4NXNQ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4nxnQ00
3ULPA 2HIXA 2JA5G 5ELOA 1CSQA 3PSIA 5LMNW 1E1TA 4LF9L 2IHFA 3AYHB 3RZDH 1FGUA 3AQQA 4BY1H 5C3EG 4YCUA 4X66Q 1YI2A 2GN5A 1WCMG 1EWIA 4LF8L 1T9HA 2EIFA 4H02A 4X62L 1WI5A 4APVA 4A75A 4GLAC 2RHSB 1VQPA 3F8TA 2MFIA 3M4QA 1BBUA 4XIGS 2K75A 1YHAA 1Q81C 5IWAL 3LGJA 1E1OA 4HJ8A 1BKBA 4IO9A 2K5NA 1K8AC 2PI2A 4DV4Q 4DV5L 1PH4A 2JA8H 3GTLH 3PO2H 3S1NH 2E5LQ 2ID0A 3KOJA 2ZJQA 2R93G 5FLXc 1D8LA 5M3FG 3F2CA 1PH3A 3ICEA 3OYYA 2F52A 1X65A 2N8NA 1SLJA 2EQSA 3SGIA 2YV5A 3STBC 3JAMc 4DV3Q 3GTGH 4YHHQ 4JI0Q 4DR2L 4R4QA 4JC0A 4A3FH 1PH2A 4LUZA 4A3MG 3HOZG 4LF7L 1LTLA 3AFQA 2MQHA 4L5SA 4NPSA 4P74A 3I4NG 1U0LA 1EUJA 1XNRL 3FKIG 1VQ9A 3J81j 5C4XH 4PG3A 4X65L 1VQ4A 3E0EA 3AEVA 4A3LH 2YYZA 2CWPA 3TS0A 4A3EH 1Z47A 3ULLA 5C44H 4BXXH 1UE7A 1P16A 2UXDQ 1MKHA 4J15A 2NN6G 5M3MH 3K8AA 2ZTCA 4Y7NH 4LFBL 1BVSA 1I5FA 4L5TA 1NJIC 4LFCQ 1Q46A 1I94L 4R4CA 3MXNB 1UE1A 3GTJH 3J7A5 3TS2A 4JI1L 4A3BH 1Y1VH 1XPOA 2Q2UA 5IYCH 4AIMA 2Q2HA 2B63G 3BZKA 4OXPA 3K0XA 4P75A 2MNAA 4QL5A 2CCZA 1PVOA 2ZJRA 1X55A 3CCLA 1X3GA 1A62A 2YU9H 1XPRA 2R7ZH 2Z6KA 4YY3L 4BY7H 4DR6Q 1VQGA 1L0WA 1N33L 4QGUA 2UXCQ 1CKMA 1OXSC 1H95A 2BH8A 1SRUA 2UXBL 1N32L 4PMWA 1CUKA 1NBWA 3BZCA 4NXNL 5IP7G 4O0AA 5C0XG 3KJOA 1VQ8A 4OX9L 1YITA 4R1JA 4B3SQ 3I4MG 1HNZL 2K50A 4DV1Q 2WFWA 4IJHA 4P72A 4LNQA 1MIUA 3H3VH 3D31A 1LYLA 3JC66 2MO1A 1Q1BA 2WP8J 3KDFA 4RMFA 5C0XJ 4JI2L 2VUMG 3HOUG 1NMGA 1NE3A 1HR0L 2ZM6Q 1KD1C 2I5LX 4LF6L 5LMNQ 4X64Q 1XMQQ 4JOIC 3FHWA 2AWOA 4AH6A 1QVFA 1UE5A 4JI7L 2JJQA 4JBWA 2B29A 2K5HA 5H1SE 4IFDG 4LF4Q 2I5HA 3UDXA 3GO5A 2IHEA 2VQEQ 4DR5Q 3PUVA 1X54A 2A1AA 1DGSA 5IYBG 1VQ6A 1YJWA 2IX1A 1B70B 4IFDJ 1YJNA 2Z0SA 4JYAL 1XNQQ 3ER0A 1XMOQ 2E2HH 4DV0Q 1NMFA 3ZJYC 3CW2C 3GTMH 4BBRG 1Y1WH 1KC8C 2I0QA 4QJFA 1I50H 2F3IA 4OWTB 4AYBE 5M5XH 1Q82C 3PIPA 1E22A 1IBLQ 1CSPA 3UDGA 1N8RC 1YIJA 5AJ3L 4A3IG 3RNUA 1JE5A 4GN5A 1N34Q 5IYDG 1HZBA 4B3TQ 2L15A 3CPFA 3NBHB 4POGA 2JA5H 4JI6L 4LF5Q 4A3DG 2KBNA 4HJ5A 1JT8A 3T1YQ 3I7FA 4OWWB 4LWCA 4B3MQ 3KF6B 5C3EH 2R92G 1V43A 4HJ9A 2I5MX 4JI5L 4A3KG 4GKJL 1FJGL 2Y0SG 1UE6A 1WCMH 3F2BA 4ME3A 4JBMA 3UDIA 1OXXK 2Y0SE 3D0FA 2CQOA 4RG1A 3UE1A 1EFWA 2E2IH 2F4VQ 3S2HH 1E24A 3HKZG 4JI8L 4JI4Q 4DR7Q 2B3GA 2XGTA 2YTVA 3HKZE 3GTOH 1Q12A 2OQ0A 1Z9FA 3CF5A 1HNXQ 1BBWA 1L1OB 1VQIA 2K4KA 1KAWA 2JE6I 2HHHL 2QGQA 3IRBA 5IY0A 2OQKA 4TQUS 1HZAA 2C35B 2LSSA 4B3RL 5ELNA 3RLNA 5M3FH 2R93H 3EBEA 5GAGC 4JBJA 3CMAA 3PUXA 1N36Q 3KFUA 1QVGA 1L1OC 2NZHA 4HIMA 3L0OA 1SFOH 5C4JH 1QVCA 1HR0W 4OO1I 5DLQE 3HOZH 1Y14B 4A3MH 2PMZE 3CCRA 3RN5A 1X6OA 4LF9Q 1SR3A 1HZCA 1SE8A 1WJJA 3I4NH 2N78A 2LXJA 3PUYA 4PZ7A 4GLXA 2GVBA 3FKIH 5FJ8G 1PHJA 4BBSG 4NXML 1YEZA 2RHQB 4LF8Q 4HIDA 4JI0L 4MNOA 1PYBA 2PI2E 2CWAA 1TWAH 1Q7YC 3TEHB 5GAEC 1P8LA 4UP9A 3GTPH 4YCVA 2ATWA 1EQQA 2VNUD 1K0RA 2KENA 2NZOA 2JEBI 3M9BA 5IWAQ 3HOXG 4L5QA 3J80c 2WAQE 2HIVA 4BA1I 1A8VA 5IP9G 1S40A 1W2BA 2K52A 4KHPL 2N49A 4DPGA 4DUYL 3K81C 4DV5Q 2UXDL 1VQEA 5JJKA 4DR1Q 2B63H 3TREA 4QQBX 2NVXH 4YCWA 3GD7A 3GTQH 3NEMA 1HNWL 1TWCH 3A74A 1G6PA 4KHZA 4DV2Q 4GNXB 3I56A 1I6HH 1PFSA 4DR2Q 1IZ6A 1PV4A 1M90C 2KHIA 4WJ4A 4LF7Q 3M85A 3PCOB 1GVPA 3RLOA 1XNRQ 5IP7H 2UU9L 4IPDA 3S1QH 4X65Q 2R7DA 3MEFA 1KHIA 4XTCS 4DAMA 3I4MH 4YWLA 4GNXC 5K36G 1YBYA 3HOWG 3CCSA 1ASZA 4A93H 3OW2A 1SN8A 4A3JG 3S1MH 1KXLA 2GVAA 1TXYA 4OONA 2RF4A 2KCMA 2KHJA 2VUMH 3G4SA 3HOUH 3KYHC 3T1HL 2ES2A 3CC2A 4LFBQ 2E8GA 2VS1A 1M1KC 2OTJA 5EAYA 1B7YB 3M3YH 2V1CC 5IE8A 4DV1L 3M4PA 5LMUQ 4FDBA 4JI1Q 3UE0A 3L2PA 2ASBA 1PH9A 5M5WH 2UUCQ 1I3QH 1UEBA 2A19A 4IOCA 3KLWA 4HJAA 4R4IA 3AFPA 5BR8L 1K9MC 2R6GA 4A3CG 1KIXA 5LMNL 2VQFL 2N3SA 4X64L 1XMQL 1K73C 5IYBH 2IT1A 1VQKA 4YY3Q 4UY8C 1OTCA 3W1GA 3JAMi 1N33Q 1K3RA 3F1ZA 2JA7G 3CCEA 4LF4L 4DAYB 4DR5L 1X56A 1IBKL 2OWOA 4OWXB 2UXBQ 1EOVA 2JQOA 4IPCA 4LFAL 1XTDA 4BBRH 4GOPB 3PGZA 4NXNQ 2ALYB 3K7UC 4OX9Q 3PO3G 5IT9c 3PUWA 1C9OA 1GD7A 1UWVA 3I2ZA 4UP7A 1V9PA 3U58A 2R92H 1QUQB 4A3IH 5IYDH 4DR3Q 3PUZA 4DV0L 1OXTA 1EIYB 4HIOA 2UUAQ 2NVYH 2NVQH 1PA6A 3S1RH 1YZ6A 1G291 4GOPC 4AYBG 1WYDA 3HKSA 1HR0Q 2UUBL 2OCEA 4A3DH 4GKKL 3H15A 4LF6Q 3CCJA 2Q2TA 1XPUA 4JOIA 4OO1G 1X3FA 3CQZH 2QA4A 4A3KH 3RR5A 1N34L 2NN6I 4B3TL 2H5XA 4JI7Q 2R7FA 3CD6A 4K0KL 4A3GG 4DV7L 1IBML 3CMEA 4AQYL 1VQDA 3KJPA 2AHOB 2PNHA 1J5EL 4DUZL 2CFMA 3EN2A 4B3ML 3G6EA 4EX5A 4JV5L 5GADC 1C0AA 1A63A 4LW1A 1TWHH 5JEAG 1J6QA 4IJLA 3EIVA 3HOYG 4IOAA 1HJPA 4DKAC 1YVCA 4O2DA 4DK3C 5GQOA 3U4ZA 4X66L 3CPWA 4DR4Q 3BU2A 2RCNA 3HOVG 4GN3B 5C0XI 1HH2P 1HNXL 3A0JA 4MTNA 3A5ZB 3S24A 1Q1EA 1GM5A 3L7ZC 5M5YH 4DV6Q 2ZJPA 1X9NA 4GLVB 4JI6Q 2DUDA 4YWMA 1OXUA 1U5KA 1G51A 2YTYA 1E3PA 4JI3Q 1OXVA 3M7NA 4JI5Q 3PV0A 5FJ8H 4BBSH 1PH7A 1FJGQ 1RIPA 4C3JH 4DV4L 3OTOQ 3CCQA 2BH2A 2D0PA 3I55A 1EYGA 2E5LL 3H3VI 4WJ3M 2D62A 1ASYA 4JI8Q 1S72A 1W3SA 2EXDA 2JA9A 3I4OA 3KF6A 5GROA 3HOXH 3CCUA 4IFDI 1JJCB 3CC4A 3M4OH 4DV3L 1VQ5A 3S2DH 1SMXA 4YHHL 3BJUA 3GDEA 5IP9H 1GKHA 3CCVA 4BA2I 4X62Q 2BA1A 1CKOA 3NENA 2FXQA 2HHHQ 4JCVE 1CKNB 3TQYA 1LM0A 3RZOH 4BY1G 3KF8B 4B3RQ 2WAQG 4NB3A 1WOCA 2VZAA 3CAMA 3DM3A 1L1OA 1EQRA 3NELA 1QZHA 5E7NA 2JA6H 4KI0A 1VQHA 1KRTA 3CP0A 4DR1L 3CXCA 1V1QA 3W1BA 1N9WA 1R9TH 5JJLA 3ERSX 1JJ2A 2D0OA 3TRZA 2YTXA 3J81i 4LFCL 1FVIA 1IYJB 1X3EA 4NXMQ 3S17H 2QEXA 4DV2L 2KCTA 2IX0A 1WFQA 3K7AH 1VQ7A 2JA8G 3HOWH 2JA6G 3PO2G 5GAHC 1MJEA 2WB1G 4A3JH 1NTGA 2ZTDA 1VQAA 2WB1E 3HFZB 1FL0A 1VQJA 2DGYA 1B8AA 1VQBA 1L2FA 3RN2A 4DR6L 2Z6KC 4QY7A 1E7ZA 4A93G 2K14A 4A3FG 2UXCL 3WWVA 1XJVA 1CKNA 4KHPQ 4DUYQ 4C2MH 3KDFB 4GS3A 4A3CH 2AKWB 4P73A 1PH6A 5C4XG 1RL2A 1VQFA 3K80C 4A3LG 4KLKA 4DK6C 4B3SL 5LMUL 4A3EG 1HNWQ 2Q2IA 1I94Q 2OTLA 1JMCA 1IXRA 4POFA 1O7IA 5C44G 2A8VA 4BXXG 4PZ6A 2UUCL 2JA7H 1VQLA 4L5RC 4LUVA 2VW9A 2CKZB 5M3MG 2HT1A 2ZM6L 2BA0A 2UU9Q 1VQNA 2VY3A 3G48A 4JBKA 3PO3H 1YNXA 4JG2A 3H0GH 1NY4A 4A4IA 4GNXA 1GO3E 1QZGA 1Y1VG 1PH8A 1C7YA 1HZ9A 1Q8KA 1VQCA 4A3BG 4Y52H 3ULJA 5IYCG 2NVTH 4PZ8A 1VCIA 2XTIA 1LUZA 1VS0A 4IPHA 2VQEL 5HGQA 3DLLA 1N32Q 3A5UA 3E9HA 3T1HQ 1KQSA 2R7ZG 4X6AH 3FP9A 4BY7G 1YHBA 3H0GG 3J80i 1S3OA 1HNZQ 4IPGA 1D7QA 2LXKA 4DR3L 1XNQL 2UUAL 4C3HH 1XMOL 4A3GH 4JI2Q 1MJCA 5BR8Q 4YWKA 3STBD 4TVAB 3RLFA 2JEAI 1PYSB 2K5VA 3CC7A 4DNIA 2VQFQ 2PQAB 3G71A 1PH5A 2E2JH 3E9IA 1IBLL 4UP8A 2MO0A 3S14H 1IL2A 4GN4B 4P71A 2AWNA 1TWGH 5J3BA 4HJ7A 1VQMA 1AH9A 1IBKQ 3UDFA 3W5OA 4R4OA 4LF5L 4R4TA 4LFAQ 3HOYH 4ALPA 3PF4A 4EQ5A 4QIWE 3T1YL 3PF5A 1KL9A 3PIOA 2AMCB 3VDYA 3HOVH 5HY6A 1VQOA 5FLMH 1Q86C 4MZ9A 3CCMA 1SROA 4A76A 4JYAQ 2HQLA 3U50C 3J7ZC 1K8GA 2F4VL 4GOPA 2ZTEA 3F2DA 3S16H 4JI4L 4GKKQ 2UUBQ 4DR7L 4LUOA 4DR4L 3GTKH 1PH1A 2JK8A 3Q8DA 4HIKA 1TWFH 1JJGA 1QUQA 4C3IH 5AJ3Q 5JEAJ 5FLMG 4K0KQ 1AE3A 4DV6L 4DV7Q 1JB7A 1IBMQ 2VL6A 1Y1WG 2IY5B 4AQYQ 1KRSA 4UPAA 1A0IA 1AE2A 1J5EQ 2PQAA 4DUZQ 4JI3L 3J81c 1YHQA 1EIFA 1K83H 1N36L 3B6YA 4JV5Q 4GKJQ 3OTOL 3S15H 5JJIA 1YJ9A 3U4VA
chains in the Genus database with same CATH superfamily
2JA5G 1ET9A 1LACA 1CSQA 5LMNW 1I4RA 1TVXA 1FGUA 3AQQA 1SNQA 1YI2A 2GN5A 4X3KA 2F0KA 2XNAC 3FRPB 1GUOA 1T9HA 2K5QA 1LT5D 4A75A 4GLAC 3QIAA 4UDUC 3S1NB 3FVQA 4K8JA 5IWAL 3HS0C 1JC7A 2K5NA 2PI2A 4ZLTF 4DV5L 2JA8H 2RDHA 3DHQA 4IUQA 1G91A 2ZJQA 5CC4A 1D8LA 2J0TD 3R2TA 2F52A 1X65A 2F0OA 2N8NA 4KK7A 4JK1C 3SGIA 2YV5A 2MP1A 5EQ0A 4YHHQ 4FF4A 4DR2L 4R4QA 2F0PA 2B2UC 1HCZA 4NPSA 4KMUC 1U0LA 1V8QA 4ZRZA 1O80A 1SBBB 4Y7NB 1IHZA 3A8IE 4BS9A 1C8CA 3ND8A 3GTJB 5C44H 1JWMD 1EQTA 1UE7A 2UXDQ 5M3MH 4LFBL 4L5TA 2IJ0A 1NJIC 1Y1VH 2B63G 2CCZA 3QB3A 1GXDC 4QL5A 2F0EA 1X3GA 1A62A 1QILA 3CCLA 4YY3L 4DR6Q 1BBXC 1L0WA 1N33L 1F2YA 3D4RA 3BS1A 2K7VA 2P5ZX 2MGSA 1CUKA 1NBWA 1JR0D 3BZCA 5IP7G 1F9RA 5T1IA 5CBEE 3H6MA 3RUZA 2MUYA 2K50A 3H09A 2WFWA 4DV1Q 4LNQA 3H3VC 2JSOA 2MO1A 1Q1BA 2WP8J 3CKIB 1KD1C 3SK8A 2I5LX 5LMNQ 1ZKOA 3FHWA 2AWOA 1STYA 2JJQA 4JBWA 5H1SE 1D5ZC 2I5HA 3GO5A 2VQEQ 4DR5Q 4HN7A 3PUVA 1X54A 4KY6A 4N9PA 1ENAA 2KUMA 2HCIA 1D5XC 2FMCA 2IX1A 2QF7A 4PMCA 2Z0SA 4IURA 3A7LA 4DV0Q 1NMFA 4BBRG 2I0QA 1DJRD 4QJFA 1I50H 4I65A 3PIPA 1E22A 1N8RC 2O4XA 4A3IG 4GN5A 1N34Q 4B3TQ 2NTSA 1WCMB 2R3ZA 4POGA 2VB2X 3NXWA 5DEHA 1V1PB 1M4VA 2K32A 4HJ5A 4OWWB 4B3MQ 1V43A 1QJOA 2L55A 3BDLA 1UE6A 3F2BA 3UDIA 3UE1A 2E2IH 3HKZG 4JI8L 4JI4Q 2EJGC 5M3FB 3HKZE 2VXWA 1XTCD 1W6KA 3J80E 3CF5A 5NUCA 1L1OB 1SFOB 3IRBA 5IY0A 3HOZB 1HZAA 3SDZA 3I91A 4G4KA 5KIXA 2R93H 3I4NB 3CMAA 3KFUA 3L0OA 2L5TA 5C4JH 4OO1I 3E5SA 2PMZE 1SE8A 2N78A 3TSSA 1CA5A 3FKIH 5FJ8G 2RQXA 2CH4W 4V190 5A2QE 5DNFA 4HIDA 1PYBA 2PI2E 4GZYC 2CWAA 3GTPH 4NDXA 1EQQA 2KENA 2NZOA 3M9BA 4FYDA 3GTQB 1JWSD 5IP9G 1NSNS 1S40A 4DPGA 1RCVD 3K81C 1I6HB 1KDBA 3A56A 3DWAA 2RVLA 1VQEA 4HCSA 4DR1Q 1JOOA 4QQBX 1ILQA 2NVXH 1LTSD 4XYQA 1G2SA 4KHZA 4GNXB 3H94A 1PV4A 2QILA 1JB3A 1CZWA 1GUGA 4N8FA 3EFXD 4I7ZC 4XTCS 4DAMA 3I4MH 3HOWG 3CCSA 2A5HA 1AP0A 1SN8A 4RA8A 1TXYA 1F9QA 1AN8A 1HQMC 4HCEA 1VMCA 3E3XA 3M4PA 3KLSA 3K57A 3UE0A 5FO7B 5FKAC 1PH9A 1I3QH 1F9SA 2A19A 4IFDH 4C1NI 4HJAA 2R6GA 2OF1A 3CRLC 1KIXA 2VQFL 2N3SA 4X64L 1K73C 1A15A 2HUGA 4TKOB 1GOZA 2JA7G 1LV9A 2OWOA 1EOVA 2JQOA 2JEAI 1PFNA 4FP5D 4G7HC 3PGZA 2ALYB 5ELEA 3S1RB 5C3XA 4OX9Q 2A6ED 4A3DB 3PO3G 1B2TA 5IT9c 2BDOA 1SDFA 1GUNA 3CQZB 1QUQB 5IYDH 1MSHA 2MPMA 3PUZA 1EIYB 3K0YA 4HIOA 2NVYH 4XXEA 1G291 2QCPX 1O7LA 1WYDA 1DCZA 4CDEC 4LF6Q 2Q2TA 1X3FA 3G7LA 3CD6A 2L4NA 4C3HG 3VA7A 1DD2A 4DV7L 3CMEA 2PQEA 4IUVA 2RSNA 5EPJA 1XYIA 4DUZL 3EN2A 2NBFA 3GTKB 1RTOA 2CW0C 5GADC 2C5CA 2F0WA 4DAPA 1C0AA 1TWHH 1J6QA 4IJLA 4FF1A 5C3WA 1DOLA 4V0BA 1ILPA 5DAUA 4DV6Q 3NWSA 3PIO3 1QOHA 4JI6Q 3I4LA 1OXUA 3M7NA 2XN9C 1OXVA 4K2KA 1A3UA 1PH7A 1FJGQ 1K8MA 3LNNA 3NBHA 2BH2A 3CCQA 4KV6A 3IFTA 2K5DA 4WFN3 3HOXH 1JJCB 3M4OH 4DV3L 4QMGA 1SNCA 2RKSA 1C48A 4X62Q 3NENA 1RD9D 2FXQA 2O2LD 1CKNB 3NBIA 4JCVE 4FF3A 3BYYB 4BY1G 1EY7A 4B3RQ 1S5FD 2J7ZA 2WAQG 2L12A 2B2YA 5JAVA 4LJZC 3NELA 2A6EC 3K7AB 2L11A 1V1QA 2RA4A 1N9WA 3OPOA 2YTXA 1FVIA 4NXMQ 3S17H 4EQNA 2QEXA 4DV2L 2KCTA 1WFQA 2B8GA 2EVBA 5GAHC 1MJEA 2EYMA 4A3JH 4C2MB 4MIUA 3P20A 3VYTA 2DGYA 4Q0FA 1D2BA 1L2FA 3RN2A 1WTPA 4B9WA 1SNOA 2D5DA 2WKCA 4A93G 2A69D 2SNSA 4A3FG 1L0YB 1CKNA 2K1BA 3KDFB 3T13A 4A3CH 2AKWB 4P73A 5C4XG 2XVSA 5JVH3 4A3EG 4BXXG 4PZ6A 2DNCA 1F2LA 2HT1A 2O5JC 1VQNA 3G48A 4OHJA 1YNXA 1LO5D 1I4PA 1KLUD 1C7YA 4Y52H 1HZ9A 5IYCG 1PYWD 1LUZA 1VS0A 4A3GB 2EJMA 1VDZA 3FP9A 2AQ1B 4ZK9B 2E2JB 1D7QA 5K5PA 4DNTB 4DR3L 1TY2A 1XMOL 1TWGB 1UUPA 3STBD 4TVAB 2E2DC 3Q23A 3HOYB 2PQAB 3E9IA 1CT1D 2MO0A 3S14H 1Y8PB 1PTOB 4ZUIA 1CA6A 3HOVB 1CQFA 1LABA 1S5BD 2HDMA 4LF5L 5ELCA 4LFAQ 1JWUD 1PTOF 3S16B 3PF5A 1WTOA 1TWFB 4G7ZC 4C3IB 3BYTB 4JYAQ 2HQLA 1K8GA 2HDLA 4GKKQ 3R3OA 4K5WA 3GTKH 2JK8A 3IAYA 5AJ3Q 4FO2A 4K0KQ 1AE3A 2AQ3B 1Y1WG 4UPAA 3MVVA 2A69C 1J5EQ 2PQAA 4JI3L 3J81c 1EIFA 1QWYA 5CV6A 3BDOA 4JV5Q 3U4VA 3JAME 3PSIA 3K58A 5C3EG 4X66Q 1M8AA 4LAAA 2MHVA 4H02A 2KCCA 1VF5C 4L63B 1TY0A 1VQPA 3AMUA 2JA8B 2MFIA 2WB1B 2XWJB 3LGJA 3OW7A 4ULLA 4CDDC 1K8AC 3Q22A 4CBVA 2B8FA 1WD0A 3HZXA 3MFYA 3PO2H 1TWAB 2E5LQ 2ID0A 1NCVA 1B1ZA 5FLXc 1SMYD 4FXKC 3STBC 3GTGH 4I7AA 4JI0Q 4JC0A 1JORA 4A3MG 5C44B 2MQHA 4L5SA 1XNRL 3A54A 4XQQA 1TS3A 5M3MB 3SE0A 2B2VA 3I70A 1JOQA 4RWSC 3AEVA 2YYZA 2JYOA 4IZ8A 3ULLA 1Y1VB 4DGZA 4J15A 2NN6G 4RCNA 3ONAB 1EYDA 1Q46A 1Y8OB 4R4CA 2N55A 5EKKA 4PQXA 4A3BH 2NYZD 2PZTA 4AIMA 1SNMA 2Q2HA 1O7YA 3BZKA 3K0XA 4OXPA 3V05A 4CJ2C 3HP3A 1X55A 3VR3A 2R7ZH 2YU9H 1XPRA 2Z6KA 3NTIA 2B2WA 4BY7H 1ESRA 1YNJD 2UXCQ 4F88A 3BVZA 3ERQA 2BH8A 3QJYA 1N32L 4PMWA 4IN3A 4O0AA 2G5DA 3OWEB 1ENFA 4B3SQ 3H3VH 1MIUA 3D31A 1LYLA 5KNCA 3JC66 5C0XJ 4RMFA 2VUMG 3HOUG 1NMGA 1NE3A 2ZM6Q 4RGTA 3VYSA 4AH6A 1QVFA 1UE5A 1X3PA 2M2LA 4KKSA 4HMIA 4KY7A 1EOTA 2ZXOA 1EZ6A 2BCOA 2Q8RE 4XQNA 1I50B 1VQ6A 1F2MA 5D65A 3ER0A 5KYIA 3ZJYC 3GTMH 1IKMA 4RFBA 3D6CA 1Q82C 5M5XH 1IBLQ 1CSPA 2R92G 3RNUA 1JE5A 1EU4A 1FYCA 1HZBA 3NWTA 3FPPA 2JA5H 4DAVA 2QDLA 2E2IB 2KBNA 1B44D 3T1YQ 2EYOA 4OGQC 2F0GA 2I5MX 4JI5L 4A3KG 5E4XA 1SXTA 4ME3A 4JW0A 1RODA 3D0FA 4RG1A 3S2HH 2WV6D 2F4VQ 3Q24A 1MGSA 4QB4A 4DR7Q 2XGTA 2R93B 2F0JA 2JN4A 5D3IB 3GTOH 2D2CC 1B3AA 1VQIA 1KAWA 1HQRD 2HHHL 5C4JB 2K04A 1YNJC 2OQKA 2LSSA 3RLNA 1SE4A 1HUMA 3OMCA 5GAGC 2B2YC 3FKIB 2QKIC 1QVGA 4HIMA 1QVCA 3NE5B 1X6OA 5CMDA 3P1HA 3GTPB 1WJJA 1EIGA 2LXJA 3EA6A 3PUYA 5IGBA 2GVBA 4BBSG 4LMQD 1YEZA 4C3JG 1FNVA 1EYAA 1TWAH 1Q7YC 3TEHB 4UP9A 1SE3A 2VNUD 4RGMA 3CU7A 5IWAQ 1STGA 4L5QA 3J80c 4K8IA 4ZQ3A 2NVXB 1CI3M 1KABA 1DOMA 2K01A 2N49A 4DV5Q 4IUPA 2UXDL 5JJKA 2BE5C 1PTOD 2EY6A 2B63H 5IGEA 1TWCH 3ND9A 3A74A 3I4MB 2SDFA 1S5ED 2KVMA 4DR2Q 1LTGD 4WJ4A 4HSPA 4DK0A 1A2TA 2N88A 3PCOB 5IP7H 4NW2A 3HRZC 4IPDA 3MZ5A 2R7DA 3MEFA 3KLRA 5K36G 1YBYA 5I2YA 3OW2A 3VR4A 2GVAA 3KLSX 4OONA 2RF4A 2KCMA 2KHJA 1I3QB 5JOBA 5KEEA 3T1HL 2ES2A 3K6OA 4ZAIA 4LFBQ 2NUCA 2OTJA 4L8JA 4HAEA 5EBCA 4DV1L 5LMUQ 4RHRA 3OHXC 1DONA 1EFID 1SNPA 2UUCQ 1UEBA 4R4IA 2K5WA 3X3MA 5BR8L 2V4DA 5LMNL 2QDBA 1VQKA 2AUKA 4YY3Q 1N33Q 1K3RA 2LY7A 5IT9L 2I07B 4F8MA 4DR5L 1X56A 4FXGC 3HGBA 1AH9A 2NVYB 4BBRH 4GOPB 3K7UC 2RCFA 1QNUA 1SNDA 3R8BA 4ZKBB 1UWVA 2CVRA 5G3LF 1I4XA 1RTNA 4A3IH 3HG9A 2F1MA 2Y0SB 4DF7A 4DXFA 4DV0L 1OXTA 4U68A 1T5EA 2NVQH 3TP6A 3VR5A 1WTRA 2UUBL 1HA6A 1BCPB 4ODGA 3H15A 5EKIA 1XPUA 1CQVA 1ET6A 4JOIA 3I8ZA 2QA4A 1S4ZA 2RDFA 1N34L 2NN6I 4B3TL 3E0JA 3VYRA 1D1KA 1TWHB 3KJPA 4S3SA 2AHOB 1WVLA 4B3ML 3OIQA 1BNZA 4EX5A 4PV1C 4NKLA 5BN3A 4LW1A 5JEAG 3OOCA 4IOAA 4DKAC 2QW7A 3CPWA 4DR4Q 2SEBD 2KEDA 5FO9B 1HH2P 4RGOS 1Q1EA 1EY0A 5M5YH 2ZJPA 1ESFA 4GLVB 1BDOA 3FMCA 1G51A 2YTYA 3RZDB 1R4QB 5FJ8H 3HOXB 3NQIA 2F0SA 4TRDA 4DV4L 3M4OB 1V1PA 4XDXA 3H3VI 4JI8Q 1S72A 4XYOA 1W3SA 5LHY1 1KNEA 2PZUA 1Q8IA 2E75C 3CC4A 4KD3A 5CV4A 1SE2A 2K05A 5IP9H 2BA1A 1CKOA 3PMFA 1XX8A 3RZOH 1TR5A 3KF8B 2PYKA 4KKUA 4NB3A 1WOCA 2VZAA 1LT6D 1D1IA 1L1OA 3WOEA 2BOSA 3S17B 1EQRA 1QZHA 2JA6H 4KI0A 1VQHA 4DR1L 4A3JB 1A3TA 2SNMA 1JJ2A 3TRZA 4RKBA 5JJZA 4LFCL 2K28A 1VQ7A 3HOWH 2HQEA 4J6HA 2JA6G 3TZDA 2F0IA 1NTGA 3HFZB 1VQJA 3MA2B 4UAIA 2Z6KC 4KD4A 2B2WC 4QY7A 1E7ZA 1XJVA 3C46A 5J22A 4HR7B 3CRKC 4GS3A 4F87A 4A3LG 1FNWA 2Q2IA 1I94Q 2OTLA 1JMCA 4POFA 5DM63 1KDCA 2A8VA 2JA7H 4LUVA 2G9HD 2CKZB 1TS2A 4IQZA 2SOBA 1STNA 2XWBB 2VY3A 4DA2A 4AYBB 3LWEA 3PO3H 4JG2A 5E4WC 1NY4A 4A4IA 4GNXA 3FPUB 1VQCA 1DM0B 2NVTH 2JP1A 2XTIA 1ZXTA 5HGQA 3E9HA 4X6AH 1YHBA 3J80i 2Z4HA 1HNZQ 3S14B 3NTHA 1XNQL 4C3HH 4JI2Q 4R8IA 1MJCA 2EYLA 3RLFA 1PYSB 2VQFQ 3G71A 1EWHA 2NTTA 1LTAD 1S5CD 3UI2A 4P71A 1Y69U 1VF7A 3W2DA 5J3BA 1VQMA 3C1FA 4R4OA 4KY5A 4ALPA 2NWGA 3GP7A 3NTKA 1HUNA 5J1ZA 3VDYA 2PZWA 2EPBA 4MZ9A 3CCMA 1SROA 5E3FA 2F0NA 2LFNA 3EROA 4OL7A 2A68D 3VR2A 4LUOA 4CKCA 1QUQA 3J81L 5JEAJ 4DV7Q 3LWUA 4DV6L 1JB7A 2F0DA 2F3WA 1NAPA 3WDNA 1A0IA 4DUZQ 4HMJA 1YHQA 1BO0A 1N36L 4N9TA 5KNBA 4GKJQ 5JJIA 3N52A 3PIP3 3ULPA 1UAPA 2EOTA 1E1TA 4LF9L 4IUTA 3AYHB 4BY1H 3RZDH 1QG7A 4YCUA 1LT4D 1WCMG 3KK7A 4LF8L 5JVG3 4X62L 4APVA 3V2TA 3IFDA 2C9OA 1NR2A 2RHSB 3K5MA 3F8TA 4A3MB 3PO2B 2K75A 4C1NK 4IO9A 4HJ8A 1BKBA 4PNYA 5FLXL 2EY1A 3QOJA 3GTGB 1PH4A 3GTLH 3KOJA 4H0LC 5M3FG 3F2CA 1PH3A 4DXGA 1GUWA 2Q8IB 5G3LD 3JAMc 4DV3Q 1IKLA 4A93H 4A3FH 3HOZG 4LF7L 2KCNA 1LTLA 2EYHA 4HEDA 3I4NG 1VQ9A 5C4XH 1EZ8A 1IYUA 4X65L 1VQ4A 2CWPA 4A3EH 1Z47A 1E2WA 4BXXH 4A3BB 2DN8A 3MXPA 1MKHA 1JQYD 3K8AA 2ZTCA 4R9WA 1PZKD 1BVSA 3MHBA 2E74C 2YU9B 3MXNB 1UE1A 3P75A 2R7ZB 4BY7B 2KA7A 2H4OA 4JI1L 2Q2UA 1MD2D 2F0QA 5IYCH 2F0LA 4Z9CB 2IWHA 4P75A 1SYFA 5IGDA 1WTWA 1B3QA 1OXSC 4OELB 5C5LA 1H95A 3K5NA 2UXBL 2XRQD 2ZXRA 3WOFA 5ELFA 4NXNL 5C0XG 3S9WA 3KJOA 1VQ8A 1RDPD 3MXGA 4RH6A 1FNUA 4P72A 3KDFA 1NUCA 1HRJA 4UHVA 1B4OA 2EJFC 1HR0L 1IYVA 1RKNA 1XMQQ 4JOIC 1G2TA 3KBXA 4RKLA 4JI7L 4XT3B 4IUUA 2B29A 2K5HA 1ENCA 1XWEA 3TP5A 4KN7C 4LF4Q 3UDXA 3IL8A 4Q5VA 3GTMB 4K5XA 5IOCA 2A1AA 1DGSA 5IYBG 1TT2A 5FOBB 5M5XB 4N8X1 1B70B 4IFDJ 1YJNA 3V96A 4JYAL 1XMOQ 2E2HH 3DMUA 3CW2C 1EY4A 1Y1WH 1STHA 1AZPA 2JA5B 4OWTB 4AYBE 1TIID 1YIJA 5AJ3L 2L15A 3CPFA 1A2UA 4LF5Q 4A3DG 3S2HB 5EPKA 1JT8A 3D4DA 3KF6B 5C3EH 3GTOB 3MC0B 2HD3A 1OXXK 5ELDA 1EFWA 1JE4A 1E24A 4CJ0B 3BZDB 4WORA 1B53A 2YTVA 3DXJC 5JPMC 3GQBA 1TQOA 4BBSB 1HNXQ 1BBWA 1GUTA 2B2TA 1R4PB 4JVZA 2JXMB 4TQUS 2C35B 1K3BC 3VYUA 5ELNA 1RF2D 1O7ZA 3EBEA 3N6RA 3PUXA 3DM1A 1L1OC 1U4PA 2EY2A 2WKDA 3A7AB 4NMZA 4A3MH 3RN5A 3T16A 4DK1A 1SR3A 1HZCA 2DY7A 1SYGA 4GLXA 4PZ7A 1U4LA 2RHQB 2K6AA 4JI0L 3D8GA 4MNOA 3J80L 1H9RA 2A6HD 4KN4C 4YCVA 1LTTD 1K0RA 2NN6H 2B63B 5IGFA 2I46A 2X6GA 4O1NA 3Q0AA 2EDGA 4BA1I 1A8VA 5I6YA 1HXYD 3F2UA 1W2BA 1TWCB 1YNND 2K52A 4KHPL 4DUYL 2FFKB 4X3SA 1SAPA 1HA5A 3M4YA 3NEMA 1HNWL 1T5XD 5A2QL 1G6PA 1TKWB 2IL8A 1PFSA 1L0XB 1PRTB 3M85A 3RLOA 3D3RA 1WD1A 3T4AC 1XNRQ 2UU9L 3S1QH 4FXDA 2CHBD 1PRTF 4K6DA 5CORA 1TS5A 2F3VA 4GNXC 4P2CB 3SXHA 1KXLA 3HOUH 2VUMH 3G4SA 3KYHC 3CC2A 4E6IA 2VS1A 2OT2A 1M1KC 5EAYA 1B7YB 3M3YH 5IE8A 2PW5A 2L1BA 2IX3A 3TBIB 3L2PA 2ASBA 5M5WH 3NHHA 4IOCA 2HCCA 3KLWA 3AFPA 2FINB 5I4DA 2XIWA 4BBRB 5FK9C 2IT1A 5C6AA 4UY8C 2ICEC 3SHLA 1OTCA 3JAMi 4A3IB 4DAYB 4QUCA 4F7XA 1IBKL 4H7BA 2NVQB 1DYQA 1TU2B 2K33A 3PUWA 3I2ZA 2L0CA 1C9OA 1CFMA 1PLFA 4RAUC 5I2XA 3U58A 2R92H 1JICA 2UUAQ 1EY6A 1SMYC 1PA6A 1JOKA 1YZ6A 4EQOA 2OCEA 3CCJA 3HKZB 4OO1G 4A3KH 1SYDA 2R7FA 4A3GG 4H44C 1IBML 3QOLA 4AQYL 1VQDA 2VB3X 2PNHA 4LK1C 1YNNC 2CFMA 1U4RA 1QCBD 4HSVA 1KNAA 4ZYSA 1EWCA 2PMZB 3EIVA 2F03A 3HOYG 5M5YB 5E1FA 1HJPA 5GQOA 3U4ZA 2LS01 3HOVG 2RBMA 1JCKB 5C0XI 1PZJD 3A0JA 4MTNA 2LKVA 3A5ZB 4M1UB 3S24A 5IODA 3L7ZC 1X9NA 1GM5A 5HGTA 5D3DA 4YWMA 1E3PA 3SK5A 1C4QA 4JI5Q 4C3IG 5IIFA 4BBSH 4C3JH 3OTOQ 1X3QA 1VMPA 2D0PA 1S5DD 4WJ3M 2D62A 3RZOB 3I4OA 2EXDA 2JA9A 5EJWA 2KJXA 3G6JB 4JPBW 1VQ5A 3S2DH 1SMXA 4YHHL 2Z1CA 1HPCA 3GDEA 3CCVA 2ENBA 2HHHQ 3TQYA 1DOKA 2JA6B 1I4HA 2Z6BA 3CAMA 3K59A 1B50A 3HOWB 1LTBD 2O5IC 2RSOA 3W1BA 1R9TH 2D0OA 1F9PA 4QUFA 3J81i 5I6WA 4EQPA 4K14A 5K36H 2JA8G 1BF4A 2WB1G 2PNRC 5EKLA 2WB1E 1FL0A 2DJFC 3VA5A 4DR6L 1CM9A 1HFNA 3WWVA 1FR3A 5D14A 2JA7B 1RL2A 3K80C 4DK6C 5LMUL 3PO3B 1IXRA 1GHJA 1O7IA 5C44G 2WIIB 2E76C 1K8OA 2UUCL 4L5RC 2VW9A 5F2DA 2NVTB 5EGTA 5M3MG 4JBKA 2BDNA 1KDAA 3H0GH 4KJNA 1PH8A 1Y1VG 1Q8KA 1STBA 3ULJA 4ZUJA 1U4MA 4IPHA 2ZT9C 4C3HB 2VQEL 3DLLA 4C56C 2Z4IA 3T1HQ 1KQSA 3OMGA 3QWNA 5CBAE 2F4IA 5CV9A 1Z6HA 3H0GG 3BVMA 3MXUA 4R8NA 2LXKA 1EY9A 3OWFA 5BR8Q 4YWKA 2K5VA 3CC7A 3QR8A 3A8KE 1MBYA 1PH5A 1XXGA 5L37A 4ME5A 2DY8A 4GN4B 1BCPF 2AWNA 3SR1A 5JEAH 3MEHA 3W5OA 1I4QA 4EGVA 3PF4A 4EQ5A 1RHPA 3LX0A 3M7GA 1KL9A 3PIOA 2AMCB 1PTOC 4H13C 2XSCA 5HY6A 5FLMH 3GV3A 4A76A 3J7ZC 4GOPA 3F2DA 4JI4L 2UUBQ 5EBDA 4DR4L 1PH1A 5FO8B 2X69A 4HIKA 3T56B 1JJGA 5FLMG 1ML0D 1HTPA 4G7OC 1SSOA 1KRSA 2B2TC 1LTID 4CGYB 1EEID 4BY1B 1PRTD 1K83H 4ABNA 1TS4A 2WAQB 3B6YA 4B9XA 3S15H 1YJ9A 2HIXA 4QF4A 5ELOA 2IHFA 1FGBD 3DUZA 3J7AV 2TMPA 4ZKCB 1EWIA 2EIFA 1WI5A 1EYCA 1MI2A 3GTLB 3M4QA 1BBUA 4X3TA 4XIGS 1YHAA 1Q81C 1E1OA 2B2VC 2ZXPA 4KTAA 4DFAA 4DV4Q 5I9PA 2EYJA 1DXMA 4A93B 3JAML 4ID6A 4A3FB 3S1NH 4RHSA 2R93G 3TMEA 3DEPA 3ITPA 4O42A 3ICEA 1BOSA 3OYYA 1SYCA 1SYEA 3QO2A 1SLJA 2EQSA 3VR6A 5C4XB 1PXUA 2B39A 3OIPA 4A3EB 3EVQA 1WTQA 1PH2A 4LUZA 3SK4A 3AFQA 4P74A 2EY5A 1EUJA 4OEMB 3FKIG 3J81j 4PG3A 3E0EA 4A3LH 3NUCA 3TS0A 5J39A 2OEOA 5CR3A 1BQQT 3R93A 3J7AF 1P16A 3KF8A 2KEEA 2CW0D 3MAQA 3TN2A 4Y7NH 1GUSA 1I5FA 2A74C 4LFCQ 1I94L 3GTJH 3J7A5 3TS2A 1XPOA 5CV8A 1H9JA 3S1MB 5BN5A 2MNAA 3C1EA 1F77A 1H9KA 2ZJRA 3J7YW 1VQGA 4RGNA 5KGUA 1Q3LA 4XQJA 4QGUA 2M9VA 1PRTC 1CKMA 1H9SB 1SRUA 4OX9L 1H9MA 3I72A 2DNEA 2J4XA 2KECA 1YITA 4R1JA 3I4MG 4XT1B 1HNZL 4IJHA 2FJ2A 1A6XA 1Q90A 2L9HA 4JI2L 1G8ZD 4LF6L 4X64Q 3SEBA 2F0HA 5A35A 3TDQA 3TZUA 4B08A 4IFDG 1SYBA 2MJ8A 1F2ZA 2IHEA 2E2HB 3HEJA 1WTXA 1Y1WB 2GA4B 3C2PA 1YJWA 1H9SA 4QCLA 1XNQQ 1KC8C 4X3UA 1J8IA 1SEBD 2F3IA 5CYUA 2G9DA 5COYA 3BDCA 3TP7A 3SVMA 2F0TA 5C3EB 3UDGA 2NB0A 5IYDG 3NBHB 3D6WA 4FNFA 1PDQA 4JI6L 3PQIA 5C5MA 3U9SA 1STEA 3I7FA 4L6TB 4LWCA 3MWYW 3DWQA 1D5MC 4HJ9A 4GKJL 4RCOA 2Y0SG 1FJGL 1WCMH 2Q8TA 1PMRA 4JBMA 4K5VA 1V1OA 1B9MA 2Y0SE 2CQOA 3AB9A 2EZVA 3DWPA 3ZYYX 2B3GA 1D6EC 1Q12A 1NR4A 2OQ0A 1Z9FA 4M8AA 1O78A 5EPLA 4PMBA 2K4KA 5CV5A 2JE6I 2QGQA 1IW7D 2XRSD 2AQ2B 4B3RL 3Q6SA 5M3FH 3K5LA 3EJIA 1LLRD 4JBJA 1N36Q 1BR9A 1EL0A 4IUNA 2NZHA 5C4ZA 1SFOH 1B9NA 1HR0W 5DLQE 3HOZH 1Y14B 3NK9A 3CCRA 4LF9Q 1MHWC 2KQ3A 1G6ZA 3I4NH 1PHJA 4NXML 4LF8Q 1ZYRD 4G57A 5GAEC 1P8LA 2M00A 2ATWA 1EU3A 1EY5A 2JEBI 3HOXG 5KNDA 5TSSA 2WAQE 1LT3D 2HIVA 2H1EA 5I9OA 1BCPD 3O13A 1X32A 2F0MA 1E2VA 3TREA 3BG3A 3AU7A 4EVOA 4YCWA 3GD7A 1IL8A 3GTQH 3S1QB 5LL6X 4DV2Q 2A68C 1NNXA 3I56A 1I6HH 2KHSA 1ZEQX 1IZ6A 1M90C 2KHIA 1HTLD 2B2UA 4LF7Q 1ICFB 1GVPA 3DEOA 1HFGA 3HOUB 2VUMB 5C0XH 4X65Q 4CJ1B 1CHPD 1KHIA 1ONLA 4YWLA 5ISRA 3M3YB 5IT9E 1ASZA 3S1MH 4A3JG 1KLGD 5M5WB 1QB5D 1I4GA 2E8GA 4QIWB 2OXPA 1W6JA 3RMHA 2V1CC 2CH4A 3A8JE 2PO4A 4FDBA 4JI1Q 1UEAB 3OSOA 5IGGA 1KAAA 4A3CG 1K9MC 3P7JA 4U673 1EIHA 1XMQL 5IYBH 2Z9HA 1IW7C 3MXNA 5IGCA 3W1GA 1ICWA 2K03A 3F1ZA 5C4HA 5JPNC 3CCEA 4LF4L 2R92B 2TSSA 2UXBQ 4OWXB 2PPBC 4IPCA 4LFAL 1XTDA 4NXNQ 5BN4A 1AFPA 1BXTA 1GD7A 4UP7A 1V9PA 4A3KB 5CGKA 4DR3Q 4WJWA 2RDGA 1U9RA 3U9OA 2F0FA 5AFWA 3S1RH 4GOPC 1PFBA 4AYBG 1HR0Q 3HKSA 2FMMA 4A3DH 4GKKL 1PVOA 1ZYRC 3NSWA 3CQZH 4JI7Q 3RR5A 1Z7TA 2H5XA 4K0KL 5DM73 2PCFB 3W3AA 1J5EL 1BCPC 1GJXA 2Z8LA 3CHBD 4DN4M 4WRDA 3G6EA 4JV5L 1AW7A 4BWGB 3X3NA 3MTSA 2QEJC 3I73A 4K2LA 4CDCC 1A63A 3URYA 3T51B 1HHVA 1PZID 1YVCA 4O2DA 4DK3C 4X66L 3QG1A 2F0VA 3BU2A 1CTMA 2RCNA 2LMCB 4GN3B 1HNXL 4C3JB 1KTKA 4FF2A 5T1GA 1CHQD 1SJED 4K6LA 4CDFC 2DUDA 2AUJD 1U5KA 1OO9B 4JI3Q 1EQVA 3PV0A 3R2IA 1K0SA 1RIPA 1RJTA 4OIKA 4NP5A 3S2DB 4HTHA 3I55A 1K28A 1EYGA 1WTVA 2E5LL 2ICIA 4KKTA 1ASYA 3FEWX 3KF6A 3NPPA 3CCUA 5GROA 4IFDI 3FDTA 3BJUA 4BA2I 1GKHA 3K5OA 3MFGA 2PW7A 1LM0A 1I6VC 4MTKA 1BUVT 4TSSA 5ELBA 1R9TB 4KHVA 1EEFD 1E2ZA 3DM3A 5CV7A 5E7NA 1GHKA 1KRTA 1QE6A 3CP0A 3CXCA 1AEXA 3KBGA 5JJLA 3NP8A 3ERSX 4ILWA 1IYJB 1X3EA 1CZGA 2IX0A 4OIJA 3K7AH 3L3OC 4IALA 1FD7D 3PO2G 2ZTDA 1VQAA 4CKEA 1B8AA 2IW3A 1VQBA 1PFMA 3E6ZX 2K14A 2UXCL 4KHPQ 4DUYQ 4C2MH 3NQTA 3T53B 3IKJA 1PH6A 4FVMA 1VQFA 2WACA 4DNRB 4MHEA 5HURA 4KLKA 4B3SL 1HNWQ 3H0GB 1SJHD 3I90A 2EYFA 1VQLA 3RD4A 5M9OA 2EYPA 2EE1A 2BA0A 3L9AX 2ZM6L 2UU9Q 1STAA 1QZGA 4A3BG 1GO3E 4PZ8A 1WTHA 1VCIA 4YIJA 1N32Q 3A5UA 1QNKA 3A55A 1E0BA 2R7ZG 1EY8A 4BY7G 3D4WA 1A3VA 4J8QA 4OO1H 1II3A 1S3OA 3I3CA 4IPGA 3TP8A 2KOLA 2UUAL 4A3GH 2WINB 1J9OA 4DNIA 3KUPA 5KRUA 2E2JH 2A6HC 1IBLL 3BVGA 4UP8A 3J81E 4CKBA 1IL2A 5LL6S 4DU9A 3EQLC 1TWGH 4HJ7A 2EXZA 3H91A 1IBKQ 3UDFA 2A73B 4R4TA 3HOYH 4QIWE 3T1YL 4KJOA 2NZ1D 1PTOH 2BE5D 3HOVH 1VQOA 4DAYA 1Q86C 4ZCKA 1UNSA 3U50C 3SK6A 2F4VL 5KYLA 2X6LA 2DJGC 2IPKD 2ZTEA 3S16H 3GV6A 4DR7L 2F0UA 2CQAA 3Q8DA 1DZ1A 4CHTB 1MSGA 1TWFH 1K83B 2FHTA 4C3IH 3C3LA 1IBMQ 1AZQA 3S15B 2VL6A 4MN3A 1CK1A 4AQYQ 2IY5B 2R61A 1AE2A 5FLXE 1Y8NB 2D9UA 3OTOL 1LTRD 4J1MA
chains in the Genus database with same CATH topology
3ULPA 2HIXA 2JA5G 5ELOA 1CSQA 3PSIA 5LMNW 1E1TA 4LF9L 2IHFA 3AYHB 3RZDH 1FGUA 3AQQA 4BY1H 5C3EG 4YCUA 4X66Q 1YI2A 2GN5A 1WCMG 1EWIA 4LF8L 1T9HA 2EIFA 4H02A 4X62L 1WI5A 4APVA 4A75A 4GLAC 2RHSB 1VQPA 3F8TA 2MFIA 3M4QA 1BBUA 4XIGS 2K75A 1YHAA 1Q81C 5IWAL 3LGJA 1E1OA 4HJ8A 1BKBA 4IO9A 2K5NA 1K8AC 2PI2A 4DV4Q 4DV5L 1PH4A 2JA8H 3GTLH 3PO2H 3S1NH 2E5LQ 2ID0A 3KOJA 2ZJQA 2R93G 5FLXc 1D8LA 5M3FG 3F2CA 1PH3A 3ICEA 3OYYA 2F52A 1X65A 2N8NA 1SLJA 2EQSA 3SGIA 2YV5A 3STBC 3JAMc 4DV3Q 3GTGH 4YHHQ 4JI0Q 4DR2L 4R4QA 4JC0A 4A3FH 1PH2A 4LUZA 4A3MG 3HOZG 4LF7L 1LTLA 3AFQA 2MQHA 4L5SA 4NPSA 4P74A 3I4NG 1U0LA 1EUJA 1XNRL 3FKIG 1VQ9A 3J81j 5C4XH 4PG3A 4X65L 1VQ4A 3E0EA 3AEVA 4A3LH 2YYZA 2CWPA 3TS0A 4A3EH 1Z47A 3ULLA 5C44H 4BXXH 1UE7A 1P16A 2UXDQ 1MKHA 4J15A 2NN6G 5M3MH 3K8AA 2ZTCA 4Y7NH 4LFBL 1BVSA 1I5FA 4L5TA 1NJIC 4LFCQ 1Q46A 1I94L 4R4CA 3MXNB 1UE1A 3GTJH 3J7A5 3TS2A 4JI1L 4A3BH 1Y1VH 1XPOA 2Q2UA 5IYCH 4AIMA 2Q2HA 2B63G 3BZKA 4OXPA 3K0XA 4P75A 2MNAA 4QL5A 2CCZA 1PVOA 2ZJRA 1X55A 3CCLA 1X3GA 1A62A 2YU9H 1XPRA 2R7ZH 2Z6KA 4YY3L 4BY7H 4DR6Q 1VQGA 1L0WA 1N33L 4QGUA 2UXCQ 1CKMA 1OXSC 1H95A 2BH8A 1SRUA 2UXBL 1N32L 4PMWA 1CUKA 1NBWA 3BZCA 4NXNL 5IP7G 4O0AA 5C0XG 3KJOA 1VQ8A 4OX9L 1YITA 4R1JA 4B3SQ 3I4MG 1HNZL 2K50A 4DV1Q 2WFWA 4IJHA 4P72A 4LNQA 1MIUA 3H3VH 3D31A 1LYLA 3JC66 2MO1A 1Q1BA 2WP8J 3KDFA 4RMFA 5C0XJ 4JI2L 2VUMG 3HOUG 1NMGA 1NE3A 1HR0L 2ZM6Q 1KD1C 2I5LX 4LF6L 5LMNQ 4X64Q 1XMQQ 4JOIC 3FHWA 2AWOA 4AH6A 1QVFA 1UE5A 4JI7L 2JJQA 4JBWA 2B29A 2K5HA 5H1SE 4IFDG 4LF4Q 2I5HA 3UDXA 3GO5A 2IHEA 2VQEQ 4DR5Q 3PUVA 1X54A 2A1AA 1DGSA 5IYBG 1VQ6A 1YJWA 2IX1A 1B70B 4IFDJ 1YJNA 2Z0SA 4JYAL 1XNQQ 3ER0A 1XMOQ 2E2HH 4DV0Q 1NMFA 3ZJYC 3CW2C 3GTMH 4BBRG 1Y1WH 1KC8C 2I0QA 4QJFA 1I50H 2F3IA 4OWTB 4AYBE 5M5XH 1Q82C 3PIPA 1E22A 1IBLQ 1CSPA 3UDGA 1N8RC 1YIJA 5AJ3L 4A3IG 3RNUA 1JE5A 4GN5A 1N34Q 5IYDG 1HZBA 4B3TQ 2L15A 3CPFA 3NBHB 4POGA 2JA5H 4JI6L 4LF5Q 4A3DG 2KBNA 4HJ5A 1JT8A 3T1YQ 3I7FA 4OWWB 4LWCA 4B3MQ 3KF6B 5C3EH 2R92G 1V43A 4HJ9A 2I5MX 4JI5L 4A3KG 4GKJL 1FJGL 2Y0SG 1UE6A 1WCMH 3F2BA 4ME3A 4JBMA 3UDIA 1OXXK 2Y0SE 3D0FA 2CQOA 4RG1A 3UE1A 1EFWA 2E2IH 2F4VQ 3S2HH 1E24A 3HKZG 4JI8L 4JI4Q 4DR7Q 2B3GA 2XGTA 2YTVA 3HKZE 3GTOH 1Q12A 2OQ0A 1Z9FA 3CF5A 1HNXQ 1BBWA 1L1OB 1VQIA 2K4KA 1KAWA 2JE6I 2HHHL 2QGQA 3IRBA 5IY0A 2OQKA 4TQUS 1HZAA 2C35B 2LSSA 4B3RL 5ELNA 3RLNA 5M3FH 2R93H 3EBEA 5GAGC 4JBJA 3CMAA 3PUXA 1N36Q 3KFUA 1QVGA 1L1OC 2NZHA 4HIMA 3L0OA 1SFOH 5C4JH 1QVCA 1HR0W 4OO1I 5DLQE 3HOZH 1Y14B 4A3MH 2PMZE 3CCRA 3RN5A 1X6OA 4LF9Q 1SR3A 1HZCA 1SE8A 1WJJA 3I4NH 2N78A 2LXJA 3PUYA 4PZ7A 4GLXA 2GVBA 3FKIH 5FJ8G 1PHJA 4BBSG 4NXML 1YEZA 2RHQB 4LF8Q 4HIDA 4JI0L 4MNOA 1PYBA 2PI2E 2CWAA 1TWAH 1Q7YC 3TEHB 5GAEC 1P8LA 4UP9A 3GTPH 4YCVA 2ATWA 1EQQA 2VNUD 1K0RA 2KENA 2NZOA 2JEBI 3M9BA 5IWAQ 3HOXG 4L5QA 3J80c 2WAQE 2HIVA 4BA1I 1A8VA 5IP9G 1S40A 1W2BA 2K52A 4KHPL 2N49A 4DPGA 4DUYL 3K81C 4DV5Q 2UXDL 1VQEA 5JJKA 4DR1Q 2B63H 3TREA 4QQBX 2NVXH 4YCWA 3GD7A 3GTQH 3NEMA 1HNWL 1TWCH 3A74A 1G6PA 4KHZA 4DV2Q 4GNXB 3I56A 1I6HH 1PFSA 4DR2Q 1IZ6A 1PV4A 1M90C 2KHIA 4WJ4A 4LF7Q 3M85A 3PCOB 1GVPA 3RLOA 1XNRQ 5IP7H 2UU9L 4IPDA 3S1QH 4X65Q 2R7DA 3MEFA 1KHIA 4XTCS 4DAMA 3I4MH 4YWLA 4GNXC 5K36G 1YBYA 3HOWG 3CCSA 1ASZA 4A93H 3OW2A 1SN8A 4A3JG 3S1MH 1KXLA 2GVAA 1TXYA 4OONA 2RF4A 2KCMA 2KHJA 2VUMH 3G4SA 3HOUH 3KYHC 3T1HL 2ES2A 3CC2A 4LFBQ 2E8GA 2VS1A 1M1KC 2OTJA 5EAYA 1B7YB 3M3YH 2V1CC 5IE8A 4DV1L 3M4PA 5LMUQ 4FDBA 4JI1Q 3UE0A 3L2PA 2ASBA 1PH9A 5M5WH 2UUCQ 1I3QH 1UEBA 2A19A 4IOCA 3KLWA 4HJAA 4R4IA 3AFPA 5BR8L 1K9MC 2R6GA 4A3CG 1KIXA 5LMNL 2VQFL 2N3SA 4X64L 1XMQL 1K73C 5IYBH 2IT1A 1VQKA 4YY3Q 4UY8C 1OTCA 3W1GA 3JAMi 1N33Q 1K3RA 3F1ZA 2JA7G 3CCEA 4LF4L 4DAYB 4DR5L 1X56A 1IBKL 2OWOA 4OWXB 2UXBQ 1EOVA 2JQOA 4IPCA 4LFAL 1XTDA 4BBRH 4GOPB 3PGZA 4NXNQ 2ALYB 3K7UC 4OX9Q 3PO3G 5IT9c 3PUWA 1C9OA 1GD7A 1UWVA 3I2ZA 4UP7A 1V9PA 3U58A 2R92H 1QUQB 4A3IH 5IYDH 4DR3Q 3PUZA 4DV0L 1OXTA 1EIYB 4HIOA 2UUAQ 2NVYH 2NVQH 1PA6A 3S1RH 1YZ6A 1G291 4GOPC 4AYBG 1WYDA 3HKSA 1HR0Q 2UUBL 2OCEA 4A3DH 4GKKL 3H15A 4LF6Q 3CCJA 2Q2TA 1XPUA 4JOIA 4OO1G 1X3FA 3CQZH 2QA4A 4A3KH 3RR5A 1N34L 2NN6I 4B3TL 2H5XA 4JI7Q 2R7FA 3CD6A 4K0KL 4A3GG 4DV7L 1IBML 3CMEA 4AQYL 1VQDA 3KJPA 2AHOB 2PNHA 1J5EL 4DUZL 2CFMA 3EN2A 4B3ML 3G6EA 4EX5A 4JV5L 5GADC 1C0AA 1A63A 4LW1A 1TWHH 5JEAG 1J6QA 4IJLA 3EIVA 3HOYG 4IOAA 1HJPA 4DKAC 1YVCA 4O2DA 4DK3C 5GQOA 3U4ZA 4X66L 3CPWA 4DR4Q 3BU2A 2RCNA 3HOVG 4GN3B 5C0XI 1HH2P 1HNXL 3A0JA 4MTNA 3A5ZB 3S24A 1Q1EA 1GM5A 3L7ZC 5M5YH 4DV6Q 2ZJPA 1X9NA 4GLVB 4JI6Q 2DUDA 4YWMA 1OXUA 1U5KA 1G51A 2YTYA 1E3PA 4JI3Q 1OXVA 3M7NA 4JI5Q 3PV0A 5FJ8H 4BBSH 1PH7A 1FJGQ 1RIPA 4C3JH 4DV4L 3OTOQ 3CCQA 2BH2A 2D0PA 3I55A 1EYGA 2E5LL 3H3VI 4WJ3M 2D62A 1ASYA 4JI8Q 1S72A 1W3SA 2EXDA 2JA9A 3I4OA 3KF6A 5GROA 3HOXH 3CCUA 4IFDI 1JJCB 3CC4A 3M4OH 4DV3L 1VQ5A 3S2DH 1SMXA 4YHHL 3BJUA 3GDEA 5IP9H 1GKHA 3CCVA 4BA2I 4X62Q 2BA1A 1CKOA 3NENA 2FXQA 2HHHQ 4JCVE 1CKNB 3TQYA 1LM0A 3RZOH 4BY1G 3KF8B 4B3RQ 2WAQG 4NB3A 1WOCA 2VZAA 3CAMA 3DM3A 1L1OA 1EQRA 3NELA 1QZHA 5E7NA 2JA6H 4KI0A 1VQHA 1KRTA 3CP0A 4DR1L 3CXCA 1V1QA 3W1BA 1N9WA 1R9TH 5JJLA 3ERSX 1JJ2A 2D0OA 3TRZA 2YTXA 3J81i 4LFCL 1FVIA 1IYJB 1X3EA 4NXMQ 3S17H 2QEXA 4DV2L 2KCTA 2IX0A 1WFQA 3K7AH 1VQ7A 2JA8G 3HOWH 2JA6G 3PO2G 5GAHC 1MJEA 2WB1G 4A3JH 1NTGA 2ZTDA 1VQAA 2WB1E 3HFZB 1FL0A 1VQJA 2DGYA 1B8AA 1VQBA 1L2FA 3RN2A 4DR6L 2Z6KC 4QY7A 1E7ZA 4A93G 2K14A 4A3FG 2UXCL 3WWVA 1XJVA 1CKNA 4KHPQ 4DUYQ 4C2MH 3KDFB 4GS3A 4A3CH 2AKWB 4P73A 1PH6A 5C4XG 1RL2A 1VQFA 3K80C 4A3LG 4KLKA 4DK6C 4B3SL 5LMUL 4A3EG 1HNWQ 2Q2IA 1I94Q 2OTLA 1JMCA 1IXRA 4POFA 1O7IA 5C44G 2A8VA 4BXXG 4PZ6A 2UUCL 2JA7H 1VQLA 4L5RC 4LUVA 2VW9A 2CKZB 5M3MG 2HT1A 2ZM6L 2BA0A 2UU9Q 1VQNA 2VY3A 3G48A 4JBKA 3PO3H 1YNXA 4JG2A 3H0GH 1NY4A 4A4IA 4GNXA 1GO3E 1QZGA 1Y1VG 1PH8A 1C7YA 1HZ9A 1Q8KA 1VQCA 4A3BG 4Y52H 3ULJA 5IYCG 2NVTH 4PZ8A 1VCIA 2XTIA 1LUZA 1VS0A 4IPHA 2VQEL 5HGQA 3DLLA 1N32Q 3A5UA 3E9HA 3T1HQ 1KQSA 2R7ZG 4X6AH 3FP9A 4BY7G 1YHBA 3H0GG 3J80i 1S3OA 1HNZQ 4IPGA 1D7QA 2LXKA 4DR3L 1XNQL 2UUAL 4C3HH 1XMOL 4A3GH 4JI2Q 1MJCA 5BR8Q 4YWKA 3STBD 4TVAB 3RLFA 2JEAI 1PYSB 2K5VA 3CC7A 4DNIA 2VQFQ 2PQAB 3G71A 1PH5A 2E2JH 3E9IA 1IBLL 4UP8A 2MO0A 3S14H 1IL2A 4GN4B 4P71A 2AWNA 1TWGH 5J3BA 4HJ7A 1VQMA 1AH9A 1IBKQ 3UDFA 3W5OA 4R4OA 4LF5L 4R4TA 4LFAQ 3HOYH 4ALPA 3PF4A 4EQ5A 4QIWE 3T1YL 3PF5A 1KL9A 3PIOA 2AMCB 3VDYA 3HOVH 5HY6A 1VQOA 5FLMH 1Q86C 4MZ9A 3CCMA 1SROA 4A76A 4JYAQ 2HQLA 3U50C 3J7ZC 1K8GA 2F4VL 4GOPA 2ZTEA 3F2DA 3S16H 4JI4L 4GKKQ 2UUBQ 4DR7L 4LUOA 4DR4L 3GTKH 1PH1A 2JK8A 3Q8DA 4HIKA 1TWFH 1JJGA 1QUQA 4C3IH 5AJ3Q 5JEAJ 5FLMG 4K0KQ 1AE3A 4DV6L 4DV7Q 1JB7A 1IBMQ 2VL6A 1Y1WG 2IY5B 4AQYQ 1KRSA 4UPAA 1A0IA 1AE2A 1J5EQ 2PQAA 4DUZQ 4JI3L 3J81c 1YHQA 1EIFA 1K83H 1N36L 3B6YA 4JV5Q 4GKJQ 3OTOL 3S15H 5JJIA 1YJ9A 3U4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULP A;  2HIX A;  2JA5 G;  5ELO A;  1CSQ A;  3PSI A;  5LMN W;  1E1T A;  4LF9 L;  2IHF A;  3AYH B;  3RZD H;  1FGU A;  3AQQ A;  4BY1 H;  5C3E G;  4YCU A;  4X66 Q;  1YI2 A;  2GN5 A;  1WCM G;  1EWI A;  4LF8 L;  1T9H A;  2EIF A;  4H02 A;  4X62 L;  1WI5 A;  4APV A;  4A75 A;  4GLA C;  2RHS B;  1VQP A;  3F8T A;  2MFI A;  3M4Q A;  1BBU A;  4XIG S;  2K75 A;  1YHA A;  1Q81 C;  5IWA L;  3LGJ A;  1E1O A;  4HJ8 A;  1BKB A;  4IO9 A;  2K5N A;  1K8A C;  2PI2 A;  4DV4 Q;  4DV5 L;  1PH4 A;  2JA8 H;  3GTL H;  3PO2 H;  3S1N H;  2E5L Q;  2ID0 A;  3KOJ A;  2ZJQ A;  2R93 G;  5FLX c;  1D8L A;  5M3F G;  3F2C A;  1PH3 A;  3ICE A;  3OYY A;  2F52 A;  1X65 A;  2N8N A;  1SLJ A;  2EQS A;  3SGI A;  2YV5 A;  3STB C;  3JAM c;  4DV3 Q;  3GTG H;  4YHH Q;  4JI0 Q;  4DR2 L;  4R4Q A;  4JC0 A;  4A3F H;  1PH2 A;  4LUZ A;  4A3M G;  3HOZ G;  4LF7 L;  1LTL A;  3AFQ A;  2MQH A;  4L5S A;  4NPS A;  4P74 A;  3I4N G;  1U0L A;  1EUJ A;  1XNR L;  3FKI G;  1VQ9 A;  3J81 j;  5C4X H;  4PG3 A;  4X65 L;  1VQ4 A;  3E0E A;  3AEV A;  4A3L H;  2YYZ A;  2CWP A;  3TS0 A;  4A3E H;  1Z47 A;  3ULL A;  5C44 H;  4BXX H;  1UE7 A;  1P16 A;  2UXD Q;  1MKH A;  4J15 A;  2NN6 G;  5M3M H;  3K8A A;  2ZTC A;  4Y7N H;  4LFB L;  1BVS A;  1I5F A;  4L5T A;  1NJI C;  4LFC Q;  1Q46 A;  1I94 L;  4R4C A;  3MXN B;  1UE1 A;  3GTJ H;  3J7A 5;  3TS2 A;  4JI1 L;  4A3B H;  1Y1V H;  1XPO A;  2Q2U A;  5IYC H;  4AIM A;  2Q2H A;  2B63 G;  3BZK A;  4OXP A;  3K0X A;  4P75 A;  2MNA A;  4QL5 A;  2CCZ A;  1PVO A;  2ZJR A;  1X55 A;  3CCL A;  1X3G A;  1A62 A;  2YU9 H;  1XPR A;  2R7Z H;  2Z6K A;  4YY3 L;  4BY7 H;  4DR6 Q;  1VQG A;  1L0W A;  1N33 L;  4QGU A;  2UXC Q;  1CKM A;  1OXS C;  1H95 A;  2BH8 A;  1SRU A;  2UXB L;  1N32 L;  4PMW A;  1CUK A;  1NBW A;  3BZC A;  4NXN L;  5IP7 G;  4O0A A;  5C0X G;  3KJO A;  1VQ8 A;  4OX9 L;  1YIT A;  4R1J A;  4B3S Q;  3I4M G;  1HNZ L;  2K50 A;  4DV1 Q;  2WFW A;  4IJH A;  4P72 A;  4LNQ A;  1MIU A;  3H3V H;  3D31 A;  1LYL A;  3JC6 6;  2MO1 A;  1Q1B A;  2WP8 J;  3KDF A;  4RMF A;  5C0X J;  4JI2 L;  2VUM G;  3HOU G;  1NMG A;  1NE3 A;  1HR0 L;  2ZM6 Q;  1KD1 C;  2I5L X;  4LF6 L;  5LMN Q;  4X64 Q;  1XMQ Q;  4JOI C;  3FHW A;  2AWO A;  4AH6 A;  1QVF A;  1UE5 A;  4JI7 L;  2JJQ A;  4JBW A;  2B29 A;  2K5H A;  5H1S E;  4IFD G;  4LF4 Q;  2I5H A;  3UDX A;  3GO5 A;  2IHE A;  2VQE Q;  4DR5 Q;  3PUV A;  1X54 A;  2A1A A;  1DGS A;  5IYB G;  1VQ6 A;  1YJW A;  2IX1 A;  1B70 B;  4IFD J;  1YJN A;  2Z0S A;  4JYA L;  1XNQ Q;  3ER0 A;  1XMO Q;  2E2H H;  4DV0 Q;  1NMF A;  3ZJY C;  3CW2 C;  3GTM H;  4BBR G;  1Y1W H;  1KC8 C;  2I0Q A;  4QJF A;  1I50 H;  2F3I A;  4OWT B;  4AYB E;  5M5X H;  1Q82 C;  3PIP A;  1E22 A;  1IBL Q;  1CSP A;  3UDG A;  1N8R C;  1YIJ A;  5AJ3 L;  4A3I G;  3RNU A;  1JE5 A;  4GN5 A;  1N34 Q;  5IYD G;  1HZB A;  4B3T Q;  2L15 A;  3CPF A;  3NBH B;  4POG A;  2JA5 H;  4JI6 L;  4LF5 Q;  4A3D G;  2KBN A;  4HJ5 A;  1JT8 A;  3T1Y Q;  3I7F A;  4OWW B;  4LWC A;  4B3M Q;  3KF6 B;  5C3E H;  2R92 G;  1V43 A;  4HJ9 A;  2I5M X;  4JI5 L;  4A3K G;  4GKJ L;  1FJG L;  2Y0S G;  1UE6 A;  1WCM H;  3F2B A;  4ME3 A;  4JBM A;  3UDI A;  1OXX K;  2Y0S E;  3D0F A;  2CQO A;  4RG1 A;  3UE1 A;  1EFW A;  2E2I H;  2F4V Q;  3S2H H;  1E24 A;  3HKZ G;  4JI8 L;  4JI4 Q;  4DR7 Q;  2B3G A;  2XGT A;  2YTV A;  3HKZ E;  3GTO H;  1Q12 A;  2OQ0 A;  1Z9F A;  3CF5 A;  1HNX Q;  1BBW A;  1L1O B;  1VQI A;  2K4K A;  1KAW A;  2JE6 I;  2HHH L;  2QGQ A;  3IRB A;  5IY0 A;  2OQK A;  4TQU S;  1HZA A;  2C35 B;  2LSS A;  4B3R L;  5ELN A;  3RLN A;  5M3F H;  2R93 H;  3EBE A;  5GAG C;  4JBJ A;  3CMA A;  3PUX A;  1N36 Q;  3KFU A;  1QVG A;  1L1O C;  2NZH A;  4HIM A;  3L0O A;  1SFO H;  5C4J H;  1QVC A;  1HR0 W;  4OO1 I;  5DLQ E;  3HOZ H;  1Y14 B;  4A3M H;  2PMZ E;  3CCR A;  3RN5 A;  1X6O A;  4LF9 Q;  1SR3 A;  1HZC A;  1SE8 A;  1WJJ A;  3I4N H;  2N78 A;  2LXJ A;  3PUY A;  4PZ7 A;  4GLX A;  2GVB A;  3FKI H;  5FJ8 G;  1PHJ A;  4BBS G;  4NXM L;  1YEZ A;  2RHQ B;  4LF8 Q;  4HID A;  4JI0 L;  4MNO A;  1PYB A;  2PI2 E;  2CWA A;  1TWA H;  1Q7Y C;  3TEH B;  5GAE C;  1P8L A;  4UP9 A;  3GTP H;  4YCV A;  2ATW A;  1EQQ A;  2VNU D;  1K0R A;  2KEN A;  2NZO A;  2JEB I;  3M9B A;  5IWA Q;  3HOX G;  4L5Q A;  3J80 c;  2WAQ E;  2HIV A;  4BA1 I;  1A8V A;  5IP9 G;  1S40 A;  1W2B A;  2K52 A;  4KHP L;  2N49 A;  4DPG A;  4DUY L;  3K81 C;  4DV5 Q;  2UXD L;  1VQE A;  5JJK A;  4DR1 Q;  2B63 H;  3TRE A;  4QQB X;  2NVX H;  4YCW A;  3GD7 A;  3GTQ H;  3NEM A;  1HNW L;  1TWC H;  3A74 A;  1G6P A;  4KHZ A;  4DV2 Q;  4GNX B;  3I56 A;  1I6H H;  1PFS A;  4DR2 Q;  1IZ6 A;  1PV4 A;  1M90 C;  2KHI A;  4WJ4 A;  4LF7 Q;  3M85 A;  3PCO B;  1GVP A;  3RLO A;  1XNR Q;  5IP7 H;  2UU9 L;  4IPD A;  3S1Q H;  4X65 Q;  2R7D A;  3MEF A;  1KHI A;  4XTC S;  4DAM A;  3I4M H;  4YWL A;  4GNX C;  5K36 G;  1YBY A;  3HOW G;  3CCS A;  1ASZ A;  4A93 H;  3OW2 A;  1SN8 A;  4A3J G;  3S1M H;  1KXL A;  2GVA A;  1TXY A;  4OON A;  2RF4 A;  2KCM A;  2KHJ A;  2VUM H;  3G4S A;  3HOU H;  3KYH C;  3T1H L;  2ES2 A;  3CC2 A;  4LFB Q;  2E8G A;  2VS1 A;  1M1K C;  2OTJ A;  5EAY A;  1B7Y B;  3M3Y H;  2V1C C;  5IE8 A;  4DV1 L;  3M4P A;  5LMU Q;  4FDB A;  4JI1 Q;  3UE0 A;  3L2P A;  2ASB A;  1PH9 A;  5M5W H;  2UUC Q;  1I3Q H;  1UEB A;  2A19 A;  4IOC A;  3KLW A;  4HJA A;  4R4I A;  3AFP A;  5BR8 L;  1K9M C;  2R6G A;  4A3C G;  1KIX A;  5LMN L;  2VQF L;  2N3S A;  4X64 L;  1XMQ L;  1K73 C;  5IYB H;  2IT1 A;  1VQK A;  4YY3 Q;  4UY8 C;  1OTC A;  3W1G A;  3JAM i;  1N33 Q;  1K3R A;  3F1Z A;  2JA7 G;  3CCE A;  4LF4 L;  4DAY B;  4DR5 L;  1X56 A;  1IBK L;  2OWO A;  4OWX B;  2UXB Q;  1EOV A;  2JQO A;  4IPC A;  4LFA L;  1XTD A;  4BBR H;  4GOP B;  3PGZ A;  4NXN Q;  2ALY B;  3K7U C;  4OX9 Q;  3PO3 G;  5IT9 c;  3PUW A;  1C9O A;  1GD7 A;  1UWV A;  3I2Z A;  4UP7 A;  1V9P A;  3U58 A;  2R92 H;  1QUQ B;  4A3I H;  5IYD H;  4DR3 Q;  3PUZ A;  4DV0 L;  1OXT A;  1EIY B;  4HIO A;  2UUA Q;  2NVY H;  2NVQ H;  1PA6 A;  3S1R H;  1YZ6 A;  1G29 1;  4GOP C;  4AYB G;  1WYD A;  3HKS A;  1HR0 Q;  2UUB L;  2OCE A;  4A3D H;  4GKK L;  3H15 A;  4LF6 Q;  3CCJ A;  2Q2T A;  1XPU A;  4JOI A;  4OO1 G;  1X3F A;  3CQZ H;  2QA4 A;  4A3K H;  3RR5 A;  1N34 L;  2NN6 I;  4B3T L;  2H5X A;  4JI7 Q;  2R7F A;  3CD6 A;  4K0K L;  4A3G G;  4DV7 L;  1IBM L;  3CME A;  4AQY L;  1VQD A;  3KJP A;  2AHO B;  2PNH A;  1J5E L;  4DUZ L;  2CFM A;  3EN2 A;  4B3M L;  3G6E A;  4EX5 A;  4JV5 L;  5GAD C;  1C0A A;  1A63 A;  4LW1 A;  1TWH H;  5JEA G;  1J6Q A;  4IJL A;  3EIV A;  3HOY G;  4IOA A;  1HJP A;  4DKA C;  1YVC A;  4O2D A;  4DK3 C;  5GQO A;  3U4Z A;  4X66 L;  3CPW A;  4DR4 Q;  3BU2 A;  2RCN A;  3HOV G;  4GN3 B;  5C0X I;  1HH2 P;  1HNX L;  3A0J A;  4MTN A;  3A5Z B;  3S24 A;  1Q1E A;  1GM5 A;  3L7Z C;  5M5Y H;  4DV6 Q;  2ZJP A;  1X9N A;  4GLV B;  4JI6 Q;  2DUD A;  4YWM A;  1OXU A;  1U5K A;  1G51 A;  2YTY A;  1E3P A;  4JI3 Q;  1OXV A;  3M7N A;  4JI5 Q;  3PV0 A;  5FJ8 H;  4BBS H;  1PH7 A;  1FJG Q;  1RIP A;  4C3J H;  4DV4 L;  3OTO Q;  3CCQ A;  2BH2 A;  2D0P A;  3I55 A;  1EYG A;  2E5L L;  3H3V I;  4WJ3 M;  2D62 A;  1ASY A;  4JI8 Q;  1S72 A;  1W3S A;  2EXD A;  2JA9 A;  3I4O A;  3KF6 A;  5GRO A;  3HOX H;  3CCU A;  4IFD I;  1JJC B;  3CC4 A;  3M4O H;  4DV3 L;  1VQ5 A;  3S2D H;  1SMX A;  4YHH L;  3BJU A;  3GDE A;  5IP9 H;  1GKH A;  3CCV A;  4BA2 I;  4X62 Q;  2BA1 A;  1CKO A;  3NEN A;  2FXQ A;  2HHH Q;  4JCV E;  1CKN B;  3TQY A;  1LM0 A;  3RZO H;  4BY1 G;  3KF8 B;  4B3R Q;  2WAQ G;  4NB3 A;  1WOC A;  2VZA A;  3CAM A;  3DM3 A;  1L1O A;  1EQR A;  3NEL A;  1QZH A;  5E7N A;  2JA6 H;  4KI0 A;  1VQH A;  1KRT A;  3CP0 A;  4DR1 L;  3CXC A;  1V1Q A;  3W1B A;  1N9W A;  1R9T H;  5JJL A;  3ERS X;  1JJ2 A;  2D0O A;  3TRZ A;  2YTX A;  3J81 i;  4LFC L;  1FVI A;  1IYJ B;  1X3E A;  4NXM Q;  3S17 H;  2QEX A;  4DV2 L;  2KCT A;  2IX0 A;  1WFQ A;  3K7A H;  1VQ7 A;  2JA8 G;  3HOW H;  2JA6 G;  3PO2 G;  5GAH C;  1MJE A;  2WB1 G;  4A3J H;  1NTG A;  2ZTD A;  1VQA A;  2WB1 E;  3HFZ B;  1FL0 A;  1VQJ A;  2DGY A;  1B8A A;  1VQB A;  1L2F A;  3RN2 A;  4DR6 L;  2Z6K C;  4QY7 A;  1E7Z A;  4A93 G;  2K14 A;  4A3F G;  2UXC L;  3WWV A;  1XJV A;  1CKN A;  4KHP Q;  4DUY Q;  4C2M H;  3KDF B;  4GS3 A;  4A3C H;  2AKW B;  4P73 A;  1PH6 A;  5C4X G;  1RL2 A;  1VQF A;  3K80 C;  4A3L G;  4KLK A;  4DK6 C;  4B3S L;  5LMU L;  4A3E G;  1HNW Q;  2Q2I A;  1I94 Q;  2OTL A;  1JMC A;  1IXR A;  4POF A;  1O7I A;  5C44 G;  2A8V A;  4BXX G;  4PZ6 A;  2UUC L;  2JA7 H;  1VQL A;  4L5R C;  4LUV A;  2VW9 A;  2CKZ B;  5M3M G;  2HT1 A;  2ZM6 L;  2BA0 A;  2UU9 Q;  1VQN A;  2VY3 A;  3G48 A;  4JBK A;  3PO3 H;  1YNX A;  4JG2 A;  3H0G H;  1NY4 A;  4A4I A;  4GNX A;  1GO3 E;  1QZG A;  1Y1V G;  1PH8 A;  1C7Y A;  1HZ9 A;  1Q8K A;  1VQC A;  4A3B G;  4Y52 H;  3ULJ A;  5IYC G;  2NVT H;  4PZ8 A;  1VCI A;  2XTI A;  1LUZ A;  1VS0 A;  4IPH A;  2VQE L;  5HGQ A;  3DLL A;  1N32 Q;  3A5U A;  3E9H A;  3T1H Q;  1KQS A;  2R7Z G;  4X6A H;  3FP9 A;  4BY7 G;  1YHB A;  3H0G G;  3J80 i;  1S3O A;  1HNZ Q;  4IPG A;  1D7Q A;  2LXK A;  4DR3 L;  1XNQ L;  2UUA L;  4C3H H;  1XMO L;  4A3G H;  4JI2 Q;  1MJC A;  5BR8 Q;  4YWK A;  3STB D;  4TVA B;  3RLF A;  2JEA I;  1PYS B;  2K5V A;  3CC7 A;  4DNI A;  2VQF Q;  2PQA B;  3G71 A;  1PH5 A;  2E2J H;  3E9I A;  1IBL L;  4UP8 A;  2MO0 A;  3S14 H;  1IL2 A;  4GN4 B;  4P71 A;  2AWN A;  1TWG H;  5J3B A;  4HJ7 A;  1VQM A;  1AH9 A;  1IBK Q;  3UDF A;  3W5O A;  4R4O A;  4LF5 L;  4R4T A;  4LFA Q;  3HOY H;  4ALP A;  3PF4 A;  4EQ5 A;  4QIW E;  3T1Y L;  3PF5 A;  1KL9 A;  3PIO A;  2AMC B;  3VDY A;  3HOV H;  5HY6 A;  1VQO A;  5FLM H;  1Q86 C;  4MZ9 A;  3CCM A;  1SRO A;  4A76 A;  4JYA Q;  2HQL A;  3U50 C;  3J7Z C;  1K8G A;  2F4V L;  4GOP A;  2ZTE A;  3F2D A;  3S16 H;  4JI4 L;  4GKK Q;  2UUB Q;  4DR7 L;  4LUO A;  4DR4 L;  3GTK H;  1PH1 A;  2JK8 A;  3Q8D A;  4HIK A;  1TWF H;  1JJG A;  1QUQ A;  4C3I H;  5AJ3 Q;  5JEA J;  5FLM G;  4K0K Q;  1AE3 A;  4DV6 L;  4DV7 Q;  1JB7 A;  1IBM Q;  2VL6 A;  1Y1W G;  2IY5 B;  4AQY Q;  1KRS A;  4UPA A;  1A0I A;  1AE2 A;  1J5E Q;  2PQA A;  4DUZ Q;  4JI3 L;  3J81 c;  1YHQ A;  1EIF A;  1K83 H;  1N36 L;  3B6Y A;  4JV5 Q;  4GKJ Q;  3OTO L;  3S15 H;  5JJI A;  1YJ9 A;  3U4V A; 
#chains in the Genus database with same CATH topology
 2JA5 G;  1ET9 A;  1LAC A;  1CSQ A;  5LMN W;  1I4R A;  1TVX A;  1FGU A;  3AQQ A;  1SNQ A;  1YI2 A;  2GN5 A;  4X3K A;  2F0K A;  2XNA C;  3FRP B;  1GUO A;  1T9H A;  2K5Q A;  1LT5 D;  4A75 A;  4GLA C;  3QIA A;  4UDU C;  3S1N B;  3FVQ A;  4K8J A;  5IWA L;  3HS0 C;  1JC7 A;  2K5N A;  2PI2 A;  4ZLT F;  4DV5 L;  2JA8 H;  2RDH A;  3DHQ A;  4IUQ A;  1G91 A;  2ZJQ A;  5CC4 A;  1D8L A;  2J0T D;  3R2T A;  2F52 A;  1X65 A;  2F0O A;  2N8N A;  4KK7 A;  4JK1 C;  3SGI A;  2YV5 A;  2MP1 A;  5EQ0 A;  4YHH Q;  4FF4 A;  4DR2 L;  4R4Q A;  2F0P A;  2B2U C;  1HCZ A;  4NPS A;  4KMU C;  1U0L A;  1V8Q A;  4ZRZ A;  1O80 A;  1SBB B;  4Y7N B;  1IHZ A;  3A8I E;  4BS9 A;  1C8C A;  3ND8 A;  3GTJ B;  5C44 H;  1JWM D;  1EQT A;  1UE7 A;  2UXD Q;  5M3M H;  4LFB L;  4L5T A;  2IJ0 A;  1NJI C;  1Y1V H;  2B63 G;  2CCZ A;  3QB3 A;  1GXD C;  4QL5 A;  2F0E A;  1X3G A;  1A62 A;  1QIL A;  3CCL A;  4YY3 L;  4DR6 Q;  1BBX C;  1L0W A;  1N33 L;  1F2Y A;  3D4R A;  3BS1 A;  2K7V A;  2P5Z X;  2MGS A;  1CUK A;  1NBW A;  1JR0 D;  3BZC A;  5IP7 G;  1F9R A;  5T1I A;  5CBE E;  3H6M A;  3RUZ A;  2MUY A;  2K50 A;  3H09 A;  2WFW A;  4DV1 Q;  4LNQ A;  3H3V C;  2JSO A;  2MO1 A;  1Q1B A;  2WP8 J;  3CKI B;  1KD1 C;  3SK8 A;  2I5L X;  5LMN Q;  1ZKO A;  3FHW A;  2AWO A;  1STY A;  2JJQ A;  4JBW A;  5H1S E;  1D5Z C;  2I5H A;  3GO5 A;  2VQE Q;  4DR5 Q;  4HN7 A;  3PUV A;  1X54 A;  4KY6 A;  4N9P A;  1ENA A;  2KUM A;  2HCI A;  1D5X C;  2FMC A;  2IX1 A;  2QF7 A;  4PMC A;  2Z0S A;  4IUR A;  3A7L A;  4DV0 Q;  1NMF A;  4BBR G;  2I0Q A;  1DJR D;  4QJF A;  1I50 H;  4I65 A;  3PIP A;  1E22 A;  1N8R C;  2O4X A;  4A3I G;  4GN5 A;  1N34 Q;  4B3T Q;  2NTS A;  1WCM B;  2R3Z A;  4POG A;  2VB2 X;  3NXW A;  5DEH A;  1V1P B;  1M4V A;  2K32 A;  4HJ5 A;  4OWW B;  4B3M Q;  1V43 A;  1QJO A;  2L55 A;  3BDL A;  1UE6 A;  3F2B A;  3UDI A;  3UE1 A;  2E2I H;  3HKZ G;  4JI8 L;  4JI4 Q;  2EJG C;  5M3F B;  3HKZ E;  2VXW A;  1XTC D;  1W6K A;  3J80 E;  3CF5 A;  5NUC A;  1L1O B;  1SFO B;  3IRB A;  5IY0 A;  3HOZ B;  1HZA A;  3SDZ A;  3I91 A;  4G4K A;  5KIX A;  2R93 H;  3I4N B;  3CMA A;  3KFU A;  3L0O A;  2L5T A;  5C4J H;  4OO1 I;  3E5S A;  2PMZ E;  1SE8 A;  2N78 A;  3TSS A;  1CA5 A;  3FKI H;  5FJ8 G;  2RQX A;  2CH4 W;  4V19 0;  5A2Q E;  5DNF A;  4HID A;  1PYB A;  2PI2 E;  4GZY C;  2CWA A;  3GTP H;  4NDX A;  1EQQ A;  2KEN A;  2NZO A;  3M9B A;  4FYD A;  3GTQ B;  1JWS D;  5IP9 G;  1NSN S;  1S40 A;  4DPG A;  1RCV D;  3K81 C;  1I6H B;  1KDB A;  3A56 A;  3DWA A;  2RVL A;  1VQE A;  4HCS A;  4DR1 Q;  1JOO A;  4QQB X;  1ILQ A;  2NVX H;  1LTS D;  4XYQ A;  1G2S A;  4KHZ A;  4GNX B;  3H94 A;  1PV4 A;  2QIL A;  1JB3 A;  1CZW A;  1GUG A;  4N8F A;  3EFX D;  4I7Z C;  4XTC S;  4DAM A;  3I4M H;  3HOW G;  3CCS A;  2A5H A;  1AP0 A;  1SN8 A;  4RA8 A;  1TXY A;  1F9Q A;  1AN8 A;  1HQM C;  4HCE A;  1VMC A;  3E3X A;  3M4P A;  3KLS A;  3K57 A;  3UE0 A;  5FO7 B;  5FKA C;  1PH9 A;  1I3Q H;  1F9S A;  2A19 A;  4IFD H;  4C1N I;  4HJA A;  2R6G A;  2OF1 A;  3CRL C;  1KIX A;  2VQF L;  2N3S A;  4X64 L;  1K73 C;  1A15 A;  2HUG A;  4TKO B;  1GOZ A;  2JA7 G;  1LV9 A;  2OWO A;  1EOV A;  2JQO A;  2JEA I;  1PFN A;  4FP5 D;  4G7H C;  3PGZ A;  2ALY B;  5ELE A;  3S1R B;  5C3X A;  4OX9 Q;  2A6E D;  4A3D B;  3PO3 G;  1B2T A;  5IT9 c;  2BDO A;  1SDF A;  1GUN A;  3CQZ B;  1QUQ B;  5IYD H;  1MSH A;  2MPM A;  3PUZ A;  1EIY B;  3K0Y A;  4HIO A;  2NVY H;  4XXE A;  1G29 1;  2QCP X;  1O7L A;  1WYD A;  1DCZ A;  4CDE C;  4LF6 Q;  2Q2T A;  1X3F A;  3G7L A;  3CD6 A;  2L4N A;  4C3H G;  3VA7 A;  1DD2 A;  4DV7 L;  3CME A;  2PQE A;  4IUV A;  2RSN A;  5EPJ A;  1XYI A;  4DUZ L;  3EN2 A;  2NBF A;  3GTK B;  1RTO A;  2CW0 C;  5GAD C;  2C5C A;  2F0W A;  4DAP A;  1C0A A;  1TWH H;  1J6Q A;  4IJL A;  4FF1 A;  5C3W A;  1DOL A;  4V0B A;  1ILP A;  5DAU A;  4DV6 Q;  3NWS A;  3PIO 3;  1QOH A;  4JI6 Q;  3I4L A;  1OXU A;  3M7N A;  2XN9 C;  1OXV A;  4K2K A;  1A3U A;  1PH7 A;  1FJG Q;  1K8M A;  3LNN A;  3NBH A;  2BH2 A;  3CCQ A;  4KV6 A;  3IFT A;  2K5D A;  4WFN 3;  3HOX H;  1JJC B;  3M4O H;  4DV3 L;  4QMG A;  1SNC A;  2RKS A;  1C48 A;  4X62 Q;  3NEN A;  1RD9 D;  2FXQ A;  2O2L D;  1CKN B;  3NBI A;  4JCV E;  4FF3 A;  3BYY B;  4BY1 G;  1EY7 A;  4B3R Q;  1S5F D;  2J7Z A;  2WAQ G;  2L12 A;  2B2Y A;  5JAV A;  4LJZ C;  3NEL A;  2A6E C;  3K7A B;  2L11 A;  1V1Q A;  2RA4 A;  1N9W A;  3OPO A;  2YTX A;  1FVI A;  4NXM Q;  3S17 H;  4EQN A;  2QEX A;  4DV2 L;  2KCT A;  1WFQ A;  2B8G A;  2EVB A;  5GAH C;  1MJE A;  2EYM A;  4A3J H;  4C2M B;  4MIU A;  3P20 A;  3VYT A;  2DGY A;  4Q0F A;  1D2B A;  1L2F A;  3RN2 A;  1WTP A;  4B9W A;  1SNO A;  2D5D A;  2WKC A;  4A93 G;  2A69 D;  2SNS A;  4A3F G;  1L0Y B;  1CKN A;  2K1B A;  3KDF B;  3T13 A;  4A3C H;  2AKW B;  4P73 A;  5C4X G;  2XVS A;  5JVH 3;  4A3E G;  4BXX G;  4PZ6 A;  2DNC A;  1F2L A;  2HT1 A;  2O5J C;  1VQN A;  3G48 A;  4OHJ A;  1YNX A;  1LO5 D;  1I4P A;  1KLU D;  1C7Y A;  4Y52 H;  1HZ9 A;  5IYC G;  1PYW D;  1LUZ A;  1VS0 A;  4A3G B;  2EJM A;  1VDZ A;  3FP9 A;  2AQ1 B;  4ZK9 B;  2E2J B;  1D7Q A;  5K5P A;  4DNT B;  4DR3 L;  1TY2 A;  1XMO L;  1TWG B;  1UUP A;  3STB D;  4TVA B;  2E2D C;  3Q23 A;  3HOY B;  2PQA B;  3E9I A;  1CT1 D;  2MO0 A;  3S14 H;  1Y8P B;  1PTO B;  4ZUI A;  1CA6 A;  3HOV B;  1CQF A;  1LAB A;  1S5B D;  2HDM A;  4LF5 L;  5ELC A;  4LFA Q;  1JWU D;  1PTO F;  3S16 B;  3PF5 A;  1WTO A;  1TWF B;  4G7Z C;  4C3I B;  3BYT B;  4JYA Q;  2HQL A;  1K8G A;  2HDL A;  4GKK Q;  3R3O A;  4K5W A;  3GTK H;  2JK8 A;  3IAY A;  5AJ3 Q;  4FO2 A;  4K0K Q;  1AE3 A;  2AQ3 B;  1Y1W G;  4UPA A;  3MVV A;  2A69 C;  1J5E Q;  2PQA A;  4JI3 L;  3J81 c;  1EIF A;  1QWY A;  5CV6 A;  3BDO A;  4JV5 Q;  3U4V A;  3JAM E;  3PSI A;  3K58 A;  5C3E G;  4X66 Q;  1M8A A;  4LAA A;  2MHV A;  4H02 A;  2KCC A;  1VF5 C;  4L63 B;  1TY0 A;  1VQP A;  3AMU A;  2JA8 B;  2MFI A;  2WB1 B;  2XWJ B;  3LGJ A;  3OW7 A;  4ULL A;  4CDD C;  1K8A C;  3Q22 A;  4CBV A;  2B8F A;  1WD0 A;  3HZX A;  3MFY A;  3PO2 H;  1TWA B;  2E5L Q;  2ID0 A;  1NCV A;  1B1Z A;  5FLX c;  1SMY D;  4FXK C;  3STB C;  3GTG H;  4I7A A;  4JI0 Q;  4JC0 A;  1JOR A;  4A3M G;  5C44 B;  2MQH A;  4L5S A;  1XNR L;  3A54 A;  4XQQ A;  1TS3 A;  5M3M B;  3SE0 A;  2B2V A;  3I70 A;  1JOQ A;  4RWS C;  3AEV A;  2YYZ A;  2JYO A;  4IZ8 A;  3ULL A;  1Y1V B;  4DGZ A;  4J15 A;  2NN6 G;  4RCN A;  3ONA B;  1EYD A;  1Q46 A;  1Y8O B;  4R4C A;  2N55 A;  5EKK A;  4PQX A;  4A3B H;  2NYZ D;  2PZT A;  4AIM A;  1SNM A;  2Q2H A;  1O7Y A;  3BZK A;  3K0X A;  4OXP A;  3V05 A;  4CJ2 C;  3HP3 A;  1X55 A;  3VR3 A;  2R7Z H;  2YU9 H;  1XPR A;  2Z6K A;  3NTI A;  2B2W A;  4BY7 H;  1ESR A;  1YNJ D;  2UXC Q;  4F88 A;  3BVZ A;  3ERQ A;  2BH8 A;  3QJY A;  1N32 L;  4PMW A;  4IN3 A;  4O0A A;  2G5D A;  3OWE B;  1ENF A;  4B3S Q;  3H3V H;  1MIU A;  3D31 A;  1LYL A;  5KNC A;  3JC6 6;  5C0X J;  4RMF A;  2VUM G;  3HOU G;  1NMG A;  1NE3 A;  2ZM6 Q;  4RGT A;  3VYS A;  4AH6 A;  1QVF A;  1UE5 A;  1X3P A;  2M2L A;  4KKS A;  4HMI A;  4KY7 A;  1EOT A;  2ZXO A;  1EZ6 A;  2BCO A;  2Q8R E;  4XQN A;  1I50 B;  1VQ6 A;  1F2M A;  5D65 A;  3ER0 A;  5KYI A;  3ZJY C;  3GTM H;  1IKM A;  4RFB A;  3D6C A;  1Q82 C;  5M5X H;  1IBL Q;  1CSP A;  2R92 G;  3RNU A;  1JE5 A;  1EU4 A;  1FYC A;  1HZB A;  3NWT A;  3FPP A;  2JA5 H;  4DAV A;  2QDL A;  2E2I B;  2KBN A;  1B44 D;  3T1Y Q;  2EYO A;  4OGQ C;  2F0G A;  2I5M X;  4JI5 L;  4A3K G;  5E4X A;  1SXT A;  4ME3 A;  4JW0 A;  1ROD A;  3D0F A;  4RG1 A;  3S2H H;  2WV6 D;  2F4V Q;  3Q24 A;  1MGS A;  4QB4 A;  4DR7 Q;  2XGT A;  2R93 B;  2F0J A;  2JN4 A;  5D3I B;  3GTO H;  2D2C C;  1B3A A;  1VQI A;  1KAW A;  1HQR D;  2HHH L;  5C4J B;  2K04 A;  1YNJ C;  2OQK A;  2LSS A;  3RLN A;  1SE4 A;  1HUM A;  3OMC A;  5GAG C;  2B2Y C;  3FKI B;  2QKI C;  1QVG A;  4HIM A;  1QVC A;  3NE5 B;  1X6O A;  5CMD A;  3P1H A;  3GTP B;  1WJJ A;  1EIG A;  2LXJ A;  3EA6 A;  3PUY A;  5IGB A;  2GVB A;  4BBS G;  4LMQ D;  1YEZ A;  4C3J G;  1FNV A;  1EYA A;  1TWA H;  1Q7Y C;  3TEH B;  4UP9 A;  1SE3 A;  2VNU D;  4RGM A;  3CU7 A;  5IWA Q;  1STG A;  4L5Q A;  3J80 c;  4K8I A;  4ZQ3 A;  2NVX B;  1CI3 M;  1KAB A;  1DOM A;  2K01 A;  2N49 A;  4DV5 Q;  4IUP A;  2UXD L;  5JJK A;  2BE5 C;  1PTO D;  2EY6 A;  2B63 H;  5IGE A;  1TWC H;  3ND9 A;  3A74 A;  3I4M B;  2SDF A;  1S5E D;  2KVM A;  4DR2 Q;  1LTG D;  4WJ4 A;  4HSP A;  4DK0 A;  1A2T A;  2N88 A;  3PCO B;  5IP7 H;  4NW2 A;  3HRZ C;  4IPD A;  3MZ5 A;  2R7D A;  3MEF A;  3KLR A;  5K36 G;  1YBY A;  5I2Y A;  3OW2 A;  3VR4 A;  2GVA A;  3KLS X;  4OON A;  2RF4 A;  2KCM A;  2KHJ A;  1I3Q B;  5JOB A;  5KEE A;  3T1H L;  2ES2 A;  3K6O A;  4ZAI A;  4LFB Q;  2NUC A;  2OTJ A;  4L8J A;  4HAE A;  5EBC A;  4DV1 L;  5LMU Q;  4RHR A;  3OHX C;  1DON A;  1EFI D;  1SNP A;  2UUC Q;  1UEB A;  4R4I A;  2K5W A;  3X3M A;  5BR8 L;  2V4D A;  5LMN L;  2QDB A;  1VQK A;  2AUK A;  4YY3 Q;  1N33 Q;  1K3R A;  2LY7 A;  5IT9 L;  2I07 B;  4F8M A;  4DR5 L;  1X56 A;  4FXG C;  3HGB A;  1AH9 A;  2NVY B;  4BBR H;  4GOP B;  3K7U C;  2RCF A;  1QNU A;  1SND A;  3R8B A;  4ZKB B;  1UWV A;  2CVR A;  5G3L F;  1I4X A;  1RTN A;  4A3I H;  3HG9 A;  2F1M A;  2Y0S B;  4DF7 A;  4DXF A;  4DV0 L;  1OXT A;  4U68 A;  1T5E A;  2NVQ H;  3TP6 A;  3VR5 A;  1WTR A;  2UUB L;  1HA6 A;  1BCP B;  4ODG A;  3H15 A;  5EKI A;  1XPU A;  1CQV A;  1ET6 A;  4JOI A;  3I8Z A;  2QA4 A;  1S4Z A;  2RDF A;  1N34 L;  2NN6 I;  4B3T L;  3E0J A;  3VYR A;  1D1K A;  1TWH B;  3KJP A;  4S3S A;  2AHO B;  1WVL A;  4B3M L;  3OIQ A;  1BNZ A;  4EX5 A;  4PV1 C;  4NKL A;  5BN3 A;  4LW1 A;  5JEA G;  3OOC A;  4IOA A;  4DKA C;  2QW7 A;  3CPW A;  4DR4 Q;  2SEB D;  2KED A;  5FO9 B;  1HH2 P;  4RGO S;  1Q1E A;  1EY0 A;  5M5Y H;  2ZJP A;  1ESF A;  4GLV B;  1BDO A;  3FMC A;  1G51 A;  2YTY A;  3RZD B;  1R4Q B;  5FJ8 H;  3HOX B;  3NQI A;  2F0S A;  4TRD A;  4DV4 L;  3M4O B;  1V1P A;  4XDX A;  3H3V I;  4JI8 Q;  1S72 A;  4XYO A;  1W3S A;  5LHY 1;  1KNE A;  2PZU A;  1Q8I A;  2E75 C;  3CC4 A;  4KD3 A;  5CV4 A;  1SE2 A;  2K05 A;  5IP9 H;  2BA1 A;  1CKO A;  3PMF A;  1XX8 A;  3RZO H;  1TR5 A;  3KF8 B;  2PYK A;  4KKU A;  4NB3 A;  1WOC A;  2VZA A;  1LT6 D;  1D1I A;  1L1O A;  3WOE A;  2BOS A;  3S17 B;  1EQR A;  1QZH A;  2JA6 H;  4KI0 A;  1VQH A;  4DR1 L;  4A3J B;  1A3T A;  2SNM A;  1JJ2 A;  3TRZ A;  4RKB A;  5JJZ A;  4LFC L;  2K28 A;  1VQ7 A;  3HOW H;  2HQE A;  4J6H A;  2JA6 G;  3TZD A;  2F0I A;  1NTG A;  3HFZ B;  1VQJ A;  3MA2 B;  4UAI A;  2Z6K C;  4KD4 A;  2B2W C;  4QY7 A;  1E7Z A;  1XJV A;  3C46 A;  5J22 A;  4HR7 B;  3CRK C;  4GS3 A;  4F87 A;  4A3L G;  1FNW A;  2Q2I A;  1I94 Q;  2OTL A;  1JMC A;  4POF A;  5DM6 3;  1KDC A;  2A8V A;  2JA7 H;  4LUV A;  2G9H D;  2CKZ B;  1TS2 A;  4IQZ A;  2SOB A;  1STN A;  2XWB B;  2VY3 A;  4DA2 A;  4AYB B;  3LWE A;  3PO3 H;  4JG2 A;  5E4W C;  1NY4 A;  4A4I A;  4GNX A;  3FPU B;  1VQC A;  1DM0 B;  2NVT H;  2JP1 A;  2XTI A;  1ZXT A;  5HGQ A;  3E9H A;  4X6A H;  1YHB A;  3J80 i;  2Z4H A;  1HNZ Q;  3S14 B;  3NTH A;  1XNQ L;  4C3H H;  4JI2 Q;  4R8I A;  1MJC A;  2EYL A;  3RLF A;  1PYS B;  2VQF Q;  3G71 A;  1EWH A;  2NTT A;  1LTA D;  1S5C D;  3UI2 A;  4P71 A;  1Y69 U;  1VF7 A;  3W2D A;  5J3B A;  1VQM A;  3C1F A;  4R4O A;  4KY5 A;  4ALP A;  2NWG A;  3GP7 A;  3NTK A;  1HUN A;  5J1Z A;  3VDY A;  2PZW A;  2EPB A;  4MZ9 A;  3CCM A;  1SRO A;  5E3F A;  2F0N A;  2LFN A;  3ERO A;  4OL7 A;  2A68 D;  3VR2 A;  4LUO A;  4CKC A;  1QUQ A;  3J81 L;  5JEA J;  4DV7 Q;  3LWU A;  4DV6 L;  1JB7 A;  2F0D A;  2F3W A;  1NAP A;  3WDN A;  1A0I A;  4DUZ Q;  4HMJ A;  1YHQ A;  1BO0 A;  1N36 L;  4N9T A;  5KNB A;  4GKJ Q;  5JJI A;  3N52 A;  3PIP 3;  3ULP A;  1UAP A;  2EOT A;  1E1T A;  4LF9 L;  4IUT A;  3AYH B;  4BY1 H;  3RZD H;  1QG7 A;  4YCU A;  1LT4 D;  1WCM G;  3KK7 A;  4LF8 L;  5JVG 3;  4X62 L;  4APV A;  3V2T A;  3IFD A;  2C9O A;  1NR2 A;  2RHS B;  3K5M A;  3F8T A;  4A3M B;  3PO2 B;  2K75 A;  4C1N K;  4IO9 A;  4HJ8 A;  1BKB A;  4PNY A;  5FLX L;  2EY1 A;  3QOJ A;  3GTG B;  1PH4 A;  3GTL H;  3KOJ A;  4H0L C;  5M3F G;  3F2C A;  1PH3 A;  4DXG A;  1GUW A;  2Q8I B;  5G3L D;  3JAM c;  4DV3 Q;  1IKL A;  4A93 H;  4A3F H;  3HOZ G;  4LF7 L;  2KCN A;  1LTL A;  2EYH A;  4HED A;  3I4N G;  1VQ9 A;  5C4X H;  1EZ8 A;  1IYU A;  4X65 L;  1VQ4 A;  2CWP A;  4A3E H;  1Z47 A;  1E2W A;  4BXX H;  4A3B B;  2DN8 A;  3MXP A;  1MKH A;  1JQY D;  3K8A A;  2ZTC A;  4R9W A;  1PZK D;  1BVS A;  3MHB A;  2E74 C;  2YU9 B;  3MXN B;  1UE1 A;  3P75 A;  2R7Z B;  4BY7 B;  2KA7 A;  2H4O A;  4JI1 L;  2Q2U A;  1MD2 D;  2F0Q A;  5IYC H;  2F0L A;  4Z9C B;  2IWH A;  4P75 A;  1SYF A;  5IGD A;  1WTW A;  1B3Q A;  1OXS C;  4OEL B;  5C5L A;  1H95 A;  3K5N A;  2UXB L;  2XRQ D;  2ZXR A;  3WOF A;  5ELF A;  4NXN L;  5C0X G;  3S9W A;  3KJO A;  1VQ8 A;  1RDP D;  3MXG A;  4RH6 A;  1FNU A;  4P72 A;  3KDF A;  1NUC A;  1HRJ A;  4UHV A;  1B4O A;  2EJF C;  1HR0 L;  1IYV A;  1RKN A;  1XMQ Q;  4JOI C;  1G2T A;  3KBX A;  4RKL A;  4JI7 L;  4XT3 B;  4IUU A;  2B29 A;  2K5H A;  1ENC A;  1XWE A;  3TP5 A;  4KN7 C;  4LF4 Q;  3UDX A;  3IL8 A;  4Q5V A;  3GTM B;  4K5X A;  5IOC A;  2A1A A;  1DGS A;  5IYB G;  1TT2 A;  5FOB B;  5M5X B;  4N8X 1;  1B70 B;  4IFD J;  1YJN A;  3V96 A;  4JYA L;  1XMO Q;  2E2H H;  3DMU A;  3CW2 C;  1EY4 A;  1Y1W H;  1STH A;  1AZP A;  2JA5 B;  4OWT B;  4AYB E;  1TII D;  1YIJ A;  5AJ3 L;  2L15 A;  3CPF A;  1A2U A;  4LF5 Q;  4A3D G;  3S2H B;  5EPK A;  1JT8 A;  3D4D A;  3KF6 B;  5C3E H;  3GTO B;  3MC0 B;  2HD3 A;  1OXX K;  5ELD A;  1EFW A;  1JE4 A;  1E24 A;  4CJ0 B;  3BZD B;  4WOR A;  1B53 A;  2YTV A;  3DXJ C;  5JPM C;  3GQB A;  1TQO A;  4BBS B;  1HNX Q;  1BBW A;  1GUT A;  2B2T A;  1R4P B;  4JVZ A;  2JXM B;  4TQU S;  2C35 B;  1K3B C;  3VYU A;  5ELN A;  1RF2 D;  1O7Z A;  3EBE A;  3N6R A;  3PUX A;  3DM1 A;  1L1O C;  1U4P A;  2EY2 A;  2WKD A;  3A7A B;  4NMZ A;  4A3M H;  3RN5 A;  3T16 A;  4DK1 A;  1SR3 A;  1HZC A;  2DY7 A;  1SYG A;  4GLX A;  4PZ7 A;  1U4L A;  2RHQ B;  2K6A A;  4JI0 L;  3D8G A;  4MNO A;  3J80 L;  1H9R A;  2A6H D;  4KN4 C;  4YCV A;  1LTT D;  1K0R A;  2NN6 H;  2B63 B;  5IGF A;  2I46 A;  2X6G A;  4O1N A;  3Q0A A;  2EDG A;  4BA1 I;  1A8V A;  5I6Y A;  1HXY D;  3F2U A;  1W2B A;  1TWC B;  1YNN D;  2K52 A;  4KHP L;  4DUY L;  2FFK B;  4X3S A;  1SAP A;  1HA5 A;  3M4Y A;  3NEM A;  1HNW L;  1T5X D;  5A2Q L;  1G6P A;  1TKW B;  2IL8 A;  1PFS A;  1L0X B;  1PRT B;  3M85 A;  3RLO A;  3D3R A;  1WD1 A;  3T4A C;  1XNR Q;  2UU9 L;  3S1Q H;  4FXD A;  2CHB D;  1PRT F;  4K6D A;  5COR A;  1TS5 A;  2F3V A;  4GNX C;  4P2C B;  3SXH A;  1KXL A;  3HOU H;  2VUM H;  3G4S A;  3KYH C;  3CC2 A;  4E6I A;  2VS1 A;  2OT2 A;  1M1K C;  5EAY A;  1B7Y B;  3M3Y H;  5IE8 A;  2PW5 A;  2L1B A;  2IX3 A;  3TBI B;  3L2P A;  2ASB A;  5M5W H;  3NHH A;  4IOC A;  2HCC A;  3KLW A;  3AFP A;  2FIN B;  5I4D A;  2XIW A;  4BBR B;  5FK9 C;  2IT1 A;  5C6A A;  4UY8 C;  2ICE C;  3SHL A;  1OTC A;  3JAM i;  4A3I B;  4DAY B;  4QUC A;  4F7X A;  1IBK L;  4H7B A;  2NVQ B;  1DYQ A;  1TU2 B;  2K33 A;  3PUW A;  3I2Z A;  2L0C A;  1C9O A;  1CFM A;  1PLF A;  4RAU C;  5I2X A;  3U58 A;  2R92 H;  1JIC A;  2UUA Q;  1EY6 A;  1SMY C;  1PA6 A;  1JOK A;  1YZ6 A;  4EQO A;  2OCE A;  3CCJ A;  3HKZ B;  4OO1 G;  4A3K H;  1SYD A;  2R7F A;  4A3G G;  4H44 C;  1IBM L;  3QOL A;  4AQY L;  1VQD A;  2VB3 X;  2PNH A;  4LK1 C;  1YNN C;  2CFM A;  1U4R A;  1QCB D;  4HSV A;  1KNA A;  4ZYS A;  1EWC A;  2PMZ B;  3EIV A;  2F03 A;  3HOY G;  5M5Y B;  5E1F A;  1HJP A;  5GQO A;  3U4Z A;  2LS0 1;  3HOV G;  2RBM A;  1JCK B;  5C0X I;  1PZJ D;  3A0J A;  4MTN A;  2LKV A;  3A5Z B;  4M1U B;  3S24 A;  5IOD A;  3L7Z C;  1X9N A;  1GM5 A;  5HGT A;  5D3D A;  4YWM A;  1E3P A;  3SK5 A;  1C4Q A;  4JI5 Q;  4C3I G;  5IIF A;  4BBS H;  4C3J H;  3OTO Q;  1X3Q A;  1VMP A;  2D0P A;  1S5D D;  4WJ3 M;  2D62 A;  3RZO B;  3I4O A;  2EXD A;  2JA9 A;  5EJW A;  2KJX A;  3G6J B;  4JPB W;  1VQ5 A;  3S2D H;  1SMX A;  4YHH L;  2Z1C A;  1HPC A;  3GDE A;  3CCV A;  2ENB A;  2HHH Q;  3TQY A;  1DOK A;  2JA6 B;  1I4H A;  2Z6B A;  3CAM A;  3K59 A;  1B50 A;  3HOW B;  1LTB D;  2O5I C;  2RSO A;  3W1B A;  1R9T H;  2D0O A;  1F9P A;  4QUF A;  3J81 i;  5I6W A;  4EQP A;  4K14 A;  5K36 H;  2JA8 G;  1BF4 A;  2WB1 G;  2PNR C;  5EKL A;  2WB1 E;  1FL0 A;  2DJF C;  3VA5 A;  4DR6 L;  1CM9 A;  1HFN A;  3WWV A;  1FR3 A;  5D14 A;  2JA7 B;  1RL2 A;  3K80 C;  4DK6 C;  5LMU L;  3PO3 B;  1IXR A;  1GHJ A;  1O7I A;  5C44 G;  2WII B;  2E76 C;  1K8O A;  2UUC L;  4L5R C;  2VW9 A;  5F2D A;  2NVT B;  5EGT A;  5M3M G;  4JBK A;  2BDN A;  1KDA A;  3H0G H;  4KJN A;  1PH8 A;  1Y1V G;  1Q8K A;  1STB A;  3ULJ A;  4ZUJ A;  1U4M A;  4IPH A;  2ZT9 C;  4C3H B;  2VQE L;  3DLL A;  4C56 C;  2Z4I A;  3T1H Q;  1KQS A;  3OMG A;  3QWN A;  5CBA E;  2F4I A;  5CV9 A;  1Z6H A;  3H0G G;  3BVM A;  3MXU A;  4R8N A;  2LXK A;  1EY9 A;  3OWF A;  5BR8 Q;  4YWK A;  2K5V A;  3CC7 A;  3QR8 A;  3A8K E;  1MBY A;  1PH5 A;  1XXG A;  5L37 A;  4ME5 A;  2DY8 A;  4GN4 B;  1BCP F;  2AWN A;  3SR1 A;  5JEA H;  3MEH A;  3W5O A;  1I4Q A;  4EGV A;  3PF4 A;  4EQ5 A;  1RHP A;  3LX0 A;  3M7G A;  1KL9 A;  3PIO A;  2AMC B;  1PTO C;  4H13 C;  2XSC A;  5HY6 A;  5FLM H;  3GV3 A;  4A76 A;  3J7Z C;  4GOP A;  3F2D A;  4JI4 L;  2UUB Q;  5EBD A;  4DR4 L;  1PH1 A;  5FO8 B;  2X69 A;  4HIK A;  3T56 B;  1JJG A;  5FLM G;  1ML0 D;  1HTP A;  4G7O C;  1SSO A;  1KRS A;  2B2T C;  1LTI D;  4CGY B;  1EEI D;  4BY1 B;  1PRT D;  1K83 H;  4ABN A;  1TS4 A;  2WAQ B;  3B6Y A;  4B9X A;  3S15 H;  1YJ9 A;  2HIX A;  4QF4 A;  5ELO A;  2IHF A;  1FGB D;  3DUZ A;  3J7A V;  2TMP A;  4ZKC B;  1EWI A;  2EIF A;  1WI5 A;  1EYC A;  1MI2 A;  3GTL B;  3M4Q A;  1BBU A;  4X3T A;  4XIG S;  1YHA A;  1Q81 C;  1E1O A;  2B2V C;  2ZXP A;  4KTA A;  4DFA A;  4DV4 Q;  5I9P A;  2EYJ A;  1DXM A;  4A93 B;  3JAM L;  4ID6 A;  4A3F B;  3S1N H;  4RHS A;  2R93 G;  3TME A;  3DEP A;  3ITP A;  4O42 A;  3ICE A;  1BOS A;  3OYY A;  1SYC A;  1SYE A;  3QO2 A;  1SLJ A;  2EQS A;  3VR6 A;  5C4X B;  1PXU A;  2B39 A;  3OIP A;  4A3E B;  3EVQ A;  1WTQ A;  1PH2 A;  4LUZ A;  3SK4 A;  3AFQ A;  4P74 A;  2EY5 A;  1EUJ A;  4OEM B;  3FKI G;  3J81 j;  4PG3 A;  3E0E A;  4A3L H;  3NUC A;  3TS0 A;  5J39 A;  2OEO A;  5CR3 A;  1BQQ T;  3R93 A;  3J7A F;  1P16 A;  3KF8 A;  2KEE A;  2CW0 D;  3MAQ A;  3TN2 A;  4Y7N H;  1GUS A;  1I5F A;  2A74 C;  4LFC Q;  1I94 L;  3GTJ H;  3J7A 5;  3TS2 A;  1XPO A;  5CV8 A;  1H9J A;  3S1M B;  5BN5 A;  2MNA A;  3C1E A;  1F77 A;  1H9K A;  2ZJR A;  3J7Y W;  1VQG A;  4RGN A;  5KGU A;  1Q3L A;  4XQJ A;  4QGU A;  2M9V A;  1PRT C;  1CKM A;  1H9S B;  1SRU A;  4OX9 L;  1H9M A;  3I72 A;  2DNE A;  2J4X A;  2KEC A;  1YIT A;  4R1J A;  3I4M G;  4XT1 B;  1HNZ L;  4IJH A;  2FJ2 A;  1A6X A;  1Q90 A;  2L9H A;  4JI2 L;  1G8Z D;  4LF6 L;  4X64 Q;  3SEB A;  2F0H A;  5A35 A;  3TDQ A;  3TZU A;  4B08 A;  4IFD G;  1SYB A;  2MJ8 A;  1F2Z A;  2IHE A;  2E2H B;  3HEJ A;  1WTX A;  1Y1W B;  2GA4 B;  3C2P A;  1YJW A;  1H9S A;  4QCL A;  1XNQ Q;  1KC8 C;  4X3U A;  1J8I A;  1SEB D;  2F3I A;  5CYU A;  2G9D A;  5COY A;  3BDC A;  3TP7 A;  3SVM A;  2F0T A;  5C3E B;  3UDG A;  2NB0 A;  5IYD G;  3NBH B;  3D6W A;  4FNF A;  1PDQ A;  4JI6 L;  3PQI A;  5C5M A;  3U9S A;  1STE A;  3I7F A;  4L6T B;  4LWC A;  3MWY W;  3DWQ A;  1D5M C;  4HJ9 A;  4GKJ L;  4RCO A;  2Y0S G;  1FJG L;  1WCM H;  2Q8T A;  1PMR A;  4JBM A;  4K5V A;  1V1O A;  1B9M A;  2Y0S E;  2CQO A;  3AB9 A;  2EZV A;  3DWP A;  3ZYY X;  2B3G A;  1D6E C;  1Q12 A;  1NR4 A;  2OQ0 A;  1Z9F A;  4M8A A;  1O78 A;  5EPL A;  4PMB A;  2K4K A;  5CV5 A;  2JE6 I;  2QGQ A;  1IW7 D;  2XRS D;  2AQ2 B;  4B3R L;  3Q6S A;  5M3F H;  3K5L A;  3EJI A;  1LLR D;  4JBJ A;  1N36 Q;  1BR9 A;  1EL0 A;  4IUN A;  2NZH A;  5C4Z A;  1SFO H;  1B9N A;  1HR0 W;  5DLQ E;  3HOZ H;  1Y14 B;  3NK9 A;  3CCR A;  4LF9 Q;  1MHW C;  2KQ3 A;  1G6Z A;  3I4N H;  1PHJ A;  4NXM L;  4LF8 Q;  1ZYR D;  4G57 A;  5GAE C;  1P8L A;  2M00 A;  2ATW A;  1EU3 A;  1EY5 A;  2JEB I;  3HOX G;  5KND A;  5TSS A;  2WAQ E;  1LT3 D;  2HIV A;  2H1E A;  5I9O A;  1BCP D;  3O13 A;  1X32 A;  2F0M A;  1E2V A;  3TRE A;  3BG3 A;  3AU7 A;  4EVO A;  4YCW A;  3GD7 A;  1IL8 A;  3GTQ H;  3S1Q B;  5LL6 X;  4DV2 Q;  2A68 C;  1NNX A;  3I56 A;  1I6H H;  2KHS A;  1ZEQ X;  1IZ6 A;  1M90 C;  2KHI A;  1HTL D;  2B2U A;  4LF7 Q;  1ICF B;  1GVP A;  3DEO A;  1HFG A;  3HOU B;  2VUM B;  5C0X H;  4X65 Q;  4CJ1 B;  1CHP D;  1KHI A;  1ONL A;  4YWL A;  5ISR A;  3M3Y B;  5IT9 E;  1ASZ A;  3S1M H;  4A3J G;  1KLG D;  5M5W B;  1QB5 D;  1I4G A;  2E8G A;  4QIW B;  2OXP A;  1W6J A;  3RMH A;  2V1C C;  2CH4 A;  3A8J E;  2PO4 A;  4FDB A;  4JI1 Q;  1UEA B;  3OSO A;  5IGG A;  1KAA A;  4A3C G;  1K9M C;  3P7J A;  4U67 3;  1EIH A;  1XMQ L;  5IYB H;  2Z9H A;  1IW7 C;  3MXN A;  5IGC A;  3W1G A;  1ICW A;  2K03 A;  3F1Z A;  5C4H A;  5JPN C;  3CCE A;  4LF4 L;  2R92 B;  2TSS A;  2UXB Q;  4OWX B;  2PPB C;  4IPC A;  4LFA L;  1XTD A;  4NXN Q;  5BN4 A;  1AFP A;  1BXT A;  1GD7 A;  4UP7 A;  1V9P A;  4A3K B;  5CGK A;  4DR3 Q;  4WJW A;  2RDG A;  1U9R A;  3U9O A;  2F0F A;  5AFW A;  3S1R H;  4GOP C;  1PFB A;  4AYB G;  1HR0 Q;  3HKS A;  2FMM A;  4A3D H;  4GKK L;  1PVO A;  1ZYR C;  3NSW A;  3CQZ H;  4JI7 Q;  3RR5 A;  1Z7T A;  2H5X A;  4K0K L;  5DM7 3;  2PCF B;  3W3A A;  1J5E L;  1BCP C;  1GJX A;  2Z8L A;  3CHB D;  4DN4 M;  4WRD A;  3G6E A;  4JV5 L;  1AW7 A;  4BWG B;  3X3N A;  3MTS A;  2QEJ C;  3I73 A;  4K2L A;  4CDC C;  1A63 A;  3URY A;  3T51 B;  1HHV A;  1PZI D;  1YVC A;  4O2D A;  4DK3 C;  4X66 L;  3QG1 A;  2F0V A;  3BU2 A;  1CTM A;  2RCN A;  2LMC B;  4GN3 B;  1HNX L;  4C3J B;  1KTK A;  4FF2 A;  5T1G A;  1CHQ D;  1SJE D;  4K6L A;  4CDF C;  2DUD A;  2AUJ D;  1U5K A;  1OO9 B;  4JI3 Q;  1EQV A;  3PV0 A;  3R2I A;  1K0S A;  1RIP A;  1RJT A;  4OIK A;  4NP5 A;  3S2D B;  4HTH A;  3I55 A;  1K28 A;  1EYG A;  1WTV A;  2E5L L;  2ICI A;  4KKT A;  1ASY A;  3FEW X;  3KF6 A;  3NPP A;  3CCU A;  5GRO A;  4IFD I;  3FDT A;  3BJU A;  4BA2 I;  1GKH A;  3K5O A;  3MFG A;  2PW7 A;  1LM0 A;  1I6V C;  4MTK A;  1BUV T;  4TSS A;  5ELB A;  1R9T B;  4KHV A;  1EEF D;  1E2Z A;  3DM3 A;  5CV7 A;  5E7N A;  1GHK A;  1KRT A;  1QE6 A;  3CP0 A;  3CXC A;  1AEX A;  3KBG A;  5JJL A;  3NP8 A;  3ERS X;  4ILW A;  1IYJ B;  1X3E A;  1CZG A;  2IX0 A;  4OIJ A;  3K7A H;  3L3O C;  4IAL A;  1FD7 D;  3PO2 G;  2ZTD A;  1VQA A;  4CKE A;  1B8A A;  2IW3 A;  1VQB A;  1PFM A;  3E6Z X;  2K14 A;  2UXC L;  4KHP Q;  4DUY Q;  4C2M H;  3NQT A;  3T53 B;  3IKJ A;  1PH6 A;  4FVM A;  1VQF A;  2WAC A;  4DNR B;  4MHE A;  5HUR A;  4KLK A;  4B3S L;  1HNW Q;  3H0G B;  1SJH D;  3I90 A;  2EYF A;  1VQL A;  3RD4 A;  5M9O A;  2EYP A;  2EE1 A;  2BA0 A;  3L9A X;  2ZM6 L;  2UU9 Q;  1STA A;  1QZG A;  4A3B G;  1GO3 E;  4PZ8 A;  1WTH A;  1VCI A;  4YIJ A;  1N32 Q;  3A5U A;  1QNK A;  3A55 A;  1E0B A;  2R7Z G;  1EY8 A;  4BY7 G;  3D4W A;  1A3V A;  4J8Q A;  4OO1 H;  1II3 A;  1S3O A;  3I3C A;  4IPG A;  3TP8 A;  2KOL A;  2UUA L;  4A3G H;  2WIN B;  1J9O A;  4DNI A;  3KUP A;  5KRU A;  2E2J H;  2A6H C;  1IBL L;  3BVG A;  4UP8 A;  3J81 E;  4CKB A;  1IL2 A;  5LL6 S;  4DU9 A;  3EQL C;  1TWG H;  4HJ7 A;  2EXZ A;  3H91 A;  1IBK Q;  3UDF A;  2A73 B;  4R4T A;  3HOY H;  4QIW E;  3T1Y L;  4KJO A;  2NZ1 D;  1PTO H;  2BE5 D;  3HOV H;  1VQO A;  4DAY A;  1Q86 C;  4ZCK A;  1UNS A;  3U50 C;  3SK6 A;  2F4V L;  5KYL A;  2X6L A;  2DJG C;  2IPK D;  2ZTE A;  3S16 H;  3GV6 A;  4DR7 L;  2F0U A;  2CQA A;  3Q8D A;  1DZ1 A;  4CHT B;  1MSG A;  1TWF H;  1K83 B;  2FHT A;  4C3I H;  3C3L A;  1IBM Q;  1AZQ A;  3S15 B;  2VL6 A;  4MN3 A;  1CK1 A;  4AQY Q;  2IY5 B;  2R61 A;  1AE2 A;  5FLX E;  1Y8N B;  2D9U A;  3OTO L;  1LTR D;  4J1M A; 
#chains in the Genus database with same CATH homology
 3ULP A;  2HIX A;  2JA5 G;  5ELO A;  1CSQ A;  3PSI A;  5LMN W;  1E1T A;  4LF9 L;  2IHF A;  3AYH B;  3RZD H;  1FGU A;  3AQQ A;  4BY1 H;  5C3E G;  4YCU A;  4X66 Q;  1YI2 A;  2GN5 A;  1WCM G;  1EWI A;  4LF8 L;  1T9H A;  2EIF A;  4H02 A;  4X62 L;  1WI5 A;  4APV A;  4A75 A;  4GLA C;  2RHS B;  1VQP A;  3F8T A;  2MFI A;  3M4Q A;  1BBU A;  4XIG S;  2K75 A;  1YHA A;  1Q81 C;  5IWA L;  3LGJ A;  1E1O A;  4HJ8 A;  1BKB A;  4IO9 A;  2K5N A;  1K8A C;  2PI2 A;  4DV4 Q;  4DV5 L;  1PH4 A;  2JA8 H;  3GTL H;  3PO2 H;  3S1N H;  2E5L Q;  2ID0 A;  3KOJ A;  2ZJQ A;  2R93 G;  5FLX c;  1D8L A;  5M3F G;  3F2C A;  1PH3 A;  3ICE A;  3OYY A;  2F52 A;  1X65 A;  2N8N A;  1SLJ A;  2EQS A;  3SGI A;  2YV5 A;  3STB C;  3JAM c;  4DV3 Q;  3GTG H;  4YHH Q;  4JI0 Q;  4DR2 L;  4R4Q A;  4JC0 A;  4A3F H;  1PH2 A;  4LUZ A;  4A3M G;  3HOZ G;  4LF7 L;  1LTL A;  3AFQ A;  2MQH A;  4L5S A;  4NPS A;  4P74 A;  3I4N G;  1U0L A;  1EUJ A;  1XNR L;  3FKI G;  1VQ9 A;  3J81 j;  5C4X H;  4PG3 A;  4X65 L;  1VQ4 A;  3E0E A;  3AEV A;  4A3L H;  2YYZ A;  2CWP A;  3TS0 A;  4A3E H;  1Z47 A;  3ULL A;  5C44 H;  4BXX H;  1UE7 A;  1P16 A;  2UXD Q;  1MKH A;  4J15 A;  2NN6 G;  5M3M H;  3K8A A;  2ZTC A;  4Y7N H;  4LFB L;  1BVS A;  1I5F A;  4L5T A;  1NJI C;  4LFC Q;  1Q46 A;  1I94 L;  4R4C A;  3MXN B;  1UE1 A;  3GTJ H;  3J7A 5;  3TS2 A;  4JI1 L;  4A3B H;  1Y1V H;  1XPO A;  2Q2U A;  5IYC H;  4AIM A;  2Q2H A;  2B63 G;  3BZK A;  4OXP A;  3K0X A;  4P75 A;  2MNA A;  4QL5 A;  2CCZ A;  1PVO A;  2ZJR A;  1X55 A;  3CCL A;  1X3G A;  1A62 A;  2YU9 H;  1XPR A;  2R7Z H;  2Z6K A;  4YY3 L;  4BY7 H;  4DR6 Q;  1VQG A;  1L0W A;  1N33 L;  4QGU A;  2UXC Q;  1CKM A;  1OXS C;  1H95 A;  2BH8 A;  1SRU A;  2UXB L;  1N32 L;  4PMW A;  1CUK A;  1NBW A;  3BZC A;  4NXN L;  5IP7 G;  4O0A A;  5C0X G;  3KJO A;  1VQ8 A;  4OX9 L;  1YIT A;  4R1J A;  4B3S Q;  3I4M G;  1HNZ L;  2K50 A;  4DV1 Q;  2WFW A;  4IJH A;  4P72 A;  4LNQ A;  1MIU A;  3H3V H;  3D31 A;  1LYL A;  3JC6 6;  2MO1 A;  1Q1B A;  2WP8 J;  3KDF A;  4RMF A;  5C0X J;  4JI2 L;  2VUM G;  3HOU G;  1NMG A;  1NE3 A;  1HR0 L;  2ZM6 Q;  1KD1 C;  2I5L X;  4LF6 L;  5LMN Q;  4X64 Q;  1XMQ Q;  4JOI C;  3FHW A;  2AWO A;  4AH6 A;  1QVF A;  1UE5 A;  4JI7 L;  2JJQ A;  4JBW A;  2B29 A;  2K5H A;  5H1S E;  4IFD G;  4LF4 Q;  2I5H A;  3UDX A;  3GO5 A;  2IHE A;  2VQE Q;  4DR5 Q;  3PUV A;  1X54 A;  2A1A A;  1DGS A;  5IYB G;  1VQ6 A;  1YJW A;  2IX1 A;  1B70 B;  4IFD J;  1YJN A;  2Z0S A;  4JYA L;  1XNQ Q;  3ER0 A;  1XMO Q;  2E2H H;  4DV0 Q;  1NMF A;  3ZJY C;  3CW2 C;  3GTM H;  4BBR G;  1Y1W H;  1KC8 C;  2I0Q A;  4QJF A;  1I50 H;  2F3I A;  4OWT B;  4AYB E;  5M5X H;  1Q82 C;  3PIP A;  1E22 A;  1IBL Q;  1CSP A;  3UDG A;  1N8R C;  1YIJ A;  5AJ3 L;  4A3I G;  3RNU A;  1JE5 A;  4GN5 A;  1N34 Q;  5IYD G;  1HZB A;  4B3T Q;  2L15 A;  3CPF A;  3NBH B;  4POG A;  2JA5 H;  4JI6 L;  4LF5 Q;  4A3D G;  2KBN A;  4HJ5 A;  1JT8 A;  3T1Y Q;  3I7F A;  4OWW B;  4LWC A;  4B3M Q;  3KF6 B;  5C3E H;  2R92 G;  1V43 A;  4HJ9 A;  2I5M X;  4JI5 L;  4A3K G;  4GKJ L;  1FJG L;  2Y0S G;  1UE6 A;  1WCM H;  3F2B A;  4ME3 A;  4JBM A;  3UDI A;  1OXX K;  2Y0S E;  3D0F A;  2CQO A;  4RG1 A;  3UE1 A;  1EFW A;  2E2I H;  2F4V Q;  3S2H H;  1E24 A;  3HKZ G;  4JI8 L;  4JI4 Q;  4DR7 Q;  2B3G A;  2XGT A;  2YTV A;  3HKZ E;  3GTO H;  1Q12 A;  2OQ0 A;  1Z9F A;  3CF5 A;  1HNX Q;  1BBW A;  1L1O B;  1VQI A;  2K4K A;  1KAW A;  2JE6 I;  2HHH L;  2QGQ A;  3IRB A;  5IY0 A;  2OQK A;  4TQU S;  1HZA A;  2C35 B;  2LSS A;  4B3R L;  5ELN A;  3RLN A;  5M3F H;  2R93 H;  3EBE A;  5GAG C;  4JBJ A;  3CMA A;  3PUX A;  1N36 Q;  3KFU A;  1QVG A;  1L1O C;  2NZH A;  4HIM A;  3L0O A;  1SFO H;  5C4J H;  1QVC A;  1HR0 W;  4OO1 I;  5DLQ E;  3HOZ H;  1Y14 B;  4A3M H;  2PMZ E;  3CCR A;  3RN5 A;  1X6O A;  4LF9 Q;  1SR3 A;  1HZC A;  1SE8 A;  1WJJ A;  3I4N H;  2N78 A;  2LXJ A;  3PUY A;  4PZ7 A;  4GLX A;  2GVB A;  3FKI H;  5FJ8 G;  1PHJ A;  4BBS G;  4NXM L;  1YEZ A;  2RHQ B;  4LF8 Q;  4HID A;  4JI0 L;  4MNO A;  1PYB A;  2PI2 E;  2CWA A;  1TWA H;  1Q7Y C;  3TEH B;  5GAE C;  1P8L A;  4UP9 A;  3GTP H;  4YCV A;  2ATW A;  1EQQ A;  2VNU D;  1K0R A;  2KEN A;  2NZO A;  2JEB I;  3M9B A;  5IWA Q;  3HOX G;  4L5Q A;  3J80 c;  2WAQ E;  2HIV A;  4BA1 I;  1A8V A;  5IP9 G;  1S40 A;  1W2B A;  2K52 A;  4KHP L;  2N49 A;  4DPG A;  4DUY L;  3K81 C;  4DV5 Q;  2UXD L;  1VQE A;  5JJK A;  4DR1 Q;  2B63 H;  3TRE A;  4QQB X;  2NVX H;  4YCW A;  3GD7 A;  3GTQ H;  3NEM A;  1HNW L;  1TWC H;  3A74 A;  1G6P A;  4KHZ A;  4DV2 Q;  4GNX B;  3I56 A;  1I6H H;  1PFS A;  4DR2 Q;  1IZ6 A;  1PV4 A;  1M90 C;  2KHI A;  4WJ4 A;  4LF7 Q;  3M85 A;  3PCO B;  1GVP A;  3RLO A;  1XNR Q;  5IP7 H;  2UU9 L;  4IPD A;  3S1Q H;  4X65 Q;  2R7D A;  3MEF A;  1KHI A;  4XTC S;  4DAM A;  3I4M H;  4YWL A;  4GNX C;  5K36 G;  1YBY A;  3HOW G;  3CCS A;  1ASZ A;  4A93 H;  3OW2 A;  1SN8 A;  4A3J G;  3S1M H;  1KXL A;  2GVA A;  1TXY A;  4OON A;  2RF4 A;  2KCM A;  2KHJ A;  2VUM H;  3G4S A;  3HOU H;  3KYH C;  3T1H L;  2ES2 A;  3CC2 A;  4LFB Q;  2E8G A;  2VS1 A;  1M1K C;  2OTJ A;  5EAY A;  1B7Y B;  3M3Y H;  2V1C C;  5IE8 A;  4DV1 L;  3M4P A;  5LMU Q;  4FDB A;  4JI1 Q;  3UE0 A;  3L2P A;  2ASB A;  1PH9 A;  5M5W H;  2UUC Q;  1I3Q H;  1UEB A;  2A19 A;  4IOC A;  3KLW A;  4HJA A;  4R4I A;  3AFP A;  5BR8 L;  1K9M C;  2R6G A;  4A3C G;  1KIX A;  5LMN L;  2VQF L;  2N3S A;  4X64 L;  1XMQ L;  1K73 C;  5IYB H;  2IT1 A;  1VQK A;  4YY3 Q;  4UY8 C;  1OTC A;  3W1G A;  3JAM i;  1N33 Q;  1K3R A;  3F1Z A;  2JA7 G;  3CCE A;  4LF4 L;  4DAY B;  4DR5 L;  1X56 A;  1IBK L;  2OWO A;  4OWX B;  2UXB Q;  1EOV A;  2JQO A;  4IPC A;  4LFA L;  1XTD A;  4BBR H;  4GOP B;  3PGZ A;  4NXN Q;  2ALY B;  3K7U C;  4OX9 Q;  3PO3 G;  5IT9 c;  3PUW A;  1C9O A;  1GD7 A;  1UWV A;  3I2Z A;  4UP7 A;  1V9P A;  3U58 A;  2R92 H;  1QUQ B;  4A3I H;  5IYD H;  4DR3 Q;  3PUZ A;  4DV0 L;  1OXT A;  1EIY B;  4HIO A;  2UUA Q;  2NVY H;  2NVQ H;  1PA6 A;  3S1R H;  1YZ6 A;  1G29 1;  4GOP C;  4AYB G;  1WYD A;  3HKS A;  1HR0 Q;  2UUB L;  2OCE A;  4A3D H;  4GKK L;  3H15 A;  4LF6 Q;  3CCJ A;  2Q2T A;  1XPU A;  4JOI A;  4OO1 G;  1X3F A;  3CQZ H;  2QA4 A;  4A3K H;  3RR5 A;  1N34 L;  2NN6 I;  4B3T L;  2H5X A;  4JI7 Q;  2R7F A;  3CD6 A;  4K0K L;  4A3G G;  4DV7 L;  1IBM L;  3CME A;  4AQY L;  1VQD A;  3KJP A;  2AHO B;  2PNH A;  1J5E L;  4DUZ L;  2CFM A;  3EN2 A;  4B3M L;  3G6E A;  4EX5 A;  4JV5 L;  5GAD C;  1C0A A;  1A63 A;  4LW1 A;  1TWH H;  5JEA G;  1J6Q A;  4IJL A;  3EIV A;  3HOY G;  4IOA A;  1HJP A;  4DKA C;  1YVC A;  4O2D A;  4DK3 C;  5GQO A;  3U4Z A;  4X66 L;  3CPW A;  4DR4 Q;  3BU2 A;  2RCN A;  3HOV G;  4GN3 B;  5C0X I;  1HH2 P;  1HNX L;  3A0J A;  4MTN A;  3A5Z B;  3S24 A;  1Q1E A;  1GM5 A;  3L7Z C;  5M5Y H;  4DV6 Q;  2ZJP A;  1X9N A;  4GLV B;  4JI6 Q;  2DUD A;  4YWM A;  1OXU A;  1U5K A;  1G51 A;  2YTY A;  1E3P A;  4JI3 Q;  1OXV A;  3M7N A;  4JI5 Q;  3PV0 A;  5FJ8 H;  4BBS H;  1PH7 A;  1FJG Q;  1RIP A;  4C3J H;  4DV4 L;  3OTO Q;  3CCQ A;  2BH2 A;  2D0P A;  3I55 A;  1EYG A;  2E5L L;  3H3V I;  4WJ3 M;  2D62 A;  1ASY A;  4JI8 Q;  1S72 A;  1W3S A;  2EXD A;  2JA9 A;  3I4O A;  3KF6 A;  5GRO A;  3HOX H;  3CCU A;  4IFD I;  1JJC B;  3CC4 A;  3M4O H;  4DV3 L;  1VQ5 A;  3S2D H;  1SMX A;  4YHH L;  3BJU A;  3GDE A;  5IP9 H;  1GKH A;  3CCV A;  4BA2 I;  4X62 Q;  2BA1 A;  1CKO A;  3NEN A;  2FXQ A;  2HHH Q;  4JCV E;  1CKN B;  3TQY A;  1LM0 A;  3RZO H;  4BY1 G;  3KF8 B;  4B3R Q;  2WAQ G;  4NB3 A;  1WOC A;  2VZA A;  3CAM A;  3DM3 A;  1L1O A;  1EQR A;  3NEL A;  1QZH A;  5E7N A;  2JA6 H;  4KI0 A;  1VQH A;  1KRT A;  3CP0 A;  4DR1 L;  3CXC A;  1V1Q A;  3W1B A;  1N9W A;  1R9T H;  5JJL A;  3ERS X;  1JJ2 A;  2D0O A;  3TRZ A;  2YTX A;  3J81 i;  4LFC L;  1FVI A;  1IYJ B;  1X3E A;  4NXM Q;  3S17 H;  2QEX A;  4DV2 L;  2KCT A;  2IX0 A;  1WFQ A;  3K7A H;  1VQ7 A;  2JA8 G;  3HOW H;  2JA6 G;  3PO2 G;  5GAH C;  1MJE A;  2WB1 G;  4A3J H;  1NTG A;  2ZTD A;  1VQA A;  2WB1 E;  3HFZ B;  1FL0 A;  1VQJ A;  2DGY A;  1B8A A;  1VQB A;  1L2F A;  3RN2 A;  4DR6 L;  2Z6K C;  4QY7 A;  1E7Z A;  4A93 G;  2K14 A;  4A3F G;  2UXC L;  3WWV A;  1XJV A;  1CKN A;  4KHP Q;  4DUY Q;  4C2M H;  3KDF B;  4GS3 A;  4A3C H;  2AKW B;  4P73 A;  1PH6 A;  5C4X G;  1RL2 A;  1VQF A;  3K80 C;  4A3L G;  4KLK A;  4DK6 C;  4B3S L;  5LMU L;  4A3E G;  1HNW Q;  2Q2I A;  1I94 Q;  2OTL A;  1JMC A;  1IXR A;  4POF A;  1O7I A;  5C44 G;  2A8V A;  4BXX G;  4PZ6 A;  2UUC L;  2JA7 H;  1VQL A;  4L5R C;  4LUV A;  2VW9 A;  2CKZ B;  5M3M G;  2HT1 A;  2ZM6 L;  2BA0 A;  2UU9 Q;  1VQN A;  2VY3 A;  3G48 A;  4JBK A;  3PO3 H;  1YNX A;  4JG2 A;  3H0G H;  1NY4 A;  4A4I A;  4GNX A;  1GO3 E;  1QZG A;  1Y1V G;  1PH8 A;  1C7Y A;  1HZ9 A;  1Q8K A;  1VQC A;  4A3B G;  4Y52 H;  3ULJ A;  5IYC G;  2NVT H;  4PZ8 A;  1VCI A;  2XTI A;  1LUZ A;  1VS0 A;  4IPH A;  2VQE L;  5HGQ A;  3DLL A;  1N32 Q;  3A5U A;  3E9H A;  3T1H Q;  1KQS A;  2R7Z G;  4X6A H;  3FP9 A;  4BY7 G;  1YHB A;  3H0G G;  3J80 i;  1S3O A;  1HNZ Q;  4IPG A;  1D7Q A;  2LXK A;  4DR3 L;  1XNQ L;  2UUA L;  4C3H H;  1XMO L;  4A3G H;  4JI2 Q;  1MJC A;  5BR8 Q;  4YWK A;  3STB D;  4TVA B;  3RLF A;  2JEA I;  1PYS B;  2K5V A;  3CC7 A;  4DNI A;  2VQF Q;  2PQA B;  3G71 A;  1PH5 A;  2E2J H;  3E9I A;  1IBL L;  4UP8 A;  2MO0 A;  3S14 H;  1IL2 A;  4GN4 B;  4P71 A;  2AWN A;  1TWG H;  5J3B A;  4HJ7 A;  1VQM A;  1AH9 A;  1IBK Q;  3UDF A;  3W5O A;  4R4O A;  4LF5 L;  4R4T A;  4LFA Q;  3HOY H;  4ALP A;  3PF4 A;  4EQ5 A;  4QIW E;  3T1Y L;  3PF5 A;  1KL9 A;  3PIO A;  2AMC B;  3VDY A;  3HOV H;  5HY6 A;  1VQO A;  5FLM H;  1Q86 C;  4MZ9 A;  3CCM A;  1SRO A;  4A76 A;  4JYA Q;  2HQL A;  3U50 C;  3J7Z C;  1K8G A;  2F4V L;  4GOP A;  2ZTE A;  3F2D A;  3S16 H;  4JI4 L;  4GKK Q;  2UUB Q;  4DR7 L;  4LUO A;  4DR4 L;  3GTK H;  1PH1 A;  2JK8 A;  3Q8D A;  4HIK A;  1TWF H;  1JJG A;  1QUQ A;  4C3I H;  5AJ3 Q;  5JEA J;  5FLM G;  4K0K Q;  1AE3 A;  4DV6 L;  4DV7 Q;  1JB7 A;  1IBM Q;  2VL6 A;  1Y1W G;  2IY5 B;  4AQY Q;  1KRS A;  4UPA A;  1A0I A;  1AE2 A;  1J5E Q;  2PQA A;  4DUZ Q;  4JI3 L;  3J81 c;  1YHQ A;  1EIF A;  1K83 H;  1N36 L;  3B6Y A;  4JV5 Q;  4GKJ Q;  3OTO L;  3S15 H;  5JJI A;  1YJ9 A;  3U4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...