1YHAA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhaA00
2QEXA 4BA1I 4P71A 1YHBA 5C44H 4L5RC 1IBLL 1UE5A 3GTLH 2R93G 3J81i 3TQYA 5GAGC 1JB7A 4LF7Q 3SGIA 3E9IA 3L0OA 4FDBA 4DAYB 1VQ4A 2BA0A 4C3IH 3HOXH 1D8LA 2AWNA 1X55A 3FKIG 2K75A 1FGUA 4GN3B 2V1CC 3BJUA 1X56A 1YHAA 4X62L 3F2BA 4LFCQ 1UE1A 3CD6A 3HFZB 1BVSA 3TRZA 3CQZH 2VL6A 3E9HA 1FJGL 1XPUA 3STBD 3CCUA 1WCMG 1Q1EA 1VCIA 1VQCA 2MO1A 1PYSB 3D31A 5GQOA 4A3EH 4A3JH 1NE3A 2F4VL 3I4NG 5C4XG 1CKMA 1HZCA 1CKNB 2OCEA 2R7ZH 3HOUH 2K50A 4P75A 2KCTA 1J5EL 3J81c 1L2FA 2JK8A 1B70B 3S24A 2WB1G 1X3GA 2NVTH 2E8GA 2NVQH 1SR3A 1X3FA 3KF6A 3Q8DA 2ALYB 1A8VA 1BBWA 1VQHA 2DGYA 1PH9A 3S14H 1PH6A 2XGTA 5M3FH 1X65A 4GNXC 4JV5Q 1HNZQ 2N8NA 4DV2Q 1K0RA 5M5WH 3L2PA 3I55A 1QVFA 5IE8A 2I5LX 4YWKA 2A8VA 2PI2E 4X64L 1PA6A 4LF9Q 4KLKA 2Y0SG 3ERSX 3W1BA 3PIOA 4YHHQ 2VQEQ 1X9NA 4WJ4A 1VQPA 3K7AH 1VQ6A 5C44G 1XNRL 1RL2A 3PO3H 3M85A 2UXCQ 4LF5Q 2OWOA 4HJAA 1OXSC 4A93H 1Q8KA 3FP9A 3M4PA 4DPGA 2WFWA 5FLMH 4MZ9A 4TVAB 3HOXG 3I7FA 3KFUA 1I6HH 1M90C 2OTJA 5LMNL 1HR0W 3TS0A 3I4MH 2UUAQ 4PZ7A 4X65L 1IL2A 2HHHQ 4B3SQ 2OQ0A 2UU9L 3RLOA 1YBYA 5IWAL 1YITA 1YHQA 3BU2A 4A3JG 3KDFA 1GKHA 4GNXB 3UE0A 4BXXH 1MKHA 2K4KA 3K80C 1YJNA 3OTOQ 4B3ML 3HOUG 4HIDA 3RR5A 2RCNA 1ASZA 3GTKH 2WP8J 2PQAA 1PH1A 2IHFA 2JA9A 3PF4A 1KIXA 4AYBE 1GD7A 3BZCA 2N49A 3OYYA 1KXLA 1IBMQ 4DR4Q 2VY3A 2C35B 4DV5Q 1PH7A 2K52A 5FJ8H 1VQOA 4LF8Q 4JI3L 4DR1Q 2NN6G 3PUVA 4LFAQ 3KJOA 4HIKA 5M3FG 2JEAI 4H02A 2MO0A 4IJLA 4B3TQ 3RLFA 4DR3L 3W5OA 1MIUA 4JC0A 4JBJA 1V43A 4GKJQ 4BA2I 5AJ3Q 4DUYL 4TQUS 3PO3G 5IYBH 3F1ZA 4OX9Q 4HIMA 3PUWA 4L5SA 2HT1A 1E24A 4QIWE 3E0EA 3OW2A 1P8LA 4DUZL 2A19A 1PH8A 3HOYG 5FLMG 1KD1C 3S1QH 2I0QA 3I4MG 2UUCQ 1AE3A 5ELOA 4UPAA 5M5XH 3UDXA 1G6PA 1UEBA 5IYCH 4LF7L 1EYGA 4DR5Q 3TS2A 1NMGA 2PNHA 1YJWA 1S40A 2GVAA 2K5VA 1VQFA 5M3MH 1QUQB 5LMNW 4BXXG 4JI8L 2MFIA 5LMUQ 3FHWA 1N36L 4GKKQ 4LFCL 3S1NH 4DV7Q 5GAHC 2YTYA 3GDEA 1BBUA 2K14A 2VUMH 4DR7Q 4IFDG 4YWMA 3U50C 5IYDH 3DLLA 4R4CA 4LWCA 5C0XJ 4HIOA 2AHOB 5IY0A 3RNUA 3HOVH 3RN2A 1L1OB 1KL9A 3M9BA 4DAMA 3CCEA 4POGA 4PZ6A 1KQSA 3GTMH 4L5QA 4LUZA 1LYLA 4IPHA 4BBSH 2NVXH 1N8RC 3J7A5 5C4JH 2IT1A 3A74A 3CC2A 2VQFL 4JI1Q 3CCLA 1I3QH 2OQKA 1VQAA 2YYZA 3ER0A 4J15A 1S3OA 1VQJA 4DV0Q 5M5YH 1N34Q 4K0KQ 3PV0A 1HR0L 1PYBA 1XTDA 2NVYH 1HNZL 1X54A 2CWAA 5IYBG 2AKWB 4R1JA 4JBMA 3S17H 4LF9L 2CWPA 2D62A 3TEHB 2VQEL 1E1OA 2JJQA 3K7UC 5FLXc 3H3VI 1V9PA 4JCVE 2PI2A 3AFQA 2LSSA 5IYCG 3HKZE 4OWTB 4HJ9A 1YNXA 4LF5L 1XNQQ 3GTOH 1Y1VH 4A4IA 3G48A 1XPRA 4JI5Q 2B63H 4XTCS 5M3MG 4OWXB 4X66L 2UUAL 5BR8Q 4GLVB 3T1YQ 2HHHL 2VUMG 2EXDA 2KCMA 2UUBQ 1LTLA 5IYDG 1E3PA 1KHIA 2KENA 4DR2Q 5E7NA 4DV1Q 1OXTA 1Q7YC 3AQQA 1MJEA 4IOCA 3HOVG 2ZJRA 1HNXL 1PHJA 1JJCB 2AMCB 1HNWQ 1NY4A 4JBWA 2ZJPA 4IPCA 3KJPA 4JI6Q 1GO3E 4BBSG 1VQMA 1VQ8A 4IJHA 1KC8C 4JOIC 1CSQA 1QUQA 4GOPC 1SROA 3G6EA 4HJ8A 4RMFA 3WWVA 1IBML 4DR4L 2BA1A 4OWWB 3CCRA 4DR6Q 3JAMi 4DV5L 4OONA 3U58A 2ASBA 2EIFA 4LF8L 4ALPA 1YI2A 1T9HA 2I5MX 1I94Q 2E2JH 5IP9H 4ME3A 1AE2A 4LF4Q 4LFAL 1L1OA 1N32Q 1Q82C 2KHIA 4A3KH 1Q1BA 2JQOA 4B3TL 3I2ZA 4A3GH 1Z9FA 4IOAA 4JI2Q 1EQQA 3HOYH 1NMFA 4GKJL 4LUVA 2MNAA 1JT8A 2Q2TA 3PGZA 1N33L 5H1SE 3I4OA 4MNOA 4C2MH 4OX9L 4BY7H 1Y1VG 1PH3A 4AQYL 4PZ8A 2YTXA 4HJ5A 1SMXA 4BBRH 1XMOL 4JI0Q 2B63G 1TWGH 3JAMc 1A0IA 1PH4A 4GOPB 4YY3L 1LM0A 1K3RA 2UUCL 3L7ZC 4A3DH 2JA7G 4X62Q 3UDGA 2OTLA 2UXBQ 1VQ5A 2VZAA 4QY7A 4YWLA 2HIVA 4LNQA 3HOZH 3F2DA 1G291 2E2IH 2NZHA 3CPWA 2HIXA 2WAQE 1UE7A 4EX5A 1VQLA 1VQGA 4GN4B 4PG3A 3GTQH 3J80i 4APVA 4DV7L 4QGUA 4GKKL 5JEAG 1XJVA 4DR7L 4KHPQ 1J5EQ 5JJLA 3U4ZA 2Z0SA 3NELA 4JI7Q 2UXDQ 1KRSA 1PH2A 2KBNA 1E1TA 3PO2H 1CKNA 2D0OA 2JA8H 1P16A 3GTJH 3M3YH 4JI4L 2YV5A 2Z6KA 1O7IA 3PUZA 4DK6C 1L0WA 3H3VH 2K5NA 1S72A 1K73C 5K36G 3CC4A 1NBWA 3PF5A 1R9TH 1Y1WH 5IP9G 1N9WA 2Q2IA 2E5LQ 2YTVA 4JI1L 4A3KG 4A3GG 1JJGA 3CF5A 1WOCA 1N34L 1KRTA 5J3BA 4LFBQ 4K0KL 1B8AA 4JYAQ 3S1MH 4NPSA 1Y14B 5GADC 4P72A 4B3RQ 1VQDA 1TXYA 1E7ZA 3ULPA 2RHQB 3HOWH 5IP7H 4BY7G 1Q81C 4DV4Q 1CKOA 4BBRG 1X3EA 1HZAA 2EQSA 3ULLA 3GTPH 1D7QA 2VW9A 2JEBI 4A3DG 3T1HQ 1ASYA 4LF6Q 3ICEA 4A3BH 2IY5B 3GD7A 1UWVA 2ES2A 4A3MH 1KAWA 3H15A 2HQLA 4DV6Q 1XNQL 5IWAQ 4GLXA 1C9OA 3HOZG 1C0AA 4JI5L 3MXNB 1OXVA 3CPFA 3JC66 3F8TA 4AH6A 1VQNA 2WB1E 4MTNA 3RN5A 3T1YL 4B3MQ 4DNIA 2ZM6Q 3CC7A 3KF6B 2IHEA 1K8GA 2UUBL 1W2BA 4IFDJ 4OXPA 4A3LH 1SN8A 4GNXA 4UP9A 3PO2G 1B7YB 2JA8G 1IBKQ 1HJPA 4NXNQ 4OO1I 4AIMA 4GS3A 2IX1A 4LUOA 4AYBG 4JI6L 3BZKA 1Y1WG 3K8AA 4JI3Q 5DLQE 3RLNA 4UP8A 4QJFA 4GN5A 4JV5L 2Y0SE 2R6GA 4DV2L 3LGJA 5C0XI 1WFQA 5C3EH 1WYDA 4DR3Q 1OXUA 2ZTDA 4POFA 4BY1G 4A3IH 3MEFA 4YHHL 1VS0A 2ZTCA 2JA6H 3K0XA 3STBC 2RF4A 4WJ3M 3S15H 1QZHA 1SE8A 4JG2A 5IP7G 2GVBA 3HOWG 3H0GH 3PIPA 1NJIC 4YCUA 5GAEC 2F4VQ 3AEVA 4JI2L 1PFSA 1PH5A 1OXXK 2JA7H 4JBKA 4HJ7A 3GTGH 3S16H 4A3BG 4L5TA 3KDFB 1WI5A 3ZJYC 2H5XA 4A3MG 4B3SL 4O2DA 2JE6I 1I50H 2R92H 4DK3C 1E22A 1VQIA 1H95A 4JI0L 5HY6A 3K81C 2PQAB 4A3CH 2XTIA 3W1GA 2AWOA 3OTOL 4JI8Q 1U5KA 1SRUA 2CKZB 2LXKA 4GLAC 1N36Q 2UXBL 4A3LG 2ZJQA 2E2HH 1JJ2A 2JA5H 3M7NA 3CCQA 3G4SA 2MQHA 1C7YA 2DUDA 2B3GA 3PSIA 1VQEA 3EN2A 3IRBA 3M4QA 2IX0A 3ULJA 2KHJA 4KHPL 3KYHC 4DR1L 4JI7L 1AH9A 4XIGS 4R4OA 1K9MC 4DV3Q 3I56A 1XMQQ 3S2HH 3CCMA 1TWCH 1A63A 1EIYB 2VQFQ 4NXMQ 5C3EG 1DGSA 4RG1A 1XPOA 3UDFA 1MJCA 1CUKA 4A3IG 2JA6G 5AJ3L 3G71A 3CCSA 4Y7NH 1QZGA 1HR0Q 2CQOA 1LUZA 1IBLQ 4A76A 2E5LL 1EIFA 1EOVA 5JJKA 3H0GG 1IXRA 1FVIA 4R4QA 3KOJA 3PUYA 3CW2C 2NZOA 1NTGA 4LFBL 3CCVA 4JYAL 2QGQA 1OTCA 4B3RL 1Q46A 3D0FA 3A5UA 4YCWA 3UDIA 1EUJA 3KF8B 4R4IA 2R92G 2R7DA 3B6YA 4PMWA 4DR5L 1IZ6A 4DV4L 3A0JA 1YIJA 1FJGQ 1EWIA 2BH8A 4A3CG 4UP7A 3CXCA 3HKZG 5LMUL 1TWHH 2N3SA 3T1HL 4X66Q 4LF6L 1YJ9A 1JE5A 3S1RH 3AYHB 5IT9c 4DV6L 2VS1A 2JA5G 3NEMA 4R4TA 4A75A 4KI0A 5HGQA 3GO5A 3RZOH 1VQ7A 1SLJA 4X6AH 4A3EG 2BH2A 3PUXA 1HNXQ 1RIPA 1QVGA 2R7FA 1EFWA 2YU9H 2B29A 2R7ZG 2RHSB 2F52A 5JEAJ 2FXQA 2ZM6L 2GN5A 1VQBA 1GVPA 1Q12A 2N78A 4A3FH 1SFOH 2UXDL 1IBKL 1QVCA 1Q86C 4NXNL 1HZ9A 2VNUD 4DKAC 3J81j 4DV0L 2ZTEA 4BY1H 2F3IA 4X64Q 1VQKA 3J80c 1PVOA 1XNRQ 5JJIA 1J6QA 1K8AC 1M1KC 3VDYA 3A5ZB 1V1QA 4LW1A 5EAYA 3KLWA 1X6OA 3U4VA 2ATWA 1GM5A 1Z47A 1YVCA 3CP0A 4P74A 4QL5A 5LMNQ 1YEZA 2LXJA 1N33Q 4X65Q 3M4OH 2R93H 3EIVA 1L1OC 3DM3A 2NN6I 3HKSA 5ELNA 3F2CA 2UU9Q 4IPDA 3CMEA 4AQYQ 4OO1G 1XMOQ 4UY8C 1HZBA 3FKIH 2CFMA 3J7ZC 4YY3Q 5BR8L 1TWAH 3EBEA 2I5HA 3UE1A 1U0LA 1WJJA 3TREA 3NENA 4DR2L 1W3SA 1UE6A 4JOIA 4DV1L 4GOPA 1PV4A 5C0XG 2ID0A 4KHZA 1A62A 1WCMH 2CCZA 2Q2UA 3I4NH 5C4XH 4O0AA 3RZDH 1HNWL 1YZ6A 4P73A 2K5HA 1FL0A 1G51A 2L15A 1IYJB 1EQRA 4IO9A 2WAQG 2QA4A 2A1AA 4A3FG 2D0PA 4EQ5A 4NB3A 4DR6L 3S2DH 4JI4Q 1VQ9A 1K83H 1TWFH 2PMZE 4C3JH 4C3HH 4QQBX 3CAMA 3NBHB 5FJ8G 1I94L 3PCOB 4LF4L 4DUYQ 4DV3L 1N32L 1CSPA 1XMQL 4IFDI 1HH2P 4A93G 2UXCL 5GROA 4YCVA 3CCJA 1I5FA 4NXML 4IPGA 3CMAA 1JMCA 2Z6KC 4Y52H 1BKBA 4DUZQ 3AFPA 2Q2HA
chains in the Genus database with same CATH superfamily
3NWTA 2QEXA 4BA1I 5C44H 3VR4A 1FGBD 3TQYA 4K8JA 4K5XA 5GAGC 1JB7A 5IGCA 4DAYB 2X6LA 2BA0A 3HOVB 1RF2D 1GUGA 1UE1A 1LTTD 3HFZB 4ZAIA 1FJGL 1XPUA 5FO8B 1WCMG 1G2TA 1VQCA 3EFXD 4A3EH 1ESFA 3K5OA 4CHTB 1I3QB 4DAVA 3HOUH 2K50A 2KCTA 3V2TA 2JK8A 3S24A 1QG7A 2NVTH 1SR3A 2F3WA 2CH4W 3E3XA 4C3HG 3S14H 2FHTA 1X65A 1BUVT 4JV5Q 1TU2B 2QILA 3BG3A 3GTOB 2A8VA 3BVMA 2VQEQ 3ERSX 3PIOA 4KK7A 3NBIA 3AU7A 2OF1A 3M85A 2OWOA 4C3IG 1UAPA 2WFWA 3HOXG 1CHPD 2UUAQ 4K8IA 2SEBD 1YBYA 5IWAL 1EY7A 1ENAA 1Y69U 4K6LA 1WTHA 2KCCA 5KRUA 4A3JG 3KDFA 1MKHA 2CW0C 4HIDA 3VYSA 3MAQA 1ASZA 2WP8J 1MSGA 3D4DA 1KXLA 3IKJA 1J9OA 1RTNA 5DM73 2C35B 4DV5Q 4ZK9B 5FJ8H 4JI3L 2NN6G 3EJIA 4FO2A 2Z1CA 2JEAI 4H02A 5KYIA 3MVVA 2MO0A 3R2IA 1PRTF 1EZ6A 4JPBW 1ILQA 3W5OA 1ICFB 1MIUA 3DHQA 1V43A 1PDQA 2F0JA 4BA2I 4FF2A 2SOBA 5IYBH 2CW0D 1PMRA 3PUWA 4L5SA 2IW3A 1KAAA 4QIWE 5T1IA 1ML0D 1KD1C 4IUUA 1HXYD 3KBXA 1EYCA 5ELOA 4UPAA 2KA7A 1HUNA 2FMCA 3UDXA 1G6PA 4CKEA 4LF7L 4DR5Q 1QOHA 3SK8A 2PNHA 1EEID 3KF8A 1VQFA 3GP7A 1SSOA 4ZUIA 5IT9E 2MFIA 4X3KA 2YTYA 5EGTA 1BBUA 4IFDG 4JVZA 1PTOB 5KNDA 4RGMA 3I3CA 4LWCA 4HIOA 4ULLA 3TN2A 2HCIA 4PZ6A 4XDXA 4IPHA 3KLSX 2IT1A 3CCLA 4K6DA 1VQAA 4J15A 1VQJA 1F2YA 4K0KQ 2Z4HA 1E0BA 2DNCA 1XX8A 3PV0A 3GTPB 3EQLC 1PYBA 2PZUA 1XTDA 2NVYH 5JPNC 3D6WA 2CWPA 3BVZA 3MA2B 5FLXc 4FP5D 4JCVE 3AFQA 2LSSA 5CGKA 1YNXA 4A4IA 3BYTB 2F0UA 3I90A 3G6JB 3OOCA 2ENBA 4XTCS 1STNA 1H9SB 4N9TA 4B9WA 2KCMA 1E3PA 1KHIA 5E7NA 2IX3A 3HOVG 4ID6A 1HCZA 1HNXL 4FXKC 1LTAD 1CA6A 1JJCB 2A68C 2K04A 4JBWA 4IPCA 3KJPA 1VQMA 1VQ8A 4IJHA 5CV4A 4HJ8A 4DR4L 2BA1A 2F0EA 4OWWB 3CCRA 4DR6Q 1UNSA 2O2LD 1WD1A 2ASBA 1PFNA 1YI2A 5IP9H 4LFAL 1AE2A 1L1OA 1R4QB 2CQAA 2EYMA 4LAAA 3A8JE 4B3TL 2JQOA 3NBHA 4A3GH 2R92B 4TKOB 1V1OA 3QG1A 2F0SA 1NMFA 4GKJL 4O1NA 3SK6A 4AQYL 2I07B 4DXGA 2YTXA 3N6RA 1XMOL 4BBRH 4JI0Q 1A0IA 1PH4A 4GOPB 4YY3L 4FXDA 4HCEA 2OTLA 4IFDH 2VZAA 3WOEA 1YNJD 3R3OA 3OMGA 1UE7A 1VQGA 4GKKL 3J80i 4APVA 2ZXOA 4KHPQ 1OO9B 2JA8H 1PFBA 3HGBA 3VR3A 3M3YH 2YV5A 4DK6C 2FINB 5K36G 3PF5A 1R9TH 1Y1WH 2Q2IA 3K7AB 4JI1L 1EFID 3CF5A 1N34L 1KRTA 1B9MA 4JYAQ 1LACA 2K03A 3K6OA 1EY4A 4B3RQ 1VQDA 1TXYA 4V190 2AQ1B 1ESRA 1AEXA 1CQVA 1CI3M 4TRDA 3R2TA 2R61A 3RZOB 3GD7A 3BVGA 1SMYD 5IWAQ 1C9OA 4YIJA 3MXNB 5IIFA 1PZID 1VQNA 3T1YL 2ZM6Q 1ZKOA 1SN8A 4GNXA 1B7YB 1IBKQ 1JWMD 1I4XA 2E76C 4AIMA 4GS3A 1JC7A 1HFGA 3I72A 4N8FA 1EY0A 4JI3Q 3K8AA 1KDBA 5DNFA 4QJFA 3HRZC 1I4QA 2K7VA 2F0LA 5C0XI 4IURA 1WFQA 1HRJA 1K8OA 3P75A 4A3IH 2EY1A 2JA6H 1BXTA 1RODA 2C9OA 1LABA 4RGOS 1QZHA 3LWEA 2GVBA 1AFPA 3H0GH 4K2LA 1LT5D 3WOFA 1PH5A 1OXXK 5IGGA 4JBKA 5I2XA 3ZJYC 1WI5A 3RZDB 4B3SL 4O2DA 5F2DA 1I50H 4CKCA 1VQIA 1B50A 3K81C 2PQAB 2WB1B 2AWOA 5CV8A 4GLAC 2CKZB 2LXKA 2EXZA 3M7NA 3AB9A 3CCQA 3M7GA 1F2ZA 2RCFA 3MFYA 5ISRA 3IRBA 2B8FA 3NP8A 1WTQA 5M5YB 4JI7L 1AH9A 1AZPA 2Y0SB 1KNEA 3I56A 5C44B 3CCMA 3C46A 2F0WA 1D1KA 1JICA 5BN3A 4TSSA 4JK1C 1H9KA 2ICIA 4IUNA 5AJ3L 3G71A 2A5HA 2CQOA 5D3IB 1LUZA 1IBLQ 3NHHA 5JJKA 5JPMC 3KOJA 2G9HD 3NTKA 1NTGA 3TP6A 4LFBL 1QNKA 3ITPA 3NTHA 5FLXE 3LWUA 1Q46A 4QF4A 3A5UA 5IT9L 4R4IA 4KY5A 2R92G 3HOUB 1YIJA 4QUCA 5CBEE 1JWUD 1GUSA 2BH8A 4OO1H 1EY5A 4A3CG 3CXCA 3T1HL 2WACA 2NVTB 1YJ9A 1EY9A 4A75A 4KI0A 3S14B 3GO5A 1VQ7A 2BCOA 2KECA 1HNXQ 4C1NK 2F52A 2LKVA 2FXQA 5JEAJ 3TMEA 4H44C 5CC4A 1NAPA 4EVOA 4NKLA 1AP0A 1HZ9A 1SNQA 3J81j 4CKBA 2F3IA 4DK0A 3OWFA 2KEEA 4IALA 3J80c 3HOYB 2EY6A 1CZGA 3NXWA 3SXHA 5JJIA 2EJMA 2E2DC 4KHVA 4LW1A 1X6OA 4P74A 4QL5A 5LMNQ 3M4OH 4XT1B 1IW7C 4XQNA 3EIVA 2R93H 3HKSA 1DOKA 1FYCA 4AQYQ 1X3PA 1XMOQ 1HZBA 2EYPA 4YY3Q 1RDPD 1TWAH 1EWCA 3UE1A 4G7OC 3ND8A 2QDBA 1EYAA 3NENA 1SNDA 1UE6A 4DR2L 5C0XG 1WD0A 1A62A 5LL6S 2CCZA 3SHLA 2A69C 1HNWL 1YZ6A 1AW7A 1D5XC 4QMGA 1C8CA 4IO9A 2P5ZX 2QA4A 2D0PA 2F1MA 2N88A 2Q8RE 5EKLA 2PMZE 2QEJC 1ENCA 1IYUA 2PZWA 4DUYQ 1N32L 5COYA 4CDDC 1I5FA 4L63B 4Y52H 3CMAA 1MSHA 1BKBA 2XWBB 2Q2HA 2F3VA 5KEEA 2EY5A 1A2UA 4P71A 1YHBA 4HMIA 2A69D 2O5IC 3VYUA 1I4HA 4FNFA 1TT2A 5I6WA 1JR0D 3V96A 3C1FA 1VQ4A 1HTLD 1HTPA 1D8LA 1SYFA 1X55A 2F0QA 4IUTA 3BJUA 1KLGD 1X56A 1YHAA 2XWJB 3TSSA 3TRZA 1H9RA 1KNAA 3CQZH 1I4PA 3STBD 1HQRD 1Q1EA 5GQOA 1PYSB 3J81c 2O4XA 3FPPA 4KY7A 2WB1G 1B53A 2E8GA 2NVQH 1X3FA 3Q8DA 5C4ZA 2ALYB 4K5WA 3BS1A 1K3BC 1STHA 3SE0A 2EYHA 5M3FH 2SNSA 4Z9CB 3OSOA 1K0RA 3N52A 3L2PA 3I55A 3DWQA 4X64L 2Y0SG 3K7AH 1SJED 5C44G 1XNRL 2UXCQ 2JA7B 2G9DA 4XQQA 4HJAA 1OXSC 3FP9A 1I6HH 2OTJA 4TVAB 3I7FA 3L3OC 3I4MH 1IL2A 4B3SQ 4R8NA 2UU9L 3RLOA 1YHQA 3H91A 3VA7A 4OHJA 4F8MA 1PTOF 3UE0A 2K4KA 1YJNA 3HOUG 2RDFA 1T5EA 4DAYA 3CHBD 1KIXA 4CJ2C 1TS2A 3BZCA 1HA6A 2ICEC 1IBMQ 2VY3A 1RD9D 1I4GA 1ZYRC 1KABA 4A3GB 5CV6A 3KJOA 4MTKA 1DZ1A 2KUMA 2EVBA 3D4WA 2VXWA 4IJLA 4XYQA 1MGSA 1LT6D 4PNYA 5J39A 1JQYD 4K2KA 2DJGC 4IUVA 1STEA 3D3RA 1K28A 4BBRB 1GOZA 5AJ3Q 4TQUS 3F1ZA 2HT1A 2F4VL 2IPKD 1E24A 3E0EA 3OW2A 1QJOA 2A19A 3HOYG 1DCZA 2I0QA 2EE1A 1AE3A 3WDNA 1WVLA 1HA5A 4XQJA 4S3SA 5IYCH 1YJWA 1S40A 3D8GA 1B9NA 5LMNW 2JA8B 1N36L 1NSNS 4LFCL 3M3YB 5GAHC 1D1IA 1RCVD 2YU9B 1D2BA 5IYDH 1PTOD 4AYBB 3X3NA 5KNBA 1Y1WB 4G4KA 4IZ8A 2JXMB 1KL9A 1FNUA 3GTMH 4G7HC 1LYLA 4BBSH 4BY1B 2NVXH 2A74C 1N8RC 1CM9A 3J7A5 5C4JH 1G91A 2L4NA 4RCOA 3J80E 1BOSA 1S3OA 5M5YH 1F77A 4X3SA 4ZUJA 5FLXL 5JOBA 2BDOA 4RHSA 1HNZL 1X54A 2CWAA 5IYBG 1W6JA 3SK4A 3S17H 4LF9L 2D62A 3TEHB 1J8IA 4WRDA 3K7UC 4ZLTF 3KLSA 2PI2A 2KEDA 3HKZE 4OWTB 4LF5L 2MHVA 1Y1VH 4JI5Q 4ZRZA 4OWXB 1EOTA 1XYIA 4GLVB 2HHHL 2M00A 2UUBQ 2KENA 4DR2Q 4G57A 3AQQA 4KTAA 4IOCA 3PQIA 1HNWQ 1EQTA 1NY4A 2ZJPA 5JEAH 4JI6Q 2EPBA 4A3IB 1KC8C 2F0NA 4JOIC 4GOPC 2JA6B 4RMFA 2JSOA 1DJRD 3H0GB 4OONA 4LF8L 2B2VC 3KLRA 3P7JA 2I5MX 5E3FA 1N32Q 1LTGD 2KHIA 1TR5A 4IN3A 5CYUA 1Z9FA 1I50B 4IOAA 3HOYH 4LUVA 2Q2TA 1GJXA 4HSVA 4C2MH 4OX9L 4BY7H 1SMXA 3JAMc 1LM0A 1K3RA 2UUCL 2JA7G 1CK1A 1S5BD 1VQ5A 4QY7A 4X3TA 3NSWA 3HOZH 2LFNA 1HUMA 4PV1C 2E2IH 2NZHA 1S5ED 4RGTA 4GN4B 4PG3A 3J81E 4DV7L 3I4LA 1LO5D 1XJVA 3C2PA 4DR7L 3U4ZA 4WFN3 2KBNA 1E1TA 3PO2H 1CKNA 1S4ZA 1P16A 3GTJH 4JI4L 2Z6KA 2KJXA 1SBBB 1GHJA 1JWSD 2DY8A 3H3VH 2K5NA 4FVMA 1S72A 1K73C 4OIKA 5IP9G 1F9RA 4PMBA 2E5LQ 3MWYW 2YTVA 4A3GG 1JJGA 3S1MH 4CJ1B 5GADC 4P72A 3OIPA 3ULPA 2RHQB 3HOWH 1Q81C 1CKOA 4BBRG 2F0HA 1HZAA 2VW9A 4IQZA 3VR2A 1ASYA 1O80A 3ICEA 4A3BH 1UWVA 4DV6Q 1XNQL 2WAQB 1IKMA 3CPFA 4AH6A 2XRQD 1X3QA 5T1GA 3CC7A 1K8GA 4A3LH 1QILA 5ELEA 2HDLA 3VYRA 2JA8G 1ILPA 2PYKA 3HEJA 4OO1I 1WTRA 4AYBG 1Y1WG 1YNNC 3OWEB 1LTRD 5DEHA 2JP1A 2R6GA 3M4OB 3LGJA 3TZDA 2R93B 1TY2A 4BY1G 1VS0A 2ZTCA 3FVQA 3K0XA 3DM1A 4RGNA 2NBFA 2RF4A 4WJ3M 1SE4A 3S15H 1TWAB 4YCUA 5GAEC 2F4VQ 4JI2L 1HPCA 2JA7H 1IYVA 3S16H 3GTGH 1FNVA 2B2WC 3KDFB 3A8IE 3K0YA 5IGBA 1H95A 1YNND 1II3A 4FF1A 1STYA 3LNNA 3OTOL 1U5KA 1N36Q 3UI2A 2UXBL 2ZJQA 2F4IA 2E2HH 2JA5H 2F0OA 3G4SA 1PLFA 2DUDA 2B3GA 2KHJA 4DR1L 5CMDA 4XIGS 4CDCC 4KKSA 4R4OA 4DV3Q 3J7AF 1WTWA 1EIYB 2BDNA 1DGSA 4RG1A 1AN8A 3UDFA 1CUKA 4A3IG 3VR6A 2JA6G 3CCSA 3A55A 4Y7NH 1EOVA 3Q24A 2A68D 4KV6A 3H0GG 1IXRA 1FVIA 5IODA 3PUYA 1SNOA 2NZOA 3CQZB 2QGQA 1OTCA 3KF8B 3A8KE 1RHPA 2R7DA 3W3AA 4PMWA 3MXGA 3A0JA 4DV4L 1FJGQ 2O5JC 1VMPA 5LMUL 1TWHH 2RKSA 2NVQB 2QW7A 4LF6L 3S1RH 1WTVA 2DN8A 2R3ZA 5KGUA 5M3FB 3PUXA 2RSOA 2YU9H 2B29A 2RHSB 3J80L 1JOOA 2GN5A 3ONAB 4NW2A 1GVPA 2N78A 2Z4IA 1BQQT 2K6AA 4NXNL 4DV0L 4DGZA 4BY1H 1BCPB 5I9PA 1TKWB 4MHEA 1I6HB 1TQOA 2DJFC 1K8AC 3I4MB 1ET6A 3A5ZB 5EAYA 3VR5A 1GM5A 1K0SA 1EU3A 1CHQD 1YVCA 3CP0A 4LMQD 2LXJA 3DM3A 4A3DB 4IPDA 3CMEA 3W2DA 1SYBA 2EJGC 3JAME 5E4WC 2K33A 4OO1G 5IGEA 1C4QA 1DONA 3FKIH 2CFMA 3R93A 2WKCA 2F0VA 1NR2A 2F03A 1PFMA 1PV4A 1W3SA 3K59A 4ZKCB 3U9SA 4DV1L 1GUWA 4KHZA 3V05A 2A6EC 2Q2UA 5IGDA 3I4NH 5C4XH 4HR7B 1A3VA 4ZQ3A 4P73A 2K5HA 2L15A 1VMCA 1IYJB 1EQRA 2F0DA 2WAQG 2A73B 2WINB 3FPUB 4EQ5A 4RCNA 1PZKD 3K5NA 4JI4Q 1VQ9A 4C3JH 4QQBX 2DNEA 3CAMA 3NBHB 2CH4A 1STAA 1GUOA 3CKIB 1XMQL 1HH2P 1FD7D 2EYFA 4YCVA 4NXML 4KN4C 2OEOA 2JN4A 2R93G 1PRTB 3J81i 4LF7Q 3TP8A 3HP3A 3E9IA 3L0OA 4FDBA 1Y8NB 5C3XA 2AWNA 1FGUA 4X62L 3S2DH 1U9RA 3HS0C 3CD6A 3GTMB 3J81L 2VL6A 3E9HA 2HUGA 1O7YA 4BBSB 2MO1A 3DXJC 2NVXB 5C4JB 3H6MA 3FDTA 1A3TA 1HZCA 5ELFA 3QOJA 4P75A 1J5EL 5CORA 2ZXPA 1X3GA 2AUKA 3KF6A 5EPJA 1ONLA 3RUZA 5DAUA 1VQHA 3QJYA 4IUPA 1PH9A 3S17B 2J0TD 3KBGA 1V1PA 1PH6A 2PNRC 3E0JA 3OW7A 2KHSA 4YWKA 2PI2E 1Y1VB 1PA6A 3F2UA 1X9NA 1VQPA 3NWSA 5KYLA 1RL2A 3PO3H 1S5FD 3I8ZA 4A93H 2PW7A 2L1BA 3M4PA 2B39A 4MZ9A 5D14A 5FLMH 2RSNA 1HHVA 1M90C 3T4AC 4X65L 4K14A 1RJTA 2OQ0A 1U4LA 1YITA 3BU2A 1MBYA 4PMCA 1B2TA 4GNXB 4BXXH 3OTOQ 4B3ML 3RR5A 3GTKH 1PH1A 1MHWC 2IHFA 2MUYA 5L37A 2BE5C 1SYGA 3OYYA 2DY7A 4DR4Q 1QCBD 1PH7A 1E2VA 4DR1Q 1S5CD 3PUVA 4LFAQ 4DFAA 5J22A 5M3FG 4HIKA 3A56A 5EJWA 3P20A 4B3TQ 4C2MB 3RLFA 4BY7B 4JBJA 4GKJQ 3Q23A 3SEBA 5C6AA 2V4DA 4NDXA 1G6ZA 4HIMA 4CJ0B 1B1ZA 1P8LA 4DUZL 1FNWA 3HOZB 4X3UA 2BE5D 2KCNA 2E2IB 3I4MG 4LJZC 2K01A 1SYCA 3NTIA 2GVAA 2M9VA 2OT2A 2FMMA 5M3MH 1QUQB 3PO2B 2IL8A 1GXDC 5LMUQ 4OELB 3FHWA 4P2CB 3GTJB 4GKKQ 2VUMH 2K14A 2B2YA 3DLLA 4R4CA 4B9XA 2AHOB 2N55A 1IW7D 5EKKA 3O13A 4POGA 1KQSA 4L5QA 5C4HA 3S1MB 3SK5A 3MFGA 3A74A 3CC2A 2VQFL 4JI1Q 3ER0A 2B2TC 3HOWB 4DV0Q 1N34Q 1QWYA 3A7AB 2L12A 2EOTA 3TDQA 1HR0L 2X6GA 1ENFA 1G2SA 4A3BB 4QIWB 1DXMA 4JBMA 1VF5C 2VQEL 2JJQA 3H3VI 4CDEC 3K57A 1V9PA 5IYCG 3SR1A 3G48A 1XPRA 1CA5A 1U4PA 2B63H 1A15A 2D2CC 2Q8IB 4X66L 2UUAL 3T1YQ 4HTHA 5IYDG 5FO7B 4DV1Q 1OXTA 1FR3A 1Q7YC 3NUCA 3OMCA 1MJEA 2ZJRA 4RHRA 1PHJA 2AMCB 2JYOA 4KJOA 1GO3E 4HEDA 4BBSG 1K83B 4NMZA 5BN4A 2B2UA 5D3DA 3WWVA 1E2ZA 3S15B 3JAMi 4DV5L 1IHZA 3U58A 3Q22A 3QOLA 5HURA 2E2JH 1KLUD 4Q5VA 3TBIB 1KTKA 1CFMA 3FRPB 4UHVA 2IWHA 4ME3A 5LL6X 4FF3A 4KD3A 3S16B 3GTGB 4A3KH 1Q1BA 3GTLB 3I2ZA 1EQQA 4OEMB 1JT8A 1CTMA 3Q6SA 2MNAA 2H4OA 2PW5A 2LS01 3PGZA 5H1SE 4KY6A 3I4OA 4MNOA 1SDFA 2XNAC 1Y1VG 3CRKC 4HJ5A 2E2HB 2JA5B 5EBCA 1TWGH 4HMJA 4A3DH 4KKTA 1L0XB 4JW0A 1QNUA 4X62Q 3UDGA 4RWSC 4YWLA 2R7ZB 2HIVA 5FK9C 3F2DA 1G291 2HIXA 1VQLA 4EX5A 4QGUA 1XTCD 5JEAG 5CV9A 1J5EQ 2Z0SA 3NELA 4JI7Q 1KRSA 4Y7NB 2J7ZA 3A54A 2QCPX 4U673 1O7IA 3PUZA 4V0BA 1L0WA 5ELBA 5M5WB 1NBWA 1N9WA 5A2QE 5C5LA 2M2LA 3FMCA 1EZ8A 3HZXA 1K8MA 3PMFA 4L8JA 1G8ZD 2E75C 1B3AA 2K28A 4LFBQ 4K0KL 3GV6A 5EPKA 3K5LA 1A6XA 4DU9A 3MXPA 2AQ2B 1E7ZA 1TWHB 1ZYRD 5BN5A 5IP7H 4BY7G 3S1RB 2VB2X 1M8AA 1V8QA 1R4PB 5I6YA 1X3EA 3ULLA 3IFTA 2JEBI 3T53B 4M8AA 3T1HQ 2L11A 1L0YB 3OPOA 5D65A 4A3MH 2ES2A 2HQLA 1Z6HA 4HN7A 3HOZG 1EY6A 3JC66 4ZKBB 2WB1E 4B3MQ 3C3LA 4N8X1 2IHEA 1EEFD 1W2BA 4IFDJ 1MI2A 4KJNA 3QWNA 3PO2G 1HJPA 2F0FA 2X69A 4DNTB 2IX1A 5I2YA 1Y8PB 4LUOA 4XT3B 3M4YA 2RA4A 4OIJA 4GN5A 2Y0SE 3ERQA 1SNMA 4DV2L 5C3EH 1WYDA 1OXUA 4POFA 4C1NI 3I91A 4YHHL 2ZT9C 3FKIB 3HOWG 1SE8A 4UAIA 3QB3A 5M5XB 3AEVA 4I65A 1NCVA 3T56B 2HQEA 3I4NB 4A3BG 5C4XB 2G5DA 4QCLA 1TS5A 2H5XA 2F0IA 2MGSA 2E74C 3S1NB 1UEAB 1E22A 4JI0L 5HY6A 4EQPA 4IUQA 5TSSA 5EQ0A 5KIXA 4C3JB 4A3LG 1DOMA 1STGA 2SNMA 5IOCA 1JJ2A 2NTSA 1JE4A 1C7YA 1QB5D 4E6IA 1ICWA 3M4QA 3EN2A 2K5DA 4J8QA 2IX0A 3ULJA 4KHPL 2KVMA 3QR8A 1BCPF 1K9MC 5EKIA 3S2HH 1LTID 1F9QA 1TWCH 3GV3A 2VQFQ 2L0CA 1XPOA 1LT4D 4ILWA 1MJCA 2RBMA 2NUCA 1QZGA 4H7BA 1HR0Q 1TY0A 4PQXA 3S2DB 4R4QA 1Z7TA 1U4RA 2EYOA 3CW2C 5NUCA 1DM0B 3CCVA 4JYAL 3DEPA 4B3RL 4YCWA 3UDIA 1EUJA 4MIUA 1IZ6A 2CVRA 1BCPC 1A2TA 4UP7A 1DD2A 1IL8A 1Q3LA 4X66Q 1I6VC 1JE5A 3AYHB 3DMUA 2EJFC 3KK7A 4ZCKA 1H9MA 2JA5G 2PPBC 1BBXC 1ET9A 4X6AH 1H9SA 2BH2A 4I7AA 1EFWA 1QVGA 2R7ZG 2ZM6L 2MJ8A 3I73A 1Q12A 1Y8OB 4EQOA 4A3FH 1SFOH 2UXDL 1IBKL 4F7XA 1QVCA 3PO3B 5J1ZA 4DKAC 3S9WA 2D9UA 2ZTEA 4X64Q 1VQKA 4A93B 1BCPD 1XNRQ 1J6QA 3MTSA 3VDYA 1V1QA 1NR4A 1Q90A 3KLWA 3U4VA 4KKUA 1UUPA 1O7LA 2NYZD 2SDFA 4J1MA 1L1OC 5ELNA 3F2CA 2UU9Q 3BZDB 3QO2A 3RD4A 3GTKB 2C5CA 4KMUC 2EYLA 4UY8C 1U4MA 3J7ZC 4RKBA 5BR8L 2I5HA 1U0LA 1WJJA 3TREA 3GTQB 4JOIA 3J7AV 4GOPA 1SEBD 3BDOA 1WCMH 3CRLC 3X3MA 1PRTC 4O0AA 2B2VA 1PXUA 1GUNA 1FL0A 4F87A 2A1AA 3DWAA 2KQ3A 3K58A 5IGFA 5CBAE 1K83H 1TWFH 2QKIC 4C3HH 3KUPA 2RQXA 1I94L 1VF7A 3PCOB 4G7ZC 4LF4L 1NUCA 1CSPA 5CV5A 5GROA 3CCJA 4IPGA 1JMCA 1GUTA 2F0KA 1WTXA 4J6HA 1RTOA 4L5RC 5M3MB 1IBLL 1UE5A 1PRTD 3GTLH 3SGIA 2VUMB 3SDZA 5AFWA 4C3IH 1Q8IA 3HOXH 4OGQC 3FKIG 1CT1D 2K75A 4GN3B 2V1CC 4ME5A 4LFCQ 1A63A 3F2BA 1F2MA 3FEWX 1BVSA 5CV7A 3CCUA 1VCIA 3D31A 2K5QA 4A3JH 3I4NG 1NE3A 3G7LA 5C4XG 4DK1A 1CKMA 2OCEA 1CKNB 2R7ZH 4DN4M 1A3UA 3MXNA 2Z8LA 5G3LF 4QB4A 2HDMA 1L2FA 1B70B 3NPPA 1B4OA 3ND9A 4XXEA 2OXPA 2TSSA 1M4VA 5A2QL 3H94A 2PMZB 4RH6A 4C3JG 1SYDA 1A8VA 1BBWA 3MC0B 1BNZA 2DGYA 2NN6H 4H13C 2XGTA 4GNXC 1HNZQ 2N8NA 3K5MA 4DV2Q 5M5WH 1QVFA 3RMHA 5IE8A 2I5LX 1QE6A 5HGTA 1YNJC 3EVQA 4KLKA 4LF9Q 3W1BA 4WJ4A 4YHHQ 2B63B 2F0MA 5EPLA 1VQ6A 4LF5Q 4N9PA 1LT3D 2LY7A 1WTOA 1Q8KA 1VDZA 4DPGA 3KFUA 4DXFA 5LMNL 1HR0W 3TS0A 1SYEA 4PZ7A 2HHHQ 2XVSA 3ZYYX 4H0LC 1E2WA 3QIAA 1GKHA 5M9OA 1H9JA 3K80C 5A35A 1HQMC 1DOLA 2RCNA 2PQAA 4BWGB 2JA9A 3PF4A 2E2JB 4AYBE 1GD7A 2N49A 1WTPA 3NQTA 5FO9B 4FF4A 4DAPA 5G3LD 1AZQA 4A3KB 2TMPA 2K52A 4LF8Q 3DEOA 1VQOA 1KDCA 4B08A 2EY2A 4ABNA 5ELCA 5I4DA 2XRSD 5FKAC 4DR3L 1SE3A 4JC0A 3H3VC 1SMYC 2WKDA 1TWGB 4DUYL 2B2WA 3PO3G 2Z6BA 1LV9A 4OX9Q 4A93G 1SNPA 2WV6D 5JVG3 4K5VA 4Q0FA 1PH8A 3S1QH 5FLMG 2UUCQ 1LTSD 5M5XH 1UEBA 2VB3X 1EYGA 3TS2A 1NMGA 2K5VA 4BXXG 4KN7C 4JI8L 3S1NH 4DV7Q 1X32A 4DR7Q 3GDEA 4I7ZC 4YWMA 3U50C 2B8GA 5C0XJ 4CGYB 5IY0A 3RNUA 2K05A 3HOVH 4EGVA 1L1OB 3RN2A 1TS4A 3M9BA 4DAMA 1W6KA 3CCEA 3EA6A 4LUZA 3LX0A 3MEHA 2F0PA 1XWEA 2EDGA 2UXDQ 1I3QH 2OQKA 2YYZA 2NZ1D 4NP5A 1S5DD 1LLRD 1STBA 2A6ED 5C5MA 2AKWB 4R1JA 4A3MB 1E1OA 2QDLA 1SNCA 4HJ9A 2UXCL 3TZUA 3GTOH 4UDUC 1XNQQ 2J4XA 3E6ZX 4GZYC 5JVH3 3R8BA 5M3MG 5BR8Q 4R9WA 2VUMG 2D5DA 2EXDA 1LTLA 2I46A 3URYA 2IJ0A 5C3EB 4HSPA 3IFDA 1CSQA 1QUQA 3D6CA 1SROA 3G6EA 1IBML 3DWPA 2EIFA 5K36H 1HFNA 4ALPA 5E1FA 1O7ZA 1T9HA 3TP7A 1I94Q 1BO0A 4LF4Q 3H09A 1Q82C 2B2YC 1D6EC 2PCFB 4JI2Q 3PIP3 2MP1A 1PYWD 3EROA 1D5ZC 4KD4A 1PZJD 1ZXTA 1N33L 3HKZB 3NQIA 1F9SA 1PH3A 1B3QA 4PZ8A 2B63G 2F0TA 3L7ZC 3MZ5A 1O78A 4A3EB 3U9OA 2UXBQ 4FYDA 2RVLA 4LNQA 4RA8A 1JOQA 3CPWA 2WAQE 3S2HB 3DUZA 1TWCB 3GTQH 1TS3A 5JJLA 4RFBA 2ZXRA 1PH2A 1B44D 2D0OA 1BF4A 4DF7A 2K5WA 1PTOH 3CC4A 3OHXC 4L6TB 3C1EA 2AUJD 2EYJA 4ZYSA 4A3KG 1WOCA 5J3BA 1B8AA 4NPSA 1KDAA 1Y14B 1F2LA 2B2UC 4BS9A 4DV4Q 3CU7A 2K32A 2EQSA 3GTPH 1D7QA 4A3DG 4LF6Q 2IY5B 2QF7A 1KAWA 3H15A 1EY8A 1T5XD 4GLXA 1C0AA 3MXUA 4JI5L 3HG9A 2BOSA 3VA5A 1OXVA 4A3FB 1SFOB 3BDLA 3F8TA 1SE2A 4RAUC 1JB3A 4MTNA 3RN5A 4DNIA 3KF6B 2UUBL 4OXPA 4EQNA 4UP9A 1V1PB 4NXNQ 1JCKB 3BYYB 3D4RA 5JJZA 4QUFA 5C3WA 4JI6L 3BZKA 5DLQE 3RLNA 4UP8A 4JV5L 3IAYA 3L9AX 1I4RA 5DM63 3A7LA 4DR3Q 2ZTDA 3MEFA 1EU4A 1CZWA 3STBC 4JG2A 5IP7G 3PIPA 1NJIC 1PFSA 2PO4A 1IKLA 5KNCA 1WCMB 1DYQA 2FJ2A 4HJ7A 4L5TA 2MPMA 4A3MG 4ODGA 2R92H 2JE6I 1BDOA 4DK3C 1ZEQX 4A3CH 2XTIA 3W1GA 1SAPA 2AQ3B 4JI8Q 1LTBD 1SRUA 3IL8A 3BDCA 1TWFB 5I9OA 4C3HB 1EYDA 2RDHA 3T13A 2L55A 2MQHA 3PSIA 1VQEA 5CR3A 5FOBB 3KYHC 2GA4B 2NWGA 2XIWA 1XMQQ 4NXMQ 5C3EG 2NVYB 1RKNA 4DNRB 5LHY1 1TVXA 3JAML 4C3IB 3HOXB 2NB0A 1EQVA 2L9HA 1EIFA 4A76A 3NE5B 2K1BA 2E5LL 3T16A 1D5MC 1MD2D 3SVMA 4F88A 4A3JB 3D0FA 3MHBA 4WORA 4DR5L 3B6YA 2EZVA 4CBVA 1XXGA 1EWIA 4U68A 1JORA 3HKZG 1F9PA 2N3SA 3J7YW 5IT9c 4DV6L 2VS1A 5C0XH 3NEMA 4R4TA 5HGQA 2CHBD 3GQBA 3RZOH 1SLJA 1SXTA 2B2TA 4A3EG 1RIPA 5K5PA 2R7FA 1EWHA 4M1UB 4RKLA 3VYTA 1VQBA 2PQEA 5EBDA 2HCCA 1Q86C 1SJHD 3T51B 2VNUD 2H1EA 2XN9C 3P1HA 5ELDA 2PZTA 2F0GA 2HD3A 2WIIB 1NNXA 3OIQA 1PVOA 1EL0A 3PIO3 1M1KC 2FFKB 1CQFA 4CDFC 5JAVA 2ATWA 2LMCB 1C48A 1PTOC 4MN3A 1Z47A 2KOLA 1EIGA 1YEZA 3I70A 1EIHA 4LK1C 1N33Q 4X65Q 2NN6I 4XYOA 4R8IA 2RDGA 4OL7A 4WJWA 3AMUA 3E5SA 3EBEA 2A6HC 2NTTA 4C56C 1JOKA 2XSCA 2ID0A 5E4XA 2Q8TA 3RZDH 2L5TA 3Q0AA 1G51A 4A3FG 4FXGC 1R9TB 1GHKA 2Z9HA 4NB3A 4DA2A 4DR6L 3TP5A 4HAEA 5FJ8G 4HCSA 3S1QB 1TIID 1BR9A 4DV3L 4O42A 4IFDI 3NK9A 2A6HD 2Z6KC 4DUZQ 3AFPA
chains in the Genus database with same CATH topology
2QEXA 4BA1I 4P71A 1YHBA 5C44H 4L5RC 1IBLL 1UE5A 3GTLH 2R93G 3J81i 3TQYA 5GAGC 1JB7A 4LF7Q 3SGIA 3E9IA 3L0OA 4FDBA 4DAYB 1VQ4A 2BA0A 4C3IH 3HOXH 1D8LA 2AWNA 1X55A 3FKIG 2K75A 1FGUA 4GN3B 2V1CC 3BJUA 1X56A 1YHAA 4X62L 3F2BA 4LFCQ 1UE1A 3CD6A 3HFZB 1BVSA 3TRZA 3CQZH 2VL6A 3E9HA 1FJGL 1XPUA 3STBD 3CCUA 1WCMG 1Q1EA 1VCIA 1VQCA 2MO1A 1PYSB 3D31A 5GQOA 4A3EH 4A3JH 1NE3A 2F4VL 3I4NG 5C4XG 1CKMA 1HZCA 1CKNB 2OCEA 2R7ZH 3HOUH 2K50A 4P75A 2KCTA 1J5EL 3J81c 1L2FA 2JK8A 1B70B 3S24A 2WB1G 1X3GA 2NVTH 2E8GA 2NVQH 1SR3A 1X3FA 3KF6A 3Q8DA 2ALYB 1A8VA 1BBWA 1VQHA 2DGYA 1PH9A 3S14H 1PH6A 2XGTA 5M3FH 1X65A 4GNXC 4JV5Q 1HNZQ 2N8NA 4DV2Q 1K0RA 5M5WH 3L2PA 3I55A 1QVFA 5IE8A 2I5LX 4YWKA 2A8VA 2PI2E 4X64L 1PA6A 4LF9Q 4KLKA 2Y0SG 3ERSX 3W1BA 3PIOA 4YHHQ 2VQEQ 1X9NA 4WJ4A 1VQPA 3K7AH 1VQ6A 5C44G 1XNRL 1RL2A 3PO3H 3M85A 2UXCQ 4LF5Q 2OWOA 4HJAA 1OXSC 4A93H 1Q8KA 3FP9A 3M4PA 4DPGA 2WFWA 5FLMH 4MZ9A 4TVAB 3HOXG 3I7FA 3KFUA 1I6HH 1M90C 2OTJA 5LMNL 1HR0W 3TS0A 3I4MH 2UUAQ 4PZ7A 4X65L 1IL2A 2HHHQ 4B3SQ 2OQ0A 2UU9L 3RLOA 1YBYA 5IWAL 1YITA 1YHQA 3BU2A 4A3JG 3KDFA 1GKHA 4GNXB 3UE0A 4BXXH 1MKHA 2K4KA 3K80C 1YJNA 3OTOQ 4B3ML 3HOUG 4HIDA 3RR5A 2RCNA 1ASZA 3GTKH 2WP8J 2PQAA 1PH1A 2IHFA 2JA9A 3PF4A 1KIXA 4AYBE 1GD7A 3BZCA 2N49A 3OYYA 1KXLA 1IBMQ 4DR4Q 2VY3A 2C35B 4DV5Q 1PH7A 2K52A 5FJ8H 1VQOA 4LF8Q 4JI3L 4DR1Q 2NN6G 3PUVA 4LFAQ 3KJOA 4HIKA 5M3FG 2JEAI 4H02A 2MO0A 4IJLA 4B3TQ 3RLFA 4DR3L 3W5OA 1MIUA 4JC0A 4JBJA 1V43A 4GKJQ 4BA2I 5AJ3Q 4DUYL 4TQUS 3PO3G 5IYBH 3F1ZA 4OX9Q 4HIMA 3PUWA 4L5SA 2HT1A 1E24A 4QIWE 3E0EA 3OW2A 1P8LA 4DUZL 2A19A 1PH8A 3HOYG 5FLMG 1KD1C 3S1QH 2I0QA 3I4MG 2UUCQ 1AE3A 5ELOA 4UPAA 5M5XH 3UDXA 1G6PA 1UEBA 5IYCH 4LF7L 1EYGA 4DR5Q 3TS2A 1NMGA 2PNHA 1YJWA 1S40A 2GVAA 2K5VA 1VQFA 5M3MH 1QUQB 5LMNW 4BXXG 4JI8L 2MFIA 5LMUQ 3FHWA 1N36L 4GKKQ 4LFCL 3S1NH 4DV7Q 5GAHC 2YTYA 3GDEA 1BBUA 2K14A 2VUMH 4DR7Q 4IFDG 4YWMA 3U50C 5IYDH 3DLLA 4R4CA 4LWCA 5C0XJ 4HIOA 2AHOB 5IY0A 3RNUA 3HOVH 3RN2A 1L1OB 1KL9A 3M9BA 4DAMA 3CCEA 4POGA 4PZ6A 1KQSA 3GTMH 4L5QA 4LUZA 1LYLA 4IPHA 4BBSH 2NVXH 1N8RC 3J7A5 5C4JH 2IT1A 3A74A 3CC2A 2VQFL 4JI1Q 3CCLA 1I3QH 2OQKA 1VQAA 2YYZA 3ER0A 4J15A 1S3OA 1VQJA 4DV0Q 5M5YH 1N34Q 4K0KQ 3PV0A 1HR0L 1PYBA 1XTDA 2NVYH 1HNZL 1X54A 2CWAA 5IYBG 2AKWB 4R1JA 4JBMA 3S17H 4LF9L 2CWPA 2D62A 3TEHB 2VQEL 1E1OA 2JJQA 3K7UC 5FLXc 3H3VI 1V9PA 4JCVE 2PI2A 3AFQA 2LSSA 5IYCG 3HKZE 4OWTB 4HJ9A 1YNXA 4LF5L 1XNQQ 3GTOH 1Y1VH 4A4IA 3G48A 1XPRA 4JI5Q 2B63H 4XTCS 5M3MG 4OWXB 4X66L 2UUAL 5BR8Q 4GLVB 3T1YQ 2HHHL 2VUMG 2EXDA 2KCMA 2UUBQ 1LTLA 5IYDG 1E3PA 1KHIA 2KENA 4DR2Q 5E7NA 4DV1Q 1OXTA 1Q7YC 3AQQA 1MJEA 4IOCA 3HOVG 2ZJRA 1HNXL 1PHJA 1JJCB 2AMCB 1HNWQ 1NY4A 4JBWA 2ZJPA 4IPCA 3KJPA 4JI6Q 1GO3E 4BBSG 1VQMA 1VQ8A 4IJHA 1KC8C 4JOIC 1CSQA 1QUQA 4GOPC 1SROA 3G6EA 4HJ8A 4RMFA 3WWVA 1IBML 4DR4L 2BA1A 4OWWB 3CCRA 4DR6Q 3JAMi 4DV5L 4OONA 3U58A 2ASBA 2EIFA 4LF8L 4ALPA 1YI2A 1T9HA 2I5MX 1I94Q 2E2JH 5IP9H 4ME3A 1AE2A 4LF4Q 4LFAL 1L1OA 1N32Q 1Q82C 2KHIA 4A3KH 1Q1BA 2JQOA 4B3TL 3I2ZA 4A3GH 1Z9FA 4IOAA 4JI2Q 1EQQA 3HOYH 1NMFA 4GKJL 4LUVA 2MNAA 1JT8A 2Q2TA 3PGZA 1N33L 5H1SE 3I4OA 4MNOA 4C2MH 4OX9L 4BY7H 1Y1VG 1PH3A 4AQYL 4PZ8A 2YTXA 4HJ5A 1SMXA 4BBRH 1XMOL 4JI0Q 2B63G 1TWGH 3JAMc 1A0IA 1PH4A 4GOPB 4YY3L 1LM0A 1K3RA 2UUCL 3L7ZC 4A3DH 2JA7G 4X62Q 3UDGA 2OTLA 2UXBQ 1VQ5A 2VZAA 4QY7A 4YWLA 2HIVA 4LNQA 3HOZH 3F2DA 1G291 2E2IH 2NZHA 3CPWA 2HIXA 2WAQE 1UE7A 4EX5A 1VQLA 1VQGA 4GN4B 4PG3A 3GTQH 3J80i 4APVA 4DV7L 4QGUA 4GKKL 5JEAG 1XJVA 4DR7L 4KHPQ 1J5EQ 5JJLA 3U4ZA 2Z0SA 3NELA 4JI7Q 2UXDQ 1KRSA 1PH2A 2KBNA 1E1TA 3PO2H 1CKNA 2D0OA 2JA8H 1P16A 3GTJH 3M3YH 4JI4L 2YV5A 2Z6KA 1O7IA 3PUZA 4DK6C 1L0WA 3H3VH 2K5NA 1S72A 1K73C 5K36G 3CC4A 1NBWA 3PF5A 1R9TH 1Y1WH 5IP9G 1N9WA 2Q2IA 2E5LQ 2YTVA 4JI1L 4A3KG 4A3GG 1JJGA 3CF5A 1WOCA 1N34L 1KRTA 5J3BA 4LFBQ 4K0KL 1B8AA 4JYAQ 3S1MH 4NPSA 1Y14B 5GADC 4P72A 4B3RQ 1VQDA 1TXYA 1E7ZA 3ULPA 2RHQB 3HOWH 5IP7H 4BY7G 1Q81C 4DV4Q 1CKOA 4BBRG 1X3EA 1HZAA 2EQSA 3ULLA 3GTPH 1D7QA 2VW9A 2JEBI 4A3DG 3T1HQ 1ASYA 4LF6Q 3ICEA 4A3BH 2IY5B 3GD7A 1UWVA 2ES2A 4A3MH 1KAWA 3H15A 2HQLA 4DV6Q 1XNQL 5IWAQ 4GLXA 1C9OA 3HOZG 1C0AA 4JI5L 3MXNB 1OXVA 3CPFA 3JC66 3F8TA 4AH6A 1VQNA 2WB1E 4MTNA 3RN5A 3T1YL 4B3MQ 4DNIA 2ZM6Q 3CC7A 3KF6B 2IHEA 1K8GA 2UUBL 1W2BA 4IFDJ 4OXPA 4A3LH 1SN8A 4GNXA 4UP9A 3PO2G 1B7YB 2JA8G 1IBKQ 1HJPA 4NXNQ 4OO1I 4AIMA 4GS3A 2IX1A 4LUOA 4AYBG 4JI6L 3BZKA 1Y1WG 3K8AA 4JI3Q 5DLQE 3RLNA 4UP8A 4QJFA 4GN5A 4JV5L 2Y0SE 2R6GA 4DV2L 3LGJA 5C0XI 1WFQA 5C3EH 1WYDA 4DR3Q 1OXUA 2ZTDA 4POFA 4BY1G 4A3IH 3MEFA 4YHHL 1VS0A 2ZTCA 2JA6H 3K0XA 3STBC 2RF4A 4WJ3M 3S15H 1QZHA 1SE8A 4JG2A 5IP7G 2GVBA 3HOWG 3H0GH 3PIPA 1NJIC 4YCUA 5GAEC 2F4VQ 3AEVA 4JI2L 1PFSA 1PH5A 1OXXK 2JA7H 4JBKA 4HJ7A 3GTGH 3S16H 4A3BG 4L5TA 3KDFB 1WI5A 3ZJYC 2H5XA 4A3MG 4B3SL 4O2DA 2JE6I 1I50H 2R92H 4DK3C 1E22A 1VQIA 1H95A 4JI0L 5HY6A 3K81C 2PQAB 4A3CH 2XTIA 3W1GA 2AWOA 3OTOL 4JI8Q 1U5KA 1SRUA 2CKZB 2LXKA 4GLAC 1N36Q 2UXBL 4A3LG 2ZJQA 2E2HH 1JJ2A 2JA5H 3M7NA 3CCQA 3G4SA 2MQHA 1C7YA 2DUDA 2B3GA 3PSIA 1VQEA 3EN2A 3IRBA 3M4QA 2IX0A 3ULJA 2KHJA 4KHPL 3KYHC 4DR1L 4JI7L 1AH9A 4XIGS 4R4OA 1K9MC 4DV3Q 3I56A 1XMQQ 3S2HH 3CCMA 1TWCH 1A63A 1EIYB 2VQFQ 4NXMQ 5C3EG 1DGSA 4RG1A 1XPOA 3UDFA 1MJCA 1CUKA 4A3IG 2JA6G 5AJ3L 3G71A 3CCSA 4Y7NH 1QZGA 1HR0Q 2CQOA 1LUZA 1IBLQ 4A76A 2E5LL 1EIFA 1EOVA 5JJKA 3H0GG 1IXRA 1FVIA 4R4QA 3KOJA 3PUYA 3CW2C 2NZOA 1NTGA 4LFBL 3CCVA 4JYAL 2QGQA 1OTCA 4B3RL 1Q46A 3D0FA 3A5UA 4YCWA 3UDIA 1EUJA 3KF8B 4R4IA 2R92G 2R7DA 3B6YA 4PMWA 4DR5L 1IZ6A 4DV4L 3A0JA 1YIJA 1FJGQ 1EWIA 2BH8A 4A3CG 4UP7A 3CXCA 3HKZG 5LMUL 1TWHH 2N3SA 3T1HL 4X66Q 4LF6L 1YJ9A 1JE5A 3S1RH 3AYHB 5IT9c 4DV6L 2VS1A 2JA5G 3NEMA 4R4TA 4A75A 4KI0A 5HGQA 3GO5A 3RZOH 1VQ7A 1SLJA 4X6AH 4A3EG 2BH2A 3PUXA 1HNXQ 1RIPA 1QVGA 2R7FA 1EFWA 2YU9H 2B29A 2R7ZG 2RHSB 2F52A 5JEAJ 2FXQA 2ZM6L 2GN5A 1VQBA 1GVPA 1Q12A 2N78A 4A3FH 1SFOH 2UXDL 1IBKL 1QVCA 1Q86C 4NXNL 1HZ9A 2VNUD 4DKAC 3J81j 4DV0L 2ZTEA 4BY1H 2F3IA 4X64Q 1VQKA 3J80c 1PVOA 1XNRQ 5JJIA 1J6QA 1K8AC 1M1KC 3VDYA 3A5ZB 1V1QA 4LW1A 5EAYA 3KLWA 1X6OA 3U4VA 2ATWA 1GM5A 1Z47A 1YVCA 3CP0A 4P74A 4QL5A 5LMNQ 1YEZA 2LXJA 1N33Q 4X65Q 3M4OH 2R93H 3EIVA 1L1OC 3DM3A 2NN6I 3HKSA 5ELNA 3F2CA 2UU9Q 4IPDA 3CMEA 4AQYQ 4OO1G 1XMOQ 4UY8C 1HZBA 3FKIH 2CFMA 3J7ZC 4YY3Q 5BR8L 1TWAH 3EBEA 2I5HA 3UE1A 1U0LA 1WJJA 3TREA 3NENA 4DR2L 1W3SA 1UE6A 4JOIA 4DV1L 4GOPA 1PV4A 5C0XG 2ID0A 4KHZA 1A62A 1WCMH 2CCZA 2Q2UA 3I4NH 5C4XH 4O0AA 3RZDH 1HNWL 1YZ6A 4P73A 2K5HA 1FL0A 1G51A 2L15A 1IYJB 1EQRA 4IO9A 2WAQG 2QA4A 2A1AA 4A3FG 2D0PA 4EQ5A 4NB3A 4DR6L 3S2DH 4JI4Q 1VQ9A 1K83H 1TWFH 2PMZE 4C3JH 4C3HH 4QQBX 3CAMA 3NBHB 5FJ8G 1I94L 3PCOB 4LF4L 4DUYQ 4DV3L 1N32L 1CSPA 1XMQL 4IFDI 1HH2P 4A93G 2UXCL 5GROA 4YCVA 3CCJA 1I5FA 4NXML 4IPGA 3CMAA 1JMCA 2Z6KC 4Y52H 1BKBA 4DUZQ 3AFPA 2Q2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX A;  4BA1 I;  4P71 A;  1YHB A;  5C44 H;  4L5R C;  1IBL L;  1UE5 A;  3GTL H;  2R93 G;  3J81 i;  3TQY A;  5GAG C;  1JB7 A;  4LF7 Q;  3SGI A;  3E9I A;  3L0O A;  4FDB A;  4DAY B;  1VQ4 A;  2BA0 A;  4C3I H;  3HOX H;  1D8L A;  2AWN A;  1X55 A;  3FKI G;  2K75 A;  1FGU A;  4GN3 B;  2V1C C;  3BJU A;  1X56 A;  1YHA A;  4X62 L;  3F2B A;  4LFC Q;  1UE1 A;  3CD6 A;  3HFZ B;  1BVS A;  3TRZ A;  3CQZ H;  2VL6 A;  3E9H A;  1FJG L;  1XPU A;  3STB D;  3CCU A;  1WCM G;  1Q1E A;  1VCI A;  1VQC A;  2MO1 A;  1PYS B;  3D31 A;  5GQO A;  4A3E H;  4A3J H;  1NE3 A;  2F4V L;  3I4N G;  5C4X G;  1CKM A;  1HZC A;  1CKN B;  2OCE A;  2R7Z H;  3HOU H;  2K50 A;  4P75 A;  2KCT A;  1J5E L;  3J81 c;  1L2F A;  2JK8 A;  1B70 B;  3S24 A;  2WB1 G;  1X3G A;  2NVT H;  2E8G A;  2NVQ H;  1SR3 A;  1X3F A;  3KF6 A;  3Q8D A;  2ALY B;  1A8V A;  1BBW A;  1VQH A;  2DGY A;  1PH9 A;  3S14 H;  1PH6 A;  2XGT A;  5M3F H;  1X65 A;  4GNX C;  4JV5 Q;  1HNZ Q;  2N8N A;  4DV2 Q;  1K0R A;  5M5W H;  3L2P A;  3I55 A;  1QVF A;  5IE8 A;  2I5L X;  4YWK A;  2A8V A;  2PI2 E;  4X64 L;  1PA6 A;  4LF9 Q;  4KLK A;  2Y0S G;  3ERS X;  3W1B A;  3PIO A;  4YHH Q;  2VQE Q;  1X9N A;  4WJ4 A;  1VQP A;  3K7A H;  1VQ6 A;  5C44 G;  1XNR L;  1RL2 A;  3PO3 H;  3M85 A;  2UXC Q;  4LF5 Q;  2OWO A;  4HJA A;  1OXS C;  4A93 H;  1Q8K A;  3FP9 A;  3M4P A;  4DPG A;  2WFW A;  5FLM H;  4MZ9 A;  4TVA B;  3HOX G;  3I7F A;  3KFU A;  1I6H H;  1M90 C;  2OTJ A;  5LMN L;  1HR0 W;  3TS0 A;  3I4M H;  2UUA Q;  4PZ7 A;  4X65 L;  1IL2 A;  2HHH Q;  4B3S Q;  2OQ0 A;  2UU9 L;  3RLO A;  1YBY A;  5IWA L;  1YIT A;  1YHQ A;  3BU2 A;  4A3J G;  3KDF A;  1GKH A;  4GNX B;  3UE0 A;  4BXX H;  1MKH A;  2K4K A;  3K80 C;  1YJN A;  3OTO Q;  4B3M L;  3HOU G;  4HID A;  3RR5 A;  2RCN A;  1ASZ A;  3GTK H;  2WP8 J;  2PQA A;  1PH1 A;  2IHF A;  2JA9 A;  3PF4 A;  1KIX A;  4AYB E;  1GD7 A;  3BZC A;  2N49 A;  3OYY A;  1KXL A;  1IBM Q;  4DR4 Q;  2VY3 A;  2C35 B;  4DV5 Q;  1PH7 A;  2K52 A;  5FJ8 H;  1VQO A;  4LF8 Q;  4JI3 L;  4DR1 Q;  2NN6 G;  3PUV A;  4LFA Q;  3KJO A;  4HIK A;  5M3F G;  2JEA I;  4H02 A;  2MO0 A;  4IJL A;  4B3T Q;  3RLF A;  4DR3 L;  3W5O A;  1MIU A;  4JC0 A;  4JBJ A;  1V43 A;  4GKJ Q;  4BA2 I;  5AJ3 Q;  4DUY L;  4TQU S;  3PO3 G;  5IYB H;  3F1Z A;  4OX9 Q;  4HIM A;  3PUW A;  4L5S A;  2HT1 A;  1E24 A;  4QIW E;  3E0E A;  3OW2 A;  1P8L A;  4DUZ L;  2A19 A;  1PH8 A;  3HOY G;  5FLM G;  1KD1 C;  3S1Q H;  2I0Q A;  3I4M G;  2UUC Q;  1AE3 A;  5ELO A;  4UPA A;  5M5X H;  3UDX A;  1G6P A;  1UEB A;  5IYC H;  4LF7 L;  1EYG A;  4DR5 Q;  3TS2 A;  1NMG A;  2PNH A;  1YJW A;  1S40 A;  2GVA A;  2K5V A;  1VQF A;  5M3M H;  1QUQ B;  5LMN W;  4BXX G;  4JI8 L;  2MFI A;  5LMU Q;  3FHW A;  1N36 L;  4GKK Q;  4LFC L;  3S1N H;  4DV7 Q;  5GAH C;  2YTY A;  3GDE A;  1BBU A;  2K14 A;  2VUM H;  4DR7 Q;  4IFD G;  4YWM A;  3U50 C;  5IYD H;  3DLL A;  4R4C A;  4LWC A;  5C0X J;  4HIO A;  2AHO B;  5IY0 A;  3RNU A;  3HOV H;  3RN2 A;  1L1O B;  1KL9 A;  3M9B A;  4DAM A;  3CCE A;  4POG A;  4PZ6 A;  1KQS A;  3GTM H;  4L5Q A;  4LUZ A;  1LYL A;  4IPH A;  4BBS H;  2NVX H;  1N8R C;  3J7A 5;  5C4J H;  2IT1 A;  3A74 A;  3CC2 A;  2VQF L;  4JI1 Q;  3CCL A;  1I3Q H;  2OQK A;  1VQA A;  2YYZ A;  3ER0 A;  4J15 A;  1S3O A;  1VQJ A;  4DV0 Q;  5M5Y H;  1N34 Q;  4K0K Q;  3PV0 A;  1HR0 L;  1PYB A;  1XTD A;  2NVY H;  1HNZ L;  1X54 A;  2CWA A;  5IYB G;  2AKW B;  4R1J A;  4JBM A;  3S17 H;  4LF9 L;  2CWP A;  2D62 A;  3TEH B;  2VQE L;  1E1O A;  2JJQ A;  3K7U C;  5FLX c;  3H3V I;  1V9P A;  4JCV E;  2PI2 A;  3AFQ A;  2LSS A;  5IYC G;  3HKZ E;  4OWT B;  4HJ9 A;  1YNX A;  4LF5 L;  1XNQ Q;  3GTO H;  1Y1V H;  4A4I A;  3G48 A;  1XPR A;  4JI5 Q;  2B63 H;  4XTC S;  5M3M G;  4OWX B;  4X66 L;  2UUA L;  5BR8 Q;  4GLV B;  3T1Y Q;  2HHH L;  2VUM G;  2EXD A;  2KCM A;  2UUB Q;  1LTL A;  5IYD G;  1E3P A;  1KHI A;  2KEN A;  4DR2 Q;  5E7N A;  4DV1 Q;  1OXT A;  1Q7Y C;  3AQQ A;  1MJE A;  4IOC A;  3HOV G;  2ZJR A;  1HNX L;  1PHJ A;  1JJC B;  2AMC B;  1HNW Q;  1NY4 A;  4JBW A;  2ZJP A;  4IPC A;  3KJP A;  4JI6 Q;  1GO3 E;  4BBS G;  1VQM A;  1VQ8 A;  4IJH A;  1KC8 C;  4JOI C;  1CSQ A;  1QUQ A;  4GOP C;  1SRO A;  3G6E A;  4HJ8 A;  4RMF A;  3WWV A;  1IBM L;  4DR4 L;  2BA1 A;  4OWW B;  3CCR A;  4DR6 Q;  3JAM i;  4DV5 L;  4OON A;  3U58 A;  2ASB A;  2EIF A;  4LF8 L;  4ALP A;  1YI2 A;  1T9H A;  2I5M X;  1I94 Q;  2E2J H;  5IP9 H;  4ME3 A;  1AE2 A;  4LF4 Q;  4LFA L;  1L1O A;  1N32 Q;  1Q82 C;  2KHI A;  4A3K H;  1Q1B A;  2JQO A;  4B3T L;  3I2Z A;  4A3G H;  1Z9F A;  4IOA A;  4JI2 Q;  1EQQ A;  3HOY H;  1NMF A;  4GKJ L;  4LUV A;  2MNA A;  1JT8 A;  2Q2T A;  3PGZ A;  1N33 L;  5H1S E;  3I4O A;  4MNO A;  4C2M H;  4OX9 L;  4BY7 H;  1Y1V G;  1PH3 A;  4AQY L;  4PZ8 A;  2YTX A;  4HJ5 A;  1SMX A;  4BBR H;  1XMO L;  4JI0 Q;  2B63 G;  1TWG H;  3JAM c;  1A0I A;  1PH4 A;  4GOP B;  4YY3 L;  1LM0 A;  1K3R A;  2UUC L;  3L7Z C;  4A3D H;  2JA7 G;  4X62 Q;  3UDG A;  2OTL A;  2UXB Q;  1VQ5 A;  2VZA A;  4QY7 A;  4YWL A;  2HIV A;  4LNQ A;  3HOZ H;  3F2D A;  1G29 1;  2E2I H;  2NZH A;  3CPW A;  2HIX A;  2WAQ E;  1UE7 A;  4EX5 A;  1VQL A;  1VQG A;  4GN4 B;  4PG3 A;  3GTQ H;  3J80 i;  4APV A;  4DV7 L;  4QGU A;  4GKK L;  5JEA G;  1XJV A;  4DR7 L;  4KHP Q;  1J5E Q;  5JJL A;  3U4Z A;  2Z0S A;  3NEL A;  4JI7 Q;  2UXD Q;  1KRS A;  1PH2 A;  2KBN A;  1E1T A;  3PO2 H;  1CKN A;  2D0O A;  2JA8 H;  1P16 A;  3GTJ H;  3M3Y H;  4JI4 L;  2YV5 A;  2Z6K A;  1O7I A;  3PUZ A;  4DK6 C;  1L0W A;  3H3V H;  2K5N A;  1S72 A;  1K73 C;  5K36 G;  3CC4 A;  1NBW A;  3PF5 A;  1R9T H;  1Y1W H;  5IP9 G;  1N9W A;  2Q2I A;  2E5L Q;  2YTV A;  4JI1 L;  4A3K G;  4A3G G;  1JJG A;  3CF5 A;  1WOC A;  1N34 L;  1KRT A;  5J3B A;  4LFB Q;  4K0K L;  1B8A A;  4JYA Q;  3S1M H;  4NPS A;  1Y14 B;  5GAD C;  4P72 A;  4B3R Q;  1VQD A;  1TXY A;  1E7Z A;  3ULP A;  2RHQ B;  3HOW H;  5IP7 H;  4BY7 G;  1Q81 C;  4DV4 Q;  1CKO A;  4BBR G;  1X3E A;  1HZA A;  2EQS A;  3ULL A;  3GTP H;  1D7Q A;  2VW9 A;  2JEB I;  4A3D G;  3T1H Q;  1ASY A;  4LF6 Q;  3ICE A;  4A3B H;  2IY5 B;  3GD7 A;  1UWV A;  2ES2 A;  4A3M H;  1KAW A;  3H15 A;  2HQL A;  4DV6 Q;  1XNQ L;  5IWA Q;  4GLX A;  1C9O A;  3HOZ G;  1C0A A;  4JI5 L;  3MXN B;  1OXV A;  3CPF A;  3JC6 6;  3F8T A;  4AH6 A;  1VQN A;  2WB1 E;  4MTN A;  3RN5 A;  3T1Y L;  4B3M Q;  4DNI A;  2ZM6 Q;  3CC7 A;  3KF6 B;  2IHE A;  1K8G A;  2UUB L;  1W2B A;  4IFD J;  4OXP A;  4A3L H;  1SN8 A;  4GNX A;  4UP9 A;  3PO2 G;  1B7Y B;  2JA8 G;  1IBK Q;  1HJP A;  4NXN Q;  4OO1 I;  4AIM A;  4GS3 A;  2IX1 A;  4LUO A;  4AYB G;  4JI6 L;  3BZK A;  1Y1W G;  3K8A A;  4JI3 Q;  5DLQ E;  3RLN A;  4UP8 A;  4QJF A;  4GN5 A;  4JV5 L;  2Y0S E;  2R6G A;  4DV2 L;  3LGJ A;  5C0X I;  1WFQ A;  5C3E H;  1WYD A;  4DR3 Q;  1OXU A;  2ZTD A;  4POF A;  4BY1 G;  4A3I H;  3MEF A;  4YHH L;  1VS0 A;  2ZTC A;  2JA6 H;  3K0X A;  3STB C;  2RF4 A;  4WJ3 M;  3S15 H;  1QZH A;  1SE8 A;  4JG2 A;  5IP7 G;  2GVB A;  3HOW G;  3H0G H;  3PIP A;  1NJI C;  4YCU A;  5GAE C;  2F4V Q;  3AEV A;  4JI2 L;  1PFS A;  1PH5 A;  1OXX K;  2JA7 H;  4JBK A;  4HJ7 A;  3GTG H;  3S16 H;  4A3B G;  4L5T A;  3KDF B;  1WI5 A;  3ZJY C;  2H5X A;  4A3M G;  4B3S L;  4O2D A;  2JE6 I;  1I50 H;  2R92 H;  4DK3 C;  1E22 A;  1VQI A;  1H95 A;  4JI0 L;  5HY6 A;  3K81 C;  2PQA B;  4A3C H;  2XTI A;  3W1G A;  2AWO A;  3OTO L;  4JI8 Q;  1U5K A;  1SRU A;  2CKZ B;  2LXK A;  4GLA C;  1N36 Q;  2UXB L;  4A3L G;  2ZJQ A;  2E2H H;  1JJ2 A;  2JA5 H;  3M7N A;  3CCQ A;  3G4S A;  2MQH A;  1C7Y A;  2DUD A;  2B3G A;  3PSI A;  1VQE A;  3EN2 A;  3IRB A;  3M4Q A;  2IX0 A;  3ULJ A;  2KHJ A;  4KHP L;  3KYH C;  4DR1 L;  4JI7 L;  1AH9 A;  4XIG S;  4R4O A;  1K9M C;  4DV3 Q;  3I56 A;  1XMQ Q;  3S2H H;  3CCM A;  1TWC H;  1A63 A;  1EIY B;  2VQF Q;  4NXM Q;  5C3E G;  1DGS A;  4RG1 A;  1XPO A;  3UDF A;  1MJC A;  1CUK A;  4A3I G;  2JA6 G;  5AJ3 L;  3G71 A;  3CCS A;  4Y7N H;  1QZG A;  1HR0 Q;  2CQO A;  1LUZ A;  1IBL Q;  4A76 A;  2E5L L;  1EIF A;  1EOV A;  5JJK A;  3H0G G;  1IXR A;  1FVI A;  4R4Q A;  3KOJ A;  3PUY A;  3CW2 C;  2NZO A;  1NTG A;  4LFB L;  3CCV A;  4JYA L;  2QGQ A;  1OTC A;  4B3R L;  1Q46 A;  3D0F A;  3A5U A;  4YCW A;  3UDI A;  1EUJ A;  3KF8 B;  4R4I A;  2R92 G;  2R7D A;  3B6Y A;  4PMW A;  4DR5 L;  1IZ6 A;  4DV4 L;  3A0J A;  1YIJ A;  1FJG Q;  1EWI A;  2BH8 A;  4A3C G;  4UP7 A;  3CXC A;  3HKZ G;  5LMU L;  1TWH H;  2N3S A;  3T1H L;  4X66 Q;  4LF6 L;  1YJ9 A;  1JE5 A;  3S1R H;  3AYH B;  5IT9 c;  4DV6 L;  2VS1 A;  2JA5 G;  3NEM A;  4R4T A;  4A75 A;  4KI0 A;  5HGQ A;  3GO5 A;  3RZO H;  1VQ7 A;  1SLJ A;  4X6A H;  4A3E G;  2BH2 A;  3PUX A;  1HNX Q;  1RIP A;  1QVG A;  2R7F A;  1EFW A;  2YU9 H;  2B29 A;  2R7Z G;  2RHS B;  2F52 A;  5JEA J;  2FXQ A;  2ZM6 L;  2GN5 A;  1VQB A;  1GVP A;  1Q12 A;  2N78 A;  4A3F H;  1SFO H;  2UXD L;  1IBK L;  1QVC A;  1Q86 C;  4NXN L;  1HZ9 A;  2VNU D;  4DKA C;  3J81 j;  4DV0 L;  2ZTE A;  4BY1 H;  2F3I A;  4X64 Q;  1VQK A;  3J80 c;  1PVO A;  1XNR Q;  5JJI A;  1J6Q A;  1K8A C;  1M1K C;  3VDY A;  3A5Z B;  1V1Q A;  4LW1 A;  5EAY A;  3KLW A;  1X6O A;  3U4V A;  2ATW A;  1GM5 A;  1Z47 A;  1YVC A;  3CP0 A;  4P74 A;  4QL5 A;  5LMN Q;  1YEZ A;  2LXJ A;  1N33 Q;  4X65 Q;  3M4O H;  2R93 H;  3EIV A;  1L1O C;  3DM3 A;  2NN6 I;  3HKS A;  5ELN A;  3F2C A;  2UU9 Q;  4IPD A;  3CME A;  4AQY Q;  4OO1 G;  1XMO Q;  4UY8 C;  1HZB A;  3FKI H;  2CFM A;  3J7Z C;  4YY3 Q;  5BR8 L;  1TWA H;  3EBE A;  2I5H A;  3UE1 A;  1U0L A;  1WJJ A;  3TRE A;  3NEN A;  4DR2 L;  1W3S A;  1UE6 A;  4JOI A;  4DV1 L;  4GOP A;  1PV4 A;  5C0X G;  2ID0 A;  4KHZ A;  1A62 A;  1WCM H;  2CCZ A;  2Q2U A;  3I4N H;  5C4X H;  4O0A A;  3RZD H;  1HNW L;  1YZ6 A;  4P73 A;  2K5H A;  1FL0 A;  1G51 A;  2L15 A;  1IYJ B;  1EQR A;  4IO9 A;  2WAQ G;  2QA4 A;  2A1A A;  4A3F G;  2D0P A;  4EQ5 A;  4NB3 A;  4DR6 L;  3S2D H;  4JI4 Q;  1VQ9 A;  1K83 H;  1TWF H;  2PMZ E;  4C3J H;  4C3H H;  4QQB X;  3CAM A;  3NBH B;  5FJ8 G;  1I94 L;  3PCO B;  4LF4 L;  4DUY Q;  4DV3 L;  1N32 L;  1CSP A;  1XMQ L;  4IFD I;  1HH2 P;  4A93 G;  2UXC L;  5GRO A;  4YCV A;  3CCJ A;  1I5F A;  4NXM L;  4IPG A;  3CMA A;  1JMC A;  2Z6K C;  4Y52 H;  1BKB A;  4DUZ Q;  3AFP A;  2Q2H A; 
#chains in the Genus database with same CATH topology
 3NWT A;  2QEX A;  4BA1 I;  5C44 H;  3VR4 A;  1FGB D;  3TQY A;  4K8J A;  4K5X A;  5GAG C;  1JB7 A;  5IGC A;  4DAY B;  2X6L A;  2BA0 A;  3HOV B;  1RF2 D;  1GUG A;  1UE1 A;  1LTT D;  3HFZ B;  4ZAI A;  1FJG L;  1XPU A;  5FO8 B;  1WCM G;  1G2T A;  1VQC A;  3EFX D;  4A3E H;  1ESF A;  3K5O A;  4CHT B;  1I3Q B;  4DAV A;  3HOU H;  2K50 A;  2KCT A;  3V2T A;  2JK8 A;  3S24 A;  1QG7 A;  2NVT H;  1SR3 A;  2F3W A;  2CH4 W;  3E3X A;  4C3H G;  3S14 H;  2FHT A;  1X65 A;  1BUV T;  4JV5 Q;  1TU2 B;  2QIL A;  3BG3 A;  3GTO B;  2A8V A;  3BVM A;  2VQE Q;  3ERS X;  3PIO A;  4KK7 A;  3NBI A;  3AU7 A;  2OF1 A;  3M85 A;  2OWO A;  4C3I G;  1UAP A;  2WFW A;  3HOX G;  1CHP D;  2UUA Q;  4K8I A;  2SEB D;  1YBY A;  5IWA L;  1EY7 A;  1ENA A;  1Y69 U;  4K6L A;  1WTH A;  2KCC A;  5KRU A;  4A3J G;  3KDF A;  1MKH A;  2CW0 C;  4HID A;  3VYS A;  3MAQ A;  1ASZ A;  2WP8 J;  1MSG A;  3D4D A;  1KXL A;  3IKJ A;  1J9O A;  1RTN A;  5DM7 3;  2C35 B;  4DV5 Q;  4ZK9 B;  5FJ8 H;  4JI3 L;  2NN6 G;  3EJI A;  4FO2 A;  2Z1C A;  2JEA I;  4H02 A;  5KYI A;  3MVV A;  2MO0 A;  3R2I A;  1PRT F;  1EZ6 A;  4JPB W;  1ILQ A;  3W5O A;  1ICF B;  1MIU A;  3DHQ A;  1V43 A;  1PDQ A;  2F0J A;  4BA2 I;  4FF2 A;  2SOB A;  5IYB H;  2CW0 D;  1PMR A;  3PUW A;  4L5S A;  2IW3 A;  1KAA A;  4QIW E;  5T1I A;  1ML0 D;  1KD1 C;  4IUU A;  1HXY D;  3KBX A;  1EYC A;  5ELO A;  4UPA A;  2KA7 A;  1HUN A;  2FMC A;  3UDX A;  1G6P A;  4CKE A;  4LF7 L;  4DR5 Q;  1QOH A;  3SK8 A;  2PNH A;  1EEI D;  3KF8 A;  1VQF A;  3GP7 A;  1SSO A;  4ZUI A;  5IT9 E;  2MFI A;  4X3K A;  2YTY A;  5EGT A;  1BBU A;  4IFD G;  4JVZ A;  1PTO B;  5KND A;  4RGM A;  3I3C A;  4LWC A;  4HIO A;  4ULL A;  3TN2 A;  2HCI A;  4PZ6 A;  4XDX A;  4IPH A;  3KLS X;  2IT1 A;  3CCL A;  4K6D A;  1VQA A;  4J15 A;  1VQJ A;  1F2Y A;  4K0K Q;  2Z4H A;  1E0B A;  2DNC A;  1XX8 A;  3PV0 A;  3GTP B;  3EQL C;  1PYB A;  2PZU A;  1XTD A;  2NVY H;  5JPN C;  3D6W A;  2CWP A;  3BVZ A;  3MA2 B;  5FLX c;  4FP5 D;  4JCV E;  3AFQ A;  2LSS A;  5CGK A;  1YNX A;  4A4I A;  3BYT B;  2F0U A;  3I90 A;  3G6J B;  3OOC A;  2ENB A;  4XTC S;  1STN A;  1H9S B;  4N9T A;  4B9W A;  2KCM A;  1E3P A;  1KHI A;  5E7N A;  2IX3 A;  3HOV G;  4ID6 A;  1HCZ A;  1HNX L;  4FXK C;  1LTA D;  1CA6 A;  1JJC B;  2A68 C;  2K04 A;  4JBW A;  4IPC A;  3KJP A;  1VQM A;  1VQ8 A;  4IJH A;  5CV4 A;  4HJ8 A;  4DR4 L;  2BA1 A;  2F0E A;  4OWW B;  3CCR A;  4DR6 Q;  1UNS A;  2O2L D;  1WD1 A;  2ASB A;  1PFN A;  1YI2 A;  5IP9 H;  4LFA L;  1AE2 A;  1L1O A;  1R4Q B;  2CQA A;  2EYM A;  4LAA A;  3A8J E;  4B3T L;  2JQO A;  3NBH A;  4A3G H;  2R92 B;  4TKO B;  1V1O A;  3QG1 A;  2F0S A;  1NMF A;  4GKJ L;  4O1N A;  3SK6 A;  4AQY L;  2I07 B;  4DXG A;  2YTX A;  3N6R A;  1XMO L;  4BBR H;  4JI0 Q;  1A0I A;  1PH4 A;  4GOP B;  4YY3 L;  4FXD A;  4HCE A;  2OTL A;  4IFD H;  2VZA A;  3WOE A;  1YNJ D;  3R3O A;  3OMG A;  1UE7 A;  1VQG A;  4GKK L;  3J80 i;  4APV A;  2ZXO A;  4KHP Q;  1OO9 B;  2JA8 H;  1PFB A;  3HGB A;  3VR3 A;  3M3Y H;  2YV5 A;  4DK6 C;  2FIN B;  5K36 G;  3PF5 A;  1R9T H;  1Y1W H;  2Q2I A;  3K7A B;  4JI1 L;  1EFI D;  3CF5 A;  1N34 L;  1KRT A;  1B9M A;  4JYA Q;  1LAC A;  2K03 A;  3K6O A;  1EY4 A;  4B3R Q;  1VQD A;  1TXY A;  4V19 0;  2AQ1 B;  1ESR A;  1AEX A;  1CQV A;  1CI3 M;  4TRD A;  3R2T A;  2R61 A;  3RZO B;  3GD7 A;  3BVG A;  1SMY D;  5IWA Q;  1C9O A;  4YIJ A;  3MXN B;  5IIF A;  1PZI D;  1VQN A;  3T1Y L;  2ZM6 Q;  1ZKO A;  1SN8 A;  4GNX A;  1B7Y B;  1IBK Q;  1JWM D;  1I4X A;  2E76 C;  4AIM A;  4GS3 A;  1JC7 A;  1HFG A;  3I72 A;  4N8F A;  1EY0 A;  4JI3 Q;  3K8A A;  1KDB A;  5DNF A;  4QJF A;  3HRZ C;  1I4Q A;  2K7V A;  2F0L A;  5C0X I;  4IUR A;  1WFQ A;  1HRJ A;  1K8O A;  3P75 A;  4A3I H;  2EY1 A;  2JA6 H;  1BXT A;  1ROD A;  2C9O A;  1LAB A;  4RGO S;  1QZH A;  3LWE A;  2GVB A;  1AFP A;  3H0G H;  4K2L A;  1LT5 D;  3WOF A;  1PH5 A;  1OXX K;  5IGG A;  4JBK A;  5I2X A;  3ZJY C;  1WI5 A;  3RZD B;  4B3S L;  4O2D A;  5F2D A;  1I50 H;  4CKC A;  1VQI A;  1B50 A;  3K81 C;  2PQA B;  2WB1 B;  2AWO A;  5CV8 A;  4GLA C;  2CKZ B;  2LXK A;  2EXZ A;  3M7N A;  3AB9 A;  3CCQ A;  3M7G A;  1F2Z A;  2RCF A;  3MFY A;  5ISR A;  3IRB A;  2B8F A;  3NP8 A;  1WTQ A;  5M5Y B;  4JI7 L;  1AH9 A;  1AZP A;  2Y0S B;  1KNE A;  3I56 A;  5C44 B;  3CCM A;  3C46 A;  2F0W A;  1D1K A;  1JIC A;  5BN3 A;  4TSS A;  4JK1 C;  1H9K A;  2ICI A;  4IUN A;  5AJ3 L;  3G71 A;  2A5H A;  2CQO A;  5D3I B;  1LUZ A;  1IBL Q;  3NHH A;  5JJK A;  5JPM C;  3KOJ A;  2G9H D;  3NTK A;  1NTG A;  3TP6 A;  4LFB L;  1QNK A;  3ITP A;  3NTH A;  5FLX E;  3LWU A;  1Q46 A;  4QF4 A;  3A5U A;  5IT9 L;  4R4I A;  4KY5 A;  2R92 G;  3HOU B;  1YIJ A;  4QUC A;  5CBE E;  1JWU D;  1GUS A;  2BH8 A;  4OO1 H;  1EY5 A;  4A3C G;  3CXC A;  3T1H L;  2WAC A;  2NVT B;  1YJ9 A;  1EY9 A;  4A75 A;  4KI0 A;  3S14 B;  3GO5 A;  1VQ7 A;  2BCO A;  2KEC A;  1HNX Q;  4C1N K;  2F52 A;  2LKV A;  2FXQ A;  5JEA J;  3TME A;  4H44 C;  5CC4 A;  1NAP A;  4EVO A;  4NKL A;  1AP0 A;  1HZ9 A;  1SNQ A;  3J81 j;  4CKB A;  2F3I A;  4DK0 A;  3OWF A;  2KEE A;  4IAL A;  3J80 c;  3HOY B;  2EY6 A;  1CZG A;  3NXW A;  3SXH A;  5JJI A;  2EJM A;  2E2D C;  4KHV A;  4LW1 A;  1X6O A;  4P74 A;  4QL5 A;  5LMN Q;  3M4O H;  4XT1 B;  1IW7 C;  4XQN A;  3EIV A;  2R93 H;  3HKS A;  1DOK A;  1FYC A;  4AQY Q;  1X3P A;  1XMO Q;  1HZB A;  2EYP A;  4YY3 Q;  1RDP D;  1TWA H;  1EWC A;  3UE1 A;  4G7O C;  3ND8 A;  2QDB A;  1EYA A;  3NEN A;  1SND A;  1UE6 A;  4DR2 L;  5C0X G;  1WD0 A;  1A62 A;  5LL6 S;  2CCZ A;  3SHL A;  2A69 C;  1HNW L;  1YZ6 A;  1AW7 A;  1D5X C;  4QMG A;  1C8C A;  4IO9 A;  2P5Z X;  2QA4 A;  2D0P A;  2F1M A;  2N88 A;  2Q8R E;  5EKL A;  2PMZ E;  2QEJ C;  1ENC A;  1IYU A;  2PZW A;  4DUY Q;  1N32 L;  5COY A;  4CDD C;  1I5F A;  4L63 B;  4Y52 H;  3CMA A;  1MSH A;  1BKB A;  2XWB B;  2Q2H A;  2F3V A;  5KEE A;  2EY5 A;  1A2U A;  4P71 A;  1YHB A;  4HMI A;  2A69 D;  2O5I C;  3VYU A;  1I4H A;  4FNF A;  1TT2 A;  5I6W A;  1JR0 D;  3V96 A;  3C1F A;  1VQ4 A;  1HTL D;  1HTP A;  1D8L A;  1SYF A;  1X55 A;  2F0Q A;  4IUT A;  3BJU A;  1KLG D;  1X56 A;  1YHA A;  2XWJ B;  3TSS A;  3TRZ A;  1H9R A;  1KNA A;  3CQZ H;  1I4P A;  3STB D;  1HQR D;  1Q1E A;  5GQO A;  1PYS B;  3J81 c;  2O4X A;  3FPP A;  4KY7 A;  2WB1 G;  1B53 A;  2E8G A;  2NVQ H;  1X3F A;  3Q8D A;  5C4Z A;  2ALY B;  4K5W A;  3BS1 A;  1K3B C;  1STH A;  3SE0 A;  2EYH A;  5M3F H;  2SNS A;  4Z9C B;  3OSO A;  1K0R A;  3N52 A;  3L2P A;  3I55 A;  3DWQ A;  4X64 L;  2Y0S G;  3K7A H;  1SJE D;  5C44 G;  1XNR L;  2UXC Q;  2JA7 B;  2G9D A;  4XQQ A;  4HJA A;  1OXS C;  3FP9 A;  1I6H H;  2OTJ A;  4TVA B;  3I7F A;  3L3O C;  3I4M H;  1IL2 A;  4B3S Q;  4R8N A;  2UU9 L;  3RLO A;  1YHQ A;  3H91 A;  3VA7 A;  4OHJ A;  4F8M A;  1PTO F;  3UE0 A;  2K4K A;  1YJN A;  3HOU G;  2RDF A;  1T5E A;  4DAY A;  3CHB D;  1KIX A;  4CJ2 C;  1TS2 A;  3BZC A;  1HA6 A;  2ICE C;  1IBM Q;  2VY3 A;  1RD9 D;  1I4G A;  1ZYR C;  1KAB A;  4A3G B;  5CV6 A;  3KJO A;  4MTK A;  1DZ1 A;  2KUM A;  2EVB A;  3D4W A;  2VXW A;  4IJL A;  4XYQ A;  1MGS A;  1LT6 D;  4PNY A;  5J39 A;  1JQY D;  4K2K A;  2DJG C;  4IUV A;  1STE A;  3D3R A;  1K28 A;  4BBR B;  1GOZ A;  5AJ3 Q;  4TQU S;  3F1Z A;  2HT1 A;  2F4V L;  2IPK D;  1E24 A;  3E0E A;  3OW2 A;  1QJO A;  2A19 A;  3HOY G;  1DCZ A;  2I0Q A;  2EE1 A;  1AE3 A;  3WDN A;  1WVL A;  1HA5 A;  4XQJ A;  4S3S A;  5IYC H;  1YJW A;  1S40 A;  3D8G A;  1B9N A;  5LMN W;  2JA8 B;  1N36 L;  1NSN S;  4LFC L;  3M3Y B;  5GAH C;  1D1I A;  1RCV D;  2YU9 B;  1D2B A;  5IYD H;  1PTO D;  4AYB B;  3X3N A;  5KNB A;  1Y1W B;  4G4K A;  4IZ8 A;  2JXM B;  1KL9 A;  1FNU A;  3GTM H;  4G7H C;  1LYL A;  4BBS H;  4BY1 B;  2NVX H;  2A74 C;  1N8R C;  1CM9 A;  3J7A 5;  5C4J H;  1G91 A;  2L4N A;  4RCO A;  3J80 E;  1BOS A;  1S3O A;  5M5Y H;  1F77 A;  4X3S A;  4ZUJ A;  5FLX L;  5JOB A;  2BDO A;  4RHS A;  1HNZ L;  1X54 A;  2CWA A;  5IYB G;  1W6J A;  3SK4 A;  3S17 H;  4LF9 L;  2D62 A;  3TEH B;  1J8I A;  4WRD A;  3K7U C;  4ZLT F;  3KLS A;  2PI2 A;  2KED A;  3HKZ E;  4OWT B;  4LF5 L;  2MHV A;  1Y1V H;  4JI5 Q;  4ZRZ A;  4OWX B;  1EOT A;  1XYI A;  4GLV B;  2HHH L;  2M00 A;  2UUB Q;  2KEN A;  4DR2 Q;  4G57 A;  3AQQ A;  4KTA A;  4IOC A;  3PQI A;  1HNW Q;  1EQT A;  1NY4 A;  2ZJP A;  5JEA H;  4JI6 Q;  2EPB A;  4A3I B;  1KC8 C;  2F0N A;  4JOI C;  4GOP C;  2JA6 B;  4RMF A;  2JSO A;  1DJR D;  3H0G B;  4OON A;  4LF8 L;  2B2V C;  3KLR A;  3P7J A;  2I5M X;  5E3F A;  1N32 Q;  1LTG D;  2KHI A;  1TR5 A;  4IN3 A;  5CYU A;  1Z9F A;  1I50 B;  4IOA A;  3HOY H;  4LUV A;  2Q2T A;  1GJX A;  4HSV A;  4C2M H;  4OX9 L;  4BY7 H;  1SMX A;  3JAM c;  1LM0 A;  1K3R A;  2UUC L;  2JA7 G;  1CK1 A;  1S5B D;  1VQ5 A;  4QY7 A;  4X3T A;  3NSW A;  3HOZ H;  2LFN A;  1HUM A;  4PV1 C;  2E2I H;  2NZH A;  1S5E D;  4RGT A;  4GN4 B;  4PG3 A;  3J81 E;  4DV7 L;  3I4L A;  1LO5 D;  1XJV A;  3C2P A;  4DR7 L;  3U4Z A;  4WFN 3;  2KBN A;  1E1T A;  3PO2 H;  1CKN A;  1S4Z A;  1P16 A;  3GTJ H;  4JI4 L;  2Z6K A;  2KJX A;  1SBB B;  1GHJ A;  1JWS D;  2DY8 A;  3H3V H;  2K5N A;  4FVM A;  1S72 A;  1K73 C;  4OIK A;  5IP9 G;  1F9R A;  4PMB A;  2E5L Q;  3MWY W;  2YTV A;  4A3G G;  1JJG A;  3S1M H;  4CJ1 B;  5GAD C;  4P72 A;  3OIP A;  3ULP A;  2RHQ B;  3HOW H;  1Q81 C;  1CKO A;  4BBR G;  2F0H A;  1HZA A;  2VW9 A;  4IQZ A;  3VR2 A;  1ASY A;  1O80 A;  3ICE A;  4A3B H;  1UWV A;  4DV6 Q;  1XNQ L;  2WAQ B;  1IKM A;  3CPF A;  4AH6 A;  2XRQ D;  1X3Q A;  5T1G A;  3CC7 A;  1K8G A;  4A3L H;  1QIL A;  5ELE A;  2HDL A;  3VYR A;  2JA8 G;  1ILP A;  2PYK A;  3HEJ A;  4OO1 I;  1WTR A;  4AYB G;  1Y1W G;  1YNN C;  3OWE B;  1LTR D;  5DEH A;  2JP1 A;  2R6G A;  3M4O B;  3LGJ A;  3TZD A;  2R93 B;  1TY2 A;  4BY1 G;  1VS0 A;  2ZTC A;  3FVQ A;  3K0X A;  3DM1 A;  4RGN A;  2NBF A;  2RF4 A;  4WJ3 M;  1SE4 A;  3S15 H;  1TWA B;  4YCU A;  5GAE C;  2F4V Q;  4JI2 L;  1HPC A;  2JA7 H;  1IYV A;  3S16 H;  3GTG H;  1FNV A;  2B2W C;  3KDF B;  3A8I E;  3K0Y A;  5IGB A;  1H95 A;  1YNN D;  1II3 A;  4FF1 A;  1STY A;  3LNN A;  3OTO L;  1U5K A;  1N36 Q;  3UI2 A;  2UXB L;  2ZJQ A;  2F4I A;  2E2H H;  2JA5 H;  2F0O A;  3G4S A;  1PLF A;  2DUD A;  2B3G A;  2KHJ A;  4DR1 L;  5CMD A;  4XIG S;  4CDC C;  4KKS A;  4R4O A;  4DV3 Q;  3J7A F;  1WTW A;  1EIY B;  2BDN A;  1DGS A;  4RG1 A;  1AN8 A;  3UDF A;  1CUK A;  4A3I G;  3VR6 A;  2JA6 G;  3CCS A;  3A55 A;  4Y7N H;  1EOV A;  3Q24 A;  2A68 D;  4KV6 A;  3H0G G;  1IXR A;  1FVI A;  5IOD A;  3PUY A;  1SNO A;  2NZO A;  3CQZ B;  2QGQ A;  1OTC A;  3KF8 B;  3A8K E;  1RHP A;  2R7D A;  3W3A A;  4PMW A;  3MXG A;  3A0J A;  4DV4 L;  1FJG Q;  2O5J C;  1VMP A;  5LMU L;  1TWH H;  2RKS A;  2NVQ B;  2QW7 A;  4LF6 L;  3S1R H;  1WTV A;  2DN8 A;  2R3Z A;  5KGU A;  5M3F B;  3PUX A;  2RSO A;  2YU9 H;  2B29 A;  2RHS B;  3J80 L;  1JOO A;  2GN5 A;  3ONA B;  4NW2 A;  1GVP A;  2N78 A;  2Z4I A;  1BQQ T;  2K6A A;  4NXN L;  4DV0 L;  4DGZ A;  4BY1 H;  1BCP B;  5I9P A;  1TKW B;  4MHE A;  1I6H B;  1TQO A;  2DJF C;  1K8A C;  3I4M B;  1ET6 A;  3A5Z B;  5EAY A;  3VR5 A;  1GM5 A;  1K0S A;  1EU3 A;  1CHQ D;  1YVC A;  3CP0 A;  4LMQ D;  2LXJ A;  3DM3 A;  4A3D B;  4IPD A;  3CME A;  3W2D A;  1SYB A;  2EJG C;  3JAM E;  5E4W C;  2K33 A;  4OO1 G;  5IGE A;  1C4Q A;  1DON A;  3FKI H;  2CFM A;  3R93 A;  2WKC A;  2F0V A;  1NR2 A;  2F03 A;  1PFM A;  1PV4 A;  1W3S A;  3K59 A;  4ZKC B;  3U9S A;  4DV1 L;  1GUW A;  4KHZ A;  3V05 A;  2A6E C;  2Q2U A;  5IGD A;  3I4N H;  5C4X H;  4HR7 B;  1A3V A;  4ZQ3 A;  4P73 A;  2K5H A;  2L15 A;  1VMC A;  1IYJ B;  1EQR A;  2F0D A;  2WAQ G;  2A73 B;  2WIN B;  3FPU B;  4EQ5 A;  4RCN A;  1PZK D;  3K5N A;  4JI4 Q;  1VQ9 A;  4C3J H;  4QQB X;  2DNE A;  3CAM A;  3NBH B;  2CH4 A;  1STA A;  1GUO A;  3CKI B;  1XMQ L;  1HH2 P;  1FD7 D;  2EYF A;  4YCV A;  4NXM L;  4KN4 C;  2OEO A;  2JN4 A;  2R93 G;  1PRT B;  3J81 i;  4LF7 Q;  3TP8 A;  3HP3 A;  3E9I A;  3L0O A;  4FDB A;  1Y8N B;  5C3X A;  2AWN A;  1FGU A;  4X62 L;  3S2D H;  1U9R A;  3HS0 C;  3CD6 A;  3GTM B;  3J81 L;  2VL6 A;  3E9H A;  2HUG A;  1O7Y A;  4BBS B;  2MO1 A;  3DXJ C;  2NVX B;  5C4J B;  3H6M A;  3FDT A;  1A3T A;  1HZC A;  5ELF A;  3QOJ A;  4P75 A;  1J5E L;  5COR A;  2ZXP A;  1X3G A;  2AUK A;  3KF6 A;  5EPJ A;  1ONL A;  3RUZ A;  5DAU A;  1VQH A;  3QJY A;  4IUP A;  1PH9 A;  3S17 B;  2J0T D;  3KBG A;  1V1P A;  1PH6 A;  2PNR C;  3E0J A;  3OW7 A;  2KHS A;  4YWK A;  2PI2 E;  1Y1V B;  1PA6 A;  3F2U A;  1X9N A;  1VQP A;  3NWS A;  5KYL A;  1RL2 A;  3PO3 H;  1S5F D;  3I8Z A;  4A93 H;  2PW7 A;  2L1B A;  3M4P A;  2B39 A;  4MZ9 A;  5D14 A;  5FLM H;  2RSN A;  1HHV A;  1M90 C;  3T4A C;  4X65 L;  4K14 A;  1RJT A;  2OQ0 A;  1U4L A;  1YIT A;  3BU2 A;  1MBY A;  4PMC A;  1B2T A;  4GNX B;  4BXX H;  3OTO Q;  4B3M L;  3RR5 A;  3GTK H;  1PH1 A;  1MHW C;  2IHF A;  2MUY A;  5L37 A;  2BE5 C;  1SYG A;  3OYY A;  2DY7 A;  4DR4 Q;  1QCB D;  1PH7 A;  1E2V A;  4DR1 Q;  1S5C D;  3PUV A;  4LFA Q;  4DFA A;  5J22 A;  5M3F G;  4HIK A;  3A56 A;  5EJW A;  3P20 A;  4B3T Q;  4C2M B;  3RLF A;  4BY7 B;  4JBJ A;  4GKJ Q;  3Q23 A;  3SEB A;  5C6A A;  2V4D A;  4NDX A;  1G6Z A;  4HIM A;  4CJ0 B;  1B1Z A;  1P8L A;  4DUZ L;  1FNW A;  3HOZ B;  4X3U A;  2BE5 D;  2KCN A;  2E2I B;  3I4M G;  4LJZ C;  2K01 A;  1SYC A;  3NTI A;  2GVA A;  2M9V A;  2OT2 A;  2FMM A;  5M3M H;  1QUQ B;  3PO2 B;  2IL8 A;  1GXD C;  5LMU Q;  4OEL B;  3FHW A;  4P2C B;  3GTJ B;  4GKK Q;  2VUM H;  2K14 A;  2B2Y A;  3DLL A;  4R4C A;  4B9X A;  2AHO B;  2N55 A;  1IW7 D;  5EKK A;  3O13 A;  4POG A;  1KQS A;  4L5Q A;  5C4H A;  3S1M B;  3SK5 A;  3MFG A;  3A74 A;  3CC2 A;  2VQF L;  4JI1 Q;  3ER0 A;  2B2T C;  3HOW B;  4DV0 Q;  1N34 Q;  1QWY A;  3A7A B;  2L12 A;  2EOT A;  3TDQ A;  1HR0 L;  2X6G A;  1ENF A;  1G2S A;  4A3B B;  4QIW B;  1DXM A;  4JBM A;  1VF5 C;  2VQE L;  2JJQ A;  3H3V I;  4CDE C;  3K57 A;  1V9P A;  5IYC G;  3SR1 A;  3G48 A;  1XPR A;  1CA5 A;  1U4P A;  2B63 H;  1A15 A;  2D2C C;  2Q8I B;  4X66 L;  2UUA L;  3T1Y Q;  4HTH A;  5IYD G;  5FO7 B;  4DV1 Q;  1OXT A;  1FR3 A;  1Q7Y C;  3NUC A;  3OMC A;  1MJE A;  2ZJR A;  4RHR A;  1PHJ A;  2AMC B;  2JYO A;  4KJO A;  1GO3 E;  4HED A;  4BBS G;  1K83 B;  4NMZ A;  5BN4 A;  2B2U A;  5D3D A;  3WWV A;  1E2Z A;  3S15 B;  3JAM i;  4DV5 L;  1IHZ A;  3U58 A;  3Q22 A;  3QOL A;  5HUR A;  2E2J H;  1KLU D;  4Q5V A;  3TBI B;  1KTK A;  1CFM A;  3FRP B;  4UHV A;  2IWH A;  4ME3 A;  5LL6 X;  4FF3 A;  4KD3 A;  3S16 B;  3GTG B;  4A3K H;  1Q1B A;  3GTL B;  3I2Z A;  1EQQ A;  4OEM B;  1JT8 A;  1CTM A;  3Q6S A;  2MNA A;  2H4O A;  2PW5 A;  2LS0 1;  3PGZ A;  5H1S E;  4KY6 A;  3I4O A;  4MNO A;  1SDF A;  2XNA C;  1Y1V G;  3CRK C;  4HJ5 A;  2E2H B;  2JA5 B;  5EBC A;  1TWG H;  4HMJ A;  4A3D H;  4KKT A;  1L0X B;  4JW0 A;  1QNU A;  4X62 Q;  3UDG A;  4RWS C;  4YWL A;  2R7Z B;  2HIV A;  5FK9 C;  3F2D A;  1G29 1;  2HIX A;  1VQL A;  4EX5 A;  4QGU A;  1XTC D;  5JEA G;  5CV9 A;  1J5E Q;  2Z0S A;  3NEL A;  4JI7 Q;  1KRS A;  4Y7N B;  2J7Z A;  3A54 A;  2QCP X;  4U67 3;  1O7I A;  3PUZ A;  4V0B A;  1L0W A;  5ELB A;  5M5W B;  1NBW A;  1N9W A;  5A2Q E;  5C5L A;  2M2L A;  3FMC A;  1EZ8 A;  3HZX A;  1K8M A;  3PMF A;  4L8J A;  1G8Z D;  2E75 C;  1B3A A;  2K28 A;  4LFB Q;  4K0K L;  3GV6 A;  5EPK A;  3K5L A;  1A6X A;  4DU9 A;  3MXP A;  2AQ2 B;  1E7Z A;  1TWH B;  1ZYR D;  5BN5 A;  5IP7 H;  4BY7 G;  3S1R B;  2VB2 X;  1M8A A;  1V8Q A;  1R4P B;  5I6Y A;  1X3E A;  3ULL A;  3IFT A;  2JEB I;  3T53 B;  4M8A A;  3T1H Q;  2L11 A;  1L0Y B;  3OPO A;  5D65 A;  4A3M H;  2ES2 A;  2HQL A;  1Z6H A;  4HN7 A;  3HOZ G;  1EY6 A;  3JC6 6;  4ZKB B;  2WB1 E;  4B3M Q;  3C3L A;  4N8X 1;  2IHE A;  1EEF D;  1W2B A;  4IFD J;  1MI2 A;  4KJN A;  3QWN A;  3PO2 G;  1HJP A;  2F0F A;  2X69 A;  4DNT B;  2IX1 A;  5I2Y A;  1Y8P B;  4LUO A;  4XT3 B;  3M4Y A;  2RA4 A;  4OIJ A;  4GN5 A;  2Y0S E;  3ERQ A;  1SNM A;  4DV2 L;  5C3E H;  1WYD A;  1OXU A;  4POF A;  4C1N I;  3I91 A;  4YHH L;  2ZT9 C;  3FKI B;  3HOW G;  1SE8 A;  4UAI A;  3QB3 A;  5M5X B;  3AEV A;  4I65 A;  1NCV A;  3T56 B;  2HQE A;  3I4N B;  4A3B G;  5C4X B;  2G5D A;  4QCL A;  1TS5 A;  2H5X A;  2F0I A;  2MGS A;  2E74 C;  3S1N B;  1UEA B;  1E22 A;  4JI0 L;  5HY6 A;  4EQP A;  4IUQ A;  5TSS A;  5EQ0 A;  5KIX A;  4C3J B;  4A3L G;  1DOM A;  1STG A;  2SNM A;  5IOC A;  1JJ2 A;  2NTS A;  1JE4 A;  1C7Y A;  1QB5 D;  4E6I A;  1ICW A;  3M4Q A;  3EN2 A;  2K5D A;  4J8Q A;  2IX0 A;  3ULJ A;  4KHP L;  2KVM A;  3QR8 A;  1BCP F;  1K9M C;  5EKI A;  3S2H H;  1LTI D;  1F9Q A;  1TWC H;  3GV3 A;  2VQF Q;  2L0C A;  1XPO A;  1LT4 D;  4ILW A;  1MJC A;  2RBM A;  2NUC A;  1QZG A;  4H7B A;  1HR0 Q;  1TY0 A;  4PQX A;  3S2D B;  4R4Q A;  1Z7T A;  1U4R A;  2EYO A;  3CW2 C;  5NUC A;  1DM0 B;  3CCV A;  4JYA L;  3DEP A;  4B3R L;  4YCW A;  3UDI A;  1EUJ A;  4MIU A;  1IZ6 A;  2CVR A;  1BCP C;  1A2T A;  4UP7 A;  1DD2 A;  1IL8 A;  1Q3L A;  4X66 Q;  1I6V C;  1JE5 A;  3AYH B;  3DMU A;  2EJF C;  3KK7 A;  4ZCK A;  1H9M A;  2JA5 G;  2PPB C;  1BBX C;  1ET9 A;  4X6A H;  1H9S A;  2BH2 A;  4I7A A;  1EFW A;  1QVG A;  2R7Z G;  2ZM6 L;  2MJ8 A;  3I73 A;  1Q12 A;  1Y8O B;  4EQO A;  4A3F H;  1SFO H;  2UXD L;  1IBK L;  4F7X A;  1QVC A;  3PO3 B;  5J1Z A;  4DKA C;  3S9W A;  2D9U A;  2ZTE A;  4X64 Q;  1VQK A;  4A93 B;  1BCP D;  1XNR Q;  1J6Q A;  3MTS A;  3VDY A;  1V1Q A;  1NR4 A;  1Q90 A;  3KLW A;  3U4V A;  4KKU A;  1UUP A;  1O7L A;  2NYZ D;  2SDF A;  4J1M A;  1L1O C;  5ELN A;  3F2C A;  2UU9 Q;  3BZD B;  3QO2 A;  3RD4 A;  3GTK B;  2C5C A;  4KMU C;  2EYL A;  4UY8 C;  1U4M A;  3J7Z C;  4RKB A;  5BR8 L;  2I5H A;  1U0L A;  1WJJ A;  3TRE A;  3GTQ B;  4JOI A;  3J7A V;  4GOP A;  1SEB D;  3BDO A;  1WCM H;  3CRL C;  3X3M A;  1PRT C;  4O0A A;  2B2V A;  1PXU A;  1GUN A;  1FL0 A;  4F87 A;  2A1A A;  3DWA A;  2KQ3 A;  3K58 A;  5IGF A;  5CBA E;  1K83 H;  1TWF H;  2QKI C;  4C3H H;  3KUP A;  2RQX A;  1I94 L;  1VF7 A;  3PCO B;  4G7Z C;  4LF4 L;  1NUC A;  1CSP A;  5CV5 A;  5GRO A;  3CCJ A;  4IPG A;  1JMC A;  1GUT A;  2F0K A;  1WTX A;  4J6H A;  1RTO A;  4L5R C;  5M3M B;  1IBL L;  1UE5 A;  1PRT D;  3GTL H;  3SGI A;  2VUM B;  3SDZ A;  5AFW A;  4C3I H;  1Q8I A;  3HOX H;  4OGQ C;  3FKI G;  1CT1 D;  2K75 A;  4GN3 B;  2V1C C;  4ME5 A;  4LFC Q;  1A63 A;  3F2B A;  1F2M A;  3FEW X;  1BVS A;  5CV7 A;  3CCU A;  1VCI A;  3D31 A;  2K5Q A;  4A3J H;  3I4N G;  1NE3 A;  3G7L A;  5C4X G;  4DK1 A;  1CKM A;  2OCE A;  1CKN B;  2R7Z H;  4DN4 M;  1A3U A;  3MXN A;  2Z8L A;  5G3L F;  4QB4 A;  2HDM A;  1L2F A;  1B70 B;  3NPP A;  1B4O A;  3ND9 A;  4XXE A;  2OXP A;  2TSS A;  1M4V A;  5A2Q L;  3H94 A;  2PMZ B;  4RH6 A;  4C3J G;  1SYD A;  1A8V A;  1BBW A;  3MC0 B;  1BNZ A;  2DGY A;  2NN6 H;  4H13 C;  2XGT A;  4GNX C;  1HNZ Q;  2N8N A;  3K5M A;  4DV2 Q;  5M5W H;  1QVF A;  3RMH A;  5IE8 A;  2I5L X;  1QE6 A;  5HGT A;  1YNJ C;  3EVQ A;  4KLK A;  4LF9 Q;  3W1B A;  4WJ4 A;  4YHH Q;  2B63 B;  2F0M A;  5EPL A;  1VQ6 A;  4LF5 Q;  4N9P A;  1LT3 D;  2LY7 A;  1WTO A;  1Q8K A;  1VDZ A;  4DPG A;  3KFU A;  4DXF A;  5LMN L;  1HR0 W;  3TS0 A;  1SYE A;  4PZ7 A;  2HHH Q;  2XVS A;  3ZYY X;  4H0L C;  1E2W A;  3QIA A;  1GKH A;  5M9O A;  1H9J A;  3K80 C;  5A35 A;  1HQM C;  1DOL A;  2RCN A;  2PQA A;  4BWG B;  2JA9 A;  3PF4 A;  2E2J B;  4AYB E;  1GD7 A;  2N49 A;  1WTP A;  3NQT A;  5FO9 B;  4FF4 A;  4DAP A;  5G3L D;  1AZQ A;  4A3K B;  2TMP A;  2K52 A;  4LF8 Q;  3DEO A;  1VQO A;  1KDC A;  4B08 A;  2EY2 A;  4ABN A;  5ELC A;  5I4D A;  2XRS D;  5FKA C;  4DR3 L;  1SE3 A;  4JC0 A;  3H3V C;  1SMY C;  2WKD A;  1TWG B;  4DUY L;  2B2W A;  3PO3 G;  2Z6B A;  1LV9 A;  4OX9 Q;  4A93 G;  1SNP A;  2WV6 D;  5JVG 3;  4K5V A;  4Q0F A;  1PH8 A;  3S1Q H;  5FLM G;  2UUC Q;  1LTS D;  5M5X H;  1UEB A;  2VB3 X;  1EYG A;  3TS2 A;  1NMG A;  2K5V A;  4BXX G;  4KN7 C;  4JI8 L;  3S1N H;  4DV7 Q;  1X32 A;  4DR7 Q;  3GDE A;  4I7Z C;  4YWM A;  3U50 C;  2B8G A;  5C0X J;  4CGY B;  5IY0 A;  3RNU A;  2K05 A;  3HOV H;  4EGV A;  1L1O B;  3RN2 A;  1TS4 A;  3M9B A;  4DAM A;  1W6K A;  3CCE A;  3EA6 A;  4LUZ A;  3LX0 A;  3MEH A;  2F0P A;  1XWE A;  2EDG A;  2UXD Q;  1I3Q H;  2OQK A;  2YYZ A;  2NZ1 D;  4NP5 A;  1S5D D;  1LLR D;  1STB A;  2A6E D;  5C5M A;  2AKW B;  4R1J A;  4A3M B;  1E1O A;  2QDL A;  1SNC A;  4HJ9 A;  2UXC L;  3TZU A;  3GTO H;  4UDU C;  1XNQ Q;  2J4X A;  3E6Z X;  4GZY C;  5JVH 3;  3R8B A;  5M3M G;  5BR8 Q;  4R9W A;  2VUM G;  2D5D A;  2EXD A;  1LTL A;  2I46 A;  3URY A;  2IJ0 A;  5C3E B;  4HSP A;  3IFD A;  1CSQ A;  1QUQ A;  3D6C A;  1SRO A;  3G6E A;  1IBM L;  3DWP A;  2EIF A;  5K36 H;  1HFN A;  4ALP A;  5E1F A;  1O7Z A;  1T9H A;  3TP7 A;  1I94 Q;  1BO0 A;  4LF4 Q;  3H09 A;  1Q82 C;  2B2Y C;  1D6E C;  2PCF B;  4JI2 Q;  3PIP 3;  2MP1 A;  1PYW D;  3ERO A;  1D5Z C;  4KD4 A;  1PZJ D;  1ZXT A;  1N33 L;  3HKZ B;  3NQI A;  1F9S A;  1PH3 A;  1B3Q A;  4PZ8 A;  2B63 G;  2F0T A;  3L7Z C;  3MZ5 A;  1O78 A;  4A3E B;  3U9O A;  2UXB Q;  4FYD A;  2RVL A;  4LNQ A;  4RA8 A;  1JOQ A;  3CPW A;  2WAQ E;  3S2H B;  3DUZ A;  1TWC B;  3GTQ H;  1TS3 A;  5JJL A;  4RFB A;  2ZXR A;  1PH2 A;  1B44 D;  2D0O A;  1BF4 A;  4DF7 A;  2K5W A;  1PTO H;  3CC4 A;  3OHX C;  4L6T B;  3C1E A;  2AUJ D;  2EYJ A;  4ZYS A;  4A3K G;  1WOC A;  5J3B A;  1B8A A;  4NPS A;  1KDA A;  1Y14 B;  1F2L A;  2B2U C;  4BS9 A;  4DV4 Q;  3CU7 A;  2K32 A;  2EQS A;  3GTP H;  1D7Q A;  4A3D G;  4LF6 Q;  2IY5 B;  2QF7 A;  1KAW A;  3H15 A;  1EY8 A;  1T5X D;  4GLX A;  1C0A A;  3MXU A;  4JI5 L;  3HG9 A;  2BOS A;  3VA5 A;  1OXV A;  4A3F B;  1SFO B;  3BDL A;  3F8T A;  1SE2 A;  4RAU C;  1JB3 A;  4MTN A;  3RN5 A;  4DNI A;  3KF6 B;  2UUB L;  4OXP A;  4EQN A;  4UP9 A;  1V1P B;  4NXN Q;  1JCK B;  3BYY B;  3D4R A;  5JJZ A;  4QUF A;  5C3W A;  4JI6 L;  3BZK A;  5DLQ E;  3RLN A;  4UP8 A;  4JV5 L;  3IAY A;  3L9A X;  1I4R A;  5DM6 3;  3A7L A;  4DR3 Q;  2ZTD A;  3MEF A;  1EU4 A;  1CZW A;  3STB C;  4JG2 A;  5IP7 G;  3PIP A;  1NJI C;  1PFS A;  2PO4 A;  1IKL A;  5KNC A;  1WCM B;  1DYQ A;  2FJ2 A;  4HJ7 A;  4L5T A;  2MPM A;  4A3M G;  4ODG A;  2R92 H;  2JE6 I;  1BDO A;  4DK3 C;  1ZEQ X;  4A3C H;  2XTI A;  3W1G A;  1SAP A;  2AQ3 B;  4JI8 Q;  1LTB D;  1SRU A;  3IL8 A;  3BDC A;  1TWF B;  5I9O A;  4C3H B;  1EYD A;  2RDH A;  3T13 A;  2L55 A;  2MQH A;  3PSI A;  1VQE A;  5CR3 A;  5FOB B;  3KYH C;  2GA4 B;  2NWG A;  2XIW A;  1XMQ Q;  4NXM Q;  5C3E G;  2NVY B;  1RKN A;  4DNR B;  5LHY 1;  1TVX A;  3JAM L;  4C3I B;  3HOX B;  2NB0 A;  1EQV A;  2L9H A;  1EIF A;  4A76 A;  3NE5 B;  2K1B A;  2E5L L;  3T16 A;  1D5M C;  1MD2 D;  3SVM A;  4F88 A;  4A3J B;  3D0F A;  3MHB A;  4WOR A;  4DR5 L;  3B6Y A;  2EZV A;  4CBV A;  1XXG A;  1EWI A;  4U68 A;  1JOR A;  3HKZ G;  1F9P A;  2N3S A;  3J7Y W;  5IT9 c;  4DV6 L;  2VS1 A;  5C0X H;  3NEM A;  4R4T A;  5HGQ A;  2CHB D;  3GQB A;  3RZO H;  1SLJ A;  1SXT A;  2B2T A;  4A3E G;  1RIP A;  5K5P A;  2R7F A;  1EWH A;  4M1U B;  4RKL A;  3VYT A;  1VQB A;  2PQE A;  5EBD A;  2HCC A;  1Q86 C;  1SJH D;  3T51 B;  2VNU D;  2H1E A;  2XN9 C;  3P1H A;  5ELD A;  2PZT A;  2F0G A;  2HD3 A;  2WII B;  1NNX A;  3OIQ A;  1PVO A;  1EL0 A;  3PIO 3;  1M1K C;  2FFK B;  1CQF A;  4CDF C;  5JAV A;  2ATW A;  2LMC B;  1C48 A;  1PTO C;  4MN3 A;  1Z47 A;  2KOL A;  1EIG A;  1YEZ A;  3I70 A;  1EIH A;  4LK1 C;  1N33 Q;  4X65 Q;  2NN6 I;  4XYO A;  4R8I A;  2RDG A;  4OL7 A;  4WJW A;  3AMU A;  3E5S A;  3EBE A;  2A6H C;  2NTT A;  4C56 C;  1JOK A;  2XSC A;  2ID0 A;  5E4X A;  2Q8T A;  3RZD H;  2L5T A;  3Q0A A;  1G51 A;  4A3F G;  4FXG C;  1R9T B;  1GHK A;  2Z9H A;  4NB3 A;  4DA2 A;  4DR6 L;  3TP5 A;  4HAE A;  5FJ8 G;  4HCS A;  3S1Q B;  1TII D;  1BR9 A;  4DV3 L;  4O42 A;  4IFD I;  3NK9 A;  2A6H D;  2Z6K C;  4DUZ Q;  3AFP A; 
#chains in the Genus database with same CATH homology
 2QEX A;  4BA1 I;  4P71 A;  1YHB A;  5C44 H;  4L5R C;  1IBL L;  1UE5 A;  3GTL H;  2R93 G;  3J81 i;  3TQY A;  5GAG C;  1JB7 A;  4LF7 Q;  3SGI A;  3E9I A;  3L0O A;  4FDB A;  4DAY B;  1VQ4 A;  2BA0 A;  4C3I H;  3HOX H;  1D8L A;  2AWN A;  1X55 A;  3FKI G;  2K75 A;  1FGU A;  4GN3 B;  2V1C C;  3BJU A;  1X56 A;  1YHA A;  4X62 L;  3F2B A;  4LFC Q;  1UE1 A;  3CD6 A;  3HFZ B;  1BVS A;  3TRZ A;  3CQZ H;  2VL6 A;  3E9H A;  1FJG L;  1XPU A;  3STB D;  3CCU A;  1WCM G;  1Q1E A;  1VCI A;  1VQC A;  2MO1 A;  1PYS B;  3D31 A;  5GQO A;  4A3E H;  4A3J H;  1NE3 A;  2F4V L;  3I4N G;  5C4X G;  1CKM A;  1HZC A;  1CKN B;  2OCE A;  2R7Z H;  3HOU H;  2K50 A;  4P75 A;  2KCT A;  1J5E L;  3J81 c;  1L2F A;  2JK8 A;  1B70 B;  3S24 A;  2WB1 G;  1X3G A;  2NVT H;  2E8G A;  2NVQ H;  1SR3 A;  1X3F A;  3KF6 A;  3Q8D A;  2ALY B;  1A8V A;  1BBW A;  1VQH A;  2DGY A;  1PH9 A;  3S14 H;  1PH6 A;  2XGT A;  5M3F H;  1X65 A;  4GNX C;  4JV5 Q;  1HNZ Q;  2N8N A;  4DV2 Q;  1K0R A;  5M5W H;  3L2P A;  3I55 A;  1QVF A;  5IE8 A;  2I5L X;  4YWK A;  2A8V A;  2PI2 E;  4X64 L;  1PA6 A;  4LF9 Q;  4KLK A;  2Y0S G;  3ERS X;  3W1B A;  3PIO A;  4YHH Q;  2VQE Q;  1X9N A;  4WJ4 A;  1VQP A;  3K7A H;  1VQ6 A;  5C44 G;  1XNR L;  1RL2 A;  3PO3 H;  3M85 A;  2UXC Q;  4LF5 Q;  2OWO A;  4HJA A;  1OXS C;  4A93 H;  1Q8K A;  3FP9 A;  3M4P A;  4DPG A;  2WFW A;  5FLM H;  4MZ9 A;  4TVA B;  3HOX G;  3I7F A;  3KFU A;  1I6H H;  1M90 C;  2OTJ A;  5LMN L;  1HR0 W;  3TS0 A;  3I4M H;  2UUA Q;  4PZ7 A;  4X65 L;  1IL2 A;  2HHH Q;  4B3S Q;  2OQ0 A;  2UU9 L;  3RLO A;  1YBY A;  5IWA L;  1YIT A;  1YHQ A;  3BU2 A;  4A3J G;  3KDF A;  1GKH A;  4GNX B;  3UE0 A;  4BXX H;  1MKH A;  2K4K A;  3K80 C;  1YJN A;  3OTO Q;  4B3M L;  3HOU G;  4HID A;  3RR5 A;  2RCN A;  1ASZ A;  3GTK H;  2WP8 J;  2PQA A;  1PH1 A;  2IHF A;  2JA9 A;  3PF4 A;  1KIX A;  4AYB E;  1GD7 A;  3BZC A;  2N49 A;  3OYY A;  1KXL A;  1IBM Q;  4DR4 Q;  2VY3 A;  2C35 B;  4DV5 Q;  1PH7 A;  2K52 A;  5FJ8 H;  1VQO A;  4LF8 Q;  4JI3 L;  4DR1 Q;  2NN6 G;  3PUV A;  4LFA Q;  3KJO A;  4HIK A;  5M3F G;  2JEA I;  4H02 A;  2MO0 A;  4IJL A;  4B3T Q;  3RLF A;  4DR3 L;  3W5O A;  1MIU A;  4JC0 A;  4JBJ A;  1V43 A;  4GKJ Q;  4BA2 I;  5AJ3 Q;  4DUY L;  4TQU S;  3PO3 G;  5IYB H;  3F1Z A;  4OX9 Q;  4HIM A;  3PUW A;  4L5S A;  2HT1 A;  1E24 A;  4QIW E;  3E0E A;  3OW2 A;  1P8L A;  4DUZ L;  2A19 A;  1PH8 A;  3HOY G;  5FLM G;  1KD1 C;  3S1Q H;  2I0Q A;  3I4M G;  2UUC Q;  1AE3 A;  5ELO A;  4UPA A;  5M5X H;  3UDX A;  1G6P A;  1UEB A;  5IYC H;  4LF7 L;  1EYG A;  4DR5 Q;  3TS2 A;  1NMG A;  2PNH A;  1YJW A;  1S40 A;  2GVA A;  2K5V A;  1VQF A;  5M3M H;  1QUQ B;  5LMN W;  4BXX G;  4JI8 L;  2MFI A;  5LMU Q;  3FHW A;  1N36 L;  4GKK Q;  4LFC L;  3S1N H;  4DV7 Q;  5GAH C;  2YTY A;  3GDE A;  1BBU A;  2K14 A;  2VUM H;  4DR7 Q;  4IFD G;  4YWM A;  3U50 C;  5IYD H;  3DLL A;  4R4C A;  4LWC A;  5C0X J;  4HIO A;  2AHO B;  5IY0 A;  3RNU A;  3HOV H;  3RN2 A;  1L1O B;  1KL9 A;  3M9B A;  4DAM A;  3CCE A;  4POG A;  4PZ6 A;  1KQS A;  3GTM H;  4L5Q A;  4LUZ A;  1LYL A;  4IPH A;  4BBS H;  2NVX H;  1N8R C;  3J7A 5;  5C4J H;  2IT1 A;  3A74 A;  3CC2 A;  2VQF L;  4JI1 Q;  3CCL A;  1I3Q H;  2OQK A;  1VQA A;  2YYZ A;  3ER0 A;  4J15 A;  1S3O A;  1VQJ A;  4DV0 Q;  5M5Y H;  1N34 Q;  4K0K Q;  3PV0 A;  1HR0 L;  1PYB A;  1XTD A;  2NVY H;  1HNZ L;  1X54 A;  2CWA A;  5IYB G;  2AKW B;  4R1J A;  4JBM A;  3S17 H;  4LF9 L;  2CWP A;  2D62 A;  3TEH B;  2VQE L;  1E1O A;  2JJQ A;  3K7U C;  5FLX c;  3H3V I;  1V9P A;  4JCV E;  2PI2 A;  3AFQ A;  2LSS A;  5IYC G;  3HKZ E;  4OWT B;  4HJ9 A;  1YNX A;  4LF5 L;  1XNQ Q;  3GTO H;  1Y1V H;  4A4I A;  3G48 A;  1XPR A;  4JI5 Q;  2B63 H;  4XTC S;  5M3M G;  4OWX B;  4X66 L;  2UUA L;  5BR8 Q;  4GLV B;  3T1Y Q;  2HHH L;  2VUM G;  2EXD A;  2KCM A;  2UUB Q;  1LTL A;  5IYD G;  1E3P A;  1KHI A;  2KEN A;  4DR2 Q;  5E7N A;  4DV1 Q;  1OXT A;  1Q7Y C;  3AQQ A;  1MJE A;  4IOC A;  3HOV G;  2ZJR A;  1HNX L;  1PHJ A;  1JJC B;  2AMC B;  1HNW Q;  1NY4 A;  4JBW A;  2ZJP A;  4IPC A;  3KJP A;  4JI6 Q;  1GO3 E;  4BBS G;  1VQM A;  1VQ8 A;  4IJH A;  1KC8 C;  4JOI C;  1CSQ A;  1QUQ A;  4GOP C;  1SRO A;  3G6E A;  4HJ8 A;  4RMF A;  3WWV A;  1IBM L;  4DR4 L;  2BA1 A;  4OWW B;  3CCR A;  4DR6 Q;  3JAM i;  4DV5 L;  4OON A;  3U58 A;  2ASB A;  2EIF A;  4LF8 L;  4ALP A;  1YI2 A;  1T9H A;  2I5M X;  1I94 Q;  2E2J H;  5IP9 H;  4ME3 A;  1AE2 A;  4LF4 Q;  4LFA L;  1L1O A;  1N32 Q;  1Q82 C;  2KHI A;  4A3K H;  1Q1B A;  2JQO A;  4B3T L;  3I2Z A;  4A3G H;  1Z9F A;  4IOA A;  4JI2 Q;  1EQQ A;  3HOY H;  1NMF A;  4GKJ L;  4LUV A;  2MNA A;  1JT8 A;  2Q2T A;  3PGZ A;  1N33 L;  5H1S E;  3I4O A;  4MNO A;  4C2M H;  4OX9 L;  4BY7 H;  1Y1V G;  1PH3 A;  4AQY L;  4PZ8 A;  2YTX A;  4HJ5 A;  1SMX A;  4BBR H;  1XMO L;  4JI0 Q;  2B63 G;  1TWG H;  3JAM c;  1A0I A;  1PH4 A;  4GOP B;  4YY3 L;  1LM0 A;  1K3R A;  2UUC L;  3L7Z C;  4A3D H;  2JA7 G;  4X62 Q;  3UDG A;  2OTL A;  2UXB Q;  1VQ5 A;  2VZA A;  4QY7 A;  4YWL A;  2HIV A;  4LNQ A;  3HOZ H;  3F2D A;  1G29 1;  2E2I H;  2NZH A;  3CPW A;  2HIX A;  2WAQ E;  1UE7 A;  4EX5 A;  1VQL A;  1VQG A;  4GN4 B;  4PG3 A;  3GTQ H;  3J80 i;  4APV A;  4DV7 L;  4QGU A;  4GKK L;  5JEA G;  1XJV A;  4DR7 L;  4KHP Q;  1J5E Q;  5JJL A;  3U4Z A;  2Z0S A;  3NEL A;  4JI7 Q;  2UXD Q;  1KRS A;  1PH2 A;  2KBN A;  1E1T A;  3PO2 H;  1CKN A;  2D0O A;  2JA8 H;  1P16 A;  3GTJ H;  3M3Y H;  4JI4 L;  2YV5 A;  2Z6K A;  1O7I A;  3PUZ A;  4DK6 C;  1L0W A;  3H3V H;  2K5N A;  1S72 A;  1K73 C;  5K36 G;  3CC4 A;  1NBW A;  3PF5 A;  1R9T H;  1Y1W H;  5IP9 G;  1N9W A;  2Q2I A;  2E5L Q;  2YTV A;  4JI1 L;  4A3K G;  4A3G G;  1JJG A;  3CF5 A;  1WOC A;  1N34 L;  1KRT A;  5J3B A;  4LFB Q;  4K0K L;  1B8A A;  4JYA Q;  3S1M H;  4NPS A;  1Y14 B;  5GAD C;  4P72 A;  4B3R Q;  1VQD A;  1TXY A;  1E7Z A;  3ULP A;  2RHQ B;  3HOW H;  5IP7 H;  4BY7 G;  1Q81 C;  4DV4 Q;  1CKO A;  4BBR G;  1X3E A;  1HZA A;  2EQS A;  3ULL A;  3GTP H;  1D7Q A;  2VW9 A;  2JEB I;  4A3D G;  3T1H Q;  1ASY A;  4LF6 Q;  3ICE A;  4A3B H;  2IY5 B;  3GD7 A;  1UWV A;  2ES2 A;  4A3M H;  1KAW A;  3H15 A;  2HQL A;  4DV6 Q;  1XNQ L;  5IWA Q;  4GLX A;  1C9O A;  3HOZ G;  1C0A A;  4JI5 L;  3MXN B;  1OXV A;  3CPF A;  3JC6 6;  3F8T A;  4AH6 A;  1VQN A;  2WB1 E;  4MTN A;  3RN5 A;  3T1Y L;  4B3M Q;  4DNI A;  2ZM6 Q;  3CC7 A;  3KF6 B;  2IHE A;  1K8G A;  2UUB L;  1W2B A;  4IFD J;  4OXP A;  4A3L H;  1SN8 A;  4GNX A;  4UP9 A;  3PO2 G;  1B7Y B;  2JA8 G;  1IBK Q;  1HJP A;  4NXN Q;  4OO1 I;  4AIM A;  4GS3 A;  2IX1 A;  4LUO A;  4AYB G;  4JI6 L;  3BZK A;  1Y1W G;  3K8A A;  4JI3 Q;  5DLQ E;  3RLN A;  4UP8 A;  4QJF A;  4GN5 A;  4JV5 L;  2Y0S E;  2R6G A;  4DV2 L;  3LGJ A;  5C0X I;  1WFQ A;  5C3E H;  1WYD A;  4DR3 Q;  1OXU A;  2ZTD A;  4POF A;  4BY1 G;  4A3I H;  3MEF A;  4YHH L;  1VS0 A;  2ZTC A;  2JA6 H;  3K0X A;  3STB C;  2RF4 A;  4WJ3 M;  3S15 H;  1QZH A;  1SE8 A;  4JG2 A;  5IP7 G;  2GVB A;  3HOW G;  3H0G H;  3PIP A;  1NJI C;  4YCU A;  5GAE C;  2F4V Q;  3AEV A;  4JI2 L;  1PFS A;  1PH5 A;  1OXX K;  2JA7 H;  4JBK A;  4HJ7 A;  3GTG H;  3S16 H;  4A3B G;  4L5T A;  3KDF B;  1WI5 A;  3ZJY C;  2H5X A;  4A3M G;  4B3S L;  4O2D A;  2JE6 I;  1I50 H;  2R92 H;  4DK3 C;  1E22 A;  1VQI A;  1H95 A;  4JI0 L;  5HY6 A;  3K81 C;  2PQA B;  4A3C H;  2XTI A;  3W1G A;  2AWO A;  3OTO L;  4JI8 Q;  1U5K A;  1SRU A;  2CKZ B;  2LXK A;  4GLA C;  1N36 Q;  2UXB L;  4A3L G;  2ZJQ A;  2E2H H;  1JJ2 A;  2JA5 H;  3M7N A;  3CCQ A;  3G4S A;  2MQH A;  1C7Y A;  2DUD A;  2B3G A;  3PSI A;  1VQE A;  3EN2 A;  3IRB A;  3M4Q A;  2IX0 A;  3ULJ A;  2KHJ A;  4KHP L;  3KYH C;  4DR1 L;  4JI7 L;  1AH9 A;  4XIG S;  4R4O A;  1K9M C;  4DV3 Q;  3I56 A;  1XMQ Q;  3S2H H;  3CCM A;  1TWC H;  1A63 A;  1EIY B;  2VQF Q;  4NXM Q;  5C3E G;  1DGS A;  4RG1 A;  1XPO A;  3UDF A;  1MJC A;  1CUK A;  4A3I G;  2JA6 G;  5AJ3 L;  3G71 A;  3CCS A;  4Y7N H;  1QZG A;  1HR0 Q;  2CQO A;  1LUZ A;  1IBL Q;  4A76 A;  2E5L L;  1EIF A;  1EOV A;  5JJK A;  3H0G G;  1IXR A;  1FVI A;  4R4Q A;  3KOJ A;  3PUY A;  3CW2 C;  2NZO A;  1NTG A;  4LFB L;  3CCV A;  4JYA L;  2QGQ A;  1OTC A;  4B3R L;  1Q46 A;  3D0F A;  3A5U A;  4YCW A;  3UDI A;  1EUJ A;  3KF8 B;  4R4I A;  2R92 G;  2R7D A;  3B6Y A;  4PMW A;  4DR5 L;  1IZ6 A;  4DV4 L;  3A0J A;  1YIJ A;  1FJG Q;  1EWI A;  2BH8 A;  4A3C G;  4UP7 A;  3CXC A;  3HKZ G;  5LMU L;  1TWH H;  2N3S A;  3T1H L;  4X66 Q;  4LF6 L;  1YJ9 A;  1JE5 A;  3S1R H;  3AYH B;  5IT9 c;  4DV6 L;  2VS1 A;  2JA5 G;  3NEM A;  4R4T A;  4A75 A;  4KI0 A;  5HGQ A;  3GO5 A;  3RZO H;  1VQ7 A;  1SLJ A;  4X6A H;  4A3E G;  2BH2 A;  3PUX A;  1HNX Q;  1RIP A;  1QVG A;  2R7F A;  1EFW A;  2YU9 H;  2B29 A;  2R7Z G;  2RHS B;  2F52 A;  5JEA J;  2FXQ A;  2ZM6 L;  2GN5 A;  1VQB A;  1GVP A;  1Q12 A;  2N78 A;  4A3F H;  1SFO H;  2UXD L;  1IBK L;  1QVC A;  1Q86 C;  4NXN L;  1HZ9 A;  2VNU D;  4DKA C;  3J81 j;  4DV0 L;  2ZTE A;  4BY1 H;  2F3I A;  4X64 Q;  1VQK A;  3J80 c;  1PVO A;  1XNR Q;  5JJI A;  1J6Q A;  1K8A C;  1M1K C;  3VDY A;  3A5Z B;  1V1Q A;  4LW1 A;  5EAY A;  3KLW A;  1X6O A;  3U4V A;  2ATW A;  1GM5 A;  1Z47 A;  1YVC A;  3CP0 A;  4P74 A;  4QL5 A;  5LMN Q;  1YEZ A;  2LXJ A;  1N33 Q;  4X65 Q;  3M4O H;  2R93 H;  3EIV A;  1L1O C;  3DM3 A;  2NN6 I;  3HKS A;  5ELN A;  3F2C A;  2UU9 Q;  4IPD A;  3CME A;  4AQY Q;  4OO1 G;  1XMO Q;  4UY8 C;  1HZB A;  3FKI H;  2CFM A;  3J7Z C;  4YY3 Q;  5BR8 L;  1TWA H;  3EBE A;  2I5H A;  3UE1 A;  1U0L A;  1WJJ A;  3TRE A;  3NEN A;  4DR2 L;  1W3S A;  1UE6 A;  4JOI A;  4DV1 L;  4GOP A;  1PV4 A;  5C0X G;  2ID0 A;  4KHZ A;  1A62 A;  1WCM H;  2CCZ A;  2Q2U A;  3I4N H;  5C4X H;  4O0A A;  3RZD H;  1HNW L;  1YZ6 A;  4P73 A;  2K5H A;  1FL0 A;  1G51 A;  2L15 A;  1IYJ B;  1EQR A;  4IO9 A;  2WAQ G;  2QA4 A;  2A1A A;  4A3F G;  2D0P A;  4EQ5 A;  4NB3 A;  4DR6 L;  3S2D H;  4JI4 Q;  1VQ9 A;  1K83 H;  1TWF H;  2PMZ E;  4C3J H;  4C3H H;  4QQB X;  3CAM A;  3NBH B;  5FJ8 G;  1I94 L;  3PCO B;  4LF4 L;  4DUY Q;  4DV3 L;  1N32 L;  1CSP A;  1XMQ L;  4IFD I;  1HH2 P;  4A93 G;  2UXC L;  5GRO A;  4YCV A;  3CCJ A;  1I5F A;  4NXM L;  4IPG A;  3CMA A;  1JMC A;  2Z6K C;  4Y52 H;  1BKB A;  4DUZ Q;  3AFP A;  2Q2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...