4DKAC

Structure of editosome protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
86
Chain Sequence
SNALMIGRIADVQHGFLGAMTVTQYVLEVDGEKEFIVIRCMGDQVKLGSRVLVQGTLRMNRHVDDVSKRLHAYPFIQVVLGYVKVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 14
structure length 86
sequence length 101
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dkaC00
1VQNA 1E1TA 1P8LA 1HR0Q 4GOPA 4IFDG 3S1MH 4K0KL 4BY1G 4A4IA 4X65Q 1EFWA 4P73A 2ZJPA 3G71A 1KHIA 1JE5A 1E3PA 2AWNA 3GD7A 1XMOL 1PH9A 4X6AH 4BBRH 4DV5Q 4DV2L 4OO1G 1Q12A 5HY6A 3U4ZA 3BZCA 3I7FA 4DR2L 3GTJH 4DKAC 3OW2A 2VNUD 1LM0A 5JEAG 4GNXA 3PSIA 2LXKA 1TWCH 3S24A 1Q86C 2B29A 2BH2A 4C3JH 1YJNA 4DR6Q 1VQGA 4A3MG 1YI2A 3ER0A 3AQQA 4IJHA 1XPOA 4A3JH 1QZGA 2JA5G 4BBSG 5JJLA 4A3KH 4DV7Q 4QL5A 3KDFB 4DK6C 3KF6A 3CCRA 1EYGA 1W3SA 3S17H 3ULJA 1VQJA 1L1OA 3RZDH 2NZOA 2LXJA 4A3IH 1S72A 1HZCA 2F52A 3G4SA 4A3EH 1K8GA 3CAMA 2ZJQA 4LFAL 4POGA 1VQCA 4B3ML 1S3OA 3F1ZA 3W1GA 1XPUA 3I4NG 1VQEA 3FKIH 4AIMA 2Q2IA 1G6PA 4WJ3M 2VZAA 4P74A 4TVAB 1N34L 5IYCG 2JJQA 2Y0SE 3MEFA 3L0OA 2WFWA 2HIVA 2F4VL 4LF4L 3TEHB 2IT1A 2MO0A 5LMNL 2VUMH 2JA6H 3IRBA 1OXUA 1A0IA 1AE2A 4A75A 1Q81C 3A5ZB 3AYHB 2A8VA 3MXNB 4ME3A 3VDYA 2ZM6L 3HOWH 4A3CH 1TWFH 2WP8J 1L0WA 1HZ9A 5IY0A 1XMQL 4BA2I 1EQRA 3E9HA 1NTGA 3TREA 4A3DH 1PH2A 1I6HH 1JJGA 3PF4A 3I4MH 1NBWA 3STBD 1QVGA 4JI0Q 4HJ9A 3HOZH 1H95A 3FP9A 2ALYB 2HHHL 1QUQB 1X55A 2GVBA 4KLKA 5LMUQ 4DK3C 2WAQE 4JBWA 3A5UA 3W5OA 4DV4Q 1IBMQ 3HOYG 2D62A 2BA0A 2VW9A 2RCNA 4JV5L 3M7NA 2PMZE 3U50C 2UUBL 1EOVA 3S1RH 2UUAL 4JI1Q 1SMXA 4X64L 3T1YQ 4BY7H 1VQ8A 1N9WA 2KENA 3GTQH 1YIJA 4DV2Q 1N8RC 1KD1C 3G6EA 1MJEA 3GTLH 2R7ZG 5ELOA 2PI2A 2CQOA 4DV6Q 3T1HL 1SLJA 4DR1L 5AJ3L 4A3GG 5C3EH 4JOIA 4C2MH 1U5KA 4AQYQ 1HR0L 3JAMc 5GROA 4X65L 3K80C 1IYJB 4QIWE 5FLMG 1FGUA 1WI5A 3ERSX 4LUZA 4IPGA 2HT1A 1E7ZA 1SE8A 1IZ6A 2ZTCA 4DV5L 4MTNA 3GTOH 5J3BA 1A62A 1AH9A 3I2ZA 1K73C 1JJCB 3S2DH 2UXDQ 5DLQE 2HIXA 1HNXQ 1N33Q 1QVCA 1J6QA 4IFDJ 1X56A 4DR6L 3WWVA 1R9TH 5IYBH 4YCVA 2KHJA 4LWCA 1Y1VG 1GKHA 2MNAA 1JMCA 4DV7L 3H3VH 1CKNB 1HNZQ 4IOCA 1HH2P 1X3EA 4DNIA 4L5TA 1HZAA 2R7DA 1C0AA 4Y7NH 3PCOB 4JI4Q 5EAYA 4L5RC 3PO3H 3F2CA 3UDFA 5JEAJ 3RNUA 4NXMQ 5M3FH 3B6YA 2OWOA 4JI6Q 4B3RQ 4A3EG 5FJ8G 4GKKQ 1XNQQ 2Z0SA 1PYBA 4DR5Q 2YYZA 1N36Q 3PV0A 1PV4A 2FXQA 3PO2G 4A3FH 1D8LA 1HZBA 3FKIG 4B3TQ 2A19A 4KHZA 1SFOH 5C0XI 1K83H 2NVXH 1FJGQ 1VQKA 3E9IA 1KXLA 5GAGC 1CKNA 4BXXH 2VUMG 2XTIA 4DR7Q 2JA6G 2UU9Q 4JBKA 3J81j 3GTGH 1GO3E 4IPDA 4O0AA 4LNQA 2K52A 3CP0A 1NJIC 1AE3A 3HOWG 4X66Q 1YHAA 4YY3Q 1A8VA 2PI2E 3KFUA 4QQBX 3L2PA 4GLVB 5IP7G 2E2IH 4JI0L 1M1KC 2V1CC 2JA9A 1OXSC 4JOIC 3FHWA 2OCEA 4L5SA 2KCTA 3H0GH 3I4MG 5LMUL 1B7YB 5GAHC 4DV4L 1XPRA 1IBML 3HOZG 2B3GA 3CMAA 3H3VI 3I56A 2I5LX 4JI1L 3T1YL 4PZ6A 4H02A 2IHEA 2WB1G 4YWMA 5IP9H 4A3BH 4BY7G 1UWVA 1PHJA 3HOUG 5K36G 2K5HA 3GTPH 4DV6L 2Q2TA 3ULPA 2ASBA 5C44H 4YWLA 3UE1A 2UXCQ 4DAMA 1KQSA 3K8AA 1MKHA 2NZHA 2R92G 4AQYL 1X54A 2C35B 3HOVH 1XJVA 2KBNA 2D0PA 4GLXA 4R1JA 4XIGS 3J81i 3CC4A 3TRZA 1NMFA 1VQ6A 4DR3Q 3HKZG 2OTLA 3W1BA 3BZKA 3M4OH 1PH1A 4X62Q 4HIDA 4LUOA 1TWAH 1WCMG 4A3LG 2UXDL 4OONA 4QGUA 1V1QA 1HNXL 4P72A 1N33L 4LF8Q 1WFQA 2CFMA 2Z6KA 1CUKA 4YHHQ 2JEAI 1VQMA 2BA1A 4JI8Q 1JB7A 1EIYB 1IXRA 3CCLA 5IYDH 5IYBG 1HNZL 4LF5Q 4LUVA 3K0XA 4UPAA 3KJPA 1SRUA 2ZJRA 4JI4L 3HKSA 2N8NA 2CWPA 3KDFA 3CCVA 4JI3Q 1PH3A 1WYDA 1Q1BA 1CKOA 3CCEA 2N3SA 4JYAQ 4NXML 1EUJA 2N49A 1KAWA 2YU9H 3S1NH 3PO3G 4JI6L 4LF7Q 4B3RL 1JT8A 3J80i 4GKKL 1XNQL 1P16A 3S14H 4DR5L 1N36L 4OX9Q 4IO9A 1K0RA 2A1AA 4B3TL 2R6GA 4R4QA 5M3MH 1FJGL 3CCQA 3HOXH 2GVAA 2EXDA 2BH8A 2JK8A 3PUYA 1CKMA 1LYLA 5GQOA 1YVCA 3EIVA 5FLXc 2UU9L 2JA7H 3DLLA 1K8AC 4DR7L 1YEZA 4OWTB 1V9PA 2CWAA 1Y14B 4X66L 4YY3L 3KLWA 3UDIA 4LFBQ 1WJJA 5BR8Q 4DUZQ 1Y1WG 2UUCQ 1E1OA 1CSQA 1PYSB 1KL9A 1YITA 3S1QH 4DR4Q 3DM3A 5C4XG 1UE7A 3K7AH 2MO1A 3CCSA 2E8GA 3PUXA 2RF4A 1IBKQ 2GN5A 1QUQA 1EWIA 3CCJA 4BY1H 3E0EA 1SROA 1Q1EA 4O2DA 3PF5A 2B63H 4IOAA 1HNWQ 3OYYA 5IE8A 1PFSA 4UP8A 2I0QA 5GAEC 1IBLQ 4BBRG 4A76A 4HJ5A 1LTLA 4A3BG 4DUYQ 1VQ5A 2Q2UA 2UXCL 2Z6KC 1PH4A 4DV1Q 1X3GA 4A3MH 1KC8C 3D31A 5LMNW 1YHBA 1FL0A 3UDGA 3CPFA 3OTOQ 4DR3L 4A3JG 2E2HH 4A3KG 1W2BA 4LF9Q 5IT9c 1I50H 1OXVA 1J5EQ 5GADC 4X62L 3S2HH 1OXTA 4A3IG 2EIFA 1VQHA 2OTJA 3S16H 4OWXB 1I94Q 4LF8L 2VQFQ 1IL2A 1X65A 3RLNA 2IX1A 4OWWB 4YHHL 1VQDA 4JI7Q 3F2DA 3CC2A 1QZHA 2NN6I 1I5FA 2OQKA 1YZ6A 4JI8L 4DAYB 2WB1E 5IYCH 4LF5L 3RR5A 3M4QA 3U58A 4IFDI 4XTCS 2KHIA 4JI3L 2YTYA 1BBWA 4DV0Q 2AHOB 1JJ2A 5C4JH 4JYAL 2YV5A 5JJIA 1T9HA 3ZJYC 4YCWA 4LF7L 1Q7YC 4A3CG 4GN4B 3G48A 4OX9L 3ICEA 4JBMA 1PH5A 1KRSA 4GKJQ 4A3DG 3HKZE 1UE6A 4QY7A 1A63A 3PUWA 1BBUA 1B70B 3CXCA 1HR0W 1VS0A 4FDBA 5M3MG 3KOJA 4DV3Q 3HOXG 4HJ7A 4LF6Q 3HOYH 4GOPB 1PVOA 2UXBQ 3LGJA 2DUDA 1HJPA 4BA1I 1TWHH 1ASYA 4B3SQ 1BVSA 1I3QH 1KIXA 1QVFA 2CKZB 2E2JH 1YJWA 4LFBL 3U4VA 4DUZL 5BR8L 3JAMi 1NMGA 4UY8C 2UUCL 5E7NA 4AYBG 4DR4L 5M5WH 2LSSA 5IWAQ 2E5LQ 2K5VA 4GNXB 4APVA 4UP9A 3CCMA 1VQFA 3RN2A 4JI5Q 1B8AA 4A3GH 1IBKL 3F2BA 1OTCA 4PG3A 2NN6G 5C3EG 5C0XG 3AEVA 4JG2A 4PZ8A 5FLMH 1HNWL 4NXNQ 2NVTH 1XTDA 2YTVA 3KF6B 3ULLA 2I5HA 1YNXA 4NB3A 2JQOA 1LUZA 4LFCQ 2B63G 1L1OB 1CSPA 1G291 1IBLL 1VQ9A 4R4TA 1Z47A 4DUYL 1EIFA 1U0LA 3J7ZC 3J7A5 3RZOH 3Q8DA 1V43A 4DV1L 2VL6A 2AMCB 2EQSA 1Y1VH 3UE0A 1KRTA 2N78A 3I4OA 3OTOL 2R7FA 4IPHA 1DGSA 2OQ0A 1PA6A 4LF9L 4GLAC 2F3IA 5M5XH 1J5EL 1GM5A 4KHPQ 4Y52H 3PUVA 3STBC 1VCIA 5JJKA 4LW1A 1E24A 3H15A 2D0OA 1I94L 3S15H 2VQFL 5FJ8H 2DGYA 5M3FG 4A93H 2VQEQ 3CF5A 4JI7L 3K7UC 3PO2H 2KCMA 2XGTA 1S40A 1VQIA 3K81C 3UDXA 2QEXA 4A3FG 2CCZA 4R4OA 1GD7A 1VQ4A 1M90C 2MFIA 3GDEA 1RL2A 1K3RA 2RHSB 4DV0L 3F8TA 1MIUA 4MNOA 1N32L 3CD6A 4BXXG 2RHQB 1VQBA 1VQPA 4PZ7A 1XNRQ 1PH6A 2R93H 4IPCA 1K9MC 4UP7A 3TS0A 3KF8B 4JI2Q 2JEBI 5IP7H 1VQOA 4GKJL 4GN5A 1VQAA 2IHFA 3M9BA 1SR3A 3CCUA 1C9OA 4DV3L 4LF6L 1Q8KA 4JCVE 2ES2A 3H0GG 2JA8H 2UXBL 4GOPC 3BU2A 4YCUA 4B3SL 4RG1A 4AH6A 3L7ZC 2K50A 3PIOA 4K0KQ 3M4PA 1X6OA 4ALPA 2VS1A 2Y0SG 3NBHB 3GTKH 1YJ9A 5M5YH 5IP9G 1XMOQ 3HOUH 5IWAL 2E5LL 3RN5A 4POFA 1EQQA 1FVIA 5ELNA 3JC66 1Z9FA 1SN8A 4KI0A 4JI5L 2PQAB 4DR2Q 4GNXC 2R92H 1WOCA 1UE5A 5C44G 2L15A 4DPGA 1MJCA 2AWOA 2JA5H 1Q82C 4BBSH 1NE3A 1TWGH 2MQHA 4WJ4A 4NXNL 3HOVG 1OXXK 2JE6I 2PNHA 2AKWB 2Q2HA 3BJUA 2VY3A 4RMFA 4LFCL 1NY4A 3A74A 4EQ5A 4TQUS 4HIOA 1C7YA 1L1OC 3EN2A 2IX0A 1WCMH 2QGQA 4A3LH 1D7QA 1N32Q 4JC0A 3I4NH 4LFAQ 4QJFA 2WAQG 4HIKA 4HJAA 4P71A 1VQLA 3J81c 4HIMA 4B3MQ 5C0XJ 1TXYA 3TS2A 4YWKA 3CW2C 2ATWA 1BKBA 4L5QA 3PGZA 1L2FA 2PQAA 1YBYA 1RIPA 1N34Q 4C3IH 5H1SE 2K4KA 5IYDG 3CMEA 3D0FA 4P75A 2F4VQ 4AYBE 4LF4Q 1GVPA 4KHPL 5LMNQ 4JBJA 4OXPA 2IY5B 2ZTDA 3KJOA 1O7IA 1Q46A 3NENA 4GS3A 4OO1I 2NVYH 4R4CA 4NPSA 2ZM6Q 3PIPA 2VQEL 2ZTEA 3RLOA 1XMQQ 4GN3B 4PMWA 4A93G 4R4IA 3HFZB 1ASZA 3TQYA 2K14A 3CC7A 4EX5A 1UE1A 2YTXA 2I5MX 3EBEA 2H5XA 3GO5A 3PUZA 3J80c 4IJLA 1X3FA 3GTMH 2HHHQ 3A0JA 3M3YH 3CPWA 1G51A 2K5NA 2K75A 3M85A 4JV5Q 1PH7A 1UEBA 3CQZH 1XNRL 4HJ8A 2UUBQ 2JA7G 1YHQA 3AFPA 4J15A 2UUAQ 1VQ7A 3AFQA 4X64Q 4JI2L 2QA4A 1X9NA 1E22A 2NVQH 2R7ZH 3KYHC 2R93G 1Y1WH 4MZ9A 2ID0A 5C4XH 5HGQA 2HQLA 3NELA 3I55A 3RLFA 1PH8A 3T1HQ 4DR1Q 5AJ3Q 3NEMA 4C3HH 2JA8G 3SGIA
chains in the Genus database with same CATH superfamily
1VQNA 1E1TA 2Q8RE 2N88A 5KIXA 2ZJPA 1G2SA 2AWNA 1JE5A 3GD7A 4B08A 4DV5Q 4OO1G 2RBMA 5HY6A 3U4ZA 3X3MA 4J1MA 4GNXA 2LXKA 2BH2A 1YJNA 3ER0A 2JA5G 4BBSG 5L37A 4DV7Q 3KDFB 4DK6C 1VF7A 3KF6A 3CCRA 3OWEB 1W3SA 1EYGA 1L1OA 3RZDH 1C8CA 1QE6A 2LXJA 1S72A 4CHTB 4POGA 4B3ML 1S3OA 3GP7A 1VQEA 3VA7A 1N34L 2Y0SE 2Z4HA 4LF4L 2WINB 3TEHB 3GTKB 2VUMH 5IGBA 1OXUA 1A0IA 3A5ZB 3MXNB 4ME3A 1SYFA 2XNAC 2F0IA 1HZ9A 2JA5B 4BBSB 5HURA 1ZKOA 4A3DH 1PH2A 3K5NA 1FD7D 2ICIA 4ME5A 4JI0Q 3HOZH 5LMUQ 3SK6A 2WAQE 1IBMQ 4Z9CB 1AZPA 3S16B 2D62A 2BA0A 2PMZE 4J8QA 1VMPA 2UUAL 4X64L 1IKLA 2PZTA 1ICWA 3C3LA 1N9WA 2KENA 1YIJA 1N8RC 2SNSA 2R7ZG 1QOHA 5ELOA 2K28A 4WORA 5D65A 4DV6Q 2C5CA 4A3GG 3SDZA 4C2MH 3JAMc 2Z6BA 2NVYB 5I6WA 4ZUIA 1DOKA 1SJED 4LUZA 4IPGA 5CV4A 3K6OA 2EXZA 1FNVA 1YNNC 5IOCA 1K73C 1JJCB 2UXDQ 1LLRD 4DR6L 3WWVA 1R9TH 2L4NA 2MNAA 1Y1VG 1GKHA 1JMCA 1NSNS 3H3VH 3Q6SA 2E74C 1OO9B 1X3EA 2R7ZB 2R7DA 4JI4Q 5DNFA 2NWGA 1V1PB 3PO3H 5JEAJ 3J81E 2EYOA 2OWOA 2RSOA 3A7AB 3D4RA 1PYBA 2YYZA 3PV0A 5K5PA 1PV4A 3PO2G 5IGCA 2A19A 1FJGQ 1TKWB 1NR4A 1XYIA 4DR7Q 5DEHA 2RSNA 2JA6G 3FMCA 3GTGH 4JBKA 1K0SA 4IPDA 4K2KA 2IJ0A 1TWCB 1Y1VB 3O13A 3QR8A 3CP0A 1NJIC 1EIHA 1BCPC 3P20A 2F0SA 3L2PA 1Q3LA 4A3KB 4ZK9B 2V1CC 3SK5A 1M1KC 3FHWA 1Y69U 3I4MG 2ENBA 4RWSC 1JOQA 1B7YB 5GAHC 1SE3A 3I56A 1EY8A 1RCVD 2XIWA 4HN7A 4EVOA 3ONAB 5G3LD 1O80A 2WB1G 1LO5D 4NKLA 1PHJA 3C2PA 4K6DA 3ULPA 1EEID 2B8FA 5C44H 2UXCQ 2JA6B 2Z1CA 1PRTD 1MKHA 3CKIB 1SNCA 4M1UB 1RODA 3HOVH 1YNJC 5CV6A 2D0PA 4GLXA 4R1JA 1TWFB 4XIGS 3J81i 4B9XA 3CC4A 1NMFA 1VQ6A 4DAPA 5JPMC 4G7ZC 5C4ZA 2CW0C 3I4MB 4X62Q 4HIDA 4K2LA 4PMBA 3J7AV 4RKBA 4N8FA 2PCFB 4CDEC 4OONA 2CHBD 1HNXL 1WVLA 4LF8Q 4JVZA 3NQTA 2WB1B 1VQMA 4KJNA 3S1RB 4EQOA 1HUNA 1HNZL 3T51B 1PFBA 2BCOA 4UPAA 5ELCA 2N8NA 4JI3Q 3A56A 4JYAQ 1LV9A 2WIIB 4NXML 4JI6L 3NE5B 1LT5D 3N6RA 3S14H 4IO9A 1FNWA 1STGA 4B3TL 4R4QA 3VYRA 5I2XA 2GVAA 2EXDA 4ZLTF 2RDHA 4DK0A 1S5ED 1B9MA 1K8MA 2B2VA 2JK8A 3QIAA 1LYLA 3EIVA 2UU9L 5T1IA 4K5VA 1Y14B 2WKDA 3EFXD 3KLWA 2GA4B 5BR8Q 1E1OA 1YITA 1JR0D 1KL9A 3S1QH 5C4XG 1UE7A 4Y7NB 4DK1A 3TZDA 1B3QA 3PUXA 5JVH3 1EWIA 4FF3A 4BY1H 4PV1C 1HNWQ 3K59A 2HDLA 1L0XB 4X3TA 1WTXA 3SR1A 2F0EA 4A3BG 5FKAC 2FFKB 5JEAH 1KC8C 3D31A 1DJRD 3W3AA 5A2QL 3UDGA 3CPFA 4WFN3 4DR3L 2E2HH 3RD4A 4LF9Q 5C4XB 1I50H 4E6IA 2QF7A 3S2HH 2E2IB 5K36H 1JQYD 2F0DA 5KNDA 3H0GB 1EWCA 1QB5D 1T5EA 1SNDA 3RLNA 3F2DA 2JSOA 1QZHA 2NN6I 2M2LA 2OQKA 1YZ6A 2R3ZA 4OL7A 3RR5A 3AU7A 4A3BB 1BBWA 4KKTA 4DV0Q 3GTPB 2YV5A 5JJIA 1T9HA 3ZJYC 4LF7L 5EBDA 1DM0B 4IUUA 4OX9L 1ZYRD 3T4AC 5JJZA 4U673 1PH5A 4B9WA 2EY2A 4FXKC 1WTRA 4A3DG 3A7LA 3PUWA 1BBUA 1B70B 2MP1A 3RZDB 3HOXG 2LKVA 1TWAB 3LGJA 4BA1I 1HJPA 4B3SQ 1TWHH 4M8AA 2UXBQ 3IAYA 1I3QH 3CU7A 2F0MA 3SXHA 1IW7C 1C48A 2A6EC 2UUCL 4DR4L 2LSSA 2K7VA 1EYAA 4GNXB 4JI5Q 1VQFA 1B8AA 1RJTA 3NWSA 4PG3A 5FLMH 2NVTH 2MUYA 1XTDA 1LT4D 3KF6B 1SMYD 2IX3A 1L1OB 1CSPA 4OHJA 3HOXB 3J7A5 1U0LA 3RZOH 4HR7B 1RF2D 2VL6A 2AMCB 1S5BD 2JA7B 4C1NK 3NTKA 2F0PA 2XWJB 1SYEA 1STYA 3MC0B 1VF5C 1VCIA 5JJKA 2KCNA 1BOSA 2E76C 2DNCA 4C2MB 5FJ8H 2EOTA 4DNRB 3K7UC 1CI3M 2KCMA 4K5WA 5BN5A 1F2LA 1S40A 3K81C 3TDQA 1GD7A 1M90C 2PPBC 2MFIA 3GDEA 4HMJA 1DXMA 3F8TA 1J8IA 5IGDA 1PRTB 2DY8A 1R9TB 2EY5A 4UP7A 1CA5A 3K58A 5IP7H 1VQOA 4GKJL 3PMFA 3M9BA 1C4QA 2QEJC 1ENCA 1C9OA 3TSSA 2ES2A 1EY6A 2H4OA 3NP8A 2K50A 4K0KQ 4OO1H 2Y0SG 3GTKH 2K5QA 3HOUH 3H09A 5IGGA 5IWAL 2E5LL 4POFA 1EQQA 1FVIA 2EJFC 2PQAB 4DR2Q 4CDDC 1O7LA 3HP3A 2R92H 3DEOA 5C44G 2AWOA 2MHVA 3NHHA 4JPBW 5C4JB 5AFWA 2JA5H 3GTGB 4BBSH 2MPMA 3HOVG 3RLFA 2AKWB 3BJUA 3NK9A 4LFCL 1LT6D 3EN2A 4NDXA 2X6LA 1WCMH 1N32Q 1QG7A 3MAQA 2WAQG 2WACA 4HIMA 1ILPA 5C0XJ 3HOYB 3TS2A 4YWKA 4MTKA 4K8JA 2SEBD 5ELBA 3CMEA 4KHPL 5LMNQ 3KJOA 5C44B 3NENA 2NVYH 1CQFA 3HOVB 3RLOA 1M8AA 4R4IA 2ICEC 2L0CA 4XDXA 4XYQA 2K14A 1BXTA 4DU9A 4LAAA 1EU3A 2H5XA 4JW0A 3PIP3 1X3FA 3A0JA 2WAQB 4YIJA 3Q24A 2K5NA 4JV5Q 3OMCA 1VQ7A 3PQIA 3M7NA 1X9NA 1D1IA 2R7ZH 4TRDA 2R93G 1JB3A 5I4DA 1HQMC 2ID0A 5HGQA 2HQLA 1B44D 4KK7A 4DAVA 3NELA 4KTAA 3VA5A 1R4PB 3T1HQ 4F87A 4BWGB 1JOOA 1HR0Q 1D2BA 4GOPA 2L12A 3S14B 4BY1G 4A4IA 4X65Q 1EFWA 2BDOA 4TKOB 4P73A 3G71A 1PH9A 3SK4A 1DCZA 4CBVA 1XMOL 1Q12A 4XXEA 5EPLA 2CH4A 2F3WA 1U9RA 3I7FA 4OGQC 3GTJH 4H13C 3OW2A 4H0LC 3QJYA 5JEAG 3PSIA 1TWCH 5IODA 2B29A 2EVBA 2EYHA 1W6KA 4N9TA 1XPOA 2EDGA 3C1FA 2R93B 4A3KH 4QL5A 3K57A 3S1QB 5CYUA 1GUSA 1I6VC 1VQJA 5K36G 1Y8NB 4LFAL 3DXJC 2PZWA 3LX0A 3W1GA 1XPUA 1JICA 1F9RA 1G6PA 1H9RA 2VZAA 4HCEA 4TVAB 1GHJA 4FF4A 1QCBD 3MEFA 3L0OA 2WFWA 2HIVA 4LJZC 2CH4W 2F4VL 2IT1A 1IL8A 2JA6H 4A75A 5G3LF 2ZM6L 1E0BA 4A3CH 1TWFH 1XMQL 4BA2I 3TREA 1JJGA 3PF4A 3I4MH 1NBWA 1PDQA 3HKZB 1QVGA 1LTSD 4HJ9A 1PRTF 3S2HB 1H95A 2HHHL 4KLKA 4DV4Q 2A68D 2KECA 3C1EA 2EZVA 3S1RH 1SMXA 1SDFA 1MGSA 5FO9B 1WD1A 4R9WA 2L1BA 1D5ZC 4F88A 4DV2Q 1PLFA 4CJ0B 4KN7C 2PI2A 2QW7A 5EKLA 1Y8OB 4DR1L 1HRJA 5AJ3L 2K05A 1U5KA 5C0XH 4AQYQ 3VYSA 3K80C 1PTOC 4HAEA 5FLMG 3ERSX 2HD3A 4RGOS 3D3RA 2HT1A 1SE8A 1IZ6A 4I7AA 2ZTCA 3WOFA 2P5ZX 4MTNA 1A62A 1AH9A 5DM63 1KDCA 3H91A 5DLQE 4QUCA 1N33Q 4IFDJ 1TWHB 2HUGA 5KYLA 4XYOA 2ZXOA 2J4XA 3JAME 2OXPA 3EA6A 1SE4A 3I72A 1CKNB 4DNIA 1GUTA 1HZAA 4L5TA 1C0AA 4Y7NH 4RGTA 2F0WA 3UDFA 5CV5A 5C4HA 4B3RQ 4A3EG 5M9OA 5FJ8G 4L8JA 4GKKQ 4N8X1 4ZRZA 3MFGA 3S1MB 3MTSA 4A3FH 3FKIG 5D3IB 1SFOH 3I70A 4HMIA 1KXLA 4UDUC 3RZOB 3SEBA 4G7HC 3J81j 1GO3E 4C3JB 3HOWG 2EYLA 2QILA 4YY3Q 1A8VA 4X66Q 4QQBX 5BN3A 4GLVB 5IP7G 3MFYA 2E2IH 1KAAA 2JA9A 3NTIA 1EZ8A 2KCTA 4DXFA 3H0GH 3S17B 1CFMA 3CMAA 4A3EB 5I9OA 1EQTA 4JI1L 3E6ZX 3T1YL 3FKIB 4H02A 5IP9H 4J6HA 4A3BH 4BY7G 1UWVA 3HOUG 2K5HA 3GTPH 2CQAA 3C46A 1QILA 2Q2TA 2IPKD 4YWLA 2B2UA 4DAMA 2R92G 3K8AA 2KCCA 3DM1A 3EQLC 1XJVA 2KBNA 3HOWB 2LS01 3BZKA 2VB3X 5A2QE 1TWAH 1WCMG 4QGUA 1V1QA 2F0JA 2F0VA 4P72A 1FGBD 4DNTB 1B9NA 2BA1A 4JI8Q 4HEDA 3VR2A 4LF5Q 4BY7B 3F2UA 3HOUB 3K0XA 3KJPA 3K0YA 2ZJRA 3GTQB 3J7YW 4K14A 1WYDA 1I4XA 3I4LA 2N3SA 3LWEA 2BE5C 2R92B 2N49A 1KAWA 3J80i 1XNQL 1P16A 1SE2A 4DR5L 1N36L 4F8MA 2A1AA 3HOXH 1WCMB 1U4RA 4CKEA 1STNA 2M00A 2PNRC 1CKMA 5GQOA 5FLXc 2JA7H 2JXMB 1YEZA 4IN3A 2CWAA 1O7ZA 3Q0AA 3UDIA 1CSQA 2B2UC 3DM3A 1IBKQ 2DJFC 4IFDH 4K6LA 3T53B 2FINB 4IOAA 3PF5A 3OYYA 1MHWC 4G57A 3NWTA 1JC7A 2J0TD 4HJ5A 1WTWA 2NVXB 1IKMA 5FO7B 4DUYQ 2K32A 1S5FD 1STBA 4DV1Q 3U9OA 1RTNA 5CBAE 1X3GA 4A3MH 4ZKBB 4EQNA 5LMNW 1KNAA 1YHBA 3OTOQ 1B2TA 3P7JA 4A3KG 5IT9c 1OXVA 1J5EQ 3TP5A 3SK8A 1I94Q 2VQFQ 1H9SA 2EYJA 5C6AA 4OWWB 4YHHL 4JI7Q 5CR3A 3DEPA 1GHKA 5IYCH 1I5FA 4IALA 4DAYB 1EEFD 4IZ8A 1YNND 3WDNA 1PFNA 4KMUC 1MI2A 3D8GA 3H6MA 3GTJB 1JJ2A 5C4JH 3N52A 5ELEA 4GZYC 4IUVA 4A3CG 3G48A 2O2LD 1SSOA 2A6HC 3MHBA 2OF1A 3HKZE 4QY7A 2L55A 1SNOA 1I4QA 1TS5A 1HR0W 1VS0A 4FDBA 5E4XA 3M4OB 4LF6Q 3HOYH 3FVQA 4OIKA 4GOPB 2PQEA 1ASYA 1BVSA 1MSGA 1TIID 2D5DA 1YJWA 4LFBL 2OEOA 3V96A 4DUZL 3NBIA 3M7GA 5E7NA 2Z8LA 2B2YA 2K5VA 1SYCA 1TS2A 2K5DA 1OTCA 3RUZA 2NN6G 4PQXA 5C0XG 3S1NB 3HG9A 2LMCB 2E75C 1G6ZA 1BCPD 2YTVA 2I5HA 1K3BC 2F3VA 4NB3A 3BZDB 2B63G 4ZKCB 1IBLL 1Z47A 1LTAD 3JAML 3J7ZC 3Q8DA 1SAPA 2EQSA 2C9OA 1ENAA 5E3FA 4CKBA 2BOSA 2LFNA 4KY5A 2RKSA 1UNSA 3QO2A 5KYIA 4GLAC 1STEA 2DNEA 3FPPA 4UHVA 5EKKA 4Y52H 3STBC 3K7AB 1E24A 1UAPA 5NUCA 2EE1A 3H15A 1YNJD 1ZEQX 2KEEA 4L6TB 2CW0D 1RDPD 2B63B 4A3FG 3IKJA 4R4OA 2X6GA 3P75A 5T1GA 1K3RA 2F0TA 4IUTA 4NW2A 4CJ2C 1BDOA 2R93H 1Z6HA 4IPCA 3VYUA 3R93A 1B3AA 3TS0A 2B2YC 1SR3A 3CCUA 4DV3L 1Q8KA 3H0GG 3KK7A 4N9PA 3NQIA 3BU2A 3BVZA 3FDTA 2SOBA 1HCZA 5EBCA 3K5MA 4ALPA 4A3FB 1LACA 5M5YH 5IP9G 1SFOB 3RN5A 4KKUA 1Q90A 5ELNA 1Z9FA 3I73A 1U4PA 4KI0A 1WOCA 1UE5A 2O5JC 2BDNA 5EPKA 1Q82C 1NE3A 4NXNL 3OSOA 1SNQA 1OXXK 2VW9A 2Q2HA 3A74A 2DJGC 4EQ5A 1C7YA 1JWUD 4IUQA 4A3LH 3NBHA 4HIKA 3LWUA 1VQLA 3EVQA 3J81c 4B3MQ 1EY5A 2AQ3B 2ATWA 1L2FA 1LTTD 1N34Q 3RMHA 5H1SE 3MZ5A 4P75A 4AYBE 4LF4Q 4JBJA 5M5WB 1JORA 2A73B 1E2WA 2F0GA 4R4CA 3PIPA 2VQEL 1X3QA 3HFZB 2NB0A 2YTXA 1GJXA 2I5MX 3EBEA 5D14A 3PUZA 4IJLA 2AUKA 4L63B 3M85A 1QJOA 3CQZH 1CHPD 1XNRL 4HJ8A 2JA7G 3TP8A 1LABA 1YHQA 3AFPA 1H9JA 2UUAQ 4X64Q 4JI2L 1E22A 1Y1WH 4MZ9A 3IL8A 1I4RA 1PH8A 1VDZA 3TN2A 3SGIA 5KNBA 1P8LA 5C5LA 4IFDG 3S1MH 3GQBA 2A69C 4BBRH 4DV2L 2RDGA 1JOKA 3ZYYX 2VNUD 1LM0A 1HUMA 3UI2A 4IUPA 3VR6A 1Q86C 1SNPA 4C3JH 4DR6Q 4A3MG 1YI2A 1IW7D 3AQQA 1QZGA 2A6ED 2IWHA 4ZYSA 4I65A 1TQOA 4LK1C 3S17H 2NUCA 3DMUA 2NZOA 4R8NA 4A3EH 3CAMA 1VQCA 3F1ZA 3I4NG 5DM73 2F0HA 1RHPA 3FKIH 3TP6A 2Q2IA 2B8GA 1HPCA 5IYCG 2JJQA 2NZ1D 1O7YA 1A6XA 2MO0A 2KOLA 2Q8IB 1AE2A 1Q81C 2A8VA 1EYCA 1F9QA 3VDYA 3HOWH 2NBFA 3DWAA 4A3MB 1WD0A 5CV7A 5CBEE 2FJ2A 1EQRA 1TWGB 3E9HA 1PZJD 1BCPB 1CM9A 5EGTA 5I2YA 4V190 3E0JA 1KNEA 1EU4A 2ALYB 1GUNA 2G9HD 4DK3C 5JPNC 3A5UA 3HOYG 3I4NB 4FVMA 1HFGA 2UUBL 3QG1A 2RVLA 3MXNA 4BY7H 3U9SA 2I46A 3GTQH 1MJEA 2CQOA 1SLJA 4X3UA 5C3EH 2HDMA 1IYJB 1WI5A 4ZAIA 1CTMA 3I90A 4DV5L 1A2TA 5CC4A 4G4KA 3I2ZA 3GTMB 2HCIA 1H9SB 3BYTB 2HIXA 5CORA 1HNXQ 3S2DH 2K5WA 2EYFA 2KA7A 4RFBA 4IURA 4YCVA 4LWCA 1WTVA 4DV7L 1I4GA 1HNZQ 1HH2P 4FXDA 3PCOB 2K01A 5EAYA 4L5RC 1BR9A 3F2CA 1MSHA 4KY6A 3RNUA 4NXMQ 3B6YA 4JI6Q 2Z0SA 1CT1D 1IHZA 4PMCA 1HZBA 4RKLA 4B3TQ 4KHZA 3DWPA 2NVXH 1K83H 3LNNA 4HTHA 2LY7A 4QCLA 1MBYA 2XTIA 2UU9Q 4K5XA 4LNQA 1V1PA 2B2TA 1CZGA 2K52A 2L11A 4ODGA 2PI2E 1F2YA 4A3JB 4H44C 4JI0L 1OXSC 4L5SA 3R8BA 2OCEA 1BQQT 2IW3A 1A3UA 5LMUL 1IBML 2B3GA 3H3VI 1WTPA 1L0YB 4RCOA 4RHSA 4PZ6A 2IHEA 2HCCA 2RQXA 4O42A 4DV6L 3DUZA 1KQSA 2NZHA 1X54A 2C35B 1ET9A 3TRZA 3GV3A 4U68A 4DR3Q 3HKZG 2OTLA 4CDCC 1I6HB 1RD9D 3M4OH 1PH1A 4OEMB 1ONLA 4UAIA 4LUOA 1NAPA 1ESRA 4HSVA 4A3LG 2UXDL 2WKCA 4BS9A 3Q22A 2L9HA 1O78A 4ZQ3A 1CUKA 1IXRA 4NP5A 5IYBG 5M5YB 1S4ZA 2K03A 2VXWA 1SNMA 1SRUA 1A15A 3HKSA 4JI4L 2CWPA 3CCVA 3GTLB 1CKOA 2TSSA 5FK9C 2B2TC 1MD2D 2YU9H 3S1NH 4FF2A 4TSSA 3K5LA 4LF7Q 1JT8A 1PTOH 4OX9Q 3MXUA 1FJGL 1EY9A 3CCQA 2QDBA 1II3A 3BDCA 3W2DA 3L9AX 3PUYA 1PZID 1BCPF 4O1NA 4DR7L 1YVCA 1K8AC 4OWTB 4RA8A 3T16A 3BDOA 1Y1WG 2UUCQ 1PYSB 4DR4Q 3K7AH 1T5XD 2NN6H 2MO1A 2E8GA 3OPOA 1AN8A 1F2ZA 1QUQA 2GN5A 2X69A 1B4OA 2EY6A 1SROA 1Q1EA 1U4LA 4O2DA 2B63H 3KBGA 5EQ0A 2I0QA 5E4WC 5GAEC 3NPPA 4BBRG 3TBIB 3NTHA 1W6JA 2Q2UA 2UXCL 1PH4A 3CQZB 3T13A 4C3JG 2F0FA 1Y1WB 3S9WA 1W2BA 3NXWA 4X62L 4CKCA 1OXTA 5TSSA 3KLSA 1CK1A 1VQHA 1PTOD 4XQQA 4LF8L 1X65A 1KDBA 1AW7A 3AB9A 1VQDA 3CC2A 3R2TA 1BF4A 2FMCA 3D4WA 3HEJA 4KKSA 4BBRB 4DA2A 3U58A 2KHIA 4JI3L 4JK1C 2A74C 5D3DA 2YTYA 4KD4A 1GOZA 4JYAL 4YCWA 5IGFA 1TT2A 1D5XC 2XSCA 4GN4B 1Z7TA 2Z4IA 2G5DA 1KRSA 4GKJQ 1A63A 4NMZA 4RHRA 5M3MG 4HJ7A 2Z9HA 1PVOA 2DUDA 2KQ3A 4DFAA 3T56B 1KIXA 1QVFA 1VMCA 5JVG3 2E2JH 1SYBA 3V05A 1IYVA 5BR8L 3JAMi 4UY8C 1XXGA 4AYBG 5M5WH 5IWAQ 2E5LQ 1R4QB 4APVA 3CCMA 1NUCA 5C3EG 1NR2A 1LT3D 4JG2A 1HNWL 2WV6D 2F0OA 4QIWB 3ULLA 1YNXA 4LFCQ 2MGSA 1G291 1XWEA 1LTRD 5M3MB 3HZXA 4R4TA 3SVMA 1F2MA 4XQJA 1V43A 1HTLD 1V8QA 1SXTA 1KRTA 1PZKD 1EWHA 2R7FA 1PA6A 4AYBB 4LF9L 2F3IA 4R8IA 1GM5A 4KHPQ 4QUFA 3PUVA 5A35A 5C3EB 1HQRD 2D0OA 4Q5VA 2DGYA 3KLRA 3CF5A 2QCPX 2XGTA 3UDXA 2QEXA 1F9SA 1VQ4A 1FNUA 1RL2A 4DV0L 5FOBB 4H7BA 2O4XA 4MNOA 3SE0A 3OW7A 3S2DB 1VQBA 5EJWA 4PZ7A 1UUPA 2JN4A 1PH6A 2NYZD 2JP1A 4FXGC 1VQAA 2IHFA 2BE5D 3A8KE 2UXBL 4S3SA 4B3SL 4RG1A 3L7ZC 5C3WA 3M4PA 2VS1A 2F0UA 1XMOQ 1AFPA 1K83B 1WTHA 3JC66 1LTID 3PIO3 1SN8A 4JI5L 3TZUA 1G8ZD 4KJOA 3HGBA 1K28A 4GNXC 1MJCA 1TR5A 1STAA 5J1ZA 1TWGH 1F77A 5EPJA 2EJMA 2VY3A 4RMFA 3V2TA 1NY4A 4TQUS 1BBXC 1L1OC 4CJ1B 4KV6A 4JC0A 3I4NH 4LFAQ 4HJAA 4P71A 2E2DC 2F0KA 1PFMA 2PQAA 1YBYA 2PO4A 5KEEA 4C3IH 1DOMA 2K4KA 2F4VQ 1RTOA 4OXPA 3WOEA 1JE4A 2ZTDA 1FYCA 4A3GB 4OO1I 5COYA 4NPSA 4DXGA 5KGUA 2ZM6Q 1Q8IA 2ZTEA 1XMQQ 2A5HA 4PMWA 4A93G 2IL8A 2QDLA 3TQYA 3CC7A 4EX5A 1STHA 1UE1A 3GO5A 2MJ8A 3J80c 3GTMH 2HHHQ 1PH7A 2EPBA 3QOLA 1PRTC 2F4IA 4RAUC 3OOCA 2D2CC 4WRDA 5J22A 3H3VC 5FLXL 3P1HA 5M5XB 5CMDA 4DR1Q 1EOTA 3OWFA 3NEMA 5AJ3Q 2YU9B 2EY1A 4FYDA 2JA8G 4HCSA 2PZUA 3S15B 1PTOB 4K0KL 2A6HD 4A93B 3D4DA 3PO2B 3HRZC 5BN4A 1KHIA 1SEBD 1E3PA 1HTPA 4X6AH 5IGEA 2F1MA 3BZCA 4DR2L 3R3OA 2XWBB 4DKAC 1G91A 1ZXTA 4X3KA 3S24A 4XT3B 1VQGA 3TP7A 3ND9A 4IJHA 4A3JH 3DHQA 5JJLA 1PXUA 3A55A 3ULJA 4A3IH 1N32L 1K8GA 1HZCA 1I4HA 2F0NA 2F52A 3G4SA 2ZJQA 2JA8B 1ILQA 5IT9L 4RGNA 4XT1B 4AIMA 2O5IC 4WJ3M 1A3TA 4P74A 1H9MA 1QNKA 3OIQA 4XQNA 5LMNL 3IRBA 3AYHB 3NSWA 2WP8J 2AQ2B 1L0WA 5IY0A 2XRQD 1NTGA 3FEWX 1I6HH 1BUVT 3STBD 1QWYA 3FP9A 1EL0A 1QUQB 1X55A 2GVBA 3L3OC 4JBWA 3W5OA 1E2ZA 4V0BA 4JV5L 2RCNA 3U50C 1EOVA 1H9KA 1KDAA 2NTSA 4JI1Q 3T1YQ 1EQVA 4X3SA 1VQ8A 3VR4A 3J80L 1KD1C 3KF8A 3G6EA 4FF1A 3GTLH 3DWQA 4OELB 3T1HL 2CVRA 3G6JB 4JOIA 1HXYD 2KUMA 1HR0L 1EFID 2KJXA 5GROA 4X65L 4C3HG 4QIWE 1FGUA 1X3PA 1A3VA 4IUNA 1E7ZA 2K1BA 1TU2B 3TMEA 1D5MC 3GTOH 2JYOA 5J3BA 3MVVA 1S5DD 3M3YB 1QVCA 1J6QA 3K5OA 5DAUA 2B2WA 1FR3A 1X56A 3BS1A 5IYBH 2KHJA 2E2JB 1EY4A 4LMQD 1ZYRC 4IOCA 3A8JE 2NVQB 4Q0FA 1KLGD 4FNFA 5M3FH 5LL6S 4OIJA 5E1FA 4C3HB 1XNQQ 2EYMA 4DR5Q 4CGYB 1N36Q 1I4PA 2FXQA 1D8LA 4C1NI 3BVGA 5C0XI 1LTGD 1VQKA 2B2VC 1AZQA 3E9IA 1TY0A 5F2DA 5GAGC 1CKNA 3MXGA 4RH6A 4BXXH 2VUMG 3E3XA 5KNCA 4O0AA 5CV8A 1AE3A 1YHAA 2K33A 3KFUA 2XVSA 3J7AF 3QB3A 1SYDA 1SMYC 4JOIC 1M4VA 4HSPA 3SHLA 4DV4L 4P2CB 1XPRA 3HOZG 1V1OA 2I5LX 3BYYB 1GUWA 2D9UA 1KLUD 3I91A 5ISRA 2F0QA 4YWMA 1S5CD 2N55A 1GUGA 3AMUA 1PTOF 2B2WC 2ASBA 4K8IA 2VUMB 4MHEA 1JWMD 3UE1A 4AQYL 2Q8TA 1CZWA 4IQZA 3W1BA 4A3DB 4KHVA 1B53A 3VR5A 3IFTA 3HOZB 4ABNA 1N33L 1WFQA 2CFMA 2H1EA 2Z6KA 2A69D 1TY2A 4YHHQ 2JEAI 1JB7A 1EIYB 3CCLA 5IYDH 4ILWA 2QKIC 4C3IG 4LUVA 1UEAB 1DONA 2SDFA 3J81L 3KDFA 1PH3A 4I7ZC 1Q1BA 3CCEA 1EUJA 1TS3A 3GV6A 3PO3G 1TVXA 4B3RL 4GKKL 1SBBB 1E2VA 2I07B 2RCFA 1K0RA 1TS4A 2XN9C 2R6GA 5M3MH 3CHBD 3NUCA 1DD2A 2M9VA 2BH8A 2ZXPA 4G7OC 2DY7A 2G9DA 3DLLA 4CDFC 4KN4C 1EYDA 1ESFA 1V9PA 4X66L 4YY3L 4C3IB 4ULLA 4LFBQ 1WJJA 4DUZQ 4QF4A 3BDLA 1KTKA 4ID6A 4KD3A 4FP5D 3CCSA 1HA6A 2RA4A 4QB4A 3PO3B 2RF4A 3VYTA 2SNMA 3CCJA 3CRKC 3E0EA 1AEXA 5IE8A 1F9PA 1PFSA 1BO0A 2FHTA 4UP8A 5FO8B 3R2IA 1IBLQ 4A76A 4MN3A 3BG3A 1LTLA 3MEHA 1WTQA 1VQ5A 2Z6KC 4WJWA 2HQEA 3ND8A 2NTTA 3D6CA 1FL0A 4A3JG 1GXDC 2EYPA 1JWSD 1B50A 5GADC 1LTBD 1D1KA 3ITPA 1EY7A 1BNZA 2KHSA 4A3IG 2EIFA 2OTJA 3S16H 4OWXB 4DN4M 1DYQA 3E5SA 1IL2A 1XTCD 2IX1A 3G7LA 4PNYA 3KBXA 2L5TA 4JI8L 5CV9A 2WB1E 4LF5L 2Y0SB 3M4QA 4IFDI 4XTCS 2AHOB 1B1ZA 3IFDA 5LL6X 3I3CA 3FRPB 5EKIA 1Q7YC 2PW5A 2V4DA 3BVMA 3ICEA 2ZT9C 4JBMA 2DN8A 1UE6A 2EJGC 5J39A 3ERQA 3CXCA 2XRSD 4DAYA 5LHY1 3KOJA 4DV3Q 4A3IB 1D6EC 4RCNA 5ELDA 3D6WA 2PMZB 2CKZB 1K8OA 3U4VA 5CGKA 1NMGA 1JCKB 5I6YA 1GUOA 5KRUA 1XX8A 4A3GH 4UP9A 3RN2A 1AP0A 1IBKL 3F2BA 3I8ZA 1WTOA 3AEVA 3KLSX 4PZ8A 4NXNQ 2JQOA 1LUZA 1A2UA 3X3NA 3A54A 1VQ9A 1SJHD 4MIUA 4DUYL 1EIFA 3EROA 1U4MA 4DV1L 1SYGA 3MWYW 5ELFA 1Y8PB 5HGTA 3HS0C 1Y1VH 2OT2A 3UE0A 4EQPA 3OIPA 2N78A 3I4OA 3OTOL 4IPHA 1DGSA 2OQ0A 2TMPA 1IYUA 1J5EL 4ZUJA 5M5XH 2B39A 3VR3A 2KVMA 4LW1A 3URYA 4C56C 1I94L 1RKNA 2ZXRA 2VQFL 5M3FG 3S15H 4A93H 1DOLA 2VQEQ 4JI7L 2A68C 1HHVA 3PO2H 4BY1B 1HA5A 1VQIA 2CCZA 1X32A 3GTOB 2RHSB 2F0LA 1MIUA 2AQ1B 4RGMA 3CD6A 4BXXG 2RHQB 3EJIA 1VQPA 1XNRQ 1PYWD 3KUPA 1K9MC 3KF8B 4JI2Q 2JEBI 4FO2A 4DF7A 4KY7A 1NCVA 4GN5A 1EIGA 2E2HB 4QMGA 3MA2B 1I50B 4LF6L 1ENFA 3A8IE 4JCVE 3Q23A 2JA8H 5M3FB 1ICFB 4GOPC 4YCUA 5FLXE 4AH6A 3PIOA 1X6OA 1EY0A 3NBHB 1YJ9A 3QWNA 3CRLC 2KEDA 4F7XA 3M4YA 2R61A 4DGZA 3H94A 2L15A 4DPGA 1PMRA 4WJ4A 2MQHA 2RDFA 4ZCKA 2VB2X 2JE6I 2PNHA 3MXPA 2K6AA 2AUJD 4HIOA 3FPUB 2FMMA 2IX0A 2PYKA 5IIFA 2QGQA 1D7QA 1CQVA 1EZ6A 4QJFA 4EGVA 5I9PA 1TXYA 3CW2C 1BKBA 4L5QA 3PGZA 1G2TA 1RIPA 1I3QB 5C5MA 3QOJA 5IYDG 3D0FA 3OMGA 5IT9E 1GVPA 2IY5B 1O7IA 1Q46A 4GS3A 1QNUA 2K04A 5C3XA 4GN3B 1CA6A 2F03A 1ASZA 2NVTB 1J9OA 1DZ1A 1ET6A 2J7ZA 5JAVA 3M3YH 1CHQD 1HFNA 3CPWA 1G51A 3OHXC 2K75A 1UEBA 2UUBQ 4J15A 3AFQA 2PW7A 5JOBA 2QA4A 2NVQH 3KYHC 1ML0D 5C4XH 1KABA 3I55A 1NNXA 3J80E 4C3HH
chains in the Genus database with same CATH topology
1VQNA 1E1TA 1P8LA 1HR0Q 4GOPA 4IFDG 3S1MH 4K0KL 4BY1G 4A4IA 4X65Q 1EFWA 4P73A 2ZJPA 3G71A 1KHIA 1JE5A 1E3PA 2AWNA 3GD7A 1XMOL 1PH9A 4X6AH 4BBRH 4DV5Q 4DV2L 4OO1G 1Q12A 5HY6A 3U4ZA 3BZCA 3I7FA 4DR2L 3GTJH 4DKAC 3OW2A 2VNUD 1LM0A 5JEAG 4GNXA 3PSIA 2LXKA 1TWCH 3S24A 1Q86C 2B29A 2BH2A 4C3JH 1YJNA 4DR6Q 1VQGA 4A3MG 1YI2A 3ER0A 3AQQA 4IJHA 1XPOA 4A3JH 1QZGA 2JA5G 4BBSG 5JJLA 4A3KH 4DV7Q 4QL5A 3KDFB 4DK6C 3KF6A 3CCRA 1EYGA 1W3SA 3S17H 3ULJA 1VQJA 1L1OA 3RZDH 2NZOA 2LXJA 4A3IH 1S72A 1HZCA 2F52A 3G4SA 4A3EH 1K8GA 3CAMA 2ZJQA 4LFAL 4POGA 1VQCA 4B3ML 1S3OA 3F1ZA 3W1GA 1XPUA 3I4NG 1VQEA 3FKIH 4AIMA 2Q2IA 1G6PA 4WJ3M 2VZAA 4P74A 4TVAB 1N34L 5IYCG 2JJQA 2Y0SE 3MEFA 3L0OA 2WFWA 2HIVA 2F4VL 4LF4L 3TEHB 2IT1A 2MO0A 5LMNL 2VUMH 2JA6H 3IRBA 1OXUA 1A0IA 1AE2A 4A75A 1Q81C 3A5ZB 3AYHB 2A8VA 3MXNB 4ME3A 3VDYA 2ZM6L 3HOWH 4A3CH 1TWFH 2WP8J 1L0WA 1HZ9A 5IY0A 1XMQL 4BA2I 1EQRA 3E9HA 1NTGA 3TREA 4A3DH 1PH2A 1I6HH 1JJGA 3PF4A 3I4MH 1NBWA 3STBD 1QVGA 4JI0Q 4HJ9A 3HOZH 1H95A 3FP9A 2ALYB 2HHHL 1QUQB 1X55A 2GVBA 4KLKA 5LMUQ 4DK3C 2WAQE 4JBWA 3A5UA 3W5OA 4DV4Q 1IBMQ 3HOYG 2D62A 2BA0A 2VW9A 2RCNA 4JV5L 3M7NA 2PMZE 3U50C 2UUBL 1EOVA 3S1RH 2UUAL 4JI1Q 1SMXA 4X64L 3T1YQ 4BY7H 1VQ8A 1N9WA 2KENA 3GTQH 1YIJA 4DV2Q 1N8RC 1KD1C 3G6EA 1MJEA 3GTLH 2R7ZG 5ELOA 2PI2A 2CQOA 4DV6Q 3T1HL 1SLJA 4DR1L 5AJ3L 4A3GG 5C3EH 4JOIA 4C2MH 1U5KA 4AQYQ 1HR0L 3JAMc 5GROA 4X65L 3K80C 1IYJB 4QIWE 5FLMG 1FGUA 1WI5A 3ERSX 4LUZA 4IPGA 2HT1A 1E7ZA 1SE8A 1IZ6A 2ZTCA 4DV5L 4MTNA 3GTOH 5J3BA 1A62A 1AH9A 3I2ZA 1K73C 1JJCB 3S2DH 2UXDQ 5DLQE 2HIXA 1HNXQ 1N33Q 1QVCA 1J6QA 4IFDJ 1X56A 4DR6L 3WWVA 1R9TH 5IYBH 4YCVA 2KHJA 4LWCA 1Y1VG 1GKHA 2MNAA 1JMCA 4DV7L 3H3VH 1CKNB 1HNZQ 4IOCA 1HH2P 1X3EA 4DNIA 4L5TA 1HZAA 2R7DA 1C0AA 4Y7NH 3PCOB 4JI4Q 5EAYA 4L5RC 3PO3H 3F2CA 3UDFA 5JEAJ 3RNUA 4NXMQ 5M3FH 3B6YA 2OWOA 4JI6Q 4B3RQ 4A3EG 5FJ8G 4GKKQ 1XNQQ 2Z0SA 1PYBA 4DR5Q 2YYZA 1N36Q 3PV0A 1PV4A 2FXQA 3PO2G 4A3FH 1D8LA 1HZBA 3FKIG 4B3TQ 2A19A 4KHZA 1SFOH 5C0XI 1K83H 2NVXH 1FJGQ 1VQKA 3E9IA 1KXLA 5GAGC 1CKNA 4BXXH 2VUMG 2XTIA 4DR7Q 2JA6G 2UU9Q 4JBKA 3J81j 3GTGH 1GO3E 4IPDA 4O0AA 4LNQA 2K52A 3CP0A 1NJIC 1AE3A 3HOWG 4X66Q 1YHAA 4YY3Q 1A8VA 2PI2E 3KFUA 4QQBX 3L2PA 4GLVB 5IP7G 2E2IH 4JI0L 1M1KC 2V1CC 2JA9A 1OXSC 4JOIC 3FHWA 2OCEA 4L5SA 2KCTA 3H0GH 3I4MG 5LMUL 1B7YB 5GAHC 4DV4L 1XPRA 1IBML 3HOZG 2B3GA 3CMAA 3H3VI 3I56A 2I5LX 4JI1L 3T1YL 4PZ6A 4H02A 2IHEA 2WB1G 4YWMA 5IP9H 4A3BH 4BY7G 1UWVA 1PHJA 3HOUG 5K36G 2K5HA 3GTPH 4DV6L 2Q2TA 3ULPA 2ASBA 5C44H 4YWLA 3UE1A 2UXCQ 4DAMA 1KQSA 3K8AA 1MKHA 2NZHA 2R92G 4AQYL 1X54A 2C35B 3HOVH 1XJVA 2KBNA 2D0PA 4GLXA 4R1JA 4XIGS 3J81i 3CC4A 3TRZA 1NMFA 1VQ6A 4DR3Q 3HKZG 2OTLA 3W1BA 3BZKA 3M4OH 1PH1A 4X62Q 4HIDA 4LUOA 1TWAH 1WCMG 4A3LG 2UXDL 4OONA 4QGUA 1V1QA 1HNXL 4P72A 1N33L 4LF8Q 1WFQA 2CFMA 2Z6KA 1CUKA 4YHHQ 2JEAI 1VQMA 2BA1A 4JI8Q 1JB7A 1EIYB 1IXRA 3CCLA 5IYDH 5IYBG 1HNZL 4LF5Q 4LUVA 3K0XA 4UPAA 3KJPA 1SRUA 2ZJRA 4JI4L 3HKSA 2N8NA 2CWPA 3KDFA 3CCVA 4JI3Q 1PH3A 1WYDA 1Q1BA 1CKOA 3CCEA 2N3SA 4JYAQ 4NXML 1EUJA 2N49A 1KAWA 2YU9H 3S1NH 3PO3G 4JI6L 4LF7Q 4B3RL 1JT8A 3J80i 4GKKL 1XNQL 1P16A 3S14H 4DR5L 1N36L 4OX9Q 4IO9A 1K0RA 2A1AA 4B3TL 2R6GA 4R4QA 5M3MH 1FJGL 3CCQA 3HOXH 2GVAA 2EXDA 2BH8A 2JK8A 3PUYA 1CKMA 1LYLA 5GQOA 1YVCA 3EIVA 5FLXc 2UU9L 2JA7H 3DLLA 1K8AC 4DR7L 1YEZA 4OWTB 1V9PA 2CWAA 1Y14B 4X66L 4YY3L 3KLWA 3UDIA 4LFBQ 1WJJA 5BR8Q 4DUZQ 1Y1WG 2UUCQ 1E1OA 1CSQA 1PYSB 1KL9A 1YITA 3S1QH 4DR4Q 3DM3A 5C4XG 1UE7A 3K7AH 2MO1A 3CCSA 2E8GA 3PUXA 2RF4A 1IBKQ 2GN5A 1QUQA 1EWIA 3CCJA 4BY1H 3E0EA 1SROA 1Q1EA 4O2DA 3PF5A 2B63H 4IOAA 1HNWQ 3OYYA 5IE8A 1PFSA 4UP8A 2I0QA 5GAEC 1IBLQ 4BBRG 4A76A 4HJ5A 1LTLA 4A3BG 4DUYQ 1VQ5A 2Q2UA 2UXCL 2Z6KC 1PH4A 4DV1Q 1X3GA 4A3MH 1KC8C 3D31A 5LMNW 1YHBA 1FL0A 3UDGA 3CPFA 3OTOQ 4DR3L 4A3JG 2E2HH 4A3KG 1W2BA 4LF9Q 5IT9c 1I50H 1OXVA 1J5EQ 5GADC 4X62L 3S2HH 1OXTA 4A3IG 2EIFA 1VQHA 2OTJA 3S16H 4OWXB 1I94Q 4LF8L 2VQFQ 1IL2A 1X65A 3RLNA 2IX1A 4OWWB 4YHHL 1VQDA 4JI7Q 3F2DA 3CC2A 1QZHA 2NN6I 1I5FA 2OQKA 1YZ6A 4JI8L 4DAYB 2WB1E 5IYCH 4LF5L 3RR5A 3M4QA 3U58A 4IFDI 4XTCS 2KHIA 4JI3L 2YTYA 1BBWA 4DV0Q 2AHOB 1JJ2A 5C4JH 4JYAL 2YV5A 5JJIA 1T9HA 3ZJYC 4YCWA 4LF7L 1Q7YC 4A3CG 4GN4B 3G48A 4OX9L 3ICEA 4JBMA 1PH5A 1KRSA 4GKJQ 4A3DG 3HKZE 1UE6A 4QY7A 1A63A 3PUWA 1BBUA 1B70B 3CXCA 1HR0W 1VS0A 4FDBA 5M3MG 3KOJA 4DV3Q 3HOXG 4HJ7A 4LF6Q 3HOYH 4GOPB 1PVOA 2UXBQ 3LGJA 2DUDA 1HJPA 4BA1I 1TWHH 1ASYA 4B3SQ 1BVSA 1I3QH 1KIXA 1QVFA 2CKZB 2E2JH 1YJWA 4LFBL 3U4VA 4DUZL 5BR8L 3JAMi 1NMGA 4UY8C 2UUCL 5E7NA 4AYBG 4DR4L 5M5WH 2LSSA 5IWAQ 2E5LQ 2K5VA 4GNXB 4APVA 4UP9A 3CCMA 1VQFA 3RN2A 4JI5Q 1B8AA 4A3GH 1IBKL 3F2BA 1OTCA 4PG3A 2NN6G 5C3EG 5C0XG 3AEVA 4JG2A 4PZ8A 5FLMH 1HNWL 4NXNQ 2NVTH 1XTDA 2YTVA 3KF6B 3ULLA 2I5HA 1YNXA 4NB3A 2JQOA 1LUZA 4LFCQ 2B63G 1L1OB 1CSPA 1G291 1IBLL 1VQ9A 4R4TA 1Z47A 4DUYL 1EIFA 1U0LA 3J7ZC 3J7A5 3RZOH 3Q8DA 1V43A 4DV1L 2VL6A 2AMCB 2EQSA 1Y1VH 3UE0A 1KRTA 2N78A 3I4OA 3OTOL 2R7FA 4IPHA 1DGSA 2OQ0A 1PA6A 4LF9L 4GLAC 2F3IA 5M5XH 1J5EL 1GM5A 4KHPQ 4Y52H 3PUVA 3STBC 1VCIA 5JJKA 4LW1A 1E24A 3H15A 2D0OA 1I94L 3S15H 2VQFL 5FJ8H 2DGYA 5M3FG 4A93H 2VQEQ 3CF5A 4JI7L 3K7UC 3PO2H 2KCMA 2XGTA 1S40A 1VQIA 3K81C 3UDXA 2QEXA 4A3FG 2CCZA 4R4OA 1GD7A 1VQ4A 1M90C 2MFIA 3GDEA 1RL2A 1K3RA 2RHSB 4DV0L 3F8TA 1MIUA 4MNOA 1N32L 3CD6A 4BXXG 2RHQB 1VQBA 1VQPA 4PZ7A 1XNRQ 1PH6A 2R93H 4IPCA 1K9MC 4UP7A 3TS0A 3KF8B 4JI2Q 2JEBI 5IP7H 1VQOA 4GKJL 4GN5A 1VQAA 2IHFA 3M9BA 1SR3A 3CCUA 1C9OA 4DV3L 4LF6L 1Q8KA 4JCVE 2ES2A 3H0GG 2JA8H 2UXBL 4GOPC 3BU2A 4YCUA 4B3SL 4RG1A 4AH6A 3L7ZC 2K50A 3PIOA 4K0KQ 3M4PA 1X6OA 4ALPA 2VS1A 2Y0SG 3NBHB 3GTKH 1YJ9A 5M5YH 5IP9G 1XMOQ 3HOUH 5IWAL 2E5LL 3RN5A 4POFA 1EQQA 1FVIA 5ELNA 3JC66 1Z9FA 1SN8A 4KI0A 4JI5L 2PQAB 4DR2Q 4GNXC 2R92H 1WOCA 1UE5A 5C44G 2L15A 4DPGA 1MJCA 2AWOA 2JA5H 1Q82C 4BBSH 1NE3A 1TWGH 2MQHA 4WJ4A 4NXNL 3HOVG 1OXXK 2JE6I 2PNHA 2AKWB 2Q2HA 3BJUA 2VY3A 4RMFA 4LFCL 1NY4A 3A74A 4EQ5A 4TQUS 4HIOA 1C7YA 1L1OC 3EN2A 2IX0A 1WCMH 2QGQA 4A3LH 1D7QA 1N32Q 4JC0A 3I4NH 4LFAQ 4QJFA 2WAQG 4HIKA 4HJAA 4P71A 1VQLA 3J81c 4HIMA 4B3MQ 5C0XJ 1TXYA 3TS2A 4YWKA 3CW2C 2ATWA 1BKBA 4L5QA 3PGZA 1L2FA 2PQAA 1YBYA 1RIPA 1N34Q 4C3IH 5H1SE 2K4KA 5IYDG 3CMEA 3D0FA 4P75A 2F4VQ 4AYBE 4LF4Q 1GVPA 4KHPL 5LMNQ 4JBJA 4OXPA 2IY5B 2ZTDA 3KJOA 1O7IA 1Q46A 3NENA 4GS3A 4OO1I 2NVYH 4R4CA 4NPSA 2ZM6Q 3PIPA 2VQEL 2ZTEA 3RLOA 1XMQQ 4GN3B 4PMWA 4A93G 4R4IA 3HFZB 1ASZA 3TQYA 2K14A 3CC7A 4EX5A 1UE1A 2YTXA 2I5MX 3EBEA 2H5XA 3GO5A 3PUZA 3J80c 4IJLA 1X3FA 3GTMH 2HHHQ 3A0JA 3M3YH 3CPWA 1G51A 2K5NA 2K75A 3M85A 4JV5Q 1PH7A 1UEBA 3CQZH 1XNRL 4HJ8A 2UUBQ 2JA7G 1YHQA 3AFPA 4J15A 2UUAQ 1VQ7A 3AFQA 4X64Q 4JI2L 2QA4A 1X9NA 1E22A 2NVQH 2R7ZH 3KYHC 2R93G 1Y1WH 4MZ9A 2ID0A 5C4XH 5HGQA 2HQLA 3NELA 3I55A 3RLFA 1PH8A 3T1HQ 4DR1Q 5AJ3Q 3NEMA 4C3HH 2JA8G 3SGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQN A;  1E1T A;  1P8L A;  1HR0 Q;  4GOP A;  4IFD G;  3S1M H;  4K0K L;  4BY1 G;  4A4I A;  4X65 Q;  1EFW A;  4P73 A;  2ZJP A;  3G71 A;  1KHI A;  1JE5 A;  1E3P A;  2AWN A;  3GD7 A;  1XMO L;  1PH9 A;  4X6A H;  4BBR H;  4DV5 Q;  4DV2 L;  4OO1 G;  1Q12 A;  5HY6 A;  3U4Z A;  3BZC A;  3I7F A;  4DR2 L;  3GTJ H;  4DKA C;  3OW2 A;  2VNU D;  1LM0 A;  5JEA G;  4GNX A;  3PSI A;  2LXK A;  1TWC H;  3S24 A;  1Q86 C;  2B29 A;  2BH2 A;  4C3J H;  1YJN A;  4DR6 Q;  1VQG A;  4A3M G;  1YI2 A;  3ER0 A;  3AQQ A;  4IJH A;  1XPO A;  4A3J H;  1QZG A;  2JA5 G;  4BBS G;  5JJL A;  4A3K H;  4DV7 Q;  4QL5 A;  3KDF B;  4DK6 C;  3KF6 A;  3CCR A;  1EYG A;  1W3S A;  3S17 H;  3ULJ A;  1VQJ A;  1L1O A;  3RZD H;  2NZO A;  2LXJ A;  4A3I H;  1S72 A;  1HZC A;  2F52 A;  3G4S A;  4A3E H;  1K8G A;  3CAM A;  2ZJQ A;  4LFA L;  4POG A;  1VQC A;  4B3M L;  1S3O A;  3F1Z A;  3W1G A;  1XPU A;  3I4N G;  1VQE A;  3FKI H;  4AIM A;  2Q2I A;  1G6P A;  4WJ3 M;  2VZA A;  4P74 A;  4TVA B;  1N34 L;  5IYC G;  2JJQ A;  2Y0S E;  3MEF A;  3L0O A;  2WFW A;  2HIV A;  2F4V L;  4LF4 L;  3TEH B;  2IT1 A;  2MO0 A;  5LMN L;  2VUM H;  2JA6 H;  3IRB A;  1OXU A;  1A0I A;  1AE2 A;  4A75 A;  1Q81 C;  3A5Z B;  3AYH B;  2A8V A;  3MXN B;  4ME3 A;  3VDY A;  2ZM6 L;  3HOW H;  4A3C H;  1TWF H;  2WP8 J;  1L0W A;  1HZ9 A;  5IY0 A;  1XMQ L;  4BA2 I;  1EQR A;  3E9H A;  1NTG A;  3TRE A;  4A3D H;  1PH2 A;  1I6H H;  1JJG A;  3PF4 A;  3I4M H;  1NBW A;  3STB D;  1QVG A;  4JI0 Q;  4HJ9 A;  3HOZ H;  1H95 A;  3FP9 A;  2ALY B;  2HHH L;  1QUQ B;  1X55 A;  2GVB A;  4KLK A;  5LMU Q;  4DK3 C;  2WAQ E;  4JBW A;  3A5U A;  3W5O A;  4DV4 Q;  1IBM Q;  3HOY G;  2D62 A;  2BA0 A;  2VW9 A;  2RCN A;  4JV5 L;  3M7N A;  2PMZ E;  3U50 C;  2UUB L;  1EOV A;  3S1R H;  2UUA L;  4JI1 Q;  1SMX A;  4X64 L;  3T1Y Q;  4BY7 H;  1VQ8 A;  1N9W A;  2KEN A;  3GTQ H;  1YIJ A;  4DV2 Q;  1N8R C;  1KD1 C;  3G6E A;  1MJE A;  3GTL H;  2R7Z G;  5ELO A;  2PI2 A;  2CQO A;  4DV6 Q;  3T1H L;  1SLJ A;  4DR1 L;  5AJ3 L;  4A3G G;  5C3E H;  4JOI A;  4C2M H;  1U5K A;  4AQY Q;  1HR0 L;  3JAM c;  5GRO A;  4X65 L;  3K80 C;  1IYJ B;  4QIW E;  5FLM G;  1FGU A;  1WI5 A;  3ERS X;  4LUZ A;  4IPG A;  2HT1 A;  1E7Z A;  1SE8 A;  1IZ6 A;  2ZTC A;  4DV5 L;  4MTN A;  3GTO H;  5J3B A;  1A62 A;  1AH9 A;  3I2Z A;  1K73 C;  1JJC B;  3S2D H;  2UXD Q;  5DLQ E;  2HIX A;  1HNX Q;  1N33 Q;  1QVC A;  1J6Q A;  4IFD J;  1X56 A;  4DR6 L;  3WWV A;  1R9T H;  5IYB H;  4YCV A;  2KHJ A;  4LWC A;  1Y1V G;  1GKH A;  2MNA A;  1JMC A;  4DV7 L;  3H3V H;  1CKN B;  1HNZ Q;  4IOC A;  1HH2 P;  1X3E A;  4DNI A;  4L5T A;  1HZA A;  2R7D A;  1C0A A;  4Y7N H;  3PCO B;  4JI4 Q;  5EAY A;  4L5R C;  3PO3 H;  3F2C A;  3UDF A;  5JEA J;  3RNU A;  4NXM Q;  5M3F H;  3B6Y A;  2OWO A;  4JI6 Q;  4B3R Q;  4A3E G;  5FJ8 G;  4GKK Q;  1XNQ Q;  2Z0S A;  1PYB A;  4DR5 Q;  2YYZ A;  1N36 Q;  3PV0 A;  1PV4 A;  2FXQ A;  3PO2 G;  4A3F H;  1D8L A;  1HZB A;  3FKI G;  4B3T Q;  2A19 A;  4KHZ A;  1SFO H;  5C0X I;  1K83 H;  2NVX H;  1FJG Q;  1VQK A;  3E9I A;  1KXL A;  5GAG C;  1CKN A;  4BXX H;  2VUM G;  2XTI A;  4DR7 Q;  2JA6 G;  2UU9 Q;  4JBK A;  3J81 j;  3GTG H;  1GO3 E;  4IPD A;  4O0A A;  4LNQ A;  2K52 A;  3CP0 A;  1NJI C;  1AE3 A;  3HOW G;  4X66 Q;  1YHA A;  4YY3 Q;  1A8V A;  2PI2 E;  3KFU A;  4QQB X;  3L2P A;  4GLV B;  5IP7 G;  2E2I H;  4JI0 L;  1M1K C;  2V1C C;  2JA9 A;  1OXS C;  4JOI C;  3FHW A;  2OCE A;  4L5S A;  2KCT A;  3H0G H;  3I4M G;  5LMU L;  1B7Y B;  5GAH C;  4DV4 L;  1XPR A;  1IBM L;  3HOZ G;  2B3G A;  3CMA A;  3H3V I;  3I56 A;  2I5L X;  4JI1 L;  3T1Y L;  4PZ6 A;  4H02 A;  2IHE A;  2WB1 G;  4YWM A;  5IP9 H;  4A3B H;  4BY7 G;  1UWV A;  1PHJ A;  3HOU G;  5K36 G;  2K5H A;  3GTP H;  4DV6 L;  2Q2T A;  3ULP A;  2ASB A;  5C44 H;  4YWL A;  3UE1 A;  2UXC Q;  4DAM A;  1KQS A;  3K8A A;  1MKH A;  2NZH A;  2R92 G;  4AQY L;  1X54 A;  2C35 B;  3HOV H;  1XJV A;  2KBN A;  2D0P A;  4GLX A;  4R1J A;  4XIG S;  3J81 i;  3CC4 A;  3TRZ A;  1NMF A;  1VQ6 A;  4DR3 Q;  3HKZ G;  2OTL A;  3W1B A;  3BZK A;  3M4O H;  1PH1 A;  4X62 Q;  4HID A;  4LUO A;  1TWA H;  1WCM G;  4A3L G;  2UXD L;  4OON A;  4QGU A;  1V1Q A;  1HNX L;  4P72 A;  1N33 L;  4LF8 Q;  1WFQ A;  2CFM A;  2Z6K A;  1CUK A;  4YHH Q;  2JEA I;  1VQM A;  2BA1 A;  4JI8 Q;  1JB7 A;  1EIY B;  1IXR A;  3CCL A;  5IYD H;  5IYB G;  1HNZ L;  4LF5 Q;  4LUV A;  3K0X A;  4UPA A;  3KJP A;  1SRU A;  2ZJR A;  4JI4 L;  3HKS A;  2N8N A;  2CWP A;  3KDF A;  3CCV A;  4JI3 Q;  1PH3 A;  1WYD A;  1Q1B A;  1CKO A;  3CCE A;  2N3S A;  4JYA Q;  4NXM L;  1EUJ A;  2N49 A;  1KAW A;  2YU9 H;  3S1N H;  3PO3 G;  4JI6 L;  4LF7 Q;  4B3R L;  1JT8 A;  3J80 i;  4GKK L;  1XNQ L;  1P16 A;  3S14 H;  4DR5 L;  1N36 L;  4OX9 Q;  4IO9 A;  1K0R A;  2A1A A;  4B3T L;  2R6G A;  4R4Q A;  5M3M H;  1FJG L;  3CCQ A;  3HOX H;  2GVA A;  2EXD A;  2BH8 A;  2JK8 A;  3PUY A;  1CKM A;  1LYL A;  5GQO A;  1YVC A;  3EIV A;  5FLX c;  2UU9 L;  2JA7 H;  3DLL A;  1K8A C;  4DR7 L;  1YEZ A;  4OWT B;  1V9P A;  2CWA A;  1Y14 B;  4X66 L;  4YY3 L;  3KLW A;  3UDI A;  4LFB Q;  1WJJ A;  5BR8 Q;  4DUZ Q;  1Y1W G;  2UUC Q;  1E1O A;  1CSQ A;  1PYS B;  1KL9 A;  1YIT A;  3S1Q H;  4DR4 Q;  3DM3 A;  5C4X G;  1UE7 A;  3K7A H;  2MO1 A;  3CCS A;  2E8G A;  3PUX A;  2RF4 A;  1IBK Q;  2GN5 A;  1QUQ A;  1EWI A;  3CCJ A;  4BY1 H;  3E0E A;  1SRO A;  1Q1E A;  4O2D A;  3PF5 A;  2B63 H;  4IOA A;  1HNW Q;  3OYY A;  5IE8 A;  1PFS A;  4UP8 A;  2I0Q A;  5GAE C;  1IBL Q;  4BBR G;  4A76 A;  4HJ5 A;  1LTL A;  4A3B G;  4DUY Q;  1VQ5 A;  2Q2U A;  2UXC L;  2Z6K C;  1PH4 A;  4DV1 Q;  1X3G A;  4A3M H;  1KC8 C;  3D31 A;  5LMN W;  1YHB A;  1FL0 A;  3UDG A;  3CPF A;  3OTO Q;  4DR3 L;  4A3J G;  2E2H H;  4A3K G;  1W2B A;  4LF9 Q;  5IT9 c;  1I50 H;  1OXV A;  1J5E Q;  5GAD C;  4X62 L;  3S2H H;  1OXT A;  4A3I G;  2EIF A;  1VQH A;  2OTJ A;  3S16 H;  4OWX B;  1I94 Q;  4LF8 L;  2VQF Q;  1IL2 A;  1X65 A;  3RLN A;  2IX1 A;  4OWW B;  4YHH L;  1VQD A;  4JI7 Q;  3F2D A;  3CC2 A;  1QZH A;  2NN6 I;  1I5F A;  2OQK A;  1YZ6 A;  4JI8 L;  4DAY B;  2WB1 E;  5IYC H;  4LF5 L;  3RR5 A;  3M4Q A;  3U58 A;  4IFD I;  4XTC S;  2KHI A;  4JI3 L;  2YTY A;  1BBW A;  4DV0 Q;  2AHO B;  1JJ2 A;  5C4J H;  4JYA L;  2YV5 A;  5JJI A;  1T9H A;  3ZJY C;  4YCW A;  4LF7 L;  1Q7Y C;  4A3C G;  4GN4 B;  3G48 A;  4OX9 L;  3ICE A;  4JBM A;  1PH5 A;  1KRS A;  4GKJ Q;  4A3D G;  3HKZ E;  1UE6 A;  4QY7 A;  1A63 A;  3PUW A;  1BBU A;  1B70 B;  3CXC A;  1HR0 W;  1VS0 A;  4FDB A;  5M3M G;  3KOJ A;  4DV3 Q;  3HOX G;  4HJ7 A;  4LF6 Q;  3HOY H;  4GOP B;  1PVO A;  2UXB Q;  3LGJ A;  2DUD A;  1HJP A;  4BA1 I;  1TWH H;  1ASY A;  4B3S Q;  1BVS A;  1I3Q H;  1KIX A;  1QVF A;  2CKZ B;  2E2J H;  1YJW A;  4LFB L;  3U4V A;  4DUZ L;  5BR8 L;  3JAM i;  1NMG A;  4UY8 C;  2UUC L;  5E7N A;  4AYB G;  4DR4 L;  5M5W H;  2LSS A;  5IWA Q;  2E5L Q;  2K5V A;  4GNX B;  4APV A;  4UP9 A;  3CCM A;  1VQF A;  3RN2 A;  4JI5 Q;  1B8A A;  4A3G H;  1IBK L;  3F2B A;  1OTC A;  4PG3 A;  2NN6 G;  5C3E G;  5C0X G;  3AEV A;  4JG2 A;  4PZ8 A;  5FLM H;  1HNW L;  4NXN Q;  2NVT H;  1XTD A;  2YTV A;  3KF6 B;  3ULL A;  2I5H A;  1YNX A;  4NB3 A;  2JQO A;  1LUZ A;  4LFC Q;  2B63 G;  1L1O B;  1CSP A;  1G29 1;  1IBL L;  1VQ9 A;  4R4T A;  1Z47 A;  4DUY L;  1EIF A;  1U0L A;  3J7Z C;  3J7A 5;  3RZO H;  3Q8D A;  1V43 A;  4DV1 L;  2VL6 A;  2AMC B;  2EQS A;  1Y1V H;  3UE0 A;  1KRT A;  2N78 A;  3I4O A;  3OTO L;  2R7F A;  4IPH A;  1DGS A;  2OQ0 A;  1PA6 A;  4LF9 L;  4GLA C;  2F3I A;  5M5X H;  1J5E L;  1GM5 A;  4KHP Q;  4Y52 H;  3PUV A;  3STB C;  1VCI A;  5JJK A;  4LW1 A;  1E24 A;  3H15 A;  2D0O A;  1I94 L;  3S15 H;  2VQF L;  5FJ8 H;  2DGY A;  5M3F G;  4A93 H;  2VQE Q;  3CF5 A;  4JI7 L;  3K7U C;  3PO2 H;  2KCM A;  2XGT A;  1S40 A;  1VQI A;  3K81 C;  3UDX A;  2QEX A;  4A3F G;  2CCZ A;  4R4O A;  1GD7 A;  1VQ4 A;  1M90 C;  2MFI A;  3GDE A;  1RL2 A;  1K3R A;  2RHS B;  4DV0 L;  3F8T A;  1MIU A;  4MNO A;  1N32 L;  3CD6 A;  4BXX G;  2RHQ B;  1VQB A;  1VQP A;  4PZ7 A;  1XNR Q;  1PH6 A;  2R93 H;  4IPC A;  1K9M C;  4UP7 A;  3TS0 A;  3KF8 B;  4JI2 Q;  2JEB I;  5IP7 H;  1VQO A;  4GKJ L;  4GN5 A;  1VQA A;  2IHF A;  3M9B A;  1SR3 A;  3CCU A;  1C9O A;  4DV3 L;  4LF6 L;  1Q8K A;  4JCV E;  2ES2 A;  3H0G G;  2JA8 H;  2UXB L;  4GOP C;  3BU2 A;  4YCU A;  4B3S L;  4RG1 A;  4AH6 A;  3L7Z C;  2K50 A;  3PIO A;  4K0K Q;  3M4P A;  1X6O A;  4ALP A;  2VS1 A;  2Y0S G;  3NBH B;  3GTK H;  1YJ9 A;  5M5Y H;  5IP9 G;  1XMO Q;  3HOU H;  5IWA L;  2E5L L;  3RN5 A;  4POF A;  1EQQ A;  1FVI A;  5ELN A;  3JC6 6;  1Z9F A;  1SN8 A;  4KI0 A;  4JI5 L;  2PQA B;  4DR2 Q;  4GNX C;  2R92 H;  1WOC A;  1UE5 A;  5C44 G;  2L15 A;  4DPG A;  1MJC A;  2AWO A;  2JA5 H;  1Q82 C;  4BBS H;  1NE3 A;  1TWG H;  2MQH A;  4WJ4 A;  4NXN L;  3HOV G;  1OXX K;  2JE6 I;  2PNH A;  2AKW B;  2Q2H A;  3BJU A;  2VY3 A;  4RMF A;  4LFC L;  1NY4 A;  3A74 A;  4EQ5 A;  4TQU S;  4HIO A;  1C7Y A;  1L1O C;  3EN2 A;  2IX0 A;  1WCM H;  2QGQ A;  4A3L H;  1D7Q A;  1N32 Q;  4JC0 A;  3I4N H;  4LFA Q;  4QJF A;  2WAQ G;  4HIK A;  4HJA A;  4P71 A;  1VQL A;  3J81 c;  4HIM A;  4B3M Q;  5C0X J;  1TXY A;  3TS2 A;  4YWK A;  3CW2 C;  2ATW A;  1BKB A;  4L5Q A;  3PGZ A;  1L2F A;  2PQA A;  1YBY A;  1RIP A;  1N34 Q;  4C3I H;  5H1S E;  2K4K A;  5IYD G;  3CME A;  3D0F A;  4P75 A;  2F4V Q;  4AYB E;  4LF4 Q;  1GVP A;  4KHP L;  5LMN Q;  4JBJ A;  4OXP A;  2IY5 B;  2ZTD A;  3KJO A;  1O7I A;  1Q46 A;  3NEN A;  4GS3 A;  4OO1 I;  2NVY H;  4R4C A;  4NPS A;  2ZM6 Q;  3PIP A;  2VQE L;  2ZTE A;  3RLO A;  1XMQ Q;  4GN3 B;  4PMW A;  4A93 G;  4R4I A;  3HFZ B;  1ASZ A;  3TQY A;  2K14 A;  3CC7 A;  4EX5 A;  1UE1 A;  2YTX A;  2I5M X;  3EBE A;  2H5X A;  3GO5 A;  3PUZ A;  3J80 c;  4IJL A;  1X3F A;  3GTM H;  2HHH Q;  3A0J A;  3M3Y H;  3CPW A;  1G51 A;  2K5N A;  2K75 A;  3M85 A;  4JV5 Q;  1PH7 A;  1UEB A;  3CQZ H;  1XNR L;  4HJ8 A;  2UUB Q;  2JA7 G;  1YHQ A;  3AFP A;  4J15 A;  2UUA Q;  1VQ7 A;  3AFQ A;  4X64 Q;  4JI2 L;  2QA4 A;  1X9N A;  1E22 A;  2NVQ H;  2R7Z H;  3KYH C;  2R93 G;  1Y1W H;  4MZ9 A;  2ID0 A;  5C4X H;  5HGQ A;  2HQL A;  3NEL A;  3I55 A;  3RLF A;  1PH8 A;  3T1H Q;  4DR1 Q;  5AJ3 Q;  3NEM A;  4C3H H;  2JA8 G;  3SGI A; 
#chains in the Genus database with same CATH topology
 1VQN A;  1E1T A;  2Q8R E;  2N88 A;  5KIX A;  2ZJP A;  1G2S A;  2AWN A;  1JE5 A;  3GD7 A;  4B08 A;  4DV5 Q;  4OO1 G;  2RBM A;  5HY6 A;  3U4Z A;  3X3M A;  4J1M A;  4GNX A;  2LXK A;  2BH2 A;  1YJN A;  3ER0 A;  2JA5 G;  4BBS G;  5L37 A;  4DV7 Q;  3KDF B;  4DK6 C;  1VF7 A;  3KF6 A;  3CCR A;  3OWE B;  1W3S A;  1EYG A;  1L1O A;  3RZD H;  1C8C A;  1QE6 A;  2LXJ A;  1S72 A;  4CHT B;  4POG A;  4B3M L;  1S3O A;  3GP7 A;  1VQE A;  3VA7 A;  1N34 L;  2Y0S E;  2Z4H A;  4LF4 L;  2WIN B;  3TEH B;  3GTK B;  2VUM H;  5IGB A;  1OXU A;  1A0I A;  3A5Z B;  3MXN B;  4ME3 A;  1SYF A;  2XNA C;  2F0I A;  1HZ9 A;  2JA5 B;  4BBS B;  5HUR A;  1ZKO A;  4A3D H;  1PH2 A;  3K5N A;  1FD7 D;  2ICI A;  4ME5 A;  4JI0 Q;  3HOZ H;  5LMU Q;  3SK6 A;  2WAQ E;  1IBM Q;  4Z9C B;  1AZP A;  3S16 B;  2D62 A;  2BA0 A;  2PMZ E;  4J8Q A;  1VMP A;  2UUA L;  4X64 L;  1IKL A;  2PZT A;  1ICW A;  3C3L A;  1N9W A;  2KEN A;  1YIJ A;  1N8R C;  2SNS A;  2R7Z G;  1QOH A;  5ELO A;  2K28 A;  4WOR A;  5D65 A;  4DV6 Q;  2C5C A;  4A3G G;  3SDZ A;  4C2M H;  3JAM c;  2Z6B A;  2NVY B;  5I6W A;  4ZUI A;  1DOK A;  1SJE D;  4LUZ A;  4IPG A;  5CV4 A;  3K6O A;  2EXZ A;  1FNV A;  1YNN C;  5IOC A;  1K73 C;  1JJC B;  2UXD Q;  1LLR D;  4DR6 L;  3WWV A;  1R9T H;  2L4N A;  2MNA A;  1Y1V G;  1GKH A;  1JMC A;  1NSN S;  3H3V H;  3Q6S A;  2E74 C;  1OO9 B;  1X3E A;  2R7Z B;  2R7D A;  4JI4 Q;  5DNF A;  2NWG A;  1V1P B;  3PO3 H;  5JEA J;  3J81 E;  2EYO A;  2OWO A;  2RSO A;  3A7A B;  3D4R A;  1PYB A;  2YYZ A;  3PV0 A;  5K5P A;  1PV4 A;  3PO2 G;  5IGC A;  2A19 A;  1FJG Q;  1TKW B;  1NR4 A;  1XYI A;  4DR7 Q;  5DEH A;  2RSN A;  2JA6 G;  3FMC A;  3GTG H;  4JBK A;  1K0S A;  4IPD A;  4K2K A;  2IJ0 A;  1TWC B;  1Y1V B;  3O13 A;  3QR8 A;  3CP0 A;  1NJI C;  1EIH A;  1BCP C;  3P20 A;  2F0S A;  3L2P A;  1Q3L A;  4A3K B;  4ZK9 B;  2V1C C;  3SK5 A;  1M1K C;  3FHW A;  1Y69 U;  3I4M G;  2ENB A;  4RWS C;  1JOQ A;  1B7Y B;  5GAH C;  1SE3 A;  3I56 A;  1EY8 A;  1RCV D;  2XIW A;  4HN7 A;  4EVO A;  3ONA B;  5G3L D;  1O80 A;  2WB1 G;  1LO5 D;  4NKL A;  1PHJ A;  3C2P A;  4K6D A;  3ULP A;  1EEI D;  2B8F A;  5C44 H;  2UXC Q;  2JA6 B;  2Z1C A;  1PRT D;  1MKH A;  3CKI B;  1SNC A;  4M1U B;  1ROD A;  3HOV H;  1YNJ C;  5CV6 A;  2D0P A;  4GLX A;  4R1J A;  1TWF B;  4XIG S;  3J81 i;  4B9X A;  3CC4 A;  1NMF A;  1VQ6 A;  4DAP A;  5JPM C;  4G7Z C;  5C4Z A;  2CW0 C;  3I4M B;  4X62 Q;  4HID A;  4K2L A;  4PMB A;  3J7A V;  4RKB A;  4N8F A;  2PCF B;  4CDE C;  4OON A;  2CHB D;  1HNX L;  1WVL A;  4LF8 Q;  4JVZ A;  3NQT A;  2WB1 B;  1VQM A;  4KJN A;  3S1R B;  4EQO A;  1HUN A;  1HNZ L;  3T51 B;  1PFB A;  2BCO A;  4UPA A;  5ELC A;  2N8N A;  4JI3 Q;  3A56 A;  4JYA Q;  1LV9 A;  2WII B;  4NXM L;  4JI6 L;  3NE5 B;  1LT5 D;  3N6R A;  3S14 H;  4IO9 A;  1FNW A;  1STG A;  4B3T L;  4R4Q A;  3VYR A;  5I2X A;  2GVA A;  2EXD A;  4ZLT F;  2RDH A;  4DK0 A;  1S5E D;  1B9M A;  1K8M A;  2B2V A;  2JK8 A;  3QIA A;  1LYL A;  3EIV A;  2UU9 L;  5T1I A;  4K5V A;  1Y14 B;  2WKD A;  3EFX D;  3KLW A;  2GA4 B;  5BR8 Q;  1E1O A;  1YIT A;  1JR0 D;  1KL9 A;  3S1Q H;  5C4X G;  1UE7 A;  4Y7N B;  4DK1 A;  3TZD A;  1B3Q A;  3PUX A;  5JVH 3;  1EWI A;  4FF3 A;  4BY1 H;  4PV1 C;  1HNW Q;  3K59 A;  2HDL A;  1L0X B;  4X3T A;  1WTX A;  3SR1 A;  2F0E A;  4A3B G;  5FKA C;  2FFK B;  5JEA H;  1KC8 C;  3D31 A;  1DJR D;  3W3A A;  5A2Q L;  3UDG A;  3CPF A;  4WFN 3;  4DR3 L;  2E2H H;  3RD4 A;  4LF9 Q;  5C4X B;  1I50 H;  4E6I A;  2QF7 A;  3S2H H;  2E2I B;  5K36 H;  1JQY D;  2F0D A;  5KND A;  3H0G B;  1EWC A;  1QB5 D;  1T5E A;  1SND A;  3RLN A;  3F2D A;  2JSO A;  1QZH A;  2NN6 I;  2M2L A;  2OQK A;  1YZ6 A;  2R3Z A;  4OL7 A;  3RR5 A;  3AU7 A;  4A3B B;  1BBW A;  4KKT A;  4DV0 Q;  3GTP B;  2YV5 A;  5JJI A;  1T9H A;  3ZJY C;  4LF7 L;  5EBD A;  1DM0 B;  4IUU A;  4OX9 L;  1ZYR D;  3T4A C;  5JJZ A;  4U67 3;  1PH5 A;  4B9W A;  2EY2 A;  4FXK C;  1WTR A;  4A3D G;  3A7L A;  3PUW A;  1BBU A;  1B70 B;  2MP1 A;  3RZD B;  3HOX G;  2LKV A;  1TWA B;  3LGJ A;  4BA1 I;  1HJP A;  4B3S Q;  1TWH H;  4M8A A;  2UXB Q;  3IAY A;  1I3Q H;  3CU7 A;  2F0M A;  3SXH A;  1IW7 C;  1C48 A;  2A6E C;  2UUC L;  4DR4 L;  2LSS A;  2K7V A;  1EYA A;  4GNX B;  4JI5 Q;  1VQF A;  1B8A A;  1RJT A;  3NWS A;  4PG3 A;  5FLM H;  2NVT H;  2MUY A;  1XTD A;  1LT4 D;  3KF6 B;  1SMY D;  2IX3 A;  1L1O B;  1CSP A;  4OHJ A;  3HOX B;  3J7A 5;  1U0L A;  3RZO H;  4HR7 B;  1RF2 D;  2VL6 A;  2AMC B;  1S5B D;  2JA7 B;  4C1N K;  3NTK A;  2F0P A;  2XWJ B;  1SYE A;  1STY A;  3MC0 B;  1VF5 C;  1VCI A;  5JJK A;  2KCN A;  1BOS A;  2E76 C;  2DNC A;  4C2M B;  5FJ8 H;  2EOT A;  4DNR B;  3K7U C;  1CI3 M;  2KCM A;  4K5W A;  5BN5 A;  1F2L A;  1S40 A;  3K81 C;  3TDQ A;  1GD7 A;  1M90 C;  2PPB C;  2MFI A;  3GDE A;  4HMJ A;  1DXM A;  3F8T A;  1J8I A;  5IGD A;  1PRT B;  2DY8 A;  1R9T B;  2EY5 A;  4UP7 A;  1CA5 A;  3K58 A;  5IP7 H;  1VQO A;  4GKJ L;  3PMF A;  3M9B A;  1C4Q A;  2QEJ C;  1ENC A;  1C9O A;  3TSS A;  2ES2 A;  1EY6 A;  2H4O A;  3NP8 A;  2K50 A;  4K0K Q;  4OO1 H;  2Y0S G;  3GTK H;  2K5Q A;  3HOU H;  3H09 A;  5IGG A;  5IWA L;  2E5L L;  4POF A;  1EQQ A;  1FVI A;  2EJF C;  2PQA B;  4DR2 Q;  4CDD C;  1O7L A;  3HP3 A;  2R92 H;  3DEO A;  5C44 G;  2AWO A;  2MHV A;  3NHH A;  4JPB W;  5C4J B;  5AFW A;  2JA5 H;  3GTG B;  4BBS H;  2MPM A;  3HOV G;  3RLF A;  2AKW B;  3BJU A;  3NK9 A;  4LFC L;  1LT6 D;  3EN2 A;  4NDX A;  2X6L A;  1WCM H;  1N32 Q;  1QG7 A;  3MAQ A;  2WAQ G;  2WAC A;  4HIM A;  1ILP A;  5C0X J;  3HOY B;  3TS2 A;  4YWK A;  4MTK A;  4K8J A;  2SEB D;  5ELB A;  3CME A;  4KHP L;  5LMN Q;  3KJO A;  5C44 B;  3NEN A;  2NVY H;  1CQF A;  3HOV B;  3RLO A;  1M8A A;  4R4I A;  2ICE C;  2L0C A;  4XDX A;  4XYQ A;  2K14 A;  1BXT A;  4DU9 A;  4LAA A;  1EU3 A;  2H5X A;  4JW0 A;  3PIP 3;  1X3F A;  3A0J A;  2WAQ B;  4YIJ A;  3Q24 A;  2K5N A;  4JV5 Q;  3OMC A;  1VQ7 A;  3PQI A;  3M7N A;  1X9N A;  1D1I A;  2R7Z H;  4TRD A;  2R93 G;  1JB3 A;  5I4D A;  1HQM C;  2ID0 A;  5HGQ A;  2HQL A;  1B44 D;  4KK7 A;  4DAV A;  3NEL A;  4KTA A;  3VA5 A;  1R4P B;  3T1H Q;  4F87 A;  4BWG B;  1JOO A;  1HR0 Q;  1D2B A;  4GOP A;  2L12 A;  3S14 B;  4BY1 G;  4A4I A;  4X65 Q;  1EFW A;  2BDO A;  4TKO B;  4P73 A;  3G71 A;  1PH9 A;  3SK4 A;  1DCZ A;  4CBV A;  1XMO L;  1Q12 A;  4XXE A;  5EPL A;  2CH4 A;  2F3W A;  1U9R A;  3I7F A;  4OGQ C;  3GTJ H;  4H13 C;  3OW2 A;  4H0L C;  3QJY A;  5JEA G;  3PSI A;  1TWC H;  5IOD A;  2B29 A;  2EVB A;  2EYH A;  1W6K A;  4N9T A;  1XPO A;  2EDG A;  3C1F A;  2R93 B;  4A3K H;  4QL5 A;  3K57 A;  3S1Q B;  5CYU A;  1GUS A;  1I6V C;  1VQJ A;  5K36 G;  1Y8N B;  4LFA L;  3DXJ C;  2PZW A;  3LX0 A;  3W1G A;  1XPU A;  1JIC A;  1F9R A;  1G6P A;  1H9R A;  2VZA A;  4HCE A;  4TVA B;  1GHJ A;  4FF4 A;  1QCB D;  3MEF A;  3L0O A;  2WFW A;  2HIV A;  4LJZ C;  2CH4 W;  2F4V L;  2IT1 A;  1IL8 A;  2JA6 H;  4A75 A;  5G3L F;  2ZM6 L;  1E0B A;  4A3C H;  1TWF H;  1XMQ L;  4BA2 I;  3TRE A;  1JJG A;  3PF4 A;  3I4M H;  1NBW A;  1PDQ A;  3HKZ B;  1QVG A;  1LTS D;  4HJ9 A;  1PRT F;  3S2H B;  1H95 A;  2HHH L;  4KLK A;  4DV4 Q;  2A68 D;  2KEC A;  3C1E A;  2EZV A;  3S1R H;  1SMX A;  1SDF A;  1MGS A;  5FO9 B;  1WD1 A;  4R9W A;  2L1B A;  1D5Z C;  4F88 A;  4DV2 Q;  1PLF A;  4CJ0 B;  4KN7 C;  2PI2 A;  2QW7 A;  5EKL A;  1Y8O B;  4DR1 L;  1HRJ A;  5AJ3 L;  2K05 A;  1U5K A;  5C0X H;  4AQY Q;  3VYS A;  3K80 C;  1PTO C;  4HAE A;  5FLM G;  3ERS X;  2HD3 A;  4RGO S;  3D3R A;  2HT1 A;  1SE8 A;  1IZ6 A;  4I7A A;  2ZTC A;  3WOF A;  2P5Z X;  4MTN A;  1A62 A;  1AH9 A;  5DM6 3;  1KDC A;  3H91 A;  5DLQ E;  4QUC A;  1N33 Q;  4IFD J;  1TWH B;  2HUG A;  5KYL A;  4XYO A;  2ZXO A;  2J4X A;  3JAM E;  2OXP A;  3EA6 A;  1SE4 A;  3I72 A;  1CKN B;  4DNI A;  1GUT A;  1HZA A;  4L5T A;  1C0A A;  4Y7N H;  4RGT A;  2F0W A;  3UDF A;  5CV5 A;  5C4H A;  4B3R Q;  4A3E G;  5M9O A;  5FJ8 G;  4L8J A;  4GKK Q;  4N8X 1;  4ZRZ A;  3MFG A;  3S1M B;  3MTS A;  4A3F H;  3FKI G;  5D3I B;  1SFO H;  3I70 A;  4HMI A;  1KXL A;  4UDU C;  3RZO B;  3SEB A;  4G7H C;  3J81 j;  1GO3 E;  4C3J B;  3HOW G;  2EYL A;  2QIL A;  4YY3 Q;  1A8V A;  4X66 Q;  4QQB X;  5BN3 A;  4GLV B;  5IP7 G;  3MFY A;  2E2I H;  1KAA A;  2JA9 A;  3NTI A;  1EZ8 A;  2KCT A;  4DXF A;  3H0G H;  3S17 B;  1CFM A;  3CMA A;  4A3E B;  5I9O A;  1EQT A;  4JI1 L;  3E6Z X;  3T1Y L;  3FKI B;  4H02 A;  5IP9 H;  4J6H A;  4A3B H;  4BY7 G;  1UWV A;  3HOU G;  2K5H A;  3GTP H;  2CQA A;  3C46 A;  1QIL A;  2Q2T A;  2IPK D;  4YWL A;  2B2U A;  4DAM A;  2R92 G;  3K8A A;  2KCC A;  3DM1 A;  3EQL C;  1XJV A;  2KBN A;  3HOW B;  2LS0 1;  3BZK A;  2VB3 X;  5A2Q E;  1TWA H;  1WCM G;  4QGU A;  1V1Q A;  2F0J A;  2F0V A;  4P72 A;  1FGB D;  4DNT B;  1B9N A;  2BA1 A;  4JI8 Q;  4HED A;  3VR2 A;  4LF5 Q;  4BY7 B;  3F2U A;  3HOU B;  3K0X A;  3KJP A;  3K0Y A;  2ZJR A;  3GTQ B;  3J7Y W;  4K14 A;  1WYD A;  1I4X A;  3I4L A;  2N3S A;  3LWE A;  2BE5 C;  2R92 B;  2N49 A;  1KAW A;  3J80 i;  1XNQ L;  1P16 A;  1SE2 A;  4DR5 L;  1N36 L;  4F8M A;  2A1A A;  3HOX H;  1WCM B;  1U4R A;  4CKE A;  1STN A;  2M00 A;  2PNR C;  1CKM A;  5GQO A;  5FLX c;  2JA7 H;  2JXM B;  1YEZ A;  4IN3 A;  2CWA A;  1O7Z A;  3Q0A A;  3UDI A;  1CSQ A;  2B2U C;  3DM3 A;  1IBK Q;  2DJF C;  4IFD H;  4K6L A;  3T53 B;  2FIN B;  4IOA A;  3PF5 A;  3OYY A;  1MHW C;  4G57 A;  3NWT A;  1JC7 A;  2J0T D;  4HJ5 A;  1WTW A;  2NVX B;  1IKM A;  5FO7 B;  4DUY Q;  2K32 A;  1S5F D;  1STB A;  4DV1 Q;  3U9O A;  1RTN A;  5CBA E;  1X3G A;  4A3M H;  4ZKB B;  4EQN A;  5LMN W;  1KNA A;  1YHB A;  3OTO Q;  1B2T A;  3P7J A;  4A3K G;  5IT9 c;  1OXV A;  1J5E Q;  3TP5 A;  3SK8 A;  1I94 Q;  2VQF Q;  1H9S A;  2EYJ A;  5C6A A;  4OWW B;  4YHH L;  4JI7 Q;  5CR3 A;  3DEP A;  1GHK A;  5IYC H;  1I5F A;  4IAL A;  4DAY B;  1EEF D;  4IZ8 A;  1YNN D;  3WDN A;  1PFN A;  4KMU C;  1MI2 A;  3D8G A;  3H6M A;  3GTJ B;  1JJ2 A;  5C4J H;  3N52 A;  5ELE A;  4GZY C;  4IUV A;  4A3C G;  3G48 A;  2O2L D;  1SSO A;  2A6H C;  3MHB A;  2OF1 A;  3HKZ E;  4QY7 A;  2L55 A;  1SNO A;  1I4Q A;  1TS5 A;  1HR0 W;  1VS0 A;  4FDB A;  5E4X A;  3M4O B;  4LF6 Q;  3HOY H;  3FVQ A;  4OIK A;  4GOP B;  2PQE A;  1ASY A;  1BVS A;  1MSG A;  1TII D;  2D5D A;  1YJW A;  4LFB L;  2OEO A;  3V96 A;  4DUZ L;  3NBI A;  3M7G A;  5E7N A;  2Z8L A;  2B2Y A;  2K5V A;  1SYC A;  1TS2 A;  2K5D A;  1OTC A;  3RUZ A;  2NN6 G;  4PQX A;  5C0X G;  3S1N B;  3HG9 A;  2LMC B;  2E75 C;  1G6Z A;  1BCP D;  2YTV A;  2I5H A;  1K3B C;  2F3V A;  4NB3 A;  3BZD B;  2B63 G;  4ZKC B;  1IBL L;  1Z47 A;  1LTA D;  3JAM L;  3J7Z C;  3Q8D A;  1SAP A;  2EQS A;  2C9O A;  1ENA A;  5E3F A;  4CKB A;  2BOS A;  2LFN A;  4KY5 A;  2RKS A;  1UNS A;  3QO2 A;  5KYI A;  4GLA C;  1STE A;  2DNE A;  3FPP A;  4UHV A;  5EKK A;  4Y52 H;  3STB C;  3K7A B;  1E24 A;  1UAP A;  5NUC A;  2EE1 A;  3H15 A;  1YNJ D;  1ZEQ X;  2KEE A;  4L6T B;  2CW0 D;  1RDP D;  2B63 B;  4A3F G;  3IKJ A;  4R4O A;  2X6G A;  3P75 A;  5T1G A;  1K3R A;  2F0T A;  4IUT A;  4NW2 A;  4CJ2 C;  1BDO A;  2R93 H;  1Z6H A;  4IPC A;  3VYU A;  3R93 A;  1B3A A;  3TS0 A;  2B2Y C;  1SR3 A;  3CCU A;  4DV3 L;  1Q8K A;  3H0G G;  3KK7 A;  4N9P A;  3NQI A;  3BU2 A;  3BVZ A;  3FDT A;  2SOB A;  1HCZ A;  5EBC A;  3K5M A;  4ALP A;  4A3F B;  1LAC A;  5M5Y H;  5IP9 G;  1SFO B;  3RN5 A;  4KKU A;  1Q90 A;  5ELN A;  1Z9F A;  3I73 A;  1U4P A;  4KI0 A;  1WOC A;  1UE5 A;  2O5J C;  2BDN A;  5EPK A;  1Q82 C;  1NE3 A;  4NXN L;  3OSO A;  1SNQ A;  1OXX K;  2VW9 A;  2Q2H A;  3A74 A;  2DJG C;  4EQ5 A;  1C7Y A;  1JWU D;  4IUQ A;  4A3L H;  3NBH A;  4HIK A;  3LWU A;  1VQL A;  3EVQ A;  3J81 c;  4B3M Q;  1EY5 A;  2AQ3 B;  2ATW A;  1L2F A;  1LTT D;  1N34 Q;  3RMH A;  5H1S E;  3MZ5 A;  4P75 A;  4AYB E;  4LF4 Q;  4JBJ A;  5M5W B;  1JOR A;  2A73 B;  1E2W A;  2F0G A;  4R4C A;  3PIP A;  2VQE L;  1X3Q A;  3HFZ B;  2NB0 A;  2YTX A;  1GJX A;  2I5M X;  3EBE A;  5D14 A;  3PUZ A;  4IJL A;  2AUK A;  4L63 B;  3M85 A;  1QJO A;  3CQZ H;  1CHP D;  1XNR L;  4HJ8 A;  2JA7 G;  3TP8 A;  1LAB A;  1YHQ A;  3AFP A;  1H9J A;  2UUA Q;  4X64 Q;  4JI2 L;  1E22 A;  1Y1W H;  4MZ9 A;  3IL8 A;  1I4R A;  1PH8 A;  1VDZ A;  3TN2 A;  3SGI A;  5KNB A;  1P8L A;  5C5L A;  4IFD G;  3S1M H;  3GQB A;  2A69 C;  4BBR H;  4DV2 L;  2RDG A;  1JOK A;  3ZYY X;  2VNU D;  1LM0 A;  1HUM A;  3UI2 A;  4IUP A;  3VR6 A;  1Q86 C;  1SNP A;  4C3J H;  4DR6 Q;  4A3M G;  1YI2 A;  1IW7 D;  3AQQ A;  1QZG A;  2A6E D;  2IWH A;  4ZYS A;  4I65 A;  1TQO A;  4LK1 C;  3S17 H;  2NUC A;  3DMU A;  2NZO A;  4R8N A;  4A3E H;  3CAM A;  1VQC A;  3F1Z A;  3I4N G;  5DM7 3;  2F0H A;  1RHP A;  3FKI H;  3TP6 A;  2Q2I A;  2B8G A;  1HPC A;  5IYC G;  2JJQ A;  2NZ1 D;  1O7Y A;  1A6X A;  2MO0 A;  2KOL A;  2Q8I B;  1AE2 A;  1Q81 C;  2A8V A;  1EYC A;  1F9Q A;  3VDY A;  3HOW H;  2NBF A;  3DWA A;  4A3M B;  1WD0 A;  5CV7 A;  5CBE E;  2FJ2 A;  1EQR A;  1TWG B;  3E9H A;  1PZJ D;  1BCP B;  1CM9 A;  5EGT A;  5I2Y A;  4V19 0;  3E0J A;  1KNE A;  1EU4 A;  2ALY B;  1GUN A;  2G9H D;  4DK3 C;  5JPN C;  3A5U A;  3HOY G;  3I4N B;  4FVM A;  1HFG A;  2UUB L;  3QG1 A;  2RVL A;  3MXN A;  4BY7 H;  3U9S A;  2I46 A;  3GTQ H;  1MJE A;  2CQO A;  1SLJ A;  4X3U A;  5C3E H;  2HDM A;  1IYJ B;  1WI5 A;  4ZAI A;  1CTM A;  3I90 A;  4DV5 L;  1A2T A;  5CC4 A;  4G4K A;  3I2Z A;  3GTM B;  2HCI A;  1H9S B;  3BYT B;  2HIX A;  5COR A;  1HNX Q;  3S2D H;  2K5W A;  2EYF A;  2KA7 A;  4RFB A;  4IUR A;  4YCV A;  4LWC A;  1WTV A;  4DV7 L;  1I4G A;  1HNZ Q;  1HH2 P;  4FXD A;  3PCO B;  2K01 A;  5EAY A;  4L5R C;  1BR9 A;  3F2C A;  1MSH A;  4KY6 A;  3RNU A;  4NXM Q;  3B6Y A;  4JI6 Q;  2Z0S A;  1CT1 D;  1IHZ A;  4PMC A;  1HZB A;  4RKL A;  4B3T Q;  4KHZ A;  3DWP A;  2NVX H;  1K83 H;  3LNN A;  4HTH A;  2LY7 A;  4QCL A;  1MBY A;  2XTI A;  2UU9 Q;  4K5X A;  4LNQ A;  1V1P A;  2B2T A;  1CZG A;  2K52 A;  2L11 A;  4ODG A;  2PI2 E;  1F2Y A;  4A3J B;  4H44 C;  4JI0 L;  1OXS C;  4L5S A;  3R8B A;  2OCE A;  1BQQ T;  2IW3 A;  1A3U A;  5LMU L;  1IBM L;  2B3G A;  3H3V I;  1WTP A;  1L0Y B;  4RCO A;  4RHS A;  4PZ6 A;  2IHE A;  2HCC A;  2RQX A;  4O42 A;  4DV6 L;  3DUZ A;  1KQS A;  2NZH A;  1X54 A;  2C35 B;  1ET9 A;  3TRZ A;  3GV3 A;  4U68 A;  4DR3 Q;  3HKZ G;  2OTL A;  4CDC C;  1I6H B;  1RD9 D;  3M4O H;  1PH1 A;  4OEM B;  1ONL A;  4UAI A;  4LUO A;  1NAP A;  1ESR A;  4HSV A;  4A3L G;  2UXD L;  2WKC A;  4BS9 A;  3Q22 A;  2L9H A;  1O78 A;  4ZQ3 A;  1CUK A;  1IXR A;  4NP5 A;  5IYB G;  5M5Y B;  1S4Z A;  2K03 A;  2VXW A;  1SNM A;  1SRU A;  1A15 A;  3HKS A;  4JI4 L;  2CWP A;  3CCV A;  3GTL B;  1CKO A;  2TSS A;  5FK9 C;  2B2T C;  1MD2 D;  2YU9 H;  3S1N H;  4FF2 A;  4TSS A;  3K5L A;  4LF7 Q;  1JT8 A;  1PTO H;  4OX9 Q;  3MXU A;  1FJG L;  1EY9 A;  3CCQ A;  2QDB A;  1II3 A;  3BDC A;  3W2D A;  3L9A X;  3PUY A;  1PZI D;  1BCP F;  4O1N A;  4DR7 L;  1YVC A;  1K8A C;  4OWT B;  4RA8 A;  3T16 A;  3BDO A;  1Y1W G;  2UUC Q;  1PYS B;  4DR4 Q;  3K7A H;  1T5X D;  2NN6 H;  2MO1 A;  2E8G A;  3OPO A;  1AN8 A;  1F2Z A;  1QUQ A;  2GN5 A;  2X69 A;  1B4O A;  2EY6 A;  1SRO A;  1Q1E A;  1U4L A;  4O2D A;  2B63 H;  3KBG A;  5EQ0 A;  2I0Q A;  5E4W C;  5GAE C;  3NPP A;  4BBR G;  3TBI B;  3NTH A;  1W6J A;  2Q2U A;  2UXC L;  1PH4 A;  3CQZ B;  3T13 A;  4C3J G;  2F0F A;  1Y1W B;  3S9W A;  1W2B A;  3NXW A;  4X62 L;  4CKC A;  1OXT A;  5TSS A;  3KLS A;  1CK1 A;  1VQH A;  1PTO D;  4XQQ A;  4LF8 L;  1X65 A;  1KDB A;  1AW7 A;  3AB9 A;  1VQD A;  3CC2 A;  3R2T A;  1BF4 A;  2FMC A;  3D4W A;  3HEJ A;  4KKS A;  4BBR B;  4DA2 A;  3U58 A;  2KHI A;  4JI3 L;  4JK1 C;  2A74 C;  5D3D A;  2YTY A;  4KD4 A;  1GOZ A;  4JYA L;  4YCW A;  5IGF A;  1TT2 A;  1D5X C;  2XSC A;  4GN4 B;  1Z7T A;  2Z4I A;  2G5D A;  1KRS A;  4GKJ Q;  1A63 A;  4NMZ A;  4RHR A;  5M3M G;  4HJ7 A;  2Z9H A;  1PVO A;  2DUD A;  2KQ3 A;  4DFA A;  3T56 B;  1KIX A;  1QVF A;  1VMC A;  5JVG 3;  2E2J H;  1SYB A;  3V05 A;  1IYV A;  5BR8 L;  3JAM i;  4UY8 C;  1XXG A;  4AYB G;  5M5W H;  5IWA Q;  2E5L Q;  1R4Q B;  4APV A;  3CCM A;  1NUC A;  5C3E G;  1NR2 A;  1LT3 D;  4JG2 A;  1HNW L;  2WV6 D;  2F0O A;  4QIW B;  3ULL A;  1YNX A;  4LFC Q;  2MGS A;  1G29 1;  1XWE A;  1LTR D;  5M3M B;  3HZX A;  4R4T A;  3SVM A;  1F2M A;  4XQJ A;  1V43 A;  1HTL D;  1V8Q A;  1SXT A;  1KRT A;  1PZK D;  1EWH A;  2R7F A;  1PA6 A;  4AYB B;  4LF9 L;  2F3I A;  4R8I A;  1GM5 A;  4KHP Q;  4QUF A;  3PUV A;  5A35 A;  5C3E B;  1HQR D;  2D0O A;  4Q5V A;  2DGY A;  3KLR A;  3CF5 A;  2QCP X;  2XGT A;  3UDX A;  2QEX A;  1F9S A;  1VQ4 A;  1FNU A;  1RL2 A;  4DV0 L;  5FOB B;  4H7B A;  2O4X A;  4MNO A;  3SE0 A;  3OW7 A;  3S2D B;  1VQB A;  5EJW A;  4PZ7 A;  1UUP A;  2JN4 A;  1PH6 A;  2NYZ D;  2JP1 A;  4FXG C;  1VQA A;  2IHF A;  2BE5 D;  3A8K E;  2UXB L;  4S3S A;  4B3S L;  4RG1 A;  3L7Z C;  5C3W A;  3M4P A;  2VS1 A;  2F0U A;  1XMO Q;  1AFP A;  1K83 B;  1WTH A;  3JC6 6;  1LTI D;  3PIO 3;  1SN8 A;  4JI5 L;  3TZU A;  1G8Z D;  4KJO A;  3HGB A;  1K28 A;  4GNX C;  1MJC A;  1TR5 A;  1STA A;  5J1Z A;  1TWG H;  1F77 A;  5EPJ A;  2EJM A;  2VY3 A;  4RMF A;  3V2T A;  1NY4 A;  4TQU S;  1BBX C;  1L1O C;  4CJ1 B;  4KV6 A;  4JC0 A;  3I4N H;  4LFA Q;  4HJA A;  4P71 A;  2E2D C;  2F0K A;  1PFM A;  2PQA A;  1YBY A;  2PO4 A;  5KEE A;  4C3I H;  1DOM A;  2K4K A;  2F4V Q;  1RTO A;  4OXP A;  3WOE A;  1JE4 A;  2ZTD A;  1FYC A;  4A3G B;  4OO1 I;  5COY A;  4NPS A;  4DXG A;  5KGU A;  2ZM6 Q;  1Q8I A;  2ZTE A;  1XMQ Q;  2A5H A;  4PMW A;  4A93 G;  2IL8 A;  2QDL A;  3TQY A;  3CC7 A;  4EX5 A;  1STH A;  1UE1 A;  3GO5 A;  2MJ8 A;  3J80 c;  3GTM H;  2HHH Q;  1PH7 A;  2EPB A;  3QOL A;  1PRT C;  2F4I A;  4RAU C;  3OOC A;  2D2C C;  4WRD A;  5J22 A;  3H3V C;  5FLX L;  3P1H A;  5M5X B;  5CMD A;  4DR1 Q;  1EOT A;  3OWF A;  3NEM A;  5AJ3 Q;  2YU9 B;  2EY1 A;  4FYD A;  2JA8 G;  4HCS A;  2PZU A;  3S15 B;  1PTO B;  4K0K L;  2A6H D;  4A93 B;  3D4D A;  3PO2 B;  3HRZ C;  5BN4 A;  1KHI A;  1SEB D;  1E3P A;  1HTP A;  4X6A H;  5IGE A;  2F1M A;  3BZC A;  4DR2 L;  3R3O A;  2XWB B;  4DKA C;  1G91 A;  1ZXT A;  4X3K A;  3S24 A;  4XT3 B;  1VQG A;  3TP7 A;  3ND9 A;  4IJH A;  4A3J H;  3DHQ A;  5JJL A;  1PXU A;  3A55 A;  3ULJ A;  4A3I H;  1N32 L;  1K8G A;  1HZC A;  1I4H A;  2F0N A;  2F52 A;  3G4S A;  2ZJQ A;  2JA8 B;  1ILQ A;  5IT9 L;  4RGN A;  4XT1 B;  4AIM A;  2O5I C;  4WJ3 M;  1A3T A;  4P74 A;  1H9M A;  1QNK A;  3OIQ A;  4XQN A;  5LMN L;  3IRB A;  3AYH B;  3NSW A;  2WP8 J;  2AQ2 B;  1L0W A;  5IY0 A;  2XRQ D;  1NTG A;  3FEW X;  1I6H H;  1BUV T;  3STB D;  1QWY A;  3FP9 A;  1EL0 A;  1QUQ B;  1X55 A;  2GVB A;  3L3O C;  4JBW A;  3W5O A;  1E2Z A;  4V0B A;  4JV5 L;  2RCN A;  3U50 C;  1EOV A;  1H9K A;  1KDA A;  2NTS A;  4JI1 Q;  3T1Y Q;  1EQV A;  4X3S A;  1VQ8 A;  3VR4 A;  3J80 L;  1KD1 C;  3KF8 A;  3G6E A;  4FF1 A;  3GTL H;  3DWQ A;  4OEL B;  3T1H L;  2CVR A;  3G6J B;  4JOI A;  1HXY D;  2KUM A;  1HR0 L;  1EFI D;  2KJX A;  5GRO A;  4X65 L;  4C3H G;  4QIW E;  1FGU A;  1X3P A;  1A3V A;  4IUN A;  1E7Z A;  2K1B A;  1TU2 B;  3TME A;  1D5M C;  3GTO H;  2JYO A;  5J3B A;  3MVV A;  1S5D D;  3M3Y B;  1QVC A;  1J6Q A;  3K5O A;  5DAU A;  2B2W A;  1FR3 A;  1X56 A;  3BS1 A;  5IYB H;  2KHJ A;  2E2J B;  1EY4 A;  4LMQ D;  1ZYR C;  4IOC A;  3A8J E;  2NVQ B;  4Q0F A;  1KLG D;  4FNF A;  5M3F H;  5LL6 S;  4OIJ A;  5E1F A;  4C3H B;  1XNQ Q;  2EYM A;  4DR5 Q;  4CGY B;  1N36 Q;  1I4P A;  2FXQ A;  1D8L A;  4C1N I;  3BVG A;  5C0X I;  1LTG D;  1VQK A;  2B2V C;  1AZQ A;  3E9I A;  1TY0 A;  5F2D A;  5GAG C;  1CKN A;  3MXG A;  4RH6 A;  4BXX H;  2VUM G;  3E3X A;  5KNC A;  4O0A A;  5CV8 A;  1AE3 A;  1YHA A;  2K33 A;  3KFU A;  2XVS A;  3J7A F;  3QB3 A;  1SYD A;  1SMY C;  4JOI C;  1M4V A;  4HSP A;  3SHL A;  4DV4 L;  4P2C B;  1XPR A;  3HOZ G;  1V1O A;  2I5L X;  3BYY B;  1GUW A;  2D9U A;  1KLU D;  3I91 A;  5ISR A;  2F0Q A;  4YWM A;  1S5C D;  2N55 A;  1GUG A;  3AMU A;  1PTO F;  2B2W C;  2ASB A;  4K8I A;  2VUM B;  4MHE A;  1JWM D;  3UE1 A;  4AQY L;  2Q8T A;  1CZW A;  4IQZ A;  3W1B A;  4A3D B;  4KHV A;  1B53 A;  3VR5 A;  3IFT A;  3HOZ B;  4ABN A;  1N33 L;  1WFQ A;  2CFM A;  2H1E A;  2Z6K A;  2A69 D;  1TY2 A;  4YHH Q;  2JEA I;  1JB7 A;  1EIY B;  3CCL A;  5IYD H;  4ILW A;  2QKI C;  4C3I G;  4LUV A;  1UEA B;  1DON A;  2SDF A;  3J81 L;  3KDF A;  1PH3 A;  4I7Z C;  1Q1B A;  3CCE A;  1EUJ A;  1TS3 A;  3GV6 A;  3PO3 G;  1TVX A;  4B3R L;  4GKK L;  1SBB B;  1E2V A;  2I07 B;  2RCF A;  1K0R A;  1TS4 A;  2XN9 C;  2R6G A;  5M3M H;  3CHB D;  3NUC A;  1DD2 A;  2M9V A;  2BH8 A;  2ZXP A;  4G7O C;  2DY7 A;  2G9D A;  3DLL A;  4CDF C;  4KN4 C;  1EYD A;  1ESF A;  1V9P A;  4X66 L;  4YY3 L;  4C3I B;  4ULL A;  4LFB Q;  1WJJ A;  4DUZ Q;  4QF4 A;  3BDL A;  1KTK A;  4ID6 A;  4KD3 A;  4FP5 D;  3CCS A;  1HA6 A;  2RA4 A;  4QB4 A;  3PO3 B;  2RF4 A;  3VYT A;  2SNM A;  3CCJ A;  3CRK C;  3E0E A;  1AEX A;  5IE8 A;  1F9P A;  1PFS A;  1BO0 A;  2FHT A;  4UP8 A;  5FO8 B;  3R2I A;  1IBL Q;  4A76 A;  4MN3 A;  3BG3 A;  1LTL A;  3MEH A;  1WTQ A;  1VQ5 A;  2Z6K C;  4WJW A;  2HQE A;  3ND8 A;  2NTT A;  3D6C A;  1FL0 A;  4A3J G;  1GXD C;  2EYP A;  1JWS D;  1B50 A;  5GAD C;  1LTB D;  1D1K A;  3ITP A;  1EY7 A;  1BNZ A;  2KHS A;  4A3I G;  2EIF A;  2OTJ A;  3S16 H;  4OWX B;  4DN4 M;  1DYQ A;  3E5S A;  1IL2 A;  1XTC D;  2IX1 A;  3G7L A;  4PNY A;  3KBX A;  2L5T A;  4JI8 L;  5CV9 A;  2WB1 E;  4LF5 L;  2Y0S B;  3M4Q A;  4IFD I;  4XTC S;  2AHO B;  1B1Z A;  3IFD A;  5LL6 X;  3I3C A;  3FRP B;  5EKI A;  1Q7Y C;  2PW5 A;  2V4D A;  3BVM A;  3ICE A;  2ZT9 C;  4JBM A;  2DN8 A;  1UE6 A;  2EJG C;  5J39 A;  3ERQ A;  3CXC A;  2XRS D;  4DAY A;  5LHY 1;  3KOJ A;  4DV3 Q;  4A3I B;  1D6E C;  4RCN A;  5ELD A;  3D6W A;  2PMZ B;  2CKZ B;  1K8O A;  3U4V A;  5CGK A;  1NMG A;  1JCK B;  5I6Y A;  1GUO A;  5KRU A;  1XX8 A;  4A3G H;  4UP9 A;  3RN2 A;  1AP0 A;  1IBK L;  3F2B A;  3I8Z A;  1WTO A;  3AEV A;  3KLS X;  4PZ8 A;  4NXN Q;  2JQO A;  1LUZ A;  1A2U A;  3X3N A;  3A54 A;  1VQ9 A;  1SJH D;  4MIU A;  4DUY L;  1EIF A;  3ERO A;  1U4M A;  4DV1 L;  1SYG A;  3MWY W;  5ELF A;  1Y8P B;  5HGT A;  3HS0 C;  1Y1V H;  2OT2 A;  3UE0 A;  4EQP A;  3OIP A;  2N78 A;  3I4O A;  3OTO L;  4IPH A;  1DGS A;  2OQ0 A;  2TMP A;  1IYU A;  1J5E L;  4ZUJ A;  5M5X H;  2B39 A;  3VR3 A;  2KVM A;  4LW1 A;  3URY A;  4C56 C;  1I94 L;  1RKN A;  2ZXR A;  2VQF L;  5M3F G;  3S15 H;  4A93 H;  1DOL A;  2VQE Q;  4JI7 L;  2A68 C;  1HHV A;  3PO2 H;  4BY1 B;  1HA5 A;  1VQI A;  2CCZ A;  1X32 A;  3GTO B;  2RHS B;  2F0L A;  1MIU A;  2AQ1 B;  4RGM A;  3CD6 A;  4BXX G;  2RHQ B;  3EJI A;  1VQP A;  1XNR Q;  1PYW D;  3KUP A;  1K9M C;  3KF8 B;  4JI2 Q;  2JEB I;  4FO2 A;  4DF7 A;  4KY7 A;  1NCV A;  4GN5 A;  1EIG A;  2E2H B;  4QMG A;  3MA2 B;  1I50 B;  4LF6 L;  1ENF A;  3A8I E;  4JCV E;  3Q23 A;  2JA8 H;  5M3F B;  1ICF B;  4GOP C;  4YCU A;  5FLX E;  4AH6 A;  3PIO A;  1X6O A;  1EY0 A;  3NBH B;  1YJ9 A;  3QWN A;  3CRL C;  2KED A;  4F7X A;  3M4Y A;  2R61 A;  4DGZ A;  3H94 A;  2L15 A;  4DPG A;  1PMR A;  4WJ4 A;  2MQH A;  2RDF A;  4ZCK A;  2VB2 X;  2JE6 I;  2PNH A;  3MXP A;  2K6A A;  2AUJ D;  4HIO A;  3FPU B;  2FMM A;  2IX0 A;  2PYK A;  5IIF A;  2QGQ A;  1D7Q A;  1CQV A;  1EZ6 A;  4QJF A;  4EGV A;  5I9P A;  1TXY A;  3CW2 C;  1BKB A;  4L5Q A;  3PGZ A;  1G2T A;  1RIP A;  1I3Q B;  5C5M A;  3QOJ A;  5IYD G;  3D0F A;  3OMG A;  5IT9 E;  1GVP A;  2IY5 B;  1O7I A;  1Q46 A;  4GS3 A;  1QNU A;  2K04 A;  5C3X A;  4GN3 B;  1CA6 A;  2F03 A;  1ASZ A;  2NVT B;  1J9O A;  1DZ1 A;  1ET6 A;  2J7Z A;  5JAV A;  3M3Y H;  1CHQ D;  1HFN A;  3CPW A;  1G51 A;  3OHX C;  2K75 A;  1UEB A;  2UUB Q;  4J15 A;  3AFQ A;  2PW7 A;  5JOB A;  2QA4 A;  2NVQ H;  3KYH C;  1ML0 D;  5C4X H;  1KAB A;  3I55 A;  1NNX A;  3J80 E;  4C3H H; 
#chains in the Genus database with same CATH homology
 1VQN A;  1E1T A;  1P8L A;  1HR0 Q;  4GOP A;  4IFD G;  3S1M H;  4K0K L;  4BY1 G;  4A4I A;  4X65 Q;  1EFW A;  4P73 A;  2ZJP A;  3G71 A;  1KHI A;  1JE5 A;  1E3P A;  2AWN A;  3GD7 A;  1XMO L;  1PH9 A;  4X6A H;  4BBR H;  4DV5 Q;  4DV2 L;  4OO1 G;  1Q12 A;  5HY6 A;  3U4Z A;  3BZC A;  3I7F A;  4DR2 L;  3GTJ H;  4DKA C;  3OW2 A;  2VNU D;  1LM0 A;  5JEA G;  4GNX A;  3PSI A;  2LXK A;  1TWC H;  3S24 A;  1Q86 C;  2B29 A;  2BH2 A;  4C3J H;  1YJN A;  4DR6 Q;  1VQG A;  4A3M G;  1YI2 A;  3ER0 A;  3AQQ A;  4IJH A;  1XPO A;  4A3J H;  1QZG A;  2JA5 G;  4BBS G;  5JJL A;  4A3K H;  4DV7 Q;  4QL5 A;  3KDF B;  4DK6 C;  3KF6 A;  3CCR A;  1EYG A;  1W3S A;  3S17 H;  3ULJ A;  1VQJ A;  1L1O A;  3RZD H;  2NZO A;  2LXJ A;  4A3I H;  1S72 A;  1HZC A;  2F52 A;  3G4S A;  4A3E H;  1K8G A;  3CAM A;  2ZJQ A;  4LFA L;  4POG A;  1VQC A;  4B3M L;  1S3O A;  3F1Z A;  3W1G A;  1XPU A;  3I4N G;  1VQE A;  3FKI H;  4AIM A;  2Q2I A;  1G6P A;  4WJ3 M;  2VZA A;  4P74 A;  4TVA B;  1N34 L;  5IYC G;  2JJQ A;  2Y0S E;  3MEF A;  3L0O A;  2WFW A;  2HIV A;  2F4V L;  4LF4 L;  3TEH B;  2IT1 A;  2MO0 A;  5LMN L;  2VUM H;  2JA6 H;  3IRB A;  1OXU A;  1A0I A;  1AE2 A;  4A75 A;  1Q81 C;  3A5Z B;  3AYH B;  2A8V A;  3MXN B;  4ME3 A;  3VDY A;  2ZM6 L;  3HOW H;  4A3C H;  1TWF H;  2WP8 J;  1L0W A;  1HZ9 A;  5IY0 A;  1XMQ L;  4BA2 I;  1EQR A;  3E9H A;  1NTG A;  3TRE A;  4A3D H;  1PH2 A;  1I6H H;  1JJG A;  3PF4 A;  3I4M H;  1NBW A;  3STB D;  1QVG A;  4JI0 Q;  4HJ9 A;  3HOZ H;  1H95 A;  3FP9 A;  2ALY B;  2HHH L;  1QUQ B;  1X55 A;  2GVB A;  4KLK A;  5LMU Q;  4DK3 C;  2WAQ E;  4JBW A;  3A5U A;  3W5O A;  4DV4 Q;  1IBM Q;  3HOY G;  2D62 A;  2BA0 A;  2VW9 A;  2RCN A;  4JV5 L;  3M7N A;  2PMZ E;  3U50 C;  2UUB L;  1EOV A;  3S1R H;  2UUA L;  4JI1 Q;  1SMX A;  4X64 L;  3T1Y Q;  4BY7 H;  1VQ8 A;  1N9W A;  2KEN A;  3GTQ H;  1YIJ A;  4DV2 Q;  1N8R C;  1KD1 C;  3G6E A;  1MJE A;  3GTL H;  2R7Z G;  5ELO A;  2PI2 A;  2CQO A;  4DV6 Q;  3T1H L;  1SLJ A;  4DR1 L;  5AJ3 L;  4A3G G;  5C3E H;  4JOI A;  4C2M H;  1U5K A;  4AQY Q;  1HR0 L;  3JAM c;  5GRO A;  4X65 L;  3K80 C;  1IYJ B;  4QIW E;  5FLM G;  1FGU A;  1WI5 A;  3ERS X;  4LUZ A;  4IPG A;  2HT1 A;  1E7Z A;  1SE8 A;  1IZ6 A;  2ZTC A;  4DV5 L;  4MTN A;  3GTO H;  5J3B A;  1A62 A;  1AH9 A;  3I2Z A;  1K73 C;  1JJC B;  3S2D H;  2UXD Q;  5DLQ E;  2HIX A;  1HNX Q;  1N33 Q;  1QVC A;  1J6Q A;  4IFD J;  1X56 A;  4DR6 L;  3WWV A;  1R9T H;  5IYB H;  4YCV A;  2KHJ A;  4LWC A;  1Y1V G;  1GKH A;  2MNA A;  1JMC A;  4DV7 L;  3H3V H;  1CKN B;  1HNZ Q;  4IOC A;  1HH2 P;  1X3E A;  4DNI A;  4L5T A;  1HZA A;  2R7D A;  1C0A A;  4Y7N H;  3PCO B;  4JI4 Q;  5EAY A;  4L5R C;  3PO3 H;  3F2C A;  3UDF A;  5JEA J;  3RNU A;  4NXM Q;  5M3F H;  3B6Y A;  2OWO A;  4JI6 Q;  4B3R Q;  4A3E G;  5FJ8 G;  4GKK Q;  1XNQ Q;  2Z0S A;  1PYB A;  4DR5 Q;  2YYZ A;  1N36 Q;  3PV0 A;  1PV4 A;  2FXQ A;  3PO2 G;  4A3F H;  1D8L A;  1HZB A;  3FKI G;  4B3T Q;  2A19 A;  4KHZ A;  1SFO H;  5C0X I;  1K83 H;  2NVX H;  1FJG Q;  1VQK A;  3E9I A;  1KXL A;  5GAG C;  1CKN A;  4BXX H;  2VUM G;  2XTI A;  4DR7 Q;  2JA6 G;  2UU9 Q;  4JBK A;  3J81 j;  3GTG H;  1GO3 E;  4IPD A;  4O0A A;  4LNQ A;  2K52 A;  3CP0 A;  1NJI C;  1AE3 A;  3HOW G;  4X66 Q;  1YHA A;  4YY3 Q;  1A8V A;  2PI2 E;  3KFU A;  4QQB X;  3L2P A;  4GLV B;  5IP7 G;  2E2I H;  4JI0 L;  1M1K C;  2V1C C;  2JA9 A;  1OXS C;  4JOI C;  3FHW A;  2OCE A;  4L5S A;  2KCT A;  3H0G H;  3I4M G;  5LMU L;  1B7Y B;  5GAH C;  4DV4 L;  1XPR A;  1IBM L;  3HOZ G;  2B3G A;  3CMA A;  3H3V I;  3I56 A;  2I5L X;  4JI1 L;  3T1Y L;  4PZ6 A;  4H02 A;  2IHE A;  2WB1 G;  4YWM A;  5IP9 H;  4A3B H;  4BY7 G;  1UWV A;  1PHJ A;  3HOU G;  5K36 G;  2K5H A;  3GTP H;  4DV6 L;  2Q2T A;  3ULP A;  2ASB A;  5C44 H;  4YWL A;  3UE1 A;  2UXC Q;  4DAM A;  1KQS A;  3K8A A;  1MKH A;  2NZH A;  2R92 G;  4AQY L;  1X54 A;  2C35 B;  3HOV H;  1XJV A;  2KBN A;  2D0P A;  4GLX A;  4R1J A;  4XIG S;  3J81 i;  3CC4 A;  3TRZ A;  1NMF A;  1VQ6 A;  4DR3 Q;  3HKZ G;  2OTL A;  3W1B A;  3BZK A;  3M4O H;  1PH1 A;  4X62 Q;  4HID A;  4LUO A;  1TWA H;  1WCM G;  4A3L G;  2UXD L;  4OON A;  4QGU A;  1V1Q A;  1HNX L;  4P72 A;  1N33 L;  4LF8 Q;  1WFQ A;  2CFM A;  2Z6K A;  1CUK A;  4YHH Q;  2JEA I;  1VQM A;  2BA1 A;  4JI8 Q;  1JB7 A;  1EIY B;  1IXR A;  3CCL A;  5IYD H;  5IYB G;  1HNZ L;  4LF5 Q;  4LUV A;  3K0X A;  4UPA A;  3KJP A;  1SRU A;  2ZJR A;  4JI4 L;  3HKS A;  2N8N A;  2CWP A;  3KDF A;  3CCV A;  4JI3 Q;  1PH3 A;  1WYD A;  1Q1B A;  1CKO A;  3CCE A;  2N3S A;  4JYA Q;  4NXM L;  1EUJ A;  2N49 A;  1KAW A;  2YU9 H;  3S1N H;  3PO3 G;  4JI6 L;  4LF7 Q;  4B3R L;  1JT8 A;  3J80 i;  4GKK L;  1XNQ L;  1P16 A;  3S14 H;  4DR5 L;  1N36 L;  4OX9 Q;  4IO9 A;  1K0R A;  2A1A A;  4B3T L;  2R6G A;  4R4Q A;  5M3M H;  1FJG L;  3CCQ A;  3HOX H;  2GVA A;  2EXD A;  2BH8 A;  2JK8 A;  3PUY A;  1CKM A;  1LYL A;  5GQO A;  1YVC A;  3EIV A;  5FLX c;  2UU9 L;  2JA7 H;  3DLL A;  1K8A C;  4DR7 L;  1YEZ A;  4OWT B;  1V9P A;  2CWA A;  1Y14 B;  4X66 L;  4YY3 L;  3KLW A;  3UDI A;  4LFB Q;  1WJJ A;  5BR8 Q;  4DUZ Q;  1Y1W G;  2UUC Q;  1E1O A;  1CSQ A;  1PYS B;  1KL9 A;  1YIT A;  3S1Q H;  4DR4 Q;  3DM3 A;  5C4X G;  1UE7 A;  3K7A H;  2MO1 A;  3CCS A;  2E8G A;  3PUX A;  2RF4 A;  1IBK Q;  2GN5 A;  1QUQ A;  1EWI A;  3CCJ A;  4BY1 H;  3E0E A;  1SRO A;  1Q1E A;  4O2D A;  3PF5 A;  2B63 H;  4IOA A;  1HNW Q;  3OYY A;  5IE8 A;  1PFS A;  4UP8 A;  2I0Q A;  5GAE C;  1IBL Q;  4BBR G;  4A76 A;  4HJ5 A;  1LTL A;  4A3B G;  4DUY Q;  1VQ5 A;  2Q2U A;  2UXC L;  2Z6K C;  1PH4 A;  4DV1 Q;  1X3G A;  4A3M H;  1KC8 C;  3D31 A;  5LMN W;  1YHB A;  1FL0 A;  3UDG A;  3CPF A;  3OTO Q;  4DR3 L;  4A3J G;  2E2H H;  4A3K G;  1W2B A;  4LF9 Q;  5IT9 c;  1I50 H;  1OXV A;  1J5E Q;  5GAD C;  4X62 L;  3S2H H;  1OXT A;  4A3I G;  2EIF A;  1VQH A;  2OTJ A;  3S16 H;  4OWX B;  1I94 Q;  4LF8 L;  2VQF Q;  1IL2 A;  1X65 A;  3RLN A;  2IX1 A;  4OWW B;  4YHH L;  1VQD A;  4JI7 Q;  3F2D A;  3CC2 A;  1QZH A;  2NN6 I;  1I5F A;  2OQK A;  1YZ6 A;  4JI8 L;  4DAY B;  2WB1 E;  5IYC H;  4LF5 L;  3RR5 A;  3M4Q A;  3U58 A;  4IFD I;  4XTC S;  2KHI A;  4JI3 L;  2YTY A;  1BBW A;  4DV0 Q;  2AHO B;  1JJ2 A;  5C4J H;  4JYA L;  2YV5 A;  5JJI A;  1T9H A;  3ZJY C;  4YCW A;  4LF7 L;  1Q7Y C;  4A3C G;  4GN4 B;  3G48 A;  4OX9 L;  3ICE A;  4JBM A;  1PH5 A;  1KRS A;  4GKJ Q;  4A3D G;  3HKZ E;  1UE6 A;  4QY7 A;  1A63 A;  3PUW A;  1BBU A;  1B70 B;  3CXC A;  1HR0 W;  1VS0 A;  4FDB A;  5M3M G;  3KOJ A;  4DV3 Q;  3HOX G;  4HJ7 A;  4LF6 Q;  3HOY H;  4GOP B;  1PVO A;  2UXB Q;  3LGJ A;  2DUD A;  1HJP A;  4BA1 I;  1TWH H;  1ASY A;  4B3S Q;  1BVS A;  1I3Q H;  1KIX A;  1QVF A;  2CKZ B;  2E2J H;  1YJW A;  4LFB L;  3U4V A;  4DUZ L;  5BR8 L;  3JAM i;  1NMG A;  4UY8 C;  2UUC L;  5E7N A;  4AYB G;  4DR4 L;  5M5W H;  2LSS A;  5IWA Q;  2E5L Q;  2K5V A;  4GNX B;  4APV A;  4UP9 A;  3CCM A;  1VQF A;  3RN2 A;  4JI5 Q;  1B8A A;  4A3G H;  1IBK L;  3F2B A;  1OTC A;  4PG3 A;  2NN6 G;  5C3E G;  5C0X G;  3AEV A;  4JG2 A;  4PZ8 A;  5FLM H;  1HNW L;  4NXN Q;  2NVT H;  1XTD A;  2YTV A;  3KF6 B;  3ULL A;  2I5H A;  1YNX A;  4NB3 A;  2JQO A;  1LUZ A;  4LFC Q;  2B63 G;  1L1O B;  1CSP A;  1G29 1;  1IBL L;  1VQ9 A;  4R4T A;  1Z47 A;  4DUY L;  1EIF A;  1U0L A;  3J7Z C;  3J7A 5;  3RZO H;  3Q8D A;  1V43 A;  4DV1 L;  2VL6 A;  2AMC B;  2EQS A;  1Y1V H;  3UE0 A;  1KRT A;  2N78 A;  3I4O A;  3OTO L;  2R7F A;  4IPH A;  1DGS A;  2OQ0 A;  1PA6 A;  4LF9 L;  4GLA C;  2F3I A;  5M5X H;  1J5E L;  1GM5 A;  4KHP Q;  4Y52 H;  3PUV A;  3STB C;  1VCI A;  5JJK A;  4LW1 A;  1E24 A;  3H15 A;  2D0O A;  1I94 L;  3S15 H;  2VQF L;  5FJ8 H;  2DGY A;  5M3F G;  4A93 H;  2VQE Q;  3CF5 A;  4JI7 L;  3K7U C;  3PO2 H;  2KCM A;  2XGT A;  1S40 A;  1VQI A;  3K81 C;  3UDX A;  2QEX A;  4A3F G;  2CCZ A;  4R4O A;  1GD7 A;  1VQ4 A;  1M90 C;  2MFI A;  3GDE A;  1RL2 A;  1K3R A;  2RHS B;  4DV0 L;  3F8T A;  1MIU A;  4MNO A;  1N32 L;  3CD6 A;  4BXX G;  2RHQ B;  1VQB A;  1VQP A;  4PZ7 A;  1XNR Q;  1PH6 A;  2R93 H;  4IPC A;  1K9M C;  4UP7 A;  3TS0 A;  3KF8 B;  4JI2 Q;  2JEB I;  5IP7 H;  1VQO A;  4GKJ L;  4GN5 A;  1VQA A;  2IHF A;  3M9B A;  1SR3 A;  3CCU A;  1C9O A;  4DV3 L;  4LF6 L;  1Q8K A;  4JCV E;  2ES2 A;  3H0G G;  2JA8 H;  2UXB L;  4GOP C;  3BU2 A;  4YCU A;  4B3S L;  4RG1 A;  4AH6 A;  3L7Z C;  2K50 A;  3PIO A;  4K0K Q;  3M4P A;  1X6O A;  4ALP A;  2VS1 A;  2Y0S G;  3NBH B;  3GTK H;  1YJ9 A;  5M5Y H;  5IP9 G;  1XMO Q;  3HOU H;  5IWA L;  2E5L L;  3RN5 A;  4POF A;  1EQQ A;  1FVI A;  5ELN A;  3JC6 6;  1Z9F A;  1SN8 A;  4KI0 A;  4JI5 L;  2PQA B;  4DR2 Q;  4GNX C;  2R92 H;  1WOC A;  1UE5 A;  5C44 G;  2L15 A;  4DPG A;  1MJC A;  2AWO A;  2JA5 H;  1Q82 C;  4BBS H;  1NE3 A;  1TWG H;  2MQH A;  4WJ4 A;  4NXN L;  3HOV G;  1OXX K;  2JE6 I;  2PNH A;  2AKW B;  2Q2H A;  3BJU A;  2VY3 A;  4RMF A;  4LFC L;  1NY4 A;  3A74 A;  4EQ5 A;  4TQU S;  4HIO A;  1C7Y A;  1L1O C;  3EN2 A;  2IX0 A;  1WCM H;  2QGQ A;  4A3L H;  1D7Q A;  1N32 Q;  4JC0 A;  3I4N H;  4LFA Q;  4QJF A;  2WAQ G;  4HIK A;  4HJA A;  4P71 A;  1VQL A;  3J81 c;  4HIM A;  4B3M Q;  5C0X J;  1TXY A;  3TS2 A;  4YWK A;  3CW2 C;  2ATW A;  1BKB A;  4L5Q A;  3PGZ A;  1L2F A;  2PQA A;  1YBY A;  1RIP A;  1N34 Q;  4C3I H;  5H1S E;  2K4K A;  5IYD G;  3CME A;  3D0F A;  4P75 A;  2F4V Q;  4AYB E;  4LF4 Q;  1GVP A;  4KHP L;  5LMN Q;  4JBJ A;  4OXP A;  2IY5 B;  2ZTD A;  3KJO A;  1O7I A;  1Q46 A;  3NEN A;  4GS3 A;  4OO1 I;  2NVY H;  4R4C A;  4NPS A;  2ZM6 Q;  3PIP A;  2VQE L;  2ZTE A;  3RLO A;  1XMQ Q;  4GN3 B;  4PMW A;  4A93 G;  4R4I A;  3HFZ B;  1ASZ A;  3TQY A;  2K14 A;  3CC7 A;  4EX5 A;  1UE1 A;  2YTX A;  2I5M X;  3EBE A;  2H5X A;  3GO5 A;  3PUZ A;  3J80 c;  4IJL A;  1X3F A;  3GTM H;  2HHH Q;  3A0J A;  3M3Y H;  3CPW A;  1G51 A;  2K5N A;  2K75 A;  3M85 A;  4JV5 Q;  1PH7 A;  1UEB A;  3CQZ H;  1XNR L;  4HJ8 A;  2UUB Q;  2JA7 G;  1YHQ A;  3AFP A;  4J15 A;  2UUA Q;  1VQ7 A;  3AFQ A;  4X64 Q;  4JI2 L;  2QA4 A;  1X9N A;  1E22 A;  2NVQ H;  2R7Z H;  3KYH C;  2R93 G;  1Y1W H;  4MZ9 A;  2ID0 A;  5C4X H;  5HGQ A;  2HQL A;  3NEL A;  3I55 A;  3RLF A;  1PH8 A;  3T1H Q;  4DR1 Q;  5AJ3 Q;  3NEM A;  4C3H H;  2JA8 G;  3SGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...