1BR9A

Human tissue inhibitor of metalloproteinase-2
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
182
Chain Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of human tissue inhibitor of metalloproteinases-2 at 2.1 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor
molecule keywords METALLOPROTEINASE-2 INHIBITOR
total genus 50
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 1998-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1br9A02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1br9A01
1D2BA 3FRPB 1UAPA 5JPNC 1OO9B 4FXGC 3L3OC 3I70A 5FOBB 4FXKC 1BUVT 3CU7A 1GXDC 3MA2B 3G6JB 2TMPA 2I07B 3OHXC 4ILWA 2A74C 1JB3A 3HRZC 1BQQT 5FO8B 1XWEA 2XWBB 3T4AC 5JPMC 3CKIB 2E2DC 3V96A 2WINB 1JC7A 2J0TD 1PXUA 1UEAB 3HS0C 2ICEC 3KLSA 2QKIC 5FO9B 2B39A 5FO7B 2A73B 2XWJB 1BR9A 2WIIB
chains in the Genus database with same CATH superfamily
3OOCA 3PGZA 1EZ6A 4QQBX 1GUOA 2FJ2A 2BDNA 3VR6A 2OEOA 1XMQL 2UXCL 2Y0SB 2VUMH 1VMCA 3PUZA 2F0GA 1PTOD 4JI3Q 1X9NA 3SK5A 3LWUA 4DAPA 2F0EA 4BBRG 1UE1A 1ZYRC 3PUVA 4DV7L 4ZKBB 2ASBA 5BN4A 1CQFA 3D31A 1ENAA 1O7ZA 2UUAL 2HCCA 5BN3A 1H9JA 2DGYA 4LF8Q 1ASZA 2HDMA 4RHSA 1L1OC 1L2FA 3FMCA 4S3SA 4IPDA 4B3ML 2Z1CA 5M5XB 1KC8C 1CSPA 1HR0W 1GJXA 2F0KA 3D8GA 2RDFA 5AFWA 4JI0L 3LNNA 1PH5A 1Q1BA 2QEXA 4YY3Q 1EWHA 1ILPA 4JCVE 3QWNA 4LF7Q 3J80i 3MXGA 1B44D 3C1EA 3IKJA 4NMZA 2AQ3B 1WOCA 2SEBD 3ULJA 4HEDA 3GTLH 1S5CD 1OXVA 1HA6A 2BE5C 2EXZA 2RHQB 2EY2A 3BVMA 2DNCA 2KHIA 4J8QA 3SE0A 1VDZA 3K5LA 3E6ZX 1PHJA 1HNZQ 5M3FB 2RCFA 4IFDG 4GKJQ 5D3IB 3PO2H 1FGBD 4DAYB 4I65A 2UUBQ 4MZ9A 1EQQA 2KENA 3MEHA 1EEID 4OEMB 4JBJA 1SEBD 2CKZB 4A3FG 1CFMA 2B39A 4WFN3 3PIP3 2Z0SA 4CGYB 3NE5B 3S1MB 2JN4A 1AN8A 3PF4A 1SSOA 1KRTA 2VXWA 4YWLA 1UUPA 3TP5A 3K8AA 4WJ4A 1YEZA 3K0XA 2ZJQA 2A68D 3RZDH 1PH9A 4YIJA 4OO1I 1QOHA 4X3KA 5HGQA 4KHPQ 2XWBB 1RDPD 4QY7A 1Q1EA 3NBHA 1B4OA 3OTOQ 3E3XA 5EJWA 2E2JH 4ZK9B 3ERQA 1T5XD 3TMEA 2Q8RE 4B3RL 3NP8A 1IW7D 5C6AA 3MC0B 5K36G 5JEAG 5JVH3 5GAHC 3S1RH 1JWSD 1Y1WB 1EUJA 4UY8C 1B50A 3FKIG 2A69D 2EDGA 4JI0Q 2UUAQ 4JOIA 2F0UA 1E2ZA 5C4XB 1JB3A 1I4GA 1AEXA 3W3AA 4XXEA 1QNKA 3T53B 3UI2A 4IUVA 5M5WB 2B2TC 4DV2L 5C4XH 4C3IB 1H9SB 1NR2A 1ONLA 1XMOQ 1V8QA 1L0WA 4BWGB 2JEBI 4YY3L 1RTNA 1C7YA 5I2YA 4QGUA 4OWWB 3MXNA 1G6ZA 5IYCG 3J7A5 4FXGC 4C3HB 2NTTA 3L3OC 2ICIA 4OGQC 1BO0A 1IBKL 3BYYB 1PZJD 1VCIA 2B2WC 1VQ8A 3GV3A 4KKTA 2KEDA 2ZXOA 4EQOA 2VQFQ 3T1HL 1BXTA 4XT1B 4CKEA 1Q90A 2B3GA 1PFNA 2HIVA 2L4NA 2R7DA 4R8NA 4R1JA 4RG1A 4KY7A 3S9WA 1IBML 4DUZQ 2A73B 5JPNC 2EPBA 4DV1Q 3HOWH 4K5VA 4A3IH 4C1NK 1GUNA 1K83B 1WCMG 2AQ1B 3KLRA 3R3OA 2NVXB 1I50H 2K52A 1F9PA 3V2TA 4LF5L 3PMFA 2SNMA 3TBIB 2RHSB 4A3GH 3RLNA 4U68A 2I0QA 3S15B 4DV2Q 4GZYC 1KABA 1E2VA 2WV6D 2XNAC 3KF8A 4B3RQ 5E4XA 5FO9B 2OQKA 3WDNA 1I4PA 4PQXA 1TT2A 5LL6S 1VQ4A 2KUMA 2RVLA 4MHEA 2KEEA 2EJMA 3M4PA 5JJLA 3KF6B 4X66L 2CFMA 3GTQH 1A6XA 4H02A 2N55A 3IRBA 3RN2A 2B8FA 4BA1I 3K5OA 4BBRB 3VR3A 5KNBA 3PIPA 3J81j 3TS0A 5E7NA 1QJOA 4K8JA 1LLRD 4IUUA 5FLXL 5H1SE 1D6EC 2UU9L 4HIDA 1CM9A 1JE5A 1QVGA 3UDXA 3T1YL 1L0YB 4EGVA 1I4RA 1A62A 5CV6A 4A3EG 4IUPA 5LMNQ 3WWVA 4JI5Q 3CAMA 1K8GA 3QJYA 1QNUA 1XYIA 2HHHL 2K04A 1HNWQ 3PCOB 5IT9L 1E24A 3CPWA 1CKNB 4UDUC 1G51A 1K73C 1PH2A 3KK7A 3TP6A 4IUQA 5LMUL 5I2XA 1TR5A 3M3YH 5C5MA 4P73A 1ZKOA 1JJ2A 2F3WA 1K3RA 1TWHH 2EQSA 2B2VA 4YCVA 5CV9A 5JEAJ 2E74C 1EEFD 3AQQA 5M3FG 4BXXG 3I4MG 1HQMC 1K0RA 4MNOA 2PI2E 1B8AA 2O5IC 4DV4L 2PI2A 2IHEA 2R93H 3BDCA 3UE1A 3U9OA 2K14A 4NXNQ 2XIWA 2F0JA 2PMZB 4ZUJA 5FKAC 3BZKA 4FVMA 1SBBB 1G291 1BDOA 4EX5A 2B2VC 1F2MA 2ATWA 2KOLA 4Z9CB 3BVZA 2ID0A 2WP8J 1YJWA 4R8IA 4DV3Q 3I3CA 2WAQG 1N33L 3I4MH 1CZGA 1M8AA 1NE3A 5E1FA 4LFBL 3K7AB 3OSOA 4KMUC 2R93G 1LT4D 2KCMA 1FYCA 2XGTA 1VQMA 1TQOA 4QIWE 2NBFA 2JA6G 1YZ6A 5EBCA 3FDTA 1RTOA 2MO1A 1DYQA 3V05A 2P5ZX 4ABNA 3TSSA 4X62Q 4E6IA 4JK1C 1Q81C 2Z6BA 2E5LL 2L55A 2NUCA 4BBSB 2K32A 3T16A 1QUQA 4DA2A 1X3GA 2F1MA 1Q46A 3AYHB 1A3VA 3HFZB 1OO9B 3BZCA 3Q23A 5IE8A 2EZVA 2NVQH 2LY7A 3R93A 3DWQA 1EFID 4GOPB 3RNUA 1Z7TA 2HQEA 3EN2A 1ET9A 1HQRD 1WYDA 5G3LF 2KBNA 1F9RA 4A3KB 1PFSA 4BBSG 1LTGD 3BDOA 4GLAC 5I9OA 4DV4Q 2CWPA 1V1OA 5J3BA 1BVSA 3HOVH 2ALYB 1BOSA 4GN3B 4XTCS 1B53A 1N32Q 2H5XA 3RZOB 3NUCA 1B7YB 4KY6A 2FINB 4DFAA 1WTVA 1GO3E 3VA7A 2SNSA 1QVFA 1XJVA 3L7ZC 4P71A 1HFGA 2G5DA 5C44B 3GTJB 2WKDA 2BDOA 3GQBA 4CKCA 4C3HH 1WTPA 4XYQA 1W2BA 3E9IA 4K0KQ 1JOOA 1G91A 1N33Q 2JA8G 2HT1A 1SRUA 4WRDA 2JA5G 3TP8A 1RODA 3C2PA 4FDBA 1Y14B 1J6QA 4R4TA 4CDEC 4PZ7A 4B3TQ 1LYLA 2IX1A 1JCKB 3GO5A 2X69A 2D62A 4O42A 1KDBA 4A3BH 1U4PA 2JA7H 4UAIA 3MAQA 5IT9E 5KGUA 1H9SA 2JA8B 1FNVA 4X3UA 4DR6L 1X6OA 2ZT9C 1CHPD 4K8IA 2PMZE 4JYAQ 1PV4A 2OT2A 4HIOA 3KDFA 3K57A 2B2YA 2F4VQ 3OIPA 2CCZA 3GTOH 4DXGA 1YNJD 3A0JA 2MNAA 2B63G 2CH4W 4K2KA 5EPLA 2PNRC 5HGTA 2NVQB 5T1IA 3NELA 4LUVA 2Q2UA 2Z9HA 1BBUA 3HOZH 2JYOA 1IW7C 3VR2A 1A2TA 4CHTB 3J80L 4QF4A 1I3QH 4JBKA 3CRKC 3NBHB 2R92G 1IBMQ 4POFA 1JWMD 1J5EL 4DNIA 2CQOA 3D4DA 5EQ0A 4JV5L 4AYBG 1K8AC 2WKCA 2VUMG 2B2UA 2XVSA 1PXUA 4JG2A 4OXPA 3KLSX 3GDEA 1LTID 2EYHA 5EPJA 3K0YA 3VYTA 1PTOH 3CCMA 4J1MA 4LF4Q 4FF3A 1SMYD 3KJOA 2YYZA 4KHZA 4GKKL 1Z6HA 1TVXA 2HQLA 2K4KA 2BA1A 1F2ZA 5HY6A 3JAMc 1E3PA 3IFDA 4TQUS 1EY7A 1CKOA 1PZKD 2EY6A 2YV5A 3LWEA 3A5UA 3RLFA 1MI2A 3EFXD 1A3UA 2C9OA 2JA7B 4OHJA 2Q8IB 4Q5VA 5IIFA 2V1CC 2J7ZA 4DK6C 2JSOA 3CRLC 4IPGA 4HSPA 3W5OA 1TXYA 1SAPA 3ER0A 1PH1A 2CH4A 4IFDI 3CF5A 2EYMA 1VQLA 1J8IA 2WINB 1MHWC 1CUKA 4BS9A 4HTHA 4ZLTF 4JBWA 1LABA 5JAVA 2EYOA 1VQ5A 1YJ9A 1VQEA 1XNRQ 1HUNA 2B8GA 3DUZA 3D4WA 5ELDA 3J7YW 2FMCA 5C0XH 3L0OA 1VF7A 3FHWA 2ZTCA 3AU7A 1PTOC 1VQAA 1DZ1A 2IT1A 2QEJC 2VQEQ 1NMGA 3WOEA 5ELFA 3IFTA 1FNUA 4RGOS 2OQ0A 5C3EB 2RCNA 2DJGC 5L37A 1NNXA 1U4MA 3PV0A 3SR1A 1WI5A 5CV7A 4OELB 5CGKA 2HD3A 1AZQA 1QZGA 1W3SA 4NXMQ 1P8LA 1CZWA 2K5QA 3G7LA 1KL9A 2A8VA 2DUDA 1HR0L 3RUZA 4K5XA 2CVRA 3H09A 4DU9A 5FO8B 5K36H 1STNA 1XTCD 4A3DH 4K5WA 4JOIC 4HIMA 1IYVA 2E5LQ 4CJ0B 2RA4A 1B70B 2OCEA 4APVA 4XYOA 2F0TA 3TRZA 4GKJL 4KJNA 4GNXB 4OX9Q 2M9VA 2O2LD 1JMCA 4EVOA 1WTQA 2BE5D 4G7OC 2SOBA 1BUVT 2QF7A 4CDFC 1EY8A 2IX0A 3E0JA 4MIUA 1F77A 2KECA 3GTGB 5IYDH 2K5NA 2EYJA 4IPHA 1ENFA 1IBLQ 3EJIA 1F2LA 2GVBA 1S3OA 3ERSX 4A3MB 2EYFA 2QGQA 1PRTF 5M3MH 4DKAC 2OWOA 2RSNA 3FKIB 2R92B 1YNJC 1ESRA 3PQIA 3FPUB 4C3IH 1XPOA 2PW7A 4ME5A 1TWFB 3M7GA 1B9NA 4ZUIA 2DN8A 3H0GG 1WCMB 5C4HA 3K7AH 1CKMA 1S5BD 1SE3A 3MFGA 3U4ZA 4A3IG 5IP7H 3PO3H 3U58A 1ZYRD 4V0BA 4L6TB 1EFWA 2MJ8A 5M3MG 5EBDA 1P16A 1TWCH 1J9OA 4YCWA 3KF8B 5IGGA 4BY1H 3FVQA 5I6YA 1M90C 4NPSA 4AQYL 5D65A 4KD3A 1XNQL 1FD7D 3KLWA 2E2IH 5M5XH 2Q8TA 1FVIA 2YU9B 4JBMA 1NSNS 3CKIB 3C1FA 4Y7NH 1LT3D 1B1ZA 1YBYA 3NWSA 1Y1VH 4A3JG 1I6VC 3A74A 3CW2C 2VY3A 4O1NA 3M9BA 5EAYA 4X62L 4JI2L 4ZCKA 2ZM6Q 4FXKC 5IP9H 1SYGA 4IUNA 1FGUA 4QUFA 5CBEE 4A93G 5C0XJ 5CORA 1M4VA 1NR4A 1D1IA 3RZOH 1KDAA 4CJ1B 4RA8A 2PPBC 2EVBA 2VW9A 3PIOA 3H3VH 4LF8L 1HFNA 2AQ2B 4DK0A 5FLMG 1B9MA 3NQTA 2F0MA 3JAML 5FJ8G 4B9WA 1RJTA 3BG3A 3CHBD 1VS0A 3HKZG 3I91A 2HIXA 4X64L 2VZAA 1R9TH 1PRTC 2RDHA 5IYCH 4DNTB 1IBLL 4GOPA 3I56A 1A63A 3HOYB 4LFCL 2H1EA 1Q8IA 2L12A 3SK6A 5IGBA 1DGSA 1E1TA 1R9TB 2G9HD 1AFPA 5AJ3L 4A3DB 4X66Q 2K1BA 1U4LA 4ULLA 2E2JB 3NEMA 2WB1E 4LF6L 2VNUD 2L15A 4C56C 2B2UC 4DR1Q 4IO9A 1JORA 1BF4A 3NWTA 3OHXC 3TN2A 2E2HH 2XRQD 4LUZA 4B08A 2V4DA 4JI6Q 1KD1C 3S1NH 4Y7NB 2D9UA 3KF6A 3VR5A 5C4JB 1Q7YC 3SVMA 4Q0FA 4JI8Q 3W2DA 2F0HA 4DR6Q 4IFDJ 4QCLA 1SFOB 1LTLA 4P72A 2K5HA 4B3SQ 3MFYA 4GLXA 1I94Q 1MGSA 3RR5A 2CHBD 5LMNL 2D0OA 1BKBA 5T1GA 3GD7A 3CCQA 3DWPA 2EYLA 3EQLC 5E4WC 3LX0A 2RDGA 2B63B 3S17H 2I5LX 1IL2A 2M00A 1PRTD 3IAYA 2AKWB 1EQTA 1V1PA 4EQPA 4DV0L 1I6HB 1N32L 3K81C 1JICA 5C44G 3VA5A 4HMJA 4EQ5A 3MXPA 1HTLD 4OWXB 3EBEA 3P20A 1UE6A 2AMCB 1MIUA 1EY9A 4A3IB 4KLKA 2WAQB 4PV1C 3J81i 3FEWX 4WJ3M 4LK1C 1SE4A 4UP7A 1C9OA 3MXUA 3AFPA 2YU9H 5IODA 4NB3A 4A3EH 1EY6A 1SJED 1STAA 2A6EC 1NAPA 3G6EA 1JOQA 3EROA 1Q3LA 3Q6SA 1HA5A 4BBSH 1HJPA 2A6HD 3CC7A 1V1PB 3OMGA 1IZ6A 1A15A 3MWYW 2YTXA 1NUCA 4NDXA 4KK7A 4JI4L 1EU3A 1C48A 3NSWA 1H95A 3T56B 3D0FA 4PZ6A 4TVAB 5IWAL 4DUZL 5FK9C 2WAQE 4JI3L 1VQ7A 4KY5A 3GTMB 1DCZA 2Z4IA 2QA4A 4XIGS 5M3FH 1CKNA 4XDXA 5M3MB 4HIKA 1GXDC 3GTMH 1KQSA 3PO2B 3D4RA 2AUKA 4MN3A 4ZRZA 4OL7A 4J6HA 4OIJA 4DR2Q 2VUMB 3I72A 2EIFA 4IPCA 4A3BG 5JPMC 5C3EH 4LF9Q 5IYBH 1JOKA 2VB3X 3U9SA 1SYCA 2MPMA 4V190 1SNOA 3AB9A 2XSCA 1S4ZA 4QUCA 3N52A 1D7QA 1YVCA 3HOUG 4JYAL 1Q86C 1FR3A 4JV5Q 1SYFA 1UAPA 4A75A 1YNND 1PH7A 4P2CB 2KCTA 1WTRA 4P75A 2HCIA 1Q12A 3S14H 1BCPF 1JJGA 4LAAA 1UEBA 2CW0D 2OTLA 1B2TA 4OX9L 2E2DC 2JA6H 1SJHD 2AUJD 2FMMA 2B2WA 4DN4M 4P74A 3M85A 3W1GA 1RL2A 1XPRA 2OF1A 1NMFA 3CMEA 2NVTH 1WTOA 2EYPA 1O7LA 3J7AF 1J5EQ 1Z9FA 1L1OB 2FFKB 4DUYL 3MZ5A 1PH8A 4DAMA 1TKWB 1HNXQ 2HDLA 2LSSA 1WTHA 4DR3Q 2AHOB 1NCVA 1TS2A 1LUZA 1AW7A 1LV9A 1VMPA 1EY0A 1N34L 3CCVA 5FLXc 2HHHQ 3SGIA 4N9TA 3HKZB 1SR3A 1EYAA 3OTOL 4FF2A 2J0TD 2F0DA 3T1YQ 4PMBA 5GADC 1ZXTA 1DD2A 4JI4Q 1DOLA 1EIFA 5KNCA 3I7FA 4EQNA 1BCPD 1QVCA 1SDFA 4POGA 4GS3A 1X55A 4LFAL 1A0IA 4QJFA 4JI2Q 1O7YA 1X54A 1AE2A 3EA6A 4DPGA 5ELEA 4PMCA 1S40A 2IW3A 3H3VI 3OPOA 4WORA 3BJUA 2H4OA 1TWCB 1PYBA 3QOJA 3K7UC 1V9PA 4C3HG 2R7ZH 2A69C 3K80C 2JA8H 1YNXA 4A3EB 2NVXH 5ISRA 4X65L 1C8CA 1DXMA 1HRJA 1A3TA 3Q8DA 4DGZA 3HZXA 3NK9A 2E8GA 1LTRD 1IKLA 1W6KA 5C4JH 3A7AB 1HXYD 2K01A 2PQEA 2IX3A 1N34Q 4H13C 2Z8LA 4LMQD 1TS5A 1KAWA 1YHAA 5AJ3Q 4A3KH 1I4HA 4CJ2C 2ICEC 4IUTA 3CC4A 5M5WH 4HJ8A 2WIIB 3U50C 3I4LA 5JEAH 1LTBD 2LFNA 3K6OA 4OIKA 3GTLB 3FKIH 1I94L 4DR1L 2B63H 3S17B 2NYZD 2KA7A 2A68C 3I4MB 1SFOH 1E1OA 1R4QB 4BBRH 3CMAA 1RF2D 5CC4A 5KIXA 1TWGB 2YTVA 3NXWA 2VQFL 2X6GA 2ENBA 1EZ8A 3I90A 1EIHA 2EJGC 2IWHA 3IL8A 4OO1G 3ONAB 5KYLA 3E5SA 4DV1L 1PTOB 3PO3B 4BY7B 1X3EA 4PNYA 3P75A 1OXTA 4B9XA 2RF4A 5G3LD 3S2DB 3MVVA 4TSSA 1R4PB 4A3DG 3HOWB 2TMPA 1STBA 4YHHQ 1X3FA 1L1OA 3TZUA 3PF5A 1K83H 2I5HA 4UHVA 1XTDA 2OTJA 1RKNA 4JI7Q 1Q82C 3QR8A 1GUSA 1TWAB 5K5PA 1UE5A 3J80E 1K9MC 2F0FA 4DF7A 3GTOB 5JOBA 4MTNA 1SYEA 2F4VL 3K5MA 3H3VC 3F2DA 1GKHA 4K6DA 2UXBL 3MHBA 3SXHA 5ELOA 5A2QE 3K5NA 4DK1A 5JJKA 3W1BA 2N78A 1XNQQ 2K28A 1IKMA 2N3SA 3HOVB 3PO2G 1BQQT 4YWMA 4JC0A 1HZ9A 4A3GG 3J80c 2PCFB 1HH2P 1DONA 1PH6A 1JQYD 4AH6A 2WACA 3H91A 3TQYA 4A3FH 1VQ6A 1EQVA 5FO7B 3GTKB 4X3TA 2BH2A 3Q0AA 1KAAA 4A3MH 4A3CG 3I8ZA 1WJJA 2DY7A 2IY5B 5IP7G 3F2BA 3PO3G 2PQAB 4FO2A 4H44C 5CBAE 3OWFA 1WFQA 5J39A 1DM0B 1GUGA 1CK1A 1GD7A 1V43A 2UUBL 5GQOA 4GLVB 2DY8A 1VQOA 1GVPA 3PIO3 2K6AA 3UDGA 1EU4A 3PUWA 1EQRA 3HP3A 3CP0A 5DM63 2EY1A 4KJOA 4QB4A 2A6HC 1H9KA 2MFIA 2QCPX 1STHA 1Y1VG 3R8BA 2JA9A 2NVTB 1MBYA 4N8FA 1KNEA 4IJHA 4DK3C 4CKBA 2UXDL 3Q24A 2B29A 5M5YH 3S24A 2F0QA 2JP1A 4L5QA 1WTWA 3GTPB 2A1AA 3M4YA 2HUGA 1PDQA 3GV6A 1KHIA 4DR4Q 2Q2IA 3NPPA 4LUOA 2LMCB 3AEVA 4DR3L 5CV5A 3F1ZA 4LF4L 1D5MC 1RIPA 2KHJA 1SYBA 2E75C 1Y8OB 1HZCA 3J81L 4FF4A 1SNCA 2F52A 2PW5A 3STBD 5FJ8H 2LXKA 2ZM6L 3P1HA 4RH6A 1E0BA 1PMRA 1F2YA 1UEAB 3HS0C 1MSHA 2JK8A 3NTHA 4GKKQ 4JW0A 5CMDA 1TWFH 4DR7Q 3FPPA 1WCMH 3ZYYX 4HCSA 5D14A 3X3MA 1PVOA 5E3FA 1LT6D 1IYUA 3A56A 3CCRA 4DUYQ 1PTOF 3AFQA 1KIXA 4MTKA 2BA0A 1JC7A 2ZXPA 5DEHA 4C1NI 4C3JG 5IGFA 2CQAA 1TWHB 2K50A 4H0LC 4X3SA 2PO4A 3BU2A 4IZ8A 3S1NB 1VQBA 3VYRA 1FJGL 5F2DA 1VQKA 5DM73 1BBXC 3TREA 4R4IA 1IYJB 1YHQA 2PYKA 1OTCA 5I6WA 3DMUA 5LL6X 1RD9D 2K33A 4LFAQ 3TDQA 2NVYB 4K14A 4DV6L 1SNQA 3RMHA 3KYHC 3CCUA 2NVYH 5A35A 2BOSA 1TIID 3E9HA 3C46A 4HJ5A 4ALPA 3GTKH 1Y8NB 4HJAA 5KNDA 4DV0Q 4CBVA 2I07B 3QB3A 4B3TL 3RD4A 2VB2X 5HURA 3NBIA 4JI1Q 1I4QA 5BN5A 5C44H 1PRTB 4RCOA 2PZWA 1PFBA 4HCEA 5IY0A 1I6HH 1T5EA 4LW1A 1HNWL 3DWAA 3SEBA 3S2DH 4HJ7A 3P7JA 3DEPA 1BNZA 4LNQA 1EYGA 1O80A 3HG9A 4KD4A 4A93H 2VS1A 1LO5D 2F0IA 3S1QB 1VQGA 1PA6A 1SROA 4KI0A 1I5FA 1VQHA 2QDBA 1MSGA 4BY1B 1SNMA 4IURA 1TWAH 5BR8Q 2KJXA 2E76C 5FLMH 2E2IB 1STGA 4HMIA 4RGTA 3FP9A 4BY7G 4KTAA 5GAEC 4B3SL 5KEEA 4OONA 3S1RB 3I4NG 4DV6Q 4GN4B 5IOCA 1WVLA 2DNEA 4NP5A 1VQIA 4HR7B 5EKKA 5I9PA 1B3AA 3CCJA 3PUXA 1D1KA 1NTGA 2IHFA 1G6PA 4DXFA 1WTXA 2BH8A 2EXDA 4GN5A 5EKIA 1STEA 4PMWA 3I55A 1ICFB 2KCNA 3HEJA 4JI7L 2B2YC 1TU2B 3M4QA 3I4NB 3J7ZC 4Y52H 5DNFA 3CCLA 1EY4A 2Q2TA 4G4KA 3KBXA 3KLSA 3I4NH 2I46A 3BYTB 1HCZA 1SN8A 4NXNL 1TY0A 2KVMA 2MUYA 4LF9L 5C3EG 1A2UA 1KTKA 2DJFC 5DLQE 5IWAQ 1F9QA 1VF5C 3OWEB 2R92H 2Z6KA 5GROA 5BR8L 1N9WA 2ZTEA 5C0XI 1LM0A 2K7VA 3SHLA 4ZKCB 4IOCA 4NXML 4DV3L 1D5ZC 1EOTA 3JC66 2JXMB 1EYDA 1EY5A 1GUTA 1JB7A 3CQZB 3CCEA 3T1HQ 1YI2A 4OWTB 1KRSA 1BR9A 2JEAI 4L8JA 4G7HC 3C3LA 2QDLA 3TZDA 3HKSA 4DR5L 1O78A 3G6JB 1U5KA 3A8JE 4N9PA 2QILA 4M1UB 4A3BB 3S15H 2RQXA 4JI1L 2EOTA 2X6LA 1BCPC 2JA5B 3A8KE 4KHVA 2NN6I 1D5XC 3A5ZB 1ML0D 4FNFA 2F03A 2LXJA 1L0XB 1HPCA 3J7AV 2GVAA 3HOVG 3ITPA 1KNAA 5IGEA 1TS4A 5DAUA 4A3GB 2PZTA 1QCBD 4R4QA 5C3WA 3GTQB 2MO0A 1IHZA 4PZ8A 2N8NA 2O4XA 1Y1VB 1GUWA 2RKSA 5CR3A 1AH9A 3EIVA 4QMGA 1E2WA 4DR4L 3MXNB 2LS01 4XT3B 2L11A 3KOJA 2N49A 4IALA 5CYUA 3QO2A 3CD6A 1PH4A 2A19A 5JVG3 3OW2A 1IBKQ 2EY5A 1C0AA 1I4XA 1U0LA 3MEFA 2UU9Q 4JPBW 5C0XG 1H9RA 4IQZA 2VL6A 3HOXB 3UDFA 2L9HA 4RGMA 4JI6L 2K5WA 3A55A 3DM3A 3SK8A 2NB0A 3ICEA 4L5RC 5C5LA 1STYA 1VQFA 4GOPC 3K58A 4C2MB 2F4IA 1OXSC 5IYBG 4IOAA 4LWCA 5IT9c 5FOBB 4BA2I 1UE7A 1JJCB 1FJGQ 4FYDA 4NW2A 1UWVA 3DLLA 5M5YB 2IJ0A 3HOUH 4K0KL 1JR0D 1PYSB 2IPKD 4KN7C 4B3MQ 3S2HH 1Q8KA 3L2PA 4R4CA 1HZBA 3HOUB 1ET6A 1DOMA 2NZOA 4L5TA 4DAYA 2K5VA 1H9MA 1VQNA 4RKBA 5CV8A 3R2TA 4J15A 4DR5Q 2SDFA 2R93B 1Z47A 2F0OA 4O0AA 3ND8A 3SDZA 4NKLA 2UXDQ 2MQHA 1M1KC 1Y69U 4OO1H 2JQOA 4L63B 5IYDG 3K59A 2ZTDA 1EWIA 3HOWG 1EIYB 4DR7L 4L5SA 1Y8PB 3VYSA 1JT8A 1K0SA 2NTSA 1HNZL 1YIJA 4IFDH 4DR2L 1ENCA 3F8TA 5CV4A 1GHJA 1KLUD 4HAEA 2CW0C 2ZJPA 3TEHB 4KV6A 1HTPA 4RFBA 3I4OA 4CDDC 2JJQA 3LGJA 2LKVA 3S1MH 4F88A 3S1QH 3H0GH 5FLXE 4IJLA 1XX8A 4UP8A 2R6GA 2ZJRA 4C2MH 2F3VA 1X3QA 2R7ZB 2UUCL 1B3QA 1WD1A 1KDCA 1N36Q 4KHPL 3F2UA 4PG3A 2GN5A 2PZUA 4A3LG 1GOZA 1T9HA 4BY1G 3ULPA 1CTMA 2F0SA 3A7LA 2N88A 3UDIA 2R7ZG 2BCOA 4R4OA 3TP7A 5LMUQ 4QL5A 1YNNC 4A3JB 3M4OH 3H6MA 3UE0A 2EJFC 3GTGH 4I7ZC 1X3PA 1SYDA 3QG1A 3DXJC 2EE1A 3GP7A 4RCNA 2ZXRA 1D8LA 1E7ZA 2XWJB 4A3JH 1SMYC 3R2IA 1GM5A 4ZAIA 3QIAA 2FXQA 2KHSA 4DAVA 1F9SA 2J4XA 4A3LH 2TSSA 4DV5Q 1A8VA 2D0PA 5C4XG 2Y0SE 4A3KG 5IP9G 3M7NA 3G48A 1FNWA 2KCCA 4RKLA 1PLFA 4HN7A 2WB1B 3GTJH 5LHY1 2L1BA 3D6CA 2UXCQ 5C4ZA 1NBWA 4ID6A 5JJIA 1I50B 3L9AX 1S5DD 3SK4A 4BXXH 2CWAA 1K28A 1LT5D 1VQCA 3CQZH 1G2SA 3H0GB 4ODGA 4U673 3S16H 2O5JC 1GHKA 2MHVA 2OXPA 3AMUA 1QILA 2AWNA 2QW7A 5M9OA 3GTPH 1K3BC 1QUQB 2NZ1D 4ZQ3A 1HR0Q 1SNPA 3T4AC 2E2HB 1EWCA 3BDLA 3E0EA 4RAUC 3S14B 4G57A 1HUMA 3CC2A 2JE6I 1MD2D 3ND9A 1CSQA 4LF5Q 3NHHA 1Y1WH 1I3QB 2JA6B 3OYYA 4C3IG 4LF6Q 1FL0A 2RSOA 5JJZA 5ELBA 1SNDA 4FXDA 1V1QA 1BBWA 1TS3A 1U9RA 3H15A 1XMQQ 3Q22A 3PSIA 3VR4A 1OXUA 3M4OB 3HOZB 4N8X1 1BCPB 3ULLA 4KKSA 4CDCC 3EVQA 2NN6G 2F0PA 5J1ZA 4H7BA 1Y1WG 3HOXH 3BVGA 1SLJA 3NQIA 1EIGA 1OXXK 2M2LA 5ELNA 5I4DA 2VQEL 1PZID 4A93B 4IN3A 1SE8A 5EPKA 3KDFB 4AIMA 4ILWA 2G9DA 4ZYSA 2F3IA 4AYBB 3U4VA 4A3MG 3KBGA 3TS2A 1PH3A 3JAME 4HJ9A 4A3CH 1IXRA 2KQ3A 3I2ZA 2NN6H 2QKIC 3I73A 3KJPA 3NTKA 1EYCA 1ILQA 3S16B 2I5MX 3HOXG 2GA4B 4K2LA 1LTAD 3RLOA 4HSVA 3CPFA 3CU7A 3N6RA 5KRUA 4AQYQ 2UUCQ 2K75A 3JAMi 1DJRD 4DNRB 1MKHA 1O7IA 2L5TA 2UXBQ 1AE3A 2WB1G 5IGCA 1NY4A 1CHQD 5LMNW 1HHVA 2NWGA 2Q2HA 1QE6A 1PYWD 3S2HB 2F0VA 1G8ZD 4A3FB 4UPAA 4A4IA 4WJWA 1VQPA 4RHRA 4GNXA 1HZAA 2A74C 4M8AA 1JE4A 4YHHL 4A76A 5ELCA 3X3NA 3STBC 1XXGA 1RHPA 2A5HA 3V96A 1YHBA 3OW7A 4K6LA 3DM1A 3A54A 1S5FD 5J22A 4GNXC 5D3DA 1UNSA 5KYIA 3FRPB 1E22A 3QOLA 1TY2A 4XQQA 4LFBQ 3D3RA 4BY7H 4TKOB 2C5CA 2K03A 4UP9A 2B2TA 4O2DA 5TSSA 4YCUA 3G4SA 2PQAA 1MJCA 1XWEA 1ASYA 1EL0A 2WFWA 2XTIA 1HNXL 4QIWB 3RZDB 4G7ZC 3HOZG 4F87A 4XQNA 4RWSC 3DHQA 4KKUA 2C35B 3HGBA 1SXTA 3M3YB 3OIQA 2D5DA 2Z4HA 1VQDA 2XN9C 2R61A 4AYBE 3G71A 1RCVD 1XMOL 1NJIC 3O13A 4I7AA 4XQJA 4LF7L 1AP0A 1D2BA 4RGNA 1CA6A 2MP1A 5A2QL 2XRSD 3MA2B 2MGSA 3BS1A 3MTSA 4C3JH 1WD0A 4F8MA 2RBMA 2PNHA 1LTTD 2Z6KC 4FF1A 2R7FA 4X6AH 1ICWA 3VYUA 2K05A 3DEOA 1LTSD 4ME3A 4LFCQ 3ZJYC 4C3JB 1QZHA 1S5ED 3URYA 2AWOA 1QWYA 1K8MA 1U4RA 3HOYG 1N36L 3CCSA 1S72A 4R9WA 5COYA 3HKZE 1CT1D 5IGDA 1AZPA 3BZDB 1X32A 1PFMA 4KN4C 5EKLA 1CQVA 3PUYA 1C4QA 2A6ED 3VDYA 1CI3M 2IL8A 4DV5L 1MJEA 1ZEQX 1X56A 1XNRL 1XPUA 1G2TA 1IL8A 1X65A 4JI8L 1II3A 3HOYH 1W6JA 4JI5L 1LACA 5GAGC 4X64Q 3A8IE 2L0CA 4LJZC 2JA5H 3I70A 4RMFA 4FP5D 3KFUA 3H94A 4TRDA 3OMCA 1SMXA 2D2CC 2FHTA 1CA5A 4DV7Q 1EOVA 3NTIA 1KLGD 2JA7G 2F0LA 3F2CA 3RN5A 1ESFA 1VQ9A 3T51B 1VQJA 1DOKA 1SE2A 1N8RC 5NUCA 2ES2A 4JVZA 4F7XA 5EGTA 3D6WA 1JWUD 4X65Q 2K5DA 3NENA 2NZHA 2F0NA 3J81E 2YTYA 2Y0SG 3HRZC 1YITA 4YWKA 3T13A 1KXLA 1QB5D 2R3ZA 1YJNA 1K8OA 3CXCA 1TWGH 1QG7A 3B6YA 2F0WA 3KUPA 3WOFA 5C3XA 3J81c
chains in the Genus database with same CATH topology
3OOCA 1EZ6A 1GUOA 2FJ2A 2BDNA 3VR6A 2OEOA 2Y0SB 1VMCA 3PUZA 2F0GA 1PTOD 3SK5A 4DAPA 3LWUA 2F0EA 1ZYRC 3PUVA 4ZKBB 5BN4A 1CQFA 3D31A 1ENAA 1O7ZA 2HCCA 5BN3A 1H9JA 2HDMA 4RHSA 3FMCA 4S3SA 2Z1CA 5M5XB 1GJXA 2F0KA 3D8GA 2RDFA 5AFWA 3LNNA 1Q1BA 1EWHA 1ILPA 3QWNA 3MXGA 1B44D 3C1EA 3IKJA 4NMZA 2AQ3B 2SEBD 4HEDA 1S5CD 1OXVA 1HA6A 2BE5C 2EXZA 3BVMA 2EY2A 2DNCA 4J8QA 3SE0A 3K5LA 1VDZA 3E6ZX 5M3FB 4IFDG 5D3IB 1FGBD 4I65A 3MEHA 1EEID 1SEBD 1CFMA 2B39A 4WFN3 3PIP3 4CGYB 3NE5B 3S1MB 1AN8A 1SSOA 2VXWA 1UUPA 3TP5A 2A68D 4YIJA 4OO1I 1QOHA 4X3KA 2XWBB 1RDPD 1Q1EA 3NBHA 1B4OA 5EJWA 4ZK9B 3ERQA 1T5XD 3TMEA 2Q8RE 3NP8A 1IW7D 5C6AA 3MC0B 5K36G 5JEAG 5JVH3 1JWSD 1Y1WB 1B50A 2A69D 2EDGA 2F0UA 1E2ZA 5C4XB 1JB3A 1I4GA 1AEXA 3W3AA 4XXEA 1QNKA 3T53B 3UI2A 4IUVA 5M5WB 2B2TC 4C3IB 1H9SB 1NR2A 1ONLA 1V8QA 4BWGB 2JEBI 1RTNA 5I2YA 1G6ZA 3MXNA 4FXGC 4C3HB 2NTTA 3L3OC 2ICIA 4OGQC 1BO0A 3BYYB 1PZJD 1VCIA 2B2WC 3GV3A 4KKTA 2KEDA 2ZXOA 4EQOA 1BXTA 4XT1B 4CKEA 1Q90A 1PFNA 2L4NA 4R8NA 4KY7A 3S9WA 2A73B 5JPNC 2EPBA 4K5VA 4C1NK 1GUNA 1K83B 2AQ1B 3KLRA 3R3OA 2NVXB 3V2TA 1F9PA 3PMFA 2SNMA 3TBIB 4U68A 3S15B 4GZYC 1KABA 1E2VA 2WV6D 2XNAC 3KF8A 5E4XA 5FO9B 3WDNA 1I4PA 4PQXA 1TT2A 5LL6S 2KUMA 2RVLA 4MHEA 2KEEA 2EJMA 1A6XA 2N55A 2B8FA 4BA1I 3K5OA 4BBRB 3VR3A 5KNBA 1QJOA 4K8JA 1LLRD 4IUUA 5FLXL 1D6EC 1CM9A 1L0YB 4EGVA 1I4RA 5CV6A 4IUPA 3QJYA 1QNUA 1XYIA 2K04A 5IT9L 4UDUC 3KK7A 3TP6A 4IUQA 5I2XA 1TR5A 5C5MA 1ZKOA 2F3WA 2B2VA 5CV9A 5JEAJ 2E74C 1EEFD 1HQMC 2O5IC 3BDCA 3U9OA 2XIWA 2F0JA 2PMZB 4ZUJA 5FKAC 4FVMA 1SBBB 1G291 1BDOA 2B2VC 1F2MA 2KOLA 4Z9CB 3BVZA 2ID0A 2WP8J 4R8IA 3I3CA 1CZGA 1M8AA 5E1FA 3K7AB 3OSOA 4KMUC 1LT4D 1FYCA 1TQOA 2NBFA 5EBCA 3FDTA 1RTOA 1DYQA 3V05A 4ABNA 3TSSA 4E6IA 4JK1C 2L55A 2NUCA 4BBSB 2K32A 3T16A 4DA2A 2F1MA 3Q23A 1A3VA 1OO9B 2EZVA 2LY7A 3R93A 3DWQA 1EFID 1Z7TA 2HQEA 1ET9A 1HQRD 5G3LF 1F9RA 4A3KB 1LTGD 3BDOA 5I9OA 1V1OA 4XTCS 1BOSA 1B53A 3RZOB 3NUCA 4KY6A 2FINB 4DFAA 1WTVA 3VA7A 2SNSA 3L7ZC 1HFGA 5C44B 3GTJB 2WKDA 2BDOA 3GQBA 4CKCA 1WTPA 4XYQA 1G91A 1JOOA 4WRDA 3TP8A 1RODA 3C2PA 2IX1A 1JCKB 3GO5A 2X69A 2D62A 4O42A 1KDBA 1U4PA 4UAIA 3MAQA 5IT9E 5KGUA 1H9SA 2JA8B 1FNVA 4X3UA 2ZT9C 1CHPD 4K8IA 2OT2A 3K57A 2B2YA 3OIPA 4DXGA 1YNJD 4K2KA 5EPLA 2PNRC 5HGTA 2NVQB 5T1IA 2JYOA 1IW7C 3VR2A 1A2TA 3J80L 4CHTB 4QF4A 3CRKC 1JWMD 3D4DA 5EQ0A 2WKCA 2B2UA 2XVSA 1PXUA 3KLSX 1LTID 2EYHA 5EPJA 3K0YA 3VYTA 1PTOH 4J1MA 4FF3A 1SMYD 2YYZA 4KHZA 1Z6HA 1TVXA 2BA1A 1F2ZA 3IFDA 4TQUS 1EY7A 1PZKD 2EY6A 3LWEA 3RLFA 1MI2A 3EFXD 1A3UA 2C9OA 2JA7B 4OHJA 2Q8IB 4Q5VA 5IIFA 2J7ZA 2JSOA 3CRLC 4HSPA 1SAPA 4IFDI 2EYMA 1J8IA 2WINB 4BS9A 4HTHA 4ZLTF 4JBWA 1LABA 5JAVA 2EYOA 1HUNA 2B8GA 3DUZA 3D4WA 5ELDA 3J7YW 2FMCA 5C0XH 1VF7A 3AU7A 1PTOC 1DZ1A 2IT1A 2QEJC 3WOEA 5ELFA 3IFTA 1FNUA 4RGOS 5C3EB 1U4MA 3PV0A 3SR1A 5CV7A 5CGKA 1AZQA 1CZWA 2K5QA 3G7LA 3RUZA 4K5XA 2CVRA 3H09A 4DU9A 5FO8B 5K36H 1STNA 1XTCD 4K5WA 1IYVA 4CJ0B 2RA4A 4XYOA 2F0TA 4KJNA 2M9VA 2O2LD 4EVOA 1WTQA 2BE5D 4G7OC 2SOBA 1BUVT 2QF7A 1EY8A 2IX0A 3E0JA 4MIUA 1F77A 2KECA 3GTGB 2EYJA 1ENFA 3EJIA 1F2LA 4A3MB 2EYFA 1PRTF 2RSNA 3FKIB 2R92B 1YNJC 1ESRA 3FPUB 2PW7A 4ME5A 1TWFB 3M7GA 1B9NA 4ZUIA 2DN8A 1WCMB 5C4HA 1S5BD 1SE3A 3MFGA 1ZYRD 4V0BA 4L6TB 2MJ8A 5EBDA 1J9OA 5IGGA 3FVQA 5I6YA 5D65A 4KD3A 1FD7D 2Q8TA 2YU9B 1NSNS 3CKIB 3C1FA 1LT3D 1B1ZA 3NWSA 1I6VC 4O1NA 4FXKC 1SYGA 4IUNA 4QUFA 5CBEE 5C0XJ 5CORA 1M4VA 1NR4A 1D1IA 1KDAA 4CJ1B 4RA8A 2PPBC 2EVBA 1HFNA 2AQ2B 4DK0A 1B9MA 3NQTA 2F0MA 3JAML 4B9WA 1RJTA 3BG3A 3CHBD 3I91A 1PRTC 2RDHA 4DNTB 3HOYB 2H1EA 1Q8IA 2L12A 3SK6A 5IGBA 1R9TB 2G9HD 1AFPA 4A3DB 2K1BA 1U4LA 4ULLA 2E2JB 2VNUD 4C56C 2B2UC 1JORA 1BF4A 3NWTA 3OHXC 3TN2A 2XRQD 4B08A 2V4DA 4Y7NB 2D9UA 3VR5A 5C4JB 3SVMA 4Q0FA 3W2DA 2F0HA 4IFDJ 4QCLA 1SFOB 3MFYA 1MGSA 2CHBD 5T1GA 3GD7A 3DWPA 2EYLA 3EQLC 5E4WC 3LX0A 2RDGA 2B63B 2M00A 1PRTD 3IAYA 1EQTA 1V1PA 4EQPA 1I6HB 1JICA 3VA5A 4HMJA 3MXPA 1HTLD 3P20A 1EY9A 4A3IB 2WAQB 4PV1C 3FEWX 4LK1C 1SE4A 3MXUA 5IODA 1EY6A 1SJED 1STAA 2A6EC 1NAPA 1JOQA 3EROA 1Q3LA 3Q6SA 1HA5A 2A6HD 1V1PB 3OMGA 1A15A 3MWYW 1NUCA 4NDXA 4KK7A 1EU3A 1C48A 3NSWA 3T56B 5FK9C 4KY5A 3GTMB 1DCZA 2Z4IA 4XIGS 4XDXA 5M3MB 1GXDC 3PO2B 4ZRZA 2AUKA 3D4RA 4MN3A 4OL7A 4J6HA 4OIJA 2VUMB 3I72A 5JPMC 1JOKA 2VB3X 3U9SA 1SYCA 2MPMA 4V190 1SNOA 3AB9A 2XSCA 1S4ZA 4QUCA 3N52A 1FR3A 1SYFA 1UAPA 1YNND 4P2CB 1WTRA 2HCIA 1Q12A 1BCPF 4LAAA 2CW0D 1B2TA 2E2DC 1SJHD 3M85A 2AUJD 2B2WA 2FMMA 4DN4M 2OF1A 1WTOA 2EYPA 1O7LA 3J7AF 2FFKB 3MZ5A 1TKWB 2HDLA 1NCVA 1TS2A 1VMPA 1AW7A 1LV9A 1EY0A 4N9TA 3HKZB 1EYAA 4FF2A 2J0TD 2F0DA 4PMBA 1ZXTA 1DD2A 1DOLA 5KNCA 4EQNA 1BCPD 1SDFA 1O7YA 3EA6A 5ELEA 4PMCA 2IW3A 3OPOA 4WORA 2H4OA 1TWCB 3QOJA 4C3HG 2A69C 4A3EB 5ISRA 1C8CA 1DXMA 1HRJA 1A3TA 4DGZA 3HZXA 3NK9A 1LTRD 1IKLA 1W6KA 3A7AB 1HXYD 2K01A 2PQEA 2IX3A 4H13C 2Z8LA 4LMQD 1TS5A 1I4HA 4CJ2C 2ICEC 4IUTA 2WIIB 3I4LA 5JEAH 1LTBD 2LFNA 3K6OA 4OIKA 3GTLB 3S17B 2NYZD 2KA7A 2A68C 3I4MB 1R4QB 1RF2D 5CC4A 5KIXA 1TWGB 3NXWA 2X6GA 2ENBA 1EZ8A 3I90A 1EIHA 2EJGC 2IWHA 3IL8A 4OO1G 3ONAB 5KYLA 3E5SA 4BY7B 1PTOB 3PO3B 4PNYA 3P75A 1OXTA 4B9XA 3S2DB 5G3LD 3MVVA 4TSSA 1R4PB 3HOWB 2TMPA 1STBA 3TZUA 1RKNA 1GUSA 1TWAB 5K5PA 3J80E 2F0FA 4DF7A 3GTOB 5JOBA 1SYEA 3K5MA 3H3VC 4K6DA 3MHBA 3SXHA 5A2QE 3K5NA 4DK1A 2K28A 1IKMA 3HOVB 1BQQT 2PCFB 1DONA 1JQYD 2WACA 3H91A 1EQVA 5FO7B 3GTKB 4X3TA 3Q0AA 1KAAA 3I8ZA 2DY7A 4FO2A 4H44C 5CBAE 3OWFA 5J39A 1DM0B 1GUGA 1CK1A 1V43A 2DY8A 3PIO3 2K6AA 1EU4A 3PUWA 3HP3A 5DM63 2EY1A 4KJOA 4QB4A 2A6HC 1H9KA 2QCPX 1STHA 3R8BA 2NVTB 1MBYA 1KNEA 4CKBA 3Q24A 2F0QA 2JP1A 1WTWA 3GTPB 3M4YA 2HUGA 1PDQA 3GV6A 3NPPA 2LMCB 5CV5A 1D5MC 1SYBA 2E75C 1Y8OB 3J81L 4FF4A 1SNCA 2PW5A 3P1HA 4RH6A 1E0BA 1PMRA 1F2YA 1UEAB 3HS0C 1MSHA 3NTHA 5CMDA 3FPPA 3ZYYX 4HCSA 5D14A 3X3MA 5E3FA 1LT6D 1IYUA 3A56A 1PTOF 2BA0A 1JC7A 2ZXPA 5DEHA 4C1NI 4C3JG 5IGFA 2CQAA 1TWHB 4H0LC 4X3SA 2PO4A 4IZ8A 3S1NB 3VYRA 5F2DA 5DM73 1BBXC 2PYKA 5I6WA 3DMUA 5LL6X 1RD9D 2K33A 3TDQA 2NVYB 4K14A 1SNQA 3RMHA 5A35A 2BOSA 1TIID 3C46A 1Y8NB 5KNDA 4CBVA 2I07B 3QB3A 3RD4A 5HURA 2VB2X 3NBIA 1I4QA 5BN5A 1PRTB 4RCOA 2PZWA 1PFBA 4HCEA 1T5EA 3DWAA 3SEBA 3P7JA 3DEPA 1BNZA 1O80A 3HG9A 4KD4A 1LO5D 2F0IA 3S1QB 4KI0A 2QDBA 1MSGA 4BY1B 1SNMA 4IURA 2KJXA 2E76C 2E2IB 1STGA 4HMIA 4RGTA 4KTAA 5KEEA 3S1RB 5IOCA 1WVLA 2DNEA 4NP5A 5EKKA 4HR7B 5I9PA 1B3AA 1D1KA 3PUXA 4DXFA 1WTXA 5EKIA 1STEA 4PMWA 2KCNA 3HEJA 2B2YC 1TU2B 3I4NB 5DNFA 1EY4A 4G4KA 3KBXA 3KLSA 2I46A 3BYTB 1HCZA 1TY0A 2KVMA 2MUYA 1A2UA 1KTKA 1F9QA 1VF5C 3OWEB 5C0XI 3SHLA 2K7VA 4ZKCB 1D5ZC 1EOTA 2JXMB 1EYDA 1EY5A 1GUTA 3CQZB 2JEAI 1BR9A 4L8JA 4G7HC 3C3LA 3TZDA 1O78A 3G6JB 3A8JE 4N9PA 2QILA 4M1UB 4A3BB 2RQXA 2EOTA 2X6LA 1BCPC 2JA5B 3A8KE 4KHVA 2NN6I 1D5XC 1ML0D 4FNFA 2F03A 3J7AV 1L0XB 1HPCA 3ITPA 1KNAA 5IGEA 1TS4A 5DAUA 4A3GB 2PZTA 1QCBD 5C3WA 3GTQB 1IHZA 2O4XA 1Y1VB 1GUWA 2RKSA 5CR3A 4QMGA 1E2WA 2LS01 4XT3B 2L11A 4IALA 5CYUA 3QO2A 5JVG3 2EY5A 1I4XA 5C0XG 1H9RA 4IQZA 3HOXB 2L9HA 4RGMA 2K5WA 3A55A 3SK8A 2NB0A 5C5LA 1STYA 3K58A 4C2MB 2F4IA 1OXSC 5FOBB 4BA2I 4FYDA 4NW2A 5M5YB 2IJ0A 1JR0D 2IPKD 4KN7C 3HOUB 1ET6A 1DOMA 4DAYA 1H9MA 4RKBA 5CV8A 3R2TA 2SDFA 2R93B 1Z47A 2F0OA 3ND8A 3SDZA 4NKLA 1Y69U 4OO1H 4L63B 3K59A 1Y8PB 3VYSA 2NTSA 4IFDH 1ENCA 5CV4A 1GHJA 1KLUD 4HAEA 2CW0C 4KV6A 1HTPA 4RFBA 2LKVA 4F88A 5FLXE 1XX8A 2R6GA 2F3VA 1X3QA 2R7ZB 1WD1A 1KDCA 3F2UA 2PZUA 1GOZA 1CTMA 2F0SA 3A7LA 2N88A 2BCOA 3TP7A 4A3JB 1YNNC 3H6MA 2EJFC 4I7ZC 1X3PA 1SYDA 3QG1A 3DXJC 2EE1A 3GP7A 4RCNA 2ZXRA 2XWJB 1SMYC 3R2IA 4ZAIA 3QIAA 2KHSA 4DAVA 1F9SA 2J4XA 2TSSA 3M7NA 1FNWA 2KCCA 4RKLA 1PLFA 4HN7A 2WB1B 5LHY1 2L1BA 3D6CA 5C4ZA 4ID6A 1I50B 3L9AX 1S5DD 3SK4A 1LT5D 3H0GB 4ODGA 2O5JC 1G2SA 4U673 1GHKA 2MHVA 2OXPA 3AMUA 1QILA 2AWNA 5M9OA 2NZ1D 4ZQ3A 1SNPA 3T4AC 2E2HB 1EWCA 3BDLA 4RAUC 3S14B 4G57A 1HUMA 2JE6I 1MD2D 3ND9A 3NHHA 1I3QB 2JA6B 4C3IG 2RSOA 5JJZA 5ELBA 1SNDA 4FXDA 1TS3A 1U9RA 3Q22A 3VR4A 1OXUA 3M4OB 3HOZB 1BCPB 4KKSA 3EVQA 2NN6G 2F0PA 5J1ZA 4H7BA 3BVGA 3NQIA 1EIGA 1OXXK 2M2LA 5I4DA 1PZID 4A93B 4IN3A 5EPKA 4ZYSA 4ILWA 2G9DA 4AYBB 3KBGA 3JAME 2KQ3A 2NN6H 2QKIC 3I73A 3NTKA 1EYCA 1ILQA 3S16B 2GA4B 4K2LA 1LTAD 4HSVA 3CU7A 3N6RA 5KRUA 1DJRD 4DNRB 2L5TA 5IGCA 1CHQD 1HHVA 2NWGA 1QE6A 1PYWD 3S2HB 2F0VA 1G8ZD 4A3FB 4WJWA 4RHRA 2A74C 4M8AA 1JE4A 5ELCA 3X3NA 1XXGA 1RHPA 2A5HA 3V96A 3OW7A 4K6LA 3DM1A 3A54A 1S5FD 5J22A 5D3DA 1UNSA 5KYIA 3FRPB 3QOLA 1TY2A 4XQQA 3D3RA 4TKOB 2C5CA 2K03A 5TSSA 2B2TA 1EL0A 1XWEA 4QIWB 3RZDB 4G7ZC 4F87A 4XQNA 4RWSC 3DHQA 4KKUA 3HGBA 1SXTA 3M3YB 3OIQA 2D5DA 2Z4HA 2XN9C 2R61A 1RCVD 3O13A 4XQJA 1D2BA 1AP0A 4RGNA 1CA6A 2MP1A 5A2QL 2XRSD 3MA2B 2MGSA 3BS1A 3MTSA 1WD0A 4F8MA 2RBMA 1LTTD 4FF1A 1ICWA 3VYUA 2K05A 3DEOA 1LTSD 4C3JB 1S5ED 3URYA 2AWOA 1QWYA 1K8MA 1U4RA 4R9WA 5COYA 1CT1D 5IGDA 1AZPA 3BZDB 1X32A 1PFMA 4KN4C 5EKLA 1CQVA 3PUYA 1C4QA 2A6ED 1CI3M 2IL8A 1ZEQX 1G2TA 1IL8A 1II3A 1W6JA 1LACA 3A8IE 2L0CA 4LJZC 3I70A 4FP5D 3H94A 4TRDA 3OMCA 2D2CC 2FHTA 1CA5A 3NTIA 1KLGD 2F0LA 1ESFA 3T51B 1DOKA 1SE2A 5NUCA 4F7XA 5EGTA 3D6WA 1JWUD 2K5DA 2F0NA 3J81E 3HRZC 3T13A 1QB5D 2R3ZA 1K8OA 1QG7A 2F0WA 3KUPA 3WOFA 5C3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D2B A;  3FRP B;  1UAP A;  5JPN C;  1OO9 B;  4FXG C;  3L3O C;  3I70 A;  5FOB B;  4FXK C;  1BUV T;  3CU7 A;  1GXD C;  3MA2 B;  3G6J B;  2TMP A;  2I07 B;  3OHX C;  4ILW A;  2A74 C;  1JB3 A;  3HRZ C;  1BQQ T;  5FO8 B;  1XWE A;  2XWB B;  3T4A C;  5JPM C;  3CKI B;  2E2D C;  3V96 A;  2WIN B;  1JC7 A;  2J0T D;  1PXU A;  1UEA B;  3HS0 C;  2ICE C;  3KLS A;  2QKI C;  5FO9 B;  2B39 A;  5FO7 B;  2A73 B;  2XWJ B;  1BR9 A;  2WII B; 
#chains in the Genus database with same CATH topology
 3OOC A;  3PGZ A;  1EZ6 A;  4QQB X;  1GUO A;  2FJ2 A;  2BDN A;  3VR6 A;  2OEO A;  1XMQ L;  2UXC L;  2Y0S B;  2VUM H;  1VMC A;  3PUZ A;  2F0G A;  1PTO D;  4JI3 Q;  1X9N A;  3SK5 A;  3LWU A;  4DAP A;  2F0E A;  4BBR G;  1UE1 A;  1ZYR C;  3PUV A;  4DV7 L;  4ZKB B;  2ASB A;  5BN4 A;  1CQF A;  3D31 A;  1ENA A;  1O7Z A;  2UUA L;  2HCC A;  5BN3 A;  1H9J A;  2DGY A;  4LF8 Q;  1ASZ A;  2HDM A;  4RHS A;  1L1O C;  1L2F A;  3FMC A;  4S3S A;  4IPD A;  4B3M L;  2Z1C A;  5M5X B;  1KC8 C;  1CSP A;  1HR0 W;  1GJX A;  2F0K A;  3D8G A;  2RDF A;  5AFW A;  4JI0 L;  3LNN A;  1PH5 A;  1Q1B A;  2QEX A;  4YY3 Q;  1EWH A;  1ILP A;  4JCV E;  3QWN A;  4LF7 Q;  3J80 i;  3MXG A;  1B44 D;  3C1E A;  3IKJ A;  4NMZ A;  2AQ3 B;  1WOC A;  2SEB D;  3ULJ A;  4HED A;  3GTL H;  1S5C D;  1OXV A;  1HA6 A;  2BE5 C;  2EXZ A;  2RHQ B;  2EY2 A;  3BVM A;  2DNC A;  2KHI A;  4J8Q A;  3SE0 A;  1VDZ A;  3K5L A;  3E6Z X;  1PHJ A;  1HNZ Q;  5M3F B;  2RCF A;  4IFD G;  4GKJ Q;  5D3I B;  3PO2 H;  1FGB D;  4DAY B;  4I65 A;  2UUB Q;  4MZ9 A;  1EQQ A;  2KEN A;  3MEH A;  1EEI D;  4OEM B;  4JBJ A;  1SEB D;  2CKZ B;  4A3F G;  1CFM A;  2B39 A;  4WFN 3;  3PIP 3;  2Z0S A;  4CGY B;  3NE5 B;  3S1M B;  2JN4 A;  1AN8 A;  3PF4 A;  1SSO A;  1KRT A;  2VXW A;  4YWL A;  1UUP A;  3TP5 A;  3K8A A;  4WJ4 A;  1YEZ A;  3K0X A;  2ZJQ A;  2A68 D;  3RZD H;  1PH9 A;  4YIJ A;  4OO1 I;  1QOH A;  4X3K A;  5HGQ A;  4KHP Q;  2XWB B;  1RDP D;  4QY7 A;  1Q1E A;  3NBH A;  1B4O A;  3OTO Q;  3E3X A;  5EJW A;  2E2J H;  4ZK9 B;  3ERQ A;  1T5X D;  3TME A;  2Q8R E;  4B3R L;  3NP8 A;  1IW7 D;  5C6A A;  3MC0 B;  5K36 G;  5JEA G;  5JVH 3;  5GAH C;  3S1R H;  1JWS D;  1Y1W B;  1EUJ A;  4UY8 C;  1B50 A;  3FKI G;  2A69 D;  2EDG A;  4JI0 Q;  2UUA Q;  4JOI A;  2F0U A;  1E2Z A;  5C4X B;  1JB3 A;  1I4G A;  1AEX A;  3W3A A;  4XXE A;  1QNK A;  3T53 B;  3UI2 A;  4IUV A;  5M5W B;  2B2T C;  4DV2 L;  5C4X H;  4C3I B;  1H9S B;  1NR2 A;  1ONL A;  1XMO Q;  1V8Q A;  1L0W A;  4BWG B;  2JEB I;  4YY3 L;  1RTN A;  1C7Y A;  5I2Y A;  4QGU A;  4OWW B;  3MXN A;  1G6Z A;  5IYC G;  3J7A 5;  4FXG C;  4C3H B;  2NTT A;  3L3O C;  2ICI A;  4OGQ C;  1BO0 A;  1IBK L;  3BYY B;  1PZJ D;  1VCI A;  2B2W C;  1VQ8 A;  3GV3 A;  4KKT A;  2KED A;  2ZXO A;  4EQO A;  2VQF Q;  3T1H L;  1BXT A;  4XT1 B;  4CKE A;  1Q90 A;  2B3G A;  1PFN A;  2HIV A;  2L4N A;  2R7D A;  4R8N A;  4R1J A;  4RG1 A;  4KY7 A;  3S9W A;  1IBM L;  4DUZ Q;  2A73 B;  5JPN C;  2EPB A;  4DV1 Q;  3HOW H;  4K5V A;  4A3I H;  4C1N K;  1GUN A;  1K83 B;  1WCM G;  2AQ1 B;  3KLR A;  3R3O A;  2NVX B;  1I50 H;  2K52 A;  1F9P A;  3V2T A;  4LF5 L;  3PMF A;  2SNM A;  3TBI B;  2RHS B;  4A3G H;  3RLN A;  4U68 A;  2I0Q A;  3S15 B;  4DV2 Q;  4GZY C;  1KAB A;  1E2V A;  2WV6 D;  2XNA C;  3KF8 A;  4B3R Q;  5E4X A;  5FO9 B;  2OQK A;  3WDN A;  1I4P A;  4PQX A;  1TT2 A;  5LL6 S;  1VQ4 A;  2KUM A;  2RVL A;  4MHE A;  2KEE A;  2EJM A;  3M4P A;  5JJL A;  3KF6 B;  4X66 L;  2CFM A;  3GTQ H;  1A6X A;  4H02 A;  2N55 A;  3IRB A;  3RN2 A;  2B8F A;  4BA1 I;  3K5O A;  4BBR B;  3VR3 A;  5KNB A;  3PIP A;  3J81 j;  3TS0 A;  5E7N A;  1QJO A;  4K8J A;  1LLR D;  4IUU A;  5FLX L;  5H1S E;  1D6E C;  2UU9 L;  4HID A;  1CM9 A;  1JE5 A;  1QVG A;  3UDX A;  3T1Y L;  1L0Y B;  4EGV A;  1I4R A;  1A62 A;  5CV6 A;  4A3E G;  4IUP A;  5LMN Q;  3WWV A;  4JI5 Q;  3CAM A;  1K8G A;  3QJY A;  1QNU A;  1XYI A;  2HHH L;  2K04 A;  1HNW Q;  3PCO B;  5IT9 L;  1E24 A;  3CPW A;  1CKN B;  4UDU C;  1G51 A;  1K73 C;  1PH2 A;  3KK7 A;  3TP6 A;  4IUQ A;  5LMU L;  5I2X A;  1TR5 A;  3M3Y H;  5C5M A;  4P73 A;  1ZKO A;  1JJ2 A;  2F3W A;  1K3R A;  1TWH H;  2EQS A;  2B2V A;  4YCV A;  5CV9 A;  5JEA J;  2E74 C;  1EEF D;  3AQQ A;  5M3F G;  4BXX G;  3I4M G;  1HQM C;  1K0R A;  4MNO A;  2PI2 E;  1B8A A;  2O5I C;  4DV4 L;  2PI2 A;  2IHE A;  2R93 H;  3BDC A;  3UE1 A;  3U9O A;  2K14 A;  4NXN Q;  2XIW A;  2F0J A;  2PMZ B;  4ZUJ A;  5FKA C;  3BZK A;  4FVM A;  1SBB B;  1G29 1;  1BDO A;  4EX5 A;  2B2V C;  1F2M A;  2ATW A;  2KOL A;  4Z9C B;  3BVZ A;  2ID0 A;  2WP8 J;  1YJW A;  4R8I A;  4DV3 Q;  3I3C A;  2WAQ G;  1N33 L;  3I4M H;  1CZG A;  1M8A A;  1NE3 A;  5E1F A;  4LFB L;  3K7A B;  3OSO A;  4KMU C;  2R93 G;  1LT4 D;  2KCM A;  1FYC A;  2XGT A;  1VQM A;  1TQO A;  4QIW E;  2NBF A;  2JA6 G;  1YZ6 A;  5EBC A;  3FDT A;  1RTO A;  2MO1 A;  1DYQ A;  3V05 A;  2P5Z X;  4ABN A;  3TSS A;  4X62 Q;  4E6I A;  4JK1 C;  1Q81 C;  2Z6B A;  2E5L L;  2L55 A;  2NUC A;  4BBS B;  2K32 A;  3T16 A;  1QUQ A;  4DA2 A;  1X3G A;  2F1M A;  1Q46 A;  3AYH B;  1A3V A;  3HFZ B;  1OO9 B;  3BZC A;  3Q23 A;  5IE8 A;  2EZV A;  2NVQ H;  2LY7 A;  3R93 A;  3DWQ A;  1EFI D;  4GOP B;  3RNU A;  1Z7T A;  2HQE A;  3EN2 A;  1ET9 A;  1HQR D;  1WYD A;  5G3L F;  2KBN A;  1F9R A;  4A3K B;  1PFS A;  4BBS G;  1LTG D;  3BDO A;  4GLA C;  5I9O A;  4DV4 Q;  2CWP A;  1V1O A;  5J3B A;  1BVS A;  3HOV H;  2ALY B;  1BOS A;  4GN3 B;  4XTC S;  1B53 A;  1N32 Q;  2H5X A;  3RZO B;  3NUC A;  1B7Y B;  4KY6 A;  2FIN B;  4DFA A;  1WTV A;  1GO3 E;  3VA7 A;  2SNS A;  1QVF A;  1XJV A;  3L7Z C;  4P71 A;  1HFG A;  2G5D A;  5C44 B;  3GTJ B;  2WKD A;  2BDO A;  3GQB A;  4CKC A;  4C3H H;  1WTP A;  4XYQ A;  1W2B A;  3E9I A;  4K0K Q;  1JOO A;  1G91 A;  1N33 Q;  2JA8 G;  2HT1 A;  1SRU A;  4WRD A;  2JA5 G;  3TP8 A;  1ROD A;  3C2P A;  4FDB A;  1Y14 B;  1J6Q A;  4R4T A;  4CDE C;  4PZ7 A;  4B3T Q;  1LYL A;  2IX1 A;  1JCK B;  3GO5 A;  2X69 A;  2D62 A;  4O42 A;  1KDB A;  4A3B H;  1U4P A;  2JA7 H;  4UAI A;  3MAQ A;  5IT9 E;  5KGU A;  1H9S A;  2JA8 B;  1FNV A;  4X3U A;  4DR6 L;  1X6O A;  2ZT9 C;  1CHP D;  4K8I A;  2PMZ E;  4JYA Q;  1PV4 A;  2OT2 A;  4HIO A;  3KDF A;  3K57 A;  2B2Y A;  2F4V Q;  3OIP A;  2CCZ A;  3GTO H;  4DXG A;  1YNJ D;  3A0J A;  2MNA A;  2B63 G;  2CH4 W;  4K2K A;  5EPL A;  2PNR C;  5HGT A;  2NVQ B;  5T1I A;  3NEL A;  4LUV A;  2Q2U A;  2Z9H A;  1BBU A;  3HOZ H;  2JYO A;  1IW7 C;  3VR2 A;  1A2T A;  4CHT B;  3J80 L;  4QF4 A;  1I3Q H;  4JBK A;  3CRK C;  3NBH B;  2R92 G;  1IBM Q;  4POF A;  1JWM D;  1J5E L;  4DNI A;  2CQO A;  3D4D A;  5EQ0 A;  4JV5 L;  4AYB G;  1K8A C;  2WKC A;  2VUM G;  2B2U A;  2XVS A;  1PXU A;  4JG2 A;  4OXP A;  3KLS X;  3GDE A;  1LTI D;  2EYH A;  5EPJ A;  3K0Y A;  3VYT A;  1PTO H;  3CCM A;  4J1M A;  4LF4 Q;  4FF3 A;  1SMY D;  3KJO A;  2YYZ A;  4KHZ A;  4GKK L;  1Z6H A;  1TVX A;  2HQL A;  2K4K A;  2BA1 A;  1F2Z A;  5HY6 A;  3JAM c;  1E3P A;  3IFD A;  4TQU S;  1EY7 A;  1CKO A;  1PZK D;  2EY6 A;  2YV5 A;  3LWE A;  3A5U A;  3RLF A;  1MI2 A;  3EFX D;  1A3U A;  2C9O A;  2JA7 B;  4OHJ A;  2Q8I B;  4Q5V A;  5IIF A;  2V1C C;  2J7Z A;  4DK6 C;  2JSO A;  3CRL C;  4IPG A;  4HSP A;  3W5O A;  1TXY A;  1SAP A;  3ER0 A;  1PH1 A;  2CH4 A;  4IFD I;  3CF5 A;  2EYM A;  1VQL A;  1J8I A;  2WIN B;  1MHW C;  1CUK A;  4BS9 A;  4HTH A;  4ZLT F;  4JBW A;  1LAB A;  5JAV A;  2EYO A;  1VQ5 A;  1YJ9 A;  1VQE A;  1XNR Q;  1HUN A;  2B8G A;  3DUZ A;  3D4W A;  5ELD A;  3J7Y W;  2FMC A;  5C0X H;  3L0O A;  1VF7 A;  3FHW A;  2ZTC A;  3AU7 A;  1PTO C;  1VQA A;  1DZ1 A;  2IT1 A;  2QEJ C;  2VQE Q;  1NMG A;  3WOE A;  5ELF A;  3IFT A;  1FNU A;  4RGO S;  2OQ0 A;  5C3E B;  2RCN A;  2DJG C;  5L37 A;  1NNX A;  1U4M A;  3PV0 A;  3SR1 A;  1WI5 A;  5CV7 A;  4OEL B;  5CGK A;  2HD3 A;  1AZQ A;  1QZG A;  1W3S A;  4NXM Q;  1P8L A;  1CZW A;  2K5Q A;  3G7L A;  1KL9 A;  2A8V A;  2DUD A;  1HR0 L;  3RUZ A;  4K5X A;  2CVR A;  3H09 A;  4DU9 A;  5FO8 B;  5K36 H;  1STN A;  1XTC D;  4A3D H;  4K5W A;  4JOI C;  4HIM A;  1IYV A;  2E5L Q;  4CJ0 B;  2RA4 A;  1B70 B;  2OCE A;  4APV A;  4XYO A;  2F0T A;  3TRZ A;  4GKJ L;  4KJN A;  4GNX B;  4OX9 Q;  2M9V A;  2O2L D;  1JMC A;  4EVO A;  1WTQ A;  2BE5 D;  4G7O C;  2SOB A;  1BUV T;  2QF7 A;  4CDF C;  1EY8 A;  2IX0 A;  3E0J A;  4MIU A;  1F77 A;  2KEC A;  3GTG B;  5IYD H;  2K5N A;  2EYJ A;  4IPH A;  1ENF A;  1IBL Q;  3EJI A;  1F2L A;  2GVB A;  1S3O A;  3ERS X;  4A3M B;  2EYF A;  2QGQ A;  1PRT F;  5M3M H;  4DKA C;  2OWO A;  2RSN A;  3FKI B;  2R92 B;  1YNJ C;  1ESR A;  3PQI A;  3FPU B;  4C3I H;  1XPO A;  2PW7 A;  4ME5 A;  1TWF B;  3M7G A;  1B9N A;  4ZUI A;  2DN8 A;  3H0G G;  1WCM B;  5C4H A;  3K7A H;  1CKM A;  1S5B D;  1SE3 A;  3MFG A;  3U4Z A;  4A3I G;  5IP7 H;  3PO3 H;  3U58 A;  1ZYR D;  4V0B A;  4L6T B;  1EFW A;  2MJ8 A;  5M3M G;  5EBD A;  1P16 A;  1TWC H;  1J9O A;  4YCW A;  3KF8 B;  5IGG A;  4BY1 H;  3FVQ A;  5I6Y A;  1M90 C;  4NPS A;  4AQY L;  5D65 A;  4KD3 A;  1XNQ L;  1FD7 D;  3KLW A;  2E2I H;  5M5X H;  2Q8T A;  1FVI A;  2YU9 B;  4JBM A;  1NSN S;  3CKI B;  3C1F A;  4Y7N H;  1LT3 D;  1B1Z A;  1YBY A;  3NWS A;  1Y1V H;  4A3J G;  1I6V C;  3A74 A;  3CW2 C;  2VY3 A;  4O1N A;  3M9B A;  5EAY A;  4X62 L;  4JI2 L;  4ZCK A;  2ZM6 Q;  4FXK C;  5IP9 H;  1SYG A;  4IUN A;  1FGU A;  4QUF A;  5CBE E;  4A93 G;  5C0X J;  5COR A;  1M4V A;  1NR4 A;  1D1I A;  3RZO H;  1KDA A;  4CJ1 B;  4RA8 A;  2PPB C;  2EVB A;  2VW9 A;  3PIO A;  3H3V H;  4LF8 L;  1HFN A;  2AQ2 B;  4DK0 A;  5FLM G;  1B9M A;  3NQT A;  2F0M A;  3JAM L;  5FJ8 G;  4B9W A;  1RJT A;  3BG3 A;  3CHB D;  1VS0 A;  3HKZ G;  3I91 A;  2HIX A;  4X64 L;  2VZA A;  1R9T H;  1PRT C;  2RDH A;  5IYC H;  4DNT B;  1IBL L;  4GOP A;  3I56 A;  1A63 A;  3HOY B;  4LFC L;  2H1E A;  1Q8I A;  2L12 A;  3SK6 A;  5IGB A;  1DGS A;  1E1T A;  1R9T B;  2G9H D;  1AFP A;  5AJ3 L;  4A3D B;  4X66 Q;  2K1B A;  1U4L A;  4ULL A;  2E2J B;  3NEM A;  2WB1 E;  4LF6 L;  2VNU D;  2L15 A;  4C56 C;  2B2U C;  4DR1 Q;  4IO9 A;  1JOR A;  1BF4 A;  3NWT A;  3OHX C;  3TN2 A;  2E2H H;  2XRQ D;  4LUZ A;  4B08 A;  2V4D A;  4JI6 Q;  1KD1 C;  3S1N H;  4Y7N B;  2D9U A;  3KF6 A;  3VR5 A;  5C4J B;  1Q7Y C;  3SVM A;  4Q0F A;  4JI8 Q;  3W2D A;  2F0H A;  4DR6 Q;  4IFD J;  4QCL A;  1SFO B;  1LTL A;  4P72 A;  2K5H A;  4B3S Q;  3MFY A;  4GLX A;  1I94 Q;  1MGS A;  3RR5 A;  2CHB D;  5LMN L;  2D0O A;  1BKB A;  5T1G A;  3GD7 A;  3CCQ A;  3DWP A;  2EYL A;  3EQL C;  5E4W C;  3LX0 A;  2RDG A;  2B63 B;  3S17 H;  2I5L X;  1IL2 A;  2M00 A;  1PRT D;  3IAY A;  2AKW B;  1EQT A;  1V1P A;  4EQP A;  4DV0 L;  1I6H B;  1N32 L;  3K81 C;  1JIC A;  5C44 G;  3VA5 A;  4HMJ A;  4EQ5 A;  3MXP A;  1HTL D;  4OWX B;  3EBE A;  3P20 A;  1UE6 A;  2AMC B;  1MIU A;  1EY9 A;  4A3I B;  4KLK A;  2WAQ B;  4PV1 C;  3J81 i;  3FEW X;  4WJ3 M;  4LK1 C;  1SE4 A;  4UP7 A;  1C9O A;  3MXU A;  3AFP A;  2YU9 H;  5IOD A;  4NB3 A;  4A3E H;  1EY6 A;  1SJE D;  1STA A;  2A6E C;  1NAP A;  3G6E A;  1JOQ A;  3ERO A;  1Q3L A;  3Q6S A;  1HA5 A;  4BBS H;  1HJP A;  2A6H D;  3CC7 A;  1V1P B;  3OMG A;  1IZ6 A;  1A15 A;  3MWY W;  2YTX A;  1NUC A;  4NDX A;  4KK7 A;  4JI4 L;  1EU3 A;  1C48 A;  3NSW A;  1H95 A;  3T56 B;  3D0F A;  4PZ6 A;  4TVA B;  5IWA L;  4DUZ L;  5FK9 C;  2WAQ E;  4JI3 L;  1VQ7 A;  4KY5 A;  3GTM B;  1DCZ A;  2Z4I A;  2QA4 A;  4XIG S;  5M3F H;  1CKN A;  4XDX A;  5M3M B;  4HIK A;  1GXD C;  3GTM H;  1KQS A;  3PO2 B;  3D4R A;  2AUK A;  4MN3 A;  4ZRZ A;  4OL7 A;  4J6H A;  4OIJ A;  4DR2 Q;  2VUM B;  3I72 A;  2EIF A;  4IPC A;  4A3B G;  5JPM C;  5C3E H;  4LF9 Q;  5IYB H;  1JOK A;  2VB3 X;  3U9S A;  1SYC A;  2MPM A;  4V19 0;  1SNO A;  3AB9 A;  2XSC A;  1S4Z A;  4QUC A;  3N52 A;  1D7Q A;  1YVC A;  3HOU G;  4JYA L;  1Q86 C;  1FR3 A;  4JV5 Q;  1SYF A;  1UAP A;  4A75 A;  1YNN D;  1PH7 A;  4P2C B;  2KCT A;  1WTR A;  4P75 A;  2HCI A;  1Q12 A;  3S14 H;  1BCP F;  1JJG A;  4LAA A;  1UEB A;  2CW0 D;  2OTL A;  1B2T A;  4OX9 L;  2E2D C;  2JA6 H;  1SJH D;  2AUJ D;  2FMM A;  2B2W A;  4DN4 M;  4P74 A;  3M85 A;  3W1G A;  1RL2 A;  1XPR A;  2OF1 A;  1NMF A;  3CME A;  2NVT H;  1WTO A;  2EYP A;  1O7L A;  3J7A F;  1J5E Q;  1Z9F A;  1L1O B;  2FFK B;  4DUY L;  3MZ5 A;  1PH8 A;  4DAM A;  1TKW B;  1HNX Q;  2HDL A;  2LSS A;  1WTH A;  4DR3 Q;  2AHO B;  1NCV A;  1TS2 A;  1LUZ A;  1AW7 A;  1LV9 A;  1VMP A;  1EY0 A;  1N34 L;  3CCV A;  5FLX c;  2HHH Q;  3SGI A;  4N9T A;  3HKZ B;  1SR3 A;  1EYA A;  3OTO L;  4FF2 A;  2J0T D;  2F0D A;  3T1Y Q;  4PMB A;  5GAD C;  1ZXT A;  1DD2 A;  4JI4 Q;  1DOL A;  1EIF A;  5KNC A;  3I7F A;  4EQN A;  1BCP D;  1QVC A;  1SDF A;  4POG A;  4GS3 A;  1X55 A;  4LFA L;  1A0I A;  4QJF A;  4JI2 Q;  1O7Y A;  1X54 A;  1AE2 A;  3EA6 A;  4DPG A;  5ELE A;  4PMC A;  1S40 A;  2IW3 A;  3H3V I;  3OPO A;  4WOR A;  3BJU A;  2H4O A;  1TWC B;  1PYB A;  3QOJ A;  3K7U C;  1V9P A;  4C3H G;  2R7Z H;  2A69 C;  3K80 C;  2JA8 H;  1YNX A;  4A3E B;  2NVX H;  5ISR A;  4X65 L;  1C8C A;  1DXM A;  1HRJ A;  1A3T A;  3Q8D A;  4DGZ A;  3HZX A;  3NK9 A;  2E8G A;  1LTR D;  1IKL A;  1W6K A;  5C4J H;  3A7A B;  1HXY D;  2K01 A;  2PQE A;  2IX3 A;  1N34 Q;  4H13 C;  2Z8L A;  4LMQ D;  1TS5 A;  1KAW A;  1YHA A;  5AJ3 Q;  4A3K H;  1I4H A;  4CJ2 C;  2ICE C;  4IUT A;  3CC4 A;  5M5W H;  4HJ8 A;  2WII B;  3U50 C;  3I4L A;  5JEA H;  1LTB D;  2LFN A;  3K6O A;  4OIK A;  3GTL B;  3FKI H;  1I94 L;  4DR1 L;  2B63 H;  3S17 B;  2NYZ D;  2KA7 A;  2A68 C;  3I4M B;  1SFO H;  1E1O A;  1R4Q B;  4BBR H;  3CMA A;  1RF2 D;  5CC4 A;  5KIX A;  1TWG B;  2YTV A;  3NXW A;  2VQF L;  2X6G A;  2ENB A;  1EZ8 A;  3I90 A;  1EIH A;  2EJG C;  2IWH A;  3IL8 A;  4OO1 G;  3ONA B;  5KYL A;  3E5S A;  4DV1 L;  1PTO B;  3PO3 B;  4BY7 B;  1X3E A;  4PNY A;  3P75 A;  1OXT A;  4B9X A;  2RF4 A;  5G3L D;  3S2D B;  3MVV A;  4TSS A;  1R4P B;  4A3D G;  3HOW B;  2TMP A;  1STB A;  4YHH Q;  1X3F A;  1L1O A;  3TZU A;  3PF5 A;  1K83 H;  2I5H A;  4UHV A;  1XTD A;  2OTJ A;  1RKN A;  4JI7 Q;  1Q82 C;  3QR8 A;  1GUS A;  1TWA B;  5K5P A;  1UE5 A;  3J80 E;  1K9M C;  2F0F A;  4DF7 A;  3GTO B;  5JOB A;  4MTN A;  1SYE A;  2F4V L;  3K5M A;  3H3V C;  3F2D A;  1GKH A;  4K6D A;  2UXB L;  3MHB A;  3SXH A;  5ELO A;  5A2Q E;  3K5N A;  4DK1 A;  5JJK A;  3W1B A;  2N78 A;  1XNQ Q;  2K28 A;  1IKM A;  2N3S A;  3HOV B;  3PO2 G;  1BQQ T;  4YWM A;  4JC0 A;  1HZ9 A;  4A3G G;  3J80 c;  2PCF B;  1HH2 P;  1DON A;  1PH6 A;  1JQY D;  4AH6 A;  2WAC A;  3H91 A;  3TQY A;  4A3F H;  1VQ6 A;  1EQV A;  5FO7 B;  3GTK B;  4X3T A;  2BH2 A;  3Q0A A;  1KAA A;  4A3M H;  4A3C G;  3I8Z A;  1WJJ A;  2DY7 A;  2IY5 B;  5IP7 G;  3F2B A;  3PO3 G;  2PQA B;  4FO2 A;  4H44 C;  5CBA E;  3OWF A;  1WFQ A;  5J39 A;  1DM0 B;  1GUG A;  1CK1 A;  1GD7 A;  1V43 A;  2UUB L;  5GQO A;  4GLV B;  2DY8 A;  1VQO A;  1GVP A;  3PIO 3;  2K6A A;  3UDG A;  1EU4 A;  3PUW A;  1EQR A;  3HP3 A;  3CP0 A;  5DM6 3;  2EY1 A;  4KJO A;  4QB4 A;  2A6H C;  1H9K A;  2MFI A;  2QCP X;  1STH A;  1Y1V G;  3R8B A;  2JA9 A;  2NVT B;  1MBY A;  4N8F A;  1KNE A;  4IJH A;  4DK3 C;  4CKB A;  2UXD L;  3Q24 A;  2B29 A;  5M5Y H;  3S24 A;  2F0Q A;  2JP1 A;  4L5Q A;  1WTW A;  3GTP B;  2A1A A;  3M4Y A;  2HUG A;  1PDQ A;  3GV6 A;  1KHI A;  4DR4 Q;  2Q2I A;  3NPP A;  4LUO A;  2LMC B;  3AEV A;  4DR3 L;  5CV5 A;  3F1Z A;  4LF4 L;  1D5M C;  1RIP A;  2KHJ A;  1SYB A;  2E75 C;  1Y8O B;  1HZC A;  3J81 L;  4FF4 A;  1SNC A;  2F52 A;  2PW5 A;  3STB D;  5FJ8 H;  2LXK A;  2ZM6 L;  3P1H A;  4RH6 A;  1E0B A;  1PMR A;  1F2Y A;  1UEA B;  3HS0 C;  1MSH A;  2JK8 A;  3NTH A;  4GKK Q;  4JW0 A;  5CMD A;  1TWF H;  4DR7 Q;  3FPP A;  1WCM H;  3ZYY X;  4HCS A;  5D14 A;  3X3M A;  1PVO A;  5E3F A;  1LT6 D;  1IYU A;  3A56 A;  3CCR A;  4DUY Q;  1PTO F;  3AFQ A;  1KIX A;  4MTK A;  2BA0 A;  1JC7 A;  2ZXP A;  5DEH A;  4C1N I;  4C3J G;  5IGF A;  2CQA A;  1TWH B;  2K50 A;  4H0L C;  4X3S A;  2PO4 A;  3BU2 A;  4IZ8 A;  3S1N B;  1VQB A;  3VYR A;  1FJG L;  5F2D A;  1VQK A;  5DM7 3;  1BBX C;  3TRE A;  4R4I A;  1IYJ B;  1YHQ A;  2PYK A;  1OTC A;  5I6W A;  3DMU A;  5LL6 X;  1RD9 D;  2K33 A;  4LFA Q;  3TDQ A;  2NVY B;  4K14 A;  4DV6 L;  1SNQ A;  3RMH A;  3KYH C;  3CCU A;  2NVY H;  5A35 A;  2BOS A;  1TII D;  3E9H A;  3C46 A;  4HJ5 A;  4ALP A;  3GTK H;  1Y8N B;  4HJA A;  5KND A;  4DV0 Q;  4CBV A;  2I07 B;  3QB3 A;  4B3T L;  3RD4 A;  2VB2 X;  5HUR A;  3NBI A;  4JI1 Q;  1I4Q A;  5BN5 A;  5C44 H;  1PRT B;  4RCO A;  2PZW A;  1PFB A;  4HCE A;  5IY0 A;  1I6H H;  1T5E A;  4LW1 A;  1HNW L;  3DWA A;  3SEB A;  3S2D H;  4HJ7 A;  3P7J A;  3DEP A;  1BNZ A;  4LNQ A;  1EYG A;  1O80 A;  3HG9 A;  4KD4 A;  4A93 H;  2VS1 A;  1LO5 D;  2F0I A;  3S1Q B;  1VQG A;  1PA6 A;  1SRO A;  4KI0 A;  1I5F A;  1VQH A;  2QDB A;  1MSG A;  4BY1 B;  1SNM A;  4IUR A;  1TWA H;  5BR8 Q;  2KJX A;  2E76 C;  5FLM H;  2E2I B;  1STG A;  4HMI A;  4RGT A;  3FP9 A;  4BY7 G;  4KTA A;  5GAE C;  4B3S L;  5KEE A;  4OON A;  3S1R B;  3I4N G;  4DV6 Q;  4GN4 B;  5IOC A;  1WVL A;  2DNE A;  4NP5 A;  1VQI A;  4HR7 B;  5EKK A;  5I9P A;  1B3A A;  3CCJ A;  3PUX A;  1D1K A;  1NTG A;  2IHF A;  1G6P A;  4DXF A;  1WTX A;  2BH8 A;  2EXD A;  4GN5 A;  5EKI A;  1STE A;  4PMW A;  3I55 A;  1ICF B;  2KCN A;  3HEJ A;  4JI7 L;  2B2Y C;  1TU2 B;  3M4Q A;  3I4N B;  3J7Z C;  4Y52 H;  5DNF A;  3CCL A;  1EY4 A;  2Q2T A;  4G4K A;  3KBX A;  3KLS A;  3I4N H;  2I46 A;  3BYT B;  1HCZ A;  1SN8 A;  4NXN L;  1TY0 A;  2KVM A;  2MUY A;  4LF9 L;  5C3E G;  1A2U A;  1KTK A;  2DJF C;  5DLQ E;  5IWA Q;  1F9Q A;  1VF5 C;  3OWE B;  2R92 H;  2Z6K A;  5GRO A;  5BR8 L;  1N9W A;  2ZTE A;  5C0X I;  1LM0 A;  2K7V A;  3SHL A;  4ZKC B;  4IOC A;  4NXM L;  4DV3 L;  1D5Z C;  1EOT A;  3JC6 6;  2JXM B;  1EYD A;  1EY5 A;  1GUT A;  1JB7 A;  3CQZ B;  3CCE A;  3T1H Q;  1YI2 A;  4OWT B;  1KRS A;  1BR9 A;  2JEA I;  4L8J A;  4G7H C;  3C3L A;  2QDL A;  3TZD A;  3HKS A;  4DR5 L;  1O78 A;  3G6J B;  1U5K A;  3A8J E;  4N9P A;  2QIL A;  4M1U B;  4A3B B;  3S15 H;  2RQX A;  4JI1 L;  2EOT A;  2X6L A;  1BCP C;  2JA5 B;  3A8K E;  4KHV A;  2NN6 I;  1D5X C;  3A5Z B;  1ML0 D;  4FNF A;  2F03 A;  2LXJ A;  1L0X B;  1HPC A;  3J7A V;  2GVA A;  3HOV G;  3ITP A;  1KNA A;  5IGE A;  1TS4 A;  5DAU A;  4A3G B;  2PZT A;  1QCB D;  4R4Q A;  5C3W A;  3GTQ B;  2MO0 A;  1IHZ A;  4PZ8 A;  2N8N A;  2O4X A;  1Y1V B;  1GUW A;  2RKS A;  5CR3 A;  1AH9 A;  3EIV A;  4QMG A;  1E2W A;  4DR4 L;  3MXN B;  2LS0 1;  4XT3 B;  2L11 A;  3KOJ A;  2N49 A;  4IAL A;  5CYU A;  3QO2 A;  3CD6 A;  1PH4 A;  2A19 A;  5JVG 3;  3OW2 A;  1IBK Q;  2EY5 A;  1C0A A;  1I4X A;  1U0L A;  3MEF A;  2UU9 Q;  4JPB W;  5C0X G;  1H9R A;  4IQZ A;  2VL6 A;  3HOX B;  3UDF A;  2L9H A;  4RGM A;  4JI6 L;  2K5W A;  3A55 A;  3DM3 A;  3SK8 A;  2NB0 A;  3ICE A;  4L5R C;  5C5L A;  1STY A;  1VQF A;  4GOP C;  3K58 A;  4C2M B;  2F4I A;  1OXS C;  5IYB G;  4IOA A;  4LWC A;  5IT9 c;  5FOB B;  4BA2 I;  1UE7 A;  1JJC B;  1FJG Q;  4FYD A;  4NW2 A;  1UWV A;  3DLL A;  5M5Y B;  2IJ0 A;  3HOU H;  4K0K L;  1JR0 D;  1PYS B;  2IPK D;  4KN7 C;  4B3M Q;  3S2H H;  1Q8K A;  3L2P A;  4R4C A;  1HZB A;  3HOU B;  1ET6 A;  1DOM A;  2NZO A;  4L5T A;  4DAY A;  2K5V A;  1H9M A;  1VQN A;  4RKB A;  5CV8 A;  3R2T A;  4J15 A;  4DR5 Q;  2SDF A;  2R93 B;  1Z47 A;  2F0O A;  4O0A A;  3ND8 A;  3SDZ A;  4NKL A;  2UXD Q;  2MQH A;  1M1K C;  1Y69 U;  4OO1 H;  2JQO A;  4L63 B;  5IYD G;  3K59 A;  2ZTD A;  1EWI A;  3HOW G;  1EIY B;  4DR7 L;  4L5S A;  1Y8P B;  3VYS A;  1JT8 A;  1K0S A;  2NTS A;  1HNZ L;  1YIJ A;  4IFD H;  4DR2 L;  1ENC A;  3F8T A;  5CV4 A;  1GHJ A;  1KLU D;  4HAE A;  2CW0 C;  2ZJP A;  3TEH B;  4KV6 A;  1HTP A;  4RFB A;  3I4O A;  4CDD C;  2JJQ A;  3LGJ A;  2LKV A;  3S1M H;  4F88 A;  3S1Q H;  3H0G H;  5FLX E;  4IJL A;  1XX8 A;  4UP8 A;  2R6G A;  2ZJR A;  4C2M H;  2F3V A;  1X3Q A;  2R7Z B;  2UUC L;  1B3Q A;  1WD1 A;  1KDC A;  1N36 Q;  4KHP L;  3F2U A;  4PG3 A;  2GN5 A;  2PZU A;  4A3L G;  1GOZ A;  1T9H A;  4BY1 G;  3ULP A;  1CTM A;  2F0S A;  3A7L A;  2N88 A;  3UDI A;  2R7Z G;  2BCO A;  4R4O A;  3TP7 A;  5LMU Q;  4QL5 A;  1YNN C;  4A3J B;  3M4O H;  3H6M A;  3UE0 A;  2EJF C;  3GTG H;  4I7Z C;  1X3P A;  1SYD A;  3QG1 A;  3DXJ C;  2EE1 A;  3GP7 A;  4RCN A;  2ZXR A;  1D8L A;  1E7Z A;  2XWJ B;  4A3J H;  1SMY C;  3R2I A;  1GM5 A;  4ZAI A;  3QIA A;  2FXQ A;  2KHS A;  4DAV A;  1F9S A;  2J4X A;  4A3L H;  2TSS A;  4DV5 Q;  1A8V A;  2D0P A;  5C4X G;  2Y0S E;  4A3K G;  5IP9 G;  3M7N A;  3G48 A;  1FNW A;  2KCC A;  4RKL A;  1PLF A;  4HN7 A;  2WB1 B;  3GTJ H;  5LHY 1;  2L1B A;  3D6C A;  2UXC Q;  5C4Z A;  1NBW A;  4ID6 A;  5JJI A;  1I50 B;  3L9A X;  1S5D D;  3SK4 A;  4BXX H;  2CWA A;  1K28 A;  1LT5 D;  1VQC A;  3CQZ H;  1G2S A;  3H0G B;  4ODG A;  4U67 3;  3S16 H;  2O5J C;  1GHK A;  2MHV A;  2OXP A;  3AMU A;  1QIL A;  2AWN A;  2QW7 A;  5M9O A;  3GTP H;  1K3B C;  1QUQ B;  2NZ1 D;  4ZQ3 A;  1HR0 Q;  1SNP A;  3T4A C;  2E2H B;  1EWC A;  3BDL A;  3E0E A;  4RAU C;  3S14 B;  4G57 A;  1HUM A;  3CC2 A;  2JE6 I;  1MD2 D;  3ND9 A;  1CSQ A;  4LF5 Q;  3NHH A;  1Y1W H;  1I3Q B;  2JA6 B;  3OYY A;  4C3I G;  4LF6 Q;  1FL0 A;  2RSO A;  5JJZ A;  5ELB A;  1SND A;  4FXD A;  1V1Q A;  1BBW A;  1TS3 A;  1U9R A;  3H15 A;  1XMQ Q;  3Q22 A;  3PSI A;  3VR4 A;  1OXU A;  3M4O B;  3HOZ B;  4N8X 1;  1BCP B;  3ULL A;  4KKS A;  4CDC C;  3EVQ A;  2NN6 G;  2F0P A;  5J1Z A;  4H7B A;  1Y1W G;  3HOX H;  3BVG A;  1SLJ A;  3NQI A;  1EIG A;  1OXX K;  2M2L A;  5ELN A;  5I4D A;  2VQE L;  1PZI D;  4A93 B;  4IN3 A;  1SE8 A;  5EPK A;  3KDF B;  4AIM A;  4ILW A;  2G9D A;  4ZYS A;  2F3I A;  4AYB B;  3U4V A;  4A3M G;  3KBG A;  3TS2 A;  1PH3 A;  3JAM E;  4HJ9 A;  4A3C H;  1IXR A;  2KQ3 A;  3I2Z A;  2NN6 H;  2QKI C;  3I73 A;  3KJP A;  3NTK A;  1EYC A;  1ILQ A;  3S16 B;  2I5M X;  3HOX G;  2GA4 B;  4K2L A;  1LTA D;  3RLO A;  4HSV A;  3CPF A;  3CU7 A;  3N6R A;  5KRU A;  4AQY Q;  2UUC Q;  2K75 A;  3JAM i;  1DJR D;  4DNR B;  1MKH A;  1O7I A;  2L5T A;  2UXB Q;  1AE3 A;  2WB1 G;  5IGC A;  1NY4 A;  1CHQ D;  5LMN W;  1HHV A;  2NWG A;  2Q2H A;  1QE6 A;  1PYW D;  3S2H B;  2F0V A;  1G8Z D;  4A3F B;  4UPA A;  4A4I A;  4WJW A;  1VQP A;  4RHR A;  4GNX A;  1HZA A;  2A74 C;  4M8A A;  1JE4 A;  4YHH L;  4A76 A;  5ELC A;  3X3N A;  3STB C;  1XXG A;  1RHP A;  2A5H A;  3V96 A;  1YHB A;  3OW7 A;  4K6L A;  3DM1 A;  3A54 A;  1S5F D;  5J22 A;  4GNX C;  5D3D A;  1UNS A;  5KYI A;  3FRP B;  1E22 A;  3QOL A;  1TY2 A;  4XQQ A;  4LFB Q;  3D3R A;  4BY7 H;  4TKO B;  2C5C A;  2K03 A;  4UP9 A;  2B2T A;  4O2D A;  5TSS A;  4YCU A;  3G4S A;  2PQA A;  1MJC A;  1XWE A;  1ASY A;  1EL0 A;  2WFW A;  2XTI A;  1HNX L;  4QIW B;  3RZD B;  4G7Z C;  3HOZ G;  4F87 A;  4XQN A;  4RWS C;  3DHQ A;  4KKU A;  2C35 B;  3HGB A;  1SXT A;  3M3Y B;  3OIQ A;  2D5D A;  2Z4H A;  1VQD A;  2XN9 C;  2R61 A;  4AYB E;  3G71 A;  1RCV D;  1XMO L;  1NJI C;  3O13 A;  4I7A A;  4XQJ A;  4LF7 L;  1AP0 A;  1D2B A;  4RGN A;  1CA6 A;  2MP1 A;  5A2Q L;  2XRS D;  3MA2 B;  2MGS A;  3BS1 A;  3MTS A;  4C3J H;  1WD0 A;  4F8M A;  2RBM A;  2PNH A;  1LTT D;  2Z6K C;  4FF1 A;  2R7F A;  4X6A H;  1ICW A;  3VYU A;  2K05 A;  3DEO A;  1LTS D;  4ME3 A;  4LFC Q;  3ZJY C;  4C3J B;  1QZH A;  1S5E D;  3URY A;  2AWO A;  1QWY A;  1K8M A;  1U4R A;  3HOY G;  1N36 L;  3CCS A;  1S72 A;  4R9W A;  5COY A;  3HKZ E;  1CT1 D;  5IGD A;  1AZP A;  3BZD B;  1X32 A;  1PFM A;  4KN4 C;  5EKL A;  1CQV A;  3PUY A;  1C4Q A;  2A6E D;  3VDY A;  1CI3 M;  2IL8 A;  4DV5 L;  1MJE A;  1ZEQ X;  1X56 A;  1XNR L;  1XPU A;  1G2T A;  1IL8 A;  1X65 A;  4JI8 L;  1II3 A;  3HOY H;  1W6J A;  4JI5 L;  1LAC A;  5GAG C;  4X64 Q;  3A8I E;  2L0C A;  4LJZ C;  2JA5 H;  3I70 A;  4RMF A;  4FP5 D;  3KFU A;  3H94 A;  4TRD A;  3OMC A;  1SMX A;  2D2C C;  2FHT A;  1CA5 A;  4DV7 Q;  1EOV A;  3NTI A;  1KLG D;  2JA7 G;  2F0L A;  3F2C A;  3RN5 A;  1ESF A;  1VQ9 A;  3T51 B;  1VQJ A;  1DOK A;  1SE2 A;  1N8R C;  5NUC A;  2ES2 A;  4JVZ A;  4F7X A;  5EGT A;  3D6W A;  1JWU D;  4X65 Q;  2K5D A;  3NEN A;  2NZH A;  2F0N A;  3J81 E;  2YTY A;  2Y0S G;  3HRZ C;  1YIT A;  4YWK A;  3T13 A;  1KXL A;  1QB5 D;  2R3Z A;  1YJN A;  1K8O A;  3CXC A;  1TWG H;  1QG7 A;  3B6Y A;  2F0W A;  3KUP A;  3WOF A;  5C3X A;  3J81 c; 
#chains in the Genus database with same CATH homology
 3OOC A;  1EZ6 A;  1GUO A;  2FJ2 A;  2BDN A;  3VR6 A;  2OEO A;  2Y0S B;  1VMC A;  3PUZ A;  2F0G A;  1PTO D;  3SK5 A;  4DAP A;  3LWU A;  2F0E A;  1ZYR C;  3PUV A;  4ZKB B;  5BN4 A;  1CQF A;  3D31 A;  1ENA A;  1O7Z A;  2HCC A;  5BN3 A;  1H9J A;  2HDM A;  4RHS A;  3FMC A;  4S3S A;  2Z1C A;  5M5X B;  1GJX A;  2F0K A;  3D8G A;  2RDF A;  5AFW A;  3LNN A;  1Q1B A;  1EWH A;  1ILP A;  3QWN A;  3MXG A;  1B44 D;  3C1E A;  3IKJ A;  4NMZ A;  2AQ3 B;  2SEB D;  4HED A;  1S5C D;  1OXV A;  1HA6 A;  2BE5 C;  2EXZ A;  3BVM A;  2EY2 A;  2DNC A;  4J8Q A;  3SE0 A;  3K5L A;  1VDZ A;  3E6Z X;  5M3F B;  4IFD G;  5D3I B;  1FGB D;  4I65 A;  3MEH A;  1EEI D;  1SEB D;  1CFM A;  2B39 A;  4WFN 3;  3PIP 3;  4CGY B;  3NE5 B;  3S1M B;  1AN8 A;  1SSO A;  2VXW A;  1UUP A;  3TP5 A;  2A68 D;  4YIJ A;  4OO1 I;  1QOH A;  4X3K A;  2XWB B;  1RDP D;  1Q1E A;  3NBH A;  1B4O A;  5EJW A;  4ZK9 B;  3ERQ A;  1T5X D;  3TME A;  2Q8R E;  3NP8 A;  1IW7 D;  5C6A A;  3MC0 B;  5K36 G;  5JEA G;  5JVH 3;  1JWS D;  1Y1W B;  1B50 A;  2A69 D;  2EDG A;  2F0U A;  1E2Z A;  5C4X B;  1JB3 A;  1I4G A;  1AEX A;  3W3A A;  4XXE A;  1QNK A;  3T53 B;  3UI2 A;  4IUV A;  5M5W B;  2B2T C;  4C3I B;  1H9S B;  1NR2 A;  1ONL A;  1V8Q A;  4BWG B;  2JEB I;  1RTN A;  5I2Y A;  1G6Z A;  3MXN A;  4FXG C;  4C3H B;  2NTT A;  3L3O C;  2ICI A;  4OGQ C;  1BO0 A;  3BYY B;  1PZJ D;  1VCI A;  2B2W C;  3GV3 A;  4KKT A;  2KED A;  2ZXO A;  4EQO A;  1BXT A;  4XT1 B;  4CKE A;  1Q90 A;  1PFN A;  2L4N A;  4R8N A;  4KY7 A;  3S9W A;  2A73 B;  5JPN C;  2EPB A;  4K5V A;  4C1N K;  1GUN A;  1K83 B;  2AQ1 B;  3KLR A;  3R3O A;  2NVX B;  3V2T A;  1F9P A;  3PMF A;  2SNM A;  3TBI B;  4U68 A;  3S15 B;  4GZY C;  1KAB A;  1E2V A;  2WV6 D;  2XNA C;  3KF8 A;  5E4X A;  5FO9 B;  3WDN A;  1I4P A;  4PQX A;  1TT2 A;  5LL6 S;  2KUM A;  2RVL A;  4MHE A;  2KEE A;  2EJM A;  1A6X A;  2N55 A;  2B8F A;  4BA1 I;  3K5O A;  4BBR B;  3VR3 A;  5KNB A;  1QJO A;  4K8J A;  1LLR D;  4IUU A;  5FLX L;  1D6E C;  1CM9 A;  1L0Y B;  4EGV A;  1I4R A;  5CV6 A;  4IUP A;  3QJY A;  1QNU A;  1XYI A;  2K04 A;  5IT9 L;  4UDU C;  3KK7 A;  3TP6 A;  4IUQ A;  5I2X A;  1TR5 A;  5C5M A;  1ZKO A;  2F3W A;  2B2V A;  5CV9 A;  5JEA J;  2E74 C;  1EEF D;  1HQM C;  2O5I C;  3BDC A;  3U9O A;  2XIW A;  2F0J A;  2PMZ B;  4ZUJ A;  5FKA C;  4FVM A;  1SBB B;  1G29 1;  1BDO A;  2B2V C;  1F2M A;  2KOL A;  4Z9C B;  3BVZ A;  2ID0 A;  2WP8 J;  4R8I A;  3I3C A;  1CZG A;  1M8A A;  5E1F A;  3K7A B;  3OSO A;  4KMU C;  1LT4 D;  1FYC A;  1TQO A;  2NBF A;  5EBC A;  3FDT A;  1RTO A;  1DYQ A;  3V05 A;  4ABN A;  3TSS A;  4E6I A;  4JK1 C;  2L55 A;  2NUC A;  4BBS B;  2K32 A;  3T16 A;  4DA2 A;  2F1M A;  3Q23 A;  1A3V A;  1OO9 B;  2EZV A;  2LY7 A;  3R93 A;  3DWQ A;  1EFI D;  1Z7T A;  2HQE A;  1ET9 A;  1HQR D;  5G3L F;  1F9R A;  4A3K B;  1LTG D;  3BDO A;  5I9O A;  1V1O A;  4XTC S;  1BOS A;  1B53 A;  3RZO B;  3NUC A;  4KY6 A;  2FIN B;  4DFA A;  1WTV A;  3VA7 A;  2SNS A;  3L7Z C;  1HFG A;  5C44 B;  3GTJ B;  2WKD A;  2BDO A;  3GQB A;  4CKC A;  1WTP A;  4XYQ A;  1G91 A;  1JOO A;  4WRD A;  3TP8 A;  1ROD A;  3C2P A;  2IX1 A;  1JCK B;  3GO5 A;  2X69 A;  2D62 A;  4O42 A;  1KDB A;  1U4P A;  4UAI A;  3MAQ A;  5IT9 E;  5KGU A;  1H9S A;  2JA8 B;  1FNV A;  4X3U A;  2ZT9 C;  1CHP D;  4K8I A;  2OT2 A;  3K57 A;  2B2Y A;  3OIP A;  4DXG A;  1YNJ D;  4K2K A;  5EPL A;  2PNR C;  5HGT A;  2NVQ B;  5T1I A;  2JYO A;  1IW7 C;  3VR2 A;  1A2T A;  3J80 L;  4CHT B;  4QF4 A;  3CRK C;  1JWM D;  3D4D A;  5EQ0 A;  2WKC A;  2B2U A;  2XVS A;  1PXU A;  3KLS X;  1LTI D;  2EYH A;  5EPJ A;  3K0Y A;  3VYT A;  1PTO H;  4J1M A;  4FF3 A;  1SMY D;  2YYZ A;  4KHZ A;  1Z6H A;  1TVX A;  2BA1 A;  1F2Z A;  3IFD A;  4TQU S;  1EY7 A;  1PZK D;  2EY6 A;  3LWE A;  3RLF A;  1MI2 A;  3EFX D;  1A3U A;  2C9O A;  2JA7 B;  4OHJ A;  2Q8I B;  4Q5V A;  5IIF A;  2J7Z A;  2JSO A;  3CRL C;  4HSP A;  1SAP A;  4IFD I;  2EYM A;  1J8I A;  2WIN B;  4BS9 A;  4HTH A;  4ZLT F;  4JBW A;  1LAB A;  5JAV A;  2EYO A;  1HUN A;  2B8G A;  3DUZ A;  3D4W A;  5ELD A;  3J7Y W;  2FMC A;  5C0X H;  1VF7 A;  3AU7 A;  1PTO C;  1DZ1 A;  2IT1 A;  2QEJ C;  3WOE A;  5ELF A;  3IFT A;  1FNU A;  4RGO S;  5C3E B;  1U4M A;  3PV0 A;  3SR1 A;  5CV7 A;  5CGK A;  1AZQ A;  1CZW A;  2K5Q A;  3G7L A;  3RUZ A;  4K5X A;  2CVR A;  3H09 A;  4DU9 A;  5FO8 B;  5K36 H;  1STN A;  1XTC D;  4K5W A;  1IYV A;  4CJ0 B;  2RA4 A;  4XYO A;  2F0T A;  4KJN A;  2M9V A;  2O2L D;  4EVO A;  1WTQ A;  2BE5 D;  4G7O C;  2SOB A;  1BUV T;  2QF7 A;  1EY8 A;  2IX0 A;  3E0J A;  4MIU A;  1F77 A;  2KEC A;  3GTG B;  2EYJ A;  1ENF A;  3EJI A;  1F2L A;  4A3M B;  2EYF A;  1PRT F;  2RSN A;  3FKI B;  2R92 B;  1YNJ C;  1ESR A;  3FPU B;  2PW7 A;  4ME5 A;  1TWF B;  3M7G A;  1B9N A;  4ZUI A;  2DN8 A;  1WCM B;  5C4H A;  1S5B D;  1SE3 A;  3MFG A;  1ZYR D;  4V0B A;  4L6T B;  2MJ8 A;  5EBD A;  1J9O A;  5IGG A;  3FVQ A;  5I6Y A;  5D65 A;  4KD3 A;  1FD7 D;  2Q8T A;  2YU9 B;  1NSN S;  3CKI B;  3C1F A;  1LT3 D;  1B1Z A;  3NWS A;  1I6V C;  4O1N A;  4FXK C;  1SYG A;  4IUN A;  4QUF A;  5CBE E;  5C0X J;  5COR A;  1M4V A;  1NR4 A;  1D1I A;  1KDA A;  4CJ1 B;  4RA8 A;  2PPB C;  2EVB A;  1HFN A;  2AQ2 B;  4DK0 A;  1B9M A;  3NQT A;  2F0M A;  3JAM L;  4B9W A;  1RJT A;  3BG3 A;  3CHB D;  3I91 A;  1PRT C;  2RDH A;  4DNT B;  3HOY B;  2H1E A;  1Q8I A;  2L12 A;  3SK6 A;  5IGB A;  1R9T B;  2G9H D;  1AFP A;  4A3D B;  2K1B A;  1U4L A;  4ULL A;  2E2J B;  2VNU D;  4C56 C;  2B2U C;  1JOR A;  1BF4 A;  3NWT A;  3OHX C;  3TN2 A;  2XRQ D;  4B08 A;  2V4D A;  4Y7N B;  2D9U A;  3VR5 A;  5C4J B;  3SVM A;  4Q0F A;  3W2D A;  2F0H A;  4IFD J;  4QCL A;  1SFO B;  3MFY A;  1MGS A;  2CHB D;  5T1G A;  3GD7 A;  3DWP A;  2EYL A;  3EQL C;  5E4W C;  3LX0 A;  2RDG A;  2B63 B;  2M00 A;  1PRT D;  3IAY A;  1EQT A;  1V1P A;  4EQP A;  1I6H B;  1JIC A;  3VA5 A;  4HMJ A;  3MXP A;  1HTL D;  3P20 A;  1EY9 A;  4A3I B;  2WAQ B;  4PV1 C;  3FEW X;  4LK1 C;  1SE4 A;  3MXU A;  5IOD A;  1EY6 A;  1SJE D;  1STA A;  2A6E C;  1NAP A;  1JOQ A;  3ERO A;  1Q3L A;  3Q6S A;  1HA5 A;  2A6H D;  1V1P B;  3OMG A;  1A15 A;  3MWY W;  1NUC A;  4NDX A;  4KK7 A;  1EU3 A;  1C48 A;  3NSW A;  3T56 B;  5FK9 C;  4KY5 A;  3GTM B;  1DCZ A;  2Z4I A;  4XIG S;  4XDX A;  5M3M B;  1GXD C;  3PO2 B;  4ZRZ A;  2AUK A;  3D4R A;  4MN3 A;  4OL7 A;  4J6H A;  4OIJ A;  2VUM B;  3I72 A;  5JPM C;  1JOK A;  2VB3 X;  3U9S A;  1SYC A;  2MPM A;  4V19 0;  1SNO A;  3AB9 A;  2XSC A;  1S4Z A;  4QUC A;  3N52 A;  1FR3 A;  1SYF A;  1UAP A;  1YNN D;  4P2C B;  1WTR A;  2HCI A;  1Q12 A;  1BCP F;  4LAA A;  2CW0 D;  1B2T A;  2E2D C;  1SJH D;  3M85 A;  2AUJ D;  2B2W A;  2FMM A;  4DN4 M;  2OF1 A;  1WTO A;  2EYP A;  1O7L A;  3J7A F;  2FFK B;  3MZ5 A;  1TKW B;  2HDL A;  1NCV A;  1TS2 A;  1VMP A;  1AW7 A;  1LV9 A;  1EY0 A;  4N9T A;  3HKZ B;  1EYA A;  4FF2 A;  2J0T D;  2F0D A;  4PMB A;  1ZXT A;  1DD2 A;  1DOL A;  5KNC A;  4EQN A;  1BCP D;  1SDF A;  1O7Y A;  3EA6 A;  5ELE A;  4PMC A;  2IW3 A;  3OPO A;  4WOR A;  2H4O A;  1TWC B;  3QOJ A;  4C3H G;  2A69 C;  4A3E B;  5ISR A;  1C8C A;  1DXM A;  1HRJ A;  1A3T A;  4DGZ A;  3HZX A;  3NK9 A;  1LTR D;  1IKL A;  1W6K A;  3A7A B;  1HXY D;  2K01 A;  2PQE A;  2IX3 A;  4H13 C;  2Z8L A;  4LMQ D;  1TS5 A;  1I4H A;  4CJ2 C;  2ICE C;  4IUT A;  2WII B;  3I4L A;  5JEA H;  1LTB D;  2LFN A;  3K6O A;  4OIK A;  3GTL B;  3S17 B;  2NYZ D;  2KA7 A;  2A68 C;  3I4M B;  1R4Q B;  1RF2 D;  5CC4 A;  5KIX A;  1TWG B;  3NXW A;  2X6G A;  2ENB A;  1EZ8 A;  3I90 A;  1EIH A;  2EJG C;  2IWH A;  3IL8 A;  4OO1 G;  3ONA B;  5KYL A;  3E5S A;  4BY7 B;  1PTO B;  3PO3 B;  4PNY A;  3P75 A;  1OXT A;  4B9X A;  3S2D B;  5G3L D;  3MVV A;  4TSS A;  1R4P B;  3HOW B;  2TMP A;  1STB A;  3TZU A;  1RKN A;  1GUS A;  1TWA B;  5K5P A;  3J80 E;  2F0F A;  4DF7 A;  3GTO B;  5JOB A;  1SYE A;  3K5M A;  3H3V C;  4K6D A;  3MHB A;  3SXH A;  5A2Q E;  3K5N A;  4DK1 A;  2K28 A;  1IKM A;  3HOV B;  1BQQ T;  2PCF B;  1DON A;  1JQY D;  2WAC A;  3H91 A;  1EQV A;  5FO7 B;  3GTK B;  4X3T A;  3Q0A A;  1KAA A;  3I8Z A;  2DY7 A;  4FO2 A;  4H44 C;  5CBA E;  3OWF A;  5J39 A;  1DM0 B;  1GUG A;  1CK1 A;  1V43 A;  2DY8 A;  3PIO 3;  2K6A A;  1EU4 A;  3PUW A;  3HP3 A;  5DM6 3;  2EY1 A;  4KJO A;  4QB4 A;  2A6H C;  1H9K A;  2QCP X;  1STH A;  3R8B A;  2NVT B;  1MBY A;  1KNE A;  4CKB A;  3Q24 A;  2F0Q A;  2JP1 A;  1WTW A;  3GTP B;  3M4Y A;  2HUG A;  1PDQ A;  3GV6 A;  3NPP A;  2LMC B;  5CV5 A;  1D5M C;  1SYB A;  2E75 C;  1Y8O B;  3J81 L;  4FF4 A;  1SNC A;  2PW5 A;  3P1H A;  4RH6 A;  1E0B A;  1PMR A;  1F2Y A;  1UEA B;  3HS0 C;  1MSH A;  3NTH A;  5CMD A;  3FPP A;  3ZYY X;  4HCS A;  5D14 A;  3X3M A;  5E3F A;  1LT6 D;  1IYU A;  3A56 A;  1PTO F;  2BA0 A;  1JC7 A;  2ZXP A;  5DEH A;  4C1N I;  4C3J G;  5IGF A;  2CQA A;  1TWH B;  4H0L C;  4X3S A;  2PO4 A;  4IZ8 A;  3S1N B;  3VYR A;  5F2D A;  5DM7 3;  1BBX C;  2PYK A;  5I6W A;  3DMU A;  5LL6 X;  1RD9 D;  2K33 A;  3TDQ A;  2NVY B;  4K14 A;  1SNQ A;  3RMH A;  5A35 A;  2BOS A;  1TII D;  3C46 A;  1Y8N B;  5KND A;  4CBV A;  2I07 B;  3QB3 A;  3RD4 A;  5HUR A;  2VB2 X;  3NBI A;  1I4Q A;  5BN5 A;  1PRT B;  4RCO A;  2PZW A;  1PFB A;  4HCE A;  1T5E A;  3DWA A;  3SEB A;  3P7J A;  3DEP A;  1BNZ A;  1O80 A;  3HG9 A;  4KD4 A;  1LO5 D;  2F0I A;  3S1Q B;  4KI0 A;  2QDB A;  1MSG A;  4BY1 B;  1SNM A;  4IUR A;  2KJX A;  2E76 C;  2E2I B;  1STG A;  4HMI A;  4RGT A;  4KTA A;  5KEE A;  3S1R B;  5IOC A;  1WVL A;  2DNE A;  4NP5 A;  5EKK A;  4HR7 B;  5I9P A;  1B3A A;  1D1K A;  3PUX A;  4DXF A;  1WTX A;  5EKI A;  1STE A;  4PMW A;  2KCN A;  3HEJ A;  2B2Y C;  1TU2 B;  3I4N B;  5DNF A;  1EY4 A;  4G4K A;  3KBX A;  3KLS A;  2I46 A;  3BYT B;  1HCZ A;  1TY0 A;  2KVM A;  2MUY A;  1A2U A;  1KTK A;  1F9Q A;  1VF5 C;  3OWE B;  5C0X I;  3SHL A;  2K7V A;  4ZKC B;  1D5Z C;  1EOT A;  2JXM B;  1EYD A;  1EY5 A;  1GUT A;  3CQZ B;  2JEA I;  1BR9 A;  4L8J A;  4G7H C;  3C3L A;  3TZD A;  1O78 A;  3G6J B;  3A8J E;  4N9P A;  2QIL A;  4M1U B;  4A3B B;  2RQX A;  2EOT A;  2X6L A;  1BCP C;  2JA5 B;  3A8K E;  4KHV A;  2NN6 I;  1D5X C;  1ML0 D;  4FNF A;  2F03 A;  3J7A V;  1L0X B;  1HPC A;  3ITP A;  1KNA A;  5IGE A;  1TS4 A;  5DAU A;  4A3G B;  2PZT A;  1QCB D;  5C3W A;  3GTQ B;  1IHZ A;  2O4X A;  1Y1V B;  1GUW A;  2RKS A;  5CR3 A;  4QMG A;  1E2W A;  2LS0 1;  4XT3 B;  2L11 A;  4IAL A;  5CYU A;  3QO2 A;  5JVG 3;  2EY5 A;  1I4X A;  5C0X G;  1H9R A;  4IQZ A;  3HOX B;  2L9H A;  4RGM A;  2K5W A;  3A55 A;  3SK8 A;  2NB0 A;  5C5L A;  1STY A;  3K58 A;  4C2M B;  2F4I A;  1OXS C;  5FOB B;  4BA2 I;  4FYD A;  4NW2 A;  5M5Y B;  2IJ0 A;  1JR0 D;  2IPK D;  4KN7 C;  3HOU B;  1ET6 A;  1DOM A;  4DAY A;  1H9M A;  4RKB A;  5CV8 A;  3R2T A;  2SDF A;  2R93 B;  1Z47 A;  2F0O A;  3ND8 A;  3SDZ A;  4NKL A;  1Y69 U;  4OO1 H;  4L63 B;  3K59 A;  1Y8P B;  3VYS A;  2NTS A;  4IFD H;  1ENC A;  5CV4 A;  1GHJ A;  1KLU D;  4HAE A;  2CW0 C;  4KV6 A;  1HTP A;  4RFB A;  2LKV A;  4F88 A;  5FLX E;  1XX8 A;  2R6G A;  2F3V A;  1X3Q A;  2R7Z B;  1WD1 A;  1KDC A;  3F2U A;  2PZU A;  1GOZ A;  1CTM A;  2F0S A;  3A7L A;  2N88 A;  2BCO A;  3TP7 A;  4A3J B;  1YNN C;  3H6M A;  2EJF C;  4I7Z C;  1X3P A;  1SYD A;  3QG1 A;  3DXJ C;  2EE1 A;  3GP7 A;  4RCN A;  2ZXR A;  2XWJ B;  1SMY C;  3R2I A;  4ZAI A;  3QIA A;  2KHS A;  4DAV A;  1F9S A;  2J4X A;  2TSS A;  3M7N A;  1FNW A;  2KCC A;  4RKL A;  1PLF A;  4HN7 A;  2WB1 B;  5LHY 1;  2L1B A;  3D6C A;  5C4Z A;  4ID6 A;  1I50 B;  3L9A X;  1S5D D;  3SK4 A;  1LT5 D;  3H0G B;  4ODG A;  2O5J C;  1G2S A;  4U67 3;  1GHK A;  2MHV A;  2OXP A;  3AMU A;  1QIL A;  2AWN A;  5M9O A;  2NZ1 D;  4ZQ3 A;  1SNP A;  3T4A C;  2E2H B;  1EWC A;  3BDL A;  4RAU C;  3S14 B;  4G57 A;  1HUM A;  2JE6 I;  1MD2 D;  3ND9 A;  3NHH A;  1I3Q B;  2JA6 B;  4C3I G;  2RSO A;  5JJZ A;  5ELB A;  1SND A;  4FXD A;  1TS3 A;  1U9R A;  3Q22 A;  3VR4 A;  1OXU A;  3M4O B;  3HOZ B;  1BCP B;  4KKS A;  3EVQ A;  2NN6 G;  2F0P A;  5J1Z A;  4H7B A;  3BVG A;  3NQI A;  1EIG A;  1OXX K;  2M2L A;  5I4D A;  1PZI D;  4A93 B;  4IN3 A;  5EPK A;  4ZYS A;  4ILW A;  2G9D A;  4AYB B;  3KBG A;  3JAM E;  2KQ3 A;  2NN6 H;  2QKI C;  3I73 A;  3NTK A;  1EYC A;  1ILQ A;  3S16 B;  2GA4 B;  4K2L A;  1LTA D;  4HSV A;  3CU7 A;  3N6R A;  5KRU A;  1DJR D;  4DNR B;  2L5T A;  5IGC A;  1CHQ D;  1HHV A;  2NWG A;  1QE6 A;  1PYW D;  3S2H B;  2F0V A;  1G8Z D;  4A3F B;  4WJW A;  4RHR A;  2A74 C;  4M8A A;  1JE4 A;  5ELC A;  3X3N A;  1XXG A;  1RHP A;  2A5H A;  3V96 A;  3OW7 A;  4K6L A;  3DM1 A;  3A54 A;  1S5F D;  5J22 A;  5D3D A;  1UNS A;  5KYI A;  3FRP B;  3QOL A;  1TY2 A;  4XQQ A;  3D3R A;  4TKO B;  2C5C A;  2K03 A;  5TSS A;  2B2T A;  1EL0 A;  1XWE A;  4QIW B;  3RZD B;  4G7Z C;  4F87 A;  4XQN A;  4RWS C;  3DHQ A;  4KKU A;  3HGB A;  1SXT A;  3M3Y B;  3OIQ A;  2D5D A;  2Z4H A;  2XN9 C;  2R61 A;  1RCV D;  3O13 A;  4XQJ A;  1D2B A;  1AP0 A;  4RGN A;  1CA6 A;  2MP1 A;  5A2Q L;  2XRS D;  3MA2 B;  2MGS A;  3BS1 A;  3MTS A;  1WD0 A;  4F8M A;  2RBM A;  1LTT D;  4FF1 A;  1ICW A;  3VYU A;  2K05 A;  3DEO A;  1LTS D;  4C3J B;  1S5E D;  3URY A;  2AWO A;  1QWY A;  1K8M A;  1U4R A;  4R9W A;  5COY A;  1CT1 D;  5IGD A;  1AZP A;  3BZD B;  1X32 A;  1PFM A;  4KN4 C;  5EKL A;  1CQV A;  3PUY A;  1C4Q A;  2A6E D;  1CI3 M;  2IL8 A;  1ZEQ X;  1G2T A;  1IL8 A;  1II3 A;  1W6J A;  1LAC A;  3A8I E;  2L0C A;  4LJZ C;  3I70 A;  4FP5 D;  3H94 A;  4TRD A;  3OMC A;  2D2C C;  2FHT A;  1CA5 A;  3NTI A;  1KLG D;  2F0L A;  1ESF A;  3T51 B;  1DOK A;  1SE2 A;  5NUC A;  4F7X A;  5EGT A;  3D6W A;  1JWU D;  2K5D A;  2F0N A;  3J81 E;  3HRZ C;  3T13 A;  1QB5 D;  2R3Z A;  1K8O A;  1QG7 A;  2F0W A;  3KUP A;  3WOF A;  5C3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...