4HMJA

Crystal structure of staphylococcal nuclease variant delta+phs l36d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmjA00
2F3WA 2PYKA 1SNMA 3C1FA 1JOKA 4K8IA 2EY1A 1A2TA 3MHBA 4DGZA 1KDCA 3C1EA 4EVOA 3OMCA 1AEXA 1RKNA 2F0JA 4QF4A 5KYIA 4KY6A 4HMIA 1ENCA 1EY7A 5CC4A 1SYGA 5I9PA 5KGUA 4IUNA 3SK6A 4K8JA 1JOQA 5CGKA 5CV9A 3R3OA 5JAVA 5HURA 1EZ6A 3DMUA 4K14A 2F0SA 2F0OA 3MXPA 2LKVA 3QOLA 4LAAA 4K5VA 2EY5A 2EYMA 2EYHA 5E1FA 4ZUIA 1SYBA 2F0UA 4K2KA 1SNCA 2F0IA 4ZQ3A 4G57A 5EKLA 1EQVA 2F0KA 4I65A 4NKLA 2EYFA 5I6YA 2EY6A 2EYJA 2OEOA 3VA5A 5IIFA 5CV5A 5IGGA 3SK4A 1EY9A 5C4ZA 2ENBA 3SK5A 2F0PA 1STAA 3D6CA 4NMZA 1KDBA 3TP5A 1SYDA 2EYLA 2PW5A 2SNSA 3EJIA 1TQOA 3QOJA 2EY2A 3NHHA 5CV4A 4DF7A 1EY5A 5C4HA 3D8GA 4NDXA 5EKKA 4EQPA 1A3VA 4RKBA 1A3UA 3H6MA 3P75A 4KV6A 1A2UA 5CV6A 4E6IA 1F2MA 4EQOA 2F0NA 2SNMA 1JORA 4YIJA 4MIUA 2KHSA 3SK8A 4KHVA 3HZXA 3TP8A 4N9TA 2RBMA 4DU9A 5K5PA 4IZ8A 5CV8A 3ERQA 1SYFA 5HGTA 2O4XA 2OXPA 1STYA 1JOOA 3D4WA 1EYAA 2F0WA 4K5WA 3EVQA 1SNPA 4KY5A 2F0QA 1STGA 1KDAA 2PZWA 1SYCA 2F0LA 5C5MA 4RKLA 1EY6A 4KY7A 2F0VA 3SR1A 2F0MA 2RKSA 4NP5A 5NUCA 5KEEA 3SHLA 2F0TA 2OF1A 4KJOA 3BDLA 4K5XA 3QB3A 4R8NA 5IGCA 5KRUA 4WRDA 2F0EA 5EGTA 4F8MA 4WORA 2F0DA 1EYDA 1SNOA 1NSNS 2F3VA 3DHQA 5CV7A 3V2TA 2F0FA 4KD3A 1EY0A 3TP7A 5ISRA 3OSOA 3BDCA 4ID6A 3OMGA 3TP6A 5DAUA 1TT2A 4KJNA 1SNDA 4IALA 5J22A 4HMJA 2WACA 2PQEA 2PW7A 1STHA 3NQTA 4PMBA 4S3SA 5C5LA 3NXWA 1KAAA 1EY8A 4J6HA 4K6DA 4J1MA 4B9WA 5IGEA 5M9OA 2RDFA 1NUCA 2M00A 4QMGA 3T13A 5F2DA 3E5SA 2PZUA 4ME5A 1EZ8A 4DFAA 4HTHA 5IGBA 5E3FA 3MZ5A 1U9RA 3NK9A 3OWFA 5KIXA 4K2LA 4PMCA 3TMEA 5I9OA 3PMFA 3D4DA 1F2YA 3EROA 3NUCA 3MVVA 4N9PA 5CR3A 5C3XA 1F2ZA 5I6WA 3ITPA 5KYLA 4KD4A 1IHZA 2EYOA 2HQEA 1II3A 2EXZA 3MEHA 4QB4A 5J39A 4PNYA 2KQ3A 1A3TA 2F0HA 3NP8A 3T16A 1STBA 1ENAA 4H7BA 3U9OA 1EY4A 4EQNA 5C6AA 1STNA 5C3WA 5IGFA 1SYEA 4KTAA 1EYCA 5IGDA 4F7XA 2PZTA 2EYPA 2F0GA 2SOBA 3HEJA 4OL7A 3RUZA 3P1HA 4ZUJA 5JOBA 3SXHA 3LX0A 5J1ZA 4TRDA 1TR5A 4B9XA 5IOCA 5IODA 4ODGA 1SNQA 3S9WA 2QDBA 5DEHA 2NUCA 1KABA
chains in the Genus database with same CATH superfamily
1XNRQ 4K8IA 2MO0A 2WKDA 3GTPB 1ENCA 1DOKA 4POGA 2A6ED 5CGKA 1Q1BA 4V190 1A0IA 4EQ5A 2NN6H 2YTYA 4DA2A 1VQEA 2E75C 2B63H 2N49A 5I6YA 1NCVA 5EPLA 1T5XD 3RMHA 1N9WA 3H0GG 3IFDA 3P20A 4A3FG 1YNXA 5EPJA 1VQ6A 3VYRA 3BS1A 4JVZA 2K4KA 4UP8A 3NPPA 1E24A 3GTJB 1RDPD 3A5UA 1IW7C 2R7ZH 5FJ8H 4A3CH 1JE4A 2BCOA 3JAME 4A3JG 2B2UC 1RJTA 3FKIH 3ZYYX 1PA6A 3CRKC 3NSWA 2Q8RE 5KNCA 1Q81C 4JV5Q 1H9RA 3J7ZC 2Z4IA 3GTQH 2JA9A 4PQXA 4DR2Q 3KBGA 4O1NA 3I4MB 2Y0SE 4O42A 2CQAA 4QJFA 3ONAB 1B4OA 4C1NI 4K6LA 3B6YA 3ULJA 4DV6L 2OF1A 4ZCKA 2AUJD 2NN6G 1EEFD 4ZKBB 2KA7A 2PI2E 1QJOA 4F8MA 3NBHA 2B63G 2E2JH 1SNOA 4L5TA 4PG3A 2UUAQ 4FF4A 1F9RA 5ELOA 1Q8KA 3SE0A 1YHBA 4R4OA 3KDFB 5C5LA 1J8IA 2NZ1D 1H9SA 3OW2A 5IGBA 3OTOL 5M3FB 1RF2D 2R7ZG 4JI0L 5FJ8G 3OWFA 1C8CA 1PH3A 2N8NA 1CZGA 4K2LA 2LFNA 1HA5A 1M8AA 2X69A 2B8FA 4N9PA 5BN5A 3FKIG 1SROA 1HZ9A 2BH2A 2EYOA 3TN2A 1ENAA 4H7BA 1STNA 3AFQA 1V1PB 3GV3A 1ZXTA 4TKOB 3RUZA 1RCVD 1K83B 4TRDA 3PF5A 4X3SA 1I5FA 1YEZA 2NUCA 2PMZE 4NXNQ 1VF7A 5D3DA 3HOWB 4LWCA 2MNAA 5G3LF 2MPMA 4GN3B 5CBEE 1L1OA 1U4LA 1HNWQ 3Q23A 3ND9A 2A5HA 2JK8A 5CV9A 2UUBL 1NAPA 2F0OA 4GNXA 1CTMA 3J7AV 4K5VA 1FNUA 1PFMA 4ZUIA 4JYAL 3K7AB 1BBUA 3HS0C 4WFN3 3S17B 1QG7A 3MXNA 3HOUG 2F0KA 4JI8L 2RA4A 3I4NH 3MC0B 3K0XA 2SEBD 4FF1A 1PH8A 2XN9C 1HHVA 2WFWA 2IX1A 1SFOH 1RODA 4XQQA 5M3MB 2O5IC 2G5DA 2K6AA 1SRUA 5DM63 4DK0A 1F2MA 2XGTA 4DR6Q 2WB1G 1DOMA 1G51A 2HHHQ 1E3PA 4BBRB 3EIVA 5K5PA 2R7DA 4IZ8A 5FLMH 1PTOD 4CGYB 2E2IB 1UEBA 2G9DA 2XRSD 4DAMA 2CQOA 1ASYA 2K5HA 4ILWA 1IKLA 1VQPA 3R8BA 4JI4Q 3TZDA 3S16H 1VQNA 2RDGA 1N33L 2C9OA 3HOYB 5NUCA 3H0GB 3M4PA 4GLAC 4ZAIA 4GKJQ 1DJRD 3I4NG 2B3GA 3TS0A 2K28A 1C9OA 3MTSA 3OMGA 5DAUA 4IJLA 3K58A 1ET6A 5DLQE 1SR3A 4ME5A 1EZ8A 1UNSA 2HUGA 4X65Q 1D1KA 4DV4Q 3TQYA 5JVG3 1Q90A 4Y7NB 1U4RA 3AFPA 5FLMG 1F9QA 2KQ3A 3J7YW 2I5MX 2ICIA 5IGFA 3V05A 2ZJQA 4X64Q 4X62Q 3VYSA 2C5CA 1RIPA 4IPDA 5KNDA 5JJIA 3A7LA 1PYBA 4PZ7A 1N32L 1MD2D 3U4ZA 2VQFQ 2AQ1B 2EY1A 1P16A 4IPHA 5C4JB 3OMCA 1QOHA 4DAYB 3GTLB 2JA7B 2F0JA 4KY6A 1J5EL 2LSSA 5BN4A 1XNQQ 4UP9A 2XSCA 4JI1L 3CCQA 3AEVA 3TRZA 4KK7A 1IKMA 1X9NA 2AHOB 1BOSA 5K36H 5T1GA 2NN6I 4G57A 3CC2A 4ME3A 3S1MB 2PQAB 3S1QH 5FO9B 1PVOA 1DYQA 5FOBB 5IIFA 1HNXL 1AW7A 3SK4A 1BF4A 2B8GA 1OXUA 3TP5A 3LWUA 2PW5A 3CCSA 1Z47A 4OWWB 4L5QA 1CKMA 3X3MA 3Q24A 2SNMA 5KNBA 2H4OA 2DNCA 1VQCA 3GTOB 1TWHH 1XNRL 4JOIC 2SDFA 3CPWA 3VR2A 1ENFA 4PZ6A 4GNXB 4YCUA 1Y8PB 1AN8A 3KLSX 2BDNA 2F0WA 4KY5A 3DXJC 1JB7A 3CRLC 2KJXA 4IUVA 2QILA 2VXWA 1FL0A 1UUPA 3PIP3 5KEEA 1Z9FA 4Q5VA 4KJOA 5K36G 4FF2A 5KRUA 1BBWA 1L2FA 3PIOA 4C3IB 2F0FA 4L8JA 4F87A 1EY0A 1DGSA 1HFNA 2IL8A 2IX0A 3OSOA 4ZRZA 3WDNA 2WAQB 1LM0A 4FVMA 1EOTA 1STHA 2EPBA 1SE4A 2Q8TA 1VMPA 1KNAA 1VQFA 1IYVA 3T1HQ 5M5WH 1WTHA 1ESFA 1X56A 2B2WA 1JWMD 3SDZA 3C2PA 1U9RA 1JR0D 4LFAQ 3PIO3 1Q12A 3DLLA 4JV5L 1JQYD 4AYBG 1MSGA 1HZCA 3A5ZB 4RHSA 4DR2L 4BBSB 3UI2A 1SYEA 5A35A 5A2QL 3NTIA 3NTHA 4P72A 2DGYA 4JI7Q 3GO5A 4B3RQ 4JI2Q 4A3DB 3DUZA 4CDFC 3ND8A 5LMNW 1SFOB 2UUAL 3FDTA 1EFWA 1AEXA 1RKNA 3UE0A 1BVSA 1CFMA 1SMYD 3D0FA 4HMIA 3CC7A 2RSNA 1JOQA 1LLRD 1C0AA 4IPGA 3QWNA 1C4QA 1EZ6A 3G6JB 4HN7A 4DPGA 5HURA 3K57A 3J81j 1XX8A 3I91A 5E4XA 3A55A 2K5DA 3CQZB 4BY1B 2EYFA 2Z6KC 1WYDA 4LF6Q 2VY3A 3R2TA 5IE8A 1K73C 3QOJA 3S1NH 2JEBI 2L9HA 4KHZA 3DM1A 4RKBA 2E8GA 2VUMH 3O13A 1QVCA 3J81c 4NXNL 4CJ2C 1JJGA 3I2ZA 4HCSA 3E0EA 4XYOA 5AJ3Q 2R61A 4A3EB 3IFTA 1BXTA 3D3RA 1HNWL 4RA8A 2KEDA 1STGA 2HCIA 3KF6B 5GQOA 4RKLA 3S15B 3E0JA 1H9JA 3SR1A 3HP3A 2YV5A 1U5KA 4ABNA 3PO3B 2JJQA 4RHRA 1GUGA 1GD7A 2D5DA 3VYUA 4WORA 1BO0A 1EYDA 2OCEA 5CV7A 3QO2A 4GKKQ 4DR3Q 4CJ1B 5M5YH 4MHEA 5GAHC 2PQEA 4PMBA 4S3SA 4JPBW 1NUCA 4DNTB 1F77A 3S14B 3NEMA 2EDGA 4DR6L 2VUMG 3IAYA 3X3NA 2HHHL 1FYCA 3RZDB 1JWSD 3URYA 5I9OA 3M3YH 1F2ZA 2HQEA 1S3OA 5JEAH 1EIFA 1II3A 1IL8A 3J81E 2VL6A 3NP8A 4JI4L 3NQIA 3T53B 3S1QB 3SXHA 2EVBA 2Y0SG 5ELBA 4GKJL 1BKBA 1B2TA 1E2VA 1VQMA 3J7A5 3BVZA 2Q8IB 3MHBA 1R4PB 4ZYSA 4IUNA 1QZGA 5EPKA 1CQVA 3HKZE 2R93B 3I7FA 5IY0A 2F0UA 1AZQA 4L6TB 4X65L 2QCPX 1S72A 4NKLA 1Y1VB 3QIAA 4DV4L 1PRTC 4P75A 4HR7B 2CCZA 4TQUS 2AKWB 1WD0A 2VS1A 4IUUA 2D2CC 5JEAG 2E2DC 1EWHA 1EY5A 2F52A 1Y14B 2K7VA 5LL6X 4X64L 2L12A 5H1SE 4X62L 4HIDA 2YTXA 1SN8A 1L0WA 1I4GA 4IUQA 3NBIA 3OIPA 2VQFL 1E1TA 1B1ZA 3CCVA 1GVPA 4G7HC 5FLXL 1EEID 2ZXRA 1TS5A 4YWLA 1TKWB 3PO2B 1M4VA 1DM0B 4R9WA 3N52A 1XNQL 2K50A 5M5WB 1TWGH 2BH8A 4K5WA 1QNKA 1SNPA 4U68A 5C5MA 1X3QA 5EAYA 1E7ZA 5I4DA 4LF8Q 4ALPA 2M2LA 1LTAD 3CAMA 3TREA 1OTCA 4LFCQ 4GN4B 4R8NA 1X55A 3W1GA 4XT3B 4G7ZC 3K80C 4RGTA 2KECA 1X6OA 2R3ZA 4WJWA 4LF7Q 2HT1A 1MHWC 1NMGA 1I94Q 1QNUA 3TP6A 3BDCA 1LACA 4KJNA 1Q86C 2PW7A 1MI2A 1YNNC 4B9WA 3LWEA 2M00A 1IXRA 4GOPC 1Q8IA 3MZ5A 4A3MB 1K8AC 2QF7A 1V1PA 5I6WA 1IHZA 1N8RC 1RTNA 3MEHA 2F0HA 3T16A 4N8FA 2R92H 4A3LG 1HQMC 2YU9H 5E4WC 2HDLA 3CP0A 4DNIA 3JAML 3TS2A 1PMRA 5C3WA 2CKZB 1A15A 3DWPA 5AFWA 1JOKA 1FR3A 3CKIB 2L4NA 4FXGC 3S1NB 5IYDG 4IQZA 1PHJA 1PTOF 4WJ4A 1Y8NB 1ONLA 3SK6A 2VUMB 1B44D 2NVXH 1B53A 1LTSD 1DONA 1LTTD 2EYHA 3T1HL 1LABA 1VMCA 1EQTA 5M5XB 1ICFB 1PDQA 1X3PA 2ICEC 4DV7L 4LFAL 1PH9A 1PTOB 2EY6A 4LFBQ 1X3GA 2Y0SB 1KTKA 3D6CA 3ERSX 3CCLA 3E6ZX 3NHHA 2R92G 4NDXA 1CSPA 1A3UA 4E6IA 4JI7L 2B2YC 1JORA 4JI2L 1TWCH 1I3QB 2D0PA 1ZKOA 2O4XA 2FMMA 5C4XH 4OX9Q 1DZ1A 2IY5B 3KJPA 4JBWA 2E2HH 2MJ8A 2RQXA 1EYAA 3PGZA 3EVQA 1EQQA 2VB2X 1QWYA 3M3YB 3SHLA 2KENA 2BA0A 3BVMA 1QUQB 3TZUA 1EWIA 1B9MA 2EOTA 1LYLA 1NSNS 2ZJPA 1CZWA 4R4IA 4LUVA 2QA4A 4LF6L 1D5MC 2CWPA 1FJGQ 2IT1A 2YTVA 2KCCA 4IO9A 1TT2A 3STBC 3NQTA 1B50A 1WTOA 1ZEQX 4K6DA 2F4VL 1Z7TA 4QMGA 3U58A 2PMZB 3GTMB 1BUVT 4KKUA 1EYGA 2ATWA 4BY7H 4Y52H 4IFDH 3PQIA 2GN5A 3D4DA 3HOVH 4B08A 3RR5A 3I55A 2NB0A 1ZYRC 5AJ3L 3L7ZC 5C4XG 4FXKC 1YI2A 2NVTB 4OWXB 3PSIA 3C46A 5FO7B 2FJ2A 2TSSA 2A1AA 2ZT9C 1J9OA 2Z1CA 2HCCA 3ULLA 3LX0A 4HJ8A 4ZKCB 4DAYA 5LHY1 2OQKA 5LMNQ 1KXLA 4PV1C 2Q2UA 1HZBA 4LF9Q 3DWQA 5C0XJ 3M85A 2JA6B 3HOUH 2RCNA 4LK1C 3C1EA 3H91A 1YVCA 1YJNA 4GKKL 4WJ3M 2K75A 4DR3L 2L0CA 3Q8DA 1KIXA 1GM5A 3I8ZA 4I7ZC 2ALYB 2MHVA 4C2MB 3GP7A 4IOAA 2PQAA 3MXPA 1PRTD 1F9PA 1CA5A 2RCFA 4MN3A 3F2UA 1XMQQ 5C44H 4BY7G 1Q1EA 2OEOA 2AWNA 4HEDA 5EQ0A 1N36Q 1LT6D 4IFDG 3CPFA 3HOVG 2B2VC 2WINB 4A3BH 3SK5A 2FFKB 4NMZA 4XDXA 1Q46A 1EU4A 4A76A 4DF7A 1R9TB 2UUCQ 3NWTA 2H5XA 4H44C 1JICA 1KQSA 4YWKA 4HSPA 5LL6S 1HNZQ 3SVMA 3HOZH 4N9TA 2I46A 3ULPA 4O2DA 1EIHA 2IJ0A 1V1OA 5E7NA 1SMXA 5D14A 1O78A 1VQGA 3K0YA 3MFYA 5JJZA 1YHQA 2PZWA 1STEA 3T56B 2F0MA 4NP5A 2I5LX 4RGOS 5JJLA 4GLVB 5C44G 4BA1I 4R8IA 2LS01 1S5CD 4JI5Q 4A3KH 4A3BG 5J3BA 1TWAB 1BBXC 2KOLA 5I2XA 3BVGA 4DV2Q 4O0AA 3KLSA 1FNVA 1WTVA 3KUPA 4GLXA 2VNUD 1OXXK 3HOZG 2NVXB 3NUCA 5CR3A 1O80A 4RAUC 1GUTA 4A3FB 2A74C 1STBA 3TSSA 2NVQB 3R2IA 1EYCA 3JAMi 4JCVE 3M4OB 2SOBA 4A3JB 3L3OC 1TWFB 3S9WA 2L1BA 2XNAC 4LF8L 1SNQA 4LFCL 4LW1A 5DEHA 2UU9L 4OXPA 4FXDA 1FVIA 3RLOA 1GUOA 4LF7L 2B39A 2A19A 1XPRA 1I94L 3BJUA 1WCMH 1SE3A 2VZAA 5IWAQ 4A93H 1EOVA 4H13C 4A3KG 3DMUA 3VYTA 2XRQD 3QOLA 2EY5A 5CBAE 5E1FA 1A6XA 3MFGA 1EFID 5GROA 5IYCH 2B63B 1SE8A 3GTKH 2K33A 4RFBA 4AH6A 3MEFA 3RN5A 2IWHA 2WV6D 5C4ZA 2MUYA 1PXUA 5IT9E 1PH5A 1BNZA 1IYJB 2EYLA 2SNSA 1W6JA 3EJIA 5C0XH 2K32A 2EIFA 5HY6A 2R7ZB 2AWOA 4L5SA 4MIUA 3M4QA 1JJ2A 3FKIB 3PV0A 3HZXA 4KN4C 3TP8A 1L0XB 3FPUB 5DNFA 4V0BA 2RDHA 4TSSA 4XT1B 4K0KQ 1A63A 4G4KA 4UDUC 3GTQB 1AFPA 1L1OC 3KF6A 5C3EH 1G8ZD 3K5OA 1VQDA 1ET9A 1WCMG 1XXGA 4QL5A 1RD9D 1I6VC 4DK6C 4GNXC 4JI3Q 2O2LD 4A93G 1IBLL 1IW7D 4APVA 1Y1WH 1NR4A 2VQEL 3HKZG 3KF8B 1F2LA 1MBYA 1IYUA 3AYHB 3OWEB 5GAEC 1QVGA 4LNQA 2F0EA 5IYCG 1S40A 2E2JB 3ZJYC 3STBD 4LFBL 3DHQA 5LMUL 1BCPC 1EWCA 4DUYQ 2EJMA 3QJYA 4J1MA 2HIVA 5C0XG 3HOUB 1VQ7A 3M9BA 3KJOA 1ZYRD 3CF5A 1X65A 5E3FA 1A62A 3NK9A 4RMFA 3UE1A 4IFDI 3I4OA 3PMFA 1F2YA 5EBCA 2CHBD 2MGSA 1VQ8A 3F2BA 3ITPA 1AH9A 2K52A 1YHAA 1LTID 1NR2A 5C3EG 5BR8Q 5IGDA 5C44B 2PZTA 2F0GA 3K59A 3U4VA 4OL7A 2WB1B 2ID0A 2EZVA 1LV9A 1Y1WG 1D1IA 3F2DA 1KABA 5L37A 4X3UA 1SNMA 1D6EC 1LT4D 4DGZA 4DR1Q 4ZK9B 2JA5H 2BA1A 1I4QA 2KHJA 3GQBA 5FO8B 3CD6A 5IP7H 4P71A 3R3OA 1O7IA 3S2DH 4YCWA 5IYBH 1WTXA 4FO2A 3A8IE 1SNCA 1LTBD 1SAPA 4ZQ3A 1EQVA 3I4NB 3W2DA 4BA2I 2EYJA 3FMCA 3VA5A 1WI5A 1CKNB 4X66Q 1EY9A 2ENBA 3J80E 3S2HH 1OXSC 2XTIA 2Q2TA 2J4XA 1WOCA 1IL2A 4EX5A 3D8GA 1B7YB 1SJED 4YCVA 4DV5Q 4HJ7A 3QG1A 1VDZA 2K5WA 5LMNL 3MA2B 2RBMA 2ZTCA 4A3KB 4LF9L 1SYFA 3J81L 1QE6A 4QUFA 4B3SQ 2NZHA 2E5LQ 2HQLA 2JA5G 4DV0Q 2K14A 3S16B 1PFSA 5IP7G 3K5LA 1HJPA 2AQ2B 2K01A 4RWSC 1S4ZA 1SEBD 5IYBG 2DUDA 1XMQL 4CKBA 4CBVA 1E22A 3AMUA 4UAIA 4QCLA 4RCNA 5ISRA 2WAQE 5CYUA 4XIGS 5J22A 3H3VC 2UUCL 1G2SA 1EY8A 1KRSA 2F1MA 1GOZA 4HJ9A 1HNZL 4DFAA 3IRBA 4HTHA 4JW0A 1HZAA 3GDEA 1G91A 3KOJA 4A93B 4PMCA 1K8GA 2I5HA 5EKIA 1VF5C 2F4IA 2HIXA 3CU7A 4JG2A 1G6ZA 1X32A 1PYSB 1B3QA 4PNYA 3I3CA 1A3TA 1EY4A 1FGUA 4DAPA 5C6AA 4DV6Q 2BOSA 1EIYB 2IHFA 5IOCA 4YWMA 1U0LA 2CWAA 4QIWB 2QDBA 1FD7D 3H15A 4X6AH 3T4AC 3J7AF 1HR0W 3SGIA 4NW2A 2GVAA 3EN2A 3I56A 1Z6HA 1MSHA 4FDBA 1PH1A 4L5RC 1SDFA 4LMQD 4JI5L 4OO1H 2N55A 3NE5B 2CH4A 2HDMA 1DD2A 2F0SA 2LKVA 4DV2L 2EYMA 3T51B 2B2WC 1YJWA 4K2KA 3K5NA 2XVSA 2IPKD 4HJ5A 2L15A 3C3LA 5CMDA 4FP5D 5C3EB 4C3HH 3K81C 2FINB 5CV5A 4FF3A 1KLGD 1Y1WB 1KDBA 2PI2A 3AU7A 3P7JA 1E1OA 4XYQA 5CV4A 1TU2B 5C0XI 4DV1Q 1VQIA 5CV6A 2F0NA 1TWHB 4AYBB 1PH2A 1S5FD 4QUCA 5HGTA 3OW7A 1N34Q 1JOOA 5IWAL 5ELFA 3GV6A 3I4MH 2A69C 3U50C 4OO1G 1SYCA 2F0LA 5T1IA 1QUQA 2KEEA 2J0TD 2KVMA 3W1BA 1GUWA 2L5TA 4HIKA 3WOFA 1BCPD 4CHTB 1L0YB 3QB3A 2N88A 2O5JC 4J8QA 1PZJD 4RH6A 1A8VA 2B2TA 4G7OC 1EQRA 3UDGA 1CA6A 2AQ3B 3VR3A 4C3HG 1LO5D 2NYZD 4DXGA 3TP7A 3CMEA 5FKAC 3DWAA 4HCEA 4A3LH 1KAAA 1UWVA 3NENA 1SJHD 3AB9A 1PRTF 2OQ0A 2PZUA 5GADC 1HUMA 1YIJA 2JA5B 1KAWA 5M3FH 4XQNA 4DAVA 4MTNA 5KYLA 5C3XA 4K0KL 4OHJA 2P5ZX 3NELA 2PPBC 4DR7Q 5IYDH 4KN7C 1X3FA 3MWYW 2PO4A 3F8TA 4JI3L 1XYIA 4KTAA 1J6QA 1PRTB 2EYPA 3I4MG 3GD7A 3P1HA 3T1YQ 5IODA 1K83H 1HQRD 1PYWD 2F3WA 4C3JH 2V4DA 3HOWH 1SSOA 4GZYC 1S5ED 3CCMA 4Q0FA 2Z6BA 1EY7A 4DUYL 1GJXA 1SYGA 5I9PA 4K8JA 3RNUA 4HSVA 3PUVA 1NJIC 3S1RH 1T5EA 1VQ5A 2UXDQ 2H1EA 3S17H 2Q2HA 1S5BD 1UE7A 1K3BC 3V96A 1QB5D 5M3FG 4DNRB 3EQLC 1PTOC 1JMCA 4TVAB 4MTKA 4QGUA 1NMFA 2KCMA 1IBMQ 1ESRA 5BR8L 1JE5A 5M3MH 3F2CA 4Z9CB 3PUZA 1A3VA 2CH4W 1VQLA 4EQOA 1UAPA 3LGJA 3KBXA 4RG1A 3UDXA 3J81i 3EA6A 4BBRH 4DR1L 1Y69U 3U9SA 4C3JG 1CQFA 1UE6A 4CDDC 2JN4A 3HOWG 4L63B 4GOPB 1EUJA 3RN2A 1YNJC 1IBKQ 1KDAA 1H9MA 2LY7A 3BU2A 4DV3Q 3HOYH 2F0TA 1MIUA 4A4IA 3LNNA 5IGCA 3RD4A 5ELEA 1LTLA 4WRDA 2UXBQ 1HTLD 2ZXOA 1MJEA 1E0BA 4EGVA 2F3VA 3HG9A 1QILA 4B3RL 4KD3A 4BWGB 4X66L 5M5YB 4FYDA 5M3MG 4QY7A 4DV5L 2RVLA 4CJ0B 3BZKA 3D4RA 2L11A 4A3GH 2OTJA 5KIXA 1VQOA 3CMAA 2K05A 1B3AA 1K0SA 2JYOA 3UDFA 4A3IH 1RHPA 4BBRG 4Y7NH 2E5LL 3D6WA 2ZM6Q 4B3SL 2BDOA 1KLUD 5ELDA 4DV0L 1CT1D 1ICWA 1NNXA 2QKIC 4JBJA 4B3TQ 1G6PA 1UE5A 1TVXA 4C3HB 4OONA 5KYIA 4OWTB 3HOYG 2QDLA 4NXMQ 4FNFA 2Z9HA 1O7YA 2GA4B 3C1FA 1YJ9A 1TXYA 3VR4A 4DR5Q 1WFQA 1CUKA 5C4JH 4QF4A 2JA7H 3GTLH 2A8VA 3CC4A 4LUZA 4XTCS 5KGUA 4X3KA 4OO1I 1YZ6A 4K14A 2WKCA 4OIKA 4UPAA 1WTRA 2X6LA 3S1MH 2F03A 2Z8LA 4A3GG 3CCRA 1X54A 3I70A 4A3IG 1AZPA 2HD3A 3Q0AA 1WVLA 4DXFA 4CKCA 4CDEC 2LXKA 3FP9A 1QVFA 4JBKA 1I50H 3MXGA 5ELCA 1HFGA 3A8KE 4M1UB 3I72A 4X3TA 4N8X1 3SK8A 3GTOH 3HRZC 3VR5A 4GN5A 2A69D 1BR9A 3N6RA 2RSOA 4IUPA 4DK1A 1TWGB 4P73A 4IJHA 2JA7G 1V9PA 3KF8A 2F0QA 4A3CG 4DUZQ 5EBDA 3HFZB 2RKSA 1FNWA 1ML0D 1G2TA 4B3MQ 1VQ4A 1PV4A 4C3IH 5JVH3 3M7NA 2FHTA 4POFA 4MZ9A 2DN8A 3FRPB 1LTGD 4C3JB 4DV1L 4JI6Q 4YHHQ 2IHEA 1GHKA 4RCOA 1MGSA 2JA8H 1NBWA 2NVYH 1OO9B 2JEAI 3EROA 5IT9L 1Q3LA 2A73B 2EXZA 3BZCA 1N34L 3S1RB 2CW0C 1VQ9A 3E9HA 1NE3A 2R92B 1SMYC 3U9OA 4BBSH 2YU9B 1K8MA 5FK9C 1KC8C 1YNND 2NTSA 4OEMB 2UXCQ 2GVBA 1NY4A 4B9XA 4BXXH 1VQKA 1V43A 4M8AA 1HR0Q 4A3DH 2PYKA 4ULLA 4C1NK 1A2TA 1WJJA 1LTRD 3RZOH 3W3AA 4JOIA 1JJCB 3KYHC 3R93A 1X3EA 4C3IG 3H94A 1CHPD 2PCFB 5IT9c 4UHVA 1V8QA 2QGQA 1CK1A 3NTKA 2WAQG 1HRJA 3TBIB 3M4YA 3H09A 2MQHA 1CKNA 1KD1C 5EKLA 3CQZH 3I90A 4AQYQ 1K8OA 4BY1H 4YY3Q 3G48A 2JA8G 1HXYD 1VQAA 4LF5Q 1C7YA 2DJGC 2XWJB 3W5OA 4DR7L 2F0PA 5COYA 1QZHA 4RGMA 4CDCC 1SYDA 5C4HA 2EY2A 5JJKA 4BBSG 4QQBX 3E3XA 4EQPA 3I4LA 1A2UA 2BE5C 3T1YL 2MFIA 4YIJA 2R7FA 4BXXG 1TWCB 4KHVA 2F3IA 4KLKA 4H02A 3VDYA 3OPOA 4A3DG 1YNJD 5CV8A 5C4XB 1CI3M 4IPCA 3ER0A 4A3EH 2E2HB 3D4WA 2KBNA 1HTPA 3VA7A 5EJWA 4A3GB 4XQJA 1K0RA 3A74A 2VB3X 4KY7A 3CCJA 1Q82C 3S15H 1KRTA 1GO3E 2UXDL 4A3IB 1MKHA 1SE2A 3PO3H 1GHJA 1GUNA 3V2TA 4BY1G 1F9SA 1R4QB 3H3VH 1PFNA 1IBML 1I4PA 3NBHB 3HGBA 2N78A 1M1KC 3MXUA 2WACA 3PF4A 2K04A 4UP7A 5IGEA 1JWUD 3FEWX 5CORA 1LT3D 5F2DA 5IP9H 1AP0A 1CSQA 3S14H 1JC7A 2A68C 2D9UA 3PUXA 1EL0A 3TMEA 4IUTA 3RZDH 2KCNA 3HOVB 1H9SB 3CCUA 3J80L 2Z6KA 3PCOB 1SLJA 3FPPA 4F88A 3GTGH 3OHXC 4EQNA 4A3EG 3WWVA 1IBKL 3BYYB 2D62A 3BZDB 4DV3L 4IOCA 1PZKD 2EJFC 2EQSA 1ILQA 1VQJA 2UXBL 1AE3A 3PO3G 1V1QA 1XJVA 4EVOA 1DCZA 3G7LA 4DR4Q 1E2WA 1G291 4KHPQ 3J80c 4LF4Q 1NTGA 1I50B 3RLFA 1WTWA 1Q7YC 4OX9L 3PIPA 3EFXD 3L2PA 1PZID 1TS2A 2R93H 2KUMA 1L1OB 3G6EA 1OXTA 3KLRA 5IP9G 1BCPF 4BY7B 1KHIA 1P8LA 5BN3A 2G9HD 1Y1VH 3OIQA 2J7ZA 1XMOQ 3DEPA 3DM3A 1QCBD 3MXNB 2ZM6L 4A3BB 1STAA 3E9IA 1AE2A 1VS0A 5JEAJ 4B3TL 1FJGL 4HIOA 2AUKA 3KK7A 1S5DD 1BCPB 2KHIA 3H6MA 1YBYA 1UEAB 3I73A 4KMUC 3A54A 5JPNC 4NXML 3HOZB 4DK3C 1I4RA 3CXCA 3ERQA 4DR5L 1RL2A 5G3LD 4C56C 2OXPA 3VR6A 4A75A 2WP8J 3PO2H 1GKHA 3K5MA 2ES2A 2Q2IA 2A6HC 3L0OA 2OTLA 4DV7Q 2JA8B 2NVYB 1HH2P 2F0VA 3PUYA 3KFUA 2R93G 3BG3A 2ZTEA 3HKSA 4K5XA 3ICEA 2CFMA 5EGTA 1ASZA 2RF4A 1Y1VG 3FVQA 3QR8A 1PFBA 4ID6A 1VQBA 4IALA 3HOXH 2I07B 4U673 1EIGA 1JB3A 2C35B 4UY8C 1B9NA 3RZOB 2DY7A 3K7UC 2YYZA 1D8LA 3UDIA 5ELNA 2JXMB 1GUSA 2CW0D 3K8AA 4NB3A 4A3MH 1YITA 1I6HH 2MP1A 4JK1C 4MNOA 3FHWA 3M7GA 5J39A 1D2BA 1N36L 3PO2G 4R4TA 2E74C 4F7XA 3KLWA 2WB1E 3F1ZA 4DUZL 2RHSB 3HEJA 2E76C 5JOBA 5J1ZA 1O7LA 3DEOA 2XWBB 4PMWA 2QEXA 1LUZA 4JC0A 4B3ML 1W6KA 1K28A 2X6GA 3TDQA 2V1CC 3K6OA 3CW2C 1W3SA 1WCMB 1GXDC 4XXEA 2OWOA 2F4VQ 5GAGC 5CC4A 1DXMA 1WD1A 2K5QA 1XPUA 3NWSA 4LAAA 3HKZB 3HOXG 4KI0A 1SYBA 2L55A 3A7AB 2F0IA 4JI6L 4YHHL 4DN4M 3Q6SA 5M5XH 2A6EC 2K1BA 4KKSA 3GTKB 2ZJRA 1PTOH 2VW9A 1K3RA 4A3MG 2NZOA 5TSSA 2BE5D 1TQOA 3MAQA 5EKKA 2UXCL 3GTPH 2KCTA 1KNEA 5A2QE 3OTOQ 4IURA 1CM9A 1XTCD 1HR0L 4IN3A 4JI0Q 1EU3A 4GOPA 1B70B 2NBFA 1I3QH 1IZ6A 1D7QA 1LT5D 1XTDA 4AIMA 3SEBA 1SXTA 1K9MC 4LJZC 5D3IB 1Y8OB 3D31A 1PLFA 1XPOA 1TIID 1UE1A 3BDLA 1JT8A 3GTGB 1I4HA 4AQYL 3CHBD 1T9HA 4YY3L 3GTJH 4HAEA 3PUWA 4LF5L 1TY2A 3WOEA 2LXJA 3H3VI 4R4CA 4HMJA 2A68D 3OYYA 2UUBQ 2ZTDA 3NXWA 3Q22A 4J6HA 4ZLTF 3T13A 4JYAQ 3E5SA 1WTPA 4RGNA 3GTMH 1OXVA 1JCKB 3IKJA 4JI8Q 2QEJC 4HIMA 1BDOA 2JP1A 4LUOA 3J80i 3BDOA 1BQQT 3MVVA 4J15A 1HUNA 1FGBD 3G4SA 4KD4A 2B29A 2K03A 5DM73 2NVTH 1MJCA 2DNEA 3OOCA 4QIWE 4ZUJA 1TR5A 2FXQA 2EE1A 2B2YA 2PNRC 5HGQA 5JPMC 2JA6H 4NPSA 4OGQC 1HPCA 1KDCA 1VCIA 4GS3A 2DJFC 2OT2A 3IL8A 2CVRA 1PH4A 4C2MH 5JAVA 4P74A 3S2DB 3G71A 1N33Q 1I4XA 4I65A 2D0OA 4IFDJ 1E2ZA 2TMPA 5IGGA 2B2UA 1DOLA 3S24A 3S2HB 2EJGC 2EXDA 1R9TH 4P2CB 1TS4A 2UU9Q 3JC66 3P75A 2JE6I 4KV6A 4AYBE 3CCEA 3KDFA 1WTQA 1U4MA 2IW3A 2KHSA 2JSOA 5FLXc 3RLNA 1U4PA 4DU9A 1M90C 3K7AH 2A6HD 1D5ZC 4OIJA 5D65A 3HOXB 1SBBB 2K5VA 4BS9A 2JA6G 1STYA 4DR4L 4KHPL 4R4QA 4LF4L 3AQQA 1PH7A 3A0JA 2M9VA 2Z4HA 1VQHA 3EBEA 5I2YA 1I6HB 2NWGA 1EY6A 2LMCB 1HA6A 2JQOA 3BYTB 1C48A 2ZXPA 1N32Q 4H0LC 1ILPA 4DKAC 2F0DA 1B8AA 3A56A 1XMOL 4I7AA 2AMCB 4PZ8A 1CHQD 2NTTA 2WIIB 4CKEA 4KKTA 1J5EQ 4R1JA 1SNDA 4JI1Q 1KL9A 1RTOA 1W2BA 1TWAH 2E2IH 1HCZA 5M9OA 2I0QA 2RDFA 2QW7A 2FMCA 1CKOA 3A8JE 1PH6A 2N3SA 2DY8A 3H0GH 2Z0SA 2K5NA 2MO1A 1HNXQ 1O7ZA 1IBLQ 4HJAA 1D5XC 4A3FH 2XIWA 4QB4A 5FLXE 2ASBA 2RHQB 1H9KA 2B2VA 1TS3A 2PNHA 2NVQH 3JAMc 4JBMA 2VQEQ 1TY0A 3L9AX 2R6GA 4OELB 3M4OH 4A3JH 1TWFH 1H95A 5LMUQ 4ODGA 2B2TC 3TEHB 2IX3A 1XWEA
chains in the Genus database with same CATH topology
4K8IA 2WKDA 3GTPB 1ENCA 1DOKA 2A6ED 5CGKA 1Q1BA 4V190 2NN6H 4DA2A 2E75C 5I6YA 1NCVA 5EPLA 1T5XD 3RMHA 3IFDA 3P20A 5EPJA 3VYRA 3BS1A 3NPPA 3GTJB 1RDPD 1IW7C 1JE4A 2BCOA 3JAME 2B2UC 1RJTA 3ZYYX 3CRKC 3NSWA 2Q8RE 5KNCA 1H9RA 2Z4IA 4PQXA 3KBGA 4O1NA 3I4MB 4O42A 2CQAA 3ONAB 1B4OA 4C1NI 4K6LA 2OF1A 2AUJD 2NN6G 1EEFD 4ZKBB 2KA7A 1QJOA 4F8MA 3NBHA 1SNOA 4FF4A 1F9RA 3SE0A 5C5LA 1J8IA 2NZ1D 1H9SA 5IGBA 5M3FB 1RF2D 3OWFA 1C8CA 4K2LA 1CZGA 2LFNA 1HA5A 1M8AA 5BN5A 2B8FA 2X69A 4N9PA 2EYOA 3TN2A 1ENAA 4H7BA 1STNA 1V1PB 3GV3A 1ZXTA 4TKOB 3RUZA 1RCVD 1K83B 4TRDA 4X3SA 2NUCA 1VF7A 5D3DA 3HOWB 5G3LF 2MPMA 5CBEE 1U4LA 3Q23A 3ND9A 2A5HA 5CV9A 1NAPA 2F0OA 1CTMA 3J7AV 4K5VA 1FNUA 1PFMA 4ZUIA 3K7AB 3HS0C 4WFN3 3S17B 1QG7A 3MXNA 2F0KA 2RA4A 3MC0B 2SEBD 4FF1A 1HHVA 2XN9C 2IX1A 1RODA 4XQQA 5M3MB 2O5IC 2K6AA 5DM63 4DK0A 1F2MA 1DOMA 4BBRB 5K5PA 4IZ8A 1PTOD 4CGYB 2E2IB 2G9DA 2XRSD 4ILWA 1IKLA 3R8BA 3TZDA 2RDGA 2C9OA 3HOYB 5NUCA 3H0GB 4ZAIA 1DJRD 2K28A 3MTSA 3OMGA 5DAUA 3K58A 1ET6A 4ME5A 1EZ8A 1UNSA 2HUGA 1D1KA 5JVG3 1Q90A 4Y7NB 1U4RA 1F9QA 2KQ3A 3J7YW 2ICIA 5IGFA 3V05A 3VYSA 2C5CA 5KNDA 3A7LA 1MD2D 2AQ1B 2EY1A 5C4JB 3OMCA 1QOHA 3GTLB 2JA7B 2F0JA 4KY6A 5BN4A 2XSCA 4KK7A 1IKMA 1BOSA 5K36H 5T1GA 2NN6I 4G57A 3S1MB 5FO9B 1DYQA 5FOBB 5IIFA 1AW7A 3SK4A 1BF4A 2B8GA 1OXUA 3TP5A 3LWUA 2PW5A 1Z47A 3X3MA 3Q24A 2SNMA 5KNBA 2H4OA 2DNCA 3GTOB 2SDFA 3VR2A 1ENFA 1Y8PB 1AN8A 1XWEA 3KLSX 2BDNA 2F0WA 4KY5A 3DXJC 3CRLC 2KJXA 4IUVA 2QILA 2VXWA 1UUPA 3PIP3 5KEEA 4Q5VA 4KJOA 5K36G 4FF2A 5KRUA 4C3IB 2F0FA 4L8JA 4F87A 1EY0A 1HFNA 2IL8A 2IX0A 3OSOA 4ZRZA 3WDNA 2WAQB 4FVMA 1EOTA 1STHA 2EPBA 1SE4A 2Q8TA 1VMPA 1KNAA 1IYVA 1ESFA 2B2WA 1JWMD 3SDZA 3C2PA 1U9RA 1JR0D 3PIO3 1Q12A 1JQYD 1MSGA 4RHSA 4BBSB 3UI2A 1SYEA 5A35A 5A2QL 3NTIA 3NTHA 3GO5A 4A3DB 3DUZA 3ND8A 1SFOB 3FDTA 1AEXA 1RKNA 1CFMA 1SMYD 4HMIA 2RSNA 1JOQA 1LLRD 3QWNA 1C4QA 1EZ6A 3G6JB 4HN7A 5HURA 3K57A 1XX8A 3I91A 5E4XA 3A55A 2K5DA 3CQZB 4BY1B 2EYFA 3R2TA 3QOJA 2JEBI 2L9HA 4KHZA 3DM1A 4RKBA 3O13A 4CJ2C 4HCSA 4XYOA 2R61A 4A3EB 3IFTA 1BXTA 3D3RA 4RA8A 2KEDA 1STGA 2HCIA 3S15B 4RKLA 3E0JA 1H9JA 3SR1A 3HP3A 4ABNA 3PO3B 4RHRA 1GUGA 3VYUA 2D5DA 4WORA 1BO0A 1EYDA 5CV7A 3QO2A 4CJ1B 4MHEA 2PQEA 4PMBA 4S3SA 1NUCA 4DNTB 1F77A 3S14B 2EDGA 3IAYA 3X3NA 1FYCA 3RZDB 1JWSD 3URYA 5I9OA 1F2ZA 2HQEA 5JEAH 1II3A 1IL8A 3J81E 3NP8A 3NQIA 3T53B 3S1QB 3SXHA 2EVBA 5ELBA 1B2TA 1E2VA 3BVZA 2Q8IB 3MHBA 1R4PB 4ZYSA 4IUNA 5EPKA 1CQVA 2R93B 2F0UA 1AZQA 4L6TB 2QCPX 4NKLA 1Y1VB 3QIAA 1PRTC 4HR7B 4TQUS 1WD0A 4IUUA 2D2CC 5JEAG 2E2DC 1EWHA 1EY5A 2K7VA 5LL6X 2L12A 1I4GA 4IUQA 3NBIA 3OIPA 1B1ZA 4G7HC 5FLXL 1EEID 2ZXRA 1TS5A 1TKWB 3PO2B 1M4VA 1DM0B 4R9WA 3N52A 5M5WB 4K5WA 1QNKA 1SNPA 4U68A 5C5MA 1X3QA 5I4DA 2M2LA 1LTAD 4R8NA 4XT3B 4G7ZC 4RGTA 2KECA 4WJWA 2R3ZA 1QNUA 3TP6A 3BDCA 1LACA 4KJNA 2PW7A 1MI2A 1YNNC 4B9WA 3LWEA 2M00A 1Q8IA 3MZ5A 4A3MB 2QF7A 1V1PA 5I6WA 1IHZA 1RTNA 3MEHA 2F0HA 3T16A 1HQMC 5E4WC 2HDLA 3JAML 1PMRA 5C3WA 1A15A 3DWPA 5AFWA 1JOKA 1FR3A 3CKIB 2L4NA 4FXGC 3S1NB 4IQZA 1PTOF 1Y8NB 1ONLA 3SK6A 2VUMB 1B44D 1B53A 1LTSD 1DONA 1LTTD 2EYHA 1LABA 1VMCA 1EQTA 5M5XB 1PDQA 1X3PA 2ICEC 1PTOB 2EY6A 2Y0SB 1KTKA 3D6CA 3E6ZX 3NHHA 4NDXA 1A3UA 4E6IA 2B2YC 1JORA 1I3QB 1ZKOA 2O4XA 2FMMA 1DZ1A 4JBWA 2MJ8A 2RQXA 1EYAA 3EVQA 2VB2X 1QWYA 3M3YB 3SHLA 2BA0A 3BVMA 3TZUA 1B9MA 2EOTA 1NSNS 1CZWA 1D5MC 2IT1A 2KCCA 1TT2A 3NQTA 1B50A 1WTOA 1ZEQX 4K6DA 1Z7TA 4QMGA 2PMZB 3GTMB 1BUVT 4KKUA 4IFDH 3D4DA 4B08A 2NB0A 1ZYRC 3L7ZC 4FXKC 2NVTB 3C46A 5FO7B 2FJ2A 2TSSA 2ZT9C 1J9OA 2Z1CA 2HCCA 3LX0A 4ZKCB 4DAYA 5LHY1 4PV1C 3DWQA 5C0XJ 3M85A 2JA6B 4LK1C 3C1EA 3H91A 2L0CA 3I8ZA 4I7ZC 2MHVA 4C2MB 3GP7A 3MXPA 1PRTD 1F9PA 1CA5A 4MN3A 3F2UA 1Q1EA 2OEOA 2AWNA 4HEDA 5EQ0A 4IFDG 1LT6D 2B2VC 2WINB 3SK5A 2FFKB 4NMZA 4XDXA 1EU4A 4DF7A 1R9TB 3NWTA 4H44C 1JICA 4HSPA 5LL6S 3SVMA 4N9TA 2I46A 1EIHA 2IJ0A 1V1OA 5D14A 1O78A 3K0YA 3MFYA 5JJZA 2PZWA 1STEA 3T56B 2F0MA 4NP5A 4RGOS 4BA1I 4R8IA 2LS01 1S5CD 1TWAB 1BBXC 2KOLA 5I2XA 3BVGA 3KLSA 1FNVA 1WTVA 3KUPA 2VNUD 1OXXK 2NVXB 3NUCA 5CR3A 1O80A 4RAUC 1GUTA 4A3FB 2A74C 1STBA 3TSSA 2NVQB 3R2IA 1EYCA 3M4OB 2SOBA 4A3JB 3L3OC 1TWFB 3S9WA 2L1BA 2XNAC 1SNQA 5DEHA 4FXDA 1GUOA 2B39A 1SE3A 4H13C 3DMUA 3VYTA 2XRQD 3QOLA 2EY5A 5CBAE 5E1FA 1A6XA 3MFGA 1EFID 2B63B 2K33A 4RFBA 2IWHA 2WV6D 5C4ZA 2MUYA 1PXUA 5IT9E 1BNZA 2EYLA 2SNSA 1W6JA 3EJIA 5C0XH 2K32A 2R7ZB 2AWOA 4MIUA 3FKIB 3PV0A 3HZXA 4KN4C 3TP8A 1L0XB 3FPUB 5DNFA 4V0BA 4XT1B 2RDHA 4TSSA 4G4KA 4UDUC 3GTQB 1AFPA 1G8ZD 3K5OA 4BY7B 1ET9A 1XXGA 1RD9D 1I6VC 2O2LD 1IW7D 1NR4A 1F2LA 1MBYA 1IYUA 3OWEB 2F0EA 2E2JB 3DHQA 1BCPC 1EWCA 2EJMA 3QJYA 4J1MA 5C0XG 3HOUB 1ZYRD 5E3FA 3NK9A 4IFDI 3PMFA 1F2YA 5EBCA 2CHBD 2MGSA 3ITPA 1LTID 1NR2A 5IGDA 5C44B 2PZTA 2F0GA 3K59A 4OL7A 2WB1B 2ID0A 2EZVA 1LV9A 1D1IA 1KABA 4X3UA 1SNMA 1D6EC 1LT4D 4DGZA 4ZK9B 2BA1A 1I4QA 3GQBA 5FO8B 3R3OA 1WTXA 4FO2A 3A8IE 1SNCA 1LTBD 1SAPA 4ZQ3A 1EQVA 3I4NB 3W2DA 4BA2I 2EYJA 3FMCA 3VA5A 1EY9A 2ENBA 3J80E 1OXSC 2J4XA 3D8GA 1SJED 3QG1A 1VDZA 2K5WA 3MA2B 2RBMA 4A3KB 1SYFA 3J81L 1QE6A 4QUFA 3S16B 3K5LA 2AQ2B 2K01A 4RWSC 1S4ZA 1SEBD 4CKBA 4CBVA 3AMUA 4UAIA 4QCLA 4RCNA 5ISRA 5CYUA 4XIGS 5J22A 3H3VC 1G2SA 1EY8A 2F1MA 1GOZA 4DFAA 4HTHA 1G91A 4A93B 4PMCA 5EKIA 1VF5C 2F4IA 3CU7A 1G6ZA 1X32A 4PNYA 3I3CA 1A3TA 1EY4A 4DAPA 5C6AA 2BOSA 5IOCA 4QIWB 2QDBA 1FD7D 3T4AC 3J7AF 4NW2A 1Z6HA 1MSHA 1SDFA 4LMQD 4OO1H 2N55A 3NE5B 2HDMA 1DD2A 2F0SA 2LKVA 2EYMA 3T51B 2B2WC 4K2KA 3K5NA 2XVSA 2IPKD 3C3LA 5CMDA 4FP5D 5C3EB 2FINB 5CV5A 4FF3A 1KLGD 1Y1WB 1KDBA 3AU7A 3P7JA 4XYQA 5CV4A 1TU2B 5C0XI 5CV6A 2F0NA 1TWHB 4AYBB 1S5FD 4QUCA 5HGTA 3OW7A 1JOOA 3GV6A 2A69C 4OO1G 1SYCA 2F0LA 5T1IA 2KEEA 2KVMA 2J0TD 1GUWA 2L5TA 3WOFA 1BCPD 4CHTB 1L0YB 3QB3A 2N88A 2O5JC 4J8QA 1PZJD 4RH6A 2B2TA 4G7OC 1CA6A 2AQ3B 3VR3A 4C3HG 1LO5D 2NYZD 4DXGA 3TP7A 5FKAC 3DWAA 4HCEA 1KAAA 1SJHD 3AB9A 1PRTF 2PZUA 1HUMA 2JA5B 4XQNA 4DAVA 5KYLA 5C3XA 4OHJA 2PPBC 4KN7C 3MWYW 2PO4A 1XYIA 4KTAA 1PRTB 2EYPA 3GD7A 3P1HA 5IODA 1HQRD 1PYWD 2F3WA 2V4DA 1SSOA 4GZYC 1S5ED 4Q0FA 1EY7A 1GJXA 1SYGA 5I9PA 4K8JA 4HSVA 3PUVA 1T5EA 2H1EA 1S5BD 3V96A 1QB5D 4DNRB 3EQLC 1PTOC 1ESRA 4Z9CB 3PUZA 1A3VA 4EQOA 1UAPA 3KBXA 3EA6A 1Y69U 3U9SA 4C3JG 1CQFA 4L63B 1YNJC 1KDAA 1H9MA 2LY7A 2F0TA 3LNNA 5IGCA 3RD4A 5ELEA 4WRDA 1HTLD 2ZXOA 1E0BA 4EGVA 2F3VA 3HG9A 1QILA 4KD3A 4BWGB 5M5YB 4FYDA 2RVLA 4CJ0B 3D4RA 2L11A 5KIXA 2K05A 1B3AA 2JYOA 1RHPA 3D6WA 2BDOA 1KLUD 5ELDA 1CT1D 1ICWA 2QKIC 4C3HB 1TVXA 5KYIA 4FNFA 1O7YA 2GA4B 3C1FA 3VR4A 4QF4A 4XTCS 5KGUA 4X3KA 4OO1I 4K14A 2WKCA 4OIKA 1WTRA 2X6LA 2F03A 2Z8LA 3I70A 1AZPA 3Q0AA 1WVLA 4DXFA 4CKCA 3MXGA 5ELCA 1HFGA 3A8KE 4M1UB 3I72A 4X3TA 3SK8A 3HRZC 3VR5A 2A69D 1BR9A 3N6RA 2RSOA 4IUPA 4DK1A 1TWGB 3KF8A 2F0QA 5EBDA 2RKSA 1FNWA 1ML0D 1G2TA 5JVH3 3M7NA 2FHTA 2DN8A 3FRPB 1LTGD 4C3JB 1GHKA 4RCOA 1MGSA 1OO9B 2JEAI 3EROA 5IT9L 1Q3LA 2A73B 2EXZA 3S1RB 2CW0C 2R92B 1SMYC 3U9OA 2YU9B 1K8MA 5FK9C 1YNND 2NTSA 4B9XA 1V43A 4M8AA 2PYKA 4ULLA 4C1NK 1A2TA 1LTRD 3W3AA 3R93A 4C3IG 3H94A 1CHPD 2PCFB 1V8QA 1CK1A 3NTKA 1HRJA 3TBIB 3M4YA 3H09A 5EKLA 3I90A 1K8OA 1HXYD 2XWJB 2F0PA 5COYA 4RGMA 1SYDA 5C4HA 2EY2A 4EQPA 3I4LA 1A2UA 2BE5C 4YIJA 1TWCB 4KHVA 3OPOA 1YNJD 5CV8A 5C4XB 1CI3M 2E2HB 3D4WA 3VA7A 1HTPA 5EJWA 4A3GB 4XQJA 2VB3X 4KY7A 4A3IB 1SE2A 1GHJA 1GUNA 3V2TA 1F9SA 1R4QB 1PFNA 1I4PA 3HGBA 3MXUA 2WACA 2K04A 5IGEA 1JWUD 3FEWX 5CORA 1LT3D 5F2DA 1AP0A 1JC7A 2A68C 2D9UA 3PUXA 1EL0A 3TMEA 4IUTA 3HOVB 2KCNA 1H9SB 3J80L 3FPPA 4F88A 3OHXC 4EQNA 3BYYB 2D62A 3BZDB 1PZKD 2EJFC 1ILQA 4EVOA 1DCZA 3G7LA 1E2WA 1G291 1I50B 3RLFA 1WTWA 3EFXD 1PZID 1TS2A 2KUMA 1OXTA 3KLRA 1BCPF 5BN3A 2G9HD 3OIQA 2J7ZA 3DEPA 1QCBD 4A3BB 1STAA 5JEAJ 2AUKA 3KK7A 1S5DD 1BCPB 3H6MA 1UEAB 3I73A 4KMUC 3A54A 5JPNC 3HOZB 1I4RA 3ERQA 5G3LD 4C56C 2OXPA 3VR6A 2WP8J 3K5MA 2A6HC 2JA8B 2NVYB 2F0VA 3PUYA 3BG3A 4K5XA 5EGTA 3FVQA 1PFBA 4ID6A 4IALA 2I07B 4U673 1EIGA 1JB3A 1B9NA 3RZOB 2DY7A 2YYZA 2JXMB 1GUSA 2CW0D 2MP1A 4JK1C 3M7GA 5J39A 1D2BA 2E74C 4F7XA 3HEJA 2E76C 5JOBA 5J1ZA 1O7LA 3DEOA 2XWBB 4PMWA 1W6KA 2X6GA 3TDQA 3K6OA 1WCMB 1GXDC 4XXEA 5CC4A 1DXMA 1WD1A 2K5QA 3NWSA 4LAAA 3HKZB 4KI0A 1SYBA 2L55A 3A7AB 2F0IA 4DN4M 3Q6SA 2A6EC 2K1BA 4KKSA 3GTKB 1PTOH 5TSSA 2BE5D 1TQOA 3MAQA 5EKKA 1KNEA 5A2QE 4IURA 1CM9A 1XTCD 4IN3A 1EU3A 2NBFA 1LT5D 3SEBA 1SXTA 4LJZC 5D3IB 1Y8OB 3D31A 1PLFA 1TIID 3BDLA 3GTGB 1I4HA 3CHBD 4HAEA 3PUWA 1TY2A 3WOEA 4HMJA 2A68D 3NXWA 3Q22A 4J6HA 4ZLTF 3T13A 3E5SA 1WTPA 4RGNA 1JCKB 1OXVA 3IKJA 2QEJC 1BDOA 2JP1A 3BDOA 1BQQT 3MVVA 1HUNA 1FGBD 4KD4A 2K03A 5DM73 2DNEA 3OOCA 4ZUJA 1TR5A 2EE1A 2B2YA 2PNRC 5JPMC 4OGQC 1HPCA 1KDCA 1VCIA 2OT2A 3IL8A 2CVRA 5JAVA 3S2DB 1I4XA 4I65A 4IFDJ 1E2ZA 2TMPA 5IGGA 2B2UA 1DOLA 3S2HB 2EJGC 4P2CB 1TS4A 3P75A 2JE6I 4KV6A 1WTQA 1U4MA 2IW3A 2KHSA 2JSOA 1U4PA 4DU9A 2A6HD 1D5ZC 4OIJA 5D65A 3HOXB 1SBBB 4BS9A 1STYA 2M9VA 2Z4HA 5I2YA 1I6HB 2NWGA 1EY6A 2LMCB 1HA6A 3BYTB 1C48A 2ZXPA 4H0LC 1ILPA 2F0DA 3A56A 1CHQD 2NTTA 2WIIB 4CKEA 4KKTA 1SNDA 1RTOA 1HCZA 5M9OA 2RDFA 2FMCA 3A8JE 2DY8A 1O7ZA 1D5XC 2XIWA 4QB4A 5FLXE 1H9KA 2B2VA 1TS3A 1TY0A 3L9AX 2R6GA 4ODGA 2B2TC 2IX3A 5ELFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3W A;  2PYK A;  1SNM A;  3C1F A;  1JOK A;  4K8I A;  2EY1 A;  1A2T A;  3MHB A;  4DGZ A;  1KDC A;  3C1E A;  4EVO A;  3OMC A;  1AEX A;  1RKN A;  2F0J A;  4QF4 A;  5KYI A;  4KY6 A;  4HMI A;  1ENC A;  1EY7 A;  5CC4 A;  1SYG A;  5I9P A;  5KGU A;  4IUN A;  3SK6 A;  4K8J A;  1JOQ A;  5CGK A;  5CV9 A;  3R3O A;  5JAV A;  5HUR A;  1EZ6 A;  3DMU A;  4K14 A;  2F0S A;  2F0O A;  3MXP A;  2LKV A;  3QOL A;  4LAA A;  4K5V A;  2EY5 A;  2EYM A;  2EYH A;  5E1F A;  4ZUI A;  1SYB A;  2F0U A;  4K2K A;  1SNC A;  2F0I A;  4ZQ3 A;  4G57 A;  5EKL A;  1EQV A;  2F0K A;  4I65 A;  4NKL A;  2EYF A;  5I6Y A;  2EY6 A;  2EYJ A;  2OEO A;  3VA5 A;  5IIF A;  5CV5 A;  5IGG A;  3SK4 A;  1EY9 A;  5C4Z A;  2ENB A;  3SK5 A;  2F0P A;  1STA A;  3D6C A;  4NMZ A;  1KDB A;  3TP5 A;  1SYD A;  2EYL A;  2PW5 A;  2SNS A;  3EJI A;  1TQO A;  3QOJ A;  2EY2 A;  3NHH A;  5CV4 A;  4DF7 A;  1EY5 A;  5C4H A;  3D8G A;  4NDX A;  5EKK A;  4EQP A;  1A3V A;  4RKB A;  1A3U A;  3H6M A;  3P75 A;  4KV6 A;  1A2U A;  5CV6 A;  4E6I A;  1F2M A;  4EQO A;  2F0N A;  2SNM A;  1JOR A;  4YIJ A;  4MIU A;  2KHS A;  3SK8 A;  4KHV A;  3HZX A;  3TP8 A;  4N9T A;  2RBM A;  4DU9 A;  5K5P A;  4IZ8 A;  5CV8 A;  3ERQ A;  1SYF A;  5HGT A;  2O4X A;  2OXP A;  1STY A;  1JOO A;  3D4W A;  1EYA A;  2F0W A;  4K5W A;  3EVQ A;  1SNP A;  4KY5 A;  2F0Q A;  1STG A;  1KDA A;  2PZW A;  1SYC A;  2F0L A;  5C5M A;  4RKL A;  1EY6 A;  4KY7 A;  2F0V A;  3SR1 A;  2F0M A;  2RKS A;  4NP5 A;  5NUC A;  5KEE A;  3SHL A;  2F0T A;  2OF1 A;  4KJO A;  3BDL A;  4K5X A;  3QB3 A;  4R8N A;  5IGC A;  5KRU A;  4WRD A;  2F0E A;  5EGT A;  4F8M A;  4WOR A;  2F0D A;  1EYD A;  1SNO A;  1NSN S;  2F3V A;  3DHQ A;  5CV7 A;  3V2T A;  2F0F A;  4KD3 A;  1EY0 A;  3TP7 A;  5ISR A;  3OSO A;  3BDC A;  4ID6 A;  3OMG A;  3TP6 A;  5DAU A;  1TT2 A;  4KJN A;  1SND A;  4IAL A;  5J22 A;  4HMJ A;  2WAC A;  2PQE A;  2PW7 A;  1STH A;  3NQT A;  4PMB A;  4S3S A;  5C5L A;  3NXW A;  1KAA A;  1EY8 A;  4J6H A;  4K6D A;  4J1M A;  4B9W A;  5IGE A;  5M9O A;  2RDF A;  1NUC A;  2M00 A;  4QMG A;  3T13 A;  5F2D A;  3E5S A;  2PZU A;  4ME5 A;  1EZ8 A;  4DFA A;  4HTH A;  5IGB A;  5E3F A;  3MZ5 A;  1U9R A;  3NK9 A;  3OWF A;  5KIX A;  4K2L A;  4PMC A;  3TME A;  5I9O A;  3PMF A;  3D4D A;  1F2Y A;  3ERO A;  3NUC A;  3MVV A;  4N9P A;  5CR3 A;  5C3X A;  1F2Z A;  5I6W A;  3ITP A;  5KYL A;  4KD4 A;  1IHZ A;  2EYO A;  2HQE A;  1II3 A;  2EXZ A;  3MEH A;  4QB4 A;  5J39 A;  4PNY A;  2KQ3 A;  1A3T A;  2F0H A;  3NP8 A;  3T16 A;  1STB A;  1ENA A;  4H7B A;  3U9O A;  1EY4 A;  4EQN A;  5C6A A;  1STN A;  5C3W A;  5IGF A;  1SYE A;  4KTA A;  1EYC A;  5IGD A;  4F7X A;  2PZT A;  2EYP A;  2F0G A;  2SOB A;  3HEJ A;  4OL7 A;  3RUZ A;  3P1H A;  4ZUJ A;  5JOB A;  3SXH A;  3LX0 A;  5J1Z A;  4TRD A;  1TR5 A;  4B9X A;  5IOC A;  5IOD A;  4ODG A;  1SNQ A;  3S9W A;  2QDB A;  5DEH A;  2NUC A;  1KAB A; 
#chains in the Genus database with same CATH topology
 1XNR Q;  4K8I A;  2MO0 A;  2WKD A;  3GTP B;  1ENC A;  1DOK A;  4POG A;  2A6E D;  5CGK A;  1Q1B A;  4V19 0;  1A0I A;  4EQ5 A;  2NN6 H;  2YTY A;  4DA2 A;  1VQE A;  2E75 C;  2B63 H;  2N49 A;  5I6Y A;  1NCV A;  5EPL A;  1T5X D;  3RMH A;  1N9W A;  3H0G G;  3IFD A;  3P20 A;  4A3F G;  1YNX A;  5EPJ A;  1VQ6 A;  3VYR A;  3BS1 A;  4JVZ A;  2K4K A;  4UP8 A;  3NPP A;  1E24 A;  3GTJ B;  1RDP D;  3A5U A;  1IW7 C;  2R7Z H;  5FJ8 H;  4A3C H;  1JE4 A;  2BCO A;  3JAM E;  4A3J G;  2B2U C;  1RJT A;  3FKI H;  3ZYY X;  1PA6 A;  3CRK C;  3NSW A;  2Q8R E;  5KNC A;  1Q81 C;  4JV5 Q;  1H9R A;  3J7Z C;  2Z4I A;  3GTQ H;  2JA9 A;  4PQX A;  4DR2 Q;  3KBG A;  4O1N A;  3I4M B;  2Y0S E;  4O42 A;  2CQA A;  4QJF A;  3ONA B;  1B4O A;  4C1N I;  4K6L A;  3B6Y A;  3ULJ A;  4DV6 L;  2OF1 A;  4ZCK A;  2AUJ D;  2NN6 G;  1EEF D;  4ZKB B;  2KA7 A;  2PI2 E;  1QJO A;  4F8M A;  3NBH A;  2B63 G;  2E2J H;  1SNO A;  4L5T A;  4PG3 A;  2UUA Q;  4FF4 A;  1F9R A;  5ELO A;  1Q8K A;  3SE0 A;  1YHB A;  4R4O A;  3KDF B;  5C5L A;  1J8I A;  2NZ1 D;  1H9S A;  3OW2 A;  5IGB A;  3OTO L;  5M3F B;  1RF2 D;  2R7Z G;  4JI0 L;  5FJ8 G;  3OWF A;  1C8C A;  1PH3 A;  2N8N A;  1CZG A;  4K2L A;  2LFN A;  1HA5 A;  1M8A A;  2X69 A;  2B8F A;  4N9P A;  5BN5 A;  3FKI G;  1SRO A;  1HZ9 A;  2BH2 A;  2EYO A;  3TN2 A;  1ENA A;  4H7B A;  1STN A;  3AFQ A;  1V1P B;  3GV3 A;  1ZXT A;  4TKO B;  3RUZ A;  1RCV D;  1K83 B;  4TRD A;  3PF5 A;  4X3S A;  1I5F A;  1YEZ A;  2NUC A;  2PMZ E;  4NXN Q;  1VF7 A;  5D3D A;  3HOW B;  4LWC A;  2MNA A;  5G3L F;  2MPM A;  4GN3 B;  5CBE E;  1L1O A;  1U4L A;  1HNW Q;  3Q23 A;  3ND9 A;  2A5H A;  2JK8 A;  5CV9 A;  2UUB L;  1NAP A;  2F0O A;  4GNX A;  1CTM A;  3J7A V;  4K5V A;  1FNU A;  1PFM A;  4ZUI A;  4JYA L;  3K7A B;  1BBU A;  3HS0 C;  4WFN 3;  3S17 B;  1QG7 A;  3MXN A;  3HOU G;  2F0K A;  4JI8 L;  2RA4 A;  3I4N H;  3MC0 B;  3K0X A;  2SEB D;  4FF1 A;  1PH8 A;  2XN9 C;  1HHV A;  2WFW A;  2IX1 A;  1SFO H;  1ROD A;  4XQQ A;  5M3M B;  2O5I C;  2G5D A;  2K6A A;  1SRU A;  5DM6 3;  4DK0 A;  1F2M A;  2XGT A;  4DR6 Q;  2WB1 G;  1DOM A;  1G51 A;  2HHH Q;  1E3P A;  4BBR B;  3EIV A;  5K5P A;  2R7D A;  4IZ8 A;  5FLM H;  1PTO D;  4CGY B;  2E2I B;  1UEB A;  2G9D A;  2XRS D;  4DAM A;  2CQO A;  1ASY A;  2K5H A;  4ILW A;  1IKL A;  1VQP A;  3R8B A;  4JI4 Q;  3TZD A;  3S16 H;  1VQN A;  2RDG A;  1N33 L;  2C9O A;  3HOY B;  5NUC A;  3H0G B;  3M4P A;  4GLA C;  4ZAI A;  4GKJ Q;  1DJR D;  3I4N G;  2B3G A;  3TS0 A;  2K28 A;  1C9O A;  3MTS A;  3OMG A;  5DAU A;  4IJL A;  3K58 A;  1ET6 A;  5DLQ E;  1SR3 A;  4ME5 A;  1EZ8 A;  1UNS A;  2HUG A;  4X65 Q;  1D1K A;  4DV4 Q;  3TQY A;  5JVG 3;  1Q90 A;  4Y7N B;  1U4R A;  3AFP A;  5FLM G;  1F9Q A;  2KQ3 A;  3J7Y W;  2I5M X;  2ICI A;  5IGF A;  3V05 A;  2ZJQ A;  4X64 Q;  4X62 Q;  3VYS A;  2C5C A;  1RIP A;  4IPD A;  5KND A;  5JJI A;  3A7L A;  1PYB A;  4PZ7 A;  1N32 L;  1MD2 D;  3U4Z A;  2VQF Q;  2AQ1 B;  2EY1 A;  1P16 A;  4IPH A;  5C4J B;  3OMC A;  1QOH A;  4DAY B;  3GTL B;  2JA7 B;  2F0J A;  4KY6 A;  1J5E L;  2LSS A;  5BN4 A;  1XNQ Q;  4UP9 A;  2XSC A;  4JI1 L;  3CCQ A;  3AEV A;  3TRZ A;  4KK7 A;  1IKM A;  1X9N A;  2AHO B;  1BOS A;  5K36 H;  5T1G A;  2NN6 I;  4G57 A;  3CC2 A;  4ME3 A;  3S1M B;  2PQA B;  3S1Q H;  5FO9 B;  1PVO A;  1DYQ A;  5FOB B;  5IIF A;  1HNX L;  1AW7 A;  3SK4 A;  1BF4 A;  2B8G A;  1OXU A;  3TP5 A;  3LWU A;  2PW5 A;  3CCS A;  1Z47 A;  4OWW B;  4L5Q A;  1CKM A;  3X3M A;  3Q24 A;  2SNM A;  5KNB A;  2H4O A;  2DNC A;  1VQC A;  3GTO B;  1TWH H;  1XNR L;  4JOI C;  2SDF A;  3CPW A;  3VR2 A;  1ENF A;  4PZ6 A;  4GNX B;  4YCU A;  1Y8P B;  1AN8 A;  3KLS X;  2BDN A;  2F0W A;  4KY5 A;  3DXJ C;  1JB7 A;  3CRL C;  2KJX A;  4IUV A;  2QIL A;  2VXW A;  1FL0 A;  1UUP A;  3PIP 3;  5KEE A;  1Z9F A;  4Q5V A;  4KJO A;  5K36 G;  4FF2 A;  5KRU A;  1BBW A;  1L2F A;  3PIO A;  4C3I B;  2F0F A;  4L8J A;  4F87 A;  1EY0 A;  1DGS A;  1HFN A;  2IL8 A;  2IX0 A;  3OSO A;  4ZRZ A;  3WDN A;  2WAQ B;  1LM0 A;  4FVM A;  1EOT A;  1STH A;  2EPB A;  1SE4 A;  2Q8T A;  1VMP A;  1KNA A;  1VQF A;  1IYV A;  3T1H Q;  5M5W H;  1WTH A;  1ESF A;  1X56 A;  2B2W A;  1JWM D;  3SDZ A;  3C2P A;  1U9R A;  1JR0 D;  4LFA Q;  3PIO 3;  1Q12 A;  3DLL A;  4JV5 L;  1JQY D;  4AYB G;  1MSG A;  1HZC A;  3A5Z B;  4RHS A;  4DR2 L;  4BBS B;  3UI2 A;  1SYE A;  5A35 A;  5A2Q L;  3NTI A;  3NTH A;  4P72 A;  2DGY A;  4JI7 Q;  3GO5 A;  4B3R Q;  4JI2 Q;  4A3D B;  3DUZ A;  4CDF C;  3ND8 A;  5LMN W;  1SFO B;  2UUA L;  3FDT A;  1EFW A;  1AEX A;  1RKN A;  3UE0 A;  1BVS A;  1CFM A;  1SMY D;  3D0F A;  4HMI A;  3CC7 A;  2RSN A;  1JOQ A;  1LLR D;  1C0A A;  4IPG A;  3QWN A;  1C4Q A;  1EZ6 A;  3G6J B;  4HN7 A;  4DPG A;  5HUR A;  3K57 A;  3J81 j;  1XX8 A;  3I91 A;  5E4X A;  3A55 A;  2K5D A;  3CQZ B;  4BY1 B;  2EYF A;  2Z6K C;  1WYD A;  4LF6 Q;  2VY3 A;  3R2T A;  5IE8 A;  1K73 C;  3QOJ A;  3S1N H;  2JEB I;  2L9H A;  4KHZ A;  3DM1 A;  4RKB A;  2E8G A;  2VUM H;  3O13 A;  1QVC A;  3J81 c;  4NXN L;  4CJ2 C;  1JJG A;  3I2Z A;  4HCS A;  3E0E A;  4XYO A;  5AJ3 Q;  2R61 A;  4A3E B;  3IFT A;  1BXT A;  3D3R A;  1HNW L;  4RA8 A;  2KED A;  1STG A;  2HCI A;  3KF6 B;  5GQO A;  4RKL A;  3S15 B;  3E0J A;  1H9J A;  3SR1 A;  3HP3 A;  2YV5 A;  1U5K A;  4ABN A;  3PO3 B;  2JJQ A;  4RHR A;  1GUG A;  1GD7 A;  2D5D A;  3VYU A;  4WOR A;  1BO0 A;  1EYD A;  2OCE A;  5CV7 A;  3QO2 A;  4GKK Q;  4DR3 Q;  4CJ1 B;  5M5Y H;  4MHE A;  5GAH C;  2PQE A;  4PMB A;  4S3S A;  4JPB W;  1NUC A;  4DNT B;  1F77 A;  3S14 B;  3NEM A;  2EDG A;  4DR6 L;  2VUM G;  3IAY A;  3X3N A;  2HHH L;  1FYC A;  3RZD B;  1JWS D;  3URY A;  5I9O A;  3M3Y H;  1F2Z A;  2HQE A;  1S3O A;  5JEA H;  1EIF A;  1II3 A;  1IL8 A;  3J81 E;  2VL6 A;  3NP8 A;  4JI4 L;  3NQI A;  3T53 B;  3S1Q B;  3SXH A;  2EVB A;  2Y0S G;  5ELB A;  4GKJ L;  1BKB A;  1B2T A;  1E2V A;  1VQM A;  3J7A 5;  3BVZ A;  2Q8I B;  3MHB A;  1R4P B;  4ZYS A;  4IUN A;  1QZG A;  5EPK A;  1CQV A;  3HKZ E;  2R93 B;  3I7F A;  5IY0 A;  2F0U A;  1AZQ A;  4L6T B;  4X65 L;  2QCP X;  1S72 A;  4NKL A;  1Y1V B;  3QIA A;  4DV4 L;  1PRT C;  4P75 A;  4HR7 B;  2CCZ A;  4TQU S;  2AKW B;  1WD0 A;  2VS1 A;  4IUU A;  2D2C C;  5JEA G;  2E2D C;  1EWH A;  1EY5 A;  2F52 A;  1Y14 B;  2K7V A;  5LL6 X;  4X64 L;  2L12 A;  5H1S E;  4X62 L;  4HID A;  2YTX A;  1SN8 A;  1L0W A;  1I4G A;  4IUQ A;  3NBI A;  3OIP A;  2VQF L;  1E1T A;  1B1Z A;  3CCV A;  1GVP A;  4G7H C;  5FLX L;  1EEI D;  2ZXR A;  1TS5 A;  4YWL A;  1TKW B;  3PO2 B;  1M4V A;  1DM0 B;  4R9W A;  3N52 A;  1XNQ L;  2K50 A;  5M5W B;  1TWG H;  2BH8 A;  4K5W A;  1QNK A;  1SNP A;  4U68 A;  5C5M A;  1X3Q A;  5EAY A;  1E7Z A;  5I4D A;  4LF8 Q;  4ALP A;  2M2L A;  1LTA D;  3CAM A;  3TRE A;  1OTC A;  4LFC Q;  4GN4 B;  4R8N A;  1X55 A;  3W1G A;  4XT3 B;  4G7Z C;  3K80 C;  4RGT A;  2KEC A;  1X6O A;  2R3Z A;  4WJW A;  4LF7 Q;  2HT1 A;  1MHW C;  1NMG A;  1I94 Q;  1QNU A;  3TP6 A;  3BDC A;  1LAC A;  4KJN A;  1Q86 C;  2PW7 A;  1MI2 A;  1YNN C;  4B9W A;  3LWE A;  2M00 A;  1IXR A;  4GOP C;  1Q8I A;  3MZ5 A;  4A3M B;  1K8A C;  2QF7 A;  1V1P A;  5I6W A;  1IHZ A;  1N8R C;  1RTN A;  3MEH A;  2F0H A;  3T16 A;  4N8F A;  2R92 H;  4A3L G;  1HQM C;  2YU9 H;  5E4W C;  2HDL A;  3CP0 A;  4DNI A;  3JAM L;  3TS2 A;  1PMR A;  5C3W A;  2CKZ B;  1A15 A;  3DWP A;  5AFW A;  1JOK A;  1FR3 A;  3CKI B;  2L4N A;  4FXG C;  3S1N B;  5IYD G;  4IQZ A;  1PHJ A;  1PTO F;  4WJ4 A;  1Y8N B;  1ONL A;  3SK6 A;  2VUM B;  1B44 D;  2NVX H;  1B53 A;  1LTS D;  1DON A;  1LTT D;  2EYH A;  3T1H L;  1LAB A;  1VMC A;  1EQT A;  5M5X B;  1ICF B;  1PDQ A;  1X3P A;  2ICE C;  4DV7 L;  4LFA L;  1PH9 A;  1PTO B;  2EY6 A;  4LFB Q;  1X3G A;  2Y0S B;  1KTK A;  3D6C A;  3ERS X;  3CCL A;  3E6Z X;  3NHH A;  2R92 G;  4NDX A;  1CSP A;  1A3U A;  4E6I A;  4JI7 L;  2B2Y C;  1JOR A;  4JI2 L;  1TWC H;  1I3Q B;  2D0P A;  1ZKO A;  2O4X A;  2FMM A;  5C4X H;  4OX9 Q;  1DZ1 A;  2IY5 B;  3KJP A;  4JBW A;  2E2H H;  2MJ8 A;  2RQX A;  1EYA A;  3PGZ A;  3EVQ A;  1EQQ A;  2VB2 X;  1QWY A;  3M3Y B;  3SHL A;  2KEN A;  2BA0 A;  3BVM A;  1QUQ B;  3TZU A;  1EWI A;  1B9M A;  2EOT A;  1LYL A;  1NSN S;  2ZJP A;  1CZW A;  4R4I A;  4LUV A;  2QA4 A;  4LF6 L;  1D5M C;  2CWP A;  1FJG Q;  2IT1 A;  2YTV A;  2KCC A;  4IO9 A;  1TT2 A;  3STB C;  3NQT A;  1B50 A;  1WTO A;  1ZEQ X;  4K6D A;  2F4V L;  1Z7T A;  4QMG A;  3U58 A;  2PMZ B;  3GTM B;  1BUV T;  4KKU A;  1EYG A;  2ATW A;  4BY7 H;  4Y52 H;  4IFD H;  3PQI A;  2GN5 A;  3D4D A;  3HOV H;  4B08 A;  3RR5 A;  3I55 A;  2NB0 A;  1ZYR C;  5AJ3 L;  3L7Z C;  5C4X G;  4FXK C;  1YI2 A;  2NVT B;  4OWX B;  3PSI A;  3C46 A;  5FO7 B;  2FJ2 A;  2TSS A;  2A1A A;  2ZT9 C;  1J9O A;  2Z1C A;  2HCC A;  3ULL A;  3LX0 A;  4HJ8 A;  4ZKC B;  4DAY A;  5LHY 1;  2OQK A;  5LMN Q;  1KXL A;  4PV1 C;  2Q2U A;  1HZB A;  4LF9 Q;  3DWQ A;  5C0X J;  3M85 A;  2JA6 B;  3HOU H;  2RCN A;  4LK1 C;  3C1E A;  3H91 A;  1YVC A;  1YJN A;  4GKK L;  4WJ3 M;  2K75 A;  4DR3 L;  2L0C A;  3Q8D A;  1KIX A;  1GM5 A;  3I8Z A;  4I7Z C;  2ALY B;  2MHV A;  4C2M B;  3GP7 A;  4IOA A;  2PQA A;  3MXP A;  1PRT D;  1F9P A;  1CA5 A;  2RCF A;  4MN3 A;  3F2U A;  1XMQ Q;  5C44 H;  4BY7 G;  1Q1E A;  2OEO A;  2AWN A;  4HED A;  5EQ0 A;  1N36 Q;  1LT6 D;  4IFD G;  3CPF A;  3HOV G;  2B2V C;  2WIN B;  4A3B H;  3SK5 A;  2FFK B;  4NMZ A;  4XDX A;  1Q46 A;  1EU4 A;  4A76 A;  4DF7 A;  1R9T B;  2UUC Q;  3NWT A;  2H5X A;  4H44 C;  1JIC A;  1KQS A;  4YWK A;  4HSP A;  5LL6 S;  1HNZ Q;  3SVM A;  3HOZ H;  4N9T A;  2I46 A;  3ULP A;  4O2D A;  1EIH A;  2IJ0 A;  1V1O A;  5E7N A;  1SMX A;  5D14 A;  1O78 A;  1VQG A;  3K0Y A;  3MFY A;  5JJZ A;  1YHQ A;  2PZW A;  1STE A;  3T56 B;  2F0M A;  4NP5 A;  2I5L X;  4RGO S;  5JJL A;  4GLV B;  5C44 G;  4BA1 I;  4R8I A;  2LS0 1;  1S5C D;  4JI5 Q;  4A3K H;  4A3B G;  5J3B A;  1TWA B;  1BBX C;  2KOL A;  5I2X A;  3BVG A;  4DV2 Q;  4O0A A;  3KLS A;  1FNV A;  1WTV A;  3KUP A;  4GLX A;  2VNU D;  1OXX K;  3HOZ G;  2NVX B;  3NUC A;  5CR3 A;  1O80 A;  4RAU C;  1GUT A;  4A3F B;  2A74 C;  1STB A;  3TSS A;  2NVQ B;  3R2I A;  1EYC A;  3JAM i;  4JCV E;  3M4O B;  2SOB A;  4A3J B;  3L3O C;  1TWF B;  3S9W A;  2L1B A;  2XNA C;  4LF8 L;  1SNQ A;  4LFC L;  4LW1 A;  5DEH A;  2UU9 L;  4OXP A;  4FXD A;  1FVI A;  3RLO A;  1GUO A;  4LF7 L;  2B39 A;  2A19 A;  1XPR A;  1I94 L;  3BJU A;  1WCM H;  1SE3 A;  2VZA A;  5IWA Q;  4A93 H;  1EOV A;  4H13 C;  4A3K G;  3DMU A;  3VYT A;  2XRQ D;  3QOL A;  2EY5 A;  5CBA E;  5E1F A;  1A6X A;  3MFG A;  1EFI D;  5GRO A;  5IYC H;  2B63 B;  1SE8 A;  3GTK H;  2K33 A;  4RFB A;  4AH6 A;  3MEF A;  3RN5 A;  2IWH A;  2WV6 D;  5C4Z A;  2MUY A;  1PXU A;  5IT9 E;  1PH5 A;  1BNZ A;  1IYJ B;  2EYL A;  2SNS A;  1W6J A;  3EJI A;  5C0X H;  2K32 A;  2EIF A;  5HY6 A;  2R7Z B;  2AWO A;  4L5S A;  4MIU A;  3M4Q A;  1JJ2 A;  3FKI B;  3PV0 A;  3HZX A;  4KN4 C;  3TP8 A;  1L0X B;  3FPU B;  5DNF A;  4V0B A;  2RDH A;  4TSS A;  4XT1 B;  4K0K Q;  1A63 A;  4G4K A;  4UDU C;  3GTQ B;  1AFP A;  1L1O C;  3KF6 A;  5C3E H;  1G8Z D;  3K5O A;  1VQD A;  1ET9 A;  1WCM G;  1XXG A;  4QL5 A;  1RD9 D;  1I6V C;  4DK6 C;  4GNX C;  4JI3 Q;  2O2L D;  4A93 G;  1IBL L;  1IW7 D;  4APV A;  1Y1W H;  1NR4 A;  2VQE L;  3HKZ G;  3KF8 B;  1F2L A;  1MBY A;  1IYU A;  3AYH B;  3OWE B;  5GAE C;  1QVG A;  4LNQ A;  2F0E A;  5IYC G;  1S40 A;  2E2J B;  3ZJY C;  3STB D;  4LFB L;  3DHQ A;  5LMU L;  1BCP C;  1EWC A;  4DUY Q;  2EJM A;  3QJY A;  4J1M A;  2HIV A;  5C0X G;  3HOU B;  1VQ7 A;  3M9B A;  3KJO A;  1ZYR D;  3CF5 A;  1X65 A;  5E3F A;  1A62 A;  3NK9 A;  4RMF A;  3UE1 A;  4IFD I;  3I4O A;  3PMF A;  1F2Y A;  5EBC A;  2CHB D;  2MGS A;  1VQ8 A;  3F2B A;  3ITP A;  1AH9 A;  2K52 A;  1YHA A;  1LTI D;  1NR2 A;  5C3E G;  5BR8 Q;  5IGD A;  5C44 B;  2PZT A;  2F0G A;  3K59 A;  3U4V A;  4OL7 A;  2WB1 B;  2ID0 A;  2EZV A;  1LV9 A;  1Y1W G;  1D1I A;  3F2D A;  1KAB A;  5L37 A;  4X3U A;  1SNM A;  1D6E C;  1LT4 D;  4DGZ A;  4DR1 Q;  4ZK9 B;  2JA5 H;  2BA1 A;  1I4Q A;  2KHJ A;  3GQB A;  5FO8 B;  3CD6 A;  5IP7 H;  4P71 A;  3R3O A;  1O7I A;  3S2D H;  4YCW A;  5IYB H;  1WTX A;  4FO2 A;  3A8I E;  1SNC A;  1LTB D;  1SAP A;  4ZQ3 A;  1EQV A;  3I4N B;  3W2D A;  4BA2 I;  2EYJ A;  3FMC A;  3VA5 A;  1WI5 A;  1CKN B;  4X66 Q;  1EY9 A;  2ENB A;  3J80 E;  3S2H H;  1OXS C;  2XTI A;  2Q2T A;  2J4X A;  1WOC A;  1IL2 A;  4EX5 A;  3D8G A;  1B7Y B;  1SJE D;  4YCV A;  4DV5 Q;  4HJ7 A;  3QG1 A;  1VDZ A;  2K5W A;  5LMN L;  3MA2 B;  2RBM A;  2ZTC A;  4A3K B;  4LF9 L;  1SYF A;  3J81 L;  1QE6 A;  4QUF A;  4B3S Q;  2NZH A;  2E5L Q;  2HQL A;  2JA5 G;  4DV0 Q;  2K14 A;  3S16 B;  1PFS A;  5IP7 G;  3K5L A;  1HJP A;  2AQ2 B;  2K01 A;  4RWS C;  1S4Z A;  1SEB D;  5IYB G;  2DUD A;  1XMQ L;  4CKB A;  4CBV A;  1E22 A;  3AMU A;  4UAI A;  4QCL A;  4RCN A;  5ISR A;  2WAQ E;  5CYU A;  4XIG S;  5J22 A;  3H3V C;  2UUC L;  1G2S A;  1EY8 A;  1KRS A;  2F1M A;  1GOZ A;  4HJ9 A;  1HNZ L;  4DFA A;  3IRB A;  4HTH A;  4JW0 A;  1HZA A;  3GDE A;  1G91 A;  3KOJ A;  4A93 B;  4PMC A;  1K8G A;  2I5H A;  5EKI A;  1VF5 C;  2F4I A;  2HIX A;  3CU7 A;  4JG2 A;  1G6Z A;  1X32 A;  1PYS B;  1B3Q A;  4PNY A;  3I3C A;  1A3T A;  1EY4 A;  1FGU A;  4DAP A;  5C6A A;  4DV6 Q;  2BOS A;  1EIY B;  2IHF A;  5IOC A;  4YWM A;  1U0L A;  2CWA A;  4QIW B;  2QDB A;  1FD7 D;  3H15 A;  4X6A H;  3T4A C;  3J7A F;  1HR0 W;  3SGI A;  4NW2 A;  2GVA A;  3EN2 A;  3I56 A;  1Z6H A;  1MSH A;  4FDB A;  1PH1 A;  4L5R C;  1SDF A;  4LMQ D;  4JI5 L;  4OO1 H;  2N55 A;  3NE5 B;  2CH4 A;  2HDM A;  1DD2 A;  2F0S A;  2LKV A;  4DV2 L;  2EYM A;  3T51 B;  2B2W C;  1YJW A;  4K2K A;  3K5N A;  2XVS A;  2IPK D;  4HJ5 A;  2L15 A;  3C3L A;  5CMD A;  4FP5 D;  5C3E B;  4C3H H;  3K81 C;  2FIN B;  5CV5 A;  4FF3 A;  1KLG D;  1Y1W B;  1KDB A;  2PI2 A;  3AU7 A;  3P7J A;  1E1O A;  4XYQ A;  5CV4 A;  1TU2 B;  5C0X I;  4DV1 Q;  1VQI A;  5CV6 A;  2F0N A;  1TWH B;  4AYB B;  1PH2 A;  1S5F D;  4QUC A;  5HGT A;  3OW7 A;  1N34 Q;  1JOO A;  5IWA L;  5ELF A;  3GV6 A;  3I4M H;  2A69 C;  3U50 C;  4OO1 G;  1SYC A;  2F0L A;  5T1I A;  1QUQ A;  2KEE A;  2J0T D;  2KVM A;  3W1B A;  1GUW A;  2L5T A;  4HIK A;  3WOF A;  1BCP D;  4CHT B;  1L0Y B;  3QB3 A;  2N88 A;  2O5J C;  4J8Q A;  1PZJ D;  4RH6 A;  1A8V A;  2B2T A;  4G7O C;  1EQR A;  3UDG A;  1CA6 A;  2AQ3 B;  3VR3 A;  4C3H G;  1LO5 D;  2NYZ D;  4DXG A;  3TP7 A;  3CME A;  5FKA C;  3DWA A;  4HCE A;  4A3L H;  1KAA A;  1UWV A;  3NEN A;  1SJH D;  3AB9 A;  1PRT F;  2OQ0 A;  2PZU A;  5GAD C;  1HUM A;  1YIJ A;  2JA5 B;  1KAW A;  5M3F H;  4XQN A;  4DAV A;  4MTN A;  5KYL A;  5C3X A;  4K0K L;  4OHJ A;  2P5Z X;  3NEL A;  2PPB C;  4DR7 Q;  5IYD H;  4KN7 C;  1X3F A;  3MWY W;  2PO4 A;  3F8T A;  4JI3 L;  1XYI A;  4KTA A;  1J6Q A;  1PRT B;  2EYP A;  3I4M G;  3GD7 A;  3P1H A;  3T1Y Q;  5IOD A;  1K83 H;  1HQR D;  1PYW D;  2F3W A;  4C3J H;  2V4D A;  3HOW H;  1SSO A;  4GZY C;  1S5E D;  3CCM A;  4Q0F A;  2Z6B A;  1EY7 A;  4DUY L;  1GJX A;  1SYG A;  5I9P A;  4K8J A;  3RNU A;  4HSV A;  3PUV A;  1NJI C;  3S1R H;  1T5E A;  1VQ5 A;  2UXD Q;  2H1E A;  3S17 H;  2Q2H A;  1S5B D;  1UE7 A;  1K3B C;  3V96 A;  1QB5 D;  5M3F G;  4DNR B;  3EQL C;  1PTO C;  1JMC A;  4TVA B;  4MTK A;  4QGU A;  1NMF A;  2KCM A;  1IBM Q;  1ESR A;  5BR8 L;  1JE5 A;  5M3M H;  3F2C A;  4Z9C B;  3PUZ A;  1A3V A;  2CH4 W;  1VQL A;  4EQO A;  1UAP A;  3LGJ A;  3KBX A;  4RG1 A;  3UDX A;  3J81 i;  3EA6 A;  4BBR H;  4DR1 L;  1Y69 U;  3U9S A;  4C3J G;  1CQF A;  1UE6 A;  4CDD C;  2JN4 A;  3HOW G;  4L63 B;  4GOP B;  1EUJ A;  3RN2 A;  1YNJ C;  1IBK Q;  1KDA A;  1H9M A;  2LY7 A;  3BU2 A;  4DV3 Q;  3HOY H;  2F0T A;  1MIU A;  4A4I A;  3LNN A;  5IGC A;  3RD4 A;  5ELE A;  1LTL A;  4WRD A;  2UXB Q;  1HTL D;  2ZXO A;  1MJE A;  1E0B A;  4EGV A;  2F3V A;  3HG9 A;  1QIL A;  4B3R L;  4KD3 A;  4BWG B;  4X66 L;  5M5Y B;  4FYD A;  5M3M G;  4QY7 A;  4DV5 L;  2RVL A;  4CJ0 B;  3BZK A;  3D4R A;  2L11 A;  4A3G H;  2OTJ A;  5KIX A;  1VQO A;  3CMA A;  2K05 A;  1B3A A;  1K0S A;  2JYO A;  3UDF A;  4A3I H;  1RHP A;  4BBR G;  4Y7N H;  2E5L L;  3D6W A;  2ZM6 Q;  4B3S L;  2BDO A;  1KLU D;  5ELD A;  4DV0 L;  1CT1 D;  1ICW A;  1NNX A;  2QKI C;  4JBJ A;  4B3T Q;  1G6P A;  1UE5 A;  1TVX A;  4C3H B;  4OON A;  5KYI A;  4OWT B;  3HOY G;  2QDL A;  4NXM Q;  4FNF A;  2Z9H A;  1O7Y A;  2GA4 B;  3C1F A;  1YJ9 A;  1TXY A;  3VR4 A;  4DR5 Q;  1WFQ A;  1CUK A;  5C4J H;  4QF4 A;  2JA7 H;  3GTL H;  2A8V A;  3CC4 A;  4LUZ A;  4XTC S;  5KGU A;  4X3K A;  4OO1 I;  1YZ6 A;  4K14 A;  2WKC A;  4OIK A;  4UPA A;  1WTR A;  2X6L A;  3S1M H;  2F03 A;  2Z8L A;  4A3G G;  3CCR A;  1X54 A;  3I70 A;  4A3I G;  1AZP A;  2HD3 A;  3Q0A A;  1WVL A;  4DXF A;  4CKC A;  4CDE C;  2LXK A;  3FP9 A;  1QVF A;  4JBK A;  1I50 H;  3MXG A;  5ELC A;  1HFG A;  3A8K E;  4M1U B;  3I72 A;  4X3T A;  4N8X 1;  3SK8 A;  3GTO H;  3HRZ C;  3VR5 A;  4GN5 A;  2A69 D;  1BR9 A;  3N6R A;  2RSO A;  4IUP A;  4DK1 A;  1TWG B;  4P73 A;  4IJH A;  2JA7 G;  1V9P A;  3KF8 A;  2F0Q A;  4A3C G;  4DUZ Q;  5EBD A;  3HFZ B;  2RKS A;  1FNW A;  1ML0 D;  1G2T A;  4B3M Q;  1VQ4 A;  1PV4 A;  4C3I H;  5JVH 3;  3M7N A;  2FHT A;  4POF A;  4MZ9 A;  2DN8 A;  3FRP B;  1LTG D;  4C3J B;  4DV1 L;  4JI6 Q;  4YHH Q;  2IHE A;  1GHK A;  4RCO A;  1MGS A;  2JA8 H;  1NBW A;  2NVY H;  1OO9 B;  2JEA I;  3ERO A;  5IT9 L;  1Q3L A;  2A73 B;  2EXZ A;  3BZC A;  1N34 L;  3S1R B;  2CW0 C;  1VQ9 A;  3E9H A;  1NE3 A;  2R92 B;  1SMY C;  3U9O A;  4BBS H;  2YU9 B;  1K8M A;  5FK9 C;  1KC8 C;  1YNN D;  2NTS A;  4OEM B;  2UXC Q;  2GVB A;  1NY4 A;  4B9X A;  4BXX H;  1VQK A;  1V43 A;  4M8A A;  1HR0 Q;  4A3D H;  2PYK A;  4ULL A;  4C1N K;  1A2T A;  1WJJ A;  1LTR D;  3RZO H;  3W3A A;  4JOI A;  1JJC B;  3KYH C;  3R93 A;  1X3E A;  4C3I G;  3H94 A;  1CHP D;  2PCF B;  5IT9 c;  4UHV A;  1V8Q A;  2QGQ A;  1CK1 A;  3NTK A;  2WAQ G;  1HRJ A;  3TBI B;  3M4Y A;  3H09 A;  2MQH A;  1CKN A;  1KD1 C;  5EKL A;  3CQZ H;  3I90 A;  4AQY Q;  1K8O A;  4BY1 H;  4YY3 Q;  3G48 A;  2JA8 G;  1HXY D;  1VQA A;  4LF5 Q;  1C7Y A;  2DJG C;  2XWJ B;  3W5O A;  4DR7 L;  2F0P A;  5COY A;  1QZH A;  4RGM A;  4CDC C;  1SYD A;  5C4H A;  2EY2 A;  5JJK A;  4BBS G;  4QQB X;  3E3X A;  4EQP A;  3I4L A;  1A2U A;  2BE5 C;  3T1Y L;  2MFI A;  4YIJ A;  2R7F A;  4BXX G;  1TWC B;  4KHV A;  2F3I A;  4KLK A;  4H02 A;  3VDY A;  3OPO A;  4A3D G;  1YNJ D;  5CV8 A;  5C4X B;  1CI3 M;  4IPC A;  3ER0 A;  4A3E H;  2E2H B;  3D4W A;  2KBN A;  1HTP A;  3VA7 A;  5EJW A;  4A3G B;  4XQJ A;  1K0R A;  3A74 A;  2VB3 X;  4KY7 A;  3CCJ A;  1Q82 C;  3S15 H;  1KRT A;  1GO3 E;  2UXD L;  4A3I B;  1MKH A;  1SE2 A;  3PO3 H;  1GHJ A;  1GUN A;  3V2T A;  4BY1 G;  1F9S A;  1R4Q B;  3H3V H;  1PFN A;  1IBM L;  1I4P A;  3NBH B;  3HGB A;  2N78 A;  1M1K C;  3MXU A;  2WAC A;  3PF4 A;  2K04 A;  4UP7 A;  5IGE A;  1JWU D;  3FEW X;  5COR A;  1LT3 D;  5F2D A;  5IP9 H;  1AP0 A;  1CSQ A;  3S14 H;  1JC7 A;  2A68 C;  2D9U A;  3PUX A;  1EL0 A;  3TME A;  4IUT A;  3RZD H;  2KCN A;  3HOV B;  1H9S B;  3CCU A;  3J80 L;  2Z6K A;  3PCO B;  1SLJ A;  3FPP A;  4F88 A;  3GTG H;  3OHX C;  4EQN A;  4A3E G;  3WWV A;  1IBK L;  3BYY B;  2D62 A;  3BZD B;  4DV3 L;  4IOC A;  1PZK D;  2EJF C;  2EQS A;  1ILQ A;  1VQJ A;  2UXB L;  1AE3 A;  3PO3 G;  1V1Q A;  1XJV A;  4EVO A;  1DCZ A;  3G7L A;  4DR4 Q;  1E2W A;  1G29 1;  4KHP Q;  3J80 c;  4LF4 Q;  1NTG A;  1I50 B;  3RLF A;  1WTW A;  1Q7Y C;  4OX9 L;  3PIP A;  3EFX D;  3L2P A;  1PZI D;  1TS2 A;  2R93 H;  2KUM A;  1L1O B;  3G6E A;  1OXT A;  3KLR A;  5IP9 G;  1BCP F;  4BY7 B;  1KHI A;  1P8L A;  5BN3 A;  2G9H D;  1Y1V H;  3OIQ A;  2J7Z A;  1XMO Q;  3DEP A;  3DM3 A;  1QCB D;  3MXN B;  2ZM6 L;  4A3B B;  1STA A;  3E9I A;  1AE2 A;  1VS0 A;  5JEA J;  4B3T L;  1FJG L;  4HIO A;  2AUK A;  3KK7 A;  1S5D D;  1BCP B;  2KHI A;  3H6M A;  1YBY A;  1UEA B;  3I73 A;  4KMU C;  3A54 A;  5JPN C;  4NXM L;  3HOZ B;  4DK3 C;  1I4R A;  3CXC A;  3ERQ A;  4DR5 L;  1RL2 A;  5G3L D;  4C56 C;  2OXP A;  3VR6 A;  4A75 A;  2WP8 J;  3PO2 H;  1GKH A;  3K5M A;  2ES2 A;  2Q2I A;  2A6H C;  3L0O A;  2OTL A;  4DV7 Q;  2JA8 B;  2NVY B;  1HH2 P;  2F0V A;  3PUY A;  3KFU A;  2R93 G;  3BG3 A;  2ZTE A;  3HKS A;  4K5X A;  3ICE A;  2CFM A;  5EGT A;  1ASZ A;  2RF4 A;  1Y1V G;  3FVQ A;  3QR8 A;  1PFB A;  4ID6 A;  1VQB A;  4IAL A;  3HOX H;  2I07 B;  4U67 3;  1EIG A;  1JB3 A;  2C35 B;  4UY8 C;  1B9N A;  3RZO B;  2DY7 A;  3K7U C;  2YYZ A;  1D8L A;  3UDI A;  5ELN A;  2JXM B;  1GUS A;  2CW0 D;  3K8A A;  4NB3 A;  4A3M H;  1YIT A;  1I6H H;  2MP1 A;  4JK1 C;  4MNO A;  3FHW A;  3M7G A;  5J39 A;  1D2B A;  1N36 L;  3PO2 G;  4R4T A;  2E74 C;  4F7X A;  3KLW A;  2WB1 E;  3F1Z A;  4DUZ L;  2RHS B;  3HEJ A;  2E76 C;  5JOB A;  5J1Z A;  1O7L A;  3DEO A;  2XWB B;  4PMW A;  2QEX A;  1LUZ A;  4JC0 A;  4B3M L;  1W6K A;  1K28 A;  2X6G A;  3TDQ A;  2V1C C;  3K6O A;  3CW2 C;  1W3S A;  1WCM B;  1GXD C;  4XXE A;  2OWO A;  2F4V Q;  5GAG C;  5CC4 A;  1DXM A;  1WD1 A;  2K5Q A;  1XPU A;  3NWS A;  4LAA A;  3HKZ B;  3HOX G;  4KI0 A;  1SYB A;  2L55 A;  3A7A B;  2F0I A;  4JI6 L;  4YHH L;  4DN4 M;  3Q6S A;  5M5X H;  2A6E C;  2K1B A;  4KKS A;  3GTK B;  2ZJR A;  1PTO H;  2VW9 A;  1K3R A;  4A3M G;  2NZO A;  5TSS A;  2BE5 D;  1TQO A;  3MAQ A;  5EKK A;  2UXC L;  3GTP H;  2KCT A;  1KNE A;  5A2Q E;  3OTO Q;  4IUR A;  1CM9 A;  1XTC D;  1HR0 L;  4IN3 A;  4JI0 Q;  1EU3 A;  4GOP A;  1B70 B;  2NBF A;  1I3Q H;  1IZ6 A;  1D7Q A;  1LT5 D;  1XTD A;  4AIM A;  3SEB A;  1SXT A;  1K9M C;  4LJZ C;  5D3I B;  1Y8O B;  3D31 A;  1PLF A;  1XPO A;  1TII D;  1UE1 A;  3BDL A;  1JT8 A;  3GTG B;  1I4H A;  4AQY L;  3CHB D;  1T9H A;  4YY3 L;  3GTJ H;  4HAE A;  3PUW A;  4LF5 L;  1TY2 A;  3WOE A;  2LXJ A;  3H3V I;  4R4C A;  4HMJ A;  2A68 D;  3OYY A;  2UUB Q;  2ZTD A;  3NXW A;  3Q22 A;  4J6H A;  4ZLT F;  3T13 A;  4JYA Q;  3E5S A;  1WTP A;  4RGN A;  3GTM H;  1OXV A;  1JCK B;  3IKJ A;  4JI8 Q;  2QEJ C;  4HIM A;  1BDO A;  2JP1 A;  4LUO A;  3J80 i;  3BDO A;  1BQQ T;  3MVV A;  4J15 A;  1HUN A;  1FGB D;  3G4S A;  4KD4 A;  2B29 A;  2K03 A;  5DM7 3;  2NVT H;  1MJC A;  2DNE A;  3OOC A;  4QIW E;  4ZUJ A;  1TR5 A;  2FXQ A;  2EE1 A;  2B2Y A;  2PNR C;  5HGQ A;  5JPM C;  2JA6 H;  4NPS A;  4OGQ C;  1HPC A;  1KDC A;  1VCI A;  4GS3 A;  2DJF C;  2OT2 A;  3IL8 A;  2CVR A;  1PH4 A;  4C2M H;  5JAV A;  4P74 A;  3S2D B;  3G71 A;  1N33 Q;  1I4X A;  4I65 A;  2D0O A;  4IFD J;  1E2Z A;  2TMP A;  5IGG A;  2B2U A;  1DOL A;  3S24 A;  3S2H B;  2EJG C;  2EXD A;  1R9T H;  4P2C B;  1TS4 A;  2UU9 Q;  3JC6 6;  3P75 A;  2JE6 I;  4KV6 A;  4AYB E;  3CCE A;  3KDF A;  1WTQ A;  1U4M A;  2IW3 A;  2KHS A;  2JSO A;  5FLX c;  3RLN A;  1U4P A;  4DU9 A;  1M90 C;  3K7A H;  2A6H D;  1D5Z C;  4OIJ A;  5D65 A;  3HOX B;  1SBB B;  2K5V A;  4BS9 A;  2JA6 G;  1STY A;  4DR4 L;  4KHP L;  4R4Q A;  4LF4 L;  3AQQ A;  1PH7 A;  3A0J A;  2M9V A;  2Z4H A;  1VQH A;  3EBE A;  5I2Y A;  1I6H B;  2NWG A;  1EY6 A;  2LMC B;  1HA6 A;  2JQO A;  3BYT B;  1C48 A;  2ZXP A;  1N32 Q;  4H0L C;  1ILP A;  4DKA C;  2F0D A;  1B8A A;  3A56 A;  1XMO L;  4I7A A;  2AMC B;  4PZ8 A;  1CHQ D;  2NTT A;  2WII B;  4CKE A;  4KKT A;  1J5E Q;  4R1J A;  1SND A;  4JI1 Q;  1KL9 A;  1RTO A;  1W2B A;  1TWA H;  2E2I H;  1HCZ A;  5M9O A;  2I0Q A;  2RDF A;  2QW7 A;  2FMC A;  1CKO A;  3A8J E;  1PH6 A;  2N3S A;  2DY8 A;  3H0G H;  2Z0S A;  2K5N A;  2MO1 A;  1HNX Q;  1O7Z A;  1IBL Q;  4HJA A;  1D5X C;  4A3F H;  2XIW A;  4QB4 A;  5FLX E;  2ASB A;  2RHQ B;  1H9K A;  2B2V A;  1TS3 A;  2PNH A;  2NVQ H;  3JAM c;  4JBM A;  2VQE Q;  1TY0 A;  3L9A X;  2R6G A;  4OEL B;  3M4O H;  4A3J H;  1TWF H;  1H95 A;  5LMU Q;  4ODG A;  2B2T C;  3TEH B;  2IX3 A;  1XWE A; 
#chains in the Genus database with same CATH homology
 4K8I A;  2WKD A;  3GTP B;  1ENC A;  1DOK A;  2A6E D;  5CGK A;  1Q1B A;  4V19 0;  2NN6 H;  4DA2 A;  2E75 C;  5I6Y A;  1NCV A;  5EPL A;  1T5X D;  3RMH A;  3IFD A;  3P20 A;  5EPJ A;  3VYR A;  3BS1 A;  3NPP A;  3GTJ B;  1RDP D;  1IW7 C;  1JE4 A;  2BCO A;  3JAM E;  2B2U C;  1RJT A;  3ZYY X;  3CRK C;  3NSW A;  2Q8R E;  5KNC A;  1H9R A;  2Z4I A;  4PQX A;  3KBG A;  4O1N A;  3I4M B;  4O42 A;  2CQA A;  3ONA B;  1B4O A;  4C1N I;  4K6L A;  2OF1 A;  2AUJ D;  2NN6 G;  1EEF D;  4ZKB B;  2KA7 A;  1QJO A;  4F8M A;  3NBH A;  1SNO A;  4FF4 A;  1F9R A;  3SE0 A;  5C5L A;  1J8I A;  2NZ1 D;  1H9S A;  5IGB A;  5M3F B;  1RF2 D;  3OWF A;  1C8C A;  4K2L A;  1CZG A;  2LFN A;  1HA5 A;  1M8A A;  5BN5 A;  2B8F A;  2X69 A;  4N9P A;  2EYO A;  3TN2 A;  1ENA A;  4H7B A;  1STN A;  1V1P B;  3GV3 A;  1ZXT A;  4TKO B;  3RUZ A;  1RCV D;  1K83 B;  4TRD A;  4X3S A;  2NUC A;  1VF7 A;  5D3D A;  3HOW B;  5G3L F;  2MPM A;  5CBE E;  1U4L A;  3Q23 A;  3ND9 A;  2A5H A;  5CV9 A;  1NAP A;  2F0O A;  1CTM A;  3J7A V;  4K5V A;  1FNU A;  1PFM A;  4ZUI A;  3K7A B;  3HS0 C;  4WFN 3;  3S17 B;  1QG7 A;  3MXN A;  2F0K A;  2RA4 A;  3MC0 B;  2SEB D;  4FF1 A;  1HHV A;  2XN9 C;  2IX1 A;  1ROD A;  4XQQ A;  5M3M B;  2O5I C;  2K6A A;  5DM6 3;  4DK0 A;  1F2M A;  1DOM A;  4BBR B;  5K5P A;  4IZ8 A;  1PTO D;  4CGY B;  2E2I B;  2G9D A;  2XRS D;  4ILW A;  1IKL A;  3R8B A;  3TZD A;  2RDG A;  2C9O A;  3HOY B;  5NUC A;  3H0G B;  4ZAI A;  1DJR D;  2K28 A;  3MTS A;  3OMG A;  5DAU A;  3K58 A;  1ET6 A;  4ME5 A;  1EZ8 A;  1UNS A;  2HUG A;  1D1K A;  5JVG 3;  1Q90 A;  4Y7N B;  1U4R A;  1F9Q A;  2KQ3 A;  3J7Y W;  2ICI A;  5IGF A;  3V05 A;  3VYS A;  2C5C A;  5KND A;  3A7L A;  1MD2 D;  2AQ1 B;  2EY1 A;  5C4J B;  3OMC A;  1QOH A;  3GTL B;  2JA7 B;  2F0J A;  4KY6 A;  5BN4 A;  2XSC A;  4KK7 A;  1IKM A;  1BOS A;  5K36 H;  5T1G A;  2NN6 I;  4G57 A;  3S1M B;  5FO9 B;  1DYQ A;  5FOB B;  5IIF A;  1AW7 A;  3SK4 A;  1BF4 A;  2B8G A;  1OXU A;  3TP5 A;  3LWU A;  2PW5 A;  1Z47 A;  3X3M A;  3Q24 A;  2SNM A;  5KNB A;  2H4O A;  2DNC A;  3GTO B;  2SDF A;  3VR2 A;  1ENF A;  1Y8P B;  1AN8 A;  1XWE A;  3KLS X;  2BDN A;  2F0W A;  4KY5 A;  3DXJ C;  3CRL C;  2KJX A;  4IUV A;  2QIL A;  2VXW A;  1UUP A;  3PIP 3;  5KEE A;  4Q5V A;  4KJO A;  5K36 G;  4FF2 A;  5KRU A;  4C3I B;  2F0F A;  4L8J A;  4F87 A;  1EY0 A;  1HFN A;  2IL8 A;  2IX0 A;  3OSO A;  4ZRZ A;  3WDN A;  2WAQ B;  4FVM A;  1EOT A;  1STH A;  2EPB A;  1SE4 A;  2Q8T A;  1VMP A;  1KNA A;  1IYV A;  1ESF A;  2B2W A;  1JWM D;  3SDZ A;  3C2P A;  1U9R A;  1JR0 D;  3PIO 3;  1Q12 A;  1JQY D;  1MSG A;  4RHS A;  4BBS B;  3UI2 A;  1SYE A;  5A35 A;  5A2Q L;  3NTI A;  3NTH A;  3GO5 A;  4A3D B;  3DUZ A;  3ND8 A;  1SFO B;  3FDT A;  1AEX A;  1RKN A;  1CFM A;  1SMY D;  4HMI A;  2RSN A;  1JOQ A;  1LLR D;  3QWN A;  1C4Q A;  1EZ6 A;  3G6J B;  4HN7 A;  5HUR A;  3K57 A;  1XX8 A;  3I91 A;  5E4X A;  3A55 A;  2K5D A;  3CQZ B;  4BY1 B;  2EYF A;  3R2T A;  3QOJ A;  2JEB I;  2L9H A;  4KHZ A;  3DM1 A;  4RKB A;  3O13 A;  4CJ2 C;  4HCS A;  4XYO A;  2R61 A;  4A3E B;  3IFT A;  1BXT A;  3D3R A;  4RA8 A;  2KED A;  1STG A;  2HCI A;  3S15 B;  4RKL A;  3E0J A;  1H9J A;  3SR1 A;  3HP3 A;  4ABN A;  3PO3 B;  4RHR A;  1GUG A;  3VYU A;  2D5D A;  4WOR A;  1BO0 A;  1EYD A;  5CV7 A;  3QO2 A;  4CJ1 B;  4MHE A;  2PQE A;  4PMB A;  4S3S A;  1NUC A;  4DNT B;  1F77 A;  3S14 B;  2EDG A;  3IAY A;  3X3N A;  1FYC A;  3RZD B;  1JWS D;  3URY A;  5I9O A;  1F2Z A;  2HQE A;  5JEA H;  1II3 A;  1IL8 A;  3J81 E;  3NP8 A;  3NQI A;  3T53 B;  3S1Q B;  3SXH A;  2EVB A;  5ELB A;  1B2T A;  1E2V A;  3BVZ A;  2Q8I B;  3MHB A;  1R4P B;  4ZYS A;  4IUN A;  5EPK A;  1CQV A;  2R93 B;  2F0U A;  1AZQ A;  4L6T B;  2QCP X;  4NKL A;  1Y1V B;  3QIA A;  1PRT C;  4HR7 B;  4TQU S;  1WD0 A;  4IUU A;  2D2C C;  5JEA G;  2E2D C;  1EWH A;  1EY5 A;  2K7V A;  5LL6 X;  2L12 A;  1I4G A;  4IUQ A;  3NBI A;  3OIP A;  1B1Z A;  4G7H C;  5FLX L;  1EEI D;  2ZXR A;  1TS5 A;  1TKW B;  3PO2 B;  1M4V A;  1DM0 B;  4R9W A;  3N52 A;  5M5W B;  4K5W A;  1QNK A;  1SNP A;  4U68 A;  5C5M A;  1X3Q A;  5I4D A;  2M2L A;  1LTA D;  4R8N A;  4XT3 B;  4G7Z C;  4RGT A;  2KEC A;  4WJW A;  2R3Z A;  1QNU A;  3TP6 A;  3BDC A;  1LAC A;  4KJN A;  2PW7 A;  1MI2 A;  1YNN C;  4B9W A;  3LWE A;  2M00 A;  1Q8I A;  3MZ5 A;  4A3M B;  2QF7 A;  1V1P A;  5I6W A;  1IHZ A;  1RTN A;  3MEH A;  2F0H A;  3T16 A;  1HQM C;  5E4W C;  2HDL A;  3JAM L;  1PMR A;  5C3W A;  1A15 A;  3DWP A;  5AFW A;  1JOK A;  1FR3 A;  3CKI B;  2L4N A;  4FXG C;  3S1N B;  4IQZ A;  1PTO F;  1Y8N B;  1ONL A;  3SK6 A;  2VUM B;  1B44 D;  1B53 A;  1LTS D;  1DON A;  1LTT D;  2EYH A;  1LAB A;  1VMC A;  1EQT A;  5M5X B;  1PDQ A;  1X3P A;  2ICE C;  1PTO B;  2EY6 A;  2Y0S B;  1KTK A;  3D6C A;  3E6Z X;  3NHH A;  4NDX A;  1A3U A;  4E6I A;  2B2Y C;  1JOR A;  1I3Q B;  1ZKO A;  2O4X A;  2FMM A;  1DZ1 A;  4JBW A;  2MJ8 A;  2RQX A;  1EYA A;  3EVQ A;  2VB2 X;  1QWY A;  3M3Y B;  3SHL A;  2BA0 A;  3BVM A;  3TZU A;  1B9M A;  2EOT A;  1NSN S;  1CZW A;  1D5M C;  2IT1 A;  2KCC A;  1TT2 A;  3NQT A;  1B50 A;  1WTO A;  1ZEQ X;  4K6D A;  1Z7T A;  4QMG A;  2PMZ B;  3GTM B;  1BUV T;  4KKU A;  4IFD H;  3D4D A;  4B08 A;  2NB0 A;  1ZYR C;  3L7Z C;  4FXK C;  2NVT B;  3C46 A;  5FO7 B;  2FJ2 A;  2TSS A;  2ZT9 C;  1J9O A;  2Z1C A;  2HCC A;  3LX0 A;  4ZKC B;  4DAY A;  5LHY 1;  4PV1 C;  3DWQ A;  5C0X J;  3M85 A;  2JA6 B;  4LK1 C;  3C1E A;  3H91 A;  2L0C A;  3I8Z A;  4I7Z C;  2MHV A;  4C2M B;  3GP7 A;  3MXP A;  1PRT D;  1F9P A;  1CA5 A;  4MN3 A;  3F2U A;  1Q1E A;  2OEO A;  2AWN A;  4HED A;  5EQ0 A;  4IFD G;  1LT6 D;  2B2V C;  2WIN B;  3SK5 A;  2FFK B;  4NMZ A;  4XDX A;  1EU4 A;  4DF7 A;  1R9T B;  3NWT A;  4H44 C;  1JIC A;  4HSP A;  5LL6 S;  3SVM A;  4N9T A;  2I46 A;  1EIH A;  2IJ0 A;  1V1O A;  5D14 A;  1O78 A;  3K0Y A;  3MFY A;  5JJZ A;  2PZW A;  1STE A;  3T56 B;  2F0M A;  4NP5 A;  4RGO S;  4BA1 I;  4R8I A;  2LS0 1;  1S5C D;  1TWA B;  1BBX C;  2KOL A;  5I2X A;  3BVG A;  3KLS A;  1FNV A;  1WTV A;  3KUP A;  2VNU D;  1OXX K;  2NVX B;  3NUC A;  5CR3 A;  1O80 A;  4RAU C;  1GUT A;  4A3F B;  2A74 C;  1STB A;  3TSS A;  2NVQ B;  3R2I A;  1EYC A;  3M4O B;  2SOB A;  4A3J B;  3L3O C;  1TWF B;  3S9W A;  2L1B A;  2XNA C;  1SNQ A;  5DEH A;  4FXD A;  1GUO A;  2B39 A;  1SE3 A;  4H13 C;  3DMU A;  3VYT A;  2XRQ D;  3QOL A;  2EY5 A;  5CBA E;  5E1F A;  1A6X A;  3MFG A;  1EFI D;  2B63 B;  2K33 A;  4RFB A;  2IWH A;  2WV6 D;  5C4Z A;  2MUY A;  1PXU A;  5IT9 E;  1BNZ A;  2EYL A;  2SNS A;  1W6J A;  3EJI A;  5C0X H;  2K32 A;  2R7Z B;  2AWO A;  4MIU A;  3FKI B;  3PV0 A;  3HZX A;  4KN4 C;  3TP8 A;  1L0X B;  3FPU B;  5DNF A;  4V0B A;  4XT1 B;  2RDH A;  4TSS A;  4G4K A;  4UDU C;  3GTQ B;  1AFP A;  1G8Z D;  3K5O A;  4BY7 B;  1ET9 A;  1XXG A;  1RD9 D;  1I6V C;  2O2L D;  1IW7 D;  1NR4 A;  1F2L A;  1MBY A;  1IYU A;  3OWE B;  2F0E A;  2E2J B;  3DHQ A;  1BCP C;  1EWC A;  2EJM A;  3QJY A;  4J1M A;  5C0X G;  3HOU B;  1ZYR D;  5E3F A;  3NK9 A;  4IFD I;  3PMF A;  1F2Y A;  5EBC A;  2CHB D;  2MGS A;  3ITP A;  1LTI D;  1NR2 A;  5IGD A;  5C44 B;  2PZT A;  2F0G A;  3K59 A;  4OL7 A;  2WB1 B;  2ID0 A;  2EZV A;  1LV9 A;  1D1I A;  1KAB A;  4X3U A;  1SNM A;  1D6E C;  1LT4 D;  4DGZ A;  4ZK9 B;  2BA1 A;  1I4Q A;  3GQB A;  5FO8 B;  3R3O A;  1WTX A;  4FO2 A;  3A8I E;  1SNC A;  1LTB D;  1SAP A;  4ZQ3 A;  1EQV A;  3I4N B;  3W2D A;  4BA2 I;  2EYJ A;  3FMC A;  3VA5 A;  1EY9 A;  2ENB A;  3J80 E;  1OXS C;  2J4X A;  3D8G A;  1SJE D;  3QG1 A;  1VDZ A;  2K5W A;  3MA2 B;  2RBM A;  4A3K B;  1SYF A;  3J81 L;  1QE6 A;  4QUF A;  3S16 B;  3K5L A;  2AQ2 B;  2K01 A;  4RWS C;  1S4Z A;  1SEB D;  4CKB A;  4CBV A;  3AMU A;  4UAI A;  4QCL A;  4RCN A;  5ISR A;  5CYU A;  4XIG S;  5J22 A;  3H3V C;  1G2S A;  1EY8 A;  2F1M A;  1GOZ A;  4DFA A;  4HTH A;  1G91 A;  4A93 B;  4PMC A;  5EKI A;  1VF5 C;  2F4I A;  3CU7 A;  1G6Z A;  1X32 A;  4PNY A;  3I3C A;  1A3T A;  1EY4 A;  4DAP A;  5C6A A;  2BOS A;  5IOC A;  4QIW B;  2QDB A;  1FD7 D;  3T4A C;  3J7A F;  4NW2 A;  1Z6H A;  1MSH A;  1SDF A;  4LMQ D;  4OO1 H;  2N55 A;  3NE5 B;  2HDM A;  1DD2 A;  2F0S A;  2LKV A;  2EYM A;  3T51 B;  2B2W C;  4K2K A;  3K5N A;  2XVS A;  2IPK D;  3C3L A;  5CMD A;  4FP5 D;  5C3E B;  2FIN B;  5CV5 A;  4FF3 A;  1KLG D;  1Y1W B;  1KDB A;  3AU7 A;  3P7J A;  4XYQ A;  5CV4 A;  1TU2 B;  5C0X I;  5CV6 A;  2F0N A;  1TWH B;  4AYB B;  1S5F D;  4QUC A;  5HGT A;  3OW7 A;  1JOO A;  3GV6 A;  2A69 C;  4OO1 G;  1SYC A;  2F0L A;  5T1I A;  2KEE A;  2KVM A;  2J0T D;  1GUW A;  2L5T A;  3WOF A;  1BCP D;  4CHT B;  1L0Y B;  3QB3 A;  2N88 A;  2O5J C;  4J8Q A;  1PZJ D;  4RH6 A;  2B2T A;  4G7O C;  1CA6 A;  2AQ3 B;  3VR3 A;  4C3H G;  1LO5 D;  2NYZ D;  4DXG A;  3TP7 A;  5FKA C;  3DWA A;  4HCE A;  1KAA A;  1SJH D;  3AB9 A;  1PRT F;  2PZU A;  1HUM A;  2JA5 B;  4XQN A;  4DAV A;  5KYL A;  5C3X A;  4OHJ A;  2PPB C;  4KN7 C;  3MWY W;  2PO4 A;  1XYI A;  4KTA A;  1PRT B;  2EYP A;  3GD7 A;  3P1H A;  5IOD A;  1HQR D;  1PYW D;  2F3W A;  2V4D A;  1SSO A;  4GZY C;  1S5E D;  4Q0F A;  1EY7 A;  1GJX A;  1SYG A;  5I9P A;  4K8J A;  4HSV A;  3PUV A;  1T5E A;  2H1E A;  1S5B D;  3V96 A;  1QB5 D;  4DNR B;  3EQL C;  1PTO C;  1ESR A;  4Z9C B;  3PUZ A;  1A3V A;  4EQO A;  1UAP A;  3KBX A;  3EA6 A;  1Y69 U;  3U9S A;  4C3J G;  1CQF A;  4L63 B;  1YNJ C;  1KDA A;  1H9M A;  2LY7 A;  2F0T A;  3LNN A;  5IGC A;  3RD4 A;  5ELE A;  4WRD A;  1HTL D;  2ZXO A;  1E0B A;  4EGV A;  2F3V A;  3HG9 A;  1QIL A;  4KD3 A;  4BWG B;  5M5Y B;  4FYD A;  2RVL A;  4CJ0 B;  3D4R A;  2L11 A;  5KIX A;  2K05 A;  1B3A A;  2JYO A;  1RHP A;  3D6W A;  2BDO A;  1KLU D;  5ELD A;  1CT1 D;  1ICW A;  2QKI C;  4C3H B;  1TVX A;  5KYI A;  4FNF A;  1O7Y A;  2GA4 B;  3C1F A;  3VR4 A;  4QF4 A;  4XTC S;  5KGU A;  4X3K A;  4OO1 I;  4K14 A;  2WKC A;  4OIK A;  1WTR A;  2X6L A;  2F03 A;  2Z8L A;  3I70 A;  1AZP A;  3Q0A A;  1WVL A;  4DXF A;  4CKC A;  3MXG A;  5ELC A;  1HFG A;  3A8K E;  4M1U B;  3I72 A;  4X3T A;  3SK8 A;  3HRZ C;  3VR5 A;  2A69 D;  1BR9 A;  3N6R A;  2RSO A;  4IUP A;  4DK1 A;  1TWG B;  3KF8 A;  2F0Q A;  5EBD A;  2RKS A;  1FNW A;  1ML0 D;  1G2T A;  5JVH 3;  3M7N A;  2FHT A;  2DN8 A;  3FRP B;  1LTG D;  4C3J B;  1GHK A;  4RCO A;  1MGS A;  1OO9 B;  2JEA I;  3ERO A;  5IT9 L;  1Q3L A;  2A73 B;  2EXZ A;  3S1R B;  2CW0 C;  2R92 B;  1SMY C;  3U9O A;  2YU9 B;  1K8M A;  5FK9 C;  1YNN D;  2NTS A;  4B9X A;  1V43 A;  4M8A A;  2PYK A;  4ULL A;  4C1N K;  1A2T A;  1LTR D;  3W3A A;  3R93 A;  4C3I G;  3H94 A;  1CHP D;  2PCF B;  1V8Q A;  1CK1 A;  3NTK A;  1HRJ A;  3TBI B;  3M4Y A;  3H09 A;  5EKL A;  3I90 A;  1K8O A;  1HXY D;  2XWJ B;  2F0P A;  5COY A;  4RGM A;  1SYD A;  5C4H A;  2EY2 A;  4EQP A;  3I4L A;  1A2U A;  2BE5 C;  4YIJ A;  1TWC B;  4KHV A;  3OPO A;  1YNJ D;  5CV8 A;  5C4X B;  1CI3 M;  2E2H B;  3D4W A;  3VA7 A;  1HTP A;  5EJW A;  4A3G B;  4XQJ A;  2VB3 X;  4KY7 A;  4A3I B;  1SE2 A;  1GHJ A;  1GUN A;  3V2T A;  1F9S A;  1R4Q B;  1PFN A;  1I4P A;  3HGB A;  3MXU A;  2WAC A;  2K04 A;  5IGE A;  1JWU D;  3FEW X;  5COR A;  1LT3 D;  5F2D A;  1AP0 A;  1JC7 A;  2A68 C;  2D9U A;  3PUX A;  1EL0 A;  3TME A;  4IUT A;  3HOV B;  2KCN A;  1H9S B;  3J80 L;  3FPP A;  4F88 A;  3OHX C;  4EQN A;  3BYY B;  2D62 A;  3BZD B;  1PZK D;  2EJF C;  1ILQ A;  4EVO A;  1DCZ A;  3G7L A;  1E2W A;  1G29 1;  1I50 B;  3RLF A;  1WTW A;  3EFX D;  1PZI D;  1TS2 A;  2KUM A;  1OXT A;  3KLR A;  1BCP F;  5BN3 A;  2G9H D;  3OIQ A;  2J7Z A;  3DEP A;  1QCB D;  4A3B B;  1STA A;  5JEA J;  2AUK A;  3KK7 A;  1S5D D;  1BCP B;  3H6M A;  1UEA B;  3I73 A;  4KMU C;  3A54 A;  5JPN C;  3HOZ B;  1I4R A;  3ERQ A;  5G3L D;  4C56 C;  2OXP A;  3VR6 A;  2WP8 J;  3K5M A;  2A6H C;  2JA8 B;  2NVY B;  2F0V A;  3PUY A;  3BG3 A;  4K5X A;  5EGT A;  3FVQ A;  1PFB A;  4ID6 A;  4IAL A;  2I07 B;  4U67 3;  1EIG A;  1JB3 A;  1B9N A;  3RZO B;  2DY7 A;  2YYZ A;  2JXM B;  1GUS A;  2CW0 D;  2MP1 A;  4JK1 C;  3M7G A;  5J39 A;  1D2B A;  2E74 C;  4F7X A;  3HEJ A;  2E76 C;  5JOB A;  5J1Z A;  1O7L A;  3DEO A;  2XWB B;  4PMW A;  1W6K A;  2X6G A;  3TDQ A;  3K6O A;  1WCM B;  1GXD C;  4XXE A;  5CC4 A;  1DXM A;  1WD1 A;  2K5Q A;  3NWS A;  4LAA A;  3HKZ B;  4KI0 A;  1SYB A;  2L55 A;  3A7A B;  2F0I A;  4DN4 M;  3Q6S A;  2A6E C;  2K1B A;  4KKS A;  3GTK B;  1PTO H;  5TSS A;  2BE5 D;  1TQO A;  3MAQ A;  5EKK A;  1KNE A;  5A2Q E;  4IUR A;  1CM9 A;  1XTC D;  4IN3 A;  1EU3 A;  2NBF A;  1LT5 D;  3SEB A;  1SXT A;  4LJZ C;  5D3I B;  1Y8O B;  3D31 A;  1PLF A;  1TII D;  3BDL A;  3GTG B;  1I4H A;  3CHB D;  4HAE A;  3PUW A;  1TY2 A;  3WOE A;  4HMJ A;  2A68 D;  3NXW A;  3Q22 A;  4J6H A;  4ZLT F;  3T13 A;  3E5S A;  1WTP A;  4RGN A;  1JCK B;  1OXV A;  3IKJ A;  2QEJ C;  1BDO A;  2JP1 A;  3BDO A;  1BQQ T;  3MVV A;  1HUN A;  1FGB D;  4KD4 A;  2K03 A;  5DM7 3;  2DNE A;  3OOC A;  4ZUJ A;  1TR5 A;  2EE1 A;  2B2Y A;  2PNR C;  5JPM C;  4OGQ C;  1HPC A;  1KDC A;  1VCI A;  2OT2 A;  3IL8 A;  2CVR A;  5JAV A;  3S2D B;  1I4X A;  4I65 A;  4IFD J;  1E2Z A;  2TMP A;  5IGG A;  2B2U A;  1DOL A;  3S2H B;  2EJG C;  4P2C B;  1TS4 A;  3P75 A;  2JE6 I;  4KV6 A;  1WTQ A;  1U4M A;  2IW3 A;  2KHS A;  2JSO A;  1U4P A;  4DU9 A;  2A6H D;  1D5Z C;  4OIJ A;  5D65 A;  3HOX B;  1SBB B;  4BS9 A;  1STY A;  2M9V A;  2Z4H A;  5I2Y A;  1I6H B;  2NWG A;  1EY6 A;  2LMC B;  1HA6 A;  3BYT B;  1C48 A;  2ZXP A;  4H0L C;  1ILP A;  2F0D A;  3A56 A;  1CHQ D;  2NTT A;  2WII B;  4CKE A;  4KKT A;  1SND A;  1RTO A;  1HCZ A;  5M9O A;  2RDF A;  2FMC A;  3A8J E;  2DY8 A;  1O7Z A;  1D5X C;  2XIW A;  4QB4 A;  5FLX E;  1H9K A;  2B2V A;  1TS3 A;  1TY0 A;  3L9A X;  2R6G A;  4ODG A;  2B2T C;  2IX3 A;  5ELF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...