3EIVA

Crystal structure of single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
98
Chain Sequence
ETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPDGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSRTVYELDVDEVGASLRSATAKVTKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the single-stranded DNA-binding protein from Streptomyces coelicolor.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein 2
total genus 16
structure length 98
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3eivA00
4OXPA 2V1CC 2MQHA 3B6YA 5BR8Q 1HNXL 1JMCA 5JJKA 1EYGA 3I4MG 2LXJA 1WCMH 5GAHC 2D0OA 5ELOA 1OXUA 4LFCQ 2F52A 3W1BA 2MNAA 5IYBG 1VQIA 2H5XA 3TRZA 1N32Q 1YVCA 2BH2A 1PH5A 2JJQA 1D7QA 4LUVA 3A0JA 5LMUL 1BKBA 2CWPA 3BZCA 1WOCA 1A63A 1VQOA 4DR4Q 3ULJA 3ULLA 4A3EH 4A3CH 1PYBA 3FKIH 3J7A5 5M3MH 2KCTA 1VQPA 2YTXA 1EFWA 4JI5Q 4BA1I 1KC8C 2VW9A 1PVOA 4JC0A 3A5UA 2Q2UA 4X65L 4MZ9A 4IOCA 4K0KL 3ZJYC 1FL0A 3RN2A 1PH9A 2BA0A 2UUAQ 4A3GG 1C0AA 3S2HH 4AIMA 2UUCL 3GTOH 1UE5A 1AH9A 3RZDH 4JI8Q 2N3SA 4LUOA 3RLNA 3KDFB 1N9WA 4NXNQ 4BY1G 3KYHC 2MO1A 2E8GA 1TXYA 3K8AA 5FJ8H 3A5ZB 2B29A 5C44H 1Q1BA 3J80c 4DR4L 2UXBL 1YNXA 4LF5L 3OTOL 3OW2A 3WWVA 4NXMQ 2ATWA 4DV3Q 4L5SA 4A3GH 4PZ6A 2L15A 2K5NA 1U0LA 3S1RH 4LF5Q 3M7NA 1YI2A 1SFOH 4OWWB 1TWHH 2NVQH 4A3LG 4O0AA 4UPAA 5M5YH 4YY3Q 3CPFA 1XPRA 4A3FG 1K0RA 4DAMA 1Y1WH 3K81C 1YITA 1HNXQ 3HOXH 1WCMG 4YCVA 1PH7A 2PQAA 4JI8L 1K83H 1X56A 1X65A 4LF4L 2VNUD 3K7UC 3AEVA 4B3MQ 1Q81C 1YJ9A 4BBSH 1IL2A 2D0PA 4JG2A 4A3DG 1QVCA 2ZTCA 4KHZA 1P8LA 3IRBA 2K4KA 3J81i 4DKAC 3CF5A 3PO2G 2N8NA 4P74A 3CCSA 4AQYQ 4DV2Q 1VQNA 5IYCG 2AWOA 1VQ4A 4C2MH 1GM5A 4JYAL 2Y0SE 1B70B 1KAWA 1WYDA 4YWMA 4IJLA 4A76A 2KCMA 2MFIA 3RNUA 4LF6L 3M85A 4GLAC 3G4SA 3CXCA 1IBML 4A3KH 3JC66 1GO3E 3CCJA 3GO5A 3J80i 1R9TH 4QL5A 3FP9A 4DR3L 3TS2A 4O2DA 3RLOA 4DV7Q 1KL9A 2VS1A 3MEFA 2UXDQ 4A3DH 2Z6KC 2Q2HA 1J5EL 1BBUA 1I5FA 5JEAG 4DV1L 1I6HH 1PH1A 2VUMH 4A3BG 2OTJA 4LFCL 1S72A 3CCQA 2HIXA 1VQ9A 4GKKQ 2GVBA 2KENA 2RHSB 1E1OA 4R4IA 1O7IA 3I2ZA 3U50C 5BR8L 2HHHQ 1FJGL 1XNRL 4BY1H 4LFAQ 4DAYB 2UU9Q 3I7FA 1E3PA 2IX0A 1XMOQ 1K9MC 1XJVA 1JJGA 3KLWA 1M90C 1OXTA 4QGUA 3MXNB 2YTVA 4LW1A 1TWFH 1UE6A 1VQHA 3M9BA 5M3FG 4B3RQ 3PUYA 1PYSB 4GNXC 4EX5A 2QEXA 3TS0A 1PH4A 4DR6L 1H95A 4YCUA 3CMAA 4JBJA 1HJPA 2JA5G 4BXXH 2YV5A 2Z6KA 3K80C 3F2CA 1YBYA 2R7DA 5IP9G 3HOYH 1FVIA 4R4CA 4GN4B 1TWGH 1EIFA 2R92G 1PHJA 1J6QA 4GS3A 3RLFA 3PIOA 1VQ7A 4DV6Q 4OO1I 5LMNW 1K73C 5IYDH 1I94Q 3TEHB 4H02A 1PH6A 4A75A 1X54A 1IXRA 3T1YL 1PH2A 4LF7Q 1X9NA 3TQYA 2Z0SA 2Y0SG 1JE5A 5JJLA 3TREA 1LM0A 4JCVE 1IBLQ 2R7ZH 3Q8DA 5IWAL 3K0XA 1A0IA 1V9PA 3E0EA 2ZJPA 1XMOL 3UDFA 2JA8G 1X3GA 3HKSA 4AYBG 5IYDG 3J7ZC 2UU9L 1HZ9A 4TQUS 4DUYQ 4GOPA 4LF8Q 3KF8B 1XNRQ 4GN5A 4OONA 1UE7A 5EAYA 3UE0A 1JB7A 4R4QA 2K5HA 2YYZA 1CSPA 5J3BA 4OX9L 2ZJQA 2XTIA 1ASYA 1WI5A 2UXDL 4HIDA 5E7NA 4DV7L 3F2DA 3GTLH 4AYBE 3HKZE 3BU2A 1W3SA 2KBNA 5IY0A 2QA4A 4DR7L 4HJ7A 3L2PA 1M1KC 1JJCB 5C4XH 3I55A 1UEBA 1PA6A 3I4NH 1A8VA 1LTLA 3D31A 5FJ8G 1NBWA 5AJ3L 1I3QH 5C44G 3HOUG 2R6GA 3ULPA 3S15H 4DV2L 3S2DH 3LGJA 2IT1A 3D0FA 1E22A 3W5OA 2A8VA 1X55A 2JA6G 4Y52H 3CMEA 1K8GA 4X66Q 4JI4L 1QZGA 5HY6A 2B63G 2R92H 1G6PA 2VUMG 3ER0A 3I4NG 4JI2L 3STBC 1Y1WG 1VQFA 1ASZA 3PF5A 3JAMi 1P16A 3UDXA 3PUWA 5M5XH 2JK8A 1K8AC 4DUZL 2HIVA 2WAQE 3GTKH 2E2JH 2NVYH 3KJOA 4LF9L 1VQKA 3PF4A 3S14H 3J81j 1HNWQ 4WJ3M 2ZM6Q 4DV3L 3GTJH 5M3FH 4NXML 4UP8A 4JV5Q 5GADC 3OTOQ 1GVPA 4YWKA 4UP9A 4GLXA 1YHAA 3W1GA 1QVGA 2A1AA 4A3IH 2I5MX 1L2FA 1SLJA 1YJNA 2WAQG 3A74A 4NXNL 5LMNL 4DV0L 2JA7H 4GKJQ 4JI2Q 2XGTA 3GD7A 4L5QA 2F4VL 4RMFA 2NN6G 4AH6A 4JI0Q 2ZTEA 4JI6Q 1VQDA 4LWCA 3G48A 4X66L 3CC4A 4JI7Q 1HR0L 2MO0A 2VY3A 1B8AA 1VQAA 2DGYA 2OQ0A 4NPSA 1U5KA 3J81c 1G51A 2IHFA 3OYYA 1HH2P 4L5TA 4YWLA 3KFUA 1BBWA 2B3GA 2UXCQ 3CW2C 5M3MG 4GNXB 1L1OB 3T1HQ 3CPWA 4GOPC 1LUZA 3CC7A 1UE1A 2ASBA 1KRSA 3PCOB 1WJJA 1L1OC 3H15A 4GOPB 4DR7Q 1Q1EA 1VS0A 2QGQA 4XTCS 5GAEC 2JA6H 5LMUQ 4HIKA 1NTGA 2AKWB 3BZKA 1OXSC 4C3HH 3UDIA 2UUBQ 2K5VA 1PFSA 3U4VA 4DK3C 3RR5A 4FDBA 1DGSA 4JBKA 3CCVA 3H3VH 4B3SQ 2LSSA 1V43A 1IZ6A 1IBKQ 4PZ7A 1XPOA 1MJEA 1I50H 1HNZL 4DUYL 5JJIA 1N32L 1SROA 4IPGA 3RZOH 2WB1E 3CCUA 2C35B 1IBLL 5C3EG 2BH8A 3GTPH 2GN5A 2E2IH 2Q2TA 1NJIC 3S1NH 3KJPA 3EIVA 4B3TQ 2CKZB 4QY7A 3M4PA 5GAGC 1CKNA 1Q46A 5HGQA 3HOVG 4LUZA 1EIYB 5C4XG 1Q8KA 2IHEA 3H0GG 4GNXA 2R93G 4X62Q 1B7YB 4DK6C 1I94L 1N36Q 2VL6A 4XIGS 2WB1G 1KHIA 2VQFL 2NVTH 1SRUA 4YHHL 1T9HA 3ERSX 4HJAA 2PMZE 1N33Q 1X6OA 1QVFA 3HOZG 2R7ZG 2CWAA 1N8RC 4P71A 4YHHQ 4DV4Q 4DV5L 4RG1A 1YZ6A 2PNHA 4UY8C 3G71A 3GTGH 1V1QA 1Z9FA 4X62L 2YTYA 4PZ8A 3ICEA 1XMQQ 4A3MH 1GKHA 3KOJA 4A4IA 3H0GH 2R93H 1KIXA 1IYJB 4JI3L 3S1MH 4HIOA 4A93H 3NENA 4EQ5A 5FLMH 3PO3H 4JOIA 2CCZA 3S16H 5IT9c 4QIWE 2NN6I 1CUKA 2JE6I 1FGUA 2RF4A 1S3OA 1SR3A 2AWNA 3CP0A 2FXQA 1Q86C 1XNQL 4A3LH 1OTCA 2ALYB 4LFAL 4P73A 4LNQA 1BVSA 2HHHL 1FJGQ 1VQCA 2K75A 1IBKL 4GKKL 4WJ4A 4A3IG 3DLLA 4B3SL 3HOUH 4Y7NH 1XMQL 4IO9A 5K36G 4DR5L 4DV1Q 2PI2E 1MJCA 1K3RA 3HOWG 1PH8A 4IFDJ 3PO3G 1YJWA 1J5EQ 3S1QH 2UUBL 5C0XG 1VQBA 4DV4L 4QQBX 4C3JH 3KDFA 3PV0A 4DR2Q 4DR1L 3PUVA 1L1OA 4DR3Q 1VQ8A 4BY7G 4HIMA 1Y1VH 1QUQB 4NB3A 4OWTB 2CQOA 3AFPA 4HJ8A 1NY4A 2VQEQ 2K52A 4LF6Q 3I4MH 2UXCL 1EQQA 4IPCA 1MKHA 5C0XI 1HZBA 4JYAQ 4KLKA 1SE8A 4R1JA 3UDGA 1YHQA 1Q12A 1HR0Q 3M3YH 2K50A 4X64L 3U4ZA 1VQMA 4BY7H 2WP8J 3CAMA 1YIJA 4B3ML 4JI6L 4A3JH 2JEBI 3F2BA 4LF4Q 1AE3A 5DLQE 1L0WA 4A3EG 4POGA 4A3CG 3FKIG 2R7FA 4POFA 2AMCB 1TWCH 1HNZQ 3CD6A 1UWVA 4GKJL 3HOXG 4DV0Q 4TVAB 3SGIA 4YY3L 3CCRA 4LFBL 1Q82C 3STBD 1KQSA 3CC2A 4KHPL 4OWXB 1EUJA 2JEAI 2E5LQ 3CCLA 3CQZH 2ZM6L 4IJHA 4P72A 3CCMA 1HNWL 4LF9Q 3CCEA 3AQQA 2UXBQ 5IYCH 5FLXc 2I5HA 3I56A 1CKMA 3GTQH 4BXXG 4PMWA 3U58A 3T1HL 2E2HH 5JEAJ 1VQ5A 4IFDI 2D62A 1VQEA 2WFWA 4J15A 2I0QA 5IYBH 2UUCQ 4IPHA 5ELNA 5H1SE 4L5RC 5IP7H 1Q7YC 4JI4Q 2K14A 2KHIA 1PH3A 2F3IA 1YEZA 2PQAB 4JI7L 2UUAL 2N78A 3HOZH 1Z47A 4K0KQ 4JI0L 4X65Q 1QZHA 1Y1VG 5AJ3Q 1RL2A 2F4VQ 4IFDG 1NMGA 4APVA 2HQLA 1CSQA 4JI5L 4DNIA 4MNOA 5LMNQ 1SMXA 4MTNA 1EQRA 3H3VI 2OWOA 5IP7G 4JV5L 4A93G 1X3FA 3UE1A 5FLMG 4HJ9A 5C3EH 2JQOA 1GD7A 3PO2H 2E5LL 1KD1C 1PV4A 4OX9Q 4DUZQ 4KHPQ 2N49A 3KF6B 4HJ5A 4LFBQ 3G6EA 1C7YA 3HOWH 3NELA 4IOAA 3M4OH 1CKNB 1LYLA 1QUQA 2EXDA 3HOYG 2EIFA 5IP9H 5GQOA 5M5WH 4JI1L 2YU9H 3M4QA 5IWAQ 1HR0W 1EWIA 1RIPA 2EQSA 4QJFA 2IX1A 4X64Q 5GROA 2I5LX 1E7ZA 1N34Q 3NEMA 1E24A 2RHQB 1Y14B 4A3BH 2ZTDA 1A62A 3PGZA 4OO1G 4R4TA 4KI0A 3AYHB 2VQEL 1HZCA 4BBRG 2AHOB 4ME3A 3NBHB 1SN8A 2LXKA 1JT8A 4DV6L 3L7ZC 4IPDA 3E9IA 4DR1Q 4DR2L 1MIUA 4BBSG 1YHBA 3F8TA 4GLVB 2DUDA 4DPGA 2GVAA 2NVXH 1VQJA 4DR5Q 2B63H 3FHWA 4X6AH 1VQGA 3AFQA 3GDEA 2Q2IA 3I4OA 4GN3B 2JA5H 2RCNA 1EOVA 3E9HA 1WFQA 4LF8L 2JA9A 3S24A 4BBRH 3VDYA 1KXLA 1AE2A 3BJUA 4A3KG 4JBWA 1XNQQ 1XTDA 4P75A 2OTLA 1VQ6A 3L0OA 1G291 5IE8A 3EN2A 1C9OA 1VQLA 2A19A 4ALPA 5C0XJ 1VCIA 4A3FH 2ES2A 2JA7G 2CFMA 4JI3Q 2ZJRA 2IY5B 3JAMc 4A3MG 4LF7L 3T1YQ 1XPUA 1CKOA 1W2BA 3S17H 1JJ2A 2OQKA 1X3EA 1KRTA 4DV5Q 3PIPA 4R4OA 4JBMA 2ID0A 4UP7A 4C3IH 4A3JG 1N33L 3GTMH 3PUZA 2JA8H 4JOIC 2VQFQ 1IBMQ 1OXVA 1N36L 1HZAA 2NZOA 3HFZB 3HOVH 4DR6Q 3EBEA 3F1ZA 2VZAA 1NMFA 1TWAH 3PUXA 4AQYL 4B3TL 4YCWA 2KHJA 4PG3A 1N34L 4B3RL 1E1TA 2HT1A 2NZHA 2BA1A 3KF6A 3PSIA 2OCEA 1D8LA 5C4JH 3K7AH 4BA2I 3DM3A 3HKZG 2PI2A 4JI1Q 1S40A 3RN5A 1OXXK 1NE3A
chains in the Genus database with same CATH superfamily
3NBIA 1EYGA 4RKBA 5IODA 5EKLA 4B08A 2H5XA 3TRZA 4WORA 3K5LA 2F0DA 3A0JA 5LMUL 1WOCA 4WRDA 1ICWA 1BBXC 1VQOA 1PYBA 2XSCA 2YTXA 1EFWA 3J7AF 2RDFA 3ITPA 1J9OA 4X65L 4K0KL 1BUVT 1PH9A 3MFGA 2EPBA 2UUAQ 3CHBD 1GJXA 1PTOC 3GTMB 3GTOH 1HUNA 1AH9A 4H0LC 2PQEA 4LUOA 2DNCA 1N9WA 1ONLA 1SNPA 1V1PA 1EFID 2L5TA 1TXYA 5C44H 2B29A 2MP1A 3G6JB 1G2TA 4A3KB 1HXYD 2K5QA 1EZ6A 2H1EA 4QF4A 4P2CB 1IW7C 1BF4A 1TIID 2K5NA 2H4OA 3M7NA 4EGVA 2KHSA 3CKIB 2FMCA 4G57A 2NVQH 5CMDA 4UPAA 1ENFA 1XPRA 4EQNA 1PH7A 1QJOA 1X65A 2EYHA 3AEVA 4BBSH 4ME5A 4JK1C 1QVCA 4KHZA 1EWCA 3IRBA 3MFYA 3CF5A 2E76C 3CCSA 1VQNA 2AWOA 4C2MH 1C8CA 2Y0SE 1KAWA 3GTPB 5C44B 3RNUA 1CFMA 4GLAC 3CXCA 5KYLA 1ET9A 1R9TH 2LY7A 3RMHA 3RLOA 4DV7Q 1KL9A 3MEFA 5JVG3 3DWQA 1TWHB 3HG9A 5J22A 1PH1A 3K59A 1EOTA 2RHSB 2HHHQ 1FJGL 3I2ZA 1XNRL 3W3AA 4LFAQ 4DAYB 1W6KA 3P1HA 2IX0A 4C3JG 3R93A 1K9MC 1EQVA 1B9MA 3KLWA 2L1BA 3MXUA 2PZUA 5JEAH 3T4AC 4GNXC 1IW7D 4DR6L 4YCUA 1CTMA 2JA5G 4KN4C 1JOQA 3MEHA 3K80C 5IP9G 4R4CA 4GN4B 4Y7NB 1S5CD 1J8IA 4A3MB 1J6QA 3RLFA 3PMFA 2Q8RE 3PIOA 1VQ7A 2K32A 5LMNW 2L11A 1PMRA 5M5WB 1X54A 2HD3A 1PH2A 3S14B 2EVBA 1Q3LA 2QKIC 5M3FB 1X9NA 3GTJB 3C46A 5JJLA 1LM0A 4JCVE 2EY2A 1IBLQ 1MD2D 5IWAL 1A0IA 3UDFA 5IYDG 3J7ZC 3S1NB 2F0JA 2NB0A 4F88A 4FF1A 5J3BA 4DA2A 2XTIA 1HA5A 1NNXA 3DXJC 2UXDL 5E7NA 3F2DA 4C2MB 3GTLH 3HKZE 1IYUA 5IY0A 5JPMC 4HJ7A 4X3TA 1A8VA 2RKSA 4CHTB 1UUPA 5EPLA 3A7LA 3O13A 1EZ8A 5C44G 1L0YB 5BN5A 3LGJA 2B2UC 1E22A 2A8VA 5ELDA 5FO9B 2JA6G 4Y52H 2PYKA 3D3RA 1TWCB 2Z1CA 1DM0B 1QZGA 1FGBD 2B63G 1G6PA 1CA6A 2VUMG 2FFKB 2BCOA 3TN2A 1LABA 3FPPA 4JI2L 1VQFA 5TSSA 1A3VA 3JAMi 1O7LA 1P16A 5CV9A 5M5XH 1K8AC 3MWYW 3GTKH 3M3YB 5CV5A 2E2JH 3KJOA 1I4HA 3PF4A 1HNWQ 2RDHA 3MXGA 4BWGB 3QWNA 4DV3L 4NXML 5M3MB 2PPBC 4JV5Q 1SJHD 4K6LA 1ZXTA 1Y1VB 2L0CA 1SSOA 5LMNL 3A74A 4NXNL 4FYDA 2Z8LA 2ZTEA 3CC4A 2IW3A 4QUFA 1QG7A 4EVOA 3HZXA 4CKEA 1TS2A 5M5XB 3CPWA 1D6EC 1KLGD 2F0GA 4HSVA 3CC7A 1KRSA 2Z4HA 3PCOB 1L1OC 1S5DD 4DR7Q 5M9OA 3T53B 2JA6H 1NTGA 3BZKA 3ND9A 1NCVA 3UDIA 2D5DA 4FDBA 1B3QA 4JBKA 4B3SQ 4OO1H 3MC0B 4ZCKA 1IZ6A 1PFNA 4DUYL 5I4DA 3FDTA 1SROA 5C3EG 3EQLC 1LT3D 1U4LA 2E2IH 2Q2TA 1NJIC 3S1NH 1U4RA 3EIVA 3CQZB 4QY7A 3D6CA 5I2XA 1Q8KA 1Y8NB 1STNA 1I94L 1CM9A 2VL6A 1E2VA 3S17B 3DEOA 1N33Q 4Q5VA 2K05A 4YHHQ 1PTOD 3VR6A 2PNHA 1LTAD 1JC7A 2ZXRA 1XMQQ 1YNND 4A3MH 3KOJA 3H0GH 2R93H 4A93H 2QEJC 2SOBA 4N9PA 4QIWE 2NN6I 3VR3A 1ML0D 2RF4A 4HEDA 4MN3A 1QOHA 1VF5C 5KNCA 1SE3A 1OTCA 2E75C 4LNQA 1ZEQX 2K75A 1XMQL 2BDNA 3T16A 3FEWX 4IO9A 1F2ZA 4DAVA 1MJCA 1K3RA 3ONAB 1J5EQ 3PIP3 4YIJA 5C0XG 3S1QH 1H9SB 3BVMA 1A3UA 3PV0A 4DR1L 1VQ8A 1HFGA 3M4OB 4HIMA 4IFDH 4NB3A 1XXGA 2CQOA 4AYBB 2VQEQ 4IPCA 1PXUA 5C4JB 4F8MA 2TSSA 2VB2X 1Q12A 1HR0Q 3M3YH 2K50A 3GTKB 1X3PA 3U4ZA 1D1IA 4JI6L 1L0XB 4A3JH 2JEBI 2PO4A 5DLQE 1L0WA 4A3EG 3FKIG 5FO8B 2AMCB 2CH4W 1EQTA 1R9TB 3HOXG 4DV0Q 2K04A 3OIPA 3STBD 2F0OA 1KQSA 3CC2A 4C1NK 2E5LQ 4IUQA 4LF9Q 3MZ5A 3AQQA 2UXBQ 1GUGA 2EZVA 2PCFB 2NYZD 3GTQH 2NTTA 2F0NA 2ZXOA 2FMMA 1VQ5A 2EE1A 2EJMA 2WFWA 4J15A 5IGDA 2I0QA 1DJRD 4H7BA 1RTOA 5IP7H 4JI4Q 2RA4A 2KHIA 2PQAB 2A73B 2G9HD 1Z47A 3D6WA 3ZYYX 4DK1A 1H9MA 1QZHA 4ZYSA 4JI5L 2F0HA 1HCZA 5LMNQ 1SMXA 5KGUA 4L63B 1MI2A 1SAPA 4JV5L 4A93G 3BDOA 5C3EH 3I73A 1AZQA 3PO2H 1KNEA 4OX9Q 4G4KA 2MUYA 2MPMA 2N49A 2PZTA 3KF6B 1F9RA 2Z4IA 3HOWH 3BYYB 2KEDA 1CKNB 2EXDA 3J80E 4JI1L 2QCPX 3SE0A 1B50A 2B2VC 1PZID 5GROA 1S5FD 2TMPA 3NEMA 4RGOS 4A3BH 4HR7B 4OO1G 1LV9A 1EEFD 3H94A 4IUUA 4BBRG 3L7ZC 4RWSC 3E9IA 4DR2L 4BBSG 1PRTC 3F8TA 1VQJA 2JA8B 1RODA 3FHWA 4X6AH 3AFQA 2FJ2A 3J7AV 1WFQA 4K8JA 3VDYA 1KXLA 4DNRB 1ESRA 3BJUA 4JBWA 1XNQQ 2JXMB 3P75A 3L0OA 3E3XA 3OPOA 5IE8A 1VQLA 1C9OA 1FNUA 5C0XJ 5C4ZA 2F0SA 2RCFA 4JI3Q 2ZJRA 4ZLTF 3MVVA 4A3MG 3S9WA 1XPUA 3BS1A 1CKOA 4MIUA 1HPCA 1LTTD 2PMZB 4K5WA 2ZXPA 4A3FB 2XWBB 3ERQA 2B63B 3GTQB 5C4XB 1STEA 2JA6B 3HFZB 1RHPA 4DR6Q 1NMFA 1QE6A 3D4WA 4B3TL 2KHJA 2SDFA 1CI3M 2NZHA 3KF6A 4DXGA 2A68C 3I8ZA 1KDAA 2OCEA 5KNDA 3DM3A 4JI1Q 3RN5A 1NE3A 1N32Q 3I91A 1RKNA 4OXPA 2MQHA 3DHQA 3I4MG 1SJED 2LXJA 3HKZB 4A3JB 5GAHC 2PW5A 5ELOA 3W1BA 1VQIA 1YVCA 2JJQA 2XRSD 4R8NA 1D7QA 1TY2A 1EY5A 1QB5D 4RGNA 4UHVA 3ULLA 4MTKA 4A3CH 3FKIH 1SNQA 5M3MH 2KCTA 4JI5Q 5DEHA 3VA5A 1PVOA 1ZKOA 4JC0A 3DMUA 1SMYC 3UI2A 4MZ9A 4IOCA 1BDOA 1FL0A 3PO3B 3LNNA 3S2HH 2K01A 4BY1G 2MO1A 4QB4A 1ZYRC 1HHVA 3A5ZB 4OIJA 5HGTA 2UXBL 5KEEA 3OTOL 2IX3A 1VMCA 2ATWA 3X3MA 4A3GH 4PZ6A 2B39A 3S1RH 4O1NA 1YI2A 4OELB 1SFOH 4ZKCB 5M5YH 4A3FG 3NUCA 1LTGD 2OEOA 4YCVA 3K5MA 1K83H 3DWPA 4KKTA 2F0EA 1IL2A 3MXNA 2ZTCA 3PO2G 2K4KA 4DV2Q 4PV1C 4OGQC 1GM5A 1B70B 1WYDA 3VR5A 5DM73 4RFBA 3G4SA 1IBML 1DYQA 1GO3E 3QJYA 3CCJA 3J80i 4QL5A 3FP9A 3GQBA 4O2DA 3I4MB 4A3DH 1SMYD 1J5EL 3NP8A 2SNMA 1EY8A 5JEAG 1I6HH 2VUMH 1S4ZA 1VQ9A 1Y8OB 3I90A 4BY1H 1ENAA 4K5XA 1AZPA 1XMOQ 1XJVA 3A54A 1JJGA 4C3IG 3KBGA 4RCOA 1TWFH 1VQHA 4KD3A 4B3RQ 3KF8A 2QEXA 3TS0A 3NBHA 1PH4A 2RSNA 5I6YA 1MGSA 4BXXH 1X32A 3F2CA 3HOYH 2F0WA 4TSSA 2NWGA 5JPNC 5EPJA 4OO1I 2Z6BA 5IYDH 3FKIB 1GXDC 1I94Q 1TKWB 4H02A 3NQIA 4IQZA 1WTRA 1PRTD 3TZDA 4IN3A 2Z0SA 1KABA 1I3QB 2Y0SG 3S15B 1AW7A 4FF2A 1I4XA 3J81L 1VDZA 4N9TA 2WV6D 4CDCC 2JA8G 3OWEB 2UU9L 4AYBG 4DUYQ 4GOPA 3NTHA 4LF8Q 4GN5A 1STBA 3KBXA 4OONA 1CHQD 1STYA 3UE0A 1RD9D 4BBSB 1JB7A 1FYCA 1TS3A 1YNJD 4R4QA 3URYA 2ENBA 1JORA 5I9PA 4IALA 1WI5A 4HIDA 4FXDA 2NTSA 2KBNA 4DR7L 1B2TA 1M1KC 1JJCB 5C4XH 3TP8A 1Q8IA 2AQ2B 4O42A 3D31A 4HN7A 5J39A 1IL8A 5FJ8G 3GTLB 5AJ3L 2R6GA 2KQ3A 5CV7A 1X55A 1JICA 3CMEA 1IYVA 4KN7C 2IWHA 4CJ1B 5HY6A 1PTOF 4XQNA 3SDZA 3SR1A 3I4NG 2WIIB 5JVH3 4CKCA 1Y1WG 2CH4A 3FPUB 3UDXA 3PUWA 4RA8A 4DGZA 1ILQA 3J81j 4RAUC 3K5OA 2ZM6Q 3GTJH 5M3FH 1MHWC 5GADC 4UP9A 1YHAA 3C3LA 2A1AA 4A3IH 2I5MX 2WAQG 2JA7H 4JI2Q 1C4QA 3JAME 2OXPA 4RMFA 1VQDA 3QIAA 1CA5A 2B2WC 3G48A 3NQTA 2KOLA 1B8AA 1VQAA 4NPSA 2OQ0A 3OYYA 4L5TA 1BBWA 1PTOH 2IPKD 2UXCQ 1L1OB 5I2YA 3GTGB 1AP0A 2NBFA 2DNEA 4GOPB 1Q1EA 2QGQA 4XTCS 3G7LA 2MJ8A 4HIKA 1OXSC 2QDLA 3U4VA 1EYAA 2DY7A 1BCPF 4JPBW 4FF4A 2LSSA 1V43A 5KIXA 1IBKQ 1SYEA 1I50H 4PMCA 3D4RA 1GHKA 1EY0A 3RZOH 2E2HB 1IBLL 2BH8A 3GTPH 2QILA 2D9UA 3M4PA 2L55A 3NXWA 5G3LD 3Q22A 4LUZA 1U4PA 3FRPB 3HOVG 4ZUJA 3H0GG 2R93G 4RKLA 1B7YB 4X62Q 1WTHA 2WB1G 1KHIA 2B2YC 4IUTA 3ERSX 2PMZE 1X6OA 1GUNA 2CWAA 3QR8A 3TSSA 4DV4Q 2JA5B 4HMJA 3G71A 2K5DA 1D5ZC 1Z9FA 1QNKA 4DAYA 1GKHA 4HTHA 1TWGB 3C1FA 4H44C 3NENA 3PO3H 4LAAA 2CCZA 2JA7B 3HS0C 5IT9c 4RHRA 2F0TA 5HURA 1HUMA 3K6OA 1S3OA 3CP0A 1B53A 1F2YA 2FXQA 2ALYB 4DAPA 4LFAL 4P73A 4C3JB 2E2DC 1FNWA 2K03A 2HHHL 1FJGQ 1VQCA 4WJ4A 3R3OA 4A3IG 4DR5L 2PI2E 3W2DA 1K8OA 4XT3B 2UUBL 4L8JA 3SK5A 3KDFA 5D65A 1L1OA 1JR0D 1Y1VH 2K7VA 4HCSA 1BCPB 2K52A 1MKHA 3AU7A 5C0XI 4R1JA 5K36H 3UDGA 1TY0A 3S1QB 2L4NA 2EJFC 1CQVA 1EY9A 4BY7H 3CAMA 4IURA 4RCNA 2B2YA 1TWCH 3CD6A 4GKJL 1UWVA 1HTPA 3VYSA 4EQOA 4LFBL 3SGIA 2BE5C 4GZYC 2F3VA 4A93B 1S5BD 3H0GB 2R93B 3M4YA 3CCMA 5F2DA 2HDMA 5IYCH 3I56A 2I5HA 4U673 1DOLA 3U58A 4CDDC 1I4RA 3T1HL 2DJFC 2E2HH 4K5VA 4OEMB 4I7AA 5EPKA 2K14A 3HOXB 5CR3A 2Z9HA 2UUAL 5E4XA 4C3HB 1JE4A 2B2WA 4K0KQ 4JI0L 4X65Q 1Y1VG 1TS5A 1NMGA 4APVA 3AMUA 2N88A 1EQRA 2OWOA 3I3CA 3RZDB 2F0IA 4F7XA 1A6XA 2ICIA 2A68D 1V1PB 3M7GA 1PV4A 2EY1A 1MSHA 4LFBQ 1C7YA 5COYA 1NR4A 1LYLA 2EIFA 5IP9H 2ICEC 5GQOA 2YU9H 1EWIA 1RIPA 4UAIA 4QJFA 2I5LX 1N34Q 1Y14B 1FD7D 1LACA 2ZTDA 4N8FA 5IIFA 4ME3A 1SN8A 2LXKA 1JT8A 4DV6L 3TBIB 4IPDA 2A5HA 1STHA 1YHBA 1U4MA 4GLVB 2IJ0A 1F9SA 4DR5Q 2NVXH 1VQGA 3SXHA 1YNNC 3S24A 2FHTA 1AE2A 3DEPA 2EJGC 4CKBA 1VQ6A 3QB3A 3EJIA 4LMQD 1SEBD 2EYFA 2IY5B 4C3IB 3JAMc 4LF7L 3T1YQ 2HCCA 5IGBA 4KD4A 2RVLA 1JJ2A 2ZT9C 1CZWA 2NN6H 2ID0A 2GA4B 4UP7A 4C3IH 4QUCA 1DCZA 4JOIC 4ZRZA 3EA6A 3EBEA 3F1ZA 1TWAH 3PUXA 4AQYL 5CYUA 1B4OA 3MTSA 4C1NI 2BA1A 4PQXA 5BN4A 5C4JH 2WACA 4BA2I 1EEID 2O4XA 2PI2A 4V0BA 1LT6D 2KCNA 3B6YA 5JJKA 1HNXL 1JMCA 4CJ2C 1WCMH 1OXUA 3NE5B 2F52A 5BN3A 2MNAA 1ESFA 4R8IA 5J1ZA 5CORA 4LUVA 1BKBA 3BG3A 1A15A 1A63A 3LWUA 1JOKA 2O5JC 4DR4Q 4A3EH 2AQ3B 3J7A5 5D14A 2F0FA 1KC8C 2YU9B 1QNUA 4HAEA 3ZJYC 3RN2A 1WTQA 4A3GG 1C0AA 1E0BA 4H13C 4AIMA 4I7ZC 2VUMB 3FMCA 4IZ8A 4ZKBB 4IUVA 1O80A 4JI8Q 2N3SA 3KDFB 1WTPA 4RH6A 5FJ8H 2Y0SB 4DR4L 3J80c 1UAPA 3HOVB 1HQRD 2L15A 4LF5Q 4OWWB 1TWHH 4A3LG 3I4NB 3CPFA 1Y1WH 4DAMA 1HNXQ 3K81C 5KYIA 4KKUA 3HOXH 1YITA 1WCMG 1PFMA 1B1ZA 2PQAA 1I50B 4LF4L 2VNUD 3K57A 2L9HA 3K7UC 3LWEA 4E6IA 1YJ9A 2D0PA 4JG2A 4A3DG 2AUJD 2V4DA 1JOOA 1P8LA 3J81i 2N8NA 1SFOB 4AQYQ 1VQ4A 2F0MA 5A2QL 4G7ZC 4KTAA 4YWMA 4LF6L 2A6EC 4IJLA 2G9DA 3M85A 4ZK9B 3JC66 1HFNA 1M8AA 4RGTA 4DR3L 1EIGA 2O5IC 2VS1A 2Z6KC 2F0QA 1I5FA 4DV1L 5I6WA 4A3BG 1XWEA 3Q23A 4LFCL 3DUZA 2KENA 4GKKQ 4R4IA 1E1OA 5FKAC 1B9NA 3U50C 5BR8L 3MA2B 2UU9Q 2A6HD 2K33A 3I7FA 1E3PA 3I70A 1ILPA 1QILA 4QGUA 3MXNB 3J80L 4LW1A 3PO2B 3PUYA 2CW0C 4XYOA 4QIWB 1GUSA 3CMAA 2PZWA 2OT2A 2YV5A 2Z6KA 3K0YA 1YBYA 5T1GA 1K0SA 2XVSA 3WDNA 4M8AA 4DV6Q 2JYOA 1AN8A 1K73C 3TEHB 4DXFA 1PH6A 4A75A 1CK1A 1TS4A 2EYLA 1JE5A 4XQQA 1SE2A 5C6AA 1JWSD 2KUMA 4LK1C 3T56B 2R7ZH 3Q8DA 2BOSA 1V9PA 1XMOL 1X3GA 5E1FA 1HZ9A 5EJWA 3KF8B 3N52A 1SYBA 2EYPA 2K5HA 1CSPA 2DY8A 2XNAC 3A56A 3MAQA 2QA4A 1Y8PB 3E5SA 3L2PA 1EYDA 3I4NH 1RTNA 1SYDA 1GUWA 2K6AA 4C56C 1F9PA 3I4LA 1SXTA 3S15H 1NBWA 3HOUG 1I3QH 3PIO3 3ULPA 4DV2L 1TU2B 2IT1A 3D0FA 2KECA 3L3OC 5C5MA 3NWTA 2R92H 1RJTA 3KLRA 2HUGA 2F0KA 3ER0A 3MXPA 1WD0A 4J1MA 3STBC 3FVQA 1ASZA 3BZDB 1ZYRD 4DF7A 4DUZL 3S14H 1VQKA 4WJ3M 4UP8A 4HMIA 1GVPA 4YWKA 5IGEA 3OTOQ 4GLXA 2JP1A 3W1GA 1BCPD 3E0JA 3H91A 5D3DA 5EGTA 4GKJQ 3A8JE 2XGTA 3H09A 4BY1B 2F4VL 4ID6A 4G7OC 4AH6A 1D5MC 4LWCA 4X66L 4JI7Q 1H9JA 2B8GA 2CHBD 3J81c 3HOUB 4A3EB 4OL7A 2IHFA 2KJXA 2QF7A 3CW2C 4GNXB 5C3EB 4GOPC 1WD1A 4RGMA 4V190 3NTKA 2VXWA 5GAEC 5E4WC 2AKWB 2UUBQ 4C3HH 4FP5D 5FOBB 2K5VA 4DK3C 1DONA 4K6DA 3A7AB 3CCVA 3H3VH 1A3TA 5FLXL 1XPOA 1HNZL 5JJIA 2R3ZA 1N32L 2WB1E 1H9KA 2C35B 4KY5A 3CCUA 2F03A 4ZQ3A 5EQ0A 4B3TQ 3R8BA 2CKZB 5GAGC 3PQIA 1CKNA 1Q46A 1BO0A 5C4XG 3P20A 2IHEA 1A2UA 3Q0AA 2NVTH 3NTIA 4HJAA 1QVFA 3HOZG 2R7ZG 1FR3A 1DD2A 3OHXC 3H6MA 1YZ6A 4FXGC 4UY8C 5CBAE 1F9QA 1V1QA 4X62L 2YTYA 4X3KA 1DZ1A 2I46A 2C9OA 3S1MH 3EFXD 4JI3L 4HIOA 2EDGA 4EQ5A 4LJZC 2WKCA 1GHJA 1STAA 1CUKA 3N6RA 2JE6I 1SR3A 2AWNA 3VYUA 4WJWA 1XNQL 1DXMA 4A3LH 2NVXB 2A74C 1BR9A 4C3HG 1BOSA 3TZUA 3P7JA 1IBKL 2EXZA 5IT9L 4DU9A 3HOUH 1YNJC 1Q90A 5K36G 3HOWG 3HOYB 1PH8A 1YJWA 3OMCA 1VQBA 5ELFA 4CDEC 1WVLA 4QQBX 4C3JH 4DR2Q 4BY7G 3PUVA 5KRUA 1QUQB 1HA6A 1H9SA 3AFPA 4HJ8A 1NY4A 2UXCL 1EQQA 4PNYA 4JYAQ 2VB3X 3TDQA 4CGYB 2EOTA 1VQMA 5K5PA 4B3ML 1PFBA 1EIHA 5ELCA 4XYQA 3CRKC 4POGA 4ABNA 2B2TC 2R7FA 1D5XC 5JOBA 1VF7A 1KLUD 4ODGA 4KHVA 1HNZQ 2M2LA 1AEXA 4TVAB 4YY3L 3CCRA 5CGKA 2R92B 1Q82C 3K7AB 1TQOA 4OWXB 2I07B 4QMGA 2JEAI 2O2LD 5G3LF 3CCLA 2ZM6L 4IJHA 1NR2A 4KK7A 4P72A 3CCEA 3D8GA 5FLXE 1B44D 2HDLA 1TR5A 1CKMA 4BXXG 4IFDI 1VQEA 2D62A 5IYBH 2UUCQ 1K83B 5H1SE 3CRLC 4HCEA 1Q7YC 4L5RC 1JQYD 1O78A 2F3IA 4JI7L 1Y69U 4WFN3 5AJ3Q 1RL2A 2F4VQ 1WTOA 1G91A 1HTLD 2HQLA 1CSQA 4DNIA 4MNOA 2NZ1D 1V8QA 1A2TA 2XIWA 4MTNA 3H3VI 3NSWA 5IP7G 1X3FA 3UE1A 2JQOA 1RF2D 4UDUC 2BDOA 2E5LL 4ULLA 1WTXA 4DUZQ 3VA7A 5NUCA 3J81E 4HJ5A 4BY7B 3U9SA 3NELA 2WB1B 1QUQA 3BYTB 2HCIA 1RCVD 3OMGA 3M4QA 1CZGA 4CBVA 4NW2A 3GV3A 3EVQA 3DM1A 2J4XA 4JVZA 2WINB 2B2UA 1A62A 1PZKD 5C3WA 4KI0A 3BVZA 1X3QA 2VQEL 1HZCA 2F0LA 2AHOB 3S1MB 3IFTA 4DR1Q 1ENCA 2DUDA 2GVAA 2XRQD 1K3BC 3ND8A 1PRTB 5D3IB 3I4OA 3GDEA 3HP3A 5LHY1 3HOZB 1TWAB 3NWSA 2JA5H 2RCNA 3OW7A 2RDGA 3E9HA 2JA9A 4BBRH 1XX8A 4JW0A 3GP7A 1R4QB 4NKLA 1S5ED 2F4IA 1G291 5IT9E 3EN2A 2A19A 4ALPA 1VCIA 2KCCA 1SYFA 2ES2A 2JA7G 4K2LA 1TT2A 3BVGA 1W2BA 4DNTB 2LKVA 3H3VC 3PIPA 4R4OA 4XT1B 4ZAIA 2CW0D 5DNFA 1N33L 3GTMH 3PUZA 4CJ0B 1IBMQ 1TVXA 1SNMA 2F0UA 2NZOA 1EU4A 1KAAA 5E3FA 3OIQA 4L6TB 2HT1A 1F77A 2EYMA 2P5ZX 1D8LA 3K7AH 4ZUIA 3HKZG 3GTGH 1OXXK 5M5WH 3T13A 2V1CC 3C1EA 3SEBA 5BR8Q 1EU3A 2D0OA 2K5WA 1SDFA 3D4DA 4LFCQ 5IYBG 1T5EA 3K58A 2BH2A 3U9OA 1PH5A 5CC4A 1V1OA 2CWPA 2RSOA 3BZCA 3TP6A 2LS01 3ULJA 1VQPA 4BA1I 2VW9A 2EYJA 2C5CA 1F2MA 3A5UA 1EY7A 2Q2UA 1EWHA 4KV6A 2BA0A 2EY5A 5KNBA 2MGSA 4IUNA 2UUCL 1UE5A 2EY6A 2JSOA 3RZDH 3NPPA 3RLNA 3I72A 4DFAA 4DN4M 2Q8TA 4NXNQ 3SVMA 3KYHC 2E8GA 3VYRA 3K8AA 1ICFB 1Q1BA 1KTKA 2WAQB 1YNXA 4LF5L 3OW2A 3WWVA 4NXMQ 1SE4A 4DV3Q 4CDFC 4L5SA 5LL6S 1U0LA 2QW7A 3TP5A 3IAYA 2SNSA 4O0AA 4YY3Q 5LL6X 1K0RA 1O7YA 4JI8L 1LO5D 1X56A 1SNOA 3KLSA 2NVTB 4B3MQ 1Q81C 1RDPD 1G8ZD 2OF1A 4PMBA 4K2KA 4Z9CB 1LTID 4DKAC 4P74A 2NVQB 3A8IE 5IYCG 4JYAL 2IL8A 2B2VA 4A76A 2KCMA 2MFIA 1KDCA 4A3KH 1LTSD 1SYGA 3GO5A 4NMZA 4M1UB 3TS2A 3HEJA 2UXDQ 2Q2HA 1BBUA 5AFWA 3S2HB 1LTBD 3TMEA 3QG1A 3GTOB 2OTJA 1E2WA 1C48A 1S72A 3CCQA 2HIXA 2GVBA 1EL0A 1O7IA 1UEAB 4ILWA 5T1IA 1LLRD 4KY7A 1W6JA 5JAVA 1M90C 1OXTA 2X6LA 1CT1D 2YTVA 1JWMD 5JJZA 1UE6A 3M9BA 5M3FG 3QO2A 1PYSB 4EX5A 1JCKB 3VYTA 1H95A 3RUZA 4JBJA 1HJPA 2KA7A 3F2UA 3BDLA 2R7DA 5L37A 1FVIA 3Q24A 1TWGH 2M00A 1EIFA 5EBCA 2R92G 1PHJA 4GS3A 5IOCA 1I6HB 1KDBA 1IXRA 2NVYB 3T1YL 4LF7Q 3TQYA 2E74C 3TREA 5EKIA 1Z6HA 2A69C 3K0XA 3IL8A 3E0EA 2QDBA 4NDXA 2ZJPA 3A55A 2HQEA 1R4PB 3HKSA 4TQUS 4Q0FA 1XNRQ 4A3DB 1UE7A 5EAYA 4X3SA 5ELBA 2YYZA 4OX9L 3S2DB 3V96A 1DOMA 2G5DA 2ZJQA 1ASYA 4KJNA 4DV7L 4K14A 2DN8A 3BU2A 1W3SA 3R2TA 4TRDA 4AYBE 1HRJA 3WOEA 3I55A 1UEBA 1PA6A 5M5YB 1LTLA 4OIKA 3OSOA 2PW7A 3S2DH 2KVMA 3W5OA 1K8GA 4X66Q 1I4GA 2CVRA 2XWJB 4JI4L 2AQ1B 4G7HC 4KKSA 4A3GB 4FNFA 3PF5A 2XN9C 3RD4A 2JK8A 2WKDA 2HIVA 2WAQE 2NVYH 2EYOA 1WTVA 4LF9L 1HQMC 3HGBA 1K28A 5ISRA 1BCPC 1QVGA 5CBEE 1L2FA 1SLJA 1YJNA 4R9WA 3SK4A 4DV0L 4B9XA 1I4QA 3GD7A 4L5QA 3HOWB 2NN6G 3QOLA 4JI0Q 4JI6Q 4A3IB 2SEBD 2R61A 2MO0A 1HR0L 2VY3A 2DGYA 1U5KA 2LMCB 1QCBD 1G51A 4YWLA 1HH2P 5IGCA 4FF3A 2FINB 5DM63 3KFUA 3MHBA 1VMPA 2B3GA 3Q6SA 5M3MG 3T1HQ 1LUZA 1UE1A 2ASBA 2E2JB 1WJJA 2BE5D 5IGGA 3H15A 2A69D 1VS0A 3OWFA 3A8KE 5LMUQ 1SBBB 4I65A 1PFSA 1I6VC 4XDXA 3RR5A 1PZJD 4HSPA 1DGSA 4PZ7A 1MJEA 3AB9A 4OHJA 4J6HA 3GV6A 4IPGA 1KNAA 1B3AA 2CQAA 1XTCD 3OOCA 2GN5A 3DWAA 3K5NA 2NUCA 1I4PA 4IUPA 3KJPA 3SK6A 3TP7A 5HGQA 1EIYB 4GNXA 4MHEA 5C3XA 4DK6C 1LTRD 1N36Q 4XIGS 2VQFL 1SRUA 3RZOB 4KJOA 4YHHL 1T9HA 1EYCA 3X3NA 3KUPA 3C2PA 2J7ZA 1N8RC 4P71A 4DV5L 4RG1A 2N55A 5EBDA 5CV4A 4PZ8A 3ICEA 4XXEA 4A4IA 1KIXA 1IYJB 1QWYA 5FLMH 3J7YW 4JOIA 3S16H 1Z7TA 1FGUA 1H9RA 1Q86C 3JAML 2LFNA 1BVSA 1BNZA 4A3BB 4GKKL 3DLLA 4B3SL 3VR4A 2MHVA 4Y7NH 1BXTA 4DV1Q 2K28A 4IFDJ 1FNVA 3PO3G 4DV4L 1MSGA 4F87A 4DR3Q 5DAUA 4OWTB 1E2ZA 4XQJA 1LT5D 4LF6Q 3I4MH 5EKKA 1D1KA 2M9VA 2F1MA 1HZBA 4KLKA 1SE8A 3S16B 1IHZA 1YHQA 4FVMA 1SNCA 1IKLA 1MBYA 4X64L 3QOJA 3CU7A 2WP8J 1YIJA 1JWUD 1WCMB 3WOFA 3F2BA 4LF4Q 1AE3A 4A3CG 1U9RA 4POFA 5CV8A 1BQQT 4N8X1 2JN4A 5C5LA 4KHPL 1EY6A 1EUJA 3T51B 3CQZH 1HNWL 4BS9A 1PYWD 1PRTF 3LX0A 3V05A 5FLXc 3S1RB 1CQFA 4J8QA 4PMWA 5I9OA 5IGFA 5CV6A 1PLFA 1IKMA 5JEAJ 4IPHA 5ELNA 1DOKA 1PH3A 1YEZA 2N78A 3HOZH 4IFDG 2R7ZB 4NP5A 2AUKA 4BBRB 1OO9B 4B9WA 1F2LA 2F0PA 1GUOA 4HJ9A 5FLMG 2X69A 4KMUC 1GD7A 1KD1C 4KHPQ 1STGA 2F3WA 3G6EA 4EQPA 1JB3A 2F0VA 2KEEA 4IOAA 4U68A 3M4OH 1AFPA 3HOYG 2RQXA 5A2QE 1UNSA 5IWAQ 1HR0W 2EQSA 2IX1A 4RHSA 4X64Q 1E7ZA 1E24A 2RHQB 3IFDA 5A35A 3L9AX 3PGZA 4R4TA 1TWFB 3NK9A 3AYHB 1CHPD 1GUTA 3NBHB 1O7ZA 2L12A 2B8FA 1MIUA 1M4VA 1PDQA 4TKOB 1ET6A 2D2CC 1NAPA 4FXKC 4DPGA 1D2BA 4FO2A 4S3SA 2B63H 1G2SA 2Q2IA 4GN3B 2A6HC 2J0TD 1EOVA 3SHLA 1II3A 4LF8L 4A3KG 5C0XH 1GOZA 1NSNS 1XTDA 4P75A 2OTLA 1EY4A 1LT4D 1XYIA 5ELEA 4A3FH 2DJGC 2CFMA 3KK7A 3BDCA 3HRZC 3KLSX 5C4HA 4KY6A 3S17H 4QCLA 2OQKA 2A6ED 4DK0A 1WTWA 1X3EA 5FK9C 1KRTA 4DV5Q 1T5XD 1Y1WB 4JBMA 2Q8IB 3E6ZX 4X3UA 4A3JG 3SK8A 3V2TA 1K8MA 2JA8H 1G6ZA 2VQFQ 2E2IB 1NUCA 2X6GA 1OXVA 1N36L 5FO7B 2K1BA 1HZAA 3HOVH 2RBMA 4K8IA 2VZAA 4YCWA 4PG3A 1N34L 4B3RL 1E1TA 3PSIA 3IKJA 2B2TA 3VR2A 1PTOB 3R2IA 3EROA 2PNRC 1S40A 1SYCA 1SNDA 3NHHA
chains in the Genus database with same CATH topology
4OXPA 2V1CC 2MQHA 3B6YA 5BR8Q 1HNXL 1JMCA 5JJKA 1EYGA 3I4MG 2LXJA 1WCMH 5GAHC 2D0OA 5ELOA 1OXUA 4LFCQ 2F52A 3W1BA 2MNAA 5IYBG 1VQIA 2H5XA 3TRZA 1N32Q 1YVCA 2BH2A 1PH5A 2JJQA 1D7QA 4LUVA 3A0JA 5LMUL 1BKBA 2CWPA 3BZCA 1WOCA 1A63A 1VQOA 4DR4Q 3ULJA 3ULLA 4A3EH 4A3CH 1PYBA 3FKIH 3J7A5 5M3MH 2KCTA 1VQPA 2YTXA 1EFWA 4JI5Q 4BA1I 1KC8C 2VW9A 1PVOA 4JC0A 3A5UA 2Q2UA 4X65L 4MZ9A 4IOCA 4K0KL 3ZJYC 1FL0A 3RN2A 1PH9A 2BA0A 2UUAQ 4A3GG 1C0AA 3S2HH 4AIMA 2UUCL 3GTOH 1UE5A 1AH9A 3RZDH 4JI8Q 2N3SA 4LUOA 3RLNA 3KDFB 1N9WA 4NXNQ 4BY1G 3KYHC 2MO1A 2E8GA 1TXYA 3K8AA 5FJ8H 3A5ZB 2B29A 5C44H 1Q1BA 3J80c 4DR4L 2UXBL 1YNXA 4LF5L 3OTOL 3OW2A 3WWVA 4NXMQ 2ATWA 4DV3Q 4L5SA 4A3GH 4PZ6A 2L15A 2K5NA 1U0LA 3S1RH 4LF5Q 3M7NA 1YI2A 1SFOH 4OWWB 1TWHH 2NVQH 4A3LG 4O0AA 4UPAA 5M5YH 4YY3Q 3CPFA 1XPRA 4A3FG 1K0RA 4DAMA 1Y1WH 3K81C 1YITA 1HNXQ 3HOXH 1WCMG 4YCVA 1PH7A 2PQAA 4JI8L 1K83H 1X56A 1X65A 4LF4L 2VNUD 3K7UC 3AEVA 4B3MQ 1Q81C 1YJ9A 4BBSH 1IL2A 2D0PA 4JG2A 4A3DG 1QVCA 2ZTCA 4KHZA 1P8LA 3IRBA 2K4KA 3J81i 4DKAC 3CF5A 3PO2G 2N8NA 4P74A 3CCSA 4AQYQ 4DV2Q 1VQNA 5IYCG 2AWOA 1VQ4A 4C2MH 1GM5A 4JYAL 2Y0SE 1B70B 1KAWA 1WYDA 4YWMA 4IJLA 4A76A 2KCMA 2MFIA 3RNUA 4LF6L 3M85A 4GLAC 3G4SA 3CXCA 1IBML 4A3KH 3JC66 1GO3E 3CCJA 3GO5A 3J80i 1R9TH 4QL5A 3FP9A 4DR3L 3TS2A 4O2DA 3RLOA 4DV7Q 1KL9A 2VS1A 3MEFA 2UXDQ 4A3DH 2Z6KC 2Q2HA 1J5EL 1BBUA 1I5FA 5JEAG 4DV1L 1I6HH 1PH1A 2VUMH 4A3BG 2OTJA 4LFCL 1S72A 3CCQA 2HIXA 1VQ9A 4GKKQ 2GVBA 2KENA 2RHSB 1E1OA 4R4IA 1O7IA 3I2ZA 3U50C 5BR8L 2HHHQ 1FJGL 1XNRL 4BY1H 4LFAQ 4DAYB 2UU9Q 3I7FA 1E3PA 2IX0A 1XMOQ 1K9MC 1XJVA 1JJGA 3KLWA 1M90C 1OXTA 4QGUA 3MXNB 2YTVA 4LW1A 1TWFH 1UE6A 1VQHA 3M9BA 5M3FG 4B3RQ 3PUYA 1PYSB 4GNXC 4EX5A 2QEXA 3TS0A 1PH4A 4DR6L 1H95A 4YCUA 3CMAA 4JBJA 1HJPA 2JA5G 4BXXH 2YV5A 2Z6KA 3K80C 3F2CA 1YBYA 2R7DA 5IP9G 3HOYH 1FVIA 4R4CA 4GN4B 1TWGH 1EIFA 2R92G 1PHJA 1J6QA 4GS3A 3RLFA 3PIOA 1VQ7A 4DV6Q 4OO1I 5LMNW 1K73C 5IYDH 1I94Q 3TEHB 4H02A 1PH6A 4A75A 1X54A 1IXRA 3T1YL 1PH2A 4LF7Q 1X9NA 3TQYA 2Z0SA 2Y0SG 1JE5A 5JJLA 3TREA 1LM0A 4JCVE 1IBLQ 2R7ZH 3Q8DA 5IWAL 3K0XA 1A0IA 1V9PA 3E0EA 2ZJPA 1XMOL 3UDFA 2JA8G 1X3GA 3HKSA 4AYBG 5IYDG 3J7ZC 2UU9L 1HZ9A 4TQUS 4DUYQ 4GOPA 4LF8Q 3KF8B 1XNRQ 4GN5A 4OONA 1UE7A 5EAYA 3UE0A 1JB7A 4R4QA 2K5HA 2YYZA 1CSPA 5J3BA 4OX9L 2ZJQA 2XTIA 1ASYA 1WI5A 2UXDL 4HIDA 5E7NA 4DV7L 3F2DA 3GTLH 4AYBE 3HKZE 3BU2A 1W3SA 2KBNA 5IY0A 2QA4A 4DR7L 4HJ7A 3L2PA 1M1KC 1JJCB 5C4XH 3I55A 1UEBA 1PA6A 3I4NH 1A8VA 1LTLA 3D31A 5FJ8G 1NBWA 5AJ3L 1I3QH 5C44G 3HOUG 2R6GA 3ULPA 3S15H 4DV2L 3S2DH 3LGJA 2IT1A 3D0FA 1E22A 3W5OA 2A8VA 1X55A 2JA6G 4Y52H 3CMEA 1K8GA 4X66Q 4JI4L 1QZGA 5HY6A 2B63G 2R92H 1G6PA 2VUMG 3ER0A 3I4NG 4JI2L 3STBC 1Y1WG 1VQFA 1ASZA 3PF5A 3JAMi 1P16A 3UDXA 3PUWA 5M5XH 2JK8A 1K8AC 4DUZL 2HIVA 2WAQE 3GTKH 2E2JH 2NVYH 3KJOA 4LF9L 1VQKA 3PF4A 3S14H 3J81j 1HNWQ 4WJ3M 2ZM6Q 4DV3L 3GTJH 5M3FH 4NXML 4UP8A 4JV5Q 5GADC 3OTOQ 1GVPA 4YWKA 4UP9A 4GLXA 1YHAA 3W1GA 1QVGA 2A1AA 4A3IH 2I5MX 1L2FA 1SLJA 1YJNA 2WAQG 3A74A 4NXNL 5LMNL 4DV0L 2JA7H 4GKJQ 4JI2Q 2XGTA 3GD7A 4L5QA 2F4VL 4RMFA 2NN6G 4AH6A 4JI0Q 2ZTEA 4JI6Q 1VQDA 4LWCA 3G48A 4X66L 3CC4A 4JI7Q 1HR0L 2MO0A 2VY3A 1B8AA 1VQAA 2DGYA 2OQ0A 4NPSA 1U5KA 3J81c 1G51A 2IHFA 3OYYA 1HH2P 4L5TA 4YWLA 3KFUA 1BBWA 2B3GA 2UXCQ 3CW2C 5M3MG 4GNXB 1L1OB 3T1HQ 3CPWA 4GOPC 1LUZA 3CC7A 1UE1A 2ASBA 1KRSA 3PCOB 1WJJA 1L1OC 3H15A 4GOPB 4DR7Q 1Q1EA 1VS0A 2QGQA 4XTCS 5GAEC 2JA6H 5LMUQ 4HIKA 1NTGA 2AKWB 3BZKA 1OXSC 4C3HH 3UDIA 2UUBQ 2K5VA 1PFSA 3U4VA 4DK3C 3RR5A 4FDBA 1DGSA 4JBKA 3CCVA 3H3VH 4B3SQ 2LSSA 1V43A 1IZ6A 1IBKQ 4PZ7A 1XPOA 1MJEA 1I50H 1HNZL 4DUYL 5JJIA 1N32L 1SROA 4IPGA 3RZOH 2WB1E 3CCUA 2C35B 1IBLL 5C3EG 2BH8A 3GTPH 2GN5A 2E2IH 2Q2TA 1NJIC 3S1NH 3KJPA 3EIVA 4B3TQ 2CKZB 4QY7A 3M4PA 5GAGC 1CKNA 1Q46A 5HGQA 3HOVG 4LUZA 1EIYB 5C4XG 1Q8KA 2IHEA 3H0GG 4GNXA 2R93G 4X62Q 1B7YB 4DK6C 1I94L 1N36Q 2VL6A 4XIGS 2WB1G 1KHIA 2VQFL 2NVTH 1SRUA 4YHHL 1T9HA 3ERSX 4HJAA 2PMZE 1N33Q 1X6OA 1QVFA 3HOZG 2R7ZG 2CWAA 1N8RC 4P71A 4YHHQ 4DV4Q 4DV5L 4RG1A 1YZ6A 2PNHA 4UY8C 3G71A 3GTGH 1V1QA 1Z9FA 4X62L 2YTYA 4PZ8A 3ICEA 1XMQQ 4A3MH 1GKHA 3KOJA 4A4IA 3H0GH 2R93H 1KIXA 1IYJB 4JI3L 3S1MH 4HIOA 4A93H 3NENA 4EQ5A 5FLMH 3PO3H 4JOIA 2CCZA 3S16H 5IT9c 4QIWE 2NN6I 1CUKA 2JE6I 1FGUA 2RF4A 1S3OA 1SR3A 2AWNA 3CP0A 2FXQA 1Q86C 1XNQL 4A3LH 1OTCA 2ALYB 4LFAL 4P73A 4LNQA 1BVSA 2HHHL 1FJGQ 1VQCA 2K75A 1IBKL 4GKKL 4WJ4A 4A3IG 3DLLA 4B3SL 3HOUH 4Y7NH 1XMQL 4IO9A 5K36G 4DR5L 4DV1Q 2PI2E 1MJCA 1K3RA 3HOWG 1PH8A 4IFDJ 3PO3G 1YJWA 1J5EQ 3S1QH 2UUBL 5C0XG 1VQBA 4DV4L 4QQBX 4C3JH 3KDFA 3PV0A 4DR2Q 4DR1L 3PUVA 1L1OA 4DR3Q 1VQ8A 4BY7G 4HIMA 1Y1VH 1QUQB 4NB3A 4OWTB 2CQOA 3AFPA 4HJ8A 1NY4A 2VQEQ 2K52A 4LF6Q 3I4MH 2UXCL 1EQQA 4IPCA 1MKHA 5C0XI 1HZBA 4JYAQ 4KLKA 1SE8A 4R1JA 3UDGA 1YHQA 1Q12A 1HR0Q 3M3YH 2K50A 4X64L 3U4ZA 1VQMA 4BY7H 2WP8J 3CAMA 1YIJA 4B3ML 4JI6L 4A3JH 2JEBI 3F2BA 4LF4Q 1AE3A 5DLQE 1L0WA 4A3EG 4POGA 4A3CG 3FKIG 2R7FA 4POFA 2AMCB 1TWCH 1HNZQ 3CD6A 1UWVA 4GKJL 3HOXG 4DV0Q 4TVAB 3SGIA 4YY3L 3CCRA 4LFBL 1Q82C 3STBD 1KQSA 3CC2A 4KHPL 4OWXB 1EUJA 2JEAI 2E5LQ 3CCLA 3CQZH 2ZM6L 4IJHA 4P72A 3CCMA 1HNWL 4LF9Q 3CCEA 3AQQA 2UXBQ 5IYCH 5FLXc 2I5HA 3I56A 1CKMA 3GTQH 4BXXG 4PMWA 3U58A 3T1HL 2E2HH 5JEAJ 1VQ5A 4IFDI 2D62A 1VQEA 2WFWA 4J15A 2I0QA 5IYBH 2UUCQ 4IPHA 5ELNA 5H1SE 4L5RC 5IP7H 1Q7YC 4JI4Q 2K14A 2KHIA 1PH3A 2F3IA 1YEZA 2PQAB 4JI7L 2UUAL 2N78A 3HOZH 1Z47A 4K0KQ 4JI0L 4X65Q 1QZHA 1Y1VG 5AJ3Q 1RL2A 2F4VQ 4IFDG 1NMGA 4APVA 2HQLA 1CSQA 4JI5L 4DNIA 4MNOA 5LMNQ 1SMXA 4MTNA 1EQRA 3H3VI 2OWOA 5IP7G 4JV5L 4A93G 1X3FA 3UE1A 5FLMG 4HJ9A 5C3EH 2JQOA 1GD7A 3PO2H 2E5LL 1KD1C 1PV4A 4OX9Q 4DUZQ 4KHPQ 2N49A 3KF6B 4HJ5A 4LFBQ 3G6EA 1C7YA 3HOWH 3NELA 4IOAA 3M4OH 1CKNB 1LYLA 1QUQA 2EXDA 3HOYG 2EIFA 5IP9H 5GQOA 5M5WH 4JI1L 2YU9H 3M4QA 5IWAQ 1HR0W 1EWIA 1RIPA 2EQSA 4QJFA 2IX1A 4X64Q 5GROA 2I5LX 1E7ZA 1N34Q 3NEMA 1E24A 2RHQB 1Y14B 4A3BH 2ZTDA 1A62A 3PGZA 4OO1G 4R4TA 4KI0A 3AYHB 2VQEL 1HZCA 4BBRG 2AHOB 4ME3A 3NBHB 1SN8A 2LXKA 1JT8A 4DV6L 3L7ZC 4IPDA 3E9IA 4DR1Q 4DR2L 1MIUA 4BBSG 1YHBA 3F8TA 4GLVB 2DUDA 4DPGA 2GVAA 2NVXH 1VQJA 4DR5Q 2B63H 3FHWA 4X6AH 1VQGA 3AFQA 3GDEA 2Q2IA 3I4OA 4GN3B 2JA5H 2RCNA 1EOVA 3E9HA 1WFQA 4LF8L 2JA9A 3S24A 4BBRH 3VDYA 1KXLA 1AE2A 3BJUA 4A3KG 4JBWA 1XNQQ 1XTDA 4P75A 2OTLA 1VQ6A 3L0OA 1G291 5IE8A 3EN2A 1C9OA 1VQLA 2A19A 4ALPA 5C0XJ 1VCIA 4A3FH 2ES2A 2JA7G 2CFMA 4JI3Q 2ZJRA 2IY5B 3JAMc 4A3MG 4LF7L 3T1YQ 1XPUA 1CKOA 1W2BA 3S17H 1JJ2A 2OQKA 1X3EA 1KRTA 4DV5Q 3PIPA 4R4OA 4JBMA 2ID0A 4UP7A 4C3IH 4A3JG 1N33L 3GTMH 3PUZA 2JA8H 4JOIC 2VQFQ 1IBMQ 1OXVA 1N36L 1HZAA 2NZOA 3HFZB 3HOVH 4DR6Q 3EBEA 3F1ZA 2VZAA 1NMFA 1TWAH 3PUXA 4AQYL 4B3TL 4YCWA 2KHJA 4PG3A 1N34L 4B3RL 1E1TA 2HT1A 2NZHA 2BA1A 3KF6A 3PSIA 2OCEA 1D8LA 5C4JH 3K7AH 4BA2I 3DM3A 3HKZG 2PI2A 4JI1Q 1S40A 3RN5A 1OXXK 1NE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXP A;  2V1C C;  2MQH A;  3B6Y A;  5BR8 Q;  1HNX L;  1JMC A;  5JJK A;  1EYG A;  3I4M G;  2LXJ A;  1WCM H;  5GAH C;  2D0O A;  5ELO A;  1OXU A;  4LFC Q;  2F52 A;  3W1B A;  2MNA A;  5IYB G;  1VQI A;  2H5X A;  3TRZ A;  1N32 Q;  1YVC A;  2BH2 A;  1PH5 A;  2JJQ A;  1D7Q A;  4LUV A;  3A0J A;  5LMU L;  1BKB A;  2CWP A;  3BZC A;  1WOC A;  1A63 A;  1VQO A;  4DR4 Q;  3ULJ A;  3ULL A;  4A3E H;  4A3C H;  1PYB A;  3FKI H;  3J7A 5;  5M3M H;  2KCT A;  1VQP A;  2YTX A;  1EFW A;  4JI5 Q;  4BA1 I;  1KC8 C;  2VW9 A;  1PVO A;  4JC0 A;  3A5U A;  2Q2U A;  4X65 L;  4MZ9 A;  4IOC A;  4K0K L;  3ZJY C;  1FL0 A;  3RN2 A;  1PH9 A;  2BA0 A;  2UUA Q;  4A3G G;  1C0A A;  3S2H H;  4AIM A;  2UUC L;  3GTO H;  1UE5 A;  1AH9 A;  3RZD H;  4JI8 Q;  2N3S A;  4LUO A;  3RLN A;  3KDF B;  1N9W A;  4NXN Q;  4BY1 G;  3KYH C;  2MO1 A;  2E8G A;  1TXY A;  3K8A A;  5FJ8 H;  3A5Z B;  2B29 A;  5C44 H;  1Q1B A;  3J80 c;  4DR4 L;  2UXB L;  1YNX A;  4LF5 L;  3OTO L;  3OW2 A;  3WWV A;  4NXM Q;  2ATW A;  4DV3 Q;  4L5S A;  4A3G H;  4PZ6 A;  2L15 A;  2K5N A;  1U0L A;  3S1R H;  4LF5 Q;  3M7N A;  1YI2 A;  1SFO H;  4OWW B;  1TWH H;  2NVQ H;  4A3L G;  4O0A A;  4UPA A;  5M5Y H;  4YY3 Q;  3CPF A;  1XPR A;  4A3F G;  1K0R A;  4DAM A;  1Y1W H;  3K81 C;  1YIT A;  1HNX Q;  3HOX H;  1WCM G;  4YCV A;  1PH7 A;  2PQA A;  4JI8 L;  1K83 H;  1X56 A;  1X65 A;  4LF4 L;  2VNU D;  3K7U C;  3AEV A;  4B3M Q;  1Q81 C;  1YJ9 A;  4BBS H;  1IL2 A;  2D0P A;  4JG2 A;  4A3D G;  1QVC A;  2ZTC A;  4KHZ A;  1P8L A;  3IRB A;  2K4K A;  3J81 i;  4DKA C;  3CF5 A;  3PO2 G;  2N8N A;  4P74 A;  3CCS A;  4AQY Q;  4DV2 Q;  1VQN A;  5IYC G;  2AWO A;  1VQ4 A;  4C2M H;  1GM5 A;  4JYA L;  2Y0S E;  1B70 B;  1KAW A;  1WYD A;  4YWM A;  4IJL A;  4A76 A;  2KCM A;  2MFI A;  3RNU A;  4LF6 L;  3M85 A;  4GLA C;  3G4S A;  3CXC A;  1IBM L;  4A3K H;  3JC6 6;  1GO3 E;  3CCJ A;  3GO5 A;  3J80 i;  1R9T H;  4QL5 A;  3FP9 A;  4DR3 L;  3TS2 A;  4O2D A;  3RLO A;  4DV7 Q;  1KL9 A;  2VS1 A;  3MEF A;  2UXD Q;  4A3D H;  2Z6K C;  2Q2H A;  1J5E L;  1BBU A;  1I5F A;  5JEA G;  4DV1 L;  1I6H H;  1PH1 A;  2VUM H;  4A3B G;  2OTJ A;  4LFC L;  1S72 A;  3CCQ A;  2HIX A;  1VQ9 A;  4GKK Q;  2GVB A;  2KEN A;  2RHS B;  1E1O A;  4R4I A;  1O7I A;  3I2Z A;  3U50 C;  5BR8 L;  2HHH Q;  1FJG L;  1XNR L;  4BY1 H;  4LFA Q;  4DAY B;  2UU9 Q;  3I7F A;  1E3P A;  2IX0 A;  1XMO Q;  1K9M C;  1XJV A;  1JJG A;  3KLW A;  1M90 C;  1OXT A;  4QGU A;  3MXN B;  2YTV A;  4LW1 A;  1TWF H;  1UE6 A;  1VQH A;  3M9B A;  5M3F G;  4B3R Q;  3PUY A;  1PYS B;  4GNX C;  4EX5 A;  2QEX A;  3TS0 A;  1PH4 A;  4DR6 L;  1H95 A;  4YCU A;  3CMA A;  4JBJ A;  1HJP A;  2JA5 G;  4BXX H;  2YV5 A;  2Z6K A;  3K80 C;  3F2C A;  1YBY A;  2R7D A;  5IP9 G;  3HOY H;  1FVI A;  4R4C A;  4GN4 B;  1TWG H;  1EIF A;  2R92 G;  1PHJ A;  1J6Q A;  4GS3 A;  3RLF A;  3PIO A;  1VQ7 A;  4DV6 Q;  4OO1 I;  5LMN W;  1K73 C;  5IYD H;  1I94 Q;  3TEH B;  4H02 A;  1PH6 A;  4A75 A;  1X54 A;  1IXR A;  3T1Y L;  1PH2 A;  4LF7 Q;  1X9N A;  3TQY A;  2Z0S A;  2Y0S G;  1JE5 A;  5JJL A;  3TRE A;  1LM0 A;  4JCV E;  1IBL Q;  2R7Z H;  3Q8D A;  5IWA L;  3K0X A;  1A0I A;  1V9P A;  3E0E A;  2ZJP A;  1XMO L;  3UDF A;  2JA8 G;  1X3G A;  3HKS A;  4AYB G;  5IYD G;  3J7Z C;  2UU9 L;  1HZ9 A;  4TQU S;  4DUY Q;  4GOP A;  4LF8 Q;  3KF8 B;  1XNR Q;  4GN5 A;  4OON A;  1UE7 A;  5EAY A;  3UE0 A;  1JB7 A;  4R4Q A;  2K5H A;  2YYZ A;  1CSP A;  5J3B A;  4OX9 L;  2ZJQ A;  2XTI A;  1ASY A;  1WI5 A;  2UXD L;  4HID A;  5E7N A;  4DV7 L;  3F2D A;  3GTL H;  4AYB E;  3HKZ E;  3BU2 A;  1W3S A;  2KBN A;  5IY0 A;  2QA4 A;  4DR7 L;  4HJ7 A;  3L2P A;  1M1K C;  1JJC B;  5C4X H;  3I55 A;  1UEB A;  1PA6 A;  3I4N H;  1A8V A;  1LTL A;  3D31 A;  5FJ8 G;  1NBW A;  5AJ3 L;  1I3Q H;  5C44 G;  3HOU G;  2R6G A;  3ULP A;  3S15 H;  4DV2 L;  3S2D H;  3LGJ A;  2IT1 A;  3D0F A;  1E22 A;  3W5O A;  2A8V A;  1X55 A;  2JA6 G;  4Y52 H;  3CME A;  1K8G A;  4X66 Q;  4JI4 L;  1QZG A;  5HY6 A;  2B63 G;  2R92 H;  1G6P A;  2VUM G;  3ER0 A;  3I4N G;  4JI2 L;  3STB C;  1Y1W G;  1VQF A;  1ASZ A;  3PF5 A;  3JAM i;  1P16 A;  3UDX A;  3PUW A;  5M5X H;  2JK8 A;  1K8A C;  4DUZ L;  2HIV A;  2WAQ E;  3GTK H;  2E2J H;  2NVY H;  3KJO A;  4LF9 L;  1VQK A;  3PF4 A;  3S14 H;  3J81 j;  1HNW Q;  4WJ3 M;  2ZM6 Q;  4DV3 L;  3GTJ H;  5M3F H;  4NXM L;  4UP8 A;  4JV5 Q;  5GAD C;  3OTO Q;  1GVP A;  4YWK A;  4UP9 A;  4GLX A;  1YHA A;  3W1G A;  1QVG A;  2A1A A;  4A3I H;  2I5M X;  1L2F A;  1SLJ A;  1YJN A;  2WAQ G;  3A74 A;  4NXN L;  5LMN L;  4DV0 L;  2JA7 H;  4GKJ Q;  4JI2 Q;  2XGT A;  3GD7 A;  4L5Q A;  2F4V L;  4RMF A;  2NN6 G;  4AH6 A;  4JI0 Q;  2ZTE A;  4JI6 Q;  1VQD A;  4LWC A;  3G48 A;  4X66 L;  3CC4 A;  4JI7 Q;  1HR0 L;  2MO0 A;  2VY3 A;  1B8A A;  1VQA A;  2DGY A;  2OQ0 A;  4NPS A;  1U5K A;  3J81 c;  1G51 A;  2IHF A;  3OYY A;  1HH2 P;  4L5T A;  4YWL A;  3KFU A;  1BBW A;  2B3G A;  2UXC Q;  3CW2 C;  5M3M G;  4GNX B;  1L1O B;  3T1H Q;  3CPW A;  4GOP C;  1LUZ A;  3CC7 A;  1UE1 A;  2ASB A;  1KRS A;  3PCO B;  1WJJ A;  1L1O C;  3H15 A;  4GOP B;  4DR7 Q;  1Q1E A;  1VS0 A;  2QGQ A;  4XTC S;  5GAE C;  2JA6 H;  5LMU Q;  4HIK A;  1NTG A;  2AKW B;  3BZK A;  1OXS C;  4C3H H;  3UDI A;  2UUB Q;  2K5V A;  1PFS A;  3U4V A;  4DK3 C;  3RR5 A;  4FDB A;  1DGS A;  4JBK A;  3CCV A;  3H3V H;  4B3S Q;  2LSS A;  1V43 A;  1IZ6 A;  1IBK Q;  4PZ7 A;  1XPO A;  1MJE A;  1I50 H;  1HNZ L;  4DUY L;  5JJI A;  1N32 L;  1SRO A;  4IPG A;  3RZO H;  2WB1 E;  3CCU A;  2C35 B;  1IBL L;  5C3E G;  2BH8 A;  3GTP H;  2GN5 A;  2E2I H;  2Q2T A;  1NJI C;  3S1N H;  3KJP A;  3EIV A;  4B3T Q;  2CKZ B;  4QY7 A;  3M4P A;  5GAG C;  1CKN A;  1Q46 A;  5HGQ A;  3HOV G;  4LUZ A;  1EIY B;  5C4X G;  1Q8K A;  2IHE A;  3H0G G;  4GNX A;  2R93 G;  4X62 Q;  1B7Y B;  4DK6 C;  1I94 L;  1N36 Q;  2VL6 A;  4XIG S;  2WB1 G;  1KHI A;  2VQF L;  2NVT H;  1SRU A;  4YHH L;  1T9H A;  3ERS X;  4HJA A;  2PMZ E;  1N33 Q;  1X6O A;  1QVF A;  3HOZ G;  2R7Z G;  2CWA A;  1N8R C;  4P71 A;  4YHH Q;  4DV4 Q;  4DV5 L;  4RG1 A;  1YZ6 A;  2PNH A;  4UY8 C;  3G71 A;  3GTG H;  1V1Q A;  1Z9F A;  4X62 L;  2YTY A;  4PZ8 A;  3ICE A;  1XMQ Q;  4A3M H;  1GKH A;  3KOJ A;  4A4I A;  3H0G H;  2R93 H;  1KIX A;  1IYJ B;  4JI3 L;  3S1M H;  4HIO A;  4A93 H;  3NEN A;  4EQ5 A;  5FLM H;  3PO3 H;  4JOI A;  2CCZ A;  3S16 H;  5IT9 c;  4QIW E;  2NN6 I;  1CUK A;  2JE6 I;  1FGU A;  2RF4 A;  1S3O A;  1SR3 A;  2AWN A;  3CP0 A;  2FXQ A;  1Q86 C;  1XNQ L;  4A3L H;  1OTC A;  2ALY B;  4LFA L;  4P73 A;  4LNQ A;  1BVS A;  2HHH L;  1FJG Q;  1VQC A;  2K75 A;  1IBK L;  4GKK L;  4WJ4 A;  4A3I G;  3DLL A;  4B3S L;  3HOU H;  4Y7N H;  1XMQ L;  4IO9 A;  5K36 G;  4DR5 L;  4DV1 Q;  2PI2 E;  1MJC A;  1K3R A;  3HOW G;  1PH8 A;  4IFD J;  3PO3 G;  1YJW A;  1J5E Q;  3S1Q H;  2UUB L;  5C0X G;  1VQB A;  4DV4 L;  4QQB X;  4C3J H;  3KDF A;  3PV0 A;  4DR2 Q;  4DR1 L;  3PUV A;  1L1O A;  4DR3 Q;  1VQ8 A;  4BY7 G;  4HIM A;  1Y1V H;  1QUQ B;  4NB3 A;  4OWT B;  2CQO A;  3AFP A;  4HJ8 A;  1NY4 A;  2VQE Q;  2K52 A;  4LF6 Q;  3I4M H;  2UXC L;  1EQQ A;  4IPC A;  1MKH A;  5C0X I;  1HZB A;  4JYA Q;  4KLK A;  1SE8 A;  4R1J A;  3UDG A;  1YHQ A;  1Q12 A;  1HR0 Q;  3M3Y H;  2K50 A;  4X64 L;  3U4Z A;  1VQM A;  4BY7 H;  2WP8 J;  3CAM A;  1YIJ A;  4B3M L;  4JI6 L;  4A3J H;  2JEB I;  3F2B A;  4LF4 Q;  1AE3 A;  5DLQ E;  1L0W A;  4A3E G;  4POG A;  4A3C G;  3FKI G;  2R7F A;  4POF A;  2AMC B;  1TWC H;  1HNZ Q;  3CD6 A;  1UWV A;  4GKJ L;  3HOX G;  4DV0 Q;  4TVA B;  3SGI A;  4YY3 L;  3CCR A;  4LFB L;  1Q82 C;  3STB D;  1KQS A;  3CC2 A;  4KHP L;  4OWX B;  1EUJ A;  2JEA I;  2E5L Q;  3CCL A;  3CQZ H;  2ZM6 L;  4IJH A;  4P72 A;  3CCM A;  1HNW L;  4LF9 Q;  3CCE A;  3AQQ A;  2UXB Q;  5IYC H;  5FLX c;  2I5H A;  3I56 A;  1CKM A;  3GTQ H;  4BXX G;  4PMW A;  3U58 A;  3T1H L;  2E2H H;  5JEA J;  1VQ5 A;  4IFD I;  2D62 A;  1VQE A;  2WFW A;  4J15 A;  2I0Q A;  5IYB H;  2UUC Q;  4IPH A;  5ELN A;  5H1S E;  4L5R C;  5IP7 H;  1Q7Y C;  4JI4 Q;  2K14 A;  2KHI A;  1PH3 A;  2F3I A;  1YEZ A;  2PQA B;  4JI7 L;  2UUA L;  2N78 A;  3HOZ H;  1Z47 A;  4K0K Q;  4JI0 L;  4X65 Q;  1QZH A;  1Y1V G;  5AJ3 Q;  1RL2 A;  2F4V Q;  4IFD G;  1NMG A;  4APV A;  2HQL A;  1CSQ A;  4JI5 L;  4DNI A;  4MNO A;  5LMN Q;  1SMX A;  4MTN A;  1EQR A;  3H3V I;  2OWO A;  5IP7 G;  4JV5 L;  4A93 G;  1X3F A;  3UE1 A;  5FLM G;  4HJ9 A;  5C3E H;  2JQO A;  1GD7 A;  3PO2 H;  2E5L L;  1KD1 C;  1PV4 A;  4OX9 Q;  4DUZ Q;  4KHP Q;  2N49 A;  3KF6 B;  4HJ5 A;  4LFB Q;  3G6E A;  1C7Y A;  3HOW H;  3NEL A;  4IOA A;  3M4O H;  1CKN B;  1LYL A;  1QUQ A;  2EXD A;  3HOY G;  2EIF A;  5IP9 H;  5GQO A;  5M5W H;  4JI1 L;  2YU9 H;  3M4Q A;  5IWA Q;  1HR0 W;  1EWI A;  1RIP A;  2EQS A;  4QJF A;  2IX1 A;  4X64 Q;  5GRO A;  2I5L X;  1E7Z A;  1N34 Q;  3NEM A;  1E24 A;  2RHQ B;  1Y14 B;  4A3B H;  2ZTD A;  1A62 A;  3PGZ A;  4OO1 G;  4R4T A;  4KI0 A;  3AYH B;  2VQE L;  1HZC A;  4BBR G;  2AHO B;  4ME3 A;  3NBH B;  1SN8 A;  2LXK A;  1JT8 A;  4DV6 L;  3L7Z C;  4IPD A;  3E9I A;  4DR1 Q;  4DR2 L;  1MIU A;  4BBS G;  1YHB A;  3F8T A;  4GLV B;  2DUD A;  4DPG A;  2GVA A;  2NVX H;  1VQJ A;  4DR5 Q;  2B63 H;  3FHW A;  4X6A H;  1VQG A;  3AFQ A;  3GDE A;  2Q2I A;  3I4O A;  4GN3 B;  2JA5 H;  2RCN A;  1EOV A;  3E9H A;  1WFQ A;  4LF8 L;  2JA9 A;  3S24 A;  4BBR H;  3VDY A;  1KXL A;  1AE2 A;  3BJU A;  4A3K G;  4JBW A;  1XNQ Q;  1XTD A;  4P75 A;  2OTL A;  1VQ6 A;  3L0O A;  1G29 1;  5IE8 A;  3EN2 A;  1C9O A;  1VQL A;  2A19 A;  4ALP A;  5C0X J;  1VCI A;  4A3F H;  2ES2 A;  2JA7 G;  2CFM A;  4JI3 Q;  2ZJR A;  2IY5 B;  3JAM c;  4A3M G;  4LF7 L;  3T1Y Q;  1XPU A;  1CKO A;  1W2B A;  3S17 H;  1JJ2 A;  2OQK A;  1X3E A;  1KRT A;  4DV5 Q;  3PIP A;  4R4O A;  4JBM A;  2ID0 A;  4UP7 A;  4C3I H;  4A3J G;  1N33 L;  3GTM H;  3PUZ A;  2JA8 H;  4JOI C;  2VQF Q;  1IBM Q;  1OXV A;  1N36 L;  1HZA A;  2NZO A;  3HFZ B;  3HOV H;  4DR6 Q;  3EBE A;  3F1Z A;  2VZA A;  1NMF A;  1TWA H;  3PUX A;  4AQY L;  4B3T L;  4YCW A;  2KHJ A;  4PG3 A;  1N34 L;  4B3R L;  1E1T A;  2HT1 A;  2NZH A;  2BA1 A;  3KF6 A;  3PSI A;  2OCE A;  1D8L A;  5C4J H;  3K7A H;  4BA2 I;  3DM3 A;  3HKZ G;  2PI2 A;  4JI1 Q;  1S40 A;  3RN5 A;  1OXX K;  1NE3 A; 
#chains in the Genus database with same CATH topology
 3NBI A;  1EYG A;  4RKB A;  5IOD A;  5EKL A;  4B08 A;  2H5X A;  3TRZ A;  4WOR A;  3K5L A;  2F0D A;  3A0J A;  5LMU L;  1WOC A;  4WRD A;  1ICW A;  1BBX C;  1VQO A;  1PYB A;  2XSC A;  2YTX A;  1EFW A;  3J7A F;  2RDF A;  3ITP A;  1J9O A;  4X65 L;  4K0K L;  1BUV T;  1PH9 A;  3MFG A;  2EPB A;  2UUA Q;  3CHB D;  1GJX A;  1PTO C;  3GTM B;  3GTO H;  1HUN A;  1AH9 A;  4H0L C;  2PQE A;  4LUO A;  2DNC A;  1N9W A;  1ONL A;  1SNP A;  1V1P A;  1EFI D;  2L5T A;  1TXY A;  5C44 H;  2B29 A;  2MP1 A;  3G6J B;  1G2T A;  4A3K B;  1HXY D;  2K5Q A;  1EZ6 A;  2H1E A;  4QF4 A;  4P2C B;  1IW7 C;  1BF4 A;  1TII D;  2K5N A;  2H4O A;  3M7N A;  4EGV A;  2KHS A;  3CKI B;  2FMC A;  4G57 A;  2NVQ H;  5CMD A;  4UPA A;  1ENF A;  1XPR A;  4EQN A;  1PH7 A;  1QJO A;  1X65 A;  2EYH A;  3AEV A;  4BBS H;  4ME5 A;  4JK1 C;  1QVC A;  4KHZ A;  1EWC A;  3IRB A;  3MFY A;  3CF5 A;  2E76 C;  3CCS A;  1VQN A;  2AWO A;  4C2M H;  1C8C A;  2Y0S E;  1KAW A;  3GTP B;  5C44 B;  3RNU A;  1CFM A;  4GLA C;  3CXC A;  5KYL A;  1ET9 A;  1R9T H;  2LY7 A;  3RMH A;  3RLO A;  4DV7 Q;  1KL9 A;  3MEF A;  5JVG 3;  3DWQ A;  1TWH B;  3HG9 A;  5J22 A;  1PH1 A;  3K59 A;  1EOT A;  2RHS B;  2HHH Q;  1FJG L;  3I2Z A;  1XNR L;  3W3A A;  4LFA Q;  4DAY B;  1W6K A;  3P1H A;  2IX0 A;  4C3J G;  3R93 A;  1K9M C;  1EQV A;  1B9M A;  3KLW A;  2L1B A;  3MXU A;  2PZU A;  5JEA H;  3T4A C;  4GNX C;  1IW7 D;  4DR6 L;  4YCU A;  1CTM A;  2JA5 G;  4KN4 C;  1JOQ A;  3MEH A;  3K80 C;  5IP9 G;  4R4C A;  4GN4 B;  4Y7N B;  1S5C D;  1J8I A;  4A3M B;  1J6Q A;  3RLF A;  3PMF A;  2Q8R E;  3PIO A;  1VQ7 A;  2K32 A;  5LMN W;  2L11 A;  1PMR A;  5M5W B;  1X54 A;  2HD3 A;  1PH2 A;  3S14 B;  2EVB A;  1Q3L A;  2QKI C;  5M3F B;  1X9N A;  3GTJ B;  3C46 A;  5JJL A;  1LM0 A;  4JCV E;  2EY2 A;  1IBL Q;  1MD2 D;  5IWA L;  1A0I A;  3UDF A;  5IYD G;  3J7Z C;  3S1N B;  2F0J A;  2NB0 A;  4F88 A;  4FF1 A;  5J3B A;  4DA2 A;  2XTI A;  1HA5 A;  1NNX A;  3DXJ C;  2UXD L;  5E7N A;  3F2D A;  4C2M B;  3GTL H;  3HKZ E;  1IYU A;  5IY0 A;  5JPM C;  4HJ7 A;  4X3T A;  1A8V A;  2RKS A;  4CHT B;  1UUP A;  5EPL A;  3A7L A;  3O13 A;  1EZ8 A;  5C44 G;  1L0Y B;  5BN5 A;  3LGJ A;  2B2U C;  1E22 A;  2A8V A;  5ELD A;  5FO9 B;  2JA6 G;  4Y52 H;  2PYK A;  3D3R A;  1TWC B;  2Z1C A;  1DM0 B;  1QZG A;  1FGB D;  2B63 G;  1G6P A;  1CA6 A;  2VUM G;  2FFK B;  2BCO A;  3TN2 A;  1LAB A;  3FPP A;  4JI2 L;  1VQF A;  5TSS A;  1A3V A;  3JAM i;  1O7L A;  1P16 A;  5CV9 A;  5M5X H;  1K8A C;  3MWY W;  3GTK H;  3M3Y B;  5CV5 A;  2E2J H;  3KJO A;  1I4H A;  3PF4 A;  1HNW Q;  2RDH A;  3MXG A;  4BWG B;  3QWN A;  4DV3 L;  4NXM L;  5M3M B;  2PPB C;  4JV5 Q;  1SJH D;  4K6L A;  1ZXT A;  1Y1V B;  2L0C A;  1SSO A;  5LMN L;  3A74 A;  4NXN L;  4FYD A;  2Z8L A;  2ZTE A;  3CC4 A;  2IW3 A;  4QUF A;  1QG7 A;  4EVO A;  3HZX A;  4CKE A;  1TS2 A;  5M5X B;  3CPW A;  1D6E C;  1KLG D;  2F0G A;  4HSV A;  3CC7 A;  1KRS A;  2Z4H A;  3PCO B;  1L1O C;  1S5D D;  4DR7 Q;  5M9O A;  3T53 B;  2JA6 H;  1NTG A;  3BZK A;  3ND9 A;  1NCV A;  3UDI A;  2D5D A;  4FDB A;  1B3Q A;  4JBK A;  4B3S Q;  4OO1 H;  3MC0 B;  4ZCK A;  1IZ6 A;  1PFN A;  4DUY L;  5I4D A;  3FDT A;  1SRO A;  5C3E G;  3EQL C;  1LT3 D;  1U4L A;  2E2I H;  2Q2T A;  1NJI C;  3S1N H;  1U4R A;  3EIV A;  3CQZ B;  4QY7 A;  3D6C A;  5I2X A;  1Q8K A;  1Y8N B;  1STN A;  1I94 L;  1CM9 A;  2VL6 A;  1E2V A;  3S17 B;  3DEO A;  1N33 Q;  4Q5V A;  2K05 A;  4YHH Q;  1PTO D;  3VR6 A;  2PNH A;  1LTA D;  1JC7 A;  2ZXR A;  1XMQ Q;  1YNN D;  4A3M H;  3KOJ A;  3H0G H;  2R93 H;  4A93 H;  2QEJ C;  2SOB A;  4N9P A;  4QIW E;  2NN6 I;  3VR3 A;  1ML0 D;  2RF4 A;  4HED A;  4MN3 A;  1QOH A;  1VF5 C;  5KNC A;  1SE3 A;  1OTC A;  2E75 C;  4LNQ A;  1ZEQ X;  2K75 A;  1XMQ L;  2BDN A;  3T16 A;  3FEW X;  4IO9 A;  1F2Z A;  4DAV A;  1MJC A;  1K3R A;  3ONA B;  1J5E Q;  3PIP 3;  4YIJ A;  5C0X G;  3S1Q H;  1H9S B;  3BVM A;  1A3U A;  3PV0 A;  4DR1 L;  1VQ8 A;  1HFG A;  3M4O B;  4HIM A;  4IFD H;  4NB3 A;  1XXG A;  2CQO A;  4AYB B;  2VQE Q;  4IPC A;  1PXU A;  5C4J B;  4F8M A;  2TSS A;  2VB2 X;  1Q12 A;  1HR0 Q;  3M3Y H;  2K50 A;  3GTK B;  1X3P A;  3U4Z A;  1D1I A;  4JI6 L;  1L0X B;  4A3J H;  2JEB I;  2PO4 A;  5DLQ E;  1L0W A;  4A3E G;  3FKI G;  5FO8 B;  2AMC B;  2CH4 W;  1EQT A;  1R9T B;  3HOX G;  4DV0 Q;  2K04 A;  3OIP A;  3STB D;  2F0O A;  1KQS A;  3CC2 A;  4C1N K;  2E5L Q;  4IUQ A;  4LF9 Q;  3MZ5 A;  3AQQ A;  2UXB Q;  1GUG A;  2EZV A;  2PCF B;  2NYZ D;  3GTQ H;  2NTT A;  2F0N A;  2ZXO A;  2FMM A;  1VQ5 A;  2EE1 A;  2EJM A;  2WFW A;  4J15 A;  5IGD A;  2I0Q A;  1DJR D;  4H7B A;  1RTO A;  5IP7 H;  4JI4 Q;  2RA4 A;  2KHI A;  2PQA B;  2A73 B;  2G9H D;  1Z47 A;  3D6W A;  3ZYY X;  4DK1 A;  1H9M A;  1QZH A;  4ZYS A;  4JI5 L;  2F0H A;  1HCZ A;  5LMN Q;  1SMX A;  5KGU A;  4L63 B;  1MI2 A;  1SAP A;  4JV5 L;  4A93 G;  3BDO A;  5C3E H;  3I73 A;  1AZQ A;  3PO2 H;  1KNE A;  4OX9 Q;  4G4K A;  2MUY A;  2MPM A;  2N49 A;  2PZT A;  3KF6 B;  1F9R A;  2Z4I A;  3HOW H;  3BYY B;  2KED A;  1CKN B;  2EXD A;  3J80 E;  4JI1 L;  2QCP X;  3SE0 A;  1B50 A;  2B2V C;  1PZI D;  5GRO A;  1S5F D;  2TMP A;  3NEM A;  4RGO S;  4A3B H;  4HR7 B;  4OO1 G;  1LV9 A;  1EEF D;  3H94 A;  4IUU A;  4BBR G;  3L7Z C;  4RWS C;  3E9I A;  4DR2 L;  4BBS G;  1PRT C;  3F8T A;  1VQJ A;  2JA8 B;  1ROD A;  3FHW A;  4X6A H;  3AFQ A;  2FJ2 A;  3J7A V;  1WFQ A;  4K8J A;  3VDY A;  1KXL A;  4DNR B;  1ESR A;  3BJU A;  4JBW A;  1XNQ Q;  2JXM B;  3P75 A;  3L0O A;  3E3X A;  3OPO A;  5IE8 A;  1VQL A;  1C9O A;  1FNU A;  5C0X J;  5C4Z A;  2F0S A;  2RCF A;  4JI3 Q;  2ZJR A;  4ZLT F;  3MVV A;  4A3M G;  3S9W A;  1XPU A;  3BS1 A;  1CKO A;  4MIU A;  1HPC A;  1LTT D;  2PMZ B;  4K5W A;  2ZXP A;  4A3F B;  2XWB B;  3ERQ A;  2B63 B;  3GTQ B;  5C4X B;  1STE A;  2JA6 B;  3HFZ B;  1RHP A;  4DR6 Q;  1NMF A;  1QE6 A;  3D4W A;  4B3T L;  2KHJ A;  2SDF A;  1CI3 M;  2NZH A;  3KF6 A;  4DXG A;  2A68 C;  3I8Z A;  1KDA A;  2OCE A;  5KND A;  3DM3 A;  4JI1 Q;  3RN5 A;  1NE3 A;  1N32 Q;  3I91 A;  1RKN A;  4OXP A;  2MQH A;  3DHQ A;  3I4M G;  1SJE D;  2LXJ A;  3HKZ B;  4A3J B;  5GAH C;  2PW5 A;  5ELO A;  3W1B A;  1VQI A;  1YVC A;  2JJQ A;  2XRS D;  4R8N A;  1D7Q A;  1TY2 A;  1EY5 A;  1QB5 D;  4RGN A;  4UHV A;  3ULL A;  4MTK A;  4A3C H;  3FKI H;  1SNQ A;  5M3M H;  2KCT A;  4JI5 Q;  5DEH A;  3VA5 A;  1PVO A;  1ZKO A;  4JC0 A;  3DMU A;  1SMY C;  3UI2 A;  4MZ9 A;  4IOC A;  1BDO A;  1FL0 A;  3PO3 B;  3LNN A;  3S2H H;  2K01 A;  4BY1 G;  2MO1 A;  4QB4 A;  1ZYR C;  1HHV A;  3A5Z B;  4OIJ A;  5HGT A;  2UXB L;  5KEE A;  3OTO L;  2IX3 A;  1VMC A;  2ATW A;  3X3M A;  4A3G H;  4PZ6 A;  2B39 A;  3S1R H;  4O1N A;  1YI2 A;  4OEL B;  1SFO H;  4ZKC B;  5M5Y H;  4A3F G;  3NUC A;  1LTG D;  2OEO A;  4YCV A;  3K5M A;  1K83 H;  3DWP A;  4KKT A;  2F0E A;  1IL2 A;  3MXN A;  2ZTC A;  3PO2 G;  2K4K A;  4DV2 Q;  4PV1 C;  4OGQ C;  1GM5 A;  1B70 B;  1WYD A;  3VR5 A;  5DM7 3;  4RFB A;  3G4S A;  1IBM L;  1DYQ A;  1GO3 E;  3QJY A;  3CCJ A;  3J80 i;  4QL5 A;  3FP9 A;  3GQB A;  4O2D A;  3I4M B;  4A3D H;  1SMY D;  1J5E L;  3NP8 A;  2SNM A;  1EY8 A;  5JEA G;  1I6H H;  2VUM H;  1S4Z A;  1VQ9 A;  1Y8O B;  3I90 A;  4BY1 H;  1ENA A;  4K5X A;  1AZP A;  1XMO Q;  1XJV A;  3A54 A;  1JJG A;  4C3I G;  3KBG A;  4RCO A;  1TWF H;  1VQH A;  4KD3 A;  4B3R Q;  3KF8 A;  2QEX A;  3TS0 A;  3NBH A;  1PH4 A;  2RSN A;  5I6Y A;  1MGS A;  4BXX H;  1X32 A;  3F2C A;  3HOY H;  2F0W A;  4TSS A;  2NWG A;  5JPN C;  5EPJ A;  4OO1 I;  2Z6B A;  5IYD H;  3FKI B;  1GXD C;  1I94 Q;  1TKW B;  4H02 A;  3NQI A;  4IQZ A;  1WTR A;  1PRT D;  3TZD A;  4IN3 A;  2Z0S A;  1KAB A;  1I3Q B;  2Y0S G;  3S15 B;  1AW7 A;  4FF2 A;  1I4X A;  3J81 L;  1VDZ A;  4N9T A;  2WV6 D;  4CDC C;  2JA8 G;  3OWE B;  2UU9 L;  4AYB G;  4DUY Q;  4GOP A;  3NTH A;  4LF8 Q;  4GN5 A;  1STB A;  3KBX A;  4OON A;  1CHQ D;  1STY A;  3UE0 A;  1RD9 D;  4BBS B;  1JB7 A;  1FYC A;  1TS3 A;  1YNJ D;  4R4Q A;  3URY A;  2ENB A;  1JOR A;  5I9P A;  4IAL A;  1WI5 A;  4HID A;  4FXD A;  2NTS A;  2KBN A;  4DR7 L;  1B2T A;  1M1K C;  1JJC B;  5C4X H;  3TP8 A;  1Q8I A;  2AQ2 B;  4O42 A;  3D31 A;  4HN7 A;  5J39 A;  1IL8 A;  5FJ8 G;  3GTL B;  5AJ3 L;  2R6G A;  2KQ3 A;  5CV7 A;  1X55 A;  1JIC A;  3CME A;  1IYV A;  4KN7 C;  2IWH A;  4CJ1 B;  5HY6 A;  1PTO F;  4XQN A;  3SDZ A;  3SR1 A;  3I4N G;  2WII B;  5JVH 3;  4CKC A;  1Y1W G;  2CH4 A;  3FPU B;  3UDX A;  3PUW A;  4RA8 A;  4DGZ A;  1ILQ A;  3J81 j;  4RAU C;  3K5O A;  2ZM6 Q;  3GTJ H;  5M3F H;  1MHW C;  5GAD C;  4UP9 A;  1YHA A;  3C3L A;  2A1A A;  4A3I H;  2I5M X;  2WAQ G;  2JA7 H;  4JI2 Q;  1C4Q A;  3JAM E;  2OXP A;  4RMF A;  1VQD A;  3QIA A;  1CA5 A;  2B2W C;  3G48 A;  3NQT A;  2KOL A;  1B8A A;  1VQA A;  4NPS A;  2OQ0 A;  3OYY A;  4L5T A;  1BBW A;  1PTO H;  2IPK D;  2UXC Q;  1L1O B;  5I2Y A;  3GTG B;  1AP0 A;  2NBF A;  2DNE A;  4GOP B;  1Q1E A;  2QGQ A;  4XTC S;  3G7L A;  2MJ8 A;  4HIK A;  1OXS C;  2QDL A;  3U4V A;  1EYA A;  2DY7 A;  1BCP F;  4JPB W;  4FF4 A;  2LSS A;  1V43 A;  5KIX A;  1IBK Q;  1SYE A;  1I50 H;  4PMC A;  3D4R A;  1GHK A;  1EY0 A;  3RZO H;  2E2H B;  1IBL L;  2BH8 A;  3GTP H;  2QIL A;  2D9U A;  3M4P A;  2L55 A;  3NXW A;  5G3L D;  3Q22 A;  4LUZ A;  1U4P A;  3FRP B;  3HOV G;  4ZUJ A;  3H0G G;  2R93 G;  4RKL A;  1B7Y B;  4X62 Q;  1WTH A;  2WB1 G;  1KHI A;  2B2Y C;  4IUT A;  3ERS X;  2PMZ E;  1X6O A;  1GUN A;  2CWA A;  3QR8 A;  3TSS A;  4DV4 Q;  2JA5 B;  4HMJ A;  3G71 A;  2K5D A;  1D5Z C;  1Z9F A;  1QNK A;  4DAY A;  1GKH A;  4HTH A;  1TWG B;  3C1F A;  4H44 C;  3NEN A;  3PO3 H;  4LAA A;  2CCZ A;  2JA7 B;  3HS0 C;  5IT9 c;  4RHR A;  2F0T A;  5HUR A;  1HUM A;  3K6O A;  1S3O A;  3CP0 A;  1B53 A;  1F2Y A;  2FXQ A;  2ALY B;  4DAP A;  4LFA L;  4P73 A;  4C3J B;  2E2D C;  1FNW A;  2K03 A;  2HHH L;  1FJG Q;  1VQC A;  4WJ4 A;  3R3O A;  4A3I G;  4DR5 L;  2PI2 E;  3W2D A;  1K8O A;  4XT3 B;  2UUB L;  4L8J A;  3SK5 A;  3KDF A;  5D65 A;  1L1O A;  1JR0 D;  1Y1V H;  2K7V A;  4HCS A;  1BCP B;  2K52 A;  1MKH A;  3AU7 A;  5C0X I;  4R1J A;  5K36 H;  3UDG A;  1TY0 A;  3S1Q B;  2L4N A;  2EJF C;  1CQV A;  1EY9 A;  4BY7 H;  3CAM A;  4IUR A;  4RCN A;  2B2Y A;  1TWC H;  3CD6 A;  4GKJ L;  1UWV A;  1HTP A;  3VYS A;  4EQO A;  4LFB L;  3SGI A;  2BE5 C;  4GZY C;  2F3V A;  4A93 B;  1S5B D;  3H0G B;  2R93 B;  3M4Y A;  3CCM A;  5F2D A;  2HDM A;  5IYC H;  3I56 A;  2I5H A;  4U67 3;  1DOL A;  3U58 A;  4CDD C;  1I4R A;  3T1H L;  2DJF C;  2E2H H;  4K5V A;  4OEM B;  4I7A A;  5EPK A;  2K14 A;  3HOX B;  5CR3 A;  2Z9H A;  2UUA L;  5E4X A;  4C3H B;  1JE4 A;  2B2W A;  4K0K Q;  4JI0 L;  4X65 Q;  1Y1V G;  1TS5 A;  1NMG A;  4APV A;  3AMU A;  2N88 A;  1EQR A;  2OWO A;  3I3C A;  3RZD B;  2F0I A;  4F7X A;  1A6X A;  2ICI A;  2A68 D;  1V1P B;  3M7G A;  1PV4 A;  2EY1 A;  1MSH A;  4LFB Q;  1C7Y A;  5COY A;  1NR4 A;  1LYL A;  2EIF A;  5IP9 H;  2ICE C;  5GQO A;  2YU9 H;  1EWI A;  1RIP A;  4UAI A;  4QJF A;  2I5L X;  1N34 Q;  1Y14 B;  1FD7 D;  1LAC A;  2ZTD A;  4N8F A;  5IIF A;  4ME3 A;  1SN8 A;  2LXK A;  1JT8 A;  4DV6 L;  3TBI B;  4IPD A;  2A5H A;  1STH A;  1YHB A;  1U4M A;  4GLV B;  2IJ0 A;  1F9S A;  4DR5 Q;  2NVX H;  1VQG A;  3SXH A;  1YNN C;  3S24 A;  2FHT A;  1AE2 A;  3DEP A;  2EJG C;  4CKB A;  1VQ6 A;  3QB3 A;  3EJI A;  4LMQ D;  1SEB D;  2EYF A;  2IY5 B;  4C3I B;  3JAM c;  4LF7 L;  3T1Y Q;  2HCC A;  5IGB A;  4KD4 A;  2RVL A;  1JJ2 A;  2ZT9 C;  1CZW A;  2NN6 H;  2ID0 A;  2GA4 B;  4UP7 A;  4C3I H;  4QUC A;  1DCZ A;  4JOI C;  4ZRZ A;  3EA6 A;  3EBE A;  3F1Z A;  1TWA H;  3PUX A;  4AQY L;  5CYU A;  1B4O A;  3MTS A;  4C1N I;  2BA1 A;  4PQX A;  5BN4 A;  5C4J H;  2WAC A;  4BA2 I;  1EEI D;  2O4X A;  2PI2 A;  4V0B A;  1LT6 D;  2KCN A;  3B6Y A;  5JJK A;  1HNX L;  1JMC A;  4CJ2 C;  1WCM H;  1OXU A;  3NE5 B;  2F52 A;  5BN3 A;  2MNA A;  1ESF A;  4R8I A;  5J1Z A;  5COR A;  4LUV A;  1BKB A;  3BG3 A;  1A15 A;  1A63 A;  3LWU A;  1JOK A;  2O5J C;  4DR4 Q;  4A3E H;  2AQ3 B;  3J7A 5;  5D14 A;  2F0F A;  1KC8 C;  2YU9 B;  1QNU A;  4HAE A;  3ZJY C;  3RN2 A;  1WTQ A;  4A3G G;  1C0A A;  1E0B A;  4H13 C;  4AIM A;  4I7Z C;  2VUM B;  3FMC A;  4IZ8 A;  4ZKB B;  4IUV A;  1O80 A;  4JI8 Q;  2N3S A;  3KDF B;  1WTP A;  4RH6 A;  5FJ8 H;  2Y0S B;  4DR4 L;  3J80 c;  1UAP A;  3HOV B;  1HQR D;  2L15 A;  4LF5 Q;  4OWW B;  1TWH H;  4A3L G;  3I4N B;  3CPF A;  1Y1W H;  4DAM A;  1HNX Q;  3K81 C;  5KYI A;  4KKU A;  3HOX H;  1YIT A;  1WCM G;  1PFM A;  1B1Z A;  2PQA A;  1I50 B;  4LF4 L;  2VNU D;  3K57 A;  2L9H A;  3K7U C;  3LWE A;  4E6I A;  1YJ9 A;  2D0P A;  4JG2 A;  4A3D G;  2AUJ D;  2V4D A;  1JOO A;  1P8L A;  3J81 i;  2N8N A;  1SFO B;  4AQY Q;  1VQ4 A;  2F0M A;  5A2Q L;  4G7Z C;  4KTA A;  4YWM A;  4LF6 L;  2A6E C;  4IJL A;  2G9D A;  3M85 A;  4ZK9 B;  3JC6 6;  1HFN A;  1M8A A;  4RGT A;  4DR3 L;  1EIG A;  2O5I C;  2VS1 A;  2Z6K C;  2F0Q A;  1I5F A;  4DV1 L;  5I6W A;  4A3B G;  1XWE A;  3Q23 A;  4LFC L;  3DUZ A;  2KEN A;  4GKK Q;  4R4I A;  1E1O A;  5FKA C;  1B9N A;  3U50 C;  5BR8 L;  3MA2 B;  2UU9 Q;  2A6H D;  2K33 A;  3I7F A;  1E3P A;  3I70 A;  1ILP A;  1QIL A;  4QGU A;  3MXN B;  3J80 L;  4LW1 A;  3PO2 B;  3PUY A;  2CW0 C;  4XYO A;  4QIW B;  1GUS A;  3CMA A;  2PZW A;  2OT2 A;  2YV5 A;  2Z6K A;  3K0Y A;  1YBY A;  5T1G A;  1K0S A;  2XVS A;  3WDN A;  4M8A A;  4DV6 Q;  2JYO A;  1AN8 A;  1K73 C;  3TEH B;  4DXF A;  1PH6 A;  4A75 A;  1CK1 A;  1TS4 A;  2EYL A;  1JE5 A;  4XQQ A;  1SE2 A;  5C6A A;  1JWS D;  2KUM A;  4LK1 C;  3T56 B;  2R7Z H;  3Q8D A;  2BOS A;  1V9P A;  1XMO L;  1X3G A;  5E1F A;  1HZ9 A;  5EJW A;  3KF8 B;  3N52 A;  1SYB A;  2EYP A;  2K5H A;  1CSP A;  2DY8 A;  2XNA C;  3A56 A;  3MAQ A;  2QA4 A;  1Y8P B;  3E5S A;  3L2P A;  1EYD A;  3I4N H;  1RTN A;  1SYD A;  1GUW A;  2K6A A;  4C56 C;  1F9P A;  3I4L A;  1SXT A;  3S15 H;  1NBW A;  3HOU G;  1I3Q H;  3PIO 3;  3ULP A;  4DV2 L;  1TU2 B;  2IT1 A;  3D0F A;  2KEC A;  3L3O C;  5C5M A;  3NWT A;  2R92 H;  1RJT A;  3KLR A;  2HUG A;  2F0K A;  3ER0 A;  3MXP A;  1WD0 A;  4J1M A;  3STB C;  3FVQ A;  1ASZ A;  3BZD B;  1ZYR D;  4DF7 A;  4DUZ L;  3S14 H;  1VQK A;  4WJ3 M;  4UP8 A;  4HMI A;  1GVP A;  4YWK A;  5IGE A;  3OTO Q;  4GLX A;  2JP1 A;  3W1G A;  1BCP D;  3E0J A;  3H91 A;  5D3D A;  5EGT A;  4GKJ Q;  3A8J E;  2XGT A;  3H09 A;  4BY1 B;  2F4V L;  4ID6 A;  4G7O C;  4AH6 A;  1D5M C;  4LWC A;  4X66 L;  4JI7 Q;  1H9J A;  2B8G A;  2CHB D;  3J81 c;  3HOU B;  4A3E B;  4OL7 A;  2IHF A;  2KJX A;  2QF7 A;  3CW2 C;  4GNX B;  5C3E B;  4GOP C;  1WD1 A;  4RGM A;  4V19 0;  3NTK A;  2VXW A;  5GAE C;  5E4W C;  2AKW B;  2UUB Q;  4C3H H;  4FP5 D;  5FOB B;  2K5V A;  4DK3 C;  1DON A;  4K6D A;  3A7A B;  3CCV A;  3H3V H;  1A3T A;  5FLX L;  1XPO A;  1HNZ L;  5JJI A;  2R3Z A;  1N32 L;  2WB1 E;  1H9K A;  2C35 B;  4KY5 A;  3CCU A;  2F03 A;  4ZQ3 A;  5EQ0 A;  4B3T Q;  3R8B A;  2CKZ B;  5GAG C;  3PQI A;  1CKN A;  1Q46 A;  1BO0 A;  5C4X G;  3P20 A;  2IHE A;  1A2U A;  3Q0A A;  2NVT H;  3NTI A;  4HJA A;  1QVF A;  3HOZ G;  2R7Z G;  1FR3 A;  1DD2 A;  3OHX C;  3H6M A;  1YZ6 A;  4FXG C;  4UY8 C;  5CBA E;  1F9Q A;  1V1Q A;  4X62 L;  2YTY A;  4X3K A;  1DZ1 A;  2I46 A;  2C9O A;  3S1M H;  3EFX D;  4JI3 L;  4HIO A;  2EDG A;  4EQ5 A;  4LJZ C;  2WKC A;  1GHJ A;  1STA A;  1CUK A;  3N6R A;  2JE6 I;  1SR3 A;  2AWN A;  3VYU A;  4WJW A;  1XNQ L;  1DXM A;  4A3L H;  2NVX B;  2A74 C;  1BR9 A;  4C3H G;  1BOS A;  3TZU A;  3P7J A;  1IBK L;  2EXZ A;  5IT9 L;  4DU9 A;  3HOU H;  1YNJ C;  1Q90 A;  5K36 G;  3HOW G;  3HOY B;  1PH8 A;  1YJW A;  3OMC A;  1VQB A;  5ELF A;  4CDE C;  1WVL A;  4QQB X;  4C3J H;  4DR2 Q;  4BY7 G;  3PUV A;  5KRU A;  1QUQ B;  1HA6 A;  1H9S A;  3AFP A;  4HJ8 A;  1NY4 A;  2UXC L;  1EQQ A;  4PNY A;  4JYA Q;  2VB3 X;  3TDQ A;  4CGY B;  2EOT A;  1VQM A;  5K5P A;  4B3M L;  1PFB A;  1EIH A;  5ELC A;  4XYQ A;  3CRK C;  4POG A;  4ABN A;  2B2T C;  2R7F A;  1D5X C;  5JOB A;  1VF7 A;  1KLU D;  4ODG A;  4KHV A;  1HNZ Q;  2M2L A;  1AEX A;  4TVA B;  4YY3 L;  3CCR A;  5CGK A;  2R92 B;  1Q82 C;  3K7A B;  1TQO A;  4OWX B;  2I07 B;  4QMG A;  2JEA I;  2O2L D;  5G3L F;  3CCL A;  2ZM6 L;  4IJH A;  1NR2 A;  4KK7 A;  4P72 A;  3CCE A;  3D8G A;  5FLX E;  1B44 D;  2HDL A;  1TR5 A;  1CKM A;  4BXX G;  4IFD I;  1VQE A;  2D62 A;  5IYB H;  2UUC Q;  1K83 B;  5H1S E;  3CRL C;  4HCE A;  1Q7Y C;  4L5R C;  1JQY D;  1O78 A;  2F3I A;  4JI7 L;  1Y69 U;  4WFN 3;  5AJ3 Q;  1RL2 A;  2F4V Q;  1WTO A;  1G91 A;  1HTL D;  2HQL A;  1CSQ A;  4DNI A;  4MNO A;  2NZ1 D;  1V8Q A;  1A2T A;  2XIW A;  4MTN A;  3H3V I;  3NSW A;  5IP7 G;  1X3F A;  3UE1 A;  2JQO A;  1RF2 D;  4UDU C;  2BDO A;  2E5L L;  4ULL A;  1WTX A;  4DUZ Q;  3VA7 A;  5NUC A;  3J81 E;  4HJ5 A;  4BY7 B;  3U9S A;  3NEL A;  2WB1 B;  1QUQ A;  3BYT B;  2HCI A;  1RCV D;  3OMG A;  3M4Q A;  1CZG A;  4CBV A;  4NW2 A;  3GV3 A;  3EVQ A;  3DM1 A;  2J4X A;  4JVZ A;  2WIN B;  2B2U A;  1A62 A;  1PZK D;  5C3W A;  4KI0 A;  3BVZ A;  1X3Q A;  2VQE L;  1HZC A;  2F0L A;  2AHO B;  3S1M B;  3IFT A;  4DR1 Q;  1ENC A;  2DUD A;  2GVA A;  2XRQ D;  1K3B C;  3ND8 A;  1PRT B;  5D3I B;  3I4O A;  3GDE A;  3HP3 A;  5LHY 1;  3HOZ B;  1TWA B;  3NWS A;  2JA5 H;  2RCN A;  3OW7 A;  2RDG A;  3E9H A;  2JA9 A;  4BBR H;  1XX8 A;  4JW0 A;  3GP7 A;  1R4Q B;  4NKL A;  1S5E D;  2F4I A;  1G29 1;  5IT9 E;  3EN2 A;  2A19 A;  4ALP A;  1VCI A;  2KCC A;  1SYF A;  2ES2 A;  2JA7 G;  4K2L A;  1TT2 A;  3BVG A;  1W2B A;  4DNT B;  2LKV A;  3H3V C;  3PIP A;  4R4O A;  4XT1 B;  4ZAI A;  2CW0 D;  5DNF A;  1N33 L;  3GTM H;  3PUZ A;  4CJ0 B;  1IBM Q;  1TVX A;  1SNM A;  2F0U A;  2NZO A;  1EU4 A;  1KAA A;  5E3F A;  3OIQ A;  4L6T B;  2HT1 A;  1F77 A;  2EYM A;  2P5Z X;  1D8L A;  3K7A H;  4ZUI A;  3HKZ G;  3GTG H;  1OXX K;  5M5W H;  3T13 A;  2V1C C;  3C1E A;  3SEB A;  5BR8 Q;  1EU3 A;  2D0O A;  2K5W A;  1SDF A;  3D4D A;  4LFC Q;  5IYB G;  1T5E A;  3K58 A;  2BH2 A;  3U9O A;  1PH5 A;  5CC4 A;  1V1O A;  2CWP A;  2RSO A;  3BZC A;  3TP6 A;  2LS0 1;  3ULJ A;  1VQP A;  4BA1 I;  2VW9 A;  2EYJ A;  2C5C A;  1F2M A;  3A5U A;  1EY7 A;  2Q2U A;  1EWH A;  4KV6 A;  2BA0 A;  2EY5 A;  5KNB A;  2MGS A;  4IUN A;  2UUC L;  1UE5 A;  2EY6 A;  2JSO A;  3RZD H;  3NPP A;  3RLN A;  3I72 A;  4DFA A;  4DN4 M;  2Q8T A;  4NXN Q;  3SVM A;  3KYH C;  2E8G A;  3VYR A;  3K8A A;  1ICF B;  1Q1B A;  1KTK A;  2WAQ B;  1YNX A;  4LF5 L;  3OW2 A;  3WWV A;  4NXM Q;  1SE4 A;  4DV3 Q;  4CDF C;  4L5S A;  5LL6 S;  1U0L A;  2QW7 A;  3TP5 A;  3IAY A;  2SNS A;  4O0A A;  4YY3 Q;  5LL6 X;  1K0R A;  1O7Y A;  4JI8 L;  1LO5 D;  1X56 A;  1SNO A;  3KLS A;  2NVT B;  4B3M Q;  1Q81 C;  1RDP D;  1G8Z D;  2OF1 A;  4PMB A;  4K2K A;  4Z9C B;  1LTI D;  4DKA C;  4P74 A;  2NVQ B;  3A8I E;  5IYC G;  4JYA L;  2IL8 A;  2B2V A;  4A76 A;  2KCM A;  2MFI A;  1KDC A;  4A3K H;  1LTS D;  1SYG A;  3GO5 A;  4NMZ A;  4M1U B;  3TS2 A;  3HEJ A;  2UXD Q;  2Q2H A;  1BBU A;  5AFW A;  3S2H B;  1LTB D;  3TME A;  3QG1 A;  3GTO B;  2OTJ A;  1E2W A;  1C48 A;  1S72 A;  3CCQ A;  2HIX A;  2GVB A;  1EL0 A;  1O7I A;  1UEA B;  4ILW A;  5T1I A;  1LLR D;  4KY7 A;  1W6J A;  5JAV A;  1M90 C;  1OXT A;  2X6L A;  1CT1 D;  2YTV A;  1JWM D;  5JJZ A;  1UE6 A;  3M9B A;  5M3F G;  3QO2 A;  1PYS B;  4EX5 A;  1JCK B;  3VYT A;  1H95 A;  3RUZ A;  4JBJ A;  1HJP A;  2KA7 A;  3F2U A;  3BDL A;  2R7D A;  5L37 A;  1FVI A;  3Q24 A;  1TWG H;  2M00 A;  1EIF A;  5EBC A;  2R92 G;  1PHJ A;  4GS3 A;  5IOC A;  1I6H B;  1KDB A;  1IXR A;  2NVY B;  3T1Y L;  4LF7 Q;  3TQY A;  2E74 C;  3TRE A;  5EKI A;  1Z6H A;  2A69 C;  3K0X A;  3IL8 A;  3E0E A;  2QDB A;  4NDX A;  2ZJP A;  3A55 A;  2HQE A;  1R4P B;  3HKS A;  4TQU S;  4Q0F A;  1XNR Q;  4A3D B;  1UE7 A;  5EAY A;  4X3S A;  5ELB A;  2YYZ A;  4OX9 L;  3S2D B;  3V96 A;  1DOM A;  2G5D A;  2ZJQ A;  1ASY A;  4KJN A;  4DV7 L;  4K14 A;  2DN8 A;  3BU2 A;  1W3S A;  3R2T A;  4TRD A;  4AYB E;  1HRJ A;  3WOE A;  3I55 A;  1UEB A;  1PA6 A;  5M5Y B;  1LTL A;  4OIK A;  3OSO A;  2PW7 A;  3S2D H;  2KVM A;  3W5O A;  1K8G A;  4X66 Q;  1I4G A;  2CVR A;  2XWJ B;  4JI4 L;  2AQ1 B;  4G7H C;  4KKS A;  4A3G B;  4FNF A;  3PF5 A;  2XN9 C;  3RD4 A;  2JK8 A;  2WKD A;  2HIV A;  2WAQ E;  2NVY H;  2EYO A;  1WTV A;  4LF9 L;  1HQM C;  3HGB A;  1K28 A;  5ISR A;  1BCP C;  1QVG A;  5CBE E;  1L2F A;  1SLJ A;  1YJN A;  4R9W A;  3SK4 A;  4DV0 L;  4B9X A;  1I4Q A;  3GD7 A;  4L5Q A;  3HOW B;  2NN6 G;  3QOL A;  4JI0 Q;  4JI6 Q;  4A3I B;  2SEB D;  2R61 A;  2MO0 A;  1HR0 L;  2VY3 A;  2DGY A;  1U5K A;  2LMC B;  1QCB D;  1G51 A;  4YWL A;  1HH2 P;  5IGC A;  4FF3 A;  2FIN B;  5DM6 3;  3KFU A;  3MHB A;  1VMP A;  2B3G A;  3Q6S A;  5M3M G;  3T1H Q;  1LUZ A;  1UE1 A;  2ASB A;  2E2J B;  1WJJ A;  2BE5 D;  5IGG A;  3H15 A;  2A69 D;  1VS0 A;  3OWF A;  3A8K E;  5LMU Q;  1SBB B;  4I65 A;  1PFS A;  1I6V C;  4XDX A;  3RR5 A;  1PZJ D;  4HSP A;  1DGS A;  4PZ7 A;  1MJE A;  3AB9 A;  4OHJ A;  4J6H A;  3GV6 A;  4IPG A;  1KNA A;  1B3A A;  2CQA A;  1XTC D;  3OOC A;  2GN5 A;  3DWA A;  3K5N A;  2NUC A;  1I4P A;  4IUP A;  3KJP A;  3SK6 A;  3TP7 A;  5HGQ A;  1EIY B;  4GNX A;  4MHE A;  5C3X A;  4DK6 C;  1LTR D;  1N36 Q;  4XIG S;  2VQF L;  1SRU A;  3RZO B;  4KJO A;  4YHH L;  1T9H A;  1EYC A;  3X3N A;  3KUP A;  3C2P A;  2J7Z A;  1N8R C;  4P71 A;  4DV5 L;  4RG1 A;  2N55 A;  5EBD A;  5CV4 A;  4PZ8 A;  3ICE A;  4XXE A;  4A4I A;  1KIX A;  1IYJ B;  1QWY A;  5FLM H;  3J7Y W;  4JOI A;  3S16 H;  1Z7T A;  1FGU A;  1H9R A;  1Q86 C;  3JAM L;  2LFN A;  1BVS A;  1BNZ A;  4A3B B;  4GKK L;  3DLL A;  4B3S L;  3VR4 A;  2MHV A;  4Y7N H;  1BXT A;  4DV1 Q;  2K28 A;  4IFD J;  1FNV A;  3PO3 G;  4DV4 L;  1MSG A;  4F87 A;  4DR3 Q;  5DAU A;  4OWT B;  1E2Z A;  4XQJ A;  1LT5 D;  4LF6 Q;  3I4M H;  5EKK A;  1D1K A;  2M9V A;  2F1M A;  1HZB A;  4KLK A;  1SE8 A;  3S16 B;  1IHZ A;  1YHQ A;  4FVM A;  1SNC A;  1IKL A;  1MBY A;  4X64 L;  3QOJ A;  3CU7 A;  2WP8 J;  1YIJ A;  1JWU D;  1WCM B;  3WOF A;  3F2B A;  4LF4 Q;  1AE3 A;  4A3C G;  1U9R A;  4POF A;  5CV8 A;  1BQQ T;  4N8X 1;  2JN4 A;  5C5L A;  4KHP L;  1EY6 A;  1EUJ A;  3T51 B;  3CQZ H;  1HNW L;  4BS9 A;  1PYW D;  1PRT F;  3LX0 A;  3V05 A;  5FLX c;  3S1R B;  1CQF A;  4J8Q A;  4PMW A;  5I9O A;  5IGF A;  5CV6 A;  1PLF A;  1IKM A;  5JEA J;  4IPH A;  5ELN A;  1DOK A;  1PH3 A;  1YEZ A;  2N78 A;  3HOZ H;  4IFD G;  2R7Z B;  4NP5 A;  2AUK A;  4BBR B;  1OO9 B;  4B9W A;  1F2L A;  2F0P A;  1GUO A;  4HJ9 A;  5FLM G;  2X69 A;  4KMU C;  1GD7 A;  1KD1 C;  4KHP Q;  1STG A;  2F3W A;  3G6E A;  4EQP A;  1JB3 A;  2F0V A;  2KEE A;  4IOA A;  4U68 A;  3M4O H;  1AFP A;  3HOY G;  2RQX A;  5A2Q E;  1UNS A;  5IWA Q;  1HR0 W;  2EQS A;  2IX1 A;  4RHS A;  4X64 Q;  1E7Z A;  1E24 A;  2RHQ B;  3IFD A;  5A35 A;  3L9A X;  3PGZ A;  4R4T A;  1TWF B;  3NK9 A;  3AYH B;  1CHP D;  1GUT A;  3NBH B;  1O7Z A;  2L12 A;  2B8F A;  1MIU A;  1M4V A;  1PDQ A;  4TKO B;  1ET6 A;  2D2C C;  1NAP A;  4FXK C;  4DPG A;  1D2B A;  4FO2 A;  4S3S A;  2B63 H;  1G2S A;  2Q2I A;  4GN3 B;  2A6H C;  2J0T D;  1EOV A;  3SHL A;  1II3 A;  4LF8 L;  4A3K G;  5C0X H;  1GOZ A;  1NSN S;  1XTD A;  4P75 A;  2OTL A;  1EY4 A;  1LT4 D;  1XYI A;  5ELE A;  4A3F H;  2DJG C;  2CFM A;  3KK7 A;  3BDC A;  3HRZ C;  3KLS X;  5C4H A;  4KY6 A;  3S17 H;  4QCL A;  2OQK A;  2A6E D;  4DK0 A;  1WTW A;  1X3E A;  5FK9 C;  1KRT A;  4DV5 Q;  1T5X D;  1Y1W B;  4JBM A;  2Q8I B;  3E6Z X;  4X3U A;  4A3J G;  3SK8 A;  3V2T A;  1K8M A;  2JA8 H;  1G6Z A;  2VQF Q;  2E2I B;  1NUC A;  2X6G A;  1OXV A;  1N36 L;  5FO7 B;  2K1B A;  1HZA A;  3HOV H;  2RBM A;  4K8I A;  2VZA A;  4YCW A;  4PG3 A;  1N34 L;  4B3R L;  1E1T A;  3PSI A;  3IKJ A;  2B2T A;  3VR2 A;  1PTO B;  3R2I A;  3ERO A;  2PNR C;  1S40 A;  1SYC A;  1SND A;  3NHH A; 
#chains in the Genus database with same CATH homology
 4OXP A;  2V1C C;  2MQH A;  3B6Y A;  5BR8 Q;  1HNX L;  1JMC A;  5JJK A;  1EYG A;  3I4M G;  2LXJ A;  1WCM H;  5GAH C;  2D0O A;  5ELO A;  1OXU A;  4LFC Q;  2F52 A;  3W1B A;  2MNA A;  5IYB G;  1VQI A;  2H5X A;  3TRZ A;  1N32 Q;  1YVC A;  2BH2 A;  1PH5 A;  2JJQ A;  1D7Q A;  4LUV A;  3A0J A;  5LMU L;  1BKB A;  2CWP A;  3BZC A;  1WOC A;  1A63 A;  1VQO A;  4DR4 Q;  3ULJ A;  3ULL A;  4A3E H;  4A3C H;  1PYB A;  3FKI H;  3J7A 5;  5M3M H;  2KCT A;  1VQP A;  2YTX A;  1EFW A;  4JI5 Q;  4BA1 I;  1KC8 C;  2VW9 A;  1PVO A;  4JC0 A;  3A5U A;  2Q2U A;  4X65 L;  4MZ9 A;  4IOC A;  4K0K L;  3ZJY C;  1FL0 A;  3RN2 A;  1PH9 A;  2BA0 A;  2UUA Q;  4A3G G;  1C0A A;  3S2H H;  4AIM A;  2UUC L;  3GTO H;  1UE5 A;  1AH9 A;  3RZD H;  4JI8 Q;  2N3S A;  4LUO A;  3RLN A;  3KDF B;  1N9W A;  4NXN Q;  4BY1 G;  3KYH C;  2MO1 A;  2E8G A;  1TXY A;  3K8A A;  5FJ8 H;  3A5Z B;  2B29 A;  5C44 H;  1Q1B A;  3J80 c;  4DR4 L;  2UXB L;  1YNX A;  4LF5 L;  3OTO L;  3OW2 A;  3WWV A;  4NXM Q;  2ATW A;  4DV3 Q;  4L5S A;  4A3G H;  4PZ6 A;  2L15 A;  2K5N A;  1U0L A;  3S1R H;  4LF5 Q;  3M7N A;  1YI2 A;  1SFO H;  4OWW B;  1TWH H;  2NVQ H;  4A3L G;  4O0A A;  4UPA A;  5M5Y H;  4YY3 Q;  3CPF A;  1XPR A;  4A3F G;  1K0R A;  4DAM A;  1Y1W H;  3K81 C;  1YIT A;  1HNX Q;  3HOX H;  1WCM G;  4YCV A;  1PH7 A;  2PQA A;  4JI8 L;  1K83 H;  1X56 A;  1X65 A;  4LF4 L;  2VNU D;  3K7U C;  3AEV A;  4B3M Q;  1Q81 C;  1YJ9 A;  4BBS H;  1IL2 A;  2D0P A;  4JG2 A;  4A3D G;  1QVC A;  2ZTC A;  4KHZ A;  1P8L A;  3IRB A;  2K4K A;  3J81 i;  4DKA C;  3CF5 A;  3PO2 G;  2N8N A;  4P74 A;  3CCS A;  4AQY Q;  4DV2 Q;  1VQN A;  5IYC G;  2AWO A;  1VQ4 A;  4C2M H;  1GM5 A;  4JYA L;  2Y0S E;  1B70 B;  1KAW A;  1WYD A;  4YWM A;  4IJL A;  4A76 A;  2KCM A;  2MFI A;  3RNU A;  4LF6 L;  3M85 A;  4GLA C;  3G4S A;  3CXC A;  1IBM L;  4A3K H;  3JC6 6;  1GO3 E;  3CCJ A;  3GO5 A;  3J80 i;  1R9T H;  4QL5 A;  3FP9 A;  4DR3 L;  3TS2 A;  4O2D A;  3RLO A;  4DV7 Q;  1KL9 A;  2VS1 A;  3MEF A;  2UXD Q;  4A3D H;  2Z6K C;  2Q2H A;  1J5E L;  1BBU A;  1I5F A;  5JEA G;  4DV1 L;  1I6H H;  1PH1 A;  2VUM H;  4A3B G;  2OTJ A;  4LFC L;  1S72 A;  3CCQ A;  2HIX A;  1VQ9 A;  4GKK Q;  2GVB A;  2KEN A;  2RHS B;  1E1O A;  4R4I A;  1O7I A;  3I2Z A;  3U50 C;  5BR8 L;  2HHH Q;  1FJG L;  1XNR L;  4BY1 H;  4LFA Q;  4DAY B;  2UU9 Q;  3I7F A;  1E3P A;  2IX0 A;  1XMO Q;  1K9M C;  1XJV A;  1JJG A;  3KLW A;  1M90 C;  1OXT A;  4QGU A;  3MXN B;  2YTV A;  4LW1 A;  1TWF H;  1UE6 A;  1VQH A;  3M9B A;  5M3F G;  4B3R Q;  3PUY A;  1PYS B;  4GNX C;  4EX5 A;  2QEX A;  3TS0 A;  1PH4 A;  4DR6 L;  1H95 A;  4YCU A;  3CMA A;  4JBJ A;  1HJP A;  2JA5 G;  4BXX H;  2YV5 A;  2Z6K A;  3K80 C;  3F2C A;  1YBY A;  2R7D A;  5IP9 G;  3HOY H;  1FVI A;  4R4C A;  4GN4 B;  1TWG H;  1EIF A;  2R92 G;  1PHJ A;  1J6Q A;  4GS3 A;  3RLF A;  3PIO A;  1VQ7 A;  4DV6 Q;  4OO1 I;  5LMN W;  1K73 C;  5IYD H;  1I94 Q;  3TEH B;  4H02 A;  1PH6 A;  4A75 A;  1X54 A;  1IXR A;  3T1Y L;  1PH2 A;  4LF7 Q;  1X9N A;  3TQY A;  2Z0S A;  2Y0S G;  1JE5 A;  5JJL A;  3TRE A;  1LM0 A;  4JCV E;  1IBL Q;  2R7Z H;  3Q8D A;  5IWA L;  3K0X A;  1A0I A;  1V9P A;  3E0E A;  2ZJP A;  1XMO L;  3UDF A;  2JA8 G;  1X3G A;  3HKS A;  4AYB G;  5IYD G;  3J7Z C;  2UU9 L;  1HZ9 A;  4TQU S;  4DUY Q;  4GOP A;  4LF8 Q;  3KF8 B;  1XNR Q;  4GN5 A;  4OON A;  1UE7 A;  5EAY A;  3UE0 A;  1JB7 A;  4R4Q A;  2K5H A;  2YYZ A;  1CSP A;  5J3B A;  4OX9 L;  2ZJQ A;  2XTI A;  1ASY A;  1WI5 A;  2UXD L;  4HID A;  5E7N A;  4DV7 L;  3F2D A;  3GTL H;  4AYB E;  3HKZ E;  3BU2 A;  1W3S A;  2KBN A;  5IY0 A;  2QA4 A;  4DR7 L;  4HJ7 A;  3L2P A;  1M1K C;  1JJC B;  5C4X H;  3I55 A;  1UEB A;  1PA6 A;  3I4N H;  1A8V A;  1LTL A;  3D31 A;  5FJ8 G;  1NBW A;  5AJ3 L;  1I3Q H;  5C44 G;  3HOU G;  2R6G A;  3ULP A;  3S15 H;  4DV2 L;  3S2D H;  3LGJ A;  2IT1 A;  3D0F A;  1E22 A;  3W5O A;  2A8V A;  1X55 A;  2JA6 G;  4Y52 H;  3CME A;  1K8G A;  4X66 Q;  4JI4 L;  1QZG A;  5HY6 A;  2B63 G;  2R92 H;  1G6P A;  2VUM G;  3ER0 A;  3I4N G;  4JI2 L;  3STB C;  1Y1W G;  1VQF A;  1ASZ A;  3PF5 A;  3JAM i;  1P16 A;  3UDX A;  3PUW A;  5M5X H;  2JK8 A;  1K8A C;  4DUZ L;  2HIV A;  2WAQ E;  3GTK H;  2E2J H;  2NVY H;  3KJO A;  4LF9 L;  1VQK A;  3PF4 A;  3S14 H;  3J81 j;  1HNW Q;  4WJ3 M;  2ZM6 Q;  4DV3 L;  3GTJ H;  5M3F H;  4NXM L;  4UP8 A;  4JV5 Q;  5GAD C;  3OTO Q;  1GVP A;  4YWK A;  4UP9 A;  4GLX A;  1YHA A;  3W1G A;  1QVG A;  2A1A A;  4A3I H;  2I5M X;  1L2F A;  1SLJ A;  1YJN A;  2WAQ G;  3A74 A;  4NXN L;  5LMN L;  4DV0 L;  2JA7 H;  4GKJ Q;  4JI2 Q;  2XGT A;  3GD7 A;  4L5Q A;  2F4V L;  4RMF A;  2NN6 G;  4AH6 A;  4JI0 Q;  2ZTE A;  4JI6 Q;  1VQD A;  4LWC A;  3G48 A;  4X66 L;  3CC4 A;  4JI7 Q;  1HR0 L;  2MO0 A;  2VY3 A;  1B8A A;  1VQA A;  2DGY A;  2OQ0 A;  4NPS A;  1U5K A;  3J81 c;  1G51 A;  2IHF A;  3OYY A;  1HH2 P;  4L5T A;  4YWL A;  3KFU A;  1BBW A;  2B3G A;  2UXC Q;  3CW2 C;  5M3M G;  4GNX B;  1L1O B;  3T1H Q;  3CPW A;  4GOP C;  1LUZ A;  3CC7 A;  1UE1 A;  2ASB A;  1KRS A;  3PCO B;  1WJJ A;  1L1O C;  3H15 A;  4GOP B;  4DR7 Q;  1Q1E A;  1VS0 A;  2QGQ A;  4XTC S;  5GAE C;  2JA6 H;  5LMU Q;  4HIK A;  1NTG A;  2AKW B;  3BZK A;  1OXS C;  4C3H H;  3UDI A;  2UUB Q;  2K5V A;  1PFS A;  3U4V A;  4DK3 C;  3RR5 A;  4FDB A;  1DGS A;  4JBK A;  3CCV A;  3H3V H;  4B3S Q;  2LSS A;  1V43 A;  1IZ6 A;  1IBK Q;  4PZ7 A;  1XPO A;  1MJE A;  1I50 H;  1HNZ L;  4DUY L;  5JJI A;  1N32 L;  1SRO A;  4IPG A;  3RZO H;  2WB1 E;  3CCU A;  2C35 B;  1IBL L;  5C3E G;  2BH8 A;  3GTP H;  2GN5 A;  2E2I H;  2Q2T A;  1NJI C;  3S1N H;  3KJP A;  3EIV A;  4B3T Q;  2CKZ B;  4QY7 A;  3M4P A;  5GAG C;  1CKN A;  1Q46 A;  5HGQ A;  3HOV G;  4LUZ A;  1EIY B;  5C4X G;  1Q8K A;  2IHE A;  3H0G G;  4GNX A;  2R93 G;  4X62 Q;  1B7Y B;  4DK6 C;  1I94 L;  1N36 Q;  2VL6 A;  4XIG S;  2WB1 G;  1KHI A;  2VQF L;  2NVT H;  1SRU A;  4YHH L;  1T9H A;  3ERS X;  4HJA A;  2PMZ E;  1N33 Q;  1X6O A;  1QVF A;  3HOZ G;  2R7Z G;  2CWA A;  1N8R C;  4P71 A;  4YHH Q;  4DV4 Q;  4DV5 L;  4RG1 A;  1YZ6 A;  2PNH A;  4UY8 C;  3G71 A;  3GTG H;  1V1Q A;  1Z9F A;  4X62 L;  2YTY A;  4PZ8 A;  3ICE A;  1XMQ Q;  4A3M H;  1GKH A;  3KOJ A;  4A4I A;  3H0G H;  2R93 H;  1KIX A;  1IYJ B;  4JI3 L;  3S1M H;  4HIO A;  4A93 H;  3NEN A;  4EQ5 A;  5FLM H;  3PO3 H;  4JOI A;  2CCZ A;  3S16 H;  5IT9 c;  4QIW E;  2NN6 I;  1CUK A;  2JE6 I;  1FGU A;  2RF4 A;  1S3O A;  1SR3 A;  2AWN A;  3CP0 A;  2FXQ A;  1Q86 C;  1XNQ L;  4A3L H;  1OTC A;  2ALY B;  4LFA L;  4P73 A;  4LNQ A;  1BVS A;  2HHH L;  1FJG Q;  1VQC A;  2K75 A;  1IBK L;  4GKK L;  4WJ4 A;  4A3I G;  3DLL A;  4B3S L;  3HOU H;  4Y7N H;  1XMQ L;  4IO9 A;  5K36 G;  4DR5 L;  4DV1 Q;  2PI2 E;  1MJC A;  1K3R A;  3HOW G;  1PH8 A;  4IFD J;  3PO3 G;  1YJW A;  1J5E Q;  3S1Q H;  2UUB L;  5C0X G;  1VQB A;  4DV4 L;  4QQB X;  4C3J H;  3KDF A;  3PV0 A;  4DR2 Q;  4DR1 L;  3PUV A;  1L1O A;  4DR3 Q;  1VQ8 A;  4BY7 G;  4HIM A;  1Y1V H;  1QUQ B;  4NB3 A;  4OWT B;  2CQO A;  3AFP A;  4HJ8 A;  1NY4 A;  2VQE Q;  2K52 A;  4LF6 Q;  3I4M H;  2UXC L;  1EQQ A;  4IPC A;  1MKH A;  5C0X I;  1HZB A;  4JYA Q;  4KLK A;  1SE8 A;  4R1J A;  3UDG A;  1YHQ A;  1Q12 A;  1HR0 Q;  3M3Y H;  2K50 A;  4X64 L;  3U4Z A;  1VQM A;  4BY7 H;  2WP8 J;  3CAM A;  1YIJ A;  4B3M L;  4JI6 L;  4A3J H;  2JEB I;  3F2B A;  4LF4 Q;  1AE3 A;  5DLQ E;  1L0W A;  4A3E G;  4POG A;  4A3C G;  3FKI G;  2R7F A;  4POF A;  2AMC B;  1TWC H;  1HNZ Q;  3CD6 A;  1UWV A;  4GKJ L;  3HOX G;  4DV0 Q;  4TVA B;  3SGI A;  4YY3 L;  3CCR A;  4LFB L;  1Q82 C;  3STB D;  1KQS A;  3CC2 A;  4KHP L;  4OWX B;  1EUJ A;  2JEA I;  2E5L Q;  3CCL A;  3CQZ H;  2ZM6 L;  4IJH A;  4P72 A;  3CCM A;  1HNW L;  4LF9 Q;  3CCE A;  3AQQ A;  2UXB Q;  5IYC H;  5FLX c;  2I5H A;  3I56 A;  1CKM A;  3GTQ H;  4BXX G;  4PMW A;  3U58 A;  3T1H L;  2E2H H;  5JEA J;  1VQ5 A;  4IFD I;  2D62 A;  1VQE A;  2WFW A;  4J15 A;  2I0Q A;  5IYB H;  2UUC Q;  4IPH A;  5ELN A;  5H1S E;  4L5R C;  5IP7 H;  1Q7Y C;  4JI4 Q;  2K14 A;  2KHI A;  1PH3 A;  2F3I A;  1YEZ A;  2PQA B;  4JI7 L;  2UUA L;  2N78 A;  3HOZ H;  1Z47 A;  4K0K Q;  4JI0 L;  4X65 Q;  1QZH A;  1Y1V G;  5AJ3 Q;  1RL2 A;  2F4V Q;  4IFD G;  1NMG A;  4APV A;  2HQL A;  1CSQ A;  4JI5 L;  4DNI A;  4MNO A;  5LMN Q;  1SMX A;  4MTN A;  1EQR A;  3H3V I;  2OWO A;  5IP7 G;  4JV5 L;  4A93 G;  1X3F A;  3UE1 A;  5FLM G;  4HJ9 A;  5C3E H;  2JQO A;  1GD7 A;  3PO2 H;  2E5L L;  1KD1 C;  1PV4 A;  4OX9 Q;  4DUZ Q;  4KHP Q;  2N49 A;  3KF6 B;  4HJ5 A;  4LFB Q;  3G6E A;  1C7Y A;  3HOW H;  3NEL A;  4IOA A;  3M4O H;  1CKN B;  1LYL A;  1QUQ A;  2EXD A;  3HOY G;  2EIF A;  5IP9 H;  5GQO A;  5M5W H;  4JI1 L;  2YU9 H;  3M4Q A;  5IWA Q;  1HR0 W;  1EWI A;  1RIP A;  2EQS A;  4QJF A;  2IX1 A;  4X64 Q;  5GRO A;  2I5L X;  1E7Z A;  1N34 Q;  3NEM A;  1E24 A;  2RHQ B;  1Y14 B;  4A3B H;  2ZTD A;  1A62 A;  3PGZ A;  4OO1 G;  4R4T A;  4KI0 A;  3AYH B;  2VQE L;  1HZC A;  4BBR G;  2AHO B;  4ME3 A;  3NBH B;  1SN8 A;  2LXK A;  1JT8 A;  4DV6 L;  3L7Z C;  4IPD A;  3E9I A;  4DR1 Q;  4DR2 L;  1MIU A;  4BBS G;  1YHB A;  3F8T A;  4GLV B;  2DUD A;  4DPG A;  2GVA A;  2NVX H;  1VQJ A;  4DR5 Q;  2B63 H;  3FHW A;  4X6A H;  1VQG A;  3AFQ A;  3GDE A;  2Q2I A;  3I4O A;  4GN3 B;  2JA5 H;  2RCN A;  1EOV A;  3E9H A;  1WFQ A;  4LF8 L;  2JA9 A;  3S24 A;  4BBR H;  3VDY A;  1KXL A;  1AE2 A;  3BJU A;  4A3K G;  4JBW A;  1XNQ Q;  1XTD A;  4P75 A;  2OTL A;  1VQ6 A;  3L0O A;  1G29 1;  5IE8 A;  3EN2 A;  1C9O A;  1VQL A;  2A19 A;  4ALP A;  5C0X J;  1VCI A;  4A3F H;  2ES2 A;  2JA7 G;  2CFM A;  4JI3 Q;  2ZJR A;  2IY5 B;  3JAM c;  4A3M G;  4LF7 L;  3T1Y Q;  1XPU A;  1CKO A;  1W2B A;  3S17 H;  1JJ2 A;  2OQK A;  1X3E A;  1KRT A;  4DV5 Q;  3PIP A;  4R4O A;  4JBM A;  2ID0 A;  4UP7 A;  4C3I H;  4A3J G;  1N33 L;  3GTM H;  3PUZ A;  2JA8 H;  4JOI C;  2VQF Q;  1IBM Q;  1OXV A;  1N36 L;  1HZA A;  2NZO A;  3HFZ B;  3HOV H;  4DR6 Q;  3EBE A;  3F1Z A;  2VZA A;  1NMF A;  1TWA H;  3PUX A;  4AQY L;  4B3T L;  4YCW A;  2KHJ A;  4PG3 A;  1N34 L;  4B3R L;  1E1T A;  2HT1 A;  2NZH A;  2BA1 A;  3KF6 A;  3PSI A;  2OCE A;  1D8L A;  5C4J H;  3K7A H;  4BA2 I;  3DM3 A;  3HKZ G;  2PI2 A;  4JI1 Q;  1S40 A;  3RN5 A;  1OXX K;  1NE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...