1BR9A

Human tissue inhibitor of metalloproteinase-2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
182
Chain Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METALLOPROTEINASE-2 INHIBITOR
publication title Three-dimensional structure of human tissue inhibitor of metalloproteinases-2 at 2.1 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor
total genus 50
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 1998-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1br9A02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1br9A01
1PXUA 2XWBB 2WINB 3HS0C 5FO7B 2I07B 1D2BA 5JPNC 3FRPB 5JPMC 3CKIB 1BUVT 3G6JB 3KLSA 3HRZC 3I70A 2E2DC 5FO9B 2B39A 2A73B 1UAPA 2QKIC 3V96A 1BQQT 1JB3A 2WIIB 3OHXC 5FO8B 2A74C 1UEAB 3T4AC 3CU7A 3MA2B 3L3OC 2XWJB 1OO9B 1BR9A 4ILWA 4FXGC 1GXDC 2J0TD 4FXKC 2TMPA 5FOBB 1XWEA 1JC7A 2ICEC
chains in the Genus database with same CATH superfamily
1RD9D 1Q12A 1C8CA 3GTGB 2OTLA 4QMGA 1U4LA 4A3JH 1U4PA 5J22A 4YCVA 2FXQA 3A5UA 5E7NA 4R4TA 2XIWA 2G9HD 4ZUIA 1I6HH 4A3FH 4R1JA 4QL5A 3UDGA 4A3BH 4OO1G 3QOJA 4DV1Q 1K8AC 1YITA 2K33A 1A63A 2EQSA 2R93H 4J8QA 5KRUA 4OGQC 4HCEA 2P5ZX 2PZUA 1EWIA 1HNZQ 2VQFQ 4LF4L 3KF6B 4FNFA 2LMCB 3QIAA 1SNOA 5M5YH 4HTHA 1AW7A 3MZ5A 4GN5A 4A4IA 5IY0A 1G51A 1IBKL 1EOTA 2Q8TA 5A2QL 4ODGA 3CCVA 1SSOA 4KK7A 4GLXA 2KBNA 1E0BA 1YI2A 4C3HG 4X6AH 1KLGD 4HR7B 1L0XB 4IUNA 3I4OA 1W6JA 3U58A 1H9KA 2MPMA 3K8AA 4X64L 4DUZQ 3T1HQ 2EJGC 3HOYG 5M3FB 1G2TA 2JA7G 1G91A 4G57A 2L0CA 4JVZA 5JVG3 3K6OA 1JE4A 1EY5A 2LS01 1VQDA 2A8VA 4HMIA 2JP1A 1HQMC 4O0AA 3PUYA 2HIVA 2M00A 1SNQA 5A2QE 3RMHA 5DAUA 1SMYD 4ZKBB 1UE5A 4H0LC 3AQQA 4LF6Q 2O2LD 4PZ6A 2KCNA 2EXDA 3GTQB 4M8AA 2JA9A 1S4ZA 3E3XA 4C3IG 1TWHH 4JI6Q 1I6VC 5C3XA 1Q82C 4ME5A 3PSIA 1SMYC 3S14H 5E3FA 1SE2A 2QILA 3S1QB 1EQVA 2JYOA 2XWBB 1PVOA 4ZKCB 2FMMA 1BBXC 2HD3A 1DONA 2IW3A 4UY8C 4BXXH 2A73B 4KI0A 1K8MA 1NBWA 1H9SB 2ZXOA 5DM63 1BCPC 1DGSA 3SDZA 1H9JA 4FVMA 5HGQA 4A93H 1B3QA 5JJZA 4DV0Q 4LJZC 3FKIG 2Z1CA 3J81L 4CKBA 1GKHA 2OXPA 2ATWA 1PRTB 4C3HB 3MC0B 3A8JE 4FXDA 4A3GB 1UAPA 1TU2B 4JI5L 1TXYA 1IYJB 4JBKA 4ULLA 3TBIB 4A3IB 4JG2A 1VQPA 3V2TA 1P16A 1MSGA 3HOYB 3OMCA 1HPCA 2VW9A 1DOLA 2N8NA 2NVXB 1KHIA 2Q2TA 5FLXL 5KIXA 1BKBA 3EFXD 3LWEA 1N9WA 5C5MA 4IPCA 4IJLA 3BZCA 3BVZA 2EDGA 3D4DA 3E6ZX 3U4VA 2KA7A 3J81E 2N49A 5LMNQ 3J80L 4RCOA 2NVQH 4A75A 1K3BC 3F2DA 4RFBA 1VF7A 3I4NG 5M3MH 1E22A 4C3IB 1TWGB 3I90A 1IXRA 4A3KH 1D5MC 2VZAA 3A8KE 4XYQA 3BDOA 5FLXE 1OTCA 3STBD 4CJ2C 2CW0D 2V4DA 1QUQA 2OF1A 3HRZC 3S1RB 4A3GH 1HUNA 1AZQA 3CCLA 3VR3A 1WOCA 2A6HC 1F2LA 1HA5A 4K8JA 2E2JH 1LTBD 3RZDH 3I8ZA 4DUYQ 2IJ0A 4POFA 2F0GA 1EIHA 2NN6G 3TP8A 4DR4Q 3D6CA 4WORA 3TZUA 2BA1A 3J80E 2R7ZG 3WWVA 2F0FA 2DY8A 2PQAA 3GD7A 4QIWB 2EYJA 3VR5A 5C44H 4WFN3 4YCUA 4GKJQ 2RF4A 1STAA 3BZKA 4YIJA 1V1PA 3KLRA 1JE5A 3D4WA 3G4SA 3K59A 3FKIB 1TWAB 3GQBA 3AB9A 2CFMA 3HZXA 1SBBB 1CQFA 3D0FA 2ZXPA 3K0YA 4NDXA 3EJIA 3BU2A 2QDLA 3F8TA 1JJGA 4QIWE 1L1OA 3TRZA 2FJ2A 3D4RA 2RSOA 3ZYYX 4F88A 2TSSA 2I5HA 3NBHA 3S1RH 1ZKOA 5GAGC 5KNDA 2IPKD 1PH7A 1E7ZA 3NP8A 3PIP3 1G6ZA 1RJTA 3T51B 4DUYL 1XMQQ 1HNWQ 4DR4L 2VQEL 5E4XA 4G4KA 2Z0SA 2R61A 4JI0Q 2XRQD 3I7FA 4KY5A 1JC7A 2F03A 2B2WA 1TS2A 3TP5A 5JPNC 1RL2A 1H9RA 1I4RA 5FKAC 4KD4A 2SNMA 2FHTA 1X32A 2GN5A 5CBAE 1VQBA 3L7ZC 4BWGB 2NYZD 1BNZA 3PUVA 4QF4A 2F0KA 1M1KC 1ICFB 2PMZE 1A8VA 1MBYA 3S16B 2AQ2B 1DJRD 4JI4Q 3U4ZA 1IL2A 1D7QA 2D5DA 2NVTH 3LNNA 3NTHA 4YCWA 4DN4M 2I07B 1CSQA 2R7ZB 2K5QA 1ZYRC 4C2MH 2NB0A 4L5SA 1STYA 2E2HB 2JQOA 1EEFD 4PMBA 3HOXG 1PH2A 2NZHA 1N36Q 3PO2H 1GUGA 1XTCD 2LXKA 4A3MG 1GUOA 1LT5D 1ICWA 2ES2A 2B2UC 4DR2L 5IGCA 2MUYA 4PV1C 4DK1A 4R4IA 2EY6A 2F0JA 3H91A 2NZ1D 1E2WA 4JI0L 1EY7A 2K50A 2ZTCA 3L9AX 1OXSC 4LFCL 3J7ZC 1WCMG 4I65A 2AUJD 4DR6Q 3NTIA 1VQ5A 5C4HA 2F4VL 3NEMA 4A3LG 4DV6Q 2EYOA 3BVMA 4BS9A 3PF5A 3KBXA 5C0XJ 2CHBD 4AH6A 3VYTA 1Q1EA 2G5DA 4IFDG 2UU9Q 1XWEA 4YHHQ 5D3IB 3E9HA 1GVPA 1IL8A 1R4PB 3BDLA 4MTNA 1BUVT 2VUMH 2XTIA 3Q24A 2K14A 4AYBB 2UXBQ 5D3DA 1PRTD 2RHQB 3VR6A 1TKWB 2MJ8A 2XGTA 1B70B 4JK1C 3HOVH 2E74C 2NWGA 4NXML 3C1FA 4GOPA 4PNYA 4JI1Q 5D14A 4KN7C 1I4XA 3G71A 3PGZA 1MJCA 4J1MA 5CV9A 1K9MC 3RLFA 1PRTC 1NSNS 2K04A 4AIMA 4B3TL 4C3JG 1JWMD 4RMFA 4GNXA 4DR6L 3K58A 2Q2UA 4AYBE 1A0IA 1KTKA 2L12A 2GVAA 1EYAA 1Z6HA 3MVVA 5IE8A 1NTGA 1WVLA 5LMUQ 1N8RC 1X3EA 2RSNA 4MNOA 1LABA 2BDOA 1B3AA 3PUWA 5LMNW 4JV5Q 2DUDA 2AKWB 4X3SA 3KDFB 3CCSA 2WP8J 1R9TH 4A3MB 2VY3A 4DXFA 4DV4Q 2B2VA 1CI3M 2IHEA 2UU9L 3PMFA 5K5PA 4QJFA 5KEEA 1HR0L 4DKAC 2JA6H 5EJWA 1UE6A 1JOOA 4H13C 4BA2I 1I4GA 2N55A 1B50A 2NTSA 1Z7TA 4CDEC 2F0NA 1DYQA 3V05A 2UXBL 5IWAQ 1WCMB 2D2CC 4DPGA 2PZTA 1CHPD 4BY7H 3GTOB 3CF5A 4MN3A 5IP7G 3TZDA 1VQ6A 4QUFA 3EVQA 1S40A 1GD7A 3C2PA 4A3DG 1A2TA 3NBIA 1IW7D 1PH3A 5C0XI 1UE1A 5H1SE 4ZQ3A 2F0UA 5IP9H 3IL8A 3MTSA 1U4RA 1H95A 3JAMi 1ONLA 1DCZA 4EQOA 1DOKA 3J7AF 1E24A 1LACA 2MO0A 2UUBQ 4RKLA 1I4PA 3MHBA 1HH2P 1IKLA 2CH4W 4PQXA 5C4ZA 2ZJRA 4JV5L 1YNNC 4PMCA 4JI7L 2E2IB 1WYDA 4K5XA 1JR0D 2RHSB 4DNIA 4IPHA 4RWSC 1EIFA 1XX8A 2F3WA 2Z6KA 1DM0B 1XNRQ 1VDZA 3KYHC 4A3FG 4JI2L 2EPBA 1Y1VG 2WKDA 2LXJA 5IWAL 4C3JB 2K28A 1U4MA 1W2BA 1A2UA 1F2YA 3BG3A 4FXGC 5KGUA 5IT9c 1CT1D 1I4HA 2ZM6Q 4B9XA 2B63G 2E8GA 4DF7A 1F2MA 5CGKA 3R93A 4DR3Q 2YU9H 1WJJA 4HJ9A 4Z9CB 1VQHA 5C4XG 3CQZH 1EY6A 2C5CA 1EYDA 2VL6A 1TIID 4BBSB 5CV6A 3P1HA 3CCRA 1B1ZA 2UUBL 3S17B 5EQ0A 4QQBX 2N3SA 2L9HA 1ET6A 1CKMA 3HKSA 2KECA 4KKUA 5BN5A 3GTMH 3PO3G 5C3EG 2CH4A 1EZ8A 1XNRL 3SR1A 5FO9B 1B44D 3KLWA 4A76A 2QF7A 1VQAA 4R8NA 2RCNA 5ELOA 2CCZA 5GQOA 4WJWA 4IJHA 2AQ3B 3OOCA 4OX9L 1SLJA 5GAHC 3CAMA 1S5ED 4BY1G 5JAVA 4X65L 1CTMA 1NR4A 4LF5Q 3FMCA 2DJFC 1K0SA 1X3GA 1GUTA 1EYGA 3S17H 2B2TA 4RHSA 3HOZB 2MFIA 3CW2C 1JJCB 1EU4A 1Y1VB 4HAEA 4BXXG 2H4OA 2B8FA 5FO7B 3FP9A 5EPJA 1K83B 1LTTD 4N8FA 5HURA 2ZTEA 2F0HA 3F2CA 2B63B 1EY9A 4X64Q 2KQ3A 4U68A 1CSPA 3CXCA 2BDNA 3K7UC 3SK6A 1SE8A 4YWKA 4OONA 1HA6A 1CQVA 5J1ZA 3JAML 4A93G 5C4XB 3MA2B 2OTJA 3MXNA 2K5HA 2B2YC 2QGQA 2JA5G 3HOWB 2IWHA 3HKZG 3Q0AA 1PTOF 1QILA 4YWMA 2GA4B 1IYUA 3NQTA 2F0SA 1M90C 1EYCA 3K7AH 1KDAA 4HEDA 3NK9A 4LF5L 2B39A 3HOUB 1BF4A 3PO3B 5CC4A 2K7VA 5C3EB 1L1OB 1N32L 3W1GA 5I9PA 2WV6D 5M9OA 2EZVA 4A3CG 2I46A 2DNEA 4CKEA 4GS3A 3TMEA 1O7LA 3WOEA 3M4QA 4IOAA 3PIOA 4XT3B 3GTGH 4G7OC 1XTDA 2QCPX 1Y8PB 2IL8A 4DNRB 4P72A 1HFGA 1L0YB 1J5EL 1PZID 3F1ZA 4HJ5A 4LF7Q 1SAPA 4XT1B 4BY1B 4Q5VA 3OHXC 3K80C 5M3MG 1F9RA 3MXUA 3KJOA 4LW1A 1HZBA 1QE6A 1FNWA 2RQXA 4X3TA 1SNDA 1OXTA 2EJMA 5TSSA 4X62L 5CMDA 5K36G 1I94Q 1STGA 2VNUD 1EU3A 1PYBA 3HOUH 1QVCA 1V1OA 3S1MB 3NENA 5FJ8H 2IT1A 4JI5Q 2X6GA 1EFID 3R2TA 1K8GA 1JORA 3KBGA 1S5DD 5C44G 3F2BA 4K5VA 5JOBA 4C1NK 2AQ1B 2RA4A 1NUCA 2GVBA 2KCTA 5C4JB 2ICEC 1HRJA 5EBDA 2WAQG 4OIJA 4NW2A 3GTJB 3VR2A 4L5RC 2JA5B 3VA5A 2DN8A 3NWTA 3H0GG 3P20A 3CCUA 2F0OA 1PTOD 1WTVA 1K0RA 5M3FH 1D5XC 1X9NA 3V96A 1GJXA 4LF7L 1K28A 2FINB 5F2DA 4RHRA 3PQIA 1I4QA 3NTKA 3A56A 1UEAB 4LMQD 4UHVA 1RDPD 1RF2D 2SEBD 5IYDH 4RGMA 2ASBA 1A6XA 1D6EC 1E1OA 2NBFA 3Q8DA 3HFZB 1IYVA 1AH9A 1I94L 4RGNA 3GTQH 4LUVA 1KDCA 3U9SA 3M9BA 1B2TA 3HEJA 1D8LA 2R92G 3TSSA 4P74A 4CDFC 4PZ7A 4XTCS 3OTOL 3AYHB 3K5NA 1PH1A 3RR5A 3K5LA 4HIDA 1ZXTA 5C4JH 2JA7B 2Q8RE 3TS2A 3S1QH 1EIGA 4OXPA 4BBRG 1WTHA 3R8BA 2PNRC 1PH5A 2HIXA 5COYA 4OO1H 3A54A 4IN3A 4MZ9A 3NE5B 1QG7A 3OPOA 1KL9A 1KRTA 4TQUS 2J4XA 5IYCG 1KQSA 2AUKA 3CC7A 2XVSA 2IY5B 1W6KA 2A74C 3MFYA 2PQEA 3T4AC 3WDNA 4HJ8A 1E2VA 4LF8Q 3GV3A 1TWFB 3KJPA 3EA6A 1CKNB 1JT8A 4DXGA 4WJ4A 1F77A 2PI2A 4DV5L 4H7BA 1PA6A 5IODA 4P75A 2ENBA 3Q22A 4P71A 3SK8A 2G9DA 3MXPA 3UI2A 3SXHA 1XMOL 2PW5A 1U0LA 3LGJA 4C3HH 3E9IA 4RCNA 1B8AA 2A68D 5I2XA 3NQIA 3K5OA 2WAQB 4A3IH 1DD2A 1YNJD 1ENFA 1WTRA 3HOYH 1HTPA 3CRLC 1CA6A 1CHQD 2VQEQ 3I2ZA 1OO9B 2N78A 3MWYW 5G3LF 2NVXH 1CUKA 4A3EG 2L1BA 1YVCA 3STBC 2CW0C 1U9RA 2A68C 4FYDA 4K8IA 3KF8B 1RIPA 4QY7A 2F0IA 2MP1A 1MD2D 3JAMc 1VQJA 5I2YA 2WAQE 1VMPA 2F0QA 4B3SL 1SJHD 3QOLA 2ALYB 2JEAI 2K4KA 1V9PA 1FNVA 1FR3A 2R92B 3KOJA 4LF8L 3FVQA 4JOIC 4C3IH 1TWCB 1TWGH 1QJOA 4G7HC 3S2DB 4X3UA 1BDOA 1A3TA 4BBRB 3SK4A 4RGTA 3SVMA 1IBLL 1GUSA 1SNPA 3KUPA 2L15A 1HZCA 2AWNA 4LFBL 1Q46A 4ALPA 1JICA 3ND9A 5JEAG 4DR2Q 5HGTA 2PW7A 2R7DA 1N33Q 1QB5D 1B53A 3OW2A 1BOSA 3A7AB 4K14A 1WTQA 3DEOA 4TRDA 5GADC 5M5WB 3N52A 3I4MG 4CKCA 4DR1L 1LTRD 1WD1A 2JA8G 4LFCQ 3QO2A 5IT9L 1EWHA 1RODA 3GP7A 2PPBC 4UP9A 1VQ7A 1SYGA 3I4NB 2F4VQ 4I7AA 4KTAA 2RDGA 1X3PA 3FKIH 2K1BA 1EQTA 1TWAH 3OIQA 1TS5A 3GTLB 3GTPB 3KK7A 1PH4A 3OW7A 2MGSA 3R3OA 1CM9A 2C35B 5ISRA 1M4VA 1K3RA 1O7YA 4V0BA 1JJ2A 3ERSX 1KC8C 2JA6G 3T13A 2K03A 1TWCH 4OO1I 4Y7NB 2WB1G 3C3LA 4RGOS 1GM5A 4P2CB 5G3LD 2KHIA 1LV9A 2FMCA 3DWQA 1Y8OB 2XNAC 3M7GA 3KLSX 3DLLA 4A3EB 1QNUA 3RN2A 4BY7G 2Z8LA 2B2UA 2JEBI 5JJIA 2JK8A 2KVMA 1AE3A 5IT9E 2A1AA 2KENA 5C0XH 2D62A 2EIFA 3AMUA 1II3A 4LFAQ 5CORA 3T1YL 5IYBG 1Q3LA 1RKNA 4UP8A 3C46A 1GHKA 4NXMQ 1TS4A 2K32A 5L37A 1Y8NB 1N33L 1SMXA 2X6LA 2DY7A 1JCKB 3AFQA 4RAUC 1BVSA 2HHHL 1G6PA 2B3GA 2HCCA 3W5OA 4HCSA 4B3TQ 3GV6A 2ICIA 2MHVA 1MI2A 1EL0A 1RTOA 4KKSA 1NMFA 3GTPH 4IPGA 1B9NA 1EQQA 4DR5Q 2K6AA 3IFTA 1Y69U 5CBEE 3S16H 1QZHA 4Y7NH 2Z4HA 1G291 1AE2A 1ENAA 1LO5D 4IQZA 5IGBA 1HNXQ 2NN6H 1J6QA 2BE5D 4X66Q 4K6LA 3I56A 1H9SA 1T5XD 3HS0C 1HR0Q 2R7ZH 3G48A 1UEBA 2E2HH 4KV6A 3J7A5 2BH2A 3RZOB 4ABNA 4LF9Q 3I4MB 3CRKC 2E2DC 1G8ZD 1LUZA 1KABA 1D5ZC 4EVOA 3M3YB 2X69A 3E0EA 5BN4A 2H5XA 3S2HB 1F9PA 4LFAL 1HJPA 2PNHA 4HIOA 3CCEA 1LTLA 2QEJC 1NE3A 2L55A 1TVXA 1W3SA 3W3AA 1BBWA 5FLMG 2MNAA 4NPSA 1XXGA 3NELA 3P75A 2FFKB 1S5BD 1KXLA 4B9WA 4OEMB 1P8LA 3F2UA 1S5FD 1S3OA 4DR5L 4R4OA 4KN4C 3RLNA 4WRDA 3HOXB 2Q2HA 4JI7Q 2A5HA 1HNXL 1VQIA 2Y0SG 4LK1C 3H15A 4X66L 1D2BA 3H3VI 3RZOH 5BR8Q 3QG1A 1EUJA 1MGSA 3K81C 1LLRD 2F0VA 2EYPA 3T56B 2UUCL 4LF9L 1AN8A 4JI2Q 3A8IE 3M4PA 1HTLD 2B8GA 4N8X1 5GROA 3VDYA 3TQYA 1LTAD 1I5FA 4R8IA 2JSOA 1L0WA 1SRUA 1D1IA 4DAMA 1O7ZA 4MTKA 3GTKB 3H09A 4KMUC 1E3PA 3SK5A 2EY1A 3I55A 3QWNA 1SE4A 2BCOA 4AQYL 2I5MX 4FF4A 2EE1A 3K5MA 1HZ9A 5M5XB 1Y1WG 2Z9HA 5IGGA 2RKSA 4IALA 1NY4A 4PG3A 1BBUA 3HOXH 3A5ZB 1IW7C 2N88A 1LT4D 4A3MH 1SYFA 2DNCA 3ULPA 1TY0A 4A3JG 3BJUA 3I3CA 2KCMA 3DWAA 1TQOA 3S9WA 5BR8L 2QA4A 1PTOB 4XDXA 3H3VC 2EY5A 3FEWX 5NUCA 1WCMH 4OL7A 3I91A 3GTOH 1BQQT 4Y52H 4A3BG 4ZCKA 1EWCA 3OIPA 4A3LH 1NR2A 2NN6I 4JI3L 2AHOB 1VQKA 2R93G 5ELFA 3GTKH 2K52A 1PYWD 4OX9Q 3A74A 2MQHA 1X6OA 4R9WA 4PMWA 3DM3A 2F4IA 1C48A 1DZ1A 3RUZA 4IFDH 3TS0A 4CDCC 4X65Q 3D3RA 4RG1A 2RDFA 2Y0SB 4O42A 2HCIA 4DV2L 2IX1A 4KD3A 4U673 3BVGA 2KUMA 3CC4A 3TEHB 4XQQA 3VYUA 4QUCA 1JMCA 2NVYB 4DA2A 3L3OC 4FO2A 5I6WA 1PFBA 5I9OA 2E2IH 4UDUC 1Q86C 1XJVA 1SXTA 1GXDC 4M1UB 3NXWA 2L11A 1GUNA 1IHZA 1LTGD 1S72A 1VQGA 4A3DB 2KHSA 2I0QA 2Y0SE 3S24A 1SE3A 5JVH3 1C4QA 2BA0A 3S15B 4RKBA 4C3JH 4JI8Q 4F8MA 2F0EA 4DAYA 2H1EA 4XYOA 1V43A 4IFDJ 4TVAB 2YTYA 4EX5A 2RVLA 1Y1WB 2F1MA 1FNUA 3W2DA 3HG9A 4GLAC 5E1FA 2UXCQ 4GKKQ 2RCFA 1UWVA 2RBMA 2VB2X 3P7JA 4BBSH 4DK6C 1SEBD 1EZ6A 1N32Q 2I5LX 3EN2A 3CCQA 1Z9FA 2K01A 5AFWA 1I6HB 4A3FB 2E76C 3VYSA 1NNXA 2QW7A 2UXDQ 3Q6SA 4K5WA 5IP7H 4PZ8A 1QUQB 4A3BB 4FXKC 1NAPA 3U9OA 1TS3A 1YHQA 1NCVA 4A3DH 3FRPB 2R93B 3MAQA 2D0PA 3MXGA 1VQCA 1ESRA 1J5EQ 3SEBA 4OELB 1LT6D 2NTTA 1QNKA 5IYDG 4BA1I 2B2YA 1SJED 2PQAB 4JI8L 2ZT9C 4L63B 5EKKA 5BN3A 1N34Q 3DUZA 1V1PB 4ILWA 3J81i 5IGEA 1U5KA 1JQYD 1I50B 2E5LL 2VB3X 2F3IA 4X62Q 2DJGC 4LUOA 1WD0A 1QCBD 5ELDA 5IIFA 4XXEA 2UXCL 4GKKL 1AZPA 2SDFA 1O7IA 2WKCA 3HGBA 1GOZA 3EBEA 3HOZH 1CFMA 4JBMA 5J3BA 4IURA 4OWXB 3D6WA 3X3NA 1VQ4A 1Y1VH 2E75C 3IKJA 1SROA 3K0XA 3NBHB 2NZOA 1BCPF 2UXDL 1VQEA 3PCOB 5E4WC 5LL6X 3JAME 3OYYA 4IFDI 2F0DA 1VQLA 1PFSA 1K83H 1XPRA 1MJEA 2EJFC 1M8AA 2B63H 3KDFA 3J80i 3G6JB 5DLQE 4B3ML 1PYSB 2EYFA 2NUCA 2UUAQ 4LNQA 4HSPA 3DHQA 5C4XH 4FP5D 4EQNA 4R4QA 1TWHB 4A3KG 1N34L 1A62A 1I50H 4IUUA 2JE6I 1VMCA 3S14B 1XYIA 3HOWH 1HQRD 1LTID 3FHWA 4A3GG 3MEHA 5I4DA 5KYIA 3VYRA 4A3IG 1F9SA 1TR5A 1X3FA 1VQMA 1EIYB 3J7YW 2PCFB 2XN9C 3NSWA 3PO3H 5C3EH 5IGDA 1BO0A 3GO5A 3ONAB 3CHBD 1HUMA 1Z47A 3R2IA 4B08A 1EY4A 2A69D 4DFAA 3OTOQ 2CQAA 1PZJD 1JOKA 2XWJB 2F52A 1AEXA 4DV1L 4IUVA 3K57A 2O4XA 3C1EA 2R3ZA 3TDQA 1DXMA 4A93B 1HZAA 1STNA 5ELNA 1YJNA 1R4QB 3DEPA 1PHJA 2M9VA 1GUWA 2MO1A 1HNZL 2A69C 1FL0A 4KHVA 3TP7A 2VQFL 3EROA 3M4YA 3HKZB 4BY1H 3ER0A 3TREA 2UUAL 1V1QA 3D31A 5T1GA 1A15A 3HP3A 3AEVA 1VCIA 4J6HA 4EQ5A 1EQRA 4APVA 3J81j 1SFOB 4DV5Q 3CP0A 2K5DA 2Z4IA 2WINB 1YJWA 1BCPD 1KDBA 1PTOC 2BOSA 4CJ1B 1XMOQ 1QOHA 3CKIB 4KY7A 5EKIA 4O1NA 3EIVA 3S1MH 4DUZL 2OQKA 3T1HL 3HKZE 1AP0A 4KKTA 1YBYA 4ZAIA 3QB3A 2NVQB 1X54A 1T5EA 2F0MA 3BYYB 3T16A 2YV5A 5M3MB 4MHEA 2PO4A 3PUXA 4A3KB 3GTJH 4WJ3M 1MSHA 5JJKA 3PIPA 2JA5H 4LF6L 3PUZA 1XNQQ 1MIUA 3UE1A 3PIO3 4GOPB 1C7YA 2JJQA 2A19A 5DEHA 2E2JB 3RZDB 1Q8KA 4B3SQ 2OT2A 3RN5A 5KNBA 4JI6L 5EPKA 2A6ED 1SFOH 3TP6A 4GNXB 1SN8A 1Q8IA 4A3CH 4UP7A 1K73C 5C44B 5J39A 5C0XG 3U50C 4DNTB 3PO2G 3M4OB 4QGUA 1E1TA 1IBLQ 2D0OA 2SOBA 3G6EA 1KNEA 2A6EC 4LFBQ 4MIUA 5CV7A 4LAAA 4NMZA 4RA8A 3CCJA 3E0JA 4EQPA 1GO3E 4DAVA 3IAYA 3H0GB 5DM73 1YZ6A 2A6HD 2JA7H 2C9OA 4L5QA 4K6DA 2CVRA 1PFMA 4JCVE 1ET9A 4EGVA 4DR1Q 4DGZA 4DV0L 2KEDA 1X3QA 3M7NA 3URYA 4HJ7A 2F0TA 5ELEA 1AFPA 1YNJC 1XNQL 1WTXA 5K36H 2DGYA 1QVGA 4JOIA 2Z6BA 2K5VA 1LM0A 2EOTA 5D65A 1IZ6A 1KD1C 2PYKA 4E6IA 1B4OA 1TWFH 1J9OA 3OWEB 1BR9A 5JJLA 2KEEA 4UAIA 5I6YA 1JB7A 1YNXA 2F0LA 3UDXA 1OXVA 4CDDC 1ASZA 2VUMG 3H94A 3M4OH 4HIMA 4FF3A 3KLSA 3NUCA 3HOVG 2R6GA 4C56C 1ILPA 4DK0A 1PV4A 3T1YQ 3H0GH 3H6MA 5LMNL 2IX0A 1ENCA 3L2PA 3I72A 2JXMB 1H9MA 1DOMA 3BS1A 3RLOA 3UDIA 3KF6A 4OHJA 5FK9C 3OSOA 1VQFA 3CMAA 2L5TA 2NVTB 4HJAA 1K8OA 2HHHQ 4JYAQ 4JPBW 5LL6S 2ZXRA 2F0PA 2ZJPA 4NB3A 4C2MB 2K75A 1VQOA 1TY2A 1B9MA 1L1OC 1VF5C 3H3VH 1LT3D 2CWAA 3PO2B 1YEZA 1YJ9A 5CV4A 4DV3Q 2PMZB 5GAEC 4YY3Q 2R92H 5IOCA 4F7XA 3SE0A 3CCMA 2IHFA 4TKOB 3RD4A 2K5NA 2EYMA 4AYBG 3S2DH 4GKJL 3OMGA 3J7AV 5HY6A 1PRTF 1WFQA 2K05A 4BBRH 3ND8A 5ELBA 1S5CD 1RTNA 1HCZA 1ILQA 3X3MA 4CBVA 1ZYRD 2B2WC 4GN3B 1ASYA 5CV8A 1YHAA 2YTXA 1Q90A 3D8GA 1SNCA 5IYCH 5IGFA 5T1IA 1C9OA 4FDBA 3FDTA 4O2DA 3EQLC 4GN4B 1D1KA 3ERQA 5IP9G 3O13A 3L0OA 2TMPA 5M5WH 1PZKD 3I73A 3QJYA 1XPUA 2F0WA 3B6YA 2HDLA 4JBWA 4K0KQ 4DAYB 3UDFA 1FGUA 4KHZA 4JYAL 2WACA 4L5TA 3QR8A 3I4NH 2VUMB 2OWOA 3GTLH 4CHTB 3I4LA 4KJNA 1E2ZA 1G2SA 3HOVB 2HUGA 4DV3L 3DXJC 2K5WA 5EAYA 1UUPA 1XMQL 4YY3L 1HNWL 3TN2A 2RDHA 3CPFA 2QDBA 3T53B 1PH6A 5KNCA 3UE0A 2XRSD 4OWTB 1PXUA 2ZTDA 4L8JA 4A3EH 3G7LA 2HDMA 2OQ0A 2J7ZA 2B29A 3MEFA 5KYLA 1MKHA 1CKOA 1FYCA 1RCVD 4XQNA 2UUCQ 2JA8B 1STEA 1VQ9A 3WOFA 4NXNQ 3CD6A 2BE5C 1WTPA 3Q23A 4G7ZC 4JI4L 3DWPA 1Q81C 1ESFA 1LYLA 1OXXK 5EBCA 1R9TB 4OIKA 3J81c 4KJOA 3ULJA 2Q2IA 2JA6B 1F2ZA 1Q1BA 1TT2A 4K0KL 4AQYQ 2JN4A 2Q8IB 3KFUA 2WB1B 1STBA 1X65A 1FGBD 3VR4A 4DU9A 5CR3A 4JW0A 3MXNB 4FF1A 4ZK9B 1N36L 1I3QB 4BY7B 4NP5A 2HT1A 4CJ0B 1JOQA 5FLXc 4NKLA 2QEXA 2VS1A 3W1BA 4GZYC 5JEAH 5AJ3Q 1CZWA 1ZEQX 3PV0A 3GDEA 3E5SA 1UNSA 4QB4A 2PZWA 4GOPC 1CKNA 4DV7Q 5ELCA 1HHVA 1STHA 3I4MH 3ZJYC 2WB1E 4P73A 2YYZA 3I70A 4H02A 2JA8H 4UPAA 3J80c 4DV6L 3BYTB 3M3YH 3IRBA 3A7LA 3BDCA 1PH8A 4S3SA 3S2HH 1F9QA 4LUZA 4GLVB 1O78A 2O5JC 4HIKA 4JI3Q 4ZLTF 1SYDA 4NXNL 2F3VA 3ITPA 4GNXC 3RNUA 2OEOA 3S1NB 1T9HA 3AFPA 1CK1A 4Q0FA 4R4CA 1Q7YC 4KHPQ 3LWUA 4YHHL 1BXTA 2V1CC 4IUPA 3MFGA 4BBSG 4ZUJA 1WTOA 1A3VA 4JBJA 2HQLA 2D9UA 4DV2Q 1CA5A 1I3QH 5JEAJ 4N9TA 2B2VC 3KF8A 4KLKA 5A35A 1PFNA 2VXWA 4DR7Q 1YIJA 2YTVA 1B7YB 3BZDB 3IFDA 4JI1L 4CGYB 4DK3C 1KNAA 1FD7D 1IKMA 5IYBH 1EFWA 1C0AA 1HFNA 1EEID 2M2LA 4DAPA 1QZGA 2R7FA 4HN7A 1IBMQ 5AJ3L 4X3KA 2ZJQA 1YNND 3NWSA 4IPDA 1QWYA 3SHLA 2AMCB 4K2KA 4DV7L 2YU9B 3ICEA 4B3RQ 1SR3A 2ID0A 4QCLA 3A0JA 3CQZB 5C6AA 4XQJA 1V8QA 1JB3A 3DM1A 5LMUL 1QVFA 2EY2A 2KCCA 1KLUD 3JC66 4ME3A 3S1NH 2WFWA 3ULLA 1WI5A 1YHBA 4TSSA 1SYEA 1JWUD 2IX3A 4DV4L 1PLFA 3N6RA 1EY0A 1BCPB 4KHPL 1VQ8A 2CWPA 1Y14B 3NHHA 2EVBA 4IUTA 3HOZG 3GTMB 4LWCA 5C5LA 5M5XH 1EOVA 2BH8A 1FJGQ 1VS0A 2SNSA 1KAAA 3CMEA 2EXZA 1EY8A 1ML0D 3FPUB 4DR7L 1X56A 3CPWA 4RH6A 2Z6KC 2O5IC 4K2LA 2XSCA 4YWLA 2AWOA 4H44C 2LKVA 2CKZB 2KJXA 5EKLA 2CQOA 2J0TD 5FOBB 1CZGA 2EYHA 1IBML 2OCEA 1L2FA 1SYCA 1PTOH 4HSVA 1PH9A 2LFNA 5EGTA 5FLMH 1O80A 4FF2A 1UE7A 4B3RL 1RHPA 4C1NI 1SNMA 4IUQA 1NJIC 2LY7A 3HOWG 3M85A 1X55A 1PMRA 3PF4A 3NPPA 4N9PA 1SYBA 3CC2A 4F87A 1MHWC 1LTSD 2E5LQ 5CYUA 4V190 1WTWA 1XPOA 4ZRZA 3HOUG 2EYLA 1HXYD 4IO9A 5DNFA 4IOCA 4IZ8A 5FJ8G 5JPMC 2HQEA 3AU7A 1FJGL 4A3JB 1FVIA 4XIGS 1KIXA 5C3WA 1PDQA 4L6TB 4ZYSA 1J8IA 2NVYH 3LX0A 1KRSA 3VA7A 3SGIA 2ZM6L 1VQNA 2KHJA 5M3FG 4JC0A 1OXUA 1KAWA 5CV5A 4DR3L 1JWSD 1HR0W 4J15A 5EPLA 1SDFA 4B3MQ 4LF4Q 3K7AB 3FPPA 3S15H 4ID6A 2QKIC 4POGA 1A3UA 2PI2E 2WIIB 3OWFA 5FO8B 4HMJA 5M5YB 5LHY1 2L4NA 1Y1WH 3CU7A 4I7ZC 1IBKQ 1NMGA 2KOLA 1GHJA 3A55A 4KY6A 2LSSA 2B2TC 3DMUA 4OWWB
chains in the Genus database with same CATH topology
1RD9D 1Q12A 1C8CA 3GTGB 4QMGA 1U4LA 1U4PA 5J22A 2XIWA 2G9HD 4ZUIA 4OO1G 3QOJA 2K33A 4J8QA 5KRUA 4OGQC 4HCEA 2PZUA 4FNFA 2LMCB 3QIAA 1SNOA 4HTHA 1AW7A 3MZ5A 1EOTA 2Q8TA 5A2QL 4ODGA 1SSOA 4KK7A 1E0BA 4C3HG 1KLGD 4HR7B 1L0XB 4IUNA 1W6JA 1H9KA 2MPMA 2EJGC 5M3FB 1G2TA 1G91A 4G57A 2L0CA 5JVG3 3K6OA 1JE4A 1EY5A 2LS01 4HMIA 2JP1A 1HQMC 3PUYA 2M00A 1SNQA 5A2QE 3RMHA 5DAUA 1SMYD 4ZKBB 4H0LC 2O2LD 2KCNA 3GTQB 4M8AA 1S4ZA 4C3IG 1I6VC 5C3XA 4ME5A 1SMYC 5E3FA 1SE2A 2QILA 3S1QB 1EQVA 2JYOA 2XWBB 4ZKCB 2FMMA 1BBXC 1DONA 2IW3A 2A73B 4KI0A 1K8MA 1H9SB 2ZXOA 5DM63 1BCPC 3SDZA 1H9JA 4FVMA 5JJZA 4LJZC 2Z1CA 3J81L 4CKBA 2OXPA 1PRTB 4C3HB 3MC0B 3A8JE 4FXDA 4A3GB 1UAPA 1TU2B 4ULLA 3TBIB 4A3IB 3V2TA 1MSGA 3HOYB 3OMCA 1HPCA 1DOLA 2NVXB 5FLXL 5KIXA 3EFXD 3LWEA 5C5MA 3BVZA 2EDGA 3D4DA 3E6ZX 2KA7A 3J81E 3J80L 4RCOA 4RFBA 1VF7A 4C3IB 1TWGB 3I90A 1D5MC 4XYQA 3A8KE 3BDOA 5FLXE 4CJ2C 2CW0D 2V4DA 2OF1A 3HRZC 3S1RB 1HUNA 1AZQA 3VR3A 2A6HC 1F2LA 1HA5A 4K8JA 1LTBD 3I8ZA 2IJ0A 2F0GA 1EIHA 2NN6G 3TP8A 3D6CA 4WORA 3TZUA 2BA1A 3J80E 2F0FA 4QIWB 2DY8A 3GD7A 2EYJA 3VR5A 4WFN3 1STAA 4YIJA 1V1PA 3KLRA 3D4WA 3K59A 3FKIB 1TWAB 3GQBA 3AB9A 3HZXA 1SBBB 1CQFA 2ZXPA 3K0YA 4NDXA 3EJIA 2FJ2A 3D4RA 2RSOA 3ZYYX 4F88A 2TSSA 3NBHA 1ZKOA 5KNDA 2IPKD 3NP8A 3PIP3 1G6ZA 1RJTA 3T51B 5E4XA 4G4KA 2R61A 2XRQD 4KY5A 1JC7A 2F03A 2B2WA 1TS2A 3TP5A 5JPNC 1H9RA 1I4RA 5FKAC 4KD4A 2SNMA 2FHTA 1X32A 5CBAE 3L7ZC 4BWGB 2NYZD 1BNZA 3PUVA 4QF4A 2F0KA 1MBYA 3S16B 2AQ2B 1DJRD 2D5DA 3LNNA 3NTHA 4DN4M 2I07B 2R7ZB 2K5QA 1ZYRC 2NB0A 1STYA 2E2HB 1EEFD 4PMBA 1GUGA 1XTCD 1GUOA 1LT5D 1ICWA 2B2UC 5IGCA 2MUYA 4PV1C 4DK1A 2EY6A 2F0JA 3H91A 2NZ1D 1E2WA 1EY7A 3L9AX 1OXSC 4I65A 2AUJD 3NTIA 5C4HA 2EYOA 3BVMA 4BS9A 3KBXA 5C0XJ 2CHBD 3VYTA 1Q1EA 4IFDG 1XWEA 5D3IB 1IL8A 1R4PB 3BDLA 1BUVT 3Q24A 4AYBB 5D3DA 1PRTD 3VR6A 1TKWB 2MJ8A 4JK1C 2E74C 2NWGA 3C1FA 4PNYA 5D14A 4KN7C 1I4XA 4J1MA 5CV9A 3RLFA 1PRTC 1NSNS 2K04A 4C3JG 1JWMD 3K58A 1KTKA 2L12A 1EYAA 1Z6HA 3MVVA 1WVLA 2RSNA 1LABA 2BDOA 1B3AA 3PUWA 4X3SA 2WP8J 4A3MB 4DXFA 2B2VA 1CI3M 3PMFA 5K5PA 5KEEA 5EJWA 1JOOA 4H13C 4BA2I 1I4GA 2N55A 1B50A 2NTSA 1Z7TA 2F0NA 1DYQA 3V05A 1WCMB 2D2CC 2PZTA 1CHPD 3GTOB 4MN3A 3TZDA 4QUFA 3EVQA 3C2PA 1A2TA 3NBIA 1IW7D 5C0XI 4ZQ3A 2F0UA 3IL8A 3MTSA 1U4RA 1ONLA 1DCZA 4EQOA 1DOKA 3J7AF 1LACA 4RKLA 1I4PA 3MHBA 4PQXA 1IKLA 5C4ZA 1YNNC 4PMCA 2E2IB 4K5XA 1JR0D 4RWSC 1XX8A 2F3WA 1DM0B 1VDZA 2EPBA 2WKDA 4C3JB 2K28A 1U4MA 1A2UA 1F2YA 3BG3A 4FXGC 5KGUA 1CT1D 1I4HA 4B9XA 4DF7A 1F2MA 5CGKA 3R93A 4Z9CB 1EY6A 2C5CA 1EYDA 4BBSB 1TIID 5CV6A 3P1HA 1B1ZA 3S17B 5EQ0A 2L9HA 1ET6A 2KECA 4KKUA 5BN5A 1EZ8A 3SR1A 5FO9B 1B44D 2QF7A 4R8NA 4WJWA 2AQ3B 3OOCA 1S5ED 5JAVA 1CTMA 1NR4A 3FMCA 1GUTA 2B2TA 4RHSA 3HOZB 1EU4A 1Y1VB 4HAEA 2H4OA 2B8FA 5FO7B 5EPJA 1K83B 1LTTD 5HURA 2F0HA 2B63B 1EY9A 2KQ3A 4U68A 2BDNA 3SK6A 1HA6A 1CQVA 5J1ZA 3JAML 5C4XB 3MA2B 3MXNA 2B2YC 3HOWB 2IWHA 3Q0AA 1PTOF 1QILA 2GA4B 1IYUA 3NQTA 2F0SA 1EYCA 1KDAA 4HEDA 3NK9A 2B39A 3HOUB 1BF4A 3PO3B 5CC4A 2K7VA 5C3EB 5I9PA 2WV6D 5M9OA 2EZVA 2I46A 2DNEA 4CKEA 3TMEA 1O7LA 3WOEA 4XT3B 4G7OC 2QCPX 1Y8PB 2IL8A 4DNRB 1HFGA 1L0YB 1PZID 1SAPA 4XT1B 4BY1B 4Q5VA 3OHXC 1F9RA 3MXUA 1QE6A 1FNWA 2RQXA 4X3TA 1SNDA 1OXTA 2EJMA 5TSSA 5CMDA 5K36G 1STGA 2VNUD 1EU3A 1V1OA 3S1MB 2IT1A 2X6GA 1EFID 3R2TA 1JORA 3KBGA 1S5DD 4K5VA 5JOBA 4C1NK 2AQ1B 2RA4A 1NUCA 5C4JB 2ICEC 1HRJA 5EBDA 3GTJB 4OIJA 4NW2A 3VR2A 2JA5B 3VA5A 2DN8A 3NWTA 3P20A 2F0OA 1PTOD 1WTVA 1D5XC 3V96A 1GJXA 5F2DA 2FINB 4RHRA 1I4QA 3NTKA 3A56A 1UEAB 4LMQD 1RDPD 1RF2D 2SEBD 4RGMA 1A6XA 1D6EC 2NBFA 1IYVA 4RGNA 1KDCA 3U9SA 1B2TA 3HEJA 3TSSA 4XTCS 3K5NA 3K5LA 1ZXTA 2JA7B 2Q8RE 1EIGA 3R8BA 2PNRC 5COYA 4OO1H 3A54A 4IN3A 3NE5B 1QG7A 3OPOA 4TQUS 2J4XA 2AUKA 2XVSA 1W6KA 2A74C 3MFYA 2PQEA 3T4AC 3WDNA 1E2VA 3GV3A 1TWFB 3EA6A 4DXGA 1F77A 4H7BA 5IODA 2ENBA 3Q22A 3UI2A 3SK8A 2G9DA 3MXPA 3SXHA 2PW5A 4RCNA 2A68D 5I2XA 3NQIA 3K5OA 2WAQB 1DD2A 1YNJD 1ENFA 1WTRA 1HTPA 3CRLC 1CA6A 1CHQD 1OO9B 3MWYW 5G3LF 2L1BA 2CW0C 1U9RA 2A68C 4FYDA 4K8IA 2F0IA 2MP1A 1MD2D 5I2YA 1VMPA 2F0QA 1SJHD 3QOLA 2JEAI 1FNVA 1FR3A 2R92B 3FVQA 1TWCB 1QJOA 4G7HC 3S2DB 4X3UA 1BDOA 1A3TA 4BBRB 3SK4A 4RGTA 3SVMA 1GUSA 1SNPA 3KUPA 2AWNA 1JICA 3ND9A 5JEAG 5HGTA 2PW7A 1QB5D 1B53A 1BOSA 3A7AB 4K14A 1WTQA 3DEOA 4TRDA 5M5WB 3N52A 4CKCA 1LTRD 1WD1A 3QO2A 5IT9L 1EWHA 1RODA 3GP7A 2PPBC 3I4NB 1SYGA 4KTAA 2RDGA 1X3PA 2K1BA 1EQTA 3OIQA 1TS5A 3GTLB 3GTPB 3KK7A 3OW7A 2MGSA 3R3OA 1CM9A 5ISRA 1M4VA 1O7YA 4V0BA 3T13A 2K03A 4OO1I 4Y7NB 3C3LA 4RGOS 4P2CB 5G3LD 1LV9A 2FMCA 3DWQA 1Y8OB 2XNAC 3M7GA 3KLSX 4A3EB 1QNUA 2Z8LA 2B2UA 2JEBI 5IT9E 2KVMA 5C0XH 2D62A 3AMUA 1II3A 5CORA 1Q3LA 1RKNA 3C46A 1GHKA 1TS4A 2K32A 1Y8NB 2X6LA 2DY7A 1JCKB 4RAUC 2HCCA 4HCSA 3GV6A 2ICIA 2MHVA 1MI2A 1EL0A 1RTOA 4KKSA 1B9NA 2K6AA 3IFTA 1Y69U 5CBEE 2Z4HA 1G291 1ENAA 1LO5D 4IQZA 5IGBA 2NN6H 2BE5D 4K6LA 1H9SA 1T5XD 3HS0C 4KV6A 3RZOB 4ABNA 3I4MB 3CRKC 2E2DC 1G8ZD 1KABA 1D5ZC 4EVOA 3M3YB 2X69A 5BN4A 3S2HB 1F9PA 2QEJC 2L55A 1TVXA 3W3AA 1XXGA 3P75A 2FFKB 1S5BD 4B9WA 3F2UA 1S5FD 4KN4C 4WRDA 3HOXB 2A5HA 4LK1C 1D2BA 3QG1A 1MGSA 1LLRD 2F0VA 2EYPA 3T56B 1AN8A 3A8IE 1HTLD 2B8GA 1LTAD 4R8IA 2JSOA 1D1IA 1O7ZA 3GTKB 3H09A 4KMUC 3SK5A 2EY1A 3QWNA 1SE4A 2BCOA 4FF4A 2EE1A 3K5MA 5M5XB 5IGGA 2RKSA 4IALA 1IW7C 2N88A 1LT4D 1SYFA 2DNCA 1TY0A 3I3CA 3DWAA 1TQOA 3S9WA 1PTOB 4XDXA 3H3VC 2EY5A 3FEWX 5NUCA 4OL7A 3I91A 1BQQT 1EWCA 3OIPA 1NR2A 2NN6I 5ELFA 1PYWD 4R9WA 4PMWA 2F4IA 1C48A 1DZ1A 3RUZA 4IFDH 3D3RA 2RDFA 2Y0SB 4O42A 2HCIA 2IX1A 4KD3A 4U673 3BVGA 2KUMA 4XQQA 3VYUA 4QUCA 2NVYB 4DA2A 3L3OC 4FO2A 5I6WA 1PFBA 5I9OA 4UDUC 1SXTA 1GXDC 4M1UB 3NXWA 2L11A 1GUNA 1IHZA 1LTGD 4A3DB 2KHSA 1SE3A 5JVH3 1C4QA 2BA0A 3S15B 4RKBA 4F8MA 2F0EA 4DAYA 2H1EA 4XYOA 1V43A 4IFDJ 2RVLA 1Y1WB 2F1MA 1FNUA 3W2DA 3HG9A 5E1FA 2RBMA 2VB2X 3P7JA 1SEBD 1EZ6A 2K01A 5AFWA 1I6HB 4A3FB 2E76C 3VYSA 3Q6SA 4K5WA 4A3BB 4FXKC 1NAPA 3U9OA 1TS3A 1NCVA 3FRPB 2R93B 3MAQA 3MXGA 1ESRA 3SEBA 1LT6D 2NTTA 1QNKA 4BA1I 2B2YA 1SJED 2ZT9C 4L63B 5EKKA 5BN3A 3DUZA 1V1PB 4ILWA 5IGEA 1JQYD 1I50B 2VB3X 1WD0A 1QCBD 5ELDA 5IIFA 4XXEA 1AZPA 2SDFA 2WKCA 3HGBA 1GOZA 1CFMA 4IURA 3D6WA 3X3NA 2E75C 3IKJA 1BCPF 3JAME 5E4WC 5LL6X 4IFDI 2F0DA 2EJFC 1M8AA 3G6JB 2EYFA 2NUCA 4HSPA 3DHQA 4FP5D 4EQNA 1TWHB 4IUUA 2JE6I 1VMCA 3S14B 1XYIA 1HQRD 1LTID 3MEHA 5I4DA 5KYIA 3VYRA 1F9SA 1TR5A 3J7YW 2PCFB 2XN9C 3NSWA 5IGDA 1BO0A 3GO5A 3ONAB 3CHBD 1HUMA 1Z47A 3R2IA 4B08A 1EY4A 2A69D 4DFAA 2CQAA 1PZJD 1JOKA 2XWJB 1AEXA 4IUVA 3K57A 2O4XA 3C1EA 2R3ZA 3TDQA 1DXMA 4A93B 1STNA 1R4QB 3DEPA 2M9VA 1GUWA 2A69C 4KHVA 3TP7A 3EROA 3HKZB 3M4YA 3D31A 5T1GA 1A15A 3HP3A 1VCIA 4J6HA 1SFOB 2K5DA 2Z4IA 2WINB 1BCPD 1KDBA 1PTOC 2BOSA 4CJ1B 1QOHA 3CKIB 4KY7A 5EKIA 4O1NA 1AP0A 4KKTA 4ZAIA 3QB3A 2NVQB 1T5EA 2F0MA 3BYYB 3T16A 5M3MB 4MHEA 2PO4A 3PUXA 4A3KB 1MSHA 3PUZA 3PIO3 5DEHA 2E2JB 3RZDB 2OT2A 5KNBA 5EPKA 2A6ED 3TP6A 1Q8IA 5C44B 5J39A 5C0XG 4DNTB 3M4OB 2SOBA 1KNEA 2A6EC 4MIUA 5CV7A 4LAAA 4NMZA 4RA8A 3E0JA 4EQPA 4DAVA 3IAYA 3H0GB 5DM73 2A6HD 2C9OA 4K6DA 2CVRA 1PFMA 1ET9A 4EGVA 4DGZA 2KEDA 1X3QA 3M7NA 3URYA 2F0TA 5ELEA 1AFPA 1YNJC 1WTXA 5K36H 2EOTA 5D65A 2PYKA 4E6IA 1B4OA 1J9OA 3OWEB 1BR9A 2KEEA 4UAIA 5I6YA 2F0LA 1OXVA 3H94A 4FF3A 3KLSA 3NUCA 2R6GA 4C56C 1ILPA 4DK0A 3H6MA 2IX0A 1ENCA 3I72A 2JXMB 1H9MA 1DOMA 3BS1A 4OHJA 5FK9C 3OSOA 2L5TA 2NVTB 1K8OA 5LL6S 2ZXRA 2F0PA 4C2MB 1TY2A 1B9MA 1VF5C 1LT3D 3PO2B 5CV4A 2PMZB 5IOCA 4F7XA 3SE0A 4TKOB 3RD4A 2EYMA 3OMGA 3J7AV 1PRTF 2K05A 3ND8A 5ELBA 1S5CD 1RTNA 1HCZA 1ILQA 3X3MA 4CBVA 1ZYRD 2B2WC 5CV8A 1Q90A 3D8GA 1SNCA 5IGFA 5T1IA 3FDTA 3EQLC 1D1KA 3ERQA 3O13A 2TMPA 1PZKD 3I73A 3QJYA 2F0WA 2HDLA 4JBWA 4KHZA 2WACA 2VUMB 4CHTB 3I4LA 4KJNA 1E2ZA 1G2SA 3HOVB 2HUGA 3DXJC 2K5WA 1UUPA 3TN2A 2RDHA 2QDBA 3T53B 5KNCA 2XRSD 1PXUA 4L8JA 3G7LA 2HDMA 2J7ZA 5KYLA 1FYCA 1RCVD 4XQNA 2JA8B 1STEA 3WOFA 2BE5C 1WTPA 3Q23A 4G7ZC 3DWPA 1ESFA 5EBCA 1OXXK 1R9TB 4OIKA 4KJOA 2JA6B 1F2ZA 1Q1BA 1TT2A 2Q8IB 2WB1B 1STBA 1FGBD 3VR4A 4DU9A 5CR3A 4FF1A 4ZK9B 1I3QB 4BY7B 4NP5A 4CJ0B 1JOQA 4NKLA 4GZYC 5JEAH 1CZWA 1ZEQX 3PV0A 3E5SA 1UNSA 4QB4A 2PZWA 1HHVA 5ELCA 1STHA 2YYZA 3I70A 3BYTB 3A7LA 3BDCA 4S3SA 1F9QA 1O78A 2O5JC 4ZLTF 1SYDA 2F3VA 3ITPA 2OEOA 3S1NB 1CK1A 4Q0FA 3LWUA 1BXTA 4IUPA 3MFGA 4ZUJA 1WTOA 1A3VA 2D9UA 1CA5A 5JEAJ 4N9TA 2B2VC 3KF8A 5A35A 1PFNA 2VXWA 3BZDB 3IFDA 4CGYB 1KNAA 1FD7D 1IKMA 1HFNA 1EEID 2M2LA 4DAPA 4HN7A 4X3KA 1YNND 3NWSA 1QWYA 3SHLA 4K2KA 2YU9B 2ID0A 4QCLA 3CQZB 5C6AA 4XQJA 1V8QA 1JB3A 3DM1A 2EY2A 2KCCA 1KLUD 4TSSA 1SYEA 1JWUD 2IX3A 1PLFA 3N6RA 1EY0A 1BCPB 3NHHA 2EVBA 4IUTA 3GTMB 5C5LA 2SNSA 1KAAA 2EXZA 1EY8A 1ML0D 3FPUB 2O5IC 4RH6A 4K2LA 2XSCA 2AWOA 4H44C 2LKVA 2KJXA 5EKLA 2J0TD 5FOBB 1CZGA 2EYHA 1SYCA 1PTOH 4HSVA 2LFNA 5EGTA 1O80A 4FF2A 1RHPA 4C1NI 1SNMA 4IUQA 2LY7A 3M85A 1PMRA 3NPPA 4N9PA 1SYBA 4F87A 1LTSD 5CYUA 4V190 1WTWA 4ZRZA 2EYLA 1HXYD 5DNFA 4IZ8A 5JPMC 2HQEA 3AU7A 4A3JB 4XIGS 5C3WA 1PDQA 4L6TB 4ZYSA 1J8IA 3LX0A 3VA7A 1OXUA 5CV5A 1JWSD 5EPLA 1SDFA 3K7AB 3FPPA 4ID6A 2QKIC 1A3UA 2WIIB 3OWFA 5FO8B 4HMJA 5M5YB 5LHY1 2L4NA 3CU7A 4I7ZC 2KOLA 1GHJA 3A55A 4KY6A 2B2TC 3DMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PXU A;  2XWB B;  2WIN B;  3HS0 C;  5FO7 B;  2I07 B;  1D2B A;  5JPN C;  3FRP B;  5JPM C;  3CKI B;  1BUV T;  3G6J B;  3KLS A;  3HRZ C;  3I70 A;  2E2D C;  5FO9 B;  2B39 A;  2A73 B;  1UAP A;  2QKI C;  3V96 A;  1BQQ T;  1JB3 A;  2WII B;  3OHX C;  5FO8 B;  2A74 C;  1UEA B;  3T4A C;  3CU7 A;  3MA2 B;  3L3O C;  2XWJ B;  1OO9 B;  1BR9 A;  4ILW A;  4FXG C;  1GXD C;  2J0T D;  4FXK C;  2TMP A;  5FOB B;  1XWE A;  1JC7 A;  2ICE C; 
#chains in the Genus database with same CATH topology
 1RD9 D;  1Q12 A;  1C8C A;  3GTG B;  2OTL A;  4QMG A;  1U4L A;  4A3J H;  1U4P A;  5J22 A;  4YCV A;  2FXQ A;  3A5U A;  5E7N A;  4R4T A;  2XIW A;  2G9H D;  4ZUI A;  1I6H H;  4A3F H;  4R1J A;  4QL5 A;  3UDG A;  4A3B H;  4OO1 G;  3QOJ A;  4DV1 Q;  1K8A C;  1YIT A;  2K33 A;  1A63 A;  2EQS A;  2R93 H;  4J8Q A;  5KRU A;  4OGQ C;  4HCE A;  2P5Z X;  2PZU A;  1EWI A;  1HNZ Q;  2VQF Q;  4LF4 L;  3KF6 B;  4FNF A;  2LMC B;  3QIA A;  1SNO A;  5M5Y H;  4HTH A;  1AW7 A;  3MZ5 A;  4GN5 A;  4A4I A;  5IY0 A;  1G51 A;  1IBK L;  1EOT A;  2Q8T A;  5A2Q L;  4ODG A;  3CCV A;  1SSO A;  4KK7 A;  4GLX A;  2KBN A;  1E0B A;  1YI2 A;  4C3H G;  4X6A H;  1KLG D;  4HR7 B;  1L0X B;  4IUN A;  3I4O A;  1W6J A;  3U58 A;  1H9K A;  2MPM A;  3K8A A;  4X64 L;  4DUZ Q;  3T1H Q;  2EJG C;  3HOY G;  5M3F B;  1G2T A;  2JA7 G;  1G91 A;  4G57 A;  2L0C A;  4JVZ A;  5JVG 3;  3K6O A;  1JE4 A;  1EY5 A;  2LS0 1;  1VQD A;  2A8V A;  4HMI A;  2JP1 A;  1HQM C;  4O0A A;  3PUY A;  2HIV A;  2M00 A;  1SNQ A;  5A2Q E;  3RMH A;  5DAU A;  1SMY D;  4ZKB B;  1UE5 A;  4H0L C;  3AQQ A;  4LF6 Q;  2O2L D;  4PZ6 A;  2KCN A;  2EXD A;  3GTQ B;  4M8A A;  2JA9 A;  1S4Z A;  3E3X A;  4C3I G;  1TWH H;  4JI6 Q;  1I6V C;  5C3X A;  1Q82 C;  4ME5 A;  3PSI A;  1SMY C;  3S14 H;  5E3F A;  1SE2 A;  2QIL A;  3S1Q B;  1EQV A;  2JYO A;  2XWB B;  1PVO A;  4ZKC B;  2FMM A;  1BBX C;  2HD3 A;  1DON A;  2IW3 A;  4UY8 C;  4BXX H;  2A73 B;  4KI0 A;  1K8M A;  1NBW A;  1H9S B;  2ZXO A;  5DM6 3;  1BCP C;  1DGS A;  3SDZ A;  1H9J A;  4FVM A;  5HGQ A;  4A93 H;  1B3Q A;  5JJZ A;  4DV0 Q;  4LJZ C;  3FKI G;  2Z1C A;  3J81 L;  4CKB A;  1GKH A;  2OXP A;  2ATW A;  1PRT B;  4C3H B;  3MC0 B;  3A8J E;  4FXD A;  4A3G B;  1UAP A;  1TU2 B;  4JI5 L;  1TXY A;  1IYJ B;  4JBK A;  4ULL A;  3TBI B;  4A3I B;  4JG2 A;  1VQP A;  3V2T A;  1P16 A;  1MSG A;  3HOY B;  3OMC A;  1HPC A;  2VW9 A;  1DOL A;  2N8N A;  2NVX B;  1KHI A;  2Q2T A;  5FLX L;  5KIX A;  1BKB A;  3EFX D;  3LWE A;  1N9W A;  5C5M A;  4IPC A;  4IJL A;  3BZC A;  3BVZ A;  2EDG A;  3D4D A;  3E6Z X;  3U4V A;  2KA7 A;  3J81 E;  2N49 A;  5LMN Q;  3J80 L;  4RCO A;  2NVQ H;  4A75 A;  1K3B C;  3F2D A;  4RFB A;  1VF7 A;  3I4N G;  5M3M H;  1E22 A;  4C3I B;  1TWG B;  3I90 A;  1IXR A;  4A3K H;  1D5M C;  2VZA A;  3A8K E;  4XYQ A;  3BDO A;  5FLX E;  1OTC A;  3STB D;  4CJ2 C;  2CW0 D;  2V4D A;  1QUQ A;  2OF1 A;  3HRZ C;  3S1R B;  4A3G H;  1HUN A;  1AZQ A;  3CCL A;  3VR3 A;  1WOC A;  2A6H C;  1F2L A;  1HA5 A;  4K8J A;  2E2J H;  1LTB D;  3RZD H;  3I8Z A;  4DUY Q;  2IJ0 A;  4POF A;  2F0G A;  1EIH A;  2NN6 G;  3TP8 A;  4DR4 Q;  3D6C A;  4WOR A;  3TZU A;  2BA1 A;  3J80 E;  2R7Z G;  3WWV A;  2F0F A;  2DY8 A;  2PQA A;  3GD7 A;  4QIW B;  2EYJ A;  3VR5 A;  5C44 H;  4WFN 3;  4YCU A;  4GKJ Q;  2RF4 A;  1STA A;  3BZK A;  4YIJ A;  1V1P A;  3KLR A;  1JE5 A;  3D4W A;  3G4S A;  3K59 A;  3FKI B;  1TWA B;  3GQB A;  3AB9 A;  2CFM A;  3HZX A;  1SBB B;  1CQF A;  3D0F A;  2ZXP A;  3K0Y A;  4NDX A;  3EJI A;  3BU2 A;  2QDL A;  3F8T A;  1JJG A;  4QIW E;  1L1O A;  3TRZ A;  2FJ2 A;  3D4R A;  2RSO A;  3ZYY X;  4F88 A;  2TSS A;  2I5H A;  3NBH A;  3S1R H;  1ZKO A;  5GAG C;  5KND A;  2IPK D;  1PH7 A;  1E7Z A;  3NP8 A;  3PIP 3;  1G6Z A;  1RJT A;  3T51 B;  4DUY L;  1XMQ Q;  1HNW Q;  4DR4 L;  2VQE L;  5E4X A;  4G4K A;  2Z0S A;  2R61 A;  4JI0 Q;  2XRQ D;  3I7F A;  4KY5 A;  1JC7 A;  2F03 A;  2B2W A;  1TS2 A;  3TP5 A;  5JPN C;  1RL2 A;  1H9R A;  1I4R A;  5FKA C;  4KD4 A;  2SNM A;  2FHT A;  1X32 A;  2GN5 A;  5CBA E;  1VQB A;  3L7Z C;  4BWG B;  2NYZ D;  1BNZ A;  3PUV A;  4QF4 A;  2F0K A;  1M1K C;  1ICF B;  2PMZ E;  1A8V A;  1MBY A;  3S16 B;  2AQ2 B;  1DJR D;  4JI4 Q;  3U4Z A;  1IL2 A;  1D7Q A;  2D5D A;  2NVT H;  3LNN A;  3NTH A;  4YCW A;  4DN4 M;  2I07 B;  1CSQ A;  2R7Z B;  2K5Q A;  1ZYR C;  4C2M H;  2NB0 A;  4L5S A;  1STY A;  2E2H B;  2JQO A;  1EEF D;  4PMB A;  3HOX G;  1PH2 A;  2NZH A;  1N36 Q;  3PO2 H;  1GUG A;  1XTC D;  2LXK A;  4A3M G;  1GUO A;  1LT5 D;  1ICW A;  2ES2 A;  2B2U C;  4DR2 L;  5IGC A;  2MUY A;  4PV1 C;  4DK1 A;  4R4I A;  2EY6 A;  2F0J A;  3H91 A;  2NZ1 D;  1E2W A;  4JI0 L;  1EY7 A;  2K50 A;  2ZTC A;  3L9A X;  1OXS C;  4LFC L;  3J7Z C;  1WCM G;  4I65 A;  2AUJ D;  4DR6 Q;  3NTI A;  1VQ5 A;  5C4H A;  2F4V L;  3NEM A;  4A3L G;  4DV6 Q;  2EYO A;  3BVM A;  4BS9 A;  3PF5 A;  3KBX A;  5C0X J;  2CHB D;  4AH6 A;  3VYT A;  1Q1E A;  2G5D A;  4IFD G;  2UU9 Q;  1XWE A;  4YHH Q;  5D3I B;  3E9H A;  1GVP A;  1IL8 A;  1R4P B;  3BDL A;  4MTN A;  1BUV T;  2VUM H;  2XTI A;  3Q24 A;  2K14 A;  4AYB B;  2UXB Q;  5D3D A;  1PRT D;  2RHQ B;  3VR6 A;  1TKW B;  2MJ8 A;  2XGT A;  1B70 B;  4JK1 C;  3HOV H;  2E74 C;  2NWG A;  4NXM L;  3C1F A;  4GOP A;  4PNY A;  4JI1 Q;  5D14 A;  4KN7 C;  1I4X A;  3G71 A;  3PGZ A;  1MJC A;  4J1M A;  5CV9 A;  1K9M C;  3RLF A;  1PRT C;  1NSN S;  2K04 A;  4AIM A;  4B3T L;  4C3J G;  1JWM D;  4RMF A;  4GNX A;  4DR6 L;  3K58 A;  2Q2U A;  4AYB E;  1A0I A;  1KTK A;  2L12 A;  2GVA A;  1EYA A;  1Z6H A;  3MVV A;  5IE8 A;  1NTG A;  1WVL A;  5LMU Q;  1N8R C;  1X3E A;  2RSN A;  4MNO A;  1LAB A;  2BDO A;  1B3A A;  3PUW A;  5LMN W;  4JV5 Q;  2DUD A;  2AKW B;  4X3S A;  3KDF B;  3CCS A;  2WP8 J;  1R9T H;  4A3M B;  2VY3 A;  4DXF A;  4DV4 Q;  2B2V A;  1CI3 M;  2IHE A;  2UU9 L;  3PMF A;  5K5P A;  4QJF A;  5KEE A;  1HR0 L;  4DKA C;  2JA6 H;  5EJW A;  1UE6 A;  1JOO A;  4H13 C;  4BA2 I;  1I4G A;  2N55 A;  1B50 A;  2NTS A;  1Z7T A;  4CDE C;  2F0N A;  1DYQ A;  3V05 A;  2UXB L;  5IWA Q;  1WCM B;  2D2C C;  4DPG A;  2PZT A;  1CHP D;  4BY7 H;  3GTO B;  3CF5 A;  4MN3 A;  5IP7 G;  3TZD A;  1VQ6 A;  4QUF A;  3EVQ A;  1S40 A;  1GD7 A;  3C2P A;  4A3D G;  1A2T A;  3NBI A;  1IW7 D;  1PH3 A;  5C0X I;  1UE1 A;  5H1S E;  4ZQ3 A;  2F0U A;  5IP9 H;  3IL8 A;  3MTS A;  1U4R A;  1H95 A;  3JAM i;  1ONL A;  1DCZ A;  4EQO A;  1DOK A;  3J7A F;  1E24 A;  1LAC A;  2MO0 A;  2UUB Q;  4RKL A;  1I4P A;  3MHB A;  1HH2 P;  1IKL A;  2CH4 W;  4PQX A;  5C4Z A;  2ZJR A;  4JV5 L;  1YNN C;  4PMC A;  4JI7 L;  2E2I B;  1WYD A;  4K5X A;  1JR0 D;  2RHS B;  4DNI A;  4IPH A;  4RWS C;  1EIF A;  1XX8 A;  2F3W A;  2Z6K A;  1DM0 B;  1XNR Q;  1VDZ A;  3KYH C;  4A3F G;  4JI2 L;  2EPB A;  1Y1V G;  2WKD A;  2LXJ A;  5IWA L;  4C3J B;  2K28 A;  1U4M A;  1W2B A;  1A2U A;  1F2Y A;  3BG3 A;  4FXG C;  5KGU A;  5IT9 c;  1CT1 D;  1I4H A;  2ZM6 Q;  4B9X A;  2B63 G;  2E8G A;  4DF7 A;  1F2M A;  5CGK A;  3R93 A;  4DR3 Q;  2YU9 H;  1WJJ A;  4HJ9 A;  4Z9C B;  1VQH A;  5C4X G;  3CQZ H;  1EY6 A;  2C5C A;  1EYD A;  2VL6 A;  1TII D;  4BBS B;  5CV6 A;  3P1H A;  3CCR A;  1B1Z A;  2UUB L;  3S17 B;  5EQ0 A;  4QQB X;  2N3S A;  2L9H A;  1ET6 A;  1CKM A;  3HKS A;  2KEC A;  4KKU A;  5BN5 A;  3GTM H;  3PO3 G;  5C3E G;  2CH4 A;  1EZ8 A;  1XNR L;  3SR1 A;  5FO9 B;  1B44 D;  3KLW A;  4A76 A;  2QF7 A;  1VQA A;  4R8N A;  2RCN A;  5ELO A;  2CCZ A;  5GQO A;  4WJW A;  4IJH A;  2AQ3 B;  3OOC A;  4OX9 L;  1SLJ A;  5GAH C;  3CAM A;  1S5E D;  4BY1 G;  5JAV A;  4X65 L;  1CTM A;  1NR4 A;  4LF5 Q;  3FMC A;  2DJF C;  1K0S A;  1X3G A;  1GUT A;  1EYG A;  3S17 H;  2B2T A;  4RHS A;  3HOZ B;  2MFI A;  3CW2 C;  1JJC B;  1EU4 A;  1Y1V B;  4HAE A;  4BXX G;  2H4O A;  2B8F A;  5FO7 B;  3FP9 A;  5EPJ A;  1K83 B;  1LTT D;  4N8F A;  5HUR A;  2ZTE A;  2F0H A;  3F2C A;  2B63 B;  1EY9 A;  4X64 Q;  2KQ3 A;  4U68 A;  1CSP A;  3CXC A;  2BDN A;  3K7U C;  3SK6 A;  1SE8 A;  4YWK A;  4OON A;  1HA6 A;  1CQV A;  5J1Z A;  3JAM L;  4A93 G;  5C4X B;  3MA2 B;  2OTJ A;  3MXN A;  2K5H A;  2B2Y C;  2QGQ A;  2JA5 G;  3HOW B;  2IWH A;  3HKZ G;  3Q0A A;  1PTO F;  1QIL A;  4YWM A;  2GA4 B;  1IYU A;  3NQT A;  2F0S A;  1M90 C;  1EYC A;  3K7A H;  1KDA A;  4HED A;  3NK9 A;  4LF5 L;  2B39 A;  3HOU B;  1BF4 A;  3PO3 B;  5CC4 A;  2K7V A;  5C3E B;  1L1O B;  1N32 L;  3W1G A;  5I9P A;  2WV6 D;  5M9O A;  2EZV A;  4A3C G;  2I46 A;  2DNE A;  4CKE A;  4GS3 A;  3TME A;  1O7L A;  3WOE A;  3M4Q A;  4IOA A;  3PIO A;  4XT3 B;  3GTG H;  4G7O C;  1XTD A;  2QCP X;  1Y8P B;  2IL8 A;  4DNR B;  4P72 A;  1HFG A;  1L0Y B;  1J5E L;  1PZI D;  3F1Z A;  4HJ5 A;  4LF7 Q;  1SAP A;  4XT1 B;  4BY1 B;  4Q5V A;  3OHX C;  3K80 C;  5M3M G;  1F9R A;  3MXU A;  3KJO A;  4LW1 A;  1HZB A;  1QE6 A;  1FNW A;  2RQX A;  4X3T A;  1SND A;  1OXT A;  2EJM A;  5TSS A;  4X62 L;  5CMD A;  5K36 G;  1I94 Q;  1STG A;  2VNU D;  1EU3 A;  1PYB A;  3HOU H;  1QVC A;  1V1O A;  3S1M B;  3NEN A;  5FJ8 H;  2IT1 A;  4JI5 Q;  2X6G A;  1EFI D;  3R2T A;  1K8G A;  1JOR A;  3KBG A;  1S5D D;  5C44 G;  3F2B A;  4K5V A;  5JOB A;  4C1N K;  2AQ1 B;  2RA4 A;  1NUC A;  2GVB A;  2KCT A;  5C4J B;  2ICE C;  1HRJ A;  5EBD A;  2WAQ G;  4OIJ A;  4NW2 A;  3GTJ B;  3VR2 A;  4L5R C;  2JA5 B;  3VA5 A;  2DN8 A;  3NWT A;  3H0G G;  3P20 A;  3CCU A;  2F0O A;  1PTO D;  1WTV A;  1K0R A;  5M3F H;  1D5X C;  1X9N A;  3V96 A;  1GJX A;  4LF7 L;  1K28 A;  2FIN B;  5F2D A;  4RHR A;  3PQI A;  1I4Q A;  3NTK A;  3A56 A;  1UEA B;  4LMQ D;  4UHV A;  1RDP D;  1RF2 D;  2SEB D;  5IYD H;  4RGM A;  2ASB A;  1A6X A;  1D6E C;  1E1O A;  2NBF A;  3Q8D A;  3HFZ B;  1IYV A;  1AH9 A;  1I94 L;  4RGN A;  3GTQ H;  4LUV A;  1KDC A;  3U9S A;  3M9B A;  1B2T A;  3HEJ A;  1D8L A;  2R92 G;  3TSS A;  4P74 A;  4CDF C;  4PZ7 A;  4XTC S;  3OTO L;  3AYH B;  3K5N A;  1PH1 A;  3RR5 A;  3K5L A;  4HID A;  1ZXT A;  5C4J H;  2JA7 B;  2Q8R E;  3TS2 A;  3S1Q H;  1EIG A;  4OXP A;  4BBR G;  1WTH A;  3R8B A;  2PNR C;  1PH5 A;  2HIX A;  5COY A;  4OO1 H;  3A54 A;  4IN3 A;  4MZ9 A;  3NE5 B;  1QG7 A;  3OPO A;  1KL9 A;  1KRT A;  4TQU S;  2J4X A;  5IYC G;  1KQS A;  2AUK A;  3CC7 A;  2XVS A;  2IY5 B;  1W6K A;  2A74 C;  3MFY A;  2PQE A;  3T4A C;  3WDN A;  4HJ8 A;  1E2V A;  4LF8 Q;  3GV3 A;  1TWF B;  3KJP A;  3EA6 A;  1CKN B;  1JT8 A;  4DXG A;  4WJ4 A;  1F77 A;  2PI2 A;  4DV5 L;  4H7B A;  1PA6 A;  5IOD A;  4P75 A;  2ENB A;  3Q22 A;  4P71 A;  3SK8 A;  2G9D A;  3MXP A;  3UI2 A;  3SXH A;  1XMO L;  2PW5 A;  1U0L A;  3LGJ A;  4C3H H;  3E9I A;  4RCN A;  1B8A A;  2A68 D;  5I2X A;  3NQI A;  3K5O A;  2WAQ B;  4A3I H;  1DD2 A;  1YNJ D;  1ENF A;  1WTR A;  3HOY H;  1HTP A;  3CRL C;  1CA6 A;  1CHQ D;  2VQE Q;  3I2Z A;  1OO9 B;  2N78 A;  3MWY W;  5G3L F;  2NVX H;  1CUK A;  4A3E G;  2L1B A;  1YVC A;  3STB C;  2CW0 C;  1U9R A;  2A68 C;  4FYD A;  4K8I A;  3KF8 B;  1RIP A;  4QY7 A;  2F0I A;  2MP1 A;  1MD2 D;  3JAM c;  1VQJ A;  5I2Y A;  2WAQ E;  1VMP A;  2F0Q A;  4B3S L;  1SJH D;  3QOL A;  2ALY B;  2JEA I;  2K4K A;  1V9P A;  1FNV A;  1FR3 A;  2R92 B;  3KOJ A;  4LF8 L;  3FVQ A;  4JOI C;  4C3I H;  1TWC B;  1TWG H;  1QJO A;  4G7H C;  3S2D B;  4X3U A;  1BDO A;  1A3T A;  4BBR B;  3SK4 A;  4RGT A;  3SVM A;  1IBL L;  1GUS A;  1SNP A;  3KUP A;  2L15 A;  1HZC A;  2AWN A;  4LFB L;  1Q46 A;  4ALP A;  1JIC A;  3ND9 A;  5JEA G;  4DR2 Q;  5HGT A;  2PW7 A;  2R7D A;  1N33 Q;  1QB5 D;  1B53 A;  3OW2 A;  1BOS A;  3A7A B;  4K14 A;  1WTQ A;  3DEO A;  4TRD A;  5GAD C;  5M5W B;  3N52 A;  3I4M G;  4CKC A;  4DR1 L;  1LTR D;  1WD1 A;  2JA8 G;  4LFC Q;  3QO2 A;  5IT9 L;  1EWH A;  1ROD A;  3GP7 A;  2PPB C;  4UP9 A;  1VQ7 A;  1SYG A;  3I4N B;  2F4V Q;  4I7A A;  4KTA A;  2RDG A;  1X3P A;  3FKI H;  2K1B A;  1EQT A;  1TWA H;  3OIQ A;  1TS5 A;  3GTL B;  3GTP B;  3KK7 A;  1PH4 A;  3OW7 A;  2MGS A;  3R3O A;  1CM9 A;  2C35 B;  5ISR A;  1M4V A;  1K3R A;  1O7Y A;  4V0B A;  1JJ2 A;  3ERS X;  1KC8 C;  2JA6 G;  3T13 A;  2K03 A;  1TWC H;  4OO1 I;  4Y7N B;  2WB1 G;  3C3L A;  4RGO S;  1GM5 A;  4P2C B;  5G3L D;  2KHI A;  1LV9 A;  2FMC A;  3DWQ A;  1Y8O B;  2XNA C;  3M7G A;  3KLS X;  3DLL A;  4A3E B;  1QNU A;  3RN2 A;  4BY7 G;  2Z8L A;  2B2U A;  2JEB I;  5JJI A;  2JK8 A;  2KVM A;  1AE3 A;  5IT9 E;  2A1A A;  2KEN A;  5C0X H;  2D62 A;  2EIF A;  3AMU A;  1II3 A;  4LFA Q;  5COR A;  3T1Y L;  5IYB G;  1Q3L A;  1RKN A;  4UP8 A;  3C46 A;  1GHK A;  4NXM Q;  1TS4 A;  2K32 A;  5L37 A;  1Y8N B;  1N33 L;  1SMX A;  2X6L A;  2DY7 A;  1JCK B;  3AFQ A;  4RAU C;  1BVS A;  2HHH L;  1G6P A;  2B3G A;  2HCC A;  3W5O A;  4HCS A;  4B3T Q;  3GV6 A;  2ICI A;  2MHV A;  1MI2 A;  1EL0 A;  1RTO A;  4KKS A;  1NMF A;  3GTP H;  4IPG A;  1B9N A;  1EQQ A;  4DR5 Q;  2K6A A;  3IFT A;  1Y69 U;  5CBE E;  3S16 H;  1QZH A;  4Y7N H;  2Z4H A;  1G29 1;  1AE2 A;  1ENA A;  1LO5 D;  4IQZ A;  5IGB A;  1HNX Q;  2NN6 H;  1J6Q A;  2BE5 D;  4X66 Q;  4K6L A;  3I56 A;  1H9S A;  1T5X D;  3HS0 C;  1HR0 Q;  2R7Z H;  3G48 A;  1UEB A;  2E2H H;  4KV6 A;  3J7A 5;  2BH2 A;  3RZO B;  4ABN A;  4LF9 Q;  3I4M B;  3CRK C;  2E2D C;  1G8Z D;  1LUZ A;  1KAB A;  1D5Z C;  4EVO A;  3M3Y B;  2X69 A;  3E0E A;  5BN4 A;  2H5X A;  3S2H B;  1F9P A;  4LFA L;  1HJP A;  2PNH A;  4HIO A;  3CCE A;  1LTL A;  2QEJ C;  1NE3 A;  2L55 A;  1TVX A;  1W3S A;  3W3A A;  1BBW A;  5FLM G;  2MNA A;  4NPS A;  1XXG A;  3NEL A;  3P75 A;  2FFK B;  1S5B D;  1KXL A;  4B9W A;  4OEM B;  1P8L A;  3F2U A;  1S5F D;  1S3O A;  4DR5 L;  4R4O A;  4KN4 C;  3RLN A;  4WRD A;  3HOX B;  2Q2H A;  4JI7 Q;  2A5H A;  1HNX L;  1VQI A;  2Y0S G;  4LK1 C;  3H15 A;  4X66 L;  1D2B A;  3H3V I;  3RZO H;  5BR8 Q;  3QG1 A;  1EUJ A;  1MGS A;  3K81 C;  1LLR D;  2F0V A;  2EYP A;  3T56 B;  2UUC L;  4LF9 L;  1AN8 A;  4JI2 Q;  3A8I E;  3M4P A;  1HTL D;  2B8G A;  4N8X 1;  5GRO A;  3VDY A;  3TQY A;  1LTA D;  1I5F A;  4R8I A;  2JSO A;  1L0W A;  1SRU A;  1D1I A;  4DAM A;  1O7Z A;  4MTK A;  3GTK B;  3H09 A;  4KMU C;  1E3P A;  3SK5 A;  2EY1 A;  3I55 A;  3QWN A;  1SE4 A;  2BCO A;  4AQY L;  2I5M X;  4FF4 A;  2EE1 A;  3K5M A;  1HZ9 A;  5M5X B;  1Y1W G;  2Z9H A;  5IGG A;  2RKS A;  4IAL A;  1NY4 A;  4PG3 A;  1BBU A;  3HOX H;  3A5Z B;  1IW7 C;  2N88 A;  1LT4 D;  4A3M H;  1SYF A;  2DNC A;  3ULP A;  1TY0 A;  4A3J G;  3BJU A;  3I3C A;  2KCM A;  3DWA A;  1TQO A;  3S9W A;  5BR8 L;  2QA4 A;  1PTO B;  4XDX A;  3H3V C;  2EY5 A;  3FEW X;  5NUC A;  1WCM H;  4OL7 A;  3I91 A;  3GTO H;  1BQQ T;  4Y52 H;  4A3B G;  4ZCK A;  1EWC A;  3OIP A;  4A3L H;  1NR2 A;  2NN6 I;  4JI3 L;  2AHO B;  1VQK A;  2R93 G;  5ELF A;  3GTK H;  2K52 A;  1PYW D;  4OX9 Q;  3A74 A;  2MQH A;  1X6O A;  4R9W A;  4PMW A;  3DM3 A;  2F4I A;  1C48 A;  1DZ1 A;  3RUZ A;  4IFD H;  3TS0 A;  4CDC C;  4X65 Q;  3D3R A;  4RG1 A;  2RDF A;  2Y0S B;  4O42 A;  2HCI A;  4DV2 L;  2IX1 A;  4KD3 A;  4U67 3;  3BVG A;  2KUM A;  3CC4 A;  3TEH B;  4XQQ A;  3VYU A;  4QUC A;  1JMC A;  2NVY B;  4DA2 A;  3L3O C;  4FO2 A;  5I6W A;  1PFB A;  5I9O A;  2E2I H;  4UDU C;  1Q86 C;  1XJV A;  1SXT A;  1GXD C;  4M1U B;  3NXW A;  2L11 A;  1GUN A;  1IHZ A;  1LTG D;  1S72 A;  1VQG A;  4A3D B;  2KHS A;  2I0Q A;  2Y0S E;  3S24 A;  1SE3 A;  5JVH 3;  1C4Q A;  2BA0 A;  3S15 B;  4RKB A;  4C3J H;  4JI8 Q;  4F8M A;  2F0E A;  4DAY A;  2H1E A;  4XYO A;  1V43 A;  4IFD J;  4TVA B;  2YTY A;  4EX5 A;  2RVL A;  1Y1W B;  2F1M A;  1FNU A;  3W2D A;  3HG9 A;  4GLA C;  5E1F A;  2UXC Q;  4GKK Q;  2RCF A;  1UWV A;  2RBM A;  2VB2 X;  3P7J A;  4BBS H;  4DK6 C;  1SEB D;  1EZ6 A;  1N32 Q;  2I5L X;  3EN2 A;  3CCQ A;  1Z9F A;  2K01 A;  5AFW A;  1I6H B;  4A3F B;  2E76 C;  3VYS A;  1NNX A;  2QW7 A;  2UXD Q;  3Q6S A;  4K5W A;  5IP7 H;  4PZ8 A;  1QUQ B;  4A3B B;  4FXK C;  1NAP A;  3U9O A;  1TS3 A;  1YHQ A;  1NCV A;  4A3D H;  3FRP B;  2R93 B;  3MAQ A;  2D0P A;  3MXG A;  1VQC A;  1ESR A;  1J5E Q;  3SEB A;  4OEL B;  1LT6 D;  2NTT A;  1QNK A;  5IYD G;  4BA1 I;  2B2Y A;  1SJE D;  2PQA B;  4JI8 L;  2ZT9 C;  4L63 B;  5EKK A;  5BN3 A;  1N34 Q;  3DUZ A;  1V1P B;  4ILW A;  3J81 i;  5IGE A;  1U5K A;  1JQY D;  1I50 B;  2E5L L;  2VB3 X;  2F3I A;  4X62 Q;  2DJG C;  4LUO A;  1WD0 A;  1QCB D;  5ELD A;  5IIF A;  4XXE A;  2UXC L;  4GKK L;  1AZP A;  2SDF A;  1O7I A;  2WKC A;  3HGB A;  1GOZ A;  3EBE A;  3HOZ H;  1CFM A;  4JBM A;  5J3B A;  4IUR A;  4OWX B;  3D6W A;  3X3N A;  1VQ4 A;  1Y1V H;  2E75 C;  3IKJ A;  1SRO A;  3K0X A;  3NBH B;  2NZO A;  1BCP F;  2UXD L;  1VQE A;  3PCO B;  5E4W C;  5LL6 X;  3JAM E;  3OYY A;  4IFD I;  2F0D A;  1VQL A;  1PFS A;  1K83 H;  1XPR A;  1MJE A;  2EJF C;  1M8A A;  2B63 H;  3KDF A;  3J80 i;  3G6J B;  5DLQ E;  4B3M L;  1PYS B;  2EYF A;  2NUC A;  2UUA Q;  4LNQ A;  4HSP A;  3DHQ A;  5C4X H;  4FP5 D;  4EQN A;  4R4Q A;  1TWH B;  4A3K G;  1N34 L;  1A62 A;  1I50 H;  4IUU A;  2JE6 I;  1VMC A;  3S14 B;  1XYI A;  3HOW H;  1HQR D;  1LTI D;  3FHW A;  4A3G G;  3MEH A;  5I4D A;  5KYI A;  3VYR A;  4A3I G;  1F9S A;  1TR5 A;  1X3F A;  1VQM A;  1EIY B;  3J7Y W;  2PCF B;  2XN9 C;  3NSW A;  3PO3 H;  5C3E H;  5IGD A;  1BO0 A;  3GO5 A;  3ONA B;  3CHB D;  1HUM A;  1Z47 A;  3R2I A;  4B08 A;  1EY4 A;  2A69 D;  4DFA A;  3OTO Q;  2CQA A;  1PZJ D;  1JOK A;  2XWJ B;  2F52 A;  1AEX A;  4DV1 L;  4IUV A;  3K57 A;  2O4X A;  3C1E A;  2R3Z A;  3TDQ A;  1DXM A;  4A93 B;  1HZA A;  1STN A;  5ELN A;  1YJN A;  1R4Q B;  3DEP A;  1PHJ A;  2M9V A;  1GUW A;  2MO1 A;  1HNZ L;  2A69 C;  1FL0 A;  4KHV A;  3TP7 A;  2VQF L;  3ERO A;  3M4Y A;  3HKZ B;  4BY1 H;  3ER0 A;  3TRE A;  2UUA L;  1V1Q A;  3D31 A;  5T1G A;  1A15 A;  3HP3 A;  3AEV A;  1VCI A;  4J6H A;  4EQ5 A;  1EQR A;  4APV A;  3J81 j;  1SFO B;  4DV5 Q;  3CP0 A;  2K5D A;  2Z4I A;  2WIN B;  1YJW A;  1BCP D;  1KDB A;  1PTO C;  2BOS A;  4CJ1 B;  1XMO Q;  1QOH A;  3CKI B;  4KY7 A;  5EKI A;  4O1N A;  3EIV A;  3S1M H;  4DUZ L;  2OQK A;  3T1H L;  3HKZ E;  1AP0 A;  4KKT A;  1YBY A;  4ZAI A;  3QB3 A;  2NVQ B;  1X54 A;  1T5E A;  2F0M A;  3BYY B;  3T16 A;  2YV5 A;  5M3M B;  4MHE A;  2PO4 A;  3PUX A;  4A3K B;  3GTJ H;  4WJ3 M;  1MSH A;  5JJK A;  3PIP A;  2JA5 H;  4LF6 L;  3PUZ A;  1XNQ Q;  1MIU A;  3UE1 A;  3PIO 3;  4GOP B;  1C7Y A;  2JJQ A;  2A19 A;  5DEH A;  2E2J B;  3RZD B;  1Q8K A;  4B3S Q;  2OT2 A;  3RN5 A;  5KNB A;  4JI6 L;  5EPK A;  2A6E D;  1SFO H;  3TP6 A;  4GNX B;  1SN8 A;  1Q8I A;  4A3C H;  4UP7 A;  1K73 C;  5C44 B;  5J39 A;  5C0X G;  3U50 C;  4DNT B;  3PO2 G;  3M4O B;  4QGU A;  1E1T A;  1IBL Q;  2D0O A;  2SOB A;  3G6E A;  1KNE A;  2A6E C;  4LFB Q;  4MIU A;  5CV7 A;  4LAA A;  4NMZ A;  4RA8 A;  3CCJ A;  3E0J A;  4EQP A;  1GO3 E;  4DAV A;  3IAY A;  3H0G B;  5DM7 3;  1YZ6 A;  2A6H D;  2JA7 H;  2C9O A;  4L5Q A;  4K6D A;  2CVR A;  1PFM A;  4JCV E;  1ET9 A;  4EGV A;  4DR1 Q;  4DGZ A;  4DV0 L;  2KED A;  1X3Q A;  3M7N A;  3URY A;  4HJ7 A;  2F0T A;  5ELE A;  1AFP A;  1YNJ C;  1XNQ L;  1WTX A;  5K36 H;  2DGY A;  1QVG A;  4JOI A;  2Z6B A;  2K5V A;  1LM0 A;  2EOT A;  5D65 A;  1IZ6 A;  1KD1 C;  2PYK A;  4E6I A;  1B4O A;  1TWF H;  1J9O A;  3OWE B;  1BR9 A;  5JJL A;  2KEE A;  4UAI A;  5I6Y A;  1JB7 A;  1YNX A;  2F0L A;  3UDX A;  1OXV A;  4CDD C;  1ASZ A;  2VUM G;  3H94 A;  3M4O H;  4HIM A;  4FF3 A;  3KLS A;  3NUC A;  3HOV G;  2R6G A;  4C56 C;  1ILP A;  4DK0 A;  1PV4 A;  3T1Y Q;  3H0G H;  3H6M A;  5LMN L;  2IX0 A;  1ENC A;  3L2P A;  3I72 A;  2JXM B;  1H9M A;  1DOM A;  3BS1 A;  3RLO A;  3UDI A;  3KF6 A;  4OHJ A;  5FK9 C;  3OSO A;  1VQF A;  3CMA A;  2L5T A;  2NVT B;  4HJA A;  1K8O A;  2HHH Q;  4JYA Q;  4JPB W;  5LL6 S;  2ZXR A;  2F0P A;  2ZJP A;  4NB3 A;  4C2M B;  2K75 A;  1VQO A;  1TY2 A;  1B9M A;  1L1O C;  1VF5 C;  3H3V H;  1LT3 D;  2CWA A;  3PO2 B;  1YEZ A;  1YJ9 A;  5CV4 A;  4DV3 Q;  2PMZ B;  5GAE C;  4YY3 Q;  2R92 H;  5IOC A;  4F7X A;  3SE0 A;  3CCM A;  2IHF A;  4TKO B;  3RD4 A;  2K5N A;  2EYM A;  4AYB G;  3S2D H;  4GKJ L;  3OMG A;  3J7A V;  5HY6 A;  1PRT F;  1WFQ A;  2K05 A;  4BBR H;  3ND8 A;  5ELB A;  1S5C D;  1RTN A;  1HCZ A;  1ILQ A;  3X3M A;  4CBV A;  1ZYR D;  2B2W C;  4GN3 B;  1ASY A;  5CV8 A;  1YHA A;  2YTX A;  1Q90 A;  3D8G A;  1SNC A;  5IYC H;  5IGF A;  5T1I A;  1C9O A;  4FDB A;  3FDT A;  4O2D A;  3EQL C;  4GN4 B;  1D1K A;  3ERQ A;  5IP9 G;  3O13 A;  3L0O A;  2TMP A;  5M5W H;  1PZK D;  3I73 A;  3QJY A;  1XPU A;  2F0W A;  3B6Y A;  2HDL A;  4JBW A;  4K0K Q;  4DAY B;  3UDF A;  1FGU A;  4KHZ A;  4JYA L;  2WAC A;  4L5T A;  3QR8 A;  3I4N H;  2VUM B;  2OWO A;  3GTL H;  4CHT B;  3I4L A;  4KJN A;  1E2Z A;  1G2S A;  3HOV B;  2HUG A;  4DV3 L;  3DXJ C;  2K5W A;  5EAY A;  1UUP A;  1XMQ L;  4YY3 L;  1HNW L;  3TN2 A;  2RDH A;  3CPF A;  2QDB A;  3T53 B;  1PH6 A;  5KNC A;  3UE0 A;  2XRS D;  4OWT B;  1PXU A;  2ZTD A;  4L8J A;  4A3E H;  3G7L A;  2HDM A;  2OQ0 A;  2J7Z A;  2B29 A;  3MEF A;  5KYL A;  1MKH A;  1CKO A;  1FYC A;  1RCV D;  4XQN A;  2UUC Q;  2JA8 B;  1STE A;  1VQ9 A;  3WOF A;  4NXN Q;  3CD6 A;  2BE5 C;  1WTP A;  3Q23 A;  4G7Z C;  4JI4 L;  3DWP A;  1Q81 C;  1ESF A;  1LYL A;  1OXX K;  5EBC A;  1R9T B;  4OIK A;  3J81 c;  4KJO A;  3ULJ A;  2Q2I A;  2JA6 B;  1F2Z A;  1Q1B A;  1TT2 A;  4K0K L;  4AQY Q;  2JN4 A;  2Q8I B;  3KFU A;  2WB1 B;  1STB A;  1X65 A;  1FGB D;  3VR4 A;  4DU9 A;  5CR3 A;  4JW0 A;  3MXN B;  4FF1 A;  4ZK9 B;  1N36 L;  1I3Q B;  4BY7 B;  4NP5 A;  2HT1 A;  4CJ0 B;  1JOQ A;  5FLX c;  4NKL A;  2QEX A;  2VS1 A;  3W1B A;  4GZY C;  5JEA H;  5AJ3 Q;  1CZW A;  1ZEQ X;  3PV0 A;  3GDE A;  3E5S A;  1UNS A;  4QB4 A;  2PZW A;  4GOP C;  1CKN A;  4DV7 Q;  5ELC A;  1HHV A;  1STH A;  3I4M H;  3ZJY C;  2WB1 E;  4P73 A;  2YYZ A;  3I70 A;  4H02 A;  2JA8 H;  4UPA A;  3J80 c;  4DV6 L;  3BYT B;  3M3Y H;  3IRB A;  3A7L A;  3BDC A;  1PH8 A;  4S3S A;  3S2H H;  1F9Q A;  4LUZ A;  4GLV B;  1O78 A;  2O5J C;  4HIK A;  4JI3 Q;  4ZLT F;  1SYD A;  4NXN L;  2F3V A;  3ITP A;  4GNX C;  3RNU A;  2OEO A;  3S1N B;  1T9H A;  3AFP A;  1CK1 A;  4Q0F A;  4R4C A;  1Q7Y C;  4KHP Q;  3LWU A;  4YHH L;  1BXT A;  2V1C C;  4IUP A;  3MFG A;  4BBS G;  4ZUJ A;  1WTO A;  1A3V A;  4JBJ A;  2HQL A;  2D9U A;  4DV2 Q;  1CA5 A;  1I3Q H;  5JEA J;  4N9T A;  2B2V C;  3KF8 A;  4KLK A;  5A35 A;  1PFN A;  2VXW A;  4DR7 Q;  1YIJ A;  2YTV A;  1B7Y B;  3BZD B;  3IFD A;  4JI1 L;  4CGY B;  4DK3 C;  1KNA A;  1FD7 D;  1IKM A;  5IYB H;  1EFW A;  1C0A A;  1HFN A;  1EEI D;  2M2L A;  4DAP A;  1QZG A;  2R7F A;  4HN7 A;  1IBM Q;  5AJ3 L;  4X3K A;  2ZJQ A;  1YNN D;  3NWS A;  4IPD A;  1QWY A;  3SHL A;  2AMC B;  4K2K A;  4DV7 L;  2YU9 B;  3ICE A;  4B3R Q;  1SR3 A;  2ID0 A;  4QCL A;  3A0J A;  3CQZ B;  5C6A A;  4XQJ A;  1V8Q A;  1JB3 A;  3DM1 A;  5LMU L;  1QVF A;  2EY2 A;  2KCC A;  1KLU D;  3JC6 6;  4ME3 A;  3S1N H;  2WFW A;  3ULL A;  1WI5 A;  1YHB A;  4TSS A;  1SYE A;  1JWU D;  2IX3 A;  4DV4 L;  1PLF A;  3N6R A;  1EY0 A;  1BCP B;  4KHP L;  1VQ8 A;  2CWP A;  1Y14 B;  3NHH A;  2EVB A;  4IUT A;  3HOZ G;  3GTM B;  4LWC A;  5C5L A;  5M5X H;  1EOV A;  2BH8 A;  1FJG Q;  1VS0 A;  2SNS A;  1KAA A;  3CME A;  2EXZ A;  1EY8 A;  1ML0 D;  3FPU B;  4DR7 L;  1X56 A;  3CPW A;  4RH6 A;  2Z6K C;  2O5I C;  4K2L A;  2XSC A;  4YWL A;  2AWO A;  4H44 C;  2LKV A;  2CKZ B;  2KJX A;  5EKL A;  2CQO A;  2J0T D;  5FOB B;  1CZG A;  2EYH A;  1IBM L;  2OCE A;  1L2F A;  1SYC A;  1PTO H;  4HSV A;  1PH9 A;  2LFN A;  5EGT A;  5FLM H;  1O80 A;  4FF2 A;  1UE7 A;  4B3R L;  1RHP A;  4C1N I;  1SNM A;  4IUQ A;  1NJI C;  2LY7 A;  3HOW G;  3M85 A;  1X55 A;  1PMR A;  3PF4 A;  3NPP A;  4N9P A;  1SYB A;  3CC2 A;  4F87 A;  1MHW C;  1LTS D;  2E5L Q;  5CYU A;  4V19 0;  1WTW A;  1XPO A;  4ZRZ A;  3HOU G;  2EYL A;  1HXY D;  4IO9 A;  5DNF A;  4IOC A;  4IZ8 A;  5FJ8 G;  5JPM C;  2HQE A;  3AU7 A;  1FJG L;  4A3J B;  1FVI A;  4XIG S;  1KIX A;  5C3W A;  1PDQ A;  4L6T B;  4ZYS A;  1J8I A;  2NVY H;  3LX0 A;  1KRS A;  3VA7 A;  3SGI A;  2ZM6 L;  1VQN A;  2KHJ A;  5M3F G;  4JC0 A;  1OXU A;  1KAW A;  5CV5 A;  4DR3 L;  1JWS D;  1HR0 W;  4J15 A;  5EPL A;  1SDF A;  4B3M Q;  4LF4 Q;  3K7A B;  3FPP A;  3S15 H;  4ID6 A;  2QKI C;  4POG A;  1A3U A;  2PI2 E;  2WII B;  3OWF A;  5FO8 B;  4HMJ A;  5M5Y B;  5LHY 1;  2L4N A;  1Y1W H;  3CU7 A;  4I7Z C;  1IBK Q;  1NMG A;  2KOL A;  1GHJ A;  3A55 A;  4KY6 A;  2LSS A;  2B2T C;  3DMU A;  4OWW B; 
#chains in the Genus database with same CATH homology
 1RD9 D;  1Q12 A;  1C8C A;  3GTG B;  4QMG A;  1U4L A;  1U4P A;  5J22 A;  2XIW A;  2G9H D;  4ZUI A;  4OO1 G;  3QOJ A;  2K33 A;  4J8Q A;  5KRU A;  4OGQ C;  4HCE A;  2PZU A;  4FNF A;  2LMC B;  3QIA A;  1SNO A;  4HTH A;  1AW7 A;  3MZ5 A;  1EOT A;  2Q8T A;  5A2Q L;  4ODG A;  1SSO A;  4KK7 A;  1E0B A;  4C3H G;  1KLG D;  4HR7 B;  1L0X B;  4IUN A;  1W6J A;  1H9K A;  2MPM A;  2EJG C;  5M3F B;  1G2T A;  1G91 A;  4G57 A;  2L0C A;  5JVG 3;  3K6O A;  1JE4 A;  1EY5 A;  2LS0 1;  4HMI A;  2JP1 A;  1HQM C;  3PUY A;  2M00 A;  1SNQ A;  5A2Q E;  3RMH A;  5DAU A;  1SMY D;  4ZKB B;  4H0L C;  2O2L D;  2KCN A;  3GTQ B;  4M8A A;  1S4Z A;  4C3I G;  1I6V C;  5C3X A;  4ME5 A;  1SMY C;  5E3F A;  1SE2 A;  2QIL A;  3S1Q B;  1EQV A;  2JYO A;  2XWB B;  4ZKC B;  2FMM A;  1BBX C;  1DON A;  2IW3 A;  2A73 B;  4KI0 A;  1K8M A;  1H9S B;  2ZXO A;  5DM6 3;  1BCP C;  3SDZ A;  1H9J A;  4FVM A;  5JJZ A;  4LJZ C;  2Z1C A;  3J81 L;  4CKB A;  2OXP A;  1PRT B;  4C3H B;  3MC0 B;  3A8J E;  4FXD A;  4A3G B;  1UAP A;  1TU2 B;  4ULL A;  3TBI B;  4A3I B;  3V2T A;  1MSG A;  3HOY B;  3OMC A;  1HPC A;  1DOL A;  2NVX B;  5FLX L;  5KIX A;  3EFX D;  3LWE A;  5C5M A;  3BVZ A;  2EDG A;  3D4D A;  3E6Z X;  2KA7 A;  3J81 E;  3J80 L;  4RCO A;  4RFB A;  1VF7 A;  4C3I B;  1TWG B;  3I90 A;  1D5M C;  4XYQ A;  3A8K E;  3BDO A;  5FLX E;  4CJ2 C;  2CW0 D;  2V4D A;  2OF1 A;  3HRZ C;  3S1R B;  1HUN A;  1AZQ A;  3VR3 A;  2A6H C;  1F2L A;  1HA5 A;  4K8J A;  1LTB D;  3I8Z A;  2IJ0 A;  2F0G A;  1EIH A;  2NN6 G;  3TP8 A;  3D6C A;  4WOR A;  3TZU A;  2BA1 A;  3J80 E;  2F0F A;  4QIW B;  2DY8 A;  3GD7 A;  2EYJ A;  3VR5 A;  4WFN 3;  1STA A;  4YIJ A;  1V1P A;  3KLR A;  3D4W A;  3K59 A;  3FKI B;  1TWA B;  3GQB A;  3AB9 A;  3HZX A;  1SBB B;  1CQF A;  2ZXP A;  3K0Y A;  4NDX A;  3EJI A;  2FJ2 A;  3D4R A;  2RSO A;  3ZYY X;  4F88 A;  2TSS A;  3NBH A;  1ZKO A;  5KND A;  2IPK D;  3NP8 A;  3PIP 3;  1G6Z A;  1RJT A;  3T51 B;  5E4X A;  4G4K A;  2R61 A;  2XRQ D;  4KY5 A;  1JC7 A;  2F03 A;  2B2W A;  1TS2 A;  3TP5 A;  5JPN C;  1H9R A;  1I4R A;  5FKA C;  4KD4 A;  2SNM A;  2FHT A;  1X32 A;  5CBA E;  3L7Z C;  4BWG B;  2NYZ D;  1BNZ A;  3PUV A;  4QF4 A;  2F0K A;  1MBY A;  3S16 B;  2AQ2 B;  1DJR D;  2D5D A;  3LNN A;  3NTH A;  4DN4 M;  2I07 B;  2R7Z B;  2K5Q A;  1ZYR C;  2NB0 A;  1STY A;  2E2H B;  1EEF D;  4PMB A;  1GUG A;  1XTC D;  1GUO A;  1LT5 D;  1ICW A;  2B2U C;  5IGC A;  2MUY A;  4PV1 C;  4DK1 A;  2EY6 A;  2F0J A;  3H91 A;  2NZ1 D;  1E2W A;  1EY7 A;  3L9A X;  1OXS C;  4I65 A;  2AUJ D;  3NTI A;  5C4H A;  2EYO A;  3BVM A;  4BS9 A;  3KBX A;  5C0X J;  2CHB D;  3VYT A;  1Q1E A;  4IFD G;  1XWE A;  5D3I B;  1IL8 A;  1R4P B;  3BDL A;  1BUV T;  3Q24 A;  4AYB B;  5D3D A;  1PRT D;  3VR6 A;  1TKW B;  2MJ8 A;  4JK1 C;  2E74 C;  2NWG A;  3C1F A;  4PNY A;  5D14 A;  4KN7 C;  1I4X A;  4J1M A;  5CV9 A;  3RLF A;  1PRT C;  1NSN S;  2K04 A;  4C3J G;  1JWM D;  3K58 A;  1KTK A;  2L12 A;  1EYA A;  1Z6H A;  3MVV A;  1WVL A;  2RSN A;  1LAB A;  2BDO A;  1B3A A;  3PUW A;  4X3S A;  2WP8 J;  4A3M B;  4DXF A;  2B2V A;  1CI3 M;  3PMF A;  5K5P A;  5KEE A;  5EJW A;  1JOO A;  4H13 C;  4BA2 I;  1I4G A;  2N55 A;  1B50 A;  2NTS A;  1Z7T A;  2F0N A;  1DYQ A;  3V05 A;  1WCM B;  2D2C C;  2PZT A;  1CHP D;  3GTO B;  4MN3 A;  3TZD A;  4QUF A;  3EVQ A;  3C2P A;  1A2T A;  3NBI A;  1IW7 D;  5C0X I;  4ZQ3 A;  2F0U A;  3IL8 A;  3MTS A;  1U4R A;  1ONL A;  1DCZ A;  4EQO A;  1DOK A;  3J7A F;  1LAC A;  4RKL A;  1I4P A;  3MHB A;  4PQX A;  1IKL A;  5C4Z A;  1YNN C;  4PMC A;  2E2I B;  4K5X A;  1JR0 D;  4RWS C;  1XX8 A;  2F3W A;  1DM0 B;  1VDZ A;  2EPB A;  2WKD A;  4C3J B;  2K28 A;  1U4M A;  1A2U A;  1F2Y A;  3BG3 A;  4FXG C;  5KGU A;  1CT1 D;  1I4H A;  4B9X A;  4DF7 A;  1F2M A;  5CGK A;  3R93 A;  4Z9C B;  1EY6 A;  2C5C A;  1EYD A;  4BBS B;  1TII D;  5CV6 A;  3P1H A;  1B1Z A;  3S17 B;  5EQ0 A;  2L9H A;  1ET6 A;  2KEC A;  4KKU A;  5BN5 A;  1EZ8 A;  3SR1 A;  5FO9 B;  1B44 D;  2QF7 A;  4R8N A;  4WJW A;  2AQ3 B;  3OOC A;  1S5E D;  5JAV A;  1CTM A;  1NR4 A;  3FMC A;  1GUT A;  2B2T A;  4RHS A;  3HOZ B;  1EU4 A;  1Y1V B;  4HAE A;  2H4O A;  2B8F A;  5FO7 B;  5EPJ A;  1K83 B;  1LTT D;  5HUR A;  2F0H A;  2B63 B;  1EY9 A;  2KQ3 A;  4U68 A;  2BDN A;  3SK6 A;  1HA6 A;  1CQV A;  5J1Z A;  3JAM L;  5C4X B;  3MA2 B;  3MXN A;  2B2Y C;  3HOW B;  2IWH A;  3Q0A A;  1PTO F;  1QIL A;  2GA4 B;  1IYU A;  3NQT A;  2F0S A;  1EYC A;  1KDA A;  4HED A;  3NK9 A;  2B39 A;  3HOU B;  1BF4 A;  3PO3 B;  5CC4 A;  2K7V A;  5C3E B;  5I9P A;  2WV6 D;  5M9O A;  2EZV A;  2I46 A;  2DNE A;  4CKE A;  3TME A;  1O7L A;  3WOE A;  4XT3 B;  4G7O C;  2QCP X;  1Y8P B;  2IL8 A;  4DNR B;  1HFG A;  1L0Y B;  1PZI D;  1SAP A;  4XT1 B;  4BY1 B;  4Q5V A;  3OHX C;  1F9R A;  3MXU A;  1QE6 A;  1FNW A;  2RQX A;  4X3T A;  1SND A;  1OXT A;  2EJM A;  5TSS A;  5CMD A;  5K36 G;  1STG A;  2VNU D;  1EU3 A;  1V1O A;  3S1M B;  2IT1 A;  2X6G A;  1EFI D;  3R2T A;  1JOR A;  3KBG A;  1S5D D;  4K5V A;  5JOB A;  4C1N K;  2AQ1 B;  2RA4 A;  1NUC A;  5C4J B;  2ICE C;  1HRJ A;  5EBD A;  3GTJ B;  4OIJ A;  4NW2 A;  3VR2 A;  2JA5 B;  3VA5 A;  2DN8 A;  3NWT A;  3P20 A;  2F0O A;  1PTO D;  1WTV A;  1D5X C;  3V96 A;  1GJX A;  5F2D A;  2FIN B;  4RHR A;  1I4Q A;  3NTK A;  3A56 A;  1UEA B;  4LMQ D;  1RDP D;  1RF2 D;  2SEB D;  4RGM A;  1A6X A;  1D6E C;  2NBF A;  1IYV A;  4RGN A;  1KDC A;  3U9S A;  1B2T A;  3HEJ A;  3TSS A;  4XTC S;  3K5N A;  3K5L A;  1ZXT A;  2JA7 B;  2Q8R E;  1EIG A;  3R8B A;  2PNR C;  5COY A;  4OO1 H;  3A54 A;  4IN3 A;  3NE5 B;  1QG7 A;  3OPO A;  4TQU S;  2J4X A;  2AUK A;  2XVS A;  1W6K A;  2A74 C;  3MFY A;  2PQE A;  3T4A C;  3WDN A;  1E2V A;  3GV3 A;  1TWF B;  3EA6 A;  4DXG A;  1F77 A;  4H7B A;  5IOD A;  2ENB A;  3Q22 A;  3UI2 A;  3SK8 A;  2G9D A;  3MXP A;  3SXH A;  2PW5 A;  4RCN A;  2A68 D;  5I2X A;  3NQI A;  3K5O A;  2WAQ B;  1DD2 A;  1YNJ D;  1ENF A;  1WTR A;  1HTP A;  3CRL C;  1CA6 A;  1CHQ D;  1OO9 B;  3MWY W;  5G3L F;  2L1B A;  2CW0 C;  1U9R A;  2A68 C;  4FYD A;  4K8I A;  2F0I A;  2MP1 A;  1MD2 D;  5I2Y A;  1VMP A;  2F0Q A;  1SJH D;  3QOL A;  2JEA I;  1FNV A;  1FR3 A;  2R92 B;  3FVQ A;  1TWC B;  1QJO A;  4G7H C;  3S2D B;  4X3U A;  1BDO A;  1A3T A;  4BBR B;  3SK4 A;  4RGT A;  3SVM A;  1GUS A;  1SNP A;  3KUP A;  2AWN A;  1JIC A;  3ND9 A;  5JEA G;  5HGT A;  2PW7 A;  1QB5 D;  1B53 A;  1BOS A;  3A7A B;  4K14 A;  1WTQ A;  3DEO A;  4TRD A;  5M5W B;  3N52 A;  4CKC A;  1LTR D;  1WD1 A;  3QO2 A;  5IT9 L;  1EWH A;  1ROD A;  3GP7 A;  2PPB C;  3I4N B;  1SYG A;  4KTA A;  2RDG A;  1X3P A;  2K1B A;  1EQT A;  3OIQ A;  1TS5 A;  3GTL B;  3GTP B;  3KK7 A;  3OW7 A;  2MGS A;  3R3O A;  1CM9 A;  5ISR A;  1M4V A;  1O7Y A;  4V0B A;  3T13 A;  2K03 A;  4OO1 I;  4Y7N B;  3C3L A;  4RGO S;  4P2C B;  5G3L D;  1LV9 A;  2FMC A;  3DWQ A;  1Y8O B;  2XNA C;  3M7G A;  3KLS X;  4A3E B;  1QNU A;  2Z8L A;  2B2U A;  2JEB I;  5IT9 E;  2KVM A;  5C0X H;  2D62 A;  3AMU A;  1II3 A;  5COR A;  1Q3L A;  1RKN A;  3C46 A;  1GHK A;  1TS4 A;  2K32 A;  1Y8N B;  2X6L A;  2DY7 A;  1JCK B;  4RAU C;  2HCC A;  4HCS A;  3GV6 A;  2ICI A;  2MHV A;  1MI2 A;  1EL0 A;  1RTO A;  4KKS A;  1B9N A;  2K6A A;  3IFT A;  1Y69 U;  5CBE E;  2Z4H A;  1G29 1;  1ENA A;  1LO5 D;  4IQZ A;  5IGB A;  2NN6 H;  2BE5 D;  4K6L A;  1H9S A;  1T5X D;  3HS0 C;  4KV6 A;  3RZO B;  4ABN A;  3I4M B;  3CRK C;  2E2D C;  1G8Z D;  1KAB A;  1D5Z C;  4EVO A;  3M3Y B;  2X69 A;  5BN4 A;  3S2H B;  1F9P A;  2QEJ C;  2L55 A;  1TVX A;  3W3A A;  1XXG A;  3P75 A;  2FFK B;  1S5B D;  4B9W A;  3F2U A;  1S5F D;  4KN4 C;  4WRD A;  3HOX B;  2A5H A;  4LK1 C;  1D2B A;  3QG1 A;  1MGS A;  1LLR D;  2F0V A;  2EYP A;  3T56 B;  1AN8 A;  3A8I E;  1HTL D;  2B8G A;  1LTA D;  4R8I A;  2JSO A;  1D1I A;  1O7Z A;  3GTK B;  3H09 A;  4KMU C;  3SK5 A;  2EY1 A;  3QWN A;  1SE4 A;  2BCO A;  4FF4 A;  2EE1 A;  3K5M A;  5M5X B;  5IGG A;  2RKS A;  4IAL A;  1IW7 C;  2N88 A;  1LT4 D;  1SYF A;  2DNC A;  1TY0 A;  3I3C A;  3DWA A;  1TQO A;  3S9W A;  1PTO B;  4XDX A;  3H3V C;  2EY5 A;  3FEW X;  5NUC A;  4OL7 A;  3I91 A;  1BQQ T;  1EWC A;  3OIP A;  1NR2 A;  2NN6 I;  5ELF A;  1PYW D;  4R9W A;  4PMW A;  2F4I A;  1C48 A;  1DZ1 A;  3RUZ A;  4IFD H;  3D3R A;  2RDF A;  2Y0S B;  4O42 A;  2HCI A;  2IX1 A;  4KD3 A;  4U67 3;  3BVG A;  2KUM A;  4XQQ A;  3VYU A;  4QUC A;  2NVY B;  4DA2 A;  3L3O C;  4FO2 A;  5I6W A;  1PFB A;  5I9O A;  4UDU C;  1SXT A;  1GXD C;  4M1U B;  3NXW A;  2L11 A;  1GUN A;  1IHZ A;  1LTG D;  4A3D B;  2KHS A;  1SE3 A;  5JVH 3;  1C4Q A;  2BA0 A;  3S15 B;  4RKB A;  4F8M A;  2F0E A;  4DAY A;  2H1E A;  4XYO A;  1V43 A;  4IFD J;  2RVL A;  1Y1W B;  2F1M A;  1FNU A;  3W2D A;  3HG9 A;  5E1F A;  2RBM A;  2VB2 X;  3P7J A;  1SEB D;  1EZ6 A;  2K01 A;  5AFW A;  1I6H B;  4A3F B;  2E76 C;  3VYS A;  3Q6S A;  4K5W A;  4A3B B;  4FXK C;  1NAP A;  3U9O A;  1TS3 A;  1NCV A;  3FRP B;  2R93 B;  3MAQ A;  3MXG A;  1ESR A;  3SEB A;  1LT6 D;  2NTT A;  1QNK A;  4BA1 I;  2B2Y A;  1SJE D;  2ZT9 C;  4L63 B;  5EKK A;  5BN3 A;  3DUZ A;  1V1P B;  4ILW A;  5IGE A;  1JQY D;  1I50 B;  2VB3 X;  1WD0 A;  1QCB D;  5ELD A;  5IIF A;  4XXE A;  1AZP A;  2SDF A;  2WKC A;  3HGB A;  1GOZ A;  1CFM A;  4IUR A;  3D6W A;  3X3N A;  2E75 C;  3IKJ A;  1BCP F;  3JAM E;  5E4W C;  5LL6 X;  4IFD I;  2F0D A;  2EJF C;  1M8A A;  3G6J B;  2EYF A;  2NUC A;  4HSP A;  3DHQ A;  4FP5 D;  4EQN A;  1TWH B;  4IUU A;  2JE6 I;  1VMC A;  3S14 B;  1XYI A;  1HQR D;  1LTI D;  3MEH A;  5I4D A;  5KYI A;  3VYR A;  1F9S A;  1TR5 A;  3J7Y W;  2PCF B;  2XN9 C;  3NSW A;  5IGD A;  1BO0 A;  3GO5 A;  3ONA B;  3CHB D;  1HUM A;  1Z47 A;  3R2I A;  4B08 A;  1EY4 A;  2A69 D;  4DFA A;  2CQA A;  1PZJ D;  1JOK A;  2XWJ B;  1AEX A;  4IUV A;  3K57 A;  2O4X A;  3C1E A;  2R3Z A;  3TDQ A;  1DXM A;  4A93 B;  1STN A;  1R4Q B;  3DEP A;  2M9V A;  1GUW A;  2A69 C;  4KHV A;  3TP7 A;  3ERO A;  3HKZ B;  3M4Y A;  3D31 A;  5T1G A;  1A15 A;  3HP3 A;  1VCI A;  4J6H A;  1SFO B;  2K5D A;  2Z4I A;  2WIN B;  1BCP D;  1KDB A;  1PTO C;  2BOS A;  4CJ1 B;  1QOH A;  3CKI B;  4KY7 A;  5EKI A;  4O1N A;  1AP0 A;  4KKT A;  4ZAI A;  3QB3 A;  2NVQ B;  1T5E A;  2F0M A;  3BYY B;  3T16 A;  5M3M B;  4MHE A;  2PO4 A;  3PUX A;  4A3K B;  1MSH A;  3PUZ A;  3PIO 3;  5DEH A;  2E2J B;  3RZD B;  2OT2 A;  5KNB A;  5EPK A;  2A6E D;  3TP6 A;  1Q8I A;  5C44 B;  5J39 A;  5C0X G;  4DNT B;  3M4O B;  2SOB A;  1KNE A;  2A6E C;  4MIU A;  5CV7 A;  4LAA A;  4NMZ A;  4RA8 A;  3E0J A;  4EQP A;  4DAV A;  3IAY A;  3H0G B;  5DM7 3;  2A6H D;  2C9O A;  4K6D A;  2CVR A;  1PFM A;  1ET9 A;  4EGV A;  4DGZ A;  2KED A;  1X3Q A;  3M7N A;  3URY A;  2F0T A;  5ELE A;  1AFP A;  1YNJ C;  1WTX A;  5K36 H;  2EOT A;  5D65 A;  2PYK A;  4E6I A;  1B4O A;  1J9O A;  3OWE B;  1BR9 A;  2KEE A;  4UAI A;  5I6Y A;  2F0L A;  1OXV A;  3H94 A;  4FF3 A;  3KLS A;  3NUC A;  2R6G A;  4C56 C;  1ILP A;  4DK0 A;  3H6M A;  2IX0 A;  1ENC A;  3I72 A;  2JXM B;  1H9M A;  1DOM A;  3BS1 A;  4OHJ A;  5FK9 C;  3OSO A;  2L5T A;  2NVT B;  1K8O A;  5LL6 S;  2ZXR A;  2F0P A;  4C2M B;  1TY2 A;  1B9M A;  1VF5 C;  1LT3 D;  3PO2 B;  5CV4 A;  2PMZ B;  5IOC A;  4F7X A;  3SE0 A;  4TKO B;  3RD4 A;  2EYM A;  3OMG A;  3J7A V;  1PRT F;  2K05 A;  3ND8 A;  5ELB A;  1S5C D;  1RTN A;  1HCZ A;  1ILQ A;  3X3M A;  4CBV A;  1ZYR D;  2B2W C;  5CV8 A;  1Q90 A;  3D8G A;  1SNC A;  5IGF A;  5T1I A;  3FDT A;  3EQL C;  1D1K A;  3ERQ A;  3O13 A;  2TMP A;  1PZK D;  3I73 A;  3QJY A;  2F0W A;  2HDL A;  4JBW A;  4KHZ A;  2WAC A;  2VUM B;  4CHT B;  3I4L A;  4KJN A;  1E2Z A;  1G2S A;  3HOV B;  2HUG A;  3DXJ C;  2K5W A;  1UUP A;  3TN2 A;  2RDH A;  2QDB A;  3T53 B;  5KNC A;  2XRS D;  1PXU A;  4L8J A;  3G7L A;  2HDM A;  2J7Z A;  5KYL A;  1FYC A;  1RCV D;  4XQN A;  2JA8 B;  1STE A;  3WOF A;  2BE5 C;  1WTP A;  3Q23 A;  4G7Z C;  3DWP A;  1ESF A;  5EBC A;  1OXX K;  1R9T B;  4OIK A;  4KJO A;  2JA6 B;  1F2Z A;  1Q1B A;  1TT2 A;  2Q8I B;  2WB1 B;  1STB A;  1FGB D;  3VR4 A;  4DU9 A;  5CR3 A;  4FF1 A;  4ZK9 B;  1I3Q B;  4BY7 B;  4NP5 A;  4CJ0 B;  1JOQ A;  4NKL A;  4GZY C;  5JEA H;  1CZW A;  1ZEQ X;  3PV0 A;  3E5S A;  1UNS A;  4QB4 A;  2PZW A;  1HHV A;  5ELC A;  1STH A;  2YYZ A;  3I70 A;  3BYT B;  3A7L A;  3BDC A;  4S3S A;  1F9Q A;  1O78 A;  2O5J C;  4ZLT F;  1SYD A;  2F3V A;  3ITP A;  2OEO A;  3S1N B;  1CK1 A;  4Q0F A;  3LWU A;  1BXT A;  4IUP A;  3MFG A;  4ZUJ A;  1WTO A;  1A3V A;  2D9U A;  1CA5 A;  5JEA J;  4N9T A;  2B2V C;  3KF8 A;  5A35 A;  1PFN A;  2VXW A;  3BZD B;  3IFD A;  4CGY B;  1KNA A;  1FD7 D;  1IKM A;  1HFN A;  1EEI D;  2M2L A;  4DAP A;  4HN7 A;  4X3K A;  1YNN D;  3NWS A;  1QWY A;  3SHL A;  4K2K A;  2YU9 B;  2ID0 A;  4QCL A;  3CQZ B;  5C6A A;  4XQJ A;  1V8Q A;  1JB3 A;  3DM1 A;  2EY2 A;  2KCC A;  1KLU D;  4TSS A;  1SYE A;  1JWU D;  2IX3 A;  1PLF A;  3N6R A;  1EY0 A;  1BCP B;  3NHH A;  2EVB A;  4IUT A;  3GTM B;  5C5L A;  2SNS A;  1KAA A;  2EXZ A;  1EY8 A;  1ML0 D;  3FPU B;  2O5I C;  4RH6 A;  4K2L A;  2XSC A;  2AWO A;  4H44 C;  2LKV A;  2KJX A;  5EKL A;  2J0T D;  5FOB B;  1CZG A;  2EYH A;  1SYC A;  1PTO H;  4HSV A;  2LFN A;  5EGT A;  1O80 A;  4FF2 A;  1RHP A;  4C1N I;  1SNM A;  4IUQ A;  2LY7 A;  3M85 A;  1PMR A;  3NPP A;  4N9P A;  1SYB A;  4F87 A;  1LTS D;  5CYU A;  4V19 0;  1WTW A;  4ZRZ A;  2EYL A;  1HXY D;  5DNF A;  4IZ8 A;  5JPM C;  2HQE A;  3AU7 A;  4A3J B;  4XIG S;  5C3W A;  1PDQ A;  4L6T B;  4ZYS A;  1J8I A;  3LX0 A;  3VA7 A;  1OXU A;  5CV5 A;  1JWS D;  5EPL A;  1SDF A;  3K7A B;  3FPP A;  4ID6 A;  2QKI C;  1A3U A;  2WII B;  3OWF A;  5FO8 B;  4HMJ A;  5M5Y B;  5LHY 1;  2L4N A;  3CU7 A;  4I7Z C;  2KOL A;  1GHJ A;  3A55 A;  4KY6 A;  2B2T C;  3DMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...