1YHAA

Crystal structures of y41h and y41f mutants of gene v protein from ff phage suggest possible protein-protein interactions in gvp-ssdna complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Y41H and Y41F mutants of gene V protein from Ff phage suggest possible protein-protein interactions in the GVP-ssDNA complex.
pubmed doi rcsb
source organism Enterobacteria phage f1
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
total genus 11
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1yhaA00
1PA6A 4LFCL 1UE5A 4IFDG 3M4PA 3HFZB 1S3OA 4P72A 4YY3L 1YIJA 3AFQA 3F1ZA 2HHHQ 3CQZH 3K7UC 4HJ9A 1M90C 4JI1L 1VQNA 4BBRH 4DR3Q 3GTJH 4A3MH 3RZDH 4OX9L 4A3BH 4LF8L 4L5RC 1PYBA 2JA5G 1I5FA 1SE8A 4DR5L 1YEZA 2QGQA 4HIMA 5BR8L 4ALPA 1NJIC 3TS2A 4GNXC 1Z47A 2ES2A 4DV7L 1EUJA 2V1CC 1B8AA 1VQLA 2UUBL 4UP7A 2JA6G 1YVCA 3L2PA 3RNUA 4A3FH 4A3IH 3S2DH 4IFDI 4AQYQ 1NMGA 4APVA 3T1HL 1TWHH 2VQFQ 2R93H 1WCMG 4OXPA 1Y1WG 4QIWE 4DUYQ 2OTLA 2PI2E 4B3SL 3HOVH 2ZJRA 2E5LL 1IL2A 2KHIA 1MJEA 2EXDA 3RLFA 1PV4A 2UU9Q 2VUMG 3M4OH 1LYLA 1PYSB 1YHBA 2ID0A 4AH6A 4DK3C 1N36Q 4KHPQ 3PSIA 1E1TA 5C0XG 2GVAA 2RHSB 4QY7A 4DAYB 1JT8A 5AJ3L 4NXNL 3HOZG 5LMNL 4X64L 1QZGA 1L1OC 1QZHA 3GTGH 2JEAI 3K0XA 4DR1Q 4IPCA 3BZCA 5GAHC 3J7ZC 3HOYG 2BA0A 1TWAH 2CCZA 2JK8A 1N9WA 1JJGA 1WJJA 3NELA 4IPHA 4KHPL 4LF9L 3CAMA 1PFSA 1OXSC 1HR0Q 4POFA 5IP7H 5M5YH 3I4MH 4A3DH 1RIPA 4NXNQ 3HKZG 4B3ML 3M7NA 1Q82C 4C2MH 1Y14B 2KENA 2N8NA 2KCTA 5C44G 1WFQA 1B70B 4DR1L 3GTOH 1TXYA 4UPAA 2ATWA 2AWNA 2MNAA 4JBJA 4DK6C 1VQJA 4LF7Q 1VQ5A 4UY8C 4NPSA 1H95A 5IYBH 4DV0Q 3KOJA 4DR6L 4DV7Q 4JBMA 4LNQA 1X65A 2N49A 4J15A 1JMCA 4JBKA 2IHFA 1UWVA 1N32Q 2R7ZG 1X6OA 5JJKA 3KDFA 4A93G 4RMFA 1MIUA 1GD7A 3MEFA 2NZOA 1YHAA 4JYAL 2HIVA 3LGJA 4DKAC 1VQ7A 4LF7L 3ULLA 2Z6KA 5IP7G 3F2DA 4A3DG 2K5NA 4L5TA 1C0AA 3I4OA 3L7ZC 2HIXA 4JC0A 4X65Q 2MQHA 5C3EH 1X54A 3EN2A 1E7ZA 4NB3A 2QA4A 2JA8H 1EYGA 4R4TA 3HOYH 1SR3A 4TQUS 5C3EG 5M5XH 3D31A 1YJNA 1J5EL 4JYAQ 4DV6L 3UDXA 1HJPA 1LTLA 3U58A 3M3YH 3J81c 5LMNQ 1HZAA 1NBWA 1K83H 2WP8J 2VS1A 4IJLA 4GKJQ 4O0AA 4BA1I 4R4CA 2LSSA 1JJCB 3OW2A 1HZBA 4PG3A 1UE1A 3PO2H 1G51A 4HJ7A 4JI7Q 4IFDJ 2Y0SE 1RL2A 2WAQE 2A8VA 1HNWL 1Y1WH 5IWAL 4EQ5A 4JI0L 4JG2A 5IYBG 2UUAL 3H3VH 1OTCA 3PF4A 1LUZA 2CWAA 2F52A 3CCQA 3BU2A 1E3PA 4A3FG 1WYDA 4QJFA 2UXDL 2YTXA 1KIXA 4B3MQ 3CP0A 2UXCQ 1VQ6A 1Q12A 4A75A 1Z9FA 1S72A 4Y7NH 3KJOA 5JJIA 1PH8A 3A5ZB 1N34Q 5HY6A 3S1MH 4A3BG 2K5HA 3DLLA 4LF6L 4GOPB 4P74A 1N33L 4A3GH 2Y0SG 4OO1G 1PH5A 4LFCQ 4YCUA 4DV5Q 3TRZA 2VL6A 5IY0A 3KF6B 2IX0A 1MJCA 2E2JH 3S17H 3CCRA 2Z6KC 2MFIA 4PZ8A 1IYJB 4HJAA 4C3JH 1FVIA 4AIMA 1A63A 1CKNA 3G48A 1VQBA 2JE6I 4K0KQ 1V1QA 4DV4L 3D0FA 1QVCA 2KCMA 1YI2A 4GNXA 3HOZH 1W3SA 4OWXB 4LF4Q 4BY7G 1TWFH 3UDGA 5IE8A 3RN5A 1VQ4A 4LF6Q 5EAYA 1UE6A 2AHOB 3I56A 2XTIA 1PH1A 4BXXH 3PO3G 2PNHA 1K0RA 2Q2TA 4LFBL 4OO1I 3S15H 1OXTA 2QEXA 1AE2A 2GVBA 1GVPA 5LMNW 3UE1A 4DAMA 2VY3A 4GN4B 3WWVA 1V9PA 4B3TQ 3I2ZA 4IOAA 4A3CG 5M3MG 3A0JA 2KHJA 3HOXH 2VQEQ 3G71A 3CCMA 2E2IH 1Q8KA 2JA7H 1T9HA 2AMCB 4BBSG 1ASZA 5LMUL 1D7QA 1EOVA 3U4ZA 3GDEA 1IBKQ 2YU9H 1N36L 3JAMc 3OTOL 3CC2A 1DGSA 2JA5H 5BR8Q 3A74A 5GAEC 3I7FA 1PH4A 1VQHA 4KHZA 3U4VA 4JI2Q 4X62Q 4LFBQ 4A3MG 2ZTDA 1SFOH 2JQOA 2UUAQ 4BBRG 4BY1G 1QVFA 4A3EH 3FKIH 4LWCA 3TS0A 1HZ9A 1E24A 1IBLQ 4DUZL 3I55A 1G291 2A19A 1X3EA 1C9OA 2NVQH 2R7DA 4GLVB 1NY4A 1D8LA 5HGQA 2NVXH 4LF9Q 1V43A 5C0XI 2UUCL 1G6PA 3CPFA 4X6AH 3PUZA 4QL5A 2ZTCA 3STBD 4X62L 3S14H 2JEBI 4B3RQ 2RF4A 2FXQA 1P16A 1Y1VH 4PZ6A 1K8AC 4GN3B 1EQQA 4YCVA 3HOUG 4DV5L 1IZ6A 3M85A 3UDFA 4DR4L 2MO0A 1EWIA 4MNOA 4DUZQ 1PH7A 4OWWB 3S2HH 4YHHQ 1VQ9A 4GOPC 1I94Q 2R92H 4DR6Q 4IJHA 1VQDA 3K7AH 2YV5A 4P71A 5M3FG 1UE7A 2B29A 2WB1G 5IYCG 2CWPA 1K3RA 3H0GH 4A3LG 1XJVA 2K4KA 3K8AA 3AYHB 3HOWH 1PH2A 1K8GA 1OXUA 3K80C 3KYHC 2DGYA 1VS0A 1IBMQ 1JB7A 3HOWG 5K36G 1SN8A 1HNZQ 2VZAA 1N8RC 4WJ4A 2Q2UA 1YBYA 3UE0A 3I4NG 2K5VA 4LUVA 4DV2Q 3W5OA 1HR0W 3F8TA 3CCJA 4C3IH 1PH3A 1FGUA 1O7IA 3GTQH 3GTKH 3J7A5 1S40A 2F4VL 4HIOA 2ALYB 4XTCS 2N78A 1J5EQ 3JC66 1VQ8A 4DV6Q 2HHHL 1UEBA 1K9MC 3UDIA 1YHQA 1EIFA 4IO9A 2I5HA 1SROA 1I3QH 3PUWA 2UXBL 4YY3Q 4JOIC 1HNXL 1I6HH 4MZ9A 2CFMA 3EBEA 4JI1Q 4DV2L 1YZ6A 2UXCL 2D62A 4A3JH 4A3KG 3STBC 3ERSX 5E7NA 1WOCA 1KD1C 4LF5Q 4JV5Q 4GNXB 5C4XG 1A8VA 1XNQQ 3GTLH 2NN6G 3I4NH 2NVTH 1XNRL 1N33Q 3FKIG 1KHIA 4X66L 4R1JA 1VQEA 4R4IA 4LUZA 2CKZB 2D0PA 4JI8L 4GN5A 2N3SA 4TVAB 3FHWA 1VQAA 3KDFB 5C4JH 4GKJL 4DUYL 1P8LA 1KQSA 1NMFA 5IYCH 5M3FH 1I94L 4JI7L 4A3LH 3CC4A 2MO1A 5JEAJ 3BZKA 4A3CH 3J80c 4X66Q 2JJQA 2YTYA 4GOPA 1QUQA 3RR5A 5JEAG 2IY5B 2VNUD 2NN6I 3S1QH 5IP9H 1L1OB 3TREA 1Q1EA 3PIOA 3RN2A 3H3VI 4MTNA 1EIYB 4O2DA 4DR3L 4HIKA 1Y1VG 4Y52H 4KLKA 1R9TH 4BY7H 5ELOA 1FL0A 1TWCH 4IPGA 3J80i 1BKBA 1X3GA 4IPDA 2OTJA 4P73A 5IYDH 4IOCA 3K81C 3PUYA 3TEHB 2WFWA 1GKHA 1OXVA 4JI5Q 4L5SA 4NXMQ 4BY1H 3J81i 3KFUA 3S1NH 4DV0L 2VQFL 1MKHA 1JE5A 1L2FA 3MXNB 3OYYA 4YWKA 3JAMi 4KI0A 1N32L 4B3SQ 3E9HA 3PCOB 4DV1L 1XNQL 1NTGA 2NZHA 2UU9L 1XNRQ 3KJPA 1Q86C 3L0OA 5H1SE 1YJ9A 3PF5A 4JI2L 4UP9A 2YYZA 1QVGA 4C3HH 3PIPA 2B63G 1XPRA 5DLQE 1XPOA 2OQKA 2C35B 3SGIA 4GS3A 4JI8Q 3TQYA 5M3MH 5IYDG 3HOXG 3F2CA 4JBWA 1GO3E 1BBWA 2BH2A 2LXJA 3B6YA 2B3GA 2XGTA 4OX9Q 2I5MX 4LF8Q 2H5XA 1E1OA 2F3IA 1PH6A 3G6EA 4BXXG 4DR5Q 1C7YA 4YHHL 4GLAC 5JJLA 2ZM6L 3CMAA 4B3RL 4JI3L 3FP9A 3CPWA 1K73C 3CD6A 5GROA 3CMEA 3J81j 2IX1A 3AFPA 3U50C 2GN5A 2WAQG 4AYBE 2ZTEA 3E9IA 4DR7L 1X3FA 3M4QA 1KL9A 4HIDA 5ELNA 2AKWB 3CCLA 2B63H 1KC8C 1M1KC 2CQOA 2BA1A 4JI3Q 4A3GG 2RHQB 1W2BA 3CC7A 2HQLA 3AQQA 1Q7YC 3HKZE 4QGUA 2OQ0A 5J3BA 2Q2IA 1JJ2A 1NE3A 2D0OA 4LFAQ 3G4SA 2ZJQA 1VQCA 5IT9c 4JI4Q 1BBUA 1IBML 1YNXA 3H15A 2ZJPA 4A93H 3T1HQ 5C4XH 4DV1Q 1GM5A 3NBHB 4JI5L 2K50A 3EIVA 1IBKL 3GD7A 3RLNA 3M9BA 4A3KH 1AH9A 1YITA 1HNXQ 5M5WH 2JA9A 4JOIA 4OWTB 2UUBQ 3PGZA 1CUKA 2AWOA 2LXKA 4YWMA 3PO2G 3Q8DA 4OONA 1SLJA 1I50H 1PVOA 4LF5L 1HZCA 5C44H 4AQYL 1PH9A 4DR2L 1A62A 1VQPA 1VCIA 1VQGA 3BJUA 3PUXA 1IXRA 1X56A 1X9NA 4HJ8A 3ICEA 1AE3A 5IP9G 5GAGC 3NENA 1IBLL 1FJGL 2E2HH 1SRUA 4LUOA 2PI2A 1U5KA 2Z0SA 2PQAB 3RLOA 3S24A 1HNZL 4QQBX 1Q1BA 4DV4Q 1WI5A 2UUCQ 1VQFA 1U0LA 3KF8B 2EQSA 2PQAA 2NVYH 3W1BA 2JA8G 1XMQL 4XIGS 4X64Q 4DV3L 4RG1A 2BH8A 2ASBA 2ZM6Q 1CKOA 1E22A 3PUVA 3W1GA 3CXCA 2K52A 4YWLA 4R4OA 3CW2C 5GADC 5C0XJ 2UXDQ 4JI6L 3CCEA 5LMUQ 4HJ5A 2K75A 1XMOL 1PHJA 2WB1E 1VQKA 1EFWA 4B3TL 1VQIA 4GKKQ 2K14A 2VQEL 2IT1A 1HR0L 2R7ZH 2A1AA 4POGA 2R92G 3S16H 1XMQQ 4LFAL 3GTPH 1X55A 1L0WA 4DV3Q 4A3JG 4JI4L 4JV5L 1LM0A 3ULJA 1B7YB 2IHEA 1J6QA 1EQRA 4UP8A 3T1YL 1XPUA 4L5QA 3PV0A 3CCSA 2VW9A 3CCVA 4ME3A 1HH2P 1L1OA 3AEVA 3ZJYC 4K0KL 3E0EA 1QUQB 2R6GA 2I5LX 5FLXc 1ASYA 3RZOH 3I4MG 4X65L 4A76A 1KRTA 5GQOA 4DNIA 4DPGA 2EIFA 1CSQA 3KLWA 3VDYA 2Q2HA 1CKNB 1KAWA 3T1YQ 2E8GA 1KXLA 4DR4Q 1SMXA 3ULPA 4A3EG 4R4QA 3CF5A 1FJGQ 4JCVE 2OWOA 1OXXK 1XTDA 2RCNA 2UXBQ 2L15A 4DR2Q 1CKMA 4A4IA 2E5LQ 1VQMA 4EX5A 1N34L 3A5UA 2PMZE 5FJ8G 3DM3A 4PMWA 3H0GG 2YTVA 4YCWA 2JA7G 4BBSH 4PZ7A 2DUDA 5AJ3Q 4FDBA 1Q81C 3OTOQ 2VUMH 3S1RH 1VQOA 3GTMH 2OCEA 2R7FA 1HNWQ 5FLMH 4H02A 1A0IA 4JI6Q 3HOVG 4WJ3M 4AYBG 1WCMH 4BA2I 3CCUA 2R93G 2I0QA 1XMOQ 5FLMG 4LW1A 4GKKL 3HKSA 4A3IG 2HT1A 3PO3H 3HOUH 4LF4L 4NXML 1YJWA 3ER0A 4P75A 2JA6H 4DR7Q 5IWAQ 4GLXA 1CSPA 1Q46A 2F4VQ 3KF6A 4JI0Q 5FJ8H 3F2BA 1TWGH 3GO5A 2KBNA 3NEMA 1KRSA 3IRBA 1BVSA
chains in the Genus database with same CATH superfamily
4LFCL 3HFZB 1B9NA 4RGNA 4C3JG 3AFQA 3F1ZA 4ZLTF 4RKLA 3A8KE 5CC4A 5K5PA 3GTJH 1HUMA 2F0WA 1PYBA 2BE5C 1L0YB 4DR5L 4HIMA 4ALPA 3S1QB 3RZDB 3C1EA 1EUJA 1VQLA 2E2IB 3P75A 2QKIC 3T1HL 1ILQA 1PTOD 1O7ZA 2KECA 1CZGA 4QIWE 3K5OA 4U68A 4Z9CB 1PV4A 3SR1A 1PYSB 1YHBA 1JQYD 1N36Q 4DK3C 5EKKA 5C0XG 4B08A 1RD9D 1GOZA 4NXNL 4C3JB 4X64L 3K5NA 1L1OC 4IPCA 1IYUA 2EYPA 3J7ZC 3W2DA 1O80A 4A3GB 2CW0D 1JJGA 1WJJA 1VDZA 1DOLA 4KHPL 4LF9L 1LLRD 4POFA 5IP7H 5M5YH 1RKNA 1RIPA 3SE0A 4C2MH 2KCTA 5C44G 4C1NI 1DCZA 1EL0A 1VQJA 1ESRA 4LF7Q 2QF7A 4NMZA 3PO3B 1H95A 2KUMA 4DV0Q 1EQVA 1S5BD 4DV7Q 4JBMA 3PO2B 1PRTB 4J15A 4JBKA 1UWVA 1NNXA 3I73A 1X6OA 2R7ZG 3M3YB 2RVLA 4A93G 1MIUA 3LGJA 4DKAC 3I4OA 2JA8H 4RKBA 4G7HC 1WD1A 1SR3A 5M5XH 1YJNA 2WACA 4QMGA 3M7GA 5FLXE 2CHBD 1HJPA 5E4XA 1TU2B 4A3FB 1LTLA 2HCCA 4ZK9B 3J81c 5LMNQ 2L12A 1HZAA 1O7YA 1UUPA 4GKJQ 2LSSA 4B9XA 3OW2A 4PG3A 3PO2H 1AEXA 4HJ7A 4OGQC 2Y0SE 4J6HA 1HNWL 2Q8TA 5C3WA 3M4OB 4JG2A 2UUAL 2A6EC 5CV8A 1OTCA 2GA4B 4A3FG 4C3IB 5J1ZA 4C3HG 1AZPA 2UXCQ 1Q12A 4DXGA 3KJOA 1N34Q 1E2WA 5HY6A 2JXMB 4A3BG 1RODA 3G7LA 4LF6L 4A3GH 2G9DA 2ZXPA 1D2BA 5EBDA 2VL6A 3KF6B 3CCRA 2MP1A 2MFIA 1FVIA 3V2TA 4DV4L 1QVCA 1YI2A 1KABA 3HOZH 2B8FA 4OWXB 1LTAD 3UDGA 3RN5A 3FEWX 4G57A 5EAYA 1UE6A 4BXXH 3PO3G 1ZYRD 2PNHA 3QJYA 3GP7A 1BF4A 3S15H 1I4QA 4I65A 5LMNW 1SYGA 2CCZA 2VY3A 4GN4B 4IOAA 4IUUA 3I2ZA 3CCMA 2E2IH 3QWNA 1I6VC 2XN9C 4ZYSA 1T9HA 5LMUL 4A3JB 1HA5A 1D1IA 1CTMA 1N36L 1T5XD 3OTOL 1B44D 2JA5H 3HOYB 5BR8Q 3QIAA 1VQHA 1YNNC 2KVMA 4KHZA 4RGTA 2ZTDA 4EVOA 2E74C 1SFOH 1YNJD 4ILWA 3TSSA 4A3EH 3VR2A 2F0OA 4DUZL 1S4ZA 1ICFB 1C9OA 1JOKA 1MI2A 5C5LA 3S16B 5IGBA 1SAPA 5C0XI 1TIID 1S5ED 1I4PA 4LAAA 3STBD 2F0VA 3S14H 2RF4A 1P16A 4GN3B 2F0HA 2MO0A 1EWIA 1E2ZA 1F2MA 3OHXC 4OWWB 4YHHQ 1VQ9A 1GHJA 4C3IG 1I94Q 1E0BA 4IJHA 2X6LA 1VQDA 5CORA 2F3WA 4FF3A 3K8AA 3AYHB 5CYUA 2A5HA 3SK8A 2K01A 1VS0A 1SN8A 3S14B 4CBVA 4WJ4A 3UE0A 4LUVA 5I2YA 3W5OA 3CCJA 1PH3A 5E3FA 4HIOA 1J5EQ 2HHHL 1Q8IA 3UDIA 1YNND 1NR4A 1KDCA 1LV9A 3EBEA 2UXCL 2PMZB 4A3JH 4A3KG 1GUWA 2DJFC 4L8JA 1WOCA 1ML0D 4JV5Q 1QILA 1A8VA 4X3SA 1IL8A 3OWEB 3GTLH 3J7AV 4X66L 3T56B 4LMQD 4NW2A 1VQEA 2I07B 2D0PA 1KLUD 4GN5A 4BY1B 2E76C 1U4MA 3DMUA 2HQEA 3IL8A 5IOCA 2EJMA 5M3FH 5JEAJ 3BZKA 4A3CH 3R93A 2JJQA 4HAEA 5M5YB 1B50A 1X32A 3RR5A 3ITPA 3D4RA 2VNUD 5DNFA 2KCNA 2B2UC 3S17B 1EIYB 1SNPA 2J4XA 1F2ZA 1FD7D 4DK0A 3X3MA 1R9TH 1G2SA 1MHWC 2B2UA 4F8MA 4BY7H 1RDPD 4QCLA 1CQVA 1FL0A 1TWCH 2B2WA 5ELBA 3J80i 2XIWA 1RCVD 4P73A 4IOCA 3TEHB 1OXVA 3BVMA 3KFUA 4BY1H 4OIKA 3CRKC 1K3BC 1GUOA 1JE5A 4YWKA 3VYRA 1N32L 2F0DA 2ZXOA 3E9HA 1WVLA 1R4PB 3KLSX 1XNQL 2UU9L 4J8QA 5H1SE 3PF5A 3PIPA 4QIWB 5DLQE 1XPOA 2NYZD 3HOXG 1XTCD 1GO3E 1RTNA 5F2DA 2XGTA 4OX9Q 2H5XA 1BR9A 4E6IA 2AQ3B 3GQBA 1E2VA 3J81j 1EEFD 4OELB 3U50C 2GN5A 2WAQG 3NBIA 2DY7A 2EY1A 1BXTA 2KEDA 2Z1CA 4PNYA 4DAPA 2AKWB 2A68C 2B63H 1KC8C 1M1KC 2Z8LA 1JWMD 1DM0B 3AQQA 2RCFA 1Q7YC 1STEA 2OQ0A 1SMYC 1JJ2A 1NE3A 3I70A 4IURA 1F9SA 3Q6SA 4JI4Q 3T16A 2RSOA 4HMIA 3AU7A 4EGVA 5C4XH 1TR5A 3A7AB 3NPPA 2PYKA 4KD3A 3VA7A 2JA9A 4HCSA 4OWTB 2UUBQ 1CUKA 2LXKA 4YWMA 3HOWB 4OONA 2EY6A 3H94A 4JPBW 1A62A 2EYJA 2VUMB 3PUXA 1IXRA 1X56A 4HJ8A 1FJGL 3V96A 1PTOF 1U5KA 2Z0SA 3PQIA 4V190 3NWTA 1U0LA 3KF8B 3NP8A 2EQSA 4IZ8A 1GUNA 3T53B 3W1BA 1PTOC 2BH8A 1F2LA 2K52A 4IUVA 4R4OA 5GADC 5C0XJ 2FMCA 5LMUQ 1XMOL 3BYTB 2BE5D 3IFDA 2Q8RE 1JWSD 1HR0L 2A1AA 3OW7A 1XYIA 1X55A 1B7YB 1J6QA 1XPUA 1GHKA 3CCSA 2VW9A 3CCVA 5M3MB 1RF2D 4ME3A 4K0KL 3JAME 2I5LX 1BDOA 1NCVA 4X65L 2PO4A 1KRTA 3NUCA 5GQOA 2NUCA 1EIHA 2EIFA 3KLWA 4DGZA 3NTHA 3SHLA 1KXLA 3ULPA 3CF5A 2OWOA 5I6WA 1LTGD 2A6HC 2DNEA 4G7OC 3A5UA 5FJ8G 1I4XA 3HKZB 2AUJD 4PMWA 4OHJA 3GTPB 2NWGA 4BBSH 4PZ7A 5IGDA 5JPMC 5AJ3Q 1FGBD 1GUSA 3R3OA 3GTMH 3K58A 1SXTA 3M4YA 3HOUB 4JI6Q 1TKWB 1XMOQ 4LW1A 4RGOS 1EYAA 1SYCA 3DUZA 5CV4A 5EPKA 3MTSA 3URYA 5D3DA 3ER0A 4H44C 2EVBA 2JA6H 2F0NA 2C9OA 1TWGH 1PFMA 3IRBA 4CGYB 1DOKA 1GM5A 3E5SA 5C4ZA 4IFDG 3M4PA 1V1PA 1YIJA 1KDBA 4X3KA 1M90C 5D14A 5J39A 4BBRH 5A2QE 3BG3A 5EKIA 4A3MH 4HCEA 4UDUC 4IFDH 1TWAB 3MXGA 1SYEA 2QGQA 1Q90A 3EROA 3QG1A 3SVMA 4GNXC 1Z47A 2JA6G 1B8AA 4XQJA 3KF8A 4L6TB 2L5TA 3N6RA 4IFDI 4AQYQ 2M2LA 4APVA 1TWHH 5C5MA 2VQFQ 1EY0A 4RAUC 1ENAA 3VA5A 3EJIA 2E5LL 1I3QB 3K0YA 2KHIA 3GV3A 3RLFA 4C1NK 2EYMA 4AH6A 1O7LA 2GVAA 2RHSB 1JT8A 4ZAIA 1QZHA 2F0JA 4DR1Q 3BZCA 5GAHC 4A3BB 1V1OA 4N8FA 4DAVA 5M5WB 3NELA 2EZVA 3MWYW 1MD2D 3P1HA 1OXSC 3DM1A 2B39A 4A3DH 1DZ1A 4XQNA 1HQRD 1EZ8A 3HKZG 4B3ML 1Y14B 4DR1L 1B70B 3GTOH 4UPAA 2AWNA 2JYOA 1HRJA 2MNAA 5IT9L 2SEBD 3NWSA 4MN3A 4UY8C 3H3VC 2M00A 2RDHA 4KV6A 5IYBH 3TP8A 1AW7A 2OXPA 5C3XA 1JMCA 1WD0A 5JJKA 3S1RB 4RMFA 2QDBA 1GD7A 5LL6S 2DNCA 1FNVA 4PMCA 2H1EA 1JE4A 4LF7L 1CQFA 2K5DA 3NQTA 5E4WC 1BO0A 2EYLA 2HIXA 4JC0A 3EN2A 1EYGA 2HCIA 3HOYH 1CT1D 2FJ2A 3I4NB 2QDLA 3UDXA 4DV6L 1SDFA 4JYAQ 2NTSA 1K83H 2VS1A 1CI3M 4R4CA 2I46A 1HZBA 1D1KA 3SDZA 1RL2A 1Y1WH 1SE3A 5IYBG 3H3VH 3VYTA 3PF4A 3CCQA 3HG9A 1EQTA 3BU2A 2UXDL 2IJ0A 1KIXA 2B2VC 3CP0A 3DWQA 4CKEA 1Z9FA 2CH4W 1PXUA 1GUGA 3S1MH 3CU7A 1N33L 1ESFA 4P2CB 3DHQA 4YCUA 4HEDA 2E2JH 1CHQD 1A63A 4HJAA 1IYJB 4AIMA 1CKNA 1DYQA 3G48A 1V1QA 2KCMA 1C8CA 5IGCA 5FKAC 3EVQA 1VQ4A 3P20A 2A69C 2AHOB 1U4PA 2Q2TA 4LFBL 4CHTB 1AFPA 3I91A 1AE2A 4RHRA 3WWVA 1BUVT 3HOXH 1WTOA 5IT9E 2BDOA 4CKCA 1LT4D 5ELEA 1MSHA 2RSNA 1ASZA 1D7QA 3GDEA 2YU9H 2K33A 3CC2A 4J1MA 3A74A 5GAEC 3I7FA 4X62Q 4JI2Q 5FK9C 4A3MG 4BBRG 4BY1G 4R8NA 1PZKD 4LWCA 1HZ9A 3TS0A 1E24A 1PRTF 1VF7A 2TSSA 3J81E 3FPUB 3I55A 4FXKC 4RCOA 2RQXA 1NY4A 1D8LA 5HGQA 4LF9Q 1V43A 2UUCL 3BS1A 3A55A 3PUZA 2EY2A 4PZ6A 1K8AC 2PW7A 4YCVA 3ND8A 1A3UA 1IZ6A 2RBMA 1EY5A 4MNOA 4N9TA 3H0GB 2O5IC 2DY8A 3GTOB 3K7AH 4FP5D 2VB3X 5M3FG 2B29A 2WB1G 2CWPA 3S2HB 2K4KA 4WRDA 2RKSA 2BCOA 1SYBA 2LS01 2DGYA 2D5DA 1JB7A 2HD3A 3O13A 1A2TA 1YBYA 3QOLA 1PDQA 2K5VA 1UEAB 1S40A 1O78A 2EJGC 3JC66 1OO9B 1PTOH 1YHQA 3VYSA 1SROA 1I3QH 3PUWA 2CQAA 1HNXL 4FF2A 1V8QA 4JI1Q 4DV2L 2PZWA 5M9OA 1B1ZA 3STBC 2YU9B 5CBAE 2K1BA 2JA7B 1KD1C 1D5MC 4GNXB 1EEID 2NVTH 1XNRL 1KHIA 1PMRA 4MHEA 3NXWA 4R4IA 2CKZB 5L37A 1I4RA 2H4OA 3X3NA 1PLFA 3NE5B 2LFNA 4CDEC 3KDFB 3K57A 4GKJL 2LY7A 3FDTA 4RH6A 1P8LA 4DUYL 1KQSA 1I94L 3IFTA 5EPLA 1H9SA 3BDLA 4Q0FA 3J80c 2YTYA 1QUQA 2IY5B 1H9SB 4DFAA 1R9TB 1Q1EA 3RN2A 1SJHD 2E2JB 1NUCA 1LABA 4Y52H 5JVH3 4BBRB 3ONAB 3FVQA 3GTMB 1U4LA 4IPDA 1ENFA 2OTJA 1NSNS 5IYDH 3LWEA 2WB1B 3K81C 2WFWA 1GKHA 3S1NH 2XVSA 4K2KA 4DV0L 4WORA 2VQFL 3JAMi 3OYYA 1C4QA 1WTPA 3PCOB 5ELCA 2B8GA 3D4WA 1YJ9A 2KOLA 4JI2L 1JORA 1QVGA 2B63G 4H7BA 4GS3A 5IYDG 1TY2A 4IUNA 4DNRB 5KYLA 2I5MX 4LF8Q 3NBHA 2PW5A 1F9RA 1QNKA 2PCFB 4BXXG 1TWCB 4YHHL 4XQQA 4ZQ3A 2ZM6L 2P5ZX 4JI3L 1Q3LA 1K73C 3CD6A 5GROA 4KY7A 2IX3A 2EYOA 3AFPA 5ISRA 1JWUD 2FMMA 4AYBE 2QW7A 1VMPA 5C44B 3M4QA 1WTRA 5CV9A 2NVQB 2CQOA 1W6JA 4F87A 4A3GG 2F0EA 4I7ZC 3CC7A 1D5ZC 3I8ZA 4QGUA 3RMHA 1BCPC 1VQCA 4CJ1B 1BBUA 1YNXA 3H15A 3G6JB 1IKMA 4LK1C 3MAQA 3T1HQ 1BCPF 4DV1Q 5IODA 3EIVA 3Q0AA 3GTLB 2B2TA 1YITA 4DAYA 3KK7A 5M5WH 2X69A 3PGZA 1PVOA 3PO2G 1I50H 3GTGB 4HTHA 4LF5L 4AQYL 1PH9A 1LT6D 1VQPA 5EPJA 1WTXA 1ILPA 1VQGA 3ICEA 1AE3A 2K5QA 5GAGC 4Y7NB 5NUCA 3RLOA 4WJWA 1LTSD 1RJTA 2NVYH 4RWSC 2JA8G 2F0SA 4RG1A 2ASBA 2ZM6Q 1E22A 3H91A 2HUGA 1KAAA 3W1GA 3J81L 4YWLA 3CW2C 4C3HB 3DWPA 4FF1A 2J7ZA 3A54A 3CCEA 1QOHA 1PHJA 1VQKA 4FO2A 4B3TL 1VQIA 2MHVA 2R7ZH 1MSGA 1ZXTA 4A3JG 4DF7A 5G3LF 4XDXA 4JI4L 2Z6BA 4JV5L 2IHEA 3HRZC 3T1YL 4L5QA 2PQEA 1LTTD 4TKOB 1RHPA 2BOSA 1L1OA 2JSOA 1CFMA 1QUQB 1ASYA 3RZOH 1JCKB 4DNIA 1CSQA 3VDYA 2MUYA 2Q2HA 4X3UA 4DK1A 2E8GA 2O5JC 5DEHA 1B3AA 1STBA 4JCVE 1QNUA 4NDXA 1FJGQ 2UXBQ 2SNSA 5JVG3 4N8X1 2A73B 3I4LA 1SFOB 2KHSA 4EX5A 5COYA 5C0XH 1A3TA 2F0MA 1C48A 4IUPA 3S1RH 1VQOA 2OCEA 4H02A 1FNUA 1ZEQX 5T1IA 5JOBA 2HT1A 4K5WA 5AFWA 4NXML 1QG7A 3KLSA 4P75A 2JN4A 1EY8A 3KLRA 4GLXA 5FJ8H 3QR8A 4QUFA 3NEMA 2ES2A 1BVSA 1UE5A 1S3OA 5IGFA 3HOZB 4BS9A 4JW0A 1CA6A 3K7UC 1I4HA 1UAPA 4JI1L 4K6DA 4HSPA 4UHVA 1SE2A 1EY9A 3RZDH 2AQ2B 2JA5G 3AB9A 1I5FA 2EYFA 1YEZA 5BR8L 1NJIC 3TS2A 3OWFA 2EOTA 2K28A 4RA8A 3AMUA 4DNTB 2V1CC 4F88A 4H13C 3I90A 3L2PA 3Q22A 1AZQA 2R93H 2L11A 1WCMG 1Y1WG 4DUYQ 2OTLA 4B3SL 2PI2E 3HOVH 2JA5B 1IL2A 1MJEA 2EXDA 2UU9Q 3M4OH 4C2MB 1LYLA 2ID0A 3PSIA 4KD4A 1E1TA 1HTLD 2E2DC 4DAYB 4QY7A 2O2LD 5AJ3L 3HOZG 1QZGA 1EWHA 4ABNA 3K0XA 4G7ZC 3HOYG 1Z6HA 4A3MB 3U9OA 2JK8A 1ZYRC 4ZUIA 4IPHA 2EXZA 1PFSA 3I4MH 3M7NA 1S5DD 1Q82C 1Z7TA 2KENA 1II3A 3C3LA 2NB0A 2ATWA 1B3QA 2L1BA 4DK6C 1VQ5A 1VMCA 4NPSA 3KOJA 4DR6L 1DONA 2N49A 3NTKA 4WFN3 1CZWA 3BDOA 3KDFA 3MEFA 2NVXB 2NZOA 5M3FB 1YHAA 3DEOA 1W6KA 2HIVA 3EQLC 4L63B 4JYAL 4FXDA 2QCPX 1VQ7A 4A3DG 2K5NA 4L5TA 1LT3D 4EQNA 3HEJA 4X65Q 1X3PA 2MQHA 1X54A 1G2TA 2XWBB 1E7ZA 1B2TA 1ET6A 2OT2A 4TQUS 3D31A 1H9KA 1EOTA 5M5XB 4IJLA 1EIGA 2WP8J 1GXDC 4DXFA 1JJCB 1UE1A 4IFDJ 1F9QA 2WAQE 2WINB 2A8VA 5IWAL 2NTTA 4EQ5A 4JI0L 2B2YC 2CWAA 2F52A 2E2HB 5KGUA 3OIQA 4QJFA 3J7YW 2O4XA 2YTXA 4B3MQ 1VF5C 3HGBA 1SYFA 5JJIA 3A5ZB 2F4IA 5EGTA 2K5HA 1DOMA 4GOPB 5FLXL 4OO1G 3HS0C 3EA6A 4QB4A 4LFCQ 4DV5Q 3TRZA 5IY0A 3D8GA 5FO7B 1MJCA 3S17H 1TVXA 1Y8PB 2Z6KC 4PZ8A 3P7JA 4Q5VA 2JE6I 4K0KQ 3D0FA 5C4XB 3TBIB 2ZT9C 1ENCA 4GNXA 1W3SA 2EPBA 4IQZA 4BY7G 1XWEA 4LF6Q 1U9RA 4NKLA 4BWGB 4HSVA 2IL8A 4OO1I 3H09A 1OXTA 2MPMA 1GVPA 1C0AA 1V9PA 3V05A 4A3CG 1SNDA 5M3MG 2VQEQ 3J7AF 1QE6A 1H9MA 2Q8IB 1B4OA 1Q8KA 4BBSG 4KKSA 3U4ZA 1IBKQ 3JAMc 4IN3A 1DGSA 4LFBQ 2L9HA 2EE1A 1F2YA 2JQOA 2K7VA 5T1GA 2UUAQ 2KQ3A 1QVFA 2AUKA 1HUNA 1IYVA 1NAPA 2XWJB 5EBCA 2VB2X 1IBLQ 2A19A 2NVQH 4K2LA 2R7DA 4GLVB 1G6PA 3CPFA 4X6AH 2PPBC 1LACA 3MEHA 2FXQA 3PIP3 2QILA 2NVYB 3HOUG 4DV5L 3KBXA 1MBYA 3M85A 4DR4L 5J22A 2R3ZA 1PH7A 1TY0A 3SK5A 4DR6Q 2IWHA 2YV5A 5CV6A 1STYA 1EFID 4K8IA 3K80C 1QCBD 1A2UA 1LT5D 1GUTA 1IBMQ 5K36G 2Z4IA 1SNQA 4X3TA 2Q2UA 5KEEA 1WTQA 4S3SA 4K14A 1HR0W 4C3IH 3BDCA 3J7A5 4XTCS 3C2PA 3K6OA 1UEBA 2CVRA 4CDCC 2R93B 1JR0D 2EYHA 1EIFA 2B2YA 2JA8B 3KBGA 4HN7A 4XT3B 2NZ1D 2UXBL 4YY3Q 1KNEA 4MZ9A 2CFMA 1YZ6A 1FR3A 3N52A 3SK4A 1AP0A 3ERSX 5BN5A 2R7ZB 5E7NA 5C4XG 1XNQQ 2NN6G 3I4NH 1N33Q 3NHHA 2LMCB 4UAIA 3S15B 4LUZA 3FKIB 1EY7A 4JI8L 2X6GA 3FHWA 1X3QA 3CQZB 2WKCA 1NMFA 5IYCH 4A3LH 3EFXD 4JI7L 2A74C 3CC4A 2MO1A 1HHVA 2F0PA 5DM73 5DAUA 4KY6A 5JEAG 2NN6I 3S1QH 5IP9H 3TREA 1U4RA 1QWYA 4O2DA 4DR3L 1Y1VG 5JAVA 2F0KA 5ELOA 3I3CA 4RFBA 4IPGA 2PZUA 3SEBA 1K0SA 1BKBA 2NBFA 1XXGA 3MXNA 3PUYA 3DXJC 2A6ED 4NXMQ 1AN8A 5C4JB 3QO2A 3TDQA 2G9HD 1MKHA 3MXNB 1Y8NB 4KI0A 4KMUC 4B3SQ 2RDFA 3TZUA 4DV1L 1NTGA 2NZHA 3KJPA 3FRPB 3L0OA 1HFGA 4UP9A 4C3HH 1K28A 1XPRA 2C35B 2FFKB 3TQYA 1SJED 1WTHA 3CRLC 4JBWA 3WOEA 1H9RA 2BH2A 2B3GA 5EQ0A 3RD4A 1E1OA 4A3EB 2F3IA 1BCPD 4KKTA 4DR5Q 4R8IA 1C7YA 4GLAC 3UI2A 1DD2A 3MXPA 3CMAA 4B3RL 3KUPA 4JVZA 2B2VA 4DR7L 4IALA 1HFNA 1KLGD 3CCLA 3VYUA 3T13A 3I72A 1EWCA 5I2XA 4JI3Q 4O1NA 1G8ZD 3MVVA 3HKZE 3CHBD 5HURA 2Q2IA 5BN4A 5KNDA 2D0OA 4LFAQ 1PRTC 5IT9c 1IBML 2A6HD 2ZJPA 4A93H 3K5LA 2XNAC 4CJ2C 5D3IB 3A8IE 4JI5L 2K50A 3D6CA 2CW0C 4A3KH 1HNXQ 3E3XA 1JOQA 4JOIA 1AH9A 3C46A 3Q8DA 1HZCA 5C44H 1SBBB 3QOJA 4DR2L 1FYCA 2L55A 1X9NA 4C56C 3NENA 3SK6A 1IBLL 2D9UA 2PQAB 1A3VA 4IUQA 5FOBB 5KYIA 1HNZL 4QQBX 1Q1BA 3R2TA 1VQFA 3IKJA 3GTKB 4CDFC 3MHBA 1XMQL 4XIGS 1K8OA 4X64Q 4DV3L 1SNOA 3D6WA 4K5VA 1CKOA 1H9JA 3NQIA 3TP7A 2UXDQ 4JI6L 1UNSA 1CM9A 3U9SA 2K75A 2WB1E 2K14A 2VQEL 2IT1A 1TT2A 2SNMA 3S16H 2OF1A 3L3OC 1XMQQ 4LFAL 1L0WA 4YIJA 5I9PA 1LM0A 3ULJA 2F3VA 4TSSA 2KEEA 1EZ6A 4AYBB 3Q24A 3MFGA 3AEVA 3ZJYC 1DJRD 4KN4C 5C4HA 2FINB 1B53A 5DM63 1JOOA 1D5XC 2E75C 2F0TA 2Z9HA 1HQMC 4B9WA 4M1UB 3RZOB 4DR4Q 1SMXA 2MGSA 4A3EG 1XTDA 1STAA 3ERQA 2L15A 4A4IA 2E5LQ 1VQMA 3DEPA 3ZYYX 1PRTD 1N34L 3F2UA 1SMYD 3H0GG 4YCWA 5CV7A 2VUMH 4FDBA 1Q81C 1HNWQ 2R7FA 1XX8A 1A0IA 1TQOA 4AYBG 4BA2I 1KNAA 2MJ8A 1F9PA 2XRSD 5FLMG 3HKSA 4A3IG 3PO3H 4LF4L 1YJWA 2DN8A 5IWAQ 1Q46A 2F4VQ 3KF6A 5I4DA 2KBNA 2L4NA 2R92B 1PA6A 2ICIA 4P72A 4YY3L 2HHHQ 3CQZH 4HJ9A 1VQNA 3TP5A 4DU9A 3BZDB 4DR3Q 1PFBA 4KJNA 1NR2A 4OX9L 2LKVA 4A3BH 4LF8L 4L5RC 1SE8A 1BBXC 4DV7L 1GJXA 2UUBL 3HOXB 4UP7A 5ELFA 1YVCA 3RNUA 4A3FH 4A3IH 3S2DH 4FVMA 4ULLA 3ND9A 1NMGA 4OXPA 4OIJA 1Y8OB 1LTRD 5EKLA 4ZUJA 3LWUA 2ZJRA 1IHZA 1TWHB 2VUMG 1R4QB 5E1FA 4KHPQ 1G6ZA 2NVTB 2K5WA 2AQ1B 4ZKBB 4HR7B 5LMNL 2JP1A 3DWAA 3GTGH 2JEAI 1I50B 2J0TD 3GTJB 2BA0A 1TWAH 3OOCA 4FXGC 3NK9A 2N55A 2TMPA 4FF4A 1N9WA 3A7LA 3K7AB 3CAMA 1HR0Q 2A69D 4NXNQ 4V0BA 3VR3A 2WAQB 2N8NA 1WFQA 3HOVB 2OEOA 1TXYA 3IAYA 3C1FA 2WV6D 4JBJA 3SXHA 4O42A 3MA2B 3R8BA 3OPOA 2ICEC 3T4AC 4LNQA 1X65A 1N32Q 3K5MA 2IHFA 1TS2A 1PYWD 4K6LA 3ULLA 2Z6KA 5IP7G 3F2DA 3TZDA 3L7ZC 5C3EH 3VR5A 3H6MA 2K04A 3J80L 4NB3A 2PNRC 2XRQD 3T51B 2QA4A 4R4TA 3A56A 5C3EG 1J5EL 4RHSA 1QJOA 2F0QA 4FYDA 1B9MA 3U58A 3M3YH 1NBWA 1TS5A 2B2WC 4O0AA 4BA1I 4RCNA 5IGEA 1KTKA 1G51A 4JI7Q 3VR6A 3WDNA 1LUZA 1E3PA 2RDGA 1EYCA 1WYDA 3GTQB 1STNA 5FO8B 3VR4A 1VQ6A 1G91A 1PTOB 4A75A 5KNBA 2HDLA 1S72A 4Y7NH 2BDNA 1HCZA 1PH8A 4KN7C 3DLLA 1J9OA 4P74A 1D6EC 2Y0SG 1PH5A 2CH4A 2IX0A 3FMCA 1V1PB 4JK1C 4G4KA 4C3JH 1VQBA 1BCPB 1SYDA 4LF4Q 1TWFH 5IE8A 1CA5A 1STGA 2F0LA 3WOFA 3I56A 2XTIA 1PH1A 1JICA 1K0RA 1M8AA 3TMEA 2QEXA 2GVBA 3UE1A 4DAMA 4B3TQ 4IUTA 3A0JA 2KHJA 3E6ZX 5CV5A 5KRUA 3G71A 1EU3A 4ZRZA 2VXWA 1BOSA 2JA7H 2AMCB 1EOVA 3K59A 3S9WA 2IW3A 3J80E 1PH4A 3RUZA 5FO9B 3U4VA 2G5DA 1HXYD 4XYQA 1JB3A 3FKIH 1J8IA 2F0FA 1K83B 1G291 1X3EA 5ELDA 5CGKA 4ODGA 2B63B 1SE4A 3OSOA 5BN3A 2NVXH 5JPNC 2A68D 2KJXA 4QL5A 2ZTCA 1T5EA 4X62L 4B3RQ 2JEBI 1Y1VH 1EQQA 4K5XA 3UDFA 4XYOA 3PMFA 4DUZQ 3FPPA 5JEAH 3S2HH 4GOPC 2R92H 4F7XA 2EY5A 5I9OA 1SNCA 1S5FD 1ET9A 4P71A 4A3LG 1UE7A 5IYCG 3H0GH 1K3RA 1XJVA 1TS3A 3HOWH 1PH2A 1K8GA 1PFNA 1OXUA 3KYHC 4KY5A 1EY4A 3HOWG 5LL6X 1HNZQ 1Y1VB 2VZAA 1N8RC 2NN6H 3I4NG 4DV2Q 2K05A 3F8TA 3S1MB 3GTQH 1FGUA 1O7IA 3GTKH 2D2CC 5KIXA 2F4VL 1VQ8A 2ALYB 2N78A 2L0CA 4DV6Q 2DJGC 1JC7A 4R9WA 5I6YA 1K9MC 4N9PA 2IPKD 4IO9A 2RA4A 2I5HA 3D4DA 4QUCA 4JOIC 1I6HH 1I4GA 4U673 4ID6A 4CJ0B 2R61A 2D62A 4LF5Q 1ICWA 4KKUA 4A3KB 3FKIG 2SDFA 4R1JA 2KCCA 5K36H 2SOBA 5JJZA 3E0JA 4PMBA 1YNJC 4TVAB 2N3SA 3S1NB 1VQAA 5C4JH 2F0IA 2B2TC 2JA6B 1ONLA 4X66Q 4H0LC 4GOPA 1L1OB 1SSOA 3MXUA 3QB3A 3PIOA 3H3VI 4MTNA 1Y69U 4CKBA 4HIKA 1L0XB 4KLKA 1LO5D 1RTOA 1FNWA 2QEJC 1X3GA 4PV1C 2V4DA 4BY7B 4K8JA 4L5SA 4JI5Q 1EY6A 3W3AA 3J81i 2WIIB 5CBEE 1Y1WB 1L2FA 4I7AA 4FNFA 4A3IB 3S2DB 4M8AA 1S5CD 1XNRQ 1Q86C 2YYZA 3OIPA 1HPCA 2OQKA 3SGIA 5M3MH 4JI8Q 3MC0B 3F2CA 5C6AA 1BBWA 2LXJA 3B6YA 5G3LD 5D65A 4ZCKA 1CK1A 1EYDA 2C5CA 5IGGA 1PH6A 3G6EA 5JJLA 1F77A 3FP9A 3CPWA 3CMEA 3TP6A 2IX1A 4KK7A 3E9IA 2ZTEA 2K32A 2N88A 2ENBA 1X3FA 1KL9A 4HIDA 5ELNA 4MTKA 2F1MA 2BA1A 5EJWA 1LTBD 4OO1H 2RHQB 1W2BA 2HQLA 5A35A 5J3BA 5LHY1 1I6HB 3G4SA 5HGTA 2ZJQA 1TWFB 3NBHB 4HMJA 5KNCA 1A6XA 5IIFA 1IBKL 3GD7A 3RLNA 3M9BA 5CR3A 1ZKOA 1TWGB 4GZYC 3LX0A 2AWOA 1WCMB 1SLJA 4DN4M 1SEBD 2WKDA 1VCIA 3BJUA 5IP9G 3BVGA 2K03A 2E2HH 4LUOA 1QB5D 1SRUA 2PI2A 4QF4A 3S24A 4A3DB 1IW7C 4DV4Q 1WI5A 1BQQT 3A8JE 3L9AX 3I4MB 2UUCQ 2HDMA 2PQAA 1CHPD 3BVZA 4RGMA 3MFYA 3NSWA 4XXEA 3PUVA 3CXCA 1IKLA 3BYYB 1HTPA 3HZXA 4OL7A 3PIO3 4HJ5A 4KHVA 4EQOA 1WTWA 1EFWA 4MIUA 4GKKQ 4KTAA 2EJFC 2K6AA 4POGA 2R92G 3R2IA 4BBSB 3GTPH 1STHA 4DV3Q 3MZ5A 3OMGA 2EDGA 1IW7D 1EQRA 4UP8A 4ZKCB 3PV0A 1KDAA 5CMDA 4KJOA 5C3EB 1HH2P 4EQPA 4XT1B 3E0EA 2R6GA 3OMCA 4CDDC 2F03A 1HA6A 5FLXc 1LTID 3I4MG 4A76A 3CKIB 4DPGA 3NTIA 2ZXRA 3HP3A 1WTVA 4TRDA 1CKNB 1EU4A 1KAWA 3T1YQ 1DXMA 1A15A 4R4QA 3LNNA 1OXXK 2RCNA 2PZTA 2FHTA 2F0UA 1CKMA 5A2QL 4DR2Q 1TS4A 1SNMA 2M9VA 3D3RA 4A93B 2PMZE 4NP5A 3GV6A 3DM3A 2YTVA 2JA7G 4DA2A 2KA7A 2DUDA 3OTOQ 1MGSA 1M4VA 3TN2A 3Q23A 5FLMH 3HOVG 2Y0SB 4WJ3M 1WCMH 3CCUA 1PZID 1BNZA 2I0QA 2R93G 1PZJD 4GKKL 4LJZC 2XSCA 1K8MA 3HOUH 4ME5A 3JAML 4DR7Q 4OEMB 4PQXA 1CSPA 4JI0Q 3F2BA 5TSSA 2Z4HA 3GO5A 2F0GA 1KRSA
chains in the Genus database with same CATH topology
1PA6A 4LFCL 1UE5A 4IFDG 3M4PA 3HFZB 1S3OA 4P72A 4YY3L 1YIJA 3AFQA 3F1ZA 2HHHQ 3CQZH 3K7UC 4HJ9A 1M90C 4JI1L 1VQNA 4BBRH 4DR3Q 3GTJH 4A3MH 3RZDH 4OX9L 4A3BH 4LF8L 4L5RC 1PYBA 2JA5G 1I5FA 1SE8A 4DR5L 1YEZA 2QGQA 4HIMA 5BR8L 4ALPA 1NJIC 3TS2A 4GNXC 1Z47A 2ES2A 4DV7L 1EUJA 2V1CC 1B8AA 1VQLA 2UUBL 4UP7A 2JA6G 1YVCA 3L2PA 3RNUA 4A3FH 4A3IH 3S2DH 4IFDI 4AQYQ 1NMGA 4APVA 3T1HL 1TWHH 2VQFQ 2R93H 1WCMG 4OXPA 1Y1WG 4QIWE 4DUYQ 2OTLA 2PI2E 4B3SL 3HOVH 2ZJRA 2E5LL 1IL2A 2KHIA 1MJEA 2EXDA 3RLFA 1PV4A 2UU9Q 2VUMG 3M4OH 1LYLA 1PYSB 1YHBA 2ID0A 4AH6A 4DK3C 1N36Q 4KHPQ 3PSIA 1E1TA 5C0XG 2GVAA 2RHSB 4QY7A 4DAYB 1JT8A 5AJ3L 4NXNL 3HOZG 5LMNL 4X64L 1QZGA 1L1OC 1QZHA 3GTGH 2JEAI 3K0XA 4DR1Q 4IPCA 3BZCA 5GAHC 3J7ZC 3HOYG 2BA0A 1TWAH 2CCZA 2JK8A 1N9WA 1JJGA 1WJJA 3NELA 4IPHA 4KHPL 4LF9L 3CAMA 1PFSA 1OXSC 1HR0Q 4POFA 5IP7H 5M5YH 3I4MH 4A3DH 1RIPA 4NXNQ 3HKZG 4B3ML 3M7NA 1Q82C 4C2MH 1Y14B 2KENA 2N8NA 2KCTA 5C44G 1WFQA 1B70B 4DR1L 3GTOH 1TXYA 4UPAA 2ATWA 2AWNA 2MNAA 4JBJA 4DK6C 1VQJA 4LF7Q 1VQ5A 4UY8C 4NPSA 1H95A 5IYBH 4DV0Q 3KOJA 4DR6L 4DV7Q 4JBMA 4LNQA 1X65A 2N49A 4J15A 1JMCA 4JBKA 2IHFA 1UWVA 1N32Q 2R7ZG 1X6OA 5JJKA 3KDFA 4A93G 4RMFA 1MIUA 1GD7A 3MEFA 2NZOA 1YHAA 4JYAL 2HIVA 3LGJA 4DKAC 1VQ7A 4LF7L 3ULLA 2Z6KA 5IP7G 3F2DA 4A3DG 2K5NA 4L5TA 1C0AA 3I4OA 3L7ZC 2HIXA 4JC0A 4X65Q 2MQHA 5C3EH 1X54A 3EN2A 1E7ZA 4NB3A 2QA4A 2JA8H 1EYGA 4R4TA 3HOYH 1SR3A 4TQUS 5C3EG 5M5XH 3D31A 1YJNA 1J5EL 4JYAQ 4DV6L 3UDXA 1HJPA 1LTLA 3U58A 3M3YH 3J81c 5LMNQ 1HZAA 1NBWA 1K83H 2WP8J 2VS1A 4IJLA 4GKJQ 4O0AA 4BA1I 4R4CA 2LSSA 1JJCB 3OW2A 1HZBA 4PG3A 1UE1A 3PO2H 1G51A 4HJ7A 4JI7Q 4IFDJ 2Y0SE 1RL2A 2WAQE 2A8VA 1HNWL 1Y1WH 5IWAL 4EQ5A 4JI0L 4JG2A 5IYBG 2UUAL 3H3VH 1OTCA 3PF4A 1LUZA 2CWAA 2F52A 3CCQA 3BU2A 1E3PA 4A3FG 1WYDA 4QJFA 2UXDL 2YTXA 1KIXA 4B3MQ 3CP0A 2UXCQ 1VQ6A 1Q12A 4A75A 1Z9FA 1S72A 4Y7NH 3KJOA 5JJIA 1PH8A 3A5ZB 1N34Q 5HY6A 3S1MH 4A3BG 2K5HA 3DLLA 4LF6L 4GOPB 4P74A 1N33L 4A3GH 2Y0SG 4OO1G 1PH5A 4LFCQ 4YCUA 4DV5Q 3TRZA 2VL6A 5IY0A 3KF6B 2IX0A 1MJCA 2E2JH 3S17H 3CCRA 2Z6KC 2MFIA 4PZ8A 1IYJB 4HJAA 4C3JH 1FVIA 4AIMA 1A63A 1CKNA 3G48A 1VQBA 2JE6I 4K0KQ 1V1QA 4DV4L 3D0FA 1QVCA 2KCMA 1YI2A 4GNXA 3HOZH 1W3SA 4OWXB 4LF4Q 4BY7G 1TWFH 3UDGA 5IE8A 3RN5A 1VQ4A 4LF6Q 5EAYA 1UE6A 2AHOB 3I56A 2XTIA 1PH1A 4BXXH 3PO3G 2PNHA 1K0RA 2Q2TA 4LFBL 4OO1I 3S15H 1OXTA 2QEXA 1AE2A 2GVBA 1GVPA 5LMNW 3UE1A 4DAMA 2VY3A 4GN4B 3WWVA 1V9PA 4B3TQ 3I2ZA 4IOAA 4A3CG 5M3MG 3A0JA 2KHJA 3HOXH 2VQEQ 3G71A 3CCMA 2E2IH 1Q8KA 2JA7H 1T9HA 2AMCB 4BBSG 1ASZA 5LMUL 1D7QA 1EOVA 3U4ZA 3GDEA 1IBKQ 2YU9H 1N36L 3JAMc 3OTOL 3CC2A 1DGSA 2JA5H 5BR8Q 3A74A 5GAEC 3I7FA 1PH4A 1VQHA 4KHZA 3U4VA 4JI2Q 4X62Q 4LFBQ 4A3MG 2ZTDA 1SFOH 2JQOA 2UUAQ 4BBRG 4BY1G 1QVFA 4A3EH 3FKIH 4LWCA 3TS0A 1HZ9A 1E24A 1IBLQ 4DUZL 3I55A 1G291 2A19A 1X3EA 1C9OA 2NVQH 2R7DA 4GLVB 1NY4A 1D8LA 5HGQA 2NVXH 4LF9Q 1V43A 5C0XI 2UUCL 1G6PA 3CPFA 4X6AH 3PUZA 4QL5A 2ZTCA 3STBD 4X62L 3S14H 2JEBI 4B3RQ 2RF4A 2FXQA 1P16A 1Y1VH 4PZ6A 1K8AC 4GN3B 1EQQA 4YCVA 3HOUG 4DV5L 1IZ6A 3M85A 3UDFA 4DR4L 2MO0A 1EWIA 4MNOA 4DUZQ 1PH7A 4OWWB 3S2HH 4YHHQ 1VQ9A 4GOPC 1I94Q 2R92H 4DR6Q 4IJHA 1VQDA 3K7AH 2YV5A 4P71A 5M3FG 1UE7A 2B29A 2WB1G 5IYCG 2CWPA 1K3RA 3H0GH 4A3LG 1XJVA 2K4KA 3K8AA 3AYHB 3HOWH 1PH2A 1K8GA 1OXUA 3K80C 3KYHC 2DGYA 1VS0A 1IBMQ 1JB7A 3HOWG 5K36G 1SN8A 1HNZQ 2VZAA 1N8RC 4WJ4A 2Q2UA 1YBYA 3UE0A 3I4NG 2K5VA 4LUVA 4DV2Q 3W5OA 1HR0W 3F8TA 3CCJA 4C3IH 1PH3A 1FGUA 1O7IA 3GTQH 3GTKH 3J7A5 1S40A 2F4VL 4HIOA 2ALYB 4XTCS 2N78A 1J5EQ 3JC66 1VQ8A 4DV6Q 2HHHL 1UEBA 1K9MC 3UDIA 1YHQA 1EIFA 4IO9A 2I5HA 1SROA 1I3QH 3PUWA 2UXBL 4YY3Q 4JOIC 1HNXL 1I6HH 4MZ9A 2CFMA 3EBEA 4JI1Q 4DV2L 1YZ6A 2UXCL 2D62A 4A3JH 4A3KG 3STBC 3ERSX 5E7NA 1WOCA 1KD1C 4LF5Q 4JV5Q 4GNXB 5C4XG 1A8VA 1XNQQ 3GTLH 2NN6G 3I4NH 2NVTH 1XNRL 1N33Q 3FKIG 1KHIA 4X66L 4R1JA 1VQEA 4R4IA 4LUZA 2CKZB 2D0PA 4JI8L 4GN5A 2N3SA 4TVAB 3FHWA 1VQAA 3KDFB 5C4JH 4GKJL 4DUYL 1P8LA 1KQSA 1NMFA 5IYCH 5M3FH 1I94L 4JI7L 4A3LH 3CC4A 2MO1A 5JEAJ 3BZKA 4A3CH 3J80c 4X66Q 2JJQA 2YTYA 4GOPA 1QUQA 3RR5A 5JEAG 2IY5B 2VNUD 2NN6I 3S1QH 5IP9H 1L1OB 3TREA 1Q1EA 3PIOA 3RN2A 3H3VI 4MTNA 1EIYB 4O2DA 4DR3L 4HIKA 1Y1VG 4Y52H 4KLKA 1R9TH 4BY7H 5ELOA 1FL0A 1TWCH 4IPGA 3J80i 1BKBA 1X3GA 4IPDA 2OTJA 4P73A 5IYDH 4IOCA 3K81C 3PUYA 3TEHB 2WFWA 1GKHA 1OXVA 4JI5Q 4L5SA 4NXMQ 4BY1H 3J81i 3KFUA 3S1NH 4DV0L 2VQFL 1MKHA 1JE5A 1L2FA 3MXNB 3OYYA 4YWKA 3JAMi 4KI0A 1N32L 4B3SQ 3E9HA 3PCOB 4DV1L 1XNQL 1NTGA 2NZHA 2UU9L 1XNRQ 3KJPA 1Q86C 3L0OA 5H1SE 1YJ9A 3PF5A 4JI2L 4UP9A 2YYZA 1QVGA 4C3HH 3PIPA 2B63G 1XPRA 5DLQE 1XPOA 2OQKA 2C35B 3SGIA 4GS3A 4JI8Q 3TQYA 5M3MH 5IYDG 3HOXG 3F2CA 4JBWA 1GO3E 1BBWA 2BH2A 2LXJA 3B6YA 2B3GA 2XGTA 4OX9Q 2I5MX 4LF8Q 2H5XA 1E1OA 2F3IA 1PH6A 3G6EA 4BXXG 4DR5Q 1C7YA 4YHHL 4GLAC 5JJLA 2ZM6L 3CMAA 4B3RL 4JI3L 3FP9A 3CPWA 1K73C 3CD6A 5GROA 3CMEA 3J81j 2IX1A 3AFPA 3U50C 2GN5A 2WAQG 4AYBE 2ZTEA 3E9IA 4DR7L 1X3FA 3M4QA 1KL9A 4HIDA 5ELNA 2AKWB 3CCLA 2B63H 1KC8C 1M1KC 2CQOA 2BA1A 4JI3Q 4A3GG 2RHQB 1W2BA 3CC7A 2HQLA 3AQQA 1Q7YC 3HKZE 4QGUA 2OQ0A 5J3BA 2Q2IA 1JJ2A 1NE3A 2D0OA 4LFAQ 3G4SA 2ZJQA 1VQCA 5IT9c 4JI4Q 1BBUA 1IBML 1YNXA 3H15A 2ZJPA 4A93H 3T1HQ 5C4XH 4DV1Q 1GM5A 3NBHB 4JI5L 2K50A 3EIVA 1IBKL 3GD7A 3RLNA 3M9BA 4A3KH 1AH9A 1YITA 1HNXQ 5M5WH 2JA9A 4JOIA 4OWTB 2UUBQ 3PGZA 1CUKA 2AWOA 2LXKA 4YWMA 3PO2G 3Q8DA 4OONA 1SLJA 1I50H 1PVOA 4LF5L 1HZCA 5C44H 4AQYL 1PH9A 4DR2L 1A62A 1VQPA 1VCIA 1VQGA 3BJUA 3PUXA 1IXRA 1X56A 1X9NA 4HJ8A 3ICEA 1AE3A 5IP9G 5GAGC 3NENA 1IBLL 1FJGL 2E2HH 1SRUA 4LUOA 2PI2A 1U5KA 2Z0SA 2PQAB 3RLOA 3S24A 1HNZL 4QQBX 1Q1BA 4DV4Q 1WI5A 2UUCQ 1VQFA 1U0LA 3KF8B 2EQSA 2PQAA 2NVYH 3W1BA 2JA8G 1XMQL 4XIGS 4X64Q 4DV3L 4RG1A 2BH8A 2ASBA 2ZM6Q 1CKOA 1E22A 3PUVA 3W1GA 3CXCA 2K52A 4YWLA 4R4OA 3CW2C 5GADC 5C0XJ 2UXDQ 4JI6L 3CCEA 5LMUQ 4HJ5A 2K75A 1XMOL 1PHJA 2WB1E 1VQKA 1EFWA 4B3TL 1VQIA 4GKKQ 2K14A 2VQEL 2IT1A 1HR0L 2R7ZH 2A1AA 4POGA 2R92G 3S16H 1XMQQ 4LFAL 3GTPH 1X55A 1L0WA 4DV3Q 4A3JG 4JI4L 4JV5L 1LM0A 3ULJA 1B7YB 2IHEA 1J6QA 1EQRA 4UP8A 3T1YL 1XPUA 4L5QA 3PV0A 3CCSA 2VW9A 3CCVA 4ME3A 1HH2P 1L1OA 3AEVA 3ZJYC 4K0KL 3E0EA 1QUQB 2R6GA 2I5LX 5FLXc 1ASYA 3RZOH 3I4MG 4X65L 4A76A 1KRTA 5GQOA 4DNIA 4DPGA 2EIFA 1CSQA 3KLWA 3VDYA 2Q2HA 1CKNB 1KAWA 3T1YQ 2E8GA 1KXLA 4DR4Q 1SMXA 3ULPA 4A3EG 4R4QA 3CF5A 1FJGQ 4JCVE 2OWOA 1OXXK 1XTDA 2RCNA 2UXBQ 2L15A 4DR2Q 1CKMA 4A4IA 2E5LQ 1VQMA 4EX5A 1N34L 3A5UA 2PMZE 5FJ8G 3DM3A 4PMWA 3H0GG 2YTVA 4YCWA 2JA7G 4BBSH 4PZ7A 2DUDA 5AJ3Q 4FDBA 1Q81C 3OTOQ 2VUMH 3S1RH 1VQOA 3GTMH 2OCEA 2R7FA 1HNWQ 5FLMH 4H02A 1A0IA 4JI6Q 3HOVG 4WJ3M 4AYBG 1WCMH 4BA2I 3CCUA 2R93G 2I0QA 1XMOQ 5FLMG 4LW1A 4GKKL 3HKSA 4A3IG 2HT1A 3PO3H 3HOUH 4LF4L 4NXML 1YJWA 3ER0A 4P75A 2JA6H 4DR7Q 5IWAQ 4GLXA 1CSPA 1Q46A 2F4VQ 3KF6A 4JI0Q 5FJ8H 3F2BA 1TWGH 3GO5A 2KBNA 3NEMA 1KRSA 3IRBA 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PA6 A;  4LFC L;  1UE5 A;  4IFD G;  3M4P A;  3HFZ B;  1S3O A;  4P72 A;  4YY3 L;  1YIJ A;  3AFQ A;  3F1Z A;  2HHH Q;  3CQZ H;  3K7U C;  4HJ9 A;  1M90 C;  4JI1 L;  1VQN A;  4BBR H;  4DR3 Q;  3GTJ H;  4A3M H;  3RZD H;  4OX9 L;  4A3B H;  4LF8 L;  4L5R C;  1PYB A;  2JA5 G;  1I5F A;  1SE8 A;  4DR5 L;  1YEZ A;  2QGQ A;  4HIM A;  5BR8 L;  4ALP A;  1NJI C;  3TS2 A;  4GNX C;  1Z47 A;  2ES2 A;  4DV7 L;  1EUJ A;  2V1C C;  1B8A A;  1VQL A;  2UUB L;  4UP7 A;  2JA6 G;  1YVC A;  3L2P A;  3RNU A;  4A3F H;  4A3I H;  3S2D H;  4IFD I;  4AQY Q;  1NMG A;  4APV A;  3T1H L;  1TWH H;  2VQF Q;  2R93 H;  1WCM G;  4OXP A;  1Y1W G;  4QIW E;  4DUY Q;  2OTL A;  2PI2 E;  4B3S L;  3HOV H;  2ZJR A;  2E5L L;  1IL2 A;  2KHI A;  1MJE A;  2EXD A;  3RLF A;  1PV4 A;  2UU9 Q;  2VUM G;  3M4O H;  1LYL A;  1PYS B;  1YHB A;  2ID0 A;  4AH6 A;  4DK3 C;  1N36 Q;  4KHP Q;  3PSI A;  1E1T A;  5C0X G;  2GVA A;  2RHS B;  4QY7 A;  4DAY B;  1JT8 A;  5AJ3 L;  4NXN L;  3HOZ G;  5LMN L;  4X64 L;  1QZG A;  1L1O C;  1QZH A;  3GTG H;  2JEA I;  3K0X A;  4DR1 Q;  4IPC A;  3BZC A;  5GAH C;  3J7Z C;  3HOY G;  2BA0 A;  1TWA H;  2CCZ A;  2JK8 A;  1N9W A;  1JJG A;  1WJJ A;  3NEL A;  4IPH A;  4KHP L;  4LF9 L;  3CAM A;  1PFS A;  1OXS C;  1HR0 Q;  4POF A;  5IP7 H;  5M5Y H;  3I4M H;  4A3D H;  1RIP A;  4NXN Q;  3HKZ G;  4B3M L;  3M7N A;  1Q82 C;  4C2M H;  1Y14 B;  2KEN A;  2N8N A;  2KCT A;  5C44 G;  1WFQ A;  1B70 B;  4DR1 L;  3GTO H;  1TXY A;  4UPA A;  2ATW A;  2AWN A;  2MNA A;  4JBJ A;  4DK6 C;  1VQJ A;  4LF7 Q;  1VQ5 A;  4UY8 C;  4NPS A;  1H95 A;  5IYB H;  4DV0 Q;  3KOJ A;  4DR6 L;  4DV7 Q;  4JBM A;  4LNQ A;  1X65 A;  2N49 A;  4J15 A;  1JMC A;  4JBK A;  2IHF A;  1UWV A;  1N32 Q;  2R7Z G;  1X6O A;  5JJK A;  3KDF A;  4A93 G;  4RMF A;  1MIU A;  1GD7 A;  3MEF A;  2NZO A;  1YHA A;  4JYA L;  2HIV A;  3LGJ A;  4DKA C;  1VQ7 A;  4LF7 L;  3ULL A;  2Z6K A;  5IP7 G;  3F2D A;  4A3D G;  2K5N A;  4L5T A;  1C0A A;  3I4O A;  3L7Z C;  2HIX A;  4JC0 A;  4X65 Q;  2MQH A;  5C3E H;  1X54 A;  3EN2 A;  1E7Z A;  4NB3 A;  2QA4 A;  2JA8 H;  1EYG A;  4R4T A;  3HOY H;  1SR3 A;  4TQU S;  5C3E G;  5M5X H;  3D31 A;  1YJN A;  1J5E L;  4JYA Q;  4DV6 L;  3UDX A;  1HJP A;  1LTL A;  3U58 A;  3M3Y H;  3J81 c;  5LMN Q;  1HZA A;  1NBW A;  1K83 H;  2WP8 J;  2VS1 A;  4IJL A;  4GKJ Q;  4O0A A;  4BA1 I;  4R4C A;  2LSS A;  1JJC B;  3OW2 A;  1HZB A;  4PG3 A;  1UE1 A;  3PO2 H;  1G51 A;  4HJ7 A;  4JI7 Q;  4IFD J;  2Y0S E;  1RL2 A;  2WAQ E;  2A8V A;  1HNW L;  1Y1W H;  5IWA L;  4EQ5 A;  4JI0 L;  4JG2 A;  5IYB G;  2UUA L;  3H3V H;  1OTC A;  3PF4 A;  1LUZ A;  2CWA A;  2F52 A;  3CCQ A;  3BU2 A;  1E3P A;  4A3F G;  1WYD A;  4QJF A;  2UXD L;  2YTX A;  1KIX A;  4B3M Q;  3CP0 A;  2UXC Q;  1VQ6 A;  1Q12 A;  4A75 A;  1Z9F A;  1S72 A;  4Y7N H;  3KJO A;  5JJI A;  1PH8 A;  3A5Z B;  1N34 Q;  5HY6 A;  3S1M H;  4A3B G;  2K5H A;  3DLL A;  4LF6 L;  4GOP B;  4P74 A;  1N33 L;  4A3G H;  2Y0S G;  4OO1 G;  1PH5 A;  4LFC Q;  4YCU A;  4DV5 Q;  3TRZ A;  2VL6 A;  5IY0 A;  3KF6 B;  2IX0 A;  1MJC A;  2E2J H;  3S17 H;  3CCR A;  2Z6K C;  2MFI A;  4PZ8 A;  1IYJ B;  4HJA A;  4C3J H;  1FVI A;  4AIM A;  1A63 A;  1CKN A;  3G48 A;  1VQB A;  2JE6 I;  4K0K Q;  1V1Q A;  4DV4 L;  3D0F A;  1QVC A;  2KCM A;  1YI2 A;  4GNX A;  3HOZ H;  1W3S A;  4OWX B;  4LF4 Q;  4BY7 G;  1TWF H;  3UDG A;  5IE8 A;  3RN5 A;  1VQ4 A;  4LF6 Q;  5EAY A;  1UE6 A;  2AHO B;  3I56 A;  2XTI A;  1PH1 A;  4BXX H;  3PO3 G;  2PNH A;  1K0R A;  2Q2T A;  4LFB L;  4OO1 I;  3S15 H;  1OXT A;  2QEX A;  1AE2 A;  2GVB A;  1GVP A;  5LMN W;  3UE1 A;  4DAM A;  2VY3 A;  4GN4 B;  3WWV A;  1V9P A;  4B3T Q;  3I2Z A;  4IOA A;  4A3C G;  5M3M G;  3A0J A;  2KHJ A;  3HOX H;  2VQE Q;  3G71 A;  3CCM A;  2E2I H;  1Q8K A;  2JA7 H;  1T9H A;  2AMC B;  4BBS G;  1ASZ A;  5LMU L;  1D7Q A;  1EOV A;  3U4Z A;  3GDE A;  1IBK Q;  2YU9 H;  1N36 L;  3JAM c;  3OTO L;  3CC2 A;  1DGS A;  2JA5 H;  5BR8 Q;  3A74 A;  5GAE C;  3I7F A;  1PH4 A;  1VQH A;  4KHZ A;  3U4V A;  4JI2 Q;  4X62 Q;  4LFB Q;  4A3M G;  2ZTD A;  1SFO H;  2JQO A;  2UUA Q;  4BBR G;  4BY1 G;  1QVF A;  4A3E H;  3FKI H;  4LWC A;  3TS0 A;  1HZ9 A;  1E24 A;  1IBL Q;  4DUZ L;  3I55 A;  1G29 1;  2A19 A;  1X3E A;  1C9O A;  2NVQ H;  2R7D A;  4GLV B;  1NY4 A;  1D8L A;  5HGQ A;  2NVX H;  4LF9 Q;  1V43 A;  5C0X I;  2UUC L;  1G6P A;  3CPF A;  4X6A H;  3PUZ A;  4QL5 A;  2ZTC A;  3STB D;  4X62 L;  3S14 H;  2JEB I;  4B3R Q;  2RF4 A;  2FXQ A;  1P16 A;  1Y1V H;  4PZ6 A;  1K8A C;  4GN3 B;  1EQQ A;  4YCV A;  3HOU G;  4DV5 L;  1IZ6 A;  3M85 A;  3UDF A;  4DR4 L;  2MO0 A;  1EWI A;  4MNO A;  4DUZ Q;  1PH7 A;  4OWW B;  3S2H H;  4YHH Q;  1VQ9 A;  4GOP C;  1I94 Q;  2R92 H;  4DR6 Q;  4IJH A;  1VQD A;  3K7A H;  2YV5 A;  4P71 A;  5M3F G;  1UE7 A;  2B29 A;  2WB1 G;  5IYC G;  2CWP A;  1K3R A;  3H0G H;  4A3L G;  1XJV A;  2K4K A;  3K8A A;  3AYH B;  3HOW H;  1PH2 A;  1K8G A;  1OXU A;  3K80 C;  3KYH C;  2DGY A;  1VS0 A;  1IBM Q;  1JB7 A;  3HOW G;  5K36 G;  1SN8 A;  1HNZ Q;  2VZA A;  1N8R C;  4WJ4 A;  2Q2U A;  1YBY A;  3UE0 A;  3I4N G;  2K5V A;  4LUV A;  4DV2 Q;  3W5O A;  1HR0 W;  3F8T A;  3CCJ A;  4C3I H;  1PH3 A;  1FGU A;  1O7I A;  3GTQ H;  3GTK H;  3J7A 5;  1S40 A;  2F4V L;  4HIO A;  2ALY B;  4XTC S;  2N78 A;  1J5E Q;  3JC6 6;  1VQ8 A;  4DV6 Q;  2HHH L;  1UEB A;  1K9M C;  3UDI A;  1YHQ A;  1EIF A;  4IO9 A;  2I5H A;  1SRO A;  1I3Q H;  3PUW A;  2UXB L;  4YY3 Q;  4JOI C;  1HNX L;  1I6H H;  4MZ9 A;  2CFM A;  3EBE A;  4JI1 Q;  4DV2 L;  1YZ6 A;  2UXC L;  2D62 A;  4A3J H;  4A3K G;  3STB C;  3ERS X;  5E7N A;  1WOC A;  1KD1 C;  4LF5 Q;  4JV5 Q;  4GNX B;  5C4X G;  1A8V A;  1XNQ Q;  3GTL H;  2NN6 G;  3I4N H;  2NVT H;  1XNR L;  1N33 Q;  3FKI G;  1KHI A;  4X66 L;  4R1J A;  1VQE A;  4R4I A;  4LUZ A;  2CKZ B;  2D0P A;  4JI8 L;  4GN5 A;  2N3S A;  4TVA B;  3FHW A;  1VQA A;  3KDF B;  5C4J H;  4GKJ L;  4DUY L;  1P8L A;  1KQS A;  1NMF A;  5IYC H;  5M3F H;  1I94 L;  4JI7 L;  4A3L H;  3CC4 A;  2MO1 A;  5JEA J;  3BZK A;  4A3C H;  3J80 c;  4X66 Q;  2JJQ A;  2YTY A;  4GOP A;  1QUQ A;  3RR5 A;  5JEA G;  2IY5 B;  2VNU D;  2NN6 I;  3S1Q H;  5IP9 H;  1L1O B;  3TRE A;  1Q1E A;  3PIO A;  3RN2 A;  3H3V I;  4MTN A;  1EIY B;  4O2D A;  4DR3 L;  4HIK A;  1Y1V G;  4Y52 H;  4KLK A;  1R9T H;  4BY7 H;  5ELO A;  1FL0 A;  1TWC H;  4IPG A;  3J80 i;  1BKB A;  1X3G A;  4IPD A;  2OTJ A;  4P73 A;  5IYD H;  4IOC A;  3K81 C;  3PUY A;  3TEH B;  2WFW A;  1GKH A;  1OXV A;  4JI5 Q;  4L5S A;  4NXM Q;  4BY1 H;  3J81 i;  3KFU A;  3S1N H;  4DV0 L;  2VQF L;  1MKH A;  1JE5 A;  1L2F A;  3MXN B;  3OYY A;  4YWK A;  3JAM i;  4KI0 A;  1N32 L;  4B3S Q;  3E9H A;  3PCO B;  4DV1 L;  1XNQ L;  1NTG A;  2NZH A;  2UU9 L;  1XNR Q;  3KJP A;  1Q86 C;  3L0O A;  5H1S E;  1YJ9 A;  3PF5 A;  4JI2 L;  4UP9 A;  2YYZ A;  1QVG A;  4C3H H;  3PIP A;  2B63 G;  1XPR A;  5DLQ E;  1XPO A;  2OQK A;  2C35 B;  3SGI A;  4GS3 A;  4JI8 Q;  3TQY A;  5M3M H;  5IYD G;  3HOX G;  3F2C A;  4JBW A;  1GO3 E;  1BBW A;  2BH2 A;  2LXJ A;  3B6Y A;  2B3G A;  2XGT A;  4OX9 Q;  2I5M X;  4LF8 Q;  2H5X A;  1E1O A;  2F3I A;  1PH6 A;  3G6E A;  4BXX G;  4DR5 Q;  1C7Y A;  4YHH L;  4GLA C;  5JJL A;  2ZM6 L;  3CMA A;  4B3R L;  4JI3 L;  3FP9 A;  3CPW A;  1K73 C;  3CD6 A;  5GRO A;  3CME A;  3J81 j;  2IX1 A;  3AFP A;  3U50 C;  2GN5 A;  2WAQ G;  4AYB E;  2ZTE A;  3E9I A;  4DR7 L;  1X3F A;  3M4Q A;  1KL9 A;  4HID A;  5ELN A;  2AKW B;  3CCL A;  2B63 H;  1KC8 C;  1M1K C;  2CQO A;  2BA1 A;  4JI3 Q;  4A3G G;  2RHQ B;  1W2B A;  3CC7 A;  2HQL A;  3AQQ A;  1Q7Y C;  3HKZ E;  4QGU A;  2OQ0 A;  5J3B A;  2Q2I A;  1JJ2 A;  1NE3 A;  2D0O A;  4LFA Q;  3G4S A;  2ZJQ A;  1VQC A;  5IT9 c;  4JI4 Q;  1BBU A;  1IBM L;  1YNX A;  3H15 A;  2ZJP A;  4A93 H;  3T1H Q;  5C4X H;  4DV1 Q;  1GM5 A;  3NBH B;  4JI5 L;  2K50 A;  3EIV A;  1IBK L;  3GD7 A;  3RLN A;  3M9B A;  4A3K H;  1AH9 A;  1YIT A;  1HNX Q;  5M5W H;  2JA9 A;  4JOI A;  4OWT B;  2UUB Q;  3PGZ A;  1CUK A;  2AWO A;  2LXK A;  4YWM A;  3PO2 G;  3Q8D A;  4OON A;  1SLJ A;  1I50 H;  1PVO A;  4LF5 L;  1HZC A;  5C44 H;  4AQY L;  1PH9 A;  4DR2 L;  1A62 A;  1VQP A;  1VCI A;  1VQG A;  3BJU A;  3PUX A;  1IXR A;  1X56 A;  1X9N A;  4HJ8 A;  3ICE A;  1AE3 A;  5IP9 G;  5GAG C;  3NEN A;  1IBL L;  1FJG L;  2E2H H;  1SRU A;  4LUO A;  2PI2 A;  1U5K A;  2Z0S A;  2PQA B;  3RLO A;  3S24 A;  1HNZ L;  4QQB X;  1Q1B A;  4DV4 Q;  1WI5 A;  2UUC Q;  1VQF A;  1U0L A;  3KF8 B;  2EQS A;  2PQA A;  2NVY H;  3W1B A;  2JA8 G;  1XMQ L;  4XIG S;  4X64 Q;  4DV3 L;  4RG1 A;  2BH8 A;  2ASB A;  2ZM6 Q;  1CKO A;  1E22 A;  3PUV A;  3W1G A;  3CXC A;  2K52 A;  4YWL A;  4R4O A;  3CW2 C;  5GAD C;  5C0X J;  2UXD Q;  4JI6 L;  3CCE A;  5LMU Q;  4HJ5 A;  2K75 A;  1XMO L;  1PHJ A;  2WB1 E;  1VQK A;  1EFW A;  4B3T L;  1VQI A;  4GKK Q;  2K14 A;  2VQE L;  2IT1 A;  1HR0 L;  2R7Z H;  2A1A A;  4POG A;  2R92 G;  3S16 H;  1XMQ Q;  4LFA L;  3GTP H;  1X55 A;  1L0W A;  4DV3 Q;  4A3J G;  4JI4 L;  4JV5 L;  1LM0 A;  3ULJ A;  1B7Y B;  2IHE A;  1J6Q A;  1EQR A;  4UP8 A;  3T1Y L;  1XPU A;  4L5Q A;  3PV0 A;  3CCS A;  2VW9 A;  3CCV A;  4ME3 A;  1HH2 P;  1L1O A;  3AEV A;  3ZJY C;  4K0K L;  3E0E A;  1QUQ B;  2R6G A;  2I5L X;  5FLX c;  1ASY A;  3RZO H;  3I4M G;  4X65 L;  4A76 A;  1KRT A;  5GQO A;  4DNI A;  4DPG A;  2EIF A;  1CSQ A;  3KLW A;  3VDY A;  2Q2H A;  1CKN B;  1KAW A;  3T1Y Q;  2E8G A;  1KXL A;  4DR4 Q;  1SMX A;  3ULP A;  4A3E G;  4R4Q A;  3CF5 A;  1FJG Q;  4JCV E;  2OWO A;  1OXX K;  1XTD A;  2RCN A;  2UXB Q;  2L15 A;  4DR2 Q;  1CKM A;  4A4I A;  2E5L Q;  1VQM A;  4EX5 A;  1N34 L;  3A5U A;  2PMZ E;  5FJ8 G;  3DM3 A;  4PMW A;  3H0G G;  2YTV A;  4YCW A;  2JA7 G;  4BBS H;  4PZ7 A;  2DUD A;  5AJ3 Q;  4FDB A;  1Q81 C;  3OTO Q;  2VUM H;  3S1R H;  1VQO A;  3GTM H;  2OCE A;  2R7F A;  1HNW Q;  5FLM H;  4H02 A;  1A0I A;  4JI6 Q;  3HOV G;  4WJ3 M;  4AYB G;  1WCM H;  4BA2 I;  3CCU A;  2R93 G;  2I0Q A;  1XMO Q;  5FLM G;  4LW1 A;  4GKK L;  3HKS A;  4A3I G;  2HT1 A;  3PO3 H;  3HOU H;  4LF4 L;  4NXM L;  1YJW A;  3ER0 A;  4P75 A;  2JA6 H;  4DR7 Q;  5IWA Q;  4GLX A;  1CSP A;  1Q46 A;  2F4V Q;  3KF6 A;  4JI0 Q;  5FJ8 H;  3F2B A;  1TWG H;  3GO5 A;  2KBN A;  3NEM A;  1KRS A;  3IRB A;  1BVS A; 
#chains in the Genus database with same CATH topology
 4LFC L;  3HFZ B;  1B9N A;  4RGN A;  4C3J G;  3AFQ A;  3F1Z A;  4ZLT F;  4RKL A;  3A8K E;  5CC4 A;  5K5P A;  3GTJ H;  1HUM A;  2F0W A;  1PYB A;  2BE5 C;  1L0Y B;  4DR5 L;  4HIM A;  4ALP A;  3S1Q B;  3RZD B;  3C1E A;  1EUJ A;  1VQL A;  2E2I B;  3P75 A;  2QKI C;  3T1H L;  1ILQ A;  1PTO D;  1O7Z A;  2KEC A;  1CZG A;  4QIW E;  3K5O A;  4U68 A;  4Z9C B;  1PV4 A;  3SR1 A;  1PYS B;  1YHB A;  1JQY D;  1N36 Q;  4DK3 C;  5EKK A;  5C0X G;  4B08 A;  1RD9 D;  1GOZ A;  4NXN L;  4C3J B;  4X64 L;  3K5N A;  1L1O C;  4IPC A;  1IYU A;  2EYP A;  3J7Z C;  3W2D A;  1O80 A;  4A3G B;  2CW0 D;  1JJG A;  1WJJ A;  1VDZ A;  1DOL A;  4KHP L;  4LF9 L;  1LLR D;  4POF A;  5IP7 H;  5M5Y H;  1RKN A;  1RIP A;  3SE0 A;  4C2M H;  2KCT A;  5C44 G;  4C1N I;  1DCZ A;  1EL0 A;  1VQJ A;  1ESR A;  4LF7 Q;  2QF7 A;  4NMZ A;  3PO3 B;  1H95 A;  2KUM A;  4DV0 Q;  1EQV A;  1S5B D;  4DV7 Q;  4JBM A;  3PO2 B;  1PRT B;  4J15 A;  4JBK A;  1UWV A;  1NNX A;  3I73 A;  1X6O A;  2R7Z G;  3M3Y B;  2RVL A;  4A93 G;  1MIU A;  3LGJ A;  4DKA C;  3I4O A;  2JA8 H;  4RKB A;  4G7H C;  1WD1 A;  1SR3 A;  5M5X H;  1YJN A;  2WAC A;  4QMG A;  3M7G A;  5FLX E;  2CHB D;  1HJP A;  5E4X A;  1TU2 B;  4A3F B;  1LTL A;  2HCC A;  4ZK9 B;  3J81 c;  5LMN Q;  2L12 A;  1HZA A;  1O7Y A;  1UUP A;  4GKJ Q;  2LSS A;  4B9X A;  3OW2 A;  4PG3 A;  3PO2 H;  1AEX A;  4HJ7 A;  4OGQ C;  2Y0S E;  4J6H A;  1HNW L;  2Q8T A;  5C3W A;  3M4O B;  4JG2 A;  2UUA L;  2A6E C;  5CV8 A;  1OTC A;  2GA4 B;  4A3F G;  4C3I B;  5J1Z A;  4C3H G;  1AZP A;  2UXC Q;  1Q12 A;  4DXG A;  3KJO A;  1N34 Q;  1E2W A;  5HY6 A;  2JXM B;  4A3B G;  1ROD A;  3G7L A;  4LF6 L;  4A3G H;  2G9D A;  2ZXP A;  1D2B A;  5EBD A;  2VL6 A;  3KF6 B;  3CCR A;  2MP1 A;  2MFI A;  1FVI A;  3V2T A;  4DV4 L;  1QVC A;  1YI2 A;  1KAB A;  3HOZ H;  2B8F A;  4OWX B;  1LTA D;  3UDG A;  3RN5 A;  3FEW X;  4G57 A;  5EAY A;  1UE6 A;  4BXX H;  3PO3 G;  1ZYR D;  2PNH A;  3QJY A;  3GP7 A;  1BF4 A;  3S15 H;  1I4Q A;  4I65 A;  5LMN W;  1SYG A;  2CCZ A;  2VY3 A;  4GN4 B;  4IOA A;  4IUU A;  3I2Z A;  3CCM A;  2E2I H;  3QWN A;  1I6V C;  2XN9 C;  4ZYS A;  1T9H A;  5LMU L;  4A3J B;  1HA5 A;  1D1I A;  1CTM A;  1N36 L;  1T5X D;  3OTO L;  1B44 D;  2JA5 H;  3HOY B;  5BR8 Q;  3QIA A;  1VQH A;  1YNN C;  2KVM A;  4KHZ A;  4RGT A;  2ZTD A;  4EVO A;  2E74 C;  1SFO H;  1YNJ D;  4ILW A;  3TSS A;  4A3E H;  3VR2 A;  2F0O A;  4DUZ L;  1S4Z A;  1ICF B;  1C9O A;  1JOK A;  1MI2 A;  5C5L A;  3S16 B;  5IGB A;  1SAP A;  5C0X I;  1TII D;  1S5E D;  1I4P A;  4LAA A;  3STB D;  2F0V A;  3S14 H;  2RF4 A;  1P16 A;  4GN3 B;  2F0H A;  2MO0 A;  1EWI A;  1E2Z A;  1F2M A;  3OHX C;  4OWW B;  4YHH Q;  1VQ9 A;  1GHJ A;  4C3I G;  1I94 Q;  1E0B A;  4IJH A;  2X6L A;  1VQD A;  5COR A;  2F3W A;  4FF3 A;  3K8A A;  3AYH B;  5CYU A;  2A5H A;  3SK8 A;  2K01 A;  1VS0 A;  1SN8 A;  3S14 B;  4CBV A;  4WJ4 A;  3UE0 A;  4LUV A;  5I2Y A;  3W5O A;  3CCJ A;  1PH3 A;  5E3F A;  4HIO A;  1J5E Q;  2HHH L;  1Q8I A;  3UDI A;  1YNN D;  1NR4 A;  1KDC A;  1LV9 A;  3EBE A;  2UXC L;  2PMZ B;  4A3J H;  4A3K G;  1GUW A;  2DJF C;  4L8J A;  1WOC A;  1ML0 D;  4JV5 Q;  1QIL A;  1A8V A;  4X3S A;  1IL8 A;  3OWE B;  3GTL H;  3J7A V;  4X66 L;  3T56 B;  4LMQ D;  4NW2 A;  1VQE A;  2I07 B;  2D0P A;  1KLU D;  4GN5 A;  4BY1 B;  2E76 C;  1U4M A;  3DMU A;  2HQE A;  3IL8 A;  5IOC A;  2EJM A;  5M3F H;  5JEA J;  3BZK A;  4A3C H;  3R93 A;  2JJQ A;  4HAE A;  5M5Y B;  1B50 A;  1X32 A;  3RR5 A;  3ITP A;  3D4R A;  2VNU D;  5DNF A;  2KCN A;  2B2U C;  3S17 B;  1EIY B;  1SNP A;  2J4X A;  1F2Z A;  1FD7 D;  4DK0 A;  3X3M A;  1R9T H;  1G2S A;  1MHW C;  2B2U A;  4F8M A;  4BY7 H;  1RDP D;  4QCL A;  1CQV A;  1FL0 A;  1TWC H;  2B2W A;  5ELB A;  3J80 i;  2XIW A;  1RCV D;  4P73 A;  4IOC A;  3TEH B;  1OXV A;  3BVM A;  3KFU A;  4BY1 H;  4OIK A;  3CRK C;  1K3B C;  1GUO A;  1JE5 A;  4YWK A;  3VYR A;  1N32 L;  2F0D A;  2ZXO A;  3E9H A;  1WVL A;  1R4P B;  3KLS X;  1XNQ L;  2UU9 L;  4J8Q A;  5H1S E;  3PF5 A;  3PIP A;  4QIW B;  5DLQ E;  1XPO A;  2NYZ D;  3HOX G;  1XTC D;  1GO3 E;  1RTN A;  5F2D A;  2XGT A;  4OX9 Q;  2H5X A;  1BR9 A;  4E6I A;  2AQ3 B;  3GQB A;  1E2V A;  3J81 j;  1EEF D;  4OEL B;  3U50 C;  2GN5 A;  2WAQ G;  3NBI A;  2DY7 A;  2EY1 A;  1BXT A;  2KED A;  2Z1C A;  4PNY A;  4DAP A;  2AKW B;  2A68 C;  2B63 H;  1KC8 C;  1M1K C;  2Z8L A;  1JWM D;  1DM0 B;  3AQQ A;  2RCF A;  1Q7Y C;  1STE A;  2OQ0 A;  1SMY C;  1JJ2 A;  1NE3 A;  3I70 A;  4IUR A;  1F9S A;  3Q6S A;  4JI4 Q;  3T16 A;  2RSO A;  4HMI A;  3AU7 A;  4EGV A;  5C4X H;  1TR5 A;  3A7A B;  3NPP A;  2PYK A;  4KD3 A;  3VA7 A;  2JA9 A;  4HCS A;  4OWT B;  2UUB Q;  1CUK A;  2LXK A;  4YWM A;  3HOW B;  4OON A;  2EY6 A;  3H94 A;  4JPB W;  1A62 A;  2EYJ A;  2VUM B;  3PUX A;  1IXR A;  1X56 A;  4HJ8 A;  1FJG L;  3V96 A;  1PTO F;  1U5K A;  2Z0S A;  3PQI A;  4V19 0;  3NWT A;  1U0L A;  3KF8 B;  3NP8 A;  2EQS A;  4IZ8 A;  1GUN A;  3T53 B;  3W1B A;  1PTO C;  2BH8 A;  1F2L A;  2K52 A;  4IUV A;  4R4O A;  5GAD C;  5C0X J;  2FMC A;  5LMU Q;  1XMO L;  3BYT B;  2BE5 D;  3IFD A;  2Q8R E;  1JWS D;  1HR0 L;  2A1A A;  3OW7 A;  1XYI A;  1X55 A;  1B7Y B;  1J6Q A;  1XPU A;  1GHK A;  3CCS A;  2VW9 A;  3CCV A;  5M3M B;  1RF2 D;  4ME3 A;  4K0K L;  3JAM E;  2I5L X;  1BDO A;  1NCV A;  4X65 L;  2PO4 A;  1KRT A;  3NUC A;  5GQO A;  2NUC A;  1EIH A;  2EIF A;  3KLW A;  4DGZ A;  3NTH A;  3SHL A;  1KXL A;  3ULP A;  3CF5 A;  2OWO A;  5I6W A;  1LTG D;  2A6H C;  2DNE A;  4G7O C;  3A5U A;  5FJ8 G;  1I4X A;  3HKZ B;  2AUJ D;  4PMW A;  4OHJ A;  3GTP B;  2NWG A;  4BBS H;  4PZ7 A;  5IGD A;  5JPM C;  5AJ3 Q;  1FGB D;  1GUS A;  3R3O A;  3GTM H;  3K58 A;  1SXT A;  3M4Y A;  3HOU B;  4JI6 Q;  1TKW B;  1XMO Q;  4LW1 A;  4RGO S;  1EYA A;  1SYC A;  3DUZ A;  5CV4 A;  5EPK A;  3MTS A;  3URY A;  5D3D A;  3ER0 A;  4H44 C;  2EVB A;  2JA6 H;  2F0N A;  2C9O A;  1TWG H;  1PFM A;  3IRB A;  4CGY B;  1DOK A;  1GM5 A;  3E5S A;  5C4Z A;  4IFD G;  3M4P A;  1V1P A;  1YIJ A;  1KDB A;  4X3K A;  1M90 C;  5D14 A;  5J39 A;  4BBR H;  5A2Q E;  3BG3 A;  5EKI A;  4A3M H;  4HCE A;  4UDU C;  4IFD H;  1TWA B;  3MXG A;  1SYE A;  2QGQ A;  1Q90 A;  3ERO A;  3QG1 A;  3SVM A;  4GNX C;  1Z47 A;  2JA6 G;  1B8A A;  4XQJ A;  3KF8 A;  4L6T B;  2L5T A;  3N6R A;  4IFD I;  4AQY Q;  2M2L A;  4APV A;  1TWH H;  5C5M A;  2VQF Q;  1EY0 A;  4RAU C;  1ENA A;  3VA5 A;  3EJI A;  2E5L L;  1I3Q B;  3K0Y A;  2KHI A;  3GV3 A;  3RLF A;  4C1N K;  2EYM A;  4AH6 A;  1O7L A;  2GVA A;  2RHS B;  1JT8 A;  4ZAI A;  1QZH A;  2F0J A;  4DR1 Q;  3BZC A;  5GAH C;  4A3B B;  1V1O A;  4N8F A;  4DAV A;  5M5W B;  3NEL A;  2EZV A;  3MWY W;  1MD2 D;  3P1H A;  1OXS C;  3DM1 A;  2B39 A;  4A3D H;  1DZ1 A;  4XQN A;  1HQR D;  1EZ8 A;  3HKZ G;  4B3M L;  1Y14 B;  4DR1 L;  1B70 B;  3GTO H;  4UPA A;  2AWN A;  2JYO A;  1HRJ A;  2MNA A;  5IT9 L;  2SEB D;  3NWS A;  4MN3 A;  4UY8 C;  3H3V C;  2M00 A;  2RDH A;  4KV6 A;  5IYB H;  3TP8 A;  1AW7 A;  2OXP A;  5C3X A;  1JMC A;  1WD0 A;  5JJK A;  3S1R B;  4RMF A;  2QDB A;  1GD7 A;  5LL6 S;  2DNC A;  1FNV A;  4PMC A;  2H1E A;  1JE4 A;  4LF7 L;  1CQF A;  2K5D A;  3NQT A;  5E4W C;  1BO0 A;  2EYL A;  2HIX A;  4JC0 A;  3EN2 A;  1EYG A;  2HCI A;  3HOY H;  1CT1 D;  2FJ2 A;  3I4N B;  2QDL A;  3UDX A;  4DV6 L;  1SDF A;  4JYA Q;  2NTS A;  1K83 H;  2VS1 A;  1CI3 M;  4R4C A;  2I46 A;  1HZB A;  1D1K A;  3SDZ A;  1RL2 A;  1Y1W H;  1SE3 A;  5IYB G;  3H3V H;  3VYT A;  3PF4 A;  3CCQ A;  3HG9 A;  1EQT A;  3BU2 A;  2UXD L;  2IJ0 A;  1KIX A;  2B2V C;  3CP0 A;  3DWQ A;  4CKE A;  1Z9F A;  2CH4 W;  1PXU A;  1GUG A;  3S1M H;  3CU7 A;  1N33 L;  1ESF A;  4P2C B;  3DHQ A;  4YCU A;  4HED A;  2E2J H;  1CHQ D;  1A63 A;  4HJA A;  1IYJ B;  4AIM A;  1CKN A;  1DYQ A;  3G48 A;  1V1Q A;  2KCM A;  1C8C A;  5IGC A;  5FKA C;  3EVQ A;  1VQ4 A;  3P20 A;  2A69 C;  2AHO B;  1U4P A;  2Q2T A;  4LFB L;  4CHT B;  1AFP A;  3I91 A;  1AE2 A;  4RHR A;  3WWV A;  1BUV T;  3HOX H;  1WTO A;  5IT9 E;  2BDO A;  4CKC A;  1LT4 D;  5ELE A;  1MSH A;  2RSN A;  1ASZ A;  1D7Q A;  3GDE A;  2YU9 H;  2K33 A;  3CC2 A;  4J1M A;  3A74 A;  5GAE C;  3I7F A;  4X62 Q;  4JI2 Q;  5FK9 C;  4A3M G;  4BBR G;  4BY1 G;  4R8N A;  1PZK D;  4LWC A;  1HZ9 A;  3TS0 A;  1E24 A;  1PRT F;  1VF7 A;  2TSS A;  3J81 E;  3FPU B;  3I55 A;  4FXK C;  4RCO A;  2RQX A;  1NY4 A;  1D8L A;  5HGQ A;  4LF9 Q;  1V43 A;  2UUC L;  3BS1 A;  3A55 A;  3PUZ A;  2EY2 A;  4PZ6 A;  1K8A C;  2PW7 A;  4YCV A;  3ND8 A;  1A3U A;  1IZ6 A;  2RBM A;  1EY5 A;  4MNO A;  4N9T A;  3H0G B;  2O5I C;  2DY8 A;  3GTO B;  3K7A H;  4FP5 D;  2VB3 X;  5M3F G;  2B29 A;  2WB1 G;  2CWP A;  3S2H B;  2K4K A;  4WRD A;  2RKS A;  2BCO A;  1SYB A;  2LS0 1;  2DGY A;  2D5D A;  1JB7 A;  2HD3 A;  3O13 A;  1A2T A;  1YBY A;  3QOL A;  1PDQ A;  2K5V A;  1UEA B;  1S40 A;  1O78 A;  2EJG C;  3JC6 6;  1OO9 B;  1PTO H;  1YHQ A;  3VYS A;  1SRO A;  1I3Q H;  3PUW A;  2CQA A;  1HNX L;  4FF2 A;  1V8Q A;  4JI1 Q;  4DV2 L;  2PZW A;  5M9O A;  1B1Z A;  3STB C;  2YU9 B;  5CBA E;  2K1B A;  2JA7 B;  1KD1 C;  1D5M C;  4GNX B;  1EEI D;  2NVT H;  1XNR L;  1KHI A;  1PMR A;  4MHE A;  3NXW A;  4R4I A;  2CKZ B;  5L37 A;  1I4R A;  2H4O A;  3X3N A;  1PLF A;  3NE5 B;  2LFN A;  4CDE C;  3KDF B;  3K57 A;  4GKJ L;  2LY7 A;  3FDT A;  4RH6 A;  1P8L A;  4DUY L;  1KQS A;  1I94 L;  3IFT A;  5EPL A;  1H9S A;  3BDL A;  4Q0F A;  3J80 c;  2YTY A;  1QUQ A;  2IY5 B;  1H9S B;  4DFA A;  1R9T B;  1Q1E A;  3RN2 A;  1SJH D;  2E2J B;  1NUC A;  1LAB A;  4Y52 H;  5JVH 3;  4BBR B;  3ONA B;  3FVQ A;  3GTM B;  1U4L A;  4IPD A;  1ENF A;  2OTJ A;  1NSN S;  5IYD H;  3LWE A;  2WB1 B;  3K81 C;  2WFW A;  1GKH A;  3S1N H;  2XVS A;  4K2K A;  4DV0 L;  4WOR A;  2VQF L;  3JAM i;  3OYY A;  1C4Q A;  1WTP A;  3PCO B;  5ELC A;  2B8G A;  3D4W A;  1YJ9 A;  2KOL A;  4JI2 L;  1JOR A;  1QVG A;  2B63 G;  4H7B A;  4GS3 A;  5IYD G;  1TY2 A;  4IUN A;  4DNR B;  5KYL A;  2I5M X;  4LF8 Q;  3NBH A;  2PW5 A;  1F9R A;  1QNK A;  2PCF B;  4BXX G;  1TWC B;  4YHH L;  4XQQ A;  4ZQ3 A;  2ZM6 L;  2P5Z X;  4JI3 L;  1Q3L A;  1K73 C;  3CD6 A;  5GRO A;  4KY7 A;  2IX3 A;  2EYO A;  3AFP A;  5ISR A;  1JWU D;  2FMM A;  4AYB E;  2QW7 A;  1VMP A;  5C44 B;  3M4Q A;  1WTR A;  5CV9 A;  2NVQ B;  2CQO A;  1W6J A;  4F87 A;  4A3G G;  2F0E A;  4I7Z C;  3CC7 A;  1D5Z C;  3I8Z A;  4QGU A;  3RMH A;  1BCP C;  1VQC A;  4CJ1 B;  1BBU A;  1YNX A;  3H15 A;  3G6J B;  1IKM A;  4LK1 C;  3MAQ A;  3T1H Q;  1BCP F;  4DV1 Q;  5IOD A;  3EIV A;  3Q0A A;  3GTL B;  2B2T A;  1YIT A;  4DAY A;  3KK7 A;  5M5W H;  2X69 A;  3PGZ A;  1PVO A;  3PO2 G;  1I50 H;  3GTG B;  4HTH A;  4LF5 L;  4AQY L;  1PH9 A;  1LT6 D;  1VQP A;  5EPJ A;  1WTX A;  1ILP A;  1VQG A;  3ICE A;  1AE3 A;  2K5Q A;  5GAG C;  4Y7N B;  5NUC A;  3RLO A;  4WJW A;  1LTS D;  1RJT A;  2NVY H;  4RWS C;  2JA8 G;  2F0S A;  4RG1 A;  2ASB A;  2ZM6 Q;  1E22 A;  3H91 A;  2HUG A;  1KAA A;  3W1G A;  3J81 L;  4YWL A;  3CW2 C;  4C3H B;  3DWP A;  4FF1 A;  2J7Z A;  3A54 A;  3CCE A;  1QOH A;  1PHJ A;  1VQK A;  4FO2 A;  4B3T L;  1VQI A;  2MHV A;  2R7Z H;  1MSG A;  1ZXT A;  4A3J G;  4DF7 A;  5G3L F;  4XDX A;  4JI4 L;  2Z6B A;  4JV5 L;  2IHE A;  3HRZ C;  3T1Y L;  4L5Q A;  2PQE A;  1LTT D;  4TKO B;  1RHP A;  2BOS A;  1L1O A;  2JSO A;  1CFM A;  1QUQ B;  1ASY A;  3RZO H;  1JCK B;  4DNI A;  1CSQ A;  3VDY A;  2MUY A;  2Q2H A;  4X3U A;  4DK1 A;  2E8G A;  2O5J C;  5DEH A;  1B3A A;  1STB A;  4JCV E;  1QNU A;  4NDX A;  1FJG Q;  2UXB Q;  2SNS A;  5JVG 3;  4N8X 1;  2A73 B;  3I4L A;  1SFO B;  2KHS A;  4EX5 A;  5COY A;  5C0X H;  1A3T A;  2F0M A;  1C48 A;  4IUP A;  3S1R H;  1VQO A;  2OCE A;  4H02 A;  1FNU A;  1ZEQ X;  5T1I A;  5JOB A;  2HT1 A;  4K5W A;  5AFW A;  4NXM L;  1QG7 A;  3KLS A;  4P75 A;  2JN4 A;  1EY8 A;  3KLR A;  4GLX A;  5FJ8 H;  3QR8 A;  4QUF A;  3NEM A;  2ES2 A;  1BVS A;  1UE5 A;  1S3O A;  5IGF A;  3HOZ B;  4BS9 A;  4JW0 A;  1CA6 A;  3K7U C;  1I4H A;  1UAP A;  4JI1 L;  4K6D A;  4HSP A;  4UHV A;  1SE2 A;  1EY9 A;  3RZD H;  2AQ2 B;  2JA5 G;  3AB9 A;  1I5F A;  2EYF A;  1YEZ A;  5BR8 L;  1NJI C;  3TS2 A;  3OWF A;  2EOT A;  2K28 A;  4RA8 A;  3AMU A;  4DNT B;  2V1C C;  4F88 A;  4H13 C;  3I90 A;  3L2P A;  3Q22 A;  1AZQ A;  2R93 H;  2L11 A;  1WCM G;  1Y1W G;  4DUY Q;  2OTL A;  4B3S L;  2PI2 E;  3HOV H;  2JA5 B;  1IL2 A;  1MJE A;  2EXD A;  2UU9 Q;  3M4O H;  4C2M B;  1LYL A;  2ID0 A;  3PSI A;  4KD4 A;  1E1T A;  1HTL D;  2E2D C;  4DAY B;  4QY7 A;  2O2L D;  5AJ3 L;  3HOZ G;  1QZG A;  1EWH A;  4ABN A;  3K0X A;  4G7Z C;  3HOY G;  1Z6H A;  4A3M B;  3U9O A;  2JK8 A;  1ZYR C;  4ZUI A;  4IPH A;  2EXZ A;  1PFS A;  3I4M H;  3M7N A;  1S5D D;  1Q82 C;  1Z7T A;  2KEN A;  1II3 A;  3C3L A;  2NB0 A;  2ATW A;  1B3Q A;  2L1B A;  4DK6 C;  1VQ5 A;  1VMC A;  4NPS A;  3KOJ A;  4DR6 L;  1DON A;  2N49 A;  3NTK A;  4WFN 3;  1CZW A;  3BDO A;  3KDF A;  3MEF A;  2NVX B;  2NZO A;  5M3F B;  1YHA A;  3DEO A;  1W6K A;  2HIV A;  3EQL C;  4L63 B;  4JYA L;  4FXD A;  2QCP X;  1VQ7 A;  4A3D G;  2K5N A;  4L5T A;  1LT3 D;  4EQN A;  3HEJ A;  4X65 Q;  1X3P A;  2MQH A;  1X54 A;  1G2T A;  2XWB B;  1E7Z A;  1B2T A;  1ET6 A;  2OT2 A;  4TQU S;  3D31 A;  1H9K A;  1EOT A;  5M5X B;  4IJL A;  1EIG A;  2WP8 J;  1GXD C;  4DXF A;  1JJC B;  1UE1 A;  4IFD J;  1F9Q A;  2WAQ E;  2WIN B;  2A8V A;  5IWA L;  2NTT A;  4EQ5 A;  4JI0 L;  2B2Y C;  2CWA A;  2F52 A;  2E2H B;  5KGU A;  3OIQ A;  4QJF A;  3J7Y W;  2O4X A;  2YTX A;  4B3M Q;  1VF5 C;  3HGB A;  1SYF A;  5JJI A;  3A5Z B;  2F4I A;  5EGT A;  2K5H A;  1DOM A;  4GOP B;  5FLX L;  4OO1 G;  3HS0 C;  3EA6 A;  4QB4 A;  4LFC Q;  4DV5 Q;  3TRZ A;  5IY0 A;  3D8G A;  5FO7 B;  1MJC A;  3S17 H;  1TVX A;  1Y8P B;  2Z6K C;  4PZ8 A;  3P7J A;  4Q5V A;  2JE6 I;  4K0K Q;  3D0F A;  5C4X B;  3TBI B;  2ZT9 C;  1ENC A;  4GNX A;  1W3S A;  2EPB A;  4IQZ A;  4BY7 G;  1XWE A;  4LF6 Q;  1U9R A;  4NKL A;  4BWG B;  4HSV A;  2IL8 A;  4OO1 I;  3H09 A;  1OXT A;  2MPM A;  1GVP A;  1C0A A;  1V9P A;  3V05 A;  4A3C G;  1SND A;  5M3M G;  2VQE Q;  3J7A F;  1QE6 A;  1H9M A;  2Q8I B;  1B4O A;  1Q8K A;  4BBS G;  4KKS A;  3U4Z A;  1IBK Q;  3JAM c;  4IN3 A;  1DGS A;  4LFB Q;  2L9H A;  2EE1 A;  1F2Y A;  2JQO A;  2K7V A;  5T1G A;  2UUA Q;  2KQ3 A;  1QVF A;  2AUK A;  1HUN A;  1IYV A;  1NAP A;  2XWJ B;  5EBC A;  2VB2 X;  1IBL Q;  2A19 A;  2NVQ H;  4K2L A;  2R7D A;  4GLV B;  1G6P A;  3CPF A;  4X6A H;  2PPB C;  1LAC A;  3MEH A;  2FXQ A;  3PIP 3;  2QIL A;  2NVY B;  3HOU G;  4DV5 L;  3KBX A;  1MBY A;  3M85 A;  4DR4 L;  5J22 A;  2R3Z A;  1PH7 A;  1TY0 A;  3SK5 A;  4DR6 Q;  2IWH A;  2YV5 A;  5CV6 A;  1STY A;  1EFI D;  4K8I A;  3K80 C;  1QCB D;  1A2U A;  1LT5 D;  1GUT A;  1IBM Q;  5K36 G;  2Z4I A;  1SNQ A;  4X3T A;  2Q2U A;  5KEE A;  1WTQ A;  4S3S A;  4K14 A;  1HR0 W;  4C3I H;  3BDC A;  3J7A 5;  4XTC S;  3C2P A;  3K6O A;  1UEB A;  2CVR A;  4CDC C;  2R93 B;  1JR0 D;  2EYH A;  1EIF A;  2B2Y A;  2JA8 B;  3KBG A;  4HN7 A;  4XT3 B;  2NZ1 D;  2UXB L;  4YY3 Q;  1KNE A;  4MZ9 A;  2CFM A;  1YZ6 A;  1FR3 A;  3N52 A;  3SK4 A;  1AP0 A;  3ERS X;  5BN5 A;  2R7Z B;  5E7N A;  5C4X G;  1XNQ Q;  2NN6 G;  3I4N H;  1N33 Q;  3NHH A;  2LMC B;  4UAI A;  3S15 B;  4LUZ A;  3FKI B;  1EY7 A;  4JI8 L;  2X6G A;  3FHW A;  1X3Q A;  3CQZ B;  2WKC A;  1NMF A;  5IYC H;  4A3L H;  3EFX D;  4JI7 L;  2A74 C;  3CC4 A;  2MO1 A;  1HHV A;  2F0P A;  5DM7 3;  5DAU A;  4KY6 A;  5JEA G;  2NN6 I;  3S1Q H;  5IP9 H;  3TRE A;  1U4R A;  1QWY A;  4O2D A;  4DR3 L;  1Y1V G;  5JAV A;  2F0K A;  5ELO A;  3I3C A;  4RFB A;  4IPG A;  2PZU A;  3SEB A;  1K0S A;  1BKB A;  2NBF A;  1XXG A;  3MXN A;  3PUY A;  3DXJ C;  2A6E D;  4NXM Q;  1AN8 A;  5C4J B;  3QO2 A;  3TDQ A;  2G9H D;  1MKH A;  3MXN B;  1Y8N B;  4KI0 A;  4KMU C;  4B3S Q;  2RDF A;  3TZU A;  4DV1 L;  1NTG A;  2NZH A;  3KJP A;  3FRP B;  3L0O A;  1HFG A;  4UP9 A;  4C3H H;  1K28 A;  1XPR A;  2C35 B;  2FFK B;  3TQY A;  1SJE D;  1WTH A;  3CRL C;  4JBW A;  3WOE A;  1H9R A;  2BH2 A;  2B3G A;  5EQ0 A;  3RD4 A;  1E1O A;  4A3E B;  2F3I A;  1BCP D;  4KKT A;  4DR5 Q;  4R8I A;  1C7Y A;  4GLA C;  3UI2 A;  1DD2 A;  3MXP A;  3CMA A;  4B3R L;  3KUP A;  4JVZ A;  2B2V A;  4DR7 L;  4IAL A;  1HFN A;  1KLG D;  3CCL A;  3VYU A;  3T13 A;  3I72 A;  1EWC A;  5I2X A;  4JI3 Q;  4O1N A;  1G8Z D;  3MVV A;  3HKZ E;  3CHB D;  5HUR A;  2Q2I A;  5BN4 A;  5KND A;  2D0O A;  4LFA Q;  1PRT C;  5IT9 c;  1IBM L;  2A6H D;  2ZJP A;  4A93 H;  3K5L A;  2XNA C;  4CJ2 C;  5D3I B;  3A8I E;  4JI5 L;  2K50 A;  3D6C A;  2CW0 C;  4A3K H;  1HNX Q;  3E3X A;  1JOQ A;  4JOI A;  1AH9 A;  3C46 A;  3Q8D A;  1HZC A;  5C44 H;  1SBB B;  3QOJ A;  4DR2 L;  1FYC A;  2L55 A;  1X9N A;  4C56 C;  3NEN A;  3SK6 A;  1IBL L;  2D9U A;  2PQA B;  1A3V A;  4IUQ A;  5FOB B;  5KYI A;  1HNZ L;  4QQB X;  1Q1B A;  3R2T A;  1VQF A;  3IKJ A;  3GTK B;  4CDF C;  3MHB A;  1XMQ L;  4XIG S;  1K8O A;  4X64 Q;  4DV3 L;  1SNO A;  3D6W A;  4K5V A;  1CKO A;  1H9J A;  3NQI A;  3TP7 A;  2UXD Q;  4JI6 L;  1UNS A;  1CM9 A;  3U9S A;  2K75 A;  2WB1 E;  2K14 A;  2VQE L;  2IT1 A;  1TT2 A;  2SNM A;  3S16 H;  2OF1 A;  3L3O C;  1XMQ Q;  4LFA L;  1L0W A;  4YIJ A;  5I9P A;  1LM0 A;  3ULJ A;  2F3V A;  4TSS A;  2KEE A;  1EZ6 A;  4AYB B;  3Q24 A;  3MFG A;  3AEV A;  3ZJY C;  1DJR D;  4KN4 C;  5C4H A;  2FIN B;  1B53 A;  5DM6 3;  1JOO A;  1D5X C;  2E75 C;  2F0T A;  2Z9H A;  1HQM C;  4B9W A;  4M1U B;  3RZO B;  4DR4 Q;  1SMX A;  2MGS A;  4A3E G;  1XTD A;  1STA A;  3ERQ A;  2L15 A;  4A4I A;  2E5L Q;  1VQM A;  3DEP A;  3ZYY X;  1PRT D;  1N34 L;  3F2U A;  1SMY D;  3H0G G;  4YCW A;  5CV7 A;  2VUM H;  4FDB A;  1Q81 C;  1HNW Q;  2R7F A;  1XX8 A;  1A0I A;  1TQO A;  4AYB G;  4BA2 I;  1KNA A;  2MJ8 A;  1F9P A;  2XRS D;  5FLM G;  3HKS A;  4A3I G;  3PO3 H;  4LF4 L;  1YJW A;  2DN8 A;  5IWA Q;  1Q46 A;  2F4V Q;  3KF6 A;  5I4D A;  2KBN A;  2L4N A;  2R92 B;  1PA6 A;  2ICI A;  4P72 A;  4YY3 L;  2HHH Q;  3CQZ H;  4HJ9 A;  1VQN A;  3TP5 A;  4DU9 A;  3BZD B;  4DR3 Q;  1PFB A;  4KJN A;  1NR2 A;  4OX9 L;  2LKV A;  4A3B H;  4LF8 L;  4L5R C;  1SE8 A;  1BBX C;  4DV7 L;  1GJX A;  2UUB L;  3HOX B;  4UP7 A;  5ELF A;  1YVC A;  3RNU A;  4A3F H;  4A3I H;  3S2D H;  4FVM A;  4ULL A;  3ND9 A;  1NMG A;  4OXP A;  4OIJ A;  1Y8O B;  1LTR D;  5EKL A;  4ZUJ A;  3LWU A;  2ZJR A;  1IHZ A;  1TWH B;  2VUM G;  1R4Q B;  5E1F A;  4KHP Q;  1G6Z A;  2NVT B;  2K5W A;  2AQ1 B;  4ZKB B;  4HR7 B;  5LMN L;  2JP1 A;  3DWA A;  3GTG H;  2JEA I;  1I50 B;  2J0T D;  3GTJ B;  2BA0 A;  1TWA H;  3OOC A;  4FXG C;  3NK9 A;  2N55 A;  2TMP A;  4FF4 A;  1N9W A;  3A7L A;  3K7A B;  3CAM A;  1HR0 Q;  2A69 D;  4NXN Q;  4V0B A;  3VR3 A;  2WAQ B;  2N8N A;  1WFQ A;  3HOV B;  2OEO A;  1TXY A;  3IAY A;  3C1F A;  2WV6 D;  4JBJ A;  3SXH A;  4O42 A;  3MA2 B;  3R8B A;  3OPO A;  2ICE C;  3T4A C;  4LNQ A;  1X65 A;  1N32 Q;  3K5M A;  2IHF A;  1TS2 A;  1PYW D;  4K6L A;  3ULL A;  2Z6K A;  5IP7 G;  3F2D A;  3TZD A;  3L7Z C;  5C3E H;  3VR5 A;  3H6M A;  2K04 A;  3J80 L;  4NB3 A;  2PNR C;  2XRQ D;  3T51 B;  2QA4 A;  4R4T A;  3A56 A;  5C3E G;  1J5E L;  4RHS A;  1QJO A;  2F0Q A;  4FYD A;  1B9M A;  3U58 A;  3M3Y H;  1NBW A;  1TS5 A;  2B2W C;  4O0A A;  4BA1 I;  4RCN A;  5IGE A;  1KTK A;  1G51 A;  4JI7 Q;  3VR6 A;  3WDN A;  1LUZ A;  1E3P A;  2RDG A;  1EYC A;  1WYD A;  3GTQ B;  1STN A;  5FO8 B;  3VR4 A;  1VQ6 A;  1G91 A;  1PTO B;  4A75 A;  5KNB A;  2HDL A;  1S72 A;  4Y7N H;  2BDN A;  1HCZ A;  1PH8 A;  4KN7 C;  3DLL A;  1J9O A;  4P74 A;  1D6E C;  2Y0S G;  1PH5 A;  2CH4 A;  2IX0 A;  3FMC A;  1V1P B;  4JK1 C;  4G4K A;  4C3J H;  1VQB A;  1BCP B;  1SYD A;  4LF4 Q;  1TWF H;  5IE8 A;  1CA5 A;  1STG A;  2F0L A;  3WOF A;  3I56 A;  2XTI A;  1PH1 A;  1JIC A;  1K0R A;  1M8A A;  3TME A;  2QEX A;  2GVB A;  3UE1 A;  4DAM A;  4B3T Q;  4IUT A;  3A0J A;  2KHJ A;  3E6Z X;  5CV5 A;  5KRU A;  3G71 A;  1EU3 A;  4ZRZ A;  2VXW A;  1BOS A;  2JA7 H;  2AMC B;  1EOV A;  3K59 A;  3S9W A;  2IW3 A;  3J80 E;  1PH4 A;  3RUZ A;  5FO9 B;  3U4V A;  2G5D A;  1HXY D;  4XYQ A;  1JB3 A;  3FKI H;  1J8I A;  2F0F A;  1K83 B;  1G29 1;  1X3E A;  5ELD A;  5CGK A;  4ODG A;  2B63 B;  1SE4 A;  3OSO A;  5BN3 A;  2NVX H;  5JPN C;  2A68 D;  2KJX A;  4QL5 A;  2ZTC A;  1T5E A;  4X62 L;  4B3R Q;  2JEB I;  1Y1V H;  1EQQ A;  4K5X A;  3UDF A;  4XYO A;  3PMF A;  4DUZ Q;  3FPP A;  5JEA H;  3S2H H;  4GOP C;  2R92 H;  4F7X A;  2EY5 A;  5I9O A;  1SNC A;  1S5F D;  1ET9 A;  4P71 A;  4A3L G;  1UE7 A;  5IYC G;  3H0G H;  1K3R A;  1XJV A;  1TS3 A;  3HOW H;  1PH2 A;  1K8G A;  1PFN A;  1OXU A;  3KYH C;  4KY5 A;  1EY4 A;  3HOW G;  5LL6 X;  1HNZ Q;  1Y1V B;  2VZA A;  1N8R C;  2NN6 H;  3I4N G;  4DV2 Q;  2K05 A;  3F8T A;  3S1M B;  3GTQ H;  1FGU A;  1O7I A;  3GTK H;  2D2C C;  5KIX A;  2F4V L;  1VQ8 A;  2ALY B;  2N78 A;  2L0C A;  4DV6 Q;  2DJG C;  1JC7 A;  4R9W A;  5I6Y A;  1K9M C;  4N9P A;  2IPK D;  4IO9 A;  2RA4 A;  2I5H A;  3D4D A;  4QUC A;  4JOI C;  1I6H H;  1I4G A;  4U67 3;  4ID6 A;  4CJ0 B;  2R61 A;  2D62 A;  4LF5 Q;  1ICW A;  4KKU A;  4A3K B;  3FKI G;  2SDF A;  4R1J A;  2KCC A;  5K36 H;  2SOB A;  5JJZ A;  3E0J A;  4PMB A;  1YNJ C;  4TVA B;  2N3S A;  3S1N B;  1VQA A;  5C4J H;  2F0I A;  2B2T C;  2JA6 B;  1ONL A;  4X66 Q;  4H0L C;  4GOP A;  1L1O B;  1SSO A;  3MXU A;  3QB3 A;  3PIO A;  3H3V I;  4MTN A;  1Y69 U;  4CKB A;  4HIK A;  1L0X B;  4KLK A;  1LO5 D;  1RTO A;  1FNW A;  2QEJ C;  1X3G A;  4PV1 C;  2V4D A;  4BY7 B;  4K8J A;  4L5S A;  4JI5 Q;  1EY6 A;  3W3A A;  3J81 i;  2WII B;  5CBE E;  1Y1W B;  1L2F A;  4I7A A;  4FNF A;  4A3I B;  3S2D B;  4M8A A;  1S5C D;  1XNR Q;  1Q86 C;  2YYZ A;  3OIP A;  1HPC A;  2OQK A;  3SGI A;  5M3M H;  4JI8 Q;  3MC0 B;  3F2C A;  5C6A A;  1BBW A;  2LXJ A;  3B6Y A;  5G3L D;  5D65 A;  4ZCK A;  1CK1 A;  1EYD A;  2C5C A;  5IGG A;  1PH6 A;  3G6E A;  5JJL A;  1F77 A;  3FP9 A;  3CPW A;  3CME A;  3TP6 A;  2IX1 A;  4KK7 A;  3E9I A;  2ZTE A;  2K32 A;  2N88 A;  2ENB A;  1X3F A;  1KL9 A;  4HID A;  5ELN A;  4MTK A;  2F1M A;  2BA1 A;  5EJW A;  1LTB D;  4OO1 H;  2RHQ B;  1W2B A;  2HQL A;  5A35 A;  5J3B A;  5LHY 1;  1I6H B;  3G4S A;  5HGT A;  2ZJQ A;  1TWF B;  3NBH B;  4HMJ A;  5KNC A;  1A6X A;  5IIF A;  1IBK L;  3GD7 A;  3RLN A;  3M9B A;  5CR3 A;  1ZKO A;  1TWG B;  4GZY C;  3LX0 A;  2AWO A;  1WCM B;  1SLJ A;  4DN4 M;  1SEB D;  2WKD A;  1VCI A;  3BJU A;  5IP9 G;  3BVG A;  2K03 A;  2E2H H;  4LUO A;  1QB5 D;  1SRU A;  2PI2 A;  4QF4 A;  3S24 A;  4A3D B;  1IW7 C;  4DV4 Q;  1WI5 A;  1BQQ T;  3A8J E;  3L9A X;  3I4M B;  2UUC Q;  2HDM A;  2PQA A;  1CHP D;  3BVZ A;  4RGM A;  3MFY A;  3NSW A;  4XXE A;  3PUV A;  3CXC A;  1IKL A;  3BYY B;  1HTP A;  3HZX A;  4OL7 A;  3PIO 3;  4HJ5 A;  4KHV A;  4EQO A;  1WTW A;  1EFW A;  4MIU A;  4GKK Q;  4KTA A;  2EJF C;  2K6A A;  4POG A;  2R92 G;  3R2I A;  4BBS B;  3GTP H;  1STH A;  4DV3 Q;  3MZ5 A;  3OMG A;  2EDG A;  1IW7 D;  1EQR A;  4UP8 A;  4ZKC B;  3PV0 A;  1KDA A;  5CMD A;  4KJO A;  5C3E B;  1HH2 P;  4EQP A;  4XT1 B;  3E0E A;  2R6G A;  3OMC A;  4CDD C;  2F03 A;  1HA6 A;  5FLX c;  1LTI D;  3I4M G;  4A76 A;  3CKI B;  4DPG A;  3NTI A;  2ZXR A;  3HP3 A;  1WTV A;  4TRD A;  1CKN B;  1EU4 A;  1KAW A;  3T1Y Q;  1DXM A;  1A15 A;  4R4Q A;  3LNN A;  1OXX K;  2RCN A;  2PZT A;  2FHT A;  2F0U A;  1CKM A;  5A2Q L;  4DR2 Q;  1TS4 A;  1SNM A;  2M9V A;  3D3R A;  4A93 B;  2PMZ E;  4NP5 A;  3GV6 A;  3DM3 A;  2YTV A;  2JA7 G;  4DA2 A;  2KA7 A;  2DUD A;  3OTO Q;  1MGS A;  1M4V A;  3TN2 A;  3Q23 A;  5FLM H;  3HOV G;  2Y0S B;  4WJ3 M;  1WCM H;  3CCU A;  1PZI D;  1BNZ A;  2I0Q A;  2R93 G;  1PZJ D;  4GKK L;  4LJZ C;  2XSC A;  1K8M A;  3HOU H;  4ME5 A;  3JAM L;  4DR7 Q;  4OEM B;  4PQX A;  1CSP A;  4JI0 Q;  3F2B A;  5TSS A;  2Z4H A;  3GO5 A;  2F0G A;  1KRS A; 
#chains in the Genus database with same CATH homology
 1PA6 A;  4LFC L;  1UE5 A;  4IFD G;  3M4P A;  3HFZ B;  1S3O A;  4P72 A;  4YY3 L;  1YIJ A;  3AFQ A;  3F1Z A;  2HHH Q;  3CQZ H;  3K7U C;  4HJ9 A;  1M90 C;  4JI1 L;  1VQN A;  4BBR H;  4DR3 Q;  3GTJ H;  4A3M H;  3RZD H;  4OX9 L;  4A3B H;  4LF8 L;  4L5R C;  1PYB A;  2JA5 G;  1I5F A;  1SE8 A;  4DR5 L;  1YEZ A;  2QGQ A;  4HIM A;  5BR8 L;  4ALP A;  1NJI C;  3TS2 A;  4GNX C;  1Z47 A;  2ES2 A;  4DV7 L;  1EUJ A;  2V1C C;  1B8A A;  1VQL A;  2UUB L;  4UP7 A;  2JA6 G;  1YVC A;  3L2P A;  3RNU A;  4A3F H;  4A3I H;  3S2D H;  4IFD I;  4AQY Q;  1NMG A;  4APV A;  3T1H L;  1TWH H;  2VQF Q;  2R93 H;  1WCM G;  4OXP A;  1Y1W G;  4QIW E;  4DUY Q;  2OTL A;  2PI2 E;  4B3S L;  3HOV H;  2ZJR A;  2E5L L;  1IL2 A;  2KHI A;  1MJE A;  2EXD A;  3RLF A;  1PV4 A;  2UU9 Q;  2VUM G;  3M4O H;  1LYL A;  1PYS B;  1YHB A;  2ID0 A;  4AH6 A;  4DK3 C;  1N36 Q;  4KHP Q;  3PSI A;  1E1T A;  5C0X G;  2GVA A;  2RHS B;  4QY7 A;  4DAY B;  1JT8 A;  5AJ3 L;  4NXN L;  3HOZ G;  5LMN L;  4X64 L;  1QZG A;  1L1O C;  1QZH A;  3GTG H;  2JEA I;  3K0X A;  4DR1 Q;  4IPC A;  3BZC A;  5GAH C;  3J7Z C;  3HOY G;  2BA0 A;  1TWA H;  2CCZ A;  2JK8 A;  1N9W A;  1JJG A;  1WJJ A;  3NEL A;  4IPH A;  4KHP L;  4LF9 L;  3CAM A;  1PFS A;  1OXS C;  1HR0 Q;  4POF A;  5IP7 H;  5M5Y H;  3I4M H;  4A3D H;  1RIP A;  4NXN Q;  3HKZ G;  4B3M L;  3M7N A;  1Q82 C;  4C2M H;  1Y14 B;  2KEN A;  2N8N A;  2KCT A;  5C44 G;  1WFQ A;  1B70 B;  4DR1 L;  3GTO H;  1TXY A;  4UPA A;  2ATW A;  2AWN A;  2MNA A;  4JBJ A;  4DK6 C;  1VQJ A;  4LF7 Q;  1VQ5 A;  4UY8 C;  4NPS A;  1H95 A;  5IYB H;  4DV0 Q;  3KOJ A;  4DR6 L;  4DV7 Q;  4JBM A;  4LNQ A;  1X65 A;  2N49 A;  4J15 A;  1JMC A;  4JBK A;  2IHF A;  1UWV A;  1N32 Q;  2R7Z G;  1X6O A;  5JJK A;  3KDF A;  4A93 G;  4RMF A;  1MIU A;  1GD7 A;  3MEF A;  2NZO A;  1YHA A;  4JYA L;  2HIV A;  3LGJ A;  4DKA C;  1VQ7 A;  4LF7 L;  3ULL A;  2Z6K A;  5IP7 G;  3F2D A;  4A3D G;  2K5N A;  4L5T A;  1C0A A;  3I4O A;  3L7Z C;  2HIX A;  4JC0 A;  4X65 Q;  2MQH A;  5C3E H;  1X54 A;  3EN2 A;  1E7Z A;  4NB3 A;  2QA4 A;  2JA8 H;  1EYG A;  4R4T A;  3HOY H;  1SR3 A;  4TQU S;  5C3E G;  5M5X H;  3D31 A;  1YJN A;  1J5E L;  4JYA Q;  4DV6 L;  3UDX A;  1HJP A;  1LTL A;  3U58 A;  3M3Y H;  3J81 c;  5LMN Q;  1HZA A;  1NBW A;  1K83 H;  2WP8 J;  2VS1 A;  4IJL A;  4GKJ Q;  4O0A A;  4BA1 I;  4R4C A;  2LSS A;  1JJC B;  3OW2 A;  1HZB A;  4PG3 A;  1UE1 A;  3PO2 H;  1G51 A;  4HJ7 A;  4JI7 Q;  4IFD J;  2Y0S E;  1RL2 A;  2WAQ E;  2A8V A;  1HNW L;  1Y1W H;  5IWA L;  4EQ5 A;  4JI0 L;  4JG2 A;  5IYB G;  2UUA L;  3H3V H;  1OTC A;  3PF4 A;  1LUZ A;  2CWA A;  2F52 A;  3CCQ A;  3BU2 A;  1E3P A;  4A3F G;  1WYD A;  4QJF A;  2UXD L;  2YTX A;  1KIX A;  4B3M Q;  3CP0 A;  2UXC Q;  1VQ6 A;  1Q12 A;  4A75 A;  1Z9F A;  1S72 A;  4Y7N H;  3KJO A;  5JJI A;  1PH8 A;  3A5Z B;  1N34 Q;  5HY6 A;  3S1M H;  4A3B G;  2K5H A;  3DLL A;  4LF6 L;  4GOP B;  4P74 A;  1N33 L;  4A3G H;  2Y0S G;  4OO1 G;  1PH5 A;  4LFC Q;  4YCU A;  4DV5 Q;  3TRZ A;  2VL6 A;  5IY0 A;  3KF6 B;  2IX0 A;  1MJC A;  2E2J H;  3S17 H;  3CCR A;  2Z6K C;  2MFI A;  4PZ8 A;  1IYJ B;  4HJA A;  4C3J H;  1FVI A;  4AIM A;  1A63 A;  1CKN A;  3G48 A;  1VQB A;  2JE6 I;  4K0K Q;  1V1Q A;  4DV4 L;  3D0F A;  1QVC A;  2KCM A;  1YI2 A;  4GNX A;  3HOZ H;  1W3S A;  4OWX B;  4LF4 Q;  4BY7 G;  1TWF H;  3UDG A;  5IE8 A;  3RN5 A;  1VQ4 A;  4LF6 Q;  5EAY A;  1UE6 A;  2AHO B;  3I56 A;  2XTI A;  1PH1 A;  4BXX H;  3PO3 G;  2PNH A;  1K0R A;  2Q2T A;  4LFB L;  4OO1 I;  3S15 H;  1OXT A;  2QEX A;  1AE2 A;  2GVB A;  1GVP A;  5LMN W;  3UE1 A;  4DAM A;  2VY3 A;  4GN4 B;  3WWV A;  1V9P A;  4B3T Q;  3I2Z A;  4IOA A;  4A3C G;  5M3M G;  3A0J A;  2KHJ A;  3HOX H;  2VQE Q;  3G71 A;  3CCM A;  2E2I H;  1Q8K A;  2JA7 H;  1T9H A;  2AMC B;  4BBS G;  1ASZ A;  5LMU L;  1D7Q A;  1EOV A;  3U4Z A;  3GDE A;  1IBK Q;  2YU9 H;  1N36 L;  3JAM c;  3OTO L;  3CC2 A;  1DGS A;  2JA5 H;  5BR8 Q;  3A74 A;  5GAE C;  3I7F A;  1PH4 A;  1VQH A;  4KHZ A;  3U4V A;  4JI2 Q;  4X62 Q;  4LFB Q;  4A3M G;  2ZTD A;  1SFO H;  2JQO A;  2UUA Q;  4BBR G;  4BY1 G;  1QVF A;  4A3E H;  3FKI H;  4LWC A;  3TS0 A;  1HZ9 A;  1E24 A;  1IBL Q;  4DUZ L;  3I55 A;  1G29 1;  2A19 A;  1X3E A;  1C9O A;  2NVQ H;  2R7D A;  4GLV B;  1NY4 A;  1D8L A;  5HGQ A;  2NVX H;  4LF9 Q;  1V43 A;  5C0X I;  2UUC L;  1G6P A;  3CPF A;  4X6A H;  3PUZ A;  4QL5 A;  2ZTC A;  3STB D;  4X62 L;  3S14 H;  2JEB I;  4B3R Q;  2RF4 A;  2FXQ A;  1P16 A;  1Y1V H;  4PZ6 A;  1K8A C;  4GN3 B;  1EQQ A;  4YCV A;  3HOU G;  4DV5 L;  1IZ6 A;  3M85 A;  3UDF A;  4DR4 L;  2MO0 A;  1EWI A;  4MNO A;  4DUZ Q;  1PH7 A;  4OWW B;  3S2H H;  4YHH Q;  1VQ9 A;  4GOP C;  1I94 Q;  2R92 H;  4DR6 Q;  4IJH A;  1VQD A;  3K7A H;  2YV5 A;  4P71 A;  5M3F G;  1UE7 A;  2B29 A;  2WB1 G;  5IYC G;  2CWP A;  1K3R A;  3H0G H;  4A3L G;  1XJV A;  2K4K A;  3K8A A;  3AYH B;  3HOW H;  1PH2 A;  1K8G A;  1OXU A;  3K80 C;  3KYH C;  2DGY A;  1VS0 A;  1IBM Q;  1JB7 A;  3HOW G;  5K36 G;  1SN8 A;  1HNZ Q;  2VZA A;  1N8R C;  4WJ4 A;  2Q2U A;  1YBY A;  3UE0 A;  3I4N G;  2K5V A;  4LUV A;  4DV2 Q;  3W5O A;  1HR0 W;  3F8T A;  3CCJ A;  4C3I H;  1PH3 A;  1FGU A;  1O7I A;  3GTQ H;  3GTK H;  3J7A 5;  1S40 A;  2F4V L;  4HIO A;  2ALY B;  4XTC S;  2N78 A;  1J5E Q;  3JC6 6;  1VQ8 A;  4DV6 Q;  2HHH L;  1UEB A;  1K9M C;  3UDI A;  1YHQ A;  1EIF A;  4IO9 A;  2I5H A;  1SRO A;  1I3Q H;  3PUW A;  2UXB L;  4YY3 Q;  4JOI C;  1HNX L;  1I6H H;  4MZ9 A;  2CFM A;  3EBE A;  4JI1 Q;  4DV2 L;  1YZ6 A;  2UXC L;  2D62 A;  4A3J H;  4A3K G;  3STB C;  3ERS X;  5E7N A;  1WOC A;  1KD1 C;  4LF5 Q;  4JV5 Q;  4GNX B;  5C4X G;  1A8V A;  1XNQ Q;  3GTL H;  2NN6 G;  3I4N H;  2NVT H;  1XNR L;  1N33 Q;  3FKI G;  1KHI A;  4X66 L;  4R1J A;  1VQE A;  4R4I A;  4LUZ A;  2CKZ B;  2D0P A;  4JI8 L;  4GN5 A;  2N3S A;  4TVA B;  3FHW A;  1VQA A;  3KDF B;  5C4J H;  4GKJ L;  4DUY L;  1P8L A;  1KQS A;  1NMF A;  5IYC H;  5M3F H;  1I94 L;  4JI7 L;  4A3L H;  3CC4 A;  2MO1 A;  5JEA J;  3BZK A;  4A3C H;  3J80 c;  4X66 Q;  2JJQ A;  2YTY A;  4GOP A;  1QUQ A;  3RR5 A;  5JEA G;  2IY5 B;  2VNU D;  2NN6 I;  3S1Q H;  5IP9 H;  1L1O B;  3TRE A;  1Q1E A;  3PIO A;  3RN2 A;  3H3V I;  4MTN A;  1EIY B;  4O2D A;  4DR3 L;  4HIK A;  1Y1V G;  4Y52 H;  4KLK A;  1R9T H;  4BY7 H;  5ELO A;  1FL0 A;  1TWC H;  4IPG A;  3J80 i;  1BKB A;  1X3G A;  4IPD A;  2OTJ A;  4P73 A;  5IYD H;  4IOC A;  3K81 C;  3PUY A;  3TEH B;  2WFW A;  1GKH A;  1OXV A;  4JI5 Q;  4L5S A;  4NXM Q;  4BY1 H;  3J81 i;  3KFU A;  3S1N H;  4DV0 L;  2VQF L;  1MKH A;  1JE5 A;  1L2F A;  3MXN B;  3OYY A;  4YWK A;  3JAM i;  4KI0 A;  1N32 L;  4B3S Q;  3E9H A;  3PCO B;  4DV1 L;  1XNQ L;  1NTG A;  2NZH A;  2UU9 L;  1XNR Q;  3KJP A;  1Q86 C;  3L0O A;  5H1S E;  1YJ9 A;  3PF5 A;  4JI2 L;  4UP9 A;  2YYZ A;  1QVG A;  4C3H H;  3PIP A;  2B63 G;  1XPR A;  5DLQ E;  1XPO A;  2OQK A;  2C35 B;  3SGI A;  4GS3 A;  4JI8 Q;  3TQY A;  5M3M H;  5IYD G;  3HOX G;  3F2C A;  4JBW A;  1GO3 E;  1BBW A;  2BH2 A;  2LXJ A;  3B6Y A;  2B3G A;  2XGT A;  4OX9 Q;  2I5M X;  4LF8 Q;  2H5X A;  1E1O A;  2F3I A;  1PH6 A;  3G6E A;  4BXX G;  4DR5 Q;  1C7Y A;  4YHH L;  4GLA C;  5JJL A;  2ZM6 L;  3CMA A;  4B3R L;  4JI3 L;  3FP9 A;  3CPW A;  1K73 C;  3CD6 A;  5GRO A;  3CME A;  3J81 j;  2IX1 A;  3AFP A;  3U50 C;  2GN5 A;  2WAQ G;  4AYB E;  2ZTE A;  3E9I A;  4DR7 L;  1X3F A;  3M4Q A;  1KL9 A;  4HID A;  5ELN A;  2AKW B;  3CCL A;  2B63 H;  1KC8 C;  1M1K C;  2CQO A;  2BA1 A;  4JI3 Q;  4A3G G;  2RHQ B;  1W2B A;  3CC7 A;  2HQL A;  3AQQ A;  1Q7Y C;  3HKZ E;  4QGU A;  2OQ0 A;  5J3B A;  2Q2I A;  1JJ2 A;  1NE3 A;  2D0O A;  4LFA Q;  3G4S A;  2ZJQ A;  1VQC A;  5IT9 c;  4JI4 Q;  1BBU A;  1IBM L;  1YNX A;  3H15 A;  2ZJP A;  4A93 H;  3T1H Q;  5C4X H;  4DV1 Q;  1GM5 A;  3NBH B;  4JI5 L;  2K50 A;  3EIV A;  1IBK L;  3GD7 A;  3RLN A;  3M9B A;  4A3K H;  1AH9 A;  1YIT A;  1HNX Q;  5M5W H;  2JA9 A;  4JOI A;  4OWT B;  2UUB Q;  3PGZ A;  1CUK A;  2AWO A;  2LXK A;  4YWM A;  3PO2 G;  3Q8D A;  4OON A;  1SLJ A;  1I50 H;  1PVO A;  4LF5 L;  1HZC A;  5C44 H;  4AQY L;  1PH9 A;  4DR2 L;  1A62 A;  1VQP A;  1VCI A;  1VQG A;  3BJU A;  3PUX A;  1IXR A;  1X56 A;  1X9N A;  4HJ8 A;  3ICE A;  1AE3 A;  5IP9 G;  5GAG C;  3NEN A;  1IBL L;  1FJG L;  2E2H H;  1SRU A;  4LUO A;  2PI2 A;  1U5K A;  2Z0S A;  2PQA B;  3RLO A;  3S24 A;  1HNZ L;  4QQB X;  1Q1B A;  4DV4 Q;  1WI5 A;  2UUC Q;  1VQF A;  1U0L A;  3KF8 B;  2EQS A;  2PQA A;  2NVY H;  3W1B A;  2JA8 G;  1XMQ L;  4XIG S;  4X64 Q;  4DV3 L;  4RG1 A;  2BH8 A;  2ASB A;  2ZM6 Q;  1CKO A;  1E22 A;  3PUV A;  3W1G A;  3CXC A;  2K52 A;  4YWL A;  4R4O A;  3CW2 C;  5GAD C;  5C0X J;  2UXD Q;  4JI6 L;  3CCE A;  5LMU Q;  4HJ5 A;  2K75 A;  1XMO L;  1PHJ A;  2WB1 E;  1VQK A;  1EFW A;  4B3T L;  1VQI A;  4GKK Q;  2K14 A;  2VQE L;  2IT1 A;  1HR0 L;  2R7Z H;  2A1A A;  4POG A;  2R92 G;  3S16 H;  1XMQ Q;  4LFA L;  3GTP H;  1X55 A;  1L0W A;  4DV3 Q;  4A3J G;  4JI4 L;  4JV5 L;  1LM0 A;  3ULJ A;  1B7Y B;  2IHE A;  1J6Q A;  1EQR A;  4UP8 A;  3T1Y L;  1XPU A;  4L5Q A;  3PV0 A;  3CCS A;  2VW9 A;  3CCV A;  4ME3 A;  1HH2 P;  1L1O A;  3AEV A;  3ZJY C;  4K0K L;  3E0E A;  1QUQ B;  2R6G A;  2I5L X;  5FLX c;  1ASY A;  3RZO H;  3I4M G;  4X65 L;  4A76 A;  1KRT A;  5GQO A;  4DNI A;  4DPG A;  2EIF A;  1CSQ A;  3KLW A;  3VDY A;  2Q2H A;  1CKN B;  1KAW A;  3T1Y Q;  2E8G A;  1KXL A;  4DR4 Q;  1SMX A;  3ULP A;  4A3E G;  4R4Q A;  3CF5 A;  1FJG Q;  4JCV E;  2OWO A;  1OXX K;  1XTD A;  2RCN A;  2UXB Q;  2L15 A;  4DR2 Q;  1CKM A;  4A4I A;  2E5L Q;  1VQM A;  4EX5 A;  1N34 L;  3A5U A;  2PMZ E;  5FJ8 G;  3DM3 A;  4PMW A;  3H0G G;  2YTV A;  4YCW A;  2JA7 G;  4BBS H;  4PZ7 A;  2DUD A;  5AJ3 Q;  4FDB A;  1Q81 C;  3OTO Q;  2VUM H;  3S1R H;  1VQO A;  3GTM H;  2OCE A;  2R7F A;  1HNW Q;  5FLM H;  4H02 A;  1A0I A;  4JI6 Q;  3HOV G;  4WJ3 M;  4AYB G;  1WCM H;  4BA2 I;  3CCU A;  2R93 G;  2I0Q A;  1XMO Q;  5FLM G;  4LW1 A;  4GKK L;  3HKS A;  4A3I G;  2HT1 A;  3PO3 H;  3HOU H;  4LF4 L;  4NXM L;  1YJW A;  3ER0 A;  4P75 A;  2JA6 H;  4DR7 Q;  5IWA Q;  4GLX A;  1CSP A;  1Q46 A;  2F4V Q;  3KF6 A;  4JI0 Q;  5FJ8 H;  3F2B A;  1TWG H;  3GO5 A;  2KBN A;  3NEM A;  1KRS A;  3IRB A;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...