1YHAA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhaA00
2OQKA 2B29A 2NVYH 4HJAA 3S1MH 4Y52H 3J7ZC 4GN3B 2KHIA 2YTXA 4GKKL 3W5OA 2UUCL 3S14H 1VQCA 2ATWA 2BH2A 4DV0L 4GKKQ 2UUCQ 3HOXG 1XPUA 4A3MG 3CMEA 3IRBA 4BY1H 5JJIA 4DV0Q 1H95A 4QJFA 2YV5A 4UP8A 1JJ2A 3CC7A 4ME3A 3I4NH 4GOPA 4A3JH 1I5FA 1OXUA 1Z47A 3CP0A 4YCVA 4O2DA 4Y7NH 4DV3L 3CCMA 2RF4A 3B6YA 1YIJA 4QIWE 5BR8L 1BBWA 3EIVA 5GROA 4A3BG 1E24A 1FL0A 2YYZA 4MZ9A 2CWAA 3GTJH 4AYBG 3TEHB 1HNZQ 3PUZA 1YBYA 4DV5L 3CCEA 4A3DG 2K4KA 3UDGA 4DV7L 1EIYB 1EYGA 3I56A 1P8LA 1JMCA 3HOVG 2WFWA 5C3EG 3L0OA 4DV5Q 2R92H 1L1OA 4DV7Q 4IJLA 1XNQL 1SE8A 4JV5Q 4UY8C 4LUZA 3PUVA 3T1YQ 1A63A 2MQHA 1NTGA 3CCQA 1HNXQ 3G4SA 4NXMQ 3EN2A 1E3PA 4LF9Q 3Q8DA 1EWIA 1X55A 4C2MH 5IP7H 1MKHA 2EIFA 2HIXA 1QVFA 4QL5A 4UP7A 3W1BA 3HOUG 1NMGA 5GQOA 1AH9A 2YTYA 1HR0L 1HJPA 1A62A 4DR4L 2IHEA 3HOYG 2Q2IA 2GVBA 3TREA 5FJ8G 2JA9A 4DV6Q 2AWNA 2D62A 3S1RH 2NZOA 1Y1WG 1X3EA 3FKIH 2NVXH 2KHJA 4LF5L 2F4VL 2CWPA 3OTOL 2E2IH 1E1OA 4JI0Q 4JBKA 4HIKA 4KHPL 2JEBI 4IPDA 5IP9H 4LF5Q 4YHHQ 1X9NA 3VDYA 2UU9L 4JBMA 3UDFA 5FLXc 4A3IH 4A3KH 1XMQQ 2B63H 5IYBG 1VQJA 1CKOA 2UU9Q 4QY7A 2N3SA 2HIVA 1LTLA 1PVOA 1N36L 1JB7A 3E9HA 3FP9A 4GNXA 4A3EH 1WOCA 1QZGA 1E7ZA 1WJJA 2N49A 1SN8A 2VQFL 5IWAQ 4TQUS 4LF8L 1I6HH 1HH2P 3A74A 2ZM6L 1PYSB 1VQFA 2VQFQ 4B3RL 3U4ZA 1VQHA 3K81C 1AE3A 1Z9FA 2DUDA 4LF8Q 2PI2A 2ZM6Q 4LWCA 1A8VA 1Q8KA 1KXLA 4B3RQ 5C44H 5C4XH 5LMUL 1YJ9A 3UE0A 1XNRQ 1L2FA 2I5HA 1SFOH 3E9IA 4BY1G 4DNIA 1R9TH 2VQEQ 5LMUQ 1UE1A 4P75A 1XPRA 2WAQG 4JOIA 4AIMA 2OTLA 3I4NG 4A3JG 3ICEA 3HKZE 4HIMA 1N9WA 1QUQA 1SMXA 1WFQA 5AJ3L 4DUZL 3RN5A 2ZJRA 2JA5H 2HHHL 1CKNB 5AJ3Q 4A75A 1S72A 1WYDA 4JYAL 2CFMA 4YWKA 3GO5A 4A4IA 3S24A 3F2CA 4DAMA 4IOCA 4DR7Q 4JYAQ 2UXDL 1SR3A 1TWGH 3PUYA 4GOPC 2UXDQ 3AQQA 5M5XH 4LF7Q 1XMOL 4P71A 1VQ7A 1X6OA 2R92G 2ZTCA 4IPCA 2L15A 1D7QA 5IYDH 1HR0W 2OCEA 1XMOQ 1PH3A 2I0QA 4LW1A 3CW2C 3CF5A 2UUBL 4DR6Q 1QVGA 4DR3Q 1EUJA 4KLKA 5DLQE 3GTKH 4JI5L 2UUBQ 1BVSA 4XIGS 4EQ5A 5M3FH 3M3YH 1X54A 5IYCH 3NELA 4JI5Q 2JA6H 3S1NH 2HQLA 5IP7G 2K14A 4GKJQ 1L1OC 2UXCL 4L5QA 3MXNB 1WCMH 2GN5A 4LFBL 3I4MH 1EQQA 3FKIG 3GTGH 1YHAA 1E1TA 2VZAA 2MO0A 4RG1A 4YCWA 4AQYQ 5IP9G 5GAHC 4R4TA 1IL2A 1G291 4DV2Q 3JC66 3ULPA 1B70B 1TXYA 3K7AH 3KLWA 4A3IG 4A3KG 2K5VA 2LXKA 3BJUA 1PH9A 4JI2L 2B63G 4L5RC 3KJPA 3DLLA 3F2BA 1UWVA 3J80c 4DV1L 1W2BA 1MIUA 2VS1A 3J81i 2PQAB 4A3EG 5HGQA 1M90C 1YHBA 3A0JA 3CCSA 4POGA 2NN6G 1PA6A 3GDEA 3CXCA 3PF4A 1VQBA 2IX1A 2F3IA 1YJNA 1QVCA 1JE5A 5E7NA 1HNWL 1YHQA 3J81c 3CQZH 2E2HH 4JI7L 3F2DA 4JBJA 4GNXC 1Q81C 1VCIA 5C44G 4DV3Q 4KHZA 4JI7Q 3GTQH 4MTNA 5C4XG 2NN6I 2K5NA 4YWLA 5BR8Q 4BBRH 1FJGL 4JI8L 3BU2A 2MFIA 3CD6A 1FJGQ 3A5UA 1OTCA 2ES2A 4AYBE 5J3BA 2JA5G 1YEZA 3U50C 5ELOA 4BXXG 5C4JH 3STBD 3CAMA 4TVAB 4QGUA 1XNQQ 4R4OA 2K5HA 3A5ZB 1YZ6A 5JEAJ 4JOIC 1HZBA 4JBWA 1KRSA 1KAWA 1SROA 2YTVA 1IXRA 4B3TL 1J6QA 4DR1L 2K50A 4UP9A 1PH6A 5IE8A 5IYDG 3OW2A 4B3TQ 4DR5L 4WJ4A 2LXJA 3CCVA 4DR1Q 1HR0Q 4RMFA 4DR4Q 4HJ7A 4IOAA 2WB1E 4WJ3M 3M7NA 1IYJB 3M4OH 3GD7A 2ASBA 3CMAA 3M4PA 5M3FG 2KENA 4X64L 2E5LL 3TS0A 5IYCG 2F4VQ 2E8GA 3OTOQ 2Y0SE 3PIPA 3HOWH 2JA6G 4KHPQ 3KDFB 2KCTA 3K80C 1TWCH 4OWXB 2E5LQ 2NVQH 2EQSA 3F8TA 4MNOA 1HZCA 1WCMG 5FLMG 1O7IA 5JEAG 3I4MG 1NBWA 3CC4A 1PYBA 1WI5A 3ZJYC 2D0OA 4B3SL 1PH8A 4NB3A 1XPOA 2DGYA 2WP8J 1Q46A 1K3RA 2AMCB 1P16A 1UE7A 4DUYL 1N36Q 1IBKL 2RCNA 4B3SQ 2PNHA 2Q2TA 1SLJA 1Y14B 2KBNA 5GADC 1E22A 1M1KC 1TWHH 1IBKQ 1K8GA 4AH6A 5M5YH 4R1JA 2GVAA 4JCVE 4H02A 1N34L 1HZ9A 1U0LA 3H0GH 1VQPA 4OX9L 3KFUA 4JC0A 3I2ZA 1N34Q 1V1QA 1XJVA 4PZ7A 1KRTA 4QQBX 3PIOA 1RIPA 2B3GA 2XGTA 1VQNA 1I3QH 4DR2L 2IY5B 3S1QH 4BY7H 1S40A 2A19A 3TS2A 2VW9A 2A8VA 4DR2Q 1ASZA 4OONA 4A3GH 1VQ6A 3CCUA 1X3GA 4A3FH 3WWVA 2WAQE 3UDXA 4DUZQ 1I94L 3H3VH 2BA0A 3CPWA 3M9BA 4JI1L 1Q12A 1KIXA 2HHHQ 1I94Q 4BBRG 2JA7H 1G51A 3L2PA 1K73C 3HKZG 2Z0SA 3KF6B 4YWMA 1MJEA 4PZ8A 3KJOA 3CPFA 4DV4L 3H15A 1X56A 4A3LH 1IBML 3AFQA 4DAYB 4DV4Q 1UEBA 3NEMA 5HY6A 3AYHB 4JG2A 1Q86C 1PV4A 3I4OA 4XTCS 5EAYA 1KC8C 1IBMQ 5M3MH 3MEFA 2ZTDA 1S3OA 1I50H 3PF5A 3RLOA 2C35B 1CKMA 1Q1BA 3G48A 2I5LX 2VUMH 3K0XA 3RLFA 2A1AA 1Q7YC 1JT8A 4B3ML 1EIFA 3S2DH 1IBLL 3LGJA 4GLVB 1PH4A 2VY3A 3J80i 4B3MQ 2UXCQ 4DR7L 1VQ4A 4LFBQ 1Q1EA 1UE6A 2BH8A 1OXXK 2H5XA 3M4QA 4C3HH 4GOPB 4A93H 1Q82C 1N8RC 1GO3E 2N78A 3RZDH 3F1ZA 5IY0A 2ID0A 3PUWA 4HJ8A 4LUVA 3J7A5 1VQAA 3HOWG 4GN4B 4R4CA 4R4IA 4BA1I 2JA8H 1DGSA 1QZHA 4GLXA 2ZTEA 3EBEA 2R6GA 1N33L 2BA1A 2VNUD 1CKNA 4JI2Q 2CKZB 1Y1VH 1VQMA 3PSIA 1VQOA 1N33Q 1J5EL 1VQKA 4LF4L 4K0KL 4DV1Q 3CC2A 1D8LA 3PO3H 3CCLA 5JJLA 2UXBL 3HOZH 2EXDA 1J5EQ 1L1OB 1EFWA 4LF4Q 2Z6KA 5LMNW 4OWWB 2R7ZH 1PHJA 3TRZA 4UPAA 2UXBQ 3E0EA 4DK3C 1GD7A 5GAEC 2IX0A 1KD1C 4DPGA 1VQLA 2UUAL 4P73A 3CCJA 1OXTA 4X62L 3PGZA 3JAMc 3U58A 2CCZA 3H0GG 1HNWQ 4LNQA 4X62Q 1HZAA 4ALPA 4BBSH 3UE1A 3ULJA 3SGIA 2JEAI 3STBC 2ZJQA 2KCMA 3OYYA 4BY7G 2MNAA 1ASYA 4JI8Q 2RHQB 4LF6L 1FVIA 4YY3L 4GN5A 2R93H 4X6AH 2JK8A 4A3GG 3AFPA 2I5MX 4LF6Q 4YY3Q 4A3FG 5H1SE 1UE5A 2OQ0A 1FGUA 3KYHC 4HJ9A 3S16H 2HT1A 2R7DA 3RZOH 1YVCA 4HIOA 2JA7G 3DM3A 1HNZL 3U4VA 5C0XJ 3L7ZC 2R7FA 2Q2UA 4GNXB 1BKBA 3I7FA 2N8NA 2LSSA 2PQAA 3GTPH 4A3LG 1G6PA 3UDIA 3H3VI 2Q2HA 4O0AA 1XTDA 2PMZE 1KL9A 1VQ9A 4JV5L 1YJWA 5M3MG 4OO1G 1K0RA 4DR5Q 3T1YL 1PH7A 2NVTH 1NY4A 4HIDA 4IJHA 3PO2H 4YCUA 3GTLH 2VL6A 1HNXL 3AEVA 5K36G 4NXML 2VUMG 4POFA 4LF9L 3NBHB 4X66L 4X64Q 2IT1A 3KOJA 4FDBA 4X66Q 1VQGA 4BA2I 3RR5A 5M5WH 2WB1G 4L5TA 4OO1I 4A3CH 4DV6L 1LYLA 4OWTB 4IFDJ 4A93G 4JI3L 1GM5A 3KF8B 1QUQB 5C0XG 2QEXA 2Y0SG 1PH5A 4JI0L 3PCOB 4JI3Q 4GS3A 4YHHL 2PI2E 4DUYQ 2JA8G 5ELNA 5IT9c 4IO9A 1LM0A 3RLNA 3ULLA 4C3IH 2ZJPA 1VQ5A 1C9OA 2CQOA 3J81j 1XMQL 1X3FA 4L5SA 4EX5A 1EQRA 4DK6C 1K8AC 2AWOA 3BZCA 4BXXH 1Y1VG 1U5KA 3K7UC 3PV0A 1KHIA 3HFZB 3G6EA 5C0XI 1NJIC 4OX9Q 4HJ5A 3PO3G 2XTIA 5LMNL 3HOZG 2R7ZG 1JJCB 4X65L 1K9MC 5IWAL 3G71A 5LMNQ 3HOXH 2QGQA 1CSPA 4A3MH 3S15H 4DKAC 4X65Q 4PG3A 4IFDG 1AE2A 4APVA 1W3SA 1K83H 1RL2A 2FXQA 3NENA 4BBSG 2F52A 3PUXA 1NMFA 3HKSA 4LFAL 1KQSA 2Z6KC 2MO1A 1GKHA 1L0WA 3KDFA 1C7YA 1XNRL 4JI1Q 2IHFA 2JQOA 1GVPA 1VQIA 4GLAC 2JJQA 4LFAQ 2VQEL 1OXSC 4A3BH 1PH1A 2R93G 4IPHA 1TWFH 4A3DH 4IFDI 2JE6I 1VQEA 3I55A 2NZHA 3HOVH 5C3EH 1PH2A 3T1HL 3RN2A 1VQ8A 1N32L 3D0FA 3TQYA 4PMWA 1NE3A 4NPSA 3T1HQ 3GTMH 3FHWA 2K52A 1LUZA 1N32Q 2OTJA 4P72A 1BBUA 3S17H 3CCRA 4LF7L 5GAGC 4PZ6A 4IPGA 4A76A 1PFSA 1JJGA 4P74A 1CSQA 4OXPA 3HOUH 3RNUA 1IBLQ 4DR6L 2OWOA 3M85A 4DR3L 3HOYH 1TWAH 1V9PA 1B7YB 2V1CC 4KI0A 4LFCL 5FJ8H 4R4QA 1Y1WH 4JI6L 3PO2G 1T9HA 1V43A 2D0PA 2YU9H 4LFCQ 3D31A 1X65A 4JI6Q 2QA4A 3K8AA 1CUKA 1YNXA 1MJCA 4NXNL 4GKJL 1OXVA 2AKWB 1YITA 1SRUA 1YI2A 5JJKA 3JAMi 2RHSB 4C3JH 5IYBH 4NXNQ 3GTOH 4LUOA 1VS0A 4A3CG 4J15A 1A0IA 3BZKA 2AHOB 5FLMH 3KF6A 1VQDA 1B8AA 4K0KQ 4AQYL 4JI4L 1EOVA 2K75A 3W1GA 3ER0A 3S2HH 4DV2L 4JI4Q 1IZ6A 3ERSX 1C0AA 2UUAQ 2ALYB 2E2JH
chains in the Genus database with same CATH superfamily
3S1MH 4K14A 4Y52H 2UUCL 1BXTA 5FLXE 5JVH3 2BE5D 1H9SB 3TMEA 2JA7B 4KN4C 3CC7A 4ME3A 4GOPA 5D3IB 1I5FA 1OXUA 1CQFA 4PV1C 2ICIA 5IODA 2NTSA 2RF4A 4FP5D 4A3BG 1FL0A 2ZXPA 3AMUA 1NUCA 1H9KA 1O7ZA 2CWAA 2YYZA 1UUPA 1A3UA 3CCEA 1NR2A 2K4KA 1JMCA 1P8LA 1I4RA 2B2VC 2WFWA 3ITPA 3L0OA 4DV5Q 2KECA 4DV7Q 4IJLA 2O4XA 4U68A 2NWGA 2RBMA 1A63A 3BDCA 3EN2A 1DOMA 3Q8DA 2K32A 2HIXA 2A5HA 4QL5A 1NMGA 4R8NA 2YTYA 3WOEA 2A6ED 1I4QA 3TREA 5IT9L 4DV6Q 2AWNA 3SHLA 2EYMA 1BBXC 1X3EA 4IUUA 4EQPA 2CWPA 3A7AB 3HOZB 4JBKA 4HIKA 5IP9H 4A3KH 1LTID 3MHBA 4QY7A 4HR7B 1ICWA 3NWSA 1N36L 1JB7A 4CGYB 1BF4A 1WOCA 2HDMA 1QZGA 1WJJA 4R9WA 1SN8A 5IWAQ 3HKZB 1I6HH 2ZM6L 1SYCA 3SK6A 1PYSB 4UHVA 3U4ZA 1VQHA 3K81C 2VB2X 2DUDA 4KJNA 4B3RL 1KXLA 1JCKB 3NBHA 5C44H 5LMUL 1YJ9A 1SFOH 1MSHA 2K33A 4DNIA 3P1HA 1UE1A 1TR5A 4AIMA 1RHPA 1GXDC 1S5ED 4A3JG 1J9OA 3HKZE 4HIMA 3KF8A 1B50A 4IALA 2F0KA 4KY7A 2JA5H 1ILPA 4EQNA 4JYAL 1BNZA 5EQ0A 3S24A 3J81E 1WTRA 5KNBA 2UXDL 1ESFA 1BR9A 4GOPC 3PUYA 4QMGA 1LABA 1TS5A 3GV3A 3TZUA 1TS4A 4GZYC 4IPCA 5ELBA 2L15A 2JYOA 2OCEA 2QF7A 4HCSA 4LW1A 4KLKA 1FNUA 1BVSA 4B9WA 4XIGS 4EQ5A 3M3YH 1STAA 1X54A 3NELA 2KOLA 4JI5Q 2K14A 2L0CA 5M5YB 4JPBW 5L37A 4LFBL 1OO9B 1ML0D 3U9OA 3KLSX 1EQQA 3FKIG 1YHAA 3JAML 4RG1A 4AQYQ 1RCVD 2MO0A 1I4PA 3IKJA 4YCWA 1L0YB 1CK1A 1G291 1PZKD 1BCPD 1TXYA 3K7AH 4A3IG 3VR5A 1PH9A 3S15B 3HRZC 3DLLA 1BOSA 1UWVA 4A3FB 1MIUA 2VS1A 2PQAB 2BOSA 4A3EG 4CJ1B 3KLRA 3A0JA 3CCSA 3K57A 3CXCA 2PPBC 5C5MA 1EWCA 2RA4A 1YJNA 3FVQA 4AYBB 1HNWL 4A3DB 5T1GA 3CQZH 2E2HH 4JI7L 4JBJA 1F9QA 1PLFA 1VCIA 4OHJA 4FO2A 5JPMC 4DV3Q 1I50B 5BR8Q 3VYUA 3K5MA 2H4OA 1FGBD 2X69A 1FJGQ 4KKTA 2XNAC 5LHY1 5D65A 5D3DA 4RWSC 1OTCA 2NYZD 2X6GA 1SYFA 4AYBE 4ID6A 5ELOA 1XNQQ 2K5HA 5JEAJ 4RKLA 2KHSA 1B2TA 2JA8B 1KRSA 2KVMA 2YU9B 3BYYB 2D9UA 2SDFA 2KUMA 1PH6A 5IE8A 2LXJA 3CCVA 4DR1Q 4WJ3M 2WB1E 3F2UA 1IYJB 4KKUA 3GD7A 5CV8A 2Q8IB 3M4PA 2ASBA 4X64L 3M4OH 1IYVA 1WTOA 5IYCG 2F4VQ 3HGBA 3HOWH 3PIPA 3HEJA 1D5ZC 3K80C 1TWCH 2F0NA 4MNOA 1HZCA 1I4HA 1K8MA 2D0OA 5FO9B 1PH8A 1XPOA 2WP8J 2AMCB 1P16A 1SLJA 1HQRD 5GADC 1E22A 3FRPB 4F88A 1DCZA 4AH6A 5CC4A 4FXKC 2A69C 2EY6A 2AQ2B 2B2TA 4R1JA 1SAPA 1HXYD 3W3AA 4O42A 1V1QA 4XXEA 5EBCA 1RIPA 2XGTA 3D6WA 2IY5B 1WTHA 5EKIA 3GP7A 2VW9A 4DR2Q 1BQQT 1K28A 3RD4A 4OONA 2RDHA 3BVMA 3CCUA 2QEJC 3H3VH 4DUZQ 2QDBA 3UDXA 1WD1A 1I94L 3J7YW 2BA0A 1SNPA 2HQEA 1IL8A 1HHVA 4ZK9B 5KYIA 3FDTA 1ILQA 3HKZG 3KF6B 3CPFA 3TZDA 3Q23A 3A8KE 4DV4Q 2H1EA 1UEBA 3NEMA 5M5WB 3AYHB 4KTAA 3I4OA 5EAYA 1KC8C 5M3MH 5EJWA 3VR2A 5CR3A 1CKMA 1Q1BA 3G48A 2E2DC 3K0XA 3CKIB 3LWUA 4K6DA 1YNND 3OMCA 4G4KA 4GLVB 4IUNA 1PH4A 4B3MQ 2B63B 1UE6A 1L0XB 4C3HH 1YNJC 1B9MA 4HJ8A 1LT6D 4R4IA 3J80L 4I7AA 1Y1VH 3OOCA 3PSIA 1VQOA 4RHSA 1DXMA 4K0KL 1HQMC 4PNYA 1HFNA 1M8AA 2CW0D 4IURA 5JJLA 2UXBL 2EXDA 1L1OB 2B2WA 3CRKC 2Z6KA 1EFWA 4OWWB 4DK0A 3K6OA 3GTQH 1GD7A 1TWFB 4EQOA 4X62L 3JAMc 1CT1D 2MHVA 1SNQA 3BYTB 5IT9E 1HZAA 4BBSH 3SDZA 3UE1A 3ULJA 2JEAI 3GTMB 2KCMA 2FFKB 3OYYA 2XSCA 3QR8A 1F2MA 1SMYC 4H7BA 4JI8Q 1ASYA 2G9DA 4GN5A 2B2TC 1TWGB 2PMZB 4LF6Q 3I91A 3R2TA 4A3FG 1IW7C 1E0BA 3S16H 3O13A 1TWAB 4DNTB 1HNZL 4DFAA 3MXGA 4Z9CB 5M3FB 1VF7A 3GTPH 4A3LG 4ZUIA 1G6PA 2LS01 3GTOB 2SNMA 4O0AA 1XTDA 2PMZE 4JV5L 1YJWA 2NVTH 3D8GA 5FLXL 4IJHA 1PFBA 3TP7A 4NXML 3S2HB 2VUMG 4LF9L 2R3ZA 1ENFA 2XRSD 4BA2I 2KCNA 2WB1G 4OO1I 4A3CH 1H9RA 4FF4A 1B3QA 1PH5A 4JI0L 2PI2E 2JA8G 4IO9A 3DMUA 4C3IH 4V190 1VQ5A 2CQOA 5NUCA 1EQRA 4DK6C 1B4OA 1HPCA 3HFZB 4OX9Q 1KTKA 5C0XI 2XTIA 2F3VA 3PIP3 2EY2A 4DAVA 1K9MC 4I7ZC 4K8IA 1PRTB 4YIJA 2DY7A 5I4DA 4IFDG 4APVA 1D1IA 4LJZC 3I73A 3SR1A 4FF3A 2FXQA 1K83H 2R92B 2LMCB 1CM9A 2B2WC 2Z6KC 1EFID 1GKHA 1SXTA 3VA7A 2O5JC 1C7YA 5C4JB 2IHFA 3I4LA 4A3BH 4DF7A 1NR4A 4Q5VA 2JE6I 1HRJA 2WIIB 4WFN3 3T1HL 4CJ2C 3IL8A 4WRDA 3D0FA 1NE3A 3FHWA 1D2BA 1K0SA 3A56A 1G6ZA 1BBUA 3R2IA 3S17H 3Q24A 1FR3A 1VF5C 4P74A 2P5ZX 2NVQB 3RNUA 2EY1A 4L6TB 3M85A 4DR7Q 2V1CC 4LFCL 4R4QA 1HA6A 4RA8A 1G8ZD 2FJ2A 1X65A 1S5CD 2F0VA 4GKJL 1YNXA 3M7GA 4CDCC 4P2CB 5KEEA 3SE0A 4NXNQ 1VS0A 1E2ZA 3BZKA 2IX3A 5FLMH 2AQ3B 3MXPA 1ZKOA 4HSVA 4JI4L 5C4XB 4FVMA 1BCPB 2Z8LA 4DV2L 2EPBA 2CH4W 1RKNA 1KAAA 1C0AA 5I9OA 4BXXG 3QOLA 4V0BA 3R3OA 2NVYH 4HJAA 2E2JH 1SE4A 2KHIA 1RODA 1EYCA 3W5OA 4B9XA 5DEHA 3DWAA 2ATWA 2SEBD 2BH2A 5G3LD 4DV0L 2UUCQ 1S5DD 2CQAA 2HCCA 1JQYD 3IRBA 2LKVA 5C5LA 4UP8A 1Y69U 4A3JH 1MI2A 4YCVA 3CP0A 1MD2D 4O1NA 1STHA 3VA5A 3MFYA 1YIJA 1H9JA 3EIVA 3GTKB 1C8CA 2MPMA 1DYQA 3GTJH 3MZ5A 1YBYA 1EY7A 3K0YA 2MJ8A 1B44D 5C3EG 3D4DA 2MUYA 4FNFA 3I4MB 2L4NA 2VB3X 4NW2A 3PUVA 1CHPD 3NP8A 4JVZA 1NTGA 2Y0SB 4MTKA 1EWIA 1X55A 4C2MH 1PZJD 2EIFA 1QVFA 3W1BA 1JWSD 2IJ0A 1HR0L 2QW7A 2IHEA 3HOYG 4DR4L 2GVBA 3S1RH 2D62A 3FKIH 5CBAE 2NVXH 5JOBA 3OTOL 5C3WA 3PO3B 4KHPL 1E1OA 1EU3A 1B9NA 2KEEA 4YHHQ 3VDYA 2UU9L 4A3IH 4J6HA 5FLXc 2FMCA 3HZXA 2N3SA 1PRTC 1C4QA 4PMBA 3OIQA 4A3EH 4DAPA 4G7OC 5JPNC 4OL7A 2VQFL 3RMHA 4LF8L 1HH2P 3CHBD 1ESRA 1HFGA 2HUGA 2ZM6Q 1Q8IA 4B3RQ 2R61A 4ZRZA 1O78A 1TQOA 3UE0A 1XNRQ 3J80E 3E9IA 4BY1G 3P20A 2VQEQ 5LMUQ 4P75A 2WAQG 1NAPA 1N9WA 1PDQA 4DK1A 1EL0A 1AEXA 2NTTA 2HHHL 4HTHA 2CFMA 2Q8RE 3Q6SA 4A4IA 4RGOS 1DM0B 4DAMA 4JYAQ 1HA5A 3PO2B 3TP5A 2UXDQ 5IIFA 1KNEA 5M5XH 1XMOL 3MVVA 4MIUA 2R92G 1QCBD 2UUBL 3CW2C 3CF5A 4E6IA 1WTPA 4DR6Q 4DR3Q 1PRTF 2C5CA 1FNWA 5DLQE 5CV9A 2GA4B 5IYCH 1HTPA 5ELCA 3KLSA 4CDDC 2GN5A 3H0GB 4RAUC 1SYEA 3DXJC 5ISRA 3H6MA 5AFWA 1SE3A 1IL2A 4BY7B 5FKAC 3ULPA 1O80A 4DXGA 1KABA 2K5VA 4JI2L 1PMRA 3T51B 3A54A 4A3GB 4H13C 5T1IA 4OEMB 1W2BA 3J81i 2B8GA 1UNSA 4H0LC 3EFXD 1M90C 1G91A 5JVG3 2IX1A 2F3IA 1MSGA 3N6RA 1PTOC 3FEWX 1T5EA 1YHQA 3J81c 3F2DA 3HOVB 2EJMA 1JOKA 1WTWA 2RQXA 4KHZA 3OWEB 4JI7Q 4MTNA 2WACA 5C4XG 2NN6I 1CHQD 1TY2A 1STGA 2N88A 2Z6BA 4YWLA 5KRUA 2F0LA 4HMIA 4F8MA 3S2DB 2RDGA 2ES2A 1EZ6A 4NDXA 3D6CA 3HOUB 3STBD 4TVAB 1CI3M 2V4DA 4JBWA 1SROA 1LT3D 1IXRA 1JICA 1H9SA 5IYDG 4QF4A 4DR5L 2EVBA 4RMFA 1SEBD 1DOLA 2R7ZB 5CV5A 2E5LL 2E8GA 2KQ3A 3KDFB 5CV7A 4OWXB 1PTOF 2EQSA 3F8TA 2XVSA 1DONA 5FLMG 1O7IA 3D3RA 3I4MG 1NBWA 1WI5A 2DGYA 2NZ1D 3BG3A 1ENCA 2R93B 1M1KC 1TWHH 1ZYRD 3NQTA 5E1FA 5M5YH 3SEBA 1N34L 1HZ9A 3I2ZA 4KKSA 1X3PA 1XJVA 1KRTA 4QQBX 1SJED 1EY8A 1I3QH 2EZVA 2A19A 3TS2A 2A8VA 3X3NA 4DA2A 2JSOA 4A3FH 3BDOA 1II3A 3SVMA 1VDZA 4IN3A 4IUVA 4BBRG 1I94Q 3N52A 3L2PA 2Z0SA 4YWMA 1EYDA 4WJWA 3H15A 1KDBA 4A3LH 1IBML 1Y8PB 2Z1CA 5FK9C 4HSPA 3PQIA 4ZAIA 2A73B 4K6LA 3NWTA 3MEFA 1I50H 3RLOA 3K5LA 5IGBA 2I5LX 2VUMH 1JT8A 2F0WA 1X32A 1RD9D 5K5PA 2UXCQ 2VY3A 3ONAB 4RHRA 1SNDA 3NK9A 2H5XA 1OXXK 1N8RC 1UAPA 1QB5D 3RZDH 4LUVA 4R4CA 2JA8H 1QZHA 4GLXA 1D5XC 2ENBA 2ZTEA 2VXWA 4KD3A 1N33L 2VNUD 2EYOA 1VQMA 4LF4L 4DV1Q 3KK7A 1STNA 4NMZA 4CKEA 5LMNW 3MXUA 3TRZA 1UEAB 1KLUD 2UXBQ 2OF1A 3E0EA 4KMUC 2UUAL 1SFOB 3CCJA 5JAVA 3PGZA 4IFDH 3U58A 3H0GG 2G9HD 4X62Q 1GHKA 1EEFD 3NSWA 2XRQD 2JA5B 2K6AA 5I6WA 4L8JA 4BY7G 2MNAA 4RGMA 2RHQB 1BO0A 1FVIA 4X6AH 2AQ1B 1A3TA 4A3GG 1B3AA 2I5MX 4XQQA 3KYHC 3SXHA 5I2YA 2R7DA 3K5NA 3T4AC 2K7VA 3RZOH 4OELB 2O5IC 4HIOA 1A3VA 2JA7G 2A68C 3U4VA 4GNXB 3M3YB 2PQAA 4LK1C 2WKDA 2FINB 5TSSA 2Q2HA 4PQXA 4OO1G 1LTBD 1PH7A 2B39A 1NY4A 1Y8OB 5FO7B 4YCUA 2F0JA 3A55A 1VMCA 1VMPA 1EY5A 3KOJA 4FDBA 1V1PB 1LO5D 2CH4A 1VQGA 5E3FA 3RR5A 5M5WH 1RJTA 1HUMA 1GUNA 4L5TA 4DV6L 1LYLA 1IKLA 5C0XG 1QUQB 1GM5A 1KLGD 1SDFA 4DUYQ 5IT9c 1LM0A 1QWYA 2HD3A 3P75A 4N8FA 3ULLA 4L5SA 3J81j 2BCOA 3I4NB 2FHTA 2AWOA 3BZCA 4BXXH 3QIAA 4Y7NB 1B53A 1NJIC 2K1BA 3CQZB 4HJ5A 2E2HB 5LMNL 3HOZG 2R7ZG 2ZXOA 5IWAL 2G5DA 4DKAC 3ND9A 3HKSA 3TBIB 1KQSA 3U9SA 1L0WA 4IZ8A 4JI1Q 2JQOA 1VQIA 3MWYW 2R93G 2F0QA 1V1PA 1TWFH 4N8X1 3E0JA 3SK4A 5C3EH 3EROA 4KV6A 1VQ8A 5J1ZA 4NPSA 3T1HQ 3GTMH 4OIKA 2OTJA 4P72A 3M4OB 4M8AA 1KDCA 2EJFC 5CGKA 4IPGA 4A76A 1JJGA 1CSQA 5ELFA 1U9RA 5DNFA 1IBLQ 3HOYH 1TWAH 1V9PA 2E76C 1T9HA 1G2SA 2D0PA 4Q0FA 2B2UA 3VR3A 3D31A 4LFCQ 2EXZA 3K8AA 1CUKA 3MEHA 4ILWA 4XQNA 4ZYSA 3JAMi 2RSNA 3GTOH 3M4YA 5IGCA 1PXUA 5JEAH 3KF6A 1VQDA 5BN3A 4AQYL 3W1GA 3ER0A 3S2HH 3HS0C 1GUOA 2QCPX 4JI4Q 1R9TB 1TY0A 3ERSX 2ALYB 2WV6D 2OQKA 3SK5A 2XWBB 3J7ZC 4QIWB 4GKKL 3S14H 1VQCA 2EYFA 2SNSA 5LL6X 3S9WA 3CMEA 4BY1H 4DV0Q 1H95A 4QJFA 2YV5A 3DM1A 1Z47A 2N55A 4O2DA 4C1NI 4DV3L 1SYGA 4M1UB 4QIWE 1ET6A 5GROA 5BR8L 2Z4HA 2EYLA 4L63B 3D4WA 4AYBG 3TEHB 3SK8A 4A3DG 2JA6B 5IGEA 3UDGA 1EIYB 1EYGA 3NQIA 1KDAA 4S3SA 2R92H 1L1OA 1WCMB 1LTRD 1XNQL 2A6HC 2F0IA 4UY8C 4LUZA 3GTGB 3T1YQ 1CFMA 3CCQA 1HNXQ 2EDGA 2SOBA 2PW7A 3TDQA 4UP7A 5GQOA 1WTXA 4DNRB 1HJPA 1SE2A 3H94A 4BS9A 2Q2IA 1TIID 2JA9A 4B08A 2NZOA 2DNCA 4LF5L 2KHJA 2F4VL 2E2IH 2A68D 1JB3A 1X9NA 4G7HC 2XWJB 1XMQQ 5IYBG 4UDUC 1VQJA 4LMQD 2UU9Q 2K01A 4QCLA 3VYSA 4RFBA 2HIVA 1LTLA 1W6KA 2B2UC 1G2TA 3E9HA 1Z7TA 1F2ZA 1D1KA 4TQUS 3A74A 3ERQA 3KUPA 1VQFA 2VQFQ 1AE3A 1QNKA 1Z9FA 4LF8Q 2PI2A 4LWCA 1A8VA 3WOFA 1Q8KA 4HN7A 5C4XH 1A6XA 3G7LA 1GUGA 3T56B 4JOIA 2KCCA 2A69D 4X3TA 3I4NG 3TN2A 1SMXA 1WFQA 5AJ3L 3RN5A 4DUZL 2RKSA 2MGSA 2ZJRA 1CKNB 2I07B 3UI2A 1WYDA 4ZUJA 4A75A 1AFPA 3GO5A 4IOCA 3AQQA 4LF7Q 4P71A 1VQ7A 1LTSD 1HUNA 5IYDH 4JK1C 1XMOQ 1PTOH 1PH3A 1HR0W 3GTKH 2UUBQ 3K58A 3J7AV 1HCZA 3KBXA 3S1NH 1HTLD 2HQLA 4ZKBB 5IP7G 1L1OC 4CKCA 1PYWD 4C3IB 3MXNB 3BVGA 3H09A 3I4MH 4RCNA 4MN3A 5I6YA 1E1TA 2VZAA 3K5OA 1CZWA 2BE5C 3JC66 1B70B 1TT2A 2LXKA 2B63G 3KJPA 1SJHD 3F2BA 3J80c 1YNJD 1K83B 2EJGC 3MA2B 2K5QA 2F0UA 2NN6G 2F0OA 1PA6A 3PF4A 4RGNA 1LLRD 5E7NA 4ULLA 3DEOA 4XYQA 4MHEA 3A7LA 3GV6A 1JOOA 2AUJD 1I4GA 4K5WA 2J4XA 3QB3A 2K5NA 4BBRH 4JI8L 3QWNA 2EE1A 2MFIA 3CD6A 4R8IA 4X3KA 2L11A 3S17B 5J3BA 1EQVA 1YEZA 1SNOA 4QGUA 4A93B 1U4LA 1F9SA 2A6EC 1SMYD 2IPKD 4JOIC 1HZBA 2C9OA 3DEPA 2YTVA 5DM63 4B3TL 2RCFA 1IW7D 2K50A 1IHZA 4UP9A 2PNRC 3OW2A 4WJ4A 1B1ZA 2OEOA 1EY4A 4HJ7A 1STYA 2IW3A 3IFTA 5M3FG 2Y0SE 2JA6G 2F0GA 2KCTA 2E5LQ 5IGDA 4LAAA 4J8QA 3WDNA 1WCMG 4KK7A 5JEAG 4K2KA 4ABNA 3GQBA 4B3SL 4NB3A 1Q46A 1N36Q 1IBKL 2RCNA 2PNHA 5IOCA 1EY6A 4HAEA 1Y14B 2KBNA 2DNEA 4CBVA 1K8GA 2GVAA 4JCVE 4H02A 4OX9L 3H0GH 1BDOA 1F2LA 1N34Q 4PZ7A 3H91A 3Q0AA 2B3GA 1FNVA 3S1QH 4BY7H 3V2TA 1ZXTA 1EOTA 2PZUA 1TKWB 5ELDA 4A3GH 5FO8B 3WWVA 3FPPA 3CPWA 1Q12A 1TU2B 3EJIA 2NB0A 2JA7H 3GTLB 1K73C 5EKKA 4X3UA 1NNXA 3KJOA 4DU9A 4C2MB 3I3CA 4DAYB 1XTCD 1MHWC 4JG2A 1PV4A 1IBMQ 4XTCS 1LTTD 4OO1H 1LT5D 2ZTDA 3PF5A 3DHQA 2X6LA 2NVXB 5E4XA 2PW5A 3RLFA 2A1AA 1SYDA 1EIFA 3S2DH 1BCPC 1CQVA 4A3IB 2TMPA 4DR7L 5EPKA 4LFBQ 4TKOB 4NP5A 4GOPB 3M4QA 1DD2A 5C0XH 2N78A 3BZDB 3PUWA 2M00A 1ICFB 1STEA 3HOXB 1DGSA 4A3MB 4U673 1SBBB 2CKZB 1N33Q 1J5EL 2K5DA 1VQKA 4XDXA 3CC2A 3LX0A 5CORA 3HOZH 4G7ZC 4LF4Q 2R7ZH 1E2WA 2ICEC 4TRDA 5BN4A 4DK3C 3LNNA 5GAEC 4DPGA 3BS1A 4KD4A 4P73A 3TP8A 1OXTA 1QILA 1HNWQ 4IUQA 3ZYYX 1SYBA 4YY3L 2R93H 1DJRD 3OWFA 1X3QA 3AFPA 4X3SA 5IGGA 1BCPF 2E74C 5M5XB 4QUCA 4ZCKA 1UE5A 2OQ0A 4HCEA 2HT1A 2L5TA 1Y1WB 5FOBB 3L7ZC 2Q2UA 5J22A 1A15A 5C4ZA 3I7FA 2LSSA 3UDIA 3H3VI 4WORA 3I70A 4C3JB 1VQ9A 3Q22A 1K0RA 3A8IE 3T16A 1F2YA 2BDNA 3D4RA 2VL6A 3AEVA 1V1OA 4POFA 3NBHB 4X66L 4X64Q 2IT1A 2F1MA 2HDLA 3S1MB 1QOHA 4I65A 3VR4A 4ZLTF 1K3BC 2DJGC 4JI3L 4IFDJ 4A93G 3KF8B 1AP0A 4EGVA 2Y0SG 1S5BD 1W6JA 5KNDA 2M2LA 4YHHL 5ELNA 1JE4A 5JJIA 4XT1B 1C9OA 3TP6A 1Q3LA 1U5KA 1KHIA 1XWEA 3G6EA 2MP1A 1EYAA 3PO3G 1JJCB 4CJ0B 4X65L 3G71A 5LMNQ 2QGQA 1CSPA 3S15H 4PG3A 1O7LA 3NENA 1RL2A 2PYKA 1PRTD 2F52A 3PUXA 4LFAL 1R4QB 2MO1A 4RCOA 3W2DA 1IKMA 3KDFA 1XNRL 3OIPA 1GVPA 4GLAC 2JJQA 1EY9A 2KJXA 2VQEL 4A3DH 3NTIA 1VQEA 5CBEE 3I55A 1YNNC 4F7XA 1N32L 1WVLA 4RKBA 3I8ZA 2K52A 1EIHA 2B2YA 4ODGA 3KBGA 1E2VA 5EGTA 3CCRA 2NBFA 5GAGC 3C46A 3E3XA 3QO2A 4A3KB 1PFSA 1LT4D 4G57A 1MGSA 4DR6L 4DR3L 1S4ZA 3PO2G 1LACA 2EYPA 2K03A 4JI6L 1EZ8A 1V43A 2EY5A 2WINB 2CW0C 2YU9H 4QB4A 5CV6A 1I6HB 1OXVA 1YITA 1SRUA 1YI2A 1TWHB 1F9PA 2RHSB 5IYBH 2TSSA 4IQZA 4LUOA 4J15A 1A0IA 3NBIA 5C44B 1B8AA 4K0KQ 4NKLA 2K75A 1SNCA 2K04A 2E75C 1I3QB 1IZ6A 3EVQA 1GUWA 2B29A 2K28A 4UAIA 5KYLA 4GN3B 4FXDA 4CKBA 2Q8TA 2YTXA 2O2LD 4RH6A 4GKKQ 2JP1A 3HOXG 1XPUA 1NSNS 2RSOA 4A3MG 1JJ2A 3I4NH 3HP3A 3AB9A 4XYOA 5IGFA 4Y7NH 1GUSA 1XX8A 1C48A 3T13A 3CCMA 3B6YA 1H9MA 1BBWA 4OGQC 1E24A 4MZ9A 1PTOD 1HNZQ 4K5XA 3PUZA 4DV5L 2VUMB 2CVRA 4DV7L 1CA5A 3I56A 2F3WA 3HOVG 3NE5B 1JOQA 1SE8A 4JV5Q 1RDPD 2WB1B 5C3XA 2MQHA 4F87A 2Z4IA 5I2XA 3G4SA 3RZDB 4NXMQ 1E3PA 4LF9Q 3K7AB 5IP7H 1MKHA 4N9PA 4C1NK 3HOUG 2F0TA 1AH9A 3MFGA 1A62A 5FJ8G 1MJEA 1ONLA 1Y1WG 2B2YC 1TVXA 4IUPA 2PZWA 1V8QA 4JI0Q 2JEBI 4IPDA 2IWHA 4LF5Q 3OHXC 4FYDA 4JBMA 1U4RA 3UDFA 3C1FA 2B63H 4JW0A 4C3JG 1CKOA 1JWUD 2KA7A 2L12A 4DN4M 1PVOA 4GNXA 3FP9A 1GOZA 2LY7A 1E7ZA 2F0MA 2NN6H 2N49A 3CU7A 5EBDA 1I6VC 1LV9A 1PFMA 3RUZA 2JN4A 1RTOA 3VYTA 5EPJA 1L2FA 2I5HA 3RZOB 1GUTA 1A2UA 1R9TH 1XPRA 3URYA 2OTLA 3OW7A 4KHVA 3ICEA 2J0TD 1QUQA 3QOJA 1EY0A 5AJ3Q 1S72A 2NUCA 2A74C 1JWMD 2OXPA 4YWKA 1FYCA 5LL6S 1Z6HA 3F2CA 1SR3A 2F0DA 3HOWB 1TWGH 1RTNA 5D14A 1TWCB 1R4PB 1X6OA 2F0FA 3OMGA 5JJZA 2ZTCA 3R8BA 1D7QA 2K5WA 3BDLA 2I0QA 1EIGA 1QVGA 1EUJA 5DAUA 5E4WC 5A2QL 4JI5L 2K05A 1A2TA 5ELEA 5M3FH 2AUKA 2JA6H 5K36H 3V96A 1CZGA 4GKJQ 1JR0D 2M9VA 2UXCL 4L5QA 3A8JE 1WCMH 1DOKA 1KNAA 5C6AA 3GTGH 4KJOA 3K59A 5IP9G 5GAHC 4R4TA 2RVLA 4FF1A 4DV2Q 3KLWA 4A3KG 3BJUA 4EVOA 4L5RC 1EWHA 4DV1L 5J39A 1QE6A 5HGQA 4XT3B 1YHBA 4J1MA 4TSSA 4POGA 3GDEA 3DWPA 1VQBA 4ZQ3A 1QVCA 1JE5A 4PMCA 1PFNA 1CA6A 1AZPA 1Q81C 4GNXC 5C44G 5C3EB 1QNUA 3I90A 5M3MB 2J7ZA 2PZTA 1RF2D 1FJGL 1GJXA 3BU2A 2IL8A 2DJFC 3X3MA 3A5UA 5EKLA 1CTMA 4ME5A 3MTSA 4K8JA 2JA5G 3U50C 2QDLA 5C4JH 3CAMA 3L3OC 1Q90A 4C3HB 4R4OA 3A5ZB 1YZ6A 3HOYB 3CRLC 1KAWA 1AW7A 5G3LF 2L1BA 2ZT9C 2EYHA 1D6EC 1J6QA 2F0EA 4DR1L 1Y1VB 5M9OA 4B3TQ 4HMJA 5I9PA 2WKCA 2PCFB 1HR0Q 4DR4Q 1PZID 4IOAA 3M7NA 1ET9A 2L9HA 1TS2A 3CMAA 2KENA 3TS0A 3OTOQ 4KHPQ 3GTQB 3HG9A 1EQTA 1U4MA 2NVQH 1SSOA 1IYUA 3OPOA 1M4VA 3EQLC 2DN8A 2F0PA 3CC4A 1PYBA 3ZJYC 4BBSB 2I46A 4IUTA 1WD0A 4RGTA 1K3RA 3L9AX 1UE7A 4DUYL 3S14B 1WTVA 4B3SQ 2Q2TA 1JC7A 1IBKQ 3C3LA 4BY1B 1ZEQX 2WAQB 2EYJA 4CDEC 3KFUA 3DUZA 1U0LA 1VQPA 5DM73 3BVZA 1MBYA 4JC0A 3S16B 5F2DA 3PIOA 1VQNA 4DR2L 1S40A 5COYA 1S5FD 1ASZA 3GTPB 4ZKCB 4CDFC 1TS3A 3I72A 1VQ6A 1X3GA 2WAQE 3M9BA 4JI1L 1KIXA 2HHHQ 3P7JA 2NVTB 5C4HA 3JAME 1G51A 4CHTB 3C2PA 4PZ8A 4DV4L 2QILA 1X56A 1WTQA 3AFQA 2B8FA 1SNMA 3VYRA 5HY6A 1Q86C 1BUVT 1S3OA 4N9TA 3G6JB 2D5DA 2C35B 4HEDA 1F77A 1XXGA 1Q7YC 2E2IB 4B3ML 2XN9C 1IBLL 3LGJA 3J80i 3QG1A 1VQ4A 1Q1EA 2BH8A 4A93H 3EA6A 3IAYA 3NPPA 1Q82C 1GO3E 1T5XD 3F1ZA 5IY0A 2ID0A 3J7A5 1VQAA 1Y8NB 4GN4B 3HOWG 4XQJA 4BA1I 4QUFA 3H3VC 3EBEA 2R6GA 1NCVA 2BA1A 1CKNA 4JI2Q 1LTGD 1J8IA 4OIJA 1D5MC 5KGUA 3QJYA 1D8LA 3PO3H 3CCLA 2RDFA 3NUCA 1J5EQ 4BWGB 1AZQA 2ZXRA 4A3BB 1PHJA 1STBA 4UPAA 2DY8A 3J81L 3E6ZX 2IX0A 1KD1C 1VQLA 1I4XA 5CMDA 5A35A 2CCZA 4LNQA 4ALPA 5KIXA 1F9RA 3SGIA 3STBC 2ZJQA 3MXNA 3FMCA 4LF6L 2JK8A 3NTKA 2D2CC 4YY3Q 5H1SE 4KY6A 1FGUA 4HJ9A 4DXFA 1PTOB 1YVCA 3PMFA 3DM3A 3R93A 5C0XJ 2R7FA 5CV4A 1BKBA 2N8NA 1EEID 3S1NB 2KEDA 4KY5A 1KL9A 5M3MG 4DR5Q 3T1YL 4H44C 4HIDA 3PO2H 3E5SA 3GTLH 1HNXL 5K36G 2FMMA 3IFDA 1XYIA 4X66Q 1GHJA 2E2JB 1ZYRC 2NVYB 2A6HD 2F0HA 2CHBD 4OWTB 4C3HG 4K5VA 2QEXA 3PCOB 4JI3Q 4GS3A 3RLNA 2ZJPA 1XMQL 1X3FA 3ND8A 4DGZA 4EX5A 1K8AC 4A3JB 1Y1VG 1U4PA 3T53B 3K7UC 3PV0A 2EOTA 2F03A 5A2QE 3C1EA 3OSOA 1QG7A 2PO4A 3GTJB 3HOXH 4BBRB 4A3MH 4X65Q 1AE2A 5KNCA 1W3SA 3LWEA 2F4IA 4BBSG 1NMFA 2B2VA 2JXMB 4LFAQ 1OXSC 1JORA 3AU7A 1PH1A 2XIWA 4IPHA 4IFDI 5BN5A 1AN8A 2QKIC 2Z9HA 3FPUB 2NZHA 3HOVH 2BDOA 1DZ1A 1PH2A 3RN2A 1QJOA 3PIO3 5CYUA 3TQYA 3S1RB 4PMWA 3FKIB 1LUZA 1N32Q 3NXWA 3DWQA 4LF7L 4PZ6A 3MC0B 1O7YA 1EU4A 4OXPA 4FF2A 3HOUH 2OWOA 1FD7D 5EPLA 5FJ8H 1B7YB 5HURA 4KI0A 1Y1WH 4A3EB 1K8OA 2HCIA 3TSSA 4JI6Q 2QA4A 4NXNL 1MJCA 2AKWB 3MAQA 2OT2A 5JJKA 4C3JH 3NHHA 5HGTA 4A3CG 3NTHA 4KN7C 2AHOB 2LFNA 4C56C 2PQEA 2F0SA 3V05A 1EOVA 3J7AF 4FXGC 1ENAA 1LTAD 4C3IG 4DAYA 4K2LA 3S1QB 3VR6A 2UUAQ 2L55A
chains in the Genus database with same CATH topology
2OQKA 2B29A 2NVYH 4HJAA 3S1MH 4Y52H 3J7ZC 4GN3B 2KHIA 2YTXA 4GKKL 3W5OA 2UUCL 3S14H 1VQCA 2ATWA 2BH2A 4DV0L 4GKKQ 2UUCQ 3HOXG 1XPUA 4A3MG 3CMEA 3IRBA 4BY1H 5JJIA 4DV0Q 1H95A 4QJFA 2YV5A 4UP8A 1JJ2A 3CC7A 4ME3A 3I4NH 4GOPA 4A3JH 1I5FA 1OXUA 1Z47A 3CP0A 4YCVA 4O2DA 4Y7NH 4DV3L 3CCMA 2RF4A 3B6YA 1YIJA 4QIWE 5BR8L 1BBWA 3EIVA 5GROA 4A3BG 1E24A 1FL0A 2YYZA 4MZ9A 2CWAA 3GTJH 4AYBG 3TEHB 1HNZQ 3PUZA 1YBYA 4DV5L 3CCEA 4A3DG 2K4KA 3UDGA 4DV7L 1EIYB 1EYGA 3I56A 1P8LA 1JMCA 3HOVG 2WFWA 5C3EG 3L0OA 4DV5Q 2R92H 1L1OA 4DV7Q 4IJLA 1XNQL 1SE8A 4JV5Q 4UY8C 4LUZA 3PUVA 3T1YQ 1A63A 2MQHA 1NTGA 3CCQA 1HNXQ 3G4SA 4NXMQ 3EN2A 1E3PA 4LF9Q 3Q8DA 1EWIA 1X55A 4C2MH 5IP7H 1MKHA 2EIFA 2HIXA 1QVFA 4QL5A 4UP7A 3W1BA 3HOUG 1NMGA 5GQOA 1AH9A 2YTYA 1HR0L 1HJPA 1A62A 4DR4L 2IHEA 3HOYG 2Q2IA 2GVBA 3TREA 5FJ8G 2JA9A 4DV6Q 2AWNA 2D62A 3S1RH 2NZOA 1Y1WG 1X3EA 3FKIH 2NVXH 2KHJA 4LF5L 2F4VL 2CWPA 3OTOL 2E2IH 1E1OA 4JI0Q 4JBKA 4HIKA 4KHPL 2JEBI 4IPDA 5IP9H 4LF5Q 4YHHQ 1X9NA 3VDYA 2UU9L 4JBMA 3UDFA 5FLXc 4A3IH 4A3KH 1XMQQ 2B63H 5IYBG 1VQJA 1CKOA 2UU9Q 4QY7A 2N3SA 2HIVA 1LTLA 1PVOA 1N36L 1JB7A 3E9HA 3FP9A 4GNXA 4A3EH 1WOCA 1QZGA 1E7ZA 1WJJA 2N49A 1SN8A 2VQFL 5IWAQ 4TQUS 4LF8L 1I6HH 1HH2P 3A74A 2ZM6L 1PYSB 1VQFA 2VQFQ 4B3RL 3U4ZA 1VQHA 3K81C 1AE3A 1Z9FA 2DUDA 4LF8Q 2PI2A 2ZM6Q 4LWCA 1A8VA 1Q8KA 1KXLA 4B3RQ 5C44H 5C4XH 5LMUL 1YJ9A 3UE0A 1XNRQ 1L2FA 2I5HA 1SFOH 3E9IA 4BY1G 4DNIA 1R9TH 2VQEQ 5LMUQ 1UE1A 4P75A 1XPRA 2WAQG 4JOIA 4AIMA 2OTLA 3I4NG 4A3JG 3ICEA 3HKZE 4HIMA 1N9WA 1QUQA 1SMXA 1WFQA 5AJ3L 4DUZL 3RN5A 2ZJRA 2JA5H 2HHHL 1CKNB 5AJ3Q 4A75A 1S72A 1WYDA 4JYAL 2CFMA 4YWKA 3GO5A 4A4IA 3S24A 3F2CA 4DAMA 4IOCA 4DR7Q 4JYAQ 2UXDL 1SR3A 1TWGH 3PUYA 4GOPC 2UXDQ 3AQQA 5M5XH 4LF7Q 1XMOL 4P71A 1VQ7A 1X6OA 2R92G 2ZTCA 4IPCA 2L15A 1D7QA 5IYDH 1HR0W 2OCEA 1XMOQ 1PH3A 2I0QA 4LW1A 3CW2C 3CF5A 2UUBL 4DR6Q 1QVGA 4DR3Q 1EUJA 4KLKA 5DLQE 3GTKH 4JI5L 2UUBQ 1BVSA 4XIGS 4EQ5A 5M3FH 3M3YH 1X54A 5IYCH 3NELA 4JI5Q 2JA6H 3S1NH 2HQLA 5IP7G 2K14A 4GKJQ 1L1OC 2UXCL 4L5QA 3MXNB 1WCMH 2GN5A 4LFBL 3I4MH 1EQQA 3FKIG 3GTGH 1YHAA 1E1TA 2VZAA 2MO0A 4RG1A 4YCWA 4AQYQ 5IP9G 5GAHC 4R4TA 1IL2A 1G291 4DV2Q 3JC66 3ULPA 1B70B 1TXYA 3K7AH 3KLWA 4A3IG 4A3KG 2K5VA 2LXKA 3BJUA 1PH9A 4JI2L 2B63G 4L5RC 3KJPA 3DLLA 3F2BA 1UWVA 3J80c 4DV1L 1W2BA 1MIUA 2VS1A 3J81i 2PQAB 4A3EG 5HGQA 1M90C 1YHBA 3A0JA 3CCSA 4POGA 2NN6G 1PA6A 3GDEA 3CXCA 3PF4A 1VQBA 2IX1A 2F3IA 1YJNA 1QVCA 1JE5A 5E7NA 1HNWL 1YHQA 3J81c 3CQZH 2E2HH 4JI7L 3F2DA 4JBJA 4GNXC 1Q81C 1VCIA 5C44G 4DV3Q 4KHZA 4JI7Q 3GTQH 4MTNA 5C4XG 2NN6I 2K5NA 4YWLA 5BR8Q 4BBRH 1FJGL 4JI8L 3BU2A 2MFIA 3CD6A 1FJGQ 3A5UA 1OTCA 2ES2A 4AYBE 5J3BA 2JA5G 1YEZA 3U50C 5ELOA 4BXXG 5C4JH 3STBD 3CAMA 4TVAB 4QGUA 1XNQQ 4R4OA 2K5HA 3A5ZB 1YZ6A 5JEAJ 4JOIC 1HZBA 4JBWA 1KRSA 1KAWA 1SROA 2YTVA 1IXRA 4B3TL 1J6QA 4DR1L 2K50A 4UP9A 1PH6A 5IE8A 5IYDG 3OW2A 4B3TQ 4DR5L 4WJ4A 2LXJA 3CCVA 4DR1Q 1HR0Q 4RMFA 4DR4Q 4HJ7A 4IOAA 2WB1E 4WJ3M 3M7NA 1IYJB 3M4OH 3GD7A 2ASBA 3CMAA 3M4PA 5M3FG 2KENA 4X64L 2E5LL 3TS0A 5IYCG 2F4VQ 2E8GA 3OTOQ 2Y0SE 3PIPA 3HOWH 2JA6G 4KHPQ 3KDFB 2KCTA 3K80C 1TWCH 4OWXB 2E5LQ 2NVQH 2EQSA 3F8TA 4MNOA 1HZCA 1WCMG 5FLMG 1O7IA 5JEAG 3I4MG 1NBWA 3CC4A 1PYBA 1WI5A 3ZJYC 2D0OA 4B3SL 1PH8A 4NB3A 1XPOA 2DGYA 2WP8J 1Q46A 1K3RA 2AMCB 1P16A 1UE7A 4DUYL 1N36Q 1IBKL 2RCNA 4B3SQ 2PNHA 2Q2TA 1SLJA 1Y14B 2KBNA 5GADC 1E22A 1M1KC 1TWHH 1IBKQ 1K8GA 4AH6A 5M5YH 4R1JA 2GVAA 4JCVE 4H02A 1N34L 1HZ9A 1U0LA 3H0GH 1VQPA 4OX9L 3KFUA 4JC0A 3I2ZA 1N34Q 1V1QA 1XJVA 4PZ7A 1KRTA 4QQBX 3PIOA 1RIPA 2B3GA 2XGTA 1VQNA 1I3QH 4DR2L 2IY5B 3S1QH 4BY7H 1S40A 2A19A 3TS2A 2VW9A 2A8VA 4DR2Q 1ASZA 4OONA 4A3GH 1VQ6A 3CCUA 1X3GA 4A3FH 3WWVA 2WAQE 3UDXA 4DUZQ 1I94L 3H3VH 2BA0A 3CPWA 3M9BA 4JI1L 1Q12A 1KIXA 2HHHQ 1I94Q 4BBRG 2JA7H 1G51A 3L2PA 1K73C 3HKZG 2Z0SA 3KF6B 4YWMA 1MJEA 4PZ8A 3KJOA 3CPFA 4DV4L 3H15A 1X56A 4A3LH 1IBML 3AFQA 4DAYB 4DV4Q 1UEBA 3NEMA 5HY6A 3AYHB 4JG2A 1Q86C 1PV4A 3I4OA 4XTCS 5EAYA 1KC8C 1IBMQ 5M3MH 3MEFA 2ZTDA 1S3OA 1I50H 3PF5A 3RLOA 2C35B 1CKMA 1Q1BA 3G48A 2I5LX 2VUMH 3K0XA 3RLFA 2A1AA 1Q7YC 1JT8A 4B3ML 1EIFA 3S2DH 1IBLL 3LGJA 4GLVB 1PH4A 2VY3A 3J80i 4B3MQ 2UXCQ 4DR7L 1VQ4A 4LFBQ 1Q1EA 1UE6A 2BH8A 1OXXK 2H5XA 3M4QA 4C3HH 4GOPB 4A93H 1Q82C 1N8RC 1GO3E 2N78A 3RZDH 3F1ZA 5IY0A 2ID0A 3PUWA 4HJ8A 4LUVA 3J7A5 1VQAA 3HOWG 4GN4B 4R4CA 4R4IA 4BA1I 2JA8H 1DGSA 1QZHA 4GLXA 2ZTEA 3EBEA 2R6GA 1N33L 2BA1A 2VNUD 1CKNA 4JI2Q 2CKZB 1Y1VH 1VQMA 3PSIA 1VQOA 1N33Q 1J5EL 1VQKA 4LF4L 4K0KL 4DV1Q 3CC2A 1D8LA 3PO3H 3CCLA 5JJLA 2UXBL 3HOZH 2EXDA 1J5EQ 1L1OB 1EFWA 4LF4Q 2Z6KA 5LMNW 4OWWB 2R7ZH 1PHJA 3TRZA 4UPAA 2UXBQ 3E0EA 4DK3C 1GD7A 5GAEC 2IX0A 1KD1C 4DPGA 1VQLA 2UUAL 4P73A 3CCJA 1OXTA 4X62L 3PGZA 3JAMc 3U58A 2CCZA 3H0GG 1HNWQ 4LNQA 4X62Q 1HZAA 4ALPA 4BBSH 3UE1A 3ULJA 3SGIA 2JEAI 3STBC 2ZJQA 2KCMA 3OYYA 4BY7G 2MNAA 1ASYA 4JI8Q 2RHQB 4LF6L 1FVIA 4YY3L 4GN5A 2R93H 4X6AH 2JK8A 4A3GG 3AFPA 2I5MX 4LF6Q 4YY3Q 4A3FG 5H1SE 1UE5A 2OQ0A 1FGUA 3KYHC 4HJ9A 3S16H 2HT1A 2R7DA 3RZOH 1YVCA 4HIOA 2JA7G 3DM3A 1HNZL 3U4VA 5C0XJ 3L7ZC 2R7FA 2Q2UA 4GNXB 1BKBA 3I7FA 2N8NA 2LSSA 2PQAA 3GTPH 4A3LG 1G6PA 3UDIA 3H3VI 2Q2HA 4O0AA 1XTDA 2PMZE 1KL9A 1VQ9A 4JV5L 1YJWA 5M3MG 4OO1G 1K0RA 4DR5Q 3T1YL 1PH7A 2NVTH 1NY4A 4HIDA 4IJHA 3PO2H 4YCUA 3GTLH 2VL6A 1HNXL 3AEVA 5K36G 4NXML 2VUMG 4POFA 4LF9L 3NBHB 4X66L 4X64Q 2IT1A 3KOJA 4FDBA 4X66Q 1VQGA 4BA2I 3RR5A 5M5WH 2WB1G 4L5TA 4OO1I 4A3CH 4DV6L 1LYLA 4OWTB 4IFDJ 4A93G 4JI3L 1GM5A 3KF8B 1QUQB 5C0XG 2QEXA 2Y0SG 1PH5A 4JI0L 3PCOB 4JI3Q 4GS3A 4YHHL 2PI2E 4DUYQ 2JA8G 5ELNA 5IT9c 4IO9A 1LM0A 3RLNA 3ULLA 4C3IH 2ZJPA 1VQ5A 1C9OA 2CQOA 3J81j 1XMQL 1X3FA 4L5SA 4EX5A 1EQRA 4DK6C 1K8AC 2AWOA 3BZCA 4BXXH 1Y1VG 1U5KA 3K7UC 3PV0A 1KHIA 3HFZB 3G6EA 5C0XI 1NJIC 4OX9Q 4HJ5A 3PO3G 2XTIA 5LMNL 3HOZG 2R7ZG 1JJCB 4X65L 1K9MC 5IWAL 3G71A 5LMNQ 3HOXH 2QGQA 1CSPA 4A3MH 3S15H 4DKAC 4X65Q 4PG3A 4IFDG 1AE2A 4APVA 1W3SA 1K83H 1RL2A 2FXQA 3NENA 4BBSG 2F52A 3PUXA 1NMFA 3HKSA 4LFAL 1KQSA 2Z6KC 2MO1A 1GKHA 1L0WA 3KDFA 1C7YA 1XNRL 4JI1Q 2IHFA 2JQOA 1GVPA 1VQIA 4GLAC 2JJQA 4LFAQ 2VQEL 1OXSC 4A3BH 1PH1A 2R93G 4IPHA 1TWFH 4A3DH 4IFDI 2JE6I 1VQEA 3I55A 2NZHA 3HOVH 5C3EH 1PH2A 3T1HL 3RN2A 1VQ8A 1N32L 3D0FA 3TQYA 4PMWA 1NE3A 4NPSA 3T1HQ 3GTMH 3FHWA 2K52A 1LUZA 1N32Q 2OTJA 4P72A 1BBUA 3S17H 3CCRA 4LF7L 5GAGC 4PZ6A 4IPGA 4A76A 1PFSA 1JJGA 4P74A 1CSQA 4OXPA 3HOUH 3RNUA 1IBLQ 4DR6L 2OWOA 3M85A 4DR3L 3HOYH 1TWAH 1V9PA 1B7YB 2V1CC 4KI0A 4LFCL 5FJ8H 4R4QA 1Y1WH 4JI6L 3PO2G 1T9HA 1V43A 2D0PA 2YU9H 4LFCQ 3D31A 1X65A 4JI6Q 2QA4A 3K8AA 1CUKA 1YNXA 1MJCA 4NXNL 4GKJL 1OXVA 2AKWB 1YITA 1SRUA 1YI2A 5JJKA 3JAMi 2RHSB 4C3JH 5IYBH 4NXNQ 3GTOH 4LUOA 1VS0A 4A3CG 4J15A 1A0IA 3BZKA 2AHOB 5FLMH 3KF6A 1VQDA 1B8AA 4K0KQ 4AQYL 4JI4L 1EOVA 2K75A 3W1GA 3ER0A 3S2HH 4DV2L 4JI4Q 1IZ6A 3ERSX 1C0AA 2UUAQ 2ALYB 2E2JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQK A;  2B29 A;  2NVY H;  4HJA A;  3S1M H;  4Y52 H;  3J7Z C;  4GN3 B;  2KHI A;  2YTX A;  4GKK L;  3W5O A;  2UUC L;  3S14 H;  1VQC A;  2ATW A;  2BH2 A;  4DV0 L;  4GKK Q;  2UUC Q;  3HOX G;  1XPU A;  4A3M G;  3CME A;  3IRB A;  4BY1 H;  5JJI A;  4DV0 Q;  1H95 A;  4QJF A;  2YV5 A;  4UP8 A;  1JJ2 A;  3CC7 A;  4ME3 A;  3I4N H;  4GOP A;  4A3J H;  1I5F A;  1OXU A;  1Z47 A;  3CP0 A;  4YCV A;  4O2D A;  4Y7N H;  4DV3 L;  3CCM A;  2RF4 A;  3B6Y A;  1YIJ A;  4QIW E;  5BR8 L;  1BBW A;  3EIV A;  5GRO A;  4A3B G;  1E24 A;  1FL0 A;  2YYZ A;  4MZ9 A;  2CWA A;  3GTJ H;  4AYB G;  3TEH B;  1HNZ Q;  3PUZ A;  1YBY A;  4DV5 L;  3CCE A;  4A3D G;  2K4K A;  3UDG A;  4DV7 L;  1EIY B;  1EYG A;  3I56 A;  1P8L A;  1JMC A;  3HOV G;  2WFW A;  5C3E G;  3L0O A;  4DV5 Q;  2R92 H;  1L1O A;  4DV7 Q;  4IJL A;  1XNQ L;  1SE8 A;  4JV5 Q;  4UY8 C;  4LUZ A;  3PUV A;  3T1Y Q;  1A63 A;  2MQH A;  1NTG A;  3CCQ A;  1HNX Q;  3G4S A;  4NXM Q;  3EN2 A;  1E3P A;  4LF9 Q;  3Q8D A;  1EWI A;  1X55 A;  4C2M H;  5IP7 H;  1MKH A;  2EIF A;  2HIX A;  1QVF A;  4QL5 A;  4UP7 A;  3W1B A;  3HOU G;  1NMG A;  5GQO A;  1AH9 A;  2YTY A;  1HR0 L;  1HJP A;  1A62 A;  4DR4 L;  2IHE A;  3HOY G;  2Q2I A;  2GVB A;  3TRE A;  5FJ8 G;  2JA9 A;  4DV6 Q;  2AWN A;  2D62 A;  3S1R H;  2NZO A;  1Y1W G;  1X3E A;  3FKI H;  2NVX H;  2KHJ A;  4LF5 L;  2F4V L;  2CWP A;  3OTO L;  2E2I H;  1E1O A;  4JI0 Q;  4JBK A;  4HIK A;  4KHP L;  2JEB I;  4IPD A;  5IP9 H;  4LF5 Q;  4YHH Q;  1X9N A;  3VDY A;  2UU9 L;  4JBM A;  3UDF A;  5FLX c;  4A3I H;  4A3K H;  1XMQ Q;  2B63 H;  5IYB G;  1VQJ A;  1CKO A;  2UU9 Q;  4QY7 A;  2N3S A;  2HIV A;  1LTL A;  1PVO A;  1N36 L;  1JB7 A;  3E9H A;  3FP9 A;  4GNX A;  4A3E H;  1WOC A;  1QZG A;  1E7Z A;  1WJJ A;  2N49 A;  1SN8 A;  2VQF L;  5IWA Q;  4TQU S;  4LF8 L;  1I6H H;  1HH2 P;  3A74 A;  2ZM6 L;  1PYS B;  1VQF A;  2VQF Q;  4B3R L;  3U4Z A;  1VQH A;  3K81 C;  1AE3 A;  1Z9F A;  2DUD A;  4LF8 Q;  2PI2 A;  2ZM6 Q;  4LWC A;  1A8V A;  1Q8K A;  1KXL A;  4B3R Q;  5C44 H;  5C4X H;  5LMU L;  1YJ9 A;  3UE0 A;  1XNR Q;  1L2F A;  2I5H A;  1SFO H;  3E9I A;  4BY1 G;  4DNI A;  1R9T H;  2VQE Q;  5LMU Q;  1UE1 A;  4P75 A;  1XPR A;  2WAQ G;  4JOI A;  4AIM A;  2OTL A;  3I4N G;  4A3J G;  3ICE A;  3HKZ E;  4HIM A;  1N9W A;  1QUQ A;  1SMX A;  1WFQ A;  5AJ3 L;  4DUZ L;  3RN5 A;  2ZJR A;  2JA5 H;  2HHH L;  1CKN B;  5AJ3 Q;  4A75 A;  1S72 A;  1WYD A;  4JYA L;  2CFM A;  4YWK A;  3GO5 A;  4A4I A;  3S24 A;  3F2C A;  4DAM A;  4IOC A;  4DR7 Q;  4JYA Q;  2UXD L;  1SR3 A;  1TWG H;  3PUY A;  4GOP C;  2UXD Q;  3AQQ A;  5M5X H;  4LF7 Q;  1XMO L;  4P71 A;  1VQ7 A;  1X6O A;  2R92 G;  2ZTC A;  4IPC A;  2L15 A;  1D7Q A;  5IYD H;  1HR0 W;  2OCE A;  1XMO Q;  1PH3 A;  2I0Q A;  4LW1 A;  3CW2 C;  3CF5 A;  2UUB L;  4DR6 Q;  1QVG A;  4DR3 Q;  1EUJ A;  4KLK A;  5DLQ E;  3GTK H;  4JI5 L;  2UUB Q;  1BVS A;  4XIG S;  4EQ5 A;  5M3F H;  3M3Y H;  1X54 A;  5IYC H;  3NEL A;  4JI5 Q;  2JA6 H;  3S1N H;  2HQL A;  5IP7 G;  2K14 A;  4GKJ Q;  1L1O C;  2UXC L;  4L5Q A;  3MXN B;  1WCM H;  2GN5 A;  4LFB L;  3I4M H;  1EQQ A;  3FKI G;  3GTG H;  1YHA A;  1E1T A;  2VZA A;  2MO0 A;  4RG1 A;  4YCW A;  4AQY Q;  5IP9 G;  5GAH C;  4R4T A;  1IL2 A;  1G29 1;  4DV2 Q;  3JC6 6;  3ULP A;  1B70 B;  1TXY A;  3K7A H;  3KLW A;  4A3I G;  4A3K G;  2K5V A;  2LXK A;  3BJU A;  1PH9 A;  4JI2 L;  2B63 G;  4L5R C;  3KJP A;  3DLL A;  3F2B A;  1UWV A;  3J80 c;  4DV1 L;  1W2B A;  1MIU A;  2VS1 A;  3J81 i;  2PQA B;  4A3E G;  5HGQ A;  1M90 C;  1YHB A;  3A0J A;  3CCS A;  4POG A;  2NN6 G;  1PA6 A;  3GDE A;  3CXC A;  3PF4 A;  1VQB A;  2IX1 A;  2F3I A;  1YJN A;  1QVC A;  1JE5 A;  5E7N A;  1HNW L;  1YHQ A;  3J81 c;  3CQZ H;  2E2H H;  4JI7 L;  3F2D A;  4JBJ A;  4GNX C;  1Q81 C;  1VCI A;  5C44 G;  4DV3 Q;  4KHZ A;  4JI7 Q;  3GTQ H;  4MTN A;  5C4X G;  2NN6 I;  2K5N A;  4YWL A;  5BR8 Q;  4BBR H;  1FJG L;  4JI8 L;  3BU2 A;  2MFI A;  3CD6 A;  1FJG Q;  3A5U A;  1OTC A;  2ES2 A;  4AYB E;  5J3B A;  2JA5 G;  1YEZ A;  3U50 C;  5ELO A;  4BXX G;  5C4J H;  3STB D;  3CAM A;  4TVA B;  4QGU A;  1XNQ Q;  4R4O A;  2K5H A;  3A5Z B;  1YZ6 A;  5JEA J;  4JOI C;  1HZB A;  4JBW A;  1KRS A;  1KAW A;  1SRO A;  2YTV A;  1IXR A;  4B3T L;  1J6Q A;  4DR1 L;  2K50 A;  4UP9 A;  1PH6 A;  5IE8 A;  5IYD G;  3OW2 A;  4B3T Q;  4DR5 L;  4WJ4 A;  2LXJ A;  3CCV A;  4DR1 Q;  1HR0 Q;  4RMF A;  4DR4 Q;  4HJ7 A;  4IOA A;  2WB1 E;  4WJ3 M;  3M7N A;  1IYJ B;  3M4O H;  3GD7 A;  2ASB A;  3CMA A;  3M4P A;  5M3F G;  2KEN A;  4X64 L;  2E5L L;  3TS0 A;  5IYC G;  2F4V Q;  2E8G A;  3OTO Q;  2Y0S E;  3PIP A;  3HOW H;  2JA6 G;  4KHP Q;  3KDF B;  2KCT A;  3K80 C;  1TWC H;  4OWX B;  2E5L Q;  2NVQ H;  2EQS A;  3F8T A;  4MNO A;  1HZC A;  1WCM G;  5FLM G;  1O7I A;  5JEA G;  3I4M G;  1NBW A;  3CC4 A;  1PYB A;  1WI5 A;  3ZJY C;  2D0O A;  4B3S L;  1PH8 A;  4NB3 A;  1XPO A;  2DGY A;  2WP8 J;  1Q46 A;  1K3R A;  2AMC B;  1P16 A;  1UE7 A;  4DUY L;  1N36 Q;  1IBK L;  2RCN A;  4B3S Q;  2PNH A;  2Q2T A;  1SLJ A;  1Y14 B;  2KBN A;  5GAD C;  1E22 A;  1M1K C;  1TWH H;  1IBK Q;  1K8G A;  4AH6 A;  5M5Y H;  4R1J A;  2GVA A;  4JCV E;  4H02 A;  1N34 L;  1HZ9 A;  1U0L A;  3H0G H;  1VQP A;  4OX9 L;  3KFU A;  4JC0 A;  3I2Z A;  1N34 Q;  1V1Q A;  1XJV A;  4PZ7 A;  1KRT A;  4QQB X;  3PIO A;  1RIP A;  2B3G A;  2XGT A;  1VQN A;  1I3Q H;  4DR2 L;  2IY5 B;  3S1Q H;  4BY7 H;  1S40 A;  2A19 A;  3TS2 A;  2VW9 A;  2A8V A;  4DR2 Q;  1ASZ A;  4OON A;  4A3G H;  1VQ6 A;  3CCU A;  1X3G A;  4A3F H;  3WWV A;  2WAQ E;  3UDX A;  4DUZ Q;  1I94 L;  3H3V H;  2BA0 A;  3CPW A;  3M9B A;  4JI1 L;  1Q12 A;  1KIX A;  2HHH Q;  1I94 Q;  4BBR G;  2JA7 H;  1G51 A;  3L2P A;  1K73 C;  3HKZ G;  2Z0S A;  3KF6 B;  4YWM A;  1MJE A;  4PZ8 A;  3KJO A;  3CPF A;  4DV4 L;  3H15 A;  1X56 A;  4A3L H;  1IBM L;  3AFQ A;  4DAY B;  4DV4 Q;  1UEB A;  3NEM A;  5HY6 A;  3AYH B;  4JG2 A;  1Q86 C;  1PV4 A;  3I4O A;  4XTC S;  5EAY A;  1KC8 C;  1IBM Q;  5M3M H;  3MEF A;  2ZTD A;  1S3O A;  1I50 H;  3PF5 A;  3RLO A;  2C35 B;  1CKM A;  1Q1B A;  3G48 A;  2I5L X;  2VUM H;  3K0X A;  3RLF A;  2A1A A;  1Q7Y C;  1JT8 A;  4B3M L;  1EIF A;  3S2D H;  1IBL L;  3LGJ A;  4GLV B;  1PH4 A;  2VY3 A;  3J80 i;  4B3M Q;  2UXC Q;  4DR7 L;  1VQ4 A;  4LFB Q;  1Q1E A;  1UE6 A;  2BH8 A;  1OXX K;  2H5X A;  3M4Q A;  4C3H H;  4GOP B;  4A93 H;  1Q82 C;  1N8R C;  1GO3 E;  2N78 A;  3RZD H;  3F1Z A;  5IY0 A;  2ID0 A;  3PUW A;  4HJ8 A;  4LUV A;  3J7A 5;  1VQA A;  3HOW G;  4GN4 B;  4R4C A;  4R4I A;  4BA1 I;  2JA8 H;  1DGS A;  1QZH A;  4GLX A;  2ZTE A;  3EBE A;  2R6G A;  1N33 L;  2BA1 A;  2VNU D;  1CKN A;  4JI2 Q;  2CKZ B;  1Y1V H;  1VQM A;  3PSI A;  1VQO A;  1N33 Q;  1J5E L;  1VQK A;  4LF4 L;  4K0K L;  4DV1 Q;  3CC2 A;  1D8L A;  3PO3 H;  3CCL A;  5JJL A;  2UXB L;  3HOZ H;  2EXD A;  1J5E Q;  1L1O B;  1EFW A;  4LF4 Q;  2Z6K A;  5LMN W;  4OWW B;  2R7Z H;  1PHJ A;  3TRZ A;  4UPA A;  2UXB Q;  3E0E A;  4DK3 C;  1GD7 A;  5GAE C;  2IX0 A;  1KD1 C;  4DPG A;  1VQL A;  2UUA L;  4P73 A;  3CCJ A;  1OXT A;  4X62 L;  3PGZ A;  3JAM c;  3U58 A;  2CCZ A;  3H0G G;  1HNW Q;  4LNQ A;  4X62 Q;  1HZA A;  4ALP A;  4BBS H;  3UE1 A;  3ULJ A;  3SGI A;  2JEA I;  3STB C;  2ZJQ A;  2KCM A;  3OYY A;  4BY7 G;  2MNA A;  1ASY A;  4JI8 Q;  2RHQ B;  4LF6 L;  1FVI A;  4YY3 L;  4GN5 A;  2R93 H;  4X6A H;  2JK8 A;  4A3G G;  3AFP A;  2I5M X;  4LF6 Q;  4YY3 Q;  4A3F G;  5H1S E;  1UE5 A;  2OQ0 A;  1FGU A;  3KYH C;  4HJ9 A;  3S16 H;  2HT1 A;  2R7D A;  3RZO H;  1YVC A;  4HIO A;  2JA7 G;  3DM3 A;  1HNZ L;  3U4V A;  5C0X J;  3L7Z C;  2R7F A;  2Q2U A;  4GNX B;  1BKB A;  3I7F A;  2N8N A;  2LSS A;  2PQA A;  3GTP H;  4A3L G;  1G6P A;  3UDI A;  3H3V I;  2Q2H A;  4O0A A;  1XTD A;  2PMZ E;  1KL9 A;  1VQ9 A;  4JV5 L;  1YJW A;  5M3M G;  4OO1 G;  1K0R A;  4DR5 Q;  3T1Y L;  1PH7 A;  2NVT H;  1NY4 A;  4HID A;  4IJH A;  3PO2 H;  4YCU A;  3GTL H;  2VL6 A;  1HNX L;  3AEV A;  5K36 G;  4NXM L;  2VUM G;  4POF A;  4LF9 L;  3NBH B;  4X66 L;  4X64 Q;  2IT1 A;  3KOJ A;  4FDB A;  4X66 Q;  1VQG A;  4BA2 I;  3RR5 A;  5M5W H;  2WB1 G;  4L5T A;  4OO1 I;  4A3C H;  4DV6 L;  1LYL A;  4OWT B;  4IFD J;  4A93 G;  4JI3 L;  1GM5 A;  3KF8 B;  1QUQ B;  5C0X G;  2QEX A;  2Y0S G;  1PH5 A;  4JI0 L;  3PCO B;  4JI3 Q;  4GS3 A;  4YHH L;  2PI2 E;  4DUY Q;  2JA8 G;  5ELN A;  5IT9 c;  4IO9 A;  1LM0 A;  3RLN A;  3ULL A;  4C3I H;  2ZJP A;  1VQ5 A;  1C9O A;  2CQO A;  3J81 j;  1XMQ L;  1X3F A;  4L5S A;  4EX5 A;  1EQR A;  4DK6 C;  1K8A C;  2AWO A;  3BZC A;  4BXX H;  1Y1V G;  1U5K A;  3K7U C;  3PV0 A;  1KHI A;  3HFZ B;  3G6E A;  5C0X I;  1NJI C;  4OX9 Q;  4HJ5 A;  3PO3 G;  2XTI A;  5LMN L;  3HOZ G;  2R7Z G;  1JJC B;  4X65 L;  1K9M C;  5IWA L;  3G71 A;  5LMN Q;  3HOX H;  2QGQ A;  1CSP A;  4A3M H;  3S15 H;  4DKA C;  4X65 Q;  4PG3 A;  4IFD G;  1AE2 A;  4APV A;  1W3S A;  1K83 H;  1RL2 A;  2FXQ A;  3NEN A;  4BBS G;  2F52 A;  3PUX A;  1NMF A;  3HKS A;  4LFA L;  1KQS A;  2Z6K C;  2MO1 A;  1GKH A;  1L0W A;  3KDF A;  1C7Y A;  1XNR L;  4JI1 Q;  2IHF A;  2JQO A;  1GVP A;  1VQI A;  4GLA C;  2JJQ A;  4LFA Q;  2VQE L;  1OXS C;  4A3B H;  1PH1 A;  2R93 G;  4IPH A;  1TWF H;  4A3D H;  4IFD I;  2JE6 I;  1VQE A;  3I55 A;  2NZH A;  3HOV H;  5C3E H;  1PH2 A;  3T1H L;  3RN2 A;  1VQ8 A;  1N32 L;  3D0F A;  3TQY A;  4PMW A;  1NE3 A;  4NPS A;  3T1H Q;  3GTM H;  3FHW A;  2K52 A;  1LUZ A;  1N32 Q;  2OTJ A;  4P72 A;  1BBU A;  3S17 H;  3CCR A;  4LF7 L;  5GAG C;  4PZ6 A;  4IPG A;  4A76 A;  1PFS A;  1JJG A;  4P74 A;  1CSQ A;  4OXP A;  3HOU H;  3RNU A;  1IBL Q;  4DR6 L;  2OWO A;  3M85 A;  4DR3 L;  3HOY H;  1TWA H;  1V9P A;  1B7Y B;  2V1C C;  4KI0 A;  4LFC L;  5FJ8 H;  4R4Q A;  1Y1W H;  4JI6 L;  3PO2 G;  1T9H A;  1V43 A;  2D0P A;  2YU9 H;  4LFC Q;  3D31 A;  1X65 A;  4JI6 Q;  2QA4 A;  3K8A A;  1CUK A;  1YNX A;  1MJC A;  4NXN L;  4GKJ L;  1OXV A;  2AKW B;  1YIT A;  1SRU A;  1YI2 A;  5JJK A;  3JAM i;  2RHS B;  4C3J H;  5IYB H;  4NXN Q;  3GTO H;  4LUO A;  1VS0 A;  4A3C G;  4J15 A;  1A0I A;  3BZK A;  2AHO B;  5FLM H;  3KF6 A;  1VQD A;  1B8A A;  4K0K Q;  4AQY L;  4JI4 L;  1EOV A;  2K75 A;  3W1G A;  3ER0 A;  3S2H H;  4DV2 L;  4JI4 Q;  1IZ6 A;  3ERS X;  1C0A A;  2UUA Q;  2ALY B;  2E2J H; 
#chains in the Genus database with same CATH topology
 3S1M H;  4K14 A;  4Y52 H;  2UUC L;  1BXT A;  5FLX E;  5JVH 3;  2BE5 D;  1H9S B;  3TME A;  2JA7 B;  4KN4 C;  3CC7 A;  4ME3 A;  4GOP A;  5D3I B;  1I5F A;  1OXU A;  1CQF A;  4PV1 C;  2ICI A;  5IOD A;  2NTS A;  2RF4 A;  4FP5 D;  4A3B G;  1FL0 A;  2ZXP A;  3AMU A;  1NUC A;  1H9K A;  1O7Z A;  2CWA A;  2YYZ A;  1UUP A;  1A3U A;  3CCE A;  1NR2 A;  2K4K A;  1JMC A;  1P8L A;  1I4R A;  2B2V C;  2WFW A;  3ITP A;  3L0O A;  4DV5 Q;  2KEC A;  4DV7 Q;  4IJL A;  2O4X A;  4U68 A;  2NWG A;  2RBM A;  1A63 A;  3BDC A;  3EN2 A;  1DOM A;  3Q8D A;  2K32 A;  2HIX A;  2A5H A;  4QL5 A;  1NMG A;  4R8N A;  2YTY A;  3WOE A;  2A6E D;  1I4Q A;  3TRE A;  5IT9 L;  4DV6 Q;  2AWN A;  3SHL A;  2EYM A;  1BBX C;  1X3E A;  4IUU A;  4EQP A;  2CWP A;  3A7A B;  3HOZ B;  4JBK A;  4HIK A;  5IP9 H;  4A3K H;  1LTI D;  3MHB A;  4QY7 A;  4HR7 B;  1ICW A;  3NWS A;  1N36 L;  1JB7 A;  4CGY B;  1BF4 A;  1WOC A;  2HDM A;  1QZG A;  1WJJ A;  4R9W A;  1SN8 A;  5IWA Q;  3HKZ B;  1I6H H;  2ZM6 L;  1SYC A;  3SK6 A;  1PYS B;  4UHV A;  3U4Z A;  1VQH A;  3K81 C;  2VB2 X;  2DUD A;  4KJN A;  4B3R L;  1KXL A;  1JCK B;  3NBH A;  5C44 H;  5LMU L;  1YJ9 A;  1SFO H;  1MSH A;  2K33 A;  4DNI A;  3P1H A;  1UE1 A;  1TR5 A;  4AIM A;  1RHP A;  1GXD C;  1S5E D;  4A3J G;  1J9O A;  3HKZ E;  4HIM A;  3KF8 A;  1B50 A;  4IAL A;  2F0K A;  4KY7 A;  2JA5 H;  1ILP A;  4EQN A;  4JYA L;  1BNZ A;  5EQ0 A;  3S24 A;  3J81 E;  1WTR A;  5KNB A;  2UXD L;  1ESF A;  1BR9 A;  4GOP C;  3PUY A;  4QMG A;  1LAB A;  1TS5 A;  3GV3 A;  3TZU A;  1TS4 A;  4GZY C;  4IPC A;  5ELB A;  2L15 A;  2JYO A;  2OCE A;  2QF7 A;  4HCS A;  4LW1 A;  4KLK A;  1FNU A;  1BVS A;  4B9W A;  4XIG S;  4EQ5 A;  3M3Y H;  1STA A;  1X54 A;  3NEL A;  2KOL A;  4JI5 Q;  2K14 A;  2L0C A;  5M5Y B;  4JPB W;  5L37 A;  4LFB L;  1OO9 B;  1ML0 D;  3U9O A;  3KLS X;  1EQQ A;  3FKI G;  1YHA A;  3JAM L;  4RG1 A;  4AQY Q;  1RCV D;  2MO0 A;  1I4P A;  3IKJ A;  4YCW A;  1L0Y B;  1CK1 A;  1G29 1;  1PZK D;  1BCP D;  1TXY A;  3K7A H;  4A3I G;  3VR5 A;  1PH9 A;  3S15 B;  3HRZ C;  3DLL A;  1BOS A;  1UWV A;  4A3F B;  1MIU A;  2VS1 A;  2PQA B;  2BOS A;  4A3E G;  4CJ1 B;  3KLR A;  3A0J A;  3CCS A;  3K57 A;  3CXC A;  2PPB C;  5C5M A;  1EWC A;  2RA4 A;  1YJN A;  3FVQ A;  4AYB B;  1HNW L;  4A3D B;  5T1G A;  3CQZ H;  2E2H H;  4JI7 L;  4JBJ A;  1F9Q A;  1PLF A;  1VCI A;  4OHJ A;  4FO2 A;  5JPM C;  4DV3 Q;  1I50 B;  5BR8 Q;  3VYU A;  3K5M A;  2H4O A;  1FGB D;  2X69 A;  1FJG Q;  4KKT A;  2XNA C;  5LHY 1;  5D65 A;  5D3D A;  4RWS C;  1OTC A;  2NYZ D;  2X6G A;  1SYF A;  4AYB E;  4ID6 A;  5ELO A;  1XNQ Q;  2K5H A;  5JEA J;  4RKL A;  2KHS A;  1B2T A;  2JA8 B;  1KRS A;  2KVM A;  2YU9 B;  3BYY B;  2D9U A;  2SDF A;  2KUM A;  1PH6 A;  5IE8 A;  2LXJ A;  3CCV A;  4DR1 Q;  4WJ3 M;  2WB1 E;  3F2U A;  1IYJ B;  4KKU A;  3GD7 A;  5CV8 A;  2Q8I B;  3M4P A;  2ASB A;  4X64 L;  3M4O H;  1IYV A;  1WTO A;  5IYC G;  2F4V Q;  3HGB A;  3HOW H;  3PIP A;  3HEJ A;  1D5Z C;  3K80 C;  1TWC H;  2F0N A;  4MNO A;  1HZC A;  1I4H A;  1K8M A;  2D0O A;  5FO9 B;  1PH8 A;  1XPO A;  2WP8 J;  2AMC B;  1P16 A;  1SLJ A;  1HQR D;  5GAD C;  1E22 A;  3FRP B;  4F88 A;  1DCZ A;  4AH6 A;  5CC4 A;  4FXK C;  2A69 C;  2EY6 A;  2AQ2 B;  2B2T A;  4R1J A;  1SAP A;  1HXY D;  3W3A A;  4O42 A;  1V1Q A;  4XXE A;  5EBC A;  1RIP A;  2XGT A;  3D6W A;  2IY5 B;  1WTH A;  5EKI A;  3GP7 A;  2VW9 A;  4DR2 Q;  1BQQ T;  1K28 A;  3RD4 A;  4OON A;  2RDH A;  3BVM A;  3CCU A;  2QEJ C;  3H3V H;  4DUZ Q;  2QDB A;  3UDX A;  1WD1 A;  1I94 L;  3J7Y W;  2BA0 A;  1SNP A;  2HQE A;  1IL8 A;  1HHV A;  4ZK9 B;  5KYI A;  3FDT A;  1ILQ A;  3HKZ G;  3KF6 B;  3CPF A;  3TZD A;  3Q23 A;  3A8K E;  4DV4 Q;  2H1E A;  1UEB A;  3NEM A;  5M5W B;  3AYH B;  4KTA A;  3I4O A;  5EAY A;  1KC8 C;  5M3M H;  5EJW A;  3VR2 A;  5CR3 A;  1CKM A;  1Q1B A;  3G48 A;  2E2D C;  3K0X A;  3CKI B;  3LWU A;  4K6D A;  1YNN D;  3OMC A;  4G4K A;  4GLV B;  4IUN A;  1PH4 A;  4B3M Q;  2B63 B;  1UE6 A;  1L0X B;  4C3H H;  1YNJ C;  1B9M A;  4HJ8 A;  1LT6 D;  4R4I A;  3J80 L;  4I7A A;  1Y1V H;  3OOC A;  3PSI A;  1VQO A;  4RHS A;  1DXM A;  4K0K L;  1HQM C;  4PNY A;  1HFN A;  1M8A A;  2CW0 D;  4IUR A;  5JJL A;  2UXB L;  2EXD A;  1L1O B;  2B2W A;  3CRK C;  2Z6K A;  1EFW A;  4OWW B;  4DK0 A;  3K6O A;  3GTQ H;  1GD7 A;  1TWF B;  4EQO A;  4X62 L;  3JAM c;  1CT1 D;  2MHV A;  1SNQ A;  3BYT B;  5IT9 E;  1HZA A;  4BBS H;  3SDZ A;  3UE1 A;  3ULJ A;  2JEA I;  3GTM B;  2KCM A;  2FFK B;  3OYY A;  2XSC A;  3QR8 A;  1F2M A;  1SMY C;  4H7B A;  4JI8 Q;  1ASY A;  2G9D A;  4GN5 A;  2B2T C;  1TWG B;  2PMZ B;  4LF6 Q;  3I91 A;  3R2T A;  4A3F G;  1IW7 C;  1E0B A;  3S16 H;  3O13 A;  1TWA B;  4DNT B;  1HNZ L;  4DFA A;  3MXG A;  4Z9C B;  5M3F B;  1VF7 A;  3GTP H;  4A3L G;  4ZUI A;  1G6P A;  2LS0 1;  3GTO B;  2SNM A;  4O0A A;  1XTD A;  2PMZ E;  4JV5 L;  1YJW A;  2NVT H;  3D8G A;  5FLX L;  4IJH A;  1PFB A;  3TP7 A;  4NXM L;  3S2H B;  2VUM G;  4LF9 L;  2R3Z A;  1ENF A;  2XRS D;  4BA2 I;  2KCN A;  2WB1 G;  4OO1 I;  4A3C H;  1H9R A;  4FF4 A;  1B3Q A;  1PH5 A;  4JI0 L;  2PI2 E;  2JA8 G;  4IO9 A;  3DMU A;  4C3I H;  4V19 0;  1VQ5 A;  2CQO A;  5NUC A;  1EQR A;  4DK6 C;  1B4O A;  1HPC A;  3HFZ B;  4OX9 Q;  1KTK A;  5C0X I;  2XTI A;  2F3V A;  3PIP 3;  2EY2 A;  4DAV A;  1K9M C;  4I7Z C;  4K8I A;  1PRT B;  4YIJ A;  2DY7 A;  5I4D A;  4IFD G;  4APV A;  1D1I A;  4LJZ C;  3I73 A;  3SR1 A;  4FF3 A;  2FXQ A;  1K83 H;  2R92 B;  2LMC B;  1CM9 A;  2B2W C;  2Z6K C;  1EFI D;  1GKH A;  1SXT A;  3VA7 A;  2O5J C;  1C7Y A;  5C4J B;  2IHF A;  3I4L A;  4A3B H;  4DF7 A;  1NR4 A;  4Q5V A;  2JE6 I;  1HRJ A;  2WII B;  4WFN 3;  3T1H L;  4CJ2 C;  3IL8 A;  4WRD A;  3D0F A;  1NE3 A;  3FHW A;  1D2B A;  1K0S A;  3A56 A;  1G6Z A;  1BBU A;  3R2I A;  3S17 H;  3Q24 A;  1FR3 A;  1VF5 C;  4P74 A;  2P5Z X;  2NVQ B;  3RNU A;  2EY1 A;  4L6T B;  3M85 A;  4DR7 Q;  2V1C C;  4LFC L;  4R4Q A;  1HA6 A;  4RA8 A;  1G8Z D;  2FJ2 A;  1X65 A;  1S5C D;  2F0V A;  4GKJ L;  1YNX A;  3M7G A;  4CDC C;  4P2C B;  5KEE A;  3SE0 A;  4NXN Q;  1VS0 A;  1E2Z A;  3BZK A;  2IX3 A;  5FLM H;  2AQ3 B;  3MXP A;  1ZKO A;  4HSV A;  4JI4 L;  5C4X B;  4FVM A;  1BCP B;  2Z8L A;  4DV2 L;  2EPB A;  2CH4 W;  1RKN A;  1KAA A;  1C0A A;  5I9O A;  4BXX G;  3QOL A;  4V0B A;  3R3O A;  2NVY H;  4HJA A;  2E2J H;  1SE4 A;  2KHI A;  1ROD A;  1EYC A;  3W5O A;  4B9X A;  5DEH A;  3DWA A;  2ATW A;  2SEB D;  2BH2 A;  5G3L D;  4DV0 L;  2UUC Q;  1S5D D;  2CQA A;  2HCC A;  1JQY D;  3IRB A;  2LKV A;  5C5L A;  4UP8 A;  1Y69 U;  4A3J H;  1MI2 A;  4YCV A;  3CP0 A;  1MD2 D;  4O1N A;  1STH A;  3VA5 A;  3MFY A;  1YIJ A;  1H9J A;  3EIV A;  3GTK B;  1C8C A;  2MPM A;  1DYQ A;  3GTJ H;  3MZ5 A;  1YBY A;  1EY7 A;  3K0Y A;  2MJ8 A;  1B44 D;  5C3E G;  3D4D A;  2MUY A;  4FNF A;  3I4M B;  2L4N A;  2VB3 X;  4NW2 A;  3PUV A;  1CHP D;  3NP8 A;  4JVZ A;  1NTG A;  2Y0S B;  4MTK A;  1EWI A;  1X55 A;  4C2M H;  1PZJ D;  2EIF A;  1QVF A;  3W1B A;  1JWS D;  2IJ0 A;  1HR0 L;  2QW7 A;  2IHE A;  3HOY G;  4DR4 L;  2GVB A;  3S1R H;  2D62 A;  3FKI H;  5CBA E;  2NVX H;  5JOB A;  3OTO L;  5C3W A;  3PO3 B;  4KHP L;  1E1O A;  1EU3 A;  1B9N A;  2KEE A;  4YHH Q;  3VDY A;  2UU9 L;  4A3I H;  4J6H A;  5FLX c;  2FMC A;  3HZX A;  2N3S A;  1PRT C;  1C4Q A;  4PMB A;  3OIQ A;  4A3E H;  4DAP A;  4G7O C;  5JPN C;  4OL7 A;  2VQF L;  3RMH A;  4LF8 L;  1HH2 P;  3CHB D;  1ESR A;  1HFG A;  2HUG A;  2ZM6 Q;  1Q8I A;  4B3R Q;  2R61 A;  4ZRZ A;  1O78 A;  1TQO A;  3UE0 A;  1XNR Q;  3J80 E;  3E9I A;  4BY1 G;  3P20 A;  2VQE Q;  5LMU Q;  4P75 A;  2WAQ G;  1NAP A;  1N9W A;  1PDQ A;  4DK1 A;  1EL0 A;  1AEX A;  2NTT A;  2HHH L;  4HTH A;  2CFM A;  2Q8R E;  3Q6S A;  4A4I A;  4RGO S;  1DM0 B;  4DAM A;  4JYA Q;  1HA5 A;  3PO2 B;  3TP5 A;  2UXD Q;  5IIF A;  1KNE A;  5M5X H;  1XMO L;  3MVV A;  4MIU A;  2R92 G;  1QCB D;  2UUB L;  3CW2 C;  3CF5 A;  4E6I A;  1WTP A;  4DR6 Q;  4DR3 Q;  1PRT F;  2C5C A;  1FNW A;  5DLQ E;  5CV9 A;  2GA4 B;  5IYC H;  1HTP A;  5ELC A;  3KLS A;  4CDD C;  2GN5 A;  3H0G B;  4RAU C;  1SYE A;  3DXJ C;  5ISR A;  3H6M A;  5AFW A;  1SE3 A;  1IL2 A;  4BY7 B;  5FKA C;  3ULP A;  1O80 A;  4DXG A;  1KAB A;  2K5V A;  4JI2 L;  1PMR A;  3T51 B;  3A54 A;  4A3G B;  4H13 C;  5T1I A;  4OEM B;  1W2B A;  3J81 i;  2B8G A;  1UNS A;  4H0L C;  3EFX D;  1M90 C;  1G91 A;  5JVG 3;  2IX1 A;  2F3I A;  1MSG A;  3N6R A;  1PTO C;  3FEW X;  1T5E A;  1YHQ A;  3J81 c;  3F2D A;  3HOV B;  2EJM A;  1JOK A;  1WTW A;  2RQX A;  4KHZ A;  3OWE B;  4JI7 Q;  4MTN A;  2WAC A;  5C4X G;  2NN6 I;  1CHQ D;  1TY2 A;  1STG A;  2N88 A;  2Z6B A;  4YWL A;  5KRU A;  2F0L A;  4HMI A;  4F8M A;  3S2D B;  2RDG A;  2ES2 A;  1EZ6 A;  4NDX A;  3D6C A;  3HOU B;  3STB D;  4TVA B;  1CI3 M;  2V4D A;  4JBW A;  1SRO A;  1LT3 D;  1IXR A;  1JIC A;  1H9S A;  5IYD G;  4QF4 A;  4DR5 L;  2EVB A;  4RMF A;  1SEB D;  1DOL A;  2R7Z B;  5CV5 A;  2E5L L;  2E8G A;  2KQ3 A;  3KDF B;  5CV7 A;  4OWX B;  1PTO F;  2EQS A;  3F8T A;  2XVS A;  1DON A;  5FLM G;  1O7I A;  3D3R A;  3I4M G;  1NBW A;  1WI5 A;  2DGY A;  2NZ1 D;  3BG3 A;  1ENC A;  2R93 B;  1M1K C;  1TWH H;  1ZYR D;  3NQT A;  5E1F A;  5M5Y H;  3SEB A;  1N34 L;  1HZ9 A;  3I2Z A;  4KKS A;  1X3P A;  1XJV A;  1KRT A;  4QQB X;  1SJE D;  1EY8 A;  1I3Q H;  2EZV A;  2A19 A;  3TS2 A;  2A8V A;  3X3N A;  4DA2 A;  2JSO A;  4A3F H;  3BDO A;  1II3 A;  3SVM A;  1VDZ A;  4IN3 A;  4IUV A;  4BBR G;  1I94 Q;  3N52 A;  3L2P A;  2Z0S A;  4YWM A;  1EYD A;  4WJW A;  3H15 A;  1KDB A;  4A3L H;  1IBM L;  1Y8P B;  2Z1C A;  5FK9 C;  4HSP A;  3PQI A;  4ZAI A;  2A73 B;  4K6L A;  3NWT A;  3MEF A;  1I50 H;  3RLO A;  3K5L A;  5IGB A;  2I5L X;  2VUM H;  1JT8 A;  2F0W A;  1X32 A;  1RD9 D;  5K5P A;  2UXC Q;  2VY3 A;  3ONA B;  4RHR A;  1SND A;  3NK9 A;  2H5X A;  1OXX K;  1N8R C;  1UAP A;  1QB5 D;  3RZD H;  4LUV A;  4R4C A;  2JA8 H;  1QZH A;  4GLX A;  1D5X C;  2ENB A;  2ZTE A;  2VXW A;  4KD3 A;  1N33 L;  2VNU D;  2EYO A;  1VQM A;  4LF4 L;  4DV1 Q;  3KK7 A;  1STN A;  4NMZ A;  4CKE A;  5LMN W;  3MXU A;  3TRZ A;  1UEA B;  1KLU D;  2UXB Q;  2OF1 A;  3E0E A;  4KMU C;  2UUA L;  1SFO B;  3CCJ A;  5JAV A;  3PGZ A;  4IFD H;  3U58 A;  3H0G G;  2G9H D;  4X62 Q;  1GHK A;  1EEF D;  3NSW A;  2XRQ D;  2JA5 B;  2K6A A;  5I6W A;  4L8J A;  4BY7 G;  2MNA A;  4RGM A;  2RHQ B;  1BO0 A;  1FVI A;  4X6A H;  2AQ1 B;  1A3T A;  4A3G G;  1B3A A;  2I5M X;  4XQQ A;  3KYH C;  3SXH A;  5I2Y A;  2R7D A;  3K5N A;  3T4A C;  2K7V A;  3RZO H;  4OEL B;  2O5I C;  4HIO A;  1A3V A;  2JA7 G;  2A68 C;  3U4V A;  4GNX B;  3M3Y B;  2PQA A;  4LK1 C;  2WKD A;  2FIN B;  5TSS A;  2Q2H A;  4PQX A;  4OO1 G;  1LTB D;  1PH7 A;  2B39 A;  1NY4 A;  1Y8O B;  5FO7 B;  4YCU A;  2F0J A;  3A55 A;  1VMC A;  1VMP A;  1EY5 A;  3KOJ A;  4FDB A;  1V1P B;  1LO5 D;  2CH4 A;  1VQG A;  5E3F A;  3RR5 A;  5M5W H;  1RJT A;  1HUM A;  1GUN A;  4L5T A;  4DV6 L;  1LYL A;  1IKL A;  5C0X G;  1QUQ B;  1GM5 A;  1KLG D;  1SDF A;  4DUY Q;  5IT9 c;  1LM0 A;  1QWY A;  2HD3 A;  3P75 A;  4N8F A;  3ULL A;  4L5S A;  3J81 j;  2BCO A;  3I4N B;  2FHT A;  2AWO A;  3BZC A;  4BXX H;  3QIA A;  4Y7N B;  1B53 A;  1NJI C;  2K1B A;  3CQZ B;  4HJ5 A;  2E2H B;  5LMN L;  3HOZ G;  2R7Z G;  2ZXO A;  5IWA L;  2G5D A;  4DKA C;  3ND9 A;  3HKS A;  3TBI B;  1KQS A;  3U9S A;  1L0W A;  4IZ8 A;  4JI1 Q;  2JQO A;  1VQI A;  3MWY W;  2R93 G;  2F0Q A;  1V1P A;  1TWF H;  4N8X 1;  3E0J A;  3SK4 A;  5C3E H;  3ERO A;  4KV6 A;  1VQ8 A;  5J1Z A;  4NPS A;  3T1H Q;  3GTM H;  4OIK A;  2OTJ A;  4P72 A;  3M4O B;  4M8A A;  1KDC A;  2EJF C;  5CGK A;  4IPG A;  4A76 A;  1JJG A;  1CSQ A;  5ELF A;  1U9R A;  5DNF A;  1IBL Q;  3HOY H;  1TWA H;  1V9P A;  2E76 C;  1T9H A;  1G2S A;  2D0P A;  4Q0F A;  2B2U A;  3VR3 A;  3D31 A;  4LFC Q;  2EXZ A;  3K8A A;  1CUK A;  3MEH A;  4ILW A;  4XQN A;  4ZYS A;  3JAM i;  2RSN A;  3GTO H;  3M4Y A;  5IGC A;  1PXU A;  5JEA H;  3KF6 A;  1VQD A;  5BN3 A;  4AQY L;  3W1G A;  3ER0 A;  3S2H H;  3HS0 C;  1GUO A;  2QCP X;  4JI4 Q;  1R9T B;  1TY0 A;  3ERS X;  2ALY B;  2WV6 D;  2OQK A;  3SK5 A;  2XWB B;  3J7Z C;  4QIW B;  4GKK L;  3S14 H;  1VQC A;  2EYF A;  2SNS A;  5LL6 X;  3S9W A;  3CME A;  4BY1 H;  4DV0 Q;  1H95 A;  4QJF A;  2YV5 A;  3DM1 A;  1Z47 A;  2N55 A;  4O2D A;  4C1N I;  4DV3 L;  1SYG A;  4M1U B;  4QIW E;  1ET6 A;  5GRO A;  5BR8 L;  2Z4H A;  2EYL A;  4L63 B;  3D4W A;  4AYB G;  3TEH B;  3SK8 A;  4A3D G;  2JA6 B;  5IGE A;  3UDG A;  1EIY B;  1EYG A;  3NQI A;  1KDA A;  4S3S A;  2R92 H;  1L1O A;  1WCM B;  1LTR D;  1XNQ L;  2A6H C;  2F0I A;  4UY8 C;  4LUZ A;  3GTG B;  3T1Y Q;  1CFM A;  3CCQ A;  1HNX Q;  2EDG A;  2SOB A;  2PW7 A;  3TDQ A;  4UP7 A;  5GQO A;  1WTX A;  4DNR B;  1HJP A;  1SE2 A;  3H94 A;  4BS9 A;  2Q2I A;  1TII D;  2JA9 A;  4B08 A;  2NZO A;  2DNC A;  4LF5 L;  2KHJ A;  2F4V L;  2E2I H;  2A68 D;  1JB3 A;  1X9N A;  4G7H C;  2XWJ B;  1XMQ Q;  5IYB G;  4UDU C;  1VQJ A;  4LMQ D;  2UU9 Q;  2K01 A;  4QCL A;  3VYS A;  4RFB A;  2HIV A;  1LTL A;  1W6K A;  2B2U C;  1G2T A;  3E9H A;  1Z7T A;  1F2Z A;  1D1K A;  4TQU S;  3A74 A;  3ERQ A;  3KUP A;  1VQF A;  2VQF Q;  1AE3 A;  1QNK A;  1Z9F A;  4LF8 Q;  2PI2 A;  4LWC A;  1A8V A;  3WOF A;  1Q8K A;  4HN7 A;  5C4X H;  1A6X A;  3G7L A;  1GUG A;  3T56 B;  4JOI A;  2KCC A;  2A69 D;  4X3T A;  3I4N G;  3TN2 A;  1SMX A;  1WFQ A;  5AJ3 L;  3RN5 A;  4DUZ L;  2RKS A;  2MGS A;  2ZJR A;  1CKN B;  2I07 B;  3UI2 A;  1WYD A;  4ZUJ A;  4A75 A;  1AFP A;  3GO5 A;  4IOC A;  3AQQ A;  4LF7 Q;  4P71 A;  1VQ7 A;  1LTS D;  1HUN A;  5IYD H;  4JK1 C;  1XMO Q;  1PTO H;  1PH3 A;  1HR0 W;  3GTK H;  2UUB Q;  3K58 A;  3J7A V;  1HCZ A;  3KBX A;  3S1N H;  1HTL D;  2HQL A;  4ZKB B;  5IP7 G;  1L1O C;  4CKC A;  1PYW D;  4C3I B;  3MXN B;  3BVG A;  3H09 A;  3I4M H;  4RCN A;  4MN3 A;  5I6Y A;  1E1T A;  2VZA A;  3K5O A;  1CZW A;  2BE5 C;  3JC6 6;  1B70 B;  1TT2 A;  2LXK A;  2B63 G;  3KJP A;  1SJH D;  3F2B A;  3J80 c;  1YNJ D;  1K83 B;  2EJG C;  3MA2 B;  2K5Q A;  2F0U A;  2NN6 G;  2F0O A;  1PA6 A;  3PF4 A;  4RGN A;  1LLR D;  5E7N A;  4ULL A;  3DEO A;  4XYQ A;  4MHE A;  3A7L A;  3GV6 A;  1JOO A;  2AUJ D;  1I4G A;  4K5W A;  2J4X A;  3QB3 A;  2K5N A;  4BBR H;  4JI8 L;  3QWN A;  2EE1 A;  2MFI A;  3CD6 A;  4R8I A;  4X3K A;  2L11 A;  3S17 B;  5J3B A;  1EQV A;  1YEZ A;  1SNO A;  4QGU A;  4A93 B;  1U4L A;  1F9S A;  2A6E C;  1SMY D;  2IPK D;  4JOI C;  1HZB A;  2C9O A;  3DEP A;  2YTV A;  5DM6 3;  4B3T L;  2RCF A;  1IW7 D;  2K50 A;  1IHZ A;  4UP9 A;  2PNR C;  3OW2 A;  4WJ4 A;  1B1Z A;  2OEO A;  1EY4 A;  4HJ7 A;  1STY A;  2IW3 A;  3IFT A;  5M3F G;  2Y0S E;  2JA6 G;  2F0G A;  2KCT A;  2E5L Q;  5IGD A;  4LAA A;  4J8Q A;  3WDN A;  1WCM G;  4KK7 A;  5JEA G;  4K2K A;  4ABN A;  3GQB A;  4B3S L;  4NB3 A;  1Q46 A;  1N36 Q;  1IBK L;  2RCN A;  2PNH A;  5IOC A;  1EY6 A;  4HAE A;  1Y14 B;  2KBN A;  2DNE A;  4CBV A;  1K8G A;  2GVA A;  4JCV E;  4H02 A;  4OX9 L;  3H0G H;  1BDO A;  1F2L A;  1N34 Q;  4PZ7 A;  3H91 A;  3Q0A A;  2B3G A;  1FNV A;  3S1Q H;  4BY7 H;  3V2T A;  1ZXT A;  1EOT A;  2PZU A;  1TKW B;  5ELD A;  4A3G H;  5FO8 B;  3WWV A;  3FPP A;  3CPW A;  1Q12 A;  1TU2 B;  3EJI A;  2NB0 A;  2JA7 H;  3GTL B;  1K73 C;  5EKK A;  4X3U A;  1NNX A;  3KJO A;  4DU9 A;  4C2M B;  3I3C A;  4DAY B;  1XTC D;  1MHW C;  4JG2 A;  1PV4 A;  1IBM Q;  4XTC S;  1LTT D;  4OO1 H;  1LT5 D;  2ZTD A;  3PF5 A;  3DHQ A;  2X6L A;  2NVX B;  5E4X A;  2PW5 A;  3RLF A;  2A1A A;  1SYD A;  1EIF A;  3S2D H;  1BCP C;  1CQV A;  4A3I B;  2TMP A;  4DR7 L;  5EPK A;  4LFB Q;  4TKO B;  4NP5 A;  4GOP B;  3M4Q A;  1DD2 A;  5C0X H;  2N78 A;  3BZD B;  3PUW A;  2M00 A;  1ICF B;  1STE A;  3HOX B;  1DGS A;  4A3M B;  4U67 3;  1SBB B;  2CKZ B;  1N33 Q;  1J5E L;  2K5D A;  1VQK A;  4XDX A;  3CC2 A;  3LX0 A;  5COR A;  3HOZ H;  4G7Z C;  4LF4 Q;  2R7Z H;  1E2W A;  2ICE C;  4TRD A;  5BN4 A;  4DK3 C;  3LNN A;  5GAE C;  4DPG A;  3BS1 A;  4KD4 A;  4P73 A;  3TP8 A;  1OXT A;  1QIL A;  1HNW Q;  4IUQ A;  3ZYY X;  1SYB A;  4YY3 L;  2R93 H;  1DJR D;  3OWF A;  1X3Q A;  3AFP A;  4X3S A;  5IGG A;  1BCP F;  2E74 C;  5M5X B;  4QUC A;  4ZCK A;  1UE5 A;  2OQ0 A;  4HCE A;  2HT1 A;  2L5T A;  1Y1W B;  5FOB B;  3L7Z C;  2Q2U A;  5J22 A;  1A15 A;  5C4Z A;  3I7F A;  2LSS A;  3UDI A;  3H3V I;  4WOR A;  3I70 A;  4C3J B;  1VQ9 A;  3Q22 A;  1K0R A;  3A8I E;  3T16 A;  1F2Y A;  2BDN A;  3D4R A;  2VL6 A;  3AEV A;  1V1O A;  4POF A;  3NBH B;  4X66 L;  4X64 Q;  2IT1 A;  2F1M A;  2HDL A;  3S1M B;  1QOH A;  4I65 A;  3VR4 A;  4ZLT F;  1K3B C;  2DJG C;  4JI3 L;  4IFD J;  4A93 G;  3KF8 B;  1AP0 A;  4EGV A;  2Y0S G;  1S5B D;  1W6J A;  5KND A;  2M2L A;  4YHH L;  5ELN A;  1JE4 A;  5JJI A;  4XT1 B;  1C9O A;  3TP6 A;  1Q3L A;  1U5K A;  1KHI A;  1XWE A;  3G6E A;  2MP1 A;  1EYA A;  3PO3 G;  1JJC B;  4CJ0 B;  4X65 L;  3G71 A;  5LMN Q;  2QGQ A;  1CSP A;  3S15 H;  4PG3 A;  1O7L A;  3NEN A;  1RL2 A;  2PYK A;  1PRT D;  2F52 A;  3PUX A;  4LFA L;  1R4Q B;  2MO1 A;  4RCO A;  3W2D A;  1IKM A;  3KDF A;  1XNR L;  3OIP A;  1GVP A;  4GLA C;  2JJQ A;  1EY9 A;  2KJX A;  2VQE L;  4A3D H;  3NTI A;  1VQE A;  5CBE E;  3I55 A;  1YNN C;  4F7X A;  1N32 L;  1WVL A;  4RKB A;  3I8Z A;  2K52 A;  1EIH A;  2B2Y A;  4ODG A;  3KBG A;  1E2V A;  5EGT A;  3CCR A;  2NBF A;  5GAG C;  3C46 A;  3E3X A;  3QO2 A;  4A3K B;  1PFS A;  1LT4 D;  4G57 A;  1MGS A;  4DR6 L;  4DR3 L;  1S4Z A;  3PO2 G;  1LAC A;  2EYP A;  2K03 A;  4JI6 L;  1EZ8 A;  1V43 A;  2EY5 A;  2WIN B;  2CW0 C;  2YU9 H;  4QB4 A;  5CV6 A;  1I6H B;  1OXV A;  1YIT A;  1SRU A;  1YI2 A;  1TWH B;  1F9P A;  2RHS B;  5IYB H;  2TSS A;  4IQZ A;  4LUO A;  4J15 A;  1A0I A;  3NBI A;  5C44 B;  1B8A A;  4K0K Q;  4NKL A;  2K75 A;  1SNC A;  2K04 A;  2E75 C;  1I3Q B;  1IZ6 A;  3EVQ A;  1GUW A;  2B29 A;  2K28 A;  4UAI A;  5KYL A;  4GN3 B;  4FXD A;  4CKB A;  2Q8T A;  2YTX A;  2O2L D;  4RH6 A;  4GKK Q;  2JP1 A;  3HOX G;  1XPU A;  1NSN S;  2RSO A;  4A3M G;  1JJ2 A;  3I4N H;  3HP3 A;  3AB9 A;  4XYO A;  5IGF A;  4Y7N H;  1GUS A;  1XX8 A;  1C48 A;  3T13 A;  3CCM A;  3B6Y A;  1H9M A;  1BBW A;  4OGQ C;  1E24 A;  4MZ9 A;  1PTO D;  1HNZ Q;  4K5X A;  3PUZ A;  4DV5 L;  2VUM B;  2CVR A;  4DV7 L;  1CA5 A;  3I56 A;  2F3W A;  3HOV G;  3NE5 B;  1JOQ A;  1SE8 A;  4JV5 Q;  1RDP D;  2WB1 B;  5C3X A;  2MQH A;  4F87 A;  2Z4I A;  5I2X A;  3G4S A;  3RZD B;  4NXM Q;  1E3P A;  4LF9 Q;  3K7A B;  5IP7 H;  1MKH A;  4N9P A;  4C1N K;  3HOU G;  2F0T A;  1AH9 A;  3MFG A;  1A62 A;  5FJ8 G;  1MJE A;  1ONL A;  1Y1W G;  2B2Y C;  1TVX A;  4IUP A;  2PZW A;  1V8Q A;  4JI0 Q;  2JEB I;  4IPD A;  2IWH A;  4LF5 Q;  3OHX C;  4FYD A;  4JBM A;  1U4R A;  3UDF A;  3C1F A;  2B63 H;  4JW0 A;  4C3J G;  1CKO A;  1JWU D;  2KA7 A;  2L12 A;  4DN4 M;  1PVO A;  4GNX A;  3FP9 A;  1GOZ A;  2LY7 A;  1E7Z A;  2F0M A;  2NN6 H;  2N49 A;  3CU7 A;  5EBD A;  1I6V C;  1LV9 A;  1PFM A;  3RUZ A;  2JN4 A;  1RTO A;  3VYT A;  5EPJ A;  1L2F A;  2I5H A;  3RZO B;  1GUT A;  1A2U A;  1R9T H;  1XPR A;  3URY A;  2OTL A;  3OW7 A;  4KHV A;  3ICE A;  2J0T D;  1QUQ A;  3QOJ A;  1EY0 A;  5AJ3 Q;  1S72 A;  2NUC A;  2A74 C;  1JWM D;  2OXP A;  4YWK A;  1FYC A;  5LL6 S;  1Z6H A;  3F2C A;  1SR3 A;  2F0D A;  3HOW B;  1TWG H;  1RTN A;  5D14 A;  1TWC B;  1R4P B;  1X6O A;  2F0F A;  3OMG A;  5JJZ A;  2ZTC A;  3R8B A;  1D7Q A;  2K5W A;  3BDL A;  2I0Q A;  1EIG A;  1QVG A;  1EUJ A;  5DAU A;  5E4W C;  5A2Q L;  4JI5 L;  2K05 A;  1A2T A;  5ELE A;  5M3F H;  2AUK A;  2JA6 H;  5K36 H;  3V96 A;  1CZG A;  4GKJ Q;  1JR0 D;  2M9V A;  2UXC L;  4L5Q A;  3A8J E;  1WCM H;  1DOK A;  1KNA A;  5C6A A;  3GTG H;  4KJO A;  3K59 A;  5IP9 G;  5GAH C;  4R4T A;  2RVL A;  4FF1 A;  4DV2 Q;  3KLW A;  4A3K G;  3BJU A;  4EVO A;  4L5R C;  1EWH A;  4DV1 L;  5J39 A;  1QE6 A;  5HGQ A;  4XT3 B;  1YHB A;  4J1M A;  4TSS A;  4POG A;  3GDE A;  3DWP A;  1VQB A;  4ZQ3 A;  1QVC A;  1JE5 A;  4PMC A;  1PFN A;  1CA6 A;  1AZP A;  1Q81 C;  4GNX C;  5C44 G;  5C3E B;  1QNU A;  3I90 A;  5M3M B;  2J7Z A;  2PZT A;  1RF2 D;  1FJG L;  1GJX A;  3BU2 A;  2IL8 A;  2DJF C;  3X3M A;  3A5U A;  5EKL A;  1CTM A;  4ME5 A;  3MTS A;  4K8J A;  2JA5 G;  3U50 C;  2QDL A;  5C4J H;  3CAM A;  3L3O C;  1Q90 A;  4C3H B;  4R4O A;  3A5Z B;  1YZ6 A;  3HOY B;  3CRL C;  1KAW A;  1AW7 A;  5G3L F;  2L1B A;  2ZT9 C;  2EYH A;  1D6E C;  1J6Q A;  2F0E A;  4DR1 L;  1Y1V B;  5M9O A;  4B3T Q;  4HMJ A;  5I9P A;  2WKC A;  2PCF B;  1HR0 Q;  4DR4 Q;  1PZI D;  4IOA A;  3M7N A;  1ET9 A;  2L9H A;  1TS2 A;  3CMA A;  2KEN A;  3TS0 A;  3OTO Q;  4KHP Q;  3GTQ B;  3HG9 A;  1EQT A;  1U4M A;  2NVQ H;  1SSO A;  1IYU A;  3OPO A;  1M4V A;  3EQL C;  2DN8 A;  2F0P A;  3CC4 A;  1PYB A;  3ZJY C;  4BBS B;  2I46 A;  4IUT A;  1WD0 A;  4RGT A;  1K3R A;  3L9A X;  1UE7 A;  4DUY L;  3S14 B;  1WTV A;  4B3S Q;  2Q2T A;  1JC7 A;  1IBK Q;  3C3L A;  4BY1 B;  1ZEQ X;  2WAQ B;  2EYJ A;  4CDE C;  3KFU A;  3DUZ A;  1U0L A;  1VQP A;  5DM7 3;  3BVZ A;  1MBY A;  4JC0 A;  3S16 B;  5F2D A;  3PIO A;  1VQN A;  4DR2 L;  1S40 A;  5COY A;  1S5F D;  1ASZ A;  3GTP B;  4ZKC B;  4CDF C;  1TS3 A;  3I72 A;  1VQ6 A;  1X3G A;  2WAQ E;  3M9B A;  4JI1 L;  1KIX A;  2HHH Q;  3P7J A;  2NVT B;  5C4H A;  3JAM E;  1G51 A;  4CHT B;  3C2P A;  4PZ8 A;  4DV4 L;  2QIL A;  1X56 A;  1WTQ A;  3AFQ A;  2B8F A;  1SNM A;  3VYR A;  5HY6 A;  1Q86 C;  1BUV T;  1S3O A;  4N9T A;  3G6J B;  2D5D A;  2C35 B;  4HED A;  1F77 A;  1XXG A;  1Q7Y C;  2E2I B;  4B3M L;  2XN9 C;  1IBL L;  3LGJ A;  3J80 i;  3QG1 A;  1VQ4 A;  1Q1E A;  2BH8 A;  4A93 H;  3EA6 A;  3IAY A;  3NPP A;  1Q82 C;  1GO3 E;  1T5X D;  3F1Z A;  5IY0 A;  2ID0 A;  3J7A 5;  1VQA A;  1Y8N B;  4GN4 B;  3HOW G;  4XQJ A;  4BA1 I;  4QUF A;  3H3V C;  3EBE A;  2R6G A;  1NCV A;  2BA1 A;  1CKN A;  4JI2 Q;  1LTG D;  1J8I A;  4OIJ A;  1D5M C;  5KGU A;  3QJY A;  1D8L A;  3PO3 H;  3CCL A;  2RDF A;  3NUC A;  1J5E Q;  4BWG B;  1AZQ A;  2ZXR A;  4A3B B;  1PHJ A;  1STB A;  4UPA A;  2DY8 A;  3J81 L;  3E6Z X;  2IX0 A;  1KD1 C;  1VQL A;  1I4X A;  5CMD A;  5A35 A;  2CCZ A;  4LNQ A;  4ALP A;  5KIX A;  1F9R A;  3SGI A;  3STB C;  2ZJQ A;  3MXN A;  3FMC A;  4LF6 L;  2JK8 A;  3NTK A;  2D2C C;  4YY3 Q;  5H1S E;  4KY6 A;  1FGU A;  4HJ9 A;  4DXF A;  1PTO B;  1YVC A;  3PMF A;  3DM3 A;  3R93 A;  5C0X J;  2R7F A;  5CV4 A;  1BKB A;  2N8N A;  1EEI D;  3S1N B;  2KED A;  4KY5 A;  1KL9 A;  5M3M G;  4DR5 Q;  3T1Y L;  4H44 C;  4HID A;  3PO2 H;  3E5S A;  3GTL H;  1HNX L;  5K36 G;  2FMM A;  3IFD A;  1XYI A;  4X66 Q;  1GHJ A;  2E2J B;  1ZYR C;  2NVY B;  2A6H D;  2F0H A;  2CHB D;  4OWT B;  4C3H G;  4K5V A;  2QEX A;  3PCO B;  4JI3 Q;  4GS3 A;  3RLN A;  2ZJP A;  1XMQ L;  1X3F A;  3ND8 A;  4DGZ A;  4EX5 A;  1K8A C;  4A3J B;  1Y1V G;  1U4P A;  3T53 B;  3K7U C;  3PV0 A;  2EOT A;  2F03 A;  5A2Q E;  3C1E A;  3OSO A;  1QG7 A;  2PO4 A;  3GTJ B;  3HOX H;  4BBR B;  4A3M H;  4X65 Q;  1AE2 A;  5KNC A;  1W3S A;  3LWE A;  2F4I A;  4BBS G;  1NMF A;  2B2V A;  2JXM B;  4LFA Q;  1OXS C;  1JOR A;  3AU7 A;  1PH1 A;  2XIW A;  4IPH A;  4IFD I;  5BN5 A;  1AN8 A;  2QKI C;  2Z9H A;  3FPU B;  2NZH A;  3HOV H;  2BDO A;  1DZ1 A;  1PH2 A;  3RN2 A;  1QJO A;  3PIO 3;  5CYU A;  3TQY A;  3S1R B;  4PMW A;  3FKI B;  1LUZ A;  1N32 Q;  3NXW A;  3DWQ A;  4LF7 L;  4PZ6 A;  3MC0 B;  1O7Y A;  1EU4 A;  4OXP A;  4FF2 A;  3HOU H;  2OWO A;  1FD7 D;  5EPL A;  5FJ8 H;  1B7Y B;  5HUR A;  4KI0 A;  1Y1W H;  4A3E B;  1K8O A;  2HCI A;  3TSS A;  4JI6 Q;  2QA4 A;  4NXN L;  1MJC A;  2AKW B;  3MAQ A;  2OT2 A;  5JJK A;  4C3J H;  3NHH A;  5HGT A;  4A3C G;  3NTH A;  4KN7 C;  2AHO B;  2LFN A;  4C56 C;  2PQE A;  2F0S A;  3V05 A;  1EOV A;  3J7A F;  4FXG C;  1ENA A;  1LTA D;  4C3I G;  4DAY A;  4K2L A;  3S1Q B;  3VR6 A;  2UUA Q;  2L55 A; 
#chains in the Genus database with same CATH homology
 2OQK A;  2B29 A;  2NVY H;  4HJA A;  3S1M H;  4Y52 H;  3J7Z C;  4GN3 B;  2KHI A;  2YTX A;  4GKK L;  3W5O A;  2UUC L;  3S14 H;  1VQC A;  2ATW A;  2BH2 A;  4DV0 L;  4GKK Q;  2UUC Q;  3HOX G;  1XPU A;  4A3M G;  3CME A;  3IRB A;  4BY1 H;  5JJI A;  4DV0 Q;  1H95 A;  4QJF A;  2YV5 A;  4UP8 A;  1JJ2 A;  3CC7 A;  4ME3 A;  3I4N H;  4GOP A;  4A3J H;  1I5F A;  1OXU A;  1Z47 A;  3CP0 A;  4YCV A;  4O2D A;  4Y7N H;  4DV3 L;  3CCM A;  2RF4 A;  3B6Y A;  1YIJ A;  4QIW E;  5BR8 L;  1BBW A;  3EIV A;  5GRO A;  4A3B G;  1E24 A;  1FL0 A;  2YYZ A;  4MZ9 A;  2CWA A;  3GTJ H;  4AYB G;  3TEH B;  1HNZ Q;  3PUZ A;  1YBY A;  4DV5 L;  3CCE A;  4A3D G;  2K4K A;  3UDG A;  4DV7 L;  1EIY B;  1EYG A;  3I56 A;  1P8L A;  1JMC A;  3HOV G;  2WFW A;  5C3E G;  3L0O A;  4DV5 Q;  2R92 H;  1L1O A;  4DV7 Q;  4IJL A;  1XNQ L;  1SE8 A;  4JV5 Q;  4UY8 C;  4LUZ A;  3PUV A;  3T1Y Q;  1A63 A;  2MQH A;  1NTG A;  3CCQ A;  1HNX Q;  3G4S A;  4NXM Q;  3EN2 A;  1E3P A;  4LF9 Q;  3Q8D A;  1EWI A;  1X55 A;  4C2M H;  5IP7 H;  1MKH A;  2EIF A;  2HIX A;  1QVF A;  4QL5 A;  4UP7 A;  3W1B A;  3HOU G;  1NMG A;  5GQO A;  1AH9 A;  2YTY A;  1HR0 L;  1HJP A;  1A62 A;  4DR4 L;  2IHE A;  3HOY G;  2Q2I A;  2GVB A;  3TRE A;  5FJ8 G;  2JA9 A;  4DV6 Q;  2AWN A;  2D62 A;  3S1R H;  2NZO A;  1Y1W G;  1X3E A;  3FKI H;  2NVX H;  2KHJ A;  4LF5 L;  2F4V L;  2CWP A;  3OTO L;  2E2I H;  1E1O A;  4JI0 Q;  4JBK A;  4HIK A;  4KHP L;  2JEB I;  4IPD A;  5IP9 H;  4LF5 Q;  4YHH Q;  1X9N A;  3VDY A;  2UU9 L;  4JBM A;  3UDF A;  5FLX c;  4A3I H;  4A3K H;  1XMQ Q;  2B63 H;  5IYB G;  1VQJ A;  1CKO A;  2UU9 Q;  4QY7 A;  2N3S A;  2HIV A;  1LTL A;  1PVO A;  1N36 L;  1JB7 A;  3E9H A;  3FP9 A;  4GNX A;  4A3E H;  1WOC A;  1QZG A;  1E7Z A;  1WJJ A;  2N49 A;  1SN8 A;  2VQF L;  5IWA Q;  4TQU S;  4LF8 L;  1I6H H;  1HH2 P;  3A74 A;  2ZM6 L;  1PYS B;  1VQF A;  2VQF Q;  4B3R L;  3U4Z A;  1VQH A;  3K81 C;  1AE3 A;  1Z9F A;  2DUD A;  4LF8 Q;  2PI2 A;  2ZM6 Q;  4LWC A;  1A8V A;  1Q8K A;  1KXL A;  4B3R Q;  5C44 H;  5C4X H;  5LMU L;  1YJ9 A;  3UE0 A;  1XNR Q;  1L2F A;  2I5H A;  1SFO H;  3E9I A;  4BY1 G;  4DNI A;  1R9T H;  2VQE Q;  5LMU Q;  1UE1 A;  4P75 A;  1XPR A;  2WAQ G;  4JOI A;  4AIM A;  2OTL A;  3I4N G;  4A3J G;  3ICE A;  3HKZ E;  4HIM A;  1N9W A;  1QUQ A;  1SMX A;  1WFQ A;  5AJ3 L;  4DUZ L;  3RN5 A;  2ZJR A;  2JA5 H;  2HHH L;  1CKN B;  5AJ3 Q;  4A75 A;  1S72 A;  1WYD A;  4JYA L;  2CFM A;  4YWK A;  3GO5 A;  4A4I A;  3S24 A;  3F2C A;  4DAM A;  4IOC A;  4DR7 Q;  4JYA Q;  2UXD L;  1SR3 A;  1TWG H;  3PUY A;  4GOP C;  2UXD Q;  3AQQ A;  5M5X H;  4LF7 Q;  1XMO L;  4P71 A;  1VQ7 A;  1X6O A;  2R92 G;  2ZTC A;  4IPC A;  2L15 A;  1D7Q A;  5IYD H;  1HR0 W;  2OCE A;  1XMO Q;  1PH3 A;  2I0Q A;  4LW1 A;  3CW2 C;  3CF5 A;  2UUB L;  4DR6 Q;  1QVG A;  4DR3 Q;  1EUJ A;  4KLK A;  5DLQ E;  3GTK H;  4JI5 L;  2UUB Q;  1BVS A;  4XIG S;  4EQ5 A;  5M3F H;  3M3Y H;  1X54 A;  5IYC H;  3NEL A;  4JI5 Q;  2JA6 H;  3S1N H;  2HQL A;  5IP7 G;  2K14 A;  4GKJ Q;  1L1O C;  2UXC L;  4L5Q A;  3MXN B;  1WCM H;  2GN5 A;  4LFB L;  3I4M H;  1EQQ A;  3FKI G;  3GTG H;  1YHA A;  1E1T A;  2VZA A;  2MO0 A;  4RG1 A;  4YCW A;  4AQY Q;  5IP9 G;  5GAH C;  4R4T A;  1IL2 A;  1G29 1;  4DV2 Q;  3JC6 6;  3ULP A;  1B70 B;  1TXY A;  3K7A H;  3KLW A;  4A3I G;  4A3K G;  2K5V A;  2LXK A;  3BJU A;  1PH9 A;  4JI2 L;  2B63 G;  4L5R C;  3KJP A;  3DLL A;  3F2B A;  1UWV A;  3J80 c;  4DV1 L;  1W2B A;  1MIU A;  2VS1 A;  3J81 i;  2PQA B;  4A3E G;  5HGQ A;  1M90 C;  1YHB A;  3A0J A;  3CCS A;  4POG A;  2NN6 G;  1PA6 A;  3GDE A;  3CXC A;  3PF4 A;  1VQB A;  2IX1 A;  2F3I A;  1YJN A;  1QVC A;  1JE5 A;  5E7N A;  1HNW L;  1YHQ A;  3J81 c;  3CQZ H;  2E2H H;  4JI7 L;  3F2D A;  4JBJ A;  4GNX C;  1Q81 C;  1VCI A;  5C44 G;  4DV3 Q;  4KHZ A;  4JI7 Q;  3GTQ H;  4MTN A;  5C4X G;  2NN6 I;  2K5N A;  4YWL A;  5BR8 Q;  4BBR H;  1FJG L;  4JI8 L;  3BU2 A;  2MFI A;  3CD6 A;  1FJG Q;  3A5U A;  1OTC A;  2ES2 A;  4AYB E;  5J3B A;  2JA5 G;  1YEZ A;  3U50 C;  5ELO A;  4BXX G;  5C4J H;  3STB D;  3CAM A;  4TVA B;  4QGU A;  1XNQ Q;  4R4O A;  2K5H A;  3A5Z B;  1YZ6 A;  5JEA J;  4JOI C;  1HZB A;  4JBW A;  1KRS A;  1KAW A;  1SRO A;  2YTV A;  1IXR A;  4B3T L;  1J6Q A;  4DR1 L;  2K50 A;  4UP9 A;  1PH6 A;  5IE8 A;  5IYD G;  3OW2 A;  4B3T Q;  4DR5 L;  4WJ4 A;  2LXJ A;  3CCV A;  4DR1 Q;  1HR0 Q;  4RMF A;  4DR4 Q;  4HJ7 A;  4IOA A;  2WB1 E;  4WJ3 M;  3M7N A;  1IYJ B;  3M4O H;  3GD7 A;  2ASB A;  3CMA A;  3M4P A;  5M3F G;  2KEN A;  4X64 L;  2E5L L;  3TS0 A;  5IYC G;  2F4V Q;  2E8G A;  3OTO Q;  2Y0S E;  3PIP A;  3HOW H;  2JA6 G;  4KHP Q;  3KDF B;  2KCT A;  3K80 C;  1TWC H;  4OWX B;  2E5L Q;  2NVQ H;  2EQS A;  3F8T A;  4MNO A;  1HZC A;  1WCM G;  5FLM G;  1O7I A;  5JEA G;  3I4M G;  1NBW A;  3CC4 A;  1PYB A;  1WI5 A;  3ZJY C;  2D0O A;  4B3S L;  1PH8 A;  4NB3 A;  1XPO A;  2DGY A;  2WP8 J;  1Q46 A;  1K3R A;  2AMC B;  1P16 A;  1UE7 A;  4DUY L;  1N36 Q;  1IBK L;  2RCN A;  4B3S Q;  2PNH A;  2Q2T A;  1SLJ A;  1Y14 B;  2KBN A;  5GAD C;  1E22 A;  1M1K C;  1TWH H;  1IBK Q;  1K8G A;  4AH6 A;  5M5Y H;  4R1J A;  2GVA A;  4JCV E;  4H02 A;  1N34 L;  1HZ9 A;  1U0L A;  3H0G H;  1VQP A;  4OX9 L;  3KFU A;  4JC0 A;  3I2Z A;  1N34 Q;  1V1Q A;  1XJV A;  4PZ7 A;  1KRT A;  4QQB X;  3PIO A;  1RIP A;  2B3G A;  2XGT A;  1VQN A;  1I3Q H;  4DR2 L;  2IY5 B;  3S1Q H;  4BY7 H;  1S40 A;  2A19 A;  3TS2 A;  2VW9 A;  2A8V A;  4DR2 Q;  1ASZ A;  4OON A;  4A3G H;  1VQ6 A;  3CCU A;  1X3G A;  4A3F H;  3WWV A;  2WAQ E;  3UDX A;  4DUZ Q;  1I94 L;  3H3V H;  2BA0 A;  3CPW A;  3M9B A;  4JI1 L;  1Q12 A;  1KIX A;  2HHH Q;  1I94 Q;  4BBR G;  2JA7 H;  1G51 A;  3L2P A;  1K73 C;  3HKZ G;  2Z0S A;  3KF6 B;  4YWM A;  1MJE A;  4PZ8 A;  3KJO A;  3CPF A;  4DV4 L;  3H15 A;  1X56 A;  4A3L H;  1IBM L;  3AFQ A;  4DAY B;  4DV4 Q;  1UEB A;  3NEM A;  5HY6 A;  3AYH B;  4JG2 A;  1Q86 C;  1PV4 A;  3I4O A;  4XTC S;  5EAY A;  1KC8 C;  1IBM Q;  5M3M H;  3MEF A;  2ZTD A;  1S3O A;  1I50 H;  3PF5 A;  3RLO A;  2C35 B;  1CKM A;  1Q1B A;  3G48 A;  2I5L X;  2VUM H;  3K0X A;  3RLF A;  2A1A A;  1Q7Y C;  1JT8 A;  4B3M L;  1EIF A;  3S2D H;  1IBL L;  3LGJ A;  4GLV B;  1PH4 A;  2VY3 A;  3J80 i;  4B3M Q;  2UXC Q;  4DR7 L;  1VQ4 A;  4LFB Q;  1Q1E A;  1UE6 A;  2BH8 A;  1OXX K;  2H5X A;  3M4Q A;  4C3H H;  4GOP B;  4A93 H;  1Q82 C;  1N8R C;  1GO3 E;  2N78 A;  3RZD H;  3F1Z A;  5IY0 A;  2ID0 A;  3PUW A;  4HJ8 A;  4LUV A;  3J7A 5;  1VQA A;  3HOW G;  4GN4 B;  4R4C A;  4R4I A;  4BA1 I;  2JA8 H;  1DGS A;  1QZH A;  4GLX A;  2ZTE A;  3EBE A;  2R6G A;  1N33 L;  2BA1 A;  2VNU D;  1CKN A;  4JI2 Q;  2CKZ B;  1Y1V H;  1VQM A;  3PSI A;  1VQO A;  1N33 Q;  1J5E L;  1VQK A;  4LF4 L;  4K0K L;  4DV1 Q;  3CC2 A;  1D8L A;  3PO3 H;  3CCL A;  5JJL A;  2UXB L;  3HOZ H;  2EXD A;  1J5E Q;  1L1O B;  1EFW A;  4LF4 Q;  2Z6K A;  5LMN W;  4OWW B;  2R7Z H;  1PHJ A;  3TRZ A;  4UPA A;  2UXB Q;  3E0E A;  4DK3 C;  1GD7 A;  5GAE C;  2IX0 A;  1KD1 C;  4DPG A;  1VQL A;  2UUA L;  4P73 A;  3CCJ A;  1OXT A;  4X62 L;  3PGZ A;  3JAM c;  3U58 A;  2CCZ A;  3H0G G;  1HNW Q;  4LNQ A;  4X62 Q;  1HZA A;  4ALP A;  4BBS H;  3UE1 A;  3ULJ A;  3SGI A;  2JEA I;  3STB C;  2ZJQ A;  2KCM A;  3OYY A;  4BY7 G;  2MNA A;  1ASY A;  4JI8 Q;  2RHQ B;  4LF6 L;  1FVI A;  4YY3 L;  4GN5 A;  2R93 H;  4X6A H;  2JK8 A;  4A3G G;  3AFP A;  2I5M X;  4LF6 Q;  4YY3 Q;  4A3F G;  5H1S E;  1UE5 A;  2OQ0 A;  1FGU A;  3KYH C;  4HJ9 A;  3S16 H;  2HT1 A;  2R7D A;  3RZO H;  1YVC A;  4HIO A;  2JA7 G;  3DM3 A;  1HNZ L;  3U4V A;  5C0X J;  3L7Z C;  2R7F A;  2Q2U A;  4GNX B;  1BKB A;  3I7F A;  2N8N A;  2LSS A;  2PQA A;  3GTP H;  4A3L G;  1G6P A;  3UDI A;  3H3V I;  2Q2H A;  4O0A A;  1XTD A;  2PMZ E;  1KL9 A;  1VQ9 A;  4JV5 L;  1YJW A;  5M3M G;  4OO1 G;  1K0R A;  4DR5 Q;  3T1Y L;  1PH7 A;  2NVT H;  1NY4 A;  4HID A;  4IJH A;  3PO2 H;  4YCU A;  3GTL H;  2VL6 A;  1HNX L;  3AEV A;  5K36 G;  4NXM L;  2VUM G;  4POF A;  4LF9 L;  3NBH B;  4X66 L;  4X64 Q;  2IT1 A;  3KOJ A;  4FDB A;  4X66 Q;  1VQG A;  4BA2 I;  3RR5 A;  5M5W H;  2WB1 G;  4L5T A;  4OO1 I;  4A3C H;  4DV6 L;  1LYL A;  4OWT B;  4IFD J;  4A93 G;  4JI3 L;  1GM5 A;  3KF8 B;  1QUQ B;  5C0X G;  2QEX A;  2Y0S G;  1PH5 A;  4JI0 L;  3PCO B;  4JI3 Q;  4GS3 A;  4YHH L;  2PI2 E;  4DUY Q;  2JA8 G;  5ELN A;  5IT9 c;  4IO9 A;  1LM0 A;  3RLN A;  3ULL A;  4C3I H;  2ZJP A;  1VQ5 A;  1C9O A;  2CQO A;  3J81 j;  1XMQ L;  1X3F A;  4L5S A;  4EX5 A;  1EQR A;  4DK6 C;  1K8A C;  2AWO A;  3BZC A;  4BXX H;  1Y1V G;  1U5K A;  3K7U C;  3PV0 A;  1KHI A;  3HFZ B;  3G6E A;  5C0X I;  1NJI C;  4OX9 Q;  4HJ5 A;  3PO3 G;  2XTI A;  5LMN L;  3HOZ G;  2R7Z G;  1JJC B;  4X65 L;  1K9M C;  5IWA L;  3G71 A;  5LMN Q;  3HOX H;  2QGQ A;  1CSP A;  4A3M H;  3S15 H;  4DKA C;  4X65 Q;  4PG3 A;  4IFD G;  1AE2 A;  4APV A;  1W3S A;  1K83 H;  1RL2 A;  2FXQ A;  3NEN A;  4BBS G;  2F52 A;  3PUX A;  1NMF A;  3HKS A;  4LFA L;  1KQS A;  2Z6K C;  2MO1 A;  1GKH A;  1L0W A;  3KDF A;  1C7Y A;  1XNR L;  4JI1 Q;  2IHF A;  2JQO A;  1GVP A;  1VQI A;  4GLA C;  2JJQ A;  4LFA Q;  2VQE L;  1OXS C;  4A3B H;  1PH1 A;  2R93 G;  4IPH A;  1TWF H;  4A3D H;  4IFD I;  2JE6 I;  1VQE A;  3I55 A;  2NZH A;  3HOV H;  5C3E H;  1PH2 A;  3T1H L;  3RN2 A;  1VQ8 A;  1N32 L;  3D0F A;  3TQY A;  4PMW A;  1NE3 A;  4NPS A;  3T1H Q;  3GTM H;  3FHW A;  2K52 A;  1LUZ A;  1N32 Q;  2OTJ A;  4P72 A;  1BBU A;  3S17 H;  3CCR A;  4LF7 L;  5GAG C;  4PZ6 A;  4IPG A;  4A76 A;  1PFS A;  1JJG A;  4P74 A;  1CSQ A;  4OXP A;  3HOU H;  3RNU A;  1IBL Q;  4DR6 L;  2OWO A;  3M85 A;  4DR3 L;  3HOY H;  1TWA H;  1V9P A;  1B7Y B;  2V1C C;  4KI0 A;  4LFC L;  5FJ8 H;  4R4Q A;  1Y1W H;  4JI6 L;  3PO2 G;  1T9H A;  1V43 A;  2D0P A;  2YU9 H;  4LFC Q;  3D31 A;  1X65 A;  4JI6 Q;  2QA4 A;  3K8A A;  1CUK A;  1YNX A;  1MJC A;  4NXN L;  4GKJ L;  1OXV A;  2AKW B;  1YIT A;  1SRU A;  1YI2 A;  5JJK A;  3JAM i;  2RHS B;  4C3J H;  5IYB H;  4NXN Q;  3GTO H;  4LUO A;  1VS0 A;  4A3C G;  4J15 A;  1A0I A;  3BZK A;  2AHO B;  5FLM H;  3KF6 A;  1VQD A;  1B8A A;  4K0K Q;  4AQY L;  4JI4 L;  1EOV A;  2K75 A;  3W1G A;  3ER0 A;  3S2H H;  4DV2 L;  4JI4 Q;  1IZ6 A;  3ERS X;  1C0A A;  2UUA Q;  2ALY B;  2E2J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...