1FR3A

The high resolution structure of a molybdate binding protein from sporomusa ovata
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
MKISGRNKLEATVKEIVKGTVMAKIVMDYKGTELVAAITIDSVADLDLVPGDKVTALVKATEMEVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the molybdate/tungstate binding protein mop from Sporomusa ovata.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords MOLYBDATE/TUNGSTATE BINDING PROTEIN
total genus 12
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2000-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1fr3A00
1H9MA 4KKTA 3BDOA 3NE5B 1H9JA 2E75C 2E76C 1LACA 2K32A 1Z7TA 1E2ZA 4TQUS 1Y8OB 1IW7C 1Q12A 3EQLC 1HPCA 1VDZA 2PPBC 1DCZA 1Q1EA 1SMYC 1HCZA 1O7LA 1T5EA 2AUJD 3P20A 1OXSC 2AWOA 2LMCB 3A8JE 2IT1A 1OXTA 1CTMA 4DNRB 5KNBA 3QJYA 3ND8A 3A7AB 3PUVA 3M7NA 1H9KA 3M85A 2JEAI 4JBWA 1A6XA 3OOCA 1V8QA 3W3AA 5JEAG 2EVBA 2QF7A 3T53B 3BG3A 2JE6I 4KMUC 3OW7A 2EDGA 3AB9A 2O5IC 3ND9A 4G7OC 1H9SB 4KI0A 1IW7D 2B8FA 1FYCA 4KKSA 2JEBI 2A69D 3VR6A 3HGBA 4DK1A 4L8JA 4IFDG 1B9MA 3I4LA 2EJMA 3QG1A 2NN6I 1ZYRC 1GUTA 2A6HC 2K33A 3VR3A 1CI3M 3CRLC 2BDOA 2DNCA 4LK1C 2BA0A 1V43A 3U9SA 4JK1C 1IYUA 3D4RA 4DNTB 2NN6H 1TU2B 2D62A 3FMCA 1Z6HA 3LNNA 3N6RA 1GUNA 3I72A 3T51B 1VF7A 5A35A 4OO1G 4KN7C 4TKOB 1HTPA 4HR7B 4XIGS 3T56B 2A6HD 2CW0C 2K7VA 3SDZA 2A6EC 3OPOA 4IQZA 2B8GA 3GD7A 1B9NA 3LWUA 2JXMB 1Y8PB 4RCNA 2BA1A 3PUWA 1H9RA 3VR5A 3A8IE 1CFMA 1Y8NB 2L5TA 2DNEA 1OXXK 2KCCA 1Y69U 1TKWB 3PV0A 1LABA 2NN6G 2D2CC 3L7ZC 1VF5C 1GUGA 1IYVA 2DN8A 2PNRC 3IKJA 2A68C 1GHJA 2EJGC 3SE0A 2PCFB 2BE5D 1DXMA 1Q90A 3IFTA 4KN4C 1OXUA 3CRKC 3GQBA 1E2WA 1K8MA 1E2VA 1VCIA 1QJOA 1H9SA 5BN3A 4IFDH 3RLFA 1K8OA 2V4DA 3D31A 4BA1I 2BE5C 4GZYC 3VR4A 2ZT9C 1O78A 1Q1BA 1ONLA 2A68D 1HQMC 1YNNC 3MXUA 4H44C 2R6GA 4BA2I 3FPPA 4I7ZC 2O5JC 3H94A 2EJFC 4OO1H 2A6ED 4H13C 4KHZA 3QIAA 1YNJC 3A8KE 5BN5A 4G7HC 3PUXA 2YYZA 4PV1C 1GUOA 2E74C 2F1MA 4OGQC 4DK0A 3TZUA 5C0XG 4XTCS 3KLRA 4G7ZC 5KNDA 1G291 3PUYA 3PUZA 5K36H 1OXVA 3A7LA 2KA7A 1FR3A 1PMRA 3MFYA 1ZKOA 4KKUA 4LJZC 2Q8IB 1GJXA 1GUSA 1I6VC 3M4YA 5C0XH 1GHKA 1DD2A 2A69C 2D5DA 3VR2A 3WDNA 5KNCA 5K36G 4H0LC 3DXJC 3VA7A 1BDOA 3I73A 5BN4A 1EWHA 5JEAH 2AUKA
chains in the Genus database with same CATH superfamily
1H9MA 4A3KH 5T1GA 4DR1Q 4JI7Q 1KTKA 3NTIA 1JCKB 1WCMB 4PG3A 3GTLH 2OWOA 1VQ5A 4KJOA 4A3LH 3A56A 3DEOA 3NUCA 3M85A 5FLMG 4BBSG 1F9SA 2LXKA 3OTOL 2EY1A 2YTYA 3P75A 4BXXG 3FEWX 4JYAQ 1C0AA 1CKOA 2MUYA 4DXGA 4MNOA 4RFBA 1IW7D 1EYAA 4H02A 4IJLA 1K73C 3GTOB 4A3MH 2SNSA 4GKJL 5M5XH 3UDFA 4HIOA 3BDLA 1U4LA 3QG1A 4KD4A 2ICIA 2ZJRA 2DNCA 2PMZB 4DN4M 2B63H 5JPMC 2ZM6Q 4DNTB 1Q7YC 2YU9H 5D3DA 3CQZH 4A3EH 4BY7H 3CCJA 2K5QA 2IL8A 5C0XI 1VQLA 4PMBA 2G5DA 3VR5A 3RR5A 2BA1A 3K6OA 3TZDA 1TY0A 3TMEA 1N36L 4B3SL 1U4RA 3J7YW 1EU4A 1VQAA 4A3JG 1RL2A 4MIUA 3HOWB 5LMNQ 3CRKC 1C48A 4LFBQ 3X3MA 4K5XA 1O78A 4R4TA 1SNMA 4EQNA 1SJHD 4GN4B 3CPFA 4OWTB 5T1IA 4RKBA 3K0XA 1A0IA 3OHXC 5GROA 5BN5A 4G7HC 4FXDA 4QGUA 4K2KA 2NTTA 3MXNA 1WJJA 1EWCA 1G51A 3KLRA 4HAEA 2HCIA 1FR3A 1JQYD 1ZKOA 4EQ5A 3OW2A 4DV1L 1HR0L 3I55A 3K7AH 4NKLA 4KY7A 4YY3L 2EZVA 4PQXA 4A3FH 3KUPA 2QKIC 4OHJA 4GOPC 4N8FA 1ICWA 1BDOA 5AJ3L 4K6DA 3DM1A 2F0FA 2GVBA 1EWHA 5JEAH 1SYCA 1VQ4A 4YCUA 1VQKA 1E0BA 4IUPA 1B2TA 3ONAB 1E2ZA 3K5MA 5E7NA 1Y8OB 2A19A 4OWXB 2QA4A 1SMYC 3P20A 4LAAA 4NB3A 1OXSC 2AWOA 2R7DA 2XRQD 3FDTA 3A7AB 3PUVA 4A75A 4FDBA 1L1OB 3I56A 3SK8A 5BR8L 5I6YA 2ES2A 4X6AH 3BVMA 4JG2A 1IBKQ 4X64Q 1TS2A 1D6EC 2EDGA 3A0JA 3OW7A 1DGSA 5EKKA 2O5IC 5C4XH 4DR7Q 4Y7NB 3PO3H 1FYCA 2D0PA 3TBIB 3KJOA 3PO3B 3PO3G 2UUCQ 3M4OH 1JWSD 3KLWA 1SE2A 2ASBA 1U4PA 3U58A 4DNIA 3N6RA 3J7A5 4IPHA 2M2LA 1Q3LA 2PI2A 1J6QA 4DGZA 3E0EA 4P74A 5C3XA 2DUDA 3F2BA 4RGMA 1LTBD 1B1ZA 2ZM6L 3SDZA 4GN3B 1SE8A 1JORA 1HJPA 4RCNA 1KNAA 3TS2A 1CKMA 1QVGA 4BBRB 2K52A 4AQYL 1SROA 3DM3A 4DUZL 4GS3A 4GOPB 3NWTA 4ILWA 1JWMD 1PZID 4Z9CB 5C44H 3EIVA 3HOZH 1VQCA 4IJHA 3W1BA 4JOIC 2X69A 5LL6X 1K83B 3KF6A 1IKMA 1E2WA 2AWNA 1E2VA 5JEAJ 2VUMB 4A3FG 4BA1I 2WKCA 2BE5C 1ONLA 3TP5A 4EGVA 4PZ7A 3OWFA 1DYQA 3Q8DA 1L1OC 1S72A 2NTSA 3QIAA 3A8KE 1PDQA 3LX0A 1ZXTA 1SFOH 1Y1WB 2F0WA 3HOZB 2NVXH 2A73B 1M1KC 4K0KL 2K04A 2RQXA 1K83H 1F2YA 3GTQH 5M3MG 4DUYL 3RZOH 1PMRA 4FF3A 1VS0A 1P16A 4DV3L 1JC7A 2EY5A 3I3CA 2OXPA 3K7AB 4RH6A 3F2CA 3KLSX 1NR4A 2JSOA 2LXJA 1EU3A 2RHSB 5M3FG 3RN2A 3PGZA 2WKDA 4ID6A 5JAVA 3J81c 1KLUD 1QNUA 5C5MA 3NE5B 1H9JA 2DJGC 1Y1VB 4C3IH 2K32A 5M3MB 1Q81C 4BY1H 3GTKB 4OELB 1CTMA 3S14H 4KHPQ 4RGOS 1IBLQ 2DY8A 5G3LD 3GV3A 4MN3A 4QQBX 5JEAG 3IAYA 1BCPC 2KOLA 4MZ9A 4IUUA 4DV4L 5C4XB 1TQOA 2FFKB 1EY8A 4CDDC 3C46A 2E2JH 3SK5A 4CKCA 1XYIA 1A62A 1B9MA 1GD7A 4OX9L 2PW5A 5M9OA 1VQ8A 2YV5A 1VQBA 2FINB 1ICFB 4EQPA 5D14A 3J80E 2CWPA 3D4RA 1X54A 3I72A 5BR8Q 1FL0A 3ICEA 3RMHA 1TT2A 1KIXA 4HIMA 3OPOA 1MIUA 3K5LA 4GNXA 2B8GA 2LFNA 2L5TA 2DNEA 3BDCA 5CV6A 3AEVA 1CA6A 3ULLA 1A3VA 1GUGA 5IYCH 2RF4A 4DV2L 2H4OA 1QUQB 1YZ6A 1AN8A 1MSHA 5GADC 1JE5A 4LF9Q 4C2MB 1UAPA 4RWSC 2NWGA 3VYUA 1XNRQ 3KF6B 4JVZA 4ZUIA 4R1JA 1K8OA 3D31A 4A3IG 5E4WC 3ERSX 3P1HA 1XXGA 3CCQA 1LTGD 4CBVA 1DOMA 4JI6Q 4NXML 2Z4IA 3G4SA 4JBKA 3HOYH 2A6ED 1XWEA 2R3ZA 3HOVG 5CV7A 2MGSA 1QUQA 2AQ1B 1TIID 4R4OA 3BVGA 4ME5A 4QUFA 5KIXA 1NMGA 4BY7G 2VZAA 2QCPX 5ELEA 3TP8A 2R92B 4RMFA 3DWPA 5KNDA 3QR8A 1OXVA 1VQHA 3CMEA 2A1AA 4B9WA 3CCLA 3S16B 3K80C 5BN4A 3I73A 1FJGL 3GTPH 2E2IB 2K50A 2SNMA 2RDGA 2F3VA 1VQDA 3Q22A 1X9NA 1ASZA 3KF8A 3M4OB 3OIQA 4B3RQ 4F88A 3HZXA 4Y52H 2E2DC 1O7IA 3MHBA 5JOBA 1PRTC 4DV7L 1ESFA 3CCMA 2HQEA 2XIWA 3HOXH 3GTGB 2NVYH 1A6XA 2K75A 4ZLTF 2NVXB 2F0DA 5IYBH 5C0XJ 4A3KG 3I4MB 3H15A 4C56C 2PQAA 3TQYA 2B2TA 3G71A 2FJ2A 4LW1A 5KEEA 4DK1A 4L8JA 1STAA 2NN6I 4JI8Q 3M3YB 1I6HB 4PZ6A 4A3CH 1NE3A 3RN5A 2VY3A 3HFZB 1YHBA 3I4NB 4LK1C 4RCOA 1LUZA 4BY1G 2Q8TA 4FYDA 2Z1CA 5L37A 5IOCA 1VQIA 1JICA 2N49A 2Y0SE 5K5PA 5A35A 4FXGC 4AQYQ 1HTPA 1M90C 3HOUB 1BCPF 1N33L 1D8LA 1K3BC 1KXLA 4IQZA 1Y8PB 4X3UA 5IP7G 3S1MB 5C6AA 4IFDI 3E9IA 3SXHA 1WOCA 2IX3A 3TEHB 5C4XG 2IX1A 1KRSA 5JVH3 5HGQA 1VQEA 4GNXB 1QJOA 2L9HA 1XTCD 5BN3A 1J5EL 2R7FA 1NNXA 2IWHA 3D6WA 1TWCB 4RHRA 5JJLA 1DJRD 1L1OA 3R3OA 1LLRD 4A3DH 1EY0A 4K0KQ 1MJCA 3E0JA 1HH2P 1N36Q 1YI2A 5JJKA 1K3RA 2Z9HA 5IP9G 1XNQQ 2B2WC 4QY7A 2HCCA 3RLNA 4E6IA 3TZUA 2K5DA 2A74C 1WTHA 4QF4A 5CORA 3U4VA 1CQFA 1X3GA 3PO2G 3PO2B 3HEJA 4KV6A 3VDYA 2UU9Q 1JT8A 2WAQG 2R7ZH 2KBNA 4IZ8A 3R2IA 5AJ3Q 1N9WA 3HKZG 2K5VA 2UXDL 2JQOA 3RZDH 2MO1A 3RD4A 2OQ0A 5I4DA 3A5ZB 2E76C 1JWUD 4LFAL 2K4KA 5A2QL 1YITA 1SN8A 1Q1EA 5IT9L 1O7LA 1T5EA 2JA8H 4ZAIA 1KAAA 3H0GB 3H0GG 4YCWA 4JBJA 1HR0W 3ZJYC 1SNPA 2K5WA 4ZRZA 1PYSB 4DV1Q 3K57A 1V8QA 3CPWA 1PYBA 3J80i 1WTVA 1VQ6A 1PFBA 1WTRA 2XVSA 1JJGA 2VUMH 1F9RA 4GLAC 3LWEA 4IALA 1I4XA 3K5NA 1L0YB 3UE1A 3VYSA 4IFDG 2EJMA 3CHBD 1GUTA 2CW0D 4X62L 4JI4Q 3CRLC 2MO0A 2JA6G 1X3FA 1V43A 2UUAL 3U9SA 3S1MH 1S5BD 1C9OA 4J15A 3F2DA 1Z6HA 3T51B 5A2QE 3JAML 4ALPA 3T56B 4XYOA 2L4NA 1TY2A 4NXNQ 3GD7A 3LWUA 2VQFQ 3ZYYX 1DOKA 4HIKA 3QB3A 1M4VA 1OXXK 1J8IA 3W5OA 1SR3A 3C1FA 2NN6G 1CKNB 1TWFB 1S5ED 1NCVA 4A3GB 2KECA 2VL6A 1FNWA 4LF7L 2HHHL 1YEZA 5EGTA 4IUTA 3GP7A 1OXUA 1X3QA 2EQSA 5EKIA 4KHPL 4OX9Q 4HJAA 1BVSA 4GKKL 4RA8A 1SNDA 1Y1WH 1KD1C 4B3MQ 4LUOA 1Q1BA 3NTKA 3I4NH 4KJNA 4H44C 1QB5D 4DK6C 4GLVB 1T5XD 1SYFA 1BCPB 2B2YA 1YNJC 3HG9A 2K05A 2E2JB 3AMUA 5IP7H 3S24A 2R61A 2AHOB 2WV6D 4UP7A 1EYGA 4DR6L 2N78A 5DM73 2K6AA 3VYRA 3T1YQ 5EKLA 5EQ0A 2EYFA 4DR1L 4JI7L 3WWVA 4L5QA 5AFWA 4NW2A 4WJWA 1SE3A 1W3SA 3S1NB 4QIWE 2ID0A 1ML0D 2PZTA 3S16H 3G48A 1Q12A 4S3SA 5LHY1 5M5YH 1YBYA 2PPBC 1B3AA 1K0SA 2AUJD 2UXBQ 1LYLA 1JOOA 1OXTA 4QCLA 2HD3A 2ZTDA 2JYOA 1XPUA 2CVRA 4OO1I 2EVBA 1XNRL 1GOZA 4DAYB 4OIJA 2M00A 3ND9A 1LT3D 4X3TA 4R8IA 3G7LA 3T1HL 3GO5A 2I0QA 1STBA 1GO3E 3NXWA 1WI5A 3DEPA 2HDMA 5C4ZA 1SYGA 3H91A 1KC8C 1I50H 1JOQA 4LMQD 3KBXA 5CBEE 3KK7A 4A3IB 3D0FA 1EQQA 2NVTH 4I65A 5C4JB 1II3A 4C3JB 3NELA 1CSQA 2PZWA 1A2UA 2D9UA 4XQJA 1SBBB 1VQ7A 1VQ9A 5C4HA 1UEAB 2ZTEA 3CCRA 4LF5L 4P73A 1T9HA 2CFMA 2Z6KC 3MTSA 2JA9A 4G4KA 4YHHQ 4ABNA 3S1NH 3RZOB 2O2LD 2YU9B 3L7ZC 2XGTA 3X3NA 1PA6A 1SRUA 2IY5B 1WTWA 2CH4A 2VQEQ 1E3PA 1SMXA 5JVG3 2L1BA 3MFGA 1NR2A 1Z47A 1VQOA 2I5HA 4A3MB 2RDFA 1UNSA 3JAMi 4WORA 5IGEA 3DWAA 1GVPA 2CWAA 3HOXB 4NXMQ 2KJXA 1AP0A 4L5RC 1NY4A 4DV6Q 3OYYA 1PXUA 2F3IA 4B3ML 3P7JA 2K03A 1S40A 3PIO3 1VQGA 4XT3B 5D3IB 1VQPA 5FKAC 4JPBW 4QJFA 5C0XG 3U50C 1CQVA 3NPPA 4TSSA 5K36H 3PUZA 4KD3A 4KKUA 1FD7D 1WD1A 2E5LQ 3G6JB 1EOTA 1I6VC 3K8AA 3M4YA 4C2MH 1QNKA 1IBMQ 4RAUC 3J80L 1A2TA 1L2FA 4MTKA 1HTLD 2K5NA 3KDFB 5HGTA 2F0HA 1I5FA 3NP8A 5EBCA 1EFWA 4N9TA 1EL0A 3KDFA 1TS4A 4GLXA 5C3EG 1F9QA 2K28A 3AQQA 2QGQA 3S9WA 3M7GA 5CBAE 1E1OA 2EYHA 4JBWA 5M5XB 2P5ZX 1SFOB 1XNQL 2ZJPA 1K0RA 5ISRA 4LF8L 1PH4A 2BH8A 1A3TA 3U4ZA 4RGTA 1PV4A 5M5WH 5DM63 3TN2A 1M8AA 1I4RA 5EBDA 1Z9FA 3E5SA 2F0EA 3A55A 3NHHA 3FVQA 2D0OA 4R4CA 1ILQA 2RCFA 2EY6A 1TU2B 3EROA 2AMCB 2B2UA 4R4QA 5IT9c 4TKOB 3U9OA 2ENBA 3EFXD 1YNJD 3HKZB 2GA4B 2WIIB 4CJ0B 1MSGA 4XQQA 2HHHQ 3VA5A 2R93G 4WJ3M 1CFMA 2KCCA 2E5LL 2PNRC 2EJGC 1DXMA 1PFMA 1PTOD 1FGUA 3TP7A 2PQEA 2PQAB 4IFDH 1SMYD 3BZDB 5IWAQ 3VR4A 4JI4L 1YIJA 2L15A 4TVAB 1HNWL 4F7XA 1SE4A 4JI1Q 3CC2A 4J1MA 1STGA 1PHJA 5FK9C 2SOBA 1Q82C 1AW7A 2F1MA 3DLLA 4DV2Q 3S2HB 2EE1A 4JI5Q 1SSOA 5CV9A 2IHEA 3A7LA 3WOFA 1BNZA 2K01A 2Z0SA 4B9XA 5LMUQ 1GJXA 2F0MA 3J80c 2JA5H 1HNZQ 3OIPA 4AH6A 2A69C 4M8AA 2N8NA 4H0LC 1F2MA 1N32Q 3S1QB 4ME3A 1D5XC 2LS01 3F2UA 3FPPA 4DV6L 1E1TA 4J8QA 1NMFA 2XWJB 4HEDA 2X6GA 3S17H 3S1QH 4JCVE 4L5TA 4NMZA 3PO2H 3Q24A 1HCZA 3STBC 1HR0Q 2KUMA 4L6TB 3T13A 3EN2A 5TSSA 1U0LA 2EYMA 3HOYB 1RDPD 3CD6A 4Y7NH 4CJ2C 2Q2TA 5CGKA 3FRPB 1QWYA 3KJPA 1HHVA 5EAYA 4DAPA 1IBML 2JE6I 4DV5Q 3D8GA 3IRBA 1HZ9A 4B08A 4KLKA 3NQIA 2F0LA 2RHQB 2N3SA 1ZYRC 4I7AA 4N9PA 2G9DA 4X62Q 1TWCH 3Q6SA 2TMPA 2KQ3A 1PTOB 4LF6L 2MPMA 2E2IH 2VW9A 3GTMH 1RTOA 4R9WA 2D62A 1B44D 3KLSA 5J1ZA 4OWWB 1S5CD 3KYHC 3L0OA 3PCOB 4N8X1 1N34Q 5M3MH 1B9NA 5E3FA 3URYA 3GDEA 5CV4A 3BVZA 1BOSA 5LMUL 4UAIA 1AE3A 1Y14B 4DR3L 2D2CC 2JN4A 1HXYD 2F52A 2R93B 3CC4A 2FXQA 3IKJA 3KOJA 4DV0Q 4BY7B 2BE5D 4GN5A 4A3JB 1ET9A 1VCIA 1H9SA 2J7ZA 2IW3A 4GKKQ 2WB1B 2I5LX 2XTIA 3M3YH 2NZ1D 3MXUA 3WOEA 3H94A 1LO5D 4POFA 2JA7B 2A5HA 1XMOL 3PIP3 1JE4A 1IL8A 3SGIA 3CU7A 2XRSD 2RA4A 3F8TA 5ELFA 2VUMG 2WP8J 1R9TH 2NZOA 2NB0A 4IUQA 5IGDA 4XTCS 5IGBA 3GTLB 3FPUB 3MFYA 3SHLA 1Q46A 1ZYRD 1PTOC 2F0VA 4JI5L 2B2YC 3MA2B 2ZJQA 2EXDA 1QVCA 3HOVB 2ATWA 1F2ZA 4BY1B 4CDFC 4AYBB 3BG3A 1XPOA 3I91A 3NK9A 4G57A 3UDXA 4DXFA 3I4OA 4B3TQ 2B2VC 2F4VL 1B53A 4RG1A 4DR6Q 4QUCA 3OMCA 3A8JE 1SEBD 4J6HA 2DJFC 3D6CA 2K1BA 3FP9A 4NDXA 1H9KA 4JV5L 3S2DB 3S2HH 1TWGH 2QF7A 1V1QA 5IP9H 3NSWA 2JP1A 2AQ3B 4EQOA 4KI0A 1MHWC 4CHTB 1TWGB 1STYA 2A69D 2M9VA 2IX0A 1WCMH 1NJIC 2QDBA 1GXDC 3GV6A 3Q23A 4GKJQ 3TRZA 5IE8A 5FJ8H 3KFUA 3S15H 4OO1G 1Q8KA 4DV4Q 4IN3A 4YIJA 3A5UA 3H3VC 3F1ZA 1C8CA 4LF6Q 4A3GH 2CCZA 4A3EB 4PMCA 3SEBA 3BZCA 1WVLA 4BBRH 3HKSA 2VB2X 1LT4D 1VF5C 4UPAA 1RKNA 3HOUH 4KY5A 2B63B 4HCSA 4V190 1UE5A 4AYBE 3R93A 4DPGA 3D4WA 1R9TB 4K8JA 1DM0B 2VXWA 2ALYB 3T4AC 4XT1B 4BA2I 1ILPA 1PH1A 1PRTB 2UUBL 5FLXL 4DR5L 4DA2A 4HTHA 5KYLA 1B4OA 1RTNA 2EJFC 4X65L 1UWVA 3ERQA 4H13C 4K6LA 3ITPA 5C44B 4X3SA 1QILA 4HJ7A 3QO2A 2KVMA 2MFIA 4HJ9A 3NTHA 3K59A 1B3QA 1YHAA 4DV0L 4LNQA 4MHEA 1EEFD 1FNVA 3MEFA 3PIPA 4C3IG 3CXCA 3HOZG 1HUNA 2B2WA 1D7QA 4O42A 4LFAQ 2J0TD 4HJ5A 2YTVA 3H0GH 1K28A 1NTGA 5C5LA 4C3HG 2F0SA 5M5YB 2VB3X 4U673 4HCEA 4KKTA 2EXZA 2ZXOA 2NUCA 1LACA 2R92G 1IW7C 1Q8IA 1OTCA 1G6ZA 4DR7L 3D3RA 5EPJA 1A15A 2R92H 2JA6B 2Q8RE 1UUPA 4IURA 4ULLA 2OTJA 2QW7A 4AIMA 3VR6A 3HGBA 4LF4L 5DLQE 2H5XA 4FVMA 3VR3A 3PIOA 1BXTA 4V0BA 3K7UC 1LTTD 4P71A 2VNUD 4DV7Q 4NXNL 1N32L 2BA0A 1XPRA 3C1EA 2WFWA 3UDGA 2NN6H 3FMCA 3LNNA 1K8AC 4XIGS 1WD0A 2UU9L 5I6WA 1EOVA 3MXNB 2O4XA 3CCUA 1WTOA 2RSOA 2FHTA 3BZKA 1IXRA 4LFCL 3EJIA 1PFNA 1I6HH 4JI6L 2QEJC 1F2LA 2DN8A 4DKAC 1SNQA 3BU2A 5CV8A 2RKSA 4DR2Q 4ODGA 2MP1A 4FF4A 4FXKC 1X65A 1N33Q 2ZT9C 4OO1H 2A68D 2R6GA 1D5MC 2PZUA 3CW2C 4A3JH 2F4IA 5IGCA 1SNCA 1PTOF 2F0TA 3ER0A 4A3GG 3C2PA 3R8BA 5GAGC 1LTRD 4C1NI 5CR3A 3W1GA 1PRTF 3HS0C 5IYCG 1YNND 1G8ZD 1HFNA 1I4GA 4ZYSA 3MEHA 5C3WA 1BUVT 4NP5A 2F0JA 1PZJD 1GUSA 2OF1A 3C3LA 1HNZL 2D5DA 4LUVA 4P72A 2EIFA 2QDLA 4KY6A 4UY8C 1AZPA 4RHSA 1TWHH 5M3FH 2PO4A 3L3OC 1A63A 4XQNA 2J4XA 4NPSA 4A3BB 1VDZA 4K14A 1I4HA 3JAME 1DCZA 3S1RB 3CCSA 2JA5B 2JA5G 2PNHA 2IT1A 1K8GA 4IPCA 5KNBA 2OTLA 1SAPA 3QJYA 2E2HB 4PNYA 2GVAA 4HMJA 3D4DA 1S5FD 4HSPA 2JEAI 3OOCA 3PF4A 1PRTD 1RJTA 1CK1A 1BQQT 1S3OA 1B50A 4KMUC 3AB9A 4DV5L 1YJ9A 3I4MH 3HRZC 1H9SB 1HZBA 4DR2L 1RF2D 3TREA 3G6EA 2KHIA 4KK7A 3MC0B 3MZ5A 3CP0A 4H7BA 1PH2A 2L55A 4OXPA 3GTGH 4CGYB 1YNXA 2MQHA 1I94L 3I7FA 4B3TL 2F4VQ 4FO2A 4KHVA 2RDHA 5DEHA 5JJZA 2A6HD 5ELCA 4YCVA 3CMAA 3EA6A 5IYBG 1SXTA 4YWKA 2EYLA 4ZKBB 3NEMA 4DAMA 4QB4A 2WACA 5E4XA 1J9OA 2RCNA 1A3UA 1BO0A 1TKWB 4B3SQ 5JPNC 1QZHA 5LMNW 2UUAQ 2OCEA 3JC66 1L0XB 1X32A 2PCFB 4ZUJA 2NYZD 3AFQA 4PMWA 2VQFL 3IL8A 3J81L 2V4DA 3M9BA 3HOYG 3GTQB 1GM5A 3J7AF 4MTNA 1EYCA 2O5JC 4QMGA 2I5MX 1CHPD 1V1OA 5GAEC 1QG7A 3DHQA 1O80A 1X6OA 3TDQA 5ELOA 1XMOQ 4Q0FA 1EIYB 5IYDG 3FKIB 3FKIG 4PV1C 1KLGD 2YYZA 5I2YA 4LF7Q 1GUOA 4IFDJ 1LTID 4IOAA 4BWGB 4R4IA 5I9PA 1G2TA 3J7AV 1WTQA 4A93G 1RHPA 5LL6S 5IWAL 1EFID 4FNFA 3S17B 2B29A 5KNCA 1EUJA 3SVMA 2JJQA 1FGBD 4DF7A 3BS1A 3V96A 4POGA 3GTPB 2DGYA 1SNOA 4JI3L 1P8LA 3AU7A 4BS9A 1X3PA 1K9MC 1JR0D 1NUCA 4JW0A 5IGGA 3M4PA 5J3BA 1ENFA 3T1YL 4APVA 4O1NA 4A3BG 3MXGA 4JI8L 4CKEA 3W3AA 4HIDA 2F0IA 2FMCA 4PZ8A 3T1HQ 2B8FA 3FHWA 2A8VA 1G91A 2HIXA 2HT1A 1KDAA 2K33A 3O13A 1KAWA 1ENCA 5C3EB 1EY4A 2HQLA 4A76A 1Y1VH 4C3IB 5H1SE 3BYTB 3PF5A 1VQMA 2X6LA 1JB7A 3N52A 4JK1C 2NVYB 2EYJA 3TS0A 2E2HH 2F0GA 4LFCQ 1STNA 2CW0C 1XTDA 3H3VI 1W2BA 4F87A 3GTMB 5FO7B 2JXMB 2F03A 1PH8A 3A54A 4O0AA 4OIKA 1EZ8A 4O2DA 5C44G 3OMGA 2EPBA 4DUZQ 1PVOA 3E9HA 3H3VH 1IYVA 2SEBD 1XX8A 2A68C 2LY7A 1HRJA 2G9HD 1JOKA 1PYWD 4HJ8A 2B39A 4UP8A 2LSSA 4LF4Q 1PFSA 4YHHL 1K8MA 4DR4Q 4LF5Q 3H6MA 1IHZA 3PSIA 1EIGA 5J39A 4JBMA 2I07B 4R8NA 4FF1A 5FLMH 2C35B 3TP6A 1CZWA 1EQRA 2TSSA 4BXXH 4A3DG 4A3DB 2E74C 1SYEA 1HFGA 1CHQD 4WJ4A 3S1RH 1AE2A 2L11A 3S14B 4LJZC 3NBHA 4DV3Q 2WB1E 4XYQA 5C0XH 3VYTA 3VR2A 1KQSA 3VA7A 2NVQH 3I4NG 1SYDA 3AYHB 2AUKA 4C3JH 1JJCB 3SK4A 1QE6A 1B70B 1Y1VG 2NVTB 4P75A 1EIFA 4TQUS 5IYDH 1UEBA 2I46A 5COYA 2PMZE 3NWSA 1WYDA 1XMQL 4ZCKA 3HOUG 2KEEA 4GNXC 1EWIA 1OO9B 3E3XA 1S5DD 4FP5D 3CCEA 4LF8Q 4JI1L 2N88A 1DONA 3I4LA 3V05A 1TVXA 1C4QA 1CI3M 4JI3Q 3MVVA 3HP3A 1CA5A 4EVOA 2XWBB 4C1NK 4F8MA 1GUNA 4EX5A 1X55A 2AKWB 2OQKA 3SR1A 4IPDA 2CQAA 4CJ1B 4OONA 2K7VA 1V1PA 2A6EC 2OEOA 1ESRA 4TRDA 2IJ0A 4DAVA 1H9RA 3A8IE 3MAQA 4DFAA 4CKBA 5CYUA 3PV0A 1IYJB 2QEXA 1CM9A 4K5VA 1GHJA 2IHFA 3SE0A 3UE0A 1Y1WG 4K5WA 3CCVA 3GTOH 3I70A 5JJIA 1AH9A 1V1PB 2R7ZG 3RLFA 4DAYA 4QL5A 1STEA 1QZGA 1HQMC 1YNNC 1HNWQ 2Y0SB 1MGSA 1NAPA 4C3JG 2B2TC 1F77A 3ULPA 3L2PA 1VQJA 3E6ZX 1IZ6A 1U5KA 3PUXA 2IPKD 5ELBA 4A93H 1KDBA 5FOBB 5FO9B 5DAUA 4IUNA 5HY6A 2WAQB 1WFQA 3PUYA 4BBRG 3ULJA 4ZQ3A 3AFPA 1GKHA 1D1KA 2ICEC 1QCBD 3QOLA 1I4QA 4KTAA 1LTLA 1GHKA 2MNAA 3M4QA 1B7YB 1E7ZA 2ZTCA 4X66Q 1ZEQX 1HA6A 3NBIA 2UXCL 3RLOA 3SK6A 5J22A 4DUYQ 1UE1A 1D1IA 2E8GA 4JI0Q 3OSOA 3LGJA 3STBD 1U9RA 3DMUA 4A4IA 3EQLC 5NUCA 4JOIA 2EY2A 3HOXG 3CQZB 2VS1A 2B3GA 1AFPA 1EQTA 3GTJH 3M7NA 4WFN3 5IODA 4LUZA 1CT1D 1YJNA 1KL9A 1PZKD 1O7ZA 3QOJA 4JYAL 1MI2A 4WRDA 4G7OC 2L0CA 3I90A 3UDIA 1I50B 3HKZE 1UE7A 3L9AX 4OEMB 5I9OA 4CDEC 1IBLL 1PH5A 1RCVD 3K58A 1I3QB 2A6HC 3J81E 5IIFA 2BDNA 4LWCA 1EIHA 5EPKA 1QVFA 2CQOA 1TWHB 5M3FB 1F9PA 3W2DA 2XN9C 2KCTA 5FO8B 2F0NA 1KHIA 2YTXA 2Z8LA 1MBYA 3GTKH 1VF7A 2FMMA 1J5EQ 1X3EA 1IL2A 4HMIA 1EQVA 1N34L 4M1UB 1UE6A 2VQEL 3TSSA 1AEXA 1BKBA 2CKZB 1Y8NB 1Y69U 2KENA 5CC4A 2QILA 2MJ8A 4B3RL 1BBUA 4IUVA 1KDCA 2K14A 1R4QB 1A8VA 1Q90A 3MWYW 4CDCC 2F3WA 5I2XA 4P2CB 1ET6A 1SYBA 2KEDA 2XNAC 1EY9A 1LV9A 4K8IA 2JA7G 3CC7A 1G6PA 5F2DA 4KHZA 1YJWA 2Y0SG 4BBSH 1BBXC 1R4PB 5HURA 1HUMA 3HOWG 4DK3C 2LKVA 1EZ6A 2NZHA 3CAMA 4Q5VA 1BF4A 1O7YA 2KA7A 1HZAA 2Q8IB 3HOVH 2PW7A 2GN5A 1MJEA 3R2TA 4L5SA 4YY3Q 1BCPD 1DD2A 3NBHB 3WDNA 5K36G 2KCNA 4A3KB 5D65A 5FJ8G 2JA8G 2Z6BA 1FVIA 2R7ZB 1CSPA 1KNEA 4UP9A 1HPCA 1RD9D 5M5WB 1EEID 1WTPA 1HNXL 2PI2E 2UUCL 1W6JA 1I3QH 2UXCQ 1FJGQ 4JI0L 2F0UA 4LFBL 2BCOA 4JI2Q 5GAHC 5C4JH 1STHA 3RNUA 4JV5Q 2EOTA 5C3EH 3T53B 1KABA 3V2TA 1YVCA 4RKLA 1PH9A 2NBFA 2HDLA 1VQFA 5IY0A 1LM0A 4DR5Q 1WTXA 2JA6H 3B6YA 3KBGA 2RVLA 1DZ1A 4QIWB 1B8AA 1TWFH 2V1CC 1NBWA 1L0WA 4A3MG 2BH2A 3DWQA 1LTSD 4LF9L 3I2ZA 3BYYB 1IYUA 2L12A 2EYOA 4G7ZC 1NSNS 1EY7A 2ZXPA 3GTJB 1TXYA 4KN7C 3PMFA 4HR7B 1PH3A 5DNFA 2WAQE 1JJ2A 2ZXRA 2UXDQ 2OT2A 2BOSA 3J81i 2CHBD 1CUKA 1ENAA 4A3EG 3PUWA 1XMQQ 1CKNA 2WINB 3K0YA 2F0PA 1PH6A 1CZGA 1PTOH 4XDXA 4YWLA 1BR9A 1TR5A 1AZQA 3J81j 3I4MG 3EVQA 2KCMA 4OL7A 2F0OA 3QWNA 4XXEA 3GQBA 4IPGA 3RUZA 1I94Q 4GZYC 2B2VA 1D5ZC 3PQIA 4UDUC 1ASYA 3EBEA 5EJWA 2H1EA 4BBSB 2HUGA 4RGNA 3IFDA 5KGUA 4OGQC 3CKIB 1Q86C 1SJED 4DK0A 1QOHA 1HZCA 3RZDB 2UUBQ 4DR4L 2DY7A 3S2DH 5G3LF 2Q2IA 2Q2HA 1MKHA 1KRTA 2KHSA 4JC0A 4A3FB 3OTOQ 5KYIA 1TWAB 4UHVA 4YWMA 1LTAD 1C7YA 4A3CG 2UXBL 1SLJA 3H09A 3CF5A 1JB3A 4C3HB 2PYKA 3J7ZC 3DXJC 3T16A 4A3LG 4GOPA 1E24A 1RODA 5IGFA 3I8ZA 1WCMG 3BDOA 4C3HH 2E75C 2WB1G 2EYPA 3K81C 1FNUA 1MD2D 1Z7TA 2Z4HA 4A3IH 1W6KA 1HA5A 4ZK9B 1EY5A 1V9PA 2LMCB 1I4PA 2F0QA 4DNRB 4DU9A 3ND8A 1G2SA 3NQTA 4HSVA 1HQRD 1LT6D 1TS5A 2MHVA 5E1FA 4ZKCB 2HIVA 3JAMc 4HN7A 4KKSA 4JI2L 1TS3A 2JEBI 3KF8B 1IBKL 5ELDA 2C5CA 5FLXE 1HNXQ 2BDOA 4AYBG 1LT5D 4X66L 1D2BA 5EPLA 5CV5A 1BBWA 5LMNL 2SDFA 1RIPA 4DR3Q 1XJVA 2JA8B 1E22A 1U4MA 1SDFA 1VMPA 1TWAH 4U68A 2AQ2B 2KHJA 2F0KA 1EYDA 1PH7A 1YHQA 3DUZA 2B2UC 1LABA 3MXPA 5KRUA 5FLXc 1GUWA 1IKLA 5CMDA 1H95A 4X65Q 3S15B 3Q0AA 4FF2A 3IFTA 3FKIH 3K5OA 4KN4C 2B63G 1DOLA 1VQNA 2JA7H 5GQOA 4A93B 2C9OA 4I7ZC 4IO9A 2RBMA 4L63B 2R93H 1EY6A 3HOWH 3A74A 2CH4W 1N8RC 2K5HA 2RSNA 2N55A 4IOCA 1JMCA 1PLFA 2XSCA 1VMCA 2NVQB 1G291 4K2LA 1S4ZA 3BJUA 4X3KA 4X64L 1X56A 5IT9E 3OWEB 5ELNA 3UI2A 4A3BH 2JK8A 2Q2UA 3NENA 2Z6KA
chains in the Genus database with same CATH topology
1H9MA 5T1GA 1KTKA 3NTIA 1JCKB 1WCMB 4KJOA 3A56A 3DEOA 3NUCA 3M85A 1F9SA 2EY1A 3P75A 3FEWX 2MUYA 4DXGA 4RFBA 1IW7D 1EYAA 3GTOB 2SNSA 3BDLA 1U4LA 3QG1A 4KD4A 2ICIA 2DNCA 2PMZB 4DN4M 5JPMC 4DNTB 5D3DA 2K5QA 2IL8A 5C0XI 4PMBA 3VR5A 2BA1A 3K6OA 3TZDA 1TY0A 3TMEA 1U4RA 3J7YW 1EU4A 4MIUA 3HOWB 3CRKC 1C48A 3X3MA 4K5XA 1O78A 1SNMA 4EQNA 1SJHD 5T1IA 4RKBA 3OHXC 5BN5A 4G7HC 4FXDA 4K2KA 2NTTA 3MXNA 1EWCA 3KLRA 4HAEA 2HCIA 1FR3A 1JQYD 1ZKOA 4NKLA 4KY7A 2EZVA 4PQXA 3KUPA 2QKIC 4OHJA 1ICWA 1BDOA 4K6DA 3DM1A 2F0FA 1EWHA 5JEAH 1SYCA 1E0BA 4IUPA 1B2TA 3ONAB 1E2ZA 3K5MA 1Y8OB 1SMYC 3P20A 4LAAA 1OXSC 2AWOA 2XRQD 3FDTA 3A7AB 3PUVA 3SK8A 5I6YA 3BVMA 1TS2A 1D6EC 2EDGA 3OW7A 5EKKA 2O5IC 4Y7NB 1FYCA 3TBIB 3PO3B 1JWSD 1SE2A 1U4PA 3N6RA 2M2LA 1Q3LA 4DGZA 5C3XA 4RGMA 1LTBD 1B1ZA 3SDZA 1JORA 4RCNA 1KNAA 4BBRB 3NWTA 4ILWA 1JWMD 1PZID 4Z9CB 2X69A 5LL6X 1K83B 1IKMA 1E2WA 2AWNA 1E2VA 5JEAJ 2VUMB 4BA1I 2WKCA 2BE5C 1ONLA 3TP5A 4EGVA 3OWFA 1DYQA 2NTSA 3QIAA 3A8KE 1PDQA 3LX0A 1ZXTA 1Y1WB 2F0WA 3HOZB 2A73B 2K04A 2RQXA 1F2YA 1PMRA 4FF3A 1JC7A 2EY5A 3I3CA 2OXPA 3K7AB 4RH6A 3KLSX 1NR4A 2JSOA 1EU3A 2WKDA 4ID6A 5JAVA 1KLUD 1QNUA 5C5MA 3NE5B 1H9JA 1Y1VB 2K32A 5M3MB 3GTKB 1CTMA 4RGOS 2DY8A 5G3LD 3GV3A 4MN3A 5JEAG 3IAYA 1BCPC 2KOLA 4IUUA 5C4XB 1TQOA 2FFKB 1EY8A 3C46A 3SK5A 4CKCA 1XYIA 1B9MA 2PW5A 5M9OA 2FINB 4EQPA 5D14A 3J80E 3D4RA 3I72A 3RMHA 1TT2A 3OPOA 3K5LA 2B8GA 2LFNA 2L5TA 2DNEA 3BDCA 5CV6A 1CA6A 1A3VA 1GUGA 2H4OA 1AN8A 1MSHA 4C2MB 1UAPA 4RWSC 2NWGA 3VYUA 1K8OA 4ZUIA 3D31A 5E4WC 3P1HA 1XXGA 1LTGD 4CBVA 1DOMA 2Z4IA 2A6ED 1XWEA 2R3ZA 5CV7A 2MGSA 2AQ1B 1TIID 3BVGA 4ME5A 4QUFA 5KIXA 2QCPX 5ELEA 3TP8A 2R92B 3DWPA 5KNDA 1OXVA 4B9WA 3S16B 5BN4A 3I73A 2E2IB 2SNMA 2RDGA 2F3VA 3Q22A 3KF8A 3M4OB 3OIQA 4F88A 3HZXA 2E2DC 3MHBA 5JOBA 1PRTC 1ESFA 2HQEA 2XIWA 3GTGB 1A6XA 4ZLTF 2NVXB 2F0DA 5C0XJ 3I4MB 4C56C 2B2TA 2FJ2A 5KEEA 4DK1A 4L8JA 1STAA 2NN6I 3M3YB 1I6HB 3I4NB 4LK1C 4RCOA 2Q8TA 4FYDA 2Z1CA 5IOCA 1JICA 5K5PA 5A35A 4FXGC 1HTPA 3HOUB 1BCPF 4IQZA 1Y8PB 4X3UA 3S1MB 5C6AA 4IFDI 3SXHA 2IX3A 2IX1A 5JVH3 1QJOA 2L9HA 1XTCD 5BN3A 2IWHA 3D6WA 1TWCB 4RHRA 1DJRD 3R3OA 1LLRD 1EY0A 3E0JA 2B2WC 2HCCA 4E6IA 3TZUA 2K5DA 2A74C 4QF4A 5CORA 1CQFA 3PO2B 3HEJA 4KV6A 4IZ8A 3R2IA 3RD4A 5I4DA 2E76C 1JWUD 5A2QL 1Q1EA 5IT9L 1O7LA 1T5EA 4ZAIA 1KAAA 3H0GB 1SNPA 2K5WA 4ZRZA 3K57A 1V8QA 1WTVA 1PFBA 1WTRA 2XVSA 1F9RA 3LWEA 4IALA 1I4XA 3K5NA 1L0YB 3VYSA 4IFDG 2EJMA 3CHBD 1GUTA 2CW0D 3CRLC 1V43A 3U9SA 1S5BD 1Z6HA 3T51B 5A2QE 3JAML 3T56B 4XYOA 2L4NA 1TY2A 3GD7A 3LWUA 3ZYYX 1DOKA 3QB3A 1M4VA 1OXXK 1J8IA 3C1FA 2NN6G 1TWFB 1S5ED 1NCVA 4A3GB 2KECA 1FNWA 5EGTA 4IUTA 3GP7A 1OXUA 1X3QA 5EKIA 4RA8A 1SNDA 1Q1BA 3NTKA 4KJNA 4H44C 1QB5D 1T5XD 1SYFA 1BCPB 2B2YA 1YNJC 3HG9A 2K05A 2E2JB 3AMUA 2R61A 2WV6D 5DM73 2K6AA 3VYRA 5EKLA 5EQ0A 2EYFA 5AFWA 4NW2A 4WJWA 1SE3A 3S1NB 2ID0A 1ML0D 2PZTA 1Q12A 4S3SA 5LHY1 2PPBC 1B3AA 2AUJD 1JOOA 1OXTA 4QCLA 2JYOA 2CVRA 4OO1I 2EVBA 1GOZA 4OIJA 2M00A 3ND9A 1LT3D 4X3TA 4R8IA 3G7LA 3GO5A 1STBA 3NXWA 3DEPA 2HDMA 5C4ZA 1SYGA 3H91A 1JOQA 4LMQD 3KBXA 5CBEE 3KK7A 4A3IB 4I65A 5C4JB 1II3A 4C3JB 2PZWA 1A2UA 2D9UA 4XQJA 1SBBB 5C4HA 1UEAB 3MTSA 4G4KA 4ABNA 3RZOB 2O2LD 2YU9B 3L7ZC 3X3NA 1WTWA 5JVG3 2L1BA 3MFGA 1NR2A 1Z47A 4A3MB 2RDFA 1UNSA 4WORA 5IGEA 3DWAA 3HOXB 2KJXA 1AP0A 1PXUA 3P7JA 2K03A 3PIO3 4XT3B 5D3IB 5FKAC 5C0XG 1CQVA 3NPPA 4TSSA 5K36H 3PUZA 4KD3A 4KKUA 1FD7D 1WD1A 3G6JB 1EOTA 1I6VC 3M4YA 1QNKA 4RAUC 3J80L 1A2TA 1HTLD 5HGTA 2F0HA 3NP8A 5EBCA 4N9TA 1EL0A 1TS4A 1F9QA 2K28A 3S9WA 3M7GA 5CBAE 2EYHA 4JBWA 5M5XB 1SFOB 5ISRA 1A3TA 4RGTA 5DM63 3TN2A 1M8AA 1I4RA 5EBDA 3E5SA 2F0EA 3A55A 3NHHA 3FVQA 1ILQA 2EY6A 1TU2B 3EROA 2B2UA 4TKOB 3U9OA 2ENBA 3EFXD 1YNJD 3HKZB 2GA4B 4CJ0B 2WIIB 1MSGA 4XQQA 3VA5A 1CFMA 2KCCA 2PNRC 2EJGC 1DXMA 1PFMA 1PTOD 3TP7A 2PQEA 4IFDH 1SMYD 3BZDB 3VR4A 4F7XA 1SE4A 4J1MA 1STGA 5FK9C 2SOBA 1AW7A 2F1MA 3S2HB 2EE1A 1SSOA 5CV9A 3A7LA 3WOFA 1BNZA 2K01A 4B9XA 1GJXA 2F0MA 3OIPA 2A69C 4M8AA 4H0LC 1F2MA 3S1QB 1D5XC 2LS01 3F2UA 3FPPA 4J8QA 2XWJB 4HEDA 2X6GA 4NMZA 3Q24A 1HCZA 2KUMA 4L6TB 3T13A 5TSSA 2EYMA 3HOYB 1RDPD 4CJ2C 5CGKA 3FRPB 1QWYA 1HHVA 4DAPA 2JE6I 3D8GA 4B08A 3NQIA 2F0LA 1ZYRC 4N9PA 2G9DA 3Q6SA 2TMPA 2KQ3A 1PTOB 2MPMA 1RTOA 4R9WA 2D62A 1B44D 3KLSA 5J1ZA 1S5CD 1B9NA 5E3FA 3URYA 5CV4A 3BVZA 1BOSA 4UAIA 2D2CC 1HXYD 2R93B 3IKJA 4BY7B 2BE5D 4A3JB 1ET9A 1VCIA 1H9SA 2J7ZA 2IW3A 2WB1B 2NZ1D 3MXUA 3WOEA 3H94A 1LO5D 2JA7B 2A5HA 3PIP3 1JE4A 1IL8A 3CU7A 2XRSD 2RA4A 5ELFA 2WP8J 4IUQA 2NB0A 5IGDA 4XTCS 5IGBA 3GTLB 3FPUB 3MFYA 3SHLA 1ZYRD 1PTOC 2F0VA 2B2YC 3MA2B 3HOVB 1F2ZA 4BY1B 4AYBB 3BG3A 3I91A 3NK9A 4G57A 4DXFA 2B2VC 1B53A 4QUCA 3OMCA 3A8JE 1SEBD 4J6HA 3D6CA 4NDXA 2K1BA 1H9KA 3S2DB 2QF7A 3NSWA 2JP1A 2AQ3B 4EQOA 4KI0A 4CHTB 1TWGB 1STYA 2A69D 2M9VA 2IX0A 2QDBA 1GXDC 3GV6A 3Q23A 4OO1G 4IN3A 4YIJA 3H3VC 1C8CA 4A3EB 4PMCA 3SEBA 1WVLA 2VB2X 1LT4D 1VF5C 1RKNA 4KY5A 2B63B 4HCSA 4V190 3R93A 3D4WA 1R9TB 4K8JA 1DM0B 2VXWA 3T4AC 4XT1B 4BA2I 1ILPA 1PRTB 5FLXL 4DA2A 4HTHA 5KYLA 1B4OA 1RTNA 2EJFC 3ERQA 4H13C 4K6LA 3ITPA 5C44B 4X3SA 1QILA 3QO2A 2KVMA 3NTHA 3K59A 4MHEA 1EEFD 1FNVA 4C3IG 1HUNA 2B2WA 4O42A 2J0TD 5C5LA 4C3HG 2F0SA 5M5YB 2VB3X 4U673 4HCEA 4KKTA 2EXZA 2ZXOA 2NUCA 1LACA 1Q8IA 1IW7C 1G6ZA 3D3RA 5EPJA 1A15A 2JA6B 2Q8RE 1UUPA 4IURA 4ULLA 3VR6A 3HGBA 4FVMA 3VR3A 1BXTA 4V0BA 2VNUD 1LTTD 2BA0A 3C1EA 2NN6H 3FMCA 3LNNA 4XIGS 1WD0A 5I6WA 2O4XA 1WTOA 2RSOA 2FHTA 3EJIA 1PFNA 2QEJC 1F2LA 2DN8A 1SNQA 5CV8A 2RKSA 4ODGA 2MP1A 4FF4A 4FXKC 2ZT9C 4OO1H 2A68D 2R6GA 1D5MC 2PZUA 2F4IA 5IGCA 1SNCA 1PTOF 2F0TA 3C2PA 3R8BA 1LTRD 4C1NI 5CR3A 1PRTF 3HS0C 1YNND 1G8ZD 1HFNA 1I4GA 4ZYSA 3MEHA 5C3WA 1BUVT 4NP5A 2F0JA 1PZJD 1GUSA 2OF1A 3C3LA 2D5DA 4KY6A 1AZPA 4RHSA 2PO4A 3L3OC 4XQNA 2J4XA 4A3BB 1VDZA 4K14A 1I4HA 3JAME 1DCZA 3S1RB 2JA5B 2IT1A 5KNBA 1SAPA 3QJYA 2E2HB 4PNYA 4HMJA 3D4DA 1S5FD 4HSPA 2JEAI 3OOCA 1PRTD 1RJTA 1CK1A 1BQQT 1B50A 4KMUC 3AB9A 3HRZC 1H9SB 1RF2D 4KK7A 3MC0B 3MZ5A 4H7BA 2L55A 4CGYB 4FO2A 4KHVA 2RDHA 5DEHA 5JJZA 2A6HD 5ELCA 3EA6A 1SXTA 2EYLA 4ZKBB 4QB4A 2WACA 5E4XA 1J9OA 1A3UA 1BO0A 1TKWB 5JPNC 1L0XB 1X32A 2PCFB 4ZUJA 2NYZD 4PMWA 3IL8A 3J81L 2V4DA 3GTQB 3J7AF 1EYCA 2O5JC 4QMGA 1CHPD 1V1OA 1QG7A 3DHQA 1O80A 3TDQA 4Q0FA 3FKIB 4PV1C 1KLGD 2YYZA 5I2YA 1GUOA 4IFDJ 1LTID 4BWGB 5I9PA 1G2TA 3J7AV 1WTQA 1RHPA 5LL6S 1EFID 4FNFA 3S17B 5KNCA 3SVMA 1FGBD 4DF7A 3BS1A 3V96A 3GTPB 1SNOA 3AU7A 4BS9A 1X3PA 1JR0D 1NUCA 5IGGA 1ENFA 4O1NA 3MXGA 4CKEA 3W3AA 2F0IA 2FMCA 2B8FA 1G91A 1KDAA 2K33A 3O13A 1ENCA 5C3EB 1EY4A 4C3IB 3BYTB 2X6LA 3N52A 4JK1C 2NVYB 2EYJA 2F0GA 1STNA 2CW0C 3GTMB 4F87A 5FO7B 2JXMB 2F03A 3A54A 4OIKA 1EZ8A 3OMGA 2EPBA 1IYVA 2SEBD 1XX8A 2A68C 2LY7A 1HRJA 2G9HD 1JOKA 1PYWD 2B39A 1K8MA 3H6MA 1IHZA 1EIGA 5J39A 2I07B 4R8NA 4FF1A 3TP6A 1CZWA 2TSSA 4A3DB 2E74C 1SYEA 1HFGA 1CHQD 2L11A 3S14B 4LJZC 3NBHA 4XYQA 5C0XH 3VYTA 3VR2A 3VA7A 1SYDA 2AUKA 3SK4A 1QE6A 2NVTB 4TQUS 2I46A 5COYA 3NWSA 2KEEA 1OO9B 4FP5D 1S5DD 2N88A 1DONA 3I4LA 3V05A 1TVXA 1C4QA 1CI3M 3MVVA 3HP3A 1CA5A 4EVOA 2XWBB 4C1NK 4F8MA 1GUNA 3SR1A 2CQAA 4CJ1B 2K7VA 1V1PA 2A6EC 2OEOA 1ESRA 4TRDA 2IJ0A 4DAVA 1H9RA 3A8IE 3MAQA 4DFAA 4CKBA 5CYUA 3PV0A 1CM9A 4K5VA 1GHJA 3SE0A 4K5WA 3I70A 1V1PB 3RLFA 4DAYA 1STEA 1HQMC 1YNNC 2Y0SB 1MGSA 1NAPA 4C3JG 2B2TC 1F77A 3E6ZX 3PUXA 2IPKD 5ELBA 1KDBA 5FOBB 5FO9B 5DAUA 4IUNA 2WAQB 3PUYA 4ZQ3A 1D1KA 2ICEC 1QCBD 4KTAA 1I4QA 1GHKA 1ZEQX 1HA6A 3NBIA 3SK6A 5J22A 1D1IA 3OSOA 1U9RA 3DMUA 3EQLC 5NUCA 2EY2A 3CQZB 1AFPA 1EQTA 3M7NA 4WFN3 5IODA 1CT1D 1PZKD 1O7ZA 3QOJA 1MI2A 4WRDA 4G7OC 2L0CA 3I90A 1I50B 5I9OA 3L9AX 1RCVD 3K58A 1I3QB 2A6HC 3J81E 5IIFA 2BDNA 1EIHA 5EPKA 1TWHB 5M3FB 1F9PA 3W2DA 2XN9C 5FO8B 2F0NA 2Z8LA 1MBYA 1VF7A 2FMMA 4HMIA 1EQVA 4M1UB 3TSSA 1AEXA 1Y8NB 1Y69U 5CC4A 2QILA 2MJ8A 4IUVA 1KDCA 1R4QB 1Q90A 3MWYW 2F3WA 5I2XA 4P2CB 1ET6A 1SYBA 2KEDA 2XNAC 1EY9A 1LV9A 4K8IA 5F2DA 4KHZA 1BBXC 1R4PB 5HURA 1HUMA 2LKVA 1EZ6A 4Q5VA 1BF4A 1O7YA 2KA7A 2Q8IB 2PW7A 3R2TA 1BCPD 1DD2A 5K36G 3WDNA 2KCNA 4A3KB 5D65A 2R7ZB 1KNEA 1HPCA 1RD9D 5M5WB 1EEID 1WTPA 1W6JA 2F0UA 2BCOA 1STHA 2EOTA 3T53B 1KABA 3V2TA 4RKLA 2NBFA 2HDLA 1WTXA 3KBGA 2RVLA 1DZ1A 4QIWB 3DWQA 1LTSD 3BYYB 1IYUA 2L12A 2EYOA 4G7ZC 1NSNS 1EY7A 2ZXPA 3GTJB 4KN7C 3PMFA 4HR7B 5DNFA 2ZXRA 2OT2A 2BOSA 2CHBD 1ENAA 3PUWA 2WINB 3K0YA 2F0PA 1CZGA 1PTOH 4XDXA 1BR9A 1TR5A 1AZQA 3EVQA 4OL7A 2F0OA 3QWNA 4XXEA 3GQBA 3RUZA 4GZYC 2B2VA 1D5ZC 4UDUC 5EJWA 2H1EA 4BBSB 2HUGA 4RGNA 3IFDA 5KGUA 4OGQC 3CKIB 1SJED 4DK0A 1QOHA 3RZDB 2DY7A 5G3LF 2KHSA 4A3FB 5KYIA 1TWAB 1LTAD 3H09A 1JB3A 4C3HB 2PYKA 3DXJC 3T16A 1RODA 5IGFA 3I8ZA 3BDOA 2E75C 2EYPA 1FNUA 1MD2D 1Z7TA 2Z4HA 1W6KA 1HA5A 4ZK9B 1EY5A 2LMCB 1I4PA 2F0QA 4DNRB 4DU9A 3ND8A 1G2SA 3NQTA 4HSVA 1HQRD 1LT6D 1TS5A 2MHVA 5E1FA 4ZKCB 4HN7A 4KKSA 1TS3A 2JEBI 5ELDA 2C5CA 5FLXE 2BDOA 1LT5D 1D2BA 5EPLA 5CV5A 2SDFA 2JA8B 1U4MA 1SDFA 1VMPA 4U68A 2AQ2B 2F0KA 1EYDA 3DUZA 2B2UC 1LABA 3MXPA 5KRUA 1GUWA 1IKLA 5CMDA 3S15B 3Q0AA 4FF2A 3IFTA 3K5OA 4KN4C 1DOLA 4A93B 2C9OA 4I7ZC 2RBMA 4L63B 1EY6A 2RSNA 2N55A 1PLFA 2XSCA 1VMCA 2NVQB 1G291 4K2LA 1S4ZA 4X3KA 5IT9E 3OWEB 3UI2A 3QOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H9M A;  4KKT A;  3BDO A;  3NE5 B;  1H9J A;  2E75 C;  2E76 C;  1LAC A;  2K32 A;  1Z7T A;  1E2Z A;  4TQU S;  1Y8O B;  1IW7 C;  1Q12 A;  3EQL C;  1HPC A;  1VDZ A;  2PPB C;  1DCZ A;  1Q1E A;  1SMY C;  1HCZ A;  1O7L A;  1T5E A;  2AUJ D;  3P20 A;  1OXS C;  2AWO A;  2LMC B;  3A8J E;  2IT1 A;  1OXT A;  1CTM A;  4DNR B;  5KNB A;  3QJY A;  3ND8 A;  3A7A B;  3PUV A;  3M7N A;  1H9K A;  3M85 A;  2JEA I;  4JBW A;  1A6X A;  3OOC A;  1V8Q A;  3W3A A;  5JEA G;  2EVB A;  2QF7 A;  3T53 B;  3BG3 A;  2JE6 I;  4KMU C;  3OW7 A;  2EDG A;  3AB9 A;  2O5I C;  3ND9 A;  4G7O C;  1H9S B;  4KI0 A;  1IW7 D;  2B8F A;  1FYC A;  4KKS A;  2JEB I;  2A69 D;  3VR6 A;  3HGB A;  4DK1 A;  4L8J A;  4IFD G;  1B9M A;  3I4L A;  2EJM A;  3QG1 A;  2NN6 I;  1ZYR C;  1GUT A;  2A6H C;  2K33 A;  3VR3 A;  1CI3 M;  3CRL C;  2BDO A;  2DNC A;  4LK1 C;  2BA0 A;  1V43 A;  3U9S A;  4JK1 C;  1IYU A;  3D4R A;  4DNT B;  2NN6 H;  1TU2 B;  2D62 A;  3FMC A;  1Z6H A;  3LNN A;  3N6R A;  1GUN A;  3I72 A;  3T51 B;  1VF7 A;  5A35 A;  4OO1 G;  4KN7 C;  4TKO B;  1HTP A;  4HR7 B;  4XIG S;  3T56 B;  2A6H D;  2CW0 C;  2K7V A;  3SDZ A;  2A6E C;  3OPO A;  4IQZ A;  2B8G A;  3GD7 A;  1B9N A;  3LWU A;  2JXM B;  1Y8P B;  4RCN A;  2BA1 A;  3PUW A;  1H9R A;  3VR5 A;  3A8I E;  1CFM A;  1Y8N B;  2L5T A;  2DNE A;  1OXX K;  2KCC A;  1Y69 U;  1TKW B;  3PV0 A;  1LAB A;  2NN6 G;  2D2C C;  3L7Z C;  1VF5 C;  1GUG A;  1IYV A;  2DN8 A;  2PNR C;  3IKJ A;  2A68 C;  1GHJ A;  2EJG C;  3SE0 A;  2PCF B;  2BE5 D;  1DXM A;  1Q90 A;  3IFT A;  4KN4 C;  1OXU A;  3CRK C;  3GQB A;  1E2W A;  1K8M A;  1E2V A;  1VCI A;  1QJO A;  1H9S A;  5BN3 A;  4IFD H;  3RLF A;  1K8O A;  2V4D A;  3D31 A;  4BA1 I;  2BE5 C;  4GZY C;  3VR4 A;  2ZT9 C;  1O78 A;  1Q1B A;  1ONL A;  2A68 D;  1HQM C;  1YNN C;  3MXU A;  4H44 C;  2R6G A;  4BA2 I;  3FPP A;  4I7Z C;  2O5J C;  3H94 A;  2EJF C;  4OO1 H;  2A6E D;  4H13 C;  4KHZ A;  3QIA A;  1YNJ C;  3A8K E;  5BN5 A;  4G7H C;  3PUX A;  2YYZ A;  4PV1 C;  1GUO A;  2E74 C;  2F1M A;  4OGQ C;  4DK0 A;  3TZU A;  5C0X G;  4XTC S;  3KLR A;  4G7Z C;  5KND A;  1G29 1;  3PUY A;  3PUZ A;  5K36 H;  1OXV A;  3A7L A;  2KA7 A;  1FR3 A;  1PMR A;  3MFY A;  1ZKO A;  4KKU A;  4LJZ C;  2Q8I B;  1GJX A;  1GUS A;  1I6V C;  3M4Y A;  5C0X H;  1GHK A;  1DD2 A;  2A69 C;  2D5D A;  3VR2 A;  3WDN A;  5KNC A;  5K36 G;  4H0L C;  3DXJ C;  3VA7 A;  1BDO A;  3I73 A;  5BN4 A;  1EWH A;  5JEA H;  2AUK A; 
#chains in the Genus database with same CATH topology
 1H9M A;  4A3K H;  5T1G A;  4DR1 Q;  4JI7 Q;  1KTK A;  3NTI A;  1JCK B;  1WCM B;  4PG3 A;  3GTL H;  2OWO A;  1VQ5 A;  4KJO A;  4A3L H;  3A56 A;  3DEO A;  3NUC A;  3M85 A;  5FLM G;  4BBS G;  1F9S A;  2LXK A;  3OTO L;  2EY1 A;  2YTY A;  3P75 A;  4BXX G;  3FEW X;  4JYA Q;  1C0A A;  1CKO A;  2MUY A;  4DXG A;  4MNO A;  4RFB A;  1IW7 D;  1EYA A;  4H02 A;  4IJL A;  1K73 C;  3GTO B;  4A3M H;  2SNS A;  4GKJ L;  5M5X H;  3UDF A;  4HIO A;  3BDL A;  1U4L A;  3QG1 A;  4KD4 A;  2ICI A;  2ZJR A;  2DNC A;  2PMZ B;  4DN4 M;  2B63 H;  5JPM C;  2ZM6 Q;  4DNT B;  1Q7Y C;  2YU9 H;  5D3D A;  3CQZ H;  4A3E H;  4BY7 H;  3CCJ A;  2K5Q A;  2IL8 A;  5C0X I;  1VQL A;  4PMB A;  2G5D A;  3VR5 A;  3RR5 A;  2BA1 A;  3K6O A;  3TZD A;  1TY0 A;  3TME A;  1N36 L;  4B3S L;  1U4R A;  3J7Y W;  1EU4 A;  1VQA A;  4A3J G;  1RL2 A;  4MIU A;  3HOW B;  5LMN Q;  3CRK C;  1C48 A;  4LFB Q;  3X3M A;  4K5X A;  1O78 A;  4R4T A;  1SNM A;  4EQN A;  1SJH D;  4GN4 B;  3CPF A;  4OWT B;  5T1I A;  4RKB A;  3K0X A;  1A0I A;  3OHX C;  5GRO A;  5BN5 A;  4G7H C;  4FXD A;  4QGU A;  4K2K A;  2NTT A;  3MXN A;  1WJJ A;  1EWC A;  1G51 A;  3KLR A;  4HAE A;  2HCI A;  1FR3 A;  1JQY D;  1ZKO A;  4EQ5 A;  3OW2 A;  4DV1 L;  1HR0 L;  3I55 A;  3K7A H;  4NKL A;  4KY7 A;  4YY3 L;  2EZV A;  4PQX A;  4A3F H;  3KUP A;  2QKI C;  4OHJ A;  4GOP C;  4N8F A;  1ICW A;  1BDO A;  5AJ3 L;  4K6D A;  3DM1 A;  2F0F A;  2GVB A;  1EWH A;  5JEA H;  1SYC A;  1VQ4 A;  4YCU A;  1VQK A;  1E0B A;  4IUP A;  1B2T A;  3ONA B;  1E2Z A;  3K5M A;  5E7N A;  1Y8O B;  2A19 A;  4OWX B;  2QA4 A;  1SMY C;  3P20 A;  4LAA A;  4NB3 A;  1OXS C;  2AWO A;  2R7D A;  2XRQ D;  3FDT A;  3A7A B;  3PUV A;  4A75 A;  4FDB A;  1L1O B;  3I56 A;  3SK8 A;  5BR8 L;  5I6Y A;  2ES2 A;  4X6A H;  3BVM A;  4JG2 A;  1IBK Q;  4X64 Q;  1TS2 A;  1D6E C;  2EDG A;  3A0J A;  3OW7 A;  1DGS A;  5EKK A;  2O5I C;  5C4X H;  4DR7 Q;  4Y7N B;  3PO3 H;  1FYC A;  2D0P A;  3TBI B;  3KJO A;  3PO3 B;  3PO3 G;  2UUC Q;  3M4O H;  1JWS D;  3KLW A;  1SE2 A;  2ASB A;  1U4P A;  3U58 A;  4DNI A;  3N6R A;  3J7A 5;  4IPH A;  2M2L A;  1Q3L A;  2PI2 A;  1J6Q A;  4DGZ A;  3E0E A;  4P74 A;  5C3X A;  2DUD A;  3F2B A;  4RGM A;  1LTB D;  1B1Z A;  2ZM6 L;  3SDZ A;  4GN3 B;  1SE8 A;  1JOR A;  1HJP A;  4RCN A;  1KNA A;  3TS2 A;  1CKM A;  1QVG A;  4BBR B;  2K52 A;  4AQY L;  1SRO A;  3DM3 A;  4DUZ L;  4GS3 A;  4GOP B;  3NWT A;  4ILW A;  1JWM D;  1PZI D;  4Z9C B;  5C44 H;  3EIV A;  3HOZ H;  1VQC A;  4IJH A;  3W1B A;  4JOI C;  2X69 A;  5LL6 X;  1K83 B;  3KF6 A;  1IKM A;  1E2W A;  2AWN A;  1E2V A;  5JEA J;  2VUM B;  4A3F G;  4BA1 I;  2WKC A;  2BE5 C;  1ONL A;  3TP5 A;  4EGV A;  4PZ7 A;  3OWF A;  1DYQ A;  3Q8D A;  1L1O C;  1S72 A;  2NTS A;  3QIA A;  3A8K E;  1PDQ A;  3LX0 A;  1ZXT A;  1SFO H;  1Y1W B;  2F0W A;  3HOZ B;  2NVX H;  2A73 B;  1M1K C;  4K0K L;  2K04 A;  2RQX A;  1K83 H;  1F2Y A;  3GTQ H;  5M3M G;  4DUY L;  3RZO H;  1PMR A;  4FF3 A;  1VS0 A;  1P16 A;  4DV3 L;  1JC7 A;  2EY5 A;  3I3C A;  2OXP A;  3K7A B;  4RH6 A;  3F2C A;  3KLS X;  1NR4 A;  2JSO A;  2LXJ A;  1EU3 A;  2RHS B;  5M3F G;  3RN2 A;  3PGZ A;  2WKD A;  4ID6 A;  5JAV A;  3J81 c;  1KLU D;  1QNU A;  5C5M A;  3NE5 B;  1H9J A;  2DJG C;  1Y1V B;  4C3I H;  2K32 A;  5M3M B;  1Q81 C;  4BY1 H;  3GTK B;  4OEL B;  1CTM A;  3S14 H;  4KHP Q;  4RGO S;  1IBL Q;  2DY8 A;  5G3L D;  3GV3 A;  4MN3 A;  4QQB X;  5JEA G;  3IAY A;  1BCP C;  2KOL A;  4MZ9 A;  4IUU A;  4DV4 L;  5C4X B;  1TQO A;  2FFK B;  1EY8 A;  4CDD C;  3C46 A;  2E2J H;  3SK5 A;  4CKC A;  1XYI A;  1A62 A;  1B9M A;  1GD7 A;  4OX9 L;  2PW5 A;  5M9O A;  1VQ8 A;  2YV5 A;  1VQB A;  2FIN B;  1ICF B;  4EQP A;  5D14 A;  3J80 E;  2CWP A;  3D4R A;  1X54 A;  3I72 A;  5BR8 Q;  1FL0 A;  3ICE A;  3RMH A;  1TT2 A;  1KIX A;  4HIM A;  3OPO A;  1MIU A;  3K5L A;  4GNX A;  2B8G A;  2LFN A;  2L5T A;  2DNE A;  3BDC A;  5CV6 A;  3AEV A;  1CA6 A;  3ULL A;  1A3V A;  1GUG A;  5IYC H;  2RF4 A;  4DV2 L;  2H4O A;  1QUQ B;  1YZ6 A;  1AN8 A;  1MSH A;  5GAD C;  1JE5 A;  4LF9 Q;  4C2M B;  1UAP A;  4RWS C;  2NWG A;  3VYU A;  1XNR Q;  3KF6 B;  4JVZ A;  4ZUI A;  4R1J A;  1K8O A;  3D31 A;  4A3I G;  5E4W C;  3ERS X;  3P1H A;  1XXG A;  3CCQ A;  1LTG D;  4CBV A;  1DOM A;  4JI6 Q;  4NXM L;  2Z4I A;  3G4S A;  4JBK A;  3HOY H;  2A6E D;  1XWE A;  2R3Z A;  3HOV G;  5CV7 A;  2MGS A;  1QUQ A;  2AQ1 B;  1TII D;  4R4O A;  3BVG A;  4ME5 A;  4QUF A;  5KIX A;  1NMG A;  4BY7 G;  2VZA A;  2QCP X;  5ELE A;  3TP8 A;  2R92 B;  4RMF A;  3DWP A;  5KND A;  3QR8 A;  1OXV A;  1VQH A;  3CME A;  2A1A A;  4B9W A;  3CCL A;  3S16 B;  3K80 C;  5BN4 A;  3I73 A;  1FJG L;  3GTP H;  2E2I B;  2K50 A;  2SNM A;  2RDG A;  2F3V A;  1VQD A;  3Q22 A;  1X9N A;  1ASZ A;  3KF8 A;  3M4O B;  3OIQ A;  4B3R Q;  4F88 A;  3HZX A;  4Y52 H;  2E2D C;  1O7I A;  3MHB A;  5JOB A;  1PRT C;  4DV7 L;  1ESF A;  3CCM A;  2HQE A;  2XIW A;  3HOX H;  3GTG B;  2NVY H;  1A6X A;  2K75 A;  4ZLT F;  2NVX B;  2F0D A;  5IYB H;  5C0X J;  4A3K G;  3I4M B;  3H15 A;  4C56 C;  2PQA A;  3TQY A;  2B2T A;  3G71 A;  2FJ2 A;  4LW1 A;  5KEE A;  4DK1 A;  4L8J A;  1STA A;  2NN6 I;  4JI8 Q;  3M3Y B;  1I6H B;  4PZ6 A;  4A3C H;  1NE3 A;  3RN5 A;  2VY3 A;  3HFZ B;  1YHB A;  3I4N B;  4LK1 C;  4RCO A;  1LUZ A;  4BY1 G;  2Q8T A;  4FYD A;  2Z1C A;  5L37 A;  5IOC A;  1VQI A;  1JIC A;  2N49 A;  2Y0S E;  5K5P A;  5A35 A;  4FXG C;  4AQY Q;  1HTP A;  1M90 C;  3HOU B;  1BCP F;  1N33 L;  1D8L A;  1K3B C;  1KXL A;  4IQZ A;  1Y8P B;  4X3U A;  5IP7 G;  3S1M B;  5C6A A;  4IFD I;  3E9I A;  3SXH A;  1WOC A;  2IX3 A;  3TEH B;  5C4X G;  2IX1 A;  1KRS A;  5JVH 3;  5HGQ A;  1VQE A;  4GNX B;  1QJO A;  2L9H A;  1XTC D;  5BN3 A;  1J5E L;  2R7F A;  1NNX A;  2IWH A;  3D6W A;  1TWC B;  4RHR A;  5JJL A;  1DJR D;  1L1O A;  3R3O A;  1LLR D;  4A3D H;  1EY0 A;  4K0K Q;  1MJC A;  3E0J A;  1HH2 P;  1N36 Q;  1YI2 A;  5JJK A;  1K3R A;  2Z9H A;  5IP9 G;  1XNQ Q;  2B2W C;  4QY7 A;  2HCC A;  3RLN A;  4E6I A;  3TZU A;  2K5D A;  2A74 C;  1WTH A;  4QF4 A;  5COR A;  3U4V A;  1CQF A;  1X3G A;  3PO2 G;  3PO2 B;  3HEJ A;  4KV6 A;  3VDY A;  2UU9 Q;  1JT8 A;  2WAQ G;  2R7Z H;  2KBN A;  4IZ8 A;  3R2I A;  5AJ3 Q;  1N9W A;  3HKZ G;  2K5V A;  2UXD L;  2JQO A;  3RZD H;  2MO1 A;  3RD4 A;  2OQ0 A;  5I4D A;  3A5Z B;  2E76 C;  1JWU D;  4LFA L;  2K4K A;  5A2Q L;  1YIT A;  1SN8 A;  1Q1E A;  5IT9 L;  1O7L A;  1T5E A;  2JA8 H;  4ZAI A;  1KAA A;  3H0G B;  3H0G G;  4YCW A;  4JBJ A;  1HR0 W;  3ZJY C;  1SNP A;  2K5W A;  4ZRZ A;  1PYS B;  4DV1 Q;  3K57 A;  1V8Q A;  3CPW A;  1PYB A;  3J80 i;  1WTV A;  1VQ6 A;  1PFB A;  1WTR A;  2XVS A;  1JJG A;  2VUM H;  1F9R A;  4GLA C;  3LWE A;  4IAL A;  1I4X A;  3K5N A;  1L0Y B;  3UE1 A;  3VYS A;  4IFD G;  2EJM A;  3CHB D;  1GUT A;  2CW0 D;  4X62 L;  4JI4 Q;  3CRL C;  2MO0 A;  2JA6 G;  1X3F A;  1V43 A;  2UUA L;  3U9S A;  3S1M H;  1S5B D;  1C9O A;  4J15 A;  3F2D A;  1Z6H A;  3T51 B;  5A2Q E;  3JAM L;  4ALP A;  3T56 B;  4XYO A;  2L4N A;  1TY2 A;  4NXN Q;  3GD7 A;  3LWU A;  2VQF Q;  3ZYY X;  1DOK A;  4HIK A;  3QB3 A;  1M4V A;  1OXX K;  1J8I A;  3W5O A;  1SR3 A;  3C1F A;  2NN6 G;  1CKN B;  1TWF B;  1S5E D;  1NCV A;  4A3G B;  2KEC A;  2VL6 A;  1FNW A;  4LF7 L;  2HHH L;  1YEZ A;  5EGT A;  4IUT A;  3GP7 A;  1OXU A;  1X3Q A;  2EQS A;  5EKI A;  4KHP L;  4OX9 Q;  4HJA A;  1BVS A;  4GKK L;  4RA8 A;  1SND A;  1Y1W H;  1KD1 C;  4B3M Q;  4LUO A;  1Q1B A;  3NTK A;  3I4N H;  4KJN A;  4H44 C;  1QB5 D;  4DK6 C;  4GLV B;  1T5X D;  1SYF A;  1BCP B;  2B2Y A;  1YNJ C;  3HG9 A;  2K05 A;  2E2J B;  3AMU A;  5IP7 H;  3S24 A;  2R61 A;  2AHO B;  2WV6 D;  4UP7 A;  1EYG A;  4DR6 L;  2N78 A;  5DM7 3;  2K6A A;  3VYR A;  3T1Y Q;  5EKL A;  5EQ0 A;  2EYF A;  4DR1 L;  4JI7 L;  3WWV A;  4L5Q A;  5AFW A;  4NW2 A;  4WJW A;  1SE3 A;  1W3S A;  3S1N B;  4QIW E;  2ID0 A;  1ML0 D;  2PZT A;  3S16 H;  3G48 A;  1Q12 A;  4S3S A;  5LHY 1;  5M5Y H;  1YBY A;  2PPB C;  1B3A A;  1K0S A;  2AUJ D;  2UXB Q;  1LYL A;  1JOO A;  1OXT A;  4QCL A;  2HD3 A;  2ZTD A;  2JYO A;  1XPU A;  2CVR A;  4OO1 I;  2EVB A;  1XNR L;  1GOZ A;  4DAY B;  4OIJ A;  2M00 A;  3ND9 A;  1LT3 D;  4X3T A;  4R8I A;  3G7L A;  3T1H L;  3GO5 A;  2I0Q A;  1STB A;  1GO3 E;  3NXW A;  1WI5 A;  3DEP A;  2HDM A;  5C4Z A;  1SYG A;  3H91 A;  1KC8 C;  1I50 H;  1JOQ A;  4LMQ D;  3KBX A;  5CBE E;  3KK7 A;  4A3I B;  3D0F A;  1EQQ A;  2NVT H;  4I65 A;  5C4J B;  1II3 A;  4C3J B;  3NEL A;  1CSQ A;  2PZW A;  1A2U A;  2D9U A;  4XQJ A;  1SBB B;  1VQ7 A;  1VQ9 A;  5C4H A;  1UEA B;  2ZTE A;  3CCR A;  4LF5 L;  4P73 A;  1T9H A;  2CFM A;  2Z6K C;  3MTS A;  2JA9 A;  4G4K A;  4YHH Q;  4ABN A;  3S1N H;  3RZO B;  2O2L D;  2YU9 B;  3L7Z C;  2XGT A;  3X3N A;  1PA6 A;  1SRU A;  2IY5 B;  1WTW A;  2CH4 A;  2VQE Q;  1E3P A;  1SMX A;  5JVG 3;  2L1B A;  3MFG A;  1NR2 A;  1Z47 A;  1VQO A;  2I5H A;  4A3M B;  2RDF A;  1UNS A;  3JAM i;  4WOR A;  5IGE A;  3DWA A;  1GVP A;  2CWA A;  3HOX B;  4NXM Q;  2KJX A;  1AP0 A;  4L5R C;  1NY4 A;  4DV6 Q;  3OYY A;  1PXU A;  2F3I A;  4B3M L;  3P7J A;  2K03 A;  1S40 A;  3PIO 3;  1VQG A;  4XT3 B;  5D3I B;  1VQP A;  5FKA C;  4JPB W;  4QJF A;  5C0X G;  3U50 C;  1CQV A;  3NPP A;  4TSS A;  5K36 H;  3PUZ A;  4KD3 A;  4KKU A;  1FD7 D;  1WD1 A;  2E5L Q;  3G6J B;  1EOT A;  1I6V C;  3K8A A;  3M4Y A;  4C2M H;  1QNK A;  1IBM Q;  4RAU C;  3J80 L;  1A2T A;  1L2F A;  4MTK A;  1HTL D;  2K5N A;  3KDF B;  5HGT A;  2F0H A;  1I5F A;  3NP8 A;  5EBC A;  1EFW A;  4N9T A;  1EL0 A;  3KDF A;  1TS4 A;  4GLX A;  5C3E G;  1F9Q A;  2K28 A;  3AQQ A;  2QGQ A;  3S9W A;  3M7G A;  5CBA E;  1E1O A;  2EYH A;  4JBW A;  5M5X B;  2P5Z X;  1SFO B;  1XNQ L;  2ZJP A;  1K0R A;  5ISR A;  4LF8 L;  1PH4 A;  2BH8 A;  1A3T A;  3U4Z A;  4RGT A;  1PV4 A;  5M5W H;  5DM6 3;  3TN2 A;  1M8A A;  1I4R A;  5EBD A;  1Z9F A;  3E5S A;  2F0E A;  3A55 A;  3NHH A;  3FVQ A;  2D0O A;  4R4C A;  1ILQ A;  2RCF A;  2EY6 A;  1TU2 B;  3ERO A;  2AMC B;  2B2U A;  4R4Q A;  5IT9 c;  4TKO B;  3U9O A;  2ENB A;  3EFX D;  1YNJ D;  3HKZ B;  2GA4 B;  2WII B;  4CJ0 B;  1MSG A;  4XQQ A;  2HHH Q;  3VA5 A;  2R93 G;  4WJ3 M;  1CFM A;  2KCC A;  2E5L L;  2PNR C;  2EJG C;  1DXM A;  1PFM A;  1PTO D;  1FGU A;  3TP7 A;  2PQE A;  2PQA B;  4IFD H;  1SMY D;  3BZD B;  5IWA Q;  3VR4 A;  4JI4 L;  1YIJ A;  2L15 A;  4TVA B;  1HNW L;  4F7X A;  1SE4 A;  4JI1 Q;  3CC2 A;  4J1M A;  1STG A;  1PHJ A;  5FK9 C;  2SOB A;  1Q82 C;  1AW7 A;  2F1M A;  3DLL A;  4DV2 Q;  3S2H B;  2EE1 A;  4JI5 Q;  1SSO A;  5CV9 A;  2IHE A;  3A7L A;  3WOF A;  1BNZ A;  2K01 A;  2Z0S A;  4B9X A;  5LMU Q;  1GJX A;  2F0M A;  3J80 c;  2JA5 H;  1HNZ Q;  3OIP A;  4AH6 A;  2A69 C;  4M8A A;  2N8N A;  4H0L C;  1F2M A;  1N32 Q;  3S1Q B;  4ME3 A;  1D5X C;  2LS0 1;  3F2U A;  3FPP A;  4DV6 L;  1E1T A;  4J8Q A;  1NMF A;  2XWJ B;  4HED A;  2X6G A;  3S17 H;  3S1Q H;  4JCV E;  4L5T A;  4NMZ A;  3PO2 H;  3Q24 A;  1HCZ A;  3STB C;  1HR0 Q;  2KUM A;  4L6T B;  3T13 A;  3EN2 A;  5TSS A;  1U0L A;  2EYM A;  3HOY B;  1RDP D;  3CD6 A;  4Y7N H;  4CJ2 C;  2Q2T A;  5CGK A;  3FRP B;  1QWY A;  3KJP A;  1HHV A;  5EAY A;  4DAP A;  1IBM L;  2JE6 I;  4DV5 Q;  3D8G A;  3IRB A;  1HZ9 A;  4B08 A;  4KLK A;  3NQI A;  2F0L A;  2RHQ B;  2N3S A;  1ZYR C;  4I7A A;  4N9P A;  2G9D A;  4X62 Q;  1TWC H;  3Q6S A;  2TMP A;  2KQ3 A;  1PTO B;  4LF6 L;  2MPM A;  2E2I H;  2VW9 A;  3GTM H;  1RTO A;  4R9W A;  2D62 A;  1B44 D;  3KLS A;  5J1Z A;  4OWW B;  1S5C D;  3KYH C;  3L0O A;  3PCO B;  4N8X 1;  1N34 Q;  5M3M H;  1B9N A;  5E3F A;  3URY A;  3GDE A;  5CV4 A;  3BVZ A;  1BOS A;  5LMU L;  4UAI A;  1AE3 A;  1Y14 B;  4DR3 L;  2D2C C;  2JN4 A;  1HXY D;  2F52 A;  2R93 B;  3CC4 A;  2FXQ A;  3IKJ A;  3KOJ A;  4DV0 Q;  4BY7 B;  2BE5 D;  4GN5 A;  4A3J B;  1ET9 A;  1VCI A;  1H9S A;  2J7Z A;  2IW3 A;  4GKK Q;  2WB1 B;  2I5L X;  2XTI A;  3M3Y H;  2NZ1 D;  3MXU A;  3WOE A;  3H94 A;  1LO5 D;  4POF A;  2JA7 B;  2A5H A;  1XMO L;  3PIP 3;  1JE4 A;  1IL8 A;  3SGI A;  3CU7 A;  2XRS D;  2RA4 A;  3F8T A;  5ELF A;  2VUM G;  2WP8 J;  1R9T H;  2NZO A;  2NB0 A;  4IUQ A;  5IGD A;  4XTC S;  5IGB A;  3GTL B;  3FPU B;  3MFY A;  3SHL A;  1Q46 A;  1ZYR D;  1PTO C;  2F0V A;  4JI5 L;  2B2Y C;  3MA2 B;  2ZJQ A;  2EXD A;  1QVC A;  3HOV B;  2ATW A;  1F2Z A;  4BY1 B;  4CDF C;  4AYB B;  3BG3 A;  1XPO A;  3I91 A;  3NK9 A;  4G57 A;  3UDX A;  4DXF A;  3I4O A;  4B3T Q;  2B2V C;  2F4V L;  1B53 A;  4RG1 A;  4DR6 Q;  4QUC A;  3OMC A;  3A8J E;  1SEB D;  4J6H A;  2DJF C;  3D6C A;  2K1B A;  3FP9 A;  4NDX A;  1H9K A;  4JV5 L;  3S2D B;  3S2H H;  1TWG H;  2QF7 A;  1V1Q A;  5IP9 H;  3NSW A;  2JP1 A;  2AQ3 B;  4EQO A;  4KI0 A;  1MHW C;  4CHT B;  1TWG B;  1STY A;  2A69 D;  2M9V A;  2IX0 A;  1WCM H;  1NJI C;  2QDB A;  1GXD C;  3GV6 A;  3Q23 A;  4GKJ Q;  3TRZ A;  5IE8 A;  5FJ8 H;  3KFU A;  3S15 H;  4OO1 G;  1Q8K A;  4DV4 Q;  4IN3 A;  4YIJ A;  3A5U A;  3H3V C;  3F1Z A;  1C8C A;  4LF6 Q;  4A3G H;  2CCZ A;  4A3E B;  4PMC A;  3SEB A;  3BZC A;  1WVL A;  4BBR H;  3HKS A;  2VB2 X;  1LT4 D;  1VF5 C;  4UPA A;  1RKN A;  3HOU H;  4KY5 A;  2B63 B;  4HCS A;  4V19 0;  1UE5 A;  4AYB E;  3R93 A;  4DPG A;  3D4W A;  1R9T B;  4K8J A;  1DM0 B;  2VXW A;  2ALY B;  3T4A C;  4XT1 B;  4BA2 I;  1ILP A;  1PH1 A;  1PRT B;  2UUB L;  5FLX L;  4DR5 L;  4DA2 A;  4HTH A;  5KYL A;  1B4O A;  1RTN A;  2EJF C;  4X65 L;  1UWV A;  3ERQ A;  4H13 C;  4K6L A;  3ITP A;  5C44 B;  4X3S A;  1QIL A;  4HJ7 A;  3QO2 A;  2KVM A;  2MFI A;  4HJ9 A;  3NTH A;  3K59 A;  1B3Q A;  1YHA A;  4DV0 L;  4LNQ A;  4MHE A;  1EEF D;  1FNV A;  3MEF A;  3PIP A;  4C3I G;  3CXC A;  3HOZ G;  1HUN A;  2B2W A;  1D7Q A;  4O42 A;  4LFA Q;  2J0T D;  4HJ5 A;  2YTV A;  3H0G H;  1K28 A;  1NTG A;  5C5L A;  4C3H G;  2F0S A;  5M5Y B;  2VB3 X;  4U67 3;  4HCE A;  4KKT A;  2EXZ A;  2ZXO A;  2NUC A;  1LAC A;  2R92 G;  1IW7 C;  1Q8I A;  1OTC A;  1G6Z A;  4DR7 L;  3D3R A;  5EPJ A;  1A15 A;  2R92 H;  2JA6 B;  2Q8R E;  1UUP A;  4IUR A;  4ULL A;  2OTJ A;  2QW7 A;  4AIM A;  3VR6 A;  3HGB A;  4LF4 L;  5DLQ E;  2H5X A;  4FVM A;  3VR3 A;  3PIO A;  1BXT A;  4V0B A;  3K7U C;  1LTT D;  4P71 A;  2VNU D;  4DV7 Q;  4NXN L;  1N32 L;  2BA0 A;  1XPR A;  3C1E A;  2WFW A;  3UDG A;  2NN6 H;  3FMC A;  3LNN A;  1K8A C;  4XIG S;  1WD0 A;  2UU9 L;  5I6W A;  1EOV A;  3MXN B;  2O4X A;  3CCU A;  1WTO A;  2RSO A;  2FHT A;  3BZK A;  1IXR A;  4LFC L;  3EJI A;  1PFN A;  1I6H H;  4JI6 L;  2QEJ C;  1F2L A;  2DN8 A;  4DKA C;  1SNQ A;  3BU2 A;  5CV8 A;  2RKS A;  4DR2 Q;  4ODG A;  2MP1 A;  4FF4 A;  4FXK C;  1X65 A;  1N33 Q;  2ZT9 C;  4OO1 H;  2A68 D;  2R6G A;  1D5M C;  2PZU A;  3CW2 C;  4A3J H;  2F4I A;  5IGC A;  1SNC A;  1PTO F;  2F0T A;  3ER0 A;  4A3G G;  3C2P A;  3R8B A;  5GAG C;  1LTR D;  4C1N I;  5CR3 A;  3W1G A;  1PRT F;  3HS0 C;  5IYC G;  1YNN D;  1G8Z D;  1HFN A;  1I4G A;  4ZYS A;  3MEH A;  5C3W A;  1BUV T;  4NP5 A;  2F0J A;  1PZJ D;  1GUS A;  2OF1 A;  3C3L A;  1HNZ L;  2D5D A;  4LUV A;  4P72 A;  2EIF A;  2QDL A;  4KY6 A;  4UY8 C;  1AZP A;  4RHS A;  1TWH H;  5M3F H;  2PO4 A;  3L3O C;  1A63 A;  4XQN A;  2J4X A;  4NPS A;  4A3B B;  1VDZ A;  4K14 A;  1I4H A;  3JAM E;  1DCZ A;  3S1R B;  3CCS A;  2JA5 B;  2JA5 G;  2PNH A;  2IT1 A;  1K8G A;  4IPC A;  5KNB A;  2OTL A;  1SAP A;  3QJY A;  2E2H B;  4PNY A;  2GVA A;  4HMJ A;  3D4D A;  1S5F D;  4HSP A;  2JEA I;  3OOC A;  3PF4 A;  1PRT D;  1RJT A;  1CK1 A;  1BQQ T;  1S3O A;  1B50 A;  4KMU C;  3AB9 A;  4DV5 L;  1YJ9 A;  3I4M H;  3HRZ C;  1H9S B;  1HZB A;  4DR2 L;  1RF2 D;  3TRE A;  3G6E A;  2KHI A;  4KK7 A;  3MC0 B;  3MZ5 A;  3CP0 A;  4H7B A;  1PH2 A;  2L55 A;  4OXP A;  3GTG H;  4CGY B;  1YNX A;  2MQH A;  1I94 L;  3I7F A;  4B3T L;  2F4V Q;  4FO2 A;  4KHV A;  2RDH A;  5DEH A;  5JJZ A;  2A6H D;  5ELC A;  4YCV A;  3CMA A;  3EA6 A;  5IYB G;  1SXT A;  4YWK A;  2EYL A;  4ZKB B;  3NEM A;  4DAM A;  4QB4 A;  2WAC A;  5E4X A;  1J9O A;  2RCN A;  1A3U A;  1BO0 A;  1TKW B;  4B3S Q;  5JPN C;  1QZH A;  5LMN W;  2UUA Q;  2OCE A;  3JC6 6;  1L0X B;  1X32 A;  2PCF B;  4ZUJ A;  2NYZ D;  3AFQ A;  4PMW A;  2VQF L;  3IL8 A;  3J81 L;  2V4D A;  3M9B A;  3HOY G;  3GTQ B;  1GM5 A;  3J7A F;  4MTN A;  1EYC A;  2O5J C;  4QMG A;  2I5M X;  1CHP D;  1V1O A;  5GAE C;  1QG7 A;  3DHQ A;  1O80 A;  1X6O A;  3TDQ A;  5ELO A;  1XMO Q;  4Q0F A;  1EIY B;  5IYD G;  3FKI B;  3FKI G;  4PV1 C;  1KLG D;  2YYZ A;  5I2Y A;  4LF7 Q;  1GUO A;  4IFD J;  1LTI D;  4IOA A;  4BWG B;  4R4I A;  5I9P A;  1G2T A;  3J7A V;  1WTQ A;  4A93 G;  1RHP A;  5LL6 S;  5IWA L;  1EFI D;  4FNF A;  3S17 B;  2B29 A;  5KNC A;  1EUJ A;  3SVM A;  2JJQ A;  1FGB D;  4DF7 A;  3BS1 A;  3V96 A;  4POG A;  3GTP B;  2DGY A;  1SNO A;  4JI3 L;  1P8L A;  3AU7 A;  4BS9 A;  1X3P A;  1K9M C;  1JR0 D;  1NUC A;  4JW0 A;  5IGG A;  3M4P A;  5J3B A;  1ENF A;  3T1Y L;  4APV A;  4O1N A;  4A3B G;  3MXG A;  4JI8 L;  4CKE A;  3W3A A;  4HID A;  2F0I A;  2FMC A;  4PZ8 A;  3T1H Q;  2B8F A;  3FHW A;  2A8V A;  1G91 A;  2HIX A;  2HT1 A;  1KDA A;  2K33 A;  3O13 A;  1KAW A;  1ENC A;  5C3E B;  1EY4 A;  2HQL A;  4A76 A;  1Y1V H;  4C3I B;  5H1S E;  3BYT B;  3PF5 A;  1VQM A;  2X6L A;  1JB7 A;  3N52 A;  4JK1 C;  2NVY B;  2EYJ A;  3TS0 A;  2E2H H;  2F0G A;  4LFC Q;  1STN A;  2CW0 C;  1XTD A;  3H3V I;  1W2B A;  4F87 A;  3GTM B;  5FO7 B;  2JXM B;  2F03 A;  1PH8 A;  3A54 A;  4O0A A;  4OIK A;  1EZ8 A;  4O2D A;  5C44 G;  3OMG A;  2EPB A;  4DUZ Q;  1PVO A;  3E9H A;  3H3V H;  1IYV A;  2SEB D;  1XX8 A;  2A68 C;  2LY7 A;  1HRJ A;  2G9H D;  1JOK A;  1PYW D;  4HJ8 A;  2B39 A;  4UP8 A;  2LSS A;  4LF4 Q;  1PFS A;  4YHH L;  1K8M A;  4DR4 Q;  4LF5 Q;  3H6M A;  1IHZ A;  3PSI A;  1EIG A;  5J39 A;  4JBM A;  2I07 B;  4R8N A;  4FF1 A;  5FLM H;  2C35 B;  3TP6 A;  1CZW A;  1EQR A;  2TSS A;  4BXX H;  4A3D G;  4A3D B;  2E74 C;  1SYE A;  1HFG A;  1CHQ D;  4WJ4 A;  3S1R H;  1AE2 A;  2L11 A;  3S14 B;  4LJZ C;  3NBH A;  4DV3 Q;  2WB1 E;  4XYQ A;  5C0X H;  3VYT A;  3VR2 A;  1KQS A;  3VA7 A;  2NVQ H;  3I4N G;  1SYD A;  3AYH B;  2AUK A;  4C3J H;  1JJC B;  3SK4 A;  1QE6 A;  1B70 B;  1Y1V G;  2NVT B;  4P75 A;  1EIF A;  4TQU S;  5IYD H;  1UEB A;  2I46 A;  5COY A;  2PMZ E;  3NWS A;  1WYD A;  1XMQ L;  4ZCK A;  3HOU G;  2KEE A;  4GNX C;  1EWI A;  1OO9 B;  3E3X A;  1S5D D;  4FP5 D;  3CCE A;  4LF8 Q;  4JI1 L;  2N88 A;  1DON A;  3I4L A;  3V05 A;  1TVX A;  1C4Q A;  1CI3 M;  4JI3 Q;  3MVV A;  3HP3 A;  1CA5 A;  4EVO A;  2XWB B;  4C1N K;  4F8M A;  1GUN A;  4EX5 A;  1X55 A;  2AKW B;  2OQK A;  3SR1 A;  4IPD A;  2CQA A;  4CJ1 B;  4OON A;  2K7V A;  1V1P A;  2A6E C;  2OEO A;  1ESR A;  4TRD A;  2IJ0 A;  4DAV A;  1H9R A;  3A8I E;  3MAQ A;  4DFA A;  4CKB A;  5CYU A;  3PV0 A;  1IYJ B;  2QEX A;  1CM9 A;  4K5V A;  1GHJ A;  2IHF A;  3SE0 A;  3UE0 A;  1Y1W G;  4K5W A;  3CCV A;  3GTO H;  3I70 A;  5JJI A;  1AH9 A;  1V1P B;  2R7Z G;  3RLF A;  4DAY A;  4QL5 A;  1STE A;  1QZG A;  1HQM C;  1YNN C;  1HNW Q;  2Y0S B;  1MGS A;  1NAP A;  4C3J G;  2B2T C;  1F77 A;  3ULP A;  3L2P A;  1VQJ A;  3E6Z X;  1IZ6 A;  1U5K A;  3PUX A;  2IPK D;  5ELB A;  4A93 H;  1KDB A;  5FOB B;  5FO9 B;  5DAU A;  4IUN A;  5HY6 A;  2WAQ B;  1WFQ A;  3PUY A;  4BBR G;  3ULJ A;  4ZQ3 A;  3AFP A;  1GKH A;  1D1K A;  2ICE C;  1QCB D;  3QOL A;  1I4Q A;  4KTA A;  1LTL A;  1GHK A;  2MNA A;  3M4Q A;  1B7Y B;  1E7Z A;  2ZTC A;  4X66 Q;  1ZEQ X;  1HA6 A;  3NBI A;  2UXC L;  3RLO A;  3SK6 A;  5J22 A;  4DUY Q;  1UE1 A;  1D1I A;  2E8G A;  4JI0 Q;  3OSO A;  3LGJ A;  3STB D;  1U9R A;  3DMU A;  4A4I A;  3EQL C;  5NUC A;  4JOI A;  2EY2 A;  3HOX G;  3CQZ B;  2VS1 A;  2B3G A;  1AFP A;  1EQT A;  3GTJ H;  3M7N A;  4WFN 3;  5IOD A;  4LUZ A;  1CT1 D;  1YJN A;  1KL9 A;  1PZK D;  1O7Z A;  3QOJ A;  4JYA L;  1MI2 A;  4WRD A;  4G7O C;  2L0C A;  3I90 A;  3UDI A;  1I50 B;  3HKZ E;  1UE7 A;  3L9A X;  4OEM B;  5I9O A;  4CDE C;  1IBL L;  1PH5 A;  1RCV D;  3K58 A;  1I3Q B;  2A6H C;  3J81 E;  5IIF A;  2BDN A;  4LWC A;  1EIH A;  5EPK A;  1QVF A;  2CQO A;  1TWH B;  5M3F B;  1F9P A;  3W2D A;  2XN9 C;  2KCT A;  5FO8 B;  2F0N A;  1KHI A;  2YTX A;  2Z8L A;  1MBY A;  3GTK H;  1VF7 A;  2FMM A;  1J5E Q;  1X3E A;  1IL2 A;  4HMI A;  1EQV A;  1N34 L;  4M1U B;  1UE6 A;  2VQE L;  3TSS A;  1AEX A;  1BKB A;  2CKZ B;  1Y8N B;  1Y69 U;  2KEN A;  5CC4 A;  2QIL A;  2MJ8 A;  4B3R L;  1BBU A;  4IUV A;  1KDC A;  2K14 A;  1R4Q B;  1A8V A;  1Q90 A;  3MWY W;  4CDC C;  2F3W A;  5I2X A;  4P2C B;  1ET6 A;  1SYB A;  2KED A;  2XNA C;  1EY9 A;  1LV9 A;  4K8I A;  2JA7 G;  3CC7 A;  1G6P A;  5F2D A;  4KHZ A;  1YJW A;  2Y0S G;  4BBS H;  1BBX C;  1R4P B;  5HUR A;  1HUM A;  3HOW G;  4DK3 C;  2LKV A;  1EZ6 A;  2NZH A;  3CAM A;  4Q5V A;  1BF4 A;  1O7Y A;  2KA7 A;  1HZA A;  2Q8I B;  3HOV H;  2PW7 A;  2GN5 A;  1MJE A;  3R2T A;  4L5S A;  4YY3 Q;  1BCP D;  1DD2 A;  3NBH B;  3WDN A;  5K36 G;  2KCN A;  4A3K B;  5D65 A;  5FJ8 G;  2JA8 G;  2Z6B A;  1FVI A;  2R7Z B;  1CSP A;  1KNE A;  4UP9 A;  1HPC A;  1RD9 D;  5M5W B;  1EEI D;  1WTP A;  1HNX L;  2PI2 E;  2UUC L;  1W6J A;  1I3Q H;  2UXC Q;  1FJG Q;  4JI0 L;  2F0U A;  4LFB L;  2BCO A;  4JI2 Q;  5GAH C;  5C4J H;  1STH A;  3RNU A;  4JV5 Q;  2EOT A;  5C3E H;  3T53 B;  1KAB A;  3V2T A;  1YVC A;  4RKL A;  1PH9 A;  2NBF A;  2HDL A;  1VQF A;  5IY0 A;  1LM0 A;  4DR5 Q;  1WTX A;  2JA6 H;  3B6Y A;  3KBG A;  2RVL A;  1DZ1 A;  4QIW B;  1B8A A;  1TWF H;  2V1C C;  1NBW A;  1L0W A;  4A3M G;  2BH2 A;  3DWQ A;  1LTS D;  4LF9 L;  3I2Z A;  3BYY B;  1IYU A;  2L12 A;  2EYO A;  4G7Z C;  1NSN S;  1EY7 A;  2ZXP A;  3GTJ B;  1TXY A;  4KN7 C;  3PMF A;  4HR7 B;  1PH3 A;  5DNF A;  2WAQ E;  1JJ2 A;  2ZXR A;  2UXD Q;  2OT2 A;  2BOS A;  3J81 i;  2CHB D;  1CUK A;  1ENA A;  4A3E G;  3PUW A;  1XMQ Q;  1CKN A;  2WIN B;  3K0Y A;  2F0P A;  1PH6 A;  1CZG A;  1PTO H;  4XDX A;  4YWL A;  1BR9 A;  1TR5 A;  1AZQ A;  3J81 j;  3I4M G;  3EVQ A;  2KCM A;  4OL7 A;  2F0O A;  3QWN A;  4XXE A;  3GQB A;  4IPG A;  3RUZ A;  1I94 Q;  4GZY C;  2B2V A;  1D5Z C;  3PQI A;  4UDU C;  1ASY A;  3EBE A;  5EJW A;  2H1E A;  4BBS B;  2HUG A;  4RGN A;  3IFD A;  5KGU A;  4OGQ C;  3CKI B;  1Q86 C;  1SJE D;  4DK0 A;  1QOH A;  1HZC A;  3RZD B;  2UUB Q;  4DR4 L;  2DY7 A;  3S2D H;  5G3L F;  2Q2I A;  2Q2H A;  1MKH A;  1KRT A;  2KHS A;  4JC0 A;  4A3F B;  3OTO Q;  5KYI A;  1TWA B;  4UHV A;  4YWM A;  1LTA D;  1C7Y A;  4A3C G;  2UXB L;  1SLJ A;  3H09 A;  3CF5 A;  1JB3 A;  4C3H B;  2PYK A;  3J7Z C;  3DXJ C;  3T16 A;  4A3L G;  4GOP A;  1E24 A;  1ROD A;  5IGF A;  3I8Z A;  1WCM G;  3BDO A;  4C3H H;  2E75 C;  2WB1 G;  2EYP A;  3K81 C;  1FNU A;  1MD2 D;  1Z7T A;  2Z4H A;  4A3I H;  1W6K A;  1HA5 A;  4ZK9 B;  1EY5 A;  1V9P A;  2LMC B;  1I4P A;  2F0Q A;  4DNR B;  4DU9 A;  3ND8 A;  1G2S A;  3NQT A;  4HSV A;  1HQR D;  1LT6 D;  1TS5 A;  2MHV A;  5E1F A;  4ZKC B;  2HIV A;  3JAM c;  4HN7 A;  4KKS A;  4JI2 L;  1TS3 A;  2JEB I;  3KF8 B;  1IBK L;  5ELD A;  2C5C A;  5FLX E;  1HNX Q;  2BDO A;  4AYB G;  1LT5 D;  4X66 L;  1D2B A;  5EPL A;  5CV5 A;  1BBW A;  5LMN L;  2SDF A;  1RIP A;  4DR3 Q;  1XJV A;  2JA8 B;  1E22 A;  1U4M A;  1SDF A;  1VMP A;  1TWA H;  4U68 A;  2AQ2 B;  2KHJ A;  2F0K A;  1EYD A;  1PH7 A;  1YHQ A;  3DUZ A;  2B2U C;  1LAB A;  3MXP A;  5KRU A;  5FLX c;  1GUW A;  1IKL A;  5CMD A;  1H95 A;  4X65 Q;  3S15 B;  3Q0A A;  4FF2 A;  3IFT A;  3FKI H;  3K5O A;  4KN4 C;  2B63 G;  1DOL A;  1VQN A;  2JA7 H;  5GQO A;  4A93 B;  2C9O A;  4I7Z C;  4IO9 A;  2RBM A;  4L63 B;  2R93 H;  1EY6 A;  3HOW H;  3A74 A;  2CH4 W;  1N8R C;  2K5H A;  2RSN A;  2N55 A;  4IOC A;  1JMC A;  1PLF A;  2XSC A;  1VMC A;  2NVQ B;  1G29 1;  4K2L A;  1S4Z A;  3BJU A;  4X3K A;  4X64 L;  1X56 A;  5IT9 E;  3OWE B;  5ELN A;  3UI2 A;  4A3B H;  2JK8 A;  2Q2U A;  3NEN A;  2Z6K A; 
#chains in the Genus database with same CATH homology
 1H9M A;  5T1G A;  1KTK A;  3NTI A;  1JCK B;  1WCM B;  4KJO A;  3A56 A;  3DEO A;  3NUC A;  3M85 A;  1F9S A;  2EY1 A;  3P75 A;  3FEW X;  2MUY A;  4DXG A;  4RFB A;  1IW7 D;  1EYA A;  3GTO B;  2SNS A;  3BDL A;  1U4L A;  3QG1 A;  4KD4 A;  2ICI A;  2DNC A;  2PMZ B;  4DN4 M;  5JPM C;  4DNT B;  5D3D A;  2K5Q A;  2IL8 A;  5C0X I;  4PMB A;  3VR5 A;  2BA1 A;  3K6O A;  3TZD A;  1TY0 A;  3TME A;  1U4R A;  3J7Y W;  1EU4 A;  4MIU A;  3HOW B;  3CRK C;  1C48 A;  3X3M A;  4K5X A;  1O78 A;  1SNM A;  4EQN A;  1SJH D;  5T1I A;  4RKB A;  3OHX C;  5BN5 A;  4G7H C;  4FXD A;  4K2K A;  2NTT A;  3MXN A;  1EWC A;  3KLR A;  4HAE A;  2HCI A;  1FR3 A;  1JQY D;  1ZKO A;  4NKL A;  4KY7 A;  2EZV A;  4PQX A;  3KUP A;  2QKI C;  4OHJ A;  1ICW A;  1BDO A;  4K6D A;  3DM1 A;  2F0F A;  1EWH A;  5JEA H;  1SYC A;  1E0B A;  4IUP A;  1B2T A;  3ONA B;  1E2Z A;  3K5M A;  1Y8O B;  1SMY C;  3P20 A;  4LAA A;  1OXS C;  2AWO A;  2XRQ D;  3FDT A;  3A7A B;  3PUV A;  3SK8 A;  5I6Y A;  3BVM A;  1TS2 A;  1D6E C;  2EDG A;  3OW7 A;  5EKK A;  2O5I C;  4Y7N B;  1FYC A;  3TBI B;  3PO3 B;  1JWS D;  1SE2 A;  1U4P A;  3N6R A;  2M2L A;  1Q3L A;  4DGZ A;  5C3X A;  4RGM A;  1LTB D;  1B1Z A;  3SDZ A;  1JOR A;  4RCN A;  1KNA A;  4BBR B;  3NWT A;  4ILW A;  1JWM D;  1PZI D;  4Z9C B;  2X69 A;  5LL6 X;  1K83 B;  1IKM A;  1E2W A;  2AWN A;  1E2V A;  5JEA J;  2VUM B;  4BA1 I;  2WKC A;  2BE5 C;  1ONL A;  3TP5 A;  4EGV A;  3OWF A;  1DYQ A;  2NTS A;  3QIA A;  3A8K E;  1PDQ A;  3LX0 A;  1ZXT A;  1Y1W B;  2F0W A;  3HOZ B;  2A73 B;  2K04 A;  2RQX A;  1F2Y A;  1PMR A;  4FF3 A;  1JC7 A;  2EY5 A;  3I3C A;  2OXP A;  3K7A B;  4RH6 A;  3KLS X;  1NR4 A;  2JSO A;  1EU3 A;  2WKD A;  4ID6 A;  5JAV A;  1KLU D;  1QNU A;  5C5M A;  3NE5 B;  1H9J A;  1Y1V B;  2K32 A;  5M3M B;  3GTK B;  1CTM A;  4RGO S;  2DY8 A;  5G3L D;  3GV3 A;  4MN3 A;  5JEA G;  3IAY A;  1BCP C;  2KOL A;  4IUU A;  5C4X B;  1TQO A;  2FFK B;  1EY8 A;  3C46 A;  3SK5 A;  4CKC A;  1XYI A;  1B9M A;  2PW5 A;  5M9O A;  2FIN B;  4EQP A;  5D14 A;  3J80 E;  3D4R A;  3I72 A;  3RMH A;  1TT2 A;  3OPO A;  3K5L A;  2B8G A;  2LFN A;  2L5T A;  2DNE A;  3BDC A;  5CV6 A;  1CA6 A;  1A3V A;  1GUG A;  2H4O A;  1AN8 A;  1MSH A;  4C2M B;  1UAP A;  4RWS C;  2NWG A;  3VYU A;  1K8O A;  4ZUI A;  3D31 A;  5E4W C;  3P1H A;  1XXG A;  1LTG D;  4CBV A;  1DOM A;  2Z4I A;  2A6E D;  1XWE A;  2R3Z A;  5CV7 A;  2MGS A;  2AQ1 B;  1TII D;  3BVG A;  4ME5 A;  4QUF A;  5KIX A;  2QCP X;  5ELE A;  3TP8 A;  2R92 B;  3DWP A;  5KND A;  1OXV A;  4B9W A;  3S16 B;  5BN4 A;  3I73 A;  2E2I B;  2SNM A;  2RDG A;  2F3V A;  3Q22 A;  3KF8 A;  3M4O B;  3OIQ A;  4F88 A;  3HZX A;  2E2D C;  3MHB A;  5JOB A;  1PRT C;  1ESF A;  2HQE A;  2XIW A;  3GTG B;  1A6X A;  4ZLT F;  2NVX B;  2F0D A;  5C0X J;  3I4M B;  4C56 C;  2B2T A;  2FJ2 A;  5KEE A;  4DK1 A;  4L8J A;  1STA A;  2NN6 I;  3M3Y B;  1I6H B;  3I4N B;  4LK1 C;  4RCO A;  2Q8T A;  4FYD A;  2Z1C A;  5IOC A;  1JIC A;  5K5P A;  5A35 A;  4FXG C;  1HTP A;  3HOU B;  1BCP F;  4IQZ A;  1Y8P B;  4X3U A;  3S1M B;  5C6A A;  4IFD I;  3SXH A;  2IX3 A;  2IX1 A;  5JVH 3;  1QJO A;  2L9H A;  1XTC D;  5BN3 A;  2IWH A;  3D6W A;  1TWC B;  4RHR A;  1DJR D;  3R3O A;  1LLR D;  1EY0 A;  3E0J A;  2B2W C;  2HCC A;  4E6I A;  3TZU A;  2K5D A;  2A74 C;  4QF4 A;  5COR A;  1CQF A;  3PO2 B;  3HEJ A;  4KV6 A;  4IZ8 A;  3R2I A;  3RD4 A;  5I4D A;  2E76 C;  1JWU D;  5A2Q L;  1Q1E A;  5IT9 L;  1O7L A;  1T5E A;  4ZAI A;  1KAA A;  3H0G B;  1SNP A;  2K5W A;  4ZRZ A;  3K57 A;  1V8Q A;  1WTV A;  1PFB A;  1WTR A;  2XVS A;  1F9R A;  3LWE A;  4IAL A;  1I4X A;  3K5N A;  1L0Y B;  3VYS A;  4IFD G;  2EJM A;  3CHB D;  1GUT A;  2CW0 D;  3CRL C;  1V43 A;  3U9S A;  1S5B D;  1Z6H A;  3T51 B;  5A2Q E;  3JAM L;  3T56 B;  4XYO A;  2L4N A;  1TY2 A;  3GD7 A;  3LWU A;  3ZYY X;  1DOK A;  3QB3 A;  1M4V A;  1OXX K;  1J8I A;  3C1F A;  2NN6 G;  1TWF B;  1S5E D;  1NCV A;  4A3G B;  2KEC A;  1FNW A;  5EGT A;  4IUT A;  3GP7 A;  1OXU A;  1X3Q A;  5EKI A;  4RA8 A;  1SND A;  1Q1B A;  3NTK A;  4KJN A;  4H44 C;  1QB5 D;  1T5X D;  1SYF A;  1BCP B;  2B2Y A;  1YNJ C;  3HG9 A;  2K05 A;  2E2J B;  3AMU A;  2R61 A;  2WV6 D;  5DM7 3;  2K6A A;  3VYR A;  5EKL A;  5EQ0 A;  2EYF A;  5AFW A;  4NW2 A;  4WJW A;  1SE3 A;  3S1N B;  2ID0 A;  1ML0 D;  2PZT A;  1Q12 A;  4S3S A;  5LHY 1;  2PPB C;  1B3A A;  2AUJ D;  1JOO A;  1OXT A;  4QCL A;  2JYO A;  2CVR A;  4OO1 I;  2EVB A;  1GOZ A;  4OIJ A;  2M00 A;  3ND9 A;  1LT3 D;  4X3T A;  4R8I A;  3G7L A;  3GO5 A;  1STB A;  3NXW A;  3DEP A;  2HDM A;  5C4Z A;  1SYG A;  3H91 A;  1JOQ A;  4LMQ D;  3KBX A;  5CBE E;  3KK7 A;  4A3I B;  4I65 A;  5C4J B;  1II3 A;  4C3J B;  2PZW A;  1A2U A;  2D9U A;  4XQJ A;  1SBB B;  5C4H A;  1UEA B;  3MTS A;  4G4K A;  4ABN A;  3RZO B;  2O2L D;  2YU9 B;  3L7Z C;  3X3N A;  1WTW A;  5JVG 3;  2L1B A;  3MFG A;  1NR2 A;  1Z47 A;  4A3M B;  2RDF A;  1UNS A;  4WOR A;  5IGE A;  3DWA A;  3HOX B;  2KJX A;  1AP0 A;  1PXU A;  3P7J A;  2K03 A;  3PIO 3;  4XT3 B;  5D3I B;  5FKA C;  5C0X G;  1CQV A;  3NPP A;  4TSS A;  5K36 H;  3PUZ A;  4KD3 A;  4KKU A;  1FD7 D;  1WD1 A;  3G6J B;  1EOT A;  1I6V C;  3M4Y A;  1QNK A;  4RAU C;  3J80 L;  1A2T A;  1HTL D;  5HGT A;  2F0H A;  3NP8 A;  5EBC A;  4N9T A;  1EL0 A;  1TS4 A;  1F9Q A;  2K28 A;  3S9W A;  3M7G A;  5CBA E;  2EYH A;  4JBW A;  5M5X B;  1SFO B;  5ISR A;  1A3T A;  4RGT A;  5DM6 3;  3TN2 A;  1M8A A;  1I4R A;  5EBD A;  3E5S A;  2F0E A;  3A55 A;  3NHH A;  3FVQ A;  1ILQ A;  2EY6 A;  1TU2 B;  3ERO A;  2B2U A;  4TKO B;  3U9O A;  2ENB A;  3EFX D;  1YNJ D;  3HKZ B;  2GA4 B;  4CJ0 B;  2WII B;  1MSG A;  4XQQ A;  3VA5 A;  1CFM A;  2KCC A;  2PNR C;  2EJG C;  1DXM A;  1PFM A;  1PTO D;  3TP7 A;  2PQE A;  4IFD H;  1SMY D;  3BZD B;  3VR4 A;  4F7X A;  1SE4 A;  4J1M A;  1STG A;  5FK9 C;  2SOB A;  1AW7 A;  2F1M A;  3S2H B;  2EE1 A;  1SSO A;  5CV9 A;  3A7L A;  3WOF A;  1BNZ A;  2K01 A;  4B9X A;  1GJX A;  2F0M A;  3OIP A;  2A69 C;  4M8A A;  4H0L C;  1F2M A;  3S1Q B;  1D5X C;  2LS0 1;  3F2U A;  3FPP A;  4J8Q A;  2XWJ B;  4HED A;  2X6G A;  4NMZ A;  3Q24 A;  1HCZ A;  2KUM A;  4L6T B;  3T13 A;  5TSS A;  2EYM A;  3HOY B;  1RDP D;  4CJ2 C;  5CGK A;  3FRP B;  1QWY A;  1HHV A;  4DAP A;  2JE6 I;  3D8G A;  4B08 A;  3NQI A;  2F0L A;  1ZYR C;  4N9P A;  2G9D A;  3Q6S A;  2TMP A;  2KQ3 A;  1PTO B;  2MPM A;  1RTO A;  4R9W A;  2D62 A;  1B44 D;  3KLS A;  5J1Z A;  1S5C D;  1B9N A;  5E3F A;  3URY A;  5CV4 A;  3BVZ A;  1BOS A;  4UAI A;  2D2C C;  1HXY D;  2R93 B;  3IKJ A;  4BY7 B;  2BE5 D;  4A3J B;  1ET9 A;  1VCI A;  1H9S A;  2J7Z A;  2IW3 A;  2WB1 B;  2NZ1 D;  3MXU A;  3WOE A;  3H94 A;  1LO5 D;  2JA7 B;  2A5H A;  3PIP 3;  1JE4 A;  1IL8 A;  3CU7 A;  2XRS D;  2RA4 A;  5ELF A;  2WP8 J;  4IUQ A;  2NB0 A;  5IGD A;  4XTC S;  5IGB A;  3GTL B;  3FPU B;  3MFY A;  3SHL A;  1ZYR D;  1PTO C;  2F0V A;  2B2Y C;  3MA2 B;  3HOV B;  1F2Z A;  4BY1 B;  4AYB B;  3BG3 A;  3I91 A;  3NK9 A;  4G57 A;  4DXF A;  2B2V C;  1B53 A;  4QUC A;  3OMC A;  3A8J E;  1SEB D;  4J6H A;  3D6C A;  4NDX A;  2K1B A;  1H9K A;  3S2D B;  2QF7 A;  3NSW A;  2JP1 A;  2AQ3 B;  4EQO A;  4KI0 A;  4CHT B;  1TWG B;  1STY A;  2A69 D;  2M9V A;  2IX0 A;  2QDB A;  1GXD C;  3GV6 A;  3Q23 A;  4OO1 G;  4IN3 A;  4YIJ A;  3H3V C;  1C8C A;  4A3E B;  4PMC A;  3SEB A;  1WVL A;  2VB2 X;  1LT4 D;  1VF5 C;  1RKN A;  4KY5 A;  2B63 B;  4HCS A;  4V19 0;  3R93 A;  3D4W A;  1R9T B;  4K8J A;  1DM0 B;  2VXW A;  3T4A C;  4XT1 B;  4BA2 I;  1ILP A;  1PRT B;  5FLX L;  4DA2 A;  4HTH A;  5KYL A;  1B4O A;  1RTN A;  2EJF C;  3ERQ A;  4H13 C;  4K6L A;  3ITP A;  5C44 B;  4X3S A;  1QIL A;  3QO2 A;  2KVM A;  3NTH A;  3K59 A;  4MHE A;  1EEF D;  1FNV A;  4C3I G;  1HUN A;  2B2W A;  4O42 A;  2J0T D;  5C5L A;  4C3H G;  2F0S A;  5M5Y B;  2VB3 X;  4U67 3;  4HCE A;  4KKT A;  2EXZ A;  2ZXO A;  2NUC A;  1LAC A;  1Q8I A;  1IW7 C;  1G6Z A;  3D3R A;  5EPJ A;  1A15 A;  2JA6 B;  2Q8R E;  1UUP A;  4IUR A;  4ULL A;  3VR6 A;  3HGB A;  4FVM A;  3VR3 A;  1BXT A;  4V0B A;  2VNU D;  1LTT D;  2BA0 A;  3C1E A;  2NN6 H;  3FMC A;  3LNN A;  4XIG S;  1WD0 A;  5I6W A;  2O4X A;  1WTO A;  2RSO A;  2FHT A;  3EJI A;  1PFN A;  2QEJ C;  1F2L A;  2DN8 A;  1SNQ A;  5CV8 A;  2RKS A;  4ODG A;  2MP1 A;  4FF4 A;  4FXK C;  2ZT9 C;  4OO1 H;  2A68 D;  2R6G A;  1D5M C;  2PZU A;  2F4I A;  5IGC A;  1SNC A;  1PTO F;  2F0T A;  3C2P A;  3R8B A;  1LTR D;  4C1N I;  5CR3 A;  1PRT F;  3HS0 C;  1YNN D;  1G8Z D;  1HFN A;  1I4G A;  4ZYS A;  3MEH A;  5C3W A;  1BUV T;  4NP5 A;  2F0J A;  1PZJ D;  1GUS A;  2OF1 A;  3C3L A;  2D5D A;  4KY6 A;  1AZP A;  4RHS A;  2PO4 A;  3L3O C;  4XQN A;  2J4X A;  4A3B B;  1VDZ A;  4K14 A;  1I4H A;  3JAM E;  1DCZ A;  3S1R B;  2JA5 B;  2IT1 A;  5KNB A;  1SAP A;  3QJY A;  2E2H B;  4PNY A;  4HMJ A;  3D4D A;  1S5F D;  4HSP A;  2JEA I;  3OOC A;  1PRT D;  1RJT A;  1CK1 A;  1BQQ T;  1B50 A;  4KMU C;  3AB9 A;  3HRZ C;  1H9S B;  1RF2 D;  4KK7 A;  3MC0 B;  3MZ5 A;  4H7B A;  2L55 A;  4CGY B;  4FO2 A;  4KHV A;  2RDH A;  5DEH A;  5JJZ A;  2A6H D;  5ELC A;  3EA6 A;  1SXT A;  2EYL A;  4ZKB B;  4QB4 A;  2WAC A;  5E4X A;  1J9O A;  1A3U A;  1BO0 A;  1TKW B;  5JPN C;  1L0X B;  1X32 A;  2PCF B;  4ZUJ A;  2NYZ D;  4PMW A;  3IL8 A;  3J81 L;  2V4D A;  3GTQ B;  3J7A F;  1EYC A;  2O5J C;  4QMG A;  1CHP D;  1V1O A;  1QG7 A;  3DHQ A;  1O80 A;  3TDQ A;  4Q0F A;  3FKI B;  4PV1 C;  1KLG D;  2YYZ A;  5I2Y A;  1GUO A;  4IFD J;  1LTI D;  4BWG B;  5I9P A;  1G2T A;  3J7A V;  1WTQ A;  1RHP A;  5LL6 S;  1EFI D;  4FNF A;  3S17 B;  5KNC A;  3SVM A;  1FGB D;  4DF7 A;  3BS1 A;  3V96 A;  3GTP B;  1SNO A;  3AU7 A;  4BS9 A;  1X3P A;  1JR0 D;  1NUC A;  5IGG A;  1ENF A;  4O1N A;  3MXG A;  4CKE A;  3W3A A;  2F0I A;  2FMC A;  2B8F A;  1G91 A;  1KDA A;  2K33 A;  3O13 A;  1ENC A;  5C3E B;  1EY4 A;  4C3I B;  3BYT B;  2X6L A;  3N52 A;  4JK1 C;  2NVY B;  2EYJ A;  2F0G A;  1STN A;  2CW0 C;  3GTM B;  4F87 A;  5FO7 B;  2JXM B;  2F03 A;  3A54 A;  4OIK A;  1EZ8 A;  3OMG A;  2EPB A;  1IYV A;  2SEB D;  1XX8 A;  2A68 C;  2LY7 A;  1HRJ A;  2G9H D;  1JOK A;  1PYW D;  2B39 A;  1K8M A;  3H6M A;  1IHZ A;  1EIG A;  5J39 A;  2I07 B;  4R8N A;  4FF1 A;  3TP6 A;  1CZW A;  2TSS A;  4A3D B;  2E74 C;  1SYE A;  1HFG A;  1CHQ D;  2L11 A;  3S14 B;  4LJZ C;  3NBH A;  4XYQ A;  5C0X H;  3VYT A;  3VR2 A;  3VA7 A;  1SYD A;  2AUK A;  3SK4 A;  1QE6 A;  2NVT B;  4TQU S;  2I46 A;  5COY A;  3NWS A;  2KEE A;  1OO9 B;  4FP5 D;  1S5D D;  2N88 A;  1DON A;  3I4L A;  3V05 A;  1TVX A;  1C4Q A;  1CI3 M;  3MVV A;  3HP3 A;  1CA5 A;  4EVO A;  2XWB B;  4C1N K;  4F8M A;  1GUN A;  3SR1 A;  2CQA A;  4CJ1 B;  2K7V A;  1V1P A;  2A6E C;  2OEO A;  1ESR A;  4TRD A;  2IJ0 A;  4DAV A;  1H9R A;  3A8I E;  3MAQ A;  4DFA A;  4CKB A;  5CYU A;  3PV0 A;  1CM9 A;  4K5V A;  1GHJ A;  3SE0 A;  4K5W A;  3I70 A;  1V1P B;  3RLF A;  4DAY A;  1STE A;  1HQM C;  1YNN C;  2Y0S B;  1MGS A;  1NAP A;  4C3J G;  2B2T C;  1F77 A;  3E6Z X;  3PUX A;  2IPK D;  5ELB A;  1KDB A;  5FOB B;  5FO9 B;  5DAU A;  4IUN A;  2WAQ B;  3PUY A;  4ZQ3 A;  1D1K A;  2ICE C;  1QCB D;  4KTA A;  1I4Q A;  1GHK A;  1ZEQ X;  1HA6 A;  3NBI A;  3SK6 A;  5J22 A;  1D1I A;  3OSO A;  1U9R A;  3DMU A;  3EQL C;  5NUC A;  2EY2 A;  3CQZ B;  1AFP A;  1EQT A;  3M7N A;  4WFN 3;  5IOD A;  1CT1 D;  1PZK D;  1O7Z A;  3QOJ A;  1MI2 A;  4WRD A;  4G7O C;  2L0C A;  3I90 A;  1I50 B;  5I9O A;  3L9A X;  1RCV D;  3K58 A;  1I3Q B;  2A6H C;  3J81 E;  5IIF A;  2BDN A;  1EIH A;  5EPK A;  1TWH B;  5M3F B;  1F9P A;  3W2D A;  2XN9 C;  5FO8 B;  2F0N A;  2Z8L A;  1MBY A;  1VF7 A;  2FMM A;  4HMI A;  1EQV A;  4M1U B;  3TSS A;  1AEX A;  1Y8N B;  1Y69 U;  5CC4 A;  2QIL A;  2MJ8 A;  4IUV A;  1KDC A;  1R4Q B;  1Q90 A;  3MWY W;  2F3W A;  5I2X A;  4P2C B;  1ET6 A;  1SYB A;  2KED A;  2XNA C;  1EY9 A;  1LV9 A;  4K8I A;  5F2D A;  4KHZ A;  1BBX C;  1R4P B;  5HUR A;  1HUM A;  2LKV A;  1EZ6 A;  4Q5V A;  1BF4 A;  1O7Y A;  2KA7 A;  2Q8I B;  2PW7 A;  3R2T A;  1BCP D;  1DD2 A;  5K36 G;  3WDN A;  2KCN A;  4A3K B;  5D65 A;  2R7Z B;  1KNE A;  1HPC A;  1RD9 D;  5M5W B;  1EEI D;  1WTP A;  1W6J A;  2F0U A;  2BCO A;  1STH A;  2EOT A;  3T53 B;  1KAB A;  3V2T A;  4RKL A;  2NBF A;  2HDL A;  1WTX A;  3KBG A;  2RVL A;  1DZ1 A;  4QIW B;  3DWQ A;  1LTS D;  3BYY B;  1IYU A;  2L12 A;  2EYO A;  4G7Z C;  1NSN S;  1EY7 A;  2ZXP A;  3GTJ B;  4KN7 C;  3PMF A;  4HR7 B;  5DNF A;  2ZXR A;  2OT2 A;  2BOS A;  2CHB D;  1ENA A;  3PUW A;  2WIN B;  3K0Y A;  2F0P A;  1CZG A;  1PTO H;  4XDX A;  1BR9 A;  1TR5 A;  1AZQ A;  3EVQ A;  4OL7 A;  2F0O A;  3QWN A;  4XXE A;  3GQB A;  3RUZ A;  4GZY C;  2B2V A;  1D5Z C;  4UDU C;  5EJW A;  2H1E A;  4BBS B;  2HUG A;  4RGN A;  3IFD A;  5KGU A;  4OGQ C;  3CKI B;  1SJE D;  4DK0 A;  1QOH A;  3RZD B;  2DY7 A;  5G3L F;  2KHS A;  4A3F B;  5KYI A;  1TWA B;  1LTA D;  3H09 A;  1JB3 A;  4C3H B;  2PYK A;  3DXJ C;  3T16 A;  1ROD A;  5IGF A;  3I8Z A;  3BDO A;  2E75 C;  2EYP A;  1FNU A;  1MD2 D;  1Z7T A;  2Z4H A;  1W6K A;  1HA5 A;  4ZK9 B;  1EY5 A;  2LMC B;  1I4P A;  2F0Q A;  4DNR B;  4DU9 A;  3ND8 A;  1G2S A;  3NQT A;  4HSV A;  1HQR D;  1LT6 D;  1TS5 A;  2MHV A;  5E1F A;  4ZKC B;  4HN7 A;  4KKS A;  1TS3 A;  2JEB I;  5ELD A;  2C5C A;  5FLX E;  2BDO A;  1LT5 D;  1D2B A;  5EPL A;  5CV5 A;  2SDF A;  2JA8 B;  1U4M A;  1SDF A;  1VMP A;  4U68 A;  2AQ2 B;  2F0K A;  1EYD A;  3DUZ A;  2B2U C;  1LAB A;  3MXP A;  5KRU A;  1GUW A;  1IKL A;  5CMD A;  3S15 B;  3Q0A A;  4FF2 A;  3IFT A;  3K5O A;  4KN4 C;  1DOL A;  4A93 B;  2C9O A;  4I7Z C;  2RBM A;  4L63 B;  1EY6 A;  2RSN A;  2N55 A;  1PLF A;  2XSC A;  1VMC A;  2NVQ B;  1G29 1;  4K2L A;  1S4Z A;  4X3K A;  5IT9 E;  3OWE B;  3UI2 A;  3QOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...