1YHAA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
b'MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
molecule tags Dna binding protein
source organism Enterobacteria phage f1
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhaA00
4GOPA 1VQAA 2OWOA 1HR0L 1YJNA 1JMCA 5M3MG 3I56A 3STBC 4JI0Q 2AKWB 3HOUH 1SROA 2A19A 3HOXG 1IXRA 2LXKA 4BY1H 1XJVA 2YTXA 2ZJRA 4DV4L 5C3EG 1HNWQ 1IBKL 1CSQA 1X6OA 2V1CC 1VS0A 1Z47A 3FP9A 3ERSX 3M4QA 4OONA 4K0KL 2BH8A 1ASYA 2N3SA 4B3RQ 4HIKA 3G71A 4DV2L 3Q8DA 4AIMA 2Q2UA 1VQNA 3S15H 4LFAQ 1Q1BA 3ULPA 4UP9A 3J81i 4DR5Q 3W1GA 1X9NA 5AJ3L 3CCVA 1HH2P 1VQOA 1EFWA 2D62A 1BBWA 3PIOA 2EIFA 4MTNA 4OO1I 2AWOA 5FLXc 1N36L 2D0OA 1I6HH 1TXYA 3PUVA 3PF5A 2HHHL 2IHFA 2Q2HA 3H15A 1Q7YC 3CCLA 3OTOQ 1PFSA 4A3KG 2R7ZH 4R1JA 4DR3Q 4JI1Q 4LF6L 5JEAG 4DR2Q 1TWFH 4DR6L 1UWVA 1HJPA 4MNOA 1IYJB 2K5NA 1I5FA 2ZJPA 2ES2A 4GKJL 2HT1A 1OXUA 3RZOH 4DV3Q 1TWHH 4A3EH 4JI2Q 4A3JG 3HOXH 2K4KA 1B7YB 2HQLA 1CKMA 1Q8KA 5C44H 4GLVB 1P8LA 2K5VA 3KF6B 3IRBA 4NXNL 3CCEA 4NXMQ 1W3SA 4PZ6A 4X64L 3I2ZA 4AQYL 3A5ZB 3G48A 1HNZQ 1MIUA 3EIVA 2CCZA 2UUCQ 4YCUA 4YY3L 4B3SQ 1SE8A 3U50C 5IWAQ 2N49A 4QL5A 4DV0Q 2Y0SG 4LF7Q 1OXVA 3EBEA 4X65Q 2YU9H 4JYAL 1VQEA 1J5EQ 1PHJA 1UEBA 1YI2A 4B3TQ 2OTJA 2UXBQ 1LYLA 1HNXQ 4HJ7A 5GAHC 1OXXK 3I4MH 1LTLA 3UE0A 4EX5A 1JB7A 3S1NH 3CAMA 4GS3A 2NVXH 3M4PA 3HKZE 3AQQA 4HIMA 1IZ6A 2DGYA 5J3BA 2WB1E 4KI0A 3KLWA 4LF8Q 4A3KH 1K3RA 4LFCL 2JEBI 3ZJYC 4A3DH 3GTOH 5IYBH 4JOIA 2F4VL 4RMFA 4UP7A 2JJQA 3S16H 2KCMA 4GLXA 1SRUA 2JK8A 3JC66 4A3BG 5IP7G 1Q1EA 3CXCA 4GKKQ 5GADC 1U5KA 1MKHA 3KDFA 1PH3A 1FVIA 3CPWA 2R6GA 2PNHA 4A3FG 1VQ4A 1HR0W 3GO5A 2E5LQ 3S1QH 4BBSH 4LF5L 2PMZE 5H1SE 4A4IA 4KHPL 3E9HA 1NJIC 5DLQE 1VQKA 3RR5A 4YCWA 1VQJA 1XMQQ 2B63G 1NMFA 1YNXA 3D31A 5IWAL 1C0AA 1EWIA 5IYCH 4YY3Q 3S2DH 5IYDH 4DR7L 3S14H 1X65A 2NVTH 4ME3A 3F2CA 4HIDA 1DGSA 1XMQL 4X62Q 4DUZQ 1Y1WH 2R92G 4P71A 3GTGH 3GTMH 5BR8L 1JT8A 1KQSA 3U58A 4BY1G 2E2HH 2UUBL 2A8VA 2GN5A 4DV7L 1EQQA 4IOAA 4JCVE 1FL0A 3AEVA 2IX0A 5ELNA 1M1KC 3KF6A 5IYDG 1PYBA 1SLJA 3PGZA 2MO0A 4JI7Q 3D0FA 3STBD 1T9HA 4JOIC 1PH4A 1HZCA 1KL9A 1O7IA 2HIVA 4LUVA 2MQHA 1A8VA 1XMOQ 3J7A5 1QUQA 2K52A 4JBKA 2PI2E 2BA0A 3TS0A 3H3VI 2HHHQ 3DLLA 4OO1G 1N36Q 2UUAL 4YCVA 4JI6Q 1FJGQ 1K0RA 1CKOA 1LUZA 1HNXL 4BXXG 2VNUD 4X6AH 3K8AA 4YHHQ 5AJ3Q 4DV7Q 2EXDA 1KD1C 1D8LA 4JI3L 2OCEA 2XTIA 3TS2A 3F2DA 1IBLQ 4DR4Q 3FKIH 4B3SL 4A93H 1Y1VG 3L2PA 4DV2Q 4C3JH 3SGIA 4B3RL 1YHAA 4PG3A 5EAYA 3BU2A 1V9PA 1IBLL 3U4VA 4NXML 4DV4Q 3TEHB 1D7QA 2ZM6L 4DV5Q 4JV5Q 2Z6KC 4LF5Q 1RL2A 3PUYA 1X3GA 4XIGS 3UDIA 2K75A 5LMNQ 3S24A 1JE5A 1VQCA 2E5LL 1JJCB 2GVAA 1N33Q 2UUAQ 1QZHA 1Y1VH 2NVYH 3GD7A 1WCMH 2I5LX 3K7AH 5LMUL 2BH2A 3KFUA 5IP9G 1QZGA 2VUMG 3PSIA 3AFPA 4DV6Q 2F4VQ 1FGUA 3H0GG 4LFCQ 1EQRA 1S40A 3S1RH 4LF6Q 3HOZH 1Q81C 1WI5A 1IL2A 1WJJA 2KHJA 1KRTA 1N8RC 1BKBA 4KHZA 4GNXC 3AFQA 3I4MG 4KLKA 1PH2A 2R7DA 3J80c 5LMUQ 1S72A 4APVA 3HOYH 5GQOA 3ULJA 3H0GH 2UXBL 2BA1A 2ZM6Q 5IE8A 3J7ZC 4DV5L 1KAWA 4GN3B 4PZ8A 2VUMH 4C2MH 3M85A 2LXJA 1OTCA 3CCSA 5M3FG 3A0JA 3BZKA 2ZTEA 4AYBG 3CCRA 1S3OA 1NMGA 4DKAC 3GTKH 2IHEA 2QEXA 3JAMi 4A3MG 2I5MX 2YV5A 3G4SA 3OW2A 2EQSA 2Q2IA 4P73A 2JA5G 5LMNW 1XPOA 2E2IH 2R7ZG 4JI5Q 4IFDJ 4P75A 4UP8A 1FJGL 4A3LG 3CQZH 2NN6G 4L5TA 4HJAA 2LSSA 2VQFL 1PH5A 1C7YA 3CMEA 3ER0A 4QQBX 1PYSB 3AYHB 1UE5A 4B3MQ 5GAEC 4HIOA 2KHIA 3PO3H 1Z9FA 2KENA 5C0XG 5JJIA 2JA5H 4JI1L 3HKZG 5FJ8H 4DV6L 1HZAA 4YWLA 1W2BA 2HIXA 1EOVA 4A3MH 1VQ9A 4JI7L 3RLOA 3M9BA 2VQFQ 1UE7A 1K73C 5IYBG 3BJUA 1CKNB 5GAGC 5M5YH 4DR1L 2NZHA 1K83H 3OYYA 2ZTDA 4L5RC 4LNQA 3M3YH 4B3TL 5LMNL 2ALYB 4BBRH 4LFBL 4GOPB 1E7ZA 1XPRA 4JYAQ 5BR8Q 1EYGA 4LF7L 4GN4B 4X62L 3DM3A 4DUZL 3HOWG 1L2FA 2VW9A 1ASZA 1SFOH 1XNRQ 4BBSG 2F52A 3PCOB 1HNZL 1N34L 1XNRL 1MJEA 3F8TA 3NELA 1TWCH 4IPGA 5C3EH 3HOZG 4R4CA 4P72A 1I3QH 4LFBQ 5M5XH 3I4NG 3NENA 1BBUA 2VL6A 3CD6A 4JI2L 4R4OA 3T1YL 3CW2C 2R92H 4JI6L 1QVFA 3A5UA 2R93G 2AHOB 3A74A 4A3FH 1K8GA 4DAMA 3E0EA 2DUDA 5JEAJ 5IP7H 4DK3C 2MO1A 1VQGA 4DR6Q 3PIPA 1XMOL 4GN5A 1EUJA 2H5XA 2RF4A 2YYZA 3KDFB 3NBHB 1M90C 1GM5A 4DR3L 3RZDH 4LF8L 4DUYL 3CPFA 1V1QA 1YHBA 4JI8Q 3RLFA 4C3IH 1WOCA 3RN5A 3L7ZC 2B3GA 4MZ9A 3RNUA 4BY7H 1GVPA 3TREA 2Q2TA 4L5SA 1CKNA 4ALPA 4DAYB 2WFWA 4IFDG 1KRSA 4A3DG 4JV5L 3FHWA 4IJHA 3F2BA 3W1BA 5HGQA 4DV0L 4C3HH 4BXXH 4LFAL 2QGQA 4A3GG 1VQPA 4R4TA 2RHSB 1VQ6A 4PMWA 1I94Q 3LGJA 3K80C 2Z0SA 5C0XI 4K0KQ 1G291 2OQ0A 4L5QA 4AQYQ 1IBKQ 1Q46A 3CC7A 4YWKA 5M5WH 1X54A 4WJ3M 2WP8J 3I7FA 4R4IA 2JA7H 3M7NA 5C4XG 1E22A 3PUZA 1YBYA 4P74A 1U0LA 1YITA 4GKKL 3GDEA 3G6EA 4X66L 4NB3A 2JA8G 1QVCA 4AYBE 1VQLA 4GNXB 4UY8C 1YJ9A 4BBRG 4A3GH 3UDXA 1PH7A 4OWTB 4POGA 3F1ZA 4LF4L 1A63A 1YEZA 4A3CH 5C0XJ 1SR3A 5K36G 4BA2I 1GO3E 4BY7G 4TQUS 4J15A 3CC4A 2NN6I 1N33L 2NZOA 2A1AA 4A93G 2UU9Q 2VQEL 4B3ML 1H95A 2ID0A 4A3LH 4DR5L 2VS1A 3JAMc 1JJGA 4Y52H 3KJPA 4FDBA 2IX1A 5JJLA 2UU9L 1XNQQ 3RN2A 3CCQA 1GD7A 1VQIA 2E8GA 4JI4L 1XPUA 2N78A 5JJKA 4IO9A 1QVGA 3S1MH 4A3IG 2AWNA 3I4OA 1K9MC 1IBML 4DR4L 1OXSC 2UXCQ 3PV0A 4A3BH 4A3CG 2N8NA 4JBWA 4LUZA 4LW1A 2E2JH 2JA6G 3HOWH 4JI3Q 1P16A 3GTQH 4HJ8A 3WWVA 1MJCA 2JA7G 4KHPQ 3UDGA 2UXDQ 4R4QA 4YHHL 4IJLA 3J81c 1EIFA 2CFMA 3J80i 1B8AA 4DV3L 2JA8H 2CKZB 1R9TH 2IT1A 1PH1A 3HOVH 3TRZA 4GKJQ 3CCMA 4OX9Q 4IFDI 4QIWE 3EN2A 3KJOA 2C35B 1TWAH 2K14A 2Z6KA 1AE3A 2Y0SE 3MXNB 3J81j 4JBMA 2UXDL 1YHQA 3OTOL 1EIYB 1X3FA 3S2HH 4A3EG 4JBJA 1WCMG 3RLNA 2QA4A 3CC2A 5IP9H 4HJ9A 3K0XA 1KIXA 3CP0A 1V43A 1L0WA 2YTYA 1A62A 1VQDA 2K5HA 2B29A 4X65L 2JA9A 5C44G 1VCIA 2WB1G 1SN8A 3UDFA 3KF8B 1Y1WG 1VQ5A 4OXPA 1PA6A 1Q12A 2K50A 3CCUA 1QUQB 3I55A 4JG2A 5IT9c 2UUCL 2MFIA 2XGTA 4O0AA 2VZAA 4O2DA 4DR7Q 4DV1L 2JEAI 4LUOA 3MEFA 5E7NA 4JI8L 3GTLH 3FKIG 1KC8C 1PH8A 1J6QA 4LF4Q 4NXNQ 2JA6H 3E9IA 3T1HL 1YIJA 2PQAA 3W5OA 1Q82C 3PO3G 1BVSA 3HOUG 1N9WA 4PZ7A 1JJ2A 2IY5B 5IYCG 1TWGH 1Q86C 3KYHC 1HZ9A 2B63H 1E24A 2WAQG 1E1OA 4LWCA 3T1YQ 4OWXB 4DPGA 1AE2A 3T1HQ 2YTVA 4HJ5A 3M4OH 1C9OA 1X56A 2AMCB 2CWAA 5FLMG 5C4JH 3CCJA 4LF9Q 1L1OC 3PF4A 3HKSA 1YJWA 1IBMQ 4POFA 1NBWA 2KCTA 1N34Q 1YVCA 1E1TA 4GLAC 1NTGA 2MNAA 3PO2H 5C4XH 2CQOA 3U4ZA 3I4NH 4JC0A 3ULLA 1J5EL 2I0QA 5FLMH 1I50H 2RCNA 3HOYG 1NE3A 2VQEQ 3PUWA 4DR1Q 3K81C 2I5HA 4H02A 3VDYA 1LM0A 4A3JH 2OTLA 1CSPA 4AH6A 5HY6A 1SMXA 1L1OB 2JE6I 2GVBA 1VQMA 1KXLA 4X64Q 1A0IA 3B6YA 4YWMA 1HZBA 3PUXA 4QGUA 3CMAA 2NVQH 2D0PA 2WAQE 1K8AC 3PO2G 2ZJQA 4OX9L 4GOPC 3GTPH 1YZ6A 1VQBA 3ICEA 3NEMA 4GNXA 1GKHA 4IPDA 4QJFA 1NY4A 4JI5L 5FJ8G 1N32L 1L1OA 4DR2L 4DNIA 4IPHA 2KBNA 4NPSA 2FXQA 1XTDA 5GROA 4A76A 4A3IH 1G6PA 1VQFA 1Y14B 1G51A 2L15A 2F3IA 4DK6C 1B70B 3HOVG 2UXCL 1PVOA 1UE1A 2VY3A 2ASBA 1WFQA 4DV1Q 2R93H 4JI4Q 1I94L 1UE6A 2ZTCA 1OXTA 4TVAB 5M3FH 1XNQL 1X55A 4XTCS 1KHIA 4IPCA 1RIPA 4IOCA 4RG1A 4UPAA 1PH6A 4EQ5A 1VQ8A 4WJ4A 5M3MH 1PV4A 1VQHA 3H3VH 3UE1A 1E3PA 4BA1I 1WYDA 4A75A 3HFZB 1AH9A 1X3EA 2UUBQ 2ATWA 2PI2A 2R7FA 2OQKA 4OWWB 1VQ7A 1HNWL 3KOJA 4DUYQ 2CWPA 4LF9L 2JQOA 3K7UC 4JI0L 4QY7A 2RHQB 5IY0A 3TQYA 3CF5A 3L0OA 1N32Q 1PH9A 4Y7NH 3GTJH 3BZCA 1CUKA 1HR0Q 3S17H 2PQAB 4X66Q 5ELOA
chains in the Genus database with same CATH superfamily
4K8JA 4M8AA 1JMCA 1H9SA 3KLSA 5CMDA 3HOXG 1IXRA 4DV4L 1HNWQ 1CSQA 1ET9A 1X6OA 1SE3A 3P1HA 1FNWA 3Q8DA 4AIMA 4IQZA 1H9SB 2B8GA 1AFPA 1B53A 3ULPA 4UP9A 3BVZA 4DR5Q 1VQOA 2D62A 1BBWA 4MTNA 5FLXc 3EROA 4RH6A 3PUVA 2HHHL 3S1QB 2A74C 5FOBB 2F0GA 1ILPA 3VR6A 3OTOQ 1PFSA 4DR3Q 2IPKD 2F1MA 2QKIC 3GTKB 2BE5D 4RHRA 1UWVA 2MPMA 2ES2A 4GKJL 2HT1A 3MFYA 1TWHH 4A3EH 2Z8LA 2Q8IB 3I3CA 1Q8KA 1P8LA 3KF6B 1LT6D 3Q24A 1J9OA 4BY1B 3GP7A 1EY5A 4MHEA 4X64L 2JYOA 2EZVA 3RZOB 3G48A 2EJFC 5DM73 1HNZQ 3EIVA 5KGUA 4YCUA 1XX8A 2NTTA 2QCPX 1GUGA 1LTAD 4QL5A 4K5VA 3HOWB 3EBEA 4JYAL 1VQEA 2UXBQ 2OTJA 4NKLA 2L55A 3FDTA 1RCVD 3JAML 2F0HA 1R4PB 3UE0A 1WTWA 5T1GA 3AU7A 1IZ6A 2WINB 1K3RA 1RODA 4RMFA 1IL8A 3QB3A 2KCMA 4A3BG 1EZ8A 5IP7G 3CXCA 1U5KA 4A3FG 2E5LQ 2PNHA 1HR0W 3VR4A 3VYSA 4LF5L 2JP1A 3NWSA 5H1SE 1NJIC 3A7AB 2SNMA 3S2DH 1RTNA 4ME3A 3F2CA 4I7ZC 4DAYA 1DGSA 1WD0A 3GTGH 1Y69U 3U58A 5FO7B 4BY1G 2UUBL 2A8VA 2GN5A 4DV7L 4XT3B 4IOAA 4JCVE 3LX0A 2IX0A 1M1KC 3KF6A 2WKDA 3MXNA 1SLJA 3D0FA 2KJXA 4KY6A 2KEDA 5CGKA 2EYPA 1PH4A 5TSSA 1XMOQ 3V05A 3M3YB 5M3FB 4YCVA 1CKOA 1HNXL 4X6AH 3K8AA 3IFDA 4A3MB 3BYTB 5JEAH 4JI3L 1UUPA 3OPOA 1IBLQ 3DHQA 3IAYA 1DZ1A 4DV2Q 4C3JH 4KK7A 3SGIA 4B3RL 4PG3A 1YNNC 2L0CA 1A3UA 2K33A 1D7QA 1QJOA 1CA6A 4JV5Q 1RL2A 2A69C 3VYUA 1VQCA 3BVGA 1JJCB 1EQTA 2BH2A 1MSHA 4HSVA 3A56A 1FGUA 3H0GG 2R92B 1EQRA 4LF6Q 2D9UA 1Q8IA 1N8RC 1G2SA 1BKBA 5COYA 1HUNA 3AFQA 3I4MG 3ND9A 3WOEA 1PH2A 3TP5A 2K5QA 1KABA 3H0GH 1I6VC 2IX3A 3Q6SA 4GN3B 5FO9B 4CKCA 1S5ED 2VUMH 5CR3A 1HA6A 1SNOA 1S3OA 4DKAC 3I8ZA 3QIAA 2B2YC 2QEXA 3G4SA 1NUCA 3DWQA 2ICEC 1XPOA 1E0BA 1WTPA 5G3LD 1FJGL 4A3LG 4L5TA 3GTLB 2CH4A 4RCNA 4QQBX 4OEMB 1PYSB 3AYHB 5EKKA 2KHIA 3PO3H 1Z9FA 1I3QB 4JPBW 3T16A 1UE7A 4A3FB 1CKNB 4DR1L 2NZHA 3OYYA 3M3YH 3MEHA 2G9DA 2FFKB 4LFBL 4GOPB 2DJGC 1TT2A 2ENBA 4LF7L 1HFGA 1OO9B 3DM3A 3P7JA 3HOWG 1SYGA 3DEPA 2VW9A 1XNRQ 3PCOB 2X69A 1TU2B 1TWCH 4IPGA 3J7AF 4K2KA 1B9MA 1SNCA 4ZYSA 3MA2B 1I3QH 4LFBQ 3I4NG 4RGMA 4JI2L 2KEEA 4R4OA 4QIWB 2FJ2A 2RDHA 1F9RA 1TWGB 1E2WA 2KQ3A 4WJWA 5IGGA 2AHOB 3A74A 4PMBA 3E0EA 3S2DB 1VQGA 4GN5A 1MD2D 2H5XA 2R7ZB 4ABNA 1W6KA 4DUYL 4BY7B 4L6TB 3DXJC 1TS4A 2C5CA 2B3GA 2Z1CA 4BY7H 4UAIA 2OXPA 1LT5D 4IFDG 3T53B 4JV5L 3FHWA 4XYOA 2HDMA 5HURA 3W1BA 3J81L 5HGQA 3HKZB 4DV0L 1X3QA 1JICA 5J39A 4LFAL 1SXTA 4R4TA 3QOLA 1I94Q 1UEAB 4FXKC 3KBXA 2Z0SA 1PTOF 2NBFA 4L5QA 1S5BD 1K83B 1S5CD 2CHBD 4P74A 1YITA 4A3EB 1CK1A 1BR9A 4X66L 4NB3A 1BCPD 2N88A 1R4QB 1CFMA 1YJ9A 3UDXA 4OWTB 1GUWA 4POGA 3F1ZA 2BE5C 2PO4A 3NQIA 1CA5A 2F0OA 2SDFA 3D4DA 3S16B 3BYYB 2PZWA 4FF4A 1N33L 1Y1VB 5KIXA 1BBXC 3DWAA 5M9OA 2E2IB 3VR5A 2IX1A 1GD7A 1H9JA 3TMEA 2CVRA 3ONAB 2NVQB 2AWNA 3I4OA 4LW1A 1P16A 2UXDQ 1QB5D 4DV3L 1BCPB 5C4ZA 1PH1A 3S2HB 2L9HA 2B2WC 4GZYC 4ZCKA 3EN2A 1GUTA 3CRLC 3KJOA 2K14A 4JBMA 2UXDL 1ENAA 3MXNB 3D6WA 4C1NI 1YHQA 1TWHB 1X3FA 3HP3A 2KHSA 2EY1A 4I7AA 4A3EG 1RKNA 1WCMG 5D14A 3UI2A 4ZKCB 4HJ9A 3CP0A 5C4HA 3KBGA 1A62A 3SK6A 5D65A 1SE2A 1Y1WG 2WB1G 3KF8B 1PA6A 3K5LA 3TSSA 1DYQA 2XWBB 3MHBA 3I55A 2MFIA 2XGTA 1TIID 4O2DA 3FKIG 4RGTA 1J6QA 4NXNQ 3U9SA 3RMHA 2RKSA 1N9WA 4PZ7A 4X3KA 1JJ2A 1PFMA 2PYKA 1FNVA 3PMFA 1DD2A 2PPBC 1E1OA 3R93A 1AE2A 3T1HQ 1ICFB 1STHA 1C9OA 1X56A 4LF9Q 2E2DC 3S9WA 3PF4A 4RWSC 5C5MA 5D3IB 1IBMQ 3KUPA 4ZK9B 1HTPA 1TWCB 3HG9A 4A3JB 4HN7A 1EFID 1NTGA 3ND8A 1YNJD 5C4XH 4N8X1 1DCZA 2HCCA 2RCNA 3HOYG 4DR1Q 1XYIA 2OTLA 4AH6A 2Q8RE 5HY6A 5CV9A 4OIJA 4U68A 1TS5A 1ZEQX 2O5IC 4X64Q 3S14B 3NTKA 5AFWA 2NVQH 4ID6A 3PO2G 5EQ0A 1BCPF 3Q0AA 1VQBA 5J22A 3NEMA 4GNXA 2AQ3B 4IPDA 1ZKOA 5FJ8G 1CI3M 1N32L 4B9XA 2XN9C 2DNCA 2FXQA 1XTDA 1BCPC 1EYDA 1G6PA 3EQLC 2R93H 4JW0A 4PQXA 2EYJA 4C3HG 4DXGA 4EQPA 1HTLD 3NSWA 4H0LC 4IOCA 4UPAA 2EYFA 2OF1A 2CQAA 2EVBA 3V96A 3L3OC 2NUCA 3HFZB 4Y7NB 3PQIA 2EYHA 1AP0A 1EY7A 4LF9L 3NE5B 1C4QA 2JQOA 2L4NA 4QY7A 4DK1A 5IY0A 3L0OA 3GTJH 1HR0Q 5CV7A 4X66Q 1VQAA 1XTCD 1WCMB 5M3MG 1U4RA 4J8QA 2HDLA 1WTQA 3I56A 1SROA 2A19A 4BY1H 1XJVA 1NSNS 5C3EG 3KF8A 2V1CC 3WDNA 3M4QA 4OONA 4K0KL 4C3JB 1JWMD 5KYIA 4B3RQ 1EY8A 3VA7A 4L8JA 2NN6H 1Q1BA 5I6WA 1A3TA 2EIFA 1AW7A 1HCZA 2AWOA 2F0WA 1N36L 3PF5A 2K03A 3BDCA 3CCLA 4JI1Q 4LF6L 2VXWA 5JEAG 2F0TA 4DR2Q 2A68D 1QCBD 1D5MC 1HJPA 1S5FD 1IYJB 2GA4B 1I5FA 2ZJPA 5KYLA 3RZOH 4JI2Q 4A3JG 1B7YB 1M4VA 1LTID 2HQLA 1CKMA 5C44H 2O5JC 4GLVB 2K5VA 4NXNL 3ITPA 1W3SA 4PZ6A 3NTHA 2RA4A 4AQYL 3A5ZB 3HOXB 3NPPA 5A2QE 1MIUA 4DN4M 5BN5A 2WB1B 3HEJA 4K6DA 4LK1C 1SE8A 4B3SQ 3U50C 5IWAQ 1CQVA 1FR3A 2Y0SG 4LF7Q 1K0SA 4V0BA 2YU9H 1E2ZA 2BOSA 4DAPA 1UEBA 4EQOA 2ZXPA 5CV6A 1TY2A 4HJ7A 3I4MH 4EX5A 3S1NH 1A6XA 3CAMA 2NVXH 3IKJA 3C1FA 3AQQA 3HKZE 4HIMA 5K36H 4A3KH 1NR4A 3ZJYC 2V4DA 4ZAIA 4JOIA 5IYBH 1DXMA 5FLXL 1SYDA 1SRUA 3JC66 1RTOA 2EOTA 1Q1EA 5GADC 1IYUA 1PH3A 1FVIA 3PIP3 1A3VA 3GV6A 2BDOA 3C2PA 3TP7A 3E9HA 4IUNA 1VQKA 2B63G 1VQJA 2QDLA 1EOTA 1YNXA 1G2TA 4YY3Q 3E5SA 1PFNA 3S14H 3H94A 3P20A 2ICIA 4R8IA 1XMQL 4DUZQ 2R92G 3GTMH 4FF1A 2E2HH 1SNPA 2BCOA 1B9NA 1I4HA 1EQQA 1BXTA 3VYTA 2SNSA 4RKBA 2JSOA 3PGZA 3STBD 1T9HA 4LUVA 5FLXE 3J7YW 2F0EA 2K52A 4MIUA 3DLLA 4OO1G 1N36Q 2UUAL 4JI6Q 4QUCA 1K0RA 1FJGQ 1O80A 1EWCA 1D5XC 3DWPA 3M4YA 5C0XH 1LT3D 3TS2A 3F2DA 5C6AA 4B3SL 5EKIA 3L2PA 5EAYA 3BU2A 1EIHA 4NXML 4DV4Q 4F7XA 2IL8A 1ICWA 3PUYA 5LMNQ 3UDIA 5ELDA 1PTOH 1JE5A 1W6JA 1QZHA 3VYRA 3KFUA 5IP9G 2PW5A 2RQXA 1F9SA 3K5MA 4DV6Q 4LJZC 5M5WB 3T56B 1SBBB 1Q81C 1IL2A 4CJ2C 1KRTA 4DU9A 2B8FA 4Q5VA 2R7DA 5C3EB 1S72A 3SK8A 4APVA 5GQOA 3ULJA 2UXBL 2ZM6Q 5IE8A 4DV5L 3H6MA 1Q3LA 3K7AB 3CCSA 2PW7A 1G8ZD 2ZTEA 4A93B 1CZWA 2F0PA 5LL6S 3JAMi 2FINB 4ZQ3A 3OW2A 2Q2IA 3RUZA 4DFAA 3D3RA 1B44D 1B3QA 4JI5Q 4P75A 3QWNA 2VQFL 3ER0A 5L37A 3Q22A 2B2UA 4HIOA 2KENA 5LHY1 1YNJC 2F3VA 2X6LA 3HKZG 4DV6L 1HZAA 1W2BA 2L1BA 4HMIA 3BVMA 2VQFQ 5IODA 1B1ZA 5IYBG 2DY7A 3BJUA 3I4MB 3H09A 3URYA 4J6HA 4LNQA 1BUVT 5LMNL 2ALYB 4B3TL 1XPRA 2B2WA 4X62L 1HQRD 4XYQA 1V8QA 1SFOH 1HNZL 1N34L 1MJEA 3NELA 2F0QA 5CV5A 5HGTA 4J1MA 3NENA 4JK1C 1LABA 2RBMA 1PRTC 2EE1A 4UDUC 2R92H 4JI6L 1K8GA 4HCSA 1PTOB 1STBA 2A73B 2HCIA 4DR6Q 3PIPA 4WRDA 1D6EC 2YYZA 1M90C 3R2IA 1WD1A 5IT9L 1YHBA 2A5HA 4C3IH 5CYUA 3RN5A 3TREA 4L5SA 1CKNA 2XNAC 2WFWA 1H9MA 1PTOC 2H4OA 4IJHA 4CJ0B 4CHTB 3F2BA 1F2LA 1STAA 4C3HH 4MN3A 1H9RA 2RHSB 3K80C 4K0KQ 2JA7B 3T4AC 2OQ0A 4IALA 3NQTA 4XXEA 2RDGA 5C4XG 4A3GB 1E22A 3PUZA 1YBYA 3A55A 1U0LA 3LNNA 3I90A 3MZ5A 2B2VA 3K6OA 1PLFA 4AYBE 4QCLA 1AZPA 4GNXB 4DGZA 2XSCA 4LF4L 1ET6A 4A3CH 5C0XJ 4NP5A 4H44C 2J7ZA 4TQUS 5ELCA 3CC4A 2NZOA 2A1AA 5IOCA 4A93G 4B3ML 3AB9A 1C8CA 4QUFA 2WKCA 4DA2A 3JAMc 1T5XD 2R3ZA 4Y52H 3DEOA 3J80E 4NDXA 1XNQQ 3CCQA 1VQIA 3HS0C 4JI4L 1D1IA 5JJKA 4IO9A 4PMCA 3S1MH 1K9MC 1IBML 4A3BH 1PRTF 2N8NA 4JBWA 2E2JH 2DNEA 1ZYRD 5G3LF 4HJ8A 3WWVA 1MJCA 3MXUA 1CM9A 2CFMA 1B8AA 2JA8H 3TRZA 1K8OA 1VF5C 5I9PA 1V1OA 3CCMA 2I46A 1PYWD 2C35B 1TWAH 1XXGA 2IJ0A 3BG3A 1R9TB 5E4XA 4RKLA 3RLNA 2QA4A 3CC2A 1CZGA 3K0XA 3A8JE 2Q8TA 1L0WA 5JVH3 2YTYA 1VQDA 4X65L 1SN8A 1VQ5A 1Q12A 5A2QL 4JG2A 5IT9c 5J1ZA 2I07B 4K5XA 2VZAA 4DR7Q 2MUYA 2MJ8A 2JEAI 4LUOA 3MEFA 2MP1A 4LF4Q 2HQEA 1JOKA 3T1HL 3QOJA 3VR3A 3W5OA 1Q82C 2EYLA 5IYCG 1TWGH 1HZ9A 1Z7TA 2JA6B 4OWXB 3TDQA 1I4PA 1O7LA 4KJNA 1VMCA 2AMCB 2CWAA 5FLMG 1L1OC 1SEBD 1YJWA 4POFA 1NBWA 2KCTA 1FYCA 1E1TA 4GLAC 1I50B 2WAQB 1MBYA 3HZXA 4F87A 2MNAA 1U4LA 1F77A 2QEJC 3ULLA 5FLMH 1I50H 3NK9A 3VDYA 2VQEQ 4A3JH 2I5HA 4XDXA 3QJYA 2M9VA 1JE4A 1VF7A 1PRTB 1HZBA 1KDBA 5KNBA 1EY6A 3FVQA 2D0PA 5C44B 5T1IA 2ZJQA 3MXPA 3GTPH 3ICEA 4L63B 2EY6A 1NY4A 2F0LA 2RVLA 4DR2L 4DNIA 2IWHA 1HHVA 2JA5B 2UXCL 2F3IA 1PVOA 1WFQA 5EJWA 3LWEA 4JI4Q 4Z9CB 5E1FA 1B3AA 3ERQA 1X55A 4XTCS 3HGBA 3OIQA 4IPCA 5IGCA 3GV3A 3E3XA 4EQ5A 4DXFA 2A68C 3H3VH 2K6AA 1E2VA 3UE1A 1E3PA 1LACA 4BA1I 1AH9A 5JPMC 1CT1D 2SOBA 2OQKA 1VQ7A 3KOJA 2CWPA 3M7GA 3BZCA 1L0YB 5EPKA 2EDGA 4KY7A 4KHVA 1SSOA 5ELOA 4FNFA 2OWOA 2K04A 4ZRZA 3HOUH 2NYZD 2RCFA 2LXKA 2YTXA 2ZJRA 1MSGA 1VS0A 3H91A 3I4NB 1G6ZA 2BH8A 1ASYA 2N3SA 5CBAE 3G71A 4HIKA 4DV2L 1HA5A 3S15H 4LFAQ 1ONLA 1UNSA 4DNRB 1X9NA 2XWJB 1STEA 3PIOA 4OO1I 1I6HH 2D0OA 1TXYA 1IW7C 3SE0A 2NVXB 2Q2HA 3I73A 3A54A 1Q7YC 1DM0B 1HPCA 1I4QA 4A3KG 4R1JA 1CQFA 1LTTD 2CW0D 3GTOB 1TWFH 1Z6HA 4MNOA 2KCCA 2A6HC 3OMCA 2TSSA 4DV3Q 3MAQA 2F0DA 4KY5A 3MVVA 3MC0B 2UUBQ 1ENCA 4JVZA 1NR2A 4NXMQ 4G57A 1HQMC 3I2ZA 4FO2A 2K01A 2CCZA 1EY4A 2F0NA 4FP5D 4YY3L 2UUCQ 1CHPD 3SK4A 1PMRA 2J4XA 1OXVA 4KKTA 4X65Q 1A2TA 1J5EQ 2AUJD 1PHJA 1YI2A 3K58A 4K2LA 1LYLA 2RDFA 1HNXQ 5GAHC 1OXXK 1LTLA 4C3JG 4HTHA 1AZQA 4GS3A 3NWTA 2NVTB 4NW2A 2WB1E 4KI0A 4LF8Q 2B2TC 4LFCL 5I6YA 4A3DH 2F4VL 3GTQB 4GLXA 2JK8A 1MKHA 3KDFA 3S1QH 3RZDB 2EYOA 3GO5A 5CBEE 2LS01 1PZJD 1TR5A 1CTMA 2F0FA 4KHPL 3RR5A 4CKBA 1XMQQ 4EQNA 1NMFA 1EWIA 5IYDH 4DR7L 2NVTH 4BS9A 1ZXTA 4HIDA 3Q23A 4P71A 5BR8L 3W2DA 2DY8A 1KQSA 3D4RA 3OOCA 1JT8A 3EVQA 3AEVA 1SYEA 4KN4C 3S17B 5IYDG 1PYBA 2D2CC 1S4ZA 2QILA 4M1UB 4PNYA 3SHLA 4YIJA 4JOIC 1HZCA 1KL9A 1O7IA 5M5YB 1A8VA 2PZTA 3J7A5 1QUQA 4JBKA 4AYBB 2BA0A 3R3OA 4C3IB 4CDDC 1BDOA 1LUZA 2VNUD 2K5DA 4DV7Q 2EXDA 1XWEA 1KD1C 2EPBA 2XTIA 3M4OB 3FKIH 4ZUIA 4A93H 1Y1VG 2E74C 1MHWC 2KA7A 1C48A 5KNCA 4QB4A 2Z6KC 4LF5Q 5EPJA 3S24A 3QG1A 3SVMA 2GVAA 5KEEA 2CH4W 1Y1VH 2NVYH 2I5LX 2EJGC 3NXWA 1QZGA 3C1EA 3PSIA 3AFPA 5FKAC 1T5EA 4BBRB 2F4VQ 4H7BA 1IKLA 1S40A 3HOZH 3CU7A 3OSOA 1WI5A 3U9OA 3A7LA 2EY5A 4KHZA 1FNUA 3MWYW 3KLSX 1PZKD 4Q0FA 3HOYH 2LY7A 4CGYB 2BA1A 1BF4A 4DNTB 1KAWA 4PZ8A 4C2MH 3OHXC 3M85A 1OTCA 1IHZA 5M3FG 1NMGA 4QF4A 1ESFA 3GTKH 1D1KA 4A3MG 4ILWA 4RGNA 1LV9A 2JA5G 4IFDH 2FHTA 5LMNW 2E2IH 2R7ZG 5LL6X 2KOLA 2NN6G 2PQEA 3CQZH 4HJAA 1QOHA 2LSSA 3FKIB 1C7YA 3TZUA 1UE5A 3L9AX 3SDZA 1KTKA 5A35A 5GAEC 2A6EC 3HOUB 2ZT9C 5JJIA 2JA5H 4IUTA 2VUMB 4JI1L 5FJ8H 4YWLA 1EOVA 1EU3A 1VQ9A 4JI7L 1KNAA 1TKWB 1K73C 1K83H 2ZTDA 4L5RC 3BS1A 4BBRH 4JYAQ 1DONA 1SYCA 1ENFA 1L2FA 1ASZA 1AN8A 4K8IA 1XNRL 5JVG3 3F8TA 2JA8B 1DOMA 2AUKA 3HOZG 4R4CA 5KNDA 2DJFC 4P72A 5M5XH 2VL6A 3DM1A 3A5UA 1X32A 4A3FH 4CDEC 2KECA 3GQBA 2DUDA 4DK3C 1NNXA 1RDPD 4FXDA 1XMOL 2F03A 1FD7D 2WIIB 1EUJA 3NBHB 1GM5A 4DR3L 1F9PA 1SDFA 1V1QA 1WTRA 2E76C 5JOBA 1F2MA 4MZ9A 2R61A 1GVPA 2Q2TA 4DAYB 2O4XA 1EY0A 3H3VC 3HOYB 4A3GG 1VQPA 1VQ6A 4G7HC 4PMWA 1SFOB 1PRTD 3LGJA 3SXHA 4XT1B 2FMCA 3K57A 4X3TA 4N9TA 1X54A 3CKIB 2WP8J 4N8FA 2G5DA 4X3UA 4R4IA 3EFXD 3M7NA 2XIWA 1GJXA 3G6EA 1QWYA 3KLRA 3R8BA 1SAPA 2JA8G 2K05A 1QVCA 1VQLA 4BBRG 1PH7A 4CKEA 3PO2B 4HAEA 1A63A 1YEZA 3NUCA 1PTOD 1SR3A 4BA2I 1RJTA 4J15A 4K14A 5C4JB 4KD4A 4IZ8A 1H95A 2O2LD 5EBCA 4DR5L 4A3BB 1JJGA 3D4WA 5JJLA 1BO0A 2UU9L 2EY2A 4TSSA 3E0JA 1XPUA 1QVGA 2L5TA 2Z9HA 2UXCQ 4A3CG 1EQVA 3NHHA 4JI3Q 1O78A 5C3XA 4XQJA 2JA7G 3GTQH 4KHPQ 5IT9E 1HUMA 5K5PA 4YHHL 2Z6BA 3J81c 3H0GB 1QILA 4IURA 3WOFA 2IT1A 4C2MB 1R9TH 3KK7A 4OX9Q 4QIWE 5I2XA 1KAAA 1QG7A 4OGQC 3J81j 2Y0SE 4NMZA 3OTOL 5IGEA 1GXDC 5IP9H 1KIXA 1ZYRC 1V43A 3D8GA 2NWGA 1JOOA 2JN4A 2JA9A 5C44G 3UDFA 5CC4A 3C3LA 2K50A 3CCUA 5NUCA 2RSNA 4ME5A 4RFBA 4DV1L 1EY9A 2PNRC 4JI8L 1JORA 4A3IB 1K28A 2JA6H 4RGOS 1I4XA 1BVSA 3HOUG 1Q86C 1GHJA 3KYHC 3TP8A 1E24A 2WAQG 3SR1A 1JCKB 4LWCA 3FPUB 2YTVA 2KVMA 1O7YA 5EGTA 4HJ5A 3M4OH 4HCEA 3CCJA 1LLRD 3HKSA 3OW7A 3IFTA 4OELB 1GUSA 1FGBD 2CQOA 3U4ZA 3I4NH 1SMYD 4JC0A 1J5EL 2I0QA 4FYDA 3PUWA 5E3FA 3K81C 2B2YA 2Z4HA 1SMXA 1L1OB 2MGSA 1KXLA 1A0IA 3B6YA 3G6JB 3PUXA 1Y1WB 3CMAA 1K8AC 4OX9L 3GTMB 2M2LA 1YZ6A 3OWFA 1O7ZA 2F0MA 1GKHA 1TWFB 1GOZA 1L1OA 4NPSA 4TRDA 1Y8NB 4A76A 1JB3A 4A3IH 1Y14B 1G51A 2L15A 3HOVG 1B70B 1UE1A 2VY3A 2ASBA 4DV1Q 2DN8A 1I94L 1UE6A 1OXTA 4IUQA 1LTSD 5I2YA 1KHIA 3N6RA 4RG1A 1LTBD 2K5WA 4HSPA 1QNKA 1LT4D 2OT2A 5C5LA 1VQ8A 4WJ4A 1VQHA 4N9PA 3K59A 4A75A 2EYMA 5IIFA 1X3EA 1IYVA 2ATWA 4CDCC 1B4OA 2PI2A 4OWWB 2F4IA 2RHQB 3CF5A 3TQYA 1DOLA 3R2TA 1CUKA 2PQAB 5C3WA 1MI2A 1K8MA 4GOPA 1HR0L 1YJNA 1PZID 3IL8A 3STBC 4JI0Q 2AKWB 2AQ2B 3QO2A 3AMUA 3GTGB 1IBKL 1EYAA 1Z47A 3ERSX 3FP9A 5JJZA 1SMYC 1KDAA 1TS3A 2Q2UA 1VQNA 4A3KB 3K5OA 3J81i 4HMJA 3OWEB 3W1GA 1LO5D 5AJ3L 1HH2P 3CCVA 2LFNA 5IGFA 1EFWA 2BDNA 2L12A 2IHFA 1SNQA 3H15A 5IGBA 2R7ZH 2A6ED 3P75A 4DF7A 3ZYYX 2E75C 4DR6L 4C56C 4OHJA 4LAAA 2K5NA 2KUMA 1OXUA 1M8AA 3X3MA 2KCNA 3HOXH 2K4KA 2XRQD 5IGDA 3CCEA 3IRBA 4IN3A 4KKUA 4R9WA 4TKOB 5KRUA 3V2TA 1ILQA 5M3MB 1JR0D 2L11A 2N49A 4DV0Q 3OMGA 1KNEA 4F8MA 4BBSB 4B3TQ 3E6ZX 2B2UC 3K5NA 2CW0C 1JB7A 2PMZB 3M4PA 3TN2A 2DGYA 5J3BA 1KLUD 1V1PA 3KLWA 4KTAA 2JEBI 3GTOH 1G91A 4UP7A 1STYA 2JJQA 3S16H 1SYBA 3NBIA 3CRKC 4GKKQ 3CPWA 1VQ4A 2R6GA 1JWUD 4BBSH 4B9WA 2PMZE 4A4IA 2K1BA 5DLQE 4YCWA 1C0AA 3D31A 5IWAL 5IYCH 2NTSA 1PDQA 1X65A 1PFBA 4X62Q 1Y1WH 5BN4A 4X3SA 1BNZA 2P5ZX 4K5WA 1EIGA 1FL0A 2EJMA 5ELNA 4ULLA 2NVYB 1ESRA 2RSOA 2MO0A 4JI7Q 4HEDA 1EU4A 1KLGD 1Q90A 3CHBD 2HIVA 2MQHA 2SEBD 4IUPA 4KD3A 1TY0A 1VDZA 2HD3A 2PI2E 3I91A 3TS0A 3H3VI 2HHHQ 5FO8B 3HOVB 4BXXG 4YHHQ 5DAUA 5AJ3Q 2N55A 3J7AV 1D8LA 4XQNA 2F0UA 2OCEA 1Y8PB 4DR4Q 2AQ1B 4RA8A 1YHAA 5CV4A 1V9PA 1IBLL 3U4VA 1BQQT 1TVXA 3T51B 3TEHB 3RD4A 2ZM6L 4DV5Q 3FPPA 3F2UA 4XIGS 1X3GA 2K75A 1II3A 2E5LL 1N33Q 4XQQA 2UUAQ 3GD7A 1WCMH 3K7AH 5LMUL 3FRPB 1HXYD 1SNMA 2VUMG 4FF3A 1RF2D 4QMGA 1WTHA 4V190 4LFCQ 3FMCA 3S1RH 1CHQD 2QDBA 1A2UA 1WJJA 2KHJA 2F0SA 2F0IA 4ZUJA 4GNXC 2ZXRA 3FEWX 4KLKA 1V1PB 1STNA 3J80c 5LMUQ 3VA5A 2NZ1D 4KKSA 1EZ6A 2M00A 3HOZB 1DJRD 2XRSD 4ODGA 3TBIB 3J7ZC 1TWAB 4RHSA 2VB2X 2LXJA 5EBDA 3TP6A 5ELBA 3A0JA 3BZKA 4AYBG 4C3IG 2D5DA 3CCRA 3DMUA 2IHEA 4O42A 2I5MX 2YV5A 2EQSA 5FK9C 4P73A 2Z4IA 4U673 3C46A 1QNUA 4G4KA 4IFDJ 4ZKBB 4UP8A 4LMQD 1WTVA 1PH5A 3CMEA 4FXGC 3K0YA 4OIKA 1DOKA 4ZLTF 1D2BA 1EL0A 2ZXOA 3HRZC 5C0XG 5ELFA 1U4MA 4A3DB 4G7ZC 1B50A 2HIXA 4A3MH 4DK0A 3RLOA 3M9BA 5CORA 1F2ZA 1L0XB 5GAGC 5M5YH 2HUGA 5E4WC 1E7ZA 4G7OC 5BR8Q 1EYGA 2VB3X 4GN4B 4DUZL 4BBSG 5C4XB 1SE4A 3JAME 2F52A 2B2VC 4WORA 2K28A 2H1EA 1F2YA 3NBHA 1S5DD 5C3EH 2TMPA 1IKMA 3A8KE 3I4LA 1TQOA 3W3AA 3I70A 3QR8A 1HRJA 4C1NK 3O13A 1BBUA 1GUOA 3CD6A 2EXZA 3T1YL 3CW2C 1QVFA 3CQZB 2R93G 4DAMA 1QE6A 4UHVA 2XVSA 3T13A 5JEAJ 5IP7H 2MO1A 3J80L 3I72A 3PO3B 2RF4A 3KDFB 5D3DA 2K32A 4LF8L 1B2TA 3RZDH 1H9KA 1STGA 3CPFA 3OIPA 4JI8Q 3PIO3 5I9OA 3RLFA 1WOCA 3L7ZC 2B63B 3RNUA 1WTOA 4ALPA 1KRSA 2B2TA 4A3DG 1JC7A 1I4GA 5F2DA 2A69D 4BXXH 4KMUC 2QGQA 4EGVA 4RCOA 1I4RA 5C0XI 5EKLA 1G291 2OEOA 5DM63 4AQYQ 3MFGA 1IBKQ 1Q46A 3CC7A 4YWKA 5M5WH 4WJ3M 3I7FA 4S3SA 2JA7H 1ML0D 2PZUA 3BDLA 2F3WA 4GKKL 3GDEA 2Y0SB 1VMPA 3EA6A 4UY8C 4H13C 2FMMA 3TZDA 2G9HD 2LMCB 4A3GH 1HFNA 2F0KA 5I4DA 2E2JB 5DEHA 5K36G 2R93B 1GO3E 4I65A 1BOSA 4BY7G 4OL7A 1K3BC 2NN6I 1WTXA 1JWSD 2UU9Q 2VQEL 2ID0A 4A3LH 2VS1A 1UAPA 4WFN3 3KJPA 4FDBA 3VR2A 1NCVA 3RN2A 3S1NB 2E8GA 2N78A 4A3IG 4E6IA 4DR4L 1OXSC 5BN3A 3PV0A 4LUZA 2JA6G 3HOWH 3DUZA 3UDGA 4DAVA 4R4QA 3N52A 2WV6D 4IJLA 1EIFA 3G7LA 3J80i 1EWHA 2K7VA 4KN7C 2CKZB 4GKJQ 3HOVH 4IFDI 2QF7A 1SNDA 5M5XB 1LTRD 4O1NA 2Z6KA 1AE3A 3D6CA 1EIYB 1PXUA 4OO1H 3S2HH 2NB0A 4IUUA 4JBJA 4CBVA 1YNND 2E2HB 3A8IE 2F0VA 2F0JA 2K5HA 2B29A 3X3NA 1VCIA 3BZDB 3MXGA 4OXPA 1QUQB 2UUCL 4O0AA 1Y8OB 5E7NA 3GTLH 1KC8C 4CDFC 1PH8A 2JXMB 3E9IA 1YIJA 2PQAA 3PO3G 2IY5B 1I6HB 4CJ1B 1RHPA 2B63H 1KDCA 3EJIA 1JOQA 3T1YQ 1TS2A 4DPGA 4PV1C 1EYCA 4MTKA 5C4JH 1AEXA 3S15B 4IUVA 4FVMA 1YVCA 1N34Q 3BDOA 1U4PA 2QW7A 2B39A 3PO2H 5JAVA 2YU9B 1JQYD 2PCFB 5JPNC 1NE3A 4B3MQ 4H02A 1LM0A 2J0TD 4KJOA 1WVLA 1CSPA 1SJED 2JE6I 2X6GA 2GVBA 1VQMA 1GUNA 3S1RB 4F88A 2A6HD 4YWMA 3J81E 2WACA 2C9OA 4QGUA 4FF2A 4HR7B 2WAQE 1NAPA 1J8IA 4GOPC 3SEBA 4C3HB 2MHVA 1X3PA 1EEID 3LWUA 4QJFA 4R8NA 4JI5L 1MGSA 2LKVA 4K6LA 4RAUC 4IPHA 2KBNA 5EPLA 5GROA 3MTSA 1VQFA 4DK6C 5ELEA 4B08A 1D5ZC 5ISRA 3S1MB 1SYFA 2ZTCA 1A15A 4TVAB 5M3FH 1XNQL 5DNFA 1U9RA 1RIPA 3SK5A 1PH6A 4BWGB 1LTGD 5CV8A 5M3MH 2IW3A 1IW7D 1PV4A 1GHKA 3GTPB 1F9QA 1WYDA 4KV6A 3GTJB 2R7FA 1HNWL 1SJHD 4DUYQ 4P2CB 3K7UC 4JI0L 1EEFD 1N32Q 3NTIA 1RD9D 3NP8A 1PH9A 4Y7NH 3S17H 4EVOA
chains in the Genus database with same CATH topology
4GOPA 1VQAA 2OWOA 1HR0L 1YJNA 1JMCA 5M3MG 3I56A 3STBC 4JI0Q 2AKWB 3HOUH 1SROA 2A19A 3HOXG 1IXRA 2LXKA 4BY1H 1XJVA 2YTXA 2ZJRA 4DV4L 5C3EG 1HNWQ 1IBKL 1CSQA 1X6OA 2V1CC 1VS0A 1Z47A 3FP9A 3ERSX 3M4QA 4OONA 4K0KL 2BH8A 1ASYA 2N3SA 4B3RQ 4HIKA 3G71A 4DV2L 3Q8DA 4AIMA 2Q2UA 1VQNA 3S15H 4LFAQ 1Q1BA 3ULPA 4UP9A 3J81i 4DR5Q 3W1GA 1X9NA 5AJ3L 3CCVA 1HH2P 1VQOA 1EFWA 2D62A 1BBWA 3PIOA 2EIFA 4MTNA 4OO1I 2AWOA 5FLXc 1N36L 2D0OA 1I6HH 1TXYA 3PUVA 3PF5A 2HHHL 2IHFA 2Q2HA 3H15A 1Q7YC 3CCLA 3OTOQ 1PFSA 4A3KG 2R7ZH 4R1JA 4DR3Q 4JI1Q 4LF6L 5JEAG 4DR2Q 1TWFH 4DR6L 1UWVA 1HJPA 4MNOA 1IYJB 2K5NA 1I5FA 2ZJPA 2ES2A 4GKJL 2HT1A 1OXUA 3RZOH 4DV3Q 1TWHH 4A3EH 4JI2Q 4A3JG 3HOXH 2K4KA 1B7YB 2HQLA 1CKMA 1Q8KA 5C44H 4GLVB 1P8LA 2K5VA 3KF6B 3IRBA 4NXNL 3CCEA 4NXMQ 1W3SA 4PZ6A 4X64L 3I2ZA 4AQYL 3A5ZB 3G48A 1HNZQ 1MIUA 3EIVA 2CCZA 2UUCQ 4YCUA 4YY3L 4B3SQ 1SE8A 3U50C 5IWAQ 2N49A 4QL5A 4DV0Q 2Y0SG 4LF7Q 1OXVA 3EBEA 4X65Q 2YU9H 4JYAL 1VQEA 1J5EQ 1PHJA 1UEBA 1YI2A 4B3TQ 2OTJA 2UXBQ 1LYLA 1HNXQ 4HJ7A 5GAHC 1OXXK 3I4MH 1LTLA 3UE0A 4EX5A 1JB7A 3S1NH 3CAMA 4GS3A 2NVXH 3M4PA 3HKZE 3AQQA 4HIMA 1IZ6A 2DGYA 5J3BA 2WB1E 4KI0A 3KLWA 4LF8Q 4A3KH 1K3RA 4LFCL 2JEBI 3ZJYC 4A3DH 3GTOH 5IYBH 4JOIA 2F4VL 4RMFA 4UP7A 2JJQA 3S16H 2KCMA 4GLXA 1SRUA 2JK8A 3JC66 4A3BG 5IP7G 1Q1EA 3CXCA 4GKKQ 5GADC 1U5KA 1MKHA 3KDFA 1PH3A 1FVIA 3CPWA 2R6GA 2PNHA 4A3FG 1VQ4A 1HR0W 3GO5A 2E5LQ 3S1QH 4BBSH 4LF5L 2PMZE 5H1SE 4A4IA 4KHPL 3E9HA 1NJIC 5DLQE 1VQKA 3RR5A 4YCWA 1VQJA 1XMQQ 2B63G 1NMFA 1YNXA 3D31A 5IWAL 1C0AA 1EWIA 5IYCH 4YY3Q 3S2DH 5IYDH 4DR7L 3S14H 1X65A 2NVTH 4ME3A 3F2CA 4HIDA 1DGSA 1XMQL 4X62Q 4DUZQ 1Y1WH 2R92G 4P71A 3GTGH 3GTMH 5BR8L 1JT8A 1KQSA 3U58A 4BY1G 2E2HH 2UUBL 2A8VA 2GN5A 4DV7L 1EQQA 4IOAA 4JCVE 1FL0A 3AEVA 2IX0A 5ELNA 1M1KC 3KF6A 5IYDG 1PYBA 1SLJA 3PGZA 2MO0A 4JI7Q 3D0FA 3STBD 1T9HA 4JOIC 1PH4A 1HZCA 1KL9A 1O7IA 2HIVA 4LUVA 2MQHA 1A8VA 1XMOQ 3J7A5 1QUQA 2K52A 4JBKA 2PI2E 2BA0A 3TS0A 3H3VI 2HHHQ 3DLLA 4OO1G 1N36Q 2UUAL 4YCVA 4JI6Q 1FJGQ 1K0RA 1CKOA 1LUZA 1HNXL 4BXXG 2VNUD 4X6AH 3K8AA 4YHHQ 5AJ3Q 4DV7Q 2EXDA 1KD1C 1D8LA 4JI3L 2OCEA 2XTIA 3TS2A 3F2DA 1IBLQ 4DR4Q 3FKIH 4B3SL 4A93H 1Y1VG 3L2PA 4DV2Q 4C3JH 3SGIA 4B3RL 1YHAA 4PG3A 5EAYA 3BU2A 1V9PA 1IBLL 3U4VA 4NXML 4DV4Q 3TEHB 1D7QA 2ZM6L 4DV5Q 4JV5Q 2Z6KC 4LF5Q 1RL2A 3PUYA 1X3GA 4XIGS 3UDIA 2K75A 5LMNQ 3S24A 1JE5A 1VQCA 2E5LL 1JJCB 2GVAA 1N33Q 2UUAQ 1QZHA 1Y1VH 2NVYH 3GD7A 1WCMH 2I5LX 3K7AH 5LMUL 2BH2A 3KFUA 5IP9G 1QZGA 2VUMG 3PSIA 3AFPA 4DV6Q 2F4VQ 1FGUA 3H0GG 4LFCQ 1EQRA 1S40A 3S1RH 4LF6Q 3HOZH 1Q81C 1WI5A 1IL2A 1WJJA 2KHJA 1KRTA 1N8RC 1BKBA 4KHZA 4GNXC 3AFQA 3I4MG 4KLKA 1PH2A 2R7DA 3J80c 5LMUQ 1S72A 4APVA 3HOYH 5GQOA 3ULJA 3H0GH 2UXBL 2BA1A 2ZM6Q 5IE8A 3J7ZC 4DV5L 1KAWA 4GN3B 4PZ8A 2VUMH 4C2MH 3M85A 2LXJA 1OTCA 3CCSA 5M3FG 3A0JA 3BZKA 2ZTEA 4AYBG 3CCRA 1S3OA 1NMGA 4DKAC 3GTKH 2IHEA 2QEXA 3JAMi 4A3MG 2I5MX 2YV5A 3G4SA 3OW2A 2EQSA 2Q2IA 4P73A 2JA5G 5LMNW 1XPOA 2E2IH 2R7ZG 4JI5Q 4IFDJ 4P75A 4UP8A 1FJGL 4A3LG 3CQZH 2NN6G 4L5TA 4HJAA 2LSSA 2VQFL 1PH5A 1C7YA 3CMEA 3ER0A 4QQBX 1PYSB 3AYHB 1UE5A 4B3MQ 5GAEC 4HIOA 2KHIA 3PO3H 1Z9FA 2KENA 5C0XG 5JJIA 2JA5H 4JI1L 3HKZG 5FJ8H 4DV6L 1HZAA 4YWLA 1W2BA 2HIXA 1EOVA 4A3MH 1VQ9A 4JI7L 3RLOA 3M9BA 2VQFQ 1UE7A 1K73C 5IYBG 3BJUA 1CKNB 5GAGC 5M5YH 4DR1L 2NZHA 1K83H 3OYYA 2ZTDA 4L5RC 4LNQA 3M3YH 4B3TL 5LMNL 2ALYB 4BBRH 4LFBL 4GOPB 1E7ZA 1XPRA 4JYAQ 5BR8Q 1EYGA 4LF7L 4GN4B 4X62L 3DM3A 4DUZL 3HOWG 1L2FA 2VW9A 1ASZA 1SFOH 1XNRQ 4BBSG 2F52A 3PCOB 1HNZL 1N34L 1XNRL 1MJEA 3F8TA 3NELA 1TWCH 4IPGA 5C3EH 3HOZG 4R4CA 4P72A 1I3QH 4LFBQ 5M5XH 3I4NG 3NENA 1BBUA 2VL6A 3CD6A 4JI2L 4R4OA 3T1YL 3CW2C 2R92H 4JI6L 1QVFA 3A5UA 2R93G 2AHOB 3A74A 4A3FH 1K8GA 4DAMA 3E0EA 2DUDA 5JEAJ 5IP7H 4DK3C 2MO1A 1VQGA 4DR6Q 3PIPA 1XMOL 4GN5A 1EUJA 2H5XA 2RF4A 2YYZA 3KDFB 3NBHB 1M90C 1GM5A 4DR3L 3RZDH 4LF8L 4DUYL 3CPFA 1V1QA 1YHBA 4JI8Q 3RLFA 4C3IH 1WOCA 3RN5A 3L7ZC 2B3GA 4MZ9A 3RNUA 4BY7H 1GVPA 3TREA 2Q2TA 4L5SA 1CKNA 4ALPA 4DAYB 2WFWA 4IFDG 1KRSA 4A3DG 4JV5L 3FHWA 4IJHA 3F2BA 3W1BA 5HGQA 4DV0L 4C3HH 4BXXH 4LFAL 2QGQA 4A3GG 1VQPA 4R4TA 2RHSB 1VQ6A 4PMWA 1I94Q 3LGJA 3K80C 2Z0SA 5C0XI 4K0KQ 1G291 2OQ0A 4L5QA 4AQYQ 1IBKQ 1Q46A 3CC7A 4YWKA 5M5WH 1X54A 4WJ3M 2WP8J 3I7FA 4R4IA 2JA7H 3M7NA 5C4XG 1E22A 3PUZA 1YBYA 4P74A 1U0LA 1YITA 4GKKL 3GDEA 3G6EA 4X66L 4NB3A 2JA8G 1QVCA 4AYBE 1VQLA 4GNXB 4UY8C 1YJ9A 4BBRG 4A3GH 3UDXA 1PH7A 4OWTB 4POGA 3F1ZA 4LF4L 1A63A 1YEZA 4A3CH 5C0XJ 1SR3A 5K36G 4BA2I 1GO3E 4BY7G 4TQUS 4J15A 3CC4A 2NN6I 1N33L 2NZOA 2A1AA 4A93G 2UU9Q 2VQEL 4B3ML 1H95A 2ID0A 4A3LH 4DR5L 2VS1A 3JAMc 1JJGA 4Y52H 3KJPA 4FDBA 2IX1A 5JJLA 2UU9L 1XNQQ 3RN2A 3CCQA 1GD7A 1VQIA 2E8GA 4JI4L 1XPUA 2N78A 5JJKA 4IO9A 1QVGA 3S1MH 4A3IG 2AWNA 3I4OA 1K9MC 1IBML 4DR4L 1OXSC 2UXCQ 3PV0A 4A3BH 4A3CG 2N8NA 4JBWA 4LUZA 4LW1A 2E2JH 2JA6G 3HOWH 4JI3Q 1P16A 3GTQH 4HJ8A 3WWVA 1MJCA 2JA7G 4KHPQ 3UDGA 2UXDQ 4R4QA 4YHHL 4IJLA 3J81c 1EIFA 2CFMA 3J80i 1B8AA 4DV3L 2JA8H 2CKZB 1R9TH 2IT1A 1PH1A 3HOVH 3TRZA 4GKJQ 3CCMA 4OX9Q 4IFDI 4QIWE 3EN2A 3KJOA 2C35B 1TWAH 2K14A 2Z6KA 1AE3A 2Y0SE 3MXNB 3J81j 4JBMA 2UXDL 1YHQA 3OTOL 1EIYB 1X3FA 3S2HH 4A3EG 4JBJA 1WCMG 3RLNA 2QA4A 3CC2A 5IP9H 4HJ9A 3K0XA 1KIXA 3CP0A 1V43A 1L0WA 2YTYA 1A62A 1VQDA 2K5HA 2B29A 4X65L 2JA9A 5C44G 1VCIA 2WB1G 1SN8A 3UDFA 3KF8B 1Y1WG 1VQ5A 4OXPA 1PA6A 1Q12A 2K50A 3CCUA 1QUQB 3I55A 4JG2A 5IT9c 2UUCL 2MFIA 2XGTA 4O0AA 2VZAA 4O2DA 4DR7Q 4DV1L 2JEAI 4LUOA 3MEFA 5E7NA 4JI8L 3GTLH 3FKIG 1KC8C 1PH8A 1J6QA 4LF4Q 4NXNQ 2JA6H 3E9IA 3T1HL 1YIJA 2PQAA 3W5OA 1Q82C 3PO3G 1BVSA 3HOUG 1N9WA 4PZ7A 1JJ2A 2IY5B 5IYCG 1TWGH 1Q86C 3KYHC 1HZ9A 2B63H 1E24A 2WAQG 1E1OA 4LWCA 3T1YQ 4OWXB 4DPGA 1AE2A 3T1HQ 2YTVA 4HJ5A 3M4OH 1C9OA 1X56A 2AMCB 2CWAA 5FLMG 5C4JH 3CCJA 4LF9Q 1L1OC 3PF4A 3HKSA 1YJWA 1IBMQ 4POFA 1NBWA 2KCTA 1N34Q 1YVCA 1E1TA 4GLAC 1NTGA 2MNAA 3PO2H 5C4XH 2CQOA 3U4ZA 3I4NH 4JC0A 3ULLA 1J5EL 2I0QA 5FLMH 1I50H 2RCNA 3HOYG 1NE3A 2VQEQ 3PUWA 4DR1Q 3K81C 2I5HA 4H02A 3VDYA 1LM0A 4A3JH 2OTLA 1CSPA 4AH6A 5HY6A 1SMXA 1L1OB 2JE6I 2GVBA 1VQMA 1KXLA 4X64Q 1A0IA 3B6YA 4YWMA 1HZBA 3PUXA 4QGUA 3CMAA 2NVQH 2D0PA 2WAQE 1K8AC 3PO2G 2ZJQA 4OX9L 4GOPC 3GTPH 1YZ6A 1VQBA 3ICEA 3NEMA 4GNXA 1GKHA 4IPDA 4QJFA 1NY4A 4JI5L 5FJ8G 1N32L 1L1OA 4DR2L 4DNIA 4IPHA 2KBNA 4NPSA 2FXQA 1XTDA 5GROA 4A76A 4A3IH 1G6PA 1VQFA 1Y14B 1G51A 2L15A 2F3IA 4DK6C 1B70B 3HOVG 2UXCL 1PVOA 1UE1A 2VY3A 2ASBA 1WFQA 4DV1Q 2R93H 4JI4Q 1I94L 1UE6A 2ZTCA 1OXTA 4TVAB 5M3FH 1XNQL 1X55A 4XTCS 1KHIA 4IPCA 1RIPA 4IOCA 4RG1A 4UPAA 1PH6A 4EQ5A 1VQ8A 4WJ4A 5M3MH 1PV4A 1VQHA 3H3VH 3UE1A 1E3PA 4BA1I 1WYDA 4A75A 3HFZB 1AH9A 1X3EA 2UUBQ 2ATWA 2PI2A 2R7FA 2OQKA 4OWWB 1VQ7A 1HNWL 3KOJA 4DUYQ 2CWPA 4LF9L 2JQOA 3K7UC 4JI0L 4QY7A 2RHQB 5IY0A 3TQYA 3CF5A 3L0OA 1N32Q 1PH9A 4Y7NH 3GTJH 3BZCA 1CUKA 1HR0Q 3S17H 2PQAB 4X66Q 5ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOP A;  1VQA A;  2OWO A;  1HR0 L;  1YJN A;  1JMC A;  5M3M G;  3I56 A;  3STB C;  4JI0 Q;  2AKW B;  3HOU H;  1SRO A;  2A19 A;  3HOX G;  1IXR A;  2LXK A;  4BY1 H;  1XJV A;  2YTX A;  2ZJR A;  4DV4 L;  5C3E G;  1HNW Q;  1IBK L;  1CSQ A;  1X6O A;  2V1C C;  1VS0 A;  1Z47 A;  3FP9 A;  3ERS X;  3M4Q A;  4OON A;  4K0K L;  2BH8 A;  1ASY A;  2N3S A;  4B3R Q;  4HIK A;  3G71 A;  4DV2 L;  3Q8D A;  4AIM A;  2Q2U A;  1VQN A;  3S15 H;  4LFA Q;  1Q1B A;  3ULP A;  4UP9 A;  3J81 i;  4DR5 Q;  3W1G A;  1X9N A;  5AJ3 L;  3CCV A;  1HH2 P;  1VQO A;  1EFW A;  2D62 A;  1BBW A;  3PIO A;  2EIF A;  4MTN A;  4OO1 I;  2AWO A;  5FLX c;  1N36 L;  2D0O A;  1I6H H;  1TXY A;  3PUV A;  3PF5 A;  2HHH L;  2IHF A;  2Q2H A;  3H15 A;  1Q7Y C;  3CCL A;  3OTO Q;  1PFS A;  4A3K G;  2R7Z H;  4R1J A;  4DR3 Q;  4JI1 Q;  4LF6 L;  5JEA G;  4DR2 Q;  1TWF H;  4DR6 L;  1UWV A;  1HJP A;  4MNO A;  1IYJ B;  2K5N A;  1I5F A;  2ZJP A;  2ES2 A;  4GKJ L;  2HT1 A;  1OXU A;  3RZO H;  4DV3 Q;  1TWH H;  4A3E H;  4JI2 Q;  4A3J G;  3HOX H;  2K4K A;  1B7Y B;  2HQL A;  1CKM A;  1Q8K A;  5C44 H;  4GLV B;  1P8L A;  2K5V A;  3KF6 B;  3IRB A;  4NXN L;  3CCE A;  4NXM Q;  1W3S A;  4PZ6 A;  4X64 L;  3I2Z A;  4AQY L;  3A5Z B;  3G48 A;  1HNZ Q;  1MIU A;  3EIV A;  2CCZ A;  2UUC Q;  4YCU A;  4YY3 L;  4B3S Q;  1SE8 A;  3U50 C;  5IWA Q;  2N49 A;  4QL5 A;  4DV0 Q;  2Y0S G;  4LF7 Q;  1OXV A;  3EBE A;  4X65 Q;  2YU9 H;  4JYA L;  1VQE A;  1J5E Q;  1PHJ A;  1UEB A;  1YI2 A;  4B3T Q;  2OTJ A;  2UXB Q;  1LYL A;  1HNX Q;  4HJ7 A;  5GAH C;  1OXX K;  3I4M H;  1LTL A;  3UE0 A;  4EX5 A;  1JB7 A;  3S1N H;  3CAM A;  4GS3 A;  2NVX H;  3M4P A;  3HKZ E;  3AQQ A;  4HIM A;  1IZ6 A;  2DGY A;  5J3B A;  2WB1 E;  4KI0 A;  3KLW A;  4LF8 Q;  4A3K H;  1K3R A;  4LFC L;  2JEB I;  3ZJY C;  4A3D H;  3GTO H;  5IYB H;  4JOI A;  2F4V L;  4RMF A;  4UP7 A;  2JJQ A;  3S16 H;  2KCM A;  4GLX A;  1SRU A;  2JK8 A;  3JC6 6;  4A3B G;  5IP7 G;  1Q1E A;  3CXC A;  4GKK Q;  5GAD C;  1U5K A;  1MKH A;  3KDF A;  1PH3 A;  1FVI A;  3CPW A;  2R6G A;  2PNH A;  4A3F G;  1VQ4 A;  1HR0 W;  3GO5 A;  2E5L Q;  3S1Q H;  4BBS H;  4LF5 L;  2PMZ E;  5H1S E;  4A4I A;  4KHP L;  3E9H A;  1NJI C;  5DLQ E;  1VQK A;  3RR5 A;  4YCW A;  1VQJ A;  1XMQ Q;  2B63 G;  1NMF A;  1YNX A;  3D31 A;  5IWA L;  1C0A A;  1EWI A;  5IYC H;  4YY3 Q;  3S2D H;  5IYD H;  4DR7 L;  3S14 H;  1X65 A;  2NVT H;  4ME3 A;  3F2C A;  4HID A;  1DGS A;  1XMQ L;  4X62 Q;  4DUZ Q;  1Y1W H;  2R92 G;  4P71 A;  3GTG H;  3GTM H;  5BR8 L;  1JT8 A;  1KQS A;  3U58 A;  4BY1 G;  2E2H H;  2UUB L;  2A8V A;  2GN5 A;  4DV7 L;  1EQQ A;  4IOA A;  4JCV E;  1FL0 A;  3AEV A;  2IX0 A;  5ELN A;  1M1K C;  3KF6 A;  5IYD G;  1PYB A;  1SLJ A;  3PGZ A;  2MO0 A;  4JI7 Q;  3D0F A;  3STB D;  1T9H A;  4JOI C;  1PH4 A;  1HZC A;  1KL9 A;  1O7I A;  2HIV A;  4LUV A;  2MQH A;  1A8V A;  1XMO Q;  3J7A 5;  1QUQ A;  2K52 A;  4JBK A;  2PI2 E;  2BA0 A;  3TS0 A;  3H3V I;  2HHH Q;  3DLL A;  4OO1 G;  1N36 Q;  2UUA L;  4YCV A;  4JI6 Q;  1FJG Q;  1K0R A;  1CKO A;  1LUZ A;  1HNX L;  4BXX G;  2VNU D;  4X6A H;  3K8A A;  4YHH Q;  5AJ3 Q;  4DV7 Q;  2EXD A;  1KD1 C;  1D8L A;  4JI3 L;  2OCE A;  2XTI A;  3TS2 A;  3F2D A;  1IBL Q;  4DR4 Q;  3FKI H;  4B3S L;  4A93 H;  1Y1V G;  3L2P A;  4DV2 Q;  4C3J H;  3SGI A;  4B3R L;  1YHA A;  4PG3 A;  5EAY A;  3BU2 A;  1V9P A;  1IBL L;  3U4V A;  4NXM L;  4DV4 Q;  3TEH B;  1D7Q A;  2ZM6 L;  4DV5 Q;  4JV5 Q;  2Z6K C;  4LF5 Q;  1RL2 A;  3PUY A;  1X3G A;  4XIG S;  3UDI A;  2K75 A;  5LMN Q;  3S24 A;  1JE5 A;  1VQC A;  2E5L L;  1JJC B;  2GVA A;  1N33 Q;  2UUA Q;  1QZH A;  1Y1V H;  2NVY H;  3GD7 A;  1WCM H;  2I5L X;  3K7A H;  5LMU L;  2BH2 A;  3KFU A;  5IP9 G;  1QZG A;  2VUM G;  3PSI A;  3AFP A;  4DV6 Q;  2F4V Q;  1FGU A;  3H0G G;  4LFC Q;  1EQR A;  1S40 A;  3S1R H;  4LF6 Q;  3HOZ H;  1Q81 C;  1WI5 A;  1IL2 A;  1WJJ A;  2KHJ A;  1KRT A;  1N8R C;  1BKB A;  4KHZ A;  4GNX C;  3AFQ A;  3I4M G;  4KLK A;  1PH2 A;  2R7D A;  3J80 c;  5LMU Q;  1S72 A;  4APV A;  3HOY H;  5GQO A;  3ULJ A;  3H0G H;  2UXB L;  2BA1 A;  2ZM6 Q;  5IE8 A;  3J7Z C;  4DV5 L;  1KAW A;  4GN3 B;  4PZ8 A;  2VUM H;  4C2M H;  3M85 A;  2LXJ A;  1OTC A;  3CCS A;  5M3F G;  3A0J A;  3BZK A;  2ZTE A;  4AYB G;  3CCR A;  1S3O A;  1NMG A;  4DKA C;  3GTK H;  2IHE A;  2QEX A;  3JAM i;  4A3M G;  2I5M X;  2YV5 A;  3G4S A;  3OW2 A;  2EQS A;  2Q2I A;  4P73 A;  2JA5 G;  5LMN W;  1XPO A;  2E2I H;  2R7Z G;  4JI5 Q;  4IFD J;  4P75 A;  4UP8 A;  1FJG L;  4A3L G;  3CQZ H;  2NN6 G;  4L5T A;  4HJA A;  2LSS A;  2VQF L;  1PH5 A;  1C7Y A;  3CME A;  3ER0 A;  4QQB X;  1PYS B;  3AYH B;  1UE5 A;  4B3M Q;  5GAE C;  4HIO A;  2KHI A;  3PO3 H;  1Z9F A;  2KEN A;  5C0X G;  5JJI A;  2JA5 H;  4JI1 L;  3HKZ G;  5FJ8 H;  4DV6 L;  1HZA A;  4YWL A;  1W2B A;  2HIX A;  1EOV A;  4A3M H;  1VQ9 A;  4JI7 L;  3RLO A;  3M9B A;  2VQF Q;  1UE7 A;  1K73 C;  5IYB G;  3BJU A;  1CKN B;  5GAG C;  5M5Y H;  4DR1 L;  2NZH A;  1K83 H;  3OYY A;  2ZTD A;  4L5R C;  4LNQ A;  3M3Y H;  4B3T L;  5LMN L;  2ALY B;  4BBR H;  4LFB L;  4GOP B;  1E7Z A;  1XPR A;  4JYA Q;  5BR8 Q;  1EYG A;  4LF7 L;  4GN4 B;  4X62 L;  3DM3 A;  4DUZ L;  3HOW G;  1L2F A;  2VW9 A;  1ASZ A;  1SFO H;  1XNR Q;  4BBS G;  2F52 A;  3PCO B;  1HNZ L;  1N34 L;  1XNR L;  1MJE A;  3F8T A;  3NEL A;  1TWC H;  4IPG A;  5C3E H;  3HOZ G;  4R4C A;  4P72 A;  1I3Q H;  4LFB Q;  5M5X H;  3I4N G;  3NEN A;  1BBU A;  2VL6 A;  3CD6 A;  4JI2 L;  4R4O A;  3T1Y L;  3CW2 C;  2R92 H;  4JI6 L;  1QVF A;  3A5U A;  2R93 G;  2AHO B;  3A74 A;  4A3F H;  1K8G A;  4DAM A;  3E0E A;  2DUD A;  5JEA J;  5IP7 H;  4DK3 C;  2MO1 A;  1VQG A;  4DR6 Q;  3PIP A;  1XMO L;  4GN5 A;  1EUJ A;  2H5X A;  2RF4 A;  2YYZ A;  3KDF B;  3NBH B;  1M90 C;  1GM5 A;  4DR3 L;  3RZD H;  4LF8 L;  4DUY L;  3CPF A;  1V1Q A;  1YHB A;  4JI8 Q;  3RLF A;  4C3I H;  1WOC A;  3RN5 A;  3L7Z C;  2B3G A;  4MZ9 A;  3RNU A;  4BY7 H;  1GVP A;  3TRE A;  2Q2T A;  4L5S A;  1CKN A;  4ALP A;  4DAY B;  2WFW A;  4IFD G;  1KRS A;  4A3D G;  4JV5 L;  3FHW A;  4IJH A;  3F2B A;  3W1B A;  5HGQ A;  4DV0 L;  4C3H H;  4BXX H;  4LFA L;  2QGQ A;  4A3G G;  1VQP A;  4R4T A;  2RHS B;  1VQ6 A;  4PMW A;  1I94 Q;  3LGJ A;  3K80 C;  2Z0S A;  5C0X I;  4K0K Q;  1G29 1;  2OQ0 A;  4L5Q A;  4AQY Q;  1IBK Q;  1Q46 A;  3CC7 A;  4YWK A;  5M5W H;  1X54 A;  4WJ3 M;  2WP8 J;  3I7F A;  4R4I A;  2JA7 H;  3M7N A;  5C4X G;  1E22 A;  3PUZ A;  1YBY A;  4P74 A;  1U0L A;  1YIT A;  4GKK L;  3GDE A;  3G6E A;  4X66 L;  4NB3 A;  2JA8 G;  1QVC A;  4AYB E;  1VQL A;  4GNX B;  4UY8 C;  1YJ9 A;  4BBR G;  4A3G H;  3UDX A;  1PH7 A;  4OWT B;  4POG A;  3F1Z A;  4LF4 L;  1A63 A;  1YEZ A;  4A3C H;  5C0X J;  1SR3 A;  5K36 G;  4BA2 I;  1GO3 E;  4BY7 G;  4TQU S;  4J15 A;  3CC4 A;  2NN6 I;  1N33 L;  2NZO A;  2A1A A;  4A93 G;  2UU9 Q;  2VQE L;  4B3M L;  1H95 A;  2ID0 A;  4A3L H;  4DR5 L;  2VS1 A;  3JAM c;  1JJG A;  4Y52 H;  3KJP A;  4FDB A;  2IX1 A;  5JJL A;  2UU9 L;  1XNQ Q;  3RN2 A;  3CCQ A;  1GD7 A;  1VQI A;  2E8G A;  4JI4 L;  1XPU A;  2N78 A;  5JJK A;  4IO9 A;  1QVG A;  3S1M H;  4A3I G;  2AWN A;  3I4O A;  1K9M C;  1IBM L;  4DR4 L;  1OXS C;  2UXC Q;  3PV0 A;  4A3B H;  4A3C G;  2N8N A;  4JBW A;  4LUZ A;  4LW1 A;  2E2J H;  2JA6 G;  3HOW H;  4JI3 Q;  1P16 A;  3GTQ H;  4HJ8 A;  3WWV A;  1MJC A;  2JA7 G;  4KHP Q;  3UDG A;  2UXD Q;  4R4Q A;  4YHH L;  4IJL A;  3J81 c;  1EIF A;  2CFM A;  3J80 i;  1B8A A;  4DV3 L;  2JA8 H;  2CKZ B;  1R9T H;  2IT1 A;  1PH1 A;  3HOV H;  3TRZ A;  4GKJ Q;  3CCM A;  4OX9 Q;  4IFD I;  4QIW E;  3EN2 A;  3KJO A;  2C35 B;  1TWA H;  2K14 A;  2Z6K A;  1AE3 A;  2Y0S E;  3MXN B;  3J81 j;  4JBM A;  2UXD L;  1YHQ A;  3OTO L;  1EIY B;  1X3F A;  3S2H H;  4A3E G;  4JBJ A;  1WCM G;  3RLN A;  2QA4 A;  3CC2 A;  5IP9 H;  4HJ9 A;  3K0X A;  1KIX A;  3CP0 A;  1V43 A;  1L0W A;  2YTY A;  1A62 A;  1VQD A;  2K5H A;  2B29 A;  4X65 L;  2JA9 A;  5C44 G;  1VCI A;  2WB1 G;  1SN8 A;  3UDF A;  3KF8 B;  1Y1W G;  1VQ5 A;  4OXP A;  1PA6 A;  1Q12 A;  2K50 A;  3CCU A;  1QUQ B;  3I55 A;  4JG2 A;  5IT9 c;  2UUC L;  2MFI A;  2XGT A;  4O0A A;  2VZA A;  4O2D A;  4DR7 Q;  4DV1 L;  2JEA I;  4LUO A;  3MEF A;  5E7N A;  4JI8 L;  3GTL H;  3FKI G;  1KC8 C;  1PH8 A;  1J6Q A;  4LF4 Q;  4NXN Q;  2JA6 H;  3E9I A;  3T1H L;  1YIJ A;  2PQA A;  3W5O A;  1Q82 C;  3PO3 G;  1BVS A;  3HOU G;  1N9W A;  4PZ7 A;  1JJ2 A;  2IY5 B;  5IYC G;  1TWG H;  1Q86 C;  3KYH C;  1HZ9 A;  2B63 H;  1E24 A;  2WAQ G;  1E1O A;  4LWC A;  3T1Y Q;  4OWX B;  4DPG A;  1AE2 A;  3T1H Q;  2YTV A;  4HJ5 A;  3M4O H;  1C9O A;  1X56 A;  2AMC B;  2CWA A;  5FLM G;  5C4J H;  3CCJ A;  4LF9 Q;  1L1O C;  3PF4 A;  3HKS A;  1YJW A;  1IBM Q;  4POF A;  1NBW A;  2KCT A;  1N34 Q;  1YVC A;  1E1T A;  4GLA C;  1NTG A;  2MNA A;  3PO2 H;  5C4X H;  2CQO A;  3U4Z A;  3I4N H;  4JC0 A;  3ULL A;  1J5E L;  2I0Q A;  5FLM H;  1I50 H;  2RCN A;  3HOY G;  1NE3 A;  2VQE Q;  3PUW A;  4DR1 Q;  3K81 C;  2I5H A;  4H02 A;  3VDY A;  1LM0 A;  4A3J H;  2OTL A;  1CSP A;  4AH6 A;  5HY6 A;  1SMX A;  1L1O B;  2JE6 I;  2GVB A;  1VQM A;  1KXL A;  4X64 Q;  1A0I A;  3B6Y A;  4YWM A;  1HZB A;  3PUX A;  4QGU A;  3CMA A;  2NVQ H;  2D0P A;  2WAQ E;  1K8A C;  3PO2 G;  2ZJQ A;  4OX9 L;  4GOP C;  3GTP H;  1YZ6 A;  1VQB A;  3ICE A;  3NEM A;  4GNX A;  1GKH A;  4IPD A;  4QJF A;  1NY4 A;  4JI5 L;  5FJ8 G;  1N32 L;  1L1O A;  4DR2 L;  4DNI A;  4IPH A;  2KBN A;  4NPS A;  2FXQ A;  1XTD A;  5GRO A;  4A76 A;  4A3I H;  1G6P A;  1VQF A;  1Y14 B;  1G51 A;  2L15 A;  2F3I A;  4DK6 C;  1B70 B;  3HOV G;  2UXC L;  1PVO A;  1UE1 A;  2VY3 A;  2ASB A;  1WFQ A;  4DV1 Q;  2R93 H;  4JI4 Q;  1I94 L;  1UE6 A;  2ZTC A;  1OXT A;  4TVA B;  5M3F H;  1XNQ L;  1X55 A;  4XTC S;  1KHI A;  4IPC A;  1RIP A;  4IOC A;  4RG1 A;  4UPA A;  1PH6 A;  4EQ5 A;  1VQ8 A;  4WJ4 A;  5M3M H;  1PV4 A;  1VQH A;  3H3V H;  3UE1 A;  1E3P A;  4BA1 I;  1WYD A;  4A75 A;  3HFZ B;  1AH9 A;  1X3E A;  2UUB Q;  2ATW A;  2PI2 A;  2R7F A;  2OQK A;  4OWW B;  1VQ7 A;  1HNW L;  3KOJ A;  4DUY Q;  2CWP A;  4LF9 L;  2JQO A;  3K7U C;  4JI0 L;  4QY7 A;  2RHQ B;  5IY0 A;  3TQY A;  3CF5 A;  3L0O A;  1N32 Q;  1PH9 A;  4Y7N H;  3GTJ H;  3BZC A;  1CUK A;  1HR0 Q;  3S17 H;  2PQA B;  4X66 Q;  5ELO A; 
#chains in the Genus database with same CATH topology
 4K8J A;  4M8A A;  1JMC A;  1H9S A;  3KLS A;  5CMD A;  3HOX G;  1IXR A;  4DV4 L;  1HNW Q;  1CSQ A;  1ET9 A;  1X6O A;  1SE3 A;  3P1H A;  1FNW A;  3Q8D A;  4AIM A;  4IQZ A;  1H9S B;  2B8G A;  1AFP A;  1B53 A;  3ULP A;  4UP9 A;  3BVZ A;  4DR5 Q;  1VQO A;  2D62 A;  1BBW A;  4MTN A;  5FLX c;  3ERO A;  4RH6 A;  3PUV A;  2HHH L;  3S1Q B;  2A74 C;  5FOB B;  2F0G A;  1ILP A;  3VR6 A;  3OTO Q;  1PFS A;  4DR3 Q;  2IPK D;  2F1M A;  2QKI C;  3GTK B;  2BE5 D;  4RHR A;  1UWV A;  2MPM A;  2ES2 A;  4GKJ L;  2HT1 A;  3MFY A;  1TWH H;  4A3E H;  2Z8L A;  2Q8I B;  3I3C A;  1Q8K A;  1P8L A;  3KF6 B;  1LT6 D;  3Q24 A;  1J9O A;  4BY1 B;  3GP7 A;  1EY5 A;  4MHE A;  4X64 L;  2JYO A;  2EZV A;  3RZO B;  3G48 A;  2EJF C;  5DM7 3;  1HNZ Q;  3EIV A;  5KGU A;  4YCU A;  1XX8 A;  2NTT A;  2QCP X;  1GUG A;  1LTA D;  4QL5 A;  4K5V A;  3HOW B;  3EBE A;  4JYA L;  1VQE A;  2UXB Q;  2OTJ A;  4NKL A;  2L55 A;  3FDT A;  1RCV D;  3JAM L;  2F0H A;  1R4P B;  3UE0 A;  1WTW A;  5T1G A;  3AU7 A;  1IZ6 A;  2WIN B;  1K3R A;  1ROD A;  4RMF A;  1IL8 A;  3QB3 A;  2KCM A;  4A3B G;  1EZ8 A;  5IP7 G;  3CXC A;  1U5K A;  4A3F G;  2E5L Q;  2PNH A;  1HR0 W;  3VR4 A;  3VYS A;  4LF5 L;  2JP1 A;  3NWS A;  5H1S E;  1NJI C;  3A7A B;  2SNM A;  3S2D H;  1RTN A;  4ME3 A;  3F2C A;  4I7Z C;  4DAY A;  1DGS A;  1WD0 A;  3GTG H;  1Y69 U;  3U58 A;  5FO7 B;  4BY1 G;  2UUB L;  2A8V A;  2GN5 A;  4DV7 L;  4XT3 B;  4IOA A;  4JCV E;  3LX0 A;  2IX0 A;  1M1K C;  3KF6 A;  2WKD A;  3MXN A;  1SLJ A;  3D0F A;  2KJX A;  4KY6 A;  2KED A;  5CGK A;  2EYP A;  1PH4 A;  5TSS A;  1XMO Q;  3V05 A;  3M3Y B;  5M3F B;  4YCV A;  1CKO A;  1HNX L;  4X6A H;  3K8A A;  3IFD A;  4A3M B;  3BYT B;  5JEA H;  4JI3 L;  1UUP A;  3OPO A;  1IBL Q;  3DHQ A;  3IAY A;  1DZ1 A;  4DV2 Q;  4C3J H;  4KK7 A;  3SGI A;  4B3R L;  4PG3 A;  1YNN C;  2L0C A;  1A3U A;  2K33 A;  1D7Q A;  1QJO A;  1CA6 A;  4JV5 Q;  1RL2 A;  2A69 C;  3VYU A;  1VQC A;  3BVG A;  1JJC B;  1EQT A;  2BH2 A;  1MSH A;  4HSV A;  3A56 A;  1FGU A;  3H0G G;  2R92 B;  1EQR A;  4LF6 Q;  2D9U A;  1Q8I A;  1N8R C;  1G2S A;  1BKB A;  5COY A;  1HUN A;  3AFQ A;  3I4M G;  3ND9 A;  3WOE A;  1PH2 A;  3TP5 A;  2K5Q A;  1KAB A;  3H0G H;  1I6V C;  2IX3 A;  3Q6S A;  4GN3 B;  5FO9 B;  4CKC A;  1S5E D;  2VUM H;  5CR3 A;  1HA6 A;  1SNO A;  1S3O A;  4DKA C;  3I8Z A;  3QIA A;  2B2Y C;  2QEX A;  3G4S A;  1NUC A;  3DWQ A;  2ICE C;  1XPO A;  1E0B A;  1WTP A;  5G3L D;  1FJG L;  4A3L G;  4L5T A;  3GTL B;  2CH4 A;  4RCN A;  4QQB X;  4OEM B;  1PYS B;  3AYH B;  5EKK A;  2KHI A;  3PO3 H;  1Z9F A;  1I3Q B;  4JPB W;  3T16 A;  1UE7 A;  4A3F B;  1CKN B;  4DR1 L;  2NZH A;  3OYY A;  3M3Y H;  3MEH A;  2G9D A;  2FFK B;  4LFB L;  4GOP B;  2DJG C;  1TT2 A;  2ENB A;  4LF7 L;  1HFG A;  1OO9 B;  3DM3 A;  3P7J A;  3HOW G;  1SYG A;  3DEP A;  2VW9 A;  1XNR Q;  3PCO B;  2X69 A;  1TU2 B;  1TWC H;  4IPG A;  3J7A F;  4K2K A;  1B9M A;  1SNC A;  4ZYS A;  3MA2 B;  1I3Q H;  4LFB Q;  3I4N G;  4RGM A;  4JI2 L;  2KEE A;  4R4O A;  4QIW B;  2FJ2 A;  2RDH A;  1F9R A;  1TWG B;  1E2W A;  2KQ3 A;  4WJW A;  5IGG A;  2AHO B;  3A74 A;  4PMB A;  3E0E A;  3S2D B;  1VQG A;  4GN5 A;  1MD2 D;  2H5X A;  2R7Z B;  4ABN A;  1W6K A;  4DUY L;  4BY7 B;  4L6T B;  3DXJ C;  1TS4 A;  2C5C A;  2B3G A;  2Z1C A;  4BY7 H;  4UAI A;  2OXP A;  1LT5 D;  4IFD G;  3T53 B;  4JV5 L;  3FHW A;  4XYO A;  2HDM A;  5HUR A;  3W1B A;  3J81 L;  5HGQ A;  3HKZ B;  4DV0 L;  1X3Q A;  1JIC A;  5J39 A;  4LFA L;  1SXT A;  4R4T A;  3QOL A;  1I94 Q;  1UEA B;  4FXK C;  3KBX A;  2Z0S A;  1PTO F;  2NBF A;  4L5Q A;  1S5B D;  1K83 B;  1S5C D;  2CHB D;  4P74 A;  1YIT A;  4A3E B;  1CK1 A;  1BR9 A;  4X66 L;  4NB3 A;  1BCP D;  2N88 A;  1R4Q B;  1CFM A;  1YJ9 A;  3UDX A;  4OWT B;  1GUW A;  4POG A;  3F1Z A;  2BE5 C;  2PO4 A;  3NQI A;  1CA5 A;  2F0O A;  2SDF A;  3D4D A;  3S16 B;  3BYY B;  2PZW A;  4FF4 A;  1N33 L;  1Y1V B;  5KIX A;  1BBX C;  3DWA A;  5M9O A;  2E2I B;  3VR5 A;  2IX1 A;  1GD7 A;  1H9J A;  3TME A;  2CVR A;  3ONA B;  2NVQ B;  2AWN A;  3I4O A;  4LW1 A;  1P16 A;  2UXD Q;  1QB5 D;  4DV3 L;  1BCP B;  5C4Z A;  1PH1 A;  3S2H B;  2L9H A;  2B2W C;  4GZY C;  4ZCK A;  3EN2 A;  1GUT A;  3CRL C;  3KJO A;  2K14 A;  4JBM A;  2UXD L;  1ENA A;  3MXN B;  3D6W A;  4C1N I;  1YHQ A;  1TWH B;  1X3F A;  3HP3 A;  2KHS A;  2EY1 A;  4I7A A;  4A3E G;  1RKN A;  1WCM G;  5D14 A;  3UI2 A;  4ZKC B;  4HJ9 A;  3CP0 A;  5C4H A;  3KBG A;  1A62 A;  3SK6 A;  5D65 A;  1SE2 A;  1Y1W G;  2WB1 G;  3KF8 B;  1PA6 A;  3K5L A;  3TSS A;  1DYQ A;  2XWB B;  3MHB A;  3I55 A;  2MFI A;  2XGT A;  1TII D;  4O2D A;  3FKI G;  4RGT A;  1J6Q A;  4NXN Q;  3U9S A;  3RMH A;  2RKS A;  1N9W A;  4PZ7 A;  4X3K A;  1JJ2 A;  1PFM A;  2PYK A;  1FNV A;  3PMF A;  1DD2 A;  2PPB C;  1E1O A;  3R93 A;  1AE2 A;  3T1H Q;  1ICF B;  1STH A;  1C9O A;  1X56 A;  4LF9 Q;  2E2D C;  3S9W A;  3PF4 A;  4RWS C;  5C5M A;  5D3I B;  1IBM Q;  3KUP A;  4ZK9 B;  1HTP A;  1TWC B;  3HG9 A;  4A3J B;  4HN7 A;  1EFI D;  1NTG A;  3ND8 A;  1YNJ D;  5C4X H;  4N8X 1;  1DCZ A;  2HCC A;  2RCN A;  3HOY G;  4DR1 Q;  1XYI A;  2OTL A;  4AH6 A;  2Q8R E;  5HY6 A;  5CV9 A;  4OIJ A;  4U68 A;  1TS5 A;  1ZEQ X;  2O5I C;  4X64 Q;  3S14 B;  3NTK A;  5AFW A;  2NVQ H;  4ID6 A;  3PO2 G;  5EQ0 A;  1BCP F;  3Q0A A;  1VQB A;  5J22 A;  3NEM A;  4GNX A;  2AQ3 B;  4IPD A;  1ZKO A;  5FJ8 G;  1CI3 M;  1N32 L;  4B9X A;  2XN9 C;  2DNC A;  2FXQ A;  1XTD A;  1BCP C;  1EYD A;  1G6P A;  3EQL C;  2R93 H;  4JW0 A;  4PQX A;  2EYJ A;  4C3H G;  4DXG A;  4EQP A;  1HTL D;  3NSW A;  4H0L C;  4IOC A;  4UPA A;  2EYF A;  2OF1 A;  2CQA A;  2EVB A;  3V96 A;  3L3O C;  2NUC A;  3HFZ B;  4Y7N B;  3PQI A;  2EYH A;  1AP0 A;  1EY7 A;  4LF9 L;  3NE5 B;  1C4Q A;  2JQO A;  2L4N A;  4QY7 A;  4DK1 A;  5IY0 A;  3L0O A;  3GTJ H;  1HR0 Q;  5CV7 A;  4X66 Q;  1VQA A;  1XTC D;  1WCM B;  5M3M G;  1U4R A;  4J8Q A;  2HDL A;  1WTQ A;  3I56 A;  1SRO A;  2A19 A;  4BY1 H;  1XJV A;  1NSN S;  5C3E G;  3KF8 A;  2V1C C;  3WDN A;  3M4Q A;  4OON A;  4K0K L;  4C3J B;  1JWM D;  5KYI A;  4B3R Q;  1EY8 A;  3VA7 A;  4L8J A;  2NN6 H;  1Q1B A;  5I6W A;  1A3T A;  2EIF A;  1AW7 A;  1HCZ A;  2AWO A;  2F0W A;  1N36 L;  3PF5 A;  2K03 A;  3BDC A;  3CCL A;  4JI1 Q;  4LF6 L;  2VXW A;  5JEA G;  2F0T A;  4DR2 Q;  2A68 D;  1QCB D;  1D5M C;  1HJP A;  1S5F D;  1IYJ B;  2GA4 B;  1I5F A;  2ZJP A;  5KYL A;  3RZO H;  4JI2 Q;  4A3J G;  1B7Y B;  1M4V A;  1LTI D;  2HQL A;  1CKM A;  5C44 H;  2O5J C;  4GLV B;  2K5V A;  4NXN L;  3ITP A;  1W3S A;  4PZ6 A;  3NTH A;  2RA4 A;  4AQY L;  3A5Z B;  3HOX B;  3NPP A;  5A2Q E;  1MIU A;  4DN4 M;  5BN5 A;  2WB1 B;  3HEJ A;  4K6D A;  4LK1 C;  1SE8 A;  4B3S Q;  3U50 C;  5IWA Q;  1CQV A;  1FR3 A;  2Y0S G;  4LF7 Q;  1K0S A;  4V0B A;  2YU9 H;  1E2Z A;  2BOS A;  4DAP A;  1UEB A;  4EQO A;  2ZXP A;  5CV6 A;  1TY2 A;  4HJ7 A;  3I4M H;  4EX5 A;  3S1N H;  1A6X A;  3CAM A;  2NVX H;  3IKJ A;  3C1F A;  3AQQ A;  3HKZ E;  4HIM A;  5K36 H;  4A3K H;  1NR4 A;  3ZJY C;  2V4D A;  4ZAI A;  4JOI A;  5IYB H;  1DXM A;  5FLX L;  1SYD A;  1SRU A;  3JC6 6;  1RTO A;  2EOT A;  1Q1E A;  5GAD C;  1IYU A;  1PH3 A;  1FVI A;  3PIP 3;  1A3V A;  3GV6 A;  2BDO A;  3C2P A;  3TP7 A;  3E9H A;  4IUN A;  1VQK A;  2B63 G;  1VQJ A;  2QDL A;  1EOT A;  1YNX A;  1G2T A;  4YY3 Q;  3E5S A;  1PFN A;  3S14 H;  3H94 A;  3P20 A;  2ICI A;  4R8I A;  1XMQ L;  4DUZ Q;  2R92 G;  3GTM H;  4FF1 A;  2E2H H;  1SNP A;  2BCO A;  1B9N A;  1I4H A;  1EQQ A;  1BXT A;  3VYT A;  2SNS A;  4RKB A;  2JSO A;  3PGZ A;  3STB D;  1T9H A;  4LUV A;  5FLX E;  3J7Y W;  2F0E A;  2K52 A;  4MIU A;  3DLL A;  4OO1 G;  1N36 Q;  2UUA L;  4JI6 Q;  4QUC A;  1K0R A;  1FJG Q;  1O80 A;  1EWC A;  1D5X C;  3DWP A;  3M4Y A;  5C0X H;  1LT3 D;  3TS2 A;  3F2D A;  5C6A A;  4B3S L;  5EKI A;  3L2P A;  5EAY A;  3BU2 A;  1EIH A;  4NXM L;  4DV4 Q;  4F7X A;  2IL8 A;  1ICW A;  3PUY A;  5LMN Q;  3UDI A;  5ELD A;  1PTO H;  1JE5 A;  1W6J A;  1QZH A;  3VYR A;  3KFU A;  5IP9 G;  2PW5 A;  2RQX A;  1F9S A;  3K5M A;  4DV6 Q;  4LJZ C;  5M5W B;  3T56 B;  1SBB B;  1Q81 C;  1IL2 A;  4CJ2 C;  1KRT A;  4DU9 A;  2B8F A;  4Q5V A;  2R7D A;  5C3E B;  1S72 A;  3SK8 A;  4APV A;  5GQO A;  3ULJ A;  2UXB L;  2ZM6 Q;  5IE8 A;  4DV5 L;  3H6M A;  1Q3L A;  3K7A B;  3CCS A;  2PW7 A;  1G8Z D;  2ZTE A;  4A93 B;  1CZW A;  2F0P A;  5LL6 S;  3JAM i;  2FIN B;  4ZQ3 A;  3OW2 A;  2Q2I A;  3RUZ A;  4DFA A;  3D3R A;  1B44 D;  1B3Q A;  4JI5 Q;  4P75 A;  3QWN A;  2VQF L;  3ER0 A;  5L37 A;  3Q22 A;  2B2U A;  4HIO A;  2KEN A;  5LHY 1;  1YNJ C;  2F3V A;  2X6L A;  3HKZ G;  4DV6 L;  1HZA A;  1W2B A;  2L1B A;  4HMI A;  3BVM A;  2VQF Q;  5IOD A;  1B1Z A;  5IYB G;  2DY7 A;  3BJU A;  3I4M B;  3H09 A;  3URY A;  4J6H A;  4LNQ A;  1BUV T;  5LMN L;  2ALY B;  4B3T L;  1XPR A;  2B2W A;  4X62 L;  1HQR D;  4XYQ A;  1V8Q A;  1SFO H;  1HNZ L;  1N34 L;  1MJE A;  3NEL A;  2F0Q A;  5CV5 A;  5HGT A;  4J1M A;  3NEN A;  4JK1 C;  1LAB A;  2RBM A;  1PRT C;  2EE1 A;  4UDU C;  2R92 H;  4JI6 L;  1K8G A;  4HCS A;  1PTO B;  1STB A;  2A73 B;  2HCI A;  4DR6 Q;  3PIP A;  4WRD A;  1D6E C;  2YYZ A;  1M90 C;  3R2I A;  1WD1 A;  5IT9 L;  1YHB A;  2A5H A;  4C3I H;  5CYU A;  3RN5 A;  3TRE A;  4L5S A;  1CKN A;  2XNA C;  2WFW A;  1H9M A;  1PTO C;  2H4O A;  4IJH A;  4CJ0 B;  4CHT B;  3F2B A;  1F2L A;  1STA A;  4C3H H;  4MN3 A;  1H9R A;  2RHS B;  3K80 C;  4K0K Q;  2JA7 B;  3T4A C;  2OQ0 A;  4IAL A;  3NQT A;  4XXE A;  2RDG A;  5C4X G;  4A3G B;  1E22 A;  3PUZ A;  1YBY A;  3A55 A;  1U0L A;  3LNN A;  3I90 A;  3MZ5 A;  2B2V A;  3K6O A;  1PLF A;  4AYB E;  4QCL A;  1AZP A;  4GNX B;  4DGZ A;  2XSC A;  4LF4 L;  1ET6 A;  4A3C H;  5C0X J;  4NP5 A;  4H44 C;  2J7Z A;  4TQU S;  5ELC A;  3CC4 A;  2NZO A;  2A1A A;  5IOC A;  4A93 G;  4B3M L;  3AB9 A;  1C8C A;  4QUF A;  2WKC A;  4DA2 A;  3JAM c;  1T5X D;  2R3Z A;  4Y52 H;  3DEO A;  3J80 E;  4NDX A;  1XNQ Q;  3CCQ A;  1VQI A;  3HS0 C;  4JI4 L;  1D1I A;  5JJK A;  4IO9 A;  4PMC A;  3S1M H;  1K9M C;  1IBM L;  4A3B H;  1PRT F;  2N8N A;  4JBW A;  2E2J H;  2DNE A;  1ZYR D;  5G3L F;  4HJ8 A;  3WWV A;  1MJC A;  3MXU A;  1CM9 A;  2CFM A;  1B8A A;  2JA8 H;  3TRZ A;  1K8O A;  1VF5 C;  5I9P A;  1V1O A;  3CCM A;  2I46 A;  1PYW D;  2C35 B;  1TWA H;  1XXG A;  2IJ0 A;  3BG3 A;  1R9T B;  5E4X A;  4RKL A;  3RLN A;  2QA4 A;  3CC2 A;  1CZG A;  3K0X A;  3A8J E;  2Q8T A;  1L0W A;  5JVH 3;  2YTY A;  1VQD A;  4X65 L;  1SN8 A;  1VQ5 A;  1Q12 A;  5A2Q L;  4JG2 A;  5IT9 c;  5J1Z A;  2I07 B;  4K5X A;  2VZA A;  4DR7 Q;  2MUY A;  2MJ8 A;  2JEA I;  4LUO A;  3MEF A;  2MP1 A;  4LF4 Q;  2HQE A;  1JOK A;  3T1H L;  3QOJ A;  3VR3 A;  3W5O A;  1Q82 C;  2EYL A;  5IYC G;  1TWG H;  1HZ9 A;  1Z7T A;  2JA6 B;  4OWX B;  3TDQ A;  1I4P A;  1O7L A;  4KJN A;  1VMC A;  2AMC B;  2CWA A;  5FLM G;  1L1O C;  1SEB D;  1YJW A;  4POF A;  1NBW A;  2KCT A;  1FYC A;  1E1T A;  4GLA C;  1I50 B;  2WAQ B;  1MBY A;  3HZX A;  4F87 A;  2MNA A;  1U4L A;  1F77 A;  2QEJ C;  3ULL A;  5FLM H;  1I50 H;  3NK9 A;  3VDY A;  2VQE Q;  4A3J H;  2I5H A;  4XDX A;  3QJY A;  2M9V A;  1JE4 A;  1VF7 A;  1PRT B;  1HZB A;  1KDB A;  5KNB A;  1EY6 A;  3FVQ A;  2D0P A;  5C44 B;  5T1I A;  2ZJQ A;  3MXP A;  3GTP H;  3ICE A;  4L63 B;  2EY6 A;  1NY4 A;  2F0L A;  2RVL A;  4DR2 L;  4DNI A;  2IWH A;  1HHV A;  2JA5 B;  2UXC L;  2F3I A;  1PVO A;  1WFQ A;  5EJW A;  3LWE A;  4JI4 Q;  4Z9C B;  5E1F A;  1B3A A;  3ERQ A;  1X55 A;  4XTC S;  3HGB A;  3OIQ A;  4IPC A;  5IGC A;  3GV3 A;  3E3X A;  4EQ5 A;  4DXF A;  2A68 C;  3H3V H;  2K6A A;  1E2V A;  3UE1 A;  1E3P A;  1LAC A;  4BA1 I;  1AH9 A;  5JPM C;  1CT1 D;  2SOB A;  2OQK A;  1VQ7 A;  3KOJ A;  2CWP A;  3M7G A;  3BZC A;  1L0Y B;  5EPK A;  2EDG A;  4KY7 A;  4KHV A;  1SSO A;  5ELO A;  4FNF A;  2OWO A;  2K04 A;  4ZRZ A;  3HOU H;  2NYZ D;  2RCF A;  2LXK A;  2YTX A;  2ZJR A;  1MSG A;  1VS0 A;  3H91 A;  3I4N B;  1G6Z A;  2BH8 A;  1ASY A;  2N3S A;  5CBA E;  3G71 A;  4HIK A;  4DV2 L;  1HA5 A;  3S15 H;  4LFA Q;  1ONL A;  1UNS A;  4DNR B;  1X9N A;  2XWJ B;  1STE A;  3PIO A;  4OO1 I;  1I6H H;  2D0O A;  1TXY A;  1IW7 C;  3SE0 A;  2NVX B;  2Q2H A;  3I73 A;  3A54 A;  1Q7Y C;  1DM0 B;  1HPC A;  1I4Q A;  4A3K G;  4R1J A;  1CQF A;  1LTT D;  2CW0 D;  3GTO B;  1TWF H;  1Z6H A;  4MNO A;  2KCC A;  2A6H C;  3OMC A;  2TSS A;  4DV3 Q;  3MAQ A;  2F0D A;  4KY5 A;  3MVV A;  3MC0 B;  2UUB Q;  1ENC A;  4JVZ A;  1NR2 A;  4NXM Q;  4G57 A;  1HQM C;  3I2Z A;  4FO2 A;  2K01 A;  2CCZ A;  1EY4 A;  2F0N A;  4FP5 D;  4YY3 L;  2UUC Q;  1CHP D;  3SK4 A;  1PMR A;  2J4X A;  1OXV A;  4KKT A;  4X65 Q;  1A2T A;  1J5E Q;  2AUJ D;  1PHJ A;  1YI2 A;  3K58 A;  4K2L A;  1LYL A;  2RDF A;  1HNX Q;  5GAH C;  1OXX K;  1LTL A;  4C3J G;  4HTH A;  1AZQ A;  4GS3 A;  3NWT A;  2NVT B;  4NW2 A;  2WB1 E;  4KI0 A;  4LF8 Q;  2B2T C;  4LFC L;  5I6Y A;  4A3D H;  2F4V L;  3GTQ B;  4GLX A;  2JK8 A;  1MKH A;  3KDF A;  3S1Q H;  3RZD B;  2EYO A;  3GO5 A;  5CBE E;  2LS0 1;  1PZJ D;  1TR5 A;  1CTM A;  2F0F A;  4KHP L;  3RR5 A;  4CKB A;  1XMQ Q;  4EQN A;  1NMF A;  1EWI A;  5IYD H;  4DR7 L;  2NVT H;  4BS9 A;  1ZXT A;  4HID A;  3Q23 A;  4P71 A;  5BR8 L;  3W2D A;  2DY8 A;  1KQS A;  3D4R A;  3OOC A;  1JT8 A;  3EVQ A;  3AEV A;  1SYE A;  4KN4 C;  3S17 B;  5IYD G;  1PYB A;  2D2C C;  1S4Z A;  2QIL A;  4M1U B;  4PNY A;  3SHL A;  4YIJ A;  4JOI C;  1HZC A;  1KL9 A;  1O7I A;  5M5Y B;  1A8V A;  2PZT A;  3J7A 5;  1QUQ A;  4JBK A;  4AYB B;  2BA0 A;  3R3O A;  4C3I B;  4CDD C;  1BDO A;  1LUZ A;  2VNU D;  2K5D A;  4DV7 Q;  2EXD A;  1XWE A;  1KD1 C;  2EPB A;  2XTI A;  3M4O B;  3FKI H;  4ZUI A;  4A93 H;  1Y1V G;  2E74 C;  1MHW C;  2KA7 A;  1C48 A;  5KNC A;  4QB4 A;  2Z6K C;  4LF5 Q;  5EPJ A;  3S24 A;  3QG1 A;  3SVM A;  2GVA A;  5KEE A;  2CH4 W;  1Y1V H;  2NVY H;  2I5L X;  2EJG C;  3NXW A;  1QZG A;  3C1E A;  3PSI A;  3AFP A;  5FKA C;  1T5E A;  4BBR B;  2F4V Q;  4H7B A;  1IKL A;  1S40 A;  3HOZ H;  3CU7 A;  3OSO A;  1WI5 A;  3U9O A;  3A7L A;  2EY5 A;  4KHZ A;  1FNU A;  3MWY W;  3KLS X;  1PZK D;  4Q0F A;  3HOY H;  2LY7 A;  4CGY B;  2BA1 A;  1BF4 A;  4DNT B;  1KAW A;  4PZ8 A;  4C2M H;  3OHX C;  3M85 A;  1OTC A;  1IHZ A;  5M3F G;  1NMG A;  4QF4 A;  1ESF A;  3GTK H;  1D1K A;  4A3M G;  4ILW A;  4RGN A;  1LV9 A;  2JA5 G;  4IFD H;  2FHT A;  5LMN W;  2E2I H;  2R7Z G;  5LL6 X;  2KOL A;  2NN6 G;  2PQE A;  3CQZ H;  4HJA A;  1QOH A;  2LSS A;  3FKI B;  1C7Y A;  3TZU A;  1UE5 A;  3L9A X;  3SDZ A;  1KTK A;  5A35 A;  5GAE C;  2A6E C;  3HOU B;  2ZT9 C;  5JJI A;  2JA5 H;  4IUT A;  2VUM B;  4JI1 L;  5FJ8 H;  4YWL A;  1EOV A;  1EU3 A;  1VQ9 A;  4JI7 L;  1KNA A;  1TKW B;  1K73 C;  1K83 H;  2ZTD A;  4L5R C;  3BS1 A;  4BBR H;  4JYA Q;  1DON A;  1SYC A;  1ENF A;  1L2F A;  1ASZ A;  1AN8 A;  4K8I A;  1XNR L;  5JVG 3;  3F8T A;  2JA8 B;  1DOM A;  2AUK A;  3HOZ G;  4R4C A;  5KND A;  2DJF C;  4P72 A;  5M5X H;  2VL6 A;  3DM1 A;  3A5U A;  1X32 A;  4A3F H;  4CDE C;  2KEC A;  3GQB A;  2DUD A;  4DK3 C;  1NNX A;  1RDP D;  4FXD A;  1XMO L;  2F03 A;  1FD7 D;  2WII B;  1EUJ A;  3NBH B;  1GM5 A;  4DR3 L;  1F9P A;  1SDF A;  1V1Q A;  1WTR A;  2E76 C;  5JOB A;  1F2M A;  4MZ9 A;  2R61 A;  1GVP A;  2Q2T A;  4DAY B;  2O4X A;  1EY0 A;  3H3V C;  3HOY B;  4A3G G;  1VQP A;  1VQ6 A;  4G7H C;  4PMW A;  1SFO B;  1PRT D;  3LGJ A;  3SXH A;  4XT1 B;  2FMC A;  3K57 A;  4X3T A;  4N9T A;  1X54 A;  3CKI B;  2WP8 J;  4N8F A;  2G5D A;  4X3U A;  4R4I A;  3EFX D;  3M7N A;  2XIW A;  1GJX A;  3G6E A;  1QWY A;  3KLR A;  3R8B A;  1SAP A;  2JA8 G;  2K05 A;  1QVC A;  1VQL A;  4BBR G;  1PH7 A;  4CKE A;  3PO2 B;  4HAE A;  1A63 A;  1YEZ A;  3NUC A;  1PTO D;  1SR3 A;  4BA2 I;  1RJT A;  4J15 A;  4K14 A;  5C4J B;  4KD4 A;  4IZ8 A;  1H95 A;  2O2L D;  5EBC A;  4DR5 L;  4A3B B;  1JJG A;  3D4W A;  5JJL A;  1BO0 A;  2UU9 L;  2EY2 A;  4TSS A;  3E0J A;  1XPU A;  1QVG A;  2L5T A;  2Z9H A;  2UXC Q;  4A3C G;  1EQV A;  3NHH A;  4JI3 Q;  1O78 A;  5C3X A;  4XQJ A;  2JA7 G;  3GTQ H;  4KHP Q;  5IT9 E;  1HUM A;  5K5P A;  4YHH L;  2Z6B A;  3J81 c;  3H0G B;  1QIL A;  4IUR A;  3WOF A;  2IT1 A;  4C2M B;  1R9T H;  3KK7 A;  4OX9 Q;  4QIW E;  5I2X A;  1KAA A;  1QG7 A;  4OGQ C;  3J81 j;  2Y0S E;  4NMZ A;  3OTO L;  5IGE A;  1GXD C;  5IP9 H;  1KIX A;  1ZYR C;  1V43 A;  3D8G A;  2NWG A;  1JOO A;  2JN4 A;  2JA9 A;  5C44 G;  3UDF A;  5CC4 A;  3C3L A;  2K50 A;  3CCU A;  5NUC A;  2RSN A;  4ME5 A;  4RFB A;  4DV1 L;  1EY9 A;  2PNR C;  4JI8 L;  1JOR A;  4A3I B;  1K28 A;  2JA6 H;  4RGO S;  1I4X A;  1BVS A;  3HOU G;  1Q86 C;  1GHJ A;  3KYH C;  3TP8 A;  1E24 A;  2WAQ G;  3SR1 A;  1JCK B;  4LWC A;  3FPU B;  2YTV A;  2KVM A;  1O7Y A;  5EGT A;  4HJ5 A;  3M4O H;  4HCE A;  3CCJ A;  1LLR D;  3HKS A;  3OW7 A;  3IFT A;  4OEL B;  1GUS A;  1FGB D;  2CQO A;  3U4Z A;  3I4N H;  1SMY D;  4JC0 A;  1J5E L;  2I0Q A;  4FYD A;  3PUW A;  5E3F A;  3K81 C;  2B2Y A;  2Z4H A;  1SMX A;  1L1O B;  2MGS A;  1KXL A;  1A0I A;  3B6Y A;  3G6J B;  3PUX A;  1Y1W B;  3CMA A;  1K8A C;  4OX9 L;  3GTM B;  2M2L A;  1YZ6 A;  3OWF A;  1O7Z A;  2F0M A;  1GKH A;  1TWF B;  1GOZ A;  1L1O A;  4NPS A;  4TRD A;  1Y8N B;  4A76 A;  1JB3 A;  4A3I H;  1Y14 B;  1G51 A;  2L15 A;  3HOV G;  1B70 B;  1UE1 A;  2VY3 A;  2ASB A;  4DV1 Q;  2DN8 A;  1I94 L;  1UE6 A;  1OXT A;  4IUQ A;  1LTS D;  5I2Y A;  1KHI A;  3N6R A;  4RG1 A;  1LTB D;  2K5W A;  4HSP A;  1QNK A;  1LT4 D;  2OT2 A;  5C5L A;  1VQ8 A;  4WJ4 A;  1VQH A;  4N9P A;  3K59 A;  4A75 A;  2EYM A;  5IIF A;  1X3E A;  1IYV A;  2ATW A;  4CDC C;  1B4O A;  2PI2 A;  4OWW B;  2F4I A;  2RHQ B;  3CF5 A;  3TQY A;  1DOL A;  3R2T A;  1CUK A;  2PQA B;  5C3W A;  1MI2 A;  1K8M A;  4GOP A;  1HR0 L;  1YJN A;  1PZI D;  3IL8 A;  3STB C;  4JI0 Q;  2AKW B;  2AQ2 B;  3QO2 A;  3AMU A;  3GTG B;  1IBK L;  1EYA A;  1Z47 A;  3ERS X;  3FP9 A;  5JJZ A;  1SMY C;  1KDA A;  1TS3 A;  2Q2U A;  1VQN A;  4A3K B;  3K5O A;  3J81 i;  4HMJ A;  3OWE B;  3W1G A;  1LO5 D;  5AJ3 L;  1HH2 P;  3CCV A;  2LFN A;  5IGF A;  1EFW A;  2BDN A;  2L12 A;  2IHF A;  1SNQ A;  3H15 A;  5IGB A;  2R7Z H;  2A6E D;  3P75 A;  4DF7 A;  3ZYY X;  2E75 C;  4DR6 L;  4C56 C;  4OHJ A;  4LAA A;  2K5N A;  2KUM A;  1OXU A;  1M8A A;  3X3M A;  2KCN A;  3HOX H;  2K4K A;  2XRQ D;  5IGD A;  3CCE A;  3IRB A;  4IN3 A;  4KKU A;  4R9W A;  4TKO B;  5KRU A;  3V2T A;  1ILQ A;  5M3M B;  1JR0 D;  2L11 A;  2N49 A;  4DV0 Q;  3OMG A;  1KNE A;  4F8M A;  4BBS B;  4B3T Q;  3E6Z X;  2B2U C;  3K5N A;  2CW0 C;  1JB7 A;  2PMZ B;  3M4P A;  3TN2 A;  2DGY A;  5J3B A;  1KLU D;  1V1P A;  3KLW A;  4KTA A;  2JEB I;  3GTO H;  1G91 A;  4UP7 A;  1STY A;  2JJQ A;  3S16 H;  1SYB A;  3NBI A;  3CRK C;  4GKK Q;  3CPW A;  1VQ4 A;  2R6G A;  1JWU D;  4BBS H;  4B9W A;  2PMZ E;  4A4I A;  2K1B A;  5DLQ E;  4YCW A;  1C0A A;  3D31 A;  5IWA L;  5IYC H;  2NTS A;  1PDQ A;  1X65 A;  1PFB A;  4X62 Q;  1Y1W H;  5BN4 A;  4X3S A;  1BNZ A;  2P5Z X;  4K5W A;  1EIG A;  1FL0 A;  2EJM A;  5ELN A;  4ULL A;  2NVY B;  1ESR A;  2RSO A;  2MO0 A;  4JI7 Q;  4HED A;  1EU4 A;  1KLG D;  1Q90 A;  3CHB D;  2HIV A;  2MQH A;  2SEB D;  4IUP A;  4KD3 A;  1TY0 A;  1VDZ A;  2HD3 A;  2PI2 E;  3I91 A;  3TS0 A;  3H3V I;  2HHH Q;  5FO8 B;  3HOV B;  4BXX G;  4YHH Q;  5DAU A;  5AJ3 Q;  2N55 A;  3J7A V;  1D8L A;  4XQN A;  2F0U A;  2OCE A;  1Y8P B;  4DR4 Q;  2AQ1 B;  4RA8 A;  1YHA A;  5CV4 A;  1V9P A;  1IBL L;  3U4V A;  1BQQ T;  1TVX A;  3T51 B;  3TEH B;  3RD4 A;  2ZM6 L;  4DV5 Q;  3FPP A;  3F2U A;  4XIG S;  1X3G A;  2K75 A;  1II3 A;  2E5L L;  1N33 Q;  4XQQ A;  2UUA Q;  3GD7 A;  1WCM H;  3K7A H;  5LMU L;  3FRP B;  1HXY D;  1SNM A;  2VUM G;  4FF3 A;  1RF2 D;  4QMG A;  1WTH A;  4V19 0;  4LFC Q;  3FMC A;  3S1R H;  1CHQ D;  2QDB A;  1A2U A;  1WJJ A;  2KHJ A;  2F0S A;  2F0I A;  4ZUJ A;  4GNX C;  2ZXR A;  3FEW X;  4KLK A;  1V1P B;  1STN A;  3J80 c;  5LMU Q;  3VA5 A;  2NZ1 D;  4KKS A;  1EZ6 A;  2M00 A;  3HOZ B;  1DJR D;  2XRS D;  4ODG A;  3TBI B;  3J7Z C;  1TWA B;  4RHS A;  2VB2 X;  2LXJ A;  5EBD A;  3TP6 A;  5ELB A;  3A0J A;  3BZK A;  4AYB G;  4C3I G;  2D5D A;  3CCR A;  3DMU A;  2IHE A;  4O42 A;  2I5M X;  2YV5 A;  2EQS A;  5FK9 C;  4P73 A;  2Z4I A;  4U67 3;  3C46 A;  1QNU A;  4G4K A;  4IFD J;  4ZKB B;  4UP8 A;  4LMQ D;  1WTV A;  1PH5 A;  3CME A;  4FXG C;  3K0Y A;  4OIK A;  1DOK A;  4ZLT F;  1D2B A;  1EL0 A;  2ZXO A;  3HRZ C;  5C0X G;  5ELF A;  1U4M A;  4A3D B;  4G7Z C;  1B50 A;  2HIX A;  4A3M H;  4DK0 A;  3RLO A;  3M9B A;  5COR A;  1F2Z A;  1L0X B;  5GAG C;  5M5Y H;  2HUG A;  5E4W C;  1E7Z A;  4G7O C;  5BR8 Q;  1EYG A;  2VB3 X;  4GN4 B;  4DUZ L;  4BBS G;  5C4X B;  1SE4 A;  3JAM E;  2F52 A;  2B2V C;  4WOR A;  2K28 A;  2H1E A;  1F2Y A;  3NBH A;  1S5D D;  5C3E H;  2TMP A;  1IKM A;  3A8K E;  3I4L A;  1TQO A;  3W3A A;  3I70 A;  3QR8 A;  1HRJ A;  4C1N K;  3O13 A;  1BBU A;  1GUO A;  3CD6 A;  2EXZ A;  3T1Y L;  3CW2 C;  1QVF A;  3CQZ B;  2R93 G;  4DAM A;  1QE6 A;  4UHV A;  2XVS A;  3T13 A;  5JEA J;  5IP7 H;  2MO1 A;  3J80 L;  3I72 A;  3PO3 B;  2RF4 A;  3KDF B;  5D3D A;  2K32 A;  4LF8 L;  1B2T A;  3RZD H;  1H9K A;  1STG A;  3CPF A;  3OIP A;  4JI8 Q;  3PIO 3;  5I9O A;  3RLF A;  1WOC A;  3L7Z C;  2B63 B;  3RNU A;  1WTO A;  4ALP A;  1KRS A;  2B2T A;  4A3D G;  1JC7 A;  1I4G A;  5F2D A;  2A69 D;  4BXX H;  4KMU C;  2QGQ A;  4EGV A;  4RCO A;  1I4R A;  5C0X I;  5EKL A;  1G29 1;  2OEO A;  5DM6 3;  4AQY Q;  3MFG A;  1IBK Q;  1Q46 A;  3CC7 A;  4YWK A;  5M5W H;  4WJ3 M;  3I7F A;  4S3S A;  2JA7 H;  1ML0 D;  2PZU A;  3BDL A;  2F3W A;  4GKK L;  3GDE A;  2Y0S B;  1VMP A;  3EA6 A;  4UY8 C;  4H13 C;  2FMM A;  3TZD A;  2G9H D;  2LMC B;  4A3G H;  1HFN A;  2F0K A;  5I4D A;  2E2J B;  5DEH A;  5K36 G;  2R93 B;  1GO3 E;  4I65 A;  1BOS A;  4BY7 G;  4OL7 A;  1K3B C;  2NN6 I;  1WTX A;  1JWS D;  2UU9 Q;  2VQE L;  2ID0 A;  4A3L H;  2VS1 A;  1UAP A;  4WFN 3;  3KJP A;  4FDB A;  3VR2 A;  1NCV A;  3RN2 A;  3S1N B;  2E8G A;  2N78 A;  4A3I G;  4E6I A;  4DR4 L;  1OXS C;  5BN3 A;  3PV0 A;  4LUZ A;  2JA6 G;  3HOW H;  3DUZ A;  3UDG A;  4DAV A;  4R4Q A;  3N52 A;  2WV6 D;  4IJL A;  1EIF A;  3G7L A;  3J80 i;  1EWH A;  2K7V A;  4KN7 C;  2CKZ B;  4GKJ Q;  3HOV H;  4IFD I;  2QF7 A;  1SND A;  5M5X B;  1LTR D;  4O1N A;  2Z6K A;  1AE3 A;  3D6C A;  1EIY B;  1PXU A;  4OO1 H;  3S2H H;  2NB0 A;  4IUU A;  4JBJ A;  4CBV A;  1YNN D;  2E2H B;  3A8I E;  2F0V A;  2F0J A;  2K5H A;  2B29 A;  3X3N A;  1VCI A;  3BZD B;  3MXG A;  4OXP A;  1QUQ B;  2UUC L;  4O0A A;  1Y8O B;  5E7N A;  3GTL H;  1KC8 C;  4CDF C;  1PH8 A;  2JXM B;  3E9I A;  1YIJ A;  2PQA A;  3PO3 G;  2IY5 B;  1I6H B;  4CJ1 B;  1RHP A;  2B63 H;  1KDC A;  3EJI A;  1JOQ A;  3T1Y Q;  1TS2 A;  4DPG A;  4PV1 C;  1EYC A;  4MTK A;  5C4J H;  1AEX A;  3S15 B;  4IUV A;  4FVM A;  1YVC A;  1N34 Q;  3BDO A;  1U4P A;  2QW7 A;  2B39 A;  3PO2 H;  5JAV A;  2YU9 B;  1JQY D;  2PCF B;  5JPN C;  1NE3 A;  4B3M Q;  4H02 A;  1LM0 A;  2J0T D;  4KJO A;  1WVL A;  1CSP A;  1SJE D;  2JE6 I;  2X6G A;  2GVB A;  1VQM A;  1GUN A;  3S1R B;  4F88 A;  2A6H D;  4YWM A;  3J81 E;  2WAC A;  2C9O A;  4QGU A;  4FF2 A;  4HR7 B;  2WAQ E;  1NAP A;  1J8I A;  4GOP C;  3SEB A;  4C3H B;  2MHV A;  1X3P A;  1EEI D;  3LWU A;  4QJF A;  4R8N A;  4JI5 L;  1MGS A;  2LKV A;  4K6L A;  4RAU C;  4IPH A;  2KBN A;  5EPL A;  5GRO A;  3MTS A;  1VQF A;  4DK6 C;  5ELE A;  4B08 A;  1D5Z C;  5ISR A;  3S1M B;  1SYF A;  2ZTC A;  1A15 A;  4TVA B;  5M3F H;  1XNQ L;  5DNF A;  1U9R A;  1RIP A;  3SK5 A;  1PH6 A;  4BWG B;  1LTG D;  5CV8 A;  5M3M H;  2IW3 A;  1IW7 D;  1PV4 A;  1GHK A;  3GTP B;  1F9Q A;  1WYD A;  4KV6 A;  3GTJ B;  2R7F A;  1HNW L;  1SJH D;  4DUY Q;  4P2C B;  3K7U C;  4JI0 L;  1EEF D;  1N32 Q;  3NTI A;  1RD9 D;  3NP8 A;  1PH9 A;  4Y7N H;  3S17 H;  4EVO A; 
#chains in the Genus database with same CATH homology
 4GOP A;  1VQA A;  2OWO A;  1HR0 L;  1YJN A;  1JMC A;  5M3M G;  3I56 A;  3STB C;  4JI0 Q;  2AKW B;  3HOU H;  1SRO A;  2A19 A;  3HOX G;  1IXR A;  2LXK A;  4BY1 H;  1XJV A;  2YTX A;  2ZJR A;  4DV4 L;  5C3E G;  1HNW Q;  1IBK L;  1CSQ A;  1X6O A;  2V1C C;  1VS0 A;  1Z47 A;  3FP9 A;  3ERS X;  3M4Q A;  4OON A;  4K0K L;  2BH8 A;  1ASY A;  2N3S A;  4B3R Q;  4HIK A;  3G71 A;  4DV2 L;  3Q8D A;  4AIM A;  2Q2U A;  1VQN A;  3S15 H;  4LFA Q;  1Q1B A;  3ULP A;  4UP9 A;  3J81 i;  4DR5 Q;  3W1G A;  1X9N A;  5AJ3 L;  3CCV A;  1HH2 P;  1VQO A;  1EFW A;  2D62 A;  1BBW A;  3PIO A;  2EIF A;  4MTN A;  4OO1 I;  2AWO A;  5FLX c;  1N36 L;  2D0O A;  1I6H H;  1TXY A;  3PUV A;  3PF5 A;  2HHH L;  2IHF A;  2Q2H A;  3H15 A;  1Q7Y C;  3CCL A;  3OTO Q;  1PFS A;  4A3K G;  2R7Z H;  4R1J A;  4DR3 Q;  4JI1 Q;  4LF6 L;  5JEA G;  4DR2 Q;  1TWF H;  4DR6 L;  1UWV A;  1HJP A;  4MNO A;  1IYJ B;  2K5N A;  1I5F A;  2ZJP A;  2ES2 A;  4GKJ L;  2HT1 A;  1OXU A;  3RZO H;  4DV3 Q;  1TWH H;  4A3E H;  4JI2 Q;  4A3J G;  3HOX H;  2K4K A;  1B7Y B;  2HQL A;  1CKM A;  1Q8K A;  5C44 H;  4GLV B;  1P8L A;  2K5V A;  3KF6 B;  3IRB A;  4NXN L;  3CCE A;  4NXM Q;  1W3S A;  4PZ6 A;  4X64 L;  3I2Z A;  4AQY L;  3A5Z B;  3G48 A;  1HNZ Q;  1MIU A;  3EIV A;  2CCZ A;  2UUC Q;  4YCU A;  4YY3 L;  4B3S Q;  1SE8 A;  3U50 C;  5IWA Q;  2N49 A;  4QL5 A;  4DV0 Q;  2Y0S G;  4LF7 Q;  1OXV A;  3EBE A;  4X65 Q;  2YU9 H;  4JYA L;  1VQE A;  1J5E Q;  1PHJ A;  1UEB A;  1YI2 A;  4B3T Q;  2OTJ A;  2UXB Q;  1LYL A;  1HNX Q;  4HJ7 A;  5GAH C;  1OXX K;  3I4M H;  1LTL A;  3UE0 A;  4EX5 A;  1JB7 A;  3S1N H;  3CAM A;  4GS3 A;  2NVX H;  3M4P A;  3HKZ E;  3AQQ A;  4HIM A;  1IZ6 A;  2DGY A;  5J3B A;  2WB1 E;  4KI0 A;  3KLW A;  4LF8 Q;  4A3K H;  1K3R A;  4LFC L;  2JEB I;  3ZJY C;  4A3D H;  3GTO H;  5IYB H;  4JOI A;  2F4V L;  4RMF A;  4UP7 A;  2JJQ A;  3S16 H;  2KCM A;  4GLX A;  1SRU A;  2JK8 A;  3JC6 6;  4A3B G;  5IP7 G;  1Q1E A;  3CXC A;  4GKK Q;  5GAD C;  1U5K A;  1MKH A;  3KDF A;  1PH3 A;  1FVI A;  3CPW A;  2R6G A;  2PNH A;  4A3F G;  1VQ4 A;  1HR0 W;  3GO5 A;  2E5L Q;  3S1Q H;  4BBS H;  4LF5 L;  2PMZ E;  5H1S E;  4A4I A;  4KHP L;  3E9H A;  1NJI C;  5DLQ E;  1VQK A;  3RR5 A;  4YCW A;  1VQJ A;  1XMQ Q;  2B63 G;  1NMF A;  1YNX A;  3D31 A;  5IWA L;  1C0A A;  1EWI A;  5IYC H;  4YY3 Q;  3S2D H;  5IYD H;  4DR7 L;  3S14 H;  1X65 A;  2NVT H;  4ME3 A;  3F2C A;  4HID A;  1DGS A;  1XMQ L;  4X62 Q;  4DUZ Q;  1Y1W H;  2R92 G;  4P71 A;  3GTG H;  3GTM H;  5BR8 L;  1JT8 A;  1KQS A;  3U58 A;  4BY1 G;  2E2H H;  2UUB L;  2A8V A;  2GN5 A;  4DV7 L;  1EQQ A;  4IOA A;  4JCV E;  1FL0 A;  3AEV A;  2IX0 A;  5ELN A;  1M1K C;  3KF6 A;  5IYD G;  1PYB A;  1SLJ A;  3PGZ A;  2MO0 A;  4JI7 Q;  3D0F A;  3STB D;  1T9H A;  4JOI C;  1PH4 A;  1HZC A;  1KL9 A;  1O7I A;  2HIV A;  4LUV A;  2MQH A;  1A8V A;  1XMO Q;  3J7A 5;  1QUQ A;  2K52 A;  4JBK A;  2PI2 E;  2BA0 A;  3TS0 A;  3H3V I;  2HHH Q;  3DLL A;  4OO1 G;  1N36 Q;  2UUA L;  4YCV A;  4JI6 Q;  1FJG Q;  1K0R A;  1CKO A;  1LUZ A;  1HNX L;  4BXX G;  2VNU D;  4X6A H;  3K8A A;  4YHH Q;  5AJ3 Q;  4DV7 Q;  2EXD A;  1KD1 C;  1D8L A;  4JI3 L;  2OCE A;  2XTI A;  3TS2 A;  3F2D A;  1IBL Q;  4DR4 Q;  3FKI H;  4B3S L;  4A93 H;  1Y1V G;  3L2P A;  4DV2 Q;  4C3J H;  3SGI A;  4B3R L;  1YHA A;  4PG3 A;  5EAY A;  3BU2 A;  1V9P A;  1IBL L;  3U4V A;  4NXM L;  4DV4 Q;  3TEH B;  1D7Q A;  2ZM6 L;  4DV5 Q;  4JV5 Q;  2Z6K C;  4LF5 Q;  1RL2 A;  3PUY A;  1X3G A;  4XIG S;  3UDI A;  2K75 A;  5LMN Q;  3S24 A;  1JE5 A;  1VQC A;  2E5L L;  1JJC B;  2GVA A;  1N33 Q;  2UUA Q;  1QZH A;  1Y1V H;  2NVY H;  3GD7 A;  1WCM H;  2I5L X;  3K7A H;  5LMU L;  2BH2 A;  3KFU A;  5IP9 G;  1QZG A;  2VUM G;  3PSI A;  3AFP A;  4DV6 Q;  2F4V Q;  1FGU A;  3H0G G;  4LFC Q;  1EQR A;  1S40 A;  3S1R H;  4LF6 Q;  3HOZ H;  1Q81 C;  1WI5 A;  1IL2 A;  1WJJ A;  2KHJ A;  1KRT A;  1N8R C;  1BKB A;  4KHZ A;  4GNX C;  3AFQ A;  3I4M G;  4KLK A;  1PH2 A;  2R7D A;  3J80 c;  5LMU Q;  1S72 A;  4APV A;  3HOY H;  5GQO A;  3ULJ A;  3H0G H;  2UXB L;  2BA1 A;  2ZM6 Q;  5IE8 A;  3J7Z C;  4DV5 L;  1KAW A;  4GN3 B;  4PZ8 A;  2VUM H;  4C2M H;  3M85 A;  2LXJ A;  1OTC A;  3CCS A;  5M3F G;  3A0J A;  3BZK A;  2ZTE A;  4AYB G;  3CCR A;  1S3O A;  1NMG A;  4DKA C;  3GTK H;  2IHE A;  2QEX A;  3JAM i;  4A3M G;  2I5M X;  2YV5 A;  3G4S A;  3OW2 A;  2EQS A;  2Q2I A;  4P73 A;  2JA5 G;  5LMN W;  1XPO A;  2E2I H;  2R7Z G;  4JI5 Q;  4IFD J;  4P75 A;  4UP8 A;  1FJG L;  4A3L G;  3CQZ H;  2NN6 G;  4L5T A;  4HJA A;  2LSS A;  2VQF L;  1PH5 A;  1C7Y A;  3CME A;  3ER0 A;  4QQB X;  1PYS B;  3AYH B;  1UE5 A;  4B3M Q;  5GAE C;  4HIO A;  2KHI A;  3PO3 H;  1Z9F A;  2KEN A;  5C0X G;  5JJI A;  2JA5 H;  4JI1 L;  3HKZ G;  5FJ8 H;  4DV6 L;  1HZA A;  4YWL A;  1W2B A;  2HIX A;  1EOV A;  4A3M H;  1VQ9 A;  4JI7 L;  3RLO A;  3M9B A;  2VQF Q;  1UE7 A;  1K73 C;  5IYB G;  3BJU A;  1CKN B;  5GAG C;  5M5Y H;  4DR1 L;  2NZH A;  1K83 H;  3OYY A;  2ZTD A;  4L5R C;  4LNQ A;  3M3Y H;  4B3T L;  5LMN L;  2ALY B;  4BBR H;  4LFB L;  4GOP B;  1E7Z A;  1XPR A;  4JYA Q;  5BR8 Q;  1EYG A;  4LF7 L;  4GN4 B;  4X62 L;  3DM3 A;  4DUZ L;  3HOW G;  1L2F A;  2VW9 A;  1ASZ A;  1SFO H;  1XNR Q;  4BBS G;  2F52 A;  3PCO B;  1HNZ L;  1N34 L;  1XNR L;  1MJE A;  3F8T A;  3NEL A;  1TWC H;  4IPG A;  5C3E H;  3HOZ G;  4R4C A;  4P72 A;  1I3Q H;  4LFB Q;  5M5X H;  3I4N G;  3NEN A;  1BBU A;  2VL6 A;  3CD6 A;  4JI2 L;  4R4O A;  3T1Y L;  3CW2 C;  2R92 H;  4JI6 L;  1QVF A;  3A5U A;  2R93 G;  2AHO B;  3A74 A;  4A3F H;  1K8G A;  4DAM A;  3E0E A;  2DUD A;  5JEA J;  5IP7 H;  4DK3 C;  2MO1 A;  1VQG A;  4DR6 Q;  3PIP A;  1XMO L;  4GN5 A;  1EUJ A;  2H5X A;  2RF4 A;  2YYZ A;  3KDF B;  3NBH B;  1M90 C;  1GM5 A;  4DR3 L;  3RZD H;  4LF8 L;  4DUY L;  3CPF A;  1V1Q A;  1YHB A;  4JI8 Q;  3RLF A;  4C3I H;  1WOC A;  3RN5 A;  3L7Z C;  2B3G A;  4MZ9 A;  3RNU A;  4BY7 H;  1GVP A;  3TRE A;  2Q2T A;  4L5S A;  1CKN A;  4ALP A;  4DAY B;  2WFW A;  4IFD G;  1KRS A;  4A3D G;  4JV5 L;  3FHW A;  4IJH A;  3F2B A;  3W1B A;  5HGQ A;  4DV0 L;  4C3H H;  4BXX H;  4LFA L;  2QGQ A;  4A3G G;  1VQP A;  4R4T A;  2RHS B;  1VQ6 A;  4PMW A;  1I94 Q;  3LGJ A;  3K80 C;  2Z0S A;  5C0X I;  4K0K Q;  1G29 1;  2OQ0 A;  4L5Q A;  4AQY Q;  1IBK Q;  1Q46 A;  3CC7 A;  4YWK A;  5M5W H;  1X54 A;  4WJ3 M;  2WP8 J;  3I7F A;  4R4I A;  2JA7 H;  3M7N A;  5C4X G;  1E22 A;  3PUZ A;  1YBY A;  4P74 A;  1U0L A;  1YIT A;  4GKK L;  3GDE A;  3G6E A;  4X66 L;  4NB3 A;  2JA8 G;  1QVC A;  4AYB E;  1VQL A;  4GNX B;  4UY8 C;  1YJ9 A;  4BBR G;  4A3G H;  3UDX A;  1PH7 A;  4OWT B;  4POG A;  3F1Z A;  4LF4 L;  1A63 A;  1YEZ A;  4A3C H;  5C0X J;  1SR3 A;  5K36 G;  4BA2 I;  1GO3 E;  4BY7 G;  4TQU S;  4J15 A;  3CC4 A;  2NN6 I;  1N33 L;  2NZO A;  2A1A A;  4A93 G;  2UU9 Q;  2VQE L;  4B3M L;  1H95 A;  2ID0 A;  4A3L H;  4DR5 L;  2VS1 A;  3JAM c;  1JJG A;  4Y52 H;  3KJP A;  4FDB A;  2IX1 A;  5JJL A;  2UU9 L;  1XNQ Q;  3RN2 A;  3CCQ A;  1GD7 A;  1VQI A;  2E8G A;  4JI4 L;  1XPU A;  2N78 A;  5JJK A;  4IO9 A;  1QVG A;  3S1M H;  4A3I G;  2AWN A;  3I4O A;  1K9M C;  1IBM L;  4DR4 L;  1OXS C;  2UXC Q;  3PV0 A;  4A3B H;  4A3C G;  2N8N A;  4JBW A;  4LUZ A;  4LW1 A;  2E2J H;  2JA6 G;  3HOW H;  4JI3 Q;  1P16 A;  3GTQ H;  4HJ8 A;  3WWV A;  1MJC A;  2JA7 G;  4KHP Q;  3UDG A;  2UXD Q;  4R4Q A;  4YHH L;  4IJL A;  3J81 c;  1EIF A;  2CFM A;  3J80 i;  1B8A A;  4DV3 L;  2JA8 H;  2CKZ B;  1R9T H;  2IT1 A;  1PH1 A;  3HOV H;  3TRZ A;  4GKJ Q;  3CCM A;  4OX9 Q;  4IFD I;  4QIW E;  3EN2 A;  3KJO A;  2C35 B;  1TWA H;  2K14 A;  2Z6K A;  1AE3 A;  2Y0S E;  3MXN B;  3J81 j;  4JBM A;  2UXD L;  1YHQ A;  3OTO L;  1EIY B;  1X3F A;  3S2H H;  4A3E G;  4JBJ A;  1WCM G;  3RLN A;  2QA4 A;  3CC2 A;  5IP9 H;  4HJ9 A;  3K0X A;  1KIX A;  3CP0 A;  1V43 A;  1L0W A;  2YTY A;  1A62 A;  1VQD A;  2K5H A;  2B29 A;  4X65 L;  2JA9 A;  5C44 G;  1VCI A;  2WB1 G;  1SN8 A;  3UDF A;  3KF8 B;  1Y1W G;  1VQ5 A;  4OXP A;  1PA6 A;  1Q12 A;  2K50 A;  3CCU A;  1QUQ B;  3I55 A;  4JG2 A;  5IT9 c;  2UUC L;  2MFI A;  2XGT A;  4O0A A;  2VZA A;  4O2D A;  4DR7 Q;  4DV1 L;  2JEA I;  4LUO A;  3MEF A;  5E7N A;  4JI8 L;  3GTL H;  3FKI G;  1KC8 C;  1PH8 A;  1J6Q A;  4LF4 Q;  4NXN Q;  2JA6 H;  3E9I A;  3T1H L;  1YIJ A;  2PQA A;  3W5O A;  1Q82 C;  3PO3 G;  1BVS A;  3HOU G;  1N9W A;  4PZ7 A;  1JJ2 A;  2IY5 B;  5IYC G;  1TWG H;  1Q86 C;  3KYH C;  1HZ9 A;  2B63 H;  1E24 A;  2WAQ G;  1E1O A;  4LWC A;  3T1Y Q;  4OWX B;  4DPG A;  1AE2 A;  3T1H Q;  2YTV A;  4HJ5 A;  3M4O H;  1C9O A;  1X56 A;  2AMC B;  2CWA A;  5FLM G;  5C4J H;  3CCJ A;  4LF9 Q;  1L1O C;  3PF4 A;  3HKS A;  1YJW A;  1IBM Q;  4POF A;  1NBW A;  2KCT A;  1N34 Q;  1YVC A;  1E1T A;  4GLA C;  1NTG A;  2MNA A;  3PO2 H;  5C4X H;  2CQO A;  3U4Z A;  3I4N H;  4JC0 A;  3ULL A;  1J5E L;  2I0Q A;  5FLM H;  1I50 H;  2RCN A;  3HOY G;  1NE3 A;  2VQE Q;  3PUW A;  4DR1 Q;  3K81 C;  2I5H A;  4H02 A;  3VDY A;  1LM0 A;  4A3J H;  2OTL A;  1CSP A;  4AH6 A;  5HY6 A;  1SMX A;  1L1O B;  2JE6 I;  2GVB A;  1VQM A;  1KXL A;  4X64 Q;  1A0I A;  3B6Y A;  4YWM A;  1HZB A;  3PUX A;  4QGU A;  3CMA A;  2NVQ H;  2D0P A;  2WAQ E;  1K8A C;  3PO2 G;  2ZJQ A;  4OX9 L;  4GOP C;  3GTP H;  1YZ6 A;  1VQB A;  3ICE A;  3NEM A;  4GNX A;  1GKH A;  4IPD A;  4QJF A;  1NY4 A;  4JI5 L;  5FJ8 G;  1N32 L;  1L1O A;  4DR2 L;  4DNI A;  4IPH A;  2KBN A;  4NPS A;  2FXQ A;  1XTD A;  5GRO A;  4A76 A;  4A3I H;  1G6P A;  1VQF A;  1Y14 B;  1G51 A;  2L15 A;  2F3I A;  4DK6 C;  1B70 B;  3HOV G;  2UXC L;  1PVO A;  1UE1 A;  2VY3 A;  2ASB A;  1WFQ A;  4DV1 Q;  2R93 H;  4JI4 Q;  1I94 L;  1UE6 A;  2ZTC A;  1OXT A;  4TVA B;  5M3F H;  1XNQ L;  1X55 A;  4XTC S;  1KHI A;  4IPC A;  1RIP A;  4IOC A;  4RG1 A;  4UPA A;  1PH6 A;  4EQ5 A;  1VQ8 A;  4WJ4 A;  5M3M H;  1PV4 A;  1VQH A;  3H3V H;  3UE1 A;  1E3P A;  4BA1 I;  1WYD A;  4A75 A;  3HFZ B;  1AH9 A;  1X3E A;  2UUB Q;  2ATW A;  2PI2 A;  2R7F A;  2OQK A;  4OWW B;  1VQ7 A;  1HNW L;  3KOJ A;  4DUY Q;  2CWP A;  4LF9 L;  2JQO A;  3K7U C;  4JI0 L;  4QY7 A;  2RHQ B;  5IY0 A;  3TQY A;  3CF5 A;  3L0O A;  1N32 Q;  1PH9 A;  4Y7N H;  3GTJ H;  3BZC A;  1CUK A;  1HR0 Q;  3S17 H;  2PQA B;  4X66 Q;  5ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...