3EIVA

Crystal structure of single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
98
Chain Sequence
b'ETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPDGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSRTVYELDVDEVGASLRSATAKVTKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein 2
publication title Structure of the single-stranded DNA-binding protein from Streptomyces coelicolor.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 16
structure length 98
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3eivA00
3K80C 1PH1A 1K9MC 1R9TH 1CKMA 2AWNA 4IOAA 3KJPA 4YY3L 1PH9A 1SR3A 3PO2H 4X65L 4OX9Q 4QQBX 2ZTCA 1WFQA 3I4NH 1CKOA 1HH2P 4DR1Q 4APVA 2UXCL 3GDEA 4PZ7A 1HNZQ 2PMZE 2YV5A 4IPGA 2IX0A 4NXNL 4JI8Q 4B3RQ 1NTGA 2HQLA 3NEMA 3DLLA 3BU2A 1VQ4A 3KFUA 5GQOA 4WJ4A 4HJAA 2CFMA 3I55A 3E9HA 1Y1WG 4UPAA 3J81i 1I94Q 4JG2A 4P71A 2NVQH 2HIVA 4JI6Q 3PIPA 2Q2HA 4IFDI 2NZHA 2WAQE 4DR1L 4LF7L 1YI2A 1CKNA 1PH4A 4A3EG 1A8VA 1HNZL 3W5OA 1HR0W 4LFCQ 3H3VH 2B3GA 4B3RL 1L2FA 1XPRA 3KOJA 2JE6I 2AMCB 3K7UC 4YWMA 3I7FA 1PA6A 4MTNA 1JJ2A 2A8VA 5GADC 1LUZA 4GN4B 1CSPA 4DV2L 2JA5G 3F8TA 1A63A 2NVTH 1XNQQ 1K8AC 4DV6Q 1B7YB 1HR0Q 3K7AH 3NELA 2GVAA 1AE2A 3CCSA 2K5NA 2MFIA 4JOIA 4UP8A 3FKIH 3EN2A 3L7ZC 5GROA 4DV4Q 4DV0L 1XNRL 1NE3A 1VQHA 4AH6A 1YNXA 2WFWA 4DAYB 2BH8A 4FDBA 3M85A 4DR4Q 2OCEA 1X3FA 4JOIC 4A93H 4DAMA 1PHJA 2YTYA 1XNQL 5C0XI 3RNUA 4DV6L 4JI3L 1S72A 1PH3A 3CCQA 4GLXA 3W1BA 5LMUQ 2JJQA 4BY7H 4JBJA 4LFBQ 3HOYG 3TS0A 3GTOH 1K73C 1KXLA 1Q1BA 4PZ8A 5M5XH 4DV4L 2JA7H 1SE8A 2YYZA 4DR4L 2VY3A 4R4IA 3H0GH 1N34Q 1HNWL 1RL2A 1K8GA 5K36G 5LMUL 2EXDA 1XPUA 1JJGA 2Q2TA 4UP9A 5M3FG 1WCMG 4DV3Q 1VQ8A 2OTJA 5FLXc 2UXDQ 1EOVA 1N33L 4IPCA 2FXQA 5HY6A 1DGSA 4LF5Q 2VQEQ 4Y52H 4PG3A 3S1MH 4DUYQ 2UU9L 4A3MG 1E1OA 3GTKH 1N34L 2L15A 3E0EA 1UE5A 5IYCG 4Y7NH 1ASYA 2C35B 4QY7A 2NZOA 2OQ0A 4J15A 5DLQE 4X6AH 2I0QA 2IHFA 1N9WA 4KHZA 3G71A 2R92H 5AJ3L 1HZCA 2KENA 2BA1A 5C4JH 2ZJQA 1KAWA 2VQEL 1Y1VG 2KBNA 3ULJA 5M5YH 3OTOQ 3A5UA 4P72A 4OWXB 1QVCA 5LMNL 3GTPH 4A3JG 5E7NA 1Y1WH 4BXXH 1NMFA 3W1GA 5H1SE 1VQ9A 4A3BG 1V43A 1OXTA 2KCMA 3TREA 4A3KG 1Q1EA 1BBUA 4YCUA 4IFDJ 4A3EH 4B3MQ 2VUMH 1TWFH 3PF4A 2IY5B 4BBSG 3CCRA 1QVGA 3CC4A 1K3RA 3RLNA 1VQPA 1X65A 1XMOQ 3OTOL 3ICEA 1J5EQ 4TQUS 3A0JA 5GAHC 2K14A 3LGJA 2JA5H 1GD7A 4DR7L 1HZAA 3CP0A 4L5SA 3HOWG 4KHPQ 4OO1G 1Q12A 4DV1Q 1AE3A 2NN6G 3S16H 2XTIA 1JMCA 1Y14B 3F2CA 4LUOA 4DUZL 4DR6Q 1SFOH 3ER0A 1LM0A 4IOCA 4JI4Q 3UDFA 4QIWE 1MJEA 2VW9A 3S1NH 3G6EA 4A76A 3UE0A 3STBC 1IBLQ 4LF9Q 4OWWB 1JT8A 3NENA 4AQYL 5IP9H 3S24A 3F2DA 1YHQA 2E5LQ 3M4OH 4DV1L 5C0XJ 1XJVA 1EQQA 3M4PA 2UUCL 3RZOH 3HOYH 3A74A 1VQDA 2Y0SG 2JEAI 2QEXA 4DV7L 3RLFA 1PVOA 2EQSA 1I50H 4R1JA 1KHIA 1XTDA 1S40A 3TS2A 2MO1A 1B8AA 3BZKA 2D62A 4JI1Q 2MNAA 4C3IH 2E5LL 3GTQH 5IE8A 4IO9A 1X55A 3CCUA 2F4VL 1H95A 3IRBA 4GS3A 1VQLA 4PZ6A 1VQ5A 3PUXA 1XMQQ 1WCMH 3HOVG 4A3GH 4DR2Q 4JV5L 4PMWA 3HOUG 1YIJA 1HNXL 3PUYA 4KI0A 1E22A 2ZJRA 3CPWA 1VQJA 1SMXA 2YTVA 2LSSA 2NVYH 1I3QH 4HJ7A 1O7IA 4A3MH 4L5RC 1D8LA 4OX9L 2NVXH 2F3IA 5GAEC 3I4MH 2K5VA 5IYCH 2CWAA 2ZM6Q 3BJUA 1VQ7A 1HZ9A 1KRTA 4YCWA 4JBKA 1FJGQ 3M3YH 4A3CG 4POGA 1XMQL 1PH8A 3JAMc 4JI8L 2RHQB 2A19A 3G48A 4P74A 4BY1G 4POFA 4X66Q 4DR2L 3RN2A 1P8LA 1WOCA 1FGUA 5IY0A 2JA9A 2V1CC 1HZBA 5C3EG 1NJIC 1Y1VH 3UDXA 1X9NA 1I94L 4JI6L 3T1YQ 4A3JH 4LF8Q 2IHEA 2ZM6L 4JBWA 5IYBG 3CXCA 4A3BH 4A3KH 4IJHA 2ZJPA 2E2JH 4H02A 5ELOA 4LFAQ 4LFCL 4JYAQ 2KHIA 2GN5A 2WP8J 1RIPA 3S2DH 1A0IA 4GN3B 4X66L 4BBSH 3PF5A 1FL0A 1JE5A 4HJ8A 2Y0SE 2QGQA 1E1TA 2Q2UA 1K0RA 4TVAB 2ID0A 2B63G 2MQHA 2IT1A 1X3GA 4JI0Q 2PNHA 4NXMQ 1I6HH 1HR0L 1KIXA 2XGTA 1CSQA 1M1KC 2E2HH 2QA4A 3HOWH 3FP9A 3CCLA 5FJ8G 4IFDG 1IZ6A 3ULPA 2ASBA 3T1HQ 3U4VA 5C44G 1KRSA 3WWVA 4GLAC 3PUVA 1G6PA 3CAMA 4UP7A 2I5MX 5M3MG 4LUZA 3I56A 3JAMi 5GAGC 3DM3A 3J81j 3NBHB 3D0FA 3ZJYC 4DKAC 4JI0L 3HOXH 4GNXA 1VQEA 2WB1G 2B29A 1PH6A 4LFBL 3FHWA 1JB7A 1YJWA 4DR5Q 5IYDH 3T1HL 3OW2A 3U50C 3H3VI 1BVSA 2K4KA 1AH9A 2HT1A 4LWCA 4YCVA 1EIFA 4LF6Q 1N32Q 1PFSA 1OTCA 1MKHA 3J7ZC 3PO3G 3S2HH 2OWOA 5C0XG 3CMAA 4L5QA 1TWHH 3CC7A 1YZ6A 3HKSA 4RG1A 4DV3L 1X56A 2UXDL 1GM5A 3HOVH 5JEAJ 2UUAQ 4LF5L 3HOUH 3B6YA 1UEBA 3CQZH 5BR8Q 4L5TA 1W2BA 1N32L 4JCVE 4DUYL 4R4OA 1YJ9A 4LF4Q 3HOZG 3L0OA 4XIGS 1P16A 2ZTDA 1PH5A 4EQ5A 1UE6A 4IPDA 1EWIA 1IBKQ 1E3PA 1G51A 2VL6A 4O2DA 1IBMQ 1EIYB 4A3LG 4A3CH 3PCOB 3K8AA 1W3SA 1U5KA 1YBYA 2NN6I 4ALPA 4BY1H 1YJNA 4P75A 1G291 1OXVA 3GTJH 2N78A 5BR8L 3RZDH 2PQAA 2N3SA 5IWAQ 3S14H 1YEZA 5C3EH 4LF4L 4BA1I 3CMEA 1KL9A 4DV5Q 1EYGA 4YWKA 3RR5A 1Q86C 1X54A 5IYBH 1IBML 1E7ZA 2JA8G 1L1OA 4B3ML 2WB1E 4JC0A 3I4OA 3MXNB 2DGYA 4OXPA 1X3EA 1XMOL 1PV4A 4GKJQ 1J5EL 5IWAL 3S1RH 2HHHQ 2R6GA 1ASZA 1VQIA 2B63H 1A62A 1YITA 1VQCA 4B3TQ 1PYSB 4DV5L 4KHPL 2UUBQ 1K83H 4MNOA 3ULLA 3UDGA 2RF4A 4MZ9A 3RN5A 1VQMA 1N36Q 2I5LX 2WAQG 1C0AA 1Q7YC 5JJLA 5FJ8H 4IPHA 3RLOA 1MJCA 4C3JH 1SRUA 4A3FG 4JI2Q 1Q81C 4R4TA 5C44H 2KCTA 4DR6L 2ALYB 1MIUA 1I5FA 4JI4L 4HIMA 4GKJL 4O0AA 2HHHL 1E24A 1TWAH 2AKWB 1VQKA 1IBLL 4LF9L 4B3TL 1SN8A 1VS0A 3AYHB 2UUBL 3CPFA 4EX5A 1Q82C 1VQ6A 1EFWA 4BBRG 3D31A 5M3FH 4JI2L 1OXUA 4X65Q 3GTGH 2ES2A 3CCVA 3CCJA 4JBMA 2R7ZG 2BA0A 1LTLA 5HGQA 5IP7G 4HIDA 2VNUD 2PI2E 2N8NA 3A5ZB 3K0XA 4JI1L 3PV0A 4YHHQ 1UE7A 4NXNQ 3PUZA 3TEHB 3CW2C 3PO3H 3EIVA 3M4QA 3CCEA 2A1AA 4AYBG 4DPGA 1BBWA 3KDFB 2JQOA 3GD7A 2R93G 3L2PA 2E8GA 4GNXB 2MO0A 1EQRA 1SLJA 4LUVA 4DR3Q 4LF7Q 2GVBA 2K75A 4B3SQ 1LYLA 2R92G 1B70B 1WI5A 1GKHA 4YHHL 2K52A 3TQYA 4A3IG 3HOZH 1NMGA 1UWVA 2N49A 2PI2A 3UDIA 3AQQA 1FJGL 2UXBQ 2ZTEA 1OXXK 2YTXA 3HFZB 3GTMH 1QUQB 4DV2Q 2JA6G 2F52A 4BXXG 1VQOA 4A3LH 1M90C 5JEAG 1D7QA 2R7DA 2LXJA 4ME3A 4DR3L 1T9HA 2K5HA 2AWOA 4B3SL 1Q8KA 2RHSB 1BKBA 4KLKA 2VUMG 2JEBI 4WJ3M 5JJKA 2Z0SA 3KF6B 3T1YL 4HJ9A 1KD1C 4LF8L 2D0PA 4DV0Q 1PYBA 1XNRQ 4DK6C 1QVFA 1OXSC 2UXBL 4QGUA 4JYAL 3H15A 1S3OA 5J3BA 4LFAL 2JA8H 3J7A5 4LNQA 4A3DG 4HIOA 3GTLH 4JI3Q 2EIFA 3S17H 1Z47A 2VS1A 3SGIA 3AFPA 5ELNA 1TXYA 3CF5A 4JI5Q 2KHJA 1WJJA 4R4CA 1U0LA 3KDFA 1TWGH 3HKZG 5JJIA 1XPOA 3I2ZA 3KF8B 4NXML 3STBD 2PQAB 3F2BA 3AEVA 2JK8A 5FLMG 1V1QA 2H5XA 3JC66 3G4SA 4GOPB 4DNIA 1PH2A 3S15H 4NPSA 5IP9G 4GNXC 5IT9c 3Q8DA 4AYBE 4A3FH 3CC2A 1HNWQ 1IXRA 4X62Q 4OONA 1L1OB 2LXKA 3CCMA 1X6OA 4JI5L 2IX1A 5C4XG 4DK3C 1Z9FA 4QJFA 1QUQA 4C3HH 2YU9H 2Q2IA 1VQBA 1N33Q 1HJPA 1YVCA 1IL2A 1TWCH 2CQOA 4DR5L 3PUWA 2Z6KA 2UU9Q 4BBRH 3PO2G 1FVIA 3ERSX 1YHAA 5LMNW 3KF6A 4X62L 1WYDA 2R7FA 1VQGA 2VQFQ 4YWLA 1KC8C 4LF6L 3I4NG 3M7NA 2Z6KC 1KQSA 3VDYA 2I5HA 4XTCS 2R7ZH 4A3GG 5IP7H 3J80c 2CCZA 3KYHC 5AJ3Q 2OQKA 3PIOA 3F1ZA 1QZGA 4IJLA 1C7YA 2R93H 1J6QA 5LMNQ 4OO1I 3PSIA 3I4MG 2ATWA 2AHOB 4A4IA 3AFQA 2UUAL 2VQFL 1PH7A 4P73A 5EAYA 5M5WH 1VQFA 4GOPA 4AIMA 1SROA 3E9IA 4GLVB 4A3IH 1UE1A 1GVPA 3TRZA 2CKZB 4HIKA 1IBKL 1Q46A 4GOPC 3HKZE 4X64Q 4JI7Q 2JA6H 1GO3E 1YHBA 4DR7Q 3PGZA 3KJOA 1NBWA 3EBEA 3M9BA 3OYYA 1QZHA 2E2IH 1L1OC 4A75A 1N8RC 1CUKA 3FKIG 1L0WA 4RMFA 4C2MH 2D0OA 1JJCB 2RCNA 2DUDA 4DUZQ 2CWPA 4A93G 3MEFA 3J80i 2OTLA 1IYJB 4X64L 4JI7L 4A3DH 4AQYQ 4BY7G 4BA2I 4GKKQ 5M3MH 2UUCQ 1NY4A 4QL5A 1C9OA 4NB3A 4K0KQ 4DV7Q 2JA7G 1EUJA 4LW1A 4R4QA 3J81c 4GN5A 4HJ5A 2K50A 1CKNB 1N36L 1V9PA 1VQNA 3UE1A 3CD6A 5FLMH 1VCIA 2VZAA 3BZCA 4YY3Q 2BH2A 3H0GG 3KLWA 3HOXG 4OWTB 2F4VQ 4GKKL 3U4ZA 2HIXA 3S1QH 2UXCQ 5IYDG 5C4XH 3U58A 4K0KL 4UY8C 4JV5Q 3GO5A 1HNXQ 3K81C 1VQAA
chains in the Genus database with same CATH superfamily
1PH1A 5EPKA 3HRZC 1HH2P 2UXCL 3NWSA 2YV5A 3I73A 1G8ZD 2HQLA 2RKSA 3BU2A 4WJ4A 3I55A 1H9SA 3HOVB 2KA7A 3J81i 1A3TA 2IW3A 2NZHA 4DR1L 1BBXC 1CKNA 2F0TA 1M4VA 1PH4A 2B3GA 1MGSA 1LV9A 3OMCA 4YWMA 3I7FA 2R93B 4MTNA 1LT3D 2A8VA 4F7XA 3F8TA 4I65A 4BY1B 2EYLA 1D5MC 5DM63 4DV6Q 1F9PA 1B9NA 2GVAA 3EVQA 2WACA 3SK5A 4A3IB 2MFIA 1GOZA 3FKIH 1HFNA 4DV0L 1XNRL 1NE3A 3W3AA 3M85A 1STBA 3CRKC 3E6ZX 4FDBA 5CYUA 5IGFA 2NYZD 4DAMA 4DNTB 1PHJA 4GLXA 3W1BA 4BY7H 4JBJA 5JAVA 2IL8A 5BN4A 5FLXL 1PZJD 5J1ZA 4C3JB 1DYQA 1TS3A 3RD4A 3D8GA 3P75A 5C44B 1CFMA 4C3IG 1RL2A 2F3VA 1ML0D 2F4IA 4DV3Q 4QCLA 5DM73 2WB1B 1EOVA 4FF2A 4IPCA 2HCCA 4OL7A 4Y52H 2EJGC 1EIGA 1JCKB 1EOTA 1AP0A 1UE5A 4Y7NH 4QUFA 1STHA 2R92H 1N9WA 3KLSA 1HZCA 2X6GA 3OSOA 1QG7A 3VA5A 2EXZA 2R61A 4OWXB 4R8NA 4PV1C 3EQLC 3TMEA 5E7NA 1EY4A 4BXXH 1QB5D 3DWAA 4A3BG 2B2TA 3TREA 4A3KG 1Q1EA 1BBUA 1CA5A 4B3MQ 2VUMH 2B2TC 1QVGA 2J4XA 1D5XC 1VQPA 4DA2A 3OTOL 3ICEA 4KD3A 4IUTA 2K14A 2QF7A 1SNQA 3NQIA 4OEMB 1GXDC 4L5SA 1AE3A 2NN6G 2XTIA 1JMCA 1Y14B 3F2CA 4DUZL 2AQ1B 1MI2A 1XXGA 3UDFA 1EY9A 3GTLB 1JT8A 4LF9Q 1IBLQ 2EDGA 4AQYL 1LO5D 1PRTB 3TP8A 5FO7B 5IGDA 5C0XJ 3RZOH 4PMBA 2Y0SG 2HUGA 4KY6A 4DV7L 1C48A 3SE0A 3DEPA 1I50H 2RCFA 2MO1A 2VB3X 4C3IH 2E5LL 2O2LD 1H95A 1LTGD 3PUXA 1XMQQ 1DJRD 3JAML 4XT3B 2FJ2A 2M9VA 1HNXL 2ZJRA 5DNFA 1UNSA 2NVYH 1DXMA 2K32A 1HZ9A 4KMUC 4U68A 3AB9A 1PH8A 1CHPD 2A19A 3QOLA 4FNFA 4XYOA 1FGUA 5BN5A 1ZYRC 1SNPA 4N9TA 2V1CC 1SJED 4Y7NB 2KECA 1NNXA 4LF8Q 2N88A 2ZM6L 4A3BH 1PRTC 2R92B 4A3KH 2ZJPA 2E2JH 4H02A 5ELOA 4LFAQ 1RIPA 2EY2A 5CGKA 3PF5A 2LY7A 2QGQA 1DONA 4K5VA 4TVAB 2DJFC 1TY2A 2IT1A 5EPLA 4JI0Q 2IWHA 2XGTA 2KCNA 2CW0D 2VUMB 2SOBA 3E0JA 3CCLA 2NN6H 1IZ6A 3T1HQ 1KRSA 4GLAC 2KUMA 1ILQA 2I5MX 3EFXD 4LUZA 1SXTA 3BG3A 5M3MG 1GJXA 3J81j 4CGYB 4DKAC 1W6JA 2NTSA 3HOXH 1VQEA 3FHWA 1A15A 1D1IA 3R93A 3ZYYX 2LS01 1Q90A 2A73B 1AZQA 5FLXE 3H3VI 4TKOB 2B2YA 3I90A 1EIFA 2B2YC 1RKNA 3S1QB 1GUNA 1YZ6A 4YIJA 2OXPA 3HKSA 4DV3L 4XXEA 4M1UB 2EYMA 4LAAA 1R9TB 1N32L 3E5SA 4JCVE 4RFBA 3L0OA 3MFYA 3I4NB 1P16A 2ZTDA 1PH5A 1QNKA 1UE6A 4KD4A 5J22A 1IBMQ 4ZAIA 4O2DA 3PCOB 3K8AA 2Q8IB 2NN6I 2NVQB 3S14H 2ZT9C 3F2UA 4LF4L 1KL9A 2EYFA 1EYGA 4YWKA 2JA8G 1E7ZA 3MVVA 4B3ML 1GHJA 4JC0A 1SNCA 3I4OA 4OXPA 1X3EA 4EQPA 3LNNA 2F0MA 5I2YA 1GHKA 3KBGA 2HHHQ 4ME5A 5KNDA 3DWQA 1A3VA 3FVQA 4A3KB 1K83H 2RF4A 4NW2A 2WAQG 2V4DA 1SBBB 2EY5A 4IPHA 1SRUA 1Y8OB 4A3FG 1Q81C 3D4WA 4GKJL 3DXJC 1KDAA 2AKWB 4LF9L 1IBLL 4B3TL 3AYHB 2UUBL 1SYCA 1ILPA 3SK4A 3RMHA 4JVZA 3IL8A 3HG9A 4X65Q 2ES2A 1EZ8A 5EGTA 3CCJA 4DAVA 2R7ZG 3HOXB 2N8NA 1HA5A 4YHHQ 4Q0FA 3PV0A 1WTPA 2EZVA 3CW2C 2JSOA 3M4QA 2A1AA 4AYBG 4DPGA 3H3VC 2JQOA 1H9KA 4GNXB 5CV4A 3S1MB 3SK6A 4LF7Q 4B3SQ 5KEEA 3GTKB 1TS5A 1UWVA 3HZXA 4CJ2C 1JWUD 2ZXOA 3HFZB 3GTMH 3K5OA 2F52A 2TMPA 1BQQT 5C4JB 4FXDA 1LTRD 3P1HA 1D7QA 2L55A 3LWEA 1WTRA 4IUNA 1SE4A 2AWOA 2RHSB 4KLKA 2JEBI 3Q6SA 1H9MA 1KD1C 4LF8L 1CQVA 1L0YB 1MSGA 4OO1H 1OXSC 1NAPA 2UXBL 5D3DA 1Y69U 1CA6A 4LFAL 2JA8H 3J7AV 3J7A5 4WRDA 4JI3Q 3S17H 2VS1A 3S14B 1TS4A 3A55A 1ET9A 4R4CA 1U0LA 1TT2A 3FMCA 3STBD 2PQAB 3S16B 3DEOA 3F2BA 5FLMG 2D5DA 3G4SA 2DJGC 4DNIA 3S15H 4K2LA 2EJMA 4GNXC 4A3FH 3CKIB 5CC4A 4JI5L 2IX1A 4DK3C 1J8IA 1K83B 4QJFA 3C1EA 5IGEA 3K0YA 1N33Q 1GUSA 2UU9Q 1EYAA 1PDQA 5ELEA 3PO2G 3ND9A 1QJOA 1E0BA 1KC8C 1SE2A 4MTKA 1KNAA 2R7ZH 3J80c 3DUZA 1EFID 4ZYSA 4FF4A 2OQKA 2KCCA 1H9JA 3F1ZA 1J6QA 4OO1I 1S4ZA 3PSIA 3I4MG 2ATWA 2OEOA 1Q3LA 1NSNS 3AFQA 1UAPA 4A3MB 3K58A 2NVXB 1VQFA 1JORA 1UE1A 1SNMA 1GVPA 1L0XB 1ENCA 4KTAA 4JK1C 5I9PA 1EQTA 1E2ZA 1YHBA 1Y1VB 3M9BA 2E2IH 1L0WA 4C2MH 2ICEC 1SEBD 2R3ZA 4XDXA 3S2DB 1V1PA 2OTLA 3NK9A 4X64L 4JI7L 4BBSB 3ITPA 1CI3M 1A2TA 1EWCA 1TQOA 1RF2D 3PIP3 3OWEB 2UUCQ 1NY4A 1C9OA 1SNOA 4NB3A 3A7AB 3HOWB 3J81c 4HJ5A 1BDOA 1ONLA 2FHTA 2M2LA 3V96A 1EIHA 3FPUB 5FLMH 3CD6A 3BZCA 3I4LA 3H0GG 2F4VQ 1EYCA 3U4ZA 1HFGA 5NUCA 2UXCQ 2K7VA 3U58A 4UY8C 4JV5Q 3D4RA 3GO5A 3K81C 3QG1A 3S15B 3SHLA 3K80C 1K9MC 3NSWA 2SNSA 5FKAC 2QCPX 4YY3L 1PH9A 4K14A 3PO2H 4X65L 4OX9Q 4QQBX 4KN4C 1FNVA 2ZTCA 5EQ0A 4DR1Q 4APVA 4NP5A 3GDEA 1PYWD 4IPGA 3D3RA 1F9RA 4JI8Q 1HUMA 1I4RA 4XQJA 4TSSA 3E9HA 3OIPA 4UPAA 1D2BA 4JI6Q 5DEHA 3PIPA 2Q2HA 3CQZB 3HOUB 4IFDI 1U4LA 2WAQE 4LF7L 4JPBW 3W5OA 4RKLA 5IODA 1PA6A 1JJ2A 5GADC 1LUZA 1A63A 1CM9A 4B9WA 2JA5G 3NHHA 1K8AC 3K7AH 2FMMA 3NELA 1AE2A 1PZKD 5JJZA 3DM1A 4JOIA 1K3BC 3DWPA 2NUCA 1YNXA 4QB4A 2BH8A 4JOIC 2MGSA 5CR3A 3RNUA 3ND8A 3NTKA 4JI3L 5BN3A 1S72A 3I8ZA 2F0FA 3HOYG 2L0CA 5CV6A 1Q1BA 4PZ8A 4RGMA 4DV4L 2EOTA 4HCEA 4ZKCB 2YYZA 4DR4L 2VY3A 3E3XA 3QR8A 1IHZA 1GUGA 3H0GH 1Z7TA 2EXDA 1XPUA 4KKTA 1ESRA 3T53B 4L63B 4ILWA 1N33L 3IFDA 5HY6A 4LF5Q 4PG3A 2UU9L 1E1OA 3R2IA 2C35B 5KGUA 2XRQD 1EEFD 2OQ0A 4X6AH 4RAUC 1ZYRD 4KHZA 1SYEA 2O5JC 2BA1A 1KAWA 3ULJA 3OTOQ 3A5UA 3PO2B 1PRTD 4BS9A 3A56A 4MHEA 1NMFA 1OXTA 4LJZC 2KCMA 5KRUA 2L9HA 4N8X1 3HOZB 5J39A 2B2UA 3U9SA 1RHPA 4DN4M 1TWFH 3NTIA 3PF4A 2IY5B 4QUCA 3KLSX 1LACA 1K3RA 3RLNA 2EY1A 1BCPF 1X65A 3K57A 4TQUS 5KNBA 3LGJA 2JA5H 1EYDA 1KLUD 4KHPQ 1JICA 2EYPA 5C4ZA 2NWGA 3SR1A 3G7LA 1SFOH 1LM0A 4IOCA 4QIWE 2VW9A 3S1NH 3G6EA 3UE0A 3K7AB 3STBC 1JB3A 1MD2D 1YHQA 2E5LQ 3M4OH 2ZXRA 4DV1L 1KDBA 1PLFA 2F0SA 4Z9CB 2UUCL 3HOYH 2JEAI 4HSVA 3RLFA 1PVOA 4R1JA 2B8GA 1XTDA 1T5EA 5EPJA 4FXGC 3Q0AA 1KNEA 2MNAA 3QIAA 4IO9A 2F4VL 3P7JA 2F0DA 4PZ6A 4CDFC 2RVLA 4C3HB 1VQ5A 2YU9B 4A3GH 4JV5L 4PMWA 1YIJA 1CHQD 4KI0A 2XWBB 4BBRB 2YTVA 3HP3A 3H0GB 2CVRA 4L5RC 2A68D 4OX9L 1HUNA 5GAEC 2ZM6Q 4JBKA 4YCWA 4DK1A 1V8QA 3MXNA 4A3CG 4F88A 4JI8L 4P74A 3G48A 4BWGB 1LABA 5IY0A 1U4PA 4CKEA 3BVZA 1X9NA 1K28A 4JI6L 2OF1A 3T1YQ 3OPOA 5M5WB 5IOCA 1AEXA 1QNUA 2CH4W 3H09A 1KAAA 4JYAQ 4C1NI 3QO2A 4HR7B 4ULLA 2KHIA 2WP8J 4K8JA 4X66L 1JE5A 1PTOH 4G4KA 4HJ8A 3P20A 3ERQA 2B63G 3OW7A 3PQIA 5IT9E 1CSQA 1M1KC 2K6AA 3NQTA 2QA4A 2E2HH 2KHSA 2F0LA 3FP9A 5FOBB 1TWFB 4IUPA 5JPNC 1SAPA 3CHBD 3U4VA 3TDQA 3CAMA 3I56A 3WDNA 2F0PA 3BYYB 1ZKOA 3D0FA 3NXWA 4TRDA 1YNNC 5D14A 1JB7A 1YJWA 1HTLD 3HKZB 5IYDH 2Z9HA 2K4KA 4LWCA 1N32Q 2EYHA 1OTCA 1C8CA 3C3LA 2EPBA 3J7ZC 4U673 1SYFA 3M4OB 5C0XG 1RDPD 4RG1A 3R3OA 1X56A 2FFKB 5ELDA 5JEAJ 4LF5L 4HMJA 5A2QL 1UEBA 1W2BA 1WTHA 2RQXA 1YJ9A 4LF4Q 4KKUA 3MC0B 2L11A 2PZWA 3T13A 1IBKQ 2F0UA 4A3GB 2JN4A 2BOSA 4A3CH 1VMCA 1U5KA 1EY8A 4ALPA 4P2CB 1YJNA 1G291 1OXVA 3GTJH 3RZDH 3S9WA 4CDCC 3CMEA 1RODA 1B1ZA 4FVMA 5K5PA 4RGTA 5KIXA 1L1OA 2E76C 2WB1E 5ELBA 4GKJQ 3S1RH 2R6GA 1H9RA 2B63H 2PMZB 4GZYC 1YITA 4B3TQ 4DV5L 4KHPL 2D2CC 2UUBQ 4MNOA 3UDGA 1HQRD 1VQMA 2I5LX 3FKIB 1C0AA 1HQMC 2M00A 1WD0A 3K5MA 2KCTA 2Q8RE 4HIMA 1KABA 4OGQC 1TWAH 1VQKA 1TU2B 1EY6A 2E2HB 4BY7B 1JQYD 1VQ6A 1EFWA 1I4XA 1XTCD 3CCVA 1U4RA 2BA0A 1LTLA 5KYIA 3A5ZB 1UE7A 5EKKA 4CKBA 3EIVA 3V2TA 1BBWA 3KDFB 5C0XH 2E8GA 2G9DA 4HEDA 2A5HA 3BZDB 1NR2A 1X32A 4X3UA 3IFTA 2B2WA 1LYLA 1WI5A 4PQXA 3TQYA 2KEEA 1F9QA 3TZDA 2B2WC 2UXBQ 2DY8A 5JPMC 2XIWA 4DV2Q 2JA6G 1VQOA 4XQQA 3SEBA 3NP8A 2EJFC 3MHBA 2R7DA 4H13C 3BDOA 1TY0A 4DR3L 2K5HA 1VF7A 2F0GA 1BKBA 1HTPA 4KJOA 4WJ3M 3KF6B 2L5TA 3T1YL 2FINB 2D0PA 3EJIA 1X3QA 2F0EA 4JYAL 3H15A 4LNQA 4A3DG 3FDTA 3NBIA 3A7LA 3SGIA 1GUWA 4JI5Q 1Z6HA 2KHJA 1WTVA 3KDFA 1TWGH 3I2ZA 1B50A 1B2TA 3AEVA 2JK8A 4IALA 1FNUA 2H5XA 1JC7A 1S5FD 4K6LA 5IP9G 3CCMA 4NMZA 1XYIA 5C4XG 1Z9FA 3J80L 4RGNA 2Q2IA 1VQBA 3OMGA 3RZOB 1YVCA 4LK1C 1IL2A 1TWCH 3PUWA 1I50B 5LMNW 3KF6A 1DZ1A 3S2HH 2DY7A 3Q24A 1BCPB 5EKIA 3TP6A 4C3IB 3NPPA 1BO0A 5AJ3Q 2B39A 3KBXA 1IL8A 2A68C 5LMNQ 1R4QB 1IYVA 2AHOB 3A54A 4A4IA 3SDZA 2AQ3B 5ELCA 4NKLA 2NVYB 4P73A 5EAYA 5A2QE 3T4AC 2P5ZX 1SROA 1I4HA 3E9IA 2L1BA 3TRZA 2A6HC 2CKZB 1IBKL 2F0OA 1Q46A 2BDNA 1S5CD 4X64Q 4JI7Q 3ONAB 2JA6H 1GO3E 4ABNA 4DR7Q 1QZHA 3OYYA 1G6ZA 1QCBD 5COYA 1CUKA 2EVBA 5D65A 2K28A 4RMFA 2D0OA 1JJCB 4A3BB 3J81L 2HD3A 2E2JB 4EVOA 4CBVA 4A93G 3FEWX 3MEFA 1SJHD 4A3DH 5M3MH 5FO9B 1BCPC 4KY7A 4OHJA 2JA7G 1EUJA 4KHVA 4GN5A 2K50A 1VQNA 2WKCA 3UE1A 1FNWA 4S3SA 2BH2A 4YY3Q 3KLWA 3MXGA 1TWGB 3I72A 5C4XH 1DM0B 1IKLA 2Y0SB 4IOAA 4MIUA 1S5BD 3JAME 3VA7A 3OHXC 2K01A 1STGA 1CKOA 4PZ7A 4WJWA 2IX0A 2VXWA 1NTGA 3NEMA 1RJTA 1JOKA 1VQ4A 4WFN3 5C4HA 1I94Q 4IURA 3S2HB 4WORA 2BE5C 4ZCKA 1J9OA 3J7AF 1YI2A 2H1EA 2XSCA 1HNZL 1A8VA 1HR0W 4LFCQ 4FYDA 4B3RL 3R2TA 1XPRA 2I46A 2JE6I 3K7UC 2QW7A 4GN4B 1CSPA 4DV2L 4I7ZC 2NVTH 1JOQA 3GV3A 1STAA 1HR0Q 4HCSA 2Z6BA 2F0KA 4DGZA 2K5NA 2O5IC 2AQ2B 5GROA 4DV4Q 1VQHA 4AH6A 4DR4Q 4A93H 2YTYA 1XNQL 3SK8A 3CCQA 2JJQA 1Y8PB 1BXTA 1K73C 2JA7H 4K6DA 1MSHA 4RWSC 4R4IA 1KTKA 1V1PB 3D6WA 5M3MB 5LMUL 5K36G 4QF4A 1JJGA 5M3FG 1WCMG 4K8IA 5F2DA 2UXDQ 3J80E 3MWYW 1DGSA 1E2VA 2PW5A 4DUYQ 5G3LF 1C4QA 5IYCG 1S5DD 3E0EA 3K5LA 1N34L 1ASYA 4QY7A 5C4XB 5DLQE 1A3UA 5EBCA 3VR4A 1GUOA 3G71A 1FD7D 1F9SA 2LKVA 5AJ3L 3W2DA 2VQEL 2KBNA 5M5YH 5LMNL 4A3JG 3W1GA 5H1SE 1QILA 3V05A 4YCUA 1TIID 4IFDJ 4DXFA 3PMFA 3CC4A 3NUCA 3GTMB 5IGBA 3GQBA 1XMOQ 1J5EQ 3A0JA 1PMRA 3N6RA 1GD7A 4DR7L 3T56B 1Q12A 1LTBD 3BVMA 4DV1Q 1TKWB 2FMCA 2PYKA 1PFBA 3SVMA 4LUOA 1YNND 4DR6Q 2JA8B 3ER0A 4K2KA 2NVTB 2ENBA 2KJXA 3VR2A 4XT1B 3S17B 4OWWB 5C3WA 3NENA 2CQAA 1I4QA 2QDBA 3TZUA 1XJVA 1EQQA 1E2WA 3M4PA 4HN7A 5JVG3 2I07B 2QEXA 3FRPB 2RBMA 5T1GA 4A93B 2WAQB 1S40A 2K03A 1Y8NB 3C1FA 4R8IA 4A3FB 4JI1Q 4DNRB 1QOHA 3GTQH 3EROA 5IE8A 3CCUA 4RGOS 3KK7A 1VQLA 1PTOF 1WD1A 1B3QA 1WTOA 1A6XA 1WCMH 3HOVG 3DMUA 2DNCA 2XNAC 3PUYA 1BNZA 3CPWA 4B9XA 2F0QA 1VQJA 1SMXA 1I3QH 1O7IA 3I91A 2PZUA 5C3XA 3X3NA 3I4MH 2K5VA 5IYCH 3BJUA 1KRTA 2R7ZB 2JXMB 5FO8B 2RHQB 4BY1G 4DR2L 4X66Q 1WOCA 4AYBB 2L4NA 2JA9A 4ZK9B 3OOCA 5C3EG 1HZBA 2F0NA 3HGBA 3UDXA 1I94L 4A3JH 3VR3A 3CXCA 1WVLA 4LFCL 3TN2A 3QWNA 1A0IA 1LTSD 4GN3B 1PXUA 5M5YB 1E1TA 2ID0A 2HCIA 4F8MA 1X3GA 3K59A 4NXMQ 2E2IB 1HR0L 1KIXA 1EWHA 4C2MB 1B53A 5FJ8G 2B2VA 4C3JG 3ULPA 2ASBA 3D6CA 5C44G 1EY0A 3WWVA 3PUVA 1G6PA 4UP7A 2B2VC 5CBAE 5CV8A 5GAGC 3JAMi 3NBHB 3ZJYC 1X3PA 2WB1G 1O7YA 2B29A 1PH6A 3FPPA 2H4OA 4DR5Q 3O13A 4J1MA 4PMCA 5IIFA 2A6ED 2HT1A 4YCVA 2ICIA 1PFSA 4J6HA 3NE5B 1Q8IA 3MEHA 2OWOA 2CHBD 3CRLC 3CMAA 4L5QA 1TWHH 2SNMA 2UXDL 1GM5A 3HOVH 2UUAQ 3B6YA 4H44C 1AFPA 4KY5A 4DUYL 2NZ1D 4R4OA 3C46A 1AN8A 4XIGS 1G91A 1BUVT 4DFAA 1O80A 3DHQA 1E3PA 1WCMB 2VL6A 4QIWB 1EIYB 4IQZA 5EBDA 3NBHA 4BY1H 4ZQ3A 3N52A 1ICWA 2N78A 5BR8L 1I3QB 2B2UC 1YEZA 4K5WA 5C3EH 3I4MB 3R8BA 4DF7A 2MP1A 1LT5D 4DV5Q 3RR5A 1Q86C 1HRJA 3X3MA 3A8KE 3MXNB 5D3IB 2DGYA 1XMOL 1PV4A 1J5EL 5IWAL 4A3JB 1ASZA 2X69A 3K6OA 1A62A 4QMGA 1VQCA 1PYSB 2NTTA 3ULLA 1K8MA 1N36Q 1Q7YC 5JJLA 5FJ8H 1V1OA 3RLOA 4C3JH 3TBIB 4R4TA 4ZRZA 5C44H 4DR6L 1HXYD 2ALYB 4FF1A 1MIUA 4O0AA 1YNJC 5EJWA 1E24A 1SN8A 3VYRA 1VS0A 1EQVA 4C1NK 1DOLA 1Q82C 2WKDA 1QWYA 5JOBA 1IW7C 2K5WA 1OXUA 4JI2L 2PO4A 4JBMA 1QE6A 5IP7G 2PI2E 3K0XA 4JI1L 4NXNQ 1AW7A 3CCEA 1BR9A 2BDOA 2PCFB 4ZUJA 3L2PA 4F87A 1HPCA 1BF4A 2PZTA 1EQRA 4DR3Q 2A6HD 2R92G 1B70B 2K52A 1NMGA 4ZLTF 1TWHB 2PI2A 4FP5D 3UDIA 2ZTEA 1OXXK 2NBFA 1STYA 4BXXG 1M90C 5JEAG 5IGGA 4ME3A 4OIKA 1F77A 4KV6A 2VUMG 1ICFB 2Z0SA 4KJNA 3MA2B 1NR4A 1NUCA 1QVFA 4QGUA 2E75C 5J3BA 3PIO3 1BCPD 2MUYA 5CV9A 3GTLH 1M8AA 1VDZA 2PNRC 5ELNA 5C3EB 1D5ZC 2JA5B 4ZUIA 4E6IA 1EU3A 2RDFA 1STNA 2QILA 1LT6D 1XPOA 4NXML 1V1QA 3JC66 4GOPB 4CKCA 2RDGA 1PH2A 4NPSA 5E4WC 3SXHA 1SFOB 5EKLA 5IT9c 3Q8DA 1HNWQ 1FGBD 1IXRA 4OONA 1L1OB 3S1NB 5HGTA 1DOMA 4V0BA 4I7AA 1F2LA 3HOYB 3QJYA 2Q8TA 4RHSA 4DR5L 4KKSA 1FVIA 2K04A 3ERSX 4IN3A 3I4NG 4X62L 2R7FA 1VQGA 3M7NA 4YWLA 1XWEA 1KQSA 3VDYA 2I5HA 3VYUA 1K0SA 5IP7H 2CCZA 3CU7A 3KYHC 3PIOA 2BE5D 2RSOA 1QZGA 1C7YA 4UDUC 1F2MA 2UUAL 2VQFL 1PH7A 2KOLA 2D9UA 4KN7C 3KLRA 5ELFA 4PNYA 4GOPA 2EYOA 2EYJA 2B8FA 2X6LA 5I6YA 4MN3A 4HIKA 1F2ZA 4GOPC 3HKZE 2IX3A 5CV5A 5L37A 2G9HD 5JEAH 3PGZA 2GA4B 1NBWA 5KNCA 3KJOA 1UUPA 1L1OC 1G2SA 3MXPA 4A75A 5DAUA 5HURA 1N8RC 3NTHA 1HHVA 2RCNA 4XYQA 3K5NA 1GUTA 1NCVA 1PTOB 4BA2I 1JWMD 4J8QA 1SMYC 2LFNA 4QL5A 1D1KA 4LW1A 4R4QA 2E2DC 3URYA 1RTNA 1N36L 2E74C 1V9PA 2KQ3A 4X3SA 4JW0A 1EY7A 3HOXG 4OWTB 4GKKL 5C5MA 2K33A 2HIXA 2MJ8A 3S1QH 3BS1A 4K0KL 2A6EC 3KUPA 4X3TA 1VQAA 3GTPH 2XRSD 3BYTB 1R9TH 1CKMA 2AWNA 3KJPA 1SR3A 2A74C 1WFQA 3I4NH 4DAPA 1HNZQ 2PMZE 1SDFA 4EQOA 4N8FA 1JE4A 4NXNL 5E1FA 4B3RQ 4G7ZC 3DLLA 3KFUA 5GQOA 4HJAA 1PFNA 2CFMA 1SYDA 1Y1WG 2NVQH 4JG2A 1JWSD 4P71A 2HIVA 1ESFA 1B4OA 1PTOC 5CV7A 5LL6X 4K5XA 1G2TA 4A3EG 3H3VH 3I70A 1L2FA 3KOJA 2AMCB 2EE1A 2XWJB 1U4MA 1B3AA 2L12A 1B9MA 3VR6A 1XNQQ 3GTJB 1ZEQX 1B7YB 3RZDB 3QOJA 1SNDA 3QB3A 3CCSA 5E3FA 2F0VA 2Z1CA 4UP8A 3EN2A 3L7ZC 2MPMA 2WFWA 4DAYB 1K8OA 2OCEA 1X3FA 3Q23A 5C0XI 4DV6L 2QEJC 1PH3A 3S1RB 4R9WA 5LMUQ 4LFBQ 2B63B 3TS0A 4DU9A 3GTOH 1KXLA 2A69C 1ENFA 5M5XH 4ODGA 1SE8A 2Z4HA 3U9OA 2NB0A 2F03A 1N34Q 4X3KA 3TP7A 1K8GA 1HNWL 5I6WA 1TWAB 1LTID 2Q2TA 4UP9A 3L9AX 2OTJA 1VQ8A 5FLXc 2K5DA 2AUJD 3T51B 2FXQA 2VQEQ 3S1MH 3UI2A 4A3MG 3GTKH 2L15A 1HCZA 4NDXA 2NZOA 4J15A 1CK1A 1RTOA 5ISRA 4DAYA 2I0QA 2IHFA 1CQFA 3GTPB 2KENA 2WINB 5C4JH 2WIIB 2ZJQA 1Y1VG 4DXGA 5TSSA 4P72A 2Z8LA 1QVCA 1Y1WH 1ZXTA 1VQ9A 1V43A 4O1NA 1TVXA 2RDHA 4A3EH 2O4XA 3CCRA 4BBSG 5GAHC 1DOKA 3RUZA 1HZAA 3CP0A 4OELB 3HOWG 4L6TB 4OO1G 3S16H 2J0TD 3OIQA 3HEJA 3M4YA 4JI4Q 1MJEA 4A76A 1I4PA 5IP9H 3S24A 3F2DA 2RSNA 3M7GA 3Q22A 3G6JB 3A74A 1VQDA 2EQSA 1DD2A 1KHIA 4C56C 4IUUA 3TS2A 1B8AA 3BZKA 1R4PB 2D62A 1MHWC 1FR3A 1II3A 1PFMA 1X55A 5IGCA 3GTOB 3IRBA 1D6EC 3IKJA 4GS3A 2QKIC 5M5XB 3MFGA 1WTWA 5I2XA 1WTQA 4DR2Q 2F0JA 1CTMA 1EL0A 2Z4IA 3HOUG 5LHY1 1TWCB 1E22A 2LSSA 4HJ7A 4A3MH 5M9OA 1D8LA 2NVXH 2F3IA 2CWAA 3MZ5A 1VQ7A 1FJGQ 5JVH3 3M3YH 5CORA 4POGA 1XMQL 3JAMc 4POFA 3RN2A 1P8LA 4IUQA 1NJIC 1Y1VH 2VB2X 3D4DA 1O7ZA 1RD9D 2IHEA 1OO9B 3AU7A 4JBWA 5IYBG 5I4DA 4G7HC 4IJHA 3WOEA 3S2DH 2GN5A 4G57A 2EY6A 4BBSH 4HAEA 1FL0A 4CDEC 2Y0SE 1Y1WB 1STEA 2Q2UA 1K0RA 2JA6B 2MQHA 2PNHA 1I6HH 2SDFA 3HOWH 2XVSA 4A3EB 4L8JA 3TP5A 4IFDG 1YNJD 3A8IE 1MBYA 4HTHA 3H91A 2IPKD 1EEID 3A8JE 4H7BA 4A3DB 3DM3A 2F1MA 4JI0L 1B44D 5CMDA 1IW7D 1LT4D 4GNXA 1KDCA 4LFBL 1EZ6A 2KVMA 4V190 3T1HL 1UEAB 4FXKC 3OW2A 3U50C 1HA6A 1BVSA 1AH9A 2C5CA 4IUVA 2CH4A 4DK0A 4LF6Q 2K1BA 1MKHA 3PO3G 2IJ0A 3H6MA 2G5DA 3CC7A 3GP7A 5I9OA 4N9PA 3HOUH 3CQZH 4UHVA 5BR8Q 4L5TA 5C5LA 2ZXPA 3OWFA 3HOZG 2AUKA 1ET6A 3I3CA 4IPDA 4EQ5A 1EWIA 1G51A 3AMUA 4A3LG 3IAYA 2N55A 1W3SA 1YBYA 4IZ8A 4P75A 3WOFA 4FF3A 2PQAA 2N3SA 5IWAQ 3GV6A 2PW7A 2HDLA 2C9OA 4BA1I 1LLRD 4EQNA 3VYSA 3M3YB 4OIJA 1TR5A 1X54A 5IYBH 1IBML 3L3OC 1FYCA 3MTSA 3J81E 4CJ0B 1VQIA 4UAIA 4MZ9A 3NWTA 4XQNA 3RN5A 3MXUA 4HMIA 2JP1A 4IFDH 1F2YA 1MJCA 4JI2Q 2CW0C 1I5FA 1SSOA 4JI4L 2HHHL 1ENAA 1I6HB 2PPBC 4C3HG 1BOSA 3CPFA 4EX5A 5K36H 3LX0A 5FK9C 4BBRG 4ID6A 3D31A 5AFWA 2TSSA 2JA7B 5M3FH 2K5QA 2RA4A 4M8AA 3GTGH 1O7LA 1AZPA 1SYGA 5HGQA 2VNUD 1IYUA 2LMCB 4HIDA 3PUZA 5LL6S 3TEHB 3MAQA 3PO3H 4HSPA 1EU4A 2R93G 3GD7A 1CT1D 1I4GA 2MO0A 1PRTF 2F3WA 1SLJA 1WTXA 1A2UA 2PQEA 5G3LD 3VR5A 4LUVA 2GVBA 2K75A 1JOOA 1TS2A 5A35A 4Q5VA 4KK7A 4YHHL 1GKHA 2HQEA 4A3IG 3HOZH 3BVGA 2DNEA 2N49A 1O78A 1FJGL 3AQQA 4RH6A 2YTXA 1QUQB 4A3LH 1SYBA 2LXJA 3VYTA 1T9HA 4B3SL 1Q8KA 5JJKA 3LWUA 2F0WA 4G7OC 4RKBA 3H94A 4HJ9A 4DV0Q 1PYBA 1XNRQ 4DK6C 3EA6A 1S3OA 1SMYD 2KEDA 3TSSA 4HIOA 4CJ1B 5T1IA 2EIFA 5IT9L 1Z47A 3AFPA 1TXYA 2SEBD 3CF5A 1T5XD 1WJJA 2F0IA 3HKZG 2BCOA 5JJIA 3KF8B 2XN9C 1JR0D 3BDLA 1S5ED 1SE3A 4B08A 4RCNA 5E4XA 4AYBE 4EGVA 3CC2A 4X62Q 1VMPA 2LXKA 1X6OA 1XX8A 4O42A 1CZGA 3J7YW 1KLGD 1LTAD 3HS0C 1QUQA 4C3HH 2YU9H 1VF5C 1HJPA 4RA8A 2CQOA 2WV6D 2Z6KA 4H0LC 4BBRH 1RCVD 1YHAA 1WYDA 2QDLA 3T16A 1I6VC 2VQFQ 4LF6L 2Z6KC 2J7ZA 4XTCS 4A3GG 3GTQB 1PTOD 4FO2A 5M3FB 4IJLA 2R93H 1LTTD 3GTGB 2DN8A 3KF8A 5M5WH 1W6KA 1EY5A 3BDCA 3PO3B 4AIMA 4GLVB 4A3IH 4CDDC 2OT2A 2JYOA 1CZWA 1DCZA 3EBEA 3C2PA 3FKIG 4DUZQ 2DUDA 4LMQD 2CWPA 2MHVA 3J80i 1IYJB 2A69D 4AQYQ 4BY7G 5C6AA 1IKMA 1H9SB 4GKKQ 4CHTB 4K0KQ 4DV7Q 1PZID 5CBEE 1CKNB 2HDMA 4RHRA 1VCIA 2VZAA 2F0HA 2K05A 4RCOA 5KYLA 1U9RA 4ZKBB 5IYDG 1HNXQ
chains in the Genus database with same CATH topology
3K80C 1PH1A 1K9MC 1R9TH 1CKMA 2AWNA 4IOAA 3KJPA 4YY3L 1PH9A 1SR3A 3PO2H 4X65L 4OX9Q 4QQBX 2ZTCA 1WFQA 3I4NH 1CKOA 1HH2P 4DR1Q 4APVA 2UXCL 3GDEA 4PZ7A 1HNZQ 2PMZE 2YV5A 4IPGA 2IX0A 4NXNL 4JI8Q 4B3RQ 1NTGA 2HQLA 3NEMA 3DLLA 3BU2A 1VQ4A 3KFUA 5GQOA 4WJ4A 4HJAA 2CFMA 3I55A 3E9HA 1Y1WG 4UPAA 3J81i 1I94Q 4JG2A 4P71A 2NVQH 2HIVA 4JI6Q 3PIPA 2Q2HA 4IFDI 2NZHA 2WAQE 4DR1L 4LF7L 1YI2A 1CKNA 1PH4A 4A3EG 1A8VA 1HNZL 3W5OA 1HR0W 4LFCQ 3H3VH 2B3GA 4B3RL 1L2FA 1XPRA 3KOJA 2JE6I 2AMCB 3K7UC 4YWMA 3I7FA 1PA6A 4MTNA 1JJ2A 2A8VA 5GADC 1LUZA 4GN4B 1CSPA 4DV2L 2JA5G 3F8TA 1A63A 2NVTH 1XNQQ 1K8AC 4DV6Q 1B7YB 1HR0Q 3K7AH 3NELA 2GVAA 1AE2A 3CCSA 2K5NA 2MFIA 4JOIA 4UP8A 3FKIH 3EN2A 3L7ZC 5GROA 4DV4Q 4DV0L 1XNRL 1NE3A 1VQHA 4AH6A 1YNXA 2WFWA 4DAYB 2BH8A 4FDBA 3M85A 4DR4Q 2OCEA 1X3FA 4JOIC 4A93H 4DAMA 1PHJA 2YTYA 1XNQL 5C0XI 3RNUA 4DV6L 4JI3L 1S72A 1PH3A 3CCQA 4GLXA 3W1BA 5LMUQ 2JJQA 4BY7H 4JBJA 4LFBQ 3HOYG 3TS0A 3GTOH 1K73C 1KXLA 1Q1BA 4PZ8A 5M5XH 4DV4L 2JA7H 1SE8A 2YYZA 4DR4L 2VY3A 4R4IA 3H0GH 1N34Q 1HNWL 1RL2A 1K8GA 5K36G 5LMUL 2EXDA 1XPUA 1JJGA 2Q2TA 4UP9A 5M3FG 1WCMG 4DV3Q 1VQ8A 2OTJA 5FLXc 2UXDQ 1EOVA 1N33L 4IPCA 2FXQA 5HY6A 1DGSA 4LF5Q 2VQEQ 4Y52H 4PG3A 3S1MH 4DUYQ 2UU9L 4A3MG 1E1OA 3GTKH 1N34L 2L15A 3E0EA 1UE5A 5IYCG 4Y7NH 1ASYA 2C35B 4QY7A 2NZOA 2OQ0A 4J15A 5DLQE 4X6AH 2I0QA 2IHFA 1N9WA 4KHZA 3G71A 2R92H 5AJ3L 1HZCA 2KENA 2BA1A 5C4JH 2ZJQA 1KAWA 2VQEL 1Y1VG 2KBNA 3ULJA 5M5YH 3OTOQ 3A5UA 4P72A 4OWXB 1QVCA 5LMNL 3GTPH 4A3JG 5E7NA 1Y1WH 4BXXH 1NMFA 3W1GA 5H1SE 1VQ9A 4A3BG 1V43A 1OXTA 2KCMA 3TREA 4A3KG 1Q1EA 1BBUA 4YCUA 4IFDJ 4A3EH 4B3MQ 2VUMH 1TWFH 3PF4A 2IY5B 4BBSG 3CCRA 1QVGA 3CC4A 1K3RA 3RLNA 1VQPA 1X65A 1XMOQ 3OTOL 3ICEA 1J5EQ 4TQUS 3A0JA 5GAHC 2K14A 3LGJA 2JA5H 1GD7A 4DR7L 1HZAA 3CP0A 4L5SA 3HOWG 4KHPQ 4OO1G 1Q12A 4DV1Q 1AE3A 2NN6G 3S16H 2XTIA 1JMCA 1Y14B 3F2CA 4LUOA 4DUZL 4DR6Q 1SFOH 3ER0A 1LM0A 4IOCA 4JI4Q 3UDFA 4QIWE 1MJEA 2VW9A 3S1NH 3G6EA 4A76A 3UE0A 3STBC 1IBLQ 4LF9Q 4OWWB 1JT8A 3NENA 4AQYL 5IP9H 3S24A 3F2DA 1YHQA 2E5LQ 3M4OH 4DV1L 5C0XJ 1XJVA 1EQQA 3M4PA 2UUCL 3RZOH 3HOYH 3A74A 1VQDA 2Y0SG 2JEAI 2QEXA 4DV7L 3RLFA 1PVOA 2EQSA 1I50H 4R1JA 1KHIA 1XTDA 1S40A 3TS2A 2MO1A 1B8AA 3BZKA 2D62A 4JI1Q 2MNAA 4C3IH 2E5LL 3GTQH 5IE8A 4IO9A 1X55A 3CCUA 2F4VL 1H95A 3IRBA 4GS3A 1VQLA 4PZ6A 1VQ5A 3PUXA 1XMQQ 1WCMH 3HOVG 4A3GH 4DR2Q 4JV5L 4PMWA 3HOUG 1YIJA 1HNXL 3PUYA 4KI0A 1E22A 2ZJRA 3CPWA 1VQJA 1SMXA 2YTVA 2LSSA 2NVYH 1I3QH 4HJ7A 1O7IA 4A3MH 4L5RC 1D8LA 4OX9L 2NVXH 2F3IA 5GAEC 3I4MH 2K5VA 5IYCH 2CWAA 2ZM6Q 3BJUA 1VQ7A 1HZ9A 1KRTA 4YCWA 4JBKA 1FJGQ 3M3YH 4A3CG 4POGA 1XMQL 1PH8A 3JAMc 4JI8L 2RHQB 2A19A 3G48A 4P74A 4BY1G 4POFA 4X66Q 4DR2L 3RN2A 1P8LA 1WOCA 1FGUA 5IY0A 2JA9A 2V1CC 1HZBA 5C3EG 1NJIC 1Y1VH 3UDXA 1X9NA 1I94L 4JI6L 3T1YQ 4A3JH 4LF8Q 2IHEA 2ZM6L 4JBWA 5IYBG 3CXCA 4A3BH 4A3KH 4IJHA 2ZJPA 2E2JH 4H02A 5ELOA 4LFAQ 4LFCL 4JYAQ 2KHIA 2GN5A 2WP8J 1RIPA 3S2DH 1A0IA 4GN3B 4X66L 4BBSH 3PF5A 1FL0A 1JE5A 4HJ8A 2Y0SE 2QGQA 1E1TA 2Q2UA 1K0RA 4TVAB 2ID0A 2B63G 2MQHA 2IT1A 1X3GA 4JI0Q 2PNHA 4NXMQ 1I6HH 1HR0L 1KIXA 2XGTA 1CSQA 1M1KC 2E2HH 2QA4A 3HOWH 3FP9A 3CCLA 5FJ8G 4IFDG 1IZ6A 3ULPA 2ASBA 3T1HQ 3U4VA 5C44G 1KRSA 3WWVA 4GLAC 3PUVA 1G6PA 3CAMA 4UP7A 2I5MX 5M3MG 4LUZA 3I56A 3JAMi 5GAGC 3DM3A 3J81j 3NBHB 3D0FA 3ZJYC 4DKAC 4JI0L 3HOXH 4GNXA 1VQEA 2WB1G 2B29A 1PH6A 4LFBL 3FHWA 1JB7A 1YJWA 4DR5Q 5IYDH 3T1HL 3OW2A 3U50C 3H3VI 1BVSA 2K4KA 1AH9A 2HT1A 4LWCA 4YCVA 1EIFA 4LF6Q 1N32Q 1PFSA 1OTCA 1MKHA 3J7ZC 3PO3G 3S2HH 2OWOA 5C0XG 3CMAA 4L5QA 1TWHH 3CC7A 1YZ6A 3HKSA 4RG1A 4DV3L 1X56A 2UXDL 1GM5A 3HOVH 5JEAJ 2UUAQ 4LF5L 3HOUH 3B6YA 1UEBA 3CQZH 5BR8Q 4L5TA 1W2BA 1N32L 4JCVE 4DUYL 4R4OA 1YJ9A 4LF4Q 3HOZG 3L0OA 4XIGS 1P16A 2ZTDA 1PH5A 4EQ5A 1UE6A 4IPDA 1EWIA 1IBKQ 1E3PA 1G51A 2VL6A 4O2DA 1IBMQ 1EIYB 4A3LG 4A3CH 3PCOB 3K8AA 1W3SA 1U5KA 1YBYA 2NN6I 4ALPA 4BY1H 1YJNA 4P75A 1G291 1OXVA 3GTJH 2N78A 5BR8L 3RZDH 2PQAA 2N3SA 5IWAQ 3S14H 1YEZA 5C3EH 4LF4L 4BA1I 3CMEA 1KL9A 4DV5Q 1EYGA 4YWKA 3RR5A 1Q86C 1X54A 5IYBH 1IBML 1E7ZA 2JA8G 1L1OA 4B3ML 2WB1E 4JC0A 3I4OA 3MXNB 2DGYA 4OXPA 1X3EA 1XMOL 1PV4A 4GKJQ 1J5EL 5IWAL 3S1RH 2HHHQ 2R6GA 1ASZA 1VQIA 2B63H 1A62A 1YITA 1VQCA 4B3TQ 1PYSB 4DV5L 4KHPL 2UUBQ 1K83H 4MNOA 3ULLA 3UDGA 2RF4A 4MZ9A 3RN5A 1VQMA 1N36Q 2I5LX 2WAQG 1C0AA 1Q7YC 5JJLA 5FJ8H 4IPHA 3RLOA 1MJCA 4C3JH 1SRUA 4A3FG 4JI2Q 1Q81C 4R4TA 5C44H 2KCTA 4DR6L 2ALYB 1MIUA 1I5FA 4JI4L 4HIMA 4GKJL 4O0AA 2HHHL 1E24A 1TWAH 2AKWB 1VQKA 1IBLL 4LF9L 4B3TL 1SN8A 1VS0A 3AYHB 2UUBL 3CPFA 4EX5A 1Q82C 1VQ6A 1EFWA 4BBRG 3D31A 5M3FH 4JI2L 1OXUA 4X65Q 3GTGH 2ES2A 3CCVA 3CCJA 4JBMA 2R7ZG 2BA0A 1LTLA 5HGQA 5IP7G 4HIDA 2VNUD 2PI2E 2N8NA 3A5ZB 3K0XA 4JI1L 3PV0A 4YHHQ 1UE7A 4NXNQ 3PUZA 3TEHB 3CW2C 3PO3H 3EIVA 3M4QA 3CCEA 2A1AA 4AYBG 4DPGA 1BBWA 3KDFB 2JQOA 3GD7A 2R93G 3L2PA 2E8GA 4GNXB 2MO0A 1EQRA 1SLJA 4LUVA 4DR3Q 4LF7Q 2GVBA 2K75A 4B3SQ 1LYLA 2R92G 1B70B 1WI5A 1GKHA 4YHHL 2K52A 3TQYA 4A3IG 3HOZH 1NMGA 1UWVA 2N49A 2PI2A 3UDIA 3AQQA 1FJGL 2UXBQ 2ZTEA 1OXXK 2YTXA 3HFZB 3GTMH 1QUQB 4DV2Q 2JA6G 2F52A 4BXXG 1VQOA 4A3LH 1M90C 5JEAG 1D7QA 2R7DA 2LXJA 4ME3A 4DR3L 1T9HA 2K5HA 2AWOA 4B3SL 1Q8KA 2RHSB 1BKBA 4KLKA 2VUMG 2JEBI 4WJ3M 5JJKA 2Z0SA 3KF6B 3T1YL 4HJ9A 1KD1C 4LF8L 2D0PA 4DV0Q 1PYBA 1XNRQ 4DK6C 1QVFA 1OXSC 2UXBL 4QGUA 4JYAL 3H15A 1S3OA 5J3BA 4LFAL 2JA8H 3J7A5 4LNQA 4A3DG 4HIOA 3GTLH 4JI3Q 2EIFA 3S17H 1Z47A 2VS1A 3SGIA 3AFPA 5ELNA 1TXYA 3CF5A 4JI5Q 2KHJA 1WJJA 4R4CA 1U0LA 3KDFA 1TWGH 3HKZG 5JJIA 1XPOA 3I2ZA 3KF8B 4NXML 3STBD 2PQAB 3F2BA 3AEVA 2JK8A 5FLMG 1V1QA 2H5XA 3JC66 3G4SA 4GOPB 4DNIA 1PH2A 3S15H 4NPSA 5IP9G 4GNXC 5IT9c 3Q8DA 4AYBE 4A3FH 3CC2A 1HNWQ 1IXRA 4X62Q 4OONA 1L1OB 2LXKA 3CCMA 1X6OA 4JI5L 2IX1A 5C4XG 4DK3C 1Z9FA 4QJFA 1QUQA 4C3HH 2YU9H 2Q2IA 1VQBA 1N33Q 1HJPA 1YVCA 1IL2A 1TWCH 2CQOA 4DR5L 3PUWA 2Z6KA 2UU9Q 4BBRH 3PO2G 1FVIA 3ERSX 1YHAA 5LMNW 3KF6A 4X62L 1WYDA 2R7FA 1VQGA 2VQFQ 4YWLA 1KC8C 4LF6L 3I4NG 3M7NA 2Z6KC 1KQSA 3VDYA 2I5HA 4XTCS 2R7ZH 4A3GG 5IP7H 3J80c 2CCZA 3KYHC 5AJ3Q 2OQKA 3PIOA 3F1ZA 1QZGA 4IJLA 1C7YA 2R93H 1J6QA 5LMNQ 4OO1I 3PSIA 3I4MG 2ATWA 2AHOB 4A4IA 3AFQA 2UUAL 2VQFL 1PH7A 4P73A 5EAYA 5M5WH 1VQFA 4GOPA 4AIMA 1SROA 3E9IA 4GLVB 4A3IH 1UE1A 1GVPA 3TRZA 2CKZB 4HIKA 1IBKL 1Q46A 4GOPC 3HKZE 4X64Q 4JI7Q 2JA6H 1GO3E 1YHBA 4DR7Q 3PGZA 3KJOA 1NBWA 3EBEA 3M9BA 3OYYA 1QZHA 2E2IH 1L1OC 4A75A 1N8RC 1CUKA 3FKIG 1L0WA 4RMFA 4C2MH 2D0OA 1JJCB 2RCNA 2DUDA 4DUZQ 2CWPA 4A93G 3MEFA 3J80i 2OTLA 1IYJB 4X64L 4JI7L 4A3DH 4AQYQ 4BY7G 4BA2I 4GKKQ 5M3MH 2UUCQ 1NY4A 4QL5A 1C9OA 4NB3A 4K0KQ 4DV7Q 2JA7G 1EUJA 4LW1A 4R4QA 3J81c 4GN5A 4HJ5A 2K50A 1CKNB 1N36L 1V9PA 1VQNA 3UE1A 3CD6A 5FLMH 1VCIA 2VZAA 3BZCA 4YY3Q 2BH2A 3H0GG 3KLWA 3HOXG 4OWTB 2F4VQ 4GKKL 3U4ZA 2HIXA 3S1QH 2UXCQ 5IYDG 5C4XH 3U58A 4K0KL 4UY8C 4JV5Q 3GO5A 1HNXQ 3K81C 1VQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K80 C;  1PH1 A;  1K9M C;  1R9T H;  1CKM A;  2AWN A;  4IOA A;  3KJP A;  4YY3 L;  1PH9 A;  1SR3 A;  3PO2 H;  4X65 L;  4OX9 Q;  4QQB X;  2ZTC A;  1WFQ A;  3I4N H;  1CKO A;  1HH2 P;  4DR1 Q;  4APV A;  2UXC L;  3GDE A;  4PZ7 A;  1HNZ Q;  2PMZ E;  2YV5 A;  4IPG A;  2IX0 A;  4NXN L;  4JI8 Q;  4B3R Q;  1NTG A;  2HQL A;  3NEM A;  3DLL A;  3BU2 A;  1VQ4 A;  3KFU A;  5GQO A;  4WJ4 A;  4HJA A;  2CFM A;  3I55 A;  3E9H A;  1Y1W G;  4UPA A;  3J81 i;  1I94 Q;  4JG2 A;  4P71 A;  2NVQ H;  2HIV A;  4JI6 Q;  3PIP A;  2Q2H A;  4IFD I;  2NZH A;  2WAQ E;  4DR1 L;  4LF7 L;  1YI2 A;  1CKN A;  1PH4 A;  4A3E G;  1A8V A;  1HNZ L;  3W5O A;  1HR0 W;  4LFC Q;  3H3V H;  2B3G A;  4B3R L;  1L2F A;  1XPR A;  3KOJ A;  2JE6 I;  2AMC B;  3K7U C;  4YWM A;  3I7F A;  1PA6 A;  4MTN A;  1JJ2 A;  2A8V A;  5GAD C;  1LUZ A;  4GN4 B;  1CSP A;  4DV2 L;  2JA5 G;  3F8T A;  1A63 A;  2NVT H;  1XNQ Q;  1K8A C;  4DV6 Q;  1B7Y B;  1HR0 Q;  3K7A H;  3NEL A;  2GVA A;  1AE2 A;  3CCS A;  2K5N A;  2MFI A;  4JOI A;  4UP8 A;  3FKI H;  3EN2 A;  3L7Z C;  5GRO A;  4DV4 Q;  4DV0 L;  1XNR L;  1NE3 A;  1VQH A;  4AH6 A;  1YNX A;  2WFW A;  4DAY B;  2BH8 A;  4FDB A;  3M85 A;  4DR4 Q;  2OCE A;  1X3F A;  4JOI C;  4A93 H;  4DAM A;  1PHJ A;  2YTY A;  1XNQ L;  5C0X I;  3RNU A;  4DV6 L;  4JI3 L;  1S72 A;  1PH3 A;  3CCQ A;  4GLX A;  3W1B A;  5LMU Q;  2JJQ A;  4BY7 H;  4JBJ A;  4LFB Q;  3HOY G;  3TS0 A;  3GTO H;  1K73 C;  1KXL A;  1Q1B A;  4PZ8 A;  5M5X H;  4DV4 L;  2JA7 H;  1SE8 A;  2YYZ A;  4DR4 L;  2VY3 A;  4R4I A;  3H0G H;  1N34 Q;  1HNW L;  1RL2 A;  1K8G A;  5K36 G;  5LMU L;  2EXD A;  1XPU A;  1JJG A;  2Q2T A;  4UP9 A;  5M3F G;  1WCM G;  4DV3 Q;  1VQ8 A;  2OTJ A;  5FLX c;  2UXD Q;  1EOV A;  1N33 L;  4IPC A;  2FXQ A;  5HY6 A;  1DGS A;  4LF5 Q;  2VQE Q;  4Y52 H;  4PG3 A;  3S1M H;  4DUY Q;  2UU9 L;  4A3M G;  1E1O A;  3GTK H;  1N34 L;  2L15 A;  3E0E A;  1UE5 A;  5IYC G;  4Y7N H;  1ASY A;  2C35 B;  4QY7 A;  2NZO A;  2OQ0 A;  4J15 A;  5DLQ E;  4X6A H;  2I0Q A;  2IHF A;  1N9W A;  4KHZ A;  3G71 A;  2R92 H;  5AJ3 L;  1HZC A;  2KEN A;  2BA1 A;  5C4J H;  2ZJQ A;  1KAW A;  2VQE L;  1Y1V G;  2KBN A;  3ULJ A;  5M5Y H;  3OTO Q;  3A5U A;  4P72 A;  4OWX B;  1QVC A;  5LMN L;  3GTP H;  4A3J G;  5E7N A;  1Y1W H;  4BXX H;  1NMF A;  3W1G A;  5H1S E;  1VQ9 A;  4A3B G;  1V43 A;  1OXT A;  2KCM A;  3TRE A;  4A3K G;  1Q1E A;  1BBU A;  4YCU A;  4IFD J;  4A3E H;  4B3M Q;  2VUM H;  1TWF H;  3PF4 A;  2IY5 B;  4BBS G;  3CCR A;  1QVG A;  3CC4 A;  1K3R A;  3RLN A;  1VQP A;  1X65 A;  1XMO Q;  3OTO L;  3ICE A;  1J5E Q;  4TQU S;  3A0J A;  5GAH C;  2K14 A;  3LGJ A;  2JA5 H;  1GD7 A;  4DR7 L;  1HZA A;  3CP0 A;  4L5S A;  3HOW G;  4KHP Q;  4OO1 G;  1Q12 A;  4DV1 Q;  1AE3 A;  2NN6 G;  3S16 H;  2XTI A;  1JMC A;  1Y14 B;  3F2C A;  4LUO A;  4DUZ L;  4DR6 Q;  1SFO H;  3ER0 A;  1LM0 A;  4IOC A;  4JI4 Q;  3UDF A;  4QIW E;  1MJE A;  2VW9 A;  3S1N H;  3G6E A;  4A76 A;  3UE0 A;  3STB C;  1IBL Q;  4LF9 Q;  4OWW B;  1JT8 A;  3NEN A;  4AQY L;  5IP9 H;  3S24 A;  3F2D A;  1YHQ A;  2E5L Q;  3M4O H;  4DV1 L;  5C0X J;  1XJV A;  1EQQ A;  3M4P A;  2UUC L;  3RZO H;  3HOY H;  3A74 A;  1VQD A;  2Y0S G;  2JEA I;  2QEX A;  4DV7 L;  3RLF A;  1PVO A;  2EQS A;  1I50 H;  4R1J A;  1KHI A;  1XTD A;  1S40 A;  3TS2 A;  2MO1 A;  1B8A A;  3BZK A;  2D62 A;  4JI1 Q;  2MNA A;  4C3I H;  2E5L L;  3GTQ H;  5IE8 A;  4IO9 A;  1X55 A;  3CCU A;  2F4V L;  1H95 A;  3IRB A;  4GS3 A;  1VQL A;  4PZ6 A;  1VQ5 A;  3PUX A;  1XMQ Q;  1WCM H;  3HOV G;  4A3G H;  4DR2 Q;  4JV5 L;  4PMW A;  3HOU G;  1YIJ A;  1HNX L;  3PUY A;  4KI0 A;  1E22 A;  2ZJR A;  3CPW A;  1VQJ A;  1SMX A;  2YTV A;  2LSS A;  2NVY H;  1I3Q H;  4HJ7 A;  1O7I A;  4A3M H;  4L5R C;  1D8L A;  4OX9 L;  2NVX H;  2F3I A;  5GAE C;  3I4M H;  2K5V A;  5IYC H;  2CWA A;  2ZM6 Q;  3BJU A;  1VQ7 A;  1HZ9 A;  1KRT A;  4YCW A;  4JBK A;  1FJG Q;  3M3Y H;  4A3C G;  4POG A;  1XMQ L;  1PH8 A;  3JAM c;  4JI8 L;  2RHQ B;  2A19 A;  3G48 A;  4P74 A;  4BY1 G;  4POF A;  4X66 Q;  4DR2 L;  3RN2 A;  1P8L A;  1WOC A;  1FGU A;  5IY0 A;  2JA9 A;  2V1C C;  1HZB A;  5C3E G;  1NJI C;  1Y1V H;  3UDX A;  1X9N A;  1I94 L;  4JI6 L;  3T1Y Q;  4A3J H;  4LF8 Q;  2IHE A;  2ZM6 L;  4JBW A;  5IYB G;  3CXC A;  4A3B H;  4A3K H;  4IJH A;  2ZJP A;  2E2J H;  4H02 A;  5ELO A;  4LFA Q;  4LFC L;  4JYA Q;  2KHI A;  2GN5 A;  2WP8 J;  1RIP A;  3S2D H;  1A0I A;  4GN3 B;  4X66 L;  4BBS H;  3PF5 A;  1FL0 A;  1JE5 A;  4HJ8 A;  2Y0S E;  2QGQ A;  1E1T A;  2Q2U A;  1K0R A;  4TVA B;  2ID0 A;  2B63 G;  2MQH A;  2IT1 A;  1X3G A;  4JI0 Q;  2PNH A;  4NXM Q;  1I6H H;  1HR0 L;  1KIX A;  2XGT A;  1CSQ A;  1M1K C;  2E2H H;  2QA4 A;  3HOW H;  3FP9 A;  3CCL A;  5FJ8 G;  4IFD G;  1IZ6 A;  3ULP A;  2ASB A;  3T1H Q;  3U4V A;  5C44 G;  1KRS A;  3WWV A;  4GLA C;  3PUV A;  1G6P A;  3CAM A;  4UP7 A;  2I5M X;  5M3M G;  4LUZ A;  3I56 A;  3JAM i;  5GAG C;  3DM3 A;  3J81 j;  3NBH B;  3D0F A;  3ZJY C;  4DKA C;  4JI0 L;  3HOX H;  4GNX A;  1VQE A;  2WB1 G;  2B29 A;  1PH6 A;  4LFB L;  3FHW A;  1JB7 A;  1YJW A;  4DR5 Q;  5IYD H;  3T1H L;  3OW2 A;  3U50 C;  3H3V I;  1BVS A;  2K4K A;  1AH9 A;  2HT1 A;  4LWC A;  4YCV A;  1EIF A;  4LF6 Q;  1N32 Q;  1PFS A;  1OTC A;  1MKH A;  3J7Z C;  3PO3 G;  3S2H H;  2OWO A;  5C0X G;  3CMA A;  4L5Q A;  1TWH H;  3CC7 A;  1YZ6 A;  3HKS A;  4RG1 A;  4DV3 L;  1X56 A;  2UXD L;  1GM5 A;  3HOV H;  5JEA J;  2UUA Q;  4LF5 L;  3HOU H;  3B6Y A;  1UEB A;  3CQZ H;  5BR8 Q;  4L5T A;  1W2B A;  1N32 L;  4JCV E;  4DUY L;  4R4O A;  1YJ9 A;  4LF4 Q;  3HOZ G;  3L0O A;  4XIG S;  1P16 A;  2ZTD A;  1PH5 A;  4EQ5 A;  1UE6 A;  4IPD A;  1EWI A;  1IBK Q;  1E3P A;  1G51 A;  2VL6 A;  4O2D A;  1IBM Q;  1EIY B;  4A3L G;  4A3C H;  3PCO B;  3K8A A;  1W3S A;  1U5K A;  1YBY A;  2NN6 I;  4ALP A;  4BY1 H;  1YJN A;  4P75 A;  1G29 1;  1OXV A;  3GTJ H;  2N78 A;  5BR8 L;  3RZD H;  2PQA A;  2N3S A;  5IWA Q;  3S14 H;  1YEZ A;  5C3E H;  4LF4 L;  4BA1 I;  3CME A;  1KL9 A;  4DV5 Q;  1EYG A;  4YWK A;  3RR5 A;  1Q86 C;  1X54 A;  5IYB H;  1IBM L;  1E7Z A;  2JA8 G;  1L1O A;  4B3M L;  2WB1 E;  4JC0 A;  3I4O A;  3MXN B;  2DGY A;  4OXP A;  1X3E A;  1XMO L;  1PV4 A;  4GKJ Q;  1J5E L;  5IWA L;  3S1R H;  2HHH Q;  2R6G A;  1ASZ A;  1VQI A;  2B63 H;  1A62 A;  1YIT A;  1VQC A;  4B3T Q;  1PYS B;  4DV5 L;  4KHP L;  2UUB Q;  1K83 H;  4MNO A;  3ULL A;  3UDG A;  2RF4 A;  4MZ9 A;  3RN5 A;  1VQM A;  1N36 Q;  2I5L X;  2WAQ G;  1C0A A;  1Q7Y C;  5JJL A;  5FJ8 H;  4IPH A;  3RLO A;  1MJC A;  4C3J H;  1SRU A;  4A3F G;  4JI2 Q;  1Q81 C;  4R4T A;  5C44 H;  2KCT A;  4DR6 L;  2ALY B;  1MIU A;  1I5F A;  4JI4 L;  4HIM A;  4GKJ L;  4O0A A;  2HHH L;  1E24 A;  1TWA H;  2AKW B;  1VQK A;  1IBL L;  4LF9 L;  4B3T L;  1SN8 A;  1VS0 A;  3AYH B;  2UUB L;  3CPF A;  4EX5 A;  1Q82 C;  1VQ6 A;  1EFW A;  4BBR G;  3D31 A;  5M3F H;  4JI2 L;  1OXU A;  4X65 Q;  3GTG H;  2ES2 A;  3CCV A;  3CCJ A;  4JBM A;  2R7Z G;  2BA0 A;  1LTL A;  5HGQ A;  5IP7 G;  4HID A;  2VNU D;  2PI2 E;  2N8N A;  3A5Z B;  3K0X A;  4JI1 L;  3PV0 A;  4YHH Q;  1UE7 A;  4NXN Q;  3PUZ A;  3TEH B;  3CW2 C;  3PO3 H;  3EIV A;  3M4Q A;  3CCE A;  2A1A A;  4AYB G;  4DPG A;  1BBW A;  3KDF B;  2JQO A;  3GD7 A;  2R93 G;  3L2P A;  2E8G A;  4GNX B;  2MO0 A;  1EQR A;  1SLJ A;  4LUV A;  4DR3 Q;  4LF7 Q;  2GVB A;  2K75 A;  4B3S Q;  1LYL A;  2R92 G;  1B70 B;  1WI5 A;  1GKH A;  4YHH L;  2K52 A;  3TQY A;  4A3I G;  3HOZ H;  1NMG A;  1UWV A;  2N49 A;  2PI2 A;  3UDI A;  3AQQ A;  1FJG L;  2UXB Q;  2ZTE A;  1OXX K;  2YTX A;  3HFZ B;  3GTM H;  1QUQ B;  4DV2 Q;  2JA6 G;  2F52 A;  4BXX G;  1VQO A;  4A3L H;  1M90 C;  5JEA G;  1D7Q A;  2R7D A;  2LXJ A;  4ME3 A;  4DR3 L;  1T9H A;  2K5H A;  2AWO A;  4B3S L;  1Q8K A;  2RHS B;  1BKB A;  4KLK A;  2VUM G;  2JEB I;  4WJ3 M;  5JJK A;  2Z0S A;  3KF6 B;  3T1Y L;  4HJ9 A;  1KD1 C;  4LF8 L;  2D0P A;  4DV0 Q;  1PYB A;  1XNR Q;  4DK6 C;  1QVF A;  1OXS C;  2UXB L;  4QGU A;  4JYA L;  3H15 A;  1S3O A;  5J3B A;  4LFA L;  2JA8 H;  3J7A 5;  4LNQ A;  4A3D G;  4HIO A;  3GTL H;  4JI3 Q;  2EIF A;  3S17 H;  1Z47 A;  2VS1 A;  3SGI A;  3AFP A;  5ELN A;  1TXY A;  3CF5 A;  4JI5 Q;  2KHJ A;  1WJJ A;  4R4C A;  1U0L A;  3KDF A;  1TWG H;  3HKZ G;  5JJI A;  1XPO A;  3I2Z A;  3KF8 B;  4NXM L;  3STB D;  2PQA B;  3F2B A;  3AEV A;  2JK8 A;  5FLM G;  1V1Q A;  2H5X A;  3JC6 6;  3G4S A;  4GOP B;  4DNI A;  1PH2 A;  3S15 H;  4NPS A;  5IP9 G;  4GNX C;  5IT9 c;  3Q8D A;  4AYB E;  4A3F H;  3CC2 A;  1HNW Q;  1IXR A;  4X62 Q;  4OON A;  1L1O B;  2LXK A;  3CCM A;  1X6O A;  4JI5 L;  2IX1 A;  5C4X G;  4DK3 C;  1Z9F A;  4QJF A;  1QUQ A;  4C3H H;  2YU9 H;  2Q2I A;  1VQB A;  1N33 Q;  1HJP A;  1YVC A;  1IL2 A;  1TWC H;  2CQO A;  4DR5 L;  3PUW A;  2Z6K A;  2UU9 Q;  4BBR H;  3PO2 G;  1FVI A;  3ERS X;  1YHA A;  5LMN W;  3KF6 A;  4X62 L;  1WYD A;  2R7F A;  1VQG A;  2VQF Q;  4YWL A;  1KC8 C;  4LF6 L;  3I4N G;  3M7N A;  2Z6K C;  1KQS A;  3VDY A;  2I5H A;  4XTC S;  2R7Z H;  4A3G G;  5IP7 H;  3J80 c;  2CCZ A;  3KYH C;  5AJ3 Q;  2OQK A;  3PIO A;  3F1Z A;  1QZG A;  4IJL A;  1C7Y A;  2R93 H;  1J6Q A;  5LMN Q;  4OO1 I;  3PSI A;  3I4M G;  2ATW A;  2AHO B;  4A4I A;  3AFQ A;  2UUA L;  2VQF L;  1PH7 A;  4P73 A;  5EAY A;  5M5W H;  1VQF A;  4GOP A;  4AIM A;  1SRO A;  3E9I A;  4GLV B;  4A3I H;  1UE1 A;  1GVP A;  3TRZ A;  2CKZ B;  4HIK A;  1IBK L;  1Q46 A;  4GOP C;  3HKZ E;  4X64 Q;  4JI7 Q;  2JA6 H;  1GO3 E;  1YHB A;  4DR7 Q;  3PGZ A;  3KJO A;  1NBW A;  3EBE A;  3M9B A;  3OYY A;  1QZH A;  2E2I H;  1L1O C;  4A75 A;  1N8R C;  1CUK A;  3FKI G;  1L0W A;  4RMF A;  4C2M H;  2D0O A;  1JJC B;  2RCN A;  2DUD A;  4DUZ Q;  2CWP A;  4A93 G;  3MEF A;  3J80 i;  2OTL A;  1IYJ B;  4X64 L;  4JI7 L;  4A3D H;  4AQY Q;  4BY7 G;  4BA2 I;  4GKK Q;  5M3M H;  2UUC Q;  1NY4 A;  4QL5 A;  1C9O A;  4NB3 A;  4K0K Q;  4DV7 Q;  2JA7 G;  1EUJ A;  4LW1 A;  4R4Q A;  3J81 c;  4GN5 A;  4HJ5 A;  2K50 A;  1CKN B;  1N36 L;  1V9P A;  1VQN A;  3UE1 A;  3CD6 A;  5FLM H;  1VCI A;  2VZA A;  3BZC A;  4YY3 Q;  2BH2 A;  3H0G G;  3KLW A;  3HOX G;  4OWT B;  2F4V Q;  4GKK L;  3U4Z A;  2HIX A;  3S1Q H;  2UXC Q;  5IYD G;  5C4X H;  3U58 A;  4K0K L;  4UY8 C;  4JV5 Q;  3GO5 A;  1HNX Q;  3K81 C;  1VQA A; 
#chains in the Genus database with same CATH topology
 1PH1 A;  5EPK A;  3HRZ C;  1HH2 P;  2UXC L;  3NWS A;  2YV5 A;  3I73 A;  1G8Z D;  2HQL A;  2RKS A;  3BU2 A;  4WJ4 A;  3I55 A;  1H9S A;  3HOV B;  2KA7 A;  3J81 i;  1A3T A;  2IW3 A;  2NZH A;  4DR1 L;  1BBX C;  1CKN A;  2F0T A;  1M4V A;  1PH4 A;  2B3G A;  1MGS A;  1LV9 A;  3OMC A;  4YWM A;  3I7F A;  2R93 B;  4MTN A;  1LT3 D;  2A8V A;  4F7X A;  3F8T A;  4I65 A;  4BY1 B;  2EYL A;  1D5M C;  5DM6 3;  4DV6 Q;  1F9P A;  1B9N A;  2GVA A;  3EVQ A;  2WAC A;  3SK5 A;  4A3I B;  2MFI A;  1GOZ A;  3FKI H;  1HFN A;  4DV0 L;  1XNR L;  1NE3 A;  3W3A A;  3M85 A;  1STB A;  3CRK C;  3E6Z X;  4FDB A;  5CYU A;  5IGF A;  2NYZ D;  4DAM A;  4DNT B;  1PHJ A;  4GLX A;  3W1B A;  4BY7 H;  4JBJ A;  5JAV A;  2IL8 A;  5BN4 A;  5FLX L;  1PZJ D;  5J1Z A;  4C3J B;  1DYQ A;  1TS3 A;  3RD4 A;  3D8G A;  3P75 A;  5C44 B;  1CFM A;  4C3I G;  1RL2 A;  2F3V A;  1ML0 D;  2F4I A;  4DV3 Q;  4QCL A;  5DM7 3;  2WB1 B;  1EOV A;  4FF2 A;  4IPC A;  2HCC A;  4OL7 A;  4Y52 H;  2EJG C;  1EIG A;  1JCK B;  1EOT A;  1AP0 A;  1UE5 A;  4Y7N H;  4QUF A;  1STH A;  2R92 H;  1N9W A;  3KLS A;  1HZC A;  2X6G A;  3OSO A;  1QG7 A;  3VA5 A;  2EXZ A;  2R61 A;  4OWX B;  4R8N A;  4PV1 C;  3EQL C;  3TME A;  5E7N A;  1EY4 A;  4BXX H;  1QB5 D;  3DWA A;  4A3B G;  2B2T A;  3TRE A;  4A3K G;  1Q1E A;  1BBU A;  1CA5 A;  4B3M Q;  2VUM H;  2B2T C;  1QVG A;  2J4X A;  1D5X C;  1VQP A;  4DA2 A;  3OTO L;  3ICE A;  4KD3 A;  4IUT A;  2K14 A;  2QF7 A;  1SNQ A;  3NQI A;  4OEM B;  1GXD C;  4L5S A;  1AE3 A;  2NN6 G;  2XTI A;  1JMC A;  1Y14 B;  3F2C A;  4DUZ L;  2AQ1 B;  1MI2 A;  1XXG A;  3UDF A;  1EY9 A;  3GTL B;  1JT8 A;  4LF9 Q;  1IBL Q;  2EDG A;  4AQY L;  1LO5 D;  1PRT B;  3TP8 A;  5FO7 B;  5IGD A;  5C0X J;  3RZO H;  4PMB A;  2Y0S G;  2HUG A;  4KY6 A;  4DV7 L;  1C48 A;  3SE0 A;  3DEP A;  1I50 H;  2RCF A;  2MO1 A;  2VB3 X;  4C3I H;  2E5L L;  2O2L D;  1H95 A;  1LTG D;  3PUX A;  1XMQ Q;  1DJR D;  3JAM L;  4XT3 B;  2FJ2 A;  2M9V A;  1HNX L;  2ZJR A;  5DNF A;  1UNS A;  2NVY H;  1DXM A;  2K32 A;  1HZ9 A;  4KMU C;  4U68 A;  3AB9 A;  1PH8 A;  1CHP D;  2A19 A;  3QOL A;  4FNF A;  4XYO A;  1FGU A;  5BN5 A;  1ZYR C;  1SNP A;  4N9T A;  2V1C C;  1SJE D;  4Y7N B;  2KEC A;  1NNX A;  4LF8 Q;  2N88 A;  2ZM6 L;  4A3B H;  1PRT C;  2R92 B;  4A3K H;  2ZJP A;  2E2J H;  4H02 A;  5ELO A;  4LFA Q;  1RIP A;  2EY2 A;  5CGK A;  3PF5 A;  2LY7 A;  2QGQ A;  1DON A;  4K5V A;  4TVA B;  2DJF C;  1TY2 A;  2IT1 A;  5EPL A;  4JI0 Q;  2IWH A;  2XGT A;  2KCN A;  2CW0 D;  2VUM B;  2SOB A;  3E0J A;  3CCL A;  2NN6 H;  1IZ6 A;  3T1H Q;  1KRS A;  4GLA C;  2KUM A;  1ILQ A;  2I5M X;  3EFX D;  4LUZ A;  1SXT A;  3BG3 A;  5M3M G;  1GJX A;  3J81 j;  4CGY B;  4DKA C;  1W6J A;  2NTS A;  3HOX H;  1VQE A;  3FHW A;  1A15 A;  1D1I A;  3R93 A;  3ZYY X;  2LS0 1;  1Q90 A;  2A73 B;  1AZQ A;  5FLX E;  3H3V I;  4TKO B;  2B2Y A;  3I90 A;  1EIF A;  2B2Y C;  1RKN A;  3S1Q B;  1GUN A;  1YZ6 A;  4YIJ A;  2OXP A;  3HKS A;  4DV3 L;  4XXE A;  4M1U B;  2EYM A;  4LAA A;  1R9T B;  1N32 L;  3E5S A;  4JCV E;  4RFB A;  3L0O A;  3MFY A;  3I4N B;  1P16 A;  2ZTD A;  1PH5 A;  1QNK A;  1UE6 A;  4KD4 A;  5J22 A;  1IBM Q;  4ZAI A;  4O2D A;  3PCO B;  3K8A A;  2Q8I B;  2NN6 I;  2NVQ B;  3S14 H;  2ZT9 C;  3F2U A;  4LF4 L;  1KL9 A;  2EYF A;  1EYG A;  4YWK A;  2JA8 G;  1E7Z A;  3MVV A;  4B3M L;  1GHJ A;  4JC0 A;  1SNC A;  3I4O A;  4OXP A;  1X3E A;  4EQP A;  3LNN A;  2F0M A;  5I2Y A;  1GHK A;  3KBG A;  2HHH Q;  4ME5 A;  5KND A;  3DWQ A;  1A3V A;  3FVQ A;  4A3K B;  1K83 H;  2RF4 A;  4NW2 A;  2WAQ G;  2V4D A;  1SBB B;  2EY5 A;  4IPH A;  1SRU A;  1Y8O B;  4A3F G;  1Q81 C;  3D4W A;  4GKJ L;  3DXJ C;  1KDA A;  2AKW B;  4LF9 L;  1IBL L;  4B3T L;  3AYH B;  2UUB L;  1SYC A;  1ILP A;  3SK4 A;  3RMH A;  4JVZ A;  3IL8 A;  3HG9 A;  4X65 Q;  2ES2 A;  1EZ8 A;  5EGT A;  3CCJ A;  4DAV A;  2R7Z G;  3HOX B;  2N8N A;  1HA5 A;  4YHH Q;  4Q0F A;  3PV0 A;  1WTP A;  2EZV A;  3CW2 C;  2JSO A;  3M4Q A;  2A1A A;  4AYB G;  4DPG A;  3H3V C;  2JQO A;  1H9K A;  4GNX B;  5CV4 A;  3S1M B;  3SK6 A;  4LF7 Q;  4B3S Q;  5KEE A;  3GTK B;  1TS5 A;  1UWV A;  3HZX A;  4CJ2 C;  1JWU D;  2ZXO A;  3HFZ B;  3GTM H;  3K5O A;  2F52 A;  2TMP A;  1BQQ T;  5C4J B;  4FXD A;  1LTR D;  3P1H A;  1D7Q A;  2L55 A;  3LWE A;  1WTR A;  4IUN A;  1SE4 A;  2AWO A;  2RHS B;  4KLK A;  2JEB I;  3Q6S A;  1H9M A;  1KD1 C;  4LF8 L;  1CQV A;  1L0Y B;  1MSG A;  4OO1 H;  1OXS C;  1NAP A;  2UXB L;  5D3D A;  1Y69 U;  1CA6 A;  4LFA L;  2JA8 H;  3J7A V;  3J7A 5;  4WRD A;  4JI3 Q;  3S17 H;  2VS1 A;  3S14 B;  1TS4 A;  3A55 A;  1ET9 A;  4R4C A;  1U0L A;  1TT2 A;  3FMC A;  3STB D;  2PQA B;  3S16 B;  3DEO A;  3F2B A;  5FLM G;  2D5D A;  3G4S A;  2DJG C;  4DNI A;  3S15 H;  4K2L A;  2EJM A;  4GNX C;  4A3F H;  3CKI B;  5CC4 A;  4JI5 L;  2IX1 A;  4DK3 C;  1J8I A;  1K83 B;  4QJF A;  3C1E A;  5IGE A;  3K0Y A;  1N33 Q;  1GUS A;  2UU9 Q;  1EYA A;  1PDQ A;  5ELE A;  3PO2 G;  3ND9 A;  1QJO A;  1E0B A;  1KC8 C;  1SE2 A;  4MTK A;  1KNA A;  2R7Z H;  3J80 c;  3DUZ A;  1EFI D;  4ZYS A;  4FF4 A;  2OQK A;  2KCC A;  1H9J A;  3F1Z A;  1J6Q A;  4OO1 I;  1S4Z A;  3PSI A;  3I4M G;  2ATW A;  2OEO A;  1Q3L A;  1NSN S;  3AFQ A;  1UAP A;  4A3M B;  3K58 A;  2NVX B;  1VQF A;  1JOR A;  1UE1 A;  1SNM A;  1GVP A;  1L0X B;  1ENC A;  4KTA A;  4JK1 C;  5I9P A;  1EQT A;  1E2Z A;  1YHB A;  1Y1V B;  3M9B A;  2E2I H;  1L0W A;  4C2M H;  2ICE C;  1SEB D;  2R3Z A;  4XDX A;  3S2D B;  1V1P A;  2OTL A;  3NK9 A;  4X64 L;  4JI7 L;  4BBS B;  3ITP A;  1CI3 M;  1A2T A;  1EWC A;  1TQO A;  1RF2 D;  3PIP 3;  3OWE B;  2UUC Q;  1NY4 A;  1C9O A;  1SNO A;  4NB3 A;  3A7A B;  3HOW B;  3J81 c;  4HJ5 A;  1BDO A;  1ONL A;  2FHT A;  2M2L A;  3V96 A;  1EIH A;  3FPU B;  5FLM H;  3CD6 A;  3BZC A;  3I4L A;  3H0G G;  2F4V Q;  1EYC A;  3U4Z A;  1HFG A;  5NUC A;  2UXC Q;  2K7V A;  3U58 A;  4UY8 C;  4JV5 Q;  3D4R A;  3GO5 A;  3K81 C;  3QG1 A;  3S15 B;  3SHL A;  3K80 C;  1K9M C;  3NSW A;  2SNS A;  5FKA C;  2QCP X;  4YY3 L;  1PH9 A;  4K14 A;  3PO2 H;  4X65 L;  4OX9 Q;  4QQB X;  4KN4 C;  1FNV A;  2ZTC A;  5EQ0 A;  4DR1 Q;  4APV A;  4NP5 A;  3GDE A;  1PYW D;  4IPG A;  3D3R A;  1F9R A;  4JI8 Q;  1HUM A;  1I4R A;  4XQJ A;  4TSS A;  3E9H A;  3OIP A;  4UPA A;  1D2B A;  4JI6 Q;  5DEH A;  3PIP A;  2Q2H A;  3CQZ B;  3HOU B;  4IFD I;  1U4L A;  2WAQ E;  4LF7 L;  4JPB W;  3W5O A;  4RKL A;  5IOD A;  1PA6 A;  1JJ2 A;  5GAD C;  1LUZ A;  1A63 A;  1CM9 A;  4B9W A;  2JA5 G;  3NHH A;  1K8A C;  3K7A H;  2FMM A;  3NEL A;  1AE2 A;  1PZK D;  5JJZ A;  3DM1 A;  4JOI A;  1K3B C;  3DWP A;  2NUC A;  1YNX A;  4QB4 A;  2BH8 A;  4JOI C;  2MGS A;  5CR3 A;  3RNU A;  3ND8 A;  3NTK A;  4JI3 L;  5BN3 A;  1S72 A;  3I8Z A;  2F0F A;  3HOY G;  2L0C A;  5CV6 A;  1Q1B A;  4PZ8 A;  4RGM A;  4DV4 L;  2EOT A;  4HCE A;  4ZKC B;  2YYZ A;  4DR4 L;  2VY3 A;  3E3X A;  3QR8 A;  1IHZ A;  1GUG A;  3H0G H;  1Z7T A;  2EXD A;  1XPU A;  4KKT A;  1ESR A;  3T53 B;  4L63 B;  4ILW A;  1N33 L;  3IFD A;  5HY6 A;  4LF5 Q;  4PG3 A;  2UU9 L;  1E1O A;  3R2I A;  2C35 B;  5KGU A;  2XRQ D;  1EEF D;  2OQ0 A;  4X6A H;  4RAU C;  1ZYR D;  4KHZ A;  1SYE A;  2O5J C;  2BA1 A;  1KAW A;  3ULJ A;  3OTO Q;  3A5U A;  3PO2 B;  1PRT D;  4BS9 A;  3A56 A;  4MHE A;  1NMF A;  1OXT A;  4LJZ C;  2KCM A;  5KRU A;  2L9H A;  4N8X 1;  3HOZ B;  5J39 A;  2B2U A;  3U9S A;  1RHP A;  4DN4 M;  1TWF H;  3NTI A;  3PF4 A;  2IY5 B;  4QUC A;  3KLS X;  1LAC A;  1K3R A;  3RLN A;  2EY1 A;  1BCP F;  1X65 A;  3K57 A;  4TQU S;  5KNB A;  3LGJ A;  2JA5 H;  1EYD A;  1KLU D;  4KHP Q;  1JIC A;  2EYP A;  5C4Z A;  2NWG A;  3SR1 A;  3G7L A;  1SFO H;  1LM0 A;  4IOC A;  4QIW E;  2VW9 A;  3S1N H;  3G6E A;  3UE0 A;  3K7A B;  3STB C;  1JB3 A;  1MD2 D;  1YHQ A;  2E5L Q;  3M4O H;  2ZXR A;  4DV1 L;  1KDB A;  1PLF A;  2F0S A;  4Z9C B;  2UUC L;  3HOY H;  2JEA I;  4HSV A;  3RLF A;  1PVO A;  4R1J A;  2B8G A;  1XTD A;  1T5E A;  5EPJ A;  4FXG C;  3Q0A A;  1KNE A;  2MNA A;  3QIA A;  4IO9 A;  2F4V L;  3P7J A;  2F0D A;  4PZ6 A;  4CDF C;  2RVL A;  4C3H B;  1VQ5 A;  2YU9 B;  4A3G H;  4JV5 L;  4PMW A;  1YIJ A;  1CHQ D;  4KI0 A;  2XWB B;  4BBR B;  2YTV A;  3HP3 A;  3H0G B;  2CVR A;  4L5R C;  2A68 D;  4OX9 L;  1HUN A;  5GAE C;  2ZM6 Q;  4JBK A;  4YCW A;  4DK1 A;  1V8Q A;  3MXN A;  4A3C G;  4F88 A;  4JI8 L;  4P74 A;  3G48 A;  4BWG B;  1LAB A;  5IY0 A;  1U4P A;  4CKE A;  3BVZ A;  1X9N A;  1K28 A;  4JI6 L;  2OF1 A;  3T1Y Q;  3OPO A;  5M5W B;  5IOC A;  1AEX A;  1QNU A;  2CH4 W;  3H09 A;  1KAA A;  4JYA Q;  4C1N I;  3QO2 A;  4HR7 B;  4ULL A;  2KHI A;  2WP8 J;  4K8J A;  4X66 L;  1JE5 A;  1PTO H;  4G4K A;  4HJ8 A;  3P20 A;  3ERQ A;  2B63 G;  3OW7 A;  3PQI A;  5IT9 E;  1CSQ A;  1M1K C;  2K6A A;  3NQT A;  2QA4 A;  2E2H H;  2KHS A;  2F0L A;  3FP9 A;  5FOB B;  1TWF B;  4IUP A;  5JPN C;  1SAP A;  3CHB D;  3U4V A;  3TDQ A;  3CAM A;  3I56 A;  3WDN A;  2F0P A;  3BYY B;  1ZKO A;  3D0F A;  3NXW A;  4TRD A;  1YNN C;  5D14 A;  1JB7 A;  1YJW A;  1HTL D;  3HKZ B;  5IYD H;  2Z9H A;  2K4K A;  4LWC A;  1N32 Q;  2EYH A;  1OTC A;  1C8C A;  3C3L A;  2EPB A;  3J7Z C;  4U67 3;  1SYF A;  3M4O B;  5C0X G;  1RDP D;  4RG1 A;  3R3O A;  1X56 A;  2FFK B;  5ELD A;  5JEA J;  4LF5 L;  4HMJ A;  5A2Q L;  1UEB A;  1W2B A;  1WTH A;  2RQX A;  1YJ9 A;  4LF4 Q;  4KKU A;  3MC0 B;  2L11 A;  2PZW A;  3T13 A;  1IBK Q;  2F0U A;  4A3G B;  2JN4 A;  2BOS A;  4A3C H;  1VMC A;  1U5K A;  1EY8 A;  4ALP A;  4P2C B;  1YJN A;  1G29 1;  1OXV A;  3GTJ H;  3RZD H;  3S9W A;  4CDC C;  3CME A;  1ROD A;  1B1Z A;  4FVM A;  5K5P A;  4RGT A;  5KIX A;  1L1O A;  2E76 C;  2WB1 E;  5ELB A;  4GKJ Q;  3S1R H;  2R6G A;  1H9R A;  2B63 H;  2PMZ B;  4GZY C;  1YIT A;  4B3T Q;  4DV5 L;  4KHP L;  2D2C C;  2UUB Q;  4MNO A;  3UDG A;  1HQR D;  1VQM A;  2I5L X;  3FKI B;  1C0A A;  1HQM C;  2M00 A;  1WD0 A;  3K5M A;  2KCT A;  2Q8R E;  4HIM A;  1KAB A;  4OGQ C;  1TWA H;  1VQK A;  1TU2 B;  1EY6 A;  2E2H B;  4BY7 B;  1JQY D;  1VQ6 A;  1EFW A;  1I4X A;  1XTC D;  3CCV A;  1U4R A;  2BA0 A;  1LTL A;  5KYI A;  3A5Z B;  1UE7 A;  5EKK A;  4CKB A;  3EIV A;  3V2T A;  1BBW A;  3KDF B;  5C0X H;  2E8G A;  2G9D A;  4HED A;  2A5H A;  3BZD B;  1NR2 A;  1X32 A;  4X3U A;  3IFT A;  2B2W A;  1LYL A;  1WI5 A;  4PQX A;  3TQY A;  2KEE A;  1F9Q A;  3TZD A;  2B2W C;  2UXB Q;  2DY8 A;  5JPM C;  2XIW A;  4DV2 Q;  2JA6 G;  1VQO A;  4XQQ A;  3SEB A;  3NP8 A;  2EJF C;  3MHB A;  2R7D A;  4H13 C;  3BDO A;  1TY0 A;  4DR3 L;  2K5H A;  1VF7 A;  2F0G A;  1BKB A;  1HTP A;  4KJO A;  4WJ3 M;  3KF6 B;  2L5T A;  3T1Y L;  2FIN B;  2D0P A;  3EJI A;  1X3Q A;  2F0E A;  4JYA L;  3H15 A;  4LNQ A;  4A3D G;  3FDT A;  3NBI A;  3A7L A;  3SGI A;  1GUW A;  4JI5 Q;  1Z6H A;  2KHJ A;  1WTV A;  3KDF A;  1TWG H;  3I2Z A;  1B50 A;  1B2T A;  3AEV A;  2JK8 A;  4IAL A;  1FNU A;  2H5X A;  1JC7 A;  1S5F D;  4K6L A;  5IP9 G;  3CCM A;  4NMZ A;  1XYI A;  5C4X G;  1Z9F A;  3J80 L;  4RGN A;  2Q2I A;  1VQB A;  3OMG A;  3RZO B;  1YVC A;  4LK1 C;  1IL2 A;  1TWC H;  3PUW A;  1I50 B;  5LMN W;  3KF6 A;  1DZ1 A;  3S2H H;  2DY7 A;  3Q24 A;  1BCP B;  5EKI A;  3TP6 A;  4C3I B;  3NPP A;  1BO0 A;  5AJ3 Q;  2B39 A;  3KBX A;  1IL8 A;  2A68 C;  5LMN Q;  1R4Q B;  1IYV A;  2AHO B;  3A54 A;  4A4I A;  3SDZ A;  2AQ3 B;  5ELC A;  4NKL A;  2NVY B;  4P73 A;  5EAY A;  5A2Q E;  3T4A C;  2P5Z X;  1SRO A;  1I4H A;  3E9I A;  2L1B A;  3TRZ A;  2A6H C;  2CKZ B;  1IBK L;  2F0O A;  1Q46 A;  2BDN A;  1S5C D;  4X64 Q;  4JI7 Q;  3ONA B;  2JA6 H;  1GO3 E;  4ABN A;  4DR7 Q;  1QZH A;  3OYY A;  1G6Z A;  1QCB D;  5COY A;  1CUK A;  2EVB A;  5D65 A;  2K28 A;  4RMF A;  2D0O A;  1JJC B;  4A3B B;  3J81 L;  2HD3 A;  2E2J B;  4EVO A;  4CBV A;  4A93 G;  3FEW X;  3MEF A;  1SJH D;  4A3D H;  5M3M H;  5FO9 B;  1BCP C;  4KY7 A;  4OHJ A;  2JA7 G;  1EUJ A;  4KHV A;  4GN5 A;  2K50 A;  1VQN A;  2WKC A;  3UE1 A;  1FNW A;  4S3S A;  2BH2 A;  4YY3 Q;  3KLW A;  3MXG A;  1TWG B;  3I72 A;  5C4X H;  1DM0 B;  1IKL A;  2Y0S B;  4IOA A;  4MIU A;  1S5B D;  3JAM E;  3VA7 A;  3OHX C;  2K01 A;  1STG A;  1CKO A;  4PZ7 A;  4WJW A;  2IX0 A;  2VXW A;  1NTG A;  3NEM A;  1RJT A;  1JOK A;  1VQ4 A;  4WFN 3;  5C4H A;  1I94 Q;  4IUR A;  3S2H B;  4WOR A;  2BE5 C;  4ZCK A;  1J9O A;  3J7A F;  1YI2 A;  2H1E A;  2XSC A;  1HNZ L;  1A8V A;  1HR0 W;  4LFC Q;  4FYD A;  4B3R L;  3R2T A;  1XPR A;  2I46 A;  2JE6 I;  3K7U C;  2QW7 A;  4GN4 B;  1CSP A;  4DV2 L;  4I7Z C;  2NVT H;  1JOQ A;  3GV3 A;  1STA A;  1HR0 Q;  4HCS A;  2Z6B A;  2F0K A;  4DGZ A;  2K5N A;  2O5I C;  2AQ2 B;  5GRO A;  4DV4 Q;  1VQH A;  4AH6 A;  4DR4 Q;  4A93 H;  2YTY A;  1XNQ L;  3SK8 A;  3CCQ A;  2JJQ A;  1Y8P B;  1BXT A;  1K73 C;  2JA7 H;  4K6D A;  1MSH A;  4RWS C;  4R4I A;  1KTK A;  1V1P B;  3D6W A;  5M3M B;  5LMU L;  5K36 G;  4QF4 A;  1JJG A;  5M3F G;  1WCM G;  4K8I A;  5F2D A;  2UXD Q;  3J80 E;  3MWY W;  1DGS A;  1E2V A;  2PW5 A;  4DUY Q;  5G3L F;  1C4Q A;  5IYC G;  1S5D D;  3E0E A;  3K5L A;  1N34 L;  1ASY A;  4QY7 A;  5C4X B;  5DLQ E;  1A3U A;  5EBC A;  3VR4 A;  1GUO A;  3G71 A;  1FD7 D;  1F9S A;  2LKV A;  5AJ3 L;  3W2D A;  2VQE L;  2KBN A;  5M5Y H;  5LMN L;  4A3J G;  3W1G A;  5H1S E;  1QIL A;  3V05 A;  4YCU A;  1TII D;  4IFD J;  4DXF A;  3PMF A;  3CC4 A;  3NUC A;  3GTM B;  5IGB A;  3GQB A;  1XMO Q;  1J5E Q;  3A0J A;  1PMR A;  3N6R A;  1GD7 A;  4DR7 L;  3T56 B;  1Q12 A;  1LTB D;  3BVM A;  4DV1 Q;  1TKW B;  2FMC A;  2PYK A;  1PFB A;  3SVM A;  4LUO A;  1YNN D;  4DR6 Q;  2JA8 B;  3ER0 A;  4K2K A;  2NVT B;  2ENB A;  2KJX A;  3VR2 A;  4XT1 B;  3S17 B;  4OWW B;  5C3W A;  3NEN A;  2CQA A;  1I4Q A;  2QDB A;  3TZU A;  1XJV A;  1EQQ A;  1E2W A;  3M4P A;  4HN7 A;  5JVG 3;  2I07 B;  2QEX A;  3FRP B;  2RBM A;  5T1G A;  4A93 B;  2WAQ B;  1S40 A;  2K03 A;  1Y8N B;  3C1F A;  4R8I A;  4A3F B;  4JI1 Q;  4DNR B;  1QOH A;  3GTQ H;  3ERO A;  5IE8 A;  3CCU A;  4RGO S;  3KK7 A;  1VQL A;  1PTO F;  1WD1 A;  1B3Q A;  1WTO A;  1A6X A;  1WCM H;  3HOV G;  3DMU A;  2DNC A;  2XNA C;  3PUY A;  1BNZ A;  3CPW A;  4B9X A;  2F0Q A;  1VQJ A;  1SMX A;  1I3Q H;  1O7I A;  3I91 A;  2PZU A;  5C3X A;  3X3N A;  3I4M H;  2K5V A;  5IYC H;  3BJU A;  1KRT A;  2R7Z B;  2JXM B;  5FO8 B;  2RHQ B;  4BY1 G;  4DR2 L;  4X66 Q;  1WOC A;  4AYB B;  2L4N A;  2JA9 A;  4ZK9 B;  3OOC A;  5C3E G;  1HZB A;  2F0N A;  3HGB A;  3UDX A;  1I94 L;  4A3J H;  3VR3 A;  3CXC A;  1WVL A;  4LFC L;  3TN2 A;  3QWN A;  1A0I A;  1LTS D;  4GN3 B;  1PXU A;  5M5Y B;  1E1T A;  2ID0 A;  2HCI A;  4F8M A;  1X3G A;  3K59 A;  4NXM Q;  2E2I B;  1HR0 L;  1KIX A;  1EWH A;  4C2M B;  1B53 A;  5FJ8 G;  2B2V A;  4C3J G;  3ULP A;  2ASB A;  3D6C A;  5C44 G;  1EY0 A;  3WWV A;  3PUV A;  1G6P A;  4UP7 A;  2B2V C;  5CBA E;  5CV8 A;  5GAG C;  3JAM i;  3NBH B;  3ZJY C;  1X3P A;  2WB1 G;  1O7Y A;  2B29 A;  1PH6 A;  3FPP A;  2H4O A;  4DR5 Q;  3O13 A;  4J1M A;  4PMC A;  5IIF A;  2A6E D;  2HT1 A;  4YCV A;  2ICI A;  1PFS A;  4J6H A;  3NE5 B;  1Q8I A;  3MEH A;  2OWO A;  2CHB D;  3CRL C;  3CMA A;  4L5Q A;  1TWH H;  2SNM A;  2UXD L;  1GM5 A;  3HOV H;  2UUA Q;  3B6Y A;  4H44 C;  1AFP A;  4KY5 A;  4DUY L;  2NZ1 D;  4R4O A;  3C46 A;  1AN8 A;  4XIG S;  1G91 A;  1BUV T;  4DFA A;  1O80 A;  3DHQ A;  1E3P A;  1WCM B;  2VL6 A;  4QIW B;  1EIY B;  4IQZ A;  5EBD A;  3NBH A;  4BY1 H;  4ZQ3 A;  3N52 A;  1ICW A;  2N78 A;  5BR8 L;  1I3Q B;  2B2U C;  1YEZ A;  4K5W A;  5C3E H;  3I4M B;  3R8B A;  4DF7 A;  2MP1 A;  1LT5 D;  4DV5 Q;  3RR5 A;  1Q86 C;  1HRJ A;  3X3M A;  3A8K E;  3MXN B;  5D3I B;  2DGY A;  1XMO L;  1PV4 A;  1J5E L;  5IWA L;  4A3J B;  1ASZ A;  2X69 A;  3K6O A;  1A62 A;  4QMG A;  1VQC A;  1PYS B;  2NTT A;  3ULL A;  1K8M A;  1N36 Q;  1Q7Y C;  5JJL A;  5FJ8 H;  1V1O A;  3RLO A;  4C3J H;  3TBI B;  4R4T A;  4ZRZ A;  5C44 H;  4DR6 L;  1HXY D;  2ALY B;  4FF1 A;  1MIU A;  4O0A A;  1YNJ C;  5EJW A;  1E24 A;  1SN8 A;  3VYR A;  1VS0 A;  1EQV A;  4C1N K;  1DOL A;  1Q82 C;  2WKD A;  1QWY A;  5JOB A;  1IW7 C;  2K5W A;  1OXU A;  4JI2 L;  2PO4 A;  4JBM A;  1QE6 A;  5IP7 G;  2PI2 E;  3K0X A;  4JI1 L;  4NXN Q;  1AW7 A;  3CCE A;  1BR9 A;  2BDO A;  2PCF B;  4ZUJ A;  3L2P A;  4F87 A;  1HPC A;  1BF4 A;  2PZT A;  1EQR A;  4DR3 Q;  2A6H D;  2R92 G;  1B70 B;  2K52 A;  1NMG A;  4ZLT F;  1TWH B;  2PI2 A;  4FP5 D;  3UDI A;  2ZTE A;  1OXX K;  2NBF A;  1STY A;  4BXX G;  1M90 C;  5JEA G;  5IGG A;  4ME3 A;  4OIK A;  1F77 A;  4KV6 A;  2VUM G;  1ICF B;  2Z0S A;  4KJN A;  3MA2 B;  1NR4 A;  1NUC A;  1QVF A;  4QGU A;  2E75 C;  5J3B A;  3PIO 3;  1BCP D;  2MUY A;  5CV9 A;  3GTL H;  1M8A A;  1VDZ A;  2PNR C;  5ELN A;  5C3E B;  1D5Z C;  2JA5 B;  4ZUI A;  4E6I A;  1EU3 A;  2RDF A;  1STN A;  2QIL A;  1LT6 D;  1XPO A;  4NXM L;  1V1Q A;  3JC6 6;  4GOP B;  4CKC A;  2RDG A;  1PH2 A;  4NPS A;  5E4W C;  3SXH A;  1SFO B;  5EKL A;  5IT9 c;  3Q8D A;  1HNW Q;  1FGB D;  1IXR A;  4OON A;  1L1O B;  3S1N B;  5HGT A;  1DOM A;  4V0B A;  4I7A A;  1F2L A;  3HOY B;  3QJY A;  2Q8T A;  4RHS A;  4DR5 L;  4KKS A;  1FVI A;  2K04 A;  3ERS X;  4IN3 A;  3I4N G;  4X62 L;  2R7F A;  1VQG A;  3M7N A;  4YWL A;  1XWE A;  1KQS A;  3VDY A;  2I5H A;  3VYU A;  1K0S A;  5IP7 H;  2CCZ A;  3CU7 A;  3KYH C;  3PIO A;  2BE5 D;  2RSO A;  1QZG A;  1C7Y A;  4UDU C;  1F2M A;  2UUA L;  2VQF L;  1PH7 A;  2KOL A;  2D9U A;  4KN7 C;  3KLR A;  5ELF A;  4PNY A;  4GOP A;  2EYO A;  2EYJ A;  2B8F A;  2X6L A;  5I6Y A;  4MN3 A;  4HIK A;  1F2Z A;  4GOP C;  3HKZ E;  2IX3 A;  5CV5 A;  5L37 A;  2G9H D;  5JEA H;  3PGZ A;  2GA4 B;  1NBW A;  5KNC A;  3KJO A;  1UUP A;  1L1O C;  1G2S A;  3MXP A;  4A75 A;  5DAU A;  5HUR A;  1N8R C;  3NTH A;  1HHV A;  2RCN A;  4XYQ A;  3K5N A;  1GUT A;  1NCV A;  1PTO B;  4BA2 I;  1JWM D;  4J8Q A;  1SMY C;  2LFN A;  4QL5 A;  1D1K A;  4LW1 A;  4R4Q A;  2E2D C;  3URY A;  1RTN A;  1N36 L;  2E74 C;  1V9P A;  2KQ3 A;  4X3S A;  4JW0 A;  1EY7 A;  3HOX G;  4OWT B;  4GKK L;  5C5M A;  2K33 A;  2HIX A;  2MJ8 A;  3S1Q H;  3BS1 A;  4K0K L;  2A6E C;  3KUP A;  4X3T A;  1VQA A;  3GTP H;  2XRS D;  3BYT B;  1R9T H;  1CKM A;  2AWN A;  3KJP A;  1SR3 A;  2A74 C;  1WFQ A;  3I4N H;  4DAP A;  1HNZ Q;  2PMZ E;  1SDF A;  4EQO A;  4N8F A;  1JE4 A;  4NXN L;  5E1F A;  4B3R Q;  4G7Z C;  3DLL A;  3KFU A;  5GQO A;  4HJA A;  1PFN A;  2CFM A;  1SYD A;  1Y1W G;  2NVQ H;  4JG2 A;  1JWS D;  4P71 A;  2HIV A;  1ESF A;  1B4O A;  1PTO C;  5CV7 A;  5LL6 X;  4K5X A;  1G2T A;  4A3E G;  3H3V H;  3I70 A;  1L2F A;  3KOJ A;  2AMC B;  2EE1 A;  2XWJ B;  1U4M A;  1B3A A;  2L12 A;  1B9M A;  3VR6 A;  1XNQ Q;  3GTJ B;  1ZEQ X;  1B7Y B;  3RZD B;  3QOJ A;  1SND A;  3QB3 A;  3CCS A;  5E3F A;  2F0V A;  2Z1C A;  4UP8 A;  3EN2 A;  3L7Z C;  2MPM A;  2WFW A;  4DAY B;  1K8O A;  2OCE A;  1X3F A;  3Q23 A;  5C0X I;  4DV6 L;  2QEJ C;  1PH3 A;  3S1R B;  4R9W A;  5LMU Q;  4LFB Q;  2B63 B;  3TS0 A;  4DU9 A;  3GTO H;  1KXL A;  2A69 C;  1ENF A;  5M5X H;  4ODG A;  1SE8 A;  2Z4H A;  3U9O A;  2NB0 A;  2F03 A;  1N34 Q;  4X3K A;  3TP7 A;  1K8G A;  1HNW L;  5I6W A;  1TWA B;  1LTI D;  2Q2T A;  4UP9 A;  3L9A X;  2OTJ A;  1VQ8 A;  5FLX c;  2K5D A;  2AUJ D;  3T51 B;  2FXQ A;  2VQE Q;  3S1M H;  3UI2 A;  4A3M G;  3GTK H;  2L15 A;  1HCZ A;  4NDX A;  2NZO A;  4J15 A;  1CK1 A;  1RTO A;  5ISR A;  4DAY A;  2I0Q A;  2IHF A;  1CQF A;  3GTP B;  2KEN A;  2WIN B;  5C4J H;  2WII B;  2ZJQ A;  1Y1V G;  4DXG A;  5TSS A;  4P72 A;  2Z8L A;  1QVC A;  1Y1W H;  1ZXT A;  1VQ9 A;  1V43 A;  4O1N A;  1TVX A;  2RDH A;  4A3E H;  2O4X A;  3CCR A;  4BBS G;  5GAH C;  1DOK A;  3RUZ A;  1HZA A;  3CP0 A;  4OEL B;  3HOW G;  4L6T B;  4OO1 G;  3S16 H;  2J0T D;  3OIQ A;  3HEJ A;  3M4Y A;  4JI4 Q;  1MJE A;  4A76 A;  1I4P A;  5IP9 H;  3S24 A;  3F2D A;  2RSN A;  3M7G A;  3Q22 A;  3G6J B;  3A74 A;  1VQD A;  2EQS A;  1DD2 A;  1KHI A;  4C56 C;  4IUU A;  3TS2 A;  1B8A A;  3BZK A;  1R4P B;  2D62 A;  1MHW C;  1FR3 A;  1II3 A;  1PFM A;  1X55 A;  5IGC A;  3GTO B;  3IRB A;  1D6E C;  3IKJ A;  4GS3 A;  2QKI C;  5M5X B;  3MFG A;  1WTW A;  5I2X A;  1WTQ A;  4DR2 Q;  2F0J A;  1CTM A;  1EL0 A;  2Z4I A;  3HOU G;  5LHY 1;  1TWC B;  1E22 A;  2LSS A;  4HJ7 A;  4A3M H;  5M9O A;  1D8L A;  2NVX H;  2F3I A;  2CWA A;  3MZ5 A;  1VQ7 A;  1FJG Q;  5JVH 3;  3M3Y H;  5COR A;  4POG A;  1XMQ L;  3JAM c;  4POF A;  3RN2 A;  1P8L A;  4IUQ A;  1NJI C;  1Y1V H;  2VB2 X;  3D4D A;  1O7Z A;  1RD9 D;  2IHE A;  1OO9 B;  3AU7 A;  4JBW A;  5IYB G;  5I4D A;  4G7H C;  4IJH A;  3WOE A;  3S2D H;  2GN5 A;  4G57 A;  2EY6 A;  4BBS H;  4HAE A;  1FL0 A;  4CDE C;  2Y0S E;  1Y1W B;  1STE A;  2Q2U A;  1K0R A;  2JA6 B;  2MQH A;  2PNH A;  1I6H H;  2SDF A;  3HOW H;  2XVS A;  4A3E B;  4L8J A;  3TP5 A;  4IFD G;  1YNJ D;  3A8I E;  1MBY A;  4HTH A;  3H91 A;  2IPK D;  1EEI D;  3A8J E;  4H7B A;  4A3D B;  3DM3 A;  2F1M A;  4JI0 L;  1B44 D;  5CMD A;  1IW7 D;  1LT4 D;  4GNX A;  1KDC A;  4LFB L;  1EZ6 A;  2KVM A;  4V19 0;  3T1H L;  1UEA B;  4FXK C;  3OW2 A;  3U50 C;  1HA6 A;  1BVS A;  1AH9 A;  2C5C A;  4IUV A;  2CH4 A;  4DK0 A;  4LF6 Q;  2K1B A;  1MKH A;  3PO3 G;  2IJ0 A;  3H6M A;  2G5D A;  3CC7 A;  3GP7 A;  5I9O A;  4N9P A;  3HOU H;  3CQZ H;  4UHV A;  5BR8 Q;  4L5T A;  5C5L A;  2ZXP A;  3OWF A;  3HOZ G;  2AUK A;  1ET6 A;  3I3C A;  4IPD A;  4EQ5 A;  1EWI A;  1G51 A;  3AMU A;  4A3L G;  3IAY A;  2N55 A;  1W3S A;  1YBY A;  4IZ8 A;  4P75 A;  3WOF A;  4FF3 A;  2PQA A;  2N3S A;  5IWA Q;  3GV6 A;  2PW7 A;  2HDL A;  2C9O A;  4BA1 I;  1LLR D;  4EQN A;  3VYS A;  3M3Y B;  4OIJ A;  1TR5 A;  1X54 A;  5IYB H;  1IBM L;  3L3O C;  1FYC A;  3MTS A;  3J81 E;  4CJ0 B;  1VQI A;  4UAI A;  4MZ9 A;  3NWT A;  4XQN A;  3RN5 A;  3MXU A;  4HMI A;  2JP1 A;  4IFD H;  1F2Y A;  1MJC A;  4JI2 Q;  2CW0 C;  1I5F A;  1SSO A;  4JI4 L;  2HHH L;  1ENA A;  1I6H B;  2PPB C;  4C3H G;  1BOS A;  3CPF A;  4EX5 A;  5K36 H;  3LX0 A;  5FK9 C;  4BBR G;  4ID6 A;  3D31 A;  5AFW A;  2TSS A;  2JA7 B;  5M3F H;  2K5Q A;  2RA4 A;  4M8A A;  3GTG H;  1O7L A;  1AZP A;  1SYG A;  5HGQ A;  2VNU D;  1IYU A;  2LMC B;  4HID A;  3PUZ A;  5LL6 S;  3TEH B;  3MAQ A;  3PO3 H;  4HSP A;  1EU4 A;  2R93 G;  3GD7 A;  1CT1 D;  1I4G A;  2MO0 A;  1PRT F;  2F3W A;  1SLJ A;  1WTX A;  1A2U A;  2PQE A;  5G3L D;  3VR5 A;  4LUV A;  2GVB A;  2K75 A;  1JOO A;  1TS2 A;  5A35 A;  4Q5V A;  4KK7 A;  4YHH L;  1GKH A;  2HQE A;  4A3I G;  3HOZ H;  3BVG A;  2DNE A;  2N49 A;  1O78 A;  1FJG L;  3AQQ A;  4RH6 A;  2YTX A;  1QUQ B;  4A3L H;  1SYB A;  2LXJ A;  3VYT A;  1T9H A;  4B3S L;  1Q8K A;  5JJK A;  3LWU A;  2F0W A;  4G7O C;  4RKB A;  3H94 A;  4HJ9 A;  4DV0 Q;  1PYB A;  1XNR Q;  4DK6 C;  3EA6 A;  1S3O A;  1SMY D;  2KED A;  3TSS A;  4HIO A;  4CJ1 B;  5T1I A;  2EIF A;  5IT9 L;  1Z47 A;  3AFP A;  1TXY A;  2SEB D;  3CF5 A;  1T5X D;  1WJJ A;  2F0I A;  3HKZ G;  2BCO A;  5JJI A;  3KF8 B;  2XN9 C;  1JR0 D;  3BDL A;  1S5E D;  1SE3 A;  4B08 A;  4RCN A;  5E4X A;  4AYB E;  4EGV A;  3CC2 A;  4X62 Q;  1VMP A;  2LXK A;  1X6O A;  1XX8 A;  4O42 A;  1CZG A;  3J7Y W;  1KLG D;  1LTA D;  3HS0 C;  1QUQ A;  4C3H H;  2YU9 H;  1VF5 C;  1HJP A;  4RA8 A;  2CQO A;  2WV6 D;  2Z6K A;  4H0L C;  4BBR H;  1RCV D;  1YHA A;  1WYD A;  2QDL A;  3T16 A;  1I6V C;  2VQF Q;  4LF6 L;  2Z6K C;  2J7Z A;  4XTC S;  4A3G G;  3GTQ B;  1PTO D;  4FO2 A;  5M3F B;  4IJL A;  2R93 H;  1LTT D;  3GTG B;  2DN8 A;  3KF8 A;  5M5W H;  1W6K A;  1EY5 A;  3BDC A;  3PO3 B;  4AIM A;  4GLV B;  4A3I H;  4CDD C;  2OT2 A;  2JYO A;  1CZW A;  1DCZ A;  3EBE A;  3C2P A;  3FKI G;  4DUZ Q;  2DUD A;  4LMQ D;  2CWP A;  2MHV A;  3J80 i;  1IYJ B;  2A69 D;  4AQY Q;  4BY7 G;  5C6A A;  1IKM A;  1H9S B;  4GKK Q;  4CHT B;  4K0K Q;  4DV7 Q;  1PZI D;  5CBE E;  1CKN B;  2HDM A;  4RHR A;  1VCI A;  2VZA A;  2F0H A;  2K05 A;  4RCO A;  5KYL A;  1U9R A;  4ZKB B;  5IYD G;  1HNX Q; 
#chains in the Genus database with same CATH homology
 3K80 C;  1PH1 A;  1K9M C;  1R9T H;  1CKM A;  2AWN A;  4IOA A;  3KJP A;  4YY3 L;  1PH9 A;  1SR3 A;  3PO2 H;  4X65 L;  4OX9 Q;  4QQB X;  2ZTC A;  1WFQ A;  3I4N H;  1CKO A;  1HH2 P;  4DR1 Q;  4APV A;  2UXC L;  3GDE A;  4PZ7 A;  1HNZ Q;  2PMZ E;  2YV5 A;  4IPG A;  2IX0 A;  4NXN L;  4JI8 Q;  4B3R Q;  1NTG A;  2HQL A;  3NEM A;  3DLL A;  3BU2 A;  1VQ4 A;  3KFU A;  5GQO A;  4WJ4 A;  4HJA A;  2CFM A;  3I55 A;  3E9H A;  1Y1W G;  4UPA A;  3J81 i;  1I94 Q;  4JG2 A;  4P71 A;  2NVQ H;  2HIV A;  4JI6 Q;  3PIP A;  2Q2H A;  4IFD I;  2NZH A;  2WAQ E;  4DR1 L;  4LF7 L;  1YI2 A;  1CKN A;  1PH4 A;  4A3E G;  1A8V A;  1HNZ L;  3W5O A;  1HR0 W;  4LFC Q;  3H3V H;  2B3G A;  4B3R L;  1L2F A;  1XPR A;  3KOJ A;  2JE6 I;  2AMC B;  3K7U C;  4YWM A;  3I7F A;  1PA6 A;  4MTN A;  1JJ2 A;  2A8V A;  5GAD C;  1LUZ A;  4GN4 B;  1CSP A;  4DV2 L;  2JA5 G;  3F8T A;  1A63 A;  2NVT H;  1XNQ Q;  1K8A C;  4DV6 Q;  1B7Y B;  1HR0 Q;  3K7A H;  3NEL A;  2GVA A;  1AE2 A;  3CCS A;  2K5N A;  2MFI A;  4JOI A;  4UP8 A;  3FKI H;  3EN2 A;  3L7Z C;  5GRO A;  4DV4 Q;  4DV0 L;  1XNR L;  1NE3 A;  1VQH A;  4AH6 A;  1YNX A;  2WFW A;  4DAY B;  2BH8 A;  4FDB A;  3M85 A;  4DR4 Q;  2OCE A;  1X3F A;  4JOI C;  4A93 H;  4DAM A;  1PHJ A;  2YTY A;  1XNQ L;  5C0X I;  3RNU A;  4DV6 L;  4JI3 L;  1S72 A;  1PH3 A;  3CCQ A;  4GLX A;  3W1B A;  5LMU Q;  2JJQ A;  4BY7 H;  4JBJ A;  4LFB Q;  3HOY G;  3TS0 A;  3GTO H;  1K73 C;  1KXL A;  1Q1B A;  4PZ8 A;  5M5X H;  4DV4 L;  2JA7 H;  1SE8 A;  2YYZ A;  4DR4 L;  2VY3 A;  4R4I A;  3H0G H;  1N34 Q;  1HNW L;  1RL2 A;  1K8G A;  5K36 G;  5LMU L;  2EXD A;  1XPU A;  1JJG A;  2Q2T A;  4UP9 A;  5M3F G;  1WCM G;  4DV3 Q;  1VQ8 A;  2OTJ A;  5FLX c;  2UXD Q;  1EOV A;  1N33 L;  4IPC A;  2FXQ A;  5HY6 A;  1DGS A;  4LF5 Q;  2VQE Q;  4Y52 H;  4PG3 A;  3S1M H;  4DUY Q;  2UU9 L;  4A3M G;  1E1O A;  3GTK H;  1N34 L;  2L15 A;  3E0E A;  1UE5 A;  5IYC G;  4Y7N H;  1ASY A;  2C35 B;  4QY7 A;  2NZO A;  2OQ0 A;  4J15 A;  5DLQ E;  4X6A H;  2I0Q A;  2IHF A;  1N9W A;  4KHZ A;  3G71 A;  2R92 H;  5AJ3 L;  1HZC A;  2KEN A;  2BA1 A;  5C4J H;  2ZJQ A;  1KAW A;  2VQE L;  1Y1V G;  2KBN A;  3ULJ A;  5M5Y H;  3OTO Q;  3A5U A;  4P72 A;  4OWX B;  1QVC A;  5LMN L;  3GTP H;  4A3J G;  5E7N A;  1Y1W H;  4BXX H;  1NMF A;  3W1G A;  5H1S E;  1VQ9 A;  4A3B G;  1V43 A;  1OXT A;  2KCM A;  3TRE A;  4A3K G;  1Q1E A;  1BBU A;  4YCU A;  4IFD J;  4A3E H;  4B3M Q;  2VUM H;  1TWF H;  3PF4 A;  2IY5 B;  4BBS G;  3CCR A;  1QVG A;  3CC4 A;  1K3R A;  3RLN A;  1VQP A;  1X65 A;  1XMO Q;  3OTO L;  3ICE A;  1J5E Q;  4TQU S;  3A0J A;  5GAH C;  2K14 A;  3LGJ A;  2JA5 H;  1GD7 A;  4DR7 L;  1HZA A;  3CP0 A;  4L5S A;  3HOW G;  4KHP Q;  4OO1 G;  1Q12 A;  4DV1 Q;  1AE3 A;  2NN6 G;  3S16 H;  2XTI A;  1JMC A;  1Y14 B;  3F2C A;  4LUO A;  4DUZ L;  4DR6 Q;  1SFO H;  3ER0 A;  1LM0 A;  4IOC A;  4JI4 Q;  3UDF A;  4QIW E;  1MJE A;  2VW9 A;  3S1N H;  3G6E A;  4A76 A;  3UE0 A;  3STB C;  1IBL Q;  4LF9 Q;  4OWW B;  1JT8 A;  3NEN A;  4AQY L;  5IP9 H;  3S24 A;  3F2D A;  1YHQ A;  2E5L Q;  3M4O H;  4DV1 L;  5C0X J;  1XJV A;  1EQQ A;  3M4P A;  2UUC L;  3RZO H;  3HOY H;  3A74 A;  1VQD A;  2Y0S G;  2JEA I;  2QEX A;  4DV7 L;  3RLF A;  1PVO A;  2EQS A;  1I50 H;  4R1J A;  1KHI A;  1XTD A;  1S40 A;  3TS2 A;  2MO1 A;  1B8A A;  3BZK A;  2D62 A;  4JI1 Q;  2MNA A;  4C3I H;  2E5L L;  3GTQ H;  5IE8 A;  4IO9 A;  1X55 A;  3CCU A;  2F4V L;  1H95 A;  3IRB A;  4GS3 A;  1VQL A;  4PZ6 A;  1VQ5 A;  3PUX A;  1XMQ Q;  1WCM H;  3HOV G;  4A3G H;  4DR2 Q;  4JV5 L;  4PMW A;  3HOU G;  1YIJ A;  1HNX L;  3PUY A;  4KI0 A;  1E22 A;  2ZJR A;  3CPW A;  1VQJ A;  1SMX A;  2YTV A;  2LSS A;  2NVY H;  1I3Q H;  4HJ7 A;  1O7I A;  4A3M H;  4L5R C;  1D8L A;  4OX9 L;  2NVX H;  2F3I A;  5GAE C;  3I4M H;  2K5V A;  5IYC H;  2CWA A;  2ZM6 Q;  3BJU A;  1VQ7 A;  1HZ9 A;  1KRT A;  4YCW A;  4JBK A;  1FJG Q;  3M3Y H;  4A3C G;  4POG A;  1XMQ L;  1PH8 A;  3JAM c;  4JI8 L;  2RHQ B;  2A19 A;  3G48 A;  4P74 A;  4BY1 G;  4POF A;  4X66 Q;  4DR2 L;  3RN2 A;  1P8L A;  1WOC A;  1FGU A;  5IY0 A;  2JA9 A;  2V1C C;  1HZB A;  5C3E G;  1NJI C;  1Y1V H;  3UDX A;  1X9N A;  1I94 L;  4JI6 L;  3T1Y Q;  4A3J H;  4LF8 Q;  2IHE A;  2ZM6 L;  4JBW A;  5IYB G;  3CXC A;  4A3B H;  4A3K H;  4IJH A;  2ZJP A;  2E2J H;  4H02 A;  5ELO A;  4LFA Q;  4LFC L;  4JYA Q;  2KHI A;  2GN5 A;  2WP8 J;  1RIP A;  3S2D H;  1A0I A;  4GN3 B;  4X66 L;  4BBS H;  3PF5 A;  1FL0 A;  1JE5 A;  4HJ8 A;  2Y0S E;  2QGQ A;  1E1T A;  2Q2U A;  1K0R A;  4TVA B;  2ID0 A;  2B63 G;  2MQH A;  2IT1 A;  1X3G A;  4JI0 Q;  2PNH A;  4NXM Q;  1I6H H;  1HR0 L;  1KIX A;  2XGT A;  1CSQ A;  1M1K C;  2E2H H;  2QA4 A;  3HOW H;  3FP9 A;  3CCL A;  5FJ8 G;  4IFD G;  1IZ6 A;  3ULP A;  2ASB A;  3T1H Q;  3U4V A;  5C44 G;  1KRS A;  3WWV A;  4GLA C;  3PUV A;  1G6P A;  3CAM A;  4UP7 A;  2I5M X;  5M3M G;  4LUZ A;  3I56 A;  3JAM i;  5GAG C;  3DM3 A;  3J81 j;  3NBH B;  3D0F A;  3ZJY C;  4DKA C;  4JI0 L;  3HOX H;  4GNX A;  1VQE A;  2WB1 G;  2B29 A;  1PH6 A;  4LFB L;  3FHW A;  1JB7 A;  1YJW A;  4DR5 Q;  5IYD H;  3T1H L;  3OW2 A;  3U50 C;  3H3V I;  1BVS A;  2K4K A;  1AH9 A;  2HT1 A;  4LWC A;  4YCV A;  1EIF A;  4LF6 Q;  1N32 Q;  1PFS A;  1OTC A;  1MKH A;  3J7Z C;  3PO3 G;  3S2H H;  2OWO A;  5C0X G;  3CMA A;  4L5Q A;  1TWH H;  3CC7 A;  1YZ6 A;  3HKS A;  4RG1 A;  4DV3 L;  1X56 A;  2UXD L;  1GM5 A;  3HOV H;  5JEA J;  2UUA Q;  4LF5 L;  3HOU H;  3B6Y A;  1UEB A;  3CQZ H;  5BR8 Q;  4L5T A;  1W2B A;  1N32 L;  4JCV E;  4DUY L;  4R4O A;  1YJ9 A;  4LF4 Q;  3HOZ G;  3L0O A;  4XIG S;  1P16 A;  2ZTD A;  1PH5 A;  4EQ5 A;  1UE6 A;  4IPD A;  1EWI A;  1IBK Q;  1E3P A;  1G51 A;  2VL6 A;  4O2D A;  1IBM Q;  1EIY B;  4A3L G;  4A3C H;  3PCO B;  3K8A A;  1W3S A;  1U5K A;  1YBY A;  2NN6 I;  4ALP A;  4BY1 H;  1YJN A;  4P75 A;  1G29 1;  1OXV A;  3GTJ H;  2N78 A;  5BR8 L;  3RZD H;  2PQA A;  2N3S A;  5IWA Q;  3S14 H;  1YEZ A;  5C3E H;  4LF4 L;  4BA1 I;  3CME A;  1KL9 A;  4DV5 Q;  1EYG A;  4YWK A;  3RR5 A;  1Q86 C;  1X54 A;  5IYB H;  1IBM L;  1E7Z A;  2JA8 G;  1L1O A;  4B3M L;  2WB1 E;  4JC0 A;  3I4O A;  3MXN B;  2DGY A;  4OXP A;  1X3E A;  1XMO L;  1PV4 A;  4GKJ Q;  1J5E L;  5IWA L;  3S1R H;  2HHH Q;  2R6G A;  1ASZ A;  1VQI A;  2B63 H;  1A62 A;  1YIT A;  1VQC A;  4B3T Q;  1PYS B;  4DV5 L;  4KHP L;  2UUB Q;  1K83 H;  4MNO A;  3ULL A;  3UDG A;  2RF4 A;  4MZ9 A;  3RN5 A;  1VQM A;  1N36 Q;  2I5L X;  2WAQ G;  1C0A A;  1Q7Y C;  5JJL A;  5FJ8 H;  4IPH A;  3RLO A;  1MJC A;  4C3J H;  1SRU A;  4A3F G;  4JI2 Q;  1Q81 C;  4R4T A;  5C44 H;  2KCT A;  4DR6 L;  2ALY B;  1MIU A;  1I5F A;  4JI4 L;  4HIM A;  4GKJ L;  4O0A A;  2HHH L;  1E24 A;  1TWA H;  2AKW B;  1VQK A;  1IBL L;  4LF9 L;  4B3T L;  1SN8 A;  1VS0 A;  3AYH B;  2UUB L;  3CPF A;  4EX5 A;  1Q82 C;  1VQ6 A;  1EFW A;  4BBR G;  3D31 A;  5M3F H;  4JI2 L;  1OXU A;  4X65 Q;  3GTG H;  2ES2 A;  3CCV A;  3CCJ A;  4JBM A;  2R7Z G;  2BA0 A;  1LTL A;  5HGQ A;  5IP7 G;  4HID A;  2VNU D;  2PI2 E;  2N8N A;  3A5Z B;  3K0X A;  4JI1 L;  3PV0 A;  4YHH Q;  1UE7 A;  4NXN Q;  3PUZ A;  3TEH B;  3CW2 C;  3PO3 H;  3EIV A;  3M4Q A;  3CCE A;  2A1A A;  4AYB G;  4DPG A;  1BBW A;  3KDF B;  2JQO A;  3GD7 A;  2R93 G;  3L2P A;  2E8G A;  4GNX B;  2MO0 A;  1EQR A;  1SLJ A;  4LUV A;  4DR3 Q;  4LF7 Q;  2GVB A;  2K75 A;  4B3S Q;  1LYL A;  2R92 G;  1B70 B;  1WI5 A;  1GKH A;  4YHH L;  2K52 A;  3TQY A;  4A3I G;  3HOZ H;  1NMG A;  1UWV A;  2N49 A;  2PI2 A;  3UDI A;  3AQQ A;  1FJG L;  2UXB Q;  2ZTE A;  1OXX K;  2YTX A;  3HFZ B;  3GTM H;  1QUQ B;  4DV2 Q;  2JA6 G;  2F52 A;  4BXX G;  1VQO A;  4A3L H;  1M90 C;  5JEA G;  1D7Q A;  2R7D A;  2LXJ A;  4ME3 A;  4DR3 L;  1T9H A;  2K5H A;  2AWO A;  4B3S L;  1Q8K A;  2RHS B;  1BKB A;  4KLK A;  2VUM G;  2JEB I;  4WJ3 M;  5JJK A;  2Z0S A;  3KF6 B;  3T1Y L;  4HJ9 A;  1KD1 C;  4LF8 L;  2D0P A;  4DV0 Q;  1PYB A;  1XNR Q;  4DK6 C;  1QVF A;  1OXS C;  2UXB L;  4QGU A;  4JYA L;  3H15 A;  1S3O A;  5J3B A;  4LFA L;  2JA8 H;  3J7A 5;  4LNQ A;  4A3D G;  4HIO A;  3GTL H;  4JI3 Q;  2EIF A;  3S17 H;  1Z47 A;  2VS1 A;  3SGI A;  3AFP A;  5ELN A;  1TXY A;  3CF5 A;  4JI5 Q;  2KHJ A;  1WJJ A;  4R4C A;  1U0L A;  3KDF A;  1TWG H;  3HKZ G;  5JJI A;  1XPO A;  3I2Z A;  3KF8 B;  4NXM L;  3STB D;  2PQA B;  3F2B A;  3AEV A;  2JK8 A;  5FLM G;  1V1Q A;  2H5X A;  3JC6 6;  3G4S A;  4GOP B;  4DNI A;  1PH2 A;  3S15 H;  4NPS A;  5IP9 G;  4GNX C;  5IT9 c;  3Q8D A;  4AYB E;  4A3F H;  3CC2 A;  1HNW Q;  1IXR A;  4X62 Q;  4OON A;  1L1O B;  2LXK A;  3CCM A;  1X6O A;  4JI5 L;  2IX1 A;  5C4X G;  4DK3 C;  1Z9F A;  4QJF A;  1QUQ A;  4C3H H;  2YU9 H;  2Q2I A;  1VQB A;  1N33 Q;  1HJP A;  1YVC A;  1IL2 A;  1TWC H;  2CQO A;  4DR5 L;  3PUW A;  2Z6K A;  2UU9 Q;  4BBR H;  3PO2 G;  1FVI A;  3ERS X;  1YHA A;  5LMN W;  3KF6 A;  4X62 L;  1WYD A;  2R7F A;  1VQG A;  2VQF Q;  4YWL A;  1KC8 C;  4LF6 L;  3I4N G;  3M7N A;  2Z6K C;  1KQS A;  3VDY A;  2I5H A;  4XTC S;  2R7Z H;  4A3G G;  5IP7 H;  3J80 c;  2CCZ A;  3KYH C;  5AJ3 Q;  2OQK A;  3PIO A;  3F1Z A;  1QZG A;  4IJL A;  1C7Y A;  2R93 H;  1J6Q A;  5LMN Q;  4OO1 I;  3PSI A;  3I4M G;  2ATW A;  2AHO B;  4A4I A;  3AFQ A;  2UUA L;  2VQF L;  1PH7 A;  4P73 A;  5EAY A;  5M5W H;  1VQF A;  4GOP A;  4AIM A;  1SRO A;  3E9I A;  4GLV B;  4A3I H;  1UE1 A;  1GVP A;  3TRZ A;  2CKZ B;  4HIK A;  1IBK L;  1Q46 A;  4GOP C;  3HKZ E;  4X64 Q;  4JI7 Q;  2JA6 H;  1GO3 E;  1YHB A;  4DR7 Q;  3PGZ A;  3KJO A;  1NBW A;  3EBE A;  3M9B A;  3OYY A;  1QZH A;  2E2I H;  1L1O C;  4A75 A;  1N8R C;  1CUK A;  3FKI G;  1L0W A;  4RMF A;  4C2M H;  2D0O A;  1JJC B;  2RCN A;  2DUD A;  4DUZ Q;  2CWP A;  4A93 G;  3MEF A;  3J80 i;  2OTL A;  1IYJ B;  4X64 L;  4JI7 L;  4A3D H;  4AQY Q;  4BY7 G;  4BA2 I;  4GKK Q;  5M3M H;  2UUC Q;  1NY4 A;  4QL5 A;  1C9O A;  4NB3 A;  4K0K Q;  4DV7 Q;  2JA7 G;  1EUJ A;  4LW1 A;  4R4Q A;  3J81 c;  4GN5 A;  4HJ5 A;  2K50 A;  1CKN B;  1N36 L;  1V9P A;  1VQN A;  3UE1 A;  3CD6 A;  5FLM H;  1VCI A;  2VZA A;  3BZC A;  4YY3 Q;  2BH2 A;  3H0G G;  3KLW A;  3HOX G;  4OWT B;  2F4V Q;  4GKK L;  3U4Z A;  2HIX A;  3S1Q H;  2UXC Q;  5IYD G;  5C4X H;  3U58 A;  4K0K L;  4UY8 C;  4JV5 Q;  3GO5 A;  1HNX Q;  3K81 C;  1VQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...