4HMJA

Crystal structure of staphylococcal nuclease variant delta+phs l36d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hmjA00
3MZ5A 5KYIA 3D4DA 3SK6A 4KD3A 5E1FA 5I9PA 4ZUJA 3D4WA 3EJIA 4RKLA 2F0SA 2PZTA 1STGA 3R3OA 4QF4A 3NP8A 3EVQA 3E5SA 3BDLA 2F0JA 3MHBA 1RKNA 4K2KA 4NKLA 5NUCA 5CGKA 3S9WA 4HTHA 3EROA 3SK5A 3C1EA 5HGTA 5IODA 2HQEA 4WRDA 5J39A 2PZWA 3QOLA 4S3SA 2KQ3A 1STHA 2F3WA 3RUZA 3SR1A 2EY5A 5HURA 4PMBA 1SNPA 4DGZA 2F0OA 2PW5A 4RKBA 1STNA 2SNMA 4I65A 3SK4A 5IGFA 2OEOA 5JAVA 3QB3A 1SYBA 1IHZA 3QOJA 1A3TA 4KY5A 5C6AA 5KYLA 3OMCA 2RBMA 1STBA 1U9RA 2EY6A 3T16A 3TP7A 2EYHA 5C4ZA 5ISRA 1A2UA 4NDXA 2RDFA 5CV4A 5C3XA 4K5WA 5KEEA 4KTAA 5EKLA 2LKVA 3NK9A 4E6IA 2QDBA 5CV9A 3MEHA 4QMGA 5E3FA 5M9OA 1NSNS 2KHSA 1ENCA 3D6CA 2EYFA 3DMUA 4KJNA 2EXZA 4KJOA 5C4HA 5I6WA 2F0VA 4ZUIA 1SYGA 5EGTA 5C3WA 2M00A 2F0WA 1KDAA 5K5PA 2EYJA 1SNCA 1TT2A 3P75A 4K2LA 4HMIA 5JOBA 3VA5A 4K14A 3LX0A 3TP5A 2F0EA 1F2MA 1EY7A 2F0UA 2RKSA 3NQTA 3T13A 5C5MA 3ERQA 4PMCA 4F8MA 5IGBA 5F2DA 1STYA 4IZ8A 1EYDA 1F2YA 4TRDA 4ID6A 1SNQA 4K5XA 4KV6A 2OXPA 4G57A 1JOOA 2F0GA 4K8IA 4PNYA 5DAUA 4N9TA 4EQOA 3PMFA 5CV6A 2EY1A 2PW7A 5IGGA 2PQEA 4YIJA 3MVVA 1A3VA 4K5VA 3H6MA 1STAA 4NP5A 2F0DA 5IGDA 1II3A 1NUCA 4J1MA 2EYLA 3DHQA 4B9XA 1AEXA 5I9OA 2O4XA 3OSOA 2SOBA 4MIUA 2F0QA 3TP8A 4R8NA 3SXHA 3U9OA 2F3VA 4KY7A 1EY4A 1SNOA 3SK8A 3P1HA 1ENAA 3ITPA 4EVOA 1SNDA 2PYKA 5CV7A 1A3UA 2F0PA 1EZ8A 4IUNA 4LAAA 4EQPA 1KDCA 4HMJA 5KRUA 5IGCA 1JOQA 1EY9A 2EYMA 5J22A 2F0IA 5CR3A 4EQNA 5J1ZA 1EQVA 4F7XA 2EYPA 5I6YA 1JORA 3TP6A 2F0LA 1EY5A 5CV5A 2EY2A 5EKKA 1SYFA 1EZ6A 1SYCA 4B9WA 2OF1A 2EYOA 3HZXA 3NUCA 4H7BA 5IIFA 4DFAA 5IGEA 4K8JA 2F0MA 3NHHA 3OMGA 3V2TA 1EY0A 1F2ZA 2SNSA 5DEHA 2PZUA 1JOKA 2F0HA 5IOCA 2F0NA 1A2TA 3BDCA 2NUCA 4KY6A 4OL7A 4ZQ3A 5C5LA 5CV8A 2F0FA 1EY8A 2ENBA 2F0TA 5KIXA 3C1FA 4QB4A 3D8GA 1KAAA 1KABA 3OWFA 4NMZA 4ODGA 1EY6A 1TQOA 2F0KA 5KGUA 1SYDA 4WORA 1TR5A 3HEJA 4J6HA 4IALA 4KD4A 4ME5A 1EYCA 4KHVA 2WACA 4N9PA 1SYEA 3TMEA 1KDBA 3MXPA 4K6DA 4DF7A 3SHLA 4DU9A 5CC4A 1EYAA 3NXWA 1SNMA
chains in the Genus database with same CATH superfamily
2E76C 3SK6A 1WJJA 3I2ZA 4RKLA 3GTOB 1HNWL 5CORA 2KENA 1SE4A 1ZXTA 2IT1A 1J5EL 1LYLA 5ELFA 2L0CA 4JI3Q 3W1BA 2ZJRA 3C1EA 1Y1VB 2AWOA 1W2BA 1K8MA 2HDMA 3BG3A 4GLAC 4CJ0B 4OELB 2GVAA 1X3FA 3F2CA 3QO2A 4M8AA 1PZID 3S24A 1TS5A 4PMBA 1Z9FA 1CQVA 2L15A 1IHZA 3K5MA 5JPMC 2MP1A 3S2HB 3P7JA 5ELDA 3TN2A 2VS1A 1A2UA 1J9OA 2F3IA 1I4RA 2XWBB 5HY6A 3CC4A 1KNEA 4DUZQ 4JC0A 3A8IE 1D6EC 4IUUA 4KHPL 2RCFA 3URYA 1PXUA 4GOPC 4A3EG 1IL8A 1E3PA 1BOSA 4F8MA 1STYA 2VY3A 1QUQA 1T5EA 2HIXA 1F77A 4YWLA 1QCBD 1B44D 4C1NI 4O0AA 5EAYA 4BBRG 1STAA 2Q2IA 4RCNA 1II3A 2ZJPA 2L11A 4YWMA 2JA8H 1S5DD 3I4MH 1LTSD 4MN3A 4HMJA 5IYCG 4DNTB 4OX9L 1V1PB 1WYDA 1X3GA 3PUYA 1YIJA 2N78A 1SYFA 4A3BG 2LFNA 4YCVA 4YY3Q 1HZCA 4HIOA 1IKLA 2G9HD 4IFDJ 2WAQB 4CDDC 2SNSA 4JG2A 3PO2B 5CV8A 1BBXC 3KUPA 5IYDG 4FF3A 2CWPA 3G48A 2DNEA 1N34Q 4A3FB 5FJ8H 2A68D 5C4JH 3K7AH 3KJOA 1IZ6A 2IX0A 3M7NA 4A3KB 1V1QA 2E5LQ 3TBIB 1GD7A 3FHWA 2VUMB 3FVQA 4DUYQ 4LFAQ 4XT3B 3VYTA 3SK5A 4CJ1B 1MHWC 3MA2B 2A6ED 3MXNA 3WOFA 4RH6A 2Z4HA 2EY5A 1V43A 1TWHH 3OW7A 4KY5A 4ZCKA 3OMCA 1OXXK 4NDXA 1C48A 2UXDQ 1HCZA 3S2DH 4GN3B 4BXXG 1BVSA 2EXZA 4YHHQ 1N33Q 2VQFL 1JJGA 2F0WA 5K5PA 2NB0A 1EQQA 3S16H 2YV5A 1NAPA 1VQDA 1EIFA 2OT2A 2F0EA 2C35B 2G5DA 1PH3A 4A75A 4Q0FA 5IGBA 4IZ8A 3ZYYX 1F2YA 2XRQD 4PNYA 3GTGH 1E7ZA 2XWJB 2E2IB 2VQEQ 1NUCA 1LTAD 4JI8Q 4RFBA 4RHRA 2EYLA 4A3JH 5BN3A 3T1YQ 4IPHA 1WTHA 2NVQH 3S1NB 3T1HL 5CV7A 3I73A 5M5YB 3UI2A 4POFA 5C4XH 3AU7A 4DR1L 5LMNQ 1X54A 4IFDH 5I6YA 1TWCH 2F4VQ 1BCPD 3AMUA 3CD6A 3ZJYC 1VQ5A 4FYDA 4K8JA 2LXJA 1U4RA 1Y1VG 1TXYA 2QDLA 3RNUA 5KIXA 1D2BA 3H3VC 4RGOS 2A73B 4X62L 3OWFA 2QKIC 1ASZA 4JV5Q 3N52A 5COYA 5KGUA 2A6HC 1GJXA 3HEJA 3CCRA 1VQNA 1PRTB 2B3GA 3C46A 2MO0A 1HPCA 1EYAA 3J81i 4DR3L 2MPMA 4R4OA 3NXWA 4KD3A 1QOHA 3KBGA 2L4NA 5JJKA 1PVOA 2YU9B 1MSHA 2YYZA 2BE5C 1O7IA 4EQ5A 1JJCB 3FKIB 2Y0SE 4A3IH 3F2DA 4OO1I 3OWEB 2EDGA 3X3MA 4L63B 5J39A 2JA5H 1ICFB 3OPOA 3TEHB 1CSQA 3HOXH 1WTVA 1X32A 5JVH3 1MI2A 1STNA 3OYYA 4I65A 1HFNA 5I4DA 1YEZA 3D31A 2A69D 5M3FH 4GNXC 4F87A 1LO5D 5E3FA 4LF8Q 2QCPX 1NSNS 3S1RH 3HOUH 3GDEA 1UWVA 1QB5D 4YCUA 3STBD 2KHJA 3VR6A 1XYIA 1PH7A 2PNHA 3FRPB 3LX0A 5G3LD 4R4CA 4R4QA 2MNAA 3CP0A 1VDZA 2R7ZB 4ID6A 3KK7A 3VR2A 4KV6A 2A69C 2MHVA 3R2TA 4C3JB 2H1EA 2WAQG 4X65L 3PMFA 5EPLA 1PTOC 4V190 3PO2G 1SAPA 3PUVA 4NP5A 1TWFB 1WCMB 2B2TC 3A7LA 4B9XA 1FGUA 4A3FG 1PFSA 1SE2A 4TVAB 2ZTDA 1SRUA 1RD9D 5FO9B 2E74C 3EBEA 2JJQA 1Z6HA 1ENFA 4A3KG 4F7XA 3DLLA 1EY5A 4B9WA 4BY7B 2AUKA 3A74A 1SYCA 1SROA 1I50H 2DY7A 3DM3A 3J7AV 2BDNA 4H7BA 3ERSX 3GTJB 2R93B 1XNRL 2L9HA 4KY6A 1JCKB 3HOZH 1CKOA 3CRLC 1KABA 1SLJA 1VQKA 3HOVH 2F0KA 4HCEA 4POGA 2BOSA 3HOWB 4X3TA 4J6HA 2KCNA 5C3EG 1EYCA 1WTQA 1IL2A 2UXBQ 2D0OA 1JWMD 3I4NH 1SFOB 1EEID 1PRTF 1VCIA 4A3CG 1HFGA 4N8X1 2XN9C 2ZTCA 4HJAA 4NKLA 1C8CA 2OQKA 2HQLA 3HOYH 3HP3A 4GS3A 3S17B 1D7QA 3VYRA 4XT1B 3PSIA 2BH2A 1LACA 1Q86C 3QOLA 3S1MB 3J80L 1STHA 2ASBA 3SR1A 2DUDA 4RMFA 2X6LA 1DGSA 5IT9c 5JEAJ 2NVXH 1BCPF 3IKJA 3RZDH 1K8GA 2CCZA 4DV0Q 4QCLA 4K5WA 4KTAA 1EWHA 4E6IA 4PG3A 3M4PA 1ENCA 3VDYA 2JA7H 4DN4M 2K4KA 4R9WA 1KRTA 1Y8PB 4ZUIA 1PFBA 1IW7D 1SYGA 5EGTA 4DV3Q 1R4QB 2UUBL 2IPKD 2V4DA 5FLMH 1TT2A 2QW7A 3K81C 1KQSA 4J15A 1YNJD 2F0UA 2RKSA 4X3KA 4GKJL 1FNWA 1R9TB 1TWGH 5E4WC 4A3GH 1UUPA 3CF5A 5IWAL 1GM5A 2X6GA 1XJVA 3RZOB 3K5NA 2KJXA 4JI0L 4BY1H 4OHJA 2R3ZA 3TZDA 4A3MH 2RVLA 2KCMA 2M9VA 5D3IB 5ELOA 1QE6A 4IPCA 2R7FA 3P1HA 4EVOA 4A93B 1XPOA 1A6XA 2B39A 5A2QE 1V9PA 1PH9A 1EEFD 1RHPA 4BWGB 4FVMA 4DFAA 3FKIG 5C44B 4JI4Q 2XSCA 3GV3A 4X3UA 2Q8TA 4NXML 2H5XA 2F0HA 1JJ2A 4X66L 4HSVA 2EXDA 1SDFA 3BYYB 2F0TA 3DEPA 3NWTA 5M3MB 4QB4A 1KAAA 1QWYA 3VR5A 4CJ2C 4IO9A 3WOEA 2K5VA 2K33A 2YTVA 1KD1C 1X9NA 4KHVA 4LF7Q 1GUTA 1KDBA 4OEMB 4K6DA 1A63A 2D5DA 1YJWA 1EFWA 3PF4A 4DAVA 2KCTA 3A5UA 3EJIA 2RHSB 1FNVA 4RG1A 1SE8A 3RD4A 5IP7H 2L55A 1WI5A 5BR8Q 1W6JA 2NZHA 1JWUD 1O78A 1I6VC 1Y8OB 1PZJD 3PV0A 5JEAH 5HURA 2EIFA 2R7ZG 3K5LA 2UUCL 4C3JG 1BO0A 1SN8A 1LTID 3TP7A 3EIVA 1WCMG 1AN8A 5CV9A 2EJMA 1CHQD 4NW2A 4C2MH 5M9OA 1Q1BA 4LFCQ 1QZGA 3DMUA 3TS0A 2JSOA 3NBIA 2CH4A 2M00A 1E2VA 2E2JH 5JOBA 1XMOL 3H0GH 1XX8A 3CKIB 2NN6I 1RF2D 3MXUA 2JE6I 4DK1A 5L37A 1F9SA 5GADC 4YWKA 4JI5Q 3M3YH 1PH5A 3C2PA 2AMCB 3KLSX 1YHQA 5CV6A 5IGGA 4XQNA 4LF9Q 1MJCA 4XTCS 4UHVA 4OO1G 1ZYRC 5C4JB 2F0DA 3OW2A 1ILQA 1HNWQ 3DHQA 3H15A 2OTJA 3U4ZA 1FGBD 2RQXA 3K57A 1QVCA 1E2ZA 2Y0SB 3HOWG 1B9NA 1J5EQ 3JAMc 3F1ZA 2PYKA 2UXCL 5KRUA 1HR0W 2DJGC 4G7HC 4DV2L 2EYPA 2TSSA 2ICEC 3D0FA 1GUNA 1L1OA 4FDBA 3HRZC 2JEAI 5K36H 1A0IA 1GXDC 1J8IA 4HEDA 2Q8IB 4R4TA 3CQZH 4FF2A 4DAYA 4WORA 4TKOB 2RF4A 3TMEA 1I6HB 2L1BA 2QF7A 4IJHA 4DV5L 4KHPQ 3MZ5A 4DR7Q 4B3RQ 2VNUD 4DV7Q 4JBMA 2D0PA 3F8TA 1XPRA 1EFID 4QY7A 3L7ZC 3GTKH 1SXTA 3S9WA 3NENA 4JI1Q 4DR2L 3UDIA 1Q1EA 4NXNL 1K73C 1FNUA 1CM9A 4HJ9A 3F2BA 5IP9H 4KI0A 4HR7B 1M90C 1GHKA 3IRBA 1NR2A 1E2WA 2Z8LA 4DR6Q 3A5ZB 3BVMA 3PIP3 4RKBA 2SNMA 2I46A 1SJHD 1RODA 2OCEA 2A1AA 3QB3A 2NVQB 1HQRD 1STBA 1GVPA 1NMGA 2J0TD 3MTSA 4LF6L 2EVBA 5A2QL 1RJTA 4OX9Q 2QDBA 1C0AA 4C3IB 1DD2A 4QQBX 1PZKD 2CVRA 1B8AA 4OGQC 1PH2A 3TZUA 2F0VA 3PO3G 4A93G 2SEBD 4A3DH 3CC2A 2ID0A 3VA5A 2YTXA 1LTLA 2LS01 4K14A 1TS2A 1DOLA 4XDXA 3T13A 1G2TA 2Z6KA 4PMCA 5F2DA 3IFTA 3VR4A 2M2LA 3NWSA 1G8ZD 3SEBA 3KF6B 1JOOA 2F0GA 2R92B 5C44G 4Y7NH 1UNSA 2BDOA 3G6JB 3S14B 3T4AC 2KEDA 5TSSA 2UU9Q 4JOIA 5M3MG 2KECA 1NR4A 3BZDB 4U68A 1AZQA 2JP1A 1O7ZA 5FO8B 5JJIA 1JB3A 3GTPB 3A54A 2EE1A 3CCSA 1SNOA 1G51A 4ZKBB 1I4QA 1TU2B 5FOBB 1HNXL 1KDCA 1BKBA 4A3IB 3NSWA 4PMWA 4GNXA 1HR0L 4CGYB 2FJ2A 3Q6SA 5CV5A 1LT4D 1RL2A 2OF1A 2K52A 3M7GA 4QL5A 2C5CA 3ND9A 3OMGA 3V2TA 1K28A 5IOCA 1NTGA 3BJUA 4A3EH 1EY8A 2I0QA 3PUZA 2ZXOA 2KBNA 1U0LA 2GA4B 1D1KA 5FLXc 1G6PA 2JYOA 1I4HA 4IALA 2F4IA 3KF8B 2V1CC 4OIJA 4F88A 4IUTA 1K0RA 3M4OB 4BBRH 1ET9A 1KRSA 1HNZL 5JPNC 4GOPB 1NBWA 2B2TA 1Y69U 2RHQB 3BDLA 2F0JA 3BYTB 3CPWA 1FL0A 1Q46A 4I7AA 4UY8C 1KTKA 1XTCD 2PPBC 3EQLC 4HIMA 4FXDA 5T1IA 5IYCH 4LF5L 1U4PA 4B3ML 1EU3A 4WRDA 4IOCA 4IPGA 1DJRD 1OXTA 4A3BH 1QG7A 5KNBA 2JA6B 3ND8A 3PCOB 4IUQA 3OHXC 4H0LC 3CW2C 4DK0A 1LTGD 1B53A 4GZYC 5IYDH 4DR1Q 2PQAB 3ULJA 3I8ZA 1KNAA 2K6AA 1Q82C 1EL0A 2Y0SG 3FPUB 2IL8A 2CQAA 3W3AA 1ICWA 4A3LG 3DM1A 3KDFB 3S1QH 1JQYD 1A62A 2NVTB 1E22A 2LSSA 2A68C 3HOZB 3NTKA 4X62Q 3NPPA 4K0KL 4HSPA 4K5XA 2I5LX 2OXPA 4DUZL 2XIWA 1EOTA 2PO4A 1FD7D 3J81L 3K7UC 4P73A 4DR3Q 1U4MA 1CFMA 3AQQA 1DZ1A 3PGZA 1FR3A 1AEXA 1PV4A 1L1OC 2BCOA 2NVYH 4MIUA 2B29A 4R8NA 1VQGA 2A6EC 3GTMH 1W6KA 4DV1Q 3CC7A 4EQPA 3HOYB 3I72A 3JC66 5AJ3L 3IL8A 1PFMA 5CR3A 2O5JC 2D62A 2C9OA 4BXXH 3CCLA 3H3VI 2L12A 3NUCA 5JJLA 1PRTD 3I91A 1KLGD 5LMNW 2NN6G 2F0FA 2ENBA 3DWPA 1QNUA 1LTTD 4JW0A 2JA9A 1EOVA 2K5QA 1N36L 4LF4L 4OIKA 4CKBA 1O7LA 4J8QA 1IBML 4ME3A 4XYQA 3ULLA 1BNZA 3E9HA 3NBHA 3HG9A 2QA4A 1OTCA 3AFQA 4UP8A 4X64L 3K6OA 1B3QA 5E1FA 2F0SA 2SDFA 1EIYB 4RA8A 4C3IG 3TREA 1AE2A 2IX1A 1N34L 1IYJB 1RIPA 4ZLTF 2RDGA 4X65Q 4A76A 1CHPD 3TSSA 3FPPA 2HQEA 5CYUA 3GTOH 4EX5A 4DKAC 3I3CA 4UPAA 1XNQQ 4X3SA 2OEOA 2R92G 3CCEA 1SYBA 4BS9A 4R8IA 4JYAL 1Y1VH 3BVGA 1L0YB 1B9MA 2EYHA 4MZ9A 2Z6KC 2RDFA 1BCPC 1PH6A 1HZ9A 2N3SA 3CPFA 4KJOA 1KXLA 2G9DA 5I6WA 4UAIA 4DNRB 1N9WA 4GLVB 5IYBG 3ULPA 3S2HH 4JOIC 1SNCA 1XNRQ 4JPBW 2KEEA 3LGJA 1PMRA 3TP5A 1I94L 1K3BC 5C5MA 2E8GA 1KHIA 5LHY1 4KMUC 1B4OA 1S5CD 5C0XI 1WTOA 1IYUA 1CKNA 4B08A 4N9TA 3RN5A 1UAPA 1VQ6A 4DR5L 1EWCA 4C3HB 2FFKB 5IYBH 3BS1A 1K8AC 1VQIA 1UE6A 4G7OC 1CSPA 4HJ7A 1SMYD 4GLXA 5IT9E 1BUVT 3BU2A 5BN4A 1GUOA 3E9IA 2GN5A 2IW3A 3SXHA 2AQ2B 1KAWA 1HUMA 4ABNA 1CKMA 3ONAB 4QUCA 4MNOA 4RWSC 4WJWA 1G291 3I7FA 4BBSB 4CDCC 2MQHA 4JI8L 1YNXA 2VB3X 3T1YL 1FJGQ 3F2UA 2WFWA 3BZKA 4FXGC 1E24A 3GP7A 4QJFA 4R1JA 3SDZA 4GKKL 1JOKA 3QG1A 2F0NA 3BDCA 4Q5VA 2EZVA 1CI3M 3CAMA 2GVBA 3NTIA 3D8GA 3STBC 2HCIA 5LMNL 4GNXB 3NTHA 1QUQB 2F4VL 1S5BD 3J80c 1D5ZC 2YTYA 3CU7A 2Q2HA 4ME5A 2JA6G 1SYEA 2UUAQ 1WD0A 2UUBQ 1F9RA 3PO2H 1S40A 1L2FA 5FK9C 2E2JB 1WTPA 3T51B 1VF5C 4GKJQ 1H9SA 4QF4A 2VUMG 4A3FH 2HUGA 2B63B 1IBLQ 2E2HB 1EWIA 2R6GA 1ESFA 4JI7L 4JI0Q 1UE7A 2AUJD 2ICIA 3DXJC 1H9JA 1NE3A 1SBBB 4DK6C 5M5WH 3KJPA 1QNKA 3BZCA 1PTOB 3OTOL 2KQ3A 4A3KH 2N88A 1CUKA 1WFQA 2F3WA 1Y1WB 2O5IC 4CKEA 2VUMH 1LT6D 1K83H 1HA5A 2FXQA 1BBWA 1A3TA 4P75A 4CKCA 2QEJC 5C4ZA 1Y8NB 1IYVA 3IAYA 3UDFA 3MFGA 1QVFA 5KEEA 3O13A 5EKLA 3AB9A 1LT3D 2KCCA 4QMGA 1IBKQ 4GN5A 1Z7TA 1YBYA 3I55A 1ET6A 5C3EH 2EJFC 3CCJA 3J7A5 4XQQA 4NXMQ 2PMZE 4AQYL 5M5XB 3HKZE 4X66Q 4LNQA 4UP9A 4A3CH 3G7LA 1IXRA 2FINB 1Q8IA 1G91A 5LMUL 3CQZB 4EQOA 4DV4Q 1WOCA 3U58A 1RCVD 5I2XA 3V96A 1A3VA 2HCCA 3MXNB 4KKSA 5DLQE 1OXUA 1C4QA 4KHZA 2K7VA 2RDHA 3UDXA 4KY7A 3VA7A 4LMQD 2N8NA 1STEA 1SNDA 4IUNA 2AQ3B 3NELA 2JQOA 2E2IH 4P74A 1JOQA 2CFMA 1I3QB 2QILA 1CZGA 2EQSA 1R4PB 2AWNA 2EY2A 5CMDA 3HZXA 3S1NH 2UUCQ 3NE5B 1YHAA 2F0MA 1G2SA 5M5YH 4I7ZC 4CDFC 2Q2UA 4G4KA 5AFWA 1A2TA 3I56A 1GKHA 1GHJA 3QJYA 4MTNA 1Q81C 1IW7C 4FP5D 4ZYSA 1VF7A 4DXGA 1E1OA 4IJLA 1E1TA 1XMQL 1YNJC 1DOKA 5H1SE 4KKTA 2WINB 2ZT9C 3V05A 3QWNA 4OXPA 4DR4Q 2K04A 3KLSA 2PZTA 1STGA 3R3OA 3RMHA 3JAME 4L6TB 4HJ8A 2B2VA 1VQMA 4HTHA 1JT8A 2FHTA 1X3PA 3KFUA 4L5SA 3D3RA 5C0XJ 2YU9H 1VQ7A 5GROA 1TY0A 5D14A 2AQ1B 2PW5A 5IGFA 2KVMA 3FKIH 5C6AA 4B3TQ 1DONA 1VQOA 4C3HG 1N32Q 2UXCQ 4JI6L 4LWCA 1V1PA 5C3XA 1HZBA 1H9MA 2Z1CA 3KBXA 4HN7A 3MEHA 4DV2Q 2D9UA 4IURA 4AYBE 5EPJA 4XQJA 1CA5A 5A35A 4BBSG 1B50A 1ML0D 4FF4A 3GTQH 2IJ0A 2NTSA 4K8IA 4CBVA 1F2LA 2NWGA 1GOZA 4DV5Q 2JA8B 3I4MB 1Y14B 3MEFA 4K5VA 1PYSB 3FDTA 4BBRB 3L3OC 3Q23A 2R7ZH 2MJ8A 1W3SA 3W2DA 4C3JH 3SK8A 1HRJA 3MXGA 3W5OA 1A3UA 3A8KE 2MFIA 1ONLA 4DR2Q 4RCOA 4NXNQ 2DY8A 3I4OA 1EY9A 1TWFH 1WCMH 4EQNA 2ZM6L 1KC8C 3I70A 4BY7G 3Q8DA 3BDOA 2F0LA 3A8JE 4LUOA 3J7AF 2B63G 4L5RC 2R93G 1N8RC 4A3BB 2CH4W 2Q8RE 3CCQA 4LFBL 1QJOA 1F2ZA 2PZUA 3K7AB 1CA6A 3K0XA 3I90A 4BA1I 4LF6Q 1JB7A 3HGBA 3MAQA 4IFDI 3NEMA 1Y1WG 4NMZA 5JJZA 1EY6A 3KLRA 5T1GA 2XTIA 5C0XG 3GTJH 1NNXA 4HJ5A 1TR5A 4KD4A 3HFZB 3BVZA 4JI4L 2E2DC 1F9QA 4OO1H 4C1NK 5EKKA 1LUZA 3MFYA 1H9RA 3K8AA 1I5FA 3FEWX 3EVQA 3E5SA 3EFXD 4PQXA 3HOWH 1YNND 2K32A 1XTDA 3DEOA 4H02A 3CCVA 1TWHB 2KA7A 5CBAE 4P2CB 4KN7C 1SFOH 1QILA 5IODA 2A8VA 4CDEC 2K14A 1LV9A 4S3SA 4V0BA 1FYCA 1X3QA 1C9OA 3S2DB 1VQLA 1T9HA 1JE5A 3Q0AA 2F03A 4JI2L 1K0SA 2NVYB 5KYLA 5BR8L 1HNXQ 1B7YB 2N55A 2NBFA 3S16B 2NTTA 2BH8A 1C7YA 2WB1E 1B2TA 3S1MH 1H95A 4KKUA 3PIPA 1HR0Q 3D6CA 5FLXE 3T56B 1XWEA 1GUWA 2IX3A 4PZ7A 2CW0D 3A55A 3H91A 3GTGB 1K3RA 4RAUC 1EY7A 1J6QA 5DM73 1TWAH 1LM0A 4A3JB 2B2WA 3A7AB 4TRDA 4LFCL 2MO1A 1CQFA 2KOLA 2K50A 3J7ZC 1F9PA 4XYOA 3PIOA 5ELBA 1JMCA 5C4XB 3MC0B 1R9TH 4H13C 3UE1A 3RR5A 5I9OA 3OSOA 5KNCA 5EJWA 1TWCB 3G71A 1WTXA 3RZOH 2MGSA 1OXVA 4RGNA 2K05A 4LF9L 1L0WA 4LF5Q 4B3MQ 3PIO3 1AP0A 2K03A 4ZAIA 2F0IA 5J22A 1EIHA 1V8QA 4R4IA 5EBCA 4XIGS 3ICEA 2EYOA 4ZRZA 1D1IA 2Z9HA 3PO3H 4A93H 2OWOA 4DV6L 2J7ZA 1OO9B 2VL6A 3W1GA 4DA2A 2PI2A 4Y52H 2B2VC 3R8BA 3LNNA 1HHVA 1L0XB 5C44H 2RSNA 2PMZB 3HKZB 4DF7A 2Z4IA 3CHBD 4DU9A 3FMCA 1BXTA 1PLFA 5KYIA 4TQUS 5M3MH 4B3SL 1EQTA 2O2LD 2QEXA 2JA5B 1I4XA 2JN4A 1EYGA 3HOXB 4K0KQ 3VYUA 5DNFA 4WJ4A 1UEBA 1CZWA 1NCVA 5FO7B 5M3FB 4DK3C 2HHHL 4DR7L 4B3RL 3S1RB 4DV7L 3HOUB 1SNPA 4FF1A 4OONA 4DGZA 2VQFQ 3WDNA 3GV6A 1KIXA 4JI1L 2JA8G 3I4MG 5ISRA 2Q2TA 1DYQA 5CV4A 3IFDA 1SE3A 5KNDA 3SE0A 5AJ3Q 3J81c 2P5ZX 1VS0A 1B70B 3JAMi 3R2IA 3DWAA 1MJEA 4KJNA 4DR6L 3Q24A 1BF4A 1MKHA 1HJPA 5C4HA 4JBJA 1PHJA 3OIPA 3LWUA 4K2LA 1LT5D 4XXEA 3TRZA 1F2MA 4APVA 3UE0A 4MHEA 1N36Q 4LF4Q 4NPSA 1SNQA 1LTBD 5FJ8G 3T1HQ 4JI3L 1IBMQ 4ZKCB 2A5HA 2PW7A 1VMCA 5I2YA 3H09A 4X64Q 2FMCA 2NYZD 3GTLH 4PV1C 3TDQA 1K9MC 3U9OA 3X3NA 2DNCA 1EY4A 1I50B 4YCWA 1ENAA 1VMPA 3KYHC 1SSOA 5ELEA 1NMFA 4HIKA 4U673 1Q3LA 4JBKA 2L5TA 1QZHA 2UU9L 1EQVA 1B1ZA 2B2YC 1BDOA 5M5WB 3TP6A 2JXMB 3HOVB 2NZOA 1RDPD 2AKWB 4A3LH 2I5HA 1K83B 1SMXA 3NHHA 4PZ8A 1AE3A 4JYAQ 3S15H 5DEHA 4AIMA 1D8LA 3I4NB 4OL7A 3E3XA 1RTNA 5FLXL 2BA1A 1SYDA 4KN4C 3OOCA 4N9PA 4AYBB 1NY4A 4NB3A 5C3EB 5E4XA 3KOJA 3D4DA 3RN2A 4ZUJA 3D4WA 4ILWA 5EPKA 3UDGA 1I94Q 3NP8A 1JWSD 1RKNA 2VZAA 1WD1A 2RA4A 2NVXB 1I6HH 3RZDB 1XPUA 4DR5Q 5ELNA 3CMEA 2CHBD 1JICA 1JC7A 4UDUC 4A3JG 1GUGA 3RUZA 2JA7B 1K8OA 3ER0A 4LUVA 3E0EA 1SJED 4YY3L 1OXSC 1JR0D 1YHBA 3QOJA 1ZEQX 1L1OB 3LWEA 4OWTB 2ES2A 1D5MC 2IY5B 2B2WC 2NN6H 5C4XG 1I4GA 4LUZA 1VQPA 3L2PA 1PRTC 1TWGB 4DNIA 1LABA 4IFDG 3J80E 4A3GB 4OWXB 1ESRA 2B2UA 4DAYB 4A4IA 2EYJA 5BN5A 1CT1D 4HCSA 2A6HD 4HMIA 1BR9A 4DAPA 4BY1B 3C3LA 4GKKQ 5D3DA 3NQTA 4A3MB 1X6OA 4C3IH 2K5WA 1A8VA 1I4PA 2E5LL 4DXFA 2HIVA 1TIID 2K5HA 4DUYL 4LFAL 1AZPA 1PYBA 3G4SA 4RGMA 2EY1A 2BE5D 5JVG3 2RCNA 4WJ3M 2XNAC 2SOBA 1AW7A 2F3VA 3G6EA 2R92H 3HKZG 3VYSA 1VQ9A 4A3IG 1EZ8A 3S14H 2ZJQA 4JI7Q 1MIUA 3GQBA 5IE8A 4L5TA 4QIWE 2JA5G 2UXDL 4UP7A 3L0OA 2ZXPA 3U9SA 2NZ1D 3OTOQ 3HOXG 3GTPH 4YHHL 1N33L 1PDQA 4RGTA 4DV1L 1DM0B 4FXKC 2ATWA 2WB1B 3J81j 2JEBI 3HS0C 1LTRD 4ZQ3A 5M3FG 1CK1A 1HZAA 3GO5A 3C1FA 3PUWA 4ODGA 4PZ6A 1FVIA 5GAEC 1BCPB 2B8GA 3HOUG 1X56A 2R61A 5D65A 1S5ED 1Q8KA 4IUPA 4JVZA 5IGCA 4L8JA 1HTLD 1U4LA 2JK8A 5C5LA 4AQYQ 4LJZC 2VQEL 2I07B 1PTOD 4HIDA 2J4XA 3TS2A 5LMUQ 2F52A 3GTQB 3EROA 1NJIC 4EGVA 1SMYC 1PH4A 1AFPA 4KK7A 5HGTA 3M4OH 3AFPA 2D2CC 1VQ4A 1ZKOA 1CTMA 2R7DA 3RLFA 2XGTA 4C2MB 1DCZA 4X6AH 1HA6A 4IPDA 1WTRA 3SK4A 3K58A 2KUMA 4G7ZC 1Q12A 1MGSA 5GAGC 3T16A 1U9RA 2X69A 3H0GB 2DGYA 1YZ6A 2H4OA 2LKVA 3I4LA 5GQOA 3CCUA 4FO2A 2KHSA 1S72A 4JV5L 2I5MX 5IWAQ 1KL9A 1XNQL 2JA6H 2PNRC 3M3YB 4JK1C 1HTPA 4KLKA 1SR3A 4ALPA 3HOZG 4RHSA 1O7YA 1TVXA 1KLUD 3ERQA 1TS3A 1EYDA 3HOVG 2DJFC 1XMQQ 1UEAB 5DM63 1HQMC 3VR3A 2NVTH 1X65A 2TMPA 3I4NG 3H6MA 3QR8A 1PH8A 2XVSA 2O4XA 4QGUA 2N49A 3TP8A 2IHEA 4FNFA 4AYBG 3HOYG 2F0PA 3TQYA 1EQRA 4C56C 1UE5A 4P72A 5EQ0A 3OIQA 5LL6S 4LF8L 3T53B 1VQFA 1EZ6A 4JBWA 1JE4A 3RLNA 2K5DA 2WV6D 1EY0A 1PYWD 4JI6Q 5EKIA 3SGIA 2ZTEA 1X55A 4MTKA 2JA7G 3E0JA 1YITA 1FJGL 1S4ZA 1BBUA 3K5OA 1A15A 3U50C 5JAVA 3GTKB 4ZK9B 3MXPA 4QUFA 3K0YA 3SHLA 5FLMG 4IOAA 4IQZA 5I9PA 4O42A 1P16A 2Z0SA 1D5XC 4A3GG 3MHBA 3R93A 1TWAB 3KF6A 4P71A 1GUSA 5CGKA 1Z47A 3K59A 2UUAL 4BY1G 3D4RA 3RLOA 3A0JA 4A3MG 2PZWA 2B2UC 2WKDA 3DWQA 4IN3A 1X3EA 2F0OA 3K80C 4TSSA 1IBLL 3L9AX 1S5FD 2RBMA 1XMOQ 3CCMA 4A3DB 2WAQE 1HH2P 3EN2A 3DUZA 1SEBD 3NK9A 2ZM6Q 3N6RA 2EYFA 4HAEA 2IHFA 1VQCA 2UXBL 1MBYA 2LXKA 3KLWA 2DN8A 1M8AA 1BQQT 3NBHB 4LFBQ 4Y7NB 3PO3B 3P75A 1WVLA 2WIIB 1WTWA 5IT9L 4ULLA 1PH1A 3QIAA 2QGQA 5GAHC 1IBKL 1PTOF 2EPBA 2CKZB 5DAUA 3KF8A 1V1OA 1U5KA 2PQEA 2KHIA 4YIJA 4BA2I 2WB1G 2ZXRA 3MVVA 4N8FA 1YJNA 3J7YW 4GOPA 3J80i 1B3AA 3B6YA 3E6ZX 5G3LF 2F0QA 3H3VH 5IP7G 1VQEA 3ITPA 1TY2A 4CHTB 5HGQA 4DV4L 4C3HH 1VQBA 4DV0L 2EOTA 1EU4A 2AHOB 2LY7A 4A3EB 2K28A 2HT1A 4H44C 2K5NA 3HKSA 3WWVA 5JEAG 2CQOA 5IIFA 2F1MA 4O1NA 4JI2Q 2FMMA 2MUYA 3MWYW 5J3BA 4DV3L 5IGEA 1AH9A 1DOMA 1S3OA 2ALYB 4BBSH 3GD7A 4L5QA 2PQAA 4DPGA 1CKNB 1IKMA 2WACA 4OWWB 5CC4A 2K75A 3KDFA 2BA0A 1HXYD 3H0GG 2A74C 3U4VA 3P20A 1TKWB 3FP9A 1ZYRD 1UE1A 1XXGA 1GO3E 1MSGA 4K2KA 5NUCA 1E0BA 1RTOA 4DR4L 5IY0A 1Q7YC 4IUVA 4BY7H 2B2YA 2K01A 1DXMA 3GTLB 2B63H 1Q90A 2R93H 2E2HH 1PA6A 2VW9A 1HUNA 3S1QB 2EY6A 2WP8J 3M4YA 4QIWB 2EJGC 1PTOH 1Y1WH 2Z6BA 3A56A 5C0XH 4JCVE 4LF7L 5C3WA 1KDAA 4B3TL 3CMAA 4GN4B 4DV6Q 4M1UB 1N32L 3S15B 3NQIA 4K6LA 5K36G 1VQAA 1MD2D 4AH6A 1EIGA 2PCFB 1H9SB 1TS4A 5EBDA 4G57A 3D6WA 3S17H 5ELCA 3AEVA 3GTMB 2CWAA 5M5XH 1O80A 2IWHA 3AYHB 2VB2X 1YNNC 2VXWA 5IGDA 1VQ8A 3Q22A 4B3SQ 3PF5A 4J1MA 4O2DA 4LK1C 3CRKC 3H94A 2WKCA 2OTLA 1LLRD 2XRSD 2LMCB 4Z9CB 4LAAA 3M85A 3J81E 1VQHA 2HDLA 2HD3A 2EYMA 5IP9G 5J1ZA 3M9BA 2PI2E 2HHHQ 3SVMA 1PFNA 1JORA 5FKAC 4DAMA 5LL6X 1VQJA 3EA6A 1ILPA 1M1KC 4LW1A 2B8FA 1T5XD 2OQ0A 1YJ9A 1HNZQ 1ASYA 1EUJA 2NUCA 1I3QH 5CBEE 2CW0C 3JAML 1TQOA 1YVCA 4JI5L 2A19A 5E7NA 4WFN3 1P8LA 1YI2A 1QVGA 2K1BA 3M4QA 1H9KA 3CXCA 1M4VA 4A3DG 3PQIA 2E75C 2RSOA 1SNMA 3PUXA 1G6ZA
chains in the Genus database with same CATH topology
2E76C 3SK6A 4RKLA 3GTOB 5CORA 1SE4A 1ZXTA 2IT1A 5ELFA 2L0CA 3C1EA 1Y1VB 2AWOA 1K8MA 2HDMA 3BG3A 4CJ0B 3QO2A 4M8AA 1PZID 1TS5A 4PMBA 1CQVA 1IHZA 3K5MA 5JPMC 2MP1A 3S2HB 3P7JA 5ELDA 3TN2A 1A2UA 1J9OA 1I4RA 2XWBB 1KNEA 3A8IE 1D6EC 4IUUA 3URYA 1PXUA 1IL8A 1BOSA 4F8MA 1STYA 1T5EA 1F77A 1QCBD 1B44D 4C1NI 1STAA 4RCNA 1II3A 2L11A 1S5DD 1LTSD 4MN3A 4HMJA 4DNTB 1V1PB 3PUYA 1SYFA 2LFNA 1IKLA 2G9HD 4IFDJ 2WAQB 2SNSA 3PO2B 5CV8A 1BBXC 3KUPA 4FF3A 2DNEA 4A3FB 2A68D 2IX0A 3M7NA 4A3KB 3TBIB 2VUMB 3FVQA 4XT3B 3VYTA 3SK5A 4CJ1B 3MA2B 2A6ED 3MXNA 3WOFA 4RH6A 2Z4HA 2EY5A 1V43A 3OW7A 4KY5A 3OMCA 1OXXK 4NDXA 1C48A 1HCZA 2EXZA 2F0WA 5K5PA 2NB0A 1NAPA 2OT2A 2F0EA 4Q0FA 5IGBA 4IZ8A 3ZYYX 1F2YA 2XRQD 4PNYA 2XWJB 2E2IB 1NUCA 1LTAD 4RFBA 4RHRA 2EYLA 5BN3A 3S1NB 5CV7A 3I73A 5M5YB 3UI2A 3AU7A 4IFDH 5I6YA 1BCPD 3AMUA 4FYDA 4K8JA 1U4RA 5KIXA 1D2BA 3H3VC 4RGOS 2A73B 3OWFA 2QKIC 3N52A 5COYA 5KGUA 2A6HC 1GJXA 3HEJA 1PRTB 3C46A 1HPCA 1EYAA 2MPMA 3NXWA 4KD3A 1QOHA 3KBGA 2L4NA 2YU9B 1MSHA 2YYZA 2BE5C 3FKIB 4OO1I 3OWEB 2EDGA 3X3MA 4L63B 5J39A 3OPOA 1WTVA 1X32A 5JVH3 1MI2A 1STNA 4I65A 1HFNA 5I4DA 3D31A 2A69D 4F87A 1LO5D 5E3FA 2QCPX 1NSNS 1QB5D 3VR6A 1XYIA 3FRPB 3LX0A 5G3LD 1VDZA 2R7ZB 4ID6A 3KK7A 3VR2A 4KV6A 2A69C 2MHVA 3R2TA 4C3JB 2H1EA 3PMFA 5EPLA 1PTOC 4V190 1SAPA 3PUVA 4NP5A 1TWFB 1WCMB 2B2TC 3A7LA 4B9XA 1SE2A 1RD9D 5FO9B 2E74C 1Z6HA 1ENFA 4F7XA 1EY5A 4B9WA 4BY7B 2AUKA 1SYCA 2DY7A 3J7AV 2BDNA 4H7BA 3GTJB 2R93B 2L9HA 4KY6A 1JCKB 3CRLC 1KABA 2F0KA 4HCEA 2BOSA 3HOWB 4X3TA 4J6HA 2KCNA 1EYCA 1WTQA 1JWMD 1SFOB 1EEID 1PRTF 1VCIA 1HFGA 2XN9C 4NKLA 1C8CA 3HP3A 3S17B 3VYRA 4XT1B 1LACA 3QOLA 3S1MB 3J80L 1STHA 3SR1A 2X6LA 5JEAJ 1BCPF 3IKJA 4QCLA 4K5WA 4KTAA 1EWHA 4E6IA 1ENCA 4DN4M 4R9WA 1Y8PB 4ZUIA 1PFBA 1IW7D 1SYGA 5EGTA 1R4QB 2IPKD 2V4DA 1TT2A 1YNJD 2F0UA 2RKSA 4X3KA 1FNWA 1R9TB 5E4WC 1UUPA 2X6GA 3RZOB 3K5NA 2KJXA 4OHJA 2R3ZA 3TZDA 2RVLA 2M9VA 5D3IB 1QE6A 3P1HA 4EVOA 4A93B 1A6XA 2B39A 5A2QE 1EEFD 1RHPA 4BWGB 4FVMA 4DFAA 5C44B 2XSCA 3GV3A 4X3UA 2Q8TA 2F0HA 4HSVA 1SDFA 3BYYB 2F0TA 3DEPA 3NWTA 5M3MB 4QB4A 1KAAA 1QWYA 3VR5A 4CJ2C 3WOEA 2K33A 4KHVA 1GUTA 1KDBA 4K6DA 2D5DA 4DAVA 3EJIA 1FNVA 3RD4A 2L55A 1W6JA 1JWUD 1O78A 1I6VC 1Y8OB 1PZJD 3PV0A 5JEAH 5HURA 3K5LA 4C3JG 1BO0A 1LTID 3TP7A 1AN8A 5CV9A 2EJMA 1CHQD 4NW2A 5M9OA 1Q1BA 3DMUA 2JSOA 3NBIA 2M00A 1E2VA 5JOBA 1XX8A 3CKIB 2NN6I 1RF2D 3MXUA 2JE6I 4DK1A 1F9SA 3C2PA 3KLSX 5CV6A 5IGGA 4XQNA 4XTCS 4OO1G 1ZYRC 5C4JB 2F0DA 1ILQA 3DHQA 1FGBD 2RQXA 3K57A 1E2ZA 2Y0SB 1B9NA 2PYKA 5KRUA 4G7HC 2EYPA 2TSSA 2ICEC 1GUNA 3HRZC 2JEAI 5K36H 1GXDC 1J8IA 4HEDA 2Q8IB 4FF2A 4DAYA 4WORA 4TKOB 3TMEA 1I6HB 2L1BA 2QF7A 3MZ5A 2VNUD 1EFID 3L7ZC 1SXTA 3S9WA 1Q1EA 1FNUA 1CM9A 4KI0A 4HR7B 1GHKA 1NR2A 1E2WA 2Z8LA 3BVMA 3PIP3 4RKBA 2SNMA 2I46A 1SJHD 1RODA 3QB3A 2NVQB 1HQRD 1STBA 2J0TD 3MTSA 2EVBA 5A2QL 1RJTA 2QDBA 4C3IB 1DD2A 1PZKD 2CVRA 4OGQC 3TZUA 2F0VA 2SEBD 2ID0A 3VA5A 2LS01 4K14A 1TS2A 1DOLA 4XDXA 3T13A 1G2TA 4PMCA 5F2DA 3IFTA 3VR4A 2M2LA 3NWSA 1G8ZD 3SEBA 1JOOA 2F0GA 2R92B 1UNSA 2BDOA 3G6JB 3S14B 3T4AC 2KEDA 5TSSA 2KECA 1NR4A 3BZDB 4U68A 1AZQA 2JP1A 1O7ZA 5FO8B 1JB3A 3GTPB 3A54A 2EE1A 1SNOA 4ZKBB 1I4QA 5FOBB 1TU2B 1KDCA 4A3IB 3NSWA 4PMWA 4CGYB 2FJ2A 3Q6SA 5CV5A 1LT4D 2OF1A 3M7GA 2C5CA 3ND9A 3OMGA 3V2TA 5IOCA 1EY8A 3PUZA 2ZXOA 2GA4B 1D1KA 2JYOA 1I4HA 4IALA 2F4IA 4OIJA 4F88A 4IUTA 3M4OB 1ET9A 5JPNC 2B2TA 1Y69U 3BYTB 3BDLA 2F0JA 1KTKA 1XTCD 2PPBC 3EQLC 4FXDA 5T1IA 1U4PA 1EU3A 4WRDA 1DJRD 1OXTA 1QG7A 5KNBA 2JA6B 3ND8A 4IUQA 3OHXC 4H0LC 4DK0A 1LTGD 1B53A 4GZYC 3I8ZA 1KNAA 2K6AA 1EL0A 3FPUB 2IL8A 2CQAA 3W3AA 1ICWA 3DM1A 1JQYD 2NVTB 2A68C 3HOZB 3NTKA 3NPPA 4HSPA 4K5XA 2OXPA 2XIWA 1EOTA 2PO4A 1FD7D 3J81L 1U4MA 1CFMA 1DZ1A 1FR3A 1AEXA 2BCOA 4MIUA 4R8NA 2A6EC 1W6KA 4EQPA 3HOYB 3I72A 3IL8A 1PFMA 5CR3A 2O5JC 2D62A 2C9OA 2L12A 3NUCA 1PRTD 3I91A 1KLGD 2NN6G 2F0FA 2ENBA 3DWPA 1QNUA 1LTTD 2K5QA 4OIKA 4CKBA 1O7LA 4J8QA 4XYQA 1BNZA 3NBHA 3HG9A 3K6OA 5E1FA 2F0SA 2SDFA 4RA8A 4C3IG 2IX1A 4ZLTF 2RDGA 1CHPD 3TSSA 3FPPA 2HQEA 5CYUA 3I3CA 4X3SA 2OEOA 1SYBA 4BS9A 4R8IA 3BVGA 1L0YB 1B9MA 2EYHA 2RDFA 1BCPC 4KJOA 2G9DA 5I6WA 4UAIA 4DNRB 1SNCA 2KEEA 1PMRA 3TP5A 5C5MA 5LHY1 4KMUC 1B4OA 1S5CD 5C0XI 1WTOA 1IYUA 4B08A 4N9TA 1UAPA 1EWCA 4C3HB 2FFKB 3BS1A 4G7OC 1SMYD 5IT9E 5BN4A 1BUVT 1GUOA 3SXHA 2IW3A 2AQ2B 1HUMA 4ABNA 3ONAB 4QUCA 4WJWA 4RWSC 1G291 4BBSB 2VB3X 3F2UA 4FXGC 3GP7A 3SDZA 1JOKA 3QG1A 2F0NA 3BDCA 4Q5VA 2EZVA 1CI3M 3NTIA 3D8GA 2HCIA 3NTHA 1S5BD 1D5ZC 3CU7A 4ME5A 1SYEA 1WD0A 1F9RA 5FK9C 2E2JB 1WTPA 3T51B 1VF5C 1H9SA 4QF4A 2HUGA 2B63B 2E2HB 2R6GA 1ESFA 2AUJD 2ICIA 3DXJC 1H9JA 1SBBB 1QNKA 1PTOB 2KQ3A 2O5IC 2N88A 2F3WA 1Y1WB 4CKEA 1LT6D 1HA5A 1A3TA 4CKCA 2QEJC 5C4ZA 1Y8NB 1IYVA 3IAYA 3MFGA 5KEEA 3O13A 5EKLA 3AB9A 1LT3D 2KCCA 4QMGA 1Z7TA 1ET6A 2EJFC 4XQQA 5M5XB 3G7LA 2FINB 1Q8IA 1G91A 3CQZB 4EQOA 1RCVD 5I2XA 3V96A 1A3VA 2HCCA 4KKSA 1OXUA 1C4QA 4KHZA 2K7VA 2RDHA 4KY7A 3VA7A 4LMQD 1STEA 1SNDA 4IUNA 2AQ3B 1JOQA 1I3QB 2QILA 1CZGA 1R4PB 2AWNA 2EY2A 5CMDA 3HZXA 3NE5B 2F0MA 1G2SA 4I7ZC 4G4KA 5AFWA 1A2TA 3QJYA 1GHJA 1IW7C 4FP5D 4ZYSA 1VF7A 4DXGA 1YNJC 1DOKA 4KKTA 2WINB 2ZT9C 3V05A 3QWNA 2K04A 3KLSA 2PZTA 1STGA 3R3OA 3RMHA 3JAME 4L6TB 2B2VA 4HTHA 2FHTA 1X3PA 3D3RA 5C0XJ 1TY0A 5D14A 2AQ1B 2PW5A 5IGFA 2KVMA 5C6AA 1DONA 4C3HG 1V1PA 5C3XA 2Z1CA 1H9MA 3KBXA 4HN7A 3MEHA 2D9UA 4IURA 5EPJA 4XQJA 1CA5A 5A35A 1B50A 1ML0D 4FF4A 2IJ0A 2NTSA 4K8IA 4CBVA 1F2LA 2NWGA 1GOZA 2JA8B 3I4MB 4K5VA 3FDTA 4BBRB 3L3OC 3Q23A 2MJ8A 3W2DA 3SK8A 1HRJA 3MXGA 1A3UA 3A8KE 1ONLA 4RCOA 2DY8A 1EY9A 4EQNA 3I70A 3BDOA 2F0LA 3A8JE 3J7AF 4A3BB 2Q8RE 1QJOA 1F2ZA 2PZUA 3K7AB 1CA6A 3I90A 4BA1I 3HGBA 3MAQA 4IFDI 5JJZA 4NMZA 1EY6A 3KLRA 5T1GA 5C0XG 1TR5A 4KD4A 3BVZA 2E2DC 1F9QA 4OO1H 4C1NK 5EKKA 3MFYA 1H9RA 3FEWX 3EVQA 3E5SA 3EFXD 4PQXA 1YNND 2K32A 3DEOA 1TWHB 2KA7A 5CBAE 4P2CB 4KN7C 1QILA 5IODA 1LV9A 4S3SA 4V0BA 1FYCA 1X3QA 3S2DB 3Q0AA 2F03A 2NVYB 5KYLA 2N55A 2NBFA 3S16B 2NTTA 1B2TA 4KKUA 3D6CA 5FLXE 3T56B 1XWEA 1GUWA 2IX3A 2CW0D 3A55A 3H91A 3GTGB 4RAUC 1EY7A 5DM73 4A3JB 2B2WA 3A7AB 4TRDA 1CQFA 2KOLA 1F9PA 4XYOA 5ELBA 5C4XB 3MC0B 4H13C 5I9OA 3OSOA 5KNCA 5EJWA 1TWCB 1WTXA 2MGSA 1OXVA 4RGNA 2K05A 3PIO3 1AP0A 2K03A 4ZAIA 2F0IA 5J22A 1EIHA 1V8QA 5EBCA 4XIGS 2EYOA 4ZRZA 1D1IA 2J7ZA 1OO9B 4DA2A 2B2VC 3R8BA 3LNNA 1HHVA 1L0XB 2RSNA 2PMZB 3HKZB 4DF7A 2Z4IA 3CHBD 4DU9A 3FMCA 1BXTA 1PLFA 5KYIA 4TQUS 1EQTA 2O2LD 2JA5B 1I4XA 3HOXB 3VYUA 5DNFA 1CZWA 1NCVA 5FO7B 5M3FB 3S1RB 3HOUB 1SNPA 4FF1A 4DGZA 3WDNA 3GV6A 5ISRA 1DYQA 5CV4A 3IFDA 1SE3A 5KNDA 3SE0A 3R2IA 3DWAA 4KJNA 3Q24A 1BF4A 5C4HA 3OIPA 3LWUA 4K2LA 1LT5D 4XXEA 1F2MA 4MHEA 1SNQA 1LTBD 4ZKCB 2A5HA 2PW7A 1VMCA 5I2YA 3H09A 2FMCA 2NYZD 4PV1C 3TDQA 3U9OA 3X3NA 2DNCA 1EY4A 1I50B 1ENAA 1VMPA 1SSOA 5ELEA 4U673 1Q3LA 2L5TA 1EQVA 1B1ZA 2B2YC 1BDOA 5M5WB 3TP6A 2JXMB 3HOVB 1RDPD 1K83B 3NHHA 5DEHA 3I4NB 4OL7A 1RTNA 5FLXL 2BA1A 1SYDA 4KN4C 3OOCA 4N9PA 4AYBB 5C3EB 5E4XA 3D4DA 4ZUJA 3D4WA 4ILWA 5EPKA 3NP8A 1JWSD 1RKNA 1WD1A 2RA4A 2NVXB 3RZDB 2CHBD 1JICA 1JC7A 4UDUC 1GUGA 3RUZA 2JA7B 1K8OA 1SJED 1OXSC 1JR0D 3QOJA 1ZEQX 3LWEA 1D5MC 2B2WC 2NN6H 1I4GA 1PRTC 1TWGB 4IFDG 1LABA 3J80E 4A3GB 1ESRA 2B2UA 2EYJA 5BN5A 1CT1D 4HCSA 2A6HD 4HMIA 1BR9A 4DAPA 4BY1B 3C3LA 5D3DA 3NQTA 4A3MB 2K5WA 1I4PA 4DXFA 1TIID 1AZPA 4RGMA 2EY1A 2BE5D 5JVG3 2XNAC 2SOBA 1AW7A 2F3VA 3VYSA 1EZ8A 3GQBA 2ZXPA 3U9SA 2NZ1D 1PDQA 4RGTA 1DM0B 4FXKC 2WB1B 2JEBI 3HS0C 1LTRD 4ZQ3A 1CK1A 3GO5A 3C1FA 3PUWA 4ODGA 1BCPB 2B8GA 2R61A 5D65A 1S5ED 4IUPA 5IGCA 4L8JA 1HTLD 1U4LA 5C5LA 4LJZC 2I07B 1PTOD 2J4XA 3GTQB 3EROA 4EGVA 1SMYC 1AFPA 4KK7A 5HGTA 2D2CC 1ZKOA 1CTMA 3RLFA 4C2MB 1DCZA 1HA6A 1WTRA 3SK4A 3K58A 2KUMA 4G7ZC 1Q12A 1MGSA 3T16A 1U9RA 2X69A 3H0GB 2H4OA 2LKVA 3I4LA 4FO2A 2KHSA 2PNRC 3M3YB 4JK1C 1HTPA 4RHSA 1O7YA 1TVXA 1KLUD 3ERQA 1TS3A 1EYDA 1UEAB 5DM63 1HQMC 3VR3A 2TMPA 3H6MA 2XVSA 2O4XA 3TP8A 4FNFA 2F0PA 4C56C 5EQ0A 3OIQA 5LL6S 3T53B 1EZ6A 4JBWA 1JE4A 2K5DA 2WV6D 1EY0A 1PYWD 5EKIA 3E0JA 1S4ZA 3K5OA 1A15A 3GTKB 5JAVA 4ZK9B 3MXPA 4QUFA 3K0YA 3SHLA 4IQZA 5I9PA 4O42A 1D5XC 3MHBA 3R93A 1TWAB 1GUSA 5CGKA 1Z47A 3K59A 3D4RA 2PZWA 2B2UC 2WKDA 3DWQA 4IN3A 2F0OA 4TSSA 3L9AX 1S5FD 2RBMA 4A3DB 3DUZA 1SEBD 3NK9A 3N6RA 2EYFA 4HAEA 1MBYA 2DN8A 1M8AA 1BQQT 4Y7NB 3PO3B 3P75A 1WVLA 2WIIB 1WTWA 5IT9L 4ULLA 3QIAA 1PTOF 2EPBA 5DAUA 3KF8A 1V1OA 2PQEA 4BA2I 4YIJA 2ZXRA 3MVVA 3J7YW 1B3AA 3E6ZX 5G3LF 2F0QA 3ITPA 1TY2A 4CHTB 2EOTA 1EU4A 2LY7A 4A3EB 2K28A 4H44C 5JEAG 5IIFA 2F1MA 4O1NA 2FMMA 2MUYA 3MWYW 5IGEA 1DOMA 3GD7A 1IKMA 2WACA 5CC4A 2BA0A 1HXYD 2A74C 3P20A 1TKWB 1ZYRD 1XXGA 1MSGA 4K2KA 5NUCA 1E0BA 1RTOA 4IUVA 2B2YA 2K01A 1DXMA 3GTLB 1Q90A 1HUNA 3S1QB 2EY6A 2WP8J 3M4YA 4QIWB 2EJGC 1PTOH 3A56A 5C0XH 5C3WA 1KDAA 4M1UB 3S15B 3NQIA 4K6LA 5K36G 1MD2D 1EIGA 2PCFB 1H9SB 1TS4A 5EBDA 4G57A 3D6WA 5ELCA 3GTMB 1O80A 2IWHA 5IGDA 2VB2X 1YNNC 2VXWA 3Q22A 4J1MA 4LK1C 3CRKC 3H94A 2WKCA 1LLRD 2XRSD 2LMCB 4Z9CB 4LAAA 3M85A 3J81E 2HDLA 2EYMA 5J1ZA 3SVMA 1PFNA 1JORA 5FKAC 5LL6X 3EA6A 1ILPA 2B8FA 1T5XD 2NUCA 5CBEE 2CW0C 3JAML 1TQOA 4WFN3 2K1BA 1H9KA 1M4VA 2E75C 2RSOA 1SNMA 3PUXA 1G6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  5KYI A;  3D4D A;  3SK6 A;  4KD3 A;  5E1F A;  5I9P A;  4ZUJ A;  3D4W A;  3EJI A;  4RKL A;  2F0S A;  2PZT A;  1STG A;  3R3O A;  4QF4 A;  3NP8 A;  3EVQ A;  3E5S A;  3BDL A;  2F0J A;  3MHB A;  1RKN A;  4K2K A;  4NKL A;  5NUC A;  5CGK A;  3S9W A;  4HTH A;  3ERO A;  3SK5 A;  3C1E A;  5HGT A;  5IOD A;  2HQE A;  4WRD A;  5J39 A;  2PZW A;  3QOL A;  4S3S A;  2KQ3 A;  1STH A;  2F3W A;  3RUZ A;  3SR1 A;  2EY5 A;  5HUR A;  4PMB A;  1SNP A;  4DGZ A;  2F0O A;  2PW5 A;  4RKB A;  1STN A;  2SNM A;  4I65 A;  3SK4 A;  5IGF A;  2OEO A;  5JAV A;  3QB3 A;  1SYB A;  1IHZ A;  3QOJ A;  1A3T A;  4KY5 A;  5C6A A;  5KYL A;  3OMC A;  2RBM A;  1STB A;  1U9R A;  2EY6 A;  3T16 A;  3TP7 A;  2EYH A;  5C4Z A;  5ISR A;  1A2U A;  4NDX A;  2RDF A;  5CV4 A;  5C3X A;  4K5W A;  5KEE A;  4KTA A;  5EKL A;  2LKV A;  3NK9 A;  4E6I A;  2QDB A;  5CV9 A;  3MEH A;  4QMG A;  5E3F A;  5M9O A;  1NSN S;  2KHS A;  1ENC A;  3D6C A;  2EYF A;  3DMU A;  4KJN A;  2EXZ A;  4KJO A;  5C4H A;  5I6W A;  2F0V A;  4ZUI A;  1SYG A;  5EGT A;  5C3W A;  2M00 A;  2F0W A;  1KDA A;  5K5P A;  2EYJ A;  1SNC A;  1TT2 A;  3P75 A;  4K2L A;  4HMI A;  5JOB A;  3VA5 A;  4K14 A;  3LX0 A;  3TP5 A;  2F0E A;  1F2M A;  1EY7 A;  2F0U A;  2RKS A;  3NQT A;  3T13 A;  5C5M A;  3ERQ A;  4PMC A;  4F8M A;  5IGB A;  5F2D A;  1STY A;  4IZ8 A;  1EYD A;  1F2Y A;  4TRD A;  4ID6 A;  1SNQ A;  4K5X A;  4KV6 A;  2OXP A;  4G57 A;  1JOO A;  2F0G A;  4K8I A;  4PNY A;  5DAU A;  4N9T A;  4EQO A;  3PMF A;  5CV6 A;  2EY1 A;  2PW7 A;  5IGG A;  2PQE A;  4YIJ A;  3MVV A;  1A3V A;  4K5V A;  3H6M A;  1STA A;  4NP5 A;  2F0D A;  5IGD A;  1II3 A;  1NUC A;  4J1M A;  2EYL A;  3DHQ A;  4B9X A;  1AEX A;  5I9O A;  2O4X A;  3OSO A;  2SOB A;  4MIU A;  2F0Q A;  3TP8 A;  4R8N A;  3SXH A;  3U9O A;  2F3V A;  4KY7 A;  1EY4 A;  1SNO A;  3SK8 A;  3P1H A;  1ENA A;  3ITP A;  4EVO A;  1SND A;  2PYK A;  5CV7 A;  1A3U A;  2F0P A;  1EZ8 A;  4IUN A;  4LAA A;  4EQP A;  1KDC A;  4HMJ A;  5KRU A;  5IGC A;  1JOQ A;  1EY9 A;  2EYM A;  5J22 A;  2F0I A;  5CR3 A;  4EQN A;  5J1Z A;  1EQV A;  4F7X A;  2EYP A;  5I6Y A;  1JOR A;  3TP6 A;  2F0L A;  1EY5 A;  5CV5 A;  2EY2 A;  5EKK A;  1SYF A;  1EZ6 A;  1SYC A;  4B9W A;  2OF1 A;  2EYO A;  3HZX A;  3NUC A;  4H7B A;  5IIF A;  4DFA A;  5IGE A;  4K8J A;  2F0M A;  3NHH A;  3OMG A;  3V2T A;  1EY0 A;  1F2Z A;  2SNS A;  5DEH A;  2PZU A;  1JOK A;  2F0H A;  5IOC A;  2F0N A;  1A2T A;  3BDC A;  2NUC A;  4KY6 A;  4OL7 A;  4ZQ3 A;  5C5L A;  5CV8 A;  2F0F A;  1EY8 A;  2ENB A;  2F0T A;  5KIX A;  3C1F A;  4QB4 A;  3D8G A;  1KAA A;  1KAB A;  3OWF A;  4NMZ A;  4ODG A;  1EY6 A;  1TQO A;  2F0K A;  5KGU A;  1SYD A;  4WOR A;  1TR5 A;  3HEJ A;  4J6H A;  4IAL A;  4KD4 A;  4ME5 A;  1EYC A;  4KHV A;  2WAC A;  4N9P A;  1SYE A;  3TME A;  1KDB A;  3MXP A;  4K6D A;  4DF7 A;  3SHL A;  4DU9 A;  5CC4 A;  1EYA A;  3NXW A;  1SNM A; 
#chains in the Genus database with same CATH topology
 2E76 C;  3SK6 A;  1WJJ A;  3I2Z A;  4RKL A;  3GTO B;  1HNW L;  5COR A;  2KEN A;  1SE4 A;  1ZXT A;  2IT1 A;  1J5E L;  1LYL A;  5ELF A;  2L0C A;  4JI3 Q;  3W1B A;  2ZJR A;  3C1E A;  1Y1V B;  2AWO A;  1W2B A;  1K8M A;  2HDM A;  3BG3 A;  4GLA C;  4CJ0 B;  4OEL B;  2GVA A;  1X3F A;  3F2C A;  3QO2 A;  4M8A A;  1PZI D;  3S24 A;  1TS5 A;  4PMB A;  1Z9F A;  1CQV A;  2L15 A;  1IHZ A;  3K5M A;  5JPM C;  2MP1 A;  3S2H B;  3P7J A;  5ELD A;  3TN2 A;  2VS1 A;  1A2U A;  1J9O A;  2F3I A;  1I4R A;  2XWB B;  5HY6 A;  3CC4 A;  1KNE A;  4DUZ Q;  4JC0 A;  3A8I E;  1D6E C;  4IUU A;  4KHP L;  2RCF A;  3URY A;  1PXU A;  4GOP C;  4A3E G;  1IL8 A;  1E3P A;  1BOS A;  4F8M A;  1STY A;  2VY3 A;  1QUQ A;  1T5E A;  2HIX A;  1F77 A;  4YWL A;  1QCB D;  1B44 D;  4C1N I;  4O0A A;  5EAY A;  4BBR G;  1STA A;  2Q2I A;  4RCN A;  1II3 A;  2ZJP A;  2L11 A;  4YWM A;  2JA8 H;  1S5D D;  3I4M H;  1LTS D;  4MN3 A;  4HMJ A;  5IYC G;  4DNT B;  4OX9 L;  1V1P B;  1WYD A;  1X3G A;  3PUY A;  1YIJ A;  2N78 A;  1SYF A;  4A3B G;  2LFN A;  4YCV A;  4YY3 Q;  1HZC A;  4HIO A;  1IKL A;  2G9H D;  4IFD J;  2WAQ B;  4CDD C;  2SNS A;  4JG2 A;  3PO2 B;  5CV8 A;  1BBX C;  3KUP A;  5IYD G;  4FF3 A;  2CWP A;  3G48 A;  2DNE A;  1N34 Q;  4A3F B;  5FJ8 H;  2A68 D;  5C4J H;  3K7A H;  3KJO A;  1IZ6 A;  2IX0 A;  3M7N A;  4A3K B;  1V1Q A;  2E5L Q;  3TBI B;  1GD7 A;  3FHW A;  2VUM B;  3FVQ A;  4DUY Q;  4LFA Q;  4XT3 B;  3VYT A;  3SK5 A;  4CJ1 B;  1MHW C;  3MA2 B;  2A6E D;  3MXN A;  3WOF A;  4RH6 A;  2Z4H A;  2EY5 A;  1V43 A;  1TWH H;  3OW7 A;  4KY5 A;  4ZCK A;  3OMC A;  1OXX K;  4NDX A;  1C48 A;  2UXD Q;  1HCZ A;  3S2D H;  4GN3 B;  4BXX G;  1BVS A;  2EXZ A;  4YHH Q;  1N33 Q;  2VQF L;  1JJG A;  2F0W A;  5K5P A;  2NB0 A;  1EQQ A;  3S16 H;  2YV5 A;  1NAP A;  1VQD A;  1EIF A;  2OT2 A;  2F0E A;  2C35 B;  2G5D A;  1PH3 A;  4A75 A;  4Q0F A;  5IGB A;  4IZ8 A;  3ZYY X;  1F2Y A;  2XRQ D;  4PNY A;  3GTG H;  1E7Z A;  2XWJ B;  2E2I B;  2VQE Q;  1NUC A;  1LTA D;  4JI8 Q;  4RFB A;  4RHR A;  2EYL A;  4A3J H;  5BN3 A;  3T1Y Q;  4IPH A;  1WTH A;  2NVQ H;  3S1N B;  3T1H L;  5CV7 A;  3I73 A;  5M5Y B;  3UI2 A;  4POF A;  5C4X H;  3AU7 A;  4DR1 L;  5LMN Q;  1X54 A;  4IFD H;  5I6Y A;  1TWC H;  2F4V Q;  1BCP D;  3AMU A;  3CD6 A;  3ZJY C;  1VQ5 A;  4FYD A;  4K8J A;  2LXJ A;  1U4R A;  1Y1V G;  1TXY A;  2QDL A;  3RNU A;  5KIX A;  1D2B A;  3H3V C;  4RGO S;  2A73 B;  4X62 L;  3OWF A;  2QKI C;  1ASZ A;  4JV5 Q;  3N52 A;  5COY A;  5KGU A;  2A6H C;  1GJX A;  3HEJ A;  3CCR A;  1VQN A;  1PRT B;  2B3G A;  3C46 A;  2MO0 A;  1HPC A;  1EYA A;  3J81 i;  4DR3 L;  2MPM A;  4R4O A;  3NXW A;  4KD3 A;  1QOH A;  3KBG A;  2L4N A;  5JJK A;  1PVO A;  2YU9 B;  1MSH A;  2YYZ A;  2BE5 C;  1O7I A;  4EQ5 A;  1JJC B;  3FKI B;  2Y0S E;  4A3I H;  3F2D A;  4OO1 I;  3OWE B;  2EDG A;  3X3M A;  4L63 B;  5J39 A;  2JA5 H;  1ICF B;  3OPO A;  3TEH B;  1CSQ A;  3HOX H;  1WTV A;  1X32 A;  5JVH 3;  1MI2 A;  1STN A;  3OYY A;  4I65 A;  1HFN A;  5I4D A;  1YEZ A;  3D31 A;  2A69 D;  5M3F H;  4GNX C;  4F87 A;  1LO5 D;  5E3F A;  4LF8 Q;  2QCP X;  1NSN S;  3S1R H;  3HOU H;  3GDE A;  1UWV A;  1QB5 D;  4YCU A;  3STB D;  2KHJ A;  3VR6 A;  1XYI A;  1PH7 A;  2PNH A;  3FRP B;  3LX0 A;  5G3L D;  4R4C A;  4R4Q A;  2MNA A;  3CP0 A;  1VDZ A;  2R7Z B;  4ID6 A;  3KK7 A;  3VR2 A;  4KV6 A;  2A69 C;  2MHV A;  3R2T A;  4C3J B;  2H1E A;  2WAQ G;  4X65 L;  3PMF A;  5EPL A;  1PTO C;  4V19 0;  3PO2 G;  1SAP A;  3PUV A;  4NP5 A;  1TWF B;  1WCM B;  2B2T C;  3A7L A;  4B9X A;  1FGU A;  4A3F G;  1PFS A;  1SE2 A;  4TVA B;  2ZTD A;  1SRU A;  1RD9 D;  5FO9 B;  2E74 C;  3EBE A;  2JJQ A;  1Z6H A;  1ENF A;  4A3K G;  4F7X A;  3DLL A;  1EY5 A;  4B9W A;  4BY7 B;  2AUK A;  3A74 A;  1SYC A;  1SRO A;  1I50 H;  2DY7 A;  3DM3 A;  3J7A V;  2BDN A;  4H7B A;  3ERS X;  3GTJ B;  2R93 B;  1XNR L;  2L9H A;  4KY6 A;  1JCK B;  3HOZ H;  1CKO A;  3CRL C;  1KAB A;  1SLJ A;  1VQK A;  3HOV H;  2F0K A;  4HCE A;  4POG A;  2BOS A;  3HOW B;  4X3T A;  4J6H A;  2KCN A;  5C3E G;  1EYC A;  1WTQ A;  1IL2 A;  2UXB Q;  2D0O A;  1JWM D;  3I4N H;  1SFO B;  1EEI D;  1PRT F;  1VCI A;  4A3C G;  1HFG A;  4N8X 1;  2XN9 C;  2ZTC A;  4HJA A;  4NKL A;  1C8C A;  2OQK A;  2HQL A;  3HOY H;  3HP3 A;  4GS3 A;  3S17 B;  1D7Q A;  3VYR A;  4XT1 B;  3PSI A;  2BH2 A;  1LAC A;  1Q86 C;  3QOL A;  3S1M B;  3J80 L;  1STH A;  2ASB A;  3SR1 A;  2DUD A;  4RMF A;  2X6L A;  1DGS A;  5IT9 c;  5JEA J;  2NVX H;  1BCP F;  3IKJ A;  3RZD H;  1K8G A;  2CCZ A;  4DV0 Q;  4QCL A;  4K5W A;  4KTA A;  1EWH A;  4E6I A;  4PG3 A;  3M4P A;  1ENC A;  3VDY A;  2JA7 H;  4DN4 M;  2K4K A;  4R9W A;  1KRT A;  1Y8P B;  4ZUI A;  1PFB A;  1IW7 D;  1SYG A;  5EGT A;  4DV3 Q;  1R4Q B;  2UUB L;  2IPK D;  2V4D A;  5FLM H;  1TT2 A;  2QW7 A;  3K81 C;  1KQS A;  4J15 A;  1YNJ D;  2F0U A;  2RKS A;  4X3K A;  4GKJ L;  1FNW A;  1R9T B;  1TWG H;  5E4W C;  4A3G H;  1UUP A;  3CF5 A;  5IWA L;  1GM5 A;  2X6G A;  1XJV A;  3RZO B;  3K5N A;  2KJX A;  4JI0 L;  4BY1 H;  4OHJ A;  2R3Z A;  3TZD A;  4A3M H;  2RVL A;  2KCM A;  2M9V A;  5D3I B;  5ELO A;  1QE6 A;  4IPC A;  2R7F A;  3P1H A;  4EVO A;  4A93 B;  1XPO A;  1A6X A;  2B39 A;  5A2Q E;  1V9P A;  1PH9 A;  1EEF D;  1RHP A;  4BWG B;  4FVM A;  4DFA A;  3FKI G;  5C44 B;  4JI4 Q;  2XSC A;  3GV3 A;  4X3U A;  2Q8T A;  4NXM L;  2H5X A;  2F0H A;  1JJ2 A;  4X66 L;  4HSV A;  2EXD A;  1SDF A;  3BYY B;  2F0T A;  3DEP A;  3NWT A;  5M3M B;  4QB4 A;  1KAA A;  1QWY A;  3VR5 A;  4CJ2 C;  4IO9 A;  3WOE A;  2K5V A;  2K33 A;  2YTV A;  1KD1 C;  1X9N A;  4KHV A;  4LF7 Q;  1GUT A;  1KDB A;  4OEM B;  4K6D A;  1A63 A;  2D5D A;  1YJW A;  1EFW A;  3PF4 A;  4DAV A;  2KCT A;  3A5U A;  3EJI A;  2RHS B;  1FNV A;  4RG1 A;  1SE8 A;  3RD4 A;  5IP7 H;  2L55 A;  1WI5 A;  5BR8 Q;  1W6J A;  2NZH A;  1JWU D;  1O78 A;  1I6V C;  1Y8O B;  1PZJ D;  3PV0 A;  5JEA H;  5HUR A;  2EIF A;  2R7Z G;  3K5L A;  2UUC L;  4C3J G;  1BO0 A;  1SN8 A;  1LTI D;  3TP7 A;  3EIV A;  1WCM G;  1AN8 A;  5CV9 A;  2EJM A;  1CHQ D;  4NW2 A;  4C2M H;  5M9O A;  1Q1B A;  4LFC Q;  1QZG A;  3DMU A;  3TS0 A;  2JSO A;  3NBI A;  2CH4 A;  2M00 A;  1E2V A;  2E2J H;  5JOB A;  1XMO L;  3H0G H;  1XX8 A;  3CKI B;  2NN6 I;  1RF2 D;  3MXU A;  2JE6 I;  4DK1 A;  5L37 A;  1F9S A;  5GAD C;  4YWK A;  4JI5 Q;  3M3Y H;  1PH5 A;  3C2P A;  2AMC B;  3KLS X;  1YHQ A;  5CV6 A;  5IGG A;  4XQN A;  4LF9 Q;  1MJC A;  4XTC S;  4UHV A;  4OO1 G;  1ZYR C;  5C4J B;  2F0D A;  3OW2 A;  1ILQ A;  1HNW Q;  3DHQ A;  3H15 A;  2OTJ A;  3U4Z A;  1FGB D;  2RQX A;  3K57 A;  1QVC A;  1E2Z A;  2Y0S B;  3HOW G;  1B9N A;  1J5E Q;  3JAM c;  3F1Z A;  2PYK A;  2UXC L;  5KRU A;  1HR0 W;  2DJG C;  4G7H C;  4DV2 L;  2EYP A;  2TSS A;  2ICE C;  3D0F A;  1GUN A;  1L1O A;  4FDB A;  3HRZ C;  2JEA I;  5K36 H;  1A0I A;  1GXD C;  1J8I A;  4HED A;  2Q8I B;  4R4T A;  3CQZ H;  4FF2 A;  4DAY A;  4WOR A;  4TKO B;  2RF4 A;  3TME A;  1I6H B;  2L1B A;  2QF7 A;  4IJH A;  4DV5 L;  4KHP Q;  3MZ5 A;  4DR7 Q;  4B3R Q;  2VNU D;  4DV7 Q;  4JBM A;  2D0P A;  3F8T A;  1XPR A;  1EFI D;  4QY7 A;  3L7Z C;  3GTK H;  1SXT A;  3S9W A;  3NEN A;  4JI1 Q;  4DR2 L;  3UDI A;  1Q1E A;  4NXN L;  1K73 C;  1FNU A;  1CM9 A;  4HJ9 A;  3F2B A;  5IP9 H;  4KI0 A;  4HR7 B;  1M90 C;  1GHK A;  3IRB A;  1NR2 A;  1E2W A;  2Z8L A;  4DR6 Q;  3A5Z B;  3BVM A;  3PIP 3;  4RKB A;  2SNM A;  2I46 A;  1SJH D;  1ROD A;  2OCE A;  2A1A A;  3QB3 A;  2NVQ B;  1HQR D;  1STB A;  1GVP A;  1NMG A;  2J0T D;  3MTS A;  4LF6 L;  2EVB A;  5A2Q L;  1RJT A;  4OX9 Q;  2QDB A;  1C0A A;  4C3I B;  1DD2 A;  4QQB X;  1PZK D;  2CVR A;  1B8A A;  4OGQ C;  1PH2 A;  3TZU A;  2F0V A;  3PO3 G;  4A93 G;  2SEB D;  4A3D H;  3CC2 A;  2ID0 A;  3VA5 A;  2YTX A;  1LTL A;  2LS0 1;  4K14 A;  1TS2 A;  1DOL A;  4XDX A;  3T13 A;  1G2T A;  2Z6K A;  4PMC A;  5F2D A;  3IFT A;  3VR4 A;  2M2L A;  3NWS A;  1G8Z D;  3SEB A;  3KF6 B;  1JOO A;  2F0G A;  2R92 B;  5C44 G;  4Y7N H;  1UNS A;  2BDO A;  3G6J B;  3S14 B;  3T4A C;  2KED A;  5TSS A;  2UU9 Q;  4JOI A;  5M3M G;  2KEC A;  1NR4 A;  3BZD B;  4U68 A;  1AZQ A;  2JP1 A;  1O7Z A;  5FO8 B;  5JJI A;  1JB3 A;  3GTP B;  3A54 A;  2EE1 A;  3CCS A;  1SNO A;  1G51 A;  4ZKB B;  1I4Q A;  1TU2 B;  5FOB B;  1HNX L;  1KDC A;  1BKB A;  4A3I B;  3NSW A;  4PMW A;  4GNX A;  1HR0 L;  4CGY B;  2FJ2 A;  3Q6S A;  5CV5 A;  1LT4 D;  1RL2 A;  2OF1 A;  2K52 A;  3M7G A;  4QL5 A;  2C5C A;  3ND9 A;  3OMG A;  3V2T A;  1K28 A;  5IOC A;  1NTG A;  3BJU A;  4A3E H;  1EY8 A;  2I0Q A;  3PUZ A;  2ZXO A;  2KBN A;  1U0L A;  2GA4 B;  1D1K A;  5FLX c;  1G6P A;  2JYO A;  1I4H A;  4IAL A;  2F4I A;  3KF8 B;  2V1C C;  4OIJ A;  4F88 A;  4IUT A;  1K0R A;  3M4O B;  4BBR H;  1ET9 A;  1KRS A;  1HNZ L;  5JPN C;  4GOP B;  1NBW A;  2B2T A;  1Y69 U;  2RHQ B;  3BDL A;  2F0J A;  3BYT B;  3CPW A;  1FL0 A;  1Q46 A;  4I7A A;  4UY8 C;  1KTK A;  1XTC D;  2PPB C;  3EQL C;  4HIM A;  4FXD A;  5T1I A;  5IYC H;  4LF5 L;  1U4P A;  4B3M L;  1EU3 A;  4WRD A;  4IOC A;  4IPG A;  1DJR D;  1OXT A;  4A3B H;  1QG7 A;  5KNB A;  2JA6 B;  3ND8 A;  3PCO B;  4IUQ A;  3OHX C;  4H0L C;  3CW2 C;  4DK0 A;  1LTG D;  1B53 A;  4GZY C;  5IYD H;  4DR1 Q;  2PQA B;  3ULJ A;  3I8Z A;  1KNA A;  2K6A A;  1Q82 C;  1EL0 A;  2Y0S G;  3FPU B;  2IL8 A;  2CQA A;  3W3A A;  1ICW A;  4A3L G;  3DM1 A;  3KDF B;  3S1Q H;  1JQY D;  1A62 A;  2NVT B;  1E22 A;  2LSS A;  2A68 C;  3HOZ B;  3NTK A;  4X62 Q;  3NPP A;  4K0K L;  4HSP A;  4K5X A;  2I5L X;  2OXP A;  4DUZ L;  2XIW A;  1EOT A;  2PO4 A;  1FD7 D;  3J81 L;  3K7U C;  4P73 A;  4DR3 Q;  1U4M A;  1CFM A;  3AQQ A;  1DZ1 A;  3PGZ A;  1FR3 A;  1AEX A;  1PV4 A;  1L1O C;  2BCO A;  2NVY H;  4MIU A;  2B29 A;  4R8N A;  1VQG A;  2A6E C;  3GTM H;  1W6K A;  4DV1 Q;  3CC7 A;  4EQP A;  3HOY B;  3I72 A;  3JC6 6;  5AJ3 L;  3IL8 A;  1PFM A;  5CR3 A;  2O5J C;  2D62 A;  2C9O A;  4BXX H;  3CCL A;  3H3V I;  2L12 A;  3NUC A;  5JJL A;  1PRT D;  3I91 A;  1KLG D;  5LMN W;  2NN6 G;  2F0F A;  2ENB A;  3DWP A;  1QNU A;  1LTT D;  4JW0 A;  2JA9 A;  1EOV A;  2K5Q A;  1N36 L;  4LF4 L;  4OIK A;  4CKB A;  1O7L A;  4J8Q A;  1IBM L;  4ME3 A;  4XYQ A;  3ULL A;  1BNZ A;  3E9H A;  3NBH A;  3HG9 A;  2QA4 A;  1OTC A;  3AFQ A;  4UP8 A;  4X64 L;  3K6O A;  1B3Q A;  5E1F A;  2F0S A;  2SDF A;  1EIY B;  4RA8 A;  4C3I G;  3TRE A;  1AE2 A;  2IX1 A;  1N34 L;  1IYJ B;  1RIP A;  4ZLT F;  2RDG A;  4X65 Q;  4A76 A;  1CHP D;  3TSS A;  3FPP A;  2HQE A;  5CYU A;  3GTO H;  4EX5 A;  4DKA C;  3I3C A;  4UPA A;  1XNQ Q;  4X3S A;  2OEO A;  2R92 G;  3CCE A;  1SYB A;  4BS9 A;  4R8I A;  4JYA L;  1Y1V H;  3BVG A;  1L0Y B;  1B9M A;  2EYH A;  4MZ9 A;  2Z6K C;  2RDF A;  1BCP C;  1PH6 A;  1HZ9 A;  2N3S A;  3CPF A;  4KJO A;  1KXL A;  2G9D A;  5I6W A;  4UAI A;  4DNR B;  1N9W A;  4GLV B;  5IYB G;  3ULP A;  3S2H H;  4JOI C;  1SNC A;  1XNR Q;  4JPB W;  2KEE A;  3LGJ A;  1PMR A;  3TP5 A;  1I94 L;  1K3B C;  5C5M A;  2E8G A;  1KHI A;  5LHY 1;  4KMU C;  1B4O A;  1S5C D;  5C0X I;  1WTO A;  1IYU A;  1CKN A;  4B08 A;  4N9T A;  3RN5 A;  1UAP A;  1VQ6 A;  4DR5 L;  1EWC A;  4C3H B;  2FFK B;  5IYB H;  3BS1 A;  1K8A C;  1VQI A;  1UE6 A;  4G7O C;  1CSP A;  4HJ7 A;  1SMY D;  4GLX A;  5IT9 E;  1BUV T;  3BU2 A;  5BN4 A;  1GUO A;  3E9I A;  2GN5 A;  2IW3 A;  3SXH A;  2AQ2 B;  1KAW A;  1HUM A;  4ABN A;  1CKM A;  3ONA B;  4QUC A;  4MNO A;  4RWS C;  4WJW A;  1G29 1;  3I7F A;  4BBS B;  4CDC C;  2MQH A;  4JI8 L;  1YNX A;  2VB3 X;  3T1Y L;  1FJG Q;  3F2U A;  2WFW A;  3BZK A;  4FXG C;  1E24 A;  3GP7 A;  4QJF A;  4R1J A;  3SDZ A;  4GKK L;  1JOK A;  3QG1 A;  2F0N A;  3BDC A;  4Q5V A;  2EZV A;  1CI3 M;  3CAM A;  2GVB A;  3NTI A;  3D8G A;  3STB C;  2HCI A;  5LMN L;  4GNX B;  3NTH A;  1QUQ B;  2F4V L;  1S5B D;  3J80 c;  1D5Z C;  2YTY A;  3CU7 A;  2Q2H A;  4ME5 A;  2JA6 G;  1SYE A;  2UUA Q;  1WD0 A;  2UUB Q;  1F9R A;  3PO2 H;  1S40 A;  1L2F A;  5FK9 C;  2E2J B;  1WTP A;  3T51 B;  1VF5 C;  4GKJ Q;  1H9S A;  4QF4 A;  2VUM G;  4A3F H;  2HUG A;  2B63 B;  1IBL Q;  2E2H B;  1EWI A;  2R6G A;  1ESF A;  4JI7 L;  4JI0 Q;  1UE7 A;  2AUJ D;  2ICI A;  3DXJ C;  1H9J A;  1NE3 A;  1SBB B;  4DK6 C;  5M5W H;  3KJP A;  1QNK A;  3BZC A;  1PTO B;  3OTO L;  2KQ3 A;  4A3K H;  2N88 A;  1CUK A;  1WFQ A;  2F3W A;  1Y1W B;  2O5I C;  4CKE A;  2VUM H;  1LT6 D;  1K83 H;  1HA5 A;  2FXQ A;  1BBW A;  1A3T A;  4P75 A;  4CKC A;  2QEJ C;  5C4Z A;  1Y8N B;  1IYV A;  3IAY A;  3UDF A;  3MFG A;  1QVF A;  5KEE A;  3O13 A;  5EKL A;  3AB9 A;  1LT3 D;  2KCC A;  4QMG A;  1IBK Q;  4GN5 A;  1Z7T A;  1YBY A;  3I55 A;  1ET6 A;  5C3E H;  2EJF C;  3CCJ A;  3J7A 5;  4XQQ A;  4NXM Q;  2PMZ E;  4AQY L;  5M5X B;  3HKZ E;  4X66 Q;  4LNQ A;  4UP9 A;  4A3C H;  3G7L A;  1IXR A;  2FIN B;  1Q8I A;  1G91 A;  5LMU L;  3CQZ B;  4EQO A;  4DV4 Q;  1WOC A;  3U58 A;  1RCV D;  5I2X A;  3V96 A;  1A3V A;  2HCC A;  3MXN B;  4KKS A;  5DLQ E;  1OXU A;  1C4Q A;  4KHZ A;  2K7V A;  2RDH A;  3UDX A;  4KY7 A;  3VA7 A;  4LMQ D;  2N8N A;  1STE A;  1SND A;  4IUN A;  2AQ3 B;  3NEL A;  2JQO A;  2E2I H;  4P74 A;  1JOQ A;  2CFM A;  1I3Q B;  2QIL A;  1CZG A;  2EQS A;  1R4P B;  2AWN A;  2EY2 A;  5CMD A;  3HZX A;  3S1N H;  2UUC Q;  3NE5 B;  1YHA A;  2F0M A;  1G2S A;  5M5Y H;  4I7Z C;  4CDF C;  2Q2U A;  4G4K A;  5AFW A;  1A2T A;  3I56 A;  1GKH A;  1GHJ A;  3QJY A;  4MTN A;  1Q81 C;  1IW7 C;  4FP5 D;  4ZYS A;  1VF7 A;  4DXG A;  1E1O A;  4IJL A;  1E1T A;  1XMQ L;  1YNJ C;  1DOK A;  5H1S E;  4KKT A;  2WIN B;  2ZT9 C;  3V05 A;  3QWN A;  4OXP A;  4DR4 Q;  2K04 A;  3KLS A;  2PZT A;  1STG A;  3R3O A;  3RMH A;  3JAM E;  4L6T B;  4HJ8 A;  2B2V A;  1VQM A;  4HTH A;  1JT8 A;  2FHT A;  1X3P A;  3KFU A;  4L5S A;  3D3R A;  5C0X J;  2YU9 H;  1VQ7 A;  5GRO A;  1TY0 A;  5D14 A;  2AQ1 B;  2PW5 A;  5IGF A;  2KVM A;  3FKI H;  5C6A A;  4B3T Q;  1DON A;  1VQO A;  4C3H G;  1N32 Q;  2UXC Q;  4JI6 L;  4LWC A;  1V1P A;  5C3X A;  1HZB A;  1H9M A;  2Z1C A;  3KBX A;  4HN7 A;  3MEH A;  4DV2 Q;  2D9U A;  4IUR A;  4AYB E;  5EPJ A;  4XQJ A;  1CA5 A;  5A35 A;  4BBS G;  1B50 A;  1ML0 D;  4FF4 A;  3GTQ H;  2IJ0 A;  2NTS A;  4K8I A;  4CBV A;  1F2L A;  2NWG A;  1GOZ A;  4DV5 Q;  2JA8 B;  3I4M B;  1Y14 B;  3MEF A;  4K5V A;  1PYS B;  3FDT A;  4BBR B;  3L3O C;  3Q23 A;  2R7Z H;  2MJ8 A;  1W3S A;  3W2D A;  4C3J H;  3SK8 A;  1HRJ A;  3MXG A;  3W5O A;  1A3U A;  3A8K E;  2MFI A;  1ONL A;  4DR2 Q;  4RCO A;  4NXN Q;  2DY8 A;  3I4O A;  1EY9 A;  1TWF H;  1WCM H;  4EQN A;  2ZM6 L;  1KC8 C;  3I70 A;  4BY7 G;  3Q8D A;  3BDO A;  2F0L A;  3A8J E;  4LUO A;  3J7A F;  2B63 G;  4L5R C;  2R93 G;  1N8R C;  4A3B B;  2CH4 W;  2Q8R E;  3CCQ A;  4LFB L;  1QJO A;  1F2Z A;  2PZU A;  3K7A B;  1CA6 A;  3K0X A;  3I90 A;  4BA1 I;  4LF6 Q;  1JB7 A;  3HGB A;  3MAQ A;  4IFD I;  3NEM A;  1Y1W G;  4NMZ A;  5JJZ A;  1EY6 A;  3KLR A;  5T1G A;  2XTI A;  5C0X G;  3GTJ H;  1NNX A;  4HJ5 A;  1TR5 A;  4KD4 A;  3HFZ B;  3BVZ A;  4JI4 L;  2E2D C;  1F9Q A;  4OO1 H;  4C1N K;  5EKK A;  1LUZ A;  3MFY A;  1H9R A;  3K8A A;  1I5F A;  3FEW X;  3EVQ A;  3E5S A;  3EFX D;  4PQX A;  3HOW H;  1YNN D;  2K32 A;  1XTD A;  3DEO A;  4H02 A;  3CCV A;  1TWH B;  2KA7 A;  5CBA E;  4P2C B;  4KN7 C;  1SFO H;  1QIL A;  5IOD A;  2A8V A;  4CDE C;  2K14 A;  1LV9 A;  4S3S A;  4V0B A;  1FYC A;  1X3Q A;  1C9O A;  3S2D B;  1VQL A;  1T9H A;  1JE5 A;  3Q0A A;  2F03 A;  4JI2 L;  1K0S A;  2NVY B;  5KYL A;  5BR8 L;  1HNX Q;  1B7Y B;  2N55 A;  2NBF A;  3S16 B;  2NTT A;  2BH8 A;  1C7Y A;  2WB1 E;  1B2T A;  3S1M H;  1H95 A;  4KKU A;  3PIP A;  1HR0 Q;  3D6C A;  5FLX E;  3T56 B;  1XWE A;  1GUW A;  2IX3 A;  4PZ7 A;  2CW0 D;  3A55 A;  3H91 A;  3GTG B;  1K3R A;  4RAU C;  1EY7 A;  1J6Q A;  5DM7 3;  1TWA H;  1LM0 A;  4A3J B;  2B2W A;  3A7A B;  4TRD A;  4LFC L;  2MO1 A;  1CQF A;  2KOL A;  2K50 A;  3J7Z C;  1F9P A;  4XYO A;  3PIO A;  5ELB A;  1JMC A;  5C4X B;  3MC0 B;  1R9T H;  4H13 C;  3UE1 A;  3RR5 A;  5I9O A;  3OSO A;  5KNC A;  5EJW A;  1TWC B;  3G71 A;  1WTX A;  3RZO H;  2MGS A;  1OXV A;  4RGN A;  2K05 A;  4LF9 L;  1L0W A;  4LF5 Q;  4B3M Q;  3PIO 3;  1AP0 A;  2K03 A;  4ZAI A;  2F0I A;  5J22 A;  1EIH A;  1V8Q A;  4R4I A;  5EBC A;  4XIG S;  3ICE A;  2EYO A;  4ZRZ A;  1D1I A;  2Z9H A;  3PO3 H;  4A93 H;  2OWO A;  4DV6 L;  2J7Z A;  1OO9 B;  2VL6 A;  3W1G A;  4DA2 A;  2PI2 A;  4Y52 H;  2B2V C;  3R8B A;  3LNN A;  1HHV A;  1L0X B;  5C44 H;  2RSN A;  2PMZ B;  3HKZ B;  4DF7 A;  2Z4I A;  3CHB D;  4DU9 A;  3FMC A;  1BXT A;  1PLF A;  5KYI A;  4TQU S;  5M3M H;  4B3S L;  1EQT A;  2O2L D;  2QEX A;  2JA5 B;  1I4X A;  2JN4 A;  1EYG A;  3HOX B;  4K0K Q;  3VYU A;  5DNF A;  4WJ4 A;  1UEB A;  1CZW A;  1NCV A;  5FO7 B;  5M3F B;  4DK3 C;  2HHH L;  4DR7 L;  4B3R L;  3S1R B;  4DV7 L;  3HOU B;  1SNP A;  4FF1 A;  4OON A;  4DGZ A;  2VQF Q;  3WDN A;  3GV6 A;  1KIX A;  4JI1 L;  2JA8 G;  3I4M G;  5ISR A;  2Q2T A;  1DYQ A;  5CV4 A;  3IFD A;  1SE3 A;  5KND A;  3SE0 A;  5AJ3 Q;  3J81 c;  2P5Z X;  1VS0 A;  1B70 B;  3JAM i;  3R2I A;  3DWA A;  1MJE A;  4KJN A;  4DR6 L;  3Q24 A;  1BF4 A;  1MKH A;  1HJP A;  5C4H A;  4JBJ A;  1PHJ A;  3OIP A;  3LWU A;  4K2L A;  1LT5 D;  4XXE A;  3TRZ A;  1F2M A;  4APV A;  3UE0 A;  4MHE A;  1N36 Q;  4LF4 Q;  4NPS A;  1SNQ A;  1LTB D;  5FJ8 G;  3T1H Q;  4JI3 L;  1IBM Q;  4ZKC B;  2A5H A;  2PW7 A;  1VMC A;  5I2Y A;  3H09 A;  4X64 Q;  2FMC A;  2NYZ D;  3GTL H;  4PV1 C;  3TDQ A;  1K9M C;  3U9O A;  3X3N A;  2DNC A;  1EY4 A;  1I50 B;  4YCW A;  1ENA A;  1VMP A;  3KYH C;  1SSO A;  5ELE A;  1NMF A;  4HIK A;  4U67 3;  1Q3L A;  4JBK A;  2L5T A;  1QZH A;  2UU9 L;  1EQV A;  1B1Z A;  2B2Y C;  1BDO A;  5M5W B;  3TP6 A;  2JXM B;  3HOV B;  2NZO A;  1RDP D;  2AKW B;  4A3L H;  2I5H A;  1K83 B;  1SMX A;  3NHH A;  4PZ8 A;  1AE3 A;  4JYA Q;  3S15 H;  5DEH A;  4AIM A;  1D8L A;  3I4N B;  4OL7 A;  3E3X A;  1RTN A;  5FLX L;  2BA1 A;  1SYD A;  4KN4 C;  3OOC A;  4N9P A;  4AYB B;  1NY4 A;  4NB3 A;  5C3E B;  5E4X A;  3KOJ A;  3D4D A;  3RN2 A;  4ZUJ A;  3D4W A;  4ILW A;  5EPK A;  3UDG A;  1I94 Q;  3NP8 A;  1JWS D;  1RKN A;  2VZA A;  1WD1 A;  2RA4 A;  2NVX B;  1I6H H;  3RZD B;  1XPU A;  4DR5 Q;  5ELN A;  3CME A;  2CHB D;  1JIC A;  1JC7 A;  4UDU C;  4A3J G;  1GUG A;  3RUZ A;  2JA7 B;  1K8O A;  3ER0 A;  4LUV A;  3E0E A;  1SJE D;  4YY3 L;  1OXS C;  1JR0 D;  1YHB A;  3QOJ A;  1ZEQ X;  1L1O B;  3LWE A;  4OWT B;  2ES2 A;  1D5M C;  2IY5 B;  2B2W C;  2NN6 H;  5C4X G;  1I4G A;  4LUZ A;  1VQP A;  3L2P A;  1PRT C;  1TWG B;  4DNI A;  1LAB A;  4IFD G;  3J80 E;  4A3G B;  4OWX B;  1ESR A;  2B2U A;  4DAY B;  4A4I A;  2EYJ A;  5BN5 A;  1CT1 D;  4HCS A;  2A6H D;  4HMI A;  1BR9 A;  4DAP A;  4BY1 B;  3C3L A;  4GKK Q;  5D3D A;  3NQT A;  4A3M B;  1X6O A;  4C3I H;  2K5W A;  1A8V A;  1I4P A;  2E5L L;  4DXF A;  2HIV A;  1TII D;  2K5H A;  4DUY L;  4LFA L;  1AZP A;  1PYB A;  3G4S A;  4RGM A;  2EY1 A;  2BE5 D;  5JVG 3;  2RCN A;  4WJ3 M;  2XNA C;  2SOB A;  1AW7 A;  2F3V A;  3G6E A;  2R92 H;  3HKZ G;  3VYS A;  1VQ9 A;  4A3I G;  1EZ8 A;  3S14 H;  2ZJQ A;  4JI7 Q;  1MIU A;  3GQB A;  5IE8 A;  4L5T A;  4QIW E;  2JA5 G;  2UXD L;  4UP7 A;  3L0O A;  2ZXP A;  3U9S A;  2NZ1 D;  3OTO Q;  3HOX G;  3GTP H;  4YHH L;  1N33 L;  1PDQ A;  4RGT A;  4DV1 L;  1DM0 B;  4FXK C;  2ATW A;  2WB1 B;  3J81 j;  2JEB I;  3HS0 C;  1LTR D;  4ZQ3 A;  5M3F G;  1CK1 A;  1HZA A;  3GO5 A;  3C1F A;  3PUW A;  4ODG A;  4PZ6 A;  1FVI A;  5GAE C;  1BCP B;  2B8G A;  3HOU G;  1X56 A;  2R61 A;  5D65 A;  1S5E D;  1Q8K A;  4IUP A;  4JVZ A;  5IGC A;  4L8J A;  1HTL D;  1U4L A;  2JK8 A;  5C5L A;  4AQY Q;  4LJZ C;  2VQE L;  2I07 B;  1PTO D;  4HID A;  2J4X A;  3TS2 A;  5LMU Q;  2F52 A;  3GTQ B;  3ERO A;  1NJI C;  4EGV A;  1SMY C;  1PH4 A;  1AFP A;  4KK7 A;  5HGT A;  3M4O H;  3AFP A;  2D2C C;  1VQ4 A;  1ZKO A;  1CTM A;  2R7D A;  3RLF A;  2XGT A;  4C2M B;  1DCZ A;  4X6A H;  1HA6 A;  4IPD A;  1WTR A;  3SK4 A;  3K58 A;  2KUM A;  4G7Z C;  1Q12 A;  1MGS A;  5GAG C;  3T16 A;  1U9R A;  2X69 A;  3H0G B;  2DGY A;  1YZ6 A;  2H4O A;  2LKV A;  3I4L A;  5GQO A;  3CCU A;  4FO2 A;  2KHS A;  1S72 A;  4JV5 L;  2I5M X;  5IWA Q;  1KL9 A;  1XNQ L;  2JA6 H;  2PNR C;  3M3Y B;  4JK1 C;  1HTP A;  4KLK A;  1SR3 A;  4ALP A;  3HOZ G;  4RHS A;  1O7Y A;  1TVX A;  1KLU D;  3ERQ A;  1TS3 A;  1EYD A;  3HOV G;  2DJF C;  1XMQ Q;  1UEA B;  5DM6 3;  1HQM C;  3VR3 A;  2NVT H;  1X65 A;  2TMP A;  3I4N G;  3H6M A;  3QR8 A;  1PH8 A;  2XVS A;  2O4X A;  4QGU A;  2N49 A;  3TP8 A;  2IHE A;  4FNF A;  4AYB G;  3HOY G;  2F0P A;  3TQY A;  1EQR A;  4C56 C;  1UE5 A;  4P72 A;  5EQ0 A;  3OIQ A;  5LL6 S;  4LF8 L;  3T53 B;  1VQF A;  1EZ6 A;  4JBW A;  1JE4 A;  3RLN A;  2K5D A;  2WV6 D;  1EY0 A;  1PYW D;  4JI6 Q;  5EKI A;  3SGI A;  2ZTE A;  1X55 A;  4MTK A;  2JA7 G;  3E0J A;  1YIT A;  1FJG L;  1S4Z A;  1BBU A;  3K5O A;  1A15 A;  3U50 C;  5JAV A;  3GTK B;  4ZK9 B;  3MXP A;  4QUF A;  3K0Y A;  3SHL A;  5FLM G;  4IOA A;  4IQZ A;  5I9P A;  4O42 A;  1P16 A;  2Z0S A;  1D5X C;  4A3G G;  3MHB A;  3R93 A;  1TWA B;  3KF6 A;  4P71 A;  1GUS A;  5CGK A;  1Z47 A;  3K59 A;  2UUA L;  4BY1 G;  3D4R A;  3RLO A;  3A0J A;  4A3M G;  2PZW A;  2B2U C;  2WKD A;  3DWQ A;  4IN3 A;  1X3E A;  2F0O A;  3K80 C;  4TSS A;  1IBL L;  3L9A X;  1S5F D;  2RBM A;  1XMO Q;  3CCM A;  4A3D B;  2WAQ E;  1HH2 P;  3EN2 A;  3DUZ A;  1SEB D;  3NK9 A;  2ZM6 Q;  3N6R A;  2EYF A;  4HAE A;  2IHF A;  1VQC A;  2UXB L;  1MBY A;  2LXK A;  3KLW A;  2DN8 A;  1M8A A;  1BQQ T;  3NBH B;  4LFB Q;  4Y7N B;  3PO3 B;  3P75 A;  1WVL A;  2WII B;  1WTW A;  5IT9 L;  4ULL A;  1PH1 A;  3QIA A;  2QGQ A;  5GAH C;  1IBK L;  1PTO F;  2EPB A;  2CKZ B;  5DAU A;  3KF8 A;  1V1O A;  1U5K A;  2PQE A;  2KHI A;  4YIJ A;  4BA2 I;  2WB1 G;  2ZXR A;  3MVV A;  4N8F A;  1YJN A;  3J7Y W;  4GOP A;  3J80 i;  1B3A A;  3B6Y A;  3E6Z X;  5G3L F;  2F0Q A;  3H3V H;  5IP7 G;  1VQE A;  3ITP A;  1TY2 A;  4CHT B;  5HGQ A;  4DV4 L;  4C3H H;  1VQB A;  4DV0 L;  2EOT A;  1EU4 A;  2AHO B;  2LY7 A;  4A3E B;  2K28 A;  2HT1 A;  4H44 C;  2K5N A;  3HKS A;  3WWV A;  5JEA G;  2CQO A;  5IIF A;  2F1M A;  4O1N A;  4JI2 Q;  2FMM A;  2MUY A;  3MWY W;  5J3B A;  4DV3 L;  5IGE A;  1AH9 A;  1DOM A;  1S3O A;  2ALY B;  4BBS H;  3GD7 A;  4L5Q A;  2PQA A;  4DPG A;  1CKN B;  1IKM A;  2WAC A;  4OWW B;  5CC4 A;  2K75 A;  3KDF A;  2BA0 A;  1HXY D;  3H0G G;  2A74 C;  3U4V A;  3P20 A;  1TKW B;  3FP9 A;  1ZYR D;  1UE1 A;  1XXG A;  1GO3 E;  1MSG A;  4K2K A;  5NUC A;  1E0B A;  1RTO A;  4DR4 L;  5IY0 A;  1Q7Y C;  4IUV A;  4BY7 H;  2B2Y A;  2K01 A;  1DXM A;  3GTL B;  2B63 H;  1Q90 A;  2R93 H;  2E2H H;  1PA6 A;  2VW9 A;  1HUN A;  3S1Q B;  2EY6 A;  2WP8 J;  3M4Y A;  4QIW B;  2EJG C;  1PTO H;  1Y1W H;  2Z6B A;  3A56 A;  5C0X H;  4JCV E;  4LF7 L;  5C3W A;  1KDA A;  4B3T L;  3CMA A;  4GN4 B;  4DV6 Q;  4M1U B;  1N32 L;  3S15 B;  3NQI A;  4K6L A;  5K36 G;  1VQA A;  1MD2 D;  4AH6 A;  1EIG A;  2PCF B;  1H9S B;  1TS4 A;  5EBD A;  4G57 A;  3D6W A;  3S17 H;  5ELC A;  3AEV A;  3GTM B;  2CWA A;  5M5X H;  1O80 A;  2IWH A;  3AYH B;  2VB2 X;  1YNN C;  2VXW A;  5IGD A;  1VQ8 A;  3Q22 A;  4B3S Q;  3PF5 A;  4J1M A;  4O2D A;  4LK1 C;  3CRK C;  3H94 A;  2WKC A;  2OTL A;  1LLR D;  2XRS D;  2LMC B;  4Z9C B;  4LAA A;  3M85 A;  3J81 E;  1VQH A;  2HDL A;  2HD3 A;  2EYM A;  5IP9 G;  5J1Z A;  3M9B A;  2PI2 E;  2HHH Q;  3SVM A;  1PFN A;  1JOR A;  5FKA C;  4DAM A;  5LL6 X;  1VQJ A;  3EA6 A;  1ILP A;  1M1K C;  4LW1 A;  2B8F A;  1T5X D;  2OQ0 A;  1YJ9 A;  1HNZ Q;  1ASY A;  1EUJ A;  2NUC A;  1I3Q H;  5CBE E;  2CW0 C;  3JAM L;  1TQO A;  1YVC A;  4JI5 L;  2A19 A;  5E7N A;  4WFN 3;  1P8L A;  1YI2 A;  1QVG A;  2K1B A;  3M4Q A;  1H9K A;  3CXC A;  1M4V A;  4A3D G;  3PQI A;  2E75 C;  2RSO A;  1SNM A;  3PUX A;  1G6Z A; 
#chains in the Genus database with same CATH homology
 2E76 C;  3SK6 A;  4RKL A;  3GTO B;  5COR A;  1SE4 A;  1ZXT A;  2IT1 A;  5ELF A;  2L0C A;  3C1E A;  1Y1V B;  2AWO A;  1K8M A;  2HDM A;  3BG3 A;  4CJ0 B;  3QO2 A;  4M8A A;  1PZI D;  1TS5 A;  4PMB A;  1CQV A;  1IHZ A;  3K5M A;  5JPM C;  2MP1 A;  3S2H B;  3P7J A;  5ELD A;  3TN2 A;  1A2U A;  1J9O A;  1I4R A;  2XWB B;  1KNE A;  3A8I E;  1D6E C;  4IUU A;  3URY A;  1PXU A;  1IL8 A;  1BOS A;  4F8M A;  1STY A;  1T5E A;  1F77 A;  1QCB D;  1B44 D;  4C1N I;  1STA A;  4RCN A;  1II3 A;  2L11 A;  1S5D D;  1LTS D;  4MN3 A;  4HMJ A;  4DNT B;  1V1P B;  3PUY A;  1SYF A;  2LFN A;  1IKL A;  2G9H D;  4IFD J;  2WAQ B;  2SNS A;  3PO2 B;  5CV8 A;  1BBX C;  3KUP A;  4FF3 A;  2DNE A;  4A3F B;  2A68 D;  2IX0 A;  3M7N A;  4A3K B;  3TBI B;  2VUM B;  3FVQ A;  4XT3 B;  3VYT A;  3SK5 A;  4CJ1 B;  3MA2 B;  2A6E D;  3MXN A;  3WOF A;  4RH6 A;  2Z4H A;  2EY5 A;  1V43 A;  3OW7 A;  4KY5 A;  3OMC A;  1OXX K;  4NDX A;  1C48 A;  1HCZ A;  2EXZ A;  2F0W A;  5K5P A;  2NB0 A;  1NAP A;  2OT2 A;  2F0E A;  4Q0F A;  5IGB A;  4IZ8 A;  3ZYY X;  1F2Y A;  2XRQ D;  4PNY A;  2XWJ B;  2E2I B;  1NUC A;  1LTA D;  4RFB A;  4RHR A;  2EYL A;  5BN3 A;  3S1N B;  5CV7 A;  3I73 A;  5M5Y B;  3UI2 A;  3AU7 A;  4IFD H;  5I6Y A;  1BCP D;  3AMU A;  4FYD A;  4K8J A;  1U4R A;  5KIX A;  1D2B A;  3H3V C;  4RGO S;  2A73 B;  3OWF A;  2QKI C;  3N52 A;  5COY A;  5KGU A;  2A6H C;  1GJX A;  3HEJ A;  1PRT B;  3C46 A;  1HPC A;  1EYA A;  2MPM A;  3NXW A;  4KD3 A;  1QOH A;  3KBG A;  2L4N A;  2YU9 B;  1MSH A;  2YYZ A;  2BE5 C;  3FKI B;  4OO1 I;  3OWE B;  2EDG A;  3X3M A;  4L63 B;  5J39 A;  3OPO A;  1WTV A;  1X32 A;  5JVH 3;  1MI2 A;  1STN A;  4I65 A;  1HFN A;  5I4D A;  3D31 A;  2A69 D;  4F87 A;  1LO5 D;  5E3F A;  2QCP X;  1NSN S;  1QB5 D;  3VR6 A;  1XYI A;  3FRP B;  3LX0 A;  5G3L D;  1VDZ A;  2R7Z B;  4ID6 A;  3KK7 A;  3VR2 A;  4KV6 A;  2A69 C;  2MHV A;  3R2T A;  4C3J B;  2H1E A;  3PMF A;  5EPL A;  1PTO C;  4V19 0;  1SAP A;  3PUV A;  4NP5 A;  1TWF B;  1WCM B;  2B2T C;  3A7L A;  4B9X A;  1SE2 A;  1RD9 D;  5FO9 B;  2E74 C;  1Z6H A;  1ENF A;  4F7X A;  1EY5 A;  4B9W A;  4BY7 B;  2AUK A;  1SYC A;  2DY7 A;  3J7A V;  2BDN A;  4H7B A;  3GTJ B;  2R93 B;  2L9H A;  4KY6 A;  1JCK B;  3CRL C;  1KAB A;  2F0K A;  4HCE A;  2BOS A;  3HOW B;  4X3T A;  4J6H A;  2KCN A;  1EYC A;  1WTQ A;  1JWM D;  1SFO B;  1EEI D;  1PRT F;  1VCI A;  1HFG A;  2XN9 C;  4NKL A;  1C8C A;  3HP3 A;  3S17 B;  3VYR A;  4XT1 B;  1LAC A;  3QOL A;  3S1M B;  3J80 L;  1STH A;  3SR1 A;  2X6L A;  5JEA J;  1BCP F;  3IKJ A;  4QCL A;  4K5W A;  4KTA A;  1EWH A;  4E6I A;  1ENC A;  4DN4 M;  4R9W A;  1Y8P B;  4ZUI A;  1PFB A;  1IW7 D;  1SYG A;  5EGT A;  1R4Q B;  2IPK D;  2V4D A;  1TT2 A;  1YNJ D;  2F0U A;  2RKS A;  4X3K A;  1FNW A;  1R9T B;  5E4W C;  1UUP A;  2X6G A;  3RZO B;  3K5N A;  2KJX A;  4OHJ A;  2R3Z A;  3TZD A;  2RVL A;  2M9V A;  5D3I B;  1QE6 A;  3P1H A;  4EVO A;  4A93 B;  1A6X A;  2B39 A;  5A2Q E;  1EEF D;  1RHP A;  4BWG B;  4FVM A;  4DFA A;  5C44 B;  2XSC A;  3GV3 A;  4X3U A;  2Q8T A;  2F0H A;  4HSV A;  1SDF A;  3BYY B;  2F0T A;  3DEP A;  3NWT A;  5M3M B;  4QB4 A;  1KAA A;  1QWY A;  3VR5 A;  4CJ2 C;  3WOE A;  2K33 A;  4KHV A;  1GUT A;  1KDB A;  4K6D A;  2D5D A;  4DAV A;  3EJI A;  1FNV A;  3RD4 A;  2L55 A;  1W6J A;  1JWU D;  1O78 A;  1I6V C;  1Y8O B;  1PZJ D;  3PV0 A;  5JEA H;  5HUR A;  3K5L A;  4C3J G;  1BO0 A;  1LTI D;  3TP7 A;  1AN8 A;  5CV9 A;  2EJM A;  1CHQ D;  4NW2 A;  5M9O A;  1Q1B A;  3DMU A;  2JSO A;  3NBI A;  2M00 A;  1E2V A;  5JOB A;  1XX8 A;  3CKI B;  2NN6 I;  1RF2 D;  3MXU A;  2JE6 I;  4DK1 A;  1F9S A;  3C2P A;  3KLS X;  5CV6 A;  5IGG A;  4XQN A;  4XTC S;  4OO1 G;  1ZYR C;  5C4J B;  2F0D A;  1ILQ A;  3DHQ A;  1FGB D;  2RQX A;  3K57 A;  1E2Z A;  2Y0S B;  1B9N A;  2PYK A;  5KRU A;  4G7H C;  2EYP A;  2TSS A;  2ICE C;  1GUN A;  3HRZ C;  2JEA I;  5K36 H;  1GXD C;  1J8I A;  4HED A;  2Q8I B;  4FF2 A;  4DAY A;  4WOR A;  4TKO B;  3TME A;  1I6H B;  2L1B A;  2QF7 A;  3MZ5 A;  2VNU D;  1EFI D;  3L7Z C;  1SXT A;  3S9W A;  1Q1E A;  1FNU A;  1CM9 A;  4KI0 A;  4HR7 B;  1GHK A;  1NR2 A;  1E2W A;  2Z8L A;  3BVM A;  3PIP 3;  4RKB A;  2SNM A;  2I46 A;  1SJH D;  1ROD A;  3QB3 A;  2NVQ B;  1HQR D;  1STB A;  2J0T D;  3MTS A;  2EVB A;  5A2Q L;  1RJT A;  2QDB A;  4C3I B;  1DD2 A;  1PZK D;  2CVR A;  4OGQ C;  3TZU A;  2F0V A;  2SEB D;  2ID0 A;  3VA5 A;  2LS0 1;  4K14 A;  1TS2 A;  1DOL A;  4XDX A;  3T13 A;  1G2T A;  4PMC A;  5F2D A;  3IFT A;  3VR4 A;  2M2L A;  3NWS A;  1G8Z D;  3SEB A;  1JOO A;  2F0G A;  2R92 B;  1UNS A;  2BDO A;  3G6J B;  3S14 B;  3T4A C;  2KED A;  5TSS A;  2KEC A;  1NR4 A;  3BZD B;  4U68 A;  1AZQ A;  2JP1 A;  1O7Z A;  5FO8 B;  1JB3 A;  3GTP B;  3A54 A;  2EE1 A;  1SNO A;  4ZKB B;  1I4Q A;  5FOB B;  1TU2 B;  1KDC A;  4A3I B;  3NSW A;  4PMW A;  4CGY B;  2FJ2 A;  3Q6S A;  5CV5 A;  1LT4 D;  2OF1 A;  3M7G A;  2C5C A;  3ND9 A;  3OMG A;  3V2T A;  5IOC A;  1EY8 A;  3PUZ A;  2ZXO A;  2GA4 B;  1D1K A;  2JYO A;  1I4H A;  4IAL A;  2F4I A;  4OIJ A;  4F88 A;  4IUT A;  3M4O B;  1ET9 A;  5JPN C;  2B2T A;  1Y69 U;  3BYT B;  3BDL A;  2F0J A;  1KTK A;  1XTC D;  2PPB C;  3EQL C;  4FXD A;  5T1I A;  1U4P A;  1EU3 A;  4WRD A;  1DJR D;  1OXT A;  1QG7 A;  5KNB A;  2JA6 B;  3ND8 A;  4IUQ A;  3OHX C;  4H0L C;  4DK0 A;  1LTG D;  1B53 A;  4GZY C;  3I8Z A;  1KNA A;  2K6A A;  1EL0 A;  3FPU B;  2IL8 A;  2CQA A;  3W3A A;  1ICW A;  3DM1 A;  1JQY D;  2NVT B;  2A68 C;  3HOZ B;  3NTK A;  3NPP A;  4HSP A;  4K5X A;  2OXP A;  2XIW A;  1EOT A;  2PO4 A;  1FD7 D;  3J81 L;  1U4M A;  1CFM A;  1DZ1 A;  1FR3 A;  1AEX A;  2BCO A;  4MIU A;  4R8N A;  2A6E C;  1W6K A;  4EQP A;  3HOY B;  3I72 A;  3IL8 A;  1PFM A;  5CR3 A;  2O5J C;  2D62 A;  2C9O A;  2L12 A;  3NUC A;  1PRT D;  3I91 A;  1KLG D;  2NN6 G;  2F0F A;  2ENB A;  3DWP A;  1QNU A;  1LTT D;  2K5Q A;  4OIK A;  4CKB A;  1O7L A;  4J8Q A;  4XYQ A;  1BNZ A;  3NBH A;  3HG9 A;  3K6O A;  5E1F A;  2F0S A;  2SDF A;  4RA8 A;  4C3I G;  2IX1 A;  4ZLT F;  2RDG A;  1CHP D;  3TSS A;  3FPP A;  2HQE A;  5CYU A;  3I3C A;  4X3S A;  2OEO A;  1SYB A;  4BS9 A;  4R8I A;  3BVG A;  1L0Y B;  1B9M A;  2EYH A;  2RDF A;  1BCP C;  4KJO A;  2G9D A;  5I6W A;  4UAI A;  4DNR B;  1SNC A;  2KEE A;  1PMR A;  3TP5 A;  5C5M A;  5LHY 1;  4KMU C;  1B4O A;  1S5C D;  5C0X I;  1WTO A;  1IYU A;  4B08 A;  4N9T A;  1UAP A;  1EWC A;  4C3H B;  2FFK B;  3BS1 A;  4G7O C;  1SMY D;  5IT9 E;  5BN4 A;  1BUV T;  1GUO A;  3SXH A;  2IW3 A;  2AQ2 B;  1HUM A;  4ABN A;  3ONA B;  4QUC A;  4WJW A;  4RWS C;  1G29 1;  4BBS B;  2VB3 X;  3F2U A;  4FXG C;  3GP7 A;  3SDZ A;  1JOK A;  3QG1 A;  2F0N A;  3BDC A;  4Q5V A;  2EZV A;  1CI3 M;  3NTI A;  3D8G A;  2HCI A;  3NTH A;  1S5B D;  1D5Z C;  3CU7 A;  4ME5 A;  1SYE A;  1WD0 A;  1F9R A;  5FK9 C;  2E2J B;  1WTP A;  3T51 B;  1VF5 C;  1H9S A;  4QF4 A;  2HUG A;  2B63 B;  2E2H B;  2R6G A;  1ESF A;  2AUJ D;  2ICI A;  3DXJ C;  1H9J A;  1SBB B;  1QNK A;  1PTO B;  2KQ3 A;  2O5I C;  2N88 A;  2F3W A;  1Y1W B;  4CKE A;  1LT6 D;  1HA5 A;  1A3T A;  4CKC A;  2QEJ C;  5C4Z A;  1Y8N B;  1IYV A;  3IAY A;  3MFG A;  5KEE A;  3O13 A;  5EKL A;  3AB9 A;  1LT3 D;  2KCC A;  4QMG A;  1Z7T A;  1ET6 A;  2EJF C;  4XQQ A;  5M5X B;  3G7L A;  2FIN B;  1Q8I A;  1G91 A;  3CQZ B;  4EQO A;  1RCV D;  5I2X A;  3V96 A;  1A3V A;  2HCC A;  4KKS A;  1OXU A;  1C4Q A;  4KHZ A;  2K7V A;  2RDH A;  4KY7 A;  3VA7 A;  4LMQ D;  1STE A;  1SND A;  4IUN A;  2AQ3 B;  1JOQ A;  1I3Q B;  2QIL A;  1CZG A;  1R4P B;  2AWN A;  2EY2 A;  5CMD A;  3HZX A;  3NE5 B;  2F0M A;  1G2S A;  4I7Z C;  4G4K A;  5AFW A;  1A2T A;  3QJY A;  1GHJ A;  1IW7 C;  4FP5 D;  4ZYS A;  1VF7 A;  4DXG A;  1YNJ C;  1DOK A;  4KKT A;  2WIN B;  2ZT9 C;  3V05 A;  3QWN A;  2K04 A;  3KLS A;  2PZT A;  1STG A;  3R3O A;  3RMH A;  3JAM E;  4L6T B;  2B2V A;  4HTH A;  2FHT A;  1X3P A;  3D3R A;  5C0X J;  1TY0 A;  5D14 A;  2AQ1 B;  2PW5 A;  5IGF A;  2KVM A;  5C6A A;  1DON A;  4C3H G;  1V1P A;  5C3X A;  2Z1C A;  1H9M A;  3KBX A;  4HN7 A;  3MEH A;  2D9U A;  4IUR A;  5EPJ A;  4XQJ A;  1CA5 A;  5A35 A;  1B50 A;  1ML0 D;  4FF4 A;  2IJ0 A;  2NTS A;  4K8I A;  4CBV A;  1F2L A;  2NWG A;  1GOZ A;  2JA8 B;  3I4M B;  4K5V A;  3FDT A;  4BBR B;  3L3O C;  3Q23 A;  2MJ8 A;  3W2D A;  3SK8 A;  1HRJ A;  3MXG A;  1A3U A;  3A8K E;  1ONL A;  4RCO A;  2DY8 A;  1EY9 A;  4EQN A;  3I70 A;  3BDO A;  2F0L A;  3A8J E;  3J7A F;  4A3B B;  2Q8R E;  1QJO A;  1F2Z A;  2PZU A;  3K7A B;  1CA6 A;  3I90 A;  4BA1 I;  3HGB A;  3MAQ A;  4IFD I;  5JJZ A;  4NMZ A;  1EY6 A;  3KLR A;  5T1G A;  5C0X G;  1TR5 A;  4KD4 A;  3BVZ A;  2E2D C;  1F9Q A;  4OO1 H;  4C1N K;  5EKK A;  3MFY A;  1H9R A;  3FEW X;  3EVQ A;  3E5S A;  3EFX D;  4PQX A;  1YNN D;  2K32 A;  3DEO A;  1TWH B;  2KA7 A;  5CBA E;  4P2C B;  4KN7 C;  1QIL A;  5IOD A;  1LV9 A;  4S3S A;  4V0B A;  1FYC A;  1X3Q A;  3S2D B;  3Q0A A;  2F03 A;  2NVY B;  5KYL A;  2N55 A;  2NBF A;  3S16 B;  2NTT A;  1B2T A;  4KKU A;  3D6C A;  5FLX E;  3T56 B;  1XWE A;  1GUW A;  2IX3 A;  2CW0 D;  3A55 A;  3H91 A;  3GTG B;  4RAU C;  1EY7 A;  5DM7 3;  4A3J B;  2B2W A;  3A7A B;  4TRD A;  1CQF A;  2KOL A;  1F9P A;  4XYO A;  5ELB A;  5C4X B;  3MC0 B;  4H13 C;  5I9O A;  3OSO A;  5KNC A;  5EJW A;  1TWC B;  1WTX A;  2MGS A;  1OXV A;  4RGN A;  2K05 A;  3PIO 3;  1AP0 A;  2K03 A;  4ZAI A;  2F0I A;  5J22 A;  1EIH A;  1V8Q A;  5EBC A;  4XIG S;  2EYO A;  4ZRZ A;  1D1I A;  2J7Z A;  1OO9 B;  4DA2 A;  2B2V C;  3R8B A;  3LNN A;  1HHV A;  1L0X B;  2RSN A;  2PMZ B;  3HKZ B;  4DF7 A;  2Z4I A;  3CHB D;  4DU9 A;  3FMC A;  1BXT A;  1PLF A;  5KYI A;  4TQU S;  1EQT A;  2O2L D;  2JA5 B;  1I4X A;  3HOX B;  3VYU A;  5DNF A;  1CZW A;  1NCV A;  5FO7 B;  5M3F B;  3S1R B;  3HOU B;  1SNP A;  4FF1 A;  4DGZ A;  3WDN A;  3GV6 A;  5ISR A;  1DYQ A;  5CV4 A;  3IFD A;  1SE3 A;  5KND A;  3SE0 A;  3R2I A;  3DWA A;  4KJN A;  3Q24 A;  1BF4 A;  5C4H A;  3OIP A;  3LWU A;  4K2L A;  1LT5 D;  4XXE A;  1F2M A;  4MHE A;  1SNQ A;  1LTB D;  4ZKC B;  2A5H A;  2PW7 A;  1VMC A;  5I2Y A;  3H09 A;  2FMC A;  2NYZ D;  4PV1 C;  3TDQ A;  3U9O A;  3X3N A;  2DNC A;  1EY4 A;  1I50 B;  1ENA A;  1VMP A;  1SSO A;  5ELE A;  4U67 3;  1Q3L A;  2L5T A;  1EQV A;  1B1Z A;  2B2Y C;  1BDO A;  5M5W B;  3TP6 A;  2JXM B;  3HOV B;  1RDP D;  1K83 B;  3NHH A;  5DEH A;  3I4N B;  4OL7 A;  1RTN A;  5FLX L;  2BA1 A;  1SYD A;  4KN4 C;  3OOC A;  4N9P A;  4AYB B;  5C3E B;  5E4X A;  3D4D A;  4ZUJ A;  3D4W A;  4ILW A;  5EPK A;  3NP8 A;  1JWS D;  1RKN A;  1WD1 A;  2RA4 A;  2NVX B;  3RZD B;  2CHB D;  1JIC A;  1JC7 A;  4UDU C;  1GUG A;  3RUZ A;  2JA7 B;  1K8O A;  1SJE D;  1OXS C;  1JR0 D;  3QOJ A;  1ZEQ X;  3LWE A;  1D5M C;  2B2W C;  2NN6 H;  1I4G A;  1PRT C;  1TWG B;  4IFD G;  1LAB A;  3J80 E;  4A3G B;  1ESR A;  2B2U A;  2EYJ A;  5BN5 A;  1CT1 D;  4HCS A;  2A6H D;  4HMI A;  1BR9 A;  4DAP A;  4BY1 B;  3C3L A;  5D3D A;  3NQT A;  4A3M B;  2K5W A;  1I4P A;  4DXF A;  1TII D;  1AZP A;  4RGM A;  2EY1 A;  2BE5 D;  5JVG 3;  2XNA C;  2SOB A;  1AW7 A;  2F3V A;  3VYS A;  1EZ8 A;  3GQB A;  2ZXP A;  3U9S A;  2NZ1 D;  1PDQ A;  4RGT A;  1DM0 B;  4FXK C;  2WB1 B;  2JEB I;  3HS0 C;  1LTR D;  4ZQ3 A;  1CK1 A;  3GO5 A;  3C1F A;  3PUW A;  4ODG A;  1BCP B;  2B8G A;  2R61 A;  5D65 A;  1S5E D;  4IUP A;  5IGC A;  4L8J A;  1HTL D;  1U4L A;  5C5L A;  4LJZ C;  2I07 B;  1PTO D;  2J4X A;  3GTQ B;  3ERO A;  4EGV A;  1SMY C;  1AFP A;  4KK7 A;  5HGT A;  2D2C C;  1ZKO A;  1CTM A;  3RLF A;  4C2M B;  1DCZ A;  1HA6 A;  1WTR A;  3SK4 A;  3K58 A;  2KUM A;  4G7Z C;  1Q12 A;  1MGS A;  3T16 A;  1U9R A;  2X69 A;  3H0G B;  2H4O A;  2LKV A;  3I4L A;  4FO2 A;  2KHS A;  2PNR C;  3M3Y B;  4JK1 C;  1HTP A;  4RHS A;  1O7Y A;  1TVX A;  1KLU D;  3ERQ A;  1TS3 A;  1EYD A;  1UEA B;  5DM6 3;  1HQM C;  3VR3 A;  2TMP A;  3H6M A;  2XVS A;  2O4X A;  3TP8 A;  4FNF A;  2F0P A;  4C56 C;  5EQ0 A;  3OIQ A;  5LL6 S;  3T53 B;  1EZ6 A;  4JBW A;  1JE4 A;  2K5D A;  2WV6 D;  1EY0 A;  1PYW D;  5EKI A;  3E0J A;  1S4Z A;  3K5O A;  1A15 A;  3GTK B;  5JAV A;  4ZK9 B;  3MXP A;  4QUF A;  3K0Y A;  3SHL A;  4IQZ A;  5I9P A;  4O42 A;  1D5X C;  3MHB A;  3R93 A;  1TWA B;  1GUS A;  5CGK A;  1Z47 A;  3K59 A;  3D4R A;  2PZW A;  2B2U C;  2WKD A;  3DWQ A;  4IN3 A;  2F0O A;  4TSS A;  3L9A X;  1S5F D;  2RBM A;  4A3D B;  3DUZ A;  1SEB D;  3NK9 A;  3N6R A;  2EYF A;  4HAE A;  1MBY A;  2DN8 A;  1M8A A;  1BQQ T;  4Y7N B;  3PO3 B;  3P75 A;  1WVL A;  2WII B;  1WTW A;  5IT9 L;  4ULL A;  3QIA A;  1PTO F;  2EPB A;  5DAU A;  3KF8 A;  1V1O A;  2PQE A;  4BA2 I;  4YIJ A;  2ZXR A;  3MVV A;  3J7Y W;  1B3A A;  3E6Z X;  5G3L F;  2F0Q A;  3ITP A;  1TY2 A;  4CHT B;  2EOT A;  1EU4 A;  2LY7 A;  4A3E B;  2K28 A;  4H44 C;  5JEA G;  5IIF A;  2F1M A;  4O1N A;  2FMM A;  2MUY A;  3MWY W;  5IGE A;  1DOM A;  3GD7 A;  1IKM A;  2WAC A;  5CC4 A;  2BA0 A;  1HXY D;  2A74 C;  3P20 A;  1TKW B;  1ZYR D;  1XXG A;  1MSG A;  4K2K A;  5NUC A;  1E0B A;  1RTO A;  4IUV A;  2B2Y A;  2K01 A;  1DXM A;  3GTL B;  1Q90 A;  1HUN A;  3S1Q B;  2EY6 A;  2WP8 J;  3M4Y A;  4QIW B;  2EJG C;  1PTO H;  3A56 A;  5C0X H;  5C3W A;  1KDA A;  4M1U B;  3S15 B;  3NQI A;  4K6L A;  5K36 G;  1MD2 D;  1EIG A;  2PCF B;  1H9S B;  1TS4 A;  5EBD A;  4G57 A;  3D6W A;  5ELC A;  3GTM B;  1O80 A;  2IWH A;  5IGD A;  2VB2 X;  1YNN C;  2VXW A;  3Q22 A;  4J1M A;  4LK1 C;  3CRK C;  3H94 A;  2WKC A;  1LLR D;  2XRS D;  2LMC B;  4Z9C B;  4LAA A;  3M85 A;  3J81 E;  2HDL A;  2EYM A;  5J1Z A;  3SVM A;  1PFN A;  1JOR A;  5FKA C;  5LL6 X;  3EA6 A;  1ILP A;  2B8F A;  1T5X D;  2NUC A;  5CBE E;  2CW0 C;  3JAM L;  1TQO A;  4WFN 3;  2K1B A;  1H9K A;  1M4V A;  2E75 C;  2RSO A;  1SNM A;  3PUX A;  1G6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...