1FR3A

The high resolution structure of a molybdate binding protein from sporomusa ovata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MKISGRNKLEATVKEIVKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords MOLYBDATE/TUNGSTATE BINDING PROTEIN
publication title Structure of the molybdate/tungstate binding protein mop from Sporomusa ovata.
pubmed doi rcsb
total genus 12
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fr3A00
1H9KA 2B8GA 2IT1A 2NN6I 2YYZA 3QIAA 3PUVA 3VR3A 1PMRA 1FR3A 3PV0A 2A6ED 2DN8A 3BDOA 3T56B 5JEAH 1H9RA 1H9JA 1Y8NB 3FPPA 2F1MA 4LK1C 1GHKA 3NE5B 4DK0A 3CRLC 5BN4A 1IYVA 4GZYC 2D62A 3EQLC 1DCZA 2A6HD 3SE0A 3ND8A 3BG3A 5JEAG 3A8IE 1Q90A 2V4DA 3LNNA 3VR6A 1BDOA 2D2CC 3ND9A 1ONLA 4KI0A 4LJZC 4TQUS 4DNTB 4G7HC 2O5JC 4KKTA 1GUOA 2A69D 2O5IC 1Q12A 2KCCA 4RCNA 3T53B 5BN5A 2DNCA 1YNNC 4DK1A 3MFYA 1OXSC 1Z7TA 1QJOA 2DNEA 4XIGS 2PPBC 3PUWA 4H44C 2EJFC 1TU2B 2EDGA 1K8MA 1GHJA 1HCZA 1V8QA 2BA1A 1Y69U 2AWOA 3D31A 2EVBA 3OW7A 1VCIA 2A6EC 1SMYC 1CFMA 5C0XH 1CTMA 1V43A 1HPCA 4HR7B 4TKOB 1IW7D 1HTPA 1ZYRC 1GUTA 2A68C 2JXMB 4KMUC 4KHZA 3N6RA 2KA7A 1FYCA 3A8KE 2BDOA 1OXXK 2A6HC 3A7AB 3H94A 3M85A 1OXTA 2B8FA 5C0XG 4BA1I 2NN6H 2LMCB 3W3AA 3TZUA 1VF7A 2E75C 5KNDA 3CRKC 5A35A 1O7LA 1LACA 3DXJC 4IQZA 1Y8OB 1G291 3FMCA 1EWHA 3QG1A 4IFDH 5BN3A 2Q8IB 4BA2I 2NN6G 1LABA 3MXUA 4G7ZC 1H9SB 1E2VA 3L7ZC 2BE5D 3PUYA 3I73A 3P20A 4XTCS 5KNCA 3M7NA 1H9SA 1E2ZA 3A7LA 2D5DA 1GJXA 4IFDG 2EJMA 4JBWA 3PUXA 2EJGC 2JEAI 4OO1H 1HQMC 3LWUA 1I6VC 1Z6HA 1Q1EA 3I4LA 3IFTA 5KNBA 1DXMA 2AUJD 3AB9A 4KN4C 5K36H 1K8OA 1OXUA 1VDZA 4OO1G 1O78A 1B9MA 2PCFB 3GQBA 1OXVA 3SDZA 2E76C 2A69C 3OPOA 1ZKOA 2AUKA 5K36G 2JE6I 1Y8PB 2R6GA 2L5TA 3HGBA 3I72A 3GD7A 3OOCA 1GUSA 3A8JE 2K33A 2JEBI 3KLRA 2K7VA 3IKJA 1E2WA 2A68D 4JK1C 1T5EA 3T51B 2BA0A 2ZT9C 4H13C 3WDNA 4DNRB 2BE5C 3M4YA 4KN7C 3VR2A 4OGQC 3VR4A 3QJYA 2E74C 3RLFA 1A6XA 4I7ZC 4G7OC 1H9MA 1B9NA 1Q1BA 3U9SA 2QF7A 1CI3M 3VR5A 4KKSA 2CW0C 1GUGA 4H0LC 3VA7A 1IW7C 3PUZA 1TKWB 4PV1C 1GUNA 1DD2A 1VF5C 2K32A 2PNRC 1IYUA 4KKUA 1YNJC 4L8JA 3D4RA
chains in the Genus database with same CATH superfamily
3W1GA 1R9TH 1BBXC 4A93B 5I6YA 4JPBW 3KFUA 1I50H 5BN4A 1NMGA 1HHVA 1EEID 3GTOH 4JI0Q 1YVCA 4G7HC 5DLQE 4DR2L 1EIFA 2KHJA 1PTOB 1D2BA 5M3FH 1FJGQ 3BU2A 2A5HA 3PO2G 3OMGA 1PXUA 1KNEA 2XN9C 3SR1A 1NUCA 1TU2B 1J5EL 1OO9B 3M3YB 1EY9A 4CDEC 1Q3LA 4A3GH 4DV7L 3DM3A 2Z6BA 3S2DH 2A6EC 1ZYRC 1GUTA 4KHZA 1BR9A 4KJNA 4YWKA 4DV4L 5M5WB 1J6QA 5J1ZA 3K8AA 2VW9A 2HIVA 3DHQA 4ZQ3A 2F0FA 4IQZA 1IBKL 4J8QA 2ZTEA 4OEMB 2L12A 3KF6B 4WJ3M 2OTLA 4IO9A 1G2SA 3P20A 1KDBA 4GN3B 4LUZA 3J80L 1PTOC 2JA7B 2F0DA 2RHSB 3HOWG 1I6HH 4X64Q 2N49A 4OO1H 4DAYA 4GOPC 4A3DG 2M00A 2XRSD 3U58A 2WAQG 2UXBQ 1A3UA 1B4OA 5IP9G 1Q7YC 1PRTC 2CWAA 4OWTB 3G7LA 4FVMA 3TP8A 3NELA 4U673 4DXFA 2R6GA 4CGYB 2DJGC 3I7FA 4Q0FA 3PO2B 2OQ0A 3T4AC 3H0GH 3HOYG 1OTCA 4XQJA 2KJXA 3RLFA 1KQSA 4UP9A 2BDNA 3NWSA 1VQOA 4K2LA 2JP1A 1NTGA 1YZ6A 3ZJYC 2VY3A 1AH9A 5KYLA 1ILQA 1XX8A 2PZTA 2WV6D 5EJWA 1B70B 3NTIA 5C0XI 1IW7C 2K32A 3E9IA 3CCQA 3J7A5 1D5XC 3CF5A 1XMQL 2D0OA 4RMFA 2IPKD 3BZDB 4X65Q 3WOFA 5GADC 5AJ3L 3UDIA 2QCPX 5EKLA 3URYA 1N34L 4GZYC 3H3VH 3KLSX 2QDBA 5DM73 1N33L 2L55A 3HOWB 3T53B 4A3BB 5IIFA 4XT1B 1SYCA 4ZUIA 5C0XJ 2R93B 4C3IB 2DNEA 1KNAA 4I65A 4HIDA 2I0QA 3HEJA 4KK7A 1YNXA 3K58A 2N8NA 3RN5A 4A3EB 1S4ZA 2K75A 4A3JG 2BA1A 1B53A 2AWOA 3D4WA 1HFGA 1KAWA 1D5MC 1G51A 4IUQA 4LF8Q 3L9AX 3DUZA 2WP8J 1E1OA 1IW7D 1FYCA 1B1ZA 3HOYB 4LF5L 2B3GA 3J7ZC 1LTID 2JA5B 1EY7A 2B63H 2LSSA 1SN8A 1ZEQX 5I2YA 4YCVA 1O7LA 3CCUA 4ALPA 5M3MH 4DR5Q 1XPUA 1F9SA 3DWAA 4DU9A 1D1IA 1VQPA 3KF6A 1HUMA 4AYBG 1GJXA 1AW7A 4N8FA 2CH4A 1ASZA 1K83H 1TWGB 4O0AA 3NPPA 1K0SA 4MNOA 4DV1L 2LFNA 1TXYA 2IHEA 1EWCA 1SYFA 4MTNA 4HTHA 1S5DD 4OO1G 1NJIC 4NW2A 1UE5A 1PH1A 2L5TA 5D14A 1TY0A 3GD7A 2JEBI 3A5UA 3E6ZX 5ELOA 1VQ8A 3WDNA 1U4RA 1WFQA 4TVAB 3R3OA 4WJWA 3FRPB 4I7ZC 1UEAB 4A3JB 4B3TL 2F0SA 4IUUA 2UXCL 1HZAA 3MXNB 4WRDA 1MGSA 4RH6A 4NKLA 1J8IA 1HTLD 1HNZL 5T1GA 1ENAA 1I5FA 1XNQL 1Y8NB 1A0IA 4HMJA 2KCNA 4JI6Q 2F0IA 3T1YL 1SYEA 1DJRD 4LUVA 1CZWA 2ZTCA 2E2HH 2WINB 1X32A 4HSPA 1TIID 3A55A 2Z4HA 3LNNA 2F0TA 2ES2A 3MC0B 1BUVT 2B2WC 3MXPA 4JYAL 4DK1A 5C3EB 1JWSD 1NMFA 2WB1G 1JOQA 1KL9A 4X3TA 1VQ4A 5FKAC 2EZVA 1UWVA 2AQ1B 1WTPA 5LMUQ 3HOXH 4LF4L 4F7XA 1TWFB 1ET9A 5FJ8H 3NUCA 3K5OA 1WCMB 3I4MB 3FPUB 5I2XA 1CKNB 4BA1I 3CCLA 4B3SL 2NVYB 3OWFA 1B50A 2HCCA 3HRZC 3CRKC 1S5BD 2Z1CA 3HKZE 5DAUA 1K9MC 1NR4A 2EIFA 2VZAA 2B63G 1GXDC 3PGZA 4RCOA 2CVRA 1EL0A 5BR8L 3SK4A 1ENCA 4FXKC 2B2VA 1L0XB 3RZDB 5M3MG 3GTQB 2EYHA 1U4LA 2Y0SB 2F0PA 2CW0D 1LTLA 3K7AB 3IFTA 4RAUC 1XXGA 2UXDL 2AUJD 1STAA 5M9OA 1LTAD 4JI2L 3M4OB 4N9PA 4QJFA 5K36H 4DA2A 4GNXB 1PDQA 3OW2A 3HOZB 3HKSA 4XQQA 5KYIA 1IKLA 1TWCH 1BCPC 5IOCA 2UUBQ 2LXKA 3CP0A 1SYBA 4DXGA 3K59A 4OL7A 3I72A 4AH6A 4LFBL 1O80A 4UDUC 4DUZL 4H13C 5D65A 4OELB 1D1KA 2VXWA 2WKDA 3C1FA 3R2IA 4OIJA 4QCLA 1SNDA 3C46A 1R4PB 4QL5A 4AQYL 1IYUA 3WOEA 5G3LF 1YNJC 3D4RA 3MXNA 2B8GA 4V190 3T56B 3NK9A 3A54A 1TY2A 1SNQA 3BZCA 2EOTA 5M5YB 2JA8H 2A73B 3CRLC 4RFBA 4BBRH 2RCNA 4C3HB 2ALYB 5K5PA 4JV5Q 5JJZA 4KHPL 4ZLTF 2Z6KC 1FGUA 3ND9A 2O5JC 3KLSA 1BCPD 1LTRD 1PH6A 1Q12A 5I6WA 1JJGA 1XJVA 4B3ML 1O7ZA 1NAPA 4JI1Q 1YJ9A 2K03A 3J81j 2BCOA 4A3KB 4EQOA 2UUCL 1BF4A 1HCZA 3TBIB 3JAME 2B2UC 3KLWA 4QY7A 1YITA 4ME5A 2AQ2B 3GTGB 1HNXL 1RHPA 1PH9A 4C3JB 3AEVA 2KECA 1STYA 2Q8TA 2YU9B 1JJ2A 5LMNW 3S2HH 2A68C 3N6RA 2PI2A 3GV6A 1YNJD 3HOXG 1VF7A 4IJHA 4A4IA 1CKNA 2KHSA 4CJ2C 1WVLA 5FJ8G 1E7ZA 2VUMB 2Q8RE 1LTGD 5G3LD 2ZM6L 2JK8A 5C5LA 5COYA 5EPLA 2B29A 1WTRA 3CKIB 3U9OA 2E5LL 1EZ8A 3K6OA 1O7IA 3V96A 4DR7L 1IBLL 1VMPA 2E2IB 1JWUD 1KD1C 4JC0A 1SE4A 4JBJA 3G6JB 1XTCD 2NZOA 4GNXA 4X66Q 2QW7A 3UDFA 2JA6H 1QOHA 2I46A 4A3MB 5K36G 5DEHA 4QB4A 2JE6I 3JAMi 2BH2A 1CKOA 2XRQD 1HZCA 1DOMA 1IXRA 2A68D 1BVSA 4B08A 1A15A 2BE5C 4KN7C 3ULPA 2F0EA 3QJYA 1N32L 2F4VL 1PFSA 4S3SA 1H9MA 2P5ZX 4FF4A 1RL2A 3HOUH 3C1EA 2ATWA 2UXBL 1GUGA 3HOVH 1JQYD 1TKWB 1SE3A 5FO9B 4CBVA 4HEDA 4K5XA 2RF4A 2NVQH 4HJ7A 1PTOH 2HQLA 3NEMA 1PLFA 3E9HA 1SEBD 2VB3X 2PZWA 1X56A 3VR3A 4XXEA 4FF1A 1S5ED 2B2TC 4K5WA 2QDLA 3EIVA 4LK1C 4QQBX 2HHHQ 1CQVA 2A6HD 3BG3A 3J81E 2JA8G 2ZTDA 4LJZC 3FHWA 5C44H 3I55A 4BBRG 3E0EA 4YCWA 1EQVA 1Z7TA 1QJOA 3Q23A 4B3RL 2AWNA 2KHIA 1D8LA 4JI7Q 5M5XH 2EDGA 1I3QB 4DR4Q 5C4JB 1PZJD 1X3GA 5CV7A 3SK6A 3S15H 3RD4A 4UP7A 3CC7A 2CKZB 2EYPA 4R4OA 3T1HQ 3Q0AA 3JAML 1SDFA 2O4XA 4TKOB 3L0OA 4KMUC 5EQ0A 2ZXOA 4LFAL 1HJPA 2SDFA 2RQXA 2ICEC 1CT1D 3CHBD 3FKIB 1K0RA 3TZUA 3PIPA 3GDEA 2OWOA 4JBKA 4LW1A 4DV0Q 2F0MA 5C4XB 1EWHA 1SNCA 2A74C 4DAVA 1QB5D 1VQHA 3I3CA 1Q82C 2FHTA 2MNAA 3NTKA 1XPRA 1GD7A 2KCMA 1HR0Q 2F4IA 1EYCA 3RZOH 2B2YC 4KV6A 3S17H 1R4QB 5IGFA 4R1JA 2F0OA 1DXMA 2TSSA 3M7GA 4IZ8A 4BWGB 2GN5A 1GUWA 2AKWB 4X62Q 4ABNA 3VYRA 3S1RH 2HUGA 1LO5D 5EBCA 4K8IA 1CSPA 1BBWA 1JR0D 3KJOA 1YHAA 2EYLA 4DKAC 1UE7A 2K04A 4RGOS 4EVOA 3I56A 1QUQB 2JA6G 4JK1C 3IKJA 1IBML 2PI2E 2WIIB 1YHBA 4OGQC 4HJAA 2L0CA 2L4NA 1LYLA 1DGSA 1B9NA 2F0KA 1SNOA 5JEAJ 2NVXB 1FGBD 1ICFB 2K28A 1LTSD 3M4PA 3N52A 1RJTA 2XNAC 4EX5A 4KKUA 1L2FA 3HOUG 3MEFA 1F2LA 3VR6A 4A3BH 1VQAA 3HOVG 4DUYL 1CA6A 3BJUA 3S1NB 2Y0SE 2FXQA 1PMRA 1GKHA 2RCFA 4FDBA 4MIUA 3PO3H 3K0YA 1V9PA 3NE5B 5IE8A 1Y1VB 3AQQA 2K52A 3H09A 3EQLC 3VYUA 3SE0A 4BY1B 4K0KL 4DV2L 1HNWQ 5D3DA 1XNRQ 1CK1A 1G6ZA 1SNPA 3VA5A 3WWVA 4DR1L 1W2BA 4JI4Q 2IW3A 1C7YA 3J81L 1TR5A 2DNCA 3K80C 1NY4A 3J80i 1ET6A 5C44G 1V8QA 3E0JA 2NYZD 4BY7B 1IL8A 3S1MB 3PF4A 3CCEA 3NHHA 3GTPB 3GO5A 4JG2A 1SMYC 5C0XH 4GKKL 1TWAB 3UE1A 2EY2A 2RVLA 4JOIA 3S1QB 1Q8KA 4J15A 1WD1A 3W3AA 3NBHB 2SNMA 2HT1A 5CMDA 2UU9Q 3STBC 5IT9L 1LUZA 4R4CA 4JI3L 1JOKA 1VQIA 1K8AC 3MXUA 3QOJA 3L7ZC 3TEHB 4XTCS 1EY8A 3NQTA 3TREA 3CD6A 1Q8IA 3SVMA 4KY5A 1WTQA 3QWNA 4UY8C 4JBWA 1RIPA 2EXZA 3LWUA 3M4QA 1Q1EA 3I4LA 1SBBB 5ELFA 3PIP3 3GTJB 1YJNA 3MTSA 1DYQA 3PF5A 3DEPA 4DGZA 4EGVA 2KUMA 3F1ZA 3NBIA 5LMNQ 1E3PA 3TP5A 3GTLH 3SDZA 1VQKA 4OXPA 4KTAA 2PW5A 4LWCA 1ZKOA 2GVBA 1PVOA 1EOVA 1PTOF 4BXXH 1Y8PB 3HGBA 1VS0A 1SMYD 2I5MX 1H95A 3KYHC 2VL6A 3LX0A 3T51B 5CYUA 1QUQA 2BA0A 2ZJQA 3M4YA 4Y7NB 5DNFA 1BO0A 4K6DA 1Q1BA 4KKSA 4JI5Q 1PRTF 5C3XA 2QEJC 2XWJB 4YCUA 4ZK9B 4PV1C 4IPGA 2Z0SA 2IHFA 2TMPA 1Y14B 3GTMH 1SFOB 2DUDA 4K14A 1EUJA 1JJCB 1A2TA 3GP7A 2E2JB 1PFBA 1JT8A 1L0WA 2A6ED 4HCSA 1ZXTA 2F1MA 1B3QA 1E1TA 1ZYRD 2K1BA 2VQEL 3H15A 4QUFA 3ND8A 4POGA 3PO3G 2V4DA 1NSNS 4O2DA 4K2KA 3MXGA 4RCNA 5BN5A 4FF3A 2QGQA 1VQ6A 4U68A 4FNFA 5JJKA 4P74A 1U0LA 1F2MA 1TWHH 2DJFC 2EJFC 3NWTA 3GTKH 5IGBA 1PTOD 4LF9L 5IYDH 3CAMA 1FD7D 1SSOA 2PZUA 5NUCA 3L3OC 4LFCL 3EA6A 2JA9A 2E2DC 3U4ZA 1DM0B 2XSCA 5CBEE 1EYGA 5JVG3 2LS01 2JXMB 1VQEA 3CC4A 1AN8A 1BBUA 3A7AB 2J7ZA 4PMCA 4WORA 1PRTD 4NMZA 5C0XG 1KDAA 2QEXA 4DAMA 1N36L 3NBHA 4JI1L 1Y8OB 3BVZA 4A3DB 4PNYA 4A3IH 4LF7L 4BA2I 2WAQB 5M3FG 4QGUA 2C9OA 1H9SB 4YHHL 1E2ZA 2OQKA 3EROA 4GLAC 4IPDA 1NCVA 4DNIA 3ZYYX 4K6LA 1Z6HA 2HCIA 5JOBA 4EQ5A 2CCZA 4A3GG 2HIXA 1Y1WH 1WTOA 3PCOB 4APVA 1CHQD 2LY7A 4LF6Q 1M8AA 1L0YB 1OXVA 3D3RA 4HIOA 4KJOA 1B8AA 4RGNA 2MO1A 4OX9Q 2F0UA 1V1OA 5IWAQ 3OOCA 4DV3L 1GUSA 2VNUD 4OONA 2ZT9C 1KLUD 4A3FH 4X3KA 1CSQA 3ERSX 5FO7B 3CQZH 2UUAQ 2CFMA 1R9TB 1VQNA 4IALA 1VQCA 4L8JA 4MTKA 4GKJQ 1KRSA 1I50B 2K6AA 4FF2A 3CW2C 4R8NA 3TS0A 2H5XA 4DFAA 3GTOB 1EY0A 4QIWB 2F3VA 3TP7A 1EQQA 5ELCA 5ELNA 5M3FB 4NXNL 2VQFQ 1HQRD 2RSOA 2EY1A 3H0GG 5CBAE 3R93A 1I94Q 1GUOA 5DM63 2B2VC 3AU7A 2SNSA 2N78A 4XIGS 3CCRA 5GQOA 4A3GB 1X3FA 1ESFA 2K5HA 2NUCA 2NVTB 1I4QA 3S2DB 1EY5A 4C2MH 3TS2A 1Y69U 4DR3L 4ZRZA 4RHRA 4M8AA 3LWEA 4UHVA 1CUKA 2I5LX 3OSOA 1CFMA 2F52A 3S16H 4HIMA 4DR6L 1SLJA 1MBYA 3A8KE 3M85A 2Q2TA 1FNVA 3KBGA 4AYBB 1U5KA 3MEHA 4BBSH 1PH2A 2MP1A 2R7DA 4XQNA 1I4HA 2Q8IB 3W5OA 3BVMA 4G7ZC 1I6HB 2LXJA 5IGEA 3M7NA 1H9SA 3DWPA 5CV5A 3A74A 1S5CD 1C9OA 3HZXA 4ULLA 4RGMA 1QVGA 2R92H 3OHXC 4G4KA 2Z9HA 4DR2Q 4NXML 3SK5A 2WACA 2QKIC 4B9XA 4HJ9A 3P75A 1Y1WG 2A69C 2AUKA 3DWQA 3H0GB 4NPSA 1JE5A 2PMZB 2ZXRA 2D9UA 2F0VA 4EQNA 3A8JE 3Q24A 1CM9A 1TQOA 1JB7A 2CWPA 4AIMA 2AMCB 2OCEA 3VR4A 1HR0L 3F2CA 3V2TA 4G7OC 4DV4Q 1SNMA 5FO8B 3S24A 4QF4A 1BCPF 3I4NH 4X62L 4POFA 1X65A 3SGIA 3RUZA 4BS9A 1YBYA 2IT1A 4YY3L 3O13A 1RD9D 1H9RA 3FPPA 4PMWA 4OWXB 1M90C 4IFDI 2EQSA 4DK0A 1CQFA 1GHKA 1IYVA 3BYYB 2D0PA 2D62A 3UDGA 2WB1B 1X3QA 2F0JA 4DV5Q 3VYTA 1HUNA 4KI0A 4YWMA 5IP7H 2RBMA 2A69D 3IL8A 2K5VA 2GVAA 2R7ZH 4H44C 1LLRD 5H1SE 1K8MA 1EY6A 4F8MA 2YTVA 2EY5A 3A0JA 1RF2D 2DY8A 2F03A 3D31A 3OW7A 1YJWA 4GNXC 4IFDJ 1HPCA 4PQXA 3B6YA 2B63B 1Q81C 2XIWA 1T5XD 2KA7A 3S14H 2XVSA 2K4KA 2B8FA 5M3MB 4IN3A 1HA5A 3TN2A 1UNSA 5A35A 3MWYW 3OIQA 1XMQQ 5BN3A 1C0AA 4BBSG 1JCKB 5AJ3Q 3F8TA 1K83B 3ICEA 2Z8LA 1UE1A 2RA4A 4ZKCB 1EYAA 4PMBA 1N34Q 5CV4A 1VQGA 1Q86C 2JEAI 1M1KC 1F9RA 3L2PA 4JI0L 4L63B 5EKIA 1VQLA 3J7AF 3BYTB 2IX0A 1U4MA 1O78A 1FJGL 2R92G 4IURA 4P73A 4RKBA 3EVQA 4GN5A 1TS4A 2E8GA 3OYYA 3PIOA 1VQ7A 1EOTA 5JJLA 2AQ3B 1STNA 2K5NA 1B7YB 2CHBD 4LF5Q 4X3SA 3RN2A 4X3UA 2A19A 2WAQE 4XYOA 5J22A 5EKKA 1MSHA 3K5LA 1H9KA 4R8IA 2NN6I 1PH3A 3J7AV 3I4NG 1RCVD 3MVVA 5LL6S 2E2HB 5JEAH 5C5MA 3AYHB 1GO3E 4A93H 2KENA 1D6EC 5ISRA 4X64L 1HRJA 3A8IE 4DV1Q 2XGTA 2L11A 1X54A 2IJ0A 3U50C 4DN4M 2DY7A 4TSSA 1WTVA 5FLXc 1YNNC 3P7JA 3MFYA 3I91A 5ELEA 3DLLA 4A76A 5IP7G 4R4TA 1P8LA 3GV3A 1CA5A 3HOXB 2K01A 5KIXA 1G6PA 2G9HD 3F2BA 2R7ZG 3QR8A 2Q2UA 3AFQA 3M3YH 3EJIA 3IAYA 2L15A 2IL8A 4B3TQ 1KLGD 5HGTA 1XYIA 2BOSA 4IOCA 3SHLA 3RLNA 1PHJA 3G71A 2UXCQ 2RDFA 3IRBA 3FVQA 3OTOQ 1LACA 3F2UA 5M5WH 2I5HA 5FOBB 4TRDA 1KHIA 1HNZQ 2BE5D 1QVFA 1XNQQ 5KRUA 4X65L 3A7LA 4C56C 4IUPA 3JAMc 2F0NA 1PFMA 2OXPA 3PUXA 1K3RA 4R4QA 3E5SA 1HQMC 1IL2A 2IWHA 2A8VA 2DGYA 2JA7H 4JYAQ 1HH2P 2PO4A 3DM1A 4P2CB 1RTOA 1W6KA 1MHWC 1D5ZC 1K73C 4LMQD 5CV9A 2M2LA 1WTHA 4DNRB 2KQ3A 4LF4Q 1SYGA 4OHJA 4AYBE 3PO2H 4LF8L 3QO2A 5FK9C 2PQAB 3J81i 1QE6A 3U9SA 1AZQA 1HZBA 3VR5A 5CORA 2FFKB 4DF7A 1TS2A 1M4VA 3PIO3 3P1HA 2WFWA 4J1MA 2JA8B 4DR5L 3NTHA 4LUOA 5BR8Q 4JOIC 4BBRB 3D4DA 1SJHD 5C4HA 4CHTB 2IX1A 4NB3A 3Q8DA 1V1QA 3QB3A 2AHOB 2RSNA 3R8BA 4O1NA 1QNUA 2UXDQ 5JEAG 1XMOQ 2ID0A 4JI2Q 1BDOA 4A93G 4H02A 4DV6Q 1UEBA 2HDMA 3EFXD 3HKZG 4ME3A 1L1OB 3TRZA 4HCEA 1MJCA 4JCVE 3ERQA 3HOWH 4J6HA 1Z9FA 2R93H 4LNQA 4C3IH 1VQMA 2N88A 3S2HB 4L6TB 1MIUA 1C48A 1LTTD 3KBXA 3MA2B 4A3EH 2Q2HA 1II3A 1V43A 1QG7A 3PSIA 1BQQT 4E6IA 1LTBD 3I2ZA 4PZ8A 1EFID 3K5NA 2F0HA 3MHBA 2RKSA 3LGJA 4AQYQ 1I94L 4RWSC 4CKCA 1E24A 3HOYH 3I90A 4JI8Q 2JA5H 3FMCA 1K3BC 5C6AA 1AP0A 2VB2X 2WB1E 3RMHA 4FXGC 1RODA 4ZAIA 2EYOA 2EJMA 4JI6L 3ER0A 1EQRA 2QILA 1SAPA 5KNBA 4IUTA 4ILWA 2A1AA 4CJ0B 2K5QA 2JA6B 1TWGH 1K8OA 4A3CH 4B3MQ 5IT9c 2XTIA 3KJPA 4P71A 1WJJA 2UUCQ 3JC66 2KEDA 4Q5VA 3RNUA 3ULJA 3HKZB 2EE1A 4KD4A 1HNXQ 1W3SA 2PNHA 2OTJA 3HOUB 4YIJA 3HOVB 1A6XA 5LMUL 1YHQA 2PQAA 2NVQB 5D3IB 1QVCA 1MSGA 4CDCC 4NDXA 4CDFC 4K8JA 3VA7A 3UI2A 3PUZA 2N3SA 4A3JH 1VF5C 2PNRC 2ZM6Q 4PZ7A 4GOPB 2K50A 5JAVA 4N8X1 3KUPA 3HFZB 3X3MA 4CDDC 3QIAA 2OEOA 1S5FD 3J80c 2E5LQ 2DN8A 3CCSA 2KBNA 3W2DA 4ZYSA 2NVTH 4EQPA 1PRTB 4DR7Q 1GVPA 1IBLQ 4FP5D 1STEA 2KOLA 1ASYA 5C44B 5T1IA 2EYJA 4RA8A 4ZCKA 2VS1A 2KCTA 1ONLA 2F3IA 4TQUS 3E3XA 2MFIA 3STBD 5M5XB 3OMCA 4V0BA 3IFDA 5TSSA 1L1OA 1PH4A 2L9HA 3S15B 5GROA 2UUBL 1GHJA 5C3EH 2EY6A 4HN7A 4R9WA 1E22A 1SXTA 5GAHC 3BDCA 2EVBA 4LAAA 1EFWA 5J39A 1N32Q 2F4VQ 4A3BG 2R93G 4C3IG 1UE6A 4QUCA 4DV5L 2WKCA 2MHVA 1AEXA 2BDOA 5E1FA 1DZ1A 1VQJA 4A3EG 1TWFH 3BZKA 3I4MH 1WCMH 1PYSB 2KVMA 2JSOA 2PW7A 2NVYH 1TS5A 1LABA 2F0QA 1KXLA 3I73A 3RZOB 4FYDA 3S17B 2JA5G 2D5DA 2MJ8A 1EY4A 1JORA 2QA4A 3CPFA 4UAIA 4K5VA 1A8VA 4JV5L 1I6VC 1IZ6A 4R4IA 3RZDH 1WOCA 3GTQH 3S1RB 1N9WA 3BS1A 3K7AH 4ZUJA 2C5CA 1X55A 2MGSA 1B2TA 2ZXPA 5E3FA 3M4OH 4B3RQ 1ML0D 1SROA 2HD3A 1MJEA 3HOZH 4A3CG 3KK7A 1SE2A 1F9QA 1LT5D 2MQHA 2R7FA 1FNUA 3F2DA 4HAEA 3TQYA 1MD2D 1PYBA 1F77A 1EWIA 1SMXA 1UAPA 4LFAQ 1CI3M 2JJQA 4P75A 3FP9A 1IKMA 4FO2A 2F0WA 4H7BA 1U4PA 3EN2A 4GOPA 1BOSA 3PO3B 2K14A 1JE4A 4MZ9A 1FR3A 1LV9A 3BDOA 3T16A 2FINB 1QZGA 1ILPA 4DPGA 1SR3A 1KDCA 2I07B 3T13A 4PG3A 4BXXG 5LHY1 5M5YH 1QCBD 4GLXA 1EIGA 3K0XA 3AMUA 2ASBA 4C3HH 3K7UC 1EIYB 5F2DA 1K8GA 4OO1I 1A63A 2ZJRA 1OXSC 4X66L 3PUWA 2Q2IA 4IJLA 1B44D 4RG1A 1IBMQ 4A3KH 3CPWA 5HURA 2RHQB 1J9OA 1WI5A 2NWGA 4WJ4A 5C3WA 5C3EG 1YI2A 4HR7B 3GTGH 4C3JH 4HJ8A 1RDPD 3NP8A 5IGDA 2YU9H 2H1EA 4O42A 5KNDA 3DXJC 4IPHA 3CMAA 1EU3A 1NNXA 1G291 4DUYQ 4IFDH 3M9BA 2VUMH 3MZ5A 1S3OA 3I4MG 1WCMG 5E4XA 4OWWB 4K0KQ 3I8ZA 4DV2Q 1AE3A 5ELBA 5JPNC 2HHHL 1E0BA 3X3NA 5IYDG 1XWEA 1AZPA 4DR1Q 3AB9A 5CC4A 3GTLB 4Z9CB 3H3VI 4B9WA 1VDZA 1A2UA 1PH8A 2E2IH 2PCFB 2RDHA 3OTOL 1WTXA 2HQEA 4GLVB 2Y0SG 5E4WC 3CXCA 1HXYD 3K57A 4JI7L 4DK3C 4DR4L 2K33A 3NENA 5IYBH 4A3MH 1T5EA 1Q46A 4C1NI 4OIKA 1NBWA 1T9HA 3VR2A 3HOZG 4A3IG 1FNWA 4GKKQ 2EPBA 3T1HL 1I4GA 1PH7A 5CR3A 2QF7A 2CW0C 3GTMB 4H0LC 3KOJA 2YTXA 3SK8A 1GUNA 1PYWD 1SE8A 5J3BA 1D7QA 1HR0W 4JI3Q 1LT3D 4ID6A 4DV0L 2NZ1D 1J5EQ 4MN3A 1LT4D 1VQFA 3CU7A 2JYOA 3PUVA 5I9OA 2V1CC 3HP3A 3BVGA 3PV0A 3H91A 3H6MA 4DV7Q 5IODA 1H9JA 2G5DA 4IOAA 2JN4A 1SRUA 1BCPB 3CCVA 3TMEA 2N55A 2M9VA 1S40A 2EYMA 1X3EA 4JVZA 3UDXA 3D6WA 4DNTB 1EIHA 2F3WA 2L1BA 5EPJA 1TWHB 4A3FG 4GS3A 3EBEA 4HJ5A 3GTKB 1IBKQ 2PPBC 4C3HG 1PA6A 2SEBD 3TP6A 1YEZA 2XWBB 5E7NA 5IYCH 1I3QH 2IX3A 5C4JH 1MI2A 1WYDA 4F88A 1XMOL 3SEBA 3C2PA 4A3KG 1VQBA 1EZ6A 1JOOA 4IUNA 4L5TA 5A2QE 1I4RA 1OXTA 2YTYA 4QMGA 4DV6L 4A75A 5C4ZA 2NN6H 5HGQA 4A3IB 2E75C 3QOLA 4C3JG 4HIKA 3Q6SA 5FLMH 3FKIH 1TVXA 3NSWA 4JW0A 1F2YA 3I70A 5IY0A 4X6AH 2B2WA 5C4XH 2K5WA 1G8ZD 3KDFB 1KIXA 2VQEQ 4G57A 4IFDG 1PH5A 3K5MA 1Y1WB 4MHEA 5CV6A 2VUMG 1EQTA 1HNWL 3TSSA 5FLXE 1NR2A 1XNRL 1BKBA 1OXUA 4JI4L 4YWLA 4JBMA 3H3VC 4P72A 1AE2A 1B3AA 3GQBA 2E76C 4JI8L 3OPOA 4LF9Q 1RKNA 4A3FB 1G91A 3KLRA 4N9TA 4LFCQ 1VQ9A 2X6LA 3A56A 3AFPA 3CQZB 1KC8C 1DONA 4KY6A 1IHZA 5IYBG 2CQOA 4A3MG 3ITPA 3K81C 5JPMC 1N33Q 3VYSA 4ODGA 2NBFA 4PZ6A 2NTTA 5CGKA 4WFN3 2FJ2A 4DK6C 1N36Q 1CHPD 1FVIA 3V05A 1DD2A 1EYDA 3SXHA 2ENBA 3G6EA 2NVXH 2UU9L 4LF7Q 3FDTA 5L37A 4YHHQ 3BDLA 5I4DA 1QZHA 1C8CA 2YV5A 1YIJA 2CQAA 1CZGA 3CC2A 3S1NH 4HSVA 1DCZA 4M1UB 2NB0A 4L5QA 5GAEC 3CCMA 2D2CC 1Y1VH 5IGCA 4L5RC 2X69A 4BY1H 2O5IC 1PFNA 2KCCA 5LL6X 4XYQA 4C2MB 1I4PA 5LMNL 1V1PB 4DV3Q 3KF8B 5KEEA 2O2LD 4F87A 4GN4B 3S16B 1K28A 1MKHA 2G9DA 3D6CA 1VCIA 1C4QA 1STHA 3RLOA 4BY7H 1CTMA 3CCJA 3OWEB 3S1MH 1HTPA 4BBSB 4DAPA 1JMCA 1QWYA 1DOLA 3GTPH 5IYCG 1OXXK 2A6HC 3H94A 1ESRA 1UUPA 4JI5L 1TWAH 2X6GA 4Y52H 5EGTA 1WD0A 1I4XA 3S1QH 2CH4W 2IY5B 5A2QL 1QILA 2H4OA 2Z6KA 2NN6G 1VQ5A 2MPMA 1SYDA 3MAQA 2JQOA 2R92B 5FLMG 3NQIA 3FKIG 3KDFA 2K05A 4HMIA 2ZJPA 2EJGC 1BNZA 4NXNQ 1PZID 4KY7A 1HFNA 5C4XG 1N8RC 2Z4IA 1KRTA 2B2UA 2EXDA 2OF1A 4CJ1B 1KAAA 1A3VA 1BXTA 3D0FA 4A3LH 1B9MA 3GTJH 5FLXL 2PYKA 2J4XA 3I4OA 1AFPA 1PV4A 4DR3Q 4QIWE 2F0GA 2FMCA 3PQIA 3J7YW 2BH8A 3T1YQ 4DR6Q 1A3TA 1F2ZA 2E74C 1LM0A 2OT2A 3I4NB 4Y7NH 4FXDA 5I9PA 1S72A 1YNND 1TWCB 4RGTA 5AFWA 2J0TD 4XT3B 1XPOA 2RDGA 2YYZA 4UP8A 5IGGA 2EYFA 4CKBA 1SFOH 2GA4B 3TZDA 2ICIA 2E2JH 1W6JA 1JWMD 1Q90A 4NXMQ 1GM5A 1A62A 5IT9E 2HDLA 3C3LA 3W1BA 3FEWX 4KKTA 2R7ZB 4B3SQ 2SOBA 1RTNA 4RHSA 1WTWA 4LF6L 1Y1VG 3OIPA 1FL0A 4ZKBB 4BY1G 5GAGC 5EAYA 1LT6D 3U4VA 3CMEA 1GOZA 1V1PA 4OX9L 1JC7A 5IWAL 2MUYA 3KF8A 3D8GA 2K5DA 1DOKA 1Z47A 3S14B 1NE3A 4NP5A 1QNKA 2F0LA 3ONAB 3G48A 2B2TA 3NXWA 2UUAL 4BY7G 3G4SA 2LMCB 1X3PA 4CKEA 4KLKA 1VMCA 2PMZE 3DMUA 5ELDA 3J80E 1F9PA 2B39A 3HG9A 1PZKD 3QG1A 1ENFA 3Q22A 3UE0A 4YY3Q 4GKJL 1XTDA 1U9RA 1HA6A 3PUYA 1E2VA 1P16A 2C35B 5KNCA 1G2TA 4IPCA 4A3DH 4LFBQ 1TS3A 1O7YA 4DUZQ 1KTKA 1CKMA 2PQEA 4DAYB 2NZHA 5IP9H 4C1NK 5EBDA 2FMMA 1JB3A 2NTSA 2VQFL 4IUVA 5JVH3 4KN4C 3J81c 3TDQA 3A5ZB 4UPAA 4I7AA 4XDXA 3DEOA 1SJED 2KEEA 1JICA 1EU4A 1TT2A 1STBA 1STGA 3MFGA 4RKLA 2MO0A 2R3ZA 4A3LG 5CV8A 1EEFD 1VQDA 1X9NA 2K7VA 1E2WA 4L5SA 1X6OA 5EPKA 1L1OC 1IYJB 1ICWA 3ULLA 4KHPQ 3PMFA 5KGUA 1KABA 3S9WA 2LKVA 1HZ9A 3VDYA 4KD3A 5HY6A 3RR5A 5JJIA 3R2TA 4KHVA 2B2YA 2R61A 2JA7G 3HS0C
chains in the Genus database with same CATH topology
1BBXC 4A93B 5I6YA 5BN4A 1HHVA 1EEID 4G7HC 1PTOB 1D2BA 2A5HA 3OMGA 1PXUA 1KNEA 2XN9C 3SR1A 1NUCA 1TU2B 1OO9B 3M3YB 1EY9A 1Q3LA 2A6EC 1ZYRC 1GUTA 4KHZA 1BR9A 4KJNA 5M5WB 5J1ZA 3DHQA 4ZQ3A 2F0FA 4IQZA 4J8QA 2L12A 1G2SA 3P20A 1KDBA 3J80L 1PTOC 2JA7B 2F0DA 4OO1H 4DAYA 2M00A 2XRSD 1A3UA 1B4OA 1PRTC 3G7LA 4FVMA 3TP8A 4U673 4DXFA 2R6GA 4CGYB 4Q0FA 3PO2B 3T4AC 4XQJA 2KJXA 3RLFA 2BDNA 3NWSA 4K2LA 2JP1A 5KYLA 1ILQA 1XX8A 2PZTA 2WV6D 5EJWA 3NTIA 5C0XI 1IW7C 2K32A 1D5XC 2IPKD 3BZDB 3WOFA 2QCPX 5EKLA 3URYA 4GZYC 3KLSX 2QDBA 5DM73 2L55A 3HOWB 3T53B 4A3BB 5IIFA 4XT1B 1SYCA 4ZUIA 5C0XJ 2R93B 4C3IB 2DNEA 1KNAA 4I65A 3HEJA 4KK7A 3K58A 4A3EB 1S4ZA 2BA1A 1B53A 2AWOA 3D4WA 1HFGA 1D5MC 4IUQA 3L9AX 3DUZA 2WP8J 1IW7D 1FYCA 1B1ZA 3HOYB 2JA5B 1LTID 1EY7A 1ZEQX 5I2YA 1O7LA 1F9SA 3DWAA 4DU9A 1D1IA 1HUMA 1GJXA 1AW7A 1TWGB 3NPPA 2LFNA 1EWCA 1SYFA 4OO1G 4HTHA 1S5DD 4NW2A 2L5TA 5D14A 1TY0A 3GD7A 2JEBI 3E6ZX 3WDNA 1U4RA 3R3OA 4WJWA 3FRPB 4I7ZC 1UEAB 4A3JB 2F0SA 4IUUA 4WRDA 1MGSA 4RH6A 4NKLA 1J8IA 1HTLD 5T1GA 1ENAA 1Y8NB 4HMJA 2KCNA 2F0IA 1SYEA 1DJRD 1CZWA 2WINB 1X32A 4HSPA 1TIID 3A55A 2Z4HA 3LNNA 2F0TA 3MC0B 1BUVT 2B2WC 3MXPA 4DK1A 5C3EB 1JWSD 1JOQA 4X3TA 5FKAC 2EZVA 2AQ1B 1WTPA 4F7XA 1TWFB 1ET9A 3NUCA 3K5OA 1WCMB 3I4MB 3FPUB 5I2XA 4BA1I 2NVYB 3OWFA 1B50A 2HCCA 3HRZC 3CRKC 1S5BD 2Z1CA 5DAUA 1NR4A 1GXDC 4RCOA 1EL0A 2CVRA 3SK4A 1ENCA 2B2VA 4FXKC 1L0XB 3RZDB 3GTQB 2EYHA 1U4LA 2Y0SB 2F0PA 2CW0D 3K7AB 3IFTA 4RAUC 1XXGA 2AUJD 1STAA 5M9OA 1LTAD 3M4OB 4N9PA 5K36H 4DA2A 1PDQA 3HOZB 4XQQA 5KYIA 1IKLA 1BCPC 5IOCA 1SYBA 4DXGA 3K59A 4OL7A 3I72A 1O80A 4UDUC 4H13C 5D65A 1D1KA 2VXWA 2WKDA 3C1FA 3R2IA 4OIJA 4QCLA 1SNDA 3C46A 1R4PB 1IYUA 3WOEA 5G3LF 1YNJC 3D4RA 3MXNA 2B8GA 4V190 3T56B 3NK9A 3A54A 1TY2A 1SNQA 2EOTA 5M5YB 2A73B 3CRLC 4RFBA 5K5PA 4C3HB 5JJZA 4ZLTF 3ND9A 2O5JC 3KLSA 1BCPD 1LTRD 1Q12A 5I6WA 1O7ZA 1NAPA 2K03A 2BCOA 4A3KB 4EQOA 1BF4A 1HCZA 3TBIB 3JAME 2B2UC 4ME5A 2AQ2B 3GTGB 1RHPA 4C3JB 2KECA 1STYA 2Q8TA 2YU9B 2A68C 3N6RA 3GV6A 1YNJD 1VF7A 4CJ2C 2KHSA 1WVLA 2VUMB 2Q8RE 1LTGD 5G3LD 5C5LA 5COYA 5EPLA 1WTRA 3CKIB 3U9OA 1EZ8A 3K6OA 3V96A 1VMPA 2E2IB 1JWUD 1SE4A 3G6JB 1XTCD 1QOHA 2I46A 4A3MB 5K36G 5DEHA 4QB4A 2JE6I 2XRQD 1DOMA 2A68D 4B08A 1A15A 2BE5C 4KN7C 2F0EA 3QJYA 4S3SA 1H9MA 4FF4A 3C1EA 1GUGA 1JQYD 1TKWB 1SE3A 5FO9B 4CBVA 4HEDA 4K5XA 1PTOH 1PLFA 1SEBD 2VB3X 2PZWA 3VR3A 4XXEA 4FF1A 1S5ED 2B2TC 4K5WA 4LK1C 1CQVA 2A6HD 3BG3A 3J81E 4LJZC 1EQVA 1Z7TA 1QJOA 3Q23A 2AWNA 2EDGA 1I3QB 5C4JB 1PZJD 5CV7A 3SK6A 3RD4A 2EYPA 3Q0AA 3JAML 1SDFA 2O4XA 4TKOB 4KMUC 5EQ0A 2ZXOA 2SDFA 2RQXA 2ICEC 1CT1D 3CHBD 3FKIB 3TZUA 2F0MA 5C4XB 1EWHA 1SNCA 2A74C 4DAVA 1QB5D 3I3CA 2FHTA 3NTKA 2F4IA 1EYCA 2B2YC 4KV6A 1R4QB 5IGFA 2F0OA 1DXMA 2TSSA 3M7GA 4IZ8A 4BWGB 1GUWA 4ABNA 3VYRA 2HUGA 1LO5D 5EBCA 4K8IA 1JR0D 2EYLA 2K04A 4RGOS 4EVOA 4JK1C 3IKJA 2WIIB 4OGQC 2L0CA 2L4NA 1B9NA 2F0KA 1SNOA 5JEAJ 2NVXB 1FGBD 2K28A 1LTSD 3N52A 1RJTA 2XNAC 4KKUA 1F2LA 3VR6A 1CA6A 3S1NB 1PMRA 4MIUA 3K0YA 3NE5B 1Y1VB 3H09A 3EQLC 3VYUA 3SE0A 4BY1B 5D3DA 1CK1A 1G6ZA 1SNPA 3VA5A 2IW3A 3J81L 1TR5A 2DNCA 1ET6A 1V8QA 3E0JA 2NYZD 4BY7B 1IL8A 3S1MB 3NHHA 3GTPB 3GO5A 1SMYC 5C0XH 1TWAB 2EY2A 2RVLA 3S1QB 1WD1A 3W3AA 2SNMA 5CMDA 5IT9L 1JOKA 3MXUA 3QOJA 3L7ZC 4XTCS 1EY8A 3NQTA 1Q8IA 3SVMA 4KY5A 1WTQA 3QWNA 4JBWA 2EXZA 3LWUA 1Q1EA 3I4LA 1SBBB 5ELFA 3PIP3 3GTJB 3MTSA 1DYQA 3DEPA 4DGZA 4EGVA 2KUMA 3NBIA 3TP5A 3SDZA 4KTAA 2PW5A 1ZKOA 1PTOF 1Y8PB 3HGBA 1SMYD 3LX0A 3T51B 5CYUA 2BA0A 3M4YA 4Y7NB 5DNFA 1BO0A 4K6DA 1Q1BA 4KKSA 1PRTF 5C3XA 2QEJC 2XWJB 4ZK9B 4PV1C 2TMPA 1SFOB 4K14A 3GP7A 2E2JB 1A2TA 1PFBA 2A6ED 4HCSA 1ZXTA 2F1MA 1ZYRD 2K1BA 4QUFA 3ND8A 2V4DA 1NSNS 4K2KA 3MXGA 4RCNA 5BN5A 4FF3A 4U68A 4FNFA 1F2MA 2EJFC 3NWTA 5IGBA 1PTOD 1FD7D 1SSOA 2PZUA 5NUCA 3L3OC 3EA6A 2E2DC 1DM0B 2XSCA 5CBEE 5JVG3 2LS01 2JXMB 1AN8A 3A7AB 2J7ZA 4PMCA 4WORA 1PRTD 4NMZA 5C0XG 1KDAA 3NBHA 1Y8OB 3BVZA 4A3DB 4PNYA 4BA2I 2WAQB 2C9OA 1H9SB 1E2ZA 3EROA 1NCVA 3ZYYX 4K6LA 1Z6HA 2HCIA 5JOBA 1WTOA 1CHQD 2LY7A 1M8AA 1L0YB 1OXVA 3D3RA 4KJOA 4RGNA 2F0UA 1V1OA 3OOCA 2VNUD 1GUSA 2ZT9C 1KLUD 4X3KA 5FO7B 1R9TB 4IALA 4L8JA 1I50B 2K6AA 4FF2A 4R8NA 4DFAA 3GTOB 1EY0A 4QIWB 2F3VA 3TP7A 5ELCA 5M3FB 1HQRD 2RSOA 2EY1A 5CBAE 3R93A 1GUOA 5DM63 2B2VC 3AU7A 2SNSA 4XIGS 4A3GB 1ESFA 2NUCA 2NVTB 1I4QA 3S2DB 1EY5A 1Y69U 4ZRZA 4RHRA 4M8AA 3LWEA 3OSOA 1CFMA 1MBYA 3A8KE 3M85A 1FNVA 3KBGA 4AYBB 3MEHA 2MP1A 4XQNA 1I4HA 2Q8IB 4G7ZC 3BVMA 1I6HB 5IGEA 3M7NA 1H9SA 3DWPA 5CV5A 1S5CD 3HZXA 4ULLA 4RGMA 3OHXC 4G4KA 3SK5A 2WACA 2QKIC 4B9XA 3P75A 2A69C 2AUKA 3DWQA 3H0GB 2PMZB 2ZXRA 2D9UA 2F0VA 4EQNA 3A8JE 3Q24A 1CM9A 1TQOA 3VR4A 3V2TA 4G7OC 1SNMA 5FO8B 4QF4A 1BCPF 3RUZA 4BS9A 2IT1A 3O13A 1RD9D 1H9RA 3FPPA 4PMWA 4IFDI 1GHKA 4DK0A 1CQFA 1IYVA 3BYYB 2D62A 2WB1B 1X3QA 2F0JA 3VYTA 1HUNA 4KI0A 2RBMA 2A69D 3IL8A 4H44C 1LLRD 1K8MA 1EY6A 4F8MA 2EY5A 1RF2D 2DY8A 2F03A 3D31A 3OW7A 4IFDJ 1HPCA 4PQXA 2B63B 2XIWA 1T5XD 2KA7A 2XVSA 2B8FA 5M3MB 4IN3A 1HA5A 3TN2A 1UNSA 5A35A 3MWYW 3OIQA 5BN3A 1JCKB 1K83B 2Z8LA 2RA4A 4ZKCB 1EYAA 4PMBA 5CV4A 2JEAI 1F9RA 4L63B 5EKIA 3J7AF 3BYTB 2IX0A 1U4MA 1O78A 4IURA 4RKBA 3EVQA 1TS4A 1EOTA 2AQ3B 1STNA 2CHBD 4X3SA 4X3UA 4XYOA 5J22A 5EKKA 1MSHA 3K5LA 1H9KA 4R8IA 2NN6I 3J7AV 1RCVD 3MVVA 5LL6S 2E2HB 5JEAH 5C5MA 1D6EC 5ISRA 1HRJA 3A8IE 2L11A 2IJ0A 4DN4M 2DY7A 4TSSA 1WTVA 1YNNC 3P7JA 3MFYA 3I91A 5ELEA 3GV3A 1CA5A 3HOXB 2K01A 5KIXA 2G9HD 3EJIA 3IAYA 2IL8A 1KLGD 5HGTA 1XYIA 2BOSA 3SHLA 2RDFA 3FVQA 1LACA 3F2UA 5FOBB 4TRDA 2BE5D 5KRUA 3A7LA 4C56C 4IUPA 2F0NA 1PFMA 2OXPA 3PUXA 3E5SA 1HQMC 2IWHA 2PO4A 3DM1A 4P2CB 1RTOA 1W6KA 1D5ZC 4LMQD 5CV9A 2M2LA 4DNRB 2KQ3A 1SYGA 4OHJA 3QO2A 5FK9C 1QE6A 3U9SA 1AZQA 3VR5A 5CORA 2FFKB 4DF7A 1TS2A 1M4VA 3PIO3 3P1HA 4J1MA 2JA8B 3NTHA 4BBRB 3D4DA 1SJHD 5C4HA 4CHTB 2IX1A 3QB3A 2RSNA 3R8BA 4O1NA 1QNUA 5JEAG 2ID0A 1BDOA 2HDMA 3EFXD 4HCEA 3ERQA 4J6HA 2N88A 3S2HB 4L6TB 1C48A 1LTTD 3KBXA 3MA2B 1II3A 1V43A 1QG7A 1BQQT 4E6IA 1LTBD 1EFID 3K5NA 2F0HA 3MHBA 2RKSA 4RWSC 4CKCA 3I90A 3FMCA 5C6AA 1AP0A 2VB2X 3RMHA 4FXGC 1RODA 4ZAIA 2EYOA 2EJMA 2QILA 1SAPA 5KNBA 4IUTA 4ILWA 4CJ0B 2K5QA 2JA6B 1K8OA 2KEDA 4Q5VA 3HKZB 2EE1A 4KD4A 3HOUB 4YIJA 3HOVB 1A6XA 2NVQB 5D3IB 1MSGA 4NDXA 4K8JA 3VA7A 3UI2A 3PUZA 1VF5C 2PNRC 5JAVA 3KUPA 3X3MA 3QIAA 2OEOA 1S5FD 2DN8A 3W2DA 4ZYSA 4EQPA 1PRTB 4FP5D 1STEA 2KOLA 5C44B 5T1IA 2EYJA 4RA8A 1ONLA 4TQUS 5M5XB 3OMCA 4V0BA 3IFDA 5TSSA 2L9HA 3S15B 1GHJA 2EY6A 4HN7A 4R9WA 1SXTA 3BDCA 2EVBA 4LAAA 5J39A 4C3IG 4QUCA 2WKCA 2MHVA 1AEXA 2BDOA 5E1FA 1DZ1A 2KVMA 2JSOA 2PW7A 1TS5A 1LABA 2F0QA 3I73A 3RZOB 4FYDA 3S17B 2D5DA 2MJ8A 1EY4A 1JORA 4UAIA 4K5VA 1I6VC 3S1RB 3BS1A 4ZUJA 2C5CA 2MGSA 1B2TA 2ZXPA 5E3FA 1ML0D 3KK7A 1SE2A 1F9QA 1LT5D 1FNUA 4HAEA 1MD2D 1F77A 1UAPA 1CI3M 1IKMA 4FO2A 2F0WA 4H7BA 1U4PA 1BOSA 3PO3B 1JE4A 1FR3A 1LV9A 3BDOA 3T16A 2FINB 1ILPA 1KDCA 2I07B 3T13A 5LHY1 1QCBD 1EIGA 3AMUA 5F2DA 4OO1I 1OXSC 3PUWA 1B44D 5HURA 1J9OA 2NWGA 5C3WA 4HR7B 1RDPD 3NP8A 5IGDA 2H1EA 4O42A 5KNDA 3DXJC 1EU3A 1G291 4IFDH 3MZ5A 5E4XA 3I8ZA 5ELBA 5JPNC 1E0BA 3X3NA 1XWEA 1AZPA 3AB9A 5CC4A 3GTLB 4Z9CB 4B9WA 1VDZA 1A2UA 2PCFB 2RDHA 1WTXA 2HQEA 5E4WC 1HXYD 3K57A 2K33A 1T5EA 4C1NI 4OIKA 3VR2A 1FNWA 2EPBA 1I4GA 5CR3A 2QF7A 2CW0C 3GTMB 4H0LC 3SK8A 1GUNA 1PYWD 1LT3D 4ID6A 2NZ1D 4MN3A 1LT4D 3CU7A 2JYOA 3PUVA 5I9OA 3HP3A 3BVGA 3PV0A 3H91A 3H6MA 5IODA 1H9JA 1BCPB 3TMEA 2N55A 2M9VA 2EYMA 3D6WA 4DNTB 1EIHA 2F3WA 2L1BA 5EPJA 1TWHB 3GTKB 2PPBC 4C3HG 2SEBD 3TP6A 2XWBB 2IX3A 1MI2A 4F88A 3SEBA 3C2PA 1EZ6A 1JOOA 4IUNA 5A2QE 1I4RA 1OXTA 4QMGA 5C4ZA 2NN6H 4A3IB 2E75C 3QOLA 4C3JG 3Q6SA 1TVXA 3NSWA 1F2YA 3I70A 2B2WA 2K5WA 1G8ZD 4G57A 4IFDG 3K5MA 1Y1WB 4MHEA 5CV6A 1EQTA 3TSSA 5FLXE 1NR2A 1OXUA 3H3VC 1B3AA 3GQBA 2E76C 3OPOA 1RKNA 4A3FB 1G91A 3KLRA 4N9TA 2X6LA 3A56A 3CQZB 1DONA 4KY6A 1IHZA 3ITPA 5JPMC 3VYSA 5CGKA 4ODGA 2NBFA 2NTTA 4WFN3 2FJ2A 1DD2A 1CHPD 3V05A 1EYDA 3SXHA 2ENBA 3FDTA 3BDLA 5I4DA 1C8CA 2CQAA 1CZGA 4HSVA 1DCZA 4M1UB 2NB0A 2D2CC 5IGCA 2X69A 2O5IC 1PFNA 2KCCA 5LL6X 4XYQA 4C2MB 1I4PA 1V1PB 5KEEA 2O2LD 4F87A 3S16B 2G9DA 3D6CA 1VCIA 1C4QA 1STHA 1CTMA 3OWEB 1HTPA 4BBSB 4DAPA 1QWYA 1DOLA 1OXXK 2A6HC 3H94A 1ESRA 1UUPA 2X6GA 5EGTA 1WD0A 1I4XA 5A2QL 1QILA 2H4OA 2NN6G 2MPMA 1SYDA 3MAQA 2R92B 3NQIA 2K05A 4HMIA 2EJGC 1BNZA 1PZID 4KY7A 1HFNA 2Z4IA 2B2UA 2OF1A 4CJ1B 1KAAA 1A3VA 1BXTA 1B9MA 5FLXL 2PYKA 2J4XA 1AFPA 2F0GA 2FMCA 3J7YW 1A3TA 1F2ZA 2E74C 2OT2A 3I4NB 4FXDA 5I9PA 1YNND 1TWCB 4RGTA 5AFWA 2J0TD 4XT3B 2RDGA 2YYZA 5IGGA 2EYFA 4CKBA 2GA4B 3TZDA 2ICIA 1W6JA 1JWMD 1Q90A 5IT9E 2HDLA 3C3LA 3FEWX 4KKTA 2R7ZB 2SOBA 1RTNA 4RHSA 1WTWA 3OIPA 4ZKBB 1LT6D 1GOZA 1V1PA 1JC7A 2MUYA 3KF8A 3D8GA 2K5DA 1DOKA 1Z47A 3S14B 4NP5A 1QNKA 2F0LA 3ONAB 2B2TA 3NXWA 2LMCB 1X3PA 4CKEA 1VMCA 3DMUA 5ELDA 3J80E 1F9PA 2B39A 3HG9A 1PZKD 3QG1A 1ENFA 3Q22A 1U9RA 1HA6A 3PUYA 1E2VA 1G2TA 5KNCA 1TS3A 1O7YA 1KTKA 2PQEA 4C1NK 5EBDA 2FMMA 1JB3A 2NTSA 4IUVA 5JVH3 4KN4C 3TDQA 4XDXA 3DEOA 1SJED 2KEEA 1JICA 1EU4A 1TT2A 1STBA 1STGA 3MFGA 4RKLA 2R3ZA 5CV8A 1EEFD 2K7VA 1E2WA 5EPKA 1ICWA 3PMFA 5KGUA 1KABA 3S9WA 2LKVA 4KD3A 3R2TA 4KHVA 2B2YA 2R61A 3HS0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9K A;  2B8G A;  2IT1 A;  2NN6 I;  2YYZ A;  3QIA A;  3PUV A;  3VR3 A;  1PMR A;  1FR3 A;  3PV0 A;  2A6E D;  2DN8 A;  3BDO A;  3T56 B;  5JEA H;  1H9R A;  1H9J A;  1Y8N B;  3FPP A;  2F1M A;  4LK1 C;  1GHK A;  3NE5 B;  4DK0 A;  3CRL C;  5BN4 A;  1IYV A;  4GZY C;  2D62 A;  3EQL C;  1DCZ A;  2A6H D;  3SE0 A;  3ND8 A;  3BG3 A;  5JEA G;  3A8I E;  1Q90 A;  2V4D A;  3LNN A;  3VR6 A;  1BDO A;  2D2C C;  3ND9 A;  1ONL A;  4KI0 A;  4LJZ C;  4TQU S;  4DNT B;  4G7H C;  2O5J C;  4KKT A;  1GUO A;  2A69 D;  2O5I C;  1Q12 A;  2KCC A;  4RCN A;  3T53 B;  5BN5 A;  2DNC A;  1YNN C;  4DK1 A;  3MFY A;  1OXS C;  1Z7T A;  1QJO A;  2DNE A;  4XIG S;  2PPB C;  3PUW A;  4H44 C;  2EJF C;  1TU2 B;  2EDG A;  1K8M A;  1GHJ A;  1HCZ A;  1V8Q A;  2BA1 A;  1Y69 U;  2AWO A;  3D31 A;  2EVB A;  3OW7 A;  1VCI A;  2A6E C;  1SMY C;  1CFM A;  5C0X H;  1CTM A;  1V43 A;  1HPC A;  4HR7 B;  4TKO B;  1IW7 D;  1HTP A;  1ZYR C;  1GUT A;  2A68 C;  2JXM B;  4KMU C;  4KHZ A;  3N6R A;  2KA7 A;  1FYC A;  3A8K E;  2BDO A;  1OXX K;  2A6H C;  3A7A B;  3H94 A;  3M85 A;  1OXT A;  2B8F A;  5C0X G;  4BA1 I;  2NN6 H;  2LMC B;  3W3A A;  3TZU A;  1VF7 A;  2E75 C;  5KND A;  3CRK C;  5A35 A;  1O7L A;  1LAC A;  3DXJ C;  4IQZ A;  1Y8O B;  1G29 1;  3FMC A;  1EWH A;  3QG1 A;  4IFD H;  5BN3 A;  2Q8I B;  4BA2 I;  2NN6 G;  1LAB A;  3MXU A;  4G7Z C;  1H9S B;  1E2V A;  3L7Z C;  2BE5 D;  3PUY A;  3I73 A;  3P20 A;  4XTC S;  5KNC A;  3M7N A;  1H9S A;  1E2Z A;  3A7L A;  2D5D A;  1GJX A;  4IFD G;  2EJM A;  4JBW A;  3PUX A;  2EJG C;  2JEA I;  4OO1 H;  1HQM C;  3LWU A;  1I6V C;  1Z6H A;  1Q1E A;  3I4L A;  3IFT A;  5KNB A;  1DXM A;  2AUJ D;  3AB9 A;  4KN4 C;  5K36 H;  1K8O A;  1OXU A;  1VDZ A;  4OO1 G;  1O78 A;  1B9M A;  2PCF B;  3GQB A;  1OXV A;  3SDZ A;  2E76 C;  2A69 C;  3OPO A;  1ZKO A;  2AUK A;  5K36 G;  2JE6 I;  1Y8P B;  2R6G A;  2L5T A;  3HGB A;  3I72 A;  3GD7 A;  3OOC A;  1GUS A;  3A8J E;  2K33 A;  2JEB I;  3KLR A;  2K7V A;  3IKJ A;  1E2W A;  2A68 D;  4JK1 C;  1T5E A;  3T51 B;  2BA0 A;  2ZT9 C;  4H13 C;  3WDN A;  4DNR B;  2BE5 C;  3M4Y A;  4KN7 C;  3VR2 A;  4OGQ C;  3VR4 A;  3QJY A;  2E74 C;  3RLF A;  1A6X A;  4I7Z C;  4G7O C;  1H9M A;  1B9N A;  1Q1B A;  3U9S A;  2QF7 A;  1CI3 M;  3VR5 A;  4KKS A;  2CW0 C;  1GUG A;  4H0L C;  3VA7 A;  1IW7 C;  3PUZ A;  1TKW B;  4PV1 C;  1GUN A;  1DD2 A;  1VF5 C;  2K32 A;  2PNR C;  1IYU A;  4KKU A;  1YNJ C;  4L8J A;  3D4R A; 
#chains in the Genus database with same CATH topology
 3W1G A;  1R9T H;  1BBX C;  4A93 B;  5I6Y A;  4JPB W;  3KFU A;  1I50 H;  5BN4 A;  1NMG A;  1HHV A;  1EEI D;  3GTO H;  4JI0 Q;  1YVC A;  4G7H C;  5DLQ E;  4DR2 L;  1EIF A;  2KHJ A;  1PTO B;  1D2B A;  5M3F H;  1FJG Q;  3BU2 A;  2A5H A;  3PO2 G;  3OMG A;  1PXU A;  1KNE A;  2XN9 C;  3SR1 A;  1NUC A;  1TU2 B;  1J5E L;  1OO9 B;  3M3Y B;  1EY9 A;  4CDE C;  1Q3L A;  4A3G H;  4DV7 L;  3DM3 A;  2Z6B A;  3S2D H;  2A6E C;  1ZYR C;  1GUT A;  4KHZ A;  1BR9 A;  4KJN A;  4YWK A;  4DV4 L;  5M5W B;  1J6Q A;  5J1Z A;  3K8A A;  2VW9 A;  2HIV A;  3DHQ A;  4ZQ3 A;  2F0F A;  4IQZ A;  1IBK L;  4J8Q A;  2ZTE A;  4OEM B;  2L12 A;  3KF6 B;  4WJ3 M;  2OTL A;  4IO9 A;  1G2S A;  3P20 A;  1KDB A;  4GN3 B;  4LUZ A;  3J80 L;  1PTO C;  2JA7 B;  2F0D A;  2RHS B;  3HOW G;  1I6H H;  4X64 Q;  2N49 A;  4OO1 H;  4DAY A;  4GOP C;  4A3D G;  2M00 A;  2XRS D;  3U58 A;  2WAQ G;  2UXB Q;  1A3U A;  1B4O A;  5IP9 G;  1Q7Y C;  1PRT C;  2CWA A;  4OWT B;  3G7L A;  4FVM A;  3TP8 A;  3NEL A;  4U67 3;  4DXF A;  2R6G A;  4CGY B;  2DJG C;  3I7F A;  4Q0F A;  3PO2 B;  2OQ0 A;  3T4A C;  3H0G H;  3HOY G;  1OTC A;  4XQJ A;  2KJX A;  3RLF A;  1KQS A;  4UP9 A;  2BDN A;  3NWS A;  1VQO A;  4K2L A;  2JP1 A;  1NTG A;  1YZ6 A;  3ZJY C;  2VY3 A;  1AH9 A;  5KYL A;  1ILQ A;  1XX8 A;  2PZT A;  2WV6 D;  5EJW A;  1B70 B;  3NTI A;  5C0X I;  1IW7 C;  2K32 A;  3E9I A;  3CCQ A;  3J7A 5;  1D5X C;  3CF5 A;  1XMQ L;  2D0O A;  4RMF A;  2IPK D;  3BZD B;  4X65 Q;  3WOF A;  5GAD C;  5AJ3 L;  3UDI A;  2QCP X;  5EKL A;  3URY A;  1N34 L;  4GZY C;  3H3V H;  3KLS X;  2QDB A;  5DM7 3;  1N33 L;  2L55 A;  3HOW B;  3T53 B;  4A3B B;  5IIF A;  4XT1 B;  1SYC A;  4ZUI A;  5C0X J;  2R93 B;  4C3I B;  2DNE A;  1KNA A;  4I65 A;  4HID A;  2I0Q A;  3HEJ A;  4KK7 A;  1YNX A;  3K58 A;  2N8N A;  3RN5 A;  4A3E B;  1S4Z A;  2K75 A;  4A3J G;  2BA1 A;  1B53 A;  2AWO A;  3D4W A;  1HFG A;  1KAW A;  1D5M C;  1G51 A;  4IUQ A;  4LF8 Q;  3L9A X;  3DUZ A;  2WP8 J;  1E1O A;  1IW7 D;  1FYC A;  1B1Z A;  3HOY B;  4LF5 L;  2B3G A;  3J7Z C;  1LTI D;  2JA5 B;  1EY7 A;  2B63 H;  2LSS A;  1SN8 A;  1ZEQ X;  5I2Y A;  4YCV A;  1O7L A;  3CCU A;  4ALP A;  5M3M H;  4DR5 Q;  1XPU A;  1F9S A;  3DWA A;  4DU9 A;  1D1I A;  1VQP A;  3KF6 A;  1HUM A;  4AYB G;  1GJX A;  1AW7 A;  4N8F A;  2CH4 A;  1ASZ A;  1K83 H;  1TWG B;  4O0A A;  3NPP A;  1K0S A;  4MNO A;  4DV1 L;  2LFN A;  1TXY A;  2IHE A;  1EWC A;  1SYF A;  4MTN A;  4HTH A;  1S5D D;  4OO1 G;  1NJI C;  4NW2 A;  1UE5 A;  1PH1 A;  2L5T A;  5D14 A;  1TY0 A;  3GD7 A;  2JEB I;  3A5U A;  3E6Z X;  5ELO A;  1VQ8 A;  3WDN A;  1U4R A;  1WFQ A;  4TVA B;  3R3O A;  4WJW A;  3FRP B;  4I7Z C;  1UEA B;  4A3J B;  4B3T L;  2F0S A;  4IUU A;  2UXC L;  1HZA A;  3MXN B;  4WRD A;  1MGS A;  4RH6 A;  4NKL A;  1J8I A;  1HTL D;  1HNZ L;  5T1G A;  1ENA A;  1I5F A;  1XNQ L;  1Y8N B;  1A0I A;  4HMJ A;  2KCN A;  4JI6 Q;  2F0I A;  3T1Y L;  1SYE A;  1DJR D;  4LUV A;  1CZW A;  2ZTC A;  2E2H H;  2WIN B;  1X32 A;  4HSP A;  1TII D;  3A55 A;  2Z4H A;  3LNN A;  2F0T A;  2ES2 A;  3MC0 B;  1BUV T;  2B2W C;  3MXP A;  4JYA L;  4DK1 A;  5C3E B;  1JWS D;  1NMF A;  2WB1 G;  1JOQ A;  1KL9 A;  4X3T A;  1VQ4 A;  5FKA C;  2EZV A;  1UWV A;  2AQ1 B;  1WTP A;  5LMU Q;  3HOX H;  4LF4 L;  4F7X A;  1TWF B;  1ET9 A;  5FJ8 H;  3NUC A;  3K5O A;  1WCM B;  3I4M B;  3FPU B;  5I2X A;  1CKN B;  4BA1 I;  3CCL A;  4B3S L;  2NVY B;  3OWF A;  1B50 A;  2HCC A;  3HRZ C;  3CRK C;  1S5B D;  2Z1C A;  3HKZ E;  5DAU A;  1K9M C;  1NR4 A;  2EIF A;  2VZA A;  2B63 G;  1GXD C;  3PGZ A;  4RCO A;  2CVR A;  1EL0 A;  5BR8 L;  3SK4 A;  1ENC A;  4FXK C;  2B2V A;  1L0X B;  3RZD B;  5M3M G;  3GTQ B;  2EYH A;  1U4L A;  2Y0S B;  2F0P A;  2CW0 D;  1LTL A;  3K7A B;  3IFT A;  4RAU C;  1XXG A;  2UXD L;  2AUJ D;  1STA A;  5M9O A;  1LTA D;  4JI2 L;  3M4O B;  4N9P A;  4QJF A;  5K36 H;  4DA2 A;  4GNX B;  1PDQ A;  3OW2 A;  3HOZ B;  3HKS A;  4XQQ A;  5KYI A;  1IKL A;  1TWC H;  1BCP C;  5IOC A;  2UUB Q;  2LXK A;  3CP0 A;  1SYB A;  4DXG A;  3K59 A;  4OL7 A;  3I72 A;  4AH6 A;  4LFB L;  1O80 A;  4UDU C;  4DUZ L;  4H13 C;  5D65 A;  4OEL B;  1D1K A;  2VXW A;  2WKD A;  3C1F A;  3R2I A;  4OIJ A;  4QCL A;  1SND A;  3C46 A;  1R4P B;  4QL5 A;  4AQY L;  1IYU A;  3WOE A;  5G3L F;  1YNJ C;  3D4R A;  3MXN A;  2B8G A;  4V19 0;  3T56 B;  3NK9 A;  3A54 A;  1TY2 A;  1SNQ A;  3BZC A;  2EOT A;  5M5Y B;  2JA8 H;  2A73 B;  3CRL C;  4RFB A;  4BBR H;  2RCN A;  4C3H B;  2ALY B;  5K5P A;  4JV5 Q;  5JJZ A;  4KHP L;  4ZLT F;  2Z6K C;  1FGU A;  3ND9 A;  2O5J C;  3KLS A;  1BCP D;  1LTR D;  1PH6 A;  1Q12 A;  5I6W A;  1JJG A;  1XJV A;  4B3M L;  1O7Z A;  1NAP A;  4JI1 Q;  1YJ9 A;  2K03 A;  3J81 j;  2BCO A;  4A3K B;  4EQO A;  2UUC L;  1BF4 A;  1HCZ A;  3TBI B;  3JAM E;  2B2U C;  3KLW A;  4QY7 A;  1YIT A;  4ME5 A;  2AQ2 B;  3GTG B;  1HNX L;  1RHP A;  1PH9 A;  4C3J B;  3AEV A;  2KEC A;  1STY A;  2Q8T A;  2YU9 B;  1JJ2 A;  5LMN W;  3S2H H;  2A68 C;  3N6R A;  2PI2 A;  3GV6 A;  1YNJ D;  3HOX G;  1VF7 A;  4IJH A;  4A4I A;  1CKN A;  2KHS A;  4CJ2 C;  1WVL A;  5FJ8 G;  1E7Z A;  2VUM B;  2Q8R E;  1LTG D;  5G3L D;  2ZM6 L;  2JK8 A;  5C5L A;  5COY A;  5EPL A;  2B29 A;  1WTR A;  3CKI B;  3U9O A;  2E5L L;  1EZ8 A;  3K6O A;  1O7I A;  3V96 A;  4DR7 L;  1IBL L;  1VMP A;  2E2I B;  1JWU D;  1KD1 C;  4JC0 A;  1SE4 A;  4JBJ A;  3G6J B;  1XTC D;  2NZO A;  4GNX A;  4X66 Q;  2QW7 A;  3UDF A;  2JA6 H;  1QOH A;  2I46 A;  4A3M B;  5K36 G;  5DEH A;  4QB4 A;  2JE6 I;  3JAM i;  2BH2 A;  1CKO A;  2XRQ D;  1HZC A;  1DOM A;  1IXR A;  2A68 D;  1BVS A;  4B08 A;  1A15 A;  2BE5 C;  4KN7 C;  3ULP A;  2F0E A;  3QJY A;  1N32 L;  2F4V L;  1PFS A;  4S3S A;  1H9M A;  2P5Z X;  4FF4 A;  1RL2 A;  3HOU H;  3C1E A;  2ATW A;  2UXB L;  1GUG A;  3HOV H;  1JQY D;  1TKW B;  1SE3 A;  5FO9 B;  4CBV A;  4HED A;  4K5X A;  2RF4 A;  2NVQ H;  4HJ7 A;  1PTO H;  2HQL A;  3NEM A;  1PLF A;  3E9H A;  1SEB D;  2VB3 X;  2PZW A;  1X56 A;  3VR3 A;  4XXE A;  4FF1 A;  1S5E D;  2B2T C;  4K5W A;  2QDL A;  3EIV A;  4LK1 C;  4QQB X;  2HHH Q;  1CQV A;  2A6H D;  3BG3 A;  3J81 E;  2JA8 G;  2ZTD A;  4LJZ C;  3FHW A;  5C44 H;  3I55 A;  4BBR G;  3E0E A;  4YCW A;  1EQV A;  1Z7T A;  1QJO A;  3Q23 A;  4B3R L;  2AWN A;  2KHI A;  1D8L A;  4JI7 Q;  5M5X H;  2EDG A;  1I3Q B;  4DR4 Q;  5C4J B;  1PZJ D;  1X3G A;  5CV7 A;  3SK6 A;  3S15 H;  3RD4 A;  4UP7 A;  3CC7 A;  2CKZ B;  2EYP A;  4R4O A;  3T1H Q;  3Q0A A;  3JAM L;  1SDF A;  2O4X A;  4TKO B;  3L0O A;  4KMU C;  5EQ0 A;  2ZXO A;  4LFA L;  1HJP A;  2SDF A;  2RQX A;  2ICE C;  1CT1 D;  3CHB D;  3FKI B;  1K0R A;  3TZU A;  3PIP A;  3GDE A;  2OWO A;  4JBK A;  4LW1 A;  4DV0 Q;  2F0M A;  5C4X B;  1EWH A;  1SNC A;  2A74 C;  4DAV A;  1QB5 D;  1VQH A;  3I3C A;  1Q82 C;  2FHT A;  2MNA A;  3NTK A;  1XPR A;  1GD7 A;  2KCM A;  1HR0 Q;  2F4I A;  1EYC A;  3RZO H;  2B2Y C;  4KV6 A;  3S17 H;  1R4Q B;  5IGF A;  4R1J A;  2F0O A;  1DXM A;  2TSS A;  3M7G A;  4IZ8 A;  4BWG B;  2GN5 A;  1GUW A;  2AKW B;  4X62 Q;  4ABN A;  3VYR A;  3S1R H;  2HUG A;  1LO5 D;  5EBC A;  4K8I A;  1CSP A;  1BBW A;  1JR0 D;  3KJO A;  1YHA A;  2EYL A;  4DKA C;  1UE7 A;  2K04 A;  4RGO S;  4EVO A;  3I56 A;  1QUQ B;  2JA6 G;  4JK1 C;  3IKJ A;  1IBM L;  2PI2 E;  2WII B;  1YHB A;  4OGQ C;  4HJA A;  2L0C A;  2L4N A;  1LYL A;  1DGS A;  1B9N A;  2F0K A;  1SNO A;  5JEA J;  2NVX B;  1FGB D;  1ICF B;  2K28 A;  1LTS D;  3M4P A;  3N52 A;  1RJT A;  2XNA C;  4EX5 A;  4KKU A;  1L2F A;  3HOU G;  3MEF A;  1F2L A;  3VR6 A;  4A3B H;  1VQA A;  3HOV G;  4DUY L;  1CA6 A;  3BJU A;  3S1N B;  2Y0S E;  2FXQ A;  1PMR A;  1GKH A;  2RCF A;  4FDB A;  4MIU A;  3PO3 H;  3K0Y A;  1V9P A;  3NE5 B;  5IE8 A;  1Y1V B;  3AQQ A;  2K52 A;  3H09 A;  3EQL C;  3VYU A;  3SE0 A;  4BY1 B;  4K0K L;  4DV2 L;  1HNW Q;  5D3D A;  1XNR Q;  1CK1 A;  1G6Z A;  1SNP A;  3VA5 A;  3WWV A;  4DR1 L;  1W2B A;  4JI4 Q;  2IW3 A;  1C7Y A;  3J81 L;  1TR5 A;  2DNC A;  3K80 C;  1NY4 A;  3J80 i;  1ET6 A;  5C44 G;  1V8Q A;  3E0J A;  2NYZ D;  4BY7 B;  1IL8 A;  3S1M B;  3PF4 A;  3CCE A;  3NHH A;  3GTP B;  3GO5 A;  4JG2 A;  1SMY C;  5C0X H;  4GKK L;  1TWA B;  3UE1 A;  2EY2 A;  2RVL A;  4JOI A;  3S1Q B;  1Q8K A;  4J15 A;  1WD1 A;  3W3A A;  3NBH B;  2SNM A;  2HT1 A;  5CMD A;  2UU9 Q;  3STB C;  5IT9 L;  1LUZ A;  4R4C A;  4JI3 L;  1JOK A;  1VQI A;  1K8A C;  3MXU A;  3QOJ A;  3L7Z C;  3TEH B;  4XTC S;  1EY8 A;  3NQT A;  3TRE A;  3CD6 A;  1Q8I A;  3SVM A;  4KY5 A;  1WTQ A;  3QWN A;  4UY8 C;  4JBW A;  1RIP A;  2EXZ A;  3LWU A;  3M4Q A;  1Q1E A;  3I4L A;  1SBB B;  5ELF A;  3PIP 3;  3GTJ B;  1YJN A;  3MTS A;  1DYQ A;  3PF5 A;  3DEP A;  4DGZ A;  4EGV A;  2KUM A;  3F1Z A;  3NBI A;  5LMN Q;  1E3P A;  3TP5 A;  3GTL H;  3SDZ A;  1VQK A;  4OXP A;  4KTA A;  2PW5 A;  4LWC A;  1ZKO A;  2GVB A;  1PVO A;  1EOV A;  1PTO F;  4BXX H;  1Y8P B;  3HGB A;  1VS0 A;  1SMY D;  2I5M X;  1H95 A;  3KYH C;  2VL6 A;  3LX0 A;  3T51 B;  5CYU A;  1QUQ A;  2BA0 A;  2ZJQ A;  3M4Y A;  4Y7N B;  5DNF A;  1BO0 A;  4K6D A;  1Q1B A;  4KKS A;  4JI5 Q;  1PRT F;  5C3X A;  2QEJ C;  2XWJ B;  4YCU A;  4ZK9 B;  4PV1 C;  4IPG A;  2Z0S A;  2IHF A;  2TMP A;  1Y14 B;  3GTM H;  1SFO B;  2DUD A;  4K14 A;  1EUJ A;  1JJC B;  1A2T A;  3GP7 A;  2E2J B;  1PFB A;  1JT8 A;  1L0W A;  2A6E D;  4HCS A;  1ZXT A;  2F1M A;  1B3Q A;  1E1T A;  1ZYR D;  2K1B A;  2VQE L;  3H15 A;  4QUF A;  3ND8 A;  4POG A;  3PO3 G;  2V4D A;  1NSN S;  4O2D A;  4K2K A;  3MXG A;  4RCN A;  5BN5 A;  4FF3 A;  2QGQ A;  1VQ6 A;  4U68 A;  4FNF A;  5JJK A;  4P74 A;  1U0L A;  1F2M A;  1TWH H;  2DJF C;  2EJF C;  3NWT A;  3GTK H;  5IGB A;  1PTO D;  4LF9 L;  5IYD H;  3CAM A;  1FD7 D;  1SSO A;  2PZU A;  5NUC A;  3L3O C;  4LFC L;  3EA6 A;  2JA9 A;  2E2D C;  3U4Z A;  1DM0 B;  2XSC A;  5CBE E;  1EYG A;  5JVG 3;  2LS0 1;  2JXM B;  1VQE A;  3CC4 A;  1AN8 A;  1BBU A;  3A7A B;  2J7Z A;  4PMC A;  4WOR A;  1PRT D;  4NMZ A;  5C0X G;  1KDA A;  2QEX A;  4DAM A;  1N36 L;  3NBH A;  4JI1 L;  1Y8O B;  3BVZ A;  4A3D B;  4PNY A;  4A3I H;  4LF7 L;  4BA2 I;  2WAQ B;  5M3F G;  4QGU A;  2C9O A;  1H9S B;  4YHH L;  1E2Z A;  2OQK A;  3ERO A;  4GLA C;  4IPD A;  1NCV A;  4DNI A;  3ZYY X;  4K6L A;  1Z6H A;  2HCI A;  5JOB A;  4EQ5 A;  2CCZ A;  4A3G G;  2HIX A;  1Y1W H;  1WTO A;  3PCO B;  4APV A;  1CHQ D;  2LY7 A;  4LF6 Q;  1M8A A;  1L0Y B;  1OXV A;  3D3R A;  4HIO A;  4KJO A;  1B8A A;  4RGN A;  2MO1 A;  4OX9 Q;  2F0U A;  1V1O A;  5IWA Q;  3OOC A;  4DV3 L;  1GUS A;  2VNU D;  4OON A;  2ZT9 C;  1KLU D;  4A3F H;  4X3K A;  1CSQ A;  3ERS X;  5FO7 B;  3CQZ H;  2UUA Q;  2CFM A;  1R9T B;  1VQN A;  4IAL A;  1VQC A;  4L8J A;  4MTK A;  4GKJ Q;  1KRS A;  1I50 B;  2K6A A;  4FF2 A;  3CW2 C;  4R8N A;  3TS0 A;  2H5X A;  4DFA A;  3GTO B;  1EY0 A;  4QIW B;  2F3V A;  3TP7 A;  1EQQ A;  5ELC A;  5ELN A;  5M3F B;  4NXN L;  2VQF Q;  1HQR D;  2RSO A;  2EY1 A;  3H0G G;  5CBA E;  3R93 A;  1I94 Q;  1GUO A;  5DM6 3;  2B2V C;  3AU7 A;  2SNS A;  2N78 A;  4XIG S;  3CCR A;  5GQO A;  4A3G B;  1X3F A;  1ESF A;  2K5H A;  2NUC A;  2NVT B;  1I4Q A;  3S2D B;  1EY5 A;  4C2M H;  3TS2 A;  1Y69 U;  4DR3 L;  4ZRZ A;  4RHR A;  4M8A A;  3LWE A;  4UHV A;  1CUK A;  2I5L X;  3OSO A;  1CFM A;  2F52 A;  3S16 H;  4HIM A;  4DR6 L;  1SLJ A;  1MBY A;  3A8K E;  3M85 A;  2Q2T A;  1FNV A;  3KBG A;  4AYB B;  1U5K A;  3MEH A;  4BBS H;  1PH2 A;  2MP1 A;  2R7D A;  4XQN A;  1I4H A;  2Q8I B;  3W5O A;  3BVM A;  4G7Z C;  1I6H B;  2LXJ A;  5IGE A;  3M7N A;  1H9S A;  3DWP A;  5CV5 A;  3A74 A;  1S5C D;  1C9O A;  3HZX A;  4ULL A;  4RGM A;  1QVG A;  2R92 H;  3OHX C;  4G4K A;  2Z9H A;  4DR2 Q;  4NXM L;  3SK5 A;  2WAC A;  2QKI C;  4B9X A;  4HJ9 A;  3P75 A;  1Y1W G;  2A69 C;  2AUK A;  3DWQ A;  3H0G B;  4NPS A;  1JE5 A;  2PMZ B;  2ZXR A;  2D9U A;  2F0V A;  4EQN A;  3A8J E;  3Q24 A;  1CM9 A;  1TQO A;  1JB7 A;  2CWP A;  4AIM A;  2AMC B;  2OCE A;  3VR4 A;  1HR0 L;  3F2C A;  3V2T A;  4G7O C;  4DV4 Q;  1SNM A;  5FO8 B;  3S24 A;  4QF4 A;  1BCP F;  3I4N H;  4X62 L;  4POF A;  1X65 A;  3SGI A;  3RUZ A;  4BS9 A;  1YBY A;  2IT1 A;  4YY3 L;  3O13 A;  1RD9 D;  1H9R A;  3FPP A;  4PMW A;  4OWX B;  1M90 C;  4IFD I;  2EQS A;  4DK0 A;  1CQF A;  1GHK A;  1IYV A;  3BYY B;  2D0P A;  2D62 A;  3UDG A;  2WB1 B;  1X3Q A;  2F0J A;  4DV5 Q;  3VYT A;  1HUN A;  4KI0 A;  4YWM A;  5IP7 H;  2RBM A;  2A69 D;  3IL8 A;  2K5V A;  2GVA A;  2R7Z H;  4H44 C;  1LLR D;  5H1S E;  1K8M A;  1EY6 A;  4F8M A;  2YTV A;  2EY5 A;  3A0J A;  1RF2 D;  2DY8 A;  2F03 A;  3D31 A;  3OW7 A;  1YJW A;  4GNX C;  4IFD J;  1HPC A;  4PQX A;  3B6Y A;  2B63 B;  1Q81 C;  2XIW A;  1T5X D;  2KA7 A;  3S14 H;  2XVS A;  2K4K A;  2B8F A;  5M3M B;  4IN3 A;  1HA5 A;  3TN2 A;  1UNS A;  5A35 A;  3MWY W;  3OIQ A;  1XMQ Q;  5BN3 A;  1C0A A;  4BBS G;  1JCK B;  5AJ3 Q;  3F8T A;  1K83 B;  3ICE A;  2Z8L A;  1UE1 A;  2RA4 A;  4ZKC B;  1EYA A;  4PMB A;  1N34 Q;  5CV4 A;  1VQG A;  1Q86 C;  2JEA I;  1M1K C;  1F9R A;  3L2P A;  4JI0 L;  4L63 B;  5EKI A;  1VQL A;  3J7A F;  3BYT B;  2IX0 A;  1U4M A;  1O78 A;  1FJG L;  2R92 G;  4IUR A;  4P73 A;  4RKB A;  3EVQ A;  4GN5 A;  1TS4 A;  2E8G A;  3OYY A;  3PIO A;  1VQ7 A;  1EOT A;  5JJL A;  2AQ3 B;  1STN A;  2K5N A;  1B7Y B;  2CHB D;  4LF5 Q;  4X3S A;  3RN2 A;  4X3U A;  2A19 A;  2WAQ E;  4XYO A;  5J22 A;  5EKK A;  1MSH A;  3K5L A;  1H9K A;  4R8I A;  2NN6 I;  1PH3 A;  3J7A V;  3I4N G;  1RCV D;  3MVV A;  5LL6 S;  2E2H B;  5JEA H;  5C5M A;  3AYH B;  1GO3 E;  4A93 H;  2KEN A;  1D6E C;  5ISR A;  4X64 L;  1HRJ A;  3A8I E;  4DV1 Q;  2XGT A;  2L11 A;  1X54 A;  2IJ0 A;  3U50 C;  4DN4 M;  2DY7 A;  4TSS A;  1WTV A;  5FLX c;  1YNN C;  3P7J A;  3MFY A;  3I91 A;  5ELE A;  3DLL A;  4A76 A;  5IP7 G;  4R4T A;  1P8L A;  3GV3 A;  1CA5 A;  3HOX B;  2K01 A;  5KIX A;  1G6P A;  2G9H D;  3F2B A;  2R7Z G;  3QR8 A;  2Q2U A;  3AFQ A;  3M3Y H;  3EJI A;  3IAY A;  2L15 A;  2IL8 A;  4B3T Q;  1KLG D;  5HGT A;  1XYI A;  2BOS A;  4IOC A;  3SHL A;  3RLN A;  1PHJ A;  3G71 A;  2UXC Q;  2RDF A;  3IRB A;  3FVQ A;  3OTO Q;  1LAC A;  3F2U A;  5M5W H;  2I5H A;  5FOB B;  4TRD A;  1KHI A;  1HNZ Q;  2BE5 D;  1QVF A;  1XNQ Q;  5KRU A;  4X65 L;  3A7L A;  4C56 C;  4IUP A;  3JAM c;  2F0N A;  1PFM A;  2OXP A;  3PUX A;  1K3R A;  4R4Q A;  3E5S A;  1HQM C;  1IL2 A;  2IWH A;  2A8V A;  2DGY A;  2JA7 H;  4JYA Q;  1HH2 P;  2PO4 A;  3DM1 A;  4P2C B;  1RTO A;  1W6K A;  1MHW C;  1D5Z C;  1K73 C;  4LMQ D;  5CV9 A;  2M2L A;  1WTH A;  4DNR B;  2KQ3 A;  4LF4 Q;  1SYG A;  4OHJ A;  4AYB E;  3PO2 H;  4LF8 L;  3QO2 A;  5FK9 C;  2PQA B;  3J81 i;  1QE6 A;  3U9S A;  1AZQ A;  1HZB A;  3VR5 A;  5COR A;  2FFK B;  4DF7 A;  1TS2 A;  1M4V A;  3PIO 3;  3P1H A;  2WFW A;  4J1M A;  2JA8 B;  4DR5 L;  3NTH A;  4LUO A;  5BR8 Q;  4JOI C;  4BBR B;  3D4D A;  1SJH D;  5C4H A;  4CHT B;  2IX1 A;  4NB3 A;  3Q8D A;  1V1Q A;  3QB3 A;  2AHO B;  2RSN A;  3R8B A;  4O1N A;  1QNU A;  2UXD Q;  5JEA G;  1XMO Q;  2ID0 A;  4JI2 Q;  1BDO A;  4A93 G;  4H02 A;  4DV6 Q;  1UEB A;  2HDM A;  3EFX D;  3HKZ G;  4ME3 A;  1L1O B;  3TRZ A;  4HCE A;  1MJC A;  4JCV E;  3ERQ A;  3HOW H;  4J6H A;  1Z9F A;  2R93 H;  4LNQ A;  4C3I H;  1VQM A;  2N88 A;  3S2H B;  4L6T B;  1MIU A;  1C48 A;  1LTT D;  3KBX A;  3MA2 B;  4A3E H;  2Q2H A;  1II3 A;  1V43 A;  1QG7 A;  3PSI A;  1BQQ T;  4E6I A;  1LTB D;  3I2Z A;  4PZ8 A;  1EFI D;  3K5N A;  2F0H A;  3MHB A;  2RKS A;  3LGJ A;  4AQY Q;  1I94 L;  4RWS C;  4CKC A;  1E24 A;  3HOY H;  3I90 A;  4JI8 Q;  2JA5 H;  3FMC A;  1K3B C;  5C6A A;  1AP0 A;  2VB2 X;  2WB1 E;  3RMH A;  4FXG C;  1ROD A;  4ZAI A;  2EYO A;  2EJM A;  4JI6 L;  3ER0 A;  1EQR A;  2QIL A;  1SAP A;  5KNB A;  4IUT A;  4ILW A;  2A1A A;  4CJ0 B;  2K5Q A;  2JA6 B;  1TWG H;  1K8O A;  4A3C H;  4B3M Q;  5IT9 c;  2XTI A;  3KJP A;  4P71 A;  1WJJ A;  2UUC Q;  3JC6 6;  2KED A;  4Q5V A;  3RNU A;  3ULJ A;  3HKZ B;  2EE1 A;  4KD4 A;  1HNX Q;  1W3S A;  2PNH A;  2OTJ A;  3HOU B;  4YIJ A;  3HOV B;  1A6X A;  5LMU L;  1YHQ A;  2PQA A;  2NVQ B;  5D3I B;  1QVC A;  1MSG A;  4CDC C;  4NDX A;  4CDF C;  4K8J A;  3VA7 A;  3UI2 A;  3PUZ A;  2N3S A;  4A3J H;  1VF5 C;  2PNR C;  2ZM6 Q;  4PZ7 A;  4GOP B;  2K50 A;  5JAV A;  4N8X 1;  3KUP A;  3HFZ B;  3X3M A;  4CDD C;  3QIA A;  2OEO A;  1S5F D;  3J80 c;  2E5L Q;  2DN8 A;  3CCS A;  2KBN A;  3W2D A;  4ZYS A;  2NVT H;  4EQP A;  1PRT B;  4DR7 Q;  1GVP A;  1IBL Q;  4FP5 D;  1STE A;  2KOL A;  1ASY A;  5C44 B;  5T1I A;  2EYJ A;  4RA8 A;  4ZCK A;  2VS1 A;  2KCT A;  1ONL A;  2F3I A;  4TQU S;  3E3X A;  2MFI A;  3STB D;  5M5X B;  3OMC A;  4V0B A;  3IFD A;  5TSS A;  1L1O A;  1PH4 A;  2L9H A;  3S15 B;  5GRO A;  2UUB L;  1GHJ A;  5C3E H;  2EY6 A;  4HN7 A;  4R9W A;  1E22 A;  1SXT A;  5GAH C;  3BDC A;  2EVB A;  4LAA A;  1EFW A;  5J39 A;  1N32 Q;  2F4V Q;  4A3B G;  2R93 G;  4C3I G;  1UE6 A;  4QUC A;  4DV5 L;  2WKC A;  2MHV A;  1AEX A;  2BDO A;  5E1F A;  1DZ1 A;  1VQJ A;  4A3E G;  1TWF H;  3BZK A;  3I4M H;  1WCM H;  1PYS B;  2KVM A;  2JSO A;  2PW7 A;  2NVY H;  1TS5 A;  1LAB A;  2F0Q A;  1KXL A;  3I73 A;  3RZO B;  4FYD A;  3S17 B;  2JA5 G;  2D5D A;  2MJ8 A;  1EY4 A;  1JOR A;  2QA4 A;  3CPF A;  4UAI A;  4K5V A;  1A8V A;  4JV5 L;  1I6V C;  1IZ6 A;  4R4I A;  3RZD H;  1WOC A;  3GTQ H;  3S1R B;  1N9W A;  3BS1 A;  3K7A H;  4ZUJ A;  2C5C A;  1X55 A;  2MGS A;  1B2T A;  2ZXP A;  5E3F A;  3M4O H;  4B3R Q;  1ML0 D;  1SRO A;  2HD3 A;  1MJE A;  3HOZ H;  4A3C G;  3KK7 A;  1SE2 A;  1F9Q A;  1LT5 D;  2MQH A;  2R7F A;  1FNU A;  3F2D A;  4HAE A;  3TQY A;  1MD2 D;  1PYB A;  1F77 A;  1EWI A;  1SMX A;  1UAP A;  4LFA Q;  1CI3 M;  2JJQ A;  4P75 A;  3FP9 A;  1IKM A;  4FO2 A;  2F0W A;  4H7B A;  1U4P A;  3EN2 A;  4GOP A;  1BOS A;  3PO3 B;  2K14 A;  1JE4 A;  4MZ9 A;  1FR3 A;  1LV9 A;  3BDO A;  3T16 A;  2FIN B;  1QZG A;  1ILP A;  4DPG A;  1SR3 A;  1KDC A;  2I07 B;  3T13 A;  4PG3 A;  4BXX G;  5LHY 1;  5M5Y H;  1QCB D;  4GLX A;  1EIG A;  3K0X A;  3AMU A;  2ASB A;  4C3H H;  3K7U C;  1EIY B;  5F2D A;  1K8G A;  4OO1 I;  1A63 A;  2ZJR A;  1OXS C;  4X66 L;  3PUW A;  2Q2I A;  4IJL A;  1B44 D;  4RG1 A;  1IBM Q;  4A3K H;  3CPW A;  5HUR A;  2RHQ B;  1J9O A;  1WI5 A;  2NWG A;  4WJ4 A;  5C3W A;  5C3E G;  1YI2 A;  4HR7 B;  3GTG H;  4C3J H;  4HJ8 A;  1RDP D;  3NP8 A;  5IGD A;  2YU9 H;  2H1E A;  4O42 A;  5KND A;  3DXJ C;  4IPH A;  3CMA A;  1EU3 A;  1NNX A;  1G29 1;  4DUY Q;  4IFD H;  3M9B A;  2VUM H;  3MZ5 A;  1S3O A;  3I4M G;  1WCM G;  5E4X A;  4OWW B;  4K0K Q;  3I8Z A;  4DV2 Q;  1AE3 A;  5ELB A;  5JPN C;  2HHH L;  1E0B A;  3X3N A;  5IYD G;  1XWE A;  1AZP A;  4DR1 Q;  3AB9 A;  5CC4 A;  3GTL B;  4Z9C B;  3H3V I;  4B9W A;  1VDZ A;  1A2U A;  1PH8 A;  2E2I H;  2PCF B;  2RDH A;  3OTO L;  1WTX A;  2HQE A;  4GLV B;  2Y0S G;  5E4W C;  3CXC A;  1HXY D;  3K57 A;  4JI7 L;  4DK3 C;  4DR4 L;  2K33 A;  3NEN A;  5IYB H;  4A3M H;  1T5E A;  1Q46 A;  4C1N I;  4OIK A;  1NBW A;  1T9H A;  3VR2 A;  3HOZ G;  4A3I G;  1FNW A;  4GKK Q;  2EPB A;  3T1H L;  1I4G A;  1PH7 A;  5CR3 A;  2QF7 A;  2CW0 C;  3GTM B;  4H0L C;  3KOJ A;  2YTX A;  3SK8 A;  1GUN A;  1PYW D;  1SE8 A;  5J3B A;  1D7Q A;  1HR0 W;  4JI3 Q;  1LT3 D;  4ID6 A;  4DV0 L;  2NZ1 D;  1J5E Q;  4MN3 A;  1LT4 D;  1VQF A;  3CU7 A;  2JYO A;  3PUV A;  5I9O A;  2V1C C;  3HP3 A;  3BVG A;  3PV0 A;  3H91 A;  3H6M A;  4DV7 Q;  5IOD A;  1H9J A;  2G5D A;  4IOA A;  2JN4 A;  1SRU A;  1BCP B;  3CCV A;  3TME A;  2N55 A;  2M9V A;  1S40 A;  2EYM A;  1X3E A;  4JVZ A;  3UDX A;  3D6W A;  4DNT B;  1EIH A;  2F3W A;  2L1B A;  5EPJ A;  1TWH B;  4A3F G;  4GS3 A;  3EBE A;  4HJ5 A;  3GTK B;  1IBK Q;  2PPB C;  4C3H G;  1PA6 A;  2SEB D;  3TP6 A;  1YEZ A;  2XWB B;  5E7N A;  5IYC H;  1I3Q H;  2IX3 A;  5C4J H;  1MI2 A;  1WYD A;  4F88 A;  1XMO L;  3SEB A;  3C2P A;  4A3K G;  1VQB A;  1EZ6 A;  1JOO A;  4IUN A;  4L5T A;  5A2Q E;  1I4R A;  1OXT A;  2YTY A;  4QMG A;  4DV6 L;  4A75 A;  5C4Z A;  2NN6 H;  5HGQ A;  4A3I B;  2E75 C;  3QOL A;  4C3J G;  4HIK A;  3Q6S A;  5FLM H;  3FKI H;  1TVX A;  3NSW A;  4JW0 A;  1F2Y A;  3I70 A;  5IY0 A;  4X6A H;  2B2W A;  5C4X H;  2K5W A;  1G8Z D;  3KDF B;  1KIX A;  2VQE Q;  4G57 A;  4IFD G;  1PH5 A;  3K5M A;  1Y1W B;  4MHE A;  5CV6 A;  2VUM G;  1EQT A;  1HNW L;  3TSS A;  5FLX E;  1NR2 A;  1XNR L;  1BKB A;  1OXU A;  4JI4 L;  4YWL A;  4JBM A;  3H3V C;  4P72 A;  1AE2 A;  1B3A A;  3GQB A;  2E76 C;  4JI8 L;  3OPO A;  4LF9 Q;  1RKN A;  4A3F B;  1G91 A;  3KLR A;  4N9T A;  4LFC Q;  1VQ9 A;  2X6L A;  3A56 A;  3AFP A;  3CQZ B;  1KC8 C;  1DON A;  4KY6 A;  1IHZ A;  5IYB G;  2CQO A;  4A3M G;  3ITP A;  3K81 C;  5JPM C;  1N33 Q;  3VYS A;  4ODG A;  2NBF A;  4PZ6 A;  2NTT A;  5CGK A;  4WFN 3;  2FJ2 A;  4DK6 C;  1N36 Q;  1CHP D;  1FVI A;  3V05 A;  1DD2 A;  1EYD A;  3SXH A;  2ENB A;  3G6E A;  2NVX H;  2UU9 L;  4LF7 Q;  3FDT A;  5L37 A;  4YHH Q;  3BDL A;  5I4D A;  1QZH A;  1C8C A;  2YV5 A;  1YIJ A;  2CQA A;  1CZG A;  3CC2 A;  3S1N H;  4HSV A;  1DCZ A;  4M1U B;  2NB0 A;  4L5Q A;  5GAE C;  3CCM A;  2D2C C;  1Y1V H;  5IGC A;  4L5R C;  2X69 A;  4BY1 H;  2O5I C;  1PFN A;  2KCC A;  5LL6 X;  4XYQ A;  4C2M B;  1I4P A;  5LMN L;  1V1P B;  4DV3 Q;  3KF8 B;  5KEE A;  2O2L D;  4F87 A;  4GN4 B;  3S16 B;  1K28 A;  1MKH A;  2G9D A;  3D6C A;  1VCI A;  1C4Q A;  1STH A;  3RLO A;  4BY7 H;  1CTM A;  3CCJ A;  3OWE B;  3S1M H;  1HTP A;  4BBS B;  4DAP A;  1JMC A;  1QWY A;  1DOL A;  3GTP H;  5IYC G;  1OXX K;  2A6H C;  3H94 A;  1ESR A;  1UUP A;  4JI5 L;  1TWA H;  2X6G A;  4Y52 H;  5EGT A;  1WD0 A;  1I4X A;  3S1Q H;  2CH4 W;  2IY5 B;  5A2Q L;  1QIL A;  2H4O A;  2Z6K A;  2NN6 G;  1VQ5 A;  2MPM A;  1SYD A;  3MAQ A;  2JQO A;  2R92 B;  5FLM G;  3NQI A;  3FKI G;  3KDF A;  2K05 A;  4HMI A;  2ZJP A;  2EJG C;  1BNZ A;  4NXN Q;  1PZI D;  4KY7 A;  1HFN A;  5C4X G;  1N8R C;  2Z4I A;  1KRT A;  2B2U A;  2EXD A;  2OF1 A;  4CJ1 B;  1KAA A;  1A3V A;  1BXT A;  3D0F A;  4A3L H;  1B9M A;  3GTJ H;  5FLX L;  2PYK A;  2J4X A;  3I4O A;  1AFP A;  1PV4 A;  4DR3 Q;  4QIW E;  2F0G A;  2FMC A;  3PQI A;  3J7Y W;  2BH8 A;  3T1Y Q;  4DR6 Q;  1A3T A;  1F2Z A;  2E74 C;  1LM0 A;  2OT2 A;  3I4N B;  4Y7N H;  4FXD A;  5I9P A;  1S72 A;  1YNN D;  1TWC B;  4RGT A;  5AFW A;  2J0T D;  4XT3 B;  1XPO A;  2RDG A;  2YYZ A;  4UP8 A;  5IGG A;  2EYF A;  4CKB A;  1SFO H;  2GA4 B;  3TZD A;  2ICI A;  2E2J H;  1W6J A;  1JWM D;  1Q90 A;  4NXM Q;  1GM5 A;  1A62 A;  5IT9 E;  2HDL A;  3C3L A;  3W1B A;  3FEW X;  4KKT A;  2R7Z B;  4B3S Q;  2SOB A;  1RTN A;  4RHS A;  1WTW A;  4LF6 L;  1Y1V G;  3OIP A;  1FL0 A;  4ZKB B;  4BY1 G;  5GAG C;  5EAY A;  1LT6 D;  3U4V A;  3CME A;  1GOZ A;  1V1P A;  4OX9 L;  1JC7 A;  5IWA L;  2MUY A;  3KF8 A;  3D8G A;  2K5D A;  1DOK A;  1Z47 A;  3S14 B;  1NE3 A;  4NP5 A;  1QNK A;  2F0L A;  3ONA B;  3G48 A;  2B2T A;  3NXW A;  2UUA L;  4BY7 G;  3G4S A;  2LMC B;  1X3P A;  4CKE A;  4KLK A;  1VMC A;  2PMZ E;  3DMU A;  5ELD A;  3J80 E;  1F9P A;  2B39 A;  3HG9 A;  1PZK D;  3QG1 A;  1ENF A;  3Q22 A;  3UE0 A;  4YY3 Q;  4GKJ L;  1XTD A;  1U9R A;  1HA6 A;  3PUY A;  1E2V A;  1P16 A;  2C35 B;  5KNC A;  1G2T A;  4IPC A;  4A3D H;  4LFB Q;  1TS3 A;  1O7Y A;  4DUZ Q;  1KTK A;  1CKM A;  2PQE A;  4DAY B;  2NZH A;  5IP9 H;  4C1N K;  5EBD A;  2FMM A;  1JB3 A;  2NTS A;  2VQF L;  4IUV A;  5JVH 3;  4KN4 C;  3J81 c;  3TDQ A;  3A5Z B;  4UPA A;  4I7A A;  4XDX A;  3DEO A;  1SJE D;  2KEE A;  1JIC A;  1EU4 A;  1TT2 A;  1STB A;  1STG A;  3MFG A;  4RKL A;  2MO0 A;  2R3Z A;  4A3L G;  5CV8 A;  1EEF D;  1VQD A;  1X9N A;  2K7V A;  1E2W A;  4L5S A;  1X6O A;  5EPK A;  1L1O C;  1IYJ B;  1ICW A;  3ULL A;  4KHP Q;  3PMF A;  5KGU A;  1KAB A;  3S9W A;  2LKV A;  1HZ9 A;  3VDY A;  4KD3 A;  5HY6 A;  3RR5 A;  5JJI A;  3R2T A;  4KHV A;  2B2Y A;  2R61 A;  2JA7 G;  3HS0 C; 
#chains in the Genus database with same CATH homology
 1BBX C;  4A93 B;  5I6Y A;  5BN4 A;  1HHV A;  1EEI D;  4G7H C;  1PTO B;  1D2B A;  2A5H A;  3OMG A;  1PXU A;  1KNE A;  2XN9 C;  3SR1 A;  1NUC A;  1TU2 B;  1OO9 B;  3M3Y B;  1EY9 A;  1Q3L A;  2A6E C;  1ZYR C;  1GUT A;  4KHZ A;  1BR9 A;  4KJN A;  5M5W B;  5J1Z A;  3DHQ A;  4ZQ3 A;  2F0F A;  4IQZ A;  4J8Q A;  2L12 A;  1G2S A;  3P20 A;  1KDB A;  3J80 L;  1PTO C;  2JA7 B;  2F0D A;  4OO1 H;  4DAY A;  2M00 A;  2XRS D;  1A3U A;  1B4O A;  1PRT C;  3G7L A;  4FVM A;  3TP8 A;  4U67 3;  4DXF A;  2R6G A;  4CGY B;  4Q0F A;  3PO2 B;  3T4A C;  4XQJ A;  2KJX A;  3RLF A;  2BDN A;  3NWS A;  4K2L A;  2JP1 A;  5KYL A;  1ILQ A;  1XX8 A;  2PZT A;  2WV6 D;  5EJW A;  3NTI A;  5C0X I;  1IW7 C;  2K32 A;  1D5X C;  2IPK D;  3BZD B;  3WOF A;  2QCP X;  5EKL A;  3URY A;  4GZY C;  3KLS X;  2QDB A;  5DM7 3;  2L55 A;  3HOW B;  3T53 B;  4A3B B;  5IIF A;  4XT1 B;  1SYC A;  4ZUI A;  5C0X J;  2R93 B;  4C3I B;  2DNE A;  1KNA A;  4I65 A;  3HEJ A;  4KK7 A;  3K58 A;  4A3E B;  1S4Z A;  2BA1 A;  1B53 A;  2AWO A;  3D4W A;  1HFG A;  1D5M C;  4IUQ A;  3L9A X;  3DUZ A;  2WP8 J;  1IW7 D;  1FYC A;  1B1Z A;  3HOY B;  2JA5 B;  1LTI D;  1EY7 A;  1ZEQ X;  5I2Y A;  1O7L A;  1F9S A;  3DWA A;  4DU9 A;  1D1I A;  1HUM A;  1GJX A;  1AW7 A;  1TWG B;  3NPP A;  2LFN A;  1EWC A;  1SYF A;  4OO1 G;  4HTH A;  1S5D D;  4NW2 A;  2L5T A;  5D14 A;  1TY0 A;  3GD7 A;  2JEB I;  3E6Z X;  3WDN A;  1U4R A;  3R3O A;  4WJW A;  3FRP B;  4I7Z C;  1UEA B;  4A3J B;  2F0S A;  4IUU A;  4WRD A;  1MGS A;  4RH6 A;  4NKL A;  1J8I A;  1HTL D;  5T1G A;  1ENA A;  1Y8N B;  4HMJ A;  2KCN A;  2F0I A;  1SYE A;  1DJR D;  1CZW A;  2WIN B;  1X32 A;  4HSP A;  1TII D;  3A55 A;  2Z4H A;  3LNN A;  2F0T A;  3MC0 B;  1BUV T;  2B2W C;  3MXP A;  4DK1 A;  5C3E B;  1JWS D;  1JOQ A;  4X3T A;  5FKA C;  2EZV A;  2AQ1 B;  1WTP A;  4F7X A;  1TWF B;  1ET9 A;  3NUC A;  3K5O A;  1WCM B;  3I4M B;  3FPU B;  5I2X A;  4BA1 I;  2NVY B;  3OWF A;  1B50 A;  2HCC A;  3HRZ C;  3CRK C;  1S5B D;  2Z1C A;  5DAU A;  1NR4 A;  1GXD C;  4RCO A;  1EL0 A;  2CVR A;  3SK4 A;  1ENC A;  2B2V A;  4FXK C;  1L0X B;  3RZD B;  3GTQ B;  2EYH A;  1U4L A;  2Y0S B;  2F0P A;  2CW0 D;  3K7A B;  3IFT A;  4RAU C;  1XXG A;  2AUJ D;  1STA A;  5M9O A;  1LTA D;  3M4O B;  4N9P A;  5K36 H;  4DA2 A;  1PDQ A;  3HOZ B;  4XQQ A;  5KYI A;  1IKL A;  1BCP C;  5IOC A;  1SYB A;  4DXG A;  3K59 A;  4OL7 A;  3I72 A;  1O80 A;  4UDU C;  4H13 C;  5D65 A;  1D1K A;  2VXW A;  2WKD A;  3C1F A;  3R2I A;  4OIJ A;  4QCL A;  1SND A;  3C46 A;  1R4P B;  1IYU A;  3WOE A;  5G3L F;  1YNJ C;  3D4R A;  3MXN A;  2B8G A;  4V19 0;  3T56 B;  3NK9 A;  3A54 A;  1TY2 A;  1SNQ A;  2EOT A;  5M5Y B;  2A73 B;  3CRL C;  4RFB A;  5K5P A;  4C3H B;  5JJZ A;  4ZLT F;  3ND9 A;  2O5J C;  3KLS A;  1BCP D;  1LTR D;  1Q12 A;  5I6W A;  1O7Z A;  1NAP A;  2K03 A;  2BCO A;  4A3K B;  4EQO A;  1BF4 A;  1HCZ A;  3TBI B;  3JAM E;  2B2U C;  4ME5 A;  2AQ2 B;  3GTG B;  1RHP A;  4C3J B;  2KEC A;  1STY A;  2Q8T A;  2YU9 B;  2A68 C;  3N6R A;  3GV6 A;  1YNJ D;  1VF7 A;  4CJ2 C;  2KHS A;  1WVL A;  2VUM B;  2Q8R E;  1LTG D;  5G3L D;  5C5L A;  5COY A;  5EPL A;  1WTR A;  3CKI B;  3U9O A;  1EZ8 A;  3K6O A;  3V96 A;  1VMP A;  2E2I B;  1JWU D;  1SE4 A;  3G6J B;  1XTC D;  1QOH A;  2I46 A;  4A3M B;  5K36 G;  5DEH A;  4QB4 A;  2JE6 I;  2XRQ D;  1DOM A;  2A68 D;  4B08 A;  1A15 A;  2BE5 C;  4KN7 C;  2F0E A;  3QJY A;  4S3S A;  1H9M A;  4FF4 A;  3C1E A;  1GUG A;  1JQY D;  1TKW B;  1SE3 A;  5FO9 B;  4CBV A;  4HED A;  4K5X A;  1PTO H;  1PLF A;  1SEB D;  2VB3 X;  2PZW A;  3VR3 A;  4XXE A;  4FF1 A;  1S5E D;  2B2T C;  4K5W A;  4LK1 C;  1CQV A;  2A6H D;  3BG3 A;  3J81 E;  4LJZ C;  1EQV A;  1Z7T A;  1QJO A;  3Q23 A;  2AWN A;  2EDG A;  1I3Q B;  5C4J B;  1PZJ D;  5CV7 A;  3SK6 A;  3RD4 A;  2EYP A;  3Q0A A;  3JAM L;  1SDF A;  2O4X A;  4TKO B;  4KMU C;  5EQ0 A;  2ZXO A;  2SDF A;  2RQX A;  2ICE C;  1CT1 D;  3CHB D;  3FKI B;  3TZU A;  2F0M A;  5C4X B;  1EWH A;  1SNC A;  2A74 C;  4DAV A;  1QB5 D;  3I3C A;  2FHT A;  3NTK A;  2F4I A;  1EYC A;  2B2Y C;  4KV6 A;  1R4Q B;  5IGF A;  2F0O A;  1DXM A;  2TSS A;  3M7G A;  4IZ8 A;  4BWG B;  1GUW A;  4ABN A;  3VYR A;  2HUG A;  1LO5 D;  5EBC A;  4K8I A;  1JR0 D;  2EYL A;  2K04 A;  4RGO S;  4EVO A;  4JK1 C;  3IKJ A;  2WII B;  4OGQ C;  2L0C A;  2L4N A;  1B9N A;  2F0K A;  1SNO A;  5JEA J;  2NVX B;  1FGB D;  2K28 A;  1LTS D;  3N52 A;  1RJT A;  2XNA C;  4KKU A;  1F2L A;  3VR6 A;  1CA6 A;  3S1N B;  1PMR A;  4MIU A;  3K0Y A;  3NE5 B;  1Y1V B;  3H09 A;  3EQL C;  3VYU A;  3SE0 A;  4BY1 B;  5D3D A;  1CK1 A;  1G6Z A;  1SNP A;  3VA5 A;  2IW3 A;  3J81 L;  1TR5 A;  2DNC A;  1ET6 A;  1V8Q A;  3E0J A;  2NYZ D;  4BY7 B;  1IL8 A;  3S1M B;  3NHH A;  3GTP B;  3GO5 A;  1SMY C;  5C0X H;  1TWA B;  2EY2 A;  2RVL A;  3S1Q B;  1WD1 A;  3W3A A;  2SNM A;  5CMD A;  5IT9 L;  1JOK A;  3MXU A;  3QOJ A;  3L7Z C;  4XTC S;  1EY8 A;  3NQT A;  1Q8I A;  3SVM A;  4KY5 A;  1WTQ A;  3QWN A;  4JBW A;  2EXZ A;  3LWU A;  1Q1E A;  3I4L A;  1SBB B;  5ELF A;  3PIP 3;  3GTJ B;  3MTS A;  1DYQ A;  3DEP A;  4DGZ A;  4EGV A;  2KUM A;  3NBI A;  3TP5 A;  3SDZ A;  4KTA A;  2PW5 A;  1ZKO A;  1PTO F;  1Y8P B;  3HGB A;  1SMY D;  3LX0 A;  3T51 B;  5CYU A;  2BA0 A;  3M4Y A;  4Y7N B;  5DNF A;  1BO0 A;  4K6D A;  1Q1B A;  4KKS A;  1PRT F;  5C3X A;  2QEJ C;  2XWJ B;  4ZK9 B;  4PV1 C;  2TMP A;  1SFO B;  4K14 A;  3GP7 A;  2E2J B;  1A2T A;  1PFB A;  2A6E D;  4HCS A;  1ZXT A;  2F1M A;  1ZYR D;  2K1B A;  4QUF A;  3ND8 A;  2V4D A;  1NSN S;  4K2K A;  3MXG A;  4RCN A;  5BN5 A;  4FF3 A;  4U68 A;  4FNF A;  1F2M A;  2EJF C;  3NWT A;  5IGB A;  1PTO D;  1FD7 D;  1SSO A;  2PZU A;  5NUC A;  3L3O C;  3EA6 A;  2E2D C;  1DM0 B;  2XSC A;  5CBE E;  5JVG 3;  2LS0 1;  2JXM B;  1AN8 A;  3A7A B;  2J7Z A;  4PMC A;  4WOR A;  1PRT D;  4NMZ A;  5C0X G;  1KDA A;  3NBH A;  1Y8O B;  3BVZ A;  4A3D B;  4PNY A;  4BA2 I;  2WAQ B;  2C9O A;  1H9S B;  1E2Z A;  3ERO A;  1NCV A;  3ZYY X;  4K6L A;  1Z6H A;  2HCI A;  5JOB A;  1WTO A;  1CHQ D;  2LY7 A;  1M8A A;  1L0Y B;  1OXV A;  3D3R A;  4KJO A;  4RGN A;  2F0U A;  1V1O A;  3OOC A;  2VNU D;  1GUS A;  2ZT9 C;  1KLU D;  4X3K A;  5FO7 B;  1R9T B;  4IAL A;  4L8J A;  1I50 B;  2K6A A;  4FF2 A;  4R8N A;  4DFA A;  3GTO B;  1EY0 A;  4QIW B;  2F3V A;  3TP7 A;  5ELC A;  5M3F B;  1HQR D;  2RSO A;  2EY1 A;  5CBA E;  3R93 A;  1GUO A;  5DM6 3;  2B2V C;  3AU7 A;  2SNS A;  4XIG S;  4A3G B;  1ESF A;  2NUC A;  2NVT B;  1I4Q A;  3S2D B;  1EY5 A;  1Y69 U;  4ZRZ A;  4RHR A;  4M8A A;  3LWE A;  3OSO A;  1CFM A;  1MBY A;  3A8K E;  3M85 A;  1FNV A;  3KBG A;  4AYB B;  3MEH A;  2MP1 A;  4XQN A;  1I4H A;  2Q8I B;  4G7Z C;  3BVM A;  1I6H B;  5IGE A;  3M7N A;  1H9S A;  3DWP A;  5CV5 A;  1S5C D;  3HZX A;  4ULL A;  4RGM A;  3OHX C;  4G4K A;  3SK5 A;  2WAC A;  2QKI C;  4B9X A;  3P75 A;  2A69 C;  2AUK A;  3DWQ A;  3H0G B;  2PMZ B;  2ZXR A;  2D9U A;  2F0V A;  4EQN A;  3A8J E;  3Q24 A;  1CM9 A;  1TQO A;  3VR4 A;  3V2T A;  4G7O C;  1SNM A;  5FO8 B;  4QF4 A;  1BCP F;  3RUZ A;  4BS9 A;  2IT1 A;  3O13 A;  1RD9 D;  1H9R A;  3FPP A;  4PMW A;  4IFD I;  1GHK A;  4DK0 A;  1CQF A;  1IYV A;  3BYY B;  2D62 A;  2WB1 B;  1X3Q A;  2F0J A;  3VYT A;  1HUN A;  4KI0 A;  2RBM A;  2A69 D;  3IL8 A;  4H44 C;  1LLR D;  1K8M A;  1EY6 A;  4F8M A;  2EY5 A;  1RF2 D;  2DY8 A;  2F03 A;  3D31 A;  3OW7 A;  4IFD J;  1HPC A;  4PQX A;  2B63 B;  2XIW A;  1T5X D;  2KA7 A;  2XVS A;  2B8F A;  5M3M B;  4IN3 A;  1HA5 A;  3TN2 A;  1UNS A;  5A35 A;  3MWY W;  3OIQ A;  5BN3 A;  1JCK B;  1K83 B;  2Z8L A;  2RA4 A;  4ZKC B;  1EYA A;  4PMB A;  5CV4 A;  2JEA I;  1F9R A;  4L63 B;  5EKI A;  3J7A F;  3BYT B;  2IX0 A;  1U4M A;  1O78 A;  4IUR A;  4RKB A;  3EVQ A;  1TS4 A;  1EOT A;  2AQ3 B;  1STN A;  2CHB D;  4X3S A;  4X3U A;  4XYO A;  5J22 A;  5EKK A;  1MSH A;  3K5L A;  1H9K A;  4R8I A;  2NN6 I;  3J7A V;  1RCV D;  3MVV A;  5LL6 S;  2E2H B;  5JEA H;  5C5M A;  1D6E C;  5ISR A;  1HRJ A;  3A8I E;  2L11 A;  2IJ0 A;  4DN4 M;  2DY7 A;  4TSS A;  1WTV A;  1YNN C;  3P7J A;  3MFY A;  3I91 A;  5ELE A;  3GV3 A;  1CA5 A;  3HOX B;  2K01 A;  5KIX A;  2G9H D;  3EJI A;  3IAY A;  2IL8 A;  1KLG D;  5HGT A;  1XYI A;  2BOS A;  3SHL A;  2RDF A;  3FVQ A;  1LAC A;  3F2U A;  5FOB B;  4TRD A;  2BE5 D;  5KRU A;  3A7L A;  4C56 C;  4IUP A;  2F0N A;  1PFM A;  2OXP A;  3PUX A;  3E5S A;  1HQM C;  2IWH A;  2PO4 A;  3DM1 A;  4P2C B;  1RTO A;  1W6K A;  1D5Z C;  4LMQ D;  5CV9 A;  2M2L A;  4DNR B;  2KQ3 A;  1SYG A;  4OHJ A;  3QO2 A;  5FK9 C;  1QE6 A;  3U9S A;  1AZQ A;  3VR5 A;  5COR A;  2FFK B;  4DF7 A;  1TS2 A;  1M4V A;  3PIO 3;  3P1H A;  4J1M A;  2JA8 B;  3NTH A;  4BBR B;  3D4D A;  1SJH D;  5C4H A;  4CHT B;  2IX1 A;  3QB3 A;  2RSN A;  3R8B A;  4O1N A;  1QNU A;  5JEA G;  2ID0 A;  1BDO A;  2HDM A;  3EFX D;  4HCE A;  3ERQ A;  4J6H A;  2N88 A;  3S2H B;  4L6T B;  1C48 A;  1LTT D;  3KBX A;  3MA2 B;  1II3 A;  1V43 A;  1QG7 A;  1BQQ T;  4E6I A;  1LTB D;  1EFI D;  3K5N A;  2F0H A;  3MHB A;  2RKS A;  4RWS C;  4CKC A;  3I90 A;  3FMC A;  5C6A A;  1AP0 A;  2VB2 X;  3RMH A;  4FXG C;  1ROD A;  4ZAI A;  2EYO A;  2EJM A;  2QIL A;  1SAP A;  5KNB A;  4IUT A;  4ILW A;  4CJ0 B;  2K5Q A;  2JA6 B;  1K8O A;  2KED A;  4Q5V A;  3HKZ B;  2EE1 A;  4KD4 A;  3HOU B;  4YIJ A;  3HOV B;  1A6X A;  2NVQ B;  5D3I B;  1MSG A;  4NDX A;  4K8J A;  3VA7 A;  3UI2 A;  3PUZ A;  1VF5 C;  2PNR C;  5JAV A;  3KUP A;  3X3M A;  3QIA A;  2OEO A;  1S5F D;  2DN8 A;  3W2D A;  4ZYS A;  4EQP A;  1PRT B;  4FP5 D;  1STE A;  2KOL A;  5C44 B;  5T1I A;  2EYJ A;  4RA8 A;  1ONL A;  4TQU S;  5M5X B;  3OMC A;  4V0B A;  3IFD A;  5TSS A;  2L9H A;  3S15 B;  1GHJ A;  2EY6 A;  4HN7 A;  4R9W A;  1SXT A;  3BDC A;  2EVB A;  4LAA A;  5J39 A;  4C3I G;  4QUC A;  2WKC A;  2MHV A;  1AEX A;  2BDO A;  5E1F A;  1DZ1 A;  2KVM A;  2JSO A;  2PW7 A;  1TS5 A;  1LAB A;  2F0Q A;  3I73 A;  3RZO B;  4FYD A;  3S17 B;  2D5D A;  2MJ8 A;  1EY4 A;  1JOR A;  4UAI A;  4K5V A;  1I6V C;  3S1R B;  3BS1 A;  4ZUJ A;  2C5C A;  2MGS A;  1B2T A;  2ZXP A;  5E3F A;  1ML0 D;  3KK7 A;  1SE2 A;  1F9Q A;  1LT5 D;  1FNU A;  4HAE A;  1MD2 D;  1F77 A;  1UAP A;  1CI3 M;  1IKM A;  4FO2 A;  2F0W A;  4H7B A;  1U4P A;  1BOS A;  3PO3 B;  1JE4 A;  1FR3 A;  1LV9 A;  3BDO A;  3T16 A;  2FIN B;  1ILP A;  1KDC A;  2I07 B;  3T13 A;  5LHY 1;  1QCB D;  1EIG A;  3AMU A;  5F2D A;  4OO1 I;  1OXS C;  3PUW A;  1B44 D;  5HUR A;  1J9O A;  2NWG A;  5C3W A;  4HR7 B;  1RDP D;  3NP8 A;  5IGD A;  2H1E A;  4O42 A;  5KND A;  3DXJ C;  1EU3 A;  1G29 1;  4IFD H;  3MZ5 A;  5E4X A;  3I8Z A;  5ELB A;  5JPN C;  1E0B A;  3X3N A;  1XWE A;  1AZP A;  3AB9 A;  5CC4 A;  3GTL B;  4Z9C B;  4B9W A;  1VDZ A;  1A2U A;  2PCF B;  2RDH A;  1WTX A;  2HQE A;  5E4W C;  1HXY D;  3K57 A;  2K33 A;  1T5E A;  4C1N I;  4OIK A;  3VR2 A;  1FNW A;  2EPB A;  1I4G A;  5CR3 A;  2QF7 A;  2CW0 C;  3GTM B;  4H0L C;  3SK8 A;  1GUN A;  1PYW D;  1LT3 D;  4ID6 A;  2NZ1 D;  4MN3 A;  1LT4 D;  3CU7 A;  2JYO A;  3PUV A;  5I9O A;  3HP3 A;  3BVG A;  3PV0 A;  3H91 A;  3H6M A;  5IOD A;  1H9J A;  1BCP B;  3TME A;  2N55 A;  2M9V A;  2EYM A;  3D6W A;  4DNT B;  1EIH A;  2F3W A;  2L1B A;  5EPJ A;  1TWH B;  3GTK B;  2PPB C;  4C3H G;  2SEB D;  3TP6 A;  2XWB B;  2IX3 A;  1MI2 A;  4F88 A;  3SEB A;  3C2P A;  1EZ6 A;  1JOO A;  4IUN A;  5A2Q E;  1I4R A;  1OXT A;  4QMG A;  5C4Z A;  2NN6 H;  4A3I B;  2E75 C;  3QOL A;  4C3J G;  3Q6S A;  1TVX A;  3NSW A;  1F2Y A;  3I70 A;  2B2W A;  2K5W A;  1G8Z D;  4G57 A;  4IFD G;  3K5M A;  1Y1W B;  4MHE A;  5CV6 A;  1EQT A;  3TSS A;  5FLX E;  1NR2 A;  1OXU A;  3H3V C;  1B3A A;  3GQB A;  2E76 C;  3OPO A;  1RKN A;  4A3F B;  1G91 A;  3KLR A;  4N9T A;  2X6L A;  3A56 A;  3CQZ B;  1DON A;  4KY6 A;  1IHZ A;  3ITP A;  5JPM C;  3VYS A;  5CGK A;  4ODG A;  2NBF A;  2NTT A;  4WFN 3;  2FJ2 A;  1DD2 A;  1CHP D;  3V05 A;  1EYD A;  3SXH A;  2ENB A;  3FDT A;  3BDL A;  5I4D A;  1C8C A;  2CQA A;  1CZG A;  4HSV A;  1DCZ A;  4M1U B;  2NB0 A;  2D2C C;  5IGC A;  2X69 A;  2O5I C;  1PFN A;  2KCC A;  5LL6 X;  4XYQ A;  4C2M B;  1I4P A;  1V1P B;  5KEE A;  2O2L D;  4F87 A;  3S16 B;  2G9D A;  3D6C A;  1VCI A;  1C4Q A;  1STH A;  1CTM A;  3OWE B;  1HTP A;  4BBS B;  4DAP A;  1QWY A;  1DOL A;  1OXX K;  2A6H C;  3H94 A;  1ESR A;  1UUP A;  2X6G A;  5EGT A;  1WD0 A;  1I4X A;  5A2Q L;  1QIL A;  2H4O A;  2NN6 G;  2MPM A;  1SYD A;  3MAQ A;  2R92 B;  3NQI A;  2K05 A;  4HMI A;  2EJG C;  1BNZ A;  1PZI D;  4KY7 A;  1HFN A;  2Z4I A;  2B2U A;  2OF1 A;  4CJ1 B;  1KAA A;  1A3V A;  1BXT A;  1B9M A;  5FLX L;  2PYK A;  2J4X A;  1AFP A;  2F0G A;  2FMC A;  3J7Y W;  1A3T A;  1F2Z A;  2E74 C;  2OT2 A;  3I4N B;  4FXD A;  5I9P A;  1YNN D;  1TWC B;  4RGT A;  5AFW A;  2J0T D;  4XT3 B;  2RDG A;  2YYZ A;  5IGG A;  2EYF A;  4CKB A;  2GA4 B;  3TZD A;  2ICI A;  1W6J A;  1JWM D;  1Q90 A;  5IT9 E;  2HDL A;  3C3L A;  3FEW X;  4KKT A;  2R7Z B;  2SOB A;  1RTN A;  4RHS A;  1WTW A;  3OIP A;  4ZKB B;  1LT6 D;  1GOZ A;  1V1P A;  1JC7 A;  2MUY A;  3KF8 A;  3D8G A;  2K5D A;  1DOK A;  1Z47 A;  3S14 B;  4NP5 A;  1QNK A;  2F0L A;  3ONA B;  2B2T A;  3NXW A;  2LMC B;  1X3P A;  4CKE A;  1VMC A;  3DMU A;  5ELD A;  3J80 E;  1F9P A;  2B39 A;  3HG9 A;  1PZK D;  3QG1 A;  1ENF A;  3Q22 A;  1U9R A;  1HA6 A;  3PUY A;  1E2V A;  1G2T A;  5KNC A;  1TS3 A;  1O7Y A;  1KTK A;  2PQE A;  4C1N K;  5EBD A;  2FMM A;  1JB3 A;  2NTS A;  4IUV A;  5JVH 3;  4KN4 C;  3TDQ A;  4XDX A;  3DEO A;  1SJE D;  2KEE A;  1JIC A;  1EU4 A;  1TT2 A;  1STB A;  1STG A;  3MFG A;  4RKL A;  2R3Z A;  5CV8 A;  1EEF D;  2K7V A;  1E2W A;  5EPK A;  1ICW A;  3PMF A;  5KGU A;  1KAB A;  3S9W A;  2LKV A;  4KD3 A;  3R2T A;  4KHV A;  2B2Y A;  2R61 A;  3HS0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...