1FR3A

The high resolution structure of a molybdate binding protein from sporomusa ovata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MKISGRNKLEATVKEIVKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the molybdate/tungstate binding protein mop from Sporomusa ovata.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords MOLYBDATE/TUNGSTATE BINDING PROTEIN
total genus 12
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fr3A00
3P20A 1I6VC 5BN3A 1E2ZA 1GUOA 1VCIA 1E2WA 3QIAA 3QJYA 2B8GA 3SE0A 2K32A 4IQZA 5BN5A 2QF7A 1IW7C 3OPOA 4HR7B 3T56B 3IFTA 3VR5A 3I73A 1OXTA 4DK0A 1ZYRC 3QG1A 3M7NA 1Y8NB 2D62A 4DNTB 3VA7A 2KCCA 2DNEA 2E76C 2ZT9C 2JXMB 3A7AB 3T53B 4H44C 2B8FA 1H9JA 3PUVA 3WDNA 1T5EA 2D2CC 5C0XH 1GHKA 2BDOA 1FR3A 2E75C 1IYVA 3U9SA 4H0LC 2L5TA 2PCFB 3A8JE 1O7LA 1V43A 2AWOA 4IFDH 4LJZC 2IT1A 1HQMC 1GHJA 3I72A 3KLRA 3PUWA 4JK1C 1OXXK 5K36H 5K36G 2EJGC 1VDZA 4KKUA 2AUJD 3ND9A 2A69D 4I7ZC 5KNDA 1Y69U 2A6HC 2PPBC 2O5JC 5KNCA 1HTPA 1Q12A 2EJFC 3L7ZC 2R6GA 2D5DA 3H94A 5JEAG 3OW7A 1IYUA 2EVBA 2NN6G 3MXUA 4KKTA 3HGBA 3AB9A 2PNRC 1YNNC 3D31A 3VR2A 4DK1A 1FYCA 4JBWA 1A6XA 3PV0A 4BA1I 3TZUA 2JEAI 1E2VA 2DNCA 1H9SA 3LWUA 4KN4C 2LMCB 2BA0A 2E74C 1GUGA 4H13C 3BG3A 3M85A 4G7ZC 2KA7A 2NN6I 1H9RA 2A6ED 4L8JA 3NE5B 3A8KE 3SDZA 1VF5C 3VR6A 3FMCA 2DN8A 1H9KA 1Y8PB 2F1MA 3FPPA 1SMYC 3LNNA 1HPCA 4KN7C 3CRLC 1Y8OB 4G7OC 2JEBI 1LABA 1H9MA 2BE5C 1IW7D 4TQUS 1CI3M 1K8OA 1Q1EA 1Q90A 2Q8IB 2EDGA 1DXMA 3PUXA 5A35A 1V8QA 1B9NA 3EQLC 4OGQC 4KHZA 3I4LA 1BDOA 1EWHA 1K8MA 3MFYA 4TKOB 4DNRB 5BN4A 1OXVA 1QJOA 1TKWB 1G291 3D4RA 4OO1H 1B9MA 2A68D 2YYZA 2AUKA 4BA2I 3A7LA 3OOCA 2NN6H 3IKJA 2JE6I 2CW0C 1H9SB 2K7VA 2BE5D 2EJMA 1VF7A 4XTCS 1GUSA 1Z7TA 2A68C 4LK1C 1ONLA 4KKSA 4KMUC 4PV1C 4G7HC 1Q1BA 2A6HD 1Z6HA 5C0XG 3A8IE 1HCZA 2A69C 3VR3A 4IFDG 5JEAH 1OXUA 1O78A 1GUTA 4RCNA 1OXSC 4OO1G 3RLFA 1GUNA 3ND8A 3PUZA 1TU2B 4XIGS 3VR4A 3M4YA 4KI0A 3T51B 1PMRA 4GZYC 1GJXA 3W3AA 2BA1A 3N6RA 1YNJC 1DD2A 3DXJC 1CTMA 2K33A 3GQBA 3GD7A 1LACA 1CFMA 1DCZA 3BDOA 3CRKC 2V4DA 3PUYA 2O5IC 5KNBA 2A6EC 1ZKOA
chains in the Genus database with same CATH superfamily
4O0AA 2NVQB 2QEXA 3CKIB 4KLKA 3OPOA 5M5XB 3CCVA 3CD6A 4A3GB 1IYJB 4QIWE 4QQBX 2D62A 4KJNA 4DV4L 4A3KH 3K8AA 1STAA 4C3JH 2VS1A 5IT9E 2SNMA 3PO3B 4JI8L 1UWVA 2R92B 1KNEA 2K5HA 3PO3G 1UE6A 1V43A 1PYWD 2K52A 1WTPA 1UE1A 2SNSA 1SFOH 2JA6G 4I7ZC 4N8FA 1ICWA 5EBDA 5KNCA 4QCLA 3KBGA 4RGTA 3GTGB 1Y14B 4APVA 2EVBA 5F2DA 3TP8A 4DK1A 3D6WA 4BS9A 5IGDA 5FJ8G 5DAUA 1PYSB 4R9WA 5C3EG 4JI5Q 3KF8B 1TQOA 2JSOA 4DR7L 5KYLA 1KDAA 4RAUC 3H91A 4XXEA 1N36Q 1Y8PB 1PVOA 1RD9D 1GKHA 4J8QA 1Y1VH 3NTKA 4DXFA 2ID0A 5ELEA 1SR3A 4MTKA 3S17H 2ICEC 1HUMA 3GP7A 1KDBA 1K8OA 3F2BA 4A93G 1Q1EA 1M90C 1LTSD 2F3VA 4KV6A 3VDYA 3ONAB 4KHZA 1TS4A 5BN4A 2EOTA 3MC0B 4V0BA 3P7JA 1E3PA 1AP0A 4X65L 2D0OA 3EBEA 3W5OA 3KDFA 4KY5A 2BDNA 4B3SQ 1Y1WB 5CV9A 1HCZA 3A5UA 2WAQE 1W3SA 4IOAA 1SNPA 2I46A 4LF8L 1HUNA 4NXNL 3J81E 3H15A 5LL6S 1I4QA 1N9WA 3H6MA 1PTOH 1SE3A 1LM0A 2K33A 1B2TA 3L3OC 4KK7A 2EY2A 3BDOA 3U9OA 1STYA 3MFGA 1WJJA 2UXBL 3X3NA 3HOZG 3E6ZX 4EQ5A 1FJGQ 1NMFA 2PQEA 1E1TA 2B8GA 1SAPA 3ZYYX 4HR7B 3P75A 2CHBD 2HIXA 2J4XA 1LO5D 1XPOA 1XMQL 3TRZA 5M5WH 1WTOA 4DAYB 5I9PA 1XNQL 3S1RB 1CKNA 1VQCA 2EYHA 2BDOA 4DV6L 3J7ZC 1FR3A 3H0GB 3T4AC 1IYVA 4DR6L 5CC4A 2CWAA 1B44D 2ZTCA 4LMQD 5M5WB 1E0BA 2WFWA 2UUBQ 2F4VQ 4IFDH 4LJZC 1TWFH 4BBRB 4AQYL 2AQ3B 5JVH3 1HA6A 4ZKCB 3I4NB 1EQQA 4A3DB 5M3FB 1AFPA 1JMCA 2EXZA 1Q12A 4IO9A 3S2DB 4KHPQ 1EQTA 4HSVA 3WWVA 2K5DA 2K6AA 3ITPA 3MA2B 1KABA 1K73C 1NMGA 4BXXG 1L0YB 4LNQA 3CCRA 2R93H 1KL9A 1PA6A 2JA8H 1LT5D 2RVLA 4LF5L 4NXML 2ZJPA 1VQ5A 2BH2A 2A5HA 1D5XC 1X6OA 1I6HB 4A3CH 5M5XH 1IBML 1VQFA 1CI3M 2IPKD 4ZUIA 2XVSA 4A3IB 1JJ2A 3FHWA 1OXVA 1STEA 4IN3A 3NEMA 2EY6A 3EROA 1JWSD 4P74A 1C4QA 1X3QA 4N8X1 2F03A 3G6EA 2EYMA 1X3EA 3A8IE 3S1MB 4IPDA 1NCVA 1ENCA 4IFDG 4HJ8A 3E3XA 1YHBA 1MIUA 4YHHQ 2HD3A 1QVGA 3OTOQ 3VA5A 2NVYB 2O4XA 4A75A 3S1QH 4GOPB 3SK4A 4JYAQ 2MHVA 1WTHA 3E0EA 1CFMA 4B3MQ 1QOHA 2CQOA 4A3DG 1ILQA 2UXDL 3HOWG 2VQEQ 3NQTA 5KNBA 2A6EC 2F3WA 3I90A 2B63H 3AU7A 4IUTA 4PZ7A 1VQNA 5FKAC 3JAMc 4HTHA 3IFDA 3PO3H 1XMOQ 1KIXA 4N9TA 3GTPH 4TRDA 5E4XA 2HDLA 5JEAJ 1ZYRC 1W6KA 5IWAQ 1KDCA 3VA7A 4RHRA 3L2PA 3SXHA 3KJPA 5C0XH 1GHKA 1EUJA 2Q8TA 3L9AX 4UP9A 1YEZA 4KY7A 4FXDA 1O7IA 1CKNB 3PIPA 2F0KA 3RZDH 1F9QA 2VY3A 3CCEA 1YNXA 4KKUA 2QCPX 1XNRL 2X6GA 1HR0Q 4C1NK 1Q81C 3O13A 4FYDA 4K8IA 3U50C 2ZM6Q 4A3MH 1SYEA 3UDXA 3M9BA 3V05A 5JEAG 3KFUA 1IYUA 5LMNQ 3PF5A 1KAWA 5IYCG 4G57A 1JT8A 1PFSA 1VQEA 1A6XA 3PQIA 3BS1A 1TWGB 4H13C 4HJAA 2VW9A 1A15A 1SXTA 2F0LA 4B3TQ 4LUOA 1JOKA 5CYUA 1SRUA 1Y1VG 4DR1L 3HKZB 1JJCB 3HKSA 1EWCA 1F2LA 2B2WC 3U58A 1IW7D 1SMXA 4WFN3 3PUXA 1TR5A 3Q0AA 3J80i 1HNXQ 5DNFA 3ULPA 1FNWA 3QR8A 1X65A 1G291 2EY1A 3FPUB 2D9UA 3DMUA 4B3RL 2A68D 3J80L 1C8CA 1R9TB 3V96A 5EKLA 1BXTA 1ZXTA 1PZID 5HGQA 4XTCS 4DXGA 4R4CA 4RFBA 1Q1BA 2L4NA 4A3EB 1VQ7A 2JA5B 1JB7A 5FO9B 1X54A 4P73A 3SEBA 1PH8A 1G8ZD 4A3JG 3J81L 2A8VA 3S1NB 3KK7A 3TQYA 3S14B 1GOZA 3PO2G 2B2VA 1WCMH 5ELDA 1LYLA 4TVAB 2NVQH 4DGZA 4A3KG 4JI3L 2OT2A 1TWFB 1J8IA 4K5VA 2UUAQ 3M3YH 3I4NH 3S14H 2X69A 3P20A 1TIID 1WCMB 4NPSA 1E2ZA 3FRPB 5I2XA 5GAGC 1KHIA 1L1OA 4J6HA 4F7XA 2F0WA 4MIUA 2KECA 1DOMA 4GKKL 1L2FA 4K14A 4X62L 4NDXA 3IAYA 2XWBB 1A62A 1H95A 1U4RA 3NENA 5JPNC 3TP5A 3T1HQ 1N34Q 4JI2L 3NELA 2HCIA 4FF1A 1TXYA 3LWEA 2F0SA 5M3FH 2E8GA 2IL8A 2B2WA 2RHQB 4LF4L 4DV7Q 1C9OA 2VQFQ 4YIJA 1X3FA 1LT6D 3PCOB 2KQ3A 2R3ZA 5GAHC 3JAME 3CXCA 3I4MH 1M8AA 2EJFC 2F0HA 2FINB 1TT2A 4ID6A 3HOXH 1Q8IA 4X3UA 3X3MA 4A3GH 2IJ0A 3MEFA 1I4RA 4JI7L 1E2VA 2L1BA 3S2HH 2LMCB 2K5NA 1AZQA 1ICFB 3Q24A 4DV1L 1JJGA 3A8KE 3BU2A 4EQPA 4XYOA 4PG3A 2EYOA 5G3LF 1BQQT 2E2HH 3HOXG 2GA4B 3K7AB 4KN7C 4UHVA 1HZBA 4ZK9B 2B3GA 1JC7A 2E2IH 4LFAL 4L63B 3HOVH 2G9DA 1DOKA 1JCKB 4ABNA 5FOBB 4L5QA 1B9NA 4CGYB 2M2LA 3EQLC 1UEAB 3RD4A 4IUVA 1BDOA 4C3IB 1S72A 2N8NA 4ZQ3A 1QJOA 5E4WC 4GNXC 1KRSA 4XT3B 4FF4A 1PHJA 4OELB 1HFNA 2EJMA 5J1ZA 3J81c 1EIFA 4NP5A 2B63B 3IL8A 4CKCA 3DEOA 1Z7TA 2A68C 2NVXB 2N88A 1PTOB 2R92G 1I3QH 3Q8DA 2M00A 3J7A5 2F0EA 2YU9B 2XRQD 1NAPA 2L9HA 5E3FA 1GUNA 2OXPA 3PUZA 5C44H 4GLXA 3GTGH 3FVQA 5CV7A 4IUPA 1TWGH 2KCMA 4DV2Q 1K9MC 4YCUA 2HHHL 1U4MA 4DR5Q 4BBSB 4JI5L 2RF4A 4QF4A 3UE1A 2KCTA 4OXPA 2OEOA 5M3MB 3HOUH 4DUYQ 4F8MA 2KHJA 1N33L 3BVZA 4POGA 1Q7YC 2I0QA 2F3IA 5M3MG 3HRZC 3J7AV 2AMCB 1X55A 2Q2HA 1EQRA 1UEBA 2KHIA 1BCPF 4XT1B 3FEWX 4GS3A 1KLUD 2LY7A 3WOFA 3PUVA 5C4XH 1CK1A 1HA5A 3HS0C 4P72A 2Y0SE 2PCFB 4L6TB 1SMYD 2AWOA 1I4GA 3PUWA 1L1OC 4HCEA 3PO2H 2RHSB 4CJ1B 1HXYD 2XTIA 3S15H 1S40A 4DA2A 1IBLL 1IKMA 4Y52H 4JCVE 3T16A 5ELFA 3SK6A 2B2VC 2UU9L 2UXCL 3W1GA 1VQAA 1R9TH 2JYOA 5A2QL 3SK8A 2JK8A 5HGTA 3NE5B 4A3LH 1VF5C 4IUQA 2ENBA 3OW2A 2I5MX 1XWEA 1MI2A 4DR4Q 1MBYA 2DUDA 4DR3Q 1LABA 2PMZE 2BE5C 1IHZA 1DXMA 1KLGD 3S2DH 4KJOA 1HZAA 3K6OA 3NXWA 3SVMA 4PMWA 2OWOA 1XTDA 1YHQA 1FNVA 2JA7H 2E2IB 1YNND 2EQSA 1DJRD 5J3BA 3TREA 1B3QA 3KLSX 3GTQH 5LHY1 1WTXA 5JJKA 1A3UA 5ISRA 4A4IA 2JA8B 1U4LA 3S1QB 2C5CA 5ELNA 1CKMA 5FK9C 3D3RA 1UE5A 2UUCL 1MGSA 1UAPA 1GUTA 4YCVA 3HOXB 2NVXH 2SOBA 2E5LL 1R4QB 4RKBA 4XIGS 3HP3A 4FP5D 4IUNA 3I91A 1XTCD 4GN5A 1YNJC 5C4JH 1MJEA 1XX8A 1EEFD 1BOSA 4N9PA 4BY7G 1Q3LA 2Q2UA 2F0UA 1A3VA 4B9WA 4JI0Q 1LTTD 2RBMA 5I2YA 1D1IA 3G71A 3K5OA 5IP9H 1K83B 2MO1A 2ZJRA 4DAVA 2B2YC 4YY3Q 1HNZL 2Z4HA 3CHBD 4U68A 5BN5A 2KENA 1AEXA 3ZJYC 2A73B 1I94L 2ZXPA 2QILA 3HOUB 3Q23A 2HQEA 4MHEA 3V2TA 4EQOA 1PTOC 1SNMA 5HURA 2DJGC 4R4OA 2KHSA 2O2LD 2JA9A 3NPPA 1N32L 1RJTA 5IT9c 1EYCA 1EL0A 1QG7A 1LTBD 2IX1A 2H5XA 2QW7A 4JI8Q 5CV8A 5EPLA 1OXXK 1A8VA 3G4SA 2FMMA 2WAQG 1EY7A 1STNA 4A3CG 3ERQA 2PNRC 3I56A 3NBHA 3R93A 1AE2A 5IGEA 1SYFA 3LWUA 4UPAA 2LKVA 4CKEA 2BA0A 1KC8C 1J5EL 1II3A 4X66Q 1JR0D 2KA7A 2WP8J 1Y1WG 2JJQA 5M3MH 4HIMA 2ATWA 2QDBA 3VR6A 4CHTB 3AYHB 3BVMA 1HPCA 2PYKA 5FLMH 2YU9H 5JJLA 1Q90A 1NR2A 1BO0A 1E24A 1XMOL 4DNRB 3C2PA 1HTLD 2AKWB 4X3SA 5KGUA 2B2TA 1EEID 2RCFA 1U9RA 3DHQA 3R3OA 4BXXH 2NTSA 3CCUA 4PV1C 1K0RA 3S1NH 4DUZQ 1NJIC 3DUZA 2D0PA 1XNRQ 1HR0L 3RLFA 1B3AA 2ZM6L 1YHAA 3A54A 1YJNA 4KI0A 3T51B 1BBXC 4HJ7A 1VQPA 1VQGA 2F0NA 2I5LX 3NHHA 4MNOA 4Q0FA 4ULLA 4LF8Q 4GLVB 3J80E 3GD7A 4UY8C 1RHPA 1GM5A 2HT1A 3CRKC 2YTVA 3RR5A 1SSOA 2WKDA 2L55A 2RA4A 1GUWA 2KOLA 1KXLA 2PI2E 4B3TL 4FDBA 4R4QA 3DM1A 3C3LA 2K1BA 1VQLA 2F0OA 3QG1A 4FO2A 3A56A 1S5DD 5CV5A 4H44C 4A3GG 2R93B 1CQFA 2RSNA 4KTAA 1QUQA 3N52A 2E75C 4M8AA 4H0LC 3E5SA 1PZJD 3I4MG 5CGKA 4GOPA 4B3RQ 4DV6Q 4DAYA 2K5QA 3VYRA 1VDZA 1VQ6A 2AUJD 3URYA 1LTLA 3D8GA 5J39A 1BBWA 5GAEC 1K3RA 4MZ9A 3ER0A 3TP6A 1K0SA 1RIPA 4JBWA 4OO1I 1BR9A 1TY0A 2BH8A 1F2MA 4KN4C 3F2CA 1Q46A 1U5KA 5M5YB 1GUGA 3TS0A 4X3KA 1DM0B 1KD1C 2F0IA 3VYTA 1BNZA 2ZXOA 4C2MB 3M3YB 2G5DA 3S16B 4GKJQ 3J7YW 2IHEA 4ME5A 4HSPA 1EY6A 4OX9L 2EY5A 1DYQA 5LMUL 3K81C 2H1EA 2EZVA 1SNDA 2RSOA 3K59A 4IFDJ 3S16H 5IY0A 3HOYH 1EWHA 2QDLA 2WAQB 4X62Q 4DR2L 2F0FA 4BA2I 4OWXB 4J15A 1H9SB 2K7VA 2NVTB 1N34L 3CMAA 3CAMA 1FGBD 1SYBA 1BCPD 2L15A 4C3JG 3MWYW 3TZDA 4B3SL 3K0XA 1DONA 1EFWA 3FDTA 1QCBD 1ESRA 5FJ8H 5C4JB 4GNXB 1SJED 1PDQA 4BBSH 1EY9A 1TU2B 3PIO3 3CC7A 4YHHL 5COYA 4A3BG 3D4WA 3S2HB 1DCZA 4ZYSA 2OTLA 2ICIA 1TWAB 1I6VC 1PRTC 4QJFA 2I5HA 1E2WA 4DV3L 4CDDC 3TSSA 1TWCH 3BZCA 3HOVB 2HUGA 1QZHA 2NZOA 4LFAQ 2SEBD 3WDNA 3MHBA 5IYCH 2CH4A 2MPMA 4CBVA 1PH1A 5J22A 1MHWC 2F0VA 3U4VA 2EYPA 4A3BH 3KLWA 3TP7A 1T9HA 1GHJA 2WINB 5EKIA 4Q5VA 4JK1C 3K5MA 3G48A 3TBIB 4AQYQ 4IPHA 2FMCA 1HJPA 2KBNA 2O5JC 1PXUA 2D5DA 3H94A 3A5ZB 3ULJA 4KKTA 2WB1E 1PFNA 1CM9A 3GDEA 3NBIA 4BY1B 5JJIA 5E1FA 4X6AH 3MTSA 2E74C 3CF5A 1NY4A 5GROA 4LF7L 1H9RA 1VQOA 2PZTA 1EU3A 4DV2L 1FGUA 2F1MA 4BWGB 2B63G 4RKLA 4UDUC 2C9OA 5LMNW 1Y8OB 2IX0A 1HNWQ 1U0LA 5JVG3 4TQUS 5CV4A 4K6DA 1MJCA 2EDGA 1N33Q 3OMGA 4DV4Q 4AIMA 1EQVA 1AN8A 1PV4A 5EJWA 1SE8A 1E1OA 2QKIC 2YYZA 2Y0SG 2NN6H 2HQLA 1SNCA 4OONA 2KCNA 2YTYA 4CJ0B 4G7HC 5GQOA 1RDPD 3F1ZA 4GN3B 4LFCL 5T1GA 4L5TA 3RN2A 5FLXc 1EIYB 5I4DA 4JOIA 1PRTB 3ND8A 2CQAA 2MFIA 4TSSA 4DPGA 1FVIA 5C44G 5DEHA 3RLNA 2UU9Q 4DR7Q 4CDCC 1JICA 4DF7A 3PUYA 2Z4IA 1Z9FA 3CCJA 1TWHH 2VQEL 4HJ9A 4E6IA 2CW0D 1G2SA 1V1PB 4K0KQ 4K5WA 3A0JA 4IQZA 3K0YA 1I6HH 1I50B 1QILA 3JC66 5NUCA 3DWQA 4DAMA 4DK0A 1JOQA 2MJ8A 3M7NA 1MKHA 1NE3A 1JQYD 3HEJA 1EYAA 3FKIG 4BBRH 3GTPB 1JE5A 1G6PA 4RGOS 3EJIA 4PZ8A 1VMCA 4AH6A 2OF1A 3FKIB 2GN5A 4A3KB 2K50A 3I4OA 2PW5A 4HN7A 3MVVA 1S5CD 5ELCA 1RODA 1SNQA 5BR8Q 2JP1A 5KNDA 1JWMD 4RHSA 3MXPA 1HTPA 3FP9A 2B2TC 3MZ5A 2Y0SB 3VR2A 1VQ8A 2OTJA 1BKBA 3HKZE 2NVYH 2G9HD 3KYHC 4HMJA 4BA1I 2F0MA 3TZUA 4PZ6A 2MGSA 2DNCA 2I07B 4GN4B 1YJWA 4F87A 4R4IA 3GTKB 5IE8A 2IWHA 4WJWA 5JOBA 1TWAH 4AYBE 5C3WA 5IIFA 4HIOA 1N8RC 5A2QE 5C3EB 4DV1Q 1I3QB 1S5ED 3HOYB 3GTKH 4QMGA 5K5PA 1D5MC 1WTQA 2JEBI 4AYBG 5FLMG 4PMCA 1Y1VB 2R61A 3BYTB 4H7BA 1RCVD 4QY7A 1Y1WH 5FO8B 3GV3A 1SN8A 3AQQA 3NK9A 2F4VL 4PQXA 5G3LD 1HQRD 2NUCA 3S15B 2XSCA 4H02A 5IYBH 1OXUA 1O78A 5KEEA 2ZXRA 5C5LA 3I7FA 2IW3A 2OQKA 1PMRA 4JVZA 4QB4A 3W3AA 4FXKC 2IHFA 2GVAA 5IP7G 3I8ZA 4JI3Q 4JI4Q 4NW2A 2Q2TA 1S5BD 1PTOD 5CR3A 5D3IB 3H3VI 2ZTDA 3PSIA 4DV5L 5EQ0A 4LF9Q 4R8IA 2JA5H 1IZ6A 2Q8RE 4GKKQ 1HRJA 1LTID 2MP1A 3T53B 5IP9G 1H9JA 2R7ZH 3RZOH 3SR1A 1B4OA 1ET6A 2RCNA 4JI2Q 3U9SA 3K5NA 2A1AA 2L5TA 4BY7H 2R7FA 1QE6A 3GTJB 4LW1A 4DV7L 2R7DA 2VQFL 1TVXA 2A69D 5E7NA 1SEBD 1BVSA 4JW0A 3PIP3 1Y69U 1EOVA 2A6HC 1QZGA 1BF4A 5IP7H 3S24A 3TS2A 1I4PA 4DUZL 3QOJA 3I4MB 4KHVA 2JEAI 1VQMA 1H9SA 1B1ZA 2WB1G 3NTIA 5I9OA 4G7ZC 1W2BA 1PH4A 1QNUA 3OIQA 5IYBG 3I70A 1G6ZA 1EU4A 4A3MG 1EIGA 2Z0SA 3CCLA 2K01A 4RWSC 2B2YA 5C4ZA 3CRLC 4G7OC 4YWLA 1IKLA 4C3JB 2Z6KA 1YIJA 2NVTH 4HIDA 4XYQA 4X64L 3CCMA 1TY2A 1K8AC 2AHOB 2MO0A 1B9MA 3MAQA 4OL7A 1YJ9A 1GO3E 5EAYA 1CZGA 1ONLA 4KKSA 4JBJA 5AJ3Q 4JBKA 2LFNA 2JA7G 1Z6HA 1BCPB 4KHPL 3CW2C 1A2TA 5JJZA 4DV0Q 1WYDA 3BDLA 4RCNA 4HIKA 1ASYA 4IPGA 2K05A 4LF6L 3ERSX 4P71A 1VS0A 3M4YA 2UUCQ 2K75A 1GJXA 4DNIA 1SNOA 3N6RA 1DD2A 1SBBB 3PF4A 1ASZA 1F9PA 4QUCA 3BJUA 4POFA 4DR5L 1X9NA 1TWCB 2F0DA 3GTMH 1IBKL 3QJYA 2A19A 1IW7C 4V190 4DR1Q 2MUYA 1HHVA 3BYYB 1EIHA 3C46A 3M4OH 2OQ0A 1Y8NB 5C5MA 2F0QA 4EX5A 1ET9A 5LMUQ 1T5EA 4UP7A 3QB3A 1G2TA 4YWKA 4EQNA 2F0GA 1PH6A 2BOSA 3CQZH 4IURA 3TEHB 3RZOB 5C4XG 3HOZB 3S17B 4RCOA 5KYIA 1DGSA 3L7ZC 4R4TA 3UDFA 3LGJA 3OTOL 4ZUJA 2V1CC 2VNUD 1IXRA 3HGBA 1YI2A 4GNXA 4U673 3KOJA 3SGIA 4A3FG 1MD2D 3HOUG 3BG3A 2IX3A 3D4DA 2F0TA 1WTRA 4R1JA 2NN6I 2F0PA 4LWCA 3SDZA 4LFBL 2CCZA 2DN8A 4ME3A 4JI1L 4A3BB 3LNNA 2KJXA 4RMFA 2RDGA 3PGZA 4DR3L 4JI6Q 2F52A 1WTVA 2K03A 1V1OA 3RUZA 3B6YA 3BVGA 3R2IA 4WJ4A 3HKZG 4TKOB 1XJVA 1J6QA 1SE4A 5EBCA 2HIVA 1CSPA 4BY1G 1F9RA 1STBA 3A7LA 3OOCA 3OIPA 4ZAIA 1D2BA 3IKJA 2QGQA 2CW0C 1K3BC 4EGVA 1GUSA 4JPBW 4ZKBB 3CCQA 4XQJA 1P16A 4LF4Q 1PFBA 1PLFA 4F88A 5C44B 4WJ3M 3KF6B 2XWJB 3WOEA 2A6HD 5CBAE 2XNAC 3PO2B 2A69C 4B08A 5EPKA 1OXSC 3BZKA 3OHXC 4O2DA 2E2DC 2VB3X 2E5LQ 3ICEA 2E2JB 1L1OB 1JE4A 4C56C 3DXJC 2C35B 4ZCKA 4C2MH 5D3DA 3KF8A 2KVMA 1FJGL 1AZPA 4RGNA 3I55A 1M1KC 2EIFA 1G91A 2K32A 2QF7A 1SJHD 3VR5A 3J81j 5DM73 2EXDA 4IZ8A 3GTMB 2H4OA 2L0CA 2DJFC 3NWSA 4DNTB 1HNXL 3KJOA 1EY5A 2ZT9C 3I4NG 4CJ2C 1CHQD 4DR6Q 1BUVT 3P1HA 3VYSA 2TMPA 3IRBA 2NBFA 5IODA 1N32Q 4A93H 1O7LA 3EVQA 1WCMG 1EZ6A 1FNUA 2J7ZA 5K36G 1LT3D 1S3OA 1PFMA 4A3JH 2PPBC 2L12A 3K7UC 4JOIC 2R6GA 1XPUA 4EVOA 1S5FD 3CP0A 2NN6G 2NZ1D 3Q6SA 1WD1A 4LFCQ 2EPBA 1O80A 3STBD 3MXNA 4A3JB 5C3EH 2LSSA 1WI5A 5LL6X 3GTOH 2RQXA 1N36L 3M85A 3PIOA 1CZWA 4X66L 1B70B 2JQOA 2QEJC 1O7ZA 3UDGA 4YWMA 3AFPA 1Q82C 1H9KA 1C7YA 3FPPA 2JA6H 4A3IH 3GTOB 5CBEE 1PH2A 1STHA 2EYJA 2K28A 4IPCA 1VQKA 1SFOB 2CVRA 1ZYRD 4DAPA 2Q8IB 2PZUA 3E9IA 4HMIA 1V8QA 1CA6A 2JA6B 4OGQC 1PTOF 1GXDC 3G6JB 3K7AH 4X65Q 3DEPA 3T1HL 1EZ8A 4HAEA 4DN4M 3GV6A 3H09A 4A3IG 4J1MA 4OO1H 1GVPA 2PZWA 4OIKA 1RTNA 2N49A 3E0JA 3A74A 2CH4W 4FNFA 3AEVA 3CCSA 2IY5B 2NB0A 3VR3A 5C3XA 5JEAH 1BCPC 2EE1A 5BR8L 2PO4A 1D7QA 2YV5A 2AWNA 5DLQE 1CTMA 3E9HA 2M9VA 4GOPC 1VQIA 3EIVA 3CQZB 2UXDQ 3MEHA 2V4DA 1ENAA 5C0XG 4HCSA 1PYBA 4K8JA 3AB9A 3D31A 1LTGD 2PQAB 5IGBA 3QIAA 4RH6A 2NYZD 2JN4A 1XMQQ 3NQIA 4UP8A 1XNQQ 4KD4A 4OHJA 3IFTA 4IALA 3OSOA 1KTKA 5IWAL 1QVFA 1IL2A 4DV3Q 1B7YB 1UNSA 3T1YQ 2Z6BA 5DM63 1HR0W 3EFXD 2DNEA 3A7AB 2UUBL 2F4IA 2B8FA 4BBSG 4JV5L 4A3DH 5CMDA 4CDEC 4I7AA 2BCOA 2K4KA 3F2UA 1JORA 1A63A 3OWFA 1RTOA 1YVCA 3T13A 4C1NI 4MN3A 3DLLA 5C0XI 1FYCA 1KAAA 3PV0A 4X3TA 3TDQA 3RN5A 2Q2IA 1RL2A 2HHHQ 4LF5Q 3HOYG 2XGTA 1NUCA 4HEDA 3M7GA 4L5SA 3HOWH 1X3GA 3G7LA 4BY1H 3BZDB 2XN9C 5C4HA 1VQBA 3R2TA 1J9OA 5FLXL 5FO7B 4CKBA 1UUPA 2FHTA 3UI2A 2KEEA 3OMCA 1H9MA 1PRTF 4OX9Q 3K58A 2NZHA 2YTXA 3QOLA 2PNHA 4ILWA 1YNJD 2Z1CA 3MFYA 1VMPA 1KRTA 4ALPA 2K04A 3R8BA 2JA8G 2EYFA 3OWEB 3H3VC 1LT4D 1JB3A 2VXWA 4A93B 2R7ZB 1CHPD 3S1MH 4P75A 1XYIA 3H0GH 2JE6I 4C3IH 1WTWA 3MXNB 2N3SA 4O1NA 3CC4A 1EYDA 4LK1C 1EWIA 4OEMB 4KMUC 5FLXE 3CU7A 4OIJA 1IBLQ 3ULLA 1OTCA 1VQ9A 4JYAL 5IT9L 3QO2A 1WFQA 1X32A 4ZRZA 3CMEA 3K57A 4C3HG 1QVCA 1K83H 5IGGA 2GVBA 2PMZB 1QB5D 1J5EQ 1NSNS 3NP8A 4XDXA 1EY4A 3W1BA 2B2UC 1X3PA 2R93G 2E2HB 1ENFA 1SYGA 1E22A 3VYUA 1VCIA 1TS2A 1I5FA 4QGUA 1SDFA 4Z9CB 2WKCA 3T56B 2WACA 1PRTD 3QWNA 2ALYB 1UE7A 1OXTA 3S9WA 2RKSA 2P5ZX 2N78A 1BBUA 4AYBB 1V9PA 2E76C 1AH9A 1HZCA 2JXMB 5IYDH 3BDCA 1VQDA 4NKLA 3HOZH 2XIWA 1ML0D 2Z6KC 4M1UB 5D65A 1VQHA 2PQAA 3D0FA 3KDFB 4QUFA 3A8JE 2HCCA 3I72A 1VQJA 2K5WA 1YZ6A 1LUZA 1AW7A 1STGA 4NXNQ 5CORA 1E7ZA 3STBC 3K80C 2OCEA 4CDFC 1PZKD 4A76A 3KF6A 5I6WA 4DV0L 4JC0A 4JI7Q 1LTAD 2UXBQ 2B2UA 4G4KA 4JI0L 3NSWA 3UDIA 4QIWB 1CQVA 4L5RC 4LF7Q 2PI2A 4YY3L 4A3EG 1D1KA 1HNZQ 4NB3A 2K14A 1NBWA 4WRDA 4GLAC 5IOCA 2AQ2B 1HNWL 1B50A 1F2YA 2Z9HA 3PMFA 4FVMA 5JPMC 5A35A 5L37A 4ODGA 3M4QA 5HY6A 3M4OB 1NNXA 1TKWB 3D4RA 4KY6A 1A0IA 2VL6A 3DWPA 1HFGA 3CPWA 3GTJH 1Z47A 4P2CB 1EFID 2BE5D 1LTRD 2JA7B 1EYGA 5H1SE 2LXJA 4PNYA 2NTTA 4A3LG 2E2JH 4IFDI 4FXGC 4DKAC 2VUMG 1D8LA 2L11A 3GTLH 1HZ9A 4IJHA 4B9XA 3A55A 4FF3A 4OO1G 1FD7D 5KIXA 3VR4A 5I6YA 4Y7NH 3AFQA 4NXMQ 3GQBA 1LACA 1D5ZC 1PH9A 4IUUA 2X6LA 2FFKB 3F2DA 2PW7A 1LV9A 1L0XB 1OO9B 1QNKA 4DFAA 4XQNA 2VUMH 1IBMQ 5BN3A 4Y7NB 2R7ZG 2ES2A 1Q8KA 3JAML 2K5VA 4NMZA 4GKJL 1B8AA 4LFBQ 1A3TA 3C1EA 1I4XA 4JI1Q 4I65A 4QL5A 3JAMi 4DV5Q 2JA5G 2J0TD 2FJ2A 2KCCA 2LXKA 1ESFA 3LX0A 2CFMA 2D2CC 4JI6L 4RG1A 2WIIB 3HOWB 3DM3A 4XQQA 3GTQB 1Q86C 2B39A 4RGMA 3HG9A 2IT1A 1HQMC 3CC2A 1I4HA 5K36H 2DY8A 2EJGC 4RA8A 4JBMA 5IGCA 3ND9A 1SROA 4R8NA 3RNUA 4DK3C 4A3EH 1K28A 1D6EC 3OW7A 4FF2A 2HDMA 1YNNC 1SLJA 2N55A 2UXCQ 4B3ML 2NWGA 1NR4A 2ZJQA 4LUVA 2WV6D 1SE2A 1F77A 4IOCA 5GADC 4PMBA 1GD7A 3Q22A 1RF2D 4L8JA 1IL8A 2B29A 3SHLA 2R92H 3NUCA 3FMCA 3EN2A 1SMYC 3RMHA 1CSQA 4S3SA 2AQ1B 4JG2A 3KUPA 1G51A 1I50H 2SDFA 3CPFA 3I4LA 3NWTA 1DOLA 5IYDG 4K6LA 1WOCA 3J80c 1CKOA 3DWAA 5C6AA 1EOTA 3HOVG 2WB1B 3RZDB 1AE3A 4X64Q 1VQ4A 1KQSA 3AMUA 2EYLA 1VF7A 1C48A 1S4ZA 3FKIH 1PH3A 4MTNA 2RDFA 4YCWA 4A3MB 1U4PA 1PH7A 4UAIA 5LMNL 4WORA 3W2DA 1ILPA 1F9SA 4DK6C 5JAVA 1FL0A 5IGFA 1WVLA 1CUKA 3I3CA 4GZYC 4C3HH 2BA1A 2Z8LA 2XRSD 4DUYL 1XXGA 5C0XJ 5EGTA 1SYCA 4K2LA 1P8LA 3M4PA 1R4PB 1RKNA 2DY7A 2O5IC 1EY0A 4JI4L 1C0AA 4C3HB 1F2ZA 1QUQB 1GUOA 4BBRG 3MXGA 5ELBA 3SE0A 4A3FB 1I94Q 2VB2X 5M3FG 4C3IG 4LF9L 3H0GG 3I73A 3K5LA 1IBKQ 4LAAA 5TSSA 3HFZB 2A74C 1ZEQX 3GO5A 1DZ1A 4DR2Q 1O7YA 4A3FH 1V1QA 3SK5A 5KRUA 1L0WA 1PH5A 3EA6A 2QA4A 1TS3A 2ZTEA 5EKKA 3I2ZA 3S1RH 1B53A 4KD3A 1K8GA 5CV6A 3KLRA 3NTHA 1EY8A 1JWUD 1M4VA 2CKZB 3GTLB 3RLOA 1X56A 2VZAA 3D6CA 5T1IA 3MXUA 4OWTB 1V1PA 5AFWA 4HJ5A 1SYDA 2UUAL 2RDHA 4IJLA 3C1FA 3H3VH 4OWWB 1MSGA 2FXQA 4DR4L 3OYYA 3L0OA 2A6ED 1W6JA 4BY7B 1MSHA 1WD0A 2DGYA 1A2UA 4K0KL 2ASBA 2KUMA 3UE0A 4ZLTF 4K5XA 2LS01 1CA5A 1YITA 3U4ZA 2F0JA 1JOOA 3TN2A 1CT1D 1QWYA 2TSSA 1K8MA 3KBXA 1NTGA 3T1YL 1TS5A 5D14A 2CWPA 2AUKA 5C4XB 2MQHA 3KLSA 4JV5Q 3HZXA 3TMEA 3J81i 2KEDA 3NBHB 5M9OA 5AJ3L 3J7AF 4O42A 3F8TA 1HH2P 2MNAA 4LUZA 5ELOA 1TWHB 5M5YH 4LF6Q 4DU9A 1XPRA 2VUMB 1YBYA 1KNAA 4K2KA 5EPJA 1T5XD 1LLRD 1ZKOA
chains in the Genus database with same CATH topology
2NVQB 3CKIB 3OPOA 5M5XB 4A3GB 2D62A 4KJNA 1STAA 5IT9E 2SNMA 3PO3B 2R92B 1KNEA 1V43A 1PYWD 1WTPA 2SNSA 4I7ZC 1ICWA 5EBDA 5KNCA 4QCLA 3KBGA 4RGTA 3GTGB 2EVBA 5F2DA 3TP8A 4DK1A 3D6WA 4BS9A 5IGDA 5DAUA 4R9WA 1TQOA 2JSOA 5KYLA 1KDAA 4RAUC 3H91A 4XXEA 1Y8PB 1RD9D 4J8QA 3NTKA 4DXFA 2ID0A 5ELEA 2ICEC 1HUMA 3GP7A 1KDBA 1K8OA 1Q1EA 1LTSD 2F3VA 4KV6A 3ONAB 4KHZA 1TS4A 5BN4A 2EOTA 3MC0B 4V0BA 3P7JA 1AP0A 4KY5A 2BDNA 1Y1WB 5CV9A 1HCZA 1SNPA 2I46A 1HUNA 3J81E 5LL6S 1I4QA 3H6MA 1PTOH 1SE3A 2K33A 1B2TA 3L3OC 3U9OA 2EY2A 3BDOA 4KK7A 1STYA 3MFGA 3X3NA 3E6ZX 2PQEA 2B8GA 1SAPA 3ZYYX 4HR7B 3P75A 2CHBD 2J4XA 1LO5D 1WTOA 5I9PA 3S1RB 2EYHA 2BDOA 1FR3A 3H0GB 3T4AC 1IYVA 5CC4A 1B44D 4LMQD 5M5WB 1E0BA 4IFDH 4LJZC 4BBRB 2AQ3B 5JVH3 1HA6A 4ZKCB 3I4NB 4A3DB 5M3FB 1AFPA 2EXZA 1Q12A 3S2DB 1EQTA 4HSVA 2K5DA 2K6AA 3ITPA 3MA2B 1KABA 1L0YB 1LT5D 2RVLA 2A5HA 1D5XC 1I6HB 1CI3M 2IPKD 4ZUIA 2XVSA 4A3IB 1OXVA 1STEA 4IN3A 2EY6A 3EROA 1JWSD 1C4QA 1X3QA 2F03A 2EYMA 3A8IE 3S1MB 1NCVA 1ENCA 4IFDG 3VA5A 2NVYB 2O4XA 3SK4A 2MHVA 1CFMA 1QOHA 1ILQA 3NQTA 5KNBA 2A6EC 2F3WA 3I90A 3AU7A 4IUTA 5FKAC 4HTHA 3IFDA 4N9TA 4TRDA 5E4XA 2HDLA 5JEAJ 1ZYRC 1W6KA 1KDCA 3VA7A 4RHRA 3SXHA 5C0XH 1GHKA 2Q8TA 3L9AX 4KY7A 4FXDA 2F0KA 1F9QA 4KKUA 2QCPX 2X6GA 4C1NK 3O13A 4FYDA 4K8IA 1SYEA 3V05A 5JEAG 1IYUA 4G57A 1A6XA 3BS1A 1TWGB 4H13C 1A15A 1SXTA 2F0LA 1JOKA 5CYUA 3HKZB 1EWCA 1F2LA 2B2WC 1IW7D 4WFN3 3PUXA 1TR5A 3Q0AA 5DNFA 1FNWA 2EY1A 1G291 3FPUB 2D9UA 3DMUA 2A68D 3J80L 1C8CA 1R9TB 3V96A 5EKLA 1BXTA 1ZXTA 1PZID 4XTCS 4DXGA 4RFBA 1Q1BA 2L4NA 4A3EB 2JA5B 5FO9B 3SEBA 1G8ZD 3J81L 3S1NB 3KK7A 3S14B 1GOZA 2B2VA 5ELDA 4DGZA 2OT2A 1TWFB 1J8IA 4K5VA 2X69A 3P20A 1TIID 1WCMB 1E2ZA 3FRPB 5I2XA 4J6HA 4F7XA 2F0WA 4MIUA 2KECA 1DOMA 4K14A 4NDXA 3IAYA 2XWBB 1U4RA 5JPNC 3TP5A 2HCIA 4FF1A 3LWEA 2F0SA 2IL8A 2B2WA 4YIJA 1LT6D 2KQ3A 2R3ZA 3JAME 1M8AA 2EJFC 2F0HA 2FINB 1TT2A 4ID6A 1Q8IA 4X3UA 3X3MA 2IJ0A 1I4RA 1E2VA 2L1BA 2LMCB 1AZQA 3Q24A 3A8KE 4EQPA 4XYOA 2EYOA 5G3LF 1BQQT 2GA4B 3K7AB 4KN7C 4ZK9B 1JC7A 4L63B 2G9DA 1DOKA 1JCKB 4ABNA 5FOBB 1B9NA 4CGYB 2M2LA 3EQLC 1UEAB 3RD4A 4IUVA 1BDOA 4C3IB 4ZQ3A 1QJOA 5E4WC 4XT3B 4FF4A 1HFNA 2EJMA 5J1ZA 2B63B 4NP5A 3IL8A 4CKCA 3DEOA 1Z7TA 2A68C 2NVXB 2N88A 1PTOB 2M00A 2F0EA 2YU9B 2XRQD 1NAPA 2L9HA 5E3FA 1GUNA 2OXPA 3PUZA 3FVQA 5CV7A 4IUPA 1U4MA 4BBSB 4QF4A 2OEOA 5M3MB 4F8MA 3BVZA 3HRZC 3J7AV 1BCPF 4XT1B 3FEWX 1KLUD 2LY7A 3WOFA 3PUVA 1CK1A 1HA5A 3HS0C 2PCFB 4L6TB 1SMYD 2AWOA 1I4GA 3PUWA 4HCEA 4CJ1B 1HXYD 4DA2A 1IKMA 3T16A 5ELFA 3SK6A 2B2VC 2JYOA 5A2QL 3SK8A 5HGTA 3NE5B 1VF5C 4IUQA 2ENBA 1XWEA 1MI2A 1MBYA 1LABA 2BE5C 1IHZA 1DXMA 1KLGD 4KJOA 3SVMA 3K6OA 3NXWA 4PMWA 1FNVA 2E2IB 1YNND 1DJRD 3KLSX 5LHY1 1WTXA 1A3UA 5ISRA 2JA8B 1U4LA 3S1QB 2C5CA 5FK9C 3D3RA 1MGSA 1UAPA 1GUTA 3HOXB 2SOBA 1R4QB 4RKBA 4XIGS 3HP3A 4FP5D 4IUNA 3I91A 1XTCD 1YNJC 1XX8A 1EEFD 1BOSA 4N9PA 1Q3LA 2F0UA 1A3VA 4B9WA 1LTTD 2RBMA 5I2YA 1D1IA 3K5OA 1K83B 4DAVA 2B2YC 2Z4HA 3CHBD 4U68A 5BN5A 1AEXA 2A73B 2ZXPA 2QILA 3HOUB 3Q23A 2HQEA 4MHEA 3V2TA 4EQOA 1PTOC 1SNMA 5HURA 2KHSA 2O2LD 3NPPA 1RJTA 1EYCA 1EL0A 1QG7A 1LTBD 2IX1A 5CV8A 5EPLA 1OXXK 2FMMA 1EY7A 1STNA 3ERQA 2PNRC 3NBHA 3R93A 5IGEA 1SYFA 3LWUA 4CKEA 2LKVA 2BA0A 1II3A 1JR0D 2KA7A 2WP8J 2QDBA 3VR6A 4CHTB 3BVMA 1HPCA 2PYKA 1Q90A 1NR2A 1BO0A 4DNRB 3C2PA 1HTLD 4X3SA 5KGUA 2B2TA 1EEID 1U9RA 3DHQA 3R3OA 2NTSA 4PV1C 3DUZA 3RLFA 1B3AA 3A54A 4KI0A 3T51B 1BBXC 2F0NA 3NHHA 4Q0FA 4ULLA 3J80E 3GD7A 1RHPA 3CRKC 1SSOA 2WKDA 2L55A 2RA4A 1GUWA 2KOLA 3DM1A 3C3LA 2K1BA 2F0OA 3QG1A 4FO2A 3A56A 1S5DD 5CV5A 4H44C 2R93B 1CQFA 2RSNA 4KTAA 3N52A 2E75C 4M8AA 4H0LC 3E5SA 1PZJD 5CGKA 4DAYA 2K5QA 3VYRA 1VDZA 2AUJD 3URYA 3D8GA 5J39A 3TP6A 4JBWA 4OO1I 1BR9A 1TY0A 1F2MA 4KN4C 5M5YB 1GUGA 4X3KA 1DM0B 2F0IA 3VYTA 1BNZA 2ZXOA 4C2MB 3M3YB 3S16B 3J7YW 4ME5A 4HSPA 1EY6A 2EY5A 1DYQA 2EZVA 2H1EA 1SNDA 2RSOA 3K59A 4IFDJ 1EWHA 2WAQB 2F0FA 4BA2I 1H9SB 2K7VA 2NVTB 1FGBD 1SYBA 1BCPD 4C3JG 3MWYW 3TZDA 1DONA 3FDTA 1QCBD 1ESRA 5C4JB 1SJED 1PDQA 1EY9A 1TU2B 3PIO3 5COYA 3D4WA 3S2HB 1DCZA 4ZYSA 2ICIA 1TWAB 1I6VC 1PRTC 1E2WA 3TSSA 3HOVB 2HUGA 2SEBD 3WDNA 3MHBA 2MPMA 4CBVA 5J22A 2F0VA 2EYPA 3TP7A 3K5MA 1GHJA 2WINB 5EKIA 4Q5VA 4JK1C 3TBIB 2FMCA 2O5JC 1PXUA 2D5DA 3H94A 4KKTA 1PFNA 1CM9A 3NBIA 4BY1B 5E1FA 3MTSA 2E74C 1H9RA 2PZTA 1EU3A 2F1MA 4BWGB 4RKLA 4UDUC 2C9OA 1Y8OB 2IX0A 5JVG3 4TQUS 5CV4A 4K6DA 2EDGA 3OMGA 1EQVA 1AN8A 5EJWA 2QKIC 2YYZA 2NN6H 1SNCA 2KCNA 4CJ0B 4G7HC 1RDPD 5T1GA 5I4DA 1PRTB 3ND8A 2CQAA 4TSSA 5DEHA 1JICA 4DF7A 3PUYA 2Z4IA 4E6IA 2CW0D 1G2SA 1V1PB 4K5WA 4IQZA 3K0YA 1I50B 1QILA 5NUCA 3DWQA 4DK0A 1JOQA 2MJ8A 3M7NA 1JQYD 3HEJA 1EYAA 3GTPB 4RGOS 3EJIA 1VMCA 2OF1A 3FKIB 4A3KB 2PW5A 4HN7A 3MVVA 1S5CD 5ELCA 1RODA 1SNQA 2JP1A 5KNDA 1JWMD 4RHSA 3MXPA 1HTPA 2B2TC 3MZ5A 2Y0SB 3VR2A 2G9HD 4HMJA 4BA1I 2F0MA 3TZUA 2MGSA 2DNCA 2I07B 4F87A 3GTKB 2IWHA 4WJWA 5JOBA 5C3WA 5IIFA 5A2QE 5C3EB 1I3QB 1S5ED 3HOYB 4QMGA 5K5PA 1D5MC 1WTQA 2JEBI 4PMCA 1Y1VB 2R61A 3BYTB 4H7BA 1RCVD 5FO8B 3GV3A 3NK9A 4PQXA 5G3LD 1HQRD 2NUCA 3S15B 2XSCA 1OXUA 1O78A 5KEEA 2ZXRA 5C5LA 2IW3A 1PMRA 4QB4A 3W3AA 4FXKC 3I8ZA 4NW2A 1S5BD 1PTOD 5CR3A 5D3IB 5EQ0A 4R8IA 2Q8RE 1HRJA 1LTID 2MP1A 3T53B 1H9JA 3SR1A 1B4OA 1ET6A 3U9SA 3K5NA 2L5TA 1QE6A 3GTJB 1TVXA 2A69D 1SEBD 1Y69U 3PIP3 2A6HC 1BF4A 1I4PA 3QOJA 3I4MB 4KHVA 2JEAI 1H9SA 1B1ZA 3NTIA 5I9OA 4G7ZC 1QNUA 3OIQA 3I70A 1G6ZA 1EU4A 1EIGA 2K01A 4RWSC 2B2YA 5C4ZA 3CRLC 4G7OC 1IKLA 4C3JB 4XYQA 1TY2A 1B9MA 3MAQA 4OL7A 1CZGA 1ONLA 4KKSA 2LFNA 1Z6HA 1BCPB 5JJZA 1A2TA 3BDLA 4RCNA 2K05A 3M4YA 1GJXA 1SNOA 3N6RA 1DD2A 1SBBB 1F9PA 4QUCA 1TWCB 2F0DA 3QJYA 1IW7C 4V190 2MUYA 1HHVA 3BYYB 1EIHA 3C46A 1Y8NB 5C5MA 2F0QA 1ET9A 1T5EA 3QB3A 1G2TA 4EQNA 2F0GA 2BOSA 4IURA 3RZOB 3HOZB 3S17B 4RCOA 5KYIA 3L7ZC 4ZUJA 2VNUD 3HGBA 4U673 1MD2D 3BG3A 2IX3A 3D4DA 2F0TA 1WTRA 2NN6I 2F0PA 3SDZA 2DN8A 4A3BB 3LNNA 2KJXA 2RDGA 1WTVA 2K03A 1V1OA 3RUZA 3R2IA 3BVGA 4TKOB 5EBCA 1SE4A 1F9RA 1STBA 3A7LA 3OOCA 3OIPA 4ZAIA 1D2BA 3IKJA 2CW0C 4EGVA 1GUSA 4ZKBB 4XQJA 1PFBA 1PLFA 4F88A 5C44B 2XWJB 3WOEA 2A6HD 5CBAE 2XNAC 3PO2B 2A69C 4B08A 5EPKA 1OXSC 3OHXC 2E2DC 2VB3X 2E2JB 1JE4A 4C56C 3DXJC 5D3DA 3KF8A 2KVMA 1AZPA 4RGNA 1G91A 2K32A 2QF7A 1SJHD 3VR5A 5DM73 4IZ8A 3GTMB 2H4OA 2L0CA 3NWSA 4DNTB 1EY5A 2ZT9C 4CJ2C 1CHQD 1BUVT 3P1HA 3VYSA 2TMPA 2NBFA 5IODA 1O7LA 3EVQA 1EZ6A 1FNUA 2J7ZA 5K36G 1LT3D 1PFMA 2PPBC 2L12A 2R6GA 4EVOA 1S5FD 2NN6G 2NZ1D 3Q6SA 1WD1A 2EPBA 1O80A 3MXNA 4A3JB 5LL6X 2RQXA 3M85A 1CZWA 2QEJC 1O7ZA 1H9KA 3FPPA 3GTOB 5CBEE 1STHA 2EYJA 2K28A 1SFOB 2CVRA 1ZYRD 4DAPA 2Q8IB 2PZUA 4HMIA 1V8QA 1CA6A 2JA6B 4OGQC 1PTOF 1GXDC 3G6JB 3DEPA 1EZ8A 4HAEA 4DN4M 3GV6A 3H09A 4J1MA 4OO1H 2PZWA 4OIKA 1RTNA 3E0JA 4FNFA 2NB0A 3VR3A 5C3XA 5JEAH 1BCPC 2EE1A 2PO4A 2AWNA 1CTMA 2M9VA 3CQZB 3MEHA 2V4DA 1ENAA 5C0XG 4HCSA 4K8JA 3AB9A 3D31A 1LTGD 5IGBA 3QIAA 4RH6A 2NYZD 3NQIA 4KD4A 4OHJA 3IFTA 4IALA 3OSOA 1KTKA 1UNSA 5DM63 3EFXD 2DNEA 3A7AB 2F4IA 2B8FA 5CMDA 2BCOA 3F2UA 1JORA 3OWFA 1RTOA 3T13A 4C1NI 4MN3A 5C0XI 1FYCA 1KAAA 3PV0A 4X3TA 3TDQA 1NUCA 4HEDA 3M7GA 3G7LA 3BZDB 2XN9C 5C4HA 3R2TA 1J9OA 5FLXL 5FO7B 4CKBA 1UUPA 2FHTA 3UI2A 2KEEA 3OMCA 1H9MA 1PRTF 3K58A 3QOLA 4ILWA 1YNJD 2Z1CA 3MFYA 1VMPA 2K04A 3R8BA 2EYFA 3OWEB 3H3VC 1LT4D 1JB3A 2VXWA 4A93B 2R7ZB 1CHPD 1XYIA 2JE6I 1WTWA 4O1NA 1EYDA 4LK1C 4KMUC 5FLXE 3CU7A 4OIJA 5IT9L 3QO2A 1X32A 4ZRZA 3K57A 4C3HG 5IGGA 2PMZB 1QB5D 1NSNS 3NP8A 4XDXA 1EY4A 2E2HB 2B2UC 1X3PA 1ENFA 1SYGA 3VYUA 1VCIA 1TS2A 1SDFA 4Z9CB 2WKCA 3T56B 2WACA 1PRTD 3QWNA 1OXTA 3S9WA 2RKSA 4AYBB 2E76C 2JXMB 3BDCA 4NKLA 2XIWA 1ML0D 4M1UB 5D65A 4QUFA 3A8JE 2HCCA 3I72A 2K5WA 1AW7A 1STGA 5CORA 1PZKD 5I6WA 1LTAD 2B2UA 4G4KA 3NSWA 4QIWB 1CQVA 1D1KA 4WRDA 5IOCA 2AQ2B 1B50A 1F2YA 3PMFA 4FVMA 5JPMC 5A35A 4ODGA 3M4OB 1TKWB 3D4RA 4KY6A 3DWPA 1HFGA 1Z47A 4P2CB 1EFID 2BE5D 1LTRD 2JA7B 4PNYA 2NTTA 4IFDI 4FXGC 2L11A 4B9XA 3A55A 4FF3A 4OO1G 1FD7D 5KIXA 3VR4A 5I6YA 3GQBA 1LACA 1D5ZC 4IUUA 2X6LA 2FFKB 2PW7A 1LV9A 1L0XB 1OO9B 1QNKA 4DFAA 4XQNA 5BN3A 4Y7NB 3JAML 4NMZA 1A3TA 3C1EA 1I4XA 4I65A 2J0TD 2FJ2A 2KCCA 1ESFA 3LX0A 2D2CC 2WIIB 3HOWB 4XQQA 3GTQB 2B39A 4RGMA 3HG9A 2IT1A 1HQMC 1I4HA 5K36H 2DY8A 2EJGC 4RA8A 5IGCA 3ND9A 4R8NA 1D6EC 3OW7A 4FF2A 2HDMA 1YNNC 2N55A 2NWGA 1NR4A 2WV6D 1SE2A 1F77A 4PMBA 3Q22A 1RF2D 4L8JA 1IL8A 3SHLA 3NUCA 3FMCA 1SMYC 3RMHA 4S3SA 2AQ1B 3KUPA 2SDFA 3I4LA 3NWTA 1DOLA 4K6LA 3DWAA 5C6AA 1EOTA 2WB1B 3RZDB 3AMUA 2EYLA 1VF7A 1C48A 1S4ZA 2RDFA 4A3MB 1U4PA 4UAIA 4WORA 3W2DA 1ILPA 1F9SA 5JAVA 5IGFA 1WVLA 3I3CA 4GZYC 2BA1A 2Z8LA 2XRSD 1XXGA 5C0XJ 5EGTA 1SYCA 4K2LA 1R4PB 1RKNA 2DY7A 2O5IC 1EY0A 4C3HB 1F2ZA 1GUOA 3MXGA 5ELBA 3SE0A 4A3FB 2VB2X 4C3IG 3I73A 3K5LA 4LAAA 5TSSA 2A74C 1ZEQX 3GO5A 1DZ1A 1O7YA 3SK5A 5KRUA 3EA6A 1TS3A 5EKKA 1B53A 4KD3A 5CV6A 3KLRA 3NTHA 1EY8A 1JWUD 1M4VA 3GTLB 3D6CA 5T1IA 3MXUA 1V1PA 5AFWA 1SYDA 2RDHA 3C1FA 1MSGA 2A6ED 1W6JA 4BY7B 1MSHA 1WD0A 1A2UA 2KUMA 4ZLTF 4K5XA 2LS01 1CA5A 2F0JA 1JOOA 3TN2A 1CT1D 1QWYA 2TSSA 1K8MA 3KBXA 1TS5A 5D14A 2AUKA 5C4XB 3KLSA 3HZXA 3TMEA 2KEDA 5M9OA 3J7AF 4O42A 1TWHB 4DU9A 2VUMB 1KNAA 4K2KA 5EPJA 1T5XD 1LLRD 1ZKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P20 A;  1I6V C;  5BN3 A;  1E2Z A;  1GUO A;  1VCI A;  1E2W A;  3QIA A;  3QJY A;  2B8G A;  3SE0 A;  2K32 A;  4IQZ A;  5BN5 A;  2QF7 A;  1IW7 C;  3OPO A;  4HR7 B;  3T56 B;  3IFT A;  3VR5 A;  3I73 A;  1OXT A;  4DK0 A;  1ZYR C;  3QG1 A;  3M7N A;  1Y8N B;  2D62 A;  4DNT B;  3VA7 A;  2KCC A;  2DNE A;  2E76 C;  2ZT9 C;  2JXM B;  3A7A B;  3T53 B;  4H44 C;  2B8F A;  1H9J A;  3PUV A;  3WDN A;  1T5E A;  2D2C C;  5C0X H;  1GHK A;  2BDO A;  1FR3 A;  2E75 C;  1IYV A;  3U9S A;  4H0L C;  2L5T A;  2PCF B;  3A8J E;  1O7L A;  1V43 A;  2AWO A;  4IFD H;  4LJZ C;  2IT1 A;  1HQM C;  1GHJ A;  3I72 A;  3KLR A;  3PUW A;  4JK1 C;  1OXX K;  5K36 H;  5K36 G;  2EJG C;  1VDZ A;  4KKU A;  2AUJ D;  3ND9 A;  2A69 D;  4I7Z C;  5KND A;  1Y69 U;  2A6H C;  2PPB C;  2O5J C;  5KNC A;  1HTP A;  1Q12 A;  2EJF C;  3L7Z C;  2R6G A;  2D5D A;  3H94 A;  5JEA G;  3OW7 A;  1IYU A;  2EVB A;  2NN6 G;  3MXU A;  4KKT A;  3HGB A;  3AB9 A;  2PNR C;  1YNN C;  3D31 A;  3VR2 A;  4DK1 A;  1FYC A;  4JBW A;  1A6X A;  3PV0 A;  4BA1 I;  3TZU A;  2JEA I;  1E2V A;  2DNC A;  1H9S A;  3LWU A;  4KN4 C;  2LMC B;  2BA0 A;  2E74 C;  1GUG A;  4H13 C;  3BG3 A;  3M85 A;  4G7Z C;  2KA7 A;  2NN6 I;  1H9R A;  2A6E D;  4L8J A;  3NE5 B;  3A8K E;  3SDZ A;  1VF5 C;  3VR6 A;  3FMC A;  2DN8 A;  1H9K A;  1Y8P B;  2F1M A;  3FPP A;  1SMY C;  3LNN A;  1HPC A;  4KN7 C;  3CRL C;  1Y8O B;  4G7O C;  2JEB I;  1LAB A;  1H9M A;  2BE5 C;  1IW7 D;  4TQU S;  1CI3 M;  1K8O A;  1Q1E A;  1Q90 A;  2Q8I B;  2EDG A;  1DXM A;  3PUX A;  5A35 A;  1V8Q A;  1B9N A;  3EQL C;  4OGQ C;  4KHZ A;  3I4L A;  1BDO A;  1EWH A;  1K8M A;  3MFY A;  4TKO B;  4DNR B;  5BN4 A;  1OXV A;  1QJO A;  1TKW B;  1G29 1;  3D4R A;  4OO1 H;  1B9M A;  2A68 D;  2YYZ A;  2AUK A;  4BA2 I;  3A7L A;  3OOC A;  2NN6 H;  3IKJ A;  2JE6 I;  2CW0 C;  1H9S B;  2K7V A;  2BE5 D;  2EJM A;  1VF7 A;  4XTC S;  1GUS A;  1Z7T A;  2A68 C;  4LK1 C;  1ONL A;  4KKS A;  4KMU C;  4PV1 C;  4G7H C;  1Q1B A;  2A6H D;  1Z6H A;  5C0X G;  3A8I E;  1HCZ A;  2A69 C;  3VR3 A;  4IFD G;  5JEA H;  1OXU A;  1O78 A;  1GUT A;  4RCN A;  1OXS C;  4OO1 G;  3RLF A;  1GUN A;  3ND8 A;  3PUZ A;  1TU2 B;  4XIG S;  3VR4 A;  3M4Y A;  4KI0 A;  3T51 B;  1PMR A;  4GZY C;  1GJX A;  3W3A A;  2BA1 A;  3N6R A;  1YNJ C;  1DD2 A;  3DXJ C;  1CTM A;  2K33 A;  3GQB A;  3GD7 A;  1LAC A;  1CFM A;  1DCZ A;  3BDO A;  3CRK C;  2V4D A;  3PUY A;  2O5I C;  5KNB A;  2A6E C;  1ZKO A; 
#chains in the Genus database with same CATH topology
 4O0A A;  2NVQ B;  2QEX A;  3CKI B;  4KLK A;  3OPO A;  5M5X B;  3CCV A;  3CD6 A;  4A3G B;  1IYJ B;  4QIW E;  4QQB X;  2D62 A;  4KJN A;  4DV4 L;  4A3K H;  3K8A A;  1STA A;  4C3J H;  2VS1 A;  5IT9 E;  2SNM A;  3PO3 B;  4JI8 L;  1UWV A;  2R92 B;  1KNE A;  2K5H A;  3PO3 G;  1UE6 A;  1V43 A;  1PYW D;  2K52 A;  1WTP A;  1UE1 A;  2SNS A;  1SFO H;  2JA6 G;  4I7Z C;  4N8F A;  1ICW A;  5EBD A;  5KNC A;  4QCL A;  3KBG A;  4RGT A;  3GTG B;  1Y14 B;  4APV A;  2EVB A;  5F2D A;  3TP8 A;  4DK1 A;  3D6W A;  4BS9 A;  5IGD A;  5FJ8 G;  5DAU A;  1PYS B;  4R9W A;  5C3E G;  4JI5 Q;  3KF8 B;  1TQO A;  2JSO A;  4DR7 L;  5KYL A;  1KDA A;  4RAU C;  3H91 A;  4XXE A;  1N36 Q;  1Y8P B;  1PVO A;  1RD9 D;  1GKH A;  4J8Q A;  1Y1V H;  3NTK A;  4DXF A;  2ID0 A;  5ELE A;  1SR3 A;  4MTK A;  3S17 H;  2ICE C;  1HUM A;  3GP7 A;  1KDB A;  1K8O A;  3F2B A;  4A93 G;  1Q1E A;  1M90 C;  1LTS D;  2F3V A;  4KV6 A;  3VDY A;  3ONA B;  4KHZ A;  1TS4 A;  5BN4 A;  2EOT A;  3MC0 B;  4V0B A;  3P7J A;  1E3P A;  1AP0 A;  4X65 L;  2D0O A;  3EBE A;  3W5O A;  3KDF A;  4KY5 A;  2BDN A;  4B3S Q;  1Y1W B;  5CV9 A;  1HCZ A;  3A5U A;  2WAQ E;  1W3S A;  4IOA A;  1SNP A;  2I46 A;  4LF8 L;  1HUN A;  4NXN L;  3J81 E;  3H15 A;  5LL6 S;  1I4Q A;  1N9W A;  3H6M A;  1PTO H;  1SE3 A;  1LM0 A;  2K33 A;  1B2T A;  3L3O C;  4KK7 A;  2EY2 A;  3BDO A;  3U9O A;  1STY A;  3MFG A;  1WJJ A;  2UXB L;  3X3N A;  3HOZ G;  3E6Z X;  4EQ5 A;  1FJG Q;  1NMF A;  2PQE A;  1E1T A;  2B8G A;  1SAP A;  3ZYY X;  4HR7 B;  3P75 A;  2CHB D;  2HIX A;  2J4X A;  1LO5 D;  1XPO A;  1XMQ L;  3TRZ A;  5M5W H;  1WTO A;  4DAY B;  5I9P A;  1XNQ L;  3S1R B;  1CKN A;  1VQC A;  2EYH A;  2BDO A;  4DV6 L;  3J7Z C;  1FR3 A;  3H0G B;  3T4A C;  1IYV A;  4DR6 L;  5CC4 A;  2CWA A;  1B44 D;  2ZTC A;  4LMQ D;  5M5W B;  1E0B A;  2WFW A;  2UUB Q;  2F4V Q;  4IFD H;  4LJZ C;  1TWF H;  4BBR B;  4AQY L;  2AQ3 B;  5JVH 3;  1HA6 A;  4ZKC B;  3I4N B;  1EQQ A;  4A3D B;  5M3F B;  1AFP A;  1JMC A;  2EXZ A;  1Q12 A;  4IO9 A;  3S2D B;  4KHP Q;  1EQT A;  4HSV A;  3WWV A;  2K5D A;  2K6A A;  3ITP A;  3MA2 B;  1KAB A;  1K73 C;  1NMG A;  4BXX G;  1L0Y B;  4LNQ A;  3CCR A;  2R93 H;  1KL9 A;  1PA6 A;  2JA8 H;  1LT5 D;  2RVL A;  4LF5 L;  4NXM L;  2ZJP A;  1VQ5 A;  2BH2 A;  2A5H A;  1D5X C;  1X6O A;  1I6H B;  4A3C H;  5M5X H;  1IBM L;  1VQF A;  1CI3 M;  2IPK D;  4ZUI A;  2XVS A;  4A3I B;  1JJ2 A;  3FHW A;  1OXV A;  1STE A;  4IN3 A;  3NEM A;  2EY6 A;  3ERO A;  1JWS D;  4P74 A;  1C4Q A;  1X3Q A;  4N8X 1;  2F03 A;  3G6E A;  2EYM A;  1X3E A;  3A8I E;  3S1M B;  4IPD A;  1NCV A;  1ENC A;  4IFD G;  4HJ8 A;  3E3X A;  1YHB A;  1MIU A;  4YHH Q;  2HD3 A;  1QVG A;  3OTO Q;  3VA5 A;  2NVY B;  2O4X A;  4A75 A;  3S1Q H;  4GOP B;  3SK4 A;  4JYA Q;  2MHV A;  1WTH A;  3E0E A;  1CFM A;  4B3M Q;  1QOH A;  2CQO A;  4A3D G;  1ILQ A;  2UXD L;  3HOW G;  2VQE Q;  3NQT A;  5KNB A;  2A6E C;  2F3W A;  3I90 A;  2B63 H;  3AU7 A;  4IUT A;  4PZ7 A;  1VQN A;  5FKA C;  3JAM c;  4HTH A;  3IFD A;  3PO3 H;  1XMO Q;  1KIX A;  4N9T A;  3GTP H;  4TRD A;  5E4X A;  2HDL A;  5JEA J;  1ZYR C;  1W6K A;  5IWA Q;  1KDC A;  3VA7 A;  4RHR A;  3L2P A;  3SXH A;  3KJP A;  5C0X H;  1GHK A;  1EUJ A;  2Q8T A;  3L9A X;  4UP9 A;  1YEZ A;  4KY7 A;  4FXD A;  1O7I A;  1CKN B;  3PIP A;  2F0K A;  3RZD H;  1F9Q A;  2VY3 A;  3CCE A;  1YNX A;  4KKU A;  2QCP X;  1XNR L;  2X6G A;  1HR0 Q;  4C1N K;  1Q81 C;  3O13 A;  4FYD A;  4K8I A;  3U50 C;  2ZM6 Q;  4A3M H;  1SYE A;  3UDX A;  3M9B A;  3V05 A;  5JEA G;  3KFU A;  1IYU A;  5LMN Q;  3PF5 A;  1KAW A;  5IYC G;  4G57 A;  1JT8 A;  1PFS A;  1VQE A;  1A6X A;  3PQI A;  3BS1 A;  1TWG B;  4H13 C;  4HJA A;  2VW9 A;  1A15 A;  1SXT A;  2F0L A;  4B3T Q;  4LUO A;  1JOK A;  5CYU A;  1SRU A;  1Y1V G;  4DR1 L;  3HKZ B;  1JJC B;  3HKS A;  1EWC A;  1F2L A;  2B2W C;  3U58 A;  1IW7 D;  1SMX A;  4WFN 3;  3PUX A;  1TR5 A;  3Q0A A;  3J80 i;  1HNX Q;  5DNF A;  3ULP A;  1FNW A;  3QR8 A;  1X65 A;  1G29 1;  2EY1 A;  3FPU B;  2D9U A;  3DMU A;  4B3R L;  2A68 D;  3J80 L;  1C8C A;  1R9T B;  3V96 A;  5EKL A;  1BXT A;  1ZXT A;  1PZI D;  5HGQ A;  4XTC S;  4DXG A;  4R4C A;  4RFB A;  1Q1B A;  2L4N A;  4A3E B;  1VQ7 A;  2JA5 B;  1JB7 A;  5FO9 B;  1X54 A;  4P73 A;  3SEB A;  1PH8 A;  1G8Z D;  4A3J G;  3J81 L;  2A8V A;  3S1N B;  3KK7 A;  3TQY A;  3S14 B;  1GOZ A;  3PO2 G;  2B2V A;  1WCM H;  5ELD A;  1LYL A;  4TVA B;  2NVQ H;  4DGZ A;  4A3K G;  4JI3 L;  2OT2 A;  1TWF B;  1J8I A;  4K5V A;  2UUA Q;  3M3Y H;  3I4N H;  3S14 H;  2X69 A;  3P20 A;  1TII D;  1WCM B;  4NPS A;  1E2Z A;  3FRP B;  5I2X A;  5GAG C;  1KHI A;  1L1O A;  4J6H A;  4F7X A;  2F0W A;  4MIU A;  2KEC A;  1DOM A;  4GKK L;  1L2F A;  4K14 A;  4X62 L;  4NDX A;  3IAY A;  2XWB B;  1A62 A;  1H95 A;  1U4R A;  3NEN A;  5JPN C;  3TP5 A;  3T1H Q;  1N34 Q;  4JI2 L;  3NEL A;  2HCI A;  4FF1 A;  1TXY A;  3LWE A;  2F0S A;  5M3F H;  2E8G A;  2IL8 A;  2B2W A;  2RHQ B;  4LF4 L;  4DV7 Q;  1C9O A;  2VQF Q;  4YIJ A;  1X3F A;  1LT6 D;  3PCO B;  2KQ3 A;  2R3Z A;  5GAH C;  3JAM E;  3CXC A;  3I4M H;  1M8A A;  2EJF C;  2F0H A;  2FIN B;  1TT2 A;  4ID6 A;  3HOX H;  1Q8I A;  4X3U A;  3X3M A;  4A3G H;  2IJ0 A;  3MEF A;  1I4R A;  4JI7 L;  1E2V A;  2L1B A;  3S2H H;  2LMC B;  2K5N A;  1AZQ A;  1ICF B;  3Q24 A;  4DV1 L;  1JJG A;  3A8K E;  3BU2 A;  4EQP A;  4XYO A;  4PG3 A;  2EYO A;  5G3L F;  1BQQ T;  2E2H H;  3HOX G;  2GA4 B;  3K7A B;  4KN7 C;  4UHV A;  1HZB A;  4ZK9 B;  2B3G A;  1JC7 A;  2E2I H;  4LFA L;  4L63 B;  3HOV H;  2G9D A;  1DOK A;  1JCK B;  4ABN A;  5FOB B;  4L5Q A;  1B9N A;  4CGY B;  2M2L A;  3EQL C;  1UEA B;  3RD4 A;  4IUV A;  1BDO A;  4C3I B;  1S72 A;  2N8N A;  4ZQ3 A;  1QJO A;  5E4W C;  4GNX C;  1KRS A;  4XT3 B;  4FF4 A;  1PHJ A;  4OEL B;  1HFN A;  2EJM A;  5J1Z A;  3J81 c;  1EIF A;  4NP5 A;  2B63 B;  3IL8 A;  4CKC A;  3DEO A;  1Z7T A;  2A68 C;  2NVX B;  2N88 A;  1PTO B;  2R92 G;  1I3Q H;  3Q8D A;  2M00 A;  3J7A 5;  2F0E A;  2YU9 B;  2XRQ D;  1NAP A;  2L9H A;  5E3F A;  1GUN A;  2OXP A;  3PUZ A;  5C44 H;  4GLX A;  3GTG H;  3FVQ A;  5CV7 A;  4IUP A;  1TWG H;  2KCM A;  4DV2 Q;  1K9M C;  4YCU A;  2HHH L;  1U4M A;  4DR5 Q;  4BBS B;  4JI5 L;  2RF4 A;  4QF4 A;  3UE1 A;  2KCT A;  4OXP A;  2OEO A;  5M3M B;  3HOU H;  4DUY Q;  4F8M A;  2KHJ A;  1N33 L;  3BVZ A;  4POG A;  1Q7Y C;  2I0Q A;  2F3I A;  5M3M G;  3HRZ C;  3J7A V;  2AMC B;  1X55 A;  2Q2H A;  1EQR A;  1UEB A;  2KHI A;  1BCP F;  4XT1 B;  3FEW X;  4GS3 A;  1KLU D;  2LY7 A;  3WOF A;  3PUV A;  5C4X H;  1CK1 A;  1HA5 A;  3HS0 C;  4P72 A;  2Y0S E;  2PCF B;  4L6T B;  1SMY D;  2AWO A;  1I4G A;  3PUW A;  1L1O C;  4HCE A;  3PO2 H;  2RHS B;  4CJ1 B;  1HXY D;  2XTI A;  3S15 H;  1S40 A;  4DA2 A;  1IBL L;  1IKM A;  4Y52 H;  4JCV E;  3T16 A;  5ELF A;  3SK6 A;  2B2V C;  2UU9 L;  2UXC L;  3W1G A;  1VQA A;  1R9T H;  2JYO A;  5A2Q L;  3SK8 A;  2JK8 A;  5HGT A;  3NE5 B;  4A3L H;  1VF5 C;  4IUQ A;  2ENB A;  3OW2 A;  2I5M X;  1XWE A;  1MI2 A;  4DR4 Q;  1MBY A;  2DUD A;  4DR3 Q;  1LAB A;  2PMZ E;  2BE5 C;  1IHZ A;  1DXM A;  1KLG D;  3S2D H;  4KJO A;  1HZA A;  3K6O A;  3NXW A;  3SVM A;  4PMW A;  2OWO A;  1XTD A;  1YHQ A;  1FNV A;  2JA7 H;  2E2I B;  1YNN D;  2EQS A;  1DJR D;  5J3B A;  3TRE A;  1B3Q A;  3KLS X;  3GTQ H;  5LHY 1;  1WTX A;  5JJK A;  1A3U A;  5ISR A;  4A4I A;  2JA8 B;  1U4L A;  3S1Q B;  2C5C A;  5ELN A;  1CKM A;  5FK9 C;  3D3R A;  1UE5 A;  2UUC L;  1MGS A;  1UAP A;  1GUT A;  4YCV A;  3HOX B;  2NVX H;  2SOB A;  2E5L L;  1R4Q B;  4RKB A;  4XIG S;  3HP3 A;  4FP5 D;  4IUN A;  3I91 A;  1XTC D;  4GN5 A;  1YNJ C;  5C4J H;  1MJE A;  1XX8 A;  1EEF D;  1BOS A;  4N9P A;  4BY7 G;  1Q3L A;  2Q2U A;  2F0U A;  1A3V A;  4B9W A;  4JI0 Q;  1LTT D;  2RBM A;  5I2Y A;  1D1I A;  3G71 A;  3K5O A;  5IP9 H;  1K83 B;  2MO1 A;  2ZJR A;  4DAV A;  2B2Y C;  4YY3 Q;  1HNZ L;  2Z4H A;  3CHB D;  4U68 A;  5BN5 A;  2KEN A;  1AEX A;  3ZJY C;  2A73 B;  1I94 L;  2ZXP A;  2QIL A;  3HOU B;  3Q23 A;  2HQE A;  4MHE A;  3V2T A;  4EQO A;  1PTO C;  1SNM A;  5HUR A;  2DJG C;  4R4O A;  2KHS A;  2O2L D;  2JA9 A;  3NPP A;  1N32 L;  1RJT A;  5IT9 c;  1EYC A;  1EL0 A;  1QG7 A;  1LTB D;  2IX1 A;  2H5X A;  2QW7 A;  4JI8 Q;  5CV8 A;  5EPL A;  1OXX K;  1A8V A;  3G4S A;  2FMM A;  2WAQ G;  1EY7 A;  1STN A;  4A3C G;  3ERQ A;  2PNR C;  3I56 A;  3NBH A;  3R93 A;  1AE2 A;  5IGE A;  1SYF A;  3LWU A;  4UPA A;  2LKV A;  4CKE A;  2BA0 A;  1KC8 C;  1J5E L;  1II3 A;  4X66 Q;  1JR0 D;  2KA7 A;  2WP8 J;  1Y1W G;  2JJQ A;  5M3M H;  4HIM A;  2ATW A;  2QDB A;  3VR6 A;  4CHT B;  3AYH B;  3BVM A;  1HPC A;  2PYK A;  5FLM H;  2YU9 H;  5JJL A;  1Q90 A;  1NR2 A;  1BO0 A;  1E24 A;  1XMO L;  4DNR B;  3C2P A;  1HTL D;  2AKW B;  4X3S A;  5KGU A;  2B2T A;  1EEI D;  2RCF A;  1U9R A;  3DHQ A;  3R3O A;  4BXX H;  2NTS A;  3CCU A;  4PV1 C;  1K0R A;  3S1N H;  4DUZ Q;  1NJI C;  3DUZ A;  2D0P A;  1XNR Q;  1HR0 L;  3RLF A;  1B3A A;  2ZM6 L;  1YHA A;  3A54 A;  1YJN A;  4KI0 A;  3T51 B;  1BBX C;  4HJ7 A;  1VQP A;  1VQG A;  2F0N A;  2I5L X;  3NHH A;  4MNO A;  4Q0F A;  4ULL A;  4LF8 Q;  4GLV B;  3J80 E;  3GD7 A;  4UY8 C;  1RHP A;  1GM5 A;  2HT1 A;  3CRK C;  2YTV A;  3RR5 A;  1SSO A;  2WKD A;  2L55 A;  2RA4 A;  1GUW A;  2KOL A;  1KXL A;  2PI2 E;  4B3T L;  4FDB A;  4R4Q A;  3DM1 A;  3C3L A;  2K1B A;  1VQL A;  2F0O A;  3QG1 A;  4FO2 A;  3A56 A;  1S5D D;  5CV5 A;  4H44 C;  4A3G G;  2R93 B;  1CQF A;  2RSN A;  4KTA A;  1QUQ A;  3N52 A;  2E75 C;  4M8A A;  4H0L C;  3E5S A;  1PZJ D;  3I4M G;  5CGK A;  4GOP A;  4B3R Q;  4DV6 Q;  4DAY A;  2K5Q A;  3VYR A;  1VDZ A;  1VQ6 A;  2AUJ D;  3URY A;  1LTL A;  3D8G A;  5J39 A;  1BBW A;  5GAE C;  1K3R A;  4MZ9 A;  3ER0 A;  3TP6 A;  1K0S A;  1RIP A;  4JBW A;  4OO1 I;  1BR9 A;  1TY0 A;  2BH8 A;  1F2M A;  4KN4 C;  3F2C A;  1Q46 A;  1U5K A;  5M5Y B;  1GUG A;  3TS0 A;  4X3K A;  1DM0 B;  1KD1 C;  2F0I A;  3VYT A;  1BNZ A;  2ZXO A;  4C2M B;  3M3Y B;  2G5D A;  3S16 B;  4GKJ Q;  3J7Y W;  2IHE A;  4ME5 A;  4HSP A;  1EY6 A;  4OX9 L;  2EY5 A;  1DYQ A;  5LMU L;  3K81 C;  2H1E A;  2EZV A;  1SND A;  2RSO A;  3K59 A;  4IFD J;  3S16 H;  5IY0 A;  3HOY H;  1EWH A;  2QDL A;  2WAQ B;  4X62 Q;  4DR2 L;  2F0F A;  4BA2 I;  4OWX B;  4J15 A;  1H9S B;  2K7V A;  2NVT B;  1N34 L;  3CMA A;  3CAM A;  1FGB D;  1SYB A;  1BCP D;  2L15 A;  4C3J G;  3MWY W;  3TZD A;  4B3S L;  3K0X A;  1DON A;  1EFW A;  3FDT A;  1QCB D;  1ESR A;  5FJ8 H;  5C4J B;  4GNX B;  1SJE D;  1PDQ A;  4BBS H;  1EY9 A;  1TU2 B;  3PIO 3;  3CC7 A;  4YHH L;  5COY A;  4A3B G;  3D4W A;  3S2H B;  1DCZ A;  4ZYS A;  2OTL A;  2ICI A;  1TWA B;  1I6V C;  1PRT C;  4QJF A;  2I5H A;  1E2W A;  4DV3 L;  4CDD C;  3TSS A;  1TWC H;  3BZC A;  3HOV B;  2HUG A;  1QZH A;  2NZO A;  4LFA Q;  2SEB D;  3WDN A;  3MHB A;  5IYC H;  2CH4 A;  2MPM A;  4CBV A;  1PH1 A;  5J22 A;  1MHW C;  2F0V A;  3U4V A;  2EYP A;  4A3B H;  3KLW A;  3TP7 A;  1T9H A;  1GHJ A;  2WIN B;  5EKI A;  4Q5V A;  4JK1 C;  3K5M A;  3G48 A;  3TBI B;  4AQY Q;  4IPH A;  2FMC A;  1HJP A;  2KBN A;  2O5J C;  1PXU A;  2D5D A;  3H94 A;  3A5Z B;  3ULJ A;  4KKT A;  2WB1 E;  1PFN A;  1CM9 A;  3GDE A;  3NBI A;  4BY1 B;  5JJI A;  5E1F A;  4X6A H;  3MTS A;  2E74 C;  3CF5 A;  1NY4 A;  5GRO A;  4LF7 L;  1H9R A;  1VQO A;  2PZT A;  1EU3 A;  4DV2 L;  1FGU A;  2F1M A;  4BWG B;  2B63 G;  4RKL A;  4UDU C;  2C9O A;  5LMN W;  1Y8O B;  2IX0 A;  1HNW Q;  1U0L A;  5JVG 3;  4TQU S;  5CV4 A;  4K6D A;  1MJC A;  2EDG A;  1N33 Q;  3OMG A;  4DV4 Q;  4AIM A;  1EQV A;  1AN8 A;  1PV4 A;  5EJW A;  1SE8 A;  1E1O A;  2QKI C;  2YYZ A;  2Y0S G;  2NN6 H;  2HQL A;  1SNC A;  4OON A;  2KCN A;  2YTY A;  4CJ0 B;  4G7H C;  5GQO A;  1RDP D;  3F1Z A;  4GN3 B;  4LFC L;  5T1G A;  4L5T A;  3RN2 A;  5FLX c;  1EIY B;  5I4D A;  4JOI A;  1PRT B;  3ND8 A;  2CQA A;  2MFI A;  4TSS A;  4DPG A;  1FVI A;  5C44 G;  5DEH A;  3RLN A;  2UU9 Q;  4DR7 Q;  4CDC C;  1JIC A;  4DF7 A;  3PUY A;  2Z4I A;  1Z9F A;  3CCJ A;  1TWH H;  2VQE L;  4HJ9 A;  4E6I A;  2CW0 D;  1G2S A;  1V1P B;  4K0K Q;  4K5W A;  3A0J A;  4IQZ A;  3K0Y A;  1I6H H;  1I50 B;  1QIL A;  3JC6 6;  5NUC A;  3DWQ A;  4DAM A;  4DK0 A;  1JOQ A;  2MJ8 A;  3M7N A;  1MKH A;  1NE3 A;  1JQY D;  3HEJ A;  1EYA A;  3FKI G;  4BBR H;  3GTP B;  1JE5 A;  1G6P A;  4RGO S;  3EJI A;  4PZ8 A;  1VMC A;  4AH6 A;  2OF1 A;  3FKI B;  2GN5 A;  4A3K B;  2K50 A;  3I4O A;  2PW5 A;  4HN7 A;  3MVV A;  1S5C D;  5ELC A;  1ROD A;  1SNQ A;  5BR8 Q;  2JP1 A;  5KND A;  1JWM D;  4RHS A;  3MXP A;  1HTP A;  3FP9 A;  2B2T C;  3MZ5 A;  2Y0S B;  3VR2 A;  1VQ8 A;  2OTJ A;  1BKB A;  3HKZ E;  2NVY H;  2G9H D;  3KYH C;  4HMJ A;  4BA1 I;  2F0M A;  3TZU A;  4PZ6 A;  2MGS A;  2DNC A;  2I07 B;  4GN4 B;  1YJW A;  4F87 A;  4R4I A;  3GTK B;  5IE8 A;  2IWH A;  4WJW A;  5JOB A;  1TWA H;  4AYB E;  5C3W A;  5IIF A;  4HIO A;  1N8R C;  5A2Q E;  5C3E B;  4DV1 Q;  1I3Q B;  1S5E D;  3HOY B;  3GTK H;  4QMG A;  5K5P A;  1D5M C;  1WTQ A;  2JEB I;  4AYB G;  5FLM G;  4PMC A;  1Y1V B;  2R61 A;  3BYT B;  4H7B A;  1RCV D;  4QY7 A;  1Y1W H;  5FO8 B;  3GV3 A;  1SN8 A;  3AQQ A;  3NK9 A;  2F4V L;  4PQX A;  5G3L D;  1HQR D;  2NUC A;  3S15 B;  2XSC A;  4H02 A;  5IYB H;  1OXU A;  1O78 A;  5KEE A;  2ZXR A;  5C5L A;  3I7F A;  2IW3 A;  2OQK A;  1PMR A;  4JVZ A;  4QB4 A;  3W3A A;  4FXK C;  2IHF A;  2GVA A;  5IP7 G;  3I8Z A;  4JI3 Q;  4JI4 Q;  4NW2 A;  2Q2T A;  1S5B D;  1PTO D;  5CR3 A;  5D3I B;  3H3V I;  2ZTD A;  3PSI A;  4DV5 L;  5EQ0 A;  4LF9 Q;  4R8I A;  2JA5 H;  1IZ6 A;  2Q8R E;  4GKK Q;  1HRJ A;  1LTI D;  2MP1 A;  3T53 B;  5IP9 G;  1H9J A;  2R7Z H;  3RZO H;  3SR1 A;  1B4O A;  1ET6 A;  2RCN A;  4JI2 Q;  3U9S A;  3K5N A;  2A1A A;  2L5T A;  4BY7 H;  2R7F A;  1QE6 A;  3GTJ B;  4LW1 A;  4DV7 L;  2R7D A;  2VQF L;  1TVX A;  2A69 D;  5E7N A;  1SEB D;  1BVS A;  4JW0 A;  3PIP 3;  1Y69 U;  1EOV A;  2A6H C;  1QZG A;  1BF4 A;  5IP7 H;  3S24 A;  3TS2 A;  1I4P A;  4DUZ L;  3QOJ A;  3I4M B;  4KHV A;  2JEA I;  1VQM A;  1H9S A;  1B1Z A;  2WB1 G;  3NTI A;  5I9O A;  4G7Z C;  1W2B A;  1PH4 A;  1QNU A;  3OIQ A;  5IYB G;  3I70 A;  1G6Z A;  1EU4 A;  4A3M G;  1EIG A;  2Z0S A;  3CCL A;  2K01 A;  4RWS C;  2B2Y A;  5C4Z A;  3CRL C;  4G7O C;  4YWL A;  1IKL A;  4C3J B;  2Z6K A;  1YIJ A;  2NVT H;  4HID A;  4XYQ A;  4X64 L;  3CCM A;  1TY2 A;  1K8A C;  2AHO B;  2MO0 A;  1B9M A;  3MAQ A;  4OL7 A;  1YJ9 A;  1GO3 E;  5EAY A;  1CZG A;  1ONL A;  4KKS A;  4JBJ A;  5AJ3 Q;  4JBK A;  2LFN A;  2JA7 G;  1Z6H A;  1BCP B;  4KHP L;  3CW2 C;  1A2T A;  5JJZ A;  4DV0 Q;  1WYD A;  3BDL A;  4RCN A;  4HIK A;  1ASY A;  4IPG A;  2K05 A;  4LF6 L;  3ERS X;  4P71 A;  1VS0 A;  3M4Y A;  2UUC Q;  2K75 A;  1GJX A;  4DNI A;  1SNO A;  3N6R A;  1DD2 A;  1SBB B;  3PF4 A;  1ASZ A;  1F9P A;  4QUC A;  3BJU A;  4POF A;  4DR5 L;  1X9N A;  1TWC B;  2F0D A;  3GTM H;  1IBK L;  3QJY A;  2A19 A;  1IW7 C;  4V19 0;  4DR1 Q;  2MUY A;  1HHV A;  3BYY B;  1EIH A;  3C46 A;  3M4O H;  2OQ0 A;  1Y8N B;  5C5M A;  2F0Q A;  4EX5 A;  1ET9 A;  5LMU Q;  1T5E A;  4UP7 A;  3QB3 A;  1G2T A;  4YWK A;  4EQN A;  2F0G A;  1PH6 A;  2BOS A;  3CQZ H;  4IUR A;  3TEH B;  3RZO B;  5C4X G;  3HOZ B;  3S17 B;  4RCO A;  5KYI A;  1DGS A;  3L7Z C;  4R4T A;  3UDF A;  3LGJ A;  3OTO L;  4ZUJ A;  2V1C C;  2VNU D;  1IXR A;  3HGB A;  1YI2 A;  4GNX A;  4U67 3;  3KOJ A;  3SGI A;  4A3F G;  1MD2 D;  3HOU G;  3BG3 A;  2IX3 A;  3D4D A;  2F0T A;  1WTR A;  4R1J A;  2NN6 I;  2F0P A;  4LWC A;  3SDZ A;  4LFB L;  2CCZ A;  2DN8 A;  4ME3 A;  4JI1 L;  4A3B B;  3LNN A;  2KJX A;  4RMF A;  2RDG A;  3PGZ A;  4DR3 L;  4JI6 Q;  2F52 A;  1WTV A;  2K03 A;  1V1O A;  3RUZ A;  3B6Y A;  3BVG A;  3R2I A;  4WJ4 A;  3HKZ G;  4TKO B;  1XJV A;  1J6Q A;  1SE4 A;  5EBC A;  2HIV A;  1CSP A;  4BY1 G;  1F9R A;  1STB A;  3A7L A;  3OOC A;  3OIP A;  4ZAI A;  1D2B A;  3IKJ A;  2QGQ A;  2CW0 C;  1K3B C;  4EGV A;  1GUS A;  4JPB W;  4ZKB B;  3CCQ A;  4XQJ A;  1P16 A;  4LF4 Q;  1PFB A;  1PLF A;  4F88 A;  5C44 B;  4WJ3 M;  3KF6 B;  2XWJ B;  3WOE A;  2A6H D;  5CBA E;  2XNA C;  3PO2 B;  2A69 C;  4B08 A;  5EPK A;  1OXS C;  3BZK A;  3OHX C;  4O2D A;  2E2D C;  2VB3 X;  2E5L Q;  3ICE A;  2E2J B;  1L1O B;  1JE4 A;  4C56 C;  3DXJ C;  2C35 B;  4ZCK A;  4C2M H;  5D3D A;  3KF8 A;  2KVM A;  1FJG L;  1AZP A;  4RGN A;  3I55 A;  1M1K C;  2EIF A;  1G91 A;  2K32 A;  2QF7 A;  1SJH D;  3VR5 A;  3J81 j;  5DM7 3;  2EXD A;  4IZ8 A;  3GTM B;  2H4O A;  2L0C A;  2DJF C;  3NWS A;  4DNT B;  1HNX L;  3KJO A;  1EY5 A;  2ZT9 C;  3I4N G;  4CJ2 C;  1CHQ D;  4DR6 Q;  1BUV T;  3P1H A;  3VYS A;  2TMP A;  3IRB A;  2NBF A;  5IOD A;  1N32 Q;  4A93 H;  1O7L A;  3EVQ A;  1WCM G;  1EZ6 A;  1FNU A;  2J7Z A;  5K36 G;  1LT3 D;  1S3O A;  1PFM A;  4A3J H;  2PPB C;  2L12 A;  3K7U C;  4JOI C;  2R6G A;  1XPU A;  4EVO A;  1S5F D;  3CP0 A;  2NN6 G;  2NZ1 D;  3Q6S A;  1WD1 A;  4LFC Q;  2EPB A;  1O80 A;  3STB D;  3MXN A;  4A3J B;  5C3E H;  2LSS A;  1WI5 A;  5LL6 X;  3GTO H;  2RQX A;  1N36 L;  3M85 A;  3PIO A;  1CZW A;  4X66 L;  1B70 B;  2JQO A;  2QEJ C;  1O7Z A;  3UDG A;  4YWM A;  3AFP A;  1Q82 C;  1H9K A;  1C7Y A;  3FPP A;  2JA6 H;  4A3I H;  3GTO B;  5CBE E;  1PH2 A;  1STH A;  2EYJ A;  2K28 A;  4IPC A;  1VQK A;  1SFO B;  2CVR A;  1ZYR D;  4DAP A;  2Q8I B;  2PZU A;  3E9I A;  4HMI A;  1V8Q A;  1CA6 A;  2JA6 B;  4OGQ C;  1PTO F;  1GXD C;  3G6J B;  3K7A H;  4X65 Q;  3DEP A;  3T1H L;  1EZ8 A;  4HAE A;  4DN4 M;  3GV6 A;  3H09 A;  4A3I G;  4J1M A;  4OO1 H;  1GVP A;  2PZW A;  4OIK A;  1RTN A;  2N49 A;  3E0J A;  3A74 A;  2CH4 W;  4FNF A;  3AEV A;  3CCS A;  2IY5 B;  2NB0 A;  3VR3 A;  5C3X A;  5JEA H;  1BCP C;  2EE1 A;  5BR8 L;  2PO4 A;  1D7Q A;  2YV5 A;  2AWN A;  5DLQ E;  1CTM A;  3E9H A;  2M9V A;  4GOP C;  1VQI A;  3EIV A;  3CQZ B;  2UXD Q;  3MEH A;  2V4D A;  1ENA A;  5C0X G;  4HCS A;  1PYB A;  4K8J A;  3AB9 A;  3D31 A;  1LTG D;  2PQA B;  5IGB A;  3QIA A;  4RH6 A;  2NYZ D;  2JN4 A;  1XMQ Q;  3NQI A;  4UP8 A;  1XNQ Q;  4KD4 A;  4OHJ A;  3IFT A;  4IAL A;  3OSO A;  1KTK A;  5IWA L;  1QVF A;  1IL2 A;  4DV3 Q;  1B7Y B;  1UNS A;  3T1Y Q;  2Z6B A;  5DM6 3;  1HR0 W;  3EFX D;  2DNE A;  3A7A B;  2UUB L;  2F4I A;  2B8F A;  4BBS G;  4JV5 L;  4A3D H;  5CMD A;  4CDE C;  4I7A A;  2BCO A;  2K4K A;  3F2U A;  1JOR A;  1A63 A;  3OWF A;  1RTO A;  1YVC A;  3T13 A;  4C1N I;  4MN3 A;  3DLL A;  5C0X I;  1FYC A;  1KAA A;  3PV0 A;  4X3T A;  3TDQ A;  3RN5 A;  2Q2I A;  1RL2 A;  2HHH Q;  4LF5 Q;  3HOY G;  2XGT A;  1NUC A;  4HED A;  3M7G A;  4L5S A;  3HOW H;  1X3G A;  3G7L A;  4BY1 H;  3BZD B;  2XN9 C;  5C4H A;  1VQB A;  3R2T A;  1J9O A;  5FLX L;  5FO7 B;  4CKB A;  1UUP A;  2FHT A;  3UI2 A;  2KEE A;  3OMC A;  1H9M A;  1PRT F;  4OX9 Q;  3K58 A;  2NZH A;  2YTX A;  3QOL A;  2PNH A;  4ILW A;  1YNJ D;  2Z1C A;  3MFY A;  1VMP A;  1KRT A;  4ALP A;  2K04 A;  3R8B A;  2JA8 G;  2EYF A;  3OWE B;  3H3V C;  1LT4 D;  1JB3 A;  2VXW A;  4A93 B;  2R7Z B;  1CHP D;  3S1M H;  4P75 A;  1XYI A;  3H0G H;  2JE6 I;  4C3I H;  1WTW A;  3MXN B;  2N3S A;  4O1N A;  3CC4 A;  1EYD A;  4LK1 C;  1EWI A;  4OEM B;  4KMU C;  5FLX E;  3CU7 A;  4OIJ A;  1IBL Q;  3ULL A;  1OTC A;  1VQ9 A;  4JYA L;  5IT9 L;  3QO2 A;  1WFQ A;  1X32 A;  4ZRZ A;  3CME A;  3K57 A;  4C3H G;  1QVC A;  1K83 H;  5IGG A;  2GVB A;  2PMZ B;  1QB5 D;  1J5E Q;  1NSN S;  3NP8 A;  4XDX A;  1EY4 A;  3W1B A;  2B2U C;  1X3P A;  2R93 G;  2E2H B;  1ENF A;  1SYG A;  1E22 A;  3VYU A;  1VCI A;  1TS2 A;  1I5F A;  4QGU A;  1SDF A;  4Z9C B;  2WKC A;  3T56 B;  2WAC A;  1PRT D;  3QWN A;  2ALY B;  1UE7 A;  1OXT A;  3S9W A;  2RKS A;  2P5Z X;  2N78 A;  1BBU A;  4AYB B;  1V9P A;  2E76 C;  1AH9 A;  1HZC A;  2JXM B;  5IYD H;  3BDC A;  1VQD A;  4NKL A;  3HOZ H;  2XIW A;  1ML0 D;  2Z6K C;  4M1U B;  5D65 A;  1VQH A;  2PQA A;  3D0F A;  3KDF B;  4QUF A;  3A8J E;  2HCC A;  3I72 A;  1VQJ A;  2K5W A;  1YZ6 A;  1LUZ A;  1AW7 A;  1STG A;  4NXN Q;  5COR A;  1E7Z A;  3STB C;  3K80 C;  2OCE A;  4CDF C;  1PZK D;  4A76 A;  3KF6 A;  5I6W A;  4DV0 L;  4JC0 A;  4JI7 Q;  1LTA D;  2UXB Q;  2B2U A;  4G4K A;  4JI0 L;  3NSW A;  3UDI A;  4QIW B;  1CQV A;  4L5R C;  4LF7 Q;  2PI2 A;  4YY3 L;  4A3E G;  1D1K A;  1HNZ Q;  4NB3 A;  2K14 A;  1NBW A;  4WRD A;  4GLA C;  5IOC A;  2AQ2 B;  1HNW L;  1B50 A;  1F2Y A;  2Z9H A;  3PMF A;  4FVM A;  5JPM C;  5A35 A;  5L37 A;  4ODG A;  3M4Q A;  5HY6 A;  3M4O B;  1NNX A;  1TKW B;  3D4R A;  4KY6 A;  1A0I A;  2VL6 A;  3DWP A;  1HFG A;  3CPW A;  3GTJ H;  1Z47 A;  4P2C B;  1EFI D;  2BE5 D;  1LTR D;  2JA7 B;  1EYG A;  5H1S E;  2LXJ A;  4PNY A;  2NTT A;  4A3L G;  2E2J H;  4IFD I;  4FXG C;  4DKA C;  2VUM G;  1D8L A;  2L11 A;  3GTL H;  1HZ9 A;  4IJH A;  4B9X A;  3A55 A;  4FF3 A;  4OO1 G;  1FD7 D;  5KIX A;  3VR4 A;  5I6Y A;  4Y7N H;  3AFQ A;  4NXM Q;  3GQB A;  1LAC A;  1D5Z C;  1PH9 A;  4IUU A;  2X6L A;  2FFK B;  3F2D A;  2PW7 A;  1LV9 A;  1L0X B;  1OO9 B;  1QNK A;  4DFA A;  4XQN A;  2VUM H;  1IBM Q;  5BN3 A;  4Y7N B;  2R7Z G;  2ES2 A;  1Q8K A;  3JAM L;  2K5V A;  4NMZ A;  4GKJ L;  1B8A A;  4LFB Q;  1A3T A;  3C1E A;  1I4X A;  4JI1 Q;  4I65 A;  4QL5 A;  3JAM i;  4DV5 Q;  2JA5 G;  2J0T D;  2FJ2 A;  2KCC A;  2LXK A;  1ESF A;  3LX0 A;  2CFM A;  2D2C C;  4JI6 L;  4RG1 A;  2WII B;  3HOW B;  3DM3 A;  4XQQ A;  3GTQ B;  1Q86 C;  2B39 A;  4RGM A;  3HG9 A;  2IT1 A;  1HQM C;  3CC2 A;  1I4H A;  5K36 H;  2DY8 A;  2EJG C;  4RA8 A;  4JBM A;  5IGC A;  3ND9 A;  1SRO A;  4R8N A;  3RNU A;  4DK3 C;  4A3E H;  1K28 A;  1D6E C;  3OW7 A;  4FF2 A;  2HDM A;  1YNN C;  1SLJ A;  2N55 A;  2UXC Q;  4B3M L;  2NWG A;  1NR4 A;  2ZJQ A;  4LUV A;  2WV6 D;  1SE2 A;  1F77 A;  4IOC A;  5GAD C;  4PMB A;  1GD7 A;  3Q22 A;  1RF2 D;  4L8J A;  1IL8 A;  2B29 A;  3SHL A;  2R92 H;  3NUC A;  3FMC A;  3EN2 A;  1SMY C;  3RMH A;  1CSQ A;  4S3S A;  2AQ1 B;  4JG2 A;  3KUP A;  1G51 A;  1I50 H;  2SDF A;  3CPF A;  3I4L A;  3NWT A;  1DOL A;  5IYD G;  4K6L A;  1WOC A;  3J80 c;  1CKO A;  3DWA A;  5C6A A;  1EOT A;  3HOV G;  2WB1 B;  3RZD B;  1AE3 A;  4X64 Q;  1VQ4 A;  1KQS A;  3AMU A;  2EYL A;  1VF7 A;  1C48 A;  1S4Z A;  3FKI H;  1PH3 A;  4MTN A;  2RDF A;  4YCW A;  4A3M B;  1U4P A;  1PH7 A;  4UAI A;  5LMN L;  4WOR A;  3W2D A;  1ILP A;  1F9S A;  4DK6 C;  5JAV A;  1FL0 A;  5IGF A;  1WVL A;  1CUK A;  3I3C A;  4GZY C;  4C3H H;  2BA1 A;  2Z8L A;  2XRS D;  4DUY L;  1XXG A;  5C0X J;  5EGT A;  1SYC A;  4K2L A;  1P8L A;  3M4P A;  1R4P B;  1RKN A;  2DY7 A;  2O5I C;  1EY0 A;  4JI4 L;  1C0A A;  4C3H B;  1F2Z A;  1QUQ B;  1GUO A;  4BBR G;  3MXG A;  5ELB A;  3SE0 A;  4A3F B;  1I94 Q;  2VB2 X;  5M3F G;  4C3I G;  4LF9 L;  3H0G G;  3I73 A;  3K5L A;  1IBK Q;  4LAA A;  5TSS A;  3HFZ B;  2A74 C;  1ZEQ X;  3GO5 A;  1DZ1 A;  4DR2 Q;  1O7Y A;  4A3F H;  1V1Q A;  3SK5 A;  5KRU A;  1L0W A;  1PH5 A;  3EA6 A;  2QA4 A;  1TS3 A;  2ZTE A;  5EKK A;  3I2Z A;  3S1R H;  1B53 A;  4KD3 A;  1K8G A;  5CV6 A;  3KLR A;  3NTH A;  1EY8 A;  1JWU D;  1M4V A;  2CKZ B;  3GTL B;  3RLO A;  1X56 A;  2VZA A;  3D6C A;  5T1I A;  3MXU A;  4OWT B;  1V1P A;  5AFW A;  4HJ5 A;  1SYD A;  2UUA L;  2RDH A;  4IJL A;  3C1F A;  3H3V H;  4OWW B;  1MSG A;  2FXQ A;  4DR4 L;  3OYY A;  3L0O A;  2A6E D;  1W6J A;  4BY7 B;  1MSH A;  1WD0 A;  2DGY A;  1A2U A;  4K0K L;  2ASB A;  2KUM A;  3UE0 A;  4ZLT F;  4K5X A;  2LS0 1;  1CA5 A;  1YIT A;  3U4Z A;  2F0J A;  1JOO A;  3TN2 A;  1CT1 D;  1QWY A;  2TSS A;  1K8M A;  3KBX A;  1NTG A;  3T1Y L;  1TS5 A;  5D14 A;  2CWP A;  2AUK A;  5C4X B;  2MQH A;  3KLS A;  4JV5 Q;  3HZX A;  3TME A;  3J81 i;  2KED A;  3NBH B;  5M9O A;  5AJ3 L;  3J7A F;  4O42 A;  3F8T A;  1HH2 P;  2MNA A;  4LUZ A;  5ELO A;  1TWH B;  5M5Y H;  4LF6 Q;  4DU9 A;  1XPR A;  2VUM B;  1YBY A;  1KNA A;  4K2K A;  5EPJ A;  1T5X D;  1LLR D;  1ZKO A; 
#chains in the Genus database with same CATH homology
 2NVQ B;  3CKI B;  3OPO A;  5M5X B;  4A3G B;  2D62 A;  4KJN A;  1STA A;  5IT9 E;  2SNM A;  3PO3 B;  2R92 B;  1KNE A;  1V43 A;  1PYW D;  1WTP A;  2SNS A;  4I7Z C;  1ICW A;  5EBD A;  5KNC A;  4QCL A;  3KBG A;  4RGT A;  3GTG B;  2EVB A;  5F2D A;  3TP8 A;  4DK1 A;  3D6W A;  4BS9 A;  5IGD A;  5DAU A;  4R9W A;  1TQO A;  2JSO A;  5KYL A;  1KDA A;  4RAU C;  3H91 A;  4XXE A;  1Y8P B;  1RD9 D;  4J8Q A;  3NTK A;  4DXF A;  2ID0 A;  5ELE A;  2ICE C;  1HUM A;  3GP7 A;  1KDB A;  1K8O A;  1Q1E A;  1LTS D;  2F3V A;  4KV6 A;  3ONA B;  4KHZ A;  1TS4 A;  5BN4 A;  2EOT A;  3MC0 B;  4V0B A;  3P7J A;  1AP0 A;  4KY5 A;  2BDN A;  1Y1W B;  5CV9 A;  1HCZ A;  1SNP A;  2I46 A;  1HUN A;  3J81 E;  5LL6 S;  1I4Q A;  3H6M A;  1PTO H;  1SE3 A;  2K33 A;  1B2T A;  3L3O C;  3U9O A;  2EY2 A;  3BDO A;  4KK7 A;  1STY A;  3MFG A;  3X3N A;  3E6Z X;  2PQE A;  2B8G A;  1SAP A;  3ZYY X;  4HR7 B;  3P75 A;  2CHB D;  2J4X A;  1LO5 D;  1WTO A;  5I9P A;  3S1R B;  2EYH A;  2BDO A;  1FR3 A;  3H0G B;  3T4A C;  1IYV A;  5CC4 A;  1B44 D;  4LMQ D;  5M5W B;  1E0B A;  4IFD H;  4LJZ C;  4BBR B;  2AQ3 B;  5JVH 3;  1HA6 A;  4ZKC B;  3I4N B;  4A3D B;  5M3F B;  1AFP A;  2EXZ A;  1Q12 A;  3S2D B;  1EQT A;  4HSV A;  2K5D A;  2K6A A;  3ITP A;  3MA2 B;  1KAB A;  1L0Y B;  1LT5 D;  2RVL A;  2A5H A;  1D5X C;  1I6H B;  1CI3 M;  2IPK D;  4ZUI A;  2XVS A;  4A3I B;  1OXV A;  1STE A;  4IN3 A;  2EY6 A;  3ERO A;  1JWS D;  1C4Q A;  1X3Q A;  2F03 A;  2EYM A;  3A8I E;  3S1M B;  1NCV A;  1ENC A;  4IFD G;  3VA5 A;  2NVY B;  2O4X A;  3SK4 A;  2MHV A;  1CFM A;  1QOH A;  1ILQ A;  3NQT A;  5KNB A;  2A6E C;  2F3W A;  3I90 A;  3AU7 A;  4IUT A;  5FKA C;  4HTH A;  3IFD A;  4N9T A;  4TRD A;  5E4X A;  2HDL A;  5JEA J;  1ZYR C;  1W6K A;  1KDC A;  3VA7 A;  4RHR A;  3SXH A;  5C0X H;  1GHK A;  2Q8T A;  3L9A X;  4KY7 A;  4FXD A;  2F0K A;  1F9Q A;  4KKU A;  2QCP X;  2X6G A;  4C1N K;  3O13 A;  4FYD A;  4K8I A;  1SYE A;  3V05 A;  5JEA G;  1IYU A;  4G57 A;  1A6X A;  3BS1 A;  1TWG B;  4H13 C;  1A15 A;  1SXT A;  2F0L A;  1JOK A;  5CYU A;  3HKZ B;  1EWC A;  1F2L A;  2B2W C;  1IW7 D;  4WFN 3;  3PUX A;  1TR5 A;  3Q0A A;  5DNF A;  1FNW A;  2EY1 A;  1G29 1;  3FPU B;  2D9U A;  3DMU A;  2A68 D;  3J80 L;  1C8C A;  1R9T B;  3V96 A;  5EKL A;  1BXT A;  1ZXT A;  1PZI D;  4XTC S;  4DXG A;  4RFB A;  1Q1B A;  2L4N A;  4A3E B;  2JA5 B;  5FO9 B;  3SEB A;  1G8Z D;  3J81 L;  3S1N B;  3KK7 A;  3S14 B;  1GOZ A;  2B2V A;  5ELD A;  4DGZ A;  2OT2 A;  1TWF B;  1J8I A;  4K5V A;  2X69 A;  3P20 A;  1TII D;  1WCM B;  1E2Z A;  3FRP B;  5I2X A;  4J6H A;  4F7X A;  2F0W A;  4MIU A;  2KEC A;  1DOM A;  4K14 A;  4NDX A;  3IAY A;  2XWB B;  1U4R A;  5JPN C;  3TP5 A;  2HCI A;  4FF1 A;  3LWE A;  2F0S A;  2IL8 A;  2B2W A;  4YIJ A;  1LT6 D;  2KQ3 A;  2R3Z A;  3JAM E;  1M8A A;  2EJF C;  2F0H A;  2FIN B;  1TT2 A;  4ID6 A;  1Q8I A;  4X3U A;  3X3M A;  2IJ0 A;  1I4R A;  1E2V A;  2L1B A;  2LMC B;  1AZQ A;  3Q24 A;  3A8K E;  4EQP A;  4XYO A;  2EYO A;  5G3L F;  1BQQ T;  2GA4 B;  3K7A B;  4KN7 C;  4ZK9 B;  1JC7 A;  4L63 B;  2G9D A;  1DOK A;  1JCK B;  4ABN A;  5FOB B;  1B9N A;  4CGY B;  2M2L A;  3EQL C;  1UEA B;  3RD4 A;  4IUV A;  1BDO A;  4C3I B;  4ZQ3 A;  1QJO A;  5E4W C;  4XT3 B;  4FF4 A;  1HFN A;  2EJM A;  5J1Z A;  2B63 B;  4NP5 A;  3IL8 A;  4CKC A;  3DEO A;  1Z7T A;  2A68 C;  2NVX B;  2N88 A;  1PTO B;  2M00 A;  2F0E A;  2YU9 B;  2XRQ D;  1NAP A;  2L9H A;  5E3F A;  1GUN A;  2OXP A;  3PUZ A;  3FVQ A;  5CV7 A;  4IUP A;  1U4M A;  4BBS B;  4QF4 A;  2OEO A;  5M3M B;  4F8M A;  3BVZ A;  3HRZ C;  3J7A V;  1BCP F;  4XT1 B;  3FEW X;  1KLU D;  2LY7 A;  3WOF A;  3PUV A;  1CK1 A;  1HA5 A;  3HS0 C;  2PCF B;  4L6T B;  1SMY D;  2AWO A;  1I4G A;  3PUW A;  4HCE A;  4CJ1 B;  1HXY D;  4DA2 A;  1IKM A;  3T16 A;  5ELF A;  3SK6 A;  2B2V C;  2JYO A;  5A2Q L;  3SK8 A;  5HGT A;  3NE5 B;  1VF5 C;  4IUQ A;  2ENB A;  1XWE A;  1MI2 A;  1MBY A;  1LAB A;  2BE5 C;  1IHZ A;  1DXM A;  1KLG D;  4KJO A;  3SVM A;  3K6O A;  3NXW A;  4PMW A;  1FNV A;  2E2I B;  1YNN D;  1DJR D;  3KLS X;  5LHY 1;  1WTX A;  1A3U A;  5ISR A;  2JA8 B;  1U4L A;  3S1Q B;  2C5C A;  5FK9 C;  3D3R A;  1MGS A;  1UAP A;  1GUT A;  3HOX B;  2SOB A;  1R4Q B;  4RKB A;  4XIG S;  3HP3 A;  4FP5 D;  4IUN A;  3I91 A;  1XTC D;  1YNJ C;  1XX8 A;  1EEF D;  1BOS A;  4N9P A;  1Q3L A;  2F0U A;  1A3V A;  4B9W A;  1LTT D;  2RBM A;  5I2Y A;  1D1I A;  3K5O A;  1K83 B;  4DAV A;  2B2Y C;  2Z4H A;  3CHB D;  4U68 A;  5BN5 A;  1AEX A;  2A73 B;  2ZXP A;  2QIL A;  3HOU B;  3Q23 A;  2HQE A;  4MHE A;  3V2T A;  4EQO A;  1PTO C;  1SNM A;  5HUR A;  2KHS A;  2O2L D;  3NPP A;  1RJT A;  1EYC A;  1EL0 A;  1QG7 A;  1LTB D;  2IX1 A;  5CV8 A;  5EPL A;  1OXX K;  2FMM A;  1EY7 A;  1STN A;  3ERQ A;  2PNR C;  3NBH A;  3R93 A;  5IGE A;  1SYF A;  3LWU A;  4CKE A;  2LKV A;  2BA0 A;  1II3 A;  1JR0 D;  2KA7 A;  2WP8 J;  2QDB A;  3VR6 A;  4CHT B;  3BVM A;  1HPC A;  2PYK A;  1Q90 A;  1NR2 A;  1BO0 A;  4DNR B;  3C2P A;  1HTL D;  4X3S A;  5KGU A;  2B2T A;  1EEI D;  1U9R A;  3DHQ A;  3R3O A;  2NTS A;  4PV1 C;  3DUZ A;  3RLF A;  1B3A A;  3A54 A;  4KI0 A;  3T51 B;  1BBX C;  2F0N A;  3NHH A;  4Q0F A;  4ULL A;  3J80 E;  3GD7 A;  1RHP A;  3CRK C;  1SSO A;  2WKD A;  2L55 A;  2RA4 A;  1GUW A;  2KOL A;  3DM1 A;  3C3L A;  2K1B A;  2F0O A;  3QG1 A;  4FO2 A;  3A56 A;  1S5D D;  5CV5 A;  4H44 C;  2R93 B;  1CQF A;  2RSN A;  4KTA A;  3N52 A;  2E75 C;  4M8A A;  4H0L C;  3E5S A;  1PZJ D;  5CGK A;  4DAY A;  2K5Q A;  3VYR A;  1VDZ A;  2AUJ D;  3URY A;  3D8G A;  5J39 A;  3TP6 A;  4JBW A;  4OO1 I;  1BR9 A;  1TY0 A;  1F2M A;  4KN4 C;  5M5Y B;  1GUG A;  4X3K A;  1DM0 B;  2F0I A;  3VYT A;  1BNZ A;  2ZXO A;  4C2M B;  3M3Y B;  3S16 B;  3J7Y W;  4ME5 A;  4HSP A;  1EY6 A;  2EY5 A;  1DYQ A;  2EZV A;  2H1E A;  1SND A;  2RSO A;  3K59 A;  4IFD J;  1EWH A;  2WAQ B;  2F0F A;  4BA2 I;  1H9S B;  2K7V A;  2NVT B;  1FGB D;  1SYB A;  1BCP D;  4C3J G;  3MWY W;  3TZD A;  1DON A;  3FDT A;  1QCB D;  1ESR A;  5C4J B;  1SJE D;  1PDQ A;  1EY9 A;  1TU2 B;  3PIO 3;  5COY A;  3D4W A;  3S2H B;  1DCZ A;  4ZYS A;  2ICI A;  1TWA B;  1I6V C;  1PRT C;  1E2W A;  3TSS A;  3HOV B;  2HUG A;  2SEB D;  3WDN A;  3MHB A;  2MPM A;  4CBV A;  5J22 A;  2F0V A;  2EYP A;  3TP7 A;  3K5M A;  1GHJ A;  2WIN B;  5EKI A;  4Q5V A;  4JK1 C;  3TBI B;  2FMC A;  2O5J C;  1PXU A;  2D5D A;  3H94 A;  4KKT A;  1PFN A;  1CM9 A;  3NBI A;  4BY1 B;  5E1F A;  3MTS A;  2E74 C;  1H9R A;  2PZT A;  1EU3 A;  2F1M A;  4BWG B;  4RKL A;  4UDU C;  2C9O A;  1Y8O B;  2IX0 A;  5JVG 3;  4TQU S;  5CV4 A;  4K6D A;  2EDG A;  3OMG A;  1EQV A;  1AN8 A;  5EJW A;  2QKI C;  2YYZ A;  2NN6 H;  1SNC A;  2KCN A;  4CJ0 B;  4G7H C;  1RDP D;  5T1G A;  5I4D A;  1PRT B;  3ND8 A;  2CQA A;  4TSS A;  5DEH A;  1JIC A;  4DF7 A;  3PUY A;  2Z4I A;  4E6I A;  2CW0 D;  1G2S A;  1V1P B;  4K5W A;  4IQZ A;  3K0Y A;  1I50 B;  1QIL A;  5NUC A;  3DWQ A;  4DK0 A;  1JOQ A;  2MJ8 A;  3M7N A;  1JQY D;  3HEJ A;  1EYA A;  3GTP B;  4RGO S;  3EJI A;  1VMC A;  2OF1 A;  3FKI B;  4A3K B;  2PW5 A;  4HN7 A;  3MVV A;  1S5C D;  5ELC A;  1ROD A;  1SNQ A;  2JP1 A;  5KND A;  1JWM D;  4RHS A;  3MXP A;  1HTP A;  2B2T C;  3MZ5 A;  2Y0S B;  3VR2 A;  2G9H D;  4HMJ A;  4BA1 I;  2F0M A;  3TZU A;  2MGS A;  2DNC A;  2I07 B;  4F87 A;  3GTK B;  2IWH A;  4WJW A;  5JOB A;  5C3W A;  5IIF A;  5A2Q E;  5C3E B;  1I3Q B;  1S5E D;  3HOY B;  4QMG A;  5K5P A;  1D5M C;  1WTQ A;  2JEB I;  4PMC A;  1Y1V B;  2R61 A;  3BYT B;  4H7B A;  1RCV D;  5FO8 B;  3GV3 A;  3NK9 A;  4PQX A;  5G3L D;  1HQR D;  2NUC A;  3S15 B;  2XSC A;  1OXU A;  1O78 A;  5KEE A;  2ZXR A;  5C5L A;  2IW3 A;  1PMR A;  4QB4 A;  3W3A A;  4FXK C;  3I8Z A;  4NW2 A;  1S5B D;  1PTO D;  5CR3 A;  5D3I B;  5EQ0 A;  4R8I A;  2Q8R E;  1HRJ A;  1LTI D;  2MP1 A;  3T53 B;  1H9J A;  3SR1 A;  1B4O A;  1ET6 A;  3U9S A;  3K5N A;  2L5T A;  1QE6 A;  3GTJ B;  1TVX A;  2A69 D;  1SEB D;  1Y69 U;  3PIP 3;  2A6H C;  1BF4 A;  1I4P A;  3QOJ A;  3I4M B;  4KHV A;  2JEA I;  1H9S A;  1B1Z A;  3NTI A;  5I9O A;  4G7Z C;  1QNU A;  3OIQ A;  3I70 A;  1G6Z A;  1EU4 A;  1EIG A;  2K01 A;  4RWS C;  2B2Y A;  5C4Z A;  3CRL C;  4G7O C;  1IKL A;  4C3J B;  4XYQ A;  1TY2 A;  1B9M A;  3MAQ A;  4OL7 A;  1CZG A;  1ONL A;  4KKS A;  2LFN A;  1Z6H A;  1BCP B;  5JJZ A;  1A2T A;  3BDL A;  4RCN A;  2K05 A;  3M4Y A;  1GJX A;  1SNO A;  3N6R A;  1DD2 A;  1SBB B;  1F9P A;  4QUC A;  1TWC B;  2F0D A;  3QJY A;  1IW7 C;  4V19 0;  2MUY A;  1HHV A;  3BYY B;  1EIH A;  3C46 A;  1Y8N B;  5C5M A;  2F0Q A;  1ET9 A;  1T5E A;  3QB3 A;  1G2T A;  4EQN A;  2F0G A;  2BOS A;  4IUR A;  3RZO B;  3HOZ B;  3S17 B;  4RCO A;  5KYI A;  3L7Z C;  4ZUJ A;  2VNU D;  3HGB A;  4U67 3;  1MD2 D;  3BG3 A;  2IX3 A;  3D4D A;  2F0T A;  1WTR A;  2NN6 I;  2F0P A;  3SDZ A;  2DN8 A;  4A3B B;  3LNN A;  2KJX A;  2RDG A;  1WTV A;  2K03 A;  1V1O A;  3RUZ A;  3R2I A;  3BVG A;  4TKO B;  5EBC A;  1SE4 A;  1F9R A;  1STB A;  3A7L A;  3OOC A;  3OIP A;  4ZAI A;  1D2B A;  3IKJ A;  2CW0 C;  4EGV A;  1GUS A;  4ZKB B;  4XQJ A;  1PFB A;  1PLF A;  4F88 A;  5C44 B;  2XWJ B;  3WOE A;  2A6H D;  5CBA E;  2XNA C;  3PO2 B;  2A69 C;  4B08 A;  5EPK A;  1OXS C;  3OHX C;  2E2D C;  2VB3 X;  2E2J B;  1JE4 A;  4C56 C;  3DXJ C;  5D3D A;  3KF8 A;  2KVM A;  1AZP A;  4RGN A;  1G91 A;  2K32 A;  2QF7 A;  1SJH D;  3VR5 A;  5DM7 3;  4IZ8 A;  3GTM B;  2H4O A;  2L0C A;  3NWS A;  4DNT B;  1EY5 A;  2ZT9 C;  4CJ2 C;  1CHQ D;  1BUV T;  3P1H A;  3VYS A;  2TMP A;  2NBF A;  5IOD A;  1O7L A;  3EVQ A;  1EZ6 A;  1FNU A;  2J7Z A;  5K36 G;  1LT3 D;  1PFM A;  2PPB C;  2L12 A;  2R6G A;  4EVO A;  1S5F D;  2NN6 G;  2NZ1 D;  3Q6S A;  1WD1 A;  2EPB A;  1O80 A;  3MXN A;  4A3J B;  5LL6 X;  2RQX A;  3M85 A;  1CZW A;  2QEJ C;  1O7Z A;  1H9K A;  3FPP A;  3GTO B;  5CBE E;  1STH A;  2EYJ A;  2K28 A;  1SFO B;  2CVR A;  1ZYR D;  4DAP A;  2Q8I B;  2PZU A;  4HMI A;  1V8Q A;  1CA6 A;  2JA6 B;  4OGQ C;  1PTO F;  1GXD C;  3G6J B;  3DEP A;  1EZ8 A;  4HAE A;  4DN4 M;  3GV6 A;  3H09 A;  4J1M A;  4OO1 H;  2PZW A;  4OIK A;  1RTN A;  3E0J A;  4FNF A;  2NB0 A;  3VR3 A;  5C3X A;  5JEA H;  1BCP C;  2EE1 A;  2PO4 A;  2AWN A;  1CTM A;  2M9V A;  3CQZ B;  3MEH A;  2V4D A;  1ENA A;  5C0X G;  4HCS A;  4K8J A;  3AB9 A;  3D31 A;  1LTG D;  5IGB A;  3QIA A;  4RH6 A;  2NYZ D;  3NQI A;  4KD4 A;  4OHJ A;  3IFT A;  4IAL A;  3OSO A;  1KTK A;  1UNS A;  5DM6 3;  3EFX D;  2DNE A;  3A7A B;  2F4I A;  2B8F A;  5CMD A;  2BCO A;  3F2U A;  1JOR A;  3OWF A;  1RTO A;  3T13 A;  4C1N I;  4MN3 A;  5C0X I;  1FYC A;  1KAA A;  3PV0 A;  4X3T A;  3TDQ A;  1NUC A;  4HED A;  3M7G A;  3G7L A;  3BZD B;  2XN9 C;  5C4H A;  3R2T A;  1J9O A;  5FLX L;  5FO7 B;  4CKB A;  1UUP A;  2FHT A;  3UI2 A;  2KEE A;  3OMC A;  1H9M A;  1PRT F;  3K58 A;  3QOL A;  4ILW A;  1YNJ D;  2Z1C A;  3MFY A;  1VMP A;  2K04 A;  3R8B A;  2EYF A;  3OWE B;  3H3V C;  1LT4 D;  1JB3 A;  2VXW A;  4A93 B;  2R7Z B;  1CHP D;  1XYI A;  2JE6 I;  1WTW A;  4O1N A;  1EYD A;  4LK1 C;  4KMU C;  5FLX E;  3CU7 A;  4OIJ A;  5IT9 L;  3QO2 A;  1X32 A;  4ZRZ A;  3K57 A;  4C3H G;  5IGG A;  2PMZ B;  1QB5 D;  1NSN S;  3NP8 A;  4XDX A;  1EY4 A;  2E2H B;  2B2U C;  1X3P A;  1ENF A;  1SYG A;  3VYU A;  1VCI A;  1TS2 A;  1SDF A;  4Z9C B;  2WKC A;  3T56 B;  2WAC A;  1PRT D;  3QWN A;  1OXT A;  3S9W A;  2RKS A;  4AYB B;  2E76 C;  2JXM B;  3BDC A;  4NKL A;  2XIW A;  1ML0 D;  4M1U B;  5D65 A;  4QUF A;  3A8J E;  2HCC A;  3I72 A;  2K5W A;  1AW7 A;  1STG A;  5COR A;  1PZK D;  5I6W A;  1LTA D;  2B2U A;  4G4K A;  3NSW A;  4QIW B;  1CQV A;  1D1K A;  4WRD A;  5IOC A;  2AQ2 B;  1B50 A;  1F2Y A;  3PMF A;  4FVM A;  5JPM C;  5A35 A;  4ODG A;  3M4O B;  1TKW B;  3D4R A;  4KY6 A;  3DWP A;  1HFG A;  1Z47 A;  4P2C B;  1EFI D;  2BE5 D;  1LTR D;  2JA7 B;  4PNY A;  2NTT A;  4IFD I;  4FXG C;  2L11 A;  4B9X A;  3A55 A;  4FF3 A;  4OO1 G;  1FD7 D;  5KIX A;  3VR4 A;  5I6Y A;  3GQB A;  1LAC A;  1D5Z C;  4IUU A;  2X6L A;  2FFK B;  2PW7 A;  1LV9 A;  1L0X B;  1OO9 B;  1QNK A;  4DFA A;  4XQN A;  5BN3 A;  4Y7N B;  3JAM L;  4NMZ A;  1A3T A;  3C1E A;  1I4X A;  4I65 A;  2J0T D;  2FJ2 A;  2KCC A;  1ESF A;  3LX0 A;  2D2C C;  2WII B;  3HOW B;  4XQQ A;  3GTQ B;  2B39 A;  4RGM A;  3HG9 A;  2IT1 A;  1HQM C;  1I4H A;  5K36 H;  2DY8 A;  2EJG C;  4RA8 A;  5IGC A;  3ND9 A;  4R8N A;  1D6E C;  3OW7 A;  4FF2 A;  2HDM A;  1YNN C;  2N55 A;  2NWG A;  1NR4 A;  2WV6 D;  1SE2 A;  1F77 A;  4PMB A;  3Q22 A;  1RF2 D;  4L8J A;  1IL8 A;  3SHL A;  3NUC A;  3FMC A;  1SMY C;  3RMH A;  4S3S A;  2AQ1 B;  3KUP A;  2SDF A;  3I4L A;  3NWT A;  1DOL A;  4K6L A;  3DWA A;  5C6A A;  1EOT A;  2WB1 B;  3RZD B;  3AMU A;  2EYL A;  1VF7 A;  1C48 A;  1S4Z A;  2RDF A;  4A3M B;  1U4P A;  4UAI A;  4WOR A;  3W2D A;  1ILP A;  1F9S A;  5JAV A;  5IGF A;  1WVL A;  3I3C A;  4GZY C;  2BA1 A;  2Z8L A;  2XRS D;  1XXG A;  5C0X J;  5EGT A;  1SYC A;  4K2L A;  1R4P B;  1RKN A;  2DY7 A;  2O5I C;  1EY0 A;  4C3H B;  1F2Z A;  1GUO A;  3MXG A;  5ELB A;  3SE0 A;  4A3F B;  2VB2 X;  4C3I G;  3I73 A;  3K5L A;  4LAA A;  5TSS A;  2A74 C;  1ZEQ X;  3GO5 A;  1DZ1 A;  1O7Y A;  3SK5 A;  5KRU A;  3EA6 A;  1TS3 A;  5EKK A;  1B53 A;  4KD3 A;  5CV6 A;  3KLR A;  3NTH A;  1EY8 A;  1JWU D;  1M4V A;  3GTL B;  3D6C A;  5T1I A;  3MXU A;  1V1P A;  5AFW A;  1SYD A;  2RDH A;  3C1F A;  1MSG A;  2A6E D;  1W6J A;  4BY7 B;  1MSH A;  1WD0 A;  1A2U A;  2KUM A;  4ZLT F;  4K5X A;  2LS0 1;  1CA5 A;  2F0J A;  1JOO A;  3TN2 A;  1CT1 D;  1QWY A;  2TSS A;  1K8M A;  3KBX A;  1TS5 A;  5D14 A;  2AUK A;  5C4X B;  3KLS A;  3HZX A;  3TME A;  2KED A;  5M9O A;  3J7A F;  4O42 A;  1TWH B;  4DU9 A;  2VUM B;  1KNA A;  4K2K A;  5EPJ A;  1T5X D;  1LLR D;  1ZKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...