1JT8A

Archaeal initiation factor-1a, aif-1a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
b'MAEQQQEQQIRVRIPRKEENEILGIIEQMLGASRVRVRCLDGKTRLGRIPGRLKNRIWVREGDVVIVKPWEVQGDQKCDIIWRYTKTQVEWLKRKGYLDELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE TRANSLATION INITIATION FACTOR 1A
publication title Structure and dynamics of translation initiation factor aIF-1A from the archaeon Methanococcus jannaschii determined by NMR spectroscopy
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 17
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jt8A00
5IY0A 3CCRA 4GOPA 4LF6L 4JV5Q 2VNUD 4IPDA 1E22A 4A3CH 4HJ7A 4GKJL 1CKMA 1K83H 2B29A 2N78A 4FDBA 4JI6L 1PH7A 1Q12A 4DK3C 2IHFA 4X6AH 5C4JH 3CCQA 2E2HH 3MEFA 3FHWA 5C0XJ 4RG1A 1I3QH 3D0FA 3NENA 1Y1WH 4DPGA 1V43A 3RLOA 5IYDG 2IY5B 4B3ML 3PCOB 4GNXC 2AMCB 2IT1A 2NZOA 1HH2P 4LUVA 4PG3A 4POFA 1KHIA 3K7UC 2R7DA 5HGQA 2F4VL 2KCMA 1SROA 5LMNQ 2AHOB 3PUYA 3T1HL 1AE3A 4LF4Q 5C0XG 4O2DA 4OO1G 3HOVG 1T9HA 1FJGL 4GOPC 2K14A 4UY8C 1TWHH 2OQKA 4JI4Q 1KL9A 1WCMH 4DV4Q 3RNUA 1QZGA 1VQNA 2NVTH 4DAYB 1NTGA 4DV3Q 5ELNA 3S14H 4JI3Q 2HT1A 1L1OB 4IPCA 5GAHC 4JBMA 4JBKA 4B3SL 4JI7Q 1HNZQ 2IX0A 1ASZA 1VQJA 1VQHA 3WWVA 3A5UA 1GO3E 3UDIA 1JB7A 4DR6L 1CKNA 4A3FG 4DKAC 4P73A 4JC0A 4R4CA 3HOYG 1FGUA 2OCEA 1E3PA 4XTCS 2YTVA 1X54A 3B6YA 4LF9L 2ZJRA 4LFBL 1VS0A 1KQSA 2ID0A 2K50A 3KOJA 2MO0A 2EXDA 5BR8Q 3HKSA 1PH2A 3Q8DA 2Q2TA 1YZ6A 1XMQQ 1C9OA 3I2ZA 1J5EL 1P16A 3K7AH 1KRSA 3JC66 1Y1VG 2BA1A 1TWCH 2H5XA 2NVYH 3KF8B 4DUYL 4JI5Q 4J15A 4BY7G 3PO3G 1KAWA 1A8VA 3UDGA 3HFZB 4BXXG 3PIPA 4BY1H 3NBHB 1PH4A 1JJGA 4YY3L 1IYJB 4A3IG 1XMOQ 4LFBQ 1VQCA 3A5ZB 3CF5A 1FVIA 4A3MG 1EIFA 1E24A 2BA0A 4DV1L 1HZCA 1PH8A 4B3RQ 5FJ8H 4C3JH 3KJOA 1XTDA 1RIPA 1YNXA 4A3DG 1VQ7A 4LFCQ 3H0GH 2ZTDA 4TQUS 4DV0L 4GKKL 1MKHA 5IYBG 1NBWA 2D0OA 4PZ6A 3HOWG 2JA7H 3PIOA 4Y52H 3S1NH 2AKWB 1YHQA 2UXCL 3GTJH 3GTMH 4GLAC 3CCJA 1IXRA 1VQ9A 3RZDH 5IP9H 1N8RC 2BH2A 4OWTB 3I4NH 4A93H 1N34Q 3BZCA 1W3SA 3S1RH 5M3FG 1I5FA 1N32L 2HHHL 2HIXA 3W1BA 2MNAA 1ASYA 1S40A 2R92G 1K8AC 2Z6KC 4YWKA 2UUAQ 1LM0A 5C4XG 4B3TQ 3ULPA 1QVCA 5C3EH 3M4QA 1KD1C 4PZ7A 2E8GA 3GO5A 2DUDA 1HNWQ 4BA1I 3PSIA 1Z47A 3W1GA 1QVFA 3HOZG 4X62L 1TWGH 4LUOA 4DR5Q 1JMCA 3CAMA 3CMEA 1FL0A 3G48A 3CP0A 4PMWA 1SFOH 1EUJA 3L2PA 4UPAA 4JG2A 4A3LG 5IT9c 1Q81C 4GN5A 4DR7Q 2A19A 3TS2A 2MO1A 1X55A 1D7QA 4GN3B 1HZAA 2Y0SE 1OXUA 2JA5H 4LF8L 1HJPA 1VQEA 1LYLA 1YEZA 3CMAA 1PVOA 2PMZE 2KCTA 1C7YA 2UXBL 4DR2Q 3S1MH 1YITA 3VDYA 4AIMA 2JJQA 1WFQA 3IRBA 3LGJA 3AQQA 4YCUA 4DV5Q 4GNXA 1VQPA 4EX5A 5EAYA 1YVCA 3D31A 1LTLA 1X3EA 4JV5L 3AFPA 4KHZA 2JA9A 2CCZA 1PH6A 5GQOA 1QUQA 5M3MH 2VQEQ 3ULLA 3S16H 2JA8G 1XPRA 4POGA 4DUZQ 1I94Q 1HZBA 2CQOA 3TRZA 3PO2G 4A76A 3M7NA 1UEBA 1YHAA 1I50H 3F2CA 1UE7A 1IBKL 3F1ZA 2LXJA 4DR1Q 1N33Q 4NXMQ 1E1OA 1WOCA 2N3SA 2QEXA 4GOPB 4JYAQ 2GVAA 1EQQA 3I4MG 4LFAQ 1U0LA 4IO9A 1VQ6A 2ZJPA 1Q8KA 2YTYA 3E9IA 3PUZA 5LMNL 2GVBA 5DLQE 3ERSX 3J80i 4LF4L 4JI0Q 3BJUA 4P74A 1TWAH 3EIVA 2RHQB 5IE8A 1Q1BA 4NB3A 3U4ZA 4JI4L 2PNHA 4KLKA 4DV4L 2E2IH 4A75A 3HOVH 4IFDI 4Y7NH 3HOXG 2UU9Q 4A3CG 3M9BA 4DV3L 4X64Q 3GTGH 1NY4A 4JBJA 1XNQQ 4QQBX 4JI3L 1KC8C 4JBWA 3STBD 2B63G 3TEHB 4AYBE 2R7ZH 4JI7L 1HNZL 2UUBQ 4L5SA 2CWPA 2WFWA 1V1QA 3JAMi 4A3BG 3CPWA 3J7ZC 1VQ4A 2ZM6Q 3J81i 1XNRQ 1N36Q 4NPSA 1YIJA 1OTCA 1W2BA 4IJHA 1XPUA 4OWXB 1L0WA 2V1CC 1QZHA 2E5LQ 3HOYH 5JJKA 4R4OA 4MTNA 1A63A 2KBNA 1WYDA 2Q2HA 4RMFA 5BR8L 3TQYA 4P72A 3DM3A 1PH5A 1GKHA 1OXXK 1WCMG 4O0AA 3A74A 1XMQL 1CKNB 3M85A 4L5RC 2ATWA 2JA6H 4MNOA 2D0PA 1RL2A 2NN6I 4JI5L 3RR5A 4C3HH 1HR0Q 1PH1A 2ES2A 4LF5Q 2K5NA 5C44H 3F2BA 1YJWA 1C0AA 2AWOA 2WB1G 1UE6A 3I55A 3E9HA 1XMOL 1JJ2A 3PO3H 4IJLA 3A0JA 3T1YQ 2YYZA 1VQMA 1VQKA 3S1QH 4BBSG 1K73C 2Q2IA 4A3IH 1L2FA 2WB1E 2Z6KA 1PV4A 3GTKH 1H95A 1OXVA 3U4VA 1TXYA 4A3GH 1Q82C 3NEMA 4B3RL 1UE1A 2JQOA 1S3OA 4AH6A 5IP7G 4YCWA 1L1OC 5IYCG 3OTOQ 1Q86C 1PA6A 4LFCL 5JJIA 4JI8Q 3CCSA 4HJ9A 3FKIG 4LUZA 1CKOA 2K5HA 5FLXc 1EFWA 4A3DH 2VY3A 3HOUG 4K0KQ 1X3FA 2VQFQ 4DR4Q 5IYBH 1PHJA 4JI1Q 4A3KG 1YHBA 3HOWH 1N34L 3EBEA 1I6HH 1GM5A 2K4KA 2R7FA 3M4PA 5LMNW 2R93H 2Q2UA 2D62A 4QY7A 4L5QA 1VQIA 4DNIA 5FLMG 1NMGA 1G51A 3ICEA 1D8LA 1B7YB 2YTXA 2UUAL 3KDFA 4B3TL 2ZTCA 1VQAA 4L5TA 2PQAA 1GD7A 1VQLA 2K5VA 5C4XH 1HNWL 3H3VH 2UUCQ 2DGYA 3J7A5 3TS0A 5GADC 4IPHA 3I4OA 3CD6A 4DR5L 3CCVA 4JI2Q 4X65Q 2EQSA 4ALPA 3HOZH 3K81C 4WJ3M 1KXLA 5H1SE 2GN5A 2VUMG 4DR7L 1A62A 4KHPQ 3UE1A 4DV7Q 4A93G 2I5HA 4A3LH 2JEBI 4TVAB 5M5XH 1M1KC 2Y0SG 4HJAA 4JOIA 1CSQA 4R1JA 3G4SA 4DV2Q 1IL2A 3GTPH 1X3GA 2RCNA 4YWLA 1Q7YC 2PI2E 4GN4B 4QGUA 1DGSA 2I5MX 4DR2L 4AQYQ 3E0EA 4X66Q 1IBMQ 1EQRA 2WAQE 1IBLQ 3S2DH 4HJ5A 3CC2A 3OW2A 4A3EG 1SRUA 5E7NA 3EN2A 3UE0A 2C35B 1Y14B 2VQEL 5IWAQ 1EIYB 3GD7A 1X65A 3RN2A 3L0OA 1KRTA 2ZJQA 2R6GA 2HIVA 4DUZL 4OX9Q 2IX1A 3KFUA 4DAMA 1E7ZA 1VQBA 3W5OA 1EOVA 2B3GA 1I94L 3ULJA 1VCIA 3RZOH 1CUKA 4DR3Q 4GLXA 3S2HH 1EYGA 5C0XI 2CWAA 4UP9A 1OXTA 4GNXB 4OO1I 4DR1L 4BBRG 4NXML 1N33L 3M4OH 2UXDQ 4JOIC 1R9TH 4WJ4A 1N9WA 4A4IA 4JYAL 1QVGA 2AWNA 4LFAL 1QUQB 3AEVA 2N49A 5JEAJ 1YJNA 4PZ8A 3CQZH 1VQ8A 2YV5A 3I56A 3I4MH 1X9NA 5JJLA 4DV6Q 1M90C 2OTLA 4JI0L 3SGIA 5LMUQ 5IYDH 2I5LX 3RLNA 1VQFA 1VQGA 4A3JG 1PFSA 1KIXA 1HNXQ 1JE5A 3BZKA 3CCLA 3U58A 3GTQH 5JEAG 2UU9L 5M3MG 3AYHB 3CCMA 4LF7Q 1NMFA 4LWCA 4YHHQ 4X64L 5AJ3Q 1O7IA 3S15H 2A1AA 1A0IA 2RF4A 1J6QA 4R4QA 3HOXH 4AYBG 1YI2A 4UP8A 4NXNQ 1XNQL 3F2DA 2FXQA 5GROA 5M5WH 2UUBL 2NZHA 1PH3A 4LF6Q 3NELA 1B8AA 2B63H 4QIWE 4GKJQ 4KI0A 4MZ9A 3H15A 4JI6Q 2CKZB 2ZM6L 3CCEA 4R4IA 1IBKQ 1XNRL 1WI5A 1N36L 3TREA 4A3BH 4OONA 1Y1WG 4R4TA 2A8VA 1AE2A 4GLVB 3CXCA 4ME3A 2VZAA 2E5LL 4GS3A 2PI2A 3K8AA 4UP7A 4A3FH 3PGZA 3RN5A 1YJ9A 4B3MQ 1WJJA 2MFIA 3CCUA 2YU9H 1L1OA 1XPOA 2F4VQ 1E1TA 3KF6A 3S24A 2ALYB 3KLWA 3T1HQ 3OYYA 1JT8A 1PYBA 1MIUA 2CFMA 2IHEA 2L15A 1HR0L 4IOCA 2ZTEA 1S72A 4LF5L 1FJGQ 2MQHA 1SLJA 2R7ZG 3I7FA 3CW2C 4DK6C 2NVQH 1VQOA 2KHJA 1K9MC 4IFDJ 5ELOA 3KF6B 1Y1VH 3T1YL 4BY7H 4HIDA 1X56A 1BBUA 1SN8A 1HZ9A 3L7ZC 4QJFA 4B3SQ 3GTOH 1K3RA 3FP9A 4BXXH 4BBSH 2KENA 4JCVE 3PF4A 3S17H 1SR3A 2NVXH 4IFDG 3OTOL 4DR6Q 1BVSA 1U5KA 5HY6A 4JI8L 1NE3A 4A3MH 1P8LA 1X6OA 2F52A 5IP7H 2JEAI 3ER0A 5IYCH 3K80C 2Z0SA 4K0KL 5GAGC 3UDFA 2JA6G 1UE5A 2HQLA 2VQFL 4LF9Q 4DR4L 2LXKA 3AFQA 3FKIH 4P71A 1VQDA 4P75A 1UWVA 1YBYA 4JI1L 1PYSB 3H3VI 3HOUH 2WP8J 2E2JH 5C44G 1K0RA 3HKZG 4A3KH 3BU2A 2JE6I 3G6EA 3PUVA 1J5EQ 1SE8A 1Z9FA 4DUYQ 3HKZE 4BY1G 5FLMH 1SMXA 3CPFA 4QL5A 5M3FH 1CSPA 2XGTA 2R92H 4A3GG 3STBC 1K8GA 5J3BA 4YY3Q 4BA2I 2UUCL 2EIFA 1MJEA 4HIMA 3GDEA 1G6PA 1BKBA 4IPGA 2NN6G 3F8TA 5FJ8G 4JI2L 4IOAA 2N8NA 4X65L 4DV1Q 2K52A 4HIKA 2OQ0A 2RHSB 3H0GG 3PUWA 3KDFB 4KHPL 1IZ6A 2KHIA 4DV7L 2PQAB 2QA4A 2F3IA 1NJIC 4LNQA 2JA7G 3GTLH 4GKKQ 4DV0Q 2VUMH 3I4NG 2R93G 5IP9G 4DV2L 3M3YH 2VS1A 3J80c 2OWOA 2UXCQ 4YCVA 4AQYL 1B70B 4X66L 2WAQG 1IBML 5GAEC 2HHHQ 1N32Q 1IBLL 3ZJYC 2K75A 2VL6A 3KJPA 4HIOA 1XJVA 1TWFH 2LSSA 3G71A 1HR0W 4DV5L 3K0XA 5C3EG 1OXSC 5IWAL 1MJCA 5M5YH 4A3EH 4LW1A 2ASBA 2I0QA 3UDXA 4HJ8A 4OX9L 3PV0A 4YWMA 1Q46A 3RLFA 3JAMc 2VW9A 5K36G 4OWWB 4DR3L 1LUZA 1JJCB 4OXPA 4APVA 4X62Q 2XTIA 1Q1EA 4C2MH 3J81c 3J81j 2UXDL 2JA8H 1V9PA 1GVPA 3PF5A 4BBRH 3PO2H 2BH8A 2JK8A 4EQ5A 2JA5G 3CC4A 2OTJA 4DV6L 3KYHC 5LMUL 3MXNB 4XIGS 4LF8Q 1G291 1HNXL 1BBWA 1PH9A 1AH9A 1EWIA 4H02A 3DLLA 4A3JH 4LF7L 2UXBQ 4YHHL 3U50C 5AJ3L 3CC7A 2QGQA 4NXNL 4C3IH 3PUXA 1VQ5A
chains in the Genus database with same CATH superfamily
1L0YB 2KHSA 3BG3A 2VNUD 1E22A 2HDLA 2QDLA 1K83H 2B29A 1KAAA 2N78A 4JI6L 1H9MA 1VMPA 5C5LA 1PRTC 3NWSA 5I6YA 1KTKA 2E2DC 3V96A 1I3QH 4HAEA 1CM9A 2IY5B 1DD2A 2IT1A 2NZOA 1CHPD 2R7DA 1TS4A 1BDOA 1SROA 5LMNQ 3S1NB 4OO1G 3MWYW 2PPBC 2VUMB 1FJGL 3TZDA 3J7YW 4RHRA 4UY8C 1TWHH 1J8IA 4DV4Q 1VQNA 1IYUA 5CV5A 5EPLA 3VR5A 2WAQB 1B2TA 4JBKA 1F9QA 2IW3A 4WRDA 1HNZQ 2IX0A 1VQJA 3GV3A 1XYIA 2XWBB 1JB7A 1GO3E 1CKNA 5G3LF 4A3FG 3HOYG 4JC0A 4OL7A 2EY6A 2L9HA 2JN4A 1HUMA 1FNWA 3B6YA 5LL6X 1A15A 2ZJRA 2B2TC 1SFOB 4LF9L 1VS0A 1CHQD 1KQSA 2ID0A 2K50A 1XMQQ 4CJ2C 1C9OA 2K5QA 5DNFA 4JI5Q 1TWCH 2NVYH 4J15A 4CBVA 2BE5D 5KRUA 3S1MB 1JJGA 4BS9A 2OT2A 1XMOQ 3K57A 5C4ZA 1BCPB 3R8BA 2M00A 4B3RQ 5FJ8H 1XTDA 3MFGA 2B2YA 3MC0B 1GUWA 1SYDA 3GQBA 4LFCQ 1TY0A 2D0OA 2JA7H 3PIOA 4FYDA 2LFNA 2F0LA 2UXCL 3GTJH 4XT3B 1VQ9A 1N8RC 1M8AA 3G7LA 3MZ5A 1N34Q 5CV9A 1I5FA 3W1BA 2F4IA 1EIHA 1GUSA 3T16A 2F0QA 2WKDA 3ULPA 2TSSA 4K2KA 2F0JA 2DUDA 2R7ZB 4LUOA 1JMCA 3CAMA 5IT9L 3CMEA 2AQ2B 4CJ0B 3L2PA 4UPAA 4JG2A 1MBYA 2F0TA 4CDFC 2A19A 3NE5B 4FF2A 4GN3B 2DN8A 1CZWA 1GUOA 1XTCD 1VQEA 3CMAA 3DUZA 2XNAC 2KCTA 4LK1C 3Q24A 1E2ZA 3DWQA 4DV5Q 4GNXA 4C3HB 4KV6A 3T53B 4N9TA 2BDNA 1H9KA 1I4QA 1QUQA 5CYUA 1RD9D 3R2TA 1HFNA 1BR9A 1G8ZD 4POGA 3SE0A 3S1QB 1I94Q 2A5HA 1UEBA 4A3IB 1I50H 2KCCA 1IBKL 4DR1Q 5D14A 1N33Q 1E1OA 2G9HD 2XRSD 2C9OA 1SYFA 4JYAQ 2GVAA 2ZJPA 2PZUA 3PUZA 4ZKCB 2AQ3B 3ERSX 2K33A 4V0BA 4H13C 1EQVA 1Q1BA 4NB3A 5IE8A 1GJXA 2E2IH 3HOVH 4CDDC 4A75A 4Y7NH 5CV8A 2QDBA 4XQQA 4X64Q 1SE2A 3GTGH 4JBJA 3LX0A 4QQBX 1ET9A 2CQAA 1KC8C 2RSNA 4JI7L 4WORA 3SEBA 3CPWA 5CV7A 3SK8A 5C4XB 1ZEQX 1I6VC 1VQ4A 1NR2A 4NPSA 4RA8A 2QF7A 1YIJA 4IZ8A 1W2BA 3VR2A 1WD1A 1A6XA 3MFYA 1AW7A 2V1CC 1QZHA 5KNDA 1WYDA 2DNCA 2Q2HA 5BR8L 3DM3A 2L1BA 2PW5A 1WCMG 1ENFA 1CKNB 4IUPA 3M85A 2ES2A 2KVMA 1PH1A 3P1HA 5J1ZA 1PDQA 1STBA 1S5FD 2AWOA 2A68D 2NTSA 3PO3H 1JJ2A 3S2DB 1VQKA 1VQMA 1EYAA 1SYEA 3FRPB 2EJFC 2Z6KA 3LWUA 4B9WA 1Q82C 3NEMA 1XWEA 1EWHA 4YCWA 3S16B 1Q86C 5JJIA 4JI8Q 2K5DA 2K04A 3CCSA 3FKIG 4K5XA 4FF1A 4A3DH 1CKOA 3NHHA 1EFWA 1R9TB 2VY3A 1SAPA 2ZT9C 2VQFQ 4DR4Q 3DHQA 1STGA 1YHBA 3CQZB 4NMZA 2R93H 2D62A 4QY7A 1U9RA 4DNIA 3IFDA 1G51A 4C1NK 1D8LA 2B2UA 1B7YB 2YTXA 2UUAL 3KDFA 2AUJD 4FF4A 1DOMA 1Z6HA 5KEEA 1JE4A 5A35A 2K5VA 4Q5VA 2FFKB 2DGYA 3HZXA 5E4WC 5M5WB 3BVZA 2OF1A 4DAPA 4DR5L 4DA2A 2B63B 2K5WA 1PRTD 4WJ3M 1KXLA 2EDGA 2GN5A 5H1SE 2VUMG 1BCPC 4A3BB 4RCNA 2I5HA 1VF5C 4A3LH 2JEBI 4IURA 1ZXTA 1B3QA 4DV2Q 1FYCA 1EY9A 1AFPA 2RCNA 2F0WA 1JICA 1H9JA 2DY7A 5ISRA 2YU9B 4QGUA 1DGSA 1ONLA 1BQQT 2BOSA 1A2TA 1IBLQ 4ZCKA 3A56A 1QWYA 3UE0A 2A6HC 2C35B 2X69A 5IWAQ 4HSVA 1X65A 3RN2A 2R6GA 2RSOA 3KFUA 1E7ZA 1VQBA 3RZOH 2B3GA 2CHBD 2O4XA 1VCIA 3MXNA 1CUKA 3ULJA 3S2HH 1S4ZA 4GNXB 3H6MA 4ZAIA 1C8CA 4L63B 2UXDQ 3SK5A 3S17B 2MJ8A 5J22A 4PNYA 2AWNA 4LFAL 1QUQB 3AEVA 4A3MB 2N49A 1SNCA 3CU7A 4K5WA 3J7AF 1X9NA 4RWSC 4KY7A 1M90C 5JJLA 5IODA 4RGMA 3NK9A 3RLNA 5A2QE 3Q0AA 4MN3A 3HOUB 3BZKA 3CCLA 3U58A 3RMHA 4C3IG 4A3KB 1NMFA 4DFAA 1I6HB 1IYVA 2A1AA 1XNQL 1J6QA 4AYBG 5EPKA 2FXQA 1PH3A 5M3FB 4GKJQ 4MZ9A 1O7YA 3NQTA 1XNRL 3CCEA 4R4IA 1IBKQ 4KHVA 4GLVB 2D2CC 2EE1A 2OXPA 2BCOA 2PI2A 5CR3A 2EOTA 3PGZA 4DAYA 1WJJA 2MFIA 1L1OA 2F4VQ 1E1TA 3KF6A 3C1EA 3S24A 3T1HQ 1JT8A 1G91A 1MIUA 2IHEA 2Y0SB 4IOCA 1S72A 3DXJC 2R7ZG 3GTPB 1WTRA 4DK6C 5IGEA 1QOHA 3QG1A 1K9MC 5ELOA 3T1YL 1X56A 1BBUA 4B3SQ 2F0NA 4BXXH 5M5YB 2KENA 2WACA 3X3NA 4I65A 4DR6Q 1BVSA 3K5LA 4HCSA 4NKLA 1HHVA 1P8LA 4S3SA 3ER0A 5IYCH 2Z0SA 3A55A 2HQLA 2EY5A 3NBHA 1VQDA 4C3HG 4JI1L 1G2SA 1EU3A 1K0RA 3BU2A 2F3VA 3G6EA 5DAUA 3PUVA 4OEMB 3C46A 3D4WA 4TRDA 1SMXA 4KK7A 1MGSA 1DOLA 2XGTA 1ZKOA 2UUCL 2EIFA 3K59A 4HIMA 1I4GA 1G6PA 1CA6A 4IOAA 3T4AC 1OO9B 1K83B 3PUWA 2CH4A 3KDFB 1NSNS 1IZ6A 2G9DA 2KHIA 1WD0A 4EQOA 3J80c 4K2LA 1D5XC 2WIIB 4AQYL 4Q0FA 2HHHQ 1EL0A 3KJPA 1PTOB 1XJVA 1TWFH 5COYA 2LSSA 1TWHB 1CFMA 3JAML 2CVRA 2ASBA 2I0QA 3UDXA 4HJ8A 4OX9L 4CJ1B 4HR7B 1Q46A 2VW9A 3J81L 3BVMA 1JJCB 2XTIA 1Q1EA 4C2MH 3J81j 4UDUC 2WB1B 3Q6SA 2JA8H 4YIJA 1S5CD 3PF5A 4BBSB 3PO2H 2PO4A 3A7AB 4XXEA 4QUCA 2OTJA 3CC4A 5D65A 1GOZA 5CBAE 1K28A 3I8ZA 3MXNB 2EYMA 4HMJA 2VB2X 4XIGS 4LF8Q 3C3LA 1HNXL 4A3JH 5JVH3 3FPPA 4KD4A 3U50C 2PYKA 4NXNL 5JEAH 4K8JA 1X32A 5IOCA 4A3CH 4HJ7A 1Y8NB 4CGYB 2F0EA 1Q12A 3RUZA 3EFXD 5C3XA 5C4JH 3CCQA 3E6ZX 2H4OA 3MEFA 5C0XJ 1TT2A 1F9RA 5D3DA 1LTAD 5EJWA 4B3ML 1KNEA 4GNXC 2AMCB 1KHIA 2SDFA 1D1IA 3VYUA 2JA7B 3GTLB 5C0XG 4O2DA 1T9HA 1SEBD 4GOPC 1I4PA 2OQKA 2JYOA 4JI4Q 3LWEA 1ET6A 2N55A 2B8GA 4DAYB 1NTGA 5ELNA 1FR3A 1NR4A 1L1OB 1V1OA 4IPCA 5GAHC 1GHJA 1LACA 3BYTB 3WWVA 2FJ2A 3OPOA 4X3UA 1C48A 2PW7A 1RTOA 3VR6A 3TBIB 4IFDH 1BCPD 2V4DA 1X54A 3PIP3 2F0SA 3A7LA 1TR5A 3H3VC 2K32A 1UEAB 1PH2A 3T56B 1E0BA 1XXGA 3H94A 1EZ6A 3K7AH 4K6LA 4DUYL 1EYCA 2F0PA 3ND8A 5F2DA 2AUKA 1A8VA 3UDGA 4BY1H 3NBHB 2P5ZX 1PH4A 2A6HD 3OW7A 1IYJB 1G6ZA 4CKBA 4A3MG 4DV1L 4DXGA 1HZCA 3I72A 4QIWB 2NN6H 3KJOA 1RJTA 1D5ZC 1RIPA 3CKIB 1PMRA 1O7LA 1I50B 3H0GH 2SNMA 2ZTDA 4TQUS 1O80A 4ZYSA 4DV0L 5IYBG 4PZ6A 5ELFA 1QNUA 1HRJA 4GLAC 3I4NH 1IXRA 3RZDH 5IP9H 2BH2A 4A93H 5M3FG 1N32L 1ASYA 1LT4D 2Z6KC 1EY8A 4YWKA 2ZXRA 2E2IB 5IGGA 4B3TQ 1DJRD 4Y7NB 1QVCA 2K28A 2EYJA 5C3EH 3M4QA 2D9UA 1AZQA 1HNWQ 4BA1I 1ILPA 1Z47A 4G57A 4CDCC 3HOZG 1TWGH 3NXWA 4IN3A 1TIID 1B53A 4L6TB 4GZYC 4C1NI 3EVQA 4DR7Q 3MA2B 4ABNA 3VYRA 1HZAA 2K05A 1PVOA 1LYLA 1TS5A 2UXBL 4DR2Q 3I4LA 3VDYA 4AIMA 2JJQA 3LGJA 1EY7A 3AQQA 1YVCA 4JV5L 3AFPA 2JA9A 3HKZB 3EA6A 3FEWX 5M3MH 3ULLA 1IHZA 3PO3B 1PTOC 1XPRA 1HZBA 2CQOA 3M7NA 3QOLA 2LXJA 2N3SA 4FNFA 1EQQA 3I4MG 4NDXA 3HGBA 4C3JB 1Q8KA 2YTYA 1QILA 4A3DB 1MD2D 5HGTA 3J80i 4QF4A 4LF4L 1CK1A 1EIGA 4R8NA 4HTHA 3J80E 4OO1H 1ZYRC 3HOXG 2R93B 5DM63 1UNSA 2UU9Q 1XX8A 4DV3L 3S1RB 4JI3L 4JBWA 2QEJC 4CDEC 2KOLA 4AYBE 2UUBQ 1V1QA 5I2YA 3J7ZC 5NUCA 1CT1D 4H0LC 2ZM6Q 2O2LD 2E76C 4RFBA 4MHEA 1BCPF 2E5LQ 3HOYH 5JJKA 2KBNA 1LTBD 3T13A 1PH5A 5EKKA 1ENAA 4O0AA 3A74A 2JA6H 2D0PA 1RL2A 3RR5A 2JA5B 1C0AA 2WB1G 1UE6A 1JOQA 1LTGD 3K5MA 2MPMA 1QG7A 2HUGA 3GTMB 3MHBA 4BBSG 1K73C 4KJOA 1L2FA 2XVSA 5C4HA 3U4VA 2G5DA 4XQNA 1B1ZA 4A3GH 1S3OA 5IP7G 3RZOB 5CORA 1L1OC 3OTOQ 3S2HB 3ND9A 5EQ0A 4HJ9A 1TQOA 2EVBA 5FLXc 1R4QB 4K0KQ 1JB3A 2L11A 3HP3A 1BF4A 1SXTA 5T1GA 4DU9A 3M4PA 4XYOA 2Q2UA 4I7AA 4L5QA 5FLMG 4RHSA 2EJGC 1F2MA 3E0JA 1II3A 3K58A 2QKIC 3TS0A 1K8OA 4FF3A 3I4OA 3CD6A 4JI2Q 1SNOA 3DWAA 2Z4IA 5K36H 2F0GA 2FINB 1AP0A 1A62A 3UE1A 4DV7Q 1AEXA 1M1KC 4HJAA 1T5EA 1CSQA 3G4SA 1EZ8A 5FO8B 2XSCA 3I90A 3IFTA 1X3GA 3EJIA 1Q7YC 2ZXPA 3SHLA 2I5MX 1SYBA 1IBMQ 2RCFA 4KY5A 3OW2A 2OEOA 2A73B 3V2TA 2VQEL 5ELBA 3GD7A 2HIVA 4DUZL 2IX1A 1EOVA 1LTRD 2CWAA 1SNDA 3M4OH 4BBRG 4NXML 4JOIC 1Y8PB 1HPCA 4DK0A 1I4XA 3S9WA 2YV5A 4DV6Q 4JI0L 1A3VA 1DCZA 3SGIA 5IYDH 2I5LX 1JE5A 1W6JA 3E3XA 2Z6BA 3GTQH 3Q23A 1DOKA 4LF7Q 3HOWB 4LWCA 5AJ3Q 1O7IA 1A0IA 3ONAB 4R4QA 4UP8A 2NZHA 3NELA 1B8AA 1U4RA 1WTQA 2RDGA 3L9AX 4JI6Q 1N36L 3TREA 4OONA 1Y1WG 3C2PA 2A8VA 1JQYD 2ICIA 3K8AA 3L3OC 1KNAA 4UP7A 1EY6A 4KKTA 5IGBA 1PYBA 1HR0L 5M5XB 4LF5L 4X3SA 1FJGQ 1SNMA 1Q8IA 3M7GA 4RCOA 1KDAA 1WTPA 3OOCA 1VQOA 3AU7A 3NQIA 1Y1VH 1TWFB 4BY7H 4HIDA 2B2VA 1HZ9A 1SE4A 2L4NA 3FP9A 2LY7A 2KUMA 2AQ1B 4JCVE 5FK9C 3PF4A 2PCFB 3P7JA 2NVXH 2F1MA 1TVXA 4IUUA 5LL6S 1U5KA 4DNTB 2KCNA 3H91A 3KF8A 4C2MB 2O5JC 3K80C 2JA8B 3UDFA 4LF9Q 1VDZA 2LXKA 1SJED 3FKIH 4P71A 3PO2B 1KDCA 1PYSB 2E2JH 2DNEA 3HKZG 3VYSA 2JE6I 1EFID 1Z9FA 4A3JB 2R92H 3QB3A 4KD3A 4RKLA 3EROA 1PTOD 1RTNA 1BKBA 5BN3A 4X3TA 4C3JG 4X65L 2KEEA 2LMCB 5FO7B 1I4HA 3DEOA 4KHPL 3P20A 5C4JB 3LNNA 1Y8OB 2VUMH 1FNVA 1KDBA 2R93G 2IWHA 4FXGC 2UXCQ 2OWOA 2DJFC 4TKOB 2WAQG 2XRQD 4X66L 5GAEC 3U9OA 1EYDA 1ZYRD 5EBCA 1SYGA 3G71A 5BN5A 5FOBB 1EEID 1H9RA 3OSOA 3OMCA 3PV0A 4YWMA 3RLFA 1U4PA 1IKMA 4DR3L 1LUZA 3MXGA 2NB0A 3IL8A 3HRZC 1GVPA 3X3MA 2JK8A 4EQ5A 3R93A 2JA5G 4Z9CB 5FLXE 3KYHC 2EY1A 5LMUL 5JVG3 1G2TA 1PH9A 1HXYD 4ME5A 3IAYA 4YHHL 3QR8A 2PZTA 3CC7A 1B9NA 3SK4A 4C3IH 4N8FA 4EVOA 5KGUA 1VQ5A 4F8MA 4LF6L 4I7ZC 3D8GA 1F2ZA 4IPDA 4BY1B 1RODA 4FO2A 1CKMA 1HCZA 4FDBA 4KY6A 4X6AH 2I46A 4LJZC 4FVMA 3FHWA 4RG1A 2BDOA 2ICEC 3D0FA 3NENA 4DPGA 1V43A 3R3OA 3HEJA 2B2WA 3RLOA 4WJ4A 4LUVA 1HH2P 4POFA 3PUYA 1AE3A 2B2TA 2F0OA 5C6AA 2F3WA 2EYHA 1O78A 5CV4A 4A93B 1S5BD 1KL9A 5IIFA 1QZGA 3QIAA 4KN7C 2PMZB 3A8JE 3S14H 1BXTA 4JI7Q 2RQXA 2NTTA 1VQHA 4DAVA 2Z4HA 1K8MA 1SJHD 3UDIA 4A3EB 4J8QA 4G7HC 1F2YA 4DK1A 4LFBL 1LT6D 1J9OA 3NTIA 5BR8Q 1L0XB 2Q2TA 4OIKA 2L12A 4NW2A 3I2ZA 2K7VA 1O7ZA 1GUGA 1P16A 1J5EL 3KF8B 1WVLA 4FP5D 4BXXG 1R4PB 4YY3L 3MAQA 4A3IG 1Q3LA 1VQCA 3A5ZB 2J0TD 3CF5A 1FVIA 3ITPA 1PTOF 5M3MB 1PH8A 3NSWA 1X3PA 3DMUA 1YNXA 3K5NA 1VQ7A 4GKKL 2F0IA 1MKHA 5A2QL 2K03A 3O13A 1C4QA 1NBWA 1DONA 3HOWG 1YHQA 3AB9A 1STAA 1VF7A 3CCJA 2F0VA 1I3QB 4OWTB 2ZXOA 3BZCA 3FDTA 3A54A 3ZYYX 1MSHA 2HQEA 2HIXA 1S40A 1K8AC 1JC7A 2UUAQ 3K0YA 1LM0A 5EKIA 5TSSA 5C4XG 1EOTA 2RKSA 1KD1C 2E8GA 3GO5A 2B2YC 5JOBA 1QVFA 4X62L 4DR5Q 2K01A 1PXUA 4M8AA 1FL0A 3G48A 3OMGA 1M4VA 4ZRZA 3URYA 1EUJA 2NUCA 2RVLA 5IT9c 4GN5A 3TS2A 3OWFA 1X55A 2NZ1D 3FMCA 1D7QA 3HOYB 1SBBB 2EYFA 1OXUA 1HJPA 1YEZA 3UI2A 4JW0A 2JA6B 1YITA 4QCLA 2F0MA 4YCUA 1PRTB 5EAYA 4EX5A 2NBFA 1HFGA 1ICFB 1X3EA 5ELDA 1PH6A 1TWCB 2NVYB 3S16H 2JA8G 3TRZA 3PO2G 4A76A 3F1ZA 4A3GB 3TP5A 1WOCA 2QEXA 1I4RA 4LFAQ 4IO9A 1VQ6A 4HSPA 5LMNL 2GVBA 5DLQE 3SXHA 2PZWA 1B4OA 3BJUA 1VMCA 1TWAH 3M4YA 2RHQB 5C0XH 4KLKA 4DV4L 3GTJB 4IFDI 1K0SA 4A3CG 4HEDA 1PYWD 5L37A 1EY0A 1XNQQ 2B63G 3HG9A 4RH6A 1HNZL 4L5SA 4A3BG 1SE3A 2GA4B 3WDNA 4DXFA 1XNRQ 1OTCA 1T5XD 1GXDC 4IJHA 1XPUA 3D3RA 1L0WA 4CKEA 1A63A 2CH4W 2ENBA 1WTOA 3I70A 4ZLTF 4RMFA 2XIWA 3DM1A 1JOOA 2IL8A 1GKHA 5JPMC 1D2BA 1SNPA 4L5RC 1XMQL 2ATWA 4G7ZC 2NN6I 4JI5L 1PFBA 2K5NA 1RKNA 4H7BA 5E4XA 4B08A 5C44H 3F2BA 3TP6A 4IQZA 3I55A 1XMOL 3A0JA 3T1YQ 2YYZA 3D4RA 3WOFA 5ELCA 1A3UA 3VA7A 3GTKH 1H95A 2F0UA 1F2LA 1STNA 1A2UA 4B3RL 1BOSA 4LFCL 2K6AA 3M4OB 4UAIA 4LUZA 3J7AV 3Q22A 3HOUG 4NP5A 1TU2B 5IYBH 1EY5A 1RCVD 4JI1Q 2MP1A 4A3KG 1N34L 4JVZA 3EBEA 1I6HH 1GM5A 2K4KA 2B2VC 3W2DA 5EGTA 3GTQB 4L5TA 2PQAA 4E6IA 1GD7A 1VQLA 3HOVB 3H3VH 2UUCQ 1D1KA 1BBXC 5GADC 4IPHA 3GTGB 1IL8A 5KNBA 2HCIA 4EQNA 3HOZH 2A74C 1WTVA 2H1EA 4PQXA 3PMFA 4A93G 1U4MA 2Y0SG 5IGFA 4R1JA 1IL2A 3GTPH 2Q8TA 2Z1CA 2B2UC 4GN4B 3BDCA 1B3AA 4AQYQ 3D4DA 3KK7A 2K1BA 2WAQE 1PZID 4HJ5A 3CC2A 2O5IC 4A3EG 1SRUA 1NNXA 1HQMC 3EN2A 1EIYB 1EQTA 3L0OA 1KRTA 4KJNA 1TS2A 4OIJA 4OX9Q 1EWCA 1JORA 1Y1VB 1I94L 2XWJB 4BY7B 2MHVA 4GLXA 2JP1A 1EYGA 4OO1I 1OXTA 4DR1L 1N33L 1LT3D 3SDZA 2Z8LA 4HN7A 1N9WA 4A4IA 4JYAL 1F9PA 4PZ8A 2SEBD 2F03A 3I56A 3I4MH 3FKIB 3BZDB 1VQFA 1PFSA 1KIXA 1HNXQ 2E2JB 5M3MG 3AYHB 1HA5A 1V1PA 3CCMA 3S15H 4X64L 3MVVA 1DZ1A 2XN9C 3HOXH 2HD3A 5JJZA 4NXNQ 3OHXC 4G4KA 2R92B 2J7ZA 1S5ED 1WI5A 1X3QA 3VA5A 2F0FA 2KA7A 1AE2A 2EXZA 4ME3A 3F2UA 3TZUA 1RHPA 1GHKA 4A3FH 2A69C 3RN5A 5IT9E 1PZJD 4B3MQ 1PTOH 4HMIA 3KBGA 4OELB 4MTKA 3BVGA 2ALYB 5IGCA 3OYYA 4ZUJA 4ODGA 2L15A 1SDFA 1F9SA 2MQHA 1SLJA 2DJGC 3I7FA 4ZKBB 3CW2C 5KIXA 2RDHA 3A8IE 2NVQH 1Z7TA 4QJFA 3L7ZC 3GTOH 2B2WC 4BBSH 1SNQA 2Q8RE 1A3TA 5HY6A 1FGBD 4JI8L 1QB5D 4ZQ3A 2F52A 1HA6A 5IP7H 5AFWA 5E1FA 2JEAI 4JK1C 1WTXA 2JA6G 1UE5A 2VQFL 4DR4L 3CRKC 1SMYC 1YBYA 2D5DA 2WP8J 2RBMA 1LTTD 5C3WA 3K5OA 3DWPA 1SE8A 4DUYQ 5FLMH 4KKUA 1TKWB 1IW7C 1CSPA 1QJOA 4A3GG 1STYA 2KEDA 1DXMA 3MXUA 3STBC 5J3BA 1K8GA 4PMCA 4C3IB 3GDEA 1YNNC 4F7XA 4AYBB 2EPBA 3F8TA 3R2IA 5FJ8G 2N8NA 4DV1Q 3KLRA 2QCPX 2PQEA 2PQAB 2QA4A 1QNKA 2F3IA 2J4XA 2KJXA 4LNQA 2JA7G 4DV0Q 3GTLH 3J80L 1LABA 1RF2D 4DV2L 3M3YH 5I2XA 2VS1A 3DEPA 3C1FA 4K14A 1B70B 1N32Q 2PNRC 3NPPA 1IBLL 2DY8A 2VL6A 4HIOA 1HR0W 5FO9B 5IWAL 3TSSA 4UHVA 3KBXA 2QILA 2E74C 3JAMc 5K36G 1ILQA 3S14B 3V05A 2R61A 1E2WA 4N8X1 3BS1A 3J81c 2UXDL 1V9PA 1DM0B 1ESRA 1LTSD 2EYPA 2LS01 2QW7A 3NUCA 4O42A 5DEHA 3VYTA 4BBRH 2BH8A 1LTID 4TSSA 5IGDA 3BYYB 4V190 4PMBA 3NTKA 3GV6A 4KN4C 3BDOA 1PLFA 1LLRD 4IUQA 1EU4A 4J6HA 1BBWA 1AH9A 1EWIA 4H02A 3DLLA 2UXBQ 3TP7A 1SSOA 1B50A 3MTSA 4PV1C 3PUXA 5IY0A 3CCRA 4GOPA 5CBEE 4JV5Q 1EEFD 3CHBD 4GKJL 5KYIA 1PH7A 4DK3C 1JCKB 2IHFA 5JPNC 1V1PB 1DYQA 2E2HH 1Y1WH 5IYDG 2FMCA 3TDQA 3PCOB 4PG3A 1KLGD 3K7UC 5HGQA 2F4VL 2KCMA 1QE6A 5CV6A 2AHOB 3T1HL 4LF4Q 1B9MA 3HOVG 1H9SA 2K14A 5BN4A 2FHTA 1WCMH 3RNUA 3VR4A 5JAVA 2NVTH 3NTHA 4K8IA 4DV3Q 2MUYA 2KECA 2NYZD 4JI3Q 2HT1A 4JBMA 1GUNA 4B3SL 2VXWA 4H44C 1ASZA 4CKCA 2WKCA 3A5UA 4DR6L 2NWGA 4DKAC 2VB3X 4P73A 4R4CA 2L55A 3FPUB 1FGUA 3VR3A 2OCEA 1E3PA 1JOKA 2YTVA 1MHWC 4XTCS 4DGZA 5EKLA 4RKBA 1EY4A 3KOJA 4LMQD 2MO0A 2EXDA 3HKSA 4ZUIA 3Q8DA 5D3IB 1YZ6A 3H09A 1KRSA 3JC66 1Y1VG 2BA1A 3AMUA 2H5XA 4BY7G 3PO3G 1KAWA 3HFZB 3PIPA 3TN2A 3E5SA 1MSGA 1EIFA 1E24A 2BA0A 1ICWA 1F77A 4C3JH 3P75A 4A3DG 1UUPA 4O1NA 4Y52H 3S1NH 2AKWB 4HCEA 3HS0C 1ML0D 1LT5D 2L5TA 1W3SA 3S1RH 1Y69U 2HHHL 2MNAA 2R92G 2WV6D 4IUNA 1TWAB 1JR0D 5KYLA 4RAUC 2Q8IB 3NBIA 4U68A 1CQVA 4PZ7A 4LAAA 2CW0C 3PSIA 3W1GA 4RGTA 3CP0A 3EQLC 4PMWA 1SFOH 4A3LG 1ENCA 4WJWA 1Q81C 4JPBW 2MO1A 2SOBA 2A69D 1CQFA 1E2VA 3QOJA 2I07B 3SK6A 2Y0SE 2JA5H 4LF8L 1TY2A 2PMZE 4XDXA 1C7YA 4F87A 3S1MH 3GTMH 1IKLA 1WFQA 3IRBA 1VQPA 3D31A 1LTLA 1NAPA 4KHZA 5C44B 2CCZA 3K7AB 1CZGA 5GQOA 2VQEQ 3OWEB 3I3CA 4EQPA 2A6EC 4DUZQ 5EPJA 3N52A 1YHAA 1HUNA 3GTKB 3F2CA 1UE7A 5CC4A 4NXMQ 2R3ZA 4GOPB 1BUVT 1UAPA 1U0LA 1YNJC 1CA5A 4EGVA 5T1IA 5C5MA 1SMYD 2Z9HA 3E9IA 2HDMA 2E75C 3H0GB 4JI0Q 2MGSA 4P74A 3EIVA 3U4ZA 4JI4L 2PNHA 3I91A 2HCCA 3I4NB 3RZDB 3KLSA 2EYOA 3SVMA 3M9BA 1IW7D 1NY4A 5CGKA 3STBD 5HURA 3TEHB 2R7ZH 2CWPA 2WFWA 2M9VA 3JAMi 1TS3A 1YNND 4IUTA 1H9SB 3JAME 3J81i 5C3EB 1N36Q 1STHA 4OWXB 3J81E 3HOZB 1TWGB 4R4OA 4F88A 4MTNA 5ELEA 3CRLC 2IX3A 3TQYA 1ESFA 4P72A 1OXXK 3D6WA 1Q90A 4MNOA 3FVQA 4C3HH 4J1MA 1HR0Q 4LF5Q 1YJWA 1LV9A 3E9HA 3T51B 4IJLA 3S1QH 1STEA 2Q2IA 3A8KE 4A3IH 1PV4A 2WB1E 3PIO3 1OXVA 1TXYA 1UE1A 2JQOA 4ILWA 2IPKD 4AH6A 3WOEA 4K6DA 5IYCG 5FLXL 1PA6A 4WFN3 1V8QA 2K5HA 2EYLA 4ID6A 1X3FA 1PHJA 4XQJA 3HOWH 4MIUA 1LO5D 2R7FA 3I4MB 5LMNW 1VQIA 4N9PA 1NMGA 3ICEA 4QMGA 4L8JA 5I6WA 1MI2A 4B3TL 2ZTCA 1VQAA 5M9OA 3S15B 4DF7A 4DNRB 1U4LA 1CI3M 3U9SA 5C4XH 5K5PA 1HNWL 3HOXB 4RGNA 3J7A5 1PRTF 3CCVA 4X65Q 2EQSA 4ALPA 3K81C 1HTPA 2EY2A 4DR7L 4KHPQ 1RDPD 4TVAB 2SNSA 5M5XH 2B8FA 4JOIA 4A3FB 4YWLA 2PI2E 4DR2L 4QB4A 2L0CA 3E0EA 4X66Q 1EQRA 3S2DH 2BE5C 2WINB 3N6RA 5E7NA 1AN8A 1Y14B 2C5CA 3GP7A 2NVQB 1QCBD 2ZJQA 1JWUD 4DAMA 3W5OA 4KTAA 4DR3Q 5C0XI 3GTOB 4UP9A 1R9TH 1QVGA 5JEAJ 1YJNA 3NP8A 3CQZH 3PQIA 1VQ8A 3K6OA 3IKJA 1PFMA 2OTLA 4XT1B 5LMUQ 1B44D 4A3JG 1NCVA 1VQGA 1D5MC 4RGOS 1AZPA 3QO2A 5JEAG 2UU9L 2F0KA 3SR1A 3ERQA 4YHHQ 2RF4A 4ULLA 1YI2A 3F2DA 1NUCA 2IJ0A 5GROA 5M5WH 2UUBL 4LF6Q 1GUTA 2B63H 4QIWE 3BDLA 4KI0A 4X3KA 3H15A 4FXKC 2CKZB 4R8IA 2ZM6L 4A3BH 1KABA 5J39A 4R4TA 3CXCA 2VZAA 2E5LL 4GS3A 5CMDA 4FXDA 3OIPA 2RDFA 3W3AA 3QWNA 1YJ9A 3CCUA 2YU9H 1JWMD 1XPOA 3KLWA 3M3YB 2TMPA 2CFMA 2ZTEA 4QUFA 4B9XA 2EJMA 2KHJA 4IFDJ 3KF6B 4M1UB 4U673 2KQ3A 1SN8A 1WTWA 1K3RA 2CW0D 3G6JB 3MXPA 3TP8A 3S17H 1SR3A 3MEHA 5G3LD 4IFDG 3OTOL 1NE3A 4A3MH 1X6OA 2FMMA 2X6GA 5LHY1 1D6EC 4K0KL 3TMEA 5E3FA 5GAGC 4LFBQ 5EBDA 3RD4A 3AFQA 3H3VI 4P75A 4BBRB 1UWVA 3HOUH 4IUVA 3NWTA 5C44G 1HTLD 4A3KH 2F0DA 2JXMB 1J5EQ 2B39A 3HKZE 4BY1G 3CPFA 4QL5A 4C56C 2LKVA 5M3FH 2JSOA 3D6CA 1BO0A 5I4DA 4YY3Q 4BA2I 1FNUA 1MJEA 2F0HA 2A6ED 4BWGB 4IPGA 2NN6G 4JI2L 2RA4A 2K52A 4HIKA 2OQ0A 1PZKD 2RHSB 3H0GG 4G7OC 4K5VA 4DN4M 4R9WA 4DV7L 5KNCA 1NJIC 4GKKQ 4P2CB 2E2HB 3I4NG 1YNJD 3QJYA 5IP9G 1Y1WB 2N88A 5I9PA 4IALA 5I9OA 1BNZA 4YCVA 5FKAC 1WTHA 1IBML 2EZVA 3OIQA 1JWSD 3ZJYC 2K75A 2M2LA 4DV5L 4CHTB 3K0XA 2A68C 5C3EG 1OXSC 1FD7D 1SYCA 1WCMB 1MJCA 5M5YH 4A3EH 4LW1A 2NVTB 1HQRD 4KKSA 3KUPA 4OWWB 4OHJA 4OXPA 4APVA 4X62Q 3KLSX 1S5DD 4XYQA 5DM73 4KMUC 2NVXB 3I73A 4ZK9B 1KLUD 4DV6L 1W6KA 1PFNA 1G291 1CTMA 2X6LA 4LF7L 1K3BC 5AJ3L 4OGQC 2QGQA
chains in the Genus database with same CATH topology
5IY0A 3CCRA 4GOPA 4LF6L 4JV5Q 2VNUD 4IPDA 1E22A 4A3CH 4HJ7A 4GKJL 1CKMA 1K83H 2B29A 2N78A 4FDBA 4JI6L 1PH7A 1Q12A 4DK3C 2IHFA 4X6AH 5C4JH 3CCQA 2E2HH 3MEFA 3FHWA 5C0XJ 4RG1A 1I3QH 3D0FA 3NENA 1Y1WH 4DPGA 1V43A 3RLOA 5IYDG 2IY5B 4B3ML 3PCOB 4GNXC 2AMCB 2IT1A 2NZOA 1HH2P 4LUVA 4PG3A 4POFA 1KHIA 3K7UC 2R7DA 5HGQA 2F4VL 2KCMA 1SROA 5LMNQ 2AHOB 3PUYA 3T1HL 1AE3A 4LF4Q 5C0XG 4O2DA 4OO1G 3HOVG 1T9HA 1FJGL 4GOPC 2K14A 4UY8C 1TWHH 2OQKA 4JI4Q 1KL9A 1WCMH 4DV4Q 3RNUA 1QZGA 1VQNA 2NVTH 4DAYB 1NTGA 4DV3Q 5ELNA 3S14H 4JI3Q 2HT1A 1L1OB 4IPCA 5GAHC 4JBMA 4JBKA 4B3SL 4JI7Q 1HNZQ 2IX0A 1ASZA 1VQJA 1VQHA 3WWVA 3A5UA 1GO3E 3UDIA 1JB7A 4DR6L 1CKNA 4A3FG 4DKAC 4P73A 4JC0A 4R4CA 3HOYG 1FGUA 2OCEA 1E3PA 4XTCS 2YTVA 1X54A 3B6YA 4LF9L 2ZJRA 4LFBL 1VS0A 1KQSA 2ID0A 2K50A 3KOJA 2MO0A 2EXDA 5BR8Q 3HKSA 1PH2A 3Q8DA 2Q2TA 1YZ6A 1XMQQ 1C9OA 3I2ZA 1J5EL 1P16A 3K7AH 1KRSA 3JC66 1Y1VG 2BA1A 1TWCH 2H5XA 2NVYH 3KF8B 4DUYL 4JI5Q 4J15A 4BY7G 3PO3G 1KAWA 1A8VA 3UDGA 3HFZB 4BXXG 3PIPA 4BY1H 3NBHB 1PH4A 1JJGA 4YY3L 1IYJB 4A3IG 1XMOQ 4LFBQ 1VQCA 3A5ZB 3CF5A 1FVIA 4A3MG 1EIFA 1E24A 2BA0A 4DV1L 1HZCA 1PH8A 4B3RQ 5FJ8H 4C3JH 3KJOA 1XTDA 1RIPA 1YNXA 4A3DG 1VQ7A 4LFCQ 3H0GH 2ZTDA 4TQUS 4DV0L 4GKKL 1MKHA 5IYBG 1NBWA 2D0OA 4PZ6A 3HOWG 2JA7H 3PIOA 4Y52H 3S1NH 2AKWB 1YHQA 2UXCL 3GTJH 3GTMH 4GLAC 3CCJA 1IXRA 1VQ9A 3RZDH 5IP9H 1N8RC 2BH2A 4OWTB 3I4NH 4A93H 1N34Q 3BZCA 1W3SA 3S1RH 5M3FG 1I5FA 1N32L 2HHHL 2HIXA 3W1BA 2MNAA 1ASYA 1S40A 2R92G 1K8AC 2Z6KC 4YWKA 2UUAQ 1LM0A 5C4XG 4B3TQ 3ULPA 1QVCA 5C3EH 3M4QA 1KD1C 4PZ7A 2E8GA 3GO5A 2DUDA 1HNWQ 4BA1I 3PSIA 1Z47A 3W1GA 1QVFA 3HOZG 4X62L 1TWGH 4LUOA 4DR5Q 1JMCA 3CAMA 3CMEA 1FL0A 3G48A 3CP0A 4PMWA 1SFOH 1EUJA 3L2PA 4UPAA 4JG2A 4A3LG 5IT9c 1Q81C 4GN5A 4DR7Q 2A19A 3TS2A 2MO1A 1X55A 1D7QA 4GN3B 1HZAA 2Y0SE 1OXUA 2JA5H 4LF8L 1HJPA 1VQEA 1LYLA 1YEZA 3CMAA 1PVOA 2PMZE 2KCTA 1C7YA 2UXBL 4DR2Q 3S1MH 1YITA 3VDYA 4AIMA 2JJQA 1WFQA 3IRBA 3LGJA 3AQQA 4YCUA 4DV5Q 4GNXA 1VQPA 4EX5A 5EAYA 1YVCA 3D31A 1LTLA 1X3EA 4JV5L 3AFPA 4KHZA 2JA9A 2CCZA 1PH6A 5GQOA 1QUQA 5M3MH 2VQEQ 3ULLA 3S16H 2JA8G 1XPRA 4POGA 4DUZQ 1I94Q 1HZBA 2CQOA 3TRZA 3PO2G 4A76A 3M7NA 1UEBA 1YHAA 1I50H 3F2CA 1UE7A 1IBKL 3F1ZA 2LXJA 4DR1Q 1N33Q 4NXMQ 1E1OA 1WOCA 2N3SA 2QEXA 4GOPB 4JYAQ 2GVAA 1EQQA 3I4MG 4LFAQ 1U0LA 4IO9A 1VQ6A 2ZJPA 1Q8KA 2YTYA 3E9IA 3PUZA 5LMNL 2GVBA 5DLQE 3ERSX 3J80i 4LF4L 4JI0Q 3BJUA 4P74A 1TWAH 3EIVA 2RHQB 5IE8A 1Q1BA 4NB3A 3U4ZA 4JI4L 2PNHA 4KLKA 4DV4L 2E2IH 4A75A 3HOVH 4IFDI 4Y7NH 3HOXG 2UU9Q 4A3CG 3M9BA 4DV3L 4X64Q 3GTGH 1NY4A 4JBJA 1XNQQ 4QQBX 4JI3L 1KC8C 4JBWA 3STBD 2B63G 3TEHB 4AYBE 2R7ZH 4JI7L 1HNZL 2UUBQ 4L5SA 2CWPA 2WFWA 1V1QA 3JAMi 4A3BG 3CPWA 3J7ZC 1VQ4A 2ZM6Q 3J81i 1XNRQ 1N36Q 4NPSA 1YIJA 1OTCA 1W2BA 4IJHA 1XPUA 4OWXB 1L0WA 2V1CC 1QZHA 2E5LQ 3HOYH 5JJKA 4R4OA 4MTNA 1A63A 2KBNA 1WYDA 2Q2HA 4RMFA 5BR8L 3TQYA 4P72A 3DM3A 1PH5A 1GKHA 1OXXK 1WCMG 4O0AA 3A74A 1XMQL 1CKNB 3M85A 4L5RC 2ATWA 2JA6H 4MNOA 2D0PA 1RL2A 2NN6I 4JI5L 3RR5A 4C3HH 1HR0Q 1PH1A 2ES2A 4LF5Q 2K5NA 5C44H 3F2BA 1YJWA 1C0AA 2AWOA 2WB1G 1UE6A 3I55A 3E9HA 1XMOL 1JJ2A 3PO3H 4IJLA 3A0JA 3T1YQ 2YYZA 1VQMA 1VQKA 3S1QH 4BBSG 1K73C 2Q2IA 4A3IH 1L2FA 2WB1E 2Z6KA 1PV4A 3GTKH 1H95A 1OXVA 3U4VA 1TXYA 4A3GH 1Q82C 3NEMA 4B3RL 1UE1A 2JQOA 1S3OA 4AH6A 5IP7G 4YCWA 1L1OC 5IYCG 3OTOQ 1Q86C 1PA6A 4LFCL 5JJIA 4JI8Q 3CCSA 4HJ9A 3FKIG 4LUZA 1CKOA 2K5HA 5FLXc 1EFWA 4A3DH 2VY3A 3HOUG 4K0KQ 1X3FA 2VQFQ 4DR4Q 5IYBH 1PHJA 4JI1Q 4A3KG 1YHBA 3HOWH 1N34L 3EBEA 1I6HH 1GM5A 2K4KA 2R7FA 3M4PA 5LMNW 2R93H 2Q2UA 2D62A 4QY7A 4L5QA 1VQIA 4DNIA 5FLMG 1NMGA 1G51A 3ICEA 1D8LA 1B7YB 2YTXA 2UUAL 3KDFA 4B3TL 2ZTCA 1VQAA 4L5TA 2PQAA 1GD7A 1VQLA 2K5VA 5C4XH 1HNWL 3H3VH 2UUCQ 2DGYA 3J7A5 3TS0A 5GADC 4IPHA 3I4OA 3CD6A 4DR5L 3CCVA 4JI2Q 4X65Q 2EQSA 4ALPA 3HOZH 3K81C 4WJ3M 1KXLA 5H1SE 2GN5A 2VUMG 4DR7L 1A62A 4KHPQ 3UE1A 4DV7Q 4A93G 2I5HA 4A3LH 2JEBI 4TVAB 5M5XH 1M1KC 2Y0SG 4HJAA 4JOIA 1CSQA 4R1JA 3G4SA 4DV2Q 1IL2A 3GTPH 1X3GA 2RCNA 4YWLA 1Q7YC 2PI2E 4GN4B 4QGUA 1DGSA 2I5MX 4DR2L 4AQYQ 3E0EA 4X66Q 1IBMQ 1EQRA 2WAQE 1IBLQ 3S2DH 4HJ5A 3CC2A 3OW2A 4A3EG 1SRUA 5E7NA 3EN2A 3UE0A 2C35B 1Y14B 2VQEL 5IWAQ 1EIYB 3GD7A 1X65A 3RN2A 3L0OA 1KRTA 2ZJQA 2R6GA 2HIVA 4DUZL 4OX9Q 2IX1A 3KFUA 4DAMA 1E7ZA 1VQBA 3W5OA 1EOVA 2B3GA 1I94L 3ULJA 1VCIA 3RZOH 1CUKA 4DR3Q 4GLXA 3S2HH 1EYGA 5C0XI 2CWAA 4UP9A 1OXTA 4GNXB 4OO1I 4DR1L 4BBRG 4NXML 1N33L 3M4OH 2UXDQ 4JOIC 1R9TH 4WJ4A 1N9WA 4A4IA 4JYAL 1QVGA 2AWNA 4LFAL 1QUQB 3AEVA 2N49A 5JEAJ 1YJNA 4PZ8A 3CQZH 1VQ8A 2YV5A 3I56A 3I4MH 1X9NA 5JJLA 4DV6Q 1M90C 2OTLA 4JI0L 3SGIA 5LMUQ 5IYDH 2I5LX 3RLNA 1VQFA 1VQGA 4A3JG 1PFSA 1KIXA 1HNXQ 1JE5A 3BZKA 3CCLA 3U58A 3GTQH 5JEAG 2UU9L 5M3MG 3AYHB 3CCMA 4LF7Q 1NMFA 4LWCA 4YHHQ 4X64L 5AJ3Q 1O7IA 3S15H 2A1AA 1A0IA 2RF4A 1J6QA 4R4QA 3HOXH 4AYBG 1YI2A 4UP8A 4NXNQ 1XNQL 3F2DA 2FXQA 5GROA 5M5WH 2UUBL 2NZHA 1PH3A 4LF6Q 3NELA 1B8AA 2B63H 4QIWE 4GKJQ 4KI0A 4MZ9A 3H15A 4JI6Q 2CKZB 2ZM6L 3CCEA 4R4IA 1IBKQ 1XNRL 1WI5A 1N36L 3TREA 4A3BH 4OONA 1Y1WG 4R4TA 2A8VA 1AE2A 4GLVB 3CXCA 4ME3A 2VZAA 2E5LL 4GS3A 2PI2A 3K8AA 4UP7A 4A3FH 3PGZA 3RN5A 1YJ9A 4B3MQ 1WJJA 2MFIA 3CCUA 2YU9H 1L1OA 1XPOA 2F4VQ 1E1TA 3KF6A 3S24A 2ALYB 3KLWA 3T1HQ 3OYYA 1JT8A 1PYBA 1MIUA 2CFMA 2IHEA 2L15A 1HR0L 4IOCA 2ZTEA 1S72A 4LF5L 1FJGQ 2MQHA 1SLJA 2R7ZG 3I7FA 3CW2C 4DK6C 2NVQH 1VQOA 2KHJA 1K9MC 4IFDJ 5ELOA 3KF6B 1Y1VH 3T1YL 4BY7H 4HIDA 1X56A 1BBUA 1SN8A 1HZ9A 3L7ZC 4QJFA 4B3SQ 3GTOH 1K3RA 3FP9A 4BXXH 4BBSH 2KENA 4JCVE 3PF4A 3S17H 1SR3A 2NVXH 4IFDG 3OTOL 4DR6Q 1BVSA 1U5KA 5HY6A 4JI8L 1NE3A 4A3MH 1P8LA 1X6OA 2F52A 5IP7H 2JEAI 3ER0A 5IYCH 3K80C 2Z0SA 4K0KL 5GAGC 3UDFA 2JA6G 1UE5A 2HQLA 2VQFL 4LF9Q 4DR4L 2LXKA 3AFQA 3FKIH 4P71A 1VQDA 4P75A 1UWVA 1YBYA 4JI1L 1PYSB 3H3VI 3HOUH 2WP8J 2E2JH 5C44G 1K0RA 3HKZG 4A3KH 3BU2A 2JE6I 3G6EA 3PUVA 1J5EQ 1SE8A 1Z9FA 4DUYQ 3HKZE 4BY1G 5FLMH 1SMXA 3CPFA 4QL5A 5M3FH 1CSPA 2XGTA 2R92H 4A3GG 3STBC 1K8GA 5J3BA 4YY3Q 4BA2I 2UUCL 2EIFA 1MJEA 4HIMA 3GDEA 1G6PA 1BKBA 4IPGA 2NN6G 3F8TA 5FJ8G 4JI2L 4IOAA 2N8NA 4X65L 4DV1Q 2K52A 4HIKA 2OQ0A 2RHSB 3H0GG 3PUWA 3KDFB 4KHPL 1IZ6A 2KHIA 4DV7L 2PQAB 2QA4A 2F3IA 1NJIC 4LNQA 2JA7G 3GTLH 4GKKQ 4DV0Q 2VUMH 3I4NG 2R93G 5IP9G 4DV2L 3M3YH 2VS1A 3J80c 2OWOA 2UXCQ 4YCVA 4AQYL 1B70B 4X66L 2WAQG 1IBML 5GAEC 2HHHQ 1N32Q 1IBLL 3ZJYC 2K75A 2VL6A 3KJPA 4HIOA 1XJVA 1TWFH 2LSSA 3G71A 1HR0W 4DV5L 3K0XA 5C3EG 1OXSC 5IWAL 1MJCA 5M5YH 4A3EH 4LW1A 2ASBA 2I0QA 3UDXA 4HJ8A 4OX9L 3PV0A 4YWMA 1Q46A 3RLFA 3JAMc 2VW9A 5K36G 4OWWB 4DR3L 1LUZA 1JJCB 4OXPA 4APVA 4X62Q 2XTIA 1Q1EA 4C2MH 3J81c 3J81j 2UXDL 2JA8H 1V9PA 1GVPA 3PF5A 4BBRH 3PO2H 2BH8A 2JK8A 4EQ5A 2JA5G 3CC4A 2OTJA 4DV6L 3KYHC 5LMUL 3MXNB 4XIGS 4LF8Q 1G291 1HNXL 1BBWA 1PH9A 1AH9A 1EWIA 4H02A 3DLLA 4A3JH 4LF7L 2UXBQ 4YHHL 3U50C 5AJ3L 3CC7A 2QGQA 4NXNL 4C3IH 3PUXA 1VQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IY0 A;  3CCR A;  4GOP A;  4LF6 L;  4JV5 Q;  2VNU D;  4IPD A;  1E22 A;  4A3C H;  4HJ7 A;  4GKJ L;  1CKM A;  1K83 H;  2B29 A;  2N78 A;  4FDB A;  4JI6 L;  1PH7 A;  1Q12 A;  4DK3 C;  2IHF A;  4X6A H;  5C4J H;  3CCQ A;  2E2H H;  3MEF A;  3FHW A;  5C0X J;  4RG1 A;  1I3Q H;  3D0F A;  3NEN A;  1Y1W H;  4DPG A;  1V43 A;  3RLO A;  5IYD G;  2IY5 B;  4B3M L;  3PCO B;  4GNX C;  2AMC B;  2IT1 A;  2NZO A;  1HH2 P;  4LUV A;  4PG3 A;  4POF A;  1KHI A;  3K7U C;  2R7D A;  5HGQ A;  2F4V L;  2KCM A;  1SRO A;  5LMN Q;  2AHO B;  3PUY A;  3T1H L;  1AE3 A;  4LF4 Q;  5C0X G;  4O2D A;  4OO1 G;  3HOV G;  1T9H A;  1FJG L;  4GOP C;  2K14 A;  4UY8 C;  1TWH H;  2OQK A;  4JI4 Q;  1KL9 A;  1WCM H;  4DV4 Q;  3RNU A;  1QZG A;  1VQN A;  2NVT H;  4DAY B;  1NTG A;  4DV3 Q;  5ELN A;  3S14 H;  4JI3 Q;  2HT1 A;  1L1O B;  4IPC A;  5GAH C;  4JBM A;  4JBK A;  4B3S L;  4JI7 Q;  1HNZ Q;  2IX0 A;  1ASZ A;  1VQJ A;  1VQH A;  3WWV A;  3A5U A;  1GO3 E;  3UDI A;  1JB7 A;  4DR6 L;  1CKN A;  4A3F G;  4DKA C;  4P73 A;  4JC0 A;  4R4C A;  3HOY G;  1FGU A;  2OCE A;  1E3P A;  4XTC S;  2YTV A;  1X54 A;  3B6Y A;  4LF9 L;  2ZJR A;  4LFB L;  1VS0 A;  1KQS A;  2ID0 A;  2K50 A;  3KOJ A;  2MO0 A;  2EXD A;  5BR8 Q;  3HKS A;  1PH2 A;  3Q8D A;  2Q2T A;  1YZ6 A;  1XMQ Q;  1C9O A;  3I2Z A;  1J5E L;  1P16 A;  3K7A H;  1KRS A;  3JC6 6;  1Y1V G;  2BA1 A;  1TWC H;  2H5X A;  2NVY H;  3KF8 B;  4DUY L;  4JI5 Q;  4J15 A;  4BY7 G;  3PO3 G;  1KAW A;  1A8V A;  3UDG A;  3HFZ B;  4BXX G;  3PIP A;  4BY1 H;  3NBH B;  1PH4 A;  1JJG A;  4YY3 L;  1IYJ B;  4A3I G;  1XMO Q;  4LFB Q;  1VQC A;  3A5Z B;  3CF5 A;  1FVI A;  4A3M G;  1EIF A;  1E24 A;  2BA0 A;  4DV1 L;  1HZC A;  1PH8 A;  4B3R Q;  5FJ8 H;  4C3J H;  3KJO A;  1XTD A;  1RIP A;  1YNX A;  4A3D G;  1VQ7 A;  4LFC Q;  3H0G H;  2ZTD A;  4TQU S;  4DV0 L;  4GKK L;  1MKH A;  5IYB G;  1NBW A;  2D0O A;  4PZ6 A;  3HOW G;  2JA7 H;  3PIO A;  4Y52 H;  3S1N H;  2AKW B;  1YHQ A;  2UXC L;  3GTJ H;  3GTM H;  4GLA C;  3CCJ A;  1IXR A;  1VQ9 A;  3RZD H;  5IP9 H;  1N8R C;  2BH2 A;  4OWT B;  3I4N H;  4A93 H;  1N34 Q;  3BZC A;  1W3S A;  3S1R H;  5M3F G;  1I5F A;  1N32 L;  2HHH L;  2HIX A;  3W1B A;  2MNA A;  1ASY A;  1S40 A;  2R92 G;  1K8A C;  2Z6K C;  4YWK A;  2UUA Q;  1LM0 A;  5C4X G;  4B3T Q;  3ULP A;  1QVC A;  5C3E H;  3M4Q A;  1KD1 C;  4PZ7 A;  2E8G A;  3GO5 A;  2DUD A;  1HNW Q;  4BA1 I;  3PSI A;  1Z47 A;  3W1G A;  1QVF A;  3HOZ G;  4X62 L;  1TWG H;  4LUO A;  4DR5 Q;  1JMC A;  3CAM A;  3CME A;  1FL0 A;  3G48 A;  3CP0 A;  4PMW A;  1SFO H;  1EUJ A;  3L2P A;  4UPA A;  4JG2 A;  4A3L G;  5IT9 c;  1Q81 C;  4GN5 A;  4DR7 Q;  2A19 A;  3TS2 A;  2MO1 A;  1X55 A;  1D7Q A;  4GN3 B;  1HZA A;  2Y0S E;  1OXU A;  2JA5 H;  4LF8 L;  1HJP A;  1VQE A;  1LYL A;  1YEZ A;  3CMA A;  1PVO A;  2PMZ E;  2KCT A;  1C7Y A;  2UXB L;  4DR2 Q;  3S1M H;  1YIT A;  3VDY A;  4AIM A;  2JJQ A;  1WFQ A;  3IRB A;  3LGJ A;  3AQQ A;  4YCU A;  4DV5 Q;  4GNX A;  1VQP A;  4EX5 A;  5EAY A;  1YVC A;  3D31 A;  1LTL A;  1X3E A;  4JV5 L;  3AFP A;  4KHZ A;  2JA9 A;  2CCZ A;  1PH6 A;  5GQO A;  1QUQ A;  5M3M H;  2VQE Q;  3ULL A;  3S16 H;  2JA8 G;  1XPR A;  4POG A;  4DUZ Q;  1I94 Q;  1HZB A;  2CQO A;  3TRZ A;  3PO2 G;  4A76 A;  3M7N A;  1UEB A;  1YHA A;  1I50 H;  3F2C A;  1UE7 A;  1IBK L;  3F1Z A;  2LXJ A;  4DR1 Q;  1N33 Q;  4NXM Q;  1E1O A;  1WOC A;  2N3S A;  2QEX A;  4GOP B;  4JYA Q;  2GVA A;  1EQQ A;  3I4M G;  4LFA Q;  1U0L A;  4IO9 A;  1VQ6 A;  2ZJP A;  1Q8K A;  2YTY A;  3E9I A;  3PUZ A;  5LMN L;  2GVB A;  5DLQ E;  3ERS X;  3J80 i;  4LF4 L;  4JI0 Q;  3BJU A;  4P74 A;  1TWA H;  3EIV A;  2RHQ B;  5IE8 A;  1Q1B A;  4NB3 A;  3U4Z A;  4JI4 L;  2PNH A;  4KLK A;  4DV4 L;  2E2I H;  4A75 A;  3HOV H;  4IFD I;  4Y7N H;  3HOX G;  2UU9 Q;  4A3C G;  3M9B A;  4DV3 L;  4X64 Q;  3GTG H;  1NY4 A;  4JBJ A;  1XNQ Q;  4QQB X;  4JI3 L;  1KC8 C;  4JBW A;  3STB D;  2B63 G;  3TEH B;  4AYB E;  2R7Z H;  4JI7 L;  1HNZ L;  2UUB Q;  4L5S A;  2CWP A;  2WFW A;  1V1Q A;  3JAM i;  4A3B G;  3CPW A;  3J7Z C;  1VQ4 A;  2ZM6 Q;  3J81 i;  1XNR Q;  1N36 Q;  4NPS A;  1YIJ A;  1OTC A;  1W2B A;  4IJH A;  1XPU A;  4OWX B;  1L0W A;  2V1C C;  1QZH A;  2E5L Q;  3HOY H;  5JJK A;  4R4O A;  4MTN A;  1A63 A;  2KBN A;  1WYD A;  2Q2H A;  4RMF A;  5BR8 L;  3TQY A;  4P72 A;  3DM3 A;  1PH5 A;  1GKH A;  1OXX K;  1WCM G;  4O0A A;  3A74 A;  1XMQ L;  1CKN B;  3M85 A;  4L5R C;  2ATW A;  2JA6 H;  4MNO A;  2D0P A;  1RL2 A;  2NN6 I;  4JI5 L;  3RR5 A;  4C3H H;  1HR0 Q;  1PH1 A;  2ES2 A;  4LF5 Q;  2K5N A;  5C44 H;  3F2B A;  1YJW A;  1C0A A;  2AWO A;  2WB1 G;  1UE6 A;  3I55 A;  3E9H A;  1XMO L;  1JJ2 A;  3PO3 H;  4IJL A;  3A0J A;  3T1Y Q;  2YYZ A;  1VQM A;  1VQK A;  3S1Q H;  4BBS G;  1K73 C;  2Q2I A;  4A3I H;  1L2F A;  2WB1 E;  2Z6K A;  1PV4 A;  3GTK H;  1H95 A;  1OXV A;  3U4V A;  1TXY A;  4A3G H;  1Q82 C;  3NEM A;  4B3R L;  1UE1 A;  2JQO A;  1S3O A;  4AH6 A;  5IP7 G;  4YCW A;  1L1O C;  5IYC G;  3OTO Q;  1Q86 C;  1PA6 A;  4LFC L;  5JJI A;  4JI8 Q;  3CCS A;  4HJ9 A;  3FKI G;  4LUZ A;  1CKO A;  2K5H A;  5FLX c;  1EFW A;  4A3D H;  2VY3 A;  3HOU G;  4K0K Q;  1X3F A;  2VQF Q;  4DR4 Q;  5IYB H;  1PHJ A;  4JI1 Q;  4A3K G;  1YHB A;  3HOW H;  1N34 L;  3EBE A;  1I6H H;  1GM5 A;  2K4K A;  2R7F A;  3M4P A;  5LMN W;  2R93 H;  2Q2U A;  2D62 A;  4QY7 A;  4L5Q A;  1VQI A;  4DNI A;  5FLM G;  1NMG A;  1G51 A;  3ICE A;  1D8L A;  1B7Y B;  2YTX A;  2UUA L;  3KDF A;  4B3T L;  2ZTC A;  1VQA A;  4L5T A;  2PQA A;  1GD7 A;  1VQL A;  2K5V A;  5C4X H;  1HNW L;  3H3V H;  2UUC Q;  2DGY A;  3J7A 5;  3TS0 A;  5GAD C;  4IPH A;  3I4O A;  3CD6 A;  4DR5 L;  3CCV A;  4JI2 Q;  4X65 Q;  2EQS A;  4ALP A;  3HOZ H;  3K81 C;  4WJ3 M;  1KXL A;  5H1S E;  2GN5 A;  2VUM G;  4DR7 L;  1A62 A;  4KHP Q;  3UE1 A;  4DV7 Q;  4A93 G;  2I5H A;  4A3L H;  2JEB I;  4TVA B;  5M5X H;  1M1K C;  2Y0S G;  4HJA A;  4JOI A;  1CSQ A;  4R1J A;  3G4S A;  4DV2 Q;  1IL2 A;  3GTP H;  1X3G A;  2RCN A;  4YWL A;  1Q7Y C;  2PI2 E;  4GN4 B;  4QGU A;  1DGS A;  2I5M X;  4DR2 L;  4AQY Q;  3E0E A;  4X66 Q;  1IBM Q;  1EQR A;  2WAQ E;  1IBL Q;  3S2D H;  4HJ5 A;  3CC2 A;  3OW2 A;  4A3E G;  1SRU A;  5E7N A;  3EN2 A;  3UE0 A;  2C35 B;  1Y14 B;  2VQE L;  5IWA Q;  1EIY B;  3GD7 A;  1X65 A;  3RN2 A;  3L0O A;  1KRT A;  2ZJQ A;  2R6G A;  2HIV A;  4DUZ L;  4OX9 Q;  2IX1 A;  3KFU A;  4DAM A;  1E7Z A;  1VQB A;  3W5O A;  1EOV A;  2B3G A;  1I94 L;  3ULJ A;  1VCI A;  3RZO H;  1CUK A;  4DR3 Q;  4GLX A;  3S2H H;  1EYG A;  5C0X I;  2CWA A;  4UP9 A;  1OXT A;  4GNX B;  4OO1 I;  4DR1 L;  4BBR G;  4NXM L;  1N33 L;  3M4O H;  2UXD Q;  4JOI C;  1R9T H;  4WJ4 A;  1N9W A;  4A4I A;  4JYA L;  1QVG A;  2AWN A;  4LFA L;  1QUQ B;  3AEV A;  2N49 A;  5JEA J;  1YJN A;  4PZ8 A;  3CQZ H;  1VQ8 A;  2YV5 A;  3I56 A;  3I4M H;  1X9N A;  5JJL A;  4DV6 Q;  1M90 C;  2OTL A;  4JI0 L;  3SGI A;  5LMU Q;  5IYD H;  2I5L X;  3RLN A;  1VQF A;  1VQG A;  4A3J G;  1PFS A;  1KIX A;  1HNX Q;  1JE5 A;  3BZK A;  3CCL A;  3U58 A;  3GTQ H;  5JEA G;  2UU9 L;  5M3M G;  3AYH B;  3CCM A;  4LF7 Q;  1NMF A;  4LWC A;  4YHH Q;  4X64 L;  5AJ3 Q;  1O7I A;  3S15 H;  2A1A A;  1A0I A;  2RF4 A;  1J6Q A;  4R4Q A;  3HOX H;  4AYB G;  1YI2 A;  4UP8 A;  4NXN Q;  1XNQ L;  3F2D A;  2FXQ A;  5GRO A;  5M5W H;  2UUB L;  2NZH A;  1PH3 A;  4LF6 Q;  3NEL A;  1B8A A;  2B63 H;  4QIW E;  4GKJ Q;  4KI0 A;  4MZ9 A;  3H15 A;  4JI6 Q;  2CKZ B;  2ZM6 L;  3CCE A;  4R4I A;  1IBK Q;  1XNR L;  1WI5 A;  1N36 L;  3TRE A;  4A3B H;  4OON A;  1Y1W G;  4R4T A;  2A8V A;  1AE2 A;  4GLV B;  3CXC A;  4ME3 A;  2VZA A;  2E5L L;  4GS3 A;  2PI2 A;  3K8A A;  4UP7 A;  4A3F H;  3PGZ A;  3RN5 A;  1YJ9 A;  4B3M Q;  1WJJ A;  2MFI A;  3CCU A;  2YU9 H;  1L1O A;  1XPO A;  2F4V Q;  1E1T A;  3KF6 A;  3S24 A;  2ALY B;  3KLW A;  3T1H Q;  3OYY A;  1JT8 A;  1PYB A;  1MIU A;  2CFM A;  2IHE A;  2L15 A;  1HR0 L;  4IOC A;  2ZTE A;  1S72 A;  4LF5 L;  1FJG Q;  2MQH A;  1SLJ A;  2R7Z G;  3I7F A;  3CW2 C;  4DK6 C;  2NVQ H;  1VQO A;  2KHJ A;  1K9M C;  4IFD J;  5ELO A;  3KF6 B;  1Y1V H;  3T1Y L;  4BY7 H;  4HID A;  1X56 A;  1BBU A;  1SN8 A;  1HZ9 A;  3L7Z C;  4QJF A;  4B3S Q;  3GTO H;  1K3R A;  3FP9 A;  4BXX H;  4BBS H;  2KEN A;  4JCV E;  3PF4 A;  3S17 H;  1SR3 A;  2NVX H;  4IFD G;  3OTO L;  4DR6 Q;  1BVS A;  1U5K A;  5HY6 A;  4JI8 L;  1NE3 A;  4A3M H;  1P8L A;  1X6O A;  2F52 A;  5IP7 H;  2JEA I;  3ER0 A;  5IYC H;  3K80 C;  2Z0S A;  4K0K L;  5GAG C;  3UDF A;  2JA6 G;  1UE5 A;  2HQL A;  2VQF L;  4LF9 Q;  4DR4 L;  2LXK A;  3AFQ A;  3FKI H;  4P71 A;  1VQD A;  4P75 A;  1UWV A;  1YBY A;  4JI1 L;  1PYS B;  3H3V I;  3HOU H;  2WP8 J;  2E2J H;  5C44 G;  1K0R A;  3HKZ G;  4A3K H;  3BU2 A;  2JE6 I;  3G6E A;  3PUV A;  1J5E Q;  1SE8 A;  1Z9F A;  4DUY Q;  3HKZ E;  4BY1 G;  5FLM H;  1SMX A;  3CPF A;  4QL5 A;  5M3F H;  1CSP A;  2XGT A;  2R92 H;  4A3G G;  3STB C;  1K8G A;  5J3B A;  4YY3 Q;  4BA2 I;  2UUC L;  2EIF A;  1MJE A;  4HIM A;  3GDE A;  1G6P A;  1BKB A;  4IPG A;  2NN6 G;  3F8T A;  5FJ8 G;  4JI2 L;  4IOA A;  2N8N A;  4X65 L;  4DV1 Q;  2K52 A;  4HIK A;  2OQ0 A;  2RHS B;  3H0G G;  3PUW A;  3KDF B;  4KHP L;  1IZ6 A;  2KHI A;  4DV7 L;  2PQA B;  2QA4 A;  2F3I A;  1NJI C;  4LNQ A;  2JA7 G;  3GTL H;  4GKK Q;  4DV0 Q;  2VUM H;  3I4N G;  2R93 G;  5IP9 G;  4DV2 L;  3M3Y H;  2VS1 A;  3J80 c;  2OWO A;  2UXC Q;  4YCV A;  4AQY L;  1B70 B;  4X66 L;  2WAQ G;  1IBM L;  5GAE C;  2HHH Q;  1N32 Q;  1IBL L;  3ZJY C;  2K75 A;  2VL6 A;  3KJP A;  4HIO A;  1XJV A;  1TWF H;  2LSS A;  3G71 A;  1HR0 W;  4DV5 L;  3K0X A;  5C3E G;  1OXS C;  5IWA L;  1MJC A;  5M5Y H;  4A3E H;  4LW1 A;  2ASB A;  2I0Q A;  3UDX A;  4HJ8 A;  4OX9 L;  3PV0 A;  4YWM A;  1Q46 A;  3RLF A;  3JAM c;  2VW9 A;  5K36 G;  4OWW B;  4DR3 L;  1LUZ A;  1JJC B;  4OXP A;  4APV A;  4X62 Q;  2XTI A;  1Q1E A;  4C2M H;  3J81 c;  3J81 j;  2UXD L;  2JA8 H;  1V9P A;  1GVP A;  3PF5 A;  4BBR H;  3PO2 H;  2BH8 A;  2JK8 A;  4EQ5 A;  2JA5 G;  3CC4 A;  2OTJ A;  4DV6 L;  3KYH C;  5LMU L;  3MXN B;  4XIG S;  4LF8 Q;  1G29 1;  1HNX L;  1BBW A;  1PH9 A;  1AH9 A;  1EWI A;  4H02 A;  3DLL A;  4A3J H;  4LF7 L;  2UXB Q;  4YHH L;  3U50 C;  5AJ3 L;  3CC7 A;  2QGQ A;  4NXN L;  4C3I H;  3PUX A;  1VQ5 A; 
#chains in the Genus database with same CATH topology
 1L0Y B;  2KHS A;  3BG3 A;  2VNU D;  1E22 A;  2HDL A;  2QDL A;  1K83 H;  2B29 A;  1KAA A;  2N78 A;  4JI6 L;  1H9M A;  1VMP A;  5C5L A;  1PRT C;  3NWS A;  5I6Y A;  1KTK A;  2E2D C;  3V96 A;  1I3Q H;  4HAE A;  1CM9 A;  2IY5 B;  1DD2 A;  2IT1 A;  2NZO A;  1CHP D;  2R7D A;  1TS4 A;  1BDO A;  1SRO A;  5LMN Q;  3S1N B;  4OO1 G;  3MWY W;  2PPB C;  2VUM B;  1FJG L;  3TZD A;  3J7Y W;  4RHR A;  4UY8 C;  1TWH H;  1J8I A;  4DV4 Q;  1VQN A;  1IYU A;  5CV5 A;  5EPL A;  3VR5 A;  2WAQ B;  1B2T A;  4JBK A;  1F9Q A;  2IW3 A;  4WRD A;  1HNZ Q;  2IX0 A;  1VQJ A;  3GV3 A;  1XYI A;  2XWB B;  1JB7 A;  1GO3 E;  1CKN A;  5G3L F;  4A3F G;  3HOY G;  4JC0 A;  4OL7 A;  2EY6 A;  2L9H A;  2JN4 A;  1HUM A;  1FNW A;  3B6Y A;  5LL6 X;  1A15 A;  2ZJR A;  2B2T C;  1SFO B;  4LF9 L;  1VS0 A;  1CHQ D;  1KQS A;  2ID0 A;  2K50 A;  1XMQ Q;  4CJ2 C;  1C9O A;  2K5Q A;  5DNF A;  4JI5 Q;  1TWC H;  2NVY H;  4J15 A;  4CBV A;  2BE5 D;  5KRU A;  3S1M B;  1JJG A;  4BS9 A;  2OT2 A;  1XMO Q;  3K57 A;  5C4Z A;  1BCP B;  3R8B A;  2M00 A;  4B3R Q;  5FJ8 H;  1XTD A;  3MFG A;  2B2Y A;  3MC0 B;  1GUW A;  1SYD A;  3GQB A;  4LFC Q;  1TY0 A;  2D0O A;  2JA7 H;  3PIO A;  4FYD A;  2LFN A;  2F0L A;  2UXC L;  3GTJ H;  4XT3 B;  1VQ9 A;  1N8R C;  1M8A A;  3G7L A;  3MZ5 A;  1N34 Q;  5CV9 A;  1I5F A;  3W1B A;  2F4I A;  1EIH A;  1GUS A;  3T16 A;  2F0Q A;  2WKD A;  3ULP A;  2TSS A;  4K2K A;  2F0J A;  2DUD A;  2R7Z B;  4LUO A;  1JMC A;  3CAM A;  5IT9 L;  3CME A;  2AQ2 B;  4CJ0 B;  3L2P A;  4UPA A;  4JG2 A;  1MBY A;  2F0T A;  4CDF C;  2A19 A;  3NE5 B;  4FF2 A;  4GN3 B;  2DN8 A;  1CZW A;  1GUO A;  1XTC D;  1VQE A;  3CMA A;  3DUZ A;  2XNA C;  2KCT A;  4LK1 C;  3Q24 A;  1E2Z A;  3DWQ A;  4DV5 Q;  4GNX A;  4C3H B;  4KV6 A;  3T53 B;  4N9T A;  2BDN A;  1H9K A;  1I4Q A;  1QUQ A;  5CYU A;  1RD9 D;  3R2T A;  1HFN A;  1BR9 A;  1G8Z D;  4POG A;  3SE0 A;  3S1Q B;  1I94 Q;  2A5H A;  1UEB A;  4A3I B;  1I50 H;  2KCC A;  1IBK L;  4DR1 Q;  5D14 A;  1N33 Q;  1E1O A;  2G9H D;  2XRS D;  2C9O A;  1SYF A;  4JYA Q;  2GVA A;  2ZJP A;  2PZU A;  3PUZ A;  4ZKC B;  2AQ3 B;  3ERS X;  2K33 A;  4V0B A;  4H13 C;  1EQV A;  1Q1B A;  4NB3 A;  5IE8 A;  1GJX A;  2E2I H;  3HOV H;  4CDD C;  4A75 A;  4Y7N H;  5CV8 A;  2QDB A;  4XQQ A;  4X64 Q;  1SE2 A;  3GTG H;  4JBJ A;  3LX0 A;  4QQB X;  1ET9 A;  2CQA A;  1KC8 C;  2RSN A;  4JI7 L;  4WOR A;  3SEB A;  3CPW A;  5CV7 A;  3SK8 A;  5C4X B;  1ZEQ X;  1I6V C;  1VQ4 A;  1NR2 A;  4NPS A;  4RA8 A;  2QF7 A;  1YIJ A;  4IZ8 A;  1W2B A;  3VR2 A;  1WD1 A;  1A6X A;  3MFY A;  1AW7 A;  2V1C C;  1QZH A;  5KND A;  1WYD A;  2DNC A;  2Q2H A;  5BR8 L;  3DM3 A;  2L1B A;  2PW5 A;  1WCM G;  1ENF A;  1CKN B;  4IUP A;  3M85 A;  2ES2 A;  2KVM A;  1PH1 A;  3P1H A;  5J1Z A;  1PDQ A;  1STB A;  1S5F D;  2AWO A;  2A68 D;  2NTS A;  3PO3 H;  1JJ2 A;  3S2D B;  1VQK A;  1VQM A;  1EYA A;  1SYE A;  3FRP B;  2EJF C;  2Z6K A;  3LWU A;  4B9W A;  1Q82 C;  3NEM A;  1XWE A;  1EWH A;  4YCW A;  3S16 B;  1Q86 C;  5JJI A;  4JI8 Q;  2K5D A;  2K04 A;  3CCS A;  3FKI G;  4K5X A;  4FF1 A;  4A3D H;  1CKO A;  3NHH A;  1EFW A;  1R9T B;  2VY3 A;  1SAP A;  2ZT9 C;  2VQF Q;  4DR4 Q;  3DHQ A;  1STG A;  1YHB A;  3CQZ B;  4NMZ A;  2R93 H;  2D62 A;  4QY7 A;  1U9R A;  4DNI A;  3IFD A;  1G51 A;  4C1N K;  1D8L A;  2B2U A;  1B7Y B;  2YTX A;  2UUA L;  3KDF A;  2AUJ D;  4FF4 A;  1DOM A;  1Z6H A;  5KEE A;  1JE4 A;  5A35 A;  2K5V A;  4Q5V A;  2FFK B;  2DGY A;  3HZX A;  5E4W C;  5M5W B;  3BVZ A;  2OF1 A;  4DAP A;  4DR5 L;  4DA2 A;  2B63 B;  2K5W A;  1PRT D;  4WJ3 M;  1KXL A;  2EDG A;  2GN5 A;  5H1S E;  2VUM G;  1BCP C;  4A3B B;  4RCN A;  2I5H A;  1VF5 C;  4A3L H;  2JEB I;  4IUR A;  1ZXT A;  1B3Q A;  4DV2 Q;  1FYC A;  1EY9 A;  1AFP A;  2RCN A;  2F0W A;  1JIC A;  1H9J A;  2DY7 A;  5ISR A;  2YU9 B;  4QGU A;  1DGS A;  1ONL A;  1BQQ T;  2BOS A;  1A2T A;  1IBL Q;  4ZCK A;  3A56 A;  1QWY A;  3UE0 A;  2A6H C;  2C35 B;  2X69 A;  5IWA Q;  4HSV A;  1X65 A;  3RN2 A;  2R6G A;  2RSO A;  3KFU A;  1E7Z A;  1VQB A;  3RZO H;  2B3G A;  2CHB D;  2O4X A;  1VCI A;  3MXN A;  1CUK A;  3ULJ A;  3S2H H;  1S4Z A;  4GNX B;  3H6M A;  4ZAI A;  1C8C A;  4L63 B;  2UXD Q;  3SK5 A;  3S17 B;  2MJ8 A;  5J22 A;  4PNY A;  2AWN A;  4LFA L;  1QUQ B;  3AEV A;  4A3M B;  2N49 A;  1SNC A;  3CU7 A;  4K5W A;  3J7A F;  1X9N A;  4RWS C;  4KY7 A;  1M90 C;  5JJL A;  5IOD A;  4RGM A;  3NK9 A;  3RLN A;  5A2Q E;  3Q0A A;  4MN3 A;  3HOU B;  3BZK A;  3CCL A;  3U58 A;  3RMH A;  4C3I G;  4A3K B;  1NMF A;  4DFA A;  1I6H B;  1IYV A;  2A1A A;  1XNQ L;  1J6Q A;  4AYB G;  5EPK A;  2FXQ A;  1PH3 A;  5M3F B;  4GKJ Q;  4MZ9 A;  1O7Y A;  3NQT A;  1XNR L;  3CCE A;  4R4I A;  1IBK Q;  4KHV A;  4GLV B;  2D2C C;  2EE1 A;  2OXP A;  2BCO A;  2PI2 A;  5CR3 A;  2EOT A;  3PGZ A;  4DAY A;  1WJJ A;  2MFI A;  1L1O A;  2F4V Q;  1E1T A;  3KF6 A;  3C1E A;  3S24 A;  3T1H Q;  1JT8 A;  1G91 A;  1MIU A;  2IHE A;  2Y0S B;  4IOC A;  1S72 A;  3DXJ C;  2R7Z G;  3GTP B;  1WTR A;  4DK6 C;  5IGE A;  1QOH A;  3QG1 A;  1K9M C;  5ELO A;  3T1Y L;  1X56 A;  1BBU A;  4B3S Q;  2F0N A;  4BXX H;  5M5Y B;  2KEN A;  2WAC A;  3X3N A;  4I65 A;  4DR6 Q;  1BVS A;  3K5L A;  4HCS A;  4NKL A;  1HHV A;  1P8L A;  4S3S A;  3ER0 A;  5IYC H;  2Z0S A;  3A55 A;  2HQL A;  2EY5 A;  3NBH A;  1VQD A;  4C3H G;  4JI1 L;  1G2S A;  1EU3 A;  1K0R A;  3BU2 A;  2F3V A;  3G6E A;  5DAU A;  3PUV A;  4OEM B;  3C46 A;  3D4W A;  4TRD A;  1SMX A;  4KK7 A;  1MGS A;  1DOL A;  2XGT A;  1ZKO A;  2UUC L;  2EIF A;  3K59 A;  4HIM A;  1I4G A;  1G6P A;  1CA6 A;  4IOA A;  3T4A C;  1OO9 B;  1K83 B;  3PUW A;  2CH4 A;  3KDF B;  1NSN S;  1IZ6 A;  2G9D A;  2KHI A;  1WD0 A;  4EQO A;  3J80 c;  4K2L A;  1D5X C;  2WII B;  4AQY L;  4Q0F A;  2HHH Q;  1EL0 A;  3KJP A;  1PTO B;  1XJV A;  1TWF H;  5COY A;  2LSS A;  1TWH B;  1CFM A;  3JAM L;  2CVR A;  2ASB A;  2I0Q A;  3UDX A;  4HJ8 A;  4OX9 L;  4CJ1 B;  4HR7 B;  1Q46 A;  2VW9 A;  3J81 L;  3BVM A;  1JJC B;  2XTI A;  1Q1E A;  4C2M H;  3J81 j;  4UDU C;  2WB1 B;  3Q6S A;  2JA8 H;  4YIJ A;  1S5C D;  3PF5 A;  4BBS B;  3PO2 H;  2PO4 A;  3A7A B;  4XXE A;  4QUC A;  2OTJ A;  3CC4 A;  5D65 A;  1GOZ A;  5CBA E;  1K28 A;  3I8Z A;  3MXN B;  2EYM A;  4HMJ A;  2VB2 X;  4XIG S;  4LF8 Q;  3C3L A;  1HNX L;  4A3J H;  5JVH 3;  3FPP A;  4KD4 A;  3U50 C;  2PYK A;  4NXN L;  5JEA H;  4K8J A;  1X32 A;  5IOC A;  4A3C H;  4HJ7 A;  1Y8N B;  4CGY B;  2F0E A;  1Q12 A;  3RUZ A;  3EFX D;  5C3X A;  5C4J H;  3CCQ A;  3E6Z X;  2H4O A;  3MEF A;  5C0X J;  1TT2 A;  1F9R A;  5D3D A;  1LTA D;  5EJW A;  4B3M L;  1KNE A;  4GNX C;  2AMC B;  1KHI A;  2SDF A;  1D1I A;  3VYU A;  2JA7 B;  3GTL B;  5C0X G;  4O2D A;  1T9H A;  1SEB D;  4GOP C;  1I4P A;  2OQK A;  2JYO A;  4JI4 Q;  3LWE A;  1ET6 A;  2N55 A;  2B8G A;  4DAY B;  1NTG A;  5ELN A;  1FR3 A;  1NR4 A;  1L1O B;  1V1O A;  4IPC A;  5GAH C;  1GHJ A;  1LAC A;  3BYT B;  3WWV A;  2FJ2 A;  3OPO A;  4X3U A;  1C48 A;  2PW7 A;  1RTO A;  3VR6 A;  3TBI B;  4IFD H;  1BCP D;  2V4D A;  1X54 A;  3PIP 3;  2F0S A;  3A7L A;  1TR5 A;  3H3V C;  2K32 A;  1UEA B;  1PH2 A;  3T56 B;  1E0B A;  1XXG A;  3H94 A;  1EZ6 A;  3K7A H;  4K6L A;  4DUY L;  1EYC A;  2F0P A;  3ND8 A;  5F2D A;  2AUK A;  1A8V A;  3UDG A;  4BY1 H;  3NBH B;  2P5Z X;  1PH4 A;  2A6H D;  3OW7 A;  1IYJ B;  1G6Z A;  4CKB A;  4A3M G;  4DV1 L;  4DXG A;  1HZC A;  3I72 A;  4QIW B;  2NN6 H;  3KJO A;  1RJT A;  1D5Z C;  1RIP A;  3CKI B;  1PMR A;  1O7L A;  1I50 B;  3H0G H;  2SNM A;  2ZTD A;  4TQU S;  1O80 A;  4ZYS A;  4DV0 L;  5IYB G;  4PZ6 A;  5ELF A;  1QNU A;  1HRJ A;  4GLA C;  3I4N H;  1IXR A;  3RZD H;  5IP9 H;  2BH2 A;  4A93 H;  5M3F G;  1N32 L;  1ASY A;  1LT4 D;  2Z6K C;  1EY8 A;  4YWK A;  2ZXR A;  2E2I B;  5IGG A;  4B3T Q;  1DJR D;  4Y7N B;  1QVC A;  2K28 A;  2EYJ A;  5C3E H;  3M4Q A;  2D9U A;  1AZQ A;  1HNW Q;  4BA1 I;  1ILP A;  1Z47 A;  4G57 A;  4CDC C;  3HOZ G;  1TWG H;  3NXW A;  4IN3 A;  1TII D;  1B53 A;  4L6T B;  4GZY C;  4C1N I;  3EVQ A;  4DR7 Q;  3MA2 B;  4ABN A;  3VYR A;  1HZA A;  2K05 A;  1PVO A;  1LYL A;  1TS5 A;  2UXB L;  4DR2 Q;  3I4L A;  3VDY A;  4AIM A;  2JJQ A;  3LGJ A;  1EY7 A;  3AQQ A;  1YVC A;  4JV5 L;  3AFP A;  2JA9 A;  3HKZ B;  3EA6 A;  3FEW X;  5M3M H;  3ULL A;  1IHZ A;  3PO3 B;  1PTO C;  1XPR A;  1HZB A;  2CQO A;  3M7N A;  3QOL A;  2LXJ A;  2N3S A;  4FNF A;  1EQQ A;  3I4M G;  4NDX A;  3HGB A;  4C3J B;  1Q8K A;  2YTY A;  1QIL A;  4A3D B;  1MD2 D;  5HGT A;  3J80 i;  4QF4 A;  4LF4 L;  1CK1 A;  1EIG A;  4R8N A;  4HTH A;  3J80 E;  4OO1 H;  1ZYR C;  3HOX G;  2R93 B;  5DM6 3;  1UNS A;  2UU9 Q;  1XX8 A;  4DV3 L;  3S1R B;  4JI3 L;  4JBW A;  2QEJ C;  4CDE C;  2KOL A;  4AYB E;  2UUB Q;  1V1Q A;  5I2Y A;  3J7Z C;  5NUC A;  1CT1 D;  4H0L C;  2ZM6 Q;  2O2L D;  2E76 C;  4RFB A;  4MHE A;  1BCP F;  2E5L Q;  3HOY H;  5JJK A;  2KBN A;  1LTB D;  3T13 A;  1PH5 A;  5EKK A;  1ENA A;  4O0A A;  3A74 A;  2JA6 H;  2D0P A;  1RL2 A;  3RR5 A;  2JA5 B;  1C0A A;  2WB1 G;  1UE6 A;  1JOQ A;  1LTG D;  3K5M A;  2MPM A;  1QG7 A;  2HUG A;  3GTM B;  3MHB A;  4BBS G;  1K73 C;  4KJO A;  1L2F A;  2XVS A;  5C4H A;  3U4V A;  2G5D A;  4XQN A;  1B1Z A;  4A3G H;  1S3O A;  5IP7 G;  3RZO B;  5COR A;  1L1O C;  3OTO Q;  3S2H B;  3ND9 A;  5EQ0 A;  4HJ9 A;  1TQO A;  2EVB A;  5FLX c;  1R4Q B;  4K0K Q;  1JB3 A;  2L11 A;  3HP3 A;  1BF4 A;  1SXT A;  5T1G A;  4DU9 A;  3M4P A;  4XYO A;  2Q2U A;  4I7A A;  4L5Q A;  5FLM G;  4RHS A;  2EJG C;  1F2M A;  3E0J A;  1II3 A;  3K58 A;  2QKI C;  3TS0 A;  1K8O A;  4FF3 A;  3I4O A;  3CD6 A;  4JI2 Q;  1SNO A;  3DWA A;  2Z4I A;  5K36 H;  2F0G A;  2FIN B;  1AP0 A;  1A62 A;  3UE1 A;  4DV7 Q;  1AEX A;  1M1K C;  4HJA A;  1T5E A;  1CSQ A;  3G4S A;  1EZ8 A;  5FO8 B;  2XSC A;  3I90 A;  3IFT A;  1X3G A;  3EJI A;  1Q7Y C;  2ZXP A;  3SHL A;  2I5M X;  1SYB A;  1IBM Q;  2RCF A;  4KY5 A;  3OW2 A;  2OEO A;  2A73 B;  3V2T A;  2VQE L;  5ELB A;  3GD7 A;  2HIV A;  4DUZ L;  2IX1 A;  1EOV A;  1LTR D;  2CWA A;  1SND A;  3M4O H;  4BBR G;  4NXM L;  4JOI C;  1Y8P B;  1HPC A;  4DK0 A;  1I4X A;  3S9W A;  2YV5 A;  4DV6 Q;  4JI0 L;  1A3V A;  1DCZ A;  3SGI A;  5IYD H;  2I5L X;  1JE5 A;  1W6J A;  3E3X A;  2Z6B A;  3GTQ H;  3Q23 A;  1DOK A;  4LF7 Q;  3HOW B;  4LWC A;  5AJ3 Q;  1O7I A;  1A0I A;  3ONA B;  4R4Q A;  4UP8 A;  2NZH A;  3NEL A;  1B8A A;  1U4R A;  1WTQ A;  2RDG A;  3L9A X;  4JI6 Q;  1N36 L;  3TRE A;  4OON A;  1Y1W G;  3C2P A;  2A8V A;  1JQY D;  2ICI A;  3K8A A;  3L3O C;  1KNA A;  4UP7 A;  1EY6 A;  4KKT A;  5IGB A;  1PYB A;  1HR0 L;  5M5X B;  4LF5 L;  4X3S A;  1FJG Q;  1SNM A;  1Q8I A;  3M7G A;  4RCO A;  1KDA A;  1WTP A;  3OOC A;  1VQO A;  3AU7 A;  3NQI A;  1Y1V H;  1TWF B;  4BY7 H;  4HID A;  2B2V A;  1HZ9 A;  1SE4 A;  2L4N A;  3FP9 A;  2LY7 A;  2KUM A;  2AQ1 B;  4JCV E;  5FK9 C;  3PF4 A;  2PCF B;  3P7J A;  2NVX H;  2F1M A;  1TVX A;  4IUU A;  5LL6 S;  1U5K A;  4DNT B;  2KCN A;  3H91 A;  3KF8 A;  4C2M B;  2O5J C;  3K80 C;  2JA8 B;  3UDF A;  4LF9 Q;  1VDZ A;  2LXK A;  1SJE D;  3FKI H;  4P71 A;  3PO2 B;  1KDC A;  1PYS B;  2E2J H;  2DNE A;  3HKZ G;  3VYS A;  2JE6 I;  1EFI D;  1Z9F A;  4A3J B;  2R92 H;  3QB3 A;  4KD3 A;  4RKL A;  3ERO A;  1PTO D;  1RTN A;  1BKB A;  5BN3 A;  4X3T A;  4C3J G;  4X65 L;  2KEE A;  2LMC B;  5FO7 B;  1I4H A;  3DEO A;  4KHP L;  3P20 A;  5C4J B;  3LNN A;  1Y8O B;  2VUM H;  1FNV A;  1KDB A;  2R93 G;  2IWH A;  4FXG C;  2UXC Q;  2OWO A;  2DJF C;  4TKO B;  2WAQ G;  2XRQ D;  4X66 L;  5GAE C;  3U9O A;  1EYD A;  1ZYR D;  5EBC A;  1SYG A;  3G71 A;  5BN5 A;  5FOB B;  1EEI D;  1H9R A;  3OSO A;  3OMC A;  3PV0 A;  4YWM A;  3RLF A;  1U4P A;  1IKM A;  4DR3 L;  1LUZ A;  3MXG A;  2NB0 A;  3IL8 A;  3HRZ C;  1GVP A;  3X3M A;  2JK8 A;  4EQ5 A;  3R93 A;  2JA5 G;  4Z9C B;  5FLX E;  3KYH C;  2EY1 A;  5LMU L;  5JVG 3;  1G2T A;  1PH9 A;  1HXY D;  4ME5 A;  3IAY A;  4YHH L;  3QR8 A;  2PZT A;  3CC7 A;  1B9N A;  3SK4 A;  4C3I H;  4N8F A;  4EVO A;  5KGU A;  1VQ5 A;  4F8M A;  4LF6 L;  4I7Z C;  3D8G A;  1F2Z A;  4IPD A;  4BY1 B;  1ROD A;  4FO2 A;  1CKM A;  1HCZ A;  4FDB A;  4KY6 A;  4X6A H;  2I46 A;  4LJZ C;  4FVM A;  3FHW A;  4RG1 A;  2BDO A;  2ICE C;  3D0F A;  3NEN A;  4DPG A;  1V43 A;  3R3O A;  3HEJ A;  2B2W A;  3RLO A;  4WJ4 A;  4LUV A;  1HH2 P;  4POF A;  3PUY A;  1AE3 A;  2B2T A;  2F0O A;  5C6A A;  2F3W A;  2EYH A;  1O78 A;  5CV4 A;  4A93 B;  1S5B D;  1KL9 A;  5IIF A;  1QZG A;  3QIA A;  4KN7 C;  2PMZ B;  3A8J E;  3S14 H;  1BXT A;  4JI7 Q;  2RQX A;  2NTT A;  1VQH A;  4DAV A;  2Z4H A;  1K8M A;  1SJH D;  3UDI A;  4A3E B;  4J8Q A;  4G7H C;  1F2Y A;  4DK1 A;  4LFB L;  1LT6 D;  1J9O A;  3NTI A;  5BR8 Q;  1L0X B;  2Q2T A;  4OIK A;  2L12 A;  4NW2 A;  3I2Z A;  2K7V A;  1O7Z A;  1GUG A;  1P16 A;  1J5E L;  3KF8 B;  1WVL A;  4FP5 D;  4BXX G;  1R4P B;  4YY3 L;  3MAQ A;  4A3I G;  1Q3L A;  1VQC A;  3A5Z B;  2J0T D;  3CF5 A;  1FVI A;  3ITP A;  1PTO F;  5M3M B;  1PH8 A;  3NSW A;  1X3P A;  3DMU A;  1YNX A;  3K5N A;  1VQ7 A;  4GKK L;  2F0I A;  1MKH A;  5A2Q L;  2K03 A;  3O13 A;  1C4Q A;  1NBW A;  1DON A;  3HOW G;  1YHQ A;  3AB9 A;  1STA A;  1VF7 A;  3CCJ A;  2F0V A;  1I3Q B;  4OWT B;  2ZXO A;  3BZC A;  3FDT A;  3A54 A;  3ZYY X;  1MSH A;  2HQE A;  2HIX A;  1S40 A;  1K8A C;  1JC7 A;  2UUA Q;  3K0Y A;  1LM0 A;  5EKI A;  5TSS A;  5C4X G;  1EOT A;  2RKS A;  1KD1 C;  2E8G A;  3GO5 A;  2B2Y C;  5JOB A;  1QVF A;  4X62 L;  4DR5 Q;  2K01 A;  1PXU A;  4M8A A;  1FL0 A;  3G48 A;  3OMG A;  1M4V A;  4ZRZ A;  3URY A;  1EUJ A;  2NUC A;  2RVL A;  5IT9 c;  4GN5 A;  3TS2 A;  3OWF A;  1X55 A;  2NZ1 D;  3FMC A;  1D7Q A;  3HOY B;  1SBB B;  2EYF A;  1OXU A;  1HJP A;  1YEZ A;  3UI2 A;  4JW0 A;  2JA6 B;  1YIT A;  4QCL A;  2F0M A;  4YCU A;  1PRT B;  5EAY A;  4EX5 A;  2NBF A;  1HFG A;  1ICF B;  1X3E A;  5ELD A;  1PH6 A;  1TWC B;  2NVY B;  3S16 H;  2JA8 G;  3TRZ A;  3PO2 G;  4A76 A;  3F1Z A;  4A3G B;  3TP5 A;  1WOC A;  2QEX A;  1I4R A;  4LFA Q;  4IO9 A;  1VQ6 A;  4HSP A;  5LMN L;  2GVB A;  5DLQ E;  3SXH A;  2PZW A;  1B4O A;  3BJU A;  1VMC A;  1TWA H;  3M4Y A;  2RHQ B;  5C0X H;  4KLK A;  4DV4 L;  3GTJ B;  4IFD I;  1K0S A;  4A3C G;  4HED A;  1PYW D;  5L37 A;  1EY0 A;  1XNQ Q;  2B63 G;  3HG9 A;  4RH6 A;  1HNZ L;  4L5S A;  4A3B G;  1SE3 A;  2GA4 B;  3WDN A;  4DXF A;  1XNR Q;  1OTC A;  1T5X D;  1GXD C;  4IJH A;  1XPU A;  3D3R A;  1L0W A;  4CKE A;  1A63 A;  2CH4 W;  2ENB A;  1WTO A;  3I70 A;  4ZLT F;  4RMF A;  2XIW A;  3DM1 A;  1JOO A;  2IL8 A;  1GKH A;  5JPM C;  1D2B A;  1SNP A;  4L5R C;  1XMQ L;  2ATW A;  4G7Z C;  2NN6 I;  4JI5 L;  1PFB A;  2K5N A;  1RKN A;  4H7B A;  5E4X A;  4B08 A;  5C44 H;  3F2B A;  3TP6 A;  4IQZ A;  3I55 A;  1XMO L;  3A0J A;  3T1Y Q;  2YYZ A;  3D4R A;  3WOF A;  5ELC A;  1A3U A;  3VA7 A;  3GTK H;  1H95 A;  2F0U A;  1F2L A;  1STN A;  1A2U A;  4B3R L;  1BOS A;  4LFC L;  2K6A A;  3M4O B;  4UAI A;  4LUZ A;  3J7A V;  3Q22 A;  3HOU G;  4NP5 A;  1TU2 B;  5IYB H;  1EY5 A;  1RCV D;  4JI1 Q;  2MP1 A;  4A3K G;  1N34 L;  4JVZ A;  3EBE A;  1I6H H;  1GM5 A;  2K4K A;  2B2V C;  3W2D A;  5EGT A;  3GTQ B;  4L5T A;  2PQA A;  4E6I A;  1GD7 A;  1VQL A;  3HOV B;  3H3V H;  2UUC Q;  1D1K A;  1BBX C;  5GAD C;  4IPH A;  3GTG B;  1IL8 A;  5KNB A;  2HCI A;  4EQN A;  3HOZ H;  2A74 C;  1WTV A;  2H1E A;  4PQX A;  3PMF A;  4A93 G;  1U4M A;  2Y0S G;  5IGF A;  4R1J A;  1IL2 A;  3GTP H;  2Q8T A;  2Z1C A;  2B2U C;  4GN4 B;  3BDC A;  1B3A A;  4AQY Q;  3D4D A;  3KK7 A;  2K1B A;  2WAQ E;  1PZI D;  4HJ5 A;  3CC2 A;  2O5I C;  4A3E G;  1SRU A;  1NNX A;  1HQM C;  3EN2 A;  1EIY B;  1EQT A;  3L0O A;  1KRT A;  4KJN A;  1TS2 A;  4OIJ A;  4OX9 Q;  1EWC A;  1JOR A;  1Y1V B;  1I94 L;  2XWJ B;  4BY7 B;  2MHV A;  4GLX A;  2JP1 A;  1EYG A;  4OO1 I;  1OXT A;  4DR1 L;  1N33 L;  1LT3 D;  3SDZ A;  2Z8L A;  4HN7 A;  1N9W A;  4A4I A;  4JYA L;  1F9P A;  4PZ8 A;  2SEB D;  2F03 A;  3I56 A;  3I4M H;  3FKI B;  3BZD B;  1VQF A;  1PFS A;  1KIX A;  1HNX Q;  2E2J B;  5M3M G;  3AYH B;  1HA5 A;  1V1P A;  3CCM A;  3S15 H;  4X64 L;  3MVV A;  1DZ1 A;  2XN9 C;  3HOX H;  2HD3 A;  5JJZ A;  4NXN Q;  3OHX C;  4G4K A;  2R92 B;  2J7Z A;  1S5E D;  1WI5 A;  1X3Q A;  3VA5 A;  2F0F A;  2KA7 A;  1AE2 A;  2EXZ A;  4ME3 A;  3F2U A;  3TZU A;  1RHP A;  1GHK A;  4A3F H;  2A69 C;  3RN5 A;  5IT9 E;  1PZJ D;  4B3M Q;  1PTO H;  4HMI A;  3KBG A;  4OEL B;  4MTK A;  3BVG A;  2ALY B;  5IGC A;  3OYY A;  4ZUJ A;  4ODG A;  2L15 A;  1SDF A;  1F9S A;  2MQH A;  1SLJ A;  2DJG C;  3I7F A;  4ZKB B;  3CW2 C;  5KIX A;  2RDH A;  3A8I E;  2NVQ H;  1Z7T A;  4QJF A;  3L7Z C;  3GTO H;  2B2W C;  4BBS H;  1SNQ A;  2Q8R E;  1A3T A;  5HY6 A;  1FGB D;  4JI8 L;  1QB5 D;  4ZQ3 A;  2F52 A;  1HA6 A;  5IP7 H;  5AFW A;  5E1F A;  2JEA I;  4JK1 C;  1WTX A;  2JA6 G;  1UE5 A;  2VQF L;  4DR4 L;  3CRK C;  1SMY C;  1YBY A;  2D5D A;  2WP8 J;  2RBM A;  1LTT D;  5C3W A;  3K5O A;  3DWP A;  1SE8 A;  4DUY Q;  5FLM H;  4KKU A;  1TKW B;  1IW7 C;  1CSP A;  1QJO A;  4A3G G;  1STY A;  2KED A;  1DXM A;  3MXU A;  3STB C;  5J3B A;  1K8G A;  4PMC A;  4C3I B;  3GDE A;  1YNN C;  4F7X A;  4AYB B;  2EPB A;  3F8T A;  3R2I A;  5FJ8 G;  2N8N A;  4DV1 Q;  3KLR A;  2QCP X;  2PQE A;  2PQA B;  2QA4 A;  1QNK A;  2F3I A;  2J4X A;  2KJX A;  4LNQ A;  2JA7 G;  4DV0 Q;  3GTL H;  3J80 L;  1LAB A;  1RF2 D;  4DV2 L;  3M3Y H;  5I2X A;  2VS1 A;  3DEP A;  3C1F A;  4K14 A;  1B70 B;  1N32 Q;  2PNR C;  3NPP A;  1IBL L;  2DY8 A;  2VL6 A;  4HIO A;  1HR0 W;  5FO9 B;  5IWA L;  3TSS A;  4UHV A;  3KBX A;  2QIL A;  2E74 C;  3JAM c;  5K36 G;  1ILQ A;  3S14 B;  3V05 A;  2R61 A;  1E2W A;  4N8X 1;  3BS1 A;  3J81 c;  2UXD L;  1V9P A;  1DM0 B;  1ESR A;  1LTS D;  2EYP A;  2LS0 1;  2QW7 A;  3NUC A;  4O42 A;  5DEH A;  3VYT A;  4BBR H;  2BH8 A;  1LTI D;  4TSS A;  5IGD A;  3BYY B;  4V19 0;  4PMB A;  3NTK A;  3GV6 A;  4KN4 C;  3BDO A;  1PLF A;  1LLR D;  4IUQ A;  1EU4 A;  4J6H A;  1BBW A;  1AH9 A;  1EWI A;  4H02 A;  3DLL A;  2UXB Q;  3TP7 A;  1SSO A;  1B50 A;  3MTS A;  4PV1 C;  3PUX A;  5IY0 A;  3CCR A;  4GOP A;  5CBE E;  4JV5 Q;  1EEF D;  3CHB D;  4GKJ L;  5KYI A;  1PH7 A;  4DK3 C;  1JCK B;  2IHF A;  5JPN C;  1V1P B;  1DYQ A;  2E2H H;  1Y1W H;  5IYD G;  2FMC A;  3TDQ A;  3PCO B;  4PG3 A;  1KLG D;  3K7U C;  5HGQ A;  2F4V L;  2KCM A;  1QE6 A;  5CV6 A;  2AHO B;  3T1H L;  4LF4 Q;  1B9M A;  3HOV G;  1H9S A;  2K14 A;  5BN4 A;  2FHT A;  1WCM H;  3RNU A;  3VR4 A;  5JAV A;  2NVT H;  3NTH A;  4K8I A;  4DV3 Q;  2MUY A;  2KEC A;  2NYZ D;  4JI3 Q;  2HT1 A;  4JBM A;  1GUN A;  4B3S L;  2VXW A;  4H44 C;  1ASZ A;  4CKC A;  2WKC A;  3A5U A;  4DR6 L;  2NWG A;  4DKA C;  2VB3 X;  4P73 A;  4R4C A;  2L55 A;  3FPU B;  1FGU A;  3VR3 A;  2OCE A;  1E3P A;  1JOK A;  2YTV A;  1MHW C;  4XTC S;  4DGZ A;  5EKL A;  4RKB A;  1EY4 A;  3KOJ A;  4LMQ D;  2MO0 A;  2EXD A;  3HKS A;  4ZUI A;  3Q8D A;  5D3I B;  1YZ6 A;  3H09 A;  1KRS A;  3JC6 6;  1Y1V G;  2BA1 A;  3AMU A;  2H5X A;  4BY7 G;  3PO3 G;  1KAW A;  3HFZ B;  3PIP A;  3TN2 A;  3E5S A;  1MSG A;  1EIF A;  1E24 A;  2BA0 A;  1ICW A;  1F77 A;  4C3J H;  3P75 A;  4A3D G;  1UUP A;  4O1N A;  4Y52 H;  3S1N H;  2AKW B;  4HCE A;  3HS0 C;  1ML0 D;  1LT5 D;  2L5T A;  1W3S A;  3S1R H;  1Y69 U;  2HHH L;  2MNA A;  2R92 G;  2WV6 D;  4IUN A;  1TWA B;  1JR0 D;  5KYL A;  4RAU C;  2Q8I B;  3NBI A;  4U68 A;  1CQV A;  4PZ7 A;  4LAA A;  2CW0 C;  3PSI A;  3W1G A;  4RGT A;  3CP0 A;  3EQL C;  4PMW A;  1SFO H;  4A3L G;  1ENC A;  4WJW A;  1Q81 C;  4JPB W;  2MO1 A;  2SOB A;  2A69 D;  1CQF A;  1E2V A;  3QOJ A;  2I07 B;  3SK6 A;  2Y0S E;  2JA5 H;  4LF8 L;  1TY2 A;  2PMZ E;  4XDX A;  1C7Y A;  4F87 A;  3S1M H;  3GTM H;  1IKL A;  1WFQ A;  3IRB A;  1VQP A;  3D31 A;  1LTL A;  1NAP A;  4KHZ A;  5C44 B;  2CCZ A;  3K7A B;  1CZG A;  5GQO A;  2VQE Q;  3OWE B;  3I3C A;  4EQP A;  2A6E C;  4DUZ Q;  5EPJ A;  3N52 A;  1YHA A;  1HUN A;  3GTK B;  3F2C A;  1UE7 A;  5CC4 A;  4NXM Q;  2R3Z A;  4GOP B;  1BUV T;  1UAP A;  1U0L A;  1YNJ C;  1CA5 A;  4EGV A;  5T1I A;  5C5M A;  1SMY D;  2Z9H A;  3E9I A;  2HDM A;  2E75 C;  3H0G B;  4JI0 Q;  2MGS A;  4P74 A;  3EIV A;  3U4Z A;  4JI4 L;  2PNH A;  3I91 A;  2HCC A;  3I4N B;  3RZD B;  3KLS A;  2EYO A;  3SVM A;  3M9B A;  1IW7 D;  1NY4 A;  5CGK A;  3STB D;  5HUR A;  3TEH B;  2R7Z H;  2CWP A;  2WFW A;  2M9V A;  3JAM i;  1TS3 A;  1YNN D;  4IUT A;  1H9S B;  3JAM E;  3J81 i;  5C3E B;  1N36 Q;  1STH A;  4OWX B;  3J81 E;  3HOZ B;  1TWG B;  4R4O A;  4F88 A;  4MTN A;  5ELE A;  3CRL C;  2IX3 A;  3TQY A;  1ESF A;  4P72 A;  1OXX K;  3D6W A;  1Q90 A;  4MNO A;  3FVQ A;  4C3H H;  4J1M A;  1HR0 Q;  4LF5 Q;  1YJW A;  1LV9 A;  3E9H A;  3T51 B;  4IJL A;  3S1Q H;  1STE A;  2Q2I A;  3A8K E;  4A3I H;  1PV4 A;  2WB1 E;  3PIO 3;  1OXV A;  1TXY A;  1UE1 A;  2JQO A;  4ILW A;  2IPK D;  4AH6 A;  3WOE A;  4K6D A;  5IYC G;  5FLX L;  1PA6 A;  4WFN 3;  1V8Q A;  2K5H A;  2EYL A;  4ID6 A;  1X3F A;  1PHJ A;  4XQJ A;  3HOW H;  4MIU A;  1LO5 D;  2R7F A;  3I4M B;  5LMN W;  1VQI A;  4N9P A;  1NMG A;  3ICE A;  4QMG A;  4L8J A;  5I6W A;  1MI2 A;  4B3T L;  2ZTC A;  1VQA A;  5M9O A;  3S15 B;  4DF7 A;  4DNR B;  1U4L A;  1CI3 M;  3U9S A;  5C4X H;  5K5P A;  1HNW L;  3HOX B;  4RGN A;  3J7A 5;  1PRT F;  3CCV A;  4X65 Q;  2EQS A;  4ALP A;  3K81 C;  1HTP A;  2EY2 A;  4DR7 L;  4KHP Q;  1RDP D;  4TVA B;  2SNS A;  5M5X H;  2B8F A;  4JOI A;  4A3F B;  4YWL A;  2PI2 E;  4DR2 L;  4QB4 A;  2L0C A;  3E0E A;  4X66 Q;  1EQR A;  3S2D H;  2BE5 C;  2WIN B;  3N6R A;  5E7N A;  1AN8 A;  1Y14 B;  2C5C A;  3GP7 A;  2NVQ B;  1QCB D;  2ZJQ A;  1JWU D;  4DAM A;  3W5O A;  4KTA A;  4DR3 Q;  5C0X I;  3GTO B;  4UP9 A;  1R9T H;  1QVG A;  5JEA J;  1YJN A;  3NP8 A;  3CQZ H;  3PQI A;  1VQ8 A;  3K6O A;  3IKJ A;  1PFM A;  2OTL A;  4XT1 B;  5LMU Q;  1B44 D;  4A3J G;  1NCV A;  1VQG A;  1D5M C;  4RGO S;  1AZP A;  3QO2 A;  5JEA G;  2UU9 L;  2F0K A;  3SR1 A;  3ERQ A;  4YHH Q;  2RF4 A;  4ULL A;  1YI2 A;  3F2D A;  1NUC A;  2IJ0 A;  5GRO A;  5M5W H;  2UUB L;  4LF6 Q;  1GUT A;  2B63 H;  4QIW E;  3BDL A;  4KI0 A;  4X3K A;  3H15 A;  4FXK C;  2CKZ B;  4R8I A;  2ZM6 L;  4A3B H;  1KAB A;  5J39 A;  4R4T A;  3CXC A;  2VZA A;  2E5L L;  4GS3 A;  5CMD A;  4FXD A;  3OIP A;  2RDF A;  3W3A A;  3QWN A;  1YJ9 A;  3CCU A;  2YU9 H;  1JWM D;  1XPO A;  3KLW A;  3M3Y B;  2TMP A;  2CFM A;  2ZTE A;  4QUF A;  4B9X A;  2EJM A;  2KHJ A;  4IFD J;  3KF6 B;  4M1U B;  4U67 3;  2KQ3 A;  1SN8 A;  1WTW A;  1K3R A;  2CW0 D;  3G6J B;  3MXP A;  3TP8 A;  3S17 H;  1SR3 A;  3MEH A;  5G3L D;  4IFD G;  3OTO L;  1NE3 A;  4A3M H;  1X6O A;  2FMM A;  2X6G A;  5LHY 1;  1D6E C;  4K0K L;  3TME A;  5E3F A;  5GAG C;  4LFB Q;  5EBD A;  3RD4 A;  3AFQ A;  3H3V I;  4P75 A;  4BBR B;  1UWV A;  3HOU H;  4IUV A;  3NWT A;  5C44 G;  1HTL D;  4A3K H;  2F0D A;  2JXM B;  1J5E Q;  2B39 A;  3HKZ E;  4BY1 G;  3CPF A;  4QL5 A;  4C56 C;  2LKV A;  5M3F H;  2JSO A;  3D6C A;  1BO0 A;  5I4D A;  4YY3 Q;  4BA2 I;  1FNU A;  1MJE A;  2F0H A;  2A6E D;  4BWG B;  4IPG A;  2NN6 G;  4JI2 L;  2RA4 A;  2K52 A;  4HIK A;  2OQ0 A;  1PZK D;  2RHS B;  3H0G G;  4G7O C;  4K5V A;  4DN4 M;  4R9W A;  4DV7 L;  5KNC A;  1NJI C;  4GKK Q;  4P2C B;  2E2H B;  3I4N G;  1YNJ D;  3QJY A;  5IP9 G;  1Y1W B;  2N88 A;  5I9P A;  4IAL A;  5I9O A;  1BNZ A;  4YCV A;  5FKA C;  1WTH A;  1IBM L;  2EZV A;  3OIQ A;  1JWS D;  3ZJY C;  2K75 A;  2M2L A;  4DV5 L;  4CHT B;  3K0X A;  2A68 C;  5C3E G;  1OXS C;  1FD7 D;  1SYC A;  1WCM B;  1MJC A;  5M5Y H;  4A3E H;  4LW1 A;  2NVT B;  1HQR D;  4KKS A;  3KUP A;  4OWW B;  4OHJ A;  4OXP A;  4APV A;  4X62 Q;  3KLS X;  1S5D D;  4XYQ A;  5DM7 3;  4KMU C;  2NVX B;  3I73 A;  4ZK9 B;  1KLU D;  4DV6 L;  1W6K A;  1PFN A;  1G29 1;  1CTM A;  2X6L A;  4LF7 L;  1K3B C;  5AJ3 L;  4OGQ C;  2QGQ A; 
#chains in the Genus database with same CATH homology
 5IY0 A;  3CCR A;  4GOP A;  4LF6 L;  4JV5 Q;  2VNU D;  4IPD A;  1E22 A;  4A3C H;  4HJ7 A;  4GKJ L;  1CKM A;  1K83 H;  2B29 A;  2N78 A;  4FDB A;  4JI6 L;  1PH7 A;  1Q12 A;  4DK3 C;  2IHF A;  4X6A H;  5C4J H;  3CCQ A;  2E2H H;  3MEF A;  3FHW A;  5C0X J;  4RG1 A;  1I3Q H;  3D0F A;  3NEN A;  1Y1W H;  4DPG A;  1V43 A;  3RLO A;  5IYD G;  2IY5 B;  4B3M L;  3PCO B;  4GNX C;  2AMC B;  2IT1 A;  2NZO A;  1HH2 P;  4LUV A;  4PG3 A;  4POF A;  1KHI A;  3K7U C;  2R7D A;  5HGQ A;  2F4V L;  2KCM A;  1SRO A;  5LMN Q;  2AHO B;  3PUY A;  3T1H L;  1AE3 A;  4LF4 Q;  5C0X G;  4O2D A;  4OO1 G;  3HOV G;  1T9H A;  1FJG L;  4GOP C;  2K14 A;  4UY8 C;  1TWH H;  2OQK A;  4JI4 Q;  1KL9 A;  1WCM H;  4DV4 Q;  3RNU A;  1QZG A;  1VQN A;  2NVT H;  4DAY B;  1NTG A;  4DV3 Q;  5ELN A;  3S14 H;  4JI3 Q;  2HT1 A;  1L1O B;  4IPC A;  5GAH C;  4JBM A;  4JBK A;  4B3S L;  4JI7 Q;  1HNZ Q;  2IX0 A;  1ASZ A;  1VQJ A;  1VQH A;  3WWV A;  3A5U A;  1GO3 E;  3UDI A;  1JB7 A;  4DR6 L;  1CKN A;  4A3F G;  4DKA C;  4P73 A;  4JC0 A;  4R4C A;  3HOY G;  1FGU A;  2OCE A;  1E3P A;  4XTC S;  2YTV A;  1X54 A;  3B6Y A;  4LF9 L;  2ZJR A;  4LFB L;  1VS0 A;  1KQS A;  2ID0 A;  2K50 A;  3KOJ A;  2MO0 A;  2EXD A;  5BR8 Q;  3HKS A;  1PH2 A;  3Q8D A;  2Q2T A;  1YZ6 A;  1XMQ Q;  1C9O A;  3I2Z A;  1J5E L;  1P16 A;  3K7A H;  1KRS A;  3JC6 6;  1Y1V G;  2BA1 A;  1TWC H;  2H5X A;  2NVY H;  3KF8 B;  4DUY L;  4JI5 Q;  4J15 A;  4BY7 G;  3PO3 G;  1KAW A;  1A8V A;  3UDG A;  3HFZ B;  4BXX G;  3PIP A;  4BY1 H;  3NBH B;  1PH4 A;  1JJG A;  4YY3 L;  1IYJ B;  4A3I G;  1XMO Q;  4LFB Q;  1VQC A;  3A5Z B;  3CF5 A;  1FVI A;  4A3M G;  1EIF A;  1E24 A;  2BA0 A;  4DV1 L;  1HZC A;  1PH8 A;  4B3R Q;  5FJ8 H;  4C3J H;  3KJO A;  1XTD A;  1RIP A;  1YNX A;  4A3D G;  1VQ7 A;  4LFC Q;  3H0G H;  2ZTD A;  4TQU S;  4DV0 L;  4GKK L;  1MKH A;  5IYB G;  1NBW A;  2D0O A;  4PZ6 A;  3HOW G;  2JA7 H;  3PIO A;  4Y52 H;  3S1N H;  2AKW B;  1YHQ A;  2UXC L;  3GTJ H;  3GTM H;  4GLA C;  3CCJ A;  1IXR A;  1VQ9 A;  3RZD H;  5IP9 H;  1N8R C;  2BH2 A;  4OWT B;  3I4N H;  4A93 H;  1N34 Q;  3BZC A;  1W3S A;  3S1R H;  5M3F G;  1I5F A;  1N32 L;  2HHH L;  2HIX A;  3W1B A;  2MNA A;  1ASY A;  1S40 A;  2R92 G;  1K8A C;  2Z6K C;  4YWK A;  2UUA Q;  1LM0 A;  5C4X G;  4B3T Q;  3ULP A;  1QVC A;  5C3E H;  3M4Q A;  1KD1 C;  4PZ7 A;  2E8G A;  3GO5 A;  2DUD A;  1HNW Q;  4BA1 I;  3PSI A;  1Z47 A;  3W1G A;  1QVF A;  3HOZ G;  4X62 L;  1TWG H;  4LUO A;  4DR5 Q;  1JMC A;  3CAM A;  3CME A;  1FL0 A;  3G48 A;  3CP0 A;  4PMW A;  1SFO H;  1EUJ A;  3L2P A;  4UPA A;  4JG2 A;  4A3L G;  5IT9 c;  1Q81 C;  4GN5 A;  4DR7 Q;  2A19 A;  3TS2 A;  2MO1 A;  1X55 A;  1D7Q A;  4GN3 B;  1HZA A;  2Y0S E;  1OXU A;  2JA5 H;  4LF8 L;  1HJP A;  1VQE A;  1LYL A;  1YEZ A;  3CMA A;  1PVO A;  2PMZ E;  2KCT A;  1C7Y A;  2UXB L;  4DR2 Q;  3S1M H;  1YIT A;  3VDY A;  4AIM A;  2JJQ A;  1WFQ A;  3IRB A;  3LGJ A;  3AQQ A;  4YCU A;  4DV5 Q;  4GNX A;  1VQP A;  4EX5 A;  5EAY A;  1YVC A;  3D31 A;  1LTL A;  1X3E A;  4JV5 L;  3AFP A;  4KHZ A;  2JA9 A;  2CCZ A;  1PH6 A;  5GQO A;  1QUQ A;  5M3M H;  2VQE Q;  3ULL A;  3S16 H;  2JA8 G;  1XPR A;  4POG A;  4DUZ Q;  1I94 Q;  1HZB A;  2CQO A;  3TRZ A;  3PO2 G;  4A76 A;  3M7N A;  1UEB A;  1YHA A;  1I50 H;  3F2C A;  1UE7 A;  1IBK L;  3F1Z A;  2LXJ A;  4DR1 Q;  1N33 Q;  4NXM Q;  1E1O A;  1WOC A;  2N3S A;  2QEX A;  4GOP B;  4JYA Q;  2GVA A;  1EQQ A;  3I4M G;  4LFA Q;  1U0L A;  4IO9 A;  1VQ6 A;  2ZJP A;  1Q8K A;  2YTY A;  3E9I A;  3PUZ A;  5LMN L;  2GVB A;  5DLQ E;  3ERS X;  3J80 i;  4LF4 L;  4JI0 Q;  3BJU A;  4P74 A;  1TWA H;  3EIV A;  2RHQ B;  5IE8 A;  1Q1B A;  4NB3 A;  3U4Z A;  4JI4 L;  2PNH A;  4KLK A;  4DV4 L;  2E2I H;  4A75 A;  3HOV H;  4IFD I;  4Y7N H;  3HOX G;  2UU9 Q;  4A3C G;  3M9B A;  4DV3 L;  4X64 Q;  3GTG H;  1NY4 A;  4JBJ A;  1XNQ Q;  4QQB X;  4JI3 L;  1KC8 C;  4JBW A;  3STB D;  2B63 G;  3TEH B;  4AYB E;  2R7Z H;  4JI7 L;  1HNZ L;  2UUB Q;  4L5S A;  2CWP A;  2WFW A;  1V1Q A;  3JAM i;  4A3B G;  3CPW A;  3J7Z C;  1VQ4 A;  2ZM6 Q;  3J81 i;  1XNR Q;  1N36 Q;  4NPS A;  1YIJ A;  1OTC A;  1W2B A;  4IJH A;  1XPU A;  4OWX B;  1L0W A;  2V1C C;  1QZH A;  2E5L Q;  3HOY H;  5JJK A;  4R4O A;  4MTN A;  1A63 A;  2KBN A;  1WYD A;  2Q2H A;  4RMF A;  5BR8 L;  3TQY A;  4P72 A;  3DM3 A;  1PH5 A;  1GKH A;  1OXX K;  1WCM G;  4O0A A;  3A74 A;  1XMQ L;  1CKN B;  3M85 A;  4L5R C;  2ATW A;  2JA6 H;  4MNO A;  2D0P A;  1RL2 A;  2NN6 I;  4JI5 L;  3RR5 A;  4C3H H;  1HR0 Q;  1PH1 A;  2ES2 A;  4LF5 Q;  2K5N A;  5C44 H;  3F2B A;  1YJW A;  1C0A A;  2AWO A;  2WB1 G;  1UE6 A;  3I55 A;  3E9H A;  1XMO L;  1JJ2 A;  3PO3 H;  4IJL A;  3A0J A;  3T1Y Q;  2YYZ A;  1VQM A;  1VQK A;  3S1Q H;  4BBS G;  1K73 C;  2Q2I A;  4A3I H;  1L2F A;  2WB1 E;  2Z6K A;  1PV4 A;  3GTK H;  1H95 A;  1OXV A;  3U4V A;  1TXY A;  4A3G H;  1Q82 C;  3NEM A;  4B3R L;  1UE1 A;  2JQO A;  1S3O A;  4AH6 A;  5IP7 G;  4YCW A;  1L1O C;  5IYC G;  3OTO Q;  1Q86 C;  1PA6 A;  4LFC L;  5JJI A;  4JI8 Q;  3CCS A;  4HJ9 A;  3FKI G;  4LUZ A;  1CKO A;  2K5H A;  5FLX c;  1EFW A;  4A3D H;  2VY3 A;  3HOU G;  4K0K Q;  1X3F A;  2VQF Q;  4DR4 Q;  5IYB H;  1PHJ A;  4JI1 Q;  4A3K G;  1YHB A;  3HOW H;  1N34 L;  3EBE A;  1I6H H;  1GM5 A;  2K4K A;  2R7F A;  3M4P A;  5LMN W;  2R93 H;  2Q2U A;  2D62 A;  4QY7 A;  4L5Q A;  1VQI A;  4DNI A;  5FLM G;  1NMG A;  1G51 A;  3ICE A;  1D8L A;  1B7Y B;  2YTX A;  2UUA L;  3KDF A;  4B3T L;  2ZTC A;  1VQA A;  4L5T A;  2PQA A;  1GD7 A;  1VQL A;  2K5V A;  5C4X H;  1HNW L;  3H3V H;  2UUC Q;  2DGY A;  3J7A 5;  3TS0 A;  5GAD C;  4IPH A;  3I4O A;  3CD6 A;  4DR5 L;  3CCV A;  4JI2 Q;  4X65 Q;  2EQS A;  4ALP A;  3HOZ H;  3K81 C;  4WJ3 M;  1KXL A;  5H1S E;  2GN5 A;  2VUM G;  4DR7 L;  1A62 A;  4KHP Q;  3UE1 A;  4DV7 Q;  4A93 G;  2I5H A;  4A3L H;  2JEB I;  4TVA B;  5M5X H;  1M1K C;  2Y0S G;  4HJA A;  4JOI A;  1CSQ A;  4R1J A;  3G4S A;  4DV2 Q;  1IL2 A;  3GTP H;  1X3G A;  2RCN A;  4YWL A;  1Q7Y C;  2PI2 E;  4GN4 B;  4QGU A;  1DGS A;  2I5M X;  4DR2 L;  4AQY Q;  3E0E A;  4X66 Q;  1IBM Q;  1EQR A;  2WAQ E;  1IBL Q;  3S2D H;  4HJ5 A;  3CC2 A;  3OW2 A;  4A3E G;  1SRU A;  5E7N A;  3EN2 A;  3UE0 A;  2C35 B;  1Y14 B;  2VQE L;  5IWA Q;  1EIY B;  3GD7 A;  1X65 A;  3RN2 A;  3L0O A;  1KRT A;  2ZJQ A;  2R6G A;  2HIV A;  4DUZ L;  4OX9 Q;  2IX1 A;  3KFU A;  4DAM A;  1E7Z A;  1VQB A;  3W5O A;  1EOV A;  2B3G A;  1I94 L;  3ULJ A;  1VCI A;  3RZO H;  1CUK A;  4DR3 Q;  4GLX A;  3S2H H;  1EYG A;  5C0X I;  2CWA A;  4UP9 A;  1OXT A;  4GNX B;  4OO1 I;  4DR1 L;  4BBR G;  4NXM L;  1N33 L;  3M4O H;  2UXD Q;  4JOI C;  1R9T H;  4WJ4 A;  1N9W A;  4A4I A;  4JYA L;  1QVG A;  2AWN A;  4LFA L;  1QUQ B;  3AEV A;  2N49 A;  5JEA J;  1YJN A;  4PZ8 A;  3CQZ H;  1VQ8 A;  2YV5 A;  3I56 A;  3I4M H;  1X9N A;  5JJL A;  4DV6 Q;  1M90 C;  2OTL A;  4JI0 L;  3SGI A;  5LMU Q;  5IYD H;  2I5L X;  3RLN A;  1VQF A;  1VQG A;  4A3J G;  1PFS A;  1KIX A;  1HNX Q;  1JE5 A;  3BZK A;  3CCL A;  3U58 A;  3GTQ H;  5JEA G;  2UU9 L;  5M3M G;  3AYH B;  3CCM A;  4LF7 Q;  1NMF A;  4LWC A;  4YHH Q;  4X64 L;  5AJ3 Q;  1O7I A;  3S15 H;  2A1A A;  1A0I A;  2RF4 A;  1J6Q A;  4R4Q A;  3HOX H;  4AYB G;  1YI2 A;  4UP8 A;  4NXN Q;  1XNQ L;  3F2D A;  2FXQ A;  5GRO A;  5M5W H;  2UUB L;  2NZH A;  1PH3 A;  4LF6 Q;  3NEL A;  1B8A A;  2B63 H;  4QIW E;  4GKJ Q;  4KI0 A;  4MZ9 A;  3H15 A;  4JI6 Q;  2CKZ B;  2ZM6 L;  3CCE A;  4R4I A;  1IBK Q;  1XNR L;  1WI5 A;  1N36 L;  3TRE A;  4A3B H;  4OON A;  1Y1W G;  4R4T A;  2A8V A;  1AE2 A;  4GLV B;  3CXC A;  4ME3 A;  2VZA A;  2E5L L;  4GS3 A;  2PI2 A;  3K8A A;  4UP7 A;  4A3F H;  3PGZ A;  3RN5 A;  1YJ9 A;  4B3M Q;  1WJJ A;  2MFI A;  3CCU A;  2YU9 H;  1L1O A;  1XPO A;  2F4V Q;  1E1T A;  3KF6 A;  3S24 A;  2ALY B;  3KLW A;  3T1H Q;  3OYY A;  1JT8 A;  1PYB A;  1MIU A;  2CFM A;  2IHE A;  2L15 A;  1HR0 L;  4IOC A;  2ZTE A;  1S72 A;  4LF5 L;  1FJG Q;  2MQH A;  1SLJ A;  2R7Z G;  3I7F A;  3CW2 C;  4DK6 C;  2NVQ H;  1VQO A;  2KHJ A;  1K9M C;  4IFD J;  5ELO A;  3KF6 B;  1Y1V H;  3T1Y L;  4BY7 H;  4HID A;  1X56 A;  1BBU A;  1SN8 A;  1HZ9 A;  3L7Z C;  4QJF A;  4B3S Q;  3GTO H;  1K3R A;  3FP9 A;  4BXX H;  4BBS H;  2KEN A;  4JCV E;  3PF4 A;  3S17 H;  1SR3 A;  2NVX H;  4IFD G;  3OTO L;  4DR6 Q;  1BVS A;  1U5K A;  5HY6 A;  4JI8 L;  1NE3 A;  4A3M H;  1P8L A;  1X6O A;  2F52 A;  5IP7 H;  2JEA I;  3ER0 A;  5IYC H;  3K80 C;  2Z0S A;  4K0K L;  5GAG C;  3UDF A;  2JA6 G;  1UE5 A;  2HQL A;  2VQF L;  4LF9 Q;  4DR4 L;  2LXK A;  3AFQ A;  3FKI H;  4P71 A;  1VQD A;  4P75 A;  1UWV A;  1YBY A;  4JI1 L;  1PYS B;  3H3V I;  3HOU H;  2WP8 J;  2E2J H;  5C44 G;  1K0R A;  3HKZ G;  4A3K H;  3BU2 A;  2JE6 I;  3G6E A;  3PUV A;  1J5E Q;  1SE8 A;  1Z9F A;  4DUY Q;  3HKZ E;  4BY1 G;  5FLM H;  1SMX A;  3CPF A;  4QL5 A;  5M3F H;  1CSP A;  2XGT A;  2R92 H;  4A3G G;  3STB C;  1K8G A;  5J3B A;  4YY3 Q;  4BA2 I;  2UUC L;  2EIF A;  1MJE A;  4HIM A;  3GDE A;  1G6P A;  1BKB A;  4IPG A;  2NN6 G;  3F8T A;  5FJ8 G;  4JI2 L;  4IOA A;  2N8N A;  4X65 L;  4DV1 Q;  2K52 A;  4HIK A;  2OQ0 A;  2RHS B;  3H0G G;  3PUW A;  3KDF B;  4KHP L;  1IZ6 A;  2KHI A;  4DV7 L;  2PQA B;  2QA4 A;  2F3I A;  1NJI C;  4LNQ A;  2JA7 G;  3GTL H;  4GKK Q;  4DV0 Q;  2VUM H;  3I4N G;  2R93 G;  5IP9 G;  4DV2 L;  3M3Y H;  2VS1 A;  3J80 c;  2OWO A;  2UXC Q;  4YCV A;  4AQY L;  1B70 B;  4X66 L;  2WAQ G;  1IBM L;  5GAE C;  2HHH Q;  1N32 Q;  1IBL L;  3ZJY C;  2K75 A;  2VL6 A;  3KJP A;  4HIO A;  1XJV A;  1TWF H;  2LSS A;  3G71 A;  1HR0 W;  4DV5 L;  3K0X A;  5C3E G;  1OXS C;  5IWA L;  1MJC A;  5M5Y H;  4A3E H;  4LW1 A;  2ASB A;  2I0Q A;  3UDX A;  4HJ8 A;  4OX9 L;  3PV0 A;  4YWM A;  1Q46 A;  3RLF A;  3JAM c;  2VW9 A;  5K36 G;  4OWW B;  4DR3 L;  1LUZ A;  1JJC B;  4OXP A;  4APV A;  4X62 Q;  2XTI A;  1Q1E A;  4C2M H;  3J81 c;  3J81 j;  2UXD L;  2JA8 H;  1V9P A;  1GVP A;  3PF5 A;  4BBR H;  3PO2 H;  2BH8 A;  2JK8 A;  4EQ5 A;  2JA5 G;  3CC4 A;  2OTJ A;  4DV6 L;  3KYH C;  5LMU L;  3MXN B;  4XIG S;  4LF8 Q;  1G29 1;  1HNX L;  1BBW A;  1PH9 A;  1AH9 A;  1EWI A;  4H02 A;  3DLL A;  4A3J H;  4LF7 L;  2UXB Q;  4YHH L;  3U50 C;  5AJ3 L;  3CC7 A;  2QGQ A;  4NXN L;  4C3I H;  3PUX A;  1VQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...