4HMJA

Crystal structure of staphylococcal nuclease variant delta+phs l36d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmjA00
1SNCA 1AEXA 4IZ8A 4DU9A 3OMCA 3SHLA 3DHQA 4ZQ3A 2EYOA 3BDLA 5C3XA 1A3VA 3E5SA 2HQEA 3PMFA 2F0TA 3SK5A 4B9WA 5CC4A 4KD4A 4F8MA 5EKKA 4PMBA 1SNMA 2EYPA 2PW7A 1JOOA 3MVVA 3OWFA 1STBA 1STHA 5EGTA 3S9WA 4IALA 2F0HA 3C1FA 3R3OA 1SYDA 2EYFA 1SNOA 3T16A 5I6YA 4NP5A 5IGFA 4H7BA 4ID6A 2KQ3A 5JAVA 4J6HA 3HZXA 3H6MA 4J1MA 4R8NA 4KTAA 4RKLA 4N9PA 1II3A 4MIUA 4QMGA 4ZUJA 5I6WA 5IGCA 1JORA 3MHBA 4PNYA 1A2TA 1SYFA 2F3VA 4OL7A 5KYLA 4HMJA 3U9OA 1KDCA 2EY2A 4KY7A 5KEEA 3TP6A 3QOJA 5E1FA 2SNMA 4KD3A 2RBMA 3SK8A 4IUNA 4K2LA 2F0KA 3SK6A 5HGTA 5C5LA 1EQVA 4KJNA 2F0EA 2F0LA 4EQNA 4KV6A 2NUCA 2SOBA 1STYA 1EYAA 4KY5A 5IODA 3ERQA 4K5VA 4KY6A 5NUCA 4NMZA 1TR5A 5ISRA 1KAAA 2PZUA 2F0QA 1KABA 4K2KA 4YIJA 5K5PA 3D4WA 5JOBA 2SNSA 1EYDA 2M00A 1EY0A 4NKLA 4EQPA 1RKNA 1STGA 4G57A 4F7XA 5CV8A 3RUZA 3OMGA 5EKLA 5I9OA 3HEJA 1EY6A 1SYCA 3EJIA 3P75A 5IGDA 2F0MA 1F2ZA 1U9RA 2F0SA 5CV6A 5C4ZA 5IGGA 3V2TA 2F0WA 4ME5A 4EVOA 2EY5A 1EY8A 1NUCA 3MXPA 1IHZA 5IGEA 5KGUA 3NUCA 4K5XA 5KRUA 3DMUA 3NQTA 4B9XA 2F0FA 1KDBA 1NSNS 1STNA 2EY6A 3MZ5A 2PZTA 2WACA 5CV7A 3SK4A 5E3FA 2PYKA 2EY1A 4KJOA 1EY7A 4S3SA 1A2UA 5CV4A 5J1ZA 3SR1A 4K8JA 4N9TA 1TT2A 4PMCA 5KYIA 2F0UA 3BDCA 4LAAA 1ENAA 1SNDA 3NXWA 1SYBA 1EZ8A 2LKVA 4HTHA 3QOLA 4WRDA 3D6CA 3C1EA 3MEHA 5DAUA 2OF1A 5CR3A 2F0PA 3VA5A 4K14A 1EY4A 5J39A 4DF7A 1EY9A 2F0DA 3SXHA 5J22A 2OXPA 1F2YA 2EYMA 2EYHA 2F0IA 3TP5A 4DGZA 5C4HA 2EXZA 4TRDA 5M9OA 5C3WA 3LX0A 2F0JA 3EVQA 3P1HA 2KHSA 4KHVA 5F2DA 4ZUIA 2RDFA 4QF4A 1TQOA 5HURA 2F0GA 5C5MA 2F0NA 3D8GA 3OSOA 5CV5A 2EYJA 2PQEA 3T13A 3TP7A 5DEHA 2PW5A 5C6AA 1KDAA 4E6IA 3NK9A 2O4XA 4I65A 4NDXA 2QDBA 4DFAA 5I9PA 3ITPA 1SYGA 4WORA 1F2MA 2F3WA 4EQOA 2F0OA 1EZ6A 1EYCA 2PZWA 2RKSA 1SYEA 2OEOA 3NHHA 4K6DA 4QB4A 5CV9A 3TMEA 5IIFA 2ENBA 4K8IA 5KIXA 2EYLA 4ODGA 1SNQA 1A3UA 1EY5A 4RKBA 3QB3A 1JOKA 1A3TA 3NP8A 1ENCA 3D4DA 3EROA 1SNPA 1STAA 2F0VA 4K5WA 5CGKA 4HMIA 5IOCA 1JOQA 3TP8A 5IGBA
chains in the Genus database with same CATH superfamily
5E7NA 3X3MA 2JEBI 3P7JA 2PQAA 3PO2H 2IJ0A 4QUFA 3GTQH 1QB5D 3BZCA 4DNTB 1STHA 2I5MX 4UY8C 3JAMc 2N3SA 3RLFA 2VY3A 3CCRA 4HIKA 1LYLA 3K5MA 4RMFA 4IN3A 5GROA 3H6MA 4LUZA 1AZQA 4N9PA 2K04A 1U5KA 2D2CC 2HDLA 3I56A 1JORA 4FXKC 4KY7A 5IYBH 3LGJA 1U4PA 2B2WC 3HOUH 4A3DB 2NN6H 2R7FA 1FL0A 4FF4A 4HJ8A 1KRTA 4GKKQ 3T1HQ 4NMZA 1TR5A 2A6HD 4HN7A 3MAQA 3M9BA 1LTLA 3M4OB 5BR8L 4NKLA 3GTLB 3OMGA 1B3QA 1WTQA 1DM0B 2IY5B 5IGEA 4QQBX 1R9TH 3PSIA 4R4TA 2PI2E 3DMUA 2MHVA 3T1YQ 2CWAA 2F0FA 3MEFA 3MZ5A 3K59A 5BN5A 2EIFA 1CQFA 4B3SL 1OXVA 2XRQD 1M1KC 4C3IB 2K5WA 3M4PA 1CI3M 1O7LA 2EJMA 2QCPX 1A63A 1I6HB 4WRDA 3AEVA 2K7VA 2IX3A 4LMQD 4B3ML 3A8JE 3UE1A 4DF7A 4MTNA 3TS2A 3H15A 1G2TA 1I3QH 2NN6I 4DR7L 3KYHC 1IBKQ 3LX0A 2UUAQ 4DNIA 1MIUA 2PNHA 2F0NA 3T13A 1YNNC 1GUGA 1FGBD 4A3IG 1IW7C 1RIPA 1MI2A 1B9NA 3ITPA 1CZWA 2VB3X 4G7ZC 4AQYQ 4B3RL 1DOLA 4RHSA 2B2TA 5KIXA 3E0JA 2CCZA 1MBYA 1X54A 1IW7D 1RDPD 3TQYA 1BBXC 2F03A 3TP8A 4GLXA 5DM73 2D0PA 4LFAL 1BOSA 4OXPA 3I8ZA 3KF6B 3N6RA 1QCBD 1LTBD 2UXDL 3K7AH 2HQEA 1JB7A 4PMBA 5JJIA 4OHJA 2E8GA 5C3EH 3C1FA 1CZGA 5J22A 3MA2B 2OCEA 5KNCA 4IPCA 3PO3B 4O2DA 1HJPA 1J6QA 4IPHA 4A3IB 4IPDA 4LF9L 4OO1H 4LUOA 3K5NA 1Q12A 4KD3A 1RTOA 3SK6A 1TWGB 4J15A 1EL0A 3DUZA 3VR5A 4EQNA 1L0XB 4KY6A 2QDLA 1S5FD 1X56A 2L55A 5EJWA 3MFGA 5K5PA 4KKUA 4A3EH 2WIIB 1Q1BA 1SRUA 2E76C 4DAYB 1F2ZA 2K6AA 1AN8A 1V1PA 2ZM6Q 3F2BA 3I70A 1N34L 3MXPA 1YNJD 5AJ3L 3NUCA 2DY7A 4DV6Q 2ZT9C 1I6VC 2ICIA 4RCNA 3I4OA 5I2XA 5M5YH 1UNSA 1PTOC 1SEBD 3C3LA 2N88A 3CMEA 2F4VQ 4OO1G 1E24A 4LK1C 5C4JB 4A93H 1D7QA 1I50B 5IY0A 4FO2A 1T5XD 2JA5G 5LL6S 5DAUA 5IYDH 3RZDB 3K58A 1BBWA 5EKIA 1BQQT 1DXMA 2WAQB 3BJUA 3J81j 3CC2A 1CSPA 2AQ3B 2JJQA 4DV7L 1YIJA 4XQJA 1IL2A 2HHHL 3S14B 2NZOA 3U4VA 2VNUD 2MPMA 4CJ1B 4O1NA 1KL9A 4E6IA 2YTXA 2ZJPA 3EIVA 4I7ZC 1IBKL 3BS1A 1IBLL 4HSPA 2WP8J 5ELDA 3Q0AA 1JT8A 1D5ZC 2XWBB 1TU2B 4DV6L 2KHIA 2K75A 4XYQA 5LMUQ 1VQJA 3OTOQ 2X6LA 2Z4IA 3WWVA 3S24A 2KCCA 3M3YB 3S1QB 3G4SA 3TSSA 1VQ7A 4HJ5A 3M4OH 3GTKH 1K8OA 2K4KA 2I0QA 2BE5C 1E2VA 1UE7A 3ULLA 3SHLA 4BA1I 2A6HC 1XTCD 2N78A 2GA4B 3KBGA 4GLVB 1EFID 3ND8A 1X3EA 2RVLA 5EKKA 2EYPA 2OTLA 3GTMH 4LF5L 4DAMA 1HQMC 2KQ3A 4J1MA 3G48A 3H94A 2IW3A 4CKBA 2K5HA 5GAGC 2AQ2B 3K5OA 1Y1VH 2ZXRA 3DEOA 3VR2A 1AW7A 3MXUA 3CPFA 4YCWA 4CJ0B 2F0KA 2M9VA 4JVZA 2QA4A 1RL2A 3EQLC 1Y1WG 4IJHA 2IWHA 1F9RA 1G51A 4GNXB 3MFYA 1KHIA 1DD2A 5NUCA 4F88A 4FDBA 5EAYA 2PZUA 5C44G 4YIJA 1EYGA 2HIXA 4FF3A 1RF2D 3QJYA 1XNRL 1EY6A 2NVTB 1LTSD 2K01A 3S15B 1PYBA 4JI5Q 1TS4A 1RCVD 5JJLA 5HGQA 2JA8G 3VYTA 5L37A 4DK3C 4V0BA 3X3NA 1GM5A 1J9OA 4AYBB 1XMQL 5A35A 1S5ED 2VQEL 3HOUG 1GVPA 3DLLA 4LAAA 4GKJQ 3QO2A 2EZVA 4R4CA 2EJFC 2E2JB 3BYTB 5J39A 2IHFA 2K05A 2N55A 3CKIB 3FPUB 2VW9A 3FHWA 3RD4A 1Z47A 1SE4A 1WFQA 1QZGA 4KHVA 4JI1L 3HKZB 1VMCA 1MGSA 4BXXH 4DFAA 5E4XA 1B1ZA 3QG1A 3S2HH 1X55A 4A3MH 1HZCA 2K5DA 3F2CA 4ME3A 1EUJA 4ODGA 1PH4A 1K3BC 3NP8A 3HOVG 3NBHA 4QCLA 1JE5A 1BCPF 4DV5L 2XNAC 4DR4L 2Y0SG 4JBJA 4APVA 4F87A 1A3VA 4C3HB 1G2SA 2L9HA 4DR5L 4IJLA 2PW7A 4JW0A 4OGQC 1GUSA 5EGTA 1K3RA 4A3LH 1Y1WB 4KTAA 1N34Q 3A8IE 4RH6A 3GTLH 4B3MQ 3K0YA 1Q46A 2F3VA 1KDCA 4JOIC 1L1OB 2PMZE 4L5QA 4DV3L 4IUNA 4JI6Q 3W2DA 1UWVA 3HOXB 3S2DH 2NUCA 4J8QA 1ZEQX 1YZ6A 5G3LD 1EYAA 1CA6A 3GV3A 3J81E 3IAYA 2QKIC 1PTOH 5M5WB 4RAUC 4JBKA 3T53B 4XDXA 3PUXA 2SNSA 3KLSX 4EQPA 3CAMA 4CBVA 3K57A 5JVG3 4BBRH 4IOAA 3DWPA 2XSCA 3FKIG 3I2ZA 2XN9C 4Y52H 4JI7Q 2OTJA 1SR3A 1LTTD 4CDFC 4Y7NH 4NPSA 1EU4A 1PFSA 2WV6D 1PH5A 4B9XA 1KDBA 1NSNS 3HOVH 1PHJA 5KNDA 1B7YB 1SFOH 2AUKA 2OQKA 4X3TA 2R92H 4K8JA 2RSOA 4C1NK 3GTPH 1O7IA 3GD7A 2F0UA 1PRTD 3NTIA 4DV4L 1VF5C 3CCQA 1YI2A 3D6CA 3HP3A 3K8AA 3IKJA 2OF1A 1VQ5A 1EY4A 4BY7B 5C44H 1C0AA 1H9MA 3CRKC 2BCOA 5CORA 1RHPA 3WDNA 3J80c 2KBNA 1QVGA 3VYSA 3RN2A 3P1HA 5IT9c 2F0GA 4JG2A 1OO9B 4JOIA 3Q24A 4DR2Q 3SE0A 1PFMA 1SYGA 1SBBB 1SYEA 3OTOL 2MQHA 1BUVT 4HIMA 4NXNL 1GJXA 3BVGA 4GOPC 2G9DA 4DKAC 2UXBQ 4K5WA 4IFDH 1ENCA 3D4DA 4KMUC 1SNPA 5IOCA 3JAML 2K5QA 1SSOA 1YBYA 3TN2A 1Q81C 4KLKA 2RQXA 1TVXA 3M7GA 3O13A 2IX1A 4GN5A 1W3SA 4YWLA 1AE3A 1L0YB 3HOVB 2F0HA 4JC0A 1SYDA 5IGFA 1SE3A 3VR6A 4A4IA 3NWTA 4J6HA 1ICWA 3TDQA 3HS0C 1TXYA 3FRPB 4OWWB 3A5UA 2LMCB 2A68C 1Q90A 1XMOQ 4QJFA 1JJGA 1D6EC 5EPKA 4L8JA 2G5DA 1GD7A 3DM1A 4L5TA 1VQNA 2IX0A 2I5HA 3BVZA 1LT5D 3PUYA 5EBCA 2YV5A 4YWMA 4JI0L 2MFIA 3W5OA 1N36Q 3S1MB 4A3BB 1CKNB 5AFWA 3K0XA 1EU3A 4P72A 4F7XA 5KEEA 3UDIA 3ZYYX 1V8QA 1HZBA 1U9RA 2IT1A 1IBLQ 3V2TA 1SN8A 1XMQQ 4CJ2C 2ES2A 4CGYB 2VL6A 3LNNA 3CCMA 2Z0SA 3R2TA 1STNA 2EY6A 4DR1Q 1EWHA 1F2LA 3J7ZC 4KJOA 2Z4HA 3RZOH 2IL8A 3T1YL 5KYIA 2K28A 4GOPA 4DV4Q 2LS01 4HIDA 3CCJA 4AH6A 3KLWA 4RG1A 2UUCQ 1BXTA 4NXML 3VA5A 1XX8A 4K14A 5BR8Q 1CTMA 1D5XC 2VXWA 1VQPA 1LLRD 4ZK9B 1Q8KA 2EXDA 2HIVA 3MC0B 2GVAA 1ESFA 1BF4A 4QGUA 1PLFA 1HFNA 4WJ3M 1WD1A 5JEAH 1PH6A 2ALYB 2H1EA 2ZJQA 2RDFA 2R7ZG 2PQEA 4FF2A 3NK9A 1FJGQ 1CKMA 1E3PA 1EQTA 2ZM6L 2J7ZA 4PZ8A 5M3FB 3F1ZA 2F3WA 5CMDA 4X62L 1A0IA 2F0OA 2NVTH 3S1RB 5EBDA 4K8IA 3A7LA 3I91A 1TS5A 3CCLA 1GKHA 3KF8B 1HRJA 2K14A 1AEXA 1RTNA 1SAPA 2MP1A 2D9UA 4JBMA 3BDLA 2V1CC 3Q23A 2G9HD 1ASZA 2B2TC 4F8MA 4LF9Q 2FJ2A 1M90C 2Z6KC 2RCFA 3KK7A 2E2IB 4NB3A 2AWOA 2WKDA 4DR5Q 2L11A 1B70B 4UHVA 4MZ9A 3NQIA 4QMGA 3OHXC 3I4MB 2N8NA 2BDOA 4OL7A 5KYLA 2Q2UA 2HUGA 2BH2A 3S16H 2EY2A 1G6ZA 4Z9CB 1VDZA 3SK8A 4BWGB 1VQ6A 3OPOA 4A3IH 4DV1L 4G7HC 2RA4A 2R7ZH 4DR6L 1ENFA 3NTKA 3A7AB 2UUBL 5JEAG 1IZ6A 2UUBQ 4KHZA 4KK7A 3KJPA 2JXMB 2NZHA 4CKCA 5C3EG 4PMWA 1YITA 1KAAA 4UDUC 2DUDA 1EYDA 2TMPA 2BA1A 1RJTA 5IGDA 4A3GH 3HEJA 3CQZB 2F0SA 5CV6A 1LACA 1K0RA 3L2PA 2Z6BA 1DJRD 1KD1C 4LF8Q 2EY1A 2K03A 2CHBD 1JWUD 4C2MH 3H91A 4DAVA 2KA7A 2CKZB 3UI2A 4C3JG 4EQ5A 4RCOA 2ZTEA 1EZ8A 2QILA 1PTOF 1QUQA 3PIP3 4AYBG 4G4KA 4DV5Q 4RFBA 3T4AC 5FOBB 2OXPA 1SJHD 2EYHA 1V43A 4MNOA 3KUPA 5IP9G 3NSWA 1TWFB 2EXZA 2PO4A 2WINB 2RF4A 1I4RA 4K6LA 5ELOA 3KF8A 4DV0Q 4BY1H 2JA6G 5M3MG 1B53A 1E1OA 4WORA 1QNKA 1WTOA 2MO0A 3VYRA 4QB4A 5CV9A 1C9OA 4C3HG 1LTID 2A1AA 5A2QL 4IFDJ 4ABNA 3B6YA 4CDEC 3WOFA 1XWEA 2R7DA 4QUCA 4PG3A 1JJ2A 1KLGD 1IXRA 1SMYD 3E0EA 4X65Q 3UDFA 2Z8LA 3E5SA 3PMFA 3NTHA 3U50C 3HKZE 2UXCQ 2YU9H 3H0GH 5ELNA 1TKWB 3CMAA 1S5DD 3D6WA 1VQ8A 3IFTA 2EPBA 1B8AA 4DUZQ 2O2LD 3U9OA 2K5NA 1QOHA 2MUYA 2B39A 1JQYD 1VQAA 4DXGA 5IYBG 4GNXA 2BH8A 1L1OC 1N8RC 1CM9A 2E74C 2R3ZA 3CQZH 3AU7A 2Q8TA 4KY5A 3PV0A 4K5VA 2B2VC 1NE3A 5C0XG 1EIYB 1SJED 1KABA 2Z9HA 4JI4Q 1U4RA 1ET9A 3P75A 4FP5D 3W3AA 3HKZG 1X3GA 3URYA 2EY5A 3H3VH 4LF6L 4X62Q 1SLJA 2VQFL 3J7YW 1WD0A 2F1MA 2WACA 5CV7A 1PH1A 2IPKD 1ZYRD 2E2HB 4CHTB 2L15A 4N9TA 2JP1A 4ZKCB 3H3VC 3HOZB 1GHJA 2KEDA 1LT3D 1PH2A 3D31A 5FLXc 5E4WC 1Z6HA 4HJAA 2QF7A 5KNBA 1YJ9A 4JPBW 4JI6L 1Q3LA 2A69C 4H02A 1N9WA 3KOJA 3TZDA 3SEBA 1PFBA 4R4IA 4B3TQ 1TWCB 3E3XA 3EN2A 4OIJA 2HCIA 2NYZD 1I5FA 1E2ZA 1DGSA 2QDBA 4NW2A 3FVQA 3OWEB 2NTTA 5G3LF 3S1NH 1EYCA 1CKNA 5FK9C 4BS9A 3HRZC 5I2YA 5FLMH 1PH8A 4MTKA 2OQ0A 3HOZG 5C3XA 4A3KG 5CGKA 3F2DA 3PUZA 3I73A 4B08A 1VQHA 1HH2P 2WKCA 1K8AC 2NVQH 1EIHA 1WCMG 2A69D 3KLRA 5ELBA 1IL8A 1SNMA 2L5TA 2VUMG 1VQKA 4DV2Q 3T16A 4ALPA 1PA6A 3RZDH 4DK0A 3D0FA 3HOWG 4MIUA 3K7UC 4NXMQ 4PNYA 1JWMD 1HUNA 5J3BA 3IRBA 3I72A 4YY3Q 3N52A 2FHTA 1W6JA 2FMMA 4XXEA 5K36H 4DV0L 4BBSH 5C5LA 5D3DA 1AFPA 4R9WA 2WAQG 3J7AV 4BA2I 1JB3A 3FMCA 2M00A 2JA9A 1H9SA 5CV8A 1VQDA 2F0MA 2H4OA 4DV3Q 2F0WA 3CCSA 2C5CA 3S2HB 1HNXL 2LSSA 3G6EA 3HOWB 3BVMA 1SE8A 1LM0A 1NCVA 5C4XH 4S3SA 5IP7H 1L1OA 3QWNA 3E6ZX 5DM63 3A55A 3GTGH 1IYVA 5BN4A 2Z1CA 3HOYB 5EPJA 3NWSA 3QOLA 1C48A 2L1BA 3MEHA 3HOXG 2GN5A 3PO3H 2O5JC 1AE2A 2HT1A 1E1TA 1JICA 3TEHB 1F2YA 2D62A 5D3IB 3TP5A 1K83H 5LL6X 1I4QA 2NVXB 3GTJH 4TRDA 5M9OA 1TS3A 2XWJB 1A8VA 5F2DA 4AQYL 4B3RQ 1ML0D 1CKOA 2VQFQ 4X64L 1LT4D 4YY3L 5C6AA 1FYCA 3PIO3 4LF7L 3OW2A 3BZKA 2Q8IB 2K1BA 1YJWA 1VCIA 3CPWA 3BDOA 3DWQA 3CCUA 2ZTDA 4K6DA 1NMFA 3S15H 1ICFB 4NXNQ 1JJCB 1SNQA 4C1NI 1EIFA 4DR3L 1JOKA 1AP0A 1VMPA 3H0GB 1O7ZA 4FNFA 3OMCA 4DK6C 2Q8RE 4IUTA 4IUQA 2MNAA 2ID0A 4OWTB 1EWIA 2NTSA 4HEDA 2F0TA 3HG9A 3CU7A 3S9WA 5C4JH 4R4QA 4G7OC 3ND9A 2VUMH 2R92B 1HFGA 2RDHA 4JV5Q 3M3YH 2KUMA 4GN3B 1WCMH 5IGCA 2ICEC 3JAMi 4LFBL 2K5VA 3MHBA 1HXYD 1V9PA 4PZ6A 3R8BA 1I4HA 3RMHA 2K52A 3VA7A 1NR2A 3A0JA 5HGTA 4BY1B 1VQEA 4BY7H 2E2JH 4BBRB 5DLQE 1S5CD 3KFUA 3EA6A 4JK1C 2CH4W 3NENA 1NR4A 2WB1E 3E9IA 4OEMB 4RA8A 4PQXA 3I4NB 3NPPA 4JI7L 3D4WA 2AMCB 2EVBA 5JOBA 1GUWA 1PRTF 2WB1G 1G8ZD 5IYDG 3GQBA 1NBWA 2JA5H 4EVOA 2R61A 1B3AA 1EEFD 3A74A 5C0XH 2H5XA 4X66Q 5C3EB 1VQLA 4QY7A 2PZTA 4L5RC 2PYKA 2E5LQ 1ILQA 4JV5L 3SR1A 1V1PB 5JVH3 4KKSA 4LUVA 3BDCA 1MD2D 1EQRA 1SYBA 1WTPA 4PZ7A 4FXDA 1JC7A 1YEZA 3G6JB 2UXBL 3C2PA 2F0PA 3HFZB 2MJ8A 1I4XA 2X6GA 4R1JA 2VUMB 4HAEA 1VQOA 2JA8H 4FVMA 1B4OA 1WTHA 4RGOS 5GAEC 4DR2L 3MXNB 1B2TA 4LJZC 5C3WA 2BE5D 5HURA 2KHSA 1TWAB 5CYUA 2AQ1B 3NBHB 4UP9A 3I55A 4P71A 4BBSB 2O4XA 2CQOA 4IPGA 1PDQA 1FNVA 2JE6I 1H9RA 2RKSA 2KCNA 2ZXOA 4I7AA 4TSSA 4C3IG 4JI5L 4XT1B 1A3TA 2D0OA 1R4QB 4HMIA 2FMCA 1QJOA 3S1QH 4OX9Q 5T1GA 1VQCA 3CXCA 3CC4A 2E2HH 1CSQA 4QL5A 3TREA 4AIMA 4GNXC 1KLUD 4DAYA 3PIOA 4IALA 3R3OA 4GKKL 4NP5A 5JAVA 4R8NA 2CQAA 1E2WA 4A3FB 2B8FA 1A2TA 1HNXQ 5H1SE 2F4IA 4R4OA 4GKJL 3BYYB 2UU9Q 3JC66 1YJNA 4K2LA 3OOCA 4TVAB 4GZYC 4MN3A 2WB1B 4KV6A 1OXTA 4RGMA 3S1MH 4R8IA 1TIID 1UAPA 2DN8A 1L0WA 5FJ8H 1TWHH 1WI5A 4KN4C 5CBAE 3U9SA 1XPUA 1LTAD 1XNRQ 5C4ZA 3GV6A 4ME5A 4A3DH 2ZTCA 4XIGS 1U0LA 5KRUA 4IO9A 2KVMA 2Y0SE 3J80L 1X32A 3PO2B 3WOEA 1PH7A 3HKSA 2JEAI 2B2UA 1XMOL 4OX9L 2MO1A 1QNUA 2UXDQ 4RHRA 3FEWX 3OYYA 1J5EL 3M7NA 2PMZB 3UDGA 1WOCA 1R4PB 1BDOA 2XRSD 2C35B 2HQLA 1EY9A 3L3OC 2F0IA 4DGZA 3FPPA 2Q2IA 4A3FH 2ATWA 3C46A 1AZPA 4Q0FA 1X3FA 4P2CB 3FKIB 4L5SA 1Q86C 3STBC 2PW5A 5M5WH 1DYQA 1MHWC 2FINB 5I9PA 1PTOB 1XXGA 1P8LA 1GHKA 1A6XA 3TMEA 2A6ED 1SE2A 1STAA 3I90A 2PI2A 4M8AA 5CBEE 4A3BG 2NVYH 1HQRD 1XPRA 4A3JB 3NBIA 1C7YA 1G6PA 1B9MA 4X3UA 3HOYH 2UU9L 3G7LA 3ULJA 2CW0D 4HR7B 1WTXA 1BBUA 2LXKA 5E1FA 2SNMA 1ZKOA 2KCTA 2L0CA 1P16A 3GTQB 2R93G 5LMNL 1UE6A 1STYA 3KDFA 1HNWL 1XTDA 2VB2X 4AYBE 1F9QA 1QE6A 1HPCA 3AB9A 3GTOH 3ONAB 4ZKBB 4XQQA 3PGZA 1PVOA 1ASYA 1I4PA 1Z7TA 3GDEA 3NQTA 4DUZL 3KLSA 3SK4A 3L9AX 4BY7G 1TT2A 4PMCA 3DWAA 2A68D 2UUAL 2A19A 5FLXL 3ULPA 2EDGA 3NXWA 4P74A 5LMNW 1D8LA 4B3TL 3K6OA 4HIOA 3S1RH 2KHJA 4ZCKA 2QW7A 4PV1C 4RWSC 3D3RA 3TBIB 3A5ZB 3W1BA 2EYMA 5C44B 1HNWQ 4A76A 4OWXB 1FR3A 1KNAA 2LFNA 4JBWA 1CQVA 1JCKB 2RSNA 1V1OA 3PO3G 1TQOA 1TWCH 4L63B 3TP7A 3ICEA 3JAME 2JA8B 4MHEA 1BO0A 1F2MA 2B63H 1XNQQ 3P20A 4WJ4A 1YVCA 2NVYB 3IL8A 2ENBA 5FKAC 1SFOB 2DNEA 2EYLA 1KAWA 3T51B 4DA2A 1I3QB 2DGYA 1QVCA 2F0VA 1EEID 4UP7A 1XPOA 1QG7A 1SNCA 4JI2L 4KN7C 3HGBA 2F4VL 3DHQA 4ZQ3A 2JYOA 4ULLA 5BN3A 5C0XI 5D14A 1HR0L 2NVXH 3RR5A 3GP7A 2PCFB 3QR8A 2EYFA 1SNOA 1QILA 1BCPC 1H9JA 3CF5A 3D4RA 4HCSA 3PIPA 1IKLA 1FVIA 1GO3E 2JA7H 3QOJA 3W1GA 1WTVA 1X9NA 5FO8B 1EQVA 2CVRA 4H0LC 1MJEA 2R92G 1UE1A 1F9SA 5IP7G 5C4XG 3M85A 3PUVA 1PYSB 1SMYC 3K80C 4YHHL 5A2QE 1O7YA 4EX5A 1UUPA 4K2KA 3I3CA 3MWYW 3IFDA 3FKIH 5EKLA 4BBRG 4IFDI 4DR3Q 3J81i 3LWUA 1E7ZA 4LF6Q 1X65A 1BR9A 3SVMA 1H95A 2X69A 3F2UA 4DV2L 5JEAJ 3R93A 4IUVA 1A2UA 5J1ZA 3CHBD 2ZJRA 2UUCL 2B63G 2RDGA 1I94L 1ENAA 3UE0A 1VQMA 3GTGB 5FO9B 3A8KE 1N33L 4KI0A 4A3JG 1T5EA 1CA5A 4A3LG 4DR1L 4LF5Q 1TY2A 2BDNA 5M3FG 4YHHQ 3R2IA 5C4HA 1KC8C 1KNEA 5T1IA 2HCCA 1FNUA 2DY8A 1QWYA 2AHOB 3SGIA 4GOPB 2F0JA 2XGTA 1JMCA 1E22A 2NZ1D 5C0XJ 4KKTA 2KENA 2B2YC 3EBEA 1KDAA 4DR7Q 5ELEA 4JI0Q 3FP9A 5FLXE 1LV9A 2E2DC 1EZ6A 4A3GB 4H13C 5IIFA 2FXQA 2CH4A 1A3UA 2A8VA 3CP0A 5IYCH 2XVSA 2NWGA 4GLAC 4ZYSA 4C3JB 4A75A 3HOYG 1Y14B 4BXXG 4DU9A 5LMNQ 5D65A 1LTGD 4DAPA 1OXUA 4JI8Q 2AKWB 1UEBA 4QIWE 2E5LL 1HHVA 4B3SQ 4X6AH 1HZ9A 4CKEA 1H9KA 1VQIA 3MVVA 4FXGC 1D2BA 4A3KB 1XNQL 1G91A 1MSGA 1XYIA 2L12A 4XYOA 4KHPQ 2R6GA 3KF6A 4P73A 1KQSA 5C4XB 3ERSX 1J5EQ 2R93H 3L0OA 5I6WA 4L6TB 4RGTA 1CT1D 4JI8L 3V05A 3HOUB 2B2YA 3VR3A 2RBMA 5JPMC 4LWCA 3PQIA 3K5LA 4JI4L 3S14H 1N32Q 4A3FG 4K0KL 3H0GG 5DNFA 5AJ3Q 4OONA 1WYDA 3CD6A 1N32L 1HUMA 5I9OA 4JCVE 1L2FA 4IUUA 4A3BH 5FO7B 2YTVA 1IHZA 1IBMQ 4IURA 3KJOA 4K5XA 4JI2Q 2I46A 4LF4L 4X3KA 1LUZA 2JA5B 4A3CG 3GTPB 4LFCL 3I4MH 2VS1A 4DPGA 4C3HH 4XQNA 4X66L 3L7ZC 4A3DG 3QIAA 4BY1G 2JA6H 3U4ZA 2LKVA 3PF5A 1C4QA 1YHAA 2K32A 1QZHA 3I7FA 3S1NB 5COYA 3GTJB 4RGNA 1IYUA 5FJ8G 3T1HL 1VQFA 5LHY1 3H3VI 1NY4A 1VQGA 3M4YA 5M5XH 5C5MA 1E0BA 3OSOA 1GUNA 1GUTA 3EFXD 5DEHA 1DOKA 4JI3Q 4QIWB 4C3JH 2RHSB 4I65A 1STEA 1V1QA 5GADC 1EWCA 3NE5B 4LFBQ 1Q7YC 2PZWA 5IWAL 1M4VA 2NB0A 2B3GA 2OEOA 4GN4B 1RD9D 3MTSA 3F8TA 1Y1WH 1NTGA 5M5YB 1YNND 2DNCA 3QB3A 4GS3A 4IOCA 5EQ0A 1F77A 3J80E 4IZ8A 5M3MH 1Y1VG 5ELFA 2EYOA 4TKOB 5JJKA 2K33A 2QEJC 2KECA 5IT9E 5IE8A 4A3GG 1ILPA 3UDXA 3U58A 2RCNA 5IP9H 1PZJD 1QUQB 1K0SA 2N49A 1W6KA 4JYAL 4ID6A 1CHPD 4LF8L 4V190 3S16B 1GUOA 2A5HA 2JN4A 5IT9L 1K73C 1D1KA 1Q82C 3A54A 1UEAB 1SYFA 4A93G 1VF7A 4HMJA 1G291 4DR4Q 4OELB 2LY7A 3TP6A 2B8GA 4LF7Q 2QGQA 2HDMA 3Q6SA 2F0LA 3SDZA 1W2BA 3J7AF 4YWKA 2DJFC 4OIKA 1FGUA 1PV4A 3AFQA 3KBXA 4DV7Q 3ERQA 3OIQA 4KHPL 1I6HH 1DCZA 4X65L 1JWSD 2CW0C 1EFWA 3GTKB 1TY0A 1YHQA 1UE5A 4WJWA 1ET6A 1HA5A 1EY0A 3OIPA 1FNWA 4G57A 3RUZA 4U673 3MXNA 5EPLA 2BOSA 2JQOA 5HY6A 5IGGA 3J7A5 2EJGC 5KGUA 3S17B 1EY8A 2FFKB 4WFN3 1HNZQ 1GOZA 3M4QA 3GTMB 1PZID 3G71A 2JSOA 3RZOB 1NJIC 1DOMA 1KRSA 5E3FA 4C3IH 4C56C 1EY7A 2P5ZX 3I4MG 2B2WA 4A93B 4A3CH 3H09A 4X3SA 2A6EC 5I4DA 1YHBA 1O80A 2VZAA 1A62A 1EOVA 2F52A 1HR0Q 4DUYL 1HZAA 2WFWA 5M5XB 1C8CA 2SDFA 1LTRD 1S40A 2F0DA 3STBD 1PRTC 1WJJA 1X6OA 2A73B 1SDFA 1CUKA 3VYUA 2QEXA 2EQSA 3EVQA 1ZYRC 1KIXA 1D1IA 2XIWA 3AMUA 1TWFH 2EYJA 1J8IA 4A3EG 2OT2A 1PTOD 1OXSC 1BKBA 1Y1VB 4XT3B 4EQOA 1HNZL 5IGBA 1WTRA 1S5BD 2B63B 1TWGH 3J81L 3RLNA 1PMRA 4A3MB 1K83B 2LXJA 3PUWA 2D5DA 5GQOA 1PXUA 4LFAQ 1PYWD 3BU2A 3SK5A 1HTPA 3RLOA 2K50A 3TRZA 3J81c 4DR6Q 3CCVA 1EIGA 5I6YA 4DNRB 1K8MA 2ASBA 2A74C 1SXTA 1CHQD 3HZXA 4RKLA 3AQQA 2VQEQ 4LNQA 4IQZA 4C2MB 1MKHA 1PH9A 1II3A 5GAHC 3FDTA 2JA6B 1O78A 4U68A 3PCOB 1TWHB 1N33Q 4KJNA 3K7AB 1S4ZA 3CW2C 2V4DA 1Y8NB 4OO1I 2B29A 5LMUL 4UPAA 3NELA 4CDCC 1LO5D 5M3FH 2CWPA 4M1UB 3CCEA 1Y8OB 1WVLA 1RKNA 1VQBA 5TSSA 1S3OA 1SYCA 3HOXH 3S2DB 4O42A 2O5IC 3GTOB 4FYDA 1NUCA 1HR0W 4YCUA 3LWEA 2YYZA 2UXCL 4UAIA 4IFDG 1ZXTA 3AYHB 2JA7B 1T9HA 4HJ7A 1Y8PB 2MGSA 2KOLA 2NBFA 2I5LX 5CV4A 1VQ9A 2AWNA 4HSVA 2IHEA 4N8X1 3Q8DA 4Y7NB 1DONA 3DEPA 1SNDA 4HJ9A 1CFMA 3C1EA 3VDYA 2R93B 1DZ1A 2EOTA 3T56B 5CR3A 1WCMB 4ZRZA 1M8AA 4P75A 3RNUA 4DXFA 1EQQA 4JYAQ 4N8FA 1U4MA 5ELCA 4HCEA 2HD3A 1WTWA 2KJXA 3I4LA 3DXJC 4O0AA 4YCVA 2I07B 3D8GA 3E9HA 1B50A 1EOTA 1KTKA 4Q5VA 5K36G 1K28A 2BA0A 4LF4Q 2JA7G 2Z6KA 1IYJB 3NHHA 3K81C 4POFA 1QVFA 2M2LA 5JPNC 3TS0A 3HOWH 4UP8A 2B2UC 2SEBD 2NN6G 1S72A 1EY5A 4RKBA 4DUYQ 2NVQB 2AUJD 3EROA 3DM3A 4A3EB 2ZXPA 3PF4A 1JOQA 4H44C 3OW7A 1KXLA 1SROA 1PFNA 2E75C 3S17H 1FD7D 2KCMA 1OTCA 1HA6A 2EE1A 4B9WA 1Y69U 5CC4A 4KD4A 3V96A 1JOOA 3OWFA 1I94Q 1STBA 2GVBA 2C9OA 4DN4M 1LABA 4A3KH 4H7BA 1VS0A 3BG3A 1JR0D 1OXXK 4ILWA 5FLMG 4ZUJA 2B2VA 3PO2G 1A15A 2J4XA 1Q1EA 1RODA 3KDFB 1I50H 4BBSG 1Z9FA 4X64Q 1K9MC 3BZDB 5IYCG 1B44D 1BVSA 2RHQB 3J80i 1TWAH 2F0EA 3RN5A 2DJGC 2CFMA 3CRLC 2SOBA 1GXDC 1NMGA 5IODA 3VR4A 1X3PA 2JK8A 2Q2HA 1ONLA 2J0TD 5JJZA 1K8GA 4LFCQ 2E2IH 4DV1Q 2F3IA 2PQAB 5ISRA 1NAPA 2F0QA 1BNZA 1IBML 2Y0SB 1BCPD 1STGA 2L4NA 1PH3A 3EJIA 1XJVA 3ER0A 1N36L 4FF1A 5M3MB 1ESRA 1AH9A 3CC7A 3I4NG 3Q22A 3HOZH 4K0KQ 4A3JH 4ZAIA 3GO5A 1TS2A 4A3MG 2YU9B 2PNRC 4HTHA 1Q8IA 4CDDC 2Q2TA 1CK1A 2R7ZB 2HHHQ 4EGVA 1BCPB 1IKMA 2YTYA 4LW1A 4XTCS 5IWAQ 3I4NH 3SXHA 3A56A 3MXGA 1H9SB 4POGA 1FJGL 2XTIA 4JI3L 1F9PA 1PZKD 1X3QA 3AFPA 4ZUIA 1JE4A 4ZLTF 4QF4A 5CV5A 1LT6D 1SMXA 4TQUS 1I4GA 4DK1A 1YNJC 4NDXA 1HTLD 1VQ4A 1MJCA 2KEEA 1PRTB 1MSHA 4JI1Q 1R9TB 1HCZA 1U4LA 4IUPA 2OWOA 3NEMA 2PPBC 2WAQE 1YNXA 2TSSA 3ZJYC 1NNXA 3TZUA 1D5MC
chains in the Genus database with same CATH topology
3X3MA 2JEBI 3P7JA 2IJ0A 4QUFA 1QB5D 4DNTB 1STHA 3RLFA 3K5MA 4IN3A 3H6MA 1AZQA 4N9PA 2K04A 2D2CC 2HDLA 1JORA 4FXKC 4KY7A 1U4PA 2B2WC 4A3DB 2NN6H 4FF4A 4NMZA 1TR5A 2A6HD 4HN7A 3MAQA 3M4OB 4NKLA 3GTLB 3OMGA 1WTQA 1DM0B 5IGEA 3DMUA 2MHVA 2F0FA 3MZ5A 3K59A 5BN5A 1CQFA 1OXVA 2XRQD 4C3IB 2K5WA 1CI3M 1O7LA 2EJMA 2QCPX 1I6HB 4WRDA 2K7VA 2IX3A 4LMQD 3A8JE 4DF7A 1G2TA 2NN6I 3LX0A 2F0NA 3T13A 1YNNC 1GUGA 1FGBD 1IW7C 1MI2A 1B9NA 3ITPA 1CZWA 2VB3X 4G7ZC 1DOLA 4RHSA 2B2TA 5KIXA 3E0JA 1MBYA 1IW7D 1RDPD 1BBXC 2F03A 3TP8A 5DM73 1BOSA 3I8ZA 3N6RA 1QCBD 1LTBD 2HQEA 4PMBA 4OHJA 3C1FA 1CZGA 5J22A 3MA2B 5KNCA 3PO3B 4A3IB 4OO1H 3K5NA 1Q12A 4KD3A 1RTOA 3SK6A 1TWGB 1EL0A 3DUZA 3VR5A 4EQNA 1L0XB 4KY6A 1S5FD 2L55A 5EJWA 3MFGA 5K5PA 4KKUA 2WIIB 1Q1BA 2E76C 1F2ZA 2K6AA 1AN8A 1V1PA 3I70A 3MXPA 1YNJD 3NUCA 2DY7A 2ZT9C 1I6VC 2ICIA 4RCNA 5I2XA 1UNSA 1PTOC 1SEBD 3C3LA 2N88A 4OO1G 5C4JB 4LK1C 1I50B 4FO2A 1T5XD 5LL6S 5DAUA 3RZDB 3K58A 5EKIA 1BQQT 1DXMA 2WAQB 2AQ3B 4XQJA 3S14B 2VNUD 2MPMA 4CJ1B 4O1NA 4E6IA 4I7ZC 3BS1A 4HSPA 2WP8J 5ELDA 3Q0AA 1D5ZC 2XWBB 1TU2B 4XYQA 2X6LA 2Z4IA 3M3YB 2KCCA 3S1QB 3TSSA 1K8OA 2BE5C 1E2VA 3SHLA 4BA1I 2A6HC 1XTCD 2GA4B 3KBGA 1EFID 3ND8A 2RVLA 5EKKA 2EYPA 1HQMC 2KQ3A 4J1MA 3H94A 2IW3A 4CKBA 2AQ2B 3K5OA 2ZXRA 3DEOA 3VR2A 1AW7A 3MXUA 4CJ0B 2F0KA 2M9VA 3EQLC 2IWHA 1F9RA 3MFYA 1DD2A 5NUCA 4F88A 2PZUA 4YIJA 4FF3A 1RF2D 3QJYA 2NVTB 1EY6A 1LTSD 2K01A 3S15B 1TS4A 1RCVD 3VYTA 4V0BA 3X3NA 1J9OA 4AYBB 5A35A 1S5ED 4LAAA 3QO2A 2EZVA 2EJFC 2E2JB 3BYTB 5J39A 2K05A 2N55A 3CKIB 3FPUB 3RD4A 1Z47A 1SE4A 4KHVA 3HKZB 1VMCA 1MGSA 4DFAA 5E4XA 1B1ZA 3QG1A 2K5DA 4ODGA 3NP8A 3NBHA 4QCLA 1BCPF 2XNAC 4F87A 1A3VA 4C3HB 1G2SA 2L9HA 2PW7A 4OGQC 1GUSA 5EGTA 1Y1WB 4KTAA 3A8IE 4RH6A 3K0YA 2F3VA 1KDCA 4IUNA 3W2DA 3HOXB 2NUCA 4J8QA 1ZEQX 1CA6A 1EYAA 5G3LD 3GV3A 3J81E 3IAYA 2QKIC 1PTOH 5M5WB 4RAUC 3T53B 4XDXA 2SNSA 3KLSX 3PUXA 5JVG3 3K57A 4CBVA 4EQPA 3DWPA 2XSCA 2XN9C 1LTTD 1EU4A 2WV6D 4B9XA 1KDBA 1NSNS 5KNDA 2AUKA 4X3TA 4K8JA 2RSOA 4C1NK 3GD7A 2F0UA 1PRTD 3NTIA 1VF5C 3D6CA 3HP3A 3IKJA 2OF1A 1EY4A 4BY7B 1H9MA 3CRKC 2BCOA 5CORA 1RHPA 3WDNA 3VYSA 3P1HA 2F0GA 1OO9B 3Q24A 3SE0A 1PFMA 1SYGA 1SBBB 1SYEA 1BUVT 1GJXA 3BVGA 2G9DA 4K5WA 4IFDH 1ENCA 3D4DA 4KMUC 1SNPA 5IOCA 3JAML 3TN2A 2K5QA 1SSOA 2RQXA 1TVXA 3M7GA 3O13A 2IX1A 1L0YB 3HOVB 2F0HA 1SYDA 5IGFA 1SE3A 3VR6A 3NWTA 4J6HA 1ICWA 3TDQA 3HS0C 3FRPB 2LMCB 2A68C 1Q90A 1D6EC 5EPKA 4L8JA 3DM1A 2IX0A 3BVZA 1LT5D 3PUYA 5EBCA 3S1MB 4A3BB 5AFWA 1EU3A 4F7XA 5KEEA 3ZYYX 1V8QA 1U9RA 2IT1A 3V2TA 4CJ2C 3LNNA 3R2TA 1STNA 2EY6A 1EWHA 1F2LA 4KJOA 2Z4HA 2IL8A 5KYIA 2K28A 2LS01 1BXTA 3VA5A 1XX8A 4K14A 1CTMA 1D5XC 2VXWA 1LLRD 4ZK9B 3MC0B 1BF4A 1ESFA 1HFNA 1PLFA 1WD1A 5JEAH 2H1EA 2RDFA 2PQEA 4FF2A 3NK9A 1EQTA 2J7ZA 5M3FB 2F3WA 5CMDA 2F0OA 3S1RB 5EBDA 4K8IA 3A7LA 3I91A 1TS5A 1HRJA 1AEXA 1RTNA 1SAPA 2MP1A 2D9UA 3BDLA 3Q23A 2G9HD 2B2TC 4F8MA 2FJ2A 3KK7A 2E2IB 2AWOA 2WKDA 2L11A 4QMGA 3NQIA 3OHXC 3I4MB 2BDOA 4OL7A 5KYLA 2HUGA 2EY2A 1G6ZA 4Z9CB 1VDZA 3SK8A 4BWGB 3OPOA 4G7HC 2RA4A 1ENFA 3NTKA 3A7AB 5JEAG 4KHZA 4KK7A 2JXMB 4CKCA 4PMWA 1KAAA 4UDUC 2TMPA 1EYDA 2BA1A 1RJTA 5IGDA 3HEJA 3CQZB 2F0SA 5CV6A 1LACA 1DJRD 2EY1A 2K03A 2CHBD 1JWUD 3H91A 4DAVA 2KA7A 3UI2A 4C3JG 4RCOA 1EZ8A 2QILA 1PTOF 3PIP3 4G4KA 4RFBA 3T4AC 5FOBB 2OXPA 1SJHD 2EYHA 1V43A 3KUPA 3NSWA 1TWFB 2EXZA 2PO4A 2WINB 4K6LA 1I4RA 3KF8A 1B53A 4WORA 1QNKA 1WTOA 3VYRA 4QB4A 5CV9A 4C3HG 1LTID 5A2QL 4IFDJ 4ABNA 3WOFA 1XWEA 4QUCA 1KLGD 1SMYD 2Z8LA 3E5SA 3PMFA 3NTHA 1TKWB 1S5DD 3D6WA 3IFTA 2EPBA 2O2LD 3U9OA 1QOHA 2MUYA 2B39A 1JQYD 4DXGA 1CM9A 2E74C 2R3ZA 3AU7A 2Q8TA 4KY5A 3PV0A 4K5VA 2B2VC 5C0XG 1SJED 1KABA 1U4RA 1ET9A 3P75A 4FP5D 3W3AA 3URYA 2EY5A 3J7YW 1WD0A 2F1MA 2WACA 5CV7A 2IPKD 1ZYRD 2E2HB 4CHTB 4N9TA 2JP1A 4ZKCB 3H3VC 3HOZB 1GHJA 2KEDA 1LT3D 3D31A 5E4WC 1Z6HA 2QF7A 5KNBA 1Q3LA 2A69C 3TZDA 3SEBA 1PFBA 1TWCB 4OIJA 2HCIA 2NYZD 1E2ZA 2QDBA 4NW2A 3FVQA 3OWEB 2NTTA 5G3LF 1EYCA 5FK9C 4BS9A 3HRZC 5I2YA 5C3XA 5CGKA 3PUZA 3I73A 4B08A 2WKCA 1EIHA 2A69D 3KLRA 5ELBA 1IL8A 1SNMA 2L5TA 3T16A 4DK0A 4MIUA 4PNYA 1JWMD 1HUNA 3I72A 3N52A 2FHTA 1W6JA 2FMMA 4XXEA 5K36H 5C5LA 5D3DA 1AFPA 4R9WA 3J7AV 4BA2I 1JB3A 3FMCA 2M00A 1H9SA 5CV8A 2F0MA 2H4OA 2F0WA 2C5CA 3S2HB 3HOWB 3BVMA 1NCVA 4S3SA 3QWNA 3E6ZX 5DM63 3A55A 1IYVA 5BN4A 2Z1CA 3HOYB 5EPJA 3NWSA 3QOLA 1C48A 2L1BA 3MEHA 2O5JC 1JICA 5D3IB 5LL6X 1F2YA 2D62A 3TP5A 1I4QA 2NVXB 4TRDA 5M9OA 1TS3A 2XWJB 5F2DA 1ML0D 1LT4D 5C6AA 1FYCA 3PIO3 2Q8IB 2K1BA 1VCIA 3BDOA 3DWQA 4K6DA 1SNQA 4C1NI 1JOKA 1AP0A 1VMPA 3H0GB 1O7ZA 4FNFA 3OMCA 2Q8RE 4IUTA 4IUQA 2ID0A 2NTSA 4HEDA 2F0TA 3HG9A 3CU7A 3S9WA 4G7OC 3ND9A 2R92B 1HFGA 2RDHA 2KUMA 5IGCA 2ICEC 3MHBA 1HXYD 3R8BA 1I4HA 3RMHA 3VA7A 1NR2A 5HGTA 4BY1B 4BBRB 1S5CD 3EA6A 4JK1C 1NR4A 4RA8A 4PQXA 3I4NB 3NPPA 3D4WA 5JOBA 2EVBA 1GUWA 1PRTF 1G8ZD 3GQBA 4EVOA 2R61A 1B3AA 1EEFD 5C0XH 5C3EB 2PZTA 2PYKA 1ILQA 3SR1A 1V1PB 5JVH3 4KKSA 3BDCA 1MD2D 1SYBA 1WTPA 4FXDA 1JC7A 3G6JB 3C2PA 2F0PA 2MJ8A 1I4XA 2X6GA 2VUMB 4HAEA 4FVMA 1B4OA 4RGOS 1B2TA 4LJZC 5C3WA 2BE5D 5HURA 2KHSA 1TWAB 5CYUA 2AQ1B 4BBSB 2O4XA 1PDQA 1FNVA 2JE6I 1H9RA 2RKSA 2KCNA 2ZXOA 4TSSA 4C3IG 4XT1B 1A3TA 1R4QB 4HMIA 2FMCA 1QJOA 5T1GA 1KLUD 4DAYA 4IALA 3R3OA 4NP5A 5JAVA 4R8NA 2CQAA 1E2WA 4A3FB 2B8FA 1A2TA 2F4IA 3BYYB 4K2LA 3OOCA 4GZYC 4MN3A 2WB1B 4KV6A 1OXTA 4RGMA 4R8IA 1TIID 1UAPA 2DN8A 4KN4C 5CBAE 3U9SA 1LTAD 5C4ZA 3GV6A 4ME5A 4XIGS 5KRUA 2KVMA 3J80L 1X32A 3PO2B 3WOEA 2JEAI 2B2UA 1QNUA 4RHRA 3FEWX 3M7NA 2PMZB 1R4PB 1BDOA 2XRSD 1EY9A 3L3OC 2F0IA 4DGZA 3FPPA 3C46A 1AZPA 4Q0FA 4P2CB 3FKIB 2PW5A 1DYQA 2FINB 5I9PA 1PTOB 1XXGA 1GHKA 1A6XA 3TMEA 2A6ED 1SE2A 1STAA 3I90A 4M8AA 5CBEE 1HQRD 4A3JB 3NBIA 1B9MA 4X3UA 3G7LA 2CW0D 4HR7B 1WTXA 5E1FA 2SNMA 1ZKOA 2L0CA 3GTQB 1STYA 2VB2X 1F9QA 1QE6A 1HPCA 3AB9A 3ONAB 4ZKBB 4XQQA 1I4PA 1Z7TA 3NQTA 3KLSA 3SK4A 3L9AX 1TT2A 4PMCA 3DWAA 2A68D 5FLXL 2EDGA 3NXWA 3K6OA 4PV1C 4RWSC 3D3RA 3TBIB 2EYMA 5C44B 1FR3A 1KNAA 2LFNA 4JBWA 1CQVA 1JCKB 2RSNA 1V1OA 1TQOA 4L63B 3TP7A 2JA8B 3JAME 4MHEA 1BO0A 1F2MA 3P20A 2NVYB 3IL8A 2ENBA 5FKAC 1SFOB 2DNEA 2EYLA 3T51B 4DA2A 1I3QB 2F0VA 1EEID 1QG7A 1SNCA 4KN7C 3HGBA 3DHQA 4ZQ3A 2JYOA 4ULLA 5BN3A 5C0XI 5D14A 3GP7A 2PCFB 2EYFA 1SNOA 1QILA 1BCPC 1H9JA 3D4RA 4HCSA 1IKLA 3QOJA 1WTVA 5FO8B 1EQVA 2CVRA 4H0LC 1F9SA 3M85A 3PUVA 1SMYC 5A2QE 1O7YA 1UUPA 4K2KA 3I3CA 3MWYW 3IFDA 5EKLA 4IFDI 3LWUA 1D5MC 1BR9A 3SVMA 2X69A 3F2UA 5JEAJ 3R93A 4IUVA 1A2UA 5J1ZA 3CHBD 2RDGA 1ENAA 3GTGB 5FO9B 3A8KE 4KI0A 1T5EA 1CA5A 1TY2A 2BDNA 3R2IA 5C4HA 1KNEA 5T1IA 2HCCA 1FNUA 2DY8A 1QWYA 2F0JA 2NZ1D 5C0XJ 4KKTA 2B2YC 1KDAA 5ELEA 5FLXE 1LV9A 2E2DC 1EZ6A 4A3GB 4H13C 5IIFA 1A3UA 2XVSA 2NWGA 4ZYSA 4C3JB 4DU9A 5D65A 1LTGD 4DAPA 1OXUA 1HHVA 4CKEA 1H9KA 3MVVA 4FXGC 1D2BA 4A3KB 1G91A 1MSGA 1XYIA 2L12A 4XYOA 2R6GA 5C4XB 5I6WA 4L6TB 4RGTA 1CT1D 3V05A 3HOUB 2B2YA 3VR3A 2RBMA 5JPMC 3K5LA 5DNFA 1HUMA 5I9OA 4IUUA 5FO7B 1IHZA 4IURA 4K5XA 2I46A 4X3KA 2JA5B 3GTPB 4XQNA 3L7ZC 3QIAA 2LKVA 1C4QA 2K32A 3S1NB 5COYA 3GTJB 4RGNA 1IYUA 5LHY1 3M4YA 5C5MA 1E0BA 3OSOA 1GUNA 1GUTA 3EFXD 5DEHA 1DOKA 4QIWB 4I65A 1STEA 1EWCA 3NE5B 2PZWA 1M4VA 2NB0A 2OEOA 1RD9D 3MTSA 5M5YB 1YNND 2DNCA 3QB3A 5EQ0A 1F77A 3J80E 4IZ8A 5ELFA 2EYOA 4TKOB 2K33A 2QEJC 2KECA 5IT9E 1ILPA 1PZJD 1W6KA 4ID6A 1CHPD 4V190 3S16B 1GUOA 2A5HA 5IT9L 1D1KA 3A54A 1UEAB 1SYFA 1VF7A 4HMJA 1G291 2LY7A 3TP6A 2B8GA 2HDMA 3Q6SA 2F0LA 3SDZA 3J7AF 4OIKA 3KBXA 3ERQA 3OIQA 1DCZA 1JWSD 2CW0C 3GTKB 1TY0A 4WJWA 1ET6A 1HA5A 1EY0A 3OIPA 1FNWA 4G57A 3RUZA 4U673 3MXNA 5EPLA 2BOSA 5IGGA 3S17B 2EJGC 5KGUA 1EY8A 2FFKB 4WFN3 1GOZA 3GTMB 1PZID 2JSOA 3RZOB 1DOMA 5E3FA 4C56C 1EY7A 2B2WA 4A93B 3H09A 4X3SA 2A6EC 5I4DA 1O80A 5M5XB 1C8CA 2SDFA 1LTRD 2F0DA 1PRTC 2A73B 1SDFA 3VYUA 3EVQA 1ZYRC 1D1IA 2XIWA 3AMUA 1J8IA 2EYJA 2OT2A 1PTOD 1OXSC 1Y1VB 4XT3B 4EQOA 5IGBA 1WTRA 1S5BD 2B63B 3J81L 4A3MB 1PMRA 1K83B 3PUWA 2D5DA 1PXUA 1PYWD 3SK5A 1HTPA 1EIGA 5I6YA 4DNRB 1K8MA 2A74C 1SXTA 1CHQD 3HZXA 4RKLA 4IQZA 4C2MB 1II3A 3FDTA 2JA6B 1O78A 4U68A 1TWHB 4KJNA 3K7AB 1S4ZA 2V4DA 1Y8NB 4OO1I 1LO5D 4M1UB 1Y8OB 1WVLA 1RKNA 5TSSA 1SYCA 3S2DB 4O42A 2O5IC 3GTOB 4FYDA 1NUCA 3LWEA 2YYZA 4UAIA 4IFDG 1ZXTA 2JA7B 1Y8PB 2MGSA 2KOLA 2NBFA 5CV4A 2AWNA 4HSVA 4Y7NB 1DONA 3DEPA 1SNDA 1CFMA 3C1EA 2R93B 1DZ1A 2EOTA 3T56B 5CR3A 1WCMB 4ZRZA 1M8AA 4DXFA 1U4MA 5ELCA 4HCEA 1WTWA 2KJXA 3I4LA 3DXJC 2I07B 3D8GA 1B50A 1EOTA 1KTKA 4Q5VA 5K36G 2BA0A 3NHHA 2M2LA 5JPNC 2B2UC 2SEBD 2NN6G 1EY5A 4RKBA 2NVQB 2AUJD 3EROA 4A3EB 2ZXPA 1JOQA 4H44C 3OW7A 1PFNA 2E75C 1FD7D 1HA6A 2EE1A 4B9WA 1Y69U 5CC4A 4KD4A 3V96A 1JOOA 3OWFA 1STBA 2C9OA 4DN4M 1LABA 4H7BA 3BG3A 1JR0D 1OXXK 4ILWA 4ZUJA 2B2VA 1A15A 2J4XA 1Q1EA 1RODA 3BZDB 1B44D 2F0EA 3CRLC 2SOBA 1GXDC 5IODA 3VR4A 1X3PA 1ONLA 2J0TD 5JJZA 5ISRA 1NAPA 2F0QA 1BNZA 2Y0SB 1BCPD 1STGA 2L4NA 3EJIA 4FF1A 5M3MB 1ESRA 3Q22A 4ZAIA 3GO5A 1TS2A 2YU9B 2PNRC 4HTHA 1Q8IA 1CK1A 2R7ZB 1IKMA 4EGVA 1BCPB 4XTCS 3SXHA 3A56A 3MXGA 1H9SB 1F9PA 1PZKD 1X3QA 4ZUIA 1JE4A 4ZLTF 4QF4A 5CV5A 1LT6D 4TQUS 1I4GA 4DK1A 1YNJC 4NDXA 1HTLD 2KEEA 1PRTB 1MSHA 1R9TB 1HCZA 1U4LA 4IUPA 2PPBC 2TSSA 3TZUA 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNC A;  1AEX A;  4IZ8 A;  4DU9 A;  3OMC A;  3SHL A;  3DHQ A;  4ZQ3 A;  2EYO A;  3BDL A;  5C3X A;  1A3V A;  3E5S A;  2HQE A;  3PMF A;  2F0T A;  3SK5 A;  4B9W A;  5CC4 A;  4KD4 A;  4F8M A;  5EKK A;  4PMB A;  1SNM A;  2EYP A;  2PW7 A;  1JOO A;  3MVV A;  3OWF A;  1STB A;  1STH A;  5EGT A;  3S9W A;  4IAL A;  2F0H A;  3C1F A;  3R3O A;  1SYD A;  2EYF A;  1SNO A;  3T16 A;  5I6Y A;  4NP5 A;  5IGF A;  4H7B A;  4ID6 A;  2KQ3 A;  5JAV A;  4J6H A;  3HZX A;  3H6M A;  4J1M A;  4R8N A;  4KTA A;  4RKL A;  4N9P A;  1II3 A;  4MIU A;  4QMG A;  4ZUJ A;  5I6W A;  5IGC A;  1JOR A;  3MHB A;  4PNY A;  1A2T A;  1SYF A;  2F3V A;  4OL7 A;  5KYL A;  4HMJ A;  3U9O A;  1KDC A;  2EY2 A;  4KY7 A;  5KEE A;  3TP6 A;  3QOJ A;  5E1F A;  2SNM A;  4KD3 A;  2RBM A;  3SK8 A;  4IUN A;  4K2L A;  2F0K A;  3SK6 A;  5HGT A;  5C5L A;  1EQV A;  4KJN A;  2F0E A;  2F0L A;  4EQN A;  4KV6 A;  2NUC A;  2SOB A;  1STY A;  1EYA A;  4KY5 A;  5IOD A;  3ERQ A;  4K5V A;  4KY6 A;  5NUC A;  4NMZ A;  1TR5 A;  5ISR A;  1KAA A;  2PZU A;  2F0Q A;  1KAB A;  4K2K A;  4YIJ A;  5K5P A;  3D4W A;  5JOB A;  2SNS A;  1EYD A;  2M00 A;  1EY0 A;  4NKL A;  4EQP A;  1RKN A;  1STG A;  4G57 A;  4F7X A;  5CV8 A;  3RUZ A;  3OMG A;  5EKL A;  5I9O A;  3HEJ A;  1EY6 A;  1SYC A;  3EJI A;  3P75 A;  5IGD A;  2F0M A;  1F2Z A;  1U9R A;  2F0S A;  5CV6 A;  5C4Z A;  5IGG A;  3V2T A;  2F0W A;  4ME5 A;  4EVO A;  2EY5 A;  1EY8 A;  1NUC A;  3MXP A;  1IHZ A;  5IGE A;  5KGU A;  3NUC A;  4K5X A;  5KRU A;  3DMU A;  3NQT A;  4B9X A;  2F0F A;  1KDB A;  1NSN S;  1STN A;  2EY6 A;  3MZ5 A;  2PZT A;  2WAC A;  5CV7 A;  3SK4 A;  5E3F A;  2PYK A;  2EY1 A;  4KJO A;  1EY7 A;  4S3S A;  1A2U A;  5CV4 A;  5J1Z A;  3SR1 A;  4K8J A;  4N9T A;  1TT2 A;  4PMC A;  5KYI A;  2F0U A;  3BDC A;  4LAA A;  1ENA A;  1SND A;  3NXW A;  1SYB A;  1EZ8 A;  2LKV A;  4HTH A;  3QOL A;  4WRD A;  3D6C A;  3C1E A;  3MEH A;  5DAU A;  2OF1 A;  5CR3 A;  2F0P A;  3VA5 A;  4K14 A;  1EY4 A;  5J39 A;  4DF7 A;  1EY9 A;  2F0D A;  3SXH A;  5J22 A;  2OXP A;  1F2Y A;  2EYM A;  2EYH A;  2F0I A;  3TP5 A;  4DGZ A;  5C4H A;  2EXZ A;  4TRD A;  5M9O A;  5C3W A;  3LX0 A;  2F0J A;  3EVQ A;  3P1H A;  2KHS A;  4KHV A;  5F2D A;  4ZUI A;  2RDF A;  4QF4 A;  1TQO A;  5HUR A;  2F0G A;  5C5M A;  2F0N A;  3D8G A;  3OSO A;  5CV5 A;  2EYJ A;  2PQE A;  3T13 A;  3TP7 A;  5DEH A;  2PW5 A;  5C6A A;  1KDA A;  4E6I A;  3NK9 A;  2O4X A;  4I65 A;  4NDX A;  2QDB A;  4DFA A;  5I9P A;  3ITP A;  1SYG A;  4WOR A;  1F2M A;  2F3W A;  4EQO A;  2F0O A;  1EZ6 A;  1EYC A;  2PZW A;  2RKS A;  1SYE A;  2OEO A;  3NHH A;  4K6D A;  4QB4 A;  5CV9 A;  3TME A;  5IIF A;  2ENB A;  4K8I A;  5KIX A;  2EYL A;  4ODG A;  1SNQ A;  1A3U A;  1EY5 A;  4RKB A;  3QB3 A;  1JOK A;  1A3T A;  3NP8 A;  1ENC A;  3D4D A;  3ERO A;  1SNP A;  1STA A;  2F0V A;  4K5W A;  5CGK A;  4HMI A;  5IOC A;  1JOQ A;  3TP8 A;  5IGB A; 
#chains in the Genus database with same CATH topology
 5E7N A;  3X3M A;  2JEB I;  3P7J A;  2PQA A;  3PO2 H;  2IJ0 A;  4QUF A;  3GTQ H;  1QB5 D;  3BZC A;  4DNT B;  1STH A;  2I5M X;  4UY8 C;  3JAM c;  2N3S A;  3RLF A;  2VY3 A;  3CCR A;  4HIK A;  1LYL A;  3K5M A;  4RMF A;  4IN3 A;  5GRO A;  3H6M A;  4LUZ A;  1AZQ A;  4N9P A;  2K04 A;  1U5K A;  2D2C C;  2HDL A;  3I56 A;  1JOR A;  4FXK C;  4KY7 A;  5IYB H;  3LGJ A;  1U4P A;  2B2W C;  3HOU H;  4A3D B;  2NN6 H;  2R7F A;  1FL0 A;  4FF4 A;  4HJ8 A;  1KRT A;  4GKK Q;  3T1H Q;  4NMZ A;  1TR5 A;  2A6H D;  4HN7 A;  3MAQ A;  3M9B A;  1LTL A;  3M4O B;  5BR8 L;  4NKL A;  3GTL B;  3OMG A;  1B3Q A;  1WTQ A;  1DM0 B;  2IY5 B;  5IGE A;  4QQB X;  1R9T H;  3PSI A;  4R4T A;  2PI2 E;  3DMU A;  2MHV A;  3T1Y Q;  2CWA A;  2F0F A;  3MEF A;  3MZ5 A;  3K59 A;  5BN5 A;  2EIF A;  1CQF A;  4B3S L;  1OXV A;  2XRQ D;  1M1K C;  4C3I B;  2K5W A;  3M4P A;  1CI3 M;  1O7L A;  2EJM A;  2QCP X;  1A63 A;  1I6H B;  4WRD A;  3AEV A;  2K7V A;  2IX3 A;  4LMQ D;  4B3M L;  3A8J E;  3UE1 A;  4DF7 A;  4MTN A;  3TS2 A;  3H15 A;  1G2T A;  1I3Q H;  2NN6 I;  4DR7 L;  3KYH C;  1IBK Q;  3LX0 A;  2UUA Q;  4DNI A;  1MIU A;  2PNH A;  2F0N A;  3T13 A;  1YNN C;  1GUG A;  1FGB D;  4A3I G;  1IW7 C;  1RIP A;  1MI2 A;  1B9N A;  3ITP A;  1CZW A;  2VB3 X;  4G7Z C;  4AQY Q;  4B3R L;  1DOL A;  4RHS A;  2B2T A;  5KIX A;  3E0J A;  2CCZ A;  1MBY A;  1X54 A;  1IW7 D;  1RDP D;  3TQY A;  1BBX C;  2F03 A;  3TP8 A;  4GLX A;  5DM7 3;  2D0P A;  4LFA L;  1BOS A;  4OXP A;  3I8Z A;  3KF6 B;  3N6R A;  1QCB D;  1LTB D;  2UXD L;  3K7A H;  2HQE A;  1JB7 A;  4PMB A;  5JJI A;  4OHJ A;  2E8G A;  5C3E H;  3C1F A;  1CZG A;  5J22 A;  3MA2 B;  2OCE A;  5KNC A;  4IPC A;  3PO3 B;  4O2D A;  1HJP A;  1J6Q A;  4IPH A;  4A3I B;  4IPD A;  4LF9 L;  4OO1 H;  4LUO A;  3K5N A;  1Q12 A;  4KD3 A;  1RTO A;  3SK6 A;  1TWG B;  4J15 A;  1EL0 A;  3DUZ A;  3VR5 A;  4EQN A;  1L0X B;  4KY6 A;  2QDL A;  1S5F D;  1X56 A;  2L55 A;  5EJW A;  3MFG A;  5K5P A;  4KKU A;  4A3E H;  2WII B;  1Q1B A;  1SRU A;  2E76 C;  4DAY B;  1F2Z A;  2K6A A;  1AN8 A;  1V1P A;  2ZM6 Q;  3F2B A;  3I70 A;  1N34 L;  3MXP A;  1YNJ D;  5AJ3 L;  3NUC A;  2DY7 A;  4DV6 Q;  2ZT9 C;  1I6V C;  2ICI A;  4RCN A;  3I4O A;  5I2X A;  5M5Y H;  1UNS A;  1PTO C;  1SEB D;  3C3L A;  2N88 A;  3CME A;  2F4V Q;  4OO1 G;  1E24 A;  4LK1 C;  5C4J B;  4A93 H;  1D7Q A;  1I50 B;  5IY0 A;  4FO2 A;  1T5X D;  2JA5 G;  5LL6 S;  5DAU A;  5IYD H;  3RZD B;  3K58 A;  1BBW A;  5EKI A;  1BQQ T;  1DXM A;  2WAQ B;  3BJU A;  3J81 j;  3CC2 A;  1CSP A;  2AQ3 B;  2JJQ A;  4DV7 L;  1YIJ A;  4XQJ A;  1IL2 A;  2HHH L;  3S14 B;  2NZO A;  3U4V A;  2VNU D;  2MPM A;  4CJ1 B;  4O1N A;  1KL9 A;  4E6I A;  2YTX A;  2ZJP A;  3EIV A;  4I7Z C;  1IBK L;  3BS1 A;  1IBL L;  4HSP A;  2WP8 J;  5ELD A;  3Q0A A;  1JT8 A;  1D5Z C;  2XWB B;  1TU2 B;  4DV6 L;  2KHI A;  2K75 A;  4XYQ A;  5LMU Q;  1VQJ A;  3OTO Q;  2X6L A;  2Z4I A;  3WWV A;  3S24 A;  2KCC A;  3M3Y B;  3S1Q B;  3G4S A;  3TSS A;  1VQ7 A;  4HJ5 A;  3M4O H;  3GTK H;  1K8O A;  2K4K A;  2I0Q A;  2BE5 C;  1E2V A;  1UE7 A;  3ULL A;  3SHL A;  4BA1 I;  2A6H C;  1XTC D;  2N78 A;  2GA4 B;  3KBG A;  4GLV B;  1EFI D;  3ND8 A;  1X3E A;  2RVL A;  5EKK A;  2EYP A;  2OTL A;  3GTM H;  4LF5 L;  4DAM A;  1HQM C;  2KQ3 A;  4J1M A;  3G48 A;  3H94 A;  2IW3 A;  4CKB A;  2K5H A;  5GAG C;  2AQ2 B;  3K5O A;  1Y1V H;  2ZXR A;  3DEO A;  3VR2 A;  1AW7 A;  3MXU A;  3CPF A;  4YCW A;  4CJ0 B;  2F0K A;  2M9V A;  4JVZ A;  2QA4 A;  1RL2 A;  3EQL C;  1Y1W G;  4IJH A;  2IWH A;  1F9R A;  1G51 A;  4GNX B;  3MFY A;  1KHI A;  1DD2 A;  5NUC A;  4F88 A;  4FDB A;  5EAY A;  2PZU A;  5C44 G;  4YIJ A;  1EYG A;  2HIX A;  4FF3 A;  1RF2 D;  3QJY A;  1XNR L;  1EY6 A;  2NVT B;  1LTS D;  2K01 A;  3S15 B;  1PYB A;  4JI5 Q;  1TS4 A;  1RCV D;  5JJL A;  5HGQ A;  2JA8 G;  3VYT A;  5L37 A;  4DK3 C;  4V0B A;  3X3N A;  1GM5 A;  1J9O A;  4AYB B;  1XMQ L;  5A35 A;  1S5E D;  2VQE L;  3HOU G;  1GVP A;  3DLL A;  4LAA A;  4GKJ Q;  3QO2 A;  2EZV A;  4R4C A;  2EJF C;  2E2J B;  3BYT B;  5J39 A;  2IHF A;  2K05 A;  2N55 A;  3CKI B;  3FPU B;  2VW9 A;  3FHW A;  3RD4 A;  1Z47 A;  1SE4 A;  1WFQ A;  1QZG A;  4KHV A;  4JI1 L;  3HKZ B;  1VMC A;  1MGS A;  4BXX H;  4DFA A;  5E4X A;  1B1Z A;  3QG1 A;  3S2H H;  1X55 A;  4A3M H;  1HZC A;  2K5D A;  3F2C A;  4ME3 A;  1EUJ A;  4ODG A;  1PH4 A;  1K3B C;  3NP8 A;  3HOV G;  3NBH A;  4QCL A;  1JE5 A;  1BCP F;  4DV5 L;  2XNA C;  4DR4 L;  2Y0S G;  4JBJ A;  4APV A;  4F87 A;  1A3V A;  4C3H B;  1G2S A;  2L9H A;  4DR5 L;  4IJL A;  2PW7 A;  4JW0 A;  4OGQ C;  1GUS A;  5EGT A;  1K3R A;  4A3L H;  1Y1W B;  4KTA A;  1N34 Q;  3A8I E;  4RH6 A;  3GTL H;  4B3M Q;  3K0Y A;  1Q46 A;  2F3V A;  1KDC A;  4JOI C;  1L1O B;  2PMZ E;  4L5Q A;  4DV3 L;  4IUN A;  4JI6 Q;  3W2D A;  1UWV A;  3HOX B;  3S2D H;  2NUC A;  4J8Q A;  1ZEQ X;  1YZ6 A;  5G3L D;  1EYA A;  1CA6 A;  3GV3 A;  3J81 E;  3IAY A;  2QKI C;  1PTO H;  5M5W B;  4RAU C;  4JBK A;  3T53 B;  4XDX A;  3PUX A;  2SNS A;  3KLS X;  4EQP A;  3CAM A;  4CBV A;  3K57 A;  5JVG 3;  4BBR H;  4IOA A;  3DWP A;  2XSC A;  3FKI G;  3I2Z A;  2XN9 C;  4Y52 H;  4JI7 Q;  2OTJ A;  1SR3 A;  1LTT D;  4CDF C;  4Y7N H;  4NPS A;  1EU4 A;  1PFS A;  2WV6 D;  1PH5 A;  4B9X A;  1KDB A;  1NSN S;  3HOV H;  1PHJ A;  5KND A;  1B7Y B;  1SFO H;  2AUK A;  2OQK A;  4X3T A;  2R92 H;  4K8J A;  2RSO A;  4C1N K;  3GTP H;  1O7I A;  3GD7 A;  2F0U A;  1PRT D;  3NTI A;  4DV4 L;  1VF5 C;  3CCQ A;  1YI2 A;  3D6C A;  3HP3 A;  3K8A A;  3IKJ A;  2OF1 A;  1VQ5 A;  1EY4 A;  4BY7 B;  5C44 H;  1C0A A;  1H9M A;  3CRK C;  2BCO A;  5COR A;  1RHP A;  3WDN A;  3J80 c;  2KBN A;  1QVG A;  3VYS A;  3RN2 A;  3P1H A;  5IT9 c;  2F0G A;  4JG2 A;  1OO9 B;  4JOI A;  3Q24 A;  4DR2 Q;  3SE0 A;  1PFM A;  1SYG A;  1SBB B;  1SYE A;  3OTO L;  2MQH A;  1BUV T;  4HIM A;  4NXN L;  1GJX A;  3BVG A;  4GOP C;  2G9D A;  4DKA C;  2UXB Q;  4K5W A;  4IFD H;  1ENC A;  3D4D A;  4KMU C;  1SNP A;  5IOC A;  3JAM L;  2K5Q A;  1SSO A;  1YBY A;  3TN2 A;  1Q81 C;  4KLK A;  2RQX A;  1TVX A;  3M7G A;  3O13 A;  2IX1 A;  4GN5 A;  1W3S A;  4YWL A;  1AE3 A;  1L0Y B;  3HOV B;  2F0H A;  4JC0 A;  1SYD A;  5IGF A;  1SE3 A;  3VR6 A;  4A4I A;  3NWT A;  4J6H A;  1ICW A;  3TDQ A;  3HS0 C;  1TXY A;  3FRP B;  4OWW B;  3A5U A;  2LMC B;  2A68 C;  1Q90 A;  1XMO Q;  4QJF A;  1JJG A;  1D6E C;  5EPK A;  4L8J A;  2G5D A;  1GD7 A;  3DM1 A;  4L5T A;  1VQN A;  2IX0 A;  2I5H A;  3BVZ A;  1LT5 D;  3PUY A;  5EBC A;  2YV5 A;  4YWM A;  4JI0 L;  2MFI A;  3W5O A;  1N36 Q;  3S1M B;  4A3B B;  1CKN B;  5AFW A;  3K0X A;  1EU3 A;  4P72 A;  4F7X A;  5KEE A;  3UDI A;  3ZYY X;  1V8Q A;  1HZB A;  1U9R A;  2IT1 A;  1IBL Q;  3V2T A;  1SN8 A;  1XMQ Q;  4CJ2 C;  2ES2 A;  4CGY B;  2VL6 A;  3LNN A;  3CCM A;  2Z0S A;  3R2T A;  1STN A;  2EY6 A;  4DR1 Q;  1EWH A;  1F2L A;  3J7Z C;  4KJO A;  2Z4H A;  3RZO H;  2IL8 A;  3T1Y L;  5KYI A;  2K28 A;  4GOP A;  4DV4 Q;  2LS0 1;  4HID A;  3CCJ A;  4AH6 A;  3KLW A;  4RG1 A;  2UUC Q;  1BXT A;  4NXM L;  3VA5 A;  1XX8 A;  4K14 A;  5BR8 Q;  1CTM A;  1D5X C;  2VXW A;  1VQP A;  1LLR D;  4ZK9 B;  1Q8K A;  2EXD A;  2HIV A;  3MC0 B;  2GVA A;  1ESF A;  1BF4 A;  4QGU A;  1PLF A;  1HFN A;  4WJ3 M;  1WD1 A;  5JEA H;  1PH6 A;  2ALY B;  2H1E A;  2ZJQ A;  2RDF A;  2R7Z G;  2PQE A;  4FF2 A;  3NK9 A;  1FJG Q;  1CKM A;  1E3P A;  1EQT A;  2ZM6 L;  2J7Z A;  4PZ8 A;  5M3F B;  3F1Z A;  2F3W A;  5CMD A;  4X62 L;  1A0I A;  2F0O A;  2NVT H;  3S1R B;  5EBD A;  4K8I A;  3A7L A;  3I91 A;  1TS5 A;  3CCL A;  1GKH A;  3KF8 B;  1HRJ A;  2K14 A;  1AEX A;  1RTN A;  1SAP A;  2MP1 A;  2D9U A;  4JBM A;  3BDL A;  2V1C C;  3Q23 A;  2G9H D;  1ASZ A;  2B2T C;  4F8M A;  4LF9 Q;  2FJ2 A;  1M90 C;  2Z6K C;  2RCF A;  3KK7 A;  2E2I B;  4NB3 A;  2AWO A;  2WKD A;  4DR5 Q;  2L11 A;  1B70 B;  4UHV A;  4MZ9 A;  3NQI A;  4QMG A;  3OHX C;  3I4M B;  2N8N A;  2BDO A;  4OL7 A;  5KYL A;  2Q2U A;  2HUG A;  2BH2 A;  3S16 H;  2EY2 A;  1G6Z A;  4Z9C B;  1VDZ A;  3SK8 A;  4BWG B;  1VQ6 A;  3OPO A;  4A3I H;  4DV1 L;  4G7H C;  2RA4 A;  2R7Z H;  4DR6 L;  1ENF A;  3NTK A;  3A7A B;  2UUB L;  5JEA G;  1IZ6 A;  2UUB Q;  4KHZ A;  4KK7 A;  3KJP A;  2JXM B;  2NZH A;  4CKC A;  5C3E G;  4PMW A;  1YIT A;  1KAA A;  4UDU C;  2DUD A;  1EYD A;  2TMP A;  2BA1 A;  1RJT A;  5IGD A;  4A3G H;  3HEJ A;  3CQZ B;  2F0S A;  5CV6 A;  1LAC A;  1K0R A;  3L2P A;  2Z6B A;  1DJR D;  1KD1 C;  4LF8 Q;  2EY1 A;  2K03 A;  2CHB D;  1JWU D;  4C2M H;  3H91 A;  4DAV A;  2KA7 A;  2CKZ B;  3UI2 A;  4C3J G;  4EQ5 A;  4RCO A;  2ZTE A;  1EZ8 A;  2QIL A;  1PTO F;  1QUQ A;  3PIP 3;  4AYB G;  4G4K A;  4DV5 Q;  4RFB A;  3T4A C;  5FOB B;  2OXP A;  1SJH D;  2EYH A;  1V43 A;  4MNO A;  3KUP A;  5IP9 G;  3NSW A;  1TWF B;  2EXZ A;  2PO4 A;  2WIN B;  2RF4 A;  1I4R A;  4K6L A;  5ELO A;  3KF8 A;  4DV0 Q;  4BY1 H;  2JA6 G;  5M3M G;  1B53 A;  1E1O A;  4WOR A;  1QNK A;  1WTO A;  2MO0 A;  3VYR A;  4QB4 A;  5CV9 A;  1C9O A;  4C3H G;  1LTI D;  2A1A A;  5A2Q L;  4IFD J;  4ABN A;  3B6Y A;  4CDE C;  3WOF A;  1XWE A;  2R7D A;  4QUC A;  4PG3 A;  1JJ2 A;  1KLG D;  1IXR A;  1SMY D;  3E0E A;  4X65 Q;  3UDF A;  2Z8L A;  3E5S A;  3PMF A;  3NTH A;  3U50 C;  3HKZ E;  2UXC Q;  2YU9 H;  3H0G H;  5ELN A;  1TKW B;  3CMA A;  1S5D D;  3D6W A;  1VQ8 A;  3IFT A;  2EPB A;  1B8A A;  4DUZ Q;  2O2L D;  3U9O A;  2K5N A;  1QOH A;  2MUY A;  2B39 A;  1JQY D;  1VQA A;  4DXG A;  5IYB G;  4GNX A;  2BH8 A;  1L1O C;  1N8R C;  1CM9 A;  2E74 C;  2R3Z A;  3CQZ H;  3AU7 A;  2Q8T A;  4KY5 A;  3PV0 A;  4K5V A;  2B2V C;  1NE3 A;  5C0X G;  1EIY B;  1SJE D;  1KAB A;  2Z9H A;  4JI4 Q;  1U4R A;  1ET9 A;  3P75 A;  4FP5 D;  3W3A A;  3HKZ G;  1X3G A;  3URY A;  2EY5 A;  3H3V H;  4LF6 L;  4X62 Q;  1SLJ A;  2VQF L;  3J7Y W;  1WD0 A;  2F1M A;  2WAC A;  5CV7 A;  1PH1 A;  2IPK D;  1ZYR D;  2E2H B;  4CHT B;  2L15 A;  4N9T A;  2JP1 A;  4ZKC B;  3H3V C;  3HOZ B;  1GHJ A;  2KED A;  1LT3 D;  1PH2 A;  3D31 A;  5FLX c;  5E4W C;  1Z6H A;  4HJA A;  2QF7 A;  5KNB A;  1YJ9 A;  4JPB W;  4JI6 L;  1Q3L A;  2A69 C;  4H02 A;  1N9W A;  3KOJ A;  3TZD A;  3SEB A;  1PFB A;  4R4I A;  4B3T Q;  1TWC B;  3E3X A;  3EN2 A;  4OIJ A;  2HCI A;  2NYZ D;  1I5F A;  1E2Z A;  1DGS A;  2QDB A;  4NW2 A;  3FVQ A;  3OWE B;  2NTT A;  5G3L F;  3S1N H;  1EYC A;  1CKN A;  5FK9 C;  4BS9 A;  3HRZ C;  5I2Y A;  5FLM H;  1PH8 A;  4MTK A;  2OQ0 A;  3HOZ G;  5C3X A;  4A3K G;  5CGK A;  3F2D A;  3PUZ A;  3I73 A;  4B08 A;  1VQH A;  1HH2 P;  2WKC A;  1K8A C;  2NVQ H;  1EIH A;  1WCM G;  2A69 D;  3KLR A;  5ELB A;  1IL8 A;  1SNM A;  2L5T A;  2VUM G;  1VQK A;  4DV2 Q;  3T16 A;  4ALP A;  1PA6 A;  3RZD H;  4DK0 A;  3D0F A;  3HOW G;  4MIU A;  3K7U C;  4NXM Q;  4PNY A;  1JWM D;  1HUN A;  5J3B A;  3IRB A;  3I72 A;  4YY3 Q;  3N52 A;  2FHT A;  1W6J A;  2FMM A;  4XXE A;  5K36 H;  4DV0 L;  4BBS H;  5C5L A;  5D3D A;  1AFP A;  4R9W A;  2WAQ G;  3J7A V;  4BA2 I;  1JB3 A;  3FMC A;  2M00 A;  2JA9 A;  1H9S A;  5CV8 A;  1VQD A;  2F0M A;  2H4O A;  4DV3 Q;  2F0W A;  3CCS A;  2C5C A;  3S2H B;  1HNX L;  2LSS A;  3G6E A;  3HOW B;  3BVM A;  1SE8 A;  1LM0 A;  1NCV A;  5C4X H;  4S3S A;  5IP7 H;  1L1O A;  3QWN A;  3E6Z X;  5DM6 3;  3A55 A;  3GTG H;  1IYV A;  5BN4 A;  2Z1C A;  3HOY B;  5EPJ A;  3NWS A;  3QOL A;  1C48 A;  2L1B A;  3MEH A;  3HOX G;  2GN5 A;  3PO3 H;  2O5J C;  1AE2 A;  2HT1 A;  1E1T A;  1JIC A;  3TEH B;  1F2Y A;  2D62 A;  5D3I B;  3TP5 A;  1K83 H;  5LL6 X;  1I4Q A;  2NVX B;  3GTJ H;  4TRD A;  5M9O A;  1TS3 A;  2XWJ B;  1A8V A;  5F2D A;  4AQY L;  4B3R Q;  1ML0 D;  1CKO A;  2VQF Q;  4X64 L;  1LT4 D;  4YY3 L;  5C6A A;  1FYC A;  3PIO 3;  4LF7 L;  3OW2 A;  3BZK A;  2Q8I B;  2K1B A;  1YJW A;  1VCI A;  3CPW A;  3BDO A;  3DWQ A;  3CCU A;  2ZTD A;  4K6D A;  1NMF A;  3S15 H;  1ICF B;  4NXN Q;  1JJC B;  1SNQ A;  4C1N I;  1EIF A;  4DR3 L;  1JOK A;  1AP0 A;  1VMP A;  3H0G B;  1O7Z A;  4FNF A;  3OMC A;  4DK6 C;  2Q8R E;  4IUT A;  4IUQ A;  2MNA A;  2ID0 A;  4OWT B;  1EWI A;  2NTS A;  4HED A;  2F0T A;  3HG9 A;  3CU7 A;  3S9W A;  5C4J H;  4R4Q A;  4G7O C;  3ND9 A;  2VUM H;  2R92 B;  1HFG A;  2RDH A;  4JV5 Q;  3M3Y H;  2KUM A;  4GN3 B;  1WCM H;  5IGC A;  2ICE C;  3JAM i;  4LFB L;  2K5V A;  3MHB A;  1HXY D;  1V9P A;  4PZ6 A;  3R8B A;  1I4H A;  3RMH A;  2K52 A;  3VA7 A;  1NR2 A;  3A0J A;  5HGT A;  4BY1 B;  1VQE A;  4BY7 H;  2E2J H;  4BBR B;  5DLQ E;  1S5C D;  3KFU A;  3EA6 A;  4JK1 C;  2CH4 W;  3NEN A;  1NR4 A;  2WB1 E;  3E9I A;  4OEM B;  4RA8 A;  4PQX A;  3I4N B;  3NPP A;  4JI7 L;  3D4W A;  2AMC B;  2EVB A;  5JOB A;  1GUW A;  1PRT F;  2WB1 G;  1G8Z D;  5IYD G;  3GQB A;  1NBW A;  2JA5 H;  4EVO A;  2R61 A;  1B3A A;  1EEF D;  3A74 A;  5C0X H;  2H5X A;  4X66 Q;  5C3E B;  1VQL A;  4QY7 A;  2PZT A;  4L5R C;  2PYK A;  2E5L Q;  1ILQ A;  4JV5 L;  3SR1 A;  1V1P B;  5JVH 3;  4KKS A;  4LUV A;  3BDC A;  1MD2 D;  1EQR A;  1SYB A;  1WTP A;  4PZ7 A;  4FXD A;  1JC7 A;  1YEZ A;  3G6J B;  2UXB L;  3C2P A;  2F0P A;  3HFZ B;  2MJ8 A;  1I4X A;  2X6G A;  4R1J A;  2VUM B;  4HAE A;  1VQO A;  2JA8 H;  4FVM A;  1B4O A;  1WTH A;  4RGO S;  5GAE C;  4DR2 L;  3MXN B;  1B2T A;  4LJZ C;  5C3W A;  2BE5 D;  5HUR A;  2KHS A;  1TWA B;  5CYU A;  2AQ1 B;  3NBH B;  4UP9 A;  3I55 A;  4P71 A;  4BBS B;  2O4X A;  2CQO A;  4IPG A;  1PDQ A;  1FNV A;  2JE6 I;  1H9R A;  2RKS A;  2KCN A;  2ZXO A;  4I7A A;  4TSS A;  4C3I G;  4JI5 L;  4XT1 B;  1A3T A;  2D0O A;  1R4Q B;  4HMI A;  2FMC A;  1QJO A;  3S1Q H;  4OX9 Q;  5T1G A;  1VQC A;  3CXC A;  3CC4 A;  2E2H H;  1CSQ A;  4QL5 A;  3TRE A;  4AIM A;  4GNX C;  1KLU D;  4DAY A;  3PIO A;  4IAL A;  3R3O A;  4GKK L;  4NP5 A;  5JAV A;  4R8N A;  2CQA A;  1E2W A;  4A3F B;  2B8F A;  1A2T A;  1HNX Q;  5H1S E;  2F4I A;  4R4O A;  4GKJ L;  3BYY B;  2UU9 Q;  3JC6 6;  1YJN A;  4K2L A;  3OOC A;  4TVA B;  4GZY C;  4MN3 A;  2WB1 B;  4KV6 A;  1OXT A;  4RGM A;  3S1M H;  4R8I A;  1TII D;  1UAP A;  2DN8 A;  1L0W A;  5FJ8 H;  1TWH H;  1WI5 A;  4KN4 C;  5CBA E;  3U9S A;  1XPU A;  1LTA D;  1XNR Q;  5C4Z A;  3GV6 A;  4ME5 A;  4A3D H;  2ZTC A;  4XIG S;  1U0L A;  5KRU A;  4IO9 A;  2KVM A;  2Y0S E;  3J80 L;  1X32 A;  3PO2 B;  3WOE A;  1PH7 A;  3HKS A;  2JEA I;  2B2U A;  1XMO L;  4OX9 L;  2MO1 A;  1QNU A;  2UXD Q;  4RHR A;  3FEW X;  3OYY A;  1J5E L;  3M7N A;  2PMZ B;  3UDG A;  1WOC A;  1R4P B;  1BDO A;  2XRS D;  2C35 B;  2HQL A;  1EY9 A;  3L3O C;  2F0I A;  4DGZ A;  3FPP A;  2Q2I A;  4A3F H;  2ATW A;  3C46 A;  1AZP A;  4Q0F A;  1X3F A;  4P2C B;  3FKI B;  4L5S A;  1Q86 C;  3STB C;  2PW5 A;  5M5W H;  1DYQ A;  1MHW C;  2FIN B;  5I9P A;  1PTO B;  1XXG A;  1P8L A;  1GHK A;  1A6X A;  3TME A;  2A6E D;  1SE2 A;  1STA A;  3I90 A;  2PI2 A;  4M8A A;  5CBE E;  4A3B G;  2NVY H;  1HQR D;  1XPR A;  4A3J B;  3NBI A;  1C7Y A;  1G6P A;  1B9M A;  4X3U A;  3HOY H;  2UU9 L;  3G7L A;  3ULJ A;  2CW0 D;  4HR7 B;  1WTX A;  1BBU A;  2LXK A;  5E1F A;  2SNM A;  1ZKO A;  2KCT A;  2L0C A;  1P16 A;  3GTQ B;  2R93 G;  5LMN L;  1UE6 A;  1STY A;  3KDF A;  1HNW L;  1XTD A;  2VB2 X;  4AYB E;  1F9Q A;  1QE6 A;  1HPC A;  3AB9 A;  3GTO H;  3ONA B;  4ZKB B;  4XQQ A;  3PGZ A;  1PVO A;  1ASY A;  1I4P A;  1Z7T A;  3GDE A;  3NQT A;  4DUZ L;  3KLS A;  3SK4 A;  3L9A X;  4BY7 G;  1TT2 A;  4PMC A;  3DWA A;  2A68 D;  2UUA L;  2A19 A;  5FLX L;  3ULP A;  2EDG A;  3NXW A;  4P74 A;  5LMN W;  1D8L A;  4B3T L;  3K6O A;  4HIO A;  3S1R H;  2KHJ A;  4ZCK A;  2QW7 A;  4PV1 C;  4RWS C;  3D3R A;  3TBI B;  3A5Z B;  3W1B A;  2EYM A;  5C44 B;  1HNW Q;  4A76 A;  4OWX B;  1FR3 A;  1KNA A;  2LFN A;  4JBW A;  1CQV A;  1JCK B;  2RSN A;  1V1O A;  3PO3 G;  1TQO A;  1TWC H;  4L63 B;  3TP7 A;  3ICE A;  3JAM E;  2JA8 B;  4MHE A;  1BO0 A;  1F2M A;  2B63 H;  1XNQ Q;  3P20 A;  4WJ4 A;  1YVC A;  2NVY B;  3IL8 A;  2ENB A;  5FKA C;  1SFO B;  2DNE A;  2EYL A;  1KAW A;  3T51 B;  4DA2 A;  1I3Q B;  2DGY A;  1QVC A;  2F0V A;  1EEI D;  4UP7 A;  1XPO A;  1QG7 A;  1SNC A;  4JI2 L;  4KN7 C;  3HGB A;  2F4V L;  3DHQ A;  4ZQ3 A;  2JYO A;  4ULL A;  5BN3 A;  5C0X I;  5D14 A;  1HR0 L;  2NVX H;  3RR5 A;  3GP7 A;  2PCF B;  3QR8 A;  2EYF A;  1SNO A;  1QIL A;  1BCP C;  1H9J A;  3CF5 A;  3D4R A;  4HCS A;  3PIP A;  1IKL A;  1FVI A;  1GO3 E;  2JA7 H;  3QOJ A;  3W1G A;  1WTV A;  1X9N A;  5FO8 B;  1EQV A;  2CVR A;  4H0L C;  1MJE A;  2R92 G;  1UE1 A;  1F9S A;  5IP7 G;  5C4X G;  3M85 A;  3PUV A;  1PYS B;  1SMY C;  3K80 C;  4YHH L;  5A2Q E;  1O7Y A;  4EX5 A;  1UUP A;  4K2K A;  3I3C A;  3MWY W;  3IFD A;  3FKI H;  5EKL A;  4BBR G;  4IFD I;  4DR3 Q;  3J81 i;  3LWU A;  1E7Z A;  4LF6 Q;  1X65 A;  1BR9 A;  3SVM A;  1H95 A;  2X69 A;  3F2U A;  4DV2 L;  5JEA J;  3R93 A;  4IUV A;  1A2U A;  5J1Z A;  3CHB D;  2ZJR A;  2UUC L;  2B63 G;  2RDG A;  1I94 L;  1ENA A;  3UE0 A;  1VQM A;  3GTG B;  5FO9 B;  3A8K E;  1N33 L;  4KI0 A;  4A3J G;  1T5E A;  1CA5 A;  4A3L G;  4DR1 L;  4LF5 Q;  1TY2 A;  2BDN A;  5M3F G;  4YHH Q;  3R2I A;  5C4H A;  1KC8 C;  1KNE A;  5T1I A;  2HCC A;  1FNU A;  2DY8 A;  1QWY A;  2AHO B;  3SGI A;  4GOP B;  2F0J A;  2XGT A;  1JMC A;  1E22 A;  2NZ1 D;  5C0X J;  4KKT A;  2KEN A;  2B2Y C;  3EBE A;  1KDA A;  4DR7 Q;  5ELE A;  4JI0 Q;  3FP9 A;  5FLX E;  1LV9 A;  2E2D C;  1EZ6 A;  4A3G B;  4H13 C;  5IIF A;  2FXQ A;  2CH4 A;  1A3U A;  2A8V A;  3CP0 A;  5IYC H;  2XVS A;  2NWG A;  4GLA C;  4ZYS A;  4C3J B;  4A75 A;  3HOY G;  1Y14 B;  4BXX G;  4DU9 A;  5LMN Q;  5D65 A;  1LTG D;  4DAP A;  1OXU A;  4JI8 Q;  2AKW B;  1UEB A;  4QIW E;  2E5L L;  1HHV A;  4B3S Q;  4X6A H;  1HZ9 A;  4CKE A;  1H9K A;  1VQI A;  3MVV A;  4FXG C;  1D2B A;  4A3K B;  1XNQ L;  1G91 A;  1MSG A;  1XYI A;  2L12 A;  4XYO A;  4KHP Q;  2R6G A;  3KF6 A;  4P73 A;  1KQS A;  5C4X B;  3ERS X;  1J5E Q;  2R93 H;  3L0O A;  5I6W A;  4L6T B;  4RGT A;  1CT1 D;  4JI8 L;  3V05 A;  3HOU B;  2B2Y A;  3VR3 A;  2RBM A;  5JPM C;  4LWC A;  3PQI A;  3K5L A;  4JI4 L;  3S14 H;  1N32 Q;  4A3F G;  4K0K L;  3H0G G;  5DNF A;  5AJ3 Q;  4OON A;  1WYD A;  3CD6 A;  1N32 L;  1HUM A;  5I9O A;  4JCV E;  1L2F A;  4IUU A;  4A3B H;  5FO7 B;  2YTV A;  1IHZ A;  1IBM Q;  4IUR A;  3KJO A;  4K5X A;  4JI2 Q;  2I46 A;  4LF4 L;  4X3K A;  1LUZ A;  2JA5 B;  4A3C G;  3GTP B;  4LFC L;  3I4M H;  2VS1 A;  4DPG A;  4C3H H;  4XQN A;  4X66 L;  3L7Z C;  4A3D G;  3QIA A;  4BY1 G;  2JA6 H;  3U4Z A;  2LKV A;  3PF5 A;  1C4Q A;  1YHA A;  2K32 A;  1QZH A;  3I7F A;  3S1N B;  5COY A;  3GTJ B;  4RGN A;  1IYU A;  5FJ8 G;  3T1H L;  1VQF A;  5LHY 1;  3H3V I;  1NY4 A;  1VQG A;  3M4Y A;  5M5X H;  5C5M A;  1E0B A;  3OSO A;  1GUN A;  1GUT A;  3EFX D;  5DEH A;  1DOK A;  4JI3 Q;  4QIW B;  4C3J H;  2RHS B;  4I65 A;  1STE A;  1V1Q A;  5GAD C;  1EWC A;  3NE5 B;  4LFB Q;  1Q7Y C;  2PZW A;  5IWA L;  1M4V A;  2NB0 A;  2B3G A;  2OEO A;  4GN4 B;  1RD9 D;  3MTS A;  3F8T A;  1Y1W H;  1NTG A;  5M5Y B;  1YNN D;  2DNC A;  3QB3 A;  4GS3 A;  4IOC A;  5EQ0 A;  1F77 A;  3J80 E;  4IZ8 A;  5M3M H;  1Y1V G;  5ELF A;  2EYO A;  4TKO B;  5JJK A;  2K33 A;  2QEJ C;  2KEC A;  5IT9 E;  5IE8 A;  4A3G G;  1ILP A;  3UDX A;  3U58 A;  2RCN A;  5IP9 H;  1PZJ D;  1QUQ B;  1K0S A;  2N49 A;  1W6K A;  4JYA L;  4ID6 A;  1CHP D;  4LF8 L;  4V19 0;  3S16 B;  1GUO A;  2A5H A;  2JN4 A;  5IT9 L;  1K73 C;  1D1K A;  1Q82 C;  3A54 A;  1UEA B;  1SYF A;  4A93 G;  1VF7 A;  4HMJ A;  1G29 1;  4DR4 Q;  4OEL B;  2LY7 A;  3TP6 A;  2B8G A;  4LF7 Q;  2QGQ A;  2HDM A;  3Q6S A;  2F0L A;  3SDZ A;  1W2B A;  3J7A F;  4YWK A;  2DJF C;  4OIK A;  1FGU A;  1PV4 A;  3AFQ A;  3KBX A;  4DV7 Q;  3ERQ A;  3OIQ A;  4KHP L;  1I6H H;  1DCZ A;  4X65 L;  1JWS D;  2CW0 C;  1EFW A;  3GTK B;  1TY0 A;  1YHQ A;  1UE5 A;  4WJW A;  1ET6 A;  1HA5 A;  1EY0 A;  3OIP A;  1FNW A;  4G57 A;  3RUZ A;  4U67 3;  3MXN A;  5EPL A;  2BOS A;  2JQO A;  5HY6 A;  5IGG A;  3J7A 5;  2EJG C;  5KGU A;  3S17 B;  1EY8 A;  2FFK B;  4WFN 3;  1HNZ Q;  1GOZ A;  3M4Q A;  3GTM B;  1PZI D;  3G71 A;  2JSO A;  3RZO B;  1NJI C;  1DOM A;  1KRS A;  5E3F A;  4C3I H;  4C56 C;  1EY7 A;  2P5Z X;  3I4M G;  2B2W A;  4A93 B;  4A3C H;  3H09 A;  4X3S A;  2A6E C;  5I4D A;  1YHB A;  1O80 A;  2VZA A;  1A62 A;  1EOV A;  2F52 A;  1HR0 Q;  4DUY L;  1HZA A;  2WFW A;  5M5X B;  1C8C A;  2SDF A;  1LTR D;  1S40 A;  2F0D A;  3STB D;  1PRT C;  1WJJ A;  1X6O A;  2A73 B;  1SDF A;  1CUK A;  3VYU A;  2QEX A;  2EQS A;  3EVQ A;  1ZYR C;  1KIX A;  1D1I A;  2XIW A;  3AMU A;  1TWF H;  2EYJ A;  1J8I A;  4A3E G;  2OT2 A;  1PTO D;  1OXS C;  1BKB A;  1Y1V B;  4XT3 B;  4EQO A;  1HNZ L;  5IGB A;  1WTR A;  1S5B D;  2B63 B;  1TWG H;  3J81 L;  3RLN A;  1PMR A;  4A3M B;  1K83 B;  2LXJ A;  3PUW A;  2D5D A;  5GQO A;  1PXU A;  4LFA Q;  1PYW D;  3BU2 A;  3SK5 A;  1HTP A;  3RLO A;  2K50 A;  3TRZ A;  3J81 c;  4DR6 Q;  3CCV A;  1EIG A;  5I6Y A;  4DNR B;  1K8M A;  2ASB A;  2A74 C;  1SXT A;  1CHQ D;  3HZX A;  4RKL A;  3AQQ A;  2VQE Q;  4LNQ A;  4IQZ A;  4C2M B;  1MKH A;  1PH9 A;  1II3 A;  5GAH C;  3FDT A;  2JA6 B;  1O78 A;  4U68 A;  3PCO B;  1TWH B;  1N33 Q;  4KJN A;  3K7A B;  1S4Z A;  3CW2 C;  2V4D A;  1Y8N B;  4OO1 I;  2B29 A;  5LMU L;  4UPA A;  3NEL A;  4CDC C;  1LO5 D;  5M3F H;  2CWP A;  4M1U B;  3CCE A;  1Y8O B;  1WVL A;  1RKN A;  1VQB A;  5TSS A;  1S3O A;  1SYC A;  3HOX H;  3S2D B;  4O42 A;  2O5I C;  3GTO B;  4FYD A;  1NUC A;  1HR0 W;  4YCU A;  3LWE A;  2YYZ A;  2UXC L;  4UAI A;  4IFD G;  1ZXT A;  3AYH B;  2JA7 B;  1T9H A;  4HJ7 A;  1Y8P B;  2MGS A;  2KOL A;  2NBF A;  2I5L X;  5CV4 A;  1VQ9 A;  2AWN A;  4HSV A;  2IHE A;  4N8X 1;  3Q8D A;  4Y7N B;  1DON A;  3DEP A;  1SND A;  4HJ9 A;  1CFM A;  3C1E A;  3VDY A;  2R93 B;  1DZ1 A;  2EOT A;  3T56 B;  5CR3 A;  1WCM B;  4ZRZ A;  1M8A A;  4P75 A;  3RNU A;  4DXF A;  1EQQ A;  4JYA Q;  4N8F A;  1U4M A;  5ELC A;  4HCE A;  2HD3 A;  1WTW A;  2KJX A;  3I4L A;  3DXJ C;  4O0A A;  4YCV A;  2I07 B;  3D8G A;  3E9H A;  1B50 A;  1EOT A;  1KTK A;  4Q5V A;  5K36 G;  1K28 A;  2BA0 A;  4LF4 Q;  2JA7 G;  2Z6K A;  1IYJ B;  3NHH A;  3K81 C;  4POF A;  1QVF A;  2M2L A;  5JPN C;  3TS0 A;  3HOW H;  4UP8 A;  2B2U C;  2SEB D;  2NN6 G;  1S72 A;  1EY5 A;  4RKB A;  4DUY Q;  2NVQ B;  2AUJ D;  3ERO A;  3DM3 A;  4A3E B;  2ZXP A;  3PF4 A;  1JOQ A;  4H44 C;  3OW7 A;  1KXL A;  1SRO A;  1PFN A;  2E75 C;  3S17 H;  1FD7 D;  2KCM A;  1OTC A;  1HA6 A;  2EE1 A;  4B9W A;  1Y69 U;  5CC4 A;  4KD4 A;  3V96 A;  1JOO A;  3OWF A;  1I94 Q;  1STB A;  2GVB A;  2C9O A;  4DN4 M;  1LAB A;  4A3K H;  4H7B A;  1VS0 A;  3BG3 A;  1JR0 D;  1OXX K;  4ILW A;  5FLM G;  4ZUJ A;  2B2V A;  3PO2 G;  1A15 A;  2J4X A;  1Q1E A;  1ROD A;  3KDF B;  1I50 H;  4BBS G;  1Z9F A;  4X64 Q;  1K9M C;  3BZD B;  5IYC G;  1B44 D;  1BVS A;  2RHQ B;  3J80 i;  1TWA H;  2F0E A;  3RN5 A;  2DJG C;  2CFM A;  3CRL C;  2SOB A;  1GXD C;  1NMG A;  5IOD A;  3VR4 A;  1X3P A;  2JK8 A;  2Q2H A;  1ONL A;  2J0T D;  5JJZ A;  1K8G A;  4LFC Q;  2E2I H;  4DV1 Q;  2F3I A;  2PQA B;  5ISR A;  1NAP A;  2F0Q A;  1BNZ A;  1IBM L;  2Y0S B;  1BCP D;  1STG A;  2L4N A;  1PH3 A;  3EJI A;  1XJV A;  3ER0 A;  1N36 L;  4FF1 A;  5M3M B;  1ESR A;  1AH9 A;  3CC7 A;  3I4N G;  3Q22 A;  3HOZ H;  4K0K Q;  4A3J H;  4ZAI A;  3GO5 A;  1TS2 A;  4A3M G;  2YU9 B;  2PNR C;  4HTH A;  1Q8I A;  4CDD C;  2Q2T A;  1CK1 A;  2R7Z B;  2HHH Q;  4EGV A;  1BCP B;  1IKM A;  2YTY A;  4LW1 A;  4XTC S;  5IWA Q;  3I4N H;  3SXH A;  3A56 A;  3MXG A;  1H9S B;  4POG A;  1FJG L;  2XTI A;  4JI3 L;  1F9P A;  1PZK D;  1X3Q A;  3AFP A;  4ZUI A;  1JE4 A;  4ZLT F;  4QF4 A;  5CV5 A;  1LT6 D;  1SMX A;  4TQU S;  1I4G A;  4DK1 A;  1YNJ C;  4NDX A;  1HTL D;  1VQ4 A;  1MJC A;  2KEE A;  1PRT B;  1MSH A;  4JI1 Q;  1R9T B;  1HCZ A;  1U4L A;  4IUP A;  2OWO A;  3NEM A;  2PPB C;  2WAQ E;  1YNX A;  2TSS A;  3ZJY C;  1NNX A;  3TZU A;  1D5M C; 
#chains in the Genus database with same CATH homology
 3X3M A;  2JEB I;  3P7J A;  2IJ0 A;  4QUF A;  1QB5 D;  4DNT B;  1STH A;  3RLF A;  3K5M A;  4IN3 A;  3H6M A;  1AZQ A;  4N9P A;  2K04 A;  2D2C C;  2HDL A;  1JOR A;  4FXK C;  4KY7 A;  1U4P A;  2B2W C;  4A3D B;  2NN6 H;  4FF4 A;  4NMZ A;  1TR5 A;  2A6H D;  4HN7 A;  3MAQ A;  3M4O B;  4NKL A;  3GTL B;  3OMG A;  1WTQ A;  1DM0 B;  5IGE A;  3DMU A;  2MHV A;  2F0F A;  3MZ5 A;  3K59 A;  5BN5 A;  1CQF A;  1OXV A;  2XRQ D;  4C3I B;  2K5W A;  1CI3 M;  1O7L A;  2EJM A;  2QCP X;  1I6H B;  4WRD A;  2K7V A;  2IX3 A;  4LMQ D;  3A8J E;  4DF7 A;  1G2T A;  2NN6 I;  3LX0 A;  2F0N A;  3T13 A;  1YNN C;  1GUG A;  1FGB D;  1IW7 C;  1MI2 A;  1B9N A;  3ITP A;  1CZW A;  2VB3 X;  4G7Z C;  1DOL A;  4RHS A;  2B2T A;  5KIX A;  3E0J A;  1MBY A;  1IW7 D;  1RDP D;  1BBX C;  2F03 A;  3TP8 A;  5DM7 3;  1BOS A;  3I8Z A;  3N6R A;  1QCB D;  1LTB D;  2HQE A;  4PMB A;  4OHJ A;  3C1F A;  1CZG A;  5J22 A;  3MA2 B;  5KNC A;  3PO3 B;  4A3I B;  4OO1 H;  3K5N A;  1Q12 A;  4KD3 A;  1RTO A;  3SK6 A;  1TWG B;  1EL0 A;  3DUZ A;  3VR5 A;  4EQN A;  1L0X B;  4KY6 A;  1S5F D;  2L55 A;  5EJW A;  3MFG A;  5K5P A;  4KKU A;  2WII B;  1Q1B A;  2E76 C;  1F2Z A;  2K6A A;  1AN8 A;  1V1P A;  3I70 A;  3MXP A;  1YNJ D;  3NUC A;  2DY7 A;  2ZT9 C;  1I6V C;  2ICI A;  4RCN A;  5I2X A;  1UNS A;  1PTO C;  1SEB D;  3C3L A;  2N88 A;  4OO1 G;  5C4J B;  4LK1 C;  1I50 B;  4FO2 A;  1T5X D;  5LL6 S;  5DAU A;  3RZD B;  3K58 A;  5EKI A;  1BQQ T;  1DXM A;  2WAQ B;  2AQ3 B;  4XQJ A;  3S14 B;  2VNU D;  2MPM A;  4CJ1 B;  4O1N A;  4E6I A;  4I7Z C;  3BS1 A;  4HSP A;  2WP8 J;  5ELD A;  3Q0A A;  1D5Z C;  2XWB B;  1TU2 B;  4XYQ A;  2X6L A;  2Z4I A;  3M3Y B;  2KCC A;  3S1Q B;  3TSS A;  1K8O A;  2BE5 C;  1E2V A;  3SHL A;  4BA1 I;  2A6H C;  1XTC D;  2GA4 B;  3KBG A;  1EFI D;  3ND8 A;  2RVL A;  5EKK A;  2EYP A;  1HQM C;  2KQ3 A;  4J1M A;  3H94 A;  2IW3 A;  4CKB A;  2AQ2 B;  3K5O A;  2ZXR A;  3DEO A;  3VR2 A;  1AW7 A;  3MXU A;  4CJ0 B;  2F0K A;  2M9V A;  3EQL C;  2IWH A;  1F9R A;  3MFY A;  1DD2 A;  5NUC A;  4F88 A;  2PZU A;  4YIJ A;  4FF3 A;  1RF2 D;  3QJY A;  2NVT B;  1EY6 A;  1LTS D;  2K01 A;  3S15 B;  1TS4 A;  1RCV D;  3VYT A;  4V0B A;  3X3N A;  1J9O A;  4AYB B;  5A35 A;  1S5E D;  4LAA A;  3QO2 A;  2EZV A;  2EJF C;  2E2J B;  3BYT B;  5J39 A;  2K05 A;  2N55 A;  3CKI B;  3FPU B;  3RD4 A;  1Z47 A;  1SE4 A;  4KHV A;  3HKZ B;  1VMC A;  1MGS A;  4DFA A;  5E4X A;  1B1Z A;  3QG1 A;  2K5D A;  4ODG A;  3NP8 A;  3NBH A;  4QCL A;  1BCP F;  2XNA C;  4F87 A;  1A3V A;  4C3H B;  1G2S A;  2L9H A;  2PW7 A;  4OGQ C;  1GUS A;  5EGT A;  1Y1W B;  4KTA A;  3A8I E;  4RH6 A;  3K0Y A;  2F3V A;  1KDC A;  4IUN A;  3W2D A;  3HOX B;  2NUC A;  4J8Q A;  1ZEQ X;  1CA6 A;  1EYA A;  5G3L D;  3GV3 A;  3J81 E;  3IAY A;  2QKI C;  1PTO H;  5M5W B;  4RAU C;  3T53 B;  4XDX A;  2SNS A;  3KLS X;  3PUX A;  5JVG 3;  3K57 A;  4CBV A;  4EQP A;  3DWP A;  2XSC A;  2XN9 C;  1LTT D;  1EU4 A;  2WV6 D;  4B9X A;  1KDB A;  1NSN S;  5KND A;  2AUK A;  4X3T A;  4K8J A;  2RSO A;  4C1N K;  3GD7 A;  2F0U A;  1PRT D;  3NTI A;  1VF5 C;  3D6C A;  3HP3 A;  3IKJ A;  2OF1 A;  1EY4 A;  4BY7 B;  1H9M A;  3CRK C;  2BCO A;  5COR A;  1RHP A;  3WDN A;  3VYS A;  3P1H A;  2F0G A;  1OO9 B;  3Q24 A;  3SE0 A;  1PFM A;  1SYG A;  1SBB B;  1SYE A;  1BUV T;  1GJX A;  3BVG A;  2G9D A;  4K5W A;  4IFD H;  1ENC A;  3D4D A;  4KMU C;  1SNP A;  5IOC A;  3JAM L;  3TN2 A;  2K5Q A;  1SSO A;  2RQX A;  1TVX A;  3M7G A;  3O13 A;  2IX1 A;  1L0Y B;  3HOV B;  2F0H A;  1SYD A;  5IGF A;  1SE3 A;  3VR6 A;  3NWT A;  4J6H A;  1ICW A;  3TDQ A;  3HS0 C;  3FRP B;  2LMC B;  2A68 C;  1Q90 A;  1D6E C;  5EPK A;  4L8J A;  3DM1 A;  2IX0 A;  3BVZ A;  1LT5 D;  3PUY A;  5EBC A;  3S1M B;  4A3B B;  5AFW A;  1EU3 A;  4F7X A;  5KEE A;  3ZYY X;  1V8Q A;  1U9R A;  2IT1 A;  3V2T A;  4CJ2 C;  3LNN A;  3R2T A;  1STN A;  2EY6 A;  1EWH A;  1F2L A;  4KJO A;  2Z4H A;  2IL8 A;  5KYI A;  2K28 A;  2LS0 1;  1BXT A;  3VA5 A;  1XX8 A;  4K14 A;  1CTM A;  1D5X C;  2VXW A;  1LLR D;  4ZK9 B;  3MC0 B;  1BF4 A;  1ESF A;  1HFN A;  1PLF A;  1WD1 A;  5JEA H;  2H1E A;  2RDF A;  2PQE A;  4FF2 A;  3NK9 A;  1EQT A;  2J7Z A;  5M3F B;  2F3W A;  5CMD A;  2F0O A;  3S1R B;  5EBD A;  4K8I A;  3A7L A;  3I91 A;  1TS5 A;  1HRJ A;  1AEX A;  1RTN A;  1SAP A;  2MP1 A;  2D9U A;  3BDL A;  3Q23 A;  2G9H D;  2B2T C;  4F8M A;  2FJ2 A;  3KK7 A;  2E2I B;  2AWO A;  2WKD A;  2L11 A;  4QMG A;  3NQI A;  3OHX C;  3I4M B;  2BDO A;  4OL7 A;  5KYL A;  2HUG A;  2EY2 A;  1G6Z A;  4Z9C B;  1VDZ A;  3SK8 A;  4BWG B;  3OPO A;  4G7H C;  2RA4 A;  1ENF A;  3NTK A;  3A7A B;  5JEA G;  4KHZ A;  4KK7 A;  2JXM B;  4CKC A;  4PMW A;  1KAA A;  4UDU C;  2TMP A;  1EYD A;  2BA1 A;  1RJT A;  5IGD A;  3HEJ A;  3CQZ B;  2F0S A;  5CV6 A;  1LAC A;  1DJR D;  2EY1 A;  2K03 A;  2CHB D;  1JWU D;  3H91 A;  4DAV A;  2KA7 A;  3UI2 A;  4C3J G;  4RCO A;  1EZ8 A;  2QIL A;  1PTO F;  3PIP 3;  4G4K A;  4RFB A;  3T4A C;  5FOB B;  2OXP A;  1SJH D;  2EYH A;  1V43 A;  3KUP A;  3NSW A;  1TWF B;  2EXZ A;  2PO4 A;  2WIN B;  4K6L A;  1I4R A;  3KF8 A;  1B53 A;  4WOR A;  1QNK A;  1WTO A;  3VYR A;  4QB4 A;  5CV9 A;  4C3H G;  1LTI D;  5A2Q L;  4IFD J;  4ABN A;  3WOF A;  1XWE A;  4QUC A;  1KLG D;  1SMY D;  2Z8L A;  3E5S A;  3PMF A;  3NTH A;  1TKW B;  1S5D D;  3D6W A;  3IFT A;  2EPB A;  2O2L D;  3U9O A;  1QOH A;  2MUY A;  2B39 A;  1JQY D;  4DXG A;  1CM9 A;  2E74 C;  2R3Z A;  3AU7 A;  2Q8T A;  4KY5 A;  3PV0 A;  4K5V A;  2B2V C;  5C0X G;  1SJE D;  1KAB A;  1U4R A;  1ET9 A;  3P75 A;  4FP5 D;  3W3A A;  3URY A;  2EY5 A;  3J7Y W;  1WD0 A;  2F1M A;  2WAC A;  5CV7 A;  2IPK D;  1ZYR D;  2E2H B;  4CHT B;  4N9T A;  2JP1 A;  4ZKC B;  3H3V C;  3HOZ B;  1GHJ A;  2KED A;  1LT3 D;  3D31 A;  5E4W C;  1Z6H A;  2QF7 A;  5KNB A;  1Q3L A;  2A69 C;  3TZD A;  3SEB A;  1PFB A;  1TWC B;  4OIJ A;  2HCI A;  2NYZ D;  1E2Z A;  2QDB A;  4NW2 A;  3FVQ A;  3OWE B;  2NTT A;  5G3L F;  1EYC A;  5FK9 C;  4BS9 A;  3HRZ C;  5I2Y A;  5C3X A;  5CGK A;  3PUZ A;  3I73 A;  4B08 A;  2WKC A;  1EIH A;  2A69 D;  3KLR A;  5ELB A;  1IL8 A;  1SNM A;  2L5T A;  3T16 A;  4DK0 A;  4MIU A;  4PNY A;  1JWM D;  1HUN A;  3I72 A;  3N52 A;  2FHT A;  1W6J A;  2FMM A;  4XXE A;  5K36 H;  5C5L A;  5D3D A;  1AFP A;  4R9W A;  3J7A V;  4BA2 I;  1JB3 A;  3FMC A;  2M00 A;  1H9S A;  5CV8 A;  2F0M A;  2H4O A;  2F0W A;  2C5C A;  3S2H B;  3HOW B;  3BVM A;  1NCV A;  4S3S A;  3QWN A;  3E6Z X;  5DM6 3;  3A55 A;  1IYV A;  5BN4 A;  2Z1C A;  3HOY B;  5EPJ A;  3NWS A;  3QOL A;  1C48 A;  2L1B A;  3MEH A;  2O5J C;  1JIC A;  5D3I B;  5LL6 X;  1F2Y A;  2D62 A;  3TP5 A;  1I4Q A;  2NVX B;  4TRD A;  5M9O A;  1TS3 A;  2XWJ B;  5F2D A;  1ML0 D;  1LT4 D;  5C6A A;  1FYC A;  3PIO 3;  2Q8I B;  2K1B A;  1VCI A;  3BDO A;  3DWQ A;  4K6D A;  1SNQ A;  4C1N I;  1JOK A;  1AP0 A;  1VMP A;  3H0G B;  1O7Z A;  4FNF A;  3OMC A;  2Q8R E;  4IUT A;  4IUQ A;  2ID0 A;  2NTS A;  4HED A;  2F0T A;  3HG9 A;  3CU7 A;  3S9W A;  4G7O C;  3ND9 A;  2R92 B;  1HFG A;  2RDH A;  2KUM A;  5IGC A;  2ICE C;  3MHB A;  1HXY D;  3R8B A;  1I4H A;  3RMH A;  3VA7 A;  1NR2 A;  5HGT A;  4BY1 B;  4BBR B;  1S5C D;  3EA6 A;  4JK1 C;  1NR4 A;  4RA8 A;  4PQX A;  3I4N B;  3NPP A;  3D4W A;  5JOB A;  2EVB A;  1GUW A;  1PRT F;  1G8Z D;  3GQB A;  4EVO A;  2R61 A;  1B3A A;  1EEF D;  5C0X H;  5C3E B;  2PZT A;  2PYK A;  1ILQ A;  3SR1 A;  1V1P B;  5JVH 3;  4KKS A;  3BDC A;  1MD2 D;  1SYB A;  1WTP A;  4FXD A;  1JC7 A;  3G6J B;  3C2P A;  2F0P A;  2MJ8 A;  1I4X A;  2X6G A;  2VUM B;  4HAE A;  4FVM A;  1B4O A;  4RGO S;  1B2T A;  4LJZ C;  5C3W A;  2BE5 D;  5HUR A;  2KHS A;  1TWA B;  5CYU A;  2AQ1 B;  4BBS B;  2O4X A;  1PDQ A;  1FNV A;  2JE6 I;  1H9R A;  2RKS A;  2KCN A;  2ZXO A;  4TSS A;  4C3I G;  4XT1 B;  1A3T A;  1R4Q B;  4HMI A;  2FMC A;  1QJO A;  5T1G A;  1KLU D;  4DAY A;  4IAL A;  3R3O A;  4NP5 A;  5JAV A;  4R8N A;  2CQA A;  1E2W A;  4A3F B;  2B8F A;  1A2T A;  2F4I A;  3BYY B;  4K2L A;  3OOC A;  4GZY C;  4MN3 A;  2WB1 B;  4KV6 A;  1OXT A;  4RGM A;  4R8I A;  1TII D;  1UAP A;  2DN8 A;  4KN4 C;  5CBA E;  3U9S A;  1LTA D;  5C4Z A;  3GV6 A;  4ME5 A;  4XIG S;  5KRU A;  2KVM A;  3J80 L;  1X32 A;  3PO2 B;  3WOE A;  2JEA I;  2B2U A;  1QNU A;  4RHR A;  3FEW X;  3M7N A;  2PMZ B;  1R4P B;  1BDO A;  2XRS D;  1EY9 A;  3L3O C;  2F0I A;  4DGZ A;  3FPP A;  3C46 A;  1AZP A;  4Q0F A;  4P2C B;  3FKI B;  2PW5 A;  1DYQ A;  2FIN B;  5I9P A;  1PTO B;  1XXG A;  1GHK A;  1A6X A;  3TME A;  2A6E D;  1SE2 A;  1STA A;  3I90 A;  4M8A A;  5CBE E;  1HQR D;  4A3J B;  3NBI A;  1B9M A;  4X3U A;  3G7L A;  2CW0 D;  4HR7 B;  1WTX A;  5E1F A;  2SNM A;  1ZKO A;  2L0C A;  3GTQ B;  1STY A;  2VB2 X;  1F9Q A;  1QE6 A;  1HPC A;  3AB9 A;  3ONA B;  4ZKB B;  4XQQ A;  1I4P A;  1Z7T A;  3NQT A;  3KLS A;  3SK4 A;  3L9A X;  1TT2 A;  4PMC A;  3DWA A;  2A68 D;  5FLX L;  2EDG A;  3NXW A;  3K6O A;  4PV1 C;  4RWS C;  3D3R A;  3TBI B;  2EYM A;  5C44 B;  1FR3 A;  1KNA A;  2LFN A;  4JBW A;  1CQV A;  1JCK B;  2RSN A;  1V1O A;  1TQO A;  4L63 B;  3TP7 A;  2JA8 B;  3JAM E;  4MHE A;  1BO0 A;  1F2M A;  3P20 A;  2NVY B;  3IL8 A;  2ENB A;  5FKA C;  1SFO B;  2DNE A;  2EYL A;  3T51 B;  4DA2 A;  1I3Q B;  2F0V A;  1EEI D;  1QG7 A;  1SNC A;  4KN7 C;  3HGB A;  3DHQ A;  4ZQ3 A;  2JYO A;  4ULL A;  5BN3 A;  5C0X I;  5D14 A;  3GP7 A;  2PCF B;  2EYF A;  1SNO A;  1QIL A;  1BCP C;  1H9J A;  3D4R A;  4HCS A;  1IKL A;  3QOJ A;  1WTV A;  5FO8 B;  1EQV A;  2CVR A;  4H0L C;  1F9S A;  3M85 A;  3PUV A;  1SMY C;  5A2Q E;  1O7Y A;  1UUP A;  4K2K A;  3I3C A;  3MWY W;  3IFD A;  5EKL A;  4IFD I;  3LWU A;  1D5M C;  1BR9 A;  3SVM A;  2X69 A;  3F2U A;  5JEA J;  3R93 A;  4IUV A;  1A2U A;  5J1Z A;  3CHB D;  2RDG A;  1ENA A;  3GTG B;  5FO9 B;  3A8K E;  4KI0 A;  1T5E A;  1CA5 A;  1TY2 A;  2BDN A;  3R2I A;  5C4H A;  1KNE A;  5T1I A;  2HCC A;  1FNU A;  2DY8 A;  1QWY A;  2F0J A;  2NZ1 D;  5C0X J;  4KKT A;  2B2Y C;  1KDA A;  5ELE A;  5FLX E;  1LV9 A;  2E2D C;  1EZ6 A;  4A3G B;  4H13 C;  5IIF A;  1A3U A;  2XVS A;  2NWG A;  4ZYS A;  4C3J B;  4DU9 A;  5D65 A;  1LTG D;  4DAP A;  1OXU A;  1HHV A;  4CKE A;  1H9K A;  3MVV A;  4FXG C;  1D2B A;  4A3K B;  1G91 A;  1MSG A;  1XYI A;  2L12 A;  4XYO A;  2R6G A;  5C4X B;  5I6W A;  4L6T B;  4RGT A;  1CT1 D;  3V05 A;  3HOU B;  2B2Y A;  3VR3 A;  2RBM A;  5JPM C;  3K5L A;  5DNF A;  1HUM A;  5I9O A;  4IUU A;  5FO7 B;  1IHZ A;  4IUR A;  4K5X A;  2I46 A;  4X3K A;  2JA5 B;  3GTP B;  4XQN A;  3L7Z C;  3QIA A;  2LKV A;  1C4Q A;  2K32 A;  3S1N B;  5COY A;  3GTJ B;  4RGN A;  1IYU A;  5LHY 1;  3M4Y A;  5C5M A;  1E0B A;  3OSO A;  1GUN A;  1GUT A;  3EFX D;  5DEH A;  1DOK A;  4QIW B;  4I65 A;  1STE A;  1EWC A;  3NE5 B;  2PZW A;  1M4V A;  2NB0 A;  2OEO A;  1RD9 D;  3MTS A;  5M5Y B;  1YNN D;  2DNC A;  3QB3 A;  5EQ0 A;  1F77 A;  3J80 E;  4IZ8 A;  5ELF A;  2EYO A;  4TKO B;  2K33 A;  2QEJ C;  2KEC A;  5IT9 E;  1ILP A;  1PZJ D;  1W6K A;  4ID6 A;  1CHP D;  4V19 0;  3S16 B;  1GUO A;  2A5H A;  5IT9 L;  1D1K A;  3A54 A;  1UEA B;  1SYF A;  1VF7 A;  4HMJ A;  1G29 1;  2LY7 A;  3TP6 A;  2B8G A;  2HDM A;  3Q6S A;  2F0L A;  3SDZ A;  3J7A F;  4OIK A;  3KBX A;  3ERQ A;  3OIQ A;  1DCZ A;  1JWS D;  2CW0 C;  3GTK B;  1TY0 A;  4WJW A;  1ET6 A;  1HA5 A;  1EY0 A;  3OIP A;  1FNW A;  4G57 A;  3RUZ A;  4U67 3;  3MXN A;  5EPL A;  2BOS A;  5IGG A;  3S17 B;  2EJG C;  5KGU A;  1EY8 A;  2FFK B;  4WFN 3;  1GOZ A;  3GTM B;  1PZI D;  2JSO A;  3RZO B;  1DOM A;  5E3F A;  4C56 C;  1EY7 A;  2B2W A;  4A93 B;  3H09 A;  4X3S A;  2A6E C;  5I4D A;  1O80 A;  5M5X B;  1C8C A;  2SDF A;  1LTR D;  2F0D A;  1PRT C;  2A73 B;  1SDF A;  3VYU A;  3EVQ A;  1ZYR C;  1D1I A;  2XIW A;  3AMU A;  1J8I A;  2EYJ A;  2OT2 A;  1PTO D;  1OXS C;  1Y1V B;  4XT3 B;  4EQO A;  5IGB A;  1WTR A;  1S5B D;  2B63 B;  3J81 L;  4A3M B;  1PMR A;  1K83 B;  3PUW A;  2D5D A;  1PXU A;  1PYW D;  3SK5 A;  1HTP A;  1EIG A;  5I6Y A;  4DNR B;  1K8M A;  2A74 C;  1SXT A;  1CHQ D;  3HZX A;  4RKL A;  4IQZ A;  4C2M B;  1II3 A;  3FDT A;  2JA6 B;  1O78 A;  4U68 A;  1TWH B;  4KJN A;  3K7A B;  1S4Z A;  2V4D A;  1Y8N B;  4OO1 I;  1LO5 D;  4M1U B;  1Y8O B;  1WVL A;  1RKN A;  5TSS A;  1SYC A;  3S2D B;  4O42 A;  2O5I C;  3GTO B;  4FYD A;  1NUC A;  3LWE A;  2YYZ A;  4UAI A;  4IFD G;  1ZXT A;  2JA7 B;  1Y8P B;  2MGS A;  2KOL A;  2NBF A;  5CV4 A;  2AWN A;  4HSV A;  4Y7N B;  1DON A;  3DEP A;  1SND A;  1CFM A;  3C1E A;  2R93 B;  1DZ1 A;  2EOT A;  3T56 B;  5CR3 A;  1WCM B;  4ZRZ A;  1M8A A;  4DXF A;  1U4M A;  5ELC A;  4HCE A;  1WTW A;  2KJX A;  3I4L A;  3DXJ C;  2I07 B;  3D8G A;  1B50 A;  1EOT A;  1KTK A;  4Q5V A;  5K36 G;  2BA0 A;  3NHH A;  2M2L A;  5JPN C;  2B2U C;  2SEB D;  2NN6 G;  1EY5 A;  4RKB A;  2NVQ B;  2AUJ D;  3ERO A;  4A3E B;  2ZXP A;  1JOQ A;  4H44 C;  3OW7 A;  1PFN A;  2E75 C;  1FD7 D;  1HA6 A;  2EE1 A;  4B9W A;  1Y69 U;  5CC4 A;  4KD4 A;  3V96 A;  1JOO A;  3OWF A;  1STB A;  2C9O A;  4DN4 M;  1LAB A;  4H7B A;  3BG3 A;  1JR0 D;  1OXX K;  4ILW A;  4ZUJ A;  2B2V A;  1A15 A;  2J4X A;  1Q1E A;  1ROD A;  3BZD B;  1B44 D;  2F0E A;  3CRL C;  2SOB A;  1GXD C;  5IOD A;  3VR4 A;  1X3P A;  1ONL A;  2J0T D;  5JJZ A;  5ISR A;  1NAP A;  2F0Q A;  1BNZ A;  2Y0S B;  1BCP D;  1STG A;  2L4N A;  3EJI A;  4FF1 A;  5M3M B;  1ESR A;  3Q22 A;  4ZAI A;  3GO5 A;  1TS2 A;  2YU9 B;  2PNR C;  4HTH A;  1Q8I A;  1CK1 A;  2R7Z B;  1IKM A;  4EGV A;  1BCP B;  4XTC S;  3SXH A;  3A56 A;  3MXG A;  1H9S B;  1F9P A;  1PZK D;  1X3Q A;  4ZUI A;  1JE4 A;  4ZLT F;  4QF4 A;  5CV5 A;  1LT6 D;  4TQU S;  1I4G A;  4DK1 A;  1YNJ C;  4NDX A;  1HTL D;  2KEE A;  1PRT B;  1MSH A;  1R9T B;  1HCZ A;  1U4L A;  4IUP A;  2PPB C;  2TSS A;  3TZU A;  4CGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...