3EIVA

Crystal structure of single-stranded dna-binding protein from streptomyces coelicolor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
117
structure length
98
Chain Sequence
ETVITVVGNLVDDPELRFTPSGAAVAKFRVASTPDGESLFLTCSVWRQAAENVAESLQRGMRVIVQGRLKQRSRTVYELDVDEVGASLRSATAKVTKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein 2
publication title Structure of the single-stranded DNA-binding protein from Streptomyces coelicolor.
pubmed doi rcsb
total genus 16
structure length 98
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3eivA00
2JA5H 1JE5A 2JA6H 4IOCA 1HR0Q 2JE6I 1UEBA 2NVXH 5DLQE 2AHOB 3CMEA 2UU9Q 4OO1I 4DR5Q 3BZCA 3T1HQ 3M4QA 1XNQL 1WCMG 1VQCA 4A3IH 1IBMQ 1U0LA 5E7NA 3RN5A 2I0QA 4LF4L 3RNUA 1HZAA 1IZ6A 3L7ZC 2IX0A 1A63A 1VQDA 4JI1Q 2YV5A 1S72A 4JBWA 2OQ0A 1I50H 2CFMA 5FJ8G 1HNXQ 2RCNA 1BVSA 5C44H 4GOPA 2N78A 2UXDQ 4R4IA 4HIMA 2JA7H 4LFBQ 4JI0L 1P8LA 4X64L 3CCVA 4RG1A 4A3BG 4JOIA 4MNOA 3SGIA 2VQEQ 1LUZA 4B3SQ 4AQYL 4IPHA 5M3FH 4X6AH 1S40A 2JJQA 3S14H 4DR1L 3S1RH 1XJVA 2HHHQ 4PG3A 1L1OB 1WI5A 3EN2A 2LXKA 4LUVA 1I94L 4DK3C 4P71A 2JA5G 2JA6G 4GLAC 5IE8A 2CKZB 1PH1A 1UE5A 2R7FA 3MXNB 1YJNA 2VUMH 3TRZA 3A5ZB 1IL2A 1OTCA 1PH9A 4C3HH 1YHAA 1PH3A 2F4VL 3GTQH 2WB1E 4IPCA 1VQ7A 4A3GH 2PQAA 1VS0A 2B3GA 1TWAH 3OTOL 1G51A 4TVAB 1J5EQ 1SR3A 2IHEA 4MZ9A 1KRSA 2IT1A 4DV2Q 1PH6A 1GM5A 1SFOH 1IBLQ 3UE0A 4DR7L 2JA7G 1Q86C 1XMOQ 1Q81C 1N32L 4DV6Q 2B29A 1QVGA 4JI6L 2JEAI 4BA1I 2OTJA 4BY1G 4LF7Q 4GN4B 1PH7A 2ALYB 4DV7L 3S1QH 1VQIA 5AJ3Q 1NY4A 2VW9A 3WWVA 4DV0L 1K83H 4GOPB 4A3FH 2Q2UA 5FLXc 2UUCQ 2WAQG 4YWMA 3L2PA 5C4XG 5IYDH 5JJIA 3M9BA 3CC4A 1NBWA 1PFSA 4RMFA 2R92H 1HNZL 3I4MH 1XTDA 2UUBL 4DNIA 4PZ7A 1CKNB 4JOIC 1EUJA 4LFAQ 3RR5A 2I5LX 2DUDA 2L15A 1YJWA 2ZM6L 3H0GH 4XTCS 3DLLA 4O0AA 3U4ZA 4QGUA 1A8VA 3S1MH 2K5HA 1FGUA 3PF5A 4LF6Q 2ZTCA 3KDFA 3UDIA 1LYLA 1Y1WG 3J7A5 1EOVA 4GLXA 1VQOA 3HOWH 4JI2Q 4X65Q 4GN3B 3A5UA 4LFCL 2PQAB 4MTNA 4JI7L 3H3VI 4DV3Q 1YZ6A 3S1NH 4BBSH 1YITA 2VQFL 2NZOA 1EIFA 1N34L 3HOZH 1Y1VH 1BKBA 4DR6L 4A3DG 1IBKL 5C0XG 1CKOA 3BJUA 3I55A 4DKAC 1QUQA 3T1YQ 2EIFA 2VZAA 5IYDG 5FLMH 4IOAA 3STBC 2YTVA 4GNXB 1FJGL 2R92G 1BBWA 3JAMc 2OTLA 1TWCH 3PUYA 4P73A 4DUYQ 4B3RQ 2V1CC 1Q1EA 4HJ7A 3CCLA 1N33Q 5LMNQ 2JEBI 3TS2A 2K52A 1SN8A 1VQGA 4LF9L 5M5YH 1HH2P 2OCEA 1Z9FA 5GAGC 2RF4A 1Q12A 4KHZA 4X62L 2MNAA 1V9PA 3BU2A 1QZHA 1VQKA 1QVFA 1A0IA 3KF6B 2R93H 4AIMA 2K4KA 2CWAA 4KHPL 1JJ2A 5IT9c 2E5LL 3HOWG 5C0XI 3K7UC 3GTGH 3PCOB 3E9HA 1HZBA 1IXRA 4P74A 4UP9A 1VQEA 3ERSX 3AEVA 4BBSG 4L5TA 3CCSA 1M1KC 3HOZG 2R7ZG 1U5KA 1VQAA 3HKZG 5GADC 3CF5A 4A3BH 1GVPA 4Y52H 5IP9H 4YWKA 1L0WA 1PH5A 1YIJA 4NXNL 1AH9A 1W2BA 2KBNA 4GLVB 1JJGA 1I3QH 1NMGA 4LF4Q 2NZHA 4LF5L 3KOJA 4ALPA 2VNUD 3B6YA 1D7QA 4R4TA 1PH8A 3PV0A 3CW2C 1XNRL 3NBHB 1VQFA 2GVBA 2KENA 3DM3A 4H02A 4AH6A 5IWAL 3ULJA 4C3JH 4DAYB 1X65A 4YCUA 4GS3A 2UXCL 5JEAJ 2Z0SA 1V1QA 4X64Q 3HOXG 4C3IH 4DV1L 2R93G 3AYHB 3L0OA 1N9WA 5GROA 1VQ6A 4AQYQ 1Z47A 1GKHA 2MQHA 4DR2Q 3UDGA 4DR1Q 4A3MH 2HT1A 3HOUH 2EQSA 1Q82C 2Y0SE 4GKJL 4EX5A 4HJ9A 1HNWQ 5GAEC 2Q2TA 1D8LA 5HY6A 4JI5L 3GTLH 1BBUA 3ULLA 4A93G 2D62A 3AFQA 2UUAL 5IP9G 3CCMA 1VCIA 4A3JH 2CWPA 3EBEA 1LTLA 4BY1H 2ATWA 4IJLA 1KXLA 3I7FA 4DV5Q 1JT8A 2K75A 4IFDI 4DUZL 2OQKA 4X66Q 4LUZA 3E9IA 4YCVA 2YTYA 2UXBQ 1VQBA 1HR0L 1G291 1VQ8A 3H3VH 5C4XH 4HJ5A 4JG2A 3CPWA 1VQPA 2E2IH 2JA9A 4OWTB 3T1HL 1K8AC 1GO3E 3CD6A 1JJCB 5IYCH 2ZTEA 1IBML 3S2HH 1E7ZA 4JI3Q 3PUVA 4JI8Q 1HZ9A 1SROA 4A4IA 2DGYA 3ULPA 1MJEA 3KJOA 3RZOH 3EIVA 2PI2E 1HNXL 1TWFH 1B8AA 3CC7A 4A3MG 4JI4L 5JJLA 3HOUG 1X9NA 4HIKA 4LFBL 3LGJA 1WJJA 5BR8Q 1N36Q 2YTXA 3PUXA 1Y1WH 2KHJA 5M3MG 2YU9H 4IPDA 5GQOA 3HKSA 4C2MH 5C3EH 2VQEL 3U58A 4A3JG 2ID0A 4B3SL 1MJCA 1OXVA 2D0PA 2E8GA 2N49A 4YCWA 2RHSB 1CKMA 2Y0SG 4BBRH 4DR3Q 2CQOA 4DR4Q 2KHIA 4B3TL 1QVCA 2HHHL 1VQMA 4A3DH 1A62A 1KD1C 3JAMi 3OW2A 2R7DA 4J15A 4JBJA 1Q1BA 1L2FA 4XIGS 1XMQQ 4GKKQ 3CCRA 2XGTA 5IYBG 3S16H 3D0FA 5IYCG 4APVA 4BY7G 2C35B 1PVOA 1OXXK 2BH8A 1ASZA 3TEHB 4GN5A 4NXML 1J6QA 3H15A 2AKWB 1J5EL 3CXCA 4JI7Q 1KL9A 4LFCQ 1XPRA 1M90C 2WB1G 1Y14B 4DV2L 2ZJRA 1IBLL 3AFPA 4IPGA 4K0KQ 1XPOA 3ZJYC 2D0OA 4KI0A 2NN6I 1IBKQ 1XMOL 4DV6L 4LF8Q 4LUOA 4POGA 3A0JA 5C3EG 4OX9L 3F2BA 4OWWB 3GDEA 4LF7L 4JV5Q 4BBRG 3J81c 3PO2H 2R7ZH 4BXXH 4DV4L 1CSPA 4A76A 3KFUA 1X3EA 5AJ3L 1YBYA 3K8AA 4AYBE 4B3MQ 2A1AA 4DAMA 2PI2A 2UUCL 3A74A 1LM0A 4X62Q 3AQQA 3W1GA 3NENA 1KHIA 3I4OA 4P75A 1UE6A 5ELOA 1O7IA 1YEZA 4YHHL 1PV4A 1VQ5A 1SRUA 1NMFA 4A3CH 4A3LH 4A3EH 3CCQA 3RLNA 1YHBA 4UP8A 5J3BA 3HOXH 3VDYA 1XPUA 2KCMA 3PIPA 1EFWA 2PNHA 1R9TH 3NELA 4L5QA 4IJHA 4YY3L 3PSIA 2YYZA 2QEXA 1IYJB 4NXNQ 1KRTA 1VQJA 4A3KG 3GTPH 2VS1A 3HFZB 4X65L 3CMAA 4JI2L 3W1BA 4POFA 3PO2G 4HJAA 4LNQA 4BXXG 2GN5A 1EWIA 2HIVA 3BZKA 3UE1A 4DV3L 3S15H 1H95A 3OYYA 3FP9A 4A93H 3RLFA 4JYAL 3KJPA 3T1YL 1CUKA 3D31A 3E0EA 1XNQQ 1E22A 3GTKH 1B70B 3PGZA 3KDFB 4QY7A 4JCVE 3RLOA 5IP7H 5LMUL 5M5WH 1VQ4A 2Z6KA 1KAWA 3HOYH 3CC2A 4DUYL 4B3RL 1L1OA 1E1OA 1WOCA 1X54A 3J7ZC 4BA2I 5LMNL 3G4SA 4IFDG 1I6HH 5IY0A 3CCJA 1VQNA 4A3LG 4A3EG 4JBKA 1SMXA 1TXYA 4JI0Q 4GKJQ 3GTOH 1QUQB 3PIOA 1OXUA 1T9HA 3FHWA 3UDXA 4DK6C 4QIWE 1JMCA 4TQUS 3K81C 1HJPA 2R6GA 3TQYA 1I94Q 4UPAA 1ASYA 4A75A 4Y7NH 2E2HH 1HR0W 2A8VA 5M3MH 4A3GG 1YVCA 3CAMA 3FKIG 3W5OA 1EIYB 3ICEA 2RHQB 2IX1A 1C7YA 5IP7G 2F4VQ 4FDBA 1X56A 3OTOQ 3HOYG 3IRBA 1VQLA 4R4OA 3CQZH 3G71A 2UU9L 4P72A 4DR5L 5IYBH 4JI4Q 4DR7Q 3F2CA 2K5NA 3CCEA 4ME3A 4BY7H 1N32Q 3S24A 3G48A 3STBD 3TREA 1TWHH 4JI6Q 2IY5B 2LSSA 4JI1L 4HIDA 1PYBA 1UE7A 1NE3A 4DR2L 1CKNA 1I5FA 1K3RA 1DGSA 2WAQE 4DV7Q 2UXDL 4B3TQ 4L5RC 3JC66 1K0RA 1RL2A 4DV0Q 1EQRA 2Z6KC 3KYHC 3J81i 2JA8H 2NVTH 1GD7A 4R4CA 2IHFA 3I56A 1HNWL 1L1OC 3CCUA 2BH2A 2JQOA 4R1JA 2WP8J 4QJFA 3U4VA 5JEAG 1V43A 3J80c 1KQSA 2XTIA 1PH4A 4DV5L 2NN6G 1HNZQ 4A3IG 1MKHA 2UUBQ 1SE8A 3U50C 3M7NA 1G6PA 5HGQA 2K50A 3S17H 4OONA 4X66L 4NXMQ 3M3YH 2UXBL 2ZM6Q 2ASBA 1C0AA 2QGQA 1EQQA 5C0XJ 5EAYA 4LWCA 5C44G 3KLWA 3UDFA 1YJ9A 4HJ8A 3F8TA 2VY3A 4JI3L 4JI8L 3PO3H 4PMWA 4GNXA 2AMCB 2NVQH 5GAHC 3KF8B 4OX9Q 1Q8KA 1UE1A 2H5XA 5M3FG 2WFWA 3S2DH 1N8RC 2VQFQ 1N34Q 4DV4Q 4O2DA 1P16A 3GD7A 2HQLA 5C4JH 3CP0A 4DR6Q 2F52A 2JA8G 5BR8L 1N36L 4OWXB 1X55A 3CPFA 3Q8DA 4PZ8A 4YWLA 1UWVA 2VUMG 3KF6A 4A3KH 1AE3A 3NEMA 2K14A 4GOPC 1QZGA 1FJGQ 4NB3A 1VQ9A 1MIUA 1OXSC 1X6OA 4DR3L 4DR4L 4L5SA 2JK8A 3HOVH 4YHHQ 2CCZA 1E1TA 3RZDH 1S3OA 4LF9Q 1Q46A 1SLJA 2AWNA 2AWOA 3PUZA 1CSQA 2ES2A 1B7YB 1XMQL 4GKKL 2MFIA 3GO5A 1YHQA 1RIPA 1PYSB 4YY3Q 2NVYH 3I4NH 3PO3G 1WFQA 3RN2A 4KHPQ 3MEFA 1WYDA 3HKZE 2E5LQ 4LFAL 1KC8C 1JB7A 1TWGH 3K80C 2B63H 4HIOA 1Q7YC 2KCTA 3GTMH 4IFDJ 4K0KL 1NJIC 4LF6L 1VQHA 4JYAQ 2Q2IA 4A3FG 1X3FA 3M85A 1PH2A 4LF8L 2QA4A 1K73C 4PZ6A 5ELNA 5JJKA 1PA6A 3GTJH 1YNXA 3TS0A 2FXQA 5LMUQ 2GVAA 4LF5Q 4JV5L 1FVIA 2Q2HA 2E2JH 1C9OA 2BA1A 2OWOA 1K8GA 3I4MG 1NTGA 2F3IA 1E24A 4OXPA 1XNRQ 3HOVG 5LMNW 4JBMA 3K7AH 3PUWA 3K0XA 3F2DA 4GNXC 4B3ML 3FKIH 5IWAQ 5K36G 4WJ3M 2LXJA 3H0GG 4UP7A 1KIXA 2I5HA 5H1SE 1WCMH 2UXCQ 3ER0A 4NPSA 3J81j 4WJ4A 4AYBG 4DV1Q 3M4OH 2BA0A 2A19A 3I4NG 4OO1G 1N33L 1E3PA 2MO0A 2VL6A 4QL5A 5M5XH 4JC0A 5FJ8H 3M4PA 1X3GA 2B63G 1AE2A 4A3CG 2EXDA 2HIXA 1OXTA 1PHJA 2I5MX 2ZJQA 3G6EA 2K5VA 2ZJPA 4JI5Q 1W3SA 1Y1VG 4KLKA 1FL0A 4EQ5A 1EYGA 2UUAQ 3PF4A 3F1ZA 3I2ZA 4QQBX 4LW1A 2MO1A 2PMZE 4UY8C 1YI2A 1HZCA 5FLMG 4IO9A 2ZTDA 4R4QA 3J80i 2N8NA 4DUZQ 1K9MC 2N3SA 4DPGA
chains in the Genus database with same CATH superfamily
2JA5H 1JE5A 4IOCA 1STYA 1KDCA 4NW2A 4R8IA 4RGTA 1CHQD 5NUCA 2D9UA 3PO3B 1PXUA 3R93A 1IBMQ 1U0LA 2QF7A 5E7NA 2I0QA 5M9OA 3RNUA 3L7ZC 1VQDA 2EY5A 2Z1CA 1SNPA 1O80A 4JBWA 1I50H 1HNXQ 5T1GA 2RCNA 1NSNS 2UXDQ 4A3FB 4JI0L 4LFBQ 2F0FA 3QJYA 1K8OA 4X64L 3CCVA 2A5HA 3TP6A 3NQTA 4JOIA 3OHXC 4MNOA 4LJZC 3SGIA 4DXFA 1DD2A 1B2TA 1TY0A 3T51B 1S40A 1L1OB 1WI5A 2I07B 2LXKA 4LUVA 2JA6G 4H13C 4DK0A 5IE8A 4KV6A 3H0GB 3S9WA 1SE3A 1UE5A 1G8ZD 3DWPA 5CV9A 1CM9A 3K5OA 3EFXD 1PH3A 1UAPA 2WB1E 4IPCA 4XDXA 1GHKA 5J39A 1VS0A 4TVAB 1J5EQ 1SR3A 3S1NB 3IAYA 3HEJA 4DV2Q 1YNND 4DU9A 2DNEA 1Y1VB 2JA7G 1PTOB 1Q90A 2F0MA 3VR5A 2V4DA 2DY7A 3QOJA 4R9WA 4C1NI 2NTSA 1TS5A 2PW7A 4FYDA 1CZGA 2KHSA 3WWVA 4LAAA 5CV6A 3A7LA 5IYDH 5C4XG 1DOLA 2FHTA 1BCPC 4RMFA 2R92H 3I4MH 1SMYD 2EYJA 1CKNB 4P2CB 4KHVA 4LFAQ 1EUJA 2E75C 2I5LX 4CJ1B 1YJWA 2XNAC 2ZM6L 1STNA 4QGUA 4TSSA 1Z6HA 4OO1H 1LYLA 2L11A 3E0JA 1I3QB 1H9KA 3D4RA 4X65Q 2F3VA 4A3CH 3A5UA 1YITA 1EYAA 3HOZH 4DR6L 1IBKL 4C3JB 4DKAC 1QUQA 1U4RA 1Q3LA 4IOAA 2YTVA 2QEJC 4OGQC 1PDQA 4GNXB 2ENBA 3JAMc 1SEBD 1F2YA 1H9JA 4P73A 3NXWA 1KDBA 4N9PA 1KTKA 2B39A 4HJ7A 3CCLA 1HRJA 2VXWA 1VQGA 5GAGC 2RF4A 1SJHD 2MNAA 1IW7D 3C2PA 5JPNC 1QVFA 1VQKA 3I90A 2CWAA 5IT9c 2E5LL 3HOWG 2RBMA 2X69A 5EKIA 2XWJB 1HZBA 1CFMA 1Y8OB 3EVQA 1KAAA 3X3MA 4BBSG 3CCSA 4HN7A 1M1KC 4M8AA 1GVPA 1S4ZA 4CGYB 3H3VC 2E2IB 1PH5A 1YIJA 1RKNA 1AH9A 2AQ1B 4GLVB 2RDFA 4K2LA 5IGFA 5G3LF 2NZHA 3HGBA 3N52A 1CQFA 3B6YA 3TMEA 3D4DA 2ICEC 3RZOB 3A7AB 3CW2C 3PV0A 5J22A 4H02A 3X3NA 2PO4A 4G4KA 2JN4A 4RFBA 4DAYB 1B3AA 4N9TA 2UXCL 2Z0SA 4X64Q 3HOXG 4G7HC 2CH4A 4C3IH 1Y1WB 1HTLD 4DV1L 4DAVA 4UAIA 1N9WA 1PFNA 5GROA 1VQ6A 2KCNA 4A3DB 1DJRD 2B2UC 4GKJL 2D62A 3AFQA 4A3JH 3CCMA 1KLGD 1KXLA 1JT8A 4IALA 4U68A 2WV6D 4TKOB 2TMPA 4HSVA 1ENAA 4X66Q 1IKMA 1HR0L 1VQ8A 1G291 3H3VH 5C4XH 3S1MB 4C3JG 3CPWA 1JB3A 3OMGA 1JJCB 5IYCH 1ENCA 2ZTEA 3J7AF 4A4IA 3HG9A 3ULPA 1D6EC 1IYVA 1EQVA 4JI4L 4A3MG 1QWYA 1X9NA 5BR8Q 5FO8B 1V1PA 4IPDA 4NP5A 5C3EH 2F0WA 4B3SL 1PFMA 2B2YC 3ONAB 2RHSB 4RGMA 4BBRH 2CQOA 1RTOA 1EY7A 2KHIA 4B3TL 1RJTA 2E74C 1K28A 5IGCA 3OW2A 3BYYB 2B2WC 2XGTA 4APVA 2F3WA 1OXXK 2BH8A 5C3WA 1LT3D 1M4VA 3TEHB 3SVMA 3BS1A 4NXML 4HCSA 1PTOC 3HRZC 2WB1G 3IKJA 2EYOA 3AFPA 1LTAD 2MPMA 1O7ZA 2D0OA 1IBKQ 1XMOL 2K04A 4LUOA 1SXTA 3GDEA 4LF7L 2PMZB 1XWEA 3J81L 3PQIA 4DV4L 1G6ZA 1GXDC 4B3MQ 4K5VA 1W6KA 2PI2A 1SDFA 4IZ8A 4KTAA 3AQQA 4I65A 1AW7A 3JAML 1AEXA 5ELOA 2EE1A 4IFDH 1SRUA 2F0GA 3HOUB 4U673 2K28A 2E2HB 3RLNA 4UP8A 5J3BA 3HOXH 1XPUA 5COYA 3PIPA 4Z9CB 1EFWA 4RH6A 4KY7A 3NELA 4IJHA 1SSOA 1R4QB 1D5XC 1IYJB 1QNUA 3P1HA 1PRTD 3FEWX 3V96A 4A3KG 4QUFA 1WD1A 1C8CA 4LNQA 5KYLA 4BXXG 3BZKA 3FP9A 4JYAL 3NE5B 4CDEC 3D31A 1SJED 3GTKH 1XNQQ 1B70B 3RLOA 4QY7A 2KQ3A 4JCVE 3EJIA 1TWHB 1U4PA 3QWNA 1PMRA 3BZDB 3CC2A 5IIFA 1WOCA 3CCJA 4HEDA 1TS2A 4GKJQ 4WFN3 1QUQB 1W6JA 3DWAA 2AQ2B 4KN7C 4KD4A 3FHWA 2L9HA 3MEHA 4X3SA 4TQUS 3SK8A 1SYDA 3S17B 2R6GA 1ASYA 2FMCA 4Y7NH 1HR0W 1MBYA 1X3QA 2F1MA 2EJGC 2RHQB 3PMFA 3VA5A 3AU7A 1DZ1A 3NPPA 5IGGA 2J4XA 5EQ0A 3HOYG 2K1BA 3CQZH 5KIXA 3BVGA 3S2DB 1I6VC 5D3DA 3M7GA 3QOLA 3QB3A 4JI4Q 2Q8IB 2K33A 1B3QA 1UNSA 3TBIB 4CDFC 1N32Q 3G48A 3STBD 4JI6Q 1ET9A 2IY5B 2J7ZA 4JI1L 4HIDA 1WTRA 1UE7A 1IYUA 4DR2L 1DGSA 4OIKA 2R61A 4B3TQ 1E0BA 3JC66 4MIUA 4DV0Q 2Z6KC 3KYHC 4XT3B 3TSSA 3MZ5A 1EEFD 2WP8J 3NTKA 5CV8A 5JEAG 1V43A 3J80c 2XTIA 4MN3A 4A3IG 1SE8A 3T56B 3M7NA 1ICFB 2PZUA 1TWGB 4OONA 4NXMQ 4A3EB 2SNMA 1A2TA 2XVSA 2QGQA 1EQQA 5C0XJ 5BN4A 4LWCA 5LHY1 1PRTF 3F8TA 2VY3A 4JI8L 4DF7A 1NNXA 1MHWC 2E2JB 3S15B 1TVXA 3MTSA 5HGTA 4DV4Q 4FXDA 5C4JH 3FKIB 3OMCA 2HDMA 4A3KH 3NEMA 1CZWA 1VQ9A 1MIUA 1OXSC 3IFTA 1SYCA 2IPKD 3BVZA 3RZDH 1SLJA 1XMQL 1K0SA 1V1PB 3FMCA 2OXPA 3HKZE 2PPBC 2RCFA 3KLSA 1JB7A 5FO9B 2Z4HA 2FJ2A 3GTMH 4DXGA 3KLRA 3T53B 4LF6L 1VQHA 2QKIC 1QG7A 2Q2IA 4JYAQ 3UI2A 1K73C 5JJKA 3E5SA 5IGDA 3GTJH 4DFAA 2GVAA 4LF5Q 1I50B 2EPBA 3K7AH 3K0XA 3F2DA 3NUCA 5IWAQ 2G9DA 2ZXOA 1BO0A 3BG3A 1WCMH 3ER0A 2DN8A 1OO9B 2BCOA 3J81j 4XYOA 4WJ4A 2BA0A 2A19A 3DM1A 3I4NG 1E3PA 2MO0A 4WORA 2I5MX 4IUNA 2K5VA 4JI5Q 4KLKA 1FL0A 1EYGA 1SNOA 2UUAQ 4ID6A 3I2ZA 4QQBX 2IJ0A 2MO1A 5C5MA 1EIGA 2ZTDA 2N8NA 4DUZQ 1K9MC 2N3SA 3NTHA 2NVXH 5JEAH 4V190 4ULLA 3CMEA 1F2MA 3BZCA 3NBIA 4J6HA 1VQCA 4A3IH 3W3AA 5I6YA 3G7LA 2NVQB 2EVBA 3D6CA 4JI1Q 4DK1A 3QG1A 1B50A 1BVSA 2WINB 4R4IA 3SK4A 4XQJA 4JK1C 2M9VA 3G6JB 1X32A 2VQEQ 5D3IB 4X6AH 4JW0A 3I4MB 3S14H 4DR1L 3HOVB 2A68D 3S1RH 3MHBA 1XJVA 4PG3A 2EJFC 3S1QH 1R4PB 1I94L 2JA5G 4DK3C 3C46A 4GLAC 1PH1A 3MXNB 2R7FA 4ZYSA 5CBEE 5LL6X 2G9HD 4ZAIA 4AYBB 3J80L 4C3HH 4IURA 1YHAA 2NVYB 3OTOL 1G51A 1HA5A 2IHEA 5KNBA 3K5LA 1GM5A 4DR7L 1Q86C 5I4DA 4DV6Q 2B29A 1BOSA 2OTJA 1D1IA 2CH4W 4RCNA 4K14A 4EGVA 5KGUA 2ALYB 4DV7L 2F0NA 4RHSA 1NY4A 2VW9A 1K83H 4GOPB 1QOHA 1LLRD 3HZXA 1KNAA 3I70A 3L2PA 2R3ZA 3FVQA 5FLXL 1UUPA 1WTXA 1PFSA 1D1KA 1JWMD 1XTDA 2TSSA 4PZ7A 4XTCS 1HQRD 4O0AA 1AZPA 1A8VA 5A2QE 2A73B 1FGUA 2CVRA 5I2XA 4LF6Q 2ZTCA 3UDIA 4I7AA 1WVLA 4GLXA 3H91A 1LO5D 5ELBA 4LFCL 4V0BA 4OEMB 1YZ6A 4DV3Q 1JCKB 2JXMB 1N34L 3BDLA 1AP0A 1BQQT 3BJUA 5IYDG 4L8JA 2R92G 2OTLA 1RODA 4DUYQ 1Q1EA 2JEBI 3TS2A 3GV3A 2HQEA 1NCVA 5M5YH 1HH2P 1Z9FA 3MXUA 3N6RA 1WTPA 1QZHA 1ZKOA 5DM73 4KKSA 4AIMA 2K03A 2K4KA 4KHPL 5C0XI 3GTGH 2Z9HA 1IXRA 4H44C 1CA6A 3A56A 3OWFA 3VYTA 4O1NA 3HOZG 1NAPA 1NR4A 2K01A 3HKZG 5GADC 5C4XB 1SAPA 4CKEA 4RA8A 4Y52H 1U4LA 2LS01 3GTQB 1HXYD 1ESRA 1DCZA 1PZID 1NMGA 1G2TA 3KOJA 2VNUD 1D7QA 1BR9A 1XNRL 1RDPD 2GVBA 1SFOB 4FF3A 1X65A 3AB9A 4YCUA 4RWSC 1GUTA 1V1QA 1I4RA 3I91A 1SE2A 2MUYA 1A3VA 3AYHB 5ELCA 4XQQA 4DR1Q 4DA2A 2KEEA 1S5ED 4EX5A 4PQXA 1D8LA 1BBUA 2EOTA 1VCIA 2CWPA 4IJLA 1ONLA 3I7FA 4PNYA 5C3XA 1KDAA 1PFBA 3VR4A 2OQKA 2ZXPA 3E9IA 2YTYA 1SNMA 1VQBA 1XX8A 3Q6SA 4QMGA 4OWTB 3T1HL 1GO3E 3TZUA 1HCZA 4C3IG 3HOWB 2RA4A 5G3LD 4KKUA 2AQ3B 1MJEA 1YNJC 3EIVA 4BBSB 1IL8A 1B8AA 3CC7A 5JJLA 1C4QA 1WJJA 3TP7A 1EU3A 3PUXA 1MSGA 5C4ZA 5GQOA 1JOQA 4A3JG 1GUWA 5ELDA 4XQNA 1OXVA 2D0PA 4YCWA 1TWCB 1CKMA 2Y0SG 3MXGA 2MJ8A 3SK6A 4DR3Q 1EY4A 1ZYRD 2HHHL 1EYDA 2ZXRA 3K59A 3JAMi 4NDXA 4FF1A 3T16A 2CW0C 4I7ZC 3HOXB 3CCRA 5IYBG 3S16H 4L63B 5IYCG 4BY7G 3RUZA 1ASZA 2AKWB 3CXCA 4LFCQ 1Z7TA 2ZJRA 1IBLL 4K0KQ 1D5ZC 4CHTB 2ZT9C 4LF8Q 3GTKB 1JWSD 4ME5A 5C3EG 4OX9L 1Y69U 3HS0C 4JV5Q 4BBRG 3J81c 3PO2H 2M2LA 4K2KA 1CSPA 3CKIB 5AJ3L 3K8AA 4DAMA 1S5CD 2UUCL 1F9RA 4UHVA 1KHIA 4P75A 3NSWA 3IL8A 2OF1A 1O7IA 3QR8A 4YHHL 4A3MB 1RF2D 1NMFA 1VQ5A 2KUMA 3BDOA 3CCQA 3GTLB 1YHBA 3VDYA 5T1IA 2PNHA 5IOCA 3NP8A 4L5QA 4YY3L 3PSIA 4ZQ3A 2YYZA 1KRTA 3CRKC 1II3A 2VS1A 4JI2L 3CRLC 3CMAA 4POFA 1V1OA 3UE1A 1H95A 4QUCA 5JVH3 2F0LA 1VDZA 1YNNC 3H94A 4CKCA 3T1YL 1PZKD 1CUKA 1CTMA 3S2HB 1STGA 3PGZA 5IP7H 4B3RL 5DAUA 1B9MA 2WB1B 1I6HH 4BA2I 4IFDG 5LMNL 4WRDA 1AZQA 1LT6D 4JBKA 1TXYA 4JI0Q 3LX0A 2OT2A 2YU9B 4H7BA 4C2MB 5IT9E 1T9HA 4TRDA 4FVMA 1SMYC 1L0YB 4C1NK 1HJPA 5K5PA 2A8VA 1A6XA 4K8IA 4X3KA 4A3GG 3W5OA 2NN6H 3LWUA 1STAA 1C48A 3G71A 1TS4A 3P7JA 1RCVD 1K8MA 1PRTB 2F0PA 4IUPA 3VR3A 4BS9A 4DGZA 5IYBH 5C4JB 3CCEA 2B8FA 4ME3A 4BY7H 2NTTA 2A6ED 3IFDA 4A3KB 1BUVT 3SR1A 1KABA 2FFKB 4CJ0B 2RSOA 2WAQE 2VB3X 4FXKC 4L5RC 2A6HD 3RZDB 4EQPA 2NVTH 2JA8H 3DMUA 3L9AX 1NUCA 1GD7A 1HNWL 2IHFA 1L1OC 2B2TA 2JQOA 4QJFA 2NZ1D 4DV5L 1MKHA 5I9OA 1EIHA 5HGQA 4G7ZC 2N55A 1JICA 1E2WA 2F0VA 2KECA 2UXBL 2ZM6Q 1S5BD 2A69D 2ASBA 3GTMB 4X3UA 4FNFA 5CMDA 1YJ9A 4HMJA 4JI3L 3PO3H 5E4WC 3I8ZA 5GAHC 3GTJB 3KF8B 4OX9Q 1K3BC 1UE1A 3NQIA 2WFWA 1UEAB 2K05A 3OWEB 2LFNA 3HP3A 4DR6Q 3CP0A 1JOKA 4PMCA 1N36L 4OWXB 3DUZA 4YWLA 4K5WA 1WCMB 5CORA 2L1BA 3HOYB 4NB3A 1IHZA 4DR4L 4L5SA 2JK8A 4YHHQ 2CCZA 5I2YA 1E1TA 1S3OA 2AWOA 1SYFA 4ZUJA 2LY7A 2ES2A 1B7YB 1TQOA 4GKKL 3GO5A 3WDNA 1RIPA 1PYSB 4YY3Q 3H09A 3DEOA 2E5LQ 1BXTA 4KKTA 5LL6S 1KC8C 4WJWA 3GP7A 4HIOA 1Q7YC 3Q23A 4IFDJ 2NVXB 4IUVA 1PTOH 4A3IB 2K5DA 1NTGA 2F3IA 4OXPA 4A3GH 5LMNW 3PUWA 3TP5A 4GNXC 1FNUA 4E6IA 2JSOA 2F0UA 1XYIA 4UP7A 2UXCQ 1A2UA 1H9MA 4DV1Q 3O13A 2D2CC 2VL6A 4QL5A 1LACA 5M5XH 3S1RB 3Q22A 5FJ8H 3S1QB 1I4HA 3MXNA 4OHJA 2HIXA 3G6EA 3URYA 2ZJPA 1QB5D 3QIAA 4Q0FA 3E6ZX 4LW1A 3DXJC 3J80i 3EQLC 1WTHA 5EPJA 4DPGA 3M3YB 4ZKBB 5FK9C 2BDOA 1CQVA 1I4GA 2JE6I 1UEBA 1HR0Q 2AHOB 4OO1I 1IKLA 4IUQA 1WCMG 1AN8A 1FR3A 5CV5A 1HPCA 3RN5A 1IZ6A 2IX0A 1A63A 2YV5A 4GOPA 2N78A 4HIMA 1CA5A 4MTKA 1K83B 3MVVA 4XXEA 4A3BG 1LUZA 1LT4D 1S5FD 4B3SQ 1LTTD 3F2UA 1D2BA 3FRPB 4ZRZA 3R2IA 1JQYD 4EQOA 3A5ZB 1IL2A 3I72A 3TN2A 1OTCA 1PH9A 2EDGA 3I4NB 2F4VL 1VQ7A 2B3GA 1KRSA 2IT1A 2O4XA 5C4HA 3D6WA 3LNNA 3C3LA 4J1MA 5EKKA 3MC0B 1O78A 1XMOQ 1EL0A 2JEAI 5KEEA 4BY1G 2LKVA 4LF7Q 4GN4B 3V2TA 2XRSD 3VR6A 4B08A 5C0XH 2Q2UA 5M5YB 5FLXc 2WAQG 4OIJA 5E1FA 3M9BA 3M4OB 1NBWA 4C3HG 1HNZL 2C9OA 2UUBL 1DM0B 4JOIC 3RR5A 3GTGB 2DUDA 3DLLA 3A8IE 3U4ZA 3OOCA 3S1MH 5JAVA 2CQAA 2NBFA 4RGOS 2JA5B 4JI7L 3H3VI 3A8JE 2PQAB 1VMCA 2Z6BA 2VQFL 1LTGD 1EIFA 4CDCC 1CKOA 1HQMC 3I73A 1LABA 1EOTA 2QDBA 2VZAA 4K8JA 3STBC 2B2UA 1FJGL 3PUYA 1O7LA 2K52A 4LF9L 1Q12A 4KHZA 4X62L 1V9PA 2MP1A 3BU2A 4OL7A 3KK7A 1A0IA 4CKBA 2R93H 1ILPA 4IN3A 1TY2A 2NB0A 3E9HA 1A3UA 4P74A 4UP9A 3AEVA 4L5TA 2R7ZG 1VQAA 2L5TA 4A3BH 3CF5A 3TDQA 1VF7A 5IP9H 1TU2B 1L0WA 5C6AA 1W2BA 1QNKA 4RKBA 4ALPA 1EZ8A 4R4TA 3RD4A 1PH8A 2Z8LA 5J1ZA 1VQFA 3DM3A 3U9OA 4AH6A 1V8QA 1WTVA 1WTQA 5JEAJ 3NHHA 4DR2Q 1GKHA 2MQHA 2IW3A 5EPLA 2HT1A 3GQBA 3HOUH 2Y0SE 5GAEC 4ZUIA 4A93G 4MHEA 3EBEA 4BY1H 1LTLA 3S16B 2R92B 4DAPA 2K75A 4IFDI 4M1UB 1AFPA 4EQNA 4LUZA 1LTBD 2MGSA 4HJ5A 4K5XA 1I4XA 4PV1C 5EKLA 4QCLA 2AUJD 3CD6A 3ZYYX 1IBML 3PUVA 4JI8Q 3KBXA 1HZ9A 2DGYA 2BE5C 1TS3A 3K58A 2HUGA 3HOZB 1HNXL 3HKZB 1TWFH 5KNDA 4LMQD 4HIKA 4LFBL 3LGJA 1EFID 5FO7B 5M3MG 3D3RA 1MJCA 2RKSA 2L12A 2I46A 1VQMA 4IQZA 4K6DA 1A62A 1KD1C 1BCPB 1E2VA 4J15A 1XMQQ 5F2DA 2DY8A 2L0CA 1J6QA 3H15A 1J5EL 4JI7Q 1KL9A 1XPRA 1EY8A 1Y14B 2PZTA 3H6MA 5EGTA 4DV2L 4IPGA 1EY9A 1F2ZA 1XPOA 2PNRC 4CJ2C 2H4OA 4KI0A 2KA7A 4POGA 3F2BA 2R7ZH 3KFUA 2H1EA 1X3EA 1I6HB 1YBYA 2A1AA 2F4IA 1LM0A 4C3IB 5BN3A 4X62Q 3I4OA 2KOLA 2A68C 1PV4A 1VMPA 3K6OA 3ERQA 1EZ6A 2XIWA 4A3LH 3WOFA 4A3EH 2E76C 2SOBA 2KCMA 4A3JB 1GHJA 1R9TH 5JPMC 2Y0SB 2F0DA 5E4XA 3GTPH 1EY0A 4X65L 5CR3A 3PO2G 3VYSA 1EWIA 3S15H 1YNJD 4X3TA 4ZLTF 3OYYA 4A93H 3R2TA 2F0IA 4BY7B 3ND8A 4HAEA 5BN5A 5M5WH 1LT5D 2Z6KA 3FPUB 1KAWA 3D4WA 1E1OA 1B44D 3G4SA 5IY0A 4ABNA 2EYMA 2NVTB 3GTOH 5C3EB 1BCPD 3PIOA 1FGBD 4BBRB 3UDXA 4QIWE 3DEPA 1I94Q 2F03A 2PYKA 1F9PA 5M3MH 1YVCA 3CAMA 3ICEA 5L37A 2IX1A 2K5WA 3R3OA 4FF2A 3KF8A 5IP7G 4FDBA 5DEHA 2HDLA 3OTOQ 1QE6A 2UU9L 4P72A 3I4LA 4DR5L 4DR7Q 1RD9D 3F2CA 2K5NA 1H9SA 1GUGA 3TREA 5DM63 2Q8RE 1PYBA 1NE3A 1F77A 4DNTB 3A8KE 1K3RA 4DV7Q 2RSNA 1RL2A 1EQRA 2EXZA 3J81i 5EJWA 4H0LC 3CCUA 2WACA 2BH2A 4R1JA 3MXPA 2OEOA 1PH4A 2NN6G 2SEBD 5EBDA 3U50C 2K50A 1KLUD 4X66L 1JORA 1C0AA 5EAYA 5C44G 2WIIB 4RCOA 3KLWA 3P75A 1STEA 4PMWA 2NVQH 3TP8A 5FOBB 5A2QL 5M3FG 3M4YA 1ZXTA 4KJNA 1N34Q 4A3GB 4O2DA 1P16A 2HQLA 2F52A 3E3XA 5EPKA 5BR8L 2JA8G 1HUMA 1X55A 3CPFA 1E2ZA 2KJXA 2VUMG 3KF6A 1AE3A 1JE4A 2EYPA 2HCCA 3RMHA 4L6TB 2XN9C 4GOPC 4DN4M 4S3SA 1X6OA 1A15A 3HOVH 5M5XB 1PYWD 1Q46A 1EWCA 1BCPF 2MFIA 4N8FA 2NVYH 3PO3G 4KHPQ 1WFQA 1SBBB 1WYDA 3NBHA 4Y7NB 2B63H 2B8GA 2G5DA 3A55A 3DHQA 4QIWB 4XT1B 1NJIC 2IL8A 4A3FG 1FNWA 1X3FA 3M85A 5CV4A 3J81E 4PZ6A 1B4OA 1EY5A 4BWGB 1PA6A 2FXQA 1SYEA 3CQZB 1C9OA 2BA1A 2OWOA 1XNRQ 1NR2A 4JBMA 1U4MA 4B3ML 5K36G 2KCCA 4WJ3M 3JAME 2LXJA 3H0GG 1KIXA 4NPSA 1HFGA 1HHVA 5D65A 2Q8TA 4Q5VA 2PZWA 5KRUA 1N33L 5HURA 4DNRB 1JOOA 1ZYRC 2N88A 4JC0A 3BYTB 1PHJA 1Y1VG 5JOBA 1VF5C 2DJGC 3F1ZA 3NK9A 2PMZE 4UY8C 1YI2A 1HZCA 5FLMG 4R4QA 3V05A 5EBCA 1L0XB 1PTOD 2X6LA 2JA6H 1SYBA 2K5QA 5DLQE 3SK5A 3VYUA 2UU9Q 4DR5Q 2RDGA 3T1HQ 3M4QA 1XNQL 5CV7A 4JPBW 4LF4L 5JVG3 1O7YA 3MAQA 1HZAA 2EYLA 1EY6A 4IUTA 2PW5A 3SHLA 1S72A 2OQ0A 2CFMA 5FJ8G 5C44H 2JYOA 3FDTA 2DNCA 4XYQA 1SE4A 2JA7H 2BDNA 1P8LA 2F0OA 4RG1A 2IX3A 3C1FA 1FD7D 4AQYL 4IPHA 5M3FH 2JJQA 1B9NA 2QDLA 2HHHQ 3EN2A 3LWEA 4P71A 2CKZB 3BVMA 1IW7C 2VUMH 1YJNA 1DONA 3TRZA 4CDDC 3AMUA 1CT1D 3J7AV 5IGBA 3GTQH 2PQAA 1TWAH 2EYHA 4MZ9A 2JP1A 3NWSA 3MA2B 1PH6A 1HTPA 1SFOH 1IBLQ 4NKLA 3UE0A 1N32L 1Q81C 1QVGA 4JI6L 1ET6A 4BA1I 3Q0AA 3T4AC 1F9QA 1PH7A 1DXMA 3K7AB 2F0HA 1VQIA 5AJ3Q 1WTOA 1JR0D 4DV0L 4A3FH 1XTCD 3PIO3 1H9SB 2UUCQ 4YWMA 3KLSX 5JJIA 2K32A 3CC4A 1A3TA 2R93B 2B2VA 1EYCA 2D5DA 2SNSA 4DNIA 4F7XA 1ENFA 5K36H 5CGKA 2L15A 3H0GH 2QILA 1B53A 4A3BB 2K5HA 3PF5A 3TZDA 3KDFA 5ELFA 4PMBA 1Y1WG 3J7A5 1EOVA 4K6LA 1VQOA 3HOWH 1PTOF 4JI2Q 3EA6A 4GN3B 3S1NH 4MTNA 1TT2A 2IWHA 4BBSH 2NZOA 1Y1VH 1BKBA 4A3DG 5C0XG 3I55A 3T1YQ 1STHA 2EIFA 3ND9A 5FLMH 4ZKCB 2A6EC 4CBVA 4KN4C 3D8GA 1G2SA 1BBWA 1TWCH 4B3RQ 2V1CC 1BDOA 3SEBA 2HD3A 3MFYA 1N33Q 4J8QA 5LMNQ 1B1ZA 1SN8A 2A6HC 2OCEA 1ILQA 1T5EA 3KF6B 1GJXA 4HSPA 4BY1B 3S14B 1JJ2A 4EVOA 3K7UC 3PCOB 5IT9L 4F88A 1VQEA 3ERSX 1QILA 2A69C 1U5KA 2WAQB 1CHPD 1MD2D 1MGSA 4C3HB 2GA4B 4YWKA 4NXNL 4GZYC 1KNEA 2KBNA 3NTIA 1JJGA 1I3QH 4LF4Q 3I3CA 4LF5L 2F0QA 1PLFA 5TSSA 3NBHB 2KENA 1TWFB 1DOMA 5IWAL 2RQXA 4RKLA 3ULJA 4C3JH 3K5NA 2C5CA 5FKAC 3MWYW 4GS3A 2A74C 4FF4A 4QB4A 2R93G 3L0OA 3NWTA 4JVZA 4AQYQ 1Z47A 3OSOA 3UDGA 4A3MH 1LTSD 2EQSA 1Q82C 1GOZA 3OPOA 4HJ9A 1HNWQ 2Q2TA 4JI5L 5HY6A 3GTLH 4ODGA 3ULLA 2UUAL 5IP9G 2ATWA 4DV5Q 1EEID 4KD3A 4DUZL 5IGEA 3CU7A 1FYCA 4YCVA 2UXBQ 1DOKA 4ILWA 1M8AA 1ESFA 5CC4A 4JG2A 1VQPA 2E2IH 2JA9A 1K8AC 3S2HH 1E7ZA 4JI3Q 1PRTC 1SROA 1CI3M 1BBXC 1HFNA 2DJFC 3KJOA 3RZOH 2PI2E 2QW7A 3W2DA 4F8MA 2R7ZB 1GUSA 3HOUG 1I4QA 1MI2A 2CHBD 1J8IA 1N36Q 2YTXA 2P5ZX 2ICIA 1Y1WH 1RTNA 2KHJA 2YU9H 2VQEL 3U58A 3HKSA 4C2MH 2ID0A 2E8GA 2N49A 2WKDA 1QJOA 4DR4Q 2KVMA 1QVCA 3J80E 4ZK9B 4A3DH 4UDUC 1TIID 1JC7A 2R7DA 4B9WA 1GUOA 4JBJA 1Q1BA 1L2FA 4RGNA 4XIGS 4GKKQ 4N8X1 1R9TB 3D0FA 2C35B 1PVOA 3K57A 4HR7B 4GN5A 3GTPB 2NWGA 4R8NA 1EQTA 1M90C 3T13A 4A93B 3ZJYC 4FP5D 2NN6I 1JWUD 4DV6L 3A0JA 3VR2A 2XRQD 5M5WB 4OWWB 4BXXH 1EU4A 4A76A 5FLXE 1ML0D 4AYBE 4NMZA 5JJZA 3A74A 3GTOB 2XWBB 3W1GA 3NENA 3CHBD 1UE6A 4RAUC 1LTRD 4O42A 1YEZA 2K7VA 3SXHA 1H9RA 2EZVA 4G7OC 4HTHA 1GUNA 4C56C 5M3MB 5A35A 2HCIA 1BF4A 2QEXA 3A54A 4NXNQ 3DWQA 1VQJA 2VB2X 1G91A 1HUNA 3HFZB 1X3PA 2BE5D 3W1BA 4HJAA 2GN5A 4DV3L 2HIVA 1DYQA 4IUUA 5KYIA 3RLFA 1I4PA 1LV9A 3SDZA 5E3FA 3KJPA 5C5LA 3E0EA 1E22A 2O5JC 3KDFB 5LMUL 4G57A 3U9SA 1VQ4A 2F0EA 3KUPA 3HOYH 3OIQA 4DUYL 1L1OA 3Q24A 1X54A 2B2YA 3J7ZC 2BOSA 2RDHA 2O2LD 1VQNA 4A3LG 4A3EG 1SMXA 3OIPA 5D14A 1CK1A 1OXUA 4LK1C 4DK6C 1ZEQX 2M00A 1PZJD 2B2WA 3P20A 1JMCA 2FINB 3K81C 3TQYA 4UPAA 4A75A 2E2HH 3EROA 2EY1A 3FKIG 1EIYB 5CBAE 4HCEA 1MSHA 1C7YA 2F4VQ 1X56A 2L55A 1Y8PB 1LTID 4FO2A 1F2LA 3IRBA 1VQLA 4R4OA 5I6WA 2X6GA 1F9SA 1SYGA 4F87A 3S24A 1S5DD 1TWHH 1XXGA 2LSSA 1TKWB 1U9RA 3PO2B 1CKNA 1I5FA 2XSCA 3QO2A 2UXDL 3OW7A 5ISRA 1K0RA 5ELEA 4OELB 4QF4A 5CYUA 3PIP3 4R4CA 3I56A 3U4VA 1KQSA 2MHVA 2PCFB 1HNZQ 2UUBQ 2AUKA 3C1EA 3K5MA 1G6PA 4B9XA 3GV6A 3S17H 3M3YH 2B63B 2NYZD 4ZCKA 4FXGC 3UDFA 5IODA 2EY6A 1HA6A 4KMUC 2EYFA 3VA7A 4HJ8A 2FMMA 4GNXA 2AMCB 2F0KA 2L4NA 1Q8KA 2KEDA 2H5XA 3J7YW 2F0SA 3S2DH 1N8RC 4KY5A 2VQFQ 5KNCA 1J9OA 3GD7A 2QCPX 2SDFA 3Q8DA 4HMIA 4KK7A 4PZ8A 1UWVA 1ICWA 2NUCA 2K14A 1QZGA 1FJGQ 4KJOA 4DR3L 1Q8IA 4RHRA 5AFWA 4LF9Q 2AWNA 3MFGA 1STBA 3PUZA 1QCBD 2RVLA 1FNVA 2J0TD 3KBGA 3L3OC 5I9PA 1WD0A 1YHQA 3I4NH 3ITPA 2E2DC 3VYRA 3RN2A 3MEFA 4LFAL 2B2TC 1D5MC 2O5IC 1TWGH 3K80C 3SE0A 2JA6B 2KCTA 2F0TA 2Z4IA 4DAYA 4K0KL 1EWHA 1PH2A 4LF8L 2QA4A 5ELNA 1YNXA 3TS0A 5LMUQ 5DNFA 4JV5L 1FVIA 2Q2HA 1BNZA 2E2JH 3I4MG 1K8GA 3HOVG 1E24A 1RHPA 4KY6A 2K6AA 5C44B 1WTWA 3FKIH 2EJMA 1Y8NB 3K0YA 2JA7B 2I5HA 5H1SE 4AYBG 3FPPA 2LMCB 3WOEA 3M4OH 1T5XD 3BDCA 3R8BA 5M3FB 4OO1G 1SNQA 2EY2A 2WKCA 3M4PA 1TR5A 1X3GA 2B63G 1AE2A 4YIJA 2JA8B 4A3CG 2EXDA 1OXTA 2ZJQA 2CW0D 2B2VC 2VUMB 1W3SA 4EQ5A 2F0JA 2PQEA 3PF4A 1SNCA 4IO9A 1SNDA 1TWAB 1CSQA
chains in the Genus database with same CATH topology
2JA5H 1JE5A 2JA6H 4IOCA 1HR0Q 2JE6I 1UEBA 2NVXH 5DLQE 2AHOB 3CMEA 2UU9Q 4OO1I 4DR5Q 3BZCA 3T1HQ 3M4QA 1XNQL 1WCMG 1VQCA 4A3IH 1IBMQ 1U0LA 5E7NA 3RN5A 2I0QA 4LF4L 3RNUA 1HZAA 1IZ6A 3L7ZC 2IX0A 1A63A 1VQDA 4JI1Q 2YV5A 1S72A 4JBWA 2OQ0A 1I50H 2CFMA 5FJ8G 1HNXQ 2RCNA 1BVSA 5C44H 4GOPA 2N78A 2UXDQ 4R4IA 4HIMA 2JA7H 4LFBQ 4JI0L 1P8LA 4X64L 3CCVA 4RG1A 4A3BG 4JOIA 4MNOA 3SGIA 2VQEQ 1LUZA 4B3SQ 4AQYL 4IPHA 5M3FH 4X6AH 1S40A 2JJQA 3S14H 4DR1L 3S1RH 1XJVA 2HHHQ 4PG3A 1L1OB 1WI5A 3EN2A 2LXKA 4LUVA 1I94L 4DK3C 4P71A 2JA5G 2JA6G 4GLAC 5IE8A 2CKZB 1PH1A 1UE5A 2R7FA 3MXNB 1YJNA 2VUMH 3TRZA 3A5ZB 1IL2A 1OTCA 1PH9A 4C3HH 1YHAA 1PH3A 2F4VL 3GTQH 2WB1E 4IPCA 1VQ7A 4A3GH 2PQAA 1VS0A 2B3GA 1TWAH 3OTOL 1G51A 4TVAB 1J5EQ 1SR3A 2IHEA 4MZ9A 1KRSA 2IT1A 4DV2Q 1PH6A 1GM5A 1SFOH 1IBLQ 3UE0A 4DR7L 2JA7G 1Q86C 1XMOQ 1Q81C 1N32L 4DV6Q 2B29A 1QVGA 4JI6L 2JEAI 4BA1I 2OTJA 4BY1G 4LF7Q 4GN4B 1PH7A 2ALYB 4DV7L 3S1QH 1VQIA 5AJ3Q 1NY4A 2VW9A 3WWVA 4DV0L 1K83H 4GOPB 4A3FH 2Q2UA 5FLXc 2UUCQ 2WAQG 4YWMA 3L2PA 5C4XG 5IYDH 5JJIA 3M9BA 3CC4A 1NBWA 1PFSA 4RMFA 2R92H 1HNZL 3I4MH 1XTDA 2UUBL 4DNIA 4PZ7A 1CKNB 4JOIC 1EUJA 4LFAQ 3RR5A 2I5LX 2DUDA 2L15A 1YJWA 2ZM6L 3H0GH 4XTCS 3DLLA 4O0AA 3U4ZA 4QGUA 1A8VA 3S1MH 2K5HA 1FGUA 3PF5A 4LF6Q 2ZTCA 3KDFA 3UDIA 1LYLA 1Y1WG 3J7A5 1EOVA 4GLXA 1VQOA 3HOWH 4JI2Q 4X65Q 4GN3B 3A5UA 4LFCL 2PQAB 4MTNA 4JI7L 3H3VI 4DV3Q 1YZ6A 3S1NH 4BBSH 1YITA 2VQFL 2NZOA 1EIFA 1N34L 3HOZH 1Y1VH 1BKBA 4DR6L 4A3DG 1IBKL 5C0XG 1CKOA 3BJUA 3I55A 4DKAC 1QUQA 3T1YQ 2EIFA 2VZAA 5IYDG 5FLMH 4IOAA 3STBC 2YTVA 4GNXB 1FJGL 2R92G 1BBWA 3JAMc 2OTLA 1TWCH 3PUYA 4P73A 4DUYQ 4B3RQ 2V1CC 1Q1EA 4HJ7A 3CCLA 1N33Q 5LMNQ 2JEBI 3TS2A 2K52A 1SN8A 1VQGA 4LF9L 5M5YH 1HH2P 2OCEA 1Z9FA 5GAGC 2RF4A 1Q12A 4KHZA 4X62L 2MNAA 1V9PA 3BU2A 1QZHA 1VQKA 1QVFA 1A0IA 3KF6B 2R93H 4AIMA 2K4KA 2CWAA 4KHPL 1JJ2A 5IT9c 2E5LL 3HOWG 5C0XI 3K7UC 3GTGH 3PCOB 3E9HA 1HZBA 1IXRA 4P74A 4UP9A 1VQEA 3ERSX 3AEVA 4BBSG 4L5TA 3CCSA 1M1KC 3HOZG 2R7ZG 1U5KA 1VQAA 3HKZG 5GADC 3CF5A 4A3BH 1GVPA 4Y52H 5IP9H 4YWKA 1L0WA 1PH5A 1YIJA 4NXNL 1AH9A 1W2BA 2KBNA 4GLVB 1JJGA 1I3QH 1NMGA 4LF4Q 2NZHA 4LF5L 3KOJA 4ALPA 2VNUD 3B6YA 1D7QA 4R4TA 1PH8A 3PV0A 3CW2C 1XNRL 3NBHB 1VQFA 2GVBA 2KENA 3DM3A 4H02A 4AH6A 5IWAL 3ULJA 4C3JH 4DAYB 1X65A 4YCUA 4GS3A 2UXCL 5JEAJ 2Z0SA 1V1QA 4X64Q 3HOXG 4C3IH 4DV1L 2R93G 3AYHB 3L0OA 1N9WA 5GROA 1VQ6A 4AQYQ 1Z47A 1GKHA 2MQHA 4DR2Q 3UDGA 4DR1Q 4A3MH 2HT1A 3HOUH 2EQSA 1Q82C 2Y0SE 4GKJL 4EX5A 4HJ9A 1HNWQ 5GAEC 2Q2TA 1D8LA 5HY6A 4JI5L 3GTLH 1BBUA 3ULLA 4A93G 2D62A 3AFQA 2UUAL 5IP9G 3CCMA 1VCIA 4A3JH 2CWPA 3EBEA 1LTLA 4BY1H 2ATWA 4IJLA 1KXLA 3I7FA 4DV5Q 1JT8A 2K75A 4IFDI 4DUZL 2OQKA 4X66Q 4LUZA 3E9IA 4YCVA 2YTYA 2UXBQ 1VQBA 1HR0L 1G291 1VQ8A 3H3VH 5C4XH 4HJ5A 4JG2A 3CPWA 1VQPA 2E2IH 2JA9A 4OWTB 3T1HL 1K8AC 1GO3E 3CD6A 1JJCB 5IYCH 2ZTEA 1IBML 3S2HH 1E7ZA 4JI3Q 3PUVA 4JI8Q 1HZ9A 1SROA 4A4IA 2DGYA 3ULPA 1MJEA 3KJOA 3RZOH 3EIVA 2PI2E 1HNXL 1TWFH 1B8AA 3CC7A 4A3MG 4JI4L 5JJLA 3HOUG 1X9NA 4HIKA 4LFBL 3LGJA 1WJJA 5BR8Q 1N36Q 2YTXA 3PUXA 1Y1WH 2KHJA 5M3MG 2YU9H 4IPDA 5GQOA 3HKSA 4C2MH 5C3EH 2VQEL 3U58A 4A3JG 2ID0A 4B3SL 1MJCA 1OXVA 2D0PA 2E8GA 2N49A 4YCWA 2RHSB 1CKMA 2Y0SG 4BBRH 4DR3Q 2CQOA 4DR4Q 2KHIA 4B3TL 1QVCA 2HHHL 1VQMA 4A3DH 1A62A 1KD1C 3JAMi 3OW2A 2R7DA 4J15A 4JBJA 1Q1BA 1L2FA 4XIGS 1XMQQ 4GKKQ 3CCRA 2XGTA 5IYBG 3S16H 3D0FA 5IYCG 4APVA 4BY7G 2C35B 1PVOA 1OXXK 2BH8A 1ASZA 3TEHB 4GN5A 4NXML 1J6QA 3H15A 2AKWB 1J5EL 3CXCA 4JI7Q 1KL9A 4LFCQ 1XPRA 1M90C 2WB1G 1Y14B 4DV2L 2ZJRA 1IBLL 3AFPA 4IPGA 4K0KQ 1XPOA 3ZJYC 2D0OA 4KI0A 2NN6I 1IBKQ 1XMOL 4DV6L 4LF8Q 4LUOA 4POGA 3A0JA 5C3EG 4OX9L 3F2BA 4OWWB 3GDEA 4LF7L 4JV5Q 4BBRG 3J81c 3PO2H 2R7ZH 4BXXH 4DV4L 1CSPA 4A76A 3KFUA 1X3EA 5AJ3L 1YBYA 3K8AA 4AYBE 4B3MQ 2A1AA 4DAMA 2PI2A 2UUCL 3A74A 1LM0A 4X62Q 3AQQA 3W1GA 3NENA 1KHIA 3I4OA 4P75A 1UE6A 5ELOA 1O7IA 1YEZA 4YHHL 1PV4A 1VQ5A 1SRUA 1NMFA 4A3CH 4A3LH 4A3EH 3CCQA 3RLNA 1YHBA 4UP8A 5J3BA 3HOXH 3VDYA 1XPUA 2KCMA 3PIPA 1EFWA 2PNHA 1R9TH 3NELA 4L5QA 4IJHA 4YY3L 3PSIA 2YYZA 2QEXA 1IYJB 4NXNQ 1KRTA 1VQJA 4A3KG 3GTPH 2VS1A 3HFZB 4X65L 3CMAA 4JI2L 3W1BA 4POFA 3PO2G 4HJAA 4LNQA 4BXXG 2GN5A 1EWIA 2HIVA 3BZKA 3UE1A 4DV3L 3S15H 1H95A 3OYYA 3FP9A 4A93H 3RLFA 4JYAL 3KJPA 3T1YL 1CUKA 3D31A 3E0EA 1XNQQ 1E22A 3GTKH 1B70B 3PGZA 3KDFB 4QY7A 4JCVE 3RLOA 5IP7H 5LMUL 5M5WH 1VQ4A 2Z6KA 1KAWA 3HOYH 3CC2A 4DUYL 4B3RL 1L1OA 1E1OA 1WOCA 1X54A 3J7ZC 4BA2I 5LMNL 3G4SA 4IFDG 1I6HH 5IY0A 3CCJA 1VQNA 4A3LG 4A3EG 4JBKA 1SMXA 1TXYA 4JI0Q 4GKJQ 3GTOH 1QUQB 3PIOA 1OXUA 1T9HA 3FHWA 3UDXA 4DK6C 4QIWE 1JMCA 4TQUS 3K81C 1HJPA 2R6GA 3TQYA 1I94Q 4UPAA 1ASYA 4A75A 4Y7NH 2E2HH 1HR0W 2A8VA 5M3MH 4A3GG 1YVCA 3CAMA 3FKIG 3W5OA 1EIYB 3ICEA 2RHQB 2IX1A 1C7YA 5IP7G 2F4VQ 4FDBA 1X56A 3OTOQ 3HOYG 3IRBA 1VQLA 4R4OA 3CQZH 3G71A 2UU9L 4P72A 4DR5L 5IYBH 4JI4Q 4DR7Q 3F2CA 2K5NA 3CCEA 4ME3A 4BY7H 1N32Q 3S24A 3G48A 3STBD 3TREA 1TWHH 4JI6Q 2IY5B 2LSSA 4JI1L 4HIDA 1PYBA 1UE7A 1NE3A 4DR2L 1CKNA 1I5FA 1K3RA 1DGSA 2WAQE 4DV7Q 2UXDL 4B3TQ 4L5RC 3JC66 1K0RA 1RL2A 4DV0Q 1EQRA 2Z6KC 3KYHC 3J81i 2JA8H 2NVTH 1GD7A 4R4CA 2IHFA 3I56A 1HNWL 1L1OC 3CCUA 2BH2A 2JQOA 4R1JA 2WP8J 4QJFA 3U4VA 5JEAG 1V43A 3J80c 1KQSA 2XTIA 1PH4A 4DV5L 2NN6G 1HNZQ 4A3IG 1MKHA 2UUBQ 1SE8A 3U50C 3M7NA 1G6PA 5HGQA 2K50A 3S17H 4OONA 4X66L 4NXMQ 3M3YH 2UXBL 2ZM6Q 2ASBA 1C0AA 2QGQA 1EQQA 5C0XJ 5EAYA 4LWCA 5C44G 3KLWA 3UDFA 1YJ9A 4HJ8A 3F8TA 2VY3A 4JI3L 4JI8L 3PO3H 4PMWA 4GNXA 2AMCB 2NVQH 5GAHC 3KF8B 4OX9Q 1Q8KA 1UE1A 2H5XA 5M3FG 2WFWA 3S2DH 1N8RC 2VQFQ 1N34Q 4DV4Q 4O2DA 1P16A 3GD7A 2HQLA 5C4JH 3CP0A 4DR6Q 2F52A 2JA8G 5BR8L 1N36L 4OWXB 1X55A 3CPFA 3Q8DA 4PZ8A 4YWLA 1UWVA 2VUMG 3KF6A 4A3KH 1AE3A 3NEMA 2K14A 4GOPC 1QZGA 1FJGQ 4NB3A 1VQ9A 1MIUA 1OXSC 1X6OA 4DR3L 4DR4L 4L5SA 2JK8A 3HOVH 4YHHQ 2CCZA 1E1TA 3RZDH 1S3OA 4LF9Q 1Q46A 1SLJA 2AWNA 2AWOA 3PUZA 1CSQA 2ES2A 1B7YB 1XMQL 4GKKL 2MFIA 3GO5A 1YHQA 1RIPA 1PYSB 4YY3Q 2NVYH 3I4NH 3PO3G 1WFQA 3RN2A 4KHPQ 3MEFA 1WYDA 3HKZE 2E5LQ 4LFAL 1KC8C 1JB7A 1TWGH 3K80C 2B63H 4HIOA 1Q7YC 2KCTA 3GTMH 4IFDJ 4K0KL 1NJIC 4LF6L 1VQHA 4JYAQ 2Q2IA 4A3FG 1X3FA 3M85A 1PH2A 4LF8L 2QA4A 1K73C 4PZ6A 5ELNA 5JJKA 1PA6A 3GTJH 1YNXA 3TS0A 2FXQA 5LMUQ 2GVAA 4LF5Q 4JV5L 1FVIA 2Q2HA 2E2JH 1C9OA 2BA1A 2OWOA 1K8GA 3I4MG 1NTGA 2F3IA 1E24A 4OXPA 1XNRQ 3HOVG 5LMNW 4JBMA 3K7AH 3PUWA 3K0XA 3F2DA 4GNXC 4B3ML 3FKIH 5IWAQ 5K36G 4WJ3M 2LXJA 3H0GG 4UP7A 1KIXA 2I5HA 5H1SE 1WCMH 2UXCQ 3ER0A 4NPSA 3J81j 4WJ4A 4AYBG 4DV1Q 3M4OH 2BA0A 2A19A 3I4NG 4OO1G 1N33L 1E3PA 2MO0A 2VL6A 4QL5A 5M5XH 4JC0A 5FJ8H 3M4PA 1X3GA 2B63G 1AE2A 4A3CG 2EXDA 2HIXA 1OXTA 1PHJA 2I5MX 2ZJQA 3G6EA 2K5VA 2ZJPA 4JI5Q 1W3SA 1Y1VG 4KLKA 1FL0A 4EQ5A 1EYGA 2UUAQ 3PF4A 3F1ZA 3I2ZA 4QQBX 4LW1A 2MO1A 2PMZE 4UY8C 1YI2A 1HZCA 5FLMG 4IO9A 2ZTDA 4R4QA 3J80i 2N8NA 4DUZQ 1K9MC 2N3SA 4DPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 H;  1JE5 A;  2JA6 H;  4IOC A;  1HR0 Q;  2JE6 I;  1UEB A;  2NVX H;  5DLQ E;  2AHO B;  3CME A;  2UU9 Q;  4OO1 I;  4DR5 Q;  3BZC A;  3T1H Q;  3M4Q A;  1XNQ L;  1WCM G;  1VQC A;  4A3I H;  1IBM Q;  1U0L A;  5E7N A;  3RN5 A;  2I0Q A;  4LF4 L;  3RNU A;  1HZA A;  1IZ6 A;  3L7Z C;  2IX0 A;  1A63 A;  1VQD A;  4JI1 Q;  2YV5 A;  1S72 A;  4JBW A;  2OQ0 A;  1I50 H;  2CFM A;  5FJ8 G;  1HNX Q;  2RCN A;  1BVS A;  5C44 H;  4GOP A;  2N78 A;  2UXD Q;  4R4I A;  4HIM A;  2JA7 H;  4LFB Q;  4JI0 L;  1P8L A;  4X64 L;  3CCV A;  4RG1 A;  4A3B G;  4JOI A;  4MNO A;  3SGI A;  2VQE Q;  1LUZ A;  4B3S Q;  4AQY L;  4IPH A;  5M3F H;  4X6A H;  1S40 A;  2JJQ A;  3S14 H;  4DR1 L;  3S1R H;  1XJV A;  2HHH Q;  4PG3 A;  1L1O B;  1WI5 A;  3EN2 A;  2LXK A;  4LUV A;  1I94 L;  4DK3 C;  4P71 A;  2JA5 G;  2JA6 G;  4GLA C;  5IE8 A;  2CKZ B;  1PH1 A;  1UE5 A;  2R7F A;  3MXN B;  1YJN A;  2VUM H;  3TRZ A;  3A5Z B;  1IL2 A;  1OTC A;  1PH9 A;  4C3H H;  1YHA A;  1PH3 A;  2F4V L;  3GTQ H;  2WB1 E;  4IPC A;  1VQ7 A;  4A3G H;  2PQA A;  1VS0 A;  2B3G A;  1TWA H;  3OTO L;  1G51 A;  4TVA B;  1J5E Q;  1SR3 A;  2IHE A;  4MZ9 A;  1KRS A;  2IT1 A;  4DV2 Q;  1PH6 A;  1GM5 A;  1SFO H;  1IBL Q;  3UE0 A;  4DR7 L;  2JA7 G;  1Q86 C;  1XMO Q;  1Q81 C;  1N32 L;  4DV6 Q;  2B29 A;  1QVG A;  4JI6 L;  2JEA I;  4BA1 I;  2OTJ A;  4BY1 G;  4LF7 Q;  4GN4 B;  1PH7 A;  2ALY B;  4DV7 L;  3S1Q H;  1VQI A;  5AJ3 Q;  1NY4 A;  2VW9 A;  3WWV A;  4DV0 L;  1K83 H;  4GOP B;  4A3F H;  2Q2U A;  5FLX c;  2UUC Q;  2WAQ G;  4YWM A;  3L2P A;  5C4X G;  5IYD H;  5JJI A;  3M9B A;  3CC4 A;  1NBW A;  1PFS A;  4RMF A;  2R92 H;  1HNZ L;  3I4M H;  1XTD A;  2UUB L;  4DNI A;  4PZ7 A;  1CKN B;  4JOI C;  1EUJ A;  4LFA Q;  3RR5 A;  2I5L X;  2DUD A;  2L15 A;  1YJW A;  2ZM6 L;  3H0G H;  4XTC S;  3DLL A;  4O0A A;  3U4Z A;  4QGU A;  1A8V A;  3S1M H;  2K5H A;  1FGU A;  3PF5 A;  4LF6 Q;  2ZTC A;  3KDF A;  3UDI A;  1LYL A;  1Y1W G;  3J7A 5;  1EOV A;  4GLX A;  1VQO A;  3HOW H;  4JI2 Q;  4X65 Q;  4GN3 B;  3A5U A;  4LFC L;  2PQA B;  4MTN A;  4JI7 L;  3H3V I;  4DV3 Q;  1YZ6 A;  3S1N H;  4BBS H;  1YIT A;  2VQF L;  2NZO A;  1EIF A;  1N34 L;  3HOZ H;  1Y1V H;  1BKB A;  4DR6 L;  4A3D G;  1IBK L;  5C0X G;  1CKO A;  3BJU A;  3I55 A;  4DKA C;  1QUQ A;  3T1Y Q;  2EIF A;  2VZA A;  5IYD G;  5FLM H;  4IOA A;  3STB C;  2YTV A;  4GNX B;  1FJG L;  2R92 G;  1BBW A;  3JAM c;  2OTL A;  1TWC H;  3PUY A;  4P73 A;  4DUY Q;  4B3R Q;  2V1C C;  1Q1E A;  4HJ7 A;  3CCL A;  1N33 Q;  5LMN Q;  2JEB I;  3TS2 A;  2K52 A;  1SN8 A;  1VQG A;  4LF9 L;  5M5Y H;  1HH2 P;  2OCE A;  1Z9F A;  5GAG C;  2RF4 A;  1Q12 A;  4KHZ A;  4X62 L;  2MNA A;  1V9P A;  3BU2 A;  1QZH A;  1VQK A;  1QVF A;  1A0I A;  3KF6 B;  2R93 H;  4AIM A;  2K4K A;  2CWA A;  4KHP L;  1JJ2 A;  5IT9 c;  2E5L L;  3HOW G;  5C0X I;  3K7U C;  3GTG H;  3PCO B;  3E9H A;  1HZB A;  1IXR A;  4P74 A;  4UP9 A;  1VQE A;  3ERS X;  3AEV A;  4BBS G;  4L5T A;  3CCS A;  1M1K C;  3HOZ G;  2R7Z G;  1U5K A;  1VQA A;  3HKZ G;  5GAD C;  3CF5 A;  4A3B H;  1GVP A;  4Y52 H;  5IP9 H;  4YWK A;  1L0W A;  1PH5 A;  1YIJ A;  4NXN L;  1AH9 A;  1W2B A;  2KBN A;  4GLV B;  1JJG A;  1I3Q H;  1NMG A;  4LF4 Q;  2NZH A;  4LF5 L;  3KOJ A;  4ALP A;  2VNU D;  3B6Y A;  1D7Q A;  4R4T A;  1PH8 A;  3PV0 A;  3CW2 C;  1XNR L;  3NBH B;  1VQF A;  2GVB A;  2KEN A;  3DM3 A;  4H02 A;  4AH6 A;  5IWA L;  3ULJ A;  4C3J H;  4DAY B;  1X65 A;  4YCU A;  4GS3 A;  2UXC L;  5JEA J;  2Z0S A;  1V1Q A;  4X64 Q;  3HOX G;  4C3I H;  4DV1 L;  2R93 G;  3AYH B;  3L0O A;  1N9W A;  5GRO A;  1VQ6 A;  4AQY Q;  1Z47 A;  1GKH A;  2MQH A;  4DR2 Q;  3UDG A;  4DR1 Q;  4A3M H;  2HT1 A;  3HOU H;  2EQS A;  1Q82 C;  2Y0S E;  4GKJ L;  4EX5 A;  4HJ9 A;  1HNW Q;  5GAE C;  2Q2T A;  1D8L A;  5HY6 A;  4JI5 L;  3GTL H;  1BBU A;  3ULL A;  4A93 G;  2D62 A;  3AFQ A;  2UUA L;  5IP9 G;  3CCM A;  1VCI A;  4A3J H;  2CWP A;  3EBE A;  1LTL A;  4BY1 H;  2ATW A;  4IJL A;  1KXL A;  3I7F A;  4DV5 Q;  1JT8 A;  2K75 A;  4IFD I;  4DUZ L;  2OQK A;  4X66 Q;  4LUZ A;  3E9I A;  4YCV A;  2YTY A;  2UXB Q;  1VQB A;  1HR0 L;  1G29 1;  1VQ8 A;  3H3V H;  5C4X H;  4HJ5 A;  4JG2 A;  3CPW A;  1VQP A;  2E2I H;  2JA9 A;  4OWT B;  3T1H L;  1K8A C;  1GO3 E;  3CD6 A;  1JJC B;  5IYC H;  2ZTE A;  1IBM L;  3S2H H;  1E7Z A;  4JI3 Q;  3PUV A;  4JI8 Q;  1HZ9 A;  1SRO A;  4A4I A;  2DGY A;  3ULP A;  1MJE A;  3KJO A;  3RZO H;  3EIV A;  2PI2 E;  1HNX L;  1TWF H;  1B8A A;  3CC7 A;  4A3M G;  4JI4 L;  5JJL A;  3HOU G;  1X9N A;  4HIK A;  4LFB L;  3LGJ A;  1WJJ A;  5BR8 Q;  1N36 Q;  2YTX A;  3PUX A;  1Y1W H;  2KHJ A;  5M3M G;  2YU9 H;  4IPD A;  5GQO A;  3HKS A;  4C2M H;  5C3E H;  2VQE L;  3U58 A;  4A3J G;  2ID0 A;  4B3S L;  1MJC A;  1OXV A;  2D0P A;  2E8G A;  2N49 A;  4YCW A;  2RHS B;  1CKM A;  2Y0S G;  4BBR H;  4DR3 Q;  2CQO A;  4DR4 Q;  2KHI A;  4B3T L;  1QVC A;  2HHH L;  1VQM A;  4A3D H;  1A62 A;  1KD1 C;  3JAM i;  3OW2 A;  2R7D A;  4J15 A;  4JBJ A;  1Q1B A;  1L2F A;  4XIG S;  1XMQ Q;  4GKK Q;  3CCR A;  2XGT A;  5IYB G;  3S16 H;  3D0F A;  5IYC G;  4APV A;  4BY7 G;  2C35 B;  1PVO A;  1OXX K;  2BH8 A;  1ASZ A;  3TEH B;  4GN5 A;  4NXM L;  1J6Q A;  3H15 A;  2AKW B;  1J5E L;  3CXC A;  4JI7 Q;  1KL9 A;  4LFC Q;  1XPR A;  1M90 C;  2WB1 G;  1Y14 B;  4DV2 L;  2ZJR A;  1IBL L;  3AFP A;  4IPG A;  4K0K Q;  1XPO A;  3ZJY C;  2D0O A;  4KI0 A;  2NN6 I;  1IBK Q;  1XMO L;  4DV6 L;  4LF8 Q;  4LUO A;  4POG A;  3A0J A;  5C3E G;  4OX9 L;  3F2B A;  4OWW B;  3GDE A;  4LF7 L;  4JV5 Q;  4BBR G;  3J81 c;  3PO2 H;  2R7Z H;  4BXX H;  4DV4 L;  1CSP A;  4A76 A;  3KFU A;  1X3E A;  5AJ3 L;  1YBY A;  3K8A A;  4AYB E;  4B3M Q;  2A1A A;  4DAM A;  2PI2 A;  2UUC L;  3A74 A;  1LM0 A;  4X62 Q;  3AQQ A;  3W1G A;  3NEN A;  1KHI A;  3I4O A;  4P75 A;  1UE6 A;  5ELO A;  1O7I A;  1YEZ A;  4YHH L;  1PV4 A;  1VQ5 A;  1SRU A;  1NMF A;  4A3C H;  4A3L H;  4A3E H;  3CCQ A;  3RLN A;  1YHB A;  4UP8 A;  5J3B A;  3HOX H;  3VDY A;  1XPU A;  2KCM A;  3PIP A;  1EFW A;  2PNH A;  1R9T H;  3NEL A;  4L5Q A;  4IJH A;  4YY3 L;  3PSI A;  2YYZ A;  2QEX A;  1IYJ B;  4NXN Q;  1KRT A;  1VQJ A;  4A3K G;  3GTP H;  2VS1 A;  3HFZ B;  4X65 L;  3CMA A;  4JI2 L;  3W1B A;  4POF A;  3PO2 G;  4HJA A;  4LNQ A;  4BXX G;  2GN5 A;  1EWI A;  2HIV A;  3BZK A;  3UE1 A;  4DV3 L;  3S15 H;  1H95 A;  3OYY A;  3FP9 A;  4A93 H;  3RLF A;  4JYA L;  3KJP A;  3T1Y L;  1CUK A;  3D31 A;  3E0E A;  1XNQ Q;  1E22 A;  3GTK H;  1B70 B;  3PGZ A;  3KDF B;  4QY7 A;  4JCV E;  3RLO A;  5IP7 H;  5LMU L;  5M5W H;  1VQ4 A;  2Z6K A;  1KAW A;  3HOY H;  3CC2 A;  4DUY L;  4B3R L;  1L1O A;  1E1O A;  1WOC A;  1X54 A;  3J7Z C;  4BA2 I;  5LMN L;  3G4S A;  4IFD G;  1I6H H;  5IY0 A;  3CCJ A;  1VQN A;  4A3L G;  4A3E G;  4JBK A;  1SMX A;  1TXY A;  4JI0 Q;  4GKJ Q;  3GTO H;  1QUQ B;  3PIO A;  1OXU A;  1T9H A;  3FHW A;  3UDX A;  4DK6 C;  4QIW E;  1JMC A;  4TQU S;  3K81 C;  1HJP A;  2R6G A;  3TQY A;  1I94 Q;  4UPA A;  1ASY A;  4A75 A;  4Y7N H;  2E2H H;  1HR0 W;  2A8V A;  5M3M H;  4A3G G;  1YVC A;  3CAM A;  3FKI G;  3W5O A;  1EIY B;  3ICE A;  2RHQ B;  2IX1 A;  1C7Y A;  5IP7 G;  2F4V Q;  4FDB A;  1X56 A;  3OTO Q;  3HOY G;  3IRB A;  1VQL A;  4R4O A;  3CQZ H;  3G71 A;  2UU9 L;  4P72 A;  4DR5 L;  5IYB H;  4JI4 Q;  4DR7 Q;  3F2C A;  2K5N A;  3CCE A;  4ME3 A;  4BY7 H;  1N32 Q;  3S24 A;  3G48 A;  3STB D;  3TRE A;  1TWH H;  4JI6 Q;  2IY5 B;  2LSS A;  4JI1 L;  4HID A;  1PYB A;  1UE7 A;  1NE3 A;  4DR2 L;  1CKN A;  1I5F A;  1K3R A;  1DGS A;  2WAQ E;  4DV7 Q;  2UXD L;  4B3T Q;  4L5R C;  3JC6 6;  1K0R A;  1RL2 A;  4DV0 Q;  1EQR A;  2Z6K C;  3KYH C;  3J81 i;  2JA8 H;  2NVT H;  1GD7 A;  4R4C A;  2IHF A;  3I56 A;  1HNW L;  1L1O C;  3CCU A;  2BH2 A;  2JQO A;  4R1J A;  2WP8 J;  4QJF A;  3U4V A;  5JEA G;  1V43 A;  3J80 c;  1KQS A;  2XTI A;  1PH4 A;  4DV5 L;  2NN6 G;  1HNZ Q;  4A3I G;  1MKH A;  2UUB Q;  1SE8 A;  3U50 C;  3M7N A;  1G6P A;  5HGQ A;  2K50 A;  3S17 H;  4OON A;  4X66 L;  4NXM Q;  3M3Y H;  2UXB L;  2ZM6 Q;  2ASB A;  1C0A A;  2QGQ A;  1EQQ A;  5C0X J;  5EAY A;  4LWC A;  5C44 G;  3KLW A;  3UDF A;  1YJ9 A;  4HJ8 A;  3F8T A;  2VY3 A;  4JI3 L;  4JI8 L;  3PO3 H;  4PMW A;  4GNX A;  2AMC B;  2NVQ H;  5GAH C;  3KF8 B;  4OX9 Q;  1Q8K A;  1UE1 A;  2H5X A;  5M3F G;  2WFW A;  3S2D H;  1N8R C;  2VQF Q;  1N34 Q;  4DV4 Q;  4O2D A;  1P16 A;  3GD7 A;  2HQL A;  5C4J H;  3CP0 A;  4DR6 Q;  2F52 A;  2JA8 G;  5BR8 L;  1N36 L;  4OWX B;  1X55 A;  3CPF A;  3Q8D A;  4PZ8 A;  4YWL A;  1UWV A;  2VUM G;  3KF6 A;  4A3K H;  1AE3 A;  3NEM A;  2K14 A;  4GOP C;  1QZG A;  1FJG Q;  4NB3 A;  1VQ9 A;  1MIU A;  1OXS C;  1X6O A;  4DR3 L;  4DR4 L;  4L5S A;  2JK8 A;  3HOV H;  4YHH Q;  2CCZ A;  1E1T A;  3RZD H;  1S3O A;  4LF9 Q;  1Q46 A;  1SLJ A;  2AWN A;  2AWO A;  3PUZ A;  1CSQ A;  2ES2 A;  1B7Y B;  1XMQ L;  4GKK L;  2MFI A;  3GO5 A;  1YHQ A;  1RIP A;  1PYS B;  4YY3 Q;  2NVY H;  3I4N H;  3PO3 G;  1WFQ A;  3RN2 A;  4KHP Q;  3MEF A;  1WYD A;  3HKZ E;  2E5L Q;  4LFA L;  1KC8 C;  1JB7 A;  1TWG H;  3K80 C;  2B63 H;  4HIO A;  1Q7Y C;  2KCT A;  3GTM H;  4IFD J;  4K0K L;  1NJI C;  4LF6 L;  1VQH A;  4JYA Q;  2Q2I A;  4A3F G;  1X3F A;  3M85 A;  1PH2 A;  4LF8 L;  2QA4 A;  1K73 C;  4PZ6 A;  5ELN A;  5JJK A;  1PA6 A;  3GTJ H;  1YNX A;  3TS0 A;  2FXQ A;  5LMU Q;  2GVA A;  4LF5 Q;  4JV5 L;  1FVI A;  2Q2H A;  2E2J H;  1C9O A;  2BA1 A;  2OWO A;  1K8G A;  3I4M G;  1NTG A;  2F3I A;  1E24 A;  4OXP A;  1XNR Q;  3HOV G;  5LMN W;  4JBM A;  3K7A H;  3PUW A;  3K0X A;  3F2D A;  4GNX C;  4B3M L;  3FKI H;  5IWA Q;  5K36 G;  4WJ3 M;  2LXJ A;  3H0G G;  4UP7 A;  1KIX A;  2I5H A;  5H1S E;  1WCM H;  2UXC Q;  3ER0 A;  4NPS A;  3J81 j;  4WJ4 A;  4AYB G;  4DV1 Q;  3M4O H;  2BA0 A;  2A19 A;  3I4N G;  4OO1 G;  1N33 L;  1E3P A;  2MO0 A;  2VL6 A;  4QL5 A;  5M5X H;  4JC0 A;  5FJ8 H;  3M4P A;  1X3G A;  2B63 G;  1AE2 A;  4A3C G;  2EXD A;  2HIX A;  1OXT A;  1PHJ A;  2I5M X;  2ZJQ A;  3G6E A;  2K5V A;  2ZJP A;  4JI5 Q;  1W3S A;  1Y1V G;  4KLK A;  1FL0 A;  4EQ5 A;  1EYG A;  2UUA Q;  3PF4 A;  3F1Z A;  3I2Z A;  4QQB X;  4LW1 A;  2MO1 A;  2PMZ E;  4UY8 C;  1YI2 A;  1HZC A;  5FLM G;  4IO9 A;  2ZTD A;  4R4Q A;  3J80 i;  2N8N A;  4DUZ Q;  1K9M C;  2N3S A;  4DPG A; 
#chains in the Genus database with same CATH topology
 2JA5 H;  1JE5 A;  4IOC A;  1STY A;  1KDC A;  4NW2 A;  4R8I A;  4RGT A;  1CHQ D;  5NUC A;  2D9U A;  3PO3 B;  1PXU A;  3R93 A;  1IBM Q;  1U0L A;  2QF7 A;  5E7N A;  2I0Q A;  5M9O A;  3RNU A;  3L7Z C;  1VQD A;  2EY5 A;  2Z1C A;  1SNP A;  1O80 A;  4JBW A;  1I50 H;  1HNX Q;  5T1G A;  2RCN A;  1NSN S;  2UXD Q;  4A3F B;  4JI0 L;  4LFB Q;  2F0F A;  3QJY A;  1K8O A;  4X64 L;  3CCV A;  2A5H A;  3TP6 A;  3NQT A;  4JOI A;  3OHX C;  4MNO A;  4LJZ C;  3SGI A;  4DXF A;  1DD2 A;  1B2T A;  1TY0 A;  3T51 B;  1S40 A;  1L1O B;  1WI5 A;  2I07 B;  2LXK A;  4LUV A;  2JA6 G;  4H13 C;  4DK0 A;  5IE8 A;  4KV6 A;  3H0G B;  3S9W A;  1SE3 A;  1UE5 A;  1G8Z D;  3DWP A;  5CV9 A;  1CM9 A;  3K5O A;  3EFX D;  1PH3 A;  1UAP A;  2WB1 E;  4IPC A;  4XDX A;  1GHK A;  5J39 A;  1VS0 A;  4TVA B;  1J5E Q;  1SR3 A;  3S1N B;  3IAY A;  3HEJ A;  4DV2 Q;  1YNN D;  4DU9 A;  2DNE A;  1Y1V B;  2JA7 G;  1PTO B;  1Q90 A;  2F0M A;  3VR5 A;  2V4D A;  2DY7 A;  3QOJ A;  4R9W A;  4C1N I;  2NTS A;  1TS5 A;  2PW7 A;  4FYD A;  1CZG A;  2KHS A;  3WWV A;  4LAA A;  5CV6 A;  3A7L A;  5IYD H;  5C4X G;  1DOL A;  2FHT A;  1BCP C;  4RMF A;  2R92 H;  3I4M H;  1SMY D;  2EYJ A;  1CKN B;  4P2C B;  4KHV A;  4LFA Q;  1EUJ A;  2E75 C;  2I5L X;  4CJ1 B;  1YJW A;  2XNA C;  2ZM6 L;  1STN A;  4QGU A;  4TSS A;  1Z6H A;  4OO1 H;  1LYL A;  2L11 A;  3E0J A;  1I3Q B;  1H9K A;  3D4R A;  4X65 Q;  2F3V A;  4A3C H;  3A5U A;  1YIT A;  1EYA A;  3HOZ H;  4DR6 L;  1IBK L;  4C3J B;  4DKA C;  1QUQ A;  1U4R A;  1Q3L A;  4IOA A;  2YTV A;  2QEJ C;  4OGQ C;  1PDQ A;  4GNX B;  2ENB A;  3JAM c;  1SEB D;  1F2Y A;  1H9J A;  4P73 A;  3NXW A;  1KDB A;  4N9P A;  1KTK A;  2B39 A;  4HJ7 A;  3CCL A;  1HRJ A;  2VXW A;  1VQG A;  5GAG C;  2RF4 A;  1SJH D;  2MNA A;  1IW7 D;  3C2P A;  5JPN C;  1QVF A;  1VQK A;  3I90 A;  2CWA A;  5IT9 c;  2E5L L;  3HOW G;  2RBM A;  2X69 A;  5EKI A;  2XWJ B;  1HZB A;  1CFM A;  1Y8O B;  3EVQ A;  1KAA A;  3X3M A;  4BBS G;  3CCS A;  4HN7 A;  1M1K C;  4M8A A;  1GVP A;  1S4Z A;  4CGY B;  3H3V C;  2E2I B;  1PH5 A;  1YIJ A;  1RKN A;  1AH9 A;  2AQ1 B;  4GLV B;  2RDF A;  4K2L A;  5IGF A;  5G3L F;  2NZH A;  3HGB A;  3N52 A;  1CQF A;  3B6Y A;  3TME A;  3D4D A;  2ICE C;  3RZO B;  3A7A B;  3CW2 C;  3PV0 A;  5J22 A;  4H02 A;  3X3N A;  2PO4 A;  4G4K A;  2JN4 A;  4RFB A;  4DAY B;  1B3A A;  4N9T A;  2UXC L;  2Z0S A;  4X64 Q;  3HOX G;  4G7H C;  2CH4 A;  4C3I H;  1Y1W B;  1HTL D;  4DV1 L;  4DAV A;  4UAI A;  1N9W A;  1PFN A;  5GRO A;  1VQ6 A;  2KCN A;  4A3D B;  1DJR D;  2B2U C;  4GKJ L;  2D62 A;  3AFQ A;  4A3J H;  3CCM A;  1KLG D;  1KXL A;  1JT8 A;  4IAL A;  4U68 A;  2WV6 D;  4TKO B;  2TMP A;  4HSV A;  1ENA A;  4X66 Q;  1IKM A;  1HR0 L;  1VQ8 A;  1G29 1;  3H3V H;  5C4X H;  3S1M B;  4C3J G;  3CPW A;  1JB3 A;  3OMG A;  1JJC B;  5IYC H;  1ENC A;  2ZTE A;  3J7A F;  4A4I A;  3HG9 A;  3ULP A;  1D6E C;  1IYV A;  1EQV A;  4JI4 L;  4A3M G;  1QWY A;  1X9N A;  5BR8 Q;  5FO8 B;  1V1P A;  4IPD A;  4NP5 A;  5C3E H;  2F0W A;  4B3S L;  1PFM A;  2B2Y C;  3ONA B;  2RHS B;  4RGM A;  4BBR H;  2CQO A;  1RTO A;  1EY7 A;  2KHI A;  4B3T L;  1RJT A;  2E74 C;  1K28 A;  5IGC A;  3OW2 A;  3BYY B;  2B2W C;  2XGT A;  4APV A;  2F3W A;  1OXX K;  2BH8 A;  5C3W A;  1LT3 D;  1M4V A;  3TEH B;  3SVM A;  3BS1 A;  4NXM L;  4HCS A;  1PTO C;  3HRZ C;  2WB1 G;  3IKJ A;  2EYO A;  3AFP A;  1LTA D;  2MPM A;  1O7Z A;  2D0O A;  1IBK Q;  1XMO L;  2K04 A;  4LUO A;  1SXT A;  3GDE A;  4LF7 L;  2PMZ B;  1XWE A;  3J81 L;  3PQI A;  4DV4 L;  1G6Z A;  1GXD C;  4B3M Q;  4K5V A;  1W6K A;  2PI2 A;  1SDF A;  4IZ8 A;  4KTA A;  3AQQ A;  4I65 A;  1AW7 A;  3JAM L;  1AEX A;  5ELO A;  2EE1 A;  4IFD H;  1SRU A;  2F0G A;  3HOU B;  4U67 3;  2K28 A;  2E2H B;  3RLN A;  4UP8 A;  5J3B A;  3HOX H;  1XPU A;  5COY A;  3PIP A;  4Z9C B;  1EFW A;  4RH6 A;  4KY7 A;  3NEL A;  4IJH A;  1SSO A;  1R4Q B;  1D5X C;  1IYJ B;  1QNU A;  3P1H A;  1PRT D;  3FEW X;  3V96 A;  4A3K G;  4QUF A;  1WD1 A;  1C8C A;  4LNQ A;  5KYL A;  4BXX G;  3BZK A;  3FP9 A;  4JYA L;  3NE5 B;  4CDE C;  3D31 A;  1SJE D;  3GTK H;  1XNQ Q;  1B70 B;  3RLO A;  4QY7 A;  2KQ3 A;  4JCV E;  3EJI A;  1TWH B;  1U4P A;  3QWN A;  1PMR A;  3BZD B;  3CC2 A;  5IIF A;  1WOC A;  3CCJ A;  4HED A;  1TS2 A;  4GKJ Q;  4WFN 3;  1QUQ B;  1W6J A;  3DWA A;  2AQ2 B;  4KN7 C;  4KD4 A;  3FHW A;  2L9H A;  3MEH A;  4X3S A;  4TQU S;  3SK8 A;  1SYD A;  3S17 B;  2R6G A;  1ASY A;  2FMC A;  4Y7N H;  1HR0 W;  1MBY A;  1X3Q A;  2F1M A;  2EJG C;  2RHQ B;  3PMF A;  3VA5 A;  3AU7 A;  1DZ1 A;  3NPP A;  5IGG A;  2J4X A;  5EQ0 A;  3HOY G;  2K1B A;  3CQZ H;  5KIX A;  3BVG A;  3S2D B;  1I6V C;  5D3D A;  3M7G A;  3QOL A;  3QB3 A;  4JI4 Q;  2Q8I B;  2K33 A;  1B3Q A;  1UNS A;  3TBI B;  4CDF C;  1N32 Q;  3G48 A;  3STB D;  4JI6 Q;  1ET9 A;  2IY5 B;  2J7Z A;  4JI1 L;  4HID A;  1WTR A;  1UE7 A;  1IYU A;  4DR2 L;  1DGS A;  4OIK A;  2R61 A;  4B3T Q;  1E0B A;  3JC6 6;  4MIU A;  4DV0 Q;  2Z6K C;  3KYH C;  4XT3 B;  3TSS A;  3MZ5 A;  1EEF D;  2WP8 J;  3NTK A;  5CV8 A;  5JEA G;  1V43 A;  3J80 c;  2XTI A;  4MN3 A;  4A3I G;  1SE8 A;  3T56 B;  3M7N A;  1ICF B;  2PZU A;  1TWG B;  4OON A;  4NXM Q;  4A3E B;  2SNM A;  1A2T A;  2XVS A;  2QGQ A;  1EQQ A;  5C0X J;  5BN4 A;  4LWC A;  5LHY 1;  1PRT F;  3F8T A;  2VY3 A;  4JI8 L;  4DF7 A;  1NNX A;  1MHW C;  2E2J B;  3S15 B;  1TVX A;  3MTS A;  5HGT A;  4DV4 Q;  4FXD A;  5C4J H;  3FKI B;  3OMC A;  2HDM A;  4A3K H;  3NEM A;  1CZW A;  1VQ9 A;  1MIU A;  1OXS C;  3IFT A;  1SYC A;  2IPK D;  3BVZ A;  3RZD H;  1SLJ A;  1XMQ L;  1K0S A;  1V1P B;  3FMC A;  2OXP A;  3HKZ E;  2PPB C;  2RCF A;  3KLS A;  1JB7 A;  5FO9 B;  2Z4H A;  2FJ2 A;  3GTM H;  4DXG A;  3KLR A;  3T53 B;  4LF6 L;  1VQH A;  2QKI C;  1QG7 A;  2Q2I A;  4JYA Q;  3UI2 A;  1K73 C;  5JJK A;  3E5S A;  5IGD A;  3GTJ H;  4DFA A;  2GVA A;  4LF5 Q;  1I50 B;  2EPB A;  3K7A H;  3K0X A;  3F2D A;  3NUC A;  5IWA Q;  2G9D A;  2ZXO A;  1BO0 A;  3BG3 A;  1WCM H;  3ER0 A;  2DN8 A;  1OO9 B;  2BCO A;  3J81 j;  4XYO A;  4WJ4 A;  2BA0 A;  2A19 A;  3DM1 A;  3I4N G;  1E3P A;  2MO0 A;  4WOR A;  2I5M X;  4IUN A;  2K5V A;  4JI5 Q;  4KLK A;  1FL0 A;  1EYG A;  1SNO A;  2UUA Q;  4ID6 A;  3I2Z A;  4QQB X;  2IJ0 A;  2MO1 A;  5C5M A;  1EIG A;  2ZTD A;  2N8N A;  4DUZ Q;  1K9M C;  2N3S A;  3NTH A;  2NVX H;  5JEA H;  4V19 0;  4ULL A;  3CME A;  1F2M A;  3BZC A;  3NBI A;  4J6H A;  1VQC A;  4A3I H;  3W3A A;  5I6Y A;  3G7L A;  2NVQ B;  2EVB A;  3D6C A;  4JI1 Q;  4DK1 A;  3QG1 A;  1B50 A;  1BVS A;  2WIN B;  4R4I A;  3SK4 A;  4XQJ A;  4JK1 C;  2M9V A;  3G6J B;  1X32 A;  2VQE Q;  5D3I B;  4X6A H;  4JW0 A;  3I4M B;  3S14 H;  4DR1 L;  3HOV B;  2A68 D;  3S1R H;  3MHB A;  1XJV A;  4PG3 A;  2EJF C;  3S1Q H;  1R4P B;  1I94 L;  2JA5 G;  4DK3 C;  3C46 A;  4GLA C;  1PH1 A;  3MXN B;  2R7F A;  4ZYS A;  5CBE E;  5LL6 X;  2G9H D;  4ZAI A;  4AYB B;  3J80 L;  4C3H H;  4IUR A;  1YHA A;  2NVY B;  3OTO L;  1G51 A;  1HA5 A;  2IHE A;  5KNB A;  3K5L A;  1GM5 A;  4DR7 L;  1Q86 C;  5I4D A;  4DV6 Q;  2B29 A;  1BOS A;  2OTJ A;  1D1I A;  2CH4 W;  4RCN A;  4K14 A;  4EGV A;  5KGU A;  2ALY B;  4DV7 L;  2F0N A;  4RHS A;  1NY4 A;  2VW9 A;  1K83 H;  4GOP B;  1QOH A;  1LLR D;  3HZX A;  1KNA A;  3I70 A;  3L2P A;  2R3Z A;  3FVQ A;  5FLX L;  1UUP A;  1WTX A;  1PFS A;  1D1K A;  1JWM D;  1XTD A;  2TSS A;  4PZ7 A;  4XTC S;  1HQR D;  4O0A A;  1AZP A;  1A8V A;  5A2Q E;  2A73 B;  1FGU A;  2CVR A;  5I2X A;  4LF6 Q;  2ZTC A;  3UDI A;  4I7A A;  1WVL A;  4GLX A;  3H91 A;  1LO5 D;  5ELB A;  4LFC L;  4V0B A;  4OEM B;  1YZ6 A;  4DV3 Q;  1JCK B;  2JXM B;  1N34 L;  3BDL A;  1AP0 A;  1BQQ T;  3BJU A;  5IYD G;  4L8J A;  2R92 G;  2OTL A;  1ROD A;  4DUY Q;  1Q1E A;  2JEB I;  3TS2 A;  3GV3 A;  2HQE A;  1NCV A;  5M5Y H;  1HH2 P;  1Z9F A;  3MXU A;  3N6R A;  1WTP A;  1QZH A;  1ZKO A;  5DM7 3;  4KKS A;  4AIM A;  2K03 A;  2K4K A;  4KHP L;  5C0X I;  3GTG H;  2Z9H A;  1IXR A;  4H44 C;  1CA6 A;  3A56 A;  3OWF A;  3VYT A;  4O1N A;  3HOZ G;  1NAP A;  1NR4 A;  2K01 A;  3HKZ G;  5GAD C;  5C4X B;  1SAP A;  4CKE A;  4RA8 A;  4Y52 H;  1U4L A;  2LS0 1;  3GTQ B;  1HXY D;  1ESR A;  1DCZ A;  1PZI D;  1NMG A;  1G2T A;  3KOJ A;  2VNU D;  1D7Q A;  1BR9 A;  1XNR L;  1RDP D;  2GVB A;  1SFO B;  4FF3 A;  1X65 A;  3AB9 A;  4YCU A;  4RWS C;  1GUT A;  1V1Q A;  1I4R A;  3I91 A;  1SE2 A;  2MUY A;  1A3V A;  3AYH B;  5ELC A;  4XQQ A;  4DR1 Q;  4DA2 A;  2KEE A;  1S5E D;  4EX5 A;  4PQX A;  1D8L A;  1BBU A;  2EOT A;  1VCI A;  2CWP A;  4IJL A;  1ONL A;  3I7F A;  4PNY A;  5C3X A;  1KDA A;  1PFB A;  3VR4 A;  2OQK A;  2ZXP A;  3E9I A;  2YTY A;  1SNM A;  1VQB A;  1XX8 A;  3Q6S A;  4QMG A;  4OWT B;  3T1H L;  1GO3 E;  3TZU A;  1HCZ A;  4C3I G;  3HOW B;  2RA4 A;  5G3L D;  4KKU A;  2AQ3 B;  1MJE A;  1YNJ C;  3EIV A;  4BBS B;  1IL8 A;  1B8A A;  3CC7 A;  5JJL A;  1C4Q A;  1WJJ A;  3TP7 A;  1EU3 A;  3PUX A;  1MSG A;  5C4Z A;  5GQO A;  1JOQ A;  4A3J G;  1GUW A;  5ELD A;  4XQN A;  1OXV A;  2D0P A;  4YCW A;  1TWC B;  1CKM A;  2Y0S G;  3MXG A;  2MJ8 A;  3SK6 A;  4DR3 Q;  1EY4 A;  1ZYR D;  2HHH L;  1EYD A;  2ZXR A;  3K59 A;  3JAM i;  4NDX A;  4FF1 A;  3T16 A;  2CW0 C;  4I7Z C;  3HOX B;  3CCR A;  5IYB G;  3S16 H;  4L63 B;  5IYC G;  4BY7 G;  3RUZ A;  1ASZ A;  2AKW B;  3CXC A;  4LFC Q;  1Z7T A;  2ZJR A;  1IBL L;  4K0K Q;  1D5Z C;  4CHT B;  2ZT9 C;  4LF8 Q;  3GTK B;  1JWS D;  4ME5 A;  5C3E G;  4OX9 L;  1Y69 U;  3HS0 C;  4JV5 Q;  4BBR G;  3J81 c;  3PO2 H;  2M2L A;  4K2K A;  1CSP A;  3CKI B;  5AJ3 L;  3K8A A;  4DAM A;  1S5C D;  2UUC L;  1F9R A;  4UHV A;  1KHI A;  4P75 A;  3NSW A;  3IL8 A;  2OF1 A;  1O7I A;  3QR8 A;  4YHH L;  4A3M B;  1RF2 D;  1NMF A;  1VQ5 A;  2KUM A;  3BDO A;  3CCQ A;  3GTL B;  1YHB A;  3VDY A;  5T1I A;  2PNH A;  5IOC A;  3NP8 A;  4L5Q A;  4YY3 L;  3PSI A;  4ZQ3 A;  2YYZ A;  1KRT A;  3CRK C;  1II3 A;  2VS1 A;  4JI2 L;  3CRL C;  3CMA A;  4POF A;  1V1O A;  3UE1 A;  1H95 A;  4QUC A;  5JVH 3;  2F0L A;  1VDZ A;  1YNN C;  3H94 A;  4CKC A;  3T1Y L;  1PZK D;  1CUK A;  1CTM A;  3S2H B;  1STG A;  3PGZ A;  5IP7 H;  4B3R L;  5DAU A;  1B9M A;  2WB1 B;  1I6H H;  4BA2 I;  4IFD G;  5LMN L;  4WRD A;  1AZQ A;  1LT6 D;  4JBK A;  1TXY A;  4JI0 Q;  3LX0 A;  2OT2 A;  2YU9 B;  4H7B A;  4C2M B;  5IT9 E;  1T9H A;  4TRD A;  4FVM A;  1SMY C;  1L0Y B;  4C1N K;  1HJP A;  5K5P A;  2A8V A;  1A6X A;  4K8I A;  4X3K A;  4A3G G;  3W5O A;  2NN6 H;  3LWU A;  1STA A;  1C48 A;  3G71 A;  1TS4 A;  3P7J A;  1RCV D;  1K8M A;  1PRT B;  2F0P A;  4IUP A;  3VR3 A;  4BS9 A;  4DGZ A;  5IYB H;  5C4J B;  3CCE A;  2B8F A;  4ME3 A;  4BY7 H;  2NTT A;  2A6E D;  3IFD A;  4A3K B;  1BUV T;  3SR1 A;  1KAB A;  2FFK B;  4CJ0 B;  2RSO A;  2WAQ E;  2VB3 X;  4FXK C;  4L5R C;  2A6H D;  3RZD B;  4EQP A;  2NVT H;  2JA8 H;  3DMU A;  3L9A X;  1NUC A;  1GD7 A;  1HNW L;  2IHF A;  1L1O C;  2B2T A;  2JQO A;  4QJF A;  2NZ1 D;  4DV5 L;  1MKH A;  5I9O A;  1EIH A;  5HGQ A;  4G7Z C;  2N55 A;  1JIC A;  1E2W A;  2F0V A;  2KEC A;  2UXB L;  2ZM6 Q;  1S5B D;  2A69 D;  2ASB A;  3GTM B;  4X3U A;  4FNF A;  5CMD A;  1YJ9 A;  4HMJ A;  4JI3 L;  3PO3 H;  5E4W C;  3I8Z A;  5GAH C;  3GTJ B;  3KF8 B;  4OX9 Q;  1K3B C;  1UE1 A;  3NQI A;  2WFW A;  1UEA B;  2K05 A;  3OWE B;  2LFN A;  3HP3 A;  4DR6 Q;  3CP0 A;  1JOK A;  4PMC A;  1N36 L;  4OWX B;  3DUZ A;  4YWL A;  4K5W A;  1WCM B;  5COR A;  2L1B A;  3HOY B;  4NB3 A;  1IHZ A;  4DR4 L;  4L5S A;  2JK8 A;  4YHH Q;  2CCZ A;  5I2Y A;  1E1T A;  1S3O A;  2AWO A;  1SYF A;  4ZUJ A;  2LY7 A;  2ES2 A;  1B7Y B;  1TQO A;  4GKK L;  3GO5 A;  3WDN A;  1RIP A;  1PYS B;  4YY3 Q;  3H09 A;  3DEO A;  2E5L Q;  1BXT A;  4KKT A;  5LL6 S;  1KC8 C;  4WJW A;  3GP7 A;  4HIO A;  1Q7Y C;  3Q23 A;  4IFD J;  2NVX B;  4IUV A;  1PTO H;  4A3I B;  2K5D A;  1NTG A;  2F3I A;  4OXP A;  4A3G H;  5LMN W;  3PUW A;  3TP5 A;  4GNX C;  1FNU A;  4E6I A;  2JSO A;  2F0U A;  1XYI A;  4UP7 A;  2UXC Q;  1A2U A;  1H9M A;  4DV1 Q;  3O13 A;  2D2C C;  2VL6 A;  4QL5 A;  1LAC A;  5M5X H;  3S1R B;  3Q22 A;  5FJ8 H;  3S1Q B;  1I4H A;  3MXN A;  4OHJ A;  2HIX A;  3G6E A;  3URY A;  2ZJP A;  1QB5 D;  3QIA A;  4Q0F A;  3E6Z X;  4LW1 A;  3DXJ C;  3J80 i;  3EQL C;  1WTH A;  5EPJ A;  4DPG A;  3M3Y B;  4ZKB B;  5FK9 C;  2BDO A;  1CQV A;  1I4G A;  2JE6 I;  1UEB A;  1HR0 Q;  2AHO B;  4OO1 I;  1IKL A;  4IUQ A;  1WCM G;  1AN8 A;  1FR3 A;  5CV5 A;  1HPC A;  3RN5 A;  1IZ6 A;  2IX0 A;  1A63 A;  2YV5 A;  4GOP A;  2N78 A;  4HIM A;  1CA5 A;  4MTK A;  1K83 B;  3MVV A;  4XXE A;  4A3B G;  1LUZ A;  1LT4 D;  1S5F D;  4B3S Q;  1LTT D;  3F2U A;  1D2B A;  3FRP B;  4ZRZ A;  3R2I A;  1JQY D;  4EQO A;  3A5Z B;  1IL2 A;  3I72 A;  3TN2 A;  1OTC A;  1PH9 A;  2EDG A;  3I4N B;  2F4V L;  1VQ7 A;  2B3G A;  1KRS A;  2IT1 A;  2O4X A;  5C4H A;  3D6W A;  3LNN A;  3C3L A;  4J1M A;  5EKK A;  3MC0 B;  1O78 A;  1XMO Q;  1EL0 A;  2JEA I;  5KEE A;  4BY1 G;  2LKV A;  4LF7 Q;  4GN4 B;  3V2T A;  2XRS D;  3VR6 A;  4B08 A;  5C0X H;  2Q2U A;  5M5Y B;  5FLX c;  2WAQ G;  4OIJ A;  5E1F A;  3M9B A;  3M4O B;  1NBW A;  4C3H G;  1HNZ L;  2C9O A;  2UUB L;  1DM0 B;  4JOI C;  3RR5 A;  3GTG B;  2DUD A;  3DLL A;  3A8I E;  3U4Z A;  3OOC A;  3S1M H;  5JAV A;  2CQA A;  2NBF A;  4RGO S;  2JA5 B;  4JI7 L;  3H3V I;  3A8J E;  2PQA B;  1VMC A;  2Z6B A;  2VQF L;  1LTG D;  1EIF A;  4CDC C;  1CKO A;  1HQM C;  3I73 A;  1LAB A;  1EOT A;  2QDB A;  2VZA A;  4K8J A;  3STB C;  2B2U A;  1FJG L;  3PUY A;  1O7L A;  2K52 A;  4LF9 L;  1Q12 A;  4KHZ A;  4X62 L;  1V9P A;  2MP1 A;  3BU2 A;  4OL7 A;  3KK7 A;  1A0I A;  4CKB A;  2R93 H;  1ILP A;  4IN3 A;  1TY2 A;  2NB0 A;  3E9H A;  1A3U A;  4P74 A;  4UP9 A;  3AEV A;  4L5T A;  2R7Z G;  1VQA A;  2L5T A;  4A3B H;  3CF5 A;  3TDQ A;  1VF7 A;  5IP9 H;  1TU2 B;  1L0W A;  5C6A A;  1W2B A;  1QNK A;  4RKB A;  4ALP A;  1EZ8 A;  4R4T A;  3RD4 A;  1PH8 A;  2Z8L A;  5J1Z A;  1VQF A;  3DM3 A;  3U9O A;  4AH6 A;  1V8Q A;  1WTV A;  1WTQ A;  5JEA J;  3NHH A;  4DR2 Q;  1GKH A;  2MQH A;  2IW3 A;  5EPL A;  2HT1 A;  3GQB A;  3HOU H;  2Y0S E;  5GAE C;  4ZUI A;  4A93 G;  4MHE A;  3EBE A;  4BY1 H;  1LTL A;  3S16 B;  2R92 B;  4DAP A;  2K75 A;  4IFD I;  4M1U B;  1AFP A;  4EQN A;  4LUZ A;  1LTB D;  2MGS A;  4HJ5 A;  4K5X A;  1I4X A;  4PV1 C;  5EKL A;  4QCL A;  2AUJ D;  3CD6 A;  3ZYY X;  1IBM L;  3PUV A;  4JI8 Q;  3KBX A;  1HZ9 A;  2DGY A;  2BE5 C;  1TS3 A;  3K58 A;  2HUG A;  3HOZ B;  1HNX L;  3HKZ B;  1TWF H;  5KND A;  4LMQ D;  4HIK A;  4LFB L;  3LGJ A;  1EFI D;  5FO7 B;  5M3M G;  3D3R A;  1MJC A;  2RKS A;  2L12 A;  2I46 A;  1VQM A;  4IQZ A;  4K6D A;  1A62 A;  1KD1 C;  1BCP B;  1E2V A;  4J15 A;  1XMQ Q;  5F2D A;  2DY8 A;  2L0C A;  1J6Q A;  3H15 A;  1J5E L;  4JI7 Q;  1KL9 A;  1XPR A;  1EY8 A;  1Y14 B;  2PZT A;  3H6M A;  5EGT A;  4DV2 L;  4IPG A;  1EY9 A;  1F2Z A;  1XPO A;  2PNR C;  4CJ2 C;  2H4O A;  4KI0 A;  2KA7 A;  4POG A;  3F2B A;  2R7Z H;  3KFU A;  2H1E A;  1X3E A;  1I6H B;  1YBY A;  2A1A A;  2F4I A;  1LM0 A;  4C3I B;  5BN3 A;  4X62 Q;  3I4O A;  2KOL A;  2A68 C;  1PV4 A;  1VMP A;  3K6O A;  3ERQ A;  1EZ6 A;  2XIW A;  4A3L H;  3WOF A;  4A3E H;  2E76 C;  2SOB A;  2KCM A;  4A3J B;  1GHJ A;  1R9T H;  5JPM C;  2Y0S B;  2F0D A;  5E4X A;  3GTP H;  1EY0 A;  4X65 L;  5CR3 A;  3PO2 G;  3VYS A;  1EWI A;  3S15 H;  1YNJ D;  4X3T A;  4ZLT F;  3OYY A;  4A93 H;  3R2T A;  2F0I A;  4BY7 B;  3ND8 A;  4HAE A;  5BN5 A;  5M5W H;  1LT5 D;  2Z6K A;  3FPU B;  1KAW A;  3D4W A;  1E1O A;  1B44 D;  3G4S A;  5IY0 A;  4ABN A;  2EYM A;  2NVT B;  3GTO H;  5C3E B;  1BCP D;  3PIO A;  1FGB D;  4BBR B;  3UDX A;  4QIW E;  3DEP A;  1I94 Q;  2F03 A;  2PYK A;  1F9P A;  5M3M H;  1YVC A;  3CAM A;  3ICE A;  5L37 A;  2IX1 A;  2K5W A;  3R3O A;  4FF2 A;  3KF8 A;  5IP7 G;  4FDB A;  5DEH A;  2HDL A;  3OTO Q;  1QE6 A;  2UU9 L;  4P72 A;  3I4L A;  4DR5 L;  4DR7 Q;  1RD9 D;  3F2C A;  2K5N A;  1H9S A;  1GUG A;  3TRE A;  5DM6 3;  2Q8R E;  1PYB A;  1NE3 A;  1F77 A;  4DNT B;  3A8K E;  1K3R A;  4DV7 Q;  2RSN A;  1RL2 A;  1EQR A;  2EXZ A;  3J81 i;  5EJW A;  4H0L C;  3CCU A;  2WAC A;  2BH2 A;  4R1J A;  3MXP A;  2OEO A;  1PH4 A;  2NN6 G;  2SEB D;  5EBD A;  3U50 C;  2K50 A;  1KLU D;  4X66 L;  1JOR A;  1C0A A;  5EAY A;  5C44 G;  2WII B;  4RCO A;  3KLW A;  3P75 A;  1STE A;  4PMW A;  2NVQ H;  3TP8 A;  5FOB B;  5A2Q L;  5M3F G;  3M4Y A;  1ZXT A;  4KJN A;  1N34 Q;  4A3G B;  4O2D A;  1P16 A;  2HQL A;  2F52 A;  3E3X A;  5EPK A;  5BR8 L;  2JA8 G;  1HUM A;  1X55 A;  3CPF A;  1E2Z A;  2KJX A;  2VUM G;  3KF6 A;  1AE3 A;  1JE4 A;  2EYP A;  2HCC A;  3RMH A;  4L6T B;  2XN9 C;  4GOP C;  4DN4 M;  4S3S A;  1X6O A;  1A15 A;  3HOV H;  5M5X B;  1PYW D;  1Q46 A;  1EWC A;  1BCP F;  2MFI A;  4N8F A;  2NVY H;  3PO3 G;  4KHP Q;  1WFQ A;  1SBB B;  1WYD A;  3NBH A;  4Y7N B;  2B63 H;  2B8G A;  2G5D A;  3A55 A;  3DHQ A;  4QIW B;  4XT1 B;  1NJI C;  2IL8 A;  4A3F G;  1FNW A;  1X3F A;  3M85 A;  5CV4 A;  3J81 E;  4PZ6 A;  1B4O A;  1EY5 A;  4BWG B;  1PA6 A;  2FXQ A;  1SYE A;  3CQZ B;  1C9O A;  2BA1 A;  2OWO A;  1XNR Q;  1NR2 A;  4JBM A;  1U4M A;  4B3M L;  5K36 G;  2KCC A;  4WJ3 M;  3JAM E;  2LXJ A;  3H0G G;  1KIX A;  4NPS A;  1HFG A;  1HHV A;  5D65 A;  2Q8T A;  4Q5V A;  2PZW A;  5KRU A;  1N33 L;  5HUR A;  4DNR B;  1JOO A;  1ZYR C;  2N88 A;  4JC0 A;  3BYT B;  1PHJ A;  1Y1V G;  5JOB A;  1VF5 C;  2DJG C;  3F1Z A;  3NK9 A;  2PMZ E;  4UY8 C;  1YI2 A;  1HZC A;  5FLM G;  4R4Q A;  3V05 A;  5EBC A;  1L0X B;  1PTO D;  2X6L A;  2JA6 H;  1SYB A;  2K5Q A;  5DLQ E;  3SK5 A;  3VYU A;  2UU9 Q;  4DR5 Q;  2RDG A;  3T1H Q;  3M4Q A;  1XNQ L;  5CV7 A;  4JPB W;  4LF4 L;  5JVG 3;  1O7Y A;  3MAQ A;  1HZA A;  2EYL A;  1EY6 A;  4IUT A;  2PW5 A;  3SHL A;  1S72 A;  2OQ0 A;  2CFM A;  5FJ8 G;  5C44 H;  2JYO A;  3FDT A;  2DNC A;  4XYQ A;  1SE4 A;  2JA7 H;  2BDN A;  1P8L A;  2F0O A;  4RG1 A;  2IX3 A;  3C1F A;  1FD7 D;  4AQY L;  4IPH A;  5M3F H;  2JJQ A;  1B9N A;  2QDL A;  2HHH Q;  3EN2 A;  3LWE A;  4P71 A;  2CKZ B;  3BVM A;  1IW7 C;  2VUM H;  1YJN A;  1DON A;  3TRZ A;  4CDD C;  3AMU A;  1CT1 D;  3J7A V;  5IGB A;  3GTQ H;  2PQA A;  1TWA H;  2EYH A;  4MZ9 A;  2JP1 A;  3NWS A;  3MA2 B;  1PH6 A;  1HTP A;  1SFO H;  1IBL Q;  4NKL A;  3UE0 A;  1N32 L;  1Q81 C;  1QVG A;  4JI6 L;  1ET6 A;  4BA1 I;  3Q0A A;  3T4A C;  1F9Q A;  1PH7 A;  1DXM A;  3K7A B;  2F0H A;  1VQI A;  5AJ3 Q;  1WTO A;  1JR0 D;  4DV0 L;  4A3F H;  1XTC D;  3PIO 3;  1H9S B;  2UUC Q;  4YWM A;  3KLS X;  5JJI A;  2K32 A;  3CC4 A;  1A3T A;  2R93 B;  2B2V A;  1EYC A;  2D5D A;  2SNS A;  4DNI A;  4F7X A;  1ENF A;  5K36 H;  5CGK A;  2L15 A;  3H0G H;  2QIL A;  1B53 A;  4A3B B;  2K5H A;  3PF5 A;  3TZD A;  3KDF A;  5ELF A;  4PMB A;  1Y1W G;  3J7A 5;  1EOV A;  4K6L A;  1VQO A;  3HOW H;  1PTO F;  4JI2 Q;  3EA6 A;  4GN3 B;  3S1N H;  4MTN A;  1TT2 A;  2IWH A;  4BBS H;  2NZO A;  1Y1V H;  1BKB A;  4A3D G;  5C0X G;  3I55 A;  3T1Y Q;  1STH A;  2EIF A;  3ND9 A;  5FLM H;  4ZKC B;  2A6E C;  4CBV A;  4KN4 C;  3D8G A;  1G2S A;  1BBW A;  1TWC H;  4B3R Q;  2V1C C;  1BDO A;  3SEB A;  2HD3 A;  3MFY A;  1N33 Q;  4J8Q A;  5LMN Q;  1B1Z A;  1SN8 A;  2A6H C;  2OCE A;  1ILQ A;  1T5E A;  3KF6 B;  1GJX A;  4HSP A;  4BY1 B;  3S14 B;  1JJ2 A;  4EVO A;  3K7U C;  3PCO B;  5IT9 L;  4F88 A;  1VQE A;  3ERS X;  1QIL A;  2A69 C;  1U5K A;  2WAQ B;  1CHP D;  1MD2 D;  1MGS A;  4C3H B;  2GA4 B;  4YWK A;  4NXN L;  4GZY C;  1KNE A;  2KBN A;  3NTI A;  1JJG A;  1I3Q H;  4LF4 Q;  3I3C A;  4LF5 L;  2F0Q A;  1PLF A;  5TSS A;  3NBH B;  2KEN A;  1TWF B;  1DOM A;  5IWA L;  2RQX A;  4RKL A;  3ULJ A;  4C3J H;  3K5N A;  2C5C A;  5FKA C;  3MWY W;  4GS3 A;  2A74 C;  4FF4 A;  4QB4 A;  2R93 G;  3L0O A;  3NWT A;  4JVZ A;  4AQY Q;  1Z47 A;  3OSO A;  3UDG A;  4A3M H;  1LTS D;  2EQS A;  1Q82 C;  1GOZ A;  3OPO A;  4HJ9 A;  1HNW Q;  2Q2T A;  4JI5 L;  5HY6 A;  3GTL H;  4ODG A;  3ULL A;  2UUA L;  5IP9 G;  2ATW A;  4DV5 Q;  1EEI D;  4KD3 A;  4DUZ L;  5IGE A;  3CU7 A;  1FYC A;  4YCV A;  2UXB Q;  1DOK A;  4ILW A;  1M8A A;  1ESF A;  5CC4 A;  4JG2 A;  1VQP A;  2E2I H;  2JA9 A;  1K8A C;  3S2H H;  1E7Z A;  4JI3 Q;  1PRT C;  1SRO A;  1CI3 M;  1BBX C;  1HFN A;  2DJF C;  3KJO A;  3RZO H;  2PI2 E;  2QW7 A;  3W2D A;  4F8M A;  2R7Z B;  1GUS A;  3HOU G;  1I4Q A;  1MI2 A;  2CHB D;  1J8I A;  1N36 Q;  2YTX A;  2P5Z X;  2ICI A;  1Y1W H;  1RTN A;  2KHJ A;  2YU9 H;  2VQE L;  3U58 A;  3HKS A;  4C2M H;  2ID0 A;  2E8G A;  2N49 A;  2WKD A;  1QJO A;  4DR4 Q;  2KVM A;  1QVC A;  3J80 E;  4ZK9 B;  4A3D H;  4UDU C;  1TII D;  1JC7 A;  2R7D A;  4B9W A;  1GUO A;  4JBJ A;  1Q1B A;  1L2F A;  4RGN A;  4XIG S;  4GKK Q;  4N8X 1;  1R9T B;  3D0F A;  2C35 B;  1PVO A;  3K57 A;  4HR7 B;  4GN5 A;  3GTP B;  2NWG A;  4R8N A;  1EQT A;  1M90 C;  3T13 A;  4A93 B;  3ZJY C;  4FP5 D;  2NN6 I;  1JWU D;  4DV6 L;  3A0J A;  3VR2 A;  2XRQ D;  5M5W B;  4OWW B;  4BXX H;  1EU4 A;  4A76 A;  5FLX E;  1ML0 D;  4AYB E;  4NMZ A;  5JJZ A;  3A74 A;  3GTO B;  2XWB B;  3W1G A;  3NEN A;  3CHB D;  1UE6 A;  4RAU C;  1LTR D;  4O42 A;  1YEZ A;  2K7V A;  3SXH A;  1H9R A;  2EZV A;  4G7O C;  4HTH A;  1GUN A;  4C56 C;  5M3M B;  5A35 A;  2HCI A;  1BF4 A;  2QEX A;  3A54 A;  4NXN Q;  3DWQ A;  1VQJ A;  2VB2 X;  1G91 A;  1HUN A;  3HFZ B;  1X3P A;  2BE5 D;  3W1B A;  4HJA A;  2GN5 A;  4DV3 L;  2HIV A;  1DYQ A;  4IUU A;  5KYI A;  3RLF A;  1I4P A;  1LV9 A;  3SDZ A;  5E3F A;  3KJP A;  5C5L A;  3E0E A;  1E22 A;  2O5J C;  3KDF B;  5LMU L;  4G57 A;  3U9S A;  1VQ4 A;  2F0E A;  3KUP A;  3HOY H;  3OIQ A;  4DUY L;  1L1O A;  3Q24 A;  1X54 A;  2B2Y A;  3J7Z C;  2BOS A;  2RDH A;  2O2L D;  1VQN A;  4A3L G;  4A3E G;  1SMX A;  3OIP A;  5D14 A;  1CK1 A;  1OXU A;  4LK1 C;  4DK6 C;  1ZEQ X;  2M00 A;  1PZJ D;  2B2W A;  3P20 A;  1JMC A;  2FIN B;  3K81 C;  3TQY A;  4UPA A;  4A75 A;  2E2H H;  3ERO A;  2EY1 A;  3FKI G;  1EIY B;  5CBA E;  4HCE A;  1MSH A;  1C7Y A;  2F4V Q;  1X56 A;  2L55 A;  1Y8P B;  1LTI D;  4FO2 A;  1F2L A;  3IRB A;  1VQL A;  4R4O A;  5I6W A;  2X6G A;  1F9S A;  1SYG A;  4F87 A;  3S24 A;  1S5D D;  1TWH H;  1XXG A;  2LSS A;  1TKW B;  1U9R A;  3PO2 B;  1CKN A;  1I5F A;  2XSC A;  3QO2 A;  2UXD L;  3OW7 A;  5ISR A;  1K0R A;  5ELE A;  4OEL B;  4QF4 A;  5CYU A;  3PIP 3;  4R4C A;  3I56 A;  3U4V A;  1KQS A;  2MHV A;  2PCF B;  1HNZ Q;  2UUB Q;  2AUK A;  3C1E A;  3K5M A;  1G6P A;  4B9X A;  3GV6 A;  3S17 H;  3M3Y H;  2B63 B;  2NYZ D;  4ZCK A;  4FXG C;  3UDF A;  5IOD A;  2EY6 A;  1HA6 A;  4KMU C;  2EYF A;  3VA7 A;  4HJ8 A;  2FMM A;  4GNX A;  2AMC B;  2F0K A;  2L4N A;  1Q8K A;  2KED A;  2H5X A;  3J7Y W;  2F0S A;  3S2D H;  1N8R C;  4KY5 A;  2VQF Q;  5KNC A;  1J9O A;  3GD7 A;  2QCP X;  2SDF A;  3Q8D A;  4HMI A;  4KK7 A;  4PZ8 A;  1UWV A;  1ICW A;  2NUC A;  2K14 A;  1QZG A;  1FJG Q;  4KJO A;  4DR3 L;  1Q8I A;  4RHR A;  5AFW A;  4LF9 Q;  2AWN A;  3MFG A;  1STB A;  3PUZ A;  1QCB D;  2RVL A;  1FNV A;  2J0T D;  3KBG A;  3L3O C;  5I9P A;  1WD0 A;  1YHQ A;  3I4N H;  3ITP A;  2E2D C;  3VYR A;  3RN2 A;  3MEF A;  4LFA L;  2B2T C;  1D5M C;  2O5I C;  1TWG H;  3K80 C;  3SE0 A;  2JA6 B;  2KCT A;  2F0T A;  2Z4I A;  4DAY A;  4K0K L;  1EWH A;  1PH2 A;  4LF8 L;  2QA4 A;  5ELN A;  1YNX A;  3TS0 A;  5LMU Q;  5DNF A;  4JV5 L;  1FVI A;  2Q2H A;  1BNZ A;  2E2J H;  3I4M G;  1K8G A;  3HOV G;  1E24 A;  1RHP A;  4KY6 A;  2K6A A;  5C44 B;  1WTW A;  3FKI H;  2EJM A;  1Y8N B;  3K0Y A;  2JA7 B;  2I5H A;  5H1S E;  4AYB G;  3FPP A;  2LMC B;  3WOE A;  3M4O H;  1T5X D;  3BDC A;  3R8B A;  5M3F B;  4OO1 G;  1SNQ A;  2EY2 A;  2WKC A;  3M4P A;  1TR5 A;  1X3G A;  2B63 G;  1AE2 A;  4YIJ A;  2JA8 B;  4A3C G;  2EXD A;  1OXT A;  2ZJQ A;  2CW0 D;  2B2V C;  2VUM B;  1W3S A;  4EQ5 A;  2F0J A;  2PQE A;  3PF4 A;  1SNC A;  4IO9 A;  1SND A;  1TWA B;  1CSQ A; 
#chains in the Genus database with same CATH homology
 2JA5 H;  1JE5 A;  2JA6 H;  4IOC A;  1HR0 Q;  2JE6 I;  1UEB A;  2NVX H;  5DLQ E;  2AHO B;  3CME A;  2UU9 Q;  4OO1 I;  4DR5 Q;  3BZC A;  3T1H Q;  3M4Q A;  1XNQ L;  1WCM G;  1VQC A;  4A3I H;  1IBM Q;  1U0L A;  5E7N A;  3RN5 A;  2I0Q A;  4LF4 L;  3RNU A;  1HZA A;  1IZ6 A;  3L7Z C;  2IX0 A;  1A63 A;  1VQD A;  4JI1 Q;  2YV5 A;  1S72 A;  4JBW A;  2OQ0 A;  1I50 H;  2CFM A;  5FJ8 G;  1HNX Q;  2RCN A;  1BVS A;  5C44 H;  4GOP A;  2N78 A;  2UXD Q;  4R4I A;  4HIM A;  2JA7 H;  4LFB Q;  4JI0 L;  1P8L A;  4X64 L;  3CCV A;  4RG1 A;  4A3B G;  4JOI A;  4MNO A;  3SGI A;  2VQE Q;  1LUZ A;  4B3S Q;  4AQY L;  4IPH A;  5M3F H;  4X6A H;  1S40 A;  2JJQ A;  3S14 H;  4DR1 L;  3S1R H;  1XJV A;  2HHH Q;  4PG3 A;  1L1O B;  1WI5 A;  3EN2 A;  2LXK A;  4LUV A;  1I94 L;  4DK3 C;  4P71 A;  2JA5 G;  2JA6 G;  4GLA C;  5IE8 A;  2CKZ B;  1PH1 A;  1UE5 A;  2R7F A;  3MXN B;  1YJN A;  2VUM H;  3TRZ A;  3A5Z B;  1IL2 A;  1OTC A;  1PH9 A;  4C3H H;  1YHA A;  1PH3 A;  2F4V L;  3GTQ H;  2WB1 E;  4IPC A;  1VQ7 A;  4A3G H;  2PQA A;  1VS0 A;  2B3G A;  1TWA H;  3OTO L;  1G51 A;  4TVA B;  1J5E Q;  1SR3 A;  2IHE A;  4MZ9 A;  1KRS A;  2IT1 A;  4DV2 Q;  1PH6 A;  1GM5 A;  1SFO H;  1IBL Q;  3UE0 A;  4DR7 L;  2JA7 G;  1Q86 C;  1XMO Q;  1Q81 C;  1N32 L;  4DV6 Q;  2B29 A;  1QVG A;  4JI6 L;  2JEA I;  4BA1 I;  2OTJ A;  4BY1 G;  4LF7 Q;  4GN4 B;  1PH7 A;  2ALY B;  4DV7 L;  3S1Q H;  1VQI A;  5AJ3 Q;  1NY4 A;  2VW9 A;  3WWV A;  4DV0 L;  1K83 H;  4GOP B;  4A3F H;  2Q2U A;  5FLX c;  2UUC Q;  2WAQ G;  4YWM A;  3L2P A;  5C4X G;  5IYD H;  5JJI A;  3M9B A;  3CC4 A;  1NBW A;  1PFS A;  4RMF A;  2R92 H;  1HNZ L;  3I4M H;  1XTD A;  2UUB L;  4DNI A;  4PZ7 A;  1CKN B;  4JOI C;  1EUJ A;  4LFA Q;  3RR5 A;  2I5L X;  2DUD A;  2L15 A;  1YJW A;  2ZM6 L;  3H0G H;  4XTC S;  3DLL A;  4O0A A;  3U4Z A;  4QGU A;  1A8V A;  3S1M H;  2K5H A;  1FGU A;  3PF5 A;  4LF6 Q;  2ZTC A;  3KDF A;  3UDI A;  1LYL A;  1Y1W G;  3J7A 5;  1EOV A;  4GLX A;  1VQO A;  3HOW H;  4JI2 Q;  4X65 Q;  4GN3 B;  3A5U A;  4LFC L;  2PQA B;  4MTN A;  4JI7 L;  3H3V I;  4DV3 Q;  1YZ6 A;  3S1N H;  4BBS H;  1YIT A;  2VQF L;  2NZO A;  1EIF A;  1N34 L;  3HOZ H;  1Y1V H;  1BKB A;  4DR6 L;  4A3D G;  1IBK L;  5C0X G;  1CKO A;  3BJU A;  3I55 A;  4DKA C;  1QUQ A;  3T1Y Q;  2EIF A;  2VZA A;  5IYD G;  5FLM H;  4IOA A;  3STB C;  2YTV A;  4GNX B;  1FJG L;  2R92 G;  1BBW A;  3JAM c;  2OTL A;  1TWC H;  3PUY A;  4P73 A;  4DUY Q;  4B3R Q;  2V1C C;  1Q1E A;  4HJ7 A;  3CCL A;  1N33 Q;  5LMN Q;  2JEB I;  3TS2 A;  2K52 A;  1SN8 A;  1VQG A;  4LF9 L;  5M5Y H;  1HH2 P;  2OCE A;  1Z9F A;  5GAG C;  2RF4 A;  1Q12 A;  4KHZ A;  4X62 L;  2MNA A;  1V9P A;  3BU2 A;  1QZH A;  1VQK A;  1QVF A;  1A0I A;  3KF6 B;  2R93 H;  4AIM A;  2K4K A;  2CWA A;  4KHP L;  1JJ2 A;  5IT9 c;  2E5L L;  3HOW G;  5C0X I;  3K7U C;  3GTG H;  3PCO B;  3E9H A;  1HZB A;  1IXR A;  4P74 A;  4UP9 A;  1VQE A;  3ERS X;  3AEV A;  4BBS G;  4L5T A;  3CCS A;  1M1K C;  3HOZ G;  2R7Z G;  1U5K A;  1VQA A;  3HKZ G;  5GAD C;  3CF5 A;  4A3B H;  1GVP A;  4Y52 H;  5IP9 H;  4YWK A;  1L0W A;  1PH5 A;  1YIJ A;  4NXN L;  1AH9 A;  1W2B A;  2KBN A;  4GLV B;  1JJG A;  1I3Q H;  1NMG A;  4LF4 Q;  2NZH A;  4LF5 L;  3KOJ A;  4ALP A;  2VNU D;  3B6Y A;  1D7Q A;  4R4T A;  1PH8 A;  3PV0 A;  3CW2 C;  1XNR L;  3NBH B;  1VQF A;  2GVB A;  2KEN A;  3DM3 A;  4H02 A;  4AH6 A;  5IWA L;  3ULJ A;  4C3J H;  4DAY B;  1X65 A;  4YCU A;  4GS3 A;  2UXC L;  5JEA J;  2Z0S A;  1V1Q A;  4X64 Q;  3HOX G;  4C3I H;  4DV1 L;  2R93 G;  3AYH B;  3L0O A;  1N9W A;  5GRO A;  1VQ6 A;  4AQY Q;  1Z47 A;  1GKH A;  2MQH A;  4DR2 Q;  3UDG A;  4DR1 Q;  4A3M H;  2HT1 A;  3HOU H;  2EQS A;  1Q82 C;  2Y0S E;  4GKJ L;  4EX5 A;  4HJ9 A;  1HNW Q;  5GAE C;  2Q2T A;  1D8L A;  5HY6 A;  4JI5 L;  3GTL H;  1BBU A;  3ULL A;  4A93 G;  2D62 A;  3AFQ A;  2UUA L;  5IP9 G;  3CCM A;  1VCI A;  4A3J H;  2CWP A;  3EBE A;  1LTL A;  4BY1 H;  2ATW A;  4IJL A;  1KXL A;  3I7F A;  4DV5 Q;  1JT8 A;  2K75 A;  4IFD I;  4DUZ L;  2OQK A;  4X66 Q;  4LUZ A;  3E9I A;  4YCV A;  2YTY A;  2UXB Q;  1VQB A;  1HR0 L;  1G29 1;  1VQ8 A;  3H3V H;  5C4X H;  4HJ5 A;  4JG2 A;  3CPW A;  1VQP A;  2E2I H;  2JA9 A;  4OWT B;  3T1H L;  1K8A C;  1GO3 E;  3CD6 A;  1JJC B;  5IYC H;  2ZTE A;  1IBM L;  3S2H H;  1E7Z A;  4JI3 Q;  3PUV A;  4JI8 Q;  1HZ9 A;  1SRO A;  4A4I A;  2DGY A;  3ULP A;  1MJE A;  3KJO A;  3RZO H;  3EIV A;  2PI2 E;  1HNX L;  1TWF H;  1B8A A;  3CC7 A;  4A3M G;  4JI4 L;  5JJL A;  3HOU G;  1X9N A;  4HIK A;  4LFB L;  3LGJ A;  1WJJ A;  5BR8 Q;  1N36 Q;  2YTX A;  3PUX A;  1Y1W H;  2KHJ A;  5M3M G;  2YU9 H;  4IPD A;  5GQO A;  3HKS A;  4C2M H;  5C3E H;  2VQE L;  3U58 A;  4A3J G;  2ID0 A;  4B3S L;  1MJC A;  1OXV A;  2D0P A;  2E8G A;  2N49 A;  4YCW A;  2RHS B;  1CKM A;  2Y0S G;  4BBR H;  4DR3 Q;  2CQO A;  4DR4 Q;  2KHI A;  4B3T L;  1QVC A;  2HHH L;  1VQM A;  4A3D H;  1A62 A;  1KD1 C;  3JAM i;  3OW2 A;  2R7D A;  4J15 A;  4JBJ A;  1Q1B A;  1L2F A;  4XIG S;  1XMQ Q;  4GKK Q;  3CCR A;  2XGT A;  5IYB G;  3S16 H;  3D0F A;  5IYC G;  4APV A;  4BY7 G;  2C35 B;  1PVO A;  1OXX K;  2BH8 A;  1ASZ A;  3TEH B;  4GN5 A;  4NXM L;  1J6Q A;  3H15 A;  2AKW B;  1J5E L;  3CXC A;  4JI7 Q;  1KL9 A;  4LFC Q;  1XPR A;  1M90 C;  2WB1 G;  1Y14 B;  4DV2 L;  2ZJR A;  1IBL L;  3AFP A;  4IPG A;  4K0K Q;  1XPO A;  3ZJY C;  2D0O A;  4KI0 A;  2NN6 I;  1IBK Q;  1XMO L;  4DV6 L;  4LF8 Q;  4LUO A;  4POG A;  3A0J A;  5C3E G;  4OX9 L;  3F2B A;  4OWW B;  3GDE A;  4LF7 L;  4JV5 Q;  4BBR G;  3J81 c;  3PO2 H;  2R7Z H;  4BXX H;  4DV4 L;  1CSP A;  4A76 A;  3KFU A;  1X3E A;  5AJ3 L;  1YBY A;  3K8A A;  4AYB E;  4B3M Q;  2A1A A;  4DAM A;  2PI2 A;  2UUC L;  3A74 A;  1LM0 A;  4X62 Q;  3AQQ A;  3W1G A;  3NEN A;  1KHI A;  3I4O A;  4P75 A;  1UE6 A;  5ELO A;  1O7I A;  1YEZ A;  4YHH L;  1PV4 A;  1VQ5 A;  1SRU A;  1NMF A;  4A3C H;  4A3L H;  4A3E H;  3CCQ A;  3RLN A;  1YHB A;  4UP8 A;  5J3B A;  3HOX H;  3VDY A;  1XPU A;  2KCM A;  3PIP A;  1EFW A;  2PNH A;  1R9T H;  3NEL A;  4L5Q A;  4IJH A;  4YY3 L;  3PSI A;  2YYZ A;  2QEX A;  1IYJ B;  4NXN Q;  1KRT A;  1VQJ A;  4A3K G;  3GTP H;  2VS1 A;  3HFZ B;  4X65 L;  3CMA A;  4JI2 L;  3W1B A;  4POF A;  3PO2 G;  4HJA A;  4LNQ A;  4BXX G;  2GN5 A;  1EWI A;  2HIV A;  3BZK A;  3UE1 A;  4DV3 L;  3S15 H;  1H95 A;  3OYY A;  3FP9 A;  4A93 H;  3RLF A;  4JYA L;  3KJP A;  3T1Y L;  1CUK A;  3D31 A;  3E0E A;  1XNQ Q;  1E22 A;  3GTK H;  1B70 B;  3PGZ A;  3KDF B;  4QY7 A;  4JCV E;  3RLO A;  5IP7 H;  5LMU L;  5M5W H;  1VQ4 A;  2Z6K A;  1KAW A;  3HOY H;  3CC2 A;  4DUY L;  4B3R L;  1L1O A;  1E1O A;  1WOC A;  1X54 A;  3J7Z C;  4BA2 I;  5LMN L;  3G4S A;  4IFD G;  1I6H H;  5IY0 A;  3CCJ A;  1VQN A;  4A3L G;  4A3E G;  4JBK A;  1SMX A;  1TXY A;  4JI0 Q;  4GKJ Q;  3GTO H;  1QUQ B;  3PIO A;  1OXU A;  1T9H A;  3FHW A;  3UDX A;  4DK6 C;  4QIW E;  1JMC A;  4TQU S;  3K81 C;  1HJP A;  2R6G A;  3TQY A;  1I94 Q;  4UPA A;  1ASY A;  4A75 A;  4Y7N H;  2E2H H;  1HR0 W;  2A8V A;  5M3M H;  4A3G G;  1YVC A;  3CAM A;  3FKI G;  3W5O A;  1EIY B;  3ICE A;  2RHQ B;  2IX1 A;  1C7Y A;  5IP7 G;  2F4V Q;  4FDB A;  1X56 A;  3OTO Q;  3HOY G;  3IRB A;  1VQL A;  4R4O A;  3CQZ H;  3G71 A;  2UU9 L;  4P72 A;  4DR5 L;  5IYB H;  4JI4 Q;  4DR7 Q;  3F2C A;  2K5N A;  3CCE A;  4ME3 A;  4BY7 H;  1N32 Q;  3S24 A;  3G48 A;  3STB D;  3TRE A;  1TWH H;  4JI6 Q;  2IY5 B;  2LSS A;  4JI1 L;  4HID A;  1PYB A;  1UE7 A;  1NE3 A;  4DR2 L;  1CKN A;  1I5F A;  1K3R A;  1DGS A;  2WAQ E;  4DV7 Q;  2UXD L;  4B3T Q;  4L5R C;  3JC6 6;  1K0R A;  1RL2 A;  4DV0 Q;  1EQR A;  2Z6K C;  3KYH C;  3J81 i;  2JA8 H;  2NVT H;  1GD7 A;  4R4C A;  2IHF A;  3I56 A;  1HNW L;  1L1O C;  3CCU A;  2BH2 A;  2JQO A;  4R1J A;  2WP8 J;  4QJF A;  3U4V A;  5JEA G;  1V43 A;  3J80 c;  1KQS A;  2XTI A;  1PH4 A;  4DV5 L;  2NN6 G;  1HNZ Q;  4A3I G;  1MKH A;  2UUB Q;  1SE8 A;  3U50 C;  3M7N A;  1G6P A;  5HGQ A;  2K50 A;  3S17 H;  4OON A;  4X66 L;  4NXM Q;  3M3Y H;  2UXB L;  2ZM6 Q;  2ASB A;  1C0A A;  2QGQ A;  1EQQ A;  5C0X J;  5EAY A;  4LWC A;  5C44 G;  3KLW A;  3UDF A;  1YJ9 A;  4HJ8 A;  3F8T A;  2VY3 A;  4JI3 L;  4JI8 L;  3PO3 H;  4PMW A;  4GNX A;  2AMC B;  2NVQ H;  5GAH C;  3KF8 B;  4OX9 Q;  1Q8K A;  1UE1 A;  2H5X A;  5M3F G;  2WFW A;  3S2D H;  1N8R C;  2VQF Q;  1N34 Q;  4DV4 Q;  4O2D A;  1P16 A;  3GD7 A;  2HQL A;  5C4J H;  3CP0 A;  4DR6 Q;  2F52 A;  2JA8 G;  5BR8 L;  1N36 L;  4OWX B;  1X55 A;  3CPF A;  3Q8D A;  4PZ8 A;  4YWL A;  1UWV A;  2VUM G;  3KF6 A;  4A3K H;  1AE3 A;  3NEM A;  2K14 A;  4GOP C;  1QZG A;  1FJG Q;  4NB3 A;  1VQ9 A;  1MIU A;  1OXS C;  1X6O A;  4DR3 L;  4DR4 L;  4L5S A;  2JK8 A;  3HOV H;  4YHH Q;  2CCZ A;  1E1T A;  3RZD H;  1S3O A;  4LF9 Q;  1Q46 A;  1SLJ A;  2AWN A;  2AWO A;  3PUZ A;  1CSQ A;  2ES2 A;  1B7Y B;  1XMQ L;  4GKK L;  2MFI A;  3GO5 A;  1YHQ A;  1RIP A;  1PYS B;  4YY3 Q;  2NVY H;  3I4N H;  3PO3 G;  1WFQ A;  3RN2 A;  4KHP Q;  3MEF A;  1WYD A;  3HKZ E;  2E5L Q;  4LFA L;  1KC8 C;  1JB7 A;  1TWG H;  3K80 C;  2B63 H;  4HIO A;  1Q7Y C;  2KCT A;  3GTM H;  4IFD J;  4K0K L;  1NJI C;  4LF6 L;  1VQH A;  4JYA Q;  2Q2I A;  4A3F G;  1X3F A;  3M85 A;  1PH2 A;  4LF8 L;  2QA4 A;  1K73 C;  4PZ6 A;  5ELN A;  5JJK A;  1PA6 A;  3GTJ H;  1YNX A;  3TS0 A;  2FXQ A;  5LMU Q;  2GVA A;  4LF5 Q;  4JV5 L;  1FVI A;  2Q2H A;  2E2J H;  1C9O A;  2BA1 A;  2OWO A;  1K8G A;  3I4M G;  1NTG A;  2F3I A;  1E24 A;  4OXP A;  1XNR Q;  3HOV G;  5LMN W;  4JBM A;  3K7A H;  3PUW A;  3K0X A;  3F2D A;  4GNX C;  4B3M L;  3FKI H;  5IWA Q;  5K36 G;  4WJ3 M;  2LXJ A;  3H0G G;  4UP7 A;  1KIX A;  2I5H A;  5H1S E;  1WCM H;  2UXC Q;  3ER0 A;  4NPS A;  3J81 j;  4WJ4 A;  4AYB G;  4DV1 Q;  3M4O H;  2BA0 A;  2A19 A;  3I4N G;  4OO1 G;  1N33 L;  1E3P A;  2MO0 A;  2VL6 A;  4QL5 A;  5M5X H;  4JC0 A;  5FJ8 H;  3M4P A;  1X3G A;  2B63 G;  1AE2 A;  4A3C G;  2EXD A;  2HIX A;  1OXT A;  1PHJ A;  2I5M X;  2ZJQ A;  3G6E A;  2K5V A;  2ZJP A;  4JI5 Q;  1W3S A;  1Y1V G;  4KLK A;  1FL0 A;  4EQ5 A;  1EYG A;  2UUA Q;  3PF4 A;  3F1Z A;  3I2Z A;  4QQB X;  4LW1 A;  2MO1 A;  2PMZ E;  4UY8 C;  1YI2 A;  1HZC A;  5FLM G;  4IO9 A;  2ZTD A;  4R4Q A;  3J80 i;  2N8N A;  4DUZ Q;  1K9M C;  2N3S A;  4DPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...