1YHAA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhaA00
2YV5A 4BY1G 5IYBH 3S17H 3F2CA 3J81j 4B3ML 1WJJA 2AWNA 3STBD 3FHWA 3HOWH 3I7FA 1HJPA 2E5LQ 2GN5A 1E1OA 1YHAA 4C3HH 4A76A 4JBKA 4UPAA 4NXML 1YVCA 4GNXB 3ULJA 2QGQA 1AH9A 1XNRQ 2UXCL 1IZ6A 1LM0A 3I4MG 1SLJA 1A0IA 2EXDA 2F52A 4RG1A 4JBMA 4GKKL 1VQGA 3TS2A 1JE5A 1VQDA 1HZAA 3DLLA 1YIJA 4P75A 1QZHA 3W1BA 5C0XJ 1YJ9A 1X56A 3H3VH 2OTJA 5DLQE 4MZ9A 4GLAC 1NY4A 2KCMA 5GAGC 2A8VA 3PO2G 3PUZA 3S24A 1N34L 1HNZL 3AYHB 2UUCL 1PH9A 2L15A 4DV2L 1YITA 4LF5L 4JOIC 2VS1A 4LFAL 2CFMA 5IP7G 2Q2IA 1M1KC 1H95A 4DR5Q 1PH6A 2WP8J 3RZDH 1N9WA 1B8AA 3PUYA 4BA1I 4JI0Q 3J80i 4BY7H 2ZJRA 1E22A 4WJ4A 4GN3B 3ZJYC 1X3EA 1CKMA 4QGUA 3AQQA 2R93G 4FDBA 4X6AH 1J6QA 5IYDH 5JJIA 3JAMi 1VQ7A 1OXSC 4YCVA 1VQOA 2IHEA 2R7DA 4YWMA 4HIDA 1I94Q 5K36G 3S1MH 4A3DH 1KRSA 3DM3A 4A3IG 2E5LL 5FLMH 2OTLA 2RCNA 2VY3A 2K75A 3KJPA 1PFSA 1CSQA 3CCLA 3K81C 4JCVE 3GTPH 1XNRL 4PZ6A 1SMXA 2MQHA 1PYBA 3EBEA 3KFUA 4JI4L 2Z0SA 3NBHB 4DUZQ 4DV3Q 1WCMH 1EIYB 3KF6B 4HJ7A 4GKJQ 3HOZG 3PO3G 2E2IH 5C4XG 3KJOA 1AE2A 1Y1WG 1Q86C 1A63A 2WB1G 2RHQB 4X64Q 1JT8A 1V1QA 1TXYA 1UE7A 3G4SA 5ELOA 2YYZA 4DV1Q 2HQLA 3I56A 2Z6KA 3AFPA 5M3FG 4IOAA 3TQYA 4B3RQ 4DKAC 4X65Q 5FLXc 2ATWA 4DR4Q 1VQFA 3KDFB 2K5VA 3CAMA 3HOVG 1Y1VG 4DAMA 3S1NH 1NBWA 1G51A 1E3PA 2AWOA 3SGIA 4DUYQ 4DR5L 1WOCA 1PH2A 1SROA 1KQSA 2VL6A 4JI0L 4A3BH 4Y7NH 2D0OA 4A3EH 4JI2Q 1YBYA 2IX1A 2PQAB 1IXRA 1YEZA 1PH7A 1HZBA 3D31A 4QJFA 1OXTA 4B3TQ 3GTQH 1X3GA 3W1GA 4DR6Q 1JJ2A 1PH3A 1TWAH 3CXCA 5FJ8H 4R4OA 4B3SQ 4LF9L 2GVBA 1I94L 1IBKQ 4A3CG 1HZCA 1BKBA 3CPFA 4A3GH 3J81c 1YZ6A 4AYBG 4LF6Q 2VW9A 4HIOA 4Y52H 5BR8Q 3GD7A 1CKNA 2NVTH 4GN5A 4EQ5A 1XPOA 2F3IA 2K4KA 4O0AA 1K8GA 5M3MG 1GVPA 2K52A 4QY7A 1CUKA 1Q8KA 1K8AC 5E7NA 2CCZA 1XPRA 3HKSA 1G6PA 2MFIA 4DV3L 2OWOA 1UEBA 2K50A 4GKJL 5EAYA 1WFQA 4BBRH 4JC0A 4R1JA 3OTOQ 1UE6A 3M9BA 1VQHA 1P16A 1Q12A 2RHSB 4X64L 5IP9G 4QQBX 3HOYG 2UUBL 4PG3A 4AH6A 4DV1L 2E2HH 4DV5Q 3PIOA 3ICEA 4B3RL 1QVGA 4X65L 4DR4L 1FVIA 3H0GH 3F1ZA 1OXXK 2PI2E 4NB3A 1J5EQ 3W5OA 1WI5A 2I5LX 1EOVA 1SN8A 3PGZA 2AKWB 4DUYL 2Q2UA 4BY1H 4JV5Q 3PIPA 5JEAG 1I6HH 2HT1A 1Q46A 3IRBA 3PF4A 3K7UC 3M4QA 1VQAA 4DV7Q 4JI2L 1QUQA 2CQOA 1K83H 2BH8A 2YTYA 2HHHQ 2JJQA 2V1CC 1MKHA 1GO3E 1VS0A 4DV4Q 5C4JH 2CKZB 4B3TL 5JJLA 1VQIA 3GDEA 1UWVA 4IPGA 4JI4Q 3I4MH 4DR6L 3CP0A 3HOXG 4ALPA 1GM5A 4B3SL 3F8TA 5GADC 4LFBQ 1IBKL 4GOPC 5M5XH 2Q2HA 5C3EG 2Y0SE 3Q8DA 4PMWA 2JEAI 3AFQA 4R4TA 1Q81C 4LF6L 5BR8L 1SRUA 2GVAA 4LWCA 3M85A 1XMQQ 1LYLA 2WFWA 1XPUA 4JI7Q 4DK6C 2PI2A 3RLNA 4IFDJ 3EIVA 3T1YQ 3CF5A 1PVOA 1UE5A 3UDFA 4A3MG 1HR0W 3PO2H 4LF8Q 3RN2A 4JBWA 1HR0Q 2VNUD 4JI6Q 3CCSA 1PYSB 3E0EA 3TRZA 3I4NG 2MO1A 1QVFA 5IP7H 3K0XA 2YTXA 4HJ9A 3BU2A 1VQKA 3STBC 4GNXA 3OTOL 4BXXG 4OXPA 1NE3A 1X3FA 5J3BA 1IBMQ 1Q82C 1B7YB 1WYDA 1S72A 2KENA 1ASYA 1PV4A 3WWVA 4DV5L 1L1OC 5JJKA 3BZCA 2R93H 5C0XG 2F4VQ 3H15A 1J5EL 4LUZA 1KAWA 4LF9Q 1RIPA 4R4CA 4P72A 4IPCA 4DR7Q 2R7FA 4JV5L 4IOCA 2JA6G 3CC2A 3FP9A 2IHFA 4A3IH 4DV7L 3CCRA 1HNXQ 3CC7A 2EQSA 2AHOB 2OQKA 2HHHL 4BBSG 2B29A 4KLKA 2ZM6Q 4GOPB 4DV4L 2XGTA 2JA8G 1MJCA 2VQEQ 2IY5B 1KD1C 1SFOH 4GLVB 4LF4Q 3M3YH 2QA4A 1K9MC 3U4VA 2C35B 1YHQA 4LFBL 1V43A 1KC8C 1M90C 2UXDQ 4QL5A 3E9HA 4LUOA 3TEHB 5GAEC 4JI5Q 1TWGH 4DR3Q 3HOZH 4L5RC 3PO3H 2N49A 5C4XH 1Y1WH 3S15H 4YY3Q 4GN4B 4PZ8A 3T1HQ 4DNIA 1PHJA 3GTLH 1XMQL 2UUBQ 1FGUA 3L7ZC 3TREA 4JI7L 1I5FA 1VQMA 3T1YL 5H1SE 4YHHQ 5M3FH 2JA7G 1D8LA 3I4OA 3CW2C 3G6EA 4LF8L 1TWFH 3A0JA 2AMCB 4LW1A 1HR0L 4JI6L 3UE0A 5C44G 5IYCG 5C44H 3CCMA 3GTGH 3HOVH 1Y1VH 4KHZA 4NXNQ 2R92G 3JC66 1G291 3S1RH 1DGSA 1L1OB 1NJIC 2B63G 1IBML 2OQ0A 1I50H 2KHIA 3JAMc 4OWTB 2NVYH 4YCWA 3KF6A 3HFZB 1PH1A 1KL9A 2BA0A 5GAHC 1FL0A 4H02A 3GTJH 2CWAA 5LMNW 1VQ5A 2F4VL 2NN6G 1E7ZA 1NMGA 1V9PA 3K7AH 4APVA 5LMNQ 1EQQA 4X62Q 4DR7L 4A3KG 4JOIA 3S14H 2DUDA 2E8GA 4A3CH 5GROA 1OTCA 4KHPQ 1SE8A 3RNUA 3U58A 3KDFA 3LGJA 1N33Q 1HNXL 4A3LG 1EYGA 4WJ3M 1XJVA 4LNQA 2WAQG 4OO1G 2ZM6L 5M3MH 1YI2A 2JE6I 2JA5G 4JI1Q 2VQEL 3VDYA 1HH2P 4LF4L 1VQEA 2IT1A 1EWIA 1QZGA 4JYAQ 3PUXA 1VQ9A 2PQAA 2MNAA 1VQLA 2UXDL 4JI5L 4A93G 3GTMH 4DR3L 2ZTDA 3KLWA 4C3JH 3S1QH 3CCQA 1X54A 2VZAA 4YY3L 3T1HL 4A3JG 1IBLQ 5IP9H 4MTNA 4HIKA 4A75A 3HOYH 4XTCS 1MIUA 1L2FA 2LXJA 3J7A5 4YHHL 2I0QA 3HKZE 3RR5A 4P71A 3I2ZA 1LUZA 1X55A 4JI3Q 4A3FG 2VUMG 2VQFQ 5C0XI 3L0OA 2ZTCA 4NXNL 1XMOQ 1P8LA 3FKIG 4IO9A 3KOJA 1XTDA 2LXKA 3CMAA 2JK8A 2RF4A 3UDXA 2NVXH 4KI0A 3MXNB 3F2DA 1X65A 4DR2Q 2IX0A 4NPSA 4A4IA 5M5YH 1RL2A 3G48A 1W2BA 3ERSX 2CWPA 3D0FA 2R7ZG 1UE1A 5LMNL 1S3OA 2UXBQ 4IJLA 2R6GA 4X62L 2ZJPA 3HOXH 3U4ZA 4C3IH 3A5UA 2B3GA 3HOUG 1NTGA 1I3QH 1PH8A 4KHPL 1ASZA 5C3EH 4QIWE 4YWLA 1A62A 1N33L 1OXUA 5IYBG 5IE8A 3AEVA 3M7NA 3PUWA 4YCUA 1R9TH 3NEMA 4HJ8A 3HOWG 4A3MH 2E2JH 4JI1L 2UUAQ 2BH2A 2K5HA 1N8RC 2N8NA 4X66L 2Z6KC 2Q2TA 3I4NH 4LFCQ 1FJGQ 5ELNA 1HZ9A 3A74A 3CCVA 4JYAL 2EIFA 2NZOA 4ME3A 5IWAQ 4BA2I 1OXVA 4OWWB 2PNHA 2MO0A 1PA6A 4BXXH 2YU9H 1N36Q 1IBLL 4LF7Q 3KF8B 3PF5A 2Y0SG 1K73C 3PV0A 2YTVA 4RMFA 1YHBA 2ASBA 4JI3L 4DAYB 2VQFL 4DV6Q 2NN6I 3K8AA 4L5QA 1XMOL 1VQNA 4IFDG 1A8VA 3F2BA 4TVAB 3U50C 4P74A 3BJUA 2JA6H 4JI8Q 3MEFA 1TWCH 4DV0Q 1SR3A 1YNXA 4BBSH 4DR2L 3PCOB 1JJGA 4OO1I 1O7IA 4AQYQ 2JA8H 4XIGS 4BY7G 3NENA 3OYYA 1GD7A 2I5HA 1AE3A 1VCIA 4DR1Q 1VQPA 3CD6A 2UXBL 2DGYA 3RLOA 3CQZH 1U5KA 3CC4A 1Z9FA 1NMFA 1PH5A 4P73A 5AJ3Q 4OONA 4AIMA 5IYDG 2WB1E 1JB7A 2K14A 2I5MX 1JMCA 3CCEA 4UP8A 2JEBI 1IYJB 3PUVA 2N78A 3UDGA 2A19A 2HIVA 3TS0A 4R4IA 4GS3A 3CCJA 2JA7H 1C0AA 4IJHA 4A3DG 3I55A 1Q1EA 2UUAL 5FLMG 1VQBA 5IYCH 1Q1BA 2N3SA 3NELA 4LFCL 1W3SA 3J80c 3J81i 3J7ZC 4UY8C 1FJGL 2NVQH 3UDIA 5IY0A 5IWAL 1YJNA 1XNQQ 3GTKH 3RN5A 2BA1A 4GOPA 4DPGA 4K0KQ 1L0WA 2KBNA 2UU9Q 1WCMG 2B63H 4L5SA 1N36L 4LF7L 3GTOH 1HNWQ 5LMUQ 2R92H 5GQOA 3RLFA 1PH4A 3S16H 1GKHA 1X9NA 2XTIA 2D0PA 4GLXA 1EQRA 1N32L 1MJEA 1VQCA 1VQJA 1C9OA 2H5XA 4DV6L 1Q7YC 4UP7A 4A3KH 3ER0A 3PSIA 1VQ8A 1CKNB 4AYBE 4POFA 5HGQA 1VQ6A 4JI8L 2NZHA 3K80C 4OX9Q 4HJ5A 1N32Q 4DV0L 2D62A 4YWKA 2ZJQA 2WAQE 4A3LH 4B3MQ 1T9HA 1EUJA 2K5NA 1BBWA 3KYHC 1JJCB 1X6OA 4HJAA 4A3BG 2LSSA 4EX5A 4AQYL 2JA5H 4A3EG 1EFWA 2ZTEA 1KXLA 4MNOA 1L1OA 4X66Q 2FXQA 1U0LA 2HIXA 2JQOA 2PMZE 2QEXA 4DR1L 1IL2A 4NXMQ 3RZOH 3CMEA 5AJ3L 3CCUA 2UXCQ 1E24A 1CKOA 3E9IA 4A93H 1LTLA 3ULLA 1Z47A 1EIFA 2A1AA 4A3JH 5FJ8G 3B6YA 4GKKQ 1YJWA 3EN2A 4IPHA 4GNXC 3ULPA 1E1TA 4JBJA 4A3GG 4L5TA 1Y14B 5IT9c 3M4OH 4DK3C 1D7QA 4OWXB 5M5WH 1CSPA 3H3VI 4A3FH 2VUMH 4J15A 1QVCA 1TWHH 4JG2A 1KIXA 3FKIH 5JEAJ 2ID0A 2OCEA 4C2MH 3CPWA 1N34Q 1XNQL 4IFDI 4POGA 4O2DA 1HNZQ 4K0KL 2UUCQ 1QUQB 4DV2Q 4DUZL 3GO5A 3L2PA 2UU9L 2KCTA 4PZ7A 1BVSA 4LFAQ 4IPDA 5LMUL 4LF5Q 4HIMA 2KHJA 1HNWL 4LUVA 4BBRG 3OW2A 3G71A 3S2HH 2ES2A 3BZKA 5HY6A 1KRTA 3S2DH 3A5ZB 1S40A 3M4PA 2R7ZH 1KHIA 2JA9A 4UP9A 1BBUA 3H0GG 3UE1A 3HOUH 3HKZG 1K3RA 2ALYB 1K0RA 4R4QA 4TQUS 1C7YA 1B70B 4OX9L 1VQ4A
chains in the Genus database with same CATH superfamily
1SE4A 2YV5A 3S17H 4B3ML 2A6HC 3I7FA 2GN5A 4C3HG 1D1IA 1SYGA 4UPAA 2WACA 4C3HB 2QGQA 1AN8A 5IGFA 1XNRQ 2QEJC 2QF7A 1VQGA 3QIAA 2C9OA 3NQIA 4P75A 5M5XB 1QZHA 3W1BA 1YJ9A 4X3TA 3LWEA 4L6TB 3N6RA 2A8VA 3PUZA 1TS2A 2L15A 1K28A 1YITA 4FF3A 4LFAL 2Q2IA 2EYJA 2ICEC 3QOLA 4DR5Q 1B8AA 1QE6A 2BDOA 3PUYA 3J80i 1WTXA 1E22A 4WJ4A 1G6ZA 1X3EA 3C2PA 1CKMA 5KGUA 4FDBA 2GA4B 5JJIA 2H4OA 1VQOA 4IALA 4DAYA 4IUNA 1BCPC 4FNFA 4TRDA 1I94Q 1LTAD 3ND8A 3QR8A 4CJ0B 2FFKB 1STGA 1KRSA 4A3IG 4A3DB 2RCNA 4A3IB 3E6ZX 1CSQA 1QILA 4QUCA 1ILPA 4JCVE 3GTPH 5ISRA 3CRKC 1LACA 1R4QB 3KFUA 4JI4L 4DV3Q 1WCMH 3MVVA 1SYEA 5CORA 3PO3G 3GP7A 1KABA 2B2VC 2F0NA 4CJ2C 3PO3B 5C4XG 1Y69U 5C4XB 2SEBD 4K5XA 1A2UA 2Z6KA 4DKAC 5FLXc 2ATWA 1KNEA 1PDQA 1VQFA 2QILA 3KDFB 1TWFB 3S1NH 3GTGB 1T5XD 3M4YA 5C5LA 3J7AV 1JWUD 3R3OA 4JI0L 2D0OA 2J7ZA 1MSGA 3MA2B 2A68C 4F7XA 4ID6A 1BCPB 4I7ZC 3S9WA 1C8CA 4E6IA 3GTJB 1JCKB 1S5CD 1STHA 1GHKA 3K7AB 1TWAH 4R4OA 5CYUA 1IBKQ 4A3GH 3MEHA 4KJNA 2F0JA 4HIOA 2NVTH 4EQ5A 5JOBA 2K4KA 2JSOA 2Z6BA 5JVH3 1SYDA 2EJGC 1RCVD 1MSHA 1G6PA 3MTSA 2M00A 3A56A 1BR9A 2OWOA 2K50A 2EY1A 4B9WA 2VB2X 3OMGA 4R1JA 4C3JG 1SNQA 1Q12A 4C3JB 3AU7A 4X64L 3S1QB 4DV5Q 3PIOA 3ICEA 4KTAA 1FVIA 3F1ZA 1HQRD 4QUFA 1WI5A 3A8IE 1JOKA 4FF1A 1NR2A 2HCIA 4JV5Q 2PO4A 3OIPA 1U9RA 1I6HH 2B2VA 4OIKA 5HURA 3M4QA 2JYOA 5ELFA 5CGKA 3PIO3 1K83H 3T13A 2V1CC 2IW3A 1GO3E 4DV4Q 1B2TA 1F2LA 1JOOA 4ZQ3A 3GDEA 4JI4Q 3MXPA 4LAAA 2AQ1B 4LFBQ 4B3SL 5GADC 5C3EG 4HEDA 4DFAA 5C3EB 4LF6L 3F2UA 1HUNA 5BR8L 1XMQQ 2GVAA 4Y52H 2PCFB 4QIWB 1PVOA 3EIVA 3T1YQ 1UE5A 3UDFA 4A3MG 4LF8Q 1TS3A 4A3MB 1HR0Q 3QJYA 3CCSA 3HEJA 4CKEA 3KLSX 2MP1A 3BDCA 1EY8A 1Y8OB 4QMGA 2YTXA 3BU2A 1BXTA 2KJXA 3OTOL 2HDLA 1B7YB 1WYDA 2KENA 3BG3A 3MFYA 2F0KA 2EXZA 1EY6A 1RIPA 1ZXTA 1FNUA 4EGVA 5K36H 4DV7L 3CC7A 2EQSA 2HHHL 5T1GA 2K5DA 1STYA 1MJCA 3VA7A 1R4PB 4J6HA 2B2UA 2VQEQ 4GLVB 3M3YH 5FK9C 4IURA 1F9RA 4L5RC 2N49A 4PZ8A 5IODA 1KDAA 1PHJA 4LMQD 1LO5D 4JI7L 1CHPD 5M3FH 1D8LA 3I4OA 3CW2C 2RVLA 4LW1A 4K14A 3PMFA 5IYCG 3HOVH 4NXNQ 3JC66 1Y1VB 3W2DA 3S1RH 2MJ8A 3TP6A 5BN4A 3LNNA 2XIWA 3KBXA 1NJIC 3P75A 1IBML 1I50H 2F0TA 4FF2A 4KKUA 3JAMc 5LL6S 4FO2A 2F0DA 3H6MA 2NN6G 1NMGA 1S4ZA 1EQQA 4A3KG 1F2MA 4A3KB 1WTVA 1EIGA 3OIQA 3LGJA 1STNA 5JJZA 1N33Q 5KRUA 1O7YA 2A6ED 1XJVA 4ZCKA 4BS9A 4DNTB 2ZM6L 2JE6I 4KK7A 2F0HA 1D1KA 1QZGA 2SOBA 3O13A 4FXKC 3PUXA 1VQ9A 2PQAA 2RSNA 2L0CA 2MNAA 4JI5L 4A93G 4UDUC 2ZTDA 4CHTB 4A93B 4YY3L 5IP9H 4HIKA 1MIUA 3AB9A 2I0QA 3DWAA 1HQMC 5C0XI 2QDLA 2VQFQ 3MXGA 2PNRC 3FKIG 3KOJA 3FKIB 5JEAH 4K2LA 2RF4A 1EL0A 1EFID 2NVXB 2IX0A 1RL2A 2J0TD 1I4RA 5I2YA 2JXMB 1NAPA 2ZJPA 1CFMA 2B3GA 3EROA 5KYLA 4YWLA 1A62A 3AEVA 1TR5A 3PUWA 1R9TH 3S17B 3C1FA 2SNMA 3V05A 2DNCA 1MHWC 2E2JB 4X66L 4KD4A 3I4NH 5ELNA 1HZ9A 1EZ8A 4HMJA 4ME3A 3SK5A 1OXVA 1Q90A 2EZVA 1KAAA 1NR4A 1SNDA 3A7LA 3VR4A 4RMFA 2YTVA 2KOLA 4JI3L 3VA5A 5C0XH 5J22A 4DV6Q 1XMOL 1F2YA 2CW0C 1SAPA 1A8VA 1I6VC 4TVAB 3BJUA 3NHHA 3CHBD 1SR3A 4BBSH 4XQQA 2D9UA 1XX8A 3D6WA 3OYYA 2PYKA 3CD6A 1H9RA 3CQZH 1U5KA 5AJ3Q 3T56B 1TY0A 4C1NK 1JB7A 4FP5D 3CCEA 3UDGA 4QF4A 3BVGA 3CCJA 3LX0A 1Q1EA 4RGTA 2UUAL 4OGQC 3W3AA 1GUSA 5I9PA 3SE0A 4ZKBB 2N3SA 4LFCL 3J80c 1FJGL 1HCZA 4M8AA 3GTKH 3GTPB 3RN5A 4DPGA 3K57A 1WCMG 2B63H 4L5SA 4ZKCB 4KY6A 1WCMB 4MN3A 3RLFA 4KMUC 1GKHA 1LTBD 2B2TA 1X9NA 1SSOA 4GLXA 4HMIA 3NPPA 4M1UB 1EEFD 3FDTA 1VQ8A 1AFPA 3K80C 3SR1A 3S1NB 4DV0L 4H44C 3WOFA 1YNJD 3D4RA 3KYHC 4XQNA 2LSSA 4EX5A 2JA5H 3D4WA 4X66Q 2ZT9C 3QG1A 1FGBD 3CMEA 1E24A 2X6GA 1PYWD 1EIFA 4A3JH 3B6YA 3EVQA 3EN2A 1TWAB 4GNXC 4A3GG 4JBJA 5IT9c 4A3GB 2KA7A 3D4DA 4OEMB 1D7QA 1L0YB 4DXFA 4NMZA 2A69C 4A3FH 1TWHB 5JEAJ 3CPWA 1N34Q 1QNKA 1RDPD 4C2MB 4K0KL 2UUCQ 1FD7D 4DV2Q 2UU9L 2WV6D 5KNCA 2DN8A 5DNFA 1BVSA 3VR3A 4IPDA 1JWSD 1HTLD 3QWNA 4B08A 1JQYD 2A6EC 1SJED 2D5DA 3S2HH 1YNND 3U9SA 1LT5D 1S5ED 3T53B 3A5ZB 1BCPF 5DEHA 3M4PA 1S40A 2JA9A 2NYZD 4UP9A 1EY5A 3HKZG 2B2YA 2ALYB 3A54A 4HAEA 4R4QA 1B70B 4DK1A 3F2CA 3J81j 2AWNA 2KQ3A 4G7ZC 3FHWA 1D5XC 1CQFA 1I6HB 2E5LQ 1E1OA 2K28A 3FPUB 1HUMA 3VYUA 4JBKA 5D3DA 2VXWA 1K83B 1GUGA 1YVCA 4GNXB 1AH9A 1ENFA 1KTKA 2UXCL 1IZ6A 2L1BA 4RG1A 4GKKL 3TS2A 1STBA 1KDBA 1AW7A 3DLLA 3J81L 5EGTA 5C0XJ 4OELB 1X56A 2OTJA 2F0PA 4WFN3 4NDXA 1V8QA 5KNDA 1HNZL 4JOIC 1MGSA 1H95A 3MXUA 1H9KA 2WP8J 3KK7A 3D8GA 4LK1C 4BA1I 4CDCC 4BY7H 2ZJRA 4C1NI 3ZJYC 1UEAB 3AQQA 1TT2A 5IYDH 3JAMi 3C46A 1IYUA 3URYA 2B8GA 4YWMA 4DXGA 5DM73 3K5OA 5K36G 5CV4A 3J81E 1RODA 3S1MH 1C4QA 4C56C 5E3FA 1F9PA 3KJPA 1PFSA 3NTKA 3TN2A 3K81C 1XNRL 3NBHB 4TSSA 3M3YB 1EIYB 3KF6B 4GKJQ 1AP0A 5D65A 2E75C 2OT2A 3TP7A 3P1HA 1A6XA 2RHQB 1V1QA 1TXYA 1UE7A 1SMYD 4K8IA 3G4SA 5ELOA 1QG7A 5M3FG 1WVLA 4DR4Q 1DZ1A 5M3FB 3HOVG 1ICWA 3HOVB 1G51A 1E3PA 2AWOA 3SGIA 5C3XA 4DUYQ 4EQNA 3S1RB 4DR5L 1WD0A 1ZKOA 4JI2Q 2M2LA 1I50B 2H1EA 1IXRA 4BWGB 1OXTA 1LTGD 4B3TQ 1X3GA 2NTTA 4IZ8A 3W1GA 5FO9B 1BF4A 4LF9L 1MD2D 2GVBA 4RHSA 1I94L 1HZCA 2F0WA 1YZ6A 1CA6A 2RQXA 1K8GA 3NP8A 1I4XA 4DV3L 4QB4A 1DXMA 3TZUA 1BOSA 1S5BD 5EAYA 1WFQA 1WD1A 2LS01 4JC0A 1B3AA 1UE6A 3A8KE 1VQHA 3M9BA 1P16A 5IP9G 4PG3A 1WTQA 2DJFC 1PTOC 3I91A 3J80L 1A3TA 1EOVA 3PGZA 3PIPA 5JEAG 3IRBA 4CGYB 1EY0A 3K7UC 2N88A 2CQOA 2YTYA 1A15A 4RGOS 1CQVA 5C4JH 1TU2B 3SEBA 1UWVA 3CP0A 4EQOA 4ALPA 5I9OA 1IBKL 3PIP3 4GOPC 1PRTF 2FJ2A 4PMWA 3E3XA 3Q24A 3QB3A 1SRUA 2B2WA 1XPUA 3M85A 4DK6C 2PI2A 3RLNA 1R9TB 2XRQD 2IJ0A 3PO2H 4JBWA 4JI6Q 3I4NG 4DK0A 3I4NB 4G7OC 4LJZC 4ZRZA 5IP7H 3K0XA 4Q5VA 1VQKA 1WTOA 2WKDA 5J3BA 1ESRA 1AEXA 2Z4HA 1PTOB 4ZK9B 4DV5L 4JVZA 4KHVA 5JJKA 3BZCA 2R93H 5C0XG 5EPJA 2F4VQ 4RCNA 2MGSA 4LF9Q 4P72A 1A3UA 4JV5L 3DEPA 4IOCA 1SNPA 4V190 1VF7A 2IHFA 1HNXQ 1G91A 4BBSG 2L12A 1I4PA 4KLKA 4BBSB 4GOPB 4DV4L 5NUCA 2XGTA 1KD1C 4LF4Q 1B53A 1K9MC 2C35B 1YHQA 4LFBL 3CQZB 4QL5A 3TEHB 1E0BA 3SK4A 1PZKD 1GHJA 2KVMA 1Y1WH 3T1HQ 4N9PA 4DNIA 2IWHA 1XMQL 2PZWA 1FGUA 3L7ZC 3T1YL 2IX3A 3A55A 3G6EA 4LF8L 2BDNA 3BYYB 4H0LC 1HR0L 2FMMA 3UE0A 5C44G 3Q6SA 5C44B 1G291 3RD4A 3GTKB 2KEEA 3OSOA 2B63G 2OQ0A 4ZLTF 2B63B 2Q8RE 2KHIA 4OWTB 2NVYH 3HFZB 2BA0A 4FVMA 2CWAA 5LMNW 1VQ5A 1E7ZA 5IGDA 3K5MA 4X62Q 3S14H 1IW7D 2E8GA 4A3CH 5GROA 4N9TA 2X6LA 3U58A 3KDFA 1SMYC 1ZYRD 4WJ3M 5M3MH 1YI2A 2JA5G 2TSSA 2VQEL 2JA5B 5I2XA 3K5LA 3G7LA 4JYAQ 5CV8A 3GTMH 1EQVA 1BNZA 1TS4A 2VZAA 4A3JG 1IBLQ 2LKVA 4A3JB 4MTNA 5EKKA 1I4GA 2EDGA 1IKLA 1A2TA 3HKZE 3GV6A 3I2ZA 4A3FG 2ZTCA 4NXNL 4IO9A 2KUMA 1QWYA 1XTDA 3K6OA 2DY7A 5C4ZA 3UDXA 4NP5A 1FR3A 3MXNB 1X65A 4DR2Q 2XWBB 4NPSA 3S2HB 5M5YH 1Z7TA 5EBCA 1SJHD 1HXYD 3HOXH 3U4ZA 4C3IH 5JPNC 2EPBA 4RKBA 3DMUA 4ZAIA 1N33L 2EJFC 1F2ZA 1RJTA 3NEMA 4HJ8A 2TMPA 2BH2A 5KIXA 1IHZA 2N8NA 4ILWA 3CCVA 4UHVA 4CDDC 3C3LA 2PNHA 2ICIA 2YU9H 1N36Q 3KF8B 3BDOA 1LLRD 2DNEA 1EYDA 1PZJD 4EVOA 3SK8A 1K73C 2ASBA 5J39A 2VQFL 4DNRB 4N8FA 1VQNA 4DU9A 3R93A 5G3LF 2B8FA 1ONLA 2EYLA 3NSWA 1YNXA 3PCOB 4AQYQ 4BY7G 1A3VA 1GD7A 1H9SB 2I5HA 4DR1Q 4BY7B 2DGYA 4K2KA 1NMFA 4P73A 3FMCA 4AIMA 5IYDG 4S3SA 2F03A 4UP8A 1IYJB 3PUVA 3TS0A 2A19A 2HIVA 3BVZA 4IJHA 3I55A 1J8IA 3KUPA 5IY0A 1YJNA 1XNQQ 2A73B 2KBNA 3GTOH 1HNWQ 5LMUQ 2PW5A 3I90A 3S16H 2XTIA 2D0PA 1EQRA 4OIJA 1MJEA 5JPMC 5EBDA 1C9OA 4DV6L 1CA5A 3IAYA 3P7JA 3PSIA 1JOQA 1CKNB 4POFA 1VQ6A 1NSNS 2RBMA 5DAUA 3V2TA 4OX9Q 4HJ5A 1N32Q 4A3LH 1T9HA 3BS1A 1EUJA 2K5NA 3TSSA 3J7YW 1SNOA 4O1NA 4MNOA 2F1MA 1IYVA 4NXMQ 3WOEA 3RZOH 2O4XA 5I6YA 5AJ3L 1FNVA 3CCUA 3ULLA 2A1AA 1YJWA 5LL6X 3M4OH 5M5WH 2JN4A 3A8JE 2VUMH 1KIXA 4XT1B 2ID0A 1HA6A 4IFDI 2RKSA 5IGCA 1QUQB 1DOKA 3L2PA 4XYOA 4LF5Q 4PZ7A 2BE5D 2V4DA 2KHJA 2KEDA 4LUVA 1HTPA 3OW2A 5HY6A 1LT6D 1CHQD 3S2DH 2MPMA 4PNYA 3HGBA 1SXTA 2L5TA 1BBUA 3ERQA 4KJOA 3UE1A 5FLXL 4DN4M 1VQ4A 2K33A 3FRPB 2K05A 4CBVA 1HJPA 4C3HH 2PZUA 4KKTA 4O42A 2NBFA 4XYQA 5M9OA 1DOLA 3I8ZA 5C4JB 1LM0A 1A0IA 2F52A 4JBMA 1JE5A 1HZAA 4FYDA 3RUZA 5DLQE 4MZ9A 5E4XA 1GUNA 4GLAC 3DXJC 2KCMA 3PO2G 4IFDH 1PZID 5FLXE 1N34L 3PO2B 3L3OC 1JR0D 1PMRA 3AYHB 2UUCL 1PH9A 4HCEA 4DV2L 3GQBA 2SNSA 2CFMA 5IP7G 3IKJA 1T5EA 4RAUC 3RZDH 3TDQA 1GOZA 3H09A 5D3IB 4GN3B 5C6AA 4QGUA 2ZXOA 2R93G 4X6AH 1K3BC 2R93B 1VQ7A 1OXSC 2HQEA 1M8AA 3NUCA 2IHEA 4HIDA 5CMDA 4I65A 1GUTA 4A3DH 3DM3A 1SNCA 1TY2A 2E5LL 2VY3A 1SNMA 1PYBA 2MQHA 5ELEA 3OHXC 1KNAA 2RDGA 3KJOA 1AE2A 1Y1WG 4FXGC 1Q86C 2WB1G 1PTOF 1Y1WB 1JT8A 3NK9A 2YYZA 4DV1Q 2HQLA 4B3RQ 3AFPA 1I4HA 4X65Q 1O7ZA 4L8JA 3IFDA 3CAMA 1NCVA 2EOTA 1KLUD 1PH2A 1II3A 1KQSA 4Y7NH 1QJOA 3TZDA 3SK6A 1YBYA 3BYTB 1YEZA 2NVYB 2KCCA 1HZBA 3D31A 2EYOA 2DJGC 3GTQH 4DR6Q 3I4LA 1Y8NB 1JJ2A 1PH3A 3CXCA 5FJ8H 4A3CG 3CPFA 2XSCA 2QW7A 4GN5A 2NVTB 2F3IA 3NWSA 4O0AA 3TBIB 5M3MG 5M3MB 1CUKA 1Q8KA 1K8AC 5E7NA 4HR7B 1XPRA 2Z1CA 3HKSA 2MFIA 2JP1A 4GKJL 1SYFA 1CK1A 4BBRH 3K59A 3GTMB 2RHSB 4XDXA 1HPCA 2E2HH 1QVGA 3IL8A 2WKCA 4DR4L 3H0GH 3DM1A 2AUJD 3HKZB 1J5EQ 3W5OA 1SN8A 4J1MA 5EJWA 2AKWB 4DUYL 1WTRA 2Q2UA 4BY1H 1LABA 1V1PB 1VQAA 4JI2L 3JAML 2BH8A 5CV9A 5J1ZA 2JJQA 5F2DA 1MKHA 3T4AC 1VS0A 1ILQA 4MHEA 5M5YB 5LHY1 4B3TL 3NXWA 4IPGA 3I4MH 3HOXG 1EEID 2BE5C 4C3IG 3HP3A 3QO2A 3HOXB 4C3IB 2JEAI 4HCSA 4R4TA 1Q81C 1LYLA 4IFDJ 2XWJB 2AQ2B 3NQTA 1M4VA 3SXHA 4ME5A 3RN2A 2VNUD 2J4XA 1PYSB 3NTHA 3TRZA 2K03A 1DM0B 2MO1A 1QVFA 4HJ9A 4GNXA 3X3NA 4OXPA 3D6CA 3CU7A 5I4DA 1Q82C 1BCPD 2YU9B 3JAME 1ASYA 1PV4A 1IKMA 1JB3A 3NE5B 4V0BA 3SHLA 1L1OC 4KY7A 4ZYSA 3H15A 4LUZA 1KAWA 1J9OA 1EQTA 4DR7Q 3MZ5A 1RF2D 4CDEC 3FP9A 4CJ1B 1BUVT 2XN9C 2OQKA 2B29A 5EKIA 4IUTA 2IY5B 1VF5C 5C5MA 1SFOH 4ODGA 5ELDA 2QA4A 1MBYA 2KECA 1CZWA 1VMPA 1M90C 2UXDQ 3E9HA 4LUOA 1H9JA 5GAEC 3HOZH 1TWGH 5CBEE 4DR3Q 3S15H 5IGBA 3GTLH 3SVMA 3TREA 1HFNA 1UUPA 1EY4A 4YHHQ 1K8OA 3A0JA 2A68D 4JI6L 3CCMA 1GUOA 1Y1VH 4KHZA 4F88A 1RD9D 1DGSA 4Q0FA 1L1OB 1FYCA 3NBHA 1WTPA 4YCWA 4ZUIA 3KF6A 4KN4C 1KL9A 2M9VA 5GAHC 1FL0A 1SYCA 1Q3LA 2F4VL 3BDLA 5LMNQ 4DA2A 2NB0A 1D6EC 4JOIA 3Q22A 2A5HA 3P20A 4KHPQ 4PQXA 3Q23A 1W6JA 1U4LA 1HNXL 4A3LG 3KLSA 4JI1Q 4OHJA 2K04A 3VDYA 1HH2P 4LF4L 2IT1A 1EWIA 4KY5A 2IL8A 1CTMA 3RZOB 2F0IA 1VQLA 1YNJC 3KLWA 3CCQA 1X54A 2I07B 3T1HL 3HOYH 4A75A 4XTCS 1PFMA 5AFWA 3J7A5 2I46A 3M4OB 1TS5A 3NWTA 3RR5A 2G5DA 4P71A 1X55A 5M5WB 1O7LA 2VUMG 5IGEA 2K32A 1P8LA 1SDFA 2NUCA 3VR2A 1QNUA 3CMAA 2JK8A 4YIJA 4RA8A 1LTRD 1EY9A 2Z8LA 4KI0A 2NVXH 1TVXA 1F77A 3H91A 1SBBB 5HGTA 4A4IA 1JE4A 2BOSA 3G48A 2CWPA 5E4WC 1SYBA 1UE1A 2UXBQ 1S3OA 3S2DB 3M7GA 2R6GA 3H94A 4X62L 5ELCA 2E2DC 1I3QH 1QB5D 1YNNC 2CH4W 3BZDB 1OXUA 1Z6HA 5IE8A 4YCUA 4KKSA 2O5JC 2E2JH 3MFGA 2K5HA 4EQPA 2Z6KC 3J80E 2F0QA 4JYAL 2EIFA 5IWAQ 1H9MA 2B39A 1O78A 1PA6A 4BXXH 4LF7Q 1IBLL 3Q0AA 3HZXA 1EU4A 3G6JB 5IT9L 2QCPX 2Y0SG 1CZGA 2Y0SB 4DAYB 4IFDG 3OPOA 3F2BA 5I6WA 2JA6H 5CV5A 1PXUA 4JI8Q 1F9QA 1TWCH 3MEFA 5CV6A 4DR2L 2ZXRA 3RZDB 4OO1I 5CBAE 2JA8H 3NENA 4CKCA 3RLOA 4F87A 1Z9FA 2WIIB 1PRTD 2FMCA 4OONA 2NZ1D 4R8NA 1RTNA 1NNXA 2WB1E 2K14A 1Q8IA 2N78A 4IUUA 4B9XA 4R4IA 4GS3A 1E2ZA 5FKAC 5IT9E 2JA7H 4A3DG 1VQBA 3NELA 4IUQA 2R92H 1W3SA 2XRSD 3I72A 2NVQH 3R2IA 1RTOA 2BA1A 4GOPA 1EYAA 2E76C 1BQQT 1L0WA 2K1BA 5CC4A 1N36L 4JW0A 4WJWA 1JICA 1D5ZC 1MI2A 1QCBD 1VQCA 5COYA 4XXEA 2LY7A 5A35A 4P2CB 2F0EA 5HGQA 1HFGA 3OWFA 4HTHA 2ZJQA 2WAQE 1ICFB 4B3MQ 4MTKA 1BBWA 1ENAA 4OO1H 1X6OA 4HJAA 4AQYL 4Y7NB 1KXLA 5K5PA 1VMCA 2HIXA 2JQOA 4DR1L 3E5SA 1SE2A 1CKOA 1LTID 4PMCA 4MIUA 3GTQB 1Z47A 3D3RA 5FJ8G 1UAPA 1E1TA 4DK3C 4OWXB 3H3VI 1WTWA 2RSOA 4J15A 1TWHH 4A3FB 1AZPA 2OCEA 3I73A 4C2MH 1XNQL 4ULLA 4POGA 5FO7B 2CH4A 1DOMA 3GO5A 4NKLA 4DUZL 2KCTA 1HNWL 4LFAQ 3E0JA 5LMUL 4BBRG 3G71A 2ES2A 4BBRB 3R8BA 3BZKA 4Z9CB 3K5NA 4FXDA 1KRTA 1Y8PB 1EWHA 2R7ZH 2E2HB 3H0GG 2B2UC 3HOUH 1B9MA 1BO0A 3H0GB 2HCCA 4RWSC 4OX9L 1N32L 4BY1G 5IYBH 1HA5A 1U4RA 4BY1B 1WJJA 2P5ZX 3STBD 4FF4A 3HOWH 1C48A 3HRZC 5IIFA 4GZYC 1YHAA 3T51B 3TMEA 4A76A 4NXML 3MXNA 3ULJA 2R61A 5D14A 3I4MG 1SLJA 2EXDA 2KCNA 4K6LA 3I4MB 2CW0D 2MHVA 3OWEB 1VQDA 2FHTA 2EYPA 1YIJA 1IL8A 4X3SA 2PW7A 1E2VA 3H3VH 1L0XB 1GUWA 1AZQA 1B4OA 5KYIA 1NY4A 5GAGC 1XXGA 2PQEA 3S24A 2F3VA 2L9HA 1JC7A 1I4QA 4LF5L 2VS1A 3HG9A 1X3QA 1M1KC 1CM9A 2X69A 1PH6A 1KLGD 1N9WA 4OL7A 4JI0Q 2K5WA 2F0UA 2ZXPA 3KF8A 4K5VA 5DM63 4K8JA 1W6KA 1J6QA 4RGMA 4QCLA 4YCVA 5BN5A 1DYQA 2R7DA 2KHSA 1LT3D 1EOTA 3S1MB 1TKWB 5FLMH 2OTLA 2K75A 5EPKA 3CCLA 4PZ6A 1SMXA 3EBEA 1DCZA 2Z0SA 4DUZQ 1SFOB 4HJ7A 1H9SA 3HOZG 2E2IH 4HSVA 2NWGA 3HOZB 1A63A 1TWGB 4X64Q 1B1ZA 3S15B 4WRDA 1HHVA 3WDNA 3GTLB 2F0VA 1PLFA 1JORA 2AQ3B 3I56A 2LMCB 4IOAA 3TQYA 1PRTC 4RGNA 1EWCA 2K5VA 1LT4D 1K8MA 1Y1VG 2G9HD 5G3LD 4IUPA 1NBWA 2A74C 3UI2A 4DAMA 5BN3A 5IGGA 1JWMD 2VB3X 4U673 3NBIA 1WOCA 1SROA 2VL6A 4RH6A 4A3BH 4A3EH 2HD3A 1RKNA 2PQAB 2IX1A 1PH7A 1GXDC 4QJFA 2A69D 2L4NA 4B3SQ 1ENCA 1BKBA 4R8IA 3J81c 4L63B 5EPLA 4AYBG 2VW9A 4LF6Q 5BR8Q 3GD7A 1CKNA 4AYBB 4K6DA 4ABNA 1XPOA 3NTIA 1GVPA 2DY8A 2K52A 4QY7A 3OOCA 5E1FA 1IW7C 1LTTD 3VR6A 2CCZA 5EKLA 1UEBA 2HUGA 2PMZB 3QOJA 4R9WA 3VYTA 1ZYRC 1PRTB 1XWEA 3OTOQ 4QQBX 1D5MC 3HOYG 2UUBL 2EYMA 4AH6A 4DV1L 3HOYB 4PMBA 4TKOB 4B3RL 4X65L 4UAIA 1OXXK 2PI2E 4NB3A 1ET9A 3ITPA 2I5LX 2QDBA 2QKIC 2HT1A 1Q46A 3PF4A 3CKIB 4DV7Q 1QUQA 1WTHA 2F4IA 2HHHQ 2EY6A 3VYRA 2CKZB 5JJLA 1VQIA 1V1OA 4XQJA 4DR6L 5A2QL 1GM5A 2L55A 3F8TA 3KLRA 1XTCD 5M5XH 2Q2HA 2Y0SE 1I3QB 3Q8DA 1HRJA 3AFQA 3FVQA 1TIID 4LWCA 2B2TC 4WORA 2WFWA 2EVBA 4JI7Q 3CF5A 4G57A 1HR0W 2F3WA 3E0EA 1GJXA 2NTSA 2EJMA 3STBC 2XVSA 4BXXG 3C1EA 1NE3A 1X3FA 2OF1A 1IBMQ 1PTOH 3N52A 1S72A 2OXPA 1U4MA 3WWVA 2K6AA 5C3WA 1ML0D 1NUCA 3OMCA 1ESFA 1J5EL 5IOCA 5A2QE 5CR3A 4R4CA 4IPCA 1KDCA 2R7FA 2JA6G 3EQLC 3CC2A 2JA6B 2RDHA 1TQOA 1DONA 2Z4IA 1TWCB 2Z9HA 4H7BA 3CCRA 4A3IH 3AMUA 1BBXC 2AHOB 2ZM6Q 2LFNA 2JA8G 2JA8B 1SEBD 2E74C 3U4VA 5JAVA 4HSPA 1V43A 3KBGA 1KC8C 3DUZA 3DEOA 4JI5Q 3PO3H 4H13C 5C4XH 3CRLC 4GN4B 4YY3Q 2WB1B 2UUBQ 1I5FA 4RCOA 1VQMA 2SDFA 5H1SE 2JA7G 4K5WA 2JA7B 1TWFH 2AMCB 2F0MA 1G2TA 3GTGH 2CVRA 5C44H 4U68A 2R92G 4NW2A 2R92B 2XNAC 2B2YC 3R2TA 3EJIA 3ND9A 4DGZA 2NVQB 4X3KA 4CKBA 2PPBC 2CHBD 3EFXD 2R3ZA 4KD3A 2PZTA 1PH1A 4H02A 2D2CC 3GTJH 1B50A 1V9PA 3K7AH 4APVA 4DR7L 2L11A 2DUDA 3S14B 3VYSA 1OTCA 1SE8A 3A7AB 3V96A 3RNUA 2HDMA 1EYGA 4RHRA 3T16A 4LNQA 2WAQG 4OO1G 4JPBW 2WAQB 1VDZA 4G7HC 5FO8B 1RHPA 1VQEA 2OEOA 5JVG3 3LWUA 2UXDL 1E2WA 3DWPA 4DR3L 4PV1C 4C3JH 3S1QH 1PTOD 3MHBA 2A6HD 1L2FA 3RMHA 2LXJA 3HS0C 4YHHL 3I70A 1LUZA 4JI3Q 2EE1A 3L0OA 2BCOA 1XMOQ 1U4PA 5ELBA 2RDFA 2LXKA 5CV7A 3H3VC 1STAA 3F2DA 4G4KA 1W2BA 3ERSX 3D0FA 2R7ZG 5LMNL 2EY5A 4CDFC 4IJLA 3J7AF 2R7ZB 3A5UA 1O80A 1NTGA 3HOUG 1B3QA 1PH8A 4KHPL 1CI3M 2ENBA 5C3EH 1ASZA 3HOUB 2K01A 4QIWE 2EY2A 3TP5A 1EU3A 5IYBG 3M7NA 1FNWA 2FINB 3MC0B 3HOWG 4A3MH 4JI1L 2UUAQ 3HOWB 5EQ0A 1N8RC 1D2BA 1EYCA 1DJRD 2Q2TA 1V1PA 4LFCQ 1QOHA 1FJGQ 3IFTA 3A74A 2CQAA 2NZOA 4BA2I 1BDOA 2WINB 4OWWB 2MO0A 5L37A 2AUKA 1SE3A 1DD2A 2EYHA 3PF5A 4TQUS 2EYFA 2IPKD 3PV0A 1YHBA 1STEA 2NN6I 3K8AA 1LV9A 4L5QA 2K5QA 4IN3A 4JK1C 4IUVA 4P74A 3U50C 4KN7C 1B44D 4DV0Q 1OO9B 3ZYYX 1JJGA 1O7IA 4J8QA 4XIGS 2F0OA 4DF7A 1ET6A 4ZUJA 4DAPA 1AE3A 1VCIA 2UXBL 1VQPA 3CC4A 1PH5A 1EIHA 4XT3B 2G9DA 2I5MX 1JMCA 2JEBI 5KEEA 4RKLA 2F0FA 1B9NA 2Q8IB 1F9SA 1C0AA 1G2SA 5FLMG 3EA6A 4DAVA 3MWYW 5IYCH 3SDZA 1Q1BA 1S5DD 3L9AX 3J81i 3J7ZC 4UY8C 3UDIA 5IWAL 2MUYA 1K0SA 2F0LA 4K0KQ 2UU9Q 2F0SA 4LF7L 3PQIA 3GTOB 3ONAB 3TP8A 5GQOA 1EY7A 1G8ZD 5T1IA 1PH4A 3S16B 3VR5A 2E2IB 1X3PA 2O2LD 1VQJA 2NN6H 3U9OA 2H5XA 1Q7YC 4RFBA 4UP7A 4A3KH 3ER0A 1LTSD 2O5IC 1PFBA 5FOBB 4AYBE 4JI8L 2NZHA 1S5FD 3MAQA 2D62A 4IQZA 4YWKA 5C4HA 1JJCB 4I7AA 4A3BG 2B2WC 4A3EG 1CT1D 2ZTEA 1EFWA 4A3BB 2QEXA 1L1OA 2F0GA 1PFNA 1U0LA 2FXQA 2PMZE 5KNBA 4HN7A 5TSSA 4A3EB 1IL2A 2N55A 3FEWX 1UNSA 2UXCQ 3E9IA 4A93H 3DHQA 4F8MA 1LTLA 4GKKQ 1ZEQX 4IPHA 2Q8TA 2RA4A 3X3MA 3ULPA 4X3UA 4L5TA 1Y14B 3GV3A 1X32A 1EZ6A 4N8X1 1CSPA 3K0YA 1QVCA 4JG2A 2VUMB 2K7VA 3FKIH 4O2DA 1HNZQ 3FPPA 4KV6A 4HIMA 3I3CA 3DWQA 2RCFA 3BVMA 3OW7A 1XYIA 1KHIA 3K58A 1K3RA 1K0RA 2C5CA 1C7YA
chains in the Genus database with same CATH topology
2YV5A 4BY1G 5IYBH 3S17H 3F2CA 3J81j 4B3ML 1WJJA 2AWNA 3STBD 3FHWA 3HOWH 3I7FA 1HJPA 2E5LQ 2GN5A 1E1OA 1YHAA 4C3HH 4A76A 4JBKA 4UPAA 4NXML 1YVCA 4GNXB 3ULJA 2QGQA 1AH9A 1XNRQ 2UXCL 1IZ6A 1LM0A 3I4MG 1SLJA 1A0IA 2EXDA 2F52A 4RG1A 4JBMA 4GKKL 1VQGA 3TS2A 1JE5A 1VQDA 1HZAA 3DLLA 1YIJA 4P75A 1QZHA 3W1BA 5C0XJ 1YJ9A 1X56A 3H3VH 2OTJA 5DLQE 4MZ9A 4GLAC 1NY4A 2KCMA 5GAGC 2A8VA 3PO2G 3PUZA 3S24A 1N34L 1HNZL 3AYHB 2UUCL 1PH9A 2L15A 4DV2L 1YITA 4LF5L 4JOIC 2VS1A 4LFAL 2CFMA 5IP7G 2Q2IA 1M1KC 1H95A 4DR5Q 1PH6A 2WP8J 3RZDH 1N9WA 1B8AA 3PUYA 4BA1I 4JI0Q 3J80i 4BY7H 2ZJRA 1E22A 4WJ4A 4GN3B 3ZJYC 1X3EA 1CKMA 4QGUA 3AQQA 2R93G 4FDBA 4X6AH 1J6QA 5IYDH 5JJIA 3JAMi 1VQ7A 1OXSC 4YCVA 1VQOA 2IHEA 2R7DA 4YWMA 4HIDA 1I94Q 5K36G 3S1MH 4A3DH 1KRSA 3DM3A 4A3IG 2E5LL 5FLMH 2OTLA 2RCNA 2VY3A 2K75A 3KJPA 1PFSA 1CSQA 3CCLA 3K81C 4JCVE 3GTPH 1XNRL 4PZ6A 1SMXA 2MQHA 1PYBA 3EBEA 3KFUA 4JI4L 2Z0SA 3NBHB 4DUZQ 4DV3Q 1WCMH 1EIYB 3KF6B 4HJ7A 4GKJQ 3HOZG 3PO3G 2E2IH 5C4XG 3KJOA 1AE2A 1Y1WG 1Q86C 1A63A 2WB1G 2RHQB 4X64Q 1JT8A 1V1QA 1TXYA 1UE7A 3G4SA 5ELOA 2YYZA 4DV1Q 2HQLA 3I56A 2Z6KA 3AFPA 5M3FG 4IOAA 3TQYA 4B3RQ 4DKAC 4X65Q 5FLXc 2ATWA 4DR4Q 1VQFA 3KDFB 2K5VA 3CAMA 3HOVG 1Y1VG 4DAMA 3S1NH 1NBWA 1G51A 1E3PA 2AWOA 3SGIA 4DUYQ 4DR5L 1WOCA 1PH2A 1SROA 1KQSA 2VL6A 4JI0L 4A3BH 4Y7NH 2D0OA 4A3EH 4JI2Q 1YBYA 2IX1A 2PQAB 1IXRA 1YEZA 1PH7A 1HZBA 3D31A 4QJFA 1OXTA 4B3TQ 3GTQH 1X3GA 3W1GA 4DR6Q 1JJ2A 1PH3A 1TWAH 3CXCA 5FJ8H 4R4OA 4B3SQ 4LF9L 2GVBA 1I94L 1IBKQ 4A3CG 1HZCA 1BKBA 3CPFA 4A3GH 3J81c 1YZ6A 4AYBG 4LF6Q 2VW9A 4HIOA 4Y52H 5BR8Q 3GD7A 1CKNA 2NVTH 4GN5A 4EQ5A 1XPOA 2F3IA 2K4KA 4O0AA 1K8GA 5M3MG 1GVPA 2K52A 4QY7A 1CUKA 1Q8KA 1K8AC 5E7NA 2CCZA 1XPRA 3HKSA 1G6PA 2MFIA 4DV3L 2OWOA 1UEBA 2K50A 4GKJL 5EAYA 1WFQA 4BBRH 4JC0A 4R1JA 3OTOQ 1UE6A 3M9BA 1VQHA 1P16A 1Q12A 2RHSB 4X64L 5IP9G 4QQBX 3HOYG 2UUBL 4PG3A 4AH6A 4DV1L 2E2HH 4DV5Q 3PIOA 3ICEA 4B3RL 1QVGA 4X65L 4DR4L 1FVIA 3H0GH 3F1ZA 1OXXK 2PI2E 4NB3A 1J5EQ 3W5OA 1WI5A 2I5LX 1EOVA 1SN8A 3PGZA 2AKWB 4DUYL 2Q2UA 4BY1H 4JV5Q 3PIPA 5JEAG 1I6HH 2HT1A 1Q46A 3IRBA 3PF4A 3K7UC 3M4QA 1VQAA 4DV7Q 4JI2L 1QUQA 2CQOA 1K83H 2BH8A 2YTYA 2HHHQ 2JJQA 2V1CC 1MKHA 1GO3E 1VS0A 4DV4Q 5C4JH 2CKZB 4B3TL 5JJLA 1VQIA 3GDEA 1UWVA 4IPGA 4JI4Q 3I4MH 4DR6L 3CP0A 3HOXG 4ALPA 1GM5A 4B3SL 3F8TA 5GADC 4LFBQ 1IBKL 4GOPC 5M5XH 2Q2HA 5C3EG 2Y0SE 3Q8DA 4PMWA 2JEAI 3AFQA 4R4TA 1Q81C 4LF6L 5BR8L 1SRUA 2GVAA 4LWCA 3M85A 1XMQQ 1LYLA 2WFWA 1XPUA 4JI7Q 4DK6C 2PI2A 3RLNA 4IFDJ 3EIVA 3T1YQ 3CF5A 1PVOA 1UE5A 3UDFA 4A3MG 1HR0W 3PO2H 4LF8Q 3RN2A 4JBWA 1HR0Q 2VNUD 4JI6Q 3CCSA 1PYSB 3E0EA 3TRZA 3I4NG 2MO1A 1QVFA 5IP7H 3K0XA 2YTXA 4HJ9A 3BU2A 1VQKA 3STBC 4GNXA 3OTOL 4BXXG 4OXPA 1NE3A 1X3FA 5J3BA 1IBMQ 1Q82C 1B7YB 1WYDA 1S72A 2KENA 1ASYA 1PV4A 3WWVA 4DV5L 1L1OC 5JJKA 3BZCA 2R93H 5C0XG 2F4VQ 3H15A 1J5EL 4LUZA 1KAWA 4LF9Q 1RIPA 4R4CA 4P72A 4IPCA 4DR7Q 2R7FA 4JV5L 4IOCA 2JA6G 3CC2A 3FP9A 2IHFA 4A3IH 4DV7L 3CCRA 1HNXQ 3CC7A 2EQSA 2AHOB 2OQKA 2HHHL 4BBSG 2B29A 4KLKA 2ZM6Q 4GOPB 4DV4L 2XGTA 2JA8G 1MJCA 2VQEQ 2IY5B 1KD1C 1SFOH 4GLVB 4LF4Q 3M3YH 2QA4A 1K9MC 3U4VA 2C35B 1YHQA 4LFBL 1V43A 1KC8C 1M90C 2UXDQ 4QL5A 3E9HA 4LUOA 3TEHB 5GAEC 4JI5Q 1TWGH 4DR3Q 3HOZH 4L5RC 3PO3H 2N49A 5C4XH 1Y1WH 3S15H 4YY3Q 4GN4B 4PZ8A 3T1HQ 4DNIA 1PHJA 3GTLH 1XMQL 2UUBQ 1FGUA 3L7ZC 3TREA 4JI7L 1I5FA 1VQMA 3T1YL 5H1SE 4YHHQ 5M3FH 2JA7G 1D8LA 3I4OA 3CW2C 3G6EA 4LF8L 1TWFH 3A0JA 2AMCB 4LW1A 1HR0L 4JI6L 3UE0A 5C44G 5IYCG 5C44H 3CCMA 3GTGH 3HOVH 1Y1VH 4KHZA 4NXNQ 2R92G 3JC66 1G291 3S1RH 1DGSA 1L1OB 1NJIC 2B63G 1IBML 2OQ0A 1I50H 2KHIA 3JAMc 4OWTB 2NVYH 4YCWA 3KF6A 3HFZB 1PH1A 1KL9A 2BA0A 5GAHC 1FL0A 4H02A 3GTJH 2CWAA 5LMNW 1VQ5A 2F4VL 2NN6G 1E7ZA 1NMGA 1V9PA 3K7AH 4APVA 5LMNQ 1EQQA 4X62Q 4DR7L 4A3KG 4JOIA 3S14H 2DUDA 2E8GA 4A3CH 5GROA 1OTCA 4KHPQ 1SE8A 3RNUA 3U58A 3KDFA 3LGJA 1N33Q 1HNXL 4A3LG 1EYGA 4WJ3M 1XJVA 4LNQA 2WAQG 4OO1G 2ZM6L 5M3MH 1YI2A 2JE6I 2JA5G 4JI1Q 2VQEL 3VDYA 1HH2P 4LF4L 1VQEA 2IT1A 1EWIA 1QZGA 4JYAQ 3PUXA 1VQ9A 2PQAA 2MNAA 1VQLA 2UXDL 4JI5L 4A93G 3GTMH 4DR3L 2ZTDA 3KLWA 4C3JH 3S1QH 3CCQA 1X54A 2VZAA 4YY3L 3T1HL 4A3JG 1IBLQ 5IP9H 4MTNA 4HIKA 4A75A 3HOYH 4XTCS 1MIUA 1L2FA 2LXJA 3J7A5 4YHHL 2I0QA 3HKZE 3RR5A 4P71A 3I2ZA 1LUZA 1X55A 4JI3Q 4A3FG 2VUMG 2VQFQ 5C0XI 3L0OA 2ZTCA 4NXNL 1XMOQ 1P8LA 3FKIG 4IO9A 3KOJA 1XTDA 2LXKA 3CMAA 2JK8A 2RF4A 3UDXA 2NVXH 4KI0A 3MXNB 3F2DA 1X65A 4DR2Q 2IX0A 4NPSA 4A4IA 5M5YH 1RL2A 3G48A 1W2BA 3ERSX 2CWPA 3D0FA 2R7ZG 1UE1A 5LMNL 1S3OA 2UXBQ 4IJLA 2R6GA 4X62L 2ZJPA 3HOXH 3U4ZA 4C3IH 3A5UA 2B3GA 3HOUG 1NTGA 1I3QH 1PH8A 4KHPL 1ASZA 5C3EH 4QIWE 4YWLA 1A62A 1N33L 1OXUA 5IYBG 5IE8A 3AEVA 3M7NA 3PUWA 4YCUA 1R9TH 3NEMA 4HJ8A 3HOWG 4A3MH 2E2JH 4JI1L 2UUAQ 2BH2A 2K5HA 1N8RC 2N8NA 4X66L 2Z6KC 2Q2TA 3I4NH 4LFCQ 1FJGQ 5ELNA 1HZ9A 3A74A 3CCVA 4JYAL 2EIFA 2NZOA 4ME3A 5IWAQ 4BA2I 1OXVA 4OWWB 2PNHA 2MO0A 1PA6A 4BXXH 2YU9H 1N36Q 1IBLL 4LF7Q 3KF8B 3PF5A 2Y0SG 1K73C 3PV0A 2YTVA 4RMFA 1YHBA 2ASBA 4JI3L 4DAYB 2VQFL 4DV6Q 2NN6I 3K8AA 4L5QA 1XMOL 1VQNA 4IFDG 1A8VA 3F2BA 4TVAB 3U50C 4P74A 3BJUA 2JA6H 4JI8Q 3MEFA 1TWCH 4DV0Q 1SR3A 1YNXA 4BBSH 4DR2L 3PCOB 1JJGA 4OO1I 1O7IA 4AQYQ 2JA8H 4XIGS 4BY7G 3NENA 3OYYA 1GD7A 2I5HA 1AE3A 1VCIA 4DR1Q 1VQPA 3CD6A 2UXBL 2DGYA 3RLOA 3CQZH 1U5KA 3CC4A 1Z9FA 1NMFA 1PH5A 4P73A 5AJ3Q 4OONA 4AIMA 5IYDG 2WB1E 1JB7A 2K14A 2I5MX 1JMCA 3CCEA 4UP8A 2JEBI 1IYJB 3PUVA 2N78A 3UDGA 2A19A 2HIVA 3TS0A 4R4IA 4GS3A 3CCJA 2JA7H 1C0AA 4IJHA 4A3DG 3I55A 1Q1EA 2UUAL 5FLMG 1VQBA 5IYCH 1Q1BA 2N3SA 3NELA 4LFCL 1W3SA 3J80c 3J81i 3J7ZC 4UY8C 1FJGL 2NVQH 3UDIA 5IY0A 5IWAL 1YJNA 1XNQQ 3GTKH 3RN5A 2BA1A 4GOPA 4DPGA 4K0KQ 1L0WA 2KBNA 2UU9Q 1WCMG 2B63H 4L5SA 1N36L 4LF7L 3GTOH 1HNWQ 5LMUQ 2R92H 5GQOA 3RLFA 1PH4A 3S16H 1GKHA 1X9NA 2XTIA 2D0PA 4GLXA 1EQRA 1N32L 1MJEA 1VQCA 1VQJA 1C9OA 2H5XA 4DV6L 1Q7YC 4UP7A 4A3KH 3ER0A 3PSIA 1VQ8A 1CKNB 4AYBE 4POFA 5HGQA 1VQ6A 4JI8L 2NZHA 3K80C 4OX9Q 4HJ5A 1N32Q 4DV0L 2D62A 4YWKA 2ZJQA 2WAQE 4A3LH 4B3MQ 1T9HA 1EUJA 2K5NA 1BBWA 3KYHC 1JJCB 1X6OA 4HJAA 4A3BG 2LSSA 4EX5A 4AQYL 2JA5H 4A3EG 1EFWA 2ZTEA 1KXLA 4MNOA 1L1OA 4X66Q 2FXQA 1U0LA 2HIXA 2JQOA 2PMZE 2QEXA 4DR1L 1IL2A 4NXMQ 3RZOH 3CMEA 5AJ3L 3CCUA 2UXCQ 1E24A 1CKOA 3E9IA 4A93H 1LTLA 3ULLA 1Z47A 1EIFA 2A1AA 4A3JH 5FJ8G 3B6YA 4GKKQ 1YJWA 3EN2A 4IPHA 4GNXC 3ULPA 1E1TA 4JBJA 4A3GG 4L5TA 1Y14B 5IT9c 3M4OH 4DK3C 1D7QA 4OWXB 5M5WH 1CSPA 3H3VI 4A3FH 2VUMH 4J15A 1QVCA 1TWHH 4JG2A 1KIXA 3FKIH 5JEAJ 2ID0A 2OCEA 4C2MH 3CPWA 1N34Q 1XNQL 4IFDI 4POGA 4O2DA 1HNZQ 4K0KL 2UUCQ 1QUQB 4DV2Q 4DUZL 3GO5A 3L2PA 2UU9L 2KCTA 4PZ7A 1BVSA 4LFAQ 4IPDA 5LMUL 4LF5Q 4HIMA 2KHJA 1HNWL 4LUVA 4BBRG 3OW2A 3G71A 3S2HH 2ES2A 3BZKA 5HY6A 1KRTA 3S2DH 3A5ZB 1S40A 3M4PA 2R7ZH 1KHIA 2JA9A 4UP9A 1BBUA 3H0GG 3UE1A 3HOUH 3HKZG 1K3RA 2ALYB 1K0RA 4R4QA 4TQUS 1C7YA 1B70B 4OX9L 1VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YV5 A;  4BY1 G;  5IYB H;  3S17 H;  3F2C A;  3J81 j;  4B3M L;  1WJJ A;  2AWN A;  3STB D;  3FHW A;  3HOW H;  3I7F A;  1HJP A;  2E5L Q;  2GN5 A;  1E1O A;  1YHA A;  4C3H H;  4A76 A;  4JBK A;  4UPA A;  4NXM L;  1YVC A;  4GNX B;  3ULJ A;  2QGQ A;  1AH9 A;  1XNR Q;  2UXC L;  1IZ6 A;  1LM0 A;  3I4M G;  1SLJ A;  1A0I A;  2EXD A;  2F52 A;  4RG1 A;  4JBM A;  4GKK L;  1VQG A;  3TS2 A;  1JE5 A;  1VQD A;  1HZA A;  3DLL A;  1YIJ A;  4P75 A;  1QZH A;  3W1B A;  5C0X J;  1YJ9 A;  1X56 A;  3H3V H;  2OTJ A;  5DLQ E;  4MZ9 A;  4GLA C;  1NY4 A;  2KCM A;  5GAG C;  2A8V A;  3PO2 G;  3PUZ A;  3S24 A;  1N34 L;  1HNZ L;  3AYH B;  2UUC L;  1PH9 A;  2L15 A;  4DV2 L;  1YIT A;  4LF5 L;  4JOI C;  2VS1 A;  4LFA L;  2CFM A;  5IP7 G;  2Q2I A;  1M1K C;  1H95 A;  4DR5 Q;  1PH6 A;  2WP8 J;  3RZD H;  1N9W A;  1B8A A;  3PUY A;  4BA1 I;  4JI0 Q;  3J80 i;  4BY7 H;  2ZJR A;  1E22 A;  4WJ4 A;  4GN3 B;  3ZJY C;  1X3E A;  1CKM A;  4QGU A;  3AQQ A;  2R93 G;  4FDB A;  4X6A H;  1J6Q A;  5IYD H;  5JJI A;  3JAM i;  1VQ7 A;  1OXS C;  4YCV A;  1VQO A;  2IHE A;  2R7D A;  4YWM A;  4HID A;  1I94 Q;  5K36 G;  3S1M H;  4A3D H;  1KRS A;  3DM3 A;  4A3I G;  2E5L L;  5FLM H;  2OTL A;  2RCN A;  2VY3 A;  2K75 A;  3KJP A;  1PFS A;  1CSQ A;  3CCL A;  3K81 C;  4JCV E;  3GTP H;  1XNR L;  4PZ6 A;  1SMX A;  2MQH A;  1PYB A;  3EBE A;  3KFU A;  4JI4 L;  2Z0S A;  3NBH B;  4DUZ Q;  4DV3 Q;  1WCM H;  1EIY B;  3KF6 B;  4HJ7 A;  4GKJ Q;  3HOZ G;  3PO3 G;  2E2I H;  5C4X G;  3KJO A;  1AE2 A;  1Y1W G;  1Q86 C;  1A63 A;  2WB1 G;  2RHQ B;  4X64 Q;  1JT8 A;  1V1Q A;  1TXY A;  1UE7 A;  3G4S A;  5ELO A;  2YYZ A;  4DV1 Q;  2HQL A;  3I56 A;  2Z6K A;  3AFP A;  5M3F G;  4IOA A;  3TQY A;  4B3R Q;  4DKA C;  4X65 Q;  5FLX c;  2ATW A;  4DR4 Q;  1VQF A;  3KDF B;  2K5V A;  3CAM A;  3HOV G;  1Y1V G;  4DAM A;  3S1N H;  1NBW A;  1G51 A;  1E3P A;  2AWO A;  3SGI A;  4DUY Q;  4DR5 L;  1WOC A;  1PH2 A;  1SRO A;  1KQS A;  2VL6 A;  4JI0 L;  4A3B H;  4Y7N H;  2D0O A;  4A3E H;  4JI2 Q;  1YBY A;  2IX1 A;  2PQA B;  1IXR A;  1YEZ A;  1PH7 A;  1HZB A;  3D31 A;  4QJF A;  1OXT A;  4B3T Q;  3GTQ H;  1X3G A;  3W1G A;  4DR6 Q;  1JJ2 A;  1PH3 A;  1TWA H;  3CXC A;  5FJ8 H;  4R4O A;  4B3S Q;  4LF9 L;  2GVB A;  1I94 L;  1IBK Q;  4A3C G;  1HZC A;  1BKB A;  3CPF A;  4A3G H;  3J81 c;  1YZ6 A;  4AYB G;  4LF6 Q;  2VW9 A;  4HIO A;  4Y52 H;  5BR8 Q;  3GD7 A;  1CKN A;  2NVT H;  4GN5 A;  4EQ5 A;  1XPO A;  2F3I A;  2K4K A;  4O0A A;  1K8G A;  5M3M G;  1GVP A;  2K52 A;  4QY7 A;  1CUK A;  1Q8K A;  1K8A C;  5E7N A;  2CCZ A;  1XPR A;  3HKS A;  1G6P A;  2MFI A;  4DV3 L;  2OWO A;  1UEB A;  2K50 A;  4GKJ L;  5EAY A;  1WFQ A;  4BBR H;  4JC0 A;  4R1J A;  3OTO Q;  1UE6 A;  3M9B A;  1VQH A;  1P16 A;  1Q12 A;  2RHS B;  4X64 L;  5IP9 G;  4QQB X;  3HOY G;  2UUB L;  4PG3 A;  4AH6 A;  4DV1 L;  2E2H H;  4DV5 Q;  3PIO A;  3ICE A;  4B3R L;  1QVG A;  4X65 L;  4DR4 L;  1FVI A;  3H0G H;  3F1Z A;  1OXX K;  2PI2 E;  4NB3 A;  1J5E Q;  3W5O A;  1WI5 A;  2I5L X;  1EOV A;  1SN8 A;  3PGZ A;  2AKW B;  4DUY L;  2Q2U A;  4BY1 H;  4JV5 Q;  3PIP A;  5JEA G;  1I6H H;  2HT1 A;  1Q46 A;  3IRB A;  3PF4 A;  3K7U C;  3M4Q A;  1VQA A;  4DV7 Q;  4JI2 L;  1QUQ A;  2CQO A;  1K83 H;  2BH8 A;  2YTY A;  2HHH Q;  2JJQ A;  2V1C C;  1MKH A;  1GO3 E;  1VS0 A;  4DV4 Q;  5C4J H;  2CKZ B;  4B3T L;  5JJL A;  1VQI A;  3GDE A;  1UWV A;  4IPG A;  4JI4 Q;  3I4M H;  4DR6 L;  3CP0 A;  3HOX G;  4ALP A;  1GM5 A;  4B3S L;  3F8T A;  5GAD C;  4LFB Q;  1IBK L;  4GOP C;  5M5X H;  2Q2H A;  5C3E G;  2Y0S E;  3Q8D A;  4PMW A;  2JEA I;  3AFQ A;  4R4T A;  1Q81 C;  4LF6 L;  5BR8 L;  1SRU A;  2GVA A;  4LWC A;  3M85 A;  1XMQ Q;  1LYL A;  2WFW A;  1XPU A;  4JI7 Q;  4DK6 C;  2PI2 A;  3RLN A;  4IFD J;  3EIV A;  3T1Y Q;  3CF5 A;  1PVO A;  1UE5 A;  3UDF A;  4A3M G;  1HR0 W;  3PO2 H;  4LF8 Q;  3RN2 A;  4JBW A;  1HR0 Q;  2VNU D;  4JI6 Q;  3CCS A;  1PYS B;  3E0E A;  3TRZ A;  3I4N G;  2MO1 A;  1QVF A;  5IP7 H;  3K0X A;  2YTX A;  4HJ9 A;  3BU2 A;  1VQK A;  3STB C;  4GNX A;  3OTO L;  4BXX G;  4OXP A;  1NE3 A;  1X3F A;  5J3B A;  1IBM Q;  1Q82 C;  1B7Y B;  1WYD A;  1S72 A;  2KEN A;  1ASY A;  1PV4 A;  3WWV A;  4DV5 L;  1L1O C;  5JJK A;  3BZC A;  2R93 H;  5C0X G;  2F4V Q;  3H15 A;  1J5E L;  4LUZ A;  1KAW A;  4LF9 Q;  1RIP A;  4R4C A;  4P72 A;  4IPC A;  4DR7 Q;  2R7F A;  4JV5 L;  4IOC A;  2JA6 G;  3CC2 A;  3FP9 A;  2IHF A;  4A3I H;  4DV7 L;  3CCR A;  1HNX Q;  3CC7 A;  2EQS A;  2AHO B;  2OQK A;  2HHH L;  4BBS G;  2B29 A;  4KLK A;  2ZM6 Q;  4GOP B;  4DV4 L;  2XGT A;  2JA8 G;  1MJC A;  2VQE Q;  2IY5 B;  1KD1 C;  1SFO H;  4GLV B;  4LF4 Q;  3M3Y H;  2QA4 A;  1K9M C;  3U4V A;  2C35 B;  1YHQ A;  4LFB L;  1V43 A;  1KC8 C;  1M90 C;  2UXD Q;  4QL5 A;  3E9H A;  4LUO A;  3TEH B;  5GAE C;  4JI5 Q;  1TWG H;  4DR3 Q;  3HOZ H;  4L5R C;  3PO3 H;  2N49 A;  5C4X H;  1Y1W H;  3S15 H;  4YY3 Q;  4GN4 B;  4PZ8 A;  3T1H Q;  4DNI A;  1PHJ A;  3GTL H;  1XMQ L;  2UUB Q;  1FGU A;  3L7Z C;  3TRE A;  4JI7 L;  1I5F A;  1VQM A;  3T1Y L;  5H1S E;  4YHH Q;  5M3F H;  2JA7 G;  1D8L A;  3I4O A;  3CW2 C;  3G6E A;  4LF8 L;  1TWF H;  3A0J A;  2AMC B;  4LW1 A;  1HR0 L;  4JI6 L;  3UE0 A;  5C44 G;  5IYC G;  5C44 H;  3CCM A;  3GTG H;  3HOV H;  1Y1V H;  4KHZ A;  4NXN Q;  2R92 G;  3JC6 6;  1G29 1;  3S1R H;  1DGS A;  1L1O B;  1NJI C;  2B63 G;  1IBM L;  2OQ0 A;  1I50 H;  2KHI A;  3JAM c;  4OWT B;  2NVY H;  4YCW A;  3KF6 A;  3HFZ B;  1PH1 A;  1KL9 A;  2BA0 A;  5GAH C;  1FL0 A;  4H02 A;  3GTJ H;  2CWA A;  5LMN W;  1VQ5 A;  2F4V L;  2NN6 G;  1E7Z A;  1NMG A;  1V9P A;  3K7A H;  4APV A;  5LMN Q;  1EQQ A;  4X62 Q;  4DR7 L;  4A3K G;  4JOI A;  3S14 H;  2DUD A;  2E8G A;  4A3C H;  5GRO A;  1OTC A;  4KHP Q;  1SE8 A;  3RNU A;  3U58 A;  3KDF A;  3LGJ A;  1N33 Q;  1HNX L;  4A3L G;  1EYG A;  4WJ3 M;  1XJV A;  4LNQ A;  2WAQ G;  4OO1 G;  2ZM6 L;  5M3M H;  1YI2 A;  2JE6 I;  2JA5 G;  4JI1 Q;  2VQE L;  3VDY A;  1HH2 P;  4LF4 L;  1VQE A;  2IT1 A;  1EWI A;  1QZG A;  4JYA Q;  3PUX A;  1VQ9 A;  2PQA A;  2MNA A;  1VQL A;  2UXD L;  4JI5 L;  4A93 G;  3GTM H;  4DR3 L;  2ZTD A;  3KLW A;  4C3J H;  3S1Q H;  3CCQ A;  1X54 A;  2VZA A;  4YY3 L;  3T1H L;  4A3J G;  1IBL Q;  5IP9 H;  4MTN A;  4HIK A;  4A75 A;  3HOY H;  4XTC S;  1MIU A;  1L2F A;  2LXJ A;  3J7A 5;  4YHH L;  2I0Q A;  3HKZ E;  3RR5 A;  4P71 A;  3I2Z A;  1LUZ A;  1X55 A;  4JI3 Q;  4A3F G;  2VUM G;  2VQF Q;  5C0X I;  3L0O A;  2ZTC A;  4NXN L;  1XMO Q;  1P8L A;  3FKI G;  4IO9 A;  3KOJ A;  1XTD A;  2LXK A;  3CMA A;  2JK8 A;  2RF4 A;  3UDX A;  2NVX H;  4KI0 A;  3MXN B;  3F2D A;  1X65 A;  4DR2 Q;  2IX0 A;  4NPS A;  4A4I A;  5M5Y H;  1RL2 A;  3G48 A;  1W2B A;  3ERS X;  2CWP A;  3D0F A;  2R7Z G;  1UE1 A;  5LMN L;  1S3O A;  2UXB Q;  4IJL A;  2R6G A;  4X62 L;  2ZJP A;  3HOX H;  3U4Z A;  4C3I H;  3A5U A;  2B3G A;  3HOU G;  1NTG A;  1I3Q H;  1PH8 A;  4KHP L;  1ASZ A;  5C3E H;  4QIW E;  4YWL A;  1A62 A;  1N33 L;  1OXU A;  5IYB G;  5IE8 A;  3AEV A;  3M7N A;  3PUW A;  4YCU A;  1R9T H;  3NEM A;  4HJ8 A;  3HOW G;  4A3M H;  2E2J H;  4JI1 L;  2UUA Q;  2BH2 A;  2K5H A;  1N8R C;  2N8N A;  4X66 L;  2Z6K C;  2Q2T A;  3I4N H;  4LFC Q;  1FJG Q;  5ELN A;  1HZ9 A;  3A74 A;  3CCV A;  4JYA L;  2EIF A;  2NZO A;  4ME3 A;  5IWA Q;  4BA2 I;  1OXV A;  4OWW B;  2PNH A;  2MO0 A;  1PA6 A;  4BXX H;  2YU9 H;  1N36 Q;  1IBL L;  4LF7 Q;  3KF8 B;  3PF5 A;  2Y0S G;  1K73 C;  3PV0 A;  2YTV A;  4RMF A;  1YHB A;  2ASB A;  4JI3 L;  4DAY B;  2VQF L;  4DV6 Q;  2NN6 I;  3K8A A;  4L5Q A;  1XMO L;  1VQN A;  4IFD G;  1A8V A;  3F2B A;  4TVA B;  3U50 C;  4P74 A;  3BJU A;  2JA6 H;  4JI8 Q;  3MEF A;  1TWC H;  4DV0 Q;  1SR3 A;  1YNX A;  4BBS H;  4DR2 L;  3PCO B;  1JJG A;  4OO1 I;  1O7I A;  4AQY Q;  2JA8 H;  4XIG S;  4BY7 G;  3NEN A;  3OYY A;  1GD7 A;  2I5H A;  1AE3 A;  1VCI A;  4DR1 Q;  1VQP A;  3CD6 A;  2UXB L;  2DGY A;  3RLO A;  3CQZ H;  1U5K A;  3CC4 A;  1Z9F A;  1NMF A;  1PH5 A;  4P73 A;  5AJ3 Q;  4OON A;  4AIM A;  5IYD G;  2WB1 E;  1JB7 A;  2K14 A;  2I5M X;  1JMC A;  3CCE A;  4UP8 A;  2JEB I;  1IYJ B;  3PUV A;  2N78 A;  3UDG A;  2A19 A;  2HIV A;  3TS0 A;  4R4I A;  4GS3 A;  3CCJ A;  2JA7 H;  1C0A A;  4IJH A;  4A3D G;  3I55 A;  1Q1E A;  2UUA L;  5FLM G;  1VQB A;  5IYC H;  1Q1B A;  2N3S A;  3NEL A;  4LFC L;  1W3S A;  3J80 c;  3J81 i;  3J7Z C;  4UY8 C;  1FJG L;  2NVQ H;  3UDI A;  5IY0 A;  5IWA L;  1YJN A;  1XNQ Q;  3GTK H;  3RN5 A;  2BA1 A;  4GOP A;  4DPG A;  4K0K Q;  1L0W A;  2KBN A;  2UU9 Q;  1WCM G;  2B63 H;  4L5S A;  1N36 L;  4LF7 L;  3GTO H;  1HNW Q;  5LMU Q;  2R92 H;  5GQO A;  3RLF A;  1PH4 A;  3S16 H;  1GKH A;  1X9N A;  2XTI A;  2D0P A;  4GLX A;  1EQR A;  1N32 L;  1MJE A;  1VQC A;  1VQJ A;  1C9O A;  2H5X A;  4DV6 L;  1Q7Y C;  4UP7 A;  4A3K H;  3ER0 A;  3PSI A;  1VQ8 A;  1CKN B;  4AYB E;  4POF A;  5HGQ A;  1VQ6 A;  4JI8 L;  2NZH A;  3K80 C;  4OX9 Q;  4HJ5 A;  1N32 Q;  4DV0 L;  2D62 A;  4YWK A;  2ZJQ A;  2WAQ E;  4A3L H;  4B3M Q;  1T9H A;  1EUJ A;  2K5N A;  1BBW A;  3KYH C;  1JJC B;  1X6O A;  4HJA A;  4A3B G;  2LSS A;  4EX5 A;  4AQY L;  2JA5 H;  4A3E G;  1EFW A;  2ZTE A;  1KXL A;  4MNO A;  1L1O A;  4X66 Q;  2FXQ A;  1U0L A;  2HIX A;  2JQO A;  2PMZ E;  2QEX A;  4DR1 L;  1IL2 A;  4NXM Q;  3RZO H;  3CME A;  5AJ3 L;  3CCU A;  2UXC Q;  1E24 A;  1CKO A;  3E9I A;  4A93 H;  1LTL A;  3ULL A;  1Z47 A;  1EIF A;  2A1A A;  4A3J H;  5FJ8 G;  3B6Y A;  4GKK Q;  1YJW A;  3EN2 A;  4IPH A;  4GNX C;  3ULP A;  1E1T A;  4JBJ A;  4A3G G;  4L5T A;  1Y14 B;  5IT9 c;  3M4O H;  4DK3 C;  1D7Q A;  4OWX B;  5M5W H;  1CSP A;  3H3V I;  4A3F H;  2VUM H;  4J15 A;  1QVC A;  1TWH H;  4JG2 A;  1KIX A;  3FKI H;  5JEA J;  2ID0 A;  2OCE A;  4C2M H;  3CPW A;  1N34 Q;  1XNQ L;  4IFD I;  4POG A;  4O2D A;  1HNZ Q;  4K0K L;  2UUC Q;  1QUQ B;  4DV2 Q;  4DUZ L;  3GO5 A;  3L2P A;  2UU9 L;  2KCT A;  4PZ7 A;  1BVS A;  4LFA Q;  4IPD A;  5LMU L;  4LF5 Q;  4HIM A;  2KHJ A;  1HNW L;  4LUV A;  4BBR G;  3OW2 A;  3G71 A;  3S2H H;  2ES2 A;  3BZK A;  5HY6 A;  1KRT A;  3S2D H;  3A5Z B;  1S40 A;  3M4P A;  2R7Z H;  1KHI A;  2JA9 A;  4UP9 A;  1BBU A;  3H0G G;  3UE1 A;  3HOU H;  3HKZ G;  1K3R A;  2ALY B;  1K0R A;  4R4Q A;  4TQU S;  1C7Y A;  1B70 B;  4OX9 L;  1VQ4 A; 
#chains in the Genus database with same CATH topology
 1SE4 A;  2YV5 A;  3S17 H;  4B3M L;  2A6H C;  3I7F A;  2GN5 A;  4C3H G;  1D1I A;  1SYG A;  4UPA A;  2WAC A;  4C3H B;  2QGQ A;  1AN8 A;  5IGF A;  1XNR Q;  2QEJ C;  2QF7 A;  1VQG A;  3QIA A;  2C9O A;  3NQI A;  4P75 A;  5M5X B;  1QZH A;  3W1B A;  1YJ9 A;  4X3T A;  3LWE A;  4L6T B;  3N6R A;  2A8V A;  3PUZ A;  1TS2 A;  2L15 A;  1K28 A;  1YIT A;  4FF3 A;  4LFA L;  2Q2I A;  2EYJ A;  2ICE C;  3QOL A;  4DR5 Q;  1B8A A;  1QE6 A;  2BDO A;  3PUY A;  3J80 i;  1WTX A;  1E22 A;  4WJ4 A;  1G6Z A;  1X3E A;  3C2P A;  1CKM A;  5KGU A;  4FDB A;  2GA4 B;  5JJI A;  2H4O A;  1VQO A;  4IAL A;  4DAY A;  4IUN A;  1BCP C;  4FNF A;  4TRD A;  1I94 Q;  1LTA D;  3ND8 A;  3QR8 A;  4CJ0 B;  2FFK B;  1STG A;  1KRS A;  4A3I G;  4A3D B;  2RCN A;  4A3I B;  3E6Z X;  1CSQ A;  1QIL A;  4QUC A;  1ILP A;  4JCV E;  3GTP H;  5ISR A;  3CRK C;  1LAC A;  1R4Q B;  3KFU A;  4JI4 L;  4DV3 Q;  1WCM H;  3MVV A;  1SYE A;  5COR A;  3PO3 G;  3GP7 A;  1KAB A;  2B2V C;  2F0N A;  4CJ2 C;  3PO3 B;  5C4X G;  1Y69 U;  5C4X B;  2SEB D;  4K5X A;  1A2U A;  2Z6K A;  4DKA C;  5FLX c;  2ATW A;  1KNE A;  1PDQ A;  1VQF A;  2QIL A;  3KDF B;  1TWF B;  3S1N H;  3GTG B;  1T5X D;  3M4Y A;  5C5L A;  3J7A V;  1JWU D;  3R3O A;  4JI0 L;  2D0O A;  2J7Z A;  1MSG A;  3MA2 B;  2A68 C;  4F7X A;  4ID6 A;  1BCP B;  4I7Z C;  3S9W A;  1C8C A;  4E6I A;  3GTJ B;  1JCK B;  1S5C D;  1STH A;  1GHK A;  3K7A B;  1TWA H;  4R4O A;  5CYU A;  1IBK Q;  4A3G H;  3MEH A;  4KJN A;  2F0J A;  4HIO A;  2NVT H;  4EQ5 A;  5JOB A;  2K4K A;  2JSO A;  2Z6B A;  5JVH 3;  1SYD A;  2EJG C;  1RCV D;  1MSH A;  1G6P A;  3MTS A;  2M00 A;  3A56 A;  1BR9 A;  2OWO A;  2K50 A;  2EY1 A;  4B9W A;  2VB2 X;  3OMG A;  4R1J A;  4C3J G;  1SNQ A;  1Q12 A;  4C3J B;  3AU7 A;  4X64 L;  3S1Q B;  4DV5 Q;  3PIO A;  3ICE A;  4KTA A;  1FVI A;  3F1Z A;  1HQR D;  4QUF A;  1WI5 A;  3A8I E;  1JOK A;  4FF1 A;  1NR2 A;  2HCI A;  4JV5 Q;  2PO4 A;  3OIP A;  1U9R A;  1I6H H;  2B2V A;  4OIK A;  5HUR A;  3M4Q A;  2JYO A;  5ELF A;  5CGK A;  3PIO 3;  1K83 H;  3T13 A;  2V1C C;  2IW3 A;  1GO3 E;  4DV4 Q;  1B2T A;  1F2L A;  1JOO A;  4ZQ3 A;  3GDE A;  4JI4 Q;  3MXP A;  4LAA A;  2AQ1 B;  4LFB Q;  4B3S L;  5GAD C;  5C3E G;  4HED A;  4DFA A;  5C3E B;  4LF6 L;  3F2U A;  1HUN A;  5BR8 L;  1XMQ Q;  2GVA A;  4Y52 H;  2PCF B;  4QIW B;  1PVO A;  3EIV A;  3T1Y Q;  1UE5 A;  3UDF A;  4A3M G;  4LF8 Q;  1TS3 A;  4A3M B;  1HR0 Q;  3QJY A;  3CCS A;  3HEJ A;  4CKE A;  3KLS X;  2MP1 A;  3BDC A;  1EY8 A;  1Y8O B;  4QMG A;  2YTX A;  3BU2 A;  1BXT A;  2KJX A;  3OTO L;  2HDL A;  1B7Y B;  1WYD A;  2KEN A;  3BG3 A;  3MFY A;  2F0K A;  2EXZ A;  1EY6 A;  1RIP A;  1ZXT A;  1FNU A;  4EGV A;  5K36 H;  4DV7 L;  3CC7 A;  2EQS A;  2HHH L;  5T1G A;  2K5D A;  1STY A;  1MJC A;  3VA7 A;  1R4P B;  4J6H A;  2B2U A;  2VQE Q;  4GLV B;  3M3Y H;  5FK9 C;  4IUR A;  1F9R A;  4L5R C;  2N49 A;  4PZ8 A;  5IOD A;  1KDA A;  1PHJ A;  4LMQ D;  1LO5 D;  4JI7 L;  1CHP D;  5M3F H;  1D8L A;  3I4O A;  3CW2 C;  2RVL A;  4LW1 A;  4K14 A;  3PMF A;  5IYC G;  3HOV H;  4NXN Q;  3JC6 6;  1Y1V B;  3W2D A;  3S1R H;  2MJ8 A;  3TP6 A;  5BN4 A;  3LNN A;  2XIW A;  3KBX A;  1NJI C;  3P75 A;  1IBM L;  1I50 H;  2F0T A;  4FF2 A;  4KKU A;  3JAM c;  5LL6 S;  4FO2 A;  2F0D A;  3H6M A;  2NN6 G;  1NMG A;  1S4Z A;  1EQQ A;  4A3K G;  1F2M A;  4A3K B;  1WTV A;  1EIG A;  3OIQ A;  3LGJ A;  1STN A;  5JJZ A;  1N33 Q;  5KRU A;  1O7Y A;  2A6E D;  1XJV A;  4ZCK A;  4BS9 A;  4DNT B;  2ZM6 L;  2JE6 I;  4KK7 A;  2F0H A;  1D1K A;  1QZG A;  2SOB A;  3O13 A;  4FXK C;  3PUX A;  1VQ9 A;  2PQA A;  2RSN A;  2L0C A;  2MNA A;  4JI5 L;  4A93 G;  4UDU C;  2ZTD A;  4CHT B;  4A93 B;  4YY3 L;  5IP9 H;  4HIK A;  1MIU A;  3AB9 A;  2I0Q A;  3DWA A;  1HQM C;  5C0X I;  2QDL A;  2VQF Q;  3MXG A;  2PNR C;  3FKI G;  3KOJ A;  3FKI B;  5JEA H;  4K2L A;  2RF4 A;  1EL0 A;  1EFI D;  2NVX B;  2IX0 A;  1RL2 A;  2J0T D;  1I4R A;  5I2Y A;  2JXM B;  1NAP A;  2ZJP A;  1CFM A;  2B3G A;  3ERO A;  5KYL A;  4YWL A;  1A62 A;  3AEV A;  1TR5 A;  3PUW A;  1R9T H;  3S17 B;  3C1F A;  2SNM A;  3V05 A;  2DNC A;  1MHW C;  2E2J B;  4X66 L;  4KD4 A;  3I4N H;  5ELN A;  1HZ9 A;  1EZ8 A;  4HMJ A;  4ME3 A;  3SK5 A;  1OXV A;  1Q90 A;  2EZV A;  1KAA A;  1NR4 A;  1SND A;  3A7L A;  3VR4 A;  4RMF A;  2YTV A;  2KOL A;  4JI3 L;  3VA5 A;  5C0X H;  5J22 A;  4DV6 Q;  1XMO L;  1F2Y A;  2CW0 C;  1SAP A;  1A8V A;  1I6V C;  4TVA B;  3BJU A;  3NHH A;  3CHB D;  1SR3 A;  4BBS H;  4XQQ A;  2D9U A;  1XX8 A;  3D6W A;  3OYY A;  2PYK A;  3CD6 A;  1H9R A;  3CQZ H;  1U5K A;  5AJ3 Q;  3T56 B;  1TY0 A;  4C1N K;  1JB7 A;  4FP5 D;  3CCE A;  3UDG A;  4QF4 A;  3BVG A;  3CCJ A;  3LX0 A;  1Q1E A;  4RGT A;  2UUA L;  4OGQ C;  3W3A A;  1GUS A;  5I9P A;  3SE0 A;  4ZKB B;  2N3S A;  4LFC L;  3J80 c;  1FJG L;  1HCZ A;  4M8A A;  3GTK H;  3GTP B;  3RN5 A;  4DPG A;  3K57 A;  1WCM G;  2B63 H;  4L5S A;  4ZKC B;  4KY6 A;  1WCM B;  4MN3 A;  3RLF A;  4KMU C;  1GKH A;  1LTB D;  2B2T A;  1X9N A;  1SSO A;  4GLX A;  4HMI A;  3NPP A;  4M1U B;  1EEF D;  3FDT A;  1VQ8 A;  1AFP A;  3K80 C;  3SR1 A;  3S1N B;  4DV0 L;  4H44 C;  3WOF A;  1YNJ D;  3D4R A;  3KYH C;  4XQN A;  2LSS A;  4EX5 A;  2JA5 H;  3D4W A;  4X66 Q;  2ZT9 C;  3QG1 A;  1FGB D;  3CME A;  1E24 A;  2X6G A;  1PYW D;  1EIF A;  4A3J H;  3B6Y A;  3EVQ A;  3EN2 A;  1TWA B;  4GNX C;  4A3G G;  4JBJ A;  5IT9 c;  4A3G B;  2KA7 A;  3D4D A;  4OEM B;  1D7Q A;  1L0Y B;  4DXF A;  4NMZ A;  2A69 C;  4A3F H;  1TWH B;  5JEA J;  3CPW A;  1N34 Q;  1QNK A;  1RDP D;  4C2M B;  4K0K L;  2UUC Q;  1FD7 D;  4DV2 Q;  2UU9 L;  2WV6 D;  5KNC A;  2DN8 A;  5DNF A;  1BVS A;  3VR3 A;  4IPD A;  1JWS D;  1HTL D;  3QWN A;  4B08 A;  1JQY D;  2A6E C;  1SJE D;  2D5D A;  3S2H H;  1YNN D;  3U9S A;  1LT5 D;  1S5E D;  3T53 B;  3A5Z B;  1BCP F;  5DEH A;  3M4P A;  1S40 A;  2JA9 A;  2NYZ D;  4UP9 A;  1EY5 A;  3HKZ G;  2B2Y A;  2ALY B;  3A54 A;  4HAE A;  4R4Q A;  1B70 B;  4DK1 A;  3F2C A;  3J81 j;  2AWN A;  2KQ3 A;  4G7Z C;  3FHW A;  1D5X C;  1CQF A;  1I6H B;  2E5L Q;  1E1O A;  2K28 A;  3FPU B;  1HUM A;  3VYU A;  4JBK A;  5D3D A;  2VXW A;  1K83 B;  1GUG A;  1YVC A;  4GNX B;  1AH9 A;  1ENF A;  1KTK A;  2UXC L;  1IZ6 A;  2L1B A;  4RG1 A;  4GKK L;  3TS2 A;  1STB A;  1KDB A;  1AW7 A;  3DLL A;  3J81 L;  5EGT A;  5C0X J;  4OEL B;  1X56 A;  2OTJ A;  2F0P A;  4WFN 3;  4NDX A;  1V8Q A;  5KND A;  1HNZ L;  4JOI C;  1MGS A;  1H95 A;  3MXU A;  1H9K A;  2WP8 J;  3KK7 A;  3D8G A;  4LK1 C;  4BA1 I;  4CDC C;  4BY7 H;  2ZJR A;  4C1N I;  3ZJY C;  1UEA B;  3AQQ A;  1TT2 A;  5IYD H;  3JAM i;  3C46 A;  1IYU A;  3URY A;  2B8G A;  4YWM A;  4DXG A;  5DM7 3;  3K5O A;  5K36 G;  5CV4 A;  3J81 E;  1ROD A;  3S1M H;  1C4Q A;  4C56 C;  5E3F A;  1F9P A;  3KJP A;  1PFS A;  3NTK A;  3TN2 A;  3K81 C;  1XNR L;  3NBH B;  4TSS A;  3M3Y B;  1EIY B;  3KF6 B;  4GKJ Q;  1AP0 A;  5D65 A;  2E75 C;  2OT2 A;  3TP7 A;  3P1H A;  1A6X A;  2RHQ B;  1V1Q A;  1TXY A;  1UE7 A;  1SMY D;  4K8I A;  3G4S A;  5ELO A;  1QG7 A;  5M3F G;  1WVL A;  4DR4 Q;  1DZ1 A;  5M3F B;  3HOV G;  1ICW A;  3HOV B;  1G51 A;  1E3P A;  2AWO A;  3SGI A;  5C3X A;  4DUY Q;  4EQN A;  3S1R B;  4DR5 L;  1WD0 A;  1ZKO A;  4JI2 Q;  2M2L A;  1I50 B;  2H1E A;  1IXR A;  4BWG B;  1OXT A;  1LTG D;  4B3T Q;  1X3G A;  2NTT A;  4IZ8 A;  3W1G A;  5FO9 B;  1BF4 A;  4LF9 L;  1MD2 D;  2GVB A;  4RHS A;  1I94 L;  1HZC A;  2F0W A;  1YZ6 A;  1CA6 A;  2RQX A;  1K8G A;  3NP8 A;  1I4X A;  4DV3 L;  4QB4 A;  1DXM A;  3TZU A;  1BOS A;  1S5B D;  5EAY A;  1WFQ A;  1WD1 A;  2LS0 1;  4JC0 A;  1B3A A;  1UE6 A;  3A8K E;  1VQH A;  3M9B A;  1P16 A;  5IP9 G;  4PG3 A;  1WTQ A;  2DJF C;  1PTO C;  3I91 A;  3J80 L;  1A3T A;  1EOV A;  3PGZ A;  3PIP A;  5JEA G;  3IRB A;  4CGY B;  1EY0 A;  3K7U C;  2N88 A;  2CQO A;  2YTY A;  1A15 A;  4RGO S;  1CQV A;  5C4J H;  1TU2 B;  3SEB A;  1UWV A;  3CP0 A;  4EQO A;  4ALP A;  5I9O A;  1IBK L;  3PIP 3;  4GOP C;  1PRT F;  2FJ2 A;  4PMW A;  3E3X A;  3Q24 A;  3QB3 A;  1SRU A;  2B2W A;  1XPU A;  3M85 A;  4DK6 C;  2PI2 A;  3RLN A;  1R9T B;  2XRQ D;  2IJ0 A;  3PO2 H;  4JBW A;  4JI6 Q;  3I4N G;  4DK0 A;  3I4N B;  4G7O C;  4LJZ C;  4ZRZ A;  5IP7 H;  3K0X A;  4Q5V A;  1VQK A;  1WTO A;  2WKD A;  5J3B A;  1ESR A;  1AEX A;  2Z4H A;  1PTO B;  4ZK9 B;  4DV5 L;  4JVZ A;  4KHV A;  5JJK A;  3BZC A;  2R93 H;  5C0X G;  5EPJ A;  2F4V Q;  4RCN A;  2MGS A;  4LF9 Q;  4P72 A;  1A3U A;  4JV5 L;  3DEP A;  4IOC A;  1SNP A;  4V19 0;  1VF7 A;  2IHF A;  1HNX Q;  1G91 A;  4BBS G;  2L12 A;  1I4P A;  4KLK A;  4BBS B;  4GOP B;  4DV4 L;  5NUC A;  2XGT A;  1KD1 C;  4LF4 Q;  1B53 A;  1K9M C;  2C35 B;  1YHQ A;  4LFB L;  3CQZ B;  4QL5 A;  3TEH B;  1E0B A;  3SK4 A;  1PZK D;  1GHJ A;  2KVM A;  1Y1W H;  3T1H Q;  4N9P A;  4DNI A;  2IWH A;  1XMQ L;  2PZW A;  1FGU A;  3L7Z C;  3T1Y L;  2IX3 A;  3A55 A;  3G6E A;  4LF8 L;  2BDN A;  3BYY B;  4H0L C;  1HR0 L;  2FMM A;  3UE0 A;  5C44 G;  3Q6S A;  5C44 B;  1G29 1;  3RD4 A;  3GTK B;  2KEE A;  3OSO A;  2B63 G;  2OQ0 A;  4ZLT F;  2B63 B;  2Q8R E;  2KHI A;  4OWT B;  2NVY H;  3HFZ B;  2BA0 A;  4FVM A;  2CWA A;  5LMN W;  1VQ5 A;  1E7Z A;  5IGD A;  3K5M A;  4X62 Q;  3S14 H;  1IW7 D;  2E8G A;  4A3C H;  5GRO A;  4N9T A;  2X6L A;  3U58 A;  3KDF A;  1SMY C;  1ZYR D;  4WJ3 M;  5M3M H;  1YI2 A;  2JA5 G;  2TSS A;  2VQE L;  2JA5 B;  5I2X A;  3K5L A;  3G7L A;  4JYA Q;  5CV8 A;  3GTM H;  1EQV A;  1BNZ A;  1TS4 A;  2VZA A;  4A3J G;  1IBL Q;  2LKV A;  4A3J B;  4MTN A;  5EKK A;  1I4G A;  2EDG A;  1IKL A;  1A2T A;  3HKZ E;  3GV6 A;  3I2Z A;  4A3F G;  2ZTC A;  4NXN L;  4IO9 A;  2KUM A;  1QWY A;  1XTD A;  3K6O A;  2DY7 A;  5C4Z A;  3UDX A;  4NP5 A;  1FR3 A;  3MXN B;  1X65 A;  4DR2 Q;  2XWB B;  4NPS A;  3S2H B;  5M5Y H;  1Z7T A;  5EBC A;  1SJH D;  1HXY D;  3HOX H;  3U4Z A;  4C3I H;  5JPN C;  2EPB A;  4RKB A;  3DMU A;  4ZAI A;  1N33 L;  2EJF C;  1F2Z A;  1RJT A;  3NEM A;  4HJ8 A;  2TMP A;  2BH2 A;  5KIX A;  1IHZ A;  2N8N A;  4ILW A;  3CCV A;  4UHV A;  4CDD C;  3C3L A;  2PNH A;  2ICI A;  2YU9 H;  1N36 Q;  3KF8 B;  3BDO A;  1LLR D;  2DNE A;  1EYD A;  1PZJ D;  4EVO A;  3SK8 A;  1K73 C;  2ASB A;  5J39 A;  2VQF L;  4DNR B;  4N8F A;  1VQN A;  4DU9 A;  3R93 A;  5G3L F;  2B8F A;  1ONL A;  2EYL A;  3NSW A;  1YNX A;  3PCO B;  4AQY Q;  4BY7 G;  1A3V A;  1GD7 A;  1H9S B;  2I5H A;  4DR1 Q;  4BY7 B;  2DGY A;  4K2K A;  1NMF A;  4P73 A;  3FMC A;  4AIM A;  5IYD G;  4S3S A;  2F03 A;  4UP8 A;  1IYJ B;  3PUV A;  3TS0 A;  2A19 A;  2HIV A;  3BVZ A;  4IJH A;  3I55 A;  1J8I A;  3KUP A;  5IY0 A;  1YJN A;  1XNQ Q;  2A73 B;  2KBN A;  3GTO H;  1HNW Q;  5LMU Q;  2PW5 A;  3I90 A;  3S16 H;  2XTI A;  2D0P A;  1EQR A;  4OIJ A;  1MJE A;  5JPM C;  5EBD A;  1C9O A;  4DV6 L;  1CA5 A;  3IAY A;  3P7J A;  3PSI A;  1JOQ A;  1CKN B;  4POF A;  1VQ6 A;  1NSN S;  2RBM A;  5DAU A;  3V2T A;  4OX9 Q;  4HJ5 A;  1N32 Q;  4A3L H;  1T9H A;  3BS1 A;  1EUJ A;  2K5N A;  3TSS A;  3J7Y W;  1SNO A;  4O1N A;  4MNO A;  2F1M A;  1IYV A;  4NXM Q;  3WOE A;  3RZO H;  2O4X A;  5I6Y A;  5AJ3 L;  1FNV A;  3CCU A;  3ULL A;  2A1A A;  1YJW A;  5LL6 X;  3M4O H;  5M5W H;  2JN4 A;  3A8J E;  2VUM H;  1KIX A;  4XT1 B;  2ID0 A;  1HA6 A;  4IFD I;  2RKS A;  5IGC A;  1QUQ B;  1DOK A;  3L2P A;  4XYO A;  4LF5 Q;  4PZ7 A;  2BE5 D;  2V4D A;  2KHJ A;  2KED A;  4LUV A;  1HTP A;  3OW2 A;  5HY6 A;  1LT6 D;  1CHQ D;  3S2D H;  2MPM A;  4PNY A;  3HGB A;  1SXT A;  2L5T A;  1BBU A;  3ERQ A;  4KJO A;  3UE1 A;  5FLX L;  4DN4 M;  1VQ4 A;  2K33 A;  3FRP B;  2K05 A;  4CBV A;  1HJP A;  4C3H H;  2PZU A;  4KKT A;  4O42 A;  2NBF A;  4XYQ A;  5M9O A;  1DOL A;  3I8Z A;  5C4J B;  1LM0 A;  1A0I A;  2F52 A;  4JBM A;  1JE5 A;  1HZA A;  4FYD A;  3RUZ A;  5DLQ E;  4MZ9 A;  5E4X A;  1GUN A;  4GLA C;  3DXJ C;  2KCM A;  3PO2 G;  4IFD H;  1PZI D;  5FLX E;  1N34 L;  3PO2 B;  3L3O C;  1JR0 D;  1PMR A;  3AYH B;  2UUC L;  1PH9 A;  4HCE A;  4DV2 L;  3GQB A;  2SNS A;  2CFM A;  5IP7 G;  3IKJ A;  1T5E A;  4RAU C;  3RZD H;  3TDQ A;  1GOZ A;  3H09 A;  5D3I B;  4GN3 B;  5C6A A;  4QGU A;  2ZXO A;  2R93 G;  4X6A H;  1K3B C;  2R93 B;  1VQ7 A;  1OXS C;  2HQE A;  1M8A A;  3NUC A;  2IHE A;  4HID A;  5CMD A;  4I65 A;  1GUT A;  4A3D H;  3DM3 A;  1SNC A;  1TY2 A;  2E5L L;  2VY3 A;  1SNM A;  1PYB A;  2MQH A;  5ELE A;  3OHX C;  1KNA A;  2RDG A;  3KJO A;  1AE2 A;  1Y1W G;  4FXG C;  1Q86 C;  2WB1 G;  1PTO F;  1Y1W B;  1JT8 A;  3NK9 A;  2YYZ A;  4DV1 Q;  2HQL A;  4B3R Q;  3AFP A;  1I4H A;  4X65 Q;  1O7Z A;  4L8J A;  3IFD A;  3CAM A;  1NCV A;  2EOT A;  1KLU D;  1PH2 A;  1II3 A;  1KQS A;  4Y7N H;  1QJO A;  3TZD A;  3SK6 A;  1YBY A;  3BYT B;  1YEZ A;  2NVY B;  2KCC A;  1HZB A;  3D31 A;  2EYO A;  2DJG C;  3GTQ H;  4DR6 Q;  3I4L A;  1Y8N B;  1JJ2 A;  1PH3 A;  3CXC A;  5FJ8 H;  4A3C G;  3CPF A;  2XSC A;  2QW7 A;  4GN5 A;  2NVT B;  2F3I A;  3NWS A;  4O0A A;  3TBI B;  5M3M G;  5M3M B;  1CUK A;  1Q8K A;  1K8A C;  5E7N A;  4HR7 B;  1XPR A;  2Z1C A;  3HKS A;  2MFI A;  2JP1 A;  4GKJ L;  1SYF A;  1CK1 A;  4BBR H;  3K59 A;  3GTM B;  2RHS B;  4XDX A;  1HPC A;  2E2H H;  1QVG A;  3IL8 A;  2WKC A;  4DR4 L;  3H0G H;  3DM1 A;  2AUJ D;  3HKZ B;  1J5E Q;  3W5O A;  1SN8 A;  4J1M A;  5EJW A;  2AKW B;  4DUY L;  1WTR A;  2Q2U A;  4BY1 H;  1LAB A;  1V1P B;  1VQA A;  4JI2 L;  3JAM L;  2BH8 A;  5CV9 A;  5J1Z A;  2JJQ A;  5F2D A;  1MKH A;  3T4A C;  1VS0 A;  1ILQ A;  4MHE A;  5M5Y B;  5LHY 1;  4B3T L;  3NXW A;  4IPG A;  3I4M H;  3HOX G;  1EEI D;  2BE5 C;  4C3I G;  3HP3 A;  3QO2 A;  3HOX B;  4C3I B;  2JEA I;  4HCS A;  4R4T A;  1Q81 C;  1LYL A;  4IFD J;  2XWJ B;  2AQ2 B;  3NQT A;  1M4V A;  3SXH A;  4ME5 A;  3RN2 A;  2VNU D;  2J4X A;  1PYS B;  3NTH A;  3TRZ A;  2K03 A;  1DM0 B;  2MO1 A;  1QVF A;  4HJ9 A;  4GNX A;  3X3N A;  4OXP A;  3D6C A;  3CU7 A;  5I4D A;  1Q82 C;  1BCP D;  2YU9 B;  3JAM E;  1ASY A;  1PV4 A;  1IKM A;  1JB3 A;  3NE5 B;  4V0B A;  3SHL A;  1L1O C;  4KY7 A;  4ZYS A;  3H15 A;  4LUZ A;  1KAW A;  1J9O A;  1EQT A;  4DR7 Q;  3MZ5 A;  1RF2 D;  4CDE C;  3FP9 A;  4CJ1 B;  1BUV T;  2XN9 C;  2OQK A;  2B29 A;  5EKI A;  4IUT A;  2IY5 B;  1VF5 C;  5C5M A;  1SFO H;  4ODG A;  5ELD A;  2QA4 A;  1MBY A;  2KEC A;  1CZW A;  1VMP A;  1M90 C;  2UXD Q;  3E9H A;  4LUO A;  1H9J A;  5GAE C;  3HOZ H;  1TWG H;  5CBE E;  4DR3 Q;  3S15 H;  5IGB A;  3GTL H;  3SVM A;  3TRE A;  1HFN A;  1UUP A;  1EY4 A;  4YHH Q;  1K8O A;  3A0J A;  2A68 D;  4JI6 L;  3CCM A;  1GUO A;  1Y1V H;  4KHZ A;  4F88 A;  1RD9 D;  1DGS A;  4Q0F A;  1L1O B;  1FYC A;  3NBH A;  1WTP A;  4YCW A;  4ZUI A;  3KF6 A;  4KN4 C;  1KL9 A;  2M9V A;  5GAH C;  1FL0 A;  1SYC A;  1Q3L A;  2F4V L;  3BDL A;  5LMN Q;  4DA2 A;  2NB0 A;  1D6E C;  4JOI A;  3Q22 A;  2A5H A;  3P20 A;  4KHP Q;  4PQX A;  3Q23 A;  1W6J A;  1U4L A;  1HNX L;  4A3L G;  3KLS A;  4JI1 Q;  4OHJ A;  2K04 A;  3VDY A;  1HH2 P;  4LF4 L;  2IT1 A;  1EWI A;  4KY5 A;  2IL8 A;  1CTM A;  3RZO B;  2F0I A;  1VQL A;  1YNJ C;  3KLW A;  3CCQ A;  1X54 A;  2I07 B;  3T1H L;  3HOY H;  4A75 A;  4XTC S;  1PFM A;  5AFW A;  3J7A 5;  2I46 A;  3M4O B;  1TS5 A;  3NWT A;  3RR5 A;  2G5D A;  4P71 A;  1X55 A;  5M5W B;  1O7L A;  2VUM G;  5IGE A;  2K32 A;  1P8L A;  1SDF A;  2NUC A;  3VR2 A;  1QNU A;  3CMA A;  2JK8 A;  4YIJ A;  4RA8 A;  1LTR D;  1EY9 A;  2Z8L A;  4KI0 A;  2NVX H;  1TVX A;  1F77 A;  3H91 A;  1SBB B;  5HGT A;  4A4I A;  1JE4 A;  2BOS A;  3G48 A;  2CWP A;  5E4W C;  1SYB A;  1UE1 A;  2UXB Q;  1S3O A;  3S2D B;  3M7G A;  2R6G A;  3H94 A;  4X62 L;  5ELC A;  2E2D C;  1I3Q H;  1QB5 D;  1YNN C;  2CH4 W;  3BZD B;  1OXU A;  1Z6H A;  5IE8 A;  4YCU A;  4KKS A;  2O5J C;  2E2J H;  3MFG A;  2K5H A;  4EQP A;  2Z6K C;  3J80 E;  2F0Q A;  4JYA L;  2EIF A;  5IWA Q;  1H9M A;  2B39 A;  1O78 A;  1PA6 A;  4BXX H;  4LF7 Q;  1IBL L;  3Q0A A;  3HZX A;  1EU4 A;  3G6J B;  5IT9 L;  2QCP X;  2Y0S G;  1CZG A;  2Y0S B;  4DAY B;  4IFD G;  3OPO A;  3F2B A;  5I6W A;  2JA6 H;  5CV5 A;  1PXU A;  4JI8 Q;  1F9Q A;  1TWC H;  3MEF A;  5CV6 A;  4DR2 L;  2ZXR A;  3RZD B;  4OO1 I;  5CBA E;  2JA8 H;  3NEN A;  4CKC A;  3RLO A;  4F87 A;  1Z9F A;  2WII B;  1PRT D;  2FMC A;  4OON A;  2NZ1 D;  4R8N A;  1RTN A;  1NNX A;  2WB1 E;  2K14 A;  1Q8I A;  2N78 A;  4IUU A;  4B9X A;  4R4I A;  4GS3 A;  1E2Z A;  5FKA C;  5IT9 E;  2JA7 H;  4A3D G;  1VQB A;  3NEL A;  4IUQ A;  2R92 H;  1W3S A;  2XRS D;  3I72 A;  2NVQ H;  3R2I A;  1RTO A;  2BA1 A;  4GOP A;  1EYA A;  2E76 C;  1BQQ T;  1L0W A;  2K1B A;  5CC4 A;  1N36 L;  4JW0 A;  4WJW A;  1JIC A;  1D5Z C;  1MI2 A;  1QCB D;  1VQC A;  5COY A;  4XXE A;  2LY7 A;  5A35 A;  4P2C B;  2F0E A;  5HGQ A;  1HFG A;  3OWF A;  4HTH A;  2ZJQ A;  2WAQ E;  1ICF B;  4B3M Q;  4MTK A;  1BBW A;  1ENA A;  4OO1 H;  1X6O A;  4HJA A;  4AQY L;  4Y7N B;  1KXL A;  5K5P A;  1VMC A;  2HIX A;  2JQO A;  4DR1 L;  3E5S A;  1SE2 A;  1CKO A;  1LTI D;  4PMC A;  4MIU A;  3GTQ B;  1Z47 A;  3D3R A;  5FJ8 G;  1UAP A;  1E1T A;  4DK3 C;  4OWX B;  3H3V I;  1WTW A;  2RSO A;  4J15 A;  1TWH H;  4A3F B;  1AZP A;  2OCE A;  3I73 A;  4C2M H;  1XNQ L;  4ULL A;  4POG A;  5FO7 B;  2CH4 A;  1DOM A;  3GO5 A;  4NKL A;  4DUZ L;  2KCT A;  1HNW L;  4LFA Q;  3E0J A;  5LMU L;  4BBR G;  3G71 A;  2ES2 A;  4BBR B;  3R8B A;  3BZK A;  4Z9C B;  3K5N A;  4FXD A;  1KRT A;  1Y8P B;  1EWH A;  2R7Z H;  2E2H B;  3H0G G;  2B2U C;  3HOU H;  1B9M A;  1BO0 A;  3H0G B;  2HCC A;  4RWS C;  4OX9 L;  1N32 L;  4BY1 G;  5IYB H;  1HA5 A;  1U4R A;  4BY1 B;  1WJJ A;  2P5Z X;  3STB D;  4FF4 A;  3HOW H;  1C48 A;  3HRZ C;  5IIF A;  4GZY C;  1YHA A;  3T51 B;  3TME A;  4A76 A;  4NXM L;  3MXN A;  3ULJ A;  2R61 A;  5D14 A;  3I4M G;  1SLJ A;  2EXD A;  2KCN A;  4K6L A;  3I4M B;  2CW0 D;  2MHV A;  3OWE B;  1VQD A;  2FHT A;  2EYP A;  1YIJ A;  1IL8 A;  4X3S A;  2PW7 A;  1E2V A;  3H3V H;  1L0X B;  1GUW A;  1AZQ A;  1B4O A;  5KYI A;  1NY4 A;  5GAG C;  1XXG A;  2PQE A;  3S24 A;  2F3V A;  2L9H A;  1JC7 A;  1I4Q A;  4LF5 L;  2VS1 A;  3HG9 A;  1X3Q A;  1M1K C;  1CM9 A;  2X69 A;  1PH6 A;  1KLG D;  1N9W A;  4OL7 A;  4JI0 Q;  2K5W A;  2F0U A;  2ZXP A;  3KF8 A;  4K5V A;  5DM6 3;  4K8J A;  1W6K A;  1J6Q A;  4RGM A;  4QCL A;  4YCV A;  5BN5 A;  1DYQ A;  2R7D A;  2KHS A;  1LT3 D;  1EOT A;  3S1M B;  1TKW B;  5FLM H;  2OTL A;  2K75 A;  5EPK A;  3CCL A;  4PZ6 A;  1SMX A;  3EBE A;  1DCZ A;  2Z0S A;  4DUZ Q;  1SFO B;  4HJ7 A;  1H9S A;  3HOZ G;  2E2I H;  4HSV A;  2NWG A;  3HOZ B;  1A63 A;  1TWG B;  4X64 Q;  1B1Z A;  3S15 B;  4WRD A;  1HHV A;  3WDN A;  3GTL B;  2F0V A;  1PLF A;  1JOR A;  2AQ3 B;  3I56 A;  2LMC B;  4IOA A;  3TQY A;  1PRT C;  4RGN A;  1EWC A;  2K5V A;  1LT4 D;  1K8M A;  1Y1V G;  2G9H D;  5G3L D;  4IUP A;  1NBW A;  2A74 C;  3UI2 A;  4DAM A;  5BN3 A;  5IGG A;  1JWM D;  2VB3 X;  4U67 3;  3NBI A;  1WOC A;  1SRO A;  2VL6 A;  4RH6 A;  4A3B H;  4A3E H;  2HD3 A;  1RKN A;  2PQA B;  2IX1 A;  1PH7 A;  1GXD C;  4QJF A;  2A69 D;  2L4N A;  4B3S Q;  1ENC A;  1BKB A;  4R8I A;  3J81 c;  4L63 B;  5EPL A;  4AYB G;  2VW9 A;  4LF6 Q;  5BR8 Q;  3GD7 A;  1CKN A;  4AYB B;  4K6D A;  4ABN A;  1XPO A;  3NTI A;  1GVP A;  2DY8 A;  2K52 A;  4QY7 A;  3OOC A;  5E1F A;  1IW7 C;  1LTT D;  3VR6 A;  2CCZ A;  5EKL A;  1UEB A;  2HUG A;  2PMZ B;  3QOJ A;  4R9W A;  3VYT A;  1ZYR C;  1PRT B;  1XWE A;  3OTO Q;  4QQB X;  1D5M C;  3HOY G;  2UUB L;  2EYM A;  4AH6 A;  4DV1 L;  3HOY B;  4PMB A;  4TKO B;  4B3R L;  4X65 L;  4UAI A;  1OXX K;  2PI2 E;  4NB3 A;  1ET9 A;  3ITP A;  2I5L X;  2QDB A;  2QKI C;  2HT1 A;  1Q46 A;  3PF4 A;  3CKI B;  4DV7 Q;  1QUQ A;  1WTH A;  2F4I A;  2HHH Q;  2EY6 A;  3VYR A;  2CKZ B;  5JJL A;  1VQI A;  1V1O A;  4XQJ A;  4DR6 L;  5A2Q L;  1GM5 A;  2L55 A;  3F8T A;  3KLR A;  1XTC D;  5M5X H;  2Q2H A;  2Y0S E;  1I3Q B;  3Q8D A;  1HRJ A;  3AFQ A;  3FVQ A;  1TII D;  4LWC A;  2B2T C;  4WOR A;  2WFW A;  2EVB A;  4JI7 Q;  3CF5 A;  4G57 A;  1HR0 W;  2F3W A;  3E0E A;  1GJX A;  2NTS A;  2EJM A;  3STB C;  2XVS A;  4BXX G;  3C1E A;  1NE3 A;  1X3F A;  2OF1 A;  1IBM Q;  1PTO H;  3N52 A;  1S72 A;  2OXP A;  1U4M A;  3WWV A;  2K6A A;  5C3W A;  1ML0 D;  1NUC A;  3OMC A;  1ESF A;  1J5E L;  5IOC A;  5A2Q E;  5CR3 A;  4R4C A;  4IPC A;  1KDC A;  2R7F A;  2JA6 G;  3EQL C;  3CC2 A;  2JA6 B;  2RDH A;  1TQO A;  1DON A;  2Z4I A;  1TWC B;  2Z9H A;  4H7B A;  3CCR A;  4A3I H;  3AMU A;  1BBX C;  2AHO B;  2ZM6 Q;  2LFN A;  2JA8 G;  2JA8 B;  1SEB D;  2E74 C;  3U4V A;  5JAV A;  4HSP A;  1V43 A;  3KBG A;  1KC8 C;  3DUZ A;  3DEO A;  4JI5 Q;  3PO3 H;  4H13 C;  5C4X H;  3CRL C;  4GN4 B;  4YY3 Q;  2WB1 B;  2UUB Q;  1I5F A;  4RCO A;  1VQM A;  2SDF A;  5H1S E;  2JA7 G;  4K5W A;  2JA7 B;  1TWF H;  2AMC B;  2F0M A;  1G2T A;  3GTG H;  2CVR A;  5C44 H;  4U68 A;  2R92 G;  4NW2 A;  2R92 B;  2XNA C;  2B2Y C;  3R2T A;  3EJI A;  3ND9 A;  4DGZ A;  2NVQ B;  4X3K A;  4CKB A;  2PPB C;  2CHB D;  3EFX D;  2R3Z A;  4KD3 A;  2PZT A;  1PH1 A;  4H02 A;  2D2C C;  3GTJ H;  1B50 A;  1V9P A;  3K7A H;  4APV A;  4DR7 L;  2L11 A;  2DUD A;  3S14 B;  3VYS A;  1OTC A;  1SE8 A;  3A7A B;  3V96 A;  3RNU A;  2HDM A;  1EYG A;  4RHR A;  3T16 A;  4LNQ A;  2WAQ G;  4OO1 G;  4JPB W;  2WAQ B;  1VDZ A;  4G7H C;  5FO8 B;  1RHP A;  1VQE A;  2OEO A;  5JVG 3;  3LWU A;  2UXD L;  1E2W A;  3DWP A;  4DR3 L;  4PV1 C;  4C3J H;  3S1Q H;  1PTO D;  3MHB A;  2A6H D;  1L2F A;  3RMH A;  2LXJ A;  3HS0 C;  4YHH L;  3I70 A;  1LUZ A;  4JI3 Q;  2EE1 A;  3L0O A;  2BCO A;  1XMO Q;  1U4P A;  5ELB A;  2RDF A;  2LXK A;  5CV7 A;  3H3V C;  1STA A;  3F2D A;  4G4K A;  1W2B A;  3ERS X;  3D0F A;  2R7Z G;  5LMN L;  2EY5 A;  4CDF C;  4IJL A;  3J7A F;  2R7Z B;  3A5U A;  1O80 A;  1NTG A;  3HOU G;  1B3Q A;  1PH8 A;  4KHP L;  1CI3 M;  2ENB A;  5C3E H;  1ASZ A;  3HOU B;  2K01 A;  4QIW E;  2EY2 A;  3TP5 A;  1EU3 A;  5IYB G;  3M7N A;  1FNW A;  2FIN B;  3MC0 B;  3HOW G;  4A3M H;  4JI1 L;  2UUA Q;  3HOW B;  5EQ0 A;  1N8R C;  1D2B A;  1EYC A;  1DJR D;  2Q2T A;  1V1P A;  4LFC Q;  1QOH A;  1FJG Q;  3IFT A;  3A74 A;  2CQA A;  2NZO A;  4BA2 I;  1BDO A;  2WIN B;  4OWW B;  2MO0 A;  5L37 A;  2AUK A;  1SE3 A;  1DD2 A;  2EYH A;  3PF5 A;  4TQU S;  2EYF A;  2IPK D;  3PV0 A;  1YHB A;  1STE A;  2NN6 I;  3K8A A;  1LV9 A;  4L5Q A;  2K5Q A;  4IN3 A;  4JK1 C;  4IUV A;  4P74 A;  3U50 C;  4KN7 C;  1B44 D;  4DV0 Q;  1OO9 B;  3ZYY X;  1JJG A;  1O7I A;  4J8Q A;  4XIG S;  2F0O A;  4DF7 A;  1ET6 A;  4ZUJ A;  4DAP A;  1AE3 A;  1VCI A;  2UXB L;  1VQP A;  3CC4 A;  1PH5 A;  1EIH A;  4XT3 B;  2G9D A;  2I5M X;  1JMC A;  2JEB I;  5KEE A;  4RKL A;  2F0F A;  1B9N A;  2Q8I B;  1F9S A;  1C0A A;  1G2S A;  5FLM G;  3EA6 A;  4DAV A;  3MWY W;  5IYC H;  3SDZ A;  1Q1B A;  1S5D D;  3L9A X;  3J81 i;  3J7Z C;  4UY8 C;  3UDI A;  5IWA L;  2MUY A;  1K0S A;  2F0L A;  4K0K Q;  2UU9 Q;  2F0S A;  4LF7 L;  3PQI A;  3GTO B;  3ONA B;  3TP8 A;  5GQO A;  1EY7 A;  1G8Z D;  5T1I A;  1PH4 A;  3S16 B;  3VR5 A;  2E2I B;  1X3P A;  2O2L D;  1VQJ A;  2NN6 H;  3U9O A;  2H5X A;  1Q7Y C;  4RFB A;  4UP7 A;  4A3K H;  3ER0 A;  1LTS D;  2O5I C;  1PFB A;  5FOB B;  4AYB E;  4JI8 L;  2NZH A;  1S5F D;  3MAQ A;  2D62 A;  4IQZ A;  4YWK A;  5C4H A;  1JJC B;  4I7A A;  4A3B G;  2B2W C;  4A3E G;  1CT1 D;  2ZTE A;  1EFW A;  4A3B B;  2QEX A;  1L1O A;  2F0G A;  1PFN A;  1U0L A;  2FXQ A;  2PMZ E;  5KNB A;  4HN7 A;  5TSS A;  4A3E B;  1IL2 A;  2N55 A;  3FEW X;  1UNS A;  2UXC Q;  3E9I A;  4A93 H;  3DHQ A;  4F8M A;  1LTL A;  4GKK Q;  1ZEQ X;  4IPH A;  2Q8T A;  2RA4 A;  3X3M A;  3ULP A;  4X3U A;  4L5T A;  1Y14 B;  3GV3 A;  1X32 A;  1EZ6 A;  4N8X 1;  1CSP A;  3K0Y A;  1QVC A;  4JG2 A;  2VUM B;  2K7V A;  3FKI H;  4O2D A;  1HNZ Q;  3FPP A;  4KV6 A;  4HIM A;  3I3C A;  3DWQ A;  2RCF A;  3BVM A;  3OW7 A;  1XYI A;  1KHI A;  3K58 A;  1K3R A;  1K0R A;  2C5C A;  1C7Y A; 
#chains in the Genus database with same CATH homology
 2YV5 A;  4BY1 G;  5IYB H;  3S17 H;  3F2C A;  3J81 j;  4B3M L;  1WJJ A;  2AWN A;  3STB D;  3FHW A;  3HOW H;  3I7F A;  1HJP A;  2E5L Q;  2GN5 A;  1E1O A;  1YHA A;  4C3H H;  4A76 A;  4JBK A;  4UPA A;  4NXM L;  1YVC A;  4GNX B;  3ULJ A;  2QGQ A;  1AH9 A;  1XNR Q;  2UXC L;  1IZ6 A;  1LM0 A;  3I4M G;  1SLJ A;  1A0I A;  2EXD A;  2F52 A;  4RG1 A;  4JBM A;  4GKK L;  1VQG A;  3TS2 A;  1JE5 A;  1VQD A;  1HZA A;  3DLL A;  1YIJ A;  4P75 A;  1QZH A;  3W1B A;  5C0X J;  1YJ9 A;  1X56 A;  3H3V H;  2OTJ A;  5DLQ E;  4MZ9 A;  4GLA C;  1NY4 A;  2KCM A;  5GAG C;  2A8V A;  3PO2 G;  3PUZ A;  3S24 A;  1N34 L;  1HNZ L;  3AYH B;  2UUC L;  1PH9 A;  2L15 A;  4DV2 L;  1YIT A;  4LF5 L;  4JOI C;  2VS1 A;  4LFA L;  2CFM A;  5IP7 G;  2Q2I A;  1M1K C;  1H95 A;  4DR5 Q;  1PH6 A;  2WP8 J;  3RZD H;  1N9W A;  1B8A A;  3PUY A;  4BA1 I;  4JI0 Q;  3J80 i;  4BY7 H;  2ZJR A;  1E22 A;  4WJ4 A;  4GN3 B;  3ZJY C;  1X3E A;  1CKM A;  4QGU A;  3AQQ A;  2R93 G;  4FDB A;  4X6A H;  1J6Q A;  5IYD H;  5JJI A;  3JAM i;  1VQ7 A;  1OXS C;  4YCV A;  1VQO A;  2IHE A;  2R7D A;  4YWM A;  4HID A;  1I94 Q;  5K36 G;  3S1M H;  4A3D H;  1KRS A;  3DM3 A;  4A3I G;  2E5L L;  5FLM H;  2OTL A;  2RCN A;  2VY3 A;  2K75 A;  3KJP A;  1PFS A;  1CSQ A;  3CCL A;  3K81 C;  4JCV E;  3GTP H;  1XNR L;  4PZ6 A;  1SMX A;  2MQH A;  1PYB A;  3EBE A;  3KFU A;  4JI4 L;  2Z0S A;  3NBH B;  4DUZ Q;  4DV3 Q;  1WCM H;  1EIY B;  3KF6 B;  4HJ7 A;  4GKJ Q;  3HOZ G;  3PO3 G;  2E2I H;  5C4X G;  3KJO A;  1AE2 A;  1Y1W G;  1Q86 C;  1A63 A;  2WB1 G;  2RHQ B;  4X64 Q;  1JT8 A;  1V1Q A;  1TXY A;  1UE7 A;  3G4S A;  5ELO A;  2YYZ A;  4DV1 Q;  2HQL A;  3I56 A;  2Z6K A;  3AFP A;  5M3F G;  4IOA A;  3TQY A;  4B3R Q;  4DKA C;  4X65 Q;  5FLX c;  2ATW A;  4DR4 Q;  1VQF A;  3KDF B;  2K5V A;  3CAM A;  3HOV G;  1Y1V G;  4DAM A;  3S1N H;  1NBW A;  1G51 A;  1E3P A;  2AWO A;  3SGI A;  4DUY Q;  4DR5 L;  1WOC A;  1PH2 A;  1SRO A;  1KQS A;  2VL6 A;  4JI0 L;  4A3B H;  4Y7N H;  2D0O A;  4A3E H;  4JI2 Q;  1YBY A;  2IX1 A;  2PQA B;  1IXR A;  1YEZ A;  1PH7 A;  1HZB A;  3D31 A;  4QJF A;  1OXT A;  4B3T Q;  3GTQ H;  1X3G A;  3W1G A;  4DR6 Q;  1JJ2 A;  1PH3 A;  1TWA H;  3CXC A;  5FJ8 H;  4R4O A;  4B3S Q;  4LF9 L;  2GVB A;  1I94 L;  1IBK Q;  4A3C G;  1HZC A;  1BKB A;  3CPF A;  4A3G H;  3J81 c;  1YZ6 A;  4AYB G;  4LF6 Q;  2VW9 A;  4HIO A;  4Y52 H;  5BR8 Q;  3GD7 A;  1CKN A;  2NVT H;  4GN5 A;  4EQ5 A;  1XPO A;  2F3I A;  2K4K A;  4O0A A;  1K8G A;  5M3M G;  1GVP A;  2K52 A;  4QY7 A;  1CUK A;  1Q8K A;  1K8A C;  5E7N A;  2CCZ A;  1XPR A;  3HKS A;  1G6P A;  2MFI A;  4DV3 L;  2OWO A;  1UEB A;  2K50 A;  4GKJ L;  5EAY A;  1WFQ A;  4BBR H;  4JC0 A;  4R1J A;  3OTO Q;  1UE6 A;  3M9B A;  1VQH A;  1P16 A;  1Q12 A;  2RHS B;  4X64 L;  5IP9 G;  4QQB X;  3HOY G;  2UUB L;  4PG3 A;  4AH6 A;  4DV1 L;  2E2H H;  4DV5 Q;  3PIO A;  3ICE A;  4B3R L;  1QVG A;  4X65 L;  4DR4 L;  1FVI A;  3H0G H;  3F1Z A;  1OXX K;  2PI2 E;  4NB3 A;  1J5E Q;  3W5O A;  1WI5 A;  2I5L X;  1EOV A;  1SN8 A;  3PGZ A;  2AKW B;  4DUY L;  2Q2U A;  4BY1 H;  4JV5 Q;  3PIP A;  5JEA G;  1I6H H;  2HT1 A;  1Q46 A;  3IRB A;  3PF4 A;  3K7U C;  3M4Q A;  1VQA A;  4DV7 Q;  4JI2 L;  1QUQ A;  2CQO A;  1K83 H;  2BH8 A;  2YTY A;  2HHH Q;  2JJQ A;  2V1C C;  1MKH A;  1GO3 E;  1VS0 A;  4DV4 Q;  5C4J H;  2CKZ B;  4B3T L;  5JJL A;  1VQI A;  3GDE A;  1UWV A;  4IPG A;  4JI4 Q;  3I4M H;  4DR6 L;  3CP0 A;  3HOX G;  4ALP A;  1GM5 A;  4B3S L;  3F8T A;  5GAD C;  4LFB Q;  1IBK L;  4GOP C;  5M5X H;  2Q2H A;  5C3E G;  2Y0S E;  3Q8D A;  4PMW A;  2JEA I;  3AFQ A;  4R4T A;  1Q81 C;  4LF6 L;  5BR8 L;  1SRU A;  2GVA A;  4LWC A;  3M85 A;  1XMQ Q;  1LYL A;  2WFW A;  1XPU A;  4JI7 Q;  4DK6 C;  2PI2 A;  3RLN A;  4IFD J;  3EIV A;  3T1Y Q;  3CF5 A;  1PVO A;  1UE5 A;  3UDF A;  4A3M G;  1HR0 W;  3PO2 H;  4LF8 Q;  3RN2 A;  4JBW A;  1HR0 Q;  2VNU D;  4JI6 Q;  3CCS A;  1PYS B;  3E0E A;  3TRZ A;  3I4N G;  2MO1 A;  1QVF A;  5IP7 H;  3K0X A;  2YTX A;  4HJ9 A;  3BU2 A;  1VQK A;  3STB C;  4GNX A;  3OTO L;  4BXX G;  4OXP A;  1NE3 A;  1X3F A;  5J3B A;  1IBM Q;  1Q82 C;  1B7Y B;  1WYD A;  1S72 A;  2KEN A;  1ASY A;  1PV4 A;  3WWV A;  4DV5 L;  1L1O C;  5JJK A;  3BZC A;  2R93 H;  5C0X G;  2F4V Q;  3H15 A;  1J5E L;  4LUZ A;  1KAW A;  4LF9 Q;  1RIP A;  4R4C A;  4P72 A;  4IPC A;  4DR7 Q;  2R7F A;  4JV5 L;  4IOC A;  2JA6 G;  3CC2 A;  3FP9 A;  2IHF A;  4A3I H;  4DV7 L;  3CCR A;  1HNX Q;  3CC7 A;  2EQS A;  2AHO B;  2OQK A;  2HHH L;  4BBS G;  2B29 A;  4KLK A;  2ZM6 Q;  4GOP B;  4DV4 L;  2XGT A;  2JA8 G;  1MJC A;  2VQE Q;  2IY5 B;  1KD1 C;  1SFO H;  4GLV B;  4LF4 Q;  3M3Y H;  2QA4 A;  1K9M C;  3U4V A;  2C35 B;  1YHQ A;  4LFB L;  1V43 A;  1KC8 C;  1M90 C;  2UXD Q;  4QL5 A;  3E9H A;  4LUO A;  3TEH B;  5GAE C;  4JI5 Q;  1TWG H;  4DR3 Q;  3HOZ H;  4L5R C;  3PO3 H;  2N49 A;  5C4X H;  1Y1W H;  3S15 H;  4YY3 Q;  4GN4 B;  4PZ8 A;  3T1H Q;  4DNI A;  1PHJ A;  3GTL H;  1XMQ L;  2UUB Q;  1FGU A;  3L7Z C;  3TRE A;  4JI7 L;  1I5F A;  1VQM A;  3T1Y L;  5H1S E;  4YHH Q;  5M3F H;  2JA7 G;  1D8L A;  3I4O A;  3CW2 C;  3G6E A;  4LF8 L;  1TWF H;  3A0J A;  2AMC B;  4LW1 A;  1HR0 L;  4JI6 L;  3UE0 A;  5C44 G;  5IYC G;  5C44 H;  3CCM A;  3GTG H;  3HOV H;  1Y1V H;  4KHZ A;  4NXN Q;  2R92 G;  3JC6 6;  1G29 1;  3S1R H;  1DGS A;  1L1O B;  1NJI C;  2B63 G;  1IBM L;  2OQ0 A;  1I50 H;  2KHI A;  3JAM c;  4OWT B;  2NVY H;  4YCW A;  3KF6 A;  3HFZ B;  1PH1 A;  1KL9 A;  2BA0 A;  5GAH C;  1FL0 A;  4H02 A;  3GTJ H;  2CWA A;  5LMN W;  1VQ5 A;  2F4V L;  2NN6 G;  1E7Z A;  1NMG A;  1V9P A;  3K7A H;  4APV A;  5LMN Q;  1EQQ A;  4X62 Q;  4DR7 L;  4A3K G;  4JOI A;  3S14 H;  2DUD A;  2E8G A;  4A3C H;  5GRO A;  1OTC A;  4KHP Q;  1SE8 A;  3RNU A;  3U58 A;  3KDF A;  3LGJ A;  1N33 Q;  1HNX L;  4A3L G;  1EYG A;  4WJ3 M;  1XJV A;  4LNQ A;  2WAQ G;  4OO1 G;  2ZM6 L;  5M3M H;  1YI2 A;  2JE6 I;  2JA5 G;  4JI1 Q;  2VQE L;  3VDY A;  1HH2 P;  4LF4 L;  1VQE A;  2IT1 A;  1EWI A;  1QZG A;  4JYA Q;  3PUX A;  1VQ9 A;  2PQA A;  2MNA A;  1VQL A;  2UXD L;  4JI5 L;  4A93 G;  3GTM H;  4DR3 L;  2ZTD A;  3KLW A;  4C3J H;  3S1Q H;  3CCQ A;  1X54 A;  2VZA A;  4YY3 L;  3T1H L;  4A3J G;  1IBL Q;  5IP9 H;  4MTN A;  4HIK A;  4A75 A;  3HOY H;  4XTC S;  1MIU A;  1L2F A;  2LXJ A;  3J7A 5;  4YHH L;  2I0Q A;  3HKZ E;  3RR5 A;  4P71 A;  3I2Z A;  1LUZ A;  1X55 A;  4JI3 Q;  4A3F G;  2VUM G;  2VQF Q;  5C0X I;  3L0O A;  2ZTC A;  4NXN L;  1XMO Q;  1P8L A;  3FKI G;  4IO9 A;  3KOJ A;  1XTD A;  2LXK A;  3CMA A;  2JK8 A;  2RF4 A;  3UDX A;  2NVX H;  4KI0 A;  3MXN B;  3F2D A;  1X65 A;  4DR2 Q;  2IX0 A;  4NPS A;  4A4I A;  5M5Y H;  1RL2 A;  3G48 A;  1W2B A;  3ERS X;  2CWP A;  3D0F A;  2R7Z G;  1UE1 A;  5LMN L;  1S3O A;  2UXB Q;  4IJL A;  2R6G A;  4X62 L;  2ZJP A;  3HOX H;  3U4Z A;  4C3I H;  3A5U A;  2B3G A;  3HOU G;  1NTG A;  1I3Q H;  1PH8 A;  4KHP L;  1ASZ A;  5C3E H;  4QIW E;  4YWL A;  1A62 A;  1N33 L;  1OXU A;  5IYB G;  5IE8 A;  3AEV A;  3M7N A;  3PUW A;  4YCU A;  1R9T H;  3NEM A;  4HJ8 A;  3HOW G;  4A3M H;  2E2J H;  4JI1 L;  2UUA Q;  2BH2 A;  2K5H A;  1N8R C;  2N8N A;  4X66 L;  2Z6K C;  2Q2T A;  3I4N H;  4LFC Q;  1FJG Q;  5ELN A;  1HZ9 A;  3A74 A;  3CCV A;  4JYA L;  2EIF A;  2NZO A;  4ME3 A;  5IWA Q;  4BA2 I;  1OXV A;  4OWW B;  2PNH A;  2MO0 A;  1PA6 A;  4BXX H;  2YU9 H;  1N36 Q;  1IBL L;  4LF7 Q;  3KF8 B;  3PF5 A;  2Y0S G;  1K73 C;  3PV0 A;  2YTV A;  4RMF A;  1YHB A;  2ASB A;  4JI3 L;  4DAY B;  2VQF L;  4DV6 Q;  2NN6 I;  3K8A A;  4L5Q A;  1XMO L;  1VQN A;  4IFD G;  1A8V A;  3F2B A;  4TVA B;  3U50 C;  4P74 A;  3BJU A;  2JA6 H;  4JI8 Q;  3MEF A;  1TWC H;  4DV0 Q;  1SR3 A;  1YNX A;  4BBS H;  4DR2 L;  3PCO B;  1JJG A;  4OO1 I;  1O7I A;  4AQY Q;  2JA8 H;  4XIG S;  4BY7 G;  3NEN A;  3OYY A;  1GD7 A;  2I5H A;  1AE3 A;  1VCI A;  4DR1 Q;  1VQP A;  3CD6 A;  2UXB L;  2DGY A;  3RLO A;  3CQZ H;  1U5K A;  3CC4 A;  1Z9F A;  1NMF A;  1PH5 A;  4P73 A;  5AJ3 Q;  4OON A;  4AIM A;  5IYD G;  2WB1 E;  1JB7 A;  2K14 A;  2I5M X;  1JMC A;  3CCE A;  4UP8 A;  2JEB I;  1IYJ B;  3PUV A;  2N78 A;  3UDG A;  2A19 A;  2HIV A;  3TS0 A;  4R4I A;  4GS3 A;  3CCJ A;  2JA7 H;  1C0A A;  4IJH A;  4A3D G;  3I55 A;  1Q1E A;  2UUA L;  5FLM G;  1VQB A;  5IYC H;  1Q1B A;  2N3S A;  3NEL A;  4LFC L;  1W3S A;  3J80 c;  3J81 i;  3J7Z C;  4UY8 C;  1FJG L;  2NVQ H;  3UDI A;  5IY0 A;  5IWA L;  1YJN A;  1XNQ Q;  3GTK H;  3RN5 A;  2BA1 A;  4GOP A;  4DPG A;  4K0K Q;  1L0W A;  2KBN A;  2UU9 Q;  1WCM G;  2B63 H;  4L5S A;  1N36 L;  4LF7 L;  3GTO H;  1HNW Q;  5LMU Q;  2R92 H;  5GQO A;  3RLF A;  1PH4 A;  3S16 H;  1GKH A;  1X9N A;  2XTI A;  2D0P A;  4GLX A;  1EQR A;  1N32 L;  1MJE A;  1VQC A;  1VQJ A;  1C9O A;  2H5X A;  4DV6 L;  1Q7Y C;  4UP7 A;  4A3K H;  3ER0 A;  3PSI A;  1VQ8 A;  1CKN B;  4AYB E;  4POF A;  5HGQ A;  1VQ6 A;  4JI8 L;  2NZH A;  3K80 C;  4OX9 Q;  4HJ5 A;  1N32 Q;  4DV0 L;  2D62 A;  4YWK A;  2ZJQ A;  2WAQ E;  4A3L H;  4B3M Q;  1T9H A;  1EUJ A;  2K5N A;  1BBW A;  3KYH C;  1JJC B;  1X6O A;  4HJA A;  4A3B G;  2LSS A;  4EX5 A;  4AQY L;  2JA5 H;  4A3E G;  1EFW A;  2ZTE A;  1KXL A;  4MNO A;  1L1O A;  4X66 Q;  2FXQ A;  1U0L A;  2HIX A;  2JQO A;  2PMZ E;  2QEX A;  4DR1 L;  1IL2 A;  4NXM Q;  3RZO H;  3CME A;  5AJ3 L;  3CCU A;  2UXC Q;  1E24 A;  1CKO A;  3E9I A;  4A93 H;  1LTL A;  3ULL A;  1Z47 A;  1EIF A;  2A1A A;  4A3J H;  5FJ8 G;  3B6Y A;  4GKK Q;  1YJW A;  3EN2 A;  4IPH A;  4GNX C;  3ULP A;  1E1T A;  4JBJ A;  4A3G G;  4L5T A;  1Y14 B;  5IT9 c;  3M4O H;  4DK3 C;  1D7Q A;  4OWX B;  5M5W H;  1CSP A;  3H3V I;  4A3F H;  2VUM H;  4J15 A;  1QVC A;  1TWH H;  4JG2 A;  1KIX A;  3FKI H;  5JEA J;  2ID0 A;  2OCE A;  4C2M H;  3CPW A;  1N34 Q;  1XNQ L;  4IFD I;  4POG A;  4O2D A;  1HNZ Q;  4K0K L;  2UUC Q;  1QUQ B;  4DV2 Q;  4DUZ L;  3GO5 A;  3L2P A;  2UU9 L;  2KCT A;  4PZ7 A;  1BVS A;  4LFA Q;  4IPD A;  5LMU L;  4LF5 Q;  4HIM A;  2KHJ A;  1HNW L;  4LUV A;  4BBR G;  3OW2 A;  3G71 A;  3S2H H;  2ES2 A;  3BZK A;  5HY6 A;  1KRT A;  3S2D H;  3A5Z B;  1S40 A;  3M4P A;  2R7Z H;  1KHI A;  2JA9 A;  4UP9 A;  1BBU A;  3H0G G;  3UE1 A;  3HOU H;  3HKZ G;  1K3R A;  2ALY B;  1K0R A;  4R4Q A;  4TQU S;  1C7Y A;  1B70 B;  4OX9 L;  1VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...