1FR3A

The high resolution structure of a molybdate binding protein from sporomusa ovata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'MKISGRNKLEATVKEIVKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDATE/TUNGSTATE BINDING PROTEIN
publication title Structure of the molybdate/tungstate binding protein mop from Sporomusa ovata.
pubmed doi rcsb
molecule tags Metal binding protein
total genus 12
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fr3A00
1B9MA 5K36H 2BDOA 1HPCA 2DNEA 3D31A 3OPOA 3EQLC 3PUYA 1SMYC 1Y8OB 2NN6G 3N6RA 3P20A 4DK0A 1K8MA 3IKJA 3VR6A 2A6HC 2AUJD 1Y8PB 1ZYRC 3A8JE 1OXVA 2DNCA 1GJXA 2A6HD 2EJMA 3PV0A 1VF5C 1BDOA 4BA1I 4RCNA 3PUXA 1Q1BA 4H44C 5A35A 4I7ZC 3CRKC 1QJOA 1EWHA 4OO1H 3AB9A 2EJFC 2D2CC 3A7AB 1H9SB 3MXUA 4XTCS 1GUOA 3OW7A 4KHZA 3PUVA 1H9KA 3U9SA 3LNNA 2E74C 1VDZA 3RLFA 1VF7A 1Z6HA 1Q90A 1YNNC 1OXXK 1CI3M 4KKUA 4KN7C 4G7HC 4OO1G 3WDNA 1CTMA 2KCCA 3NE5B 3HGBA 4DNTB 2YYZA 1E2WA 2B8FA 4DNRB 1LABA 4KN4C 3I73A 2K32A 4KKSA 4IFDH 3OOCA 4GZYC 2F1MA 2QF7A 2AUKA 4KMUC 1Y8NB 1H9RA 2A68C 2CW0C 1B9NA 4LJZC 3VR5A 3QJYA 1Y69U 2A68D 1HCZA 2V4DA 1H9MA 3D4RA 1IYVA 5K36G 2K33A 4IFDG 1GUSA 1OXUA 1A6XA 1Z7TA 2EJGC 1GUNA 5BN3A 1IW7C 3T56B 2Q8IB 1IW7D 3T53B 3T51B 2NN6I 1HQMC 4KI0A 1GUTA 3QG1A 4IQZA 2BA1A 1ZKOA 2B8GA 4L8JA 2EVBA 1O7LA 3PUZA 5JEAH 3A8IE 2A69C 1HTPA 3PUWA 3M7NA 5BN5A 3VR2A 4XIGS 3VR4A 1PMRA 3FMCA 2A69D 3CRLC 3I4LA 2K7VA 1E2ZA 4PV1C 1GUGA 2D62A 4G7ZC 1OXTA 1FYCA 1K8OA 4HR7B 2JEAI 3ND8A 4OGQC 1OXSC 3TZUA 3IFTA 5C0XH 4DK1A 1ONLA 5BN4A 2BA0A 3SE0A 3A8KE 2R6GA 1H9JA 1IYUA 4TKOB 3ND9A 1I6VC 5KNCA 1GHKA 1GHJA 1Q12A 2AWOA 3BG3A 3SDZA 2D5DA 2PNRC 1DXMA 1FR3A 1G291 1T5EA 1TKWB 2ZT9C 3A7LA 3L7ZC 1YNJC 2KA7A 2E75C 4H0LC 4H13C 1DCZA 1CFMA 1TU2B 4JK1C 3H94A 2A6EC 3QIAA 2JXMB 1VCIA 2BE5C 3VR3A 4JBWA 5KNBA 3M85A 4BA2I 2A6ED 4LK1C 1H9SA 3GD7A 2PPBC 2DN8A 2JEBI 2BE5D 3DXJC 3I72A 1DD2A 1LACA 4TQUS 5JEAG 2O5IC 1E2VA 1O78A 3M4YA 1V43A 4KKTA 4G7OC 3KLRA 3VA7A 3GQBA 2LMCB 3BDOA 5KNDA 1V8QA 2NN6H 2IT1A 2JE6I 3FPPA 3LWUA 1Q1EA 3MFYA 2E76C 2PCFB 3W3AA 2O5JC 2EDGA 5C0XG 2L5TA
chains in the Genus database with same CATH superfamily
4DV3L 5EQ0A 1QG7A 4CJ0B 1K8MA 3RUZA 1SYDA 1WYDA 2KEDA 1I5FA 2EJMA 4WJ4A 1ZYRD 1NCVA 5IODA 4B9XA 1BVSA 2EYOA 3OWFA 4OO1H 1EY7A 1YITA 5IGBA 2CQOA 3AFPA 1IL8A 4FNFA 5ELFA 4DN4M 4JI4L 5C0XI 5FK9C 1EY6A 1D8LA 4OO1G 4O0AA 1OXXK 1F9QA 2VQEQ 2ID0A 5JVH3 1E2WA 2CQAA 4LMQD 5AJ3Q 4YCWA 3Q23A 2CWPA 1K8AC 4QGUA 4FF4A 4DUYQ 1V1QA 2A68C 2CKZB 3UDFA 1YJ9A 3HKZE 3GV6A 5M5WB 3S1RB 3CC2A 2IW3A 2X69A 2ZTDA 1IW7C 1QZHA 4K8JA 2XGTA 1WCMG 2HDMA 2Z6KC 4GLAC 4CKCA 4KI0A 3CCMA 4CDEC 3D4WA 1VQBA 1K0SA 1BO0A 3OYYA 4RGMA 2EYFA 1QILA 3PUZA 2JQOA 4DV6L 5AJ3L 4RH6A 3GTKB 1HQRD 2GVBA 1LV9A 5E1FA 5M5WH 2L4NA 4DUYL 3MHBA 2CWAA 2O4XA 1BNZA 4HR7B 2JEAI 3ND8A 1WD0A 4HIKA 4X3TA 4EX5A 2QGQA 1J8IA 4IPGA 1HR0L 2NZ1D 2R6GA 4MZ9A 2G9DA 1VQKA 4CBVA 2BH2A 2XIWA 1H95A 1T5XD 2N49A 3BG3A 1SN8A 1TKWB 3MA2B 4H0LC 4L63B 4IFDI 2R7ZG 4JK1C 1XTDA 3FKIB 3GTKH 1PH3A 2HQLA 5KNBA 3CPWA 4BBSB 2A6ED 1I4HA 2GVAA 2SOBA 1B50A 2IWHA 5C4ZA 2QA4A 4X3SA 2XWJB 2B63H 3I4NG 4XYQA 5IT9c 1TY0A 1V8QA 2RDFA 4KLKA 1L0WA 1F77A 2RDHA 2JE6I 2RF4A 4MN3A 2EY6A 3AQQA 2B63G 2B2WC 3R8BA 4Z9CB 1PH6A 3FPUB 1UEAB 2Y0SG 5IGCA 3S1QH 1XPUA 4GOPB 3S2DB 4DR2L 2KHSA 4JI1L 4BY7B 4C1NI 4RHSA 2HHHQ 1EZ6A 3HOUB 1RJTA 5A35A 3TRZA 4R4IA 1NE3A 3WOEA 2J7ZA 2R92H 1B1ZA 1D6EC 4RKLA 4DR5Q 1BF4A 4NXMQ 3RLFA 4KHPL 5IT9L 1FJGQ 4H7BA 4G7HC 1G6ZA 2IX3A 1STNA 2R92G 1A62A 1DGSA 1PRTD 1MI2A 2A5HA 2QILA 4FF1A 1L1OC 2EXDA 2FMMA 1H9RA 5CV8A 5GAHC 3K5LA 4BY7H 5LMNQ 1TWGB 4CKBA 2K33A 2Z4HA 1BQQT 3C1EA 3DWAA 3TP6A 4BY7G 5FO9B 2JA5B 5EBDA 1JOQA 2IHEA 1HH2P 4C3IB 2IY5B 3HOVB 1ASZA 4HJ9A 1DOLA 4JBKA 3DM1A 5C4XB 5M3FB 2KENA 3A8IE 4DR1L 1IHZA 3GP7A 3OIQA 2PW5A 4AH6A 4A3IG 1TWGH 2K14A 4K8IA 2WB1G 1WI5A 2PQAA 1DZ1A 1U0LA 4YCVA 2JA5H 4B3MQ 1SYGA 4C3IH 3DUZA 4DAVA 1YNXA 3HOVH 1FNWA 5KNCA 4RCOA 2LXKA 2JA5G 4JVZA 5JJIA 4HTHA 1XMOQ 2O2LD 3TS0A 5M3FH 3HKZB 3HOXB 1LT4D 1DCZA 1PLFA 3EFXD 3I2ZA 1NMGA 5CBAE 3HOYG 1PTOD 4IJHA 2WIIB 1I4XA 4K0KL 3E0JA 1HZCA 2BDNA 1RTOA 1PH4A 5JEAG 2HQEA 5FKAC 1KDAA 5IOCA 2PQAB 1AW7A 2K5QA 2OTJA 3MXGA 4K6LA 1XNRQ 3CD6A 4X65Q 3MTSA 5FO7B 2ES2A 1D1IA 2KECA 1Y1WB 4A75A 1Y8PB 1JJCB 1HJPA 3KK7A 4JI7Q 3RZOH 1JORA 1C48A 4R8IA 2Z6BA 1U5KA 3OIPA 3CPFA 1HUMA 3LNNA 5IYCH 4IUVA 2HUGA 1JCKB 1M1KC 1N32L 3WDNA 4NKLA 3JAMi 4GKKQ 4DNTB 1XNRL 5IYCG 4KN4C 2H5XA 3I73A 4R4QA 4GZYC 1Y1WH 3H0GG 3DM3A 4IUTA 1B9NA 5CORA 1BCPC 2QDLA 3MWYW 3S17H 4IZ8A 1EIYB 4IJLA 4UP7A 2QCPX 1OXUA 1A6XA 1Z7TA 2AKWB 1R4QB 4JI7L 1FGUA 1V1OA 3I4MG 2F0UA 2B2YC 3CC7A 2PMZE 1XTCD 4ID6A 2NWGA 3LGJA 4ZAIA 2A19A 5IT9E 1GD7A 2AMCB 4A3BB 4CDFC 2F0FA 2LY7A 3QG1A 1J9OA 1STBA 5C44B 1UE6A 4JOIC 1ESFA 1VQGA 1TIID 2D0OA 1HNXL 3FMCA 1N8RC 3I4LA 1O7IA 4HJAA 1VQFA 5COYA 3SR1A 4CKEA 3IFDA 5M5YH 1Q81C 1SSOA 2QDBA 3FVQA 1OXSC 3D4DA 1JB7A 5C0XH 4PMWA 4IURA 5BN4A 3RZDB 3ER0A 1CT1D 2ZTCA 2R93B 2PZTA 4C3HG 4C56C 4A3BH 5HY6A 1KAAA 4X3UA 1MKHA 1EQVA 1SJED 2PZUA 1ENFA 2L15A 5C44H 4E6IA 4A3BG 2UXCQ 2YV5A 3ERQA 1SEBD 1RODA 3T1HL 1N34Q 4O2DA 3R2IA 4K6DA 1X3GA 1VQ7A 4KKTA 3PIOA 4PZ8A 3E6ZX 4P75A 1C9OA 4JG2A 5CV9A 4JI6Q 4ZUIA 3C46A 3RZDH 1EZ8A 2R93H 4FXDA 3O13A 5K36H 1PZID 3H6MA 1TWAH 3N6RA 4DNRB 3NELA 2KHIA 3UE1A 3A8JE 3HRZC 2QEJC 2I0QA 5F2DA 3NTHA 3D8GA 2K50A 4OWTB 4P72A 1GO3E 2FMCA 1SDFA 3ICEA 4QCLA 3UE0A 1Q86C 1TWFB 2WP8J 4DV0Q 4KHZA 4GN5A 3B6YA 3T4AC 1PTOF 2F0SA 1GKHA 1Q90A 3GTPH 1YNND 3TN2A 2AQ3B 3M7GA 1YZ6A 4ULLA 2E2JB 1CKOA 3C1FA 4IFDH 1A0IA 3SEBA 3K0YA 1LT5D 2OTLA 4DR7L 1BOSA 3UDGA 4A3KB 1Y69U 1QE6A 2KUMA 1IYVA 4IFDG 1W6KA 2C5CA 1L2FA 1WVLA 1II3A 4DR3L 2WAQG 1ICWA 1LTGD 1TWFH 5GQOA 1S5ED 3DWPA 1PFNA 1AFPA 1HNWL 4EQPA 4DV0L 1BCPF 1MJEA 1STHA 1TWCB 3BZKA 3FEWX 1EFWA 3T51B 2X6LA 3TREA 3GTQB 3DLLA 3GTOB 5FO8B 2VL6A 2E2JH 4PMBA 4L8JA 1TT2A 1X9NA 4LWCA 3CKIB 5C4JB 1GUGA 3I7FA 1F9PA 1K8OA 4DAPA 5IYBH 1GVPA 4DV7L 3C2PA 1A15A 3N52A 4X62L 1TWCH 5KYIA 5IYBG 2PI2E 4A3JB 2AWNA 4RA8A 3GTQH 1EIFA 5D14A 3GTOH 3RLOA 3MFYA 4OGQC 2O5JC 4XT3B 4YHHQ 1YNJD 4PG3A 1C7YA 2RHQB 1I4PA 2J0TD 5CBEE 2NVTH 1VQDA 3PQIA 3J7AV 5C4JH 4BA2I 3STBC 2JEBI 1CKNA 4LF7L 4QIWE 3ULLA 3KLWA 4LUOA 1A2TA 5HURA 4HIMA 4JW0A 3BDOA 4ZCKA 4OONA 2PQEA 1SE3A 1YJWA 2F3WA 2L5TA 1B9MA 1KDCA 2K4KA 4PMCA 3OPOA 2ZTEA 4KY6A 3EQLC 3KBGA 3KDFB 2A6HC 1TXYA 1WOCA 2MO1A 1FL0A 5ELOA 1SNQA 4LNQA 2KCMA 2RKSA 1WTWA 2CH4W 4NP5A 4QUCA 1EUJA 4DK6C 4LF5Q 2UUCQ 3S15B 4B3RQ 1SJHD 1EY9A 4L5SA 2YU9H 3LWEA 5EPJA 1RCVD 4XYOA 3BVZA 2DGYA 2K01A 2Z8LA 2HCIA 1DM0B 3GDEA 1CI3M 2A73B 1VQNA 3ZJYC 1KQSA 2K32A 4KKSA 3CU7A 1X3FA 2F1MA 3L9AX 2CW0C 4OXPA 5IWAL 2FJ2A 1XMQL 4KHVA 1CSQA 1JMCA 1PZJD 2Q2HA 3S15H 3QR8A 3GTJB 2F4VL 5EGTA 1R9TH 4LF5L 5KGUA 1QUQA 1TY2A 1TS4A 1WTVA 2Q2TA 1ZEQX 2JA8B 1PH7A 3HEJA 1BBWA 1N33L 1RTNA 5I9OA 3Q8DA 2JSOA 1ZKOA 1O7LA 3IRBA 1AZPA 3A54A 3EJIA 5ELCA 4TVAB 5BN5A 2F0TA 3K7AB 2A69D 4DU9A 1HZBA 1SFOH 4BBRB 1B8AA 2B39A 3FP9A 4L6TB 1CZWA 2CH4A 1PRTB 3EROA 3GTJH 5GADC 2Z4IA 4JI8Q 2EOTA 4X66L 4NMZA 2JA7B 4DAYB 5ELBA 3BZCA 4RFBA 2HT1A 2JA8H 1G8ZD 2XRSD 2AWOA 1G291 2JA8G 4R9WA 4U68A 3L7ZC 2ATWA 1FNUA 1PZKD 3K7AH 1QOHA 1YHAA 1NSNS 2BE5C 1CHQD 3M85A 2WFWA 4BBRH 2OWOA 4LK1C 2ENBA 1CKMA 4LFAL 4DF7A 3K5MA 4BXXH 4ZUJA 4A76A 1VQ5A 1ML0D 1VQCA 3ULJA 4AQYQ 5CV6A 1SROA 2JA7H 4FXKC 1ASYA 4BBRG 4TRDA 5IP9H 3BS1A 1YIJA 3WWVA 3OMCA 2F0GA 1SE2A 3H09A 4IPDA 2JA7G 4A4IA 3VYSA 1L0XB 5BR8Q 3PUYA 2I5LX 4EVOA 4HIDA 2B2YA 1B70B 2E2DC 3ULPA 3EN2A 1PVOA 4DUZQ 1J5EQ 2M2LA 2D2CC 3TSSA 4B3TQ 1KDBA 1TS5A 4JOIA 3PIPA 4ILWA 4YCUA 1F9SA 2K5VA 2IX1A 4JI5L 1KC8C 1PYWD 2KJXA 2UXDL 2NVQH 1EWIA 3MXNB 2MNAA 4QIWB 2A68D 4WJ3M 3D4RA 1GUSA 2VB2X 3SK4A 5LHY1 1D5XC 1W6JA 3CCSA 4J8QA 1LO5D 3KLSA 1AE3A 4DV2Q 1IW7D 3J7AF 2IX0A 1KLGD 2Z0SA 1G2TA 2NN6I 4DPGA 2LSSA 2BH8A 3J81j 2N55A 2M9VA 3PF5A 4JI3L 3G6JB 4LFCQ 3NBHB 4DR6Q 3K81C 1EYCA 3GV3A 1GUWA 1X65A 1TVXA 1SE8A 1XNQQ 3H15A 3S24A 3OTOQ 2XWBB 5LL6X 4KV6A 3BVMA 4BS9A 1FVIA 1QZGA 1J6QA 1E3PA 1H9JA 2ICIA 1O7ZA 5CV7A 3E0EA 1XWEA 1UNSA 2WKCA 2B2TA 1FR3A 2G9HD 4HMJA 2VQEL 4KK7A 1YHQA 2A1AA 2MQHA 3MC0B 1U4LA 3A5UA 4R8NA 4LFCL 1VQLA 4PZ7A 4HMIA 3S1RH 4A3CH 4M1UB 4P71A 1XNQL 1YHBA 2FINB 3VA7A 5C5LA 3GQBA 2LMCB 4LAAA 5DLQE 4A3CG 4AYBE 2IT1A 4OIKA 2KVMA 3W3AA 5ISRA 3M9BA 5IGDA 4GOPA 3SK8A 3IAYA 3PIO3 3V05A 3JAMc 2VY3A 1Y14B 4A3MB 3J7ZC 1YEZA 2VW9A 1GJXA 2L1BA 2TMPA 1G2SA 3A7AB 3H3VI 1GUOA 3TDQA 1S4ZA 3S14B 1Y1VB 1QNKA 3NTKA 3FRPB 4KN7C 5FLMH 1VQ6A 3KYHC 4FO2A 4OIJA 1BBXC 2B8FA 4X64Q 3J80i 1T9HA 3CHBD 4KMUC 3JAML 3FKIH 1EYAA 3FDTA 4DXGA 1ET6A 1AP0A 5JVG3 2V4DA 4C3JB 3VYUA 2F3VA 4BBSH 3OW2A 4GS3A 3FKIG 1I94Q 5JJKA 1GM5A 4IOCA 3S14H 3T56B 1Y1VH 3OMGA 5J1ZA 1P8LA 4BBSG 1DYQA 2BA1A 1Y1VG 3A0JA 2XN9C 4BY1B 4JBJA 3F2BA 4A3LH 3VR4A 3S2DH 3AFQA 2N78A 4C3JH 3HOUH 3RN5A 2F52A 2HHHL 4A3LG 1IKLA 4V190 1DJRD 3M4OB 1ZXTA 4HSPA 1ENCA 2AQ1B 4GKJQ 5ELDA 2I5HA 4R4TA 3HOUG 1TQOA 1A3TA 5C3EB 1AZQA 4DR5L 1K73C 4NXML 1FJGL 4OWWB 3RMHA 2EYMA 3KOJA 3OWEB 2ICEC 5C5MA 4JI0Q 4YY3Q 1G6PA 3ITPA 1B3AA 2SDFA 4BY1H 1CFMA 2I07B 4N9TA 4QL5A 1EY0A 5M9OA 4QB4A 1H9SA 1D7QA 3K59A 1KRTA 1EYGA 4BY1G 4I65A 5LMNL 4DFAA 1C0AA 1MGSA 4A3EB 1I4QA 1QCBD 1V43A 2K75A 4RGOS 3KJPA 3M4OH 1UWVA 3CCEA 1X56A 4Q0FA 3C3LA 2NBFA 4RAUC 4DK3C 2E2HB 5C3EH 3FPPA 3GTMB 3PGZA 4XT1B 2EDGA 5C4XH 3G4SA 4C3IG 1KHIA 1SMYC 3CF5A 5C3EG 4EQNA 1BUVT 3HOVG 3G6EA 2PW7A 2R7FA 1VF5C 3SK5A 2ZXOA 5C4XG 4A3DB 4IUUA 5M3FG 3U9OA 3S1NB 3NWTA 1H9SB 1WTQA 4HJ7A 4A3EH 3MXUA 1WTRA 3PUVA 4GLXA 1TWHB 1EYDA 2B2UA 1KXLA 4F7XA 4I7AA 4B3SQ 2E2HH 4B3ML 3UDXA 3GTMH 1SNMA 4A3EG 4CDCC 1AE2A 2NTTA 4MHEA 3HOXH 4C1NK 1VQMA 5IGFA 1XMOL 1N9WA 1SYEA 3ERSX 1NR4A 4O42A 2H4OA 1BCPD 5DEHA 4A3DH 4B9WA 3HKZG 3S1NH 3HOXG 2E5LQ 3MEHA 4AYBB 1GUNA 1LLRD 3MVVA 4L5QA 4L5TA 1TWHH 1PHJA 4A3DG 1RDPD 2PO4A 2RBMA 2KEEA 1E24A 2Q2IA 3UI2A 1HFNA 1FGBD 1KNEA 5AFWA 4X65L 5I2YA 4LF6Q 5JJLA 4KY7A 3JAME 5CGKA 1EU3A 4DV4Q 1KTKA 2OXPA 3PSIA 3E9IA 4O1NA 1BXTA 1SNCA 1Y1WG 1YJNA 5JEAJ 1NNXA 4K5XA 3KLSX 5GROA 1I6VC 3F2CA 1JB3A 3CXCA 3Q24A 1LTID 2D5DA 3K5OA 3Q22A 3D3RA 4GKKL 1M90C 4LUVA 3K57A 3VR3A 4ZLTF 3GD7A 2MHVA 1WTOA 2K1BA 3K58A 1HNZQ 4X6AH 3CMAA 1LTAD 1JQYD 2NN6H 1IKMA 3NPPA 2E76C 1CA6A 3D0FA 2JN4A 5C0XG 2UUAQ 5E4XA 1I3QB 2NN6G 5CV4A 1E7ZA 3NK9A 2DNCA 1IYJB 4N9PA 3SXHA 3CMEA 1EIGA 3G7LA 4UP8A 1RHPA 4KTAA 5C44G 2E2IB 2VNUD 1H9KA 4OEMB 1VDZA 3ONAB 4K5VA 1F2ZA 3CCQA 3QO2A 2YTVA 2Q2UA 1F2YA 2KCCA 4LF9Q 1LABA 4OX9Q 4MNOA 5FJ8H 1UEBA 1I3QH 5TSSA 2R93G 4IPCA 2DJGC 3DEOA 4KY5A 3HKSA 5D3IB 3AU7A 5I2XA 3PIP3 3QWNA 3J7A5 2K05A 2UXCL 5K36G 4IN3A 3NEMA 4Y7NB 2F0QA 4OO1I 3BZDB 3S16B 2X6GA 2B2TC 1EFID 2E2IH 1W3SA 4LF4Q 5HGTA 1N34L 4JBMA 2F0JA 4RWSC 2Q8IB 4JI6L 1VMPA 1LYLA 1RD9D 2VXWA 3A5ZB 4JC0A 4J15A 5EKIA 1K3BC 2ZJPA 2L0CA 4OX9L 4FXGC 3K5NA 1PMRA 2GN5A 2D62A 1VQHA 1MSHA 4Y7NH 1ILPA 1CUKA 3H3VH 3TZUA 3F8TA 4GOPC 1Z9FA 3QOLA 4QY7A 4IUPA 3TP7A 3HZXA 1IYUA 2L11A 1XYIA 1ENAA 3ND9A 1JT8A 3NWSA 2F0DA 3J81i 1Q12A 3SDZA 2CHBD 3A7LA 4DAMA 1IBKQ 5IP7H 5C4HA 3H94A 5EBCA 1DOMA 3W2DA 5KRUA 2MUYA 1K83B 2DY8A 4MTKA 3HFZB 4A3KH 1UUPA 3X3MA 1B4OA 5IP7G 2R7DA 4TQUS 3STBD 5KIXA 4G7OC 2B29A 4OWXB 2B2VC 2SNMA 1QVGA 4DKAC 1YVCA 1EQTA 4A3KG 1A63A 4K2LA 4JV5Q 2VB3X 3HOWB 5A2QL 3Q6SA 3KDFA 5J39A 4DK0A 1EQRA 2EY2A 2F0MA 2AUJD 2N3SA 4NXNQ 1S40A 2A6HD 1BDOA 2EQSA 1KAWA 1PH9A 1K83H 2PMZB 3R2TA 2K28A 1EWHA 3JC66 1CZGA 4IUNA 1SLJA 3T1YQ 4DA2A 3NQTA 1NJIC 4DV1Q 5IYDH 3G48A 4DR4Q 2Q8TA 2NVYB 2G5DA 2MJ8A 5E7NA 3VYTA 5IYDG 4A3JH 2BCOA 1X55A 4JI2Q 3H91A 1SR3A 5IY0A 2KCNA 1SRUA 4A3JG 2CW0D 4NXNL 1IBMQ 4YHHL 1EL0A 2ZM6Q 1A3VA 1JJGA 4NB3A 5G3LD 2NUCA 1CM9A 1E0BA 4FDBA 3W1BA 2IL8A 5J22A 1IBLQ 3S1MB 3T53B 5D3DA 2MO0A 1WD1A 1D2BA 1G91A 2NVYH 1ESRA 5LMUQ 1GUTA 5IE8A 5CR3A 3DWQA 3M3YB 3WOFA 4QF4A 2VQFQ 1QVCA 4TSSA 1HRJA 2K52A 1A3UA 4RGNA 1PYSB 4A3GB 4A3FB 4DAYA 1S5BD 1IBML 3KF8B 4DK1A 2UUCL 4B3RL 2BA0A 1PYBA 1L1OB 4N8FA 2F0VA 2VUMB 1SYFA 2ZJRA 4CJ2C 1JJ2A 1HZ9A 3CCUA 2UUBQ 2UXBQ 4RHRA 2J4XA 3P75A 3KF6B 4H13C 4NDXA 5JPMC 1XPRA 4FF3A 2B2UC 4KD3A 1TS2A 2KOLA 4P73A 4XXEA 3I90A 1N36Q 4JBWA 2PPBC 3TQYA 5T1GA 2VS1A 1CHPD 1P16A 2BE5D 4ZYSA 1SE4A 1LACA 4A3GH 4A3FH 1KD1C 5C3WA 2CVRA 4IPHA 1NY4A 4A3FG 2VUMH 3AYHB 2Y0SE 5FLXc 1V9PA 1VQJA 3J7YW 4IALA 3D31A 1TR5A 1WJJA 1JE5A 1XPOA 1W2BA 4GN4B 2UUBL 2VUMG 5L37A 1DONA 4DGZA 3J80c 1X54A 1O80A 2I5MX 2E8GA 3R3OA 3CW2C 2PI2A 5JOBA 4JI8L 2EYPA 4YWMA 2UU9Q 4BXXG 4JYAQ 4LFBQ 3D6WA 5A2QE 5FLXL 4G4KA 3K7UC 5IP9G 5JPNC 3MXNA 4RG1A 1Y8NB 4LJZC 1KABA 2F0NA 4K2KA 1HCZA 4R4CA 5LL6S 3J80L 2OQ0A 4WJWA 1HFGA 1CK1A 1STAA 4GLVB 2RSNA 4OL7A 4Q5VA 4HCSA 4AQYL 3S2HB 1QNUA 1PTOB 1RF2D 4DV3Q 4EQOA 2OF1A 1S72A 4HJ5A 4JYAL 3NBHA 5KYLA 1HTPA 4LW1A 1LM0A 5BR8L 3M7NA 2CFMA 2WB1E 3UDIA 3RLNA 5GAGC 2B3GA 4DXFA 3A55A 2F03A 4JI4Q 2LKVA 2QEXA 3Q0AA 4DUZL 1Q8IA 5ELEA 1J5EL 3F1ZA 2EYHA 1U4MA 1XJVA 4B3TL 1FD7D 1CQFA 1NBWA 1PTOH 1BCPB 2PYKA 3MXPA 3H3VC 5G3LF 2PNRC 3LX0A 4TKOB 4B08A 3K6OA 2BOSA 2KA7A 4WRDA 2ZJQA 4ABNA 1HHVA 3PCOB 3U58A 2JXMB 2D0PA 1K9MC 1WCMB 1NR2A 3TMEA 2DN8A 3HOZB 3DXJC 4FYDA 3I70A 1IL2A 1F2MA 2WACA 1UAPA 4JPBW 3DHQA 1HXYD 1K28A 2L12A 3SGIA 4DV2L 4X3KA 4DV6Q 3NBIA 3E5SA 1HPCA 4P2CB 3P20A 1VQAA 1ZYRC 5H1SE 1EY4A 1HUNA 3TZDA 1ICFB 2IPKD 2P5ZX 3P7JA 1WCMH 1QJOA 3HOZH 1D5MC 4DR6L 2OT2A 1HR0Q 4YIJA 2CCZA 2XTIA 3OTOL 3MAQA 2R7ZB 2F0HA 3HOZG 1VQEA 2EY5A 4MTNA 1CTMA 3NE5B 2C35B 2KHJA 1Q3LA 1SYBA 1ILQA 1A8VA 2QF7A 1UE1A 3I4NB 4CGYB 1I4RA 4HCEA 2KQ3A 2B63B 1VQ9A 1YBYA 1K3RA 1NAPA 1U4RA 2Y0SB 4K14A 1LT3D 2JP1A 1VQOA 2R7ZH 3CQZB 1S5CD 4QMGA 1HQMC 1EIHA 1FNVA 4DR2Q 3L0OA 1STYA 4GNXA 5FLXE 4JI1Q 3VA5A 3S1QB 5M5XB 2B2VA 2F0LA 5E3FA 5FLMG 1EEFD 1SXTA 3I4NH 3CRLC 4A3MH 1QB5D 3DEPA 3J80E 1X32A 1PH1A 4KHPQ 2R92B 3IFTA 2ALYB 4A3MG 2PZWA 3A8KE 3VYRA 4L5RC 2K5WA 3CQZH 1JOKA 4F88A 1KNAA 2EPBA 2AHOB 5EAYA 5EPKA 5M5XH 4HN7A 4GNXB 1S5DD 1B7YB 3CCRA 3RD4A 4X64L 2A6EC 1L0YB 3QB3A 1JE4A 1PA6A 1RL2A 4IOAA 3K80C 4PNYA 1XXGA 1F9RA 1E22A 3M4PA 2OQKA 3D6CA 3NENA 3I8ZA 1E2VA 4CHTB 1MD2D 4UDUC 3S9WA 4UY8C 5KNDA 2H1EA 4C3JG 1I94L 5K5PA 4JCVE 3LWUA 4NPSA 2PCFB 2FHTA 3PMFA 5FOBB 1UE5A 1HTLD 4DR1Q 2DUDA 4A3IB 2ZXPA 4P74A 2WB1B 4LUZA 2O5IC 3VR6A 1SMYD 4F87A 4BA1I 3PV0A 3CRKC 3AB9A 2RSOA 1Q8KA 2AQ2B 4XTCS 1K8GA 3DMUA 1VQIA 2LS01 3HS0C 3U9SA 2E74C 1TS3A 2F0EA 2N88A 4DV5Q 3NXWA 2K03A 4GKJL 4KKUA 2V1CC 2WKDA 3HOYB 1PRTC 1EOVA 3HGBA 4A3IH 2YYZA 1S5FD 1NMFA 3OOCA 4K0KQ 3VDYA 4JI0L 2KCTA 3SK6A 4YY3L 2WINB 3QJYA 3CCJA 2WAQE 1LTBD 3MEFA 3TP8A 3W1GA 4NW2A 4QQBX 5NUCA 5BN3A 1MSGA 4N8X1 3AEVA 3NUCA 5C3XA 2MP1A 1JC7A 3HOYH 4DV5L 4KJNA 2JA6B 3EVQA 3RN2A 5JEAH 1CQVA 2KBNA 5JAVA 3J81c 4ODGA 1EWCA 3RZOB 3K8AA 4PV1C 5IGGA 1JWUD 4G7ZC 4XQJA 2LFNA 1STGA 1Q46A 4F8MA 1WTXA 1N32Q 1MJCA 2ASBA 3SE0A 1PFSA 1SNDA 3H0GB 4WFN3 1AEXA 4G57A 4V0BA 3TEHB 4XQNA 1IZ6A 2EIFA 4B3SL 1G51A 4HSVA 2JA6H 2ZT9C 2Q8RE 1PTOC 3M4QA 3I4MB 2F3IA 3S17B 2L55A 3EBEA 2RCNA 3J81L 5IIFA 4ALPA 1VCIA 1SNPA 2YTYA 1U4PA 2JA6G 4MIUA 4FF2A 3HP3A 5JJZA 1LTLA 1O7YA 1JWMD 4PQXA 3T13A 1JOOA 2EE1A 2RCFA 4CJ1B 2E5LL 5T1IA 3H0GH 2EY1A 1XX8A 3SHLA 3BDLA 1Q1EA 4AYBG 4FVMA 5DM63 1CA5A 1HNXQ 2BDOA 1WTHA 4H02A 1Y8OB 3I4MH 1PH5A 4HIOA 4J1MA 2RDGA 1I4GA 5M5YB 2NTSA 1QVFA 3BJUA 4RCNA 1Q1BA 4IUQA 1I50B 4I7ZC 4C3HB 4LF6L 3X3NA 4U673 1S3OA 1HR0W 5CV5A 2HIXA 4DV4L 2YTXA 2NB0A 3OW7A 2R3ZA 5I6YA 1VF7A 4HJ8A 3URYA 2DJFC 4GN3B 4POFA 4FP5D 1KRSA 3KFUA 5KEEA 2PNHA 3F2DA 1LT6D 3RR5A 3T1HQ 1X3PA 4ME3A 3RNUA 1PRTF 1H9MA 3T16A 4HAEA 3E3XA 1I50H 4C3HH 1PH8A 1B3QA 4ME5A 4DNIA 3NP8A 5GAEC 2EXZA 4ZRZA 2R61A 3CCVA 5CMDA 1M8AA 1HNZL 2Z9HA 4UAIA 4EGVA 2RHSB 2OCEA 4IQZA 1SBBB 1TWAB 1NUCA 2B8GA 2EVBA 4LF8Q 3W5OA 3PUWA 1GXDC 2UUAL 2K5DA 5M3MB 1OXTA 5FJ8G 2NZOA 5J3BA 1STEA 5E4WC 1OTCA 3E9HA 3ZYYX 1BKBA 1OO9B 1LUZA 1NTGA 3GTPB 1PXUA 1GHKA 1QWYA 5DAUA 2EYLA 1GOZA 4AIMA 4DR7Q 1B44D 5C0XJ 4Y52H 1DXMA 4R4OA 1D5ZC 2SNSA 2WAQB 3NSWA 1VQ4A 1EOTA 3KBXA 4LF9L 4LF8L 2LXJA 3QIAA 3CC4A 2Z6KA 4DR3Q 3L2PA 5I9PA 3I91A 5M3MH 5D65A 4UP9A 2K5HA 1EQQA 1HNWQ 1KLUD 3S16H 3KLRA 2K6AA 1B53A 4M8AA 2F0WA 5M3MG 1VQ8A 2Z1CA 4EQ5A 1C8CA 2F0IA 1E1OA 2F0KA 4LF4L 3G71A 4A93B 1KL9A 2OEOA 2DNEA 4UHVA 3U50C 3V96A 1PDQA 3QOJA 5LMNW 1WTPA 1OXVA 3I3CA 3J81E 2RA4A 4QJFA 4QUFA 4POGA 1K0RA 1VQPA 4DV7Q 3BVGA 4X62Q 2EJFC 4GNXC 1Q82C 1VS0A 2DY7A 2MGSA 5EKLA 1MHWC 5DM73 3K0XA 3PF4A 1YNNC 3MZ5A 1E1TA 4A93H 1JWSD 1JICA 1SAPA 2AUKA 3NTIA 4OELB 3GTGB 2K04A 2NVTB 1VMCA 3VR5A 4LF7Q 5HGQA 4A93G 1RKNA 2NVXB 1B2TA 1IBKL 4WORA 2JJQA 2B2WA 1DOKA 2EJGC 4OHJA 4IFDJ 1D1KA 3EIVA 1PFBA 2F4IA 2ZXRA 5EJWA 3HOWH 3CAMA 3OSOA 2WV6D 4JV5L 3BU2A 4XIGS 3GTGH 3HOWG 1BR9A 1SMXA 3I55A 1KIXA 2NVXH 3NQIA 2JA9A 1AH9A 2YU9B 3KF8A 3TS2A 1MBYA 1HA6A 1U9RA 3A74A 1R4PB 4XQQA 1L1OA 1EU4A 4CDDC 1EY8A 5CC4A 3T1YL 2XVSA 5ELNA 4DV1L 1JR0D 4DR4L 3TBIB 2IHFA 3KF6A 2FFKB 4RMFA 5IWAQ 2NYZD 4KD4A 1XMQQ 1YNJC 2E75C 4KJOA 1MIUA 1TU2B 2F0PA 3NHHA 3R93A 1SYCA 2F4VQ 3OHXC 4JI2L 2IJ0A 4HEDA 5C6AA 2QW7A 4RGTA 5IGEA 1R9TB 2XNAC 1EY5A 1A2UA 2MPMA 1CKNB 3M4YA 2C9OA 2ZM6L 1CSPA 2N8NA 1N33Q 3I4OA 3S1MH 1F2LA 5DNFA 1IBLL 4YWLA 5I6WA 3M3YH 5LMUL 4XDXA 3IKJA 1SFOB 4UPAA 4X66Q 4R1JA 3PUXA 2VQFL 4IO9A 4H44C 4BWGB 3EA6A 1C4QA 3GTLB 1I6HB 3PO2B 4ZQ3A 4C2MB 4K5WA 3CP0A 3U4VA 1Z6HA 3F2UA 3GO5A 3I56A 3MFGA 1YI2A 1X3QA 4A3GG 3PO3B 2I46A 2EYJA 2HDLA 1X3EA 2D9UA 2GA4B 2FXQA 2EZVA 4PZ6A 1RIPA 4LFAQ 1AN8A 2HIVA 2UXBL 3CCLA 5I4DA 4ZKBB 1BBUA 3AMUA 3SVMA 2K5NA 1N36L 4J6HA 2JYOA 2XSCA 3GTLH 1I6HH 3PO2H 2L9HA 2RQXA 4C2MH 2VZAA 1QUQB 2NZHA 1LTRD 2HCCA 3PO2G 3PO3H 1HA5A 1M4VA 2SEBD 5CYUA 5EPLA 2A69C 1ET9A 2F0OA 2TSSA 3VR2A 3PO3G 2RVLA 3P1HA 2K7VA 1E2ZA 1FYCA 1V1PA 2A8VA 1EEID 1LTTD 1Q7YC 4ZKCB 3V2TA 1ONLA 4APVA 1HZAA 4YWKA 4JI5Q 3KJOA 3BYTB 2QKIC 4ZK9B 1PFMA 3BDCA 1PH2A 2JK8A 2UXDQ 3TP5A 1GHJA 1IXRA 5EKKA 3IL8A 1LTSD 2UU9L 4LFBL 1T5EA 2NVQB 2M00A 3A56A 3U4ZA 3FHWA 1PV4A 1SNOA 1UE7A 3I72A 3L3OC 1DD2A 1Z47A 1O78A 1V1PB 1WFQA 4RKBA 1X6OA 2MFIA 2XRQD 3S2HH 3BYYB 3KUPA 3HG9A 4JI3Q 4S3SA 2HD3A 2A74C
chains in the Genus database with same CATH topology
5EQ0A 1QG7A 4CJ0B 1K8MA 3RUZA 1SYDA 2KEDA 2EJMA 1ZYRD 1NCVA 5IODA 4B9XA 2EYOA 3OWFA 4OO1H 1EY7A 5IGBA 4DN4M 1IL8A 4FNFA 5ELFA 5C0XI 5FK9C 1EY6A 4OO1G 1OXXK 1F9QA 2ID0A 5JVH3 1E2WA 2CQAA 4LMQD 3Q23A 4FF4A 2A68C 3GV6A 5M5WB 3S1RB 2IW3A 2X69A 1IW7C 4K8JA 2HDMA 4CKCA 4KI0A 3D4WA 1BO0A 4RGMA 2EYFA 1QILA 3PUZA 4RH6A 3GTKB 1HQRD 1LV9A 5E1FA 2L4NA 3MHBA 2O4XA 1BNZA 4HR7B 2JEAI 3ND8A 1WD0A 4X3TA 1J8IA 2NZ1D 2R6GA 2G9DA 4CBVA 2XIWA 1T5XD 3BG3A 1TKWB 3MA2B 4H0LC 4L63B 4IFDI 4JK1C 3FKIB 5KNBA 4BBSB 2A6ED 1I4HA 2SOBA 1B50A 2IWHA 5C4ZA 4X3SA 2XWJB 4XYQA 1TY0A 1V8QA 2RDFA 1F77A 2RDHA 2JE6I 4MN3A 2EY6A 2B2WC 3R8BA 4Z9CB 3FPUB 1UEAB 5IGCA 3S2DB 2KHSA 4BY7B 4C1NI 4RHSA 1EZ6A 3HOUB 1RJTA 5A35A 3WOEA 2J7ZA 1B1ZA 1D6EC 4RKLA 1BF4A 3RLFA 5IT9L 4H7BA 4G7HC 1G6ZA 2IX3A 1STNA 1PRTD 1MI2A 2A5HA 2QILA 4FF1A 2FMMA 1H9RA 5CV8A 3K5LA 1TWGB 4CKBA 2K33A 2Z4HA 1BQQT 3C1EA 3DWAA 3TP6A 5FO9B 2JA5B 5EBDA 1JOQA 4C3IB 3HOVB 1DOLA 3DM1A 5C4XB 5M3FB 3A8IE 1IHZA 3GP7A 3OIQA 2PW5A 4K8IA 1DZ1A 1SYGA 3DUZA 4DAVA 1FNWA 5KNCA 4RCOA 4HTHA 2O2LD 3HKZB 3HOXB 1LT4D 1DCZA 1PLFA 3EFXD 5CBAE 1PTOD 2WIIB 1I4XA 3E0JA 2BDNA 1RTOA 5JEAG 2HQEA 5FKAC 1KDAA 5IOCA 1AW7A 2K5QA 3MXGA 4K6LA 3MTSA 5FO7B 1D1IA 2KECA 1Y1WB 1Y8PB 3KK7A 1JORA 1C48A 4R8IA 3OIPA 1HUMA 3LNNA 4IUVA 2HUGA 1JCKB 3WDNA 4NKLA 4DNTB 4KN4C 3I73A 4GZYC 4IUTA 1B9NA 5CORA 1BCPC 3MWYW 4IZ8A 2QCPX 1OXUA 1A6XA 1Z7TA 1R4QB 1V1OA 2F0UA 2B2YC 1XTCD 4ID6A 2NWGA 4ZAIA 5IT9E 4A3BB 2F0FA 2LY7A 3QG1A 1J9OA 1STBA 5C44B 1ESFA 1TIID 3FMCA 3I4LA 5COYA 3SR1A 4CKEA 3IFDA 1SSOA 2QDBA 3FVQA 1OXSC 3D4DA 5C0XH 4PMWA 4IURA 5BN4A 3RZDB 1CT1D 2R93B 2PZTA 4C3HG 4C56C 1KAAA 4X3UA 1EQVA 1SJED 2PZUA 1ENFA 4E6IA 3ERQA 1SEBD 1RODA 3R2IA 4K6DA 4KKTA 3E6ZX 5CV9A 4ZUIA 3C46A 1EZ8A 4FXDA 3O13A 5K36H 1PZID 3H6MA 3N6RA 4DNRB 3A8JE 3HRZC 2QEJC 5F2DA 3NTHA 3D8GA 2FMCA 1SDFA 4QCLA 1TWFB 2WP8J 4KHZA 3T4AC 1PTOF 2F0SA 1Q90A 1YNND 3TN2A 2AQ3B 3M7GA 4ULLA 2E2JB 3C1FA 4IFDH 3SEBA 3K0YA 1LT5D 1BOSA 4A3KB 1Y69U 1QE6A 2KUMA 1IYVA 4IFDG 1W6KA 2C5CA 1WVLA 1II3A 1ICWA 1LTGD 1S5ED 1PFNA 3DWPA 1AFPA 4EQPA 1BCPF 1STHA 1TWCB 3FEWX 3T51B 2X6LA 3GTQB 3GTOB 5FO8B 4PMBA 4L8JA 1TT2A 3CKIB 5C4JB 1GUGA 1F9PA 1K8OA 4DAPA 3C2PA 1A15A 3N52A 5KYIA 4A3JB 2AWNA 4RA8A 5D14A 3MFYA 4OGQC 2O5JC 4XT3B 1YNJD 1I4PA 2J0TD 5CBEE 3J7AV 4BA2I 2JEBI 1A2TA 5HURA 3BDOA 2PQEA 1SE3A 2F3WA 2L5TA 1B9MA 1KDCA 4PMCA 3OPOA 4KY6A 3EQLC 3KBGA 2A6HC 1SNQA 2RKSA 1WTWA 4NP5A 4QUCA 3S15B 1SJHD 1EY9A 3LWEA 5EPJA 1RCVD 4XYOA 3BVZA 2K01A 2Z8LA 2HCIA 1DM0B 1CI3M 2A73B 2K32A 4KKSA 3CU7A 2F1MA 3L9AX 2CW0C 2FJ2A 4KHVA 1PZJD 3GTJB 5EGTA 5KGUA 1TY2A 1TS4A 1WTVA 1ZEQX 2JA8B 3HEJA 1RTNA 5I9OA 2JSOA 1ZKOA 1O7LA 1AZPA 3A54A 3EJIA 5ELCA 5BN5A 2F0TA 3K7AB 2A69D 4DU9A 4BBRB 2B39A 4L6TB 1CZWA 3EROA 1PRTB 2Z4IA 2EOTA 4NMZA 2JA7B 5ELBA 4RFBA 1G8ZD 2XRSD 2AWOA 1G291 4U68A 4R9WA 3L7ZC 1FNUA 1PZKD 1QOHA 1NSNS 2BE5C 1CHQD 3M85A 4LK1C 2ENBA 4DF7A 3K5MA 4ZUJA 1ML0D 5CV6A 4FXKC 4TRDA 3BS1A 3OMCA 2F0GA 1SE2A 3H09A 3VYSA 1L0XB 3PUYA 4EVOA 2B2YA 2E2DC 2M2LA 2D2CC 3TSSA 1KDBA 1TS5A 4ILWA 1F9SA 2IX1A 1PYWD 2KJXA 4QIWB 2A68D 3D4RA 1GUSA 2VB2X 3SK4A 5LHY1 1D5XC 1W6JA 4J8QA 1LO5D 3KLSA 1IW7D 3J7AF 2IX0A 1KLGD 1G2TA 2NN6I 2N55A 2M9VA 3G6JB 1EYCA 3GV3A 1GUWA 1TVXA 2XWBB 5LL6X 4KV6A 3BVMA 4BS9A 1H9JA 2ICIA 1O7ZA 5CV7A 1XWEA 1UNSA 2WKCA 2B2TA 1FR3A 2G9HD 4HMJA 4KK7A 3MC0B 1U4LA 4R8NA 4HMIA 4M1UB 2FINB 3VA7A 5C5LA 3GQBA 2LMCB 4LAAA 2IT1A 4OIKA 2KVMA 3W3AA 5ISRA 5IGDA 3SK8A 3IAYA 3PIO3 3V05A 4A3MB 1GJXA 2L1BA 2TMPA 1G2SA 3A7AB 1GUOA 3TDQA 1S4ZA 3S14B 1Y1VB 1QNKA 3NTKA 3FRPB 4KN7C 4FO2A 4OIJA 1BBXC 2B8FA 3CHBD 4KMUC 3JAML 4DXGA 1EYAA 3FDTA 1ET6A 1AP0A 5JVG3 2V4DA 4C3JB 3VYUA 2F3VA 3T56B 3OMGA 5J1ZA 1DYQA 2BA1A 2XN9C 4BY1B 3VR4A 1IKLA 4V190 1DJRD 3M4OB 1ZXTA 4HSPA 1ENCA 2AQ1B 5ELDA 1TQOA 1A3TA 5C3EB 1AZQA 3RMHA 2EYMA 3OWEB 2ICEC 5C5MA 3ITPA 1B3AA 2SDFA 1CFMA 2I07B 4N9TA 1EY0A 5M9OA 4QB4A 1H9SA 3K59A 4I65A 4DFAA 1MGSA 4A3EB 1I4QA 1QCBD 1V43A 4RGOS 4Q0FA 3C3LA 2NBFA 4RAUC 2E2HB 3GTMB 3FPPA 4XT1B 2EDGA 4C3IG 1SMYC 4EQNA 1BUVT 2PW7A 1VF5C 3SK5A 2ZXOA 4A3DB 4IUUA 3U9OA 3S1NB 3NWTA 1H9SB 1WTQA 3MXUA 1WTRA 3PUVA 1TWHB 1EYDA 2B2UA 4F7XA 1SNMA 2NTTA 4MHEA 4C1NK 5IGFA 1SYEA 1NR4A 4O42A 2H4OA 1BCPD 5DEHA 4B9WA 3MEHA 4AYBB 1GUNA 1LLRD 3MVVA 1RDPD 2PO4A 2RBMA 2KEEA 3UI2A 1HFNA 1FGBD 1KNEA 5AFWA 5I2YA 4KY7A 3JAME 5CGKA 1EU3A 1KTKA 2OXPA 4O1NA 1BXTA 1SNCA 5JEAJ 4K5XA 3KLSX 1I6VC 1JB3A 3Q24A 1LTID 2D5DA 3K5OA 3Q22A 3D3RA 3K57A 3VR3A 4ZLTF 3GD7A 2MHVA 1WTOA 2K1BA 3K58A 1LTAD 1JQYD 2NN6H 1IKMA 3NPPA 2E76C 1CA6A 5C0XG 5E4XA 1I3QB 2NN6G 5CV4A 3NK9A 2DNCA 4N9PA 3SXHA 1EIGA 3G7LA 1RHPA 4KTAA 2E2IB 2VNUD 1H9KA 1VDZA 3ONAB 4K5VA 1F2ZA 3QO2A 1F2YA 2KCCA 1LABA 5TSSA 3DEOA 4KY5A 5D3IB 5I2XA 3AU7A 3PIP3 3QWNA 2K05A 5K36G 4IN3A 4Y7NB 2F0QA 4OO1I 3BZDB 3S16B 2X6GA 2B2TC 1EFID 5HGTA 2F0JA 4RWSC 2Q8IB 1VMPA 1RD9D 2VXWA 5EKIA 2L0CA 4FXGC 3K5NA 1PMRA 2D62A 1MSHA 1ILPA 3TZUA 3QOLA 4IUPA 3TP7A 3HZXA 1IYUA 2L11A 1XYIA 1ENAA 3ND9A 3NWSA 2F0DA 1Q12A 3SDZA 2CHBD 3A7LA 5C4HA 3H94A 5EBCA 1DOMA 5KRUA 3W2DA 2MUYA 1K83B 2DY8A 1UUPA 3X3MA 1B4OA 4TQUS 5KIXA 4G7OC 2B2VC 2SNMA 1EQTA 4K2LA 2VB3X 3HOWB 5A2QL 3Q6SA 5J39A 4DK0A 2EY2A 2F0MA 2AUJD 2A6HD 1BDOA 2PMZB 3R2TA 2K28A 1EWHA 1CZGA 4IUNA 4DA2A 3NQTA 2Q8TA 2NVYB 2MJ8A 3VYTA 2BCOA 3H91A 2KCNA 2CW0D 1EL0A 1A3VA 5G3LD 2NUCA 1CM9A 1E0BA 2IL8A 5J22A 3S1MB 3T53B 5D3DA 1WD1A 1D2BA 1G91A 1ESRA 1GUTA 5CR3A 3DWQA 3M3YB 3WOFA 4QF4A 4TSSA 1HRJA 1A3UA 4RGNA 4A3GB 4A3FB 4DAYA 1S5BD 4DK1A 2BA0A 2F0VA 2VUMB 1SYFA 4CJ2C 4RHRA 2J4XA 3P75A 4H13C 4NDXA 5JPMC 4FF3A 2B2UC 4KD3A 1TS2A 2KOLA 4XXEA 3I90A 4JBWA 2PPBC 5T1GA 1CHPD 2BE5D 4ZYSA 1SE4A 1LACA 5C3WA 2CVRA 3J7YW 4IALA 3D31A 1TR5A 1DONA 4DGZA 1O80A 3R3OA 5JOBA 2EYPA 3D6WA 5A2QE 5FLXL 4G4KA 5JPNC 3MXNA 1Y8NB 4LJZC 1KABA 2F0NA 4K2KA 1HCZA 5LL6S 3J80L 4WJWA 1HFGA 1CK1A 1STAA 2RSNA 4OL7A 4Q5VA 4HCSA 3S2HB 1QNUA 1PTOB 1RF2D 4EQOA 2OF1A 3NBHA 5KYLA 1HTPA 3M7NA 4DXFA 3A55A 2F03A 2LKVA 3Q0AA 1Q8IA 5ELEA 2EYHA 1U4MA 1FD7D 1CQFA 1PTOH 1BCPB 2PYKA 3MXPA 3H3VC 5G3LF 2PNRC 3LX0A 4TKOB 4B08A 4WRDA 2BOSA 2KA7A 3K6OA 1HHVA 4ABNA 2JXMB 1WCMB 1NR2A 3TMEA 2DN8A 3HOZB 3DXJC 4FYDA 3I70A 1F2MA 2WACA 1UAPA 3DHQA 1HXYD 2L12A 4X3KA 3NBIA 3E5SA 1HPCA 4P2CB 3P20A 1ZYRC 1EY4A 1HUNA 3TZDA 2IPKD 3P7JA 1QJOA 1D5MC 2OT2A 4YIJA 3MAQA 2R7ZB 2F0HA 2EY5A 1CTMA 3NE5B 1Q3LA 1SYBA 1ILQA 2QF7A 3I4NB 4CGYB 1I4RA 4HCEA 2KQ3A 2B63B 1NAPA 1U4RA 2Y0SB 4K14A 1LT3D 2JP1A 3CQZB 1S5CD 4QMGA 1HQMC 1EIHA 1FNVA 1STYA 5FLXE 3VA5A 3S1QB 5M5XB 2B2VA 2F0LA 5E3FA 1EEFD 1SXTA 3CRLC 1QB5D 3DEPA 3J80E 1X32A 2R92B 3IFTA 2PZWA 3A8KE 3VYRA 2K5WA 1JOKA 4F88A 1KNAA 2EPBA 5EPKA 4HN7A 1S5DD 3RD4A 2A6EC 1L0YB 1JE4A 3QB3A 4PNYA 1XXGA 1F9RA 3D6CA 3I8ZA 1E2VA 4CHTB 1MD2D 4UDUC 3S9WA 5KNDA 2H1EA 4C3JG 5K5PA 3LWUA 2PCFB 2FHTA 3PMFA 5FOBB 4A3IB 1HTLD 2ZXPA 2WB1B 2O5IC 3VR6A 1SMYD 4F87A 4BA1I 3PV0A 3CRKC 3AB9A 2RSOA 2AQ2B 4XTCS 3DMUA 2LS01 3HS0C 3U9SA 2E74C 1TS3A 2F0EA 2N88A 3NXWA 2K03A 4KKUA 2WKDA 3HOYB 1PRTC 3HGBA 2YYZA 1S5FD 3OOCA 3SK6A 2WINB 3QJYA 1LTBD 3TP8A 4NW2A 5NUCA 5BN3A 1MSGA 3NUCA 5C3XA 2MP1A 1JC7A 4KJNA 2JA6B 3EVQA 5JEAH 1CQVA 5JAVA 4ODGA 1EWCA 3RZOB 4PV1C 5IGGA 1JWUD 4G7ZC 4XQJA 2LFNA 1STGA 4F8MA 1WTXA 3SE0A 1SNDA 3H0GB 4WFN3 1AEXA 4G57A 4V0BA 4XQNA 4HSVA 2ZT9C 2Q8RE 1PTOC 3I4MB 3S17B 2L55A 3J81L 5IIFA 1VCIA 1SNPA 1U4PA 4MIUA 4FF2A 3HP3A 5JJZA 1O7YA 1JWMD 4PQXA 3T13A 1JOOA 2EE1A 4CJ1B 5T1IA 2EY1A 1XX8A 3SHLA 3BDLA 1Q1EA 4FVMA 5DM63 1CA5A 2BDOA 1Y8OB 4J1MA 2RDGA 1I4GA 5M5YB 2NTSA 4RCNA 1Q1BA 4IUQA 1I50B 4I7ZC 4C3HB 3X3NA 4U673 5CV5A 2NB0A 3OW7A 2R3ZA 5I6YA 1VF7A 3URYA 4FP5D 5KEEA 1LT6D 1X3PA 1PRTF 1H9MA 3T16A 4HAEA 4ME5A 3NP8A 2EXZA 4ZRZA 2R61A 5CMDA 1M8AA 4EGVA 4UAIA 4IQZA 1SBBB 1TWAB 1NUCA 2B8GA 2EVBA 3PUWA 1GXDC 2K5DA 5M3MB 1OXTA 1STEA 5E4WC 3ZYYX 1OO9B 3GTPB 1PXUA 1GHKA 1QWYA 5DAUA 2EYLA 1GOZA 1B44D 5C0XJ 1DXMA 1D5ZC 2SNSA 2WAQB 3NSWA 1EOTA 3KBXA 3QIAA 5I9PA 3I91A 5D65A 1KLUD 3KLRA 2K6AA 1B53A 4M8AA 2F0WA 2Z1CA 1C8CA 2F0IA 2F0KA 4A93B 2OEOA 2DNEA 3V96A 1PDQA 3QOJA 1WTPA 1OXVA 3I3CA 3J81E 2RA4A 4QUFA 3BVGA 2EJFC 2DY7A 2MGSA 5EKLA 5DM73 1YNNC 3MZ5A 1JWSD 1JICA 1SAPA 2AUKA 3NTIA 3GTGB 2K04A 2NVTB 1VMCA 3VR5A 1B2TA 1RKNA 2NVXB 4WORA 2B2WA 1DOKA 2EJGC 4OHJA 4IFDJ 1D1KA 1PFBA 2F4IA 2ZXRA 5EJWA 3OSOA 2WV6D 4XIGS 1BR9A 3NQIA 2YU9B 3KF8A 1MBYA 1HA6A 1U9RA 1R4PB 4XQQA 1EU4A 5CC4A 1EY8A 2XVSA 1JR0D 3TBIB 2FFKB 2NYZD 4KD4A 1YNJC 4KJOA 2E75C 1TU2B 2F0PA 3NHHA 3R93A 1SYCA 3OHXC 2IJ0A 4HEDA 5C6AA 4RGTA 5IGEA 1R9TB 2XNAC 1EY5A 1A2UA 2MPMA 3M4YA 2C9OA 1F2LA 5DNFA 5I6WA 4XDXA 3IKJA 1SFOB 3PUXA 4H44C 4BWGB 3EA6A 1C4QA 3GTLB 1I6HB 3PO2B 4ZQ3A 4C2MB 4K5WA 1Z6HA 3F2UA 3GO5A 3MFGA 1X3QA 3PO3B 2I46A 2EYJA 2HDLA 2D9UA 2GA4B 2EZVA 1AN8A 5I4DA 4ZKBB 3AMUA 3SVMA 4J6HA 2JYOA 2XSCA 2L9HA 2RQXA 1LTRD 2HCCA 1HA5A 1M4VA 2SEBD 5CYUA 5EPLA 2A69C 1ET9A 2F0OA 2TSSA 3VR2A 2RVLA 3P1HA 2K7VA 1E2ZA 1FYCA 1V1PA 1EEID 1LTTD 4ZKCB 3V2TA 1ONLA 3BYTB 2QKIC 4ZK9B 1PFMA 3BDCA 3TP5A 1GHJA 5EKKA 3IL8A 1LTSD 1T5EA 2NVQB 2M00A 3A56A 1SNOA 3I72A 3L3OC 1DD2A 1Z47A 1O78A 1V1PB 4RKBA 2XRQD 3BYYB 3KUPA 3HG9A 4S3SA 2A74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9M A;  5K36 H;  2BDO A;  1HPC A;  2DNE A;  3D31 A;  3OPO A;  3EQL C;  3PUY A;  1SMY C;  1Y8O B;  2NN6 G;  3N6R A;  3P20 A;  4DK0 A;  1K8M A;  3IKJ A;  3VR6 A;  2A6H C;  2AUJ D;  1Y8P B;  1ZYR C;  3A8J E;  1OXV A;  2DNC A;  1GJX A;  2A6H D;  2EJM A;  3PV0 A;  1VF5 C;  1BDO A;  4BA1 I;  4RCN A;  3PUX A;  1Q1B A;  4H44 C;  5A35 A;  4I7Z C;  3CRK C;  1QJO A;  1EWH A;  4OO1 H;  3AB9 A;  2EJF C;  2D2C C;  3A7A B;  1H9S B;  3MXU A;  4XTC S;  1GUO A;  3OW7 A;  4KHZ A;  3PUV A;  1H9K A;  3U9S A;  3LNN A;  2E74 C;  1VDZ A;  3RLF A;  1VF7 A;  1Z6H A;  1Q90 A;  1YNN C;  1OXX K;  1CI3 M;  4KKU A;  4KN7 C;  4G7H C;  4OO1 G;  3WDN A;  1CTM A;  2KCC A;  3NE5 B;  3HGB A;  4DNT B;  2YYZ A;  1E2W A;  2B8F A;  4DNR B;  1LAB A;  4KN4 C;  3I73 A;  2K32 A;  4KKS A;  4IFD H;  3OOC A;  4GZY C;  2F1M A;  2QF7 A;  2AUK A;  4KMU C;  1Y8N B;  1H9R A;  2A68 C;  2CW0 C;  1B9N A;  4LJZ C;  3VR5 A;  3QJY A;  1Y69 U;  2A68 D;  1HCZ A;  2V4D A;  1H9M A;  3D4R A;  1IYV A;  5K36 G;  2K33 A;  4IFD G;  1GUS A;  1OXU A;  1A6X A;  1Z7T A;  2EJG C;  1GUN A;  5BN3 A;  1IW7 C;  3T56 B;  2Q8I B;  1IW7 D;  3T53 B;  3T51 B;  2NN6 I;  1HQM C;  4KI0 A;  1GUT A;  3QG1 A;  4IQZ A;  2BA1 A;  1ZKO A;  2B8G A;  4L8J A;  2EVB A;  1O7L A;  3PUZ A;  5JEA H;  3A8I E;  2A69 C;  1HTP A;  3PUW A;  3M7N A;  5BN5 A;  3VR2 A;  4XIG S;  3VR4 A;  1PMR A;  3FMC A;  2A69 D;  3CRL C;  3I4L A;  2K7V A;  1E2Z A;  4PV1 C;  1GUG A;  2D62 A;  4G7Z C;  1OXT A;  1FYC A;  1K8O A;  4HR7 B;  2JEA I;  3ND8 A;  4OGQ C;  1OXS C;  3TZU A;  3IFT A;  5C0X H;  4DK1 A;  1ONL A;  5BN4 A;  2BA0 A;  3SE0 A;  3A8K E;  2R6G A;  1H9J A;  1IYU A;  4TKO B;  3ND9 A;  1I6V C;  5KNC A;  1GHK A;  1GHJ A;  1Q12 A;  2AWO A;  3BG3 A;  3SDZ A;  2D5D A;  2PNR C;  1DXM A;  1FR3 A;  1G29 1;  1T5E A;  1TKW B;  2ZT9 C;  3A7L A;  3L7Z C;  1YNJ C;  2KA7 A;  2E75 C;  4H0L C;  4H13 C;  1DCZ A;  1CFM A;  1TU2 B;  4JK1 C;  3H94 A;  2A6E C;  3QIA A;  2JXM B;  1VCI A;  2BE5 C;  3VR3 A;  4JBW A;  5KNB A;  3M85 A;  4BA2 I;  2A6E D;  4LK1 C;  1H9S A;  3GD7 A;  2PPB C;  2DN8 A;  2JEB I;  2BE5 D;  3DXJ C;  3I72 A;  1DD2 A;  1LAC A;  4TQU S;  5JEA G;  2O5I C;  1E2V A;  1O78 A;  3M4Y A;  1V43 A;  4KKT A;  4G7O C;  3KLR A;  3VA7 A;  3GQB A;  2LMC B;  3BDO A;  5KND A;  1V8Q A;  2NN6 H;  2IT1 A;  2JE6 I;  3FPP A;  3LWU A;  1Q1E A;  3MFY A;  2E76 C;  2PCF B;  3W3A A;  2O5J C;  2EDG A;  5C0X G;  2L5T A; 
#chains in the Genus database with same CATH topology
 4DV3 L;  5EQ0 A;  1QG7 A;  4CJ0 B;  1K8M A;  3RUZ A;  1SYD A;  1WYD A;  2KED A;  1I5F A;  2EJM A;  4WJ4 A;  1ZYR D;  1NCV A;  5IOD A;  4B9X A;  1BVS A;  2EYO A;  3OWF A;  4OO1 H;  1EY7 A;  1YIT A;  5IGB A;  2CQO A;  3AFP A;  1IL8 A;  4FNF A;  5ELF A;  4DN4 M;  4JI4 L;  5C0X I;  5FK9 C;  1EY6 A;  1D8L A;  4OO1 G;  4O0A A;  1OXX K;  1F9Q A;  2VQE Q;  2ID0 A;  5JVH 3;  1E2W A;  2CQA A;  4LMQ D;  5AJ3 Q;  4YCW A;  3Q23 A;  2CWP A;  1K8A C;  4QGU A;  4FF4 A;  4DUY Q;  1V1Q A;  2A68 C;  2CKZ B;  3UDF A;  1YJ9 A;  3HKZ E;  3GV6 A;  5M5W B;  3S1R B;  3CC2 A;  2IW3 A;  2X69 A;  2ZTD A;  1IW7 C;  1QZH A;  4K8J A;  2XGT A;  1WCM G;  2HDM A;  2Z6K C;  4GLA C;  4CKC A;  4KI0 A;  3CCM A;  4CDE C;  3D4W A;  1VQB A;  1K0S A;  1BO0 A;  3OYY A;  4RGM A;  2EYF A;  1QIL A;  3PUZ A;  2JQO A;  4DV6 L;  5AJ3 L;  4RH6 A;  3GTK B;  1HQR D;  2GVB A;  1LV9 A;  5E1F A;  5M5W H;  2L4N A;  4DUY L;  3MHB A;  2CWA A;  2O4X A;  1BNZ A;  4HR7 B;  2JEA I;  3ND8 A;  1WD0 A;  4HIK A;  4X3T A;  4EX5 A;  2QGQ A;  1J8I A;  4IPG A;  1HR0 L;  2NZ1 D;  2R6G A;  4MZ9 A;  2G9D A;  1VQK A;  4CBV A;  2BH2 A;  2XIW A;  1H95 A;  1T5X D;  2N49 A;  3BG3 A;  1SN8 A;  1TKW B;  3MA2 B;  4H0L C;  4L63 B;  4IFD I;  2R7Z G;  4JK1 C;  1XTD A;  3FKI B;  3GTK H;  1PH3 A;  2HQL A;  5KNB A;  3CPW A;  4BBS B;  2A6E D;  1I4H A;  2GVA A;  2SOB A;  1B50 A;  2IWH A;  5C4Z A;  2QA4 A;  4X3S A;  2XWJ B;  2B63 H;  3I4N G;  4XYQ A;  5IT9 c;  1TY0 A;  1V8Q A;  2RDF A;  4KLK A;  1L0W A;  1F77 A;  2RDH A;  2JE6 I;  2RF4 A;  4MN3 A;  2EY6 A;  3AQQ A;  2B63 G;  2B2W C;  3R8B A;  4Z9C B;  1PH6 A;  3FPU B;  1UEA B;  2Y0S G;  5IGC A;  3S1Q H;  1XPU A;  4GOP B;  3S2D B;  4DR2 L;  2KHS A;  4JI1 L;  4BY7 B;  4C1N I;  4RHS A;  2HHH Q;  1EZ6 A;  3HOU B;  1RJT A;  5A35 A;  3TRZ A;  4R4I A;  1NE3 A;  3WOE A;  2J7Z A;  2R92 H;  1B1Z A;  1D6E C;  4RKL A;  4DR5 Q;  1BF4 A;  4NXM Q;  3RLF A;  4KHP L;  5IT9 L;  1FJG Q;  4H7B A;  4G7H C;  1G6Z A;  2IX3 A;  1STN A;  2R92 G;  1A62 A;  1DGS A;  1PRT D;  1MI2 A;  2A5H A;  2QIL A;  4FF1 A;  1L1O C;  2EXD A;  2FMM A;  1H9R A;  5CV8 A;  5GAH C;  3K5L A;  4BY7 H;  5LMN Q;  1TWG B;  4CKB A;  2K33 A;  2Z4H A;  1BQQ T;  3C1E A;  3DWA A;  3TP6 A;  4BY7 G;  5FO9 B;  2JA5 B;  5EBD A;  1JOQ A;  2IHE A;  1HH2 P;  4C3I B;  2IY5 B;  3HOV B;  1ASZ A;  4HJ9 A;  1DOL A;  4JBK A;  3DM1 A;  5C4X B;  5M3F B;  2KEN A;  3A8I E;  4DR1 L;  1IHZ A;  3GP7 A;  3OIQ A;  2PW5 A;  4AH6 A;  4A3I G;  1TWG H;  2K14 A;  4K8I A;  2WB1 G;  1WI5 A;  2PQA A;  1DZ1 A;  1U0L A;  4YCV A;  2JA5 H;  4B3M Q;  1SYG A;  4C3I H;  3DUZ A;  4DAV A;  1YNX A;  3HOV H;  1FNW A;  5KNC A;  4RCO A;  2LXK A;  2JA5 G;  4JVZ A;  5JJI A;  4HTH A;  1XMO Q;  2O2L D;  3TS0 A;  5M3F H;  3HKZ B;  3HOX B;  1LT4 D;  1DCZ A;  1PLF A;  3EFX D;  3I2Z A;  1NMG A;  5CBA E;  3HOY G;  1PTO D;  4IJH A;  2WII B;  1I4X A;  4K0K L;  3E0J A;  1HZC A;  2BDN A;  1RTO A;  1PH4 A;  5JEA G;  2HQE A;  5FKA C;  1KDA A;  5IOC A;  2PQA B;  1AW7 A;  2K5Q A;  2OTJ A;  3MXG A;  4K6L A;  1XNR Q;  3CD6 A;  4X65 Q;  3MTS A;  5FO7 B;  2ES2 A;  1D1I A;  2KEC A;  1Y1W B;  4A75 A;  1Y8P B;  1JJC B;  1HJP A;  3KK7 A;  4JI7 Q;  3RZO H;  1JOR A;  1C48 A;  4R8I A;  2Z6B A;  1U5K A;  3OIP A;  3CPF A;  1HUM A;  3LNN A;  5IYC H;  4IUV A;  2HUG A;  1JCK B;  1M1K C;  1N32 L;  3WDN A;  4NKL A;  3JAM i;  4GKK Q;  4DNT B;  1XNR L;  5IYC G;  4KN4 C;  2H5X A;  3I73 A;  4R4Q A;  4GZY C;  1Y1W H;  3H0G G;  3DM3 A;  4IUT A;  1B9N A;  5COR A;  1BCP C;  2QDL A;  3MWY W;  3S17 H;  4IZ8 A;  1EIY B;  4IJL A;  4UP7 A;  2QCP X;  1OXU A;  1A6X A;  1Z7T A;  2AKW B;  1R4Q B;  4JI7 L;  1FGU A;  1V1O A;  3I4M G;  2F0U A;  2B2Y C;  3CC7 A;  2PMZ E;  1XTC D;  4ID6 A;  2NWG A;  3LGJ A;  4ZAI A;  2A19 A;  5IT9 E;  1GD7 A;  2AMC B;  4A3B B;  4CDF C;  2F0F A;  2LY7 A;  3QG1 A;  1J9O A;  1STB A;  5C44 B;  1UE6 A;  4JOI C;  1ESF A;  1VQG A;  1TII D;  2D0O A;  1HNX L;  3FMC A;  1N8R C;  3I4L A;  1O7I A;  4HJA A;  1VQF A;  5COY A;  3SR1 A;  4CKE A;  3IFD A;  5M5Y H;  1Q81 C;  1SSO A;  2QDB A;  3FVQ A;  1OXS C;  3D4D A;  1JB7 A;  5C0X H;  4PMW A;  4IUR A;  5BN4 A;  3RZD B;  3ER0 A;  1CT1 D;  2ZTC A;  2R93 B;  2PZT A;  4C3H G;  4C56 C;  4A3B H;  5HY6 A;  1KAA A;  4X3U A;  1MKH A;  1EQV A;  1SJE D;  2PZU A;  1ENF A;  2L15 A;  5C44 H;  4E6I A;  4A3B G;  2UXC Q;  2YV5 A;  3ERQ A;  1SEB D;  1ROD A;  3T1H L;  1N34 Q;  4O2D A;  3R2I A;  4K6D A;  1X3G A;  1VQ7 A;  4KKT A;  3PIO A;  4PZ8 A;  3E6Z X;  4P75 A;  1C9O A;  4JG2 A;  5CV9 A;  4JI6 Q;  4ZUI A;  3C46 A;  3RZD H;  1EZ8 A;  2R93 H;  4FXD A;  3O13 A;  5K36 H;  1PZI D;  3H6M A;  1TWA H;  3N6R A;  4DNR B;  3NEL A;  2KHI A;  3UE1 A;  3A8J E;  3HRZ C;  2QEJ C;  2I0Q A;  5F2D A;  3NTH A;  3D8G A;  2K50 A;  4OWT B;  4P72 A;  1GO3 E;  2FMC A;  1SDF A;  3ICE A;  4QCL A;  3UE0 A;  1Q86 C;  1TWF B;  2WP8 J;  4DV0 Q;  4KHZ A;  4GN5 A;  3B6Y A;  3T4A C;  1PTO F;  2F0S A;  1GKH A;  1Q90 A;  3GTP H;  1YNN D;  3TN2 A;  2AQ3 B;  3M7G A;  1YZ6 A;  4ULL A;  2E2J B;  1CKO A;  3C1F A;  4IFD H;  1A0I A;  3SEB A;  3K0Y A;  1LT5 D;  2OTL A;  4DR7 L;  1BOS A;  3UDG A;  4A3K B;  1Y69 U;  1QE6 A;  2KUM A;  1IYV A;  4IFD G;  1W6K A;  2C5C A;  1L2F A;  1WVL A;  1II3 A;  4DR3 L;  2WAQ G;  1ICW A;  1LTG D;  1TWF H;  5GQO A;  1S5E D;  3DWP A;  1PFN A;  1AFP A;  1HNW L;  4EQP A;  4DV0 L;  1BCP F;  1MJE A;  1STH A;  1TWC B;  3BZK A;  3FEW X;  1EFW A;  3T51 B;  2X6L A;  3TRE A;  3GTQ B;  3DLL A;  3GTO B;  5FO8 B;  2VL6 A;  2E2J H;  4PMB A;  4L8J A;  1TT2 A;  1X9N A;  4LWC A;  3CKI B;  5C4J B;  1GUG A;  3I7F A;  1F9P A;  1K8O A;  4DAP A;  5IYB H;  1GVP A;  4DV7 L;  3C2P A;  1A15 A;  3N52 A;  4X62 L;  1TWC H;  5KYI A;  5IYB G;  2PI2 E;  4A3J B;  2AWN A;  4RA8 A;  3GTQ H;  1EIF A;  5D14 A;  3GTO H;  3RLO A;  3MFY A;  4OGQ C;  2O5J C;  4XT3 B;  4YHH Q;  1YNJ D;  4PG3 A;  1C7Y A;  2RHQ B;  1I4P A;  2J0T D;  5CBE E;  2NVT H;  1VQD A;  3PQI A;  3J7A V;  5C4J H;  4BA2 I;  3STB C;  2JEB I;  1CKN A;  4LF7 L;  4QIW E;  3ULL A;  3KLW A;  4LUO A;  1A2T A;  5HUR A;  4HIM A;  4JW0 A;  3BDO A;  4ZCK A;  4OON A;  2PQE A;  1SE3 A;  1YJW A;  2F3W A;  2L5T A;  1B9M A;  1KDC A;  2K4K A;  4PMC A;  3OPO A;  2ZTE A;  4KY6 A;  3EQL C;  3KBG A;  3KDF B;  2A6H C;  1TXY A;  1WOC A;  2MO1 A;  1FL0 A;  5ELO A;  1SNQ A;  4LNQ A;  2KCM A;  2RKS A;  1WTW A;  2CH4 W;  4NP5 A;  4QUC A;  1EUJ A;  4DK6 C;  4LF5 Q;  2UUC Q;  3S15 B;  4B3R Q;  1SJH D;  1EY9 A;  4L5S A;  2YU9 H;  3LWE A;  5EPJ A;  1RCV D;  4XYO A;  3BVZ A;  2DGY A;  2K01 A;  2Z8L A;  2HCI A;  1DM0 B;  3GDE A;  1CI3 M;  2A73 B;  1VQN A;  3ZJY C;  1KQS A;  2K32 A;  4KKS A;  3CU7 A;  1X3F A;  2F1M A;  3L9A X;  2CW0 C;  4OXP A;  5IWA L;  2FJ2 A;  1XMQ L;  4KHV A;  1CSQ A;  1JMC A;  1PZJ D;  2Q2H A;  3S15 H;  3QR8 A;  3GTJ B;  2F4V L;  5EGT A;  1R9T H;  4LF5 L;  5KGU A;  1QUQ A;  1TY2 A;  1TS4 A;  1WTV A;  2Q2T A;  1ZEQ X;  2JA8 B;  1PH7 A;  3HEJ A;  1BBW A;  1N33 L;  1RTN A;  5I9O A;  3Q8D A;  2JSO A;  1ZKO A;  1O7L A;  3IRB A;  1AZP A;  3A54 A;  3EJI A;  5ELC A;  4TVA B;  5BN5 A;  2F0T A;  3K7A B;  2A69 D;  4DU9 A;  1HZB A;  1SFO H;  4BBR B;  1B8A A;  2B39 A;  3FP9 A;  4L6T B;  1CZW A;  2CH4 A;  1PRT B;  3ERO A;  3GTJ H;  5GAD C;  2Z4I A;  4JI8 Q;  2EOT A;  4X66 L;  4NMZ A;  2JA7 B;  4DAY B;  5ELB A;  3BZC A;  4RFB A;  2HT1 A;  2JA8 H;  1G8Z D;  2XRS D;  2AWO A;  1G29 1;  2JA8 G;  4R9W A;  4U68 A;  3L7Z C;  2ATW A;  1FNU A;  1PZK D;  3K7A H;  1QOH A;  1YHA A;  1NSN S;  2BE5 C;  1CHQ D;  3M85 A;  2WFW A;  4BBR H;  2OWO A;  4LK1 C;  2ENB A;  1CKM A;  4LFA L;  4DF7 A;  3K5M A;  4BXX H;  4ZUJ A;  4A76 A;  1VQ5 A;  1ML0 D;  1VQC A;  3ULJ A;  4AQY Q;  5CV6 A;  1SRO A;  2JA7 H;  4FXK C;  1ASY A;  4BBR G;  4TRD A;  5IP9 H;  3BS1 A;  1YIJ A;  3WWV A;  3OMC A;  2F0G A;  1SE2 A;  3H09 A;  4IPD A;  2JA7 G;  4A4I A;  3VYS A;  1L0X B;  5BR8 Q;  3PUY A;  2I5L X;  4EVO A;  4HID A;  2B2Y A;  1B70 B;  2E2D C;  3ULP A;  3EN2 A;  1PVO A;  4DUZ Q;  1J5E Q;  2M2L A;  2D2C C;  3TSS A;  4B3T Q;  1KDB A;  1TS5 A;  4JOI A;  3PIP A;  4ILW A;  4YCU A;  1F9S A;  2K5V A;  2IX1 A;  4JI5 L;  1KC8 C;  1PYW D;  2KJX A;  2UXD L;  2NVQ H;  1EWI A;  3MXN B;  2MNA A;  4QIW B;  2A68 D;  4WJ3 M;  3D4R A;  1GUS A;  2VB2 X;  3SK4 A;  5LHY 1;  1D5X C;  1W6J A;  3CCS A;  4J8Q A;  1LO5 D;  3KLS A;  1AE3 A;  4DV2 Q;  1IW7 D;  3J7A F;  2IX0 A;  1KLG D;  2Z0S A;  1G2T A;  2NN6 I;  4DPG A;  2LSS A;  2BH8 A;  3J81 j;  2N55 A;  2M9V A;  3PF5 A;  4JI3 L;  3G6J B;  4LFC Q;  3NBH B;  4DR6 Q;  3K81 C;  1EYC A;  3GV3 A;  1GUW A;  1X65 A;  1TVX A;  1SE8 A;  1XNQ Q;  3H15 A;  3S24 A;  3OTO Q;  2XWB B;  5LL6 X;  4KV6 A;  3BVM A;  4BS9 A;  1FVI A;  1QZG A;  1J6Q A;  1E3P A;  1H9J A;  2ICI A;  1O7Z A;  5CV7 A;  3E0E A;  1XWE A;  1UNS A;  2WKC A;  2B2T A;  1FR3 A;  2G9H D;  4HMJ A;  2VQE L;  4KK7 A;  1YHQ A;  2A1A A;  2MQH A;  3MC0 B;  1U4L A;  3A5U A;  4R8N A;  4LFC L;  1VQL A;  4PZ7 A;  4HMI A;  3S1R H;  4A3C H;  4M1U B;  4P71 A;  1XNQ L;  1YHB A;  2FIN B;  3VA7 A;  5C5L A;  3GQB A;  2LMC B;  4LAA A;  5DLQ E;  4A3C G;  4AYB E;  2IT1 A;  4OIK A;  2KVM A;  3W3A A;  5ISR A;  3M9B A;  5IGD A;  4GOP A;  3SK8 A;  3IAY A;  3PIO 3;  3V05 A;  3JAM c;  2VY3 A;  1Y14 B;  4A3M B;  3J7Z C;  1YEZ A;  2VW9 A;  1GJX A;  2L1B A;  2TMP A;  1G2S A;  3A7A B;  3H3V I;  1GUO A;  3TDQ A;  1S4Z A;  3S14 B;  1Y1V B;  1QNK A;  3NTK A;  3FRP B;  4KN7 C;  5FLM H;  1VQ6 A;  3KYH C;  4FO2 A;  4OIJ A;  1BBX C;  2B8F A;  4X64 Q;  3J80 i;  1T9H A;  3CHB D;  4KMU C;  3JAM L;  3FKI H;  1EYA A;  3FDT A;  4DXG A;  1ET6 A;  1AP0 A;  5JVG 3;  2V4D A;  4C3J B;  3VYU A;  2F3V A;  4BBS H;  3OW2 A;  4GS3 A;  3FKI G;  1I94 Q;  5JJK A;  1GM5 A;  4IOC A;  3S14 H;  3T56 B;  1Y1V H;  3OMG A;  5J1Z A;  1P8L A;  4BBS G;  1DYQ A;  2BA1 A;  1Y1V G;  3A0J A;  2XN9 C;  4BY1 B;  4JBJ A;  3F2B A;  4A3L H;  3VR4 A;  3S2D H;  3AFQ A;  2N78 A;  4C3J H;  3HOU H;  3RN5 A;  2F52 A;  2HHH L;  4A3L G;  1IKL A;  4V19 0;  1DJR D;  3M4O B;  1ZXT A;  4HSP A;  1ENC A;  2AQ1 B;  4GKJ Q;  5ELD A;  2I5H A;  4R4T A;  3HOU G;  1TQO A;  1A3T A;  5C3E B;  1AZQ A;  4DR5 L;  1K73 C;  4NXM L;  1FJG L;  4OWW B;  3RMH A;  2EYM A;  3KOJ A;  3OWE B;  2ICE C;  5C5M A;  4JI0 Q;  4YY3 Q;  1G6P A;  3ITP A;  1B3A A;  2SDF A;  4BY1 H;  1CFM A;  2I07 B;  4N9T A;  4QL5 A;  1EY0 A;  5M9O A;  4QB4 A;  1H9S A;  1D7Q A;  3K59 A;  1KRT A;  1EYG A;  4BY1 G;  4I65 A;  5LMN L;  4DFA A;  1C0A A;  1MGS A;  4A3E B;  1I4Q A;  1QCB D;  1V43 A;  2K75 A;  4RGO S;  3KJP A;  3M4O H;  1UWV A;  3CCE A;  1X56 A;  4Q0F A;  3C3L A;  2NBF A;  4RAU C;  4DK3 C;  2E2H B;  5C3E H;  3FPP A;  3GTM B;  3PGZ A;  4XT1 B;  2EDG A;  5C4X H;  3G4S A;  4C3I G;  1KHI A;  1SMY C;  3CF5 A;  5C3E G;  4EQN A;  1BUV T;  3HOV G;  3G6E A;  2PW7 A;  2R7F A;  1VF5 C;  3SK5 A;  2ZXO A;  5C4X G;  4A3D B;  4IUU A;  5M3F G;  3U9O A;  3S1N B;  3NWT A;  1H9S B;  1WTQ A;  4HJ7 A;  4A3E H;  3MXU A;  1WTR A;  3PUV A;  4GLX A;  1TWH B;  1EYD A;  2B2U A;  1KXL A;  4F7X A;  4I7A A;  4B3S Q;  2E2H H;  4B3M L;  3UDX A;  3GTM H;  1SNM A;  4A3E G;  4CDC C;  1AE2 A;  2NTT A;  4MHE A;  3HOX H;  4C1N K;  1VQM A;  5IGF A;  1XMO L;  1N9W A;  1SYE A;  3ERS X;  1NR4 A;  4O42 A;  2H4O A;  1BCP D;  5DEH A;  4A3D H;  4B9W A;  3HKZ G;  3S1N H;  3HOX G;  2E5L Q;  3MEH A;  4AYB B;  1GUN A;  1LLR D;  3MVV A;  4L5Q A;  4L5T A;  1TWH H;  1PHJ A;  4A3D G;  1RDP D;  2PO4 A;  2RBM A;  2KEE A;  1E24 A;  2Q2I A;  3UI2 A;  1HFN A;  1FGB D;  1KNE A;  5AFW A;  4X65 L;  5I2Y A;  4LF6 Q;  5JJL A;  4KY7 A;  3JAM E;  5CGK A;  1EU3 A;  4DV4 Q;  1KTK A;  2OXP A;  3PSI A;  3E9I A;  4O1N A;  1BXT A;  1SNC A;  1Y1W G;  1YJN A;  5JEA J;  1NNX A;  4K5X A;  3KLS X;  5GRO A;  1I6V C;  3F2C A;  1JB3 A;  3CXC A;  3Q24 A;  1LTI D;  2D5D A;  3K5O A;  3Q22 A;  3D3R A;  4GKK L;  1M90 C;  4LUV A;  3K57 A;  3VR3 A;  4ZLT F;  3GD7 A;  2MHV A;  1WTO A;  2K1B A;  3K58 A;  1HNZ Q;  4X6A H;  3CMA A;  1LTA D;  1JQY D;  2NN6 H;  1IKM A;  3NPP A;  2E76 C;  1CA6 A;  3D0F A;  2JN4 A;  5C0X G;  2UUA Q;  5E4X A;  1I3Q B;  2NN6 G;  5CV4 A;  1E7Z A;  3NK9 A;  2DNC A;  1IYJ B;  4N9P A;  3SXH A;  3CME A;  1EIG A;  3G7L A;  4UP8 A;  1RHP A;  4KTA A;  5C44 G;  2E2I B;  2VNU D;  1H9K A;  4OEM B;  1VDZ A;  3ONA B;  4K5V A;  1F2Z A;  3CCQ A;  3QO2 A;  2YTV A;  2Q2U A;  1F2Y A;  2KCC A;  4LF9 Q;  1LAB A;  4OX9 Q;  4MNO A;  5FJ8 H;  1UEB A;  1I3Q H;  5TSS A;  2R93 G;  4IPC A;  2DJG C;  3DEO A;  4KY5 A;  3HKS A;  5D3I B;  3AU7 A;  5I2X A;  3PIP 3;  3QWN A;  3J7A 5;  2K05 A;  2UXC L;  5K36 G;  4IN3 A;  3NEM A;  4Y7N B;  2F0Q A;  4OO1 I;  3BZD B;  3S16 B;  2X6G A;  2B2T C;  1EFI D;  2E2I H;  1W3S A;  4LF4 Q;  5HGT A;  1N34 L;  4JBM A;  2F0J A;  4RWS C;  2Q8I B;  4JI6 L;  1VMP A;  1LYL A;  1RD9 D;  2VXW A;  3A5Z B;  4JC0 A;  4J15 A;  5EKI A;  1K3B C;  2ZJP A;  2L0C A;  4OX9 L;  4FXG C;  3K5N A;  1PMR A;  2GN5 A;  2D62 A;  1VQH A;  1MSH A;  4Y7N H;  1ILP A;  1CUK A;  3H3V H;  3TZU A;  3F8T A;  4GOP C;  1Z9F A;  3QOL A;  4QY7 A;  4IUP A;  3TP7 A;  3HZX A;  1IYU A;  2L11 A;  1XYI A;  1ENA A;  3ND9 A;  1JT8 A;  3NWS A;  2F0D A;  3J81 i;  1Q12 A;  3SDZ A;  2CHB D;  3A7L A;  4DAM A;  1IBK Q;  5IP7 H;  5C4H A;  3H94 A;  5EBC A;  1DOM A;  3W2D A;  5KRU A;  2MUY A;  1K83 B;  2DY8 A;  4MTK A;  3HFZ B;  4A3K H;  1UUP A;  3X3M A;  1B4O A;  5IP7 G;  2R7D A;  4TQU S;  3STB D;  5KIX A;  4G7O C;  2B29 A;  4OWX B;  2B2V C;  2SNM A;  1QVG A;  4DKA C;  1YVC A;  1EQT A;  4A3K G;  1A63 A;  4K2L A;  4JV5 Q;  2VB3 X;  3HOW B;  5A2Q L;  3Q6S A;  3KDF A;  5J39 A;  4DK0 A;  1EQR A;  2EY2 A;  2F0M A;  2AUJ D;  2N3S A;  4NXN Q;  1S40 A;  2A6H D;  1BDO A;  2EQS A;  1KAW A;  1PH9 A;  1K83 H;  2PMZ B;  3R2T A;  2K28 A;  1EWH A;  3JC6 6;  1CZG A;  4IUN A;  1SLJ A;  3T1Y Q;  4DA2 A;  3NQT A;  1NJI C;  4DV1 Q;  5IYD H;  3G48 A;  4DR4 Q;  2Q8T A;  2NVY B;  2G5D A;  2MJ8 A;  5E7N A;  3VYT A;  5IYD G;  4A3J H;  2BCO A;  1X55 A;  4JI2 Q;  3H91 A;  1SR3 A;  5IY0 A;  2KCN A;  1SRU A;  4A3J G;  2CW0 D;  4NXN L;  1IBM Q;  4YHH L;  1EL0 A;  2ZM6 Q;  1A3V A;  1JJG A;  4NB3 A;  5G3L D;  2NUC A;  1CM9 A;  1E0B A;  4FDB A;  3W1B A;  2IL8 A;  5J22 A;  1IBL Q;  3S1M B;  3T53 B;  5D3D A;  2MO0 A;  1WD1 A;  1D2B A;  1G91 A;  2NVY H;  1ESR A;  5LMU Q;  1GUT A;  5IE8 A;  5CR3 A;  3DWQ A;  3M3Y B;  3WOF A;  4QF4 A;  2VQF Q;  1QVC A;  4TSS A;  1HRJ A;  2K52 A;  1A3U A;  4RGN A;  1PYS B;  4A3G B;  4A3F B;  4DAY A;  1S5B D;  1IBM L;  3KF8 B;  4DK1 A;  2UUC L;  4B3R L;  2BA0 A;  1PYB A;  1L1O B;  4N8F A;  2F0V A;  2VUM B;  1SYF A;  2ZJR A;  4CJ2 C;  1JJ2 A;  1HZ9 A;  3CCU A;  2UUB Q;  2UXB Q;  4RHR A;  2J4X A;  3P75 A;  3KF6 B;  4H13 C;  4NDX A;  5JPM C;  1XPR A;  4FF3 A;  2B2U C;  4KD3 A;  1TS2 A;  2KOL A;  4P73 A;  4XXE A;  3I90 A;  1N36 Q;  4JBW A;  2PPB C;  3TQY A;  5T1G A;  2VS1 A;  1CHP D;  1P16 A;  2BE5 D;  4ZYS A;  1SE4 A;  1LAC A;  4A3G H;  4A3F H;  1KD1 C;  5C3W A;  2CVR A;  4IPH A;  1NY4 A;  4A3F G;  2VUM H;  3AYH B;  2Y0S E;  5FLX c;  1V9P A;  1VQJ A;  3J7Y W;  4IAL A;  3D31 A;  1TR5 A;  1WJJ A;  1JE5 A;  1XPO A;  1W2B A;  4GN4 B;  2UUB L;  2VUM G;  5L37 A;  1DON A;  4DGZ A;  3J80 c;  1X54 A;  1O80 A;  2I5M X;  2E8G A;  3R3O A;  3CW2 C;  2PI2 A;  5JOB A;  4JI8 L;  2EYP A;  4YWM A;  2UU9 Q;  4BXX G;  4JYA Q;  4LFB Q;  3D6W A;  5A2Q E;  5FLX L;  4G4K A;  3K7U C;  5IP9 G;  5JPN C;  3MXN A;  4RG1 A;  1Y8N B;  4LJZ C;  1KAB A;  2F0N A;  4K2K A;  1HCZ A;  4R4C A;  5LL6 S;  3J80 L;  2OQ0 A;  4WJW A;  1HFG A;  1CK1 A;  1STA A;  4GLV B;  2RSN A;  4OL7 A;  4Q5V A;  4HCS A;  4AQY L;  3S2H B;  1QNU A;  1PTO B;  1RF2 D;  4DV3 Q;  4EQO A;  2OF1 A;  1S72 A;  4HJ5 A;  4JYA L;  3NBH A;  5KYL A;  1HTP A;  4LW1 A;  1LM0 A;  5BR8 L;  3M7N A;  2CFM A;  2WB1 E;  3UDI A;  3RLN A;  5GAG C;  2B3G A;  4DXF A;  3A55 A;  2F03 A;  4JI4 Q;  2LKV A;  2QEX A;  3Q0A A;  4DUZ L;  1Q8I A;  5ELE A;  1J5E L;  3F1Z A;  2EYH A;  1U4M A;  1XJV A;  4B3T L;  1FD7 D;  1CQF A;  1NBW A;  1PTO H;  1BCP B;  2PYK A;  3MXP A;  3H3V C;  5G3L F;  2PNR C;  3LX0 A;  4TKO B;  4B08 A;  3K6O A;  2BOS A;  2KA7 A;  4WRD A;  2ZJQ A;  4ABN A;  1HHV A;  3PCO B;  3U58 A;  2JXM B;  2D0P A;  1K9M C;  1WCM B;  1NR2 A;  3TME A;  2DN8 A;  3HOZ B;  3DXJ C;  4FYD A;  3I70 A;  1IL2 A;  1F2M A;  2WAC A;  1UAP A;  4JPB W;  3DHQ A;  1HXY D;  1K28 A;  2L12 A;  3SGI A;  4DV2 L;  4X3K A;  4DV6 Q;  3NBI A;  3E5S A;  1HPC A;  4P2C B;  3P20 A;  1VQA A;  1ZYR C;  5H1S E;  1EY4 A;  1HUN A;  3TZD A;  1ICF B;  2IPK D;  2P5Z X;  3P7J A;  1WCM H;  1QJO A;  3HOZ H;  1D5M C;  4DR6 L;  2OT2 A;  1HR0 Q;  4YIJ A;  2CCZ A;  2XTI A;  3OTO L;  3MAQ A;  2R7Z B;  2F0H A;  3HOZ G;  1VQE A;  2EY5 A;  4MTN A;  1CTM A;  3NE5 B;  2C35 B;  2KHJ A;  1Q3L A;  1SYB A;  1ILQ A;  1A8V A;  2QF7 A;  1UE1 A;  3I4N B;  4CGY B;  1I4R A;  4HCE A;  2KQ3 A;  2B63 B;  1VQ9 A;  1YBY A;  1K3R A;  1NAP A;  1U4R A;  2Y0S B;  4K14 A;  1LT3 D;  2JP1 A;  1VQO A;  2R7Z H;  3CQZ B;  1S5C D;  4QMG A;  1HQM C;  1EIH A;  1FNV A;  4DR2 Q;  3L0O A;  1STY A;  4GNX A;  5FLX E;  4JI1 Q;  3VA5 A;  3S1Q B;  5M5X B;  2B2V A;  2F0L A;  5E3F A;  5FLM G;  1EEF D;  1SXT A;  3I4N H;  3CRL C;  4A3M H;  1QB5 D;  3DEP A;  3J80 E;  1X32 A;  1PH1 A;  4KHP Q;  2R92 B;  3IFT A;  2ALY B;  4A3M G;  2PZW A;  3A8K E;  3VYR A;  4L5R C;  2K5W A;  3CQZ H;  1JOK A;  4F88 A;  1KNA A;  2EPB A;  2AHO B;  5EAY A;  5EPK A;  5M5X H;  4HN7 A;  4GNX B;  1S5D D;  1B7Y B;  3CCR A;  3RD4 A;  4X64 L;  2A6E C;  1L0Y B;  3QB3 A;  1JE4 A;  1PA6 A;  1RL2 A;  4IOA A;  3K80 C;  4PNY A;  1XXG A;  1F9R A;  1E22 A;  3M4P A;  2OQK A;  3D6C A;  3NEN A;  3I8Z A;  1E2V A;  4CHT B;  1MD2 D;  4UDU C;  3S9W A;  4UY8 C;  5KND A;  2H1E A;  4C3J G;  1I94 L;  5K5P A;  4JCV E;  3LWU A;  4NPS A;  2PCF B;  2FHT A;  3PMF A;  5FOB B;  1UE5 A;  1HTL D;  4DR1 Q;  2DUD A;  4A3I B;  2ZXP A;  4P74 A;  2WB1 B;  4LUZ A;  2O5I C;  3VR6 A;  1SMY D;  4F87 A;  4BA1 I;  3PV0 A;  3CRK C;  3AB9 A;  2RSO A;  1Q8K A;  2AQ2 B;  4XTC S;  1K8G A;  3DMU A;  1VQI A;  2LS0 1;  3HS0 C;  3U9S A;  2E74 C;  1TS3 A;  2F0E A;  2N88 A;  4DV5 Q;  3NXW A;  2K03 A;  4GKJ L;  4KKU A;  2V1C C;  2WKD A;  3HOY B;  1PRT C;  1EOV A;  3HGB A;  4A3I H;  2YYZ A;  1S5F D;  1NMF A;  3OOC A;  4K0K Q;  3VDY A;  4JI0 L;  2KCT A;  3SK6 A;  4YY3 L;  2WIN B;  3QJY A;  3CCJ A;  2WAQ E;  1LTB D;  3MEF A;  3TP8 A;  3W1G A;  4NW2 A;  4QQB X;  5NUC A;  5BN3 A;  1MSG A;  4N8X 1;  3AEV A;  3NUC A;  5C3X A;  2MP1 A;  1JC7 A;  3HOY H;  4DV5 L;  4KJN A;  2JA6 B;  3EVQ A;  3RN2 A;  5JEA H;  1CQV A;  2KBN A;  5JAV A;  3J81 c;  4ODG A;  1EWC A;  3RZO B;  3K8A A;  4PV1 C;  5IGG A;  1JWU D;  4G7Z C;  4XQJ A;  2LFN A;  1STG A;  1Q46 A;  4F8M A;  1WTX A;  1N32 Q;  1MJC A;  2ASB A;  3SE0 A;  1PFS A;  1SND A;  3H0G B;  4WFN 3;  1AEX A;  4G57 A;  4V0B A;  3TEH B;  4XQN A;  1IZ6 A;  2EIF A;  4B3S L;  1G51 A;  4HSV A;  2JA6 H;  2ZT9 C;  2Q8R E;  1PTO C;  3M4Q A;  3I4M B;  2F3I A;  3S17 B;  2L55 A;  3EBE A;  2RCN A;  3J81 L;  5IIF A;  4ALP A;  1VCI A;  1SNP A;  2YTY A;  1U4P A;  2JA6 G;  4MIU A;  4FF2 A;  3HP3 A;  5JJZ A;  1LTL A;  1O7Y A;  1JWM D;  4PQX A;  3T13 A;  1JOO A;  2EE1 A;  2RCF A;  4CJ1 B;  2E5L L;  5T1I A;  3H0G H;  2EY1 A;  1XX8 A;  3SHL A;  3BDL A;  1Q1E A;  4AYB G;  4FVM A;  5DM6 3;  1CA5 A;  1HNX Q;  2BDO A;  1WTH A;  4H02 A;  1Y8O B;  3I4M H;  1PH5 A;  4HIO A;  4J1M A;  2RDG A;  1I4G A;  5M5Y B;  2NTS A;  1QVF A;  3BJU A;  4RCN A;  1Q1B A;  4IUQ A;  1I50 B;  4I7Z C;  4C3H B;  4LF6 L;  3X3N A;  4U67 3;  1S3O A;  1HR0 W;  5CV5 A;  2HIX A;  4DV4 L;  2YTX A;  2NB0 A;  3OW7 A;  2R3Z A;  5I6Y A;  1VF7 A;  4HJ8 A;  3URY A;  2DJF C;  4GN3 B;  4POF A;  4FP5 D;  1KRS A;  3KFU A;  5KEE A;  2PNH A;  3F2D A;  1LT6 D;  3RR5 A;  3T1H Q;  1X3P A;  4ME3 A;  3RNU A;  1PRT F;  1H9M A;  3T16 A;  4HAE A;  3E3X A;  1I50 H;  4C3H H;  1PH8 A;  1B3Q A;  4ME5 A;  4DNI A;  3NP8 A;  5GAE C;  2EXZ A;  4ZRZ A;  2R61 A;  3CCV A;  5CMD A;  1M8A A;  1HNZ L;  2Z9H A;  4UAI A;  4EGV A;  2RHS B;  2OCE A;  4IQZ A;  1SBB B;  1TWA B;  1NUC A;  2B8G A;  2EVB A;  4LF8 Q;  3W5O A;  3PUW A;  1GXD C;  2UUA L;  2K5D A;  5M3M B;  1OXT A;  5FJ8 G;  2NZO A;  5J3B A;  1STE A;  5E4W C;  1OTC A;  3E9H A;  3ZYY X;  1BKB A;  1OO9 B;  1LUZ A;  1NTG A;  3GTP B;  1PXU A;  1GHK A;  1QWY A;  5DAU A;  2EYL A;  1GOZ A;  4AIM A;  4DR7 Q;  1B44 D;  5C0X J;  4Y52 H;  1DXM A;  4R4O A;  1D5Z C;  2SNS A;  2WAQ B;  3NSW A;  1VQ4 A;  1EOT A;  3KBX A;  4LF9 L;  4LF8 L;  2LXJ A;  3QIA A;  3CC4 A;  2Z6K A;  4DR3 Q;  3L2P A;  5I9P A;  3I91 A;  5M3M H;  5D65 A;  4UP9 A;  2K5H A;  1EQQ A;  1HNW Q;  1KLU D;  3S16 H;  3KLR A;  2K6A A;  1B53 A;  4M8A A;  2F0W A;  5M3M G;  1VQ8 A;  2Z1C A;  4EQ5 A;  1C8C A;  2F0I A;  1E1O A;  2F0K A;  4LF4 L;  3G71 A;  4A93 B;  1KL9 A;  2OEO A;  2DNE A;  4UHV A;  3U50 C;  3V96 A;  1PDQ A;  3QOJ A;  5LMN W;  1WTP A;  1OXV A;  3I3C A;  3J81 E;  2RA4 A;  4QJF A;  4QUF A;  4POG A;  1K0R A;  1VQP A;  4DV7 Q;  3BVG A;  4X62 Q;  2EJF C;  4GNX C;  1Q82 C;  1VS0 A;  2DY7 A;  2MGS A;  5EKL A;  1MHW C;  5DM7 3;  3K0X A;  3PF4 A;  1YNN C;  3MZ5 A;  1E1T A;  4A93 H;  1JWS D;  1JIC A;  1SAP A;  2AUK A;  3NTI A;  4OEL B;  3GTG B;  2K04 A;  2NVT B;  1VMC A;  3VR5 A;  4LF7 Q;  5HGQ A;  4A93 G;  1RKN A;  2NVX B;  1B2T A;  1IBK L;  4WOR A;  2JJQ A;  2B2W A;  1DOK A;  2EJG C;  4OHJ A;  4IFD J;  1D1K A;  3EIV A;  1PFB A;  2F4I A;  2ZXR A;  5EJW A;  3HOW H;  3CAM A;  3OSO A;  2WV6 D;  4JV5 L;  3BU2 A;  4XIG S;  3GTG H;  3HOW G;  1BR9 A;  1SMX A;  3I55 A;  1KIX A;  2NVX H;  3NQI A;  2JA9 A;  1AH9 A;  2YU9 B;  3KF8 A;  3TS2 A;  1MBY A;  1HA6 A;  1U9R A;  3A74 A;  1R4P B;  4XQQ A;  1L1O A;  1EU4 A;  4CDD C;  1EY8 A;  5CC4 A;  3T1Y L;  2XVS A;  5ELN A;  4DV1 L;  1JR0 D;  4DR4 L;  3TBI B;  2IHF A;  3KF6 A;  2FFK B;  4RMF A;  5IWA Q;  2NYZ D;  4KD4 A;  1XMQ Q;  1YNJ C;  2E75 C;  4KJO A;  1MIU A;  1TU2 B;  2F0P A;  3NHH A;  3R93 A;  1SYC A;  2F4V Q;  3OHX C;  4JI2 L;  2IJ0 A;  4HED A;  5C6A A;  2QW7 A;  4RGT A;  5IGE A;  1R9T B;  2XNA C;  1EY5 A;  1A2U A;  2MPM A;  1CKN B;  3M4Y A;  2C9O A;  2ZM6 L;  1CSP A;  2N8N A;  1N33 Q;  3I4O A;  3S1M H;  1F2L A;  5DNF A;  1IBL L;  4YWL A;  5I6W A;  3M3Y H;  5LMU L;  4XDX A;  3IKJ A;  1SFO B;  4UPA A;  4X66 Q;  4R1J A;  3PUX A;  2VQF L;  4IO9 A;  4H44 C;  4BWG B;  3EA6 A;  1C4Q A;  3GTL B;  1I6H B;  3PO2 B;  4ZQ3 A;  4C2M B;  4K5W A;  3CP0 A;  3U4V A;  1Z6H A;  3F2U A;  3GO5 A;  3I56 A;  3MFG A;  1YI2 A;  1X3Q A;  4A3G G;  3PO3 B;  2I46 A;  2EYJ A;  2HDL A;  1X3E A;  2D9U A;  2GA4 B;  2FXQ A;  2EZV A;  4PZ6 A;  1RIP A;  4LFA Q;  1AN8 A;  2HIV A;  2UXB L;  3CCL A;  5I4D A;  4ZKB B;  1BBU A;  3AMU A;  3SVM A;  2K5N A;  1N36 L;  4J6H A;  2JYO A;  2XSC A;  3GTL H;  1I6H H;  3PO2 H;  2L9H A;  2RQX A;  4C2M H;  2VZA A;  1QUQ B;  2NZH A;  1LTR D;  2HCC A;  3PO2 G;  3PO3 H;  1HA5 A;  1M4V A;  2SEB D;  5CYU A;  5EPL A;  2A69 C;  1ET9 A;  2F0O A;  2TSS A;  3VR2 A;  3PO3 G;  2RVL A;  3P1H A;  2K7V A;  1E2Z A;  1FYC A;  1V1P A;  2A8V A;  1EEI D;  1LTT D;  1Q7Y C;  4ZKC B;  3V2T A;  1ONL A;  4APV A;  1HZA A;  4YWK A;  4JI5 Q;  3KJO A;  3BYT B;  2QKI C;  4ZK9 B;  1PFM A;  3BDC A;  1PH2 A;  2JK8 A;  2UXD Q;  3TP5 A;  1GHJ A;  1IXR A;  5EKK A;  3IL8 A;  1LTS D;  2UU9 L;  4LFB L;  1T5E A;  2NVQ B;  2M00 A;  3A56 A;  3U4Z A;  3FHW A;  1PV4 A;  1SNO A;  1UE7 A;  3I72 A;  3L3O C;  1DD2 A;  1Z47 A;  1O78 A;  1V1P B;  1WFQ A;  4RKB A;  1X6O A;  2MFI A;  2XRQ D;  3S2H H;  3BYY B;  3KUP A;  3HG9 A;  4JI3 Q;  4S3S A;  2HD3 A;  2A74 C; 
#chains in the Genus database with same CATH homology
 5EQ0 A;  1QG7 A;  4CJ0 B;  1K8M A;  3RUZ A;  1SYD A;  2KED A;  2EJM A;  1ZYR D;  1NCV A;  5IOD A;  4B9X A;  2EYO A;  3OWF A;  4OO1 H;  1EY7 A;  5IGB A;  4DN4 M;  1IL8 A;  4FNF A;  5ELF A;  5C0X I;  5FK9 C;  1EY6 A;  4OO1 G;  1OXX K;  1F9Q A;  2ID0 A;  5JVH 3;  1E2W A;  2CQA A;  4LMQ D;  3Q23 A;  4FF4 A;  2A68 C;  3GV6 A;  5M5W B;  3S1R B;  2IW3 A;  2X69 A;  1IW7 C;  4K8J A;  2HDM A;  4CKC A;  4KI0 A;  3D4W A;  1BO0 A;  4RGM A;  2EYF A;  1QIL A;  3PUZ A;  4RH6 A;  3GTK B;  1HQR D;  1LV9 A;  5E1F A;  2L4N A;  3MHB A;  2O4X A;  1BNZ A;  4HR7 B;  2JEA I;  3ND8 A;  1WD0 A;  4X3T A;  1J8I A;  2NZ1 D;  2R6G A;  2G9D A;  4CBV A;  2XIW A;  1T5X D;  3BG3 A;  1TKW B;  3MA2 B;  4H0L C;  4L63 B;  4IFD I;  4JK1 C;  3FKI B;  5KNB A;  4BBS B;  2A6E D;  1I4H A;  2SOB A;  1B50 A;  2IWH A;  5C4Z A;  4X3S A;  2XWJ B;  4XYQ A;  1TY0 A;  1V8Q A;  2RDF A;  1F77 A;  2RDH A;  2JE6 I;  4MN3 A;  2EY6 A;  2B2W C;  3R8B A;  4Z9C B;  3FPU B;  1UEA B;  5IGC A;  3S2D B;  2KHS A;  4BY7 B;  4C1N I;  4RHS A;  1EZ6 A;  3HOU B;  1RJT A;  5A35 A;  3WOE A;  2J7Z A;  1B1Z A;  1D6E C;  4RKL A;  1BF4 A;  3RLF A;  5IT9 L;  4H7B A;  4G7H C;  1G6Z A;  2IX3 A;  1STN A;  1PRT D;  1MI2 A;  2A5H A;  2QIL A;  4FF1 A;  2FMM A;  1H9R A;  5CV8 A;  3K5L A;  1TWG B;  4CKB A;  2K33 A;  2Z4H A;  1BQQ T;  3C1E A;  3DWA A;  3TP6 A;  5FO9 B;  2JA5 B;  5EBD A;  1JOQ A;  4C3I B;  3HOV B;  1DOL A;  3DM1 A;  5C4X B;  5M3F B;  3A8I E;  1IHZ A;  3GP7 A;  3OIQ A;  2PW5 A;  4K8I A;  1DZ1 A;  1SYG A;  3DUZ A;  4DAV A;  1FNW A;  5KNC A;  4RCO A;  4HTH A;  2O2L D;  3HKZ B;  3HOX B;  1LT4 D;  1DCZ A;  1PLF A;  3EFX D;  5CBA E;  1PTO D;  2WII B;  1I4X A;  3E0J A;  2BDN A;  1RTO A;  5JEA G;  2HQE A;  5FKA C;  1KDA A;  5IOC A;  1AW7 A;  2K5Q A;  3MXG A;  4K6L A;  3MTS A;  5FO7 B;  1D1I A;  2KEC A;  1Y1W B;  1Y8P B;  3KK7 A;  1JOR A;  1C48 A;  4R8I A;  3OIP A;  1HUM A;  3LNN A;  4IUV A;  2HUG A;  1JCK B;  3WDN A;  4NKL A;  4DNT B;  4KN4 C;  3I73 A;  4GZY C;  4IUT A;  1B9N A;  5COR A;  1BCP C;  3MWY W;  4IZ8 A;  2QCP X;  1OXU A;  1A6X A;  1Z7T A;  1R4Q B;  1V1O A;  2F0U A;  2B2Y C;  1XTC D;  4ID6 A;  2NWG A;  4ZAI A;  5IT9 E;  4A3B B;  2F0F A;  2LY7 A;  3QG1 A;  1J9O A;  1STB A;  5C44 B;  1ESF A;  1TII D;  3FMC A;  3I4L A;  5COY A;  3SR1 A;  4CKE A;  3IFD A;  1SSO A;  2QDB A;  3FVQ A;  1OXS C;  3D4D A;  5C0X H;  4PMW A;  4IUR A;  5BN4 A;  3RZD B;  1CT1 D;  2R93 B;  2PZT A;  4C3H G;  4C56 C;  1KAA A;  4X3U A;  1EQV A;  1SJE D;  2PZU A;  1ENF A;  4E6I A;  3ERQ A;  1SEB D;  1ROD A;  3R2I A;  4K6D A;  4KKT A;  3E6Z X;  5CV9 A;  4ZUI A;  3C46 A;  1EZ8 A;  4FXD A;  3O13 A;  5K36 H;  1PZI D;  3H6M A;  3N6R A;  4DNR B;  3A8J E;  3HRZ C;  2QEJ C;  5F2D A;  3NTH A;  3D8G A;  2FMC A;  1SDF A;  4QCL A;  1TWF B;  2WP8 J;  4KHZ A;  3T4A C;  1PTO F;  2F0S A;  1Q90 A;  1YNN D;  3TN2 A;  2AQ3 B;  3M7G A;  4ULL A;  2E2J B;  3C1F A;  4IFD H;  3SEB A;  3K0Y A;  1LT5 D;  1BOS A;  4A3K B;  1Y69 U;  1QE6 A;  2KUM A;  1IYV A;  4IFD G;  1W6K A;  2C5C A;  1WVL A;  1II3 A;  1ICW A;  1LTG D;  1S5E D;  1PFN A;  3DWP A;  1AFP A;  4EQP A;  1BCP F;  1STH A;  1TWC B;  3FEW X;  3T51 B;  2X6L A;  3GTQ B;  3GTO B;  5FO8 B;  4PMB A;  4L8J A;  1TT2 A;  3CKI B;  5C4J B;  1GUG A;  1F9P A;  1K8O A;  4DAP A;  3C2P A;  1A15 A;  3N52 A;  5KYI A;  4A3J B;  2AWN A;  4RA8 A;  5D14 A;  3MFY A;  4OGQ C;  2O5J C;  4XT3 B;  1YNJ D;  1I4P A;  2J0T D;  5CBE E;  3J7A V;  4BA2 I;  2JEB I;  1A2T A;  5HUR A;  3BDO A;  2PQE A;  1SE3 A;  2F3W A;  2L5T A;  1B9M A;  1KDC A;  4PMC A;  3OPO A;  4KY6 A;  3EQL C;  3KBG A;  2A6H C;  1SNQ A;  2RKS A;  1WTW A;  4NP5 A;  4QUC A;  3S15 B;  1SJH D;  1EY9 A;  3LWE A;  5EPJ A;  1RCV D;  4XYO A;  3BVZ A;  2K01 A;  2Z8L A;  2HCI A;  1DM0 B;  1CI3 M;  2A73 B;  2K32 A;  4KKS A;  3CU7 A;  2F1M A;  3L9A X;  2CW0 C;  2FJ2 A;  4KHV A;  1PZJ D;  3GTJ B;  5EGT A;  5KGU A;  1TY2 A;  1TS4 A;  1WTV A;  1ZEQ X;  2JA8 B;  3HEJ A;  1RTN A;  5I9O A;  2JSO A;  1ZKO A;  1O7L A;  1AZP A;  3A54 A;  3EJI A;  5ELC A;  5BN5 A;  2F0T A;  3K7A B;  2A69 D;  4DU9 A;  4BBR B;  2B39 A;  4L6T B;  1CZW A;  3ERO A;  1PRT B;  2Z4I A;  2EOT A;  4NMZ A;  2JA7 B;  5ELB A;  4RFB A;  1G8Z D;  2XRS D;  2AWO A;  1G29 1;  4U68 A;  4R9W A;  3L7Z C;  1FNU A;  1PZK D;  1QOH A;  1NSN S;  2BE5 C;  1CHQ D;  3M85 A;  4LK1 C;  2ENB A;  4DF7 A;  3K5M A;  4ZUJ A;  1ML0 D;  5CV6 A;  4FXK C;  4TRD A;  3BS1 A;  3OMC A;  2F0G A;  1SE2 A;  3H09 A;  3VYS A;  1L0X B;  3PUY A;  4EVO A;  2B2Y A;  2E2D C;  2M2L A;  2D2C C;  3TSS A;  1KDB A;  1TS5 A;  4ILW A;  1F9S A;  2IX1 A;  1PYW D;  2KJX A;  4QIW B;  2A68 D;  3D4R A;  1GUS A;  2VB2 X;  3SK4 A;  5LHY 1;  1D5X C;  1W6J A;  4J8Q A;  1LO5 D;  3KLS A;  1IW7 D;  3J7A F;  2IX0 A;  1KLG D;  1G2T A;  2NN6 I;  2N55 A;  2M9V A;  3G6J B;  1EYC A;  3GV3 A;  1GUW A;  1TVX A;  2XWB B;  5LL6 X;  4KV6 A;  3BVM A;  4BS9 A;  1H9J A;  2ICI A;  1O7Z A;  5CV7 A;  1XWE A;  1UNS A;  2WKC A;  2B2T A;  1FR3 A;  2G9H D;  4HMJ A;  4KK7 A;  3MC0 B;  1U4L A;  4R8N A;  4HMI A;  4M1U B;  2FIN B;  3VA7 A;  5C5L A;  3GQB A;  2LMC B;  4LAA A;  2IT1 A;  4OIK A;  2KVM A;  3W3A A;  5ISR A;  5IGD A;  3SK8 A;  3IAY A;  3PIO 3;  3V05 A;  4A3M B;  1GJX A;  2L1B A;  2TMP A;  1G2S A;  3A7A B;  1GUO A;  3TDQ A;  1S4Z A;  3S14 B;  1Y1V B;  1QNK A;  3NTK A;  3FRP B;  4KN7 C;  4FO2 A;  4OIJ A;  1BBX C;  2B8F A;  3CHB D;  4KMU C;  3JAM L;  4DXG A;  1EYA A;  3FDT A;  1ET6 A;  1AP0 A;  5JVG 3;  2V4D A;  4C3J B;  3VYU A;  2F3V A;  3T56 B;  3OMG A;  5J1Z A;  1DYQ A;  2BA1 A;  2XN9 C;  4BY1 B;  3VR4 A;  1IKL A;  4V19 0;  1DJR D;  3M4O B;  1ZXT A;  4HSP A;  1ENC A;  2AQ1 B;  5ELD A;  1TQO A;  1A3T A;  5C3E B;  1AZQ A;  3RMH A;  2EYM A;  3OWE B;  2ICE C;  5C5M A;  3ITP A;  1B3A A;  2SDF A;  1CFM A;  2I07 B;  4N9T A;  1EY0 A;  5M9O A;  4QB4 A;  1H9S A;  3K59 A;  4I65 A;  4DFA A;  1MGS A;  4A3E B;  1I4Q A;  1QCB D;  1V43 A;  4RGO S;  4Q0F A;  3C3L A;  2NBF A;  4RAU C;  2E2H B;  3GTM B;  3FPP A;  4XT1 B;  2EDG A;  4C3I G;  1SMY C;  4EQN A;  1BUV T;  2PW7 A;  1VF5 C;  3SK5 A;  2ZXO A;  4A3D B;  4IUU A;  3U9O A;  3S1N B;  3NWT A;  1H9S B;  1WTQ A;  3MXU A;  1WTR A;  3PUV A;  1TWH B;  1EYD A;  2B2U A;  4F7X A;  1SNM A;  2NTT A;  4MHE A;  4C1N K;  5IGF A;  1SYE A;  1NR4 A;  4O42 A;  2H4O A;  1BCP D;  5DEH A;  4B9W A;  3MEH A;  4AYB B;  1GUN A;  1LLR D;  3MVV A;  1RDP D;  2PO4 A;  2RBM A;  2KEE A;  3UI2 A;  1HFN A;  1FGB D;  1KNE A;  5AFW A;  5I2Y A;  4KY7 A;  3JAM E;  5CGK A;  1EU3 A;  1KTK A;  2OXP A;  4O1N A;  1BXT A;  1SNC A;  5JEA J;  4K5X A;  3KLS X;  1I6V C;  1JB3 A;  3Q24 A;  1LTI D;  2D5D A;  3K5O A;  3Q22 A;  3D3R A;  3K57 A;  3VR3 A;  4ZLT F;  3GD7 A;  2MHV A;  1WTO A;  2K1B A;  3K58 A;  1LTA D;  1JQY D;  2NN6 H;  1IKM A;  3NPP A;  2E76 C;  1CA6 A;  5C0X G;  5E4X A;  1I3Q B;  2NN6 G;  5CV4 A;  3NK9 A;  2DNC A;  4N9P A;  3SXH A;  1EIG A;  3G7L A;  1RHP A;  4KTA A;  2E2I B;  2VNU D;  1H9K A;  1VDZ A;  3ONA B;  4K5V A;  1F2Z A;  3QO2 A;  1F2Y A;  2KCC A;  1LAB A;  5TSS A;  3DEO A;  4KY5 A;  5D3I B;  5I2X A;  3AU7 A;  3PIP 3;  3QWN A;  2K05 A;  5K36 G;  4IN3 A;  4Y7N B;  2F0Q A;  4OO1 I;  3BZD B;  3S16 B;  2X6G A;  2B2T C;  1EFI D;  5HGT A;  2F0J A;  4RWS C;  2Q8I B;  1VMP A;  1RD9 D;  2VXW A;  5EKI A;  2L0C A;  4FXG C;  3K5N A;  1PMR A;  2D62 A;  1MSH A;  1ILP A;  3TZU A;  3QOL A;  4IUP A;  3TP7 A;  3HZX A;  1IYU A;  2L11 A;  1XYI A;  1ENA A;  3ND9 A;  3NWS A;  2F0D A;  1Q12 A;  3SDZ A;  2CHB D;  3A7L A;  5C4H A;  3H94 A;  5EBC A;  1DOM A;  5KRU A;  3W2D A;  2MUY A;  1K83 B;  2DY8 A;  1UUP A;  3X3M A;  1B4O A;  4TQU S;  5KIX A;  4G7O C;  2B2V C;  2SNM A;  1EQT A;  4K2L A;  2VB3 X;  3HOW B;  5A2Q L;  3Q6S A;  5J39 A;  4DK0 A;  2EY2 A;  2F0M A;  2AUJ D;  2A6H D;  1BDO A;  2PMZ B;  3R2T A;  2K28 A;  1EWH A;  1CZG A;  4IUN A;  4DA2 A;  3NQT A;  2Q8T A;  2NVY B;  2MJ8 A;  3VYT A;  2BCO A;  3H91 A;  2KCN A;  2CW0 D;  1EL0 A;  1A3V A;  5G3L D;  2NUC A;  1CM9 A;  1E0B A;  2IL8 A;  5J22 A;  3S1M B;  3T53 B;  5D3D A;  1WD1 A;  1D2B A;  1G91 A;  1ESR A;  1GUT A;  5CR3 A;  3DWQ A;  3M3Y B;  3WOF A;  4QF4 A;  4TSS A;  1HRJ A;  1A3U A;  4RGN A;  4A3G B;  4A3F B;  4DAY A;  1S5B D;  4DK1 A;  2BA0 A;  2F0V A;  2VUM B;  1SYF A;  4CJ2 C;  4RHR A;  2J4X A;  3P75 A;  4H13 C;  4NDX A;  5JPM C;  4FF3 A;  2B2U C;  4KD3 A;  1TS2 A;  2KOL A;  4XXE A;  3I90 A;  4JBW A;  2PPB C;  5T1G A;  1CHP D;  2BE5 D;  4ZYS A;  1SE4 A;  1LAC A;  5C3W A;  2CVR A;  3J7Y W;  4IAL A;  3D31 A;  1TR5 A;  1DON A;  4DGZ A;  1O80 A;  3R3O A;  5JOB A;  2EYP A;  3D6W A;  5A2Q E;  5FLX L;  4G4K A;  5JPN C;  3MXN A;  1Y8N B;  4LJZ C;  1KAB A;  2F0N A;  4K2K A;  1HCZ A;  5LL6 S;  3J80 L;  4WJW A;  1HFG A;  1CK1 A;  1STA A;  2RSN A;  4OL7 A;  4Q5V A;  4HCS A;  3S2H B;  1QNU A;  1PTO B;  1RF2 D;  4EQO A;  2OF1 A;  3NBH A;  5KYL A;  1HTP A;  3M7N A;  4DXF A;  3A55 A;  2F03 A;  2LKV A;  3Q0A A;  1Q8I A;  5ELE A;  2EYH A;  1U4M A;  1FD7 D;  1CQF A;  1PTO H;  1BCP B;  2PYK A;  3MXP A;  3H3V C;  5G3L F;  2PNR C;  3LX0 A;  4TKO B;  4B08 A;  4WRD A;  2BOS A;  2KA7 A;  3K6O A;  1HHV A;  4ABN A;  2JXM B;  1WCM B;  1NR2 A;  3TME A;  2DN8 A;  3HOZ B;  3DXJ C;  4FYD A;  3I70 A;  1F2M A;  2WAC A;  1UAP A;  3DHQ A;  1HXY D;  2L12 A;  4X3K A;  3NBI A;  3E5S A;  1HPC A;  4P2C B;  3P20 A;  1ZYR C;  1EY4 A;  1HUN A;  3TZD A;  2IPK D;  3P7J A;  1QJO A;  1D5M C;  2OT2 A;  4YIJ A;  3MAQ A;  2R7Z B;  2F0H A;  2EY5 A;  1CTM A;  3NE5 B;  1Q3L A;  1SYB A;  1ILQ A;  2QF7 A;  3I4N B;  4CGY B;  1I4R A;  4HCE A;  2KQ3 A;  2B63 B;  1NAP A;  1U4R A;  2Y0S B;  4K14 A;  1LT3 D;  2JP1 A;  3CQZ B;  1S5C D;  4QMG A;  1HQM C;  1EIH A;  1FNV A;  1STY A;  5FLX E;  3VA5 A;  3S1Q B;  5M5X B;  2B2V A;  2F0L A;  5E3F A;  1EEF D;  1SXT A;  3CRL C;  1QB5 D;  3DEP A;  3J80 E;  1X32 A;  2R92 B;  3IFT A;  2PZW A;  3A8K E;  3VYR A;  2K5W A;  1JOK A;  4F88 A;  1KNA A;  2EPB A;  5EPK A;  4HN7 A;  1S5D D;  3RD4 A;  2A6E C;  1L0Y B;  1JE4 A;  3QB3 A;  4PNY A;  1XXG A;  1F9R A;  3D6C A;  3I8Z A;  1E2V A;  4CHT B;  1MD2 D;  4UDU C;  3S9W A;  5KND A;  2H1E A;  4C3J G;  5K5P A;  3LWU A;  2PCF B;  2FHT A;  3PMF A;  5FOB B;  4A3I B;  1HTL D;  2ZXP A;  2WB1 B;  2O5I C;  3VR6 A;  1SMY D;  4F87 A;  4BA1 I;  3PV0 A;  3CRK C;  3AB9 A;  2RSO A;  2AQ2 B;  4XTC S;  3DMU A;  2LS0 1;  3HS0 C;  3U9S A;  2E74 C;  1TS3 A;  2F0E A;  2N88 A;  3NXW A;  2K03 A;  4KKU A;  2WKD A;  3HOY B;  1PRT C;  3HGB A;  2YYZ A;  1S5F D;  3OOC A;  3SK6 A;  2WIN B;  3QJY A;  1LTB D;  3TP8 A;  4NW2 A;  5NUC A;  5BN3 A;  1MSG A;  3NUC A;  5C3X A;  2MP1 A;  1JC7 A;  4KJN A;  2JA6 B;  3EVQ A;  5JEA H;  1CQV A;  5JAV A;  4ODG A;  1EWC A;  3RZO B;  4PV1 C;  5IGG A;  1JWU D;  4G7Z C;  4XQJ A;  2LFN A;  1STG A;  4F8M A;  1WTX A;  3SE0 A;  1SND A;  3H0G B;  4WFN 3;  1AEX A;  4G57 A;  4V0B A;  4XQN A;  4HSV A;  2ZT9 C;  2Q8R E;  1PTO C;  3I4M B;  3S17 B;  2L55 A;  3J81 L;  5IIF A;  1VCI A;  1SNP A;  1U4P A;  4MIU A;  4FF2 A;  3HP3 A;  5JJZ A;  1O7Y A;  1JWM D;  4PQX A;  3T13 A;  1JOO A;  2EE1 A;  4CJ1 B;  5T1I A;  2EY1 A;  1XX8 A;  3SHL A;  3BDL A;  1Q1E A;  4FVM A;  5DM6 3;  1CA5 A;  2BDO A;  1Y8O B;  4J1M A;  2RDG A;  1I4G A;  5M5Y B;  2NTS A;  4RCN A;  1Q1B A;  4IUQ A;  1I50 B;  4I7Z C;  4C3H B;  3X3N A;  4U67 3;  5CV5 A;  2NB0 A;  3OW7 A;  2R3Z A;  5I6Y A;  1VF7 A;  3URY A;  4FP5 D;  5KEE A;  1LT6 D;  1X3P A;  1PRT F;  1H9M A;  3T16 A;  4HAE A;  4ME5 A;  3NP8 A;  2EXZ A;  4ZRZ A;  2R61 A;  5CMD A;  1M8A A;  4EGV A;  4UAI A;  4IQZ A;  1SBB B;  1TWA B;  1NUC A;  2B8G A;  2EVB A;  3PUW A;  1GXD C;  2K5D A;  5M3M B;  1OXT A;  1STE A;  5E4W C;  3ZYY X;  1OO9 B;  3GTP B;  1PXU A;  1GHK A;  1QWY A;  5DAU A;  2EYL A;  1GOZ A;  1B44 D;  5C0X J;  1DXM A;  1D5Z C;  2SNS A;  2WAQ B;  3NSW A;  1EOT A;  3KBX A;  3QIA A;  5I9P A;  3I91 A;  5D65 A;  1KLU D;  3KLR A;  2K6A A;  1B53 A;  4M8A A;  2F0W A;  2Z1C A;  1C8C A;  2F0I A;  2F0K A;  4A93 B;  2OEO A;  2DNE A;  3V96 A;  1PDQ A;  3QOJ A;  1WTP A;  1OXV A;  3I3C A;  3J81 E;  2RA4 A;  4QUF A;  3BVG A;  2EJF C;  2DY7 A;  2MGS A;  5EKL A;  5DM7 3;  1YNN C;  3MZ5 A;  1JWS D;  1JIC A;  1SAP A;  2AUK A;  3NTI A;  3GTG B;  2K04 A;  2NVT B;  1VMC A;  3VR5 A;  1B2T A;  1RKN A;  2NVX B;  4WOR A;  2B2W A;  1DOK A;  2EJG C;  4OHJ A;  4IFD J;  1D1K A;  1PFB A;  2F4I A;  2ZXR A;  5EJW A;  3OSO A;  2WV6 D;  4XIG S;  1BR9 A;  3NQI A;  2YU9 B;  3KF8 A;  1MBY A;  1HA6 A;  1U9R A;  1R4P B;  4XQQ A;  1EU4 A;  5CC4 A;  1EY8 A;  2XVS A;  1JR0 D;  3TBI B;  2FFK B;  2NYZ D;  4KD4 A;  1YNJ C;  4KJO A;  2E75 C;  1TU2 B;  2F0P A;  3NHH A;  3R93 A;  1SYC A;  3OHX C;  2IJ0 A;  4HED A;  5C6A A;  4RGT A;  5IGE A;  1R9T B;  2XNA C;  1EY5 A;  1A2U A;  2MPM A;  3M4Y A;  2C9O A;  1F2L A;  5DNF A;  5I6W A;  4XDX A;  3IKJ A;  1SFO B;  3PUX A;  4H44 C;  4BWG B;  3EA6 A;  1C4Q A;  3GTL B;  1I6H B;  3PO2 B;  4ZQ3 A;  4C2M B;  4K5W A;  1Z6H A;  3F2U A;  3GO5 A;  3MFG A;  1X3Q A;  3PO3 B;  2I46 A;  2EYJ A;  2HDL A;  2D9U A;  2GA4 B;  2EZV A;  1AN8 A;  5I4D A;  4ZKB B;  3AMU A;  3SVM A;  4J6H A;  2JYO A;  2XSC A;  2L9H A;  2RQX A;  1LTR D;  2HCC A;  1HA5 A;  1M4V A;  2SEB D;  5CYU A;  5EPL A;  2A69 C;  1ET9 A;  2F0O A;  2TSS A;  3VR2 A;  2RVL A;  3P1H A;  2K7V A;  1E2Z A;  1FYC A;  1V1P A;  1EEI D;  1LTT D;  4ZKC B;  3V2T A;  1ONL A;  3BYT B;  2QKI C;  4ZK9 B;  1PFM A;  3BDC A;  3TP5 A;  1GHJ A;  5EKK A;  3IL8 A;  1LTS D;  1T5E A;  2NVQ B;  2M00 A;  3A56 A;  1SNO A;  3I72 A;  3L3O C;  1DD2 A;  1Z47 A;  1O78 A;  1V1P B;  4RKB A;  2XRQ D;  3BYY B;  3KUP A;  3HG9 A;  4S3S A;  2A74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...