1BR9A

Human tissue inhibitor of metalloproteinase-2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
182
Chain Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase inhibitor
molecule keywords METALLOPROTEINASE-2 INHIBITOR
publication title Three-dimensional structure of human tissue inhibitor of metalloproteinases-2 at 2.1 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 1998-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1br9A02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1br9A01
3HRZC 1BR9A 2XWJB 2E2DC 1PXUA 1JC7A 1UAPA 2TMPA 3G6JB 5FO7B 5FO8B 1JB3A 3CKIB 2XWBB 2WINB 1UEAB 1D2BA 5FOBB 2A73B 2J0TD 3FRPB 2A74C 3CU7A 2ICEC 1XWEA 4FXKC 2B39A 5JPNC 3HS0C 1OO9B 2I07B 3MA2B 3KLSA 5FO9B 3V96A 1BQQT 2WIIB 3OHXC 4ILWA 5JPMC 3L3OC 3I70A 1BUVT 2QKIC 1GXDC 3T4AC 4FXGC
chains in the Genus database with same CATH superfamily
4IFDJ 4A3CH 2JA8H 1IBKL 1PTOH 1W6JA 1YVCA 5J3BA 2SOBA 1CZWA 1J8IA 1N9WA 2KVMA 1GD7A 1AEXA 4FO2A 3TQYA 2F0IA 4JPBW 3ND8A 1EZ8A 2KQ3A 1GUSA 2M00A 3IFDA 1BQQT 2K14A 2PW7A 1PH6A 3ULJA 1XMQL 5M3MG 1KRSA 5I6YA 4C3IB 4OIKA 3KOJA 4A3JB 1PH5A 2VNUD 1A3TA 2PQAB 4JG2A 2ES2A 2EXDA 1LTRD 2R3ZA 5FLXE 4X66Q 1BF4A 3D3RA 3K7AB 2M9VA 5J1ZA 1L2FA 1WFQA 2MO1A 3EROA 3TZUA 3ONAB 5EKLA 2AUKA 1VQDA 4KY7A 5KIXA 2B2TC 4NP5A 1DJRD 5DEHA 1I5FA 5EAYA 1WOCA 4A3JH 2VUMB 4JVZA 2AUJD 1SNCA 3RLOA 4KHPL 1PTOF 4DV2L 3NBIA 4LF5Q 1IL2A 4CKBA 1PMRA 3K7AH 2LSSA 1P8LA 2R93G 1AE2A 1IBML 2Q8RE 4AIMA 1TQOA 3P20A 4DAVA 1E2VA 1WTXA 1HNXL 4QIWE 1PFNA 1SFOB 1Y8NB 3NENA 4R8NA 2VUMH 3S2DH 1F2ZA 4DNRB 4B3ML 3S1RB 3J80c 3J81c 4ME5A 2VQEL 4GOPA 5D65A 5LMNL 4NW2A 2ZXOA 4C56C 3RR5A 3S9WA 1IKLA 1Q3LA 2ATWA 3I2ZA 4JI6L 1HHVA 2F52A 4GLAC 3EIVA 1BBXC 2PI2E 1AZQA 1SFOH 1KDBA 3GP7A 5HGQA 3U9SA 2X6GA 3S1RH 4J15A 5M3MB 3PSIA 2E2IB 2K04A 2ZXPA 3NBHB 4BBRG 1Y8PB 5FLMG 1GUOA 4DV6L 5IP7G 2A68D 1STHA 2YTVA 2MP1A 4BY7G 1NSNS 4DR5Q 1UAPA 4KKSA 3HOVG 2ALYB 1PH7A 3WOFA 5C3WA 2FXQA 3BVZA 4QB4A 1CSPA 3UDFA 2KEEA 5M3MH 1HXYD 4KD3A 2E2IH 3AEVA 4O42A 1SE4A 1M1KC 4LFAL 5CV7A 5JEAH 5CV9A 1MJEA 4JI2L 4PV1C 4DR6L 3A74A 3FEWX 3VYTA 3R3OA 1JOOA 4L5SA 4POGA 1B2TA 4RHRA 1GUTA 1O80A 3Q22A 1CUKA 4P74A 2UXBQ 1I4GA 5M9OA 3DXJC 3GQBA 3GTJH 3CP0A 2MGSA 1J6QA 3CXCA 3MTSA 3PO3G 1S4ZA 3URYA 4FDBA 1YNXA 3TS0A 1G2SA 5CBEE 3W1GA 2O5JC 2R93H 1MJCA 2EZVA 1QUQA 3N52A 4OX9Q 1F2LA 1V1OA 4XQJA 4JI0L 2ZTDA 2ZM6L 1MSHA 3H3VH 1H9MA 3H09A 3IFTA 4JI7L 4LAAA 4GNXA 2J0TD 4RG1A 5A2QE 3LNNA 4H7BA 4BBRB 5AJ3L 2NN6G 1WD0A 3HEJA 4R4OA 4BA2I 4LF6L 2IT1A 2RQXA 3VDYA 1KIXA 2JQOA 4JYAQ 4GN5A 4L8JA 1PTOC 1NTGA 4F8MA 4LK1C 3CCLA 1OTCA 4BBRH 5FLMH 2IX1A 1JJ2A 3C1EA 1H9RA 5ELOA 4XT1B 3S2HB 4RH6A 3GO5A 3K5OA 4CJ2C 5IP7H 4YHHL 3J80i 3J81i 1UWVA 1TWFB 3A8KE 5GADC 4NXNL 2HHHQ 1EIGA 1I3QB 4BY7H 1SSOA 4Z9CB 1X32A 1V1PA 4I65A 1CKMA 2LMCB 2RA4A 2JA7B 4P73A 2E2JB 3MFYA 3D4WA 2RSOA 1D5ZC 4DGZA 2YYZA 3I4NG 1SYGA 2JEAI 1GVPA 4POFA 3GTMB 2JK8A 2L5TA 1BBUA 3PO3B 1RDPD 3S2HH 5H1SE 1BOSA 1L1OC 2F0HA 2SNMA 3NQIA 2KCTA 1TWFH 3L2PA 1XMOQ 4JW0A 1I3QH 1KRTA 1YJWA 3JAMc 4DK6C 1QZHA 5FKAC 4P75A 2JA7H 1OXTA 1Z47A 3V05A 1PTOD 4B3TQ 3DM1A 3T1YL 2YV5A 2L9HA 3D31A 4N9PA 3X3MA 4HIKA 5CV8A 2ICIA 2C5CA 3PO3H 2K7VA 4ZK9B 3PO2B 5CV5A 1SROA 2GN5A 3GV3A 3OMCA 3J7A5 3RN5A 3K57A 2N49A 3K7UC 4DV1Q 1SYCA 1SAPA 1RIPA 5DAUA 3ULPA 3K0YA 2RBMA 3VR5A 4H44C 3B6YA 5J39A 2ENBA 3FP9A 1U4MA 2NVTB 1FL0A 3PO2H 2CQOA 2EDGA 1VQLA 5KYIA 1XYIA 4LUOA 3F2CA 3NUCA 2NN6H 2AWOA 2MFIA 1U4PA 1BO0A 1K0RA 2CH4A 1AW7A 2OXPA 3KF6A 3HOZG 5IT9E 2K1BA 4X66L 1FJGQ 4GLVB 1E24A 4DNTB 1E2WA 1KDCA 1A3UA 1LT3D 4A3MB 1VQFA 1K8GA 3ND9A 1Q12A 2B2VC 1Q81C 3OWEB 2KCNA 5LHY1 3RZOB 2LXJA 5L37A 1Z7TA 3OPOA 1PXUA 2F1MA 2WACA 3Q8DA 4MZ9A 1EY6A 1PFSA 2PZTA 4DXGA 4LF5L 1KD1C 1X56A 1KLGD 2L55A 5HURA 4J1MA 4R9WA 2JE6I 3E9HA 4A3MH 3VYSA 1QZGA 1BDOA 4IUTA 4DV7Q 3I4NH 4XTCS 5IGCA 3E0JA 4QL5A 1EY7A 5COYA 1LV9A 4LMQD 3RZOH 4U673 4OONA 1YI2A 4MHEA 1F2MA 4HCSA 2QDBA 3H3VI 3FKIG 4A76A 2AKWB 4QCLA 2IY5B 1R9TB 3S17H 1QB5D 2MHVA 1CI3M 2JXMB 4Y52H 2NUCA 5I6WA 1RL2A 3M4PA 4LUVA 1O7ZA 4QIWB 3GTOB 1UUPA 2B63G 3T53B 4LFBQ 3R2TA 1Y1WB 5D3DA 4CGYB 3BU2A 3CMEA 3I7FA 1OO9B 1EY8A 2EYLA 2E74C 1GOZA 1X65A 2F0NA 3JC66 3SVMA 3BVGA 3MXUA 2IX3A 1JE5A 2QKIC 4BS9A 2OTJA 1EY4A 3T51B 1WVLA 1XPOA 3GTOH 3H3VC 1Q7YC 1LTSD 4UPAA 3HOZB 3JAMi 4FF4A 4GN3B 4DR5L 3SEBA 4G7HC 2Z4IA 4IALA 3CQZB 1PH2A 2F0PA 3NE5B 2EYFA 5KYLA 2Z8LA 1X3QA 2M2LA 4WORA 1HJPA 3VR4A 2DN8A 4PNYA 1TS2A 3QOLA 3CF5A 4IUNA 4KD4A 3AMUA 2WKDA 1VQOA 4H0LC 4K8JA 5F2DA 3HOZH 1JQYD 1PH4A 2BH8A 3TP8A 3V2TA 3J7YW 2J7ZA 1RODA 3CQZH 3J81L 3KF8B 4MTKA 2QEXA 1WD1A 2EYOA 3M4YA 1VQ6A 1SNDA 5A35A 3MEFA 2UXBL 3G7LA 1MHWC 2F0JA 3J7AF 3CPFA 1F9SA 2Z9HA 4DPGA 4A3LG 4ZUIA 3F8TA 4BXXG 1NY4A 3D0FA 1Q1EA 5EBDA 3Q0AA 3IL8A 5E4WC 3I3CA 1LABA 4PZ8A 4DK0A 1KLUD 2E5LQ 4HMIA 4WFN3 3H94A 4WJ4A 4C3JB 4OX9L 1X54A 3CCRA 4QUFA 4JV5Q 1QE6A 4F87A 3G6EA 4QJFA 5DM73 4BY1B 4K5VA 1EL0A 3FKIH 1J5EQ 3S14H 2B29A 1EIHA 4HJ5A 2O2LD 4UP8A 2JA5B 1DCZA 1ET9A 1WTRA 2WV6D 2F0UA 3WWVA 5E4XA 2GVBA 2NN6I 1GUNA 3KLRA 3A8IE 3TREA 1TR5A 4OL7A 3HRZC 2E2DC 3GTPB 4QF4A 4KMUC 4RAUC 2JA5H 4FYDA 4A3IB 2IWHA 4IPHA 3WOEA 2CVRA 3MXNB 4K0KL 1HRJA 3R93A 1VF5C 2EJMA 4B08A 1TY2A 1EWHA 4CHTB 4WJWA 1WTOA 2HHHL 1CQVA 2IHEA 1J9OA 2O4XA 1CSQA 1E2ZA 1Y69U 3GTPH 4C3HB 1Q8IA 2EY2A 2Q8IB 1C7YA 3S15H 3GDEA 3E5SA 1EFWA 1ILQA 2K5NA 1HZCA 3A54A 5KEEA 3C3LA 3NELA 2JP1A 2TSSA 1WI5A 1WTPA 1N34Q 2AQ3B 4C1NI 1XMOL 2DY8A 1CK1A 5G3LF 1ENAA 2EXZA 3SK5A 2BE5C 4LJZC 3BJUA 1EEID 2WP8J 3CC7A 4B3TL 1VQGA 3TBIB 5FJ8G 4EQOA 1LUZA 1PDQA 4EQPA 5CGKA 3MHBA 5FO8B 5FO7B 4A3LH 2EOTA 1A8VA 1N8RC 5FOBB 4CKCA 2F0VA 2BA1A 4N9TA 4BXXH 1DZ1A 5C4JB 1FVIA 4A93B 3K8AA 1VS0A 5BN5A 4DV1L 5IODA 3A7AB 3MAQA 3NWSA 4KK7A 1C48A 2PQAA 4CDEC 1XJVA 1JOKA 2I5MX 5FLXL 5IYDG 1VQHA 4RGNA 5C4JH 1TT2A 1B1ZA 1HUNA 3NSWA 3NTIA 1JOQA 2IHFA 1YIJA 2BE5D 2RDFA 2VY3A 3RUZA 1QWYA 2HDMA 4UAIA 1FJGL 3KLSA 3VR3A 4X6AH 4ZCKA 2K03A 1IZ6A 3H0GB 4HN7A 3OWFA 4CDFC 3NK9A 3BDLA 1JC7A 1S5ED 3DM3A 1EWCA 2QF7A 4DKAC 2IPKD 4A3EG 3GTQB 3UDXA 2EQSA 1VQPA 2B2WC 1UE7A 1I4QA 2F0SA 3CU7A 2D0OA 1LLRD 4DAYB 1A2TA 4HSVA 4RHSA 3PIPA 4DV7L 5C3EG 5JVH3 4JI1Q 1DONA 1VQ4A 5CV6A 1VQIA 1JE4A 3GTQH 1C0AA 2QDLA 1H9SA 5CR3A 2BDOA 2UXDQ 3SK6A 3UE1A 3NBHA 2D2CC 2L0CA 1Q90A 1S5BD 5FJ8H 2HCCA 4DV0Q 1PRTB 4LFBL 2NVYB 3HG9A 2EE1A 1L1OB 3QIAA 4OWXB 1PLFA 3PUZA 4G57A 5JPMC 3CMAA 1KL9A 4IFDG 5EGTA 3I72A 1K0SA 2VS1A 1JB7A 1AFPA 3D4RA 1NR2A 1V43A 4Y7NB 1MBYA 4UP9A 1PFBA 2A74C 1B7YB 1F9RA 4KN4C 2NVYH 2L11A 4ZKCB 3C46A 1EQTA 5JPNC 2GA4B 4L63B 5IYDH 4OEMB 3QB3A 3HKZG 1XTCD 3BYTB 2NVXB 3NPPA 1T9HA 4A3EB 2R92B 4Y7NH 1DXMA 3S2DB 4R4CA 4FF1A 3NXWA 4R8IA 1ESRA 1FNUA 1FNVA 5LL6X 3IKJA 2A68C 5JJKA 1X55A 3DUZA 1A3VA 1TXYA 4HJ9A 2XSCA 3BDOA 1VMCA 2QGQA 1LT6D 4CJ0B 2NVXH 4A3EH 4ZKBB 2R92H 1SYFA 2RF4A 4ILWA 1YBYA 2DJFC 1GUGA 5C0XJ 4G7ZC 5A2QL 1DYQA 3PGZA 1PRTF 1B3AA 2D5DA 5EPLA 1MKHA 1PYBA 1D2BA 5BR8Q 4JI4L 5C3EH 1A63A 2E5LL 4QQBX 1HNZQ 4JV5L 1S3OA 5G3LD 1F9QA 3HOXG 4DXFA 1W6KA 1XNRQ 3MC0B 5EJWA 1TY0A 2EJGC 4DR4Q 2XGTA 4GKJQ 5ISRA 1ML0D 2PZUA 3BG3A 1K3BC 1NCVA 2B2UC 1GJXA 3HOYG 4A3KG 1AE3A 1JWMD 3WDNA 1RTOA 2R7FA 3L9AX 2WAQG 1K73C 1SE3A 2EY6A 4H13C 1B9MA 4RGMA 5JJLA 4IFDH 1E0BA 3OOCA 5I2YA 1EFID 3GTJB 3FMCA 4RA8A 4A3GG 1EWIA 2B8GA 3CCQA 4ZUJA 1IW7C 1PZKD 1QG7A 4IURA 4HJ7A 1X6OA 4LW1A 1DD2A 3KBXA 3J7ZC 4DNIA 1WTQA 2R93B 4XYOA 2DUDA 2FINB 1ZYRC 2B8FA 4DAMA 1TWGB 2CH4W 4R4IA 1HFNA 4C2MB 1ESFA 2JYOA 2L4NA 3M7GA 3RLFA 2L1BA 2Z6KC 2LS01 4BA1I 4WRDA 4GLXA 2N3SA 4O2DA 3IAYA 2E2HH 4HTHA 4OO1I 4G7OC 2DJGC 1X3GA 1N34L 2Q2HA 4TVAB 1EQRA 1TWGH 1AP0A 1DM0B 3FPPA 3KBGA 4C2MH 1G6ZA 1T5EA 4LF9Q 1PYWD 1Q1BA 3OW2A 1MI2A 4PMCA 4K6DA 1NE3A 1EOTA 4ZQ3A 3HOXB 2HIXA 1Q46A 2EYMA 1Q82C 1LM0A 3VA7A 1IW7D 3TEHB 3DEPA 4J8QA 3IRBA 2EY1A 2OQKA 2SDFA 4NKLA 4O0AA 4A3KB 1S5FD 1WCMG 1ZYRD 1SXTA 4BY7B 2KHSA 3RD4A 1PV4A 3HOVB 3DEOA 1B4OA 4AYBG 3HOXH 5IT9L 1EIFA 1F77A 4CDCC 1NNXA 4GOPB 4NMZA 4R1JA 4A3GB 4BBSG 4HJAA 4FF2A 1ZEQX 2ZXRA 1O7LA 3KUPA 5LMNW 3D6CA 4KJOA 3HOYH 4CKEA 1E7ZA 3UI2A 4A3KH 3SR1A 3A0JA 3MA2B 2YTYA 2WKCA 2OT2A 2WIIB 4PMBA 5FLXc 4IO9A 2LFNA 3HOVH 4ZLTF 3K5MA 1QCBD 3OIQA 4OWTB 4DU9A 2NVQB 4HMJA 5GAGC 3CCVA 4A3GH 1SNMA 4KV6A 1PRTC 3NQTA 2KENA 3VYRA 3AFPA 4ZAIA 2IL8A 1F9PA 3DHQA 3J81j 4GZYC 4DR3Q 1LO5D 4QGUA 1N36L 4X3KA 4X64Q 4RCNA 2MNAA 2LY7A 2NVQH 2FJ2A 2QA4A 3FHWA 4EX5A 5ELNA 1T5XD 1UE1A 2R6GA 1PFMA 2UUBQ 3F1ZA 5T1IA 4JI1L 1A15A 1SNOA 5JJIA 5DNFA 1Y14B 2OEOA 1XTDA 3I4LA 5JVG3 4PG3A 4EQ5A 1H95A 3OTOQ 1VF7A 4DF7A 1QJOA 4NB3A 2UXDL 3CAMA 5CC4A 2F0LA 3HGBA 4JOIA 5K5PA 1IXRA 1SBBB 1SJHD 3EQLC 4V0BA 2PQEA 4YWKA 2IJ0A 3OMGA 2H4OA 2CQAA 4DV0L 4JI3Q 5IIFA 4EGVA 3TP7A 1LTAD 1PRTD 3KYHC 5I4DA 4BBSB 4IFDI 2K33A 1PH3A 1HNWQ 1I4XA 2CWPA 2ZT9C 3K59A 3M4OB 2NZOA 1QUQB 4GN4B 3M9BA 3AYHB 4RCOA 3TZDA 2BOSA 3SK4A 1U0LA 1N33Q 4YCUA 1RKNA 2HQEA 4X3TA 2KHJA 2CWAA 3EFXD 1WYDA 2F0MA 3PIO3 3KF8A 3I4NB 4BBSH 1M8AA 2FMMA 3T16A 1SMYC 1ENFA 3M4OH 4IQZA 1HTLD 1RHPA 3S17B 1HQRD 2LKVA 1YITA 2AWNA 3KJPA 3RNUA 2VB2X 4XIGS 4K5XA 1YHQA 5ELDA 5IP9G 1Y1VG 4IOCA 3OYYA 5CYUA 3ULLA 2KCMA 5AFWA 4GKKQ 2XTIA 4JBKA 2B2TA 1YHAA 4UDUC 2XIWA 4TKOB 3I70A 3PUXA 1R4PB 1PH1A 5IYCG 2CFMA 1V1PB 5E7NA 2KECA 4FF3A 2V1CC 4IPGA 1TVXA 4I7AA 4K14A 4PQXA 4UY8C 5EKKA 1KNAA 1K9MC 1I6HB 3SGIA 5BR8L 4FXKC 3H91A 1PZJD 3S16B 1HNZL 4ZRZA 2A8VA 1D8LA 2FHTA 2Q8TA 1SMYD 1I4HA 3CCEA 1XNRL 5C0XI 4L5RC 3I8ZA 4DR4L 1K3RA 4ID6A 3I4MG 4GKJL 4X65Q 2G9DA 4DA2A 1K8OA 3RZDB 1I6HH 4A75A 1TIID 4KLKA 4RGOS 1IBLQ 3HOUG 3HOWG 3S16H 2NYZD 1ASYA 1Y8OB 4DFAA 3GTGB 2RDHA 1UE5A 3R2IA 1SN8A 2I5LX 5GQOA 3GTKB 4R4TA 2A6EC 3M4QA 2AHOB 3BZKA 1ENCA 3RZDH 5IGDA 2RHQB 1EQQA 1IYUA 1G91A 4KI0A 1CZGA 2UUAQ 3CCUA 3GTGH 1LTTD 5C4XG 3E3XA 4A3FG 4K2LA 4DR2Q 3KLSX 3LGJA 2Q2TA 4TQUS 2OF1A 3GTKH 4IZ8A 4U68A 4K8IA 2YU9B 3FKIB 1UEBA 3S14B 2KCCA 4RKBA 4IUVA 4LWCA 1XPRA 4F7XA 3K5LA 1U5KA 4GOPC 3K58A 1JMCA 3HZXA 5IP9H 1Y1VH 3OW7A 4MIUA 1BR9A 2B63B 3G6JB 1HQMC 2B2YA 1O7IA 3MXPA 3QWNA 1KXLA 4JBJA 4LF9L 3D6WA 4BWGB 1HNXQ 3U4ZA 4XDXA 2YU9H 1XWEA 2WFWA 1EU3A 5IYCH 2A5HA 1JR0D 2A6ED 3QOJA 1CKNA 4LF4Q 1LT5D 1X3FA 1I6VC 4DR1Q 2VQEQ 1HR0W 4ULLA 1KTKA 2K01A 2D0PA 3W5OA 2OWOA 4KKUA 1C9OA 2B63H 1VQKA 1WTVA 3VYUA 3HKZE 2DY7A 5K36G 3P1HA 1K28A 4QY7A 1ZXTA 4JYAL 2XWBB 4DK3C 2Z1CA 3UE0A 1HZ9A 5IGBA 1VQCA 3KDFA 3S15B 3HKSA 5C4ZA 2H1EA 3UDGA 4JK1C 1SE8A 1HFGA 3CRLC 2Q2IA 3V96A 5FK9C 3HP3A 3HOWH 5C44G 3PF5A 5IT9c 1STGA 4X62Q 1B70B 1B44D 2B3GA 5C4XB 2L15A 2XVSA 2Y0SG 1TWAB 3ZJYC 2JA9A 1I4RA 2PW5A 2SEBD 4AH6A 3LWUA 1G6PA 1MGSA 4XT3B 1G291 4DAPA 3J7AV 4A3BG 4B3RQ 4OO1G 2I46A 1TU2B 1HPCA 4YWLA 3SE0A 2K5QA 3AU7A 1L0XB 1TWHB 1XX8A 1K83B 2WB1G 4YY3Q 4DR3L 4X64L 3W3AA 4HIOA 5C4XH 4A3FH 5GAEC 1TWAH 3T4AC 4H02A 5CORA 2UUBL 1EZ6A 1CT1D 4LF8Q 4EVOA 3SDZA 1ASZA 3CCMA 1QNKA 2DNCA 4GNXC 3GD7A 2JJQA 1EY9A 3L7ZC 1HH2P 1NJIC 3C2PA 3OTOL 4YCWA 3J80E 1TWHH 3FDTA 3J81E 2WAQE 1MSGA 1K83H 1SMXA 2AQ1B 1X3EA 1QVFA 3DWAA 2P5ZX 1IHZA 1A6XA 2D9UA 2K5HA 2F0QA 1M90C 3T1HQ 2ZM6Q 4OXPA 2C9OA 2HDLA 4KHVA 1LT4D 2AMCB 1IKMA 1V1QA 4HR7B 3I91A 1YZ6A 3O13A 4FNFA 4DV4Q 1HZAA 1CM9A 2KUMA 1HNWL 3Q24A 3M3YH 3CPWA 3PUVA 5M5XB 5IGEA 4A3DG 5CMDA 1SR3A 2KJXA 2DNEA 3MVVA 5C44B 2SNSA 5K36H 5IYBG 3M7NA 1N33L 1YNJC 1VDZA 1AN8A 1BUVT 5T1GA 3UDIA 2RCFA 2HT1A 3PQIA 4IJLA 2Z4HA 1QOHA 2F4VQ 5M5XH 4NXMQ 4C3IG 4X3UA 5GAHC 3EA6A 3DMUA 1QILA 4WJ3M 5C44H 3PUWA 4UP7A 4APVA 4YWMA 5TSSA 4PMWA 3LWEA 3AFQA 2A1AA 5LL6S 2F0OA 1IYVA 3MXGA 1S40A 4GKKL 3BZDB 2F0TA 4A3BH 4OWWB 4OO1H 1STEA 2ZTEA 1W3SA 2EIFA 3KFUA 1BCPF 4GS3A 2K5WA 4AYBE 1UEAB 3W1BA 3H15A 2F03A 2VXWA 2EPBA 2K4KA 1KHIA 2VB3X 4V190 1YNJD 1LYLA 5E1FA 1JJCB 2VQFQ 2N78A 3RLNA 2QCPX 2ZJRA 3TS2A 2XRQD 2PMZE 3NTKA 3S1NB 4J6HA 1I50H 1KAWA 1JWUD 5KNDA 1PHJA 4A3DB 4X65L 2K5DA 5M3FG 5JEAJ 3I4OA 2XRSD 2F4IA 1IBLL 4G4KA 1Z9FA 4AQYQ 1B9NA 4F88A 2F3VA 3U58A 3S1NH 5I2XA 4JI5Q 3NP8A 2PCFB 3F2BA 1GXDC 1ONLA 3PMFA 1STAA 4A3DH 2K05A 2KBNA 5JEAG 3QR8A 2RKSA 5IYBH 3I56A 5C5LA 2RVLA 1CA5A 2UUAL 1CHQD 3PUYA 1VQBA 3S1MB 1HZBA 2F3IA 1JORA 5C3EB 4DR2L 2XNAC 3E0EA 1UNSA 3A8JE 1STNA 1FGUA 4C3IH 2R7ZG 1HUMA 4JC0A 1GUWA 2BH2A 4JCVE 1HR0Q 3F2UA 3JAME 3EJIA 3R8BA 1KABA 2K50A 4LFCQ 3E6ZX 3A5UA 3S1MH 4B9XA 2KOLA 4M8AA 1OXSC 1LTLA 2K32A 5EQ0A 3G4SA 2G9HD 1J5EL 5FO9B 4UHVA 2JN4A 5C0XG 1VQEA 1VQ9A 4LF4L 1NAPA 2V4DA 1JJGA 3BYYB 4DR1L 4IN3A 4KTAA 4CDDC 4KY5A 2NZ1D 3D4DA 1E22A 1CHPD 5M3FB 2AQ2B 4XQQA 3F2DA 4L6TB 1RJTA 3U9OA 1I4PA 5IWAQ 1C4QA 3EBEA 2PPBC 3K80C 5HY6A 1H9SB 4MN3A 5EBCA 1LTID 4B9WA 3HKZB 2DGYA 3CC4A 4N8X1 1FR3A 3K0XA 4MNOA 1Z6HA 1XNQQ 2E2HB 4IUUA 5M3FH 3KK7A 1VQ8A 2K6AA 1ILPA 5C3XA 5DM63 5KNBA 2E75C 1DOLA 2HQLA 4X62L 1BNZA 5C6AA 1BCPC 2E76C 2VL6A 4ME3A 1EYDA 3Q6SA 2R7ZB 1G51A 3E9IA 1CFMA 1BXTA 4B3RL 3RN2A 1EOVA 2F0WA 3PF4A 1LACA 2A6HC 4FVMA 3S1QB 4YY3L 1QVGA 3T56B 1EYCA 1SEBD 2XN9C 2VZAA 2B2YC 4FXGC 2JA7G 1NUCA 1OXUA 3CKIB 4K6LA 1QNUA 1FGBD 4LF8L 2R7ZH 2Z6BA 4Q5VA 2UUCQ 5IGGA 2F0DA 3P7JA 3U4VA 5IOCA 5D3IB 1EY5A 1VCIA 1BBWA 3S1QH 3HOYB 1PZID 1NR4A 1WJJA 1RTNA 2BA0A 4TRDA 2I5HA 1BCPD 2J4XA 1P16A 1TKWB 1CQFA 2WAQB 1X9NA 3T1HL 1KAAA 2MQHA 1YJ9A 2O5IC 3I73A 1FNWA 5C0XH 3PO2G 2F3WA 4DUZQ 4DV4L 3DWQA 2D62A 3VR2A 2PNRC 1KNEA 5KRUA 2A6HD 1TS5A 1Q86C 3M85A 3RMHA 4XYQA 1WTWA 1UE6A 2UU9Q 1DOKA 1R4QB 1SRUA 4IPCA 1Q8KA 4HJ8A 1W2BA 3FPUB 2OCEA 3ITPA 2K52A 1GKHA 1TWCB 2WINB 2HIVA 3K81C 2F4VL 3TN2A 4K0KQ 4PZ6A 1CTMA 4NXML 3ERSX 1PH8A 3AB9A 2IX0A 4ZYSA 1SYEA 2UXCQ 1I94Q 1VQ5A 1VQ7A 5J22A 2RSNA 4KJNA 4E6IA 4A3MG 4XXEA 1G8ZD 4DR7Q 2HD3A 5C4HA 1XXGA 4JBMA 1TWCH 1EIYB 3QJYA 2H5XA 4X3SA 3CW2C 2KHIA 3ZYYX 3BDCA 2PNHA 2B2WA 2QEJC 4QMGA 3HFZB 4FXDA 4B3SQ 2PI2A 5DLQE 1WCMB 1GHKA 2E2JH 3ERQA 2ASBA 5E3FA 2VQFL 3DLLA 4AYBB 4K2KA 3LX0A 2ZJQA 2NTSA 3GTMH 4DV3Q 1M4VA 2R61A 2PZWA 1ICWA 1S72A 2JSOA 2PYKA 3A56A 3KJOA 3H6MA 2Y0SE 3A7LA 3G71A 2PMZB 2F0FA 1WCMH 2ICEC 2NB0A 5JAVA 5KGUA 3T13A 3MWYW 3HS0C 5BN4A 1BVSA 4GNXB 4AQYL 4JI8Q 1JICA 5M5YB 1Y1WG 1JWSD 3NHHA 3DWPA 3BZCA 1GO3E 5LMUQ 4JI5L 2N55A 1A0IA 2WB1E 3CRKC 3QG1A 2MJ8A 4PZ7A 4KHZA 1VQAA 5ELEA 2NTTA 1YEZA 1O78A 2A73B 3FRPB 3U50C 1S5DD 2EY5A 2NVTH 5M5YH 1SNPA 1NMGA 2RHSB 3AQQA 1LTBD 3STBC 4DUYQ 4LF7Q 2PO4A 4YCVA 5ELFA 3L3OC 2F0KA 3I90A 1B3QA 4DV5Q 2XWJB 2TMPA 2RDGA 1KDAA 1CA6A 1HR0L 4ABNA 1OXXK 1F2YA 1MD2D 4LFCL 3K6OA 2JA6G 1V9PA 5IGFA 1OXVA 2G5DA 1EU4A 5JJZA 5I9OA 3W2DA 1N32Q 2I07B 2F0EA 1KQSA 2CW0C 2ZTCA 3OHXC 3K5NA 2RCNA 1IBKQ 4M1UB 1II3A 4L5TA 1PVOA 3OIPA 1PA6A 1EUJA 1JB3A 1KC8C 1IYJB 4OGQC 3SK8A 2CHBD 3MXNA 4IUQA 4ODGA 1QVCA 3P75A 3STBD 4C3JG 1D7QA 2EVBA 5IWAL 4BY1G 1VQMA 1SNQA 1VMPA 1B53A 3TP6A 1R9TH 1RD9D 1ZKOA 2EJFC 1XMQQ 2JA5G 3S24A 2VW9A 4KY6A 2MUYA 5KNCA 5ELBA 1XNQL 5C5MA 1YJNA 4YIJA 2B2UA 5IE8A 1XPUA 1SLJA 1CKOA 2K5VA 1Y1WH 3TDQA 1LTGD 1B50A 1Y1VB 2CW0D 3MEHA 5EPKA 4K5WA 2HUGA 5CBAE 1U9RA 1O7YA 3I55A 1RF2D 4A3IG 2FMCA 3X3NA 4KHPQ 4DV2Q 3KF6B 2N88A 1B8AA 5D14A 3NWTA 4RKLA 2YTXA 1L0WA 1YHBA 3J80L 2F0GA 4O1NA 2X6LA 1IBMQ 2JA6B 4RGTA 2R7DA 1K8AC 2QILA 1FYCA 2N8NA 3BS1A 4C3HG 3OSOA 1A2UA 4ALPA 2Z6KA 3GV6A 3SHLA 4HAEA 3BVMA 2UUCL 1H9KA 1HA5A 1AZPA 1D5XC 4B3MQ 2X69A 4OELB 2MPMA 1D5MC 1D6EC 1L0YB 3MFGA 3I4MB 2A69C 2C35B 4P2CB 3PIP3 5LMNQ 2JA6H 4LUZA 5CV4A 2IW3A 4JI4Q 4JI6Q 3HOWB 3HOUB 4C1NK 1U4RA 1STYA 1NMFA 2EYPA 4OHJA 4A4IA 3PV0A 1H9JA 2Z0SA 1G2TA 1RCVD 3TRZA 5HGTA 2K75A 2B39A 4L5QA 3I4MH 4RWSC 4DUZL 5EPJA 1SYBA 3PIOA 2HCIA 1FD7D 3CHBD 5GROA 1S5CD 2QW7A 4A93G 4HEDA 4DV6Q 1AH9A 4I7ZC 3GTLB 2UU9L 3HOUH 4C3JH 2A19A 4HSPA 4BY1H 4A3FB 4RFBA 4DAYA 2NWGA 4TSSA 1A62A 4JBWA 4FP5D 4LFAQ 2A69D 3C1FA 2MO0A 2BCOA 3GTLH 4JI2Q 1SYDA 4N8FA 1SE2A 4DR6Q 2K28A 2UXCL 1I94L 1PH9A 5JOBA 3TP5A 4CJ1B 3KLWA 2Q2UA 1WTHA 3FVQA 1SDFA 4XQNA 5M5WB 3NTHA 4DR7L 1EEFD 3H0GG 3G48A 4A3IH 3EVQA 5I9PA 1K8MA 1MIUA 4OIJA 3SXHA 3CC2A 1L1OA 4IJHA 3EN2A 2L12A 4RMFA 5IY0A 3M3YB 4A3CG 2JA8G 4IUPA 3D8GA 2OQ0A 3MZ5A 4QUCA 1BCPB 1GHJA 2ID0A 4B3SL 1EQVA 3L0OA 4C3HH 3CCSA 1DOMA 1C8CA 2E8GA 5M5WH 1D1IA 2I0QA 1ICFB 4JI0Q 1SJED 4JI3L 2FFKB 4JI7Q 2EYJA 4DV3L 4P71A 2BDNA 1HA6A 2NZHA 5AJ3Q 1E1TA 3ER0A 1TS4A 1NBWA 2CKZB 1JT8A 5BN3A 3N6RA 4EQNA 1GM5A 1HTPA 5NUCA 1VQJA 1V8QA 3CD6A 4LF6Q 2KEDA 2OTLA 4R4QA 3PCOB 1EY0A 2Y0SB 1HCZA 1E1OA 1CKNB 4JI8L 1YNNC 2EYHA 4KN7C 5LMUL 4P72A 4HCEA 1BKBA 4S3SA 5ELCA 4A3BB 4A93H 4NPSA 1DGSA 1PYSB 4YHHQ 4A3JG 4DN4M 3NEMA 4NXNQ 3VA5A 4KKTA 2WB1B 4LNQA 4IPDA 1EYAA 3KDFB 3A5ZB 3JAML 3A55A 1EYGA 1STBA 4DUYL 3VR6A 4HIMA 4LF7L 3TMEA 1VQNA 2B2VA 4HIDA 2JEBI 3ICEA 5EKIA 1E3PA 4MTNA 2R92G 1U4LA 2VUMG 4NDXA 1I50B 4DV5L 2KA7A 2NBFA 1N36Q 2JA8B 4JOIC 3QO2A 3TSSA 1JCKB 4Q0FA 1PTOB 4IOAA 2GVAA 4CBVA 1YNND 1ET6A 3T1YQ 3H0GH 2CCZA 1IL8A 1X3PA 2ZJPA 1N32L 2LXKA 4DK1A 3CCJA 1TS3A 3Q23A 1D1KA
chains in the Genus database with same CATH topology
4IFDJ 1PTOH 1W6JA 2SOBA 1CZWA 1J8IA 2KVMA 1AEXA 4FO2A 2F0IA 3ND8A 1EZ8A 2KQ3A 1GUSA 2M00A 3IFDA 1BQQT 2PW7A 5I6YA 4C3IB 4OIKA 4A3JB 2VNUD 1A3TA 1LTRD 2R3ZA 5FLXE 1BF4A 3D3RA 3K7AB 2M9VA 5J1ZA 3EROA 3TZUA 3ONAB 5EKLA 2AUKA 4KY7A 5KIXA 2B2TC 4NP5A 1DJRD 5DEHA 2VUMB 2AUJD 1SNCA 1PTOF 3NBIA 4CKBA 1PMRA 2Q8RE 1TQOA 3P20A 4DAVA 1E2VA 1WTXA 1SFOB 1PFNA 1Y8NB 4R8NA 1F2ZA 4DNRB 3S1RB 4ME5A 5D65A 4NW2A 2ZXOA 4C56C 3S9WA 1IKLA 1Q3LA 1HHVA 1BBXC 1AZQA 1KDBA 3GP7A 3U9SA 2X6GA 5M3MB 2E2IB 2K04A 2ZXPA 1Y8PB 1GUOA 2A68D 1STHA 2MP1A 1NSNS 1UAPA 4KKSA 3WOFA 5C3WA 3BVZA 4QB4A 2KEEA 1HXYD 4KD3A 4O42A 1SE4A 5CV7A 5JEAH 5CV9A 4PV1C 3FEWX 3VYTA 3R3OA 1JOOA 1B2TA 4RHRA 1GUTA 1O80A 3Q22A 1I4GA 5M9OA 3DXJC 3GQBA 2MGSA 3MTSA 1S4ZA 3URYA 1G2SA 5CBEE 2O5JC 2EZVA 3N52A 1F2LA 1V1OA 4XQJA 1MSHA 1H9MA 3H09A 3IFTA 4LAAA 2J0TD 5A2QE 3LNNA 4H7BA 4BBRB 2NN6G 1WD0A 3HEJA 4BA2I 2IT1A 2RQXA 4L8JA 1PTOC 4F8MA 4LK1C 2IX1A 3C1EA 1H9RA 3S2HB 4XT1B 4RH6A 3GO5A 3K5OA 4CJ2C 1TWFB 3A8KE 1EIGA 1I3QB 1SSOA 4Z9CB 1X32A 1V1PA 4I65A 2LMCB 2RA4A 2JA7B 2E2JB 3MFYA 3D4WA 2RSOA 1D5ZC 4DGZA 2YYZA 1SYGA 2JEAI 3GTMB 2L5TA 3PO3B 1RDPD 1BOSA 2F0HA 2SNMA 3NQIA 5FKAC 1OXTA 1Z47A 3V05A 1PTOD 3DM1A 2L9HA 3X3MA 3D31A 4N9PA 5CV8A 2ICIA 2C5CA 2K7VA 4ZK9B 3PO2B 5CV5A 3GV3A 3OMCA 3K57A 1SYCA 1SAPA 5DAUA 3K0YA 2RBMA 3VR5A 4H44C 5J39A 2ENBA 2NVTB 1U4MA 2EDGA 5KYIA 1XYIA 3NUCA 2NN6H 2AWOA 1U4PA 1BO0A 1AW7A 2OXPA 5IT9E 2K1BA 4DNTB 1E2WA 1KDCA 1A3UA 1LT3D 4A3MB 3ND9A 1Q12A 2B2VC 3OWEB 2KCNA 5LHY1 3RZOB 1Z7TA 3OPOA 1PXUA 2F1MA 2WACA 1EY6A 2PZTA 4DXGA 5HURA 1KLGD 2L55A 4J1MA 4R9WA 2JE6I 3VYSA 1BDOA 4IUTA 4XTCS 5IGCA 3E0JA 5COYA 1EY7A 1LV9A 4LMQD 4U673 4MHEA 1F2MA 4HCSA 2QDBA 4QCLA 1R9TB 1QB5D 2MHVA 1CI3M 2JXMB 2NUCA 5I6WA 4QIWB 1O7ZA 3GTOB 1UUPA 3T53B 3R2TA 1Y1WB 5D3DA 4CGYB 1OO9B 1EY8A 2EYLA 2E74C 1GOZA 2F0NA 3SVMA 3BVGA 3MXUA 2IX3A 2QKIC 4BS9A 1EY4A 3T51B 1WVLA 3H3VC 1LTSD 3HOZB 4FF4A 3SEBA 4G7HC 2Z4IA 4IALA 3CQZB 2F0PA 3NE5B 2EYFA 5KYLA 2Z8LA 1X3QA 2M2LA 4WORA 3VR4A 2DN8A 4PNYA 1TS2A 3QOLA 4IUNA 4KD4A 3AMUA 2WKDA 4H0LC 4K8JA 5F2DA 1JQYD 3TP8A 3V2TA 3J7YW 2J7ZA 1RODA 3J81L 1WD1A 2EYOA 3M4YA 1SNDA 5A35A 3G7LA 2F0JA 3J7AF 1F9SA 4ZUIA 1Q1EA 5EBDA 3Q0AA 3IL8A 5E4WC 3I3CA 1LABA 4DK0A 1KLUD 4HMIA 4WFN3 3H94A 4C3JB 4QUFA 1QE6A 4F87A 5DM73 4BY1B 4K5VA 1EL0A 1EIHA 2O2LD 2JA5B 1DCZA 1ET9A 1WTRA 2WV6D 2F0UA 5E4XA 2NN6I 1GUNA 3KLRA 3A8IE 1TR5A 4OL7A 3HRZC 2E2DC 3GTPB 4QF4A 4KMUC 4RAUC 4FYDA 4A3IB 2IWHA 3WOEA 2CVRA 1HRJA 3R93A 1VF5C 2EJMA 4B08A 1TY2A 1EWHA 4CHTB 4WJWA 1WTOA 1CQVA 2O4XA 1J9OA 1Y69U 1E2ZA 4C3HB 1Q8IA 2EY2A 2Q8IB 3E5SA 1ILQA 3A54A 5KEEA 3C3LA 2JP1A 2TSSA 1WTPA 2AQ3B 4C1NI 2DY8A 1CK1A 5G3LF 1ENAA 2EXZA 3SK5A 2BE5C 4LJZC 1EEID 2WP8J 3TBIB 4EQOA 1PDQA 4EQPA 5CGKA 3MHBA 5FO8B 5FO7B 2EOTA 5FOBB 4CKCA 2F0VA 2BA1A 4N9TA 1DZ1A 5C4JB 4A93B 5BN5A 5IODA 3A7AB 3MAQA 3NWSA 4KK7A 1C48A 1JOKA 5FLXL 4RGNA 1TT2A 1B1ZA 1HUNA 3NSWA 3NTIA 1JOQA 2BE5D 2RDFA 3RUZA 1QWYA 2HDMA 4UAIA 3KLSA 3VR3A 2K03A 3H0GB 4HN7A 3OWFA 3NK9A 3BDLA 1JC7A 1S5ED 1EWCA 2QF7A 2IPKD 3GTQB 2B2WC 1I4QA 2F0SA 3CU7A 1LLRD 1A2TA 4HSVA 4RHSA 5JVH3 1DONA 5CV6A 1JE4A 1H9SA 5CR3A 2BDOA 3SK6A 3NBHA 2D2CC 2L0CA 1Q90A 1S5BD 2HCCA 1PRTB 2NVYB 3HG9A 2EE1A 3QIAA 1PLFA 3PUZA 4G57A 5JPMC 4IFDG 5EGTA 3I72A 1AFPA 3D4RA 1NR2A 1V43A 4Y7NB 1MBYA 1PFBA 2A74C 1F9RA 4KN4C 2L11A 4ZKCB 3C46A 1EQTA 5JPNC 2GA4B 4L63B 3QB3A 1XTCD 3BYTB 2NVXB 3NPPA 4A3EB 2R92B 1DXMA 3S2DB 4FF1A 3NXWA 4R8IA 1ESRA 1FNUA 1FNVA 5LL6X 3IKJA 2A68C 3DUZA 1A3VA 2XSCA 3BDOA 1VMCA 1LT6D 4CJ0B 4ZKBB 1SYFA 4ILWA 1GUGA 5C0XJ 4G7ZC 5A2QL 1DYQA 1PRTF 1B3AA 2D5DA 5EPLA 1D2BA 5G3LD 1F9QA 4DXFA 1W6KA 3MC0B 5EJWA 1TY0A 2EJGC 5ISRA 1ML0D 2PZUA 3BG3A 1NCVA 2B2UC 1GJXA 1JWMD 3WDNA 1RTOA 3L9AX 1SE3A 2EY6A 4H13C 1B9MA 4RGMA 4IFDH 1E0BA 3OOCA 5I2YA 1EFID 3GTJB 3FMCA 4RA8A 2B8GA 4ZUJA 1IW7C 1PZKD 1QG7A 4IURA 1DD2A 3KBXA 1WTQA 2R93B 4XYOA 2FINB 1ZYRC 2B8FA 1TWGB 1HFNA 4C2MB 1ESFA 2JYOA 2L4NA 3M7GA 3RLFA 2L1BA 2LS01 4BA1I 4WRDA 3IAYA 4HTHA 4OO1I 4G7OC 1AP0A 1DM0B 3FPPA 3KBGA 1G6ZA 1T5EA 1PYWD 1Q1BA 1MI2A 4PMCA 4K6DA 1EOTA 4ZQ3A 3HOXB 2EYMA 3VA7A 1IW7D 3DEPA 4J8QA 2EY1A 2SDFA 4NKLA 1D1KA 4A3KB 1S5FD 1ZYRD 1SXTA 4BY7B 2KHSA 3RD4A 3HOVB 3DEOA 1B4OA 5IT9L 1F77A 4NMZA 4A3GB 4FF2A 1ZEQX 2ZXRA 1O7LA 3KUPA 3D6CA 4KJOA 4CKEA 3UI2A 3SR1A 3MA2B 2WKCA 2OT2A 2WIIB 4PMBA 2LFNA 4ZLTF 3K5MA 1QCBD 3OIQA 4DU9A 2NVQB 4HMJA 1SNMA 4KV6A 1PRTC 3NQTA 3VYRA 4ZAIA 2IL8A 1F9PA 3DHQA 4GZYC 1LO5D 4X3KA 4RCNA 2LY7A 2FJ2A 1T5XD 2R6GA 1PFMA 5T1IA 1A15A 1SNOA 5DNFA 2OEOA 3I4LA 5JVG3 1VF7A 4DF7A 1QJOA 5CC4A 2F0LA 3HGBA 5K5PA 3EQLC 1SBBB 1SJHD 4V0BA 2PQEA 2IJ0A 3OMGA 2H4OA 2CQAA 5IIFA 4EGVA 3TP7A 1LTAD 1PRTD 5I4DA 4BBSB 4IFDI 2K33A 1I4XA 2ZT9C 3K59A 3M4OB 4RCOA 3TZDA 2BOSA 3SK4A 1RKNA 2HQEA 4X3TA 3EFXD 2F0MA 3PIO3 3KF8A 3I4NB 1M8AA 2FMMA 3T16A 1SMYC 1ENFA 4IQZA 1HTLD 1RHPA 3S17B 1HQRD 2LKVA 2AWNA 2VB2X 4XIGS 4K5XA 5ELDA 5CYUA 5AFWA 2B2TA 4UDUC 2XIWA 4TKOB 3I70A 3PUXA 1R4PB 1V1PB 2KECA 4FF3A 1TVXA 4K14A 4PQXA 5EKKA 1KNAA 1I6HB 4FXKC 3H91A 1PZJD 3S16B 4ZRZA 2FHTA 2Q8TA 1SMYD 1I4HA 5C0XI 3I8ZA 4ID6A 2G9DA 4DA2A 1K8OA 3RZDB 1TIID 4RGOS 2NYZD 1Y8OB 4DFAA 3GTGB 2RDHA 3R2IA 3GTKB 2A6EC 1ENCA 5IGDA 1IYUA 1G91A 4KI0A 1CZGA 1LTTD 4K2LA 3KLSX 4TQUS 2OF1A 4IZ8A 4U68A 4K8IA 2YU9B 3FKIB 3S14B 2KCCA 4RKBA 4IUVA 4F7XA 3K5LA 3K58A 3HZXA 3OW7A 4MIUA 1BR9A 2B63B 3G6JB 1HQMC 2B2YA 3MXPA 3QWNA 3D6WA 4BWGB 4XDXA 1XWEA 1EU3A 2A5HA 1JR0D 2A6ED 3QOJA 1LT5D 1I6VC 4ULLA 1KTKA 2K01A 4KKUA 1WTVA 3VYUA 2DY7A 5K36G 3P1HA 1ZXTA 2XWBB 2Z1CA 5IGBA 3S15B 5C4ZA 2H1EA 4JK1C 1HFGA 3CRLC 3V96A 3HP3A 1STGA 1B44D 5C4XB 2XVSA 1TWAB 1I4RA 2PW5A 2SEBD 3LWUA 1MGSA 4XT3B 1G291 4DAPA 3J7AV 4OO1G 2I46A 1TU2B 1HPCA 3SE0A 2K5QA 3AU7A 1L0XB 1TWHB 1XX8A 1K83B 3W3AA 3T4AC 5CORA 1EZ6A 1CT1D 4EVOA 3SDZA 1QNKA 2DNCA 3GD7A 1EY9A 3L7ZC 3C2PA 3J80E 3FDTA 3J81E 1MSGA 2AQ1B 3DWAA 1IHZA 1A6XA 2D9UA 2F0QA 2C9OA 2HDLA 4KHVA 1LT4D 1IKMA 4HR7B 3I91A 3O13A 4FNFA 1CM9A 2KUMA 3Q24A 3PUVA 5M5XB 5IGEA 5CMDA 2KJXA 2DNEA 3MVVA 5C44B 2SNSA 5K36H 3M7NA 1YNJC 1VDZA 1AN8A 1BUVT 5T1GA 2Z4HA 1QOHA 4C3IG 4X3UA 3EA6A 3DMUA 1QILA 3PUWA 5TSSA 4PMWA 3LWEA 5LL6S 2F0OA 1IYVA 3MXGA 3BZDB 2F0TA 4OO1H 1STEA 1BCPF 2K5WA 1UEAB 2F03A 2VXWA 2EPBA 2VB3X 4V190 1YNJD 5E1FA 2QCPX 2XRQD 3NTKA 3S1NB 4J6HA 1JWUD 5KNDA 4A3DB 2K5DA 5JEAJ 2XRSD 2F4IA 4G4KA 1B9NA 4F88A 2F3VA 5I2XA 3NP8A 2PCFB 1GXDC 1ONLA 1STAA 3PMFA 2K05A 5JEAG 2RKSA 5C5LA 2RVLA 1CA5A 1CHQD 3PUYA 3S1MB 1JORA 5C3EB 2XNAC 1UNSA 3A8JE 1STNA 1HUMA 1GUWA 3F2UA 3JAME 3EJIA 3R8BA 1KABA 3E6ZX 4B9XA 2KOLA 4M8AA 1OXSC 2K32A 5EQ0A 2G9HD 5FO9B 5C0XG 1NAPA 2V4DA 3BYYB 4IN3A 4KTAA 4KY5A 2NZ1D 3D4DA 5M3FB 1CHPD 2AQ2B 4XQQA 4L6TB 1RJTA 3U9OA 1I4PA 1C4QA 2PPBC 1H9SB 4MN3A 5EBCA 1LTID 4B9WA 3HKZB 1FR3A 1Z6HA 2E2HB 4IUUA 3KK7A 2K6AA 1ILPA 5C3XA 5DM63 5KNBA 2E75C 1DOLA 1BNZA 5C6AA 1BCPC 2E76C 1EYDA 3Q6SA 2R7ZB 1CFMA 1BXTA 2F0WA 1LACA 2A6HC 4FVMA 3S1QB 3T56B 1EYCA 1SEBD 2XN9C 2B2YC 4FXGC 1NUCA 1OXUA 3CKIB 4K6LA 1QNUA 1FGBD 4Q5VA 5IGGA 2F0DA 3P7JA 5IOCA 5D3IB 1EY5A 1VCIA 3HOYB 1PZID 1NR4A 2BA0A 1RTNA 4TRDA 1BCPD 2J4XA 1TKWB 1CQFA 2WAQB 1KAAA 2O5IC 3I73A 1FNWA 5C0XH 2F3WA 3DWQA 2D62A 3VR2A 2PNRC 1KNEA 5KRUA 2A6HD 1TS5A 3M85A 3RMHA 4XYQA 1WTWA 1DOKA 1R4QB 3FPUB 3ITPA 1TWCB 2WINB 3TN2A 1CTMA 3AB9A 2IX0A 4ZYSA 1SYEA 5J22A 2RSNA 4KJNA 4E6IA 4XXEA 1G8ZD 5C4HA 1XXGA 3QJYA 4X3SA 3ZYYX 3BDCA 2B2WA 2QEJC 4QMGA 4FXDA 1WCMB 1GHKA 3ERQA 5E3FA 4AYBB 4K2KA 3LX0A 2NTSA 1M4VA 2R61A 2PZWA 1ICWA 2JSOA 2PYKA 3A56A 3H6MA 3A7LA 2PMZB 2F0FA 2ICEC 2NB0A 5JAVA 5KGUA 3T13A 3MWYW 3HS0C 5BN4A 5M5YB 1JICA 1JWSD 3NHHA 3DWPA 2N55A 3CRKC 3QG1A 2MJ8A 4KHZA 5ELEA 2NTTA 1O78A 2A73B 3FRPB 1S5DD 2EY5A 1SNPA 1LTBD 2PO4A 5ELFA 3L3OC 2F0KA 3I90A 2XWJB 2TMPA 2RDGA 1KDAA 1CA6A 4ABNA 1OXXK 1F2YA 1MD2D 3K6OA 5IGFA 1OXVA 1EU4A 5JJZA 5I9OA 3W2DA 2I07B 2F0EA 2CW0C 3OHXC 3K5NA 4M1UB 1II3A 3OIPA 1JB3A 4OGQC 3SK8A 2CHBD 3MXNA 4IUQA 4ODGA 3P75A 4C3JG 2EVBA 3TP6A 1SNQA 1B53A 1VMPA 1RD9D 1ZKOA 2EJFC 4KY6A 2MUYA 5KNCA 5ELBA 5C5MA 4YIJA 2B2UA 3TDQA 1LTGD 1B50A 1Y1VB 2CW0D 3MEHA 5EPKA 4K5WA 2HUGA 5CBAE 1U9RA 1O7YA 1RF2D 2FMCA 3X3NA 2N88A 5D14A 3NWTA 4RKLA 3J80L 2F0GA 4O1NA 2X6LA 2JA6B 4RGTA 2QILA 1FYCA 3BS1A 4C3HG 3OSOA 1A2UA 3GV6A 3SHLA 4HAEA 3BVMA 1H9KA 1HA5A 1AZPA 1D5XC 2X69A 2MPMA 1D5MC 1D6EC 1L0YB 3MFGA 3I4MB 2A69C 4P2CB 3PIP3 5CV4A 2IW3A 3HOWB 3HOUB 4C1NK 1U4RA 1STYA 2EYPA 4OHJA 1G2TA 3PV0A 1H9JA 1RCVD 5HGTA 2B39A 4RWSC 5EPJA 1SYBA 2HCIA 1FD7D 3CHBD 1S5CD 4HEDA 4I7ZC 3GTLB 4HSPA 4A3FB 4RFBA 4DAYA 2NWGA 4TSSA 4JBWA 4FP5D 2A69D 3C1FA 2BCOA 1SYDA 1SE2A 2K28A 5JOBA 3TP5A 4CJ1B 3FVQA 1SDFA 4XQNA 5M5WB 3NTHA 1EEFD 3EVQA 5I9PA 1K8MA 4OIJA 3SXHA 2L12A 3M3YB 4IUPA 3D8GA 4QUCA 3MZ5A 1BCPB 1GHJA 2ID0A 1EQVA 1DOMA 1C8CA 1D1IA 1SJED 2FFKB 2EYJA 2BDNA 1HA6A 1TS4A 5BN3A 3N6RA 4EQNA 1HTPA 5NUCA 1V8QA 2KEDA 1EY0A 2Y0SB 1HCZA 1YNNC 2EYHA 4KN7C 4HCEA 4S3SA 5ELCA 4A3BB 4DN4M 3VA5A 4KKTA 2WB1B 1EYAA 3JAML 3A55A 1STBA 3VR6A 3TMEA 2B2VA 2JEBI 5EKIA 1U4LA 4NDXA 1I50B 2KA7A 2NBFA 2JA8B 3QO2A 3TSSA 1JCKB 4Q0FA 1PTOB 4CBVA 1YNND 1ET6A 1IL8A 1X3PA 4DK1A 1TS3A 3Q23A 5FK9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRZ C;  1BR9 A;  2XWJ B;  2E2D C;  1PXU A;  1JC7 A;  1UAP A;  2TMP A;  3G6J B;  5FO7 B;  5FO8 B;  1JB3 A;  3CKI B;  2XWB B;  2WIN B;  1UEA B;  1D2B A;  5FOB B;  2A73 B;  2J0T D;  3FRP B;  2A74 C;  3CU7 A;  2ICE C;  1XWE A;  4FXK C;  2B39 A;  5JPN C;  3HS0 C;  1OO9 B;  2I07 B;  3MA2 B;  3KLS A;  5FO9 B;  3V96 A;  1BQQ T;  2WII B;  3OHX C;  4ILW A;  5JPM C;  3L3O C;  3I70 A;  1BUV T;  2QKI C;  1GXD C;  3T4A C;  4FXG C; 
#chains in the Genus database with same CATH topology
 4IFD J;  4A3C H;  2JA8 H;  1IBK L;  1PTO H;  1W6J A;  1YVC A;  5J3B A;  2SOB A;  1CZW A;  1J8I A;  1N9W A;  2KVM A;  1GD7 A;  1AEX A;  4FO2 A;  3TQY A;  2F0I A;  4JPB W;  3ND8 A;  1EZ8 A;  2KQ3 A;  1GUS A;  2M00 A;  3IFD A;  1BQQ T;  2K14 A;  2PW7 A;  1PH6 A;  3ULJ A;  1XMQ L;  5M3M G;  1KRS A;  5I6Y A;  4C3I B;  4OIK A;  3KOJ A;  4A3J B;  1PH5 A;  2VNU D;  1A3T A;  2PQA B;  4JG2 A;  2ES2 A;  2EXD A;  1LTR D;  2R3Z A;  5FLX E;  4X66 Q;  1BF4 A;  3D3R A;  3K7A B;  2M9V A;  5J1Z A;  1L2F A;  1WFQ A;  2MO1 A;  3ERO A;  3TZU A;  3ONA B;  5EKL A;  2AUK A;  1VQD A;  4KY7 A;  5KIX A;  2B2T C;  4NP5 A;  1DJR D;  5DEH A;  1I5F A;  5EAY A;  1WOC A;  4A3J H;  2VUM B;  4JVZ A;  2AUJ D;  1SNC A;  3RLO A;  4KHP L;  1PTO F;  4DV2 L;  3NBI A;  4LF5 Q;  1IL2 A;  4CKB A;  1PMR A;  3K7A H;  2LSS A;  1P8L A;  2R93 G;  1AE2 A;  1IBM L;  2Q8R E;  4AIM A;  1TQO A;  3P20 A;  4DAV A;  1E2V A;  1WTX A;  1HNX L;  4QIW E;  1PFN A;  1SFO B;  1Y8N B;  3NEN A;  4R8N A;  2VUM H;  3S2D H;  1F2Z A;  4DNR B;  4B3M L;  3S1R B;  3J80 c;  3J81 c;  4ME5 A;  2VQE L;  4GOP A;  5D65 A;  5LMN L;  4NW2 A;  2ZXO A;  4C56 C;  3RR5 A;  3S9W A;  1IKL A;  1Q3L A;  2ATW A;  3I2Z A;  4JI6 L;  1HHV A;  2F52 A;  4GLA C;  3EIV A;  1BBX C;  2PI2 E;  1AZQ A;  1SFO H;  1KDB A;  3GP7 A;  5HGQ A;  3U9S A;  2X6G A;  3S1R H;  4J15 A;  5M3M B;  3PSI A;  2E2I B;  2K04 A;  2ZXP A;  3NBH B;  4BBR G;  1Y8P B;  5FLM G;  1GUO A;  4DV6 L;  5IP7 G;  2A68 D;  1STH A;  2YTV A;  2MP1 A;  4BY7 G;  1NSN S;  4DR5 Q;  1UAP A;  4KKS A;  3HOV G;  2ALY B;  1PH7 A;  3WOF A;  5C3W A;  2FXQ A;  3BVZ A;  4QB4 A;  1CSP A;  3UDF A;  2KEE A;  5M3M H;  1HXY D;  4KD3 A;  2E2I H;  3AEV A;  4O42 A;  1SE4 A;  1M1K C;  4LFA L;  5CV7 A;  5JEA H;  5CV9 A;  1MJE A;  4JI2 L;  4PV1 C;  4DR6 L;  3A74 A;  3FEW X;  3VYT A;  3R3O A;  1JOO A;  4L5S A;  4POG A;  1B2T A;  4RHR A;  1GUT A;  1O80 A;  3Q22 A;  1CUK A;  4P74 A;  2UXB Q;  1I4G A;  5M9O A;  3DXJ C;  3GQB A;  3GTJ H;  3CP0 A;  2MGS A;  1J6Q A;  3CXC A;  3MTS A;  3PO3 G;  1S4Z A;  3URY A;  4FDB A;  1YNX A;  3TS0 A;  1G2S A;  5CBE E;  3W1G A;  2O5J C;  2R93 H;  1MJC A;  2EZV A;  1QUQ A;  3N52 A;  4OX9 Q;  1F2L A;  1V1O A;  4XQJ A;  4JI0 L;  2ZTD A;  2ZM6 L;  1MSH A;  3H3V H;  1H9M A;  3H09 A;  3IFT A;  4JI7 L;  4LAA A;  4GNX A;  2J0T D;  4RG1 A;  5A2Q E;  3LNN A;  4H7B A;  4BBR B;  5AJ3 L;  2NN6 G;  1WD0 A;  3HEJ A;  4R4O A;  4BA2 I;  4LF6 L;  2IT1 A;  2RQX A;  3VDY A;  1KIX A;  2JQO A;  4JYA Q;  4GN5 A;  4L8J A;  1PTO C;  1NTG A;  4F8M A;  4LK1 C;  3CCL A;  1OTC A;  4BBR H;  5FLM H;  2IX1 A;  1JJ2 A;  3C1E A;  1H9R A;  5ELO A;  4XT1 B;  3S2H B;  4RH6 A;  3GO5 A;  3K5O A;  4CJ2 C;  5IP7 H;  4YHH L;  3J80 i;  3J81 i;  1UWV A;  1TWF B;  3A8K E;  5GAD C;  4NXN L;  2HHH Q;  1EIG A;  1I3Q B;  4BY7 H;  1SSO A;  4Z9C B;  1X32 A;  1V1P A;  4I65 A;  1CKM A;  2LMC B;  2RA4 A;  2JA7 B;  4P73 A;  2E2J B;  3MFY A;  3D4W A;  2RSO A;  1D5Z C;  4DGZ A;  2YYZ A;  3I4N G;  1SYG A;  2JEA I;  1GVP A;  4POF A;  3GTM B;  2JK8 A;  2L5T A;  1BBU A;  3PO3 B;  1RDP D;  3S2H H;  5H1S E;  1BOS A;  1L1O C;  2F0H A;  2SNM A;  3NQI A;  2KCT A;  1TWF H;  3L2P A;  1XMO Q;  4JW0 A;  1I3Q H;  1KRT A;  1YJW A;  3JAM c;  4DK6 C;  1QZH A;  5FKA C;  4P75 A;  2JA7 H;  1OXT A;  1Z47 A;  3V05 A;  1PTO D;  4B3T Q;  3DM1 A;  3T1Y L;  2YV5 A;  2L9H A;  3D31 A;  4N9P A;  3X3M A;  4HIK A;  5CV8 A;  2ICI A;  2C5C A;  3PO3 H;  2K7V A;  4ZK9 B;  3PO2 B;  5CV5 A;  1SRO A;  2GN5 A;  3GV3 A;  3OMC A;  3J7A 5;  3RN5 A;  3K57 A;  2N49 A;  3K7U C;  4DV1 Q;  1SYC A;  1SAP A;  1RIP A;  5DAU A;  3ULP A;  3K0Y A;  2RBM A;  3VR5 A;  4H44 C;  3B6Y A;  5J39 A;  2ENB A;  3FP9 A;  1U4M A;  2NVT B;  1FL0 A;  3PO2 H;  2CQO A;  2EDG A;  1VQL A;  5KYI A;  1XYI A;  4LUO A;  3F2C A;  3NUC A;  2NN6 H;  2AWO A;  2MFI A;  1U4P A;  1BO0 A;  1K0R A;  2CH4 A;  1AW7 A;  2OXP A;  3KF6 A;  3HOZ G;  5IT9 E;  2K1B A;  4X66 L;  1FJG Q;  4GLV B;  1E24 A;  4DNT B;  1E2W A;  1KDC A;  1A3U A;  1LT3 D;  4A3M B;  1VQF A;  1K8G A;  3ND9 A;  1Q12 A;  2B2V C;  1Q81 C;  3OWE B;  2KCN A;  5LHY 1;  3RZO B;  2LXJ A;  5L37 A;  1Z7T A;  3OPO A;  1PXU A;  2F1M A;  2WAC A;  3Q8D A;  4MZ9 A;  1EY6 A;  1PFS A;  2PZT A;  4DXG A;  4LF5 L;  1KD1 C;  1X56 A;  1KLG D;  2L55 A;  5HUR A;  4J1M A;  4R9W A;  2JE6 I;  3E9H A;  4A3M H;  3VYS A;  1QZG A;  1BDO A;  4IUT A;  4DV7 Q;  3I4N H;  4XTC S;  5IGC A;  3E0J A;  4QL5 A;  1EY7 A;  5COY A;  1LV9 A;  4LMQ D;  3RZO H;  4U67 3;  4OON A;  1YI2 A;  4MHE A;  1F2M A;  4HCS A;  2QDB A;  3H3V I;  3FKI G;  4A76 A;  2AKW B;  4QCL A;  2IY5 B;  1R9T B;  3S17 H;  1QB5 D;  2MHV A;  1CI3 M;  2JXM B;  4Y52 H;  2NUC A;  5I6W A;  1RL2 A;  3M4P A;  4LUV A;  1O7Z A;  4QIW B;  3GTO B;  1UUP A;  2B63 G;  3T53 B;  4LFB Q;  3R2T A;  1Y1W B;  5D3D A;  4CGY B;  3BU2 A;  3CME A;  3I7F A;  1OO9 B;  1EY8 A;  2EYL A;  2E74 C;  1GOZ A;  1X65 A;  2F0N A;  3JC6 6;  3SVM A;  3BVG A;  3MXU A;  2IX3 A;  1JE5 A;  2QKI C;  4BS9 A;  2OTJ A;  1EY4 A;  3T51 B;  1WVL A;  1XPO A;  3GTO H;  3H3V C;  1Q7Y C;  1LTS D;  4UPA A;  3HOZ B;  3JAM i;  4FF4 A;  4GN3 B;  4DR5 L;  3SEB A;  4G7H C;  2Z4I A;  4IAL A;  3CQZ B;  1PH2 A;  2F0P A;  3NE5 B;  2EYF A;  5KYL A;  2Z8L A;  1X3Q A;  2M2L A;  4WOR A;  1HJP A;  3VR4 A;  2DN8 A;  4PNY A;  1TS2 A;  3QOL A;  3CF5 A;  4IUN A;  4KD4 A;  3AMU A;  2WKD A;  1VQO A;  4H0L C;  4K8J A;  5F2D A;  3HOZ H;  1JQY D;  1PH4 A;  2BH8 A;  3TP8 A;  3V2T A;  3J7Y W;  2J7Z A;  1ROD A;  3CQZ H;  3J81 L;  3KF8 B;  4MTK A;  2QEX A;  1WD1 A;  2EYO A;  3M4Y A;  1VQ6 A;  1SND A;  5A35 A;  3MEF A;  2UXB L;  3G7L A;  1MHW C;  2F0J A;  3J7A F;  3CPF A;  1F9S A;  2Z9H A;  4DPG A;  4A3L G;  4ZUI A;  3F8T A;  4BXX G;  1NY4 A;  3D0F A;  1Q1E A;  5EBD A;  3Q0A A;  3IL8 A;  5E4W C;  3I3C A;  1LAB A;  4PZ8 A;  4DK0 A;  1KLU D;  2E5L Q;  4HMI A;  4WFN 3;  3H94 A;  4WJ4 A;  4C3J B;  4OX9 L;  1X54 A;  3CCR A;  4QUF A;  4JV5 Q;  1QE6 A;  4F87 A;  3G6E A;  4QJF A;  5DM7 3;  4BY1 B;  4K5V A;  1EL0 A;  3FKI H;  1J5E Q;  3S14 H;  2B29 A;  1EIH A;  4HJ5 A;  2O2L D;  4UP8 A;  2JA5 B;  1DCZ A;  1ET9 A;  1WTR A;  2WV6 D;  2F0U A;  3WWV A;  5E4X A;  2GVB A;  2NN6 I;  1GUN A;  3KLR A;  3A8I E;  3TRE A;  1TR5 A;  4OL7 A;  3HRZ C;  2E2D C;  3GTP B;  4QF4 A;  4KMU C;  4RAU C;  2JA5 H;  4FYD A;  4A3I B;  2IWH A;  4IPH A;  3WOE A;  2CVR A;  3MXN B;  4K0K L;  1HRJ A;  3R93 A;  1VF5 C;  2EJM A;  4B08 A;  1TY2 A;  1EWH A;  4CHT B;  4WJW A;  1WTO A;  2HHH L;  1CQV A;  2IHE A;  1J9O A;  2O4X A;  1CSQ A;  1E2Z A;  1Y69 U;  3GTP H;  4C3H B;  1Q8I A;  2EY2 A;  2Q8I B;  1C7Y A;  3S15 H;  3GDE A;  3E5S A;  1EFW A;  1ILQ A;  2K5N A;  1HZC A;  3A54 A;  5KEE A;  3C3L A;  3NEL A;  2JP1 A;  2TSS A;  1WI5 A;  1WTP A;  1N34 Q;  2AQ3 B;  4C1N I;  1XMO L;  2DY8 A;  1CK1 A;  5G3L F;  1ENA A;  2EXZ A;  3SK5 A;  2BE5 C;  4LJZ C;  3BJU A;  1EEI D;  2WP8 J;  3CC7 A;  4B3T L;  1VQG A;  3TBI B;  5FJ8 G;  4EQO A;  1LUZ A;  1PDQ A;  4EQP A;  5CGK A;  3MHB A;  5FO8 B;  5FO7 B;  4A3L H;  2EOT A;  1A8V A;  1N8R C;  5FOB B;  4CKC A;  2F0V A;  2BA1 A;  4N9T A;  4BXX H;  1DZ1 A;  5C4J B;  1FVI A;  4A93 B;  3K8A A;  1VS0 A;  5BN5 A;  4DV1 L;  5IOD A;  3A7A B;  3MAQ A;  3NWS A;  4KK7 A;  1C48 A;  2PQA A;  4CDE C;  1XJV A;  1JOK A;  2I5M X;  5FLX L;  5IYD G;  1VQH A;  4RGN A;  5C4J H;  1TT2 A;  1B1Z A;  1HUN A;  3NSW A;  3NTI A;  1JOQ A;  2IHF A;  1YIJ A;  2BE5 D;  2RDF A;  2VY3 A;  3RUZ A;  1QWY A;  2HDM A;  4UAI A;  1FJG L;  3KLS A;  3VR3 A;  4X6A H;  4ZCK A;  2K03 A;  1IZ6 A;  3H0G B;  4HN7 A;  3OWF A;  4CDF C;  3NK9 A;  3BDL A;  1JC7 A;  1S5E D;  3DM3 A;  1EWC A;  2QF7 A;  4DKA C;  2IPK D;  4A3E G;  3GTQ B;  3UDX A;  2EQS A;  1VQP A;  2B2W C;  1UE7 A;  1I4Q A;  2F0S A;  3CU7 A;  2D0O A;  1LLR D;  4DAY B;  1A2T A;  4HSV A;  4RHS A;  3PIP A;  4DV7 L;  5C3E G;  5JVH 3;  4JI1 Q;  1DON A;  1VQ4 A;  5CV6 A;  1VQI A;  1JE4 A;  3GTQ H;  1C0A A;  2QDL A;  1H9S A;  5CR3 A;  2BDO A;  2UXD Q;  3SK6 A;  3UE1 A;  3NBH A;  2D2C C;  2L0C A;  1Q90 A;  1S5B D;  5FJ8 H;  2HCC A;  4DV0 Q;  1PRT B;  4LFB L;  2NVY B;  3HG9 A;  2EE1 A;  1L1O B;  3QIA A;  4OWX B;  1PLF A;  3PUZ A;  4G57 A;  5JPM C;  3CMA A;  1KL9 A;  4IFD G;  5EGT A;  3I72 A;  1K0S A;  2VS1 A;  1JB7 A;  1AFP A;  3D4R A;  1NR2 A;  1V43 A;  4Y7N B;  1MBY A;  4UP9 A;  1PFB A;  2A74 C;  1B7Y B;  1F9R A;  4KN4 C;  2NVY H;  2L11 A;  4ZKC B;  3C46 A;  1EQT A;  5JPN C;  2GA4 B;  4L63 B;  5IYD H;  4OEM B;  3QB3 A;  3HKZ G;  1XTC D;  3BYT B;  2NVX B;  3NPP A;  1T9H A;  4A3E B;  2R92 B;  4Y7N H;  1DXM A;  3S2D B;  4R4C A;  4FF1 A;  3NXW A;  4R8I A;  1ESR A;  1FNU A;  1FNV A;  5LL6 X;  3IKJ A;  2A68 C;  5JJK A;  1X55 A;  3DUZ A;  1A3V A;  1TXY A;  4HJ9 A;  2XSC A;  3BDO A;  1VMC A;  2QGQ A;  1LT6 D;  4CJ0 B;  2NVX H;  4A3E H;  4ZKB B;  2R92 H;  1SYF A;  2RF4 A;  4ILW A;  1YBY A;  2DJF C;  1GUG A;  5C0X J;  4G7Z C;  5A2Q L;  1DYQ A;  3PGZ A;  1PRT F;  1B3A A;  2D5D A;  5EPL A;  1MKH A;  1PYB A;  1D2B A;  5BR8 Q;  4JI4 L;  5C3E H;  1A63 A;  2E5L L;  4QQB X;  1HNZ Q;  4JV5 L;  1S3O A;  5G3L D;  1F9Q A;  3HOX G;  4DXF A;  1W6K A;  1XNR Q;  3MC0 B;  5EJW A;  1TY0 A;  2EJG C;  4DR4 Q;  2XGT A;  4GKJ Q;  5ISR A;  1ML0 D;  2PZU A;  3BG3 A;  1K3B C;  1NCV A;  2B2U C;  1GJX A;  3HOY G;  4A3K G;  1AE3 A;  1JWM D;  3WDN A;  1RTO A;  2R7F A;  3L9A X;  2WAQ G;  1K73 C;  1SE3 A;  2EY6 A;  4H13 C;  1B9M A;  4RGM A;  5JJL A;  4IFD H;  1E0B A;  3OOC A;  5I2Y A;  1EFI D;  3GTJ B;  3FMC A;  4RA8 A;  4A3G G;  1EWI A;  2B8G A;  3CCQ A;  4ZUJ A;  1IW7 C;  1PZK D;  1QG7 A;  4IUR A;  4HJ7 A;  1X6O A;  4LW1 A;  1DD2 A;  3KBX A;  3J7Z C;  4DNI A;  1WTQ A;  2R93 B;  4XYO A;  2DUD A;  2FIN B;  1ZYR C;  2B8F A;  4DAM A;  1TWG B;  2CH4 W;  4R4I A;  1HFN A;  4C2M B;  1ESF A;  2JYO A;  2L4N A;  3M7G A;  3RLF A;  2L1B A;  2Z6K C;  2LS0 1;  4BA1 I;  4WRD A;  4GLX A;  2N3S A;  4O2D A;  3IAY A;  2E2H H;  4HTH A;  4OO1 I;  4G7O C;  2DJG C;  1X3G A;  1N34 L;  2Q2H A;  4TVA B;  1EQR A;  1TWG H;  1AP0 A;  1DM0 B;  3FPP A;  3KBG A;  4C2M H;  1G6Z A;  1T5E A;  4LF9 Q;  1PYW D;  1Q1B A;  3OW2 A;  1MI2 A;  4PMC A;  4K6D A;  1NE3 A;  1EOT A;  4ZQ3 A;  3HOX B;  2HIX A;  1Q46 A;  2EYM A;  1Q82 C;  1LM0 A;  3VA7 A;  1IW7 D;  3TEH B;  3DEP A;  4J8Q A;  3IRB A;  2EY1 A;  2OQK A;  2SDF A;  4NKL A;  4O0A A;  4A3K B;  1S5F D;  1WCM G;  1ZYR D;  1SXT A;  4BY7 B;  2KHS A;  3RD4 A;  1PV4 A;  3HOV B;  3DEO A;  1B4O A;  4AYB G;  3HOX H;  5IT9 L;  1EIF A;  1F77 A;  4CDC C;  1NNX A;  4GOP B;  4NMZ A;  4R1J A;  4A3G B;  4BBS G;  4HJA A;  4FF2 A;  1ZEQ X;  2ZXR A;  1O7L A;  3KUP A;  5LMN W;  3D6C A;  4KJO A;  3HOY H;  4CKE A;  1E7Z A;  3UI2 A;  4A3K H;  3SR1 A;  3A0J A;  3MA2 B;  2YTY A;  2WKC A;  2OT2 A;  2WII B;  4PMB A;  5FLX c;  4IO9 A;  2LFN A;  3HOV H;  4ZLT F;  3K5M A;  1QCB D;  3OIQ A;  4OWT B;  4DU9 A;  2NVQ B;  4HMJ A;  5GAG C;  3CCV A;  4A3G H;  1SNM A;  4KV6 A;  1PRT C;  3NQT A;  2KEN A;  3VYR A;  3AFP A;  4ZAI A;  2IL8 A;  1F9P A;  3DHQ A;  3J81 j;  4GZY C;  4DR3 Q;  1LO5 D;  4QGU A;  1N36 L;  4X3K A;  4X64 Q;  4RCN A;  2MNA A;  2LY7 A;  2NVQ H;  2FJ2 A;  2QA4 A;  3FHW A;  4EX5 A;  5ELN A;  1T5X D;  1UE1 A;  2R6G A;  1PFM A;  2UUB Q;  3F1Z A;  5T1I A;  4JI1 L;  1A15 A;  1SNO A;  5JJI A;  5DNF A;  1Y14 B;  2OEO A;  1XTD A;  3I4L A;  5JVG 3;  4PG3 A;  4EQ5 A;  1H95 A;  3OTO Q;  1VF7 A;  4DF7 A;  1QJO A;  4NB3 A;  2UXD L;  3CAM A;  5CC4 A;  2F0L A;  3HGB A;  4JOI A;  5K5P A;  1IXR A;  1SBB B;  1SJH D;  3EQL C;  4V0B A;  2PQE A;  4YWK A;  2IJ0 A;  3OMG A;  2H4O A;  2CQA A;  4DV0 L;  4JI3 Q;  5IIF A;  4EGV A;  3TP7 A;  1LTA D;  1PRT D;  3KYH C;  5I4D A;  4BBS B;  4IFD I;  2K33 A;  1PH3 A;  1HNW Q;  1I4X A;  2CWP A;  2ZT9 C;  3K59 A;  3M4O B;  2NZO A;  1QUQ B;  4GN4 B;  3M9B A;  3AYH B;  4RCO A;  3TZD A;  2BOS A;  3SK4 A;  1U0L A;  1N33 Q;  4YCU A;  1RKN A;  2HQE A;  4X3T A;  2KHJ A;  2CWA A;  3EFX D;  1WYD A;  2F0M A;  3PIO 3;  3KF8 A;  3I4N B;  4BBS H;  1M8A A;  2FMM A;  3T16 A;  1SMY C;  1ENF A;  3M4O H;  4IQZ A;  1HTL D;  1RHP A;  3S17 B;  1HQR D;  2LKV A;  1YIT A;  2AWN A;  3KJP A;  3RNU A;  2VB2 X;  4XIG S;  4K5X A;  1YHQ A;  5ELD A;  5IP9 G;  1Y1V G;  4IOC A;  3OYY A;  5CYU A;  3ULL A;  2KCM A;  5AFW A;  4GKK Q;  2XTI A;  4JBK A;  2B2T A;  1YHA A;  4UDU C;  2XIW A;  4TKO B;  3I70 A;  3PUX A;  1R4P B;  1PH1 A;  5IYC G;  2CFM A;  1V1P B;  5E7N A;  2KEC A;  4FF3 A;  2V1C C;  4IPG A;  1TVX A;  4I7A A;  4K14 A;  4PQX A;  4UY8 C;  5EKK A;  1KNA A;  1K9M C;  1I6H B;  3SGI A;  5BR8 L;  4FXK C;  3H91 A;  1PZJ D;  3S16 B;  1HNZ L;  4ZRZ A;  2A8V A;  1D8L A;  2FHT A;  2Q8T A;  1SMY D;  1I4H A;  3CCE A;  1XNR L;  5C0X I;  4L5R C;  3I8Z A;  4DR4 L;  1K3R A;  4ID6 A;  3I4M G;  4GKJ L;  4X65 Q;  2G9D A;  4DA2 A;  1K8O A;  3RZD B;  1I6H H;  4A75 A;  1TII D;  4KLK A;  4RGO S;  1IBL Q;  3HOU G;  3HOW G;  3S16 H;  2NYZ D;  1ASY A;  1Y8O B;  4DFA A;  3GTG B;  2RDH A;  1UE5 A;  3R2I A;  1SN8 A;  2I5L X;  5GQO A;  3GTK B;  4R4T A;  2A6E C;  3M4Q A;  2AHO B;  3BZK A;  1ENC A;  3RZD H;  5IGD A;  2RHQ B;  1EQQ A;  1IYU A;  1G91 A;  4KI0 A;  1CZG A;  2UUA Q;  3CCU A;  3GTG H;  1LTT D;  5C4X G;  3E3X A;  4A3F G;  4K2L A;  4DR2 Q;  3KLS X;  3LGJ A;  2Q2T A;  4TQU S;  2OF1 A;  3GTK H;  4IZ8 A;  4U68 A;  4K8I A;  2YU9 B;  3FKI B;  1UEB A;  3S14 B;  2KCC A;  4RKB A;  4IUV A;  4LWC A;  1XPR A;  4F7X A;  3K5L A;  1U5K A;  4GOP C;  3K58 A;  1JMC A;  3HZX A;  5IP9 H;  1Y1V H;  3OW7 A;  4MIU A;  1BR9 A;  2B63 B;  3G6J B;  1HQM C;  2B2Y A;  1O7I A;  3MXP A;  3QWN A;  1KXL A;  4JBJ A;  4LF9 L;  3D6W A;  4BWG B;  1HNX Q;  3U4Z A;  4XDX A;  2YU9 H;  1XWE A;  2WFW A;  1EU3 A;  5IYC H;  2A5H A;  1JR0 D;  2A6E D;  3QOJ A;  1CKN A;  4LF4 Q;  1LT5 D;  1X3F A;  1I6V C;  4DR1 Q;  2VQE Q;  1HR0 W;  4ULL A;  1KTK A;  2K01 A;  2D0P A;  3W5O A;  2OWO A;  4KKU A;  1C9O A;  2B63 H;  1VQK A;  1WTV A;  3VYU A;  3HKZ E;  2DY7 A;  5K36 G;  3P1H A;  1K28 A;  4QY7 A;  1ZXT A;  4JYA L;  2XWB B;  4DK3 C;  2Z1C A;  3UE0 A;  1HZ9 A;  5IGB A;  1VQC A;  3KDF A;  3S15 B;  3HKS A;  5C4Z A;  2H1E A;  3UDG A;  4JK1 C;  1SE8 A;  1HFG A;  3CRL C;  2Q2I A;  3V96 A;  5FK9 C;  3HP3 A;  3HOW H;  5C44 G;  3PF5 A;  5IT9 c;  1STG A;  4X62 Q;  1B70 B;  1B44 D;  2B3G A;  5C4X B;  2L15 A;  2XVS A;  2Y0S G;  1TWA B;  3ZJY C;  2JA9 A;  1I4R A;  2PW5 A;  2SEB D;  4AH6 A;  3LWU A;  1G6P A;  1MGS A;  4XT3 B;  1G29 1;  4DAP A;  3J7A V;  4A3B G;  4B3R Q;  4OO1 G;  2I46 A;  1TU2 B;  1HPC A;  4YWL A;  3SE0 A;  2K5Q A;  3AU7 A;  1L0X B;  1TWH B;  1XX8 A;  1K83 B;  2WB1 G;  4YY3 Q;  4DR3 L;  4X64 L;  3W3A A;  4HIO A;  5C4X H;  4A3F H;  5GAE C;  1TWA H;  3T4A C;  4H02 A;  5COR A;  2UUB L;  1EZ6 A;  1CT1 D;  4LF8 Q;  4EVO A;  3SDZ A;  1ASZ A;  3CCM A;  1QNK A;  2DNC A;  4GNX C;  3GD7 A;  2JJQ A;  1EY9 A;  3L7Z C;  1HH2 P;  1NJI C;  3C2P A;  3OTO L;  4YCW A;  3J80 E;  1TWH H;  3FDT A;  3J81 E;  2WAQ E;  1MSG A;  1K83 H;  1SMX A;  2AQ1 B;  1X3E A;  1QVF A;  3DWA A;  2P5Z X;  1IHZ A;  1A6X A;  2D9U A;  2K5H A;  2F0Q A;  1M90 C;  3T1H Q;  2ZM6 Q;  4OXP A;  2C9O A;  2HDL A;  4KHV A;  1LT4 D;  2AMC B;  1IKM A;  1V1Q A;  4HR7 B;  3I91 A;  1YZ6 A;  3O13 A;  4FNF A;  4DV4 Q;  1HZA A;  1CM9 A;  2KUM A;  1HNW L;  3Q24 A;  3M3Y H;  3CPW A;  3PUV A;  5M5X B;  5IGE A;  4A3D G;  5CMD A;  1SR3 A;  2KJX A;  2DNE A;  3MVV A;  5C44 B;  2SNS A;  5K36 H;  5IYB G;  3M7N A;  1N33 L;  1YNJ C;  1VDZ A;  1AN8 A;  1BUV T;  5T1G A;  3UDI A;  2RCF A;  2HT1 A;  3PQI A;  4IJL A;  2Z4H A;  1QOH A;  2F4V Q;  5M5X H;  4NXM Q;  4C3I G;  4X3U A;  5GAH C;  3EA6 A;  3DMU A;  1QIL A;  4WJ3 M;  5C44 H;  3PUW A;  4UP7 A;  4APV A;  4YWM A;  5TSS A;  4PMW A;  3LWE A;  3AFQ A;  2A1A A;  5LL6 S;  2F0O A;  1IYV A;  3MXG A;  1S40 A;  4GKK L;  3BZD B;  2F0T A;  4A3B H;  4OWW B;  4OO1 H;  1STE A;  2ZTE A;  1W3S A;  2EIF A;  3KFU A;  1BCP F;  4GS3 A;  2K5W A;  4AYB E;  1UEA B;  3W1B A;  3H15 A;  2F03 A;  2VXW A;  2EPB A;  2K4K A;  1KHI A;  2VB3 X;  4V19 0;  1YNJ D;  1LYL A;  5E1F A;  1JJC B;  2VQF Q;  2N78 A;  3RLN A;  2QCP X;  2ZJR A;  3TS2 A;  2XRQ D;  2PMZ E;  3NTK A;  3S1N B;  4J6H A;  1I50 H;  1KAW A;  1JWU D;  5KND A;  1PHJ A;  4A3D B;  4X65 L;  2K5D A;  5M3F G;  5JEA J;  3I4O A;  2XRS D;  2F4I A;  1IBL L;  4G4K A;  1Z9F A;  4AQY Q;  1B9N A;  4F88 A;  2F3V A;  3U58 A;  3S1N H;  5I2X A;  4JI5 Q;  3NP8 A;  2PCF B;  3F2B A;  1GXD C;  1ONL A;  3PMF A;  1STA A;  4A3D H;  2K05 A;  2KBN A;  5JEA G;  3QR8 A;  2RKS A;  5IYB H;  3I56 A;  5C5L A;  2RVL A;  1CA5 A;  2UUA L;  1CHQ D;  3PUY A;  1VQB A;  3S1M B;  1HZB A;  2F3I A;  1JOR A;  5C3E B;  4DR2 L;  2XNA C;  3E0E A;  1UNS A;  3A8J E;  1STN A;  1FGU A;  4C3I H;  2R7Z G;  1HUM A;  4JC0 A;  1GUW A;  2BH2 A;  4JCV E;  1HR0 Q;  3F2U A;  3JAM E;  3EJI A;  3R8B A;  1KAB A;  2K50 A;  4LFC Q;  3E6Z X;  3A5U A;  3S1M H;  4B9X A;  2KOL A;  4M8A A;  1OXS C;  1LTL A;  2K32 A;  5EQ0 A;  3G4S A;  2G9H D;  1J5E L;  5FO9 B;  4UHV A;  2JN4 A;  5C0X G;  1VQE A;  1VQ9 A;  4LF4 L;  1NAP A;  2V4D A;  1JJG A;  3BYY B;  4DR1 L;  4IN3 A;  4KTA A;  4CDD C;  4KY5 A;  2NZ1 D;  3D4D A;  1E22 A;  1CHP D;  5M3F B;  2AQ2 B;  4XQQ A;  3F2D A;  4L6T B;  1RJT A;  3U9O A;  1I4P A;  5IWA Q;  1C4Q A;  3EBE A;  2PPB C;  3K80 C;  5HY6 A;  1H9S B;  4MN3 A;  5EBC A;  1LTI D;  4B9W A;  3HKZ B;  2DGY A;  3CC4 A;  4N8X 1;  1FR3 A;  3K0X A;  4MNO A;  1Z6H A;  1XNQ Q;  2E2H B;  4IUU A;  5M3F H;  3KK7 A;  1VQ8 A;  2K6A A;  1ILP A;  5C3X A;  5DM6 3;  5KNB A;  2E75 C;  1DOL A;  2HQL A;  4X62 L;  1BNZ A;  5C6A A;  1BCP C;  2E76 C;  2VL6 A;  4ME3 A;  1EYD A;  3Q6S A;  2R7Z B;  1G51 A;  3E9I A;  1CFM A;  1BXT A;  4B3R L;  3RN2 A;  1EOV A;  2F0W A;  3PF4 A;  1LAC A;  2A6H C;  4FVM A;  3S1Q B;  4YY3 L;  1QVG A;  3T56 B;  1EYC A;  1SEB D;  2XN9 C;  2VZA A;  2B2Y C;  4FXG C;  2JA7 G;  1NUC A;  1OXU A;  3CKI B;  4K6L A;  1QNU A;  1FGB D;  4LF8 L;  2R7Z H;  2Z6B A;  4Q5V A;  2UUC Q;  5IGG A;  2F0D A;  3P7J A;  3U4V A;  5IOC A;  5D3I B;  1EY5 A;  1VCI A;  1BBW A;  3S1Q H;  3HOY B;  1PZI D;  1NR4 A;  1WJJ A;  1RTN A;  2BA0 A;  4TRD A;  2I5H A;  1BCP D;  2J4X A;  1P16 A;  1TKW B;  1CQF A;  2WAQ B;  1X9N A;  3T1H L;  1KAA A;  2MQH A;  1YJ9 A;  2O5I C;  3I73 A;  1FNW A;  5C0X H;  3PO2 G;  2F3W A;  4DUZ Q;  4DV4 L;  3DWQ A;  2D62 A;  3VR2 A;  2PNR C;  1KNE A;  5KRU A;  2A6H D;  1TS5 A;  1Q86 C;  3M85 A;  3RMH A;  4XYQ A;  1WTW A;  1UE6 A;  2UU9 Q;  1DOK A;  1R4Q B;  1SRU A;  4IPC A;  1Q8K A;  4HJ8 A;  1W2B A;  3FPU B;  2OCE A;  3ITP A;  2K52 A;  1GKH A;  1TWC B;  2WIN B;  2HIV A;  3K81 C;  2F4V L;  3TN2 A;  4K0K Q;  4PZ6 A;  1CTM A;  4NXM L;  3ERS X;  1PH8 A;  3AB9 A;  2IX0 A;  4ZYS A;  1SYE A;  2UXC Q;  1I94 Q;  1VQ5 A;  1VQ7 A;  5J22 A;  2RSN A;  4KJN A;  4E6I A;  4A3M G;  4XXE A;  1G8Z D;  4DR7 Q;  2HD3 A;  5C4H A;  1XXG A;  4JBM A;  1TWC H;  1EIY B;  3QJY A;  2H5X A;  4X3S A;  3CW2 C;  2KHI A;  3ZYY X;  3BDC A;  2PNH A;  2B2W A;  2QEJ C;  4QMG A;  3HFZ B;  4FXD A;  4B3S Q;  2PI2 A;  5DLQ E;  1WCM B;  1GHK A;  2E2J H;  3ERQ A;  2ASB A;  5E3F A;  2VQF L;  3DLL A;  4AYB B;  4K2K A;  3LX0 A;  2ZJQ A;  2NTS A;  3GTM H;  4DV3 Q;  1M4V A;  2R61 A;  2PZW A;  1ICW A;  1S72 A;  2JSO A;  2PYK A;  3A56 A;  3KJO A;  3H6M A;  2Y0S E;  3A7L A;  3G71 A;  2PMZ B;  2F0F A;  1WCM H;  2ICE C;  2NB0 A;  5JAV A;  5KGU A;  3T13 A;  3MWY W;  3HS0 C;  5BN4 A;  1BVS A;  4GNX B;  4AQY L;  4JI8 Q;  1JIC A;  5M5Y B;  1Y1W G;  1JWS D;  3NHH A;  3DWP A;  3BZC A;  1GO3 E;  5LMU Q;  4JI5 L;  2N55 A;  1A0I A;  2WB1 E;  3CRK C;  3QG1 A;  2MJ8 A;  4PZ7 A;  4KHZ A;  1VQA A;  5ELE A;  2NTT A;  1YEZ A;  1O78 A;  2A73 B;  3FRP B;  3U50 C;  1S5D D;  2EY5 A;  2NVT H;  5M5Y H;  1SNP A;  1NMG A;  2RHS B;  3AQQ A;  1LTB D;  3STB C;  4DUY Q;  4LF7 Q;  2PO4 A;  4YCV A;  5ELF A;  3L3O C;  2F0K A;  3I90 A;  1B3Q A;  4DV5 Q;  2XWJ B;  2TMP A;  2RDG A;  1KDA A;  1CA6 A;  1HR0 L;  4ABN A;  1OXX K;  1F2Y A;  1MD2 D;  4LFC L;  3K6O A;  2JA6 G;  1V9P A;  5IGF A;  1OXV A;  2G5D A;  1EU4 A;  5JJZ A;  5I9O A;  3W2D A;  1N32 Q;  2I07 B;  2F0E A;  1KQS A;  2CW0 C;  2ZTC A;  3OHX C;  3K5N A;  2RCN A;  1IBK Q;  4M1U B;  1II3 A;  4L5T A;  1PVO A;  3OIP A;  1PA6 A;  1EUJ A;  1JB3 A;  1KC8 C;  1IYJ B;  4OGQ C;  3SK8 A;  2CHB D;  3MXN A;  4IUQ A;  4ODG A;  1QVC A;  3P75 A;  3STB D;  4C3J G;  1D7Q A;  2EVB A;  5IWA L;  4BY1 G;  1VQM A;  1SNQ A;  1VMP A;  1B53 A;  3TP6 A;  1R9T H;  1RD9 D;  1ZKO A;  2EJF C;  1XMQ Q;  2JA5 G;  3S24 A;  2VW9 A;  4KY6 A;  2MUY A;  5KNC A;  5ELB A;  1XNQ L;  5C5M A;  1YJN A;  4YIJ A;  2B2U A;  5IE8 A;  1XPU A;  1SLJ A;  1CKO A;  2K5V A;  1Y1W H;  3TDQ A;  1LTG D;  1B50 A;  1Y1V B;  2CW0 D;  3MEH A;  5EPK A;  4K5W A;  2HUG A;  5CBA E;  1U9R A;  1O7Y A;  3I55 A;  1RF2 D;  4A3I G;  2FMC A;  3X3N A;  4KHP Q;  4DV2 Q;  3KF6 B;  2N88 A;  1B8A A;  5D14 A;  3NWT A;  4RKL A;  2YTX A;  1L0W A;  1YHB A;  3J80 L;  2F0G A;  4O1N A;  2X6L A;  1IBM Q;  2JA6 B;  4RGT A;  2R7D A;  1K8A C;  2QIL A;  1FYC A;  2N8N A;  3BS1 A;  4C3H G;  3OSO A;  1A2U A;  4ALP A;  2Z6K A;  3GV6 A;  3SHL A;  4HAE A;  3BVM A;  2UUC L;  1H9K A;  1HA5 A;  1AZP A;  1D5X C;  4B3M Q;  2X69 A;  4OEL B;  2MPM A;  1D5M C;  1D6E C;  1L0Y B;  3MFG A;  3I4M B;  2A69 C;  2C35 B;  4P2C B;  3PIP 3;  5LMN Q;  2JA6 H;  4LUZ A;  5CV4 A;  2IW3 A;  4JI4 Q;  4JI6 Q;  3HOW B;  3HOU B;  4C1N K;  1U4R A;  1STY A;  1NMF A;  2EYP A;  4OHJ A;  4A4I A;  3PV0 A;  1H9J A;  2Z0S A;  1G2T A;  1RCV D;  3TRZ A;  5HGT A;  2K75 A;  2B39 A;  4L5Q A;  3I4M H;  4RWS C;  4DUZ L;  5EPJ A;  1SYB A;  3PIO A;  2HCI A;  1FD7 D;  3CHB D;  5GRO A;  1S5C D;  2QW7 A;  4A93 G;  4HED A;  4DV6 Q;  1AH9 A;  4I7Z C;  3GTL B;  2UU9 L;  3HOU H;  4C3J H;  2A19 A;  4HSP A;  4BY1 H;  4A3F B;  4RFB A;  4DAY A;  2NWG A;  4TSS A;  1A62 A;  4JBW A;  4FP5 D;  4LFA Q;  2A69 D;  3C1F A;  2MO0 A;  2BCO A;  3GTL H;  4JI2 Q;  1SYD A;  4N8F A;  1SE2 A;  4DR6 Q;  2K28 A;  2UXC L;  1I94 L;  1PH9 A;  5JOB A;  3TP5 A;  4CJ1 B;  3KLW A;  2Q2U A;  1WTH A;  3FVQ A;  1SDF A;  4XQN A;  5M5W B;  3NTH A;  4DR7 L;  1EEF D;  3H0G G;  3G48 A;  4A3I H;  3EVQ A;  5I9P A;  1K8M A;  1MIU A;  4OIJ A;  3SXH A;  3CC2 A;  1L1O A;  4IJH A;  3EN2 A;  2L12 A;  4RMF A;  5IY0 A;  3M3Y B;  4A3C G;  2JA8 G;  4IUP A;  3D8G A;  2OQ0 A;  3MZ5 A;  4QUC A;  1BCP B;  1GHJ A;  2ID0 A;  4B3S L;  1EQV A;  3L0O A;  4C3H H;  3CCS A;  1DOM A;  1C8C A;  2E8G A;  5M5W H;  1D1I A;  2I0Q A;  1ICF B;  4JI0 Q;  1SJE D;  4JI3 L;  2FFK B;  4JI7 Q;  2EYJ A;  4DV3 L;  4P71 A;  2BDN A;  1HA6 A;  2NZH A;  5AJ3 Q;  1E1T A;  3ER0 A;  1TS4 A;  1NBW A;  2CKZ B;  1JT8 A;  5BN3 A;  3N6R A;  4EQN A;  1GM5 A;  1HTP A;  5NUC A;  1VQJ A;  1V8Q A;  3CD6 A;  4LF6 Q;  2KED A;  2OTL A;  4R4Q A;  3PCO B;  1EY0 A;  2Y0S B;  1HCZ A;  1E1O A;  1CKN B;  4JI8 L;  1YNN C;  2EYH A;  4KN7 C;  5LMU L;  4P72 A;  4HCE A;  1BKB A;  4S3S A;  5ELC A;  4A3B B;  4A93 H;  4NPS A;  1DGS A;  1PYS B;  4YHH Q;  4A3J G;  4DN4 M;  3NEM A;  4NXN Q;  3VA5 A;  4KKT A;  2WB1 B;  4LNQ A;  4IPD A;  1EYA A;  3KDF B;  3A5Z B;  3JAM L;  3A55 A;  1EYG A;  1STB A;  4DUY L;  3VR6 A;  4HIM A;  4LF7 L;  3TME A;  1VQN A;  2B2V A;  4HID A;  2JEB I;  3ICE A;  5EKI A;  1E3P A;  4MTN A;  2R92 G;  1U4L A;  2VUM G;  4NDX A;  1I50 B;  4DV5 L;  2KA7 A;  2NBF A;  1N36 Q;  2JA8 B;  4JOI C;  3QO2 A;  3TSS A;  1JCK B;  4Q0F A;  1PTO B;  4IOA A;  2GVA A;  4CBV A;  1YNN D;  1ET6 A;  3T1Y Q;  3H0G H;  2CCZ A;  1IL8 A;  1X3P A;  2ZJP A;  1N32 L;  2LXK A;  4DK1 A;  3CCJ A;  1TS3 A;  3Q23 A;  1D1K A; 
#chains in the Genus database with same CATH homology
 4IFD J;  1PTO H;  1W6J A;  2SOB A;  1CZW A;  1J8I A;  2KVM A;  1AEX A;  4FO2 A;  2F0I A;  3ND8 A;  1EZ8 A;  2KQ3 A;  1GUS A;  2M00 A;  3IFD A;  1BQQ T;  2PW7 A;  5I6Y A;  4C3I B;  4OIK A;  4A3J B;  2VNU D;  1A3T A;  1LTR D;  2R3Z A;  5FLX E;  1BF4 A;  3D3R A;  3K7A B;  2M9V A;  5J1Z A;  3ERO A;  3TZU A;  3ONA B;  5EKL A;  2AUK A;  4KY7 A;  5KIX A;  2B2T C;  4NP5 A;  1DJR D;  5DEH A;  2VUM B;  2AUJ D;  1SNC A;  1PTO F;  3NBI A;  4CKB A;  1PMR A;  2Q8R E;  1TQO A;  3P20 A;  4DAV A;  1E2V A;  1WTX A;  1SFO B;  1PFN A;  1Y8N B;  4R8N A;  1F2Z A;  4DNR B;  3S1R B;  4ME5 A;  5D65 A;  4NW2 A;  2ZXO A;  4C56 C;  3S9W A;  1IKL A;  1Q3L A;  1HHV A;  1BBX C;  1AZQ A;  1KDB A;  3GP7 A;  3U9S A;  2X6G A;  5M3M B;  2E2I B;  2K04 A;  2ZXP A;  1Y8P B;  1GUO A;  2A68 D;  1STH A;  2MP1 A;  1NSN S;  1UAP A;  4KKS A;  3WOF A;  5C3W A;  3BVZ A;  4QB4 A;  2KEE A;  1HXY D;  4KD3 A;  4O42 A;  1SE4 A;  5CV7 A;  5JEA H;  5CV9 A;  4PV1 C;  3FEW X;  3VYT A;  3R3O A;  1JOO A;  1B2T A;  4RHR A;  1GUT A;  1O80 A;  3Q22 A;  1I4G A;  5M9O A;  3DXJ C;  3GQB A;  2MGS A;  3MTS A;  1S4Z A;  3URY A;  1G2S A;  5CBE E;  2O5J C;  2EZV A;  3N52 A;  1F2L A;  1V1O A;  4XQJ A;  1MSH A;  1H9M A;  3H09 A;  3IFT A;  4LAA A;  2J0T D;  5A2Q E;  3LNN A;  4H7B A;  4BBR B;  2NN6 G;  1WD0 A;  3HEJ A;  4BA2 I;  2IT1 A;  2RQX A;  4L8J A;  1PTO C;  4F8M A;  4LK1 C;  2IX1 A;  3C1E A;  1H9R A;  3S2H B;  4XT1 B;  4RH6 A;  3GO5 A;  3K5O A;  4CJ2 C;  1TWF B;  3A8K E;  1EIG A;  1I3Q B;  1SSO A;  4Z9C B;  1X32 A;  1V1P A;  4I65 A;  2LMC B;  2RA4 A;  2JA7 B;  2E2J B;  3MFY A;  3D4W A;  2RSO A;  1D5Z C;  4DGZ A;  2YYZ A;  1SYG A;  2JEA I;  3GTM B;  2L5T A;  3PO3 B;  1RDP D;  1BOS A;  2F0H A;  2SNM A;  3NQI A;  5FKA C;  1OXT A;  1Z47 A;  3V05 A;  1PTO D;  3DM1 A;  2L9H A;  3X3M A;  3D31 A;  4N9P A;  5CV8 A;  2ICI A;  2C5C A;  2K7V A;  4ZK9 B;  3PO2 B;  5CV5 A;  3GV3 A;  3OMC A;  3K57 A;  1SYC A;  1SAP A;  5DAU A;  3K0Y A;  2RBM A;  3VR5 A;  4H44 C;  5J39 A;  2ENB A;  2NVT B;  1U4M A;  2EDG A;  5KYI A;  1XYI A;  3NUC A;  2NN6 H;  2AWO A;  1U4P A;  1BO0 A;  1AW7 A;  2OXP A;  5IT9 E;  2K1B A;  4DNT B;  1E2W A;  1KDC A;  1A3U A;  1LT3 D;  4A3M B;  3ND9 A;  1Q12 A;  2B2V C;  3OWE B;  2KCN A;  5LHY 1;  3RZO B;  1Z7T A;  3OPO A;  1PXU A;  2F1M A;  2WAC A;  1EY6 A;  2PZT A;  4DXG A;  5HUR A;  1KLG D;  2L55 A;  4J1M A;  4R9W A;  2JE6 I;  3VYS A;  1BDO A;  4IUT A;  4XTC S;  5IGC A;  3E0J A;  5COY A;  1EY7 A;  1LV9 A;  4LMQ D;  4U67 3;  4MHE A;  1F2M A;  4HCS A;  2QDB A;  4QCL A;  1R9T B;  1QB5 D;  2MHV A;  1CI3 M;  2JXM B;  2NUC A;  5I6W A;  4QIW B;  1O7Z A;  3GTO B;  1UUP A;  3T53 B;  3R2T A;  1Y1W B;  5D3D A;  4CGY B;  1OO9 B;  1EY8 A;  2EYL A;  2E74 C;  1GOZ A;  2F0N A;  3SVM A;  3BVG A;  3MXU A;  2IX3 A;  2QKI C;  4BS9 A;  1EY4 A;  3T51 B;  1WVL A;  3H3V C;  1LTS D;  3HOZ B;  4FF4 A;  3SEB A;  4G7H C;  2Z4I A;  4IAL A;  3CQZ B;  2F0P A;  3NE5 B;  2EYF A;  5KYL A;  2Z8L A;  1X3Q A;  2M2L A;  4WOR A;  3VR4 A;  2DN8 A;  4PNY A;  1TS2 A;  3QOL A;  4IUN A;  4KD4 A;  3AMU A;  2WKD A;  4H0L C;  4K8J A;  5F2D A;  1JQY D;  3TP8 A;  3V2T A;  3J7Y W;  2J7Z A;  1ROD A;  3J81 L;  1WD1 A;  2EYO A;  3M4Y A;  1SND A;  5A35 A;  3G7L A;  2F0J A;  3J7A F;  1F9S A;  4ZUI A;  1Q1E A;  5EBD A;  3Q0A A;  3IL8 A;  5E4W C;  3I3C A;  1LAB A;  4DK0 A;  1KLU D;  4HMI A;  4WFN 3;  3H94 A;  4C3J B;  4QUF A;  1QE6 A;  4F87 A;  5DM7 3;  4BY1 B;  4K5V A;  1EL0 A;  1EIH A;  2O2L D;  2JA5 B;  1DCZ A;  1ET9 A;  1WTR A;  2WV6 D;  2F0U A;  5E4X A;  2NN6 I;  1GUN A;  3KLR A;  3A8I E;  1TR5 A;  4OL7 A;  3HRZ C;  2E2D C;  3GTP B;  4QF4 A;  4KMU C;  4RAU C;  4FYD A;  4A3I B;  2IWH A;  3WOE A;  2CVR A;  1HRJ A;  3R93 A;  1VF5 C;  2EJM A;  4B08 A;  1TY2 A;  1EWH A;  4CHT B;  4WJW A;  1WTO A;  1CQV A;  2O4X A;  1J9O A;  1Y69 U;  1E2Z A;  4C3H B;  1Q8I A;  2EY2 A;  2Q8I B;  3E5S A;  1ILQ A;  3A54 A;  5KEE A;  3C3L A;  2JP1 A;  2TSS A;  1WTP A;  2AQ3 B;  4C1N I;  2DY8 A;  1CK1 A;  5G3L F;  1ENA A;  2EXZ A;  3SK5 A;  2BE5 C;  4LJZ C;  1EEI D;  2WP8 J;  3TBI B;  4EQO A;  1PDQ A;  4EQP A;  5CGK A;  3MHB A;  5FO8 B;  5FO7 B;  2EOT A;  5FOB B;  4CKC A;  2F0V A;  2BA1 A;  4N9T A;  1DZ1 A;  5C4J B;  4A93 B;  5BN5 A;  5IOD A;  3A7A B;  3MAQ A;  3NWS A;  4KK7 A;  1C48 A;  1JOK A;  5FLX L;  4RGN A;  1TT2 A;  1B1Z A;  1HUN A;  3NSW A;  3NTI A;  1JOQ A;  2BE5 D;  2RDF A;  3RUZ A;  1QWY A;  2HDM A;  4UAI A;  3KLS A;  3VR3 A;  2K03 A;  3H0G B;  4HN7 A;  3OWF A;  3NK9 A;  3BDL A;  1JC7 A;  1S5E D;  1EWC A;  2QF7 A;  2IPK D;  3GTQ B;  2B2W C;  1I4Q A;  2F0S A;  3CU7 A;  1LLR D;  1A2T A;  4HSV A;  4RHS A;  5JVH 3;  1DON A;  5CV6 A;  1JE4 A;  1H9S A;  5CR3 A;  2BDO A;  3SK6 A;  3NBH A;  2D2C C;  2L0C A;  1Q90 A;  1S5B D;  2HCC A;  1PRT B;  2NVY B;  3HG9 A;  2EE1 A;  3QIA A;  1PLF A;  3PUZ A;  4G57 A;  5JPM C;  4IFD G;  5EGT A;  3I72 A;  1AFP A;  3D4R A;  1NR2 A;  1V43 A;  4Y7N B;  1MBY A;  1PFB A;  2A74 C;  1F9R A;  4KN4 C;  2L11 A;  4ZKC B;  3C46 A;  1EQT A;  5JPN C;  2GA4 B;  4L63 B;  3QB3 A;  1XTC D;  3BYT B;  2NVX B;  3NPP A;  4A3E B;  2R92 B;  1DXM A;  3S2D B;  4FF1 A;  3NXW A;  4R8I A;  1ESR A;  1FNU A;  1FNV A;  5LL6 X;  3IKJ A;  2A68 C;  3DUZ A;  1A3V A;  2XSC A;  3BDO A;  1VMC A;  1LT6 D;  4CJ0 B;  4ZKB B;  1SYF A;  4ILW A;  1GUG A;  5C0X J;  4G7Z C;  5A2Q L;  1DYQ A;  1PRT F;  1B3A A;  2D5D A;  5EPL A;  1D2B A;  5G3L D;  1F9Q A;  4DXF A;  1W6K A;  3MC0 B;  5EJW A;  1TY0 A;  2EJG C;  5ISR A;  1ML0 D;  2PZU A;  3BG3 A;  1NCV A;  2B2U C;  1GJX A;  1JWM D;  3WDN A;  1RTO A;  3L9A X;  1SE3 A;  2EY6 A;  4H13 C;  1B9M A;  4RGM A;  4IFD H;  1E0B A;  3OOC A;  5I2Y A;  1EFI D;  3GTJ B;  3FMC A;  4RA8 A;  2B8G A;  4ZUJ A;  1IW7 C;  1PZK D;  1QG7 A;  4IUR A;  1DD2 A;  3KBX A;  1WTQ A;  2R93 B;  4XYO A;  2FIN B;  1ZYR C;  2B8F A;  1TWG B;  1HFN A;  4C2M B;  1ESF A;  2JYO A;  2L4N A;  3M7G A;  3RLF A;  2L1B A;  2LS0 1;  4BA1 I;  4WRD A;  3IAY A;  4HTH A;  4OO1 I;  4G7O C;  1AP0 A;  1DM0 B;  3FPP A;  3KBG A;  1G6Z A;  1T5E A;  1PYW D;  1Q1B A;  1MI2 A;  4PMC A;  4K6D A;  1EOT A;  4ZQ3 A;  3HOX B;  2EYM A;  3VA7 A;  1IW7 D;  3DEP A;  4J8Q A;  2EY1 A;  2SDF A;  4NKL A;  1D1K A;  4A3K B;  1S5F D;  1ZYR D;  1SXT A;  4BY7 B;  2KHS A;  3RD4 A;  3HOV B;  3DEO A;  1B4O A;  5IT9 L;  1F77 A;  4NMZ A;  4A3G B;  4FF2 A;  1ZEQ X;  2ZXR A;  1O7L A;  3KUP A;  3D6C A;  4KJO A;  4CKE A;  3UI2 A;  3SR1 A;  3MA2 B;  2WKC A;  2OT2 A;  2WII B;  4PMB A;  2LFN A;  4ZLT F;  3K5M A;  1QCB D;  3OIQ A;  4DU9 A;  2NVQ B;  4HMJ A;  1SNM A;  4KV6 A;  1PRT C;  3NQT A;  3VYR A;  4ZAI A;  2IL8 A;  1F9P A;  3DHQ A;  4GZY C;  1LO5 D;  4X3K A;  4RCN A;  2LY7 A;  2FJ2 A;  1T5X D;  2R6G A;  1PFM A;  5T1I A;  1A15 A;  1SNO A;  5DNF A;  2OEO A;  3I4L A;  5JVG 3;  1VF7 A;  4DF7 A;  1QJO A;  5CC4 A;  2F0L A;  3HGB A;  5K5P A;  3EQL C;  1SBB B;  1SJH D;  4V0B A;  2PQE A;  2IJ0 A;  3OMG A;  2H4O A;  2CQA A;  5IIF A;  4EGV A;  3TP7 A;  1LTA D;  1PRT D;  5I4D A;  4BBS B;  4IFD I;  2K33 A;  1I4X A;  2ZT9 C;  3K59 A;  3M4O B;  4RCO A;  3TZD A;  2BOS A;  3SK4 A;  1RKN A;  2HQE A;  4X3T A;  3EFX D;  2F0M A;  3PIO 3;  3KF8 A;  3I4N B;  1M8A A;  2FMM A;  3T16 A;  1SMY C;  1ENF A;  4IQZ A;  1HTL D;  1RHP A;  3S17 B;  1HQR D;  2LKV A;  2AWN A;  2VB2 X;  4XIG S;  4K5X A;  5ELD A;  5CYU A;  5AFW A;  2B2T A;  4UDU C;  2XIW A;  4TKO B;  3I70 A;  3PUX A;  1R4P B;  1V1P B;  2KEC A;  4FF3 A;  1TVX A;  4K14 A;  4PQX A;  5EKK A;  1KNA A;  1I6H B;  4FXK C;  3H91 A;  1PZJ D;  3S16 B;  4ZRZ A;  2FHT A;  2Q8T A;  1SMY D;  1I4H A;  5C0X I;  3I8Z A;  4ID6 A;  2G9D A;  4DA2 A;  1K8O A;  3RZD B;  1TII D;  4RGO S;  2NYZ D;  1Y8O B;  4DFA A;  3GTG B;  2RDH A;  3R2I A;  3GTK B;  2A6E C;  1ENC A;  5IGD A;  1IYU A;  1G91 A;  4KI0 A;  1CZG A;  1LTT D;  4K2L A;  3KLS X;  4TQU S;  2OF1 A;  4IZ8 A;  4U68 A;  4K8I A;  2YU9 B;  3FKI B;  3S14 B;  2KCC A;  4RKB A;  4IUV A;  4F7X A;  3K5L A;  3K58 A;  3HZX A;  3OW7 A;  4MIU A;  1BR9 A;  2B63 B;  3G6J B;  1HQM C;  2B2Y A;  3MXP A;  3QWN A;  3D6W A;  4BWG B;  4XDX A;  1XWE A;  1EU3 A;  2A5H A;  1JR0 D;  2A6E D;  3QOJ A;  1LT5 D;  1I6V C;  4ULL A;  1KTK A;  2K01 A;  4KKU A;  1WTV A;  3VYU A;  2DY7 A;  5K36 G;  3P1H A;  1ZXT A;  2XWB B;  2Z1C A;  5IGB A;  3S15 B;  5C4Z A;  2H1E A;  4JK1 C;  1HFG A;  3CRL C;  3V96 A;  3HP3 A;  1STG A;  1B44 D;  5C4X B;  2XVS A;  1TWA B;  1I4R A;  2PW5 A;  2SEB D;  3LWU A;  1MGS A;  4XT3 B;  1G29 1;  4DAP A;  3J7A V;  4OO1 G;  2I46 A;  1TU2 B;  1HPC A;  3SE0 A;  2K5Q A;  3AU7 A;  1L0X B;  1TWH B;  1XX8 A;  1K83 B;  3W3A A;  3T4A C;  5COR A;  1EZ6 A;  1CT1 D;  4EVO A;  3SDZ A;  1QNK A;  2DNC A;  3GD7 A;  1EY9 A;  3L7Z C;  3C2P A;  3J80 E;  3FDT A;  3J81 E;  1MSG A;  2AQ1 B;  3DWA A;  1IHZ A;  1A6X A;  2D9U A;  2F0Q A;  2C9O A;  2HDL A;  4KHV A;  1LT4 D;  1IKM A;  4HR7 B;  3I91 A;  3O13 A;  4FNF A;  1CM9 A;  2KUM A;  3Q24 A;  3PUV A;  5M5X B;  5IGE A;  5CMD A;  2KJX A;  2DNE A;  3MVV A;  5C44 B;  2SNS A;  5K36 H;  3M7N A;  1YNJ C;  1VDZ A;  1AN8 A;  1BUV T;  5T1G A;  2Z4H A;  1QOH A;  4C3I G;  4X3U A;  3EA6 A;  3DMU A;  1QIL A;  3PUW A;  5TSS A;  4PMW A;  3LWE A;  5LL6 S;  2F0O A;  1IYV A;  3MXG A;  3BZD B;  2F0T A;  4OO1 H;  1STE A;  1BCP F;  2K5W A;  1UEA B;  2F03 A;  2VXW A;  2EPB A;  2VB3 X;  4V19 0;  1YNJ D;  5E1F A;  2QCP X;  2XRQ D;  3NTK A;  3S1N B;  4J6H A;  1JWU D;  5KND A;  4A3D B;  2K5D A;  5JEA J;  2XRS D;  2F4I A;  4G4K A;  1B9N A;  4F88 A;  2F3V A;  5I2X A;  3NP8 A;  2PCF B;  1GXD C;  1ONL A;  1STA A;  3PMF A;  2K05 A;  5JEA G;  2RKS A;  5C5L A;  2RVL A;  1CA5 A;  1CHQ D;  3PUY A;  3S1M B;  1JOR A;  5C3E B;  2XNA C;  1UNS A;  3A8J E;  1STN A;  1HUM A;  1GUW A;  3F2U A;  3JAM E;  3EJI A;  3R8B A;  1KAB A;  3E6Z X;  4B9X A;  2KOL A;  4M8A A;  1OXS C;  2K32 A;  5EQ0 A;  2G9H D;  5FO9 B;  5C0X G;  1NAP A;  2V4D A;  3BYY B;  4IN3 A;  4KTA A;  4KY5 A;  2NZ1 D;  3D4D A;  5M3F B;  1CHP D;  2AQ2 B;  4XQQ A;  4L6T B;  1RJT A;  3U9O A;  1I4P A;  1C4Q A;  2PPB C;  1H9S B;  4MN3 A;  5EBC A;  1LTI D;  4B9W A;  3HKZ B;  1FR3 A;  1Z6H A;  2E2H B;  4IUU A;  3KK7 A;  2K6A A;  1ILP A;  5C3X A;  5DM6 3;  5KNB A;  2E75 C;  1DOL A;  1BNZ A;  5C6A A;  1BCP C;  2E76 C;  1EYD A;  3Q6S A;  2R7Z B;  1CFM A;  1BXT A;  2F0W A;  1LAC A;  2A6H C;  4FVM A;  3S1Q B;  3T56 B;  1EYC A;  1SEB D;  2XN9 C;  2B2Y C;  4FXG C;  1NUC A;  1OXU A;  3CKI B;  4K6L A;  1QNU A;  1FGB D;  4Q5V A;  5IGG A;  2F0D A;  3P7J A;  5IOC A;  5D3I B;  1EY5 A;  1VCI A;  3HOY B;  1PZI D;  1NR4 A;  2BA0 A;  1RTN A;  4TRD A;  1BCP D;  2J4X A;  1TKW B;  1CQF A;  2WAQ B;  1KAA A;  2O5I C;  3I73 A;  1FNW A;  5C0X H;  2F3W A;  3DWQ A;  2D62 A;  3VR2 A;  2PNR C;  1KNE A;  5KRU A;  2A6H D;  1TS5 A;  3M85 A;  3RMH A;  4XYQ A;  1WTW A;  1DOK A;  1R4Q B;  3FPU B;  3ITP A;  1TWC B;  2WIN B;  3TN2 A;  1CTM A;  3AB9 A;  2IX0 A;  4ZYS A;  1SYE A;  5J22 A;  2RSN A;  4KJN A;  4E6I A;  4XXE A;  1G8Z D;  5C4H A;  1XXG A;  3QJY A;  4X3S A;  3ZYY X;  3BDC A;  2B2W A;  2QEJ C;  4QMG A;  4FXD A;  1WCM B;  1GHK A;  3ERQ A;  5E3F A;  4AYB B;  4K2K A;  3LX0 A;  2NTS A;  1M4V A;  2R61 A;  2PZW A;  1ICW A;  2JSO A;  2PYK A;  3A56 A;  3H6M A;  3A7L A;  2PMZ B;  2F0F A;  2ICE C;  2NB0 A;  5JAV A;  5KGU A;  3T13 A;  3MWY W;  3HS0 C;  5BN4 A;  5M5Y B;  1JIC A;  1JWS D;  3NHH A;  3DWP A;  2N55 A;  3CRK C;  3QG1 A;  2MJ8 A;  4KHZ A;  5ELE A;  2NTT A;  1O78 A;  2A73 B;  3FRP B;  1S5D D;  2EY5 A;  1SNP A;  1LTB D;  2PO4 A;  5ELF A;  3L3O C;  2F0K A;  3I90 A;  2XWJ B;  2TMP A;  2RDG A;  1KDA A;  1CA6 A;  4ABN A;  1OXX K;  1F2Y A;  1MD2 D;  3K6O A;  5IGF A;  1OXV A;  1EU4 A;  5JJZ A;  5I9O A;  3W2D A;  2I07 B;  2F0E A;  2CW0 C;  3OHX C;  3K5N A;  4M1U B;  1II3 A;  3OIP A;  1JB3 A;  4OGQ C;  3SK8 A;  2CHB D;  3MXN A;  4IUQ A;  4ODG A;  3P75 A;  4C3J G;  2EVB A;  3TP6 A;  1SNQ A;  1B53 A;  1VMP A;  1RD9 D;  1ZKO A;  2EJF C;  4KY6 A;  2MUY A;  5KNC A;  5ELB A;  5C5M A;  4YIJ A;  2B2U A;  3TDQ A;  1LTG D;  1B50 A;  1Y1V B;  2CW0 D;  3MEH A;  5EPK A;  4K5W A;  2HUG A;  5CBA E;  1U9R A;  1O7Y A;  1RF2 D;  2FMC A;  3X3N A;  2N88 A;  5D14 A;  3NWT A;  4RKL A;  3J80 L;  2F0G A;  4O1N A;  2X6L A;  2JA6 B;  4RGT A;  2QIL A;  1FYC A;  3BS1 A;  4C3H G;  3OSO A;  1A2U A;  3GV6 A;  3SHL A;  4HAE A;  3BVM A;  1H9K A;  1HA5 A;  1AZP A;  1D5X C;  2X69 A;  2MPM A;  1D5M C;  1D6E C;  1L0Y B;  3MFG A;  3I4M B;  2A69 C;  4P2C B;  3PIP 3;  5CV4 A;  2IW3 A;  3HOW B;  3HOU B;  4C1N K;  1U4R A;  1STY A;  2EYP A;  4OHJ A;  1G2T A;  3PV0 A;  1H9J A;  1RCV D;  5HGT A;  2B39 A;  4RWS C;  5EPJ A;  1SYB A;  2HCI A;  1FD7 D;  3CHB D;  1S5C D;  4HED A;  4I7Z C;  3GTL B;  4HSP A;  4A3F B;  4RFB A;  4DAY A;  2NWG A;  4TSS A;  4JBW A;  4FP5 D;  2A69 D;  3C1F A;  2BCO A;  1SYD A;  1SE2 A;  2K28 A;  5JOB A;  3TP5 A;  4CJ1 B;  3FVQ A;  1SDF A;  4XQN A;  5M5W B;  3NTH A;  1EEF D;  3EVQ A;  5I9P A;  1K8M A;  4OIJ A;  3SXH A;  2L12 A;  3M3Y B;  4IUP A;  3D8G A;  4QUC A;  3MZ5 A;  1BCP B;  1GHJ A;  2ID0 A;  1EQV A;  1DOM A;  1C8C A;  1D1I A;  1SJE D;  2FFK B;  2EYJ A;  2BDN A;  1HA6 A;  1TS4 A;  5BN3 A;  3N6R A;  4EQN A;  1HTP A;  5NUC A;  1V8Q A;  2KED A;  1EY0 A;  2Y0S B;  1HCZ A;  1YNN C;  2EYH A;  4KN7 C;  4HCE A;  4S3S A;  5ELC A;  4A3B B;  4DN4 M;  3VA5 A;  4KKT A;  2WB1 B;  1EYA A;  3JAM L;  3A55 A;  1STB A;  3VR6 A;  3TME A;  2B2V A;  2JEB I;  5EKI A;  1U4L A;  4NDX A;  1I50 B;  2KA7 A;  2NBF A;  2JA8 B;  3QO2 A;  3TSS A;  1JCK B;  4Q0F A;  1PTO B;  4CBV A;  1YNN D;  1ET6 A;  1IL8 A;  1X3P A;  4DK1 A;  1TS3 A;  3Q23 A;  5FK9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...