1JT8A

Archaeal initiation factor-1a, aif-1a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSLATION INITIATION FACTOR 1A
publication title Structure and dynamics of translation initiation factor aIF-1A from the archaeon Methanococcus jannaschii determined by NMR spectroscopy
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jt8A00
1E22A 4YCWA 4LF6L 3PUXA 2I0QA 1JMCA 2Y0SE 4NPSA 3G6EA 2ZTDA 1TWAH 4IPGA 3HKZG 3L0OA 2UXDL 3K7UC 2WAQG 4A3KH 4BY7G 3CC7A 4AQYL 3HKZE 4A3FG 5C4XG 1YEZA 4P71A 3GTLH 2B3GA 1P16A 2D62A 2WAQE 5IE8A 4IFDI 1V1QA 3PUVA 5JJKA 5M3MH 1IBLL 4O0AA 5GAEC 3CCLA 1XNRQ 3L7ZC 2ALYB 1PYSB 1TWGH 2FXQA 1IBMQ 1N33L 2OQKA 1WCMH 2NVYH 4IOAA 3Q8DA 1B8AA 4OONA 4H02A 2KCMA 2ZJQA 2ATWA 1YI2A 3DLLA 4A3MG 5GADC 3I2ZA 4QL5A 1BBUA 3M85A 1HNXQ 1EWIA 1NY4A 2MQHA 3KF6B 3K7AH 3J7A5 1R9TH 3CQZH 2IT1A 1Q46A 5M5WH 1VQ8A 2YTYA 5IP7H 3RLFA 5GAGC 3AYHB 1CUKA 4JI1L 4C2MH 2V1CC 4A3IG 4QQBX 1P8LA 3TQYA 4A3CH 2D0OA 2N49A 2AMCB 3I7FA 3JC66 3STBD 5LMNQ 4DV6L 4GNXC 2MO1A 4R4QA 4IOCA 1VQPA 4DK3C 1CSQA 3W1GA 3MEFA 3PO2H 4DV1L 2I5HA 1Q12A 3K80C 1CKMA 4BA1I 1X65A 1XPOA 1XMQQ 2AKWB 5LMUL 1S40A 5JJIA 2K50A 1W2BA 1A62A 3ER0A 2NVXH 3PO3H 4X64Q 4JC0A 5FJ8G 2EQSA 4JI4L 4DUYQ 1KC8C 3I4OA 1MJCA 2Q2HA 3AQQA 3CP0A 1N32Q 3CC4A 2JA6G 3S2HH 4TQUS 4LF8Q 1VQ4A 1HZBA 4JOIC 1B7YB 4GOPB 3CCJA 4BY7H 2NZOA 2GVAA 3F8TA 1VQJA 4X65Q 4OX9Q 4A3FH 3UDIA 5C4XH 3KFUA 2CWPA 4LFAQ 1QUQB 2YV5A 2ZTCA 1AH9A 1L1OB 1H95A 3CCVA 1XMOL 2UUAL 2NZHA 3U4VA 5M5XH 3JAMi 4UPAA 1HNWL 1G6PA 2UUBL 1U5KA 3KOJA 4YY3Q 1SR3A 1TWHH 5GAHC 2WB1G 3ULPA 1KD1C 1LUZA 3DM3A 4BY1G 1FJGQ 2E2HH 3RLNA 5C0XI 3TRZA 4JI2L 1S72A 4BA2I 1HZ9A 1K0RA 2WB1E 4JCVE 1HZAA 4A3MH 5IYCG 1Q82C 1DGSA 5JEAG 1VQOA 1VQDA 5LMNW 4GLAC 4KHZA 4NXNL 1OXUA 2AWOA 3L2PA 1KIXA 2KHIA 3AFPA 2XTIA 5AJ3Q 4DV7Q 4LF5Q 2UXBL 1VQKA 1VS0A 4A3IH 1Y1VG 4DAYB 3S1RH 1X55A 2VNUD 3K0XA 4J15A 1MJEA 3IRBA 1L0WA 2F52A 3K8AA 3M4PA 4LF4Q 4IPHA 4B3RQ 2IY5B 4A3EG 1KXLA 1KHIA 3HOYG 3E9IA 2WP8J 4B3SQ 4UP8A 4HIDA 5FJ8H 3KJOA 1B70B 1Q1BA 1S3OA 4EX5A 5FLXc 1IBML 2BA1A 1Y1WG 4IFDG 1VQAA 1PV4A 2JA6H 1YJWA 2MO0A 2RCNA 1X9NA 1RIPA 2BA0A 3GTOH 1HNXL 4L5QA 5M3FG 4QGUA 2IHFA 4JI8Q 4DR2Q 3F2DA 1YHQA 1I94L 4XIGS 1ASZA 2ES2A 4DR7Q 2VQEQ 1QZGA 1L2FA 3T1HQ 3BZCA 1EIYB 3HFZB 4MTNA 2K52A 2MFIA 1N9WA 3M3YH 1VQHA 1JJCB 2B63G 4JBKA 1K9MC 4BY1H 1BKBA 4DV3Q 3FP9A 5LMNL 4GOPC 3FHWA 3UDFA 4L5RC 2F4VQ 5IYCH 1NTGA 1J5EQ 3OW2A 1PH1A 2NVTH 1L1OC 3D0FA 1XMQL 2Q2UA 2HQLA 2L15A 1J6QA 1SN8A 4DUZQ 1VQMA 1U0LA 4X64L 3TS0A 3RZDH 4DUYL 4HJAA 3H3VI 2A19A 1T9HA 4UP7A 1VCIA 3AFQA 5DLQE 2JJQA 1Y1VH 3MXNB 4LF9Q 1N32L 3F2CA 5JJLA 2EXDA 3A0JA 4LWCA 3I56A 4LF8L 2D0PA 4A3BG 4TVAB 4X65L 4OX9L 1WJJA 4NB3A 1Q7YC 3J81j 4A3GG 4K0KQ 4A3EH 3RLOA 2R7DA 4LFAL 3HOYH 4GKJQ 4RG1A 1GD7A 4DR4Q 3PV0A 4BXXG 3G71A 2I5LX 4JV5Q 1JJGA 5GQOA 1IBKQ 1W3SA 4YY3L 4R4CA 3S1NH 3GTPH 1Y1WH 1YJ9A 1XNQQ 4DR6L 3D31A 5EAYA 4JYAQ 4DK6C 1FJGL 1O7IA 4BBRG 3S1MH 1EQRA 1GM5A 1NBWA 5C44G 5M3FH 2K4KA 1CKNA 2IX1A 3S2DH 1LTLA 2AHOB 2E5LQ 1KL9A 1E7ZA 3LGJA 1PH3A 2LXKA 5AJ3L 4DV7L 1EQQA 4LF5L 1N34Q 3FKIG 5IWAL 4DAMA 4A3LG 1KQSA 1JE5A 2N78A 4PMWA 2B63H 3U58A 1YBYA 4P73A 1Q8KA 1FGUA 3G4SA 2NN6G 2OCEA 4JI3Q 3AEVA 3ICEA 5IT9c 4B3RL 1GVPA 4LF4L 1VQ9A 1I6HH 3CPFA 4JI7Q 1K3RA 1HNZQ 1OXVA 1HZCA 4QJFA 1SE8A 3KDFA 2MNAA 2N8NA 1D7QA 2R7FA 4MZ9A 4HJ8A 4YCUA 5C0XJ 4LNQA 1EFWA 3HOXG 1XPRA 3ULJA 4LUZA 2XGTA 1A63A 2K14A 4AYBG 1WOCA 5HGQA 3GTKH 4LFBQ 4A3BH 2JQOA 4L5TA 4AYBE 3ZJYC 4FDBA 5BR8L 3H15A 4WJ3M 5M5YH 4GNXA 4JI8L 4DR2L 4DR7L 4A3GH 2VQEL 3T1HL 4IJHA 1I50H 1VQ5A 3CMAA 4BXXH 1UE7A 2JK8A 4DR5Q 1MIUA 1QZHA 4IPCA 3HOZG 1Q81C 3G48A 3I4NH 1AE2A 1TWCH 3GO5A 4MNOA 4DV3L 3EN2A 3CC2A 1QVFA 4BBRH 4OO1G 2N3SA 2UXCQ 3JAMc 2BH8A 2GVBA 2ZTEA 3EBEA 4JI5Q 2E8GA 1X3FA 5C44H 1J5EL 2F4VL 3HOWG 4GKKQ 1Z47A 4JOIA 3W1BA 4ME3A 4PZ7A 4DUZL 4LW1A 2HHHL 3GDEA 3GTGH 4P75A 4HJ9A 1NE3A 3PIPA 4DV5Q 3FKIH 1PH8A 3GTQH 1LYLA 4A3LH 4L5SA 4LF9L 4UP9A 3PUYA 2CWAA 3UE0A 3CPWA 4A3CG 1GKHA 3M4OH 1AE3A 1I5FA 3H0GG 4RMFA 4C3IH 3CCSA 1C9OA 1CKOA 1KRTA 4LFCQ 4K0KL 1YHAA 2YYZA 4GKJL 4DR4L 2JE6I 3J80c 2OTLA 2PNHA 4JV5L 1IBKL 4HIMA 4X62Q 1XNRL 2R7ZG 3HOXH 3NENA 1XNQL 4B3TQ 1SMXA 2CFMA 2B29A 2DUDA 4JYAL 1CKNB 3M4QA 4DV4Q 1K8AC 3J7ZC 2Q2IA 1M90C 1PYBA 4PZ6A 4XTCS 4IJLA 1PVOA 4A93G 4POGA 1VQCA 1IXRA 1VQGA 3NBHB 3KYHC 3GTMH 3OYYA 3U4ZA 2E5LL 4ALPA 4DR1Q 3S17H 1UEBA 1N34L 2A8VA 4APVA 2ZM6Q 1VQ7A 2Z6KC 4AH6A 3HOZH 4JI6Q 4JI3L 1FVIA 2UU9Q 3CCMA 1HH2P 2E2IH 1C0AA 3KDFB 2F3IA 4YWLA 4LUOA 1YZ6A 4JI7L 1Q1EA 1V9PA 3J81i 1HNZL 1HR0Q 3HOWH 2AWNA 4HJ7A 1SROA 1A8VA 1Z9FA 1TWFH 1Y14B 2KCTA 3OTOQ 3PCOB 4JBWA 1YJNA 3HKSA 1PH7A 2OWOA 2HIXA 2RHQB 3ULLA 4A3DG 1EOVA 1Q86C 4LFBL 4O2DA 1UE6A 1X56A 4PG3A 1XPUA 1KAWA 1N8RC 3I4MG 2OQ0A 1X6OA 2A1AA 3H0GH 4JG2A 2LXJA 4B3MQ 4DNIA 4GOPA 4R4IA 3T1YQ 2UUAQ 5IYBG 1NJIC 2K5HA 4EQ5A 3F2BA 3RN5A 5IYDG 1IYJB 2R92G 1VQFA 1L1OA 2R6GA 1SRUA 3KF8B 4DR5L 3SGIA 3ERSX 3PF5A 1WFQA 1SFOH 1VQIA 4JBMA 2JA7G 4X6AH 2R7ZH 1HJPA 4GLXA 1YVCA 3E0EA 2WFWA 2UUCQ 4NXMQ 3E9HA 3I4NG 2UXCL 2I5MX 4JI5L 2PQAA 4A93H 4GKKL 3UDGA 3S15H 4UY8C 2UXBQ 1MKHA 4YHHQ 2JEAI 5C0XG 1LM0A 4GN3B 4QY7A 1HR0W 1VQEA 3S1QH 4DV5L 4LF7Q 1UE5A 4LUVA 1GO3E 1VQBA 2YTVA 2LSSA 1EIFA 2VZAA 5FLMG 1JT8A 4R4OA 2CCZA 2JEBI 2KENA 4DV0Q 2RF4A 4WJ4A 2CQOA 3BU2A 4JI0Q 2VQFQ 2ID0A 4LFCL 3PSIA 3A5UA 2NVQH 4A3JG 2IX0A 4X66Q 1X3GA 4OWWB 2JA8G 3A5ZB 3NEMA 4B3SL 2KHJA 3CMEA 4OWXB 1IL2A 4BBSG 4X62L 1PFSA 2VS1A 1EUJA 4B3TL 4A3DH 4Y52H 4DV4L 2R93G 1XJVA 3BZKA 4DR3Q 1I94Q 3I4MH 3EIVA 4GLVB 5ELNA 4YWMA 3CCUA 2VUMG 2ZJRA 4HIKA 2K5VA 1OTCA 5IYBH 2RHSB 4KHPQ 5IYDH 3HOVG 2R92H 5IY0A 4GS3A 4DV2Q 4DR1L 4IPDA 1QVCA 1JB7A 1E3PA 4YWKA 1WI5A 2JA7H 3TS2A 5IP9G 4P74A 3UE1A 2JA5G 2ZM6L 1UWVA 1PH6A 2ASBA 4JI6L 2UU9L 1N36Q 4C3JH 5C3EG 1FL0A 3CXCA 1PH4A 1VQNA 1IZ6A 4AIMA 4OXPA 2H5XA 2E2JH 1WYDA 1PA6A 3CCRA 1HR0L 2IHEA 4KLKA 2ZJPA 2HT1A 4R1JA 3TEHB 1E1OA 1KRSA 3OTOL 3RNUA 2YU9H 3UDXA 4LF6Q 3PUWA 1ASYA 2PMZE 3A74A 3CW2C 5E7NA 5FLMH 3KJPA 1V43A 3W5OA 2UXDQ 1A0IA 4B3ML 4AQYQ 4JBJA 4GN4B 2K5NA 3T1YL 3HOUG 3PGZA 4HIOA 4A3JH 5H1SE 1IBLQ 3RN2A 2JA8H 3KLWA 1YIJA 4DR6Q 1N33Q 1OXXK 2Z0SA 4POFA 3CCEA 1PH5A 4BBSH 1K8GA 1M1KC 3CAMA 1PH9A 4OWTB 1YITA 4YCVA 3U50C 2PQAB 5ELOA 2UUCL 2R93H 3PIOA 4NXML 2VUMH 1E1TA 1OXTA 2Q2TA 2CKZB 3TREA 3S24A 4YHHL 2NN6I 5IWAQ 3HOVH 4P72A 3RR5A 4A4IA 1YNXA 1UE1A 3KF6A 1OXSC 1YHBA 3B6YA 1X3EA 2C35B 2VY3A 3J80i 4JI1Q 1BVSA 5IP9H 1D8LA 3STBC 4DKAC 4Y7NH 3I55A 2JA5H 4LF7L 2BH2A 5C4JH 4DV6Q 1PH2A 4C3HH 4DV0L 1BBWA 1K73C 4A3KG 5C3EH 4DV1Q 3CCQA 1NMFA 4JI0L 2VQFL 3BJUA 5JEAJ 2GN5A 5LMUQ 5K36G 4DPGA 1X54A 3F1ZA 5M3MG 4X66L 3NELA 2VW9A 3VDYA 4JI4Q 3CF5A 1WCMG 2VL6A 1RL2A 5HY6A 3J81c 4R4TA 1G51A 5GROA 3WWVA 5BR8Q 1VQ6A 5J3BA 2EIFA 1E24A 2JA9A 4DR3L 2Z6KA 1CSPA 1TXYA 4GNXB 1NMGA 1SLJA 1PHJA 1JJ2A 3H3VH 2OTJA 3HOUH 2K75A 2PI2A 1QVGA 4OO1I 5IP7G 4KHPL 1XMOQ 4KI0A 4QIWE 3PUZA 4HJ5A 4DV2L 2KBNA 1C7YA 1EYGA 2QA4A 2UUBQ 3CD6A 1HNWQ 1QUQA 1I3QH 3RZOH 3M7NA 3PF4A 4IFDJ 3M9BA 3K81C 2DGYA 4JI2Q 2HIVA 1N36L 4PZ8A 4A76A 3GD7A 4IO9A 4A75A 1G291 2YTXA 3GTJH 1XTDA 3PO2G 1K83H 2QEXA 3S16H 1VQLA 2HHHQ 3PO3G 3S14H 2PI2E 2QGQA 4NXNQ 4GN5A 2Y0SG
chains in the Genus database with same CATH superfamily
1I3QB 3HS0C 4IUNA 3EROA 2K6AA 1JMCA 1R4PB 1LT4D 2KCNA 1TWAH 1EU4A 2EE1A 4IPGA 5J1ZA 3K58A 3L0OA 2FINB 2RQXA 3WOEA 5CBEE 3GTJB 4BY7G 2UXDL 5E4WC 3CC7A 1IL8A 2B3GA 1P16A 2WAQE 2XIWA 4K2LA 5IE8A 5EPLA 3GTLH 1GUSA 3T4AC 5M3MH 1ENFA 1H9MA 4O0AA 5FO7B 2FXQA 1TWGH 1IBMQ 3R2TA 1TWAB 3M4YA 3BG3A 3RUZA 2ZJQA 1YI2A 4FNFA 4BS9A 4QL5A 1HNXQ 3GTLB 1NY4A 3KF6B 3CQZH 1IW7D 5M3MB 2NZ1D 1TWGB 2FHTA 1PFNA 5GAGC 4C2MH 1Y69U 4QQBX 2RDGA 1NNXA 1I4RA 2AMCB 3JC66 2N49A 4ZKBB 1KABA 5BN5A 5LMNQ 4R4QA 1LO5D 4QIWB 3CQZB 1X65A 1S40A 5JJIA 4UDUC 5A35A 2E76C 4C2MB 2B8GA 3CP0A 1N32Q 4DXGA 3K5MA 4TQUS 3BVMA 4LF8Q 1VQ4A 5KYLA 3MXNA 5ELDA 2NZOA 3CCJA 1DOMA 5C4XH 4X3SA 3KFUA 4LFAQ 2YV5A 1AH9A 1PFMA 1U5KA 4ID6A 4YY3Q 1SR3A 3EA6A 5KYIA 1KD1C 4DFAA 1SE2A 1HZ9A 2WB1E 4JCVE 5C4XB 5FO9B 4XXEA 4XYQA 5CV6A 4KHZA 1TIID 4PV1C 2KHSA 2F03A 1JQYD 2UXBL 3DXJC 1VQKA 1Y8PB 4A3IH 4XQQA 3GV3A 3GP7A 1F9SA 5IGDA 1ENCA 3A56A 3M4PA 1B9MA 4IPHA 2IY5B 1V1PA 4G7HC 1KXLA 1KHIA 1HXYD 4UP8A 2F0TA 4RGMA 3KJOA 3LWUA 5IT9E 2CH4W 4A3IB 5FLXc 2BA1A 1Y1WG 1PTOC 4IFDG 1DONA 5I6YA 2RCNA 3LX0A 3GTOH 5M3FG 5E3FA 2VB2X 4JPBW 1YHQA 4DR7Q 1I94L 1F9QA 5ELBA 2O2LD 3Q22A 1L2FA 1MGSA 1EIYB 2ICIA 4XT3B 2K52A 3MHBA 1STYA 3FP9A 1EQTA 2EJMA 1NTGA 5JEAH 4LJZC 2Q2UA 1LV9A 2L15A 1J6QA 1A3VA 4HJAA 4ZYSA 1T9HA 4UP7A 3AFQA 1Y1VH 2BCOA 4LF9Q 2A6EC 3F2CA 2EXZA 2B2UC 1TT2A 2PPBC 4OX9L 3A7AB 1B53A 1Q7YC 4A3GG 4A3EH 1K83B 3RLOA 2DN8A 1CQVA 1TY0A 4DR4Q 4RAUC 2B8FA 4BXXG 4JV5Q 3SK5A 1EWCA 3N6RA 1IBKQ 1W3SA 5BN3A 1Y1VB 4R4CA 3LWEA 1SEBD 4KN4C 5EAYA 4JYAQ 4DK6C 4MN3A 4A3EB 5C44G 1FYCA 2L9HA 5L37A 1PYWD 1LTLA 2E5LQ 4G7OC 3LGJA 4CDEC 4DV7L 1EQQA 4LF5L 2PO4A 1JOKA 1KQSA 1GUGA 3U58A 3H09A 3NWTA 1YBYA 4JI3Q 1Q8KA 1SMYC 4WRDA 4B3RL 1WTVA 4LF4L 1VQ9A 2Q8IB 1X3PA 1HNZQ 1BCPB 3QJYA 3MEHA 1NAPA 3KDFA 2I07B 2N8NA 5M5WB 4IZ8A 3TP6A 3OW7A 1EYCA 1BF4A 1EFWA 1XPRA 1CTMA 2KECA 4AYBG 2B2TC 1LT6D 4L5TA 3ZJYC 1B9NA 1VMCA 1BUVT 4JI8L 3I70A 4DR2L 2VQEL 2F0JA 3D6WA 4N8FA 2JK8A 4DR5Q 1MIUA 1F2ZA 1F2YA 4WFN3 3DM1A 1TVXA 5DAUA 4IPCA 4RFBA 1CK1A 1Q81C 3KF8A 3K5OA 1AE2A 1QVFA 3S2HB 2F4VL 5DNFA 1X3FA 1Z47A 4J6HA 4HEDA 5EKIA 3ND9A 4KKUA 1RKNA 3KBXA 4UP9A 3PUYA 2CWAA 2A6ED 3CPWA 1GKHA 4O1NA 5EBDA 1I5FA 4RMFA 1CKOA 1EOTA 3T16A 2YYZA 4GKJL 1SJHD 3DWAA 5EPKA 3HOXH 1QCBD 4OIKA 1XNQL 2CFMA 3MXUA 1CKNB 1PDQA 1ONLA 2RSOA 5I6WA 3NBHB 3U4ZA 4DR1Q 3BDCA 1UEBA 3HOXB 2QF7A 2XRQD 2A8VA 5D3DA 1VQ7A 3KLSX 4L8JA 2NTSA 1SMYD 2F3IA 4CJ2C 3TP5A 4JI7L 1Z6HA 2PZUA 2AWNA 1Y14B 4RGTA 5EKKA 1Z7TA 1YJNA 2RHQB 3ULLA 4O2DA 1UE6A 4PG3A 4RCOA 1N8RC 3AU7A 3H0GH 2XRSD 4RCNA 3T1YQ 3F2BA 3RD4A 5IYDG 1IYJB 1S4ZA 4JK1C 3W2DA 2QCPX 1KTKA 1B44D 2JA7G 4N9TA 3BS1A 4RHSA 1YVCA 3E0EA 3HRZC 1JORA 3H0GB 5CV9A 3E9HA 2UXCL 4HTHA 2ENBA 4K6DA 1MI2A 4GKKL 2FJ2A 3UDGA 1MKHA 5CBAE 5EJWA 1Q90A 2XWJB 5C0XG 1HR0W 2IW3A 4DV5L 2EYMA 3J80L 1GO3E 1VQBA 2F0KA 3A8KE 2VZAA 2I46A 2KENA 4EQPA 2RF4A 2Z8LA 1G8ZD 4OL7A 3FRPB 2QKIC 1IKLA 3DHQA 1H9JA 2VQFQ 1RODA 4LFCL 3A5UA 1X3GA 3NUCA 2EYLA 3NPPA 1JB3A 3CRLC 2KHJA 3OIPA 1S5FD 4X62L 1PZID 1CZWA 3NHHA 1XWEA 2G5DA 3BZKA 4LMQD 3KLRA 4DR3Q 4GLVB 3CCUA 5IYBH 3HOVG 5KNCA 2R92H 1KNEA 4ULLA 4ILWA 2RCFA 4UHVA 1ILPA 2ASBA 1I4PA 3MZ5A 5D14A 2H5XA 1HR0L 2ZJPA 2R92B 4DNTB 1CT1D 3C1EA 3RNUA 2YU9H 1E0BA 1BXTA 1EIGA 4NP5A 2QDLA 3CW2C 3V05A 3I4NB 3W5OA 2D5DA 4CKEA 1K3BC 5IGEA 3HOUG 3PGZA 1WTHA 1C48A 2YU9B 2JA8H 4DR6Q 3CAMA 1PH9A 1SXTA 3U50C 2PQAB 3WOFA 2R93H 2LFNA 2A69C 4G4KA 1IKMA 2EDGA 5BN4A 4HN7A 1OXTA 2K32A 3DEOA 4ZCKA 1CM9A 2Q2TA 2JA8B 3S24A 4YHHL 3EJIA 1BCPF 3RR5A 4A4IA 3VR6A 2VY3A 1HTLD 4Y7NH 3STBC 3I55A 2R93B 2BH2A 4DV6Q 4C3HH 4FXGC 3H91A 4DV1Q 4IQZA 1NMFA 4RHRA 3I90A 3K0YA 3F1ZA 5M3MG 3V2TA 4CKCA 2VW9A 4JI4Q 5LL6S 5JOBA 2OXPA 2VL6A 4Y7NB 4KY5A 3I8ZA 3J81c 4R4TA 3WWVA 4C3HB 5J3BA 2Z6BA 4RGNA 2NWGA 4S3SA 1SLJA 2F0VA 3H3VH 1C4QA 3I4LA 1XMOQ 1EYGA 1HNWQ 3CD6A 3TP8A 1QUQA 3TSSA 3RZOH 3PF4A 4IFDJ 2PNRC 1GOZA 3IFDA 2F0UA 3GD7A 1G291 4ODGA 1XTDA 4IN3A 1JOQA 1SSOA 4K8JA 4M1UB 1JOOA 4IUTA 3RZOB 1PXUA 1AEXA 1L0YB 2CQAA 4A3KH 1LTAD 2G9HD 5C4XG 2JXMB 1EZ8A 2D62A 1V1QA 5E4XA 1IBLL 5GAEC 3CCLA 2EJGC 2LS01 2ALYB 1N33L 2JN4A 1WCMH 1PZJD 2NVYH 3I91A 1B8AA 2KCMA 4A3KB 3DLLA 1PTOH 2A69D 4J1MA 4GZYC 3A8JE 1R9TH 2K5QA 4U673 5IP7H 1BCPD 1HFNA 2NVYB 4A3IG 1XX8A 1I4XA 3FVQA 3S9WA 3TQYA 1PTOB 3STBD 4QB4A 2QW7A 2OF1A 2MO1A 4DK3C 1CSQA 3W1GA 3MEFA 1QB5D 1YNJC 1R9TB 1PLFA 3ER0A 1ZEQX 2R3ZA 4JC0A 3D4DA 3C2PA 5EKLA 3CC4A 2PQEA 2PW5A 5D65A 2XN9C 1HZBA 5EQ0A 3Q24A 4X65Q 4C3JB 3UDIA 2ZTCA 2Y0SB 2UUAL 3UI2A 2L5TA 4OIJA 2EY2A 4ZKCB 1FJGQ 2E2HH 5C0XI 3TRZA 4JI2L 1QNKA 4BA2I 1HZAA 1Q82C 1VQOA 5JEAG 3ITPA 5LMNW 1KIXA 4H7BA 1OXUA 3L2PA 2F0NA 4KKSA 2DNCA 3AFPA 2K01A 4TKOB 1Y1VG 2MPMA 5CC4A 2E2HB 2NN6H 4J15A 2RSNA 1DM0B 3IRBA 1WTRA 1L0WA 4IUUA 2F3VA 4A3EG 5TSSA 3SHLA 1VF5C 4PMCA 4CGYB 5JAVA 4HIDA 2KVMA 5FJ8H 1Q1BA 4EX5A 4X3TA 1IBML 2DY7A 1YJWA 2O5JC 2H4OA 1X9NA 4DGZA 2BA0A 2D2CC 1HNXL 5A2QE 4XIGS 1BBXC 1EWHA 4OHJA 3TDQA 2XVSA 3T1HQ 5I9OA 4KD4A 1VQHA 1A2UA 3TMEA 1SNMA 4GOPC 5LMNL 4L5RC 5IYCH 3IKJA 1L1OC 4EQNA 2B2YA 2HQLA 2WKCA 1VQMA 3TS0A 1FNWA 1D5XC 2HCIA 3RZDH 2A19A 5FOBB 1N32L 1VCIA 2SDFA 2EOTA 2EXDA 4LF8L 2D0PA 2IX3A 3BDLA 1WJJA 4K0KQ 4LFAL 3HOYH 3D4RA 3S16B 1GD7A 3MFGA 3RZDB 3U9OA 1MD2D 1D1KA 1JJGA 3QG1A 4YY3L 1IYVA 5JPMC 3S1MH 2QDBA 3HOYB 1XTCD 4CKBA 2AHOB 4U68A 4CJ1B 1PH3A 1VMPA 2B63H 3S1MB 3NXWA 2C5CA 3G4SA 2OCEA 1GVPA 4OELB 1NUCA 2AUKA 4DAPA 3P7JA 2R7FA 2O5IC 5C0XJ 3A55A 1SE3A 3HOXG 3L9AX 1O78A 1EQVA 1A63A 1WOCA 5HGQA 1UAPA 4A3BH 3SK4A 2OT2A 1O7ZA 2K7VA 1D5ZC 4AYBE 5BR8L 4HSPA 3H15A 2Z9HA 2LMCB 3H3VC 4DR7L 4C56C 1LTTD 5KEEA 1I50H 3CMAA 4N8X1 1I4HA 4ZUJA 3GO5A 2L1BA 4MNOA 3EN2A 3C3LA 2N3SA 3JAMc 2GVBA 4R8IA 4JI5Q 4PNYA 1I50B 2AUJD 2ZXOA 4PZ7A 2HHHL 3GDEA 4P75A 3GTQH 1IHZA 3DWQA 4LF9L 3H0GG 1G2TA 2K05A 4DR4L 2OTLA 4JV5L 3GTQB 2LKVA 4H0LC 5HGTA 1IBKL 4HIMA 1DD2A 1XNRL 3NENA 4B3TQ 1SMXA 2B29A 2DUDA 1STEA 4DV4Q 4JYAL 3J7ZC 3J7YW 1PTOF 1VQCA 5IT9L 2E5LL 4KN7C 3TZDA 2Z6KC 4AH6A 5C3XA 4JI6Q 1J9OA 2HUGA 4JI3L 3MVVA 1STGA 2E2IH 1C0AA 2CHBD 2HD3A 3GTOB 4RKLA 1V9PA 3J81i 3SK6A 1HNZL 1SROA 1A8VA 1Z9FA 1TWFH 5C6AA 3C1FA 3LNNA 2OWOA 3K57A 1EOVA 2E2IB 5C3WA 1X56A 4A3CH 1KAWA 2A1AA 2OQ0A 4B3MQ 4DNIA 2CH4A 2N55A 5IYBG 1TWFB 2R92G 1VQFA 4RH6A 1A2TA 3VR5A 4DR5L 2VB3X 4KJOA 3ERSX 4RGOS 3SGIA 1WTQA 1SFOH 4JBMA 4X6AH 2R7ZH 1HJPA 1O80A 5KIXA 1DYQA 3Q6SA 2UUCQ 3I4NG 5CGKA 1F9PA 2UXBQ 2DY8A 1SFOB 2J0TD 3MXPA 2R7ZB 3OIQA 4LF7Q 4LUVA 3EVQA 3ERQA 2Z4HA 4R4OA 5CV7A 5FO8B 3FMCA 2EYPA 4WJ4A 3BU2A 5FK9C 2DJGC 4JI0Q 2ID0A 2NVQH 2A6HC 2WACA 4QF4A 4X66Q 2JA8G 3NEMA 4B3SL 4OWXB 1EY6A 1PFSA 2R93G 1KNAA 1XJVA 1I94Q 4Z9CB 1PTOD 2NVQB 3J81E 4KHPQ 2DJFC 5EPJA 4DV2Q 3H6MA 4DR1L 1QVCA 2O4XA 1E3PA 4FF4A 4X3UA 3URYA 3TS2A 4XYOA 1UWVA 4C3HG 1N36Q 3CXCA 1PH4A 2KA7A 1VQNA 2B2TA 4QUCA 4AIMA 4KK7A 3SEBA 1WYDA 2E2JH 1HA6A 1PA6A 1XXGA 4K6LA 3E0JA 3NTKA 4UAIA 5CYUA 1KLGD 4LF6Q 2EY1A 1ASYA 3NQTA 4ZRZA 1RTOA 2PMZE 3A74A 5E7NA 2E2JB 4AQYQ 1G91A 4PQXA 3T1YL 4A3JH 3CKIB 1HTPA 3N52A 2RVLA 1YIJA 1JE4A 1LTRD 1OXXK 3CCEA 4F87A 1PH5A 4BBSH 1K8GA 1M1KC 4K5XA 1YITA 1TQOA 2R61A 3NTIA 2E2DC 4A3JB 2CKZB 3L3OC 4P72A 3KF6A 4BBSB 3B6YA 4JI1Q 3R93A 1X3EA 3U9SA 2MJ8A 3J80i 2KEDA 5IP9H 5C4JH 4B08A 3SDZA 4A3KG 2SNMA 5C3EH 3CCQA 1BO0A 2VQFL 5JEAJ 5LMUQ 2EVBA 2KJXA 2PYKA 3NWSA 3NELA 3VYRA 3FEWX 2A6HD 3CF5A 1WCMG 2MUYA 4KJNA 1RL2A 5HY6A 3QB3A 3TZUA 5C4JB 5GROA 1VDZA 2ICEC 5C3EB 1SDFA 2VXWA 4DR3L 1CSPA 1PHJA 4FXKC 4L6TB 2Z1CA 3T56B 5IP7G 1STNA 4QIWE 2SEBD 4DNRB 2UUBQ 2CW0C 3H94A 4K14A 3M7NA 4DN4M 1AW7A 1CZGA 4PZ8A 4A75A 3OSOA 2B2VC 4QUFA 4C3JG 3S14H 4NXNQ 1SAPA 5CV5A 4GN5A 3TP7A 2Y0SG 4YCWA 2I0QA 2ZTDA 4FVMA 3HKZG 1F9RA 2NYZD 4KY7A 4TSSA 1IYUA 4P71A 3S14B 5D3IB 5K36H 1K8OA 4IFDI 5JJKA 5EBCA 1RF2D 5JJZA 1PYSB 2RDHA 3J80E 1HHVA 4F8MA 4C1NI 3PIP3 4IOAA 4OONA 4H02A 3TN2A 2IWHA 4FYDA 3DMUA 3I2ZA 1BBUA 1EWIA 2MQHA 3K7AH 4TRDA 3J7A5 1Q46A 1VQ8A 2YTYA 2PZTA 4HCEA 4ZAIA 3RLFA 5KRUA 1CUKA 5EGTA 5CR3A 5I2XA 4B9WA 5KNBA 2D0OA 1A3TA 2SNSA 4DV6L 4GNXC 1PH6A 1EY4A 1DOLA 3PO2H 4DV1L 4HMJA 1Q12A 3K7AB 3K80C 4BA1I 1XPOA 1XMQQ 3V96A 1A62A 4X64Q 5FJ8G 2A68C 1JWSD 4JI4L 1A6XA 4DUYQ 1KC8C 3I4OA 4N9PA 4EVOA 1SNQA 2E74C 1AFPA 1TS5A 3I72A 2L4NA 2MHVA 4FF1A 3PO2B 3P20A 1MSHA 4JOIC 4GOPB 2GVAA 4A3FH 3SK8A 2CWPA 2L12A 1GUWA 1L1OB 1S5DD 4EGVA 1H95A 1XMOL 3U4VA 3JAMi 1HNWL 3KOJA 1EZ6A 5GAHC 3DM3A 2WAQB 1K0RA 4A3MH 4A3FB 5IYCG 3X3MA 2X6GA 4GLAC 1NSNS 2KHIA 1EU3A 2V4DA 3NBIA 5DM63 1GHKA 5AJ3Q 1VS0A 1KDBA 1JR0D 1EIHA 1FR3A 4DAYB 1STAA 4NDXA 3S1RH 4A3MB 1X55A 2KQ3A 3K8AA 4I65A 3ND8A 3HOYG 3E9IA 2WP8J 1WVLA 1FGBD 2P5ZX 1EEFD 1MSGA 1DZ1A 1B70B 1Q8IA 1S3OA 1U9RA 1H9RA 2X6LA 1YNNC 1I4GA 3S1RB 1EY7A 1PV4A 2JA6H 1WD0A 1RIPA 2KCCA 2F0DA 2HDMA 4O42A 4QGUA 3CHBD 1B3AA 3F2DA 3D6CA 2ES2A 3MA2B 2FFKB 1M4VA 3HFZB 4MTNA 2MFIA 1H9SB 2WV6D 2B63G 2B2WC 4ZUIA 2SOBA 4DAVA 4BY1H 4RA8A 1BKBA 4DV3Q 1W6KA 3FHWA 1M8AA 1J5EQ 3OW2A 3A8IE 3T51B 3D0FA 3OMCA 2PZWA 4DUZQ 2NTTA 2Q8TA 3JAME 2A68D 1AZPA 3H3VI 5DLQE 4BY1B 3MXNB 5JJLA 3P1HA 4LWCA 4A3BG 1O7YA 2A74C 3OPOA 4X65L 3J81j 3G71A 2I5LX 4JW0A 3S1NH 3DUZA 1D2BA 3KLSA 1K28A 3A54A 1FJGL 3G6JB 5I2YA 1K8MA 1EQRA 1NBWA 1SNOA 3KUPA 1CKNA 5ELCA 3S2DH 2K03A 1II3A 4X3KA 2F0PA 3S1NB 3NBHA 4CBVA 1N34Q 5IWAL 1WCMB 1V1PB 4P73A 5FLXL 3BYYB 3AEVA 1LACA 1DOKA 1I6HH 3S2DB 3CPFA 1K3RA 5IOCA 1HZCA 3MC0B 4QJFA 1D7QA 4MZ9A 4HJ8A 1TKWB 4YCUA 4LNQA 2MGSA 4CHTB 3Q23A 2XGTA 1D6EC 2K04A 4LFBQ 1EY9A 2JSOA 4LAAA 2EYOA 1I6HB 2JQOA 5M5YH 1WTXA 1O7LA 3T1HL 1RTNA 1B1ZA 1NCVA 3I3CA 4ZQ3A 5CORA 1QZHA 1GUTA 2F0QA 4K2KA 2GA4B 1TWCH 2HCCA 3CC2A 4BBRH 5M5YB 5NUCA 3HKZB 5ELEA 2BH8A 3EBEA 2E8GA 1WTOA 3W1BA 4ME3A 5AFWA 2AQ1B 4LW1A 1B2TA 2Z4IA 3PIPA 1PH8A 3FKIH 2ZXRA 4A3LH 1TWCB 2K5DA 1J8IA 3EFXD 4BBRB 4YIJA 4IUQA 5COYA 3UE0A 4A3CG 1F2LA 3M4OH 2TSSA 4C3IH 2B39A 5T1GA 4K0KL 3VYSA 1YHAA 3R3OA 2PCFB 5C5MA 3J80c 2PNHA 3FKIB 2R7ZG 5CV8A 1K8AC 4C3IB 1IW7C 1M90C 1PYBA 4PZ6A 4IJLA 1PVOA 1VQGA 3GTMH 3S17H 1TY2A 1BR9A 4KHVA 2ZM6Q 3HOZH 4XQJA 3J7AV 1FVIA 2UU9Q 4OO1H 5A2QL 3NP8A 4NKLA 3CCMA 3KDFB 4YWLA 4LUOA 4DU9A 3GTMB 3HOWH 1SBBB 3S17B 2F0SA 1QG7A 1YNJD 2F0IA 2KCTA 3QR8A 3OTOQ 4CDCC 4HAEA 4E6IA 3HOZB 1GJXA 1X6OA 2LXJA 1EY0A 3HOWB 4GOPA 2UUAQ 1NJIC 1DCZA 2K5HA 1SYDA 1L1OA 2R6GA 1SRUA 3KF8B 3PF5A 1WFQA 1VQIA 5DEHA 4GLXA 1ZXTA 3ZYYX 2E75C 3E6ZX 1EL0A 5C4ZA 4NXMQ 2EZVA 3NE5B 4JI5L 1GUOA 2PQAA 4A93H 2OEOA 4ME5A 3QWNA 3OOCA 1LM0A 4WJWA 4GN3B 1VQEA 1UE5A 4DAYA 1JT8A 1G6ZA 4DV0Q 1G2SA 1F77A 3QO2A 2CQOA 4A93B 4DF7A 2RKSA 2L55A 3PSIA 1ML0D 4A3JG 2IX0A 4OWWB 1JWUD 4RKBA 4RWSC 1A15A 1OO9B 4BBSG 2VS1A 4B3TL 4Q0FA 4A3DH 4Y52H 4DV4L 2B63B 1SNDA 3VR4A 3I4MH 5J39A 1QJOA 4HIKA 2K5VA 2RHSB 2EPBA 4GS3A 1X3QA 2M00A 1JB7A 4YWKA 1WI5A 1ESRA 3VYUA 3BVGA 4P74A 5IP9G 4A3DB 1H9SA 4FXDA 1Q3LA 4JI6L 1JCKB 3I4MB 1Y8NB 1FD7D 5C3EG 1FL0A 4A3BB 1B50A 1IZ6A 1EYDA 3CRKC 4OXPA 3SE0A 3SVMA 5G3LF 4P2CB 2HT1A 4R1JA 1E1OA 4B9XA 2M9VA 3UDXA 5FLMH 3KJPA 4KMUC 2UXDQ 1A0IA 1C8CA 4B3ML 4JBJA 4GN4B 2K5NA 1BQQT 2J7ZA 4HIOA 2CVRA 3RN2A 3KLWA 2Z0SA 4POFA 3E5SA 4YCVA 2UUCL 1D5MC 5K5PA 1STBA 1QE6A 1E1TA 2VUMH 1JICA 2IL8A 3TREA 4K5VA 5JVH3 1YNXA 1OXSC 1YHBA 3BYTB 3O13A 2C35B 4OEMB 1BVSA 1ZYRC 2JA5H 4DKAC 4LF7L 3WDNA 1K73C 1BBWA 3KBGA 1XYIA 2VUMB 1AZQA 2QEJC 3T13A 4JI0L 1WTPA 2GN5A 5K36G 1X54A 4X66L 3VA5A 1PFBA 4V190 4XQNA 2JA5B 4H13C 1G51A 2F0OA 5BR8Q 1VQ6A 2EY6A 1UEAB 3X3NA 2Z6KA 1HUNA 4GNXB 1NMGA 3MWYW 5CV4A 1JWMD 4KKTA 5DM73 4KHPL 4L63B 4DV2L 2KBNA 4CJ0B 1E2ZA 2QA4A 1SJED 1C7YA 3C46A 3VR2A 3M9BA 1TU2B 2HIVA 4HMIA 1N36L 2FMMA 4A76A 3PO2G 3RMHA 4JVZA 1K83H 1ZKOA 2QEXA 1VQLA 5G3LD 2HHHQ 2QGQA 4FF3A 2B2UA 1SNPA 1E22A 2G9DA 4LF6L 3PUXA 2K28A 2Y0SE 3OWFA 3QIAA 4NPSA 3G6EA 1JC7A 1HQRD 3K7UC 2WAQG 4AQYL 3HKZE 4A3FG 1YEZA 3PUVA 1XNRQ 4C1NK 1SYGA 1RHPA 3L7ZC 4M8AA 1U4LA 2LY7A 2OQKA 1GHJA 3IAYA 4CDDC 3Q8DA 1DJRD 2ATWA 3E3XA 4A3MG 3GQBA 2A73B 3IL8A 5GADC 3VYTA 3M85A 4K8IA 2IT1A 2F0GA 5M5WH 4WORA 3AYHB 4JI1L 2V1CC 1P8LA 1L0XB 2F0FA 3I7FA 1ZYRD 2FMCA 4IOCA 1VQPA 1S72A 3J81L 1KLUD 2I5HA 1CKMA 5C5LA 2AKWB 3I73A 5LMUL 2K50A 1W2BA 2NVXH 3PO3H 4NW2A 5KGUA 2EQSA 3PQIA 3ONAB 1MJCA 2Q2HA 3AQQA 3DEPA 4IALA 2JA6G 3S2HH 1B7YB 4BY7H 3F8TA 4OX9Q 1VQJA 4FP5D 4PMBA 3PO3B 2NVXB 1QUQB 2TMPA 2F0HA 3CCVA 3D3RA 2NZHA 5M5XH 1G6PA 4UPAA 2UUBL 5IGFA 1TWHH 1PRTB 1B3QA 2WB1G 1E2VA 3ULPA 1LUZA 4BY1G 4G7ZC 2XWBB 3RLNA 4BY7B 1RD9D 1ENAA 1HQMC 1DGSA 1VQDA 1TS4A 2XSCA 5IIFA 3NSWA 4K5WA 4NXNL 2AWOA 3AB9A 5M5XB 5LHY1 1X32A 2XTIA 4DV7Q 1TWHB 4LF5Q 2KEEA 3Q0AA 3HZXA 5HURA 2VNUD 3K0XA 1MJEA 1LLRD 1NR4A 4B3RQ 2F52A 4LF4Q 3OMGA 4B3SQ 4I7ZC 4J8QA 1E2WA 2ZXPA 2Q8RE 1LTBD 2EJFC 1QOHA 4HSVA 1HFGA 1AN8A 1D1IA 1VQAA 4I7AA 2MO0A 3MFYA 3MTSA 1B4OA 2NBFA 5IODA 4L5QA 2IHFA 4JI8Q 4DR2Q 1ASZA 2N88A 3M7GA 2VQEQ 1QZGA 5M9OA 3BZCA 4F88A 1QNUA 2L0CA 4MHEA 1WTWA 2QILA 1I4QA 1N9WA 3M3YH 1JJCB 1RJTA 4JBKA 1K9MC 3P75A 1HRJA 3UDFA 5IGBA 2F4VQ 1PH1A 2NVTH 1XMQL 1AP0A 1SN8A 1U0LA 4X64L 3FPUB 4DUYL 3M3YB 3J7AF 2JJQA 1SE4A 3A0JA 3I56A 4ABNA 1CFMA 2IJ0A 2NUCA 2NVTB 4TVAB 3CU7A 4NB3A 3KK7A 4HCSA 2R7DA 1SYBA 1S5ED 4GKJQ 4RG1A 2B2VA 3PV0A 2KOLA 3NK9A 4G57A 1TS3A 5GQOA 5C4HA 4IUPA 3GTPH 3A7LA 1Y1WH 1YJ9A 1XNQQ 4DR6L 4IFDH 3D31A 1O7IA 4BBRG 2JYOA 2A5HA 1GXDC 2EYHA 2JP1A 1GM5A 1A3UA 2F1MA 2K4KA 5M3FH 2IX1A 1S5BD 3VA7A 2EYJA 2F0WA 1KDAA 1KL9A 1E7ZA 2LXKA 5AJ3L 1Y1WB 3GTPB 3FKIG 4DAMA 1QILA 2EYFA 4A3LG 1JE5A 2N78A 4PMWA 2H1EA 1FGUA 1BDOA 2NN6G 3ICEA 5M3FB 1CA5A 4C3IG 5IT9c 1Y8OB 2HDLA 3PIO3 4JI7Q 1KAAA 4KY6A 1EEID 1OXVA 2F4IA 2IPKD 1SE8A 2MNAA 5F2DA 4Q5VA 3ULJA 4LUZA 2K14A 3GTKH 2PW7A 1PMRA 4FDBA 4WJ3M 1ICWA 4GNXA 3K6OA 3F2UA 3BVZA 4A3GH 1LTSD 1TS2A 1LABA 4IJHA 1VQ5A 3QOJA 4BXXH 1UE7A 3SXHA 2F0MA 4R9WA 4DK0A 3GTKB 3HOZG 3G48A 3I4NH 2BOSA 2CW0D 4IUVA 1NR2A 4DV3L 4OO1G 2UXCQ 1SNCA 2C9OA 2ZTEA 4A3GB 5C44H 1J5EL 4GKKQ 3HOWG 4JOIA 1ESFA 3OHXC 1SYEA 4BWGB 1CQFA 2XNAC 4DUZL 1EY8A 3GTGH 4HJ9A 3K5LA 1NE3A 3T53B 4DV5Q 1LYLA 2L11A 4L5SA 1UNSA 1AE3A 4MTKA 5C44B 3CCSA 1C9OA 1KRTA 3TBIB 1T5EA 4CDFC 4LFCQ 4HR7B 1BNZA 5IGGA 1UUPA 2JE6I 1HCZA 3GTGB 1WD1A 4X62Q 1EFID 3M4QA 4EQOA 2Q2IA 1ET6A 1R4QB 5JPNC 1BCPC 2WKDA 1F2MA 4XTCS 4A93G 4POGA 2AQ2B 1IXRA 1VF7A 3KYHC 3OYYA 4ALPA 3NTHA 2HQEA 2MP1A 1N34L 4DXFA 2RA4A 4AYBB 4APVA 2JA6B 2X69A 1CA6A 1HH2P 4KV6A 1RDPD 1YZ6A 2F3WA 1ILQA 1Q1EA 1HR0Q 4HJ7A 1HA5A 4IURA 1LT3D 3PCOB 4JBWA 5IGCA 3HKSA 3D8GA 1PH7A 2J4XA 2HIXA 1PRTC 4A3DG 1Q86C 4LFBL 2WB1B 1T5XD 1XPUA 1PRTF 3I4MG 2B2WA 4JG2A 1BOSA 3HP3A 4R4IA 1HPCA 1V1OA 4EQ5A 3RN5A 3JAML 5J22A 4MIUA 4DA2A 4ZLTF 3GV6A 4KD3A 3HG9A 4H44C 1DXMA 2WFWA 3HEJA 5KNDA 1I6VC 2I5MX 3MXGA 1MBYA 1LTGD 3S15H 4UY8C 4YHHQ 1LT5D 2K5WA 2JEAI 1K0SA 4QY7A 3K59A 1S5CD 1EYAA 2K1BA 3S1QH 1CHPD 2YTVA 2LSSA 3R2IA 1EIFA 5FLMG 3EQLC 2JEBI 2CCZA 3AMUA 3S15B 3G7LA 3SR1A 1HUMA 2BE5C 2K33A 1V8QA 5CMDA 3A5ZB 3S1QB 5E1FA 3CMEA 1IL2A 2RBMA 1EUJA 5FLXE 3HGBA 2WIIB 1YNND 3EIVA 2WINB 5ELNA 4YWMA 2VUMG 1U4RA 2ZJRA 1OTCA 1KDCA 2RDFA 4V0BA 4NMZA 1FNUA 2F0LA 3BZDB 5IYDH 1ICFB 5IY0A 4IPDA 2AQ3B 2JA7H 1CI3M 2JA5G 3UE1A 2ZM6L 2ZT9C 2UU9L 3DWPA 4C3JH 3CCRA 2IHEA 4KLKA 3W3AA 3TEHB 1KRSA 3OTOL 5C0XH 2F0EA 3D4WA 2JA7B 5I4DA 3PUWA 1H9KA 1PRTD 1V43A 1CHQD 4LK1C 2D9UA 5H1SE 1IBLQ 1SYCA 1SYFA 1N33Q 2EY5A 2DNEA 2M2LA 3FPPA 4OWTB 3QOLA 5ELOA 1RCVD 1TR5A 3PIOA 4NXML 3M4OB 3VR3A 3IFTA 2NN6I 5IWAQ 3HOVH 2NB0A 1GUNA 4R8NA 1UE1A 5I9PA 1MHWC 4OGQC 1D8LA 4F7XA 2BDNA 1PH2A 4DV0L 3NQIA 3FDTA 4DK1A 3K5NA 3BJUA 1U4PA 4XDXA 4DPGA 3HOVB 1W6JA 5ISRA 1FNVA 2BE5D 3VDYA 3MAQA 1LTID 2KUMA 4FO2A 1U4MA 1ET9A 2EIFA 1E24A 2JA9A 1EY5A 2B2YC 1TXYA 4KTAA 1JJ2A 4XT1B 5LL6X 2OTJA 1PZKD 5T1IA 3HOUH 2K75A 2PI2A 1QVGA 4OO1I 4KI0A 4FF2A 3R8BA 3PUZA 4HJ5A 2PMZB 2BDOA 5JVG3 1I3QH 3PMFA 3K81C 4ZK9B 5FKAC 4QCLA 2DGYA 4JI2Q 4IO9A 2YTXA 3GTJH 3HOUB 3S16H 1QWYA 3PO3G 2PI2E 3OWEB 1STHA 5ELFA 4QMGA 3BDOA
chains in the Genus database with same CATH topology
1E22A 4YCWA 4LF6L 3PUXA 2I0QA 1JMCA 2Y0SE 4NPSA 3G6EA 2ZTDA 1TWAH 4IPGA 3HKZG 3L0OA 2UXDL 3K7UC 2WAQG 4A3KH 4BY7G 3CC7A 4AQYL 3HKZE 4A3FG 5C4XG 1YEZA 4P71A 3GTLH 2B3GA 1P16A 2D62A 2WAQE 5IE8A 4IFDI 1V1QA 3PUVA 5JJKA 5M3MH 1IBLL 4O0AA 5GAEC 3CCLA 1XNRQ 3L7ZC 2ALYB 1PYSB 1TWGH 2FXQA 1IBMQ 1N33L 2OQKA 1WCMH 2NVYH 4IOAA 3Q8DA 1B8AA 4OONA 4H02A 2KCMA 2ZJQA 2ATWA 1YI2A 3DLLA 4A3MG 5GADC 3I2ZA 4QL5A 1BBUA 3M85A 1HNXQ 1EWIA 1NY4A 2MQHA 3KF6B 3K7AH 3J7A5 1R9TH 3CQZH 2IT1A 1Q46A 5M5WH 1VQ8A 2YTYA 5IP7H 3RLFA 5GAGC 3AYHB 1CUKA 4JI1L 4C2MH 2V1CC 4A3IG 4QQBX 1P8LA 3TQYA 4A3CH 2D0OA 2N49A 2AMCB 3I7FA 3JC66 3STBD 5LMNQ 4DV6L 4GNXC 2MO1A 4R4QA 4IOCA 1VQPA 4DK3C 1CSQA 3W1GA 3MEFA 3PO2H 4DV1L 2I5HA 1Q12A 3K80C 1CKMA 4BA1I 1X65A 1XPOA 1XMQQ 2AKWB 5LMUL 1S40A 5JJIA 2K50A 1W2BA 1A62A 3ER0A 2NVXH 3PO3H 4X64Q 4JC0A 5FJ8G 2EQSA 4JI4L 4DUYQ 1KC8C 3I4OA 1MJCA 2Q2HA 3AQQA 3CP0A 1N32Q 3CC4A 2JA6G 3S2HH 4TQUS 4LF8Q 1VQ4A 1HZBA 4JOIC 1B7YB 4GOPB 3CCJA 4BY7H 2NZOA 2GVAA 3F8TA 1VQJA 4X65Q 4OX9Q 4A3FH 3UDIA 5C4XH 3KFUA 2CWPA 4LFAQ 1QUQB 2YV5A 2ZTCA 1AH9A 1L1OB 1H95A 3CCVA 1XMOL 2UUAL 2NZHA 3U4VA 5M5XH 3JAMi 4UPAA 1HNWL 1G6PA 2UUBL 1U5KA 3KOJA 4YY3Q 1SR3A 1TWHH 5GAHC 2WB1G 3ULPA 1KD1C 1LUZA 3DM3A 4BY1G 1FJGQ 2E2HH 3RLNA 5C0XI 3TRZA 4JI2L 1S72A 4BA2I 1HZ9A 1K0RA 2WB1E 4JCVE 1HZAA 4A3MH 5IYCG 1Q82C 1DGSA 5JEAG 1VQOA 1VQDA 5LMNW 4GLAC 4KHZA 4NXNL 1OXUA 2AWOA 3L2PA 1KIXA 2KHIA 3AFPA 2XTIA 5AJ3Q 4DV7Q 4LF5Q 2UXBL 1VQKA 1VS0A 4A3IH 1Y1VG 4DAYB 3S1RH 1X55A 2VNUD 3K0XA 4J15A 1MJEA 3IRBA 1L0WA 2F52A 3K8AA 3M4PA 4LF4Q 4IPHA 4B3RQ 2IY5B 4A3EG 1KXLA 1KHIA 3HOYG 3E9IA 2WP8J 4B3SQ 4UP8A 4HIDA 5FJ8H 3KJOA 1B70B 1Q1BA 1S3OA 4EX5A 5FLXc 1IBML 2BA1A 1Y1WG 4IFDG 1VQAA 1PV4A 2JA6H 1YJWA 2MO0A 2RCNA 1X9NA 1RIPA 2BA0A 3GTOH 1HNXL 4L5QA 5M3FG 4QGUA 2IHFA 4JI8Q 4DR2Q 3F2DA 1YHQA 1I94L 4XIGS 1ASZA 2ES2A 4DR7Q 2VQEQ 1QZGA 1L2FA 3T1HQ 3BZCA 1EIYB 3HFZB 4MTNA 2K52A 2MFIA 1N9WA 3M3YH 1VQHA 1JJCB 2B63G 4JBKA 1K9MC 4BY1H 1BKBA 4DV3Q 3FP9A 5LMNL 4GOPC 3FHWA 3UDFA 4L5RC 2F4VQ 5IYCH 1NTGA 1J5EQ 3OW2A 1PH1A 2NVTH 1L1OC 3D0FA 1XMQL 2Q2UA 2HQLA 2L15A 1J6QA 1SN8A 4DUZQ 1VQMA 1U0LA 4X64L 3TS0A 3RZDH 4DUYL 4HJAA 3H3VI 2A19A 1T9HA 4UP7A 1VCIA 3AFQA 5DLQE 2JJQA 1Y1VH 3MXNB 4LF9Q 1N32L 3F2CA 5JJLA 2EXDA 3A0JA 4LWCA 3I56A 4LF8L 2D0PA 4A3BG 4TVAB 4X65L 4OX9L 1WJJA 4NB3A 1Q7YC 3J81j 4A3GG 4K0KQ 4A3EH 3RLOA 2R7DA 4LFAL 3HOYH 4GKJQ 4RG1A 1GD7A 4DR4Q 3PV0A 4BXXG 3G71A 2I5LX 4JV5Q 1JJGA 5GQOA 1IBKQ 1W3SA 4YY3L 4R4CA 3S1NH 3GTPH 1Y1WH 1YJ9A 1XNQQ 4DR6L 3D31A 5EAYA 4JYAQ 4DK6C 1FJGL 1O7IA 4BBRG 3S1MH 1EQRA 1GM5A 1NBWA 5C44G 5M3FH 2K4KA 1CKNA 2IX1A 3S2DH 1LTLA 2AHOB 2E5LQ 1KL9A 1E7ZA 3LGJA 1PH3A 2LXKA 5AJ3L 4DV7L 1EQQA 4LF5L 1N34Q 3FKIG 5IWAL 4DAMA 4A3LG 1KQSA 1JE5A 2N78A 4PMWA 2B63H 3U58A 1YBYA 4P73A 1Q8KA 1FGUA 3G4SA 2NN6G 2OCEA 4JI3Q 3AEVA 3ICEA 5IT9c 4B3RL 1GVPA 4LF4L 1VQ9A 1I6HH 3CPFA 4JI7Q 1K3RA 1HNZQ 1OXVA 1HZCA 4QJFA 1SE8A 3KDFA 2MNAA 2N8NA 1D7QA 2R7FA 4MZ9A 4HJ8A 4YCUA 5C0XJ 4LNQA 1EFWA 3HOXG 1XPRA 3ULJA 4LUZA 2XGTA 1A63A 2K14A 4AYBG 1WOCA 5HGQA 3GTKH 4LFBQ 4A3BH 2JQOA 4L5TA 4AYBE 3ZJYC 4FDBA 5BR8L 3H15A 4WJ3M 5M5YH 4GNXA 4JI8L 4DR2L 4DR7L 4A3GH 2VQEL 3T1HL 4IJHA 1I50H 1VQ5A 3CMAA 4BXXH 1UE7A 2JK8A 4DR5Q 1MIUA 1QZHA 4IPCA 3HOZG 1Q81C 3G48A 3I4NH 1AE2A 1TWCH 3GO5A 4MNOA 4DV3L 3EN2A 3CC2A 1QVFA 4BBRH 4OO1G 2N3SA 2UXCQ 3JAMc 2BH8A 2GVBA 2ZTEA 3EBEA 4JI5Q 2E8GA 1X3FA 5C44H 1J5EL 2F4VL 3HOWG 4GKKQ 1Z47A 4JOIA 3W1BA 4ME3A 4PZ7A 4DUZL 4LW1A 2HHHL 3GDEA 3GTGH 4P75A 4HJ9A 1NE3A 3PIPA 4DV5Q 3FKIH 1PH8A 3GTQH 1LYLA 4A3LH 4L5SA 4LF9L 4UP9A 3PUYA 2CWAA 3UE0A 3CPWA 4A3CG 1GKHA 3M4OH 1AE3A 1I5FA 3H0GG 4RMFA 4C3IH 3CCSA 1C9OA 1CKOA 1KRTA 4LFCQ 4K0KL 1YHAA 2YYZA 4GKJL 4DR4L 2JE6I 3J80c 2OTLA 2PNHA 4JV5L 1IBKL 4HIMA 4X62Q 1XNRL 2R7ZG 3HOXH 3NENA 1XNQL 4B3TQ 1SMXA 2CFMA 2B29A 2DUDA 4JYAL 1CKNB 3M4QA 4DV4Q 1K8AC 3J7ZC 2Q2IA 1M90C 1PYBA 4PZ6A 4XTCS 4IJLA 1PVOA 4A93G 4POGA 1VQCA 1IXRA 1VQGA 3NBHB 3KYHC 3GTMH 3OYYA 3U4ZA 2E5LL 4ALPA 4DR1Q 3S17H 1UEBA 1N34L 2A8VA 4APVA 2ZM6Q 1VQ7A 2Z6KC 4AH6A 3HOZH 4JI6Q 4JI3L 1FVIA 2UU9Q 3CCMA 1HH2P 2E2IH 1C0AA 3KDFB 2F3IA 4YWLA 4LUOA 1YZ6A 4JI7L 1Q1EA 1V9PA 3J81i 1HNZL 1HR0Q 3HOWH 2AWNA 4HJ7A 1SROA 1A8VA 1Z9FA 1TWFH 1Y14B 2KCTA 3OTOQ 3PCOB 4JBWA 1YJNA 3HKSA 1PH7A 2OWOA 2HIXA 2RHQB 3ULLA 4A3DG 1EOVA 1Q86C 4LFBL 4O2DA 1UE6A 1X56A 4PG3A 1XPUA 1KAWA 1N8RC 3I4MG 2OQ0A 1X6OA 2A1AA 3H0GH 4JG2A 2LXJA 4B3MQ 4DNIA 4GOPA 4R4IA 3T1YQ 2UUAQ 5IYBG 1NJIC 2K5HA 4EQ5A 3F2BA 3RN5A 5IYDG 1IYJB 2R92G 1VQFA 1L1OA 2R6GA 1SRUA 3KF8B 4DR5L 3SGIA 3ERSX 3PF5A 1WFQA 1SFOH 1VQIA 4JBMA 2JA7G 4X6AH 2R7ZH 1HJPA 4GLXA 1YVCA 3E0EA 2WFWA 2UUCQ 4NXMQ 3E9HA 3I4NG 2UXCL 2I5MX 4JI5L 2PQAA 4A93H 4GKKL 3UDGA 3S15H 4UY8C 2UXBQ 1MKHA 4YHHQ 2JEAI 5C0XG 1LM0A 4GN3B 4QY7A 1HR0W 1VQEA 3S1QH 4DV5L 4LF7Q 1UE5A 4LUVA 1GO3E 1VQBA 2YTVA 2LSSA 1EIFA 2VZAA 5FLMG 1JT8A 4R4OA 2CCZA 2JEBI 2KENA 4DV0Q 2RF4A 4WJ4A 2CQOA 3BU2A 4JI0Q 2VQFQ 2ID0A 4LFCL 3PSIA 3A5UA 2NVQH 4A3JG 2IX0A 4X66Q 1X3GA 4OWWB 2JA8G 3A5ZB 3NEMA 4B3SL 2KHJA 3CMEA 4OWXB 1IL2A 4BBSG 4X62L 1PFSA 2VS1A 1EUJA 4B3TL 4A3DH 4Y52H 4DV4L 2R93G 1XJVA 3BZKA 4DR3Q 1I94Q 3I4MH 3EIVA 4GLVB 5ELNA 4YWMA 3CCUA 2VUMG 2ZJRA 4HIKA 2K5VA 1OTCA 5IYBH 2RHSB 4KHPQ 5IYDH 3HOVG 2R92H 5IY0A 4GS3A 4DV2Q 4DR1L 4IPDA 1QVCA 1JB7A 1E3PA 4YWKA 1WI5A 2JA7H 3TS2A 5IP9G 4P74A 3UE1A 2JA5G 2ZM6L 1UWVA 1PH6A 2ASBA 4JI6L 2UU9L 1N36Q 4C3JH 5C3EG 1FL0A 3CXCA 1PH4A 1VQNA 1IZ6A 4AIMA 4OXPA 2H5XA 2E2JH 1WYDA 1PA6A 3CCRA 1HR0L 2IHEA 4KLKA 2ZJPA 2HT1A 4R1JA 3TEHB 1E1OA 1KRSA 3OTOL 3RNUA 2YU9H 3UDXA 4LF6Q 3PUWA 1ASYA 2PMZE 3A74A 3CW2C 5E7NA 5FLMH 3KJPA 1V43A 3W5OA 2UXDQ 1A0IA 4B3ML 4AQYQ 4JBJA 4GN4B 2K5NA 3T1YL 3HOUG 3PGZA 4HIOA 4A3JH 5H1SE 1IBLQ 3RN2A 2JA8H 3KLWA 1YIJA 4DR6Q 1N33Q 1OXXK 2Z0SA 4POFA 3CCEA 1PH5A 4BBSH 1K8GA 1M1KC 3CAMA 1PH9A 4OWTB 1YITA 4YCVA 3U50C 2PQAB 5ELOA 2UUCL 2R93H 3PIOA 4NXML 2VUMH 1E1TA 1OXTA 2Q2TA 2CKZB 3TREA 3S24A 4YHHL 2NN6I 5IWAQ 3HOVH 4P72A 3RR5A 4A4IA 1YNXA 1UE1A 3KF6A 1OXSC 1YHBA 3B6YA 1X3EA 2C35B 2VY3A 3J80i 4JI1Q 1BVSA 5IP9H 1D8LA 3STBC 4DKAC 4Y7NH 3I55A 2JA5H 4LF7L 2BH2A 5C4JH 4DV6Q 1PH2A 4C3HH 4DV0L 1BBWA 1K73C 4A3KG 5C3EH 4DV1Q 3CCQA 1NMFA 4JI0L 2VQFL 3BJUA 5JEAJ 2GN5A 5LMUQ 5K36G 4DPGA 1X54A 3F1ZA 5M3MG 4X66L 3NELA 2VW9A 3VDYA 4JI4Q 3CF5A 1WCMG 2VL6A 1RL2A 5HY6A 3J81c 4R4TA 1G51A 5GROA 3WWVA 5BR8Q 1VQ6A 5J3BA 2EIFA 1E24A 2JA9A 4DR3L 2Z6KA 1CSPA 1TXYA 4GNXB 1NMGA 1SLJA 1PHJA 1JJ2A 3H3VH 2OTJA 3HOUH 2K75A 2PI2A 1QVGA 4OO1I 5IP7G 4KHPL 1XMOQ 4KI0A 4QIWE 3PUZA 4HJ5A 4DV2L 2KBNA 1C7YA 1EYGA 2QA4A 2UUBQ 3CD6A 1HNWQ 1QUQA 1I3QH 3RZOH 3M7NA 3PF4A 4IFDJ 3M9BA 3K81C 2DGYA 4JI2Q 2HIVA 1N36L 4PZ8A 4A76A 3GD7A 4IO9A 4A75A 1G291 2YTXA 3GTJH 1XTDA 3PO2G 1K83H 2QEXA 3S16H 1VQLA 2HHHQ 3PO3G 3S14H 2PI2E 2QGQA 4NXNQ 4GN5A 2Y0SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  4YCW A;  4LF6 L;  3PUX A;  2I0Q A;  1JMC A;  2Y0S E;  4NPS A;  3G6E A;  2ZTD A;  1TWA H;  4IPG A;  3HKZ G;  3L0O A;  2UXD L;  3K7U C;  2WAQ G;  4A3K H;  4BY7 G;  3CC7 A;  4AQY L;  3HKZ E;  4A3F G;  5C4X G;  1YEZ A;  4P71 A;  3GTL H;  2B3G A;  1P16 A;  2D62 A;  2WAQ E;  5IE8 A;  4IFD I;  1V1Q A;  3PUV A;  5JJK A;  5M3M H;  1IBL L;  4O0A A;  5GAE C;  3CCL A;  1XNR Q;  3L7Z C;  2ALY B;  1PYS B;  1TWG H;  2FXQ A;  1IBM Q;  1N33 L;  2OQK A;  1WCM H;  2NVY H;  4IOA A;  3Q8D A;  1B8A A;  4OON A;  4H02 A;  2KCM A;  2ZJQ A;  2ATW A;  1YI2 A;  3DLL A;  4A3M G;  5GAD C;  3I2Z A;  4QL5 A;  1BBU A;  3M85 A;  1HNX Q;  1EWI A;  1NY4 A;  2MQH A;  3KF6 B;  3K7A H;  3J7A 5;  1R9T H;  3CQZ H;  2IT1 A;  1Q46 A;  5M5W H;  1VQ8 A;  2YTY A;  5IP7 H;  3RLF A;  5GAG C;  3AYH B;  1CUK A;  4JI1 L;  4C2M H;  2V1C C;  4A3I G;  4QQB X;  1P8L A;  3TQY A;  4A3C H;  2D0O A;  2N49 A;  2AMC B;  3I7F A;  3JC6 6;  3STB D;  5LMN Q;  4DV6 L;  4GNX C;  2MO1 A;  4R4Q A;  4IOC A;  1VQP A;  4DK3 C;  1CSQ A;  3W1G A;  3MEF A;  3PO2 H;  4DV1 L;  2I5H A;  1Q12 A;  3K80 C;  1CKM A;  4BA1 I;  1X65 A;  1XPO A;  1XMQ Q;  2AKW B;  5LMU L;  1S40 A;  5JJI A;  2K50 A;  1W2B A;  1A62 A;  3ER0 A;  2NVX H;  3PO3 H;  4X64 Q;  4JC0 A;  5FJ8 G;  2EQS A;  4JI4 L;  4DUY Q;  1KC8 C;  3I4O A;  1MJC A;  2Q2H A;  3AQQ A;  3CP0 A;  1N32 Q;  3CC4 A;  2JA6 G;  3S2H H;  4TQU S;  4LF8 Q;  1VQ4 A;  1HZB A;  4JOI C;  1B7Y B;  4GOP B;  3CCJ A;  4BY7 H;  2NZO A;  2GVA A;  3F8T A;  1VQJ A;  4X65 Q;  4OX9 Q;  4A3F H;  3UDI A;  5C4X H;  3KFU A;  2CWP A;  4LFA Q;  1QUQ B;  2YV5 A;  2ZTC A;  1AH9 A;  1L1O B;  1H95 A;  3CCV A;  1XMO L;  2UUA L;  2NZH A;  3U4V A;  5M5X H;  3JAM i;  4UPA A;  1HNW L;  1G6P A;  2UUB L;  1U5K A;  3KOJ A;  4YY3 Q;  1SR3 A;  1TWH H;  5GAH C;  2WB1 G;  3ULP A;  1KD1 C;  1LUZ A;  3DM3 A;  4BY1 G;  1FJG Q;  2E2H H;  3RLN A;  5C0X I;  3TRZ A;  4JI2 L;  1S72 A;  4BA2 I;  1HZ9 A;  1K0R A;  2WB1 E;  4JCV E;  1HZA A;  4A3M H;  5IYC G;  1Q82 C;  1DGS A;  5JEA G;  1VQO A;  1VQD A;  5LMN W;  4GLA C;  4KHZ A;  4NXN L;  1OXU A;  2AWO A;  3L2P A;  1KIX A;  2KHI A;  3AFP A;  2XTI A;  5AJ3 Q;  4DV7 Q;  4LF5 Q;  2UXB L;  1VQK A;  1VS0 A;  4A3I H;  1Y1V G;  4DAY B;  3S1R H;  1X55 A;  2VNU D;  3K0X A;  4J15 A;  1MJE A;  3IRB A;  1L0W A;  2F52 A;  3K8A A;  3M4P A;  4LF4 Q;  4IPH A;  4B3R Q;  2IY5 B;  4A3E G;  1KXL A;  1KHI A;  3HOY G;  3E9I A;  2WP8 J;  4B3S Q;  4UP8 A;  4HID A;  5FJ8 H;  3KJO A;  1B70 B;  1Q1B A;  1S3O A;  4EX5 A;  5FLX c;  1IBM L;  2BA1 A;  1Y1W G;  4IFD G;  1VQA A;  1PV4 A;  2JA6 H;  1YJW A;  2MO0 A;  2RCN A;  1X9N A;  1RIP A;  2BA0 A;  3GTO H;  1HNX L;  4L5Q A;  5M3F G;  4QGU A;  2IHF A;  4JI8 Q;  4DR2 Q;  3F2D A;  1YHQ A;  1I94 L;  4XIG S;  1ASZ A;  2ES2 A;  4DR7 Q;  2VQE Q;  1QZG A;  1L2F A;  3T1H Q;  3BZC A;  1EIY B;  3HFZ B;  4MTN A;  2K52 A;  2MFI A;  1N9W A;  3M3Y H;  1VQH A;  1JJC B;  2B63 G;  4JBK A;  1K9M C;  4BY1 H;  1BKB A;  4DV3 Q;  3FP9 A;  5LMN L;  4GOP C;  3FHW A;  3UDF A;  4L5R C;  2F4V Q;  5IYC H;  1NTG A;  1J5E Q;  3OW2 A;  1PH1 A;  2NVT H;  1L1O C;  3D0F A;  1XMQ L;  2Q2U A;  2HQL A;  2L15 A;  1J6Q A;  1SN8 A;  4DUZ Q;  1VQM A;  1U0L A;  4X64 L;  3TS0 A;  3RZD H;  4DUY L;  4HJA A;  3H3V I;  2A19 A;  1T9H A;  4UP7 A;  1VCI A;  3AFQ A;  5DLQ E;  2JJQ A;  1Y1V H;  3MXN B;  4LF9 Q;  1N32 L;  3F2C A;  5JJL A;  2EXD A;  3A0J A;  4LWC A;  3I56 A;  4LF8 L;  2D0P A;  4A3B G;  4TVA B;  4X65 L;  4OX9 L;  1WJJ A;  4NB3 A;  1Q7Y C;  3J81 j;  4A3G G;  4K0K Q;  4A3E H;  3RLO A;  2R7D A;  4LFA L;  3HOY H;  4GKJ Q;  4RG1 A;  1GD7 A;  4DR4 Q;  3PV0 A;  4BXX G;  3G71 A;  2I5L X;  4JV5 Q;  1JJG A;  5GQO A;  1IBK Q;  1W3S A;  4YY3 L;  4R4C A;  3S1N H;  3GTP H;  1Y1W H;  1YJ9 A;  1XNQ Q;  4DR6 L;  3D31 A;  5EAY A;  4JYA Q;  4DK6 C;  1FJG L;  1O7I A;  4BBR G;  3S1M H;  1EQR A;  1GM5 A;  1NBW A;  5C44 G;  5M3F H;  2K4K A;  1CKN A;  2IX1 A;  3S2D H;  1LTL A;  2AHO B;  2E5L Q;  1KL9 A;  1E7Z A;  3LGJ A;  1PH3 A;  2LXK A;  5AJ3 L;  4DV7 L;  1EQQ A;  4LF5 L;  1N34 Q;  3FKI G;  5IWA L;  4DAM A;  4A3L G;  1KQS A;  1JE5 A;  2N78 A;  4PMW A;  2B63 H;  3U58 A;  1YBY A;  4P73 A;  1Q8K A;  1FGU A;  3G4S A;  2NN6 G;  2OCE A;  4JI3 Q;  3AEV A;  3ICE A;  5IT9 c;  4B3R L;  1GVP A;  4LF4 L;  1VQ9 A;  1I6H H;  3CPF A;  4JI7 Q;  1K3R A;  1HNZ Q;  1OXV A;  1HZC A;  4QJF A;  1SE8 A;  3KDF A;  2MNA A;  2N8N A;  1D7Q A;  2R7F A;  4MZ9 A;  4HJ8 A;  4YCU A;  5C0X J;  4LNQ A;  1EFW A;  3HOX G;  1XPR A;  3ULJ A;  4LUZ A;  2XGT A;  1A63 A;  2K14 A;  4AYB G;  1WOC A;  5HGQ A;  3GTK H;  4LFB Q;  4A3B H;  2JQO A;  4L5T A;  4AYB E;  3ZJY C;  4FDB A;  5BR8 L;  3H15 A;  4WJ3 M;  5M5Y H;  4GNX A;  4JI8 L;  4DR2 L;  4DR7 L;  4A3G H;  2VQE L;  3T1H L;  4IJH A;  1I50 H;  1VQ5 A;  3CMA A;  4BXX H;  1UE7 A;  2JK8 A;  4DR5 Q;  1MIU A;  1QZH A;  4IPC A;  3HOZ G;  1Q81 C;  3G48 A;  3I4N H;  1AE2 A;  1TWC H;  3GO5 A;  4MNO A;  4DV3 L;  3EN2 A;  3CC2 A;  1QVF A;  4BBR H;  4OO1 G;  2N3S A;  2UXC Q;  3JAM c;  2BH8 A;  2GVB A;  2ZTE A;  3EBE A;  4JI5 Q;  2E8G A;  1X3F A;  5C44 H;  1J5E L;  2F4V L;  3HOW G;  4GKK Q;  1Z47 A;  4JOI A;  3W1B A;  4ME3 A;  4PZ7 A;  4DUZ L;  4LW1 A;  2HHH L;  3GDE A;  3GTG H;  4P75 A;  4HJ9 A;  1NE3 A;  3PIP A;  4DV5 Q;  3FKI H;  1PH8 A;  3GTQ H;  1LYL A;  4A3L H;  4L5S A;  4LF9 L;  4UP9 A;  3PUY A;  2CWA A;  3UE0 A;  3CPW A;  4A3C G;  1GKH A;  3M4O H;  1AE3 A;  1I5F A;  3H0G G;  4RMF A;  4C3I H;  3CCS A;  1C9O A;  1CKO A;  1KRT A;  4LFC Q;  4K0K L;  1YHA A;  2YYZ A;  4GKJ L;  4DR4 L;  2JE6 I;  3J80 c;  2OTL A;  2PNH A;  4JV5 L;  1IBK L;  4HIM A;  4X62 Q;  1XNR L;  2R7Z G;  3HOX H;  3NEN A;  1XNQ L;  4B3T Q;  1SMX A;  2CFM A;  2B29 A;  2DUD A;  4JYA L;  1CKN B;  3M4Q A;  4DV4 Q;  1K8A C;  3J7Z C;  2Q2I A;  1M90 C;  1PYB A;  4PZ6 A;  4XTC S;  4IJL A;  1PVO A;  4A93 G;  4POG A;  1VQC A;  1IXR A;  1VQG A;  3NBH B;  3KYH C;  3GTM H;  3OYY A;  3U4Z A;  2E5L L;  4ALP A;  4DR1 Q;  3S17 H;  1UEB A;  1N34 L;  2A8V A;  4APV A;  2ZM6 Q;  1VQ7 A;  2Z6K C;  4AH6 A;  3HOZ H;  4JI6 Q;  4JI3 L;  1FVI A;  2UU9 Q;  3CCM A;  1HH2 P;  2E2I H;  1C0A A;  3KDF B;  2F3I A;  4YWL A;  4LUO A;  1YZ6 A;  4JI7 L;  1Q1E A;  1V9P A;  3J81 i;  1HNZ L;  1HR0 Q;  3HOW H;  2AWN A;  4HJ7 A;  1SRO A;  1A8V A;  1Z9F A;  1TWF H;  1Y14 B;  2KCT A;  3OTO Q;  3PCO B;  4JBW A;  1YJN A;  3HKS A;  1PH7 A;  2OWO A;  2HIX A;  2RHQ B;  3ULL A;  4A3D G;  1EOV A;  1Q86 C;  4LFB L;  4O2D A;  1UE6 A;  1X56 A;  4PG3 A;  1XPU A;  1KAW A;  1N8R C;  3I4M G;  2OQ0 A;  1X6O A;  2A1A A;  3H0G H;  4JG2 A;  2LXJ A;  4B3M Q;  4DNI A;  4GOP A;  4R4I A;  3T1Y Q;  2UUA Q;  5IYB G;  1NJI C;  2K5H A;  4EQ5 A;  3F2B A;  3RN5 A;  5IYD G;  1IYJ B;  2R92 G;  1VQF A;  1L1O A;  2R6G A;  1SRU A;  3KF8 B;  4DR5 L;  3SGI A;  3ERS X;  3PF5 A;  1WFQ A;  1SFO H;  1VQI A;  4JBM A;  2JA7 G;  4X6A H;  2R7Z H;  1HJP A;  4GLX A;  1YVC A;  3E0E A;  2WFW A;  2UUC Q;  4NXM Q;  3E9H A;  3I4N G;  2UXC L;  2I5M X;  4JI5 L;  2PQA A;  4A93 H;  4GKK L;  3UDG A;  3S15 H;  4UY8 C;  2UXB Q;  1MKH A;  4YHH Q;  2JEA I;  5C0X G;  1LM0 A;  4GN3 B;  4QY7 A;  1HR0 W;  1VQE A;  3S1Q H;  4DV5 L;  4LF7 Q;  1UE5 A;  4LUV A;  1GO3 E;  1VQB A;  2YTV A;  2LSS A;  1EIF A;  2VZA A;  5FLM G;  1JT8 A;  4R4O A;  2CCZ A;  2JEB I;  2KEN A;  4DV0 Q;  2RF4 A;  4WJ4 A;  2CQO A;  3BU2 A;  4JI0 Q;  2VQF Q;  2ID0 A;  4LFC L;  3PSI A;  3A5U A;  2NVQ H;  4A3J G;  2IX0 A;  4X66 Q;  1X3G A;  4OWW B;  2JA8 G;  3A5Z B;  3NEM A;  4B3S L;  2KHJ A;  3CME A;  4OWX B;  1IL2 A;  4BBS G;  4X62 L;  1PFS A;  2VS1 A;  1EUJ A;  4B3T L;  4A3D H;  4Y52 H;  4DV4 L;  2R93 G;  1XJV A;  3BZK A;  4DR3 Q;  1I94 Q;  3I4M H;  3EIV A;  4GLV B;  5ELN A;  4YWM A;  3CCU A;  2VUM G;  2ZJR A;  4HIK A;  2K5V A;  1OTC A;  5IYB H;  2RHS B;  4KHP Q;  5IYD H;  3HOV G;  2R92 H;  5IY0 A;  4GS3 A;  4DV2 Q;  4DR1 L;  4IPD A;  1QVC A;  1JB7 A;  1E3P A;  4YWK A;  1WI5 A;  2JA7 H;  3TS2 A;  5IP9 G;  4P74 A;  3UE1 A;  2JA5 G;  2ZM6 L;  1UWV A;  1PH6 A;  2ASB A;  4JI6 L;  2UU9 L;  1N36 Q;  4C3J H;  5C3E G;  1FL0 A;  3CXC A;  1PH4 A;  1VQN A;  1IZ6 A;  4AIM A;  4OXP A;  2H5X A;  2E2J H;  1WYD A;  1PA6 A;  3CCR A;  1HR0 L;  2IHE A;  4KLK A;  2ZJP A;  2HT1 A;  4R1J A;  3TEH B;  1E1O A;  1KRS A;  3OTO L;  3RNU A;  2YU9 H;  3UDX A;  4LF6 Q;  3PUW A;  1ASY A;  2PMZ E;  3A74 A;  3CW2 C;  5E7N A;  5FLM H;  3KJP A;  1V43 A;  3W5O A;  2UXD Q;  1A0I A;  4B3M L;  4AQY Q;  4JBJ A;  4GN4 B;  2K5N A;  3T1Y L;  3HOU G;  3PGZ A;  4HIO A;  4A3J H;  5H1S E;  1IBL Q;  3RN2 A;  2JA8 H;  3KLW A;  1YIJ A;  4DR6 Q;  1N33 Q;  1OXX K;  2Z0S A;  4POF A;  3CCE A;  1PH5 A;  4BBS H;  1K8G A;  1M1K C;  3CAM A;  1PH9 A;  4OWT B;  1YIT A;  4YCV A;  3U50 C;  2PQA B;  5ELO A;  2UUC L;  2R93 H;  3PIO A;  4NXM L;  2VUM H;  1E1T A;  1OXT A;  2Q2T A;  2CKZ B;  3TRE A;  3S24 A;  4YHH L;  2NN6 I;  5IWA Q;  3HOV H;  4P72 A;  3RR5 A;  4A4I A;  1YNX A;  1UE1 A;  3KF6 A;  1OXS C;  1YHB A;  3B6Y A;  1X3E A;  2C35 B;  2VY3 A;  3J80 i;  4JI1 Q;  1BVS A;  5IP9 H;  1D8L A;  3STB C;  4DKA C;  4Y7N H;  3I55 A;  2JA5 H;  4LF7 L;  2BH2 A;  5C4J H;  4DV6 Q;  1PH2 A;  4C3H H;  4DV0 L;  1BBW A;  1K73 C;  4A3K G;  5C3E H;  4DV1 Q;  3CCQ A;  1NMF A;  4JI0 L;  2VQF L;  3BJU A;  5JEA J;  2GN5 A;  5LMU Q;  5K36 G;  4DPG A;  1X54 A;  3F1Z A;  5M3M G;  4X66 L;  3NEL A;  2VW9 A;  3VDY A;  4JI4 Q;  3CF5 A;  1WCM G;  2VL6 A;  1RL2 A;  5HY6 A;  3J81 c;  4R4T A;  1G51 A;  5GRO A;  3WWV A;  5BR8 Q;  1VQ6 A;  5J3B A;  2EIF A;  1E24 A;  2JA9 A;  4DR3 L;  2Z6K A;  1CSP A;  1TXY A;  4GNX B;  1NMG A;  1SLJ A;  1PHJ A;  1JJ2 A;  3H3V H;  2OTJ A;  3HOU H;  2K75 A;  2PI2 A;  1QVG A;  4OO1 I;  5IP7 G;  4KHP L;  1XMO Q;  4KI0 A;  4QIW E;  3PUZ A;  4HJ5 A;  4DV2 L;  2KBN A;  1C7Y A;  1EYG A;  2QA4 A;  2UUB Q;  3CD6 A;  1HNW Q;  1QUQ A;  1I3Q H;  3RZO H;  3M7N A;  3PF4 A;  4IFD J;  3M9B A;  3K81 C;  2DGY A;  4JI2 Q;  2HIV A;  1N36 L;  4PZ8 A;  4A76 A;  3GD7 A;  4IO9 A;  4A75 A;  1G29 1;  2YTX A;  3GTJ H;  1XTD A;  3PO2 G;  1K83 H;  2QEX A;  3S16 H;  1VQL A;  2HHH Q;  3PO3 G;  3S14 H;  2PI2 E;  2QGQ A;  4NXN Q;  4GN5 A;  2Y0S G; 
#chains in the Genus database with same CATH topology
 1I3Q B;  3HS0 C;  4IUN A;  3ERO A;  2K6A A;  1JMC A;  1R4P B;  1LT4 D;  2KCN A;  1TWA H;  1EU4 A;  2EE1 A;  4IPG A;  5J1Z A;  3K58 A;  3L0O A;  2FIN B;  2RQX A;  3WOE A;  5CBE E;  3GTJ B;  4BY7 G;  2UXD L;  5E4W C;  3CC7 A;  1IL8 A;  2B3G A;  1P16 A;  2WAQ E;  2XIW A;  4K2L A;  5IE8 A;  5EPL A;  3GTL H;  1GUS A;  3T4A C;  5M3M H;  1ENF A;  1H9M A;  4O0A A;  5FO7 B;  2FXQ A;  1TWG H;  1IBM Q;  3R2T A;  1TWA B;  3M4Y A;  3BG3 A;  3RUZ A;  2ZJQ A;  1YI2 A;  4FNF A;  4BS9 A;  4QL5 A;  1HNX Q;  3GTL B;  1NY4 A;  3KF6 B;  3CQZ H;  1IW7 D;  5M3M B;  2NZ1 D;  1TWG B;  2FHT A;  1PFN A;  5GAG C;  4C2M H;  1Y69 U;  4QQB X;  2RDG A;  1NNX A;  1I4R A;  2AMC B;  3JC6 6;  2N49 A;  4ZKB B;  1KAB A;  5BN5 A;  5LMN Q;  4R4Q A;  1LO5 D;  4QIW B;  3CQZ B;  1X65 A;  1S40 A;  5JJI A;  4UDU C;  5A35 A;  2E76 C;  4C2M B;  2B8G A;  3CP0 A;  1N32 Q;  4DXG A;  3K5M A;  4TQU S;  3BVM A;  4LF8 Q;  1VQ4 A;  5KYL A;  3MXN A;  5ELD A;  2NZO A;  3CCJ A;  1DOM A;  5C4X H;  4X3S A;  3KFU A;  4LFA Q;  2YV5 A;  1AH9 A;  1PFM A;  1U5K A;  4ID6 A;  4YY3 Q;  1SR3 A;  3EA6 A;  5KYI A;  1KD1 C;  4DFA A;  1SE2 A;  1HZ9 A;  2WB1 E;  4JCV E;  5C4X B;  5FO9 B;  4XXE A;  4XYQ A;  5CV6 A;  4KHZ A;  1TII D;  4PV1 C;  2KHS A;  2F03 A;  1JQY D;  2UXB L;  3DXJ C;  1VQK A;  1Y8P B;  4A3I H;  4XQQ A;  3GV3 A;  3GP7 A;  1F9S A;  5IGD A;  1ENC A;  3A56 A;  3M4P A;  1B9M A;  4IPH A;  2IY5 B;  1V1P A;  4G7H C;  1KXL A;  1KHI A;  1HXY D;  4UP8 A;  2F0T A;  4RGM A;  3KJO A;  3LWU A;  5IT9 E;  2CH4 W;  4A3I B;  5FLX c;  2BA1 A;  1Y1W G;  1PTO C;  4IFD G;  1DON A;  5I6Y A;  2RCN A;  3LX0 A;  3GTO H;  5M3F G;  5E3F A;  2VB2 X;  4JPB W;  1YHQ A;  4DR7 Q;  1I94 L;  1F9Q A;  5ELB A;  2O2L D;  3Q22 A;  1L2F A;  1MGS A;  1EIY B;  2ICI A;  4XT3 B;  2K52 A;  3MHB A;  1STY A;  3FP9 A;  1EQT A;  2EJM A;  1NTG A;  5JEA H;  4LJZ C;  2Q2U A;  1LV9 A;  2L15 A;  1J6Q A;  1A3V A;  4HJA A;  4ZYS A;  1T9H A;  4UP7 A;  3AFQ A;  1Y1V H;  2BCO A;  4LF9 Q;  2A6E C;  3F2C A;  2EXZ A;  2B2U C;  1TT2 A;  2PPB C;  4OX9 L;  3A7A B;  1B53 A;  1Q7Y C;  4A3G G;  4A3E H;  1K83 B;  3RLO A;  2DN8 A;  1CQV A;  1TY0 A;  4DR4 Q;  4RAU C;  2B8F A;  4BXX G;  4JV5 Q;  3SK5 A;  1EWC A;  3N6R A;  1IBK Q;  1W3S A;  5BN3 A;  1Y1V B;  4R4C A;  3LWE A;  1SEB D;  4KN4 C;  5EAY A;  4JYA Q;  4DK6 C;  4MN3 A;  4A3E B;  5C44 G;  1FYC A;  2L9H A;  5L37 A;  1PYW D;  1LTL A;  2E5L Q;  4G7O C;  3LGJ A;  4CDE C;  4DV7 L;  1EQQ A;  4LF5 L;  2PO4 A;  1JOK A;  1KQS A;  1GUG A;  3U58 A;  3H09 A;  3NWT A;  1YBY A;  4JI3 Q;  1Q8K A;  1SMY C;  4WRD A;  4B3R L;  1WTV A;  4LF4 L;  1VQ9 A;  2Q8I B;  1X3P A;  1HNZ Q;  1BCP B;  3QJY A;  3MEH A;  1NAP A;  3KDF A;  2I07 B;  2N8N A;  5M5W B;  4IZ8 A;  3TP6 A;  3OW7 A;  1EYC A;  1BF4 A;  1EFW A;  1XPR A;  1CTM A;  2KEC A;  4AYB G;  2B2T C;  1LT6 D;  4L5T A;  3ZJY C;  1B9N A;  1VMC A;  1BUV T;  4JI8 L;  3I70 A;  4DR2 L;  2VQE L;  2F0J A;  3D6W A;  4N8F A;  2JK8 A;  4DR5 Q;  1MIU A;  1F2Z A;  1F2Y A;  4WFN 3;  3DM1 A;  1TVX A;  5DAU A;  4IPC A;  4RFB A;  1CK1 A;  1Q81 C;  3KF8 A;  3K5O A;  1AE2 A;  1QVF A;  3S2H B;  2F4V L;  5DNF A;  1X3F A;  1Z47 A;  4J6H A;  4HED A;  5EKI A;  3ND9 A;  4KKU A;  1RKN A;  3KBX A;  4UP9 A;  3PUY A;  2CWA A;  2A6E D;  3CPW A;  1GKH A;  4O1N A;  5EBD A;  1I5F A;  4RMF A;  1CKO A;  1EOT A;  3T16 A;  2YYZ A;  4GKJ L;  1SJH D;  3DWA A;  5EPK A;  3HOX H;  1QCB D;  4OIK A;  1XNQ L;  2CFM A;  3MXU A;  1CKN B;  1PDQ A;  1ONL A;  2RSO A;  5I6W A;  3NBH B;  3U4Z A;  4DR1 Q;  3BDC A;  1UEB A;  3HOX B;  2QF7 A;  2XRQ D;  2A8V A;  5D3D A;  1VQ7 A;  3KLS X;  4L8J A;  2NTS A;  1SMY D;  2F3I A;  4CJ2 C;  3TP5 A;  4JI7 L;  1Z6H A;  2PZU A;  2AWN A;  1Y14 B;  4RGT A;  5EKK A;  1Z7T A;  1YJN A;  2RHQ B;  3ULL A;  4O2D A;  1UE6 A;  4PG3 A;  4RCO A;  1N8R C;  3AU7 A;  3H0G H;  2XRS D;  4RCN A;  3T1Y Q;  3F2B A;  3RD4 A;  5IYD G;  1IYJ B;  1S4Z A;  4JK1 C;  3W2D A;  2QCP X;  1KTK A;  1B44 D;  2JA7 G;  4N9T A;  3BS1 A;  4RHS A;  1YVC A;  3E0E A;  3HRZ C;  1JOR A;  3H0G B;  5CV9 A;  3E9H A;  2UXC L;  4HTH A;  2ENB A;  4K6D A;  1MI2 A;  4GKK L;  2FJ2 A;  3UDG A;  1MKH A;  5CBA E;  5EJW A;  1Q90 A;  2XWJ B;  5C0X G;  1HR0 W;  2IW3 A;  4DV5 L;  2EYM A;  3J80 L;  1GO3 E;  1VQB A;  2F0K A;  3A8K E;  2VZA A;  2I46 A;  2KEN A;  4EQP A;  2RF4 A;  2Z8L A;  1G8Z D;  4OL7 A;  3FRP B;  2QKI C;  1IKL A;  3DHQ A;  1H9J A;  2VQF Q;  1ROD A;  4LFC L;  3A5U A;  1X3G A;  3NUC A;  2EYL A;  3NPP A;  1JB3 A;  3CRL C;  2KHJ A;  3OIP A;  1S5F D;  4X62 L;  1PZI D;  1CZW A;  3NHH A;  1XWE A;  2G5D A;  3BZK A;  4LMQ D;  3KLR A;  4DR3 Q;  4GLV B;  3CCU A;  5IYB H;  3HOV G;  5KNC A;  2R92 H;  1KNE A;  4ULL A;  4ILW A;  2RCF A;  4UHV A;  1ILP A;  2ASB A;  1I4P A;  3MZ5 A;  5D14 A;  2H5X A;  1HR0 L;  2ZJP A;  2R92 B;  4DNT B;  1CT1 D;  3C1E A;  3RNU A;  2YU9 H;  1E0B A;  1BXT A;  1EIG A;  4NP5 A;  2QDL A;  3CW2 C;  3V05 A;  3I4N B;  3W5O A;  2D5D A;  4CKE A;  1K3B C;  5IGE A;  3HOU G;  3PGZ A;  1WTH A;  1C48 A;  2YU9 B;  2JA8 H;  4DR6 Q;  3CAM A;  1PH9 A;  1SXT A;  3U50 C;  2PQA B;  3WOF A;  2R93 H;  2LFN A;  2A69 C;  4G4K A;  1IKM A;  2EDG A;  5BN4 A;  4HN7 A;  1OXT A;  2K32 A;  3DEO A;  4ZCK A;  1CM9 A;  2Q2T A;  2JA8 B;  3S24 A;  4YHH L;  3EJI A;  1BCP F;  3RR5 A;  4A4I A;  3VR6 A;  2VY3 A;  1HTL D;  4Y7N H;  3STB C;  3I55 A;  2R93 B;  2BH2 A;  4DV6 Q;  4C3H H;  4FXG C;  3H91 A;  4DV1 Q;  4IQZ A;  1NMF A;  4RHR A;  3I90 A;  3K0Y A;  3F1Z A;  5M3M G;  3V2T A;  4CKC A;  2VW9 A;  4JI4 Q;  5LL6 S;  5JOB A;  2OXP A;  2VL6 A;  4Y7N B;  4KY5 A;  3I8Z A;  3J81 c;  4R4T A;  3WWV A;  4C3H B;  5J3B A;  2Z6B A;  4RGN A;  2NWG A;  4S3S A;  1SLJ A;  2F0V A;  3H3V H;  1C4Q A;  3I4L A;  1XMO Q;  1EYG A;  1HNW Q;  3CD6 A;  3TP8 A;  1QUQ A;  3TSS A;  3RZO H;  3PF4 A;  4IFD J;  2PNR C;  1GOZ A;  3IFD A;  2F0U A;  3GD7 A;  1G29 1;  4ODG A;  1XTD A;  4IN3 A;  1JOQ A;  1SSO A;  4K8J A;  4M1U B;  1JOO A;  4IUT A;  3RZO B;  1PXU A;  1AEX A;  1L0Y B;  2CQA A;  4A3K H;  1LTA D;  2G9H D;  5C4X G;  2JXM B;  1EZ8 A;  2D62 A;  1V1Q A;  5E4X A;  1IBL L;  5GAE C;  3CCL A;  2EJG C;  2LS0 1;  2ALY B;  1N33 L;  2JN4 A;  1WCM H;  1PZJ D;  2NVY H;  3I91 A;  1B8A A;  2KCM A;  4A3K B;  3DLL A;  1PTO H;  2A69 D;  4J1M A;  4GZY C;  3A8J E;  1R9T H;  2K5Q A;  4U67 3;  5IP7 H;  1BCP D;  1HFN A;  2NVY B;  4A3I G;  1XX8 A;  1I4X A;  3FVQ A;  3S9W A;  3TQY A;  1PTO B;  3STB D;  4QB4 A;  2QW7 A;  2OF1 A;  2MO1 A;  4DK3 C;  1CSQ A;  3W1G A;  3MEF A;  1QB5 D;  1YNJ C;  1R9T B;  1PLF A;  3ER0 A;  1ZEQ X;  2R3Z A;  4JC0 A;  3D4D A;  3C2P A;  5EKL A;  3CC4 A;  2PQE A;  2PW5 A;  5D65 A;  2XN9 C;  1HZB A;  5EQ0 A;  3Q24 A;  4X65 Q;  4C3J B;  3UDI A;  2ZTC A;  2Y0S B;  2UUA L;  3UI2 A;  2L5T A;  4OIJ A;  2EY2 A;  4ZKC B;  1FJG Q;  2E2H H;  5C0X I;  3TRZ A;  4JI2 L;  1QNK A;  4BA2 I;  1HZA A;  1Q82 C;  1VQO A;  5JEA G;  3ITP A;  5LMN W;  1KIX A;  4H7B A;  1OXU A;  3L2P A;  2F0N A;  4KKS A;  2DNC A;  3AFP A;  2K01 A;  4TKO B;  1Y1V G;  2MPM A;  5CC4 A;  2E2H B;  2NN6 H;  4J15 A;  2RSN A;  1DM0 B;  3IRB A;  1WTR A;  1L0W A;  4IUU A;  2F3V A;  4A3E G;  5TSS A;  3SHL A;  1VF5 C;  4PMC A;  4CGY B;  5JAV A;  4HID A;  2KVM A;  5FJ8 H;  1Q1B A;  4EX5 A;  4X3T A;  1IBM L;  2DY7 A;  1YJW A;  2O5J C;  2H4O A;  1X9N A;  4DGZ A;  2BA0 A;  2D2C C;  1HNX L;  5A2Q E;  4XIG S;  1BBX C;  1EWH A;  4OHJ A;  3TDQ A;  2XVS A;  3T1H Q;  5I9O A;  4KD4 A;  1VQH A;  1A2U A;  3TME A;  1SNM A;  4GOP C;  5LMN L;  4L5R C;  5IYC H;  3IKJ A;  1L1O C;  4EQN A;  2B2Y A;  2HQL A;  2WKC A;  1VQM A;  3TS0 A;  1FNW A;  1D5X C;  2HCI A;  3RZD H;  2A19 A;  5FOB B;  1N32 L;  1VCI A;  2SDF A;  2EOT A;  2EXD A;  4LF8 L;  2D0P A;  2IX3 A;  3BDL A;  1WJJ A;  4K0K Q;  4LFA L;  3HOY H;  3D4R A;  3S16 B;  1GD7 A;  3MFG A;  3RZD B;  3U9O A;  1MD2 D;  1D1K A;  1JJG A;  3QG1 A;  4YY3 L;  1IYV A;  5JPM C;  3S1M H;  2QDB A;  3HOY B;  1XTC D;  4CKB A;  2AHO B;  4U68 A;  4CJ1 B;  1PH3 A;  1VMP A;  2B63 H;  3S1M B;  3NXW A;  2C5C A;  3G4S A;  2OCE A;  1GVP A;  4OEL B;  1NUC A;  2AUK A;  4DAP A;  3P7J A;  2R7F A;  2O5I C;  5C0X J;  3A55 A;  1SE3 A;  3HOX G;  3L9A X;  1O78 A;  1EQV A;  1A63 A;  1WOC A;  5HGQ A;  1UAP A;  4A3B H;  3SK4 A;  2OT2 A;  1O7Z A;  2K7V A;  1D5Z C;  4AYB E;  5BR8 L;  4HSP A;  3H15 A;  2Z9H A;  2LMC B;  3H3V C;  4DR7 L;  4C56 C;  1LTT D;  5KEE A;  1I50 H;  3CMA A;  4N8X 1;  1I4H A;  4ZUJ A;  3GO5 A;  2L1B A;  4MNO A;  3EN2 A;  3C3L A;  2N3S A;  3JAM c;  2GVB A;  4R8I A;  4JI5 Q;  4PNY A;  1I50 B;  2AUJ D;  2ZXO A;  4PZ7 A;  2HHH L;  3GDE A;  4P75 A;  3GTQ H;  1IHZ A;  3DWQ A;  4LF9 L;  3H0G G;  1G2T A;  2K05 A;  4DR4 L;  2OTL A;  4JV5 L;  3GTQ B;  2LKV A;  4H0L C;  5HGT A;  1IBK L;  4HIM A;  1DD2 A;  1XNR L;  3NEN A;  4B3T Q;  1SMX A;  2B29 A;  2DUD A;  1STE A;  4DV4 Q;  4JYA L;  3J7Z C;  3J7Y W;  1PTO F;  1VQC A;  5IT9 L;  2E5L L;  4KN7 C;  3TZD A;  2Z6K C;  4AH6 A;  5C3X A;  4JI6 Q;  1J9O A;  2HUG A;  4JI3 L;  3MVV A;  1STG A;  2E2I H;  1C0A A;  2CHB D;  2HD3 A;  3GTO B;  4RKL A;  1V9P A;  3J81 i;  3SK6 A;  1HNZ L;  1SRO A;  1A8V A;  1Z9F A;  1TWF H;  5C6A A;  3C1F A;  3LNN A;  2OWO A;  3K57 A;  1EOV A;  2E2I B;  5C3W A;  1X56 A;  4A3C H;  1KAW A;  2A1A A;  2OQ0 A;  4B3M Q;  4DNI A;  2CH4 A;  2N55 A;  5IYB G;  1TWF B;  2R92 G;  1VQF A;  4RH6 A;  1A2T A;  3VR5 A;  4DR5 L;  2VB3 X;  4KJO A;  3ERS X;  4RGO S;  3SGI A;  1WTQ A;  1SFO H;  4JBM A;  4X6A H;  2R7Z H;  1HJP A;  1O80 A;  5KIX A;  1DYQ A;  3Q6S A;  2UUC Q;  3I4N G;  5CGK A;  1F9P A;  2UXB Q;  2DY8 A;  1SFO B;  2J0T D;  3MXP A;  2R7Z B;  3OIQ A;  4LF7 Q;  4LUV A;  3EVQ A;  3ERQ A;  2Z4H A;  4R4O A;  5CV7 A;  5FO8 B;  3FMC A;  2EYP A;  4WJ4 A;  3BU2 A;  5FK9 C;  2DJG C;  4JI0 Q;  2ID0 A;  2NVQ H;  2A6H C;  2WAC A;  4QF4 A;  4X66 Q;  2JA8 G;  3NEM A;  4B3S L;  4OWX B;  1EY6 A;  1PFS A;  2R93 G;  1KNA A;  1XJV A;  1I94 Q;  4Z9C B;  1PTO D;  2NVQ B;  3J81 E;  4KHP Q;  2DJF C;  5EPJ A;  4DV2 Q;  3H6M A;  4DR1 L;  1QVC A;  2O4X A;  1E3P A;  4FF4 A;  4X3U A;  3URY A;  3TS2 A;  4XYO A;  1UWV A;  4C3H G;  1N36 Q;  3CXC A;  1PH4 A;  2KA7 A;  1VQN A;  2B2T A;  4QUC A;  4AIM A;  4KK7 A;  3SEB A;  1WYD A;  2E2J H;  1HA6 A;  1PA6 A;  1XXG A;  4K6L A;  3E0J A;  3NTK A;  4UAI A;  5CYU A;  1KLG D;  4LF6 Q;  2EY1 A;  1ASY A;  3NQT A;  4ZRZ A;  1RTO A;  2PMZ E;  3A74 A;  5E7N A;  2E2J B;  4AQY Q;  1G91 A;  4PQX A;  3T1Y L;  4A3J H;  3CKI B;  1HTP A;  3N52 A;  2RVL A;  1YIJ A;  1JE4 A;  1LTR D;  1OXX K;  3CCE A;  4F87 A;  1PH5 A;  4BBS H;  1K8G A;  1M1K C;  4K5X A;  1YIT A;  1TQO A;  2R61 A;  3NTI A;  2E2D C;  4A3J B;  2CKZ B;  3L3O C;  4P72 A;  3KF6 A;  4BBS B;  3B6Y A;  4JI1 Q;  3R93 A;  1X3E A;  3U9S A;  2MJ8 A;  3J80 i;  2KED A;  5IP9 H;  5C4J H;  4B08 A;  3SDZ A;  4A3K G;  2SNM A;  5C3E H;  3CCQ A;  1BO0 A;  2VQF L;  5JEA J;  5LMU Q;  2EVB A;  2KJX A;  2PYK A;  3NWS A;  3NEL A;  3VYR A;  3FEW X;  2A6H D;  3CF5 A;  1WCM G;  2MUY A;  4KJN A;  1RL2 A;  5HY6 A;  3QB3 A;  3TZU A;  5C4J B;  5GRO A;  1VDZ A;  2ICE C;  5C3E B;  1SDF A;  2VXW A;  4DR3 L;  1CSP A;  1PHJ A;  4FXK C;  4L6T B;  2Z1C A;  3T56 B;  5IP7 G;  1STN A;  4QIW E;  2SEB D;  4DNR B;  2UUB Q;  2CW0 C;  3H94 A;  4K14 A;  3M7N A;  4DN4 M;  1AW7 A;  1CZG A;  4PZ8 A;  4A75 A;  3OSO A;  2B2V C;  4QUF A;  4C3J G;  3S14 H;  4NXN Q;  1SAP A;  5CV5 A;  4GN5 A;  3TP7 A;  2Y0S G;  4YCW A;  2I0Q A;  2ZTD A;  4FVM A;  3HKZ G;  1F9R A;  2NYZ D;  4KY7 A;  4TSS A;  1IYU A;  4P71 A;  3S14 B;  5D3I B;  5K36 H;  1K8O A;  4IFD I;  5JJK A;  5EBC A;  1RF2 D;  5JJZ A;  1PYS B;  2RDH A;  3J80 E;  1HHV A;  4F8M A;  4C1N I;  3PIP 3;  4IOA A;  4OON A;  4H02 A;  3TN2 A;  2IWH A;  4FYD A;  3DMU A;  3I2Z A;  1BBU A;  1EWI A;  2MQH A;  3K7A H;  4TRD A;  3J7A 5;  1Q46 A;  1VQ8 A;  2YTY A;  2PZT A;  4HCE A;  4ZAI A;  3RLF A;  5KRU A;  1CUK A;  5EGT A;  5CR3 A;  5I2X A;  4B9W A;  5KNB A;  2D0O A;  1A3T A;  2SNS A;  4DV6 L;  4GNX C;  1PH6 A;  1EY4 A;  1DOL A;  3PO2 H;  4DV1 L;  4HMJ A;  1Q12 A;  3K7A B;  3K80 C;  4BA1 I;  1XPO A;  1XMQ Q;  3V96 A;  1A62 A;  4X64 Q;  5FJ8 G;  2A68 C;  1JWS D;  4JI4 L;  1A6X A;  4DUY Q;  1KC8 C;  3I4O A;  4N9P A;  4EVO A;  1SNQ A;  2E74 C;  1AFP A;  1TS5 A;  3I72 A;  2L4N A;  2MHV A;  4FF1 A;  3PO2 B;  3P20 A;  1MSH A;  4JOI C;  4GOP B;  2GVA A;  4A3F H;  3SK8 A;  2CWP A;  2L12 A;  1GUW A;  1L1O B;  1S5D D;  4EGV A;  1H95 A;  1XMO L;  3U4V A;  3JAM i;  1HNW L;  3KOJ A;  1EZ6 A;  5GAH C;  3DM3 A;  2WAQ B;  1K0R A;  4A3M H;  4A3F B;  5IYC G;  3X3M A;  2X6G A;  4GLA C;  1NSN S;  2KHI A;  1EU3 A;  2V4D A;  3NBI A;  5DM6 3;  1GHK A;  5AJ3 Q;  1VS0 A;  1KDB A;  1JR0 D;  1EIH A;  1FR3 A;  4DAY B;  1STA A;  4NDX A;  3S1R H;  4A3M B;  1X55 A;  2KQ3 A;  3K8A A;  4I65 A;  3ND8 A;  3HOY G;  3E9I A;  2WP8 J;  1WVL A;  1FGB D;  2P5Z X;  1EEF D;  1MSG A;  1DZ1 A;  1B70 B;  1Q8I A;  1S3O A;  1U9R A;  1H9R A;  2X6L A;  1YNN C;  1I4G A;  3S1R B;  1EY7 A;  1PV4 A;  2JA6 H;  1WD0 A;  1RIP A;  2KCC A;  2F0D A;  2HDM A;  4O42 A;  4QGU A;  3CHB D;  1B3A A;  3F2D A;  3D6C A;  2ES2 A;  3MA2 B;  2FFK B;  1M4V A;  3HFZ B;  4MTN A;  2MFI A;  1H9S B;  2WV6 D;  2B63 G;  2B2W C;  4ZUI A;  2SOB A;  4DAV A;  4BY1 H;  4RA8 A;  1BKB A;  4DV3 Q;  1W6K A;  3FHW A;  1M8A A;  1J5E Q;  3OW2 A;  3A8I E;  3T51 B;  3D0F A;  3OMC A;  2PZW A;  4DUZ Q;  2NTT A;  2Q8T A;  3JAM E;  2A68 D;  1AZP A;  3H3V I;  5DLQ E;  4BY1 B;  3MXN B;  5JJL A;  3P1H A;  4LWC A;  4A3B G;  1O7Y A;  2A74 C;  3OPO A;  4X65 L;  3J81 j;  3G71 A;  2I5L X;  4JW0 A;  3S1N H;  3DUZ A;  1D2B A;  3KLS A;  1K28 A;  3A54 A;  1FJG L;  3G6J B;  5I2Y A;  1K8M A;  1EQR A;  1NBW A;  1SNO A;  3KUP A;  1CKN A;  5ELC A;  3S2D H;  2K03 A;  1II3 A;  4X3K A;  2F0P A;  3S1N B;  3NBH A;  4CBV A;  1N34 Q;  5IWA L;  1WCM B;  1V1P B;  4P73 A;  5FLX L;  3BYY B;  3AEV A;  1LAC A;  1DOK A;  1I6H H;  3S2D B;  3CPF A;  1K3R A;  5IOC A;  1HZC A;  3MC0 B;  4QJF A;  1D7Q A;  4MZ9 A;  4HJ8 A;  1TKW B;  4YCU A;  4LNQ A;  2MGS A;  4CHT B;  3Q23 A;  2XGT A;  1D6E C;  2K04 A;  4LFB Q;  1EY9 A;  2JSO A;  4LAA A;  2EYO A;  1I6H B;  2JQO A;  5M5Y H;  1WTX A;  1O7L A;  3T1H L;  1RTN A;  1B1Z A;  1NCV A;  3I3C A;  4ZQ3 A;  5COR A;  1QZH A;  1GUT A;  2F0Q A;  4K2K A;  2GA4 B;  1TWC H;  2HCC A;  3CC2 A;  4BBR H;  5M5Y B;  5NUC A;  3HKZ B;  5ELE A;  2BH8 A;  3EBE A;  2E8G A;  1WTO A;  3W1B A;  4ME3 A;  5AFW A;  2AQ1 B;  4LW1 A;  1B2T A;  2Z4I A;  3PIP A;  1PH8 A;  3FKI H;  2ZXR A;  4A3L H;  1TWC B;  2K5D A;  1J8I A;  3EFX D;  4BBR B;  4YIJ A;  4IUQ A;  5COY A;  3UE0 A;  4A3C G;  1F2L A;  3M4O H;  2TSS A;  4C3I H;  2B39 A;  5T1G A;  4K0K L;  3VYS A;  1YHA A;  3R3O A;  2PCF B;  5C5M A;  3J80 c;  2PNH A;  3FKI B;  2R7Z G;  5CV8 A;  1K8A C;  4C3I B;  1IW7 C;  1M90 C;  1PYB A;  4PZ6 A;  4IJL A;  1PVO A;  1VQG A;  3GTM H;  3S17 H;  1TY2 A;  1BR9 A;  4KHV A;  2ZM6 Q;  3HOZ H;  4XQJ A;  3J7A V;  1FVI A;  2UU9 Q;  4OO1 H;  5A2Q L;  3NP8 A;  4NKL A;  3CCM A;  3KDF B;  4YWL A;  4LUO A;  4DU9 A;  3GTM B;  3HOW H;  1SBB B;  3S17 B;  2F0S A;  1QG7 A;  1YNJ D;  2F0I A;  2KCT A;  3QR8 A;  3OTO Q;  4CDC C;  4HAE A;  4E6I A;  3HOZ B;  1GJX A;  1X6O A;  2LXJ A;  1EY0 A;  3HOW B;  4GOP A;  2UUA Q;  1NJI C;  1DCZ A;  2K5H A;  1SYD A;  1L1O A;  2R6G A;  1SRU A;  3KF8 B;  3PF5 A;  1WFQ A;  1VQI A;  5DEH A;  4GLX A;  1ZXT A;  3ZYY X;  2E75 C;  3E6Z X;  1EL0 A;  5C4Z A;  4NXM Q;  2EZV A;  3NE5 B;  4JI5 L;  1GUO A;  2PQA A;  4A93 H;  2OEO A;  4ME5 A;  3QWN A;  3OOC A;  1LM0 A;  4WJW A;  4GN3 B;  1VQE A;  1UE5 A;  4DAY A;  1JT8 A;  1G6Z A;  4DV0 Q;  1G2S A;  1F77 A;  3QO2 A;  2CQO A;  4A93 B;  4DF7 A;  2RKS A;  2L55 A;  3PSI A;  1ML0 D;  4A3J G;  2IX0 A;  4OWW B;  1JWU D;  4RKB A;  4RWS C;  1A15 A;  1OO9 B;  4BBS G;  2VS1 A;  4B3T L;  4Q0F A;  4A3D H;  4Y52 H;  4DV4 L;  2B63 B;  1SND A;  3VR4 A;  3I4M H;  5J39 A;  1QJO A;  4HIK A;  2K5V A;  2RHS B;  2EPB A;  4GS3 A;  1X3Q A;  2M00 A;  1JB7 A;  4YWK A;  1WI5 A;  1ESR A;  3VYU A;  3BVG A;  4P74 A;  5IP9 G;  4A3D B;  1H9S A;  4FXD A;  1Q3L A;  4JI6 L;  1JCK B;  3I4M B;  1Y8N B;  1FD7 D;  5C3E G;  1FL0 A;  4A3B B;  1B50 A;  1IZ6 A;  1EYD A;  3CRK C;  4OXP A;  3SE0 A;  3SVM A;  5G3L F;  4P2C B;  2HT1 A;  4R1J A;  1E1O A;  4B9X A;  2M9V A;  3UDX A;  5FLM H;  3KJP A;  4KMU C;  2UXD Q;  1A0I A;  1C8C A;  4B3M L;  4JBJ A;  4GN4 B;  2K5N A;  1BQQ T;  2J7Z A;  4HIO A;  2CVR A;  3RN2 A;  3KLW A;  2Z0S A;  4POF A;  3E5S A;  4YCV A;  2UUC L;  1D5M C;  5K5P A;  1STB A;  1QE6 A;  1E1T A;  2VUM H;  1JIC A;  2IL8 A;  3TRE A;  4K5V A;  5JVH 3;  1YNX A;  1OXS C;  1YHB A;  3BYT B;  3O13 A;  2C35 B;  4OEM B;  1BVS A;  1ZYR C;  2JA5 H;  4DKA C;  4LF7 L;  3WDN A;  1K73 C;  1BBW A;  3KBG A;  1XYI A;  2VUM B;  1AZQ A;  2QEJ C;  3T13 A;  4JI0 L;  1WTP A;  2GN5 A;  5K36 G;  1X54 A;  4X66 L;  3VA5 A;  1PFB A;  4V19 0;  4XQN A;  2JA5 B;  4H13 C;  1G51 A;  2F0O A;  5BR8 Q;  1VQ6 A;  2EY6 A;  1UEA B;  3X3N A;  2Z6K A;  1HUN A;  4GNX B;  1NMG A;  3MWY W;  5CV4 A;  1JWM D;  4KKT A;  5DM7 3;  4KHP L;  4L63 B;  4DV2 L;  2KBN A;  4CJ0 B;  1E2Z A;  2QA4 A;  1SJE D;  1C7Y A;  3C46 A;  3VR2 A;  3M9B A;  1TU2 B;  2HIV A;  4HMI A;  1N36 L;  2FMM A;  4A76 A;  3PO2 G;  3RMH A;  4JVZ A;  1K83 H;  1ZKO A;  2QEX A;  1VQL A;  5G3L D;  2HHH Q;  2QGQ A;  4FF3 A;  2B2U A;  1SNP A;  1E22 A;  2G9D A;  4LF6 L;  3PUX A;  2K28 A;  2Y0S E;  3OWF A;  3QIA A;  4NPS A;  3G6E A;  1JC7 A;  1HQR D;  3K7U C;  2WAQ G;  4AQY L;  3HKZ E;  4A3F G;  1YEZ A;  3PUV A;  1XNR Q;  4C1N K;  1SYG A;  1RHP A;  3L7Z C;  4M8A A;  1U4L A;  2LY7 A;  2OQK A;  1GHJ A;  3IAY A;  4CDD C;  3Q8D A;  1DJR D;  2ATW A;  3E3X A;  4A3M G;  3GQB A;  2A73 B;  3IL8 A;  5GAD C;  3VYT A;  3M85 A;  4K8I A;  2IT1 A;  2F0G A;  5M5W H;  4WOR A;  3AYH B;  4JI1 L;  2V1C C;  1P8L A;  1L0X B;  2F0F A;  3I7F A;  1ZYR D;  2FMC A;  4IOC A;  1VQP A;  1S72 A;  3J81 L;  1KLU D;  2I5H A;  1CKM A;  5C5L A;  2AKW B;  3I73 A;  5LMU L;  2K50 A;  1W2B A;  2NVX H;  3PO3 H;  4NW2 A;  5KGU A;  2EQS A;  3PQI A;  3ONA B;  1MJC A;  2Q2H A;  3AQQ A;  3DEP A;  4IAL A;  2JA6 G;  3S2H H;  1B7Y B;  4BY7 H;  3F8T A;  4OX9 Q;  1VQJ A;  4FP5 D;  4PMB A;  3PO3 B;  2NVX B;  1QUQ B;  2TMP A;  2F0H A;  3CCV A;  3D3R A;  2NZH A;  5M5X H;  1G6P A;  4UPA A;  2UUB L;  5IGF A;  1TWH H;  1PRT B;  1B3Q A;  2WB1 G;  1E2V A;  3ULP A;  1LUZ A;  4BY1 G;  4G7Z C;  2XWB B;  3RLN A;  4BY7 B;  1RD9 D;  1ENA A;  1HQM C;  1DGS A;  1VQD A;  1TS4 A;  2XSC A;  5IIF A;  3NSW A;  4K5W A;  4NXN L;  2AWO A;  3AB9 A;  5M5X B;  5LHY 1;  1X32 A;  2XTI A;  4DV7 Q;  1TWH B;  4LF5 Q;  2KEE A;  3Q0A A;  3HZX A;  5HUR A;  2VNU D;  3K0X A;  1MJE A;  1LLR D;  1NR4 A;  4B3R Q;  2F52 A;  4LF4 Q;  3OMG A;  4B3S Q;  4I7Z C;  4J8Q A;  1E2W A;  2ZXP A;  2Q8R E;  1LTB D;  2EJF C;  1QOH A;  4HSV A;  1HFG A;  1AN8 A;  1D1I A;  1VQA A;  4I7A A;  2MO0 A;  3MFY A;  3MTS A;  1B4O A;  2NBF A;  5IOD A;  4L5Q A;  2IHF A;  4JI8 Q;  4DR2 Q;  1ASZ A;  2N88 A;  3M7G A;  2VQE Q;  1QZG A;  5M9O A;  3BZC A;  4F88 A;  1QNU A;  2L0C A;  4MHE A;  1WTW A;  2QIL A;  1I4Q A;  1N9W A;  3M3Y H;  1JJC B;  1RJT A;  4JBK A;  1K9M C;  3P75 A;  1HRJ A;  3UDF A;  5IGB A;  2F4V Q;  1PH1 A;  2NVT H;  1XMQ L;  1AP0 A;  1SN8 A;  1U0L A;  4X64 L;  3FPU B;  4DUY L;  3M3Y B;  3J7A F;  2JJQ A;  1SE4 A;  3A0J A;  3I56 A;  4ABN A;  1CFM A;  2IJ0 A;  2NUC A;  2NVT B;  4TVA B;  3CU7 A;  4NB3 A;  3KK7 A;  4HCS A;  2R7D A;  1SYB A;  1S5E D;  4GKJ Q;  4RG1 A;  2B2V A;  3PV0 A;  2KOL A;  3NK9 A;  4G57 A;  1TS3 A;  5GQO A;  5C4H A;  4IUP A;  3GTP H;  3A7L A;  1Y1W H;  1YJ9 A;  1XNQ Q;  4DR6 L;  4IFD H;  3D31 A;  1O7I A;  4BBR G;  2JYO A;  2A5H A;  1GXD C;  2EYH A;  2JP1 A;  1GM5 A;  1A3U A;  2F1M A;  2K4K A;  5M3F H;  2IX1 A;  1S5B D;  3VA7 A;  2EYJ A;  2F0W A;  1KDA A;  1KL9 A;  1E7Z A;  2LXK A;  5AJ3 L;  1Y1W B;  3GTP B;  3FKI G;  4DAM A;  1QIL A;  2EYF A;  4A3L G;  1JE5 A;  2N78 A;  4PMW A;  2H1E A;  1FGU A;  1BDO A;  2NN6 G;  3ICE A;  5M3F B;  1CA5 A;  4C3I G;  5IT9 c;  1Y8O B;  2HDL A;  3PIO 3;  4JI7 Q;  1KAA A;  4KY6 A;  1EEI D;  1OXV A;  2F4I A;  2IPK D;  1SE8 A;  2MNA A;  5F2D A;  4Q5V A;  3ULJ A;  4LUZ A;  2K14 A;  3GTK H;  2PW7 A;  1PMR A;  4FDB A;  4WJ3 M;  1ICW A;  4GNX A;  3K6O A;  3F2U A;  3BVZ A;  4A3G H;  1LTS D;  1TS2 A;  1LAB A;  4IJH A;  1VQ5 A;  3QOJ A;  4BXX H;  1UE7 A;  3SXH A;  2F0M A;  4R9W A;  4DK0 A;  3GTK B;  3HOZ G;  3G48 A;  3I4N H;  2BOS A;  2CW0 D;  4IUV A;  1NR2 A;  4DV3 L;  4OO1 G;  2UXC Q;  1SNC A;  2C9O A;  2ZTE A;  4A3G B;  5C44 H;  1J5E L;  4GKK Q;  3HOW G;  4JOI A;  1ESF A;  3OHX C;  1SYE A;  4BWG B;  1CQF A;  2XNA C;  4DUZ L;  1EY8 A;  3GTG H;  4HJ9 A;  3K5L A;  1NE3 A;  3T53 B;  4DV5 Q;  1LYL A;  2L11 A;  4L5S A;  1UNS A;  1AE3 A;  4MTK A;  5C44 B;  3CCS A;  1C9O A;  1KRT A;  3TBI B;  1T5E A;  4CDF C;  4LFC Q;  4HR7 B;  1BNZ A;  5IGG A;  1UUP A;  2JE6 I;  1HCZ A;  3GTG B;  1WD1 A;  4X62 Q;  1EFI D;  3M4Q A;  4EQO A;  2Q2I A;  1ET6 A;  1R4Q B;  5JPN C;  1BCP C;  2WKD A;  1F2M A;  4XTC S;  4A93 G;  4POG A;  2AQ2 B;  1IXR A;  1VF7 A;  3KYH C;  3OYY A;  4ALP A;  3NTH A;  2HQE A;  2MP1 A;  1N34 L;  4DXF A;  2RA4 A;  4AYB B;  4APV A;  2JA6 B;  2X69 A;  1CA6 A;  1HH2 P;  4KV6 A;  1RDP D;  1YZ6 A;  2F3W A;  1ILQ A;  1Q1E A;  1HR0 Q;  4HJ7 A;  1HA5 A;  4IUR A;  1LT3 D;  3PCO B;  4JBW A;  5IGC A;  3HKS A;  3D8G A;  1PH7 A;  2J4X A;  2HIX A;  1PRT C;  4A3D G;  1Q86 C;  4LFB L;  2WB1 B;  1T5X D;  1XPU A;  1PRT F;  3I4M G;  2B2W A;  4JG2 A;  1BOS A;  3HP3 A;  4R4I A;  1HPC A;  1V1O A;  4EQ5 A;  3RN5 A;  3JAM L;  5J22 A;  4MIU A;  4DA2 A;  4ZLT F;  3GV6 A;  4KD3 A;  3HG9 A;  4H44 C;  1DXM A;  2WFW A;  3HEJ A;  5KND A;  1I6V C;  2I5M X;  3MXG A;  1MBY A;  1LTG D;  3S15 H;  4UY8 C;  4YHH Q;  1LT5 D;  2K5W A;  2JEA I;  1K0S A;  4QY7 A;  3K59 A;  1S5C D;  1EYA A;  2K1B A;  3S1Q H;  1CHP D;  2YTV A;  2LSS A;  3R2I A;  1EIF A;  5FLM G;  3EQL C;  2JEB I;  2CCZ A;  3AMU A;  3S15 B;  3G7L A;  3SR1 A;  1HUM A;  2BE5 C;  2K33 A;  1V8Q A;  5CMD A;  3A5Z B;  3S1Q B;  5E1F A;  3CME A;  1IL2 A;  2RBM A;  1EUJ A;  5FLX E;  3HGB A;  2WII B;  1YNN D;  3EIV A;  2WIN B;  5ELN A;  4YWM A;  2VUM G;  1U4R A;  2ZJR A;  1OTC A;  1KDC A;  2RDF A;  4V0B A;  4NMZ A;  1FNU A;  2F0L A;  3BZD B;  5IYD H;  1ICF B;  5IY0 A;  4IPD A;  2AQ3 B;  2JA7 H;  1CI3 M;  2JA5 G;  3UE1 A;  2ZM6 L;  2ZT9 C;  2UU9 L;  3DWP A;  4C3J H;  3CCR A;  2IHE A;  4KLK A;  3W3A A;  3TEH B;  1KRS A;  3OTO L;  5C0X H;  2F0E A;  3D4W A;  2JA7 B;  5I4D A;  3PUW A;  1H9K A;  1PRT D;  1V43 A;  1CHQ D;  4LK1 C;  2D9U A;  5H1S E;  1IBL Q;  1SYC A;  1SYF A;  1N33 Q;  2EY5 A;  2DNE A;  2M2L A;  3FPP A;  4OWT B;  3QOL A;  5ELO A;  1RCV D;  1TR5 A;  3PIO A;  4NXM L;  3M4O B;  3VR3 A;  3IFT A;  2NN6 I;  5IWA Q;  3HOV H;  2NB0 A;  1GUN A;  4R8N A;  1UE1 A;  5I9P A;  1MHW C;  4OGQ C;  1D8L A;  4F7X A;  2BDN A;  1PH2 A;  4DV0 L;  3NQI A;  3FDT A;  4DK1 A;  3K5N A;  3BJU A;  1U4P A;  4XDX A;  4DPG A;  3HOV B;  1W6J A;  5ISR A;  1FNV A;  2BE5 D;  3VDY A;  3MAQ A;  1LTI D;  2KUM A;  4FO2 A;  1U4M A;  1ET9 A;  2EIF A;  1E24 A;  2JA9 A;  1EY5 A;  2B2Y C;  1TXY A;  4KTA A;  1JJ2 A;  4XT1 B;  5LL6 X;  2OTJ A;  1PZK D;  5T1I A;  3HOU H;  2K75 A;  2PI2 A;  1QVG A;  4OO1 I;  4KI0 A;  4FF2 A;  3R8B A;  3PUZ A;  4HJ5 A;  2PMZ B;  2BDO A;  5JVG 3;  1I3Q H;  3PMF A;  3K81 C;  4ZK9 B;  5FKA C;  4QCL A;  2DGY A;  4JI2 Q;  4IO9 A;  2YTX A;  3GTJ H;  3HOU B;  3S16 H;  1QWY A;  3PO3 G;  2PI2 E;  3OWE B;  1STH A;  5ELF A;  4QMG A;  3BDO A; 
#chains in the Genus database with same CATH homology
 1E22 A;  4YCW A;  4LF6 L;  3PUX A;  2I0Q A;  1JMC A;  2Y0S E;  4NPS A;  3G6E A;  2ZTD A;  1TWA H;  4IPG A;  3HKZ G;  3L0O A;  2UXD L;  3K7U C;  2WAQ G;  4A3K H;  4BY7 G;  3CC7 A;  4AQY L;  3HKZ E;  4A3F G;  5C4X G;  1YEZ A;  4P71 A;  3GTL H;  2B3G A;  1P16 A;  2D62 A;  2WAQ E;  5IE8 A;  4IFD I;  1V1Q A;  3PUV A;  5JJK A;  5M3M H;  1IBL L;  4O0A A;  5GAE C;  3CCL A;  1XNR Q;  3L7Z C;  2ALY B;  1PYS B;  1TWG H;  2FXQ A;  1IBM Q;  1N33 L;  2OQK A;  1WCM H;  2NVY H;  4IOA A;  3Q8D A;  1B8A A;  4OON A;  4H02 A;  2KCM A;  2ZJQ A;  2ATW A;  1YI2 A;  3DLL A;  4A3M G;  5GAD C;  3I2Z A;  4QL5 A;  1BBU A;  3M85 A;  1HNX Q;  1EWI A;  1NY4 A;  2MQH A;  3KF6 B;  3K7A H;  3J7A 5;  1R9T H;  3CQZ H;  2IT1 A;  1Q46 A;  5M5W H;  1VQ8 A;  2YTY A;  5IP7 H;  3RLF A;  5GAG C;  3AYH B;  1CUK A;  4JI1 L;  4C2M H;  2V1C C;  4A3I G;  4QQB X;  1P8L A;  3TQY A;  4A3C H;  2D0O A;  2N49 A;  2AMC B;  3I7F A;  3JC6 6;  3STB D;  5LMN Q;  4DV6 L;  4GNX C;  2MO1 A;  4R4Q A;  4IOC A;  1VQP A;  4DK3 C;  1CSQ A;  3W1G A;  3MEF A;  3PO2 H;  4DV1 L;  2I5H A;  1Q12 A;  3K80 C;  1CKM A;  4BA1 I;  1X65 A;  1XPO A;  1XMQ Q;  2AKW B;  5LMU L;  1S40 A;  5JJI A;  2K50 A;  1W2B A;  1A62 A;  3ER0 A;  2NVX H;  3PO3 H;  4X64 Q;  4JC0 A;  5FJ8 G;  2EQS A;  4JI4 L;  4DUY Q;  1KC8 C;  3I4O A;  1MJC A;  2Q2H A;  3AQQ A;  3CP0 A;  1N32 Q;  3CC4 A;  2JA6 G;  3S2H H;  4TQU S;  4LF8 Q;  1VQ4 A;  1HZB A;  4JOI C;  1B7Y B;  4GOP B;  3CCJ A;  4BY7 H;  2NZO A;  2GVA A;  3F8T A;  1VQJ A;  4X65 Q;  4OX9 Q;  4A3F H;  3UDI A;  5C4X H;  3KFU A;  2CWP A;  4LFA Q;  1QUQ B;  2YV5 A;  2ZTC A;  1AH9 A;  1L1O B;  1H95 A;  3CCV A;  1XMO L;  2UUA L;  2NZH A;  3U4V A;  5M5X H;  3JAM i;  4UPA A;  1HNW L;  1G6P A;  2UUB L;  1U5K A;  3KOJ A;  4YY3 Q;  1SR3 A;  1TWH H;  5GAH C;  2WB1 G;  3ULP A;  1KD1 C;  1LUZ A;  3DM3 A;  4BY1 G;  1FJG Q;  2E2H H;  3RLN A;  5C0X I;  3TRZ A;  4JI2 L;  1S72 A;  4BA2 I;  1HZ9 A;  1K0R A;  2WB1 E;  4JCV E;  1HZA A;  4A3M H;  5IYC G;  1Q82 C;  1DGS A;  5JEA G;  1VQO A;  1VQD A;  5LMN W;  4GLA C;  4KHZ A;  4NXN L;  1OXU A;  2AWO A;  3L2P A;  1KIX A;  2KHI A;  3AFP A;  2XTI A;  5AJ3 Q;  4DV7 Q;  4LF5 Q;  2UXB L;  1VQK A;  1VS0 A;  4A3I H;  1Y1V G;  4DAY B;  3S1R H;  1X55 A;  2VNU D;  3K0X A;  4J15 A;  1MJE A;  3IRB A;  1L0W A;  2F52 A;  3K8A A;  3M4P A;  4LF4 Q;  4IPH A;  4B3R Q;  2IY5 B;  4A3E G;  1KXL A;  1KHI A;  3HOY G;  3E9I A;  2WP8 J;  4B3S Q;  4UP8 A;  4HID A;  5FJ8 H;  3KJO A;  1B70 B;  1Q1B A;  1S3O A;  4EX5 A;  5FLX c;  1IBM L;  2BA1 A;  1Y1W G;  4IFD G;  1VQA A;  1PV4 A;  2JA6 H;  1YJW A;  2MO0 A;  2RCN A;  1X9N A;  1RIP A;  2BA0 A;  3GTO H;  1HNX L;  4L5Q A;  5M3F G;  4QGU A;  2IHF A;  4JI8 Q;  4DR2 Q;  3F2D A;  1YHQ A;  1I94 L;  4XIG S;  1ASZ A;  2ES2 A;  4DR7 Q;  2VQE Q;  1QZG A;  1L2F A;  3T1H Q;  3BZC A;  1EIY B;  3HFZ B;  4MTN A;  2K52 A;  2MFI A;  1N9W A;  3M3Y H;  1VQH A;  1JJC B;  2B63 G;  4JBK A;  1K9M C;  4BY1 H;  1BKB A;  4DV3 Q;  3FP9 A;  5LMN L;  4GOP C;  3FHW A;  3UDF A;  4L5R C;  2F4V Q;  5IYC H;  1NTG A;  1J5E Q;  3OW2 A;  1PH1 A;  2NVT H;  1L1O C;  3D0F A;  1XMQ L;  2Q2U A;  2HQL A;  2L15 A;  1J6Q A;  1SN8 A;  4DUZ Q;  1VQM A;  1U0L A;  4X64 L;  3TS0 A;  3RZD H;  4DUY L;  4HJA A;  3H3V I;  2A19 A;  1T9H A;  4UP7 A;  1VCI A;  3AFQ A;  5DLQ E;  2JJQ A;  1Y1V H;  3MXN B;  4LF9 Q;  1N32 L;  3F2C A;  5JJL A;  2EXD A;  3A0J A;  4LWC A;  3I56 A;  4LF8 L;  2D0P A;  4A3B G;  4TVA B;  4X65 L;  4OX9 L;  1WJJ A;  4NB3 A;  1Q7Y C;  3J81 j;  4A3G G;  4K0K Q;  4A3E H;  3RLO A;  2R7D A;  4LFA L;  3HOY H;  4GKJ Q;  4RG1 A;  1GD7 A;  4DR4 Q;  3PV0 A;  4BXX G;  3G71 A;  2I5L X;  4JV5 Q;  1JJG A;  5GQO A;  1IBK Q;  1W3S A;  4YY3 L;  4R4C A;  3S1N H;  3GTP H;  1Y1W H;  1YJ9 A;  1XNQ Q;  4DR6 L;  3D31 A;  5EAY A;  4JYA Q;  4DK6 C;  1FJG L;  1O7I A;  4BBR G;  3S1M H;  1EQR A;  1GM5 A;  1NBW A;  5C44 G;  5M3F H;  2K4K A;  1CKN A;  2IX1 A;  3S2D H;  1LTL A;  2AHO B;  2E5L Q;  1KL9 A;  1E7Z A;  3LGJ A;  1PH3 A;  2LXK A;  5AJ3 L;  4DV7 L;  1EQQ A;  4LF5 L;  1N34 Q;  3FKI G;  5IWA L;  4DAM A;  4A3L G;  1KQS A;  1JE5 A;  2N78 A;  4PMW A;  2B63 H;  3U58 A;  1YBY A;  4P73 A;  1Q8K A;  1FGU A;  3G4S A;  2NN6 G;  2OCE A;  4JI3 Q;  3AEV A;  3ICE A;  5IT9 c;  4B3R L;  1GVP A;  4LF4 L;  1VQ9 A;  1I6H H;  3CPF A;  4JI7 Q;  1K3R A;  1HNZ Q;  1OXV A;  1HZC A;  4QJF A;  1SE8 A;  3KDF A;  2MNA A;  2N8N A;  1D7Q A;  2R7F A;  4MZ9 A;  4HJ8 A;  4YCU A;  5C0X J;  4LNQ A;  1EFW A;  3HOX G;  1XPR A;  3ULJ A;  4LUZ A;  2XGT A;  1A63 A;  2K14 A;  4AYB G;  1WOC A;  5HGQ A;  3GTK H;  4LFB Q;  4A3B H;  2JQO A;  4L5T A;  4AYB E;  3ZJY C;  4FDB A;  5BR8 L;  3H15 A;  4WJ3 M;  5M5Y H;  4GNX A;  4JI8 L;  4DR2 L;  4DR7 L;  4A3G H;  2VQE L;  3T1H L;  4IJH A;  1I50 H;  1VQ5 A;  3CMA A;  4BXX H;  1UE7 A;  2JK8 A;  4DR5 Q;  1MIU A;  1QZH A;  4IPC A;  3HOZ G;  1Q81 C;  3G48 A;  3I4N H;  1AE2 A;  1TWC H;  3GO5 A;  4MNO A;  4DV3 L;  3EN2 A;  3CC2 A;  1QVF A;  4BBR H;  4OO1 G;  2N3S A;  2UXC Q;  3JAM c;  2BH8 A;  2GVB A;  2ZTE A;  3EBE A;  4JI5 Q;  2E8G A;  1X3F A;  5C44 H;  1J5E L;  2F4V L;  3HOW G;  4GKK Q;  1Z47 A;  4JOI A;  3W1B A;  4ME3 A;  4PZ7 A;  4DUZ L;  4LW1 A;  2HHH L;  3GDE A;  3GTG H;  4P75 A;  4HJ9 A;  1NE3 A;  3PIP A;  4DV5 Q;  3FKI H;  1PH8 A;  3GTQ H;  1LYL A;  4A3L H;  4L5S A;  4LF9 L;  4UP9 A;  3PUY A;  2CWA A;  3UE0 A;  3CPW A;  4A3C G;  1GKH A;  3M4O H;  1AE3 A;  1I5F A;  3H0G G;  4RMF A;  4C3I H;  3CCS A;  1C9O A;  1CKO A;  1KRT A;  4LFC Q;  4K0K L;  1YHA A;  2YYZ A;  4GKJ L;  4DR4 L;  2JE6 I;  3J80 c;  2OTL A;  2PNH A;  4JV5 L;  1IBK L;  4HIM A;  4X62 Q;  1XNR L;  2R7Z G;  3HOX H;  3NEN A;  1XNQ L;  4B3T Q;  1SMX A;  2CFM A;  2B29 A;  2DUD A;  4JYA L;  1CKN B;  3M4Q A;  4DV4 Q;  1K8A C;  3J7Z C;  2Q2I A;  1M90 C;  1PYB A;  4PZ6 A;  4XTC S;  4IJL A;  1PVO A;  4A93 G;  4POG A;  1VQC A;  1IXR A;  1VQG A;  3NBH B;  3KYH C;  3GTM H;  3OYY A;  3U4Z A;  2E5L L;  4ALP A;  4DR1 Q;  3S17 H;  1UEB A;  1N34 L;  2A8V A;  4APV A;  2ZM6 Q;  1VQ7 A;  2Z6K C;  4AH6 A;  3HOZ H;  4JI6 Q;  4JI3 L;  1FVI A;  2UU9 Q;  3CCM A;  1HH2 P;  2E2I H;  1C0A A;  3KDF B;  2F3I A;  4YWL A;  4LUO A;  1YZ6 A;  4JI7 L;  1Q1E A;  1V9P A;  3J81 i;  1HNZ L;  1HR0 Q;  3HOW H;  2AWN A;  4HJ7 A;  1SRO A;  1A8V A;  1Z9F A;  1TWF H;  1Y14 B;  2KCT A;  3OTO Q;  3PCO B;  4JBW A;  1YJN A;  3HKS A;  1PH7 A;  2OWO A;  2HIX A;  2RHQ B;  3ULL A;  4A3D G;  1EOV A;  1Q86 C;  4LFB L;  4O2D A;  1UE6 A;  1X56 A;  4PG3 A;  1XPU A;  1KAW A;  1N8R C;  3I4M G;  2OQ0 A;  1X6O A;  2A1A A;  3H0G H;  4JG2 A;  2LXJ A;  4B3M Q;  4DNI A;  4GOP A;  4R4I A;  3T1Y Q;  2UUA Q;  5IYB G;  1NJI C;  2K5H A;  4EQ5 A;  3F2B A;  3RN5 A;  5IYD G;  1IYJ B;  2R92 G;  1VQF A;  1L1O A;  2R6G A;  1SRU A;  3KF8 B;  4DR5 L;  3SGI A;  3ERS X;  3PF5 A;  1WFQ A;  1SFO H;  1VQI A;  4JBM A;  2JA7 G;  4X6A H;  2R7Z H;  1HJP A;  4GLX A;  1YVC A;  3E0E A;  2WFW A;  2UUC Q;  4NXM Q;  3E9H A;  3I4N G;  2UXC L;  2I5M X;  4JI5 L;  2PQA A;  4A93 H;  4GKK L;  3UDG A;  3S15 H;  4UY8 C;  2UXB Q;  1MKH A;  4YHH Q;  2JEA I;  5C0X G;  1LM0 A;  4GN3 B;  4QY7 A;  1HR0 W;  1VQE A;  3S1Q H;  4DV5 L;  4LF7 Q;  1UE5 A;  4LUV A;  1GO3 E;  1VQB A;  2YTV A;  2LSS A;  1EIF A;  2VZA A;  5FLM G;  1JT8 A;  4R4O A;  2CCZ A;  2JEB I;  2KEN A;  4DV0 Q;  2RF4 A;  4WJ4 A;  2CQO A;  3BU2 A;  4JI0 Q;  2VQF Q;  2ID0 A;  4LFC L;  3PSI A;  3A5U A;  2NVQ H;  4A3J G;  2IX0 A;  4X66 Q;  1X3G A;  4OWW B;  2JA8 G;  3A5Z B;  3NEM A;  4B3S L;  2KHJ A;  3CME A;  4OWX B;  1IL2 A;  4BBS G;  4X62 L;  1PFS A;  2VS1 A;  1EUJ A;  4B3T L;  4A3D H;  4Y52 H;  4DV4 L;  2R93 G;  1XJV A;  3BZK A;  4DR3 Q;  1I94 Q;  3I4M H;  3EIV A;  4GLV B;  5ELN A;  4YWM A;  3CCU A;  2VUM G;  2ZJR A;  4HIK A;  2K5V A;  1OTC A;  5IYB H;  2RHS B;  4KHP Q;  5IYD H;  3HOV G;  2R92 H;  5IY0 A;  4GS3 A;  4DV2 Q;  4DR1 L;  4IPD A;  1QVC A;  1JB7 A;  1E3P A;  4YWK A;  1WI5 A;  2JA7 H;  3TS2 A;  5IP9 G;  4P74 A;  3UE1 A;  2JA5 G;  2ZM6 L;  1UWV A;  1PH6 A;  2ASB A;  4JI6 L;  2UU9 L;  1N36 Q;  4C3J H;  5C3E G;  1FL0 A;  3CXC A;  1PH4 A;  1VQN A;  1IZ6 A;  4AIM A;  4OXP A;  2H5X A;  2E2J H;  1WYD A;  1PA6 A;  3CCR A;  1HR0 L;  2IHE A;  4KLK A;  2ZJP A;  2HT1 A;  4R1J A;  3TEH B;  1E1O A;  1KRS A;  3OTO L;  3RNU A;  2YU9 H;  3UDX A;  4LF6 Q;  3PUW A;  1ASY A;  2PMZ E;  3A74 A;  3CW2 C;  5E7N A;  5FLM H;  3KJP A;  1V43 A;  3W5O A;  2UXD Q;  1A0I A;  4B3M L;  4AQY Q;  4JBJ A;  4GN4 B;  2K5N A;  3T1Y L;  3HOU G;  3PGZ A;  4HIO A;  4A3J H;  5H1S E;  1IBL Q;  3RN2 A;  2JA8 H;  3KLW A;  1YIJ A;  4DR6 Q;  1N33 Q;  1OXX K;  2Z0S A;  4POF A;  3CCE A;  1PH5 A;  4BBS H;  1K8G A;  1M1K C;  3CAM A;  1PH9 A;  4OWT B;  1YIT A;  4YCV A;  3U50 C;  2PQA B;  5ELO A;  2UUC L;  2R93 H;  3PIO A;  4NXM L;  2VUM H;  1E1T A;  1OXT A;  2Q2T A;  2CKZ B;  3TRE A;  3S24 A;  4YHH L;  2NN6 I;  5IWA Q;  3HOV H;  4P72 A;  3RR5 A;  4A4I A;  1YNX A;  1UE1 A;  3KF6 A;  1OXS C;  1YHB A;  3B6Y A;  1X3E A;  2C35 B;  2VY3 A;  3J80 i;  4JI1 Q;  1BVS A;  5IP9 H;  1D8L A;  3STB C;  4DKA C;  4Y7N H;  3I55 A;  2JA5 H;  4LF7 L;  2BH2 A;  5C4J H;  4DV6 Q;  1PH2 A;  4C3H H;  4DV0 L;  1BBW A;  1K73 C;  4A3K G;  5C3E H;  4DV1 Q;  3CCQ A;  1NMF A;  4JI0 L;  2VQF L;  3BJU A;  5JEA J;  2GN5 A;  5LMU Q;  5K36 G;  4DPG A;  1X54 A;  3F1Z A;  5M3M G;  4X66 L;  3NEL A;  2VW9 A;  3VDY A;  4JI4 Q;  3CF5 A;  1WCM G;  2VL6 A;  1RL2 A;  5HY6 A;  3J81 c;  4R4T A;  1G51 A;  5GRO A;  3WWV A;  5BR8 Q;  1VQ6 A;  5J3B A;  2EIF A;  1E24 A;  2JA9 A;  4DR3 L;  2Z6K A;  1CSP A;  1TXY A;  4GNX B;  1NMG A;  1SLJ A;  1PHJ A;  1JJ2 A;  3H3V H;  2OTJ A;  3HOU H;  2K75 A;  2PI2 A;  1QVG A;  4OO1 I;  5IP7 G;  4KHP L;  1XMO Q;  4KI0 A;  4QIW E;  3PUZ A;  4HJ5 A;  4DV2 L;  2KBN A;  1C7Y A;  1EYG A;  2QA4 A;  2UUB Q;  3CD6 A;  1HNW Q;  1QUQ A;  1I3Q H;  3RZO H;  3M7N A;  3PF4 A;  4IFD J;  3M9B A;  3K81 C;  2DGY A;  4JI2 Q;  2HIV A;  1N36 L;  4PZ8 A;  4A76 A;  3GD7 A;  4IO9 A;  4A75 A;  1G29 1;  2YTX A;  3GTJ H;  1XTD A;  3PO2 G;  1K83 H;  2QEX A;  3S16 H;  1VQL A;  2HHH Q;  3PO3 G;  3S14 H;  2PI2 E;  2QGQ A;  4NXN Q;  4GN5 A;  2Y0S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...