3EIVA

Crystal structure of single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
98
Chain Sequence
ETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPDGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSRTVYELDVDEVGASLRSATAKVTKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein 2
publication title Structure of the single-stranded DNA-binding protein from Streptomyces coelicolor.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 16
structure length 98
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3eivA00
3S1RH 4B3ML 3TRZA 1EWIA 2BH2A 3GTKH 4PMWA 1E1OA 4YCVA 5LMNQ 4DR3L 1SRUA 2WAQE 1FGUA 1MKHA 3RLOA 2H5XA 2QA4A 4JI6Q 2UU9Q 2WFWA 2JA5G 3CCUA 3S1QH 4DUYQ 4BXXH 1PH3A 4OWWB 2D0OA 2IY5B 2YV5A 3PV0A 3UDXA 1PH8A 4RMFA 4HJ7A 3CXCA 3UDFA 4K0KL 4DR6L 4IPDA 3KLWA 4BBRG 2KHIA 4DUZL 1PH2A 1R9TH 3GTPH 3EBEA 3E9HA 3JAMc 4LF6Q 1PH1A 4UY8C 3S14H 2R7FA 1VQGA 5GQOA 4HIKA 2Q2HA 3CC2A 5IYBG 1CSPA 4DNIA 2ES2A 3ICEA 4LF7L 1UE7A 4OWXB 3CCQA 1VQBA 1O7IA 3GO5A 2BA1A 3L7ZC 2Q2TA 5M3FH 3CCVA 4R1JA 1YJWA 3S15H 3PSIA 2UXBQ 1GD7A 2B29A 4UP8A 2F3IA 4DR2Q 3HOWH 2R6GA 2N49A 2JA6G 4DR1Q 2ZJPA 4GS3A 1PH5A 3CCMA 1UE5A 1VQLA 5GAEC 1WJJA 4JG2A 3L0OA 1VQEA 1Q82C 2JJQA 1CUKA 1WCMH 5ELNA 1SLJA 2NZHA 3GTJH 5HY6A 3J7A5 5FLXc 2A8VA 4BY7H 3CF5A 2ZJRA 1S3OA 4P72A 1NY4A 4PZ6A 4A3FH 3AYHB 4NPSA 2UUCL 4OO1G 4DK3C 4AQYL 5C4XG 4AH6A 1XNQL 3TS2A 1BBUA 4C3IH 1PH6A 2GVAA 2MO0A 4YWLA 1X9NA 1KRSA 1Q46A 4YWKA 3HOYH 5IYDG 3PO3H 2R93G 3NENA 3G4SA 1YEZA 4A3DG 5IY0A 2Q2UA 4B3SQ 1Q12A 1SN8A 2K4KA 4UPAA 4DV4L 4JI2L 2UXCL 3RNUA 5M5YH 2K5HA 3M85A 3CCEA 1Q81C 4IFDG 2F4VQ 2K5NA 2QGQA 1A63A 2MNAA 4LF9L 2VS1A 2RHSB 1AE2A 4B3TQ 1OXSC 1S72A 1X55A 4DV0Q 1HR0W 2UUAQ 4JI3Q 2ASBA 2RF4A 3CC7A 4NB3A 5FJ8G 5BR8L 1VQOA 2IX0A 2VQFQ 4DV6Q 1UE6A 2OQ0A 4GOPA 2KCMA 2N3SA 1YHQA 4A76A 4LF5Q 4X62L 5IP9G 3ERSX 3BJUA 3KJOA 2JE6I 4OWTB 1GM5A 5IE8A 4A3IH 2MO1A 4QIWE 4O0AA 1VQIA 1IBML 3I4NG 4A3LH 4X66L 3FKIH 4LF8L 2K5VA 4A3JG 4JI0L 3W1GA 4QY7A 2VQEL 1VQ9A 1WI5A 1A62A 1KRTA 2B63H 4YCUA 1CSQA 3U58A 3H0GG 3CCLA 4HJ8A 2E5LL 3H3VH 4C2MH 3ER0A 3A74A 2Q2IA 1QVFA 1X3GA 2JA8H 4HJ5A 2HT1A 3UE1A 1X6OA 4IJLA 1N36Q 4B3RL 3GTQH 4JBJA 1Y1VG 3KOJA 2E2IH 2PI2A 3OTOL 4DR5Q 1XPRA 1Q1BA 5GADC 2EXDA 2GVBA 4YY3L 4DV2Q 2KHJA 2R92G 4L5TA 2Y0SG 1VQFA 2ALYB 1TWGH 2BA0A 3DLLA 4JYAQ 2K75A 4HIDA 3KJPA 5C0XJ 3HKZG 3CCJA 4JBMA 2UUBL 3TQYA 4A3BH 4BBSH 4DR7Q 4GNXA 3HOXH 5JJKA 4A3KH 2E2HH 2WB1G 4UP9A 5K36G 1HZAA 1IBKQ 5IYCG 5LMUQ 2OTLA 2K52A 1HNZQ 3PF5A 1EYGA 3HOUH 3B6YA 3GTMH 3HOVG 2JA7G 2HQLA 2Z6KC 3H3VI 1HNXQ 1I3QH 1KAWA 4GN4B 4R4TA 2OTJA 2CFMA 1Q8KA 2CWAA 4LFBQ 2LSSA 1FL0A 3FHWA 3T1YQ 2OCEA 4DR4L 3T1HQ 3I4OA 3TS0A 3AFPA 3J81i 2WP8J 3F2DA 3PGZA 5IP7G 2YTXA 4EX5A 1J5EQ 4BY1H 5M3MG 4KLKA 1N34L 1XMQL 2V1CC 1N32Q 4GNXC 2K50A 4X65Q 1L1OB 4BA1I 2OWOA 5DLQE 4HJ9A 1XMOQ 4A3GG 1I6HH 2ZTCA 3G48A 4OXPA 1I94L 4KHPL 1OXVA 3PIOA 3RR5A 4DV5L 1PV4A 1K3RA 1M90C 3M7NA 2F52A 4GKJQ 3NELA 4IPGA 4A3EG 1IXRA 2WAQG 4NXNQ 4GKKL 4JC0A 2KBNA 1XPUA 1B7YB 1OXUA 4MTNA 1AE3A 1YHAA 3PCOB 2UXDQ 3BZKA 4AYBE 1V9PA 1WYDA 2OQKA 4TQUS 1PH7A 3GTOH 4IFDJ 2UUAL 4A93H 3RN5A 4A3MH 1MJEA 1T9HA 1W2BA 4GLAC 2JA9A 2CKZB 5E7NA 4L5SA 3AFQA 2NVQH 4LF4Q 1HR0Q 5HGQA 5EAYA 4DV6L 3LGJA 1VQKA 4WJ3M 2R7ZH 1E3PA 1LUZA 2N78A 1E1TA 2PI2E 3F2BA 3ULJA 4C3JH 1IBLQ 4YHHQ 3S17H 1C7YA 4X6AH 4X64Q 4AIMA 1CKOA 3RZDH 3PF4A 5C3EG 3HOZH 5C0XI 3KFUA 2NZOA 3STBD 1K9MC 3S1NH 2VUMG 5FLMH 1AH9A 2R93H 1OTCA 2VNUD 3GD7A 3CPFA 3CPWA 3GDEA 3I55A 3AEVA 2KCTA 3K7AH 3J80i 2PQAB 4YCWA 3A5ZB 4IOAA 4GN5A 1XNRQ 1C0AA 2VW9A 3AQQA 1N36L 1FJGL 3KF6B 5ELOA 2AMCB 1M1KC 4JV5Q 3TREA 5IWAQ 1VQ7A 4DR5L 4LW1A 3S2HH 2VZAA 1KC8C 1HNZL 1VQ6A 4LFCL 2D0PA 4DV7Q 4A3CH 4JI4Q 4DR7L 1QVGA 4P75A 1WOCA 5AJ3Q 1PVOA 1Z47A 2IT1A 2ZM6Q 1K0RA 3KYHC 3J80c 1A8VA 4LUVA 4DV3Q 1YJNA 4JBWA 2BH8A 2E8GA 2JK8A 4FDBA 3I4MH 2FXQA 1MIUA 4J15A 4HIOA 1YITA 4OX9L 5M3FG 1N33L 3D0FA 1HNWQ 1FVIA 1KHIA 1PHJA 2HHHL 3HOWG 3UDGA 1Y1WH 4LFBL 1I5FA 1OXTA 1YIJA 1K83H 1E24A 2ZTEA 1SROA 2QEXA 1MJCA 3EIVA 3KDFB 4L5QA 3S1MH 2ZTDA 4BY7G 1TXYA 4K0KQ 4P71A 5LMNL 4DR6Q 4A3FG 2I5MX 4Y7NH 3CMEA 1VQMA 2XTIA 4JI6L 2UU9L 2RHQB 4DAYB 1CKNB 5GAGC 1VQDA 4DUYL 1QZGA 4NXMQ 1NTGA 3K81C 3OYYA 3HOYG 1PYBA 3PO3G 2AWOA 4NXNL 1QUQB 4JI7Q 4LF7Q 1RL2A 1V43A 4LNQA 2Z6KA 1OXXK 2NN6I 1BBWA 4PZ8A 5JJLA 3A5UA 1QVCA 3J81j 4PZ7A 4LF6L 1XJVA 1G291 1JJ2A 4POGA 2JA7H 1JJCB 2I5LX 1NMFA 2RCNA 4JBKA 1SR3A 1VQHA 4R4CA 5M5WH 1SFOH 1HZ9A 1EQRA 5C44H 4JI8L 4QL5A 2IHFA 3PO2H 3K8AA 2Z0SA 2UXBL 1ASZA 1G6PA 3PUZA 2B3GA 4LFAQ 4KI0A 4LUZA 5GAHC 1UWVA 5JEAG 4DR2L 4DR1L 1IYJB 1NMGA 4A3IG 2Y0SE 2UUCQ 4PG3A 1TWCH 1Q7YC 4A3LG 4AQYQ 1H95A 2MQHA 3FKIG 3RLFA 1XNQQ 2NVTH 4L5RC 2L15A 1NJIC 1X54A 1PH4A 2JA5H 4LUOA 3J7ZC 2PNHA 2B63G 1X56A 4IOCA 2JEAI 1VS0A 1LM0A 1SMXA 1KIXA 3JC66 1X3FA 3GTLH 4JV5L 3RLNA 4BBRH 2JA8G 1CKMA 1Z9FA 5H1SE 2UXCQ 3HFZB 1BKBA 1VQAA 1PFSA 4LF9Q 4APVA 1LTLA 3ULLA 4XIGS 5IYBH 2I5HA 4RG1A 4B3SL 1B70B 4R4IA 4A4IA 5AJ3L 1UE1A 1EUJA 1EIFA 3U4ZA 2F4VL 4XTCS 3ZJYC 4HJAA 1L1OA 5IT9c 4A3BG 4IPCA 1VQ8A 4BBSG 3G71A 1SE8A 1P8LA 4DV1Q 4QJFA 1PH9A 4JI3L 4DV3L 4B3TL 4DV0L 2JA6H 3K80C 5C4JH 3HOXG 3J81c 4A3KG 1K8AC 1IBMQ 3G6EA 4POFA 4X66Q 3CCSA 1HNWL 4AYBG 4JI0Q 2VQEQ 4MZ9A 2ID0A 2VQFL 1B8AA 3HOUG 1VQPA 4LF5L 3ULPA 3RN2A 1P16A 3VDYA 2E5LQ 4BA2I 2K14A 3M4QA 2N8NA 1VQ4A 1X65A 5C4XH 4H02A 1HJPA 2HIXA 3MXNB 3I56A 1VQJA 4B3RQ 1L1OC 1HH2P 1C9OA 4BY1G 4MNOA 1DGSA 3OTOQ 1S40A 1PA6A 5IYDH 4YY3Q 3S24A 4A3DH 1GKHA 3PUWA 5C0XG 3IRBA 3I7FA 4JI5Q 4NXML 3F1ZA 1K73C 3F2CA 1EOVA 3TEHB 1HZCA 2DUDA 4JI7L 1V1QA 2UUBQ 1NE3A 4BXXG 1YHBA 4DV2L 2R7DA 4Y52H 2LXJA 5FJ8H 3UDIA 4JI1Q 3OW2A 1YJ9A 4C3HH 1D7QA 4UP7A 3CCRA 1J6QA 2PQAA 3KF8B 4JYAL 3CC4A 2NVYH 2NVXH 4A3MG 4QQBX 4R4QA 4A93G 5IP9H 3KF6A 4OO1I 4DKAC 3I4NH 1JMCA 2GN5A 2A19A 2R7ZG 3BU2A 3K0XA 3W1BA 4A3JH 1IBKL 5LMUL 4LFAL 1YVCA 5GROA 4DR4Q 1JE5A 3PIPA 5LMNW 3MEFA 3PUYA 2DGYA 4JI8Q 3U4VA 1N34Q 1XMQQ 2E2JH 1HNXL 2YU9H 4B3MQ 3H0GH 1A0IA 3HOZG 3S2DH 5JEAJ 1TWHH 2PMZE 4DR3Q 2JQOA 1ASYA 5FLMG 4IFDI 1I94Q 2D62A 4GN3B 4KHPQ 1NBWA 3T1YL 2YYZA 3T1HL 4DV5Q 1YNXA 1WCMG 3NEMA 1YI2A 1Y1VH 1J5EL 1GO3E 1N32L 1EFWA 2KENA 3EN2A 4GOPB 4GKKQ 4P74A 4X65L 2A1AA 1Q1EA 3NBHB 2R92H 3H15A 1XMOL 2HIVA 3K7UC 1XTDA 3I2ZA 3PUXA 4DUZQ 1TWAH 1L0WA 1JJGA 1KL9A 1IL2A 2CWPA 3BZCA 3KDFA 4GKJL 4O2DA 3CD6A 4JCVE 2XGTA 3CP0A 1IZ6A 1E7ZA 4A3CG 4OONA 4P73A 2UXDL 1RIPA 3F8TA 1VQ5A 4DV1L 4WJ4A 5IYCH 1PYSB 4QGUA 3WWVA 3CQZH 1EQQA 3HOVH 4IPHA 1I50H 3CW2C 4YWMA 4HIMA 1CKNA 4LF4L 1HR0L 3HKSA 4R4OA 2NN6G 2CCZA 3I4MG 1QUQA 1VQNA 4DPGA 3CAMA 4IJHA 3STBC 1IBLL 4YHHL 5IP7H 4X64L 1Y1WG 5M3MH 4GLVB 3S16H 1WFQA 1D8LA 3M4PA 4A75A 1KD1C 1QZHA 1GVPA 2AHOB 4GOPC 2IHEA 4A3GH 1G51A 2VL6A 1FJGQ 1BVSA 1U5KA 2VY3A 1E22A 1VCIA 2AWNA 5J3BA 1Y14B 3DM3A 4GNXB 5JJIA 3HKZE 4KHZA 2IX1A 1UEBA 1U0LA 4LWCA 4IO9A 1TWFH 1YZ6A 1W3SA 2C35B 4JI5L 2CQOA 4JOIA 4ME3A 4A3EH 1KQSA 2EIFA 3A0JA 3E9IA 1N8RC 5M5XH 4LFCQ 3U50C 2WB1E 1YBYA 1EIYB 2ZJQA 1XNRL 2JEBI 2ATWA 3FP9A 1VQCA 2YTVA 4DV4Q 4JI2Q 5IWAL 1Q86C 4DK6C 1XPOA 1KXLA 3L2PA 3M9BA 2I0QA 1X3EA 3GTGH 4JI1L 3RZOH 1LYLA 3M4OH 2YTYA 4ALPA 4DV7L 4EQ5A 4JI4L 3SGIA 5BR8Q 2LXKA 4DAMA 4OX9Q 1N33Q 2HHHQ 2ZM6L 1JB7A 4TVAB 3E0EA 3CMAA 1K8GA 1HZBA 5C3EH 2EQSA 3D31A 4X62Q 2MFIA 4JOIC 3W5OA 3M3YH 1L2FA 3Q8DA 4GLXA 5C44G 3UE0A 3PUVA 2VUMH 1JT8A 3JAMi 3PO2G 2AKWB 1N9WA 4LF8Q
chains in the Genus database with same CATH superfamily
3HG9A 3K7AB 4PMWA 1EYDA 1E1OA 2B8FA 1F2YA 1SRUA 2PW7A 2WAQE 3EQLC 3HZXA 1UEAB 2H5XA 3IKJA 4ME5A 5E4XA 1WTRA 2WFWA 2IY5B 3J80L 3R93A 4DGZA 5JPNC 2NVYB 5CV9A 1WTWA 4DUZL 1QOHA 3EBEA 4LF6Q 3MXPA 5DM73 2R7FA 2Q2HA 1S5DD 4L8JA 5IYBG 1CSPA 3MXNA 3ICEA 1X3QA 3K6OA 4KHVA 3I4MB 3FDTA 3CCQA 3GO5A 3BVGA 1D1IA 2BA1A 2HDLA 3L7ZC 2Q2TA 2WV6D 4G57A 4R1JA 2PNRC 4K14A 1Y1WB 2F3IA 1E2VA 2ZJPA 4GS3A 1H9KA 1BDOA 1QCBD 4KD3A 4XQQA 1SNQA 1PRTF 5ELNA 3GTJH 1SLJA 2F0FA 3SK6A 2A8VA 1CZWA 2EJMA 1S3OA 4PZ6A 4Y7NB 1SYEA 1AP0A 1I6VC 4RHRA 1BOSA 1LT4D 2AQ3B 1BBUA 4C3IH 3TS2A 1K8MA 1KRSA 3NXWA 3PO3H 3NENA 3G4SA 4A3DG 3AU7A 1SN8A 4B08A 2JA7B 1TS3A 2K5NA 2MNAA 2L11A 4JI3Q 1HR0W 2RF4A 2ZXPA 3KUPA 4X3UA 5BR8L 1VQOA 1EU3A 3PO2B 1UE6A 1F77A 4A76A 4KKUA 1GUOA 1TWCB 2CH4A 4OWTB 5IE8A 2F0OA 3C1FA 4O0AA 3I4NG 1VMCA 2JA5B 5J22A 1BBXC 3W1GA 4R8NA 2B63H 4YCUA 3U58A 1I4QA 3BDOA 3HRZC 1X3GA 2K6AA 1JOOA 2K03A 3UE1A 2D2CC 4IJLA 5KYIA 4LK1C 2VB3X 4I65A 1KDCA 3KOJA 1H9RA 1Q1BA 4DV2Q 5TSSA 2KHJA 2R92G 1VQFA 2ALYB 2BA0A 1QJOA 2JA6B 2B2YA 5C3WA 4GNXA 4FF1A 2WB1G 4UP9A 5K36G 1PFBA 1PTOH 1PZKD 2PQEA 4FNFA 1XTCD 4NP5A 2Z6KC 2RA4A 1I3QH 4R4TA 3A7LA 2CFMA 3DWAA 4RGNA 5C4XB 1RD9D 5KGUA 2LSSA 1U4LA 1W6JA 4DR4L 1BCPC 5DAUA 3AFPA 5IP7G 5T1IA 3OPOA 1H9SB 4KLKA 1XMQL 1EZ6A 4QB4A 3FPUB 5C0XH 1UUPA 4OXPA 2E2DC 1EFID 3PIOA 1NSNS 1AZPA 1R4QB 1IXRA 4GKKL 2HCIA 1XPUA 2D9UA 4MTNA 3PCOB 2UXDQ 3BZKA 4AYBE 1V9PA 1WYDA 2H4OA 2UUAL 4A93H 4A3MH 4L5SA 2D5DA 2B2VA 4A3JB 3NWTA 2R7ZH 1FD7D 3K5OA 1E1TA 2PI2E 1IBLQ 3WOEA 4FP5D 2L12A 3LX0A 2IL8A 1K9MC 1OTCA 3U9OA 3AEVA 2KCTA 2M9VA 1DM0B 4GN5A 2PW5A 1D6EC 1IKLA 1O78A 1U4RA 4JV5Q 4RAUC 3HKZB 1VQ7A 4HAEA 1HHVA 3EVQA 2VZAA 2G9DA 1JWSD 3MXGA 1VQ6A 3NHHA 3VR5A 3FMCA 2D0PA 4LFCL 4DV7Q 1R4PB 1A15A 4DR7L 5IIFA 1WOCA 1PVOA 2LMCB 1I50B 4LUVA 2A6ED 1KABA 3U9SA 2FXQA 2XSCA 1YITA 1N33L 5M3FG 3D0FA 2HUGA 3S16B 3UDGA 4LFBL 1K83H 2N55A 2QEXA 3EIVA 3OOCA 2F0DA 2I5MX 4PNYA 3CMEA 3KBGA 1VQMA 2F0MA 2UU9L 2QKIC 1VQDA 3I8ZA 3OWFA 2AWOA 3SHLA 1EYCA 4F7XA 1RL2A 1OXXK 4PZ8A 5ELCA 1JJ2A 1HTLD 1LV9A 1JJCB 4LJZC 2I5LX 4OHJA 1A3TA 5KEEA 3M3YB 1SR3A 1X32A 1HZ9A 4MHEA 5C44H 2PPBC 3K8AA 3PUZA 1LTID 5JEAG 4DA2A 2NUCA 4A3IG 4A3LG 2NVTH 1NNXA 3J7ZC 4IOCA 1LM0A 1SMXA 2F0LA 1ZEQX 3GTLH 1EY7A 1CHQD 4BBRH 1BKBA 2B2TC 4K6DA 1DOLA 4RG1A 1WTHA 2SEBD 5FLXL 4B3SL 1HQMC 5AJ3L 1EUJA 3U4ZA 4XTCS 1EZ8A 1ICFB 1L1OA 3ZJYC 4A3BG 1SE8A 1ICWA 1PH9A 4B3TL 4DV0L 3K80C 1IBMQ 3G6EA 3GTJB 3CCSA 1CZGA 4JI0Q 1SJHD 2VQEQ 4HTHA 1SYDA 2PO4A 4LF5L 3ULPA 4ZKBB 4QIWB 3RN2A 3IFTA 4K8JA 4UDUC 4C3IB 2N8NA 4H7BA 4H02A 1HJPA 2HIXA 4KMUC 4WRDA 1VQJA 3PO3B 4B3RQ 5I9OA 4BY1G 3OSOA 3OIQA 3IRBA 4HMIA 3TDQA 3I7FA 4NXML 1K73C 2KUMA 3F2CA 3TEHB 4IFDH 1HZCA 4HR7B 1V1QA 1YHBA 2L0CA 4DNTB 4IURA 2ZXRA 2R7DA 1B50A 4XQNA 1EY9A 1ZKOA 2KEEA 4JI1Q 3TZDA 3OW2A 1D7QA 3KF8B 1EWHA 2P5ZX 2NVYH 4QUCA 3F2UA 3CKIB 3KF6A 4IUVA 2C5CA 4DKAC 5KNDA 2GN5A 2A19A 4FF3A 3BU2A 3K0XA 3MHBA 2B63B 3MFYA 2RDGA 1HUNA 3MEFA 4B3MQ 3LNNA 2YU9H 3H0GH 1A0IA 1SBBB 5JPMC 3S2DH 2JQOA 3BS1A 1ASYA 5FLMG 1DZ1A 5JAVA 5IGBA 3T1YL 1Y8OB 2XWJB 1IYUA 1GO3E 4GOPB 1TS2A 2OF1A 4P74A 2A1AA 1Q1EA 3NBHB 2FMCA 4R8IA 3SK8A 1TWAH 1L0WA 1IL2A 4GKJL 3BG3A 1PTOB 3SK4A 4RKLA 4DV1L 5IYCH 3MVVA 3SVMA 3WWVA 3CQZH 4N8X1 1I3QB 3HOVH 4DAYA 1CKNA 4JK1C 2J7ZA 2QW7A 4NKLA 3DUZA 2NN6G 1B9NA 4L63B 2CCZA 1K0SA 5HURA 4DPGA 3CAMA 4CJ1B 4GZYC 4IJHA 3ERQA 3NUCA 1STGA 4I7AA 4X64L 1CFMA 2I46A 4XT3B 4GLVB 4L6TB 1WFQA 1D8LA 1E2ZA 4MN3A 1QZHA 2MP1A 2AHOB 2IHEA 4A3GH 2A68D 4J8QA 1BNZA 1U5KA 1IKMA 1B44D 3HKZE 1IW7D 1TWFH 2C35B 4A3EH 4ME3A 1F9SA 3A0JA 1I4HA 4A93B 4A3MB 4HCSA 1VDZA 4OL7A 3IL8A 3Q23A 3GTGH 1F9QA 2R7ZB 3SGIA 2LXKA 1OO9B 3IFDA 1V1PA 2A6EC 2SNMA 1ENFA 5C5MA 5C3EH 1MSGA 1RODA 2QCPX 1L2FA 1S4ZA 3SE0A 2B2YC 1ENAA 2ZXOA 2AKWB 1N9WA 4LF8Q 1SXTA 1XWEA 2BH2A 4I7ZC 2A5HA 1G8ZD 3SEBA 4DR3L 1KNEA 5LMNQ 1IHZA 2QA4A 4JI6Q 3J81E 2D0OA 3PV0A 2DJFC 3UDXA 4K0KL 1SMYD 4HJ7A 3UDFA 4IUTA 4DR6L 4IPDA 2NVXB 5D14A 2K32A 5ELEA 1H9MA 1R9TH 1EYAA 3TN2A 1STAA 1PH1A 3BVZA 4UY8C 1YNNC 5GQOA 3SK5A 1TVXA 4LF7L 1UE7A 1EOTA 1SNMA 3X3NA 3FEWX 1O7LA 3A8IE 4QMGA 3NTIA 5DM63 5ELDA 1TWHB 1JICA 5EBCA 1GD7A 4UP8A 4WFN3 4DR2Q 1HFGA 1QE6A 4DR1Q 1K83B 3MXUA 5EQ0A 2F0SA 1Q82C 1CUKA 1Y8NB 3J7A5 4PV1C 4F88A 4M8AA 2LY7A 2B2VC 3CF5A 2ZJRA 3Q6SA 4A3FH 3AYHB 4AQYL 1SYFA 4AH6A 3MA2B 3HOYH 5I6YA 3J80E 3G6JB 3Q0AA 2R93G 2FJ2A 1YEZA 2Q2UA 4K2LA 5JVH3 1PTOF 4JI2L 3C3LA 1WTVA 1Q81C 1DOKA 4LF9L 2VS1A 5CBAE 1OXSC 2GA4B 1WD0A 3CC7A 4NB3A 3TP7A 5C44B 2B2WA 1QWYA 1CA6A 1RHPA 4C3HG 4DV6Q 2QILA 1YHQA 2EYLA 4XDXA 4XYOA 4X62L 2EXZA 5IP9G 3ERSX 2QDBA 1I4XA 3BJUA 1GM5A 4KJNA 2NVTB 4QIWE 1SNCA 1VQIA 2KCNA 4K8IA 2F0PA 3FKIH 4X66L 4CKEA 1SYGA 1B9MA 1WI5A 1A62A 2Z4IA 4J6HA 5CV5A 3CCLA 3GTLB 1HCZA 4BBRB 4HJ8A 2E5LL 2Q2IA 3DHQA 2HT1A 1X6OA 1BCPB 3WOFA 3J81L 1N36Q 1SSOA 2KOLA 4JBJA 4CHTB 1Y1VG 1Z7TA 3OTOL 1CTMA 1YNJC 1KTKA 3D4RA 1LT6D 4XXEA 3IAYA 5IGGA 4L5TA 2Y0SG 4JYAQ 2WACA 4IN3A 5CV6A 4HIDA 3I4LA 3CCJA 3T53B 4JBMA 2UUBL 4BBSH 1TU2B 5J39A 2K7VA 1HZAA 4WJWA 1IBKQ 5D3DA 2CW0D 4IZ8A 4K5WA 3HOUH 3H3VI 1HNXQ 2OTJA 1H9JA 2CQAA 2CWAA 5CV7A 3FHWA 1F2LA 4BS9A 2OCEA 3I4OA 3TS0A 3C46A 4DXGA 4X3SA 2YTXA 5LL6S 5M3MG 3LWEA 2Z8LA 5D3IB 2SOBA 2OWOA 4HJ9A 1EEID 5IT9E 1I94L 3M4YA 4KHPL 1NR2A 1OXVA 3GQBA 4DV5L 3M7NA 1AZQA 2WAQG 4OGQC 2JN4A 4NXNQ 5EPKA 1OXUA 1AW7A 2OQKA 1PH7A 4IFDJ 1JQYD 3RN5A 4ZUIA 1KLGD 4ZCKA 1W2BA 5E7NA 2JA9A 2NVQH 4LF4Q 1HR0Q 5EAYA 3LGJA 3C2PA 1E3PA 1LUZA 2B8GA 2N78A 2HDMA 4OEMB 3ULJA 1WTXA 4YHHQ 2YU9B 1TY2A 3H0GB 1FGBD 1HFNA 3PF4A 3S2DB 3HOZH 2VUMG 1AH9A 4CGYB 2R93H 2EE1A 2A68C 3GDEA 1EY6A 2KEDA 4EQOA 2PQAB 1IW7C 2K28A 2Z9HA 1EU4A 1PDQA 2AMCB 1M1KC 1TWAB 3TREA 1DJRD 3NQTA 4LW1A 3S2HH 1LACA 4ILWA 4PQXA 3W2DA 4V0BA 1STEA 1JE4A 1LTGD 3G7LA 2HCCA 4KK7A 5EPLA 1D1KA 4JI4Q 1FR3A 3CQZB 4A3IB 1KNAA 4H13C 3HOVB 2IT1A 2ZM6Q 1K0RA 3T13A 5IOCA 3A55A 4DV3Q 2E8GA 1MIUA 4HIOA 4OX9L 5D65A 1HNWQ 1PHJA 2HHHL 2PCFB 3HOWG 1S5FD 4A3GB 1JWMD 1SROA 2F1MA 3KDFB 4L5QA 3MTSA 1BCPF 3BYYB 4BY7G 3FRPB 1GUGA 4U673 1TWFB 4A3EB 2IJ0A 5CBEE 4P71A 1IYVA 4KY7A 2BE5D 4P2CB 1SMYC 4TSSA 5IT9L 4DUYL 3K81C 4R9WA 3GTGB 5FKAC 4JI7Q 3QG1A 4LNQA 3GTMB 2Q8TA 2NN6I 4HMJA 3V2TA 3A5UA 5IGDA 3J81j 1XJVA 1D5XC 1SAPA 1G2SA 5C3EB 4EVOA 1SE4A 2RCNA 1VQHA 1LO5D 1X3PA 4R4CA 5M5WH 1SFOH 1EQRA 3RD4A 2UXBL 1I6HB 4KI0A 4LUZA 4FF2A 4IOAA 2QF7A 1Z6HA 2PNHA 2JEAI 5F2DA 1R9TB 4JV5L 5J1ZA 2JA8G 1CKMA 1C48A 1HPCA 3QB3A 4PMBA 1TR5A 3ULLA 1TQOA 1W6KA 5IYBH 1HXYD 1DONA 2KJXA 3KLSA 2PZUA 4R4IA 4A4IA 2F4VL 4C56C 4IPCA 1P8LA 4QJFA 3HOXG 2N88A 4A3KG 1K8AC 4M1UB 4POFA 5JVG3 1CT1D 3GV6A 4AYBG 2VQFL 4OIKA 5G3LF 1B8AA 1B4OA 4YIJA 1VQPA 4A3FB 4FXDA 1P16A 4BA2I 2XIWA 5FO9B 2K14A 2Q8IB 3JAME 3ND9A 3MXNB 3HOYB 4O42A 2R61A 3E6ZX 4IUQA 4A3DH 3PUWA 1CM9A 2FHTA 4G7HC 3D4DA 5ELFA 3VR3A 1NE3A 4BXXG 2K5DA 1EQTA 2ZT9C 3UDIA 1M4VA 3X3MA 5FLXE 3E3XA 3EJIA 3CCRA 3RMHA 2NVXH 4QQBX 1LTTD 2EOTA 2CW0C 3FKIB 5KNCA 3K59A 4OELB 4S3SA 1JMCA 3I4NH 2J0TD 3W1BA 4DR4Q 5LMUL 4C3JG 1JE5A 3H94A 4JI8Q 2DGYA 1XMQQ 1TWHH 3HP3A 2EYHA 2IW3A 2D62A 4GN3B 3A54A 1SDFA 3T1HL 1O7ZA 2MHVA 1WCMG 3NEMA 1J5EL 1MD2D 1N32L 2KENA 3EN2A 4GKKQ 4X65L 2R92H 3H15A 1XMOL 2HIVA 2Q8RE 4TRDA 3R8BA 1XTDA 3I2ZA 4FF4A 2XNAC 2MPMA 2IWHA 4BBSB 1Q90A 1RDPD 4QF4A 2NWGA 1E7ZA 4A3CG 5K36H 1GUNA 4WORA 1VQ5A 3HOUB 1PYSB 4KN7C 3H3VC 2LS01 3D4WA 3I4MG 1QUQA 1VQNA 4CDFC 1ZXTA 1PZID 1ET6A 5IP7H 2BOSA 5KYLA 1Y1WG 2B2WC 3M4PA 4A75A 2XVSA 4FYDA 1GVPA 1V1OA 2VL6A 1DOMA 3JAML 2VB2X 3OIPA 3T56B 2VY3A 3A56A 1E22A 4GNXB 5J3BA 5EKKA 1Y14B 3DM3A 5JJIA 4EGVA 3E5SA 2NTSA 3D8GA 5KRUA 4LWCA 2K5WA 1W3SA 2CQOA 3E9IA 4LFCQ 5M5XH 1XNRL 2ATWA 3QIAA 1VQCA 3NQIA 4DV4Q 5IWAL 1Q86C 5EJWA 2NVQB 1KXLA 2I0QA 1K3BC 4JI1L 3RZOH 1LYLA 3M4OH 4KY5A 3H09A 1N33Q 1NUCA 3HOZB 1K8GA 2MFIA 4H0LC 4JOIC 3P75A 3Q8DA 2R93B 4DNRB 3PO2G 3S1RH 4B3ML 3TRZA 1LLRD 4RGOS 1SYBA 2KVMA 1FGUA 1MKHA 5L37A 1D2BA 4ZLTF 2UU9Q 2NBFA 4BXXH 2JA5G 3S2HB 5M9OA 1PH3A 2BE5C 2YV5A 1PH8A 4RMFA 3CXCA 3VR4A 2KHIA 1PH2A 1M8AA 3E9HA 1VQGA 4HIKA 2MGSA 4N9PA 3P1HA 1MGSA 2ES2A 2EYOA 3UI2A 1VQBA 2JYOA 1II3A 2E2JB 1EY5A 3Q24A 5M3FH 4OIJA 2B29A 2R6GA 3BZDB 2JA6G 1EL0A 2CVRA 3TZUA 4JG2A 1EY8A 1WCMH 1I4GA 2JJQA 5AFWA 5HY6A 4EQNA 1ILQA 1NY4A 3VYRA 2VXWA 1WVLA 1C4QA 2UUCL 4OO1G 4DK3C 5C4XG 4RA8A 1XNQL 1X9NA 2MO0A 2A6HD 4ID6A 4YWLA 3I3CA 4YWKA 5IYDG 1ESRA 2RQXA 4B3SQ 1Q12A 2AQ1B 2K4KA 4UPAA 2UXCL 3RNUA 5M5YH 2F0VA 3CCEA 5BN4A 4HSPA 2QGQA 1A63A 2RHSB 3NP8A 1GXDC 2F0KA 4B3TQ 2ASBA 1S72A 4DV0Q 2F0WA 5M5WB 1SFOB 5FJ8G 2R3ZA 3K0YA 5M3MB 2KCMA 2N3SA 3EFXD 1A3VA 4LF5Q 3CRLC 4ZUJA 2M2LA 3KJOA 3EA6A 5JEAH 2MUYA 4A3IH 2MO1A 4A3LH 1A2UA 4LF8L 2E76C 2K5VA 4A3JG 1HA6A 2F0IA 5IGEA 3LWUA 3J7AF 1CSQA 3H3VH 5NUCA 4RKBA 3DWPA 4HJ5A 3VA5A 4NW2A 1WTPA 3T16A 1XX8A 2PI2A 4DR5Q 1XPRA 5GADC 4YY3L 1KLUD 1SNDA 2Z6BA 4KKTA 1PXUA 1JORA 1A2TA 2EPBA 2K75A 4A3BH 5C0XJ 3HKZG 3TQYA 3KK7A 3QWNA 2F03A 1U4MA 2F3WA 2X69A 5IGCA 3HS0C 2F0GA 2K52A 2NTTA 3PF5A 1EYGA 4ZYSA 4KKSA 3B6YA 3GTMH 1CI3M 4GN4B 3S1QB 3MZ5A 1RTNA 2AQ2B 1XXGA 5IODA 3T1YQ 1L0YB 3J81i 1PLFA 2WP8J 3F2DA 3PGZA 4BY1H 4EX5A 4A3DB 1N34L 2V1CC 4GNXC 1EIHA 1J8IA 1L1OB 1I6HH 3NK9A 5DLQE 2ZTCA 3G48A 2G5DA 2I07B 3RR5A 3VYSA 1PV4A 1K3RA 4GKJQ 2F52A 1F2MA 3CRKC 1F2ZA 3MAQA 2KBNA 4NDXA 5EKIA 4QCLA 4TQUS 3GTOH 1JC7A 1MJEA 1T9HA 2L4NA 2CKZB 3AFQA 5I6WA 3I4NB 4DV6L 4BY7B 2F0JA 1VQKA 2RVLA 4WJ3M 5ELBA 2KHSA 2IPKD 1WD1A 3QOJA 3S17H 1C7YA 2DN8A 4X64Q 4AIMA 3RZDH 1PRTD 3STBD 1KAAA 1EY4A 1DYQA 3DEOA 5FLMH 2K05A 2EY5A 1GHKA 4PMCA 2VNUD 2F0UA 3FVQA 2O4XA 3GV3A 3GD7A 4DXFA 1ILPA 4NMZA 3I55A 3OW7A 2HQEA 3J80i 2R92B 3A7AB 4YCWA 3NBIA 3RUZA 2EDGA 2K33A 2DNCA 2VW9A 1N36L 1GJXA 1FJGL 3KF6B 2B39A 4V190 2KECA 1HNZL 2WB1B 3BDCA 1PFNA 4HSVA 3SDZA 4P75A 1ET9A 1PFMA 5A35A 3KYHC 3WDNA 3J80c 3E0JA 1YJNA 5FO8B 3L3OC 2JK8A 2NN6H 3HGBA 1FVIA 1Q3LA 1Y8PB 1I5FA 1YIJA 2ZTEA 1E24A 5COYA 1MJCA 2NYZD 3S1MH 2ICIA 4RWSC 1EQVA 2F0HA 3NPPA 4K0KQ 1BF4A 4DR6Q 5M5XB 1JOQA 3NTHA 1MHWC 1ONLA 2XTIA 4C3IG 4DAYB 1CKNB 2E2HB 3PO3G 4NXNL 3BDLA 1F9RA 3RZOB 2E75C 2RDHA 4LF7Q 3M4OB 4CKCA 4N9TA 1SEBD 3M7GA 5JJLA 4LF6L 1G291 1LT5D 1NMFA 2XRSD 4LMQD 5E1FA 3CHBD 2FFKB 3EROA 4QL5A 3S1RB 2Z0SA 1IL8A 5KIXA 1B2TA 2B3GA 4LFAQ 1LTSD 5GAHC 2RBMA 4IUPA 1NMGA 2X6GA 1QNUA 2Y0SE 4JW0A 4AQYQ 1H95A 2MQHA 4L5RC 1NJIC 1PH4A 3VYUA 4LUOA 2B63G 1X56A 4ODGA 1FYCA 3JC66 1GOZA 1RF2D 1V1PB 2A6HC 3RLNA 4IUUA 1B1ZA 3OHXC 1VQAA 1PFSA 4HN7A 2KA7A 4LF9Q 1LTLA 2NZ1D 3TP5A 1DXMA 4XIGS 4ZQ3A 2E74C 2I5HA 4X3KA 4G4KA 1H9SA 1UE1A 4K6LA 5M3FB 3K57A 3HEJA 4HJAA 5IT9c 1STBA 2JXMB 5G3LD 4CDDC 3S1NB 1STYA 1HQRD 4JI3L 4DV3L 5C4JH 1STHA 1WCMB 4X66Q 1HNWL 2A73B 5FK9C 2Z1CA 4DK0A 4CJ0B 2L5TA 2E5LQ 3AMUA 4EQPA 3I56A 3NWSA 1L1OC 1HH2P 4N8FA 1C9OA 4DK1A 4RGTA 4MNOA 3OTOQ 1S40A 3S24A 3J7AV 1SE3A 1GKHA 5C0XG 5M5YB 3TBIB 4JI5Q 4C1NI 1KDBA 4O1NA 4F8MA 2DUDA 4JI7L 1A3UA 2UUBQ 3ITPA 2HD3A 2SNSA 4DV2L 1CQVA 2LXJA 4IQZA 3VA7A 1F9PA 4C3HH 1J6QA 1SNOA 3CC4A 4A93G 4A3MG 4RCOA 5IP9H 3VR6A 2KCCA 4OO1I 3OMCA 2R7ZG 1YVCA 5GROA 2E2JH 3PUYA 5HGTA 3K5LA 5JEAJ 2PMZE 2L55A 2BCOA 1I94Q 1EIGA 1VF7A 1MSHA 4KHPQ 4X3TA 4DV5Q 1STNA 1YNXA 2CH4W 1Y1VH 5DEHA 2IX3A 1GUTA 1EFWA 4C1NK 4A3BB 4DUZQ 4RGMA 4DF7A 1JJGA 1KL9A 2CWPA 4O2DA 4JCVE 3CP0A 1IZ6A 2WKCA 5K5PA 2UXDL 3F8TA 4WJ4A 3A8KE 4IPHA 2J4XA 3CW2C 4HIMA 4FXGC 2AUKA 4R4OA 3N6RA 1T5EA 2PZTA 1C8CA 1RTOA 1PRTC 5CC4A 4BY1B 1U4PA 3STBC 1IBLL 2Z4HA 5M3MH 1KD1C 1RJTA 4DAVA 1G51A 1BVSA 1EY0A 3N52A 1VCIA 1GUSA 4KHZA 2IX1A 1B3AA 1KQSA 3I90A 2EIFA 3I91A 1N8RC 2NB0A 2WB1E 5I2YA 2ZJQA 3GTOB 1SE2A 2YTVA 1WTQA 4CBVA 3SR1A 4DK6C 1XPOA 3MWYW 2LKVA 3FPPA 3M9BA 2EYPA 3L9AX 2RSNA 2YTYA 4ALPA 4DV7L 4EQ5A 3PMFA 5BR8Q 4OX9Q 3S17B 5I2XA 2HHHQ 3RZDB 1E0BA 1RCVD 3E0EA 3CMAA 3Q22A 2EQSA 2JSOA 3D31A 2B2UA 4GLXA 5CGKA 5A2QE 3UE0A 5C44G 2VUMH 1JT8A 3JAMi 4JI8L 1EWIA 5E4WC 3GTKH 4LAAA 4YCVA 1AN8A 3RLOA 2TMPA 3S1QH 3CCUA 4DUYQ 4OWWB 1I4RA 2OXPA 2QDLA 4U68A 3QO2A 3KLWA 4BBRG 3GTPH 3QJYA 3JAMc 1QILA 3S14H 3CC2A 1UNSA 4DNIA 4KV6A 4OWXB 1O7IA 2V4DA 1BR9A 4K5VA 3S15H 3CCVA 2UXBQ 1YJWA 3PSIA 5CV4A 3HOWH 4UHVA 2N49A 1PH5A 3CCMA 4G7ZC 1UE5A 1VQLA 5GAEC 3S1MB 1WJJA 4DAPA 2XN9C 3L0OA 1VQEA 2RSOA 4F87A 2NZHA 3TP8A 1UAPA 5FLXc 4BY7H 2EYFA 1TS5A 1GUWA 4P72A 3KF8A 4NPSA 3QOLA 2K5QA 2EZVA 5EGTA 5EPJA 4ABNA 1Y69U 1PH6A 2GVAA 1Q46A 2F3VA 5IY0A 4FXKC 1CK1A 4B9XA 4DV4L 2K5HA 3M85A 4IFDG 2F4VQ 4MTKA 3D6CA 1NR4A 1AE2A 5C6AA 1X55A 4KJOA 2RKSA 2UUAQ 3BVMA 3P20A 2XRQD 3TSSA 2IX0A 2AUJD 2VQFQ 2OQ0A 4GOPA 3NBHA 5EBDA 1ZYRD 1ML0D 1G91A 2JE6I 3D3RA 2OEOA 1L0XB 1LT3D 1S5ED 3NE5B 1IBML 2F0TA 2SDFA 1LTBD 5A2QL 4JI0L 2VQEL 4QY7A 1VQ9A 1KRTA 3NSWA 3H0GG 4C2MH 3TMEA 3ER0A 2EY6A 3A74A 1QVFA 2JA8H 3C1EA 1JCKB 1K28A 3P7JA 2EY2A 1S5BD 4B3RL 3GTQH 4CDEC 3CU7A 2E2IH 1YNND 2EJGC 2EYJA 2EXDA 2GVBA 2WINB 5LL6X 4KY6A 3I70A 2F4IA 1TWGH 3DLLA 1LTAD 2L1BA 4Q0FA 3KJPA 1ENCA 4DR7Q 3TP6A 5C4JB 2EY1A 1S5CD 3HOXH 5JJKA 4A3KH 2E2HH 5FOBB 4K2KA 2K1BA 5IYCG 5LMUQ 2OTLA 2F0NA 2TSSA 1FNVA 3HOVG 3OWEB 2JA7G 2HQLA 1KAWA 2DY7A 1Q8KA 4LFBQ 1FL0A 3DM1A 4CKBA 3T1HQ 1BUVT 1J5EQ 1TS4A 1N32Q 3KLSX 3PIP3 2K50A 2A74C 2QEJC 4X65Q 4BA1I 4A3GG 1QNKA 1XMOQ 1A6XA 1JOKA 1PYWD 3GP7A 1QG7A 1HA5A 1M90C 3DMUA 3J7YW 3NELA 4IPGA 4A3EG 2O5JC 4K5XA 4JC0A 4XT1B 4E6IA 5DNFA 4C3HB 1B7YB 2MJ8A 2RDFA 1AE3A 1YHAA 3VYTA 3ONAB 3VR2A 2CHBD 1VF5C 4GLAC 2K01A 5HGQA 4ZAIA 3F2BA 4C3JH 4X6AH 1TT2A 1CKOA 1E2WA 5C3EG 5JJZA 1AFPA 5C0XI 3KFUA 1LTRD 2NZOA 2DNEA 3S1NH 1CQFA 1Y1VB 3CPWA 2DY8A 3CPFA 3S9WA 1U9RA 3K7AH 2XWBB 1C0AA 1YNJD 2Y0SB 3A5ZB 1XNRQ 1TKWB 3AQQA 1DCZA 5ELOA 4MIUA 5IWAQ 1TIID 4DR5L 4Z9CB 1PTOD 1KC8C 2PYKA 1NCVA 5LHY1 1Q8IA 4IUNA 1NAPA 4A3CH 4DN4M 1QVGA 5AJ3Q 1Z47A 2OT2A 4DU9A 3O13A 3MFGA 5C4HA 1A8VA 3NTKA 2FMMA 4JBWA 2BH8A 4FDBA 5FO7B 3I4MH 3R2TA 4J15A 1KHIA 2A69D 1K8OA 1B53A 3ND8A 1JB3A 1Y1WH 1OXTA 5JOBA 1BXTA 3W3AA 5CR3A 3V96A 2RCFA 3H91A 2ZTDA 1BQQT 3I72A 4B9WA 1TXYA 1AEXA 2WAQB 2X6LA 3T4AC 1JR0D 1SNPA 3V05A 5LMNL 4A3FG 4Y7NH 2K04A 4JI6L 2RHQB 4KD4A 4J1MA 5GAGC 1QZGA 4NXMQ 1NTGA 3OYYA 4JPBW 3HOYG 1PYBA 1T5XD 1QUQB 4CDCC 1V43A 4CJ2C 2Z6KA 1BBWA 1FNWA 1QVCA 4G7OC 4PZ7A 3K58A 4POGA 2JA7H 1MBYA 4JBKA 2VUMB 5BN5A 2IHFA 3PO2H 5E3FA 4QUFA 3GTKB 3H6MA 2L9HA 1ASZA 1G6PA 2JP1A 1LABA 4DR2L 1UWVA 4DR1L 1IYJB 1DD2A 1SJED 2UUCQ 4PG3A 1TWCH 3KLRA 1Q7YC 3FKIG 3RLFA 4RCNA 1XNQQ 1XYIA 2L15A 1D5MC 2F0QA 1X54A 2JA5H 2ICEC 3K5MA 1QB5D 1VS0A 1KIXA 2H1EA 4ZKCB 1X3FA 3GTPB 5CYUA 3R3OA 2F0EA 1Z9FA 2PMZB 5H1SE 4ZRZA 3HFZB 3S14B 2UXCQ 5I9PA 4APVA 2EJFC 1EWCA 4H44C 1BO0A 4FO2A 1B70B 5CMDA 5I4DA 3S15B 1EIFA 3HOWB 5CV8A 1VQ8A 4BWGB 3G71A 2O2LD 4DV1Q 4BBSG 2JA6H 3J81c 1ZYRC 1TY0A 1WTOA 4MZ9A 2ID0A 2FINB 3HOUG 3VDYA 4OO1H 3M4QA 1VQ4A 3MEHA 1X65A 5C4XH 1KDAA 2PZWA 1B3QA 3OMGA 4JVZA 1V8QA 2B2UC 1DGSA 2M00A 1PA6A 5IYDH 4DFAA 5BN3A 4YY3Q 3MC0B 1O80A 3F1ZA 1EOVA 4UAIA 3PQIA 5C5LA 4Y52H 3T51B 5FJ8H 3SXHA 4FVMA 1YJ9A 4UP7A 4JYAL 2PQAA 4R4QA 1HTPA 4HCEA 1G6ZA 3URYA 3BYTB 4A3JH 1IBKL 4LFAL 2ENBA 3PIPA 5LMNW 4KTAA 3U4VA 4C2MB 1N34Q 5EKLA 1HNXL 4Q5VA 3HOZG 2JA8B 1BCPD 5CORA 4DR3Q 1PRTB 1MI2A 4IFDI 3GTQB 1FNUA 1NBWA 2YYZA 2E2IB 2G9HD 1YI2A 1SYCA 4RHSA 1PMRA 3DWQA 1TWGB 1D5ZC 3K7UC 2O5IC 3PUXA 1VMPA 5C4ZA 1JWUD 1ESFA 3PIO3 3BZCA 3KDFA 3HOXB 4A3KB 3CD6A 1GHJA 2C9OA 2XGTA 3DEPA 3DXJC 4AYBB 4OONA 4P73A 2WKDA 1RIPA 5C3XA 4QGUA 2KQ3A 1EQQA 1I50H 4YWMA 4IALA 4RFBA 1HR0L 1PZJD 3HKSA 3I73A 4LF4L 2WIIB 4ZK9B 3KBXA 4XYQA 3K5NA 2BDNA 1RKNA 3D6WA 4TKOB 4XQJA 4YHHL 2B2TA 3S16H 1EEFD 4GOPC 3AB9A 4KN4C 2BDOA 1FJGQ 2AWNA 4HEDA 4ULLA 4RH6A 1G2TA 1CHPD 2EYMA 1UEBA 1U0LA 4IO9A 1HNZQ 1YZ6A 4JI5L 1HUMA 4JOIA 1I4PA 1PTOC 3U50C 1EIYB 1YBYA 2JEBI 3FP9A 4JI2Q 5KNBA 1J9OA 1HRJA 3R2IA 2LFNA 1CA5A 1O7YA 2EVBA 3L2PA 3A8JE 1X3EA 4JI4L 4DAMA 4C3JB 2DJGC 2ZM6L 1JB7A 4TVAB 3ZYYX 1HZBA 4X62Q 2A69C 3W5OA 3M3YH 3QR8A 5T1GA 3PUVA 5ISRA 5IGFA
chains in the Genus database with same CATH topology
3S1RH 4B3ML 3TRZA 1EWIA 2BH2A 3GTKH 4PMWA 1E1OA 4YCVA 5LMNQ 4DR3L 1SRUA 2WAQE 1FGUA 1MKHA 3RLOA 2H5XA 2QA4A 4JI6Q 2UU9Q 2WFWA 2JA5G 3CCUA 3S1QH 4DUYQ 4BXXH 1PH3A 4OWWB 2D0OA 2IY5B 2YV5A 3PV0A 3UDXA 1PH8A 4RMFA 4HJ7A 3CXCA 3UDFA 4K0KL 4DR6L 4IPDA 3KLWA 4BBRG 2KHIA 4DUZL 1PH2A 1R9TH 3GTPH 3EBEA 3E9HA 3JAMc 4LF6Q 1PH1A 4UY8C 3S14H 2R7FA 1VQGA 5GQOA 4HIKA 2Q2HA 3CC2A 5IYBG 1CSPA 4DNIA 2ES2A 3ICEA 4LF7L 1UE7A 4OWXB 3CCQA 1VQBA 1O7IA 3GO5A 2BA1A 3L7ZC 2Q2TA 5M3FH 3CCVA 4R1JA 1YJWA 3S15H 3PSIA 2UXBQ 1GD7A 2B29A 4UP8A 2F3IA 4DR2Q 3HOWH 2R6GA 2N49A 2JA6G 4DR1Q 2ZJPA 4GS3A 1PH5A 3CCMA 1UE5A 1VQLA 5GAEC 1WJJA 4JG2A 3L0OA 1VQEA 1Q82C 2JJQA 1CUKA 1WCMH 5ELNA 1SLJA 2NZHA 3GTJH 5HY6A 3J7A5 5FLXc 2A8VA 4BY7H 3CF5A 2ZJRA 1S3OA 4P72A 1NY4A 4PZ6A 4A3FH 3AYHB 4NPSA 2UUCL 4OO1G 4DK3C 4AQYL 5C4XG 4AH6A 1XNQL 3TS2A 1BBUA 4C3IH 1PH6A 2GVAA 2MO0A 4YWLA 1X9NA 1KRSA 1Q46A 4YWKA 3HOYH 5IYDG 3PO3H 2R93G 3NENA 3G4SA 1YEZA 4A3DG 5IY0A 2Q2UA 4B3SQ 1Q12A 1SN8A 2K4KA 4UPAA 4DV4L 4JI2L 2UXCL 3RNUA 5M5YH 2K5HA 3M85A 3CCEA 1Q81C 4IFDG 2F4VQ 2K5NA 2QGQA 1A63A 2MNAA 4LF9L 2VS1A 2RHSB 1AE2A 4B3TQ 1OXSC 1S72A 1X55A 4DV0Q 1HR0W 2UUAQ 4JI3Q 2ASBA 2RF4A 3CC7A 4NB3A 5FJ8G 5BR8L 1VQOA 2IX0A 2VQFQ 4DV6Q 1UE6A 2OQ0A 4GOPA 2KCMA 2N3SA 1YHQA 4A76A 4LF5Q 4X62L 5IP9G 3ERSX 3BJUA 3KJOA 2JE6I 4OWTB 1GM5A 5IE8A 4A3IH 2MO1A 4QIWE 4O0AA 1VQIA 1IBML 3I4NG 4A3LH 4X66L 3FKIH 4LF8L 2K5VA 4A3JG 4JI0L 3W1GA 4QY7A 2VQEL 1VQ9A 1WI5A 1A62A 1KRTA 2B63H 4YCUA 1CSQA 3U58A 3H0GG 3CCLA 4HJ8A 2E5LL 3H3VH 4C2MH 3ER0A 3A74A 2Q2IA 1QVFA 1X3GA 2JA8H 4HJ5A 2HT1A 3UE1A 1X6OA 4IJLA 1N36Q 4B3RL 3GTQH 4JBJA 1Y1VG 3KOJA 2E2IH 2PI2A 3OTOL 4DR5Q 1XPRA 1Q1BA 5GADC 2EXDA 2GVBA 4YY3L 4DV2Q 2KHJA 2R92G 4L5TA 2Y0SG 1VQFA 2ALYB 1TWGH 2BA0A 3DLLA 4JYAQ 2K75A 4HIDA 3KJPA 5C0XJ 3HKZG 3CCJA 4JBMA 2UUBL 3TQYA 4A3BH 4BBSH 4DR7Q 4GNXA 3HOXH 5JJKA 4A3KH 2E2HH 2WB1G 4UP9A 5K36G 1HZAA 1IBKQ 5IYCG 5LMUQ 2OTLA 2K52A 1HNZQ 3PF5A 1EYGA 3HOUH 3B6YA 3GTMH 3HOVG 2JA7G 2HQLA 2Z6KC 3H3VI 1HNXQ 1I3QH 1KAWA 4GN4B 4R4TA 2OTJA 2CFMA 1Q8KA 2CWAA 4LFBQ 2LSSA 1FL0A 3FHWA 3T1YQ 2OCEA 4DR4L 3T1HQ 3I4OA 3TS0A 3AFPA 3J81i 2WP8J 3F2DA 3PGZA 5IP7G 2YTXA 4EX5A 1J5EQ 4BY1H 5M3MG 4KLKA 1N34L 1XMQL 2V1CC 1N32Q 4GNXC 2K50A 4X65Q 1L1OB 4BA1I 2OWOA 5DLQE 4HJ9A 1XMOQ 4A3GG 1I6HH 2ZTCA 3G48A 4OXPA 1I94L 4KHPL 1OXVA 3PIOA 3RR5A 4DV5L 1PV4A 1K3RA 1M90C 3M7NA 2F52A 4GKJQ 3NELA 4IPGA 4A3EG 1IXRA 2WAQG 4NXNQ 4GKKL 4JC0A 2KBNA 1XPUA 1B7YB 1OXUA 4MTNA 1AE3A 1YHAA 3PCOB 2UXDQ 3BZKA 4AYBE 1V9PA 1WYDA 2OQKA 4TQUS 1PH7A 3GTOH 4IFDJ 2UUAL 4A93H 3RN5A 4A3MH 1MJEA 1T9HA 1W2BA 4GLAC 2JA9A 2CKZB 5E7NA 4L5SA 3AFQA 2NVQH 4LF4Q 1HR0Q 5HGQA 5EAYA 4DV6L 3LGJA 1VQKA 4WJ3M 2R7ZH 1E3PA 1LUZA 2N78A 1E1TA 2PI2E 3F2BA 3ULJA 4C3JH 1IBLQ 4YHHQ 3S17H 1C7YA 4X6AH 4X64Q 4AIMA 1CKOA 3RZDH 3PF4A 5C3EG 3HOZH 5C0XI 3KFUA 2NZOA 3STBD 1K9MC 3S1NH 2VUMG 5FLMH 1AH9A 2R93H 1OTCA 2VNUD 3GD7A 3CPFA 3CPWA 3GDEA 3I55A 3AEVA 2KCTA 3K7AH 3J80i 2PQAB 4YCWA 3A5ZB 4IOAA 4GN5A 1XNRQ 1C0AA 2VW9A 3AQQA 1N36L 1FJGL 3KF6B 5ELOA 2AMCB 1M1KC 4JV5Q 3TREA 5IWAQ 1VQ7A 4DR5L 4LW1A 3S2HH 2VZAA 1KC8C 1HNZL 1VQ6A 4LFCL 2D0PA 4DV7Q 4A3CH 4JI4Q 4DR7L 1QVGA 4P75A 1WOCA 5AJ3Q 1PVOA 1Z47A 2IT1A 2ZM6Q 1K0RA 3KYHC 3J80c 1A8VA 4LUVA 4DV3Q 1YJNA 4JBWA 2BH8A 2E8GA 2JK8A 4FDBA 3I4MH 2FXQA 1MIUA 4J15A 4HIOA 1YITA 4OX9L 5M3FG 1N33L 3D0FA 1HNWQ 1FVIA 1KHIA 1PHJA 2HHHL 3HOWG 3UDGA 1Y1WH 4LFBL 1I5FA 1OXTA 1YIJA 1K83H 1E24A 2ZTEA 1SROA 2QEXA 1MJCA 3EIVA 3KDFB 4L5QA 3S1MH 2ZTDA 4BY7G 1TXYA 4K0KQ 4P71A 5LMNL 4DR6Q 4A3FG 2I5MX 4Y7NH 3CMEA 1VQMA 2XTIA 4JI6L 2UU9L 2RHQB 4DAYB 1CKNB 5GAGC 1VQDA 4DUYL 1QZGA 4NXMQ 1NTGA 3K81C 3OYYA 3HOYG 1PYBA 3PO3G 2AWOA 4NXNL 1QUQB 4JI7Q 4LF7Q 1RL2A 1V43A 4LNQA 2Z6KA 1OXXK 2NN6I 1BBWA 4PZ8A 5JJLA 3A5UA 1QVCA 3J81j 4PZ7A 4LF6L 1XJVA 1G291 1JJ2A 4POGA 2JA7H 1JJCB 2I5LX 1NMFA 2RCNA 4JBKA 1SR3A 1VQHA 4R4CA 5M5WH 1SFOH 1HZ9A 1EQRA 5C44H 4JI8L 4QL5A 2IHFA 3PO2H 3K8AA 2Z0SA 2UXBL 1ASZA 1G6PA 3PUZA 2B3GA 4LFAQ 4KI0A 4LUZA 5GAHC 1UWVA 5JEAG 4DR2L 4DR1L 1IYJB 1NMGA 4A3IG 2Y0SE 2UUCQ 4PG3A 1TWCH 1Q7YC 4A3LG 4AQYQ 1H95A 2MQHA 3FKIG 3RLFA 1XNQQ 2NVTH 4L5RC 2L15A 1NJIC 1X54A 1PH4A 2JA5H 4LUOA 3J7ZC 2PNHA 2B63G 1X56A 4IOCA 2JEAI 1VS0A 1LM0A 1SMXA 1KIXA 3JC66 1X3FA 3GTLH 4JV5L 3RLNA 4BBRH 2JA8G 1CKMA 1Z9FA 5H1SE 2UXCQ 3HFZB 1BKBA 1VQAA 1PFSA 4LF9Q 4APVA 1LTLA 3ULLA 4XIGS 5IYBH 2I5HA 4RG1A 4B3SL 1B70B 4R4IA 4A4IA 5AJ3L 1UE1A 1EUJA 1EIFA 3U4ZA 2F4VL 4XTCS 3ZJYC 4HJAA 1L1OA 5IT9c 4A3BG 4IPCA 1VQ8A 4BBSG 3G71A 1SE8A 1P8LA 4DV1Q 4QJFA 1PH9A 4JI3L 4DV3L 4B3TL 4DV0L 2JA6H 3K80C 5C4JH 3HOXG 3J81c 4A3KG 1K8AC 1IBMQ 3G6EA 4POFA 4X66Q 3CCSA 1HNWL 4AYBG 4JI0Q 2VQEQ 4MZ9A 2ID0A 2VQFL 1B8AA 3HOUG 1VQPA 4LF5L 3ULPA 3RN2A 1P16A 3VDYA 2E5LQ 4BA2I 2K14A 3M4QA 2N8NA 1VQ4A 1X65A 5C4XH 4H02A 1HJPA 2HIXA 3MXNB 3I56A 1VQJA 4B3RQ 1L1OC 1HH2P 1C9OA 4BY1G 4MNOA 1DGSA 3OTOQ 1S40A 1PA6A 5IYDH 4YY3Q 3S24A 4A3DH 1GKHA 3PUWA 5C0XG 3IRBA 3I7FA 4JI5Q 4NXML 3F1ZA 1K73C 3F2CA 1EOVA 3TEHB 1HZCA 2DUDA 4JI7L 1V1QA 2UUBQ 1NE3A 4BXXG 1YHBA 4DV2L 2R7DA 4Y52H 2LXJA 5FJ8H 3UDIA 4JI1Q 3OW2A 1YJ9A 4C3HH 1D7QA 4UP7A 3CCRA 1J6QA 2PQAA 3KF8B 4JYAL 3CC4A 2NVYH 2NVXH 4A3MG 4QQBX 4R4QA 4A93G 5IP9H 3KF6A 4OO1I 4DKAC 3I4NH 1JMCA 2GN5A 2A19A 2R7ZG 3BU2A 3K0XA 3W1BA 4A3JH 1IBKL 5LMUL 4LFAL 1YVCA 5GROA 4DR4Q 1JE5A 3PIPA 5LMNW 3MEFA 3PUYA 2DGYA 4JI8Q 3U4VA 1N34Q 1XMQQ 2E2JH 1HNXL 2YU9H 4B3MQ 3H0GH 1A0IA 3HOZG 3S2DH 5JEAJ 1TWHH 2PMZE 4DR3Q 2JQOA 1ASYA 5FLMG 4IFDI 1I94Q 2D62A 4GN3B 4KHPQ 1NBWA 3T1YL 2YYZA 3T1HL 4DV5Q 1YNXA 1WCMG 3NEMA 1YI2A 1Y1VH 1J5EL 1GO3E 1N32L 1EFWA 2KENA 3EN2A 4GOPB 4GKKQ 4P74A 4X65L 2A1AA 1Q1EA 3NBHB 2R92H 3H15A 1XMOL 2HIVA 3K7UC 1XTDA 3I2ZA 3PUXA 4DUZQ 1TWAH 1L0WA 1JJGA 1KL9A 1IL2A 2CWPA 3BZCA 3KDFA 4GKJL 4O2DA 3CD6A 4JCVE 2XGTA 3CP0A 1IZ6A 1E7ZA 4A3CG 4OONA 4P73A 2UXDL 1RIPA 3F8TA 1VQ5A 4DV1L 4WJ4A 5IYCH 1PYSB 4QGUA 3WWVA 3CQZH 1EQQA 3HOVH 4IPHA 1I50H 3CW2C 4YWMA 4HIMA 1CKNA 4LF4L 1HR0L 3HKSA 4R4OA 2NN6G 2CCZA 3I4MG 1QUQA 1VQNA 4DPGA 3CAMA 4IJHA 3STBC 1IBLL 4YHHL 5IP7H 4X64L 1Y1WG 5M3MH 4GLVB 3S16H 1WFQA 1D8LA 3M4PA 4A75A 1KD1C 1QZHA 1GVPA 2AHOB 4GOPC 2IHEA 4A3GH 1G51A 2VL6A 1FJGQ 1BVSA 1U5KA 2VY3A 1E22A 1VCIA 2AWNA 5J3BA 1Y14B 3DM3A 4GNXB 5JJIA 3HKZE 4KHZA 2IX1A 1UEBA 1U0LA 4LWCA 4IO9A 1TWFH 1YZ6A 1W3SA 2C35B 4JI5L 2CQOA 4JOIA 4ME3A 4A3EH 1KQSA 2EIFA 3A0JA 3E9IA 1N8RC 5M5XH 4LFCQ 3U50C 2WB1E 1YBYA 1EIYB 2ZJQA 1XNRL 2JEBI 2ATWA 3FP9A 1VQCA 2YTVA 4DV4Q 4JI2Q 5IWAL 1Q86C 4DK6C 1XPOA 1KXLA 3L2PA 3M9BA 2I0QA 1X3EA 3GTGH 4JI1L 3RZOH 1LYLA 3M4OH 2YTYA 4ALPA 4DV7L 4EQ5A 4JI4L 3SGIA 5BR8Q 2LXKA 4DAMA 4OX9Q 1N33Q 2HHHQ 2ZM6L 1JB7A 4TVAB 3E0EA 3CMAA 1K8GA 1HZBA 5C3EH 2EQSA 3D31A 4X62Q 2MFIA 4JOIC 3W5OA 3M3YH 1L2FA 3Q8DA 4GLXA 5C44G 3UE0A 3PUVA 2VUMH 1JT8A 3JAMi 3PO2G 2AKWB 1N9WA 4LF8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R H;  4B3M L;  3TRZ A;  1EWI A;  2BH2 A;  3GTK H;  4PMW A;  1E1O A;  4YCV A;  5LMN Q;  4DR3 L;  1SRU A;  2WAQ E;  1FGU A;  1MKH A;  3RLO A;  2H5X A;  2QA4 A;  4JI6 Q;  2UU9 Q;  2WFW A;  2JA5 G;  3CCU A;  3S1Q H;  4DUY Q;  4BXX H;  1PH3 A;  4OWW B;  2D0O A;  2IY5 B;  2YV5 A;  3PV0 A;  3UDX A;  1PH8 A;  4RMF A;  4HJ7 A;  3CXC A;  3UDF A;  4K0K L;  4DR6 L;  4IPD A;  3KLW A;  4BBR G;  2KHI A;  4DUZ L;  1PH2 A;  1R9T H;  3GTP H;  3EBE A;  3E9H A;  3JAM c;  4LF6 Q;  1PH1 A;  4UY8 C;  3S14 H;  2R7F A;  1VQG A;  5GQO A;  4HIK A;  2Q2H A;  3CC2 A;  5IYB G;  1CSP A;  4DNI A;  2ES2 A;  3ICE A;  4LF7 L;  1UE7 A;  4OWX B;  3CCQ A;  1VQB A;  1O7I A;  3GO5 A;  2BA1 A;  3L7Z C;  2Q2T A;  5M3F H;  3CCV A;  4R1J A;  1YJW A;  3S15 H;  3PSI A;  2UXB Q;  1GD7 A;  2B29 A;  4UP8 A;  2F3I A;  4DR2 Q;  3HOW H;  2R6G A;  2N49 A;  2JA6 G;  4DR1 Q;  2ZJP A;  4GS3 A;  1PH5 A;  3CCM A;  1UE5 A;  1VQL A;  5GAE C;  1WJJ A;  4JG2 A;  3L0O A;  1VQE A;  1Q82 C;  2JJQ A;  1CUK A;  1WCM H;  5ELN A;  1SLJ A;  2NZH A;  3GTJ H;  5HY6 A;  3J7A 5;  5FLX c;  2A8V A;  4BY7 H;  3CF5 A;  2ZJR A;  1S3O A;  4P72 A;  1NY4 A;  4PZ6 A;  4A3F H;  3AYH B;  4NPS A;  2UUC L;  4OO1 G;  4DK3 C;  4AQY L;  5C4X G;  4AH6 A;  1XNQ L;  3TS2 A;  1BBU A;  4C3I H;  1PH6 A;  2GVA A;  2MO0 A;  4YWL A;  1X9N A;  1KRS A;  1Q46 A;  4YWK A;  3HOY H;  5IYD G;  3PO3 H;  2R93 G;  3NEN A;  3G4S A;  1YEZ A;  4A3D G;  5IY0 A;  2Q2U A;  4B3S Q;  1Q12 A;  1SN8 A;  2K4K A;  4UPA A;  4DV4 L;  4JI2 L;  2UXC L;  3RNU A;  5M5Y H;  2K5H A;  3M85 A;  3CCE A;  1Q81 C;  4IFD G;  2F4V Q;  2K5N A;  2QGQ A;  1A63 A;  2MNA A;  4LF9 L;  2VS1 A;  2RHS B;  1AE2 A;  4B3T Q;  1OXS C;  1S72 A;  1X55 A;  4DV0 Q;  1HR0 W;  2UUA Q;  4JI3 Q;  2ASB A;  2RF4 A;  3CC7 A;  4NB3 A;  5FJ8 G;  5BR8 L;  1VQO A;  2IX0 A;  2VQF Q;  4DV6 Q;  1UE6 A;  2OQ0 A;  4GOP A;  2KCM A;  2N3S A;  1YHQ A;  4A76 A;  4LF5 Q;  4X62 L;  5IP9 G;  3ERS X;  3BJU A;  3KJO A;  2JE6 I;  4OWT B;  1GM5 A;  5IE8 A;  4A3I H;  2MO1 A;  4QIW E;  4O0A A;  1VQI A;  1IBM L;  3I4N G;  4A3L H;  4X66 L;  3FKI H;  4LF8 L;  2K5V A;  4A3J G;  4JI0 L;  3W1G A;  4QY7 A;  2VQE L;  1VQ9 A;  1WI5 A;  1A62 A;  1KRT A;  2B63 H;  4YCU A;  1CSQ A;  3U58 A;  3H0G G;  3CCL A;  4HJ8 A;  2E5L L;  3H3V H;  4C2M H;  3ER0 A;  3A74 A;  2Q2I A;  1QVF A;  1X3G A;  2JA8 H;  4HJ5 A;  2HT1 A;  3UE1 A;  1X6O A;  4IJL A;  1N36 Q;  4B3R L;  3GTQ H;  4JBJ A;  1Y1V G;  3KOJ A;  2E2I H;  2PI2 A;  3OTO L;  4DR5 Q;  1XPR A;  1Q1B A;  5GAD C;  2EXD A;  2GVB A;  4YY3 L;  4DV2 Q;  2KHJ A;  2R92 G;  4L5T A;  2Y0S G;  1VQF A;  2ALY B;  1TWG H;  2BA0 A;  3DLL A;  4JYA Q;  2K75 A;  4HID A;  3KJP A;  5C0X J;  3HKZ G;  3CCJ A;  4JBM A;  2UUB L;  3TQY A;  4A3B H;  4BBS H;  4DR7 Q;  4GNX A;  3HOX H;  5JJK A;  4A3K H;  2E2H H;  2WB1 G;  4UP9 A;  5K36 G;  1HZA A;  1IBK Q;  5IYC G;  5LMU Q;  2OTL A;  2K52 A;  1HNZ Q;  3PF5 A;  1EYG A;  3HOU H;  3B6Y A;  3GTM H;  3HOV G;  2JA7 G;  2HQL A;  2Z6K C;  3H3V I;  1HNX Q;  1I3Q H;  1KAW A;  4GN4 B;  4R4T A;  2OTJ A;  2CFM A;  1Q8K A;  2CWA A;  4LFB Q;  2LSS A;  1FL0 A;  3FHW A;  3T1Y Q;  2OCE A;  4DR4 L;  3T1H Q;  3I4O A;  3TS0 A;  3AFP A;  3J81 i;  2WP8 J;  3F2D A;  3PGZ A;  5IP7 G;  2YTX A;  4EX5 A;  1J5E Q;  4BY1 H;  5M3M G;  4KLK A;  1N34 L;  1XMQ L;  2V1C C;  1N32 Q;  4GNX C;  2K50 A;  4X65 Q;  1L1O B;  4BA1 I;  2OWO A;  5DLQ E;  4HJ9 A;  1XMO Q;  4A3G G;  1I6H H;  2ZTC A;  3G48 A;  4OXP A;  1I94 L;  4KHP L;  1OXV A;  3PIO A;  3RR5 A;  4DV5 L;  1PV4 A;  1K3R A;  1M90 C;  3M7N A;  2F52 A;  4GKJ Q;  3NEL A;  4IPG A;  4A3E G;  1IXR A;  2WAQ G;  4NXN Q;  4GKK L;  4JC0 A;  2KBN A;  1XPU A;  1B7Y B;  1OXU A;  4MTN A;  1AE3 A;  1YHA A;  3PCO B;  2UXD Q;  3BZK A;  4AYB E;  1V9P A;  1WYD A;  2OQK A;  4TQU S;  1PH7 A;  3GTO H;  4IFD J;  2UUA L;  4A93 H;  3RN5 A;  4A3M H;  1MJE A;  1T9H A;  1W2B A;  4GLA C;  2JA9 A;  2CKZ B;  5E7N A;  4L5S A;  3AFQ A;  2NVQ H;  4LF4 Q;  1HR0 Q;  5HGQ A;  5EAY A;  4DV6 L;  3LGJ A;  1VQK A;  4WJ3 M;  2R7Z H;  1E3P A;  1LUZ A;  2N78 A;  1E1T A;  2PI2 E;  3F2B A;  3ULJ A;  4C3J H;  1IBL Q;  4YHH Q;  3S17 H;  1C7Y A;  4X6A H;  4X64 Q;  4AIM A;  1CKO A;  3RZD H;  3PF4 A;  5C3E G;  3HOZ H;  5C0X I;  3KFU A;  2NZO A;  3STB D;  1K9M C;  3S1N H;  2VUM G;  5FLM H;  1AH9 A;  2R93 H;  1OTC A;  2VNU D;  3GD7 A;  3CPF A;  3CPW A;  3GDE A;  3I55 A;  3AEV A;  2KCT A;  3K7A H;  3J80 i;  2PQA B;  4YCW A;  3A5Z B;  4IOA A;  4GN5 A;  1XNR Q;  1C0A A;  2VW9 A;  3AQQ A;  1N36 L;  1FJG L;  3KF6 B;  5ELO A;  2AMC B;  1M1K C;  4JV5 Q;  3TRE A;  5IWA Q;  1VQ7 A;  4DR5 L;  4LW1 A;  3S2H H;  2VZA A;  1KC8 C;  1HNZ L;  1VQ6 A;  4LFC L;  2D0P A;  4DV7 Q;  4A3C H;  4JI4 Q;  4DR7 L;  1QVG A;  4P75 A;  1WOC A;  5AJ3 Q;  1PVO A;  1Z47 A;  2IT1 A;  2ZM6 Q;  1K0R A;  3KYH C;  3J80 c;  1A8V A;  4LUV A;  4DV3 Q;  1YJN A;  4JBW A;  2BH8 A;  2E8G A;  2JK8 A;  4FDB A;  3I4M H;  2FXQ A;  1MIU A;  4J15 A;  4HIO A;  1YIT A;  4OX9 L;  5M3F G;  1N33 L;  3D0F A;  1HNW Q;  1FVI A;  1KHI A;  1PHJ A;  2HHH L;  3HOW G;  3UDG A;  1Y1W H;  4LFB L;  1I5F A;  1OXT A;  1YIJ A;  1K83 H;  1E24 A;  2ZTE A;  1SRO A;  2QEX A;  1MJC A;  3EIV A;  3KDF B;  4L5Q A;  3S1M H;  2ZTD A;  4BY7 G;  1TXY A;  4K0K Q;  4P71 A;  5LMN L;  4DR6 Q;  4A3F G;  2I5M X;  4Y7N H;  3CME A;  1VQM A;  2XTI A;  4JI6 L;  2UU9 L;  2RHQ B;  4DAY B;  1CKN B;  5GAG C;  1VQD A;  4DUY L;  1QZG A;  4NXM Q;  1NTG A;  3K81 C;  3OYY A;  3HOY G;  1PYB A;  3PO3 G;  2AWO A;  4NXN L;  1QUQ B;  4JI7 Q;  4LF7 Q;  1RL2 A;  1V43 A;  4LNQ A;  2Z6K A;  1OXX K;  2NN6 I;  1BBW A;  4PZ8 A;  5JJL A;  3A5U A;  1QVC A;  3J81 j;  4PZ7 A;  4LF6 L;  1XJV A;  1G29 1;  1JJ2 A;  4POG A;  2JA7 H;  1JJC B;  2I5L X;  1NMF A;  2RCN A;  4JBK A;  1SR3 A;  1VQH A;  4R4C A;  5M5W H;  1SFO H;  1HZ9 A;  1EQR A;  5C44 H;  4JI8 L;  4QL5 A;  2IHF A;  3PO2 H;  3K8A A;  2Z0S A;  2UXB L;  1ASZ A;  1G6P A;  3PUZ A;  2B3G A;  4LFA Q;  4KI0 A;  4LUZ A;  5GAH C;  1UWV A;  5JEA G;  4DR2 L;  4DR1 L;  1IYJ B;  1NMG A;  4A3I G;  2Y0S E;  2UUC Q;  4PG3 A;  1TWC H;  1Q7Y C;  4A3L G;  4AQY Q;  1H95 A;  2MQH A;  3FKI G;  3RLF A;  1XNQ Q;  2NVT H;  4L5R C;  2L15 A;  1NJI C;  1X54 A;  1PH4 A;  2JA5 H;  4LUO A;  3J7Z C;  2PNH A;  2B63 G;  1X56 A;  4IOC A;  2JEA I;  1VS0 A;  1LM0 A;  1SMX A;  1KIX A;  3JC6 6;  1X3F A;  3GTL H;  4JV5 L;  3RLN A;  4BBR H;  2JA8 G;  1CKM A;  1Z9F A;  5H1S E;  2UXC Q;  3HFZ B;  1BKB A;  1VQA A;  1PFS A;  4LF9 Q;  4APV A;  1LTL A;  3ULL A;  4XIG S;  5IYB H;  2I5H A;  4RG1 A;  4B3S L;  1B70 B;  4R4I A;  4A4I A;  5AJ3 L;  1UE1 A;  1EUJ A;  1EIF A;  3U4Z A;  2F4V L;  4XTC S;  3ZJY C;  4HJA A;  1L1O A;  5IT9 c;  4A3B G;  4IPC A;  1VQ8 A;  4BBS G;  3G71 A;  1SE8 A;  1P8L A;  4DV1 Q;  4QJF A;  1PH9 A;  4JI3 L;  4DV3 L;  4B3T L;  4DV0 L;  2JA6 H;  3K80 C;  5C4J H;  3HOX G;  3J81 c;  4A3K G;  1K8A C;  1IBM Q;  3G6E A;  4POF A;  4X66 Q;  3CCS A;  1HNW L;  4AYB G;  4JI0 Q;  2VQE Q;  4MZ9 A;  2ID0 A;  2VQF L;  1B8A A;  3HOU G;  1VQP A;  4LF5 L;  3ULP A;  3RN2 A;  1P16 A;  3VDY A;  2E5L Q;  4BA2 I;  2K14 A;  3M4Q A;  2N8N A;  1VQ4 A;  1X65 A;  5C4X H;  4H02 A;  1HJP A;  2HIX A;  3MXN B;  3I56 A;  1VQJ A;  4B3R Q;  1L1O C;  1HH2 P;  1C9O A;  4BY1 G;  4MNO A;  1DGS A;  3OTO Q;  1S40 A;  1PA6 A;  5IYD H;  4YY3 Q;  3S24 A;  4A3D H;  1GKH A;  3PUW A;  5C0X G;  3IRB A;  3I7F A;  4JI5 Q;  4NXM L;  3F1Z A;  1K73 C;  3F2C A;  1EOV A;  3TEH B;  1HZC A;  2DUD A;  4JI7 L;  1V1Q A;  2UUB Q;  1NE3 A;  4BXX G;  1YHB A;  4DV2 L;  2R7D A;  4Y52 H;  2LXJ A;  5FJ8 H;  3UDI A;  4JI1 Q;  3OW2 A;  1YJ9 A;  4C3H H;  1D7Q A;  4UP7 A;  3CCR A;  1J6Q A;  2PQA A;  3KF8 B;  4JYA L;  3CC4 A;  2NVY H;  2NVX H;  4A3M G;  4QQB X;  4R4Q A;  4A93 G;  5IP9 H;  3KF6 A;  4OO1 I;  4DKA C;  3I4N H;  1JMC A;  2GN5 A;  2A19 A;  2R7Z G;  3BU2 A;  3K0X A;  3W1B A;  4A3J H;  1IBK L;  5LMU L;  4LFA L;  1YVC A;  5GRO A;  4DR4 Q;  1JE5 A;  3PIP A;  5LMN W;  3MEF A;  3PUY A;  2DGY A;  4JI8 Q;  3U4V A;  1N34 Q;  1XMQ Q;  2E2J H;  1HNX L;  2YU9 H;  4B3M Q;  3H0G H;  1A0I A;  3HOZ G;  3S2D H;  5JEA J;  1TWH H;  2PMZ E;  4DR3 Q;  2JQO A;  1ASY A;  5FLM G;  4IFD I;  1I94 Q;  2D62 A;  4GN3 B;  4KHP Q;  1NBW A;  3T1Y L;  2YYZ A;  3T1H L;  4DV5 Q;  1YNX A;  1WCM G;  3NEM A;  1YI2 A;  1Y1V H;  1J5E L;  1GO3 E;  1N32 L;  1EFW A;  2KEN A;  3EN2 A;  4GOP B;  4GKK Q;  4P74 A;  4X65 L;  2A1A A;  1Q1E A;  3NBH B;  2R92 H;  3H15 A;  1XMO L;  2HIV A;  3K7U C;  1XTD A;  3I2Z A;  3PUX A;  4DUZ Q;  1TWA H;  1L0W A;  1JJG A;  1KL9 A;  1IL2 A;  2CWP A;  3BZC A;  3KDF A;  4GKJ L;  4O2D A;  3CD6 A;  4JCV E;  2XGT A;  3CP0 A;  1IZ6 A;  1E7Z A;  4A3C G;  4OON A;  4P73 A;  2UXD L;  1RIP A;  3F8T A;  1VQ5 A;  4DV1 L;  4WJ4 A;  5IYC H;  1PYS B;  4QGU A;  3WWV A;  3CQZ H;  1EQQ A;  3HOV H;  4IPH A;  1I50 H;  3CW2 C;  4YWM A;  4HIM A;  1CKN A;  4LF4 L;  1HR0 L;  3HKS A;  4R4O A;  2NN6 G;  2CCZ A;  3I4M G;  1QUQ A;  1VQN A;  4DPG A;  3CAM A;  4IJH A;  3STB C;  1IBL L;  4YHH L;  5IP7 H;  4X64 L;  1Y1W G;  5M3M H;  4GLV B;  3S16 H;  1WFQ A;  1D8L A;  3M4P A;  4A75 A;  1KD1 C;  1QZH A;  1GVP A;  2AHO B;  4GOP C;  2IHE A;  4A3G H;  1G51 A;  2VL6 A;  1FJG Q;  1BVS A;  1U5K A;  2VY3 A;  1E22 A;  1VCI A;  2AWN A;  5J3B A;  1Y14 B;  3DM3 A;  4GNX B;  5JJI A;  3HKZ E;  4KHZ A;  2IX1 A;  1UEB A;  1U0L A;  4LWC A;  4IO9 A;  1TWF H;  1YZ6 A;  1W3S A;  2C35 B;  4JI5 L;  2CQO A;  4JOI A;  4ME3 A;  4A3E H;  1KQS A;  2EIF A;  3A0J A;  3E9I A;  1N8R C;  5M5X H;  4LFC Q;  3U50 C;  2WB1 E;  1YBY A;  1EIY B;  2ZJQ A;  1XNR L;  2JEB I;  2ATW A;  3FP9 A;  1VQC A;  2YTV A;  4DV4 Q;  4JI2 Q;  5IWA L;  1Q86 C;  4DK6 C;  1XPO A;  1KXL A;  3L2P A;  3M9B A;  2I0Q A;  1X3E A;  3GTG H;  4JI1 L;  3RZO H;  1LYL A;  3M4O H;  2YTY A;  4ALP A;  4DV7 L;  4EQ5 A;  4JI4 L;  3SGI A;  5BR8 Q;  2LXK A;  4DAM A;  4OX9 Q;  1N33 Q;  2HHH Q;  2ZM6 L;  1JB7 A;  4TVA B;  3E0E A;  3CMA A;  1K8G A;  1HZB A;  5C3E H;  2EQS A;  3D31 A;  4X62 Q;  2MFI A;  4JOI C;  3W5O A;  3M3Y H;  1L2F A;  3Q8D A;  4GLX A;  5C44 G;  3UE0 A;  3PUV A;  2VUM H;  1JT8 A;  3JAM i;  3PO2 G;  2AKW B;  1N9W A;  4LF8 Q; 
#chains in the Genus database with same CATH topology
 3HG9 A;  3K7A B;  4PMW A;  1EYD A;  1E1O A;  2B8F A;  1F2Y A;  1SRU A;  2PW7 A;  2WAQ E;  3EQL C;  3HZX A;  1UEA B;  2H5X A;  3IKJ A;  4ME5 A;  5E4X A;  1WTR A;  2WFW A;  2IY5 B;  3J80 L;  3R93 A;  4DGZ A;  5JPN C;  2NVY B;  5CV9 A;  1WTW A;  4DUZ L;  1QOH A;  3EBE A;  4LF6 Q;  3MXP A;  5DM7 3;  2R7F A;  2Q2H A;  1S5D D;  4L8J A;  5IYB G;  1CSP A;  3MXN A;  3ICE A;  1X3Q A;  3K6O A;  4KHV A;  3I4M B;  3FDT A;  3CCQ A;  3GO5 A;  3BVG A;  1D1I A;  2BA1 A;  2HDL A;  3L7Z C;  2Q2T A;  2WV6 D;  4G57 A;  4R1J A;  2PNR C;  4K14 A;  1Y1W B;  2F3I A;  1E2V A;  2ZJP A;  4GS3 A;  1H9K A;  1BDO A;  1QCB D;  4KD3 A;  4XQQ A;  1SNQ A;  1PRT F;  5ELN A;  3GTJ H;  1SLJ A;  2F0F A;  3SK6 A;  2A8V A;  1CZW A;  2EJM A;  1S3O A;  4PZ6 A;  4Y7N B;  1SYE A;  1AP0 A;  1I6V C;  4RHR A;  1BOS A;  1LT4 D;  2AQ3 B;  1BBU A;  4C3I H;  3TS2 A;  1K8M A;  1KRS A;  3NXW A;  3PO3 H;  3NEN A;  3G4S A;  4A3D G;  3AU7 A;  1SN8 A;  4B08 A;  2JA7 B;  1TS3 A;  2K5N A;  2MNA A;  2L11 A;  4JI3 Q;  1HR0 W;  2RF4 A;  2ZXP A;  3KUP A;  4X3U A;  5BR8 L;  1VQO A;  1EU3 A;  3PO2 B;  1UE6 A;  1F77 A;  4A76 A;  4KKU A;  1GUO A;  1TWC B;  2CH4 A;  4OWT B;  5IE8 A;  2F0O A;  3C1F A;  4O0A A;  3I4N G;  1VMC A;  2JA5 B;  5J22 A;  1BBX C;  3W1G A;  4R8N A;  2B63 H;  4YCU A;  3U58 A;  1I4Q A;  3BDO A;  3HRZ C;  1X3G A;  2K6A A;  1JOO A;  2K03 A;  3UE1 A;  2D2C C;  4IJL A;  5KYI A;  4LK1 C;  2VB3 X;  4I65 A;  1KDC A;  3KOJ A;  1H9R A;  1Q1B A;  4DV2 Q;  5TSS A;  2KHJ A;  2R92 G;  1VQF A;  2ALY B;  2BA0 A;  1QJO A;  2JA6 B;  2B2Y A;  5C3W A;  4GNX A;  4FF1 A;  2WB1 G;  4UP9 A;  5K36 G;  1PFB A;  1PTO H;  1PZK D;  2PQE A;  4FNF A;  1XTC D;  4NP5 A;  2Z6K C;  2RA4 A;  1I3Q H;  4R4T A;  3A7L A;  2CFM A;  3DWA A;  4RGN A;  5C4X B;  1RD9 D;  5KGU A;  2LSS A;  1U4L A;  1W6J A;  4DR4 L;  1BCP C;  5DAU A;  3AFP A;  5IP7 G;  5T1I A;  3OPO A;  1H9S B;  4KLK A;  1XMQ L;  1EZ6 A;  4QB4 A;  3FPU B;  5C0X H;  1UUP A;  4OXP A;  2E2D C;  1EFI D;  3PIO A;  1NSN S;  1AZP A;  1R4Q B;  1IXR A;  4GKK L;  2HCI A;  1XPU A;  2D9U A;  4MTN A;  3PCO B;  2UXD Q;  3BZK A;  4AYB E;  1V9P A;  1WYD A;  2H4O A;  2UUA L;  4A93 H;  4A3M H;  4L5S A;  2D5D A;  2B2V A;  4A3J B;  3NWT A;  2R7Z H;  1FD7 D;  3K5O A;  1E1T A;  2PI2 E;  1IBL Q;  3WOE A;  4FP5 D;  2L12 A;  3LX0 A;  2IL8 A;  1K9M C;  1OTC A;  3U9O A;  3AEV A;  2KCT A;  2M9V A;  1DM0 B;  4GN5 A;  2PW5 A;  1D6E C;  1IKL A;  1O78 A;  1U4R A;  4JV5 Q;  4RAU C;  3HKZ B;  1VQ7 A;  4HAE A;  1HHV A;  3EVQ A;  2VZA A;  2G9D A;  1JWS D;  3MXG A;  1VQ6 A;  3NHH A;  3VR5 A;  3FMC A;  2D0P A;  4LFC L;  4DV7 Q;  1R4P B;  1A15 A;  4DR7 L;  5IIF A;  1WOC A;  1PVO A;  2LMC B;  1I50 B;  4LUV A;  2A6E D;  1KAB A;  3U9S A;  2FXQ A;  2XSC A;  1YIT A;  1N33 L;  5M3F G;  3D0F A;  2HUG A;  3S16 B;  3UDG A;  4LFB L;  1K83 H;  2N55 A;  2QEX A;  3EIV A;  3OOC A;  2F0D A;  2I5M X;  4PNY A;  3CME A;  3KBG A;  1VQM A;  2F0M A;  2UU9 L;  2QKI C;  1VQD A;  3I8Z A;  3OWF A;  2AWO A;  3SHL A;  1EYC A;  4F7X A;  1RL2 A;  1OXX K;  4PZ8 A;  5ELC A;  1JJ2 A;  1HTL D;  1LV9 A;  1JJC B;  4LJZ C;  2I5L X;  4OHJ A;  1A3T A;  5KEE A;  3M3Y B;  1SR3 A;  1X32 A;  1HZ9 A;  4MHE A;  5C44 H;  2PPB C;  3K8A A;  3PUZ A;  1LTI D;  5JEA G;  4DA2 A;  2NUC A;  4A3I G;  4A3L G;  2NVT H;  1NNX A;  3J7Z C;  4IOC A;  1LM0 A;  1SMX A;  2F0L A;  1ZEQ X;  3GTL H;  1EY7 A;  1CHQ D;  4BBR H;  1BKB A;  2B2T C;  4K6D A;  1DOL A;  4RG1 A;  1WTH A;  2SEB D;  5FLX L;  4B3S L;  1HQM C;  5AJ3 L;  1EUJ A;  3U4Z A;  4XTC S;  1EZ8 A;  1ICF B;  1L1O A;  3ZJY C;  4A3B G;  1SE8 A;  1ICW A;  1PH9 A;  4B3T L;  4DV0 L;  3K80 C;  1IBM Q;  3G6E A;  3GTJ B;  3CCS A;  1CZG A;  4JI0 Q;  1SJH D;  2VQE Q;  4HTH A;  1SYD A;  2PO4 A;  4LF5 L;  3ULP A;  4ZKB B;  4QIW B;  3RN2 A;  3IFT A;  4K8J A;  4UDU C;  4C3I B;  2N8N A;  4H7B A;  4H02 A;  1HJP A;  2HIX A;  4KMU C;  4WRD A;  1VQJ A;  3PO3 B;  4B3R Q;  5I9O A;  4BY1 G;  3OSO A;  3OIQ A;  3IRB A;  4HMI A;  3TDQ A;  3I7F A;  4NXM L;  1K73 C;  2KUM A;  3F2C A;  3TEH B;  4IFD H;  1HZC A;  4HR7 B;  1V1Q A;  1YHB A;  2L0C A;  4DNT B;  4IUR A;  2ZXR A;  2R7D A;  1B50 A;  4XQN A;  1EY9 A;  1ZKO A;  2KEE A;  4JI1 Q;  3TZD A;  3OW2 A;  1D7Q A;  3KF8 B;  1EWH A;  2P5Z X;  2NVY H;  4QUC A;  3F2U A;  3CKI B;  3KF6 A;  4IUV A;  2C5C A;  4DKA C;  5KND A;  2GN5 A;  2A19 A;  4FF3 A;  3BU2 A;  3K0X A;  3MHB A;  2B63 B;  3MFY A;  2RDG A;  1HUN A;  3MEF A;  4B3M Q;  3LNN A;  2YU9 H;  3H0G H;  1A0I A;  1SBB B;  5JPM C;  3S2D H;  2JQO A;  3BS1 A;  1ASY A;  5FLM G;  1DZ1 A;  5JAV A;  5IGB A;  3T1Y L;  1Y8O B;  2XWJ B;  1IYU A;  1GO3 E;  4GOP B;  1TS2 A;  2OF1 A;  4P74 A;  2A1A A;  1Q1E A;  3NBH B;  2FMC A;  4R8I A;  3SK8 A;  1TWA H;  1L0W A;  1IL2 A;  4GKJ L;  3BG3 A;  1PTO B;  3SK4 A;  4RKL A;  4DV1 L;  5IYC H;  3MVV A;  3SVM A;  3WWV A;  3CQZ H;  4N8X 1;  1I3Q B;  3HOV H;  4DAY A;  1CKN A;  4JK1 C;  2J7Z A;  2QW7 A;  4NKL A;  3DUZ A;  2NN6 G;  1B9N A;  4L63 B;  2CCZ A;  1K0S A;  5HUR A;  4DPG A;  3CAM A;  4CJ1 B;  4GZY C;  4IJH A;  3ERQ A;  3NUC A;  1STG A;  4I7A A;  4X64 L;  1CFM A;  2I46 A;  4XT3 B;  4GLV B;  4L6T B;  1WFQ A;  1D8L A;  1E2Z A;  4MN3 A;  1QZH A;  2MP1 A;  2AHO B;  2IHE A;  4A3G H;  2A68 D;  4J8Q A;  1BNZ A;  1U5K A;  1IKM A;  1B44 D;  3HKZ E;  1IW7 D;  1TWF H;  2C35 B;  4A3E H;  4ME3 A;  1F9S A;  3A0J A;  1I4H A;  4A93 B;  4A3M B;  4HCS A;  1VDZ A;  4OL7 A;  3IL8 A;  3Q23 A;  3GTG H;  1F9Q A;  2R7Z B;  3SGI A;  2LXK A;  1OO9 B;  3IFD A;  1V1P A;  2A6E C;  2SNM A;  1ENF A;  5C5M A;  5C3E H;  1MSG A;  1ROD A;  2QCP X;  1L2F A;  1S4Z A;  3SE0 A;  2B2Y C;  1ENA A;  2ZXO A;  2AKW B;  1N9W A;  4LF8 Q;  1SXT A;  1XWE A;  2BH2 A;  4I7Z C;  2A5H A;  1G8Z D;  3SEB A;  4DR3 L;  1KNE A;  5LMN Q;  1IHZ A;  2QA4 A;  4JI6 Q;  3J81 E;  2D0O A;  3PV0 A;  2DJF C;  3UDX A;  4K0K L;  1SMY D;  4HJ7 A;  3UDF A;  4IUT A;  4DR6 L;  4IPD A;  2NVX B;  5D14 A;  2K32 A;  5ELE A;  1H9M A;  1R9T H;  1EYA A;  3TN2 A;  1STA A;  1PH1 A;  3BVZ A;  4UY8 C;  1YNN C;  5GQO A;  3SK5 A;  1TVX A;  4LF7 L;  1UE7 A;  1EOT A;  1SNM A;  3X3N A;  3FEW X;  1O7L A;  3A8I E;  4QMG A;  3NTI A;  5DM6 3;  5ELD A;  1TWH B;  1JIC A;  5EBC A;  1GD7 A;  4UP8 A;  4WFN 3;  4DR2 Q;  1HFG A;  1QE6 A;  4DR1 Q;  1K83 B;  3MXU A;  5EQ0 A;  2F0S A;  1Q82 C;  1CUK A;  1Y8N B;  3J7A 5;  4PV1 C;  4F88 A;  4M8A A;  2LY7 A;  2B2V C;  3CF5 A;  2ZJR A;  3Q6S A;  4A3F H;  3AYH B;  4AQY L;  1SYF A;  4AH6 A;  3MA2 B;  3HOY H;  5I6Y A;  3J80 E;  3G6J B;  3Q0A A;  2R93 G;  2FJ2 A;  1YEZ A;  2Q2U A;  4K2L A;  5JVH 3;  1PTO F;  4JI2 L;  3C3L A;  1WTV A;  1Q81 C;  1DOK A;  4LF9 L;  2VS1 A;  5CBA E;  1OXS C;  2GA4 B;  1WD0 A;  3CC7 A;  4NB3 A;  3TP7 A;  5C44 B;  2B2W A;  1QWY A;  1CA6 A;  1RHP A;  4C3H G;  4DV6 Q;  2QIL A;  1YHQ A;  2EYL A;  4XDX A;  4XYO A;  4X62 L;  2EXZ A;  5IP9 G;  3ERS X;  2QDB A;  1I4X A;  3BJU A;  1GM5 A;  4KJN A;  2NVT B;  4QIW E;  1SNC A;  1VQI A;  2KCN A;  4K8I A;  2F0P A;  3FKI H;  4X66 L;  4CKE A;  1SYG A;  1B9M A;  1WI5 A;  1A62 A;  2Z4I A;  4J6H A;  5CV5 A;  3CCL A;  3GTL B;  1HCZ A;  4BBR B;  4HJ8 A;  2E5L L;  2Q2I A;  3DHQ A;  2HT1 A;  1X6O A;  1BCP B;  3WOF A;  3J81 L;  1N36 Q;  1SSO A;  2KOL A;  4JBJ A;  4CHT B;  1Y1V G;  1Z7T A;  3OTO L;  1CTM A;  1YNJ C;  1KTK A;  3D4R A;  1LT6 D;  4XXE A;  3IAY A;  5IGG A;  4L5T A;  2Y0S G;  4JYA Q;  2WAC A;  4IN3 A;  5CV6 A;  4HID A;  3I4L A;  3CCJ A;  3T53 B;  4JBM A;  2UUB L;  4BBS H;  1TU2 B;  5J39 A;  2K7V A;  1HZA A;  4WJW A;  1IBK Q;  5D3D A;  2CW0 D;  4IZ8 A;  4K5W A;  3HOU H;  3H3V I;  1HNX Q;  2OTJ A;  1H9J A;  2CQA A;  2CWA A;  5CV7 A;  3FHW A;  1F2L A;  4BS9 A;  2OCE A;  3I4O A;  3TS0 A;  3C46 A;  4DXG A;  4X3S A;  2YTX A;  5LL6 S;  5M3M G;  3LWE A;  2Z8L A;  5D3I B;  2SOB A;  2OWO A;  4HJ9 A;  1EEI D;  5IT9 E;  1I94 L;  3M4Y A;  4KHP L;  1NR2 A;  1OXV A;  3GQB A;  4DV5 L;  3M7N A;  1AZQ A;  2WAQ G;  4OGQ C;  2JN4 A;  4NXN Q;  5EPK A;  1OXU A;  1AW7 A;  2OQK A;  1PH7 A;  4IFD J;  1JQY D;  3RN5 A;  4ZUI A;  1KLG D;  4ZCK A;  1W2B A;  5E7N A;  2JA9 A;  2NVQ H;  4LF4 Q;  1HR0 Q;  5EAY A;  3LGJ A;  3C2P A;  1E3P A;  1LUZ A;  2B8G A;  2N78 A;  2HDM A;  4OEM B;  3ULJ A;  1WTX A;  4YHH Q;  2YU9 B;  1TY2 A;  3H0G B;  1FGB D;  1HFN A;  3PF4 A;  3S2D B;  3HOZ H;  2VUM G;  1AH9 A;  4CGY B;  2R93 H;  2EE1 A;  2A68 C;  3GDE A;  1EY6 A;  2KED A;  4EQO A;  2PQA B;  1IW7 C;  2K28 A;  2Z9H A;  1EU4 A;  1PDQ A;  2AMC B;  1M1K C;  1TWA B;  3TRE A;  1DJR D;  3NQT A;  4LW1 A;  3S2H H;  1LAC A;  4ILW A;  4PQX A;  3W2D A;  4V0B A;  1STE A;  1JE4 A;  1LTG D;  3G7L A;  2HCC A;  4KK7 A;  5EPL A;  1D1K A;  4JI4 Q;  1FR3 A;  3CQZ B;  4A3I B;  1KNA A;  4H13 C;  3HOV B;  2IT1 A;  2ZM6 Q;  1K0R A;  3T13 A;  5IOC A;  3A55 A;  4DV3 Q;  2E8G A;  1MIU A;  4HIO A;  4OX9 L;  5D65 A;  1HNW Q;  1PHJ A;  2HHH L;  2PCF B;  3HOW G;  1S5F D;  4A3G B;  1JWM D;  1SRO A;  2F1M A;  3KDF B;  4L5Q A;  3MTS A;  1BCP F;  3BYY B;  4BY7 G;  3FRP B;  1GUG A;  4U67 3;  1TWF B;  4A3E B;  2IJ0 A;  5CBE E;  4P71 A;  1IYV A;  4KY7 A;  2BE5 D;  4P2C B;  1SMY C;  4TSS A;  5IT9 L;  4DUY L;  3K81 C;  4R9W A;  3GTG B;  5FKA C;  4JI7 Q;  3QG1 A;  4LNQ A;  3GTM B;  2Q8T A;  2NN6 I;  4HMJ A;  3V2T A;  3A5U A;  5IGD A;  3J81 j;  1XJV A;  1D5X C;  1SAP A;  1G2S A;  5C3E B;  4EVO A;  1SE4 A;  2RCN A;  1VQH A;  1LO5 D;  1X3P A;  4R4C A;  5M5W H;  1SFO H;  1EQR A;  3RD4 A;  2UXB L;  1I6H B;  4KI0 A;  4LUZ A;  4FF2 A;  4IOA A;  2QF7 A;  1Z6H A;  2PNH A;  2JEA I;  5F2D A;  1R9T B;  4JV5 L;  5J1Z A;  2JA8 G;  1CKM A;  1C48 A;  1HPC A;  3QB3 A;  4PMB A;  1TR5 A;  3ULL A;  1TQO A;  1W6K A;  5IYB H;  1HXY D;  1DON A;  2KJX A;  3KLS A;  2PZU A;  4R4I A;  4A4I A;  2F4V L;  4C56 C;  4IPC A;  1P8L A;  4QJF A;  3HOX G;  2N88 A;  4A3K G;  1K8A C;  4M1U B;  4POF A;  5JVG 3;  1CT1 D;  3GV6 A;  4AYB G;  2VQF L;  4OIK A;  5G3L F;  1B8A A;  1B4O A;  4YIJ A;  1VQP A;  4A3F B;  4FXD A;  1P16 A;  4BA2 I;  2XIW A;  5FO9 B;  2K14 A;  2Q8I B;  3JAM E;  3ND9 A;  3MXN B;  3HOY B;  4O42 A;  2R61 A;  3E6Z X;  4IUQ A;  4A3D H;  3PUW A;  1CM9 A;  2FHT A;  4G7H C;  3D4D A;  5ELF A;  3VR3 A;  1NE3 A;  4BXX G;  2K5D A;  1EQT A;  2ZT9 C;  3UDI A;  1M4V A;  3X3M A;  5FLX E;  3E3X A;  3EJI A;  3CCR A;  3RMH A;  2NVX H;  4QQB X;  1LTT D;  2EOT A;  2CW0 C;  3FKI B;  5KNC A;  3K59 A;  4OEL B;  4S3S A;  1JMC A;  3I4N H;  2J0T D;  3W1B A;  4DR4 Q;  5LMU L;  4C3J G;  1JE5 A;  3H94 A;  4JI8 Q;  2DGY A;  1XMQ Q;  1TWH H;  3HP3 A;  2EYH A;  2IW3 A;  2D62 A;  4GN3 B;  3A54 A;  1SDF A;  3T1H L;  1O7Z A;  2MHV A;  1WCM G;  3NEM A;  1J5E L;  1MD2 D;  1N32 L;  2KEN A;  3EN2 A;  4GKK Q;  4X65 L;  2R92 H;  3H15 A;  1XMO L;  2HIV A;  2Q8R E;  4TRD A;  3R8B A;  1XTD A;  3I2Z A;  4FF4 A;  2XNA C;  2MPM A;  2IWH A;  4BBS B;  1Q90 A;  1RDP D;  4QF4 A;  2NWG A;  1E7Z A;  4A3C G;  5K36 H;  1GUN A;  4WOR A;  1VQ5 A;  3HOU B;  1PYS B;  4KN7 C;  3H3V C;  2LS0 1;  3D4W A;  3I4M G;  1QUQ A;  1VQN A;  4CDF C;  1ZXT A;  1PZI D;  1ET6 A;  5IP7 H;  2BOS A;  5KYL A;  1Y1W G;  2B2W C;  3M4P A;  4A75 A;  2XVS A;  4FYD A;  1GVP A;  1V1O A;  2VL6 A;  1DOM A;  3JAM L;  2VB2 X;  3OIP A;  3T56 B;  2VY3 A;  3A56 A;  1E22 A;  4GNX B;  5J3B A;  5EKK A;  1Y14 B;  3DM3 A;  5JJI A;  4EGV A;  3E5S A;  2NTS A;  3D8G A;  5KRU A;  4LWC A;  2K5W A;  1W3S A;  2CQO A;  3E9I A;  4LFC Q;  5M5X H;  1XNR L;  2ATW A;  3QIA A;  1VQC A;  3NQI A;  4DV4 Q;  5IWA L;  1Q86 C;  5EJW A;  2NVQ B;  1KXL A;  2I0Q A;  1K3B C;  4JI1 L;  3RZO H;  1LYL A;  3M4O H;  4KY5 A;  3H09 A;  1N33 Q;  1NUC A;  3HOZ B;  1K8G A;  2MFI A;  4H0L C;  4JOI C;  3P75 A;  3Q8D A;  2R93 B;  4DNR B;  3PO2 G;  3S1R H;  4B3M L;  3TRZ A;  1LLR D;  4RGO S;  1SYB A;  2KVM A;  1FGU A;  1MKH A;  5L37 A;  1D2B A;  4ZLT F;  2UU9 Q;  2NBF A;  4BXX H;  2JA5 G;  3S2H B;  5M9O A;  1PH3 A;  2BE5 C;  2YV5 A;  1PH8 A;  4RMF A;  3CXC A;  3VR4 A;  2KHI A;  1PH2 A;  1M8A A;  3E9H A;  1VQG A;  4HIK A;  2MGS A;  4N9P A;  3P1H A;  1MGS A;  2ES2 A;  2EYO A;  3UI2 A;  1VQB A;  2JYO A;  1II3 A;  2E2J B;  1EY5 A;  3Q24 A;  5M3F H;  4OIJ A;  2B29 A;  2R6G A;  3BZD B;  2JA6 G;  1EL0 A;  2CVR A;  3TZU A;  4JG2 A;  1EY8 A;  1WCM H;  1I4G A;  2JJQ A;  5AFW A;  5HY6 A;  4EQN A;  1ILQ A;  1NY4 A;  3VYR A;  2VXW A;  1WVL A;  1C4Q A;  2UUC L;  4OO1 G;  4DK3 C;  5C4X G;  4RA8 A;  1XNQ L;  1X9N A;  2MO0 A;  2A6H D;  4ID6 A;  4YWL A;  3I3C A;  4YWK A;  5IYD G;  1ESR A;  2RQX A;  4B3S Q;  1Q12 A;  2AQ1 B;  2K4K A;  4UPA A;  2UXC L;  3RNU A;  5M5Y H;  2F0V A;  3CCE A;  5BN4 A;  4HSP A;  2QGQ A;  1A63 A;  2RHS B;  3NP8 A;  1GXD C;  2F0K A;  4B3T Q;  2ASB A;  1S72 A;  4DV0 Q;  2F0W A;  5M5W B;  1SFO B;  5FJ8 G;  2R3Z A;  3K0Y A;  5M3M B;  2KCM A;  2N3S A;  3EFX D;  1A3V A;  4LF5 Q;  3CRL C;  4ZUJ A;  2M2L A;  3KJO A;  3EA6 A;  5JEA H;  2MUY A;  4A3I H;  2MO1 A;  4A3L H;  1A2U A;  4LF8 L;  2E76 C;  2K5V A;  4A3J G;  1HA6 A;  2F0I A;  5IGE A;  3LWU A;  3J7A F;  1CSQ A;  3H3V H;  5NUC A;  4RKB A;  3DWP A;  4HJ5 A;  3VA5 A;  4NW2 A;  1WTP A;  3T16 A;  1XX8 A;  2PI2 A;  4DR5 Q;  1XPR A;  5GAD C;  4YY3 L;  1KLU D;  1SND A;  2Z6B A;  4KKT A;  1PXU A;  1JOR A;  1A2T A;  2EPB A;  2K75 A;  4A3B H;  5C0X J;  3HKZ G;  3TQY A;  3KK7 A;  3QWN A;  2F03 A;  1U4M A;  2F3W A;  2X69 A;  5IGC A;  3HS0 C;  2F0G A;  2K52 A;  2NTT A;  3PF5 A;  1EYG A;  4ZYS A;  4KKS A;  3B6Y A;  3GTM H;  1CI3 M;  4GN4 B;  3S1Q B;  3MZ5 A;  1RTN A;  2AQ2 B;  1XXG A;  5IOD A;  3T1Y Q;  1L0Y B;  3J81 i;  1PLF A;  2WP8 J;  3F2D A;  3PGZ A;  4BY1 H;  4EX5 A;  4A3D B;  1N34 L;  2V1C C;  4GNX C;  1EIH A;  1J8I A;  1L1O B;  1I6H H;  3NK9 A;  5DLQ E;  2ZTC A;  3G48 A;  2G5D A;  2I07 B;  3RR5 A;  3VYS A;  1PV4 A;  1K3R A;  4GKJ Q;  2F52 A;  1F2M A;  3CRK C;  1F2Z A;  3MAQ A;  2KBN A;  4NDX A;  5EKI A;  4QCL A;  4TQU S;  3GTO H;  1JC7 A;  1MJE A;  1T9H A;  2L4N A;  2CKZ B;  3AFQ A;  5I6W A;  3I4N B;  4DV6 L;  4BY7 B;  2F0J A;  1VQK A;  2RVL A;  4WJ3 M;  5ELB A;  2KHS A;  2IPK D;  1WD1 A;  3QOJ A;  3S17 H;  1C7Y A;  2DN8 A;  4X64 Q;  4AIM A;  3RZD H;  1PRT D;  3STB D;  1KAA A;  1EY4 A;  1DYQ A;  3DEO A;  5FLM H;  2K05 A;  2EY5 A;  1GHK A;  4PMC A;  2VNU D;  2F0U A;  3FVQ A;  2O4X A;  3GV3 A;  3GD7 A;  4DXF A;  1ILP A;  4NMZ A;  3I55 A;  3OW7 A;  2HQE A;  3J80 i;  2R92 B;  3A7A B;  4YCW A;  3NBI A;  3RUZ A;  2EDG A;  2K33 A;  2DNC A;  2VW9 A;  1N36 L;  1GJX A;  1FJG L;  3KF6 B;  2B39 A;  4V19 0;  2KEC A;  1HNZ L;  2WB1 B;  3BDC A;  1PFN A;  4HSV A;  3SDZ A;  4P75 A;  1ET9 A;  1PFM A;  5A35 A;  3KYH C;  3WDN A;  3J80 c;  3E0J A;  1YJN A;  5FO8 B;  3L3O C;  2JK8 A;  2NN6 H;  3HGB A;  1FVI A;  1Q3L A;  1Y8P B;  1I5F A;  1YIJ A;  2ZTE A;  1E24 A;  5COY A;  1MJC A;  2NYZ D;  3S1M H;  2ICI A;  4RWS C;  1EQV A;  2F0H A;  3NPP A;  4K0K Q;  1BF4 A;  4DR6 Q;  5M5X B;  1JOQ A;  3NTH A;  1MHW C;  1ONL A;  2XTI A;  4C3I G;  4DAY B;  1CKN B;  2E2H B;  3PO3 G;  4NXN L;  3BDL A;  1F9R A;  3RZO B;  2E75 C;  2RDH A;  4LF7 Q;  3M4O B;  4CKC A;  4N9T A;  1SEB D;  3M7G A;  5JJL A;  4LF6 L;  1G29 1;  1LT5 D;  1NMF A;  2XRS D;  4LMQ D;  5E1F A;  3CHB D;  2FFK B;  3ERO A;  4QL5 A;  3S1R B;  2Z0S A;  1IL8 A;  5KIX A;  1B2T A;  2B3G A;  4LFA Q;  1LTS D;  5GAH C;  2RBM A;  4IUP A;  1NMG A;  2X6G A;  1QNU A;  2Y0S E;  4JW0 A;  4AQY Q;  1H95 A;  2MQH A;  4L5R C;  1NJI C;  1PH4 A;  3VYU A;  4LUO A;  2B63 G;  1X56 A;  4ODG A;  1FYC A;  3JC6 6;  1GOZ A;  1RF2 D;  1V1P B;  2A6H C;  3RLN A;  4IUU A;  1B1Z A;  3OHX C;  1VQA A;  1PFS A;  4HN7 A;  2KA7 A;  4LF9 Q;  1LTL A;  2NZ1 D;  3TP5 A;  1DXM A;  4XIG S;  4ZQ3 A;  2E74 C;  2I5H A;  4X3K A;  4G4K A;  1H9S A;  1UE1 A;  4K6L A;  5M3F B;  3K57 A;  3HEJ A;  4HJA A;  5IT9 c;  1STB A;  2JXM B;  5G3L D;  4CDD C;  3S1N B;  1STY A;  1HQR D;  4JI3 L;  4DV3 L;  5C4J H;  1STH A;  1WCM B;  4X66 Q;  1HNW L;  2A73 B;  5FK9 C;  2Z1C A;  4DK0 A;  4CJ0 B;  2L5T A;  2E5L Q;  3AMU A;  4EQP A;  3I56 A;  3NWS A;  1L1O C;  1HH2 P;  4N8F A;  1C9O A;  4DK1 A;  4RGT A;  4MNO A;  3OTO Q;  1S40 A;  3S24 A;  3J7A V;  1SE3 A;  1GKH A;  5C0X G;  5M5Y B;  3TBI B;  4JI5 Q;  4C1N I;  1KDB A;  4O1N A;  4F8M A;  2DUD A;  4JI7 L;  1A3U A;  2UUB Q;  3ITP A;  2HD3 A;  2SNS A;  4DV2 L;  1CQV A;  2LXJ A;  4IQZ A;  3VA7 A;  1F9P A;  4C3H H;  1J6Q A;  1SNO A;  3CC4 A;  4A93 G;  4A3M G;  4RCO A;  5IP9 H;  3VR6 A;  2KCC A;  4OO1 I;  3OMC A;  2R7Z G;  1YVC A;  5GRO A;  2E2J H;  3PUY A;  5HGT A;  3K5L A;  5JEA J;  2PMZ E;  2L55 A;  2BCO A;  1I94 Q;  1EIG A;  1VF7 A;  1MSH A;  4KHP Q;  4X3T A;  4DV5 Q;  1STN A;  1YNX A;  2CH4 W;  1Y1V H;  5DEH A;  2IX3 A;  1GUT A;  1EFW A;  4C1N K;  4A3B B;  4DUZ Q;  4RGM A;  4DF7 A;  1JJG A;  1KL9 A;  2CWP A;  4O2D A;  4JCV E;  3CP0 A;  1IZ6 A;  2WKC A;  5K5P A;  2UXD L;  3F8T A;  4WJ4 A;  3A8K E;  4IPH A;  2J4X A;  3CW2 C;  4HIM A;  4FXG C;  2AUK A;  4R4O A;  3N6R A;  1T5E A;  2PZT A;  1C8C A;  1RTO A;  1PRT C;  5CC4 A;  4BY1 B;  1U4P A;  3STB C;  1IBL L;  2Z4H A;  5M3M H;  1KD1 C;  1RJT A;  4DAV A;  1G51 A;  1BVS A;  1EY0 A;  3N52 A;  1VCI A;  1GUS A;  4KHZ A;  2IX1 A;  1B3A A;  1KQS A;  3I90 A;  2EIF A;  3I91 A;  1N8R C;  2NB0 A;  2WB1 E;  5I2Y A;  2ZJQ A;  3GTO B;  1SE2 A;  2YTV A;  1WTQ A;  4CBV A;  3SR1 A;  4DK6 C;  1XPO A;  3MWY W;  2LKV A;  3FPP A;  3M9B A;  2EYP A;  3L9A X;  2RSN A;  2YTY A;  4ALP A;  4DV7 L;  4EQ5 A;  3PMF A;  5BR8 Q;  4OX9 Q;  3S17 B;  5I2X A;  2HHH Q;  3RZD B;  1E0B A;  1RCV D;  3E0E A;  3CMA A;  3Q22 A;  2EQS A;  2JSO A;  3D31 A;  2B2U A;  4GLX A;  5CGK A;  5A2Q E;  3UE0 A;  5C44 G;  2VUM H;  1JT8 A;  3JAM i;  4JI8 L;  1EWI A;  5E4W C;  3GTK H;  4LAA A;  4YCV A;  1AN8 A;  3RLO A;  2TMP A;  3S1Q H;  3CCU A;  4DUY Q;  4OWW B;  1I4R A;  2OXP A;  2QDL A;  4U68 A;  3QO2 A;  3KLW A;  4BBR G;  3GTP H;  3QJY A;  3JAM c;  1QIL A;  3S14 H;  3CC2 A;  1UNS A;  4DNI A;  4KV6 A;  4OWX B;  1O7I A;  2V4D A;  1BR9 A;  4K5V A;  3S15 H;  3CCV A;  2UXB Q;  1YJW A;  3PSI A;  5CV4 A;  3HOW H;  4UHV A;  2N49 A;  1PH5 A;  3CCM A;  4G7Z C;  1UE5 A;  1VQL A;  5GAE C;  3S1M B;  1WJJ A;  4DAP A;  2XN9 C;  3L0O A;  1VQE A;  2RSO A;  4F87 A;  2NZH A;  3TP8 A;  1UAP A;  5FLX c;  4BY7 H;  2EYF A;  1TS5 A;  1GUW A;  4P72 A;  3KF8 A;  4NPS A;  3QOL A;  2K5Q A;  2EZV A;  5EGT A;  5EPJ A;  4ABN A;  1Y69 U;  1PH6 A;  2GVA A;  1Q46 A;  2F3V A;  5IY0 A;  4FXK C;  1CK1 A;  4B9X A;  4DV4 L;  2K5H A;  3M85 A;  4IFD G;  2F4V Q;  4MTK A;  3D6C A;  1NR4 A;  1AE2 A;  5C6A A;  1X55 A;  4KJO A;  2RKS A;  2UUA Q;  3BVM A;  3P20 A;  2XRQ D;  3TSS A;  2IX0 A;  2AUJ D;  2VQF Q;  2OQ0 A;  4GOP A;  3NBH A;  5EBD A;  1ZYR D;  1ML0 D;  1G91 A;  2JE6 I;  3D3R A;  2OEO A;  1L0X B;  1LT3 D;  1S5E D;  3NE5 B;  1IBM L;  2F0T A;  2SDF A;  1LTB D;  5A2Q L;  4JI0 L;  2VQE L;  4QY7 A;  1VQ9 A;  1KRT A;  3NSW A;  3H0G G;  4C2M H;  3TME A;  3ER0 A;  2EY6 A;  3A74 A;  1QVF A;  2JA8 H;  3C1E A;  1JCK B;  1K28 A;  3P7J A;  2EY2 A;  1S5B D;  4B3R L;  3GTQ H;  4CDE C;  3CU7 A;  2E2I H;  1YNN D;  2EJG C;  2EYJ A;  2EXD A;  2GVB A;  2WIN B;  5LL6 X;  4KY6 A;  3I70 A;  2F4I A;  1TWG H;  3DLL A;  1LTA D;  2L1B A;  4Q0F A;  3KJP A;  1ENC A;  4DR7 Q;  3TP6 A;  5C4J B;  2EY1 A;  1S5C D;  3HOX H;  5JJK A;  4A3K H;  2E2H H;  5FOB B;  4K2K A;  2K1B A;  5IYC G;  5LMU Q;  2OTL A;  2F0N A;  2TSS A;  1FNV A;  3HOV G;  3OWE B;  2JA7 G;  2HQL A;  1KAW A;  2DY7 A;  1Q8K A;  4LFB Q;  1FL0 A;  3DM1 A;  4CKB A;  3T1H Q;  1BUV T;  1J5E Q;  1TS4 A;  1N32 Q;  3KLS X;  3PIP 3;  2K50 A;  2A74 C;  2QEJ C;  4X65 Q;  4BA1 I;  4A3G G;  1QNK A;  1XMO Q;  1A6X A;  1JOK A;  1PYW D;  3GP7 A;  1QG7 A;  1HA5 A;  1M90 C;  3DMU A;  3J7Y W;  3NEL A;  4IPG A;  4A3E G;  2O5J C;  4K5X A;  4JC0 A;  4XT1 B;  4E6I A;  5DNF A;  4C3H B;  1B7Y B;  2MJ8 A;  2RDF A;  1AE3 A;  1YHA A;  3VYT A;  3ONA B;  3VR2 A;  2CHB D;  1VF5 C;  4GLA C;  2K01 A;  5HGQ A;  4ZAI A;  3F2B A;  4C3J H;  4X6A H;  1TT2 A;  1CKO A;  1E2W A;  5C3E G;  5JJZ A;  1AFP A;  5C0X I;  3KFU A;  1LTR D;  2NZO A;  2DNE A;  3S1N H;  1CQF A;  1Y1V B;  3CPW A;  2DY8 A;  3CPF A;  3S9W A;  1U9R A;  3K7A H;  2XWB B;  1C0A A;  1YNJ D;  2Y0S B;  3A5Z B;  1XNR Q;  1TKW B;  3AQQ A;  1DCZ A;  5ELO A;  4MIU A;  5IWA Q;  1TII D;  4DR5 L;  4Z9C B;  1PTO D;  1KC8 C;  2PYK A;  1NCV A;  5LHY 1;  1Q8I A;  4IUN A;  1NAP A;  4A3C H;  4DN4 M;  1QVG A;  5AJ3 Q;  1Z47 A;  2OT2 A;  4DU9 A;  3O13 A;  3MFG A;  5C4H A;  1A8V A;  3NTK A;  2FMM A;  4JBW A;  2BH8 A;  4FDB A;  5FO7 B;  3I4M H;  3R2T A;  4J15 A;  1KHI A;  2A69 D;  1K8O A;  1B53 A;  3ND8 A;  1JB3 A;  1Y1W H;  1OXT A;  5JOB A;  1BXT A;  3W3A A;  5CR3 A;  3V96 A;  2RCF A;  3H91 A;  2ZTD A;  1BQQ T;  3I72 A;  4B9W A;  1TXY A;  1AEX A;  2WAQ B;  2X6L A;  3T4A C;  1JR0 D;  1SNP A;  3V05 A;  5LMN L;  4A3F G;  4Y7N H;  2K04 A;  4JI6 L;  2RHQ B;  4KD4 A;  4J1M A;  5GAG C;  1QZG A;  4NXM Q;  1NTG A;  3OYY A;  4JPB W;  3HOY G;  1PYB A;  1T5X D;  1QUQ B;  4CDC C;  1V43 A;  4CJ2 C;  2Z6K A;  1BBW A;  1FNW A;  1QVC A;  4G7O C;  4PZ7 A;  3K58 A;  4POG A;  2JA7 H;  1MBY A;  4JBK A;  2VUM B;  5BN5 A;  2IHF A;  3PO2 H;  5E3F A;  4QUF A;  3GTK B;  3H6M A;  2L9H A;  1ASZ A;  1G6P A;  2JP1 A;  1LAB A;  4DR2 L;  1UWV A;  4DR1 L;  1IYJ B;  1DD2 A;  1SJE D;  2UUC Q;  4PG3 A;  1TWC H;  3KLR A;  1Q7Y C;  3FKI G;  3RLF A;  4RCN A;  1XNQ Q;  1XYI A;  2L15 A;  1D5M C;  2F0Q A;  1X54 A;  2JA5 H;  2ICE C;  3K5M A;  1QB5 D;  1VS0 A;  1KIX A;  2H1E A;  4ZKC B;  1X3F A;  3GTP B;  5CYU A;  3R3O A;  2F0E A;  1Z9F A;  2PMZ B;  5H1S E;  4ZRZ A;  3HFZ B;  3S14 B;  2UXC Q;  5I9P A;  4APV A;  2EJF C;  1EWC A;  4H44 C;  1BO0 A;  4FO2 A;  1B70 B;  5CMD A;  5I4D A;  3S15 B;  1EIF A;  3HOW B;  5CV8 A;  1VQ8 A;  4BWG B;  3G71 A;  2O2L D;  4DV1 Q;  4BBS G;  2JA6 H;  3J81 c;  1ZYR C;  1TY0 A;  1WTO A;  4MZ9 A;  2ID0 A;  2FIN B;  3HOU G;  3VDY A;  4OO1 H;  3M4Q A;  1VQ4 A;  3MEH A;  1X65 A;  5C4X H;  1KDA A;  2PZW A;  1B3Q A;  3OMG A;  4JVZ A;  1V8Q A;  2B2U C;  1DGS A;  2M00 A;  1PA6 A;  5IYD H;  4DFA A;  5BN3 A;  4YY3 Q;  3MC0 B;  1O80 A;  3F1Z A;  1EOV A;  4UAI A;  3PQI A;  5C5L A;  4Y52 H;  3T51 B;  5FJ8 H;  3SXH A;  4FVM A;  1YJ9 A;  4UP7 A;  4JYA L;  2PQA A;  4R4Q A;  1HTP A;  4HCE A;  1G6Z A;  3URY A;  3BYT B;  4A3J H;  1IBK L;  4LFA L;  2ENB A;  3PIP A;  5LMN W;  4KTA A;  3U4V A;  4C2M B;  1N34 Q;  5EKL A;  1HNX L;  4Q5V A;  3HOZ G;  2JA8 B;  1BCP D;  5COR A;  4DR3 Q;  1PRT B;  1MI2 A;  4IFD I;  3GTQ B;  1FNU A;  1NBW A;  2YYZ A;  2E2I B;  2G9H D;  1YI2 A;  1SYC A;  4RHS A;  1PMR A;  3DWQ A;  1TWG B;  1D5Z C;  3K7U C;  2O5I C;  3PUX A;  1VMP A;  5C4Z A;  1JWU D;  1ESF A;  3PIO 3;  3BZC A;  3KDF A;  3HOX B;  4A3K B;  3CD6 A;  1GHJ A;  2C9O A;  2XGT A;  3DEP A;  3DXJ C;  4AYB B;  4OON A;  4P73 A;  2WKD A;  1RIP A;  5C3X A;  4QGU A;  2KQ3 A;  1EQQ A;  1I50 H;  4YWM A;  4IAL A;  4RFB A;  1HR0 L;  1PZJ D;  3HKS A;  3I73 A;  4LF4 L;  2WII B;  4ZK9 B;  3KBX A;  4XYQ A;  3K5N A;  2BDN A;  1RKN A;  3D6W A;  4TKO B;  4XQJ A;  4YHH L;  2B2T A;  3S16 H;  1EEF D;  4GOP C;  3AB9 A;  4KN4 C;  2BDO A;  1FJG Q;  2AWN A;  4HED A;  4ULL A;  4RH6 A;  1G2T A;  1CHP D;  2EYM A;  1UEB A;  1U0L A;  4IO9 A;  1HNZ Q;  1YZ6 A;  4JI5 L;  1HUM A;  4JOI A;  1I4P A;  1PTO C;  3U50 C;  1EIY B;  1YBY A;  2JEB I;  3FP9 A;  4JI2 Q;  5KNB A;  1J9O A;  1HRJ A;  3R2I A;  2LFN A;  1CA5 A;  1O7Y A;  2EVB A;  3L2P A;  3A8J E;  1X3E A;  4JI4 L;  4DAM A;  4C3J B;  2DJG C;  2ZM6 L;  1JB7 A;  4TVA B;  3ZYY X;  1HZB A;  4X62 Q;  2A69 C;  3W5O A;  3M3Y H;  3QR8 A;  5T1G A;  3PUV A;  5ISR A;  5IGF A; 
#chains in the Genus database with same CATH homology
 3S1R H;  4B3M L;  3TRZ A;  1EWI A;  2BH2 A;  3GTK H;  4PMW A;  1E1O A;  4YCV A;  5LMN Q;  4DR3 L;  1SRU A;  2WAQ E;  1FGU A;  1MKH A;  3RLO A;  2H5X A;  2QA4 A;  4JI6 Q;  2UU9 Q;  2WFW A;  2JA5 G;  3CCU A;  3S1Q H;  4DUY Q;  4BXX H;  1PH3 A;  4OWW B;  2D0O A;  2IY5 B;  2YV5 A;  3PV0 A;  3UDX A;  1PH8 A;  4RMF A;  4HJ7 A;  3CXC A;  3UDF A;  4K0K L;  4DR6 L;  4IPD A;  3KLW A;  4BBR G;  2KHI A;  4DUZ L;  1PH2 A;  1R9T H;  3GTP H;  3EBE A;  3E9H A;  3JAM c;  4LF6 Q;  1PH1 A;  4UY8 C;  3S14 H;  2R7F A;  1VQG A;  5GQO A;  4HIK A;  2Q2H A;  3CC2 A;  5IYB G;  1CSP A;  4DNI A;  2ES2 A;  3ICE A;  4LF7 L;  1UE7 A;  4OWX B;  3CCQ A;  1VQB A;  1O7I A;  3GO5 A;  2BA1 A;  3L7Z C;  2Q2T A;  5M3F H;  3CCV A;  4R1J A;  1YJW A;  3S15 H;  3PSI A;  2UXB Q;  1GD7 A;  2B29 A;  4UP8 A;  2F3I A;  4DR2 Q;  3HOW H;  2R6G A;  2N49 A;  2JA6 G;  4DR1 Q;  2ZJP A;  4GS3 A;  1PH5 A;  3CCM A;  1UE5 A;  1VQL A;  5GAE C;  1WJJ A;  4JG2 A;  3L0O A;  1VQE A;  1Q82 C;  2JJQ A;  1CUK A;  1WCM H;  5ELN A;  1SLJ A;  2NZH A;  3GTJ H;  5HY6 A;  3J7A 5;  5FLX c;  2A8V A;  4BY7 H;  3CF5 A;  2ZJR A;  1S3O A;  4P72 A;  1NY4 A;  4PZ6 A;  4A3F H;  3AYH B;  4NPS A;  2UUC L;  4OO1 G;  4DK3 C;  4AQY L;  5C4X G;  4AH6 A;  1XNQ L;  3TS2 A;  1BBU A;  4C3I H;  1PH6 A;  2GVA A;  2MO0 A;  4YWL A;  1X9N A;  1KRS A;  1Q46 A;  4YWK A;  3HOY H;  5IYD G;  3PO3 H;  2R93 G;  3NEN A;  3G4S A;  1YEZ A;  4A3D G;  5IY0 A;  2Q2U A;  4B3S Q;  1Q12 A;  1SN8 A;  2K4K A;  4UPA A;  4DV4 L;  4JI2 L;  2UXC L;  3RNU A;  5M5Y H;  2K5H A;  3M85 A;  3CCE A;  1Q81 C;  4IFD G;  2F4V Q;  2K5N A;  2QGQ A;  1A63 A;  2MNA A;  4LF9 L;  2VS1 A;  2RHS B;  1AE2 A;  4B3T Q;  1OXS C;  1S72 A;  1X55 A;  4DV0 Q;  1HR0 W;  2UUA Q;  4JI3 Q;  2ASB A;  2RF4 A;  3CC7 A;  4NB3 A;  5FJ8 G;  5BR8 L;  1VQO A;  2IX0 A;  2VQF Q;  4DV6 Q;  1UE6 A;  2OQ0 A;  4GOP A;  2KCM A;  2N3S A;  1YHQ A;  4A76 A;  4LF5 Q;  4X62 L;  5IP9 G;  3ERS X;  3BJU A;  3KJO A;  2JE6 I;  4OWT B;  1GM5 A;  5IE8 A;  4A3I H;  2MO1 A;  4QIW E;  4O0A A;  1VQI A;  1IBM L;  3I4N G;  4A3L H;  4X66 L;  3FKI H;  4LF8 L;  2K5V A;  4A3J G;  4JI0 L;  3W1G A;  4QY7 A;  2VQE L;  1VQ9 A;  1WI5 A;  1A62 A;  1KRT A;  2B63 H;  4YCU A;  1CSQ A;  3U58 A;  3H0G G;  3CCL A;  4HJ8 A;  2E5L L;  3H3V H;  4C2M H;  3ER0 A;  3A74 A;  2Q2I A;  1QVF A;  1X3G A;  2JA8 H;  4HJ5 A;  2HT1 A;  3UE1 A;  1X6O A;  4IJL A;  1N36 Q;  4B3R L;  3GTQ H;  4JBJ A;  1Y1V G;  3KOJ A;  2E2I H;  2PI2 A;  3OTO L;  4DR5 Q;  1XPR A;  1Q1B A;  5GAD C;  2EXD A;  2GVB A;  4YY3 L;  4DV2 Q;  2KHJ A;  2R92 G;  4L5T A;  2Y0S G;  1VQF A;  2ALY B;  1TWG H;  2BA0 A;  3DLL A;  4JYA Q;  2K75 A;  4HID A;  3KJP A;  5C0X J;  3HKZ G;  3CCJ A;  4JBM A;  2UUB L;  3TQY A;  4A3B H;  4BBS H;  4DR7 Q;  4GNX A;  3HOX H;  5JJK A;  4A3K H;  2E2H H;  2WB1 G;  4UP9 A;  5K36 G;  1HZA A;  1IBK Q;  5IYC G;  5LMU Q;  2OTL A;  2K52 A;  1HNZ Q;  3PF5 A;  1EYG A;  3HOU H;  3B6Y A;  3GTM H;  3HOV G;  2JA7 G;  2HQL A;  2Z6K C;  3H3V I;  1HNX Q;  1I3Q H;  1KAW A;  4GN4 B;  4R4T A;  2OTJ A;  2CFM A;  1Q8K A;  2CWA A;  4LFB Q;  2LSS A;  1FL0 A;  3FHW A;  3T1Y Q;  2OCE A;  4DR4 L;  3T1H Q;  3I4O A;  3TS0 A;  3AFP A;  3J81 i;  2WP8 J;  3F2D A;  3PGZ A;  5IP7 G;  2YTX A;  4EX5 A;  1J5E Q;  4BY1 H;  5M3M G;  4KLK A;  1N34 L;  1XMQ L;  2V1C C;  1N32 Q;  4GNX C;  2K50 A;  4X65 Q;  1L1O B;  4BA1 I;  2OWO A;  5DLQ E;  4HJ9 A;  1XMO Q;  4A3G G;  1I6H H;  2ZTC A;  3G48 A;  4OXP A;  1I94 L;  4KHP L;  1OXV A;  3PIO A;  3RR5 A;  4DV5 L;  1PV4 A;  1K3R A;  1M90 C;  3M7N A;  2F52 A;  4GKJ Q;  3NEL A;  4IPG A;  4A3E G;  1IXR A;  2WAQ G;  4NXN Q;  4GKK L;  4JC0 A;  2KBN A;  1XPU A;  1B7Y B;  1OXU A;  4MTN A;  1AE3 A;  1YHA A;  3PCO B;  2UXD Q;  3BZK A;  4AYB E;  1V9P A;  1WYD A;  2OQK A;  4TQU S;  1PH7 A;  3GTO H;  4IFD J;  2UUA L;  4A93 H;  3RN5 A;  4A3M H;  1MJE A;  1T9H A;  1W2B A;  4GLA C;  2JA9 A;  2CKZ B;  5E7N A;  4L5S A;  3AFQ A;  2NVQ H;  4LF4 Q;  1HR0 Q;  5HGQ A;  5EAY A;  4DV6 L;  3LGJ A;  1VQK A;  4WJ3 M;  2R7Z H;  1E3P A;  1LUZ A;  2N78 A;  1E1T A;  2PI2 E;  3F2B A;  3ULJ A;  4C3J H;  1IBL Q;  4YHH Q;  3S17 H;  1C7Y A;  4X6A H;  4X64 Q;  4AIM A;  1CKO A;  3RZD H;  3PF4 A;  5C3E G;  3HOZ H;  5C0X I;  3KFU A;  2NZO A;  3STB D;  1K9M C;  3S1N H;  2VUM G;  5FLM H;  1AH9 A;  2R93 H;  1OTC A;  2VNU D;  3GD7 A;  3CPF A;  3CPW A;  3GDE A;  3I55 A;  3AEV A;  2KCT A;  3K7A H;  3J80 i;  2PQA B;  4YCW A;  3A5Z B;  4IOA A;  4GN5 A;  1XNR Q;  1C0A A;  2VW9 A;  3AQQ A;  1N36 L;  1FJG L;  3KF6 B;  5ELO A;  2AMC B;  1M1K C;  4JV5 Q;  3TRE A;  5IWA Q;  1VQ7 A;  4DR5 L;  4LW1 A;  3S2H H;  2VZA A;  1KC8 C;  1HNZ L;  1VQ6 A;  4LFC L;  2D0P A;  4DV7 Q;  4A3C H;  4JI4 Q;  4DR7 L;  1QVG A;  4P75 A;  1WOC A;  5AJ3 Q;  1PVO A;  1Z47 A;  2IT1 A;  2ZM6 Q;  1K0R A;  3KYH C;  3J80 c;  1A8V A;  4LUV A;  4DV3 Q;  1YJN A;  4JBW A;  2BH8 A;  2E8G A;  2JK8 A;  4FDB A;  3I4M H;  2FXQ A;  1MIU A;  4J15 A;  4HIO A;  1YIT A;  4OX9 L;  5M3F G;  1N33 L;  3D0F A;  1HNW Q;  1FVI A;  1KHI A;  1PHJ A;  2HHH L;  3HOW G;  3UDG A;  1Y1W H;  4LFB L;  1I5F A;  1OXT A;  1YIJ A;  1K83 H;  1E24 A;  2ZTE A;  1SRO A;  2QEX A;  1MJC A;  3EIV A;  3KDF B;  4L5Q A;  3S1M H;  2ZTD A;  4BY7 G;  1TXY A;  4K0K Q;  4P71 A;  5LMN L;  4DR6 Q;  4A3F G;  2I5M X;  4Y7N H;  3CME A;  1VQM A;  2XTI A;  4JI6 L;  2UU9 L;  2RHQ B;  4DAY B;  1CKN B;  5GAG C;  1VQD A;  4DUY L;  1QZG A;  4NXM Q;  1NTG A;  3K81 C;  3OYY A;  3HOY G;  1PYB A;  3PO3 G;  2AWO A;  4NXN L;  1QUQ B;  4JI7 Q;  4LF7 Q;  1RL2 A;  1V43 A;  4LNQ A;  2Z6K A;  1OXX K;  2NN6 I;  1BBW A;  4PZ8 A;  5JJL A;  3A5U A;  1QVC A;  3J81 j;  4PZ7 A;  4LF6 L;  1XJV A;  1G29 1;  1JJ2 A;  4POG A;  2JA7 H;  1JJC B;  2I5L X;  1NMF A;  2RCN A;  4JBK A;  1SR3 A;  1VQH A;  4R4C A;  5M5W H;  1SFO H;  1HZ9 A;  1EQR A;  5C44 H;  4JI8 L;  4QL5 A;  2IHF A;  3PO2 H;  3K8A A;  2Z0S A;  2UXB L;  1ASZ A;  1G6P A;  3PUZ A;  2B3G A;  4LFA Q;  4KI0 A;  4LUZ A;  5GAH C;  1UWV A;  5JEA G;  4DR2 L;  4DR1 L;  1IYJ B;  1NMG A;  4A3I G;  2Y0S E;  2UUC Q;  4PG3 A;  1TWC H;  1Q7Y C;  4A3L G;  4AQY Q;  1H95 A;  2MQH A;  3FKI G;  3RLF A;  1XNQ Q;  2NVT H;  4L5R C;  2L15 A;  1NJI C;  1X54 A;  1PH4 A;  2JA5 H;  4LUO A;  3J7Z C;  2PNH A;  2B63 G;  1X56 A;  4IOC A;  2JEA I;  1VS0 A;  1LM0 A;  1SMX A;  1KIX A;  3JC6 6;  1X3F A;  3GTL H;  4JV5 L;  3RLN A;  4BBR H;  2JA8 G;  1CKM A;  1Z9F A;  5H1S E;  2UXC Q;  3HFZ B;  1BKB A;  1VQA A;  1PFS A;  4LF9 Q;  4APV A;  1LTL A;  3ULL A;  4XIG S;  5IYB H;  2I5H A;  4RG1 A;  4B3S L;  1B70 B;  4R4I A;  4A4I A;  5AJ3 L;  1UE1 A;  1EUJ A;  1EIF A;  3U4Z A;  2F4V L;  4XTC S;  3ZJY C;  4HJA A;  1L1O A;  5IT9 c;  4A3B G;  4IPC A;  1VQ8 A;  4BBS G;  3G71 A;  1SE8 A;  1P8L A;  4DV1 Q;  4QJF A;  1PH9 A;  4JI3 L;  4DV3 L;  4B3T L;  4DV0 L;  2JA6 H;  3K80 C;  5C4J H;  3HOX G;  3J81 c;  4A3K G;  1K8A C;  1IBM Q;  3G6E A;  4POF A;  4X66 Q;  3CCS A;  1HNW L;  4AYB G;  4JI0 Q;  2VQE Q;  4MZ9 A;  2ID0 A;  2VQF L;  1B8A A;  3HOU G;  1VQP A;  4LF5 L;  3ULP A;  3RN2 A;  1P16 A;  3VDY A;  2E5L Q;  4BA2 I;  2K14 A;  3M4Q A;  2N8N A;  1VQ4 A;  1X65 A;  5C4X H;  4H02 A;  1HJP A;  2HIX A;  3MXN B;  3I56 A;  1VQJ A;  4B3R Q;  1L1O C;  1HH2 P;  1C9O A;  4BY1 G;  4MNO A;  1DGS A;  3OTO Q;  1S40 A;  1PA6 A;  5IYD H;  4YY3 Q;  3S24 A;  4A3D H;  1GKH A;  3PUW A;  5C0X G;  3IRB A;  3I7F A;  4JI5 Q;  4NXM L;  3F1Z A;  1K73 C;  3F2C A;  1EOV A;  3TEH B;  1HZC A;  2DUD A;  4JI7 L;  1V1Q A;  2UUB Q;  1NE3 A;  4BXX G;  1YHB A;  4DV2 L;  2R7D A;  4Y52 H;  2LXJ A;  5FJ8 H;  3UDI A;  4JI1 Q;  3OW2 A;  1YJ9 A;  4C3H H;  1D7Q A;  4UP7 A;  3CCR A;  1J6Q A;  2PQA A;  3KF8 B;  4JYA L;  3CC4 A;  2NVY H;  2NVX H;  4A3M G;  4QQB X;  4R4Q A;  4A93 G;  5IP9 H;  3KF6 A;  4OO1 I;  4DKA C;  3I4N H;  1JMC A;  2GN5 A;  2A19 A;  2R7Z G;  3BU2 A;  3K0X A;  3W1B A;  4A3J H;  1IBK L;  5LMU L;  4LFA L;  1YVC A;  5GRO A;  4DR4 Q;  1JE5 A;  3PIP A;  5LMN W;  3MEF A;  3PUY A;  2DGY A;  4JI8 Q;  3U4V A;  1N34 Q;  1XMQ Q;  2E2J H;  1HNX L;  2YU9 H;  4B3M Q;  3H0G H;  1A0I A;  3HOZ G;  3S2D H;  5JEA J;  1TWH H;  2PMZ E;  4DR3 Q;  2JQO A;  1ASY A;  5FLM G;  4IFD I;  1I94 Q;  2D62 A;  4GN3 B;  4KHP Q;  1NBW A;  3T1Y L;  2YYZ A;  3T1H L;  4DV5 Q;  1YNX A;  1WCM G;  3NEM A;  1YI2 A;  1Y1V H;  1J5E L;  1GO3 E;  1N32 L;  1EFW A;  2KEN A;  3EN2 A;  4GOP B;  4GKK Q;  4P74 A;  4X65 L;  2A1A A;  1Q1E A;  3NBH B;  2R92 H;  3H15 A;  1XMO L;  2HIV A;  3K7U C;  1XTD A;  3I2Z A;  3PUX A;  4DUZ Q;  1TWA H;  1L0W A;  1JJG A;  1KL9 A;  1IL2 A;  2CWP A;  3BZC A;  3KDF A;  4GKJ L;  4O2D A;  3CD6 A;  4JCV E;  2XGT A;  3CP0 A;  1IZ6 A;  1E7Z A;  4A3C G;  4OON A;  4P73 A;  2UXD L;  1RIP A;  3F8T A;  1VQ5 A;  4DV1 L;  4WJ4 A;  5IYC H;  1PYS B;  4QGU A;  3WWV A;  3CQZ H;  1EQQ A;  3HOV H;  4IPH A;  1I50 H;  3CW2 C;  4YWM A;  4HIM A;  1CKN A;  4LF4 L;  1HR0 L;  3HKS A;  4R4O A;  2NN6 G;  2CCZ A;  3I4M G;  1QUQ A;  1VQN A;  4DPG A;  3CAM A;  4IJH A;  3STB C;  1IBL L;  4YHH L;  5IP7 H;  4X64 L;  1Y1W G;  5M3M H;  4GLV B;  3S16 H;  1WFQ A;  1D8L A;  3M4P A;  4A75 A;  1KD1 C;  1QZH A;  1GVP A;  2AHO B;  4GOP C;  2IHE A;  4A3G H;  1G51 A;  2VL6 A;  1FJG Q;  1BVS A;  1U5K A;  2VY3 A;  1E22 A;  1VCI A;  2AWN A;  5J3B A;  1Y14 B;  3DM3 A;  4GNX B;  5JJI A;  3HKZ E;  4KHZ A;  2IX1 A;  1UEB A;  1U0L A;  4LWC A;  4IO9 A;  1TWF H;  1YZ6 A;  1W3S A;  2C35 B;  4JI5 L;  2CQO A;  4JOI A;  4ME3 A;  4A3E H;  1KQS A;  2EIF A;  3A0J A;  3E9I A;  1N8R C;  5M5X H;  4LFC Q;  3U50 C;  2WB1 E;  1YBY A;  1EIY B;  2ZJQ A;  1XNR L;  2JEB I;  2ATW A;  3FP9 A;  1VQC A;  2YTV A;  4DV4 Q;  4JI2 Q;  5IWA L;  1Q86 C;  4DK6 C;  1XPO A;  1KXL A;  3L2P A;  3M9B A;  2I0Q A;  1X3E A;  3GTG H;  4JI1 L;  3RZO H;  1LYL A;  3M4O H;  2YTY A;  4ALP A;  4DV7 L;  4EQ5 A;  4JI4 L;  3SGI A;  5BR8 Q;  2LXK A;  4DAM A;  4OX9 Q;  1N33 Q;  2HHH Q;  2ZM6 L;  1JB7 A;  4TVA B;  3E0E A;  3CMA A;  1K8G A;  1HZB A;  5C3E H;  2EQS A;  3D31 A;  4X62 Q;  2MFI A;  4JOI C;  3W5O A;  3M3Y H;  1L2F A;  3Q8D A;  4GLX A;  5C44 G;  3UE0 A;  3PUV A;  2VUM H;  1JT8 A;  3JAM i;  3PO2 G;  2AKW B;  1N9W A;  4LF8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...