4DKAC

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
86
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 14
structure length 86
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dkaC00
1Q46A 3HOYH 2JJQA 3M4QA 3ULJA 1HZ9A 3GTLH 1YHBA 3HFZB 5IWAQ 4A3EH 3CC4A 4P73A 4APVA 3JAMc 4POGA 3LGJA 5H1SE 3BU2A 2VS1A 4PZ6A 4LF6Q 1SMXA 2MNAA 3S1RH 4JI8L 4AQYL 1PH3A 3PO3H 3BZKA 2WFWA 4HIDA 4Y7NH 5ELNA 1A8VA 4B3RL 4LFAQ 5M3FG 4JI2L 1PH4A 1E7ZA 2UUBL 4EX5A 3TRZA 3TQYA 4X66Q 4X65Q 2ID0A 2ZJQA 4A3BG 1A0IA 3I4OA 5ELOA 3K80C 4A4IA 2FXQA 1FJGL 1QZGA 1PH7A 1OXUA 5AJ3L 4LUVA 5IYBH 4X64L 2VQEL 3CCVA 2V1CC 4LW1A 2UXDL 3AYHB 3NELA 4GOPA 4JI7L 3DLLA 5DLQE 3CPFA 4YWKA 1X65A 3ULPA 1EOVA 1N8RC 2R7ZH 2F3IA 3NBHB 1FVIA 5C3EH 4XTCS 1IXRA 1TWAH 4IJHA 1VQKA 2R7DA 4X64Q 1K8AC 3S1QH 4BY7H 2ZTCA 4UP9A 1QUQA 1KRSA 1HNWQ 3J7A5 1TWCH 2GVBA 4RG1A 3HOXH 4JI7Q 1J5EQ 4JI3Q 1Q1BA 3PUYA 4DAMA 4DV0L 3S1MH 3OYYA 3M4OH 4POFA 3KOJA 4A3EG 3TS2A 1W3SA 3I2ZA 4DV0Q 1YHAA 3RLOA 4LUOA 5C44H 1GKHA 2I5HA 2LXKA 2VY3A 2NN6G 3UDGA 3T1YQ 1VQ4A 4JI6L 2NVQH 4BA2I 4TVAB 4JI1L 4LNQA 1HZAA 1EQQA 4GOPC 1Z9FA 5EAYA 3SGIA 3S1NH 3KFUA 3H3VH 2RCNA 4QL5A 4IPCA 1YHQA 1I94Q 2CCZA 4DR4L 1PH2A 4LFCL 3TS0A 1B70B 4PG3A 4IPGA 4DV6L 1S3OA 2CWPA 3PO2G 1C9OA 4GKKQ 1VQHA 5M3MG 2NVTH 1IYJB 3A5ZB 3GTJH 4JYAL 3RR5A 1CSQA 3CMAA 1SLJA 2K4KA 3I7FA 2N78A 2QGQA 5GAEC 2VQEQ 1YI2A 1HR0L 1JJCB 4B3MQ 1CKNA 1EUJA 2IT1A 5C4JH 1HJPA 4A93G 1A63A 2EIFA 1NMFA 3PUXA 3OTOQ 1KD1C 2N49A 1JJ2A 4A3FH 3STBC 2JEBI 3TEHB 3K81C 3OTOL 3M85A 3G6EA 4LUZA 4A3GG 2ALYB 3S14H 1CKMA 4X6AH 1DGSA 4XIGS 4PZ7A 1L0WA 1A62A 2NVXH 2K5VA 4A3IH 3L0OA 1IL2A 5FJ8G 5E7NA 1X3FA 2NZHA 2Y0SE 3ZJYC 3L2PA 2CFMA 1YIJA 4HIOA 2B29A 4ALPA 2GN5A 4YHHL 4DR2Q 2KHIA 2PNHA 2LXJA 2ASBA 2PMZE 1WJJA 1BBWA 1X9NA 4DV7Q 4C2MH 3I56A 4HIKA 4BBSH 2PI2A 4C3HH 4QJFA 1NY4A 2BA0A 4DKAC 4DV4Q 1AE3A 4JYAQ 4R4OA 4A3GH 3T1HL 1PV4A 3J81i 5IE8A 4B3SL 4YY3L 2KCTA 3A74A 1X3GA 2UXCL 1TWFH 2I5LX 5LMUL 4GLAC 1SR3A 1IBML 3PO2H 1K0RA 1CKOA 4QY7A 1MJEA 3PUWA 1IBMQ 1UE6A 2E2HH 4K0KQ 4MNOA 1PA6A 2D0OA 3CCMA 4JG2A 3PF4A 3GDEA 1VQ8A 2Q2UA 5C0XG 5IY0A 1WFQA 4YWLA 4JBJA 5LMUQ 1EWIA 1N32L 2XTIA 2Q2HA 3W1GA 3TREA 1HNWL 2E5LL 3W1BA 4JOIA 3UDFA 5K36G 1J5EL 3HKSA 3PIPA 1XPUA 3FP9A 2K5HA 1WOCA 5FLMG 3CPWA 4HJ8A 3J7ZC 3NENA 2B3GA 1V43A 1YITA 4NPSA 4JCVE 2WAQG 3MEFA 3Q8DA 5IWAL 4A3KH 1EFWA 3PO3G 2OCEA 1PVOA 3RN5A 1N33Q 5M5WH 3KF6A 4X66L 2BH8A 1EIFA 3I4NG 1I94L 4A3FG 3RLNA 5IYDG 5JEAJ 4IFDG 2MFIA 1NJIC 4JI2Q 2VQFQ 1K9MC 1XNRL 1BKBA 3PSIA 4DV3L 4IJLA 2JA9A 3UE1A 3F8TA 4B3TQ 1QVCA 1I5FA 1HNXQ 2JQOA 5GADC 3J80c 1YJ9A 4DV2Q 1AH9A 2IX0A 4FDBA 3PCOB 1VQNA 5GAGC 2IHEA 4DUZL 2ZJRA 1Q7YC 1PYBA 1BVSA 4JOIC 1JE5A 2L15A 3PV0A 4AH6A 2R92G 3KYHC 4GKKL 4P74A 1V9PA 3EBEA 5M5XH 1X55A 4LF8Q 3K7AH 1HR0Q 3CAMA 1G6PA 1XMOQ 1VS0A 4LF8L 4P71A 2VW9A 4A3MH 1SRUA 1PFSA 2KCMA 4KI0A 4NXNL 2E2IH 3HOVH 1QUQB 2OQ0A 4GN5A 3K0XA 2Q2TA 4JI6Q 4KHZA 1VQIA 1PHJA 5J3BA 1J6QA 4A75A 1I6HH 3PIOA 1E24A 3AFPA 1BBUA 3CC7A 2WP8J 2R92H 1NBWA 3G4SA 5IP7H 3T1YL 5LMNW 1M1KC 2Z0SA 5IYCG 3OW2A 2UU9L 4WJ3M 1WI5A 4JI1Q 4DV3Q 1Q86C 3M4PA 2HQLA 4X62Q 4A3CH 4A3BH 4KHPL 1B8AA 4B3SQ 1P8LA 1S72A 4Y52H 1B7YB 3STBD 3K8AA 1QVGA 1CUKA 4B3ML 2OWOA 4LF5L 5C4XG 4DV1L 2GVAA 1YBYA 1L1OA 2VL6A 1KL9A 4YWMA 2JA5H 2JEAI 1HZBA 2JA6H 1FGUA 4GN4B 2IY5B 5JJIA 4RMFA 2WB1E 1P16A 4KHPQ 3CQZH 2B63H 4PZ8A 4A3JG 3BZCA 3CCJA 3S16H 3CP0A 1TXYA 1N32Q 3EN2A 2DUDA 2KENA 1YZ6A 4L5QA 4A76A 1PH8A 1I3QH 2A19A 4DUZQ 2ZJPA 1EIYB 4DV1Q 1W2BA 4DR6Q 1UE1A 1WCMG 3HOVG 2F4VQ 3GTGH 3HOZH 3ICEA 1LUZA 2NVYH 4JBKA 2AKWB 4L5TA 4ME3A 3K7UC 2JE6I 1N34L 4UPAA 5IYBG 3RNUA 1NTGA 3AQQA 4AQYQ 1SE8A 3WWVA 3FKIH 3UDXA 1Q12A 3RN2A 3S17H 1T9HA 2PI2E 1N33L 2JA7H 3AEVA 2E2JH 3GTPH 4A3LG 1KC8C 1G291 3CCLA 4JV5Q 1YVCA 2NZOA 5JJKA 1Z47A 4DR5L 2UXCQ 4R4CA 2D0PA 4DV7L 3I55A 4DV6Q 1X6OA 2PQAA 1Y1VG 4DR7L 4HJ7A 1L2FA 3CCRA 4DV4L 4BY1G 4OO1G 3RLFA 1LYLA 2Q2IA 1Y14B 1MJCA 2ATWA 4LF5Q 4X62L 1RL2A 2A1AA 2ZTEA 4LF9Q 3CD6A 3ULLA 4LWCA 1IBLQ 3CW2C 1G51A 1E1TA 3CC2A 4NXMQ 3RZDH 2UUCQ 4K0KL 4YCUA 2UXDQ 4BA1I 1HNZL 2HIVA 4H02A 2QA4A 2KHJA 3M7NA 4A3CG 2AWOA 1Q1EA 2MQHA 1OTCA 1Q82C 2WAQE 2F52A 3GD7A 5IP9G 1Y1VH 2AHOB 4R4TA 4NXML 5GAHC 4MTNA 2JA5G 5FLXc 3S2DH 4JBWA 1C7YA 1EYGA 2JA6G 1YJNA 3L7ZC 3E0EA 3H0GG 1K73C 3ER0A 2QEXA 2K52A 4IOCA 2N3SA 4IFDI 4HIMA 1X56A 1LM0A 2RF4A 3KF6B 2OTLA 3HKZG 1VQAA 3U58A 4LFBQ 1CKNB 2VUMG 1C0AA 3F1ZA 1XNQL 2AWNA 3G48A 4DR1L 2DGYA 3HOXG 4JI5Q 4X65L 4IO9A 4B3RQ 4DR4Q 1KAWA 4IPDA 1UEBA 4A3DG 2UXBL 2R93G 4DR1Q 3GTMH 1HH2P 1KXLA 4UP7A 3S15H 3U50C 4A3IG 4HJ5A 5C44G 4AYBG 4DPGA 4LF7L 4DR7Q 1H95A 2YTXA 3U4VA 1XMQL 2K50A 1IZ6A 4P75A 2VNUD 3G71A 3HOUG 5C0XI 1Q81C 2JK8A 3PUZA 1VQ6A 4O0AA 4QGUA 4LF9L 2HT1A 1L1OB 2R6GA 5IYDH 2Y0SG 1JT8A 2E8GA 4BY1H 3CMEA 3ERSX 1WYDA 2I5MX 3A0JA 4HJAA 5FLMH 2OTJA 3AFQA 1MIUA 2IX1A 5JJLA 1D8LA 1VQMA 2UUAQ 3J80i 1VCIA 1KHIA 1VQ5A 1GO3E 1KRTA 1R9TH 4TQUS 4EQ5A 1UE7A 2K14A 2F4VL 4YCVA 5LMNQ 2K75A 1K83H 4JI0L 1GM5A 3J81c 1K8GA 3PGZA 1Q8KA 4UP8A 3W5OA 5C3EG 1VQOA 4DV5L 1XPRA 1VQCA 5HY6A 1LTLA 4DV2L 1E22A 3M3YH 1MKHA 2UXBQ 4AYBE 1L1OC 4YY3Q 4B3TL 4UY8C 3D31A 4LFAL 4L5RC 1XNQQ 1N36Q 3GTKH 1XTDA 2HHHL 3I4MH 4JI5L 3PF5A 1SFOH 4BBRH 2YTYA 5C4XH 3KJPA 1VQBA 1IBLL 3F2BA 1U5KA 2RHQB 3KDFB 2VQFL 5C0XJ 5M3MH 2YYZA 3MXNB 4OWTB 1TWGH 2R7FA 1PH9A 3H3VI 4R4QA 1EQRA 3HKZE 4A3JH 2KBNA 1YEZA 1N36L 2ZM6Q 1AE2A 2ZTDA 4L5SA 1XMOL 4OWXB 1GD7A 1GVPA 4GKJQ 2I0QA 2CKZB 4PMWA 4GNXB 3BJUA 1HNZQ 1XMQQ 1WCMH 2N8NA 3M9BA 2A8VA 1E3PA 3F2CA 1O7IA 4QQBX 2UU9Q 1IBKQ 3HOWG 1X54A 2MO1A 3JC66 4OO1I 2E5LQ 4OX9Q 4IPHA 1PH5A 1YJWA 1VQJA 1N34Q 3KF8B 5IT9c 3FKIG 1KQSA 4OX9L 5IP7G 2K5NA 3EIVA 1N9WA 3S2HH 2JA7G 4C3IH 2LSSA 3UDIA 1VQEA 4R1JA 4DK6C 5LMNL 3UE0A 1JB7A 1JJGA 3T1HQ 1UE5A 4GOPB 4JBMA 3GTQH 4GN3B 2Z6KC 2B63G 2Z6KA 1XPOA 2UUAL 3J81j 1V1QA 3CF5A 1PH1A 1VQLA 2NN6I 4DR5Q 4GLXA 1X3EA 2VUMH 2JA8H 1Y1WH 3DM3A 4DUYQ 4A3MG 3E9IA 4YHHQ 4DR2L 4GNXC 4AIMA 3CXCA 4MZ9A 3HOWH 4OWWB 3I4MG 1D7QA 4A3DH 4DK3C 3HOYG 2R93H 4BXXH 2EXDA 1HR0W 1I50H 1NMGA 2XGTA 1CSPA 4QIWE 3CCQA 3CCUA 3F2DA 3FHWA 4A3KG 1HNXL 1FJGQ 1SN8A 2H5XA 2HHHQ 1XNRQ 4J15A 1RIPA 1OXSC 3NEMA 4P72A 4YCWA 1NE3A 3KJOA 3I4NH 2RHSB 4DR3Q 4LF4Q 2ES2A 1PH6A 5GROA 3S24A 1Y1WG 1JMCA 4GKJL 3PUVA 2D62A 4DR3L 4O2DA 4LF4L 4DR6L 4IOAA 4GS3A 3HOZG 4BBRG 2AMCB 1UWVA 3A5UA 4JC0A 2ZM6L 4C3JH 4DNIA 2CWAA 2EQSA 4GLVB 1XJVA 4BXXG 3E9HA 4HJ9A 1QVFA 3D0FA 1E1OA 1TWHH 4LF6L 4JI3L 1VQPA 4JI0Q 1U0LA 5FJ8H 4LFBL 2YV5A 1M90C 1VQ9A 2C35B 3B6YA 1VQDA 4NXNQ 4KLKA 4DAYB 2VZAA 1QZHA 2WB1G 1HZCA 2YTVA 4R4IA 3GO5A 1VQGA 5GQOA 2IHFA 2HIXA 5M5YH 5JEAG 4IFDJ 3RZOH 1K3RA 4JI4Q 1OXTA 2JA8G 4JV5L 2PQAB 4DV5Q 4BY7G 4DUYL 1S40A 4LF7Q 2MO0A 2OQKA 1PYSB 5AJ3Q 2UUBQ 4LFCQ 4NB3A 5BR8Q 3IRBA 1ASZA 3JAMi 3CCEA 3CCSA 4OXPA 4OONA 1SROA 1FL0A 4GNXA 2BA1A 3KLWA 5BR8L 2UUCL 2YU9H 3H0GH 1OXVA 3H15A 4A93H 1YNXA 5IYCH 4JI4L 2R7ZG 2BH2A 3HOUH 4A3LH 3VDYA 1VQFA 4WJ4A 5M3FH 3GTOH 3U4ZA 4BBSG 1VQ7A 3KDFA 1KIXA 2CQOA 1ASYA 5HGQA 5IP9H 1IBKL 4JI8Q 1OXXK
chains in the Genus database with same CATH superfamily
1K83B 1Q46A 2JJQA 2WINB 3M4QA 4FXDA 2L4NA 3HFZB 2B8FA 2AQ2B 2Z1CA 1AEXA 4ZYSA 1PH3A 3PO3H 1WTOA 5CC4A 4B3RL 1A8VA 3MZ5A 5M3FG 4JI2L 2ZT9C 4EX5A 4X66Q 4X65Q 5ELOA 1MGSA 2BCOA 2LKVA 5AJ3L 2RKSA 2V1CC 1EZ6A 3HS0C 2A69D 4JI7L 5EJWA 3GTPB 1TWCB 1X65A 3NBHB 1FVIA 1SNOA 3UI2A 4XTCS 5M5YB 1IXRA 1BNZA 3LWUA 2WAQB 4BY7H 4UP9A 1SYEA 1HNWQ 1BDOA 5C5LA 3PUYA 1H9KA 1JWUD 4DAMA 3S1MH 3OYYA 4POFA 5KNDA 4A3EG 1U4MA 3P7JA 3TS2A 3S1QB 1Y1WB 3RLOA 1MSGA 4LUOA 3T1YQ 5LL6S 2VY3A 3TBIB 4C2MB 3TP8A 4FF2A 5EAYA 3S1NH 3GQBA 3OIPA 3F2UA 1YHQA 2CCZA 1GUOA 2SEBD 3TS0A 1B70B 1S3OA 2VB2X 2OT2A 1C9OA 1VQHA 4M8AA 3A5ZB 5EGTA 1LTID 3GTJH 1BBXC 1SLJA 5GAEC 1X32A 1CKNA 2IT1A 1C4QA 1HJPA 1DOLA 5A35A 3PUXA 3OTOQ 1KD1C 3K57A 2JEBI 1A6XA 3G6EA 4LUZA 1O7YA 2E2JB 2F0HA 4X6AH 1DGSA 4HSVA 2PZUA 1ZYRC 4IUTA 4A3IH 1J9OA 1JCKB 3L9AX 4ZUJA 4HIOA 4ALPA 2EYOA 2N88A 3I8ZA 2PNHA 4IALA 2PMZE 1D1KA 4DV7Q 4C2MH 1KDAA 2R3ZA 1V8QA 3TP5A 4DKAC 1Y8OB 4DV4Q 4A3GH 1RCVD 1PV4A 2F0VA 1I4GA 2I5LX 5LMUL 4GLAC 1LLRD 4TRDA 4KKSA 1CKOA 4QY7A 2QKIC 5KNBA 1IBMQ 1UE6A 4K0KQ 3CCMA 4JG2A 3PF4A 4LAAA 2XN9C 2Q2UA 2O5IC 1D5MC 4S3SA 3T56B 5K5PA 1HNWL 1T5EA 3W1BA 4JOIA 4ABNA 3FP9A 3PO2B 2F0TA 2KQ3A 3M4YA 4HJ8A 3MXNA 2B3GA 3GTOB 1R4PB 1EYDA 4OIKA 5IWAL 3MEFA 3AB9A 5FO8B 3I4LA 1O7LA 4FF3A 5ELFA 4ZQ3A 3TDQA 5IODA 3I4NG 1I94L 4A3FG 3RLNA 1QB5D 5JEAJ 3BDCA 3PSIA 2JA9A 3F8TA 2F0KA 2WKDA 3K5LA 3TSSA 1LACA 2IX0A 4FDBA 5IIFA 2L12A 1BVSA 1GUWA 3KYHC 4GKKL 4P74A 2KOLA 3EBEA 5M5XH 2NTTA 1HR0Q 5I6WA 1G6PA 4P71A 4NXNL 3SHLA 4JI6Q 5J3BA 3NQIA 3DEOA 1F9RA 4P2CB 1EY9A 1NBWA 3G4SA 2P5ZX 1GHKA 3V96A 3TZDA 4DV3Q 4JW0A 4PQXA 2KUMA 1RD9D 1A3VA 1FNWA 4A3IB 1JWMD 1P8LA 4Y7NB 1PRTD 3NPPA 1S72A 4LF5L 3NP8A 3V2TA 4DV1L 1YBYA 1KL9A 2JA5H 1NR4A 1TT2A 5JJIA 3Q0AA 3D6WA 2SDFA 4KHPQ 3MVVA 4XT3B 3CCJA 4A3JG 3S16H 1TXYA 3EJIA 3HOYB 3P1HA 3EN2A 2DUDA 1EY4A 2KENA 4A76A 3N52A 2ZJPA 3H91A 3KF8A 3KLSX 4DR6Q 1F2YA 3HOVG 3MFGA 1LUZA 3LX0A 2AKWB 1KDBA 4UPAA 2C5CA 1STNA 3EA6A 1BUVT 2K04A 2JA7H 5JOBA 3AEVA 3NWSA 1G291 3CCLA 1I3QB 3N6RA 5JJKA 4RKBA 5I9OA 4FYDA 3MXPA 1EU3A 4JPBW 3CCRA 4OO1G 2MUYA 2HDLA 1Y14B 1K8MA 3QB3A 1IBLQ 1G51A 4BY7B 4FXGC 2XWBB 2UXDQ 1LV9A 2HIVA 1STAA 1QWYA 4H02A 1B3AA 4FNFA 4X3TA 2XRSD 2AWOA 3SR1A 1Q82C 5EKLA 3NWTA 4NXML 1WTHA 5GAHC 1B9MA 3QG1A 1PTOF 3S2DH 5C4XB 1EYCA 2JXMB 2JA6G 3E0EA 3OW7A 3H0GG 3ER0A 1RKNA 5KEEA 2K52A 1IYVA 2N3SA 2SNSA 1SBBB 4XQJA 2A6EC 1LM0A 3KF6B 4MIUA 1DOMA 1VQAA 3U58A 4LJZC 1TY0A 2NB0A 2AWNA 3G48A 4DK1A 4DR1L 4IPDA 2UXBL 1CK1A 1HH2P 1STHA 1EYAA 1KXLA 4GZYC 1JQYD 4DPGA 2K50A 1VF5C 4P75A 4DU9A 2VNUD 1YNJC 2OF1A 3A56A 1WTRA 1V1PB 3SE0A 2R6GA 2Y0SG 2FMCA 2OEOA 2E8GA 3EROA 3CMEA 4OELB 1FGBD 2OTJA 4JVZA 1D8LA 1VQMA 3J80i 2AUKA 4E6IA 2F4VL 3ERQA 5LMNQ 1SSOA 1GM5A 1QILA 4UP8A 5C3EG 4DV5L 5C3EB 3PIO3 1LTLA 4I7AA 1A3TA 1MKHA 5JEAH 4QB4A 4B3TL 3GTKH 4L5RC 2KJXA 1XNQQ 1KTKA 2HHHL 4FXKC 3HEJA 1SFOH 1LT6D 3CRLC 3BVMA 3KDFB 3NSWA 2YYZA 2R7FA 1ILPA 1V1PA 1KABA 1XMOL 1SNCA 3A7LA 1GD7A 4GKJQ 1WD1A 1DXMA 3DUZA 2N8NA 3F2CA 1O7IA 3HOWG 1X54A 3HOWB 4IPHA 4PMCA 1KQSA 5ELBA 4KD4A 3UDIA 4R1JA 2B63B 4GOPB 1XPOA 3J81j 3CF5A 2NN6I 4GLXA 3J81L 4A3MG 2DJGC 4DR2L 3CRKC 1ESFA 4HCSA 4OWWB 3I4MG 4DK3C 4A3JB 3HOYG 2EXDA 1HR0W 1I50H 5JPMC 3CCQA 1SN8A 2HHHQ 1XNRQ 2F0SA 1K8OA 3NEMA 4P72A 4YCWA 3ITPA 5C4JB 1NE3A 5M3FB 3KJOA 3I4NH 2RHSB 4LF4Q 5IGBA 2QILA 5GROA 3NK9A 1HTPA 1Y1WG 2EY5A 3QOLA 4DR3L 4GS3A 1IW7C 2AMCB 1UWVA 1XJVA 2CWAA 3VR3A 4FP5D 1XTCD 3D0FA 4ODGA 2M9VA 4LF6L 2RBMA 4JI0Q 1EIGA 2PNRC 1RTNA 4LFBL 1CI3M 3K5OA 4C1NK 1VQDA 1HCZA 5CV7A 1GUNA 1TIID 3BYTB 2YTVA 5M5YH 4BBSG 1VQGA 2IHFA 4IURA 5JEAG 3RZOH 4OGQC 1OXTA 5I2YA 4JI4Q 2PQAB 2UUBQ 3MHBA 3WOEA 2EYFA 4RH6A 3IRBA 5CYUA 1YNJD 3CCEA 4OXPA 1FL0A 2BA1A 5BR8L 1PFMA 2UUCL 2NZ1D 1OXVA 1YNXA 2BH2A 3HOUH 2HQEA 1EQTA 3SK5A 1CFMA 4EVOA 3VDYA 4WJ4A 5M3FH 3GTOH 3U4ZA 3FMCA 3KDFA 1E2ZA 2CQOA 4HEDA 1KIXA 5IP9H 4KK7A 4AQYQ 2DNEA 1I4XA 3ULJA 5J39A 4FF1A 2HCIA 5KRUA 3CC4A 3DEPA 4P73A 3JAMc 4POGA 5H1SE 3BU2A 2VS1A 3I90A 1SMXA 2MNAA 2QDBA 1PZID 4JI8L 4HIDA 1VMPA 5ELNA 2E76C 4LFAQ 1K0SA 3S9WA 3SXHA 4IFDH 5D65A 3VYSA 1TR5A 2ID0A 1A0IA 3I4OA 4A4IA 3K80C 2F0IA 2FXQA 4ZKCB 1OXUA 4K5VA 4X64L 2VQEL 3CCVA 2UXDL 3DLLA 2AUJD 1B50A 3CPFA 4YWKA 1JORA 2F3IA 2OXPA 4U68A 3U9SA 4X3UA 2B2WA 2R7DA 1K8AC 3S1QH 2L5TA 1QUQA 3S1RB 1TWCH 1F2MA 4RG1A 4JI7Q 1J5EQ 1ET6A 5C5MA 1Q1BA 4DV0L 5JVH3 4ME5A 4A3FB 3M4OH 2KEDA 1SXTA 4G7HC 4BA2I 1VQ4A 3UDGA 4RKLA 1BXTA 4JI1L 4LNQA 1EQQA 5ELCA 4RA8A 4R8IA 3SGIA 3J80E 2HDMA 1G2TA 2RCNA 4IPCA 1I94Q 4N8FA 1PH2A 1TS2A 4IPGA 4DV6L 2CWPA 1HUMA 4QMGA 4GKKQ 5M3MG 2NVTH 1IYJB 3ZYYX 4JYAL 1CSQA 2WB1B 2K4KA 3I7FA 1HR0L 2N78A 2NUCA 2RA4A 2WKCA 4B3MQ 3GV3A 1GUTA 4K5XA 1STEA 2PMZB 2N49A 4IUVA 3VYUA 3M7GA 4A3GG 4G7OC 4M1UB 4PZ7A 5IGEA 1A62A 1IL2A 2LMCB 2B2VA 3J81E 2Y0SE 3QR8A 2CFMA 4YHHL 3OHXC 2PI2A 1WTVA 1I4QA 1R9TB 2BA0A 1HRJA 1DD2A 5ELDA 3J81i 3D3RA 4B3SL 2ENBA 5IGDA 1ZEQX 2KCTA 3A74A 1X3GA 3S2DB 1TWFH 3PO2H 1SR3A 3OMGA 1K0RA 4DK0A 1SNQA 4QCLA 2DJFC 1PA6A 4O42A 2EE1A 3X3NA 5IY0A 5I6YA 3RMHA 2E2DC 2HUGA 5ELEA 5LMUQ 1LTAD 4R8NA 5C44B 3K6OA 2K5DA 5CV9A 1EY5A 5K36G 1J5EL 2EYHA 1XPUA 2K5HA 1EY7A 1B2TA 3CPWA 3J7ZC 1V43A 2A74C 3OMCA 3SVMA 2BH8A 1EIFA 1FYCA 1T5XD 2XSCA 2MFIA 4K6LA 1XNRL 3CU7A 3UE1A 1QVCA 1YNND 3BVZA 3J80c 1YJ9A 1SFOB 4DV2Q 4DA2A 2E74C 1VQNA 5CR3A 2I07B 2IHEA 5CGKA 4CJ0B 1Q7YC 5HURA 2L15A 5A2QE 1B4OA 1V9PA 1X55A 4LF8Q 1ZKOA 3K7AH 3CAMA 5JPNC 3H0GB 4A3MH 1SRUA 5DEHA 1XWEA 3KLSA 2E2IH 5DAUA 5E1FA 1QUQB 2RDGA 4GN5A 3K0XA 1V1OA 2Q2TA 2XIWA 2MHVA 5BN5A 3SEBA 2B39A 5LMNW 2UU9L 4WJ3M 5M5WB 1STGA 4HN7A 4Q5VA 1G91A 2Z9HA 4UAIA 4C56C 1JB3A 3D6CA 1EFID 4C1NI 4A3BH 1B8AA 4B3SQ 4EGVA 2OWOA 5C4XG 2GVAA 2JEAI 3IKJA 4GN4B 2IY5B 2MPMA 2WB1E 2B63H 4PZ8A 1N32Q 3CP0A 1PH8A 1PFBA 1EIYB 4DV1Q 4L8JA 1EWHA 5D14A 2K03A 3DWQA 1WCMG 4DFAA 4IUNA 3PIP3 1WCMB 2F4VQ 5CV5A 4L5TA 4DXFA 1LTGD 5IYBG 1HQRD 1NTGA 3FKIH 3UDXA 1Q12A 3S17H 1T9HA 2PI2E 4NKLA 3GTPH 5DNFA 2V4DA 4KY6A 4RHRA 4DR5L 2UXCQ 3BG3A 1TWAB 1UNSA 3I55A 3PO3B 3OPOA 1X6OA 2PQAA 4CGYB 3GTGB 1PZKD 1EL0A 3DXJC 1MJCA 2Q8TA 4LF5Q 1RL2A 2ZTEA 5TSSA 1EEID 1HUNA 3CW2C 4K2KA 2JA8B 4L63B 4J1MA 4A3GB 4Q0FA 2F0DA 2K33A 3VYTA 1BCPB 3IAYA 2WAQE 2F52A 5IP9G 4R4TA 1B3QA 4F87A 1OO9B 1PDQA 4MTNA 1L0XB 2JA5G 4JBWA 3R2TA 1C7YA 1EYGA 2KCCA 3WOFA 1QJOA 3RD4A 4A3MB 1ZXTA 5EKIA 2RDHA 4QUFA 1X56A 2Z4IA 1SYGA 3HKZG 3KLRA 1CKNB 1YNNC 1C0AA 4DN4M 1JOKA 4A3DB 1SYFA 4DR4Q 1LT4D 4A3DG 1UEBA 1GXDC 1ENCA 2B8GA 4IZ8A 1WD0A 2EDGA 1EY0A 4A3BB 1BOSA 2YTXA 1XMQL 1IZ6A 4YIJA 1SYBA 3G71A 1GUGA 1VMCA 1TWHB 2HT1A 1W6JA 5EBDA 2CVRA 2BE5C 1WYDA 2I5MX 2C9OA 4ZCKA 4HJAA 3A8KE 5FLMH 1WTQA 3BDOA 1EQVA 5JJLA 2UUAQ 5G3LF 1KHIA 4TQUS 4EQ5A 2K14A 4YCVA 5E4WC 3HOVB 3TMEA 4JI0L 1WTPA 3J81c 1K8GA 1CM9A 2M2LA 1VQOA 1ENAA 5F2DA 5C0XH 4NW2A 3M3YH 1STYA 3E0JA 2UXBQ 4KN7C 5DM73 3D4RA 1N36Q 2X6LA 3VA5A 2YTYA 2M00A 1VQBA 3DM1A 3KBGA 3F2BA 1U5KA 3VA7A 4K8JA 5C0XJ 5M3MH 3MXNB 3VR2A 5IOCA 3D8GA 3I70A 3J7YW 3HKZE 4OWXB 1QCBD 1EOTA 1XMQQ 2NVYB 4B9WA 4QQBX 3JC66 2K32A 1AN8A 4OO1I 2E5LQ 1SNPA 1U4PA 1VQJA 1N34Q 4OX9L 5IP7G 2K5NA 3EIVA 4N9PA 5LMNL 5FLXE 5IT9E 2H4OA 3UE0A 1RODA 3T1HQ 1UE5A 3O13A 4ZKBB 5M5XB 4GN3B 2Z6KC 2G9DA 2Z6KA 1KAAA 2UUAL 1VQLA 1LO5D 4IUQA 4DNTB 1X3EA 2JA8H 1Y1WH 3SK4A 3DM3A 4DUYQ 3E9IA 3I73A 4AIMA 1A2TA 4MZ9A 4A3DH 1FR3A 1EZ8A 1BR9A 3I91A 2QCPX 1TWFB 1O80A 2XGTA 2EZVA 1HNXL 3F2DA 3FHWA 3J7AF 4C3IB 4IUUA 4C3IG 1U4RA 4J15A 3E3XA 5FO9B 3KK7A 1JE4A 2F0FA 1ENFA 1GOZA 3HP3A 2ES2A 4O1NA 2F0UA 4GKJL 3HRZC 4DR6L 3HOZG 3MC0B 5EPLA 4BBRB 4DNIA 4GLVB 4BXXG 3E9HA 1ONLA 1E1OA 1M90C 2PZWA 2C35B 1D6EC 3FVQA 1E0BA 2R61A 4DAYB 2VZAA 4G57A 5LL6X 2WB1G 1HZCA 5EPJA 5GQOA 3TP7A 4IFDJ 2F0PA 1K3RA 3EFXD 2EOTA 1F77A 1Y8NB 1PTOB 1S40A 4LF7Q 2OQKA 1ASZA 3QWNA 3CCSA 5EBCA 3KLWA 2RSNA 4ZK9B 3H0GH 4A93H 4JI4L 2NWGA 4A3LH 3MXGA 5EPKA 1ASYA 3HZXA 2F1MA 1SE2A 3S15B 1OXXK 3ND9A 4HTHA 3HOYH 3S16B 1YHBA 2KVMA 2QDLA 5IWAQ 4A3EH 3LGJA 1H9SA 2L11A 1HXYD 4LF6Q 1RTOA 3H6MA 1G8ZD 2O5JC 4AQYL 2CW0D 3BZKA 1CZWA 3BVGA 4FVMA 1CTMA 1W6KA 1PH4A 1JC7A 2I46A 2XRQD 2UUBL 2JA7B 3GTLB 2ZJQA 4A3BG 1KDCA 4G7ZC 5CBEE 1KLGD 1FJGL 5HGTA 1GHJA 5IYBH 2TSSA 2B2YA 3P20A 4DAYA 4LW1A 1AFPA 1O78A 1MBYA 3NELA 1Q8IA 3VYRA 4GOPA 1XYIA 5DLQE 5A2QL 2RQXA 4CDEC 4CHTB 3C1FA 2R7ZH 1AW7A 1FNVA 5C3EH 1TWAH 4IJHA 4X64Q 4A3KB 1J8IA 4ZUIA 2RDFA 3TP6A 1KRSA 4DAPA 4CJ2C 3GTKB 2QF7A 3HOXH 3NQTA 4U673 1PRTC 4A3EB 3J7AV 3I2ZA 3L3OC 4XQNA 1GKHA 2I5HA 2LXKA 4JI6L 2BDOA 2NN6G 2NVQH 4TVAB 1HZAA 4X3KA 4GOPC 5JJZA 3ND8A 4WRDA 4QL5A 4DR4L 4JK1C 2R92B 1KNEA 3MWYW 1NSNS 3C2PA 1AZQA 1H9SB 3RR5A 1AZPA 2QGQA 2VQEQ 1JJCB 2D2CC 1IYUA 1DYQA 4A93G 1TY2A 1A63A 4CKBA 2F0EA 2EIFA 1JJ2A 1JWSD 3STBC 1SE3A 3TEHB 5KNCA 3OTOL 3M85A 1M8AA 3SDZA 5C6AA 4IQZA 1CKMA 4RHSA 4XIGS 3NBIA 1L0WA 4ILWA 2BOSA 1K28A 1MI2A 1O7ZA 4X3SA 5FJ8G 5E7NA 1X3FA 1YIJA 3NTIA 2GN5A 4DR2Q 2DNCA 3R8BA 2KHIA 4CDCC 3K58A 1WJJA 1X9NA 4HIKA 2L1BA 3I56A 1BQQT 2WV6D 1H9JA 2CHBD 4QJFA 1NY4A 1SDFA 5D3IB 1AE3A 4JYAQ 3T1HL 1HFGA 1XX8A 2MJ8A 1S5DD 4YY3L 2LS01 1IBML 3C46A 3K5NA 1B9NA 3VR5A 2KCNA 4KY5A 4QIWB 2SOBA 4HMIA 3GDEA 1VQ8A 2DY8A 2CW0C 5C0XG 1MD2D 3Q22A 1BCPC 4JBJA 1KLUD 1N32L 4XYQA 3W1GA 3TREA 2E5LL 4C3JG 1E2WA 2YU9B 4C3JB 3PIPA 1TS4A 1JICA 5FLMG 3J80L 4ID6A 5CV4A 1EU4A 1YITA 3M3YB 4NPSA 4A3KH 2B2TC 2LY7A 3TN2A 3PO3G 1PVOA 4MN3A 3KF6A 5FO7B 4X66L 2ICEC 1X3PA 5IYDG 1SJHD 3OIQA 4JI2Q 2VQFQ 1TWGB 1BO0A 1WTXA 1I5FA 2PW7A 1HNXQ 2JQOA 2NYZD 2O2LD 2K1BA 2WIIB 3A7AB 1PYBA 1SEBD 4JOIC 1JE5A 4AH6A 4F7XA 4HSPA 4KJOA 4XYOA 2JA5B 3A8IE 3GV6A 3HOVH 1PFSA 2OQ0A 2IWHA 1LTSD 4KHZA 1VQIA 1PHJA 1J6QA 3A55A 1I6HH 2A68C 3PIOA 1E24A 3AFPA 1BBUA 4EQPA 3CC7A 2WP8J 2R92H 3K0YA 3IFDA 5IP7H 3T1YL 1M1KC 4H0LC 5IYCG 4XQQA 3KBXA 4PV1C 2A6HD 2AQ1B 2HQLA 3I3CA 1JOOA 2B2YC 4A3CH 3P75A 2F3VA 1S4ZA 2F0GA 1CUKA 1QVGA 1X3QA 3X3MA 2B2UA 2PZTA 2VL6A 1L1OA 3FEWX 3I72A 1HZBA 4FO2A 4PMBA 4OEMB 1U4LA 1F9SA 3MA2B 3NE5B 4L5QA 1K3BC 2A19A 3EQLC 1W2BA 1UE1A 3DMUA 1UEAB 3GTGH 2ICIA 3HOZH 3ICEA 2CQAA 4HMJA 3C3LA 4ME3A 2E75C 3RNUA 1LTBD 1SE8A 3WWVA 1ESRA 3RN2A 1SMYD 3ONAB 4A3LG 5IT9L 2NZOA 1Z47A 1D5XC 4R4CA 4RCOA 4DV7L 4DV6Q 2J7ZA 5CV8A 1L2FA 2RSOA 4DV4L 4BY1G 1CHQD 1ZYRD 3RLFA 1LYLA 2Q2IA 2VXWA 4QF4A 3CD6A 1SYDA 3ULLA 4B08A 4RGOS 3CC2A 3BYYB 4V190 1CQVA 1WTWA 4K0KL 4DXGA 1A2UA 2MQHA 3MEHA 4WJWA 3GD7A 1Y1VH 2AHOB 2B2VC 1TVXA 2K28A 1BF4A 1SNDA 4OIJA 4KD3A 1DJRD 1MHWC 2K05A 3S1NB 1DONA 2EY1A 3S14B 2QEXA 4IOCA 3H94A 3R3OA 1WVLA 2RF4A 3FDTA 2OTLA 4LFBQ 1NAPA 2EY6A 1LTRD 3F1ZA 1BCPD 1CHPD 2DGYA 3HOXG 4JI5Q 4X65L 4IO9A 4B3RQ 4DR1Q 3DWPA 4UP7A 3S15H 1HFNA 3U50C 5KYIA 3U4VA 3HOZB 1H9RA 4K14A 3HOUG 5C0XI 1XXGA 3HOUB 2JK8A 4O0AA 1DOKA 5I4DA 4QGUA 1L1OB 1PZJD 1TKWB 4BWGB 1Y1VB 2D9UA 2EYJA 3A0JA 3GTJB 3AFQA 1MIUA 2IX1A 1C8CA 1VCIA 2VB3X 2A5HA 2K75A 2A73B 3W5OA 2ZXOA 2EYMA 5IGFA 1XPRA 5M9OA 1VQCA 4DV2L 1E22A 1F9PA 3S2HB 1CA6A 4YY3Q 4I7ZC 3HGBA 4LFAL 3I4MH 1XTDA 4BBRH 3S1MB 3KJPA 5EKKA 4XT1B 2VQFL 2RHQB 4N8X1 4H7BA 1EQRA 1STBA 4A3JH 2KBNA 1YEZA 5D3DA 1N36L 1NNXA 2NTSA 3QJYA 3MAQA 1GVPA 2I0QA 2CKZB 4HR7B 4GNXB 1HNZQ 4QUCA 1E3PA 4EQNA 2UU9Q 2A69C 1SMYC 2EYLA 5IT9c 3KUPA 2MGSA 1D5ZC 1N9WA 2JA7G 4C3IH 2LSSA 3S2HH 1VQEA 1JJGA 1S5BD 2CH4A 4JBMA 2B63G 1NUCA 1PH1A 3HG9A 4I65A 1PMRA 4RFBA 4GNXC 3I4MB 3CXCA 1D7QA 2XVSA 4BXXH 1M4VA 2F0QA 1CSPA 4QIWE 1FJGQ 4A3KG 4XXEA 2F03A 2H5XA 1TQOA 1D1IA 4IUPA 2PO4A 3T53B 1IHZA 4DR3Q 3IL8A 3T13A 1I6HB 3S24A 1JMCA 4TSSA 4LF4L 2D62A 4O2DA 1E2VA 1RHPA 3RZDB 4C3JH 2EQSA 3M4OB 2EJGC 2PQEA 1TS3A 4UHVA 1U0LA 2K7VA 5CBAE 5CMDA 3B6YA 2SNMA 2EPBA 4KLKA 4K2LA 4KTAA 4R4IA 4MHEA 3GO5A 4BBSB 4NDXA 2HIXA 3A8JE 4BY7G 4DUYL 2ZXRA 1HTLD 1LT3D 2BDNA 5AJ3Q 4NB3A 5BR8Q 2IJ0A 1SROA 3PQIA 5LHY1 4GNXA 2JSOA 2YU9H 3E6ZX 3H15A 5IYCH 4XDXA 1VQFA 4H13C 1VQ7A 2NVTB 2JA6B 5T1GA 2F0MA 1IBKL 4CJ1B 3NXWA 2RVLA 3U9OA 1HZ9A 3GTLH 1GUSA 3AU7A 1G6ZA 4APVA 3H09A 4PZ6A 3S1RH 2IW3A 2WFWA 4Y7NH 5L37A 2QW7A 1ILQA 1E7ZA 4HAEA 3TRZA 3S17B 3TQYA 2PW5A 3RUZA 2JYOA 5KGUA 1QZGA 1PH7A 1HQMC 3JAML 4LUVA 5J1ZA 4C3HB 1QE6A 3AYHB 2Y0SB 3FPPA 5JAVA 5CV6A 3ULPA 1EOVA 1N8RC 1VQKA 3T51B 3BZDB 4UDUC 2ZTCA 1IW7D 3J7A5 2GVBA 4JI3Q 1CA5A 3SK8A 4DF7A 3KOJA 1W3SA 3PMFA 4DV0Q 1YHAA 4OHJA 4L6TB 5C44H 2PCFB 2R7ZB 1QG7A 2ZXPA 1RF2D 4KMUC 1Z9FA 1VDZA 3KFUA 3H3VH 1ICFB 4LFCL 2NVQB 3QOJA 4PG3A 2HD3A 3PO2G 2G9HD 1F2LA 1I4HA 1VF7A 3CMAA 3LNNA 3NBHA 1YI2A 1EUJA 2F0OA 1BCPF 5C4JH 2JN4A 1NMFA 4ULLA 4G4KA 1NCVA 5IGGA 4A3FH 3K81C 2KHSA 2EY2A 2EJMA 2ALYB 3S14H 4CDDC 4RGNA 2A68D 1H9MA 2B2UC 2NVXH 2K5VA 3L0OA 3NHHA 1LTTD 1DM0B 4RGMA 2NZHA 3ZJYC 3L2PA 4N9TA 2B29A 1EY8A 2HCCA 5DM63 2LXJA 2ASBA 2K6AA 1BBWA 2F4IA 4F8MA 4BBSH 4C3HH 1PXUA 4R4OA 4ZLTF 1KNAA 3CQZB 5IE8A 2L0CA 1PTOC 3BS1A 2UXCL 2G5DA 4OL7A 1DCZA 2DY7A 1MJEA 2XWJB 3PUWA 5J22A 3OOCA 5C4HA 2E2HH 4MNOA 4RAUC 5EQ0A 1SNMA 2D0OA 1WFQA 4RGTA 1AP0A 5JVG3 4YWLA 1EWIA 3G6JB 4CKCA 2XTIA 2Q2HA 2MP1A 4AYBB 2NVXB 2E2IB 2Z8LA 3UDFA 3HKSA 2K5QA 5BN3A 1WOCA 3NENA 5FOBB 4JCVE 2WAQG 3Q8DA 1EFWA 4Z9CB 3D4WA 2OCEA 4A93B 2F3WA 3RN5A 1N33Q 5M5WH 3G7LA 4IFDG 1NJIC 1A3UA 5C4ZA 2B2TA 1K9MC 1BKBA 4DV3L 1PTOH 4IJLA 4B3TQ 1PRTF 5GADC 2BE5D 2EYPA 1AH9A 3PCOB 4MTKA 5GAGC 1CQFA 1S5FD 2ZJRA 4DUZL 1I4RA 3PV0A 5KYLA 2R92G 2LFNA 3VR4A 3CHBD 3CKIB 1XMOQ 1VS0A 1F2ZA 3JAME 4LF8L 2EXZA 5IGCA 1Q3LA 2VW9A 2KCMA 4KI0A 5G3LD 5C3WA 2AQ3B 4CDFC 1ML0D 1LABA 4A75A 3NTHA 4NMZA 5CORA 1PRTB 1QNUA 2F0NA 3C1EA 4DGZA 2KA7A 1I4PA 3RZOB 1L0YB 2Z0SA 3OW2A 1WI5A 4JI1Q 1RDPD 1PLFA 4RCNA 1Q86C 3M4PA 1IL8A 4X62Q 1I50B 3FKIB 4J8QA 2FMMA 2J4XA 2O4XA 2FJ2A 2Z4HA 4KHPL 4RWSC 1IKLA 1QOHA 1B7YB 2FHTA 3K8AA 3STBD 4B3ML 4Y52H 4J6HA 1B53A 4YWMA 3W3AA 3H3VC 1SYCA 3EVQA 2JA6H 1FGUA 3R93A 2K5WA 4RMFA 1P16A 3CQZH 1EEFD 2NN6H 3BZCA 1YZ6A 3I4NB 1I3QH 5FK9C 3GTMB 4DUZQ 4NP5A 3A54A 3NTKA 5C3XA 3HOXB 2Q8RE 1SJED 5NUCA 2NVYH 4K6DA 4JBKA 3E5SA 3R2IA 3K7UC 2JE6I 1N34L 1PTOD 1UUPA 3AQQA 3QIAA 1FNUA 1EWCA 4R9WA 1B44D 1Y8PB 2FFKB 5E3FA 2E2JH 1N33L 1KC8C 4JV5Q 1YVCA 3GTQB 5M3MB 4PNYA 2CH4W 2D0PA 2WACA 3Q24A 1TS5A 4DR7L 1Y1VG 2RCFA 4HJ7A 3WDNA 1TU2B 1FD7D 2ATWA 4X62L 1C48A 2A1AA 3Q23A 4LF9Q 1JR0D 3DWAA 1ET9A 4LWCA 1E1TA 4NXMQ 1UAPA 3RZDH 2UUCQ 4YCUA 4BA1I 1HNZL 3OWEB 1Z6HA 3QO2A 2QA4A 2KHJA 4FF4A 3M7NA 4A3CG 4IN3A 1Q1EA 1OTCA 2JP1A 1CT1D 1DZ1A 2IPKD 3BDLA 2K01A 5FLXc 4KJNA 4CKEA 1YJNA 3L7ZC 2F0WA 1K73C 1A15A 2A6HC 2PYKA 3VR6A 4IFDI 4HIMA 4B9XA 3K59A 3HKZB 3OSOA 2VUMB 1R4QB 2VUMG 4DAVA 1XNQL 2R93B 2X69A 2R93G 1KAWA 4LMQD 3GTMH 3MXUA 2H1EA 3Q6SA 1Q90A 4A3IG 4HJ5A 5C44G 3DHQA 4AYBG 4LF7L 1SE4A 1MSHA 5I2XA 1S5CD 4DR7Q 1H95A 4KKUA 1EY6A 1IKMA 3GP7A 1Q81C 3PUZA 1VQ6A 4LF9L 3MFYA 5IYDH 1JT8A 4BY1H 3ERSX 2QEJC 3IFTA 2Z6BA 1SAPA 1VQ5A 1GO3E 2KECA 1KRTA 1R9TH 1UE7A 2DN8A 3MTSA 4WFN3 2F0LA 1K83H 1HPCA 3PGZA 1Q8KA 5FKAC 5HY6A 2A6ED 5ISRA 2J0TD 2GA4B 5I9PA 3W2DA 4DNRB 4AYBE 1L1OC 1I6VC 4UY8C 3D31A 1RJTA 4JI5L 3PF5A 1LT5D 5C4XH 1IBLL 2KEEA 5BN4A 2X6GA 4K5WA 3AMUA 2F0JA 3T4AC 4OWTB 1PH9A 1TWGH 4KY7A 1D2BA 3H3VI 4R4QA 4K8IA 3TZUA 4BY1B 2ZM6Q 1AE2A 2ZTDA 4L5SA 2EJFC 4PMWA 3BJUA 1WCMH 3M9BA 3K5MA 2A8VA 1G2SA 1IBKQ 2MO1A 4OX9Q 3FRPB 3URYA 1PH5A 1YJWA 2XNAC 2EVBA 2N55A 3KF8B 1CZGA 3FKIG 1JOQA 2FINB 2L9HA 4LK1C 1PYWD 4H44C 4DK6C 2TMPA 1JB7A 1U9RA 3GTQH 1V1QA 5COYA 5AFWA 4DR5Q 2VUMH 4C3HG 4YHHQ 2Q8IB 3OWFA 3HOWH 2R93H 4CBVA 4V0BA 1NMGA 4KV6A 3CCUA 1Z7TA 1Y69U 4BS9A 3T16A 2E2HB 2IX3A 1RIPA 1OXSC 4WORA 5T1IA 1ICWA 2L55A 3LWEA 3NUCA 1PH6A 3PUVA 4HCEA 5FLXL 4IOAA 1HA6A 4BBRG 3A5UA 2ZM6L 4JC0A 4ZRZA 1QNKA 2D5DA 3FPUB 4HJ9A 4KN4C 1QVFA 3SK6A 1TWHH 1HHVA 4JI3L 1VQPA 1PFNA 5FJ8H 5E4XA 2YV5A 1VQ9A 2PPBC 4KHVA 3K7AB 4NXNQ 1GJXA 1QZHA 1F9QA 2IL8A 5K36H 2JA8G 4JV5L 4DV5Q 4OO1H 2MO0A 1S5ED 1B1ZA 1PYSB 4LFCQ 1EIHA 1II3A 2B2WC 3JAMi 5KIXA 4ZAIA 4OONA 1HA5A 4F88A 4KKTA 3V05A 2R7ZG 2NBFA 1NR2A 4EQOA 5HGQA 4TKOB 4JI8Q 3D4DA
chains in the Genus database with same CATH topology
1Q46A 3HOYH 2JJQA 3M4QA 3ULJA 1HZ9A 3GTLH 1YHBA 3HFZB 5IWAQ 4A3EH 3CC4A 4P73A 4APVA 3JAMc 4POGA 3LGJA 5H1SE 3BU2A 2VS1A 4PZ6A 4LF6Q 1SMXA 2MNAA 3S1RH 4JI8L 4AQYL 1PH3A 3PO3H 3BZKA 2WFWA 4HIDA 4Y7NH 5ELNA 1A8VA 4B3RL 4LFAQ 5M3FG 4JI2L 1PH4A 1E7ZA 2UUBL 4EX5A 3TRZA 3TQYA 4X66Q 4X65Q 2ID0A 2ZJQA 4A3BG 1A0IA 3I4OA 5ELOA 3K80C 4A4IA 2FXQA 1FJGL 1QZGA 1PH7A 1OXUA 5AJ3L 4LUVA 5IYBH 4X64L 2VQEL 3CCVA 2V1CC 4LW1A 2UXDL 3AYHB 3NELA 4GOPA 4JI7L 3DLLA 5DLQE 3CPFA 4YWKA 1X65A 3ULPA 1EOVA 1N8RC 2R7ZH 2F3IA 3NBHB 1FVIA 5C3EH 4XTCS 1IXRA 1TWAH 4IJHA 1VQKA 2R7DA 4X64Q 1K8AC 3S1QH 4BY7H 2ZTCA 4UP9A 1QUQA 1KRSA 1HNWQ 3J7A5 1TWCH 2GVBA 4RG1A 3HOXH 4JI7Q 1J5EQ 4JI3Q 1Q1BA 3PUYA 4DAMA 4DV0L 3S1MH 3OYYA 3M4OH 4POFA 3KOJA 4A3EG 3TS2A 1W3SA 3I2ZA 4DV0Q 1YHAA 3RLOA 4LUOA 5C44H 1GKHA 2I5HA 2LXKA 2VY3A 2NN6G 3UDGA 3T1YQ 1VQ4A 4JI6L 2NVQH 4BA2I 4TVAB 4JI1L 4LNQA 1HZAA 1EQQA 4GOPC 1Z9FA 5EAYA 3SGIA 3S1NH 3KFUA 3H3VH 2RCNA 4QL5A 4IPCA 1YHQA 1I94Q 2CCZA 4DR4L 1PH2A 4LFCL 3TS0A 1B70B 4PG3A 4IPGA 4DV6L 1S3OA 2CWPA 3PO2G 1C9OA 4GKKQ 1VQHA 5M3MG 2NVTH 1IYJB 3A5ZB 3GTJH 4JYAL 3RR5A 1CSQA 3CMAA 1SLJA 2K4KA 3I7FA 2N78A 2QGQA 5GAEC 2VQEQ 1YI2A 1HR0L 1JJCB 4B3MQ 1CKNA 1EUJA 2IT1A 5C4JH 1HJPA 4A93G 1A63A 2EIFA 1NMFA 3PUXA 3OTOQ 1KD1C 2N49A 1JJ2A 4A3FH 3STBC 2JEBI 3TEHB 3K81C 3OTOL 3M85A 3G6EA 4LUZA 4A3GG 2ALYB 3S14H 1CKMA 4X6AH 1DGSA 4XIGS 4PZ7A 1L0WA 1A62A 2NVXH 2K5VA 4A3IH 3L0OA 1IL2A 5FJ8G 5E7NA 1X3FA 2NZHA 2Y0SE 3ZJYC 3L2PA 2CFMA 1YIJA 4HIOA 2B29A 4ALPA 2GN5A 4YHHL 4DR2Q 2KHIA 2PNHA 2LXJA 2ASBA 2PMZE 1WJJA 1BBWA 1X9NA 4DV7Q 4C2MH 3I56A 4HIKA 4BBSH 2PI2A 4C3HH 4QJFA 1NY4A 2BA0A 4DKAC 4DV4Q 1AE3A 4JYAQ 4R4OA 4A3GH 3T1HL 1PV4A 3J81i 5IE8A 4B3SL 4YY3L 2KCTA 3A74A 1X3GA 2UXCL 1TWFH 2I5LX 5LMUL 4GLAC 1SR3A 1IBML 3PO2H 1K0RA 1CKOA 4QY7A 1MJEA 3PUWA 1IBMQ 1UE6A 2E2HH 4K0KQ 4MNOA 1PA6A 2D0OA 3CCMA 4JG2A 3PF4A 3GDEA 1VQ8A 2Q2UA 5C0XG 5IY0A 1WFQA 4YWLA 4JBJA 5LMUQ 1EWIA 1N32L 2XTIA 2Q2HA 3W1GA 3TREA 1HNWL 2E5LL 3W1BA 4JOIA 3UDFA 5K36G 1J5EL 3HKSA 3PIPA 1XPUA 3FP9A 2K5HA 1WOCA 5FLMG 3CPWA 4HJ8A 3J7ZC 3NENA 2B3GA 1V43A 1YITA 4NPSA 4JCVE 2WAQG 3MEFA 3Q8DA 5IWAL 4A3KH 1EFWA 3PO3G 2OCEA 1PVOA 3RN5A 1N33Q 5M5WH 3KF6A 4X66L 2BH8A 1EIFA 3I4NG 1I94L 4A3FG 3RLNA 5IYDG 5JEAJ 4IFDG 2MFIA 1NJIC 4JI2Q 2VQFQ 1K9MC 1XNRL 1BKBA 3PSIA 4DV3L 4IJLA 2JA9A 3UE1A 3F8TA 4B3TQ 1QVCA 1I5FA 1HNXQ 2JQOA 5GADC 3J80c 1YJ9A 4DV2Q 1AH9A 2IX0A 4FDBA 3PCOB 1VQNA 5GAGC 2IHEA 4DUZL 2ZJRA 1Q7YC 1PYBA 1BVSA 4JOIC 1JE5A 2L15A 3PV0A 4AH6A 2R92G 3KYHC 4GKKL 4P74A 1V9PA 3EBEA 5M5XH 1X55A 4LF8Q 3K7AH 1HR0Q 3CAMA 1G6PA 1XMOQ 1VS0A 4LF8L 4P71A 2VW9A 4A3MH 1SRUA 1PFSA 2KCMA 4KI0A 4NXNL 2E2IH 3HOVH 1QUQB 2OQ0A 4GN5A 3K0XA 2Q2TA 4JI6Q 4KHZA 1VQIA 1PHJA 5J3BA 1J6QA 4A75A 1I6HH 3PIOA 1E24A 3AFPA 1BBUA 3CC7A 2WP8J 2R92H 1NBWA 3G4SA 5IP7H 3T1YL 5LMNW 1M1KC 2Z0SA 5IYCG 3OW2A 2UU9L 4WJ3M 1WI5A 4JI1Q 4DV3Q 1Q86C 3M4PA 2HQLA 4X62Q 4A3CH 4A3BH 4KHPL 1B8AA 4B3SQ 1P8LA 1S72A 4Y52H 1B7YB 3STBD 3K8AA 1QVGA 1CUKA 4B3ML 2OWOA 4LF5L 5C4XG 4DV1L 2GVAA 1YBYA 1L1OA 2VL6A 1KL9A 4YWMA 2JA5H 2JEAI 1HZBA 2JA6H 1FGUA 4GN4B 2IY5B 5JJIA 4RMFA 2WB1E 1P16A 4KHPQ 3CQZH 2B63H 4PZ8A 4A3JG 3BZCA 3CCJA 3S16H 3CP0A 1TXYA 1N32Q 3EN2A 2DUDA 2KENA 1YZ6A 4L5QA 4A76A 1PH8A 1I3QH 2A19A 4DUZQ 2ZJPA 1EIYB 4DV1Q 1W2BA 4DR6Q 1UE1A 1WCMG 3HOVG 2F4VQ 3GTGH 3HOZH 3ICEA 1LUZA 2NVYH 4JBKA 2AKWB 4L5TA 4ME3A 3K7UC 2JE6I 1N34L 4UPAA 5IYBG 3RNUA 1NTGA 3AQQA 4AQYQ 1SE8A 3WWVA 3FKIH 3UDXA 1Q12A 3RN2A 3S17H 1T9HA 2PI2E 1N33L 2JA7H 3AEVA 2E2JH 3GTPH 4A3LG 1KC8C 1G291 3CCLA 4JV5Q 1YVCA 2NZOA 5JJKA 1Z47A 4DR5L 2UXCQ 4R4CA 2D0PA 4DV7L 3I55A 4DV6Q 1X6OA 2PQAA 1Y1VG 4DR7L 4HJ7A 1L2FA 3CCRA 4DV4L 4BY1G 4OO1G 3RLFA 1LYLA 2Q2IA 1Y14B 1MJCA 2ATWA 4LF5Q 4X62L 1RL2A 2A1AA 2ZTEA 4LF9Q 3CD6A 3ULLA 4LWCA 1IBLQ 3CW2C 1G51A 1E1TA 3CC2A 4NXMQ 3RZDH 2UUCQ 4K0KL 4YCUA 2UXDQ 4BA1I 1HNZL 2HIVA 4H02A 2QA4A 2KHJA 3M7NA 4A3CG 2AWOA 1Q1EA 2MQHA 1OTCA 1Q82C 2WAQE 2F52A 3GD7A 5IP9G 1Y1VH 2AHOB 4R4TA 4NXML 5GAHC 4MTNA 2JA5G 5FLXc 3S2DH 4JBWA 1C7YA 1EYGA 2JA6G 1YJNA 3L7ZC 3E0EA 3H0GG 1K73C 3ER0A 2QEXA 2K52A 4IOCA 2N3SA 4IFDI 4HIMA 1X56A 1LM0A 2RF4A 3KF6B 2OTLA 3HKZG 1VQAA 3U58A 4LFBQ 1CKNB 2VUMG 1C0AA 3F1ZA 1XNQL 2AWNA 3G48A 4DR1L 2DGYA 3HOXG 4JI5Q 4X65L 4IO9A 4B3RQ 4DR4Q 1KAWA 4IPDA 1UEBA 4A3DG 2UXBL 2R93G 4DR1Q 3GTMH 1HH2P 1KXLA 4UP7A 3S15H 3U50C 4A3IG 4HJ5A 5C44G 4AYBG 4DPGA 4LF7L 4DR7Q 1H95A 2YTXA 3U4VA 1XMQL 2K50A 1IZ6A 4P75A 2VNUD 3G71A 3HOUG 5C0XI 1Q81C 2JK8A 3PUZA 1VQ6A 4O0AA 4QGUA 4LF9L 2HT1A 1L1OB 2R6GA 5IYDH 2Y0SG 1JT8A 2E8GA 4BY1H 3CMEA 3ERSX 1WYDA 2I5MX 3A0JA 4HJAA 5FLMH 2OTJA 3AFQA 1MIUA 2IX1A 5JJLA 1D8LA 1VQMA 2UUAQ 3J80i 1VCIA 1KHIA 1VQ5A 1GO3E 1KRTA 1R9TH 4TQUS 4EQ5A 1UE7A 2K14A 2F4VL 4YCVA 5LMNQ 2K75A 1K83H 4JI0L 1GM5A 3J81c 1K8GA 3PGZA 1Q8KA 4UP8A 3W5OA 5C3EG 1VQOA 4DV5L 1XPRA 1VQCA 5HY6A 1LTLA 4DV2L 1E22A 3M3YH 1MKHA 2UXBQ 4AYBE 1L1OC 4YY3Q 4B3TL 4UY8C 3D31A 4LFAL 4L5RC 1XNQQ 1N36Q 3GTKH 1XTDA 2HHHL 3I4MH 4JI5L 3PF5A 1SFOH 4BBRH 2YTYA 5C4XH 3KJPA 1VQBA 1IBLL 3F2BA 1U5KA 2RHQB 3KDFB 2VQFL 5C0XJ 5M3MH 2YYZA 3MXNB 4OWTB 1TWGH 2R7FA 1PH9A 3H3VI 4R4QA 1EQRA 3HKZE 4A3JH 2KBNA 1YEZA 1N36L 2ZM6Q 1AE2A 2ZTDA 4L5SA 1XMOL 4OWXB 1GD7A 1GVPA 4GKJQ 2I0QA 2CKZB 4PMWA 4GNXB 3BJUA 1HNZQ 1XMQQ 1WCMH 2N8NA 3M9BA 2A8VA 1E3PA 3F2CA 1O7IA 4QQBX 2UU9Q 1IBKQ 3HOWG 1X54A 2MO1A 3JC66 4OO1I 2E5LQ 4OX9Q 4IPHA 1PH5A 1YJWA 1VQJA 1N34Q 3KF8B 5IT9c 3FKIG 1KQSA 4OX9L 5IP7G 2K5NA 3EIVA 1N9WA 3S2HH 2JA7G 4C3IH 2LSSA 3UDIA 1VQEA 4R1JA 4DK6C 5LMNL 3UE0A 1JB7A 1JJGA 3T1HQ 1UE5A 4GOPB 4JBMA 3GTQH 4GN3B 2Z6KC 2B63G 2Z6KA 1XPOA 2UUAL 3J81j 1V1QA 3CF5A 1PH1A 1VQLA 2NN6I 4DR5Q 4GLXA 1X3EA 2VUMH 2JA8H 1Y1WH 3DM3A 4DUYQ 4A3MG 3E9IA 4YHHQ 4DR2L 4GNXC 4AIMA 3CXCA 4MZ9A 3HOWH 4OWWB 3I4MG 1D7QA 4A3DH 4DK3C 3HOYG 2R93H 4BXXH 2EXDA 1HR0W 1I50H 1NMGA 2XGTA 1CSPA 4QIWE 3CCQA 3CCUA 3F2DA 3FHWA 4A3KG 1HNXL 1FJGQ 1SN8A 2H5XA 2HHHQ 1XNRQ 4J15A 1RIPA 1OXSC 3NEMA 4P72A 4YCWA 1NE3A 3KJOA 3I4NH 2RHSB 4DR3Q 4LF4Q 2ES2A 1PH6A 5GROA 3S24A 1Y1WG 1JMCA 4GKJL 3PUVA 2D62A 4DR3L 4O2DA 4LF4L 4DR6L 4IOAA 4GS3A 3HOZG 4BBRG 2AMCB 1UWVA 3A5UA 4JC0A 2ZM6L 4C3JH 4DNIA 2CWAA 2EQSA 4GLVB 1XJVA 4BXXG 3E9HA 4HJ9A 1QVFA 3D0FA 1E1OA 1TWHH 4LF6L 4JI3L 1VQPA 4JI0Q 1U0LA 5FJ8H 4LFBL 2YV5A 1M90C 1VQ9A 2C35B 3B6YA 1VQDA 4NXNQ 4KLKA 4DAYB 2VZAA 1QZHA 2WB1G 1HZCA 2YTVA 4R4IA 3GO5A 1VQGA 5GQOA 2IHFA 2HIXA 5M5YH 5JEAG 4IFDJ 3RZOH 1K3RA 4JI4Q 1OXTA 2JA8G 4JV5L 2PQAB 4DV5Q 4BY7G 4DUYL 1S40A 4LF7Q 2MO0A 2OQKA 1PYSB 5AJ3Q 2UUBQ 4LFCQ 4NB3A 5BR8Q 3IRBA 1ASZA 3JAMi 3CCEA 3CCSA 4OXPA 4OONA 1SROA 1FL0A 4GNXA 2BA1A 3KLWA 5BR8L 2UUCL 2YU9H 3H0GH 1OXVA 3H15A 4A93H 1YNXA 5IYCH 4JI4L 2R7ZG 2BH2A 3HOUH 4A3LH 3VDYA 1VQFA 4WJ4A 5M3FH 3GTOH 3U4ZA 4BBSG 1VQ7A 3KDFA 1KIXA 2CQOA 1ASYA 5HGQA 5IP9H 1IBKL 4JI8Q 1OXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q46 A;  3HOY H;  2JJQ A;  3M4Q A;  3ULJ A;  1HZ9 A;  3GTL H;  1YHB A;  3HFZ B;  5IWA Q;  4A3E H;  3CC4 A;  4P73 A;  4APV A;  3JAM c;  4POG A;  3LGJ A;  5H1S E;  3BU2 A;  2VS1 A;  4PZ6 A;  4LF6 Q;  1SMX A;  2MNA A;  3S1R H;  4JI8 L;  4AQY L;  1PH3 A;  3PO3 H;  3BZK A;  2WFW A;  4HID A;  4Y7N H;  5ELN A;  1A8V A;  4B3R L;  4LFA Q;  5M3F G;  4JI2 L;  1PH4 A;  1E7Z A;  2UUB L;  4EX5 A;  3TRZ A;  3TQY A;  4X66 Q;  4X65 Q;  2ID0 A;  2ZJQ A;  4A3B G;  1A0I A;  3I4O A;  5ELO A;  3K80 C;  4A4I A;  2FXQ A;  1FJG L;  1QZG A;  1PH7 A;  1OXU A;  5AJ3 L;  4LUV A;  5IYB H;  4X64 L;  2VQE L;  3CCV A;  2V1C C;  4LW1 A;  2UXD L;  3AYH B;  3NEL A;  4GOP A;  4JI7 L;  3DLL A;  5DLQ E;  3CPF A;  4YWK A;  1X65 A;  3ULP A;  1EOV A;  1N8R C;  2R7Z H;  2F3I A;  3NBH B;  1FVI A;  5C3E H;  4XTC S;  1IXR A;  1TWA H;  4IJH A;  1VQK A;  2R7D A;  4X64 Q;  1K8A C;  3S1Q H;  4BY7 H;  2ZTC A;  4UP9 A;  1QUQ A;  1KRS A;  1HNW Q;  3J7A 5;  1TWC H;  2GVB A;  4RG1 A;  3HOX H;  4JI7 Q;  1J5E Q;  4JI3 Q;  1Q1B A;  3PUY A;  4DAM A;  4DV0 L;  3S1M H;  3OYY A;  3M4O H;  4POF A;  3KOJ A;  4A3E G;  3TS2 A;  1W3S A;  3I2Z A;  4DV0 Q;  1YHA A;  3RLO A;  4LUO A;  5C44 H;  1GKH A;  2I5H A;  2LXK A;  2VY3 A;  2NN6 G;  3UDG A;  3T1Y Q;  1VQ4 A;  4JI6 L;  2NVQ H;  4BA2 I;  4TVA B;  4JI1 L;  4LNQ A;  1HZA A;  1EQQ A;  4GOP C;  1Z9F A;  5EAY A;  3SGI A;  3S1N H;  3KFU A;  3H3V H;  2RCN A;  4QL5 A;  4IPC A;  1YHQ A;  1I94 Q;  2CCZ A;  4DR4 L;  1PH2 A;  4LFC L;  3TS0 A;  1B70 B;  4PG3 A;  4IPG A;  4DV6 L;  1S3O A;  2CWP A;  3PO2 G;  1C9O A;  4GKK Q;  1VQH A;  5M3M G;  2NVT H;  1IYJ B;  3A5Z B;  3GTJ H;  4JYA L;  3RR5 A;  1CSQ A;  3CMA A;  1SLJ A;  2K4K A;  3I7F A;  2N78 A;  2QGQ A;  5GAE C;  2VQE Q;  1YI2 A;  1HR0 L;  1JJC B;  4B3M Q;  1CKN A;  1EUJ A;  2IT1 A;  5C4J H;  1HJP A;  4A93 G;  1A63 A;  2EIF A;  1NMF A;  3PUX A;  3OTO Q;  1KD1 C;  2N49 A;  1JJ2 A;  4A3F H;  3STB C;  2JEB I;  3TEH B;  3K81 C;  3OTO L;  3M85 A;  3G6E A;  4LUZ A;  4A3G G;  2ALY B;  3S14 H;  1CKM A;  4X6A H;  1DGS A;  4XIG S;  4PZ7 A;  1L0W A;  1A62 A;  2NVX H;  2K5V A;  4A3I H;  3L0O A;  1IL2 A;  5FJ8 G;  5E7N A;  1X3F A;  2NZH A;  2Y0S E;  3ZJY C;  3L2P A;  2CFM A;  1YIJ A;  4HIO A;  2B29 A;  4ALP A;  2GN5 A;  4YHH L;  4DR2 Q;  2KHI A;  2PNH A;  2LXJ A;  2ASB A;  2PMZ E;  1WJJ A;  1BBW A;  1X9N A;  4DV7 Q;  4C2M H;  3I56 A;  4HIK A;  4BBS H;  2PI2 A;  4C3H H;  4QJF A;  1NY4 A;  2BA0 A;  4DKA C;  4DV4 Q;  1AE3 A;  4JYA Q;  4R4O A;  4A3G H;  3T1H L;  1PV4 A;  3J81 i;  5IE8 A;  4B3S L;  4YY3 L;  2KCT A;  3A74 A;  1X3G A;  2UXC L;  1TWF H;  2I5L X;  5LMU L;  4GLA C;  1SR3 A;  1IBM L;  3PO2 H;  1K0R A;  1CKO A;  4QY7 A;  1MJE A;  3PUW A;  1IBM Q;  1UE6 A;  2E2H H;  4K0K Q;  4MNO A;  1PA6 A;  2D0O A;  3CCM A;  4JG2 A;  3PF4 A;  3GDE A;  1VQ8 A;  2Q2U A;  5C0X G;  5IY0 A;  1WFQ A;  4YWL A;  4JBJ A;  5LMU Q;  1EWI A;  1N32 L;  2XTI A;  2Q2H A;  3W1G A;  3TRE A;  1HNW L;  2E5L L;  3W1B A;  4JOI A;  3UDF A;  5K36 G;  1J5E L;  3HKS A;  3PIP A;  1XPU A;  3FP9 A;  2K5H A;  1WOC A;  5FLM G;  3CPW A;  4HJ8 A;  3J7Z C;  3NEN A;  2B3G A;  1V43 A;  1YIT A;  4NPS A;  4JCV E;  2WAQ G;  3MEF A;  3Q8D A;  5IWA L;  4A3K H;  1EFW A;  3PO3 G;  2OCE A;  1PVO A;  3RN5 A;  1N33 Q;  5M5W H;  3KF6 A;  4X66 L;  2BH8 A;  1EIF A;  3I4N G;  1I94 L;  4A3F G;  3RLN A;  5IYD G;  5JEA J;  4IFD G;  2MFI A;  1NJI C;  4JI2 Q;  2VQF Q;  1K9M C;  1XNR L;  1BKB A;  3PSI A;  4DV3 L;  4IJL A;  2JA9 A;  3UE1 A;  3F8T A;  4B3T Q;  1QVC A;  1I5F A;  1HNX Q;  2JQO A;  5GAD C;  3J80 c;  1YJ9 A;  4DV2 Q;  1AH9 A;  2IX0 A;  4FDB A;  3PCO B;  1VQN A;  5GAG C;  2IHE A;  4DUZ L;  2ZJR A;  1Q7Y C;  1PYB A;  1BVS A;  4JOI C;  1JE5 A;  2L15 A;  3PV0 A;  4AH6 A;  2R92 G;  3KYH C;  4GKK L;  4P74 A;  1V9P A;  3EBE A;  5M5X H;  1X55 A;  4LF8 Q;  3K7A H;  1HR0 Q;  3CAM A;  1G6P A;  1XMO Q;  1VS0 A;  4LF8 L;  4P71 A;  2VW9 A;  4A3M H;  1SRU A;  1PFS A;  2KCM A;  4KI0 A;  4NXN L;  2E2I H;  3HOV H;  1QUQ B;  2OQ0 A;  4GN5 A;  3K0X A;  2Q2T A;  4JI6 Q;  4KHZ A;  1VQI A;  1PHJ A;  5J3B A;  1J6Q A;  4A75 A;  1I6H H;  3PIO A;  1E24 A;  3AFP A;  1BBU A;  3CC7 A;  2WP8 J;  2R92 H;  1NBW A;  3G4S A;  5IP7 H;  3T1Y L;  5LMN W;  1M1K C;  2Z0S A;  5IYC G;  3OW2 A;  2UU9 L;  4WJ3 M;  1WI5 A;  4JI1 Q;  4DV3 Q;  1Q86 C;  3M4P A;  2HQL A;  4X62 Q;  4A3C H;  4A3B H;  4KHP L;  1B8A A;  4B3S Q;  1P8L A;  1S72 A;  4Y52 H;  1B7Y B;  3STB D;  3K8A A;  1QVG A;  1CUK A;  4B3M L;  2OWO A;  4LF5 L;  5C4X G;  4DV1 L;  2GVA A;  1YBY A;  1L1O A;  2VL6 A;  1KL9 A;  4YWM A;  2JA5 H;  2JEA I;  1HZB A;  2JA6 H;  1FGU A;  4GN4 B;  2IY5 B;  5JJI A;  4RMF A;  2WB1 E;  1P16 A;  4KHP Q;  3CQZ H;  2B63 H;  4PZ8 A;  4A3J G;  3BZC A;  3CCJ A;  3S16 H;  3CP0 A;  1TXY A;  1N32 Q;  3EN2 A;  2DUD A;  2KEN A;  1YZ6 A;  4L5Q A;  4A76 A;  1PH8 A;  1I3Q H;  2A19 A;  4DUZ Q;  2ZJP A;  1EIY B;  4DV1 Q;  1W2B A;  4DR6 Q;  1UE1 A;  1WCM G;  3HOV G;  2F4V Q;  3GTG H;  3HOZ H;  3ICE A;  1LUZ A;  2NVY H;  4JBK A;  2AKW B;  4L5T A;  4ME3 A;  3K7U C;  2JE6 I;  1N34 L;  4UPA A;  5IYB G;  3RNU A;  1NTG A;  3AQQ A;  4AQY Q;  1SE8 A;  3WWV A;  3FKI H;  3UDX A;  1Q12 A;  3RN2 A;  3S17 H;  1T9H A;  2PI2 E;  1N33 L;  2JA7 H;  3AEV A;  2E2J H;  3GTP H;  4A3L G;  1KC8 C;  1G29 1;  3CCL A;  4JV5 Q;  1YVC A;  2NZO A;  5JJK A;  1Z47 A;  4DR5 L;  2UXC Q;  4R4C A;  2D0P A;  4DV7 L;  3I55 A;  4DV6 Q;  1X6O A;  2PQA A;  1Y1V G;  4DR7 L;  4HJ7 A;  1L2F A;  3CCR A;  4DV4 L;  4BY1 G;  4OO1 G;  3RLF A;  1LYL A;  2Q2I A;  1Y14 B;  1MJC A;  2ATW A;  4LF5 Q;  4X62 L;  1RL2 A;  2A1A A;  2ZTE A;  4LF9 Q;  3CD6 A;  3ULL A;  4LWC A;  1IBL Q;  3CW2 C;  1G51 A;  1E1T A;  3CC2 A;  4NXM Q;  3RZD H;  2UUC Q;  4K0K L;  4YCU A;  2UXD Q;  4BA1 I;  1HNZ L;  2HIV A;  4H02 A;  2QA4 A;  2KHJ A;  3M7N A;  4A3C G;  2AWO A;  1Q1E A;  2MQH A;  1OTC A;  1Q82 C;  2WAQ E;  2F52 A;  3GD7 A;  5IP9 G;  1Y1V H;  2AHO B;  4R4T A;  4NXM L;  5GAH C;  4MTN A;  2JA5 G;  5FLX c;  3S2D H;  4JBW A;  1C7Y A;  1EYG A;  2JA6 G;  1YJN A;  3L7Z C;  3E0E A;  3H0G G;  1K73 C;  3ER0 A;  2QEX A;  2K52 A;  4IOC A;  2N3S A;  4IFD I;  4HIM A;  1X56 A;  1LM0 A;  2RF4 A;  3KF6 B;  2OTL A;  3HKZ G;  1VQA A;  3U58 A;  4LFB Q;  1CKN B;  2VUM G;  1C0A A;  3F1Z A;  1XNQ L;  2AWN A;  3G48 A;  4DR1 L;  2DGY A;  3HOX G;  4JI5 Q;  4X65 L;  4IO9 A;  4B3R Q;  4DR4 Q;  1KAW A;  4IPD A;  1UEB A;  4A3D G;  2UXB L;  2R93 G;  4DR1 Q;  3GTM H;  1HH2 P;  1KXL A;  4UP7 A;  3S15 H;  3U50 C;  4A3I G;  4HJ5 A;  5C44 G;  4AYB G;  4DPG A;  4LF7 L;  4DR7 Q;  1H95 A;  2YTX A;  3U4V A;  1XMQ L;  2K50 A;  1IZ6 A;  4P75 A;  2VNU D;  3G71 A;  3HOU G;  5C0X I;  1Q81 C;  2JK8 A;  3PUZ A;  1VQ6 A;  4O0A A;  4QGU A;  4LF9 L;  2HT1 A;  1L1O B;  2R6G A;  5IYD H;  2Y0S G;  1JT8 A;  2E8G A;  4BY1 H;  3CME A;  3ERS X;  1WYD A;  2I5M X;  3A0J A;  4HJA A;  5FLM H;  2OTJ A;  3AFQ A;  1MIU A;  2IX1 A;  5JJL A;  1D8L A;  1VQM A;  2UUA Q;  3J80 i;  1VCI A;  1KHI A;  1VQ5 A;  1GO3 E;  1KRT A;  1R9T H;  4TQU S;  4EQ5 A;  1UE7 A;  2K14 A;  2F4V L;  4YCV A;  5LMN Q;  2K75 A;  1K83 H;  4JI0 L;  1GM5 A;  3J81 c;  1K8G A;  3PGZ A;  1Q8K A;  4UP8 A;  3W5O A;  5C3E G;  1VQO A;  4DV5 L;  1XPR A;  1VQC A;  5HY6 A;  1LTL A;  4DV2 L;  1E22 A;  3M3Y H;  1MKH A;  2UXB Q;  4AYB E;  1L1O C;  4YY3 Q;  4B3T L;  4UY8 C;  3D31 A;  4LFA L;  4L5R C;  1XNQ Q;  1N36 Q;  3GTK H;  1XTD A;  2HHH L;  3I4M H;  4JI5 L;  3PF5 A;  1SFO H;  4BBR H;  2YTY A;  5C4X H;  3KJP A;  1VQB A;  1IBL L;  3F2B A;  1U5K A;  2RHQ B;  3KDF B;  2VQF L;  5C0X J;  5M3M H;  2YYZ A;  3MXN B;  4OWT B;  1TWG H;  2R7F A;  1PH9 A;  3H3V I;  4R4Q A;  1EQR A;  3HKZ E;  4A3J H;  2KBN A;  1YEZ A;  1N36 L;  2ZM6 Q;  1AE2 A;  2ZTD A;  4L5S A;  1XMO L;  4OWX B;  1GD7 A;  1GVP A;  4GKJ Q;  2I0Q A;  2CKZ B;  4PMW A;  4GNX B;  3BJU A;  1HNZ Q;  1XMQ Q;  1WCM H;  2N8N A;  3M9B A;  2A8V A;  1E3P A;  3F2C A;  1O7I A;  4QQB X;  2UU9 Q;  1IBK Q;  3HOW G;  1X54 A;  2MO1 A;  3JC6 6;  4OO1 I;  2E5L Q;  4OX9 Q;  4IPH A;  1PH5 A;  1YJW A;  1VQJ A;  1N34 Q;  3KF8 B;  5IT9 c;  3FKI G;  1KQS A;  4OX9 L;  5IP7 G;  2K5N A;  3EIV A;  1N9W A;  3S2H H;  2JA7 G;  4C3I H;  2LSS A;  3UDI A;  1VQE A;  4R1J A;  4DK6 C;  5LMN L;  3UE0 A;  1JB7 A;  1JJG A;  3T1H Q;  1UE5 A;  4GOP B;  4JBM A;  3GTQ H;  4GN3 B;  2Z6K C;  2B63 G;  2Z6K A;  1XPO A;  2UUA L;  3J81 j;  1V1Q A;  3CF5 A;  1PH1 A;  1VQL A;  2NN6 I;  4DR5 Q;  4GLX A;  1X3E A;  2VUM H;  2JA8 H;  1Y1W H;  3DM3 A;  4DUY Q;  4A3M G;  3E9I A;  4YHH Q;  4DR2 L;  4GNX C;  4AIM A;  3CXC A;  4MZ9 A;  3HOW H;  4OWW B;  3I4M G;  1D7Q A;  4A3D H;  4DK3 C;  3HOY G;  2R93 H;  4BXX H;  2EXD A;  1HR0 W;  1I50 H;  1NMG A;  2XGT A;  1CSP A;  4QIW E;  3CCQ A;  3CCU A;  3F2D A;  3FHW A;  4A3K G;  1HNX L;  1FJG Q;  1SN8 A;  2H5X A;  2HHH Q;  1XNR Q;  4J15 A;  1RIP A;  1OXS C;  3NEM A;  4P72 A;  4YCW A;  1NE3 A;  3KJO A;  3I4N H;  2RHS B;  4DR3 Q;  4LF4 Q;  2ES2 A;  1PH6 A;  5GRO A;  3S24 A;  1Y1W G;  1JMC A;  4GKJ L;  3PUV A;  2D62 A;  4DR3 L;  4O2D A;  4LF4 L;  4DR6 L;  4IOA A;  4GS3 A;  3HOZ G;  4BBR G;  2AMC B;  1UWV A;  3A5U A;  4JC0 A;  2ZM6 L;  4C3J H;  4DNI A;  2CWA A;  2EQS A;  4GLV B;  1XJV A;  4BXX G;  3E9H A;  4HJ9 A;  1QVF A;  3D0F A;  1E1O A;  1TWH H;  4LF6 L;  4JI3 L;  1VQP A;  4JI0 Q;  1U0L A;  5FJ8 H;  4LFB L;  2YV5 A;  1M90 C;  1VQ9 A;  2C35 B;  3B6Y A;  1VQD A;  4NXN Q;  4KLK A;  4DAY B;  2VZA A;  1QZH A;  2WB1 G;  1HZC A;  2YTV A;  4R4I A;  3GO5 A;  1VQG A;  5GQO A;  2IHF A;  2HIX A;  5M5Y H;  5JEA G;  4IFD J;  3RZO H;  1K3R A;  4JI4 Q;  1OXT A;  2JA8 G;  4JV5 L;  2PQA B;  4DV5 Q;  4BY7 G;  4DUY L;  1S40 A;  4LF7 Q;  2MO0 A;  2OQK A;  1PYS B;  5AJ3 Q;  2UUB Q;  4LFC Q;  4NB3 A;  5BR8 Q;  3IRB A;  1ASZ A;  3JAM i;  3CCE A;  3CCS A;  4OXP A;  4OON A;  1SRO A;  1FL0 A;  4GNX A;  2BA1 A;  3KLW A;  5BR8 L;  2UUC L;  2YU9 H;  3H0G H;  1OXV A;  3H15 A;  4A93 H;  1YNX A;  5IYC H;  4JI4 L;  2R7Z G;  2BH2 A;  3HOU H;  4A3L H;  3VDY A;  1VQF A;  4WJ4 A;  5M3F H;  3GTO H;  3U4Z A;  4BBS G;  1VQ7 A;  3KDF A;  1KIX A;  2CQO A;  1ASY A;  5HGQ A;  5IP9 H;  1IBK L;  4JI8 Q;  1OXX K; 
#chains in the Genus database with same CATH topology
 1K83 B;  1Q46 A;  2JJQ A;  2WIN B;  3M4Q A;  4FXD A;  2L4N A;  3HFZ B;  2B8F A;  2AQ2 B;  2Z1C A;  1AEX A;  4ZYS A;  1PH3 A;  3PO3 H;  1WTO A;  5CC4 A;  4B3R L;  1A8V A;  3MZ5 A;  5M3F G;  4JI2 L;  2ZT9 C;  4EX5 A;  4X66 Q;  4X65 Q;  5ELO A;  1MGS A;  2BCO A;  2LKV A;  5AJ3 L;  2RKS A;  2V1C C;  1EZ6 A;  3HS0 C;  2A69 D;  4JI7 L;  5EJW A;  3GTP B;  1TWC B;  1X65 A;  3NBH B;  1FVI A;  1SNO A;  3UI2 A;  4XTC S;  5M5Y B;  1IXR A;  1BNZ A;  3LWU A;  2WAQ B;  4BY7 H;  4UP9 A;  1SYE A;  1HNW Q;  1BDO A;  5C5L A;  3PUY A;  1H9K A;  1JWU D;  4DAM A;  3S1M H;  3OYY A;  4POF A;  5KND A;  4A3E G;  1U4M A;  3P7J A;  3TS2 A;  3S1Q B;  1Y1W B;  3RLO A;  1MSG A;  4LUO A;  3T1Y Q;  5LL6 S;  2VY3 A;  3TBI B;  4C2M B;  3TP8 A;  4FF2 A;  5EAY A;  3S1N H;  3GQB A;  3OIP A;  3F2U A;  1YHQ A;  2CCZ A;  1GUO A;  2SEB D;  3TS0 A;  1B70 B;  1S3O A;  2VB2 X;  2OT2 A;  1C9O A;  1VQH A;  4M8A A;  3A5Z B;  5EGT A;  1LTI D;  3GTJ H;  1BBX C;  1SLJ A;  5GAE C;  1X32 A;  1CKN A;  2IT1 A;  1C4Q A;  1HJP A;  1DOL A;  5A35 A;  3PUX A;  3OTO Q;  1KD1 C;  3K57 A;  2JEB I;  1A6X A;  3G6E A;  4LUZ A;  1O7Y A;  2E2J B;  2F0H A;  4X6A H;  1DGS A;  4HSV A;  2PZU A;  1ZYR C;  4IUT A;  4A3I H;  1J9O A;  1JCK B;  3L9A X;  4ZUJ A;  4HIO A;  4ALP A;  2EYO A;  2N88 A;  3I8Z A;  2PNH A;  4IAL A;  2PMZ E;  1D1K A;  4DV7 Q;  4C2M H;  1KDA A;  2R3Z A;  1V8Q A;  3TP5 A;  4DKA C;  1Y8O B;  4DV4 Q;  4A3G H;  1RCV D;  1PV4 A;  2F0V A;  1I4G A;  2I5L X;  5LMU L;  4GLA C;  1LLR D;  4TRD A;  4KKS A;  1CKO A;  4QY7 A;  2QKI C;  5KNB A;  1IBM Q;  1UE6 A;  4K0K Q;  3CCM A;  4JG2 A;  3PF4 A;  4LAA A;  2XN9 C;  2Q2U A;  2O5I C;  1D5M C;  4S3S A;  3T56 B;  5K5P A;  1HNW L;  1T5E A;  3W1B A;  4JOI A;  4ABN A;  3FP9 A;  3PO2 B;  2F0T A;  2KQ3 A;  3M4Y A;  4HJ8 A;  3MXN A;  2B3G A;  3GTO B;  1R4P B;  1EYD A;  4OIK A;  5IWA L;  3MEF A;  3AB9 A;  5FO8 B;  3I4L A;  1O7L A;  4FF3 A;  5ELF A;  4ZQ3 A;  3TDQ A;  5IOD A;  3I4N G;  1I94 L;  4A3F G;  3RLN A;  1QB5 D;  5JEA J;  3BDC A;  3PSI A;  2JA9 A;  3F8T A;  2F0K A;  2WKD A;  3K5L A;  3TSS A;  1LAC A;  2IX0 A;  4FDB A;  5IIF A;  2L12 A;  1BVS A;  1GUW A;  3KYH C;  4GKK L;  4P74 A;  2KOL A;  3EBE A;  5M5X H;  2NTT A;  1HR0 Q;  5I6W A;  1G6P A;  4P71 A;  4NXN L;  3SHL A;  4JI6 Q;  5J3B A;  3NQI A;  3DEO A;  1F9R A;  4P2C B;  1EY9 A;  1NBW A;  3G4S A;  2P5Z X;  1GHK A;  3V96 A;  3TZD A;  4DV3 Q;  4JW0 A;  4PQX A;  2KUM A;  1RD9 D;  1A3V A;  1FNW A;  4A3I B;  1JWM D;  1P8L A;  4Y7N B;  1PRT D;  3NPP A;  1S72 A;  4LF5 L;  3NP8 A;  3V2T A;  4DV1 L;  1YBY A;  1KL9 A;  2JA5 H;  1NR4 A;  1TT2 A;  5JJI A;  3Q0A A;  3D6W A;  2SDF A;  4KHP Q;  3MVV A;  4XT3 B;  3CCJ A;  4A3J G;  3S16 H;  1TXY A;  3EJI A;  3HOY B;  3P1H A;  3EN2 A;  2DUD A;  1EY4 A;  2KEN A;  4A76 A;  3N52 A;  2ZJP A;  3H91 A;  3KF8 A;  3KLS X;  4DR6 Q;  1F2Y A;  3HOV G;  3MFG A;  1LUZ A;  3LX0 A;  2AKW B;  1KDB A;  4UPA A;  2C5C A;  1STN A;  3EA6 A;  1BUV T;  2K04 A;  2JA7 H;  5JOB A;  3AEV A;  3NWS A;  1G29 1;  3CCL A;  1I3Q B;  3N6R A;  5JJK A;  4RKB A;  5I9O A;  4FYD A;  3MXP A;  1EU3 A;  4JPB W;  3CCR A;  4OO1 G;  2MUY A;  2HDL A;  1Y14 B;  1K8M A;  3QB3 A;  1IBL Q;  1G51 A;  4BY7 B;  4FXG C;  2XWB B;  2UXD Q;  1LV9 A;  2HIV A;  1STA A;  1QWY A;  4H02 A;  1B3A A;  4FNF A;  4X3T A;  2XRS D;  2AWO A;  3SR1 A;  1Q82 C;  5EKL A;  3NWT A;  4NXM L;  1WTH A;  5GAH C;  1B9M A;  3QG1 A;  1PTO F;  3S2D H;  5C4X B;  1EYC A;  2JXM B;  2JA6 G;  3E0E A;  3OW7 A;  3H0G G;  3ER0 A;  1RKN A;  5KEE A;  2K52 A;  1IYV A;  2N3S A;  2SNS A;  1SBB B;  4XQJ A;  2A6E C;  1LM0 A;  3KF6 B;  4MIU A;  1DOM A;  1VQA A;  3U58 A;  4LJZ C;  1TY0 A;  2NB0 A;  2AWN A;  3G48 A;  4DK1 A;  4DR1 L;  4IPD A;  2UXB L;  1CK1 A;  1HH2 P;  1STH A;  1EYA A;  1KXL A;  4GZY C;  1JQY D;  4DPG A;  2K50 A;  1VF5 C;  4P75 A;  4DU9 A;  2VNU D;  1YNJ C;  2OF1 A;  3A56 A;  1WTR A;  1V1P B;  3SE0 A;  2R6G A;  2Y0S G;  2FMC A;  2OEO A;  2E8G A;  3ERO A;  3CME A;  4OEL B;  1FGB D;  2OTJ A;  4JVZ A;  1D8L A;  1VQM A;  3J80 i;  2AUK A;  4E6I A;  2F4V L;  3ERQ A;  5LMN Q;  1SSO A;  1GM5 A;  1QIL A;  4UP8 A;  5C3E G;  4DV5 L;  5C3E B;  3PIO 3;  1LTL A;  4I7A A;  1A3T A;  1MKH A;  5JEA H;  4QB4 A;  4B3T L;  3GTK H;  4L5R C;  2KJX A;  1XNQ Q;  1KTK A;  2HHH L;  4FXK C;  3HEJ A;  1SFO H;  1LT6 D;  3CRL C;  3BVM A;  3KDF B;  3NSW A;  2YYZ A;  2R7F A;  1ILP A;  1V1P A;  1KAB A;  1XMO L;  1SNC A;  3A7L A;  1GD7 A;  4GKJ Q;  1WD1 A;  1DXM A;  3DUZ A;  2N8N A;  3F2C A;  1O7I A;  3HOW G;  1X54 A;  3HOW B;  4IPH A;  4PMC A;  1KQS A;  5ELB A;  4KD4 A;  3UDI A;  4R1J A;  2B63 B;  4GOP B;  1XPO A;  3J81 j;  3CF5 A;  2NN6 I;  4GLX A;  3J81 L;  4A3M G;  2DJG C;  4DR2 L;  3CRK C;  1ESF A;  4HCS A;  4OWW B;  3I4M G;  4DK3 C;  4A3J B;  3HOY G;  2EXD A;  1HR0 W;  1I50 H;  5JPM C;  3CCQ A;  1SN8 A;  2HHH Q;  1XNR Q;  2F0S A;  1K8O A;  3NEM A;  4P72 A;  4YCW A;  3ITP A;  5C4J B;  1NE3 A;  5M3F B;  3KJO A;  3I4N H;  2RHS B;  4LF4 Q;  5IGB A;  2QIL A;  5GRO A;  3NK9 A;  1HTP A;  1Y1W G;  2EY5 A;  3QOL A;  4DR3 L;  4GS3 A;  1IW7 C;  2AMC B;  1UWV A;  1XJV A;  2CWA A;  3VR3 A;  4FP5 D;  1XTC D;  3D0F A;  4ODG A;  2M9V A;  4LF6 L;  2RBM A;  4JI0 Q;  1EIG A;  2PNR C;  1RTN A;  4LFB L;  1CI3 M;  3K5O A;  4C1N K;  1VQD A;  1HCZ A;  5CV7 A;  1GUN A;  1TII D;  3BYT B;  2YTV A;  5M5Y H;  4BBS G;  1VQG A;  2IHF A;  4IUR A;  5JEA G;  3RZO H;  4OGQ C;  1OXT A;  5I2Y A;  4JI4 Q;  2PQA B;  2UUB Q;  3MHB A;  3WOE A;  2EYF A;  4RH6 A;  3IRB A;  5CYU A;  1YNJ D;  3CCE A;  4OXP A;  1FL0 A;  2BA1 A;  5BR8 L;  1PFM A;  2UUC L;  2NZ1 D;  1OXV A;  1YNX A;  2BH2 A;  3HOU H;  2HQE A;  1EQT A;  3SK5 A;  1CFM A;  4EVO A;  3VDY A;  4WJ4 A;  5M3F H;  3GTO H;  3U4Z A;  3FMC A;  3KDF A;  1E2Z A;  2CQO A;  4HED A;  1KIX A;  5IP9 H;  4KK7 A;  4AQY Q;  2DNE A;  1I4X A;  3ULJ A;  5J39 A;  4FF1 A;  2HCI A;  5KRU A;  3CC4 A;  3DEP A;  4P73 A;  3JAM c;  4POG A;  5H1S E;  3BU2 A;  2VS1 A;  3I90 A;  1SMX A;  2MNA A;  2QDB A;  1PZI D;  4JI8 L;  4HID A;  1VMP A;  5ELN A;  2E76 C;  4LFA Q;  1K0S A;  3S9W A;  3SXH A;  4IFD H;  5D65 A;  3VYS A;  1TR5 A;  2ID0 A;  1A0I A;  3I4O A;  4A4I A;  3K80 C;  2F0I A;  2FXQ A;  4ZKC B;  1OXU A;  4K5V A;  4X64 L;  2VQE L;  3CCV A;  2UXD L;  3DLL A;  2AUJ D;  1B50 A;  3CPF A;  4YWK A;  1JOR A;  2F3I A;  2OXP A;  4U68 A;  3U9S A;  4X3U A;  2B2W A;  2R7D A;  1K8A C;  3S1Q H;  2L5T A;  1QUQ A;  3S1R B;  1TWC H;  1F2M A;  4RG1 A;  4JI7 Q;  1J5E Q;  1ET6 A;  5C5M A;  1Q1B A;  4DV0 L;  5JVH 3;  4ME5 A;  4A3F B;  3M4O H;  2KED A;  1SXT A;  4G7H C;  4BA2 I;  1VQ4 A;  3UDG A;  4RKL A;  1BXT A;  4JI1 L;  4LNQ A;  1EQQ A;  5ELC A;  4RA8 A;  4R8I A;  3SGI A;  3J80 E;  2HDM A;  1G2T A;  2RCN A;  4IPC A;  1I94 Q;  4N8F A;  1PH2 A;  1TS2 A;  4IPG A;  4DV6 L;  2CWP A;  1HUM A;  4QMG A;  4GKK Q;  5M3M G;  2NVT H;  1IYJ B;  3ZYY X;  4JYA L;  1CSQ A;  2WB1 B;  2K4K A;  3I7F A;  1HR0 L;  2N78 A;  2NUC A;  2RA4 A;  2WKC A;  4B3M Q;  3GV3 A;  1GUT A;  4K5X A;  1STE A;  2PMZ B;  2N49 A;  4IUV A;  3VYU A;  3M7G A;  4A3G G;  4G7O C;  4M1U B;  4PZ7 A;  5IGE A;  1A62 A;  1IL2 A;  2LMC B;  2B2V A;  3J81 E;  2Y0S E;  3QR8 A;  2CFM A;  4YHH L;  3OHX C;  2PI2 A;  1WTV A;  1I4Q A;  1R9T B;  2BA0 A;  1HRJ A;  1DD2 A;  5ELD A;  3J81 i;  3D3R A;  4B3S L;  2ENB A;  5IGD A;  1ZEQ X;  2KCT A;  3A74 A;  1X3G A;  3S2D B;  1TWF H;  3PO2 H;  1SR3 A;  3OMG A;  1K0R A;  4DK0 A;  1SNQ A;  4QCL A;  2DJF C;  1PA6 A;  4O42 A;  2EE1 A;  3X3N A;  5IY0 A;  5I6Y A;  3RMH A;  2E2D C;  2HUG A;  5ELE A;  5LMU Q;  1LTA D;  4R8N A;  5C44 B;  3K6O A;  2K5D A;  5CV9 A;  1EY5 A;  5K36 G;  1J5E L;  2EYH A;  1XPU A;  2K5H A;  1EY7 A;  1B2T A;  3CPW A;  3J7Z C;  1V43 A;  2A74 C;  3OMC A;  3SVM A;  2BH8 A;  1EIF A;  1FYC A;  1T5X D;  2XSC A;  2MFI A;  4K6L A;  1XNR L;  3CU7 A;  3UE1 A;  1QVC A;  1YNN D;  3BVZ A;  3J80 c;  1YJ9 A;  1SFO B;  4DV2 Q;  4DA2 A;  2E74 C;  1VQN A;  5CR3 A;  2I07 B;  2IHE A;  5CGK A;  4CJ0 B;  1Q7Y C;  5HUR A;  2L15 A;  5A2Q E;  1B4O A;  1V9P A;  1X55 A;  4LF8 Q;  1ZKO A;  3K7A H;  3CAM A;  5JPN C;  3H0G B;  4A3M H;  1SRU A;  5DEH A;  1XWE A;  3KLS A;  2E2I H;  5DAU A;  5E1F A;  1QUQ B;  2RDG A;  4GN5 A;  3K0X A;  1V1O A;  2Q2T A;  2XIW A;  2MHV A;  5BN5 A;  3SEB A;  2B39 A;  5LMN W;  2UU9 L;  4WJ3 M;  5M5W B;  1STG A;  4HN7 A;  4Q5V A;  1G91 A;  2Z9H A;  4UAI A;  4C56 C;  1JB3 A;  3D6C A;  1EFI D;  4C1N I;  4A3B H;  1B8A A;  4B3S Q;  4EGV A;  2OWO A;  5C4X G;  2GVA A;  2JEA I;  3IKJ A;  4GN4 B;  2IY5 B;  2MPM A;  2WB1 E;  2B63 H;  4PZ8 A;  1N32 Q;  3CP0 A;  1PH8 A;  1PFB A;  1EIY B;  4DV1 Q;  4L8J A;  1EWH A;  5D14 A;  2K03 A;  3DWQ A;  1WCM G;  4DFA A;  4IUN A;  3PIP 3;  1WCM B;  2F4V Q;  5CV5 A;  4L5T A;  4DXF A;  1LTG D;  5IYB G;  1HQR D;  1NTG A;  3FKI H;  3UDX A;  1Q12 A;  3S17 H;  1T9H A;  2PI2 E;  4NKL A;  3GTP H;  5DNF A;  2V4D A;  4KY6 A;  4RHR A;  4DR5 L;  2UXC Q;  3BG3 A;  1TWA B;  1UNS A;  3I55 A;  3PO3 B;  3OPO A;  1X6O A;  2PQA A;  4CGY B;  3GTG B;  1PZK D;  1EL0 A;  3DXJ C;  1MJC A;  2Q8T A;  4LF5 Q;  1RL2 A;  2ZTE A;  5TSS A;  1EEI D;  1HUN A;  3CW2 C;  4K2K A;  2JA8 B;  4L63 B;  4J1M A;  4A3G B;  4Q0F A;  2F0D A;  2K33 A;  3VYT A;  1BCP B;  3IAY A;  2WAQ E;  2F52 A;  5IP9 G;  4R4T A;  1B3Q A;  4F87 A;  1OO9 B;  1PDQ A;  4MTN A;  1L0X B;  2JA5 G;  4JBW A;  3R2T A;  1C7Y A;  1EYG A;  2KCC A;  3WOF A;  1QJO A;  3RD4 A;  4A3M B;  1ZXT A;  5EKI A;  2RDH A;  4QUF A;  1X56 A;  2Z4I A;  1SYG A;  3HKZ G;  3KLR A;  1CKN B;  1YNN C;  1C0A A;  4DN4 M;  1JOK A;  4A3D B;  1SYF A;  4DR4 Q;  1LT4 D;  4A3D G;  1UEB A;  1GXD C;  1ENC A;  2B8G A;  4IZ8 A;  1WD0 A;  2EDG A;  1EY0 A;  4A3B B;  1BOS A;  2YTX A;  1XMQ L;  1IZ6 A;  4YIJ A;  1SYB A;  3G71 A;  1GUG A;  1VMC A;  1TWH B;  2HT1 A;  1W6J A;  5EBD A;  2CVR A;  2BE5 C;  1WYD A;  2I5M X;  2C9O A;  4ZCK A;  4HJA A;  3A8K E;  5FLM H;  1WTQ A;  3BDO A;  1EQV A;  5JJL A;  2UUA Q;  5G3L F;  1KHI A;  4TQU S;  4EQ5 A;  2K14 A;  4YCV A;  5E4W C;  3HOV B;  3TME A;  4JI0 L;  1WTP A;  3J81 c;  1K8G A;  1CM9 A;  2M2L A;  1VQO A;  1ENA A;  5F2D A;  5C0X H;  4NW2 A;  3M3Y H;  1STY A;  3E0J A;  2UXB Q;  4KN7 C;  5DM7 3;  3D4R A;  1N36 Q;  2X6L A;  3VA5 A;  2YTY A;  2M00 A;  1VQB A;  3DM1 A;  3KBG A;  3F2B A;  1U5K A;  3VA7 A;  4K8J A;  5C0X J;  5M3M H;  3MXN B;  3VR2 A;  5IOC A;  3D8G A;  3I70 A;  3J7Y W;  3HKZ E;  4OWX B;  1QCB D;  1EOT A;  1XMQ Q;  2NVY B;  4B9W A;  4QQB X;  3JC6 6;  2K32 A;  1AN8 A;  4OO1 I;  2E5L Q;  1SNP A;  1U4P A;  1VQJ A;  1N34 Q;  4OX9 L;  5IP7 G;  2K5N A;  3EIV A;  4N9P A;  5LMN L;  5FLX E;  5IT9 E;  2H4O A;  3UE0 A;  1ROD A;  3T1H Q;  1UE5 A;  3O13 A;  4ZKB B;  5M5X B;  4GN3 B;  2Z6K C;  2G9D A;  2Z6K A;  1KAA A;  2UUA L;  1VQL A;  1LO5 D;  4IUQ A;  4DNT B;  1X3E A;  2JA8 H;  1Y1W H;  3SK4 A;  3DM3 A;  4DUY Q;  3E9I A;  3I73 A;  4AIM A;  1A2T A;  4MZ9 A;  4A3D H;  1FR3 A;  1EZ8 A;  1BR9 A;  3I91 A;  2QCP X;  1TWF B;  1O80 A;  2XGT A;  2EZV A;  1HNX L;  3F2D A;  3FHW A;  3J7A F;  4C3I B;  4IUU A;  4C3I G;  1U4R A;  4J15 A;  3E3X A;  5FO9 B;  3KK7 A;  1JE4 A;  2F0F A;  1ENF A;  1GOZ A;  3HP3 A;  2ES2 A;  4O1N A;  2F0U A;  4GKJ L;  3HRZ C;  4DR6 L;  3HOZ G;  3MC0 B;  5EPL A;  4BBR B;  4DNI A;  4GLV B;  4BXX G;  3E9H A;  1ONL A;  1E1O A;  1M90 C;  2PZW A;  2C35 B;  1D6E C;  3FVQ A;  1E0B A;  2R61 A;  4DAY B;  2VZA A;  4G57 A;  5LL6 X;  2WB1 G;  1HZC A;  5EPJ A;  5GQO A;  3TP7 A;  4IFD J;  2F0P A;  1K3R A;  3EFX D;  2EOT A;  1F77 A;  1Y8N B;  1PTO B;  1S40 A;  4LF7 Q;  2OQK A;  1ASZ A;  3QWN A;  3CCS A;  5EBC A;  3KLW A;  2RSN A;  4ZK9 B;  3H0G H;  4A93 H;  4JI4 L;  2NWG A;  4A3L H;  3MXG A;  5EPK A;  1ASY A;  3HZX A;  2F1M A;  1SE2 A;  3S15 B;  1OXX K;  3ND9 A;  4HTH A;  3HOY H;  3S16 B;  1YHB A;  2KVM A;  2QDL A;  5IWA Q;  4A3E H;  3LGJ A;  1H9S A;  2L11 A;  1HXY D;  4LF6 Q;  1RTO A;  3H6M A;  1G8Z D;  2O5J C;  4AQY L;  2CW0 D;  3BZK A;  1CZW A;  3BVG A;  4FVM A;  1CTM A;  1W6K A;  1PH4 A;  1JC7 A;  2I46 A;  2XRQ D;  2UUB L;  2JA7 B;  3GTL B;  2ZJQ A;  4A3B G;  1KDC A;  4G7Z C;  5CBE E;  1KLG D;  1FJG L;  5HGT A;  1GHJ A;  5IYB H;  2TSS A;  2B2Y A;  3P20 A;  4DAY A;  4LW1 A;  1AFP A;  1O78 A;  1MBY A;  3NEL A;  1Q8I A;  3VYR A;  4GOP A;  1XYI A;  5DLQ E;  5A2Q L;  2RQX A;  4CDE C;  4CHT B;  3C1F A;  2R7Z H;  1AW7 A;  1FNV A;  5C3E H;  1TWA H;  4IJH A;  4X64 Q;  4A3K B;  1J8I A;  4ZUI A;  2RDF A;  3TP6 A;  1KRS A;  4DAP A;  4CJ2 C;  3GTK B;  2QF7 A;  3HOX H;  3NQT A;  4U67 3;  1PRT C;  4A3E B;  3J7A V;  3I2Z A;  3L3O C;  4XQN A;  1GKH A;  2I5H A;  2LXK A;  4JI6 L;  2BDO A;  2NN6 G;  2NVQ H;  4TVA B;  1HZA A;  4X3K A;  4GOP C;  5JJZ A;  3ND8 A;  4WRD A;  4QL5 A;  4DR4 L;  4JK1 C;  2R92 B;  1KNE A;  3MWY W;  1NSN S;  3C2P A;  1AZQ A;  1H9S B;  3RR5 A;  1AZP A;  2QGQ A;  2VQE Q;  1JJC B;  2D2C C;  1IYU A;  1DYQ A;  4A93 G;  1TY2 A;  1A63 A;  4CKB A;  2F0E A;  2EIF A;  1JJ2 A;  1JWS D;  3STB C;  1SE3 A;  3TEH B;  5KNC A;  3OTO L;  3M85 A;  1M8A A;  3SDZ A;  5C6A A;  4IQZ A;  1CKM A;  4RHS A;  4XIG S;  3NBI A;  1L0W A;  4ILW A;  2BOS A;  1K28 A;  1MI2 A;  1O7Z A;  4X3S A;  5FJ8 G;  5E7N A;  1X3F A;  1YIJ A;  3NTI A;  2GN5 A;  4DR2 Q;  2DNC A;  3R8B A;  2KHI A;  4CDC C;  3K58 A;  1WJJ A;  1X9N A;  4HIK A;  2L1B A;  3I56 A;  1BQQ T;  2WV6 D;  1H9J A;  2CHB D;  4QJF A;  1NY4 A;  1SDF A;  5D3I B;  1AE3 A;  4JYA Q;  3T1H L;  1HFG A;  1XX8 A;  2MJ8 A;  1S5D D;  4YY3 L;  2LS0 1;  1IBM L;  3C46 A;  3K5N A;  1B9N A;  3VR5 A;  2KCN A;  4KY5 A;  4QIW B;  2SOB A;  4HMI A;  3GDE A;  1VQ8 A;  2DY8 A;  2CW0 C;  5C0X G;  1MD2 D;  3Q22 A;  1BCP C;  4JBJ A;  1KLU D;  1N32 L;  4XYQ A;  3W1G A;  3TRE A;  2E5L L;  4C3J G;  1E2W A;  2YU9 B;  4C3J B;  3PIP A;  1TS4 A;  1JIC A;  5FLM G;  3J80 L;  4ID6 A;  5CV4 A;  1EU4 A;  1YIT A;  3M3Y B;  4NPS A;  4A3K H;  2B2T C;  2LY7 A;  3TN2 A;  3PO3 G;  1PVO A;  4MN3 A;  3KF6 A;  5FO7 B;  4X66 L;  2ICE C;  1X3P A;  5IYD G;  1SJH D;  3OIQ A;  4JI2 Q;  2VQF Q;  1TWG B;  1BO0 A;  1WTX A;  1I5F A;  2PW7 A;  1HNX Q;  2JQO A;  2NYZ D;  2O2L D;  2K1B A;  2WII B;  3A7A B;  1PYB A;  1SEB D;  4JOI C;  1JE5 A;  4AH6 A;  4F7X A;  4HSP A;  4KJO A;  4XYO A;  2JA5 B;  3A8I E;  3GV6 A;  3HOV H;  1PFS A;  2OQ0 A;  2IWH A;  1LTS D;  4KHZ A;  1VQI A;  1PHJ A;  1J6Q A;  3A55 A;  1I6H H;  2A68 C;  3PIO A;  1E24 A;  3AFP A;  1BBU A;  4EQP A;  3CC7 A;  2WP8 J;  2R92 H;  3K0Y A;  3IFD A;  5IP7 H;  3T1Y L;  1M1K C;  4H0L C;  5IYC G;  4XQQ A;  3KBX A;  4PV1 C;  2A6H D;  2AQ1 B;  2HQL A;  3I3C A;  1JOO A;  2B2Y C;  4A3C H;  3P75 A;  2F3V A;  1S4Z A;  2F0G A;  1CUK A;  1QVG A;  1X3Q A;  3X3M A;  2B2U A;  2PZT A;  2VL6 A;  1L1O A;  3FEW X;  3I72 A;  1HZB A;  4FO2 A;  4PMB A;  4OEM B;  1U4L A;  1F9S A;  3MA2 B;  3NE5 B;  4L5Q A;  1K3B C;  2A19 A;  3EQL C;  1W2B A;  1UE1 A;  3DMU A;  1UEA B;  3GTG H;  2ICI A;  3HOZ H;  3ICE A;  2CQA A;  4HMJ A;  3C3L A;  4ME3 A;  2E75 C;  3RNU A;  1LTB D;  1SE8 A;  3WWV A;  1ESR A;  3RN2 A;  1SMY D;  3ONA B;  4A3L G;  5IT9 L;  2NZO A;  1Z47 A;  1D5X C;  4R4C A;  4RCO A;  4DV7 L;  4DV6 Q;  2J7Z A;  5CV8 A;  1L2F A;  2RSO A;  4DV4 L;  4BY1 G;  1CHQ D;  1ZYR D;  3RLF A;  1LYL A;  2Q2I A;  2VXW A;  4QF4 A;  3CD6 A;  1SYD A;  3ULL A;  4B08 A;  4RGO S;  3CC2 A;  3BYY B;  4V19 0;  1CQV A;  1WTW A;  4K0K L;  4DXG A;  1A2U A;  2MQH A;  3MEH A;  4WJW A;  3GD7 A;  1Y1V H;  2AHO B;  2B2V C;  1TVX A;  2K28 A;  1BF4 A;  1SND A;  4OIJ A;  4KD3 A;  1DJR D;  1MHW C;  2K05 A;  3S1N B;  1DON A;  2EY1 A;  3S14 B;  2QEX A;  4IOC A;  3H94 A;  3R3O A;  1WVL A;  2RF4 A;  3FDT A;  2OTL A;  4LFB Q;  1NAP A;  2EY6 A;  1LTR D;  3F1Z A;  1BCP D;  1CHP D;  2DGY A;  3HOX G;  4JI5 Q;  4X65 L;  4IO9 A;  4B3R Q;  4DR1 Q;  3DWP A;  4UP7 A;  3S15 H;  1HFN A;  3U50 C;  5KYI A;  3U4V A;  3HOZ B;  1H9R A;  4K14 A;  3HOU G;  5C0X I;  1XXG A;  3HOU B;  2JK8 A;  4O0A A;  1DOK A;  5I4D A;  4QGU A;  1L1O B;  1PZJ D;  1TKW B;  4BWG B;  1Y1V B;  2D9U A;  2EYJ A;  3A0J A;  3GTJ B;  3AFQ A;  1MIU A;  2IX1 A;  1C8C A;  1VCI A;  2VB3 X;  2A5H A;  2K75 A;  2A73 B;  3W5O A;  2ZXO A;  2EYM A;  5IGF A;  1XPR A;  5M9O A;  1VQC A;  4DV2 L;  1E22 A;  1F9P A;  3S2H B;  1CA6 A;  4YY3 Q;  4I7Z C;  3HGB A;  4LFA L;  3I4M H;  1XTD A;  4BBR H;  3S1M B;  3KJP A;  5EKK A;  4XT1 B;  2VQF L;  2RHQ B;  4N8X 1;  4H7B A;  1EQR A;  1STB A;  4A3J H;  2KBN A;  1YEZ A;  5D3D A;  1N36 L;  1NNX A;  2NTS A;  3QJY A;  3MAQ A;  1GVP A;  2I0Q A;  2CKZ B;  4HR7 B;  4GNX B;  1HNZ Q;  4QUC A;  1E3P A;  4EQN A;  2UU9 Q;  2A69 C;  1SMY C;  2EYL A;  5IT9 c;  3KUP A;  2MGS A;  1D5Z C;  1N9W A;  2JA7 G;  4C3I H;  2LSS A;  3S2H H;  1VQE A;  1JJG A;  1S5B D;  2CH4 A;  4JBM A;  2B63 G;  1NUC A;  1PH1 A;  3HG9 A;  4I65 A;  1PMR A;  4RFB A;  4GNX C;  3I4M B;  3CXC A;  1D7Q A;  2XVS A;  4BXX H;  1M4V A;  2F0Q A;  1CSP A;  4QIW E;  1FJG Q;  4A3K G;  4XXE A;  2F03 A;  2H5X A;  1TQO A;  1D1I A;  4IUP A;  2PO4 A;  3T53 B;  1IHZ A;  4DR3 Q;  3IL8 A;  3T13 A;  1I6H B;  3S24 A;  1JMC A;  4TSS A;  4LF4 L;  2D62 A;  4O2D A;  1E2V A;  1RHP A;  3RZD B;  4C3J H;  2EQS A;  3M4O B;  2EJG C;  2PQE A;  1TS3 A;  4UHV A;  1U0L A;  2K7V A;  5CBA E;  5CMD A;  3B6Y A;  2SNM A;  2EPB A;  4KLK A;  4K2L A;  4KTA A;  4R4I A;  4MHE A;  3GO5 A;  4BBS B;  4NDX A;  2HIX A;  3A8J E;  4BY7 G;  4DUY L;  2ZXR A;  1HTL D;  1LT3 D;  2BDN A;  5AJ3 Q;  4NB3 A;  5BR8 Q;  2IJ0 A;  1SRO A;  3PQI A;  5LHY 1;  4GNX A;  2JSO A;  2YU9 H;  3E6Z X;  3H15 A;  5IYC H;  4XDX A;  1VQF A;  4H13 C;  1VQ7 A;  2NVT B;  2JA6 B;  5T1G A;  2F0M A;  1IBK L;  4CJ1 B;  3NXW A;  2RVL A;  3U9O A;  1HZ9 A;  3GTL H;  1GUS A;  3AU7 A;  1G6Z A;  4APV A;  3H09 A;  4PZ6 A;  3S1R H;  2IW3 A;  2WFW A;  4Y7N H;  5L37 A;  2QW7 A;  1ILQ A;  1E7Z A;  4HAE A;  3TRZ A;  3S17 B;  3TQY A;  2PW5 A;  3RUZ A;  2JYO A;  5KGU A;  1QZG A;  1PH7 A;  1HQM C;  3JAM L;  4LUV A;  5J1Z A;  4C3H B;  1QE6 A;  3AYH B;  2Y0S B;  3FPP A;  5JAV A;  5CV6 A;  3ULP A;  1EOV A;  1N8R C;  1VQK A;  3T51 B;  3BZD B;  4UDU C;  2ZTC A;  1IW7 D;  3J7A 5;  2GVB A;  4JI3 Q;  1CA5 A;  3SK8 A;  4DF7 A;  3KOJ A;  1W3S A;  3PMF A;  4DV0 Q;  1YHA A;  4OHJ A;  4L6T B;  5C44 H;  2PCF B;  2R7Z B;  1QG7 A;  2ZXP A;  1RF2 D;  4KMU C;  1Z9F A;  1VDZ A;  3KFU A;  3H3V H;  1ICF B;  4LFC L;  2NVQ B;  3QOJ A;  4PG3 A;  2HD3 A;  3PO2 G;  2G9H D;  1F2L A;  1I4H A;  1VF7 A;  3CMA A;  3LNN A;  3NBH A;  1YI2 A;  1EUJ A;  2F0O A;  1BCP F;  5C4J H;  2JN4 A;  1NMF A;  4ULL A;  4G4K A;  1NCV A;  5IGG A;  4A3F H;  3K81 C;  2KHS A;  2EY2 A;  2EJM A;  2ALY B;  3S14 H;  4CDD C;  4RGN A;  2A68 D;  1H9M A;  2B2U C;  2NVX H;  2K5V A;  3L0O A;  3NHH A;  1LTT D;  1DM0 B;  4RGM A;  2NZH A;  3ZJY C;  3L2P A;  4N9T A;  2B29 A;  1EY8 A;  2HCC A;  5DM6 3;  2LXJ A;  2ASB A;  2K6A A;  1BBW A;  2F4I A;  4F8M A;  4BBS H;  4C3H H;  1PXU A;  4R4O A;  4ZLT F;  1KNA A;  3CQZ B;  5IE8 A;  2L0C A;  1PTO C;  3BS1 A;  2UXC L;  2G5D A;  4OL7 A;  1DCZ A;  2DY7 A;  1MJE A;  2XWJ B;  3PUW A;  5J22 A;  3OOC A;  5C4H A;  2E2H H;  4MNO A;  4RAU C;  5EQ0 A;  1SNM A;  2D0O A;  1WFQ A;  4RGT A;  1AP0 A;  5JVG 3;  4YWL A;  1EWI A;  3G6J B;  4CKC A;  2XTI A;  2Q2H A;  2MP1 A;  4AYB B;  2NVX B;  2E2I B;  2Z8L A;  3UDF A;  3HKS A;  2K5Q A;  5BN3 A;  1WOC A;  3NEN A;  5FOB B;  4JCV E;  2WAQ G;  3Q8D A;  1EFW A;  4Z9C B;  3D4W A;  2OCE A;  4A93 B;  2F3W A;  3RN5 A;  1N33 Q;  5M5W H;  3G7L A;  4IFD G;  1NJI C;  1A3U A;  5C4Z A;  2B2T A;  1K9M C;  1BKB A;  4DV3 L;  1PTO H;  4IJL A;  4B3T Q;  1PRT F;  5GAD C;  2BE5 D;  2EYP A;  1AH9 A;  3PCO B;  4MTK A;  5GAG C;  1CQF A;  1S5F D;  2ZJR A;  4DUZ L;  1I4R A;  3PV0 A;  5KYL A;  2R92 G;  2LFN A;  3VR4 A;  3CHB D;  3CKI B;  1XMO Q;  1VS0 A;  1F2Z A;  3JAM E;  4LF8 L;  2EXZ A;  5IGC A;  1Q3L A;  2VW9 A;  2KCM A;  4KI0 A;  5G3L D;  5C3W A;  2AQ3 B;  4CDF C;  1ML0 D;  1LAB A;  4A75 A;  3NTH A;  4NMZ A;  5COR A;  1PRT B;  1QNU A;  2F0N A;  3C1E A;  4DGZ A;  2KA7 A;  1I4P A;  3RZO B;  1L0Y B;  2Z0S A;  3OW2 A;  1WI5 A;  4JI1 Q;  1RDP D;  1PLF A;  4RCN A;  1Q86 C;  3M4P A;  1IL8 A;  4X62 Q;  1I50 B;  3FKI B;  4J8Q A;  2FMM A;  2J4X A;  2O4X A;  2FJ2 A;  2Z4H A;  4KHP L;  4RWS C;  1IKL A;  1QOH A;  1B7Y B;  2FHT A;  3K8A A;  3STB D;  4B3M L;  4Y52 H;  4J6H A;  1B53 A;  4YWM A;  3W3A A;  3H3V C;  1SYC A;  3EVQ A;  2JA6 H;  1FGU A;  3R93 A;  2K5W A;  4RMF A;  1P16 A;  3CQZ H;  1EEF D;  2NN6 H;  3BZC A;  1YZ6 A;  3I4N B;  1I3Q H;  5FK9 C;  3GTM B;  4DUZ Q;  4NP5 A;  3A54 A;  3NTK A;  5C3X A;  3HOX B;  2Q8R E;  1SJE D;  5NUC A;  2NVY H;  4K6D A;  4JBK A;  3E5S A;  3R2I A;  3K7U C;  2JE6 I;  1N34 L;  1PTO D;  1UUP A;  3AQQ A;  3QIA A;  1FNU A;  1EWC A;  4R9W A;  1B44 D;  1Y8P B;  2FFK B;  5E3F A;  2E2J H;  1N33 L;  1KC8 C;  4JV5 Q;  1YVC A;  3GTQ B;  5M3M B;  4PNY A;  2CH4 W;  2D0P A;  2WAC A;  3Q24 A;  1TS5 A;  4DR7 L;  1Y1V G;  2RCF A;  4HJ7 A;  3WDN A;  1TU2 B;  1FD7 D;  2ATW A;  4X62 L;  1C48 A;  2A1A A;  3Q23 A;  4LF9 Q;  1JR0 D;  3DWA A;  1ET9 A;  4LWC A;  1E1T A;  4NXM Q;  1UAP A;  3RZD H;  2UUC Q;  4YCU A;  4BA1 I;  1HNZ L;  3OWE B;  1Z6H A;  3QO2 A;  2QA4 A;  2KHJ A;  4FF4 A;  3M7N A;  4A3C G;  4IN3 A;  1Q1E A;  1OTC A;  2JP1 A;  1CT1 D;  1DZ1 A;  2IPK D;  3BDL A;  2K01 A;  5FLX c;  4KJN A;  4CKE A;  1YJN A;  3L7Z C;  2F0W A;  1K73 C;  1A15 A;  2A6H C;  2PYK A;  3VR6 A;  4IFD I;  4HIM A;  4B9X A;  3K59 A;  3HKZ B;  3OSO A;  2VUM B;  1R4Q B;  2VUM G;  4DAV A;  1XNQ L;  2R93 B;  2X69 A;  2R93 G;  1KAW A;  4LMQ D;  3GTM H;  3MXU A;  2H1E A;  3Q6S A;  1Q90 A;  4A3I G;  4HJ5 A;  5C44 G;  3DHQ A;  4AYB G;  4LF7 L;  1SE4 A;  1MSH A;  5I2X A;  1S5C D;  4DR7 Q;  1H95 A;  4KKU A;  1EY6 A;  1IKM A;  3GP7 A;  1Q81 C;  3PUZ A;  1VQ6 A;  4LF9 L;  3MFY A;  5IYD H;  1JT8 A;  4BY1 H;  3ERS X;  2QEJ C;  3IFT A;  2Z6B A;  1SAP A;  1VQ5 A;  1GO3 E;  2KEC A;  1KRT A;  1R9T H;  1UE7 A;  2DN8 A;  3MTS A;  4WFN 3;  2F0L A;  1K83 H;  1HPC A;  3PGZ A;  1Q8K A;  5FKA C;  5HY6 A;  2A6E D;  5ISR A;  2J0T D;  2GA4 B;  5I9P A;  3W2D A;  4DNR B;  4AYB E;  1L1O C;  1I6V C;  4UY8 C;  3D31 A;  1RJT A;  4JI5 L;  3PF5 A;  1LT5 D;  5C4X H;  1IBL L;  2KEE A;  5BN4 A;  2X6G A;  4K5W A;  3AMU A;  2F0J A;  3T4A C;  4OWT B;  1PH9 A;  1TWG H;  4KY7 A;  1D2B A;  3H3V I;  4R4Q A;  4K8I A;  3TZU A;  4BY1 B;  2ZM6 Q;  1AE2 A;  2ZTD A;  4L5S A;  2EJF C;  4PMW A;  3BJU A;  1WCM H;  3M9B A;  3K5M A;  2A8V A;  1G2S A;  1IBK Q;  2MO1 A;  4OX9 Q;  3FRP B;  3URY A;  1PH5 A;  1YJW A;  2XNA C;  2EVB A;  2N55 A;  3KF8 B;  1CZG A;  3FKI G;  1JOQ A;  2FIN B;  2L9H A;  4LK1 C;  1PYW D;  4H44 C;  4DK6 C;  2TMP A;  1JB7 A;  1U9R A;  3GTQ H;  1V1Q A;  5COY A;  5AFW A;  4DR5 Q;  2VUM H;  4C3H G;  4YHH Q;  2Q8I B;  3OWF A;  3HOW H;  2R93 H;  4CBV A;  4V0B A;  1NMG A;  4KV6 A;  3CCU A;  1Z7T A;  1Y69 U;  4BS9 A;  3T16 A;  2E2H B;  2IX3 A;  1RIP A;  1OXS C;  4WOR A;  5T1I A;  1ICW A;  2L55 A;  3LWE A;  3NUC A;  1PH6 A;  3PUV A;  4HCE A;  5FLX L;  4IOA A;  1HA6 A;  4BBR G;  3A5U A;  2ZM6 L;  4JC0 A;  4ZRZ A;  1QNK A;  2D5D A;  3FPU B;  4HJ9 A;  4KN4 C;  1QVF A;  3SK6 A;  1TWH H;  1HHV A;  4JI3 L;  1VQP A;  1PFN A;  5FJ8 H;  5E4X A;  2YV5 A;  1VQ9 A;  2PPB C;  4KHV A;  3K7A B;  4NXN Q;  1GJX A;  1QZH A;  1F9Q A;  2IL8 A;  5K36 H;  2JA8 G;  4JV5 L;  4DV5 Q;  4OO1 H;  2MO0 A;  1S5E D;  1B1Z A;  1PYS B;  4LFC Q;  1EIH A;  1II3 A;  2B2W C;  3JAM i;  5KIX A;  4ZAI A;  4OON A;  1HA5 A;  4F88 A;  4KKT A;  3V05 A;  2R7Z G;  2NBF A;  1NR2 A;  4EQO A;  5HGQ A;  4TKO B;  4JI8 Q;  3D4D A; 
#chains in the Genus database with same CATH homology
 1Q46 A;  3HOY H;  2JJQ A;  3M4Q A;  3ULJ A;  1HZ9 A;  3GTL H;  1YHB A;  3HFZ B;  5IWA Q;  4A3E H;  3CC4 A;  4P73 A;  4APV A;  3JAM c;  4POG A;  3LGJ A;  5H1S E;  3BU2 A;  2VS1 A;  4PZ6 A;  4LF6 Q;  1SMX A;  2MNA A;  3S1R H;  4JI8 L;  4AQY L;  1PH3 A;  3PO3 H;  3BZK A;  2WFW A;  4HID A;  4Y7N H;  5ELN A;  1A8V A;  4B3R L;  4LFA Q;  5M3F G;  4JI2 L;  1PH4 A;  1E7Z A;  2UUB L;  4EX5 A;  3TRZ A;  3TQY A;  4X66 Q;  4X65 Q;  2ID0 A;  2ZJQ A;  4A3B G;  1A0I A;  3I4O A;  5ELO A;  3K80 C;  4A4I A;  2FXQ A;  1FJG L;  1QZG A;  1PH7 A;  1OXU A;  5AJ3 L;  4LUV A;  5IYB H;  4X64 L;  2VQE L;  3CCV A;  2V1C C;  4LW1 A;  2UXD L;  3AYH B;  3NEL A;  4GOP A;  4JI7 L;  3DLL A;  5DLQ E;  3CPF A;  4YWK A;  1X65 A;  3ULP A;  1EOV A;  1N8R C;  2R7Z H;  2F3I A;  3NBH B;  1FVI A;  5C3E H;  4XTC S;  1IXR A;  1TWA H;  4IJH A;  1VQK A;  2R7D A;  4X64 Q;  1K8A C;  3S1Q H;  4BY7 H;  2ZTC A;  4UP9 A;  1QUQ A;  1KRS A;  1HNW Q;  3J7A 5;  1TWC H;  2GVB A;  4RG1 A;  3HOX H;  4JI7 Q;  1J5E Q;  4JI3 Q;  1Q1B A;  3PUY A;  4DAM A;  4DV0 L;  3S1M H;  3OYY A;  3M4O H;  4POF A;  3KOJ A;  4A3E G;  3TS2 A;  1W3S A;  3I2Z A;  4DV0 Q;  1YHA A;  3RLO A;  4LUO A;  5C44 H;  1GKH A;  2I5H A;  2LXK A;  2VY3 A;  2NN6 G;  3UDG A;  3T1Y Q;  1VQ4 A;  4JI6 L;  2NVQ H;  4BA2 I;  4TVA B;  4JI1 L;  4LNQ A;  1HZA A;  1EQQ A;  4GOP C;  1Z9F A;  5EAY A;  3SGI A;  3S1N H;  3KFU A;  3H3V H;  2RCN A;  4QL5 A;  4IPC A;  1YHQ A;  1I94 Q;  2CCZ A;  4DR4 L;  1PH2 A;  4LFC L;  3TS0 A;  1B70 B;  4PG3 A;  4IPG A;  4DV6 L;  1S3O A;  2CWP A;  3PO2 G;  1C9O A;  4GKK Q;  1VQH A;  5M3M G;  2NVT H;  1IYJ B;  3A5Z B;  3GTJ H;  4JYA L;  3RR5 A;  1CSQ A;  3CMA A;  1SLJ A;  2K4K A;  3I7F A;  2N78 A;  2QGQ A;  5GAE C;  2VQE Q;  1YI2 A;  1HR0 L;  1JJC B;  4B3M Q;  1CKN A;  1EUJ A;  2IT1 A;  5C4J H;  1HJP A;  4A93 G;  1A63 A;  2EIF A;  1NMF A;  3PUX A;  3OTO Q;  1KD1 C;  2N49 A;  1JJ2 A;  4A3F H;  3STB C;  2JEB I;  3TEH B;  3K81 C;  3OTO L;  3M85 A;  3G6E A;  4LUZ A;  4A3G G;  2ALY B;  3S14 H;  1CKM A;  4X6A H;  1DGS A;  4XIG S;  4PZ7 A;  1L0W A;  1A62 A;  2NVX H;  2K5V A;  4A3I H;  3L0O A;  1IL2 A;  5FJ8 G;  5E7N A;  1X3F A;  2NZH A;  2Y0S E;  3ZJY C;  3L2P A;  2CFM A;  1YIJ A;  4HIO A;  2B29 A;  4ALP A;  2GN5 A;  4YHH L;  4DR2 Q;  2KHI A;  2PNH A;  2LXJ A;  2ASB A;  2PMZ E;  1WJJ A;  1BBW A;  1X9N A;  4DV7 Q;  4C2M H;  3I56 A;  4HIK A;  4BBS H;  2PI2 A;  4C3H H;  4QJF A;  1NY4 A;  2BA0 A;  4DKA C;  4DV4 Q;  1AE3 A;  4JYA Q;  4R4O A;  4A3G H;  3T1H L;  1PV4 A;  3J81 i;  5IE8 A;  4B3S L;  4YY3 L;  2KCT A;  3A74 A;  1X3G A;  2UXC L;  1TWF H;  2I5L X;  5LMU L;  4GLA C;  1SR3 A;  1IBM L;  3PO2 H;  1K0R A;  1CKO A;  4QY7 A;  1MJE A;  3PUW A;  1IBM Q;  1UE6 A;  2E2H H;  4K0K Q;  4MNO A;  1PA6 A;  2D0O A;  3CCM A;  4JG2 A;  3PF4 A;  3GDE A;  1VQ8 A;  2Q2U A;  5C0X G;  5IY0 A;  1WFQ A;  4YWL A;  4JBJ A;  5LMU Q;  1EWI A;  1N32 L;  2XTI A;  2Q2H A;  3W1G A;  3TRE A;  1HNW L;  2E5L L;  3W1B A;  4JOI A;  3UDF A;  5K36 G;  1J5E L;  3HKS A;  3PIP A;  1XPU A;  3FP9 A;  2K5H A;  1WOC A;  5FLM G;  3CPW A;  4HJ8 A;  3J7Z C;  3NEN A;  2B3G A;  1V43 A;  1YIT A;  4NPS A;  4JCV E;  2WAQ G;  3MEF A;  3Q8D A;  5IWA L;  4A3K H;  1EFW A;  3PO3 G;  2OCE A;  1PVO A;  3RN5 A;  1N33 Q;  5M5W H;  3KF6 A;  4X66 L;  2BH8 A;  1EIF A;  3I4N G;  1I94 L;  4A3F G;  3RLN A;  5IYD G;  5JEA J;  4IFD G;  2MFI A;  1NJI C;  4JI2 Q;  2VQF Q;  1K9M C;  1XNR L;  1BKB A;  3PSI A;  4DV3 L;  4IJL A;  2JA9 A;  3UE1 A;  3F8T A;  4B3T Q;  1QVC A;  1I5F A;  1HNX Q;  2JQO A;  5GAD C;  3J80 c;  1YJ9 A;  4DV2 Q;  1AH9 A;  2IX0 A;  4FDB A;  3PCO B;  1VQN A;  5GAG C;  2IHE A;  4DUZ L;  2ZJR A;  1Q7Y C;  1PYB A;  1BVS A;  4JOI C;  1JE5 A;  2L15 A;  3PV0 A;  4AH6 A;  2R92 G;  3KYH C;  4GKK L;  4P74 A;  1V9P A;  3EBE A;  5M5X H;  1X55 A;  4LF8 Q;  3K7A H;  1HR0 Q;  3CAM A;  1G6P A;  1XMO Q;  1VS0 A;  4LF8 L;  4P71 A;  2VW9 A;  4A3M H;  1SRU A;  1PFS A;  2KCM A;  4KI0 A;  4NXN L;  2E2I H;  3HOV H;  1QUQ B;  2OQ0 A;  4GN5 A;  3K0X A;  2Q2T A;  4JI6 Q;  4KHZ A;  1VQI A;  1PHJ A;  5J3B A;  1J6Q A;  4A75 A;  1I6H H;  3PIO A;  1E24 A;  3AFP A;  1BBU A;  3CC7 A;  2WP8 J;  2R92 H;  1NBW A;  3G4S A;  5IP7 H;  3T1Y L;  5LMN W;  1M1K C;  2Z0S A;  5IYC G;  3OW2 A;  2UU9 L;  4WJ3 M;  1WI5 A;  4JI1 Q;  4DV3 Q;  1Q86 C;  3M4P A;  2HQL A;  4X62 Q;  4A3C H;  4A3B H;  4KHP L;  1B8A A;  4B3S Q;  1P8L A;  1S72 A;  4Y52 H;  1B7Y B;  3STB D;  3K8A A;  1QVG A;  1CUK A;  4B3M L;  2OWO A;  4LF5 L;  5C4X G;  4DV1 L;  2GVA A;  1YBY A;  1L1O A;  2VL6 A;  1KL9 A;  4YWM A;  2JA5 H;  2JEA I;  1HZB A;  2JA6 H;  1FGU A;  4GN4 B;  2IY5 B;  5JJI A;  4RMF A;  2WB1 E;  1P16 A;  4KHP Q;  3CQZ H;  2B63 H;  4PZ8 A;  4A3J G;  3BZC A;  3CCJ A;  3S16 H;  3CP0 A;  1TXY A;  1N32 Q;  3EN2 A;  2DUD A;  2KEN A;  1YZ6 A;  4L5Q A;  4A76 A;  1PH8 A;  1I3Q H;  2A19 A;  4DUZ Q;  2ZJP A;  1EIY B;  4DV1 Q;  1W2B A;  4DR6 Q;  1UE1 A;  1WCM G;  3HOV G;  2F4V Q;  3GTG H;  3HOZ H;  3ICE A;  1LUZ A;  2NVY H;  4JBK A;  2AKW B;  4L5T A;  4ME3 A;  3K7U C;  2JE6 I;  1N34 L;  4UPA A;  5IYB G;  3RNU A;  1NTG A;  3AQQ A;  4AQY Q;  1SE8 A;  3WWV A;  3FKI H;  3UDX A;  1Q12 A;  3RN2 A;  3S17 H;  1T9H A;  2PI2 E;  1N33 L;  2JA7 H;  3AEV A;  2E2J H;  3GTP H;  4A3L G;  1KC8 C;  1G29 1;  3CCL A;  4JV5 Q;  1YVC A;  2NZO A;  5JJK A;  1Z47 A;  4DR5 L;  2UXC Q;  4R4C A;  2D0P A;  4DV7 L;  3I55 A;  4DV6 Q;  1X6O A;  2PQA A;  1Y1V G;  4DR7 L;  4HJ7 A;  1L2F A;  3CCR A;  4DV4 L;  4BY1 G;  4OO1 G;  3RLF A;  1LYL A;  2Q2I A;  1Y14 B;  1MJC A;  2ATW A;  4LF5 Q;  4X62 L;  1RL2 A;  2A1A A;  2ZTE A;  4LF9 Q;  3CD6 A;  3ULL A;  4LWC A;  1IBL Q;  3CW2 C;  1G51 A;  1E1T A;  3CC2 A;  4NXM Q;  3RZD H;  2UUC Q;  4K0K L;  4YCU A;  2UXD Q;  4BA1 I;  1HNZ L;  2HIV A;  4H02 A;  2QA4 A;  2KHJ A;  3M7N A;  4A3C G;  2AWO A;  1Q1E A;  2MQH A;  1OTC A;  1Q82 C;  2WAQ E;  2F52 A;  3GD7 A;  5IP9 G;  1Y1V H;  2AHO B;  4R4T A;  4NXM L;  5GAH C;  4MTN A;  2JA5 G;  5FLX c;  3S2D H;  4JBW A;  1C7Y A;  1EYG A;  2JA6 G;  1YJN A;  3L7Z C;  3E0E A;  3H0G G;  1K73 C;  3ER0 A;  2QEX A;  2K52 A;  4IOC A;  2N3S A;  4IFD I;  4HIM A;  1X56 A;  1LM0 A;  2RF4 A;  3KF6 B;  2OTL A;  3HKZ G;  1VQA A;  3U58 A;  4LFB Q;  1CKN B;  2VUM G;  1C0A A;  3F1Z A;  1XNQ L;  2AWN A;  3G48 A;  4DR1 L;  2DGY A;  3HOX G;  4JI5 Q;  4X65 L;  4IO9 A;  4B3R Q;  4DR4 Q;  1KAW A;  4IPD A;  1UEB A;  4A3D G;  2UXB L;  2R93 G;  4DR1 Q;  3GTM H;  1HH2 P;  1KXL A;  4UP7 A;  3S15 H;  3U50 C;  4A3I G;  4HJ5 A;  5C44 G;  4AYB G;  4DPG A;  4LF7 L;  4DR7 Q;  1H95 A;  2YTX A;  3U4V A;  1XMQ L;  2K50 A;  1IZ6 A;  4P75 A;  2VNU D;  3G71 A;  3HOU G;  5C0X I;  1Q81 C;  2JK8 A;  3PUZ A;  1VQ6 A;  4O0A A;  4QGU A;  4LF9 L;  2HT1 A;  1L1O B;  2R6G A;  5IYD H;  2Y0S G;  1JT8 A;  2E8G A;  4BY1 H;  3CME A;  3ERS X;  1WYD A;  2I5M X;  3A0J A;  4HJA A;  5FLM H;  2OTJ A;  3AFQ A;  1MIU A;  2IX1 A;  5JJL A;  1D8L A;  1VQM A;  2UUA Q;  3J80 i;  1VCI A;  1KHI A;  1VQ5 A;  1GO3 E;  1KRT A;  1R9T H;  4TQU S;  4EQ5 A;  1UE7 A;  2K14 A;  2F4V L;  4YCV A;  5LMN Q;  2K75 A;  1K83 H;  4JI0 L;  1GM5 A;  3J81 c;  1K8G A;  3PGZ A;  1Q8K A;  4UP8 A;  3W5O A;  5C3E G;  1VQO A;  4DV5 L;  1XPR A;  1VQC A;  5HY6 A;  1LTL A;  4DV2 L;  1E22 A;  3M3Y H;  1MKH A;  2UXB Q;  4AYB E;  1L1O C;  4YY3 Q;  4B3T L;  4UY8 C;  3D31 A;  4LFA L;  4L5R C;  1XNQ Q;  1N36 Q;  3GTK H;  1XTD A;  2HHH L;  3I4M H;  4JI5 L;  3PF5 A;  1SFO H;  4BBR H;  2YTY A;  5C4X H;  3KJP A;  1VQB A;  1IBL L;  3F2B A;  1U5K A;  2RHQ B;  3KDF B;  2VQF L;  5C0X J;  5M3M H;  2YYZ A;  3MXN B;  4OWT B;  1TWG H;  2R7F A;  1PH9 A;  3H3V I;  4R4Q A;  1EQR A;  3HKZ E;  4A3J H;  2KBN A;  1YEZ A;  1N36 L;  2ZM6 Q;  1AE2 A;  2ZTD A;  4L5S A;  1XMO L;  4OWX B;  1GD7 A;  1GVP A;  4GKJ Q;  2I0Q A;  2CKZ B;  4PMW A;  4GNX B;  3BJU A;  1HNZ Q;  1XMQ Q;  1WCM H;  2N8N A;  3M9B A;  2A8V A;  1E3P A;  3F2C A;  1O7I A;  4QQB X;  2UU9 Q;  1IBK Q;  3HOW G;  1X54 A;  2MO1 A;  3JC6 6;  4OO1 I;  2E5L Q;  4OX9 Q;  4IPH A;  1PH5 A;  1YJW A;  1VQJ A;  1N34 Q;  3KF8 B;  5IT9 c;  3FKI G;  1KQS A;  4OX9 L;  5IP7 G;  2K5N A;  3EIV A;  1N9W A;  3S2H H;  2JA7 G;  4C3I H;  2LSS A;  3UDI A;  1VQE A;  4R1J A;  4DK6 C;  5LMN L;  3UE0 A;  1JB7 A;  1JJG A;  3T1H Q;  1UE5 A;  4GOP B;  4JBM A;  3GTQ H;  4GN3 B;  2Z6K C;  2B63 G;  2Z6K A;  1XPO A;  2UUA L;  3J81 j;  1V1Q A;  3CF5 A;  1PH1 A;  1VQL A;  2NN6 I;  4DR5 Q;  4GLX A;  1X3E A;  2VUM H;  2JA8 H;  1Y1W H;  3DM3 A;  4DUY Q;  4A3M G;  3E9I A;  4YHH Q;  4DR2 L;  4GNX C;  4AIM A;  3CXC A;  4MZ9 A;  3HOW H;  4OWW B;  3I4M G;  1D7Q A;  4A3D H;  4DK3 C;  3HOY G;  2R93 H;  4BXX H;  2EXD A;  1HR0 W;  1I50 H;  1NMG A;  2XGT A;  1CSP A;  4QIW E;  3CCQ A;  3CCU A;  3F2D A;  3FHW A;  4A3K G;  1HNX L;  1FJG Q;  1SN8 A;  2H5X A;  2HHH Q;  1XNR Q;  4J15 A;  1RIP A;  1OXS C;  3NEM A;  4P72 A;  4YCW A;  1NE3 A;  3KJO A;  3I4N H;  2RHS B;  4DR3 Q;  4LF4 Q;  2ES2 A;  1PH6 A;  5GRO A;  3S24 A;  1Y1W G;  1JMC A;  4GKJ L;  3PUV A;  2D62 A;  4DR3 L;  4O2D A;  4LF4 L;  4DR6 L;  4IOA A;  4GS3 A;  3HOZ G;  4BBR G;  2AMC B;  1UWV A;  3A5U A;  4JC0 A;  2ZM6 L;  4C3J H;  4DNI A;  2CWA A;  2EQS A;  4GLV B;  1XJV A;  4BXX G;  3E9H A;  4HJ9 A;  1QVF A;  3D0F A;  1E1O A;  1TWH H;  4LF6 L;  4JI3 L;  1VQP A;  4JI0 Q;  1U0L A;  5FJ8 H;  4LFB L;  2YV5 A;  1M90 C;  1VQ9 A;  2C35 B;  3B6Y A;  1VQD A;  4NXN Q;  4KLK A;  4DAY B;  2VZA A;  1QZH A;  2WB1 G;  1HZC A;  2YTV A;  4R4I A;  3GO5 A;  1VQG A;  5GQO A;  2IHF A;  2HIX A;  5M5Y H;  5JEA G;  4IFD J;  3RZO H;  1K3R A;  4JI4 Q;  1OXT A;  2JA8 G;  4JV5 L;  2PQA B;  4DV5 Q;  4BY7 G;  4DUY L;  1S40 A;  4LF7 Q;  2MO0 A;  2OQK A;  1PYS B;  5AJ3 Q;  2UUB Q;  4LFC Q;  4NB3 A;  5BR8 Q;  3IRB A;  1ASZ A;  3JAM i;  3CCE A;  3CCS A;  4OXP A;  4OON A;  1SRO A;  1FL0 A;  4GNX A;  2BA1 A;  3KLW A;  5BR8 L;  2UUC L;  2YU9 H;  3H0G H;  1OXV A;  3H15 A;  4A93 H;  1YNX A;  5IYC H;  4JI4 L;  2R7Z G;  2BH2 A;  3HOU H;  4A3L H;  3VDY A;  1VQF A;  4WJ4 A;  5M3F H;  3GTO H;  3U4Z A;  4BBS G;  1VQ7 A;  3KDF A;  1KIX A;  2CQO A;  1ASY A;  5HGQ A;  5IP9 H;  1IBK L;  4JI8 Q;  1OXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...