4HMJA

Crystal structure of staphylococcal nuclease variant delta+phs l36d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmjA00
5IGFA 3PMFA 4QMGA 4K2KA 5IGDA 3BDLA 1STGA 2PYKA 3NK9A 1EQVA 2F0KA 2PZWA 1A3TA 3EVQA 4QF4A 3QOJA 2EYJA 4S3SA 5EKLA 4DFAA 4DGZA 4EQPA 4QB4A 1A3VA 1KDCA 2HQEA 3QOLA 5IGCA 4K8JA 3SK4A 2ENBA 3S9WA 4DU9A 4DF7A 3QB3A 2KHSA 1SNQA 2NUCA 3SXHA 5C5MA 2F0WA 4KJNA 5C4ZA 2OXPA 1EY6A 5KIXA 4NMZA 3MHBA 5C3XA 1EY5A 1SYDA 2EY6A 2EYPA 1F2MA 4NDXA 4ZQ3A 5KEEA 5C5LA 5CV4A 1SNOA 1KAAA 2F0MA 4ID6A 5M9OA 2SNMA 4KHVA 4KV6A 3DMUA 2PZUA 5CV9A 1RKNA 1U9RA 3TMEA 2F0GA 2OF1A 4RKLA 1SYBA 5IOCA 5KGUA 3RUZA 4PMCA 2F0LA 2F0JA 3ITPA 3MEHA 1TR5A 5IGGA 3D4WA 1A2UA 3SR1A 2EY2A 3MXPA 5K5PA 2PQEA 5CC4A 2RDFA 4HMJA 3NP8A 4IZ8A 1JOOA 3SK6A 1STHA 5E1FA 3T16A 4N9TA 5KRUA 4F8MA 1A2TA 5I6YA 4K8IA 3DHQA 2F0VA 3C1EA 4PNYA 2RBMA 3D4DA 3MVVA 4K6DA 5E3FA 5I6WA 3R3OA 2EY5A 4R8NA 2F0PA 2SNSA 5CR3A 1TT2A 4NKLA 1SYFA 5C4HA 5JAVA 4J6HA 2EYLA 2F0FA 4OL7A 4WRDA 4YIJA 3TP5A 4EVOA 5C3WA 2F0TA 3MZ5A 4NP5A 5JOBA 4HMIA 3ERQA 3OSOA 4ODGA 5CV8A 1EY4A 2RKSA 3U9OA 2F0DA 2EY1A 2F3VA 5F2DA 3SHLA 3TP6A 5I9OA 5ISRA 4KD3A 4N9PA 1SYEA 4K5WA 4ZUJA 3H6MA 3NQTA 4LAAA 5HGTA 1F2ZA 2F0OA 5IODA 3D6CA 4KY7A 2M00A 5I9PA 3EROA 1EZ6A 1F2YA 1KDAA 2QDBA 4KD4A 5CV7A 4PMBA 2F0EA 1SNDA 1EZ8A 5HURA 2O4XA 3HEJA 1STAA 4B9WA 1EY9A 4HTHA 4ME5A 3VA5A 2EYFA 1NSNS 3TP8A 2PZTA 3NHHA 3SK5A 5EGTA 4J1MA 1EY7A 5CV6A 4K5VA 3SK8A 5IGBA 4TRDA 1ENCA 4IALA 4K2LA 1JORA 4E6IA 1SNPA 2EYHA 3NUCA 5KYLA 5IGEA 5DEHA 3T13A 5J1ZA 3TP7A 4K5XA 5J39A 2F0SA 3OWFA 1NUCA 2F0QA 4I65A 5IIFA 2EXZA 1EYCA 2PW5A 1AEXA 4KY5A 1SYCA 4EQOA 2F0IA 5J22A 1STNA 3C1FA 4KY6A 1JOKA 3BDCA 5DAUA 4B9XA 1EYDA 5CV5A 3P1HA 3E5SA 2LKVA 2F0HA 2OEOA 3OMGA 4WORA 1JOQA 4EQNA 1KABA 3EJIA 1EY0A 1EY8A 1A3UA 1KDBA 3D8GA 1II3A 4G57A 4IUNA 2F0UA 3P75A 1IHZA 2KQ3A 3OMCA 4RKBA 5C6AA 1STYA 2F3WA 2PW7A 2SOBA 4K14A 5NUCA 1SNCA 1ENAA 1EYAA 1SYGA 2EYOA 3HZXA 2F0NA 1SNMA 3NXWA 3LX0A 4H7BA 4KTAA 4F7XA 5CGKA 4MIUA 5EKKA 2WACA 5KYIA 1TQOA 4ZUIA 2EYMA 4KJOA 1STBA 3V2TA
chains in the Genus database with same CATH superfamily
1DOLA 1JE4A 1EUJA 2UUAQ 1FJGL 3CF5A 1KRSA 5C44G 5JEAJ 4LK1C 3HOUB 2JA8H 3S16B 4POFA 1WTHA 4JI6L 4U68A 4OHJA 1F2LA 1MI2A 5GQOA 5COYA 3A8IE 3HOYB 5BN3A 1R9TB 1DJRD 1E2WA 3CC4A 1G2TA 3J80E 1WD1A 3IKJA 2R7FA 2WAQB 2YU9B 1TS4A 1VQ7A 4KV6A 4DR2Q 4JI3L 3F2UA 2RHQB 1A15A 4P75A 4IPGA 2DNCA 1EWIA 2JSOA 4A3JG 1K83H 1QJOA 2EY2A 1CKMA 2PQEA 1GUGA 4A3FH 2DGYA 4R4QA 4KKSA 5FLXc 4CKCA 2ZTEA 3D4DA 1IYJB 4C1NI 1XMOL 2EYLA 1PH6A 2I5LX 3G6EA 2J7ZA 1XNRQ 4NPSA 3TP6A 2GN5A 1LT4D 4KD3A 3TRZA 2NTSA 1QNKA 5IODA 1Q3LA 1Q81C 1WTVA 1F9SA 1X65A 4GLVB 4DV5Q 1AW7A 1JT8A 2EJGC 2NVYB 1J8IA 1VQDA 3S2HH 2L55A 1N8RC 3TP8A 3A5ZB 4TRDA 1TWFB 3R2IA 1XJVA 3FMCA 5KYLA 3W1GA 5J39A 1P16A 4DK6C 4JI0L 2N49A 2OCEA 3OWFA 2F0QA 1I50B 2LXJA 4LMQD 3KDFB 4HCSA 3VYTA 3H15A 4X3UA 4F87A 3DLLA 1EYDA 1H9SA 1M1KC 5C0XH 1JB7A 2EIFA 1KDBA 1TXYA 3NBHA 1IHZA 5I2YA 5IWAQ 4X62L 1NNXA 4X62Q 1EQTA 4BY7G 1JR0D 2UXCL 2UXCQ 2N3SA 2F0NA 3AMUA 2RVLA 3F1ZA 4OO1H 5GAHC 2F0KA 3K5OA 4QB4A 4V190 4GNXC 1PZID 1LT3D 4KHPQ 1PMRA 1HRJA 4JBWA 2KHSA 2NUCA 3SXHA 2O5IC 1VQLA 1DXMA 1GUNA 1VQAA 1BBUA 3KOJA 4HAEA 1TWHH 4TQUS 3I55A 4JOIA 3T56B 2ES2A 1SFOB 3OIQA 1C0AA 2RF4A 4QJFA 3SEBA 4P2CB 4A3BB 3S1MH 2LSSA 2A6HD 4A4IA 4JYAL 4JYAQ 1BKBA 2UXDL 3MXPA 4RGMA 1K8GA 5E1FA 4HCEA 2LMCB 2RSNA 3GV3A 2F0PA 3KJOA 1YJ9A 3H09A 4A3GH 1AZPA 1GUTA 2KJXA 4POGA 4ZCKA 2MUYA 4CDFC 2Z4IA 4FXKC 4ODGA 3BDOA 1TY2A 3W3AA 2NVXH 5E4XA 4GOPA 2IX1A 1JB3A 3IL8A 3S17H 2I07B 2B29A 1XPRA 2L15A 1PA6A 3TS0A 2PPBC 2B2WA 3A74A 3NENA 1JMCA 1Q7YC 3DXJC 1EZ8A 2NVQB 5IP9G 4KK7A 1ML0D 1CKNB 3GTMH 2F4IA 1A0IA 4C3IG 4K5VA 4DK0A 2D2CC 4LF5L 1IBLL 3S1NB 3UDFA 2FXQA 1IBLQ 1C9OA 1Y8NB 3HKZG 1SSOA 4LNQA 4YCWA 5D3IB 3HKZE 3RLOA 1GM5A 3HOUH 3S16H 5JVG3 1ESFA 5DAUA 1K0SA 1M8AA 1G2SA 1HA5A 3HOYH 1R9TH 2E8GA 1CFMA 2JEAI 1STYA 5A35A 2K28A 5NUCA 4Q0FA 2YU9H 1EYAA 2JEBI 4F7XA 1XTDA 4V0BA 3PQIA 2R7ZB 1WTQA 3L3OC 4L6TB 3OYYA 4A93B 1LTAD 3O13A 4QMGA 5GAGC 2BE5D 2X69A 1AZQA 1N33Q 1WCMB 4QF4A 5IYDH 1KDCA 4AYBG 2HQEA 4K8JA 1LTTD 1LUZA 1O78A 4AYBE 4DR1L 3UE1A 2KHJA 3TSSA 2D9UA 4IOCA 1EY6A 4YCUA 1EY5A 1UEAB 1F2MA 4K6LA 5FJ8G 5K36G 4FXGC 2ZM6L 3I3CA 3GTOB 2ZM6Q 3KF6A 4A3DH 4LUVA 4ID6A 4FYDA 3DMUA 4OGQC 1G6PA 4GKKL 4DPGA 4BXXH 4GKKQ 1XTCD 3RD4A 1XYIA 3J80i 1AH9A 2KCCA 3PO2B 1NE3A 1RTNA 2WKCA 3DHQA 2FJ2A 1UE6A 1TS5A 2EE1A 3M7NA 3S1QB 3R3OA 1UE1A 2PI2E 1TWFH 4XQJA 1E1TA 4JBMA 1YI2A 2B2TA 4WRDA 5LL6S 4DV2L 5JOBA 1I50H 2Z4HA 1W3SA 3A5UA 5F2DA 3UDGA 1FNWA 4HJAA 5IYBG 1YIJA 2JJQA 5EBCA 1L1OA 2PMZE 2NZHA 4KY7A 3D0FA 3PO3B 2ICIA 3TZDA 2B2WC 3NWTA 5BR8L 3FKIH 1SBBB 1PFBA 4A3JB 3SK8A 4DR5L 1EWCA 3M4OB 4K2LA 1TWCB 2G9DA 2XRSD 3QO2A 2EYHA 2K5HA 5EBDA 5IIFA 2DUDA 2C5CA 3K7UC 1KTKA 2ZJQA 2VXWA 4WORA 5A2QL 1G8ZD 3D8GA 5IYCH 2UUCL 1B4OA 2CWAA 2UUCQ 1ASYA 1F9RA 5FO8B 4BY1B 2SEBD 1EIFA 1HNZL 3MXNB 4DXFA 4ZUIA 4A3BH 2XSCA 2KCTA 4RG1A 3DWAA 5FO9B 4FNFA 4EQPA 3FDTA 1OXUA 1PYBA 1V1PB 4CJ0B 1TKWB 3ULJA 2Y0SG 1PTOB 3SVMA 2OXPA 4XT1B 4FDBA 2Y0SE 1EOVA 1LTGD 2EYPA 2EVBA 2DJGC 3E6ZX 1KNEA 2JA5G 1DOMA 4C3JG 1KAAA 4JI2L 1WD0A 2PZUA 4RWSC 4JI2Q 1QILA 1U4MA 3H0GG 4R8IA 2HT1A 3H3VH 1WOCA 2RSOA 3A55A 2MO0A 2NYZD 2AQ1B 3HKSA 4DV7L 2NVQH 3TREA 1PH4A 3GTLB 1XWEA 4K6DA 1SYFA 2RCFA 3S1NH 4C2MB 4NXMQ 2K05A 3OW2A 2VUMB 1RODA 1B3QA 3T1YL 3T1YQ 2NZ1D 2N88A 4ZUJA 4GLAC 3BZDB 4IO9A 2E2IB 3D6CA 4AIMA 1RD9D 4RHSA 4ABNA 4BA2I 1L1OC 5EPKA 3C3LA 1ENFA 1VQJA 1U0LA 3A7AB 3J81L 4G7OC 2O4XA 3UI2A 2K14A 3M4YA 1QCBD 4OWXB 4ME5A 4DAYA 1ZYRC 3TQYA 1YHQA 1B70B 2EPBA 2X6LA 3H3VI 3IFDA 3NUCA 1LTLA 4YWMA 5IGEA 5J3BA 1WCMH 2PW5A 4A3EG 2I0QA 2A73B 3PF5A 2A74C 3R2TA 3JAML 4YCVA 1JOKA 3MFYA 2IPKD 2FMMA 3I4MH 1HNWL 5KNCA 2IX3A 1K83B 3ER0A 1QE6A 3P75A 4A3FB 4X65Q 1HZ9A 1Y8PB 1GOZA 3D4RA 2JK8A 1FL0A 4H7BA 1NCVA 1EYGA 3GTQB 1ILPA 5EPJA 1ICWA 4H13C 1G6ZA 2OWOA 4IUTA 4X66L 4K2KA 4X66Q 2PYKA 4BBSB 1SJED 5C0XJ 5DNFA 3PO2H 4C3IB 2ALYB 2K7VA 1GUWA 1HR0W 4FO2A 3S1QH 5C5MA 1PHJA 4EX5A 3MHBA 2L11A 2F52A 1CHPD 4B08A 4AQYL 1EIGA 4KHVA 1CQVA 3I73A 1U9RA 2F0GA 1IBKL 3VR6A 1IBKQ 2KA7A 1PH8A 2K5DA 4UP9A 3FP9A 3M3YB 5LMUQ 2BDNA 3EFXD 3U4ZA 2CH4W 1B44D 3J7ZC 4A3JH 5GAEC 5FLMG 3M4OH 2OT2A 4AYBB 2K03A 4YIJA 4CKBA 1I4RA 1B3AA 1X6OA 1EIYB 2F0DA 3SHLA 3VA7A 5E7NA 1LTRD 1D5XC 1PH1A 4LAAA 3NWSA 2L1BA 1VQHA 3NEMA 1DGSA 4X6AH 3G71A 1Y69U 2A69D 2GVAA 1D5MC 2QDBA 4HSVA 1KL9A 2QKIC 3WOEA 1T5EA 4QCLA 1OO9B 4BY1H 3T53B 4HTHA 3NTKA 3STBD 1PLFA 4A3LG 2BOSA 2F4VL 2F4VQ 1Q90A 2VZAA 3CPFA 1JORA 4LF4L 1DONA 3HOXG 4LF4Q 4A3MB 4I65A 1NTGA 2H4OA 1D1IA 4X3TA 4IUUA 4B3ML 4B3MQ 3CC2A 1SJHD 3FHWA 3M85A 2TSSA 5CV5A 3LNNA 1SEBD 1PTOH 2OTJA 1TWGB 4EQNA 5AJ3L 1X32A 2EOTA 5AJ3Q 1I94L 4CDCC 1YNND 2F3WA 2PMZB 4ME3A 4P72A 1Y1WG 1PFMA 4GZYC 1LABA 1MJCA 3CCRA 1N9WA 3ULPA 1EU3A 3VYSA 3PUVA 4A3GB 3GD7A 1IKLA 5ELOA 4DV6Q 3V05A 3C46A 3HOZG 5A2QE 3G4SA 1X3EA 5M3FG 4DFAA 3D6WA 1SROA 1HPCA 4MHEA 2JA7B 1YJNA 1GHKA 4A3KG 3GTLH 1DCZA 1Q8KA 3U9SA 3PUZA 1PRTB 2PNHA 4R1JA 5C4ZA 1B9MA 4B3SL 4DR7Q 3BS1A 5FKAC 2VUMH 3PIO3 3NBIA 1XMQL 1N36L 1SNOA 1YZ6A 1N36Q 1GO3E 4HIMA 1TU2B 1O7IA 2PQAA 1EFWA 2NVTH 3AU7A 2E2IH 4JV5L 3RUZA 1IBML 4GS3A 3ITPA 1CSPA 5CMDA 4GNXA 1IBMQ 1FJGQ 4C3HG 3VDYA 4ALPA 4DAVA 2VB2X 5CC4A 2RDFA 4MZ9A 4OWWB 1N32L 2K50A 4JCVE 1L0WA 1N32Q 4XXEA 2B2UC 4JI6Q 2AWOA 2F0VA 1J6QA 5JVH3 1BVSA 3MVVA 1ESRA 3VR4A 2K5WA 4UP7A 3T4AC 3TP5A 1XPUA 3GTPB 1CK1A 5CV8A 1SMYD 4DUYL 3HP3A 1SDFA 5I9OA 4KLKA 3JC66 4JI3Q 3H91A 2YTXA 1B53A 4A3IG 3BVZA 3TBIB 1CA6A 5C3EG 4HIDA 3A8JE 2JA5B 5EAYA 1F2YA 4C3JB 1NBWA 4P73A 1YNXA 2BA0A 3H0GB 5HURA 2K52A 1HH2P 1DOKA 2XVSA 3GTQH 2HCCA 3EA6A 4J1MA 5CBEE 4XDXA 1M4VA 1XMOQ 1ENCA 1HUMA 5DM73 5IP9H 4BBSH 4K5XA 1EYCA 1PV4A 4TSSA 4A3DB 2JXMB 4C3IH 1UE7A 4JI1L 5J22A 4JI1Q 5FK9C 1TY0A 1VQ4A 2KCMA 2AUKA 2DJFC 5HY6A 3J81E 2K5VA 4DR4L 3IRBA 1VQ6A 2AWNA 2B2YC 2UUBL 2ATWA 4DR4Q 1I4QA 2UUBQ 1SE4A 1PTOC 4NB3A 1U4PA 4RKBA 2NN6G 2SOBA 3CCJA 1LTID 1SYGA 3LX0A 5CGKA 2WACA 1B2TA 1R4QB 4JK1C 1VQMA 3OHXC 2ZXPA 4DNIA 2XIWA 2E76C 3QG1A 3JAME 4KI0A 3K5LA 3NTIA 4JI0Q 3I56A 2OQKA 3X3NA 2R92G 2ZJRA 2P5ZX 4PG3A 3M3YH 2HDMA 3PV0A 3QOLA 2K1BA 5IP7G 5LL6X 1EEID 1Z6HA 2Z6KC 2DN8A 4KN4C 2V1CC 1PRTD 4R4IA 5C4XG 3HRZC 1CQFA 4ZQ3A 1S72A 1I3QB 1AE3A 1EU4A 1WYDA 3FKIB 1W6KA 2Q8RE 4C56C 2JA6G 1FR3A 2B63G 5KGUA 4RKLA 5FJ8H 1JWUD 2Q2IA 2F0JA 1KRTA 1TR5A 1EQRA 1I4HA 3B6YA 2QEXA 2A69C 3SK6A 4WFN3 3T16A 2IJ0A 1VDZA 2I5MX 3C1EA 4PNYA 3CCMA 4IPHA 3STBC 1LT6D 5JPMC 3H94A 3W1BA 3CD6A 1DM0B 1NR2A 4A3MH 3S15B 3V96A 1A62A 1VQIA 3K59A 4QUCA 5ISRA 4N9PA 3H6MA 3J81j 3KLRA 4HJ5A 1GHJA 3CMAA 1TWGH 4I7AA 1KNAA 2UXDQ 3NE5B 4RH6A 4PMBA 4PZ6A 3DM3A 1GKHA 4OEMB 1YNNC 2E2HB 3M9BA 1PH5A 4X3KA 3PCOB 5IGBA 4GN3B 3HGBA 3NQIA 2B8FA 4KN7C 5BN4A 5I4DA 4ZAIA 1YJWA 2F03A 4B3TL 2I5HA 4QGUA 1CZWA 3HS0C 4KY5A 1SYCA 2BCOA 4QY7A 2JA7H 5ELCA 1ET9A 3OMGA 2KVMA 2FMCA 1SE3A 4DV4L 1K9MC 2E2JH 2PW7A 3HFZB 2WB1G 2WFWA 3K8AA 4BBRG 1Y1VB 2ID0A 4KTAA 2VY3A 2IT1A 2WB1E 3P20A 3K5MA 1TQOA 4IFDG 3GO5A 4LF5Q 1UUPA 4R4TA 2L4NA 1L0XB 3ICEA 5E4WC 3GTKB 1VQEA 4RCNA 4A76A 4MTKA 4JG2A 4DU9A 2EDGA 3BG3A 3KBGA 4EGVA 1ET6A 3PUYA 1H9KA 1ZYRD 2WP8J 1YNJD 3GTPH 1HTPA 1LT5D 2K04A 1VQ5A 1EWHA 1PH9A 1SMYC 3QWNA 4GLXA 1X3GA 3PF4A 3MXUA 2F3IA 4CJ2C 5IGGA 2JA5H 3CXCA 4C3JH 4DAPA 3PIP3 1LTBD 1K8MA 4IZ8A 1NR4A 1STHA 3H0GH 1B7YB 1Q12A 1A2TA 4DR1Q 1KXLA 3I4MB 2XNAC 1MHWC 2CVRA 4P71A 4GN4B 4HSPA 3HOZB 5M3FB 4EVOA 5D14A 3MC0B 1KLUD 3CMEA 1JWMD 1Y14B 4G7HC 4A3KB 1WTOA 2BH8A 4JBKA 3LWEA 3J80c 1PXUA 4IUPA 1XNQL 1DZ1A 4FXDA 1KQSA 4DN4M 5CV7A 5DLQE 2MQHA 1TVXA 3K80C 4OO1G 5FO7B 1XXGA 1IYVA 1BR9A 4C3HB 2X6GA 3SK5A 3NHHA 5C44B 5EGTA 4L5RC 3F8TA 2D62A 3S14B 1K8OA 4M8AA 4JI7L 1SNPA 5IT9L 5DEHA 4DV2Q 1J9OA 3KDFA 4OX9L 1VMPA 2D5DA 2MNAA 4QIWE 1W2BA 2PO4A 5LMNL 5D65A 2MFIA 5LMNQ 2J0TD 3OOCA 4KY6A 3BDCA 1X54A 2AKWB 4QQBX 4LF7L 3VR2A 4LF7Q 1A3UA 1PRTC 2K6AA 1E24A 3BZCA 3J81c 4ZK9B 2QF7A 1I3QH 4DR6L 5BR8Q 1HHVA 4DR6Q 2EYOA 3HZXA 3KUPA 3NXWA 3J81i 3Q24A 4OIJA 5JPNC 4DR5Q 2UXBL 3U50C 2ZTCA 1K28A 3LWUA 1IYUA 2BA1A 3PMFA 4GKJL 2VQFL 1PTOF 1LV9A 4GKJQ 1STGA 5KNDA 2VQFQ 2PZWA 1HTLD 2A5HA 3EVQA 2EYJA 3I4NG 2D0PA 3CRKC 3JAMc 3SK4A 3K5NA 3K7AB 2A19A 2VS1A 1MGSA 2HIVA 4JI4L 3JAMi 4DV0L 4JI4Q 4DV0Q 4RGOS 1CI3M 4RAUC 4XQQA 5KEEA 3RLFA 3S15H 5C5LA 1Q8IA 1FGUA 1HNZQ 4FF2A 5M9OA 2ZXRA 1XX8A 1RKNA 1MD2D 3MXGA 1O80A 1HQMC 1IL2A 4XIGS 3I4OA 3AB9A 2F0LA 5IE8A 4YY3L 2M2LA 4O1NA 4YY3Q 3SR1A 1OXXK 3FPUB 2Q2HA 1VQ8A 1SLJA 2Q8IB 2E2HH 1G51A 5E3FA 5I6WA 4R8NA 1Z9FA 4KKTA 4LFBL 5ELBA 4APVA 4LFBQ 2F0FA 2QILA 3J7AF 4WJ3M 4H0LC 2R61A 2HUGA 1G291 3U9OA 2BH2A 5M3MG 5FLMH 2OTLA 1PZJD 3GTGH 5C4XB 2KECA 3FEWX 3HOYG 1S40A 4BY7B 2WAQG 3EN2A 1NMFA 2WAQE 4DV7Q 1MBYA 2J4XA 2B63B 3AYHB 2D0OA 4DK1A 1CKNA 3HEJA 1Y1VH 1PFSA 1E0BA 1I6HH 3K0YA 4NXNL 1W6JA 1EOTA 4NXNQ 3QR8A 3RR5A 4LFAL 5D3DA 4DAMA 2AMCB 3T13A 4KHZA 3U4VA 1PYWD 3GTKH 3KF8B 4DUZL 4A3LH 4HN7A 3UDXA 5ELEA 5JEAG 1D1KA 4UAIA 3X3MA 1BNZA 3DEOA 2NVTB 1VMCA 2SDFA 3TEHB 3EJIA 3HOWG 1LACA 4G57A 1YVCA 1ASZA 2FHTA 1V8QA 1YNJC 3CCSA 2IWHA 3T1HL 3T1HQ 1Y1WH 3OW7A 4JBJA 3DM1A 2MGSA 1VQOA 3HOVG 3S24A 1N34L 4PQXA 1N34Q 1HNWQ 1C48A 1ONLA 4JVZA 3HOZH 1RJTA 5M3FH 1TS2A 3OTOL 4DKAC 5CORA 4L8JA 5C3XA 4IUVA 1NAPA 2CW0C 5EPLA 4X64L 3U58A 4X64Q 5ELFA 3E3XA 4A3KH 1GJXA 5L37A 1BCPB 2NZOA 3DWQA 5AFWA 4U673 2SNMA 2NTTA 4PZ8A 5CV9A 3CCUA 2OQ0A 3J7A5 2MO1A 2IHFA 2FFKB 2WB1B 2VNUD 2NBFA 4BBRB 1A2UA 1JJCB 3FPPA 5K5PA 1D5ZC 3I90A 1VQFA 4K8IA 1ZEQX 2KBNA 3HKZB 4C3HH 1PTOD 3CU7A 5C44H 1L2FA 3S14H 1TT2A 4J6HA 1QVCA 4NP5A 3PGZA 3L0OA 3MWYW 4AQYQ 4TKOB 4DR3L 5IYCG 3H3VC 1O7ZA 1RF2D 1VQBA 3E0EA 3KLSA 2YYZA 4CDDC 1KDAA 2B2UA 2F0EA 4CHTB 2JN4A 4LFCL 4LFCQ 5C3EH 2EYFA 4M1UB 3VYUA 4K0KL 3NELA 5CV6A 1BXTA 3ND9A 4K0KQ 2QCPX 2FINB 2H5XA 4DK3C 3TP7A 2HD3A 4MNOA 1FD7D 4LJZC 5BN5A 1A8VA 1UAPA 2NWGA 3K7AH 1AP0A 1CA5A 5FOBB 1V9PA 3E0JA 4H02A 3CRLC 1X3FA 3P1HA 2LKVA 1IW7D 1H9SB 4FVMA 3MEFA 3MAQA 1X3QA 3NBHB 1SMXA 3GDEA 5IT9E 3QJYA 1SR3A 3MXNA 4C1NK 4MIUA 4IJLA 1EEFD 4GN5A 4RFBA 3GQBA 1PRTF 2ICEC 2NN6H 4ZYSA 4LUZA 1HNXL 4S3SA 3MA2B 1KHIA 5EKLA 1A3VA 1V1PA 2B2YA 2B2VC 2ENBA 2WKDA 4RMFA 5EQ0A 3QB3A 4LUOA 1SE2A 1V1OA 2K5NA 5GROA 4JI8L 4HJ9A 3RNUA 2R92H 1RIPA 5GADC 1I94Q 2A6ED 5IP7H 1I4PA 2DY8A 4UP8A 4NDXA 3L9AX 1BDOA 4FF3A 1E22A 1K3BC 1IZ6A 5C4XH 1B9NA 1VF7A 4L63B 4Y7NB 4BY7H 3RN2A 2L5TA 1Q46A 5CBAE 2IHEA 2KHIA 1B8AA 1G91A 1STEA 2Z6KA 3NP8A 2B63H 2R7ZG 4A93G 5JJIA 1X56A 4IURA 4J15A 4F8MA 4LW1A 3CAMA 2A68C 2KOLA 1HCZA 1EQQA 1WCMG 4B3SQ 4NKLA 1QVGA 2EJFC 2NN6I 3DEPA 2E2JB 3DWPA 1QUQB 1RTOA 3MZ5A 5JJLA 5M5XH 1WFQA 1XMQQ 5T1GA 2M9VA 3ONAB 3KLSX 1FVIA 4K5WA 5TSSA 4GOPB 4JV5Q 5G3LD 1VCIA 3RZOB 2TMPA 3EROA 3UDIA 1WTPA 4IJHA 4WJWA 3M7GA 4DA2A 2QEJC 1CM9A 1MIUA 1PH3A 4LF6L 3RZDB 4YHHL 2L12A 4ZKBB 3SDZA 4LF6Q 4YHHQ 3TS2A 1BOSA 2UUAL 3KFUA 2F0SA 2XN9C 2Y0SB 4DUYQ 4HJ8A 1JWSD 3D3RA 3W5OA 1QG7A 1WI5A 1OXTA 4IPCA 1QNUA 5M3MB 4XYQA 1HA6A 2RQXA 4QL5A 5C6AA 3ND8A 1MJEA 1D8LA 4K14A 4L5SA 2CH4A 3OPOA 1CKOA 1QB5D 3PO3G 1PH7A 3EIVA 4DR2L 1MSHA 1STBA 2H1EA 5IGDA 4BBRH 4A3CG 1A3TA 1PH2A 3Q0AA 2HDLA 3CW2C 1HZCA 4IFDH 1TWAB 3BU2A 3S9WA 2R93G 3TDQA 5HGQA 2CCZA 3CCVA 3SE0A 3SGIA 2KUMA 1SYDA 1U5KA 3J7YW 1FNUA 3I91A 3N6RA 1XNRL 4P74A 2F0MA 3QIAA 4A75A 3HOWB 3KF6B 3ERSX 4HR7B 1BO0A 3CPWA 2CWPA 3UE0A 3L7ZC 4BY1G 4L5QA 1H95A 4DV5L 2YV5A 5I2XA 1JOOA 1FYCA 2I46A 1S5BD 3NTHA 4A3EB 5M5WB 1S3OA 4LF9L 1JE5A 4LF9Q 1B1ZA 3HOVB 3K81C 2LY7A 1QOHA 1Q1BA 2B3GA 3LGJA 4HMIA 3OSOA 1T5XD 1ZXTA 4IFDI 3ULLA 5K36H 1FNVA 1UEBA 3URYA 1Y8OB 4Z9CB 1L1OB 1YHBA 1IW7C 1XPOA 3RN5A 4Y52H 5IWAL 2VW9A 3I2ZA 1PVOA 1HZBA 4WJ4A 1JJ2A 1EY7A 1HFGA 3CCLA 4DV1L 4DV1Q 2PI2A 5KNBA 3AFQA 4MN3A 2ZT9C 2WINB 4KHPL 2VUMG 1JICA 1U4LA 3A0JA 1NY4A 5IYBH 4G4KA 2A6EC 1HQRD 4PZ7A 4RCOA 1H9RA 1J5EL 1BCPC 1KLGD 4KMUC 1J5EQ 4Y7NH 3CQZH 5IT9c 3W2DA 2JA8G 4O0AA 2KCNA 4B3TQ 2ZXOA 1L0YB 3RLNA 1EQVA 5C0XI 4DGZA 1HUNA 3GTGB 4RGTA 4DF7A 1D2BA 2R6GA 3K0XA 1EL0A 3FVQA 5FLXL 2VB3X 4KJNA 1BQQT 4L5TA 1TIID 1UNSA 3I4NH 4DV4Q 4R9WA 2Z1CA 3Q6SA 4OO1I 1OXVA 1QUQA 3Q22A 1NMGA 1VQNA 1E1OA 1Q82C 4J8QA 5CV4A 3S1RB 1I6HB 4OONA 1HFNA 4A3FG 2QW7A 5T1IA 2AUJD 1EIHA 2MHVA 1BBXC 4PMCA 1LM0A 3WDNA 3RZOH 3BVMA 2JQOA 1GUSA 4BWGB 4CBVA 1K0RA 1ZKOA 3TN2A 2EZVA 1D7QA 3BVGA 5KRUA 1E2ZA 3HOXB 4BBSG 2EY5A 2LS01 5CR3A 5JAVA 3RZDH 1YITA 4OL7A 3ERQA 1FGBD 2RDGA 2F3VA 2EY1A 1LTSD 2DY7A 1TS3A 2G5DA 4UHVA 4AH6A 2ZJPA 1Y1WB 5HGTA 3K57A 2HHHL 3PUWA 2HHHQ 2G9HD 2M00A 5M3MH 1KC8C 1EZ6A 1S4ZA 1SNDA 3ZJYC 4G7ZC 2N55A 2JE6I 3CKIB 1U4RA 4DAYB 2EJMA 2CW0D 3S2DB 2ZTDA 4YWLA 3KLWA 2XWJB 1KD1C 1SE8A 3A8KE 1OXSC 2AHOB 3K58A 1Q86C 1N33L 2O5JC 2YTYA 3CHBD 4DXGA 1AEXA 5C0XG 2XTIA 4OWTB 1LYLA 5LMNW 4EQOA 1TWAH 3F2BA 1XNQQ 3C1FA 4HIKA 2HQLA 4B9XA 2QA4A 1BUVT 1JOQA 1KABA 2E2DC 4DNTB 5JEAH 3D31A 2AQ2B 2E74C 1M90C 1JC7A 1E3PA 1S5CD 1SNCA 3BYTB 1F77A 1A6XA 1SNMA 3GV6A 4JOIC 4PV1C 3HOWH 3CP0A 3WWVA 5KYIA 1PDQA 3AEVA 2XWBB 4EQ5A 1AE2A 4JI7Q 1IXRA 2K5QA 1I4XA 1WVLA 1V43A 3BDLA 4IPDA 4RHRA 1QWYA 3NK9A 4OX9Q 3QOJA 3PSIA 1O7LA 1C4QA 5IGCA 1SXTA 1KIXA 1IKMA 2K4KA 1F9QA 2NVYH 3T51B 4A3EH 5M5WH 4A3MG 2F0WA 2N78A 5EJWA 1K8AC 3EQLC 3R93A 3CC7A 3HOVH 2EY6A 1OTCA 1RHPA 1UWVA 3F2CA 3Q23A 2QDLA 4A3IB 1CHQD 2VL6A 1KAWA 3HG9A 4H44C 3PUXA 5C3EB 2GVBA 1B50A 2UXBQ 5IOCA 1VQ9A 3GTJB 4FF4A 3VR5A 1WTWA 2BDOA 4IOAA 4GOPC 4DV3L 3RMHA 3D4WA 1R4PB 4DV3Q 2V4DA 4A3GG 5EKIA 3I4LA 2MPMA 3VR3A 2Q2TA 3P7JA 3L2PA 1JJGA 4OIKA 1WTXA 2LFNA 5C4HA 2JA9A 4UPAA 2JA7G 2CQOA 5C3WA 1LLRD 1SRUA 2R93B 4I7ZC 3IFTA 1I5FA 1EY4A 4NW2A 1PZKD 3G7LA 3GP7A 1C7YA 1HJPA 4HIOA 3NQTA 1VS0A 3KK7A 2F0OA 3M4PA 3AFPA 2YTVA 2QGQA 2Q8TA 4XYOA 2RCNA 2F1MA 1F9PA 1PFNA 2RA4A 2GA4B 4PMWA 2EXDA 3DUZA 3KYHC 1STAA 4ULLA 2IW3A 1SFOH 4N8X1 3PIOA 1EFID 2R92B 4IUQA 1SAPA 1X9NA 4RGNA 3BJUA 5ELNA 1NJIC 3HOUG 4IALA 5IY0A 4E6IA 1BF4A 2E5LL 3R8BA 2E5LQ 1E7ZA 3OWEB 1NUCA 1RL2A 2EXZA 3I72A 3Q8DA 2A6HC 3M4QA 1CTMA 2PCFB 2Z0SA 4CDEC 3G6JB 3I70A 4O2DA 2F0HA 3I8ZA 5C4JB 2C35B 2Q2UA 5M5YB 2JA6B 4LF8L 2A68D 1ILQA 2KQ3A 4LF8Q 2IL8A 2K33A 1HZAA 1WJJA 4XT3B 3S1RH 5KIXA 5IYDG 3NPPA 4MTNA 2A8VA 1X3PA 4LFAQ 3FRPB 3J80L 2EQSA 4JW0A 5M5XB 4DUZQ 1AN8A 3WOFA 1BCPF 3HOXH 1SNQA 1VQKA 1P8LA 4A3DG 2R7DA 4CJ1B 1I6VC 1Z7TA 3OIPA 4NMZA 1VQPA 1A63A 4NXML 3MFGA 2CQAA 4BXXG 2B2TC 1S5FD 1VF5C 2IX0A 4IFDJ 2PQAB 1VQGA 2Z8LA 4B3RL 4N8FA 4GNXB 1I4GA 5FLXE 2B2VA 4B3RQ 1GD7A 1BBWA 1RDPD 1QZHA 4ILWA 4Q5VA 2L0CA 4O42A 4N9TA 2JA8B 5I6YA 2ASBA 3S2DH 4RA8A 3VYRA 2PNRC 3OTOQ 2SNSA 2R7ZH 4A93H 5G3LF 1WTRA 2F0TA 1H9MA 2K01A 1SN8A 2O2LD 4JI5L 2BE5C 4JI5Q 5CYUA 3A54A 3AQQA 2RDHA 4IQZA 1SYEA 3J7AV 2N8NA 1K3RA 3E9IA 1F2ZA 4XTCS 3FKIG 3F2DA 2JYOA 1D6EC 4JPBW 4ZRZA 1CSQA 4X65L 2R3ZA 4R4CA 5JJKA 4QUFA 3KBXA 1PYSB 1C8CA 1EY9A 4ZLTF 3GTOH 1GVPA 3TZUA 1NSNS 4UY8C 2CFMA 4XQNA 1O7YA 2XRQD 1HXYD 1E2VA 4OELB 5DM63 2F0IA 4DR3Q 1STNA 2LXKA 2OEOA 4BS9A 3NSWA 2KENA 1EY8A 4TVAB 2VQEL 4UDUC 4A3BG 2VQEQ 3OMCA 4A3IH 1RCVD 1QVFA 3S2HB 4LWCA 5EKKA 2EYMA 1DYQA 4KJOA 3GTJH 1UE5A 2K32A 3A56A 3E9HA 3K6OA 4ZKCB 1S5ED 1V1QA 3PO3H 1YHAA 4HEDA 3IAYA 5LMUL 5JJZA 1MSGA 2KEEA 2K75A 4A3CH 1IL8A 2HCIA 2JP1A 1HR0L 1YBYA 1HR0Q 1VQCA 1TWCH 3BZKA 2R93H 1LO5D 1K73C 2RHSB 1Q1EA 4X3SA 2B8GA 3I7FA 1CUKA 5LHY1 3TMEA 4R4OA 2OF1A 1SYBA 3ZYYX 4HJ7A 2IY5B 2WV6D 3MEHA 4CKEA 1Y1VG 1HNXQ 1QZGA 2XGTA 1MKHA 4HMJA 1Z47A 4JI8Q 4KKUA 4IN3A 3G48A 2RBMA 4OXPA 4QIWB 3CCQA 1JCKB 2MJ8A 2DNEA 2KEDA 2A1AA 1TWHB 3N52A 1GUOA 1BCPD 2MP1A 2RKSA 1H9JA 4CGYB 3MTSA 3CQZB 3S1MB 2NB0A 3EBEA 3BYYB 2C9OA 5C4JH 2CKZB 1CT1D 5I9PA 5M5YH 4YWKA 2JA6H 4KD4A 2L9HA 2Z9HA 1X55A 1T9HA 4B9WA 1DD2A 3VA5A 3CCEA 2CHBD 3I4NB 2PZTA 1GXDC 1YEZA 4DNRB 2HIXA 2Z6BA 5J1ZA 3KF8A 3I4MG 4DV6L 3A7LA 1JQYD 3KJPA 2NVXB 1ICFB 1CZGA 3PIPA 4FP5D 5H1SE 4F88A 3S17B 3C2PA 3E5SA 1EY0A 4DR7L 4IUNA 1II3A 5ELDA 1AFPA 2F0UA 2AQ3B 5IGFA 4C2MH 2UU9L 4JC0A 2B39A 4FF1A 2UU9Q 4BA1I 2E75C 1ENAA 1S5DD 3GTMB 3PO2G 2WIIB 3V2TA
chains in the Genus database with same CATH topology
1DOLA 1JE4A 5JEAJ 4LK1C 3HOUB 3S16B 4U68A 4OHJA 1F2LA 1MI2A 5COYA 3A8IE 3HOYB 5BN3A 1R9TB 1DJRD 1E2WA 1G2TA 3J80E 1WD1A 3IKJA 2WAQB 2YU9B 1TS4A 4KV6A 3F2UA 1A15A 2DNCA 2JSOA 1QJOA 2EY2A 2PQEA 1GUGA 4KKSA 4CKCA 3D4DA 4C1NI 2EYLA 2J7ZA 3TP6A 1LT4D 4KD3A 2NTSA 1QNKA 5IODA 1Q3LA 1WTVA 1F9SA 1AW7A 2EJGC 2NVYB 1J8IA 2L55A 3TP8A 4TRDA 1TWFB 3R2IA 3FMCA 5KYLA 5J39A 3OWFA 2F0QA 1I50B 4LMQD 4HCSA 3VYTA 4X3UA 4F87A 1EYDA 1H9SA 5C0XH 1KDBA 3NBHA 1IHZA 5I2YA 1EQTA 1JR0D 2F0NA 3AMUA 2RVLA 4OO1H 2F0KA 3K5OA 4QB4A 4V190 1PZID 1LT3D 1HRJA 1PMRA 4JBWA 2KHSA 2NUCA 3SXHA 2O5IC 1DXMA 1GUNA 4HAEA 4TQUS 3T56B 1SFOB 3OIQA 3SEBA 4P2CB 4A3BB 2A6HD 3MXPA 4RGMA 5E1FA 4HCEA 2LMCB 2RSNA 3GV3A 2F0PA 3H09A 1AZPA 1GUTA 2KJXA 2MUYA 2Z4IA 4FXKC 4ODGA 3BDOA 1TY2A 3W3AA 5E4XA 2IX1A 1JB3A 3IL8A 2I07B 2PPBC 2B2WA 3DXJC 1EZ8A 2NVQB 4KK7A 1ML0D 2F4IA 4C3IG 4K5VA 4DK0A 2D2CC 3S1NB 1Y8NB 1SSOA 5D3IB 5JVG3 1ESFA 5DAUA 1M8AA 1G2SA 1HA5A 1CFMA 2JEAI 1STYA 5A35A 2K28A 5NUCA 4Q0FA 1EYAA 2JEBI 4F7XA 4V0BA 2R7ZB 1WTQA 3L3OC 4L6TB 4A93B 1LTAD 3O13A 4QMGA 2BE5D 2X69A 1AZQA 1WCMB 4QF4A 1KDCA 2HQEA 4K8JA 1LTTD 1O78A 3TSSA 2D9UA 1EY6A 1EY5A 1UEAB 1F2MA 4K6LA 5K36G 4FXGC 3I3CA 3GTOB 4ID6A 4FYDA 3DMUA 4OGQC 1XTCD 3RD4A 1XYIA 2KCCA 3PO2B 1RTNA 2WKCA 3DHQA 2FJ2A 1TS5A 2EE1A 3M7NA 3S1QB 3R3OA 4XQJA 2B2TA 4WRDA 5LL6S 5JOBA 2Z4HA 5F2DA 1FNWA 5EBCA 4KY7A 3PO3B 2ICIA 3TZDA 2B2WC 3NWTA 1SBBB 1PFBA 4A3JB 3SK8A 1EWCA 3M4OB 4K2LA 1TWCB 2G9DA 2XRSD 3QO2A 2EYHA 5EBDA 5IIFA 2C5CA 1KTKA 2VXWA 4WORA 5A2QL 1G8ZD 3D8GA 1B4OA 1F9RA 5FO8B 4BY1B 2SEBD 4DXFA 4ZUIA 2XSCA 3DWAA 5FO9B 4FNFA 4EQPA 3FDTA 1OXUA 1V1PB 4CJ0B 1TKWB 1PTOB 3SVMA 2OXPA 4XT1B 1LTGD 2EYPA 2EVBA 3E6ZX 1KNEA 1DOMA 4C3JG 1KAAA 1WD0A 2PZUA 4RWSC 1QILA 1U4MA 4R8IA 2RSOA 3A55A 2NYZD 2AQ1B 3GTLB 1XWEA 4K6DA 1SYFA 4C2MB 2K05A 2VUMB 1RODA 2NZ1D 2N88A 4ZUJA 3BZDB 2E2IB 3D6CA 1RD9D 4RHSA 4ABNA 4BA2I 5EPKA 3C3LA 1ENFA 3A7AB 3J81L 4G7OC 2O4XA 3UI2A 3M4YA 1QCBD 4DAYA 4ME5A 1ZYRC 2EPBA 2X6LA 3IFDA 3NUCA 5IGEA 2PW5A 2A73B 2A74C 3R2TA 3JAML 1JOKA 3MFYA 2IPKD 2FMMA 5KNCA 2IX3A 1K83B 1QE6A 3P75A 4A3FB 1Y8PB 1GOZA 3D4RA 4H7BA 1NCVA 1ILPA 3GTQB 5EPJA 1ICWA 4H13C 1G6ZA 4IUTA 4K2KA 2PYKA 4BBSB 1SJED 5C0XJ 5DNFA 4C3IB 1GUWA 2K7VA 4FO2A 5C5MA 3MHBA 2L11A 1CHPD 4B08A 1EIGA 4KHVA 1CQVA 3I73A 1U9RA 2F0GA 3VR6A 2KA7A 2K5DA 3M3YB 2BDNA 3EFXD 1B44D 2OT2A 4AYBB 2K03A 4YIJA 4CKBA 1I4RA 1B3AA 2F0DA 3SHLA 3VA7A 1LTRD 1D5XC 4LAAA 3NWSA 2L1BA 1Y69U 2A69D 1D5MC 2QDBA 4HSVA 2QKIC 3WOEA 1T5EA 4QCLA 1OO9B 3T53B 4HTHA 3NTKA 1PLFA 2BOSA 1Q90A 1JORA 1DONA 4A3MB 4I65A 2H4OA 1D1IA 4X3TA 4IUUA 1SJHD 3M85A 2TSSA 5CV5A 3LNNA 1SEBD 1PTOH 1TWGB 4EQNA 1X32A 2EOTA 1YNND 2F3WA 2PMZB 1PFMA 4GZYC 1LABA 1EU3A 3VYSA 3PUVA 4A3GB 3GD7A 1IKLA 3V05A 3C46A 5A2QE 4DFAA 3D6WA 1HPCA 4MHEA 2JA7B 1GHKA 1DCZA 3U9SA 3PUZA 1PRTB 5C4ZA 1B9MA 3BS1A 5FKAC 3PIO3 3NBIA 1SNOA 1TU2B 3AU7A 3RUZA 3ITPA 5CMDA 4C3HG 4DAVA 2VB2X 5CC4A 2RDFA 4XXEA 2B2UC 2AWOA 2F0VA 5JVH3 3MVVA 1ESRA 3VR4A 2K5WA 3T4AC 3TP5A 3GTPB 1CK1A 5CV8A 1SMYD 3HP3A 1SDFA 5I9OA 3H91A 1B53A 3BVZA 3TBIB 1CA6A 3A8JE 2JA5B 1F2YA 4C3JB 2BA0A 3H0GB 5HURA 1DOKA 2XVSA 2HCCA 3EA6A 4J1MA 5CBEE 4XDXA 1M4VA 1ENCA 1HUMA 5DM73 4K5XA 1EYCA 4A3DB 4TSSA 2JXMB 5J22A 5FK9C 1TY0A 2AUKA 3J81E 2AWNA 2B2YC 1I4QA 1SE4A 1PTOC 1U4PA 4RKBA 2NN6G 2SOBA 1LTID 1SYGA 3LX0A 5CGKA 2WACA 1B2TA 1R4QB 4JK1C 3OHXC 2ZXPA 2XIWA 2E76C 3QG1A 3JAME 4KI0A 3K5LA 3NTIA 3X3NA 2HDMA 3PV0A 3QOLA 2K1BA 5LL6X 1EEID 1Z6HA 2DN8A 4KN4C 1PRTD 3HRZC 1CQFA 4ZQ3A 1I3QB 1EU4A 3FKIB 1W6KA 2Q8RE 4C56C 1FR3A 5KGUA 4RKLA 1JWUD 2F0JA 1TR5A 1I4HA 2A69C 3SK6A 4WFN3 3T16A 2IJ0A 1VDZA 3C1EA 4PNYA 1LT6D 5JPMC 3H94A 1DM0B 1NR2A 3S15B 3V96A 3K59A 4QUCA 5ISRA 4N9PA 3H6MA 3KLRA 1GHJA 1KNAA 3NE5B 4RH6A 4PMBA 1YNNC 2E2HB 4X3KA 5IGBA 5I4DA 4KN7C 3HGBA 3NQIA 2B8FA 5BN4A 4ZAIA 2F03A 1CZWA 3HS0C 4KY5A 1SYCA 2BCOA 5ELCA 1ET9A 3OMGA 2KVMA 2FMCA 1SE3A 2PW7A 1Y1VB 2ID0A 4KTAA 2IT1A 3P20A 3K5MA 1TQOA 4IFDG 3GO5A 1UUPA 2L4NA 1L0XB 5E4WC 3GTKB 4RCNA 4DU9A 2EDGA 3BG3A 3KBGA 4EGVA 1ET6A 3PUYA 1H9KA 1ZYRD 2WP8J 1YNJD 1HTPA 1LT5D 2K04A 1EWHA 1SMYC 3QWNA 3MXUA 4CJ2C 5IGGA 4DAPA 3PIP3 1LTBD 1K8MA 4IZ8A 1NR4A 1STHA 1Q12A 1A2TA 3I4MB 2XNAC 2CVRA 3HOZB 4HSPA 5M3FB 4EVOA 5D14A 3MC0B 1KLUD 1JWMD 4G7HC 4A3KB 1WTOA 3LWEA 1PXUA 4IUPA 1DZ1A 4FXDA 4DN4M 5CV7A 1TVXA 4OO1G 5FO7B 1XXGA 1IYVA 1BR9A 4C3HB 2X6GA 3SK5A 3NHHA 5C44B 5EGTA 2D62A 3S14B 1K8OA 4M8AA 1SNPA 5IT9L 5DEHA 1J9OA 1VMPA 2D5DA 2PO4A 5D65A 2J0TD 3OOCA 4KY6A 3BDCA 3VR2A 1A3UA 1PRTC 2K6AA 4ZK9B 2QF7A 1HHVA 2EYOA 3HZXA 3KUPA 3NXWA 3Q24A 4OIJA 5JPNC 3LWUA 1IYUA 2BA1A 3PMFA 1PTOF 1LV9A 1STGA 5KNDA 2PZWA 1HTLD 2A5HA 3EVQA 2EYJA 3CRKC 3SK4A 3K5NA 3K7AB 1MGSA 4RGOS 1CI3M 4RAUC 4XQQA 5KEEA 3RLFA 5C5LA 1Q8IA 4FF2A 5M9OA 2ZXRA 1XX8A 1RKNA 1MD2D 3MXGA 1O80A 1HQMC 4XIGS 3AB9A 2F0LA 2M2LA 4O1NA 3SR1A 1OXXK 3FPUB 2Q8IB 5E3FA 5I6WA 4R8NA 4KKTA 5ELBA 2F0FA 2QILA 3J7AF 4H0LC 2R61A 2HUGA 1G291 3U9OA 1PZJD 5C4XB 2KECA 3FEWX 4BY7B 1MBYA 2J4XA 2B63B 4DK1A 3HEJA 1E0BA 3K0YA 1W6JA 1EOTA 5D3DA 3T13A 4KHZA 1PYWD 4HN7A 5JEAG 5ELEA 1D1KA 4UAIA 3X3MA 1BNZA 3DEOA 2NVTB 1VMCA 2SDFA 3EJIA 1LACA 4G57A 2FHTA 1V8QA 1YNJC 2IWHA 3OW7A 3DM1A 2MGSA 4PQXA 1C48A 1ONLA 1RJTA 1TS2A 5CORA 4L8JA 5C3XA 4IUVA 1NAPA 2CW0C 5EPLA 5ELFA 1GJXA 1BCPB 3DWQA 5AFWA 4U673 2SNMA 2NTTA 5CV9A 2FFKB 2WB1B 2VNUD 2NBFA 4BBRB 1A2UA 3FPPA 5K5PA 1D5ZC 3I90A 4K8IA 1ZEQX 3HKZB 1PTOD 3CU7A 1TT2A 4J6HA 4NP5A 3MWYW 4TKOB 3H3VC 1O7ZA 1RF2D 3KLSA 2YYZA 1KDAA 2B2UA 2F0EA 4CHTB 2EYFA 4M1UB 3VYUA 5CV6A 1BXTA 3ND9A 2QCPX 2FINB 3TP7A 1FD7D 4LJZC 5BN5A 1UAPA 2NWGA 1AP0A 1CA5A 5FOBB 3E0JA 3CRLC 3P1HA 2LKVA 1IW7D 1H9SB 4FVMA 3MAQA 1X3QA 5IT9E 3QJYA 3MXNA 4C1NK 4MIUA 1EEFD 4RFBA 3GQBA 1PRTF 2ICEC 2NN6H 4ZYSA 4S3SA 3MA2B 5EKLA 1A3VA 1V1PA 2B2YA 2B2VC 5EQ0A 2ENBA 2WKDA 3QB3A 1SE2A 1V1OA 2A6ED 1I4PA 2DY8A 4NDXA 3L9AX 1BDOA 4FF3A 1B9NA 1VF7A 4L63B 4Y7NB 2L5TA 5CBAE 1G91A 1STEA 3NP8A 4IURA 4F8MA 2A68C 2KOLA 1HCZA 4NKLA 2EJFC 2NN6I 3DEPA 2E2JB 3DWPA 1RTOA 3MZ5A 5T1GA 2M9VA 3ONAB 3KLSX 4K5WA 5TSSA 5G3LD 1VCIA 3RZOB 2TMPA 3EROA 1WTPA 4WJWA 3M7GA 4DA2A 2QEJC 1CM9A 3RZDB 2L12A 4ZKBB 3SDZA 1BOSA 2F0SA 2XN9C 2Y0SB 1JWSD 3D3RA 1QG7A 1OXTA 1QNUA 5M3MB 4XYQA 1HA6A 2RQXA 5C6AA 3ND8A 4K14A 3OPOA 1QB5D 1MSHA 1STBA 2H1EA 5IGDA 1A3TA 3Q0AA 2HDLA 4IFDH 1TWAB 3S9WA 3TDQA 3SE0A 2KUMA 1SYDA 3J7YW 1FNUA 3I91A 3N6RA 2F0MA 3QIAA 3HOWB 4HR7B 1BO0A 3L7ZC 5I2XA 1JOOA 1FYCA 2I46A 1S5BD 3NTHA 4A3EB 5M5WB 1B1ZA 3HOVB 2LY7A 1QOHA 1Q1BA 4HMIA 3OSOA 1T5XD 1ZXTA 4IFDI 5K36H 1FNVA 3URYA 1Y8OB 4Z9CB 1IW7C 1EY7A 1HFGA 5KNBA 4MN3A 2ZT9C 2WINB 1JICA 1U4LA 4G4KA 2A6EC 1HQRD 4RCOA 1H9RA 1BCPC 1KLGD 4KMUC 3W2DA 2KCNA 2ZXOA 1L0YB 1EQVA 5C0XI 4DGZA 1HUNA 3GTGB 4RGTA 4DF7A 1D2BA 2R6GA 1EL0A 3FVQA 5FLXL 2VB3X 4KJNA 1BQQT 1TIID 1UNSA 4R9WA 2Z1CA 3Q6SA 4OO1I 1OXVA 3Q22A 4J8QA 5CV4A 3S1RB 1I6HB 1HFNA 5T1IA 2AUJD 1EIHA 2MHVA 1BBXC 4PMCA 3WDNA 3BVMA 1GUSA 4BWGB 4CBVA 2EZVA 1ZKOA 3TN2A 3BVGA 5KRUA 1E2ZA 3HOXB 2EY5A 2LS01 5CR3A 5JAVA 4OL7A 3ERQA 1FGBD 2RDGA 2F3VA 2EY1A 1LTSD 2DY7A 1TS3A 1Y1WB 5HGTA 3K57A 3PUWA 2G9HD 2M00A 1EZ6A 1S4ZA 1SNDA 4G7ZC 2N55A 2JE6I 3CKIB 1U4RA 2EJMA 2CW0D 3S2DB 2XWJB 3A8KE 1OXSC 3K58A 2O5JC 3CHBD 4DXGA 1AEXA 5C0XG 4EQOA 3C1FA 4B9XA 1BUVT 1JOQA 1KABA 2E2DC 4DNTB 5JEAH 3D31A 2AQ2B 2E74C 1JC7A 1S5CD 1SNCA 3BYTB 1F77A 1A6XA 1SNMA 3GV6A 4PV1C 5KYIA 1PDQA 2XWBB 2K5QA 1I4XA 1WVLA 1V43A 3BDLA 4RHRA 1QWYA 3NK9A 3QOJA 1O7LA 1C4QA 5IGCA 1SXTA 1IKMA 1F9QA 3T51B 2F0WA 5EJWA 3EQLC 3R93A 2EY6A 1RHPA 3Q23A 4A3IB 1CHQD 3HG9A 4H44C 3PUXA 5C3EB 1B50A 5IOCA 3GTJB 4FF4A 3VR5A 1WTWA 2BDOA 3RMHA 3D4WA 1R4PB 2V4DA 5EKIA 3I4LA 2MPMA 3VR3A 3P7JA 4OIKA 1WTXA 2LFNA 5C4HA 5C3WA 1LLRD 2R93B 4I7ZC 3IFTA 1EY4A 4NW2A 1PZKD 3G7LA 3GP7A 3NQTA 3KK7A 2F0OA 2Q8TA 4XYOA 2F1MA 1F9PA 1PFNA 2RA4A 2GA4B 4PMWA 3DUZA 1STAA 4ULLA 2IW3A 2R92B 1EFID 4IUQA 1SAPA 4RGNA 4IALA 4E6IA 1BF4A 3R8BA 3OWEB 1NUCA 2EXZA 3I72A 2A6HC 1CTMA 2PCFB 3G6JB 3I70A 2F0HA 3I8ZA 5C4JB 5M5YB 2JA6B 2A68D 1ILQA 2KQ3A 2IL8A 2K33A 4XT3B 5KIXA 3NPPA 1X3PA 3FRPB 3J80L 5M5XB 1AN8A 3WOFA 1BCPF 1SNQA 4CJ1B 1I6VC 1Z7TA 3OIPA 4NMZA 3MFGA 2CQAA 2B2TC 1S5FD 1VF5C 2IX0A 4IFDJ 2Z8LA 1I4GA 5FLXE 2B2VA 1RDPD 4ILWA 4Q5VA 2L0CA 4O42A 4N9TA 2JA8B 5I6YA 4RA8A 3VYRA 2PNRC 2SNSA 5G3LF 1WTRA 2F0TA 1H9MA 2K01A 2O2LD 2BE5C 5CYUA 3A54A 2RDHA 4IQZA 1SYEA 3J7AV 1F2ZA 4XTCS 2JYOA 1D6EC 4ZRZA 2R3ZA 4QUFA 3KBXA 1C8CA 1EY9A 4ZLTF 3TZUA 1NSNS 4XQNA 1O7YA 2XRQD 1HXYD 1E2VA 5DM63 2F0IA 1STNA 2OEOA 4BS9A 3NSWA 1EY8A 4UDUC 3OMCA 1RCVD 3S2HB 5EKKA 2EYMA 1DYQA 4KJOA 2K32A 3A56A 4ZKCB 3K6OA 1S5ED 4HEDA 3IAYA 5JJZA 1MSGA 2KEEA 1IL8A 2HCIA 2JP1A 1LO5D 1Q1EA 4X3SA 2B8GA 5LHY1 3TMEA 2OF1A 1SYBA 3ZYYX 2WV6D 3MEHA 4CKEA 4HMJA 1Z47A 4KKUA 4IN3A 4QIWB 2RBMA 1JCKB 2MJ8A 2DNEA 2KEDA 1TWHB 3N52A 1GUOA 1BCPD 2MP1A 2RKSA 1H9JA 4CGYB 3MTSA 3CQZB 3S1MB 2NB0A 3BYYB 2C9OA 1CT1D 5I9PA 4KD4A 2L9HA 4B9WA 1DD2A 3VA5A 2CHBD 3I4NB 2PZTA 1GXDC 4DNRB 5J1ZA 3KF8A 3A7LA 1JQYD 2NVXB 1CZGA 4FP5D 4F88A 3S17B 3C2PA 3E5SA 1EY0A 4IUNA 1II3A 5ELDA 1AFPA 2F0UA 2AQ3B 5IGFA 2B39A 4FF1A 4BA1I 2E75C 1ENAA 1S5DD 3GTMB 2WIIB 3V2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGF A;  3PMF A;  4QMG A;  4K2K A;  5IGD A;  3BDL A;  1STG A;  2PYK A;  3NK9 A;  1EQV A;  2F0K A;  2PZW A;  1A3T A;  3EVQ A;  4QF4 A;  3QOJ A;  2EYJ A;  4S3S A;  5EKL A;  4DFA A;  4DGZ A;  4EQP A;  4QB4 A;  1A3V A;  1KDC A;  2HQE A;  3QOL A;  5IGC A;  4K8J A;  3SK4 A;  2ENB A;  3S9W A;  4DU9 A;  4DF7 A;  3QB3 A;  2KHS A;  1SNQ A;  2NUC A;  3SXH A;  5C5M A;  2F0W A;  4KJN A;  5C4Z A;  2OXP A;  1EY6 A;  5KIX A;  4NMZ A;  3MHB A;  5C3X A;  1EY5 A;  1SYD A;  2EY6 A;  2EYP A;  1F2M A;  4NDX A;  4ZQ3 A;  5KEE A;  5C5L A;  5CV4 A;  1SNO A;  1KAA A;  2F0M A;  4ID6 A;  5M9O A;  2SNM A;  4KHV A;  4KV6 A;  3DMU A;  2PZU A;  5CV9 A;  1RKN A;  1U9R A;  3TME A;  2F0G A;  2OF1 A;  4RKL A;  1SYB A;  5IOC A;  5KGU A;  3RUZ A;  4PMC A;  2F0L A;  2F0J A;  3ITP A;  3MEH A;  1TR5 A;  5IGG A;  3D4W A;  1A2U A;  3SR1 A;  2EY2 A;  3MXP A;  5K5P A;  2PQE A;  5CC4 A;  2RDF A;  4HMJ A;  3NP8 A;  4IZ8 A;  1JOO A;  3SK6 A;  1STH A;  5E1F A;  3T16 A;  4N9T A;  5KRU A;  4F8M A;  1A2T A;  5I6Y A;  4K8I A;  3DHQ A;  2F0V A;  3C1E A;  4PNY A;  2RBM A;  3D4D A;  3MVV A;  4K6D A;  5E3F A;  5I6W A;  3R3O A;  2EY5 A;  4R8N A;  2F0P A;  2SNS A;  5CR3 A;  1TT2 A;  4NKL A;  1SYF A;  5C4H A;  5JAV A;  4J6H A;  2EYL A;  2F0F A;  4OL7 A;  4WRD A;  4YIJ A;  3TP5 A;  4EVO A;  5C3W A;  2F0T A;  3MZ5 A;  4NP5 A;  5JOB A;  4HMI A;  3ERQ A;  3OSO A;  4ODG A;  5CV8 A;  1EY4 A;  2RKS A;  3U9O A;  2F0D A;  2EY1 A;  2F3V A;  5F2D A;  3SHL A;  3TP6 A;  5I9O A;  5ISR A;  4KD3 A;  4N9P A;  1SYE A;  4K5W A;  4ZUJ A;  3H6M A;  3NQT A;  4LAA A;  5HGT A;  1F2Z A;  2F0O A;  5IOD A;  3D6C A;  4KY7 A;  2M00 A;  5I9P A;  3ERO A;  1EZ6 A;  1F2Y A;  1KDA A;  2QDB A;  4KD4 A;  5CV7 A;  4PMB A;  2F0E A;  1SND A;  1EZ8 A;  5HUR A;  2O4X A;  3HEJ A;  1STA A;  4B9W A;  1EY9 A;  4HTH A;  4ME5 A;  3VA5 A;  2EYF A;  1NSN S;  3TP8 A;  2PZT A;  3NHH A;  3SK5 A;  5EGT A;  4J1M A;  1EY7 A;  5CV6 A;  4K5V A;  3SK8 A;  5IGB A;  4TRD A;  1ENC A;  4IAL A;  4K2L A;  1JOR A;  4E6I A;  1SNP A;  2EYH A;  3NUC A;  5KYL A;  5IGE A;  5DEH A;  3T13 A;  5J1Z A;  3TP7 A;  4K5X A;  5J39 A;  2F0S A;  3OWF A;  1NUC A;  2F0Q A;  4I65 A;  5IIF A;  2EXZ A;  1EYC A;  2PW5 A;  1AEX A;  4KY5 A;  1SYC A;  4EQO A;  2F0I A;  5J22 A;  1STN A;  3C1F A;  4KY6 A;  1JOK A;  3BDC A;  5DAU A;  4B9X A;  1EYD A;  5CV5 A;  3P1H A;  3E5S A;  2LKV A;  2F0H A;  2OEO A;  3OMG A;  4WOR A;  1JOQ A;  4EQN A;  1KAB A;  3EJI A;  1EY0 A;  1EY8 A;  1A3U A;  1KDB A;  3D8G A;  1II3 A;  4G57 A;  4IUN A;  2F0U A;  3P75 A;  1IHZ A;  2KQ3 A;  3OMC A;  4RKB A;  5C6A A;  1STY A;  2F3W A;  2PW7 A;  2SOB A;  4K14 A;  5NUC A;  1SNC A;  1ENA A;  1EYA A;  1SYG A;  2EYO A;  3HZX A;  2F0N A;  1SNM A;  3NXW A;  3LX0 A;  4H7B A;  4KTA A;  4F7X A;  5CGK A;  4MIU A;  5EKK A;  2WAC A;  5KYI A;  1TQO A;  4ZUI A;  2EYM A;  4KJO A;  1STB A;  3V2T A; 
#chains in the Genus database with same CATH topology
 1DOL A;  1JE4 A;  1EUJ A;  2UUA Q;  1FJG L;  3CF5 A;  1KRS A;  5C44 G;  5JEA J;  4LK1 C;  3HOU B;  2JA8 H;  3S16 B;  4POF A;  1WTH A;  4JI6 L;  4U68 A;  4OHJ A;  1F2L A;  1MI2 A;  5GQO A;  5COY A;  3A8I E;  3HOY B;  5BN3 A;  1R9T B;  1DJR D;  1E2W A;  3CC4 A;  1G2T A;  3J80 E;  1WD1 A;  3IKJ A;  2R7F A;  2WAQ B;  2YU9 B;  1TS4 A;  1VQ7 A;  4KV6 A;  4DR2 Q;  4JI3 L;  3F2U A;  2RHQ B;  1A15 A;  4P75 A;  4IPG A;  2DNC A;  1EWI A;  2JSO A;  4A3J G;  1K83 H;  1QJO A;  2EY2 A;  1CKM A;  2PQE A;  1GUG A;  4A3F H;  2DGY A;  4R4Q A;  4KKS A;  5FLX c;  4CKC A;  2ZTE A;  3D4D A;  1IYJ B;  4C1N I;  1XMO L;  2EYL A;  1PH6 A;  2I5L X;  3G6E A;  2J7Z A;  1XNR Q;  4NPS A;  3TP6 A;  2GN5 A;  1LT4 D;  4KD3 A;  3TRZ A;  2NTS A;  1QNK A;  5IOD A;  1Q3L A;  1Q81 C;  1WTV A;  1F9S A;  1X65 A;  4GLV B;  4DV5 Q;  1AW7 A;  1JT8 A;  2EJG C;  2NVY B;  1J8I A;  1VQD A;  3S2H H;  2L55 A;  1N8R C;  3TP8 A;  3A5Z B;  4TRD A;  1TWF B;  3R2I A;  1XJV A;  3FMC A;  5KYL A;  3W1G A;  5J39 A;  1P16 A;  4DK6 C;  4JI0 L;  2N49 A;  2OCE A;  3OWF A;  2F0Q A;  1I50 B;  2LXJ A;  4LMQ D;  3KDF B;  4HCS A;  3VYT A;  3H15 A;  4X3U A;  4F87 A;  3DLL A;  1EYD A;  1H9S A;  1M1K C;  5C0X H;  1JB7 A;  2EIF A;  1KDB A;  1TXY A;  3NBH A;  1IHZ A;  5I2Y A;  5IWA Q;  4X62 L;  1NNX A;  4X62 Q;  1EQT A;  4BY7 G;  1JR0 D;  2UXC L;  2UXC Q;  2N3S A;  2F0N A;  3AMU A;  2RVL A;  3F1Z A;  4OO1 H;  5GAH C;  2F0K A;  3K5O A;  4QB4 A;  4V19 0;  4GNX C;  1PZI D;  1LT3 D;  4KHP Q;  1PMR A;  1HRJ A;  4JBW A;  2KHS A;  2NUC A;  3SXH A;  2O5I C;  1VQL A;  1DXM A;  1GUN A;  1VQA A;  1BBU A;  3KOJ A;  4HAE A;  1TWH H;  4TQU S;  3I55 A;  4JOI A;  3T56 B;  2ES2 A;  1SFO B;  3OIQ A;  1C0A A;  2RF4 A;  4QJF A;  3SEB A;  4P2C B;  4A3B B;  3S1M H;  2LSS A;  2A6H D;  4A4I A;  4JYA L;  4JYA Q;  1BKB A;  2UXD L;  3MXP A;  4RGM A;  1K8G A;  5E1F A;  4HCE A;  2LMC B;  2RSN A;  3GV3 A;  2F0P A;  3KJO A;  1YJ9 A;  3H09 A;  4A3G H;  1AZP A;  1GUT A;  2KJX A;  4POG A;  4ZCK A;  2MUY A;  4CDF C;  2Z4I A;  4FXK C;  4ODG A;  3BDO A;  1TY2 A;  3W3A A;  2NVX H;  5E4X A;  4GOP A;  2IX1 A;  1JB3 A;  3IL8 A;  3S17 H;  2I07 B;  2B29 A;  1XPR A;  2L15 A;  1PA6 A;  3TS0 A;  2PPB C;  2B2W A;  3A74 A;  3NEN A;  1JMC A;  1Q7Y C;  3DXJ C;  1EZ8 A;  2NVQ B;  5IP9 G;  4KK7 A;  1ML0 D;  1CKN B;  3GTM H;  2F4I A;  1A0I A;  4C3I G;  4K5V A;  4DK0 A;  2D2C C;  4LF5 L;  1IBL L;  3S1N B;  3UDF A;  2FXQ A;  1IBL Q;  1C9O A;  1Y8N B;  3HKZ G;  1SSO A;  4LNQ A;  4YCW A;  5D3I B;  3HKZ E;  3RLO A;  1GM5 A;  3HOU H;  3S16 H;  5JVG 3;  1ESF A;  5DAU A;  1K0S A;  1M8A A;  1G2S A;  1HA5 A;  3HOY H;  1R9T H;  2E8G A;  1CFM A;  2JEA I;  1STY A;  5A35 A;  2K28 A;  5NUC A;  4Q0F A;  2YU9 H;  1EYA A;  2JEB I;  4F7X A;  1XTD A;  4V0B A;  3PQI A;  2R7Z B;  1WTQ A;  3L3O C;  4L6T B;  3OYY A;  4A93 B;  1LTA D;  3O13 A;  4QMG A;  5GAG C;  2BE5 D;  2X69 A;  1AZQ A;  1N33 Q;  1WCM B;  4QF4 A;  5IYD H;  1KDC A;  4AYB G;  2HQE A;  4K8J A;  1LTT D;  1LUZ A;  1O78 A;  4AYB E;  4DR1 L;  3UE1 A;  2KHJ A;  3TSS A;  2D9U A;  4IOC A;  1EY6 A;  4YCU A;  1EY5 A;  1UEA B;  1F2M A;  4K6L A;  5FJ8 G;  5K36 G;  4FXG C;  2ZM6 L;  3I3C A;  3GTO B;  2ZM6 Q;  3KF6 A;  4A3D H;  4LUV A;  4ID6 A;  4FYD A;  3DMU A;  4OGQ C;  1G6P A;  4GKK L;  4DPG A;  4BXX H;  4GKK Q;  1XTC D;  3RD4 A;  1XYI A;  3J80 i;  1AH9 A;  2KCC A;  3PO2 B;  1NE3 A;  1RTN A;  2WKC A;  3DHQ A;  2FJ2 A;  1UE6 A;  1TS5 A;  2EE1 A;  3M7N A;  3S1Q B;  3R3O A;  1UE1 A;  2PI2 E;  1TWF H;  4XQJ A;  1E1T A;  4JBM A;  1YI2 A;  2B2T A;  4WRD A;  5LL6 S;  4DV2 L;  5JOB A;  1I50 H;  2Z4H A;  1W3S A;  3A5U A;  5F2D A;  3UDG A;  1FNW A;  4HJA A;  5IYB G;  1YIJ A;  2JJQ A;  5EBC A;  1L1O A;  2PMZ E;  2NZH A;  4KY7 A;  3D0F A;  3PO3 B;  2ICI A;  3TZD A;  2B2W C;  3NWT A;  5BR8 L;  3FKI H;  1SBB B;  1PFB A;  4A3J B;  3SK8 A;  4DR5 L;  1EWC A;  3M4O B;  4K2L A;  1TWC B;  2G9D A;  2XRS D;  3QO2 A;  2EYH A;  2K5H A;  5EBD A;  5IIF A;  2DUD A;  2C5C A;  3K7U C;  1KTK A;  2ZJQ A;  2VXW A;  4WOR A;  5A2Q L;  1G8Z D;  3D8G A;  5IYC H;  2UUC L;  1B4O A;  2CWA A;  2UUC Q;  1ASY A;  1F9R A;  5FO8 B;  4BY1 B;  2SEB D;  1EIF A;  1HNZ L;  3MXN B;  4DXF A;  4ZUI A;  4A3B H;  2XSC A;  2KCT A;  4RG1 A;  3DWA A;  5FO9 B;  4FNF A;  4EQP A;  3FDT A;  1OXU A;  1PYB A;  1V1P B;  4CJ0 B;  1TKW B;  3ULJ A;  2Y0S G;  1PTO B;  3SVM A;  2OXP A;  4XT1 B;  4FDB A;  2Y0S E;  1EOV A;  1LTG D;  2EYP A;  2EVB A;  2DJG C;  3E6Z X;  1KNE A;  2JA5 G;  1DOM A;  4C3J G;  1KAA A;  4JI2 L;  1WD0 A;  2PZU A;  4RWS C;  4JI2 Q;  1QIL A;  1U4M A;  3H0G G;  4R8I A;  2HT1 A;  3H3V H;  1WOC A;  2RSO A;  3A55 A;  2MO0 A;  2NYZ D;  2AQ1 B;  3HKS A;  4DV7 L;  2NVQ H;  3TRE A;  1PH4 A;  3GTL B;  1XWE A;  4K6D A;  1SYF A;  2RCF A;  3S1N H;  4C2M B;  4NXM Q;  2K05 A;  3OW2 A;  2VUM B;  1ROD A;  1B3Q A;  3T1Y L;  3T1Y Q;  2NZ1 D;  2N88 A;  4ZUJ A;  4GLA C;  3BZD B;  4IO9 A;  2E2I B;  3D6C A;  4AIM A;  1RD9 D;  4RHS A;  4ABN A;  4BA2 I;  1L1O C;  5EPK A;  3C3L A;  1ENF A;  1VQJ A;  1U0L A;  3A7A B;  3J81 L;  4G7O C;  2O4X A;  3UI2 A;  2K14 A;  3M4Y A;  1QCB D;  4OWX B;  4ME5 A;  4DAY A;  1ZYR C;  3TQY A;  1YHQ A;  1B70 B;  2EPB A;  2X6L A;  3H3V I;  3IFD A;  3NUC A;  1LTL A;  4YWM A;  5IGE A;  5J3B A;  1WCM H;  2PW5 A;  4A3E G;  2I0Q A;  2A73 B;  3PF5 A;  2A74 C;  3R2T A;  3JAM L;  4YCV A;  1JOK A;  3MFY A;  2IPK D;  2FMM A;  3I4M H;  1HNW L;  5KNC A;  2IX3 A;  1K83 B;  3ER0 A;  1QE6 A;  3P75 A;  4A3F B;  4X65 Q;  1HZ9 A;  1Y8P B;  1GOZ A;  3D4R A;  2JK8 A;  1FL0 A;  4H7B A;  1NCV A;  1EYG A;  3GTQ B;  1ILP A;  5EPJ A;  1ICW A;  4H13 C;  1G6Z A;  2OWO A;  4IUT A;  4X66 L;  4K2K A;  4X66 Q;  2PYK A;  4BBS B;  1SJE D;  5C0X J;  5DNF A;  3PO2 H;  4C3I B;  2ALY B;  2K7V A;  1GUW A;  1HR0 W;  4FO2 A;  3S1Q H;  5C5M A;  1PHJ A;  4EX5 A;  3MHB A;  2L11 A;  2F52 A;  1CHP D;  4B08 A;  4AQY L;  1EIG A;  4KHV A;  1CQV A;  3I73 A;  1U9R A;  2F0G A;  1IBK L;  3VR6 A;  1IBK Q;  2KA7 A;  1PH8 A;  2K5D A;  4UP9 A;  3FP9 A;  3M3Y B;  5LMU Q;  2BDN A;  3EFX D;  3U4Z A;  2CH4 W;  1B44 D;  3J7Z C;  4A3J H;  5GAE C;  5FLM G;  3M4O H;  2OT2 A;  4AYB B;  2K03 A;  4YIJ A;  4CKB A;  1I4R A;  1B3A A;  1X6O A;  1EIY B;  2F0D A;  3SHL A;  3VA7 A;  5E7N A;  1LTR D;  1D5X C;  1PH1 A;  4LAA A;  3NWS A;  2L1B A;  1VQH A;  3NEM A;  1DGS A;  4X6A H;  3G71 A;  1Y69 U;  2A69 D;  2GVA A;  1D5M C;  2QDB A;  4HSV A;  1KL9 A;  2QKI C;  3WOE A;  1T5E A;  4QCL A;  1OO9 B;  4BY1 H;  3T53 B;  4HTH A;  3NTK A;  3STB D;  1PLF A;  4A3L G;  2BOS A;  2F4V L;  2F4V Q;  1Q90 A;  2VZA A;  3CPF A;  1JOR A;  4LF4 L;  1DON A;  3HOX G;  4LF4 Q;  4A3M B;  4I65 A;  1NTG A;  2H4O A;  1D1I A;  4X3T A;  4IUU A;  4B3M L;  4B3M Q;  3CC2 A;  1SJH D;  3FHW A;  3M85 A;  2TSS A;  5CV5 A;  3LNN A;  1SEB D;  1PTO H;  2OTJ A;  1TWG B;  4EQN A;  5AJ3 L;  1X32 A;  2EOT A;  5AJ3 Q;  1I94 L;  4CDC C;  1YNN D;  2F3W A;  2PMZ B;  4ME3 A;  4P72 A;  1Y1W G;  1PFM A;  4GZY C;  1LAB A;  1MJC A;  3CCR A;  1N9W A;  3ULP A;  1EU3 A;  3VYS A;  3PUV A;  4A3G B;  3GD7 A;  1IKL A;  5ELO A;  4DV6 Q;  3V05 A;  3C46 A;  3HOZ G;  5A2Q E;  3G4S A;  1X3E A;  5M3F G;  4DFA A;  3D6W A;  1SRO A;  1HPC A;  4MHE A;  2JA7 B;  1YJN A;  1GHK A;  4A3K G;  3GTL H;  1DCZ A;  1Q8K A;  3U9S A;  3PUZ A;  1PRT B;  2PNH A;  4R1J A;  5C4Z A;  1B9M A;  4B3S L;  4DR7 Q;  3BS1 A;  5FKA C;  2VUM H;  3PIO 3;  3NBI A;  1XMQ L;  1N36 L;  1SNO A;  1YZ6 A;  1N36 Q;  1GO3 E;  4HIM A;  1TU2 B;  1O7I A;  2PQA A;  1EFW A;  2NVT H;  3AU7 A;  2E2I H;  4JV5 L;  3RUZ A;  1IBM L;  4GS3 A;  3ITP A;  1CSP A;  5CMD A;  4GNX A;  1IBM Q;  1FJG Q;  4C3H G;  3VDY A;  4ALP A;  4DAV A;  2VB2 X;  5CC4 A;  2RDF A;  4MZ9 A;  4OWW B;  1N32 L;  2K50 A;  4JCV E;  1L0W A;  1N32 Q;  4XXE A;  2B2U C;  4JI6 Q;  2AWO A;  2F0V A;  1J6Q A;  5JVH 3;  1BVS A;  3MVV A;  1ESR A;  3VR4 A;  2K5W A;  4UP7 A;  3T4A C;  3TP5 A;  1XPU A;  3GTP B;  1CK1 A;  5CV8 A;  1SMY D;  4DUY L;  3HP3 A;  1SDF A;  5I9O A;  4KLK A;  3JC6 6;  4JI3 Q;  3H91 A;  2YTX A;  1B53 A;  4A3I G;  3BVZ A;  3TBI B;  1CA6 A;  5C3E G;  4HID A;  3A8J E;  2JA5 B;  5EAY A;  1F2Y A;  4C3J B;  1NBW A;  4P73 A;  1YNX A;  2BA0 A;  3H0G B;  5HUR A;  2K52 A;  1HH2 P;  1DOK A;  2XVS A;  3GTQ H;  2HCC A;  3EA6 A;  4J1M A;  5CBE E;  4XDX A;  1M4V A;  1XMO Q;  1ENC A;  1HUM A;  5DM7 3;  5IP9 H;  4BBS H;  4K5X A;  1EYC A;  1PV4 A;  4TSS A;  4A3D B;  2JXM B;  4C3I H;  1UE7 A;  4JI1 L;  5J22 A;  4JI1 Q;  5FK9 C;  1TY0 A;  1VQ4 A;  2KCM A;  2AUK A;  2DJF C;  5HY6 A;  3J81 E;  2K5V A;  4DR4 L;  3IRB A;  1VQ6 A;  2AWN A;  2B2Y C;  2UUB L;  2ATW A;  4DR4 Q;  1I4Q A;  2UUB Q;  1SE4 A;  1PTO C;  4NB3 A;  1U4P A;  4RKB A;  2NN6 G;  2SOB A;  3CCJ A;  1LTI D;  1SYG A;  3LX0 A;  5CGK A;  2WAC A;  1B2T A;  1R4Q B;  4JK1 C;  1VQM A;  3OHX C;  2ZXP A;  4DNI A;  2XIW A;  2E76 C;  3QG1 A;  3JAM E;  4KI0 A;  3K5L A;  3NTI A;  4JI0 Q;  3I56 A;  2OQK A;  3X3N A;  2R92 G;  2ZJR A;  2P5Z X;  4PG3 A;  3M3Y H;  2HDM A;  3PV0 A;  3QOL A;  2K1B A;  5IP7 G;  5LL6 X;  1EEI D;  1Z6H A;  2Z6K C;  2DN8 A;  4KN4 C;  2V1C C;  1PRT D;  4R4I A;  5C4X G;  3HRZ C;  1CQF A;  4ZQ3 A;  1S72 A;  1I3Q B;  1AE3 A;  1EU4 A;  1WYD A;  3FKI B;  1W6K A;  2Q8R E;  4C56 C;  2JA6 G;  1FR3 A;  2B63 G;  5KGU A;  4RKL A;  5FJ8 H;  1JWU D;  2Q2I A;  2F0J A;  1KRT A;  1TR5 A;  1EQR A;  1I4H A;  3B6Y A;  2QEX A;  2A69 C;  3SK6 A;  4WFN 3;  3T16 A;  2IJ0 A;  1VDZ A;  2I5M X;  3C1E A;  4PNY A;  3CCM A;  4IPH A;  3STB C;  1LT6 D;  5JPM C;  3H94 A;  3W1B A;  3CD6 A;  1DM0 B;  1NR2 A;  4A3M H;  3S15 B;  3V96 A;  1A62 A;  1VQI A;  3K59 A;  4QUC A;  5ISR A;  4N9P A;  3H6M A;  3J81 j;  3KLR A;  4HJ5 A;  1GHJ A;  3CMA A;  1TWG H;  4I7A A;  1KNA A;  2UXD Q;  3NE5 B;  4RH6 A;  4PMB A;  4PZ6 A;  3DM3 A;  1GKH A;  4OEM B;  1YNN C;  2E2H B;  3M9B A;  1PH5 A;  4X3K A;  3PCO B;  5IGB A;  4GN3 B;  3HGB A;  3NQI A;  2B8F A;  4KN7 C;  5BN4 A;  5I4D A;  4ZAI A;  1YJW A;  2F03 A;  4B3T L;  2I5H A;  4QGU A;  1CZW A;  3HS0 C;  4KY5 A;  1SYC A;  2BCO A;  4QY7 A;  2JA7 H;  5ELC A;  1ET9 A;  3OMG A;  2KVM A;  2FMC A;  1SE3 A;  4DV4 L;  1K9M C;  2E2J H;  2PW7 A;  3HFZ B;  2WB1 G;  2WFW A;  3K8A A;  4BBR G;  1Y1V B;  2ID0 A;  4KTA A;  2VY3 A;  2IT1 A;  2WB1 E;  3P20 A;  3K5M A;  1TQO A;  4IFD G;  3GO5 A;  4LF5 Q;  1UUP A;  4R4T A;  2L4N A;  1L0X B;  3ICE A;  5E4W C;  3GTK B;  1VQE A;  4RCN A;  4A76 A;  4MTK A;  4JG2 A;  4DU9 A;  2EDG A;  3BG3 A;  3KBG A;  4EGV A;  1ET6 A;  3PUY A;  1H9K A;  1ZYR D;  2WP8 J;  1YNJ D;  3GTP H;  1HTP A;  1LT5 D;  2K04 A;  1VQ5 A;  1EWH A;  1PH9 A;  1SMY C;  3QWN A;  4GLX A;  1X3G A;  3PF4 A;  3MXU A;  2F3I A;  4CJ2 C;  5IGG A;  2JA5 H;  3CXC A;  4C3J H;  4DAP A;  3PIP 3;  1LTB D;  1K8M A;  4IZ8 A;  1NR4 A;  1STH A;  3H0G H;  1B7Y B;  1Q12 A;  1A2T A;  4DR1 Q;  1KXL A;  3I4M B;  2XNA C;  1MHW C;  2CVR A;  4P71 A;  4GN4 B;  4HSP A;  3HOZ B;  5M3F B;  4EVO A;  5D14 A;  3MC0 B;  1KLU D;  3CME A;  1JWM D;  1Y14 B;  4G7H C;  4A3K B;  1WTO A;  2BH8 A;  4JBK A;  3LWE A;  3J80 c;  1PXU A;  4IUP A;  1XNQ L;  1DZ1 A;  4FXD A;  1KQS A;  4DN4 M;  5CV7 A;  5DLQ E;  2MQH A;  1TVX A;  3K80 C;  4OO1 G;  5FO7 B;  1XXG A;  1IYV A;  1BR9 A;  4C3H B;  2X6G A;  3SK5 A;  3NHH A;  5C44 B;  5EGT A;  4L5R C;  3F8T A;  2D62 A;  3S14 B;  1K8O A;  4M8A A;  4JI7 L;  1SNP A;  5IT9 L;  5DEH A;  4DV2 Q;  1J9O A;  3KDF A;  4OX9 L;  1VMP A;  2D5D A;  2MNA A;  4QIW E;  1W2B A;  2PO4 A;  5LMN L;  5D65 A;  2MFI A;  5LMN Q;  2J0T D;  3OOC A;  4KY6 A;  3BDC A;  1X54 A;  2AKW B;  4QQB X;  4LF7 L;  3VR2 A;  4LF7 Q;  1A3U A;  1PRT C;  2K6A A;  1E24 A;  3BZC A;  3J81 c;  4ZK9 B;  2QF7 A;  1I3Q H;  4DR6 L;  5BR8 Q;  1HHV A;  4DR6 Q;  2EYO A;  3HZX A;  3KUP A;  3NXW A;  3J81 i;  3Q24 A;  4OIJ A;  5JPN C;  4DR5 Q;  2UXB L;  3U50 C;  2ZTC A;  1K28 A;  3LWU A;  1IYU A;  2BA1 A;  3PMF A;  4GKJ L;  2VQF L;  1PTO F;  1LV9 A;  4GKJ Q;  1STG A;  5KND A;  2VQF Q;  2PZW A;  1HTL D;  2A5H A;  3EVQ A;  2EYJ A;  3I4N G;  2D0P A;  3CRK C;  3JAM c;  3SK4 A;  3K5N A;  3K7A B;  2A19 A;  2VS1 A;  1MGS A;  2HIV A;  4JI4 L;  3JAM i;  4DV0 L;  4JI4 Q;  4DV0 Q;  4RGO S;  1CI3 M;  4RAU C;  4XQQ A;  5KEE A;  3RLF A;  3S15 H;  5C5L A;  1Q8I A;  1FGU A;  1HNZ Q;  4FF2 A;  5M9O A;  2ZXR A;  1XX8 A;  1RKN A;  1MD2 D;  3MXG A;  1O80 A;  1HQM C;  1IL2 A;  4XIG S;  3I4O A;  3AB9 A;  2F0L A;  5IE8 A;  4YY3 L;  2M2L A;  4O1N A;  4YY3 Q;  3SR1 A;  1OXX K;  3FPU B;  2Q2H A;  1VQ8 A;  1SLJ A;  2Q8I B;  2E2H H;  1G51 A;  5E3F A;  5I6W A;  4R8N A;  1Z9F A;  4KKT A;  4LFB L;  5ELB A;  4APV A;  4LFB Q;  2F0F A;  2QIL A;  3J7A F;  4WJ3 M;  4H0L C;  2R61 A;  2HUG A;  1G29 1;  3U9O A;  2BH2 A;  5M3M G;  5FLM H;  2OTL A;  1PZJ D;  3GTG H;  5C4X B;  2KEC A;  3FEW X;  3HOY G;  1S40 A;  4BY7 B;  2WAQ G;  3EN2 A;  1NMF A;  2WAQ E;  4DV7 Q;  1MBY A;  2J4X A;  2B63 B;  3AYH B;  2D0O A;  4DK1 A;  1CKN A;  3HEJ A;  1Y1V H;  1PFS A;  1E0B A;  1I6H H;  3K0Y A;  4NXN L;  1W6J A;  1EOT A;  4NXN Q;  3QR8 A;  3RR5 A;  4LFA L;  5D3D A;  4DAM A;  2AMC B;  3T13 A;  4KHZ A;  3U4V A;  1PYW D;  3GTK H;  3KF8 B;  4DUZ L;  4A3L H;  4HN7 A;  3UDX A;  5ELE A;  5JEA G;  1D1K A;  4UAI A;  3X3M A;  1BNZ A;  3DEO A;  2NVT B;  1VMC A;  2SDF A;  3TEH B;  3EJI A;  3HOW G;  1LAC A;  4G57 A;  1YVC A;  1ASZ A;  2FHT A;  1V8Q A;  1YNJ C;  3CCS A;  2IWH A;  3T1H L;  3T1H Q;  1Y1W H;  3OW7 A;  4JBJ A;  3DM1 A;  2MGS A;  1VQO A;  3HOV G;  3S24 A;  1N34 L;  4PQX A;  1N34 Q;  1HNW Q;  1C48 A;  1ONL A;  4JVZ A;  3HOZ H;  1RJT A;  5M3F H;  1TS2 A;  3OTO L;  4DKA C;  5COR A;  4L8J A;  5C3X A;  4IUV A;  1NAP A;  2CW0 C;  5EPL A;  4X64 L;  3U58 A;  4X64 Q;  5ELF A;  3E3X A;  4A3K H;  1GJX A;  5L37 A;  1BCP B;  2NZO A;  3DWQ A;  5AFW A;  4U67 3;  2SNM A;  2NTT A;  4PZ8 A;  5CV9 A;  3CCU A;  2OQ0 A;  3J7A 5;  2MO1 A;  2IHF A;  2FFK B;  2WB1 B;  2VNU D;  2NBF A;  4BBR B;  1A2U A;  1JJC B;  3FPP A;  5K5P A;  1D5Z C;  3I90 A;  1VQF A;  4K8I A;  1ZEQ X;  2KBN A;  3HKZ B;  4C3H H;  1PTO D;  3CU7 A;  5C44 H;  1L2F A;  3S14 H;  1TT2 A;  4J6H A;  1QVC A;  4NP5 A;  3PGZ A;  3L0O A;  3MWY W;  4AQY Q;  4TKO B;  4DR3 L;  5IYC G;  3H3V C;  1O7Z A;  1RF2 D;  1VQB A;  3E0E A;  3KLS A;  2YYZ A;  4CDD C;  1KDA A;  2B2U A;  2F0E A;  4CHT B;  2JN4 A;  4LFC L;  4LFC Q;  5C3E H;  2EYF A;  4M1U B;  3VYU A;  4K0K L;  3NEL A;  5CV6 A;  1BXT A;  3ND9 A;  4K0K Q;  2QCP X;  2FIN B;  2H5X A;  4DK3 C;  3TP7 A;  2HD3 A;  4MNO A;  1FD7 D;  4LJZ C;  5BN5 A;  1A8V A;  1UAP A;  2NWG A;  3K7A H;  1AP0 A;  1CA5 A;  5FOB B;  1V9P A;  3E0J A;  4H02 A;  3CRL C;  1X3F A;  3P1H A;  2LKV A;  1IW7 D;  1H9S B;  4FVM A;  3MEF A;  3MAQ A;  1X3Q A;  3NBH B;  1SMX A;  3GDE A;  5IT9 E;  3QJY A;  1SR3 A;  3MXN A;  4C1N K;  4MIU A;  4IJL A;  1EEF D;  4GN5 A;  4RFB A;  3GQB A;  1PRT F;  2ICE C;  2NN6 H;  4ZYS A;  4LUZ A;  1HNX L;  4S3S A;  3MA2 B;  1KHI A;  5EKL A;  1A3V A;  1V1P A;  2B2Y A;  2B2V C;  2ENB A;  2WKD A;  4RMF A;  5EQ0 A;  3QB3 A;  4LUO A;  1SE2 A;  1V1O A;  2K5N A;  5GRO A;  4JI8 L;  4HJ9 A;  3RNU A;  2R92 H;  1RIP A;  5GAD C;  1I94 Q;  2A6E D;  5IP7 H;  1I4P A;  2DY8 A;  4UP8 A;  4NDX A;  3L9A X;  1BDO A;  4FF3 A;  1E22 A;  1K3B C;  1IZ6 A;  5C4X H;  1B9N A;  1VF7 A;  4L63 B;  4Y7N B;  4BY7 H;  3RN2 A;  2L5T A;  1Q46 A;  5CBA E;  2IHE A;  2KHI A;  1B8A A;  1G91 A;  1STE A;  2Z6K A;  3NP8 A;  2B63 H;  2R7Z G;  4A93 G;  5JJI A;  1X56 A;  4IUR A;  4J15 A;  4F8M A;  4LW1 A;  3CAM A;  2A68 C;  2KOL A;  1HCZ A;  1EQQ A;  1WCM G;  4B3S Q;  4NKL A;  1QVG A;  2EJF C;  2NN6 I;  3DEP A;  2E2J B;  3DWP A;  1QUQ B;  1RTO A;  3MZ5 A;  5JJL A;  5M5X H;  1WFQ A;  1XMQ Q;  5T1G A;  2M9V A;  3ONA B;  3KLS X;  1FVI A;  4K5W A;  5TSS A;  4GOP B;  4JV5 Q;  5G3L D;  1VCI A;  3RZO B;  2TMP A;  3ERO A;  3UDI A;  1WTP A;  4IJH A;  4WJW A;  3M7G A;  4DA2 A;  2QEJ C;  1CM9 A;  1MIU A;  1PH3 A;  4LF6 L;  3RZD B;  4YHH L;  2L12 A;  4ZKB B;  3SDZ A;  4LF6 Q;  4YHH Q;  3TS2 A;  1BOS A;  2UUA L;  3KFU A;  2F0S A;  2XN9 C;  2Y0S B;  4DUY Q;  4HJ8 A;  1JWS D;  3D3R A;  3W5O A;  1QG7 A;  1WI5 A;  1OXT A;  4IPC A;  1QNU A;  5M3M B;  4XYQ A;  1HA6 A;  2RQX A;  4QL5 A;  5C6A A;  3ND8 A;  1MJE A;  1D8L A;  4K14 A;  4L5S A;  2CH4 A;  3OPO A;  1CKO A;  1QB5 D;  3PO3 G;  1PH7 A;  3EIV A;  4DR2 L;  1MSH A;  1STB A;  2H1E A;  5IGD A;  4BBR H;  4A3C G;  1A3T A;  1PH2 A;  3Q0A A;  2HDL A;  3CW2 C;  1HZC A;  4IFD H;  1TWA B;  3BU2 A;  3S9W A;  2R93 G;  3TDQ A;  5HGQ A;  2CCZ A;  3CCV A;  3SE0 A;  3SGI A;  2KUM A;  1SYD A;  1U5K A;  3J7Y W;  1FNU A;  3I91 A;  3N6R A;  1XNR L;  4P74 A;  2F0M A;  3QIA A;  4A75 A;  3HOW B;  3KF6 B;  3ERS X;  4HR7 B;  1BO0 A;  3CPW A;  2CWP A;  3UE0 A;  3L7Z C;  4BY1 G;  4L5Q A;  1H95 A;  4DV5 L;  2YV5 A;  5I2X A;  1JOO A;  1FYC A;  2I46 A;  1S5B D;  3NTH A;  4A3E B;  5M5W B;  1S3O A;  4LF9 L;  1JE5 A;  4LF9 Q;  1B1Z A;  3HOV B;  3K81 C;  2LY7 A;  1QOH A;  1Q1B A;  2B3G A;  3LGJ A;  4HMI A;  3OSO A;  1T5X D;  1ZXT A;  4IFD I;  3ULL A;  5K36 H;  1FNV A;  1UEB A;  3URY A;  1Y8O B;  4Z9C B;  1L1O B;  1YHB A;  1IW7 C;  1XPO A;  3RN5 A;  4Y52 H;  5IWA L;  2VW9 A;  3I2Z A;  1PVO A;  1HZB A;  4WJ4 A;  1JJ2 A;  1EY7 A;  1HFG A;  3CCL A;  4DV1 L;  4DV1 Q;  2PI2 A;  5KNB A;  3AFQ A;  4MN3 A;  2ZT9 C;  2WIN B;  4KHP L;  2VUM G;  1JIC A;  1U4L A;  3A0J A;  1NY4 A;  5IYB H;  4G4K A;  2A6E C;  1HQR D;  4PZ7 A;  4RCO A;  1H9R A;  1J5E L;  1BCP C;  1KLG D;  4KMU C;  1J5E Q;  4Y7N H;  3CQZ H;  5IT9 c;  3W2D A;  2JA8 G;  4O0A A;  2KCN A;  4B3T Q;  2ZXO A;  1L0Y B;  3RLN A;  1EQV A;  5C0X I;  4DGZ A;  1HUN A;  3GTG B;  4RGT A;  4DF7 A;  1D2B A;  2R6G A;  3K0X A;  1EL0 A;  3FVQ A;  5FLX L;  2VB3 X;  4KJN A;  1BQQ T;  4L5T A;  1TII D;  1UNS A;  3I4N H;  4DV4 Q;  4R9W A;  2Z1C A;  3Q6S A;  4OO1 I;  1OXV A;  1QUQ A;  3Q22 A;  1NMG A;  1VQN A;  1E1O A;  1Q82 C;  4J8Q A;  5CV4 A;  3S1R B;  1I6H B;  4OON A;  1HFN A;  4A3F G;  2QW7 A;  5T1I A;  2AUJ D;  1EIH A;  2MHV A;  1BBX C;  4PMC A;  1LM0 A;  3WDN A;  3RZO H;  3BVM A;  2JQO A;  1GUS A;  4BWG B;  4CBV A;  1K0R A;  1ZKO A;  3TN2 A;  2EZV A;  1D7Q A;  3BVG A;  5KRU A;  1E2Z A;  3HOX B;  4BBS G;  2EY5 A;  2LS0 1;  5CR3 A;  5JAV A;  3RZD H;  1YIT A;  4OL7 A;  3ERQ A;  1FGB D;  2RDG A;  2F3V A;  2EY1 A;  1LTS D;  2DY7 A;  1TS3 A;  2G5D A;  4UHV A;  4AH6 A;  2ZJP A;  1Y1W B;  5HGT A;  3K57 A;  2HHH L;  3PUW A;  2HHH Q;  2G9H D;  2M00 A;  5M3M H;  1KC8 C;  1EZ6 A;  1S4Z A;  1SND A;  3ZJY C;  4G7Z C;  2N55 A;  2JE6 I;  3CKI B;  1U4R A;  4DAY B;  2EJM A;  2CW0 D;  3S2D B;  2ZTD A;  4YWL A;  3KLW A;  2XWJ B;  1KD1 C;  1SE8 A;  3A8K E;  1OXS C;  2AHO B;  3K58 A;  1Q86 C;  1N33 L;  2O5J C;  2YTY A;  3CHB D;  4DXG A;  1AEX A;  5C0X G;  2XTI A;  4OWT B;  1LYL A;  5LMN W;  4EQO A;  1TWA H;  3F2B A;  1XNQ Q;  3C1F A;  4HIK A;  2HQL A;  4B9X A;  2QA4 A;  1BUV T;  1JOQ A;  1KAB A;  2E2D C;  4DNT B;  5JEA H;  3D31 A;  2AQ2 B;  2E74 C;  1M90 C;  1JC7 A;  1E3P A;  1S5C D;  1SNC A;  3BYT B;  1F77 A;  1A6X A;  1SNM A;  3GV6 A;  4JOI C;  4PV1 C;  3HOW H;  3CP0 A;  3WWV A;  5KYI A;  1PDQ A;  3AEV A;  2XWB B;  4EQ5 A;  1AE2 A;  4JI7 Q;  1IXR A;  2K5Q A;  1I4X A;  1WVL A;  1V43 A;  3BDL A;  4IPD A;  4RHR A;  1QWY A;  3NK9 A;  4OX9 Q;  3QOJ A;  3PSI A;  1O7L A;  1C4Q A;  5IGC A;  1SXT A;  1KIX A;  1IKM A;  2K4K A;  1F9Q A;  2NVY H;  3T51 B;  4A3E H;  5M5W H;  4A3M G;  2F0W A;  2N78 A;  5EJW A;  1K8A C;  3EQL C;  3R93 A;  3CC7 A;  3HOV H;  2EY6 A;  1OTC A;  1RHP A;  1UWV A;  3F2C A;  3Q23 A;  2QDL A;  4A3I B;  1CHQ D;  2VL6 A;  1KAW A;  3HG9 A;  4H44 C;  3PUX A;  5C3E B;  2GVB A;  1B50 A;  2UXB Q;  5IOC A;  1VQ9 A;  3GTJ B;  4FF4 A;  3VR5 A;  1WTW A;  2BDO A;  4IOA A;  4GOP C;  4DV3 L;  3RMH A;  3D4W A;  1R4P B;  4DV3 Q;  2V4D A;  4A3G G;  5EKI A;  3I4L A;  2MPM A;  3VR3 A;  2Q2T A;  3P7J A;  3L2P A;  1JJG A;  4OIK A;  1WTX A;  2LFN A;  5C4H A;  2JA9 A;  4UPA A;  2JA7 G;  2CQO A;  5C3W A;  1LLR D;  1SRU A;  2R93 B;  4I7Z C;  3IFT A;  1I5F A;  1EY4 A;  4NW2 A;  1PZK D;  3G7L A;  3GP7 A;  1C7Y A;  1HJP A;  4HIO A;  3NQT A;  1VS0 A;  3KK7 A;  2F0O A;  3M4P A;  3AFP A;  2YTV A;  2QGQ A;  2Q8T A;  4XYO A;  2RCN A;  2F1M A;  1F9P A;  1PFN A;  2RA4 A;  2GA4 B;  4PMW A;  2EXD A;  3DUZ A;  3KYH C;  1STA A;  4ULL A;  2IW3 A;  1SFO H;  4N8X 1;  3PIO A;  1EFI D;  2R92 B;  4IUQ A;  1SAP A;  1X9N A;  4RGN A;  3BJU A;  5ELN A;  1NJI C;  3HOU G;  4IAL A;  5IY0 A;  4E6I A;  1BF4 A;  2E5L L;  3R8B A;  2E5L Q;  1E7Z A;  3OWE B;  1NUC A;  1RL2 A;  2EXZ A;  3I72 A;  3Q8D A;  2A6H C;  3M4Q A;  1CTM A;  2PCF B;  2Z0S A;  4CDE C;  3G6J B;  3I70 A;  4O2D A;  2F0H A;  3I8Z A;  5C4J B;  2C35 B;  2Q2U A;  5M5Y B;  2JA6 B;  4LF8 L;  2A68 D;  1ILQ A;  2KQ3 A;  4LF8 Q;  2IL8 A;  2K33 A;  1HZA A;  1WJJ A;  4XT3 B;  3S1R H;  5KIX A;  5IYD G;  3NPP A;  4MTN A;  2A8V A;  1X3P A;  4LFA Q;  3FRP B;  3J80 L;  2EQS A;  4JW0 A;  5M5X B;  4DUZ Q;  1AN8 A;  3WOF A;  1BCP F;  3HOX H;  1SNQ A;  1VQK A;  1P8L A;  4A3D G;  2R7D A;  4CJ1 B;  1I6V C;  1Z7T A;  3OIP A;  4NMZ A;  1VQP A;  1A63 A;  4NXM L;  3MFG A;  2CQA A;  4BXX G;  2B2T C;  1S5F D;  1VF5 C;  2IX0 A;  4IFD J;  2PQA B;  1VQG A;  2Z8L A;  4B3R L;  4N8F A;  4GNX B;  1I4G A;  5FLX E;  2B2V A;  4B3R Q;  1GD7 A;  1BBW A;  1RDP D;  1QZH A;  4ILW A;  4Q5V A;  2L0C A;  4O42 A;  4N9T A;  2JA8 B;  5I6Y A;  2ASB A;  3S2D H;  4RA8 A;  3VYR A;  2PNR C;  3OTO Q;  2SNS A;  2R7Z H;  4A93 H;  5G3L F;  1WTR A;  2F0T A;  1H9M A;  2K01 A;  1SN8 A;  2O2L D;  4JI5 L;  2BE5 C;  4JI5 Q;  5CYU A;  3A54 A;  3AQQ A;  2RDH A;  4IQZ A;  1SYE A;  3J7A V;  2N8N A;  1K3R A;  3E9I A;  1F2Z A;  4XTC S;  3FKI G;  3F2D A;  2JYO A;  1D6E C;  4JPB W;  4ZRZ A;  1CSQ A;  4X65 L;  2R3Z A;  4R4C A;  5JJK A;  4QUF A;  3KBX A;  1PYS B;  1C8C A;  1EY9 A;  4ZLT F;  3GTO H;  1GVP A;  3TZU A;  1NSN S;  4UY8 C;  2CFM A;  4XQN A;  1O7Y A;  2XRQ D;  1HXY D;  1E2V A;  4OEL B;  5DM6 3;  2F0I A;  4DR3 Q;  1STN A;  2LXK A;  2OEO A;  4BS9 A;  3NSW A;  2KEN A;  1EY8 A;  4TVA B;  2VQE L;  4UDU C;  4A3B G;  2VQE Q;  3OMC A;  4A3I H;  1RCV D;  1QVF A;  3S2H B;  4LWC A;  5EKK A;  2EYM A;  1DYQ A;  4KJO A;  3GTJ H;  1UE5 A;  2K32 A;  3A56 A;  3E9H A;  3K6O A;  4ZKC B;  1S5E D;  1V1Q A;  3PO3 H;  1YHA A;  4HED A;  3IAY A;  5LMU L;  5JJZ A;  1MSG A;  2KEE A;  2K75 A;  4A3C H;  1IL8 A;  2HCI A;  2JP1 A;  1HR0 L;  1YBY A;  1HR0 Q;  1VQC A;  1TWC H;  3BZK A;  2R93 H;  1LO5 D;  1K73 C;  2RHS B;  1Q1E A;  4X3S A;  2B8G A;  3I7F A;  1CUK A;  5LHY 1;  3TME A;  4R4O A;  2OF1 A;  1SYB A;  3ZYY X;  4HJ7 A;  2IY5 B;  2WV6 D;  3MEH A;  4CKE A;  1Y1V G;  1HNX Q;  1QZG A;  2XGT A;  1MKH A;  4HMJ A;  1Z47 A;  4JI8 Q;  4KKU A;  4IN3 A;  3G48 A;  2RBM A;  4OXP A;  4QIW B;  3CCQ A;  1JCK B;  2MJ8 A;  2DNE A;  2KED A;  2A1A A;  1TWH B;  3N52 A;  1GUO A;  1BCP D;  2MP1 A;  2RKS A;  1H9J A;  4CGY B;  3MTS A;  3CQZ B;  3S1M B;  2NB0 A;  3EBE A;  3BYY B;  2C9O A;  5C4J H;  2CKZ B;  1CT1 D;  5I9P A;  5M5Y H;  4YWK A;  2JA6 H;  4KD4 A;  2L9H A;  2Z9H A;  1X55 A;  1T9H A;  4B9W A;  1DD2 A;  3VA5 A;  3CCE A;  2CHB D;  3I4N B;  2PZT A;  1GXD C;  1YEZ A;  4DNR B;  2HIX A;  2Z6B A;  5J1Z A;  3KF8 A;  3I4M G;  4DV6 L;  3A7L A;  1JQY D;  3KJP A;  2NVX B;  1ICF B;  1CZG A;  3PIP A;  4FP5 D;  5H1S E;  4F88 A;  3S17 B;  3C2P A;  3E5S A;  1EY0 A;  4DR7 L;  4IUN A;  1II3 A;  5ELD A;  1AFP A;  2F0U A;  2AQ3 B;  5IGF A;  4C2M H;  2UU9 L;  4JC0 A;  2B39 A;  4FF1 A;  2UU9 Q;  4BA1 I;  2E75 C;  1ENA A;  1S5D D;  3GTM B;  3PO2 G;  2WII B;  3V2T A; 
#chains in the Genus database with same CATH homology
 1DOL A;  1JE4 A;  5JEA J;  4LK1 C;  3HOU B;  3S16 B;  4U68 A;  4OHJ A;  1F2L A;  1MI2 A;  5COY A;  3A8I E;  3HOY B;  5BN3 A;  1R9T B;  1DJR D;  1E2W A;  1G2T A;  3J80 E;  1WD1 A;  3IKJ A;  2WAQ B;  2YU9 B;  1TS4 A;  4KV6 A;  3F2U A;  1A15 A;  2DNC A;  2JSO A;  1QJO A;  2EY2 A;  2PQE A;  1GUG A;  4KKS A;  4CKC A;  3D4D A;  4C1N I;  2EYL A;  2J7Z A;  3TP6 A;  1LT4 D;  4KD3 A;  2NTS A;  1QNK A;  5IOD A;  1Q3L A;  1WTV A;  1F9S A;  1AW7 A;  2EJG C;  2NVY B;  1J8I A;  2L55 A;  3TP8 A;  4TRD A;  1TWF B;  3R2I A;  3FMC A;  5KYL A;  5J39 A;  3OWF A;  2F0Q A;  1I50 B;  4LMQ D;  4HCS A;  3VYT A;  4X3U A;  4F87 A;  1EYD A;  1H9S A;  5C0X H;  1KDB A;  3NBH A;  1IHZ A;  5I2Y A;  1EQT A;  1JR0 D;  2F0N A;  3AMU A;  2RVL A;  4OO1 H;  2F0K A;  3K5O A;  4QB4 A;  4V19 0;  1PZI D;  1LT3 D;  1HRJ A;  1PMR A;  4JBW A;  2KHS A;  2NUC A;  3SXH A;  2O5I C;  1DXM A;  1GUN A;  4HAE A;  4TQU S;  3T56 B;  1SFO B;  3OIQ A;  3SEB A;  4P2C B;  4A3B B;  2A6H D;  3MXP A;  4RGM A;  5E1F A;  4HCE A;  2LMC B;  2RSN A;  3GV3 A;  2F0P A;  3H09 A;  1AZP A;  1GUT A;  2KJX A;  2MUY A;  2Z4I A;  4FXK C;  4ODG A;  3BDO A;  1TY2 A;  3W3A A;  5E4X A;  2IX1 A;  1JB3 A;  3IL8 A;  2I07 B;  2PPB C;  2B2W A;  3DXJ C;  1EZ8 A;  2NVQ B;  4KK7 A;  1ML0 D;  2F4I A;  4C3I G;  4K5V A;  4DK0 A;  2D2C C;  3S1N B;  1Y8N B;  1SSO A;  5D3I B;  5JVG 3;  1ESF A;  5DAU A;  1M8A A;  1G2S A;  1HA5 A;  1CFM A;  2JEA I;  1STY A;  5A35 A;  2K28 A;  5NUC A;  4Q0F A;  1EYA A;  2JEB I;  4F7X A;  4V0B A;  2R7Z B;  1WTQ A;  3L3O C;  4L6T B;  4A93 B;  1LTA D;  3O13 A;  4QMG A;  2BE5 D;  2X69 A;  1AZQ A;  1WCM B;  4QF4 A;  1KDC A;  2HQE A;  4K8J A;  1LTT D;  1O78 A;  3TSS A;  2D9U A;  1EY6 A;  1EY5 A;  1UEA B;  1F2M A;  4K6L A;  5K36 G;  4FXG C;  3I3C A;  3GTO B;  4ID6 A;  4FYD A;  3DMU A;  4OGQ C;  1XTC D;  3RD4 A;  1XYI A;  2KCC A;  3PO2 B;  1RTN A;  2WKC A;  3DHQ A;  2FJ2 A;  1TS5 A;  2EE1 A;  3M7N A;  3S1Q B;  3R3O A;  4XQJ A;  2B2T A;  4WRD A;  5LL6 S;  5JOB A;  2Z4H A;  5F2D A;  1FNW A;  5EBC A;  4KY7 A;  3PO3 B;  2ICI A;  3TZD A;  2B2W C;  3NWT A;  1SBB B;  1PFB A;  4A3J B;  3SK8 A;  1EWC A;  3M4O B;  4K2L A;  1TWC B;  2G9D A;  2XRS D;  3QO2 A;  2EYH A;  5EBD A;  5IIF A;  2C5C A;  1KTK A;  2VXW A;  4WOR A;  5A2Q L;  1G8Z D;  3D8G A;  1B4O A;  1F9R A;  5FO8 B;  4BY1 B;  2SEB D;  4DXF A;  4ZUI A;  2XSC A;  3DWA A;  5FO9 B;  4FNF A;  4EQP A;  3FDT A;  1OXU A;  1V1P B;  4CJ0 B;  1TKW B;  1PTO B;  3SVM A;  2OXP A;  4XT1 B;  1LTG D;  2EYP A;  2EVB A;  3E6Z X;  1KNE A;  1DOM A;  4C3J G;  1KAA A;  1WD0 A;  2PZU A;  4RWS C;  1QIL A;  1U4M A;  4R8I A;  2RSO A;  3A55 A;  2NYZ D;  2AQ1 B;  3GTL B;  1XWE A;  4K6D A;  1SYF A;  4C2M B;  2K05 A;  2VUM B;  1ROD A;  2NZ1 D;  2N88 A;  4ZUJ A;  3BZD B;  2E2I B;  3D6C A;  1RD9 D;  4RHS A;  4ABN A;  4BA2 I;  5EPK A;  3C3L A;  1ENF A;  3A7A B;  3J81 L;  4G7O C;  2O4X A;  3UI2 A;  3M4Y A;  1QCB D;  4DAY A;  4ME5 A;  1ZYR C;  2EPB A;  2X6L A;  3IFD A;  3NUC A;  5IGE A;  2PW5 A;  2A73 B;  2A74 C;  3R2T A;  3JAM L;  1JOK A;  3MFY A;  2IPK D;  2FMM A;  5KNC A;  2IX3 A;  1K83 B;  1QE6 A;  3P75 A;  4A3F B;  1Y8P B;  1GOZ A;  3D4R A;  4H7B A;  1NCV A;  1ILP A;  3GTQ B;  5EPJ A;  1ICW A;  4H13 C;  1G6Z A;  4IUT A;  4K2K A;  2PYK A;  4BBS B;  1SJE D;  5C0X J;  5DNF A;  4C3I B;  1GUW A;  2K7V A;  4FO2 A;  5C5M A;  3MHB A;  2L11 A;  1CHP D;  4B08 A;  1EIG A;  4KHV A;  1CQV A;  3I73 A;  1U9R A;  2F0G A;  3VR6 A;  2KA7 A;  2K5D A;  3M3Y B;  2BDN A;  3EFX D;  1B44 D;  2OT2 A;  4AYB B;  2K03 A;  4YIJ A;  4CKB A;  1I4R A;  1B3A A;  2F0D A;  3SHL A;  3VA7 A;  1LTR D;  1D5X C;  4LAA A;  3NWS A;  2L1B A;  1Y69 U;  2A69 D;  1D5M C;  2QDB A;  4HSV A;  2QKI C;  3WOE A;  1T5E A;  4QCL A;  1OO9 B;  3T53 B;  4HTH A;  3NTK A;  1PLF A;  2BOS A;  1Q90 A;  1JOR A;  1DON A;  4A3M B;  4I65 A;  2H4O A;  1D1I A;  4X3T A;  4IUU A;  1SJH D;  3M85 A;  2TSS A;  5CV5 A;  3LNN A;  1SEB D;  1PTO H;  1TWG B;  4EQN A;  1X32 A;  2EOT A;  1YNN D;  2F3W A;  2PMZ B;  1PFM A;  4GZY C;  1LAB A;  1EU3 A;  3VYS A;  3PUV A;  4A3G B;  3GD7 A;  1IKL A;  3V05 A;  3C46 A;  5A2Q E;  4DFA A;  3D6W A;  1HPC A;  4MHE A;  2JA7 B;  1GHK A;  1DCZ A;  3U9S A;  3PUZ A;  1PRT B;  5C4Z A;  1B9M A;  3BS1 A;  5FKA C;  3PIO 3;  3NBI A;  1SNO A;  1TU2 B;  3AU7 A;  3RUZ A;  3ITP A;  5CMD A;  4C3H G;  4DAV A;  2VB2 X;  5CC4 A;  2RDF A;  4XXE A;  2B2U C;  2AWO A;  2F0V A;  5JVH 3;  3MVV A;  1ESR A;  3VR4 A;  2K5W A;  3T4A C;  3TP5 A;  3GTP B;  1CK1 A;  5CV8 A;  1SMY D;  3HP3 A;  1SDF A;  5I9O A;  3H91 A;  1B53 A;  3BVZ A;  3TBI B;  1CA6 A;  3A8J E;  2JA5 B;  1F2Y A;  4C3J B;  2BA0 A;  3H0G B;  5HUR A;  1DOK A;  2XVS A;  2HCC A;  3EA6 A;  4J1M A;  5CBE E;  4XDX A;  1M4V A;  1ENC A;  1HUM A;  5DM7 3;  4K5X A;  1EYC A;  4A3D B;  4TSS A;  2JXM B;  5J22 A;  5FK9 C;  1TY0 A;  2AUK A;  3J81 E;  2AWN A;  2B2Y C;  1I4Q A;  1SE4 A;  1PTO C;  1U4P A;  4RKB A;  2NN6 G;  2SOB A;  1LTI D;  1SYG A;  3LX0 A;  5CGK A;  2WAC A;  1B2T A;  1R4Q B;  4JK1 C;  3OHX C;  2ZXP A;  2XIW A;  2E76 C;  3QG1 A;  3JAM E;  4KI0 A;  3K5L A;  3NTI A;  3X3N A;  2HDM A;  3PV0 A;  3QOL A;  2K1B A;  5LL6 X;  1EEI D;  1Z6H A;  2DN8 A;  4KN4 C;  1PRT D;  3HRZ C;  1CQF A;  4ZQ3 A;  1I3Q B;  1EU4 A;  3FKI B;  1W6K A;  2Q8R E;  4C56 C;  1FR3 A;  5KGU A;  4RKL A;  1JWU D;  2F0J A;  1TR5 A;  1I4H A;  2A69 C;  3SK6 A;  4WFN 3;  3T16 A;  2IJ0 A;  1VDZ A;  3C1E A;  4PNY A;  1LT6 D;  5JPM C;  3H94 A;  1DM0 B;  1NR2 A;  3S15 B;  3V96 A;  3K59 A;  4QUC A;  5ISR A;  4N9P A;  3H6M A;  3KLR A;  1GHJ A;  1KNA A;  3NE5 B;  4RH6 A;  4PMB A;  1YNN C;  2E2H B;  4X3K A;  5IGB A;  5I4D A;  4KN7 C;  3HGB A;  3NQI A;  2B8F A;  5BN4 A;  4ZAI A;  2F03 A;  1CZW A;  3HS0 C;  4KY5 A;  1SYC A;  2BCO A;  5ELC A;  1ET9 A;  3OMG A;  2KVM A;  2FMC A;  1SE3 A;  2PW7 A;  1Y1V B;  2ID0 A;  4KTA A;  2IT1 A;  3P20 A;  3K5M A;  1TQO A;  4IFD G;  3GO5 A;  1UUP A;  2L4N A;  1L0X B;  5E4W C;  3GTK B;  4RCN A;  4DU9 A;  2EDG A;  3BG3 A;  3KBG A;  4EGV A;  1ET6 A;  3PUY A;  1H9K A;  1ZYR D;  2WP8 J;  1YNJ D;  1HTP A;  1LT5 D;  2K04 A;  1EWH A;  1SMY C;  3QWN A;  3MXU A;  4CJ2 C;  5IGG A;  4DAP A;  3PIP 3;  1LTB D;  1K8M A;  4IZ8 A;  1NR4 A;  1STH A;  1Q12 A;  1A2T A;  3I4M B;  2XNA C;  2CVR A;  3HOZ B;  4HSP A;  5M3F B;  4EVO A;  5D14 A;  3MC0 B;  1KLU D;  1JWM D;  4G7H C;  4A3K B;  1WTO A;  3LWE A;  1PXU A;  4IUP A;  1DZ1 A;  4FXD A;  4DN4 M;  5CV7 A;  1TVX A;  4OO1 G;  5FO7 B;  1XXG A;  1IYV A;  1BR9 A;  4C3H B;  2X6G A;  3SK5 A;  3NHH A;  5C44 B;  5EGT A;  2D62 A;  3S14 B;  1K8O A;  4M8A A;  1SNP A;  5IT9 L;  5DEH A;  1J9O A;  1VMP A;  2D5D A;  2PO4 A;  5D65 A;  2J0T D;  3OOC A;  4KY6 A;  3BDC A;  3VR2 A;  1A3U A;  1PRT C;  2K6A A;  4ZK9 B;  2QF7 A;  1HHV A;  2EYO A;  3HZX A;  3KUP A;  3NXW A;  3Q24 A;  4OIJ A;  5JPN C;  3LWU A;  1IYU A;  2BA1 A;  3PMF A;  1PTO F;  1LV9 A;  1STG A;  5KND A;  2PZW A;  1HTL D;  2A5H A;  3EVQ A;  2EYJ A;  3CRK C;  3SK4 A;  3K5N A;  3K7A B;  1MGS A;  4RGO S;  1CI3 M;  4RAU C;  4XQQ A;  5KEE A;  3RLF A;  5C5L A;  1Q8I A;  4FF2 A;  5M9O A;  2ZXR A;  1XX8 A;  1RKN A;  1MD2 D;  3MXG A;  1O80 A;  1HQM C;  4XIG S;  3AB9 A;  2F0L A;  2M2L A;  4O1N A;  3SR1 A;  1OXX K;  3FPU B;  2Q8I B;  5E3F A;  5I6W A;  4R8N A;  4KKT A;  5ELB A;  2F0F A;  2QIL A;  3J7A F;  4H0L C;  2R61 A;  2HUG A;  1G29 1;  3U9O A;  1PZJ D;  5C4X B;  2KEC A;  3FEW X;  4BY7 B;  1MBY A;  2J4X A;  2B63 B;  4DK1 A;  3HEJ A;  1E0B A;  3K0Y A;  1W6J A;  1EOT A;  5D3D A;  3T13 A;  4KHZ A;  1PYW D;  4HN7 A;  5JEA G;  5ELE A;  1D1K A;  4UAI A;  3X3M A;  1BNZ A;  3DEO A;  2NVT B;  1VMC A;  2SDF A;  3EJI A;  1LAC A;  4G57 A;  2FHT A;  1V8Q A;  1YNJ C;  2IWH A;  3OW7 A;  3DM1 A;  2MGS A;  4PQX A;  1C48 A;  1ONL A;  1RJT A;  1TS2 A;  5COR A;  4L8J A;  5C3X A;  4IUV A;  1NAP A;  2CW0 C;  5EPL A;  5ELF A;  1GJX A;  1BCP B;  3DWQ A;  5AFW A;  4U67 3;  2SNM A;  2NTT A;  5CV9 A;  2FFK B;  2WB1 B;  2VNU D;  2NBF A;  4BBR B;  1A2U A;  3FPP A;  5K5P A;  1D5Z C;  3I90 A;  4K8I A;  1ZEQ X;  3HKZ B;  1PTO D;  3CU7 A;  1TT2 A;  4J6H A;  4NP5 A;  3MWY W;  4TKO B;  3H3V C;  1O7Z A;  1RF2 D;  3KLS A;  2YYZ A;  1KDA A;  2B2U A;  2F0E A;  4CHT B;  2EYF A;  4M1U B;  3VYU A;  5CV6 A;  1BXT A;  3ND9 A;  2QCP X;  2FIN B;  3TP7 A;  1FD7 D;  4LJZ C;  5BN5 A;  1UAP A;  2NWG A;  1AP0 A;  1CA5 A;  5FOB B;  3E0J A;  3CRL C;  3P1H A;  2LKV A;  1IW7 D;  1H9S B;  4FVM A;  3MAQ A;  1X3Q A;  5IT9 E;  3QJY A;  3MXN A;  4C1N K;  4MIU A;  1EEF D;  4RFB A;  3GQB A;  1PRT F;  2ICE C;  2NN6 H;  4ZYS A;  4S3S A;  3MA2 B;  5EKL A;  1A3V A;  1V1P A;  2B2Y A;  2B2V C;  5EQ0 A;  2ENB A;  2WKD A;  3QB3 A;  1SE2 A;  1V1O A;  2A6E D;  1I4P A;  2DY8 A;  4NDX A;  3L9A X;  1BDO A;  4FF3 A;  1B9N A;  1VF7 A;  4L63 B;  4Y7N B;  2L5T A;  5CBA E;  1G91 A;  1STE A;  3NP8 A;  4IUR A;  4F8M A;  2A68 C;  2KOL A;  1HCZ A;  4NKL A;  2EJF C;  2NN6 I;  3DEP A;  2E2J B;  3DWP A;  1RTO A;  3MZ5 A;  5T1G A;  2M9V A;  3ONA B;  3KLS X;  4K5W A;  5TSS A;  5G3L D;  1VCI A;  3RZO B;  2TMP A;  3ERO A;  1WTP A;  4WJW A;  3M7G A;  4DA2 A;  2QEJ C;  1CM9 A;  3RZD B;  2L12 A;  4ZKB B;  3SDZ A;  1BOS A;  2F0S A;  2XN9 C;  2Y0S B;  1JWS D;  3D3R A;  1QG7 A;  1OXT A;  1QNU A;  5M3M B;  4XYQ A;  1HA6 A;  2RQX A;  5C6A A;  3ND8 A;  4K14 A;  3OPO A;  1QB5 D;  1MSH A;  1STB A;  2H1E A;  5IGD A;  1A3T A;  3Q0A A;  2HDL A;  4IFD H;  1TWA B;  3S9W A;  3TDQ A;  3SE0 A;  2KUM A;  1SYD A;  3J7Y W;  1FNU A;  3I91 A;  3N6R A;  2F0M A;  3QIA A;  3HOW B;  4HR7 B;  1BO0 A;  3L7Z C;  5I2X A;  1JOO A;  1FYC A;  2I46 A;  1S5B D;  3NTH A;  4A3E B;  5M5W B;  1B1Z A;  3HOV B;  2LY7 A;  1QOH A;  1Q1B A;  4HMI A;  3OSO A;  1T5X D;  1ZXT A;  4IFD I;  5K36 H;  1FNV A;  3URY A;  1Y8O B;  4Z9C B;  1IW7 C;  1EY7 A;  1HFG A;  5KNB A;  4MN3 A;  2ZT9 C;  2WIN B;  1JIC A;  1U4L A;  4G4K A;  2A6E C;  1HQR D;  4RCO A;  1H9R A;  1BCP C;  1KLG D;  4KMU C;  3W2D A;  2KCN A;  2ZXO A;  1L0Y B;  1EQV A;  5C0X I;  4DGZ A;  1HUN A;  3GTG B;  4RGT A;  4DF7 A;  1D2B A;  2R6G A;  1EL0 A;  3FVQ A;  5FLX L;  2VB3 X;  4KJN A;  1BQQ T;  1TII D;  1UNS A;  4R9W A;  2Z1C A;  3Q6S A;  4OO1 I;  1OXV A;  3Q22 A;  4J8Q A;  5CV4 A;  3S1R B;  1I6H B;  1HFN A;  5T1I A;  2AUJ D;  1EIH A;  2MHV A;  1BBX C;  4PMC A;  3WDN A;  3BVM A;  1GUS A;  4BWG B;  4CBV A;  2EZV A;  1ZKO A;  3TN2 A;  3BVG A;  5KRU A;  1E2Z A;  3HOX B;  2EY5 A;  2LS0 1;  5CR3 A;  5JAV A;  4OL7 A;  3ERQ A;  1FGB D;  2RDG A;  2F3V A;  2EY1 A;  1LTS D;  2DY7 A;  1TS3 A;  1Y1W B;  5HGT A;  3K57 A;  3PUW A;  2G9H D;  2M00 A;  1EZ6 A;  1S4Z A;  1SND A;  4G7Z C;  2N55 A;  2JE6 I;  3CKI B;  1U4R A;  2EJM A;  2CW0 D;  3S2D B;  2XWJ B;  3A8K E;  1OXS C;  3K58 A;  2O5J C;  3CHB D;  4DXG A;  1AEX A;  5C0X G;  4EQO A;  3C1F A;  4B9X A;  1BUV T;  1JOQ A;  1KAB A;  2E2D C;  4DNT B;  5JEA H;  3D31 A;  2AQ2 B;  2E74 C;  1JC7 A;  1S5C D;  1SNC A;  3BYT B;  1F77 A;  1A6X A;  1SNM A;  3GV6 A;  4PV1 C;  5KYI A;  1PDQ A;  2XWB B;  2K5Q A;  1I4X A;  1WVL A;  1V43 A;  3BDL A;  4RHR A;  1QWY A;  3NK9 A;  3QOJ A;  1O7L A;  1C4Q A;  5IGC A;  1SXT A;  1IKM A;  1F9Q A;  3T51 B;  2F0W A;  5EJW A;  3EQL C;  3R93 A;  2EY6 A;  1RHP A;  3Q23 A;  4A3I B;  1CHQ D;  3HG9 A;  4H44 C;  3PUX A;  5C3E B;  1B50 A;  5IOC A;  3GTJ B;  4FF4 A;  3VR5 A;  1WTW A;  2BDO A;  3RMH A;  3D4W A;  1R4P B;  2V4D A;  5EKI A;  3I4L A;  2MPM A;  3VR3 A;  3P7J A;  4OIK A;  1WTX A;  2LFN A;  5C4H A;  5C3W A;  1LLR D;  2R93 B;  4I7Z C;  3IFT A;  1EY4 A;  4NW2 A;  1PZK D;  3G7L A;  3GP7 A;  3NQT A;  3KK7 A;  2F0O A;  2Q8T A;  4XYO A;  2F1M A;  1F9P A;  1PFN A;  2RA4 A;  2GA4 B;  4PMW A;  3DUZ A;  1STA A;  4ULL A;  2IW3 A;  2R92 B;  1EFI D;  4IUQ A;  1SAP A;  4RGN A;  4IAL A;  4E6I A;  1BF4 A;  3R8B A;  3OWE B;  1NUC A;  2EXZ A;  3I72 A;  2A6H C;  1CTM A;  2PCF B;  3G6J B;  3I70 A;  2F0H A;  3I8Z A;  5C4J B;  5M5Y B;  2JA6 B;  2A68 D;  1ILQ A;  2KQ3 A;  2IL8 A;  2K33 A;  4XT3 B;  5KIX A;  3NPP A;  1X3P A;  3FRP B;  3J80 L;  5M5X B;  1AN8 A;  3WOF A;  1BCP F;  1SNQ A;  4CJ1 B;  1I6V C;  1Z7T A;  3OIP A;  4NMZ A;  3MFG A;  2CQA A;  2B2T C;  1S5F D;  1VF5 C;  2IX0 A;  4IFD J;  2Z8L A;  1I4G A;  5FLX E;  2B2V A;  1RDP D;  4ILW A;  4Q5V A;  2L0C A;  4O42 A;  4N9T A;  2JA8 B;  5I6Y A;  4RA8 A;  3VYR A;  2PNR C;  2SNS A;  5G3L F;  1WTR A;  2F0T A;  1H9M A;  2K01 A;  2O2L D;  2BE5 C;  5CYU A;  3A54 A;  2RDH A;  4IQZ A;  1SYE A;  3J7A V;  1F2Z A;  4XTC S;  2JYO A;  1D6E C;  4ZRZ A;  2R3Z A;  4QUF A;  3KBX A;  1C8C A;  1EY9 A;  4ZLT F;  3TZU A;  1NSN S;  4XQN A;  1O7Y A;  2XRQ D;  1HXY D;  1E2V A;  5DM6 3;  2F0I A;  1STN A;  2OEO A;  4BS9 A;  3NSW A;  1EY8 A;  4UDU C;  3OMC A;  1RCV D;  3S2H B;  5EKK A;  2EYM A;  1DYQ A;  4KJO A;  2K32 A;  3A56 A;  4ZKC B;  3K6O A;  1S5E D;  4HED A;  3IAY A;  5JJZ A;  1MSG A;  2KEE A;  1IL8 A;  2HCI A;  2JP1 A;  1LO5 D;  1Q1E A;  4X3S A;  2B8G A;  5LHY 1;  3TME A;  2OF1 A;  1SYB A;  3ZYY X;  2WV6 D;  3MEH A;  4CKE A;  4HMJ A;  1Z47 A;  4KKU A;  4IN3 A;  4QIW B;  2RBM A;  1JCK B;  2MJ8 A;  2DNE A;  2KED A;  1TWH B;  3N52 A;  1GUO A;  1BCP D;  2MP1 A;  2RKS A;  1H9J A;  4CGY B;  3MTS A;  3CQZ B;  3S1M B;  2NB0 A;  3BYY B;  2C9O A;  1CT1 D;  5I9P A;  4KD4 A;  2L9H A;  4B9W A;  1DD2 A;  3VA5 A;  2CHB D;  3I4N B;  2PZT A;  1GXD C;  4DNR B;  5J1Z A;  3KF8 A;  3A7L A;  1JQY D;  2NVX B;  1CZG A;  4FP5 D;  4F88 A;  3S17 B;  3C2P A;  3E5S A;  1EY0 A;  4IUN A;  1II3 A;  5ELD A;  1AFP A;  2F0U A;  2AQ3 B;  5IGF A;  2B39 A;  4FF1 A;  4BA1 I;  2E75 C;  1ENA A;  1S5D D;  3GTM B;  2WII B;  3V2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...