I55 A;  4A3M H;  2Q2U A;  2NN6 I;  1OXX K;  2KCM A;  2NZO A;  1FVI A;  4HJ8 A;  1L2F A;  4DV0 Q;  2D0P A;  1KHI A;  2YU9 H;  1CUK A;  1QUQ A;  2WB1 E;  4JBM A;  4IPC A;  3I7F A;  4Y7N H;  3PSI A;  3UDF A;  4DR4 L;  2WB1 G;  1JT8 A;  1O7I A;  5IWA L;  1HNW L;  4LF6 Q;  4QQB X;  4A3E H;  3ER0 A;  1A8V A;  3M9B A;  3DLL A;  3OTO Q;  3HOW G;  2K5N A;  3A0J A;  1PH3 A;  4K0K L;  3CAM A;  1DGS A;  2OQK A;  1N8R C;  3J81 c;  3F1Z A;  1IYJ B;  2Z0S A;  3STB D;  2Q2H A;  2B3G A;  3F2D A;  3GTK H;  4A3L G;  2ASB A;  5IP9 H;  1J5E Q;  1KIX A;  2UXC L;  4A3M G;  1YBY A;  1JJ2 A;  3CCQ A;  1XNQ L;  1VQ8 A;  3RZO H;  2MNA A;  2IY5 B;  2ZTD A;  1HZ9 A;  3HOY H;  1PHJ A;  1Q1B A;  4DR5 L;  5C0X J;  2UU9 L;  4B3S L;  4LF8 L;  2OTL A;  3S2H H;  2C35 B;  1PH1 A;  4A3J H;  4DV1 Q;  3PF5 A;  5BR8 Q;  2ZJQ A;  3Q8D A;  1BKB A;  4JOI A;  1QVG A;  1CKM A;  5LMU Q;  3J80 i;  4DV6 Q;  3KF6 B;  4IFD I;  2JA8 H;  4DV7 Q;  4MZ9 A;  4JI2 Q;  2B29 A;  3RLF A;  2K4K A;  3CC4 A;  1AE2 A;  1P16 A;  1GKH A;  2HQL A;  1MJC A;  3M4P A;  4H02 A;  3G71 A;  4BXX H;  4GKK L;  2K5V A;  4JV5 Q;  2KHI A;  2BA1 A;  5E7N A;  3TRZ A;  5LMN Q;  1QZG A;  3PUW A;  4JBW A;  4O0A A;  4YY3 Q;  3JAM c;  5C0X G;  4B3M L;  1ASZ A;  2WAQ G;  1JB7 A;  4YWL A;  4GOP A;  2PMZ E;  3K8A A;  4DK3 C;  1VQ4 A;  4A4I A;  4BA1 I;  1Q7Y C;  4JI1 Q;  2UUB Q;  4YCW A;  1BBW A;  3S17 H;  4Y52 H;  4A3D H;  2Q2I A;  1PH9 A;  1WJJ A;  3UDX A;  2JA8 G;  4DR4 Q;  4DR6 Q;  2F4V Q;  1Y1V H;  3KDF B;  1YZ6 A;  1IBM L;  2UUC L;  2VUM G;  3S1N H;  3HKS A;  2OQ0 A;  2RCN A;  3S15 H;  4R4C A;  1AE3 A;  4BXX G;  1VQE A;  1N34 Q;  4LF9 Q;  2PI2 E;  1SN8 A;  1N36 Q;  1M90 C;  2PNH A;  4QY7 A;  4R4I A;  1YHB A;  5JJI A;  3I2Z A;  3HOX H;  1B8A A;  3GD7 A;  3PUX A;  1PH6 A;  1FJG Q;  1TWC H;  4X62 L;  4X66 Q;  4OO1 I;  2I5M X;  3EIV A;  4J15 A;  1MKH A;  4A93 H;  5C4J H;  3CPW A;  1PVO A;  3K7U C;  4GS3 A;  2BH2 A;  5GAD C;  1RIP A;  5M5Y H;  1G29 1;  1MJE A;  1ASY A;  1C0A A;  2D0O A;  3GO5 A;  2JA6 H;  1U5K A;  4A3D G;  4DV0 L;  1NY4 A;  4IJH A;  1HZB A;  2HHH Q;  1K8A C;  1XMO Q;  3BZC A;  4JI3 Q;  1CSQ A;  1VQP A;  1H95 A;  4LF6 L;  4HIO A;  3PIO A;  3PO3 H;  2NN6 G;  3PUV A;  1Q82 C;  2ZJR A;  1FL0 A;  2IX0 A;  3OTO L;  3HOX G;  1I50 H;  4AH6 A;  1PH4 A;  4NXM Q;  2Y0S G;  2CCZ A;  4UP7 A;  3J81 i;  2UXB Q;  3M3Y H;  1PFS A;  4HIK A;  4JCV E;  4GLA C;  1PH7 A;  2FXQ A;  4A3B G;  1J5E L;  1XNR Q;  1OXT A;  3KLW A;  2YYZ A;  1YHQ A;  2DGY A;  4BBR G;  1P8L A;  1VQI A;  2IHF A;  4GLV B;  3TEH B;  3GTJ H;  5IYC H;  2JA6 G;  4IFD J;  1S40 A;  4LF4 Q;  4DR3 Q;  4IPG A;  4DV1 L;  5BR8 L;  4AYB E;  3GTQ H;  5LMU L;  4DUY Q;  3U4V A;  4DV6 L;  5M3M H;  3RN5 A;  3CCE A;  4DV7 L;  4LF5 Q;  1GO3 E;  1X65 A;  3PO3 G;  1WOC A;  4JI2 L;  2OTJ A;  1YIJ A;  2UUA Q;  4OON A;  5M5W H;  1TWH H;  4GN3 B;  4MTN A;  3RZD H;  4R4T A;  4JV5 L;  5FLX c;  4C2M H;  3A5U A;  1JJC B;  3CCV A;  3PO2 H;  1B70 B;  4X62 Q;  4R4Q A;  5LMN L;  1V43 A;  1TXY A;  1YHA A;  4YCU A;  3CP0 A;  3SGI A;  4IFD G;  3JAM i;  1CKN B;  1BBU A;  4YY3 L;  1X3F A;  3UDI A;  2AHO B;  3AQQ A;  1LUZ A;  4LWC A;  4WJ4 A;  3GDE A;  2N78 A;  2YV5 A;  3E9I A;  2ZTE A;  4JI1 L;  3CW2 C;  4DUZ Q;  2UUB L;  4GKJ Q;  4OWX B;  1OXV A;  5M3M G;  1NE3 A;  1W2B A;  4DR6 L;  5AJ3 Q;  2F4V L;  1TWG H;  1CSP A;  2PQA A;  2ZM6 Q;  5GAE C;  1KL9 A;  1IXR A;  1EQQ A;  1PH5 A;  1X54 A;  2IX1 A;  4PZ7 A;  1QVC A;  4KI0 A;  5H1S E;  2GVA A;  1VQJ A;  2WFW A;  3AYH B;  2ZJP A;  3KF8 B;  4P71 A;  1N34 L;  4LF9 L;  1VQA A;  1N36 L;  4DR2 Q;  4RMF A;  1IBL Q;  4QL5 A;  3J7Z C;  2QGQ A;  3RLN A;  1HZC A;  4JI6 Q;  2VS1 A;  3F2C A;  1FJG L;  1VQC A;  1X3E A;  2JEA I;  1N9W A;  1LYL A;  4X66 L;  4JG2 A;  3IRB A;  3W5O A;  1XJV A;  2B63 H;  4YWK A;  2I0Q A;  1VQD A;  2EXD A;  5IY0 A;  1JE5 A;  3K80 C;  1UE1 A;  4LUO A;  4JBJ A;  4P75 A;  3PF4 A;  5C4X H;  3NEL A;  3U4Z A;  1HNX Q;  4XIG S;  4OX9 Q;  1HZA A;  2LXK A;  3M85 A;  4JYA Q;  1KAW A;  1UE5 A;  2HHH L;  2HIV A;  4P73 A;  1C7Y A;  3AEV A;  4UP9 A;  4MNO A;  2XGT A;  1XMO L;  4OO1 G;  4A3E G;  4JI3 L;  3W1B A;  3BZK A;  1E22 A;  1WYD A;  4R1J A;  5GAH C;  1UE6 A;  3G48 A;  4LW1 A;  4DKA C;  4DV4 Q;  4GNX B;  3S1R H;  2VQF Q;  1Y1W H;  1KD1 C;  4IJL A;  4APV A;  3UDG A;  4NXM L;  4LUZ A;  1Q8K A;  5IP9 G;  2UXB L;  3L0O A;  2CWA A;  2B63 G;  3S1M H;  3S14 H;  1NMF A;  2WAQ E;  3FP9 A;  1TWA H;  4IPH A;  1K9M C;  4HID A;  1EIY B;  1XNR L;  3HOY G;  3MEF A;  4P74 A;  1VQ5 A;  1I94 Q;  3D0F A;  4JI5 L;  4A3J G;  3H0G H;  3L7Z C;  3L2P A;  1VQN A;  1L1O B;  4LF4 L;  2K52 A;  3ZJY C;  3CMA A;  4DR3 L;  2UXD Q;  2KCT A;  3I4N H;  4UP8 A;  4A3F H;  2QEX A;  4YHH Q;  1EFW A;  4DUY L;  1X3G A;  4NXN Q;  4OWW B;  2AWO A;  1U0L A;  2ALY B;  3F2B A;  4LF5 L;  1YI2 A;  1Z9F A;  3NEN A;  4L5Q A;  1EIF A;  2CKZ B;  2K5H A;  4NPS A;  1K73 C;  3CCR A;  1D8L A;  1HR0 Q;  2R93 G;  2UUA L;  3HOV H;  1VS0 A;  3FKI H;  2VW9 A;  4JI7 Q;  1EWI A;  1NJI C;  1W3S A;  3ULL A;  4A3G H;  4X6A H;  2CFM A;  4DPG A;  4P72 A;  1VCI A;  3KF6 A;  4GN5 A;  1E1O A;  3M4Q A;  1QZH A;  4WJ3 M;  1QVF A;  1UWV A;  1K3R A;  2YTY A;  4QIW E;  2YTX A;  2WP8 J;  3WWV A;  4HJ7 A;  4AQY L;  1VQO A;  2ZTC A;  3UE0 A;  2RF4 A;  3H3V H;  4GKJ L;  1OXU A;  4IOC A;  4B3T Q;  4DUZ L;  3I4N G;  4A3C H;  2E5L Q;  1Y1V G;  2DUD A;  1IBK Q;  4DK6 C;  1KRS A;  1LTL A;  1Y14 B;  4KLK A;  2A8V A;  1CKO A;  3STB C;  4PZ6 A;  5AJ3 L;  2E2I H;  1SRO A;  1EUJ A;  2ZM6 L;  3M7N A;  4XTC S;  4L5R C;  1VQ9 A;  2I5L X;  1Q1E A;  1JJG A;  3K0X A;  1BVS A;  1PA6 A;  3HOV G;  1VQM A;  2Y0S E;  4A3G G;  1S3O A;  4QJF A;  4A76 A;  4X65 Q;  3ULJ A;  3T1H Q;  4DR2 L;  5IYB H;  3DM3 A;  4A75 A;  1IBL L;  3GTP H;  5JJK A;  1K0R A;  1NBW A;  4JI6 L;  1KRT A;  1K83 H;  2A19 A;  3KDF A;  3LGJ A;  3CC7 A;  1VQF A;  4A93 G;  3CD6 A;  3GTO H;  2E8G A;  2BA0 A;  2VNU D;  5C44 H;  4A3K H;  4B3R Q;  4JI5 Q;  1IZ6 A;  3I4O A;  1S72 A;  3CCL A;  3HOU H;  1E3P A;  3I4M H;  5FLM H;  1HNX L;  2KBN A;  1PYB A;  4A3C G;  4OX9 L;  4R4O A;  3OW2 A;  4OWT B;  4JYA L;  4JI8 Q;  4HJ9 A;  3NEM A;  1B7Y B;  4BY7 H;  1X55 A;  3B6Y A;  1QUQ B;  2AWN A;  2VY3 A;  3NBH B;  3PUY A;  2JA7 H;  1E7Z A;  1SRU A;  3KYH C;  4DV4 L;  4OXP A;  3CPF A;  4JBK A;  1N33 Q;  2VQF L;  4JC0 A;  2R7D A;  4DV2 Q;  1GD7 A;  1I5F A;  4L5T A;  2OCE A;  1WFQ A;  3M4O H;  4JOI C;  1XPR A;  4ME3 A;  5IYC G;  2VL6 A;  3HOU G;  3I4M G;  3K81 C;  1LM0 A;  1I94 L;  4AQY Q;  4UPA A;  5FLM G;  4KHP Q;  5IYD H;  2LXJ A;  2HIX A;  5IT9 c;  4AIM A;  2RHQ B;  2NVQ H;  1I6H H;  5GQO A;  2D62 A;  3CQZ H;  3S24 A;  4EQ5 A;  2QA4 A;  2UXD L;  4LFA Q;  1L0W A;  4JI0 Q;  3GTM H;  3FHW A;  4NXN L;  4YHH L;  2MQH A;  4KHZ A;  4RG1 A;  3BU2 A;  5IP7 H;  3S2D H;  3H3V I;  2IHE A;  3F8T A;  4HJ5 A;  3U50 C;  1PH8 A;  3ERS X;  2ID0 A;  4O2D A;  1HR0 L;  4LNQ A;  4JI7 L;  3VDY A;  2OWO A;  2R7Z H;  2AKW B;  3PO2 G;  2VQE Q;  1Z47 A;  4C3I H;  3KJP A;  1J6Q A;  1Q12 A;  2Z6K C;  3UE1 A;  4JI4 Q;  1VQB A;  1HJP A;  5GAG C;  3GTG H;  4BY1 H;  5IYD G;  1K8G A;  5DLQ E;  4GNX C;  4LF7 Q;  3H15 A;  4LFB Q;  4DR1 Q;  2H5X A;  2HT1 A;  1PH2 A;  3CCS A;  2I5H A;  4B3T L;  5HGQ A;  2E2J H;  2E5L L;  4GOP B;  2ATW A;  5JEA J;  1IBK L;  4BA2 I;  3AFQ A;  2NVY H;  2KEN A;  3TQY A;  2Q2T A;  5IP7 G;  3CME A;  2NVX H;  5IE8 A;  1CKN A;  4X64 Q;  1I3Q H;  1V9P A;  1L1O C;  2R7Z G;  2V1C C;  5C3E H;  1YIT A;  1HNZ Q;  2IT1 A;  2K75 A;  4YWM A;  4X65 L;  3CCJ A;  3T1H L;  1VQ7 A;  4FDB A;  1EYG A;  3CCU A;  1YNX A;  4DV3 Q;  4EX5 A;  4TVA B;  4BY1 G;  4POG A;  3PV0 A;  1YJ9 A;  5C4X G;  5M5X H;  5EAY A;  4DV5 Q;  4B3R L;  3RNU A;  5JEA G;  1XPO A;  1MIU A;  1XTD A;  1VQH A;  5LMN W;  2R6G A;  4C3H H;  2YTV A;  2NZH A;  2VUM H;  4JI8 L;  4POF A;  4GN4 B;  3T1Y L;  2EQS A;  1D7Q A;  1A62 A;  1KQS A;  4DR7 Q;  1X56 A;  2K50 A;  1YEZ A;  3TS0 A;  2PI2 A;  3E9H A;  1N32 Q;  1Y1W G;  4LUV A;  4LFC Q;  1NTG A;  5C3E G;  1G51 A;  3HFZ B; 
#chains in the Genus database with same CATH topology
 3KLR A;  3VYU A;  2HCC A;  4ZKB B;  4CJ2 C;  3CHB D;  3GTP B;  4PZ8 A;  4DAY B;  2EE1 A;  1PDQ A;  1UE7 A;  4G4K A;  3U58 A;  5IWA Q;  3D6W A;  2Z8L A;  4A3F G;  4ZRZ A;  4LFA L;  3HKZ E;  1PYS B;  2L5T A;  1JWS D;  3HKZ G;  2GN5 A;  1VQG A;  1ZXT A;  4KJN A;  2K5Q A;  2MFI A;  5A35 A;  1E1T A;  2KCN A;  1B3Q A;  3CC2 A;  1Z6H A;  2NVT H;  1SYC A;  4PG3 A;  3KBG A;  3RR5 A;  1BO0 A;  2MO0 A;  4X3T A;  3WDN A;  1XPU A;  5DM6 3;  2UU9 Q;  4B3S Q;  2EYF A;  3PCO B;  4JI4 L;  4OEL B;  3S9W A;  4FF4 A;  3KJO A;  2R92 G;  1DOK A;  1RL2 A;  4OGQ C;  4LF7 L;  3W1G A;  3AFP A;  4H7B A;  3M4O B;  4RWS C;  1TWF H;  3GTL H;  1SNQ A;  4PMC A;  2JJQ A;  5D14 A;  2BOS A;  2ICE C;  3TRE A;  1WTP A;  2G9D A;  4DR5 Q;  1RKN A;  3HS0 C;  1RHP A;  4K2L A;  5IYB G;  1TS4 A;  5FJ8 G;  1HNZ L;  3NBI A;  5IGE A;  3S16 H;  1GVP A;  3I56 A;  2XTI A;  1DYQ A;  5C44 G;  4A3K G;  4DV3 L;  1HRJ A;  1SBB B;  1PTO C;  5IT9 L;  3IKJ A;  1IBM Q;  2F3I A;  2RVL A;  5I2X A;  1C9O A;  5C4X B;  1PYW D;  1YVC A;  2EPB A;  1JMC A;  1B3A A;  1EQR A;  3MXN B;  1H9J A;  4DR7 L;  3CU7 A;  3MFG A;  1ENA A;  3GP7 A;  3OYY A;  2BDO A;  2CHB D;  2N3S A;  4LK1 C;  1N32 L;  4A3L H;  1QNK A;  2KHJ A;  3C46 A;  1Q46 A;  3BG3 A;  3D31 A;  4A3M H;  1GHK A;  1Y1W B;  3PQI A;  2KCM A;  3N52 A;  2A5H A;  5KND A;  3NBH A;  2XSC A;  4Y7N H;  4FF2 A;  1TII D;  1GXD C;  3A7A B;  3T4A C;  5M5X B;  1BR9 A;  2TSS A;  1HNW L;  4LF6 Q;  3QOL A;  2J7Z A;  1ZEQ X;  3H91 A;  1H9S B;  3HOW G;  4C3H B;  3KBX A;  2OQK A;  1FNU A;  3F1Z A;  2Z0S A;  3STB D;  3F2D A;  3UI2 A;  2IX3 A;  2ASB A;  1J5E Q;  1PZI D;  1QB5 D;  1VQ8 A;  1KNE A;  4RGO S;  2DJF C;  1Q1B A;  2C35 B;  4A3J H;  2ZJQ A;  2PCF B;  1LTT D;  5KGU A;  1PFM A;  5D3D A;  2F0H A;  4U68 A;  4MZ9 A;  5EPJ A;  1WCM B;  3HOZ B;  3CC4 A;  4GKK L;  2HQL A;  3NXW A;  3K58 A;  2KHI A;  1ONL A;  3TRZ A;  1QZG A;  5CV8 A;  1FR3 A;  5DEH A;  4JBW A;  3S1Q B;  3JAM c;  1JB7 A;  1TS3 A;  1F9Q A;  4GOP A;  4DK3 C;  4A4I A;  4BA1 I;  1Q7Y C;  1SJH D;  3MXG A;  5IT9 E;  4HCE A;  4Y52 H;  2Q2I A;  3DEP A;  3UDX A;  2JA8 G;  2EJG C;  4DR4 Q;  5EBD A;  2LY7 A;  3KDF B;  4K8I A;  1LO5 D;  1YZ6 A;  2K03 A;  2Q8I B;  3BS1 A;  2OQ0 A;  4HSP A;  1AE3 A;  1GUO A;  1M90 C;  4QY7 A;  1YHB A;  3I2Z A;  4DXF A;  1B8A A;  3GD7 A;  4BY7 B;  4X62 L;  4OO1 I;  2I5M X;  4J15 A;  3CPW A;  3NE5 B;  5I9O A;  4GS3 A;  3A7L A;  5GAD C;  1RIP A;  1MJE A;  5ISR A;  3J7Y W;  3GO5 A;  4A3D G;  2L0C A;  4CKB A;  4IJH A;  1HZB A;  5ELF A;  5FOB B;  1C8C A;  2SOB A;  3DMU A;  1EY4 A;  1LTR D;  3PUV A;  2NTS A;  1FL0 A;  3OTO L;  1PH4 A;  4AH6 A;  5J22 A;  5JVG 3;  1I4H A;  2UXB Q;  3GTM B;  1F2M A;  5LHY 1;  4HIK A;  1KNA A;  2FJ2 A;  4BBR G;  1WTV A;  1VQI A;  2IHF A;  1RJT A;  4IUT A;  2JA6 G;  1F2L A;  2AUK A;  4IPG A;  2O4X A;  4GZY C;  1B53 A;  4DV1 L;  3T53 B;  1DXM A;  1NSN S;  3IL8 A;  4DV6 L;  1F2Y A;  4BY1 B;  1GO3 E;  3M7G A;  4WFN 3;  2BDN A;  4OON A;  2EDG A;  4R4T A;  1EYC A;  1HUN A;  2KOL A;  1O7L A;  4R4Q A;  2NVX B;  3G6J B;  1CKN B;  1BBU A;  2RQX A;  4YY3 L;  2K01 A;  1W6K A;  4CJ1 B;  2AHO B;  4WJ4 A;  4GKJ Q;  2N78 A;  3E9I A;  4JI1 L;  4CJ0 B;  1EWC A;  2Z6B A;  1BCP C;  1OXV A;  4CDD C;  1HA5 A;  2F4V L;  2F0K A;  2EYP A;  1SYE A;  1EQQ A;  2IX1 A;  3AYH B;  1SYD A;  1CHP D;  3FPP A;  1N34 L;  4LF9 L;  2F0I A;  1N36 L;  1IBL Q;  1CQV A;  3Q24 A;  4JI6 Q;  1BCP B;  1HQM C;  2VS1 A;  3F2C A;  1FJG L;  1QJO A;  1DCZ A;  1LYL A;  3W5O A;  4YWK A;  1IW7 D;  2EXD A;  4DAV A;  1JE5 A;  3K80 C;  4LUO A;  1UNS A;  5C4X H;  1A3U A;  1HNX Q;  3K6O A;  4OX9 Q;  1HZA A;  2LXK A;  5CBA E;  4JYA Q;  3D4R A;  4IUN A;  2L4N A;  4MNO A;  1XMO L;  4OO1 G;  2MGS A;  3FDT A;  3W1B A;  2EJM A;  1AN8 A;  1KDA A;  1WYD A;  3SK4 A;  2Z4I A;  1D5X C;  1Y1W H;  4IJL A;  5EKL A;  3P7J A;  1K0S A;  4EQN A;  1Q8K A;  3L0O A;  2B63 G;  4IPH A;  1KDC A;  3HOX B;  2CH4 W;  3EJI A;  5AFW A;  3TBI B;  4IUR A;  1ML0 D;  4ME5 A;  4A3B B;  3L7Z C;  1BQQ T;  3ZJY C;  4RAU C;  4DR3 L;  2KA7 A;  2KCT A;  3J7A F;  1VMP A;  1MSH A;  1BBX C;  1X3G A;  4UHV A;  4ZUI A;  2AWO A;  1A6X A;  2RBM A;  4NPS A;  1HUM A;  3NTH A;  4JI7 Q;  4EQP A;  1W3S A;  3G7L A;  3PO3 B;  1I4P A;  3KF6 A;  1CI3 M;  5HUR A;  1U4R A;  1D5M C;  4V0B A;  4K6L A;  1NR2 A;  1D6E C;  3VA5 A;  4AQY L;  1R9T B;  3X3M A;  3K7A B;  4B3T Q;  4DUZ L;  1IBK Q;  1B50 A;  4DK6 C;  2A8V A;  4KLK A;  1CKO A;  2WII B;  5AJ3 L;  1SE4 A;  1U9R A;  1JJG A;  5M3M B;  3HOV G;  3MEH A;  2L9H A;  3T1H Q;  1O78 A;  4DR2 L;  3DM3 A;  1RF2 D;  2K7V A;  1EOT A;  1NBW A;  2RSN A;  4RCN A;  4DNR B;  2A19 A;  4A93 G;  1VQF A;  1VDZ A;  3HRZ C;  2BA0 A;  4JI5 Q;  3I4M H;  5COR A;  1S72 A;  3CCL A;  4QB4 A;  2KBN A;  2F0N A;  5E4X A;  5DNF A;  3P1H A;  2HQE A;  3NEM A;  2YU9 B;  1B7Y B;  4BY7 H;  3OPO A;  1LTI D;  2VY3 A;  3D8G A;  4O42 A;  3KYH C;  4DV4 L;  2XWB B;  3CPF A;  4NDX A;  5FO7 B;  2R7D A;  4DV2 Q;  1GD7 A;  1EY9 A;  2OCE A;  4HSV A;  5IGC A;  4JOI C;  3TP6 A;  4ME3 A;  2VL6 A;  3K57 A;  3KK7 A;  1STH A;  2A68 C;  3RZO B;  4AIM A;  2RHQ B;  2NTT A;  3HOY B;  3S2H B;  3S24 A;  3D6C A;  2QA4 A;  3W2D A;  2UXD L;  3GTM H;  2PZW A;  2SDF A;  1D2B A;  5C6A A;  2HDL A;  5IP7 H;  1HHV A;  3SK6 A;  3H3V I;  4HJ5 A;  4LNQ A;  1SJE D;  1IKM A;  3PO2 G;  1STG A;  2VQE Q;  3KJP A;  3S1R B;  1Q12 A;  1F77 A;  2WKC A;  5GAG C;  4K5X A;  3WOF A;  4BY1 H;  1K8G A;  4KKU A;  1TWA B;  3U9O A;  2M2L A;  1GUN A;  2XN9 C;  1PH2 A;  2C5C A;  3CCS A;  2E5L L;  3V05 A;  5D3I B;  3AFQ A;  2Q2T A;  2KEN A;  3TQY A;  3CME A;  2NVX H;  2F0T A;  1Y1V B;  1WTW A;  3H6M A;  1L1O C;  4IAL A;  1PFN A;  5E3F A;  5TSS A;  3S1N B;  1I4G A;  1QIL A;  5C3E H;  3PIO 3;  4C3I G;  3CCJ A;  3FRP B;  4FDB A;  1YNX A;  4A3G B;  1E0B A;  3PV0 A;  4R8N A;  4UDU C;  4B3R L;  3KUP A;  2KVM A;  1B2T A;  1X32 A;  1MIU A;  1PZJ D;  2EY1 A;  5K5P A;  3I90 A;  5M5Y B;  1ET6 A;  2NZH A;  4JI8 L;  5K36 H;  1KQS A;  2P5Z X;  3I8Z A;  2PZT A;  3E9H A;  4K6D A;  5C3X A;  3MEF A;  1NTG A;  5M9O A;  4DR5 L;  1QE6 A;  1IL2 A;  5CGK A;  1SLJ A;  4N9T A;  4BBS H;  1I50 B;  5DAU A;  2EY6 A;  1OXS C;  4N9P A;  3URY A;  4A3I H;  4BWG B;  3H0G G;  1HR0 W;  4RKL A;  4BS9 A;  4GNX A;  3A74 A;  2BH8 A;  3HOU B;  4JI0 L;  3SR1 A;  4NB3 A;  1IL8 A;  1EY5 A;  3FKI G;  2EYM A;  2UXC Q;  1FNV A;  2F0O A;  4A3B H;  1YJN A;  4QGU A;  2J0T D;  4XT3 B;  4C2M B;  1EQV A;  3KFU A;  5M3F H;  3BYY B;  2F0V A;  1KXL A;  1X6O A;  4KHV A;  4LFB L;  2A73 B;  1HTL D;  1DM0 B;  2E2D C;  2JA5 H;  4IOA A;  3FEW X;  2F52 A;  4TSS A;  4KJO A;  3CXC A;  4X64 L;  3BJU A;  1EYD A;  1TWG B;  4ZK9 B;  4FXG C;  1E2V A;  2CQO A;  3E0E A;  2N8N A;  2E74 C;  3EFX D;  3GV3 A;  4B3M Q;  3S2D B;  1FD7 D;  5LL6 S;  2B2Y A;  5CC4 A;  1R9T H;  3K7A H;  4IPD A;  2R7Z B;  4IO9 A;  1T9H A;  1HXY D;  2E76 C;  1Q90 A;  1X9N A;  1A0I A;  4DV5 L;  3D3R A;  1M1K C;  4AYB G;  3A5Z B;  1MHW C;  4C3J H;  5CV9 A;  5T1G A;  3EBE A;  1UEB A;  1R4P B;  3G6E A;  1VQL A;  3KOJ A;  2OEO A;  3ND8 A;  4E6I A;  1I3Q B;  3I55 A;  2EYL A;  1OXX K;  4DV0 Q;  2YU9 H;  1QUQ A;  2WB1 E;  3PSI A;  1S5B D;  4DR4 L;  2WB1 G;  4KKT A;  3OWE B;  5KNC A;  4QQB X;  1YNJ D;  3ERO A;  1U4P A;  4NKL A;  2HCI A;  3V96 A;  5FKA C;  1I4R A;  2VXW A;  4K0K L;  1DGS A;  3J81 c;  4A3F B;  1IYJ B;  4A3L G;  4RHS A;  5ELB A;  4OIJ A;  5IGB A;  5IP9 H;  1YNN D;  4A3M G;  3HKZ B;  1JJ2 A;  1XNQ L;  3RZO H;  2BE5 D;  1HZ9 A;  2DNC A;  3HOY H;  3S2H H;  4LF8 L;  1ENF A;  3PF5 A;  2PPB C;  1BKB A;  5LMU Q;  3J80 i;  1SYF A;  3OMG A;  4HMI A;  4OL7 A;  4XYO A;  2R92 B;  3RUZ A;  1P16 A;  2IW3 A;  5I6Y A;  1H9M A;  3G71 A;  4JV5 Q;  2BA1 A;  5E7N A;  2B8F A;  1E2Z A;  3HEJ A;  1ASZ A;  2WAQ G;  1ZYR D;  4YWL A;  1WTX A;  3D4D A;  1VQ4 A;  2FMC A;  2IWH A;  2D9U A;  2UUB Q;  4V19 0;  1BBW A;  5D65 A;  2GA4 B;  5ELE A;  1PH9 A;  5IGF A;  4KD4 A;  3GTO B;  1Y1V H;  4CHT B;  5C44 B;  1L0Y B;  4A3K B;  2UUC L;  2VUM G;  3S1N H;  1SNM A;  1EFI D;  2NN6 H;  4CKE A;  4R4I A;  4J1M A;  4KD3 A;  3PUX A;  3SVM A;  1F2Z A;  4X66 Q;  3EIV A;  4RA8 A;  3MWY W;  2F4I A;  2NWG A;  2BH2 A;  3E5S A;  5M5Y H;  1U4M A;  1G29 1;  2DY8 A;  2PZU A;  4FO2 A;  4QUC A;  3MC0 B;  1HFG A;  1V1P B;  4NW2 A;  5IOC A;  2HHH Q;  1CSQ A;  3TN2 A;  5JPM C;  2LMC B;  4HIO A;  3PIO A;  1Q82 C;  2ZJR A;  4NXM Q;  1I50 H;  4I65 A;  2Y0S G;  1L0X B;  3NTK A;  1PFS A;  2KEC A;  3HOW B;  3MHB A;  1OXT A;  1LT3 D;  1YHQ A;  2YYZ A;  1CZG A;  1I4Q A;  3TEH B;  5IYC H;  2XVS A;  1EEF D;  4M1U B;  5BR8 L;  4IUV A;  3TSS A;  3GTG B;  4R8I A;  3U4V A;  3RN5 A;  2A74 C;  4DV7 L;  1PRT D;  1EY7 A;  4JI2 L;  2OTJ A;  2UUA Q;  2B2T C;  5KRU A;  3K59 A;  4GN3 B;  4MTN A;  5FK9 C;  5FLX c;  4C2M H;  4ZCK A;  5E1F A;  5LMN L;  1V43 A;  1TXY A;  3Q0A A;  3CP0 A;  1ENC A;  3SGI A;  5F2D A;  3GTK B;  2JXM B;  3UDI A;  1STE A;  2SNS A;  4WJW A;  1JE4 A;  3P75 A;  1EZ6 A;  3CW2 C;  4OWX B;  1KAB A;  4DR6 L;  1TWG H;  2PQA A;  2ZM6 Q;  1KL9 A;  1IXR A;  5H1S E;  2WFW A;  4P71 A;  4RMF A;  3A8I E;  4QL5 A;  1VQC A;  3IRB A;  2I0Q A;  2TMP A;  4P75 A;  4JBJ A;  1BDO A;  1EZ8 A;  2A69 D;  2L11 A;  1KAW A;  3CKI B;  3IFT A;  3AEV A;  4UP9 A;  3S17 B;  2XGT A;  4A3E G;  4JI3 L;  1B9M A;  1O7Y A;  1E22 A;  4R1J A;  4LAA A;  1KLU D;  5GAH C;  3VA7 A;  2VQF Q;  1KD1 C;  4APV A;  1XYI A;  3JAM L;  3S1M H;  3MXU A;  3S14 H;  1K8O A;  4HID A;  2QDL A;  2ZXP A;  1XNR L;  4P74 A;  4J6H A;  1VQ5 A;  3A54 A;  4JI5 L;  1XXG A;  3MFY A;  5J39 A;  2K52 A;  4LF4 L;  4I7Z C;  4BBR B;  2JA6 B;  4UP8 A;  4A3F H;  4YHH Q;  4DUY L;  5I6W A;  5CV6 A;  2ALY B;  4XXE A;  4LF5 L;  1YI2 A;  4L5Q A;  2R93 G;  2CKZ B;  2K5H A;  1HR0 Q;  2VW9 A;  1PRT B;  3ULL A;  4X6A H;  2B2W C;  4DPG A;  4P72 A;  2QF7 A;  1VCI A;  1E1O A;  2PW7 A;  4WJ3 M;  2EYJ A;  3VYS A;  1TT2 A;  1UWV A;  1K3R A;  2F0L A;  2JP1 A;  4QIW E;  2YTX A;  1Z7T A;  2WP8 J;  3WWV A;  2ZTC A;  4KTA A;  2RF4 A;  1G2S A;  3UE0 A;  1SFO B;  4IOC A;  4A3C H;  3R93 A;  5JAV A;  1IKL A;  3STB C;  3BDO A;  2E2I H;  3SK5 A;  1EUJ A;  1KDB A;  1BVS A;  3OHX C;  1S3O A;  4QJF A;  4A76 A;  4X65 Q;  4ID6 A;  5IYB H;  3GTP H;  1TWH B;  3BYT B;  3LGJ A;  4IUP A;  3GTO H;  1R4Q B;  5C44 H;  4A3K H;  1IZ6 A;  1E3P A;  3SHL A;  4R4O A;  3T51 B;  4HJ9 A;  1Q3L A;  3TDQ A;  2AWN A;  3NBH B;  3PUY A;  1SRU A;  4JC0 A;  3JAM E;  1QCB D;  1I5F A;  1LT4 D;  2J4X A;  1A2U A;  3E3X A;  3M4O H;  4KMU C;  1XPR A;  4L63 B;  3I4M G;  1I94 L;  2B63 B;  4UPA A;  3R2I A;  2LXJ A;  2HIX A;  2L12 A;  1S5E D;  1F9R A;  5GQO A;  3HP3 A;  4LFA Q;  1Y8N B;  3NQT A;  4RGT A;  4NXN L;  2MQH A;  3VR3 A;  4RKB A;  4RG1 A;  3BU2 A;  2K1B A;  1AP0 A;  1G2T A;  2IHE A;  3U50 C;  4CGY B;  2ID0 A;  4O2D A;  2XWJ B;  1DJR D;  2OF1 A;  2OWO A;  3MAQ A;  4WOR A;  3IAY A;  2Z6K C;  3UE1 A;  1ICW A;  1TQO A;  4JI4 Q;  2F0S A;  1HJP A;  2OT2 A;  1EIH A;  3GTG H;  1GUT A;  3RD4 A;  5BN4 A;  5DLQ E;  5CMD A;  4LF7 Q;  1ET9 A;  3VR6 A;  3K5M A;  2HT1 A;  4FP5 D;  1QOH A;  2I5H A;  1A3V A;  4GOP B;  2ATW A;  4BA2 I;  1OO9 B;  5IP7 G;  3FPU B;  2D2C C;  4KKS A;  5IE8 A;  2Z1C A;  1CTM A;  1AZP A;  3I3C A;  3ND9 A;  4PV1 C;  1YIT A;  1HNZ Q;  3S15 B;  3NPP A;  3QR8 A;  4YWM A;  2H1E A;  3HOV B;  4FNF A;  4DV3 Q;  4ABN A;  1QWY A;  3FMC A;  4BY1 G;  4F88 A;  1SND A;  1YJ9 A;  1S5D D;  5M5X H;  2CQA A;  3RNU A;  4A93 B;  5C4J B;  3R8B A;  3KF8 A;  2R6G A;  4C3H H;  2F0M A;  5JJZ A;  4GN4 B;  2EZV A;  2CH4 A;  1D7Q A;  3AMU A;  4DR7 Q;  1PRT F;  2PI2 A;  1N32 Q;  4B9X A;  5C3E G;  3I4L A;  3RN2 A;  2EVB A;  1N33 L;  4DA2 A;  2LS0 1;  5ELN A;  5J3B A;  3JC6 6;  1NMG A;  1DON A;  2R7F A;  2ENB A;  1WTH A;  1PLF A;  5EKK A;  2JK8 A;  3RLO A;  2F0U A;  3CCM A;  1OTC A;  1VQK A;  1TR5 A;  1WCM H;  1K83 B;  4KHP L;  3HOZ H;  1HNW Q;  3GTJ B;  2K6A A;  3BVM A;  5K36 G;  1SE8 A;  1Y69 U;  3TP5 A;  5EKI A;  2L15 A;  3S1Q H;  1YJW A;  2GVB A;  1IW7 C;  3J81 j;  3OW7 A;  2VZA A;  1JCK B;  1L1O A;  1XX8 A;  4KN4 C;  4BBS G;  4HJA A;  1JOK A;  2JE6 I;  4NP5 A;  1V8Q A;  2M00 A;  4BBR H;  1SR3 A;  1Q8I A;  4A3I G;  2IPK D;  3QB3 A;  5HY6 A;  3PO2 B;  1ZKO A;  3V2T A;  2ICI A;  4R9W A;  5ELO A;  1ILP A;  2LFN A;  5EPK A;  5C0X I;  4PMB A;  4DR1 L;  4G57 A;  5C5L A;  1STY A;  3VYR A;  4L8J A;  3CF5 A;  4GKK Q;  5ELD A;  4K2K A;  2NVQ B;  2DNE A;  3QOJ A;  1SMX A;  4JK1 C;  4N8X 1;  1GM5 A;  4GLX A;  1Q86 C;  1J8I A;  1II3 A;  1JOR A;  1E24 A;  4TKO B;  2F0G A;  2QIL A;  1D5Z C;  2JA9 A;  3NWT A;  1HQR D;  1SFO H;  3D4W A;  3I72 A;  4YCV A;  1X3P A;  3EN2 A;  3NSW A;  5M3F G;  2MO1 A;  2JQO A;  4C3I B;  2LSS A;  4RFB A;  2JA5 G;  1XMQ Q;  3ICE A;  1JQY D;  2FHT A;  1TVX A;  4PMW A;  1QG7 A;  4DNT B;  1WI5 A;  1SMY D;  2JA7 G;  2E2J B;  1LTS D;  5EPL A;  1RTN A;  4H0L C;  5EGT A;  1B9N A;  3A56 A;  5DM7 3;  4LFC L;  2Q2U A;  2NN6 I;  1GJX A;  4RGM A;  2NZO A;  1FVI A;  4HJ8 A;  1L2F A;  1WTQ A;  5LL6 X;  2EJF C;  5HGT A;  4JBM A;  4IPC A;  3I7F A;  3UDF A;  1JT8 A;  4DFA A;  1LAC A;  1O7I A;  1A15 A;  5IWA L;  4C3J G;  3H0G B;  4JVZ A;  4OO1 H;  3ER0 A;  1A8V A;  3SEB A;  3L3O C;  5CBE E;  3OTO Q;  3A0J A;  3DEO A;  3I4N B;  1N8R C;  1S5C D;  1LLR D;  4EVO A;  5FO8 B;  1KIX A;  1I6V C;  1EY8 A;  2ZXR A;  1YBY A;  2A6H D;  3CCQ A;  2IY5 B;  4EGV A;  2MNA A;  2ZTD A;  3WOE A;  5KYL A;  3FKI B;  1EYA A;  1PHJ A;  2UU9 L;  5C0X J;  4B3S L;  1SXT A;  1CZW A;  1PH1 A;  4DV1 Q;  3NUC A;  3QO2 A;  3Q8D A;  1QVG A;  2BCO A;  3KF6 B;  4DV6 Q;  1WTR A;  2B2V C;  2NZ1 D;  4KY5 A;  4ZYS A;  2B29 A;  1DZ1 A;  1AE2 A;  1MJC A;  4BXX H;  4HTH A;  1O80 A;  5FO9 B;  3DWP A;  4YY3 Q;  5C0X G;  3LWU A;  3BZD B;  2PMZ E;  5IGD A;  2A6E D;  4MHE A;  4JI1 Q;  1ILQ A;  4YCW A;  1SEB D;  1WJJ A;  3OWF A;  2DN8 A;  2F4V Q;  1IBM L;  1WD0 A;  1KTK A;  2K04 A;  2RCN A;  3S15 H;  4R4C A;  4JPB W;  1VQE A;  1N34 Q;  4AYB B;  4LF9 Q;  2PI2 E;  1SN8 A;  1N36 Q;  2IL8 A;  2HDM A;  3HOX H;  2PYK A;  1FJG Q;  4XT1 B;  2D5D A;  4L6T B;  4A93 H;  5C4J H;  4JW0 A;  1PVO A;  3K7U C;  4KV6 A;  3VR5 A;  1ASY A;  3C1F A;  1C0A A;  3J7A V;  2D0O A;  1U5K A;  3S16 B;  3PMF A;  1U4L A;  1NY4 A;  4MTK A;  1BNZ A;  4K14 A;  1K8A C;  1XMO Q;  3BZC A;  1VQP A;  4FXK C;  4DK1 A;  2F03 A;  3LWE A;  4LF6 L;  1CFM A;  3T56 B;  2CW0 D;  3PO3 H;  2NN6 G;  2WB1 B;  4H44 C;  1I6H B;  1H95 A;  2IX0 A;  3CQZ B;  3HG9 A;  4UP7 A;  4F8M A;  4DAY A;  1MGS A;  1PH7 A;  4JCV E;  2RDG A;  2KCC A;  3HGB A;  2FXQ A;  1J5E L;  1NNX A;  3KLW A;  4IFD H;  4GLV B;  2KHS A;  3F2U A;  3GTJ H;  4A3M B;  4DR3 Q;  4IQZ A;  5ELC A;  4AYB E;  2NUC A;  4WRD A;  5M3M H;  3CCE A;  1X65 A;  4IUQ A;  1WOC A;  1YIJ A;  3A5U A;  3MA2 B;  3CCV A;  2MHV A;  3PO2 H;  2QDB A;  3NTI A;  1YHA A;  3H94 A;  1G6Z A;  4YCU A;  3SE0 A;  3JAM i;  2FMM A;  4G7H C;  4LWC A;  4XQJ A;  4DUZ Q;  2R3Z A;  2WAQ B;  3E6Z X;  1NE3 A;  5AJ3 Q;  2X6G A;  4KN7 C;  1PH5 A;  1X54 A;  3RMH A;  1QVC A;  1RCV D;  4KI0 A;  2GVA A;  1VQJ A;  2NB0 A;  2NBF A;  3J81 L;  1VQA A;  2VUM B;  4DR2 Q;  1ESR A;  2QGQ A;  1WTO A;  4Q0F A;  1T5E A;  1X3E A;  2JEA I;  1UEA B;  1N9W A;  4ZAI A;  1AZQ A;  4JG2 A;  2FIN B;  3PIP 3;  1BXT A;  1SNP A;  1VQD A;  2JSO A;  1CA6 A;  1H9R A;  5IY0 A;  1UE1 A;  1LTG D;  1SSO A;  1EIG A;  3NEL A;  3U4Z A;  4XIG S;  3MXN A;  2HD3 A;  1EQT A;  1PXU A;  1UE5 A;  4M8A A;  3BZK A;  1BOS A;  2Q8R E;  1UE6 A;  4LW1 A;  4DKA C;  4DV4 Q;  1ICF B;  4GNX B;  5EBC A;  3S1R H;  3C3L A;  3UDG A;  2B2T A;  1SDF A;  4LUZ A;  2UXB L;  2EYH A;  4U67 3;  4F87 A;  2WAQ E;  1K9M C;  1TWA H;  2B8G A;  1EIY B;  3EA6 A;  2Y0S B;  3D0F A;  4KK7 A;  4A3J G;  3H0G H;  1EU4 A;  1H9S A;  3NK9 A;  3L2P A;  1VQN A;  4DGZ A;  5C4Z A;  2UXD Q;  3I4N H;  1EU3 A;  2QEX A;  1EFW A;  4DU9 A;  1PTO D;  4OWW B;  5KIX A;  3ITP A;  1U0L A;  1Z9F A;  3O13 A;  4IUU A;  1EIF A;  2RCF A;  1HFN A;  2JN4 A;  1D8L A;  2B2U C;  1VS0 A;  2B2Y C;  3P20 A;  1M8A A;  2WKD A;  3FKI H;  3KLS X;  1G91 A;  3TP7 A;  4A3G H;  2CFM A;  4Q5V A;  2F0P A;  4K8J A;  2WV6 D;  2K33 A;  1QVF A;  2YTY A;  2EYO A;  2FFK B;  3ZYY X;  1YNJ C;  1VQO A;  3H3V H;  4GKJ L;  1JWU D;  2E5L Q;  1LTL A;  1Y14 B;  2WIN B;  2SEB D;  4PZ6 A;  2E2H B;  2Q8T A;  3M7N A;  2CVR A;  1YNN C;  3L9A X;  4XTC S;  1VQ9 A;  1Q1E A;  3DHQ A;  3K0X A;  3J81 E;  1MSG A;  1PA6 A;  2BE5 C;  1VQM A;  2Y0S E;  5C5M A;  1AW7 A;  4RH6 A;  1ROD A;  1WVL A;  1UAP A;  3ULJ A;  5KEE A;  1IBL L;  5JJK A;  4JI6 L;  3KDF A;  3CC7 A;  5I2Y A;  4G7O C;  4B3R Q;  4CDE C;  3HOU H;  1VF5 C;  3TME A;  5COY A;  5FLM H;  1HNX L;  4A3C G;  1PYB A;  4OX9 L;  4OWT B;  3MXP A;  4JYA L;  1VMC A;  4JI8 Q;  4LJZ C;  3AB9 A;  1F9P A;  5JVH 3;  2X69 A;  1LT5 D;  1QUQ B;  3K5O A;  4C1N I;  5FLX L;  1E7Z A;  4OXP A;  1ZYR C;  4JBK A;  1B4O A;  4A3E B;  2AQ3 B;  4UAI A;  1CHQ D;  2I46 A;  1HTP A;  2B2W A;  4L5T A;  1S5F D;  4DXG A;  2X6L A;  5IYD H;  5IT9 c;  4KY6 A;  4C56 C;  1I6H H;  2NYZ D;  3CQZ H;  4EQ5 A;  1L0W A;  3X3N A;  4JI0 Q;  3FHW A;  3SDZ A;  3MZ5 A;  3T13 A;  3S2D H;  4ZQ3 A;  2JA8 B;  1PTO B;  5G3L D;  1PH8 A;  2F0D A;  4JI7 L;  3VDY A;  4DN4 M;  2R7Z H;  4CDC C;  1Z47 A;  2QEJ C;  4FYD A;  2R93 B;  1J6Q A;  2G9H D;  1VQB A;  4OHJ A;  3KLS A;  4LFB Q;  3H15 A;  1J9O A;  4G7Z C;  5JEA H;  4B3T L;  1IBK L;  4FVM A;  4A3D B;  4QIW B;  3IFD A;  3OSO A;  1CKN A;  2AQ2 B;  2AQ1 B;  4X64 Q;  3MTS A;  1GUS A;  1I3Q H;  1E2W A;  2V1C C;  2N88 A;  3BDC A;  3T1H L;  1EYG A;  4EX5 A;  4S3S A;  4HR7 B;  4TVA B;  4POG A;  1TWC B;  4XQQ A;  5C4X G;  5EQ0 A;  4DV5 Q;  1JWM D;  1NAP A;  3EVQ A;  1PRT C;  1AFP A;  1XTD A;  1VQH A;  2YTV A;  2VUM H;  4POF A;  2EQS A;  2K50 A;  3TS0 A;  5BN3 A;  2RSO A;  5FLX E;  1Y1W G;  1SNO A;  3C1E A;  1STN A;  2K5W A;  5JJL A;  1A63 A;  2KQ3 A;  1B1Z A;  4DAM A;  4DV2 L;  5C3W A;  4HIM A;  2DJG C;  3A55 A;  1VQ6 A;  5I4D A;  3DXJ C;  2Z6K A;  3M3Y B;  4K5W A;  5GRO A;  1PV4 A;  1AH9 A;  2R92 H;  1Q81 C;  4C3H G;  1V1Q A;  1H9K A;  2ES2 A;  1XMQ L;  2N55 A;  3I4M B;  1O7Z A;  1HPC A;  1LAB A;  4K0K Q;  1BCP D;  3PUZ A;  4DAP A;  3GTQ B;  3J7A 5;  1KAA A;  4DNI A;  1CK1 A;  3G4S A;  3PIP A;  3I91 A;  2RA4 A;  1JIC A;  1XNQ Q;  1EEI D;  1F9S A;  2A69 C;  5FJ8 H;  4PQX A;  5M5W B;  4QUF A;  2VQE L;  3RZD B;  4LF8 Q;  1JR0 D;  2DY7 A;  2A1A A;  3J80 L;  1WCM G;  3BVG A;  4ODG A;  4TQU S;  3J80 c;  3HOZ G;  1TS2 A;  4HAE A;  2EIF A;  4CKC A;  4UY8 C;  2N49 A;  1EOV A;  2XRQ D;  2AMC B;  4RCO A;  5I9P A;  3T1Y Q;  2K14 A;  2VB3 X;  2JEB I;  3ONA B;  1W6J A;  2CWP A;  2K05 A;  4ALP A;  1GOZ A;  1X3Q A;  1C4Q A;  1K3B C;  1RD9 D;  2PQA B;  1G6P A;  4H13 C;  4QMG A;  3QG1 A;  1G8Z D;  3SK8 A;  4ZUJ A;  2G5D A;  1CM9 A;  4X3S A;  2E2H H;  1B44 D;  1BUV T;  3PGZ A;  3A8K E;  4PNY A;  2UUC Q;  3ULP A;  4L5S A;  1FGU A;  1PTO F;  4BY7 G;  5IOD A;  2XRS D;  5A2Q L;  2O5I C;  3HOW H;  1K28 A;  2EY2 A;  4FXD A;  1KC8 C;  1HH2 P;  2RHS B;  4GOP C;  2PW5 A;  5CV4 A;  5C3E B;  4CBV A;  2D0P A;  1KHI A;  4OIK A;  1CUK A;  2M9V A;  4N8F A;  3ERQ A;  1V1O A;  4I7A A;  2RKS A;  3NQI A;  4FF1 A;  4IZ8 A;  5J1Z A;  4A3E H;  3M9B A;  4O1N A;  3DLL A;  3BDL A;  2K5N A;  1PH3 A;  2PNR C;  3CAM A;  4QF4 A;  2K5D A;  3GTK H;  3E0J A;  2Q2H A;  2B3G A;  5CV5 A;  5KNB A;  1LTB D;  2UXC L;  1T5X D;  5CV7 A;  1I4X A;  3CRK C;  4X3U A;  4XDX A;  2OTL A;  3J80 E;  5BR8 Q;  4BBS B;  4JOI A;  1CKM A;  2V4D A;  4LMQ D;  1TS5 A;  3K5N A;  4IFD I;  2JA8 H;  2F0W A;  4DV7 Q;  1PTO H;  2F0J A;  4A3I B;  1LV9 A;  4JI2 Q;  4J8Q A;  3RLF A;  3TS2 A;  2K4K A;  1GKH A;  2R93 H;  4H02 A;  3M4P A;  2C9O A;  2K5V A;  3Q22 A;  3HZX A;  5LMN Q;  5NUC A;  1Y8P B;  3PUW A;  4O0A A;  4B3M L;  3K8A A;  5IIF A;  3DUZ A;  3S17 H;  4A3D H;  1FYC A;  2H4O A;  4DR6 Q;  5M3F B;  3OMC A;  1RTO A;  2KEE A;  3HKS A;  3NHH A;  1TU2 B;  1EWH A;  2A68 D;  5T1I A;  5A2Q E;  1DOM A;  2JA5 B;  4BXX G;  2PNH A;  5JJI A;  1STA A;  5G3L F;  1PH6 A;  1TWC H;  2JA7 B;  1MKH A;  4ZKC B;  1D1I A;  4CDF C;  2O5J C;  1SNC A;  3GV6 A;  2JA6 H;  2JYO A;  4DV0 L;  1JOO A;  2R61 A;  5KYI A;  2MP1 A;  4JI3 Q;  1NCV A;  2B2V A;  2QW7 A;  1GHJ A;  2F0F A;  2QKI C;  3EQL C;  2F0E A;  4RHR A;  3HOX G;  4C3J B;  2CCZ A;  4DF7 A;  3J81 i;  1GUG A;  3M3Y H;  1DD2 A;  4GLA C;  1GUW A;  4A3B G;  4MN3 A;  1XNR Q;  2DGY A;  3A8J E;  1P8L A;  4B9W A;  4IFD J;  1S40 A;  3W3A A;  4LF4 Q;  2F3V A;  1PZK D;  3GTQ H;  5LMU L;  4DUY Q;  4LF5 Q;  4ILW A;  4YIJ A;  4K5V A;  2MUY A;  1A2T A;  3PO3 G;  4Z9C B;  3NWS A;  4HMJ A;  5M5W H;  1TWH H;  3RZD H;  4JV5 L;  4MIU A;  1JJC B;  2NVY B;  1B70 B;  2ZT9 C;  4X62 Q;  2EOT A;  4IFD G;  3VR2 A;  1X3F A;  1STB A;  3AQQ A;  4P2C B;  3R3O A;  1LUZ A;  3GDE A;  2YV5 A;  2ZTE A;  2Z4H A;  2UUB L;  3VYT A;  5M3M G;  4XYQ A;  1W2B A;  4C1N K;  2PMZ B;  1CSP A;  5GAE C;  2E75 C;  4PZ7 A;  1BCP F;  3BVZ A;  2ZJP A;  3KF8 B;  3J7Z C;  4KY7 A;  3RLN A;  5C4H A;  1HZC A;  2XNA C;  3NP8 A;  3R2T A;  4X66 L;  2B63 H;  1RDP D;  1XJV A;  5CR3 A;  3H3V C;  1IYV A;  3QWN A;  2VB2 X;  1HCZ A;  3PF4 A;  1JB3 A;  3M85 A;  3Q23 A;  3C2P A;  2SNM A;  3Q6S A;  2HHH L;  2HIV A;  4P73 A;  1BF4 A;  1C7Y A;  3OIP A;  4FF3 A;  1ESF A;  5IGG A;  3G48 A;  1PFB A;  1SE3 A;  2QCP X;  4X3K A;  4NXM L;  1NR4 A;  5IP9 G;  2CWA A;  1NMF A;  1WD1 A;  3FP9 A;  1UUP A;  3TZU A;  1CA5 A;  3HOY G;  5E4W C;  1I94 Q;  2NVT B;  4HED A;  4HCS A;  1L1O B;  3H09 A;  3CMA A;  1SMY C;  4DK0 A;  4RGN A;  4NXN Q;  3F2B A;  1EY6 A;  2B39 A;  3NEN A;  1NUC A;  1K73 C;  3CCR A;  2UUA L;  3HOV H;  1TWF B;  3GTL B;  1EWI A;  1QNU A;  1NJI C;  1CT1 D;  1IYU A;  4GN5 A;  3VR4 A;  3M4Q A;  1QZH A;  2HUG A;  4ULL A;  1AEX A;  4HJ7 A;  3MVV A;  3K0Y A;  2KJX A;  1OXU A;  3I4N G;  1Y1V G;  2DUD A;  1KRS A;  1S4Z A;  2EY5 A;  2I07 B;  1XTC D;  1SRO A;  2ZM6 L;  4L5R C;  2I5L X;  2A6H C;  3DM1 A;  1XWE A;  1LTA D;  4A3G G;  1JOQ A;  3AU7 A;  1SAP A;  4A75 A;  1K0R A;  1KRT A;  1CQF A;  2O2L D;  1K83 H;  5EJW A;  1FGB D;  3U9S A;  3CD6 A;  2VNU D;  1TY2 A;  2E8G A;  3I4O A;  4B08 A;  3OW2 A;  3DWQ A;  1M4V A;  2LKV A;  2F1M A;  4QCL A;  4Y7N B;  1X55 A;  3B6Y A;  2JA7 H;  2K28 A;  2MPM A;  2RDH A;  4EQO A;  1N33 Q;  2VQF L;  4OEM B;  2IJ0 A;  2MJ8 A;  1V1P A;  2B2U A;  2A6E C;  1MI2 A;  1PMR A;  3TP8 A;  1WFQ A;  3TZD A;  1A3T A;  5IYC G;  3HOU G;  2Z9H A;  3K81 C;  1IHZ A;  1LM0 A;  4AQY Q;  5FLM G;  4KHP Q;  2WAC A;  3FVQ A;  2EXZ A;  2AUJ D;  5JOB A;  1KLG D;  5L37 A;  2D62 A;  2NVQ H;  1SYB A;  2XIW A;  4XQN A;  3QIA A;  2F0Q A;  4A3J B;  1C48 A;  4YHH L;  4KHZ A;  3DWA A;  3SXH A;  2OXP A;  3F8T A;  3ERS X;  2RDF A;  2L1B A;  1HR0 L;  2KED A;  3K5L A;  1MBY A;  2AKW B;  1DOL A;  2PQE A;  1JC7 A;  3OOC A;  3GQB A;  1HA6 A;  4C3I H;  5JPN C;  3I70 A;  3LNN A;  3LX0 A;  3N6R A;  1FNW A;  1TY0 A;  2F3W A;  3S1M B;  1Y8O B;  5IYD G;  3S14 B;  4GNX C;  4DR1 Q;  2H5X A;  2CW0 C;  5HGQ A;  2E2J H;  5JEA J;  2NVY H;  2PO4 A;  3M4Y A;  1V9P A;  3QJY A;  4HN7 A;  4IN3 A;  5CYU A;  1D1K A;  2R7Z G;  4ZLT F;  2IT1 A;  2K75 A;  4X65 L;  2K32 A;  2ZXO A;  5BN5 A;  5C0X H;  1VQ7 A;  1MD2 D;  1VF7 A;  3T16 A;  3CCU A;  4TRD A;  2KUM A;  1TKW B;  1EY0 A;  5EAY A;  1EL0 A;  3CRL C;  1SE2 A;  2L55 A;  5JEA G;  1XPO A;  5LMN W;  4NMZ A;  3OIQ A;  3T1Y L;  4F7X A;  1LT6 D;  1A62 A;  3I73 A;  1X56 A;  1YEZ A;  4LUV A;  4LFC Q;  1K8M A;  2E2I B;  1SYG A;  1G51 A;  3HFZ B; 
#chains in the Genus database with same CATH homology
 1IL2 A;  1N33 L;  5JJL A;  1A63 A;  5ELN A;  5J3B A;  3JC6 6;  1NMG A;  1SLJ A;  4DAM A;  2R7F A;  4DV2 L;  4BBS H;  4HIM A;  1VQ6 A;  2JK8 A;  3RLO A;  1OXS C;  3CCM A;  2Z6K A;  1OTC A;  5GRO A;  4A3I H;  1VQK A;  4PZ8 A;  3H0G G;  1PV4 A;  1HR0 W;  4DAY B;  1WCM H;  1AH9 A;  2R92 H;  1UE7 A;  3U58 A;  1Q81 C;  4GNX A;  5IWA Q;  3HOZ H;  4KHP L;  1V1Q A;  3A74 A;  2BH8 A;  1HNW Q;  2ES2 A;  1XMQ L;  4A3F G;  5K36 G;  1SE8 A;  4LFA L;  3HKZ E;  1PYS B;  4JI0 L;  4K0K Q;  2L15 A;  3PUZ A;  3HKZ G;  2GN5 A;  1VQG A;  3J7A 5;  3S1Q H;  4DNI A;  1YJW A;  4NB3 A;  3G4S A;  3PIP A;  3FKI G;  2GVB A;  2MFI A;  3J81 j;  1E1T A;  2UXC Q;  3CC2 A;  2VZA A;  2NVT H;  1L1O A;  1XNQ Q;  3RR5 A;  4PG3 A;  5FJ8 H;  1XPU A;  2MO0 A;  4HJA A;  4A3B H;  2JE6 I;  2VQE L;  1YJN A;  2UU9 Q;  4QGU A;  4B3S Q;  4LF8 Q;  4BBR H;  1SR3 A;  3PCO B;  4A3I G;  3KFU A;  5HY6 A;  4JI4 L;  2A1A A;  5M3F H;  1WCM G;  2R92 G;  3KJO A;  1X6O A;  1KXL A;  1RL2 A;  4TQU S;  5ELO A;  3J80 c;  3W1G A;  3AFP A;  4LF7 L;  3HOZ G;  3TS2 A;  5C0X I;  2EIF A;  4LFB L;  4UY8 C;  2JA5 H;  4DR1 L;  2N49 A;  1EOV A;  2AMC B;  1TWF H;  3GTL H;  3T1Y Q;  4IOA A;  2K14 A;  2JJQ A;  3CF5 A;  4GKK Q;  2R93 H;  2F52 A;  1GM5 A;  1SMX A;  2JEB I;  3TRE A;  4GLX A;  1Q86 C;  3CXC A;  4X64 L;  2CWP A;  3BJU A;  4DR5 Q;  4ALP A;  1E24 A;  2CQO A;  3E0E A;  2N8N A;  5IYB G;  4B3M Q;  2JA9 A;  2PQA B;  5FJ8 G;  1HNZ L;  1R9T H;  3S16 H;  1G6P A;  1GVP A;  3I56 A;  1SFO H;  3K7A H;  4IPD A;  2XTI A;  3EN2 A;  4YCV A;  5M3F G;  5C44 G;  4IO9 A;  1T9H A;  2MO1 A;  4DV3 L;  2JQO A;  4A3K G;  2LSS A;  2E2H H;  1X9N A;  1A0I A;  3PGZ A;  4DV5 L;  2JA5 G;  1M1K C;  4AYB G;  1IBM Q;  4BBS G;  2UUC Q;  1XMQ Q;  3ICE A;  2F3I A;  3A5Z B;  1C9O A;  3ULP A;  4L5S A;  1FGU A;  1YVC A;  4C3J H;  1JMC A;  4PMW A;  4BY7 G;  1WI5 A;  1EQR A;  3MXN B;  2JA7 G;  4DR7 L;  3EBE A;  1UEB A;  3HOW H;  3OYY A;  2N3S A;  3RN2 A;  1N32 L;  1KC8 C;  4A3L H;  1HH2 P;  3G6E A;  4LFC L;  2KHJ A;  1VQL A;  3KOJ A;  1Q46 A;  2RHS B;  3D31 A;  4GOP C;  3I55 A;  4A3M H;  2Q2U A;  2NN6 I;  1OXX K;  2KCM A;  2NZO A;  1FVI A;  4HJ8 A;  1L2F A;  4DV0 Q;  2D0P A;  1KHI A;  2YU9 H;  1CUK A;  1QUQ A;  2WB1 E;  4JBM A;  4IPC A;  3I7F A;  4Y7N H;  3PSI A;  3UDF A;  4DR4 L;  2WB1 G;  1JT8 A;  1O7I A;  5IWA L;  1HNW L;  4LF6 Q;  4QQB X;  4A3E H;  3ER0 A;  1A8V A;  3M9B A;  3DLL A;  3OTO Q;  3HOW G;  2K5N A;  3A0J A;  1PH3 A;  4K0K L;  3CAM A;  1DGS A;  2OQK A;  1N8R C;  3J81 c;  3F1Z A;  1IYJ B;  2Z0S A;  3STB D;  2Q2H A;  2B3G A;  3F2D A;  3GTK H;  4A3L G;  2ASB A;  5IP9 H;  1J5E Q;  1KIX A;  2UXC L;  4A3M G;  1YBY A;  1JJ2 A;  3CCQ A;  1XNQ L;  1VQ8 A;  3RZO H;  2MNA A;  2IY5 B;  2ZTD A;  1HZ9 A;  3HOY H;  1PHJ A;  1Q1B A;  4DR5 L;  5C0X J;  2UU9 L;  4B3S L;  4LF8 L;  2OTL A;  3S2H H;  2C35 B;  1PH1 A;  4A3J H;  4DV1 Q;  3PF5 A;  5BR8 Q;  2ZJQ A;  3Q8D A;  1BKB A;  4JOI A;  1QVG A;  1CKM A;  5LMU Q;  3J80 i;  4DV6 Q;  3KF6 B;  4IFD I;  2JA8 H;  4DV7 Q;  4MZ9 A;  4JI2 Q;  2B29 A;  3RLF A;  2K4K A;  3CC4 A;  1AE2 A;  1P16 A;  1GKH A;  2HQL A;  1MJC A;  3M4P A;  4H02 A;  3G71 A;  4BXX H;  4GKK L;  2K5V A;  4JV5 Q;  2KHI A;  2BA1 A;  5E7N A;  3TRZ A;  5LMN Q;  1QZG A;  3PUW A;  4JBW A;  4O0A A;  4YY3 Q;  3JAM c;  5C0X G;  4B3M L;  1ASZ A;  2WAQ G;  1JB7 A;  4YWL A;  4GOP A;  2PMZ E;  3K8A A;  4DK3 C;  1VQ4 A;  4A4I A;  4BA1 I;  1Q7Y C;  4JI1 Q;  2UUB Q;  4YCW A;  1BBW A;  3S17 H;  4Y52 H;  4A3D H;  2Q2I A;  1PH9 A;  1WJJ A;  3UDX A;  2JA8 G;  4DR4 Q;  4DR6 Q;  2F4V Q;  1Y1V H;  3KDF B;  1YZ6 A;  1IBM L;  2UUC L;  2VUM G;  3S1N H;  3HKS A;  2OQ0 A;  2RCN A;  3S15 H;  4R4C A;  1AE3 A;  4BXX G;  1VQE A;  1N34 Q;  4LF9 Q;  2PI2 E;  1SN8 A;  1N36 Q;  1M90 C;  2PNH A;  4QY7 A;  4R4I A;  1YHB A;  5JJI A;  3I2Z A;  3HOX H;  1B8A A;  3GD7 A;  3PUX A;  1PH6 A;  1FJG Q;  1TWC H;  4X62 L;  4X66 Q;  4OO1 I;  2I5M X;  3EIV A;  4J15 A;  1MKH A;  4A93 H;  5C4J H;  3CPW A;  1PVO A;  3K7U C;  4GS3 A;  2BH2 A;  5GAD C;  1RIP A;  5M5Y H;  1G29 1;  1MJE A;  1ASY A;  1C0A A;  2D0O A;  3GO5 A;  2JA6 H;  1U5K A;  4A3D G;  4DV0 L;  1NY4 A;  4IJH A;  1HZB A;  2HHH Q;  1K8A C;  1XMO Q;  3BZC A;  4JI3 Q;  1CSQ A;  1VQP A;  1H95 A;  4LF6 L;  4HIO A;  3PIO A;  3PO3 H;  2NN6 G;  3PUV A;  1Q82 C;  2ZJR A;  1FL0 A;  2IX0 A;  3OTO L;  3HOX G;  1I50 H;  4AH6 A;  1PH4 A;  4NXM Q;  2Y0S G;  2CCZ A;  4UP7 A;  3J81 i;  2UXB Q;  3M3Y H;  1PFS A;  4HIK A;  4JCV E;  4GLA C;  1PH7 A;  2FXQ A;  4A3B G;  1J5E L;  1XNR Q;  1OXT A;  3KLW A;  2YYZ A;  1YHQ A;  2DGY A;  4BBR G;  1P8L A;  1VQI A;  2IHF A;  4GLV B;  3TEH B;  3GTJ H;  5IYC H;  2JA6 G;  4IFD J;  1S40 A;  4LF4 Q;  4DR3 Q;  4IPG A;  4DV1 L;  5BR8 L;  4AYB E;  3GTQ H;  5LMU L;  4DUY Q;  3U4V A;  4DV6 L;  5M3M H;  3RN5 A;  3CCE A;  4DV7 L;  4LF5 Q;  1GO3 E;  1X65 A;  3PO3 G;  1WOC A;  4JI2 L;  2OTJ A;  1YIJ A;  2UUA Q;  4OON A;  5M5W H;  1TWH H;  4GN3 B;  4MTN A;  3RZD H;  4R4T A;  4JV5 L;  5FLX c;  4C2M H;  3A5U A;  1JJC B;  3CCV A;  3PO2 H;  1B70 B;  4X62 Q;  4R4Q A;  5LMN L;  1V43 A;  1TXY A;  1YHA A;  4YCU A;  3CP0 A;  3SGI A;  4IFD G;  3JAM i;  1CKN B;  1BBU A;  4YY3 L;  1X3F A;  3UDI A;  2AHO B;  3AQQ A;  1LUZ A;  4LWC A;  4WJ4 A;  3GDE A;  2N78 A;  2YV5 A;  3E9I A;  2ZTE A;  4JI1 L;  3CW2 C;  4DUZ Q;  2UUB L;  4GKJ Q;  4OWX B;  1OXV A;  5M3M G;  1NE3 A;  1W2B A;  4DR6 L;  5AJ3 Q;  2F4V L;  1TWG H;  1CSP A;  2PQA A;  2ZM6 Q;  5GAE C;  1KL9 A;  1IXR A;  1EQQ A;  1PH5 A;  1X54 A;  2IX1 A;  4PZ7 A;  1QVC A;  4KI0 A;  5H1S E;  2GVA A;  1VQJ A;  2WFW A;  3AYH B;  2ZJP A;  3KF8 B;  4P71 A;  1N34 L;  4LF9 L;  1VQA A;  1N36 L;  4DR2 Q;  4RMF A;  1IBL Q;  4QL5 A;  3J7Z C;  2QGQ A;  3RLN A;  1HZC A;  4JI6 Q;  2VS1 A;  3F2C A;  1FJG L;  1VQC A;  1X3E A;  2JEA I;  1N9W A;  1LYL A;  4X66 L;  4JG2 A;  3IRB A;  3W5O A;  1XJV A;  2B63 H;  4YWK A;  2I0Q A;  1VQD A;  2EXD A;  5IY0 A;  1JE5 A;  3K80 C;  1UE1 A;  4LUO A;  4JBJ A;  4P75 A;  3PF4 A;  5C4X H;  3NEL A;  3U4Z A;  1HNX Q;  4XIG S;  4OX9 Q;  1HZA A;  2LXK A;  3M85 A;  4JYA Q;  1KAW A;  1UE5 A;  2HHH L;  2HIV A;  4P73 A;  1C7Y A;  3AEV A;  4UP9 A;  4MNO A;  2XGT A;  1XMO L;  4OO1 G;  4A3E G;  4JI3 L;  3W1B A;  3BZK A;  1E22 A;  1WYD A;  4R1J A;  5GAH C;  1UE6 A;  3G48 A;  4LW1 A;  4DKA C;  4DV4 Q;  4GNX B;  3S1R H;  2VQF Q;  1Y1W H;  1KD1 C;  4IJL A;  4APV A;  3UDG A;  4NXM L;  4LUZ A;  1Q8K A;  5IP9 G;  2UXB L;  3L0O A;  2CWA A;  2B63 G;  3S1M H;  3S14 H;  1NMF A;  2WAQ E;  3FP9 A;  1TWA H;  4IPH A;  1K9M C;  4HID A;  1EIY B;  1XNR L;  3HOY G;  3MEF A;  4P74 A;  1VQ5 A;  1I94 Q;  3D0F A;  4JI5 L;  4A3J G;  3H0G H;  3L7Z C;  3L2P A;  1VQN A;  1L1O B;  4LF4 L;  2K52 A;  3ZJY C;  3CMA A;  4DR3 L;  2UXD Q;  2KCT A;  3I4N H;  4UP8 A;  4A3F H;  2QEX A;  4YHH Q;  1EFW A;  4DUY L;  1X3G A;  4NXN Q;  4OWW B;  2AWO A;  1U0L A;  2ALY B;  3F2B A;  4LF5 L;  1YI2 A;  1Z9F A;  3NEN A;  4L5Q A;  1EIF A;  2CKZ B;  2K5H A;  4NPS A;  1K73 C;  3CCR A;  1D8L A;  1HR0 Q;  2R93 G;  2UUA L;  3HOV H;  1VS0 A;  3FKI H;  2VW9 A;  4JI7 Q;  1EWI A;  1NJI C;  1W3S A;  3ULL A;  4A3G H;  4X6A H;  2CFM A;  4DPG A;  4P72 A;  1VCI A;  3KF6 A;  4GN5 A;  1E1O A;  3M4Q A;  1QZH A;  4WJ3 M;  1QVF A;  1UWV A;  1K3R A;  2YTY A;  4QIW E;  2YTX A;  2WP8 J;  3WWV A;  4HJ7 A;  4AQY L;  1VQO A;  2ZTC A;  3UE0 A;  2RF4 A;  3H3V H;  4GKJ L;  1OXU A;  4IOC A;  4B3T Q;  4DUZ L;  3I4N G;  4A3C H;  2E5L Q;  1Y1V G;  2DUD A;  1IBK Q;  4DK6 C;  1KRS A;  1LTL A;  1Y14 B;  4KLK A;  2A8V A;  1CKO A;  3STB C;  4PZ6 A;  5AJ3 L;  2E2I H;  1SRO A;  1EUJ A;  2ZM6 L;  3M7N A;  4XTC S;  4L5R C;  1VQ9 A;  2I5L X;  1Q1E A;  1JJG A;  3K0X A;  1BVS A;  1PA6 A;  3HOV G;  1VQM A;  2Y0S E;  4A3G G;  1S3O A;  4QJF A;  4A76 A;  4X65 Q;  3ULJ A;  3T1H Q;  4DR2 L;  5IYB H;  3DM3 A;  4A75 A;  1IBL L;  3GTP H;  5JJK A;  1K0R A;  1NBW A;  4JI6 L;  1KRT A;  1K83 H;  2A19 A;  3KDF A;  3LGJ A;  3CC7 A;  1VQF A;  4A93 G;  3CD6 A;  3GTO H;  2E8G A;  2BA0 A;  2VNU D;  5C44 H;  4A3K H;  4B3R Q;  4JI5 Q;  1IZ6 A;  3I4O A;  1S72 A;  3CCL A;  3HOU H;  1E3P A;  3I4M H;  5FLM H;  1HNX L;  2KBN A;  1PYB A;  4A3C G;  4OX9 L;  4R4O A;  3OW2 A;  4OWT B;  4JYA L;  4JI8 Q;  4HJ9 A;  3NEM A;  1B7Y B;  4BY7 H;  1X55 A;  3B6Y A;  1QUQ B;  2AWN A;  2VY3 A;  3NBH B;  3PUY A;  2JA7 H;  1E7Z A;  1SRU A;  3KYH C;  4DV4 L;  4OXP A;  3CPF A;  4JBK A;  1N33 Q;  2VQF L;  4JC0 A;  2R7D A;  4DV2 Q;  1GD7 A;  1I5F A;  4L5T A;  2OCE A;  1WFQ A;  3M4O H;  4JOI C;  1XPR A;  4ME3 A;  5IYC G;  2VL6 A;  3HOU G;  3I4M G;  3K81 C;  1LM0 A;  1I94 L;  4AQY Q;  4UPA A;  5FLM G;  4KHP Q;  5IYD H;  2LXJ A;  2HIX A;  5IT9 c;  4AIM A;  2RHQ B;  2NVQ H;  1I6H H;  5GQO A;  2D62 A;  3CQZ H;  3S24 A;  4EQ5 A;  2QA4 A;  2UXD L;  4LFA Q;  1L0W A;  4JI0 Q;  3GTM H;  3FHW A;  4NXN L;  4YHH L;  2MQH A;  4KHZ A;  4RG1 A;  3BU2 A;  5IP7 H;  3S2D H;  3H3V I;  2IHE A;  3F8T A;  4HJ5 A;  3U50 C;  1PH8 A;  3ERS X;  2ID0 A;  4O2D A;  1HR0 L;  4LNQ A;  4JI7 L;  3VDY A;  2OWO A;  2R7Z H;  2AKW B;  3PO2 G;  2VQE Q;  1Z47 A;  4C3I H;  3KJP A;  1J6Q A;  1Q12 A;  2Z6K C;  3UE1 A;  4JI4 Q;  1VQB A;  1HJP A;  5GAG C;  3GTG H;  4BY1 H;  5IYD G;  1K8G A;  5DLQ E;  4GNX C;  4LF7 Q;  3H15 A;  4LFB Q;  4DR1 Q;  2H5X A;  2HT1 A;  1PH2 A;  3CCS A;  2I5H A;  4B3T L;  5HGQ A;  2E2J H;  2E5L L;  4GOP B;  2ATW A;  5JEA J;  1IBK L;  4BA2 I;  3AFQ A;  2NVY H;  2KEN A;  3TQY A;  2Q2T A;  5IP7 G;  3CME A;  2NVX H;  5IE8 A;  1CKN A;  4X64 Q;  1I3Q H;  1V9P A;  1L1O C;  2R7Z G;  2V1C C;  5C3E H;  1YIT A;  1HNZ Q;  2IT1 A;  2K75 A;  4YWM A;  4X65 L;  3CCJ A;  3T1H L;  1VQ7 A;  4FDB A;  1EYG A;  3CCU A;  1YNX A;  4DV3 Q;  4EX5 A;  4TVA B;  4BY1 G;  4POG A;  3PV0 A;  1YJ9 A;  5C4X G;  5M5X H;  5EAY A;  4DV5 Q;  4B3R L;  3RNU A;  5JEA G;  1XPO A;  1MIU A;  1XTD A;  1VQH A;  5LMN W;  2R6G A;  4C3H H;  2YTV A;  2NZH A;  2VUM H;  4JI8 L;  4POF A;  4GN4 B;  3T1Y L;  2EQS A;  1D7Q A;  1A62 A;  1KQS A;  4DR7 Q;  1X56 A;  2K50 A;  1YEZ A;  3TS0 A;  2PI2 A;  3E9H A;  1N32 Q;  1Y1W G;  4LUV A;  4LFC Q;  1NTG A;  5C3E G;  1G51 A;  3HFZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...