1JT8A

Archaeal initiation factor-1a, aif-1a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords PROBABLE TRANSLATION INITIATION FACTOR 1A
publication title Structure and dynamics of translation initiation factor aIF-1A from the archaeon Methanococcus jannaschii determined by NMR spectroscopy
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jt8A00
1E24A 1WCMH 4LF7L 3DM3A 2Y0SG 3PO3H 5K36G 1TWCH 3UDIA 2YYZA 1VQ9A 3JAMc 3T1YQ 1GO3E 5GAHC 2F4VQ 1EQQA 5IP7H 4A3CG 1PHJA 3HOXH 2PI2A 4POFA 4R4QA 4AYBE 2HIVA 1N34L 1YHQA 1OXSC 1U0LA 5IYDG 4JI4L 4LWCA 3J7ZC 3HOZG 1YHAA 3BZKA 3K80C 4GS3A 4R4OA 2ZTCA 1W3SA 3KJOA 5C44G 3CCJA 3PV0A 1PH4A 4J15A 3F2DA 3PCOB 1HR0L 3GTGH 2CCZA 1EWIA 1TWAH 2PMZE 4X64Q 4YCUA 1TXYA 3KFUA 1LUZA 1LM0A 3PIPA 1MJCA 4JG2A 3CPFA 3STBD 2LSSA 4PZ8A 3S1RH 1XNRL 4L5SA 2K75A 4YWLA 1EYGA 4DV5Q 3S16H 3TS2A 1N33Q 4PG3A 3IRBA 1XMQL 4DR7Q 1XTDA 2I5LX 4JV5Q 4OO1G 1NJIC 4DV7L 4AIMA 3RLNA 1NBWA 1VQLA 5GADC 1I94L 2HHHL 5IYBH 4A3IH 1IBLL 2F52A 1V1QA 4GKKL 4A3BG 1A8VA 4NXNL 4A3EH 3M7NA 5C3EG 2K52A 5GROA 4LF7Q 1XJVA 3BZCA 1KIXA 1XMOL 2YTXA 3RN5A 3H0GH 1PH1A 1YHBA 3RNUA 1J5EL 2VUMG 4NB3A 1KQSA 2VZAA 3CC4A 3W1GA 5ELOA 1N34Q 4IFDI 1OXTA 1W2BA 3M85A 4JI4Q 4JI6Q 3HOYH 4QJFA 3CMAA 3I2ZA 1HR0Q 2K14A 2QA4A 3CP0A 3AQQA 4C3IH 2R7ZG 4JCVE 1O7IA 3GTKH 3FHWA 4DR4L 2K50A 3J81c 2ZTDA 1XNQL 1XNRQ 3HOUG 3TRZA 1PH9A 1U5KA 2DUDA 4L5TA 1XMQQ 1B7YB 4O2DA 2E2HH 4R4CA 4BBSH 1CSQA 5IT9c 4DV7Q 3I4MH 1HNWL 3UDXA 1NY4A 2AKWB 2HHHQ 1HJPA 1I94Q 1A62A 5FLMG 3H3VH 1IBLQ 3PGZA 2B63G 1VQIA 1L1OC 1DGSA 1HZCA 3S24A 5IY0A 1YJWA 4JI2L 4NXNQ 1X3EA 4GKKQ 5JJKA 2WP8J 5JJLA 4IJHA 4TVAB 5LMNW 4P73A 4DK6C 3TQYA 2AWNA 5AJ3L 1VQOA 1XMOQ 3NBHB 1X65A 3BU2A 2R7FA 3OW2A 1Y1WH 1VCIA 1J5EQ 3U4ZA 3PF4A 2UXBL 4RG1A 1YNXA 1YITA 3ER0A 2MO0A 3OYYA 2CWAA 4P72A 3H15A 4POGA 1RL2A 1SR3A 5M5XH 2NZHA 5J3BA 1PV4A 2IX1A 1VQCA 1KRSA 2JA5H 3KF6B 2ZTEA 1AE2A 1NMFA 2NVXH 1Y1VH 2AMCB 2JQOA 4HIDA 2E2IH 1PH8A 4A3FG 1XNQQ 4JYAL 4HJAA 4A3GG 1L2FA 5IWAL 1XPRA 1EUJA 3S2DH 2N49A 1HNWQ 4RMFA 5C0XI 3CC7A 1M1KC 4BA1I 4A3JG 1N8RC 3I55A 3KDFA 5M5YH 2IY5B 2YTVA 2IT1A 2JK8A 2UUBL 2BA0A 1Y14B 1G291 4DK3C 1PH2A 4JI2Q 2JA8G 1JJCB 3PO2G 4WJ3M 4X66L 1SROA 3KOJA 3GTOH 4L5RC 2D62A 2Q2IA 4A3MH 2N3SA 1G6PA 1WI5A 5AJ3Q 1JMCA 2XTIA 1CKOA 3E0EA 1PH3A 4YY3L 2UXBQ 4K0KL 3E9IA 4DV3L 1HZ9A 3UE1A 4DNIA 1K73C 4BA2I 1B8AA 2NN6G 1QVGA 5E7NA 2JJQA 4DR2L 1CSPA 4MZ9A 4EQ5A 5IYDH 1QVFA 2JE6I 5M3FH 4X65L 5C4XH 2UUCL 4JYAQ 4OONA 4B3TL 3CW2C 5IWAQ 4C2MH 3ULJA 1VQ6A 2D0PA 2MQHA 2WAQG 5M3MH 1PVOA 2NVTH 1S3OA 1FL0A 1UE6A 1KD1C 3STBC 1JB7A 4B3ML 2JA6H 3HKZG 3K81C 4APVA 4R4IA 3J80i 3SGIA 4YWMA 1MJEA 1YVCA 3PIOA 5FJ8G 2UUBQ 2E2JH 3K8AA 4BXXH 3CCSA 3ULLA 4X66Q 4BBRG 4P75A 4LW1A 2Z6KC 3ICEA 5HY6A 3NEMA 3CPWA 5IP9H 4A3BH 4TQUS 3RZDH 2EXDA 1HR0W 1SRUA 1X54A 3KF8B 5C3EH 4YY3Q 4K0KQ 1X3GA 2R92H 4DV3Q 1VQGA 3CCQA 2UXCL 2K5HA 2K5VA 1Q12A 3JC66 1HNXL 1ASZA 3HOVG 3AFQA 4DR2Q 3TREA 4GNXB 2L15A 1K8AC 4JOIA 4IPGA 1IL2A 1YIJA 4X65Q 1KXLA 2KHIA 3L0OA 3TEHB 1HNZL 2UUCQ 4B3TQ 5H1SE 3ULPA 1YBYA 4IPDA 1KL9A 4JC0A 2YTYA 5M5WH 1GM5A 4GNXA 4B3MQ 3J81j 4IFDJ 3I4NG 3HOUH 3GTJH 1OTCA 2PNHA 4HJ8A 1FGUA 1YJNA 1PH7A 2RHQB 2Q2TA 3PO3G 2UXDQ 2QEXA 5EAYA 2JEAI 1EFWA 1Q46A 5C4JH 1R9TH 2PQAB 1MIUA 3M4QA 4KHZA 4EX5A 3HOXG 2UUAL 5IYCH 2OCEA 4A93G 3KJPA 3UE0A 2Z0SA 4JBJA 4MTNA 3CCUA 4Y52H 4JI7L 3PUXA 1WFQA 1UWVA 4A4IA 1V43A 2WAQE 4JI1L 3M4PA 3K7UC 2UXCQ 2Y0SE 4UP8A 3S2HH 4GOPB 3HKZE 2RHSB 2C35B 4DAMA 1M90C 1HNXQ 1FJGL 1JJGA 4LF6L 1VQDA 3RLOA 2KCMA 3A5ZB 1ASYA 1VQMA 3G71A 1BKBA 1HNZQ 4GKJL 1QVCA 2Z6KA 2GN5A 1FVIA 1H95A 1N9WA 2CWPA 2N8NA 4JBWA 5IYBG 3CXCA 1Q1BA 4GOPA 4A3IG 1VQ7A 2KCTA 2JA7H 4OO1I 3S1QH 1KC8C 3PUWA 3PUVA 1BBWA 3ZJYC 4IOAA 5GAEC 3S15H 3K0XA 4HJ7A 2A8VA 5LMUL 3H0GG 1OXXK 3PUYA 4XTCS 1CKNB 3DLLA 4AQYL 2UUAQ 3F2BA 2YU9H 3FKIG 2I5MX 3PO2H 1P16A 1Q8KA 1K9MC 4B3RL 4JI7Q 4DAYB 1X9NA 4JI1Q 1WYDA 3GO5A 1KHIA 4B3SL 3B6YA 3LGJA 3U50C 2IHFA 1FJGQ 1JT8A 4QIWE 1P8LA 3CAMA 4LFCL 3KF6A 4LF6Q 4DV2L 2UU9L 3L7ZC 3WWVA 1YZ6A 5JJIA 2MO1A 4YWKA 1NMGA 2AHOB 3I4MG 1QZGA 4LF9L 2WB1G 4KLKA 4ME3A 2E8GA 2ES2A 4DR3L 3HOWG 4GKJQ 4JOIC 5FLXc 4LF8L 2ASBA 4BY7G 4HJ5A 1EQRA 2I0QA 4GLVB 3CCMA 1E7ZA 4UP7A 3KYHC 4QGUA 3CCRA 4X62L 4HIKA 3OTOL 2ZM6L 4JI6L 1KAWA 1PFSA 4GN5A 4JI5L 4GNXC 4A3DH 3T1HL 1PH6A 3PF5A 4X6AH 1IBML 5LMUQ 1J6QA 1GKHA 4DV4L 1Y1WG 3D31A 3M4OH 4A75A 3U4VA 2GVBA 4AQYQ 1X55A 3AFPA 4MNOA 2N78A 3S1NH 2HIXA 2OWOA 4A3CH 1NE3A 4YCVA 2B29A 1X56A 2FXQA 4DPGA 4PZ6A 4B3RQ 3A0JA 3HOZH 4A3LG 2JA5G 4IPCA 5JEAJ 2NZOA 5C44H 1Y1VG 2F3IA 4GN3B 1GVPA 1D8LA 4DKAC 1S40A 1EIFA 2UXDL 4B3SQ 4DV1L 4LFAL 2OTLA 3I56A 2NVQH 4LFCQ 3I7FA 1K3RA 4DV2Q 2UU9Q 5ELNA 2V1CC 4O0AA 2QGQA 1TWHH 4GN4B 3GTLH 3HKSA 1JE5A 3F2CA 1T9HA 1VQBA 4LF9Q 5DLQE 4HIMA 3HOVH 4QQBX 4JI3L 4DR3Q 4LF8Q 3TS0A 4GOPC 3GTPH 3J80c 4NXML 4X62Q 3W5OA 2RCNA 3OTOQ 2ZM6Q 4A3MG 4A3KG 3G4SA 4JI0L 4JI5Q 1CKMA 1VQHA 3T1HQ 1UE5A 3JAMi 3A74A 1IBMQ 2R93G 2BH2A 1VQEA 1WOCA 1I5FA 3EIVA 4DV4Q 1PA6A 2EIFA 3PSIA 4IFDG 4JBMA 4Y7NH 3VDYA 3S14H 2VUMH 1BBUA 3M9BA 3AYHB 2VQEL 3Q8DA 1Q1EA 2OQ0A 3BJUA 4BY1G 4DR5L 1C7YA 2WB1E 2H5XA 2KBNA 3D0FA 3EBEA 3EN2A 3S1MH 4OX9L 3CCEA 3CMEA 2VQFL 4NPSA 2OQKA 2ZJPA 4DV6L 2EQSA 3HFZB 2K5NA 5M3FG 4DV1Q 2VW9A 2NN6I 2R7ZH 1X3FA 3NELA 4LFAQ 4A93H 5C4XG 2ID0A 2Q2HA 3PUZA 4LUOA 3W1BA 5IE8A 5M3MG 3GTMH 1EOVA 3RZOH 1WCMG 4UY8C 3RLFA 2JA6G 1AE3A 4JI3Q 1A0IA 3CCLA 3CCVA 4DR1L 1QUQB 3MEFA 5IP7G 5FLMH 2PI2E 1A63A 4LF4L 4UPAA 2ATWA 2B63H 4BXXG 1C0AA 4NXMQ 2B3GA 3CQZH 4DUYL 3GTQH 2JEBI 4PMWA 4JI0Q 4DR6L 3K7AH 4YHHL 3CC2A 5IP9G 4YCWA 1QUQA 2PQAA 2RF4A 2ALYB 3GD7A 2R92G 1IYJB 2VQEQ 4DR5Q 1I3QH 1X6OA 1VQ4A 2CQOA 4OX9Q 1VQPA 2VQFQ 4PZ7A 3FKIH 4LNQA 2MNAA 4DV6Q 4DR4Q 1SLJA 2LXKA 1S72A 3J81i 4R4TA 3L2PA 1IBKL 4DV0L 1LYLA 2CFMA 4IJLA 1E22A 2VS1A 5C0XG 1MKHA 4A3EG 4A3FH 1PH5A 3M3YH 2A1AA 3I4OA 4FDBA 4A3GH 1VQKA 1KRTA 4GLAC 4OWXB 4DUZL 1I6HH 4WJ4A 2AWOA 1K83H 1EIYB 4DR1Q 3A5UA 4A3JH 1YEZA 4GLXA 1QZHA 4LF5L 4LF4Q 1CUKA 5GAGC 1V9PA 4DUYQ 2E5LL 1TWFH 3HOWH 2XGTA 2JA8H 4LFBL 4BY7H 4DR6Q 1E1TA 2Q2UA 3HOYG 5C0XJ 4YHHQ 5IYCG 3AEVA 1B70B 3KLWA 2K4KA 4QY7A 4R1JA 5GQOA 1SE8A 4AH6A 3CF5A 5LMNL 1VQAA 2JA9A 4A3DG 4OWTB 1CKNA 4P74A 3UDFA 1UE1A 3CD6A 1TWGH 1N32L 1XPOA 1LTLA 2VL6A 1IZ6A 1AH9A 4OXPA 3RN2A 3J7A5 4KHPL 2WFWA 1VQ8A 4BBSG 1G51A 1C9OA 3U58A 1HZBA 2VY3A 4A76A 3ERSX 1D7QA 5BR8L 3FP9A 2IX0A 4AYBG 1E3PA 1IBKQ 4JI8L 4DV0Q 4A3LH 1GD7A 1UE7A 1JJ2A 1N36L 2ZJRA 2KENA 2R6GA 4KI0A 2NVYH 4C3HH 5JEAG 2JA7G 3UDGA 1E1OA 4L5QA 3KDFB 2DGYA 4C3JH 3NENA 4HIOA 4DUZQ 4IO9A 1OXUA 3S17H 4XIGS 3F8TA 2VNUD 1K8GA 1SFOH 4LUVA 4LF5Q 1XPUA 4HJ9A 5FJ8H 2E5LQ 1L0WA 2I5HA 4LFBQ 2IHEA 3T1YL 1RIPA 4BBRH 2F4VL 1Z9FA 1PYSB 4LUZA 1I50H 5LMNQ 1HZAA 4IPHA 4OWWB 4A3KH 1K0RA 2ZJQA 1Z47A 1VQFA 1Q81C 1IXRA 2CKZB 2LXJA 1SN8A 1VQNA 3MXNB 1N32Q 2BA1A 1NTGA 1Q82C 2KHJA 3GDEA 2R93H 1PYBA 4X64L 2MFIA 4KHPQ 1YJ9A 2HQLA 2BH8A 1L1OB 2A19A 4UP9A 4P71A 2HT1A 1HH2P 4JBKA 5BR8Q 1UEBA 1VS0A 1VQ5A 4BY1H 4DV5L 1YI2A 1WJJA 1N33L 3F1ZA 4DR7L 4JI8Q 3G48A 1Q86C 2YV5A 1OXVA 4JV5L 2OTJA 2R7DA 1N36Q 1SMXA 3E9HA 1L1OA 2D0OA 4H02A 4ALPA 3G6EA 1VQJA 1Q7YC 5HGQA 3RR5A 4QL5A 2GVAA 3H3VI 4IOCA 3I4NH 1BVSA
chains in the Genus database with same CATH superfamily
1E24A 2Y0SG 2NVXB 2SOBA 5K36G 4RHSA 3T1YQ 4FNFA 1HQRD 4TKOB 3HOXH 5IYDG 1QNKA 3HOZG 3BZKA 3A7AB 2ZTCA 5C44G 3F2DA 1TWAH 4DF7A 1MJCA 1FR3A 3S1RH 3ZYYX 1G91A 4KY5A 4A3MB 1N33Q 4PG3A 2RQXA 2I5LX 4DV7L 1BBXC 4AIMA 3RLNA 1NBWA 2A5HA 4A3IH 1Z6HA 4FXKC 1WTOA 4A3BG 1ILQA 2K01A 4HCEA 2FMMA 3TP5A 3BZCA 2G5DA 3H0GH 1B9NA 2F0FA 3RNUA 1TS3A 1J5EL 2VUMG 1KAAA 1SYBA 1QB5D 1CK1A 3VR4A 2RA4A 4NW2A 2BE5C 2NVTB 1HR0Q 2K14A 3AQQA 5IGBA 1K28A 3GTKH 2B2YC 2K50A 1HCZA 1XNRQ 2DUDA 4RWSC 1B7YB 5EKLA 1HNWL 4G7HC 4N8FA 5IT9c 3JAME 5C3EB 3K59A 3NTIA 1HJPA 2HHHQ 2F0MA 1A62A 3HEJA 5FLMG 1IBLQ 3H3VC 3PGZA 3MWYW 2B63G 1VQIA 1L1OC 1HZCA 4NXNQ 5DNFA 5JJLA 4RGTA 1DXMA 5LHY1 3SDZA 3TQYA 4DK6C 1XMOQ 3A8KE 3E5SA 3T4AC 1VCIA 2A74C 1BXTA 3ER0A 5D3DA 2CWAA 4POGA 1SR3A 1JE4A 1W6JA 5M5XH 2NZHA 4U68A 3F2UA 5J3BA 5COYA 1PV4A 1VQCA 2JA5H 3KF6B 3GTJB 5KRUA 2DJGC 2JQOA 4A3FG 3NQIA 4O1NA 5C4JB 4A3GG 4RMFA 3TZUA 5C0XI 5M5YH 4HSVA 2UUBL 5EBDA 1G291 1EIGA 3PO2G 4JI2Q 1SROA 5JPNC 5AJ3Q 3C3LA 1PH3A 4IN3A 5ELDA 4YY3L 4IFDH 1TVXA 3J81E 1EQTA 4DV3L 1HZ9A 3UE1A 1K73C 3SK6A 1B8AA 3MXNA 1B9MA 2PMZB 4KN7C 4FF3A 4DR2L 4EQ5A 2JE6I 5M3FH 5IGFA 4JYAQ 4OONA 3E3XA 5IWAQ 4J1MA 4KKSA 4OGQC 3DWAA 1KD1C 3I4LA 1JB7A 2JA6H 3K81C 2Z9HA 3KLSA 2CQAA 3PIOA 3DEPA 4X66Q 4P75A 1EIHA 1HR0W 3QIAA 4K0KQ 3FPPA 1XXGA 3J7YW 2UXCL 1NCVA 2K5HA 1B2TA 2JP1A 3JC66 1ASZA 2EYMA 3AFQA 1ENCA 4A3DB 2FINB 2Y0SB 5D14A 4X65Q 2KHIA 3L0OA 2BDNA 4QUCA 5M5WH 4JC0A 4GNXA 4CJ1B 3J81j 4IFDJ 3D6CA 2SNSA 3R3OA 5FO7B 3I4NG 3BVZA 3HOZB 2Z4HA 4HJ8A 4ZRZA 1YJNA 2Q2TA 5C44B 1Q90A 1X3PA 4KHZA 3HOXG 1LABA 4IUPA 3TP7A 2Z0SA 4Y52H 4UDUC 4JI7L 3WOFA 1UWVA 2DY7A 3U9OA 4DAMA 1HNXQ 2KCNA 1SNMA 1VQDA 2KCMA 1SE2A 3A5ZB 3U9SA 1SYGA 3G71A 1HFNA 1HNZQ 1SAPA 2GN5A 4GOPA 2N8NA 4A3IG 1EY7A 3CXCA 3AMUA 2VUMB 2KCTA 1S5FD 3S1QH 1ICWA 4IALA 4IOAA 1DOLA 2IJ0A 3S15H 1SYDA 4HJ7A 4A93B 3H0GG 4RHRA 3PUYA 2PZUA 2UUAQ 2CVRA 3RZOB 2I5MX 3GTMB 3P75A 3KK7A 2CW0C 1TS2A 4LK1C 5D3IB 1X9NA 4B3SL 1ZEQX 3LGJA 3U50C 2B63B 1FJGQ 1JT8A 3L9AX 4JVZA 4QIWE 3GTQB 3CQZB 3KF6A 3QOLA 3MHBA 4I65A 4DV2L 2MO1A 4YWKA 1NMGA 2ZXOA 3RD4A 4DK0A 1QZGA 2VB2X 1RTNA 2P5ZX 3NSWA 2O4XA 1WTVA 1DD2A 5FLXc 2F0OA 2ASBA 1EQRA 1ESRA 5CC4A 1BNZA 1CFMA 4QGUA 2ZM6L 3T1HL 3PF5A 1KDBA 3D31A 3U4VA 4AQYQ 3AFPA 2H4OA 4A3FB 3S1NH 4A3GB 3A0JA 3MA2B 2ZXPA 2JA5G 3LWEA 2NZOA 4DKAC 2PZTA 2UXDL 2KUMA 1ML0D 1RD9D 1TS4A 2F0LA 4DAVA 3K58A 5CV7A 5CORA 3HOWB 3TBIB 2QGQA 1TWHH 4GN4B 3HKSA 3E0JA 4ULLA 3HOVH 3EQLC 1S5ED 4IUTA 1TWGB 1PTOC 5J1ZA 3TS0A 1FGBD 1UAPA 4NXML 1JORA 2EYJA 5L37A 1CKMA 3OWEB 1UE5A 3A74A 1WOCA 1I5FA 3EIVA 5EGTA 4DV4Q 1PA6A 4IFDG 3SE0A 3S14H 3BYYB 1ENFA 3M9BA 2VQEL 2NVYB 1Q1EA 1O78A 4LMQD 1JR0D 3CMEA 2OQKA 2ZJPA 1WD0A 2EQSA 5M3FG 3NELA 2L1BA 4KK7A 2EE1A 1EOVA 3RLFA 2JA6G 1AE3A 4A3KB 1F9RA 4DR1L 1A63A 1C0AA 4UPAA 4CJ2C 1BCPC 4JI0Q 4PMCA 3KBGA 2F0DA 3CC2A 4FYDA 2E75C 5A2QE 2EY1A 5I6WA 2KEDA 1VQ4A 3BDOA 4KY6A 5I2YA 1EY4A 2EJMA 3FKIH 3I4NB 2M2LA 1EZ6A 2Z8LA 4XDXA 3J80E 1E22A 1MKHA 3A8JE 3I4OA 3A55A 4FF4A 3HOXB 1GUGA 1I6HH 4OWXB 5IGEA 1AP0A 2KJXA 3VR5A 2F4IA 2L4NA 3NPPA 1EIYB 1AZQA 3A5UA 4A3JH 4GLXA 1TWAB 4BY7H 1E1TA 3S1RB 1OO9B 4KKUA 1B70B 3C1EA 2K4KA 4QY7A 5GQOA 3SVMA 4AH6A 1VQAA 2JA9A 4OWTB 1N32L 2VL6A 4N8X1 4A3IB 1XX8A 2K6AA 2PCFB 5ELEA 1GJXA 2MPMA 4BBSG 1F9QA 1G51A 3U58A 3K5LA 2JYOA 3ERQA 5BR8L 2N55A 2F0SA 2TMPA 4AYBG 4CKEA 4HR7B 1IBKQ 1FNUA 4A3LH 4HTHA 1F9SA 3H0GB 2R6GA 1JQYD 1E1OA 4C3JH 3KDFB 3NENA 4IO9A 1GOZA 1OXUA 1Q8IA 4XIGS 4DAPA 2VNUD 1K8GA 1NR4A 1SFOH 5CV9A 1EY6A 2KQ3A 2E5LQ 1L0WA 3GTKB 3T1YL 1RIPA 1YNJD 4RGNA 3NTKA 2ZJQA 1Z47A 1VQFA 1IXRA 2LXJA 1SN8A 1BF4A 1HPCA 2F1MA 2BA1A 4FF1A 1TWFB 2Z4IA 2MFIA 1YJ9A 2A19A 1GHKA 4CHTB 5ELFA 4K5XA 5E1FA 1SE3A 2I07B 1BUVT 1N33L 3F1ZA 4J6HA 3E9HA 2XNAC 3DUZA 3I72A 4H02A 4K6LA 1PZJD 1RHPA 5DM63 3H3VI 1C8CA 3QWNA 1WCMH 2JA5B 2IX3A 2C9OA 2Q8TA 3UDIA 1VQ9A 1GO3E 2F4VQ 1EQQA 4POFA 1OXSC 1ZKOA 4HAEA 3SHLA 3J7ZC 1F2MA 3CCJA 1HR0L 4X64Q 5M5YB 2PMZE 1TXYA 3N6RA 1LUZA 2DJFC 1LM0A 1B53A 3CPFA 3STBD 2QILA 4XQJA 1C48A 1XNRL 4DV5Q 3S16H 4DR7Q 1XTDA 3PQIA 1X32A 4IUVA 2L55A 2BDOA 2RBMA 5GADC 2WACA 2HHHL 2F0UA 4B9WA 1IBLL 1UEAB 2F52A 4NXNL 5KNDA 5C3EG 1KDCA 3QJYA 3IFDA 4LF7Q 1XJVA 1CQFA 1XMOL 3MVVA 5M3FB 2XSCA 4KHVA 1Y8NB 3CC4A 2EZVA 1N34Q 4JI6Q 2HUGA 2JA6B 4ZUJA 1WTWA 3AU7A 1O7IA 1U5KA 1STNA 4O2DA 3I4MH 2KA7A 1FYCA 1EEID 2AKWB 1I94Q 1U4RA 2WKCA 1K8OA 5IGGA 1DGSA 4JI2L 1RF2D 2WP8J 1VQOA 2AWNA 5AJ3L 3Q22A 1SYFA 1SEBD 2R7FA 4KD3A 3OW2A 1Y1WH 3PF4A 4DA2A 1YNXA 1YITA 2MO0A 2D2CC 3MC0B 4ZK9B 1RL2A 1VDZA 5M5WB 5FO9B 1HUMA 1YNJC 1GUNA 2F3VA 3NBHA 2HDLA 4L6TB 4CJ0B 4HIDA 3T56B 1U4LA 1XNQQ 4JYAL 4HJAA 1TY2A 3A7LA 2E2DC 5IWAL 3S2DH 1PXUA 3CC7A 2K5DA 4A3JG 3S9WA 3KDFA 4K2KA 2XN9C 5T1GA 5HURA 4DK3C 4XXEA 1EFID 4X66L 3CHBD 1PZKD 4L5RC 3GTOH 2D62A 2Q2IA 1GUTA 1JMCA 2XTIA 1EY8A 4O42A 4RGMA 2O5IC 4K0KL 3KLRA 5E4XA 4BA2I 3S1QB 5IT9E 1QVGA 3CRLC 5E7NA 5JJZA 3S15B 1X3QA 1YNNC 4Z9CB 4GZYC 1SBBB 3TSSA 4X65L 5C4XH 2D9UA 2KECA 4C3JG 1VQ6A 2D0PA 2MQHA 2WAQG 3P20A 4KKTA 1UE6A 3STBC 5J22A 3ITPA 2MP1A 1YVCA 4BXXH 3CCSA 3CPWA 1MHWC 3RZDH 1SRUA 1X54A 1LLRD 1QG7A 2SNMA 2R3ZA 4XYOA 1Q12A 1HNXL 4GNXB 1A2UA 4H0LC 2RSNA 5DAUA 1K8AC 4JOIA 4IPGA 3O13A 5KIXA 5C5LA 1HNZL 3HKZB 1SYEA 4B3TQ 5C0XH 5H1SE 4HMJA 2YTYA 3S1NB 4B3MQ 1Y8OB 4XYQA 4KY7A 3HOUH 1PH7A 2RHQB 2FHTA 5EAYA 2JEAI 3M4QA 4EX5A 2UUAL 1CTMA 1TWHB 2IPKD 2LMCB 4A93G 2EJFC 4DXGA 4Q0FA 4UP8A 3K5NA 4GOPB 3S2HH 1FJGL 1JJGA 5E3FA 1B4OA 2A68C 2A6EC 1NAPA 4XQQA 2SDFA 1QVCA 2Z6KA 1FVIA 4JBWA 1VQ7A 1LTRD 5JEAH 2JA7H 3S14B 4OO1I 4JPBW 1KC8C 4OELB 5FO8B 1EU4A 3ZJYC 5GAEC 1D2BA 1WTPA 4R8NA 1A3VA 4AQYL 1CKNB 2YU9H 4HMIA 3BVMA 5I2XA 4N9PA 3V2TA 1K9MC 1TQOA 1PYWD 4CBVA 4JI1Q 2XRQD 1WYDA 2IHFA 3CAMA 4LF6Q 1QWYA 3Q0AA 1G6ZA 1G8ZD 3T13A 3I4MG 3PMFA 3WOEA 2ES2A 3HOWG 4GKJQ 3HG9A 4NMZA 3LWUA 4HJ5A 4GLVB 1RTOA 2CW0D 5EQ0A 4HIKA 1KAWA 1EWHA 1PH6A 3FKIB 4F88A 1GKHA 1BQQT 4DV4L 1Y1WG 2PPBC 3M4OH 1IYUA 1X55A 4MNOA 2N78A 2HIXA 2OWOA 4A3CH 1NE3A 4YCVA 2B29A 4YIJA 2Z1CA 2FXQA 2J4XA 4B3RQ 1I6HB 2PYKA 2EYOA 5JEAJ 4GN3B 1EL0A 4A3JB 2WB1B 3I56A 4LFCQ 1F9PA 4NP5A 4BY7B 4O0AA 3GTLH 4LF9Q 4Q5VA 5DLQE 4QQBX 4DR3Q 1IW7C 4LF8Q 2G9DA 1SNOA 1S5BD 1SJHD 3GTPH 2ENBA 3T53B 2RCNA 3OTOQ 4A3KG 4JI0L 1SNQA 2BCOA 3A54A 3JAMi 2R93G 2FFKB 1VQEA 1H9SA 2EIFA 4ZAIA 1KTKA 3VDYA 5LL6S 3BJUA 3P1HA 4C3JB 1C7YA 1CHPD 2WAQB 1MSHA 1PTOD 2H5XA 3EBEA 3S1MH 5JAVA 3VYTA 5FLXE 1JWUD 1SFOB 3HFZB 4DV1Q 2NN6I 1X3FA 5FKAC 4LFAQ 5C4XG 4RKLA 5A2QL 2Q2HA 3PUZA 3VA5A 4B9XA 1B3QA 3SK4A 4JI3Q 5EJWA 3OIQA 1LACA 3MEFA 4HN7A 4BS9A 1HRJA 4BXXG 2ATWA 3MAQA 1EEFD 2JEBI 2B2WA 1RCVD 1EU3A 3K7AH 2G9HD 2MGSA 4YCWA 1QUQA 2RF4A 4CKCA 4DR5Q 2KVMA 2K7VA 2CQOA 2EDGA 1C4QA 4PMBA 1VQPA 2VQFQ 3C46A 4LNQA 4DV6Q 4DR4Q 1BCPD 1WCMB 2LXKA 3J81i 1IBKL 3NWSA 2F0EA 1LT4D 4G57A 1LYLA 2CFMA 5C0XG 2VS1A 1PH5A 2A1AA 4FDBA 2LFNA 5CV8A 2RCFA 4FP5D 1K83H 1KLUD 3OIPA 1QZHA 1YEZA 3AB9A 1RKNA 3Q23A 1A2TA 3I8ZA 1V9PA 2E5LL 2XGTA 1E2ZA 3NBIA 2Q2UA 3T51B 2EJGC 4YHHQ 1HXYD 1SE8A 3S16B 3UDFA 1CKNA 1UE1A 4EVOA 1JICA 1AH9A 1GUOA 1JC7A 2JN4A 4G7OC 1H9JA 2CH4A 2WFWA 1VQ8A 1C9OA 4ZUIA 3ERSX 2K05A 2EY5A 3FP9A 1E3PA 1BDOA 4DV0Q 1GD7A 1SNDA 2ZJRA 1PFBA 1M4VA 4KI0A 4C3HH 5JEAG 2JA7G 4L5QA 4HIOA 1PMRA 5C3WA 4L8JA 4HEDA 3LNNA 4LUVA 4LF5Q 1H9MA 3K6OA 3VR3A 1E0BA 4LFBQ 4BBRH 2F4VL 1LO5D 4F8MA 1Z9FA 4OWWB 1I50H 3TMEA 5C4HA 4IPHA 1R4PB 1Q81C 3I4MB 3HRZC 1Q82C 1PYBA 4X64L 4LAAA 4KHPQ 1STBA 4UP9A 1WTRA 4H44C 3UI2A 1J8IA 1SNPA 1EYAA 4XT3B 4BY1H 3R2TA 4DV5L 4DR7L 3E6ZX 3G48A 2YV5A 1OXVA 2D5DA 1SMXA 1N36Q 1Y1WB 3KUPA 1L1OA 2D0OA 1MD2D 4ALPA 1RODA 3RR5A 4QL5A 1TKWB 4LF7L 3DM3A 3CU7A 5F2DA 1D5MC 3K5MA 3NK9A 2F0KA 1O7ZA 1CQVA 3PO3H 4N9TA 5IP7H 2XVSA 2J7ZA 4A3CG 1NSNS 2PI2A 2MHVA 2LY7A 4AYBE 2HIVA 1N34L 1YHQA 5FOBB 1U0LA 5IOCA 5ELCA 3S2DB 4JI6L 3K80C 4R4OA 1PH4A 4KMUC 3PV0A 4J15A 3OOCA 4YCUA 3PIPA 3QO2A 1JWMD 3TP8A 4IUNA 2K75A 5D65A 3GTOB 1EYGA 2K1BA 3SK8A 4H13C 4JV5Q 2R93B 3OW7A 3G6JB 1I94L 1STAA 5IYBH 3SEBA 2PQEA 3K0YA 1PTOF 4A3EH 3M7NA 5GROA 3QG1A 1R4QB 2TSSA 3W3AA 3NE5B 2F0IA 2KHSA 1PH1A 3QOJA 5C4XB 4NB3A 1V1PA 1KQSA 2EOTA 5ELOA 2F0JA 2V4DA 4RCOA 1W2BA 4JI4Q 4KJOA 3HOYH 2K28A 2AUKA 2QF7A 2QA4A 4KD4A 3VR2A 3FPUB 4JCVE 2PO4A 4C1NK 4OL7A 3DHQA 1XNQL 2FJ2A 1TS5A 1S4ZA 1EY9A 2IL8A 1K0SA 1I4PA 4L5TA 1XMQQ 2E2HH 1ENAA 4R4CA 3RZDB 3UDXA 1NY4A 3C2PA 3H3VH 4GKKQ 3S24A 5IY0A 4ZQ3A 5JJKA 1X3EA 5I4DA 1TIID 1F2LA 4IJHA 2QCPX 1BCPF 3NBHB 2X6LA 4DK1A 4RG1A 3EJIA 3OYYA 3H15A 3URYA 3M7GA 1TY0A 1KRSA 3HOUB 4X3KA 1Y1VH 1CZGA 2AMCB 1IYVA 1I4QA 2E2IH 1LT3D 2NTSA 1SE4A 3TN2A 1XYIA 4RKBA 2SEBD 5IT9L 1N8RC 1I6VC 3I55A 2QW7A 2YTVA 2JK8A 1EY5A 1WTQA 1CZWA 5FK9C 4WJ3M 5CBEE 4MN3A 3S2HB 2K03A 3FRPB 2B2UA 2OEOA 1HHVA 1ET9A 1WI5A 2F0WA 1SMYD 3D3RA 2UXBQ 1DZ1A 1XWEA 2B8GA 1VMCA 2PNRC 3MXGA 4QMGA 3E9IA 2JA7B 4QB4A 3DEOA 2X6GA 1SYCA 4R8IA 5C3XA 5IYDH 1QVFA 2JXMB 4B3TL 3D8GA 4C3HG 3CW2C 5M5XB 1EY0A 4C2MH 5M3MH 2YU9B 1S3OA 1FL0A 4B3ML 3NHHA 3HKZG 1M8AA 4C1NI 3WDNA 1DCZA 2F0GA 4PQXA 4YWMA 3J80i 1WVLA 4JW0A 4ZKBB 2E2JH 3K8AA 1YNND 4BBRG 2L9HA 3MXPA 2Z6KC 4B08A 3OMGA 4R9WA 5HY6A 3ICEA 3NEMA 4A3BH 3KF8B 1D6EC 5AFWA 2BOSA 1Q3LA 1X3GA 2R92H 3GP7A 4I7AA 3CCQA 1STYA 2R61A 2K5VA 2PZWA 3K57A 2RVLA 3HOVG 1GHJA 3TREA 1QCBD 2L15A 1B1ZA 3VYSA 2M9VA 2UUCQ 5EPLA 3M4OB 5EPJA 4IPDA 5BN3A 1GM5A 1I4XA 4MIUA 3OHXC 3DXJC 4S3SA 2NTTA 3JAML 4V190 4ZKCB 2C5CA 3PO3G 2Q8RE 1B3AA 3K5OA 5ELBA 1EFWA 1Q46A 1R9TH 2EYLA 5CV5A 3NUCA 1ILPA 3GTLB 3UE0A 3IAYA 4JBJA 4MTNA 5I6YA 3CCUA 4WFN3 4A4IA 2HQEA 2WAQE 4JI1L 3M4PA 3W2DA 2Y0SE 1M90C 2C35B 3GTPB 4LF6L 3IKJA 4X3UA 1EWCA 1EYDA 2NZ1D 4QIWB 4GKJL 1LT5D 1H95A 5IYBG 1Q1BA 3FVQA 1RJTA 4I7ZC 3PUVA 1BBWA 4G7ZC 3OWFA 3S1MB 4OIKA 4QCLA 5EBCA 5C6AA 5CBAE 5CR3A 1OXXK 3DLLA 2A68D 2A6ED 1ONLA 3PIO3 3F2BA 3FKIG 4TSSA 3PO2H 1P16A 4ZLTF 1PRTB 5TSSA 4B3RL 5BN5A 4ODGA 3BDCA 2EY6A 3J81L 1O80A 1SMYC 1T5EA 2WIIB 3B6YA 1K3BC 4OHJA 5CYUA 4LFCL 2JSOA 3WWVA 3K7AB 1UNSA 1IKLA 3C1FA 2AHOB 2L11A 4LF9L 2WB1G 2EPBA 2E8GA 3EVQA 4ME3A 4DR3L 3R8BA 4LF8L 4BY7G 1RDPD 1E7ZA 1Y69U 3OTOL 2WINB 4GNXC 4GN5A 5LMUQ 3TZDA 1II3A 1L0XB 1BR9A 4F87A 4QUFA 3EA6A 4DPGA 4A3LG 5I9PA 2B2WC 1L0YB 1K83B 4FF2A 1Y1VG 2F3IA 1GVPA 1EIFA 3DWQA 4KV6A 4DV1L 4L63B 4LFAL 2OTLA 2NVQH 1EQVA 3I7FA 2UU9Q 2AQ1B 5ELNA 2V1CC 5CGKA 1AN8A 3T16A 3F2CA 4EQNA 4HIMA 4OO1H 4JI3L 3DWPA 2A6HC 4DNRB 5FLXL 1H9SB 3BVGA 1PTOH 4GOPC 4X62Q 3W5OA 4OEMB 4JI5Q 3LX0A 5KGUA 1VQHA 4CDFC 4K2LA 2RDFA 1IBMQ 1U9RA 5IIFA 4DGZA 3PSIA 4JBMA 4Y7NH 3H91A 4CDDC 1IKMA 4K8JA 3AYHB 1PFNA 4C3HB 1IW7D 2K33A 3KF8A 4DR5L 1JWSD 2MJ8A 2KBNA 3D0FA 3EN2A 5G3LD 2VQFL 4NPSA 4DV6L 5CMDA 4DR4L 1HTPA 2K5NA 2R7ZH 3R93A 3L3OC 2H1EA 2ID0A 3FMCA 3W1BA 4BBRB 5M3MG 1WCMG 5A35A 1JOOA 2QDBA 2WV6D 3BYTB 1I50B 5LL6X 4MHEA 1A0IA 4ABNA 1QUQB 2HD3A 2DY8A 4QF4A 3IFTA 2DN8A 4DU9A 4YHHL 3HOVB 4EQOA 5KYLA 4BY1B 3OSOA 1HTLD 2ALYB 3GD7A 5C5MA 2R92G 1IYJB 4X3SA 4U673 1PFMA 1I3QH 3Q6SA 4K5WA 1DONA 5KNBA 4OX9Q 5C4ZA 2NUCA 3I70A 2MNAA 1SLJA 3ND9A 2HCIA 4CDCC 2ICEC 4R4TA 3L2PA 3PO3B 4DV0L 3M3YH 4XQNA 3KLSX 2NBFA 1VQKA 4KJNA 4TRDA 1KRTA 2AWOA 1CHQD 1F2ZA 2L5TA 3GV6A 2EXZA 4LF5L 1EYCA 4LF4Q 1CUKA 3GQBA 4H7BA 4DUYQ 1TT2A 1TWFH 5EPKA 4NKLA 2JA8H 4LFBL 4DR6Q 1F77A 5C0XJ 3AEVA 1MGSA 3BZDB 1MSGA 4R1JA 2A69D 1S5DD 3CF5A 2EYPA 1LTGD 3DM1A 5IGCA 4MTKA 4KHPL 2NN6H 1D5XC 4IZ8A 4A3EB 1BOSA 1UUPA 2IX0A 2F0TA 1HA5A 1HUNA 2F0QA 1UE7A 1JJ2A 1N36L 4OIJA 1D5ZC 2DGYA 3I73A 4DUZQ 1AEXA 3S17H 1STHA 1AFPA 3F8TA 3HOYB 3PIP3 4RH6A 5ISRA 1XPUA 5FJ8H 1V8QA 4UAIA 1A6XA 2IHEA 1A15A 1H9KA 1ZYRC 1O7LA 1PYSB 5LMNQ 1HZAA 5EKIA 2E2HB 3ONAB 2CKZB 1LTSD 4JK1C 1VQNA 1TU2B 4ILWA 2HQLA 4IUQA 1L1OB 3RMHA 2HT1A 1HH2P 3EROA 4JBKA 2MUYA 2RSOA 1VS0A 1YI2A 1WJJA 3H09A 4JI8Q 3OMCA 4JV5L 2OTJA 1FNVA 5T1IA 2F0VA 1AW7A 5HGQA 1PZID 2IWHA 2B2TA 4IOCA 1BVSA 1SJED 1Y1VB 1TWCH 2B2VA 3J7AF 1F2YA 2YYZA 3JAMc 3NXWA 2E2IB 2LS01 5GAHC 4K6DA 1PHJA 2HDMA 3I90A 4R4QA 5NUCA 4JI4L 4LWCA 1YHAA 4GS3A 3KJOA 1W3SA 1B50A 3PCOB 3GTGH 2CCZA 4EGVA 1EWIA 3KFUA 4JG2A 2LSSA 4PZ8A 5J39A 4L5SA 4YWLA 1IHZA 3TS2A 3IRBA 1XMQL 4OO1G 1NJIC 2B39A 3H6MA 1VQLA 3J80L 2GA4B 1V1QA 1V1PB 4GKKL 1A8VA 2K52A 5G3LF 1LV9A 1KIXA 1CT1D 2I46A 2YTXA 3RN5A 3J7AV 1YHBA 2K32A 2LKVA 2VZAA 3W1GA 4C2MB 1DOKA 4IFDI 5M3MB 1OXTA 3MZ5A 2VB3X 3M85A 4QJFA 3CMAA 3I2ZA 2B2UC 2A69C 3CP0A 4C3IH 4LJZC 2R7ZG 3FHWA 2E2JB 3J81c 2ZTDA 3HOUG 3TRZA 1PH9A 3QB3A 4ZCKA 4BBSH 1CSQA 2ZXRA 4DV7Q 4A3BB 5CV4A 1QNUA 2O2LD 2B8FA 2E76C 2R92B 4DXFA 1BO0A 4RAUC 1HA6A 1YJWA 2DNCA 2IW3A 3OPOA 4TVAB 5LMNW 4P73A 1DOMA 4FXDA 3NTHA 1X65A 3BU2A 1J5EQ 1W6KA 3U4ZA 2UXBL 1SDFA 4PNYA 4K8IA 2Q8IB 4RFBA 4P72A 5DM73 2VXWA 2IX1A 4IQZA 2ZTEA 1AE2A 1NMFA 2NVXH 1Z7TA 1GUSA 2L12A 1PH8A 1ET6A 4ME5A 1R9TB 1L2FA 1XPRA 1EUJA 1NNXA 4WORA 1JCKB 2N49A 1HNWQ 4V0BA 5DEHA 2K5QA 4BA1I 1M1KC 2IY5B 2IT1A 1Y14B 2BA0A 1PH2A 1NUCA 2JA8G 4UHVA 1JJCB 4PV1C 3IL8A 3KOJA 4A3MH 2NYZD 2N3SA 1G6PA 5KNCA 1CKOA 2B2YA 3E0EA 3D6WA 3D4RA 1CA6A 4J8QA 2AQ3B 3N52A 4XT1B 4DNIA 2QDLA 2NN6G 2O5JC 2JJQA 1CSPA 1PLFA 4MZ9A 1SXTA 2PW5A 4BWGB 2EYHA 3R2IA 2UUCL 2F0PA 3P7JA 5I9OA 3D4WA 4M8AA 3ULJA 1PVOA 3TP6A 2NVTH 3PO2B 2N88A 1TR5A 3CRKC 5JVG3 4APVA 4R4IA 3SGIA 1MJEA 5FJ8G 2UUBQ 4FO2A 1U4MA 3ULLA 4LW1A 4RCNA 4RGOS 3SXHA 2OF1A 5IP9H 4TQUS 2EY2A 2EXDA 3HGBA 5C3EH 4YY3Q 2F03A 4C56C 1QOHA 5CV6A 4DV3Q 1VQGA 1I4RA 1IL8A 2XIWA 4DR2Q 2AUJD 1KABA 1IL2A 1KXLA 1YIJA 3TEHB 2RKSA 3ULPA 1I4GA 1YBYA 1KL9A 1D1KA 2XWBB 2AQ2B 4KN4C 3GTJH 2PNHA 1OTCA 2HCCA 1FGUA 1SNCA 2RDHA 2Z6BA 1KLGD 3HP3A 2QEXA 5C4JH 2NVQB 2PQAB 1MIUA 3D4DA 1I4HA 5IYCH 2OCEA 3KJPA 3NWTA 3MFGA 1ICFB 2RDGA 1D1IA 3PUXA 1WFQA 2NB0A 1V43A 3TDQA 5JOBA 1HQMC 1PTOB 3K7UC 2UXCQ 1A3TA 3HKZE 2RHSB 1PRTD 3RLOA 4IURA 1ASYA 5IGDA 1VQMA 1BKBA 4K5VA 1N9WA 2CWPA 4Y7NB 3PUWA 4EQPA 3K0XA 1HFGA 1GUWA 2ZT9C 2A8VA 1LTID 2KEEA 5LMUL 2R7ZB 3KBXA 4XTCS 3BS1A 2QEJC 1V1OA 3VA7A 1Q8KA 2J0TD 4JI7Q 1PDQA 3QR8A 4C3IG 3CKIB 4DAYB 3GO5A 1KHIA 3H94A 1O7YA 1P8LA 1BCPB 2UU9L 3MFYA 1STEA 3L7ZC 4KTAA 1YZ6A 5JJIA 3X3NA 4KLKA 4G4KA 4JOIC 1QJOA 3G7LA 2I0QA 3CCMA 4UP7A 3KYHC 1I3QB 2WKDA 4X62L 3CCRA 1PFSA 4JI5L 4A3DH 1QILA 5JPMC 4X6AH 3HS0C 2EYFA 1VF5C 2F0HA 1IBML 1J6QA 5K36H 2E74C 1E2WA 4A75A 2X69A 2GVBA 3V05A 1SSOA 4ID6A 3M3YB 1H9RA 2NWGA 1X56A 4PZ6A 3I3CA 3HOZH 1FD7D 1G2TA 4IPCA 3VR6A 5C44H 1ESFA 1D8LA 5IODA 1S40A 1LT6D 2L0CA 4B3SQ 2XRSD 1K3RA 1STGA 4DV2Q 2JA8B 4E6IA 5JVH3 1LTAD 2EVBA 1JE5A 1T9HA 1VQBA 3FEWX 5KEEA 2KCCA 3J80c 2ZM6Q 4A3MG 3G4SA 3NQTA 1EZ8A 5KYIA 3T1HQ 1Y8PB 2BH2A 5EKKA 2K04A 3VYUA 2VUMH 1BBUA 3SR1A 3DMUA 3Q8DA 2A6HD 2OQ0A 4BY1G 2WB1E 3ND8A 4OX9L 3S17B 4ZYSA 3CCEA 3BDLA 2UXDQ 4A93H 2VW9A 3A56A 5M9OA 1VMPA 2FMCA 3VYRA 1A3UA 2QKIC 4LUOA 1E2VA 3MEHA 5IE8A 3GTMH 3RZOH 2A73B 1WTXA 1JOKA 4UY8C 1PRTC 4K14A 4CDEC 2DNEA 3M4YA 3CCLA 3RUZA 3CCVA 1J9OA 1VF7A 3BG3A 2PI2E 3FDTA 5IP7G 5FLMH 4LF4L 2B63H 4NXMQ 2B3GA 3CQZH 4DUYL 3GTQH 4PMWA 1CI3M 1KNAA 4DR6L 4DNTB 5IP9G 2OT2A 2PQAA 4CGYB 1KDAA 2VQEQ 1LTTD 4HCSA 4CKBA 2F3WA 1X6OA 1JB3A 3MXUA 5E4WC 4PZ7A 4P2CB 2M00A 1S72A 1B44D 3X3MA 1TWCB 4IJLA 5BN4A 4A3EG 4A3FH 4A3GH 1FNWA 1K8MA 1NR2A 4NDXA 2XWJB 4GLAC 4DUZL 4WJ4A 1DYQA 2PW7A 1ZXTA 3NP8A 4DR1Q 1DJRD 2K5WA 3GTGB 5GAGC 4WJWA 3HOWH 1S5CD 2BE5D 4DN4M 1PRTF 2CHBD 3V96A 3HOYG 5IYCG 3KLWA 4WRDA 5LMNL 4A3DG 4P74A 3CD6A 1TWGH 1XPOA 2B2TC 1LTLA 5HGTA 1CA5A 1IZ6A 2CH4W 4OXPA 3RN2A 3J7A5 2F0NA 3I91A 2B2VC 1EOTA 3MTSA 1HZBA 2VY3A 4DAYA 4A76A 1D7QA 3Q24A 4JI8L 5K5PA 1QE6A 2KENA 2NVYH 4HSPA 4M1UB 3UDGA 1G2SA 1DM0B 1XTCD 1WD1A 4IUUA 1U4PA 1T5XD 1WTHA 2KOLA 2OXPA 3GV3A 4C3IB 4HJ9A 2I5HA 4X3TA 1MBYA 4LUZA 4A3KH 1K0RA 1LTBD 4BBSB 3MXNB 1N32Q 1NTGA 4DFAA 2KHJA 3GDEA 2R93H 4F7XA 4AYBB 1MI2A 2BH8A 1JOQA 3HZXA 4P71A 3A8IE 4RA8A 5BR8Q 1UEBA 1VQ5A 1GXDC 4FXGC 1Q86C 1ZYRD 2R7DA 1CM9A 1KNEA 3G6EA 1VQJA 1Q7YC 3SK5A 1AZPA 4FVMA 2GVAA 3EFXD 3I4NH 2ICIA
chains in the Genus database with same CATH topology
1E24A 1WCMH 4LF7L 3DM3A 2Y0SG 3PO3H 5K36G 1TWCH 3UDIA 2YYZA 1VQ9A 3JAMc 3T1YQ 1GO3E 5GAHC 2F4VQ 1EQQA 5IP7H 4A3CG 1PHJA 3HOXH 2PI2A 4POFA 4R4QA 4AYBE 2HIVA 1N34L 1YHQA 1OXSC 1U0LA 5IYDG 4JI4L 4LWCA 3J7ZC 3HOZG 1YHAA 3BZKA 3K80C 4GS3A 4R4OA 2ZTCA 1W3SA 3KJOA 5C44G 3CCJA 3PV0A 1PH4A 4J15A 3F2DA 3PCOB 1HR0L 3GTGH 2CCZA 1EWIA 1TWAH 2PMZE 4X64Q 4YCUA 1TXYA 3KFUA 1LUZA 1LM0A 3PIPA 1MJCA 4JG2A 3CPFA 3STBD 2LSSA 4PZ8A 3S1RH 1XNRL 4L5SA 2K75A 4YWLA 1EYGA 4DV5Q 3S16H 3TS2A 1N33Q 4PG3A 3IRBA 1XMQL 4DR7Q 1XTDA 2I5LX 4JV5Q 4OO1G 1NJIC 4DV7L 4AIMA 3RLNA 1NBWA 1VQLA 5GADC 1I94L 2HHHL 5IYBH 4A3IH 1IBLL 2F52A 1V1QA 4GKKL 4A3BG 1A8VA 4NXNL 4A3EH 3M7NA 5C3EG 2K52A 5GROA 4LF7Q 1XJVA 3BZCA 1KIXA 1XMOL 2YTXA 3RN5A 3H0GH 1PH1A 1YHBA 3RNUA 1J5EL 2VUMG 4NB3A 1KQSA 2VZAA 3CC4A 3W1GA 5ELOA 1N34Q 4IFDI 1OXTA 1W2BA 3M85A 4JI4Q 4JI6Q 3HOYH 4QJFA 3CMAA 3I2ZA 1HR0Q 2K14A 2QA4A 3CP0A 3AQQA 4C3IH 2R7ZG 4JCVE 1O7IA 3GTKH 3FHWA 4DR4L 2K50A 3J81c 2ZTDA 1XNQL 1XNRQ 3HOUG 3TRZA 1PH9A 1U5KA 2DUDA 4L5TA 1XMQQ 1B7YB 4O2DA 2E2HH 4R4CA 4BBSH 1CSQA 5IT9c 4DV7Q 3I4MH 1HNWL 3UDXA 1NY4A 2AKWB 2HHHQ 1HJPA 1I94Q 1A62A 5FLMG 3H3VH 1IBLQ 3PGZA 2B63G 1VQIA 1L1OC 1DGSA 1HZCA 3S24A 5IY0A 1YJWA 4JI2L 4NXNQ 1X3EA 4GKKQ 5JJKA 2WP8J 5JJLA 4IJHA 4TVAB 5LMNW 4P73A 4DK6C 3TQYA 2AWNA 5AJ3L 1VQOA 1XMOQ 3NBHB 1X65A 3BU2A 2R7FA 3OW2A 1Y1WH 1VCIA 1J5EQ 3U4ZA 3PF4A 2UXBL 4RG1A 1YNXA 1YITA 3ER0A 2MO0A 3OYYA 2CWAA 4P72A 3H15A 4POGA 1RL2A 1SR3A 5M5XH 2NZHA 5J3BA 1PV4A 2IX1A 1VQCA 1KRSA 2JA5H 3KF6B 2ZTEA 1AE2A 1NMFA 2NVXH 1Y1VH 2AMCB 2JQOA 4HIDA 2E2IH 1PH8A 4A3FG 1XNQQ 4JYAL 4HJAA 4A3GG 1L2FA 5IWAL 1XPRA 1EUJA 3S2DH 2N49A 1HNWQ 4RMFA 5C0XI 3CC7A 1M1KC 4BA1I 4A3JG 1N8RC 3I55A 3KDFA 5M5YH 2IY5B 2YTVA 2IT1A 2JK8A 2UUBL 2BA0A 1Y14B 1G291 4DK3C 1PH2A 4JI2Q 2JA8G 1JJCB 3PO2G 4WJ3M 4X66L 1SROA 3KOJA 3GTOH 4L5RC 2D62A 2Q2IA 4A3MH 2N3SA 1G6PA 1WI5A 5AJ3Q 1JMCA 2XTIA 1CKOA 3E0EA 1PH3A 4YY3L 2UXBQ 4K0KL 3E9IA 4DV3L 1HZ9A 3UE1A 4DNIA 1K73C 4BA2I 1B8AA 2NN6G 1QVGA 5E7NA 2JJQA 4DR2L 1CSPA 4MZ9A 4EQ5A 5IYDH 1QVFA 2JE6I 5M3FH 4X65L 5C4XH 2UUCL 4JYAQ 4OONA 4B3TL 3CW2C 5IWAQ 4C2MH 3ULJA 1VQ6A 2D0PA 2MQHA 2WAQG 5M3MH 1PVOA 2NVTH 1S3OA 1FL0A 1UE6A 1KD1C 3STBC 1JB7A 4B3ML 2JA6H 3HKZG 3K81C 4APVA 4R4IA 3J80i 3SGIA 4YWMA 1MJEA 1YVCA 3PIOA 5FJ8G 2UUBQ 2E2JH 3K8AA 4BXXH 3CCSA 3ULLA 4X66Q 4BBRG 4P75A 4LW1A 2Z6KC 3ICEA 5HY6A 3NEMA 3CPWA 5IP9H 4A3BH 4TQUS 3RZDH 2EXDA 1HR0W 1SRUA 1X54A 3KF8B 5C3EH 4YY3Q 4K0KQ 1X3GA 2R92H 4DV3Q 1VQGA 3CCQA 2UXCL 2K5HA 2K5VA 1Q12A 3JC66 1HNXL 1ASZA 3HOVG 3AFQA 4DR2Q 3TREA 4GNXB 2L15A 1K8AC 4JOIA 4IPGA 1IL2A 1YIJA 4X65Q 1KXLA 2KHIA 3L0OA 3TEHB 1HNZL 2UUCQ 4B3TQ 5H1SE 3ULPA 1YBYA 4IPDA 1KL9A 4JC0A 2YTYA 5M5WH 1GM5A 4GNXA 4B3MQ 3J81j 4IFDJ 3I4NG 3HOUH 3GTJH 1OTCA 2PNHA 4HJ8A 1FGUA 1YJNA 1PH7A 2RHQB 2Q2TA 3PO3G 2UXDQ 2QEXA 5EAYA 2JEAI 1EFWA 1Q46A 5C4JH 1R9TH 2PQAB 1MIUA 3M4QA 4KHZA 4EX5A 3HOXG 2UUAL 5IYCH 2OCEA 4A93G 3KJPA 3UE0A 2Z0SA 4JBJA 4MTNA 3CCUA 4Y52H 4JI7L 3PUXA 1WFQA 1UWVA 4A4IA 1V43A 2WAQE 4JI1L 3M4PA 3K7UC 2UXCQ 2Y0SE 4UP8A 3S2HH 4GOPB 3HKZE 2RHSB 2C35B 4DAMA 1M90C 1HNXQ 1FJGL 1JJGA 4LF6L 1VQDA 3RLOA 2KCMA 3A5ZB 1ASYA 1VQMA 3G71A 1BKBA 1HNZQ 4GKJL 1QVCA 2Z6KA 2GN5A 1FVIA 1H95A 1N9WA 2CWPA 2N8NA 4JBWA 5IYBG 3CXCA 1Q1BA 4GOPA 4A3IG 1VQ7A 2KCTA 2JA7H 4OO1I 3S1QH 1KC8C 3PUWA 3PUVA 1BBWA 3ZJYC 4IOAA 5GAEC 3S15H 3K0XA 4HJ7A 2A8VA 5LMUL 3H0GG 1OXXK 3PUYA 4XTCS 1CKNB 3DLLA 4AQYL 2UUAQ 3F2BA 2YU9H 3FKIG 2I5MX 3PO2H 1P16A 1Q8KA 1K9MC 4B3RL 4JI7Q 4DAYB 1X9NA 4JI1Q 1WYDA 3GO5A 1KHIA 4B3SL 3B6YA 3LGJA 3U50C 2IHFA 1FJGQ 1JT8A 4QIWE 1P8LA 3CAMA 4LFCL 3KF6A 4LF6Q 4DV2L 2UU9L 3L7ZC 3WWVA 1YZ6A 5JJIA 2MO1A 4YWKA 1NMGA 2AHOB 3I4MG 1QZGA 4LF9L 2WB1G 4KLKA 4ME3A 2E8GA 2ES2A 4DR3L 3HOWG 4GKJQ 4JOIC 5FLXc 4LF8L 2ASBA 4BY7G 4HJ5A 1EQRA 2I0QA 4GLVB 3CCMA 1E7ZA 4UP7A 3KYHC 4QGUA 3CCRA 4X62L 4HIKA 3OTOL 2ZM6L 4JI6L 1KAWA 1PFSA 4GN5A 4JI5L 4GNXC 4A3DH 3T1HL 1PH6A 3PF5A 4X6AH 1IBML 5LMUQ 1J6QA 1GKHA 4DV4L 1Y1WG 3D31A 3M4OH 4A75A 3U4VA 2GVBA 4AQYQ 1X55A 3AFPA 4MNOA 2N78A 3S1NH 2HIXA 2OWOA 4A3CH 1NE3A 4YCVA 2B29A 1X56A 2FXQA 4DPGA 4PZ6A 4B3RQ 3A0JA 3HOZH 4A3LG 2JA5G 4IPCA 5JEAJ 2NZOA 5C44H 1Y1VG 2F3IA 4GN3B 1GVPA 1D8LA 4DKAC 1S40A 1EIFA 2UXDL 4B3SQ 4DV1L 4LFAL 2OTLA 3I56A 2NVQH 4LFCQ 3I7FA 1K3RA 4DV2Q 2UU9Q 5ELNA 2V1CC 4O0AA 2QGQA 1TWHH 4GN4B 3GTLH 3HKSA 1JE5A 3F2CA 1T9HA 1VQBA 4LF9Q 5DLQE 4HIMA 3HOVH 4QQBX 4JI3L 4DR3Q 4LF8Q 3TS0A 4GOPC 3GTPH 3J80c 4NXML 4X62Q 3W5OA 2RCNA 3OTOQ 2ZM6Q 4A3MG 4A3KG 3G4SA 4JI0L 4JI5Q 1CKMA 1VQHA 3T1HQ 1UE5A 3JAMi 3A74A 1IBMQ 2R93G 2BH2A 1VQEA 1WOCA 1I5FA 3EIVA 4DV4Q 1PA6A 2EIFA 3PSIA 4IFDG 4JBMA 4Y7NH 3VDYA 3S14H 2VUMH 1BBUA 3M9BA 3AYHB 2VQEL 3Q8DA 1Q1EA 2OQ0A 3BJUA 4BY1G 4DR5L 1C7YA 2WB1E 2H5XA 2KBNA 3D0FA 3EBEA 3EN2A 3S1MH 4OX9L 3CCEA 3CMEA 2VQFL 4NPSA 2OQKA 2ZJPA 4DV6L 2EQSA 3HFZB 2K5NA 5M3FG 4DV1Q 2VW9A 2NN6I 2R7ZH 1X3FA 3NELA 4LFAQ 4A93H 5C4XG 2ID0A 2Q2HA 3PUZA 4LUOA 3W1BA 5IE8A 5M3MG 3GTMH 1EOVA 3RZOH 1WCMG 4UY8C 3RLFA 2JA6G 1AE3A 4JI3Q 1A0IA 3CCLA 3CCVA 4DR1L 1QUQB 3MEFA 5IP7G 5FLMH 2PI2E 1A63A 4LF4L 4UPAA 2ATWA 2B63H 4BXXG 1C0AA 4NXMQ 2B3GA 3CQZH 4DUYL 3GTQH 2JEBI 4PMWA 4JI0Q 4DR6L 3K7AH 4YHHL 3CC2A 5IP9G 4YCWA 1QUQA 2PQAA 2RF4A 2ALYB 3GD7A 2R92G 1IYJB 2VQEQ 4DR5Q 1I3QH 1X6OA 1VQ4A 2CQOA 4OX9Q 1VQPA 2VQFQ 4PZ7A 3FKIH 4LNQA 2MNAA 4DV6Q 4DR4Q 1SLJA 2LXKA 1S72A 3J81i 4R4TA 3L2PA 1IBKL 4DV0L 1LYLA 2CFMA 4IJLA 1E22A 2VS1A 5C0XG 1MKHA 4A3EG 4A3FH 1PH5A 3M3YH 2A1AA 3I4OA 4FDBA 4A3GH 1VQKA 1KRTA 4GLAC 4OWXB 4DUZL 1I6HH 4WJ4A 2AWOA 1K83H 1EIYB 4DR1Q 3A5UA 4A3JH 1YEZA 4GLXA 1QZHA 4LF5L 4LF4Q 1CUKA 5GAGC 1V9PA 4DUYQ 2E5LL 1TWFH 3HOWH 2XGTA 2JA8H 4LFBL 4BY7H 4DR6Q 1E1TA 2Q2UA 3HOYG 5C0XJ 4YHHQ 5IYCG 3AEVA 1B70B 3KLWA 2K4KA 4QY7A 4R1JA 5GQOA 1SE8A 4AH6A 3CF5A 5LMNL 1VQAA 2JA9A 4A3DG 4OWTB 1CKNA 4P74A 3UDFA 1UE1A 3CD6A 1TWGH 1N32L 1XPOA 1LTLA 2VL6A 1IZ6A 1AH9A 4OXPA 3RN2A 3J7A5 4KHPL 2WFWA 1VQ8A 4BBSG 1G51A 1C9OA 3U58A 1HZBA 2VY3A 4A76A 3ERSX 1D7QA 5BR8L 3FP9A 2IX0A 4AYBG 1E3PA 1IBKQ 4JI8L 4DV0Q 4A3LH 1GD7A 1UE7A 1JJ2A 1N36L 2ZJRA 2KENA 2R6GA 4KI0A 2NVYH 4C3HH 5JEAG 2JA7G 3UDGA 1E1OA 4L5QA 3KDFB 2DGYA 4C3JH 3NENA 4HIOA 4DUZQ 4IO9A 1OXUA 3S17H 4XIGS 3F8TA 2VNUD 1K8GA 1SFOH 4LUVA 4LF5Q 1XPUA 4HJ9A 5FJ8H 2E5LQ 1L0WA 2I5HA 4LFBQ 2IHEA 3T1YL 1RIPA 4BBRH 2F4VL 1Z9FA 1PYSB 4LUZA 1I50H 5LMNQ 1HZAA 4IPHA 4OWWB 4A3KH 1K0RA 2ZJQA 1Z47A 1VQFA 1Q81C 1IXRA 2CKZB 2LXJA 1SN8A 1VQNA 3MXNB 1N32Q 2BA1A 1NTGA 1Q82C 2KHJA 3GDEA 2R93H 1PYBA 4X64L 2MFIA 4KHPQ 1YJ9A 2HQLA 2BH8A 1L1OB 2A19A 4UP9A 4P71A 2HT1A 1HH2P 4JBKA 5BR8Q 1UEBA 1VS0A 1VQ5A 4BY1H 4DV5L 1YI2A 1WJJA 1N33L 3F1ZA 4DR7L 4JI8Q 3G48A 1Q86C 2YV5A 1OXVA 4JV5L 2OTJA 2R7DA 1N36Q 1SMXA 3E9HA 1L1OA 2D0OA 4H02A 4ALPA 3G6EA 1VQJA 1Q7YC 5HGQA 3RR5A 4QL5A 2GVAA 3H3VI 4IOCA 3I4NH 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E24 A;  1WCM H;  4LF7 L;  3DM3 A;  2Y0S G;  3PO3 H;  5K36 G;  1TWC H;  3UDI A;  2YYZ A;  1VQ9 A;  3JAM c;  3T1Y Q;  1GO3 E;  5GAH C;  2F4V Q;  1EQQ A;  5IP7 H;  4A3C G;  1PHJ A;  3HOX H;  2PI2 A;  4POF A;  4R4Q A;  4AYB E;  2HIV A;  1N34 L;  1YHQ A;  1OXS C;  1U0L A;  5IYD G;  4JI4 L;  4LWC A;  3J7Z C;  3HOZ G;  1YHA A;  3BZK A;  3K80 C;  4GS3 A;  4R4O A;  2ZTC A;  1W3S A;  3KJO A;  5C44 G;  3CCJ A;  3PV0 A;  1PH4 A;  4J15 A;  3F2D A;  3PCO B;  1HR0 L;  3GTG H;  2CCZ A;  1EWI A;  1TWA H;  2PMZ E;  4X64 Q;  4YCU A;  1TXY A;  3KFU A;  1LUZ A;  1LM0 A;  3PIP A;  1MJC A;  4JG2 A;  3CPF A;  3STB D;  2LSS A;  4PZ8 A;  3S1R H;  1XNR L;  4L5S A;  2K75 A;  4YWL A;  1EYG A;  4DV5 Q;  3S16 H;  3TS2 A;  1N33 Q;  4PG3 A;  3IRB A;  1XMQ L;  4DR7 Q;  1XTD A;  2I5L X;  4JV5 Q;  4OO1 G;  1NJI C;  4DV7 L;  4AIM A;  3RLN A;  1NBW A;  1VQL A;  5GAD C;  1I94 L;  2HHH L;  5IYB H;  4A3I H;  1IBL L;  2F52 A;  1V1Q A;  4GKK L;  4A3B G;  1A8V A;  4NXN L;  4A3E H;  3M7N A;  5C3E G;  2K52 A;  5GRO A;  4LF7 Q;  1XJV A;  3BZC A;  1KIX A;  1XMO L;  2YTX A;  3RN5 A;  3H0G H;  1PH1 A;  1YHB A;  3RNU A;  1J5E L;  2VUM G;  4NB3 A;  1KQS A;  2VZA A;  3CC4 A;  3W1G A;  5ELO A;  1N34 Q;  4IFD I;  1OXT A;  1W2B A;  3M85 A;  4JI4 Q;  4JI6 Q;  3HOY H;  4QJF A;  3CMA A;  3I2Z A;  1HR0 Q;  2K14 A;  2QA4 A;  3CP0 A;  3AQQ A;  4C3I H;  2R7Z G;  4JCV E;  1O7I A;  3GTK H;  3FHW A;  4DR4 L;  2K50 A;  3J81 c;  2ZTD A;  1XNQ L;  1XNR Q;  3HOU G;  3TRZ A;  1PH9 A;  1U5K A;  2DUD A;  4L5T A;  1XMQ Q;  1B7Y B;  4O2D A;  2E2H H;  4R4C A;  4BBS H;  1CSQ A;  5IT9 c;  4DV7 Q;  3I4M H;  1HNW L;  3UDX A;  1NY4 A;  2AKW B;  2HHH Q;  1HJP A;  1I94 Q;  1A62 A;  5FLM G;  3H3V H;  1IBL Q;  3PGZ A;  2B63 G;  1VQI A;  1L1O C;  1DGS A;  1HZC A;  3S24 A;  5IY0 A;  1YJW A;  4JI2 L;  4NXN Q;  1X3E A;  4GKK Q;  5JJK A;  2WP8 J;  5JJL A;  4IJH A;  4TVA B;  5LMN W;  4P73 A;  4DK6 C;  3TQY A;  2AWN A;  5AJ3 L;  1VQO A;  1XMO Q;  3NBH B;  1X65 A;  3BU2 A;  2R7F A;  3OW2 A;  1Y1W H;  1VCI A;  1J5E Q;  3U4Z A;  3PF4 A;  2UXB L;  4RG1 A;  1YNX A;  1YIT A;  3ER0 A;  2MO0 A;  3OYY A;  2CWA A;  4P72 A;  3H15 A;  4POG A;  1RL2 A;  1SR3 A;  5M5X H;  2NZH A;  5J3B A;  1PV4 A;  2IX1 A;  1VQC A;  1KRS A;  2JA5 H;  3KF6 B;  2ZTE A;  1AE2 A;  1NMF A;  2NVX H;  1Y1V H;  2AMC B;  2JQO A;  4HID A;  2E2I H;  1PH8 A;  4A3F G;  1XNQ Q;  4JYA L;  4HJA A;  4A3G G;  1L2F A;  5IWA L;  1XPR A;  1EUJ A;  3S2D H;  2N49 A;  1HNW Q;  4RMF A;  5C0X I;  3CC7 A;  1M1K C;  4BA1 I;  4A3J G;  1N8R C;  3I55 A;  3KDF A;  5M5Y H;  2IY5 B;  2YTV A;  2IT1 A;  2JK8 A;  2UUB L;  2BA0 A;  1Y14 B;  1G29 1;  4DK3 C;  1PH2 A;  4JI2 Q;  2JA8 G;  1JJC B;  3PO2 G;  4WJ3 M;  4X66 L;  1SRO A;  3KOJ A;  3GTO H;  4L5R C;  2D62 A;  2Q2I A;  4A3M H;  2N3S A;  1G6P A;  1WI5 A;  5AJ3 Q;  1JMC A;  2XTI A;  1CKO A;  3E0E A;  1PH3 A;  4YY3 L;  2UXB Q;  4K0K L;  3E9I A;  4DV3 L;  1HZ9 A;  3UE1 A;  4DNI A;  1K73 C;  4BA2 I;  1B8A A;  2NN6 G;  1QVG A;  5E7N A;  2JJQ A;  4DR2 L;  1CSP A;  4MZ9 A;  4EQ5 A;  5IYD H;  1QVF A;  2JE6 I;  5M3F H;  4X65 L;  5C4X H;  2UUC L;  4JYA Q;  4OON A;  4B3T L;  3CW2 C;  5IWA Q;  4C2M H;  3ULJ A;  1VQ6 A;  2D0P A;  2MQH A;  2WAQ G;  5M3M H;  1PVO A;  2NVT H;  1S3O A;  1FL0 A;  1UE6 A;  1KD1 C;  3STB C;  1JB7 A;  4B3M L;  2JA6 H;  3HKZ G;  3K81 C;  4APV A;  4R4I A;  3J80 i;  3SGI A;  4YWM A;  1MJE A;  1YVC A;  3PIO A;  5FJ8 G;  2UUB Q;  2E2J H;  3K8A A;  4BXX H;  3CCS A;  3ULL A;  4X66 Q;  4BBR G;  4P75 A;  4LW1 A;  2Z6K C;  3ICE A;  5HY6 A;  3NEM A;  3CPW A;  5IP9 H;  4A3B H;  4TQU S;  3RZD H;  2EXD A;  1HR0 W;  1SRU A;  1X54 A;  3KF8 B;  5C3E H;  4YY3 Q;  4K0K Q;  1X3G A;  2R92 H;  4DV3 Q;  1VQG A;  3CCQ A;  2UXC L;  2K5H A;  2K5V A;  1Q12 A;  3JC6 6;  1HNX L;  1ASZ A;  3HOV G;  3AFQ A;  4DR2 Q;  3TRE A;  4GNX B;  2L15 A;  1K8A C;  4JOI A;  4IPG A;  1IL2 A;  1YIJ A;  4X65 Q;  1KXL A;  2KHI A;  3L0O A;  3TEH B;  1HNZ L;  2UUC Q;  4B3T Q;  5H1S E;  3ULP A;  1YBY A;  4IPD A;  1KL9 A;  4JC0 A;  2YTY A;  5M5W H;  1GM5 A;  4GNX A;  4B3M Q;  3J81 j;  4IFD J;  3I4N G;  3HOU H;  3GTJ H;  1OTC A;  2PNH A;  4HJ8 A;  1FGU A;  1YJN A;  1PH7 A;  2RHQ B;  2Q2T A;  3PO3 G;  2UXD Q;  2QEX A;  5EAY A;  2JEA I;  1EFW A;  1Q46 A;  5C4J H;  1R9T H;  2PQA B;  1MIU A;  3M4Q A;  4KHZ A;  4EX5 A;  3HOX G;  2UUA L;  5IYC H;  2OCE A;  4A93 G;  3KJP A;  3UE0 A;  2Z0S A;  4JBJ A;  4MTN A;  3CCU A;  4Y52 H;  4JI7 L;  3PUX A;  1WFQ A;  1UWV A;  4A4I A;  1V43 A;  2WAQ E;  4JI1 L;  3M4P A;  3K7U C;  2UXC Q;  2Y0S E;  4UP8 A;  3S2H H;  4GOP B;  3HKZ E;  2RHS B;  2C35 B;  4DAM A;  1M90 C;  1HNX Q;  1FJG L;  1JJG A;  4LF6 L;  1VQD A;  3RLO A;  2KCM A;  3A5Z B;  1ASY A;  1VQM A;  3G71 A;  1BKB A;  1HNZ Q;  4GKJ L;  1QVC A;  2Z6K A;  2GN5 A;  1FVI A;  1H95 A;  1N9W A;  2CWP A;  2N8N A;  4JBW A;  5IYB G;  3CXC A;  1Q1B A;  4GOP A;  4A3I G;  1VQ7 A;  2KCT A;  2JA7 H;  4OO1 I;  3S1Q H;  1KC8 C;  3PUW A;  3PUV A;  1BBW A;  3ZJY C;  4IOA A;  5GAE C;  3S15 H;  3K0X A;  4HJ7 A;  2A8V A;  5LMU L;  3H0G G;  1OXX K;  3PUY A;  4XTC S;  1CKN B;  3DLL A;  4AQY L;  2UUA Q;  3F2B A;  2YU9 H;  3FKI G;  2I5M X;  3PO2 H;  1P16 A;  1Q8K A;  1K9M C;  4B3R L;  4JI7 Q;  4DAY B;  1X9N A;  4JI1 Q;  1WYD A;  3GO5 A;  1KHI A;  4B3S L;  3B6Y A;  3LGJ A;  3U50 C;  2IHF A;  1FJG Q;  1JT8 A;  4QIW E;  1P8L A;  3CAM A;  4LFC L;  3KF6 A;  4LF6 Q;  4DV2 L;  2UU9 L;  3L7Z C;  3WWV A;  1YZ6 A;  5JJI A;  2MO1 A;  4YWK A;  1NMG A;  2AHO B;  3I4M G;  1QZG A;  4LF9 L;  2WB1 G;  4KLK A;  4ME3 A;  2E8G A;  2ES2 A;  4DR3 L;  3HOW G;  4GKJ Q;  4JOI C;  5FLX c;  4LF8 L;  2ASB A;  4BY7 G;  4HJ5 A;  1EQR A;  2I0Q A;  4GLV B;  3CCM A;  1E7Z A;  4UP7 A;  3KYH C;  4QGU A;  3CCR A;  4X62 L;  4HIK A;  3OTO L;  2ZM6 L;  4JI6 L;  1KAW A;  1PFS A;  4GN5 A;  4JI5 L;  4GNX C;  4A3D H;  3T1H L;  1PH6 A;  3PF5 A;  4X6A H;  1IBM L;  5LMU Q;  1J6Q A;  1GKH A;  4DV4 L;  1Y1W G;  3D31 A;  3M4O H;  4A75 A;  3U4V A;  2GVB A;  4AQY Q;  1X55 A;  3AFP A;  4MNO A;  2N78 A;  3S1N H;  2HIX A;  2OWO A;  4A3C H;  1NE3 A;  4YCV A;  2B29 A;  1X56 A;  2FXQ A;  4DPG A;  4PZ6 A;  4B3R Q;  3A0J A;  3HOZ H;  4A3L G;  2JA5 G;  4IPC A;  5JEA J;  2NZO A;  5C44 H;  1Y1V G;  2F3I A;  4GN3 B;  1GVP A;  1D8L A;  4DKA C;  1S40 A;  1EIF A;  2UXD L;  4B3S Q;  4DV1 L;  4LFA L;  2OTL A;  3I56 A;  2NVQ H;  4LFC Q;  3I7F A;  1K3R A;  4DV2 Q;  2UU9 Q;  5ELN A;  2V1C C;  4O0A A;  2QGQ A;  1TWH H;  4GN4 B;  3GTL H;  3HKS A;  1JE5 A;  3F2C A;  1T9H A;  1VQB A;  4LF9 Q;  5DLQ E;  4HIM A;  3HOV H;  4QQB X;  4JI3 L;  4DR3 Q;  4LF8 Q;  3TS0 A;  4GOP C;  3GTP H;  3J80 c;  4NXM L;  4X62 Q;  3W5O A;  2RCN A;  3OTO Q;  2ZM6 Q;  4A3M G;  4A3K G;  3G4S A;  4JI0 L;  4JI5 Q;  1CKM A;  1VQH A;  3T1H Q;  1UE5 A;  3JAM i;  3A74 A;  1IBM Q;  2R93 G;  2BH2 A;  1VQE A;  1WOC A;  1I5F A;  3EIV A;  4DV4 Q;  1PA6 A;  2EIF A;  3PSI A;  4IFD G;  4JBM A;  4Y7N H;  3VDY A;  3S14 H;  2VUM H;  1BBU A;  3M9B A;  3AYH B;  2VQE L;  3Q8D A;  1Q1E A;  2OQ0 A;  3BJU A;  4BY1 G;  4DR5 L;  1C7Y A;  2WB1 E;  2H5X A;  2KBN A;  3D0F A;  3EBE A;  3EN2 A;  3S1M H;  4OX9 L;  3CCE A;  3CME A;  2VQF L;  4NPS A;  2OQK A;  2ZJP A;  4DV6 L;  2EQS A;  3HFZ B;  2K5N A;  5M3F G;  4DV1 Q;  2VW9 A;  2NN6 I;  2R7Z H;  1X3F A;  3NEL A;  4LFA Q;  4A93 H;  5C4X G;  2ID0 A;  2Q2H A;  3PUZ A;  4LUO A;  3W1B A;  5IE8 A;  5M3M G;  3GTM H;  1EOV A;  3RZO H;  1WCM G;  4UY8 C;  3RLF A;  2JA6 G;  1AE3 A;  4JI3 Q;  1A0I A;  3CCL A;  3CCV A;  4DR1 L;  1QUQ B;  3MEF A;  5IP7 G;  5FLM H;  2PI2 E;  1A63 A;  4LF4 L;  4UPA A;  2ATW A;  2B63 H;  4BXX G;  1C0A A;  4NXM Q;  2B3G A;  3CQZ H;  4DUY L;  3GTQ H;  2JEB I;  4PMW A;  4JI0 Q;  4DR6 L;  3K7A H;  4YHH L;  3CC2 A;  5IP9 G;  4YCW A;  1QUQ A;  2PQA A;  2RF4 A;  2ALY B;  3GD7 A;  2R92 G;  1IYJ B;  2VQE Q;  4DR5 Q;  1I3Q H;  1X6O A;  1VQ4 A;  2CQO A;  4OX9 Q;  1VQP A;  2VQF Q;  4PZ7 A;  3FKI H;  4LNQ A;  2MNA A;  4DV6 Q;  4DR4 Q;  1SLJ A;  2LXK A;  1S72 A;  3J81 i;  4R4T A;  3L2P A;  1IBK L;  4DV0 L;  1LYL A;  2CFM A;  4IJL A;  1E22 A;  2VS1 A;  5C0X G;  1MKH A;  4A3E G;  4A3F H;  1PH5 A;  3M3Y H;  2A1A A;  3I4O A;  4FDB A;  4A3G H;  1VQK A;  1KRT A;  4GLA C;  4OWX B;  4DUZ L;  1I6H H;  4WJ4 A;  2AWO A;  1K83 H;  1EIY B;  4DR1 Q;  3A5U A;  4A3J H;  1YEZ A;  4GLX A;  1QZH A;  4LF5 L;  4LF4 Q;  1CUK A;  5GAG C;  1V9P A;  4DUY Q;  2E5L L;  1TWF H;  3HOW H;  2XGT A;  2JA8 H;  4LFB L;  4BY7 H;  4DR6 Q;  1E1T A;  2Q2U A;  3HOY G;  5C0X J;  4YHH Q;  5IYC G;  3AEV A;  1B70 B;  3KLW A;  2K4K A;  4QY7 A;  4R1J A;  5GQO A;  1SE8 A;  4AH6 A;  3CF5 A;  5LMN L;  1VQA A;  2JA9 A;  4A3D G;  4OWT B;  1CKN A;  4P74 A;  3UDF A;  1UE1 A;  3CD6 A;  1TWG H;  1N32 L;  1XPO A;  1LTL A;  2VL6 A;  1IZ6 A;  1AH9 A;  4OXP A;  3RN2 A;  3J7A 5;  4KHP L;  2WFW A;  1VQ8 A;  4BBS G;  1G51 A;  1C9O A;  3U58 A;  1HZB A;  2VY3 A;  4A76 A;  3ERS X;  1D7Q A;  5BR8 L;  3FP9 A;  2IX0 A;  4AYB G;  1E3P A;  1IBK Q;  4JI8 L;  4DV0 Q;  4A3L H;  1GD7 A;  1UE7 A;  1JJ2 A;  1N36 L;  2ZJR A;  2KEN A;  2R6G A;  4KI0 A;  2NVY H;  4C3H H;  5JEA G;  2JA7 G;  3UDG A;  1E1O A;  4L5Q A;  3KDF B;  2DGY A;  4C3J H;  3NEN A;  4HIO A;  4DUZ Q;  4IO9 A;  1OXU A;  3S17 H;  4XIG S;  3F8T A;  2VNU D;  1K8G A;  1SFO H;  4LUV A;  4LF5 Q;  1XPU A;  4HJ9 A;  5FJ8 H;  2E5L Q;  1L0W A;  2I5H A;  4LFB Q;  2IHE A;  3T1Y L;  1RIP A;  4BBR H;  2F4V L;  1Z9F A;  1PYS B;  4LUZ A;  1I50 H;  5LMN Q;  1HZA A;  4IPH A;  4OWW B;  4A3K H;  1K0R A;  2ZJQ A;  1Z47 A;  1VQF A;  1Q81 C;  1IXR A;  2CKZ B;  2LXJ A;  1SN8 A;  1VQN A;  3MXN B;  1N32 Q;  2BA1 A;  1NTG A;  1Q82 C;  2KHJ A;  3GDE A;  2R93 H;  1PYB A;  4X64 L;  2MFI A;  4KHP Q;  1YJ9 A;  2HQL A;  2BH8 A;  1L1O B;  2A19 A;  4UP9 A;  4P71 A;  2HT1 A;  1HH2 P;  4JBK A;  5BR8 Q;  1UEB A;  1VS0 A;  1VQ5 A;  4BY1 H;  4DV5 L;  1YI2 A;  1WJJ A;  1N33 L;  3F1Z A;  4DR7 L;  4JI8 Q;  3G48 A;  1Q86 C;  2YV5 A;  1OXV A;  4JV5 L;  2OTJ A;  2R7D A;  1N36 Q;  1SMX A;  3E9H A;  1L1O A;  2D0O A;  4H02 A;  4ALP A;  3G6E A;  1VQJ A;  1Q7Y C;  5HGQ A;  3RR5 A;  4QL5 A;  2GVA A;  3H3V I;  4IOC A;  3I4N H;  1BVS A; 
#chains in the Genus database with same CATH topology
 1E24 A;  2Y0S G;  2NVX B;  2SOB A;  5K36 G;  4RHS A;  3T1Y Q;  4FNF A;  1HQR D;  4TKO B;  3HOX H;  5IYD G;  1QNK A;  3HOZ G;  3BZK A;  3A7A B;  2ZTC A;  5C44 G;  3F2D A;  1TWA H;  4DF7 A;  1MJC A;  1FR3 A;  3S1R H;  3ZYY X;  1G91 A;  4KY5 A;  4A3M B;  1N33 Q;  4PG3 A;  2RQX A;  2I5L X;  4DV7 L;  1BBX C;  4AIM A;  3RLN A;  1NBW A;  2A5H A;  4A3I H;  1Z6H A;  4FXK C;  1WTO A;  4A3B G;  1ILQ A;  2K01 A;  4HCE A;  2FMM A;  3TP5 A;  3BZC A;  2G5D A;  3H0G H;  1B9N A;  2F0F A;  3RNU A;  1TS3 A;  1J5E L;  2VUM G;  1KAA A;  1SYB A;  1QB5 D;  1CK1 A;  3VR4 A;  2RA4 A;  4NW2 A;  2BE5 C;  2NVT B;  1HR0 Q;  2K14 A;  3AQQ A;  5IGB A;  1K28 A;  3GTK H;  2B2Y C;  2K50 A;  1HCZ A;  1XNR Q;  2DUD A;  4RWS C;  1B7Y B;  5EKL A;  1HNW L;  4G7H C;  4N8F A;  5IT9 c;  3JAM E;  5C3E B;  3K59 A;  3NTI A;  1HJP A;  2HHH Q;  2F0M A;  1A62 A;  3HEJ A;  5FLM G;  1IBL Q;  3H3V C;  3PGZ A;  3MWY W;  2B63 G;  1VQI A;  1L1O C;  1HZC A;  4NXN Q;  5DNF A;  5JJL A;  4RGT A;  1DXM A;  5LHY 1;  3SDZ A;  3TQY A;  4DK6 C;  1XMO Q;  3A8K E;  3E5S A;  3T4A C;  1VCI A;  2A74 C;  1BXT A;  3ER0 A;  5D3D A;  2CWA A;  4POG A;  1SR3 A;  1JE4 A;  1W6J A;  5M5X H;  2NZH A;  4U68 A;  3F2U A;  5J3B A;  5COY A;  1PV4 A;  1VQC A;  2JA5 H;  3KF6 B;  3GTJ B;  5KRU A;  2DJG C;  2JQO A;  4A3F G;  3NQI A;  4O1N A;  5C4J B;  4A3G G;  4RMF A;  3TZU A;  5C0X I;  5M5Y H;  4HSV A;  2UUB L;  5EBD A;  1G29 1;  1EIG A;  3PO2 G;  4JI2 Q;  1SRO A;  5JPN C;  5AJ3 Q;  3C3L A;  1PH3 A;  4IN3 A;  5ELD A;  4YY3 L;  4IFD H;  1TVX A;  3J81 E;  1EQT A;  4DV3 L;  1HZ9 A;  3UE1 A;  1K73 C;  3SK6 A;  1B8A A;  3MXN A;  1B9M A;  2PMZ B;  4KN7 C;  4FF3 A;  4DR2 L;  4EQ5 A;  2JE6 I;  5M3F H;  5IGF A;  4JYA Q;  4OON A;  3E3X A;  5IWA Q;  4J1M A;  4KKS A;  4OGQ C;  3DWA A;  1KD1 C;  3I4L A;  1JB7 A;  2JA6 H;  3K81 C;  2Z9H A;  3KLS A;  2CQA A;  3PIO A;  3DEP A;  4X66 Q;  4P75 A;  1EIH A;  1HR0 W;  3QIA A;  4K0K Q;  3FPP A;  1XXG A;  3J7Y W;  2UXC L;  1NCV A;  2K5H A;  1B2T A;  2JP1 A;  3JC6 6;  1ASZ A;  2EYM A;  3AFQ A;  1ENC A;  4A3D B;  2FIN B;  2Y0S B;  5D14 A;  4X65 Q;  2KHI A;  3L0O A;  2BDN A;  4QUC A;  5M5W H;  4JC0 A;  4GNX A;  4CJ1 B;  3J81 j;  4IFD J;  3D6C A;  2SNS A;  3R3O A;  5FO7 B;  3I4N G;  3BVZ A;  3HOZ B;  2Z4H A;  4HJ8 A;  4ZRZ A;  1YJN A;  2Q2T A;  5C44 B;  1Q90 A;  1X3P A;  4KHZ A;  3HOX G;  1LAB A;  4IUP A;  3TP7 A;  2Z0S A;  4Y52 H;  4UDU C;  4JI7 L;  3WOF A;  1UWV A;  2DY7 A;  3U9O A;  4DAM A;  1HNX Q;  2KCN A;  1SNM A;  1VQD A;  2KCM A;  1SE2 A;  3A5Z B;  3U9S A;  1SYG A;  3G71 A;  1HFN A;  1HNZ Q;  1SAP A;  2GN5 A;  4GOP A;  2N8N A;  4A3I G;  1EY7 A;  3CXC A;  3AMU A;  2VUM B;  2KCT A;  1S5F D;  3S1Q H;  1ICW A;  4IAL A;  4IOA A;  1DOL A;  2IJ0 A;  3S15 H;  1SYD A;  4HJ7 A;  4A93 B;  3H0G G;  4RHR A;  3PUY A;  2PZU A;  2UUA Q;  2CVR A;  3RZO B;  2I5M X;  3GTM B;  3P75 A;  3KK7 A;  2CW0 C;  1TS2 A;  4LK1 C;  5D3I B;  1X9N A;  4B3S L;  1ZEQ X;  3LGJ A;  3U50 C;  2B63 B;  1FJG Q;  1JT8 A;  3L9A X;  4JVZ A;  4QIW E;  3GTQ B;  3CQZ B;  3KF6 A;  3QOL A;  3MHB A;  4I65 A;  4DV2 L;  2MO1 A;  4YWK A;  1NMG A;  2ZXO A;  3RD4 A;  4DK0 A;  1QZG A;  2VB2 X;  1RTN A;  2P5Z X;  3NSW A;  2O4X A;  1WTV A;  1DD2 A;  5FLX c;  2F0O A;  2ASB A;  1EQR A;  1ESR A;  5CC4 A;  1BNZ A;  1CFM A;  4QGU A;  2ZM6 L;  3T1H L;  3PF5 A;  1KDB A;  3D31 A;  3U4V A;  4AQY Q;  3AFP A;  2H4O A;  4A3F B;  3S1N H;  4A3G B;  3A0J A;  3MA2 B;  2ZXP A;  2JA5 G;  3LWE A;  2NZO A;  4DKA C;  2PZT A;  2UXD L;  2KUM A;  1ML0 D;  1RD9 D;  1TS4 A;  2F0L A;  4DAV A;  3K58 A;  5CV7 A;  5COR A;  3HOW B;  3TBI B;  2QGQ A;  1TWH H;  4GN4 B;  3HKS A;  3E0J A;  4ULL A;  3HOV H;  3EQL C;  1S5E D;  4IUT A;  1TWG B;  1PTO C;  5J1Z A;  3TS0 A;  1FGB D;  1UAP A;  4NXM L;  1JOR A;  2EYJ A;  5L37 A;  1CKM A;  3OWE B;  1UE5 A;  3A74 A;  1WOC A;  1I5F A;  3EIV A;  5EGT A;  4DV4 Q;  1PA6 A;  4IFD G;  3SE0 A;  3S14 H;  3BYY B;  1ENF A;  3M9B A;  2VQE L;  2NVY B;  1Q1E A;  1O78 A;  4LMQ D;  1JR0 D;  3CME A;  2OQK A;  2ZJP A;  1WD0 A;  2EQS A;  5M3F G;  3NEL A;  2L1B A;  4KK7 A;  2EE1 A;  1EOV A;  3RLF A;  2JA6 G;  1AE3 A;  4A3K B;  1F9R A;  4DR1 L;  1A63 A;  1C0A A;  4UPA A;  4CJ2 C;  1BCP C;  4JI0 Q;  4PMC A;  3KBG A;  2F0D A;  3CC2 A;  4FYD A;  2E75 C;  5A2Q E;  2EY1 A;  5I6W A;  2KED A;  1VQ4 A;  3BDO A;  4KY6 A;  5I2Y A;  1EY4 A;  2EJM A;  3FKI H;  3I4N B;  2M2L A;  1EZ6 A;  2Z8L A;  4XDX A;  3J80 E;  1E22 A;  1MKH A;  3A8J E;  3I4O A;  3A55 A;  4FF4 A;  3HOX B;  1GUG A;  1I6H H;  4OWX B;  5IGE A;  1AP0 A;  2KJX A;  3VR5 A;  2F4I A;  2L4N A;  3NPP A;  1EIY B;  1AZQ A;  3A5U A;  4A3J H;  4GLX A;  1TWA B;  4BY7 H;  1E1T A;  3S1R B;  1OO9 B;  4KKU A;  1B70 B;  3C1E A;  2K4K A;  4QY7 A;  5GQO A;  3SVM A;  4AH6 A;  1VQA A;  2JA9 A;  4OWT B;  1N32 L;  2VL6 A;  4N8X 1;  4A3I B;  1XX8 A;  2K6A A;  2PCF B;  5ELE A;  1GJX A;  2MPM A;  4BBS G;  1F9Q A;  1G51 A;  3U58 A;  3K5L A;  2JYO A;  3ERQ A;  5BR8 L;  2N55 A;  2F0S A;  2TMP A;  4AYB G;  4CKE A;  4HR7 B;  1IBK Q;  1FNU A;  4A3L H;  4HTH A;  1F9S A;  3H0G B;  2R6G A;  1JQY D;  1E1O A;  4C3J H;  3KDF B;  3NEN A;  4IO9 A;  1GOZ A;  1OXU A;  1Q8I A;  4XIG S;  4DAP A;  2VNU D;  1K8G A;  1NR4 A;  1SFO H;  5CV9 A;  1EY6 A;  2KQ3 A;  2E5L Q;  1L0W A;  3GTK B;  3T1Y L;  1RIP A;  1YNJ D;  4RGN A;  3NTK A;  2ZJQ A;  1Z47 A;  1VQF A;  1IXR A;  2LXJ A;  1SN8 A;  1BF4 A;  1HPC A;  2F1M A;  2BA1 A;  4FF1 A;  1TWF B;  2Z4I A;  2MFI A;  1YJ9 A;  2A19 A;  1GHK A;  4CHT B;  5ELF A;  4K5X A;  5E1F A;  1SE3 A;  2I07 B;  1BUV T;  1N33 L;  3F1Z A;  4J6H A;  3E9H A;  2XNA C;  3DUZ A;  3I72 A;  4H02 A;  4K6L A;  1PZJ D;  1RHP A;  5DM6 3;  3H3V I;  1C8C A;  3QWN A;  1WCM H;  2JA5 B;  2IX3 A;  2C9O A;  2Q8T A;  3UDI A;  1VQ9 A;  1GO3 E;  2F4V Q;  1EQQ A;  4POF A;  1OXS C;  1ZKO A;  4HAE A;  3SHL A;  3J7Z C;  1F2M A;  3CCJ A;  1HR0 L;  4X64 Q;  5M5Y B;  2PMZ E;  1TXY A;  3N6R A;  1LUZ A;  2DJF C;  1LM0 A;  1B53 A;  3CPF A;  3STB D;  2QIL A;  4XQJ A;  1C48 A;  1XNR L;  4DV5 Q;  3S16 H;  4DR7 Q;  1XTD A;  3PQI A;  1X32 A;  4IUV A;  2L55 A;  2BDO A;  2RBM A;  5GAD C;  2WAC A;  2HHH L;  2F0U A;  4B9W A;  1IBL L;  1UEA B;  2F52 A;  4NXN L;  5KND A;  5C3E G;  1KDC A;  3QJY A;  3IFD A;  4LF7 Q;  1XJV A;  1CQF A;  1XMO L;  3MVV A;  5M3F B;  2XSC A;  4KHV A;  1Y8N B;  3CC4 A;  2EZV A;  1N34 Q;  4JI6 Q;  2HUG A;  2JA6 B;  4ZUJ A;  1WTW A;  3AU7 A;  1O7I A;  1U5K A;  1STN A;  4O2D A;  3I4M H;  2KA7 A;  1FYC A;  1EEI D;  2AKW B;  1I94 Q;  1U4R A;  2WKC A;  1K8O A;  5IGG A;  1DGS A;  4JI2 L;  1RF2 D;  2WP8 J;  1VQO A;  2AWN A;  5AJ3 L;  3Q22 A;  1SYF A;  1SEB D;  2R7F A;  4KD3 A;  3OW2 A;  1Y1W H;  3PF4 A;  4DA2 A;  1YNX A;  1YIT A;  2MO0 A;  2D2C C;  3MC0 B;  4ZK9 B;  1RL2 A;  1VDZ A;  5M5W B;  5FO9 B;  1HUM A;  1YNJ C;  1GUN A;  2F3V A;  3NBH A;  2HDL A;  4L6T B;  4CJ0 B;  4HID A;  3T56 B;  1U4L A;  1XNQ Q;  4JYA L;  4HJA A;  1TY2 A;  3A7L A;  2E2D C;  5IWA L;  3S2D H;  1PXU A;  3CC7 A;  2K5D A;  4A3J G;  3S9W A;  3KDF A;  4K2K A;  2XN9 C;  5T1G A;  5HUR A;  4DK3 C;  4XXE A;  1EFI D;  4X66 L;  3CHB D;  1PZK D;  4L5R C;  3GTO H;  2D62 A;  2Q2I A;  1GUT A;  1JMC A;  2XTI A;  1EY8 A;  4O42 A;  4RGM A;  2O5I C;  4K0K L;  3KLR A;  5E4X A;  4BA2 I;  3S1Q B;  5IT9 E;  1QVG A;  3CRL C;  5E7N A;  5JJZ A;  3S15 B;  1X3Q A;  1YNN C;  4Z9C B;  4GZY C;  1SBB B;  3TSS A;  4X65 L;  5C4X H;  2D9U A;  2KEC A;  4C3J G;  1VQ6 A;  2D0P A;  2MQH A;  2WAQ G;  3P20 A;  4KKT A;  1UE6 A;  3STB C;  5J22 A;  3ITP A;  2MP1 A;  1YVC A;  4BXX H;  3CCS A;  3CPW A;  1MHW C;  3RZD H;  1SRU A;  1X54 A;  1LLR D;  1QG7 A;  2SNM A;  2R3Z A;  4XYO A;  1Q12 A;  1HNX L;  4GNX B;  1A2U A;  4H0L C;  2RSN A;  5DAU A;  1K8A C;  4JOI A;  4IPG A;  3O13 A;  5KIX A;  5C5L A;  1HNZ L;  3HKZ B;  1SYE A;  4B3T Q;  5C0X H;  5H1S E;  4HMJ A;  2YTY A;  3S1N B;  4B3M Q;  1Y8O B;  4XYQ A;  4KY7 A;  3HOU H;  1PH7 A;  2RHQ B;  2FHT A;  5EAY A;  2JEA I;  3M4Q A;  4EX5 A;  2UUA L;  1CTM A;  1TWH B;  2IPK D;  2LMC B;  4A93 G;  2EJF C;  4DXG A;  4Q0F A;  4UP8 A;  3K5N A;  4GOP B;  3S2H H;  1FJG L;  1JJG A;  5E3F A;  1B4O A;  2A68 C;  2A6E C;  1NAP A;  4XQQ A;  2SDF A;  1QVC A;  2Z6K A;  1FVI A;  4JBW A;  1VQ7 A;  1LTR D;  5JEA H;  2JA7 H;  3S14 B;  4OO1 I;  4JPB W;  1KC8 C;  4OEL B;  5FO8 B;  1EU4 A;  3ZJY C;  5GAE C;  1D2B A;  1WTP A;  4R8N A;  1A3V A;  4AQY L;  1CKN B;  2YU9 H;  4HMI A;  3BVM A;  5I2X A;  4N9P A;  3V2T A;  1K9M C;  1TQO A;  1PYW D;  4CBV A;  4JI1 Q;  2XRQ D;  1WYD A;  2IHF A;  3CAM A;  4LF6 Q;  1QWY A;  3Q0A A;  1G6Z A;  1G8Z D;  3T13 A;  3I4M G;  3PMF A;  3WOE A;  2ES2 A;  3HOW G;  4GKJ Q;  3HG9 A;  4NMZ A;  3LWU A;  4HJ5 A;  4GLV B;  1RTO A;  2CW0 D;  5EQ0 A;  4HIK A;  1KAW A;  1EWH A;  1PH6 A;  3FKI B;  4F88 A;  1GKH A;  1BQQ T;  4DV4 L;  1Y1W G;  2PPB C;  3M4O H;  1IYU A;  1X55 A;  4MNO A;  2N78 A;  2HIX A;  2OWO A;  4A3C H;  1NE3 A;  4YCV A;  2B29 A;  4YIJ A;  2Z1C A;  2FXQ A;  2J4X A;  4B3R Q;  1I6H B;  2PYK A;  2EYO A;  5JEA J;  4GN3 B;  1EL0 A;  4A3J B;  2WB1 B;  3I56 A;  4LFC Q;  1F9P A;  4NP5 A;  4BY7 B;  4O0A A;  3GTL H;  4LF9 Q;  4Q5V A;  5DLQ E;  4QQB X;  4DR3 Q;  1IW7 C;  4LF8 Q;  2G9D A;  1SNO A;  1S5B D;  1SJH D;  3GTP H;  2ENB A;  3T53 B;  2RCN A;  3OTO Q;  4A3K G;  4JI0 L;  1SNQ A;  2BCO A;  3A54 A;  3JAM i;  2R93 G;  2FFK B;  1VQE A;  1H9S A;  2EIF A;  4ZAI A;  1KTK A;  3VDY A;  5LL6 S;  3BJU A;  3P1H A;  4C3J B;  1C7Y A;  1CHP D;  2WAQ B;  1MSH A;  1PTO D;  2H5X A;  3EBE A;  3S1M H;  5JAV A;  3VYT A;  5FLX E;  1JWU D;  1SFO B;  3HFZ B;  4DV1 Q;  2NN6 I;  1X3F A;  5FKA C;  4LFA Q;  5C4X G;  4RKL A;  5A2Q L;  2Q2H A;  3PUZ A;  3VA5 A;  4B9X A;  1B3Q A;  3SK4 A;  4JI3 Q;  5EJW A;  3OIQ A;  1LAC A;  3MEF A;  4HN7 A;  4BS9 A;  1HRJ A;  4BXX G;  2ATW A;  3MAQ A;  1EEF D;  2JEB I;  2B2W A;  1RCV D;  1EU3 A;  3K7A H;  2G9H D;  2MGS A;  4YCW A;  1QUQ A;  2RF4 A;  4CKC A;  4DR5 Q;  2KVM A;  2K7V A;  2CQO A;  2EDG A;  1C4Q A;  4PMB A;  1VQP A;  2VQF Q;  3C46 A;  4LNQ A;  4DV6 Q;  4DR4 Q;  1BCP D;  1WCM B;  2LXK A;  3J81 i;  1IBK L;  3NWS A;  2F0E A;  1LT4 D;  4G57 A;  1LYL A;  2CFM A;  5C0X G;  2VS1 A;  1PH5 A;  2A1A A;  4FDB A;  2LFN A;  5CV8 A;  2RCF A;  4FP5 D;  1K83 H;  1KLU D;  3OIP A;  1QZH A;  1YEZ A;  3AB9 A;  1RKN A;  3Q23 A;  1A2T A;  3I8Z A;  1V9P A;  2E5L L;  2XGT A;  1E2Z A;  3NBI A;  2Q2U A;  3T51 B;  2EJG C;  4YHH Q;  1HXY D;  1SE8 A;  3S16 B;  3UDF A;  1CKN A;  1UE1 A;  4EVO A;  1JIC A;  1AH9 A;  1GUO A;  1JC7 A;  2JN4 A;  4G7O C;  1H9J A;  2CH4 A;  2WFW A;  1VQ8 A;  1C9O A;  4ZUI A;  3ERS X;  2K05 A;  2EY5 A;  3FP9 A;  1E3P A;  1BDO A;  4DV0 Q;  1GD7 A;  1SND A;  2ZJR A;  1PFB A;  1M4V A;  4KI0 A;  4C3H H;  5JEA G;  2JA7 G;  4L5Q A;  4HIO A;  1PMR A;  5C3W A;  4L8J A;  4HED A;  3LNN A;  4LUV A;  4LF5 Q;  1H9M A;  3K6O A;  3VR3 A;  1E0B A;  4LFB Q;  4BBR H;  2F4V L;  1LO5 D;  4F8M A;  1Z9F A;  4OWW B;  1I50 H;  3TME A;  5C4H A;  4IPH A;  1R4P B;  1Q81 C;  3I4M B;  3HRZ C;  1Q82 C;  1PYB A;  4X64 L;  4LAA A;  4KHP Q;  1STB A;  4UP9 A;  1WTR A;  4H44 C;  3UI2 A;  1J8I A;  1SNP A;  1EYA A;  4XT3 B;  4BY1 H;  3R2T A;  4DV5 L;  4DR7 L;  3E6Z X;  3G48 A;  2YV5 A;  1OXV A;  2D5D A;  1SMX A;  1N36 Q;  1Y1W B;  3KUP A;  1L1O A;  2D0O A;  1MD2 D;  4ALP A;  1ROD A;  3RR5 A;  4QL5 A;  1TKW B;  4LF7 L;  3DM3 A;  3CU7 A;  5F2D A;  1D5M C;  3K5M A;  3NK9 A;  2F0K A;  1O7Z A;  1CQV A;  3PO3 H;  4N9T A;  5IP7 H;  2XVS A;  2J7Z A;  4A3C G;  1NSN S;  2PI2 A;  2MHV A;  2LY7 A;  4AYB E;  2HIV A;  1N34 L;  1YHQ A;  5FOB B;  1U0L A;  5IOC A;  5ELC A;  3S2D B;  4JI6 L;  3K80 C;  4R4O A;  1PH4 A;  4KMU C;  3PV0 A;  4J15 A;  3OOC A;  4YCU A;  3PIP A;  3QO2 A;  1JWM D;  3TP8 A;  4IUN A;  2K75 A;  5D65 A;  3GTO B;  1EYG A;  2K1B A;  3SK8 A;  4H13 C;  4JV5 Q;  2R93 B;  3OW7 A;  3G6J B;  1I94 L;  1STA A;  5IYB H;  3SEB A;  2PQE A;  3K0Y A;  1PTO F;  4A3E H;  3M7N A;  5GRO A;  3QG1 A;  1R4Q B;  2TSS A;  3W3A A;  3NE5 B;  2F0I A;  2KHS A;  1PH1 A;  3QOJ A;  5C4X B;  4NB3 A;  1V1P A;  1KQS A;  2EOT A;  5ELO A;  2F0J A;  2V4D A;  4RCO A;  1W2B A;  4JI4 Q;  4KJO A;  3HOY H;  2K28 A;  2AUK A;  2QF7 A;  2QA4 A;  4KD4 A;  3VR2 A;  3FPU B;  4JCV E;  2PO4 A;  4C1N K;  4OL7 A;  3DHQ A;  1XNQ L;  2FJ2 A;  1TS5 A;  1S4Z A;  1EY9 A;  2IL8 A;  1K0S A;  1I4P A;  4L5T A;  1XMQ Q;  2E2H H;  1ENA A;  4R4C A;  3RZD B;  3UDX A;  1NY4 A;  3C2P A;  3H3V H;  4GKK Q;  3S24 A;  5IY0 A;  4ZQ3 A;  5JJK A;  1X3E A;  5I4D A;  1TII D;  1F2L A;  4IJH A;  2QCP X;  1BCP F;  3NBH B;  2X6L A;  4DK1 A;  4RG1 A;  3EJI A;  3OYY A;  3H15 A;  3URY A;  3M7G A;  1TY0 A;  1KRS A;  3HOU B;  4X3K A;  1Y1V H;  1CZG A;  2AMC B;  1IYV A;  1I4Q A;  2E2I H;  1LT3 D;  2NTS A;  1SE4 A;  3TN2 A;  1XYI A;  4RKB A;  2SEB D;  5IT9 L;  1N8R C;  1I6V C;  3I55 A;  2QW7 A;  2YTV A;  2JK8 A;  1EY5 A;  1WTQ A;  1CZW A;  5FK9 C;  4WJ3 M;  5CBE E;  4MN3 A;  3S2H B;  2K03 A;  3FRP B;  2B2U A;  2OEO A;  1HHV A;  1ET9 A;  1WI5 A;  2F0W A;  1SMY D;  3D3R A;  2UXB Q;  1DZ1 A;  1XWE A;  2B8G A;  1VMC A;  2PNR C;  3MXG A;  4QMG A;  3E9I A;  2JA7 B;  4QB4 A;  3DEO A;  2X6G A;  1SYC A;  4R8I A;  5C3X A;  5IYD H;  1QVF A;  2JXM B;  4B3T L;  3D8G A;  4C3H G;  3CW2 C;  5M5X B;  1EY0 A;  4C2M H;  5M3M H;  2YU9 B;  1S3O A;  1FL0 A;  4B3M L;  3NHH A;  3HKZ G;  1M8A A;  4C1N I;  3WDN A;  1DCZ A;  2F0G A;  4PQX A;  4YWM A;  3J80 i;  1WVL A;  4JW0 A;  4ZKB B;  2E2J H;  3K8A A;  1YNN D;  4BBR G;  2L9H A;  3MXP A;  2Z6K C;  4B08 A;  3OMG A;  4R9W A;  5HY6 A;  3ICE A;  3NEM A;  4A3B H;  3KF8 B;  1D6E C;  5AFW A;  2BOS A;  1Q3L A;  1X3G A;  2R92 H;  3GP7 A;  4I7A A;  3CCQ A;  1STY A;  2R61 A;  2K5V A;  2PZW A;  3K57 A;  2RVL A;  3HOV G;  1GHJ A;  3TRE A;  1QCB D;  2L15 A;  1B1Z A;  3VYS A;  2M9V A;  2UUC Q;  5EPL A;  3M4O B;  5EPJ A;  4IPD A;  5BN3 A;  1GM5 A;  1I4X A;  4MIU A;  3OHX C;  3DXJ C;  4S3S A;  2NTT A;  3JAM L;  4V19 0;  4ZKC B;  2C5C A;  3PO3 G;  2Q8R E;  1B3A A;  3K5O A;  5ELB A;  1EFW A;  1Q46 A;  1R9T H;  2EYL A;  5CV5 A;  3NUC A;  1ILP A;  3GTL B;  3UE0 A;  3IAY A;  4JBJ A;  4MTN A;  5I6Y A;  3CCU A;  4WFN 3;  4A4I A;  2HQE A;  2WAQ E;  4JI1 L;  3M4P A;  3W2D A;  2Y0S E;  1M90 C;  2C35 B;  3GTP B;  4LF6 L;  3IKJ A;  4X3U A;  1EWC A;  1EYD A;  2NZ1 D;  4QIW B;  4GKJ L;  1LT5 D;  1H95 A;  5IYB G;  1Q1B A;  3FVQ A;  1RJT A;  4I7Z C;  3PUV A;  1BBW A;  4G7Z C;  3OWF A;  3S1M B;  4OIK A;  4QCL A;  5EBC A;  5C6A A;  5CBA E;  5CR3 A;  1OXX K;  3DLL A;  2A68 D;  2A6E D;  1ONL A;  3PIO 3;  3F2B A;  3FKI G;  4TSS A;  3PO2 H;  1P16 A;  4ZLT F;  1PRT B;  5TSS A;  4B3R L;  5BN5 A;  4ODG A;  3BDC A;  2EY6 A;  3J81 L;  1O80 A;  1SMY C;  1T5E A;  2WII B;  3B6Y A;  1K3B C;  4OHJ A;  5CYU A;  4LFC L;  2JSO A;  3WWV A;  3K7A B;  1UNS A;  1IKL A;  3C1F A;  2AHO B;  2L11 A;  4LF9 L;  2WB1 G;  2EPB A;  2E8G A;  3EVQ A;  4ME3 A;  4DR3 L;  3R8B A;  4LF8 L;  4BY7 G;  1RDP D;  1E7Z A;  1Y69 U;  3OTO L;  2WIN B;  4GNX C;  4GN5 A;  5LMU Q;  3TZD A;  1II3 A;  1L0X B;  1BR9 A;  4F87 A;  4QUF A;  3EA6 A;  4DPG A;  4A3L G;  5I9P A;  2B2W C;  1L0Y B;  1K83 B;  4FF2 A;  1Y1V G;  2F3I A;  1GVP A;  1EIF A;  3DWQ A;  4KV6 A;  4DV1 L;  4L63 B;  4LFA L;  2OTL A;  2NVQ H;  1EQV A;  3I7F A;  2UU9 Q;  2AQ1 B;  5ELN A;  2V1C C;  5CGK A;  1AN8 A;  3T16 A;  3F2C A;  4EQN A;  4HIM A;  4OO1 H;  4JI3 L;  3DWP A;  2A6H C;  4DNR B;  5FLX L;  1H9S B;  3BVG A;  1PTO H;  4GOP C;  4X62 Q;  3W5O A;  4OEM B;  4JI5 Q;  3LX0 A;  5KGU A;  1VQH A;  4CDF C;  4K2L A;  2RDF A;  1IBM Q;  1U9R A;  5IIF A;  4DGZ A;  3PSI A;  4JBM A;  4Y7N H;  3H91 A;  4CDD C;  1IKM A;  4K8J A;  3AYH B;  1PFN A;  4C3H B;  1IW7 D;  2K33 A;  3KF8 A;  4DR5 L;  1JWS D;  2MJ8 A;  2KBN A;  3D0F A;  3EN2 A;  5G3L D;  2VQF L;  4NPS A;  4DV6 L;  5CMD A;  4DR4 L;  1HTP A;  2K5N A;  2R7Z H;  3R93 A;  3L3O C;  2H1E A;  2ID0 A;  3FMC A;  3W1B A;  4BBR B;  5M3M G;  1WCM G;  5A35 A;  1JOO A;  2QDB A;  2WV6 D;  3BYT B;  1I50 B;  5LL6 X;  4MHE A;  1A0I A;  4ABN A;  1QUQ B;  2HD3 A;  2DY8 A;  4QF4 A;  3IFT A;  2DN8 A;  4DU9 A;  4YHH L;  3HOV B;  4EQO A;  5KYL A;  4BY1 B;  3OSO A;  1HTL D;  2ALY B;  3GD7 A;  5C5M A;  2R92 G;  1IYJ B;  4X3S A;  4U67 3;  1PFM A;  1I3Q H;  3Q6S A;  4K5W A;  1DON A;  5KNB A;  4OX9 Q;  5C4Z A;  2NUC A;  3I70 A;  2MNA A;  1SLJ A;  3ND9 A;  2HCI A;  4CDC C;  2ICE C;  4R4T A;  3L2P A;  3PO3 B;  4DV0 L;  3M3Y H;  4XQN A;  3KLS X;  2NBF A;  1VQK A;  4KJN A;  4TRD A;  1KRT A;  2AWO A;  1CHQ D;  1F2Z A;  2L5T A;  3GV6 A;  2EXZ A;  4LF5 L;  1EYC A;  4LF4 Q;  1CUK A;  3GQB A;  4H7B A;  4DUY Q;  1TT2 A;  1TWF H;  5EPK A;  4NKL A;  2JA8 H;  4LFB L;  4DR6 Q;  1F77 A;  5C0X J;  3AEV A;  1MGS A;  3BZD B;  1MSG A;  4R1J A;  2A69 D;  1S5D D;  3CF5 A;  2EYP A;  1LTG D;  3DM1 A;  5IGC A;  4MTK A;  4KHP L;  2NN6 H;  1D5X C;  4IZ8 A;  4A3E B;  1BOS A;  1UUP A;  2IX0 A;  2F0T A;  1HA5 A;  1HUN A;  2F0Q A;  1UE7 A;  1JJ2 A;  1N36 L;  4OIJ A;  1D5Z C;  2DGY A;  3I73 A;  4DUZ Q;  1AEX A;  3S17 H;  1STH A;  1AFP A;  3F8T A;  3HOY B;  3PIP 3;  4RH6 A;  5ISR A;  1XPU A;  5FJ8 H;  1V8Q A;  4UAI A;  1A6X A;  2IHE A;  1A15 A;  1H9K A;  1ZYR C;  1O7L A;  1PYS B;  5LMN Q;  1HZA A;  5EKI A;  2E2H B;  3ONA B;  2CKZ B;  1LTS D;  4JK1 C;  1VQN A;  1TU2 B;  4ILW A;  2HQL A;  4IUQ A;  1L1O B;  3RMH A;  2HT1 A;  1HH2 P;  3ERO A;  4JBK A;  2MUY A;  2RSO A;  1VS0 A;  1YI2 A;  1WJJ A;  3H09 A;  4JI8 Q;  3OMC A;  4JV5 L;  2OTJ A;  1FNV A;  5T1I A;  2F0V A;  1AW7 A;  5HGQ A;  1PZI D;  2IWH A;  2B2T A;  4IOC A;  1BVS A;  1SJE D;  1Y1V B;  1TWC H;  2B2V A;  3J7A F;  1F2Y A;  2YYZ A;  3JAM c;  3NXW A;  2E2I B;  2LS0 1;  5GAH C;  4K6D A;  1PHJ A;  2HDM A;  3I90 A;  4R4Q A;  5NUC A;  4JI4 L;  4LWC A;  1YHA A;  4GS3 A;  3KJO A;  1W3S A;  1B50 A;  3PCO B;  3GTG H;  2CCZ A;  4EGV A;  1EWI A;  3KFU A;  4JG2 A;  2LSS A;  4PZ8 A;  5J39 A;  4L5S A;  4YWL A;  1IHZ A;  3TS2 A;  3IRB A;  1XMQ L;  4OO1 G;  1NJI C;  2B39 A;  3H6M A;  1VQL A;  3J80 L;  2GA4 B;  1V1Q A;  1V1P B;  4GKK L;  1A8V A;  2K52 A;  5G3L F;  1LV9 A;  1KIX A;  1CT1 D;  2I46 A;  2YTX A;  3RN5 A;  3J7A V;  1YHB A;  2K32 A;  2LKV A;  2VZA A;  3W1G A;  4C2M B;  1DOK A;  4IFD I;  5M3M B;  1OXT A;  3MZ5 A;  2VB3 X;  3M85 A;  4QJF A;  3CMA A;  3I2Z A;  2B2U C;  2A69 C;  3CP0 A;  4C3I H;  4LJZ C;  2R7Z G;  3FHW A;  2E2J B;  3J81 c;  2ZTD A;  3HOU G;  3TRZ A;  1PH9 A;  3QB3 A;  4ZCK A;  4BBS H;  1CSQ A;  2ZXR A;  4DV7 Q;  4A3B B;  5CV4 A;  1QNU A;  2O2L D;  2B8F A;  2E76 C;  2R92 B;  4DXF A;  1BO0 A;  4RAU C;  1HA6 A;  1YJW A;  2DNC A;  2IW3 A;  3OPO A;  4TVA B;  5LMN W;  4P73 A;  1DOM A;  4FXD A;  3NTH A;  1X65 A;  3BU2 A;  1J5E Q;  1W6K A;  3U4Z A;  2UXB L;  1SDF A;  4PNY A;  4K8I A;  2Q8I B;  4RFB A;  4P72 A;  5DM7 3;  2VXW A;  2IX1 A;  4IQZ A;  2ZTE A;  1AE2 A;  1NMF A;  2NVX H;  1Z7T A;  1GUS A;  2L12 A;  1PH8 A;  1ET6 A;  4ME5 A;  1R9T B;  1L2F A;  1XPR A;  1EUJ A;  1NNX A;  4WOR A;  1JCK B;  2N49 A;  1HNW Q;  4V0B A;  5DEH A;  2K5Q A;  4BA1 I;  1M1K C;  2IY5 B;  2IT1 A;  1Y14 B;  2BA0 A;  1PH2 A;  1NUC A;  2JA8 G;  4UHV A;  1JJC B;  4PV1 C;  3IL8 A;  3KOJ A;  4A3M H;  2NYZ D;  2N3S A;  1G6P A;  5KNC A;  1CKO A;  2B2Y A;  3E0E A;  3D6W A;  3D4R A;  1CA6 A;  4J8Q A;  2AQ3 B;  3N52 A;  4XT1 B;  4DNI A;  2QDL A;  2NN6 G;  2O5J C;  2JJQ A;  1CSP A;  1PLF A;  4MZ9 A;  1SXT A;  2PW5 A;  4BWG B;  2EYH A;  3R2I A;  2UUC L;  2F0P A;  3P7J A;  5I9O A;  3D4W A;  4M8A A;  3ULJ A;  1PVO A;  3TP6 A;  2NVT H;  3PO2 B;  2N88 A;  1TR5 A;  3CRK C;  5JVG 3;  4APV A;  4R4I A;  3SGI A;  1MJE A;  5FJ8 G;  2UUB Q;  4FO2 A;  1U4M A;  3ULL A;  4LW1 A;  4RCN A;  4RGO S;  3SXH A;  2OF1 A;  5IP9 H;  4TQU S;  2EY2 A;  2EXD A;  3HGB A;  5C3E H;  4YY3 Q;  2F03 A;  4C56 C;  1QOH A;  5CV6 A;  4DV3 Q;  1VQG A;  1I4R A;  1IL8 A;  2XIW A;  4DR2 Q;  2AUJ D;  1KAB A;  1IL2 A;  1KXL A;  1YIJ A;  3TEH B;  2RKS A;  3ULP A;  1I4G A;  1YBY A;  1KL9 A;  1D1K A;  2XWB B;  2AQ2 B;  4KN4 C;  3GTJ H;  2PNH A;  1OTC A;  2HCC A;  1FGU A;  1SNC A;  2RDH A;  2Z6B A;  1KLG D;  3HP3 A;  2QEX A;  5C4J H;  2NVQ B;  2PQA B;  1MIU A;  3D4D A;  1I4H A;  5IYC H;  2OCE A;  3KJP A;  3NWT A;  3MFG A;  1ICF B;  2RDG A;  1D1I A;  3PUX A;  1WFQ A;  2NB0 A;  1V43 A;  3TDQ A;  5JOB A;  1HQM C;  1PTO B;  3K7U C;  2UXC Q;  1A3T A;  3HKZ E;  2RHS B;  1PRT D;  3RLO A;  4IUR A;  1ASY A;  5IGD A;  1VQM A;  1BKB A;  4K5V A;  1N9W A;  2CWP A;  4Y7N B;  3PUW A;  4EQP A;  3K0X A;  1HFG A;  1GUW A;  2ZT9 C;  2A8V A;  1LTI D;  2KEE A;  5LMU L;  2R7Z B;  3KBX A;  4XTC S;  3BS1 A;  2QEJ C;  1V1O A;  3VA7 A;  1Q8K A;  2J0T D;  4JI7 Q;  1PDQ A;  3QR8 A;  4C3I G;  3CKI B;  4DAY B;  3GO5 A;  1KHI A;  3H94 A;  1O7Y A;  1P8L A;  1BCP B;  2UU9 L;  3MFY A;  1STE A;  3L7Z C;  4KTA A;  1YZ6 A;  5JJI A;  3X3N A;  4KLK A;  4G4K A;  4JOI C;  1QJO A;  3G7L A;  2I0Q A;  3CCM A;  4UP7 A;  3KYH C;  1I3Q B;  2WKD A;  4X62 L;  3CCR A;  1PFS A;  4JI5 L;  4A3D H;  1QIL A;  5JPM C;  4X6A H;  3HS0 C;  2EYF A;  1VF5 C;  2F0H A;  1IBM L;  1J6Q A;  5K36 H;  2E74 C;  1E2W A;  4A75 A;  2X69 A;  2GVB A;  3V05 A;  1SSO A;  4ID6 A;  3M3Y B;  1H9R A;  2NWG A;  1X56 A;  4PZ6 A;  3I3C A;  3HOZ H;  1FD7 D;  1G2T A;  4IPC A;  3VR6 A;  5C44 H;  1ESF A;  1D8L A;  5IOD A;  1S40 A;  1LT6 D;  2L0C A;  4B3S Q;  2XRS D;  1K3R A;  1STG A;  4DV2 Q;  2JA8 B;  4E6I A;  5JVH 3;  1LTA D;  2EVB A;  1JE5 A;  1T9H A;  1VQB A;  3FEW X;  5KEE A;  2KCC A;  3J80 c;  2ZM6 Q;  4A3M G;  3G4S A;  3NQT A;  1EZ8 A;  5KYI A;  3T1H Q;  1Y8P B;  2BH2 A;  5EKK A;  2K04 A;  3VYU A;  2VUM H;  1BBU A;  3SR1 A;  3DMU A;  3Q8D A;  2A6H D;  2OQ0 A;  4BY1 G;  2WB1 E;  3ND8 A;  4OX9 L;  3S17 B;  4ZYS A;  3CCE A;  3BDL A;  2UXD Q;  4A93 H;  2VW9 A;  3A56 A;  5M9O A;  1VMP A;  2FMC A;  3VYR A;  1A3U A;  2QKI C;  4LUO A;  1E2V A;  3MEH A;  5IE8 A;  3GTM H;  3RZO H;  2A73 B;  1WTX A;  1JOK A;  4UY8 C;  1PRT C;  4K14 A;  4CDE C;  2DNE A;  3M4Y A;  3CCL A;  3RUZ A;  3CCV A;  1J9O A;  1VF7 A;  3BG3 A;  2PI2 E;  3FDT A;  5IP7 G;  5FLM H;  4LF4 L;  2B63 H;  4NXM Q;  2B3G A;  3CQZ H;  4DUY L;  3GTQ H;  4PMW A;  1CI3 M;  1KNA A;  4DR6 L;  4DNT B;  5IP9 G;  2OT2 A;  2PQA A;  4CGY B;  1KDA A;  2VQE Q;  1LTT D;  4HCS A;  4CKB A;  2F3W A;  1X6O A;  1JB3 A;  3MXU A;  5E4W C;  4PZ7 A;  4P2C B;  2M00 A;  1S72 A;  1B44 D;  3X3M A;  1TWC B;  4IJL A;  5BN4 A;  4A3E G;  4A3F H;  4A3G H;  1FNW A;  1K8M A;  1NR2 A;  4NDX A;  2XWJ B;  4GLA C;  4DUZ L;  4WJ4 A;  1DYQ A;  2PW7 A;  1ZXT A;  3NP8 A;  4DR1 Q;  1DJR D;  2K5W A;  3GTG B;  5GAG C;  4WJW A;  3HOW H;  1S5C D;  2BE5 D;  4DN4 M;  1PRT F;  2CHB D;  3V96 A;  3HOY G;  5IYC G;  3KLW A;  4WRD A;  5LMN L;  4A3D G;  4P74 A;  3CD6 A;  1TWG H;  1XPO A;  2B2T C;  1LTL A;  5HGT A;  1CA5 A;  1IZ6 A;  2CH4 W;  4OXP A;  3RN2 A;  3J7A 5;  2F0N A;  3I91 A;  2B2V C;  1EOT A;  3MTS A;  1HZB A;  2VY3 A;  4DAY A;  4A76 A;  1D7Q A;  3Q24 A;  4JI8 L;  5K5P A;  1QE6 A;  2KEN A;  2NVY H;  4HSP A;  4M1U B;  3UDG A;  1G2S A;  1DM0 B;  1XTC D;  1WD1 A;  4IUU A;  1U4P A;  1T5X D;  1WTH A;  2KOL A;  2OXP A;  3GV3 A;  4C3I B;  4HJ9 A;  2I5H A;  4X3T A;  1MBY A;  4LUZ A;  4A3K H;  1K0R A;  1LTB D;  4BBS B;  3MXN B;  1N32 Q;  1NTG A;  4DFA A;  2KHJ A;  3GDE A;  2R93 H;  4F7X A;  4AYB B;  1MI2 A;  2BH8 A;  1JOQ A;  3HZX A;  4P71 A;  3A8I E;  4RA8 A;  5BR8 Q;  1UEB A;  1VQ5 A;  1GXD C;  4FXG C;  1Q86 C;  1ZYR D;  2R7D A;  1CM9 A;  1KNE A;  3G6E A;  1VQJ A;  1Q7Y C;  3SK5 A;  1AZP A;  4FVM A;  2GVA A;  3EFX D;  3I4N H;  2ICI A; 
#chains in the Genus database with same CATH homology
 1E24 A;  1WCM H;  4LF7 L;  3DM3 A;  2Y0S G;  3PO3 H;  5K36 G;  1TWC H;  3UDI A;  2YYZ A;  1VQ9 A;  3JAM c;  3T1Y Q;  1GO3 E;  5GAH C;  2F4V Q;  1EQQ A;  5IP7 H;  4A3C G;  1PHJ A;  3HOX H;  2PI2 A;  4POF A;  4R4Q A;  4AYB E;  2HIV A;  1N34 L;  1YHQ A;  1OXS C;  1U0L A;  5IYD G;  4JI4 L;  4LWC A;  3J7Z C;  3HOZ G;  1YHA A;  3BZK A;  3K80 C;  4GS3 A;  4R4O A;  2ZTC A;  1W3S A;  3KJO A;  5C44 G;  3CCJ A;  3PV0 A;  1PH4 A;  4J15 A;  3F2D A;  3PCO B;  1HR0 L;  3GTG H;  2CCZ A;  1EWI A;  1TWA H;  2PMZ E;  4X64 Q;  4YCU A;  1TXY A;  3KFU A;  1LUZ A;  1LM0 A;  3PIP A;  1MJC A;  4JG2 A;  3CPF A;  3STB D;  2LSS A;  4PZ8 A;  3S1R H;  1XNR L;  4L5S A;  2K75 A;  4YWL A;  1EYG A;  4DV5 Q;  3S16 H;  3TS2 A;  1N33 Q;  4PG3 A;  3IRB A;  1XMQ L;  4DR7 Q;  1XTD A;  2I5L X;  4JV5 Q;  4OO1 G;  1NJI C;  4DV7 L;  4AIM A;  3RLN A;  1NBW A;  1VQL A;  5GAD C;  1I94 L;  2HHH L;  5IYB H;  4A3I H;  1IBL L;  2F52 A;  1V1Q A;  4GKK L;  4A3B G;  1A8V A;  4NXN L;  4A3E H;  3M7N A;  5C3E G;  2K52 A;  5GRO A;  4LF7 Q;  1XJV A;  3BZC A;  1KIX A;  1XMO L;  2YTX A;  3RN5 A;  3H0G H;  1PH1 A;  1YHB A;  3RNU A;  1J5E L;  2VUM G;  4NB3 A;  1KQS A;  2VZA A;  3CC4 A;  3W1G A;  5ELO A;  1N34 Q;  4IFD I;  1OXT A;  1W2B A;  3M85 A;  4JI4 Q;  4JI6 Q;  3HOY H;  4QJF A;  3CMA A;  3I2Z A;  1HR0 Q;  2K14 A;  2QA4 A;  3CP0 A;  3AQQ A;  4C3I H;  2R7Z G;  4JCV E;  1O7I A;  3GTK H;  3FHW A;  4DR4 L;  2K50 A;  3J81 c;  2ZTD A;  1XNQ L;  1XNR Q;  3HOU G;  3TRZ A;  1PH9 A;  1U5K A;  2DUD A;  4L5T A;  1XMQ Q;  1B7Y B;  4O2D A;  2E2H H;  4R4C A;  4BBS H;  1CSQ A;  5IT9 c;  4DV7 Q;  3I4M H;  1HNW L;  3UDX A;  1NY4 A;  2AKW B;  2HHH Q;  1HJP A;  1I94 Q;  1A62 A;  5FLM G;  3H3V H;  1IBL Q;  3PGZ A;  2B63 G;  1VQI A;  1L1O C;  1DGS A;  1HZC A;  3S24 A;  5IY0 A;  1YJW A;  4JI2 L;  4NXN Q;  1X3E A;  4GKK Q;  5JJK A;  2WP8 J;  5JJL A;  4IJH A;  4TVA B;  5LMN W;  4P73 A;  4DK6 C;  3TQY A;  2AWN A;  5AJ3 L;  1VQO A;  1XMO Q;  3NBH B;  1X65 A;  3BU2 A;  2R7F A;  3OW2 A;  1Y1W H;  1VCI A;  1J5E Q;  3U4Z A;  3PF4 A;  2UXB L;  4RG1 A;  1YNX A;  1YIT A;  3ER0 A;  2MO0 A;  3OYY A;  2CWA A;  4P72 A;  3H15 A;  4POG A;  1RL2 A;  1SR3 A;  5M5X H;  2NZH A;  5J3B A;  1PV4 A;  2IX1 A;  1VQC A;  1KRS A;  2JA5 H;  3KF6 B;  2ZTE A;  1AE2 A;  1NMF A;  2NVX H;  1Y1V H;  2AMC B;  2JQO A;  4HID A;  2E2I H;  1PH8 A;  4A3F G;  1XNQ Q;  4JYA L;  4HJA A;  4A3G G;  1L2F A;  5IWA L;  1XPR A;  1EUJ A;  3S2D H;  2N49 A;  1HNW Q;  4RMF A;  5C0X I;  3CC7 A;  1M1K C;  4BA1 I;  4A3J G;  1N8R C;  3I55 A;  3KDF A;  5M5Y H;  2IY5 B;  2YTV A;  2IT1 A;  2JK8 A;  2UUB L;  2BA0 A;  1Y14 B;  1G29 1;  4DK3 C;  1PH2 A;  4JI2 Q;  2JA8 G;  1JJC B;  3PO2 G;  4WJ3 M;  4X66 L;  1SRO A;  3KOJ A;  3GTO H;  4L5R C;  2D62 A;  2Q2I A;  4A3M H;  2N3S A;  1G6P A;  1WI5 A;  5AJ3 Q;  1JMC A;  2XTI A;  1CKO A;  3E0E A;  1PH3 A;  4YY3 L;  2UXB Q;  4K0K L;  3E9I A;  4DV3 L;  1HZ9 A;  3UE1 A;  4DNI A;  1K73 C;  4BA2 I;  1B8A A;  2NN6 G;  1QVG A;  5E7N A;  2JJQ A;  4DR2 L;  1CSP A;  4MZ9 A;  4EQ5 A;  5IYD H;  1QVF A;  2JE6 I;  5M3F H;  4X65 L;  5C4X H;  2UUC L;  4JYA Q;  4OON A;  4B3T L;  3CW2 C;  5IWA Q;  4C2M H;  3ULJ A;  1VQ6 A;  2D0P A;  2MQH A;  2WAQ G;  5M3M H;  1PVO A;  2NVT H;  1S3O A;  1FL0 A;  1UE6 A;  1KD1 C;  3STB C;  1JB7 A;  4B3M L;  2JA6 H;  3HKZ G;  3K81 C;  4APV A;  4R4I A;  3J80 i;  3SGI A;  4YWM A;  1MJE A;  1YVC A;  3PIO A;  5FJ8 G;  2UUB Q;  2E2J H;  3K8A A;  4BXX H;  3CCS A;  3ULL A;  4X66 Q;  4BBR G;  4P75 A;  4LW1 A;  2Z6K C;  3ICE A;  5HY6 A;  3NEM A;  3CPW A;  5IP9 H;  4A3B H;  4TQU S;  3RZD H;  2EXD A;  1HR0 W;  1SRU A;  1X54 A;  3KF8 B;  5C3E H;  4YY3 Q;  4K0K Q;  1X3G A;  2R92 H;  4DV3 Q;  1VQG A;  3CCQ A;  2UXC L;  2K5H A;  2K5V A;  1Q12 A;  3JC6 6;  1HNX L;  1ASZ A;  3HOV G;  3AFQ A;  4DR2 Q;  3TRE A;  4GNX B;  2L15 A;  1K8A C;  4JOI A;  4IPG A;  1IL2 A;  1YIJ A;  4X65 Q;  1KXL A;  2KHI A;  3L0O A;  3TEH B;  1HNZ L;  2UUC Q;  4B3T Q;  5H1S E;  3ULP A;  1YBY A;  4IPD A;  1KL9 A;  4JC0 A;  2YTY A;  5M5W H;  1GM5 A;  4GNX A;  4B3M Q;  3J81 j;  4IFD J;  3I4N G;  3HOU H;  3GTJ H;  1OTC A;  2PNH A;  4HJ8 A;  1FGU A;  1YJN A;  1PH7 A;  2RHQ B;  2Q2T A;  3PO3 G;  2UXD Q;  2QEX A;  5EAY A;  2JEA I;  1EFW A;  1Q46 A;  5C4J H;  1R9T H;  2PQA B;  1MIU A;  3M4Q A;  4KHZ A;  4EX5 A;  3HOX G;  2UUA L;  5IYC H;  2OCE A;  4A93 G;  3KJP A;  3UE0 A;  2Z0S A;  4JBJ A;  4MTN A;  3CCU A;  4Y52 H;  4JI7 L;  3PUX A;  1WFQ A;  1UWV A;  4A4I A;  1V43 A;  2WAQ E;  4JI1 L;  3M4P A;  3K7U C;  2UXC Q;  2Y0S E;  4UP8 A;  3S2H H;  4GOP B;  3HKZ E;  2RHS B;  2C35 B;  4DAM A;  1M90 C;  1HNX Q;  1FJG L;  1JJG A;  4LF6 L;  1VQD A;  3RLO A;  2KCM A;  3A5Z B;  1ASY A;  1VQM A;  3G71 A;  1BKB A;  1HNZ Q;  4GKJ L;  1QVC A;  2Z6K A;  2GN5 A;  1FVI A;  1H95 A;  1N9W A;  2CWP A;  2N8N A;  4JBW A;  5IYB G;  3CXC A;  1Q1B A;  4GOP A;  4A3I G;  1VQ7 A;  2KCT A;  2JA7 H;  4OO1 I;  3S1Q H;  1KC8 C;  3PUW A;  3PUV A;  1BBW A;  3ZJY C;  4IOA A;  5GAE C;  3S15 H;  3K0X A;  4HJ7 A;  2A8V A;  5LMU L;  3H0G G;  1OXX K;  3PUY A;  4XTC S;  1CKN B;  3DLL A;  4AQY L;  2UUA Q;  3F2B A;  2YU9 H;  3FKI G;  2I5M X;  3PO2 H;  1P16 A;  1Q8K A;  1K9M C;  4B3R L;  4JI7 Q;  4DAY B;  1X9N A;  4JI1 Q;  1WYD A;  3GO5 A;  1KHI A;  4B3S L;  3B6Y A;  3LGJ A;  3U50 C;  2IHF A;  1FJG Q;  1JT8 A;  4QIW E;  1P8L A;  3CAM A;  4LFC L;  3KF6 A;  4LF6 Q;  4DV2 L;  2UU9 L;  3L7Z C;  3WWV A;  1YZ6 A;  5JJI A;  2MO1 A;  4YWK A;  1NMG A;  2AHO B;  3I4M G;  1QZG A;  4LF9 L;  2WB1 G;  4KLK A;  4ME3 A;  2E8G A;  2ES2 A;  4DR3 L;  3HOW G;  4GKJ Q;  4JOI C;  5FLX c;  4LF8 L;  2ASB A;  4BY7 G;  4HJ5 A;  1EQR A;  2I0Q A;  4GLV B;  3CCM A;  1E7Z A;  4UP7 A;  3KYH C;  4QGU A;  3CCR A;  4X62 L;  4HIK A;  3OTO L;  2ZM6 L;  4JI6 L;  1KAW A;  1PFS A;  4GN5 A;  4JI5 L;  4GNX C;  4A3D H;  3T1H L;  1PH6 A;  3PF5 A;  4X6A H;  1IBM L;  5LMU Q;  1J6Q A;  1GKH A;  4DV4 L;  1Y1W G;  3D31 A;  3M4O H;  4A75 A;  3U4V A;  2GVB A;  4AQY Q;  1X55 A;  3AFP A;  4MNO A;  2N78 A;  3S1N H;  2HIX A;  2OWO A;  4A3C H;  1NE3 A;  4YCV A;  2B29 A;  1X56 A;  2FXQ A;  4DPG A;  4PZ6 A;  4B3R Q;  3A0J A;  3HOZ H;  4A3L G;  2JA5 G;  4IPC A;  5JEA J;  2NZO A;  5C44 H;  1Y1V G;  2F3I A;  4GN3 B;  1GVP A;  1D8L A;  4DKA C;  1S40 A;  1EIF A;  2UXD L;  4B3S Q;  4DV1 L;  4LFA L;  2OTL A;  3I56 A;  2NVQ H;  4LFC Q;  3I7F A;  1K3R A;  4DV2 Q;  2UU9 Q;  5ELN A;  2V1C C;  4O0A A;  2QGQ A;  1TWH H;  4GN4 B;  3GTL H;  3HKS A;  1JE5 A;  3F2C A;  1T9H A;  1VQB A;  4LF9 Q;  5DLQ E;  4HIM A;  3HOV H;  4QQB X;  4JI3 L;  4DR3 Q;  4LF8 Q;  3TS0 A;  4GOP C;  3GTP H;  3J80 c;  4NXM L;  4X62 Q;  3W5O A;  2RCN A;  3OTO Q;  2ZM6 Q;  4A3M G;  4A3K G;  3G4S A;  4JI0 L;  4JI5 Q;  1CKM A;  1VQH A;  3T1H Q;  1UE5 A;  3JAM i;  3A74 A;  1IBM Q;  2R93 G;  2BH2 A;  1VQE A;  1WOC A;  1I5F A;  3EIV A;  4DV4 Q;  1PA6 A;  2EIF A;  3PSI A;  4IFD G;  4JBM A;  4Y7N H;  3VDY A;  3S14 H;  2VUM H;  1BBU A;  3M9B A;  3AYH B;  2VQE L;  3Q8D A;  1Q1E A;  2OQ0 A;  3BJU A;  4BY1 G;  4DR5 L;  1C7Y A;  2WB1 E;  2H5X A;  2KBN A;  3D0F A;  3EBE A;  3EN2 A;  3S1M H;  4OX9 L;  3CCE A;  3CME A;  2VQF L;  4NPS A;  2OQK A;  2ZJP A;  4DV6 L;  2EQS A;  3HFZ B;  2K5N A;  5M3F G;  4DV1 Q;  2VW9 A;  2NN6 I;  2R7Z H;  1X3F A;  3NEL A;  4LFA Q;  4A93 H;  5C4X G;  2ID0 A;  2Q2H A;  3PUZ A;  4LUO A;  3W1B A;  5IE8 A;  5M3M G;  3GTM H;  1EOV A;  3RZO H;  1WCM G;  4UY8 C;  3RLF A;  2JA6 G;  1AE3 A;  4JI3 Q;  1A0I A;  3CCL A;  3CCV A;  4DR1 L;  1QUQ B;  3MEF A;  5IP7 G;  5FLM H;  2PI2 E;  1A63 A;  4LF4 L;  4UPA A;  2ATW A;  2B63 H;  4BXX G;  1C0A A;  4NXM Q;  2B3G A;  3CQZ H;  4DUY L;  3GTQ H;  2JEB I;  4PMW A;  4JI0 Q;  4DR6 L;  3K7A H;  4YHH L;  3CC2 A;  5IP9 G;  4YCW A;  1QUQ A;  2PQA A;  2RF4 A;  2ALY B;  3GD7 A;  2R92 G;  1IYJ B;  2VQE Q;  4DR5 Q;  1I3Q H;  1X6O A;  1VQ4 A;  2CQO A;  4OX9 Q;  1VQP A;  2VQF Q;  4PZ7 A;  3FKI H;  4LNQ A;  2MNA A;  4DV6 Q;  4DR4 Q;  1SLJ A;  2LXK A;  1S72 A;  3J81 i;  4R4T A;  3L2P A;  1IBK L;  4DV0 L;  1LYL A;  2CFM A;  4IJL A;  1E22 A;  2VS1 A;  5C0X G;  1MKH A;  4A3E G;  4A3F H;  1PH5 A;  3M3Y H;  2A1A A;  3I4O A;  4FDB A;  4A3G H;  1VQK A;  1KRT A;  4GLA C;  4OWX B;  4DUZ L;  1I6H H;  4WJ4 A;  2AWO A;  1K83 H;  1EIY B;  4DR1 Q;  3A5U A;  4A3J H;  1YEZ A;  4GLX A;  1QZH A;  4LF5 L;  4LF4 Q;  1CUK A;  5GAG C;  1V9P A;  4DUY Q;  2E5L L;  1TWF H;  3HOW H;  2XGT A;  2JA8 H;  4LFB L;  4BY7 H;  4DR6 Q;  1E1T A;  2Q2U A;  3HOY G;  5C0X J;  4YHH Q;  5IYC G;  3AEV A;  1B70 B;  3KLW A;  2K4K A;  4QY7 A;  4R1J A;  5GQO A;  1SE8 A;  4AH6 A;  3CF5 A;  5LMN L;  1VQA A;  2JA9 A;  4A3D G;  4OWT B;  1CKN A;  4P74 A;  3UDF A;  1UE1 A;  3CD6 A;  1TWG H;  1N32 L;  1XPO A;  1LTL A;  2VL6 A;  1IZ6 A;  1AH9 A;  4OXP A;  3RN2 A;  3J7A 5;  4KHP L;  2WFW A;  1VQ8 A;  4BBS G;  1G51 A;  1C9O A;  3U58 A;  1HZB A;  2VY3 A;  4A76 A;  3ERS X;  1D7Q A;  5BR8 L;  3FP9 A;  2IX0 A;  4AYB G;  1E3P A;  1IBK Q;  4JI8 L;  4DV0 Q;  4A3L H;  1GD7 A;  1UE7 A;  1JJ2 A;  1N36 L;  2ZJR A;  2KEN A;  2R6G A;  4KI0 A;  2NVY H;  4C3H H;  5JEA G;  2JA7 G;  3UDG A;  1E1O A;  4L5Q A;  3KDF B;  2DGY A;  4C3J H;  3NEN A;  4HIO A;  4DUZ Q;  4IO9 A;  1OXU A;  3S17 H;  4XIG S;  3F8T A;  2VNU D;  1K8G A;  1SFO H;  4LUV A;  4LF5 Q;  1XPU A;  4HJ9 A;  5FJ8 H;  2E5L Q;  1L0W A;  2I5H A;  4LFB Q;  2IHE A;  3T1Y L;  1RIP A;  4BBR H;  2F4V L;  1Z9F A;  1PYS B;  4LUZ A;  1I50 H;  5LMN Q;  1HZA A;  4IPH A;  4OWW B;  4A3K H;  1K0R A;  2ZJQ A;  1Z47 A;  1VQF A;  1Q81 C;  1IXR A;  2CKZ B;  2LXJ A;  1SN8 A;  1VQN A;  3MXN B;  1N32 Q;  2BA1 A;  1NTG A;  1Q82 C;  2KHJ A;  3GDE A;  2R93 H;  1PYB A;  4X64 L;  2MFI A;  4KHP Q;  1YJ9 A;  2HQL A;  2BH8 A;  1L1O B;  2A19 A;  4UP9 A;  4P71 A;  2HT1 A;  1HH2 P;  4JBK A;  5BR8 Q;  1UEB A;  1VS0 A;  1VQ5 A;  4BY1 H;  4DV5 L;  1YI2 A;  1WJJ A;  1N33 L;  3F1Z A;  4DR7 L;  4JI8 Q;  3G48 A;  1Q86 C;  2YV5 A;  1OXV A;  4JV5 L;  2OTJ A;  2R7D A;  1N36 Q;  1SMX A;  3E9H A;  1L1O A;  2D0O A;  4H02 A;  4ALP A;  3G6E A;  1VQJ A;  1Q7Y C;  5HGQ A;  3RR5 A;  4QL5 A;  2GVA A;  3H3V I;  4IOC A;  3I4N H;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...