4DKAC

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
86
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 14
structure length 86
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dkaC00
4JBJA 1MJCA 2NVYH 1Z47A 4JI7L 1HNZL 1WI5A 4A3GH 3RZOH 1BBWA 5LMUL 5J3BA 3U4ZA 5H1SE 4A3GG 2KHIA 4X64Q 2OTJA 2Z0SA 2JK8A 3NENA 3B6YA 3J80i 1E7ZA 1E1OA 3W5OA 5FJ8H 5JEAG 1WCMG 5C44H 3T1HL 2V1CC 3ERSX 1GD7A 3AYHB 5AJ3Q 3G71A 2Y0SG 3F2DA 3AQQA 3PIPA 3M9BA 3S1NH 2BA0A 2AWNA 2HT1A 1HR0Q 4GOPA 5C4JH 4OX9Q 5IE8A 4LNQA 4DV5L 2UUAL 4JBWA 1G291 3RN5A 1PH9A 3U4VA 4LF5L 4IFDJ 1N32Q 4LFCL 1VQGA 4DV6L 2NN6G 1YHQA 4GS3A 4DV3L 1N34L 1PH3A 4O2DA 1YHAA 4DR3Q 2AMCB 3PUWA 2Z6KA 1OTCA 1IYJB 1OXUA 4LF9Q 4JBMA 4Y7NH 1X56A 3KFUA 1VQKA 1OXTA 2IHFA 1N33L 5JJIA 4IOAA 2VUMG 1CSPA 1QVCA 1R9TH 4B3ML 1FL0A 3I2ZA 2YV5A 5GADC 4JI6Q 4BBSH 3AEVA 3CP0A 3GTOH 2E8GA 2ZJRA 1HNWL 4HIKA 2E5LQ 5IWAL 2CQOA 3M4PA 4NXNQ 2CFMA 2A8VA 4B3SQ 4JOIA 3UDIA 3HOYH 5JEAJ 1ASZA 4IJLA 1HH2P 4R1JA 4HJ8A 3OYYA 1SMXA 3BJUA 3J80c 4HJ7A 5IYDG 3EBEA 3Q8DA 1FJGL 5C0XG 1ASYA 4R4TA 1Z9FA 5IYDH 4LF7Q 3I4MG 5IYCG 2MNAA 4IO9A 4JI5Q 1PYSB 1BKBA 3RNUA 3AFQA 4A3IH 3TREA 1OXSC 3BU2A 1PH4A 1K8GA 1UE7A 2L15A 4QIWE 4ALPA 1Y1VH 3H3VI 4PMWA 2LSSA 3GTQH 3CC7A 2F4VL 2UXDQ 4A3MG 1PH6A 4GKKL 1QZGA 5JJKA 1NE3A 4X65Q 1QVGA 1W2BA 2JA6H 4HIDA 1HZCA 1U0LA 2AHOB 4DUYQ 4DV2L 1NY4A 5FJ8G 1KIXA 3CW2C 3CCLA 3GTLH 1VS0A 4DR4Q 2VY3A 4JI1L 4A3CG 3PUZA 1N36Q 4WJ3M 2JJQA 3HKZE 4DV0Q 4QY7A 3A0JA 3OTOQ 3OW2A 2Q2HA 1KD1C 2I0QA 1QUQA 2NVTH 1KQSA 1X3GA 5AJ3L 3CC2A 3RZDH 3K8AA 3HOVH 1UE6A 1VQJA 2JA8H 3JAMc 4HIOA 4O0AA 2Y0SE 3CQZH 3G6EA 1VQMA 2OWOA 1VQNA 4DUZQ 3S1RH 1N9WA 3HOZG 1HNZQ 2AKWB 2D62A 4H02A 4POFA 1VQFA 1U5KA 3TS0A 1JB7A 3W1BA 4L5RC 1OXVA 1Q8KA 4BY7H 3J7A5 4GLVB 4UY8C 1E24A 3KJOA 2KCMA 3H0GH 2K5VA 1K9MC 2E2HH 2KHJA 4AIMA 4A4IA 4P75A 1WCMH 4P74A 2Q2IA 3FP9A 4DV1Q 2UXBL 1JJGA 3E0EA 4DPGA 2YU9H 4JI4L 3K0XA 2UXCQ 1L1OA 4HIMA 4DR7Q 4B3TL 2K75A 4UPAA 1V1QA 1VQDA 2HIVA 3W1GA 2ZTDA 4JI3Q 1KHIA 2N78A 1IBLQ 5IWAQ 2ZJPA 1YJNA 2VW9A 2R7DA 4PZ7A 1K8AC 4JG2A 1G51A 1GKHA 3I7FA 4LF6Q 1XPUA 2AWOA 4R4IA 5C3EH 2F4VQ 5ELNA 3G4SA 1LUZA 4IJHA 5IT9c 2E2JH 1KL9A 1X54A 3GO5A 2GVBA 2B63H 1C0AA 4A3DH 1WOCA 3RR5A 3BZKA 3DM3A 4C3JH 3J7ZC 5LMNL 4IFDG 2JE6I 1XNQQ 3ICEA 1S72A 4X66L 4POGA 2VQFL 4KLKA 4YWLA 5M5WH 3HOWG 3I4OA 3RLNA 3STBC 1E22A 4YHHQ 1W3SA 4AYBG 2JA5H 4BXXG 1QZHA 4GLAC 4LFCQ 4JOIC 1PH2A 1WJJA 2JQOA 3JC66 3UDGA 3F8TA 1Q1EA 5IYBG 4A3EH 4LUOA 3WWVA 1M90C 2H5XA 4L5QA 4DV7Q 4UP8A 2ZM6L 2F52A 1N33Q 1Q81C 3GTGH 1VQBA 1Q86C 1YIJA 2R93G 1I5FA 4PZ6A 4P71A 1NJIC 3A5ZB 2VZAA 3KF6A 3KJPA 1A63A 4A3FH 2NVXH 2PNHA 2KCTA 2IT1A 4P73A 1VCIA 3KDFA 1EWIA 4L5TA 1JMCA 1X3EA 2HQLA 4DR1Q 4LF5Q 4A3JH 1VQEA 1J5EL 5IY0A 4JCVE 1IL2A 4GN3B 3EIVA 3CCJA 1AH9A 5ELOA 3RN2A 1I3QH 2BA1A 1X55A 2Z6KC 1PFSA 1H95A 3CCSA 1VQ7A 4LF8Q 2PMZE 2WFWA 3HOUH 3CCMA 3E9IA 3ULJA 4AQYQ 2CWAA 1HNWQ 1G6PA 2EXDA 4A3LG 2R6GA 1CKMA 1QVFA 3F2BA 2WAQE 3K7AH 4HJAA 3E9HA 1VQIA 4X64L 3KF6B 1SROA 4LW1A 4GKKQ 4A3CH 4GNXA 4DV6Q 2UXCL 2FXQA 3L7ZC 3HOXH 4B3TQ 4YY3L 4LUZA 4JI0L 1EQQA 3F2CA 1Q46A 4IPHA 1L2FA 4MZ9A 4OX9L 1N36L 1XMOL 4XTCS 1SR3A 1RIPA 2K5NA 2UUAQ 1Q12A 1VQ5A 3HFZB 1WYDA 2NZOA 5M5XH 2K50A 4JI0Q 1XPRA 1K83H 3S15H 3M3YH 1A0IA 1L1OC 1JJ2A 3MEFA 2UUBQ 1PA6A 3STBD 2ATWA 4X65L 3J81j 1PHJA 3NBHB 1X9NA 2K5HA 5LMUQ 2PI2E 1JT8A 4DK3C 1SRUA 4JI2Q 3GTKH 2NZHA 5M3MG 1C7YA 1KXLA 4TQUS 1VQPA 2JA9A 2ZM6Q 3H0GG 4X66Q 2VQEL 2BH2A 2ZTCA 2R7ZG 4OONA 1E3PA 4B3MQ 1IBMQ 3PV0A 1A8VA 3D0FA 4C2MH 1DGSA 4C3IH 4K0KQ 4JV5L 4RMFA 1B7YB 2QEXA 1HJPA 3M4QA 3KDFB 2RHSB 4X6AH 4R4QA 1I94Q 3GD7A 4MTNA 2VL6A 5GROA 4OXPA 4QL5A 3JAMi 1TWCH 3PO2H 4KI0A 2N8NA 5IP7H 4DNIA 3CF5A 1SLJA 4A3DG 1O7IA 1UEBA 3FKIH 1AE3A 3AFPA 1CKNB 1K3RA 1MKHA 1VQCA 2N3SA 4DR5Q 5LMNW 2ALYB 1BVSA 3CCRA 1GM5A 1EFWA 2UUCL 1XNRQ 4MNOA 2I5HA 5JJLA 2PQAB 4LWCA 2LXKA 3L2PA 1VQ6A 2YTYA 4P72A 4YWKA 5HGQA 4LF6L 1T9HA 4JC0A 4DV7L 2NVQH 2UXBQ 3K7UC 1YI2A 4BA2I 1HZ9A 4B3RQ 3BZCA 5HY6A 3J81c 2HHHL 3CC4A 2JA6G 4EQ5A 4X62L 4JI7Q 4OO1G 4DR6Q 4YY3Q 1KAWA 1LYLA 4LF4Q 1XMQQ 2DGYA 1FJGQ 4JI1Q 1LM0A 3PUVA 1YHBA 3PUXA 2HHHQ 2ES2A 1Q82C 4A93H 4RG1A 1CKOA 1L0WA 2Q2UA 4A3KG 1HR0L 2JA7H 1OXXK 2YTVA 3GTJH 3PF5A 2R92G 2RCNA 2OQKA 2VS1A 2ZTEA 3HOZH 3KOJA 4XIGS 2JA7G 1EUJA 1TWFH 4BBRH 4JI8Q 4A3IG 3T1HQ 4KHPQ 4GKJL 4DV4L 3T1YQ 3PGZA 3H15A 4DV3Q 1FVIA 5IP9H 1X65A 1LTLA 4OWTB 4DR3L 1MJEA 2D0PA 3S16H 4AYBE 2KENA 3NEMA 3NELA 4GNXB 1XNQL 2ASBA 4GOPB 2WB1E 1GVPA 2CCZA 2XTIA 3HOUG 3VDYA 5K36G 3S1MH 3RLFA 3CAMA 4HJ5A 1M1KC 3TRZA 1J6QA 1MIUA 4HJ9A 1EIYB 3S2HH 5C44G 1D7QA 1EIFA 3J81i 4IPDA 2WAQG 2OQ0A 2QA4A 1IBKQ 2IX0A 3FKIG 1PH1A 3TEHB 1YJWA 1HR0W 4UP9A 2GN5A 5FLXc 2JEAI 1JJCB 4GOPC 2OTLA 1N34Q 4GNXC 4DR7L 4OWXB 1I94L 4YCUA 3CCVA 4C3HH 2A19A 1TWGH 3ZJYC 1PVOA 4KHPL 3OTOL 2MO1A 1B70B 3HOWH 4IOCA 1VQLA 4B3SL 4BXXH 2B63G 3PCOB 4A75A 1B8AA 1SN8A 1VQHA 3S1QH 4BBSG 2R7ZH 4DKAC 1YEZA 1HNXL 4BY1H 4JI2L 1K0RA 1V9PA 4YCVA 2VQEQ 1UE1A 4DUZL 1YNXA 2IHEA 1BBUA 4YCWA 4DAYB 4DUYL 1WFQA 4DV2Q 3UDXA 3CMEA 1GO3E 1KRSA 1UE5A 4PZ8A 5M3MH 4JBKA 2UUBL 3K80C 1Y14B 4Y52H 5M3FH 3CXCA 1SE8A 1IBLL 2UU9Q 3PO3G 1CUKA 1CSQA 2K52A 3HOYG 5IP7G 5M3FG 3ULLA 1FGUA 5IYCH 2C35B 3U58A 2E2IH 3UDFA 5E7NA 2YYZA 1TWHH 4A76A 4TVAB 1XMOQ 4QGUA 2I5LX 4A3JG 4NB3A 1Y1WH 4LFBQ 3I4NG 5DLQE 4DAMA 2Q2TA 3I4MH 4EX5A 1Y1WG 4A3MH 2LXJA 2VQFQ 3L0OA 4KHZA 3A74A 5FLMH 3PUYA 3DLLA 2D0OA 3I56A 3D31A 1C9OA 4DR2L 1I50H 4NPSA 3TQYA 2MO0A 4AH6A 2QGQA 4QQBX 2ZJQA 4IPGA 2JA5G 1E1TA 3CD6A 1PH5A 1HZBA 4JYAQ 1IZ6A 4JI6L 3GTMH 5BR8L 3SGIA 4GLXA 1S40A 3GTPH 1Q1BA 1L1OB 4A3EG 1TXYA 1UWVA 3HOXG 1PYBA 3CMAA 1QUQB 1K73C 1VQ8A 4JI3L 1YJ9A 2WB1G 5GAHC 4QJFA 1YVCA 4B3RL 1D8LA 4DV4Q 1X6OA 1EYGA 4L5SA 3ER0A 2ID0A 4A3FG 2NN6I 1PV4A 1PH8A 3S17H 1PH7A 1YBYA 4PG3A 4BA1I 4JI8L 2YTXA 3IRBA 3UE1A 5IP9G 3I55A 4R4OA 2E5LL 4A3BG 1IXRA 2GVAA 1HNXQ 1P8LA 3MXNB 2JEBI 4LFAQ 1P16A 4DR5L 3A5UA 2RHQB 3KF8B 2K4KA 4AQYL 4LF8L 1V43A 2UUCQ 1XNRL 1JE5A 3H3VH 3M85A 3HKSA 4FDBA 4LUVA 5C4XH 1VQ4A 4NXMQ 5IYBH 3CCQA 1CKNA 4YHHL 4BY7G 2K14A 2I5MX 2XGTA 3U50C 1J5EQ 2VUMH 3T1YL 3PF4A 1YITA 4A3LH 5GQOA 3HKZG 5GAGC 4DV5Q 2F3IA 1XJVA 4LFBL 1N32L 5C0XI 1EQRA 4DV1L 5C0XJ 4DV0L 1IBKL 2UXDL 1SFOH 3LGJA 5C3EG 4NXNL 2CWPA 3I4NH 2PI2A 3PSIA 3K81C 2IY5B 1X3FA 2B3GA 3FHWA 1KRTA 1HZAA 3S2DH 3RLOA 5GAEC 3KYHC 2HIXA 2IX1A 3PO2G 3KLWA 1XTDA 5FLMG 4DR2Q 2WP8J 2KBNA 3S14H 4LF7L 4DR1L 1N8RC 4DR6L 1I6HH 4BY1G 1Q7YC 2EIFA 4X62Q 1RL2A 2R7FA 1XMQL 3M4OH 4JI4Q 4LF4L 3M7NA 4GKJQ 3S24A 4NXML 4ME3A 3CCEA 1AE2A 5LMNQ 4IPCA 3PIOA 1IBML 1NMFA 2BH8A 4YWMA 1VQOA 1NMGA 4GN4B 4JV5Q 4K0KL 2DUDA 3TS2A 4UP7A 4A93G 2A1AA 3GDEA 2B29A 3EN2A 3CPWA 2UU9L 2VNUD 4JYAL 1YZ6A 4OWWB 4A3KH 1KC8C 3ULPA 1S3OA 3HOVG 3G48A 1A62A 2JA8G 2PQAA 3F1ZA 1VQ9A 3PO3H 2R93H 2MQHA 1TWAH 4BBRG 1XPOA 4R4CA 3CPFA 4APVA 4LFAL 1EOVA 2MFIA 5EAYA 4DK6C 4GN5A 3CCUA 4A3BH 4WJ4A 2OCEA 2N49A 3UE0A 2R92H 4OO1I 4J15A 5M5YH 4JI5L 1VQAA 2CKZB 4IFDI 4LF9L 5BR8Q 1Y1VG 5C4XG 1NTGA 2EQSA 4DR4L 1NBWA 2RF4A
chains in the Genus database with same CATH superfamily
5I9OA 1MJCA 2NVYH 4A3GH 1HNZL 1WI5A 5IODA 5J3BA 3VR2A 2OTJA 4X64Q 1DM0B 2JK8A 5E4WC 3B6YA 3SVMA 1E7ZA 3W5OA 3T1HL 3MAQA 3ERSX 1M8AA 3W2DA 3AYHB 3G71A 1SNOA 1B9NA 5KRUA 3F2DA 3AQQA 3S1NH 2HT1A 4LNQA 1PH9A 4LF5L 4IFDJ 3A8IE 2OT2A 3MC0B 2SOBA 2NN6G 4DV3L 2PO4A 2K01A 1DD2A 1NCVA 5JOBA 1UEAB 4LF9Q 4JBMA 1X56A 1VQKA 1CK1A 3KLSX 5T1GA 1BOSA 1TY2A 1S5BD 1R9TH 4B3ML 3NHHA 2YV5A 2K5WA 4BBSH 2E8GA 3M4PA 5C44B 4B3SQ 4JOIA 2N88A 1LT4D 3SK5A 4IJLA 4R1JA 3TP5A 3OYYA 3J80c 2WV6D 4HJ7A 2AUKA 1FJGL 4KKUA 4IO9A 1JR0D 1PYSB 5KYLA 1OXSC 3BU2A 1PH4A 1IW7D 4ALPA 3VR6A 4LK1C 1NR4A 3H3VI 2LSSA 1KNEA 1FGBD 2F4VL 2UXDQ 3J80E 4A3MG 4BY7B 1QZGA 5JJKA 2KCNA 4IURA 2JA6H 2AHOB 5FJ8G 1SYCA 3CW2C 3MFYA 3CCLA 2EE1A 2F0WA 1ENFA 1CA5A 1N36Q 2H4OA 2V4DA 4RH6A 5IOCA 4WRDA 4QY7A 1JWUD 3OW2A 2I0QA 1KD1C 4ULLA 3K5NA 1I4RA 1KQSA 4RAUC 5AJ3L 5FLXL 3RZDH 5C3EB 3GV6A 4O0AA 2Y0SE 1ONLA 1VF5C 3S1RH 1N9WA 4ME5A 2D62A 3FPPA 1ESRA 3HGBA 1Q8KA 4GLVB 3KJOA 3H0GH 4DU9A 4AIMA 2UXBL 1STNA 4ZAIA 1DONA 3K0XA 1I4PA 2K75A 4UPAA 1SSOA 2E2DC 4OEMB 1MGSA 2SNSA 5IWAQ 2ZJPA 4ABNA 2R7DA 4PZ7A 4CKBA 5DM63 2VW9A 1V1OA 2F0NA 1GKHA 3VA5A 2A6ED 2JA8B 1JE4A 1LUZA 4IJHA 3A56A 2N55A 3GO5A 4KJNA 3BZKA 3J7ZC 5J39A 5CV9A 1SJHD 3MZ5A 3C3LA 3RLNA 2JA5H 2HD3A 2KCCA 1WCMB 3UDGA 4XQQA 1Q1EA 4A3EH 1AW7A 4UP8A 1Z6HA 1RD9D 2PMZB 1YIJA 1I5FA 1BR9A 4PZ6A 3KF6A 4A3FH 2L11A 2IT1A 4CDEC 4G7OC 3KDFA 5DEHA 2A68C 4EVOA 5FO8B 2B63B 5JPMC 4DR1Q 1EY0A 2LS01 3T16A 4JCVE 3TP8A 1LV9A 1EZ8A 3EVQA 4RGMA 1TS2A 1X55A 2Z6KC 1EY5A 4PQXA 5M5WB 4FXDA 4LF8Q 4DGZA 5K36H 4AQYQ 3ULJA 2CWAA 2IX3A 1B50A 2XNAC 1FNWA 4A3LG 4HN7A 1STHA 3F2BA 4HMIA 3SHLA 5JAVA 2HDLA 3KF6B 4GNXA 4DV6Q 3HOXH 1J9OA 4ODGA 4B3TQ 1WTWA 3TDQA 1S4ZA 1HFNA 2B2UA 1AFPA 1SR3A 2K5NA 2UUAQ 3AB9A 1WYDA 1U4RA 3M3YH 1L1OC 2BE5C 1PA6A 2ATWA 4RGOS 3J81j 5LMUQ 4Q5VA 2RCFA 3QOLA 2EDGA 1IYVA 1SRUA 3UI2A 5IGCA 3GTKH 1B3QA 4MIUA 5M3MG 3Q24A 1C7YA 3NQTA 4TQUS 1VQPA 2JA9A 3D6WA 3H0GG 2VQEL 1E3PA 5COYA 1IBMQ 3PV0A 3K7AB 3D0FA 4L63B 4C2MH 1DGSA 4C3IH 1SE3A 2NB0A 3GD7A 3NTIA 1BCPB 5DNFA 2VL6A 5A2QE 4OXPA 2N8NA 5IP7H 1SLJA 4FYDA 3SK4A 3T51B 1EU4A 4DR5Q 3S15B 3EFXD 1VQ6A 1F2YA 1TY0A 4C1NI 2F0PA 3I4LA 3V2TA 3N52A 2UXBQ 1S5DD 2K1BA 3EQLC 1YI2A 4BA2I 1HZ9A 5EJWA 3T53B 2PZTA 4FNFA 2HHHL 3S1MB 4YY3Q 4LF4Q 2DGYA 4F87A 1LM0A 2HHHQ 1TU2B 2ES2A 3MXGA 2RSNA 1WTHA 3PO2B 2Q2UA 2SEBD 2JA7H 3PF5A 2K04A 3RD4A 3K5LA 1SDFA 1QB5D 1TWGB 1JOKA 1KDBA 4JPBW 1H9MA 1CT1D 3H15A 4DV3Q 1X65A 2D0PA 3S16H 2KENA 3BVZA 2AQ2B 2KHSA 1XNQL 2ZXRA 4DK1A 2WB1E 5K36G 3GQBA 2SNMA 3RLFA 1M1KC 2QDLA 1EIYB 2E76C 1D7QA 5FO7B 2MGSA 3AU7A 1XWEA 3ND8A 1K3BC 1PMRA 1BQQT 2AQ3B 2NUCA 1YJWA 4ZUJA 1H9JA 3VR5A 2F0UA 4GNXC 1I94L 4C3HH 5CBEE 3NTHA 4C3HG 4KHPL 3HOWH 1CI3M 1A2UA 1VQHA 4Z9CB 1FNUA 2XRSD 1I50B 1YEZA 4C1NK 4DKAC 5IT9E 5K5PA 1V9PA 4WFN3 2VQEQ 4OO1H 2IHEA 4YCWA 4DUYL 4DV2Q 3EROA 3UDXA 3E6ZX 3CMEA 1GXDC 3F2UA 3CXCA 1SE8A 2UU9Q 3PO3G 1CSQA 5IP7G 1TKWB 5ELCA 5IYCH 2E2IH 3UDFA 3O13A 4B08A 2KEEA 4DN4M 5BN5A 3TBIB 4A76A 1QNUA 5EKLA 4IUPA 4A3JG 4NB3A 1Y1WH 5ELEA 3I4NG 1Y1WG 4A3MH 2VQFQ 2BE5D 4X3TA 2KA7A 4OHJA 2R7ZB 4DR2L 3TQYA 3CD6A 1CZWA 3URYA 4JI6L 1QNKA 1S40A 5M3MB 3CKIB 1L1OB 2MP1A 1XXGA 1V1PA 4IUUA 3J80L 1QE6A 4NDXA 2F03A 4ZRZA 1JCKB 1EYCA 4QJFA 1CFMA 4KN7C 4ZQ3A 3ER0A 4A3FG 3S2DB 3I90A 3S17H 4G57A 4PG3A 1SAPA 3UE1A 5I2XA 2GVAA 3BDCA 4JW0A 2J4XA 3MXNB 4CJ1B 3QB3A 3KF8B 1PRTD 1XNRL 2IW3A 3H3VH 4FDBA 2I5MX 5CYUA 5TSSA 2WINB 3GTPB 2F0FA 4DNTB 3HKZG 5GAGC 5C0XH 4DV1L 1EQRA 4NXNL 2MHVA 1CQVA 2B3GA 1Y8OB 3PO2G 4A3BB 2EOTA 1SE2A 3I73A 1EIHA 3VYUA 2KBNA 1A6XA 3S14H 4LF7L 2GA4B 1GUSA 4X62Q 3M4OH 4YIJA 5KYIA 4NXML 5C4XB 4ME3A 1K0SA 1AE2A 4G4KA 2BH8A 2DJGC 4NKLA 4V0BA 2DUDA 3TS2A 3K0YA 2A1AA 4IUNA 2UU9L 5C5LA 3D8GA 4OWWB 2EJFC 1S3OA 1I4GA 1ILQA 3HOVG 3G48A 2R93H 1TWAH 3CPFA 4LFAL 2K32A 3CCUA 1K28A 2F0VA 2OCEA 4QCLA 4J15A 5M5YH 4JI5L 1VQAA 2CKZB 4IFDI 5KIXA 1HTPA 5BR8Q 1Y1VG 4LF9L 3IKJA 4JI7L 1U4LA 4BBSB 5LMUL 3U4ZA 1UUPA 4A3GG 2B2YA 3NENA 2PZWA 2A69C 2B2TC 2V1CC 1HRJA 1GD7A 4CGYB 3PIPA 2BA0A 1I4QA 2AWNA 4KD3A 5C4JH 3PO3B 5IE8A 1MSGA 2UUAL 4JBWA 1N32Q 2B2VC 3RMHA 1EZ6A 4LFCL 1VQGA 4Q0FA 4DK0A 1YHQA 4GS3A 5BN3A 4O2DA 2ZT9C 2OEOA 2KOLA 3PUWA 1OTCA 3GTQB 1B9MA 1QWYA 5KNCA 2VUMG 1QVCA 1EYAA 3I2ZA 4FF4A 4JI6Q 2KECA 3R8BA 3GTOH 2AUJD 1HNWL 1D2BA 2F0MA 2WKCA 2E5LQ 4CKCA 2CFMA 1FYCA 2KEDA 2WB1B 1D1IA 4ZCKA 4XYQA 1KLUD 5C0XG 1ASYA 1Z9FA 1A3TA 3PIO3 2JYOA 3GV3A 3MWYW 3RNUA 4A3IH 2HCIA 1WTQA 2A5HA 3J81E 2L15A 4EGVA 1Y1VH 4K2KA 3P1HA 1F9SA 1QVGA 2FINB 4F8MA 3GTLH 1E2ZA 3I3CA 2VY3A 2ICIA 4RCNA 2DNCA 1MBYA 1A15A 3CC2A 2JA8H 3A55A 4J6HA 1X3PA 1AZQA 1S5CD 2NWGA 3CQZH 3G6EA 1VQMA 2PW7A 1HNZQ 2AKWB 4HMJA 2M00A 1JB7A 3QOJA 4HR7B 5DAUA 3CRKC 2JA5B 1F2LA 2E2HH 2Z6BA 4K5WA 2KHJA 3OMGA 1HUNA 2YU9H 1PFMA 1L1OA 1PZID 2ZTDA 5T1IA 5C5MA 1YJNA 2QDBA 1SXTA 5JPNC 2NVTB 2TMPA 4JG2A 4A3FB 1G51A 4LF6Q 4R4IA 3HOVB 2F4VQ 5ELNA 3G4SA 2E2JH 1KL9A 1X54A 3A7LA 5DM73 4A3DH 1QCBD 4KV6A 3DM3A 3RR5A 5LMNL 5FOBB 2EVBA 3I91A 1SBBB 2JE6I 1XNQQ 3ICEA 1I3QB 2VQFL 4KLKA 4POGA 4YWLA 5M5WH 3HOWG 3I4OA 5ELFA 1E22A 4YHHQ 4AYBG 3HOUB 1F2ZA 1QZHA 4GLAC 4BWGB 4LJZC 3JC66 3F8TA 5IYBG 2H5XA 1STEA 4KTAA 4OIKA 4FO2A 2ZM6L 1Q81C 1VQBA 1Q86C 3KK7A 3NXWA 1EYDA 3A5ZB 2VZAA 1A63A 1LTBD 2MJ8A 1QILA 2FFKB 4KJOA 4L5TA 1G2TA 1LT6D 2F0EA 1J5EL 5IY0A 4C3JB 4FF1A 1H95A 5F2DA 1B3AA 2CH4A 1G6PA 3CCMA 1X32A 1HNWQ 2EXDA 1U4MA 5JVG3 5A2QL 1CKMA 2QILA 1QVFA 2KUMA 3K7AH 4A3CH 1DOLA 2EYFA 2Z9HA 2UXCL 4FF2A 2FXQA 1G6ZA 1M4VA 4LUZA 1TWCB 4JI0L 3OIPA 1GUGA 1EQQA 4IPHA 1N36L 4XTCS 4RHRA 3NPPA 2NZOA 5CMDA 3Q22A 2K50A 4JI0Q 1XPRA 1K83H 3S15H 1A0IA 2DNEA 2EZVA 1B44D 4I7AA 4DAPA 3NBHB 2K5HA 4J1MA 1K8OA 4DK3C 2EYHA 1EQTA 3Q0AA 2L4NA 4X66Q 3A54A 3H09A 1A8VA 2F1MA 2P5ZX 2Z8LA 2QEXA 5EBDA 2RHSB 2MUYA 2I07B 5GROA 3JAMi 3PO2H 3K59A 1LACA 3CF5A 4CJ2C 1UEBA 3WDNA 1CKNB 1K3RA 3IFTA 1TWFB 1GM5A 1XNRQ 1STGA 4LWCA 2LXKA 3L2PA 2NTTA 4YWKA 2RKSA 2XWBB 4QB4A 3T56B 3K7UC 4DAYA 3A7AB 4CKEA 2IJ0A 1NAPA 3CC4A 2X6GA 3QG1A 2L12A 4JI7Q 4PV1C 4DR6Q 4JI1Q 2LKVA 2K7VA 5IGFA 1YHBA 2RDHA 1ICFB 1BUVT 1YNND 4RG1A 4A3KG 1HR0L 2YTVA 4RFBA 3HOZH 2RCNA 2OQKA 3FKIB 3JAML 4XIGS 5ELDA 5I6WA 4K6LA 3U9SA 1EUJA 5EKKA 4JI8Q 1PFNA 3G7LA 1LTRD 3T1HQ 4KHPQ 4PMCA 4DF7A 3HOWB 1VF7A 3T1YQ 2Q8TA 3PGZA 1FVIA 1RDPD 1LTLA 1IL8A 1MJEA 1EEFD 2NVQB 2A6HD 1W6JA 4GNXB 2EY5A 3HOUG 3VDYA 2F0LA 2F0KA 2Q8IB 2WAQG 1HPCA 3CHBD 1WTRA 2QA4A 2K5DA 1Y8PB 2IX0A 1PTOB 1U9RA 5FLXc 2A6EC 4DR7L 5ELBA 3CCVA 5EPKA 4BBRB 1PVOA 3OTOL 2L1BA 4IOCA 1VQLA 4B3SL 4BXXH 3PCOB 5D3DA 2EJGC 2PCFB 4IFDH 1ET9A 2ZXOA 1DXMA 4BY1H 1K0RA 3D6CA 3ND9A 3NWTA 4DUZL 2F0SA 1C4QA 3TP6A 1WFQA 2Y0SB 1GO3E 5M3MH 2WIIB 5M3FH 4MTKA 5CC4A 4XQJA 5JJZA 3ULLA 1FGUA 2C35B 3ONAB 3U58A 3DM1A 5E7NA 2DN8A 3ITPA 4WORA 2B8GA 4QGUA 4LFBQ 2WACA 3NTKA 2G5DA 4H44C 4EX5A 1CQFA 2LXJA 4K6DA 1F9PA 1T5EA 3L0OA 4KHZA 3A74A 3PUYA 1I4HA 3L9AX 3BDLA 3DXJC 4NPSA 4O1NA 2QGQA 4QQBX 2ZJQA 4HCSA 1E1TA 3NBIA 1PH5A 4JYAQ 2EPBA 3GTMH 3GTPH 4ZKBB 1Q1BA 1GHJA 1PLFA 2XN9C 5I2YA 1EEID 1HHVA 1QUQB 3SK6A 5GAHC 1YJ9A 1TWHB 4F88A 3T4AC 1D8LA 1EYGA 3I4NB 2ID0A 1SNDA 3HG9A 1PH7A 3I4MB 1YBYA 4JI8L 2YTXA 4O42A 5IP9G 3I55A 4G7HC 3OHXC 4A3BG 5LHY1 2RSOA 1P8LA 5C3WA 4PNYA 3MFGA 4LF8L 3HKSA 1TS5A 5C4XH 4NXMQ 3CCQA 4BY7G 4IZ8A 4XT3B 2VUMH 3PF4A 3IL8A 1YITA 3NWSA 1TQOA 2LY7A 1A3UA 4G7ZC 1H9RA 1VMPA 1G2SA 1IYUA 3NP8A 4R8NA 5C0XJ 4DV0L 2L55A 2XWJB 1SFOH 5C3EG 2CWPA 2R93B 3LWEA 3VYSA 1TWAB 1KRTA 3RLOA 5GAEC 2IX1A 1XTDA 4DR2Q 2WP8J 1LTTD 3SR1A 1N8RC 4DR6L 1Q7YC 2EIFA 3FEWX 1RL2A 4FVMA 3M7NA 1HTLD 1XTCD 3D4WA 4GKJQ 1LTAD 5CR3A 3N6RA 1IBML 2R61A 1NMFA 4JV5Q 4K0KL 1NMGA 4GN4B 2Z4IA 1Z7TA 3M4YA 3CPWA 2VNUD 1Q90A 3KBGA 3MEHA 1I6VC 5CV7A 1DOMA 3E3XA 4A3KH 5KGUA 1UNSA 2PQAA 3F1ZA 3BG3A 1HQMC 4XXEA 2DJFC 2EY6A 1XPOA 1EOVA 4ZUIA 1JORA 2N49A 3NQIA 2L5TA 2B8FA 2B2WA 2XSCA 4IALA 1I6HB 3VYTA 5C4XG 2EQSA 1NBWA 4PMBA 3VR3A 1HXYD 1Z47A 4HSVA 1BBWA 5H1SE 2KHIA 2Z0SA 5FJ8H 5C44H 1WCMG 4EQOA 4ZLTF 5G3LD 5AJ3Q 2Y0SG 4DA2A 3LWUA 3NE5B 5CBAE 4DV5L 3U4VA 5EBCA 5ISRA 3V05A 2JXMB 4L6TB 4CDFC 4DV6L 1MD2D 1TR5A 1PH3A 1N34L 1YHAA 1Y1VB 5D14A 2AMCB 2Z6KA 1AP0A 1IYJB 1OXUA 3BVGA 1KDAA 3KFUA 1RJTA 2LFNA 3DEOA 3WOFA 1BNZA 1OXTA 2IHFA 1N33L 4IOAA 5EQ0A 1CSPA 3P75A 2NVYB 4A3GB 1FL0A 3D3RA 3RZOB 3GTLB 3CP0A 2ZJRA 2D5DA 3R2IA 5IWAL 2CQOA 4J8QA 1WD0A 4NXNQ 2A8VA 3H94A 1Q3LA 3NBHA 3UDIA 1BCPC 2EYMA 5JEAJ 1ASZA 4HJ8A 2XVSA 4N8FA 3S1NB 5L37A 2SDFA 4R4TA 4NW2A 4LF7Q 5IYDH 3I4MG 2MNAA 4JI5Q 2FJ2A 1DYQA 4IN3A 1D5XC 1BKBA 3VYRA 3DWQA 5KEEA 3TREA 2X6LA 4RWSC 5KNBA 1UE7A 3U9OA 4PMWA 1VDZA 4C56C 1PH6A 4GKKL 1NE3A 4X65Q 3H0GB 1R9TB 1W2BA 2E2HB 1HZCA 2K28A 4DUYQ 4DV2L 4DR4Q 4JI1L 4A3CG 5BN4A 3PUZA 5J22A 3HOYB 4DV0Q 3A0JA 1R4QB 4KKTA 2F0IA 2Q2HA 1YNNC 1X3GA 1ENAA 1W6KA 2A68D 3KBXA 3HOVH 1UE6A 1VQJA 1LTID 1EY8A 2L9HA 3DMUA 4HIOA 2OWOA 2E2JB 1VQNA 3HOZG 4A3DB 1F9RA 1B2TA 1IKMA 4L5RC 3QIAA 1GOZA 3J7YW 3J7A5 4H0LC 4UY8C 4R9WA 2K5VA 2JA6B 4A4IA 4P75A 1WCMH 3FP9A 1JJGA 3E0EA 4JI4L 3H6MA 4A3EB 1EQVA 3I8ZA 4HIMA 5EKIA 4B3TL 1PTOF 1V1QA 1VQDA 2HIVA 3W1GA 2M2LA 1KHIA 3IAYA 1XYIA 3J81L 1IBLQ 3X3NA 1DZ1A 4QUCA 2F0TA 3I7FA 2AWOA 1H9SB 2X69A 5IT9c 2B63H 3MVVA 2GVBA 3S1RB 4C3JH 1O7ZA 1TIID 1ZEQX 4IFDG 4XDXA 5FKAC 1S72A 2BOSA 2QW7A 3STBC 4BXXG 1W3SA 2F3VA 4LFCQ 4JOIC 1PH2A 1HFGA 5EGTA 3WWVA 4DV7Q 1SNQA 1ZKOA 3NSWA 3DWAA 1R4PB 2R93G 3SXHA 3KJPA 3DUZA 2ZXPA 2NVXH 2PNHA 4I65A 4TRDA 1CTMA 1VCIA 1EWIA 3BDOA 1JMCA 3QR8A 2O5JC 2HQLA 2NTSA 4N8X1 1IL2A 3KLRA 5A35A 4GN3B 1MI2A 2A73B 4K5VA 3CCJA 1U4PA 1AH9A 4XYOA 5ELOA 4U673 2XRQD 4DAVA 1JC7A 5KNDA 1PZJD 2EY2A 1PFSA 3CCSA 1VQ7A 2HDMA 3E9IA 3GTKB 3SDZA 2R6GA 2RBMA 1SYFA 2WAQE 1PTOD 1HCZA 1RHPA 3E9HA 1VQIA 4C3IB 3GTGB 5I9PA 3L7ZC 1I4XA 1X3QA 1Y69U 2WKDA 1DJRD 2IL8A 3D4DA 3F2CA 4OX9L 1L2FA 4MZ9A 3TZDA 2F4IA 1Q12A 1VQ5A 3HFZB 3QO2A 1C8CA 1RF2D 3HEJA 5M5XH 4RGTA 4A3JB 1PYWD 2UUBQ 3MEFA 3STBD 4X65L 3BZDB 1PHJA 1SYDA 2FMMA 1B4OA 2PI2E 4JI2Q 2JSOA 1KXLA 4CJ0B 2ZM6Q 2R7ZG 2RDFA 2ZTCA 4JK1C 2Z4HA 1PDQA 4K8IA 4K0KQ 4JV5L 1JOQA 1O80A 1B7YB 1HJPA 4KD4A 5E4XA 2EYPA 1I94Q 1KABA 1EIGA 4QL5A 4DNIA 3OSOA 3HOZB 4A3DG 3FKIH 5I4DA 1RCVD 4X3KA 1EFID 2N3SA 1MKHA 4ILWA 5LMNW 2L0CA 3CCRA 1WTXA 4MNOA 4E6IA 1NR2A 2YTYA 4KY5A 4P72A 5HGQA 4KY6A 4U68A 4LF6L 3S16B 1RTNA 4B3RQ 5IIFA 3BZCA 5HY6A 3K57A 2O4XA 3S9WA 3HKZB 4ZKCB 1G8ZD 3IFDA 2JA6G 4EQ5A 4X62L 3TN2A 3C1FA 4RA8A 1LYLA 4C2MB 1YNJD 3PUVA 3FDTA 4EQNA 3WOEA 1PTOH 4K8JA 2B2TA 1OXXK 3GTJH 1LO5D 2ZTEA 2G9DA 2HQEA 1II3A 4EQPA 4WJWA 4BBRH 1LTGD 4A3IG 2O2LD 4GKJL 1LT5D 4DV4L 2QF7A 5IP9H 4OWTB 4ZK9B 3E5SA 4AYBE 2DY7A 1KDCA 2ASBA 4GOPB 2CCZA 1Y8NB 1E0BA 3KF8A 3TRZA 1J6QA 3S2HH 5IGEA 3FPUB 4GZYC 4X3SA 5JEAH 3J81i 4HSPA 1DOKA 4A93B 2E2IB 2RVLA 3FKIG 3KUPA 1HR0W 1BF4A 5G3LF 2JA7B 1JJCB 3GP7A 1N34Q 5E1FA 4YCUA 3DHQA 1TWGH 1T5XD 3D4RA 2MO1A 1SEBD 3QWNA 3BYTB 2B63G 4A75A 1B8AA 4H13C 3S1QH 4BBSG 1GUWA 2R7ZH 1HNXL 4JI2L 2JP1A 4YCVA 1WTOA 1UE1A 1S5ED 1ZXTA 2O5IC 4JBKA 1UE5A 4PZ8A 2A69D 1D5ZC 2K52A 2OXPA 5M3FG 3TP7A 4TKOB 3TSSA 2VXWA 4TVAB 5C6AA 3MXPA 1QOHA 5DLQE 1O7LA 4N9TA 4DAMA 2Q2TA 3I70A 1B53A 1C48A 1HA6A 3DLLA 1E2VA 3D31A 1C9OA 1RODA 1EY7A 1I50H 2E75C 2MO0A 4AH6A 3K5OA 4IPGA 5C4HA 2JA5G 2Q8RE 3H91A 2HCCA 4QIWB 1HZBA 1IZ6A 3K58A 2VUMB 4RGNA 1UWVA 1PXUA 1YNJC 3BVMA 4KKSA 3FVQA 1FD7D 1NNXA 1K73C 4K14A 1VQ8A 2QKIC 1SFOB 2WB1G 4V190 1JOOA 1YVCA 3C2PA 1SNMA 1X6OA 4L5SA 3MA2B 2NN6I 3A8JE 1ZYRD 2QCPX 4LAAA 1S5FD 2CW0D 3IRBA 4R4OA 5C3XA 2CQAA 1SNCA 2NN6H 1BCPF 1P16A 5C4ZA 2RHQB 1V43A 2UUCQ 4Y52H 4LUVA 5IYBH 4B9XA 1SMYD 3U50C 3T1YL 1OO9B 2I46A 2F3IA 4LFBL 2B2VA 1N32L 5C0XI 5IGBA 1V1PB 2UXDL 3LGJA 4QMGA 2PI2A 2IY5B 2CVRA 3PQIA 3SEBA 3FHWA 3S2DH 2HIXA 3S17B 2KVMA 3PMFA 3I72A 3BYYB 3HZXA 5FLMG 5M5YB 3LX0A 4DR1L 3P20A 1I6HH 3NUCA 1A3VA 2R7FA 4JI4Q 4LF4L 1KTKA 1D6EC 2F0QA 5LMNQ 1SYBA 1XX8A 4IPCA 3PIOA 4YWMA 1VQOA 4UP7A 3OMCA 4A93G 2B29A 3EN2A 2H1EA 1EY6A 1YZ6A 4IQZA 4KHVA 5C4JB 3PO3H 1VQ9A 1ZYRC 2MQHA 2MPMA 1QJOA 2M9VA 4APVA 5EAYA 3UE0A 1E2WA 2R92H 5EPJA 4OO1I 3S14B 1L0XB 4CHTB 2KQ3A 4AYBB 3AMUA 1D5MC 3M4OB 2RF4A 4JBJA 1SNPA 2F0OA 2C9OA 3E0JA 1FNVA 4CDCC 3RZOH 1K8MA 1JWMD 3GTOB 4IUTA 3J80i 3H3VC 4DXGA 1E1OA 5JEAG 1ET6A 2EY1A 3OIQA 3TMEA 4FXKC 5I6YA 3M9BA 4FXGC 1HR0Q 4GOPA 4OX9Q 1G291 3RN5A 4A3IB 5CGKA 2XIWA 4DNRB 1F77A 4DR3Q 1KNAA 1PFBA 4Y7NH 5JJIA 4IUQA 1IKLA 1EY9A 2DY8A 5GADC 1SMYC 3OW7A 3AEVA 1PTOC 1BCPD 4HIKA 1PRTB 2BDNA 3ZYYX 3C1EA 3HOYH 3J7AF 4KK7A 5CV8A 1HH2P 2F3WA 1SMXA 3BJUA 1L0YB 1WTVA 5IYDG 3EBEA 3Q8DA 5HURA 4NP5A 4OL7A 3V96A 5IYCG 3AFQA 1K8GA 4QIWE 5IGDA 4OGQC 1LABA 4ZYSA 3GTQH 3CC7A 3HP3A 5E3FA 1AZPA 5M9OA 1BBXC 4HIDA 1U0LA 1NY4A 1Q8IA 1KIXA 1VS0A 2B2UC 4TSSA 1PZKD 1QG7A 2YU9B 2NZ1D 1UAPA 4JVZA 4WJ3M 2JJQA 3HKZE 3OTOQ 2NVTH 1QUQA 5EPLA 3K8AA 4M1UB 3JAMc 1G91A 4BS9A 1H9SA 4DUZQ 4P2CB 2PYKA 4H02A 4POFA 1VQFA 1U5KA 3TS0A 3W1BA 1RKNA 1OXVA 4BY7H 1AN8A 4NMZA 1E24A 2KCMA 4FP5D 5NUCA 1K9MC 1J8IA 4P74A 2Q2IA 4DV1Q 4DPGA 5FLXE 2UXCQ 4DR7Q 1CM9A 5D65A 4JI3Q 2N78A 4HAEA 4N9PA 4XT1B 1F9QA 2JN4A 1K8AC 4XQNA 2NVXB 3RZDB 1XPUA 4HEDA 2BDOA 2B2WC 3DEPA 5C3EH 3LNNA 1HA5A 3CQZB 1C0AA 1O7YA 4CBVA 1WOCA 2VB2X 3T13A 4CDDC 1ESFA 1HQRD 4M8AA 4X66L 3R2TA 2EJMA 1BXTA 2QEJC 1WJJA 2JQOA 2A74C 1JQYD 4UAIA 4LUOA 4UDUC 2WAQB 1M90C 2BCOA 4L5QA 4HCEA 2J0TD 3GTGH 2F52A 1N33Q 1TT2A 4P71A 1NJIC 2KCTA 5HGTA 4P73A 2RQXA 3HS0C 2EYJA 1X3EA 2CW0C 5M5XB 4LF5Q 4A3JH 1VQEA 1K83B 3HRZC 2EYOA 2AQ1B 3EIVA 3NK9A 3RN2A 3OOCA 1SE4A 1I3QH 2BA1A 4UHVA 1WTPA 1WD1A 2PMZE 2WFWA 3HOUH 1DCZA 4DXFA 2FHTA 3TZUA 4HJAA 5FK9C 1EY4A 1NUCA 3VA7A 4X64L 4LW1A 1SROA 4GKKQ 4ID6A 4YY3L 1STYA 2K6AA 3FRPB 1Q46A 3MTSA 1B1ZA 1XMOL 3OWEB 1RIPA 1D1KA 1JWSD 3R3OA 1JJ2A 2A6HC 1PRTC 4DFAA 1X9NA 1JT8A 2NZHA 1WVLA 1ENCA 2BH2A 1TS4A 4OONA 4B3MQ 2K5QA 5LL6X 2K33A 3BS1A 2ENBA 4RMFA 3M4QA 1KLGD 2ICEC 2Z1CA 1EOTA 3KDFB 4X6AH 4R4QA 3HOXB 4MTNA 2OF1A 3J7AV 1TWCH 4KI0A 1SYEA 3EJIA 2D9UA 3GTJB 1KAAA 1NSNS 2J7ZA 1O7IA 1AE3A 3AFPA 1VQCA 2ALYB 4S3SA 1BVSA 1EFWA 2UUCL 5JJLA 2I5HA 3M3YB 2PQAB 3Q6SA 1SJED 1CA6A 2CH4W 1T9HA 4JC0A 4DV7L 2NVQH 4MHEA 3K5MA 4I7ZC 2R3ZA 3L3OC 3J81c 3P7JA 4H7BA 1EU3A 5CV4A 4OO1G 5IGGA 1BDOA 1KAWA 3S2HB 1XMQQ 1FJGQ 3PUXA 1LLRD 2PNRC 2F0GA 1O78A 2K05A 1Q82C 4A93H 2D2CC 1CKOA 2F0DA 2IPKD 1L0WA 5JVH3 4K5XA 4B9WA 2R92G 3CU7A 1CHPD 2VS1A 2KJXA 3KOJA 2JA7G 3CRLC 1TWFH 3SK8A 2LMCB 4X3UA 4R8IA 4DR3L 3S1QB 1LTSD 2PPBC 1BO0A 4BY1B 3JAME 3NEMA 3NELA 1GVPA 3MXNA 2XTIA 3S1MH 3OWFA 1VMCA 3CAMA 4L8JA 4HJ5A 1MIUA 4HJ9A 5C44G 2HUGA 1EIFA 4IPDA 2OQ0A 4QF4A 1IBKQ 1A2TA 4K2LA 1PH1A 3TEHB 4UP9A 2GN5A 1GUTA 2JEAI 4GOPC 2OTLA 4OWXB 2A19A 3ZJYC 5LL6S 1V8QA 1CHQD 1B70B 1FR3A 1CZGA 1HUMA 2C5CA 1SN8A 1STAA 2PZUA 4C3JG 2NYZD 1ILPA 1YNXA 1BBUA 4QUFA 1ML0D 4DAYB 3GTMB 1GUOA 1KRSA 1TS3A 2UUBL 3K80C 1Y14B 1IBLL 1STBA 1CUKA 3HOYG 1IHZA 3Q23A 2YYZA 1TWHH 2TSSA 1XMOQ 2I5LX 4FF3A 2E74C 5IT9L 2EYLA 4C3HB 3I4MH 2VB3X 1EL0A 3PIP3 5CV6A 5FLMH 3EA6A 2D0OA 3I56A 3X3MA 3QJYA 2RDGA 1H9KA 1GJXA 4RCOA 1MHWC 3VR4A 5BR8L 3SGIA 4GLXA 4A3EG 1TXYA 4MN3A 5J1ZA 1PYBA 3HOXG 5M3FB 1GUNA 5CV5A 4KMUC 1EWCA 3CMAA 4JI3L 4B3RL 4DV4Q 2B2YC 1PRTF 3W3AA 4KN4C 1Y1WB 1PV4A 1PH8A 4BA1I 2IWHA 2PQEA 4A3MB 2E5LL 1AEXA 1IXRA 3G6JB 1HNXQ 1GHKA 3OPOA 2JEBI 4LFAQ 4DR5L 4AQYL 3A5UA 2K4KA 3FMCA 4OELB 1JE5A 3M85A 2F0JA 3MHBA 1VQ4A 4RKLA 1CKNA 4YHHL 2K14A 2XGTA 3DWPA 1J5EQ 2F0HA 4A3LH 2NBFA 4F7XA 5GQOA 4OIJA 1EWHA 4DV5Q 1XJVA 1JICA 4A3KB 1IBKL 4IUVA 4RHSA 2G9HD 3PSIA 3K81C 3I4NH 1X3FA 1HZAA 3R93A 3KYHC 5D3IB 4KY7A 1F2MA 3KLWA 4LMQD 1LT3D 3MXUA 2R92B 1JB3A 1MSHA 5AFWA 4BY1G 5CORA 3RUZA 1XMQL 1ICWA 3S24A 3CCEA 2FMCA 3ERQA 3K6OA 2CHBD 3GDEA 4HTHA 4JYAL 2EXZA 1KC8C 3ULPA 4C3IG 4RKBA 1TVXA 1A62A 1SYGA 1RTOA 2B39A 2JA8G 3SE0A 4BBRG 4R4CA 3A8KE 2MFIA 4DK6C 4GN5A 4A3BH 4WJ4A 5FO9B 3M7GA 2PW5A 3KLSA 2RA4A 2K03A 1IW7C 4Y7NB 3C46A 1NTGA 4DR4L
chains in the Genus database with same CATH topology
4JBJA 1MJCA 2NVYH 1Z47A 4JI7L 1HNZL 1WI5A 4A3GH 3RZOH 1BBWA 5LMUL 5J3BA 3U4ZA 5H1SE 4A3GG 2KHIA 4X64Q 2OTJA 2Z0SA 2JK8A 3NENA 3B6YA 3J80i 1E7ZA 1E1OA 3W5OA 5FJ8H 5JEAG 1WCMG 5C44H 3T1HL 2V1CC 3ERSX 1GD7A 3AYHB 5AJ3Q 3G71A 2Y0SG 3F2DA 3AQQA 3PIPA 3M9BA 3S1NH 2BA0A 2AWNA 2HT1A 1HR0Q 4GOPA 5C4JH 4OX9Q 5IE8A 4LNQA 4DV5L 2UUAL 4JBWA 1G291 3RN5A 1PH9A 3U4VA 4LF5L 4IFDJ 1N32Q 4LFCL 1VQGA 4DV6L 2NN6G 1YHQA 4GS3A 4DV3L 1N34L 1PH3A 4O2DA 1YHAA 4DR3Q 2AMCB 3PUWA 2Z6KA 1OTCA 1IYJB 1OXUA 4LF9Q 4JBMA 4Y7NH 1X56A 3KFUA 1VQKA 1OXTA 2IHFA 1N33L 5JJIA 4IOAA 2VUMG 1CSPA 1QVCA 1R9TH 4B3ML 1FL0A 3I2ZA 2YV5A 5GADC 4JI6Q 4BBSH 3AEVA 3CP0A 3GTOH 2E8GA 2ZJRA 1HNWL 4HIKA 2E5LQ 5IWAL 2CQOA 3M4PA 4NXNQ 2CFMA 2A8VA 4B3SQ 4JOIA 3UDIA 3HOYH 5JEAJ 1ASZA 4IJLA 1HH2P 4R1JA 4HJ8A 3OYYA 1SMXA 3BJUA 3J80c 4HJ7A 5IYDG 3EBEA 3Q8DA 1FJGL 5C0XG 1ASYA 4R4TA 1Z9FA 5IYDH 4LF7Q 3I4MG 5IYCG 2MNAA 4IO9A 4JI5Q 1PYSB 1BKBA 3RNUA 3AFQA 4A3IH 3TREA 1OXSC 3BU2A 1PH4A 1K8GA 1UE7A 2L15A 4QIWE 4ALPA 1Y1VH 3H3VI 4PMWA 2LSSA 3GTQH 3CC7A 2F4VL 2UXDQ 4A3MG 1PH6A 4GKKL 1QZGA 5JJKA 1NE3A 4X65Q 1QVGA 1W2BA 2JA6H 4HIDA 1HZCA 1U0LA 2AHOB 4DUYQ 4DV2L 1NY4A 5FJ8G 1KIXA 3CW2C 3CCLA 3GTLH 1VS0A 4DR4Q 2VY3A 4JI1L 4A3CG 3PUZA 1N36Q 4WJ3M 2JJQA 3HKZE 4DV0Q 4QY7A 3A0JA 3OTOQ 3OW2A 2Q2HA 1KD1C 2I0QA 1QUQA 2NVTH 1KQSA 1X3GA 5AJ3L 3CC2A 3RZDH 3K8AA 3HOVH 1UE6A 1VQJA 2JA8H 3JAMc 4HIOA 4O0AA 2Y0SE 3CQZH 3G6EA 1VQMA 2OWOA 1VQNA 4DUZQ 3S1RH 1N9WA 3HOZG 1HNZQ 2AKWB 2D62A 4H02A 4POFA 1VQFA 1U5KA 3TS0A 1JB7A 3W1BA 4L5RC 1OXVA 1Q8KA 4BY7H 3J7A5 4GLVB 4UY8C 1E24A 3KJOA 2KCMA 3H0GH 2K5VA 1K9MC 2E2HH 2KHJA 4AIMA 4A4IA 4P75A 1WCMH 4P74A 2Q2IA 3FP9A 4DV1Q 2UXBL 1JJGA 3E0EA 4DPGA 2YU9H 4JI4L 3K0XA 2UXCQ 1L1OA 4HIMA 4DR7Q 4B3TL 2K75A 4UPAA 1V1QA 1VQDA 2HIVA 3W1GA 2ZTDA 4JI3Q 1KHIA 2N78A 1IBLQ 5IWAQ 2ZJPA 1YJNA 2VW9A 2R7DA 4PZ7A 1K8AC 4JG2A 1G51A 1GKHA 3I7FA 4LF6Q 1XPUA 2AWOA 4R4IA 5C3EH 2F4VQ 5ELNA 3G4SA 1LUZA 4IJHA 5IT9c 2E2JH 1KL9A 1X54A 3GO5A 2GVBA 2B63H 1C0AA 4A3DH 1WOCA 3RR5A 3BZKA 3DM3A 4C3JH 3J7ZC 5LMNL 4IFDG 2JE6I 1XNQQ 3ICEA 1S72A 4X66L 4POGA 2VQFL 4KLKA 4YWLA 5M5WH 3HOWG 3I4OA 3RLNA 3STBC 1E22A 4YHHQ 1W3SA 4AYBG 2JA5H 4BXXG 1QZHA 4GLAC 4LFCQ 4JOIC 1PH2A 1WJJA 2JQOA 3JC66 3UDGA 3F8TA 1Q1EA 5IYBG 4A3EH 4LUOA 3WWVA 1M90C 2H5XA 4L5QA 4DV7Q 4UP8A 2ZM6L 2F52A 1N33Q 1Q81C 3GTGH 1VQBA 1Q86C 1YIJA 2R93G 1I5FA 4PZ6A 4P71A 1NJIC 3A5ZB 2VZAA 3KF6A 3KJPA 1A63A 4A3FH 2NVXH 2PNHA 2KCTA 2IT1A 4P73A 1VCIA 3KDFA 1EWIA 4L5TA 1JMCA 1X3EA 2HQLA 4DR1Q 4LF5Q 4A3JH 1VQEA 1J5EL 5IY0A 4JCVE 1IL2A 4GN3B 3EIVA 3CCJA 1AH9A 5ELOA 3RN2A 1I3QH 2BA1A 1X55A 2Z6KC 1PFSA 1H95A 3CCSA 1VQ7A 4LF8Q 2PMZE 2WFWA 3HOUH 3CCMA 3E9IA 3ULJA 4AQYQ 2CWAA 1HNWQ 1G6PA 2EXDA 4A3LG 2R6GA 1CKMA 1QVFA 3F2BA 2WAQE 3K7AH 4HJAA 3E9HA 1VQIA 4X64L 3KF6B 1SROA 4LW1A 4GKKQ 4A3CH 4GNXA 4DV6Q 2UXCL 2FXQA 3L7ZC 3HOXH 4B3TQ 4YY3L 4LUZA 4JI0L 1EQQA 3F2CA 1Q46A 4IPHA 1L2FA 4MZ9A 4OX9L 1N36L 1XMOL 4XTCS 1SR3A 1RIPA 2K5NA 2UUAQ 1Q12A 1VQ5A 3HFZB 1WYDA 2NZOA 5M5XH 2K50A 4JI0Q 1XPRA 1K83H 3S15H 3M3YH 1A0IA 1L1OC 1JJ2A 3MEFA 2UUBQ 1PA6A 3STBD 2ATWA 4X65L 3J81j 1PHJA 3NBHB 1X9NA 2K5HA 5LMUQ 2PI2E 1JT8A 4DK3C 1SRUA 4JI2Q 3GTKH 2NZHA 5M3MG 1C7YA 1KXLA 4TQUS 1VQPA 2JA9A 2ZM6Q 3H0GG 4X66Q 2VQEL 2BH2A 2ZTCA 2R7ZG 4OONA 1E3PA 4B3MQ 1IBMQ 3PV0A 1A8VA 3D0FA 4C2MH 1DGSA 4C3IH 4K0KQ 4JV5L 4RMFA 1B7YB 2QEXA 1HJPA 3M4QA 3KDFB 2RHSB 4X6AH 4R4QA 1I94Q 3GD7A 4MTNA 2VL6A 5GROA 4OXPA 4QL5A 3JAMi 1TWCH 3PO2H 4KI0A 2N8NA 5IP7H 4DNIA 3CF5A 1SLJA 4A3DG 1O7IA 1UEBA 3FKIH 1AE3A 3AFPA 1CKNB 1K3RA 1MKHA 1VQCA 2N3SA 4DR5Q 5LMNW 2ALYB 1BVSA 3CCRA 1GM5A 1EFWA 2UUCL 1XNRQ 4MNOA 2I5HA 5JJLA 2PQAB 4LWCA 2LXKA 3L2PA 1VQ6A 2YTYA 4P72A 4YWKA 5HGQA 4LF6L 1T9HA 4JC0A 4DV7L 2NVQH 2UXBQ 3K7UC 1YI2A 4BA2I 1HZ9A 4B3RQ 3BZCA 5HY6A 3J81c 2HHHL 3CC4A 2JA6G 4EQ5A 4X62L 4JI7Q 4OO1G 4DR6Q 4YY3Q 1KAWA 1LYLA 4LF4Q 1XMQQ 2DGYA 1FJGQ 4JI1Q 1LM0A 3PUVA 1YHBA 3PUXA 2HHHQ 2ES2A 1Q82C 4A93H 4RG1A 1CKOA 1L0WA 2Q2UA 4A3KG 1HR0L 2JA7H 1OXXK 2YTVA 3GTJH 3PF5A 2R92G 2RCNA 2OQKA 2VS1A 2ZTEA 3HOZH 3KOJA 4XIGS 2JA7G 1EUJA 1TWFH 4BBRH 4JI8Q 4A3IG 3T1HQ 4KHPQ 4GKJL 4DV4L 3T1YQ 3PGZA 3H15A 4DV3Q 1FVIA 5IP9H 1X65A 1LTLA 4OWTB 4DR3L 1MJEA 2D0PA 3S16H 4AYBE 2KENA 3NEMA 3NELA 4GNXB 1XNQL 2ASBA 4GOPB 2WB1E 1GVPA 2CCZA 2XTIA 3HOUG 3VDYA 5K36G 3S1MH 3RLFA 3CAMA 4HJ5A 1M1KC 3TRZA 1J6QA 1MIUA 4HJ9A 1EIYB 3S2HH 5C44G 1D7QA 1EIFA 3J81i 4IPDA 2WAQG 2OQ0A 2QA4A 1IBKQ 2IX0A 3FKIG 1PH1A 3TEHB 1YJWA 1HR0W 4UP9A 2GN5A 5FLXc 2JEAI 1JJCB 4GOPC 2OTLA 1N34Q 4GNXC 4DR7L 4OWXB 1I94L 4YCUA 3CCVA 4C3HH 2A19A 1TWGH 3ZJYC 1PVOA 4KHPL 3OTOL 2MO1A 1B70B 3HOWH 4IOCA 1VQLA 4B3SL 4BXXH 2B63G 3PCOB 4A75A 1B8AA 1SN8A 1VQHA 3S1QH 4BBSG 2R7ZH 4DKAC 1YEZA 1HNXL 4BY1H 4JI2L 1K0RA 1V9PA 4YCVA 2VQEQ 1UE1A 4DUZL 1YNXA 2IHEA 1BBUA 4YCWA 4DAYB 4DUYL 1WFQA 4DV2Q 3UDXA 3CMEA 1GO3E 1KRSA 1UE5A 4PZ8A 5M3MH 4JBKA 2UUBL 3K80C 1Y14B 4Y52H 5M3FH 3CXCA 1SE8A 1IBLL 2UU9Q 3PO3G 1CUKA 1CSQA 2K52A 3HOYG 5IP7G 5M3FG 3ULLA 1FGUA 5IYCH 2C35B 3U58A 2E2IH 3UDFA 5E7NA 2YYZA 1TWHH 4A76A 4TVAB 1XMOQ 4QGUA 2I5LX 4A3JG 4NB3A 1Y1WH 4LFBQ 3I4NG 5DLQE 4DAMA 2Q2TA 3I4MH 4EX5A 1Y1WG 4A3MH 2LXJA 2VQFQ 3L0OA 4KHZA 3A74A 5FLMH 3PUYA 3DLLA 2D0OA 3I56A 3D31A 1C9OA 4DR2L 1I50H 4NPSA 3TQYA 2MO0A 4AH6A 2QGQA 4QQBX 2ZJQA 4IPGA 2JA5G 1E1TA 3CD6A 1PH5A 1HZBA 4JYAQ 1IZ6A 4JI6L 3GTMH 5BR8L 3SGIA 4GLXA 1S40A 3GTPH 1Q1BA 1L1OB 4A3EG 1TXYA 1UWVA 3HOXG 1PYBA 3CMAA 1QUQB 1K73C 1VQ8A 4JI3L 1YJ9A 2WB1G 5GAHC 4QJFA 1YVCA 4B3RL 1D8LA 4DV4Q 1X6OA 1EYGA 4L5SA 3ER0A 2ID0A 4A3FG 2NN6I 1PV4A 1PH8A 3S17H 1PH7A 1YBYA 4PG3A 4BA1I 4JI8L 2YTXA 3IRBA 3UE1A 5IP9G 3I55A 4R4OA 2E5LL 4A3BG 1IXRA 2GVAA 1HNXQ 1P8LA 3MXNB 2JEBI 4LFAQ 1P16A 4DR5L 3A5UA 2RHQB 3KF8B 2K4KA 4AQYL 4LF8L 1V43A 2UUCQ 1XNRL 1JE5A 3H3VH 3M85A 3HKSA 4FDBA 4LUVA 5C4XH 1VQ4A 4NXMQ 5IYBH 3CCQA 1CKNA 4YHHL 4BY7G 2K14A 2I5MX 2XGTA 3U50C 1J5EQ 2VUMH 3T1YL 3PF4A 1YITA 4A3LH 5GQOA 3HKZG 5GAGC 4DV5Q 2F3IA 1XJVA 4LFBL 1N32L 5C0XI 1EQRA 4DV1L 5C0XJ 4DV0L 1IBKL 2UXDL 1SFOH 3LGJA 5C3EG 4NXNL 2CWPA 3I4NH 2PI2A 3PSIA 3K81C 2IY5B 1X3FA 2B3GA 3FHWA 1KRTA 1HZAA 3S2DH 3RLOA 5GAEC 3KYHC 2HIXA 2IX1A 3PO2G 3KLWA 1XTDA 5FLMG 4DR2Q 2WP8J 2KBNA 3S14H 4LF7L 4DR1L 1N8RC 4DR6L 1I6HH 4BY1G 1Q7YC 2EIFA 4X62Q 1RL2A 2R7FA 1XMQL 3M4OH 4JI4Q 4LF4L 3M7NA 4GKJQ 3S24A 4NXML 4ME3A 3CCEA 1AE2A 5LMNQ 4IPCA 3PIOA 1IBML 1NMFA 2BH8A 4YWMA 1VQOA 1NMGA 4GN4B 4JV5Q 4K0KL 2DUDA 3TS2A 4UP7A 4A93G 2A1AA 3GDEA 2B29A 3EN2A 3CPWA 2UU9L 2VNUD 4JYAL 1YZ6A 4OWWB 4A3KH 1KC8C 3ULPA 1S3OA 3HOVG 3G48A 1A62A 2JA8G 2PQAA 3F1ZA 1VQ9A 3PO3H 2R93H 2MQHA 1TWAH 4BBRG 1XPOA 4R4CA 3CPFA 4APVA 4LFAL 1EOVA 2MFIA 5EAYA 4DK6C 4GN5A 3CCUA 4A3BH 4WJ4A 2OCEA 2N49A 3UE0A 2R92H 4OO1I 4J15A 5M5YH 4JI5L 1VQAA 2CKZB 4IFDI 4LF9L 5BR8Q 1Y1VG 5C4XG 1NTGA 2EQSA 4DR4L 1NBWA 2RF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBJ A;  1MJC A;  2NVY H;  1Z47 A;  4JI7 L;  1HNZ L;  1WI5 A;  4A3G H;  3RZO H;  1BBW A;  5LMU L;  5J3B A;  3U4Z A;  5H1S E;  4A3G G;  2KHI A;  4X64 Q;  2OTJ A;  2Z0S A;  2JK8 A;  3NEN A;  3B6Y A;  3J80 i;  1E7Z A;  1E1O A;  3W5O A;  5FJ8 H;  5JEA G;  1WCM G;  5C44 H;  3T1H L;  2V1C C;  3ERS X;  1GD7 A;  3AYH B;  5AJ3 Q;  3G71 A;  2Y0S G;  3F2D A;  3AQQ A;  3PIP A;  3M9B A;  3S1N H;  2BA0 A;  2AWN A;  2HT1 A;  1HR0 Q;  4GOP A;  5C4J H;  4OX9 Q;  5IE8 A;  4LNQ A;  4DV5 L;  2UUA L;  4JBW A;  1G29 1;  3RN5 A;  1PH9 A;  3U4V A;  4LF5 L;  4IFD J;  1N32 Q;  4LFC L;  1VQG A;  4DV6 L;  2NN6 G;  1YHQ A;  4GS3 A;  4DV3 L;  1N34 L;  1PH3 A;  4O2D A;  1YHA A;  4DR3 Q;  2AMC B;  3PUW A;  2Z6K A;  1OTC A;  1IYJ B;  1OXU A;  4LF9 Q;  4JBM A;  4Y7N H;  1X56 A;  3KFU A;  1VQK A;  1OXT A;  2IHF A;  1N33 L;  5JJI A;  4IOA A;  2VUM G;  1CSP A;  1QVC A;  1R9T H;  4B3M L;  1FL0 A;  3I2Z A;  2YV5 A;  5GAD C;  4JI6 Q;  4BBS H;  3AEV A;  3CP0 A;  3GTO H;  2E8G A;  2ZJR A;  1HNW L;  4HIK A;  2E5L Q;  5IWA L;  2CQO A;  3M4P A;  4NXN Q;  2CFM A;  2A8V A;  4B3S Q;  4JOI A;  3UDI A;  3HOY H;  5JEA J;  1ASZ A;  4IJL A;  1HH2 P;  4R1J A;  4HJ8 A;  3OYY A;  1SMX A;  3BJU A;  3J80 c;  4HJ7 A;  5IYD G;  3EBE A;  3Q8D A;  1FJG L;  5C0X G;  1ASY A;  4R4T A;  1Z9F A;  5IYD H;  4LF7 Q;  3I4M G;  5IYC G;  2MNA A;  4IO9 A;  4JI5 Q;  1PYS B;  1BKB A;  3RNU A;  3AFQ A;  4A3I H;  3TRE A;  1OXS C;  3BU2 A;  1PH4 A;  1K8G A;  1UE7 A;  2L15 A;  4QIW E;  4ALP A;  1Y1V H;  3H3V I;  4PMW A;  2LSS A;  3GTQ H;  3CC7 A;  2F4V L;  2UXD Q;  4A3M G;  1PH6 A;  4GKK L;  1QZG A;  5JJK A;  1NE3 A;  4X65 Q;  1QVG A;  1W2B A;  2JA6 H;  4HID A;  1HZC A;  1U0L A;  2AHO B;  4DUY Q;  4DV2 L;  1NY4 A;  5FJ8 G;  1KIX A;  3CW2 C;  3CCL A;  3GTL H;  1VS0 A;  4DR4 Q;  2VY3 A;  4JI1 L;  4A3C G;  3PUZ A;  1N36 Q;  4WJ3 M;  2JJQ A;  3HKZ E;  4DV0 Q;  4QY7 A;  3A0J A;  3OTO Q;  3OW2 A;  2Q2H A;  1KD1 C;  2I0Q A;  1QUQ A;  2NVT H;  1KQS A;  1X3G A;  5AJ3 L;  3CC2 A;  3RZD H;  3K8A A;  3HOV H;  1UE6 A;  1VQJ A;  2JA8 H;  3JAM c;  4HIO A;  4O0A A;  2Y0S E;  3CQZ H;  3G6E A;  1VQM A;  2OWO A;  1VQN A;  4DUZ Q;  3S1R H;  1N9W A;  3HOZ G;  1HNZ Q;  2AKW B;  2D62 A;  4H02 A;  4POF A;  1VQF A;  1U5K A;  3TS0 A;  1JB7 A;  3W1B A;  4L5R C;  1OXV A;  1Q8K A;  4BY7 H;  3J7A 5;  4GLV B;  4UY8 C;  1E24 A;  3KJO A;  2KCM A;  3H0G H;  2K5V A;  1K9M C;  2E2H H;  2KHJ A;  4AIM A;  4A4I A;  4P75 A;  1WCM H;  4P74 A;  2Q2I A;  3FP9 A;  4DV1 Q;  2UXB L;  1JJG A;  3E0E A;  4DPG A;  2YU9 H;  4JI4 L;  3K0X A;  2UXC Q;  1L1O A;  4HIM A;  4DR7 Q;  4B3T L;  2K75 A;  4UPA A;  1V1Q A;  1VQD A;  2HIV A;  3W1G A;  2ZTD A;  4JI3 Q;  1KHI A;  2N78 A;  1IBL Q;  5IWA Q;  2ZJP A;  1YJN A;  2VW9 A;  2R7D A;  4PZ7 A;  1K8A C;  4JG2 A;  1G51 A;  1GKH A;  3I7F A;  4LF6 Q;  1XPU A;  2AWO A;  4R4I A;  5C3E H;  2F4V Q;  5ELN A;  3G4S A;  1LUZ A;  4IJH A;  5IT9 c;  2E2J H;  1KL9 A;  1X54 A;  3GO5 A;  2GVB A;  2B63 H;  1C0A A;  4A3D H;  1WOC A;  3RR5 A;  3BZK A;  3DM3 A;  4C3J H;  3J7Z C;  5LMN L;  4IFD G;  2JE6 I;  1XNQ Q;  3ICE A;  1S72 A;  4X66 L;  4POG A;  2VQF L;  4KLK A;  4YWL A;  5M5W H;  3HOW G;  3I4O A;  3RLN A;  3STB C;  1E22 A;  4YHH Q;  1W3S A;  4AYB G;  2JA5 H;  4BXX G;  1QZH A;  4GLA C;  4LFC Q;  4JOI C;  1PH2 A;  1WJJ A;  2JQO A;  3JC6 6;  3UDG A;  3F8T A;  1Q1E A;  5IYB G;  4A3E H;  4LUO A;  3WWV A;  1M90 C;  2H5X A;  4L5Q A;  4DV7 Q;  4UP8 A;  2ZM6 L;  2F52 A;  1N33 Q;  1Q81 C;  3GTG H;  1VQB A;  1Q86 C;  1YIJ A;  2R93 G;  1I5F A;  4PZ6 A;  4P71 A;  1NJI C;  3A5Z B;  2VZA A;  3KF6 A;  3KJP A;  1A63 A;  4A3F H;  2NVX H;  2PNH A;  2KCT A;  2IT1 A;  4P73 A;  1VCI A;  3KDF A;  1EWI A;  4L5T A;  1JMC A;  1X3E A;  2HQL A;  4DR1 Q;  4LF5 Q;  4A3J H;  1VQE A;  1J5E L;  5IY0 A;  4JCV E;  1IL2 A;  4GN3 B;  3EIV A;  3CCJ A;  1AH9 A;  5ELO A;  3RN2 A;  1I3Q H;  2BA1 A;  1X55 A;  2Z6K C;  1PFS A;  1H95 A;  3CCS A;  1VQ7 A;  4LF8 Q;  2PMZ E;  2WFW A;  3HOU H;  3CCM A;  3E9I A;  3ULJ A;  4AQY Q;  2CWA A;  1HNW Q;  1G6P A;  2EXD A;  4A3L G;  2R6G A;  1CKM A;  1QVF A;  3F2B A;  2WAQ E;  3K7A H;  4HJA A;  3E9H A;  1VQI A;  4X64 L;  3KF6 B;  1SRO A;  4LW1 A;  4GKK Q;  4A3C H;  4GNX A;  4DV6 Q;  2UXC L;  2FXQ A;  3L7Z C;  3HOX H;  4B3T Q;  4YY3 L;  4LUZ A;  4JI0 L;  1EQQ A;  3F2C A;  1Q46 A;  4IPH A;  1L2F A;  4MZ9 A;  4OX9 L;  1N36 L;  1XMO L;  4XTC S;  1SR3 A;  1RIP A;  2K5N A;  2UUA Q;  1Q12 A;  1VQ5 A;  3HFZ B;  1WYD A;  2NZO A;  5M5X H;  2K50 A;  4JI0 Q;  1XPR A;  1K83 H;  3S15 H;  3M3Y H;  1A0I A;  1L1O C;  1JJ2 A;  3MEF A;  2UUB Q;  1PA6 A;  3STB D;  2ATW A;  4X65 L;  3J81 j;  1PHJ A;  3NBH B;  1X9N A;  2K5H A;  5LMU Q;  2PI2 E;  1JT8 A;  4DK3 C;  1SRU A;  4JI2 Q;  3GTK H;  2NZH A;  5M3M G;  1C7Y A;  1KXL A;  4TQU S;  1VQP A;  2JA9 A;  2ZM6 Q;  3H0G G;  4X66 Q;  2VQE L;  2BH2 A;  2ZTC A;  2R7Z G;  4OON A;  1E3P A;  4B3M Q;  1IBM Q;  3PV0 A;  1A8V A;  3D0F A;  4C2M H;  1DGS A;  4C3I H;  4K0K Q;  4JV5 L;  4RMF A;  1B7Y B;  2QEX A;  1HJP A;  3M4Q A;  3KDF B;  2RHS B;  4X6A H;  4R4Q A;  1I94 Q;  3GD7 A;  4MTN A;  2VL6 A;  5GRO A;  4OXP A;  4QL5 A;  3JAM i;  1TWC H;  3PO2 H;  4KI0 A;  2N8N A;  5IP7 H;  4DNI A;  3CF5 A;  1SLJ A;  4A3D G;  1O7I A;  1UEB A;  3FKI H;  1AE3 A;  3AFP A;  1CKN B;  1K3R A;  1MKH A;  1VQC A;  2N3S A;  4DR5 Q;  5LMN W;  2ALY B;  1BVS A;  3CCR A;  1GM5 A;  1EFW A;  2UUC L;  1XNR Q;  4MNO A;  2I5H A;  5JJL A;  2PQA B;  4LWC A;  2LXK A;  3L2P A;  1VQ6 A;  2YTY A;  4P72 A;  4YWK A;  5HGQ A;  4LF6 L;  1T9H A;  4JC0 A;  4DV7 L;  2NVQ H;  2UXB Q;  3K7U C;  1YI2 A;  4BA2 I;  1HZ9 A;  4B3R Q;  3BZC A;  5HY6 A;  3J81 c;  2HHH L;  3CC4 A;  2JA6 G;  4EQ5 A;  4X62 L;  4JI7 Q;  4OO1 G;  4DR6 Q;  4YY3 Q;  1KAW A;  1LYL A;  4LF4 Q;  1XMQ Q;  2DGY A;  1FJG Q;  4JI1 Q;  1LM0 A;  3PUV A;  1YHB A;  3PUX A;  2HHH Q;  2ES2 A;  1Q82 C;  4A93 H;  4RG1 A;  1CKO A;  1L0W A;  2Q2U A;  4A3K G;  1HR0 L;  2JA7 H;  1OXX K;  2YTV A;  3GTJ H;  3PF5 A;  2R92 G;  2RCN A;  2OQK A;  2VS1 A;  2ZTE A;  3HOZ H;  3KOJ A;  4XIG S;  2JA7 G;  1EUJ A;  1TWF H;  4BBR H;  4JI8 Q;  4A3I G;  3T1H Q;  4KHP Q;  4GKJ L;  4DV4 L;  3T1Y Q;  3PGZ A;  3H15 A;  4DV3 Q;  1FVI A;  5IP9 H;  1X65 A;  1LTL A;  4OWT B;  4DR3 L;  1MJE A;  2D0P A;  3S16 H;  4AYB E;  2KEN A;  3NEM A;  3NEL A;  4GNX B;  1XNQ L;  2ASB A;  4GOP B;  2WB1 E;  1GVP A;  2CCZ A;  2XTI A;  3HOU G;  3VDY A;  5K36 G;  3S1M H;  3RLF A;  3CAM A;  4HJ5 A;  1M1K C;  3TRZ A;  1J6Q A;  1MIU A;  4HJ9 A;  1EIY B;  3S2H H;  5C44 G;  1D7Q A;  1EIF A;  3J81 i;  4IPD A;  2WAQ G;  2OQ0 A;  2QA4 A;  1IBK Q;  2IX0 A;  3FKI G;  1PH1 A;  3TEH B;  1YJW A;  1HR0 W;  4UP9 A;  2GN5 A;  5FLX c;  2JEA I;  1JJC B;  4GOP C;  2OTL A;  1N34 Q;  4GNX C;  4DR7 L;  4OWX B;  1I94 L;  4YCU A;  3CCV A;  4C3H H;  2A19 A;  1TWG H;  3ZJY C;  1PVO A;  4KHP L;  3OTO L;  2MO1 A;  1B70 B;  3HOW H;  4IOC A;  1VQL A;  4B3S L;  4BXX H;  2B63 G;  3PCO B;  4A75 A;  1B8A A;  1SN8 A;  1VQH A;  3S1Q H;  4BBS G;  2R7Z H;  4DKA C;  1YEZ A;  1HNX L;  4BY1 H;  4JI2 L;  1K0R A;  1V9P A;  4YCV A;  2VQE Q;  1UE1 A;  4DUZ L;  1YNX A;  2IHE A;  1BBU A;  4YCW A;  4DAY B;  4DUY L;  1WFQ A;  4DV2 Q;  3UDX A;  3CME A;  1GO3 E;  1KRS A;  1UE5 A;  4PZ8 A;  5M3M H;  4JBK A;  2UUB L;  3K80 C;  1Y14 B;  4Y52 H;  5M3F H;  3CXC A;  1SE8 A;  1IBL L;  2UU9 Q;  3PO3 G;  1CUK A;  1CSQ A;  2K52 A;  3HOY G;  5IP7 G;  5M3F G;  3ULL A;  1FGU A;  5IYC H;  2C35 B;  3U58 A;  2E2I H;  3UDF A;  5E7N A;  2YYZ A;  1TWH H;  4A76 A;  4TVA B;  1XMO Q;  4QGU A;  2I5L X;  4A3J G;  4NB3 A;  1Y1W H;  4LFB Q;  3I4N G;  5DLQ E;  4DAM A;  2Q2T A;  3I4M H;  4EX5 A;  1Y1W G;  4A3M H;  2LXJ A;  2VQF Q;  3L0O A;  4KHZ A;  3A74 A;  5FLM H;  3PUY A;  3DLL A;  2D0O A;  3I56 A;  3D31 A;  1C9O A;  4DR2 L;  1I50 H;  4NPS A;  3TQY A;  2MO0 A;  4AH6 A;  2QGQ A;  4QQB X;  2ZJQ A;  4IPG A;  2JA5 G;  1E1T A;  3CD6 A;  1PH5 A;  1HZB A;  4JYA Q;  1IZ6 A;  4JI6 L;  3GTM H;  5BR8 L;  3SGI A;  4GLX A;  1S40 A;  3GTP H;  1Q1B A;  1L1O B;  4A3E G;  1TXY A;  1UWV A;  3HOX G;  1PYB A;  3CMA A;  1QUQ B;  1K73 C;  1VQ8 A;  4JI3 L;  1YJ9 A;  2WB1 G;  5GAH C;  4QJF A;  1YVC A;  4B3R L;  1D8L A;  4DV4 Q;  1X6O A;  1EYG A;  4L5S A;  3ER0 A;  2ID0 A;  4A3F G;  2NN6 I;  1PV4 A;  1PH8 A;  3S17 H;  1PH7 A;  1YBY A;  4PG3 A;  4BA1 I;  4JI8 L;  2YTX A;  3IRB A;  3UE1 A;  5IP9 G;  3I55 A;  4R4O A;  2E5L L;  4A3B G;  1IXR A;  2GVA A;  1HNX Q;  1P8L A;  3MXN B;  2JEB I;  4LFA Q;  1P16 A;  4DR5 L;  3A5U A;  2RHQ B;  3KF8 B;  2K4K A;  4AQY L;  4LF8 L;  1V43 A;  2UUC Q;  1XNR L;  1JE5 A;  3H3V H;  3M85 A;  3HKS A;  4FDB A;  4LUV A;  5C4X H;  1VQ4 A;  4NXM Q;  5IYB H;  3CCQ A;  1CKN A;  4YHH L;  4BY7 G;  2K14 A;  2I5M X;  2XGT A;  3U50 C;  1J5E Q;  2VUM H;  3T1Y L;  3PF4 A;  1YIT A;  4A3L H;  5GQO A;  3HKZ G;  5GAG C;  4DV5 Q;  2F3I A;  1XJV A;  4LFB L;  1N32 L;  5C0X I;  1EQR A;  4DV1 L;  5C0X J;  4DV0 L;  1IBK L;  2UXD L;  1SFO H;  3LGJ A;  5C3E G;  4NXN L;  2CWP A;  3I4N H;  2PI2 A;  3PSI A;  3K81 C;  2IY5 B;  1X3F A;  2B3G A;  3FHW A;  1KRT A;  1HZA A;  3S2D H;  3RLO A;  5GAE C;  3KYH C;  2HIX A;  2IX1 A;  3PO2 G;  3KLW A;  1XTD A;  5FLM G;  4DR2 Q;  2WP8 J;  2KBN A;  3S14 H;  4LF7 L;  4DR1 L;  1N8R C;  4DR6 L;  1I6H H;  4BY1 G;  1Q7Y C;  2EIF A;  4X62 Q;  1RL2 A;  2R7F A;  1XMQ L;  3M4O H;  4JI4 Q;  4LF4 L;  3M7N A;  4GKJ Q;  3S24 A;  4NXM L;  4ME3 A;  3CCE A;  1AE2 A;  5LMN Q;  4IPC A;  3PIO A;  1IBM L;  1NMF A;  2BH8 A;  4YWM A;  1VQO A;  1NMG A;  4GN4 B;  4JV5 Q;  4K0K L;  2DUD A;  3TS2 A;  4UP7 A;  4A93 G;  2A1A A;  3GDE A;  2B29 A;  3EN2 A;  3CPW A;  2UU9 L;  2VNU D;  4JYA L;  1YZ6 A;  4OWW B;  4A3K H;  1KC8 C;  3ULP A;  1S3O A;  3HOV G;  3G48 A;  1A62 A;  2JA8 G;  2PQA A;  3F1Z A;  1VQ9 A;  3PO3 H;  2R93 H;  2MQH A;  1TWA H;  4BBR G;  1XPO A;  4R4C A;  3CPF A;  4APV A;  4LFA L;  1EOV A;  2MFI A;  5EAY A;  4DK6 C;  4GN5 A;  3CCU A;  4A3B H;  4WJ4 A;  2OCE A;  2N49 A;  3UE0 A;  2R92 H;  4OO1 I;  4J15 A;  5M5Y H;  4JI5 L;  1VQA A;  2CKZ B;  4IFD I;  4LF9 L;  5BR8 Q;  1Y1V G;  5C4X G;  1NTG A;  2EQS A;  4DR4 L;  1NBW A;  2RF4 A; 
#chains in the Genus database with same CATH topology
 5I9O A;  1MJC A;  2NVY H;  4A3G H;  1HNZ L;  1WI5 A;  5IOD A;  5J3B A;  3VR2 A;  2OTJ A;  4X64 Q;  1DM0 B;  2JK8 A;  5E4W C;  3B6Y A;  3SVM A;  1E7Z A;  3W5O A;  3T1H L;  3MAQ A;  3ERS X;  1M8A A;  3W2D A;  3AYH B;  3G71 A;  1SNO A;  1B9N A;  5KRU A;  3F2D A;  3AQQ A;  3S1N H;  2HT1 A;  4LNQ A;  1PH9 A;  4LF5 L;  4IFD J;  3A8I E;  2OT2 A;  3MC0 B;  2SOB A;  2NN6 G;  4DV3 L;  2PO4 A;  2K01 A;  1DD2 A;  1NCV A;  5JOB A;  1UEA B;  4LF9 Q;  4JBM A;  1X56 A;  1VQK A;  1CK1 A;  3KLS X;  5T1G A;  1BOS A;  1TY2 A;  1S5B D;  1R9T H;  4B3M L;  3NHH A;  2YV5 A;  2K5W A;  4BBS H;  2E8G A;  3M4P A;  5C44 B;  4B3S Q;  4JOI A;  2N88 A;  1LT4 D;  3SK5 A;  4IJL A;  4R1J A;  3TP5 A;  3OYY A;  3J80 c;  2WV6 D;  4HJ7 A;  2AUK A;  1FJG L;  4KKU A;  4IO9 A;  1JR0 D;  1PYS B;  5KYL A;  1OXS C;  3BU2 A;  1PH4 A;  1IW7 D;  4ALP A;  3VR6 A;  4LK1 C;  1NR4 A;  3H3V I;  2LSS A;  1KNE A;  1FGB D;  2F4V L;  2UXD Q;  3J80 E;  4A3M G;  4BY7 B;  1QZG A;  5JJK A;  2KCN A;  4IUR A;  2JA6 H;  2AHO B;  5FJ8 G;  1SYC A;  3CW2 C;  3MFY A;  3CCL A;  2EE1 A;  2F0W A;  1ENF A;  1CA5 A;  1N36 Q;  2H4O A;  2V4D A;  4RH6 A;  5IOC A;  4WRD A;  4QY7 A;  1JWU D;  3OW2 A;  2I0Q A;  1KD1 C;  4ULL A;  3K5N A;  1I4R A;  1KQS A;  4RAU C;  5AJ3 L;  5FLX L;  3RZD H;  5C3E B;  3GV6 A;  4O0A A;  2Y0S E;  1ONL A;  1VF5 C;  3S1R H;  1N9W A;  4ME5 A;  2D62 A;  3FPP A;  1ESR A;  3HGB A;  1Q8K A;  4GLV B;  3KJO A;  3H0G H;  4DU9 A;  4AIM A;  2UXB L;  1STN A;  4ZAI A;  1DON A;  3K0X A;  1I4P A;  2K75 A;  4UPA A;  1SSO A;  2E2D C;  4OEM B;  1MGS A;  2SNS A;  5IWA Q;  2ZJP A;  4ABN A;  2R7D A;  4PZ7 A;  4CKB A;  5DM6 3;  2VW9 A;  1V1O A;  2F0N A;  1GKH A;  3VA5 A;  2A6E D;  2JA8 B;  1JE4 A;  1LUZ A;  4IJH A;  3A56 A;  2N55 A;  3GO5 A;  4KJN A;  3BZK A;  3J7Z C;  5J39 A;  5CV9 A;  1SJH D;  3MZ5 A;  3C3L A;  3RLN A;  2JA5 H;  2HD3 A;  2KCC A;  1WCM B;  3UDG A;  4XQQ A;  1Q1E A;  4A3E H;  1AW7 A;  4UP8 A;  1Z6H A;  1RD9 D;  2PMZ B;  1YIJ A;  1I5F A;  1BR9 A;  4PZ6 A;  3KF6 A;  4A3F H;  2L11 A;  2IT1 A;  4CDE C;  4G7O C;  3KDF A;  5DEH A;  2A68 C;  4EVO A;  5FO8 B;  2B63 B;  5JPM C;  4DR1 Q;  1EY0 A;  2LS0 1;  3T16 A;  4JCV E;  3TP8 A;  1LV9 A;  1EZ8 A;  3EVQ A;  4RGM A;  1TS2 A;  1X55 A;  2Z6K C;  1EY5 A;  4PQX A;  5M5W B;  4FXD A;  4LF8 Q;  4DGZ A;  5K36 H;  4AQY Q;  3ULJ A;  2CWA A;  2IX3 A;  1B50 A;  2XNA C;  1FNW A;  4A3L G;  4HN7 A;  1STH A;  3F2B A;  4HMI A;  3SHL A;  5JAV A;  2HDL A;  3KF6 B;  4GNX A;  4DV6 Q;  3HOX H;  1J9O A;  4ODG A;  4B3T Q;  1WTW A;  3TDQ A;  1S4Z A;  1HFN A;  2B2U A;  1AFP A;  1SR3 A;  2K5N A;  2UUA Q;  3AB9 A;  1WYD A;  1U4R A;  3M3Y H;  1L1O C;  2BE5 C;  1PA6 A;  2ATW A;  4RGO S;  3J81 j;  5LMU Q;  4Q5V A;  2RCF A;  3QOL A;  2EDG A;  1IYV A;  1SRU A;  3UI2 A;  5IGC A;  3GTK H;  1B3Q A;  4MIU A;  5M3M G;  3Q24 A;  1C7Y A;  3NQT A;  4TQU S;  1VQP A;  2JA9 A;  3D6W A;  3H0G G;  2VQE L;  1E3P A;  5COY A;  1IBM Q;  3PV0 A;  3K7A B;  3D0F A;  4L63 B;  4C2M H;  1DGS A;  4C3I H;  1SE3 A;  2NB0 A;  3GD7 A;  3NTI A;  1BCP B;  5DNF A;  2VL6 A;  5A2Q E;  4OXP A;  2N8N A;  5IP7 H;  1SLJ A;  4FYD A;  3SK4 A;  3T51 B;  1EU4 A;  4DR5 Q;  3S15 B;  3EFX D;  1VQ6 A;  1F2Y A;  1TY0 A;  4C1N I;  2F0P A;  3I4L A;  3V2T A;  3N52 A;  2UXB Q;  1S5D D;  2K1B A;  3EQL C;  1YI2 A;  4BA2 I;  1HZ9 A;  5EJW A;  3T53 B;  2PZT A;  4FNF A;  2HHH L;  3S1M B;  4YY3 Q;  4LF4 Q;  2DGY A;  4F87 A;  1LM0 A;  2HHH Q;  1TU2 B;  2ES2 A;  3MXG A;  2RSN A;  1WTH A;  3PO2 B;  2Q2U A;  2SEB D;  2JA7 H;  3PF5 A;  2K04 A;  3RD4 A;  3K5L A;  1SDF A;  1QB5 D;  1TWG B;  1JOK A;  1KDB A;  4JPB W;  1H9M A;  1CT1 D;  3H15 A;  4DV3 Q;  1X65 A;  2D0P A;  3S16 H;  2KEN A;  3BVZ A;  2AQ2 B;  2KHS A;  1XNQ L;  2ZXR A;  4DK1 A;  2WB1 E;  5K36 G;  3GQB A;  2SNM A;  3RLF A;  1M1K C;  2QDL A;  1EIY B;  2E76 C;  1D7Q A;  5FO7 B;  2MGS A;  3AU7 A;  1XWE A;  3ND8 A;  1K3B C;  1PMR A;  1BQQ T;  2AQ3 B;  2NUC A;  1YJW A;  4ZUJ A;  1H9J A;  3VR5 A;  2F0U A;  4GNX C;  1I94 L;  4C3H H;  5CBE E;  3NTH A;  4C3H G;  4KHP L;  3HOW H;  1CI3 M;  1A2U A;  1VQH A;  4Z9C B;  1FNU A;  2XRS D;  1I50 B;  1YEZ A;  4C1N K;  4DKA C;  5IT9 E;  5K5P A;  1V9P A;  4WFN 3;  2VQE Q;  4OO1 H;  2IHE A;  4YCW A;  4DUY L;  4DV2 Q;  3ERO A;  3UDX A;  3E6Z X;  3CME A;  1GXD C;  3F2U A;  3CXC A;  1SE8 A;  2UU9 Q;  3PO3 G;  1CSQ A;  5IP7 G;  1TKW B;  5ELC A;  5IYC H;  2E2I H;  3UDF A;  3O13 A;  4B08 A;  2KEE A;  4DN4 M;  5BN5 A;  3TBI B;  4A76 A;  1QNU A;  5EKL A;  4IUP A;  4A3J G;  4NB3 A;  1Y1W H;  5ELE A;  3I4N G;  1Y1W G;  4A3M H;  2VQF Q;  2BE5 D;  4X3T A;  2KA7 A;  4OHJ A;  2R7Z B;  4DR2 L;  3TQY A;  3CD6 A;  1CZW A;  3URY A;  4JI6 L;  1QNK A;  1S40 A;  5M3M B;  3CKI B;  1L1O B;  2MP1 A;  1XXG A;  1V1P A;  4IUU A;  3J80 L;  1QE6 A;  4NDX A;  2F03 A;  4ZRZ A;  1JCK B;  1EYC A;  4QJF A;  1CFM A;  4KN7 C;  4ZQ3 A;  3ER0 A;  4A3F G;  3S2D B;  3I90 A;  3S17 H;  4G57 A;  4PG3 A;  1SAP A;  3UE1 A;  5I2X A;  2GVA A;  3BDC A;  4JW0 A;  2J4X A;  3MXN B;  4CJ1 B;  3QB3 A;  3KF8 B;  1PRT D;  1XNR L;  2IW3 A;  3H3V H;  4FDB A;  2I5M X;  5CYU A;  5TSS A;  2WIN B;  3GTP B;  2F0F A;  4DNT B;  3HKZ G;  5GAG C;  5C0X H;  4DV1 L;  1EQR A;  4NXN L;  2MHV A;  1CQV A;  2B3G A;  1Y8O B;  3PO2 G;  4A3B B;  2EOT A;  1SE2 A;  3I73 A;  1EIH A;  3VYU A;  2KBN A;  1A6X A;  3S14 H;  4LF7 L;  2GA4 B;  1GUS A;  4X62 Q;  3M4O H;  4YIJ A;  5KYI A;  4NXM L;  5C4X B;  4ME3 A;  1K0S A;  1AE2 A;  4G4K A;  2BH8 A;  2DJG C;  4NKL A;  4V0B A;  2DUD A;  3TS2 A;  3K0Y A;  2A1A A;  4IUN A;  2UU9 L;  5C5L A;  3D8G A;  4OWW B;  2EJF C;  1S3O A;  1I4G A;  1ILQ A;  3HOV G;  3G48 A;  2R93 H;  1TWA H;  3CPF A;  4LFA L;  2K32 A;  3CCU A;  1K28 A;  2F0V A;  2OCE A;  4QCL A;  4J15 A;  5M5Y H;  4JI5 L;  1VQA A;  2CKZ B;  4IFD I;  5KIX A;  1HTP A;  5BR8 Q;  1Y1V G;  4LF9 L;  3IKJ A;  4JI7 L;  1U4L A;  4BBS B;  5LMU L;  3U4Z A;  1UUP A;  4A3G G;  2B2Y A;  3NEN A;  2PZW A;  2A69 C;  2B2T C;  2V1C C;  1HRJ A;  1GD7 A;  4CGY B;  3PIP A;  2BA0 A;  1I4Q A;  2AWN A;  4KD3 A;  5C4J H;  3PO3 B;  5IE8 A;  1MSG A;  2UUA L;  4JBW A;  1N32 Q;  2B2V C;  3RMH A;  1EZ6 A;  4LFC L;  1VQG A;  4Q0F A;  4DK0 A;  1YHQ A;  4GS3 A;  5BN3 A;  4O2D A;  2ZT9 C;  2OEO A;  2KOL A;  3PUW A;  1OTC A;  3GTQ B;  1B9M A;  1QWY A;  5KNC A;  2VUM G;  1QVC A;  1EYA A;  3I2Z A;  4FF4 A;  4JI6 Q;  2KEC A;  3R8B A;  3GTO H;  2AUJ D;  1HNW L;  1D2B A;  2F0M A;  2WKC A;  2E5L Q;  4CKC A;  2CFM A;  1FYC A;  2KED A;  2WB1 B;  1D1I A;  4ZCK A;  4XYQ A;  1KLU D;  5C0X G;  1ASY A;  1Z9F A;  1A3T A;  3PIO 3;  2JYO A;  3GV3 A;  3MWY W;  3RNU A;  4A3I H;  2HCI A;  1WTQ A;  2A5H A;  3J81 E;  2L15 A;  4EGV A;  1Y1V H;  4K2K A;  3P1H A;  1F9S A;  1QVG A;  2FIN B;  4F8M A;  3GTL H;  1E2Z A;  3I3C A;  2VY3 A;  2ICI A;  4RCN A;  2DNC A;  1MBY A;  1A15 A;  3CC2 A;  2JA8 H;  3A55 A;  4J6H A;  1X3P A;  1AZQ A;  1S5C D;  2NWG A;  3CQZ H;  3G6E A;  1VQM A;  2PW7 A;  1HNZ Q;  2AKW B;  4HMJ A;  2M00 A;  1JB7 A;  3QOJ A;  4HR7 B;  5DAU A;  3CRK C;  2JA5 B;  1F2L A;  2E2H H;  2Z6B A;  4K5W A;  2KHJ A;  3OMG A;  1HUN A;  2YU9 H;  1PFM A;  1L1O A;  1PZI D;  2ZTD A;  5T1I A;  5C5M A;  1YJN A;  2QDB A;  1SXT A;  5JPN C;  2NVT B;  2TMP A;  4JG2 A;  4A3F B;  1G51 A;  4LF6 Q;  4R4I A;  3HOV B;  2F4V Q;  5ELN A;  3G4S A;  2E2J H;  1KL9 A;  1X54 A;  3A7L A;  5DM7 3;  4A3D H;  1QCB D;  4KV6 A;  3DM3 A;  3RR5 A;  5LMN L;  5FOB B;  2EVB A;  3I91 A;  1SBB B;  2JE6 I;  1XNQ Q;  3ICE A;  1I3Q B;  2VQF L;  4KLK A;  4POG A;  4YWL A;  5M5W H;  3HOW G;  3I4O A;  5ELF A;  1E22 A;  4YHH Q;  4AYB G;  3HOU B;  1F2Z A;  1QZH A;  4GLA C;  4BWG B;  4LJZ C;  3JC6 6;  3F8T A;  5IYB G;  2H5X A;  1STE A;  4KTA A;  4OIK A;  4FO2 A;  2ZM6 L;  1Q81 C;  1VQB A;  1Q86 C;  3KK7 A;  3NXW A;  1EYD A;  3A5Z B;  2VZA A;  1A63 A;  1LTB D;  2MJ8 A;  1QIL A;  2FFK B;  4KJO A;  4L5T A;  1G2T A;  1LT6 D;  2F0E A;  1J5E L;  5IY0 A;  4C3J B;  4FF1 A;  1H95 A;  5F2D A;  1B3A A;  2CH4 A;  1G6P A;  3CCM A;  1X32 A;  1HNW Q;  2EXD A;  1U4M A;  5JVG 3;  5A2Q L;  1CKM A;  2QIL A;  1QVF A;  2KUM A;  3K7A H;  4A3C H;  1DOL A;  2EYF A;  2Z9H A;  2UXC L;  4FF2 A;  2FXQ A;  1G6Z A;  1M4V A;  4LUZ A;  1TWC B;  4JI0 L;  3OIP A;  1GUG A;  1EQQ A;  4IPH A;  1N36 L;  4XTC S;  4RHR A;  3NPP A;  2NZO A;  5CMD A;  3Q22 A;  2K50 A;  4JI0 Q;  1XPR A;  1K83 H;  3S15 H;  1A0I A;  2DNE A;  2EZV A;  1B44 D;  4I7A A;  4DAP A;  3NBH B;  2K5H A;  4J1M A;  1K8O A;  4DK3 C;  2EYH A;  1EQT A;  3Q0A A;  2L4N A;  4X66 Q;  3A54 A;  3H09 A;  1A8V A;  2F1M A;  2P5Z X;  2Z8L A;  2QEX A;  5EBD A;  2RHS B;  2MUY A;  2I07 B;  5GRO A;  3JAM i;  3PO2 H;  3K59 A;  1LAC A;  3CF5 A;  4CJ2 C;  1UEB A;  3WDN A;  1CKN B;  1K3R A;  3IFT A;  1TWF B;  1GM5 A;  1XNR Q;  1STG A;  4LWC A;  2LXK A;  3L2P A;  2NTT A;  4YWK A;  2RKS A;  2XWB B;  4QB4 A;  3T56 B;  3K7U C;  4DAY A;  3A7A B;  4CKE A;  2IJ0 A;  1NAP A;  3CC4 A;  2X6G A;  3QG1 A;  2L12 A;  4JI7 Q;  4PV1 C;  4DR6 Q;  4JI1 Q;  2LKV A;  2K7V A;  5IGF A;  1YHB A;  2RDH A;  1ICF B;  1BUV T;  1YNN D;  4RG1 A;  4A3K G;  1HR0 L;  2YTV A;  4RFB A;  3HOZ H;  2RCN A;  2OQK A;  3FKI B;  3JAM L;  4XIG S;  5ELD A;  5I6W A;  4K6L A;  3U9S A;  1EUJ A;  5EKK A;  4JI8 Q;  1PFN A;  3G7L A;  1LTR D;  3T1H Q;  4KHP Q;  4PMC A;  4DF7 A;  3HOW B;  1VF7 A;  3T1Y Q;  2Q8T A;  3PGZ A;  1FVI A;  1RDP D;  1LTL A;  1IL8 A;  1MJE A;  1EEF D;  2NVQ B;  2A6H D;  1W6J A;  4GNX B;  2EY5 A;  3HOU G;  3VDY A;  2F0L A;  2F0K A;  2Q8I B;  2WAQ G;  1HPC A;  3CHB D;  1WTR A;  2QA4 A;  2K5D A;  1Y8P B;  2IX0 A;  1PTO B;  1U9R A;  5FLX c;  2A6E C;  4DR7 L;  5ELB A;  3CCV A;  5EPK A;  4BBR B;  1PVO A;  3OTO L;  2L1B A;  4IOC A;  1VQL A;  4B3S L;  4BXX H;  3PCO B;  5D3D A;  2EJG C;  2PCF B;  4IFD H;  1ET9 A;  2ZXO A;  1DXM A;  4BY1 H;  1K0R A;  3D6C A;  3ND9 A;  3NWT A;  4DUZ L;  2F0S A;  1C4Q A;  3TP6 A;  1WFQ A;  2Y0S B;  1GO3 E;  5M3M H;  2WII B;  5M3F H;  4MTK A;  5CC4 A;  4XQJ A;  5JJZ A;  3ULL A;  1FGU A;  2C35 B;  3ONA B;  3U58 A;  3DM1 A;  5E7N A;  2DN8 A;  3ITP A;  4WOR A;  2B8G A;  4QGU A;  4LFB Q;  2WAC A;  3NTK A;  2G5D A;  4H44 C;  4EX5 A;  1CQF A;  2LXJ A;  4K6D A;  1F9P A;  1T5E A;  3L0O A;  4KHZ A;  3A74 A;  3PUY A;  1I4H A;  3L9A X;  3BDL A;  3DXJ C;  4NPS A;  4O1N A;  2QGQ A;  4QQB X;  2ZJQ A;  4HCS A;  1E1T A;  3NBI A;  1PH5 A;  4JYA Q;  2EPB A;  3GTM H;  3GTP H;  4ZKB B;  1Q1B A;  1GHJ A;  1PLF A;  2XN9 C;  5I2Y A;  1EEI D;  1HHV A;  1QUQ B;  3SK6 A;  5GAH C;  1YJ9 A;  1TWH B;  4F88 A;  3T4A C;  1D8L A;  1EYG A;  3I4N B;  2ID0 A;  1SND A;  3HG9 A;  1PH7 A;  3I4M B;  1YBY A;  4JI8 L;  2YTX A;  4O42 A;  5IP9 G;  3I55 A;  4G7H C;  3OHX C;  4A3B G;  5LHY 1;  2RSO A;  1P8L A;  5C3W A;  4PNY A;  3MFG A;  4LF8 L;  3HKS A;  1TS5 A;  5C4X H;  4NXM Q;  3CCQ A;  4BY7 G;  4IZ8 A;  4XT3 B;  2VUM H;  3PF4 A;  3IL8 A;  1YIT A;  3NWS A;  1TQO A;  2LY7 A;  1A3U A;  4G7Z C;  1H9R A;  1VMP A;  1G2S A;  1IYU A;  3NP8 A;  4R8N A;  5C0X J;  4DV0 L;  2L55 A;  2XWJ B;  1SFO H;  5C3E G;  2CWP A;  2R93 B;  3LWE A;  3VYS A;  1TWA B;  1KRT A;  3RLO A;  5GAE C;  2IX1 A;  1XTD A;  4DR2 Q;  2WP8 J;  1LTT D;  3SR1 A;  1N8R C;  4DR6 L;  1Q7Y C;  2EIF A;  3FEW X;  1RL2 A;  4FVM A;  3M7N A;  1HTL D;  1XTC D;  3D4W A;  4GKJ Q;  1LTA D;  5CR3 A;  3N6R A;  1IBM L;  2R61 A;  1NMF A;  4JV5 Q;  4K0K L;  1NMG A;  4GN4 B;  2Z4I A;  1Z7T A;  3M4Y A;  3CPW A;  2VNU D;  1Q90 A;  3KBG A;  3MEH A;  1I6V C;  5CV7 A;  1DOM A;  3E3X A;  4A3K H;  5KGU A;  1UNS A;  2PQA A;  3F1Z A;  3BG3 A;  1HQM C;  4XXE A;  2DJF C;  2EY6 A;  1XPO A;  1EOV A;  4ZUI A;  1JOR A;  2N49 A;  3NQI A;  2L5T A;  2B8F A;  2B2W A;  2XSC A;  4IAL A;  1I6H B;  3VYT A;  5C4X G;  2EQS A;  1NBW A;  4PMB A;  3VR3 A;  1HXY D;  1Z47 A;  4HSV A;  1BBW A;  5H1S E;  2KHI A;  2Z0S A;  5FJ8 H;  5C44 H;  1WCM G;  4EQO A;  4ZLT F;  5G3L D;  5AJ3 Q;  2Y0S G;  4DA2 A;  3LWU A;  3NE5 B;  5CBA E;  4DV5 L;  3U4V A;  5EBC A;  5ISR A;  3V05 A;  2JXM B;  4L6T B;  4CDF C;  4DV6 L;  1MD2 D;  1TR5 A;  1PH3 A;  1N34 L;  1YHA A;  1Y1V B;  5D14 A;  2AMC B;  2Z6K A;  1AP0 A;  1IYJ B;  1OXU A;  3BVG A;  1KDA A;  3KFU A;  1RJT A;  2LFN A;  3DEO A;  3WOF A;  1BNZ A;  1OXT A;  2IHF A;  1N33 L;  4IOA A;  5EQ0 A;  1CSP A;  3P75 A;  2NVY B;  4A3G B;  1FL0 A;  3D3R A;  3RZO B;  3GTL B;  3CP0 A;  2ZJR A;  2D5D A;  3R2I A;  5IWA L;  2CQO A;  4J8Q A;  1WD0 A;  4NXN Q;  2A8V A;  3H94 A;  1Q3L A;  3NBH A;  3UDI A;  1BCP C;  2EYM A;  5JEA J;  1ASZ A;  4HJ8 A;  2XVS A;  4N8F A;  3S1N B;  5L37 A;  2SDF A;  4R4T A;  4NW2 A;  4LF7 Q;  5IYD H;  3I4M G;  2MNA A;  4JI5 Q;  2FJ2 A;  1DYQ A;  4IN3 A;  1D5X C;  1BKB A;  3VYR A;  3DWQ A;  5KEE A;  3TRE A;  2X6L A;  4RWS C;  5KNB A;  1UE7 A;  3U9O A;  4PMW A;  1VDZ A;  4C56 C;  1PH6 A;  4GKK L;  1NE3 A;  4X65 Q;  3H0G B;  1R9T B;  1W2B A;  2E2H B;  1HZC A;  2K28 A;  4DUY Q;  4DV2 L;  4DR4 Q;  4JI1 L;  4A3C G;  5BN4 A;  3PUZ A;  5J22 A;  3HOY B;  4DV0 Q;  3A0J A;  1R4Q B;  4KKT A;  2F0I A;  2Q2H A;  1YNN C;  1X3G A;  1ENA A;  1W6K A;  2A68 D;  3KBX A;  3HOV H;  1UE6 A;  1VQJ A;  1LTI D;  1EY8 A;  2L9H A;  3DMU A;  4HIO A;  2OWO A;  2E2J B;  1VQN A;  3HOZ G;  4A3D B;  1F9R A;  1B2T A;  1IKM A;  4L5R C;  3QIA A;  1GOZ A;  3J7Y W;  3J7A 5;  4H0L C;  4UY8 C;  4R9W A;  2K5V A;  2JA6 B;  4A4I A;  4P75 A;  1WCM H;  3FP9 A;  1JJG A;  3E0E A;  4JI4 L;  3H6M A;  4A3E B;  1EQV A;  3I8Z A;  4HIM A;  5EKI A;  4B3T L;  1PTO F;  1V1Q A;  1VQD A;  2HIV A;  3W1G A;  2M2L A;  1KHI A;  3IAY A;  1XYI A;  3J81 L;  1IBL Q;  3X3N A;  1DZ1 A;  4QUC A;  2F0T A;  3I7F A;  2AWO A;  1H9S B;  2X69 A;  5IT9 c;  2B63 H;  3MVV A;  2GVB A;  3S1R B;  4C3J H;  1O7Z A;  1TII D;  1ZEQ X;  4IFD G;  4XDX A;  5FKA C;  1S72 A;  2BOS A;  2QW7 A;  3STB C;  4BXX G;  1W3S A;  2F3V A;  4LFC Q;  4JOI C;  1PH2 A;  1HFG A;  5EGT A;  3WWV A;  4DV7 Q;  1SNQ A;  1ZKO A;  3NSW A;  3DWA A;  1R4P B;  2R93 G;  3SXH A;  3KJP A;  3DUZ A;  2ZXP A;  2NVX H;  2PNH A;  4I65 A;  4TRD A;  1CTM A;  1VCI A;  1EWI A;  3BDO A;  1JMC A;  3QR8 A;  2O5J C;  2HQL A;  2NTS A;  4N8X 1;  1IL2 A;  3KLR A;  5A35 A;  4GN3 B;  1MI2 A;  2A73 B;  4K5V A;  3CCJ A;  1U4P A;  1AH9 A;  4XYO A;  5ELO A;  4U67 3;  2XRQ D;  4DAV A;  1JC7 A;  5KND A;  1PZJ D;  2EY2 A;  1PFS A;  3CCS A;  1VQ7 A;  2HDM A;  3E9I A;  3GTK B;  3SDZ A;  2R6G A;  2RBM A;  1SYF A;  2WAQ E;  1PTO D;  1HCZ A;  1RHP A;  3E9H A;  1VQI A;  4C3I B;  3GTG B;  5I9P A;  3L7Z C;  1I4X A;  1X3Q A;  1Y69 U;  2WKD A;  1DJR D;  2IL8 A;  3D4D A;  3F2C A;  4OX9 L;  1L2F A;  4MZ9 A;  3TZD A;  2F4I A;  1Q12 A;  1VQ5 A;  3HFZ B;  3QO2 A;  1C8C A;  1RF2 D;  3HEJ A;  5M5X H;  4RGT A;  4A3J B;  1PYW D;  2UUB Q;  3MEF A;  3STB D;  4X65 L;  3BZD B;  1PHJ A;  1SYD A;  2FMM A;  1B4O A;  2PI2 E;  4JI2 Q;  2JSO A;  1KXL A;  4CJ0 B;  2ZM6 Q;  2R7Z G;  2RDF A;  2ZTC A;  4JK1 C;  2Z4H A;  1PDQ A;  4K8I A;  4K0K Q;  4JV5 L;  1JOQ A;  1O80 A;  1B7Y B;  1HJP A;  4KD4 A;  5E4X A;  2EYP A;  1I94 Q;  1KAB A;  1EIG A;  4QL5 A;  4DNI A;  3OSO A;  3HOZ B;  4A3D G;  3FKI H;  5I4D A;  1RCV D;  4X3K A;  1EFI D;  2N3S A;  1MKH A;  4ILW A;  5LMN W;  2L0C A;  3CCR A;  1WTX A;  4MNO A;  4E6I A;  1NR2 A;  2YTY A;  4KY5 A;  4P72 A;  5HGQ A;  4KY6 A;  4U68 A;  4LF6 L;  3S16 B;  1RTN A;  4B3R Q;  5IIF A;  3BZC A;  5HY6 A;  3K57 A;  2O4X A;  3S9W A;  3HKZ B;  4ZKC B;  1G8Z D;  3IFD A;  2JA6 G;  4EQ5 A;  4X62 L;  3TN2 A;  3C1F A;  4RA8 A;  1LYL A;  4C2M B;  1YNJ D;  3PUV A;  3FDT A;  4EQN A;  3WOE A;  1PTO H;  4K8J A;  2B2T A;  1OXX K;  3GTJ H;  1LO5 D;  2ZTE A;  2G9D A;  2HQE A;  1II3 A;  4EQP A;  4WJW A;  4BBR H;  1LTG D;  4A3I G;  2O2L D;  4GKJ L;  1LT5 D;  4DV4 L;  2QF7 A;  5IP9 H;  4OWT B;  4ZK9 B;  3E5S A;  4AYB E;  2DY7 A;  1KDC A;  2ASB A;  4GOP B;  2CCZ A;  1Y8N B;  1E0B A;  3KF8 A;  3TRZ A;  1J6Q A;  3S2H H;  5IGE A;  3FPU B;  4GZY C;  4X3S A;  5JEA H;  3J81 i;  4HSP A;  1DOK A;  4A93 B;  2E2I B;  2RVL A;  3FKI G;  3KUP A;  1HR0 W;  1BF4 A;  5G3L F;  2JA7 B;  1JJC B;  3GP7 A;  1N34 Q;  5E1F A;  4YCU A;  3DHQ A;  1TWG H;  1T5X D;  3D4R A;  2MO1 A;  1SEB D;  3QWN A;  3BYT B;  2B63 G;  4A75 A;  1B8A A;  4H13 C;  3S1Q H;  4BBS G;  1GUW A;  2R7Z H;  1HNX L;  4JI2 L;  2JP1 A;  4YCV A;  1WTO A;  1UE1 A;  1S5E D;  1ZXT A;  2O5I C;  4JBK A;  1UE5 A;  4PZ8 A;  2A69 D;  1D5Z C;  2K52 A;  2OXP A;  5M3F G;  3TP7 A;  4TKO B;  3TSS A;  2VXW A;  4TVA B;  5C6A A;  3MXP A;  1QOH A;  5DLQ E;  1O7L A;  4N9T A;  4DAM A;  2Q2T A;  3I70 A;  1B53 A;  1C48 A;  1HA6 A;  3DLL A;  1E2V A;  3D31 A;  1C9O A;  1ROD A;  1EY7 A;  1I50 H;  2E75 C;  2MO0 A;  4AH6 A;  3K5O A;  4IPG A;  5C4H A;  2JA5 G;  2Q8R E;  3H91 A;  2HCC A;  4QIW B;  1HZB A;  1IZ6 A;  3K58 A;  2VUM B;  4RGN A;  1UWV A;  1PXU A;  1YNJ C;  3BVM A;  4KKS A;  3FVQ A;  1FD7 D;  1NNX A;  1K73 C;  4K14 A;  1VQ8 A;  2QKI C;  1SFO B;  2WB1 G;  4V19 0;  1JOO A;  1YVC A;  3C2P A;  1SNM A;  1X6O A;  4L5S A;  3MA2 B;  2NN6 I;  3A8J E;  1ZYR D;  2QCP X;  4LAA A;  1S5F D;  2CW0 D;  3IRB A;  4R4O A;  5C3X A;  2CQA A;  1SNC A;  2NN6 H;  1BCP F;  1P16 A;  5C4Z A;  2RHQ B;  1V43 A;  2UUC Q;  4Y52 H;  4LUV A;  5IYB H;  4B9X A;  1SMY D;  3U50 C;  3T1Y L;  1OO9 B;  2I46 A;  2F3I A;  4LFB L;  2B2V A;  1N32 L;  5C0X I;  5IGB A;  1V1P B;  2UXD L;  3LGJ A;  4QMG A;  2PI2 A;  2IY5 B;  2CVR A;  3PQI A;  3SEB A;  3FHW A;  3S2D H;  2HIX A;  3S17 B;  2KVM A;  3PMF A;  3I72 A;  3BYY B;  3HZX A;  5FLM G;  5M5Y B;  3LX0 A;  4DR1 L;  3P20 A;  1I6H H;  3NUC A;  1A3V A;  2R7F A;  4JI4 Q;  4LF4 L;  1KTK A;  1D6E C;  2F0Q A;  5LMN Q;  1SYB A;  1XX8 A;  4IPC A;  3PIO A;  4YWM A;  1VQO A;  4UP7 A;  3OMC A;  4A93 G;  2B29 A;  3EN2 A;  2H1E A;  1EY6 A;  1YZ6 A;  4IQZ A;  4KHV A;  5C4J B;  3PO3 H;  1VQ9 A;  1ZYR C;  2MQH A;  2MPM A;  1QJO A;  2M9V A;  4APV A;  5EAY A;  3UE0 A;  1E2W A;  2R92 H;  5EPJ A;  4OO1 I;  3S14 B;  1L0X B;  4CHT B;  2KQ3 A;  4AYB B;  3AMU A;  1D5M C;  3M4O B;  2RF4 A;  4JBJ A;  1SNP A;  2F0O A;  2C9O A;  3E0J A;  1FNV A;  4CDC C;  3RZO H;  1K8M A;  1JWM D;  3GTO B;  4IUT A;  3J80 i;  3H3V C;  4DXG A;  1E1O A;  5JEA G;  1ET6 A;  2EY1 A;  3OIQ A;  3TME A;  4FXK C;  5I6Y A;  3M9B A;  4FXG C;  1HR0 Q;  4GOP A;  4OX9 Q;  1G29 1;  3RN5 A;  4A3I B;  5CGK A;  2XIW A;  4DNR B;  1F77 A;  4DR3 Q;  1KNA A;  1PFB A;  4Y7N H;  5JJI A;  4IUQ A;  1IKL A;  1EY9 A;  2DY8 A;  5GAD C;  1SMY C;  3OW7 A;  3AEV A;  1PTO C;  1BCP D;  4HIK A;  1PRT B;  2BDN A;  3ZYY X;  3C1E A;  3HOY H;  3J7A F;  4KK7 A;  5CV8 A;  1HH2 P;  2F3W A;  1SMX A;  3BJU A;  1L0Y B;  1WTV A;  5IYD G;  3EBE A;  3Q8D A;  5HUR A;  4NP5 A;  4OL7 A;  3V96 A;  5IYC G;  3AFQ A;  1K8G A;  4QIW E;  5IGD A;  4OGQ C;  1LAB A;  4ZYS A;  3GTQ H;  3CC7 A;  3HP3 A;  5E3F A;  1AZP A;  5M9O A;  1BBX C;  4HID A;  1U0L A;  1NY4 A;  1Q8I A;  1KIX A;  1VS0 A;  2B2U C;  4TSS A;  1PZK D;  1QG7 A;  2YU9 B;  2NZ1 D;  1UAP A;  4JVZ A;  4WJ3 M;  2JJQ A;  3HKZ E;  3OTO Q;  2NVT H;  1QUQ A;  5EPL A;  3K8A A;  4M1U B;  3JAM c;  1G91 A;  4BS9 A;  1H9S A;  4DUZ Q;  4P2C B;  2PYK A;  4H02 A;  4POF A;  1VQF A;  1U5K A;  3TS0 A;  3W1B A;  1RKN A;  1OXV A;  4BY7 H;  1AN8 A;  4NMZ A;  1E24 A;  2KCM A;  4FP5 D;  5NUC A;  1K9M C;  1J8I A;  4P74 A;  2Q2I A;  4DV1 Q;  4DPG A;  5FLX E;  2UXC Q;  4DR7 Q;  1CM9 A;  5D65 A;  4JI3 Q;  2N78 A;  4HAE A;  4N9P A;  4XT1 B;  1F9Q A;  2JN4 A;  1K8A C;  4XQN A;  2NVX B;  3RZD B;  1XPU A;  4HED A;  2BDO A;  2B2W C;  3DEP A;  5C3E H;  3LNN A;  1HA5 A;  3CQZ B;  1C0A A;  1O7Y A;  4CBV A;  1WOC A;  2VB2 X;  3T13 A;  4CDD C;  1ESF A;  1HQR D;  4M8A A;  4X66 L;  3R2T A;  2EJM A;  1BXT A;  2QEJ C;  1WJJ A;  2JQO A;  2A74 C;  1JQY D;  4UAI A;  4LUO A;  4UDU C;  2WAQ B;  1M90 C;  2BCO A;  4L5Q A;  4HCE A;  2J0T D;  3GTG H;  2F52 A;  1N33 Q;  1TT2 A;  4P71 A;  1NJI C;  2KCT A;  5HGT A;  4P73 A;  2RQX A;  3HS0 C;  2EYJ A;  1X3E A;  2CW0 C;  5M5X B;  4LF5 Q;  4A3J H;  1VQE A;  1K83 B;  3HRZ C;  2EYO A;  2AQ1 B;  3EIV A;  3NK9 A;  3RN2 A;  3OOC A;  1SE4 A;  1I3Q H;  2BA1 A;  4UHV A;  1WTP A;  1WD1 A;  2PMZ E;  2WFW A;  3HOU H;  1DCZ A;  4DXF A;  2FHT A;  3TZU A;  4HJA A;  5FK9 C;  1EY4 A;  1NUC A;  3VA7 A;  4X64 L;  4LW1 A;  1SRO A;  4GKK Q;  4ID6 A;  4YY3 L;  1STY A;  2K6A A;  3FRP B;  1Q46 A;  3MTS A;  1B1Z A;  1XMO L;  3OWE B;  1RIP A;  1D1K A;  1JWS D;  3R3O A;  1JJ2 A;  2A6H C;  1PRT C;  4DFA A;  1X9N A;  1JT8 A;  2NZH A;  1WVL A;  1ENC A;  2BH2 A;  1TS4 A;  4OON A;  4B3M Q;  2K5Q A;  5LL6 X;  2K33 A;  3BS1 A;  2ENB A;  4RMF A;  3M4Q A;  1KLG D;  2ICE C;  2Z1C A;  1EOT A;  3KDF B;  4X6A H;  4R4Q A;  3HOX B;  4MTN A;  2OF1 A;  3J7A V;  1TWC H;  4KI0 A;  1SYE A;  3EJI A;  2D9U A;  3GTJ B;  1KAA A;  1NSN S;  2J7Z A;  1O7I A;  1AE3 A;  3AFP A;  1VQC A;  2ALY B;  4S3S A;  1BVS A;  1EFW A;  2UUC L;  5JJL A;  2I5H A;  3M3Y B;  2PQA B;  3Q6S A;  1SJE D;  1CA6 A;  2CH4 W;  1T9H A;  4JC0 A;  4DV7 L;  2NVQ H;  4MHE A;  3K5M A;  4I7Z C;  2R3Z A;  3L3O C;  3J81 c;  3P7J A;  4H7B A;  1EU3 A;  5CV4 A;  4OO1 G;  5IGG A;  1BDO A;  1KAW A;  3S2H B;  1XMQ Q;  1FJG Q;  3PUX A;  1LLR D;  2PNR C;  2F0G A;  1O78 A;  2K05 A;  1Q82 C;  4A93 H;  2D2C C;  1CKO A;  2F0D A;  2IPK D;  1L0W A;  5JVH 3;  4K5X A;  4B9W A;  2R92 G;  3CU7 A;  1CHP D;  2VS1 A;  2KJX A;  3KOJ A;  2JA7 G;  3CRL C;  1TWF H;  3SK8 A;  2LMC B;  4X3U A;  4R8I A;  4DR3 L;  3S1Q B;  1LTS D;  2PPB C;  1BO0 A;  4BY1 B;  3JAM E;  3NEM A;  3NEL A;  1GVP A;  3MXN A;  2XTI A;  3S1M H;  3OWF A;  1VMC A;  3CAM A;  4L8J A;  4HJ5 A;  1MIU A;  4HJ9 A;  5C44 G;  2HUG A;  1EIF A;  4IPD A;  2OQ0 A;  4QF4 A;  1IBK Q;  1A2T A;  4K2L A;  1PH1 A;  3TEH B;  4UP9 A;  2GN5 A;  1GUT A;  2JEA I;  4GOP C;  2OTL A;  4OWX B;  2A19 A;  3ZJY C;  5LL6 S;  1V8Q A;  1CHQ D;  1B70 B;  1FR3 A;  1CZG A;  1HUM A;  2C5C A;  1SN8 A;  1STA A;  2PZU A;  4C3J G;  2NYZ D;  1ILP A;  1YNX A;  1BBU A;  4QUF A;  1ML0 D;  4DAY B;  3GTM B;  1GUO A;  1KRS A;  1TS3 A;  2UUB L;  3K80 C;  1Y14 B;  1IBL L;  1STB A;  1CUK A;  3HOY G;  1IHZ A;  3Q23 A;  2YYZ A;  1TWH H;  2TSS A;  1XMO Q;  2I5L X;  4FF3 A;  2E74 C;  5IT9 L;  2EYL A;  4C3H B;  3I4M H;  2VB3 X;  1EL0 A;  3PIP 3;  5CV6 A;  5FLM H;  3EA6 A;  2D0O A;  3I56 A;  3X3M A;  3QJY A;  2RDG A;  1H9K A;  1GJX A;  4RCO A;  1MHW C;  3VR4 A;  5BR8 L;  3SGI A;  4GLX A;  4A3E G;  1TXY A;  4MN3 A;  5J1Z A;  1PYB A;  3HOX G;  5M3F B;  1GUN A;  5CV5 A;  4KMU C;  1EWC A;  3CMA A;  4JI3 L;  4B3R L;  4DV4 Q;  2B2Y C;  1PRT F;  3W3A A;  4KN4 C;  1Y1W B;  1PV4 A;  1PH8 A;  4BA1 I;  2IWH A;  2PQE A;  4A3M B;  2E5L L;  1AEX A;  1IXR A;  3G6J B;  1HNX Q;  1GHK A;  3OPO A;  2JEB I;  4LFA Q;  4DR5 L;  4AQY L;  3A5U A;  2K4K A;  3FMC A;  4OEL B;  1JE5 A;  3M85 A;  2F0J A;  3MHB A;  1VQ4 A;  4RKL A;  1CKN A;  4YHH L;  2K14 A;  2XGT A;  3DWP A;  1J5E Q;  2F0H A;  4A3L H;  2NBF A;  4F7X A;  5GQO A;  4OIJ A;  1EWH A;  4DV5 Q;  1XJV A;  1JIC A;  4A3K B;  1IBK L;  4IUV A;  4RHS A;  2G9H D;  3PSI A;  3K81 C;  3I4N H;  1X3F A;  1HZA A;  3R93 A;  3KYH C;  5D3I B;  4KY7 A;  1F2M A;  3KLW A;  4LMQ D;  1LT3 D;  3MXU A;  2R92 B;  1JB3 A;  1MSH A;  5AFW A;  4BY1 G;  5COR A;  3RUZ A;  1XMQ L;  1ICW A;  3S24 A;  3CCE A;  2FMC A;  3ERQ A;  3K6O A;  2CHB D;  3GDE A;  4HTH A;  4JYA L;  2EXZ A;  1KC8 C;  3ULP A;  4C3I G;  4RKB A;  1TVX A;  1A62 A;  1SYG A;  1RTO A;  2B39 A;  2JA8 G;  3SE0 A;  4BBR G;  4R4C A;  3A8K E;  2MFI A;  4DK6 C;  4GN5 A;  4A3B H;  4WJ4 A;  5FO9 B;  3M7G A;  2PW5 A;  3KLS A;  2RA4 A;  2K03 A;  1IW7 C;  4Y7N B;  3C46 A;  1NTG A;  4DR4 L; 
#chains in the Genus database with same CATH homology
 4JBJ A;  1MJC A;  2NVY H;  1Z47 A;  4JI7 L;  1HNZ L;  1WI5 A;  4A3G H;  3RZO H;  1BBW A;  5LMU L;  5J3B A;  3U4Z A;  5H1S E;  4A3G G;  2KHI A;  4X64 Q;  2OTJ A;  2Z0S A;  2JK8 A;  3NEN A;  3B6Y A;  3J80 i;  1E7Z A;  1E1O A;  3W5O A;  5FJ8 H;  5JEA G;  1WCM G;  5C44 H;  3T1H L;  2V1C C;  3ERS X;  1GD7 A;  3AYH B;  5AJ3 Q;  3G71 A;  2Y0S G;  3F2D A;  3AQQ A;  3PIP A;  3M9B A;  3S1N H;  2BA0 A;  2AWN A;  2HT1 A;  1HR0 Q;  4GOP A;  5C4J H;  4OX9 Q;  5IE8 A;  4LNQ A;  4DV5 L;  2UUA L;  4JBW A;  1G29 1;  3RN5 A;  1PH9 A;  3U4V A;  4LF5 L;  4IFD J;  1N32 Q;  4LFC L;  1VQG A;  4DV6 L;  2NN6 G;  1YHQ A;  4GS3 A;  4DV3 L;  1N34 L;  1PH3 A;  4O2D A;  1YHA A;  4DR3 Q;  2AMC B;  3PUW A;  2Z6K A;  1OTC A;  1IYJ B;  1OXU A;  4LF9 Q;  4JBM A;  4Y7N H;  1X56 A;  3KFU A;  1VQK A;  1OXT A;  2IHF A;  1N33 L;  5JJI A;  4IOA A;  2VUM G;  1CSP A;  1QVC A;  1R9T H;  4B3M L;  1FL0 A;  3I2Z A;  2YV5 A;  5GAD C;  4JI6 Q;  4BBS H;  3AEV A;  3CP0 A;  3GTO H;  2E8G A;  2ZJR A;  1HNW L;  4HIK A;  2E5L Q;  5IWA L;  2CQO A;  3M4P A;  4NXN Q;  2CFM A;  2A8V A;  4B3S Q;  4JOI A;  3UDI A;  3HOY H;  5JEA J;  1ASZ A;  4IJL A;  1HH2 P;  4R1J A;  4HJ8 A;  3OYY A;  1SMX A;  3BJU A;  3J80 c;  4HJ7 A;  5IYD G;  3EBE A;  3Q8D A;  1FJG L;  5C0X G;  1ASY A;  4R4T A;  1Z9F A;  5IYD H;  4LF7 Q;  3I4M G;  5IYC G;  2MNA A;  4IO9 A;  4JI5 Q;  1PYS B;  1BKB A;  3RNU A;  3AFQ A;  4A3I H;  3TRE A;  1OXS C;  3BU2 A;  1PH4 A;  1K8G A;  1UE7 A;  2L15 A;  4QIW E;  4ALP A;  1Y1V H;  3H3V I;  4PMW A;  2LSS A;  3GTQ H;  3CC7 A;  2F4V L;  2UXD Q;  4A3M G;  1PH6 A;  4GKK L;  1QZG A;  5JJK A;  1NE3 A;  4X65 Q;  1QVG A;  1W2B A;  2JA6 H;  4HID A;  1HZC A;  1U0L A;  2AHO B;  4DUY Q;  4DV2 L;  1NY4 A;  5FJ8 G;  1KIX A;  3CW2 C;  3CCL A;  3GTL H;  1VS0 A;  4DR4 Q;  2VY3 A;  4JI1 L;  4A3C G;  3PUZ A;  1N36 Q;  4WJ3 M;  2JJQ A;  3HKZ E;  4DV0 Q;  4QY7 A;  3A0J A;  3OTO Q;  3OW2 A;  2Q2H A;  1KD1 C;  2I0Q A;  1QUQ A;  2NVT H;  1KQS A;  1X3G A;  5AJ3 L;  3CC2 A;  3RZD H;  3K8A A;  3HOV H;  1UE6 A;  1VQJ A;  2JA8 H;  3JAM c;  4HIO A;  4O0A A;  2Y0S E;  3CQZ H;  3G6E A;  1VQM A;  2OWO A;  1VQN A;  4DUZ Q;  3S1R H;  1N9W A;  3HOZ G;  1HNZ Q;  2AKW B;  2D62 A;  4H02 A;  4POF A;  1VQF A;  1U5K A;  3TS0 A;  1JB7 A;  3W1B A;  4L5R C;  1OXV A;  1Q8K A;  4BY7 H;  3J7A 5;  4GLV B;  4UY8 C;  1E24 A;  3KJO A;  2KCM A;  3H0G H;  2K5V A;  1K9M C;  2E2H H;  2KHJ A;  4AIM A;  4A4I A;  4P75 A;  1WCM H;  4P74 A;  2Q2I A;  3FP9 A;  4DV1 Q;  2UXB L;  1JJG A;  3E0E A;  4DPG A;  2YU9 H;  4JI4 L;  3K0X A;  2UXC Q;  1L1O A;  4HIM A;  4DR7 Q;  4B3T L;  2K75 A;  4UPA A;  1V1Q A;  1VQD A;  2HIV A;  3W1G A;  2ZTD A;  4JI3 Q;  1KHI A;  2N78 A;  1IBL Q;  5IWA Q;  2ZJP A;  1YJN A;  2VW9 A;  2R7D A;  4PZ7 A;  1K8A C;  4JG2 A;  1G51 A;  1GKH A;  3I7F A;  4LF6 Q;  1XPU A;  2AWO A;  4R4I A;  5C3E H;  2F4V Q;  5ELN A;  3G4S A;  1LUZ A;  4IJH A;  5IT9 c;  2E2J H;  1KL9 A;  1X54 A;  3GO5 A;  2GVB A;  2B63 H;  1C0A A;  4A3D H;  1WOC A;  3RR5 A;  3BZK A;  3DM3 A;  4C3J H;  3J7Z C;  5LMN L;  4IFD G;  2JE6 I;  1XNQ Q;  3ICE A;  1S72 A;  4X66 L;  4POG A;  2VQF L;  4KLK A;  4YWL A;  5M5W H;  3HOW G;  3I4O A;  3RLN A;  3STB C;  1E22 A;  4YHH Q;  1W3S A;  4AYB G;  2JA5 H;  4BXX G;  1QZH A;  4GLA C;  4LFC Q;  4JOI C;  1PH2 A;  1WJJ A;  2JQO A;  3JC6 6;  3UDG A;  3F8T A;  1Q1E A;  5IYB G;  4A3E H;  4LUO A;  3WWV A;  1M90 C;  2H5X A;  4L5Q A;  4DV7 Q;  4UP8 A;  2ZM6 L;  2F52 A;  1N33 Q;  1Q81 C;  3GTG H;  1VQB A;  1Q86 C;  1YIJ A;  2R93 G;  1I5F A;  4PZ6 A;  4P71 A;  1NJI C;  3A5Z B;  2VZA A;  3KF6 A;  3KJP A;  1A63 A;  4A3F H;  2NVX H;  2PNH A;  2KCT A;  2IT1 A;  4P73 A;  1VCI A;  3KDF A;  1EWI A;  4L5T A;  1JMC A;  1X3E A;  2HQL A;  4DR1 Q;  4LF5 Q;  4A3J H;  1VQE A;  1J5E L;  5IY0 A;  4JCV E;  1IL2 A;  4GN3 B;  3EIV A;  3CCJ A;  1AH9 A;  5ELO A;  3RN2 A;  1I3Q H;  2BA1 A;  1X55 A;  2Z6K C;  1PFS A;  1H95 A;  3CCS A;  1VQ7 A;  4LF8 Q;  2PMZ E;  2WFW A;  3HOU H;  3CCM A;  3E9I A;  3ULJ A;  4AQY Q;  2CWA A;  1HNW Q;  1G6P A;  2EXD A;  4A3L G;  2R6G A;  1CKM A;  1QVF A;  3F2B A;  2WAQ E;  3K7A H;  4HJA A;  3E9H A;  1VQI A;  4X64 L;  3KF6 B;  1SRO A;  4LW1 A;  4GKK Q;  4A3C H;  4GNX A;  4DV6 Q;  2UXC L;  2FXQ A;  3L7Z C;  3HOX H;  4B3T Q;  4YY3 L;  4LUZ A;  4JI0 L;  1EQQ A;  3F2C A;  1Q46 A;  4IPH A;  1L2F A;  4MZ9 A;  4OX9 L;  1N36 L;  1XMO L;  4XTC S;  1SR3 A;  1RIP A;  2K5N A;  2UUA Q;  1Q12 A;  1VQ5 A;  3HFZ B;  1WYD A;  2NZO A;  5M5X H;  2K50 A;  4JI0 Q;  1XPR A;  1K83 H;  3S15 H;  3M3Y H;  1A0I A;  1L1O C;  1JJ2 A;  3MEF A;  2UUB Q;  1PA6 A;  3STB D;  2ATW A;  4X65 L;  3J81 j;  1PHJ A;  3NBH B;  1X9N A;  2K5H A;  5LMU Q;  2PI2 E;  1JT8 A;  4DK3 C;  1SRU A;  4JI2 Q;  3GTK H;  2NZH A;  5M3M G;  1C7Y A;  1KXL A;  4TQU S;  1VQP A;  2JA9 A;  2ZM6 Q;  3H0G G;  4X66 Q;  2VQE L;  2BH2 A;  2ZTC A;  2R7Z G;  4OON A;  1E3P A;  4B3M Q;  1IBM Q;  3PV0 A;  1A8V A;  3D0F A;  4C2M H;  1DGS A;  4C3I H;  4K0K Q;  4JV5 L;  4RMF A;  1B7Y B;  2QEX A;  1HJP A;  3M4Q A;  3KDF B;  2RHS B;  4X6A H;  4R4Q A;  1I94 Q;  3GD7 A;  4MTN A;  2VL6 A;  5GRO A;  4OXP A;  4QL5 A;  3JAM i;  1TWC H;  3PO2 H;  4KI0 A;  2N8N A;  5IP7 H;  4DNI A;  3CF5 A;  1SLJ A;  4A3D G;  1O7I A;  1UEB A;  3FKI H;  1AE3 A;  3AFP A;  1CKN B;  1K3R A;  1MKH A;  1VQC A;  2N3S A;  4DR5 Q;  5LMN W;  2ALY B;  1BVS A;  3CCR A;  1GM5 A;  1EFW A;  2UUC L;  1XNR Q;  4MNO A;  2I5H A;  5JJL A;  2PQA B;  4LWC A;  2LXK A;  3L2P A;  1VQ6 A;  2YTY A;  4P72 A;  4YWK A;  5HGQ A;  4LF6 L;  1T9H A;  4JC0 A;  4DV7 L;  2NVQ H;  2UXB Q;  3K7U C;  1YI2 A;  4BA2 I;  1HZ9 A;  4B3R Q;  3BZC A;  5HY6 A;  3J81 c;  2HHH L;  3CC4 A;  2JA6 G;  4EQ5 A;  4X62 L;  4JI7 Q;  4OO1 G;  4DR6 Q;  4YY3 Q;  1KAW A;  1LYL A;  4LF4 Q;  1XMQ Q;  2DGY A;  1FJG Q;  4JI1 Q;  1LM0 A;  3PUV A;  1YHB A;  3PUX A;  2HHH Q;  2ES2 A;  1Q82 C;  4A93 H;  4RG1 A;  1CKO A;  1L0W A;  2Q2U A;  4A3K G;  1HR0 L;  2JA7 H;  1OXX K;  2YTV A;  3GTJ H;  3PF5 A;  2R92 G;  2RCN A;  2OQK A;  2VS1 A;  2ZTE A;  3HOZ H;  3KOJ A;  4XIG S;  2JA7 G;  1EUJ A;  1TWF H;  4BBR H;  4JI8 Q;  4A3I G;  3T1H Q;  4KHP Q;  4GKJ L;  4DV4 L;  3T1Y Q;  3PGZ A;  3H15 A;  4DV3 Q;  1FVI A;  5IP9 H;  1X65 A;  1LTL A;  4OWT B;  4DR3 L;  1MJE A;  2D0P A;  3S16 H;  4AYB E;  2KEN A;  3NEM A;  3NEL A;  4GNX B;  1XNQ L;  2ASB A;  4GOP B;  2WB1 E;  1GVP A;  2CCZ A;  2XTI A;  3HOU G;  3VDY A;  5K36 G;  3S1M H;  3RLF A;  3CAM A;  4HJ5 A;  1M1K C;  3TRZ A;  1J6Q A;  1MIU A;  4HJ9 A;  1EIY B;  3S2H H;  5C44 G;  1D7Q A;  1EIF A;  3J81 i;  4IPD A;  2WAQ G;  2OQ0 A;  2QA4 A;  1IBK Q;  2IX0 A;  3FKI G;  1PH1 A;  3TEH B;  1YJW A;  1HR0 W;  4UP9 A;  2GN5 A;  5FLX c;  2JEA I;  1JJC B;  4GOP C;  2OTL A;  1N34 Q;  4GNX C;  4DR7 L;  4OWX B;  1I94 L;  4YCU A;  3CCV A;  4C3H H;  2A19 A;  1TWG H;  3ZJY C;  1PVO A;  4KHP L;  3OTO L;  2MO1 A;  1B70 B;  3HOW H;  4IOC A;  1VQL A;  4B3S L;  4BXX H;  2B63 G;  3PCO B;  4A75 A;  1B8A A;  1SN8 A;  1VQH A;  3S1Q H;  4BBS G;  2R7Z H;  4DKA C;  1YEZ A;  1HNX L;  4BY1 H;  4JI2 L;  1K0R A;  1V9P A;  4YCV A;  2VQE Q;  1UE1 A;  4DUZ L;  1YNX A;  2IHE A;  1BBU A;  4YCW A;  4DAY B;  4DUY L;  1WFQ A;  4DV2 Q;  3UDX A;  3CME A;  1GO3 E;  1KRS A;  1UE5 A;  4PZ8 A;  5M3M H;  4JBK A;  2UUB L;  3K80 C;  1Y14 B;  4Y52 H;  5M3F H;  3CXC A;  1SE8 A;  1IBL L;  2UU9 Q;  3PO3 G;  1CUK A;  1CSQ A;  2K52 A;  3HOY G;  5IP7 G;  5M3F G;  3ULL A;  1FGU A;  5IYC H;  2C35 B;  3U58 A;  2E2I H;  3UDF A;  5E7N A;  2YYZ A;  1TWH H;  4A76 A;  4TVA B;  1XMO Q;  4QGU A;  2I5L X;  4A3J G;  4NB3 A;  1Y1W H;  4LFB Q;  3I4N G;  5DLQ E;  4DAM A;  2Q2T A;  3I4M H;  4EX5 A;  1Y1W G;  4A3M H;  2LXJ A;  2VQF Q;  3L0O A;  4KHZ A;  3A74 A;  5FLM H;  3PUY A;  3DLL A;  2D0O A;  3I56 A;  3D31 A;  1C9O A;  4DR2 L;  1I50 H;  4NPS A;  3TQY A;  2MO0 A;  4AH6 A;  2QGQ A;  4QQB X;  2ZJQ A;  4IPG A;  2JA5 G;  1E1T A;  3CD6 A;  1PH5 A;  1HZB A;  4JYA Q;  1IZ6 A;  4JI6 L;  3GTM H;  5BR8 L;  3SGI A;  4GLX A;  1S40 A;  3GTP H;  1Q1B A;  1L1O B;  4A3E G;  1TXY A;  1UWV A;  3HOX G;  1PYB A;  3CMA A;  1QUQ B;  1K73 C;  1VQ8 A;  4JI3 L;  1YJ9 A;  2WB1 G;  5GAH C;  4QJF A;  1YVC A;  4B3R L;  1D8L A;  4DV4 Q;  1X6O A;  1EYG A;  4L5S A;  3ER0 A;  2ID0 A;  4A3F G;  2NN6 I;  1PV4 A;  1PH8 A;  3S17 H;  1PH7 A;  1YBY A;  4PG3 A;  4BA1 I;  4JI8 L;  2YTX A;  3IRB A;  3UE1 A;  5IP9 G;  3I55 A;  4R4O A;  2E5L L;  4A3B G;  1IXR A;  2GVA A;  1HNX Q;  1P8L A;  3MXN B;  2JEB I;  4LFA Q;  1P16 A;  4DR5 L;  3A5U A;  2RHQ B;  3KF8 B;  2K4K A;  4AQY L;  4LF8 L;  1V43 A;  2UUC Q;  1XNR L;  1JE5 A;  3H3V H;  3M85 A;  3HKS A;  4FDB A;  4LUV A;  5C4X H;  1VQ4 A;  4NXM Q;  5IYB H;  3CCQ A;  1CKN A;  4YHH L;  4BY7 G;  2K14 A;  2I5M X;  2XGT A;  3U50 C;  1J5E Q;  2VUM H;  3T1Y L;  3PF4 A;  1YIT A;  4A3L H;  5GQO A;  3HKZ G;  5GAG C;  4DV5 Q;  2F3I A;  1XJV A;  4LFB L;  1N32 L;  5C0X I;  1EQR A;  4DV1 L;  5C0X J;  4DV0 L;  1IBK L;  2UXD L;  1SFO H;  3LGJ A;  5C3E G;  4NXN L;  2CWP A;  3I4N H;  2PI2 A;  3PSI A;  3K81 C;  2IY5 B;  1X3F A;  2B3G A;  3FHW A;  1KRT A;  1HZA A;  3S2D H;  3RLO A;  5GAE C;  3KYH C;  2HIX A;  2IX1 A;  3PO2 G;  3KLW A;  1XTD A;  5FLM G;  4DR2 Q;  2WP8 J;  2KBN A;  3S14 H;  4LF7 L;  4DR1 L;  1N8R C;  4DR6 L;  1I6H H;  4BY1 G;  1Q7Y C;  2EIF A;  4X62 Q;  1RL2 A;  2R7F A;  1XMQ L;  3M4O H;  4JI4 Q;  4LF4 L;  3M7N A;  4GKJ Q;  3S24 A;  4NXM L;  4ME3 A;  3CCE A;  1AE2 A;  5LMN Q;  4IPC A;  3PIO A;  1IBM L;  1NMF A;  2BH8 A;  4YWM A;  1VQO A;  1NMG A;  4GN4 B;  4JV5 Q;  4K0K L;  2DUD A;  3TS2 A;  4UP7 A;  4A93 G;  2A1A A;  3GDE A;  2B29 A;  3EN2 A;  3CPW A;  2UU9 L;  2VNU D;  4JYA L;  1YZ6 A;  4OWW B;  4A3K H;  1KC8 C;  3ULP A;  1S3O A;  3HOV G;  3G48 A;  1A62 A;  2JA8 G;  2PQA A;  3F1Z A;  1VQ9 A;  3PO3 H;  2R93 H;  2MQH A;  1TWA H;  4BBR G;  1XPO A;  4R4C A;  3CPF A;  4APV A;  4LFA L;  1EOV A;  2MFI A;  5EAY A;  4DK6 C;  4GN5 A;  3CCU A;  4A3B H;  4WJ4 A;  2OCE A;  2N49 A;  3UE0 A;  2R92 H;  4OO1 I;  4J15 A;  5M5Y H;  4JI5 L;  1VQA A;  2CKZ B;  4IFD I;  4LF9 L;  5BR8 Q;  1Y1V G;  5C4X G;  1NTG A;  2EQS A;  4DR4 L;  1NBW A;  2RF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...