4HMJA

Crystal structure of staphylococcal nuclease variant delta+phs l36d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmjA00
1JOOA 3D8GA 5J39A 1STGA 4K2LA 2F0GA 3TP7A 1SYDA 1A3TA 1SNDA 2EY5A 3H6MA 4N9TA 1EYDA 5DEHA 2EYOA 4ZUJA 3VA5A 5JAVA 4EQPA 2OEOA 2F0WA 1SYGA 1STNA 3P75A 4K8IA 2F0VA 4KY7A 4OL7A 3SK8A 4LAAA 5I6WA 1STBA 4KY5A 5ISRA 1F2ZA 2EYJA 2PZWA 5CV8A 3SHLA 3NQTA 4NKLA 3D4DA 4EQNA 3TP6A 4HMIA 4MIUA 4K6DA 4IUNA 3D4WA 4QF4A 5JOBA 1U9RA 1IHZA 2KQ3A 4G57A 4H7BA 1KDCA 2SOBA 4PNYA 5J1ZA 2F0PA 3QB3A 4KD3A 1KDAA 2F0FA 2F0IA 2F3WA 4J6HA 5C5LA 5NUCA 1EY8A 2F0KA 3P1HA 4B9XA 2LKVA 1EY7A 5KYIA 1JOQA 2NUCA 3HZXA 3MZ5A 2PZUA 3OMGA 5C5MA 5KIXA 1SNQA 1STAA 2F0MA 2F0OA 2O4XA 3NXWA 4KD4A 4RKBA 3T13A 5CV4A 5I9PA 3SK5A 4KY6A 1ENAA 2RDFA 4K14A 5KGUA 2HQEA 2EYMA 3R3OA 4K5VA 3EVQA 3SK6A 4ZQ3A 2PW7A 5C4HA 2ENBA 4ID6A 4NDXA 4S3SA 1ENCA 4DFAA 1TR5A 3ITPA 5IGBA 3NP8A 1EY6A 2PZTA 1SYBA 5KEEA 2SNMA 1KABA 5IGDA 4E6IA 5IGEA 2EYFA 1EY9A 2PW5A 1A3UA 4ODGA 2OF1A 3TMEA 4DF7A 1EQVA 2KHSA 3MHBA 3BDCA 1EY4A 3QOJA 4KJNA 2EYHA 1EY5A 2WACA 2F0UA 3V2TA 2EY6A 4B9WA 5IIFA 4I65A 2F0SA 2EYLA 4NMZA 5CR3A 1II3A 2F0EA 4RKLA 1EZ6A 3C1FA 5EGTA 1F2YA 3SR1A 5IGCA 4QMGA 4K5XA 5CV5A 3SK4A 4EQOA 4ZUIA 3NUCA 5C4ZA 4F8MA 3LX0A 3QOLA 3T16A 3OSOA 3MVVA 5C6AA 1EZ8A 4TRDA 1STHA 2F0HA 5C3WA 4PMBA 5E3FA 1SNMA 1SYCA 4KJOA 3RUZA 5E1FA 5KYLA 5CGKA 5HURA 1SNOA 1A2UA 3PMFA 1TQOA 2PQEA 4F7XA 4IZ8A 4ME5A 3TP5A 5I9OA 1JOKA 3SXHA 1KAAA 1EYCA 3D6CA 4HTHA 3NK9A 4J1MA 3EJIA 1STYA 5IGFA 4K5WA 4QB4A 2M00A 5IOCA 5J22A 2RKSA 3MEHA 3OWFA 1A3VA 1SYFA 3ERQA 4PMCA 2F0QA 5K5PA 3E5SA 2PYKA 3OMCA 4NP5A 2QDBA 2EYPA 5EKLA 3U9OA 1TT2A 2F0JA 5CV9A 1RKNA 5IODA 4HMJA 4YIJA 2F0DA 5I6YA 3NHHA 1SYEA 1SNPA 4KV6A 2RBMA 5EKKA 5DAUA 1A2TA 3TP8A 4WORA 3HEJA 4R8NA 1NSNS 4DU9A 5IGGA 5M9OA 3DMUA 1F2MA 3MXPA 1KDBA 1SNCA 2F3VA 5CC4A 4IALA 3S9WA 1JORA 3DHQA 2EXZA 3BDLA 1EY0A 5CV7A 5CV6A 2EY2A 1NUCA 2OXPA 4KHVA 5F2DA 5C3XA 2EY1A 3C1EA 4K2KA 4WRDA 3EROA 4N9PA 2F0LA 4EVOA 5KRUA 5HGTA 2F0NA 1AEXA 4K8JA 2SNSA 2F0TA 4KTAA 1EYAA 4DGZA
chains in the Genus database with same CATH superfamily
3NBHB 2AQ2B 3TP7A 3VA5A 3GTPH 2NVTH 4V0BA 5JJLA 1E7ZA 3ER0A 4A3IG 3HOYB 5G3LD 3RZOH 5C4XB 3LNNA 4X3UA 2CVRA 3SHLA 4LFAQ 4MIUA 4IUNA 4A3KG 4DK1A 2KQ3A 1EL0A 4O2DA 2F0PA 3L7ZC 4ZKCB 1XYIA 4LUZA 1PH1A 2IX1A 2BH8A 2X6GA 2NWGA 1PTOD 2I46A 4LFBQ 2B2UC 4CGYB 4RKBA 2E2IB 1DM0B 1B2TA 3S15H 1WTPA 4K14A 4JI2L 3R2TA 4OX9Q 3M85A 3Q23A 4XT1B 1VQJA 2F1MA 2FMCA 4FDBA 1X3EA 4A3FG 2PZTA 1KQSA 1KXLA 5IGDA 4FF4A 5IYBG 1PTOB 4TSSA 1H9KA 1WVLA 2K5VA 1DGSA 4DR6L 4X3SA 1Y1WH 3M4OB 4I65A 1PYSB 2E5LL 4CKBA 2PI2A 3P7JA 3C1FA 1DCZA 2K03A 1K9MC 1LO5D 3BVMA 1XPOA 4XYQA 4GNXB 3H3VH 2D0PA 2NTSA 4YCWA 3QIAA 1FGUA 1RL2A 5ELCA 4GS3A 3UDGA 3FKIG 1JOKA 4Y52H 1QJOA 2A69D 5HGQA 1XWEA 5JPMC 2Q2UA 4GKKQ 1GUNA 2M00A 4BY1G 4ABNA 4HIKA 4A76A 1YJWA 1XPRA 2JA6B 3PCOB 1KLGD 1Y1VH 1RHPA 1CSQA 4PZ8A 1NJIC 4NXML 2R93G 1PH8A 1SNPA 2LS01 4WORA 4FF1A 1JE4A 5FLXL 5AJ3L 1KDBA 1SNCA 3TZDA 2NVQB 1TWFH 3BZCA 1KLUD 1EY0A 2OXPA 1ZYRC 4KHVA 3CD6A 1GUWA 4K2KA 3GTKH 1HZCA 2UU9Q 2MO0A 4KTAA 1EWIA 1AP0A 1HNXL 1A3TA 4ZUJA 1J9OA 3DLLA 3KYHC 4LNQA 3I56A 3CCRA 1XNRL 5EKIA 4NXNL 1LV9A 4OELB 1XMOL 3FVQA 1L1OA 3PUWA 2Z6KC 4FO2A 3D4WA 3TZUA 1IHZA 2NB0A 5J1ZA 1KDCA 1N32L 5FJ8H 1O78A 1O7IA 2ZJRA 3UDIA 1DZ1A 1QVGA 3M4PA 4A93B 5KIXA 4CJ0B 3SK5A 5GQOA 4LF6L 1I5FA 1SN8A 4YCUA 4DR2Q 1BCPF 2MUYA 3B6YA 5DM73 2KHJA 5FO9B 2JEBI 3OTOL 1QCBD 2Z4HA 2G9HD 5M3MG 1NCVA 2YU9H 4CDEC 1X3QA 3HOXH 4N8X1 4A3FB 2JA5G 1XMQL 2NYZD 2QW7A 4IUVA 1EQTA 1TS5A 4PQXA 5FLXE 1E2ZA 5BN5A 3CHBD 3NUCA 4OWTB 3A7LA 2CHBD 3CCEA 2QA4A 1GUTA 4HEDA 1CHPD 4P2CB 4J8QA 1I6HH 1SNMA 2C5CA 3RUZA 3S14H 5HURA 5L37A 4KHPL 2X69A 1FNWA 1CQFA 2EXDA 1I50B 3M3YB 2KEEA 3OYYA 4RGOS 1QG7A 1VQOA 3D6CA 2ZJPA 4G7ZC 1Y8PB 4KKUA 4X65L 3FKIB 1Y1VG 3PO3B 3ERQA 3H3VI 2HHHQ 1CFMA 1IBKL 2AWOA 2EYPA 3U4VA 2WFWA 4DR3Q 4BY1B 1DONA 1Y14B 2OQ0A 1B8AA 4C3IB 3A0JA 4UPAA 3CQZB 2UUAL 1JQYD 3KJOA 1C7YA 1A2TA 1PHJA 3KLRA 5M3FB 4DV2L 3UDXA 2Z0SA 1IW7D 1J5EL 4A3DB 4IALA 4KN7C 4TQUS 3CRLC 2ATWA 2E75C 2LXJA 3PO2G 1X56A 2DGYA 4JBMA 1F77A 3D8GA 3SEBA 1VQ6A 1SRUA 1VQKA 3CCUA 5ELOA 3ICEA 3GTPB 2NVTB 2A6EC 2BH2A 4CDDC 2K14A 1WD0A 3KLWA 3RZOB 1NNXA 2EYJA 3KUPA 2LFNA 4NKLA 3D4DA 3MC0B 1E2VA 2AHOB 3L3OC 2HCIA 1KNAA 2KENA 2G9DA 2F0FA 2F3WA 4X64L 1EY8A 1E0BA 2QGQA 4Y7NH 2OQKA 1N36Q 1RTOA 1AFPA 1O7YA 1XTDA 2XN9C 4C3JG 1S4ZA 4JI4L 2K5NA 2ZM6Q 1VQEA 3S15B 1TS3A 1BNZA 4LF9Q 2UXBL 3SE0A 1AE2A 2RF4A 1W2BA 1BUVT 5FKAC 1DD2A 3ND8A 2VB2X 4ZKBB 1TWGH 2B8GA 1PH6A 1NE3A 3GTJB 1ET9A 1Y1WB 4GNXC 2EYHA 1ASZA 1R9TH 3NWTA 1FGBD 2F0EA 1GUGA 4B3ML 2PQAA 4RCOA 4EQOA 3JC66 2YTYA 2OTJA 2I0QA 5GAEC 1O7ZA 2V1CC 4HIOA 3DEPA 4GOPC 5E1FA 1TWAH 1C4QA 1RCVD 4JVZA 5I4DA 3PF5A 2H5XA 2A6HD 4OO1G 1QWYA 3CXCA 2R92G 3CC4A 3NBHA 3F2UA 4K5WA 2MFIA 1ILPA 3OWFA 1X6OA 4CJ2C 4A3GH 1NR4A 1NMFA 4LFBL 2PYKA 4DAVA 4NP5A 1Y1VB 3AU7A 2EJGC 4JOIC 2F0DA 2DUDA 1AZQA 4MZ9A 1HFNA 1PMRA 4JCVE 3MXUA 3S1RH 5DAUA 4YHHQ 2RHQB 1VQLA 3HOZH 4R8NA 3F2DA 2F3VA 5CC4A 3PUXA 1FVIA 3FDTA 1TWFB 5FO8B 2NBFA 3AQQA 3L9AX 5CV7A 5CV6A 3GTKB 1ET6A 1PXUA 4IPGA 1HR0Q 4LF8L 4JI6L 2F0TA 1EYAA 5FLMH 2CW0C 2EY5A 3ERSX 4FP5D 1PH5A 5C3EH 4X66Q 1E3PA 3A8IE 2F0WA 4LF7Q 3UE1A 3MXNB 1STBA 3AYHB 2GA4B 5EPJA 2B63H 1LLRD 4A3JH 3H15A 4LW1A 1P8LA 3CCJA 4LF4Q 1PZID 1O7LA 1HFGA 5IP9H 2K7VA 3DM3A 1JC7A 1EY7A 4P73A 4GNXA 1YVCA 1MSGA 4R4OA 3NXWA 3I2ZA 1YI2A 5CV4A 3HKZB 1LTBD 1HUMA 5BR8Q 5EPLA 1NY4A 3S24A 3EBEA 2J0TD 5C4HA 4ID6A 5CBAE 2EQSA 4BA2I 4JBJA 5IGEA 2YU9B 4DF7A 3HOXB 5G3LF 1LTAD 5C44H 1LT3D 5EBDA 3V2TA 2EY6A 3AB9A 1CA6A 1MHWC 5A35A 4QMGA 3SK4A 4JI0Q 3E9IA 3EIVA 1PTOF 1WCMH 2F0HA 1I6HB 4PMBA 2IW3A 2E2HH 4JOIA 3EFXD 5M5XH 3J7AV 2M2LA 3S14B 1SNOA 2BDNA 4PG3A 5E7NA 1IBML 3KLSX 2WINB 4IZ8A 1E22A 2ASBA 4BXXG 3STBD 3EA6A 1V8QA 3RMHA 2F4IA 5IGFA 4X62Q 1LM0A 2A19A 3HS0C 3MEHA 2DY7A 5C0XG 1CSPA 1KIXA 4JC0A 3D0FA 1QZGA 1I94Q 5CV9A 1HNZQ 3PIP3 3LWEA 1E1TA 2R7FA 2RCNA 1IBLQ 4OONA 4HIDA 4C1NI 3HOUG 1Q8IA 1CKMA 1X32A 1B44D 5TSSA 1GJXA 1FL0A 5ELNA 1VQDA 1GOZA 2ZT9C 3UE0A 1HQMC 2QDLA 3D3RA 4B9XA 1WTHA 1CI3M 1BXTA 2CWAA 4POFA 1UE6A 3K5OA 5IWAL 3T1YQ 1EU3A 4NPSA 4UY8C 3GD7A 2QF7A 1B9NA 4DR7Q 2JK8A 1T5XD 1VDZA 5IP9G 3RLNA 4HMIA 5C3XA 2IPKD 1B53A 2SDFA 2XGTA 1DOMA 1S5FD 5C5LA 3P1HA 4Y7NB 4X3TA 1YITA 2VQFQ 4IJHA 3V05A 4JI5Q 5EAYA 5D65A 2A74C 4GN3B 3HOYG 5C4XG 2R3ZA 1SJED 1UE7A 4B3RL 3TS0A 1STEA 4C3HH 3T1HQ 1TWGB 2SNMA 1UAPA 1A3UA 2KHSA 2WIIB 4JI8L 4ZLTF 1R9TB 4GLAC 5IP7G 3TSSA 1EZ6A 2RSOA 1A63A 1QUQB 2C35B 5C4ZA 1KRTA 4GKJL 2Z6BA 5JJZA 2MO1A 2VB3X 2JA8H 2KECA 4DNRB 1FJGL 1JJ2A 3T56B 3G71A 2O5JC 3A8JE 1VMCA 1TWAB 1J8IA 1HH2P 1D8LA 3DWPA 2PQEA 3MAQA 3K0XA 5I9OA 3F2CA 3DWAA 3VR5A 1VCIA 4BY7H 3DXJC 1MGSA 4L6TB 4ZRZA 3GQBA 5J22A 1LYLA 4A3GB 3A54A 4XXEA 4DN4M 1N36L 3E5SA 1YJNA 2ZM6L 1FNVA 3BYTB 3E6ZX 4LF9L 5C4JH 2AKWB 1Y8OB 5EKKA 2RBMA 5ELDA 4YY3L 4OHJA 3HOZB 2E2DC 3MXPA 2CQAA 1S40A 2L4NA 2K28A 4UP9A 1I4PA 3R2IA 2F03A 4DA2A 2JA6G 1AE3A 4EVOA 3CMAA 5J3BA 4A3EH 1I4GA 1SMYD 2F0GA 1JOQA 5E4WC 1F9PA 2PMZB 4HAEA 5C3EB 1EYDA 1VQBA 5JAVA 1I4HA 4LFCQ 2F0VA 4U673 1D6EC 4JI1Q 5I6WA 4KY5A 2B63B 2Q2IA 2PZWA 4A3JB 2QKIC 3NQTA 2DJGC 1CZGA 2RDHA 4DV1Q 4AQYQ 4C2MH 1T9HA 2VUMG 2SOBA 1K3BC 2NN6H 3K0YA 2F0IA 4J6HA 4KI0A 2EZVA 2VNUD 2ICIA 1VQPA 3MTSA 2K5QA 1GUOA 1GKHA 3GO5A 3NWSA 5I9PA 2AQ1B 2N49A 1IKMA 4C3HG 1BCPC 4K5VA 1EOTA 2JP1A 1SMXA 4HJ8A 4YHHL 4ILWA 1KABA 2HIXA 2EYFA 4F88A 1CUKA 5C44B 2O2LD 5D3IB 4HJ9A 5LL6S 4A93G 1RIPA 1Q3LA 3CKIB 4NMZA 1V1PB 3U9SA 3G4SA 1EIGA 1LUZA 4XTCS 3MVVA 2TMPA 1WCMB 4DV4L 1Q8KA 2E2HB 5M5XB 2JSOA 1TWHH 1L1OC 4IUUA 3GTOH 1A2UA 1EU4A 3KDFB 5A2QE 2JE6I 5HY6A 4N8FA 3ULLA 1STYA 3NBIA 4IPDA 4LJZC 3KJPA 4BBRH 2RKSA 3JAME 1SYFA 2R7ZH 5IT9L 3DUZA 2OT2A 4YWLA 2ID0A 2XWJB 3MXNA 2F0JA 4A3CH 4YIJA 2I07B 3K81C 4KLKA 4A3BH 4RAUC 2ZXRA 4KV6A 4FVMA 3NELA 3RNUA 1WTWA 5IGGA 2BE5C 2L9HA 4FF3A 4A3EG 1X3FA 3PO3G 3CRKC 1YNJD 2R61A 3PUZA 4HCEA 2K04A 3EROA 1GXDC 3J7ZC 2NZOA 3VDYA 4RWSC 2Q2HA 4C3IG 1GUSA 5H1SE 3W1BA 4JI0L 1YNXA 1QOHA 5DLQE 4EGVA 3CMEA 4L8JA 5M3FG 3DWQA 4OL7A 2DN8A 2UUCQ 4A3DG 1WYDA 1W6JA 1RTNA 1WI5A 1YNND 3FPPA 3H0GH 2GN5A 1ESFA 4MTNA 4ZCKA 1J6QA 1HPCA 3N6RA 3KF6B 1Y8NB 2VUMB 2PZUA 2IX3A 2O4XA 2P5ZX 1G291 2JYOA 3F8TA 4QGUA 2FMMA 4BBSH 1HNZL 2A8VA 1HNWQ 2CFMA 3R3OA 4EX5A 4DV7Q 2ZXPA 2PW7A 4MN3A 2VW9A 3PV0A 1M90C 1TR5A 4OWWB 4C3HB 2NN6I 1D5MC 2PW5A 3PSIA 4CKCA 2CKZB 1HZ9A 1ZEQX 4KJNA 1H95A 4CBVA 5I2YA 2QILA 3E3XA 3RZDH 4DR5L 4NW2A 2A68D 4IFDH 3R8BA 1RD9D 3J80c 5E4XA 1LABA 4FXDA 1V1OA 2JA8B 1L0XB 1STHA 4IFDJ 3L2PA 1I4QA 3SDZA 2JN4A 1EEID 1TS2A 4RCNA 3KF8B 1VQ7A 4DR7L 1VQAA 1DXMA 1Y1WG 2RQXA 4G7OC 2Z9HA 1E1OA 2IHFA 4BY7B 1A3VA 4DV6Q 1N9WA 2VQFL 2NZHA 4JI5L 4WJ4A 2D2CC 5EKLA 4DUZQ 2D62A 4A3MH 5C4JB 1S5ED 1SEBD 2IHEA 4RGMA 5JEAH 1OXTA 3VYRA 1TY2A 1B70B 3A7AB 5LMNL 2GVAA 2JA7H 3T1HL 2IY5B 4A3LH 5JEAJ 4EQ5A 1XX8A 3BVZA 2EY2A 1NUCA 4MNOA 1GM5A 1BKBA 4IUPA 1HTLD 1WTOA 4A3EB 2SNSA 2PPBC 4QQBX 1OXVA 2A5HA 3BJUA 5CBEE 1HRJA 1F2LA 1SE2A 3IAYA 3CW2C 1XNQQ 4DXFA 1SYGA 3TS2A 3GTMH 4DR4Q 1ZXTA 4O42A 2HDLA 4IPHA 3K7AH 4R4TA 4C2MB 4AIMA 2FXQA 3BS1A 1QUQA 3HKSA 3BG3A 2YV5A 4IURA 3OW2A 2EDGA 3K5NA 1K73C 1VQ5A 4R1JA 2J7ZA 1WJJA 3A5ZB 1EYGA 4DV0Q 4RHSA 3CPFA 4XQNA 4FF2A 4YWKA 3K6OA 1LACA 2VQEQ 3CU7A 1YHBA 3FP9A 3VYTA 1JWSD 5FJ8G 4XIGS 2FINB 3TMEA 2E2JH 1FD7D 1TY0A 3K59A 2KVMA 3BDCA 4HJ5A 1RF2D 1OXUA 3HKZG 5JJKA 5EGTA 2IL8A 2DJFC 1N8RC 4R4QA 3FMCA 2K1BA 4TRDA 1PTOC 4O1NA 3TBIB 4DV5L 4JI3Q 4TKOB 3J80L 4JI7Q 1TWHB 2EJMA 4JI1L 3GTOB 2UXDQ 3HOXG 1WOCA 4CKEA 3TP5A 3VR4A 2GVBA 2Z1CA 3KLSA 1G91A 4IFDI 4BBRB 1CKNB 1M4VA 2L11A 3RLFA 2R7ZB 1MKHA 1CK1A 1BBUA 4CJ1B 1FNUA 1LT4D 3G48A 1RKNA 1V1QA 1Q86C 2JA7G 4A3BB 4B3SQ 1NMGA 2O5IC 2LXKA 1PA6A 1F9SA 4LF5Q 1NSNS 2EJFC 3K80C 1F2MA 1K83H 3S16H 2K4KA 1CTMA 2L5TA 1CHQD 3IFDA 3S9WA 4LFAL 1PRTD 3QO2A 2OWOA 3I4LA 1ESRA 3CPWA 3FEWX 4RA8A 1EQRA 2A69C 1S5DD 1GD7A 3IFTA 3H6MA 2EYOA 1D5ZC 1PRTB 4Q5VA 1X65A 4OX9L 4UHVA 3W2DA 1MBYA 2B2VC 5ISRA 2B39A 2BA0A 2E8GA 4EQNA 1K8GA 3I4NH 1N34Q 2ALYB 2M9VA 4X6AH 1ASYA 3J80i 3ZYYX 1V1PA 4UAIA 3H0GB 3VR3A 4FXKC 3H94A 5NUCA 4PZ7A 5KYIA 2B2TC 1TWCH 4DAYB 1WTXA 3LGJA 4BBSB 3X3NA 4Q0FA 3RN5A 2XNAC 1A0IA 3E9HA 4U68A 1HZBA 4HSPA 3PIOA 4S3SA 5IGBA 1NAPA 1SYBA 1OXXK 3MEFA 1EY9A 5LMNW 4P74A 3D6WA 3RLOA 2I5LX 3TRZA 1EY4A 2WACA 2YTXA 2L1BA 2F0SA 1A62A 1B7YB 4GKKL 3RZDB 2NZ1D 1G51A 2K05A 4JI2Q 3BU2A 3H09A 3IL8A 1VQ4A 3HKZE 3P20A 1UEBA 4OIJA 1HCZA 3S17H 2DNCA 3PF4A 4KJOA 3NSWA 4ALPA 5KYLA 2EOTA 3K8AA 1VQHA 1LTSD 5ELEA 1XXGA 3NENA 3NEMA 3ULPA 5IYDH 4DR6Q 2HIVA 2CWPA 3I7FA 2E5LQ 1Z7TA 2VZAA 4MTKA 2UU9L 3J81i 5LMUQ 1Q46A 5JJIA 1TT2A 4A3MB 1HNWL 2X6LA 1CM9A 2B29A 1SYEA 3KFUA 5T1IA 2FJ2A 3OIPA 3M4YA 1C8CA 3A5UA 1M8AA 4L5TA 2MPMA 3VR6A 1ILQA 2JA7B 1VQGA 2Z8LA 5COYA 2LY7A 3RR5A 1KAWA 3KF6A 2B2VA 4NB3A 1Z6HA 1EIHA 1JR0D 1UE5A 4IO9A 2CQOA 3WDNA 4A3GG 1L0YB 1G2SA 2EPBA 5KRUA 2L15A 4AYBB 2F0NA 2VL6A 4K8JA 1A6XA 4DGZA 5JVG3 2B2YA 2B2TA 2UXCQ 2OEOA 1DOKA 4NXMQ 4OEMB 3GTLH 3HOZG 4KHZA 4DR2L 4CHTB 3I4NG 3GTMB 4K8IA 4KY7A 1ZKOA 5AJ3Q 2ZTCA 3I4MH 3K7AB 1VQMA 2PNHA 4H7BA 1IW7C 5KNCA 4DAPA 4JBKA 5FLMG 3OPOA 5EJWA 1PV4A 4DV6L 5C3EG 1C0AA 3SGIA 1HNXQ 1AW7A 1STAA 3TDQA 4UP7A 1X55A 3T13A 1Y69U 3KF8A 2RDFA 1XNRQ 2B63G 1CQVA 4A3JG 1YIJA 1EQQA 2RA4A 4NDXA 4L63B 1ENCA 3NP8A 1WFQA 5CORA 3C46A 3W3AA 4E6IA 2E2JB 4ODGA 1U4MA 1N32Q 2Q2TA 1UWVA 1X3PA 2F0UA 2XVSA 4J15A 5IIFA 2ZJQA 1F9QA 1LTRD 3KBGA 4HIMA 2HHHL 1A8VA 3NQIA 2XIWA 3KOJA 4LMQD 5CV5A 1VS0A 1HXYD 4LF6Q 1Q90A 4DR3L 2DY8A 3OTOQ 1SYCA 4P71A 2KCTA 1ZYRD 3S1NH 2QEJC 1ML0D 5C44G 4POGA 4F7XA 5KNBA 3AFQA 2ZXOA 3BZKA 3LWUA 4J1MA 1XMQQ 5JPNC 1EFWA 1WTQA 3H3VC 1TU2B 1AZPA 3VYUA 3OMCA 2L55A 4CDCC 1WCMG 3Q22A 4DV0L 5I6YA 1B1ZA 1FYCA 3W5OA 2HT1A 3MXGA 3HEJA 2VQEL 4QL5A 3A56A 2K01A 1D1KA 1K83B 3S16B 2Y0SG 4A3IH 4H44C 4PV1C 5ELFA 2I5MX 3C1EA 1PFNA 2A6HC 5IT9c 1KHIA 4X65Q 4A3KH 3A74A 2F0LA 3HOWH 1WTRA 1EWHA 2MGSA 1IBKQ 5KGUA 3MFYA 2XRSD 1FR3A 1MD2D 1I6VC 1Q1EA 1D7QA 4HR7B 1PFSA 3I4MG 1DYQA 1L0WA 3S1RB 4GN4B 4QY7A 3I4NB 1S5BD 2D9UA 3CC2A 4GLXA 1MSHA 4TVAB 4FNFA 4KD3A 2YTVA 5IYBH 1TS4A 2KHIA 5DM63 3HOVH 1TKWB 1TWCB 1VF5C 4GZYC 5JVH3 5K36H 2PMZE 4KY6A 3GTGH 1IL8A 4WJ3M 3PQIA 1JT8A 3ITPA 4Z9CB 1KTKA 3J7YW 1BOSA 1R4QB 5KEEA 1NR2A 1CKNA 2D0OA 3CCLA 1QZHA 1PYBA 2KUMA 4WJWA 3CC7A 1HUNA 3NTIA 4WFN3 1V43A 3E0JA 3R93A 2AMCB 1KC8C 1YBYA 3T51B 1BF4A 4UDUC 3U50C 4K5XA 4R9WA 1K3RA 4ZUIA 1HJPA 4F8MA 2UXBQ 2YYZA 1C9OA 2MJ8A 3S17B 3CQZH 5M5WH 1CZWA 2XRQD 5E3FA 4HCSA 5GADC 3I91A 1UE1A 1IZ6A 2R7DA 2R93H 1X54A 1YEZA 3GV3A 5IYCH 3BDOA 4DAMA 3O13A 3KBXA 1PZKD 2AUJD 1B50A 1VF7A 1B3QA 1EFID 2AWNA 1PFMA 1HR0L 4B3MQ 2A6ED 4B3TQ 2JA8G 3C2PA 1E2WA 4HMJA 4X66L 3I8ZA 1E24A 4LF7L 1R4PB 2WB1G 4PMWA 2SEBD 4R8IA 4BY7G 5EBCA 1PVOA 3HOWG 3FPUB 4LF4L 4DAYA 3GV6A 2Y0SB 4C56C 2Y0SE 1YJ9A 1H9SB 1UNSA 3OW7A 1S5CD 1VQIA 2RVLA 3STBC 5D14A 1Q7YC 2R6GA 2ES2A 4AH6A 3A55A 1JJCB 5KNDA 1OO9B 4L5SA 2OTLA 2Q8RE 5DEHA 2WAQG 4HJ7A 5LHY1 4X3KA 5D3DA 1DJRD 3GTLB 1H9MA 5BR8L 1GHJA 5FOBB 3ND9A 1YZ6A 1S72A 4DNTB 3SK8A 2JA9A 4LAAA 1JMCA 1MJCA 1F2ZA 2F4VQ 3D31A 2KCNA 5CV8A 3I4MB 3KK7A 3HG9A 2NVXH 5IY0A 3HOVG 4QJFA 3JAMi 3GTJH 2ICEC 5M3MH 3M7NA 1PRTF 4JI6Q 4LF8Q 2LKVA 2JA5H 5K36G 4O0AA 5LMUL 1YHQA 5I2XA 3S1QH 1HHVA 3MFGA 3OHXC 4CDFC 4BA1I 1SFOH 5BN4A 3L0OA 2CCZA 1ONLA 4V190 4BS9A 2B3GA 1EWCA 1JB7A 2RSNA 2NN6G 2IWHA 1EQVA 4XT3B 1EIYB 3S2HH 4APVA 3QOJA 4H0LC 4GOPB 1LTID 1LTGD 2VS1A 1G8ZD 3K57A 4X62L 2EVBA 4JW0A 2HDMA 4RH6A 3SR1A 2KCMA 5IGCA 1NTGA 3SVMA 2UXCL 5C6AA 1EZ8A 1I94L 5IYCG 1SJHD 1VQ8A 5IT9E 1IYVA 1Q81C 4DUYQ 2JEAI 5CMDA 1IBLL 3I72A 1SAPA 3S1NB 2HD3A 4ME5A 3Q0AA 4FXGC 4M1UB 1XTCD 2CW0D 4QB4A 1PH2A 2Q8IB 1SE4A 3K58A 1ICFB 1X3GA 1V9PA 1B3AA 4R4IA 3I73A 3PO2H 3U9OA 2B2UA 2K5DA 4RMFA 1EUJA 4IPCA 1WTVA 3PUVA 2OCEA 3TP8A 3T1YL 2K6AA 1BBWA 4LK1C 2J4XA 4DU9A 1IBMQ 4A3IB 4BBRG 2WB1B 2WB1E 1PYWD 2R7ZG 4DR1Q 4A3KB 4N9PA 3HOWB 1CT1D 3CCVA 1I4RA 4A3CG 3S2DH 1JOOA 1STGA 4K2LA 4ZYSA 5EPKA 1M1KC 4A3BG 5FO7B 1HQRD 4C3JH 3ZJYC 4OGQC 2K5HA 3TREA 3M9BA 1STNA 2WAQB 2WAQE 4XDXA 1K0SA 4RFBA 2FFKB 2XTIA 1UEAB 1U9RA 4PNYA 3QB3A 1U4RA 2EE1A 1KDAA 3PGZA 3HOVB 2NUCA 3HZXA 3MZ5A 1KRSA 4DKAC 3AEVA 3BYYB 2PO4A 3PUYA 1JB3A 2MHVA 1HR0W 1D1IA 1SMYC 2NVYH 1K8AC 2HQEA 5IWAQ 3U58A 3K5LA 3GTGB 2F52A 2WKCA 3SK6A 2H4OA 2ENBA 1JICA 4JV5Q 3F2BA 2KCCA 2JJQA 3H0GG 4IUTA 1BQQT 1T5EA 1N33Q 3J81c 2RDGA 3FHWA 4LUOA 3MA2B 4OO1H 3K5MA 1EY5A 2HCCA 3URYA 2ZTEA 2R92H 1O80A 4BBSG 1MIUA 1Q12A 2N55A 5FK9C 4B08A 2DNEA 3A8KE 3OSOA 2K5WA 1SSOA 1QE6A 2I5HA 4G7HC 2MQHA 4JK1C 5C3WA 5M5WB 4B3RQ 2KA7A 3C3LA 4OXPA 2R93B 2QEXA 3J7AF 1I3QH 1TQOA 2HUGA 5EQ0A 3IRBA 2K50A 2PNRC 1UUPA 2Z6KA 4JI8Q 1BR9A 1SDFA 4IFDG 4DV3Q 4DK3C 1HA5A 5K5PA 2UUBQ 5M5YH 2AUKA 4GKJQ 1U4PA 3NHHA 2XWBB 4LFCL 1FJGQ 1C48A 4LWCA 1SROA 3QWNA 4IJLA 3AFPA 1VQFA 5M9OA 1SR3A 3T53B 4M8AA 3BVGA 4PZ6A 1JE5A 2EXZA 5IE8A 4RG1A 2G5DA 3F1ZA 4AQYL 4DV1L 3Q8DA 5F2DA 4WRDA 4C1NK 4I7AA 1ICWA 4JYAQ 1IXRA 3NE5B 1LT6D 1TIID 3I70A 4A3MG 4K0KQ 1SYDA 2C9OA 4XQJA 4JG2A 5JEAG 1Z47A 4EQPA 5ELBA 4GN5A 1KL9A 4YY3Q 3P75A 4A3LG 1QVCA 2F3IA 3V96A 4IOAA 2N3SA 1QNKA 2NVXB 1G6PA 1IL2A 2CH4W 1JWUD 5M3MB 4AYBG 3OIQA 4IUQA 1G6ZA 4P75A 1JJGA 3VR2A 3I3CA 4P72A 2JA5B 3M7GA 2N88A 5C5MA 4KK7A 3H91A 1SNQA 1YNJC 2F0OA 4B3TL 3S1MH 1K8OA 1W6KA 3AMUA 3S1QB 1QB5D 2E74C 4QCLA 1SFOB 3OWEB 3CAMA 1AN8A 1H9RA 2FHTA 2Z4IA 1GHKA 3TEHB 2OF1A 2PCFB 3S2HB 3MHBA 1K28A 1K0RA 3J80E 4BXXH 3WOEA 3J81L 1TXYA 3QG1A 1VQNA 1YNNC 3HRZC 1II3A 4RKLA 1HTPA 2B2YC 1F2YA 4KMUC 2N78A 5C0XH 3LX0A 3T16A 4RHRA 1KD1C 4YWMA 5C0XJ 3MWYW 3KDFA 1W3SA 1NBWA 5CGKA 5AFWA 2F4VL 4FYDA 4OO1I 3ULJA 3M4QA 1H9SA 1H9JA 1YHAA 4OIKA 2Q8TA 1QNUA 2WKDA 3SXHA 4I7ZC 2D5DA 1SXTA 3EJIA 4MHEA 3T4AC 3HOUH 4KN4C 3CCSA 1IYUA 3EQLC 2QCPX 1XPUA 4RGTA 3PO2B 4ZAIA 3OOCA 2KBNA 4KKSA 5IODA 5CYUA 4DV4Q 3PIPA 2PI2E 4G4KA 2A68C 3VYSA 4ZK9B 2UUCL 3Q24A 3N52A 4XYOA 3GTQH 1BDOA 1XJVA 5DNFA 1AEXA 1ENFA 3S2DB 1BCPD 1SNDA 4N9TA 3RD4A 2KEDA 1IKLA 4C3JB 1Q1BA 3J81E 4K6LA 2WP8J 2AQ3B 4DV7L 2LSSA 2MP1A 3HOYH 4DUYL 5C4XH 4GOPA 3EN2A 3TP6A 4R4CA 3W1GA 5IOCA 4QF4A 1BCPB 5JOBA 1BVSA 4QIWB 4QIWE 1QVFA 4ME3A 2F0KA 2K52A 3OMGA 4AYBE 1EIFA 2F0MA 1QILA 2KOLA 2E2IH 1VQCA 5IP7H 4JBWA 5LL6X 2NVYB 2EYMA 3EVQA 1G2TA 3I4OA 3U4ZA 3PIO3 1RDPD 1DOLA 2A1AA 2B2WC 4DFAA 2A73B 3G6EA 1EY6A 4L5RC 4DPGA 1PTOH 2IT1A 1SE8A 3M4OH 1RJTA 1LTLA 4DR1L 1L1OB 2V4DA 2ZTDA 2EYLA 2R92B 3WWVA 1MJEA 1PH4A 4DUZL 4NXNQ 2BE5D 2EIFA 1XMOQ 2L0CA 3X3MA 1I3QB 3DEOA 4DK0A 3NK9A 1K8MA 2BOSA 3DM1A 1U0LA 2IX0A 5C0XI 1GVPA 2TSSA 2L12A 4PMCA 4DR5Q 4H02A 4DNIA 2JA6H 5M5YB 3HP3A 3GP7A 3CCMA 3JAMc 1XNQL 1PDQA 1CA5A 1PFBA 4JV5L 4DR4L 5IYDG 3CF5A 1LT5D 4GLVB 2CH4A 2E76C 1N33L 2NVQH 1JORA 2B8FA 1MI2A 2KJXA 3CP0A 4QUCA 1OXSC 1LTTD 5GROA 4ULLA 3CCQA 4OWXB 3WOFA 2HQLA 5HGTA 2VUMH 2VY3A 3I55A 2BA1A 5J39A 4HJAA 3UDFA 1BBXC 3UI2A 4QUFA 2NTTA 3NPPA 1Q82C 4IQZA 3K7UC 5LMNQ 4IOCA 4HSVA 4KHPQ 1I4XA 1OTCA 2B2WA 4K6DA 1PH3A 2K75A 1SE3A 2RCFA 4G57A 4DXGA 3HFZB 3HGBA 3FRPB 1B9MA 2BCOA 2RHSB 1PRTC 4A4IA 1TVXA 1EOVA 4DV3L 3J81j 2UUBL 4A93H 4KD4A 3S1MB 4HN7A 3J7A5 5T1GA 1PLFA 1ENAA 1B4OA 4F87A 4ZQ3A 4JI3L 2UUAQ 3D4RA 1D2BA 2WV6D 1IYJB 4JI7L 2K33A 4DV2Q 1J5EQ 2UXDL 2JQOA 4YCVA 1AH9A 4H13C 4A3FH 1Z9FA 4BWGB 1WD1A 4B9WA 4UP8A 5CR3A 4JYAL 4XQQA 1P16A 3BZDB 2IJ0A 4K0KL 1D5XC 1PZJD 1S3OA 4LUVA 2N8NA 1SLJA 3NTKA 3E0EA 3TQYA 3QOLA 4L5QA 1RODA 2K32A 4JPBW 3RN2A 1KNEA 3I90A 4DK6C 4B3SL 2LMCB 4A75A 4LF5L 3PMFA 1U5KA 1VMPA 1I50H 3M3YH 5BN3A 2XSCA 1U4LA 2JXMB 1KAAA 1EYCA 3G6JB 3QR8A 4HTHA 2VXWA 3HOUB 1JCKB 1L2FA 3VA7A 1SBBB 4X64Q 3FKIH 1HZAA 3PO3H 3TN2A 1CKOA 2F0QA 3IKJA 3Q6SA 1HA6A 3QJYA 1PH7A 2QDBA 4JI4Q 3GDEA 4BY1H 5A2QL 4DV5Q 1GO3E 1F9RA 4C3IH 5FLXc 2PQAB 4KKTA 1A15A 3ONAB 1JWMD 3JAML 4IN3A 5GAHC 2MNAA 5M3FH 3DMUA 3GTQB 4A3DH 1VQ9A 1BO0A 1PH9A 2H1EA 3DHQA 1X9NA 2BDOA 3BDLA 1EEFD 3NTHA 5GAGC 1N34L 2EY1A 4RGNA 3G7LA
chains in the Genus database with same CATH topology
2AQ2B 3TP7A 3VA5A 4V0BA 3HOYB 5G3LD 5C4XB 3LNNA 4X3UA 2CVRA 3SHLA 4MIUA 4IUNA 4DK1A 2KQ3A 1EL0A 2F0PA 3L7ZC 4ZKCB 1XYIA 2IX1A 2X6GA 2NWGA 1PTOD 2I46A 2B2UC 4CGYB 4RKBA 2E2IB 1DM0B 1B2TA 1WTPA 4K14A 3R2TA 3M85A 3Q23A 4XT1B 2F1MA 2FMCA 2PZTA 5IGDA 4FF4A 1PTOB 4TSSA 1H9KA 1WVLA 4X3SA 3M4OB 4I65A 4CKBA 3P7JA 1DCZA 2K03A 3C1FA 1LO5D 3BVMA 4XYQA 2NTSA 3QIAA 5ELCA 1JOKA 1QJOA 2A69D 1XWEA 5JPMC 1GUNA 2M00A 4ABNA 2JA6B 1KLGD 1RHPA 1SNPA 2LS01 4WORA 4FF1A 1JE4A 5FLXL 1KDBA 1SNCA 3TZDA 2NVQB 1KLUD 1EY0A 2OXPA 1ZYRC 4KHVA 1GUWA 4K2KA 4KTAA 1AP0A 1A3TA 4ZUJA 1J9OA 5EKIA 1LV9A 3FVQA 3PUWA 4FO2A 3D4WA 3TZUA 1IHZA 2NB0A 5J1ZA 1KDCA 1O78A 1DZ1A 4A93B 5KIXA 4CJ0B 3SK5A 1BCPF 2MUYA 5DM73 5FO9B 2JEBI 1QCBD 2Z4HA 2G9HD 1NCVA 1X3QA 4A3FB 2NYZD 4IUVA 1EQTA 1TS5A 4PQXA 5FLXE 1E2ZA 5BN5A 3CHBD 3NUCA 3A7LA 2CHBD 1GUTA 4HEDA 1CHPD 4P2CB 4J8QA 1SNMA 2C5CA 3RUZA 5HURA 2X69A 1FNWA 1CQFA 1I50B 3M3YB 2KEEA 4RGOS 1QG7A 3D6CA 4G7ZC 1Y8PB 4KKUA 3FKIB 3PO3B 3ERQA 1CFMA 2AWOA 2EYPA 4BY1B 1DONA 4C3IB 3CQZB 1JQYD 1A2TA 3KLRA 5M3FB 1IW7D 4A3DB 4IALA 4KN7C 4TQUS 3CRLC 2E75C 1F77A 3D8GA 3SEBA 3GTPB 2NVTB 2A6EC 1WD0A 3RZOB 2EYJA 3KUPA 2LFNA 4NKLA 3D4DA 3MC0B 1E2VA 3L3OC 2HCIA 1KNAA 2G9DA 2F0FA 2F3WA 1EY8A 1E0BA 1RTOA 1AFPA 1O7YA 2XN9C 4C3JG 1S4ZA 3S15B 1TS3A 1BNZA 3SE0A 1BUVT 5FKAC 1DD2A 3ND8A 2VB2X 4ZKBB 2B8GA 3GTJB 1ET9A 1Y1WB 2EYHA 3NWTA 1FGBD 2F0EA 1GUGA 4RCOA 4EQOA 1O7ZA 3DEPA 5E1FA 1C4QA 1RCVD 5I4DA 2A6HD 4OO1G 1QWYA 3NBHA 3F2UA 4K5WA 1ILPA 3OWFA 4CJ2C 1NR4A 2PYKA 4DAVA 4NP5A 1Y1VB 3AU7A 2EJGC 2F0DA 1AZQA 1HFNA 1PMRA 3MXUA 5DAUA 4R8NA 2F3VA 5CC4A 3PUXA 3FDTA 1TWFB 5FO8B 2NBFA 3L9AX 5CV7A 5CV6A 3GTKB 1ET6A 1PXUA 2F0TA 1EYAA 2CW0C 2EY5A 4FP5D 3A8IE 2F0WA 1STBA 2GA4B 5EPJA 1LLRD 1PZID 1O7LA 1HFGA 2K7VA 1JC7A 1EY7A 1MSGA 3NXWA 5CV4A 3HKZB 1LTBD 1HUMA 5EPLA 2J0TD 5C4HA 4ID6A 5CBAE 4BA2I 5IGEA 2YU9B 4DF7A 3HOXB 5G3LF 1LTAD 1LT3D 5EBDA 3V2TA 2EY6A 3AB9A 1CA6A 5A35A 4QMGA 3SK4A 1PTOF 2F0HA 1I6HB 4PMBA 2IW3A 3EFXD 3J7AV 2M2LA 3S14B 1SNOA 2BDNA 3KLSX 2WINB 4IZ8A 3EA6A 1V8QA 3RMHA 2F4IA 5IGFA 3HS0C 3MEHA 2DY7A 5C0XG 5CV9A 3PIP3 3LWEA 4C1NI 1Q8IA 1X32A 1B44D 5TSSA 1GJXA 2ZT9C 1GOZA 1HQMC 3D3RA 4B9XA 1CI3M 1BXTA 3K5OA 1EU3A 3GD7A 2QF7A 1B9NA 1T5XD 1VDZA 4HMIA 5C3XA 2IPKD 1B53A 2SDFA 1DOMA 1S5FD 5C5LA 3P1HA 4Y7NB 4X3TA 3V05A 5D65A 2A74C 2R3ZA 1SJED 1STEA 1TWGB 2SNMA 1UAPA 1A3UA 2KHSA 2WIIB 4ZLTF 1R9TB 3TSSA 1EZ6A 2RSOA 5C4ZA 5JJZA 2VB3X 2KECA 4DNRB 3T56B 2O5JC 3A8JE 1VMCA 1TWAB 1J8IA 3DWPA 2PQEA 3MAQA 5I9OA 3DWAA 3VR5A 1VCIA 3DXJC 1MGSA 4L6TB 4ZRZA 3GQBA 5J22A 4A3GB 3A54A 4XXEA 4DN4M 3E5SA 1FNVA 3BYTB 3E6ZX 1Y8OB 5EKKA 2RBMA 5ELDA 4OHJA 3HOZB 2E2DC 3MXPA 2CQAA 2L4NA 2K28A 1I4PA 3R2IA 2F03A 4DA2A 4EVOA 1I4GA 1SMYD 2F0GA 1JOQA 5E4WC 1F9PA 2PMZB 4HAEA 5C3EB 1EYDA 5JAVA 1I4HA 2F0VA 4U673 1D6EC 5I6WA 2B63B 4KY5A 2PZWA 4A3JB 2QKIC 3NQTA 1CZGA 2RDHA 2SOBA 2NN6H 3K0YA 2F0IA 4J6HA 4KI0A 2EZVA 2VNUD 2ICIA 3MTSA 2K5QA 1GUOA 3GO5A 3NWSA 5I9PA 2AQ1B 1IKMA 4C3HG 1BCPC 4K5VA 1EOTA 2JP1A 4ILWA 1KABA 2EYFA 4F88A 5C44B 2O2LD 5D3IB 5LL6S 1Q3LA 3CKIB 4NMZA 1V1PB 3U9SA 1EIGA 4XTCS 3MVVA 2TMPA 1WCMB 2E2HB 5M5XB 2JSOA 4IUUA 1A2UA 1EU4A 5A2QE 2JE6I 1STYA 3NBIA 4LJZC 2RKSA 3JAME 1SYFA 5IT9L 3DUZA 2OT2A 2ID0A 2XWJB 3MXNA 2F0JA 4YIJA 2I07B 4RAUC 2ZXRA 4KV6A 4FVMA 1WTWA 5IGGA 2BE5C 2L9HA 4FF3A 3CRKC 1YNJD 2R61A 3PUZA 4HCEA 2K04A 3EROA 1GXDC 4RWSC 4C3IG 1GUSA 1QOHA 4EGVA 4L8JA 3DWQA 4OL7A 2DN8A 1W6JA 1RTNA 1YNND 3FPPA 1ESFA 1HPCA 3N6RA 1Y8NB 2VUMB 2PZUA 2IX3A 2O4XA 1G291 2JYOA 2FMMA 3R3OA 2ZXPA 2PW7A 4MN3A 3PV0A 1TR5A 4C3HB 2NN6I 1D5MC 2PW5A 4CKCA 1ZEQX 4KJNA 4CBVA 5I2YA 2QILA 4NW2A 2A68D 4IFDH 3R8BA 1RD9D 5E4XA 1LABA 4FXDA 1V1OA 2JA8B 1L0XB 1STHA 4IFDJ 1I4QA 3SDZA 1EEID 1TS2A 4RCNA 1DXMA 2RQXA 4G7OC 4BY7B 1A3VA 2D2CC 5EKLA 2D62A 5C4JB 1S5ED 1SEBD 4RGMA 5JEAH 1OXTA 3VYRA 1TY2A 3A7AB 5JEAJ 1XX8A 3BVZA 2EY2A 1NUCA 4IUPA 1HTLD 1WTOA 4A3EB 2SNSA 2PPBC 1OXVA 2A5HA 5CBEE 1HRJA 1F2LA 1SE2A 3IAYA 4DXFA 1SYGA 1ZXTA 4O42A 2HDLA 4C2MB 3BS1A 3BG3A 4IURA 2EDGA 3K5NA 2J7ZA 4RHSA 4XQNA 4FF2A 3K6OA 1LACA 3CU7A 3VYTA 1JWSD 4XIGS 2FINB 3TMEA 1FD7D 1TY0A 3K59A 2KVMA 3BDCA 1RF2D 1OXUA 5EGTA 2IL8A 3FMCA 2K1BA 4TRDA 1PTOC 4O1NA 3TBIB 4TKOB 3J80L 1TWHB 2EJMA 3GTOB 4CKEA 3TP5A 3VR4A 2Z1CA 3KLSA 1G91A 4IFDI 4BBRB 1M4VA 2L11A 3RLFA 2R7ZB 1CK1A 4CJ1B 1FNUA 1LT4D 1RKNA 4A3BB 2O5IC 1F9SA 1NSNS 2EJFC 1F2MA 1CTMA 2L5TA 1CHQD 3IFDA 3S9WA 1PRTD 3QO2A 3I4LA 1ESRA 3FEWX 4RA8A 2A69C 1S5DD 3IFTA 3H6MA 2EYOA 1D5ZC 1PRTB 4Q5VA 3W2DA 1MBYA 2B2VC 5ISRA 2B39A 2BA0A 4EQNA 2M9VA 3ZYYX 1V1PA 4UAIA 3H0GB 3VR3A 4FXKC 3H94A 5NUCA 5KYIA 2B2TC 1WTXA 4BBSB 3X3NA 4Q0FA 2XNAC 4U68A 4HSPA 4S3SA 5IGBA 1NAPA 1SYBA 1OXXK 1EY9A 3D6WA 1EY4A 2WACA 2L1BA 2F0SA 3RZDB 2NZ1D 2K05A 3H09A 3IL8A 3P20A 4OIJA 1HCZA 2DNCA 4KJOA 3NSWA 5KYLA 2EOTA 1LTSD 5ELEA 1XXGA 1Z7TA 1TT2A 4A3MB 2X6LA 1CM9A 1SYEA 5T1IA 2FJ2A 3OIPA 3M4YA 1C8CA 1M8AA 2MPMA 3VR6A 1ILQA 2JA7B 2Z8LA 5COYA 2LY7A 2B2VA 1Z6HA 1EIHA 1JR0D 3WDNA 1L0YB 1G2SA 2EPBA 5KRUA 4AYBB 2F0NA 1A6XA 4K8JA 4DGZA 5JVG3 2B2YA 2B2TA 2OEOA 1DOKA 4KHZA 4CHTB 3GTMB 4K8IA 4KY7A 1ZKOA 3K7AB 4H7BA 1IW7C 5KNCA 4DAPA 3OPOA 5EJWA 1AW7A 1STAA 3TDQA 3T13A 1Y69U 3KF8A 2RDFA 1CQVA 2RA4A 4NDXA 4L63B 1ENCA 3NP8A 5CORA 3C46A 3W3AA 4E6IA 2E2JB 4ODGA 1U4MA 1X3PA 2F0UA 2XVSA 5IIFA 1F9QA 1LTRD 3KBGA 3NQIA 2XIWA 4LMQD 5CV5A 1HXYD 1Q90A 2DY8A 1SYCA 1ZYRD 2QEJC 1ML0D 4F7XA 5KNBA 2ZXOA 3LWUA 4J1MA 5JPNC 1WTQA 3H3VC 1TU2B 1AZPA 3VYUA 3OMCA 2L55A 3Q22A 5I6YA 1B1ZA 1FYCA 3MXGA 3HEJA 3A56A 2K01A 1D1KA 1K83B 3S16B 4H44C 4PV1C 5ELFA 3C1EA 1PFNA 2A6HC 2F0LA 1WTRA 1EWHA 2MGSA 5KGUA 3MFYA 2XRSD 1FR3A 1MD2D 1I6VC 1Q1EA 4HR7B 1DYQA 3S1RB 3I4NB 1S5BD 2D9UA 1MSHA 4FNFA 4KD3A 1TS4A 5DM63 1TKWB 1TWCB 1VF5C 4GZYC 5JVH3 5K36H 4KY6A 1IL8A 3ITPA 4Z9CB 1KTKA 3J7YW 1BOSA 1R4QB 5KEEA 1NR2A 2KUMA 4WJWA 1HUNA 3NTIA 4WFN3 1V43A 3E0JA 3R93A 3T51B 1BF4A 4UDUC 4K5XA 4R9WA 4ZUIA 4F8MA 2YYZA 2MJ8A 3S17B 1CZWA 2XRQD 5E3FA 4HCSA 3I91A 3GV3A 3BDOA 3O13A 3KBXA 1PZKD 2AUJD 1B50A 1VF7A 1EFID 2AWNA 1PFMA 2A6ED 3C2PA 1E2WA 4HMJA 3I8ZA 1R4PB 4PMWA 2SEBD 4R8IA 5EBCA 3FPUB 4DAYA 3GV6A 2Y0SB 4C56C 1H9SB 1UNSA 3OW7A 1S5CD 2RVLA 5D14A 2R6GA 3A55A 5KNDA 1OO9B 2Q8RE 5DEHA 5LHY1 4X3KA 5D3DA 1DJRD 3GTLB 1H9MA 1GHJA 5FOBB 3ND9A 4DNTB 3SK8A 4LAAA 1F2ZA 3D31A 2KCNA 5CV8A 3I4MB 3KK7A 3HG9A 2ICEC 3M7NA 1PRTF 2LKVA 5K36G 5I2XA 1HHVA 3MFGA 3OHXC 4BA1I 5BN4A 1ONLA 4V190 4BS9A 1EWCA 2RSNA 2NN6G 2IWHA 1EQVA 4XT3B 3QOJA 4H0LC 1LTID 1LTGD 1G8ZD 3K57A 2EVBA 2HDMA 4RH6A 3SR1A 5IGCA 3SVMA 5C6AA 1EZ8A 1SJHD 5IT9E 1IYVA 2JEAI 5CMDA 3I72A 1SAPA 3S1NB 4ME5A 3Q0AA 4FXGC 4M1UB 1XTCD 2CW0D 4QB4A 2Q8IB 1SE4A 3K58A 1B3AA 3I73A 3U9OA 2B2UA 2K5DA 1WTVA 3PUVA 3TP8A 2K6AA 4LK1C 2J4XA 4DU9A 4A3IB 2WB1B 1PYWD 4A3KB 4N9PA 3HOWB 1CT1D 1I4RA 1JOOA 1STGA 4K2LA 4ZYSA 5EPKA 5FO7B 1HQRD 4OGQC 1STNA 2WAQB 4XDXA 4RFBA 2FFKB 1UEAB 1U9RA 4PNYA 3QB3A 1U4RA 2EE1A 1KDAA 3HOVB 2NUCA 3HZXA 3MZ5A 3BYYB 2PO4A 3PUYA 1JB3A 2MHVA 1D1IA 1SMYC 2HQEA 3K5LA 3GTGB 2WKCA 3SK6A 2H4OA 2ENBA 1JICA 2KCCA 4IUTA 1BQQT 1T5EA 2RDGA 3MA2B 4OO1H 3K5MA 1EY5A 2HCCA 3URYA 1O80A 1Q12A 2N55A 5FK9C 4B08A 2DNEA 3A8KE 3OSOA 2K5WA 1SSOA 1QE6A 4G7HC 4JK1C 5C3WA 5M5WB 2KA7A 3C3LA 2R93B 3J7AF 1TQOA 2HUGA 5EQ0A 2PNRC 1UUPA 1BR9A 1SDFA 4IFDG 1HA5A 5K5PA 2AUKA 1U4PA 3NHHA 2XWBB 1C48A 3QWNA 5M9OA 3T53B 4M8AA 3BVGA 2EXZA 5F2DA 4WRDA 4C1NK 1ICWA 3NE5B 1LT6D 1TIID 3I70A 1SYDA 2C9OA 4XQJA 5JEAG 1Z47A 4EQPA 5ELBA 3P75A 3V96A 1QNKA 2NVXB 1JWUD 5M3MB 1G6ZA 3OIQA 4IUQA 3VR2A 3I3CA 2JA5B 3M7GA 2N88A 5C5MA 4KK7A 1SNQA 1YNJC 2F0OA 3H91A 1K8OA 1W6KA 3AMUA 3S1QB 1QB5D 2E74C 4QCLA 1SFOB 3OWEB 1AN8A 1H9RA 2FHTA 2Z4IA 1GHKA 2OF1A 2PCFB 3S2HB 3MHBA 3J80E 3WOEA 3J81L 3QG1A 1YNNC 3HRZC 1II3A 4RKLA 1HTPA 2B2YC 1F2YA 4KMUC 5C0XH 3LX0A 3T16A 4RHRA 5C0XJ 3MWYW 5CGKA 5AFWA 4FYDA 4OO1I 1H9SA 1H9JA 4OIKA 2Q8TA 1QNUA 2WKDA 3SXHA 4I7ZC 2D5DA 1SXTA 3EJIA 4MHEA 3T4AC 4KN4C 1IYUA 3EQLC 2QCPX 4RGTA 3PO2B 4ZAIA 3OOCA 4KKSA 5IODA 5CYUA 4G4KA 2A68C 3VYSA 4ZK9B 3Q24A 3N52A 4XYOA 1BDOA 5DNFA 1AEXA 1ENFA 3S2DB 1BCPD 1SNDA 4N9TA 3RD4A 2KEDA 1IKLA 4C3JB 1Q1BA 3J81E 4K6LA 2WP8J 2AQ3B 2MP1A 3TP6A 5IOCA 4QF4A 1BCPB 5JOBA 4QIWB 2F0KA 3OMGA 2F0MA 1QILA 2KOLA 4JBWA 5LL6X 2NVYB 2EYMA 3EVQA 1G2TA 3PIO3 1RDPD 1DOLA 2B2WC 4DFAA 2A73B 1EY6A 1PTOH 2IT1A 1RJTA 2V4DA 2EYLA 2R92B 2BE5D 2L0CA 3X3MA 1I3QB 3DEOA 4DK0A 3NK9A 1K8MA 2BOSA 3DM1A 2IX0A 5C0XI 2TSSA 2L12A 4PMCA 5M5YB 3HP3A 3GP7A 1PDQA 1CA5A 1PFBA 1LT5D 2E76C 1JORA 2B8FA 1MI2A 2KJXA 4QUCA 1OXSC 1LTTD 4ULLA 3WOFA 5HGTA 2BA1A 5J39A 1BBXC 3UI2A 4QUFA 2NTTA 3NPPA 4IQZA 4HSVA 1I4XA 2B2WA 4K6DA 1SE3A 4G57A 4DXGA 3HGBA 3FRPB 1B9MA 2BCOA 1PRTC 1TVXA 4KD4A 3S1MB 4HN7A 5T1GA 1PLFA 1ENAA 1B4OA 4F87A 4ZQ3A 3D4RA 1D2BA 2WV6D 2K33A 4H13C 4BWGB 1WD1A 4B9WA 5CR3A 4XQQA 3BZDB 2IJ0A 1D5XC 1PZJD 3NTKA 3QOLA 1RODA 2K32A 1KNEA 3I90A 2LMCB 3PMFA 1VMPA 5BN3A 2XSCA 1U4LA 2JXMB 1KAAA 1EYCA 3G6JB 4HTHA 2VXWA 3HOUB 1JCKB 3VA7A 1SBBB 3TN2A 2F0QA 3IKJA 3Q6SA 1HA6A 3QJYA 2QDBA 5A2QL 1F9RA 4KKTA 1A15A 3ONAB 1JWMD 3JAML 4IN3A 3DMUA 3GTQB 1BO0A 2H1EA 3DHQA 2BDOA 3BDLA 1EEFD 3NTHA 2EY1A 4RGNA 3G7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOO A;  3D8G A;  5J39 A;  1STG A;  4K2L A;  2F0G A;  3TP7 A;  1SYD A;  1A3T A;  1SND A;  2EY5 A;  3H6M A;  4N9T A;  1EYD A;  5DEH A;  2EYO A;  4ZUJ A;  3VA5 A;  5JAV A;  4EQP A;  2OEO A;  2F0W A;  1SYG A;  1STN A;  3P75 A;  4K8I A;  2F0V A;  4KY7 A;  4OL7 A;  3SK8 A;  4LAA A;  5I6W A;  1STB A;  4KY5 A;  5ISR A;  1F2Z A;  2EYJ A;  2PZW A;  5CV8 A;  3SHL A;  3NQT A;  4NKL A;  3D4D A;  4EQN A;  3TP6 A;  4HMI A;  4MIU A;  4K6D A;  4IUN A;  3D4W A;  4QF4 A;  5JOB A;  1U9R A;  1IHZ A;  2KQ3 A;  4G57 A;  4H7B A;  1KDC A;  2SOB A;  4PNY A;  5J1Z A;  2F0P A;  3QB3 A;  4KD3 A;  1KDA A;  2F0F A;  2F0I A;  2F3W A;  4J6H A;  5C5L A;  5NUC A;  1EY8 A;  2F0K A;  3P1H A;  4B9X A;  2LKV A;  1EY7 A;  5KYI A;  1JOQ A;  2NUC A;  3HZX A;  3MZ5 A;  2PZU A;  3OMG A;  5C5M A;  5KIX A;  1SNQ A;  1STA A;  2F0M A;  2F0O A;  2O4X A;  3NXW A;  4KD4 A;  4RKB A;  3T13 A;  5CV4 A;  5I9P A;  3SK5 A;  4KY6 A;  1ENA A;  2RDF A;  4K14 A;  5KGU A;  2HQE A;  2EYM A;  3R3O A;  4K5V A;  3EVQ A;  3SK6 A;  4ZQ3 A;  2PW7 A;  5C4H A;  2ENB A;  4ID6 A;  4NDX A;  4S3S A;  1ENC A;  4DFA A;  1TR5 A;  3ITP A;  5IGB A;  3NP8 A;  1EY6 A;  2PZT A;  1SYB A;  5KEE A;  2SNM A;  1KAB A;  5IGD A;  4E6I A;  5IGE A;  2EYF A;  1EY9 A;  2PW5 A;  1A3U A;  4ODG A;  2OF1 A;  3TME A;  4DF7 A;  1EQV A;  2KHS A;  3MHB A;  3BDC A;  1EY4 A;  3QOJ A;  4KJN A;  2EYH A;  1EY5 A;  2WAC A;  2F0U A;  3V2T A;  2EY6 A;  4B9W A;  5IIF A;  4I65 A;  2F0S A;  2EYL A;  4NMZ A;  5CR3 A;  1II3 A;  2F0E A;  4RKL A;  1EZ6 A;  3C1F A;  5EGT A;  1F2Y A;  3SR1 A;  5IGC A;  4QMG A;  4K5X A;  5CV5 A;  3SK4 A;  4EQO A;  4ZUI A;  3NUC A;  5C4Z A;  4F8M A;  3LX0 A;  3QOL A;  3T16 A;  3OSO A;  3MVV A;  5C6A A;  1EZ8 A;  4TRD A;  1STH A;  2F0H A;  5C3W A;  4PMB A;  5E3F A;  1SNM A;  1SYC A;  4KJO A;  3RUZ A;  5E1F A;  5KYL A;  5CGK A;  5HUR A;  1SNO A;  1A2U A;  3PMF A;  1TQO A;  2PQE A;  4F7X A;  4IZ8 A;  4ME5 A;  3TP5 A;  5I9O A;  1JOK A;  3SXH A;  1KAA A;  1EYC A;  3D6C A;  4HTH A;  3NK9 A;  4J1M A;  3EJI A;  1STY A;  5IGF A;  4K5W A;  4QB4 A;  2M00 A;  5IOC A;  5J22 A;  2RKS A;  3MEH A;  3OWF A;  1A3V A;  1SYF A;  3ERQ A;  4PMC A;  2F0Q A;  5K5P A;  3E5S A;  2PYK A;  3OMC A;  4NP5 A;  2QDB A;  2EYP A;  5EKL A;  3U9O A;  1TT2 A;  2F0J A;  5CV9 A;  1RKN A;  5IOD A;  4HMJ A;  4YIJ A;  2F0D A;  5I6Y A;  3NHH A;  1SYE A;  1SNP A;  4KV6 A;  2RBM A;  5EKK A;  5DAU A;  1A2T A;  3TP8 A;  4WOR A;  3HEJ A;  4R8N A;  1NSN S;  4DU9 A;  5IGG A;  5M9O A;  3DMU A;  1F2M A;  3MXP A;  1KDB A;  1SNC A;  2F3V A;  5CC4 A;  4IAL A;  3S9W A;  1JOR A;  3DHQ A;  2EXZ A;  3BDL A;  1EY0 A;  5CV7 A;  5CV6 A;  2EY2 A;  1NUC A;  2OXP A;  4KHV A;  5F2D A;  5C3X A;  2EY1 A;  3C1E A;  4K2K A;  4WRD A;  3ERO A;  4N9P A;  2F0L A;  4EVO A;  5KRU A;  5HGT A;  2F0N A;  1AEX A;  4K8J A;  2SNS A;  2F0T A;  4KTA A;  1EYA A;  4DGZ A; 
#chains in the Genus database with same CATH topology
 3NBH B;  2AQ2 B;  3TP7 A;  3VA5 A;  3GTP H;  2NVT H;  4V0B A;  5JJL A;  1E7Z A;  3ER0 A;  4A3I G;  3HOY B;  5G3L D;  3RZO H;  5C4X B;  3LNN A;  4X3U A;  2CVR A;  3SHL A;  4LFA Q;  4MIU A;  4IUN A;  4A3K G;  4DK1 A;  2KQ3 A;  1EL0 A;  4O2D A;  2F0P A;  3L7Z C;  4ZKC B;  1XYI A;  4LUZ A;  1PH1 A;  2IX1 A;  2BH8 A;  2X6G A;  2NWG A;  1PTO D;  2I46 A;  4LFB Q;  2B2U C;  4CGY B;  4RKB A;  2E2I B;  1DM0 B;  1B2T A;  3S15 H;  1WTP A;  4K14 A;  4JI2 L;  3R2T A;  4OX9 Q;  3M85 A;  3Q23 A;  4XT1 B;  1VQJ A;  2F1M A;  2FMC A;  4FDB A;  1X3E A;  4A3F G;  2PZT A;  1KQS A;  1KXL A;  5IGD A;  4FF4 A;  5IYB G;  1PTO B;  4TSS A;  1H9K A;  1WVL A;  2K5V A;  1DGS A;  4DR6 L;  4X3S A;  1Y1W H;  3M4O B;  4I65 A;  1PYS B;  2E5L L;  4CKB A;  2PI2 A;  3P7J A;  3C1F A;  1DCZ A;  2K03 A;  1K9M C;  1LO5 D;  3BVM A;  1XPO A;  4XYQ A;  4GNX B;  3H3V H;  2D0P A;  2NTS A;  4YCW A;  3QIA A;  1FGU A;  1RL2 A;  5ELC A;  4GS3 A;  3UDG A;  3FKI G;  1JOK A;  4Y52 H;  1QJO A;  2A69 D;  5HGQ A;  1XWE A;  5JPM C;  2Q2U A;  4GKK Q;  1GUN A;  2M00 A;  4BY1 G;  4ABN A;  4HIK A;  4A76 A;  1YJW A;  1XPR A;  2JA6 B;  3PCO B;  1KLG D;  1Y1V H;  1RHP A;  1CSQ A;  4PZ8 A;  1NJI C;  4NXM L;  2R93 G;  1PH8 A;  1SNP A;  2LS0 1;  4WOR A;  4FF1 A;  1JE4 A;  5FLX L;  5AJ3 L;  1KDB A;  1SNC A;  3TZD A;  2NVQ B;  1TWF H;  3BZC A;  1KLU D;  1EY0 A;  2OXP A;  1ZYR C;  4KHV A;  3CD6 A;  1GUW A;  4K2K A;  3GTK H;  1HZC A;  2UU9 Q;  2MO0 A;  4KTA A;  1EWI A;  1AP0 A;  1HNX L;  1A3T A;  4ZUJ A;  1J9O A;  3DLL A;  3KYH C;  4LNQ A;  3I56 A;  3CCR A;  1XNR L;  5EKI A;  4NXN L;  1LV9 A;  4OEL B;  1XMO L;  3FVQ A;  1L1O A;  3PUW A;  2Z6K C;  4FO2 A;  3D4W A;  3TZU A;  1IHZ A;  2NB0 A;  5J1Z A;  1KDC A;  1N32 L;  5FJ8 H;  1O78 A;  1O7I A;  2ZJR A;  3UDI A;  1DZ1 A;  1QVG A;  3M4P A;  4A93 B;  5KIX A;  4CJ0 B;  3SK5 A;  5GQO A;  4LF6 L;  1I5F A;  1SN8 A;  4YCU A;  4DR2 Q;  1BCP F;  2MUY A;  3B6Y A;  5DM7 3;  2KHJ A;  5FO9 B;  2JEB I;  3OTO L;  1QCB D;  2Z4H A;  2G9H D;  5M3M G;  1NCV A;  2YU9 H;  4CDE C;  1X3Q A;  3HOX H;  4N8X 1;  4A3F B;  2JA5 G;  1XMQ L;  2NYZ D;  2QW7 A;  4IUV A;  1EQT A;  1TS5 A;  4PQX A;  5FLX E;  1E2Z A;  5BN5 A;  3CHB D;  3NUC A;  4OWT B;  3A7L A;  2CHB D;  3CCE A;  2QA4 A;  1GUT A;  4HED A;  1CHP D;  4P2C B;  4J8Q A;  1I6H H;  1SNM A;  2C5C A;  3RUZ A;  3S14 H;  5HUR A;  5L37 A;  4KHP L;  2X69 A;  1FNW A;  1CQF A;  2EXD A;  1I50 B;  3M3Y B;  2KEE A;  3OYY A;  4RGO S;  1QG7 A;  1VQO A;  3D6C A;  2ZJP A;  4G7Z C;  1Y8P B;  4KKU A;  4X65 L;  3FKI B;  1Y1V G;  3PO3 B;  3ERQ A;  3H3V I;  2HHH Q;  1CFM A;  1IBK L;  2AWO A;  2EYP A;  3U4V A;  2WFW A;  4DR3 Q;  4BY1 B;  1DON A;  1Y14 B;  2OQ0 A;  1B8A A;  4C3I B;  3A0J A;  4UPA A;  3CQZ B;  2UUA L;  1JQY D;  3KJO A;  1C7Y A;  1A2T A;  1PHJ A;  3KLR A;  5M3F B;  4DV2 L;  3UDX A;  2Z0S A;  1IW7 D;  1J5E L;  4A3D B;  4IAL A;  4KN7 C;  4TQU S;  3CRL C;  2ATW A;  2E75 C;  2LXJ A;  3PO2 G;  1X56 A;  2DGY A;  4JBM A;  1F77 A;  3D8G A;  3SEB A;  1VQ6 A;  1SRU A;  1VQK A;  3CCU A;  5ELO A;  3ICE A;  3GTP B;  2NVT B;  2A6E C;  2BH2 A;  4CDD C;  2K14 A;  1WD0 A;  3KLW A;  3RZO B;  1NNX A;  2EYJ A;  3KUP A;  2LFN A;  4NKL A;  3D4D A;  3MC0 B;  1E2V A;  2AHO B;  3L3O C;  2HCI A;  1KNA A;  2KEN A;  2G9D A;  2F0F A;  2F3W A;  4X64 L;  1EY8 A;  1E0B A;  2QGQ A;  4Y7N H;  2OQK A;  1N36 Q;  1RTO A;  1AFP A;  1O7Y A;  1XTD A;  2XN9 C;  4C3J G;  1S4Z A;  4JI4 L;  2K5N A;  2ZM6 Q;  1VQE A;  3S15 B;  1TS3 A;  1BNZ A;  4LF9 Q;  2UXB L;  3SE0 A;  1AE2 A;  2RF4 A;  1W2B A;  1BUV T;  5FKA C;  1DD2 A;  3ND8 A;  2VB2 X;  4ZKB B;  1TWG H;  2B8G A;  1PH6 A;  1NE3 A;  3GTJ B;  1ET9 A;  1Y1W B;  4GNX C;  2EYH A;  1ASZ A;  1R9T H;  3NWT A;  1FGB D;  2F0E A;  1GUG A;  4B3M L;  2PQA A;  4RCO A;  4EQO A;  3JC6 6;  2YTY A;  2OTJ A;  2I0Q A;  5GAE C;  1O7Z A;  2V1C C;  4HIO A;  3DEP A;  4GOP C;  5E1F A;  1TWA H;  1C4Q A;  1RCV D;  4JVZ A;  5I4D A;  3PF5 A;  2H5X A;  2A6H D;  4OO1 G;  1QWY A;  3CXC A;  2R92 G;  3CC4 A;  3NBH A;  3F2U A;  4K5W A;  2MFI A;  1ILP A;  3OWF A;  1X6O A;  4CJ2 C;  4A3G H;  1NR4 A;  1NMF A;  4LFB L;  2PYK A;  4DAV A;  4NP5 A;  1Y1V B;  3AU7 A;  2EJG C;  4JOI C;  2F0D A;  2DUD A;  1AZQ A;  4MZ9 A;  1HFN A;  1PMR A;  4JCV E;  3MXU A;  3S1R H;  5DAU A;  4YHH Q;  2RHQ B;  1VQL A;  3HOZ H;  4R8N A;  3F2D A;  2F3V A;  5CC4 A;  3PUX A;  1FVI A;  3FDT A;  1TWF B;  5FO8 B;  2NBF A;  3AQQ A;  3L9A X;  5CV7 A;  5CV6 A;  3GTK B;  1ET6 A;  1PXU A;  4IPG A;  1HR0 Q;  4LF8 L;  4JI6 L;  2F0T A;  1EYA A;  5FLM H;  2CW0 C;  2EY5 A;  3ERS X;  4FP5 D;  1PH5 A;  5C3E H;  4X66 Q;  1E3P A;  3A8I E;  2F0W A;  4LF7 Q;  3UE1 A;  3MXN B;  1STB A;  3AYH B;  2GA4 B;  5EPJ A;  2B63 H;  1LLR D;  4A3J H;  3H15 A;  4LW1 A;  1P8L A;  3CCJ A;  4LF4 Q;  1PZI D;  1O7L A;  1HFG A;  5IP9 H;  2K7V A;  3DM3 A;  1JC7 A;  1EY7 A;  4P73 A;  4GNX A;  1YVC A;  1MSG A;  4R4O A;  3NXW A;  3I2Z A;  1YI2 A;  5CV4 A;  3HKZ B;  1LTB D;  1HUM A;  5BR8 Q;  5EPL A;  1NY4 A;  3S24 A;  3EBE A;  2J0T D;  5C4H A;  4ID6 A;  5CBA E;  2EQS A;  4BA2 I;  4JBJ A;  5IGE A;  2YU9 B;  4DF7 A;  3HOX B;  5G3L F;  1LTA D;  5C44 H;  1LT3 D;  5EBD A;  3V2T A;  2EY6 A;  3AB9 A;  1CA6 A;  1MHW C;  5A35 A;  4QMG A;  3SK4 A;  4JI0 Q;  3E9I A;  3EIV A;  1PTO F;  1WCM H;  2F0H A;  1I6H B;  4PMB A;  2IW3 A;  2E2H H;  4JOI A;  3EFX D;  5M5X H;  3J7A V;  2M2L A;  3S14 B;  1SNO A;  2BDN A;  4PG3 A;  5E7N A;  1IBM L;  3KLS X;  2WIN B;  4IZ8 A;  1E22 A;  2ASB A;  4BXX G;  3STB D;  3EA6 A;  1V8Q A;  3RMH A;  2F4I A;  5IGF A;  4X62 Q;  1LM0 A;  2A19 A;  3HS0 C;  3MEH A;  2DY7 A;  5C0X G;  1CSP A;  1KIX A;  4JC0 A;  3D0F A;  1QZG A;  1I94 Q;  5CV9 A;  1HNZ Q;  3PIP 3;  3LWE A;  1E1T A;  2R7F A;  2RCN A;  1IBL Q;  4OON A;  4HID A;  4C1N I;  3HOU G;  1Q8I A;  1CKM A;  1X32 A;  1B44 D;  5TSS A;  1GJX A;  1FL0 A;  5ELN A;  1VQD A;  1GOZ A;  2ZT9 C;  3UE0 A;  1HQM C;  2QDL A;  3D3R A;  4B9X A;  1WTH A;  1CI3 M;  1BXT A;  2CWA A;  4POF A;  1UE6 A;  3K5O A;  5IWA L;  3T1Y Q;  1EU3 A;  4NPS A;  4UY8 C;  3GD7 A;  2QF7 A;  1B9N A;  4DR7 Q;  2JK8 A;  1T5X D;  1VDZ A;  5IP9 G;  3RLN A;  4HMI A;  5C3X A;  2IPK D;  1B53 A;  2SDF A;  2XGT A;  1DOM A;  1S5F D;  5C5L A;  3P1H A;  4Y7N B;  4X3T A;  1YIT A;  2VQF Q;  4IJH A;  3V05 A;  4JI5 Q;  5EAY A;  5D65 A;  2A74 C;  4GN3 B;  3HOY G;  5C4X G;  2R3Z A;  1SJE D;  1UE7 A;  4B3R L;  3TS0 A;  1STE A;  4C3H H;  3T1H Q;  1TWG B;  2SNM A;  1UAP A;  1A3U A;  2KHS A;  2WII B;  4JI8 L;  4ZLT F;  1R9T B;  4GLA C;  5IP7 G;  3TSS A;  1EZ6 A;  2RSO A;  1A63 A;  1QUQ B;  2C35 B;  5C4Z A;  1KRT A;  4GKJ L;  2Z6B A;  5JJZ A;  2MO1 A;  2VB3 X;  2JA8 H;  2KEC A;  4DNR B;  1FJG L;  1JJ2 A;  3T56 B;  3G71 A;  2O5J C;  3A8J E;  1VMC A;  1TWA B;  1J8I A;  1HH2 P;  1D8L A;  3DWP A;  2PQE A;  3MAQ A;  3K0X A;  5I9O A;  3F2C A;  3DWA A;  3VR5 A;  1VCI A;  4BY7 H;  3DXJ C;  1MGS A;  4L6T B;  4ZRZ A;  3GQB A;  5J22 A;  1LYL A;  4A3G B;  3A54 A;  4XXE A;  4DN4 M;  1N36 L;  3E5S A;  1YJN A;  2ZM6 L;  1FNV A;  3BYT B;  3E6Z X;  4LF9 L;  5C4J H;  2AKW B;  1Y8O B;  5EKK A;  2RBM A;  5ELD A;  4YY3 L;  4OHJ A;  3HOZ B;  2E2D C;  3MXP A;  2CQA A;  1S40 A;  2L4N A;  2K28 A;  4UP9 A;  1I4P A;  3R2I A;  2F03 A;  4DA2 A;  2JA6 G;  1AE3 A;  4EVO A;  3CMA A;  5J3B A;  4A3E H;  1I4G A;  1SMY D;  2F0G A;  1JOQ A;  5E4W C;  1F9P A;  2PMZ B;  4HAE A;  5C3E B;  1EYD A;  1VQB A;  5JAV A;  1I4H A;  4LFC Q;  2F0V A;  4U67 3;  1D6E C;  4JI1 Q;  5I6W A;  4KY5 A;  2B63 B;  2Q2I A;  2PZW A;  4A3J B;  2QKI C;  3NQT A;  2DJG C;  1CZG A;  2RDH A;  4DV1 Q;  4AQY Q;  4C2M H;  1T9H A;  2VUM G;  2SOB A;  1K3B C;  2NN6 H;  3K0Y A;  2F0I A;  4J6H A;  4KI0 A;  2EZV A;  2VNU D;  2ICI A;  1VQP A;  3MTS A;  2K5Q A;  1GUO A;  1GKH A;  3GO5 A;  3NWS A;  5I9P A;  2AQ1 B;  2N49 A;  1IKM A;  4C3H G;  1BCP C;  4K5V A;  1EOT A;  2JP1 A;  1SMX A;  4HJ8 A;  4YHH L;  4ILW A;  1KAB A;  2HIX A;  2EYF A;  4F88 A;  1CUK A;  5C44 B;  2O2L D;  5D3I B;  4HJ9 A;  5LL6 S;  4A93 G;  1RIP A;  1Q3L A;  3CKI B;  4NMZ A;  1V1P B;  3U9S A;  3G4S A;  1EIG A;  1LUZ A;  4XTC S;  3MVV A;  2TMP A;  1WCM B;  4DV4 L;  1Q8K A;  2E2H B;  5M5X B;  2JSO A;  1TWH H;  1L1O C;  4IUU A;  3GTO H;  1A2U A;  1EU4 A;  3KDF B;  5A2Q E;  2JE6 I;  5HY6 A;  4N8F A;  3ULL A;  1STY A;  3NBI A;  4IPD A;  4LJZ C;  3KJP A;  4BBR H;  2RKS A;  3JAM E;  1SYF A;  2R7Z H;  5IT9 L;  3DUZ A;  2OT2 A;  4YWL A;  2ID0 A;  2XWJ B;  3MXN A;  2F0J A;  4A3C H;  4YIJ A;  2I07 B;  3K81 C;  4KLK A;  4A3B H;  4RAU C;  2ZXR A;  4KV6 A;  4FVM A;  3NEL A;  3RNU A;  1WTW A;  5IGG A;  2BE5 C;  2L9H A;  4FF3 A;  4A3E G;  1X3F A;  3PO3 G;  3CRK C;  1YNJ D;  2R61 A;  3PUZ A;  4HCE A;  2K04 A;  3ERO A;  1GXD C;  3J7Z C;  2NZO A;  3VDY A;  4RWS C;  2Q2H A;  4C3I G;  1GUS A;  5H1S E;  3W1B A;  4JI0 L;  1YNX A;  1QOH A;  5DLQ E;  4EGV A;  3CME A;  4L8J A;  5M3F G;  3DWQ A;  4OL7 A;  2DN8 A;  2UUC Q;  4A3D G;  1WYD A;  1W6J A;  1RTN A;  1WI5 A;  1YNN D;  3FPP A;  3H0G H;  2GN5 A;  1ESF A;  4MTN A;  4ZCK A;  1J6Q A;  1HPC A;  3N6R A;  3KF6 B;  1Y8N B;  2VUM B;  2PZU A;  2IX3 A;  2O4X A;  2P5Z X;  1G29 1;  2JYO A;  3F8T A;  4QGU A;  2FMM A;  4BBS H;  1HNZ L;  2A8V A;  1HNW Q;  2CFM A;  3R3O A;  4EX5 A;  4DV7 Q;  2ZXP A;  2PW7 A;  4MN3 A;  2VW9 A;  3PV0 A;  1M90 C;  1TR5 A;  4OWW B;  4C3H B;  2NN6 I;  1D5M C;  2PW5 A;  3PSI A;  4CKC A;  2CKZ B;  1HZ9 A;  1ZEQ X;  4KJN A;  1H95 A;  4CBV A;  5I2Y A;  2QIL A;  3E3X A;  3RZD H;  4DR5 L;  4NW2 A;  2A68 D;  4IFD H;  3R8B A;  1RD9 D;  3J80 c;  5E4X A;  1LAB A;  4FXD A;  1V1O A;  2JA8 B;  1L0X B;  1STH A;  4IFD J;  3L2P A;  1I4Q A;  3SDZ A;  2JN4 A;  1EEI D;  1TS2 A;  4RCN A;  3KF8 B;  1VQ7 A;  4DR7 L;  1VQA A;  1DXM A;  1Y1W G;  2RQX A;  4G7O C;  2Z9H A;  1E1O A;  2IHF A;  4BY7 B;  1A3V A;  4DV6 Q;  1N9W A;  2VQF L;  2NZH A;  4JI5 L;  4WJ4 A;  2D2C C;  5EKL A;  4DUZ Q;  2D62 A;  4A3M H;  5C4J B;  1S5E D;  1SEB D;  2IHE A;  4RGM A;  5JEA H;  1OXT A;  3VYR A;  1TY2 A;  1B70 B;  3A7A B;  5LMN L;  2GVA A;  2JA7 H;  3T1H L;  2IY5 B;  4A3L H;  5JEA J;  4EQ5 A;  1XX8 A;  3BVZ A;  2EY2 A;  1NUC A;  4MNO A;  1GM5 A;  1BKB A;  4IUP A;  1HTL D;  1WTO A;  4A3E B;  2SNS A;  2PPB C;  4QQB X;  1OXV A;  2A5H A;  3BJU A;  5CBE E;  1HRJ A;  1F2L A;  1SE2 A;  3IAY A;  3CW2 C;  1XNQ Q;  4DXF A;  1SYG A;  3TS2 A;  3GTM H;  4DR4 Q;  1ZXT A;  4O42 A;  2HDL A;  4IPH A;  3K7A H;  4R4T A;  4C2M B;  4AIM A;  2FXQ A;  3BS1 A;  1QUQ A;  3HKS A;  3BG3 A;  2YV5 A;  4IUR A;  3OW2 A;  2EDG A;  3K5N A;  1K73 C;  1VQ5 A;  4R1J A;  2J7Z A;  1WJJ A;  3A5Z B;  1EYG A;  4DV0 Q;  4RHS A;  3CPF A;  4XQN A;  4FF2 A;  4YWK A;  3K6O A;  1LAC A;  2VQE Q;  3CU7 A;  1YHB A;  3FP9 A;  3VYT A;  1JWS D;  5FJ8 G;  4XIG S;  2FIN B;  3TME A;  2E2J H;  1FD7 D;  1TY0 A;  3K59 A;  2KVM A;  3BDC A;  4HJ5 A;  1RF2 D;  1OXU A;  3HKZ G;  5JJK A;  5EGT A;  2IL8 A;  2DJF C;  1N8R C;  4R4Q A;  3FMC A;  2K1B A;  4TRD A;  1PTO C;  4O1N A;  3TBI B;  4DV5 L;  4JI3 Q;  4TKO B;  3J80 L;  4JI7 Q;  1TWH B;  2EJM A;  4JI1 L;  3GTO B;  2UXD Q;  3HOX G;  1WOC A;  4CKE A;  3TP5 A;  3VR4 A;  2GVB A;  2Z1C A;  3KLS A;  1G91 A;  4IFD I;  4BBR B;  1CKN B;  1M4V A;  2L11 A;  3RLF A;  2R7Z B;  1MKH A;  1CK1 A;  1BBU A;  4CJ1 B;  1FNU A;  1LT4 D;  3G48 A;  1RKN A;  1V1Q A;  1Q86 C;  2JA7 G;  4A3B B;  4B3S Q;  1NMG A;  2O5I C;  2LXK A;  1PA6 A;  1F9S A;  4LF5 Q;  1NSN S;  2EJF C;  3K80 C;  1F2M A;  1K83 H;  3S16 H;  2K4K A;  1CTM A;  2L5T A;  1CHQ D;  3IFD A;  3S9W A;  4LFA L;  1PRT D;  3QO2 A;  2OWO A;  3I4L A;  1ESR A;  3CPW A;  3FEW X;  4RA8 A;  1EQR A;  2A69 C;  1S5D D;  1GD7 A;  3IFT A;  3H6M A;  2EYO A;  1D5Z C;  1PRT B;  4Q5V A;  1X65 A;  4OX9 L;  4UHV A;  3W2D A;  1MBY A;  2B2V C;  5ISR A;  2B39 A;  2BA0 A;  2E8G A;  4EQN A;  1K8G A;  3I4N H;  1N34 Q;  2ALY B;  2M9V A;  4X6A H;  1ASY A;  3J80 i;  3ZYY X;  1V1P A;  4UAI A;  3H0G B;  3VR3 A;  4FXK C;  3H94 A;  5NUC A;  4PZ7 A;  5KYI A;  2B2T C;  1TWC H;  4DAY B;  1WTX A;  3LGJ A;  4BBS B;  3X3N A;  4Q0F A;  3RN5 A;  2XNA C;  1A0I A;  3E9H A;  4U68 A;  1HZB A;  4HSP A;  3PIO A;  4S3S A;  5IGB A;  1NAP A;  1SYB A;  1OXX K;  3MEF A;  1EY9 A;  5LMN W;  4P74 A;  3D6W A;  3RLO A;  2I5L X;  3TRZ A;  1EY4 A;  2WAC A;  2YTX A;  2L1B A;  2F0S A;  1A62 A;  1B7Y B;  4GKK L;  3RZD B;  2NZ1 D;  1G51 A;  2K05 A;  4JI2 Q;  3BU2 A;  3H09 A;  3IL8 A;  1VQ4 A;  3HKZ E;  3P20 A;  1UEB A;  4OIJ A;  1HCZ A;  3S17 H;  2DNC A;  3PF4 A;  4KJO A;  3NSW A;  4ALP A;  5KYL A;  2EOT A;  3K8A A;  1VQH A;  1LTS D;  5ELE A;  1XXG A;  3NEN A;  3NEM A;  3ULP A;  5IYD H;  4DR6 Q;  2HIV A;  2CWP A;  3I7F A;  2E5L Q;  1Z7T A;  2VZA A;  4MTK A;  2UU9 L;  3J81 i;  5LMU Q;  1Q46 A;  5JJI A;  1TT2 A;  4A3M B;  1HNW L;  2X6L A;  1CM9 A;  2B29 A;  1SYE A;  3KFU A;  5T1I A;  2FJ2 A;  3OIP A;  3M4Y A;  1C8C A;  3A5U A;  1M8A A;  4L5T A;  2MPM A;  3VR6 A;  1ILQ A;  2JA7 B;  1VQG A;  2Z8L A;  5COY A;  2LY7 A;  3RR5 A;  1KAW A;  3KF6 A;  2B2V A;  4NB3 A;  1Z6H A;  1EIH A;  1JR0 D;  1UE5 A;  4IO9 A;  2CQO A;  3WDN A;  4A3G G;  1L0Y B;  1G2S A;  2EPB A;  5KRU A;  2L15 A;  4AYB B;  2F0N A;  2VL6 A;  4K8J A;  1A6X A;  4DGZ A;  5JVG 3;  2B2Y A;  2B2T A;  2UXC Q;  2OEO A;  1DOK A;  4NXM Q;  4OEM B;  3GTL H;  3HOZ G;  4KHZ A;  4DR2 L;  4CHT B;  3I4N G;  3GTM B;  4K8I A;  4KY7 A;  1ZKO A;  5AJ3 Q;  2ZTC A;  3I4M H;  3K7A B;  1VQM A;  2PNH A;  4H7B A;  1IW7 C;  5KNC A;  4DAP A;  4JBK A;  5FLM G;  3OPO A;  5EJW A;  1PV4 A;  4DV6 L;  5C3E G;  1C0A A;  3SGI A;  1HNX Q;  1AW7 A;  1STA A;  3TDQ A;  4UP7 A;  1X55 A;  3T13 A;  1Y69 U;  3KF8 A;  2RDF A;  1XNR Q;  2B63 G;  1CQV A;  4A3J G;  1YIJ A;  1EQQ A;  2RA4 A;  4NDX A;  4L63 B;  1ENC A;  3NP8 A;  1WFQ A;  5COR A;  3C46 A;  3W3A A;  4E6I A;  2E2J B;  4ODG A;  1U4M A;  1N32 Q;  2Q2T A;  1UWV A;  1X3P A;  2F0U A;  2XVS A;  4J15 A;  5IIF A;  2ZJQ A;  1F9Q A;  1LTR D;  3KBG A;  4HIM A;  2HHH L;  1A8V A;  3NQI A;  2XIW A;  3KOJ A;  4LMQ D;  5CV5 A;  1VS0 A;  1HXY D;  4LF6 Q;  1Q90 A;  4DR3 L;  2DY8 A;  3OTO Q;  1SYC A;  4P71 A;  2KCT A;  1ZYR D;  3S1N H;  2QEJ C;  1ML0 D;  5C44 G;  4POG A;  4F7X A;  5KNB A;  3AFQ A;  2ZXO A;  3BZK A;  3LWU A;  4J1M A;  1XMQ Q;  5JPN C;  1EFW A;  1WTQ A;  3H3V C;  1TU2 B;  1AZP A;  3VYU A;  3OMC A;  2L55 A;  4CDC C;  1WCM G;  3Q22 A;  4DV0 L;  5I6Y A;  1B1Z A;  1FYC A;  3W5O A;  2HT1 A;  3MXG A;  3HEJ A;  2VQE L;  4QL5 A;  3A56 A;  2K01 A;  1D1K A;  1K83 B;  3S16 B;  2Y0S G;  4A3I H;  4H44 C;  4PV1 C;  5ELF A;  2I5M X;  3C1E A;  1PFN A;  2A6H C;  5IT9 c;  1KHI A;  4X65 Q;  4A3K H;  3A74 A;  2F0L A;  3HOW H;  1WTR A;  1EWH A;  2MGS A;  1IBK Q;  5KGU A;  3MFY A;  2XRS D;  1FR3 A;  1MD2 D;  1I6V C;  1Q1E A;  1D7Q A;  4HR7 B;  1PFS A;  3I4M G;  1DYQ A;  1L0W A;  3S1R B;  4GN4 B;  4QY7 A;  3I4N B;  1S5B D;  2D9U A;  3CC2 A;  4GLX A;  1MSH A;  4TVA B;  4FNF A;  4KD3 A;  2YTV A;  5IYB H;  1TS4 A;  2KHI A;  5DM6 3;  3HOV H;  1TKW B;  1TWC B;  1VF5 C;  4GZY C;  5JVH 3;  5K36 H;  2PMZ E;  4KY6 A;  3GTG H;  1IL8 A;  4WJ3 M;  3PQI A;  1JT8 A;  3ITP A;  4Z9C B;  1KTK A;  3J7Y W;  1BOS A;  1R4Q B;  5KEE A;  1NR2 A;  1CKN A;  2D0O A;  3CCL A;  1QZH A;  1PYB A;  2KUM A;  4WJW A;  3CC7 A;  1HUN A;  3NTI A;  4WFN 3;  1V43 A;  3E0J A;  3R93 A;  2AMC B;  1KC8 C;  1YBY A;  3T51 B;  1BF4 A;  4UDU C;  3U50 C;  4K5X A;  4R9W A;  1K3R A;  4ZUI A;  1HJP A;  4F8M A;  2UXB Q;  2YYZ A;  1C9O A;  2MJ8 A;  3S17 B;  3CQZ H;  5M5W H;  1CZW A;  2XRQ D;  5E3F A;  4HCS A;  5GAD C;  3I91 A;  1UE1 A;  1IZ6 A;  2R7D A;  2R93 H;  1X54 A;  1YEZ A;  3GV3 A;  5IYC H;  3BDO A;  4DAM A;  3O13 A;  3KBX A;  1PZK D;  2AUJ D;  1B50 A;  1VF7 A;  1B3Q A;  1EFI D;  2AWN A;  1PFM A;  1HR0 L;  4B3M Q;  2A6E D;  4B3T Q;  2JA8 G;  3C2P A;  1E2W A;  4HMJ A;  4X66 L;  3I8Z A;  1E24 A;  4LF7 L;  1R4P B;  2WB1 G;  4PMW A;  2SEB D;  4R8I A;  4BY7 G;  5EBC A;  1PVO A;  3HOW G;  3FPU B;  4LF4 L;  4DAY A;  3GV6 A;  2Y0S B;  4C56 C;  2Y0S E;  1YJ9 A;  1H9S B;  1UNS A;  3OW7 A;  1S5C D;  1VQI A;  2RVL A;  3STB C;  5D14 A;  1Q7Y C;  2R6G A;  2ES2 A;  4AH6 A;  3A55 A;  1JJC B;  5KND A;  1OO9 B;  4L5S A;  2OTL A;  2Q8R E;  5DEH A;  2WAQ G;  4HJ7 A;  5LHY 1;  4X3K A;  5D3D A;  1DJR D;  3GTL B;  1H9M A;  5BR8 L;  1GHJ A;  5FOB B;  3ND9 A;  1YZ6 A;  1S72 A;  4DNT B;  3SK8 A;  2JA9 A;  4LAA A;  1JMC A;  1MJC A;  1F2Z A;  2F4V Q;  3D31 A;  2KCN A;  5CV8 A;  3I4M B;  3KK7 A;  3HG9 A;  2NVX H;  5IY0 A;  3HOV G;  4QJF A;  3JAM i;  3GTJ H;  2ICE C;  5M3M H;  3M7N A;  1PRT F;  4JI6 Q;  4LF8 Q;  2LKV A;  2JA5 H;  5K36 G;  4O0A A;  5LMU L;  1YHQ A;  5I2X A;  3S1Q H;  1HHV A;  3MFG A;  3OHX C;  4CDF C;  4BA1 I;  1SFO H;  5BN4 A;  3L0O A;  2CCZ A;  1ONL A;  4V19 0;  4BS9 A;  2B3G A;  1EWC A;  1JB7 A;  2RSN A;  2NN6 G;  2IWH A;  1EQV A;  4XT3 B;  1EIY B;  3S2H H;  4APV A;  3QOJ A;  4H0L C;  4GOP B;  1LTI D;  1LTG D;  2VS1 A;  1G8Z D;  3K57 A;  4X62 L;  2EVB A;  4JW0 A;  2HDM A;  4RH6 A;  3SR1 A;  2KCM A;  5IGC A;  1NTG A;  3SVM A;  2UXC L;  5C6A A;  1EZ8 A;  1I94 L;  5IYC G;  1SJH D;  1VQ8 A;  5IT9 E;  1IYV A;  1Q81 C;  4DUY Q;  2JEA I;  5CMD A;  1IBL L;  3I72 A;  1SAP A;  3S1N B;  2HD3 A;  4ME5 A;  3Q0A A;  4FXG C;  4M1U B;  1XTC D;  2CW0 D;  4QB4 A;  1PH2 A;  2Q8I B;  1SE4 A;  3K58 A;  1ICF B;  1X3G A;  1V9P A;  1B3A A;  4R4I A;  3I73 A;  3PO2 H;  3U9O A;  2B2U A;  2K5D A;  4RMF A;  1EUJ A;  4IPC A;  1WTV A;  3PUV A;  2OCE A;  3TP8 A;  3T1Y L;  2K6A A;  1BBW A;  4LK1 C;  2J4X A;  4DU9 A;  1IBM Q;  4A3I B;  4BBR G;  2WB1 B;  2WB1 E;  1PYW D;  2R7Z G;  4DR1 Q;  4A3K B;  4N9P A;  3HOW B;  1CT1 D;  3CCV A;  1I4R A;  4A3C G;  3S2D H;  1JOO A;  1STG A;  4K2L A;  4ZYS A;  5EPK A;  1M1K C;  4A3B G;  5FO7 B;  1HQR D;  4C3J H;  3ZJY C;  4OGQ C;  2K5H A;  3TRE A;  3M9B A;  1STN A;  2WAQ B;  2WAQ E;  4XDX A;  1K0S A;  4RFB A;  2FFK B;  2XTI A;  1UEA B;  1U9R A;  4PNY A;  3QB3 A;  1U4R A;  2EE1 A;  1KDA A;  3PGZ A;  3HOV B;  2NUC A;  3HZX A;  3MZ5 A;  1KRS A;  4DKA C;  3AEV A;  3BYY B;  2PO4 A;  3PUY A;  1JB3 A;  2MHV A;  1HR0 W;  1D1I A;  1SMY C;  2NVY H;  1K8A C;  2HQE A;  5IWA Q;  3U58 A;  3K5L A;  3GTG B;  2F52 A;  2WKC A;  3SK6 A;  2H4O A;  2ENB A;  1JIC A;  4JV5 Q;  3F2B A;  2KCC A;  2JJQ A;  3H0G G;  4IUT A;  1BQQ T;  1T5E A;  1N33 Q;  3J81 c;  2RDG A;  3FHW A;  4LUO A;  3MA2 B;  4OO1 H;  3K5M A;  1EY5 A;  2HCC A;  3URY A;  2ZTE A;  2R92 H;  1O80 A;  4BBS G;  1MIU A;  1Q12 A;  2N55 A;  5FK9 C;  4B08 A;  2DNE A;  3A8K E;  3OSO A;  2K5W A;  1SSO A;  1QE6 A;  2I5H A;  4G7H C;  2MQH A;  4JK1 C;  5C3W A;  5M5W B;  4B3R Q;  2KA7 A;  3C3L A;  4OXP A;  2R93 B;  2QEX A;  3J7A F;  1I3Q H;  1TQO A;  2HUG A;  5EQ0 A;  3IRB A;  2K50 A;  2PNR C;  1UUP A;  2Z6K A;  4JI8 Q;  1BR9 A;  1SDF A;  4IFD G;  4DV3 Q;  4DK3 C;  1HA5 A;  5K5P A;  2UUB Q;  5M5Y H;  2AUK A;  4GKJ Q;  1U4P A;  3NHH A;  2XWB B;  4LFC L;  1FJG Q;  1C48 A;  4LWC A;  1SRO A;  3QWN A;  4IJL A;  3AFP A;  1VQF A;  5M9O A;  1SR3 A;  3T53 B;  4M8A A;  3BVG A;  4PZ6 A;  1JE5 A;  2EXZ A;  5IE8 A;  4RG1 A;  2G5D A;  3F1Z A;  4AQY L;  4DV1 L;  3Q8D A;  5F2D A;  4WRD A;  4C1N K;  4I7A A;  1ICW A;  4JYA Q;  1IXR A;  3NE5 B;  1LT6 D;  1TII D;  3I70 A;  4A3M G;  4K0K Q;  1SYD A;  2C9O A;  4XQJ A;  4JG2 A;  5JEA G;  1Z47 A;  4EQP A;  5ELB A;  4GN5 A;  1KL9 A;  4YY3 Q;  3P75 A;  4A3L G;  1QVC A;  2F3I A;  3V96 A;  4IOA A;  2N3S A;  1QNK A;  2NVX B;  1G6P A;  1IL2 A;  2CH4 W;  1JWU D;  5M3M B;  4AYB G;  3OIQ A;  4IUQ A;  1G6Z A;  4P75 A;  1JJG A;  3VR2 A;  3I3C A;  4P72 A;  2JA5 B;  3M7G A;  2N88 A;  5C5M A;  4KK7 A;  3H91 A;  1SNQ A;  1YNJ C;  2F0O A;  4B3T L;  3S1M H;  1K8O A;  1W6K A;  3AMU A;  3S1Q B;  1QB5 D;  2E74 C;  4QCL A;  1SFO B;  3OWE B;  3CAM A;  1AN8 A;  1H9R A;  2FHT A;  2Z4I A;  1GHK A;  3TEH B;  2OF1 A;  2PCF B;  3S2H B;  3MHB A;  1K28 A;  1K0R A;  3J80 E;  4BXX H;  3WOE A;  3J81 L;  1TXY A;  3QG1 A;  1VQN A;  1YNN C;  3HRZ C;  1II3 A;  4RKL A;  1HTP A;  2B2Y C;  1F2Y A;  4KMU C;  2N78 A;  5C0X H;  3LX0 A;  3T16 A;  4RHR A;  1KD1 C;  4YWM A;  5C0X J;  3MWY W;  3KDF A;  1W3S A;  1NBW A;  5CGK A;  5AFW A;  2F4V L;  4FYD A;  4OO1 I;  3ULJ A;  3M4Q A;  1H9S A;  1H9J A;  1YHA A;  4OIK A;  2Q8T A;  1QNU A;  2WKD A;  3SXH A;  4I7Z C;  2D5D A;  1SXT A;  3EJI A;  4MHE A;  3T4A C;  3HOU H;  4KN4 C;  3CCS A;  1IYU A;  3EQL C;  2QCP X;  1XPU A;  4RGT A;  3PO2 B;  4ZAI A;  3OOC A;  2KBN A;  4KKS A;  5IOD A;  5CYU A;  4DV4 Q;  3PIP A;  2PI2 E;  4G4K A;  2A68 C;  3VYS A;  4ZK9 B;  2UUC L;  3Q24 A;  3N52 A;  4XYO A;  3GTQ H;  1BDO A;  1XJV A;  5DNF A;  1AEX A;  1ENF A;  3S2D B;  1BCP D;  1SND A;  4N9T A;  3RD4 A;  2KED A;  1IKL A;  4C3J B;  1Q1B A;  3J81 E;  4K6L A;  2WP8 J;  2AQ3 B;  4DV7 L;  2LSS A;  2MP1 A;  3HOY H;  4DUY L;  5C4X H;  4GOP A;  3EN2 A;  3TP6 A;  4R4C A;  3W1G A;  5IOC A;  4QF4 A;  1BCP B;  5JOB A;  1BVS A;  4QIW B;  4QIW E;  1QVF A;  4ME3 A;  2F0K A;  2K52 A;  3OMG A;  4AYB E;  1EIF A;  2F0M A;  1QIL A;  2KOL A;  2E2I H;  1VQC A;  5IP7 H;  4JBW A;  5LL6 X;  2NVY B;  2EYM A;  3EVQ A;  1G2T A;  3I4O A;  3U4Z A;  3PIO 3;  1RDP D;  1DOL A;  2A1A A;  2B2W C;  4DFA A;  2A73 B;  3G6E A;  1EY6 A;  4L5R C;  4DPG A;  1PTO H;  2IT1 A;  1SE8 A;  3M4O H;  1RJT A;  1LTL A;  4DR1 L;  1L1O B;  2V4D A;  2ZTD A;  2EYL A;  2R92 B;  3WWV A;  1MJE A;  1PH4 A;  4DUZ L;  4NXN Q;  2BE5 D;  2EIF A;  1XMO Q;  2L0C A;  3X3M A;  1I3Q B;  3DEO A;  4DK0 A;  3NK9 A;  1K8M A;  2BOS A;  3DM1 A;  1U0L A;  2IX0 A;  5C0X I;  1GVP A;  2TSS A;  2L12 A;  4PMC A;  4DR5 Q;  4H02 A;  4DNI A;  2JA6 H;  5M5Y B;  3HP3 A;  3GP7 A;  3CCM A;  3JAM c;  1XNQ L;  1PDQ A;  1CA5 A;  1PFB A;  4JV5 L;  4DR4 L;  5IYD G;  3CF5 A;  1LT5 D;  4GLV B;  2CH4 A;  2E76 C;  1N33 L;  2NVQ H;  1JOR A;  2B8F A;  1MI2 A;  2KJX A;  3CP0 A;  4QUC A;  1OXS C;  1LTT D;  5GRO A;  4ULL A;  3CCQ A;  4OWX B;  3WOF A;  2HQL A;  5HGT A;  2VUM H;  2VY3 A;  3I55 A;  2BA1 A;  5J39 A;  4HJA A;  3UDF A;  1BBX C;  3UI2 A;  4QUF A;  2NTT A;  3NPP A;  1Q82 C;  4IQZ A;  3K7U C;  5LMN Q;  4IOC A;  4HSV A;  4KHP Q;  1I4X A;  1OTC A;  2B2W A;  4K6D A;  1PH3 A;  2K75 A;  1SE3 A;  2RCF A;  4G57 A;  4DXG A;  3HFZ B;  3HGB A;  3FRP B;  1B9M A;  2BCO A;  2RHS B;  1PRT C;  4A4I A;  1TVX A;  1EOV A;  4DV3 L;  3J81 j;  2UUB L;  4A93 H;  4KD4 A;  3S1M B;  4HN7 A;  3J7A 5;  5T1G A;  1PLF A;  1ENA A;  1B4O A;  4F87 A;  4ZQ3 A;  4JI3 L;  2UUA Q;  3D4R A;  1D2B A;  2WV6 D;  1IYJ B;  4JI7 L;  2K33 A;  4DV2 Q;  1J5E Q;  2UXD L;  2JQO A;  4YCV A;  1AH9 A;  4H13 C;  4A3F H;  1Z9F A;  4BWG B;  1WD1 A;  4B9W A;  4UP8 A;  5CR3 A;  4JYA L;  4XQQ A;  1P16 A;  3BZD B;  2IJ0 A;  4K0K L;  1D5X C;  1PZJ D;  1S3O A;  4LUV A;  2N8N A;  1SLJ A;  3NTK A;  3E0E A;  3TQY A;  3QOL A;  4L5Q A;  1ROD A;  2K32 A;  4JPB W;  3RN2 A;  1KNE A;  3I90 A;  4DK6 C;  4B3S L;  2LMC B;  4A75 A;  4LF5 L;  3PMF A;  1U5K A;  1VMP A;  1I50 H;  3M3Y H;  5BN3 A;  2XSC A;  1U4L A;  2JXM B;  1KAA A;  1EYC A;  3G6J B;  3QR8 A;  4HTH A;  2VXW A;  3HOU B;  1JCK B;  1L2F A;  3VA7 A;  1SBB B;  4X64 Q;  3FKI H;  1HZA A;  3PO3 H;  3TN2 A;  1CKO A;  2F0Q A;  3IKJ A;  3Q6S A;  1HA6 A;  3QJY A;  1PH7 A;  2QDB A;  4JI4 Q;  3GDE A;  4BY1 H;  5A2Q L;  4DV5 Q;  1GO3 E;  1F9R A;  4C3I H;  5FLX c;  2PQA B;  4KKT A;  1A15 A;  3ONA B;  1JWM D;  3JAM L;  4IN3 A;  5GAH C;  2MNA A;  5M3F H;  3DMU A;  3GTQ B;  4A3D H;  1VQ9 A;  1BO0 A;  1PH9 A;  2H1E A;  3DHQ A;  1X9N A;  2BDO A;  3BDL A;  1EEF D;  3NTH A;  5GAG C;  1N34 L;  2EY1 A;  4RGN A;  3G7L A; 
#chains in the Genus database with same CATH homology
 2AQ2 B;  3TP7 A;  3VA5 A;  4V0B A;  3HOY B;  5G3L D;  5C4X B;  3LNN A;  4X3U A;  2CVR A;  3SHL A;  4MIU A;  4IUN A;  4DK1 A;  2KQ3 A;  1EL0 A;  2F0P A;  3L7Z C;  4ZKC B;  1XYI A;  2IX1 A;  2X6G A;  2NWG A;  1PTO D;  2I46 A;  2B2U C;  4CGY B;  4RKB A;  2E2I B;  1DM0 B;  1B2T A;  1WTP A;  4K14 A;  3R2T A;  3M85 A;  3Q23 A;  4XT1 B;  2F1M A;  2FMC A;  2PZT A;  5IGD A;  4FF4 A;  1PTO B;  4TSS A;  1H9K A;  1WVL A;  4X3S A;  3M4O B;  4I65 A;  4CKB A;  3P7J A;  1DCZ A;  2K03 A;  3C1F A;  1LO5 D;  3BVM A;  4XYQ A;  2NTS A;  3QIA A;  5ELC A;  1JOK A;  1QJO A;  2A69 D;  1XWE A;  5JPM C;  1GUN A;  2M00 A;  4ABN A;  2JA6 B;  1KLG D;  1RHP A;  1SNP A;  2LS0 1;  4WOR A;  4FF1 A;  1JE4 A;  5FLX L;  1KDB A;  1SNC A;  3TZD A;  2NVQ B;  1KLU D;  1EY0 A;  2OXP A;  1ZYR C;  4KHV A;  1GUW A;  4K2K A;  4KTA A;  1AP0 A;  1A3T A;  4ZUJ A;  1J9O A;  5EKI A;  1LV9 A;  3FVQ A;  3PUW A;  4FO2 A;  3D4W A;  3TZU A;  1IHZ A;  2NB0 A;  5J1Z A;  1KDC A;  1O78 A;  1DZ1 A;  4A93 B;  5KIX A;  4CJ0 B;  3SK5 A;  1BCP F;  2MUY A;  5DM7 3;  5FO9 B;  2JEB I;  1QCB D;  2Z4H A;  2G9H D;  1NCV A;  1X3Q A;  4A3F B;  2NYZ D;  4IUV A;  1EQT A;  1TS5 A;  4PQX A;  5FLX E;  1E2Z A;  5BN5 A;  3CHB D;  3NUC A;  3A7L A;  2CHB D;  1GUT A;  4HED A;  1CHP D;  4P2C B;  4J8Q A;  1SNM A;  2C5C A;  3RUZ A;  5HUR A;  2X69 A;  1FNW A;  1CQF A;  1I50 B;  3M3Y B;  2KEE A;  4RGO S;  1QG7 A;  3D6C A;  4G7Z C;  1Y8P B;  4KKU A;  3FKI B;  3PO3 B;  3ERQ A;  1CFM A;  2AWO A;  2EYP A;  4BY1 B;  1DON A;  4C3I B;  3CQZ B;  1JQY D;  1A2T A;  3KLR A;  5M3F B;  1IW7 D;  4A3D B;  4IAL A;  4KN7 C;  4TQU S;  3CRL C;  2E75 C;  1F77 A;  3D8G A;  3SEB A;  3GTP B;  2NVT B;  2A6E C;  1WD0 A;  3RZO B;  2EYJ A;  3KUP A;  2LFN A;  4NKL A;  3D4D A;  3MC0 B;  1E2V A;  3L3O C;  2HCI A;  1KNA A;  2G9D A;  2F0F A;  2F3W A;  1EY8 A;  1E0B A;  1RTO A;  1AFP A;  1O7Y A;  2XN9 C;  4C3J G;  1S4Z A;  3S15 B;  1TS3 A;  1BNZ A;  3SE0 A;  1BUV T;  5FKA C;  1DD2 A;  3ND8 A;  2VB2 X;  4ZKB B;  2B8G A;  3GTJ B;  1ET9 A;  1Y1W B;  2EYH A;  3NWT A;  1FGB D;  2F0E A;  1GUG A;  4RCO A;  4EQO A;  1O7Z A;  3DEP A;  5E1F A;  1C4Q A;  1RCV D;  5I4D A;  2A6H D;  4OO1 G;  1QWY A;  3NBH A;  3F2U A;  4K5W A;  1ILP A;  3OWF A;  4CJ2 C;  1NR4 A;  2PYK A;  4DAV A;  4NP5 A;  1Y1V B;  3AU7 A;  2EJG C;  2F0D A;  1AZQ A;  1HFN A;  1PMR A;  3MXU A;  5DAU A;  4R8N A;  2F3V A;  5CC4 A;  3PUX A;  3FDT A;  1TWF B;  5FO8 B;  2NBF A;  3L9A X;  5CV7 A;  5CV6 A;  3GTK B;  1ET6 A;  1PXU A;  2F0T A;  1EYA A;  2CW0 C;  2EY5 A;  4FP5 D;  3A8I E;  2F0W A;  1STB A;  2GA4 B;  5EPJ A;  1LLR D;  1PZI D;  1O7L A;  1HFG A;  2K7V A;  1JC7 A;  1EY7 A;  1MSG A;  3NXW A;  5CV4 A;  3HKZ B;  1LTB D;  1HUM A;  5EPL A;  2J0T D;  5C4H A;  4ID6 A;  5CBA E;  4BA2 I;  5IGE A;  2YU9 B;  4DF7 A;  3HOX B;  5G3L F;  1LTA D;  1LT3 D;  5EBD A;  3V2T A;  2EY6 A;  3AB9 A;  1CA6 A;  5A35 A;  4QMG A;  3SK4 A;  1PTO F;  2F0H A;  1I6H B;  4PMB A;  2IW3 A;  3EFX D;  3J7A V;  2M2L A;  3S14 B;  1SNO A;  2BDN A;  3KLS X;  2WIN B;  4IZ8 A;  3EA6 A;  1V8Q A;  3RMH A;  2F4I A;  5IGF A;  3HS0 C;  3MEH A;  2DY7 A;  5C0X G;  5CV9 A;  3PIP 3;  3LWE A;  4C1N I;  1Q8I A;  1X32 A;  1B44 D;  5TSS A;  1GJX A;  2ZT9 C;  1GOZ A;  1HQM C;  3D3R A;  4B9X A;  1CI3 M;  1BXT A;  3K5O A;  1EU3 A;  3GD7 A;  2QF7 A;  1B9N A;  1T5X D;  1VDZ A;  4HMI A;  5C3X A;  2IPK D;  1B53 A;  2SDF A;  1DOM A;  1S5F D;  5C5L A;  3P1H A;  4Y7N B;  4X3T A;  3V05 A;  5D65 A;  2A74 C;  2R3Z A;  1SJE D;  1STE A;  1TWG B;  2SNM A;  1UAP A;  1A3U A;  2KHS A;  2WII B;  4ZLT F;  1R9T B;  3TSS A;  1EZ6 A;  2RSO A;  5C4Z A;  5JJZ A;  2VB3 X;  2KEC A;  4DNR B;  3T56 B;  2O5J C;  3A8J E;  1VMC A;  1TWA B;  1J8I A;  3DWP A;  2PQE A;  3MAQ A;  5I9O A;  3DWA A;  3VR5 A;  1VCI A;  3DXJ C;  1MGS A;  4L6T B;  4ZRZ A;  3GQB A;  5J22 A;  4A3G B;  3A54 A;  4XXE A;  4DN4 M;  3E5S A;  1FNV A;  3BYT B;  3E6Z X;  1Y8O B;  5EKK A;  2RBM A;  5ELD A;  4OHJ A;  3HOZ B;  2E2D C;  3MXP A;  2CQA A;  2L4N A;  2K28 A;  1I4P A;  3R2I A;  2F03 A;  4DA2 A;  4EVO A;  1I4G A;  1SMY D;  2F0G A;  1JOQ A;  5E4W C;  1F9P A;  2PMZ B;  4HAE A;  5C3E B;  1EYD A;  5JAV A;  1I4H A;  2F0V A;  4U67 3;  1D6E C;  5I6W A;  2B63 B;  4KY5 A;  2PZW A;  4A3J B;  2QKI C;  3NQT A;  1CZG A;  2RDH A;  2SOB A;  2NN6 H;  3K0Y A;  2F0I A;  4J6H A;  4KI0 A;  2EZV A;  2VNU D;  2ICI A;  3MTS A;  2K5Q A;  1GUO A;  3GO5 A;  3NWS A;  5I9P A;  2AQ1 B;  1IKM A;  4C3H G;  1BCP C;  4K5V A;  1EOT A;  2JP1 A;  4ILW A;  1KAB A;  2EYF A;  4F88 A;  5C44 B;  2O2L D;  5D3I B;  5LL6 S;  1Q3L A;  3CKI B;  4NMZ A;  1V1P B;  3U9S A;  1EIG A;  4XTC S;  3MVV A;  2TMP A;  1WCM B;  2E2H B;  5M5X B;  2JSO A;  4IUU A;  1A2U A;  1EU4 A;  5A2Q E;  2JE6 I;  1STY A;  3NBI A;  4LJZ C;  2RKS A;  3JAM E;  1SYF A;  5IT9 L;  3DUZ A;  2OT2 A;  2ID0 A;  2XWJ B;  3MXN A;  2F0J A;  4YIJ A;  2I07 B;  4RAU C;  2ZXR A;  4KV6 A;  4FVM A;  1WTW A;  5IGG A;  2BE5 C;  2L9H A;  4FF3 A;  3CRK C;  1YNJ D;  2R61 A;  3PUZ A;  4HCE A;  2K04 A;  3ERO A;  1GXD C;  4RWS C;  4C3I G;  1GUS A;  1QOH A;  4EGV A;  4L8J A;  3DWQ A;  4OL7 A;  2DN8 A;  1W6J A;  1RTN A;  1YNN D;  3FPP A;  1ESF A;  1HPC A;  3N6R A;  1Y8N B;  2VUM B;  2PZU A;  2IX3 A;  2O4X A;  1G29 1;  2JYO A;  2FMM A;  3R3O A;  2ZXP A;  2PW7 A;  4MN3 A;  3PV0 A;  1TR5 A;  4C3H B;  2NN6 I;  1D5M C;  2PW5 A;  4CKC A;  1ZEQ X;  4KJN A;  4CBV A;  5I2Y A;  2QIL A;  4NW2 A;  2A68 D;  4IFD H;  3R8B A;  1RD9 D;  5E4X A;  1LAB A;  4FXD A;  1V1O A;  2JA8 B;  1L0X B;  1STH A;  4IFD J;  1I4Q A;  3SDZ A;  1EEI D;  1TS2 A;  4RCN A;  1DXM A;  2RQX A;  4G7O C;  4BY7 B;  1A3V A;  2D2C C;  5EKL A;  2D62 A;  5C4J B;  1S5E D;  1SEB D;  4RGM A;  5JEA H;  1OXT A;  3VYR A;  1TY2 A;  3A7A B;  5JEA J;  1XX8 A;  3BVZ A;  2EY2 A;  1NUC A;  4IUP A;  1HTL D;  1WTO A;  4A3E B;  2SNS A;  2PPB C;  1OXV A;  2A5H A;  5CBE E;  1HRJ A;  1F2L A;  1SE2 A;  3IAY A;  4DXF A;  1SYG A;  1ZXT A;  4O42 A;  2HDL A;  4C2M B;  3BS1 A;  3BG3 A;  4IUR A;  2EDG A;  3K5N A;  2J7Z A;  4RHS A;  4XQN A;  4FF2 A;  3K6O A;  1LAC A;  3CU7 A;  3VYT A;  1JWS D;  4XIG S;  2FIN B;  3TME A;  1FD7 D;  1TY0 A;  3K59 A;  2KVM A;  3BDC A;  1RF2 D;  1OXU A;  5EGT A;  2IL8 A;  3FMC A;  2K1B A;  4TRD A;  1PTO C;  4O1N A;  3TBI B;  4TKO B;  3J80 L;  1TWH B;  2EJM A;  3GTO B;  4CKE A;  3TP5 A;  3VR4 A;  2Z1C A;  3KLS A;  1G91 A;  4IFD I;  4BBR B;  1M4V A;  2L11 A;  3RLF A;  2R7Z B;  1CK1 A;  4CJ1 B;  1FNU A;  1LT4 D;  1RKN A;  4A3B B;  2O5I C;  1F9S A;  1NSN S;  2EJF C;  1F2M A;  1CTM A;  2L5T A;  1CHQ D;  3IFD A;  3S9W A;  1PRT D;  3QO2 A;  3I4L A;  1ESR A;  3FEW X;  4RA8 A;  2A69 C;  1S5D D;  3IFT A;  3H6M A;  2EYO A;  1D5Z C;  1PRT B;  4Q5V A;  3W2D A;  1MBY A;  2B2V C;  5ISR A;  2B39 A;  2BA0 A;  4EQN A;  2M9V A;  3ZYY X;  1V1P A;  4UAI A;  3H0G B;  3VR3 A;  4FXK C;  3H94 A;  5NUC A;  5KYI A;  2B2T C;  1WTX A;  4BBS B;  3X3N A;  4Q0F A;  2XNA C;  4U68 A;  4HSP A;  4S3S A;  5IGB A;  1NAP A;  1SYB A;  1OXX K;  1EY9 A;  3D6W A;  1EY4 A;  2WAC A;  2L1B A;  2F0S A;  3RZD B;  2NZ1 D;  2K05 A;  3H09 A;  3IL8 A;  3P20 A;  4OIJ A;  1HCZ A;  2DNC A;  4KJO A;  3NSW A;  5KYL A;  2EOT A;  1LTS D;  5ELE A;  1XXG A;  1Z7T A;  1TT2 A;  4A3M B;  2X6L A;  1CM9 A;  1SYE A;  5T1I A;  2FJ2 A;  3OIP A;  3M4Y A;  1C8C A;  1M8A A;  2MPM A;  3VR6 A;  1ILQ A;  2JA7 B;  2Z8L A;  5COY A;  2LY7 A;  2B2V A;  1Z6H A;  1EIH A;  1JR0 D;  3WDN A;  1L0Y B;  1G2S A;  2EPB A;  5KRU A;  4AYB B;  2F0N A;  1A6X A;  4K8J A;  4DGZ A;  5JVG 3;  2B2Y A;  2B2T A;  2OEO A;  1DOK A;  4KHZ A;  4CHT B;  3GTM B;  4K8I A;  4KY7 A;  1ZKO A;  3K7A B;  4H7B A;  1IW7 C;  5KNC A;  4DAP A;  3OPO A;  5EJW A;  1AW7 A;  1STA A;  3TDQ A;  3T13 A;  1Y69 U;  3KF8 A;  2RDF A;  1CQV A;  2RA4 A;  4NDX A;  4L63 B;  1ENC A;  3NP8 A;  5COR A;  3C46 A;  3W3A A;  4E6I A;  2E2J B;  4ODG A;  1U4M A;  1X3P A;  2F0U A;  2XVS A;  5IIF A;  1F9Q A;  1LTR D;  3KBG A;  3NQI A;  2XIW A;  4LMQ D;  5CV5 A;  1HXY D;  1Q90 A;  2DY8 A;  1SYC A;  1ZYR D;  2QEJ C;  1ML0 D;  4F7X A;  5KNB A;  2ZXO A;  3LWU A;  4J1M A;  5JPN C;  1WTQ A;  3H3V C;  1TU2 B;  1AZP A;  3VYU A;  3OMC A;  2L55 A;  3Q22 A;  5I6Y A;  1B1Z A;  1FYC A;  3MXG A;  3HEJ A;  3A56 A;  2K01 A;  1D1K A;  1K83 B;  3S16 B;  4H44 C;  4PV1 C;  5ELF A;  3C1E A;  1PFN A;  2A6H C;  2F0L A;  1WTR A;  1EWH A;  2MGS A;  5KGU A;  3MFY A;  2XRS D;  1FR3 A;  1MD2 D;  1I6V C;  1Q1E A;  4HR7 B;  1DYQ A;  3S1R B;  3I4N B;  1S5B D;  2D9U A;  1MSH A;  4FNF A;  4KD3 A;  1TS4 A;  5DM6 3;  1TKW B;  1TWC B;  1VF5 C;  4GZY C;  5JVH 3;  5K36 H;  4KY6 A;  1IL8 A;  3ITP A;  4Z9C B;  1KTK A;  3J7Y W;  1BOS A;  1R4Q B;  5KEE A;  1NR2 A;  2KUM A;  4WJW A;  1HUN A;  3NTI A;  4WFN 3;  1V43 A;  3E0J A;  3R93 A;  3T51 B;  1BF4 A;  4UDU C;  4K5X A;  4R9W A;  4ZUI A;  4F8M A;  2YYZ A;  2MJ8 A;  3S17 B;  1CZW A;  2XRQ D;  5E3F A;  4HCS A;  3I91 A;  3GV3 A;  3BDO A;  3O13 A;  3KBX A;  1PZK D;  2AUJ D;  1B50 A;  1VF7 A;  1EFI D;  2AWN A;  1PFM A;  2A6E D;  3C2P A;  1E2W A;  4HMJ A;  3I8Z A;  1R4P B;  4PMW A;  2SEB D;  4R8I A;  5EBC A;  3FPU B;  4DAY A;  3GV6 A;  2Y0S B;  4C56 C;  1H9S B;  1UNS A;  3OW7 A;  1S5C D;  2RVL A;  5D14 A;  2R6G A;  3A55 A;  5KND A;  1OO9 B;  2Q8R E;  5DEH A;  5LHY 1;  4X3K A;  5D3D A;  1DJR D;  3GTL B;  1H9M A;  1GHJ A;  5FOB B;  3ND9 A;  4DNT B;  3SK8 A;  4LAA A;  1F2Z A;  3D31 A;  2KCN A;  5CV8 A;  3I4M B;  3KK7 A;  3HG9 A;  2ICE C;  3M7N A;  1PRT F;  2LKV A;  5K36 G;  5I2X A;  1HHV A;  3MFG A;  3OHX C;  4BA1 I;  5BN4 A;  1ONL A;  4V19 0;  4BS9 A;  1EWC A;  2RSN A;  2NN6 G;  2IWH A;  1EQV A;  4XT3 B;  3QOJ A;  4H0L C;  1LTI D;  1LTG D;  1G8Z D;  3K57 A;  2EVB A;  2HDM A;  4RH6 A;  3SR1 A;  5IGC A;  3SVM A;  5C6A A;  1EZ8 A;  1SJH D;  5IT9 E;  1IYV A;  2JEA I;  5CMD A;  3I72 A;  1SAP A;  3S1N B;  4ME5 A;  3Q0A A;  4FXG C;  4M1U B;  1XTC D;  2CW0 D;  4QB4 A;  2Q8I B;  1SE4 A;  3K58 A;  1B3A A;  3I73 A;  3U9O A;  2B2U A;  2K5D A;  1WTV A;  3PUV A;  3TP8 A;  2K6A A;  4LK1 C;  2J4X A;  4DU9 A;  4A3I B;  2WB1 B;  1PYW D;  4A3K B;  4N9P A;  3HOW B;  1CT1 D;  1I4R A;  1JOO A;  1STG A;  4K2L A;  4ZYS A;  5EPK A;  5FO7 B;  1HQR D;  4OGQ C;  1STN A;  2WAQ B;  4XDX A;  4RFB A;  2FFK B;  1UEA B;  1U9R A;  4PNY A;  3QB3 A;  1U4R A;  2EE1 A;  1KDA A;  3HOV B;  2NUC A;  3HZX A;  3MZ5 A;  3BYY B;  2PO4 A;  3PUY A;  1JB3 A;  2MHV A;  1D1I A;  1SMY C;  2HQE A;  3K5L A;  3GTG B;  2WKC A;  3SK6 A;  2H4O A;  2ENB A;  1JIC A;  2KCC A;  4IUT A;  1BQQ T;  1T5E A;  2RDG A;  3MA2 B;  4OO1 H;  3K5M A;  1EY5 A;  2HCC A;  3URY A;  1O80 A;  1Q12 A;  2N55 A;  5FK9 C;  4B08 A;  2DNE A;  3A8K E;  3OSO A;  2K5W A;  1SSO A;  1QE6 A;  4G7H C;  4JK1 C;  5C3W A;  5M5W B;  2KA7 A;  3C3L A;  2R93 B;  3J7A F;  1TQO A;  2HUG A;  5EQ0 A;  2PNR C;  1UUP A;  1BR9 A;  1SDF A;  4IFD G;  1HA5 A;  5K5P A;  2AUK A;  1U4P A;  3NHH A;  2XWB B;  1C48 A;  3QWN A;  5M9O A;  3T53 B;  4M8A A;  3BVG A;  2EXZ A;  5F2D A;  4WRD A;  4C1N K;  1ICW A;  3NE5 B;  1LT6 D;  1TII D;  3I70 A;  1SYD A;  2C9O A;  4XQJ A;  5JEA G;  1Z47 A;  4EQP A;  5ELB A;  3P75 A;  3V96 A;  1QNK A;  2NVX B;  1JWU D;  5M3M B;  1G6Z A;  3OIQ A;  4IUQ A;  3VR2 A;  3I3C A;  2JA5 B;  3M7G A;  2N88 A;  5C5M A;  4KK7 A;  1SNQ A;  1YNJ C;  2F0O A;  3H91 A;  1K8O A;  1W6K A;  3AMU A;  3S1Q B;  1QB5 D;  2E74 C;  4QCL A;  1SFO B;  3OWE B;  1AN8 A;  1H9R A;  2FHT A;  2Z4I A;  1GHK A;  2OF1 A;  2PCF B;  3S2H B;  3MHB A;  3J80 E;  3WOE A;  3J81 L;  3QG1 A;  1YNN C;  3HRZ C;  1II3 A;  4RKL A;  1HTP A;  2B2Y C;  1F2Y A;  4KMU C;  5C0X H;  3LX0 A;  3T16 A;  4RHR A;  5C0X J;  3MWY W;  5CGK A;  5AFW A;  4FYD A;  4OO1 I;  1H9S A;  1H9J A;  4OIK A;  2Q8T A;  1QNU A;  2WKD A;  3SXH A;  4I7Z C;  2D5D A;  1SXT A;  3EJI A;  4MHE A;  3T4A C;  4KN4 C;  1IYU A;  3EQL C;  2QCP X;  4RGT A;  3PO2 B;  4ZAI A;  3OOC A;  4KKS A;  5IOD A;  5CYU A;  4G4K A;  2A68 C;  3VYS A;  4ZK9 B;  3Q24 A;  3N52 A;  4XYO A;  1BDO A;  5DNF A;  1AEX A;  1ENF A;  3S2D B;  1BCP D;  1SND A;  4N9T A;  3RD4 A;  2KED A;  1IKL A;  4C3J B;  1Q1B A;  3J81 E;  4K6L A;  2WP8 J;  2AQ3 B;  2MP1 A;  3TP6 A;  5IOC A;  4QF4 A;  1BCP B;  5JOB A;  4QIW B;  2F0K A;  3OMG A;  2F0M A;  1QIL A;  2KOL A;  4JBW A;  5LL6 X;  2NVY B;  2EYM A;  3EVQ A;  1G2T A;  3PIO 3;  1RDP D;  1DOL A;  2B2W C;  4DFA A;  2A73 B;  1EY6 A;  1PTO H;  2IT1 A;  1RJT A;  2V4D A;  2EYL A;  2R92 B;  2BE5 D;  2L0C A;  3X3M A;  1I3Q B;  3DEO A;  4DK0 A;  3NK9 A;  1K8M A;  2BOS A;  3DM1 A;  2IX0 A;  5C0X I;  2TSS A;  2L12 A;  4PMC A;  5M5Y B;  3HP3 A;  3GP7 A;  1PDQ A;  1CA5 A;  1PFB A;  1LT5 D;  2E76 C;  1JOR A;  2B8F A;  1MI2 A;  2KJX A;  4QUC A;  1OXS C;  1LTT D;  4ULL A;  3WOF A;  5HGT A;  2BA1 A;  5J39 A;  1BBX C;  3UI2 A;  4QUF A;  2NTT A;  3NPP A;  4IQZ A;  4HSV A;  1I4X A;  2B2W A;  4K6D A;  1SE3 A;  4G57 A;  4DXG A;  3HGB A;  3FRP B;  1B9M A;  2BCO A;  1PRT C;  1TVX A;  4KD4 A;  3S1M B;  4HN7 A;  5T1G A;  1PLF A;  1ENA A;  1B4O A;  4F87 A;  4ZQ3 A;  3D4R A;  1D2B A;  2WV6 D;  2K33 A;  4H13 C;  4BWG B;  1WD1 A;  4B9W A;  5CR3 A;  4XQQ A;  3BZD B;  2IJ0 A;  1D5X C;  1PZJ D;  3NTK A;  3QOL A;  1ROD A;  2K32 A;  1KNE A;  3I90 A;  2LMC B;  3PMF A;  1VMP A;  5BN3 A;  2XSC A;  1U4L A;  2JXM B;  1KAA A;  1EYC A;  3G6J B;  4HTH A;  2VXW A;  3HOU B;  1JCK B;  3VA7 A;  1SBB B;  3TN2 A;  2F0Q A;  3IKJ A;  3Q6S A;  1HA6 A;  3QJY A;  2QDB A;  5A2Q L;  1F9R A;  4KKT A;  1A15 A;  3ONA B;  1JWM D;  3JAM L;  4IN3 A;  3DMU A;  3GTQ B;  1BO0 A;  2H1E A;  3DHQ A;  2BDO A;  3BDL A;  1EEF D;  3NTH A;  2EY1 A;  4RGN A;  3G7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...