4NXNQ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nxnQ00
1IZ6A 4NB3A 4A3EG 2UUBQ 3CCQA 4HIKA 3TREA 1Q7YC 3S2HH 1K73C 2VL6A 4JI5Q 5IT9c 4DV0L 5IYBH 3U58A 5LMNL 3PF5A 2NVQH 4NXML 2VUMG 5HGQA 2ZM6L 4R1JA 3TRZA 4A3LH 4YY3Q 4X64L 1G291 2K5NA 4POGA 3BZKA 4X6AH 5JJKA 1Q86C 4DV7L 2WB1E 4P72A 3JC66 1MJEA 3BU2A 2UUCQ 1N34Q 5M5XH 1VQCA 1IBLQ 2Z6KA 4UP7A 1X3EA 2WP8J 3HOZH 1M1KC 3PO3H 4GN3B 1ASZA 2ES2A 2BA1A 2Z6KC 1X3GA 1U0LA 4PZ6A 1AE2A 2ZTDA 4UP9A 4LFCQ 4O0AA 2AWOA 3A5UA 1XMQL 2CWPA 3CD6A 4IJLA 5C0XJ 1GD7A 2MFIA 4IO9A 4YHHL 1LYLA 2MO1A 3F2BA 3CCMA 2FXQA 2K5HA 1X55A 3M4QA 4DK3C 3HFZB 1J5EQ 3F8TA 3CPFA 1HNZQ 2E2HH 1HNWQ 2PI2A 3CF5A 2WB1G 5JJLA 1L1OC 4QGUA 3CCJA 2E2IH 2XTIA 2IT1A 1FJGL 3STBD 4A3IH 4DNIA 3FKIH 4JYAL 4IPGA 2GN5A 4LF9Q 4O2DA 4DV1Q 2RCNA 4JCVE 2ZM6Q 3UDIA 3ZJYC 2OTLA 3STBC 2GVAA 2VQFL 2N3SA 5IYDH 2K4KA 3J81i 1SLJA 3B6YA 4JV5L 4IFDJ 2Q2TA 4DV7Q 4NXNL 4A75A 1X3FA 4A3KG 4LFBQ 2GVBA 2D0OA 3TQYA 3AEVA 3GTKH 2EQSA 1SRUA 4JC0A 3KJPA 3UDGA 1VQMA 3KFUA 4LUZA 4DUYQ 3H3VI 3CC2A 2AHOB 5GAHC 2CWAA 1TWAH 5IYBG 2AMCB 3MXNB 1VQJA 1CSQA 3U4VA 5EAYA 4YWLA 2Y0SE 3RLNA 4DR7L 2PQAA 4LF7L 1GM5A 1VQLA 1E3PA 1RL2A 2JA9A 3OTOQ 3G6EA 4HJ5A 2VZAA 3HOXH 3CP0A 4LF4L 1UE1A 4A3EH 1MKHA 4HIMA 2EIFA 2ID0A 1HR0W 1KRTA 1QVFA 3GTLH 1HZ9A 2NVYH 4A3JG 4XIGS 3SGIA 1D7QA 2JJQA 3PV0A 2VUMH 2B3GA 1CKNA 2PQAB 4LW1A 2VQEL 1L2FA 3U4ZA 4AQYL 2HHHL 1H95A 4DV3L 3KDFA 3CAMA 1IBKQ 1S72A 1XJVA 4KI0A 1Y1VH 1I3QH 3W1BA 2VQFQ 2ASBA 2E5LL 2KCTA 3CCLA 3ER0A 3I4MG 3HKZE 4NXNQ 2NZOA 1X54A 1HNXQ 5C4XG 4X62L 2Y0SG 2OCEA 3KF6A 2UXDL 1VQBA 3AFPA 1W3SA 3PSIA 5C0XG 4A3IG 1WCMG 4YY3L 4JBMA 3FHWA 4GOPA 3HOYH 4DR5L 2F52A 4B3TL 3EIVA 3K8AA 4YWMA 2PMZE 3CMAA 3GD7A 4GOPC 1EQQA 4DR7Q 4LF7Q 1HH2P 5ELOA 3KJOA 2IHFA 2N8NA 2D0PA 3WWVA 2JA6H 2RHQB 4UY8C 2B63G 2OQ0A 1K0RA 3J80c 2I0QA 3S1RH 1WOCA 1PH3A 3NBHB 2KHJA 1JMCA 4IPCA 1PH9A 4C3JH 1VQFA 3HKZG 3S15H 3S1NH 5DLQE 4IOCA 1HZBA 3M7NA 1B70B 1GKHA 5C44H 3HKSA 4IFDG 4LF8L 1K8AC 2K75A 1B7YB 1WI5A 4AQYQ 2YTXA 4XTCS 2CKZB 4DV3Q 4KLKA 3T1HL 4JI4L 4A76A 4BBRH 2VW9A 4JOIA 1G51A 1UE6A 1J5EL 3M4PA 3L2PA 3HOXG 3KF8B 2Q2HA 5ELNA 1HNZL 1EYGA 4QL5A 2E5LQ 4A3KH 1HNWL 1S40A 4AYBE 4JOIC 3I55A 3AFQA 1VQOA 5GAGC 4X62Q 4L5QA 2ZJQA 4B3RQ 1N32L 1AE3A 1JJGA 3G71A 1YITA 2UXDQ 1BBUA 2ZTCA 1YI2A 2V1CC 2YV5A 3UDXA 4LF9L 2H5XA 3PUWA 4DV1L 2Q2UA 2HT1A 3A5ZB 4GKKQ 4DR5Q 5IWAQ 4Y7NH 1E1TA 4DV5L 1Y1VG 3ULLA 4B3TQ 3IRBA 4JI1L 2JA7H 3PCOB 4LFBL 3K7UC 1C0AA 3Q8DA 4OWTB 5IYCH 1EIFA 3K7AH 4J15A 4DUYL 1SN8A 4POFA 3D31A 3M85A 4A3CH 1WFQA 1I94L 5M3MG 4A3JH 1I5FA 1LUZA 5GQOA 3ICEA 1KHIA 3CQZH 4AYBG 3S17H 2A19A 1GVPA 2KENA 3HOYG 2R7DA 4MNOA 5M5YH 3K0XA 1PYBA 1IL2A 1GO3E 4GLVB 4LF8Q 3OTOL 4JI4Q 3T1HQ 3H15A 2HIVA 1TWHH 1BVSA 4A3BH 2BH2A 4R4IA 2JA6G 1EWIA 3I4MH 3PUXA 4GS3A 1SFOH 5C4XH 4HIDA 4MTNA 3TS0A 5C0XI 2JEAI 3PIOA 1VQGA 5IP9G 1N32Q 2NN6I 1S3OA 3K81C 4LNQA 1CUKA 2IX0A 5FLXc 3KOJA 2K5VA 1WCMH 5C44G 2MNAA 1IBKL 2VS1A 1VQ6A 1NBWA 1YJNA 4BBRG 1UWVA 4YWKA 1K9MC 4DV5Q 3I4NH 5LMNW 2JQOA 4JI1Q 1V1QA 3PGZA 4LFAQ 1HNXL 4B3ML 2Q2IA 3S1QH 1VQ7A 4A3DH 2B63H 1CSPA 1O7IA 4EQ5A 2UU9Q 4HJAA 5C3EH 1QZHA 1HZCA 1W2BA 4GN5A 1X56A 1PH1A 3ULJA 1I94Q 4IFDI 3RR5A 3K80C 4FDBA 1M90C 1BKBA 3RLOA 1JJ2A 1EUJA 1YZ6A 3GTPH 4L5TA 4C2MH 1RIPA 1X6OA 2JA5G 4LF5L 1V9PA 3G4SA 1PH4A 2JA7G 3GTJH 5GROA 2VNUD 1Y1WH 3TEHB 2YTYA 4NPSA 5IP7G 3S16H 3L0OA 4QY7A 1OXTA 2LXKA 4DPGA 5IYCG 4K0KQ 1YHAA 3CPWA 3CCRA 4C3HH 4A3CG 4WJ3M 1XPRA 3CW2C 3GTMH 4AIMA 5LMUL 2E2JH 3J80i 4H02A 1Y14B 4UPAA 2YU9H 2N78A 2JEBI 1SE8A 4R4OA 4C3IH 1XPOA 4OX9Q 3CCEA 2RF4A 2XGTA 1Q82C 1N36Q 4DKAC 1JT8A 4A3BG 1TWFH 3GTGH 1QUQA 2R7ZG 2NZHA 2JA8G 2HQLA 1HR0Q 4B3MQ 4BBSH 1YVCA 4GNXB 4B3RL 1V43A 2F3IA 4L5SA 3E9IA 4IPHA 1QZGA 1R9TH 2ZJPA 1YBYA 2OQKA 5M3MH 1IBMQ 1VQ5A 4JBWA 4A3GG 2R93G 1A63A 2DGYA 5BR8L 4GKKL 2JE6I 3JAMc 5IWAL 2K14A 3HOUG 3E0EA 1QUQB 4YCWA 4DR2Q 4DR1Q 1IYJB 3CCVA 3I4NG 3AQQA 1WJJA 4LF5Q 1VQ9A 1PFSA 3TS2A 2AKWB 5GADC 1E1OA 1KL9A 3BJUA 5J3BA 3CCUA 4A3DG 1FVIA 1P16A 1VQ4A 4BA2I 5M3FH 4GN4B 2UXCL 1Q8KA 5C3EG 2MO0A 1KC8C 1PH6A 1PH5A 3ERSX 2A1AA 1DGSA 1LM0A 1VQDA 4A3MH 5IP9H 2QA4A 3UE1A 1NJIC 2CQOA 3MEFA 5LMUQ 3RNUA 3A74A 1P8LA 2I5MX 4P74A 3RN2A 5IY0A 4P71A 1Q46A 4B3SQ 4TQUS 3DLLA 4GLAC 4BY1G 4MZ9A 3NEMA 2OTJA 1Y1WG 4R4TA 5H1SE 2Z0SA 2CCZA 1VQNA 1VQHA 3PO2G 1KRSA 1JJCB 5FLMG 1Z47A 4ALPA 1Z9FA 1EQRA 2HIXA 4JBJA 1EOVA 4X66L 1L0WA 1Q81C 1PH8A 3HOWH 1MJCA 1J6QA 1YEZA 3T1YL 4RG1A 4JI2L 5BR8Q 2ALYB 3VDYA 4QJFA 5C4JH 4KHPL 2R7FA 1A0IA 4RMFA 2JA5H 3D0FA 3M3YH 4LFAL 4A93G 1A62A 2N49A 1XNQQ 4DV4Q 4DAYB 5IP7H 2UU9L 4BBSG 3M4OH 1YHBA 3J81j 1KD1C 4AH6A 3BZCA 2UXCQ 1VQKA 1NY4A 1NMGA 3UDFA 1CKOA 2I5LX 3DM3A 1IXRA 4WJ4A 2B29A 4DR3Q 3CC7A 1KIXA 1AH9A 2K50A 4PZ7A 3CXCA 2UUAL 2A8VA 4DR6Q 4GLXA 4LF6Q 4JI7Q 1N33Q 4BXXG 5FJ8H 4GKJQ 1D8LA 1XNRQ 3OW2A 4DR4Q 4DK6C 3CMEA 2UXBQ 3HOVG 2R7ZH 2MQHA 1KAWA 2JA8H 1YNXA 2K52A 4K0KL 5M3FG 2EXDA 2IX1A 2PNHA 3PUYA 4A3MG 1YHQA 3H0GH 4X66Q 1E22A 4IOAA 1PVOA 2JK8A 2I5HA 4DV2Q 3RZDH 4A3GH 1XMOL 1N8RC 2R93H 2F4VL 2IY5B 1SMXA 1FGUA 1TWGH 4OX9L 3T1YQ 1Q1EA 3HOUH 4HJ7A 1N36L 4JI2Q 5GAEC 2BA0A 2IHEA 4KHPQ 1NTGA 1ASYA 2NVTH 1HR0L 1YJ9A 4OONA 3CCSA 4Y52H 3EBEA 1U5KA 4IJHA 2D62A 1K3RA 1L1OA 4DAMA 3RN5A 4PZ8A 1VQIA 4BY7G 1IBML 1KQSA 3HOWG 1EIYB 4EX5A 3S14H 1OXSC 3F1ZA 4PG3A 3W1GA 2WAQE 4DR2L 4DV0Q 4DR1L 2UUAQ 1VQEA 5LMNQ 5JEAG 1JB7A 1X65A 2YYZA 4NXMQ 2KHIA 2ZTEA 3AYHB 4BY1H 1B8AA 1BBWA 1EFWA 4YCVA 4X64Q 3JAMi 1PH7A 5AJ3L 4OO1G 1L1OB 4YCUA 1K8GA 3UE0A 3J7ZC 4JG2A 3PO2H 1CKMA 3GDEA 5FLMH 2QGQA 4QIWE 3F2DA 1HJPA 4A3FG 1YJWA 4A4IA 1FL0A 1OXUA 1QVCA 1SR3A 1UE7A 3I7FA 4LUVA 5HY6A 4JI3L 1VS0A 2LSSA 3OYYA 4P75A 4HIOA 3PIPA 2WFWA 4GNXA 4L5RC 2R92H 5JJIA 3PUVA 1VQPA 4B3SL 1XMOQ 4GNXC 2L15A 2ZJRA 2KBNA 2F4VQ 1K83H 2C35B 3LGJA 1SROA 2RHSB 3H3VH 4DV6L 5FJ8G 4A3LG 4JI0L 1XMQQ 1JE5A 4A93H 3RZOH 3KYHC 3M9BA 4BA1I 3GTOH 2WAQG 4JI6L 1PHJA 4YHHQ 1OTCA 2ATWA 4LUOA 1LTLA 2YTVA 3I2ZA 1OXVA 4JI8L 3FP9A 4P73A 1XTDA 3NELA 4X65L 4LWCA 1PV4A 3H0GG 3HOZG 1VQ8A 4TVAB 5K36G 3PO3G 2R6GA 1NMFA 3I56A 4HJ9A 4OWWB 2VY3A 1QVGA 4BXXH 1FJGQ 3J81c 1KXLA 4JYAQ 1XNQL 4DUZL 4DV4L 3S1MH 2LXJA 2NVXH 3HOVH 1TXYA 5AJ3Q 2KCMA 5M5WH 1E7ZA 4JBKA 2CFMA 3W5OA 4JV5Q 1G6PA 4ME3A 2UUBL 2QEXA 1C9OA 1HZAA 1VQAA 3A0JA 2AWNA 3PF4A 1XPUA 4DR3L 1CKNB 4JI5L 4APVA 4JI3Q 1PYSB 1PH2A 4DR6L 4LF6L 4JI7L 1N33L 1I50H 3KDFB 5IE8A 1NE3A 1TWCH 3FKIG 4GKJL 1YIJA 1T9HA 1XNRL 2NN6G 4R4QA 1A8VA 3S24A 4DR4L 4DV6Q 4HJ8A 2UXBL 1UEBA 5IYDG 4JI0Q 5JEAJ 2UUCL 3GTQH 1C7YA 3G48A 5E7NA 1Q12A 4PMWA 1N34L 3KF6B 4JI6Q 1UE5A 2OWOA 2E8GA 3KLWA 1IBLL 1VCIA 4JI8Q 1MIUA 3PUZA 4X65Q 3J7A5 1PA6A 4BY7H 4LF4Q 3L7ZC 4DV2L 2PI2E 2R92G 1OXXK 3I4OA 4GOPB 3CC4A 4IPDA 1N9WA 1X9NA 3GO5A 3F2CA 4LFCL 2BH8A 1WYDA 3EN2A 4OO1I 4KHZA 3RLFA 2DUDA 2VQEQ 4R4CA 3ULPA 2HHHQ 4QQBX 4OWXB 3E9HA 4DUZQ 3U50C 3S2DH 1E24A 1I6HH 4UP8A 1Q1BA 4OXPA 3NENA 4A3FH
chains in the Genus database with same CATH superfamily
1IZ6A 1TWHB 3W2DA 2RA4A 3CCQA 1Q7YC 1BO0A 3BZDB 3HGBA 1UAPA 4DV0L 1EZ8A 1W6JA 3TRZA 4R1JA 4YY3Q 4X64L 3BVGA 3JC66 1MJEA 2UUCQ 2HDLA 1VQCA 2EY1A 1IW7D 1GUGA 4H44C 3MXPA 2OEOA 1CM9A 3PO3H 4GN3B 2ES2A 2BA1A 1JWSD 4LFCQ 2AWOA 3HKZB 1ZYRC 2FXQA 1J5EQ 1TY2A 3M4QA 3HFZB 2HCIA 1PTOH 2PI2A 4NDXA 5EBCA 3HOXB 4H7BA 4C3HB 3L3OC 4KKTA 2XTIA 1JE4A 2IT1A 5C0XH 1FJGL 2GN5A 1PDQA 2YU9B 5IODA 3TBIB 2F0WA 5IYDH 2EYMA 2F0IA 3B6YA 4JV5L 2Q2TA 4DV7Q 1X3FA 4A3KG 4LFBQ 1TWFB 2EQSA 1VQMA 3H3VI 5GAHC 1TWAH 3MXNB 4FP5D 1VQJA 5FO8B 1CSQA 3U4VA 1KDBA 4YWLA 1STAA 2EYLA 2CH4W 1PRTF 3CP0A 3MHBA 1UE1A 3LWUA 1HR0W 1QVFA 3KBXA 1BQQT 4XIGS 2H1EA 3S9WA 4FXGC 4LW1A 4KKSA 1L2FA 3U4ZA 3KDFA 2LMCB 1S72A 4RHRA 2VQFQ 1JQYD 2KCTA 4KN7C 3ER0A 2NZOA 5C4XG 2Y0SG 1F2MA 2UXDL 1TS4A 1WCMG 1RJTA 2O5IC 3N6RA 4YWMA 2PMZE 4HEDA 2EYJA 3CMAA 3H09A 2RHQB 3TZUA 4UY8C 2J4XA 3U9SA 4CJ1B 1WOCA 1LTAD 3M4OB 5C5MA 4IPCA 3HS0C 4C3JH 4K14A 4FYDA 3MXUA 1GKHA 4CBVA 1PZID 4AQYQ 2YTXA 3T1HL 1MI2A 2CKZB 4A76A 3KLRA 4KK7A 3KF8B 5ELNA 4DXFA 1EYGA 3I3CA 4ZYSA 3SVMA 4A3KH 5IOCA 1YNJD 4QCLA 5GAGC 2R7ZB 4B3RQ 4L5QA 1EYDA 4M8AA 2ZTCA 3LX0A 1QOHA 5EGTA 3UDXA 3I70A 3A55A 3MC0B 2Q2UA 2HT1A 3OIQA 4PMCA 4GKKQ 4QUCA 4DR5Q 2R93B 3A7LA 1BR9A 1Y1VG 5EPLA 1HRJA 2JA7H 4ZK9B 2KCCA 3I4NB 5CORA 4OWTB 5IYCH 1QJOA 1EIFA 4DUYL 1SN8A 4POFA 1IW7C 5C3EB 1LUZA 3ICEA 3BVMA 4HTHA 2A19A 1ONLA 4M1UB 5JPMC 3K0XA 1PYBA 5C6AA 5ISRA 3E0JA 4LF8Q 3KLSA 4DXGA 3IFTA 3H15A 2HIVA 2IPKD 1RODA 1BXTA 2SNMA 2JA6G 1OO9B 3PUXA 4GS3A 2WKCA 5C4XH 3Q24A 2G9DA 4RHSA 3EQLC 3SDZA 4C56C 3QIAA 4NW2A 5IP9G 2IX0A 1KTKA 4DFAA 1WCMH 5CC4A 5C44G 4FXKC 1IBKL 1VQ6A 5EKLA 2R92B 1STHA 3KBGA 1YJNA 1JB3A 2QILA 1UWVA 3N52A 4KJOA 4DV5Q 1Q3LA 1PFNA 1V1QA 4ZRZA 4B3ML 2Q2IA 4A3DH 4K6LA 4RFBA 3GTOB 1SJHD 4HJAA 4LK1C 4MIUA 3ULJA 1I94Q 3RR5A 1UNSA 3K80C 1ET6A 1BKBA 1JJ2A 1EUJA 3MZ5A 1SSOA 2FJ2A 3G4SA 1VMPA 2YTYA 3HOVB 1JWMD 1JC7A 1SNCA 1DOMA 2F0EA 1Y14B 4UPAA 1SMYD 2ZXPA 1SE8A 4R4OA 2CW0C 3SK6A 1SNOA 1XPOA 3CCEA 1JT8A 4A3BG 1U4LA 3BS1A 1QUQA 2NZHA 1HR0Q 4BBSH 2FMCA 2KUMA 2VB2X 2F3IA 3E9IA 3RD4A 1CK1A 1WTOA 1R9TH 1YBYA 1IBMQ 3NBHA 4KHVA 5E4WC 2DGYA 3HOWB 5JVH3 2C5CA 3JAMc 2PW7A 3HOUG 3E0EA 1IYJB 5KNDA 3AQQA 5KIXA 3TMEA 4CJ2C 3BJUA 4RGNA 2EYPA 1EYAA 5M3FH 5JJLA 4G4KA 1KC8C 2MO0A 1PH5A 2HDMA 1K28A 5IP9H 1B9MA 2XN9C 2QA4A 2IJ0A 5LMUQ 4KN4C 5A2QL 3AB9A 3S2HB 2Z4HA 1HTLD 4IALA 2QW7A 4R4TA 4K6DA 2CCZA 2BE5D 5FLMG 1JJCB 1Z47A 2B2TA 5JOBA 1EZ6A 1CZGA 4RGMA 1JWUD 1YNJC 4F8MA 5M5XB 3SR1A 1FNUA 3DEOA 3NE5B 3D6CA 4ULLA 5JEAH 1PTOD 4QIWB 3D0FA 1KLUD 3VYUA 4OO1H 2UU9L 1LT4D 2A73B 1YHBA 1GXDC 1KD1C 4AH6A 2UXCQ 2RBMA 1LLRD 5A2QE 2B2YC 3NUCA 1DONA 2Y0SB 4MTKA 2OXPA 1WTPA 2F4IA 3CXCA 2UUAL 4JI7Q 4BXXG 2E2IB 4K5XA 1F9QA 2UXBQ 1QNUA 3AU7A 4EQNA 4K0KL 2BDOA 2DJGC 5EPKA 1RKNA 3MVVA 3H0GH 4X66Q 4IOAA 1PVOA 2JK8A 3FVQA 1XMOL 3ND9A 5LHY1 2JXMB 2F1MA 1TWGH 4RCOA 3T1YQ 3HOUH 1N36L 1F9RA 5M9OA 1HXYD 4HSVA 1NTGA 4I7ZC 1JR0D 5D65A 2FFKB 4Y52H 1U5KA 4IJHA 4DN4M 3DWAA 3RN5A 4BY7G 1STGA 1H9JA 1PFBA 1EIYB 1E2ZA 1OXSC 1WD0A 3S14H 4WJWA 1G2SA 1SE4A 2WAQE 4DR2L 4DV0Q 4DR1L 1JB7A 4HN7A 1EY5A 2ZTEA 4KKUA 4YCVA 4X64Q 3JAMi 2NZ1D 5AJ3L 2F0DA 3UE0A 3J7ZC 3VR4A 1CKMA 5FLMH 1Y1VB 3OWEB 1YJWA 1G8ZD 4O42A 2PZUA 3I7FA 1VS0A 3PIPA 5JJIA 5CV6A 3VA7A 3PUVA 2A69D 4KY7A 5KYLA 2LKVA 3LGJA 3H3VH 1SROA 2N55A 3KYHC 1EOTA 3M9BA 4LUOA 1QZHA 3NELA 1QB5D 2R61A 2JA6B 3K5NA 4TVAB 1BBXC 1QVGA 4FF2A 1FJGQ 4BXXH 1KXLA 3S1MH 5C44B 3VR6A 5M5WH 2HCCA 4JV5Q 2UUBL 1XPUA 4JI3Q 1K8MA 3TN2A 1PH2A 1LTGD 2P5ZX 3BG3A 1NE3A 1TWCH 3FKIG 3LNNA 4H13C 1H9SA 1AP0A 1QILA 4JI0Q 1EU4A 3GTQH 2M2LA 3G48A 5E7NA 1N34L 4JI6Q 2K28A 1VCIA 4JI8Q 1PA6A 4BY7H 2BE5C 2PI2E 2XVSA 1A3VA 2ZT9C 1OXXK 1CZWA 2VB3X 4IPDA 1EY4A 4XQJA 2F0UA 3EN2A 4A3JB 1GUOA 3FDTA 4KHZA 3VYTA 3CQZB 3S17B 3SE0A 4QQBX 4OWXB 1PTOC 3S2DH 2F0TA 3U50C 1I6HH 4UP8A 4CDCC 3GTKH 4C1NI 1IKLA 4NB3A 4A3EG 4A3BB 3I4MB 3TREA 1HFNA 2VL6A 2XSCA 4RCNA 4JI5Q 5IYBH 2RCFA 3Q6SA 2VUMG 3QB3A 1CTMA 4POGA 4X6AH 2NB0A 3BZKA 4J1MA 4MN3A 2AUKA 3T56B 3QJYA 3EROA 4Q0FA 1I4HA 1IBLQ 4UP7A 2O4XA 1X3EA 3S1QB 5E4XA 2B63B 1EWHA 1ASZA 1X3GA 1U0LA 4PZ6A 1AE2A 1E2VA 4UP9A 4O0AA 2AQ1B 2CWPA 3CD6A 1KAAA 3SK5A 5D14A 4IJLA 5C0XJ 4YHHL 3GTPB 3CCMA 2K5HA 2PCFB 2F0SA 4RKBA 4DK3C 3E5SA 4IUNA 3GTJB 2EY6A 2EOTA 3CF5A 3S16B 1SNQA 2BCOA 3CCJA 2PMZB 1TKWB 4A3IH 4DNIA 3FKIH 4JYAL 2E2JB 2ZM6Q 2OTLA 3MXNA 3STBC 1KDAA 1RD9D 4C3IB 1SLJA 4HMIA 4NXNL 1TS5A 2F0PA 3AEVA 2D0OA 1BF4A 1U4MA 1SRUA 3KFUA 2NYZD 4DUYQ 4IUQA 4DNRB 1GJXA 2A69C 3F2UA 5M3MB 4XQQA 3MA2B 1PXUA 2Y0SE 3WOFA 1ET9A 4DR7L 4LF7L 3NPPA 1RL2A 3G6EA 2VZAA 4ZUJA 3HOXH 2PW5A 3R2IA 3A54A 1AZQA 4A3EH 3D4DA 2EIFA 3GTLH 3PIO3 2R3ZA 2NVYH 3SGIA 1AW7A 5J1ZA 2VUMH 2PQAB 3A56A 2VQEL 3S1NB 4DV3L 4L6TB 4G7ZC 1TS3A 1IBKQ 2M9VA 1XWEA 3W1BA 1MHWC 1CI3M 4BBRB 3CCLA 3FEWX 2K5DA 4X62L 2EXZA 1SNPA 1DOKA 3IFDA 3TSSA 3AFPA 3PSIA 5C0XG 1GUSA 2EJFC 3UI2A 1LTID 3HOYH 1A2UA 4B3TL 1HH2P 4K2KA 1HA5A 3KJOA 1WTVA 3J7YW 2D0PA 4ZCKA 2JA5B 3M3YB 2OQ0A 3I72A 3J80c 1PRTD 3S1RH 2E75C 1SE3A 2KHJA 1JMCA 1TR5A 1E0BA 2KECA 1PH9A 1VQFA 2QDLA 5DLQE 2XNAC 5EKKA 1A3UA 3HKSA 4DK0A 1K8AC 1WI5A 2RSNA 2VW9A 4JOIA 1G51A 1UE6A 5CMDA 4CHTB 2Q2HA 2E5LQ 5NUCA 2NTSA 1XTCD 5DEHA 1SFOB 2JA8B 1N32L 1JJGA 2ZXRA 2PZTA 1Y8NB 1BBUA 2YV5A 1SAPA 2H5XA 5T1GA 3A5ZB 3RZDB 3DXJC 4A3GB 4JI1L 2DN8A 2K6AA 2K1BA 1HTPA 2NVTB 2EE1A 3V05A 2I46A 3K7AH 4A3CH 1SJED 4KJNA 2F0JA 5GQOA 1LTTD 2KENA 2R7DA 5M5YH 4G57A 5CBAE 3NK9A 1Q90A 3CRKC 3OTOL 4JI4Q 3DWPA 2KHSA 1Y1WB 1I4XA 4HIDA 4MTNA 4ABNA 4C3JG 4B9XA 2BDNA 1CUKA 3QO2A 3KOJA 2IX3A 4UAIA 1IYVA 1R4PB 2MNAA 2VS1A 3OOCA 3KK7A 4YWKA 1K9MC 3I4NH 3PGZA 3TZDA 2SOBA 1HHVA 1VQ7A 1D5ZC 3JAML 1CSPA 1O7IA 2UU9Q 3RZOB 1PYWD 5C3EH 5KYIA 1X56A 4IFDI 1ML0D 1X32A 2L5TA 2DJFC 3MTSA 3MXGA 3SK8A 4C2MH 3TP5A 2K03A 4LF5L 1V9PA 2JA7G 1O78A 5GROA 2F0KA 3C46A 3TEHB 2J7ZA 3QWNA 4CDEC 2D9UA 2LXKA 5IYCG 2E2DC 4K0KQ 2Q8IB 4WJ3M 1CHQD 4XQNA 1G2TA 3CW2C 4AIMA 1KABA 3J80i 4H02A 2RDGA 2CW0D 4ZLTF 2JEBI 2XGTA 1I50B 3BYTB 1N36Q 1BDOA 3JAME 3GTGH 5DM63 3CKIB 4ME5A 2B2WA 5C4ZA 4L5SA 1QZGA 4X3TA 2OQKA 1VQ5A 1M4VA 5BR8L 1SYGA 1U9RA 2PNRC 5IWAL 4DR2Q 4DR1Q 3CCVA 2MJ8A 3TS2A 2AKWB 5GADC 1KL9A 5BN4A 3CCUA 4A3DG 1FVIA 1P16A 2N88A 1VQ4A 1Q8KA 1DGSA 1LM0A 4A3MH 5FOBB 5J39A 1PRTC 1NJIC 3A74A 1P8LA 5KNBA 2I5MX 4P74A 1SYBA 1B53A 1PLFA 4BY1G 2ICEC 4MZ9A 3NEMA 1D1IA 3PO2G 1KRSA 1FNWA 3A8IE 2HIXA 2WAQB 1L0WA 2CH4A 1JOOA 1PH8A 1K3BC 3HOWH 1MJCA 3Q23A 1J6QA 2MHVA 3PO3B 3VDYA 2L0CA 2EYOA 4QJFA 5C4JH 4KHPL 5ELCA 4LFAL 1WTXA 4A93G 2N49A 1STEA 4BBSG 3J81j 1SNMA 1TIID 3L9AX 3H6MA 1NY4A 3UDFA 3DM3A 1IXRA 3VR3A 1PTOB 4WJ4A 1KIXA 3CC7A 1AH9A 1F9SA 2EYFA 4MHEA 4GLXA 5FJ8H 4XYQA 1D8LA 3NWTA 3OW2A 1LABA 1QG7A 2MQHA 1KAWA 1YNXA 2K52A 1VF7A 5M3FG 2IX1A 4FF1A 1Y8OB 1GUTA 1AEXA 5I9OA 1YHQA 2Z9HA 1E22A 3H3VC 1SBBB 4PMBA 1SMXA 4OX9L 2PQEA 4JI2Q 2H4OA 2IHEA 3HEJA 1YJ9A 2KQ3A 1GUWA 4OONA 4KY6A 2EY2A 5D3IB 1GOZA 2D62A 3P75A 2A74C 2K05A 4PZ8A 1VQIA 3TP6A 4XXEA 1KQSA 3DHQA 4KD3A 2NBFA 3OMCA 4HMJA 3V96A 3W1GA 1A6XA 1VQEA 5JEAG 1X65A 2KHIA 1EQVA 4BY1H 4OO1G 1K8GA 1DCZA 3PO2H 3GDEA 4A3FG 4DAVA 1B44D 4A4IA 4FVMA 1SR3A 4GNXA 1LTRD 3OYYA 2K5WA 1Q8IA 4OELB 4B3SL 1DZ1A 2F4VQ 1K83H 1LT6D 2XRSD 1STNA 2JN4A 4DNTB 4A3LG 1D5XC 5ELDA 4A93H 2F0QA 4YHHQ 4OIKA 1LTLA 4DK1A 3K0YA 3ZYYX 3H0GG 1HUMA 3HOZG 4IUPA 3QOLA 4RGTA 5K36G 2JP1A 4G7OC 2R6GA 1KNEA 4HJ9A 4OWWB 3RUZA 3J81c 3P20A 1K0SA 2FHTA 4JYAQ 3C1FA 1XNQL 4DV4L 4IQZA 3IAYA 1C8CA 2NVXH 1XXGA 4E6IA 1TXYA 1MBYA 3NXWA 1G6PA 4H0LC 1ENAA 4ME3A 4V190 1HZAA 3A0JA 1F2YA 1L0XB 3T53B 4A3KB 4CKEA 4RWSC 4DR3L 1T5EA 4L8JA 4DR6L 4LF6L 1N33L 1S5ED 3KDFB 5IE8A 3SK4A 4GKJL 1T9HA 4R4QA 3NTKA 4DR4L 4DV6Q 3FRPB 2ZXOA 3C2PA 2UUCL 1C7YA 4PMWA 1Q12A 1F77A 1SYCA 2JA7B 3PUZA 4X65Q 3J7A5 1ICFB 4I7AA 4DV2L 2MPMA 4N8X1 2RDHA 1X9NA 3GO5A 4LFCL 1MSHA 5JJZA 2DNCA 2VQEQ 4DUZQ 1E24A 4A3FH 2EZVA 4JK1C 2E2HB 4HIKA 1LTBD 2SDFA 5C4XB 2NVQH 3PF5A 5LMNL 2D2CC 1QNKA 1B4OA 3FPUB 5HGQA 3J7AF 4A3LH 3D6WA 1Z6HA 4ID6A 2E74C 1G291 2K5NA 1WCMB 1F9PA 2KVMA 4DV7L 5CV8A 3BU2A 1J8IA 1G6ZA 2IWHA 2Z6KA 1MD2D 2WP8J 3HOZH 1IKMA 1KNAA 1M1KC 5K36H 5I6WA 3A8KE 2IL8A 2X69A 1B1ZA 2MP1A 3OW7A 1GD7A 1RF2D 1LYLA 2MO1A 3F2BA 1HA6A 3CPFA 4QMGA 1B50A 1H9MA 3E3XA 2LY7A 3R3OA 2WB1G 2B2UC 1L1OC 2JYOA 2OF1A 5JVG3 3STBD 4IPGA 5DAUA 2RCNA 4JCVE 3UDIA 2GVAA 2VQFL 2N3SA 2K4KA 3NTIA 5D3DA 3J81i 1ZXTA 4C1NK 5KNCA 2GVBA 4CKCA 4JC0A 2L4NA 2V4DA 3CC2A 2AHOB 1EY6A 2CWAA 5IYBG 5EKIA 1EY0A 2AMCB 1NNXA 1R9TB 5F2DA 3J80L 3P1HA 3NTHA 4IFDH 2DNEA 2PQAA 1E3PA 2JA9A 3OTOQ 4HJ5A 1BOSA 4V0BA 4XYOA 1V1OA 5JAVA 4LF4L 3Q0AA 1MKHA 2FINB 4HIMA 2F0FA 2ID0A 4XDXA 1KRTA 3K5LA 3TP8A 3J7AV 1CKNA 1MGSA 4HAEA 3S15B 4AQYL 2HHHL 3HZXA 1H95A 3CAMA 1EWCA 1I3QH 1VMCA 3I90A 4OGQC 3P7JA 2HD3A 2TMPA 3KF6A 1UEAB 2RDFA 1BUVT 3J80E 4A3IG 3FHWA 4GOPA 4DR5L 1V1PB 5BN5A 3K8AA 1D5MC 3QR8A 3GD7A 1NR4A 1EU3A 5IGEA 1WTQA 2IHFA 4KTAA 1ESRA 1C48A 2I0QA 4LJZC 1K8OA 3NBHB 3NSWA 4U68A 3HKZG 3KUPA 3S1NH 4TSSA 3PIP3 1HZBA 4IOCA 1B70B 1PMRA 5IGBA 4KMUC 2A6HD 2L9HA 4LF8L 1B7YB 2F3WA 3HG9A 4BBRH 2A6EC 2XIWA 3L2PA 1PRTB 3HOXG 1HNWL 4EGVA 1HNZL 3I91A 1S4ZA 4JOIC 5G3LF 3AFQA 1VQOA 4PNYA 3VR2A 2ZJQA 3PMFA 4YIJA 5ELFA 4CGYB 3G71A 1YITA 2UXDQ 4UDUC 1BCPF 2L55A 4LF9L 3H0GB 3I8ZA 3PUWA 4DV1L 5FK9C 5IWAQ 3OHXC 1E1TA 4Y7NH 1I4RA 4DV5L 1XX8A 3ULLA 3IRBA 3HOUB 3FMCA 1CQFA 2K04A 5FO7B 1S5FD 3K7UC 1C0AA 3Q8DA 1G91A 4J15A 5CV9A 3M85A 4OEMB 1STBA 1I94L 1HFGA 1KHIA 4AYBG 1GVPA 1SNDA 3KLSX 5L37A 3HOYG 4MNOA 5EBDA 3S14B 1B9NA 4GLVB 4PV1C 1DJRD 3T1HQ 1TWHH 4XT3B 2VXWA 1BVSA 2BH2A 3O13A 4R4IA 1EWIA 3ND8A 1SFOH 2JEAI 3PIOA 1B3AA 2JSOA 2NN6I 1S3OA 3D4WA 1STYA 3K81C 4XT1B 3GTMB 5FLXc 1H9KA 2K5VA 1C4QA 1CA5A 4B9WA 1NBWA 5CBEE 3R2TA 5TSSA 1Y8PB 1EQTA 1NUCA 5LMNW 2JQOA 1BCPC 4LFAQ 1HNXL 1I4PA 4EQ5A 1W2BA 1EY9A 4GN5A 1EEFD 1M90C 3I73A 4DA2A 2DY8A 3RLOA 1X6OA 3DM1A 4KD4A 3TDQA 5J22A 1PZKD 1XYIA 2VNUD 1Y1WH 4NPSA 5IP7G 2Q8RE 1S5CD 1OXTA 4QY7A 4DPGA 3S1MB 4C3HH 4A3CG 1U4PA 1XPRA 5M5WB 2IW3A 4J6HA 2K32A 5LMUL 1AFPA 1S5BD 2YU9H 1B3QA 2N78A 1EL0A 5C3XA 4OX9Q 2L12A 1TWCB 1TWFH 1IYUA 3K59A 2R7ZG 3VYRA 4B3MQ 3Q22A 2FMMA 4K5WA 2Z6BA 3GTQB 4LAAA 5IIFA 2ZJPA 1CHPD 4JBWA 4BY7B 4BS9A 2R93G 3R93A 1A63A 3G6JB 4FXDA 5I4DA 2F0OA 2K14A 1D6EC 4YCWA 3X3NA 3I4NG 3C3LA 1WJJA 3NBIA 4HCSA 1HUNA 5A35A 2UXCL 1I6HB 3S2DB 5C3EG 3HRZC 3KF8A 1WD1A 3ERSX 1RDPD 1EY8A 2LFNA 3GTKB 1GHKA 3UE1A 3RNUA 2ICIA 3RN2A 4B3SQ 3DLLA 3K6OA 4GLAC 4RA8A 1RHPA 2A6HC 5H1SE 1VQNA 3MWYW 4ALPA 1Z9FA 1EQRA 1EOVA 4X66L 1Q81C 3T1YL 1H9SB 1LTSD 4NMZA 1R4QB 2ALYB 3URYA 2R7FA 1A0IA 5IT9E 3TP7A 2CQAA 4FNFA 1XNQQ 4DV4Q 4DAYB 5IP7H 3M4OH 3BZCA 1VQKA 1FYCA 1I6VC 2I5LX 1H9RA 1TT2A 2B29A 4DR3Q 2A8VA 3D8GA 4DR6Q 4LF6Q 1N33Q 5CR3A 2RSOA 4R9WA 4DU9A 4GKJQ 4DR4Q 4P2CB 4A3IB 3FKIB 4DK6C 4ZKBB 3HOVG 2R7ZH 5IGDA 2EXDA 3BDLA 2PNHA 2X6GA 4A3MG 3V2TA 1FGBD 3NQIA 4DV2Q 2R93H 3H91A 1FGUA 4OIJA 3R8BA 5DM73 5GAEC 2BA0A 1ASYA 3NHHA 2O5JC 1O7YA 1V8QA 4IN3A 3EBEA 1IL8A 3J81L 4NKLA 3CU7A 3HOWG 1EIGA 4TKOB 4EX5A 3F1ZA 3CRLC 4A3EB 4FF4A 3GTLB 3GV6A 4Z9CB 2UUAQ 4Q5VA 5LMNQ 2NVYB 3ERQA 5EPJA 2YYZA 3K58A 2L11A 5IGFA 3AYHB 1EFWA 2VUMB 1L1OB 4YCUA 5ELEA 1HJPA 1O7ZA 1OXUA 5HY6A 2ASBA 4JI3L 2LSSA 4P75A 4IUVA 2R92H 1VQPA 1XMOQ 4GNXC 2ZJRA 2KBNA 5CV4A 1DYQA 4FF3A 2RHSB 5FJ8G 4JI0L 4AYBB 1JE5A 2Z8LA 3HOYB 4BA1I 3GTOH 4JI6L 3J81E 1PHJA 1LACA 2AQ2B 1OTCA 2ATWA 4JI8L 2YTVA 1PZJD 3I2ZA 3FP9A 4P73A 5KRUA 5CV7A 4K5VA 4ILWA 4LWCA 1PV4A 2EYHA 2NTTA 4OL7A 3CHBD 2QKIC 1FR3A 4J8QA 1NMFA 3S1RB 1ZKOA 3A8JE 3DEPA 5FKAC 4KV6A 2PO4A 4OHJA 4TRDA 1NAPA 3HOVH 4ZUIA 5AJ3Q 4JBKA 1E7ZA 2CFMA 4X3KA 3NWSA 2SEBD 1C9OA 1VQAA 1I4GA 4L63B 3PF4A 4JI5L 1PYSB 2Z4IA 3T16A 2MGSA 1ILQA 2ENBA 5CYUA 1DXMA 2NN6G 1XNRL 1JOQA 2Q8TA 1Y69U 1UEBA 4BWGB 2OT2A 2B2VA 4CKBA 5JEAJ 2C9OA 1UE5A 2CHBD 2E8GA 3KLWA 1IBLL 4LF4Q 2B2TC 3M7GA 5T1IA 1YNND 1CT1D 1ESFA 3K7AB 1NCVA 1N9WA 1TVXA 2BOSA 3WOEA 3RLFA 2DUDA 2HHHQ 2QDBA 5M5YB 1Q1BA 1SYEA 3NENA 1NR2A 2AUJD 3T51B 5HURA 2UUBQ 3S2HH 4DAPA 1K73C 5I2XA 4U673 5IT9c 3U58A 3D4RA 4NXML 1NSNS 4X3UA 2ZM6L 1CQVA 2Z1CA 5JJKA 4O1NA 1Q86C 2WB1E 4N9TA 4P72A 1CA6A 3OSOA 1SXTA 1N34Q 4S3SA 5M5XH 3GP7A 2G9HD 4K2LA 3OMGA 3VYSA 4IUUA 2Z6KC 3SEBA 3SXHA 1SE2A 1ENFA 2F0GA 2ZTDA 1TWAB 4G7HC 3A5UA 1XMQL 3AMUA 4R8NA 1JORA 1D1KA 3W3AA 2MFIA 4IO9A 3LWEA 2NUCA 2EVBA 4C2MB 1X3PA 1X55A 2E2HH 2A68D 3F8TA 1HNWQ 1HNZQ 1QE6A 1JICA 2EPBA 1TU2B 2K33A 4QGUA 2E2IH 1CFMA 3OPOA 2KA7A 3NQTA 3BDCA 4HCEA 2PPBC 4LF9Q 2NN6H 4O2DA 4DV1Q 3ZJYC 3PQIA 4IURA 2F0MA 4IFDJ 4A75A 3TQYA 5KEEA 2B39A 2F3VA 3ITPA 3GTGB 3KJPA 4CDFC 3UDGA 2LS01 4LUZA 4CDDC 3MFYA 3BDOA 1BCPB 1A3TA 3K5MA 5EAYA 2B8FA 3RLNA 4ODGA 1GM5A 1VQLA 2I07B 2RVLA 2TSSA 4ZQ3A 2XWBB 3RMHA 5EQ0A 5BN3A 1HZ9A 4RH6A 4A3JG 1D7QA 2QCPX 2JJQA 3PV0A 2F0LA 2B3GA 4A3MB 3X3MA 4C3JB 5LL6S 4JPBW 4KY5A 1XJVA 4KI0A 1Y1VH 1V1PA 2E5LL 4K8JA 3I4MG 3HKZE 4NXNQ 3M4YA 1X54A 1HNXQ 2OCEA 5CGKA 1AZPA 5HGTA 1VQBA 1W3SA 3K57A 1Z7TA 2XWJB 1LV9A 4YY3L 4JBMA 2WIIB 2F52A 4F7XA 3GQBA 3EIVA 3BYYB 4GOPC 1EQQA 4DR7Q 4LF7Q 5ELOA 4WFN3 5C4JB 5ELBA 1GUNA 2N8NA 3WWVA 2JA6H 4EQPA 2B63G 1K0RA 2WKDA 1PH3A 4NP5A 1DOLA 3U9OA 3S15H 2F0NA 1YNNC 3M7NA 5AFWA 5C44H 2A6ED 4IFDG 2K75A 1HCZA 1JOKA 4JI4L 4XTCS 4DV3Q 4KLKA 5JPNC 3MFGA 1J5EL 3M4PA 5FLXL 4LMQD 4QB4A 4QL5A 1S40A 4AYBE 1II3A 3I55A 3HP3A 4X62Q 2KJXA 1AE3A 2WINB 1YI2A 1MSGA 2V1CC 4IZ8A 4C3IG 1ENCA 4B3TQ 1D2BA 1E2WA 3NP8A 3PCOB 4LFBL 1RTNA 2J0TD 2RKSA 4EVOA 3D31A 1AN8A 1ICWA 4A3DB 1WFQA 5M3MG 1VDZA 4A3JH 1I5FA 3S17H 3CQZH 4FO2A 1IL2A 1GO3E 2CVRA 5COYA 5FLXE 1QWYA 1F2ZA 2D5DA 4A3BH 3T4AC 1HPCA 4BY1B 3I4MH 2A68C 3PO2B 3TS0A 5C0XI 2E76C 1VQGA 5I9PA 1I4QA 5G3LD 1HQMC 1N32Q 4LNQA 1BCPD 2MUYA 3VA5A 4BBRG 3DMUA 1K83B 4JI1Q 4K8IA 2F03A 3S1QH 2B63H 4A93B 2PYKA 3FPPA 3GV3A 1WTWA 1HZCA 4BBSB 3IKJA 1PH1A 1ZEQX 4FDBA 1YZ6A 3GTPH 1F2LA 4L5TA 1RIPA 4GZYC 1LO5D 2JA5G 1PH4A 4ZKCB 3MEHA 3GTJH 3D3RA 2WACA 4B08A 1BNZA 3S16H 4RAUC 3L0OA 4N9PA 3EJIA 2NVXB 1YHAA 3CPWA 3CCRA 3VR5A 1A15A 3GTMH 5M3FB 2E2JH 1WTRA 1HQRD 3EVQA 4C3IH 5E1FA 1RTOA 1SMYC 2RF4A 1L0YB 1Q82C 4DKAC 1U4RA 2EJMA 3EFXD 3EA6A 4F87A 2HQLA 2JA8G 1YVCA 4GNXB 4B3RL 1V43A 4IPHA 2F0VA 4EQOA 5M3MH 2G5DA 1PTOF 4A3GG 1FD7D 4GKKL 2JE6I 3OIPA 1QUQB 2QEJC 2DY7A 4LF5Q 1VQ9A 1PFSA 2PZWA 4N8FA 1E1OA 5J3BA 4BA2I 4GN4B 1PH6A 5IGGA 4RGOS 2A1AA 1TQOA 1DD2A 1VQDA 4A3FB 5EJWA 2CQOA 3MEFA 3T13A 1WVLA 5IY0A 4P71A 1Q46A 4TQUS 4RKLA 5I2YA 2NVQB 2OTJA 2AQ3B 1W6KA 1Y1WG 2WV6D 2Z0SA 1VQHA 2A5HA 4C3HG 4JBJA 4DAYA 2L1BA 2NWGA 1VF5C 2K01A 1YEZA 3BVZA 1UUPA 2QF7A 2X6LA 4RG1A 3HOZB 4JI2L 4QF4A 5BR8Q 1TWGB 4RMFA 2JA5H 3M3YH 2KEEA 1A62A 1T5XD 5IGCA 1FNVA 1KDCA 2B2YA 1NMGA 1CKOA 3DUZA 5KGUA 1LT3D 3MAQA 3E6ZX 2K50A 2EDGA 4PZ7A 1RCVD 1SEBD 5LL6X 1XNRQ 1JCKB 3CMEA 4X3SA 4R8IA 2JA8H 1O7LA 4ZAIA 2KEDA 3PUYA 2KCNA 5I6YA 3QOJA 3QG1A 2I5HA 3RZDH 4A3GH 1N8RC 2F4VL 2IY5B 3G7LA 5C4HA 1Q1EA 4HJ7A 1EY7A 1QCBD 1ZYRD 2GA4B 4KHPQ 3C1EA 2NVTH 1DM0B 1HR0L 2EY5A 3CCSA 2M00A 3ONAB 5FO9B 1ILPA 2B2UA 1K3RA 1L1OA 4DAMA 1EIHA 5E3FA 1IBML 4CJ0B 2HUGA 1KLGD 1GHJA 4PG3A 1J9OA 4JVZA 4NXMQ 2HQEA 1B8AA 1BBWA 1PH7A 3SHLA 1EFID 4JG2A 3F2DA 2QGQA 4QIWE 2O2LD 1I3QB 1FL0A 1QVCA 1UE7A 4WRDA 4LUVA 4HIOA 1VQ8A 5C3WA 2WFWA 4L5RC 2L15A 1TY0A 3K5OA 4DF7A 2C35B 3A7AB 4I65A 4DV6L 1XMQQ 3RZOH 2SNSA 2B8GA 2WAQG 3OWFA 4UHVA 4X65L 1OXVA 1XTDA 2B2WC 3PO3G 3I56A 5DNFA 2WB1B 1SYDA 2VY3A 4DUZL 1M8AA 1S5DD 2LXJA 2RQXA 3I4LA 5IT9L 1IHZA 4HR7B 4JW0A 3WDNA 1EEID 2KCMA 1LT5D 3W5OA 5C5LA 2QEXA 4QUFA 2EJGC 2AWNA 1CKNB 1X3QA 4APVA 4HSPA 4JI7L 1I50H 1B2TA 1YIJA 4WORA 1A8VA 2KOLA 3IL8A 3S24A 4HJ8A 2UXBL 5IYDG 3H94A 1SYFA 2K7VA 1PFMA 2XRQD 4DGZA 4Y7NB 3KF6B 2OWOA 2B2VC 1WTHA 1MIUA 4F88A 4PQXA 3DWQA 3L7ZC 4IUTA 2R92G 3I4OA 4GOPB 2K5QA 3CC4A 1A2TA 3F2CA 1EYCA 2BH8A 1WYDA 1TS2A 4OO1I 4R4CA 3ULPA 1O80A 3E9HA 5CV5A 1SDFA 4OXPA 5K5PA 2F0HA
chains in the Genus database with same CATH topology
1IZ6A 4NB3A 4A3EG 2UUBQ 3CCQA 4HIKA 3TREA 1Q7YC 3S2HH 1K73C 2VL6A 4JI5Q 5IT9c 4DV0L 5IYBH 3U58A 5LMNL 3PF5A 2NVQH 4NXML 2VUMG 5HGQA 2ZM6L 4R1JA 3TRZA 4A3LH 4YY3Q 4X64L 1G291 2K5NA 4POGA 3BZKA 4X6AH 5JJKA 1Q86C 4DV7L 2WB1E 4P72A 3JC66 1MJEA 3BU2A 2UUCQ 1N34Q 5M5XH 1VQCA 1IBLQ 2Z6KA 4UP7A 1X3EA 2WP8J 3HOZH 1M1KC 3PO3H 4GN3B 1ASZA 2ES2A 2BA1A 2Z6KC 1X3GA 1U0LA 4PZ6A 1AE2A 2ZTDA 4UP9A 4LFCQ 4O0AA 2AWOA 3A5UA 1XMQL 2CWPA 3CD6A 4IJLA 5C0XJ 1GD7A 2MFIA 4IO9A 4YHHL 1LYLA 2MO1A 3F2BA 3CCMA 2FXQA 2K5HA 1X55A 3M4QA 4DK3C 3HFZB 1J5EQ 3F8TA 3CPFA 1HNZQ 2E2HH 1HNWQ 2PI2A 3CF5A 2WB1G 5JJLA 1L1OC 4QGUA 3CCJA 2E2IH 2XTIA 2IT1A 1FJGL 3STBD 4A3IH 4DNIA 3FKIH 4JYAL 4IPGA 2GN5A 4LF9Q 4O2DA 4DV1Q 2RCNA 4JCVE 2ZM6Q 3UDIA 3ZJYC 2OTLA 3STBC 2GVAA 2VQFL 2N3SA 5IYDH 2K4KA 3J81i 1SLJA 3B6YA 4JV5L 4IFDJ 2Q2TA 4DV7Q 4NXNL 4A75A 1X3FA 4A3KG 4LFBQ 2GVBA 2D0OA 3TQYA 3AEVA 3GTKH 2EQSA 1SRUA 4JC0A 3KJPA 3UDGA 1VQMA 3KFUA 4LUZA 4DUYQ 3H3VI 3CC2A 2AHOB 5GAHC 2CWAA 1TWAH 5IYBG 2AMCB 3MXNB 1VQJA 1CSQA 3U4VA 5EAYA 4YWLA 2Y0SE 3RLNA 4DR7L 2PQAA 4LF7L 1GM5A 1VQLA 1E3PA 1RL2A 2JA9A 3OTOQ 3G6EA 4HJ5A 2VZAA 3HOXH 3CP0A 4LF4L 1UE1A 4A3EH 1MKHA 4HIMA 2EIFA 2ID0A 1HR0W 1KRTA 1QVFA 3GTLH 1HZ9A 2NVYH 4A3JG 4XIGS 3SGIA 1D7QA 2JJQA 3PV0A 2VUMH 2B3GA 1CKNA 2PQAB 4LW1A 2VQEL 1L2FA 3U4ZA 4AQYL 2HHHL 1H95A 4DV3L 3KDFA 3CAMA 1IBKQ 1S72A 1XJVA 4KI0A 1Y1VH 1I3QH 3W1BA 2VQFQ 2ASBA 2E5LL 2KCTA 3CCLA 3ER0A 3I4MG 3HKZE 4NXNQ 2NZOA 1X54A 1HNXQ 5C4XG 4X62L 2Y0SG 2OCEA 3KF6A 2UXDL 1VQBA 3AFPA 1W3SA 3PSIA 5C0XG 4A3IG 1WCMG 4YY3L 4JBMA 3FHWA 4GOPA 3HOYH 4DR5L 2F52A 4B3TL 3EIVA 3K8AA 4YWMA 2PMZE 3CMAA 3GD7A 4GOPC 1EQQA 4DR7Q 4LF7Q 1HH2P 5ELOA 3KJOA 2IHFA 2N8NA 2D0PA 3WWVA 2JA6H 2RHQB 4UY8C 2B63G 2OQ0A 1K0RA 3J80c 2I0QA 3S1RH 1WOCA 1PH3A 3NBHB 2KHJA 1JMCA 4IPCA 1PH9A 4C3JH 1VQFA 3HKZG 3S15H 3S1NH 5DLQE 4IOCA 1HZBA 3M7NA 1B70B 1GKHA 5C44H 3HKSA 4IFDG 4LF8L 1K8AC 2K75A 1B7YB 1WI5A 4AQYQ 2YTXA 4XTCS 2CKZB 4DV3Q 4KLKA 3T1HL 4JI4L 4A76A 4BBRH 2VW9A 4JOIA 1G51A 1UE6A 1J5EL 3M4PA 3L2PA 3HOXG 3KF8B 2Q2HA 5ELNA 1HNZL 1EYGA 4QL5A 2E5LQ 4A3KH 1HNWL 1S40A 4AYBE 4JOIC 3I55A 3AFQA 1VQOA 5GAGC 4X62Q 4L5QA 2ZJQA 4B3RQ 1N32L 1AE3A 1JJGA 3G71A 1YITA 2UXDQ 1BBUA 2ZTCA 1YI2A 2V1CC 2YV5A 3UDXA 4LF9L 2H5XA 3PUWA 4DV1L 2Q2UA 2HT1A 3A5ZB 4GKKQ 4DR5Q 5IWAQ 4Y7NH 1E1TA 4DV5L 1Y1VG 3ULLA 4B3TQ 3IRBA 4JI1L 2JA7H 3PCOB 4LFBL 3K7UC 1C0AA 3Q8DA 4OWTB 5IYCH 1EIFA 3K7AH 4J15A 4DUYL 1SN8A 4POFA 3D31A 3M85A 4A3CH 1WFQA 1I94L 5M3MG 4A3JH 1I5FA 1LUZA 5GQOA 3ICEA 1KHIA 3CQZH 4AYBG 3S17H 2A19A 1GVPA 2KENA 3HOYG 2R7DA 4MNOA 5M5YH 3K0XA 1PYBA 1IL2A 1GO3E 4GLVB 4LF8Q 3OTOL 4JI4Q 3T1HQ 3H15A 2HIVA 1TWHH 1BVSA 4A3BH 2BH2A 4R4IA 2JA6G 1EWIA 3I4MH 3PUXA 4GS3A 1SFOH 5C4XH 4HIDA 4MTNA 3TS0A 5C0XI 2JEAI 3PIOA 1VQGA 5IP9G 1N32Q 2NN6I 1S3OA 3K81C 4LNQA 1CUKA 2IX0A 5FLXc 3KOJA 2K5VA 1WCMH 5C44G 2MNAA 1IBKL 2VS1A 1VQ6A 1NBWA 1YJNA 4BBRG 1UWVA 4YWKA 1K9MC 4DV5Q 3I4NH 5LMNW 2JQOA 4JI1Q 1V1QA 3PGZA 4LFAQ 1HNXL 4B3ML 2Q2IA 3S1QH 1VQ7A 4A3DH 2B63H 1CSPA 1O7IA 4EQ5A 2UU9Q 4HJAA 5C3EH 1QZHA 1HZCA 1W2BA 4GN5A 1X56A 1PH1A 3ULJA 1I94Q 4IFDI 3RR5A 3K80C 4FDBA 1M90C 1BKBA 3RLOA 1JJ2A 1EUJA 1YZ6A 3GTPH 4L5TA 4C2MH 1RIPA 1X6OA 2JA5G 4LF5L 1V9PA 3G4SA 1PH4A 2JA7G 3GTJH 5GROA 2VNUD 1Y1WH 3TEHB 2YTYA 4NPSA 5IP7G 3S16H 3L0OA 4QY7A 1OXTA 2LXKA 4DPGA 5IYCG 4K0KQ 1YHAA 3CPWA 3CCRA 4C3HH 4A3CG 4WJ3M 1XPRA 3CW2C 3GTMH 4AIMA 5LMUL 2E2JH 3J80i 4H02A 1Y14B 4UPAA 2YU9H 2N78A 2JEBI 1SE8A 4R4OA 4C3IH 1XPOA 4OX9Q 3CCEA 2RF4A 2XGTA 1Q82C 1N36Q 4DKAC 1JT8A 4A3BG 1TWFH 3GTGH 1QUQA 2R7ZG 2NZHA 2JA8G 2HQLA 1HR0Q 4B3MQ 4BBSH 1YVCA 4GNXB 4B3RL 1V43A 2F3IA 4L5SA 3E9IA 4IPHA 1QZGA 1R9TH 2ZJPA 1YBYA 2OQKA 5M3MH 1IBMQ 1VQ5A 4JBWA 4A3GG 2R93G 1A63A 2DGYA 5BR8L 4GKKL 2JE6I 3JAMc 5IWAL 2K14A 3HOUG 3E0EA 1QUQB 4YCWA 4DR2Q 4DR1Q 1IYJB 3CCVA 3I4NG 3AQQA 1WJJA 4LF5Q 1VQ9A 1PFSA 3TS2A 2AKWB 5GADC 1E1OA 1KL9A 3BJUA 5J3BA 3CCUA 4A3DG 1FVIA 1P16A 1VQ4A 4BA2I 5M3FH 4GN4B 2UXCL 1Q8KA 5C3EG 2MO0A 1KC8C 1PH6A 1PH5A 3ERSX 2A1AA 1DGSA 1LM0A 1VQDA 4A3MH 5IP9H 2QA4A 3UE1A 1NJIC 2CQOA 3MEFA 5LMUQ 3RNUA 3A74A 1P8LA 2I5MX 4P74A 3RN2A 5IY0A 4P71A 1Q46A 4B3SQ 4TQUS 3DLLA 4GLAC 4BY1G 4MZ9A 3NEMA 2OTJA 1Y1WG 4R4TA 5H1SE 2Z0SA 2CCZA 1VQNA 1VQHA 3PO2G 1KRSA 1JJCB 5FLMG 1Z47A 4ALPA 1Z9FA 1EQRA 2HIXA 4JBJA 1EOVA 4X66L 1L0WA 1Q81C 1PH8A 3HOWH 1MJCA 1J6QA 1YEZA 3T1YL 4RG1A 4JI2L 5BR8Q 2ALYB 3VDYA 4QJFA 5C4JH 4KHPL 2R7FA 1A0IA 4RMFA 2JA5H 3D0FA 3M3YH 4LFAL 4A93G 1A62A 2N49A 1XNQQ 4DV4Q 4DAYB 5IP7H 2UU9L 4BBSG 3M4OH 1YHBA 3J81j 1KD1C 4AH6A 3BZCA 2UXCQ 1VQKA 1NY4A 1NMGA 3UDFA 1CKOA 2I5LX 3DM3A 1IXRA 4WJ4A 2B29A 4DR3Q 3CC7A 1KIXA 1AH9A 2K50A 4PZ7A 3CXCA 2UUAL 2A8VA 4DR6Q 4GLXA 4LF6Q 4JI7Q 1N33Q 4BXXG 5FJ8H 4GKJQ 1D8LA 1XNRQ 3OW2A 4DR4Q 4DK6C 3CMEA 2UXBQ 3HOVG 2R7ZH 2MQHA 1KAWA 2JA8H 1YNXA 2K52A 4K0KL 5M3FG 2EXDA 2IX1A 2PNHA 3PUYA 4A3MG 1YHQA 3H0GH 4X66Q 1E22A 4IOAA 1PVOA 2JK8A 2I5HA 4DV2Q 3RZDH 4A3GH 1XMOL 1N8RC 2R93H 2F4VL 2IY5B 1SMXA 1FGUA 1TWGH 4OX9L 3T1YQ 1Q1EA 3HOUH 4HJ7A 1N36L 4JI2Q 5GAEC 2BA0A 2IHEA 4KHPQ 1NTGA 1ASYA 2NVTH 1HR0L 1YJ9A 4OONA 3CCSA 4Y52H 3EBEA 1U5KA 4IJHA 2D62A 1K3RA 1L1OA 4DAMA 3RN5A 4PZ8A 1VQIA 4BY7G 1IBML 1KQSA 3HOWG 1EIYB 4EX5A 3S14H 1OXSC 3F1ZA 4PG3A 3W1GA 2WAQE 4DR2L 4DV0Q 4DR1L 2UUAQ 1VQEA 5LMNQ 5JEAG 1JB7A 1X65A 2YYZA 4NXMQ 2KHIA 2ZTEA 3AYHB 4BY1H 1B8AA 1BBWA 1EFWA 4YCVA 4X64Q 3JAMi 1PH7A 5AJ3L 4OO1G 1L1OB 4YCUA 1K8GA 3UE0A 3J7ZC 4JG2A 3PO2H 1CKMA 3GDEA 5FLMH 2QGQA 4QIWE 3F2DA 1HJPA 4A3FG 1YJWA 4A4IA 1FL0A 1OXUA 1QVCA 1SR3A 1UE7A 3I7FA 4LUVA 5HY6A 4JI3L 1VS0A 2LSSA 3OYYA 4P75A 4HIOA 3PIPA 2WFWA 4GNXA 4L5RC 2R92H 5JJIA 3PUVA 1VQPA 4B3SL 1XMOQ 4GNXC 2L15A 2ZJRA 2KBNA 2F4VQ 1K83H 2C35B 3LGJA 1SROA 2RHSB 3H3VH 4DV6L 5FJ8G 4A3LG 4JI0L 1XMQQ 1JE5A 4A93H 3RZOH 3KYHC 3M9BA 4BA1I 3GTOH 2WAQG 4JI6L 1PHJA 4YHHQ 1OTCA 2ATWA 4LUOA 1LTLA 2YTVA 3I2ZA 1OXVA 4JI8L 3FP9A 4P73A 1XTDA 3NELA 4X65L 4LWCA 1PV4A 3H0GG 3HOZG 1VQ8A 4TVAB 5K36G 3PO3G 2R6GA 1NMFA 3I56A 4HJ9A 4OWWB 2VY3A 1QVGA 4BXXH 1FJGQ 3J81c 1KXLA 4JYAQ 1XNQL 4DUZL 4DV4L 3S1MH 2LXJA 2NVXH 3HOVH 1TXYA 5AJ3Q 2KCMA 5M5WH 1E7ZA 4JBKA 2CFMA 3W5OA 4JV5Q 1G6PA 4ME3A 2UUBL 2QEXA 1C9OA 1HZAA 1VQAA 3A0JA 2AWNA 3PF4A 1XPUA 4DR3L 1CKNB 4JI5L 4APVA 4JI3Q 1PYSB 1PH2A 4DR6L 4LF6L 4JI7L 1N33L 1I50H 3KDFB 5IE8A 1NE3A 1TWCH 3FKIG 4GKJL 1YIJA 1T9HA 1XNRL 2NN6G 4R4QA 1A8VA 3S24A 4DR4L 4DV6Q 4HJ8A 2UXBL 1UEBA 5IYDG 4JI0Q 5JEAJ 2UUCL 3GTQH 1C7YA 3G48A 5E7NA 1Q12A 4PMWA 1N34L 3KF6B 4JI6Q 1UE5A 2OWOA 2E8GA 3KLWA 1IBLL 1VCIA 4JI8Q 1MIUA 3PUZA 4X65Q 3J7A5 1PA6A 4BY7H 4LF4Q 3L7ZC 4DV2L 2PI2E 2R92G 1OXXK 3I4OA 4GOPB 3CC4A 4IPDA 1N9WA 1X9NA 3GO5A 3F2CA 4LFCL 2BH8A 1WYDA 3EN2A 4OO1I 4KHZA 3RLFA 2DUDA 2VQEQ 4R4CA 3ULPA 2HHHQ 4QQBX 4OWXB 3E9HA 4DUZQ 3U50C 3S2DH 1E24A 1I6HH 4UP8A 1Q1BA 4OXPA 3NENA 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZ6 A;  4NB3 A;  4A3E G;  2UUB Q;  3CCQ A;  4HIK A;  3TRE A;  1Q7Y C;  3S2H H;  1K73 C;  2VL6 A;  4JI5 Q;  5IT9 c;  4DV0 L;  5IYB H;  3U58 A;  5LMN L;  3PF5 A;  2NVQ H;  4NXM L;  2VUM G;  5HGQ A;  2ZM6 L;  4R1J A;  3TRZ A;  4A3L H;  4YY3 Q;  4X64 L;  1G29 1;  2K5N A;  4POG A;  3BZK A;  4X6A H;  5JJK A;  1Q86 C;  4DV7 L;  2WB1 E;  4P72 A;  3JC6 6;  1MJE A;  3BU2 A;  2UUC Q;  1N34 Q;  5M5X H;  1VQC A;  1IBL Q;  2Z6K A;  4UP7 A;  1X3E A;  2WP8 J;  3HOZ H;  1M1K C;  3PO3 H;  4GN3 B;  1ASZ A;  2ES2 A;  2BA1 A;  2Z6K C;  1X3G A;  1U0L A;  4PZ6 A;  1AE2 A;  2ZTD A;  4UP9 A;  4LFC Q;  4O0A A;  2AWO A;  3A5U A;  1XMQ L;  2CWP A;  3CD6 A;  4IJL A;  5C0X J;  1GD7 A;  2MFI A;  4IO9 A;  4YHH L;  1LYL A;  2MO1 A;  3F2B A;  3CCM A;  2FXQ A;  2K5H A;  1X55 A;  3M4Q A;  4DK3 C;  3HFZ B;  1J5E Q;  3F8T A;  3CPF A;  1HNZ Q;  2E2H H;  1HNW Q;  2PI2 A;  3CF5 A;  2WB1 G;  5JJL A;  1L1O C;  4QGU A;  3CCJ A;  2E2I H;  2XTI A;  2IT1 A;  1FJG L;  3STB D;  4A3I H;  4DNI A;  3FKI H;  4JYA L;  4IPG A;  2GN5 A;  4LF9 Q;  4O2D A;  4DV1 Q;  2RCN A;  4JCV E;  2ZM6 Q;  3UDI A;  3ZJY C;  2OTL A;  3STB C;  2GVA A;  2VQF L;  2N3S A;  5IYD H;  2K4K A;  3J81 i;  1SLJ A;  3B6Y A;  4JV5 L;  4IFD J;  2Q2T A;  4DV7 Q;  4NXN L;  4A75 A;  1X3F A;  4A3K G;  4LFB Q;  2GVB A;  2D0O A;  3TQY A;  3AEV A;  3GTK H;  2EQS A;  1SRU A;  4JC0 A;  3KJP A;  3UDG A;  1VQM A;  3KFU A;  4LUZ A;  4DUY Q;  3H3V I;  3CC2 A;  2AHO B;  5GAH C;  2CWA A;  1TWA H;  5IYB G;  2AMC B;  3MXN B;  1VQJ A;  1CSQ A;  3U4V A;  5EAY A;  4YWL A;  2Y0S E;  3RLN A;  4DR7 L;  2PQA A;  4LF7 L;  1GM5 A;  1VQL A;  1E3P A;  1RL2 A;  2JA9 A;  3OTO Q;  3G6E A;  4HJ5 A;  2VZA A;  3HOX H;  3CP0 A;  4LF4 L;  1UE1 A;  4A3E H;  1MKH A;  4HIM A;  2EIF A;  2ID0 A;  1HR0 W;  1KRT A;  1QVF A;  3GTL H;  1HZ9 A;  2NVY H;  4A3J G;  4XIG S;  3SGI A;  1D7Q A;  2JJQ A;  3PV0 A;  2VUM H;  2B3G A;  1CKN A;  2PQA B;  4LW1 A;  2VQE L;  1L2F A;  3U4Z A;  4AQY L;  2HHH L;  1H95 A;  4DV3 L;  3KDF A;  3CAM A;  1IBK Q;  1S72 A;  1XJV A;  4KI0 A;  1Y1V H;  1I3Q H;  3W1B A;  2VQF Q;  2ASB A;  2E5L L;  2KCT A;  3CCL A;  3ER0 A;  3I4M G;  3HKZ E;  4NXN Q;  2NZO A;  1X54 A;  1HNX Q;  5C4X G;  4X62 L;  2Y0S G;  2OCE A;  3KF6 A;  2UXD L;  1VQB A;  3AFP A;  1W3S A;  3PSI A;  5C0X G;  4A3I G;  1WCM G;  4YY3 L;  4JBM A;  3FHW A;  4GOP A;  3HOY H;  4DR5 L;  2F52 A;  4B3T L;  3EIV A;  3K8A A;  4YWM A;  2PMZ E;  3CMA A;  3GD7 A;  4GOP C;  1EQQ A;  4DR7 Q;  4LF7 Q;  1HH2 P;  5ELO A;  3KJO A;  2IHF A;  2N8N A;  2D0P A;  3WWV A;  2JA6 H;  2RHQ B;  4UY8 C;  2B63 G;  2OQ0 A;  1K0R A;  3J80 c;  2I0Q A;  3S1R H;  1WOC A;  1PH3 A;  3NBH B;  2KHJ A;  1JMC A;  4IPC A;  1PH9 A;  4C3J H;  1VQF A;  3HKZ G;  3S15 H;  3S1N H;  5DLQ E;  4IOC A;  1HZB A;  3M7N A;  1B70 B;  1GKH A;  5C44 H;  3HKS A;  4IFD G;  4LF8 L;  1K8A C;  2K75 A;  1B7Y B;  1WI5 A;  4AQY Q;  2YTX A;  4XTC S;  2CKZ B;  4DV3 Q;  4KLK A;  3T1H L;  4JI4 L;  4A76 A;  4BBR H;  2VW9 A;  4JOI A;  1G51 A;  1UE6 A;  1J5E L;  3M4P A;  3L2P A;  3HOX G;  3KF8 B;  2Q2H A;  5ELN A;  1HNZ L;  1EYG A;  4QL5 A;  2E5L Q;  4A3K H;  1HNW L;  1S40 A;  4AYB E;  4JOI C;  3I55 A;  3AFQ A;  1VQO A;  5GAG C;  4X62 Q;  4L5Q A;  2ZJQ A;  4B3R Q;  1N32 L;  1AE3 A;  1JJG A;  3G71 A;  1YIT A;  2UXD Q;  1BBU A;  2ZTC A;  1YI2 A;  2V1C C;  2YV5 A;  3UDX A;  4LF9 L;  2H5X A;  3PUW A;  4DV1 L;  2Q2U A;  2HT1 A;  3A5Z B;  4GKK Q;  4DR5 Q;  5IWA Q;  4Y7N H;  1E1T A;  4DV5 L;  1Y1V G;  3ULL A;  4B3T Q;  3IRB A;  4JI1 L;  2JA7 H;  3PCO B;  4LFB L;  3K7U C;  1C0A A;  3Q8D A;  4OWT B;  5IYC H;  1EIF A;  3K7A H;  4J15 A;  4DUY L;  1SN8 A;  4POF A;  3D31 A;  3M85 A;  4A3C H;  1WFQ A;  1I94 L;  5M3M G;  4A3J H;  1I5F A;  1LUZ A;  5GQO A;  3ICE A;  1KHI A;  3CQZ H;  4AYB G;  3S17 H;  2A19 A;  1GVP A;  2KEN A;  3HOY G;  2R7D A;  4MNO A;  5M5Y H;  3K0X A;  1PYB A;  1IL2 A;  1GO3 E;  4GLV B;  4LF8 Q;  3OTO L;  4JI4 Q;  3T1H Q;  3H15 A;  2HIV A;  1TWH H;  1BVS A;  4A3B H;  2BH2 A;  4R4I A;  2JA6 G;  1EWI A;  3I4M H;  3PUX A;  4GS3 A;  1SFO H;  5C4X H;  4HID A;  4MTN A;  3TS0 A;  5C0X I;  2JEA I;  3PIO A;  1VQG A;  5IP9 G;  1N32 Q;  2NN6 I;  1S3O A;  3K81 C;  4LNQ A;  1CUK A;  2IX0 A;  5FLX c;  3KOJ A;  2K5V A;  1WCM H;  5C44 G;  2MNA A;  1IBK L;  2VS1 A;  1VQ6 A;  1NBW A;  1YJN A;  4BBR G;  1UWV A;  4YWK A;  1K9M C;  4DV5 Q;  3I4N H;  5LMN W;  2JQO A;  4JI1 Q;  1V1Q A;  3PGZ A;  4LFA Q;  1HNX L;  4B3M L;  2Q2I A;  3S1Q H;  1VQ7 A;  4A3D H;  2B63 H;  1CSP A;  1O7I A;  4EQ5 A;  2UU9 Q;  4HJA A;  5C3E H;  1QZH A;  1HZC A;  1W2B A;  4GN5 A;  1X56 A;  1PH1 A;  3ULJ A;  1I94 Q;  4IFD I;  3RR5 A;  3K80 C;  4FDB A;  1M90 C;  1BKB A;  3RLO A;  1JJ2 A;  1EUJ A;  1YZ6 A;  3GTP H;  4L5T A;  4C2M H;  1RIP A;  1X6O A;  2JA5 G;  4LF5 L;  1V9P A;  3G4S A;  1PH4 A;  2JA7 G;  3GTJ H;  5GRO A;  2VNU D;  1Y1W H;  3TEH B;  2YTY A;  4NPS A;  5IP7 G;  3S16 H;  3L0O A;  4QY7 A;  1OXT A;  2LXK A;  4DPG A;  5IYC G;  4K0K Q;  1YHA A;  3CPW A;  3CCR A;  4C3H H;  4A3C G;  4WJ3 M;  1XPR A;  3CW2 C;  3GTM H;  4AIM A;  5LMU L;  2E2J H;  3J80 i;  4H02 A;  1Y14 B;  4UPA A;  2YU9 H;  2N78 A;  2JEB I;  1SE8 A;  4R4O A;  4C3I H;  1XPO A;  4OX9 Q;  3CCE A;  2RF4 A;  2XGT A;  1Q82 C;  1N36 Q;  4DKA C;  1JT8 A;  4A3B G;  1TWF H;  3GTG H;  1QUQ A;  2R7Z G;  2NZH A;  2JA8 G;  2HQL A;  1HR0 Q;  4B3M Q;  4BBS H;  1YVC A;  4GNX B;  4B3R L;  1V43 A;  2F3I A;  4L5S A;  3E9I A;  4IPH A;  1QZG A;  1R9T H;  2ZJP A;  1YBY A;  2OQK A;  5M3M H;  1IBM Q;  1VQ5 A;  4JBW A;  4A3G G;  2R93 G;  1A63 A;  2DGY A;  5BR8 L;  4GKK L;  2JE6 I;  3JAM c;  5IWA L;  2K14 A;  3HOU G;  3E0E A;  1QUQ B;  4YCW A;  4DR2 Q;  4DR1 Q;  1IYJ B;  3CCV A;  3I4N G;  3AQQ A;  1WJJ A;  4LF5 Q;  1VQ9 A;  1PFS A;  3TS2 A;  2AKW B;  5GAD C;  1E1O A;  1KL9 A;  3BJU A;  5J3B A;  3CCU A;  4A3D G;  1FVI A;  1P16 A;  1VQ4 A;  4BA2 I;  5M3F H;  4GN4 B;  2UXC L;  1Q8K A;  5C3E G;  2MO0 A;  1KC8 C;  1PH6 A;  1PH5 A;  3ERS X;  2A1A A;  1DGS A;  1LM0 A;  1VQD A;  4A3M H;  5IP9 H;  2QA4 A;  3UE1 A;  1NJI C;  2CQO A;  3MEF A;  5LMU Q;  3RNU A;  3A74 A;  1P8L A;  2I5M X;  4P74 A;  3RN2 A;  5IY0 A;  4P71 A;  1Q46 A;  4B3S Q;  4TQU S;  3DLL A;  4GLA C;  4BY1 G;  4MZ9 A;  3NEM A;  2OTJ A;  1Y1W G;  4R4T A;  5H1S E;  2Z0S A;  2CCZ A;  1VQN A;  1VQH A;  3PO2 G;  1KRS A;  1JJC B;  5FLM G;  1Z47 A;  4ALP A;  1Z9F A;  1EQR A;  2HIX A;  4JBJ A;  1EOV A;  4X66 L;  1L0W A;  1Q81 C;  1PH8 A;  3HOW H;  1MJC A;  1J6Q A;  1YEZ A;  3T1Y L;  4RG1 A;  4JI2 L;  5BR8 Q;  2ALY B;  3VDY A;  4QJF A;  5C4J H;  4KHP L;  2R7F A;  1A0I A;  4RMF A;  2JA5 H;  3D0F A;  3M3Y H;  4LFA L;  4A93 G;  1A62 A;  2N49 A;  1XNQ Q;  4DV4 Q;  4DAY B;  5IP7 H;  2UU9 L;  4BBS G;  3M4O H;  1YHB A;  3J81 j;  1KD1 C;  4AH6 A;  3BZC A;  2UXC Q;  1VQK A;  1NY4 A;  1NMG A;  3UDF A;  1CKO A;  2I5L X;  3DM3 A;  1IXR A;  4WJ4 A;  2B29 A;  4DR3 Q;  3CC7 A;  1KIX A;  1AH9 A;  2K50 A;  4PZ7 A;  3CXC A;  2UUA L;  2A8V A;  4DR6 Q;  4GLX A;  4LF6 Q;  4JI7 Q;  1N33 Q;  4BXX G;  5FJ8 H;  4GKJ Q;  1D8L A;  1XNR Q;  3OW2 A;  4DR4 Q;  4DK6 C;  3CME A;  2UXB Q;  3HOV G;  2R7Z H;  2MQH A;  1KAW A;  2JA8 H;  1YNX A;  2K52 A;  4K0K L;  5M3F G;  2EXD A;  2IX1 A;  2PNH A;  3PUY A;  4A3M G;  1YHQ A;  3H0G H;  4X66 Q;  1E22 A;  4IOA A;  1PVO A;  2JK8 A;  2I5H A;  4DV2 Q;  3RZD H;  4A3G H;  1XMO L;  1N8R C;  2R93 H;  2F4V L;  2IY5 B;  1SMX A;  1FGU A;  1TWG H;  4OX9 L;  3T1Y Q;  1Q1E A;  3HOU H;  4HJ7 A;  1N36 L;  4JI2 Q;  5GAE C;  2BA0 A;  2IHE A;  4KHP Q;  1NTG A;  1ASY A;  2NVT H;  1HR0 L;  1YJ9 A;  4OON A;  3CCS A;  4Y52 H;  3EBE A;  1U5K A;  4IJH A;  2D62 A;  1K3R A;  1L1O A;  4DAM A;  3RN5 A;  4PZ8 A;  1VQI A;  4BY7 G;  1IBM L;  1KQS A;  3HOW G;  1EIY B;  4EX5 A;  3S14 H;  1OXS C;  3F1Z A;  4PG3 A;  3W1G A;  2WAQ E;  4DR2 L;  4DV0 Q;  4DR1 L;  2UUA Q;  1VQE A;  5LMN Q;  5JEA G;  1JB7 A;  1X65 A;  2YYZ A;  4NXM Q;  2KHI A;  2ZTE A;  3AYH B;  4BY1 H;  1B8A A;  1BBW A;  1EFW A;  4YCV A;  4X64 Q;  3JAM i;  1PH7 A;  5AJ3 L;  4OO1 G;  1L1O B;  4YCU A;  1K8G A;  3UE0 A;  3J7Z C;  4JG2 A;  3PO2 H;  1CKM A;  3GDE A;  5FLM H;  2QGQ A;  4QIW E;  3F2D A;  1HJP A;  4A3F G;  1YJW A;  4A4I A;  1FL0 A;  1OXU A;  1QVC A;  1SR3 A;  1UE7 A;  3I7F A;  4LUV A;  5HY6 A;  4JI3 L;  1VS0 A;  2LSS A;  3OYY A;  4P75 A;  4HIO A;  3PIP A;  2WFW A;  4GNX A;  4L5R C;  2R92 H;  5JJI A;  3PUV A;  1VQP A;  4B3S L;  1XMO Q;  4GNX C;  2L15 A;  2ZJR A;  2KBN A;  2F4V Q;  1K83 H;  2C35 B;  3LGJ A;  1SRO A;  2RHS B;  3H3V H;  4DV6 L;  5FJ8 G;  4A3L G;  4JI0 L;  1XMQ Q;  1JE5 A;  4A93 H;  3RZO H;  3KYH C;  3M9B A;  4BA1 I;  3GTO H;  2WAQ G;  4JI6 L;  1PHJ A;  4YHH Q;  1OTC A;  2ATW A;  4LUO A;  1LTL A;  2YTV A;  3I2Z A;  1OXV A;  4JI8 L;  3FP9 A;  4P73 A;  1XTD A;  3NEL A;  4X65 L;  4LWC A;  1PV4 A;  3H0G G;  3HOZ G;  1VQ8 A;  4TVA B;  5K36 G;  3PO3 G;  2R6G A;  1NMF A;  3I56 A;  4HJ9 A;  4OWW B;  2VY3 A;  1QVG A;  4BXX H;  1FJG Q;  3J81 c;  1KXL A;  4JYA Q;  1XNQ L;  4DUZ L;  4DV4 L;  3S1M H;  2LXJ A;  2NVX H;  3HOV H;  1TXY A;  5AJ3 Q;  2KCM A;  5M5W H;  1E7Z A;  4JBK A;  2CFM A;  3W5O A;  4JV5 Q;  1G6P A;  4ME3 A;  2UUB L;  2QEX A;  1C9O A;  1HZA A;  1VQA A;  3A0J A;  2AWN A;  3PF4 A;  1XPU A;  4DR3 L;  1CKN B;  4JI5 L;  4APV A;  4JI3 Q;  1PYS B;  1PH2 A;  4DR6 L;  4LF6 L;  4JI7 L;  1N33 L;  1I50 H;  3KDF B;  5IE8 A;  1NE3 A;  1TWC H;  3FKI G;  4GKJ L;  1YIJ A;  1T9H A;  1XNR L;  2NN6 G;  4R4Q A;  1A8V A;  3S24 A;  4DR4 L;  4DV6 Q;  4HJ8 A;  2UXB L;  1UEB A;  5IYD G;  4JI0 Q;  5JEA J;  2UUC L;  3GTQ H;  1C7Y A;  3G48 A;  5E7N A;  1Q12 A;  4PMW A;  1N34 L;  3KF6 B;  4JI6 Q;  1UE5 A;  2OWO A;  2E8G A;  3KLW A;  1IBL L;  1VCI A;  4JI8 Q;  1MIU A;  3PUZ A;  4X65 Q;  3J7A 5;  1PA6 A;  4BY7 H;  4LF4 Q;  3L7Z C;  4DV2 L;  2PI2 E;  2R92 G;  1OXX K;  3I4O A;  4GOP B;  3CC4 A;  4IPD A;  1N9W A;  1X9N A;  3GO5 A;  3F2C A;  4LFC L;  2BH8 A;  1WYD A;  3EN2 A;  4OO1 I;  4KHZ A;  3RLF A;  2DUD A;  2VQE Q;  4R4C A;  3ULP A;  2HHH Q;  4QQB X;  4OWX B;  3E9H A;  4DUZ Q;  3U50 C;  3S2D H;  1E24 A;  1I6H H;  4UP8 A;  1Q1B A;  4OXP A;  3NEN A;  4A3F H; 
#chains in the Genus database with same CATH topology
 1IZ6 A;  1TWH B;  3W2D A;  2RA4 A;  3CCQ A;  1Q7Y C;  1BO0 A;  3BZD B;  3HGB A;  1UAP A;  4DV0 L;  1EZ8 A;  1W6J A;  3TRZ A;  4R1J A;  4YY3 Q;  4X64 L;  3BVG A;  3JC6 6;  1MJE A;  2UUC Q;  2HDL A;  1VQC A;  2EY1 A;  1IW7 D;  1GUG A;  4H44 C;  3MXP A;  2OEO A;  1CM9 A;  3PO3 H;  4GN3 B;  2ES2 A;  2BA1 A;  1JWS D;  4LFC Q;  2AWO A;  3HKZ B;  1ZYR C;  2FXQ A;  1J5E Q;  1TY2 A;  3M4Q A;  3HFZ B;  2HCI A;  1PTO H;  2PI2 A;  4NDX A;  5EBC A;  3HOX B;  4H7B A;  4C3H B;  3L3O C;  4KKT A;  2XTI A;  1JE4 A;  2IT1 A;  5C0X H;  1FJG L;  2GN5 A;  1PDQ A;  2YU9 B;  5IOD A;  3TBI B;  2F0W A;  5IYD H;  2EYM A;  2F0I A;  3B6Y A;  4JV5 L;  2Q2T A;  4DV7 Q;  1X3F A;  4A3K G;  4LFB Q;  1TWF B;  2EQS A;  1VQM A;  3H3V I;  5GAH C;  1TWA H;  3MXN B;  4FP5 D;  1VQJ A;  5FO8 B;  1CSQ A;  3U4V A;  1KDB A;  4YWL A;  1STA A;  2EYL A;  2CH4 W;  1PRT F;  3CP0 A;  3MHB A;  1UE1 A;  3LWU A;  1HR0 W;  1QVF A;  3KBX A;  1BQQ T;  4XIG S;  2H1E A;  3S9W A;  4FXG C;  4LW1 A;  4KKS A;  1L2F A;  3U4Z A;  3KDF A;  2LMC B;  1S72 A;  4RHR A;  2VQF Q;  1JQY D;  2KCT A;  4KN7 C;  3ER0 A;  2NZO A;  5C4X G;  2Y0S G;  1F2M A;  2UXD L;  1TS4 A;  1WCM G;  1RJT A;  2O5I C;  3N6R A;  4YWM A;  2PMZ E;  4HED A;  2EYJ A;  3CMA A;  3H09 A;  2RHQ B;  3TZU A;  4UY8 C;  2J4X A;  3U9S A;  4CJ1 B;  1WOC A;  1LTA D;  3M4O B;  5C5M A;  4IPC A;  3HS0 C;  4C3J H;  4K14 A;  4FYD A;  3MXU A;  1GKH A;  4CBV A;  1PZI D;  4AQY Q;  2YTX A;  3T1H L;  1MI2 A;  2CKZ B;  4A76 A;  3KLR A;  4KK7 A;  3KF8 B;  5ELN A;  4DXF A;  1EYG A;  3I3C A;  4ZYS A;  3SVM A;  4A3K H;  5IOC A;  1YNJ D;  4QCL A;  5GAG C;  2R7Z B;  4B3R Q;  4L5Q A;  1EYD A;  4M8A A;  2ZTC A;  3LX0 A;  1QOH A;  5EGT A;  3UDX A;  3I70 A;  3A55 A;  3MC0 B;  2Q2U A;  2HT1 A;  3OIQ A;  4PMC A;  4GKK Q;  4QUC A;  4DR5 Q;  2R93 B;  3A7L A;  1BR9 A;  1Y1V G;  5EPL A;  1HRJ A;  2JA7 H;  4ZK9 B;  2KCC A;  3I4N B;  5COR A;  4OWT B;  5IYC H;  1QJO A;  1EIF A;  4DUY L;  1SN8 A;  4POF A;  1IW7 C;  5C3E B;  1LUZ A;  3ICE A;  3BVM A;  4HTH A;  2A19 A;  1ONL A;  4M1U B;  5JPM C;  3K0X A;  1PYB A;  5C6A A;  5ISR A;  3E0J A;  4LF8 Q;  3KLS A;  4DXG A;  3IFT A;  3H15 A;  2HIV A;  2IPK D;  1ROD A;  1BXT A;  2SNM A;  2JA6 G;  1OO9 B;  3PUX A;  4GS3 A;  2WKC A;  5C4X H;  3Q24 A;  2G9D A;  4RHS A;  3EQL C;  3SDZ A;  4C56 C;  3QIA A;  4NW2 A;  5IP9 G;  2IX0 A;  1KTK A;  4DFA A;  1WCM H;  5CC4 A;  5C44 G;  4FXK C;  1IBK L;  1VQ6 A;  5EKL A;  2R92 B;  1STH A;  3KBG A;  1YJN A;  1JB3 A;  2QIL A;  1UWV A;  3N52 A;  4KJO A;  4DV5 Q;  1Q3L A;  1PFN A;  1V1Q A;  4ZRZ A;  4B3M L;  2Q2I A;  4A3D H;  4K6L A;  4RFB A;  3GTO B;  1SJH D;  4HJA A;  4LK1 C;  4MIU A;  3ULJ A;  1I94 Q;  3RR5 A;  1UNS A;  3K80 C;  1ET6 A;  1BKB A;  1JJ2 A;  1EUJ A;  3MZ5 A;  1SSO A;  2FJ2 A;  3G4S A;  1VMP A;  2YTY A;  3HOV B;  1JWM D;  1JC7 A;  1SNC A;  1DOM A;  2F0E A;  1Y14 B;  4UPA A;  1SMY D;  2ZXP A;  1SE8 A;  4R4O A;  2CW0 C;  3SK6 A;  1SNO A;  1XPO A;  3CCE A;  1JT8 A;  4A3B G;  1U4L A;  3BS1 A;  1QUQ A;  2NZH A;  1HR0 Q;  4BBS H;  2FMC A;  2KUM A;  2VB2 X;  2F3I A;  3E9I A;  3RD4 A;  1CK1 A;  1WTO A;  1R9T H;  1YBY A;  1IBM Q;  3NBH A;  4KHV A;  5E4W C;  2DGY A;  3HOW B;  5JVH 3;  2C5C A;  3JAM c;  2PW7 A;  3HOU G;  3E0E A;  1IYJ B;  5KND A;  3AQQ A;  5KIX A;  3TME A;  4CJ2 C;  3BJU A;  4RGN A;  2EYP A;  1EYA A;  5M3F H;  5JJL A;  4G4K A;  1KC8 C;  2MO0 A;  1PH5 A;  2HDM A;  1K28 A;  5IP9 H;  1B9M A;  2XN9 C;  2QA4 A;  2IJ0 A;  5LMU Q;  4KN4 C;  5A2Q L;  3AB9 A;  3S2H B;  2Z4H A;  1HTL D;  4IAL A;  2QW7 A;  4R4T A;  4K6D A;  2CCZ A;  2BE5 D;  5FLM G;  1JJC B;  1Z47 A;  2B2T A;  5JOB A;  1EZ6 A;  1CZG A;  4RGM A;  1JWU D;  1YNJ C;  4F8M A;  5M5X B;  3SR1 A;  1FNU A;  3DEO A;  3NE5 B;  3D6C A;  4ULL A;  5JEA H;  1PTO D;  4QIW B;  3D0F A;  1KLU D;  3VYU A;  4OO1 H;  2UU9 L;  1LT4 D;  2A73 B;  1YHB A;  1GXD C;  1KD1 C;  4AH6 A;  2UXC Q;  2RBM A;  1LLR D;  5A2Q E;  2B2Y C;  3NUC A;  1DON A;  2Y0S B;  4MTK A;  2OXP A;  1WTP A;  2F4I A;  3CXC A;  2UUA L;  4JI7 Q;  4BXX G;  2E2I B;  4K5X A;  1F9Q A;  2UXB Q;  1QNU A;  3AU7 A;  4EQN A;  4K0K L;  2BDO A;  2DJG C;  5EPK A;  1RKN A;  3MVV A;  3H0G H;  4X66 Q;  4IOA A;  1PVO A;  2JK8 A;  3FVQ A;  1XMO L;  3ND9 A;  5LHY 1;  2JXM B;  2F1M A;  1TWG H;  4RCO A;  3T1Y Q;  3HOU H;  1N36 L;  1F9R A;  5M9O A;  1HXY D;  4HSV A;  1NTG A;  4I7Z C;  1JR0 D;  5D65 A;  2FFK B;  4Y52 H;  1U5K A;  4IJH A;  4DN4 M;  3DWA A;  3RN5 A;  4BY7 G;  1STG A;  1H9J A;  1PFB A;  1EIY B;  1E2Z A;  1OXS C;  1WD0 A;  3S14 H;  4WJW A;  1G2S A;  1SE4 A;  2WAQ E;  4DR2 L;  4DV0 Q;  4DR1 L;  1JB7 A;  4HN7 A;  1EY5 A;  2ZTE A;  4KKU A;  4YCV A;  4X64 Q;  3JAM i;  2NZ1 D;  5AJ3 L;  2F0D A;  3UE0 A;  3J7Z C;  3VR4 A;  1CKM A;  5FLM H;  1Y1V B;  3OWE B;  1YJW A;  1G8Z D;  4O42 A;  2PZU A;  3I7F A;  1VS0 A;  3PIP A;  5JJI A;  5CV6 A;  3VA7 A;  3PUV A;  2A69 D;  4KY7 A;  5KYL A;  2LKV A;  3LGJ A;  3H3V H;  1SRO A;  2N55 A;  3KYH C;  1EOT A;  3M9B A;  4LUO A;  1QZH A;  3NEL A;  1QB5 D;  2R61 A;  2JA6 B;  3K5N A;  4TVA B;  1BBX C;  1QVG A;  4FF2 A;  1FJG Q;  4BXX H;  1KXL A;  3S1M H;  5C44 B;  3VR6 A;  5M5W H;  2HCC A;  4JV5 Q;  2UUB L;  1XPU A;  4JI3 Q;  1K8M A;  3TN2 A;  1PH2 A;  1LTG D;  2P5Z X;  3BG3 A;  1NE3 A;  1TWC H;  3FKI G;  3LNN A;  4H13 C;  1H9S A;  1AP0 A;  1QIL A;  4JI0 Q;  1EU4 A;  3GTQ H;  2M2L A;  3G48 A;  5E7N A;  1N34 L;  4JI6 Q;  2K28 A;  1VCI A;  4JI8 Q;  1PA6 A;  4BY7 H;  2BE5 C;  2PI2 E;  2XVS A;  1A3V A;  2ZT9 C;  1OXX K;  1CZW A;  2VB3 X;  4IPD A;  1EY4 A;  4XQJ A;  2F0U A;  3EN2 A;  4A3J B;  1GUO A;  3FDT A;  4KHZ A;  3VYT A;  3CQZ B;  3S17 B;  3SE0 A;  4QQB X;  4OWX B;  1PTO C;  3S2D H;  2F0T A;  3U50 C;  1I6H H;  4UP8 A;  4CDC C;  3GTK H;  4C1N I;  1IKL A;  4NB3 A;  4A3E G;  4A3B B;  3I4M B;  3TRE A;  1HFN A;  2VL6 A;  2XSC A;  4RCN A;  4JI5 Q;  5IYB H;  2RCF A;  3Q6S A;  2VUM G;  3QB3 A;  1CTM A;  4POG A;  4X6A H;  2NB0 A;  3BZK A;  4J1M A;  4MN3 A;  2AUK A;  3T56 B;  3QJY A;  3ERO A;  4Q0F A;  1I4H A;  1IBL Q;  4UP7 A;  2O4X A;  1X3E A;  3S1Q B;  5E4X A;  2B63 B;  1EWH A;  1ASZ A;  1X3G A;  1U0L A;  4PZ6 A;  1AE2 A;  1E2V A;  4UP9 A;  4O0A A;  2AQ1 B;  2CWP A;  3CD6 A;  1KAA A;  3SK5 A;  5D14 A;  4IJL A;  5C0X J;  4YHH L;  3GTP B;  3CCM A;  2K5H A;  2PCF B;  2F0S A;  4RKB A;  4DK3 C;  3E5S A;  4IUN A;  3GTJ B;  2EY6 A;  2EOT A;  3CF5 A;  3S16 B;  1SNQ A;  2BCO A;  3CCJ A;  2PMZ B;  1TKW B;  4A3I H;  4DNI A;  3FKI H;  4JYA L;  2E2J B;  2ZM6 Q;  2OTL A;  3MXN A;  3STB C;  1KDA A;  1RD9 D;  4C3I B;  1SLJ A;  4HMI A;  4NXN L;  1TS5 A;  2F0P A;  3AEV A;  2D0O A;  1BF4 A;  1U4M A;  1SRU A;  3KFU A;  2NYZ D;  4DUY Q;  4IUQ A;  4DNR B;  1GJX A;  2A69 C;  3F2U A;  5M3M B;  4XQQ A;  3MA2 B;  1PXU A;  2Y0S E;  3WOF A;  1ET9 A;  4DR7 L;  4LF7 L;  3NPP A;  1RL2 A;  3G6E A;  2VZA A;  4ZUJ A;  3HOX H;  2PW5 A;  3R2I A;  3A54 A;  1AZQ A;  4A3E H;  3D4D A;  2EIF A;  3GTL H;  3PIO 3;  2R3Z A;  2NVY H;  3SGI A;  1AW7 A;  5J1Z A;  2VUM H;  2PQA B;  3A56 A;  2VQE L;  3S1N B;  4DV3 L;  4L6T B;  4G7Z C;  1TS3 A;  1IBK Q;  2M9V A;  1XWE A;  3W1B A;  1MHW C;  1CI3 M;  4BBR B;  3CCL A;  3FEW X;  2K5D A;  4X62 L;  2EXZ A;  1SNP A;  1DOK A;  3IFD A;  3TSS A;  3AFP A;  3PSI A;  5C0X G;  1GUS A;  2EJF C;  3UI2 A;  1LTI D;  3HOY H;  1A2U A;  4B3T L;  1HH2 P;  4K2K A;  1HA5 A;  3KJO A;  1WTV A;  3J7Y W;  2D0P A;  4ZCK A;  2JA5 B;  3M3Y B;  2OQ0 A;  3I72 A;  3J80 c;  1PRT D;  3S1R H;  2E75 C;  1SE3 A;  2KHJ A;  1JMC A;  1TR5 A;  1E0B A;  2KEC A;  1PH9 A;  1VQF A;  2QDL A;  5DLQ E;  2XNA C;  5EKK A;  1A3U A;  3HKS A;  4DK0 A;  1K8A C;  1WI5 A;  2RSN A;  2VW9 A;  4JOI A;  1G51 A;  1UE6 A;  5CMD A;  4CHT B;  2Q2H A;  2E5L Q;  5NUC A;  2NTS A;  1XTC D;  5DEH A;  1SFO B;  2JA8 B;  1N32 L;  1JJG A;  2ZXR A;  2PZT A;  1Y8N B;  1BBU A;  2YV5 A;  1SAP A;  2H5X A;  5T1G A;  3A5Z B;  3RZD B;  3DXJ C;  4A3G B;  4JI1 L;  2DN8 A;  2K6A A;  2K1B A;  1HTP A;  2NVT B;  2EE1 A;  3V05 A;  2I46 A;  3K7A H;  4A3C H;  1SJE D;  4KJN A;  2F0J A;  5GQO A;  1LTT D;  2KEN A;  2R7D A;  5M5Y H;  4G57 A;  5CBA E;  3NK9 A;  1Q90 A;  3CRK C;  3OTO L;  4JI4 Q;  3DWP A;  2KHS A;  1Y1W B;  1I4X A;  4HID A;  4MTN A;  4ABN A;  4C3J G;  4B9X A;  2BDN A;  1CUK A;  3QO2 A;  3KOJ A;  2IX3 A;  4UAI A;  1IYV A;  1R4P B;  2MNA A;  2VS1 A;  3OOC A;  3KK7 A;  4YWK A;  1K9M C;  3I4N H;  3PGZ A;  3TZD A;  2SOB A;  1HHV A;  1VQ7 A;  1D5Z C;  3JAM L;  1CSP A;  1O7I A;  2UU9 Q;  3RZO B;  1PYW D;  5C3E H;  5KYI A;  1X56 A;  4IFD I;  1ML0 D;  1X32 A;  2L5T A;  2DJF C;  3MTS A;  3MXG A;  3SK8 A;  4C2M H;  3TP5 A;  2K03 A;  4LF5 L;  1V9P A;  2JA7 G;  1O78 A;  5GRO A;  2F0K A;  3C46 A;  3TEH B;  2J7Z A;  3QWN A;  4CDE C;  2D9U A;  2LXK A;  5IYC G;  2E2D C;  4K0K Q;  2Q8I B;  4WJ3 M;  1CHQ D;  4XQN A;  1G2T A;  3CW2 C;  4AIM A;  1KAB A;  3J80 i;  4H02 A;  2RDG A;  2CW0 D;  4ZLT F;  2JEB I;  2XGT A;  1I50 B;  3BYT B;  1N36 Q;  1BDO A;  3JAM E;  3GTG H;  5DM6 3;  3CKI B;  4ME5 A;  2B2W A;  5C4Z A;  4L5S A;  1QZG A;  4X3T A;  2OQK A;  1VQ5 A;  1M4V A;  5BR8 L;  1SYG A;  1U9R A;  2PNR C;  5IWA L;  4DR2 Q;  4DR1 Q;  3CCV A;  2MJ8 A;  3TS2 A;  2AKW B;  5GAD C;  1KL9 A;  5BN4 A;  3CCU A;  4A3D G;  1FVI A;  1P16 A;  2N88 A;  1VQ4 A;  1Q8K A;  1DGS A;  1LM0 A;  4A3M H;  5FOB B;  5J39 A;  1PRT C;  1NJI C;  3A74 A;  1P8L A;  5KNB A;  2I5M X;  4P74 A;  1SYB A;  1B53 A;  1PLF A;  4BY1 G;  2ICE C;  4MZ9 A;  3NEM A;  1D1I A;  3PO2 G;  1KRS A;  1FNW A;  3A8I E;  2HIX A;  2WAQ B;  1L0W A;  2CH4 A;  1JOO A;  1PH8 A;  1K3B C;  3HOW H;  1MJC A;  3Q23 A;  1J6Q A;  2MHV A;  3PO3 B;  3VDY A;  2L0C A;  2EYO A;  4QJF A;  5C4J H;  4KHP L;  5ELC A;  4LFA L;  1WTX A;  4A93 G;  2N49 A;  1STE A;  4BBS G;  3J81 j;  1SNM A;  1TII D;  3L9A X;  3H6M A;  1NY4 A;  3UDF A;  3DM3 A;  1IXR A;  3VR3 A;  1PTO B;  4WJ4 A;  1KIX A;  3CC7 A;  1AH9 A;  1F9S A;  2EYF A;  4MHE A;  4GLX A;  5FJ8 H;  4XYQ A;  1D8L A;  3NWT A;  3OW2 A;  1LAB A;  1QG7 A;  2MQH A;  1KAW A;  1YNX A;  2K52 A;  1VF7 A;  5M3F G;  2IX1 A;  4FF1 A;  1Y8O B;  1GUT A;  1AEX A;  5I9O A;  1YHQ A;  2Z9H A;  1E22 A;  3H3V C;  1SBB B;  4PMB A;  1SMX A;  4OX9 L;  2PQE A;  4JI2 Q;  2H4O A;  2IHE A;  3HEJ A;  1YJ9 A;  2KQ3 A;  1GUW A;  4OON A;  4KY6 A;  2EY2 A;  5D3I B;  1GOZ A;  2D62 A;  3P75 A;  2A74 C;  2K05 A;  4PZ8 A;  1VQI A;  3TP6 A;  4XXE A;  1KQS A;  3DHQ A;  4KD3 A;  2NBF A;  3OMC A;  4HMJ A;  3V96 A;  3W1G A;  1A6X A;  1VQE A;  5JEA G;  1X65 A;  2KHI A;  1EQV A;  4BY1 H;  4OO1 G;  1K8G A;  1DCZ A;  3PO2 H;  3GDE A;  4A3F G;  4DAV A;  1B44 D;  4A4I A;  4FVM A;  1SR3 A;  4GNX A;  1LTR D;  3OYY A;  2K5W A;  1Q8I A;  4OEL B;  4B3S L;  1DZ1 A;  2F4V Q;  1K83 H;  1LT6 D;  2XRS D;  1STN A;  2JN4 A;  4DNT B;  4A3L G;  1D5X C;  5ELD A;  4A93 H;  2F0Q A;  4YHH Q;  4OIK A;  1LTL A;  4DK1 A;  3K0Y A;  3ZYY X;  3H0G G;  1HUM A;  3HOZ G;  4IUP A;  3QOL A;  4RGT A;  5K36 G;  2JP1 A;  4G7O C;  2R6G A;  1KNE A;  4HJ9 A;  4OWW B;  3RUZ A;  3J81 c;  3P20 A;  1K0S A;  2FHT A;  4JYA Q;  3C1F A;  1XNQ L;  4DV4 L;  4IQZ A;  3IAY A;  1C8C A;  2NVX H;  1XXG A;  4E6I A;  1TXY A;  1MBY A;  3NXW A;  1G6P A;  4H0L C;  1ENA A;  4ME3 A;  4V19 0;  1HZA A;  3A0J A;  1F2Y A;  1L0X B;  3T53 B;  4A3K B;  4CKE A;  4RWS C;  4DR3 L;  1T5E A;  4L8J A;  4DR6 L;  4LF6 L;  1N33 L;  1S5E D;  3KDF B;  5IE8 A;  3SK4 A;  4GKJ L;  1T9H A;  4R4Q A;  3NTK A;  4DR4 L;  4DV6 Q;  3FRP B;  2ZXO A;  3C2P A;  2UUC L;  1C7Y A;  4PMW A;  1Q12 A;  1F77 A;  1SYC A;  2JA7 B;  3PUZ A;  4X65 Q;  3J7A 5;  1ICF B;  4I7A A;  4DV2 L;  2MPM A;  4N8X 1;  2RDH A;  1X9N A;  3GO5 A;  4LFC L;  1MSH A;  5JJZ A;  2DNC A;  2VQE Q;  4DUZ Q;  1E24 A;  4A3F H;  2EZV A;  4JK1 C;  2E2H B;  4HIK A;  1LTB D;  2SDF A;  5C4X B;  2NVQ H;  3PF5 A;  5LMN L;  2D2C C;  1QNK A;  1B4O A;  3FPU B;  5HGQ A;  3J7A F;  4A3L H;  3D6W A;  1Z6H A;  4ID6 A;  2E74 C;  1G29 1;  2K5N A;  1WCM B;  1F9P A;  2KVM A;  4DV7 L;  5CV8 A;  3BU2 A;  1J8I A;  1G6Z A;  2IWH A;  2Z6K A;  1MD2 D;  2WP8 J;  3HOZ H;  1IKM A;  1KNA A;  1M1K C;  5K36 H;  5I6W A;  3A8K E;  2IL8 A;  2X69 A;  1B1Z A;  2MP1 A;  3OW7 A;  1GD7 A;  1RF2 D;  1LYL A;  2MO1 A;  3F2B A;  1HA6 A;  3CPF A;  4QMG A;  1B50 A;  1H9M A;  3E3X A;  2LY7 A;  3R3O A;  2WB1 G;  2B2U C;  1L1O C;  2JYO A;  2OF1 A;  5JVG 3;  3STB D;  4IPG A;  5DAU A;  2RCN A;  4JCV E;  3UDI A;  2GVA A;  2VQF L;  2N3S A;  2K4K A;  3NTI A;  5D3D A;  3J81 i;  1ZXT A;  4C1N K;  5KNC A;  2GVB A;  4CKC A;  4JC0 A;  2L4N A;  2V4D A;  3CC2 A;  2AHO B;  1EY6 A;  2CWA A;  5IYB G;  5EKI A;  1EY0 A;  2AMC B;  1NNX A;  1R9T B;  5F2D A;  3J80 L;  3P1H A;  3NTH A;  4IFD H;  2DNE A;  2PQA A;  1E3P A;  2JA9 A;  3OTO Q;  4HJ5 A;  1BOS A;  4V0B A;  4XYO A;  1V1O A;  5JAV A;  4LF4 L;  3Q0A A;  1MKH A;  2FIN B;  4HIM A;  2F0F A;  2ID0 A;  4XDX A;  1KRT A;  3K5L A;  3TP8 A;  3J7A V;  1CKN A;  1MGS A;  4HAE A;  3S15 B;  4AQY L;  2HHH L;  3HZX A;  1H95 A;  3CAM A;  1EWC A;  1I3Q H;  1VMC A;  3I90 A;  4OGQ C;  3P7J A;  2HD3 A;  2TMP A;  3KF6 A;  1UEA B;  2RDF A;  1BUV T;  3J80 E;  4A3I G;  3FHW A;  4GOP A;  4DR5 L;  1V1P B;  5BN5 A;  3K8A A;  1D5M C;  3QR8 A;  3GD7 A;  1NR4 A;  1EU3 A;  5IGE A;  1WTQ A;  2IHF A;  4KTA A;  1ESR A;  1C48 A;  2I0Q A;  4LJZ C;  1K8O A;  3NBH B;  3NSW A;  4U68 A;  3HKZ G;  3KUP A;  3S1N H;  4TSS A;  3PIP 3;  1HZB A;  4IOC A;  1B70 B;  1PMR A;  5IGB A;  4KMU C;  2A6H D;  2L9H A;  4LF8 L;  1B7Y B;  2F3W A;  3HG9 A;  4BBR H;  2A6E C;  2XIW A;  3L2P A;  1PRT B;  3HOX G;  1HNW L;  4EGV A;  1HNZ L;  3I91 A;  1S4Z A;  4JOI C;  5G3L F;  3AFQ A;  1VQO A;  4PNY A;  3VR2 A;  2ZJQ A;  3PMF A;  4YIJ A;  5ELF A;  4CGY B;  3G71 A;  1YIT A;  2UXD Q;  4UDU C;  1BCP F;  2L55 A;  4LF9 L;  3H0G B;  3I8Z A;  3PUW A;  4DV1 L;  5FK9 C;  5IWA Q;  3OHX C;  1E1T A;  4Y7N H;  1I4R A;  4DV5 L;  1XX8 A;  3ULL A;  3IRB A;  3HOU B;  3FMC A;  1CQF A;  2K04 A;  5FO7 B;  1S5F D;  3K7U C;  1C0A A;  3Q8D A;  1G91 A;  4J15 A;  5CV9 A;  3M85 A;  4OEM B;  1STB A;  1I94 L;  1HFG A;  1KHI A;  4AYB G;  1GVP A;  1SND A;  3KLS X;  5L37 A;  3HOY G;  4MNO A;  5EBD A;  3S14 B;  1B9N A;  4GLV B;  4PV1 C;  1DJR D;  3T1H Q;  1TWH H;  4XT3 B;  2VXW A;  1BVS A;  2BH2 A;  3O13 A;  4R4I A;  1EWI A;  3ND8 A;  1SFO H;  2JEA I;  3PIO A;  1B3A A;  2JSO A;  2NN6 I;  1S3O A;  3D4W A;  1STY A;  3K81 C;  4XT1 B;  3GTM B;  5FLX c;  1H9K A;  2K5V A;  1C4Q A;  1CA5 A;  4B9W A;  1NBW A;  5CBE E;  3R2T A;  5TSS A;  1Y8P B;  1EQT A;  1NUC A;  5LMN W;  2JQO A;  1BCP C;  4LFA Q;  1HNX L;  1I4P A;  4EQ5 A;  1W2B A;  1EY9 A;  4GN5 A;  1EEF D;  1M90 C;  3I73 A;  4DA2 A;  2DY8 A;  3RLO A;  1X6O A;  3DM1 A;  4KD4 A;  3TDQ A;  5J22 A;  1PZK D;  1XYI A;  2VNU D;  1Y1W H;  4NPS A;  5IP7 G;  2Q8R E;  1S5C D;  1OXT A;  4QY7 A;  4DPG A;  3S1M B;  4C3H H;  4A3C G;  1U4P A;  1XPR A;  5M5W B;  2IW3 A;  4J6H A;  2K32 A;  5LMU L;  1AFP A;  1S5B D;  2YU9 H;  1B3Q A;  2N78 A;  1EL0 A;  5C3X A;  4OX9 Q;  2L12 A;  1TWC B;  1TWF H;  1IYU A;  3K59 A;  2R7Z G;  3VYR A;  4B3M Q;  3Q22 A;  2FMM A;  4K5W A;  2Z6B A;  3GTQ B;  4LAA A;  5IIF A;  2ZJP A;  1CHP D;  4JBW A;  4BY7 B;  4BS9 A;  2R93 G;  3R93 A;  1A63 A;  3G6J B;  4FXD A;  5I4D A;  2F0O A;  2K14 A;  1D6E C;  4YCW A;  3X3N A;  3I4N G;  3C3L A;  1WJJ A;  3NBI A;  4HCS A;  1HUN A;  5A35 A;  2UXC L;  1I6H B;  3S2D B;  5C3E G;  3HRZ C;  3KF8 A;  1WD1 A;  3ERS X;  1RDP D;  1EY8 A;  2LFN A;  3GTK B;  1GHK A;  3UE1 A;  3RNU A;  2ICI A;  3RN2 A;  4B3S Q;  3DLL A;  3K6O A;  4GLA C;  4RA8 A;  1RHP A;  2A6H C;  5H1S E;  1VQN A;  3MWY W;  4ALP A;  1Z9F A;  1EQR A;  1EOV A;  4X66 L;  1Q81 C;  3T1Y L;  1H9S B;  1LTS D;  4NMZ A;  1R4Q B;  2ALY B;  3URY A;  2R7F A;  1A0I A;  5IT9 E;  3TP7 A;  2CQA A;  4FNF A;  1XNQ Q;  4DV4 Q;  4DAY B;  5IP7 H;  3M4O H;  3BZC A;  1VQK A;  1FYC A;  1I6V C;  2I5L X;  1H9R A;  1TT2 A;  2B29 A;  4DR3 Q;  2A8V A;  3D8G A;  4DR6 Q;  4LF6 Q;  1N33 Q;  5CR3 A;  2RSO A;  4R9W A;  4DU9 A;  4GKJ Q;  4DR4 Q;  4P2C B;  4A3I B;  3FKI B;  4DK6 C;  4ZKB B;  3HOV G;  2R7Z H;  5IGD A;  2EXD A;  3BDL A;  2PNH A;  2X6G A;  4A3M G;  3V2T A;  1FGB D;  3NQI A;  4DV2 Q;  2R93 H;  3H91 A;  1FGU A;  4OIJ A;  3R8B A;  5DM7 3;  5GAE C;  2BA0 A;  1ASY A;  3NHH A;  2O5J C;  1O7Y A;  1V8Q A;  4IN3 A;  3EBE A;  1IL8 A;  3J81 L;  4NKL A;  3CU7 A;  3HOW G;  1EIG A;  4TKO B;  4EX5 A;  3F1Z A;  3CRL C;  4A3E B;  4FF4 A;  3GTL B;  3GV6 A;  4Z9C B;  2UUA Q;  4Q5V A;  5LMN Q;  2NVY B;  3ERQ A;  5EPJ A;  2YYZ A;  3K58 A;  2L11 A;  5IGF A;  3AYH B;  1EFW A;  2VUM B;  1L1O B;  4YCU A;  5ELE A;  1HJP A;  1O7Z A;  1OXU A;  5HY6 A;  2ASB A;  4JI3 L;  2LSS A;  4P75 A;  4IUV A;  2R92 H;  1VQP A;  1XMO Q;  4GNX C;  2ZJR A;  2KBN A;  5CV4 A;  1DYQ A;  4FF3 A;  2RHS B;  5FJ8 G;  4JI0 L;  4AYB B;  1JE5 A;  2Z8L A;  3HOY B;  4BA1 I;  3GTO H;  4JI6 L;  3J81 E;  1PHJ A;  1LAC A;  2AQ2 B;  1OTC A;  2ATW A;  4JI8 L;  2YTV A;  1PZJ D;  3I2Z A;  3FP9 A;  4P73 A;  5KRU A;  5CV7 A;  4K5V A;  4ILW A;  4LWC A;  1PV4 A;  2EYH A;  2NTT A;  4OL7 A;  3CHB D;  2QKI C;  1FR3 A;  4J8Q A;  1NMF A;  3S1R B;  1ZKO A;  3A8J E;  3DEP A;  5FKA C;  4KV6 A;  2PO4 A;  4OHJ A;  4TRD A;  1NAP A;  3HOV H;  4ZUI A;  5AJ3 Q;  4JBK A;  1E7Z A;  2CFM A;  4X3K A;  3NWS A;  2SEB D;  1C9O A;  1VQA A;  1I4G A;  4L63 B;  3PF4 A;  4JI5 L;  1PYS B;  2Z4I A;  3T16 A;  2MGS A;  1ILQ A;  2ENB A;  5CYU A;  1DXM A;  2NN6 G;  1XNR L;  1JOQ A;  2Q8T A;  1Y69 U;  1UEB A;  4BWG B;  2OT2 A;  2B2V A;  4CKB A;  5JEA J;  2C9O A;  1UE5 A;  2CHB D;  2E8G A;  3KLW A;  1IBL L;  4LF4 Q;  2B2T C;  3M7G A;  5T1I A;  1YNN D;  1CT1 D;  1ESF A;  3K7A B;  1NCV A;  1N9W A;  1TVX A;  2BOS A;  3WOE A;  3RLF A;  2DUD A;  2HHH Q;  2QDB A;  5M5Y B;  1Q1B A;  1SYE A;  3NEN A;  1NR2 A;  2AUJ D;  3T51 B;  5HUR A;  2UUB Q;  3S2H H;  4DAP A;  1K73 C;  5I2X A;  4U67 3;  5IT9 c;  3U58 A;  3D4R A;  4NXM L;  1NSN S;  4X3U A;  2ZM6 L;  1CQV A;  2Z1C A;  5JJK A;  4O1N A;  1Q86 C;  2WB1 E;  4N9T A;  4P72 A;  1CA6 A;  3OSO A;  1SXT A;  1N34 Q;  4S3S A;  5M5X H;  3GP7 A;  2G9H D;  4K2L A;  3OMG A;  3VYS A;  4IUU A;  2Z6K C;  3SEB A;  3SXH A;  1SE2 A;  1ENF A;  2F0G A;  2ZTD A;  1TWA B;  4G7H C;  3A5U A;  1XMQ L;  3AMU A;  4R8N A;  1JOR A;  1D1K A;  3W3A A;  2MFI A;  4IO9 A;  3LWE A;  2NUC A;  2EVB A;  4C2M B;  1X3P A;  1X55 A;  2E2H H;  2A68 D;  3F8T A;  1HNW Q;  1HNZ Q;  1QE6 A;  1JIC A;  2EPB A;  1TU2 B;  2K33 A;  4QGU A;  2E2I H;  1CFM A;  3OPO A;  2KA7 A;  3NQT A;  3BDC A;  4HCE A;  2PPB C;  4LF9 Q;  2NN6 H;  4O2D A;  4DV1 Q;  3ZJY C;  3PQI A;  4IUR A;  2F0M A;  4IFD J;  4A75 A;  3TQY A;  5KEE A;  2B39 A;  2F3V A;  3ITP A;  3GTG B;  3KJP A;  4CDF C;  3UDG A;  2LS0 1;  4LUZ A;  4CDD C;  3MFY A;  3BDO A;  1BCP B;  1A3T A;  3K5M A;  5EAY A;  2B8F A;  3RLN A;  4ODG A;  1GM5 A;  1VQL A;  2I07 B;  2RVL A;  2TSS A;  4ZQ3 A;  2XWB B;  3RMH A;  5EQ0 A;  5BN3 A;  1HZ9 A;  4RH6 A;  4A3J G;  1D7Q A;  2QCP X;  2JJQ A;  3PV0 A;  2F0L A;  2B3G A;  4A3M B;  3X3M A;  4C3J B;  5LL6 S;  4JPB W;  4KY5 A;  1XJV A;  4KI0 A;  1Y1V H;  1V1P A;  2E5L L;  4K8J A;  3I4M G;  3HKZ E;  4NXN Q;  3M4Y A;  1X54 A;  1HNX Q;  2OCE A;  5CGK A;  1AZP A;  5HGT A;  1VQB A;  1W3S A;  3K57 A;  1Z7T A;  2XWJ B;  1LV9 A;  4YY3 L;  4JBM A;  2WII B;  2F52 A;  4F7X A;  3GQB A;  3EIV A;  3BYY B;  4GOP C;  1EQQ A;  4DR7 Q;  4LF7 Q;  5ELO A;  4WFN 3;  5C4J B;  5ELB A;  1GUN A;  2N8N A;  3WWV A;  2JA6 H;  4EQP A;  2B63 G;  1K0R A;  2WKD A;  1PH3 A;  4NP5 A;  1DOL A;  3U9O A;  3S15 H;  2F0N A;  1YNN C;  3M7N A;  5AFW A;  5C44 H;  2A6E D;  4IFD G;  2K75 A;  1HCZ A;  1JOK A;  4JI4 L;  4XTC S;  4DV3 Q;  4KLK A;  5JPN C;  3MFG A;  1J5E L;  3M4P A;  5FLX L;  4LMQ D;  4QB4 A;  4QL5 A;  1S40 A;  4AYB E;  1II3 A;  3I55 A;  3HP3 A;  4X62 Q;  2KJX A;  1AE3 A;  2WIN B;  1YI2 A;  1MSG A;  2V1C C;  4IZ8 A;  4C3I G;  1ENC A;  4B3T Q;  1D2B A;  1E2W A;  3NP8 A;  3PCO B;  4LFB L;  1RTN A;  2J0T D;  2RKS A;  4EVO A;  3D31 A;  1AN8 A;  1ICW A;  4A3D B;  1WFQ A;  5M3M G;  1VDZ A;  4A3J H;  1I5F A;  3S17 H;  3CQZ H;  4FO2 A;  1IL2 A;  1GO3 E;  2CVR A;  5COY A;  5FLX E;  1QWY A;  1F2Z A;  2D5D A;  4A3B H;  3T4A C;  1HPC A;  4BY1 B;  3I4M H;  2A68 C;  3PO2 B;  3TS0 A;  5C0X I;  2E76 C;  1VQG A;  5I9P A;  1I4Q A;  5G3L D;  1HQM C;  1N32 Q;  4LNQ A;  1BCP D;  2MUY A;  3VA5 A;  4BBR G;  3DMU A;  1K83 B;  4JI1 Q;  4K8I A;  2F03 A;  3S1Q H;  2B63 H;  4A93 B;  2PYK A;  3FPP A;  3GV3 A;  1WTW A;  1HZC A;  4BBS B;  3IKJ A;  1PH1 A;  1ZEQ X;  4FDB A;  1YZ6 A;  3GTP H;  1F2L A;  4L5T A;  1RIP A;  4GZY C;  1LO5 D;  2JA5 G;  1PH4 A;  4ZKC B;  3MEH A;  3GTJ H;  3D3R A;  2WAC A;  4B08 A;  1BNZ A;  3S16 H;  4RAU C;  3L0O A;  4N9P A;  3EJI A;  2NVX B;  1YHA A;  3CPW A;  3CCR A;  3VR5 A;  1A15 A;  3GTM H;  5M3F B;  2E2J H;  1WTR A;  1HQR D;  3EVQ A;  4C3I H;  5E1F A;  1RTO A;  1SMY C;  2RF4 A;  1L0Y B;  1Q82 C;  4DKA C;  1U4R A;  2EJM A;  3EFX D;  3EA6 A;  4F87 A;  2HQL A;  2JA8 G;  1YVC A;  4GNX B;  4B3R L;  1V43 A;  4IPH A;  2F0V A;  4EQO A;  5M3M H;  2G5D A;  1PTO F;  4A3G G;  1FD7 D;  4GKK L;  2JE6 I;  3OIP A;  1QUQ B;  2QEJ C;  2DY7 A;  4LF5 Q;  1VQ9 A;  1PFS A;  2PZW A;  4N8F A;  1E1O A;  5J3B A;  4BA2 I;  4GN4 B;  1PH6 A;  5IGG A;  4RGO S;  2A1A A;  1TQO A;  1DD2 A;  1VQD A;  4A3F B;  5EJW A;  2CQO A;  3MEF A;  3T13 A;  1WVL A;  5IY0 A;  4P71 A;  1Q46 A;  4TQU S;  4RKL A;  5I2Y A;  2NVQ B;  2OTJ A;  2AQ3 B;  1W6K A;  1Y1W G;  2WV6 D;  2Z0S A;  1VQH A;  2A5H A;  4C3H G;  4JBJ A;  4DAY A;  2L1B A;  2NWG A;  1VF5 C;  2K01 A;  1YEZ A;  3BVZ A;  1UUP A;  2QF7 A;  2X6L A;  4RG1 A;  3HOZ B;  4JI2 L;  4QF4 A;  5BR8 Q;  1TWG B;  4RMF A;  2JA5 H;  3M3Y H;  2KEE A;  1A62 A;  1T5X D;  5IGC A;  1FNV A;  1KDC A;  2B2Y A;  1NMG A;  1CKO A;  3DUZ A;  5KGU A;  1LT3 D;  3MAQ A;  3E6Z X;  2K50 A;  2EDG A;  4PZ7 A;  1RCV D;  1SEB D;  5LL6 X;  1XNR Q;  1JCK B;  3CME A;  4X3S A;  4R8I A;  2JA8 H;  1O7L A;  4ZAI A;  2KED A;  3PUY A;  2KCN A;  5I6Y A;  3QOJ A;  3QG1 A;  2I5H A;  3RZD H;  4A3G H;  1N8R C;  2F4V L;  2IY5 B;  3G7L A;  5C4H A;  1Q1E A;  4HJ7 A;  1EY7 A;  1QCB D;  1ZYR D;  2GA4 B;  4KHP Q;  3C1E A;  2NVT H;  1DM0 B;  1HR0 L;  2EY5 A;  3CCS A;  2M00 A;  3ONA B;  5FO9 B;  1ILP A;  2B2U A;  1K3R A;  1L1O A;  4DAM A;  1EIH A;  5E3F A;  1IBM L;  4CJ0 B;  2HUG A;  1KLG D;  1GHJ A;  4PG3 A;  1J9O A;  4JVZ A;  4NXM Q;  2HQE A;  1B8A A;  1BBW A;  1PH7 A;  3SHL A;  1EFI D;  4JG2 A;  3F2D A;  2QGQ A;  4QIW E;  2O2L D;  1I3Q B;  1FL0 A;  1QVC A;  1UE7 A;  4WRD A;  4LUV A;  4HIO A;  1VQ8 A;  5C3W A;  2WFW A;  4L5R C;  2L15 A;  1TY0 A;  3K5O A;  4DF7 A;  2C35 B;  3A7A B;  4I65 A;  4DV6 L;  1XMQ Q;  3RZO H;  2SNS A;  2B8G A;  2WAQ G;  3OWF A;  4UHV A;  4X65 L;  1OXV A;  1XTD A;  2B2W C;  3PO3 G;  3I56 A;  5DNF A;  2WB1 B;  1SYD A;  2VY3 A;  4DUZ L;  1M8A A;  1S5D D;  2LXJ A;  2RQX A;  3I4L A;  5IT9 L;  1IHZ A;  4HR7 B;  4JW0 A;  3WDN A;  1EEI D;  2KCM A;  1LT5 D;  3W5O A;  5C5L A;  2QEX A;  4QUF A;  2EJG C;  2AWN A;  1CKN B;  1X3Q A;  4APV A;  4HSP A;  4JI7 L;  1I50 H;  1B2T A;  1YIJ A;  4WOR A;  1A8V A;  2KOL A;  3IL8 A;  3S24 A;  4HJ8 A;  2UXB L;  5IYD G;  3H94 A;  1SYF A;  2K7V A;  1PFM A;  2XRQ D;  4DGZ A;  4Y7N B;  3KF6 B;  2OWO A;  2B2V C;  1WTH A;  1MIU A;  4F88 A;  4PQX A;  3DWQ A;  3L7Z C;  4IUT A;  2R92 G;  3I4O A;  4GOP B;  2K5Q A;  3CC4 A;  1A2T A;  3F2C A;  1EYC A;  2BH8 A;  1WYD A;  1TS2 A;  4OO1 I;  4R4C A;  3ULP A;  1O80 A;  3E9H A;  5CV5 A;  1SDF A;  4OXP A;  5K5P A;  2F0H A; 
#chains in the Genus database with same CATH homology
 1IZ6 A;  4NB3 A;  4A3E G;  2UUB Q;  3CCQ A;  4HIK A;  3TRE A;  1Q7Y C;  3S2H H;  1K73 C;  2VL6 A;  4JI5 Q;  5IT9 c;  4DV0 L;  5IYB H;  3U58 A;  5LMN L;  3PF5 A;  2NVQ H;  4NXM L;  2VUM G;  5HGQ A;  2ZM6 L;  4R1J A;  3TRZ A;  4A3L H;  4YY3 Q;  4X64 L;  1G29 1;  2K5N A;  4POG A;  3BZK A;  4X6A H;  5JJK A;  1Q86 C;  4DV7 L;  2WB1 E;  4P72 A;  3JC6 6;  1MJE A;  3BU2 A;  2UUC Q;  1N34 Q;  5M5X H;  1VQC A;  1IBL Q;  2Z6K A;  4UP7 A;  1X3E A;  2WP8 J;  3HOZ H;  1M1K C;  3PO3 H;  4GN3 B;  1ASZ A;  2ES2 A;  2BA1 A;  2Z6K C;  1X3G A;  1U0L A;  4PZ6 A;  1AE2 A;  2ZTD A;  4UP9 A;  4LFC Q;  4O0A A;  2AWO A;  3A5U A;  1XMQ L;  2CWP A;  3CD6 A;  4IJL A;  5C0X J;  1GD7 A;  2MFI A;  4IO9 A;  4YHH L;  1LYL A;  2MO1 A;  3F2B A;  3CCM A;  2FXQ A;  2K5H A;  1X55 A;  3M4Q A;  4DK3 C;  3HFZ B;  1J5E Q;  3F8T A;  3CPF A;  1HNZ Q;  2E2H H;  1HNW Q;  2PI2 A;  3CF5 A;  2WB1 G;  5JJL A;  1L1O C;  4QGU A;  3CCJ A;  2E2I H;  2XTI A;  2IT1 A;  1FJG L;  3STB D;  4A3I H;  4DNI A;  3FKI H;  4JYA L;  4IPG A;  2GN5 A;  4LF9 Q;  4O2D A;  4DV1 Q;  2RCN A;  4JCV E;  2ZM6 Q;  3UDI A;  3ZJY C;  2OTL A;  3STB C;  2GVA A;  2VQF L;  2N3S A;  5IYD H;  2K4K A;  3J81 i;  1SLJ A;  3B6Y A;  4JV5 L;  4IFD J;  2Q2T A;  4DV7 Q;  4NXN L;  4A75 A;  1X3F A;  4A3K G;  4LFB Q;  2GVB A;  2D0O A;  3TQY A;  3AEV A;  3GTK H;  2EQS A;  1SRU A;  4JC0 A;  3KJP A;  3UDG A;  1VQM A;  3KFU A;  4LUZ A;  4DUY Q;  3H3V I;  3CC2 A;  2AHO B;  5GAH C;  2CWA A;  1TWA H;  5IYB G;  2AMC B;  3MXN B;  1VQJ A;  1CSQ A;  3U4V A;  5EAY A;  4YWL A;  2Y0S E;  3RLN A;  4DR7 L;  2PQA A;  4LF7 L;  1GM5 A;  1VQL A;  1E3P A;  1RL2 A;  2JA9 A;  3OTO Q;  3G6E A;  4HJ5 A;  2VZA A;  3HOX H;  3CP0 A;  4LF4 L;  1UE1 A;  4A3E H;  1MKH A;  4HIM A;  2EIF A;  2ID0 A;  1HR0 W;  1KRT A;  1QVF A;  3GTL H;  1HZ9 A;  2NVY H;  4A3J G;  4XIG S;  3SGI A;  1D7Q A;  2JJQ A;  3PV0 A;  2VUM H;  2B3G A;  1CKN A;  2PQA B;  4LW1 A;  2VQE L;  1L2F A;  3U4Z A;  4AQY L;  2HHH L;  1H95 A;  4DV3 L;  3KDF A;  3CAM A;  1IBK Q;  1S72 A;  1XJV A;  4KI0 A;  1Y1V H;  1I3Q H;  3W1B A;  2VQF Q;  2ASB A;  2E5L L;  2KCT A;  3CCL A;  3ER0 A;  3I4M G;  3HKZ E;  4NXN Q;  2NZO A;  1X54 A;  1HNX Q;  5C4X G;  4X62 L;  2Y0S G;  2OCE A;  3KF6 A;  2UXD L;  1VQB A;  3AFP A;  1W3S A;  3PSI A;  5C0X G;  4A3I G;  1WCM G;  4YY3 L;  4JBM A;  3FHW A;  4GOP A;  3HOY H;  4DR5 L;  2F52 A;  4B3T L;  3EIV A;  3K8A A;  4YWM A;  2PMZ E;  3CMA A;  3GD7 A;  4GOP C;  1EQQ A;  4DR7 Q;  4LF7 Q;  1HH2 P;  5ELO A;  3KJO A;  2IHF A;  2N8N A;  2D0P A;  3WWV A;  2JA6 H;  2RHQ B;  4UY8 C;  2B63 G;  2OQ0 A;  1K0R A;  3J80 c;  2I0Q A;  3S1R H;  1WOC A;  1PH3 A;  3NBH B;  2KHJ A;  1JMC A;  4IPC A;  1PH9 A;  4C3J H;  1VQF A;  3HKZ G;  3S15 H;  3S1N H;  5DLQ E;  4IOC A;  1HZB A;  3M7N A;  1B70 B;  1GKH A;  5C44 H;  3HKS A;  4IFD G;  4LF8 L;  1K8A C;  2K75 A;  1B7Y B;  1WI5 A;  4AQY Q;  2YTX A;  4XTC S;  2CKZ B;  4DV3 Q;  4KLK A;  3T1H L;  4JI4 L;  4A76 A;  4BBR H;  2VW9 A;  4JOI A;  1G51 A;  1UE6 A;  1J5E L;  3M4P A;  3L2P A;  3HOX G;  3KF8 B;  2Q2H A;  5ELN A;  1HNZ L;  1EYG A;  4QL5 A;  2E5L Q;  4A3K H;  1HNW L;  1S40 A;  4AYB E;  4JOI C;  3I55 A;  3AFQ A;  1VQO A;  5GAG C;  4X62 Q;  4L5Q A;  2ZJQ A;  4B3R Q;  1N32 L;  1AE3 A;  1JJG A;  3G71 A;  1YIT A;  2UXD Q;  1BBU A;  2ZTC A;  1YI2 A;  2V1C C;  2YV5 A;  3UDX A;  4LF9 L;  2H5X A;  3PUW A;  4DV1 L;  2Q2U A;  2HT1 A;  3A5Z B;  4GKK Q;  4DR5 Q;  5IWA Q;  4Y7N H;  1E1T A;  4DV5 L;  1Y1V G;  3ULL A;  4B3T Q;  3IRB A;  4JI1 L;  2JA7 H;  3PCO B;  4LFB L;  3K7U C;  1C0A A;  3Q8D A;  4OWT B;  5IYC H;  1EIF A;  3K7A H;  4J15 A;  4DUY L;  1SN8 A;  4POF A;  3D31 A;  3M85 A;  4A3C H;  1WFQ A;  1I94 L;  5M3M G;  4A3J H;  1I5F A;  1LUZ A;  5GQO A;  3ICE A;  1KHI A;  3CQZ H;  4AYB G;  3S17 H;  2A19 A;  1GVP A;  2KEN A;  3HOY G;  2R7D A;  4MNO A;  5M5Y H;  3K0X A;  1PYB A;  1IL2 A;  1GO3 E;  4GLV B;  4LF8 Q;  3OTO L;  4JI4 Q;  3T1H Q;  3H15 A;  2HIV A;  1TWH H;  1BVS A;  4A3B H;  2BH2 A;  4R4I A;  2JA6 G;  1EWI A;  3I4M H;  3PUX A;  4GS3 A;  1SFO H;  5C4X H;  4HID A;  4MTN A;  3TS0 A;  5C0X I;  2JEA I;  3PIO A;  1VQG A;  5IP9 G;  1N32 Q;  2NN6 I;  1S3O A;  3K81 C;  4LNQ A;  1CUK A;  2IX0 A;  5FLX c;  3KOJ A;  2K5V A;  1WCM H;  5C44 G;  2MNA A;  1IBK L;  2VS1 A;  1VQ6 A;  1NBW A;  1YJN A;  4BBR G;  1UWV A;  4YWK A;  1K9M C;  4DV5 Q;  3I4N H;  5LMN W;  2JQO A;  4JI1 Q;  1V1Q A;  3PGZ A;  4LFA Q;  1HNX L;  4B3M L;  2Q2I A;  3S1Q H;  1VQ7 A;  4A3D H;  2B63 H;  1CSP A;  1O7I A;  4EQ5 A;  2UU9 Q;  4HJA A;  5C3E H;  1QZH A;  1HZC A;  1W2B A;  4GN5 A;  1X56 A;  1PH1 A;  3ULJ A;  1I94 Q;  4IFD I;  3RR5 A;  3K80 C;  4FDB A;  1M90 C;  1BKB A;  3RLO A;  1JJ2 A;  1EUJ A;  1YZ6 A;  3GTP H;  4L5T A;  4C2M H;  1RIP A;  1X6O A;  2JA5 G;  4LF5 L;  1V9P A;  3G4S A;  1PH4 A;  2JA7 G;  3GTJ H;  5GRO A;  2VNU D;  1Y1W H;  3TEH B;  2YTY A;  4NPS A;  5IP7 G;  3S16 H;  3L0O A;  4QY7 A;  1OXT A;  2LXK A;  4DPG A;  5IYC G;  4K0K Q;  1YHA A;  3CPW A;  3CCR A;  4C3H H;  4A3C G;  4WJ3 M;  1XPR A;  3CW2 C;  3GTM H;  4AIM A;  5LMU L;  2E2J H;  3J80 i;  4H02 A;  1Y14 B;  4UPA A;  2YU9 H;  2N78 A;  2JEB I;  1SE8 A;  4R4O A;  4C3I H;  1XPO A;  4OX9 Q;  3CCE A;  2RF4 A;  2XGT A;  1Q82 C;  1N36 Q;  4DKA C;  1JT8 A;  4A3B G;  1TWF H;  3GTG H;  1QUQ A;  2R7Z G;  2NZH A;  2JA8 G;  2HQL A;  1HR0 Q;  4B3M Q;  4BBS H;  1YVC A;  4GNX B;  4B3R L;  1V43 A;  2F3I A;  4L5S A;  3E9I A;  4IPH A;  1QZG A;  1R9T H;  2ZJP A;  1YBY A;  2OQK A;  5M3M H;  1IBM Q;  1VQ5 A;  4JBW A;  4A3G G;  2R93 G;  1A63 A;  2DGY A;  5BR8 L;  4GKK L;  2JE6 I;  3JAM c;  5IWA L;  2K14 A;  3HOU G;  3E0E A;  1QUQ B;  4YCW A;  4DR2 Q;  4DR1 Q;  1IYJ B;  3CCV A;  3I4N G;  3AQQ A;  1WJJ A;  4LF5 Q;  1VQ9 A;  1PFS A;  3TS2 A;  2AKW B;  5GAD C;  1E1O A;  1KL9 A;  3BJU A;  5J3B A;  3CCU A;  4A3D G;  1FVI A;  1P16 A;  1VQ4 A;  4BA2 I;  5M3F H;  4GN4 B;  2UXC L;  1Q8K A;  5C3E G;  2MO0 A;  1KC8 C;  1PH6 A;  1PH5 A;  3ERS X;  2A1A A;  1DGS A;  1LM0 A;  1VQD A;  4A3M H;  5IP9 H;  2QA4 A;  3UE1 A;  1NJI C;  2CQO A;  3MEF A;  5LMU Q;  3RNU A;  3A74 A;  1P8L A;  2I5M X;  4P74 A;  3RN2 A;  5IY0 A;  4P71 A;  1Q46 A;  4B3S Q;  4TQU S;  3DLL A;  4GLA C;  4BY1 G;  4MZ9 A;  3NEM A;  2OTJ A;  1Y1W G;  4R4T A;  5H1S E;  2Z0S A;  2CCZ A;  1VQN A;  1VQH A;  3PO2 G;  1KRS A;  1JJC B;  5FLM G;  1Z47 A;  4ALP A;  1Z9F A;  1EQR A;  2HIX A;  4JBJ A;  1EOV A;  4X66 L;  1L0W A;  1Q81 C;  1PH8 A;  3HOW H;  1MJC A;  1J6Q A;  1YEZ A;  3T1Y L;  4RG1 A;  4JI2 L;  5BR8 Q;  2ALY B;  3VDY A;  4QJF A;  5C4J H;  4KHP L;  2R7F A;  1A0I A;  4RMF A;  2JA5 H;  3D0F A;  3M3Y H;  4LFA L;  4A93 G;  1A62 A;  2N49 A;  1XNQ Q;  4DV4 Q;  4DAY B;  5IP7 H;  2UU9 L;  4BBS G;  3M4O H;  1YHB A;  3J81 j;  1KD1 C;  4AH6 A;  3BZC A;  2UXC Q;  1VQK A;  1NY4 A;  1NMG A;  3UDF A;  1CKO A;  2I5L X;  3DM3 A;  1IXR A;  4WJ4 A;  2B29 A;  4DR3 Q;  3CC7 A;  1KIX A;  1AH9 A;  2K50 A;  4PZ7 A;  3CXC A;  2UUA L;  2A8V A;  4DR6 Q;  4GLX A;  4LF6 Q;  4JI7 Q;  1N33 Q;  4BXX G;  5FJ8 H;  4GKJ Q;  1D8L A;  1XNR Q;  3OW2 A;  4DR4 Q;  4DK6 C;  3CME A;  2UXB Q;  3HOV G;  2R7Z H;  2MQH A;  1KAW A;  2JA8 H;  1YNX A;  2K52 A;  4K0K L;  5M3F G;  2EXD A;  2IX1 A;  2PNH A;  3PUY A;  4A3M G;  1YHQ A;  3H0G H;  4X66 Q;  1E22 A;  4IOA A;  1PVO A;  2JK8 A;  2I5H A;  4DV2 Q;  3RZD H;  4A3G H;  1XMO L;  1N8R C;  2R93 H;  2F4V L;  2IY5 B;  1SMX A;  1FGU A;  1TWG H;  4OX9 L;  3T1Y Q;  1Q1E A;  3HOU H;  4HJ7 A;  1N36 L;  4JI2 Q;  5GAE C;  2BA0 A;  2IHE A;  4KHP Q;  1NTG A;  1ASY A;  2NVT H;  1HR0 L;  1YJ9 A;  4OON A;  3CCS A;  4Y52 H;  3EBE A;  1U5K A;  4IJH A;  2D62 A;  1K3R A;  1L1O A;  4DAM A;  3RN5 A;  4PZ8 A;  1VQI A;  4BY7 G;  1IBM L;  1KQS A;  3HOW G;  1EIY B;  4EX5 A;  3S14 H;  1OXS C;  3F1Z A;  4PG3 A;  3W1G A;  2WAQ E;  4DR2 L;  4DV0 Q;  4DR1 L;  2UUA Q;  1VQE A;  5LMN Q;  5JEA G;  1JB7 A;  1X65 A;  2YYZ A;  4NXM Q;  2KHI A;  2ZTE A;  3AYH B;  4BY1 H;  1B8A A;  1BBW A;  1EFW A;  4YCV A;  4X64 Q;  3JAM i;  1PH7 A;  5AJ3 L;  4OO1 G;  1L1O B;  4YCU A;  1K8G A;  3UE0 A;  3J7Z C;  4JG2 A;  3PO2 H;  1CKM A;  3GDE A;  5FLM H;  2QGQ A;  4QIW E;  3F2D A;  1HJP A;  4A3F G;  1YJW A;  4A4I A;  1FL0 A;  1OXU A;  1QVC A;  1SR3 A;  1UE7 A;  3I7F A;  4LUV A;  5HY6 A;  4JI3 L;  1VS0 A;  2LSS A;  3OYY A;  4P75 A;  4HIO A;  3PIP A;  2WFW A;  4GNX A;  4L5R C;  2R92 H;  5JJI A;  3PUV A;  1VQP A;  4B3S L;  1XMO Q;  4GNX C;  2L15 A;  2ZJR A;  2KBN A;  2F4V Q;  1K83 H;  2C35 B;  3LGJ A;  1SRO A;  2RHS B;  3H3V H;  4DV6 L;  5FJ8 G;  4A3L G;  4JI0 L;  1XMQ Q;  1JE5 A;  4A93 H;  3RZO H;  3KYH C;  3M9B A;  4BA1 I;  3GTO H;  2WAQ G;  4JI6 L;  1PHJ A;  4YHH Q;  1OTC A;  2ATW A;  4LUO A;  1LTL A;  2YTV A;  3I2Z A;  1OXV A;  4JI8 L;  3FP9 A;  4P73 A;  1XTD A;  3NEL A;  4X65 L;  4LWC A;  1PV4 A;  3H0G G;  3HOZ G;  1VQ8 A;  4TVA B;  5K36 G;  3PO3 G;  2R6G A;  1NMF A;  3I56 A;  4HJ9 A;  4OWW B;  2VY3 A;  1QVG A;  4BXX H;  1FJG Q;  3J81 c;  1KXL A;  4JYA Q;  1XNQ L;  4DUZ L;  4DV4 L;  3S1M H;  2LXJ A;  2NVX H;  3HOV H;  1TXY A;  5AJ3 Q;  2KCM A;  5M5W H;  1E7Z A;  4JBK A;  2CFM A;  3W5O A;  4JV5 Q;  1G6P A;  4ME3 A;  2UUB L;  2QEX A;  1C9O A;  1HZA A;  1VQA A;  3A0J A;  2AWN A;  3PF4 A;  1XPU A;  4DR3 L;  1CKN B;  4JI5 L;  4APV A;  4JI3 Q;  1PYS B;  1PH2 A;  4DR6 L;  4LF6 L;  4JI7 L;  1N33 L;  1I50 H;  3KDF B;  5IE8 A;  1NE3 A;  1TWC H;  3FKI G;  4GKJ L;  1YIJ A;  1T9H A;  1XNR L;  2NN6 G;  4R4Q A;  1A8V A;  3S24 A;  4DR4 L;  4DV6 Q;  4HJ8 A;  2UXB L;  1UEB A;  5IYD G;  4JI0 Q;  5JEA J;  2UUC L;  3GTQ H;  1C7Y A;  3G48 A;  5E7N A;  1Q12 A;  4PMW A;  1N34 L;  3KF6 B;  4JI6 Q;  1UE5 A;  2OWO A;  2E8G A;  3KLW A;  1IBL L;  1VCI A;  4JI8 Q;  1MIU A;  3PUZ A;  4X65 Q;  3J7A 5;  1PA6 A;  4BY7 H;  4LF4 Q;  3L7Z C;  4DV2 L;  2PI2 E;  2R92 G;  1OXX K;  3I4O A;  4GOP B;  3CC4 A;  4IPD A;  1N9W A;  1X9N A;  3GO5 A;  3F2C A;  4LFC L;  2BH8 A;  1WYD A;  3EN2 A;  4OO1 I;  4KHZ A;  3RLF A;  2DUD A;  2VQE Q;  4R4C A;  3ULP A;  2HHH Q;  4QQB X;  4OWX B;  3E9H A;  4DUZ Q;  3U50 C;  3S2D H;  1E24 A;  1I6H H;  4UP8 A;  1Q1B A;  4OXP A;  3NEN A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...