4DKAC

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
86
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
total genus 14
structure length 86
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dkaC00
1WCMG 1JE5A 2JA8G 1QZHA 3PGZA 3A5ZB 4BY1G 1G51A 4DR3Q 3T1YL 3M7NA 2H5XA 2FXQA 2OWOA 4KHPQ 5IWAQ 1D7QA 5M3MH 2IT1A 3S1NH 1AE3A 4H02A 2K50A 4JG2A 4P72A 1Q82C 3HKZG 1K0RA 2N49A 3K7UC 4C3HH 2HIVA 4DV1L 1XNQQ 3MXNB 1WCMH 3G4SA 4R4CA 1PH5A 2OCEA 5ELOA 4XIGS 3L2PA 2Q2TA 2B63G 3F2CA 2A8VA 1IBMQ 3HFZB 4IJHA 1Q1BA 1P16A 1X3GA 4XTCS 3PO3G 1B7YB 1N32Q 2VUMH 3S16H 2UUAL 4JV5Q 3J81c 2UXDQ 4JOIA 1Y1WH 3RR5A 4DV3L 2B63H 3RLOA 1Q86C 2E5LL 2UUBQ 3U4ZA 4JI2Q 1YI2A 2A1AA 3AEVA 3HOVH 3PO3H 1YHQA 1L0WA 4C2MH 1KQSA 1VQJA 1I5FA 4TVAB 5JEAJ 3UE0A 3MEFA 2KHJA 2Z6KA 3NBHB 3RZOH 4OO1G 4KLKA 2R7ZG 1XJVA 2QGQA 3OYYA 4QJFA 1Q7YC 1R9TH 1IBKQ 2IHEA 3FKIH 3W1BA 1N9WA 1PH9A 4PMWA 2C35B 4UP8A 4NPSA 2VQFQ 2F3IA 2LXJA 1N34Q 4NXML 2R7ZH 4B3RQ 2JEAI 4GLAC 3E0EA 2JA9A 3GTQH 3PCOB 3I55A 2HIXA 1PYBA 3STBC 4LUVA 4JI6Q 2HHHQ 4ALPA 1FVIA 2UU9L 3CF5A 3HOWH 1SE8A 1M1KC 4B3MQ 1XNRL 2VZAA 4GNXA 4GN5A 4AQYL 4QIWE 5FLMH 1X65A 2JQOA 5C3EG 4DR4Q 3T1YQ 4YWKA 2IX1A 3GTPH 1OXXK 1I94Q 3DLLA 1BBUA 4IJLA 2UUCL 3PUZA 3J81j 2K4KA 1HNWL 1HNZL 3TS2A 1X6OA 3RZDH 1IYJB 4DV1Q 1PA6A 4X62Q 1S40A 2CFMA 5C3EH 1HR0W 1U0LA 4R4OA 2Q2UA 5HY6A 1MIUA 3K80C 2NZOA 4GOPB 3J7A5 1BKBA 2GN5A 3PIOA 2F4VL 1N8RC 4YY3L 4GN3B 1IZ6A 4X64L 4BA2I 1VS0A 4DV4L 2YTVA 1S3OA 2UUAQ 3CXCA 5LMNW 4GKJL 4A3DG 3A74A 3A5UA 4LF4L 2I0QA 3RLFA 4PZ8A 1B8AA 3GDEA 2Y0SG 3M4PA 5H1SE 4KHPL 4BA1I 2PI2A 3UDFA 5IWAL 4DV0L 4OXPA 4YWMA 4DV2Q 2QEXA 3CCEA 1PH1A 3GTLH 1Q1EA 4QY7A 4A3DH 1UE1A 1XNQL 2B29A 1KRTA 1WFQA 4A3CH 1WI5A 4P75A 4HIOA 1Y14B 2R92G 3E9IA 4LNQA 1RL2A 2WB1G 4YWLA 4A3MH 3K7AH 1PHJA 1IBML 1CKOA 2AWNA 2D62A 1VQLA 4BXXG 1N32L 4A3BG 4NXMQ 4JV5L 4LF5L 1TWHH 4OONA 4JI5Q 3FHWA 2EQSA 4AYBE 4B3TL 4RG1A 4TQUS 3NENA 1YITA 2R92H 1VQCA 2F52A 1LYLA 2ID0A 4RMFA 1VQKA 2UUBL 4JI2L 1PYSB 4NB3A 2UU9Q 3ERSX 1CKMA 1PH3A 1XNRQ 4A3BH 3CCUA 1TXYA 2PI2E 3AYHB 4WJ3M 4A3LG 4R1JA 1CKNA 4MZ9A 1KL9A 1VQ8A 2VNUD 4JBKA 4DR6Q 3ULJA 2DGYA 5GAEC 3S2HH 1IBKL 2RHSB 1HNWQ 1HNZQ 2ZTEA 2OQKA 4HIMA 4WJ4A 1Z9FA 4A3LH 1IBLQ 1KRSA 4DV7Q 4B3RL 2MNAA 4L5QA 1SFOH 4PZ6A 2YTYA 3F1ZA 3KF6A 3GD7A 1KXLA 1OXVA 4YY3Q 5IYCG 5M3FG 4Y52H 1X56A 2R7DA 5M3MG 3STBD 4ME3A 4OWXB 2PQAB 4JBWA 5JJKA 4B3ML 1BVSA 4L5SA 4IPHA 2AMCB 1VQDA 4P71A 4HJ9A 4DR4L 2KHIA 2CWAA 2Q2IA 3CCSA 2RCNA 3RLNA 5IYCH 5M3FH 4DV0Q 3HKZE 1I94L 4PG3A 2JEBI 3PV0A 1UE6A 1A0IA 5M5YH 3F2BA 4X62L 1X9NA 2E8GA 3ER0A 1PH6A 2ALYB 4YHHL 1Y1WG 1VQNA 3E9HA 4JI8L 1OXUA 2AHOB 4O2DA 3ZJYC 3HOVG 1J6QA 1NBWA 2CCZA 1WOCA 2D0OA 3JAMi 2GVAA 1XMOL 4OX9Q 4HJ5A 1NE3A 1EQRA 3CMEA 4DK3C 4LF5Q 1K8GA 4A4IA 4PZ7A 4B3TQ 4APVA 4BBRG 4L5TA 3I56A 2YU9H 1EWIA 2NVYH 5C0XJ 3KDFA 5IY0A 5IYDG 1G291 3G6EA 3GTJH 3FKIG 4UPAA 5LMNL 4A3FG 4DV2L 1VQPA 3PUVA 4JI1L 5C44G 3K8AA 1YZ6A 5C4XG 3JC66 1YBYA 1VQEA 4DR1L 4BBRH 2YV5A 2VL6A 3D0FA 2XGTA 5IE8A 3GTGH 2WP8J 3HOXG 5IYDH 3B6YA 2NN6G 4A3FH 1Z47A 4KHZA 1YJNA 3CMAA 3KFUA 4IPGA 1X54A 5J3BA 5C44H 1EQQA 2E2JH 3EN2A 1HZ9A 5C4XH 3CPWA 1E3PA 1IL2A 3HOWG 3ULPA 4A3IG 3Q8DA 2A19A 1KC8C 4JI5L 2LSSA 3UE1A 1VQIA 1Q46A 5GAGC 5FLMG 3HOXH 2JA7G 1N33Q 1XTDA 2IHFA 1DGSA 1UE5A 3HOUH 3PUWA 4UP7A 5FJ8H 4A3IH 1YHBA 3CC4A 4AH6A 4YCVA 1SRUA 4OO1I 1QVCA 1C9OA 2JA7H 1EFWA 3EBEA 5IP9G 3CC7A 4A3JH 4LF7Q 4LFAQ 4DR6L 2NN6I 1C7YA 1EIYB 1YEZA 5LMUQ 4KI0A 3S24A 3RNUA 3H0GG 4NXNQ 5DLQE 3KJOA 1IBLL 3NELA 2KCTA 4DV7L 5IP9H 4YHHQ 3PF5A 4C3IH 1HJPA 4JI8Q 1K73C 5JJLA 1FGUA 2IY5B 4DR7Q 3CCQA 2MFIA 1KAWA 1XMOQ 1HR0Q 4A3EH 1S72A 2OTJA 2K5VA 3H0GH 1SR3A 1JB7A 1VQFA 4LFCQ 3HOYG 3I7FA 3JAMc 4DAYB 4JOIC 1W2BA 4R4QA 2Y0SE 3D31A 3TEHB 1VQ4A 3M3YH 2VQEL 4A3CG 3TQYA 4LF6L 1QUQB 4DUZQ 2PMZE 5LMNQ 4A3MG 4DUYQ 1K9MC 1A8VA 3KYHC 4JBMA 4JI1Q 1PH2A 1TWAH 4L5RC 3HOYH 1X3FA 2Z6KC 5C0XG 4DR1Q 3PO2G 3G48A 1X55A 2WB1E 3U50C 1TWCH 1J5EL 5JJIA 3AFPA 4LUOA 1XMQQ 1NJIC 1VQGA 4HIKA 3CCRA 4OX9L 3S1QH 2R93H 1AH9A 2I5LX 3T1HQ 4GOPA 2NZHA 3OW2A 3CCVA 3I4OA 1CSQA 2ES2A 1YVCA 2CKZB 2Q2HA 3CC2A 3H15A 2B3GA 2UXCL 1XPOA 2R6GA 3J80i 3TS0A 2R93G 4DR2Q 3GTOH 1BBWA 4JBJA 1E1TA 4BBSG 2ASBA 2CWPA 1YIJA 4QQBX 1I3QH 4GN4B 4J15A 1MJEA 2JA5H 1C0AA 2K14A 4GNXC 4X6AH 5C0XI 3PF4A 5HGQA 4A75A 2JE6I 5M5WH 1VQ5A 1W3SA 4B3SQ 1FJGL 3ICEA 2WAQE 4BBSH 3F2DA 3UDIA 1GO3E 1UWVA 1KD1C 4Y7NH 1NTGA 2UXBL 2JJQA 3CP0A 1L1OB 3BZCA 5GAHC 1K3RA 3KLWA 2E2IH 4JI7L 1E7ZA 4O0AA 1N33L 2NVXH 4AYBG 4EQ5A 1O7IA 3VDYA 4AIMA 3GO5A 1Y1VH 2VUMG 4IOCA 3CD6A 3W5OA 3H3VH 3S2DH 2VQEQ 2QA4A 2CQOA 2ZTCA 1K83H 2OQ0A 1VQ7A 4LF7L 4LF6Q 4BY7G 4LFAL 3DM3A 2ZM6Q 3J7ZC 2ZJPA 4LWCA 2MQHA 1GM5A 5EAYA 5LMUL 4GLXA 1ASZA 3CW2C 5BR8Q 4NXNL 2I5HA 4POGA 1GKHA 1NMGA 5IP7H 4JCVE 3OTOQ 3GTMH 4GKKL 2JA6H 1YJWA 4IFDG 1SN8A 3L7ZC 1J5EQ 4BY7H 4A3KH 1M90C 1JJCB 1UE7A 4UP9A 4HJ8A 2EIFA 1VQHA 4K0KQ 2XTIA 3WWVA 3TRZA 3I2ZA 1HR0L 4DV5L 3FP9A 4A3GH 3PO2H 4LFCL 5GQOA 1KIXA 4DV6Q 1YHAA 2UXCQ 4POFA 1U5KA 4GLVB 1PH7A 3S14H 2HT1A 4DAMA 1VQ6A 3SGIA 3CCJA 1X3EA 2IX0A 2PQAA 1VQBA 3J80c 1VQ9A 1H95A 5E7NA 4DUZL 1Q8KA 1N36Q 4DUYL 3L0OA 1JMCA 5C4JH 1PVOA 4DPGA 4IO9A 2N8NA 2BH8A 3HKSA 2JA8H 1E1OA 4IFDI 4BY1H 3RN2A 3M4QA 1FJGQ 1LTLA 3KF8B 1I6HH 4LF8Q 1CSPA 2ZJRA 1SLJA 4QGUA 2RHQB 1RIPA 1XMQL 1YNXA 3CAMA 1V9PA 2UXBQ 3HOUG 5AJ3L 3HOZG 4DNIA 3T1HL 1VCIA 3IRBA 5FJ8G 1JT8A 1EIFA 1V1QA 1OTCA 4JI4L 1Q12A 1NY4A 4IPDA 4X66Q 4JI7Q 1L1OC 2KENA 4DR2L 3S15H 4GNXB 1EUJA 4A3JG 4YCUA 3CQZH 3HOZH 4JYAL 2K5NA 1HZAA 1ASYA 4UY8C 4LW1A 1MKHA 3EIVA 4LF9Q 2NVQH 1E22A 3KJPA 3CCLA 1G6PA 2EXDA 3TREA 1LM0A 4B3SL 1JJ2A 1TWGH 4A93G 1I50H 1GD7A 1PV4A 4A3EG 1WJJA 2HQLA 2D0PA 3M85A 2MO0A 4GKKQ 1NMFA 3S1MH 3U4VA 4LFBL 1QVGA 3NEMA 1HNXL 4A93H 4FDBA 3PIPA 2ATWA 4DKAC 1A63A 4DV5Q 2PNHA 4IOAA 4OWTB 1B70B 3M9BA 3S1RH 1QVFA 2RF4A 4DR5L 2ZM6L 1PH8A 2ZJQA 4IFDJ 5IYBG 4HJ7A 4X65L 5BR8L 4JI3L 3I4NG 3ULLA 3OTOL 2N3SA 4IPCA 4QL5A 4MNOA 2ZTDA 5FLXc 1P8LA 1QZGA 2AWOA 4K0KL 5K36G 5IYBH 4HIDA 3PUXA 4JI0L 5AJ3Q 2OTLA 3U58A 2E2HH 2JA5G 2L15A 3I4NH 1V43A 5M5XH 1WYDA 3KOJA 3G71A 4DV6L 4JI4Q 4DV3Q 3PUYA 1FL0A 4GS3A 2E5LQ 4OWWB 2K52A 4DR3L 5ELNA 1CKNB 4JYAQ 1GVPA 1TWFH 1N36L 2VW9A 4P74A 2AKWB 2I5MX 4HJAA 1CUKA 1QUQA 3PSIA 2BA1A 3BJUA 1XPUA 1IXRA 2BA0A 1KHIA 4LF8L 5JEAG 3W1GA 1EYGA 4YCWA 1HZBA 2VY3A 3J81i 3I4MG 1T9HA 3KF6B 2V1CC 3K81C 1Y1VG 3BZKA 2UXDL 3UDGA 3F8TA 4R4TA 4LFBQ 2LXKA 4C3JH 3RN5A 1VQAA 4X66L 3LGJA 5GROA 1HNXQ 1E24A 2NVTH 1SMXA 1HZCA 2DUDA 1PH4A 4BXXH 2K75A 3I4MH 2VS1A 2GVBA 3UDXA 2BH2A 4P73A 5GADC 1JJGA 4AQYQ 4R4IA 3AQQA 5IP7G 4LF9L 1K8AC 2WFWA 4A76A 2YYZA 1D8LA 1EOVA 1Q81C 4MTNA 3CPFA 2YTXA 1VQMA 4DR5Q 3AFQA 2JA6G 3M4OH 5IT9c 4A3KG 1XPRA 4JC0A 2R7FA 2UUCQ 2K5HA 2WAQG 3K0XA 1PFSA 2MO1A 4LUZA 4DR7L 4EX5A 1HH2P 2KCMA 2Z0SA 4X65Q 1YJ9A 3S17H 4A3GG 4JI3Q 2VQFL 1N34L 1L2FA 3BU2A 3H3VI 4DK6C 1A62A 1OXTA 2F4VQ 1L1OA 1AE2A 1MJCA 1SROA 2KBNA 4X64Q 2HHHL 4JI0Q 4JI6L 3GTKH 4GOPC 2JK8A 4DV4Q 3CCMA 3A0JA 1LUZA 1UEBA 1VQOA 2N78A 4GKJQ 4LF4Q 3KDFB 1OXSC
chains in the Genus database with same CATH superfamily
5ISRA 4PV1C 1JE5A 4FF3A 1D7QA 2H5XA 5M3MH 3S1NH 1AE3A 2N49A 5M5XB 1QE6A 2HIVA 4DV1L 1XNQQ 3MXNB 1WCMH 4BWGB 3G4SA 2OCEA 2Q2TA 3F2CA 3HFZB 1H9SA 3J80E 1SAPA 5EPJA 3J81c 3TBIB 3QOLA 2F1MA 2Y0SB 1LTSD 1Q86C 2E5LL 5BN4A 3HOVH 4JI2Q 5KNBA 4G7HC 3H6MA 2LFNA 2BE5C 3A8KE 2PMZB 3L9AX 3HG9A 1VQJA 3C3LA 3MEFA 2KHJA 1Y8NB 3G7LA 4KLKA 2WB1B 3OYYA 5CORA 1Q7YC 1R9TH 1QB5D 1N9WA 3BYTB 5NUCA 4UP8A 5K5PA 4OO1H 4KKSA 2QDBA 4CDFC 2TMPA 3DWPA 4GLAC 3E0EA 2HIXA 4LUVA 4XQQA 1SE4A 2OF1A 1MSHA 2CHBD 2UU9L 3HOWH 1SE8A 1DM0B 3NXWA 5FLMH 2JQOA 4MIUA 4DR4Q 2WV6D 3T1YQ 3TP8A 4YWKA 2IX1A 1I94Q 4X3KA 1JOOA 3TS2A 1X6OA 3K6OA 4R4OA 5HY6A 5KYLA 1D1KA 3K80C 3IL8A 2GN5A 1SYFA 2OXPA 5IGDA 3BDOA 4C3HB 3T13A 3CXCA 4A3DG 5C3WA 4JK1C 3A5UA 2I0QA 1AFPA 3LNNA 2Y0SG 5L37A 5KNCA 5IWAL 2E76C 4YWMA 5CR3A 4DNTB 2VXWA 2QEXA 3GTLH 1GHJA 3S16B 2Q8IB 4H7BA 1EYDA 4CJ0B 3WOEA 2B63B 3NSWA 1O80A 1WTQA 2R92G 1TR5A 1PRTF 2WB1G 3K7AH 2NTTA 1D5MC 5C0XH 1N32L 4A3BG 4JV5L 4K14A 1TWHH 2ICEC 5M9OA 1EEFD 1YITA 1VQCA 4RMFA 2HD3A 4EGVA 4NB3A 2O2LD 3ERSX 3CCUA 1TXYA 3AYHB 4WJ3M 5IGFA 4R1JA 3VR6A 1VQ8A 2RQXA 3ULJA 1G91A 2RHSB 2ZTEA 4A3LH 1SYCA 1Q90A 2B2UC 5EBCA 4DV7Q 4B3RL 3BYYB 3FPPA 4RGNA 2RSNA 1LO5D 1TVXA 5M3FG 3MTSA 4KTAA 5EKIA 3FMCA 4XDXA 4IPHA 2AMCB 4F8MA 4HJ9A 3CCSA 1S5BD 5IYCH 2HUGA 4DV0Q 3HKZE 2JEBI 3PV0A 2AQ3B 3LWEA 4BS9A 3OW7A 1SXTA 4K5XA 1EU4A 2ALYB 1VQNA 1NBWA 3JAMi 1A3VA 2KOLA 1NE3A 1EQRA 4DK3C 5J1ZA 4A4IA 3DWQA 4BBRG 3E6ZX 3R2TA 3A55A 3OHXC 1G291 4A3FG 1LV9A 5C44G 5C4XG 1K8MA 1Q3LA 2VL6A 3TP6A 3J81E 5IYDH 2F0HA 2NN6G 2F0OA 4ZCKA 3KFUA 3CMAA 1YNJC 2EPBA 4HN7A 4FXGC 3CPWA 3BVZA 3NHHA 4XT1B 2Z6BA 1C4QA 3S2HB 2JA7G 1N33Q 2XRQD 2IHFA 4EQPA 1SNCA 3H91A 5FJ8H 2EYLA 3T53B 2EYMA 2CH4W 3EBEA 4DR6L 1SYDA 2MHVA 1XYIA 1G2SA 3NBHA 1CT1D 5A2QE 3D4WA 3H0GG 1RKNA 5DLQE 3KJOA 2EY6A 1EOTA 4YHHQ 3PF5A 4C3IH 1U4PA 4JI8Q 4O1NA 1FGUA 5I2YA 4A3EH 4IUQA 1SR3A 1RDPD 1MHWC 4N8FA 3I7FA 1W2BA 2CW0C 3NP8A 4DAPA 1QUQB 4DUZQ 4H13C 5D14A 3D6CA 5LMNQ 4JBMA 1K9MC 5IGCA 2EJFC 3A7AB 2Z6KC 1KNAA 3G48A 1J5EL 2D5DA 3AFPA 2B2TC 4K5VA 3S1QH 3OW2A 2NZHA 4DF7A 3I4OA 1CSQA 2CKZB 2Q2HA 3CC2A 1GUOA 1CFMA 2UXCL 2R6GA 3J80i 5HGTA 3GTOH 1BBWA 3DEPA 1B50A 2ASBA 4QQBX 5CBAE 2E2JB 1I4QA 4CBVA 3Q6SA 3QOJA 2FMMA 2HDMA 4CJ2C 1EQTA 5I6WA 1JE4A 2EY2A 2PZWA 4Y7NH 1NTGA 2JJQA 3CP0A 4RHSA 1YNJD 1K3RA 1E7ZA 1SJED 1OXSC 4EQ5A 5CGKA 4KN7C 2C5CA 3GO5A 1Y1VH 2NBFA 2QA4A 2CQOA 2ZTCA 3EQLC 4LF7L 4LF6Q 1DOKA 3DM3A 1F9PA 1VMCA 2ZM6Q 4LFAL 3J7ZC 1GOZA 1MBYA 1S4ZA 1KABA 2HDLA 3HRZC 5BR8Q 4POGA 3PO2G 1LABA 1M90C 4UP9A 2QDLA 1HR0L 4DA2A 3MZ5A 1YHAA 3TMEA 1PH7A 2LS01 1ENFA 4DAMA 2CW0D 1X3EA 1VQBA 2R93B 2KVMA 1Q8KA 1B3AA 1PVOA 1ENAA 4DPGA 2BH8A 2K5QA 5E4WC 3TZDA 3NTIA 1E1OA 4BY1H 3RN2A 1NR2A 4LF8Q 1CSPA 2F4IA 3SK5A 1RIPA 1YNXA 3CAMA 1V9PA 5AJ3L 3T1HL 1I4XA 1TQOA 2JP1A 1HXYD 1EIFA 1GJXA 1Q12A 1JC7A 4BBSB 2KENA 4DR2L 2Z1CA 5D3DA 1E2WA 1GUWA 1NAPA 2D2CC 4KY5A 1D2BA 3TREA 1LM0A 4A93G 3C46A 1I50H 1PV4A 4GKKQ 4Q5VA 3S1MH 3M7GA 4ODGA 1AN8A 2L5TA 5E1FA 1DYQA 2RDHA 2JA6B 1Q8IA 4BY7B 3OWEB 1CQVA 1QVFA 2WINB 1DD2A 2Z8LA 4H44C 1U4MA 2K33A 1PH8A 1K0SA 5FO7B 3N52A 1SNDA 3VR3A 3I4NG 5TSSA 1BR9A 4IPCA 3WDNA 1Y69U 4K0KL 2AWOA 1SNQA 2K03A 4KKTA 2E2HH 1WYDA 4J8QA 3FRPB 2JA8B 4JI4Q 4DV3Q 4X3SA 3PUYA 4GS3A 4KKUA 1CKNB 2F3VA 1LTGD 3HKZB 5KGUA 1N36L 1TWFH 4P74A 2I5MX 1LTAD 3K58A 1CUKA 3BJUA 1XWEA 4NW2A 1XPUA 1I4GA 5DM73 2M9VA 4PQXA 1M4VA 3CQZB 5JEAG 4YCWA 3J81i 3I4MG 1T9HA 2V1CC 1NCVA 4LFBQ 3RN5A 4H0LC 2SOBA 1HNXQ 4G57A 3BS1A 1E24A 1TWGB 2A68C 3H3VC 1W6KA 4G7ZC 1PH4A 2NWGA 1EY8A 4MTKA 3UDXA 4P73A 2DJFC 1VMPA 5GADC 1JJGA 2EJMA 4LF9L 3AQQA 5J39A 2B2WA 4MTNA 2JA6G 4DR5Q 3CRKC 3M4OH 4FF2A 4JC0A 2K5HA 1HH2P 2B8GA 2F0UA 1IL8A 3BVMA 3BU2A 5T1GA 2F4VQ 4RFBA 2KBNA 3K5OA 3GTKH 4JI0Q 1BCPF 2E74C 3I90A 4GKJQ 1A3UA 4LF4Q 3KDFB 1D1IA 1WCMG 2JA8G 1QZHA 1V1PA 3T1YL 3A5ZB 3M7NA 2OWOA 5ELCA 4B9XA 4H02A 1Q82C 4JG2A 1QG7A 1SEBD 3HKZG 3K7UC 2AQ2B 2WACA 4R4CA 5ELOA 3DEOA 1JWUD 1STHA 2A8VA 4XTCS 1B7YB 2EYFA 1BDOA 2UXDQ 1I4HA 3A7LA 1AW7A 2F0JA 5C6AA 3RLOA 3PO3H 1F2LA 1YHQA 1L0WA 1EYCA 4C2MH 2E75C 1G8ZD 5JJZA 5FLXL 5JEAJ 3UE0A 3RZOH 4OO1G 4C3JB 1C8CA 4R9WA 3FKIH 4CKEA 3KF8A 2F0TA 1ZYRD 1PFNA 2XWJB 4NPSA 1N34Q 1TS5A 2LXJA 2R7ZH 2EOTA 2AUKA 2JA9A 3HGBA 3I55A 2JSOA 3GTQH 1PYBA 1CHPD 2HHHQ 4RKBA 3MAQA 2A68D 4B3MQ 4GNXA 1EY6A 2R61A 2F0DA 4QIWE 1X65A 3GTPH 2F0EA 4IJLA 3J81j 3Q23A 3UI2A 1PA6A 4X62Q 1S40A 1HR0W 5BN5A 5C3EH 4DK1A 1MIUA 3NTKA 4GOPB 4M1UB 1LT4D 3J7A5 1HHVA 2DNEA 3D4RA 1WTRA 3OPOA 4DV4L 1S3OA 4FNFA 4KHPL 2PI2A 4DV0L 3C1FA 2NTSA 3EVQA 2A6EC 2B29A 2F0VA 1WFQA 3LX0A 1Y1WB 2K6AA 2L9HA 4FO2A 4C3JG 1IYVA 1K3BC 1RL2A 3A8IE 4YWLA 1IBML 1PHJA 5FOBB 1VQLA 4NDXA 2PQEA 4IUPA 3NPPA 3FHWA 3NENA 2F52A 2ID0A 2UUBL 1VQKA 1HPCA 1I4RA 4IUVA 5EBDA 1PH3A 3T4AC 3HZXA 4A3LG 4XYOA 2VB2X 3EJIA 2VNUD 4JBKA 4QUCA 5GAEC 3A56A 4ID6A 1IBKL 2IL8A 4B08A 3TSSA 2LY7A 2OQKA 1Z9FA 1JICA 1IBLQ 1KRSA 1SFOH 4PZ6A 2YTYA 3F1ZA 4ZUIA 1OXVA 5IYCG 4Y52H 1X56A 2H1EA 2R7DA 4OWXB 3RZDB 5JJKA 3IKJA 5E3FA 2Q2IA 2XN9C 1PTOF 2RCNA 3NQIA 1WTOA 4PG3A 3F2BA 1STYA 1X9NA 4YHHL 1ET9A 1I4PA 1Y1WG 4JI8L 1J8IA 4OX9Q 2CCZA 1WOCA 2GVAA 2XVSA 4A3DB 4HMIA 4LF5Q 1D5XC 4IFDH 4PZ7A 4B3TQ 1EY4A 2IJ0A 4APVA 2WKCA 4L5TA 1U4RA 2L4NA 4A3MB 5C0XJ 2Z4IA 4K6DA 1TS2A 5IYDG 3G6EA 3CU7A 5LMNL 4DV2L 3J7AF 4PMBA 2YV5A 3GTGH 2A6ED 2R92B 2WP8J 3MXNA 1G2TA 3QO2A 3MEHA 4I7ZC 1HZ9A 4A3BB 1IL2A 1E3PA 3ULPA 1DOLA 3IFTA 2A19A 3OWFA 4JI5L 3UE1A 4IALA 5GAGC 1Q46A 3HOXH 1KC8C 5LL6S 3R8BA 2L11A 3HOUH 2CVRA 4UP7A 4EQOA 4A3IH 3GV6A 1FNUA 4IURA 4YCVA 1SRUA 4OO1I 4X3UA 1LACA 2LMCB 1EFWA 4A3JH 4C3IG 5EKKA 1C7YA 3S24A 4NXNQ 1ENCA 3NELA 2N88A 4EVOA 5IP9H 2PW5A 5M3FB 1HTLD 2IY5B 1G6ZA 4DR7Q 2OTJA 1S72A 1STAA 1JB7A 5M5YB 1VQFA 2FINB 4DAYB 4R4QA 1KLUD 1RF2D 4A3CG 1PRTC 1EU3A 3TQYA 4LF6L 1STBA 4RGMA 4A3MG 3HOYH 1A8VA 3A8JE 3P7JA 1TWAH 4FXKC 5DNFA 1X3FA 4DR1Q 1SE2A 1X55A 1EL0A 1R4QB 1TWCH 2YU9B 2NVYB 3E0JA 1XMQQ 3VR4A 1NJIC 1AZQA 3R3OA 3GTJB 2I5LX 2EYOA 5FK9C 2XIWA 2L1BA 4KMUC 2V4DA 4BBRB 3H15A 1CK1A 3KLRA 3SXHA 2OT2A 4JBJA 1E1TA 4A3FB 2CWPA 1YIJA 2HCCA 5C44B 4DAVA 5C4XB 2K14A 4X6AH 5C0XI 5KNDA 3PF4A 5HGQA 4I65A 4B3SQ 3UDIA 1H9MA 1GO3E 1UWVA 1UAPA 1O7ZA 4RHRA 2JA7B 1CHQD 5D65A 2BDOA 1HUNA 4AIMA 1RODA 1PTOH 1HCZA 3CD6A 1HQRD 3W5OA 1CA6A 1ML0D 1D5ZC 2A74C 2NB0A 4IN3A 1F77A 1TKWB 4LWCA 4F88A 2RKSA 3GQBA 1JOKA 3H0GB 5LMUL 4GLXA 2VUMH 3CW2C 1H9KA 2I5HA 1NMGA 4RWSC 3GTMH 4RGOS 4GKKL 3M3YB 2A73B 1S5DD 2CQAA 1SN8A 3L7ZC 1JJCB 1DCZA 2PYKA 4HJ8A 2XTIA 4JVZA 4A3GH 2XWBB 3RUZA 4LFCL 2EVBA 4DV6Q 5CBEE 4QIWB 4HCSA 3S14H 3SGIA 3CCJA 1VF5C 3R93A 5CV4A 2HQEA 1PRTD 4DUYL 3DWAA 5BN3A 5C4JH 3HKSA 2PZUA 5F2DA 4CKCA 1FJGQ 2EY1A 1I6HH 1T5XD 2RHQB 1I3QB 2JA5B 2UXBQ 2Q8RE 1HFNA 1PZID 3T51B 2F0QA 3IRBA 1JT8A 4RA8A 1OTCA 5M5WB 4JI4L 1NY4A 4IPDA 4CKBA 4X66Q 3S15H 3I91A 4OIKA 2DJGC 3HOZH 2QCPX 4KD3A 1HA5A 1HZAA 3VYSA 1ASYA 1MKHA 1KLGD 1BUVT 3EIVA 2NVQH 2E2IB 4FYDA 3KJPA 1PFMA 2NVXB 2B2VC 3CRLC 3NUCA 2NUCA 5EJWA 1GD7A 1RTNA 3P20A 1WJJA 4HMJA 3S2DB 4DNRB 5I4DA 2F0SA 4LFBL 1D6EC 1K83B 3NEMA 1HNXL 4JW0A 2ATWA 4HR7B 1A2TA 3HEJA 4DV5Q 1TY2A 4FP5D 1B53A 1KAAA 1ZXTA 2FJ2A 3MXGA 3P75A 4OWTB 2RBMA 1B70B 4L6TB 1SJHD 3S1RH 3SE0A 4A3KB 2SDFA 5ELBA 4DR5L 2QILA 3PO2B 1O7YA 3ULLA 3OTOL 4QL5A 2ZTDA 5FLXc 1P8LA 1QZGA 3MXUA 5IYBH 3PUXA 2K7VA 2IW3A 4JI0L 1IW7C 2JA5G 3I70A 1V43A 5M5XH 1GUSA 3G71A 5JAVA 1FL0A 1Y8PB 2E5LQ 2K52A 5I9PA 2J7ZA 2WIIB 5ELFA 4ME5A 2F0PA 4JYAQ 4LMQD 1GXDC 3OSOA 3DUZA 1QUQA 3PSIA 2EY5A 2QW7A 2TSSA 5C3XA 3W1GA 2VY3A 3KF6B 1NR4A 3K81C 2UXDL 4ZYSA 1FR3A 1KTKA 3NE5B 4ZKBB 1ZEQX 1NUCA 1SMXA 3ONAB 1HFGA 2K75A 2EZVA 1JR0D 3R2IA 5IGEA 5IP7G 1Q81C 4A93B 1C0AA 1VQMA 4A3KG 1XPRA 2K32A 2WAQG 3K0XA 1PFSA 1TY0A 1JWMD 4X65Q 1YJ9A 4JI3Q 4J6HA 5CV9A 1N34L 4NP5A 1EY7A 4DK6C 2KUMA 2J0TD 3BG3A 2HHHL 3EA6A 5HURA 3A0JA 1KDCA 3WOFA 3PGZA 1SNOA 1G51A 2F0NA 4Z9CB 4DR3Q 2FXQA 5IWAQ 1TT2A 2IT1A 4P72A 1K0RA 4C3HH 3I4NB 2RA4A 5A2QL 2EYHA 1EZ6A 1PH5A 3SDZA 2K04A 3L2PA 4CDEC 3PIP3 4IJHA 3O13A 1EY0A 1P16A 1X3GA 3PO3G 1N32Q 3S16H 4JV5Q 4JOIA 1IW7D 2ZXPA 2B63H 3U4ZA 1YI2A 3AEVA 1PLFA 4KJNA 4QMGA 1PZJD 4K8IA 2K1BA 5COYA 1S5FD 2NVTB 2R7ZG 1XJVA 1SBBB 3GP7A 4WJWA 1EZ8A 3I4MB 3IAYA 1CQFA 4RCOA 1GUNA 5I6YA 4B3RQ 2SNSA 3TDQA 3BDCA 2NN6H 3HS0C 4JI6Q 1LTID 3V2TA 5FO8B 3S17B 2VZAA 4GN5A 4AQYL 3QWNA 5C3EG 1ESRA 1OXXK 1XX8A 2UUCL 4IZ8A 2K4KA 2CFMA 1U0LA 1EQVA 2Q2UA 2PPBC 1HRJA 4MHEA 2R3ZA 5M3MB 4GN3B 3S1NB 4X64L 4BA2I 1ICFB 4ABNA 1PYWD 1STEA 2UUAQ 3OIQA 5IT9L 2B2YA 1WCMB 3A74A 3RLFA 4PZ8A 1B8AA 3GDEA 1DOMA 3UDFA 1ICWA 1ET6A 1M8AA 3K5MA 1S5CD 1PH1A 3KUPA 5FLXE 2Z4HA 1XNQL 1KRTA 3T56B 2EDGA 1E0BA 1E2ZA 1WI5A 2SEBD 4HIOA 3HOVB 4LNQA 1CKOA 1ZYRC 2AWNA 3KLSX 2VB3X 2K5DA 4BXXG 1FYCA 4NXMQ 1SSOA 4LF5L 4TKOB 4OONA 4B3TL 4K2KA 4RG1A 4TQUS 1LYLA 1R9TB 4JI2L 5C5LA 2QF7A 3C2PA 1XNRQ 1WD0A 1CKNA 1B9NA 3KBXA 4HAEA 3E5SA 4DR6Q 3S2HH 1DONA 2DGYA 3SK6A 1HNWQ 1BCPC 1HNZQ 3HOWB 4WJ4A 3P1HA 3TP5A 2MNAA 2B8FA 1IHZA 2OEOA 1JQYD 2XRSD 3GD7A 1KXLA 4YY3Q 3A54A 2BOSA 2MJ8A 5M3MG 2PQAB 4JBWA 3CHBD 1BVSA 5KRUA 1VQDA 2GA4B 4ILWA 4DR4L 2KHIA 4IQZA 3RLNA 3BDLA 1EFID 3K57A 1I94L 1BQQT 3PQIA 1CZWA 2E8GA 4WORA 3ER0A 4RGTA 1PH6A 3J7AV 1A6XA 1CZGA 3E9HA 3W2DA 4ZLTF 4FF4A 1UEAB 3ZJYC 4PNYA 1IKLA 3HOVG 1J6QA 4DR7L 3C1EA 5DAUA 4HJ5A 3GTLB 4HTHA 5IODA 3CMEA 3D3RA 1K8GA 1EIGA 4K6LA 2DY7A 3I56A 1EWIA 3K7AB 4U68A 3KDFA 1VQPA 4UPAA 2RCFA 1YBYA 1VQEA 1TWHB 4DR1L 3OMCA 2B2WC 2F3WA 4K2LA 3HOXG 3B6YA 1V1OA 3PIO3 1Z47A 1YJNA 4IPGA 1X54A 5J3BA 1H9RA 1EQQA 2F0FA 2E2JH 1ILQA 2ENBA 1S5ED 3HOWG 4A3IG 5C4HA 4PMCA 2LSSA 5FLMG 4CHTB 3VYRA 1DGSA 1UE5A 4B9WA 2NYZD 5G3LF 2MPMA 1C9OA 5IP9G 4LF7Q 3CC7A 4LFAQ 1SNPA 4KI0A 5IGBA 1BCPD 1E2VA 3T16A 4DV7L 1GHKA 1B2TA 5JJLA 5FO9B 1KAWA 1XMOQ 1HR0Q 2EYJA 4XYQA 4G7OC 3HOYG 2ICIA 4TSSA 3NWTA 1RHPA 1VQ4A 1B9MA 3TEHB 1MI2A 4DU9A 4UHVA 1AEXA 1RCVD 1TS4A 4LAAA 4JI1Q 3J7YW 4L5RC 1KNEA 5EGTA 5C0XG 3GV3A 2X6LA 3FDTA 2R93H 3U9OA 3SK4A 3CCRA 3IFDA 5D3IB 4DFAA 4GOPA 3T1HQ 2D9UA 1CM9A 2B39A 4RH6A 3Q22A 3TS0A 4DR2Q 4P2CB 1MJEA 1B3QA 4GN4B 4J15A 3VYTA 4KD4A 2KCNA 4GNXC 4F7XA 1SYBA 1TIID 5JVH3 4KY6A 2KEDA 4A75A 1VQ5A 1FJGL 2WAQE 1MSGA 1BOSA 4BBSH 2FHTA 1KD1C 2UXBL 2X69A 1L1OB 5GAHC 3KLWA 5JOBA 1LTTD 1PTOC 5KYIA 4O0AA 1N33L 1UNSA 4AYBG 1O7IA 2F0WA 2VUMG 5CC4A 4IOCA 3H3VH 1F9RA 4C3IB 2VQEQ 2F0MA 2L0CA 4A3EB 2MQHA 1ASZA 1GKHA 1HUMA 2PW7A 2JA6H 1YJWA 1H9SB 4BY7H 1UE7A 4K0KQ 3TRZA 3I2ZA 3QB3A 1BO0A 4DV5L 4KHVA 3MA2B 1QWYA 4ZAIA 1PRTB 3KK7A 1LT5D 1U5KA 2I07B 1VQ6A 2IX0A 1H95A 4DUZL 3S1QB 1N36Q 4IO9A 3OIPA 1QOHA 3AMUA 3I72A 2ZT9C 2JA8H 1B4OA 4IFDI 1SYGA 2O5IC 1LTLA 1SNMA 3JAML 3GTOB 3K5NA 2ZJRA 5CV7A 4QGUA 4O42A 3HOZG 2PCFB 1VCIA 4C56C 1SYEA 5FJ8G 4FF1A 2IPKD 4JI7Q 1L1OC 3VA7A 1EUJA 1I6VC 4YCUA 3CQZH 4Y7NB 4JYAL 1GUGA 2K5NA 4UY8C 4LW1A 4LF9Q 1E22A 1U4LA 2EXDA 1U9RA 2PNRC 1JJ2A 1TWGH 4A3EG 1Y1VB 1WD1A 2HQLA 2AQ1B 3SVMA 2FFKB 1F2ZA 1X3PA 2MO0A 4IUTA 1NMFA 1K28A 4OL7A 4CGYB 3PIPA 3SEBA 1PTOD 2PNHA 1DXMA 4IOAA 4L63B 3QG1A 4DGZA 4WFN3 1A3TA 2M2LA 3ITPA 4YIJA 2ZM6L 5EKLA 2ZJQA 2H4OA 5IYBG 3Q0AA 4HJ7A 4X65L 3F2UA 5BR8L 4JI3L 2N55A 3FEWX 1YNNC 2B2UA 4HSVA 1STNA 1W6JA 4MNOA 1FGBD 1PFBA 3K5LA 2RSOA 4HIDA 1HQMC 3U58A 1LT3D 2Z9HA 4R8IA 4BY1B 4XT3B 3G6JB 4OWWB 5K36H 4HEDA 4DAYA 4DR3L 1L0XB 1ZKOA 4DK0A 1KDBA 1KHIA 1MD2D 4LF8L 4IUNA 1EYGA 3SK8A 4ULLA 1HZBA 3J80L 1Y1VG 4V0BA 4R4TA 2LXKA 4C3JH 1VQAA 3LGJA 3V96A 4KJOA 1HZCA 1I50B 2GVBA 2BH2A 2BCOA 3E3XA 2BE5D 1XXGA 1QILA 2F0GA 4R4IA 3VYUA 3S1MB 2WFWA 2YYZA 1EOVA 1X32A 3RD4A 3CPFA 2YTXA 4CDDC 5IT9c 2R7FA 3DHQA 5JPNC 2MO1A 2KA7A 4LUZA 2JYOA 2KCMA 2EXZA 2Z0SA 2HCIA 2SNMA 1RJTA 1K8OA 1L2FA 3NK9A 3AU7A 1SROA 4JI6L 2JK8A 4DV4Q 1UEBA 4C3HG 1VQOA 4OELB 1ONLA 4BY1G 3BZDB 4KHPQ 3TP7A 2B2VA 2MUYA 2K50A 2E2HB 1BBXC 4NKLA 4LJZC 4N9PA 1EY5A 4XIGS 2G9DA 2B63G 1YNND 2CH4A 1IBMQ 1FNWA 1EWHA 1JB3A 1Q1BA 1OO9B 1TWFB 2MGSA 4QF4A 4C1NK 2JXMB 2UUAL 3EROA 1NNXA 1Y1WH 2RVLA 3RR5A 4DV3L 3D8GA 1NSNS 2UUBQ 2A1AA 3URYA 4CJ1B 1KQSA 4FXDA 1A2UA 1FNVA 1I5FA 2X6GA 4TVAB 3S9WA 2Z6KA 3NBHB 3K59A 2LKVA 3ND9A 2QGQA 4QJFA 1TS3A 3MXPA 3ZYYX 1IBKQ 2IHEA 2B2TA 3W1BA 2P5ZX 1PH9A 4PMWA 2C35B 4ZRZA 1PDQA 2VQFQ 2F3IA 4NXML 1T5EA 2JEAI 4KV6A 3PCOB 3Q24A 3M4OB 3STBC 2KEEA 4ALPA 1FVIA 1WTPA 4ZQ3A 3CF5A 1M1KC 1XNRL 4KK7A 4S3SA 1WTHA 2WAQB 3I73A 3DLLA 1BBUA 3GTKB 3PUZA 1WTVA 1HNWL 1HNZL 3RZDH 1IYJB 4DV1Q 3N6RA 1HTPA 4N9TA 2NZOA 2G5DA 3MWYW 1BKBA 2F4VL 3PIOA 1N8RC 4YY3L 1IZ6A 3TZUA 2KJXA 1VS0A 2YTVA 5LMNW 4GKJL 4LF4L 1SMYC 5H1SE 3M4PA 4BA1I 1RD9D 4R8NA 3SR1A 4OXPA 4DV2Q 3CCEA 1F2YA 1Q1EA 4QY7A 4A3DH 1QNUA 1UE1A 2M00A 2F0IA 4FVMA 1AP0A 4A3CH 4P75A 1Y14B 2KHSA 3E9IA 3PO3B 4A3MH 1V8QA 4G4KA 4C2MB 4U673 2D62A 3H09A 4E6IA 2A5HA 5IGGA 3RZOB 4JI5Q 4AYBE 2EQSA 2R92H 3KLSA 1PYSB 3FKIB 4M8AA 2UU9Q 5E4XA 1PMRA 1CKMA 4A3BH 2PI2E 5LHY1 3LWUA 3RMHA 2R7ZB 4MZ9A 1KL9A 3GTQB 3QR8A 3J81L 2E2DC 5CV5A 5A35A 4HIMA 2O5JC 5CV8A 1JWSD 2ZXRA 4F87A 4L5QA 3GTPB 1IYUA 1QCBD 3KF6A 3D4DA 3K0YA 3STBD 4ME3A 5IT9E 4B3ML 5C3EB 4L5SA 4DXGA 4P71A 2CWAA 2L55A 1WVLA 5M3FH 1HA6A 1UE6A 1A0IA 4UAIA 5M5YH 3VR2A 4X62L 1PXUA 2IX3A 1OXUA 2AHOB 2A6HC 2ZXOA 4O2DA 2D0OA 1XMOL 1BF4A 3V05A 2L12A 2DNCA 4HCEA 2YU9H 1II3A 1SMYD 2NVYH 1F9SA 5FKAC 5IY0A 1DJRD 3ND8A 3GTJH 3FKIG 3PUVA 4JI1L 3K8AA 1YZ6A 1EY9A 3JC66 1Z6HA 5C5MA 3VR5A 5T1IA 1LTRD 4KY7A 3D0FA 4OGQC 5EPLA 1ESFA 2C9OA 2XGTA 4BBRH 5IE8A 1IKMA 1UUPA 1JORA 4A3FH 4MN3A 4KHZA 5C44H 3EN2A 5C4XH 3PMFA 5CMDA 3Q8DA 5KIXA 4KN4C 1VQIA 4OEMB 1XTDA 2F0LA 3PUWA 2RDGA 1YHBA 5AFWA 3CC4A 4AH6A 1BXTA 1QVCA 4I7AA 1LT6D 4QUFA 1SFOB 2JA7H 1BCPB 2NN6I 5C4ZA 1EIYB 1YEZA 2WKDA 5LMUQ 3RNUA 1WTWA 1IBLL 1PZKD 2KCTA 3M4YA 5DEHA 1HJPA 3L3OC 1K73C 3CCQA 2MFIA 2PO4A 4RKLA 2K5VA 3H0GH 3QIAA 3D6WA 4OHJA 4LFCQ 3JAMc 4JOIC 2Y0SE 3D31A 3M3YH 1TU2B 2EYPA 3DMUA 2VQEL 4C1NI 4DXFA 2K01A 2PMZE 4DUYQ 2R93G 2MP1A 3KYHC 2F03A 1PH2A 2WB1E 3U50C 1J9OA 5JJIA 4LUOA 1VQGA 4HIKA 4OX9L 5IIFA 1AH9A 1STGA 2A6HD 3CCVA 2ES2A 1YVCA 3FPUB 5J22A 2B3GA 1EWCA 1XPOA 3GTGB 5JVG3 4BBSG 4CDCC 1I3QH 2JA5H 1FD7D 1LTBD 3MVVA 3MC0B 5EPKA 2JE6I 3ERQA 2O4XA 4ZKCB 5M5WH 3HOXB 4V190 1W3SA 3ICEA 3OMGA 3F2DA 4GZYC 3HOUB 4QB4A 4A3IB 2J4XA 3BZCA 1CA5A 2E2IH 4JI7L 2F0KA 2NZ1D 4A3JB 2NVXH 1SDFA 3VDYA 4ZK9B 1V1PB 2B2YC 1AZPA 1R4PB 1EYAA 1X3QA 2Q8TA 3S2DH 5ELDA 1QJOA 2JN4A 2A69C 1K83H 2OQ0A 1VQ7A 4BY7G 4K8JA 1GM5A 1JCKB 3H94A 2ZJPA 5EAYA 3DM1A 1ILPA 4NXNL 5IP7H 4JCVE 3OTOQ 4IFDG 1J5EQ 4A3KH 2EIFA 1VQHA 2QEJC 3WWVA 1EIHA 4XXEA 3HOYB 3FP9A 3PO2H 1TWAB 2XNAC 5GQOA 1KIXA 2UXCQ 1QNKA 4POFA 4GLVB 2HT1A 5DM63 1TWCB 1B44D 5ELEA 2PQAA 3J80c 1VQ9A 5E7NA 5EQ0A 3X3NA 3NBIA 1GUTA 3L0OA 1JMCA 2K5WA 2N8NA 4XQNA 3M4QA 3KF8B 2EE1A 1LLRD 3OOCA 1SLJA 1B1ZA 1XMQL 3DXJC 1Y8OB 1KDAA 3HOUG 4DNIA 1XTCD 3EFXD 4LK1C 1V1QA 2I46A 5LL6X 5JPMC 4GNXB 4EQNA 4A3JG 4QCLA 2KQ3A 3TN2A 3CCLA 1G6PA 1WTXA 1JOQA 1A15A 4B3SL 2PZTA 4RCNA 2AUJD 3I4LA 1Z7TA 3FVQA 1PTOB 2D0PA 3M85A 1L0YB 3U4VA 4OIJA 1QVGA 4AYBB 4A93H 4FDBA 4L8JA 1A63A 4DKAC 4IUUA 5KEEA 2K28A 2VUMB 2DY8A 3GTMB 3M9BA 3QJYA 2RF4A 2G9HD 2A69D 4A3GB 4IFDJ 1EEID 3W3AA 4N8X1 1DZ1A 1CTMA 4JPBW 3S14B 2N3SA 3JAME 1MGSA 4XQJA 4ZUJA 5I2XA 5K36G 3CKIB 5AJ3Q 2OTLA 1SE3A 5C4JB 1VDZA 2L15A 3I4NH 3KOJA 4DV6L 5CYUA 4HSPA 1I6HB 2IWHA 3BVGA 5ELNA 3NWSA 1GVPA 4NMZA 2VW9A 2K05A 2AKWB 4HJAA 4X3TA 2BA1A 3SHLA 2QKIC 4TRDA 1O7LA 2KCCA 3I8ZA 4J1MA 3NTHA 1IXRA 3S15B 2BA0A 1F2MA 3X3MA 4RAUC 3HOZB 2DN8A 1RTOA 5I9OA 3BZKA 2NVQB 2BDNA 3UDGA 2FMCA 3F8TA 5G3LD 4X66L 2NVTH 5GROA 1BNZA 1VF7A 5JEAH 5CV6A 2DUDA 2RDFA 4BXXH 1C48A 3I4MH 1H9JA 4WRDA 2VS1A 3U9SA 4K5WA 5IOCA 1CI3M 4AQYQ 1K8AC 3MFYA 4A76A 1D8LA 3AFQA 1O78A 2UUCQ 3HP3A 2KECA 4EX5A 4DN4M 3S17H 4A3GG 3KBGA 2VQFL 3S1RB 3H3VI 4UDUC 1A62A 2XSCA 1OXTA 3VA5A 1L1OA 3NQTA 1AE2A 1MJCA 4Q0FA 4X64Q 3I3CA 4GOPC 3CCMA 3AB9A 3MHBA 1LUZA 2N78A 2EJGC 1F9QA 3MFGA
chains in the Genus database with same CATH topology
1WCMG 1JE5A 2JA8G 1QZHA 3PGZA 3A5ZB 4BY1G 1G51A 4DR3Q 3T1YL 3M7NA 2H5XA 2FXQA 2OWOA 4KHPQ 5IWAQ 1D7QA 5M3MH 2IT1A 3S1NH 1AE3A 4H02A 2K50A 4JG2A 4P72A 1Q82C 3HKZG 1K0RA 2N49A 3K7UC 4C3HH 2HIVA 4DV1L 1XNQQ 3MXNB 1WCMH 3G4SA 4R4CA 1PH5A 2OCEA 5ELOA 4XIGS 3L2PA 2Q2TA 2B63G 3F2CA 2A8VA 1IBMQ 3HFZB 4IJHA 1Q1BA 1P16A 1X3GA 4XTCS 3PO3G 1B7YB 1N32Q 2VUMH 3S16H 2UUAL 4JV5Q 3J81c 2UXDQ 4JOIA 1Y1WH 3RR5A 4DV3L 2B63H 3RLOA 1Q86C 2E5LL 2UUBQ 3U4ZA 4JI2Q 1YI2A 2A1AA 3AEVA 3HOVH 3PO3H 1YHQA 1L0WA 4C2MH 1KQSA 1VQJA 1I5FA 4TVAB 5JEAJ 3UE0A 3MEFA 2KHJA 2Z6KA 3NBHB 3RZOH 4OO1G 4KLKA 2R7ZG 1XJVA 2QGQA 3OYYA 4QJFA 1Q7YC 1R9TH 1IBKQ 2IHEA 3FKIH 3W1BA 1N9WA 1PH9A 4PMWA 2C35B 4UP8A 4NPSA 2VQFQ 2F3IA 2LXJA 1N34Q 4NXML 2R7ZH 4B3RQ 2JEAI 4GLAC 3E0EA 2JA9A 3GTQH 3PCOB 3I55A 2HIXA 1PYBA 3STBC 4LUVA 4JI6Q 2HHHQ 4ALPA 1FVIA 2UU9L 3CF5A 3HOWH 1SE8A 1M1KC 4B3MQ 1XNRL 2VZAA 4GNXA 4GN5A 4AQYL 4QIWE 5FLMH 1X65A 2JQOA 5C3EG 4DR4Q 3T1YQ 4YWKA 2IX1A 3GTPH 1OXXK 1I94Q 3DLLA 1BBUA 4IJLA 2UUCL 3PUZA 3J81j 2K4KA 1HNWL 1HNZL 3TS2A 1X6OA 3RZDH 1IYJB 4DV1Q 1PA6A 4X62Q 1S40A 2CFMA 5C3EH 1HR0W 1U0LA 4R4OA 2Q2UA 5HY6A 1MIUA 3K80C 2NZOA 4GOPB 3J7A5 1BKBA 2GN5A 3PIOA 2F4VL 1N8RC 4YY3L 4GN3B 1IZ6A 4X64L 4BA2I 1VS0A 4DV4L 2YTVA 1S3OA 2UUAQ 3CXCA 5LMNW 4GKJL 4A3DG 3A74A 3A5UA 4LF4L 2I0QA 3RLFA 4PZ8A 1B8AA 3GDEA 2Y0SG 3M4PA 5H1SE 4KHPL 4BA1I 2PI2A 3UDFA 5IWAL 4DV0L 4OXPA 4YWMA 4DV2Q 2QEXA 3CCEA 1PH1A 3GTLH 1Q1EA 4QY7A 4A3DH 1UE1A 1XNQL 2B29A 1KRTA 1WFQA 4A3CH 1WI5A 4P75A 4HIOA 1Y14B 2R92G 3E9IA 4LNQA 1RL2A 2WB1G 4YWLA 4A3MH 3K7AH 1PHJA 1IBML 1CKOA 2AWNA 2D62A 1VQLA 4BXXG 1N32L 4A3BG 4NXMQ 4JV5L 4LF5L 1TWHH 4OONA 4JI5Q 3FHWA 2EQSA 4AYBE 4B3TL 4RG1A 4TQUS 3NENA 1YITA 2R92H 1VQCA 2F52A 1LYLA 2ID0A 4RMFA 1VQKA 2UUBL 4JI2L 1PYSB 4NB3A 2UU9Q 3ERSX 1CKMA 1PH3A 1XNRQ 4A3BH 3CCUA 1TXYA 2PI2E 3AYHB 4WJ3M 4A3LG 4R1JA 1CKNA 4MZ9A 1KL9A 1VQ8A 2VNUD 4JBKA 4DR6Q 3ULJA 2DGYA 5GAEC 3S2HH 1IBKL 2RHSB 1HNWQ 1HNZQ 2ZTEA 2OQKA 4HIMA 4WJ4A 1Z9FA 4A3LH 1IBLQ 1KRSA 4DV7Q 4B3RL 2MNAA 4L5QA 1SFOH 4PZ6A 2YTYA 3F1ZA 3KF6A 3GD7A 1KXLA 1OXVA 4YY3Q 5IYCG 5M3FG 4Y52H 1X56A 2R7DA 5M3MG 3STBD 4ME3A 4OWXB 2PQAB 4JBWA 5JJKA 4B3ML 1BVSA 4L5SA 4IPHA 2AMCB 1VQDA 4P71A 4HJ9A 4DR4L 2KHIA 2CWAA 2Q2IA 3CCSA 2RCNA 3RLNA 5IYCH 5M3FH 4DV0Q 3HKZE 1I94L 4PG3A 2JEBI 3PV0A 1UE6A 1A0IA 5M5YH 3F2BA 4X62L 1X9NA 2E8GA 3ER0A 1PH6A 2ALYB 4YHHL 1Y1WG 1VQNA 3E9HA 4JI8L 1OXUA 2AHOB 4O2DA 3ZJYC 3HOVG 1J6QA 1NBWA 2CCZA 1WOCA 2D0OA 3JAMi 2GVAA 1XMOL 4OX9Q 4HJ5A 1NE3A 1EQRA 3CMEA 4DK3C 4LF5Q 1K8GA 4A4IA 4PZ7A 4B3TQ 4APVA 4BBRG 4L5TA 3I56A 2YU9H 1EWIA 2NVYH 5C0XJ 3KDFA 5IY0A 5IYDG 1G291 3G6EA 3GTJH 3FKIG 4UPAA 5LMNL 4A3FG 4DV2L 1VQPA 3PUVA 4JI1L 5C44G 3K8AA 1YZ6A 5C4XG 3JC66 1YBYA 1VQEA 4DR1L 4BBRH 2YV5A 2VL6A 3D0FA 2XGTA 5IE8A 3GTGH 2WP8J 3HOXG 5IYDH 3B6YA 2NN6G 4A3FH 1Z47A 4KHZA 1YJNA 3CMAA 3KFUA 4IPGA 1X54A 5J3BA 5C44H 1EQQA 2E2JH 3EN2A 1HZ9A 5C4XH 3CPWA 1E3PA 1IL2A 3HOWG 3ULPA 4A3IG 3Q8DA 2A19A 1KC8C 4JI5L 2LSSA 3UE1A 1VQIA 1Q46A 5GAGC 5FLMG 3HOXH 2JA7G 1N33Q 1XTDA 2IHFA 1DGSA 1UE5A 3HOUH 3PUWA 4UP7A 5FJ8H 4A3IH 1YHBA 3CC4A 4AH6A 4YCVA 1SRUA 4OO1I 1QVCA 1C9OA 2JA7H 1EFWA 3EBEA 5IP9G 3CC7A 4A3JH 4LF7Q 4LFAQ 4DR6L 2NN6I 1C7YA 1EIYB 1YEZA 5LMUQ 4KI0A 3S24A 3RNUA 3H0GG 4NXNQ 5DLQE 3KJOA 1IBLL 3NELA 2KCTA 4DV7L 5IP9H 4YHHQ 3PF5A 4C3IH 1HJPA 4JI8Q 1K73C 5JJLA 1FGUA 2IY5B 4DR7Q 3CCQA 2MFIA 1KAWA 1XMOQ 1HR0Q 4A3EH 1S72A 2OTJA 2K5VA 3H0GH 1SR3A 1JB7A 1VQFA 4LFCQ 3HOYG 3I7FA 3JAMc 4DAYB 4JOIC 1W2BA 4R4QA 2Y0SE 3D31A 3TEHB 1VQ4A 3M3YH 2VQEL 4A3CG 3TQYA 4LF6L 1QUQB 4DUZQ 2PMZE 5LMNQ 4A3MG 4DUYQ 1K9MC 1A8VA 3KYHC 4JBMA 4JI1Q 1PH2A 1TWAH 4L5RC 3HOYH 1X3FA 2Z6KC 5C0XG 4DR1Q 3PO2G 3G48A 1X55A 2WB1E 3U50C 1TWCH 1J5EL 5JJIA 3AFPA 4LUOA 1XMQQ 1NJIC 1VQGA 4HIKA 3CCRA 4OX9L 3S1QH 2R93H 1AH9A 2I5LX 3T1HQ 4GOPA 2NZHA 3OW2A 3CCVA 3I4OA 1CSQA 2ES2A 1YVCA 2CKZB 2Q2HA 3CC2A 3H15A 2B3GA 2UXCL 1XPOA 2R6GA 3J80i 3TS0A 2R93G 4DR2Q 3GTOH 1BBWA 4JBJA 1E1TA 4BBSG 2ASBA 2CWPA 1YIJA 4QQBX 1I3QH 4GN4B 4J15A 1MJEA 2JA5H 1C0AA 2K14A 4GNXC 4X6AH 5C0XI 3PF4A 5HGQA 4A75A 2JE6I 5M5WH 1VQ5A 1W3SA 4B3SQ 1FJGL 3ICEA 2WAQE 4BBSH 3F2DA 3UDIA 1GO3E 1UWVA 1KD1C 4Y7NH 1NTGA 2UXBL 2JJQA 3CP0A 1L1OB 3BZCA 5GAHC 1K3RA 3KLWA 2E2IH 4JI7L 1E7ZA 4O0AA 1N33L 2NVXH 4AYBG 4EQ5A 1O7IA 3VDYA 4AIMA 3GO5A 1Y1VH 2VUMG 4IOCA 3CD6A 3W5OA 3H3VH 3S2DH 2VQEQ 2QA4A 2CQOA 2ZTCA 1K83H 2OQ0A 1VQ7A 4LF7L 4LF6Q 4BY7G 4LFAL 3DM3A 2ZM6Q 3J7ZC 2ZJPA 4LWCA 2MQHA 1GM5A 5EAYA 5LMUL 4GLXA 1ASZA 3CW2C 5BR8Q 4NXNL 2I5HA 4POGA 1GKHA 1NMGA 5IP7H 4JCVE 3OTOQ 3GTMH 4GKKL 2JA6H 1YJWA 4IFDG 1SN8A 3L7ZC 1J5EQ 4BY7H 4A3KH 1M90C 1JJCB 1UE7A 4UP9A 4HJ8A 2EIFA 1VQHA 4K0KQ 2XTIA 3WWVA 3TRZA 3I2ZA 1HR0L 4DV5L 3FP9A 4A3GH 3PO2H 4LFCL 5GQOA 1KIXA 4DV6Q 1YHAA 2UXCQ 4POFA 1U5KA 4GLVB 1PH7A 3S14H 2HT1A 4DAMA 1VQ6A 3SGIA 3CCJA 1X3EA 2IX0A 2PQAA 1VQBA 3J80c 1VQ9A 1H95A 5E7NA 4DUZL 1Q8KA 1N36Q 4DUYL 3L0OA 1JMCA 5C4JH 1PVOA 4DPGA 4IO9A 2N8NA 2BH8A 3HKSA 2JA8H 1E1OA 4IFDI 4BY1H 3RN2A 3M4QA 1FJGQ 1LTLA 3KF8B 1I6HH 4LF8Q 1CSPA 2ZJRA 1SLJA 4QGUA 2RHQB 1RIPA 1XMQL 1YNXA 3CAMA 1V9PA 2UXBQ 3HOUG 5AJ3L 3HOZG 4DNIA 3T1HL 1VCIA 3IRBA 5FJ8G 1JT8A 1EIFA 1V1QA 1OTCA 4JI4L 1Q12A 1NY4A 4IPDA 4X66Q 4JI7Q 1L1OC 2KENA 4DR2L 3S15H 4GNXB 1EUJA 4A3JG 4YCUA 3CQZH 3HOZH 4JYAL 2K5NA 1HZAA 1ASYA 4UY8C 4LW1A 1MKHA 3EIVA 4LF9Q 2NVQH 1E22A 3KJPA 3CCLA 1G6PA 2EXDA 3TREA 1LM0A 4B3SL 1JJ2A 1TWGH 4A93G 1I50H 1GD7A 1PV4A 4A3EG 1WJJA 2HQLA 2D0PA 3M85A 2MO0A 4GKKQ 1NMFA 3S1MH 3U4VA 4LFBL 1QVGA 3NEMA 1HNXL 4A93H 4FDBA 3PIPA 2ATWA 4DKAC 1A63A 4DV5Q 2PNHA 4IOAA 4OWTB 1B70B 3M9BA 3S1RH 1QVFA 2RF4A 4DR5L 2ZM6L 1PH8A 2ZJQA 4IFDJ 5IYBG 4HJ7A 4X65L 5BR8L 4JI3L 3I4NG 3ULLA 3OTOL 2N3SA 4IPCA 4QL5A 4MNOA 2ZTDA 5FLXc 1P8LA 1QZGA 2AWOA 4K0KL 5K36G 5IYBH 4HIDA 3PUXA 4JI0L 5AJ3Q 2OTLA 3U58A 2E2HH 2JA5G 2L15A 3I4NH 1V43A 5M5XH 1WYDA 3KOJA 3G71A 4DV6L 4JI4Q 4DV3Q 3PUYA 1FL0A 4GS3A 2E5LQ 4OWWB 2K52A 4DR3L 5ELNA 1CKNB 4JYAQ 1GVPA 1TWFH 1N36L 2VW9A 4P74A 2AKWB 2I5MX 4HJAA 1CUKA 1QUQA 3PSIA 2BA1A 3BJUA 1XPUA 1IXRA 2BA0A 1KHIA 4LF8L 5JEAG 3W1GA 1EYGA 4YCWA 1HZBA 2VY3A 3J81i 3I4MG 1T9HA 3KF6B 2V1CC 3K81C 1Y1VG 3BZKA 2UXDL 3UDGA 3F8TA 4R4TA 4LFBQ 2LXKA 4C3JH 3RN5A 1VQAA 4X66L 3LGJA 5GROA 1HNXQ 1E24A 2NVTH 1SMXA 1HZCA 2DUDA 1PH4A 4BXXH 2K75A 3I4MH 2VS1A 2GVBA 3UDXA 2BH2A 4P73A 5GADC 1JJGA 4AQYQ 4R4IA 3AQQA 5IP7G 4LF9L 1K8AC 2WFWA 4A76A 2YYZA 1D8LA 1EOVA 1Q81C 4MTNA 3CPFA 2YTXA 1VQMA 4DR5Q 3AFQA 2JA6G 3M4OH 5IT9c 4A3KG 1XPRA 4JC0A 2R7FA 2UUCQ 2K5HA 2WAQG 3K0XA 1PFSA 2MO1A 4LUZA 4DR7L 4EX5A 1HH2P 2KCMA 2Z0SA 4X65Q 1YJ9A 3S17H 4A3GG 4JI3Q 2VQFL 1N34L 1L2FA 3BU2A 3H3VI 4DK6C 1A62A 1OXTA 2F4VQ 1L1OA 1AE2A 1MJCA 1SROA 2KBNA 4X64Q 2HHHL 4JI0Q 4JI6L 3GTKH 4GOPC 2JK8A 4DV4Q 3CCMA 3A0JA 1LUZA 1UEBA 1VQOA 2N78A 4GKJQ 4LF4Q 3KDFB 1OXSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM G;  1JE5 A;  2JA8 G;  1QZH A;  3PGZ A;  3A5Z B;  4BY1 G;  1G51 A;  4DR3 Q;  3T1Y L;  3M7N A;  2H5X A;  2FXQ A;  2OWO A;  4KHP Q;  5IWA Q;  1D7Q A;  5M3M H;  2IT1 A;  3S1N H;  1AE3 A;  4H02 A;  2K50 A;  4JG2 A;  4P72 A;  1Q82 C;  3HKZ G;  1K0R A;  2N49 A;  3K7U C;  4C3H H;  2HIV A;  4DV1 L;  1XNQ Q;  3MXN B;  1WCM H;  3G4S A;  4R4C A;  1PH5 A;  2OCE A;  5ELO A;  4XIG S;  3L2P A;  2Q2T A;  2B63 G;  3F2C A;  2A8V A;  1IBM Q;  3HFZ B;  4IJH A;  1Q1B A;  1P16 A;  1X3G A;  4XTC S;  3PO3 G;  1B7Y B;  1N32 Q;  2VUM H;  3S16 H;  2UUA L;  4JV5 Q;  3J81 c;  2UXD Q;  4JOI A;  1Y1W H;  3RR5 A;  4DV3 L;  2B63 H;  3RLO A;  1Q86 C;  2E5L L;  2UUB Q;  3U4Z A;  4JI2 Q;  1YI2 A;  2A1A A;  3AEV A;  3HOV H;  3PO3 H;  1YHQ A;  1L0W A;  4C2M H;  1KQS A;  1VQJ A;  1I5F A;  4TVA B;  5JEA J;  3UE0 A;  3MEF A;  2KHJ A;  2Z6K A;  3NBH B;  3RZO H;  4OO1 G;  4KLK A;  2R7Z G;  1XJV A;  2QGQ A;  3OYY A;  4QJF A;  1Q7Y C;  1R9T H;  1IBK Q;  2IHE A;  3FKI H;  3W1B A;  1N9W A;  1PH9 A;  4PMW A;  2C35 B;  4UP8 A;  4NPS A;  2VQF Q;  2F3I A;  2LXJ A;  1N34 Q;  4NXM L;  2R7Z H;  4B3R Q;  2JEA I;  4GLA C;  3E0E A;  2JA9 A;  3GTQ H;  3PCO B;  3I55 A;  2HIX A;  1PYB A;  3STB C;  4LUV A;  4JI6 Q;  2HHH Q;  4ALP A;  1FVI A;  2UU9 L;  3CF5 A;  3HOW H;  1SE8 A;  1M1K C;  4B3M Q;  1XNR L;  2VZA A;  4GNX A;  4GN5 A;  4AQY L;  4QIW E;  5FLM H;  1X65 A;  2JQO A;  5C3E G;  4DR4 Q;  3T1Y Q;  4YWK A;  2IX1 A;  3GTP H;  1OXX K;  1I94 Q;  3DLL A;  1BBU A;  4IJL A;  2UUC L;  3PUZ A;  3J81 j;  2K4K A;  1HNW L;  1HNZ L;  3TS2 A;  1X6O A;  3RZD H;  1IYJ B;  4DV1 Q;  1PA6 A;  4X62 Q;  1S40 A;  2CFM A;  5C3E H;  1HR0 W;  1U0L A;  4R4O A;  2Q2U A;  5HY6 A;  1MIU A;  3K80 C;  2NZO A;  4GOP B;  3J7A 5;  1BKB A;  2GN5 A;  3PIO A;  2F4V L;  1N8R C;  4YY3 L;  4GN3 B;  1IZ6 A;  4X64 L;  4BA2 I;  1VS0 A;  4DV4 L;  2YTV A;  1S3O A;  2UUA Q;  3CXC A;  5LMN W;  4GKJ L;  4A3D G;  3A74 A;  3A5U A;  4LF4 L;  2I0Q A;  3RLF A;  4PZ8 A;  1B8A A;  3GDE A;  2Y0S G;  3M4P A;  5H1S E;  4KHP L;  4BA1 I;  2PI2 A;  3UDF A;  5IWA L;  4DV0 L;  4OXP A;  4YWM A;  4DV2 Q;  2QEX A;  3CCE A;  1PH1 A;  3GTL H;  1Q1E A;  4QY7 A;  4A3D H;  1UE1 A;  1XNQ L;  2B29 A;  1KRT A;  1WFQ A;  4A3C H;  1WI5 A;  4P75 A;  4HIO A;  1Y14 B;  2R92 G;  3E9I A;  4LNQ A;  1RL2 A;  2WB1 G;  4YWL A;  4A3M H;  3K7A H;  1PHJ A;  1IBM L;  1CKO A;  2AWN A;  2D62 A;  1VQL A;  4BXX G;  1N32 L;  4A3B G;  4NXM Q;  4JV5 L;  4LF5 L;  1TWH H;  4OON A;  4JI5 Q;  3FHW A;  2EQS A;  4AYB E;  4B3T L;  4RG1 A;  4TQU S;  3NEN A;  1YIT A;  2R92 H;  1VQC A;  2F52 A;  1LYL A;  2ID0 A;  4RMF A;  1VQK A;  2UUB L;  4JI2 L;  1PYS B;  4NB3 A;  2UU9 Q;  3ERS X;  1CKM A;  1PH3 A;  1XNR Q;  4A3B H;  3CCU A;  1TXY A;  2PI2 E;  3AYH B;  4WJ3 M;  4A3L G;  4R1J A;  1CKN A;  4MZ9 A;  1KL9 A;  1VQ8 A;  2VNU D;  4JBK A;  4DR6 Q;  3ULJ A;  2DGY A;  5GAE C;  3S2H H;  1IBK L;  2RHS B;  1HNW Q;  1HNZ Q;  2ZTE A;  2OQK A;  4HIM A;  4WJ4 A;  1Z9F A;  4A3L H;  1IBL Q;  1KRS A;  4DV7 Q;  4B3R L;  2MNA A;  4L5Q A;  1SFO H;  4PZ6 A;  2YTY A;  3F1Z A;  3KF6 A;  3GD7 A;  1KXL A;  1OXV A;  4YY3 Q;  5IYC G;  5M3F G;  4Y52 H;  1X56 A;  2R7D A;  5M3M G;  3STB D;  4ME3 A;  4OWX B;  2PQA B;  4JBW A;  5JJK A;  4B3M L;  1BVS A;  4L5S A;  4IPH A;  2AMC B;  1VQD A;  4P71 A;  4HJ9 A;  4DR4 L;  2KHI A;  2CWA A;  2Q2I A;  3CCS A;  2RCN A;  3RLN A;  5IYC H;  5M3F H;  4DV0 Q;  3HKZ E;  1I94 L;  4PG3 A;  2JEB I;  3PV0 A;  1UE6 A;  1A0I A;  5M5Y H;  3F2B A;  4X62 L;  1X9N A;  2E8G A;  3ER0 A;  1PH6 A;  2ALY B;  4YHH L;  1Y1W G;  1VQN A;  3E9H A;  4JI8 L;  1OXU A;  2AHO B;  4O2D A;  3ZJY C;  3HOV G;  1J6Q A;  1NBW A;  2CCZ A;  1WOC A;  2D0O A;  3JAM i;  2GVA A;  1XMO L;  4OX9 Q;  4HJ5 A;  1NE3 A;  1EQR A;  3CME A;  4DK3 C;  4LF5 Q;  1K8G A;  4A4I A;  4PZ7 A;  4B3T Q;  4APV A;  4BBR G;  4L5T A;  3I56 A;  2YU9 H;  1EWI A;  2NVY H;  5C0X J;  3KDF A;  5IY0 A;  5IYD G;  1G29 1;  3G6E A;  3GTJ H;  3FKI G;  4UPA A;  5LMN L;  4A3F G;  4DV2 L;  1VQP A;  3PUV A;  4JI1 L;  5C44 G;  3K8A A;  1YZ6 A;  5C4X G;  3JC6 6;  1YBY A;  1VQE A;  4DR1 L;  4BBR H;  2YV5 A;  2VL6 A;  3D0F A;  2XGT A;  5IE8 A;  3GTG H;  2WP8 J;  3HOX G;  5IYD H;  3B6Y A;  2NN6 G;  4A3F H;  1Z47 A;  4KHZ A;  1YJN A;  3CMA A;  3KFU A;  4IPG A;  1X54 A;  5J3B A;  5C44 H;  1EQQ A;  2E2J H;  3EN2 A;  1HZ9 A;  5C4X H;  3CPW A;  1E3P A;  1IL2 A;  3HOW G;  3ULP A;  4A3I G;  3Q8D A;  2A19 A;  1KC8 C;  4JI5 L;  2LSS A;  3UE1 A;  1VQI A;  1Q46 A;  5GAG C;  5FLM G;  3HOX H;  2JA7 G;  1N33 Q;  1XTD A;  2IHF A;  1DGS A;  1UE5 A;  3HOU H;  3PUW A;  4UP7 A;  5FJ8 H;  4A3I H;  1YHB A;  3CC4 A;  4AH6 A;  4YCV A;  1SRU A;  4OO1 I;  1QVC A;  1C9O A;  2JA7 H;  1EFW A;  3EBE A;  5IP9 G;  3CC7 A;  4A3J H;  4LF7 Q;  4LFA Q;  4DR6 L;  2NN6 I;  1C7Y A;  1EIY B;  1YEZ A;  5LMU Q;  4KI0 A;  3S24 A;  3RNU A;  3H0G G;  4NXN Q;  5DLQ E;  3KJO A;  1IBL L;  3NEL A;  2KCT A;  4DV7 L;  5IP9 H;  4YHH Q;  3PF5 A;  4C3I H;  1HJP A;  4JI8 Q;  1K73 C;  5JJL A;  1FGU A;  2IY5 B;  4DR7 Q;  3CCQ A;  2MFI A;  1KAW A;  1XMO Q;  1HR0 Q;  4A3E H;  1S72 A;  2OTJ A;  2K5V A;  3H0G H;  1SR3 A;  1JB7 A;  1VQF A;  4LFC Q;  3HOY G;  3I7F A;  3JAM c;  4DAY B;  4JOI C;  1W2B A;  4R4Q A;  2Y0S E;  3D31 A;  3TEH B;  1VQ4 A;  3M3Y H;  2VQE L;  4A3C G;  3TQY A;  4LF6 L;  1QUQ B;  4DUZ Q;  2PMZ E;  5LMN Q;  4A3M G;  4DUY Q;  1K9M C;  1A8V A;  3KYH C;  4JBM A;  4JI1 Q;  1PH2 A;  1TWA H;  4L5R C;  3HOY H;  1X3F A;  2Z6K C;  5C0X G;  4DR1 Q;  3PO2 G;  3G48 A;  1X55 A;  2WB1 E;  3U50 C;  1TWC H;  1J5E L;  5JJI A;  3AFP A;  4LUO A;  1XMQ Q;  1NJI C;  1VQG A;  4HIK A;  3CCR A;  4OX9 L;  3S1Q H;  2R93 H;  1AH9 A;  2I5L X;  3T1H Q;  4GOP A;  2NZH A;  3OW2 A;  3CCV A;  3I4O A;  1CSQ A;  2ES2 A;  1YVC A;  2CKZ B;  2Q2H A;  3CC2 A;  3H15 A;  2B3G A;  2UXC L;  1XPO A;  2R6G A;  3J80 i;  3TS0 A;  2R93 G;  4DR2 Q;  3GTO H;  1BBW A;  4JBJ A;  1E1T A;  4BBS G;  2ASB A;  2CWP A;  1YIJ A;  4QQB X;  1I3Q H;  4GN4 B;  4J15 A;  1MJE A;  2JA5 H;  1C0A A;  2K14 A;  4GNX C;  4X6A H;  5C0X I;  3PF4 A;  5HGQ A;  4A75 A;  2JE6 I;  5M5W H;  1VQ5 A;  1W3S A;  4B3S Q;  1FJG L;  3ICE A;  2WAQ E;  4BBS H;  3F2D A;  3UDI A;  1GO3 E;  1UWV A;  1KD1 C;  4Y7N H;  1NTG A;  2UXB L;  2JJQ A;  3CP0 A;  1L1O B;  3BZC A;  5GAH C;  1K3R A;  3KLW A;  2E2I H;  4JI7 L;  1E7Z A;  4O0A A;  1N33 L;  2NVX H;  4AYB G;  4EQ5 A;  1O7I A;  3VDY A;  4AIM A;  3GO5 A;  1Y1V H;  2VUM G;  4IOC A;  3CD6 A;  3W5O A;  3H3V H;  3S2D H;  2VQE Q;  2QA4 A;  2CQO A;  2ZTC A;  1K83 H;  2OQ0 A;  1VQ7 A;  4LF7 L;  4LF6 Q;  4BY7 G;  4LFA L;  3DM3 A;  2ZM6 Q;  3J7Z C;  2ZJP A;  4LWC A;  2MQH A;  1GM5 A;  5EAY A;  5LMU L;  4GLX A;  1ASZ A;  3CW2 C;  5BR8 Q;  4NXN L;  2I5H A;  4POG A;  1GKH A;  1NMG A;  5IP7 H;  4JCV E;  3OTO Q;  3GTM H;  4GKK L;  2JA6 H;  1YJW A;  4IFD G;  1SN8 A;  3L7Z C;  1J5E Q;  4BY7 H;  4A3K H;  1M90 C;  1JJC B;  1UE7 A;  4UP9 A;  4HJ8 A;  2EIF A;  1VQH A;  4K0K Q;  2XTI A;  3WWV A;  3TRZ A;  3I2Z A;  1HR0 L;  4DV5 L;  3FP9 A;  4A3G H;  3PO2 H;  4LFC L;  5GQO A;  1KIX A;  4DV6 Q;  1YHA A;  2UXC Q;  4POF A;  1U5K A;  4GLV B;  1PH7 A;  3S14 H;  2HT1 A;  4DAM A;  1VQ6 A;  3SGI A;  3CCJ A;  1X3E A;  2IX0 A;  2PQA A;  1VQB A;  3J80 c;  1VQ9 A;  1H95 A;  5E7N A;  4DUZ L;  1Q8K A;  1N36 Q;  4DUY L;  3L0O A;  1JMC A;  5C4J H;  1PVO A;  4DPG A;  4IO9 A;  2N8N A;  2BH8 A;  3HKS A;  2JA8 H;  1E1O A;  4IFD I;  4BY1 H;  3RN2 A;  3M4Q A;  1FJG Q;  1LTL A;  3KF8 B;  1I6H H;  4LF8 Q;  1CSP A;  2ZJR A;  1SLJ A;  4QGU A;  2RHQ B;  1RIP A;  1XMQ L;  1YNX A;  3CAM A;  1V9P A;  2UXB Q;  3HOU G;  5AJ3 L;  3HOZ G;  4DNI A;  3T1H L;  1VCI A;  3IRB A;  5FJ8 G;  1JT8 A;  1EIF A;  1V1Q A;  1OTC A;  4JI4 L;  1Q12 A;  1NY4 A;  4IPD A;  4X66 Q;  4JI7 Q;  1L1O C;  2KEN A;  4DR2 L;  3S15 H;  4GNX B;  1EUJ A;  4A3J G;  4YCU A;  3CQZ H;  3HOZ H;  4JYA L;  2K5N A;  1HZA A;  1ASY A;  4UY8 C;  4LW1 A;  1MKH A;  3EIV A;  4LF9 Q;  2NVQ H;  1E22 A;  3KJP A;  3CCL A;  1G6P A;  2EXD A;  3TRE A;  1LM0 A;  4B3S L;  1JJ2 A;  1TWG H;  4A93 G;  1I50 H;  1GD7 A;  1PV4 A;  4A3E G;  1WJJ A;  2HQL A;  2D0P A;  3M85 A;  2MO0 A;  4GKK Q;  1NMF A;  3S1M H;  3U4V A;  4LFB L;  1QVG A;  3NEM A;  1HNX L;  4A93 H;  4FDB A;  3PIP A;  2ATW A;  4DKA C;  1A63 A;  4DV5 Q;  2PNH A;  4IOA A;  4OWT B;  1B70 B;  3M9B A;  3S1R H;  1QVF A;  2RF4 A;  4DR5 L;  2ZM6 L;  1PH8 A;  2ZJQ A;  4IFD J;  5IYB G;  4HJ7 A;  4X65 L;  5BR8 L;  4JI3 L;  3I4N G;  3ULL A;  3OTO L;  2N3S A;  4IPC A;  4QL5 A;  4MNO A;  2ZTD A;  5FLX c;  1P8L A;  1QZG A;  2AWO A;  4K0K L;  5K36 G;  5IYB H;  4HID A;  3PUX A;  4JI0 L;  5AJ3 Q;  2OTL A;  3U58 A;  2E2H H;  2JA5 G;  2L15 A;  3I4N H;  1V43 A;  5M5X H;  1WYD A;  3KOJ A;  3G71 A;  4DV6 L;  4JI4 Q;  4DV3 Q;  3PUY A;  1FL0 A;  4GS3 A;  2E5L Q;  4OWW B;  2K52 A;  4DR3 L;  5ELN A;  1CKN B;  4JYA Q;  1GVP A;  1TWF H;  1N36 L;  2VW9 A;  4P74 A;  2AKW B;  2I5M X;  4HJA A;  1CUK A;  1QUQ A;  3PSI A;  2BA1 A;  3BJU A;  1XPU A;  1IXR A;  2BA0 A;  1KHI A;  4LF8 L;  5JEA G;  3W1G A;  1EYG A;  4YCW A;  1HZB A;  2VY3 A;  3J81 i;  3I4M G;  1T9H A;  3KF6 B;  2V1C C;  3K81 C;  1Y1V G;  3BZK A;  2UXD L;  3UDG A;  3F8T A;  4R4T A;  4LFB Q;  2LXK A;  4C3J H;  3RN5 A;  1VQA A;  4X66 L;  3LGJ A;  5GRO A;  1HNX Q;  1E24 A;  2NVT H;  1SMX A;  1HZC A;  2DUD A;  1PH4 A;  4BXX H;  2K75 A;  3I4M H;  2VS1 A;  2GVB A;  3UDX A;  2BH2 A;  4P73 A;  5GAD C;  1JJG A;  4AQY Q;  4R4I A;  3AQQ A;  5IP7 G;  4LF9 L;  1K8A C;  2WFW A;  4A76 A;  2YYZ A;  1D8L A;  1EOV A;  1Q81 C;  4MTN A;  3CPF A;  2YTX A;  1VQM A;  4DR5 Q;  3AFQ A;  2JA6 G;  3M4O H;  5IT9 c;  4A3K G;  1XPR A;  4JC0 A;  2R7F A;  2UUC Q;  2K5H A;  2WAQ G;  3K0X A;  1PFS A;  2MO1 A;  4LUZ A;  4DR7 L;  4EX5 A;  1HH2 P;  2KCM A;  2Z0S A;  4X65 Q;  1YJ9 A;  3S17 H;  4A3G G;  4JI3 Q;  2VQF L;  1N34 L;  1L2F A;  3BU2 A;  3H3V I;  4DK6 C;  1A62 A;  1OXT A;  2F4V Q;  1L1O A;  1AE2 A;  1MJC A;  1SRO A;  2KBN A;  4X64 Q;  2HHH L;  4JI0 Q;  4JI6 L;  3GTK H;  4GOP C;  2JK8 A;  4DV4 Q;  3CCM A;  3A0J A;  1LUZ A;  1UEB A;  1VQO A;  2N78 A;  4GKJ Q;  4LF4 Q;  3KDF B;  1OXS C; 
#chains in the Genus database with same CATH topology
 5ISR A;  4PV1 C;  1JE5 A;  4FF3 A;  1D7Q A;  2H5X A;  5M3M H;  3S1N H;  1AE3 A;  2N49 A;  5M5X B;  1QE6 A;  2HIV A;  4DV1 L;  1XNQ Q;  3MXN B;  1WCM H;  4BWG B;  3G4S A;  2OCE A;  2Q2T A;  3F2C A;  3HFZ B;  1H9S A;  3J80 E;  1SAP A;  5EPJ A;  3J81 c;  3TBI B;  3QOL A;  2F1M A;  2Y0S B;  1LTS D;  1Q86 C;  2E5L L;  5BN4 A;  3HOV H;  4JI2 Q;  5KNB A;  4G7H C;  3H6M A;  2LFN A;  2BE5 C;  3A8K E;  2PMZ B;  3L9A X;  3HG9 A;  1VQJ A;  3C3L A;  3MEF A;  2KHJ A;  1Y8N B;  3G7L A;  4KLK A;  2WB1 B;  3OYY A;  5COR A;  1Q7Y C;  1R9T H;  1QB5 D;  1N9W A;  3BYT B;  5NUC A;  4UP8 A;  5K5P A;  4OO1 H;  4KKS A;  2QDB A;  4CDF C;  2TMP A;  3DWP A;  4GLA C;  3E0E A;  2HIX A;  4LUV A;  4XQQ A;  1SE4 A;  2OF1 A;  1MSH A;  2CHB D;  2UU9 L;  3HOW H;  1SE8 A;  1DM0 B;  3NXW A;  5FLM H;  2JQO A;  4MIU A;  4DR4 Q;  2WV6 D;  3T1Y Q;  3TP8 A;  4YWK A;  2IX1 A;  1I94 Q;  4X3K A;  1JOO A;  3TS2 A;  1X6O A;  3K6O A;  4R4O A;  5HY6 A;  5KYL A;  1D1K A;  3K80 C;  3IL8 A;  2GN5 A;  1SYF A;  2OXP A;  5IGD A;  3BDO A;  4C3H B;  3T13 A;  3CXC A;  4A3D G;  5C3W A;  4JK1 C;  3A5U A;  2I0Q A;  1AFP A;  3LNN A;  2Y0S G;  5L37 A;  5KNC A;  5IWA L;  2E76 C;  4YWM A;  5CR3 A;  4DNT B;  2VXW A;  2QEX A;  3GTL H;  1GHJ A;  3S16 B;  2Q8I B;  4H7B A;  1EYD A;  4CJ0 B;  3WOE A;  2B63 B;  3NSW A;  1O80 A;  1WTQ A;  2R92 G;  1TR5 A;  1PRT F;  2WB1 G;  3K7A H;  2NTT A;  1D5M C;  5C0X H;  1N32 L;  4A3B G;  4JV5 L;  4K14 A;  1TWH H;  2ICE C;  5M9O A;  1EEF D;  1YIT A;  1VQC A;  4RMF A;  2HD3 A;  4EGV A;  4NB3 A;  2O2L D;  3ERS X;  3CCU A;  1TXY A;  3AYH B;  4WJ3 M;  5IGF A;  4R1J A;  3VR6 A;  1VQ8 A;  2RQX A;  3ULJ A;  1G91 A;  2RHS B;  2ZTE A;  4A3L H;  1SYC A;  1Q90 A;  2B2U C;  5EBC A;  4DV7 Q;  4B3R L;  3BYY B;  3FPP A;  4RGN A;  2RSN A;  1LO5 D;  1TVX A;  5M3F G;  3MTS A;  4KTA A;  5EKI A;  3FMC A;  4XDX A;  4IPH A;  2AMC B;  4F8M A;  4HJ9 A;  3CCS A;  1S5B D;  5IYC H;  2HUG A;  4DV0 Q;  3HKZ E;  2JEB I;  3PV0 A;  2AQ3 B;  3LWE A;  4BS9 A;  3OW7 A;  1SXT A;  4K5X A;  1EU4 A;  2ALY B;  1VQN A;  1NBW A;  3JAM i;  1A3V A;  2KOL A;  1NE3 A;  1EQR A;  4DK3 C;  5J1Z A;  4A4I A;  3DWQ A;  4BBR G;  3E6Z X;  3R2T A;  3A55 A;  3OHX C;  1G29 1;  4A3F G;  1LV9 A;  5C44 G;  5C4X G;  1K8M A;  1Q3L A;  2VL6 A;  3TP6 A;  3J81 E;  5IYD H;  2F0H A;  2NN6 G;  2F0O A;  4ZCK A;  3KFU A;  3CMA A;  1YNJ C;  2EPB A;  4HN7 A;  4FXG C;  3CPW A;  3BVZ A;  3NHH A;  4XT1 B;  2Z6B A;  1C4Q A;  3S2H B;  2JA7 G;  1N33 Q;  2XRQ D;  2IHF A;  4EQP A;  1SNC A;  3H91 A;  5FJ8 H;  2EYL A;  3T53 B;  2EYM A;  2CH4 W;  3EBE A;  4DR6 L;  1SYD A;  2MHV A;  1XYI A;  1G2S A;  3NBH A;  1CT1 D;  5A2Q E;  3D4W A;  3H0G G;  1RKN A;  5DLQ E;  3KJO A;  2EY6 A;  1EOT A;  4YHH Q;  3PF5 A;  4C3I H;  1U4P A;  4JI8 Q;  4O1N A;  1FGU A;  5I2Y A;  4A3E H;  4IUQ A;  1SR3 A;  1RDP D;  1MHW C;  4N8F A;  3I7F A;  1W2B A;  2CW0 C;  3NP8 A;  4DAP A;  1QUQ B;  4DUZ Q;  4H13 C;  5D14 A;  3D6C A;  5LMN Q;  4JBM A;  1K9M C;  5IGC A;  2EJF C;  3A7A B;  2Z6K C;  1KNA A;  3G48 A;  1J5E L;  2D5D A;  3AFP A;  2B2T C;  4K5V A;  3S1Q H;  3OW2 A;  2NZH A;  4DF7 A;  3I4O A;  1CSQ A;  2CKZ B;  2Q2H A;  3CC2 A;  1GUO A;  1CFM A;  2UXC L;  2R6G A;  3J80 i;  5HGT A;  3GTO H;  1BBW A;  3DEP A;  1B50 A;  2ASB A;  4QQB X;  5CBA E;  2E2J B;  1I4Q A;  4CBV A;  3Q6S A;  3QOJ A;  2FMM A;  2HDM A;  4CJ2 C;  1EQT A;  5I6W A;  1JE4 A;  2EY2 A;  2PZW A;  4Y7N H;  1NTG A;  2JJQ A;  3CP0 A;  4RHS A;  1YNJ D;  1K3R A;  1E7Z A;  1SJE D;  1OXS C;  4EQ5 A;  5CGK A;  4KN7 C;  2C5C A;  3GO5 A;  1Y1V H;  2NBF A;  2QA4 A;  2CQO A;  2ZTC A;  3EQL C;  4LF7 L;  4LF6 Q;  1DOK A;  3DM3 A;  1F9P A;  1VMC A;  2ZM6 Q;  4LFA L;  3J7Z C;  1GOZ A;  1MBY A;  1S4Z A;  1KAB A;  2HDL A;  3HRZ C;  5BR8 Q;  4POG A;  3PO2 G;  1LAB A;  1M90 C;  4UP9 A;  2QDL A;  1HR0 L;  4DA2 A;  3MZ5 A;  1YHA A;  3TME A;  1PH7 A;  2LS0 1;  1ENF A;  4DAM A;  2CW0 D;  1X3E A;  1VQB A;  2R93 B;  2KVM A;  1Q8K A;  1B3A A;  1PVO A;  1ENA A;  4DPG A;  2BH8 A;  2K5Q A;  5E4W C;  3TZD A;  3NTI A;  1E1O A;  4BY1 H;  3RN2 A;  1NR2 A;  4LF8 Q;  1CSP A;  2F4I A;  3SK5 A;  1RIP A;  1YNX A;  3CAM A;  1V9P A;  5AJ3 L;  3T1H L;  1I4X A;  1TQO A;  2JP1 A;  1HXY D;  1EIF A;  1GJX A;  1Q12 A;  1JC7 A;  4BBS B;  2KEN A;  4DR2 L;  2Z1C A;  5D3D A;  1E2W A;  1GUW A;  1NAP A;  2D2C C;  4KY5 A;  1D2B A;  3TRE A;  1LM0 A;  4A93 G;  3C46 A;  1I50 H;  1PV4 A;  4GKK Q;  4Q5V A;  3S1M H;  3M7G A;  4ODG A;  1AN8 A;  2L5T A;  5E1F A;  1DYQ A;  2RDH A;  2JA6 B;  1Q8I A;  4BY7 B;  3OWE B;  1CQV A;  1QVF A;  2WIN B;  1DD2 A;  2Z8L A;  4H44 C;  1U4M A;  2K33 A;  1PH8 A;  1K0S A;  5FO7 B;  3N52 A;  1SND A;  3VR3 A;  3I4N G;  5TSS A;  1BR9 A;  4IPC A;  3WDN A;  1Y69 U;  4K0K L;  2AWO A;  1SNQ A;  2K03 A;  4KKT A;  2E2H H;  1WYD A;  4J8Q A;  3FRP B;  2JA8 B;  4JI4 Q;  4DV3 Q;  4X3S A;  3PUY A;  4GS3 A;  4KKU A;  1CKN B;  2F3V A;  1LTG D;  3HKZ B;  5KGU A;  1N36 L;  1TWF H;  4P74 A;  2I5M X;  1LTA D;  3K58 A;  1CUK A;  3BJU A;  1XWE A;  4NW2 A;  1XPU A;  1I4G A;  5DM7 3;  2M9V A;  4PQX A;  1M4V A;  3CQZ B;  5JEA G;  4YCW A;  3J81 i;  3I4M G;  1T9H A;  2V1C C;  1NCV A;  4LFB Q;  3RN5 A;  4H0L C;  2SOB A;  1HNX Q;  4G57 A;  3BS1 A;  1E24 A;  1TWG B;  2A68 C;  3H3V C;  1W6K A;  4G7Z C;  1PH4 A;  2NWG A;  1EY8 A;  4MTK A;  3UDX A;  4P73 A;  2DJF C;  1VMP A;  5GAD C;  1JJG A;  2EJM A;  4LF9 L;  3AQQ A;  5J39 A;  2B2W A;  4MTN A;  2JA6 G;  4DR5 Q;  3CRK C;  3M4O H;  4FF2 A;  4JC0 A;  2K5H A;  1HH2 P;  2B8G A;  2F0U A;  1IL8 A;  3BVM A;  3BU2 A;  5T1G A;  2F4V Q;  4RFB A;  2KBN A;  3K5O A;  3GTK H;  4JI0 Q;  1BCP F;  2E74 C;  3I90 A;  4GKJ Q;  1A3U A;  4LF4 Q;  3KDF B;  1D1I A;  1WCM G;  2JA8 G;  1QZH A;  1V1P A;  3T1Y L;  3A5Z B;  3M7N A;  2OWO A;  5ELC A;  4B9X A;  4H02 A;  1Q82 C;  4JG2 A;  1QG7 A;  1SEB D;  3HKZ G;  3K7U C;  2AQ2 B;  2WAC A;  4R4C A;  5ELO A;  3DEO A;  1JWU D;  1STH A;  2A8V A;  4XTC S;  1B7Y B;  2EYF A;  1BDO A;  2UXD Q;  1I4H A;  3A7L A;  1AW7 A;  2F0J A;  5C6A A;  3RLO A;  3PO3 H;  1F2L A;  1YHQ A;  1L0W A;  1EYC A;  4C2M H;  2E75 C;  1G8Z D;  5JJZ A;  5FLX L;  5JEA J;  3UE0 A;  3RZO H;  4OO1 G;  4C3J B;  1C8C A;  4R9W A;  3FKI H;  4CKE A;  3KF8 A;  2F0T A;  1ZYR D;  1PFN A;  2XWJ B;  4NPS A;  1N34 Q;  1TS5 A;  2LXJ A;  2R7Z H;  2EOT A;  2AUK A;  2JA9 A;  3HGB A;  3I55 A;  2JSO A;  3GTQ H;  1PYB A;  1CHP D;  2HHH Q;  4RKB A;  3MAQ A;  2A68 D;  4B3M Q;  4GNX A;  1EY6 A;  2R61 A;  2F0D A;  4QIW E;  1X65 A;  3GTP H;  2F0E A;  4IJL A;  3J81 j;  3Q23 A;  3UI2 A;  1PA6 A;  4X62 Q;  1S40 A;  1HR0 W;  5BN5 A;  5C3E H;  4DK1 A;  1MIU A;  3NTK A;  4GOP B;  4M1U B;  1LT4 D;  3J7A 5;  1HHV A;  2DNE A;  3D4R A;  1WTR A;  3OPO A;  4DV4 L;  1S3O A;  4FNF A;  4KHP L;  2PI2 A;  4DV0 L;  3C1F A;  2NTS A;  3EVQ A;  2A6E C;  2B29 A;  2F0V A;  1WFQ A;  3LX0 A;  1Y1W B;  2K6A A;  2L9H A;  4FO2 A;  4C3J G;  1IYV A;  1K3B C;  1RL2 A;  3A8I E;  4YWL A;  1IBM L;  1PHJ A;  5FOB B;  1VQL A;  4NDX A;  2PQE A;  4IUP A;  3NPP A;  3FHW A;  3NEN A;  2F52 A;  2ID0 A;  2UUB L;  1VQK A;  1HPC A;  1I4R A;  4IUV A;  5EBD A;  1PH3 A;  3T4A C;  3HZX A;  4A3L G;  4XYO A;  2VB2 X;  3EJI A;  2VNU D;  4JBK A;  4QUC A;  5GAE C;  3A56 A;  4ID6 A;  1IBK L;  2IL8 A;  4B08 A;  3TSS A;  2LY7 A;  2OQK A;  1Z9F A;  1JIC A;  1IBL Q;  1KRS A;  1SFO H;  4PZ6 A;  2YTY A;  3F1Z A;  4ZUI A;  1OXV A;  5IYC G;  4Y52 H;  1X56 A;  2H1E A;  2R7D A;  4OWX B;  3RZD B;  5JJK A;  3IKJ A;  5E3F A;  2Q2I A;  2XN9 C;  1PTO F;  2RCN A;  3NQI A;  1WTO A;  4PG3 A;  3F2B A;  1STY A;  1X9N A;  4YHH L;  1ET9 A;  1I4P A;  1Y1W G;  4JI8 L;  1J8I A;  4OX9 Q;  2CCZ A;  1WOC A;  2GVA A;  2XVS A;  4A3D B;  4HMI A;  4LF5 Q;  1D5X C;  4IFD H;  4PZ7 A;  4B3T Q;  1EY4 A;  2IJ0 A;  4APV A;  2WKC A;  4L5T A;  1U4R A;  2L4N A;  4A3M B;  5C0X J;  2Z4I A;  4K6D A;  1TS2 A;  5IYD G;  3G6E A;  3CU7 A;  5LMN L;  4DV2 L;  3J7A F;  4PMB A;  2YV5 A;  3GTG H;  2A6E D;  2R92 B;  2WP8 J;  3MXN A;  1G2T A;  3QO2 A;  3MEH A;  4I7Z C;  1HZ9 A;  4A3B B;  1IL2 A;  1E3P A;  3ULP A;  1DOL A;  3IFT A;  2A19 A;  3OWF A;  4JI5 L;  3UE1 A;  4IAL A;  5GAG C;  1Q46 A;  3HOX H;  1KC8 C;  5LL6 S;  3R8B A;  2L11 A;  3HOU H;  2CVR A;  4UP7 A;  4EQO A;  4A3I H;  3GV6 A;  1FNU A;  4IUR A;  4YCV A;  1SRU A;  4OO1 I;  4X3U A;  1LAC A;  2LMC B;  1EFW A;  4A3J H;  4C3I G;  5EKK A;  1C7Y A;  3S24 A;  4NXN Q;  1ENC A;  3NEL A;  2N88 A;  4EVO A;  5IP9 H;  2PW5 A;  5M3F B;  1HTL D;  2IY5 B;  1G6Z A;  4DR7 Q;  2OTJ A;  1S72 A;  1STA A;  1JB7 A;  5M5Y B;  1VQF A;  2FIN B;  4DAY B;  4R4Q A;  1KLU D;  1RF2 D;  4A3C G;  1PRT C;  1EU3 A;  3TQY A;  4LF6 L;  1STB A;  4RGM A;  4A3M G;  3HOY H;  1A8V A;  3A8J E;  3P7J A;  1TWA H;  4FXK C;  5DNF A;  1X3F A;  4DR1 Q;  1SE2 A;  1X55 A;  1EL0 A;  1R4Q B;  1TWC H;  2YU9 B;  2NVY B;  3E0J A;  1XMQ Q;  3VR4 A;  1NJI C;  1AZQ A;  3R3O A;  3GTJ B;  2I5L X;  2EYO A;  5FK9 C;  2XIW A;  2L1B A;  4KMU C;  2V4D A;  4BBR B;  3H15 A;  1CK1 A;  3KLR A;  3SXH A;  2OT2 A;  4JBJ A;  1E1T A;  4A3F B;  2CWP A;  1YIJ A;  2HCC A;  5C44 B;  4DAV A;  5C4X B;  2K14 A;  4X6A H;  5C0X I;  5KND A;  3PF4 A;  5HGQ A;  4I65 A;  4B3S Q;  3UDI A;  1H9M A;  1GO3 E;  1UWV A;  1UAP A;  1O7Z A;  4RHR A;  2JA7 B;  1CHQ D;  5D65 A;  2BDO A;  1HUN A;  4AIM A;  1ROD A;  1PTO H;  1HCZ A;  3CD6 A;  1HQR D;  3W5O A;  1CA6 A;  1ML0 D;  1D5Z C;  2A74 C;  2NB0 A;  4IN3 A;  1F77 A;  1TKW B;  4LWC A;  4F88 A;  2RKS A;  3GQB A;  1JOK A;  3H0G B;  5LMU L;  4GLX A;  2VUM H;  3CW2 C;  1H9K A;  2I5H A;  1NMG A;  4RWS C;  3GTM H;  4RGO S;  4GKK L;  3M3Y B;  2A73 B;  1S5D D;  2CQA A;  1SN8 A;  3L7Z C;  1JJC B;  1DCZ A;  2PYK A;  4HJ8 A;  2XTI A;  4JVZ A;  4A3G H;  2XWB B;  3RUZ A;  4LFC L;  2EVB A;  4DV6 Q;  5CBE E;  4QIW B;  4HCS A;  3S14 H;  3SGI A;  3CCJ A;  1VF5 C;  3R93 A;  5CV4 A;  2HQE A;  1PRT D;  4DUY L;  3DWA A;  5BN3 A;  5C4J H;  3HKS A;  2PZU A;  5F2D A;  4CKC A;  1FJG Q;  2EY1 A;  1I6H H;  1T5X D;  2RHQ B;  1I3Q B;  2JA5 B;  2UXB Q;  2Q8R E;  1HFN A;  1PZI D;  3T51 B;  2F0Q A;  3IRB A;  1JT8 A;  4RA8 A;  1OTC A;  5M5W B;  4JI4 L;  1NY4 A;  4IPD A;  4CKB A;  4X66 Q;  3S15 H;  3I91 A;  4OIK A;  2DJG C;  3HOZ H;  2QCP X;  4KD3 A;  1HA5 A;  1HZA A;  3VYS A;  1ASY A;  1MKH A;  1KLG D;  1BUV T;  3EIV A;  2NVQ H;  2E2I B;  4FYD A;  3KJP A;  1PFM A;  2NVX B;  2B2V C;  3CRL C;  3NUC A;  2NUC A;  5EJW A;  1GD7 A;  1RTN A;  3P20 A;  1WJJ A;  4HMJ A;  3S2D B;  4DNR B;  5I4D A;  2F0S A;  4LFB L;  1D6E C;  1K83 B;  3NEM A;  1HNX L;  4JW0 A;  2ATW A;  4HR7 B;  1A2T A;  3HEJ A;  4DV5 Q;  1TY2 A;  4FP5 D;  1B53 A;  1KAA A;  1ZXT A;  2FJ2 A;  3MXG A;  3P75 A;  4OWT B;  2RBM A;  1B70 B;  4L6T B;  1SJH D;  3S1R H;  3SE0 A;  4A3K B;  2SDF A;  5ELB A;  4DR5 L;  2QIL A;  3PO2 B;  1O7Y A;  3ULL A;  3OTO L;  4QL5 A;  2ZTD A;  5FLX c;  1P8L A;  1QZG A;  3MXU A;  5IYB H;  3PUX A;  2K7V A;  2IW3 A;  4JI0 L;  1IW7 C;  2JA5 G;  3I70 A;  1V43 A;  5M5X H;  1GUS A;  3G71 A;  5JAV A;  1FL0 A;  1Y8P B;  2E5L Q;  2K52 A;  5I9P A;  2J7Z A;  2WII B;  5ELF A;  4ME5 A;  2F0P A;  4JYA Q;  4LMQ D;  1GXD C;  3OSO A;  3DUZ A;  1QUQ A;  3PSI A;  2EY5 A;  2QW7 A;  2TSS A;  5C3X A;  3W1G A;  2VY3 A;  3KF6 B;  1NR4 A;  3K81 C;  2UXD L;  4ZYS A;  1FR3 A;  1KTK A;  3NE5 B;  4ZKB B;  1ZEQ X;  1NUC A;  1SMX A;  3ONA B;  1HFG A;  2K75 A;  2EZV A;  1JR0 D;  3R2I A;  5IGE A;  5IP7 G;  1Q81 C;  4A93 B;  1C0A A;  1VQM A;  4A3K G;  1XPR A;  2K32 A;  2WAQ G;  3K0X A;  1PFS A;  1TY0 A;  1JWM D;  4X65 Q;  1YJ9 A;  4JI3 Q;  4J6H A;  5CV9 A;  1N34 L;  4NP5 A;  1EY7 A;  4DK6 C;  2KUM A;  2J0T D;  3BG3 A;  2HHH L;  3EA6 A;  5HUR A;  3A0J A;  1KDC A;  3WOF A;  3PGZ A;  1SNO A;  1G51 A;  2F0N A;  4Z9C B;  4DR3 Q;  2FXQ A;  5IWA Q;  1TT2 A;  2IT1 A;  4P72 A;  1K0R A;  4C3H H;  3I4N B;  2RA4 A;  5A2Q L;  2EYH A;  1EZ6 A;  1PH5 A;  3SDZ A;  2K04 A;  3L2P A;  4CDE C;  3PIP 3;  4IJH A;  3O13 A;  1EY0 A;  1P16 A;  1X3G A;  3PO3 G;  1N32 Q;  3S16 H;  4JV5 Q;  4JOI A;  1IW7 D;  2ZXP A;  2B63 H;  3U4Z A;  1YI2 A;  3AEV A;  1PLF A;  4KJN A;  4QMG A;  1PZJ D;  4K8I A;  2K1B A;  5COY A;  1S5F D;  2NVT B;  2R7Z G;  1XJV A;  1SBB B;  3GP7 A;  4WJW A;  1EZ8 A;  3I4M B;  3IAY A;  1CQF A;  4RCO A;  1GUN A;  5I6Y A;  4B3R Q;  2SNS A;  3TDQ A;  3BDC A;  2NN6 H;  3HS0 C;  4JI6 Q;  1LTI D;  3V2T A;  5FO8 B;  3S17 B;  2VZA A;  4GN5 A;  4AQY L;  3QWN A;  5C3E G;  1ESR A;  1OXX K;  1XX8 A;  2UUC L;  4IZ8 A;  2K4K A;  2CFM A;  1U0L A;  1EQV A;  2Q2U A;  2PPB C;  1HRJ A;  4MHE A;  2R3Z A;  5M3M B;  4GN3 B;  3S1N B;  4X64 L;  4BA2 I;  1ICF B;  4ABN A;  1PYW D;  1STE A;  2UUA Q;  3OIQ A;  5IT9 L;  2B2Y A;  1WCM B;  3A74 A;  3RLF A;  4PZ8 A;  1B8A A;  3GDE A;  1DOM A;  3UDF A;  1ICW A;  1ET6 A;  1M8A A;  3K5M A;  1S5C D;  1PH1 A;  3KUP A;  5FLX E;  2Z4H A;  1XNQ L;  1KRT A;  3T56 B;  2EDG A;  1E0B A;  1E2Z A;  1WI5 A;  2SEB D;  4HIO A;  3HOV B;  4LNQ A;  1CKO A;  1ZYR C;  2AWN A;  3KLS X;  2VB3 X;  2K5D A;  4BXX G;  1FYC A;  4NXM Q;  1SSO A;  4LF5 L;  4TKO B;  4OON A;  4B3T L;  4K2K A;  4RG1 A;  4TQU S;  1LYL A;  1R9T B;  4JI2 L;  5C5L A;  2QF7 A;  3C2P A;  1XNR Q;  1WD0 A;  1CKN A;  1B9N A;  3KBX A;  4HAE A;  3E5S A;  4DR6 Q;  3S2H H;  1DON A;  2DGY A;  3SK6 A;  1HNW Q;  1BCP C;  1HNZ Q;  3HOW B;  4WJ4 A;  3P1H A;  3TP5 A;  2MNA A;  2B8F A;  1IHZ A;  2OEO A;  1JQY D;  2XRS D;  3GD7 A;  1KXL A;  4YY3 Q;  3A54 A;  2BOS A;  2MJ8 A;  5M3M G;  2PQA B;  4JBW A;  3CHB D;  1BVS A;  5KRU A;  1VQD A;  2GA4 B;  4ILW A;  4DR4 L;  2KHI A;  4IQZ A;  3RLN A;  3BDL A;  1EFI D;  3K57 A;  1I94 L;  1BQQ T;  3PQI A;  1CZW A;  2E8G A;  4WOR A;  3ER0 A;  4RGT A;  1PH6 A;  3J7A V;  1A6X A;  1CZG A;  3E9H A;  3W2D A;  4ZLT F;  4FF4 A;  1UEA B;  3ZJY C;  4PNY A;  1IKL A;  3HOV G;  1J6Q A;  4DR7 L;  3C1E A;  5DAU A;  4HJ5 A;  3GTL B;  4HTH A;  5IOD A;  3CME A;  3D3R A;  1K8G A;  1EIG A;  4K6L A;  2DY7 A;  3I56 A;  1EWI A;  3K7A B;  4U68 A;  3KDF A;  1VQP A;  4UPA A;  2RCF A;  1YBY A;  1VQE A;  1TWH B;  4DR1 L;  3OMC A;  2B2W C;  2F3W A;  4K2L A;  3HOX G;  3B6Y A;  1V1O A;  3PIO 3;  1Z47 A;  1YJN A;  4IPG A;  1X54 A;  5J3B A;  1H9R A;  1EQQ A;  2F0F A;  2E2J H;  1ILQ A;  2ENB A;  1S5E D;  3HOW G;  4A3I G;  5C4H A;  4PMC A;  2LSS A;  5FLM G;  4CHT B;  3VYR A;  1DGS A;  1UE5 A;  4B9W A;  2NYZ D;  5G3L F;  2MPM A;  1C9O A;  5IP9 G;  4LF7 Q;  3CC7 A;  4LFA Q;  1SNP A;  4KI0 A;  5IGB A;  1BCP D;  1E2V A;  3T16 A;  4DV7 L;  1GHK A;  1B2T A;  5JJL A;  5FO9 B;  1KAW A;  1XMO Q;  1HR0 Q;  2EYJ A;  4XYQ A;  4G7O C;  3HOY G;  2ICI A;  4TSS A;  3NWT A;  1RHP A;  1VQ4 A;  1B9M A;  3TEH B;  1MI2 A;  4DU9 A;  4UHV A;  1AEX A;  1RCV D;  1TS4 A;  4LAA A;  4JI1 Q;  3J7Y W;  4L5R C;  1KNE A;  5EGT A;  5C0X G;  3GV3 A;  2X6L A;  3FDT A;  2R93 H;  3U9O A;  3SK4 A;  3CCR A;  3IFD A;  5D3I B;  4DFA A;  4GOP A;  3T1H Q;  2D9U A;  1CM9 A;  2B39 A;  4RH6 A;  3Q22 A;  3TS0 A;  4DR2 Q;  4P2C B;  1MJE A;  1B3Q A;  4GN4 B;  4J15 A;  3VYT A;  4KD4 A;  2KCN A;  4GNX C;  4F7X A;  1SYB A;  1TII D;  5JVH 3;  4KY6 A;  2KED A;  4A75 A;  1VQ5 A;  1FJG L;  2WAQ E;  1MSG A;  1BOS A;  4BBS H;  2FHT A;  1KD1 C;  2UXB L;  2X69 A;  1L1O B;  5GAH C;  3KLW A;  5JOB A;  1LTT D;  1PTO C;  5KYI A;  4O0A A;  1N33 L;  1UNS A;  4AYB G;  1O7I A;  2F0W A;  2VUM G;  5CC4 A;  4IOC A;  3H3V H;  1F9R A;  4C3I B;  2VQE Q;  2F0M A;  2L0C A;  4A3E B;  2MQH A;  1ASZ A;  1GKH A;  1HUM A;  2PW7 A;  2JA6 H;  1YJW A;  1H9S B;  4BY7 H;  1UE7 A;  4K0K Q;  3TRZ A;  3I2Z A;  3QB3 A;  1BO0 A;  4DV5 L;  4KHV A;  3MA2 B;  1QWY A;  4ZAI A;  1PRT B;  3KK7 A;  1LT5 D;  1U5K A;  2I07 B;  1VQ6 A;  2IX0 A;  1H95 A;  4DUZ L;  3S1Q B;  1N36 Q;  4IO9 A;  3OIP A;  1QOH A;  3AMU A;  3I72 A;  2ZT9 C;  2JA8 H;  1B4O A;  4IFD I;  1SYG A;  2O5I C;  1LTL A;  1SNM A;  3JAM L;  3GTO B;  3K5N A;  2ZJR A;  5CV7 A;  4QGU A;  4O42 A;  3HOZ G;  2PCF B;  1VCI A;  4C56 C;  1SYE A;  5FJ8 G;  4FF1 A;  2IPK D;  4JI7 Q;  1L1O C;  3VA7 A;  1EUJ A;  1I6V C;  4YCU A;  3CQZ H;  4Y7N B;  4JYA L;  1GUG A;  2K5N A;  4UY8 C;  4LW1 A;  4LF9 Q;  1E22 A;  1U4L A;  2EXD A;  1U9R A;  2PNR C;  1JJ2 A;  1TWG H;  4A3E G;  1Y1V B;  1WD1 A;  2HQL A;  2AQ1 B;  3SVM A;  2FFK B;  1F2Z A;  1X3P A;  2MO0 A;  4IUT A;  1NMF A;  1K28 A;  4OL7 A;  4CGY B;  3PIP A;  3SEB A;  1PTO D;  2PNH A;  1DXM A;  4IOA A;  4L63 B;  3QG1 A;  4DGZ A;  4WFN 3;  1A3T A;  2M2L A;  3ITP A;  4YIJ A;  2ZM6 L;  5EKL A;  2ZJQ A;  2H4O A;  5IYB G;  3Q0A A;  4HJ7 A;  4X65 L;  3F2U A;  5BR8 L;  4JI3 L;  2N55 A;  3FEW X;  1YNN C;  2B2U A;  4HSV A;  1STN A;  1W6J A;  4MNO A;  1FGB D;  1PFB A;  3K5L A;  2RSO A;  4HID A;  1HQM C;  3U58 A;  1LT3 D;  2Z9H A;  4R8I A;  4BY1 B;  4XT3 B;  3G6J B;  4OWW B;  5K36 H;  4HED A;  4DAY A;  4DR3 L;  1L0X B;  1ZKO A;  4DK0 A;  1KDB A;  1KHI A;  1MD2 D;  4LF8 L;  4IUN A;  1EYG A;  3SK8 A;  4ULL A;  1HZB A;  3J80 L;  1Y1V G;  4V0B A;  4R4T A;  2LXK A;  4C3J H;  1VQA A;  3LGJ A;  3V96 A;  4KJO A;  1HZC A;  1I50 B;  2GVB A;  2BH2 A;  2BCO A;  3E3X A;  2BE5 D;  1XXG A;  1QIL A;  2F0G A;  4R4I A;  3VYU A;  3S1M B;  2WFW A;  2YYZ A;  1EOV A;  1X32 A;  3RD4 A;  3CPF A;  2YTX A;  4CDD C;  5IT9 c;  2R7F A;  3DHQ A;  5JPN C;  2MO1 A;  2KA7 A;  4LUZ A;  2JYO A;  2KCM A;  2EXZ A;  2Z0S A;  2HCI A;  2SNM A;  1RJT A;  1K8O A;  1L2F A;  3NK9 A;  3AU7 A;  1SRO A;  4JI6 L;  2JK8 A;  4DV4 Q;  1UEB A;  4C3H G;  1VQO A;  4OEL B;  1ONL A;  4BY1 G;  3BZD B;  4KHP Q;  3TP7 A;  2B2V A;  2MUY A;  2K50 A;  2E2H B;  1BBX C;  4NKL A;  4LJZ C;  4N9P A;  1EY5 A;  4XIG S;  2G9D A;  2B63 G;  1YNN D;  2CH4 A;  1IBM Q;  1FNW A;  1EWH A;  1JB3 A;  1Q1B A;  1OO9 B;  1TWF B;  2MGS A;  4QF4 A;  4C1N K;  2JXM B;  2UUA L;  3ERO A;  1NNX A;  1Y1W H;  2RVL A;  3RR5 A;  4DV3 L;  3D8G A;  1NSN S;  2UUB Q;  2A1A A;  3URY A;  4CJ1 B;  1KQS A;  4FXD A;  1A2U A;  1FNV A;  1I5F A;  2X6G A;  4TVA B;  3S9W A;  2Z6K A;  3NBH B;  3K59 A;  2LKV A;  3ND9 A;  2QGQ A;  4QJF A;  1TS3 A;  3MXP A;  3ZYY X;  1IBK Q;  2IHE A;  2B2T A;  3W1B A;  2P5Z X;  1PH9 A;  4PMW A;  2C35 B;  4ZRZ A;  1PDQ A;  2VQF Q;  2F3I A;  4NXM L;  1T5E A;  2JEA I;  4KV6 A;  3PCO B;  3Q24 A;  3M4O B;  3STB C;  2KEE A;  4ALP A;  1FVI A;  1WTP A;  4ZQ3 A;  3CF5 A;  1M1K C;  1XNR L;  4KK7 A;  4S3S A;  1WTH A;  2WAQ B;  3I73 A;  3DLL A;  1BBU A;  3GTK B;  3PUZ A;  1WTV A;  1HNW L;  1HNZ L;  3RZD H;  1IYJ B;  4DV1 Q;  3N6R A;  1HTP A;  4N9T A;  2NZO A;  2G5D A;  3MWY W;  1BKB A;  2F4V L;  3PIO A;  1N8R C;  4YY3 L;  1IZ6 A;  3TZU A;  2KJX A;  1VS0 A;  2YTV A;  5LMN W;  4GKJ L;  4LF4 L;  1SMY C;  5H1S E;  3M4P A;  4BA1 I;  1RD9 D;  4R8N A;  3SR1 A;  4OXP A;  4DV2 Q;  3CCE A;  1F2Y A;  1Q1E A;  4QY7 A;  4A3D H;  1QNU A;  1UE1 A;  2M00 A;  2F0I A;  4FVM A;  1AP0 A;  4A3C H;  4P75 A;  1Y14 B;  2KHS A;  3E9I A;  3PO3 B;  4A3M H;  1V8Q A;  4G4K A;  4C2M B;  4U67 3;  2D62 A;  3H09 A;  4E6I A;  2A5H A;  5IGG A;  3RZO B;  4JI5 Q;  4AYB E;  2EQS A;  2R92 H;  3KLS A;  1PYS B;  3FKI B;  4M8A A;  2UU9 Q;  5E4X A;  1PMR A;  1CKM A;  4A3B H;  2PI2 E;  5LHY 1;  3LWU A;  3RMH A;  2R7Z B;  4MZ9 A;  1KL9 A;  3GTQ B;  3QR8 A;  3J81 L;  2E2D C;  5CV5 A;  5A35 A;  4HIM A;  2O5J C;  5CV8 A;  1JWS D;  2ZXR A;  4F87 A;  4L5Q A;  3GTP B;  1IYU A;  1QCB D;  3KF6 A;  3D4D A;  3K0Y A;  3STB D;  4ME3 A;  5IT9 E;  4B3M L;  5C3E B;  4L5S A;  4DXG A;  4P71 A;  2CWA A;  2L55 A;  1WVL A;  5M3F H;  1HA6 A;  1UE6 A;  1A0I A;  4UAI A;  5M5Y H;  3VR2 A;  4X62 L;  1PXU A;  2IX3 A;  1OXU A;  2AHO B;  2A6H C;  2ZXO A;  4O2D A;  2D0O A;  1XMO L;  1BF4 A;  3V05 A;  2L12 A;  2DNC A;  4HCE A;  2YU9 H;  1II3 A;  1SMY D;  2NVY H;  1F9S A;  5FKA C;  5IY0 A;  1DJR D;  3ND8 A;  3GTJ H;  3FKI G;  3PUV A;  4JI1 L;  3K8A A;  1YZ6 A;  1EY9 A;  3JC6 6;  1Z6H A;  5C5M A;  3VR5 A;  5T1I A;  1LTR D;  4KY7 A;  3D0F A;  4OGQ C;  5EPL A;  1ESF A;  2C9O A;  2XGT A;  4BBR H;  5IE8 A;  1IKM A;  1UUP A;  1JOR A;  4A3F H;  4MN3 A;  4KHZ A;  5C44 H;  3EN2 A;  5C4X H;  3PMF A;  5CMD A;  3Q8D A;  5KIX A;  4KN4 C;  1VQI A;  4OEM B;  1XTD A;  2F0L A;  3PUW A;  2RDG A;  1YHB A;  5AFW A;  3CC4 A;  4AH6 A;  1BXT A;  1QVC A;  4I7A A;  1LT6 D;  4QUF A;  1SFO B;  2JA7 H;  1BCP B;  2NN6 I;  5C4Z A;  1EIY B;  1YEZ A;  2WKD A;  5LMU Q;  3RNU A;  1WTW A;  1IBL L;  1PZK D;  2KCT A;  3M4Y A;  5DEH A;  1HJP A;  3L3O C;  1K73 C;  3CCQ A;  2MFI A;  2PO4 A;  4RKL A;  2K5V A;  3H0G H;  3QIA A;  3D6W A;  4OHJ A;  4LFC Q;  3JAM c;  4JOI C;  2Y0S E;  3D31 A;  3M3Y H;  1TU2 B;  2EYP A;  3DMU A;  2VQE L;  4C1N I;  4DXF A;  2K01 A;  2PMZ E;  4DUY Q;  2R93 G;  2MP1 A;  3KYH C;  2F03 A;  1PH2 A;  2WB1 E;  3U50 C;  1J9O A;  5JJI A;  4LUO A;  1VQG A;  4HIK A;  4OX9 L;  5IIF A;  1AH9 A;  1STG A;  2A6H D;  3CCV A;  2ES2 A;  1YVC A;  3FPU B;  5J22 A;  2B3G A;  1EWC A;  1XPO A;  3GTG B;  5JVG 3;  4BBS G;  4CDC C;  1I3Q H;  2JA5 H;  1FD7 D;  1LTB D;  3MVV A;  3MC0 B;  5EPK A;  2JE6 I;  3ERQ A;  2O4X A;  4ZKC B;  5M5W H;  3HOX B;  4V19 0;  1W3S A;  3ICE A;  3OMG A;  3F2D A;  4GZY C;  3HOU B;  4QB4 A;  4A3I B;  2J4X A;  3BZC A;  1CA5 A;  2E2I H;  4JI7 L;  2F0K A;  2NZ1 D;  4A3J B;  2NVX H;  1SDF A;  3VDY A;  4ZK9 B;  1V1P B;  2B2Y C;  1AZP A;  1R4P B;  1EYA A;  1X3Q A;  2Q8T A;  3S2D H;  5ELD A;  1QJO A;  2JN4 A;  2A69 C;  1K83 H;  2OQ0 A;  1VQ7 A;  4BY7 G;  4K8J A;  1GM5 A;  1JCK B;  3H94 A;  2ZJP A;  5EAY A;  3DM1 A;  1ILP A;  4NXN L;  5IP7 H;  4JCV E;  3OTO Q;  4IFD G;  1J5E Q;  4A3K H;  2EIF A;  1VQH A;  2QEJ C;  3WWV A;  1EIH A;  4XXE A;  3HOY B;  3FP9 A;  3PO2 H;  1TWA B;  2XNA C;  5GQO A;  1KIX A;  2UXC Q;  1QNK A;  4POF A;  4GLV B;  2HT1 A;  5DM6 3;  1TWC B;  1B44 D;  5ELE A;  2PQA A;  3J80 c;  1VQ9 A;  5E7N A;  5EQ0 A;  3X3N A;  3NBI A;  1GUT A;  3L0O A;  1JMC A;  2K5W A;  2N8N A;  4XQN A;  3M4Q A;  3KF8 B;  2EE1 A;  1LLR D;  3OOC A;  1SLJ A;  1B1Z A;  1XMQ L;  3DXJ C;  1Y8O B;  1KDA A;  3HOU G;  4DNI A;  1XTC D;  3EFX D;  4LK1 C;  1V1Q A;  2I46 A;  5LL6 X;  5JPM C;  4GNX B;  4EQN A;  4A3J G;  4QCL A;  2KQ3 A;  3TN2 A;  3CCL A;  1G6P A;  1WTX A;  1JOQ A;  1A15 A;  4B3S L;  2PZT A;  4RCN A;  2AUJ D;  3I4L A;  1Z7T A;  3FVQ A;  1PTO B;  2D0P A;  3M85 A;  1L0Y B;  3U4V A;  4OIJ A;  1QVG A;  4AYB B;  4A93 H;  4FDB A;  4L8J A;  1A63 A;  4DKA C;  4IUU A;  5KEE A;  2K28 A;  2VUM B;  2DY8 A;  3GTM B;  3M9B A;  3QJY A;  2RF4 A;  2G9H D;  2A69 D;  4A3G B;  4IFD J;  1EEI D;  3W3A A;  4N8X 1;  1DZ1 A;  1CTM A;  4JPB W;  3S14 B;  2N3S A;  3JAM E;  1MGS A;  4XQJ A;  4ZUJ A;  5I2X A;  5K36 G;  3CKI B;  5AJ3 Q;  2OTL A;  1SE3 A;  5C4J B;  1VDZ A;  2L15 A;  3I4N H;  3KOJ A;  4DV6 L;  5CYU A;  4HSP A;  1I6H B;  2IWH A;  3BVG A;  5ELN A;  3NWS A;  1GVP A;  4NMZ A;  2VW9 A;  2K05 A;  2AKW B;  4HJA A;  4X3T A;  2BA1 A;  3SHL A;  2QKI C;  4TRD A;  1O7L A;  2KCC A;  3I8Z A;  4J1M A;  3NTH A;  1IXR A;  3S15 B;  2BA0 A;  1F2M A;  3X3M A;  4RAU C;  3HOZ B;  2DN8 A;  1RTO A;  5I9O A;  3BZK A;  2NVQ B;  2BDN A;  3UDG A;  2FMC A;  3F8T A;  5G3L D;  4X66 L;  2NVT H;  5GRO A;  1BNZ A;  1VF7 A;  5JEA H;  5CV6 A;  2DUD A;  2RDF A;  4BXX H;  1C48 A;  3I4M H;  1H9J A;  4WRD A;  2VS1 A;  3U9S A;  4K5W A;  5IOC A;  1CI3 M;  4AQY Q;  1K8A C;  3MFY A;  4A76 A;  1D8L A;  3AFQ A;  1O78 A;  2UUC Q;  3HP3 A;  2KEC A;  4EX5 A;  4DN4 M;  3S17 H;  4A3G G;  3KBG A;  2VQF L;  3S1R B;  3H3V I;  4UDU C;  1A62 A;  2XSC A;  1OXT A;  3VA5 A;  1L1O A;  3NQT A;  1AE2 A;  1MJC A;  4Q0F A;  4X64 Q;  3I3C A;  4GOP C;  3CCM A;  3AB9 A;  3MHB A;  1LUZ A;  2N78 A;  2EJG C;  1F9Q A;  3MFG A; 
#chains in the Genus database with same CATH homology
 1WCM G;  1JE5 A;  2JA8 G;  1QZH A;  3PGZ A;  3A5Z B;  4BY1 G;  1G51 A;  4DR3 Q;  3T1Y L;  3M7N A;  2H5X A;  2FXQ A;  2OWO A;  4KHP Q;  5IWA Q;  1D7Q A;  5M3M H;  2IT1 A;  3S1N H;  1AE3 A;  4H02 A;  2K50 A;  4JG2 A;  4P72 A;  1Q82 C;  3HKZ G;  1K0R A;  2N49 A;  3K7U C;  4C3H H;  2HIV A;  4DV1 L;  1XNQ Q;  3MXN B;  1WCM H;  3G4S A;  4R4C A;  1PH5 A;  2OCE A;  5ELO A;  4XIG S;  3L2P A;  2Q2T A;  2B63 G;  3F2C A;  2A8V A;  1IBM Q;  3HFZ B;  4IJH A;  1Q1B A;  1P16 A;  1X3G A;  4XTC S;  3PO3 G;  1B7Y B;  1N32 Q;  2VUM H;  3S16 H;  2UUA L;  4JV5 Q;  3J81 c;  2UXD Q;  4JOI A;  1Y1W H;  3RR5 A;  4DV3 L;  2B63 H;  3RLO A;  1Q86 C;  2E5L L;  2UUB Q;  3U4Z A;  4JI2 Q;  1YI2 A;  2A1A A;  3AEV A;  3HOV H;  3PO3 H;  1YHQ A;  1L0W A;  4C2M H;  1KQS A;  1VQJ A;  1I5F A;  4TVA B;  5JEA J;  3UE0 A;  3MEF A;  2KHJ A;  2Z6K A;  3NBH B;  3RZO H;  4OO1 G;  4KLK A;  2R7Z G;  1XJV A;  2QGQ A;  3OYY A;  4QJF A;  1Q7Y C;  1R9T H;  1IBK Q;  2IHE A;  3FKI H;  3W1B A;  1N9W A;  1PH9 A;  4PMW A;  2C35 B;  4UP8 A;  4NPS A;  2VQF Q;  2F3I A;  2LXJ A;  1N34 Q;  4NXM L;  2R7Z H;  4B3R Q;  2JEA I;  4GLA C;  3E0E A;  2JA9 A;  3GTQ H;  3PCO B;  3I55 A;  2HIX A;  1PYB A;  3STB C;  4LUV A;  4JI6 Q;  2HHH Q;  4ALP A;  1FVI A;  2UU9 L;  3CF5 A;  3HOW H;  1SE8 A;  1M1K C;  4B3M Q;  1XNR L;  2VZA A;  4GNX A;  4GN5 A;  4AQY L;  4QIW E;  5FLM H;  1X65 A;  2JQO A;  5C3E G;  4DR4 Q;  3T1Y Q;  4YWK A;  2IX1 A;  3GTP H;  1OXX K;  1I94 Q;  3DLL A;  1BBU A;  4IJL A;  2UUC L;  3PUZ A;  3J81 j;  2K4K A;  1HNW L;  1HNZ L;  3TS2 A;  1X6O A;  3RZD H;  1IYJ B;  4DV1 Q;  1PA6 A;  4X62 Q;  1S40 A;  2CFM A;  5C3E H;  1HR0 W;  1U0L A;  4R4O A;  2Q2U A;  5HY6 A;  1MIU A;  3K80 C;  2NZO A;  4GOP B;  3J7A 5;  1BKB A;  2GN5 A;  3PIO A;  2F4V L;  1N8R C;  4YY3 L;  4GN3 B;  1IZ6 A;  4X64 L;  4BA2 I;  1VS0 A;  4DV4 L;  2YTV A;  1S3O A;  2UUA Q;  3CXC A;  5LMN W;  4GKJ L;  4A3D G;  3A74 A;  3A5U A;  4LF4 L;  2I0Q A;  3RLF A;  4PZ8 A;  1B8A A;  3GDE A;  2Y0S G;  3M4P A;  5H1S E;  4KHP L;  4BA1 I;  2PI2 A;  3UDF A;  5IWA L;  4DV0 L;  4OXP A;  4YWM A;  4DV2 Q;  2QEX A;  3CCE A;  1PH1 A;  3GTL H;  1Q1E A;  4QY7 A;  4A3D H;  1UE1 A;  1XNQ L;  2B29 A;  1KRT A;  1WFQ A;  4A3C H;  1WI5 A;  4P75 A;  4HIO A;  1Y14 B;  2R92 G;  3E9I A;  4LNQ A;  1RL2 A;  2WB1 G;  4YWL A;  4A3M H;  3K7A H;  1PHJ A;  1IBM L;  1CKO A;  2AWN A;  2D62 A;  1VQL A;  4BXX G;  1N32 L;  4A3B G;  4NXM Q;  4JV5 L;  4LF5 L;  1TWH H;  4OON A;  4JI5 Q;  3FHW A;  2EQS A;  4AYB E;  4B3T L;  4RG1 A;  4TQU S;  3NEN A;  1YIT A;  2R92 H;  1VQC A;  2F52 A;  1LYL A;  2ID0 A;  4RMF A;  1VQK A;  2UUB L;  4JI2 L;  1PYS B;  4NB3 A;  2UU9 Q;  3ERS X;  1CKM A;  1PH3 A;  1XNR Q;  4A3B H;  3CCU A;  1TXY A;  2PI2 E;  3AYH B;  4WJ3 M;  4A3L G;  4R1J A;  1CKN A;  4MZ9 A;  1KL9 A;  1VQ8 A;  2VNU D;  4JBK A;  4DR6 Q;  3ULJ A;  2DGY A;  5GAE C;  3S2H H;  1IBK L;  2RHS B;  1HNW Q;  1HNZ Q;  2ZTE A;  2OQK A;  4HIM A;  4WJ4 A;  1Z9F A;  4A3L H;  1IBL Q;  1KRS A;  4DV7 Q;  4B3R L;  2MNA A;  4L5Q A;  1SFO H;  4PZ6 A;  2YTY A;  3F1Z A;  3KF6 A;  3GD7 A;  1KXL A;  1OXV A;  4YY3 Q;  5IYC G;  5M3F G;  4Y52 H;  1X56 A;  2R7D A;  5M3M G;  3STB D;  4ME3 A;  4OWX B;  2PQA B;  4JBW A;  5JJK A;  4B3M L;  1BVS A;  4L5S A;  4IPH A;  2AMC B;  1VQD A;  4P71 A;  4HJ9 A;  4DR4 L;  2KHI A;  2CWA A;  2Q2I A;  3CCS A;  2RCN A;  3RLN A;  5IYC H;  5M3F H;  4DV0 Q;  3HKZ E;  1I94 L;  4PG3 A;  2JEB I;  3PV0 A;  1UE6 A;  1A0I A;  5M5Y H;  3F2B A;  4X62 L;  1X9N A;  2E8G A;  3ER0 A;  1PH6 A;  2ALY B;  4YHH L;  1Y1W G;  1VQN A;  3E9H A;  4JI8 L;  1OXU A;  2AHO B;  4O2D A;  3ZJY C;  3HOV G;  1J6Q A;  1NBW A;  2CCZ A;  1WOC A;  2D0O A;  3JAM i;  2GVA A;  1XMO L;  4OX9 Q;  4HJ5 A;  1NE3 A;  1EQR A;  3CME A;  4DK3 C;  4LF5 Q;  1K8G A;  4A4I A;  4PZ7 A;  4B3T Q;  4APV A;  4BBR G;  4L5T A;  3I56 A;  2YU9 H;  1EWI A;  2NVY H;  5C0X J;  3KDF A;  5IY0 A;  5IYD G;  1G29 1;  3G6E A;  3GTJ H;  3FKI G;  4UPA A;  5LMN L;  4A3F G;  4DV2 L;  1VQP A;  3PUV A;  4JI1 L;  5C44 G;  3K8A A;  1YZ6 A;  5C4X G;  3JC6 6;  1YBY A;  1VQE A;  4DR1 L;  4BBR H;  2YV5 A;  2VL6 A;  3D0F A;  2XGT A;  5IE8 A;  3GTG H;  2WP8 J;  3HOX G;  5IYD H;  3B6Y A;  2NN6 G;  4A3F H;  1Z47 A;  4KHZ A;  1YJN A;  3CMA A;  3KFU A;  4IPG A;  1X54 A;  5J3B A;  5C44 H;  1EQQ A;  2E2J H;  3EN2 A;  1HZ9 A;  5C4X H;  3CPW A;  1E3P A;  1IL2 A;  3HOW G;  3ULP A;  4A3I G;  3Q8D A;  2A19 A;  1KC8 C;  4JI5 L;  2LSS A;  3UE1 A;  1VQI A;  1Q46 A;  5GAG C;  5FLM G;  3HOX H;  2JA7 G;  1N33 Q;  1XTD A;  2IHF A;  1DGS A;  1UE5 A;  3HOU H;  3PUW A;  4UP7 A;  5FJ8 H;  4A3I H;  1YHB A;  3CC4 A;  4AH6 A;  4YCV A;  1SRU A;  4OO1 I;  1QVC A;  1C9O A;  2JA7 H;  1EFW A;  3EBE A;  5IP9 G;  3CC7 A;  4A3J H;  4LF7 Q;  4LFA Q;  4DR6 L;  2NN6 I;  1C7Y A;  1EIY B;  1YEZ A;  5LMU Q;  4KI0 A;  3S24 A;  3RNU A;  3H0G G;  4NXN Q;  5DLQ E;  3KJO A;  1IBL L;  3NEL A;  2KCT A;  4DV7 L;  5IP9 H;  4YHH Q;  3PF5 A;  4C3I H;  1HJP A;  4JI8 Q;  1K73 C;  5JJL A;  1FGU A;  2IY5 B;  4DR7 Q;  3CCQ A;  2MFI A;  1KAW A;  1XMO Q;  1HR0 Q;  4A3E H;  1S72 A;  2OTJ A;  2K5V A;  3H0G H;  1SR3 A;  1JB7 A;  1VQF A;  4LFC Q;  3HOY G;  3I7F A;  3JAM c;  4DAY B;  4JOI C;  1W2B A;  4R4Q A;  2Y0S E;  3D31 A;  3TEH B;  1VQ4 A;  3M3Y H;  2VQE L;  4A3C G;  3TQY A;  4LF6 L;  1QUQ B;  4DUZ Q;  2PMZ E;  5LMN Q;  4A3M G;  4DUY Q;  1K9M C;  1A8V A;  3KYH C;  4JBM A;  4JI1 Q;  1PH2 A;  1TWA H;  4L5R C;  3HOY H;  1X3F A;  2Z6K C;  5C0X G;  4DR1 Q;  3PO2 G;  3G48 A;  1X55 A;  2WB1 E;  3U50 C;  1TWC H;  1J5E L;  5JJI A;  3AFP A;  4LUO A;  1XMQ Q;  1NJI C;  1VQG A;  4HIK A;  3CCR A;  4OX9 L;  3S1Q H;  2R93 H;  1AH9 A;  2I5L X;  3T1H Q;  4GOP A;  2NZH A;  3OW2 A;  3CCV A;  3I4O A;  1CSQ A;  2ES2 A;  1YVC A;  2CKZ B;  2Q2H A;  3CC2 A;  3H15 A;  2B3G A;  2UXC L;  1XPO A;  2R6G A;  3J80 i;  3TS0 A;  2R93 G;  4DR2 Q;  3GTO H;  1BBW A;  4JBJ A;  1E1T A;  4BBS G;  2ASB A;  2CWP A;  1YIJ A;  4QQB X;  1I3Q H;  4GN4 B;  4J15 A;  1MJE A;  2JA5 H;  1C0A A;  2K14 A;  4GNX C;  4X6A H;  5C0X I;  3PF4 A;  5HGQ A;  4A75 A;  2JE6 I;  5M5W H;  1VQ5 A;  1W3S A;  4B3S Q;  1FJG L;  3ICE A;  2WAQ E;  4BBS H;  3F2D A;  3UDI A;  1GO3 E;  1UWV A;  1KD1 C;  4Y7N H;  1NTG A;  2UXB L;  2JJQ A;  3CP0 A;  1L1O B;  3BZC A;  5GAH C;  1K3R A;  3KLW A;  2E2I H;  4JI7 L;  1E7Z A;  4O0A A;  1N33 L;  2NVX H;  4AYB G;  4EQ5 A;  1O7I A;  3VDY A;  4AIM A;  3GO5 A;  1Y1V H;  2VUM G;  4IOC A;  3CD6 A;  3W5O A;  3H3V H;  3S2D H;  2VQE Q;  2QA4 A;  2CQO A;  2ZTC A;  1K83 H;  2OQ0 A;  1VQ7 A;  4LF7 L;  4LF6 Q;  4BY7 G;  4LFA L;  3DM3 A;  2ZM6 Q;  3J7Z C;  2ZJP A;  4LWC A;  2MQH A;  1GM5 A;  5EAY A;  5LMU L;  4GLX A;  1ASZ A;  3CW2 C;  5BR8 Q;  4NXN L;  2I5H A;  4POG A;  1GKH A;  1NMG A;  5IP7 H;  4JCV E;  3OTO Q;  3GTM H;  4GKK L;  2JA6 H;  1YJW A;  4IFD G;  1SN8 A;  3L7Z C;  1J5E Q;  4BY7 H;  4A3K H;  1M90 C;  1JJC B;  1UE7 A;  4UP9 A;  4HJ8 A;  2EIF A;  1VQH A;  4K0K Q;  2XTI A;  3WWV A;  3TRZ A;  3I2Z A;  1HR0 L;  4DV5 L;  3FP9 A;  4A3G H;  3PO2 H;  4LFC L;  5GQO A;  1KIX A;  4DV6 Q;  1YHA A;  2UXC Q;  4POF A;  1U5K A;  4GLV B;  1PH7 A;  3S14 H;  2HT1 A;  4DAM A;  1VQ6 A;  3SGI A;  3CCJ A;  1X3E A;  2IX0 A;  2PQA A;  1VQB A;  3J80 c;  1VQ9 A;  1H95 A;  5E7N A;  4DUZ L;  1Q8K A;  1N36 Q;  4DUY L;  3L0O A;  1JMC A;  5C4J H;  1PVO A;  4DPG A;  4IO9 A;  2N8N A;  2BH8 A;  3HKS A;  2JA8 H;  1E1O A;  4IFD I;  4BY1 H;  3RN2 A;  3M4Q A;  1FJG Q;  1LTL A;  3KF8 B;  1I6H H;  4LF8 Q;  1CSP A;  2ZJR A;  1SLJ A;  4QGU A;  2RHQ B;  1RIP A;  1XMQ L;  1YNX A;  3CAM A;  1V9P A;  2UXB Q;  3HOU G;  5AJ3 L;  3HOZ G;  4DNI A;  3T1H L;  1VCI A;  3IRB A;  5FJ8 G;  1JT8 A;  1EIF A;  1V1Q A;  1OTC A;  4JI4 L;  1Q12 A;  1NY4 A;  4IPD A;  4X66 Q;  4JI7 Q;  1L1O C;  2KEN A;  4DR2 L;  3S15 H;  4GNX B;  1EUJ A;  4A3J G;  4YCU A;  3CQZ H;  3HOZ H;  4JYA L;  2K5N A;  1HZA A;  1ASY A;  4UY8 C;  4LW1 A;  1MKH A;  3EIV A;  4LF9 Q;  2NVQ H;  1E22 A;  3KJP A;  3CCL A;  1G6P A;  2EXD A;  3TRE A;  1LM0 A;  4B3S L;  1JJ2 A;  1TWG H;  4A93 G;  1I50 H;  1GD7 A;  1PV4 A;  4A3E G;  1WJJ A;  2HQL A;  2D0P A;  3M85 A;  2MO0 A;  4GKK Q;  1NMF A;  3S1M H;  3U4V A;  4LFB L;  1QVG A;  3NEM A;  1HNX L;  4A93 H;  4FDB A;  3PIP A;  2ATW A;  4DKA C;  1A63 A;  4DV5 Q;  2PNH A;  4IOA A;  4OWT B;  1B70 B;  3M9B A;  3S1R H;  1QVF A;  2RF4 A;  4DR5 L;  2ZM6 L;  1PH8 A;  2ZJQ A;  4IFD J;  5IYB G;  4HJ7 A;  4X65 L;  5BR8 L;  4JI3 L;  3I4N G;  3ULL A;  3OTO L;  2N3S A;  4IPC A;  4QL5 A;  4MNO A;  2ZTD A;  5FLX c;  1P8L A;  1QZG A;  2AWO A;  4K0K L;  5K36 G;  5IYB H;  4HID A;  3PUX A;  4JI0 L;  5AJ3 Q;  2OTL A;  3U58 A;  2E2H H;  2JA5 G;  2L15 A;  3I4N H;  1V43 A;  5M5X H;  1WYD A;  3KOJ A;  3G71 A;  4DV6 L;  4JI4 Q;  4DV3 Q;  3PUY A;  1FL0 A;  4GS3 A;  2E5L Q;  4OWW B;  2K52 A;  4DR3 L;  5ELN A;  1CKN B;  4JYA Q;  1GVP A;  1TWF H;  1N36 L;  2VW9 A;  4P74 A;  2AKW B;  2I5M X;  4HJA A;  1CUK A;  1QUQ A;  3PSI A;  2BA1 A;  3BJU A;  1XPU A;  1IXR A;  2BA0 A;  1KHI A;  4LF8 L;  5JEA G;  3W1G A;  1EYG A;  4YCW A;  1HZB A;  2VY3 A;  3J81 i;  3I4M G;  1T9H A;  3KF6 B;  2V1C C;  3K81 C;  1Y1V G;  3BZK A;  2UXD L;  3UDG A;  3F8T A;  4R4T A;  4LFB Q;  2LXK A;  4C3J H;  3RN5 A;  1VQA A;  4X66 L;  3LGJ A;  5GRO A;  1HNX Q;  1E24 A;  2NVT H;  1SMX A;  1HZC A;  2DUD A;  1PH4 A;  4BXX H;  2K75 A;  3I4M H;  2VS1 A;  2GVB A;  3UDX A;  2BH2 A;  4P73 A;  5GAD C;  1JJG A;  4AQY Q;  4R4I A;  3AQQ A;  5IP7 G;  4LF9 L;  1K8A C;  2WFW A;  4A76 A;  2YYZ A;  1D8L A;  1EOV A;  1Q81 C;  4MTN A;  3CPF A;  2YTX A;  1VQM A;  4DR5 Q;  3AFQ A;  2JA6 G;  3M4O H;  5IT9 c;  4A3K G;  1XPR A;  4JC0 A;  2R7F A;  2UUC Q;  2K5H A;  2WAQ G;  3K0X A;  1PFS A;  2MO1 A;  4LUZ A;  4DR7 L;  4EX5 A;  1HH2 P;  2KCM A;  2Z0S A;  4X65 Q;  1YJ9 A;  3S17 H;  4A3G G;  4JI3 Q;  2VQF L;  1N34 L;  1L2F A;  3BU2 A;  3H3V I;  4DK6 C;  1A62 A;  1OXT A;  2F4V Q;  1L1O A;  1AE2 A;  1MJC A;  1SRO A;  2KBN A;  4X64 Q;  2HHH L;  4JI0 Q;  4JI6 L;  3GTK H;  4GOP C;  2JK8 A;  4DV4 Q;  3CCM A;  3A0J A;  1LUZ A;  1UEB A;  1VQO A;  2N78 A;  4GKJ Q;  4LF4 Q;  3KDF B;  1OXS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...