4DKAC

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
86
Chain Sequence
b'SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVLGYVKVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 14
structure length 86
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dkaC00
2JE6I 2LXKA 1X56A 4LF8Q 1B7YB 1YJNA 1HZBA 4A3JH 1YJWA 5E7NA 2UXDQ 2E5LL 1G291 5M5WH 4L5SA 4YCVA 4A3MG 4JI5Q 4IFDJ 4DK6C 1U0LA 2YTYA 4A3FG 1M90C 1VQPA 3HOUH 4LF8L 2UXDL 4GKKL 3I55A 3KOJA 2ID0A 5M3FH 2OQ0A 4X64L 1AE2A 4AH6A 4BBRG 4LUOA 1PH9A 3FP9A 1WOCA 1YIJA 5BR8Q 1A0IA 3KLWA 1A63A 3E0EA 4BY1H 2UXCQ 2DGYA 2FXQA 1QVFA 1YEZA 3GD7A 1XPUA 3VDYA 3CC2A 1D7QA 3JC66 3RLFA 4A75A 1Z9FA 1S3OA 1WJJA 1RIPA 3LGJA 3J80i 5BR8L 2OWOA 1BBWA 3I2ZA 1XMOQ 3J7A5 2UXCL 2K4KA 2ZJRA 4A3MH 3EN2A 5H1SE 4JBWA 5IP7G 1UE7A 4YY3Q 4A3FH 4LF9Q 1AH9A 1PYSB 1OXTA 1AE3A 4BBRH 5GAGC 2QGQA 4L5TA 4JI0Q 4R4TA 4C3HH 1HZ9A 5JJLA 1NBWA 4A76A 1E22A 4LF9L 3PUWA 1KAWA 5C44G 3HOVG 1VQNA 3EIVA 1BBUA 5C4JH 4IJHA 4JI1Q 5IP9H 5FLMG 2Q2UA 5EAYA 3GTJH 2XGTA 5LMNQ 1HNXL 2Y0SG 4RG1A 1D8LA 1HR0Q 4DR4Q 3E9IA 2RF4A 2F4VQ 5IP7H 5C4XH 3A5ZB 4JI1L 3CD6A 1XNQQ 1VQ8A 3H3VI 3I56A 3F2DA 3HOZG 3ER0A 3H0GG 1KRTA 5LMNL 1ASYA 1VQGA 4L5QA 1NMFA 2F4VL 2RHSB 1WCMG 2HT1A 2I5MX 1N8RC 2YU9H 4DR1Q 4DR5Q 5C44H 4IOCA 4OO1I 4A3CG 4UP9A 2OTJA 3GTQH 1WI5A 2HIXA 3CCVA 1K8AC 1MKHA 5FLMH 1C0AA 3K81C 2WAQE 4K0KQ 2PMZE 4GN4B 5C0XI 2F3IA 1X6OA 5IT9c 3M4OH 1L1OA 4FDBA 1QVGA 3HOZH 3TRZA 3H0GH 4JV5Q 1Q81C 4K0KL 1OXVA 2NVXH 1WCMH 4JOIA 1YZ6A 2KHJA 4P73A 4JI2L 4JOIC 3RZOH 4LWCA 2IY5B 2HHHQ 1J6QA 4A3CH 1SLJA 2CFMA 2DUDA 5HGQA 1Y14B 1K8GA 1J5EL 3HFZB 1K73C 4PG3A 2NVTH 2KCMA 4O2DA 1EQRA 3G71A 2JJQA 1KIXA 3CXCA 2VZAA 1XPOA 3S24A 4BA1I 3OTOQ 1CUKA 2N8NA 5IE8A 2B63G 3A0JA 4IPGA 1CKMA 3GDEA 1NJIC 1N33L 4DR7Q 4UP8A 4QIWE 4DPGA 2BH2A 1NY4A 4GKJQ 2R92G 3STBD 2H5XA 2IX0A 2C35B 2K5HA 4A3DG 3G6EA 4QL5A 4C3JH 4YHHQ 1Q7YC 2B29A 4DR7L 2ATWA 2NN6G 1GVPA 3PF5A 3ULLA 5JEAJ 2ZTCA 4MNOA 3U4ZA 4DV1Q 1OTCA 3OW2A 2R6GA 2OCEA 3TS0A 1XPRA 3T1HQ 4YHHL 1VQKA 2KCTA 4GLAC 2B63H 1W2BA 1LM0A 1PH8A 4KLKA 1WFQA 4DV4Q 3T1HL 4GN3B 4JBKA 2IX1A 4IFDI 3JAMi 2R92H 1L2FA 3L0OA 1I94Q 3PF4A 4P72A 3BU2A 2Q2TA 4A3DH 1I50H 2OQKA 4B3ML 1VQJA 1PH4A 4DV4L 1KD1C 1K3RA 3S16H 1UWVA 2VS1A 2YTVA 2JA7G 1T9HA 1VQDA 1PH2A 1JT8A 2WB1E 3OYYA 3F2BA 2ZJPA 3F2CA 3CCUA 3UDIA 3I4OA 1CSQA 2R93G 1SN8A 4BA2I 4LF5Q 4YCWA 1K0RA 3S1QH 3L7ZC 1OXUA 1OXXK 1S40A 1YVCA 2E2IH 4UY8C 4LFBQ 3CPFA 1XJVA 2VUMG 4DKAC 5M3MG 4LF6Q 2R7FA 3PIPA 4DR2Q 4JG2A 2JA7H 1PV4A 1VQLA 4DAYB 3CMEA 2CCZA 4JI7Q 1V43A 4R1JA 4LFCQ 3GTMH 4LFBL 1CKNA 4J15A 1PA6A 4YWLA 4ALPA 2R93H 4JI5L 4DR2L 3PUXA 2WFWA 1IZ6A 5JEAG 1PH7A 2JA6G 1WYDA 1KC8C 4GS3A 4A3BG 3NENA 4LFAQ 4DV3Q 2UUCQ 4JI7L 1KQSA 3CW2C 4P75A 3J81c 4HJAA 3S2HH 3FHWA 4POGA 1XTDA 1EQQA 4DR6Q 1I5FA 5M3MH 3RN2A 4LFAL 4HIKA 4JBJA 2WAQG 5LMNW 1YHQA 1HR0W 4AIMA 1GD7A 4B3RQ 4GN5A 1RL2A 1TWFH 4WJ3M 1XNRQ 1PFSA 1LTLA 4X66Q 1XMOL 1V1QA 1PH5A 4LF4Q 4A93G 2GVAA 4B3RL 3K0XA 1B70B 4YY3L 2JA6H 3HKZE 1XNRL 4A3BH 2QEXA 1TWAH 2I0QA 1YHBA 4OONA 1PVOA 4LF4L 4JI0L 4UP7A 1UE1A 4H02A 1EIFA 1N9WA 1R9TH 3CCLA 1NE3A 2ASBA 1PHJA 3GTLH 2K5NA 2NVYH 5LMUQ 1Y1VG 2BA0A 4P71A 4R4IA 1E24A 1MIUA 1CKNB 1HR0L 3S14H 4A93H 4DR4L 4IJLA 4XTCS 1P8LA 1XNQL 3S1RH 3TS2A 5GAHC 5ELOA 3HOVH 4B3TQ 1YI2A 1A8VA 5FLXc 1G6PA 2Z0SA 4DUYQ 4A3LG 4DV2Q 1CSPA 4APVA 1SMXA 4DR1L 4DR5L 5GAEC 4HIMA 1VQAA 1X54A 1EUJA 5IYDG 1VQBA 1Y1VH 2PQAA 1L1OC 4DUYL 1X65A 2EQSA 2VY3A 4BXXG 1X3EA 2NZOA 4DV2L 1B8AA 4HIOA 1EFWA 4R4OA 3T1YQ 3BJUA 4L5RC 4YWMA 1BVSA 4NB3A 4JV5L 3W1GA 2A1AA 1E3PA 3K8AA 1EOVA 3GTPH 4X6AH 4JI6Q 4A3LH 3U58A 1Y1WG 1LUZA 5FJ8G 1VQ9A 2HHHL 5GQOA 1PYBA 1VQ5A 2QA4A 4KHPQ 3S15H 2Q2IA 3KFUA 4A3GG 1Q46A 1IBKQ 1VQ6A 2A19A 3U50C 2WB1G 1IYJB 5IYBG 1EYGA 4DNIA 2VQFQ 1O7IA 1K83H 1TWCH 3PGZA 4LW1A 3HOXG 2EXDA 3J81j 2CWPA 3D0FA 3KJPA 1G51A 1JB7A 4PZ7A 4JBMA 3S2DH 3OTOL 3BZKA 1X3GA 3F1ZA 4EX5A 5C3EG 2VQFL 1JMCA 4NXNQ 2IHEA 5GROA 2PI2A 4JCVE 3S17H 1Y1WH 2JEBI 2ES2A 2JA8G 4X65Q 3AEVA 4GKJL 1JJ2A 4NXNL 4DV0Q 3UDFA 5IYCG 3J80c 3ICEA 1L1OB 4Y52H 2PQAB 2D0OA 5IYBH 1KL9A 4O0AA 1JE5A 4JI3Q 3UDGA 1V9PA 3KYHC 3CCRA 1OXSC 3TEHB 3HOXH 4AYBE 4EQ5A 4DV0L 3I4MG 4DV1L 3M4PA 2I5HA 3S1NH 3G48A 3GO5A 3W1BA 5C3EH 4NXMQ 4OWWB 3CAMA 3MEFA 1SROA 4HJ5A 3FKIG 1ASZA 1E1TA 2CKZB 3DM3A 5IWAQ 1Z47A 2JA8H 4IOAA 4QGUA 2K50A 4BY7G 2MO0A 4NXML 4HIDA 3KF8B 1I94L 3UE1A 3HOYG 5K36G 3B6YA 3KJOA 4HJ9A 4LUZA 5AJ3Q 4HJ8A 1L0WA 3HKSA 1E7ZA 1YHAA 1HZCA 4YCUA 3CMAA 3I4MH 1Q1EA 2I5LX 1KRSA 1VQEA 3AYHB 3IRBA 1JJGA 3HKZG 3EBEA 1IBMQ 4DR3Q 2IT1A 3CC7A 3H15A 1E1OA 3FKIH 3D31A 4LF5L 1GKHA 1IBLQ 1NMGA 2JEAI 1JJCB 1VQ7A 1IBML 1KHIA 3J7ZC 2E2HH 2ZTDA 1QZGA 1LYLA 3E9HA 4GNXA 1TWGH 4GNXC 3CCQA 1IBLL 3HOWG 4GLXA 1FL0A 4LF6L 1QVCA 1N34Q 1SFOH 3CF5A 2PNHA 1X55A 3MXNB 1PH6A 5M3FG 1MJEA 4JI8Q 4Y7NH 3M85A 4OO1G 2UUAQ 4LFCL 2ZM6Q 1N34L 3U4VA 1TWHH 2N78A 4JI8L 4DV6Q 2VUMH 2N49A 5JJKA 3RR5A 5C0XG 4DV3L 4OWTB 2UUCL 1UE5A 1QUQA 2ZM6L 2UUAL 4GKKQ 3H3VH 1U5KA 4C2MH 1A62A 1IL2A 1IXRA 4X64Q 4TVAB 3I4NG 2E8GA 2NN6I 4DV6L 3HOWH 4DR6L 2AWOA 4QQBX 1UE6A 3PIOA 3KDFA 4LUVA 2VW9A 2R7DA 4A3IG 3A5UA 1I3QH 3AFQA 3CCSA 4X66L 4DV7Q 3NBHB 3K80C 2D62A 3PCOB 3K7AH 3I7FA 2IHFA 2RHQB 3GTOH 5IP9G 2UXBQ 4DV7L 1X3FA 3CPWA 3PUZA 3I4NH 1Q1BA 4PZ6A 4GNXB 4BBSG 3CP0A 1GM5A 4YWKA 1N32Q 2BA1A 5C4XG 2R7ZG 2UXBL 4IPHA 1C9OA 1MJCA 2HIVA 4A3IH 1P16A 1SRUA 5LMUL 3F8TA 3M4QA 2CQOA 1Q8KA 1N32L 4PZ8A 1EIYB 4DAMA 2OTLA 3PUVA 1HNWQ 1PH3A 1N36Q 1HNXQ 4IPDA 1HNZQ 2HQLA 1Q82C 4GLVB 5J3BA 2K5VA 3JAMc 1YITA 2YYZA 3RLNA 1QUQB 4B3TL 2BH8A 1HNWL 1N36L 3ZJYC 1H95A 5DLQE 4BBSH 2ALYB 1FJGQ 1HNZL 3S1MH 2K52A 3KDFB 2R7ZH 3BZCA 3TQYA 2GVBA 5M5XH 4DV5Q 4AYBG 1FJGL 1Q12A 2UUBQ 3ULJA 5M5YH 4IFDG 1UEBA 1GO3E 2JA5G 4POFA 4MTNA 5GADC 4IO9A 3T1YL 4DV5L 2Z6KA 4B3SQ 2D0PA 3STBC 1S72A 2JA9A 2F52A 2Z6KC 2RCNA 2UUBL 1YJ9A 2WP8J 3CCEA 1K9MC 3M3YH 5JJIA 2VL6A 3Q8DA 4A4IA 3CC4A 1VQIA 5IYDH 4RMFA 3TREA 4QY7A 2KHIA 4JI6L 2YV5A 1VQFA 3A74A 4R4CA 4JI2Q 4B3SL 4BXXH 1KXLA 2KBNA 3RN5A 4KHPL 2Q2HA 4LNQA 1VQHA 2CWAA 4PMWA 2B3GA 1IBKL 2JK8A 3PV0A 3J81i 4A3KG 1J5EQ 3GTKH 3PO2G 1I6HH 2JA5H 1VQMA 2NVQH 3KF6A 3UE0A 2MNAA 2GN5A 5FJ8H 2Y0SE 4OX9Q 1FVIA 2NZHA 2ZTEA 3ERSX 5IY0A 4A3GH 3M9BA 4GOPA 4HJ7A 3UDXA 4GOPC 1X9NA 1BKBA 1DGSA 1QZHA 4IPCA 1VQOA 1Q86C 4WJ4A 4R4QA 2K75A 4X65L 4OX9L 1N33Q 4P74A 2JQOA 5C0XJ 3AQQA 3G4SA 3M7NA 4A3KH 2A8VA 2MFIA 2V1CC 4JI3L 3PO2H 2L15A 4NPSA 3RLOA 3PUYA 3AFPA 1VS0A 3NEMA 4A3EG 1HZAA 4AQYQ 5IYCH 4MZ9A 3PO3G 2AHOB 4OWXB 1NTGA 1VQ4A 1TXYA 2UU9Q 3GTGH 4JC0A 5IWAL 4JYAQ 4X62Q 3NELA 4DK3C 2N3SA 1CKOA 2AMCB 3CCJA 1HJPA 3SGIA 3ULPA 1FGUA 1SR3A 3RZDH 4LF7Q 4AQYL 1YBYA 2AWNA 2UU9L 4JYAL 1VCIA 2PI2E 2AKWB 4X62L 2K14A 5AJ3L 3DLLA 3CCMA 1XMQQ 4B3MQ 2VNUD 3RNUA 4LF7L 3K7UC 2KENA 3KF6B 4KI0A 4OXPA 4A3EH 1C7YA 3L2PA 1HH2P 2VQEQ 4JI4Q 4TQUS 2EIFA 4UPAA 1M1KC 4BY7H 1XMQL 1SE8A 2LXJA 2XTIA 5HY6A 1VQCA 4DR3L 4A3JG 3HOYH 3PO3H 4GOPB 4ME3A 1W3SA 2YTXA 3W5OA 2VQEL 1PH1A 3WWVA 4JI4L 3HOUG 4XIGS 2ZJQA 4QJFA 1YNXA 5ELNA 2E2JH 2LSSA 4DUZQ 3PSIA 3CQZH 2E5LQ 4BY1G 2MQHA 4C3IH 2MO1A 1EWIA 4KHZA 4DUZL
chains in the Genus database with same CATH superfamily
2UXDQ 1B7YB 1YJNA 4N8FA 4A3JH 5E7NA 1S5BD 1SJED 1G291 3G7LA 4JI5Q 5A35A 4IFDJ 3MHBA 4L6TB 1M90C 1VQPA 1D1IA 3OMCA 2ID0A 2C9OA 4X64L 4OO1H 3S9WA 1YIJA 2ZXRA 3KLWA 1D7QA 3AB9A 4A75A 2E2IB 2ZJRA 4NDXA 1AEXA 4CDFC 4A3FH 2E76C 3T13A 2QGQA 2EPBA 4R4TA 4CHTB 1E22A 2FMCA 1AZQA 5C44G 1VQNA 4Y7NB 1BBUA 4V190 3MFGA 1GHKA 3T16A 1HNXL 1HR0Q 4RG1A 4DF7A 4DR4Q 1CI3M 5C4XH 4R8IA 1XNQQ 3I56A 3HOZG 5C3WA 5LMNL 2F3WA 1UUPA 1FR3A 2J4XA 3WOFA 4OO1I 2OTJA 4IOCA 4DNRB 2EJFC 1WI5A 3FEWX 5FO9B 3K81C 2OXPA 2WAQE 4KV6A 2Q8RE 5CV9A 1L1OA 4FDBA 1G8ZD 2K28A 4JV5Q 4K0KL 3I70A 1WCMH 4JI2L 1YZ6A 2IY5B 4JOIC 1TS2A 3DMUA 1SLJA 2R3ZA 1CA6A 3OW7A 1J5EL 3MC0B 2FJ2A 1K73C 2NBFA 2ZXOA 1EOTA 2KCMA 2BDOA 2JJQA 3OMGA 3CXCA 1XPOA 3HRZC 3OTOQ 1Y1VB 3Q23A 3S1MB 3N6RA 4G4KA 4IPGA 4DR7Q 4UP8A 4P2CB 4QIWE 2BH2A 2VB3X 2H5XA 4CGYB 4C3JH 4YHHQ 2B29A 2PPBC 3GTPB 2ATWA 3U4ZA 4H44C 2KVMA 2R6GA 3I4LA 4O42A 2B63H 4RHSA 1W2BA 1LM0A 1F2LA 1SYCA 4GN3B 1KLUD 2R92H 3L0OA 1PRTC 3BU2A 4A3DH 4XT3B 1I50H 1KABA 3K5OA 3MTSA 4EQNA 1T9HA 1PH2A 3NTHA 4DAPA 2A73B 3I3CA 3TP5A 4K5VA 3CCUA 2R93G 1SN8A 4BA2I 4LF5Q 3HOXB 3S1QH 4KTAA 1MGSA 4UY8C 5C3EB 2KEDA 5M3MG 4JG2A 2JA7H 1XYIA 2JA8B 1V1PB 3GTMH 3HEJA 2JA6G 1ENAA 2UUCQ 4P75A 1TR5A 4WJWA 1EU4A 2F0KA 1XTDA 4LK1C 4RAUC 4RKBA 5BN3A 3LWEA 4DR6Q 5CV4A 3FKIB 1PTOC 1VF5C 4NP5A 4B3RQ 2O5JC 1S5CD 1TWFH 2B2YA 5FK9C 3HG9A 3R3OA 3HOYB 5I2YA 2HUGA 5JEAH 5DM63 3HKZE 4N9TA 1TWAH 4KY5A 1JICA 4M8AA 2PZTA 1EYDA 4UP7A 1LLRD 4JI0L 4H02A 1EIFA 1R9TH 3CCLA 1A2TA 3QWNA 3GTLH 4OEMB 1E2WA 2NVYH 4P71A 3ERQA 1LACA 4A93H 1QILA 4ZK9B 4XTCS 1XX8A 1YI2A 1G6PA 5IGDA 1SMXA 1F9RA 4HIMA 2SOBA 4ZQ3A 1PFNA 1VQBA 1Z7TA 1JOOA 2NZOA 1PZID 4HIOA 3T1YQ 3KLSX 4YWMA 2LY7A 1DCZA 1TY0A 1EOVA 2FFKB 2DNCA 3U58A 1Y1WG 4DK1A 2B2WC 3Q24A 1PYBA 4KHPQ 1SE2A 4BBSB 2VQFQ 1TWCH 1K83H 2MP1A 3BDOA 2CW0C 2CWPA 3D3RA 1ILQA 3NWTA 4HAEA 4PZ7A 3IFTA 3S2DH 4CKBA 3BZKA 4EX5A 3F1ZA 4NXNQ 2IHEA 5GROA 5M5YB 1BUVT 4X65Q 5HURA 3J80c 1L1OB 2D9UA 3M3YB 3OHXC 1JE5A 4JI3Q 1V9PA 1OXSC 1WTOA 4IALA 3TZUA 2RVLA 1H9JA 3I4MG 1Y8PB 3C1FA 3V96A 3OSOA 1CZGA 3GO5A 4TSSA 3CAMA 1L0YB 5FLXE 3DM3A 4F88A 1Z47A 1O80A 2IX3A 4NXML 3JAME 2KOLA 3DHQA 1DZ1A 3UE1A 1S5FD 4KD4A 4R9WA 3RD4A 3FPUB 3HKSA 1ILPA 5EPJA 1Q1EA 1I4XA 2I5LX 3AYHB 1VQEA 1HRJA 3EBEA 3DEPA 3NBHA 4A3KB 3PO2B 4HR7B 1GKHA 2TSSA 1NNXA 1VQ7A 1IBML 1B3QA 4K14A 2ZTDA 1LYLA 2IPKD 5K36H 1TWGH 4GNXC 4RGOS 1IBLL 2EJGC 4GLXA 1HTPA 1QVCA 5IOCA 4LF6L 2QW7A 4ZCKA 1PYWD 5DEHA 4Y7NH 4OO1G 3D4RA 1N34L 3U4VA 5CR3A 2N49A 1TQOA 1A15A 3L3OC 1UE5A 1QUQA 3X3MA 1IL2A 4X64Q 1SNOA 1BXTA 2NN6I 4LUVA 2DN8A 2ENBA 2R7DA 4WRDA 1JWUD 1I3QH 4X66L 4DV7Q 3GV3A 5BN4A 3PCOB 3BDCA 3K7AH 3G6JB 3K0YA 4ME5A 5CV8A 4C3IB 3CPWA 3E5SA 1S4ZA 3Q22A 4EGVA 4A3JB 3KBGA 5C4XG 1O7YA 3GQBA 2UXBL 2HIVA 2L0CA 5LMUL 1STGA 2Z4IA 2K32A 3F8TA 4DFAA 1N32L 4PZ8A 4K5XA 3DEOA 3PUVA 1HNXQ 4IPDA 5F2DA 5C5LA 1Q82C 4GLVB 3JAMc 1H9RA 1HNWL 1BCPD 1H95A 1LTTD 3S1MH 4HMJA 3P7JA 1K3BC 2XRQD 2R7ZH 3VR6A 3BZCA 4A3FB 3TQYA 4O1NA 2GVBA 1FJGL 1Q12A 2UUBQ 2EYJA 4POFA 3Q0AA 2JYOA 2KEEA 3PQIA 4DV5L 1S72A 3STBC 1YJ9A 1E2VA 3CCEA 2VL6A 3Q8DA 3CC4A 3TREA 1EY0A 2B2TC 3NSWA 2YV5A 1VQFA 4B3SL 4JI2Q 3RN5A 1RTOA 1MI2A 4KJNA 4PMWA 2B3GA 5NUCA 4IFDH 4K6LA 1V1OA 1J5EQ 3GTKH 1EZ6A 2A6EC 5CYUA 2JA5H 3UE0A 2RA4A 5FJ8H 3HOVB 1FVIA 1T5XD 2NZHA 2ZTEA 2QF7A 3OWEB 3D6CA 3UDXA 3VA7A 1LABA 1X9NA 4WJ4A 1JB3A 2Z4HA 4P74A 4G57A 4H7BA 2MFIA 4E6IA 2EY5A 3J80L 1WCMB 2ICEC 3PUYA 3RLOA 4ID6A 4A3EG 3SDZA 5IYCH 2AHOB 4OWXB 1VQ4A 4IURA 5C4ZA 3VA5A 2N3SA 1CKOA 1JT8A 4KKTA 4LF7Q 4CKEA 3S15B 3E0JA 2AWNA 3V2TA 2PI2E 3DLLA 4ODGA 4PMCA 5AJ3L 1XMQQ 1SYGA 3KF6B 1HH2P 1M1KC 2N88A 5IODA 3ZYYX 3KUPA 4I7AA 3HOYH 1FGBD 4GOPB 4ME3A 1CFMA 4C3JB 3W5OA 2VQEL 1LT6D 5K5PA 1RJTA 2K05A 2K5DA 4DUZQ 2B63B 4H13C 5FOBB 3A8KE 1PFMA 5CGKA 1EWIA 3MVVA 2HCIA 2LXKA 3E6ZX 3D6WA 2R92B 1YJWA 2M00A 3HZXA 2E5LL 2LKVA 4A3DB 4L5SA 1I50B 4YCVA 4A3MG 4RWSC 1LO5D 1RKNA 1U0LA 3BVGA 4ZUIA 4LF8L 3KOJA 4OGQC 4AH6A 4BBRG 3FP9A 1WOCA 2QKIC 5BR8Q 3E0EA 4BY1H 3QB3A 3T56B 1WVLA 1ML0D 3E3XA 3RLFA 1S3OA 3S1QB 1WJJA 3LGJA 3NBIA 3J80i 2SEBD 3J7A5 2PW7A 2UXCL 2K4KA 1KDAA 1ZKOA 2JSOA 5CV6A 1TT2A 1PYSB 1OXTA 2JA7B 2WIIB 4JI0Q 3GTMB 4C3HH 1HZ9A 4A76A 4LF9L 2EYOA 4J1MA 1KAWA 4JI1Q 5IP9H 5FLMG 2Q2UA 4FXDA 5EAYA 4HCSA 4RGNA 2Y0SG 3EFXD 1D8LA 1ZYRC 5IP7H 1D1KA 1OO9B 3H3VI 4G7ZC 2MGSA 1VQ8A 3F2DA 1DOKA 1GJXA 1KRTA 1TWFB 1B9MA 3BYTB 2QDBA 1NMFA 1ET6A 2F4VL 1C48A 1RCVD 2I5MX 2HT1A 1N8RC 2NB0A 1K8AC 1IL8A 3DWPA 2PMZE 5C0XI 1CHQD 1X6OA 2IWHA 4BWGB 5IT9c 1HQMC 1R9TB 2WAQB 2BOSA 3GTLB 2EY1A 3H0GH 1Q81C 2NVYB 4A93B 2KECA 5EPLA 2XNAC 4WFN3 1J6QA 1RF2D 4A3CH 5C4HA 2CFMA 2DUDA 5HGQA 1Y14B 2MPMA 4DGZA 1K8GA 2XN9C 2FHTA 4PG3A 1TU2B 4V0BA 1KDCA 1EQRA 3G71A 1F2ZA 1BR9A 1LTGD 3S24A 5L37A 4CJ2C 3A0JA 3NK9A 3GDEA 5JVH3 1QG7A 1N33L 1O7LA 1X3PA 1NY4A 4TKOB 5M5XB 4B9WA 2IX0A 2K5HA 3CHBD 3G6EA 2HCCA 2B8FA 4QL5A 5DNFA 1Q7YC 2NN6G 1GVPA 3PF5A 3ULLA 2ZTCA 4IUUA 1V1PA 3OW2A 3TS0A 2OCEA 1XPRA 3T1HQ 3N52A 4GLAC 4RHRA 4CDEC 2AUKA 4KLKA 1K83B 1IYUA 4DV4Q 3H94A 4CJ0B 3JAMi 1F2MA 2NTSA 2XIWA 3S2DB 2OQKA 4OELB 2LMCB 1KD1C 2Q8TA 1UWVA 1SDFA 4X3TA 1VQDA 1R4QB 2WB1E 3P1HA 3VYTA 2ZJPA 3VYUA 4A3GB 3LWUA 1EY9A 5G3LD 1I4HA 1K0RA 5TSSA 1OXXK 3BG3A 1S40A 1CZWA 3CPFA 4LF6Q 2R7FA 4DR2Q 1GUWA 1VQLA 3CMEA 4LFBL 4JI7Q 2EE1A 4YWLA 3ND8A 4ALPA 2RQXA 1PH7A 4KKSA 3FDTA 4FXGC 4OIKA 4B9XA 1G91A 3CW2C 3FHWA 1EQQA 4LFAL 4JBJA 5LMNW 4AIMA 3C1EA 2J0TD 2PW5A 1UNSA 4GN5A 3QJYA 4WJ3M 1XNRQ 2B2YC 4BY7B 1PFSA 1LTLA 3TMEA 1FNVA 1SAPA 4X66Q 2QDLA 1XMOL 1WD0A 1H9MA 1V1QA 1TWGB 2F0SA 1HUNA 4A3BH 2QEXA 1ICWA 1YHBA 2H4OA 2QCPX 1AP0A 1UEAB 1PVOA 4ILWA 4LF4L 1SYBA 3HKZB 4DXFA 3NTKA 1NE3A 5T1IA 3A54A 1YNJC 5I4DA 5C3XA 5LMUQ 3VYSA 1Y1VG 4R4IA 5EPKA 1E24A 1CKNB 3S14H 3S1RH 2K6AA 1L0XB 5GAHC 5ELOA 3HOVH 2F0VA 1A8VA 4FVMA 1I3QB 4KHVA 3SK8A 1B2TA 4A3LG 1CA5A 1CSPA 2K01A 2A68C 4DR1L 1DOLA 3K7AB 1BCPB 3DXJC 4DUYL 2EQSA 2VY3A 4DV2L 1B8AA 3P20A 4R4OA 1EFWA 3A55A 4L5RC 1BVSA 2B2VA 3W1GA 5IT9L 1E3PA 1LTSD 5JAVA 1WTRA 3BDLA 5KYIA 1LUZA 5FJ8G 1VQ5A 1TIID 2K5QA 3S15H 1I4QA 2Q2IA 3KFUA 2MUYA 1SNQA 1EYGA 4DNIA 3HOXG 1RD9D 1PZJD 2R7ZB 3D0FA 1G51A 4JBMA 2NVQH 5C3EG 1X3GA 3FVQA 2WACA 1JMCA 2PI2A 4JCVE 1PXUA 2JEBI 2JA8G 3ONAB 3AEVA 4GKJL 1LTAD 4DV0Q 5IYCG 4FF1A 3ICEA 4Y52H 2PQAB 1DYQA 5IYBH 4HN7A 2PQEA 4HTHA 3UDGA 1WTPA 1EY6A 4AYBE 4EQ5A 4DV1L 3G48A 3MEFA 4XQNA 1SROA 3FKIG 1U4RA 2SNSA 1E1TA 2CKZB 3GTKB 2JA5B 4IOAA 4QGUA 4K2KA 2MO0A 3HOYG 4OL7A 3CU7A 5AJ3Q 4HJ8A 2CVRA 1DM0B 4DNTB 1E7ZA 1YHAA 1HZCA 2EYLA 4YCUA 1GUNA 4LJZC 3GV6A 3IRBA 3BYYB 1H9SB 1PFBA 3DUZA 1FYCA 1EU3A 1NMGA 1IKLA 3QO2A 1KHIA 1KNEA 3FMCA 4LMQD 3E9HA 5IIFA 1XXGA 3CCQA 2F0UA 1NAPA 4EQOA 1MJEA 1X55A 1JWSD 4JI8Q 3M85A 1M8AA 2UUAQ 1NCVA 4DA2A 3BVMA 1PRTD 2N78A 3I90A 5JJKA 5C0XG 2IJ0A 4OWTB 3HP3A 4DV3L 2ZM6L 2A69C 1VF7A 1U5KA 5KNDA 3QOLA 1JORA 4DV6L 3HOWH 2AWOA 4QQBX 1X32A 3J80E 3PIOA 1A3TA 5JOBA 3AFQA 2EYFA 4MIUA 2XVSA 2D62A 3K5LA 1PTOH 4QCLA 4X3UA 3I7FA 2IHFA 2RHQB 5E1FA 3GTOH 5IP9G 1S5ED 3PUZA 3I4NH 4BBSG 3CP0A 4IUNA 1B1ZA 2BA1A 5C6AA 2L9HA 3NPPA 4A3IH 1P16A 4KK7A 2CQOA 1Q8KA 4K2LA 1JR0D 1N36Q 1HNZQ 4F87A 4BY1B 2K5VA 3CRKC 2XSCA 2EYPA 1PTOD 2A69D 3RLNA 1PLFA 1HUMA 3SHLA 2WKDA 1JOKA 5HGTA 2J7ZA 5M5XH 1Z6HA 2B39A 3OIPA 3ULJA 4PV1C 4MTNA 4C3HB 2F52A 2WP8J 4F7XA 2MJ8A 3FPPA 3SE0A 4R4CA 2KBNA 4YIJA 4LNQA 2CWAA 1IBKL 3PV0A 4A3KG 1B53A 3PO2G 4FF4A 2DY8A 4JPBW 3KF6A 1NSNS 3I8ZA 1G2SA 3KK7A 4RH6A 4OX9Q 3ERSX 4A3GH 3M9BA 4GOPA 1CQVA 1QZHA 2DY7A 1TKWB 4R4QA 1GHJA 5EJWA 1N33Q 2SNMA 4HSPA 1WTWA 2JQOA 4FP5D 3AQQA 3LNNA 3M7NA 3H0GB 5J1ZA 1HA6A 4DAVA 1FD7D 4IUPA 2N55A 4FXKC 4IUVA 3MZ5A 1NTGA 1HA5A 3D4DA 4JYAQ 5IWAL 4X62Q 1GUOA 3RZDH 3R2IA 2AMCB 3CCJA 3VR3A 4AQYL 2CW0D 3HGBA 3H09A 2UU9L 1IW7C 2AKWB 3URYA 2L5TA 1J9OA 3RNUA 1JCKB 1ZXTA 5CORA 4C3IG 3K5NA 3L2PA 4B08A 2E2DC 2R61A 4BY7H 1SE8A 5ELEA 4DR3L 2XTIA 4A3JG 3PO3H 2OT2A 4PNYA 3S17B 4JI4L 3TP6A 1AN8A 4RGMA 2E2JH 2F0EA 4J8QA 3PSIA 3CQZH 1DD2A 2RKSA 5D3DA 2MO1A 4KHZA 2EY6A 1X56A 1HZBA 3DWQA 2RSOA 5M5WH 2YTYA 4A3FG 3HOUH 2RDHA 2UXDL 1SE3A 2OQ0A 3TP7A 4LUOA 1SYEA 1ET9A 1A63A 4F8MA 4N8X1 2DGYA 1QVFA 3GD7A 3OPOA 1XPUA 3JC66 1Z9FA 1RIPA 2OWOA 4RA8A 1BBWA 3I2ZA 2BE5C 1XMOQ 4OHJA 5H1SE 4JBWA 1UE7A 2F0TA 4KD3A 1LTBD 1U9RA 2EXZA 5GAGC 4L5TA 4XQQA 1Q3LA 5JJLA 3T53B 1NBWA 1SFOB 3PMFA 3HOVG 3A8JE 3EIVA 4IJHA 1RTNA 4HEDA 5LHY1 3GTJH 1ONLA 1STHA 2EDGA 2RBMA 3IFDA 5LMNQ 1B50A 2VUMB 3E9IA 2ZXPA 1ENCA 2F3VA 5IGEA 2K04A 2CQAA 1ASYA 5EKKA 4L5QA 3TDQA 1WCMG 1JWMD 4UDUC 4H0LC 2YU9H 4DR1Q 5C44H 1I6VC 2NWGA 3GTQH 3TZDA 5JJZA 2HIXA 3CCVA 4A3BB 1C0AA 1SJHD 2K33A 1KDBA 1SSOA 4K0KQ 4QUCA 3M4OH 2CH4A 2PMZB 1QVGA 3HOZH 1OXVA 2NVXH 1LT3D 2KHJA 3S14B 4G7HC 4LWCA 4BS9A 3NWSA 1KTKA 1STNA 3X3NA 2F03A 3S1RB 3QIAA 4C3JG 1NR2A 2NVTH 1G2TA 4O2DA 1KIXA 2PNRC 2VZAA 2XWBB 4L63B 3W2DA 5IE8A 2B63G 5DAUA 1EY5A 1CKMA 1LTID 1SEBD 3MFYA 1NJIC 1F2YA 1EEFD 4DPGA 4U673 4GKJQ 2R92G 3STBD 4CDCC 4A3DG 4DR7L 5JEAJ 3BS1A 4MNOA 1OTCA 4S3SA 4DV1Q 1EIHA 4MHEA 4YHHL 1YNNC 5KEEA 2KCTA 2D5DA 5E4WC 3MXNA 4ZUJA 2A6ED 1W6KA 2F0QA 4IFDI 5M9OA 3PF4A 4P72A 2Q2TA 2NVQB 1VQJA 1PZKD 3S16H 2YTVA 2JA7G 1STYA 1TY2A 2X69A 5IT9E 4N9PA 4C56C 3F2CA 3UDIA 4HSVA 2WB1B 1A3UA 1XWEA 2P5ZX 1STBA 3L7ZC 1OXUA 1GUSA 2KUMA 5BN5A 3EROA 1XJVA 2K7VA 4DKAC 5KYLA 1PMRA 3EJIA 2CCZA 4DAYB 1V43A 3H3VC 1CKNA 1PA6A 2R93H 5JEAG 1WYDA 1KC8C 3A56A 4DV3Q 1KQSA 5KNCA 3J81c 1JOQA 1PRTB 4HJAA 5JPNC 3C46A 3S2HH 2RSNA 4POGA 1I5FA 5M3MH 3RN2A 4HIKA 2O4XA 1K8MA 1HXYD 2WAQG 3R8BA 1YHQA 2B2UA 1GD7A 4QUFA 4CDDC 2MHVA 3OIQA 1IHZA 1PH5A 4K8IA 4A93G 2GVAA 4B3RL 4YY3L 2JA6H 2K1BA 5COYA 2F0HA 1Y8NB 3A8IE 2F0FA 2QEJC 2K5NA 1EEID 1J8IA 2JXMB 3QG1A 4IUQA 1EQTA 1MIUA 2Q8IB 2DJGC 3HOWB 4XXEA 1P8LA 3NUCA 5M3FB 2Z0SA 4APVA 4DR5L 1PTOB 3BVZA 4KY7A 2X6GA 1VQAA 3GTOB 2PQAA 1L1OC 1X3EA 2IL8A 3I4NB 3EA6A 5EKIA 3BJUA 4NB3A 2F0MA 4A3IB 1D6EC 5CC4A 2B2VC 1ESRA 4X6AH 1SMYC 2F0LA 2HHHL 1I4GA 1ZEQX 1ZYRD 4I7ZC 5GQOA 2QA4A 3ITPA 1TS4A 2BCOA 3J7AF 4A3GG 5D65A 2VB2X 1Q46A 1IBKQ 1VQ6A 2A19A 1IYJB 1HPCA 1O7IA 3PGZA 2M9VA 2F1MA 4LW1A 2EXDA 4Z9CB 3J81j 2HD3A 2BDNA 1JB7A 1H9SA 2B8GA 3MEHA 4C1NI 2VQFL 1M4VA 1EQVA 3S17H 5C5MA 1Y1WH 2ES2A 1K8OA 1PRTF 4K5WA 4NXNL 3UDFA 3F2UA 5ELBA 3D4WA 1WTHA 1KL9A 5KNBA 3KYHC 1V8QA 3CCRA 5ELFA 2F0OA 3IL8A 3M4PA 2I5HA 3S1NH 4MTKA 1BNZA 4AYBB 4NXMQ 4OWWB 5J22A 3QOJA 1ASZA 5IWAQ 1EIGA 2K50A 3O13A 4BY7G 1S5DD 4HIDA 3KF8B 1F77A 1I94L 5K36G 3B6YA 4HJ9A 3DWAA 4LUZA 5JVG3 3MA2B 4X3SA 3CMAA 3I4MH 1KRSA 1JJGA 1H9KA 3HKZG 1IBMQ 1GUGA 4DR3Q 2IT1A 3TBIB 3H15A 1QWYA 1E1OA 3CC7A 2HDMA 5EQ0A 1IBLQ 2JEAI 2EYHA 1HTLD 3VR4A 2E2HH 1QZGA 1DONA 1DXMA 3NTIA 1N34Q 1SFOH 3CF5A 3MXNB 3OOCA 3RZDB 1W6JA 4XDXA 2EJMA 1A6XA 1SNCA 4LFCL 3K6OA 1TWHH 2F0WA 2VUMH 4PMBA 1TS3A 2L4NA 2NZ1D 4C2MH 3V05A 1IXRA 4TVAB 4RFBA 2LFNA 3PO3B 1UE6A 3J81L 1II3A 3WOEA 3A5UA 1DJRD 4RCOA 3K80C 2E2JB 4R8NA 2KQ3A 3RUZA 3CQZB 1Y8OB 3SVMA 2UXBQ 4DV7L 1RDPD 1X3FA 1Q1BA 4PZ6A 1AW7A 4GNXB 1O78A 1N32Q 3NXWA 4RCNA 1RHPA 5M5WB 3CKIB 2R7ZG 1G6ZA 1U4MA 1MJCA 4L8JA 3T51B 1SRUA 3M4QA 3HOUB 1SNDA 4DAMA 2OTLA 1HNWQ 1PH3A 2KHSA 1KNAA 1VMPA 3DM1A 5J3BA 5A2QL 2YYZA 4B3TL 2EY2A 2PZUA 4JW0A 5DLQE 2ALYB 1FJGQ 3TSSA 1EWHA 2Z8LA 3KDFB 2VXWA 4DV5Q 4IFDG 1GO3E 2JA5G 4KJOA 2EVBA 5GADC 2Z6KA 4B3SQ 2UUBL 1YNJD 4QMGA 1F9PA 2K03A 1K9MC 5JJIA 5IYDH 4RMFA 4JI6L 3SXHA 3A74A 3GTJB 1BF4A 4BXXH 1KXLA 2F0IA 2WINB 5IGCA 1VQHA 5D3IB 3A7LA 4TRDA 3CRLC 3J81i 1CQFA 3Q6SA 1VQMA 4FNFA 1EY8A 2MNAA 3GP7A 2YU9B 2A68D 5C44B 3QR8A 4KN7C 3GTQB 1Q8IA 2Y0SE 4HJ7A 4GOPC 3KLSA 5ISRA 1DGSA 3M4OB 2K75A 5CV7A 5C0XJ 2TMPA 3J7AV 3HOZB 2A8VA 2L15A 4ABNA 2NVXB 4NPSA 2JP1A 3AFPA 1VS0A 5FO7B 1HZAA 1TXYA 3AU7A 4JC0A 3GTGH 1JC7A 4DK3C 2NVTB 3SGIA 1FGUA 1JE4A 1YBYA 2KJXA 4EQPA 3CCMA 1SYFA 2NYZD 4LF7L 2K5WA 2KENA 2NUCA 5KRUA 4KI0A 4OXPA 4A3EH 1C7YA 2AQ3B 2VQEQ 2EIFA 2ZT9C 4G7OC 1XMQL 1VQCA 4QF4A 3WWVA 5I6WA 4XIGS 3FRPB 1BCPF 4QJFA 1YNXA 5EGTA 2E5LQ 4BY1G 2O2LD 3TN2A 2FINB 1PV4A 4DUZL 2JE6I 4LF8Q 1U4LA 3U9OA 3SEBA 5KGUA 1NR4A 1LV9A 4XYQA 2XRSD 4DK6C 4IQZA 3S16B 2PYKA 4GKKL 1HFGA 3I55A 5M3FH 1AE2A 1PH9A 1CK1A 1X3QA 4C3HG 1A0IA 5E3FA 2UXCQ 1B9NA 2FXQA 1YEZA 1EY7A 3VDYA 3CC2A 5BR8L 3K5MA 2A6HC 4A3MH 3EN2A 5IP7G 4YY3Q 1EZ8A 4LF9Q 1AH9A 5D14A 1AE3A 3MAQA 5FO8B 4BBRH 3SK6A 4GZYC 3SK4A 1HQRD 1WTXA 2R93B 2WKCA 3PUWA 5C4JH 3OWFA 3P75A 2O5IC 3MXGA 2XGTA 4JK1C 3S2HB 4DN4M 2KA7A 2F4VQ 2RF4A 5M3MB 1STAA 4OIJA 3A5ZB 4JI1L 3CD6A 4K6DA 3ER0A 3H0GG 1VQGA 2RHSB 2L12A 2IW3A 3VR5A 2NTTA 2RCFA 2Z9HA 4DR5Q 2JA6B 4UP9A 4A3CG 1QJOA 2L1BA 1MKHA 5FLMH 2RDGA 2A6HD 2OF1A 4GN4B 2F3IA 2LS01 5J39A 5AFWA 3TRZA 4JOIA 3RZOH 4P73A 2HHHQ 3I73A 1SNPA 4NMZA 4Q5VA 3HFZB 1VDZA 3SR1A 2H1EA 3R2TA 1NUCA 2RDFA 3M7GA 4ZLTF 4QB4A 5DM73 3MXPA 4BA1I 3MWYW 1CUKA 3R93A 2N8NA 2ICIA 4IZ8A 2F0DA 2C35B 1T5EA 1HHVA 2EYMA 1RODA 4DAYA 1VQKA 1WD1A 4CKCA 3VYRA 3J7YW 1PH8A 1WFQA 3M4YA 1HCZA 3T1HL 4JBKA 2IX1A 4J6HA 1L2FA 1I94Q 1I6HB 4B3ML 2GA4B 2EOTA 4DV4L 1PH4A 1K3RA 2NN6H 2G5DA 4EVOA 2VS1A 2I07B 1Y1WB 5CV5A 3OYYA 3PIO3 3F2BA 5LL6S 3I4OA 1CM9A 1CSQA 1E2ZA 2DJFC 1D2BA 4YCWA 1B44D 1C4QA 1YVCA 2E2IH 3S1NB 4LFBQ 2VUMG 3K58A 3PIPA 4KY6A 1EY4A 2AQ2B 4HMIA 4R1JA 2QILA 4ZKBB 4LFCQ 4J15A 1IW7D 4JI5L 4DR2L 3PUXA 2WFWA 1IZ6A 3EQLC 1SYDA 4GS3A 3NENA 4LFAQ 4A3BG 4JI7L 3I4MB 1QE6A 1ENFA 3T4AC 1BQQT 1LT5D 2PO4A 1PDQA 4Q0FA 2A74C 2CH4W 1HR0W 1AFPA 1QOHA 2B2UC 1RL2A 1BCPC 2C5CA 4I65A 1EYAA 4ZRZA 2E2HB 2D2CC 4LF4Q 1O7ZA 3K0XA 1B70B 4C1NK 1XNRL 1IYVA 5I2XA 1D5MC 2I0QA 2SDFA 5IGFA 4OONA 1EL0A 1UE1A 4KMUC 1N9WA 1BO0A 2ASBA 1PHJA 1Q90A 4NW2A 1SNMA 1TWHB 3NQIA 1EFID 1BOSA 1TS5A 2BA0A 3W3AA 4C2MB 4LAAA 4KN4C 4PQXA 1HR0L 4DR4L 4IJLA 4UHVA 1CHPD 1XNQL 3AMUA 3TS2A 4B3TQ 5FLXc 1SBBB 4DUYQ 2BE5D 1EWCA 4DV2Q 3NE5B 5GAEC 5E4XA 1D5ZC 4FF2A 1X54A 1EUJA 5IYDG 4IUTA 1Y1VH 1CT1D 1X65A 4BXXG 4ZAIA 2KCCA 4JV5L 1TVXA 4ZYSA 2A1AA 5LL6X 1UAPA 2G9HD 5IGGA 3K8AA 5G3LF 3GTPH 2Z1CA 4JI6Q 3J81E 4K8JA 4A3LH 2B2WA 1VQ9A 3TP8A 4CJ1B 1QCBD 3KF8A 4X3KA 5KIXA 3U50C 5IYBG 2WB1G 3D8GA 3H91A 5C4XB 1KAAA 1WTVA 3KJPA 1VMCA 3OTOL 1MD2D 4DK0A 3C2PA 4FF3A 1JJ2A 2E75C 2D0OA 3BZDB 3RMHA 4O0AA 2A5HA 1XTCD 1I4PA 4XYOA 4ULLA 3TEHB 3HOXH 1HFNA 5A2QE 4DV0L 4DXGA 3MXUA 3W1BA 5C3EH 4HJ5A 2JA8H 1GXDC 2L11A 2F0GA 1DOMA 3PIP3 2F4IA 5EBDA 1A3VA 3ND9A 3KJOA 4CBVA 1L0WA 1B4OA 2F0PA 4WORA 1LTRD 3FKIH 3D31A 4LF5L 1JJCB 5ELDA 4RKLA 3J7ZC 1D5XC 4GNXA 5IGBA 1AZPA 1YNND 3WDNA 3HOWG 1FL0A 3GTGB 2PNHA 2V4DA 1PH6A 5M3FG 1F9QA 2ZM6Q 1F9SA 4MN3A 3NP8A 4JI8L 4DV6Q 3RR5A 2I46A 2UUCL 1FNWA 2UUAL 2EZVA 5I9OA 4A3EB 3H3VH 4GKKQ 1A62A 5CBAE 3I4NG 2E8GA 4DR6L 3KDFA 3NQTA 2VW9A 1R4PB 3SK5A 4A3IG 3CCSA 1MSHA 3NBHB 2XWJB 5FKAC 5C0XH 3U9SA 1MBYA 3A7AB 5I9PA 2E74C 1MHWC 1JQYD 1GM5A 4YWKA 4FYDA 2FMMA 2Z6BA 4IPHA 1GUTA 1C9OA 1K0SA 1QB5D 3KLRA 1BDOA 1SE4A 2F0NA 1EIYB 5I6YA 1FNUA 2HQLA 3I91A 1YITA 1QUQB 2BH8A 1N36L 3ZJYC 4BBSH 1HNZL 2K52A 2PZWA 2PCFB 4ZKCB 5FLXL 4A3MB 2WV6D 2X6LA 4U68A 4AYBG 1WTQA 3JAML 5M5YH 3KBXA 4BBRB 1UEBA 1ICFB 3LX0A 4JVZA 2M2LA 4IO9A 3T1YL 1TWAB 2D0PA 3UI2A 2JA9A 2Z6KC 2RCNA 3C3LA 2HQEA 3M3YH 1QNKA 3L9AX 5C4JB 2B2TA 4A4IA 1VQIA 4QY7A 2KHIA 4M1UB 4KHPL 2Q2HA 2AUJD 4RGTA 5T1GA 2JK8A 1ESFA 1STEA 4UAIA 1GOZA 1I6HH 2AQ1B 2G9DA 4IN3A 1K28A 1E0BA 2GN5A 4NKLA 4DU9A 1MSGA 3K57A 5CMDA 5IY0A 3IAYA 3K59A 1BKBA 4IPCA 2Y0SB 1VQOA 1Q86C 1KLGD 4X65L 4OX9L 2HDLA 3G4SA 1A2UA 4A3KH 2V1CC 4JI3L 3PO2H 2L55A 3HS0C 3NEMA 1SMYD 3RZOB 2KCNA 2F0JA 3IKJA 4QIWB 4AQYQ 4MZ9A 3PO3G 3NHHA 2UU9Q 5ELCA 3NELA 4HCEA 4FO2A 3ULPA 1HJPA 1SR3A 5CBEE 1C8CA 4JYAL 1VCIA 3EVQA 2K14A 4X62L 4B3MQ 1IKMA 1TWCB 2VNUD 4XT1B 3H6MA 3K7UC 5EBCA 1QNUA 1Y69U 4JI4Q 4TQUS 4UPAA 2LXJA 5HY6A 1CTMA 2OEOA 4XQJA 1W3SA 2YTXA 1BBXC 2DNEA 5EKLA 3I72A 1PH1A 2CHBD 1PTOF 3HOUG 2ZJQA 5ELNA 1SXTA 2LSSA 1LT4D 1I4RA 1U4PA 2JN4A 1EYCA 4KKUA 2MQHA 4C3IH 1B3AA 5JPMC 3VR2A
chains in the Genus database with same CATH topology
2JE6I 2LXKA 1X56A 4LF8Q 1B7YB 1YJNA 1HZBA 4A3JH 1YJWA 5E7NA 2UXDQ 2E5LL 1G291 5M5WH 4L5SA 4YCVA 4A3MG 4JI5Q 4IFDJ 4DK6C 1U0LA 2YTYA 4A3FG 1M90C 1VQPA 3HOUH 4LF8L 2UXDL 4GKKL 3I55A 3KOJA 2ID0A 5M3FH 2OQ0A 4X64L 1AE2A 4AH6A 4BBRG 4LUOA 1PH9A 3FP9A 1WOCA 1YIJA 5BR8Q 1A0IA 3KLWA 1A63A 3E0EA 4BY1H 2UXCQ 2DGYA 2FXQA 1QVFA 1YEZA 3GD7A 1XPUA 3VDYA 3CC2A 1D7QA 3JC66 3RLFA 4A75A 1Z9FA 1S3OA 1WJJA 1RIPA 3LGJA 3J80i 5BR8L 2OWOA 1BBWA 3I2ZA 1XMOQ 3J7A5 2UXCL 2K4KA 2ZJRA 4A3MH 3EN2A 5H1SE 4JBWA 5IP7G 1UE7A 4YY3Q 4A3FH 4LF9Q 1AH9A 1PYSB 1OXTA 1AE3A 4BBRH 5GAGC 2QGQA 4L5TA 4JI0Q 4R4TA 4C3HH 1HZ9A 5JJLA 1NBWA 4A76A 1E22A 4LF9L 3PUWA 1KAWA 5C44G 3HOVG 1VQNA 3EIVA 1BBUA 5C4JH 4IJHA 4JI1Q 5IP9H 5FLMG 2Q2UA 5EAYA 3GTJH 2XGTA 5LMNQ 1HNXL 2Y0SG 4RG1A 1D8LA 1HR0Q 4DR4Q 3E9IA 2RF4A 2F4VQ 5IP7H 5C4XH 3A5ZB 4JI1L 3CD6A 1XNQQ 1VQ8A 3H3VI 3I56A 3F2DA 3HOZG 3ER0A 3H0GG 1KRTA 5LMNL 1ASYA 1VQGA 4L5QA 1NMFA 2F4VL 2RHSB 1WCMG 2HT1A 2I5MX 1N8RC 2YU9H 4DR1Q 4DR5Q 5C44H 4IOCA 4OO1I 4A3CG 4UP9A 2OTJA 3GTQH 1WI5A 2HIXA 3CCVA 1K8AC 1MKHA 5FLMH 1C0AA 3K81C 2WAQE 4K0KQ 2PMZE 4GN4B 5C0XI 2F3IA 1X6OA 5IT9c 3M4OH 1L1OA 4FDBA 1QVGA 3HOZH 3TRZA 3H0GH 4JV5Q 1Q81C 4K0KL 1OXVA 2NVXH 1WCMH 4JOIA 1YZ6A 2KHJA 4P73A 4JI2L 4JOIC 3RZOH 4LWCA 2IY5B 2HHHQ 1J6QA 4A3CH 1SLJA 2CFMA 2DUDA 5HGQA 1Y14B 1K8GA 1J5EL 3HFZB 1K73C 4PG3A 2NVTH 2KCMA 4O2DA 1EQRA 3G71A 2JJQA 1KIXA 3CXCA 2VZAA 1XPOA 3S24A 4BA1I 3OTOQ 1CUKA 2N8NA 5IE8A 2B63G 3A0JA 4IPGA 1CKMA 3GDEA 1NJIC 1N33L 4DR7Q 4UP8A 4QIWE 4DPGA 2BH2A 1NY4A 4GKJQ 2R92G 3STBD 2H5XA 2IX0A 2C35B 2K5HA 4A3DG 3G6EA 4QL5A 4C3JH 4YHHQ 1Q7YC 2B29A 4DR7L 2ATWA 2NN6G 1GVPA 3PF5A 3ULLA 5JEAJ 2ZTCA 4MNOA 3U4ZA 4DV1Q 1OTCA 3OW2A 2R6GA 2OCEA 3TS0A 1XPRA 3T1HQ 4YHHL 1VQKA 2KCTA 4GLAC 2B63H 1W2BA 1LM0A 1PH8A 4KLKA 1WFQA 4DV4Q 3T1HL 4GN3B 4JBKA 2IX1A 4IFDI 3JAMi 2R92H 1L2FA 3L0OA 1I94Q 3PF4A 4P72A 3BU2A 2Q2TA 4A3DH 1I50H 2OQKA 4B3ML 1VQJA 1PH4A 4DV4L 1KD1C 1K3RA 3S16H 1UWVA 2VS1A 2YTVA 2JA7G 1T9HA 1VQDA 1PH2A 1JT8A 2WB1E 3OYYA 3F2BA 2ZJPA 3F2CA 3CCUA 3UDIA 3I4OA 1CSQA 2R93G 1SN8A 4BA2I 4LF5Q 4YCWA 1K0RA 3S1QH 3L7ZC 1OXUA 1OXXK 1S40A 1YVCA 2E2IH 4UY8C 4LFBQ 3CPFA 1XJVA 2VUMG 4DKAC 5M3MG 4LF6Q 2R7FA 3PIPA 4DR2Q 4JG2A 2JA7H 1PV4A 1VQLA 4DAYB 3CMEA 2CCZA 4JI7Q 1V43A 4R1JA 4LFCQ 3GTMH 4LFBL 1CKNA 4J15A 1PA6A 4YWLA 4ALPA 2R93H 4JI5L 4DR2L 3PUXA 2WFWA 1IZ6A 5JEAG 1PH7A 2JA6G 1WYDA 1KC8C 4GS3A 4A3BG 3NENA 4LFAQ 4DV3Q 2UUCQ 4JI7L 1KQSA 3CW2C 4P75A 3J81c 4HJAA 3S2HH 3FHWA 4POGA 1XTDA 1EQQA 4DR6Q 1I5FA 5M3MH 3RN2A 4LFAL 4HIKA 4JBJA 2WAQG 5LMNW 1YHQA 1HR0W 4AIMA 1GD7A 4B3RQ 4GN5A 1RL2A 1TWFH 4WJ3M 1XNRQ 1PFSA 1LTLA 4X66Q 1XMOL 1V1QA 1PH5A 4LF4Q 4A93G 2GVAA 4B3RL 3K0XA 1B70B 4YY3L 2JA6H 3HKZE 1XNRL 4A3BH 2QEXA 1TWAH 2I0QA 1YHBA 4OONA 1PVOA 4LF4L 4JI0L 4UP7A 1UE1A 4H02A 1EIFA 1N9WA 1R9TH 3CCLA 1NE3A 2ASBA 1PHJA 3GTLH 2K5NA 2NVYH 5LMUQ 1Y1VG 2BA0A 4P71A 4R4IA 1E24A 1MIUA 1CKNB 1HR0L 3S14H 4A93H 4DR4L 4IJLA 4XTCS 1P8LA 1XNQL 3S1RH 3TS2A 5GAHC 5ELOA 3HOVH 4B3TQ 1YI2A 1A8VA 5FLXc 1G6PA 2Z0SA 4DUYQ 4A3LG 4DV2Q 1CSPA 4APVA 1SMXA 4DR1L 4DR5L 5GAEC 4HIMA 1VQAA 1X54A 1EUJA 5IYDG 1VQBA 1Y1VH 2PQAA 1L1OC 4DUYL 1X65A 2EQSA 2VY3A 4BXXG 1X3EA 2NZOA 4DV2L 1B8AA 4HIOA 1EFWA 4R4OA 3T1YQ 3BJUA 4L5RC 4YWMA 1BVSA 4NB3A 4JV5L 3W1GA 2A1AA 1E3PA 3K8AA 1EOVA 3GTPH 4X6AH 4JI6Q 4A3LH 3U58A 1Y1WG 1LUZA 5FJ8G 1VQ9A 2HHHL 5GQOA 1PYBA 1VQ5A 2QA4A 4KHPQ 3S15H 2Q2IA 3KFUA 4A3GG 1Q46A 1IBKQ 1VQ6A 2A19A 3U50C 2WB1G 1IYJB 5IYBG 1EYGA 4DNIA 2VQFQ 1O7IA 1K83H 1TWCH 3PGZA 4LW1A 3HOXG 2EXDA 3J81j 2CWPA 3D0FA 3KJPA 1G51A 1JB7A 4PZ7A 4JBMA 3S2DH 3OTOL 3BZKA 1X3GA 3F1ZA 4EX5A 5C3EG 2VQFL 1JMCA 4NXNQ 2IHEA 5GROA 2PI2A 4JCVE 3S17H 1Y1WH 2JEBI 2ES2A 2JA8G 4X65Q 3AEVA 4GKJL 1JJ2A 4NXNL 4DV0Q 3UDFA 5IYCG 3J80c 3ICEA 1L1OB 4Y52H 2PQAB 2D0OA 5IYBH 1KL9A 4O0AA 1JE5A 4JI3Q 3UDGA 1V9PA 3KYHC 3CCRA 1OXSC 3TEHB 3HOXH 4AYBE 4EQ5A 4DV0L 3I4MG 4DV1L 3M4PA 2I5HA 3S1NH 3G48A 3GO5A 3W1BA 5C3EH 4NXMQ 4OWWB 3CAMA 3MEFA 1SROA 4HJ5A 3FKIG 1ASZA 1E1TA 2CKZB 3DM3A 5IWAQ 1Z47A 2JA8H 4IOAA 4QGUA 2K50A 4BY7G 2MO0A 4NXML 4HIDA 3KF8B 1I94L 3UE1A 3HOYG 5K36G 3B6YA 3KJOA 4HJ9A 4LUZA 5AJ3Q 4HJ8A 1L0WA 3HKSA 1E7ZA 1YHAA 1HZCA 4YCUA 3CMAA 3I4MH 1Q1EA 2I5LX 1KRSA 1VQEA 3AYHB 3IRBA 1JJGA 3HKZG 3EBEA 1IBMQ 4DR3Q 2IT1A 3CC7A 3H15A 1E1OA 3FKIH 3D31A 4LF5L 1GKHA 1IBLQ 1NMGA 2JEAI 1JJCB 1VQ7A 1IBML 1KHIA 3J7ZC 2E2HH 2ZTDA 1QZGA 1LYLA 3E9HA 4GNXA 1TWGH 4GNXC 3CCQA 1IBLL 3HOWG 4GLXA 1FL0A 4LF6L 1QVCA 1N34Q 1SFOH 3CF5A 2PNHA 1X55A 3MXNB 1PH6A 5M3FG 1MJEA 4JI8Q 4Y7NH 3M85A 4OO1G 2UUAQ 4LFCL 2ZM6Q 1N34L 3U4VA 1TWHH 2N78A 4JI8L 4DV6Q 2VUMH 2N49A 5JJKA 3RR5A 5C0XG 4DV3L 4OWTB 2UUCL 1UE5A 1QUQA 2ZM6L 2UUAL 4GKKQ 3H3VH 1U5KA 4C2MH 1A62A 1IL2A 1IXRA 4X64Q 4TVAB 3I4NG 2E8GA 2NN6I 4DV6L 3HOWH 4DR6L 2AWOA 4QQBX 1UE6A 3PIOA 3KDFA 4LUVA 2VW9A 2R7DA 4A3IG 3A5UA 1I3QH 3AFQA 3CCSA 4X66L 4DV7Q 3NBHB 3K80C 2D62A 3PCOB 3K7AH 3I7FA 2IHFA 2RHQB 3GTOH 5IP9G 2UXBQ 4DV7L 1X3FA 3CPWA 3PUZA 3I4NH 1Q1BA 4PZ6A 4GNXB 4BBSG 3CP0A 1GM5A 4YWKA 1N32Q 2BA1A 5C4XG 2R7ZG 2UXBL 4IPHA 1C9OA 1MJCA 2HIVA 4A3IH 1P16A 1SRUA 5LMUL 3F8TA 3M4QA 2CQOA 1Q8KA 1N32L 4PZ8A 1EIYB 4DAMA 2OTLA 3PUVA 1HNWQ 1PH3A 1N36Q 1HNXQ 4IPDA 1HNZQ 2HQLA 1Q82C 4GLVB 5J3BA 2K5VA 3JAMc 1YITA 2YYZA 3RLNA 1QUQB 4B3TL 2BH8A 1HNWL 1N36L 3ZJYC 1H95A 5DLQE 4BBSH 2ALYB 1FJGQ 1HNZL 3S1MH 2K52A 3KDFB 2R7ZH 3BZCA 3TQYA 2GVBA 5M5XH 4DV5Q 4AYBG 1FJGL 1Q12A 2UUBQ 3ULJA 5M5YH 4IFDG 1UEBA 1GO3E 2JA5G 4POFA 4MTNA 5GADC 4IO9A 3T1YL 4DV5L 2Z6KA 4B3SQ 2D0PA 3STBC 1S72A 2JA9A 2F52A 2Z6KC 2RCNA 2UUBL 1YJ9A 2WP8J 3CCEA 1K9MC 3M3YH 5JJIA 2VL6A 3Q8DA 4A4IA 3CC4A 1VQIA 5IYDH 4RMFA 3TREA 4QY7A 2KHIA 4JI6L 2YV5A 1VQFA 3A74A 4R4CA 4JI2Q 4B3SL 4BXXH 1KXLA 2KBNA 3RN5A 4KHPL 2Q2HA 4LNQA 1VQHA 2CWAA 4PMWA 2B3GA 1IBKL 2JK8A 3PV0A 3J81i 4A3KG 1J5EQ 3GTKH 3PO2G 1I6HH 2JA5H 1VQMA 2NVQH 3KF6A 3UE0A 2MNAA 2GN5A 5FJ8H 2Y0SE 4OX9Q 1FVIA 2NZHA 2ZTEA 3ERSX 5IY0A 4A3GH 3M9BA 4GOPA 4HJ7A 3UDXA 4GOPC 1X9NA 1BKBA 1DGSA 1QZHA 4IPCA 1VQOA 1Q86C 4WJ4A 4R4QA 2K75A 4X65L 4OX9L 1N33Q 4P74A 2JQOA 5C0XJ 3AQQA 3G4SA 3M7NA 4A3KH 2A8VA 2MFIA 2V1CC 4JI3L 3PO2H 2L15A 4NPSA 3RLOA 3PUYA 3AFPA 1VS0A 3NEMA 4A3EG 1HZAA 4AQYQ 5IYCH 4MZ9A 3PO3G 2AHOB 4OWXB 1NTGA 1VQ4A 1TXYA 2UU9Q 3GTGH 4JC0A 5IWAL 4JYAQ 4X62Q 3NELA 4DK3C 2N3SA 1CKOA 2AMCB 3CCJA 1HJPA 3SGIA 3ULPA 1FGUA 1SR3A 3RZDH 4LF7Q 4AQYL 1YBYA 2AWNA 2UU9L 4JYAL 1VCIA 2PI2E 2AKWB 4X62L 2K14A 5AJ3L 3DLLA 3CCMA 1XMQQ 4B3MQ 2VNUD 3RNUA 4LF7L 3K7UC 2KENA 3KF6B 4KI0A 4OXPA 4A3EH 1C7YA 3L2PA 1HH2P 2VQEQ 4JI4Q 4TQUS 2EIFA 4UPAA 1M1KC 4BY7H 1XMQL 1SE8A 2LXJA 2XTIA 5HY6A 1VQCA 4DR3L 4A3JG 3HOYH 3PO3H 4GOPB 4ME3A 1W3SA 2YTXA 3W5OA 2VQEL 1PH1A 3WWVA 4JI4L 3HOUG 4XIGS 2ZJQA 4QJFA 1YNXA 5ELNA 2E2JH 2LSSA 4DUZQ 3PSIA 3CQZH 2E5LQ 4BY1G 2MQHA 4C3IH 2MO1A 1EWIA 4KHZA 4DUZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  2LXK A;  1X56 A;  4LF8 Q;  1B7Y B;  1YJN A;  1HZB A;  4A3J H;  1YJW A;  5E7N A;  2UXD Q;  2E5L L;  1G29 1;  5M5W H;  4L5S A;  4YCV A;  4A3M G;  4JI5 Q;  4IFD J;  4DK6 C;  1U0L A;  2YTY A;  4A3F G;  1M90 C;  1VQP A;  3HOU H;  4LF8 L;  2UXD L;  4GKK L;  3I55 A;  3KOJ A;  2ID0 A;  5M3F H;  2OQ0 A;  4X64 L;  1AE2 A;  4AH6 A;  4BBR G;  4LUO A;  1PH9 A;  3FP9 A;  1WOC A;  1YIJ A;  5BR8 Q;  1A0I A;  3KLW A;  1A63 A;  3E0E A;  4BY1 H;  2UXC Q;  2DGY A;  2FXQ A;  1QVF A;  1YEZ A;  3GD7 A;  1XPU A;  3VDY A;  3CC2 A;  1D7Q A;  3JC6 6;  3RLF A;  4A75 A;  1Z9F A;  1S3O A;  1WJJ A;  1RIP A;  3LGJ A;  3J80 i;  5BR8 L;  2OWO A;  1BBW A;  3I2Z A;  1XMO Q;  3J7A 5;  2UXC L;  2K4K A;  2ZJR A;  4A3M H;  3EN2 A;  5H1S E;  4JBW A;  5IP7 G;  1UE7 A;  4YY3 Q;  4A3F H;  4LF9 Q;  1AH9 A;  1PYS B;  1OXT A;  1AE3 A;  4BBR H;  5GAG C;  2QGQ A;  4L5T A;  4JI0 Q;  4R4T A;  4C3H H;  1HZ9 A;  5JJL A;  1NBW A;  4A76 A;  1E22 A;  4LF9 L;  3PUW A;  1KAW A;  5C44 G;  3HOV G;  1VQN A;  3EIV A;  1BBU A;  5C4J H;  4IJH A;  4JI1 Q;  5IP9 H;  5FLM G;  2Q2U A;  5EAY A;  3GTJ H;  2XGT A;  5LMN Q;  1HNX L;  2Y0S G;  4RG1 A;  1D8L A;  1HR0 Q;  4DR4 Q;  3E9I A;  2RF4 A;  2F4V Q;  5IP7 H;  5C4X H;  3A5Z B;  4JI1 L;  3CD6 A;  1XNQ Q;  1VQ8 A;  3H3V I;  3I56 A;  3F2D A;  3HOZ G;  3ER0 A;  3H0G G;  1KRT A;  5LMN L;  1ASY A;  1VQG A;  4L5Q A;  1NMF A;  2F4V L;  2RHS B;  1WCM G;  2HT1 A;  2I5M X;  1N8R C;  2YU9 H;  4DR1 Q;  4DR5 Q;  5C44 H;  4IOC A;  4OO1 I;  4A3C G;  4UP9 A;  2OTJ A;  3GTQ H;  1WI5 A;  2HIX A;  3CCV A;  1K8A C;  1MKH A;  5FLM H;  1C0A A;  3K81 C;  2WAQ E;  4K0K Q;  2PMZ E;  4GN4 B;  5C0X I;  2F3I A;  1X6O A;  5IT9 c;  3M4O H;  1L1O A;  4FDB A;  1QVG A;  3HOZ H;  3TRZ A;  3H0G H;  4JV5 Q;  1Q81 C;  4K0K L;  1OXV A;  2NVX H;  1WCM H;  4JOI A;  1YZ6 A;  2KHJ A;  4P73 A;  4JI2 L;  4JOI C;  3RZO H;  4LWC A;  2IY5 B;  2HHH Q;  1J6Q A;  4A3C H;  1SLJ A;  2CFM A;  2DUD A;  5HGQ A;  1Y14 B;  1K8G A;  1J5E L;  3HFZ B;  1K73 C;  4PG3 A;  2NVT H;  2KCM A;  4O2D A;  1EQR A;  3G71 A;  2JJQ A;  1KIX A;  3CXC A;  2VZA A;  1XPO A;  3S24 A;  4BA1 I;  3OTO Q;  1CUK A;  2N8N A;  5IE8 A;  2B63 G;  3A0J A;  4IPG A;  1CKM A;  3GDE A;  1NJI C;  1N33 L;  4DR7 Q;  4UP8 A;  4QIW E;  4DPG A;  2BH2 A;  1NY4 A;  4GKJ Q;  2R92 G;  3STB D;  2H5X A;  2IX0 A;  2C35 B;  2K5H A;  4A3D G;  3G6E A;  4QL5 A;  4C3J H;  4YHH Q;  1Q7Y C;  2B29 A;  4DR7 L;  2ATW A;  2NN6 G;  1GVP A;  3PF5 A;  3ULL A;  5JEA J;  2ZTC A;  4MNO A;  3U4Z A;  4DV1 Q;  1OTC A;  3OW2 A;  2R6G A;  2OCE A;  3TS0 A;  1XPR A;  3T1H Q;  4YHH L;  1VQK A;  2KCT A;  4GLA C;  2B63 H;  1W2B A;  1LM0 A;  1PH8 A;  4KLK A;  1WFQ A;  4DV4 Q;  3T1H L;  4GN3 B;  4JBK A;  2IX1 A;  4IFD I;  3JAM i;  2R92 H;  1L2F A;  3L0O A;  1I94 Q;  3PF4 A;  4P72 A;  3BU2 A;  2Q2T A;  4A3D H;  1I50 H;  2OQK A;  4B3M L;  1VQJ A;  1PH4 A;  4DV4 L;  1KD1 C;  1K3R A;  3S16 H;  1UWV A;  2VS1 A;  2YTV A;  2JA7 G;  1T9H A;  1VQD A;  1PH2 A;  1JT8 A;  2WB1 E;  3OYY A;  3F2B A;  2ZJP A;  3F2C A;  3CCU A;  3UDI A;  3I4O A;  1CSQ A;  2R93 G;  1SN8 A;  4BA2 I;  4LF5 Q;  4YCW A;  1K0R A;  3S1Q H;  3L7Z C;  1OXU A;  1OXX K;  1S40 A;  1YVC A;  2E2I H;  4UY8 C;  4LFB Q;  3CPF A;  1XJV A;  2VUM G;  4DKA C;  5M3M G;  4LF6 Q;  2R7F A;  3PIP A;  4DR2 Q;  4JG2 A;  2JA7 H;  1PV4 A;  1VQL A;  4DAY B;  3CME A;  2CCZ A;  4JI7 Q;  1V43 A;  4R1J A;  4LFC Q;  3GTM H;  4LFB L;  1CKN A;  4J15 A;  1PA6 A;  4YWL A;  4ALP A;  2R93 H;  4JI5 L;  4DR2 L;  3PUX A;  2WFW A;  1IZ6 A;  5JEA G;  1PH7 A;  2JA6 G;  1WYD A;  1KC8 C;  4GS3 A;  4A3B G;  3NEN A;  4LFA Q;  4DV3 Q;  2UUC Q;  4JI7 L;  1KQS A;  3CW2 C;  4P75 A;  3J81 c;  4HJA A;  3S2H H;  3FHW A;  4POG A;  1XTD A;  1EQQ A;  4DR6 Q;  1I5F A;  5M3M H;  3RN2 A;  4LFA L;  4HIK A;  4JBJ A;  2WAQ G;  5LMN W;  1YHQ A;  1HR0 W;  4AIM A;  1GD7 A;  4B3R Q;  4GN5 A;  1RL2 A;  1TWF H;  4WJ3 M;  1XNR Q;  1PFS A;  1LTL A;  4X66 Q;  1XMO L;  1V1Q A;  1PH5 A;  4LF4 Q;  4A93 G;  2GVA A;  4B3R L;  3K0X A;  1B70 B;  4YY3 L;  2JA6 H;  3HKZ E;  1XNR L;  4A3B H;  2QEX A;  1TWA H;  2I0Q A;  1YHB A;  4OON A;  1PVO A;  4LF4 L;  4JI0 L;  4UP7 A;  1UE1 A;  4H02 A;  1EIF A;  1N9W A;  1R9T H;  3CCL A;  1NE3 A;  2ASB A;  1PHJ A;  3GTL H;  2K5N A;  2NVY H;  5LMU Q;  1Y1V G;  2BA0 A;  4P71 A;  4R4I A;  1E24 A;  1MIU A;  1CKN B;  1HR0 L;  3S14 H;  4A93 H;  4DR4 L;  4IJL A;  4XTC S;  1P8L A;  1XNQ L;  3S1R H;  3TS2 A;  5GAH C;  5ELO A;  3HOV H;  4B3T Q;  1YI2 A;  1A8V A;  5FLX c;  1G6P A;  2Z0S A;  4DUY Q;  4A3L G;  4DV2 Q;  1CSP A;  4APV A;  1SMX A;  4DR1 L;  4DR5 L;  5GAE C;  4HIM A;  1VQA A;  1X54 A;  1EUJ A;  5IYD G;  1VQB A;  1Y1V H;  2PQA A;  1L1O C;  4DUY L;  1X65 A;  2EQS A;  2VY3 A;  4BXX G;  1X3E A;  2NZO A;  4DV2 L;  1B8A A;  4HIO A;  1EFW A;  4R4O A;  3T1Y Q;  3BJU A;  4L5R C;  4YWM A;  1BVS A;  4NB3 A;  4JV5 L;  3W1G A;  2A1A A;  1E3P A;  3K8A A;  1EOV A;  3GTP H;  4X6A H;  4JI6 Q;  4A3L H;  3U58 A;  1Y1W G;  1LUZ A;  5FJ8 G;  1VQ9 A;  2HHH L;  5GQO A;  1PYB A;  1VQ5 A;  2QA4 A;  4KHP Q;  3S15 H;  2Q2I A;  3KFU A;  4A3G G;  1Q46 A;  1IBK Q;  1VQ6 A;  2A19 A;  3U50 C;  2WB1 G;  1IYJ B;  5IYB G;  1EYG A;  4DNI A;  2VQF Q;  1O7I A;  1K83 H;  1TWC H;  3PGZ A;  4LW1 A;  3HOX G;  2EXD A;  3J81 j;  2CWP A;  3D0F A;  3KJP A;  1G51 A;  1JB7 A;  4PZ7 A;  4JBM A;  3S2D H;  3OTO L;  3BZK A;  1X3G A;  3F1Z A;  4EX5 A;  5C3E G;  2VQF L;  1JMC A;  4NXN Q;  2IHE A;  5GRO A;  2PI2 A;  4JCV E;  3S17 H;  1Y1W H;  2JEB I;  2ES2 A;  2JA8 G;  4X65 Q;  3AEV A;  4GKJ L;  1JJ2 A;  4NXN L;  4DV0 Q;  3UDF A;  5IYC G;  3J80 c;  3ICE A;  1L1O B;  4Y52 H;  2PQA B;  2D0O A;  5IYB H;  1KL9 A;  4O0A A;  1JE5 A;  4JI3 Q;  3UDG A;  1V9P A;  3KYH C;  3CCR A;  1OXS C;  3TEH B;  3HOX H;  4AYB E;  4EQ5 A;  4DV0 L;  3I4M G;  4DV1 L;  3M4P A;  2I5H A;  3S1N H;  3G48 A;  3GO5 A;  3W1B A;  5C3E H;  4NXM Q;  4OWW B;  3CAM A;  3MEF A;  1SRO A;  4HJ5 A;  3FKI G;  1ASZ A;  1E1T A;  2CKZ B;  3DM3 A;  5IWA Q;  1Z47 A;  2JA8 H;  4IOA A;  4QGU A;  2K50 A;  4BY7 G;  2MO0 A;  4NXM L;  4HID A;  3KF8 B;  1I94 L;  3UE1 A;  3HOY G;  5K36 G;  3B6Y A;  3KJO A;  4HJ9 A;  4LUZ A;  5AJ3 Q;  4HJ8 A;  1L0W A;  3HKS A;  1E7Z A;  1YHA A;  1HZC A;  4YCU A;  3CMA A;  3I4M H;  1Q1E A;  2I5L X;  1KRS A;  1VQE A;  3AYH B;  3IRB A;  1JJG A;  3HKZ G;  3EBE A;  1IBM Q;  4DR3 Q;  2IT1 A;  3CC7 A;  3H15 A;  1E1O A;  3FKI H;  3D31 A;  4LF5 L;  1GKH A;  1IBL Q;  1NMG A;  2JEA I;  1JJC B;  1VQ7 A;  1IBM L;  1KHI A;  3J7Z C;  2E2H H;  2ZTD A;  1QZG A;  1LYL A;  3E9H A;  4GNX A;  1TWG H;  4GNX C;  3CCQ A;  1IBL L;  3HOW G;  4GLX A;  1FL0 A;  4LF6 L;  1QVC A;  1N34 Q;  1SFO H;  3CF5 A;  2PNH A;  1X55 A;  3MXN B;  1PH6 A;  5M3F G;  1MJE A;  4JI8 Q;  4Y7N H;  3M85 A;  4OO1 G;  2UUA Q;  4LFC L;  2ZM6 Q;  1N34 L;  3U4V A;  1TWH H;  2N78 A;  4JI8 L;  4DV6 Q;  2VUM H;  2N49 A;  5JJK A;  3RR5 A;  5C0X G;  4DV3 L;  4OWT B;  2UUC L;  1UE5 A;  1QUQ A;  2ZM6 L;  2UUA L;  4GKK Q;  3H3V H;  1U5K A;  4C2M H;  1A62 A;  1IL2 A;  1IXR A;  4X64 Q;  4TVA B;  3I4N G;  2E8G A;  2NN6 I;  4DV6 L;  3HOW H;  4DR6 L;  2AWO A;  4QQB X;  1UE6 A;  3PIO A;  3KDF A;  4LUV A;  2VW9 A;  2R7D A;  4A3I G;  3A5U A;  1I3Q H;  3AFQ A;  3CCS A;  4X66 L;  4DV7 Q;  3NBH B;  3K80 C;  2D62 A;  3PCO B;  3K7A H;  3I7F A;  2IHF A;  2RHQ B;  3GTO H;  5IP9 G;  2UXB Q;  4DV7 L;  1X3F A;  3CPW A;  3PUZ A;  3I4N H;  1Q1B A;  4PZ6 A;  4GNX B;  4BBS G;  3CP0 A;  1GM5 A;  4YWK A;  1N32 Q;  2BA1 A;  5C4X G;  2R7Z G;  2UXB L;  4IPH A;  1C9O A;  1MJC A;  2HIV A;  4A3I H;  1P16 A;  1SRU A;  5LMU L;  3F8T A;  3M4Q A;  2CQO A;  1Q8K A;  1N32 L;  4PZ8 A;  1EIY B;  4DAM A;  2OTL A;  3PUV A;  1HNW Q;  1PH3 A;  1N36 Q;  1HNX Q;  4IPD A;  1HNZ Q;  2HQL A;  1Q82 C;  4GLV B;  5J3B A;  2K5V A;  3JAM c;  1YIT A;  2YYZ A;  3RLN A;  1QUQ B;  4B3T L;  2BH8 A;  1HNW L;  1N36 L;  3ZJY C;  1H95 A;  5DLQ E;  4BBS H;  2ALY B;  1FJG Q;  1HNZ L;  3S1M H;  2K52 A;  3KDF B;  2R7Z H;  3BZC A;  3TQY A;  2GVB A;  5M5X H;  4DV5 Q;  4AYB G;  1FJG L;  1Q12 A;  2UUB Q;  3ULJ A;  5M5Y H;  4IFD G;  1UEB A;  1GO3 E;  2JA5 G;  4POF A;  4MTN A;  5GAD C;  4IO9 A;  3T1Y L;  4DV5 L;  2Z6K A;  4B3S Q;  2D0P A;  3STB C;  1S72 A;  2JA9 A;  2F52 A;  2Z6K C;  2RCN A;  2UUB L;  1YJ9 A;  2WP8 J;  3CCE A;  1K9M C;  3M3Y H;  5JJI A;  2VL6 A;  3Q8D A;  4A4I A;  3CC4 A;  1VQI A;  5IYD H;  4RMF A;  3TRE A;  4QY7 A;  2KHI A;  4JI6 L;  2YV5 A;  1VQF A;  3A74 A;  4R4C A;  4JI2 Q;  4B3S L;  4BXX H;  1KXL A;  2KBN A;  3RN5 A;  4KHP L;  2Q2H A;  4LNQ A;  1VQH A;  2CWA A;  4PMW A;  2B3G A;  1IBK L;  2JK8 A;  3PV0 A;  3J81 i;  4A3K G;  1J5E Q;  3GTK H;  3PO2 G;  1I6H H;  2JA5 H;  1VQM A;  2NVQ H;  3KF6 A;  3UE0 A;  2MNA A;  2GN5 A;  5FJ8 H;  2Y0S E;  4OX9 Q;  1FVI A;  2NZH A;  2ZTE A;  3ERS X;  5IY0 A;  4A3G H;  3M9B A;  4GOP A;  4HJ7 A;  3UDX A;  4GOP C;  1X9N A;  1BKB A;  1DGS A;  1QZH A;  4IPC A;  1VQO A;  1Q86 C;  4WJ4 A;  4R4Q A;  2K75 A;  4X65 L;  4OX9 L;  1N33 Q;  4P74 A;  2JQO A;  5C0X J;  3AQQ A;  3G4S A;  3M7N A;  4A3K H;  2A8V A;  2MFI A;  2V1C C;  4JI3 L;  3PO2 H;  2L15 A;  4NPS A;  3RLO A;  3PUY A;  3AFP A;  1VS0 A;  3NEM A;  4A3E G;  1HZA A;  4AQY Q;  5IYC H;  4MZ9 A;  3PO3 G;  2AHO B;  4OWX B;  1NTG A;  1VQ4 A;  1TXY A;  2UU9 Q;  3GTG H;  4JC0 A;  5IWA L;  4JYA Q;  4X62 Q;  3NEL A;  4DK3 C;  2N3S A;  1CKO A;  2AMC B;  3CCJ A;  1HJP A;  3SGI A;  3ULP A;  1FGU A;  1SR3 A;  3RZD H;  4LF7 Q;  4AQY L;  1YBY A;  2AWN A;  2UU9 L;  4JYA L;  1VCI A;  2PI2 E;  2AKW B;  4X62 L;  2K14 A;  5AJ3 L;  3DLL A;  3CCM A;  1XMQ Q;  4B3M Q;  2VNU D;  3RNU A;  4LF7 L;  3K7U C;  2KEN A;  3KF6 B;  4KI0 A;  4OXP A;  4A3E H;  1C7Y A;  3L2P A;  1HH2 P;  2VQE Q;  4JI4 Q;  4TQU S;  2EIF A;  4UPA A;  1M1K C;  4BY7 H;  1XMQ L;  1SE8 A;  2LXJ A;  2XTI A;  5HY6 A;  1VQC A;  4DR3 L;  4A3J G;  3HOY H;  3PO3 H;  4GOP B;  4ME3 A;  1W3S A;  2YTX A;  3W5O A;  2VQE L;  1PH1 A;  3WWV A;  4JI4 L;  3HOU G;  4XIG S;  2ZJQ A;  4QJF A;  1YNX A;  5ELN A;  2E2J H;  2LSS A;  4DUZ Q;  3PSI A;  3CQZ H;  2E5L Q;  4BY1 G;  2MQH A;  4C3I H;  2MO1 A;  1EWI A;  4KHZ A;  4DUZ L; 
#chains in the Genus database with same CATH topology
 2UXD Q;  1B7Y B;  1YJN A;  4N8F A;  4A3J H;  5E7N A;  1S5B D;  1SJE D;  1G29 1;  3G7L A;  4JI5 Q;  5A35 A;  4IFD J;  3MHB A;  4L6T B;  1M90 C;  1VQP A;  1D1I A;  3OMC A;  2ID0 A;  2C9O A;  4X64 L;  4OO1 H;  3S9W A;  1YIJ A;  2ZXR A;  3KLW A;  1D7Q A;  3AB9 A;  4A75 A;  2E2I B;  2ZJR A;  4NDX A;  1AEX A;  4CDF C;  4A3F H;  2E76 C;  3T13 A;  2QGQ A;  2EPB A;  4R4T A;  4CHT B;  1E22 A;  2FMC A;  1AZQ A;  5C44 G;  1VQN A;  4Y7N B;  1BBU A;  4V19 0;  3MFG A;  1GHK A;  3T16 A;  1HNX L;  1HR0 Q;  4RG1 A;  4DF7 A;  4DR4 Q;  1CI3 M;  5C4X H;  4R8I A;  1XNQ Q;  3I56 A;  3HOZ G;  5C3W A;  5LMN L;  2F3W A;  1UUP A;  1FR3 A;  2J4X A;  3WOF A;  4OO1 I;  2OTJ A;  4IOC A;  4DNR B;  2EJF C;  1WI5 A;  3FEW X;  5FO9 B;  3K81 C;  2OXP A;  2WAQ E;  4KV6 A;  2Q8R E;  5CV9 A;  1L1O A;  4FDB A;  1G8Z D;  2K28 A;  4JV5 Q;  4K0K L;  3I70 A;  1WCM H;  4JI2 L;  1YZ6 A;  2IY5 B;  4JOI C;  1TS2 A;  3DMU A;  1SLJ A;  2R3Z A;  1CA6 A;  3OW7 A;  1J5E L;  3MC0 B;  2FJ2 A;  1K73 C;  2NBF A;  2ZXO A;  1EOT A;  2KCM A;  2BDO A;  2JJQ A;  3OMG A;  3CXC A;  1XPO A;  3HRZ C;  3OTO Q;  1Y1V B;  3Q23 A;  3S1M B;  3N6R A;  4G4K A;  4IPG A;  4DR7 Q;  4UP8 A;  4P2C B;  4QIW E;  2BH2 A;  2VB3 X;  2H5X A;  4CGY B;  4C3J H;  4YHH Q;  2B29 A;  2PPB C;  3GTP B;  2ATW A;  3U4Z A;  4H44 C;  2KVM A;  2R6G A;  3I4L A;  4O42 A;  2B63 H;  4RHS A;  1W2B A;  1LM0 A;  1F2L A;  1SYC A;  4GN3 B;  1KLU D;  2R92 H;  3L0O A;  1PRT C;  3BU2 A;  4A3D H;  4XT3 B;  1I50 H;  1KAB A;  3K5O A;  3MTS A;  4EQN A;  1T9H A;  1PH2 A;  3NTH A;  4DAP A;  2A73 B;  3I3C A;  3TP5 A;  4K5V A;  3CCU A;  2R93 G;  1SN8 A;  4BA2 I;  4LF5 Q;  3HOX B;  3S1Q H;  4KTA A;  1MGS A;  4UY8 C;  5C3E B;  2KED A;  5M3M G;  4JG2 A;  2JA7 H;  1XYI A;  2JA8 B;  1V1P B;  3GTM H;  3HEJ A;  2JA6 G;  1ENA A;  2UUC Q;  4P75 A;  1TR5 A;  4WJW A;  1EU4 A;  2F0K A;  1XTD A;  4LK1 C;  4RAU C;  4RKB A;  5BN3 A;  3LWE A;  4DR6 Q;  5CV4 A;  3FKI B;  1PTO C;  1VF5 C;  4NP5 A;  4B3R Q;  2O5J C;  1S5C D;  1TWF H;  2B2Y A;  5FK9 C;  3HG9 A;  3R3O A;  3HOY B;  5I2Y A;  2HUG A;  5JEA H;  5DM6 3;  3HKZ E;  4N9T A;  1TWA H;  4KY5 A;  1JIC A;  4M8A A;  2PZT A;  1EYD A;  4UP7 A;  1LLR D;  4JI0 L;  4H02 A;  1EIF A;  1R9T H;  3CCL A;  1A2T A;  3QWN A;  3GTL H;  4OEM B;  1E2W A;  2NVY H;  4P71 A;  3ERQ A;  1LAC A;  4A93 H;  1QIL A;  4ZK9 B;  4XTC S;  1XX8 A;  1YI2 A;  1G6P A;  5IGD A;  1SMX A;  1F9R A;  4HIM A;  2SOB A;  4ZQ3 A;  1PFN A;  1VQB A;  1Z7T A;  1JOO A;  2NZO A;  1PZI D;  4HIO A;  3T1Y Q;  3KLS X;  4YWM A;  2LY7 A;  1DCZ A;  1TY0 A;  1EOV A;  2FFK B;  2DNC A;  3U58 A;  1Y1W G;  4DK1 A;  2B2W C;  3Q24 A;  1PYB A;  4KHP Q;  1SE2 A;  4BBS B;  2VQF Q;  1TWC H;  1K83 H;  2MP1 A;  3BDO A;  2CW0 C;  2CWP A;  3D3R A;  1ILQ A;  3NWT A;  4HAE A;  4PZ7 A;  3IFT A;  3S2D H;  4CKB A;  3BZK A;  4EX5 A;  3F1Z A;  4NXN Q;  2IHE A;  5GRO A;  5M5Y B;  1BUV T;  4X65 Q;  5HUR A;  3J80 c;  1L1O B;  2D9U A;  3M3Y B;  3OHX C;  1JE5 A;  4JI3 Q;  1V9P A;  1OXS C;  1WTO A;  4IAL A;  3TZU A;  2RVL A;  1H9J A;  3I4M G;  1Y8P B;  3C1F A;  3V96 A;  3OSO A;  1CZG A;  3GO5 A;  4TSS A;  3CAM A;  1L0Y B;  5FLX E;  3DM3 A;  4F88 A;  1Z47 A;  1O80 A;  2IX3 A;  4NXM L;  3JAM E;  2KOL A;  3DHQ A;  1DZ1 A;  3UE1 A;  1S5F D;  4KD4 A;  4R9W A;  3RD4 A;  3FPU B;  3HKS A;  1ILP A;  5EPJ A;  1Q1E A;  1I4X A;  2I5L X;  3AYH B;  1VQE A;  1HRJ A;  3EBE A;  3DEP A;  3NBH A;  4A3K B;  3PO2 B;  4HR7 B;  1GKH A;  2TSS A;  1NNX A;  1VQ7 A;  1IBM L;  1B3Q A;  4K14 A;  2ZTD A;  1LYL A;  2IPK D;  5K36 H;  1TWG H;  4GNX C;  4RGO S;  1IBL L;  2EJG C;  4GLX A;  1HTP A;  1QVC A;  5IOC A;  4LF6 L;  2QW7 A;  4ZCK A;  1PYW D;  5DEH A;  4Y7N H;  4OO1 G;  3D4R A;  1N34 L;  3U4V A;  5CR3 A;  2N49 A;  1TQO A;  1A15 A;  3L3O C;  1UE5 A;  1QUQ A;  3X3M A;  1IL2 A;  4X64 Q;  1SNO A;  1BXT A;  2NN6 I;  4LUV A;  2DN8 A;  2ENB A;  2R7D A;  4WRD A;  1JWU D;  1I3Q H;  4X66 L;  4DV7 Q;  3GV3 A;  5BN4 A;  3PCO B;  3BDC A;  3K7A H;  3G6J B;  3K0Y A;  4ME5 A;  5CV8 A;  4C3I B;  3CPW A;  3E5S A;  1S4Z A;  3Q22 A;  4EGV A;  4A3J B;  3KBG A;  5C4X G;  1O7Y A;  3GQB A;  2UXB L;  2HIV A;  2L0C A;  5LMU L;  1STG A;  2Z4I A;  2K32 A;  3F8T A;  4DFA A;  1N32 L;  4PZ8 A;  4K5X A;  3DEO A;  3PUV A;  1HNX Q;  4IPD A;  5F2D A;  5C5L A;  1Q82 C;  4GLV B;  3JAM c;  1H9R A;  1HNW L;  1BCP D;  1H95 A;  1LTT D;  3S1M H;  4HMJ A;  3P7J A;  1K3B C;  2XRQ D;  2R7Z H;  3VR6 A;  3BZC A;  4A3F B;  3TQY A;  4O1N A;  2GVB A;  1FJG L;  1Q12 A;  2UUB Q;  2EYJ A;  4POF A;  3Q0A A;  2JYO A;  2KEE A;  3PQI A;  4DV5 L;  1S72 A;  3STB C;  1YJ9 A;  1E2V A;  3CCE A;  2VL6 A;  3Q8D A;  3CC4 A;  3TRE A;  1EY0 A;  2B2T C;  3NSW A;  2YV5 A;  1VQF A;  4B3S L;  4JI2 Q;  3RN5 A;  1RTO A;  1MI2 A;  4KJN A;  4PMW A;  2B3G A;  5NUC A;  4IFD H;  4K6L A;  1V1O A;  1J5E Q;  3GTK H;  1EZ6 A;  2A6E C;  5CYU A;  2JA5 H;  3UE0 A;  2RA4 A;  5FJ8 H;  3HOV B;  1FVI A;  1T5X D;  2NZH A;  2ZTE A;  2QF7 A;  3OWE B;  3D6C A;  3UDX A;  3VA7 A;  1LAB A;  1X9N A;  4WJ4 A;  1JB3 A;  2Z4H A;  4P74 A;  4G57 A;  4H7B A;  2MFI A;  4E6I A;  2EY5 A;  3J80 L;  1WCM B;  2ICE C;  3PUY A;  3RLO A;  4ID6 A;  4A3E G;  3SDZ A;  5IYC H;  2AHO B;  4OWX B;  1VQ4 A;  4IUR A;  5C4Z A;  3VA5 A;  2N3S A;  1CKO A;  1JT8 A;  4KKT A;  4LF7 Q;  4CKE A;  3S15 B;  3E0J A;  2AWN A;  3V2T A;  2PI2 E;  3DLL A;  4ODG A;  4PMC A;  5AJ3 L;  1XMQ Q;  1SYG A;  3KF6 B;  1HH2 P;  1M1K C;  2N88 A;  5IOD A;  3ZYY X;  3KUP A;  4I7A A;  3HOY H;  1FGB D;  4GOP B;  4ME3 A;  1CFM A;  4C3J B;  3W5O A;  2VQE L;  1LT6 D;  5K5P A;  1RJT A;  2K05 A;  2K5D A;  4DUZ Q;  2B63 B;  4H13 C;  5FOB B;  3A8K E;  1PFM A;  5CGK A;  1EWI A;  3MVV A;  2HCI A;  2LXK A;  3E6Z X;  3D6W A;  2R92 B;  1YJW A;  2M00 A;  3HZX A;  2E5L L;  2LKV A;  4A3D B;  4L5S A;  1I50 B;  4YCV A;  4A3M G;  4RWS C;  1LO5 D;  1RKN A;  1U0L A;  3BVG A;  4ZUI A;  4LF8 L;  3KOJ A;  4OGQ C;  4AH6 A;  4BBR G;  3FP9 A;  1WOC A;  2QKI C;  5BR8 Q;  3E0E A;  4BY1 H;  3QB3 A;  3T56 B;  1WVL A;  1ML0 D;  3E3X A;  3RLF A;  1S3O A;  3S1Q B;  1WJJ A;  3LGJ A;  3NBI A;  3J80 i;  2SEB D;  3J7A 5;  2PW7 A;  2UXC L;  2K4K A;  1KDA A;  1ZKO A;  2JSO A;  5CV6 A;  1TT2 A;  1PYS B;  1OXT A;  2JA7 B;  2WII B;  4JI0 Q;  3GTM B;  4C3H H;  1HZ9 A;  4A76 A;  4LF9 L;  2EYO A;  4J1M A;  1KAW A;  4JI1 Q;  5IP9 H;  5FLM G;  2Q2U A;  4FXD A;  5EAY A;  4HCS A;  4RGN A;  2Y0S G;  3EFX D;  1D8L A;  1ZYR C;  5IP7 H;  1D1K A;  1OO9 B;  3H3V I;  4G7Z C;  2MGS A;  1VQ8 A;  3F2D A;  1DOK A;  1GJX A;  1KRT A;  1TWF B;  1B9M A;  3BYT B;  2QDB A;  1NMF A;  1ET6 A;  2F4V L;  1C48 A;  1RCV D;  2I5M X;  2HT1 A;  1N8R C;  2NB0 A;  1K8A C;  1IL8 A;  3DWP A;  2PMZ E;  5C0X I;  1CHQ D;  1X6O A;  2IWH A;  4BWG B;  5IT9 c;  1HQM C;  1R9T B;  2WAQ B;  2BOS A;  3GTL B;  2EY1 A;  3H0G H;  1Q81 C;  2NVY B;  4A93 B;  2KEC A;  5EPL A;  2XNA C;  4WFN 3;  1J6Q A;  1RF2 D;  4A3C H;  5C4H A;  2CFM A;  2DUD A;  5HGQ A;  1Y14 B;  2MPM A;  4DGZ A;  1K8G A;  2XN9 C;  2FHT A;  4PG3 A;  1TU2 B;  4V0B A;  1KDC A;  1EQR A;  3G71 A;  1F2Z A;  1BR9 A;  1LTG D;  3S24 A;  5L37 A;  4CJ2 C;  3A0J A;  3NK9 A;  3GDE A;  5JVH 3;  1QG7 A;  1N33 L;  1O7L A;  1X3P A;  1NY4 A;  4TKO B;  5M5X B;  4B9W A;  2IX0 A;  2K5H A;  3CHB D;  3G6E A;  2HCC A;  2B8F A;  4QL5 A;  5DNF A;  1Q7Y C;  2NN6 G;  1GVP A;  3PF5 A;  3ULL A;  2ZTC A;  4IUU A;  1V1P A;  3OW2 A;  3TS0 A;  2OCE A;  1XPR A;  3T1H Q;  3N52 A;  4GLA C;  4RHR A;  4CDE C;  2AUK A;  4KLK A;  1K83 B;  1IYU A;  4DV4 Q;  3H94 A;  4CJ0 B;  3JAM i;  1F2M A;  2NTS A;  2XIW A;  3S2D B;  2OQK A;  4OEL B;  2LMC B;  1KD1 C;  2Q8T A;  1UWV A;  1SDF A;  4X3T A;  1VQD A;  1R4Q B;  2WB1 E;  3P1H A;  3VYT A;  2ZJP A;  3VYU A;  4A3G B;  3LWU A;  1EY9 A;  5G3L D;  1I4H A;  1K0R A;  5TSS A;  1OXX K;  3BG3 A;  1S40 A;  1CZW A;  3CPF A;  4LF6 Q;  2R7F A;  4DR2 Q;  1GUW A;  1VQL A;  3CME A;  4LFB L;  4JI7 Q;  2EE1 A;  4YWL A;  3ND8 A;  4ALP A;  2RQX A;  1PH7 A;  4KKS A;  3FDT A;  4FXG C;  4OIK A;  4B9X A;  1G91 A;  3CW2 C;  3FHW A;  1EQQ A;  4LFA L;  4JBJ A;  5LMN W;  4AIM A;  3C1E A;  2J0T D;  2PW5 A;  1UNS A;  4GN5 A;  3QJY A;  4WJ3 M;  1XNR Q;  2B2Y C;  4BY7 B;  1PFS A;  1LTL A;  3TME A;  1FNV A;  1SAP A;  4X66 Q;  2QDL A;  1XMO L;  1WD0 A;  1H9M A;  1V1Q A;  1TWG B;  2F0S A;  1HUN A;  4A3B H;  2QEX A;  1ICW A;  1YHB A;  2H4O A;  2QCP X;  1AP0 A;  1UEA B;  1PVO A;  4ILW A;  4LF4 L;  1SYB A;  3HKZ B;  4DXF A;  3NTK A;  1NE3 A;  5T1I A;  3A54 A;  1YNJ C;  5I4D A;  5C3X A;  5LMU Q;  3VYS A;  1Y1V G;  4R4I A;  5EPK A;  1E24 A;  1CKN B;  3S14 H;  3S1R H;  2K6A A;  1L0X B;  5GAH C;  5ELO A;  3HOV H;  2F0V A;  1A8V A;  4FVM A;  1I3Q B;  4KHV A;  3SK8 A;  1B2T A;  4A3L G;  1CA5 A;  1CSP A;  2K01 A;  2A68 C;  4DR1 L;  1DOL A;  3K7A B;  1BCP B;  3DXJ C;  4DUY L;  2EQS A;  2VY3 A;  4DV2 L;  1B8A A;  3P20 A;  4R4O A;  1EFW A;  3A55 A;  4L5R C;  1BVS A;  2B2V A;  3W1G A;  5IT9 L;  1E3P A;  1LTS D;  5JAV A;  1WTR A;  3BDL A;  5KYI A;  1LUZ A;  5FJ8 G;  1VQ5 A;  1TII D;  2K5Q A;  3S15 H;  1I4Q A;  2Q2I A;  3KFU A;  2MUY A;  1SNQ A;  1EYG A;  4DNI A;  3HOX G;  1RD9 D;  1PZJ D;  2R7Z B;  3D0F A;  1G51 A;  4JBM A;  2NVQ H;  5C3E G;  1X3G A;  3FVQ A;  2WAC A;  1JMC A;  2PI2 A;  4JCV E;  1PXU A;  2JEB I;  2JA8 G;  3ONA B;  3AEV A;  4GKJ L;  1LTA D;  4DV0 Q;  5IYC G;  4FF1 A;  3ICE A;  4Y52 H;  2PQA B;  1DYQ A;  5IYB H;  4HN7 A;  2PQE A;  4HTH A;  3UDG A;  1WTP A;  1EY6 A;  4AYB E;  4EQ5 A;  4DV1 L;  3G48 A;  3MEF A;  4XQN A;  1SRO A;  3FKI G;  1U4R A;  2SNS A;  1E1T A;  2CKZ B;  3GTK B;  2JA5 B;  4IOA A;  4QGU A;  4K2K A;  2MO0 A;  3HOY G;  4OL7 A;  3CU7 A;  5AJ3 Q;  4HJ8 A;  2CVR A;  1DM0 B;  4DNT B;  1E7Z A;  1YHA A;  1HZC A;  2EYL A;  4YCU A;  1GUN A;  4LJZ C;  3GV6 A;  3IRB A;  3BYY B;  1H9S B;  1PFB A;  3DUZ A;  1FYC A;  1EU3 A;  1NMG A;  1IKL A;  3QO2 A;  1KHI A;  1KNE A;  3FMC A;  4LMQ D;  3E9H A;  5IIF A;  1XXG A;  3CCQ A;  2F0U A;  1NAP A;  4EQO A;  1MJE A;  1X55 A;  1JWS D;  4JI8 Q;  3M85 A;  1M8A A;  2UUA Q;  1NCV A;  4DA2 A;  3BVM A;  1PRT D;  2N78 A;  3I90 A;  5JJK A;  5C0X G;  2IJ0 A;  4OWT B;  3HP3 A;  4DV3 L;  2ZM6 L;  2A69 C;  1VF7 A;  1U5K A;  5KND A;  3QOL A;  1JOR A;  4DV6 L;  3HOW H;  2AWO A;  4QQB X;  1X32 A;  3J80 E;  3PIO A;  1A3T A;  5JOB A;  3AFQ A;  2EYF A;  4MIU A;  2XVS A;  2D62 A;  3K5L A;  1PTO H;  4QCL A;  4X3U A;  3I7F A;  2IHF A;  2RHQ B;  5E1F A;  3GTO H;  5IP9 G;  1S5E D;  3PUZ A;  3I4N H;  4BBS G;  3CP0 A;  4IUN A;  1B1Z A;  2BA1 A;  5C6A A;  2L9H A;  3NPP A;  4A3I H;  1P16 A;  4KK7 A;  2CQO A;  1Q8K A;  4K2L A;  1JR0 D;  1N36 Q;  1HNZ Q;  4F87 A;  4BY1 B;  2K5V A;  3CRK C;  2XSC A;  2EYP A;  1PTO D;  2A69 D;  3RLN A;  1PLF A;  1HUM A;  3SHL A;  2WKD A;  1JOK A;  5HGT A;  2J7Z A;  5M5X H;  1Z6H A;  2B39 A;  3OIP A;  3ULJ A;  4PV1 C;  4MTN A;  4C3H B;  2F52 A;  2WP8 J;  4F7X A;  2MJ8 A;  3FPP A;  3SE0 A;  4R4C A;  2KBN A;  4YIJ A;  4LNQ A;  2CWA A;  1IBK L;  3PV0 A;  4A3K G;  1B53 A;  3PO2 G;  4FF4 A;  2DY8 A;  4JPB W;  3KF6 A;  1NSN S;  3I8Z A;  1G2S A;  3KK7 A;  4RH6 A;  4OX9 Q;  3ERS X;  4A3G H;  3M9B A;  4GOP A;  1CQV A;  1QZH A;  2DY7 A;  1TKW B;  4R4Q A;  1GHJ A;  5EJW A;  1N33 Q;  2SNM A;  4HSP A;  1WTW A;  2JQO A;  4FP5 D;  3AQQ A;  3LNN A;  3M7N A;  3H0G B;  5J1Z A;  1HA6 A;  4DAV A;  1FD7 D;  4IUP A;  2N55 A;  4FXK C;  4IUV A;  3MZ5 A;  1NTG A;  1HA5 A;  3D4D A;  4JYA Q;  5IWA L;  4X62 Q;  1GUO A;  3RZD H;  3R2I A;  2AMC B;  3CCJ A;  3VR3 A;  4AQY L;  2CW0 D;  3HGB A;  3H09 A;  2UU9 L;  1IW7 C;  2AKW B;  3URY A;  2L5T A;  1J9O A;  3RNU A;  1JCK B;  1ZXT A;  5COR A;  4C3I G;  3K5N A;  3L2P A;  4B08 A;  2E2D C;  2R61 A;  4BY7 H;  1SE8 A;  5ELE A;  4DR3 L;  2XTI A;  4A3J G;  3PO3 H;  2OT2 A;  4PNY A;  3S17 B;  4JI4 L;  3TP6 A;  1AN8 A;  4RGM A;  2E2J H;  2F0E A;  4J8Q A;  3PSI A;  3CQZ H;  1DD2 A;  2RKS A;  5D3D A;  2MO1 A;  4KHZ A;  2EY6 A;  1X56 A;  1HZB A;  3DWQ A;  2RSO A;  5M5W H;  2YTY A;  4A3F G;  3HOU H;  2RDH A;  2UXD L;  1SE3 A;  2OQ0 A;  3TP7 A;  4LUO A;  1SYE A;  1ET9 A;  1A63 A;  4F8M A;  4N8X 1;  2DGY A;  1QVF A;  3GD7 A;  3OPO A;  1XPU A;  3JC6 6;  1Z9F A;  1RIP A;  2OWO A;  4RA8 A;  1BBW A;  3I2Z A;  2BE5 C;  1XMO Q;  4OHJ A;  5H1S E;  4JBW A;  1UE7 A;  2F0T A;  4KD3 A;  1LTB D;  1U9R A;  2EXZ A;  5GAG C;  4L5T A;  4XQQ A;  1Q3L A;  5JJL A;  3T53 B;  1NBW A;  1SFO B;  3PMF A;  3HOV G;  3A8J E;  3EIV A;  4IJH A;  1RTN A;  4HED A;  5LHY 1;  3GTJ H;  1ONL A;  1STH A;  2EDG A;  2RBM A;  3IFD A;  5LMN Q;  1B50 A;  2VUM B;  3E9I A;  2ZXP A;  1ENC A;  2F3V A;  5IGE A;  2K04 A;  2CQA A;  1ASY A;  5EKK A;  4L5Q A;  3TDQ A;  1WCM G;  1JWM D;  4UDU C;  4H0L C;  2YU9 H;  4DR1 Q;  5C44 H;  1I6V C;  2NWG A;  3GTQ H;  3TZD A;  5JJZ A;  2HIX A;  3CCV A;  4A3B B;  1C0A A;  1SJH D;  2K33 A;  1KDB A;  1SSO A;  4K0K Q;  4QUC A;  3M4O H;  2CH4 A;  2PMZ B;  1QVG A;  3HOZ H;  1OXV A;  2NVX H;  1LT3 D;  2KHJ A;  3S14 B;  4G7H C;  4LWC A;  4BS9 A;  3NWS A;  1KTK A;  1STN A;  3X3N A;  2F03 A;  3S1R B;  3QIA A;  4C3J G;  1NR2 A;  2NVT H;  1G2T A;  4O2D A;  1KIX A;  2PNR C;  2VZA A;  2XWB B;  4L63 B;  3W2D A;  5IE8 A;  2B63 G;  5DAU A;  1EY5 A;  1CKM A;  1LTI D;  1SEB D;  3MFY A;  1NJI C;  1F2Y A;  1EEF D;  4DPG A;  4U67 3;  4GKJ Q;  2R92 G;  3STB D;  4CDC C;  4A3D G;  4DR7 L;  5JEA J;  3BS1 A;  4MNO A;  1OTC A;  4S3S A;  4DV1 Q;  1EIH A;  4MHE A;  4YHH L;  1YNN C;  5KEE A;  2KCT A;  2D5D A;  5E4W C;  3MXN A;  4ZUJ A;  2A6E D;  1W6K A;  2F0Q A;  4IFD I;  5M9O A;  3PF4 A;  4P72 A;  2Q2T A;  2NVQ B;  1VQJ A;  1PZK D;  3S16 H;  2YTV A;  2JA7 G;  1STY A;  1TY2 A;  2X69 A;  5IT9 E;  4N9P A;  4C56 C;  3F2C A;  3UDI A;  4HSV A;  2WB1 B;  1A3U A;  1XWE A;  2P5Z X;  1STB A;  3L7Z C;  1OXU A;  1GUS A;  2KUM A;  5BN5 A;  3ERO A;  1XJV A;  2K7V A;  4DKA C;  5KYL A;  1PMR A;  3EJI A;  2CCZ A;  4DAY B;  1V43 A;  3H3V C;  1CKN A;  1PA6 A;  2R93 H;  5JEA G;  1WYD A;  1KC8 C;  3A56 A;  4DV3 Q;  1KQS A;  5KNC A;  3J81 c;  1JOQ A;  1PRT B;  4HJA A;  5JPN C;  3C46 A;  3S2H H;  2RSN A;  4POG A;  1I5F A;  5M3M H;  3RN2 A;  4HIK A;  2O4X A;  1K8M A;  1HXY D;  2WAQ G;  3R8B A;  1YHQ A;  2B2U A;  1GD7 A;  4QUF A;  4CDD C;  2MHV A;  3OIQ A;  1IHZ A;  1PH5 A;  4K8I A;  4A93 G;  2GVA A;  4B3R L;  4YY3 L;  2JA6 H;  2K1B A;  5COY A;  2F0H A;  1Y8N B;  3A8I E;  2F0F A;  2QEJ C;  2K5N A;  1EEI D;  1J8I A;  2JXM B;  3QG1 A;  4IUQ A;  1EQT A;  1MIU A;  2Q8I B;  2DJG C;  3HOW B;  4XXE A;  1P8L A;  3NUC A;  5M3F B;  2Z0S A;  4APV A;  4DR5 L;  1PTO B;  3BVZ A;  4KY7 A;  2X6G A;  1VQA A;  3GTO B;  2PQA A;  1L1O C;  1X3E A;  2IL8 A;  3I4N B;  3EA6 A;  5EKI A;  3BJU A;  4NB3 A;  2F0M A;  4A3I B;  1D6E C;  5CC4 A;  2B2V C;  1ESR A;  4X6A H;  1SMY C;  2F0L A;  2HHH L;  1I4G A;  1ZEQ X;  1ZYR D;  4I7Z C;  5GQO A;  2QA4 A;  3ITP A;  1TS4 A;  2BCO A;  3J7A F;  4A3G G;  5D65 A;  2VB2 X;  1Q46 A;  1IBK Q;  1VQ6 A;  2A19 A;  1IYJ B;  1HPC A;  1O7I A;  3PGZ A;  2M9V A;  2F1M A;  4LW1 A;  2EXD A;  4Z9C B;  3J81 j;  2HD3 A;  2BDN A;  1JB7 A;  1H9S A;  2B8G A;  3MEH A;  4C1N I;  2VQF L;  1M4V A;  1EQV A;  3S17 H;  5C5M A;  1Y1W H;  2ES2 A;  1K8O A;  1PRT F;  4K5W A;  4NXN L;  3UDF A;  3F2U A;  5ELB A;  3D4W A;  1WTH A;  1KL9 A;  5KNB A;  3KYH C;  1V8Q A;  3CCR A;  5ELF A;  2F0O A;  3IL8 A;  3M4P A;  2I5H A;  3S1N H;  4MTK A;  1BNZ A;  4AYB B;  4NXM Q;  4OWW B;  5J22 A;  3QOJ A;  1ASZ A;  5IWA Q;  1EIG A;  2K50 A;  3O13 A;  4BY7 G;  1S5D D;  4HID A;  3KF8 B;  1F77 A;  1I94 L;  5K36 G;  3B6Y A;  4HJ9 A;  3DWA A;  4LUZ A;  5JVG 3;  3MA2 B;  4X3S A;  3CMA A;  3I4M H;  1KRS A;  1JJG A;  1H9K A;  3HKZ G;  1IBM Q;  1GUG A;  4DR3 Q;  2IT1 A;  3TBI B;  3H15 A;  1QWY A;  1E1O A;  3CC7 A;  2HDM A;  5EQ0 A;  1IBL Q;  2JEA I;  2EYH A;  1HTL D;  3VR4 A;  2E2H H;  1QZG A;  1DON A;  1DXM A;  3NTI A;  1N34 Q;  1SFO H;  3CF5 A;  3MXN B;  3OOC A;  3RZD B;  1W6J A;  4XDX A;  2EJM A;  1A6X A;  1SNC A;  4LFC L;  3K6O A;  1TWH H;  2F0W A;  2VUM H;  4PMB A;  1TS3 A;  2L4N A;  2NZ1 D;  4C2M H;  3V05 A;  1IXR A;  4TVA B;  4RFB A;  2LFN A;  3PO3 B;  1UE6 A;  3J81 L;  1II3 A;  3WOE A;  3A5U A;  1DJR D;  4RCO A;  3K80 C;  2E2J B;  4R8N A;  2KQ3 A;  3RUZ A;  3CQZ B;  1Y8O B;  3SVM A;  2UXB Q;  4DV7 L;  1RDP D;  1X3F A;  1Q1B A;  4PZ6 A;  1AW7 A;  4GNX B;  1O78 A;  1N32 Q;  3NXW A;  4RCN A;  1RHP A;  5M5W B;  3CKI B;  2R7Z G;  1G6Z A;  1U4M A;  1MJC A;  4L8J A;  3T51 B;  1SRU A;  3M4Q A;  3HOU B;  1SND A;  4DAM A;  2OTL A;  1HNW Q;  1PH3 A;  2KHS A;  1KNA A;  1VMP A;  3DM1 A;  5J3B A;  5A2Q L;  2YYZ A;  4B3T L;  2EY2 A;  2PZU A;  4JW0 A;  5DLQ E;  2ALY B;  1FJG Q;  3TSS A;  1EWH A;  2Z8L A;  3KDF B;  2VXW A;  4DV5 Q;  4IFD G;  1GO3 E;  2JA5 G;  4KJO A;  2EVB A;  5GAD C;  2Z6K A;  4B3S Q;  2UUB L;  1YNJ D;  4QMG A;  1F9P A;  2K03 A;  1K9M C;  5JJI A;  5IYD H;  4RMF A;  4JI6 L;  3SXH A;  3A74 A;  3GTJ B;  1BF4 A;  4BXX H;  1KXL A;  2F0I A;  2WIN B;  5IGC A;  1VQH A;  5D3I B;  3A7L A;  4TRD A;  3CRL C;  3J81 i;  1CQF A;  3Q6S A;  1VQM A;  4FNF A;  1EY8 A;  2MNA A;  3GP7 A;  2YU9 B;  2A68 D;  5C44 B;  3QR8 A;  4KN7 C;  3GTQ B;  1Q8I A;  2Y0S E;  4HJ7 A;  4GOP C;  3KLS A;  5ISR A;  1DGS A;  3M4O B;  2K75 A;  5CV7 A;  5C0X J;  2TMP A;  3J7A V;  3HOZ B;  2A8V A;  2L15 A;  4ABN A;  2NVX B;  4NPS A;  2JP1 A;  3AFP A;  1VS0 A;  5FO7 B;  1HZA A;  1TXY A;  3AU7 A;  4JC0 A;  3GTG H;  1JC7 A;  4DK3 C;  2NVT B;  3SGI A;  1FGU A;  1JE4 A;  1YBY A;  2KJX A;  4EQP A;  3CCM A;  1SYF A;  2NYZ D;  4LF7 L;  2K5W A;  2KEN A;  2NUC A;  5KRU A;  4KI0 A;  4OXP A;  4A3E H;  1C7Y A;  2AQ3 B;  2VQE Q;  2EIF A;  2ZT9 C;  4G7O C;  1XMQ L;  1VQC A;  4QF4 A;  3WWV A;  5I6W A;  4XIG S;  3FRP B;  1BCP F;  4QJF A;  1YNX A;  5EGT A;  2E5L Q;  4BY1 G;  2O2L D;  3TN2 A;  2FIN B;  1PV4 A;  4DUZ L;  2JE6 I;  4LF8 Q;  1U4L A;  3U9O A;  3SEB A;  5KGU A;  1NR4 A;  1LV9 A;  4XYQ A;  2XRS D;  4DK6 C;  4IQZ A;  3S16 B;  2PYK A;  4GKK L;  1HFG A;  3I55 A;  5M3F H;  1AE2 A;  1PH9 A;  1CK1 A;  1X3Q A;  4C3H G;  1A0I A;  5E3F A;  2UXC Q;  1B9N A;  2FXQ A;  1YEZ A;  1EY7 A;  3VDY A;  3CC2 A;  5BR8 L;  3K5M A;  2A6H C;  4A3M H;  3EN2 A;  5IP7 G;  4YY3 Q;  1EZ8 A;  4LF9 Q;  1AH9 A;  5D14 A;  1AE3 A;  3MAQ A;  5FO8 B;  4BBR H;  3SK6 A;  4GZY C;  3SK4 A;  1HQR D;  1WTX A;  2R93 B;  2WKC A;  3PUW A;  5C4J H;  3OWF A;  3P75 A;  2O5I C;  3MXG A;  2XGT A;  4JK1 C;  3S2H B;  4DN4 M;  2KA7 A;  2F4V Q;  2RF4 A;  5M3M B;  1STA A;  4OIJ A;  3A5Z B;  4JI1 L;  3CD6 A;  4K6D A;  3ER0 A;  3H0G G;  1VQG A;  2RHS B;  2L12 A;  2IW3 A;  3VR5 A;  2NTT A;  2RCF A;  2Z9H A;  4DR5 Q;  2JA6 B;  4UP9 A;  4A3C G;  1QJO A;  2L1B A;  1MKH A;  5FLM H;  2RDG A;  2A6H D;  2OF1 A;  4GN4 B;  2F3I A;  2LS0 1;  5J39 A;  5AFW A;  3TRZ A;  4JOI A;  3RZO H;  4P73 A;  2HHH Q;  3I73 A;  1SNP A;  4NMZ A;  4Q5V A;  3HFZ B;  1VDZ A;  3SR1 A;  2H1E A;  3R2T A;  1NUC A;  2RDF A;  3M7G A;  4ZLT F;  4QB4 A;  5DM7 3;  3MXP A;  4BA1 I;  3MWY W;  1CUK A;  3R93 A;  2N8N A;  2ICI A;  4IZ8 A;  2F0D A;  2C35 B;  1T5E A;  1HHV A;  2EYM A;  1ROD A;  4DAY A;  1VQK A;  1WD1 A;  4CKC A;  3VYR A;  3J7Y W;  1PH8 A;  1WFQ A;  3M4Y A;  1HCZ A;  3T1H L;  4JBK A;  2IX1 A;  4J6H A;  1L2F A;  1I94 Q;  1I6H B;  4B3M L;  2GA4 B;  2EOT A;  4DV4 L;  1PH4 A;  1K3R A;  2NN6 H;  2G5D A;  4EVO A;  2VS1 A;  2I07 B;  1Y1W B;  5CV5 A;  3OYY A;  3PIO 3;  3F2B A;  5LL6 S;  3I4O A;  1CM9 A;  1CSQ A;  1E2Z A;  2DJF C;  1D2B A;  4YCW A;  1B44 D;  1C4Q A;  1YVC A;  2E2I H;  3S1N B;  4LFB Q;  2VUM G;  3K58 A;  3PIP A;  4KY6 A;  1EY4 A;  2AQ2 B;  4HMI A;  4R1J A;  2QIL A;  4ZKB B;  4LFC Q;  4J15 A;  1IW7 D;  4JI5 L;  4DR2 L;  3PUX A;  2WFW A;  1IZ6 A;  3EQL C;  1SYD A;  4GS3 A;  3NEN A;  4LFA Q;  4A3B G;  4JI7 L;  3I4M B;  1QE6 A;  1ENF A;  3T4A C;  1BQQ T;  1LT5 D;  2PO4 A;  1PDQ A;  4Q0F A;  2A74 C;  2CH4 W;  1HR0 W;  1AFP A;  1QOH A;  2B2U C;  1RL2 A;  1BCP C;  2C5C A;  4I65 A;  1EYA A;  4ZRZ A;  2E2H B;  2D2C C;  4LF4 Q;  1O7Z A;  3K0X A;  1B70 B;  4C1N K;  1XNR L;  1IYV A;  5I2X A;  1D5M C;  2I0Q A;  2SDF A;  5IGF A;  4OON A;  1EL0 A;  1UE1 A;  4KMU C;  1N9W A;  1BO0 A;  2ASB A;  1PHJ A;  1Q90 A;  4NW2 A;  1SNM A;  1TWH B;  3NQI A;  1EFI D;  1BOS A;  1TS5 A;  2BA0 A;  3W3A A;  4C2M B;  4LAA A;  4KN4 C;  4PQX A;  1HR0 L;  4DR4 L;  4IJL A;  4UHV A;  1CHP D;  1XNQ L;  3AMU A;  3TS2 A;  4B3T Q;  5FLX c;  1SBB B;  4DUY Q;  2BE5 D;  1EWC A;  4DV2 Q;  3NE5 B;  5GAE C;  5E4X A;  1D5Z C;  4FF2 A;  1X54 A;  1EUJ A;  5IYD G;  4IUT A;  1Y1V H;  1CT1 D;  1X65 A;  4BXX G;  4ZAI A;  2KCC A;  4JV5 L;  1TVX A;  4ZYS A;  2A1A A;  5LL6 X;  1UAP A;  2G9H D;  5IGG A;  3K8A A;  5G3L F;  3GTP H;  2Z1C A;  4JI6 Q;  3J81 E;  4K8J A;  4A3L H;  2B2W A;  1VQ9 A;  3TP8 A;  4CJ1 B;  1QCB D;  3KF8 A;  4X3K A;  5KIX A;  3U50 C;  5IYB G;  2WB1 G;  3D8G A;  3H91 A;  5C4X B;  1KAA A;  1WTV A;  3KJP A;  1VMC A;  3OTO L;  1MD2 D;  4DK0 A;  3C2P A;  4FF3 A;  1JJ2 A;  2E75 C;  2D0O A;  3BZD B;  3RMH A;  4O0A A;  2A5H A;  1XTC D;  1I4P A;  4XYO A;  4ULL A;  3TEH B;  3HOX H;  1HFN A;  5A2Q E;  4DV0 L;  4DXG A;  3MXU A;  3W1B A;  5C3E H;  4HJ5 A;  2JA8 H;  1GXD C;  2L11 A;  2F0G A;  1DOM A;  3PIP 3;  2F4I A;  5EBD A;  1A3V A;  3ND9 A;  3KJO A;  4CBV A;  1L0W A;  1B4O A;  2F0P A;  4WOR A;  1LTR D;  3FKI H;  3D31 A;  4LF5 L;  1JJC B;  5ELD A;  4RKL A;  3J7Z C;  1D5X C;  4GNX A;  5IGB A;  1AZP A;  1YNN D;  3WDN A;  3HOW G;  1FL0 A;  3GTG B;  2PNH A;  2V4D A;  1PH6 A;  5M3F G;  1F9Q A;  2ZM6 Q;  1F9S A;  4MN3 A;  3NP8 A;  4JI8 L;  4DV6 Q;  3RR5 A;  2I46 A;  2UUC L;  1FNW A;  2UUA L;  2EZV A;  5I9O A;  4A3E B;  3H3V H;  4GKK Q;  1A62 A;  5CBA E;  3I4N G;  2E8G A;  4DR6 L;  3KDF A;  3NQT A;  2VW9 A;  1R4P B;  3SK5 A;  4A3I G;  3CCS A;  1MSH A;  3NBH B;  2XWJ B;  5FKA C;  5C0X H;  3U9S A;  1MBY A;  3A7A B;  5I9P A;  2E74 C;  1MHW C;  1JQY D;  1GM5 A;  4YWK A;  4FYD A;  2FMM A;  2Z6B A;  4IPH A;  1GUT A;  1C9O A;  1K0S A;  1QB5 D;  3KLR A;  1BDO A;  1SE4 A;  2F0N A;  1EIY B;  5I6Y A;  1FNU A;  2HQL A;  3I91 A;  1YIT A;  1QUQ B;  2BH8 A;  1N36 L;  3ZJY C;  4BBS H;  1HNZ L;  2K52 A;  2PZW A;  2PCF B;  4ZKC B;  5FLX L;  4A3M B;  2WV6 D;  2X6L A;  4U68 A;  4AYB G;  1WTQ A;  3JAM L;  5M5Y H;  3KBX A;  4BBR B;  1UEB A;  1ICF B;  3LX0 A;  4JVZ A;  2M2L A;  4IO9 A;  3T1Y L;  1TWA B;  2D0P A;  3UI2 A;  2JA9 A;  2Z6K C;  2RCN A;  3C3L A;  2HQE A;  3M3Y H;  1QNK A;  3L9A X;  5C4J B;  2B2T A;  4A4I A;  1VQI A;  4QY7 A;  2KHI A;  4M1U B;  4KHP L;  2Q2H A;  2AUJ D;  4RGT A;  5T1G A;  2JK8 A;  1ESF A;  1STE A;  4UAI A;  1GOZ A;  1I6H H;  2AQ1 B;  2G9D A;  4IN3 A;  1K28 A;  1E0B A;  2GN5 A;  4NKL A;  4DU9 A;  1MSG A;  3K57 A;  5CMD A;  5IY0 A;  3IAY A;  3K59 A;  1BKB A;  4IPC A;  2Y0S B;  1VQO A;  1Q86 C;  1KLG D;  4X65 L;  4OX9 L;  2HDL A;  3G4S A;  1A2U A;  4A3K H;  2V1C C;  4JI3 L;  3PO2 H;  2L55 A;  3HS0 C;  3NEM A;  1SMY D;  3RZO B;  2KCN A;  2F0J A;  3IKJ A;  4QIW B;  4AQY Q;  4MZ9 A;  3PO3 G;  3NHH A;  2UU9 Q;  5ELC A;  3NEL A;  4HCE A;  4FO2 A;  3ULP A;  1HJP A;  1SR3 A;  5CBE E;  1C8C A;  4JYA L;  1VCI A;  3EVQ A;  2K14 A;  4X62 L;  4B3M Q;  1IKM A;  1TWC B;  2VNU D;  4XT1 B;  3H6M A;  3K7U C;  5EBC A;  1QNU A;  1Y69 U;  4JI4 Q;  4TQU S;  4UPA A;  2LXJ A;  5HY6 A;  1CTM A;  2OEO A;  4XQJ A;  1W3S A;  2YTX A;  1BBX C;  2DNE A;  5EKL A;  3I72 A;  1PH1 A;  2CHB D;  1PTO F;  3HOU G;  2ZJQ A;  5ELN A;  1SXT A;  2LSS A;  1LT4 D;  1I4R A;  1U4P A;  2JN4 A;  1EYC A;  4KKU A;  2MQH A;  4C3I H;  1B3A A;  5JPM C;  3VR2 A; 
#chains in the Genus database with same CATH homology
 2JE6 I;  2LXK A;  1X56 A;  4LF8 Q;  1B7Y B;  1YJN A;  1HZB A;  4A3J H;  1YJW A;  5E7N A;  2UXD Q;  2E5L L;  1G29 1;  5M5W H;  4L5S A;  4YCV A;  4A3M G;  4JI5 Q;  4IFD J;  4DK6 C;  1U0L A;  2YTY A;  4A3F G;  1M90 C;  1VQP A;  3HOU H;  4LF8 L;  2UXD L;  4GKK L;  3I55 A;  3KOJ A;  2ID0 A;  5M3F H;  2OQ0 A;  4X64 L;  1AE2 A;  4AH6 A;  4BBR G;  4LUO A;  1PH9 A;  3FP9 A;  1WOC A;  1YIJ A;  5BR8 Q;  1A0I A;  3KLW A;  1A63 A;  3E0E A;  4BY1 H;  2UXC Q;  2DGY A;  2FXQ A;  1QVF A;  1YEZ A;  3GD7 A;  1XPU A;  3VDY A;  3CC2 A;  1D7Q A;  3JC6 6;  3RLF A;  4A75 A;  1Z9F A;  1S3O A;  1WJJ A;  1RIP A;  3LGJ A;  3J80 i;  5BR8 L;  2OWO A;  1BBW A;  3I2Z A;  1XMO Q;  3J7A 5;  2UXC L;  2K4K A;  2ZJR A;  4A3M H;  3EN2 A;  5H1S E;  4JBW A;  5IP7 G;  1UE7 A;  4YY3 Q;  4A3F H;  4LF9 Q;  1AH9 A;  1PYS B;  1OXT A;  1AE3 A;  4BBR H;  5GAG C;  2QGQ A;  4L5T A;  4JI0 Q;  4R4T A;  4C3H H;  1HZ9 A;  5JJL A;  1NBW A;  4A76 A;  1E22 A;  4LF9 L;  3PUW A;  1KAW A;  5C44 G;  3HOV G;  1VQN A;  3EIV A;  1BBU A;  5C4J H;  4IJH A;  4JI1 Q;  5IP9 H;  5FLM G;  2Q2U A;  5EAY A;  3GTJ H;  2XGT A;  5LMN Q;  1HNX L;  2Y0S G;  4RG1 A;  1D8L A;  1HR0 Q;  4DR4 Q;  3E9I A;  2RF4 A;  2F4V Q;  5IP7 H;  5C4X H;  3A5Z B;  4JI1 L;  3CD6 A;  1XNQ Q;  1VQ8 A;  3H3V I;  3I56 A;  3F2D A;  3HOZ G;  3ER0 A;  3H0G G;  1KRT A;  5LMN L;  1ASY A;  1VQG A;  4L5Q A;  1NMF A;  2F4V L;  2RHS B;  1WCM G;  2HT1 A;  2I5M X;  1N8R C;  2YU9 H;  4DR1 Q;  4DR5 Q;  5C44 H;  4IOC A;  4OO1 I;  4A3C G;  4UP9 A;  2OTJ A;  3GTQ H;  1WI5 A;  2HIX A;  3CCV A;  1K8A C;  1MKH A;  5FLM H;  1C0A A;  3K81 C;  2WAQ E;  4K0K Q;  2PMZ E;  4GN4 B;  5C0X I;  2F3I A;  1X6O A;  5IT9 c;  3M4O H;  1L1O A;  4FDB A;  1QVG A;  3HOZ H;  3TRZ A;  3H0G H;  4JV5 Q;  1Q81 C;  4K0K L;  1OXV A;  2NVX H;  1WCM H;  4JOI A;  1YZ6 A;  2KHJ A;  4P73 A;  4JI2 L;  4JOI C;  3RZO H;  4LWC A;  2IY5 B;  2HHH Q;  1J6Q A;  4A3C H;  1SLJ A;  2CFM A;  2DUD A;  5HGQ A;  1Y14 B;  1K8G A;  1J5E L;  3HFZ B;  1K73 C;  4PG3 A;  2NVT H;  2KCM A;  4O2D A;  1EQR A;  3G71 A;  2JJQ A;  1KIX A;  3CXC A;  2VZA A;  1XPO A;  3S24 A;  4BA1 I;  3OTO Q;  1CUK A;  2N8N A;  5IE8 A;  2B63 G;  3A0J A;  4IPG A;  1CKM A;  3GDE A;  1NJI C;  1N33 L;  4DR7 Q;  4UP8 A;  4QIW E;  4DPG A;  2BH2 A;  1NY4 A;  4GKJ Q;  2R92 G;  3STB D;  2H5X A;  2IX0 A;  2C35 B;  2K5H A;  4A3D G;  3G6E A;  4QL5 A;  4C3J H;  4YHH Q;  1Q7Y C;  2B29 A;  4DR7 L;  2ATW A;  2NN6 G;  1GVP A;  3PF5 A;  3ULL A;  5JEA J;  2ZTC A;  4MNO A;  3U4Z A;  4DV1 Q;  1OTC A;  3OW2 A;  2R6G A;  2OCE A;  3TS0 A;  1XPR A;  3T1H Q;  4YHH L;  1VQK A;  2KCT A;  4GLA C;  2B63 H;  1W2B A;  1LM0 A;  1PH8 A;  4KLK A;  1WFQ A;  4DV4 Q;  3T1H L;  4GN3 B;  4JBK A;  2IX1 A;  4IFD I;  3JAM i;  2R92 H;  1L2F A;  3L0O A;  1I94 Q;  3PF4 A;  4P72 A;  3BU2 A;  2Q2T A;  4A3D H;  1I50 H;  2OQK A;  4B3M L;  1VQJ A;  1PH4 A;  4DV4 L;  1KD1 C;  1K3R A;  3S16 H;  1UWV A;  2VS1 A;  2YTV A;  2JA7 G;  1T9H A;  1VQD A;  1PH2 A;  1JT8 A;  2WB1 E;  3OYY A;  3F2B A;  2ZJP A;  3F2C A;  3CCU A;  3UDI A;  3I4O A;  1CSQ A;  2R93 G;  1SN8 A;  4BA2 I;  4LF5 Q;  4YCW A;  1K0R A;  3S1Q H;  3L7Z C;  1OXU A;  1OXX K;  1S40 A;  1YVC A;  2E2I H;  4UY8 C;  4LFB Q;  3CPF A;  1XJV A;  2VUM G;  4DKA C;  5M3M G;  4LF6 Q;  2R7F A;  3PIP A;  4DR2 Q;  4JG2 A;  2JA7 H;  1PV4 A;  1VQL A;  4DAY B;  3CME A;  2CCZ A;  4JI7 Q;  1V43 A;  4R1J A;  4LFC Q;  3GTM H;  4LFB L;  1CKN A;  4J15 A;  1PA6 A;  4YWL A;  4ALP A;  2R93 H;  4JI5 L;  4DR2 L;  3PUX A;  2WFW A;  1IZ6 A;  5JEA G;  1PH7 A;  2JA6 G;  1WYD A;  1KC8 C;  4GS3 A;  4A3B G;  3NEN A;  4LFA Q;  4DV3 Q;  2UUC Q;  4JI7 L;  1KQS A;  3CW2 C;  4P75 A;  3J81 c;  4HJA A;  3S2H H;  3FHW A;  4POG A;  1XTD A;  1EQQ A;  4DR6 Q;  1I5F A;  5M3M H;  3RN2 A;  4LFA L;  4HIK A;  4JBJ A;  2WAQ G;  5LMN W;  1YHQ A;  1HR0 W;  4AIM A;  1GD7 A;  4B3R Q;  4GN5 A;  1RL2 A;  1TWF H;  4WJ3 M;  1XNR Q;  1PFS A;  1LTL A;  4X66 Q;  1XMO L;  1V1Q A;  1PH5 A;  4LF4 Q;  4A93 G;  2GVA A;  4B3R L;  3K0X A;  1B70 B;  4YY3 L;  2JA6 H;  3HKZ E;  1XNR L;  4A3B H;  2QEX A;  1TWA H;  2I0Q A;  1YHB A;  4OON A;  1PVO A;  4LF4 L;  4JI0 L;  4UP7 A;  1UE1 A;  4H02 A;  1EIF A;  1N9W A;  1R9T H;  3CCL A;  1NE3 A;  2ASB A;  1PHJ A;  3GTL H;  2K5N A;  2NVY H;  5LMU Q;  1Y1V G;  2BA0 A;  4P71 A;  4R4I A;  1E24 A;  1MIU A;  1CKN B;  1HR0 L;  3S14 H;  4A93 H;  4DR4 L;  4IJL A;  4XTC S;  1P8L A;  1XNQ L;  3S1R H;  3TS2 A;  5GAH C;  5ELO A;  3HOV H;  4B3T Q;  1YI2 A;  1A8V A;  5FLX c;  1G6P A;  2Z0S A;  4DUY Q;  4A3L G;  4DV2 Q;  1CSP A;  4APV A;  1SMX A;  4DR1 L;  4DR5 L;  5GAE C;  4HIM A;  1VQA A;  1X54 A;  1EUJ A;  5IYD G;  1VQB A;  1Y1V H;  2PQA A;  1L1O C;  4DUY L;  1X65 A;  2EQS A;  2VY3 A;  4BXX G;  1X3E A;  2NZO A;  4DV2 L;  1B8A A;  4HIO A;  1EFW A;  4R4O A;  3T1Y Q;  3BJU A;  4L5R C;  4YWM A;  1BVS A;  4NB3 A;  4JV5 L;  3W1G A;  2A1A A;  1E3P A;  3K8A A;  1EOV A;  3GTP H;  4X6A H;  4JI6 Q;  4A3L H;  3U58 A;  1Y1W G;  1LUZ A;  5FJ8 G;  1VQ9 A;  2HHH L;  5GQO A;  1PYB A;  1VQ5 A;  2QA4 A;  4KHP Q;  3S15 H;  2Q2I A;  3KFU A;  4A3G G;  1Q46 A;  1IBK Q;  1VQ6 A;  2A19 A;  3U50 C;  2WB1 G;  1IYJ B;  5IYB G;  1EYG A;  4DNI A;  2VQF Q;  1O7I A;  1K83 H;  1TWC H;  3PGZ A;  4LW1 A;  3HOX G;  2EXD A;  3J81 j;  2CWP A;  3D0F A;  3KJP A;  1G51 A;  1JB7 A;  4PZ7 A;  4JBM A;  3S2D H;  3OTO L;  3BZK A;  1X3G A;  3F1Z A;  4EX5 A;  5C3E G;  2VQF L;  1JMC A;  4NXN Q;  2IHE A;  5GRO A;  2PI2 A;  4JCV E;  3S17 H;  1Y1W H;  2JEB I;  2ES2 A;  2JA8 G;  4X65 Q;  3AEV A;  4GKJ L;  1JJ2 A;  4NXN L;  4DV0 Q;  3UDF A;  5IYC G;  3J80 c;  3ICE A;  1L1O B;  4Y52 H;  2PQA B;  2D0O A;  5IYB H;  1KL9 A;  4O0A A;  1JE5 A;  4JI3 Q;  3UDG A;  1V9P A;  3KYH C;  3CCR A;  1OXS C;  3TEH B;  3HOX H;  4AYB E;  4EQ5 A;  4DV0 L;  3I4M G;  4DV1 L;  3M4P A;  2I5H A;  3S1N H;  3G48 A;  3GO5 A;  3W1B A;  5C3E H;  4NXM Q;  4OWW B;  3CAM A;  3MEF A;  1SRO A;  4HJ5 A;  3FKI G;  1ASZ A;  1E1T A;  2CKZ B;  3DM3 A;  5IWA Q;  1Z47 A;  2JA8 H;  4IOA A;  4QGU A;  2K50 A;  4BY7 G;  2MO0 A;  4NXM L;  4HID A;  3KF8 B;  1I94 L;  3UE1 A;  3HOY G;  5K36 G;  3B6Y A;  3KJO A;  4HJ9 A;  4LUZ A;  5AJ3 Q;  4HJ8 A;  1L0W A;  3HKS A;  1E7Z A;  1YHA A;  1HZC A;  4YCU A;  3CMA A;  3I4M H;  1Q1E A;  2I5L X;  1KRS A;  1VQE A;  3AYH B;  3IRB A;  1JJG A;  3HKZ G;  3EBE A;  1IBM Q;  4DR3 Q;  2IT1 A;  3CC7 A;  3H15 A;  1E1O A;  3FKI H;  3D31 A;  4LF5 L;  1GKH A;  1IBL Q;  1NMG A;  2JEA I;  1JJC B;  1VQ7 A;  1IBM L;  1KHI A;  3J7Z C;  2E2H H;  2ZTD A;  1QZG A;  1LYL A;  3E9H A;  4GNX A;  1TWG H;  4GNX C;  3CCQ A;  1IBL L;  3HOW G;  4GLX A;  1FL0 A;  4LF6 L;  1QVC A;  1N34 Q;  1SFO H;  3CF5 A;  2PNH A;  1X55 A;  3MXN B;  1PH6 A;  5M3F G;  1MJE A;  4JI8 Q;  4Y7N H;  3M85 A;  4OO1 G;  2UUA Q;  4LFC L;  2ZM6 Q;  1N34 L;  3U4V A;  1TWH H;  2N78 A;  4JI8 L;  4DV6 Q;  2VUM H;  2N49 A;  5JJK A;  3RR5 A;  5C0X G;  4DV3 L;  4OWT B;  2UUC L;  1UE5 A;  1QUQ A;  2ZM6 L;  2UUA L;  4GKK Q;  3H3V H;  1U5K A;  4C2M H;  1A62 A;  1IL2 A;  1IXR A;  4X64 Q;  4TVA B;  3I4N G;  2E8G A;  2NN6 I;  4DV6 L;  3HOW H;  4DR6 L;  2AWO A;  4QQB X;  1UE6 A;  3PIO A;  3KDF A;  4LUV A;  2VW9 A;  2R7D A;  4A3I G;  3A5U A;  1I3Q H;  3AFQ A;  3CCS A;  4X66 L;  4DV7 Q;  3NBH B;  3K80 C;  2D62 A;  3PCO B;  3K7A H;  3I7F A;  2IHF A;  2RHQ B;  3GTO H;  5IP9 G;  2UXB Q;  4DV7 L;  1X3F A;  3CPW A;  3PUZ A;  3I4N H;  1Q1B A;  4PZ6 A;  4GNX B;  4BBS G;  3CP0 A;  1GM5 A;  4YWK A;  1N32 Q;  2BA1 A;  5C4X G;  2R7Z G;  2UXB L;  4IPH A;  1C9O A;  1MJC A;  2HIV A;  4A3I H;  1P16 A;  1SRU A;  5LMU L;  3F8T A;  3M4Q A;  2CQO A;  1Q8K A;  1N32 L;  4PZ8 A;  1EIY B;  4DAM A;  2OTL A;  3PUV A;  1HNW Q;  1PH3 A;  1N36 Q;  1HNX Q;  4IPD A;  1HNZ Q;  2HQL A;  1Q82 C;  4GLV B;  5J3B A;  2K5V A;  3JAM c;  1YIT A;  2YYZ A;  3RLN A;  1QUQ B;  4B3T L;  2BH8 A;  1HNW L;  1N36 L;  3ZJY C;  1H95 A;  5DLQ E;  4BBS H;  2ALY B;  1FJG Q;  1HNZ L;  3S1M H;  2K52 A;  3KDF B;  2R7Z H;  3BZC A;  3TQY A;  2GVB A;  5M5X H;  4DV5 Q;  4AYB G;  1FJG L;  1Q12 A;  2UUB Q;  3ULJ A;  5M5Y H;  4IFD G;  1UEB A;  1GO3 E;  2JA5 G;  4POF A;  4MTN A;  5GAD C;  4IO9 A;  3T1Y L;  4DV5 L;  2Z6K A;  4B3S Q;  2D0P A;  3STB C;  1S72 A;  2JA9 A;  2F52 A;  2Z6K C;  2RCN A;  2UUB L;  1YJ9 A;  2WP8 J;  3CCE A;  1K9M C;  3M3Y H;  5JJI A;  2VL6 A;  3Q8D A;  4A4I A;  3CC4 A;  1VQI A;  5IYD H;  4RMF A;  3TRE A;  4QY7 A;  2KHI A;  4JI6 L;  2YV5 A;  1VQF A;  3A74 A;  4R4C A;  4JI2 Q;  4B3S L;  4BXX H;  1KXL A;  2KBN A;  3RN5 A;  4KHP L;  2Q2H A;  4LNQ A;  1VQH A;  2CWA A;  4PMW A;  2B3G A;  1IBK L;  2JK8 A;  3PV0 A;  3J81 i;  4A3K G;  1J5E Q;  3GTK H;  3PO2 G;  1I6H H;  2JA5 H;  1VQM A;  2NVQ H;  3KF6 A;  3UE0 A;  2MNA A;  2GN5 A;  5FJ8 H;  2Y0S E;  4OX9 Q;  1FVI A;  2NZH A;  2ZTE A;  3ERS X;  5IY0 A;  4A3G H;  3M9B A;  4GOP A;  4HJ7 A;  3UDX A;  4GOP C;  1X9N A;  1BKB A;  1DGS A;  1QZH A;  4IPC A;  1VQO A;  1Q86 C;  4WJ4 A;  4R4Q A;  2K75 A;  4X65 L;  4OX9 L;  1N33 Q;  4P74 A;  2JQO A;  5C0X J;  3AQQ A;  3G4S A;  3M7N A;  4A3K H;  2A8V A;  2MFI A;  2V1C C;  4JI3 L;  3PO2 H;  2L15 A;  4NPS A;  3RLO A;  3PUY A;  3AFP A;  1VS0 A;  3NEM A;  4A3E G;  1HZA A;  4AQY Q;  5IYC H;  4MZ9 A;  3PO3 G;  2AHO B;  4OWX B;  1NTG A;  1VQ4 A;  1TXY A;  2UU9 Q;  3GTG H;  4JC0 A;  5IWA L;  4JYA Q;  4X62 Q;  3NEL A;  4DK3 C;  2N3S A;  1CKO A;  2AMC B;  3CCJ A;  1HJP A;  3SGI A;  3ULP A;  1FGU A;  1SR3 A;  3RZD H;  4LF7 Q;  4AQY L;  1YBY A;  2AWN A;  2UU9 L;  4JYA L;  1VCI A;  2PI2 E;  2AKW B;  4X62 L;  2K14 A;  5AJ3 L;  3DLL A;  3CCM A;  1XMQ Q;  4B3M Q;  2VNU D;  3RNU A;  4LF7 L;  3K7U C;  2KEN A;  3KF6 B;  4KI0 A;  4OXP A;  4A3E H;  1C7Y A;  3L2P A;  1HH2 P;  2VQE Q;  4JI4 Q;  4TQU S;  2EIF A;  4UPA A;  1M1K C;  4BY7 H;  1XMQ L;  1SE8 A;  2LXJ A;  2XTI A;  5HY6 A;  1VQC A;  4DR3 L;  4A3J G;  3HOY H;  3PO3 H;  4GOP B;  4ME3 A;  1W3S A;  2YTX A;  3W5O A;  2VQE L;  1PH1 A;  3WWV A;  4JI4 L;  3HOU G;  4XIG S;  2ZJQ A;  4QJF A;  1YNX A;  5ELN A;  2E2J H;  2LSS A;  4DUZ Q;  3PSI A;  3CQZ H;  2E5L Q;  4BY1 G;  2MQH A;  4C3I H;  2MO1 A;  1EWI A;  4KHZ A;  4DUZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...