4B3SQ

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sQ00
4B3ML 3F2CA 5IP9H 4A3KH 1XPRA 3CCSA 1XMOL 4LFBQ 1R9TH 2Y0SG 3U50C 4DK6C 3GTMH 4OONA 3S15H 5AJ3Q 3CMAA 3I4MG 2Q2IA 3CC2A 4DR5L 4B3SQ 1YJWA 1TWCH 1VQBA 2Z0SA 1EUJA 1Y14B 3ERSX 1XMQL 4QL5A 2NVTH 2YV5A 1XNQL 3GO5A 5IYCH 4DV4Q 1YEZA 2MO0A 1L2FA 2K5VA 1JJCB 2B3GA 3EIVA 3KDFA 4UPAA 4JI8L 3RLOA 2F4VL 4BA2I 1BVSA 2N49A 4BBSG 3BZKA 1VQ9A 5LMUQ 4LF9Q 3WWVA 1X55A 1SE8A 4NPSA 1EIYB 4DR6Q 2QA4A 4DV1Q 4A4IA 4A3GH 1VQMA 5FJ8H 2RCNA 1PYBA 3D0FA 2MNAA 1XTDA 2VW9A 2MFIA 1D8LA 4DR4L 2JA7H 4OWTB 3GDEA 4OWWB 3STBD 3I4NH 4DAYB 5M5XH 4OO1I 1YJNA 1VQ4A 1E24A 4LUVA 4DV2L 1CSPA 4A3FH 2R7FA 3PUWA 3PUXA 4A3IH 3HOZG 1TXYA 1M90C 1KXLA 5FLMG 1HNZQ 3BU2A 3CCJA 3KJPA 2NN6G 2UUBQ 1VQJA 2PMZE 4TQUS 2K5HA 4MNOA 2I5HA 5C0XG 1KD1C 1Q86C 2KCTA 4HJ5A 4DUZL 1WCMG 3H0GH 4JC0A 4C3HH 1XNRQ 1S72A 1K83H 4Y7NH 3M3YH 1L1OC 3M4PA 4ALPA 4P71A 5IYBG 1HNXQ 1HNWL 3A74A 2JE6I 4A3LG 1K0RA 4R4IA 2XGTA 2YTYA 4DUYL 1CSQA 2AKWB 4YCUA 1PH8A 1I3QH 1U0LA 1E3PA 3CCUA 1QUQB 1KHIA 2VUMH 1CKMA 2F52A 2L15A 4JI2L 1N32Q 1UWVA 4X6AH 1G291 4LF7L 4X66L 1GM5A 4FDBA 1H95A 2Q2HA 1AE2A 1GKHA 1LUZA 3CCRA 1SROA 4IPDA 4IJHA 1PVOA 5M3FG 1MJEA 2IT1A 4YHHQ 4JI7Q 4QQBX 1JJGA 1ASYA 1HH2P 3I7FA 1Z9FA 1Q1BA 1YHAA 3TREA 1D7QA 1VQEA 3RN2A 4NXMQ 2R92G 1G6PA 1IBML 2EIFA 4X62Q 5DLQE 4PZ7A 3GTOH 1I50H 1B7YB 3TEHB 4POFA 4DV1L 4OX9L 3ICEA 3F1ZA 2JEAI 3SGIA 2R93G 3JC66 4LF8Q 5C44H 2KENA 1A62A 3K80C 3G4SA 1K8GA 4GKJQ 3GTPH 3L2PA 3HFZB 1J5EQ 4JI3L 4HJ7A 1G51A 4P72A 2OQKA 1FGUA 1KL9A 2VY3A 5IYDG 4GKKQ 1LTLA 4DV7L 4A3MH 1X54A 3BZCA 5C4XH 1UE1A 4JI1L 4YY3Q 1JE5A 1FJGQ 3K7UC 2DUDA 4C2MH 3CCVA 4DV6Q 4A3JH 1MIUA 4QY7A 4A3DH 4JI5Q 2N8NA 5IP7H 5GADC 3KLWA 4JYAQ 1PH6A 1C7YA 1N9WA 2UUAL 1S40A 3CCMA 4PZ8A 1KIXA 4AQYL 2HHHQ 1HNXL 3PGZA 4GN4B 3ULLA 3AQQA 3PF4A 1WYDA 1K9MC 4R4OA 4LF5Q 3GTGH 4K0KL 3KOJA 4JBMA 2KBNA 4JI4Q 3PO2G 3K7AH 4AIMA 1GVPA 3D31A 3M4QA 2VZAA 1SN8A 1AE3A 3B6YA 4BY1G 5FLXc 1NTGA 2IY5B 2BH2A 4X65Q 3GTJH 1I94L 2ES2A 4BBSH 1Q8KA 4GLVB 4UY8C 3HOXG 4DV3Q 3PIOA 2FXQA 1A8VA 1XPUA 2PNHA 2JA6G 4OWXB 4JBJA 1B8AA 1KRSA 4XTCS 3BJUA 1X3GA 1IBKQ 4MZ9A 1LM0A 1IBLL 3RZDH 3CXCA 3STBC 1KAWA 4LUZA 4P75A 3HOZH 4XIGS 4BBRG 1NE3A 1PH3A 1EIFA 3DLLA 1Q7YC 1VQLA 5LMNL 2UU9L 4LF8L 4JV5L 5FLMH 4X64Q 4IOCA 2UXDL 1NMFA 1N33L 3VDYA 1FVIA 4GN5A 1S3OA 5EAYA 5C3EG 1DGSA 5IE8A 5IWAQ 1X56A 4DR1L 3ULPA 1CKNA 4TVAB 1E1TA 3PUYA 1V9PA 1PH9A 5LMNW 3S1MH 1Z47A 4L5QA 1FJGL 5BR8L 1VQDA 2HIVA 3CPWA 3GTLH 3W1BA 4KHPQ 3OTOL 2ZJRA 4RG1A 4A3LH 2PI2E 3S1RH 2D0PA 2KHJA 4DR3Q 3AEVA 3KF6A 1V1QA 4YWMA 1K73C 3FKIG 2E2IH 2HHHL 4BXXG 2R7ZG 1UE7A 3J81c 1Q1EA 2K14A 2UXCQ 1OXSC 1C9OA 1FL0A 1X3FA 4JCVE 3CCEA 1Q12A 4R4CA 2GVAA 2PQAA 5M3FH 3H15A 1PH5A 3HOWG 4KLKA 3M4OH 3HOYG 2YU9H 2ZM6L 1VQCA 2R92H 5H1SE 3RZOH 4GOPA 2F3IA 1NMGA 1EWIA 4ME3A 3JAMi 2BA1A 4DV5L 1XPOA 1A0IA 1O7IA 2K5NA 1RL2A 3T1HL 4LF6Q 1YHBA 1N36Q 4JI6Q 4NXNQ 1E1OA 1AH9A 1VQ5A 2K75A 4IFDG 1HR0Q 2WB1E 3MXNB 2VQEQ 2N3SA 4WJ3M 3J80i 5IYDH 3UDIA 4BY7H 3L0OA 1MKHA 3CAMA 3PUZA 2PI2A 4B3TL 5C0XJ 4JI0Q 3HOVH 2A1AA 1LYLA 5GAEC 4R4TA 4DR2Q 1GO3E 4LF4Q 3HOUG 2JJQA 1X3EA 2HIXA 4LFBL 2OTLA 4GS3A 5JJLA 2WB1G 1L1OB 3S2HH 2RHSB 5JJIA 1CKNB 4BA1I 5AJ3L 4IPCA 1UEBA 1JB7A 5JJKA 2YYZA 4KHPL 4B3SL 2ZJPA 3T1YQ 4HIKA 1NY4A 4P73A 1Y1WG 1HZBA 1E7ZA 3J7ZC 1VQOA 4A3KG 4C3JH 4DR3L 2UUCQ 3RLNA 4JOIA 3ULJA 3NEMA 4JI5L 4DV4L 4DPGA 4GKJL 2YTXA 2OQ0A 2JA8G 1X6OA 2I5MX 3KF6B 3KDFB 2JQOA 2ZTCA 5JEAJ 1V43A 4KHZA 5LMUL 4LF9L 3A5ZB 3HOXH 3K8AA 2B63H 3CF5A 1K8AC 5IY0A 4DR6L 1BBWA 3A5UA 5IYCG 2ID0A 2NN6I 4LFAQ 4A76A 2BA0A 2YTVA 3ZJYC 1SR3A 1JT8A 4GOPC 1JJ2A 3F2DA 4IOAA 4GNXA 5C0XI 1YNXA 4IJLA 1EQQA 1N34Q 4APVA 3S16H 2OCEA 3J81j 2BH8A 3TRZA 2R7DA 4GOPB 3RR5A 5ELNA 3UDGA 1T9HA 3H3VH 4BBRH 2AWOA 1HNZL 2ZTEA 2E5LQ 3S2DH 2JA7G 2UUBL 5M5YH 4A3EH 2NZOA 2Q2UA 1Y1VG 4DV0Q 2JA9A 1MJCA 3UE1A 1YBYA 4YWKA 5C3EH 2VQFQ 2A19A 1HR0L 1WOCA 3M9BA 3CMEA 1XNRL 4DR7Q 3I4MH 3S1QH 3K0XA 3U4ZA 4LF4L 4A3CG 2K50A 1L0WA 4B3MQ 2Q2TA 3CPFA 4IO9A 1PYSB 3FHWA 4GLAC 1XMOQ 1WI5A 1I6HH 1BBUA 1N32L 2VL6A 5GROA 2OTJA 1C0AA 2R7ZH 3L7ZC 1HZCA 4JOIC 3CQZH 4DR5Q 3CD6A 3S1NH 3KYHC 4DK3C 1XMQQ 4L5TA 4GLXA 3AYHB 4YHHL 1SLJA 4JI7L 1XNQQ 3M85A 3RNUA 2ZJQA 1VS0A 3CCLA 4JI8Q 1SRUA 2F4VQ 4NXML 3HOYH 1EFWA 3I4OA 4X62L 3TS0A 4JG2A 3CC7A 4LWCA 2ZTDA 1QVGA 3PF5A 1QVFA 3PO3G 4YCWA 3KFUA 4UP7A 1XJVA 4O0AA 2E2HH 4HIMA 2LSSA 2CFMA 2EXDA 2ASBA 1KRTA 4YCVA 3U4VA 4IPGA 1OXUA 4DR4Q 1J5EL 1N8RC 3UDFA 1K3RA 2EQSA 1OXXK 4DV2Q 1PHJA 2K4KA 2UXBQ 4GKKL 3AFQA 2ATWA 1WCMH 1I5FA 1VCIA 2Z6KA 4YY3L 4O2DA 2WFWA 1VQAA 2AWNA 4DV6L 4JBKA 2NVYH 5IYBH 2NVXH 3RLFA 4AH6A 1M1KC 4JYAL 4A93G 2CKZB 4POGA 5HY6A 4OO1G 1WJJA 1B70B 4DUZQ 2IX0A 2GN5A 1KC8C 1OTCA 2KHIA 2IX1A 4A3BG 1TWHH 4R1JA 5M3MG 1HNWQ 4QGUA 4LF5L 1Y1WH 3CCQA 1CKOA 4JI4L 1QUQA 5IP7G 3G6EA 4DUYQ 1NBWA 4KI0A 1VQHA 4R4QA 3M7NA 4DKAC 3ER0A 1SMXA 2JA8H 4RMFA 4JBWA 4X65L 1VQ7A 4JI2Q 1JMCA 3HKSA 1YZ6A 4DV3L 4LF7Q 3H3VI 4X66Q 1IZ6A 1PH2A 4Y52H 1UE6A 2K52A 3J7A5 3I56A 1X9NA 3E9IA 3F8TA 3NENA 5J3BA 4LW1A 2GVBA 2JK8A 4EX5A 5C4JH 3S17H 2R93H 3EN2A 3UDXA 1J6QA 4J15A 3CW2C 1IBKL 3OYYA 5HGQA 1OXTA 4HJ9A 1IBMQ 2LXJA 1P8LA 2N78A 1VQNA 2IHEA 5M5WH 4HJ8A 3G48A 1PH1A 4P74A 2NZHA 4OX9Q 1VQ8A 2ALYB 3MEFA 4AYBE 1YITA 4IFDJ 1A63A 4X64L 2JA5G 4IPHA 5ELOA 2MO1A 4LNQA 1IYJB 1U5KA 1Y1VH 1UE5A 2WP8J 4JI3Q 5IWAL 2CWAA 2Z6KC 3PIPA 2B29A 1YHQA 1VQPA 4AYBG 3F2BA 4DV7Q 2C35B 1EYGA 1IL2A 3HKZE 2A8VA 4JI1Q 4A75A 3G71A 4PMWA 1QVCA 1W2BA 5IP9G 4A3CH 2UXBL 1PA6A 1VQKA 1VQIA 3PO2H 4C3IH 2UUAQ 5GAHC 4LUOA 4BY1H 3HKZG 3KF8B 3J81i 4AQYQ 5K36G 2UXCL 4EQ5A 3Q8DA 3FP9A 1PFSA 4B3RQ 4K0KQ 2QGQA 4UP8A 3NBHB 4WJ4A 2OWOA 2JA6H 4L5RC 2IHFA 3PCOB 2PQAB 4IFDI 1W3SA 4PG3A 1I94Q 2E2JH 1RIPA 2RHQB 3CC4A 3PV0A 1CUKA 4A3GG 4UP9A 4LFCQ 4DAMA 3PO3H 5FJ8G 5JEAG 5GAGC 1QZHA 1PH7A 1BKBA 4LF6L 3I4NG 3S14H 4NXNL 1N36L 4JI6L 1E22A 4MTNA 2D62A 1HZAA 3I2ZA 4A3FG 3UE0A 4A3IG 3W5OA 1IBLQ 2VQEL 4QJFA 2H5XA 4DNIA 2HT1A 4JI0L 1VQGA 2LXKA 1TWFH 2I5LX 2HQLA 5LMNQ 2UU9Q 4JV5Q 2UXDQ 1VQ6A 2I0QA 1N33Q 3E0EA 4DR2L 4PZ6A 1EOVA 1PH4A 1HR0W 2CWPA 3H0GG 1EQRA 3W1GA 4DR1Q 3E9HA 1Q81C 4HIDA 5E7NA 1Q82C 4A93H 3HOVG 3FKIH 3TS2A 4BY7G 4BXXH 3PUVA 5BR8Q 4A3BH 2MQHA 1YVCA 1TWGH 3IRBA 3T1YL 4GN3B 5M3MH 3OTOQ 1TWAH 2RF4A 3GTKH 2UUCL 1YJ9A 2VUMG 3HOWH 1OXVA 2XTIA 2DGYA 3AFPA 3CP0A 2QEXA 2KCMA 2D0OA 3GTQH 3EBEA 4HIOA 2V1CC 3NELA 3LGJA 1KQSA 3A0JA 4B3RL 1VQFA 1HZ9A 2R6GA 3OW2A 1YIJA 4LFAL 2VS1A 1Q46A 2E8GA 3PSIA 4GNXC 1NJIC 2VNUD 3KJOA 1P16A 2ZM6Q 2B63G 1WFQA 2AMCB 1N34L 4GNXB 2JEBI 1QZGA 4LFCL 2WAQE 4NB3A 4DV5Q 1ASZA 4YWLA 3JAMc 1HJPA 5C44G 2E5LL 5GQOA 4OXPA 1YI2A 2CQOA 3GD7A 2CCZA 2JA5H 3T1HQ 3DM3A 4DV0L 4HJAA 1GD7A 1X65A 3HOUH 4H02A 2VQFL 2WAQG 5IT9c 3TQYA 4A3MG 4L5SA 1SFOH 2Y0SE 5C4XG 1IXRA 4DR7L 3J80c 3I55A 4A3JG 3K81C 4B3TQ 4A3EG 1PV4A 2NVQH 3S24A 4A3DG 3RN5A 3U58A 2AHOB 4QIWE 1L1OA
chains in the Genus database with same CATH superfamily
3HG9A 1XMOL 1MHWC 1HQMC 4DK6C 5I6YA 1HUMA 1SJED 3CMAA 5M5WB 3I4MG 4B3SQ 1VQBA 1EUJA 1XMQL 2NVTH 3NK9A 3MXGA 4LMQD 1NSNS 5K5PA 4L6TB 5IYCH 4DV4Q 4U673 2JA7B 2B3GA 2B2UC 2F4VL 1BVSA 2N49A 5CORA 1VQ9A 1PLFA 2ICIA 1JE4A 1SE8A 3X3MA 1CA5A 4DV1Q 1JWMD 1HRJA 3MFGA 2RCNA 4F87A 2VW9A 3VYUA 5IT9E 1SAPA 2O4XA 3GDEA 4OWWB 3STBD 3I4NH 4DAYB 4N8FA 4CJ2C 5M5XH 1YJNA 4OO1I 1J8IA 1CSPA 2X6GA 2R7FA 3PUXA 1SYGA 1F9SA 1HNZQ 1TQOA 2F3VA 3F2UA 1SYEA 5C5LA 1RCVD 5JOBA 4DAPA 1GUSA 1K83H 4Y7NH 4ALPA 2JE6I 4KKTA 1F9RA 3HS0C 1PH8A 3BYYB 1PZKD 1U0LA 3CCUA 1E3PA 3EROA 2L15A 4X6AH 3TMEA 5KYIA 1G291 4LF7L 2F03A 1H95A 2Q2HA 1PVOA 4IJHA 1TWFB 4JI7Q 2B2VA 1HH2P 3I7FA 4K2KA 4NXMQ 1JR0D 2EIFA 4X62Q 4PZ7A 1KDAA 1I50H 4C1NI 3GTOH 2K32A 3TEHB 4DV1L 4OX9L 1MD2D 3ICEA 2JEAI 2HD3A 4A3BB 3JC66 2F0HA 4LF8Q 2KENA 3GTKB 1TWAB 1YNNC 3G4SA 2NZ1D 4HSPA 1J5EQ 4JI3L 2F0SA 4HJ7A 2IPKD 3MHBA 1LTLA 4TRDA 4DV7L 3GTQB 3GV3A 1UE1A 1MSGA 2K01A 4C2MH 4DV6Q 2N8NA 4ODGA 2WINB 5IP7H 2X6LA 1N9WA 4DNRB 1DYQA 2HHHQ 4K5VA 4GN4B 1WYDA 4H13C 1D5ZC 2KBNA 3PO2G 4N8X1 2N88A 1W6JA 2VZAA 1KABA 3B6YA 3BVMA 2EPBA 5FLXc 1DONA 2IY5B 5E3FA 3RZDB 3J7AV 1IYVA 2BCOA 1XXGA 1UNSA 2K05A 5COYA 5CV7A 1R9TB 1PFBA 1LM0A 1LTGD 3KLSX 3GTMB 3BG3A 4NDXA 4XIGS 3HOZH 4LF8L 1Q7YC 2XWBB 4OIKA 4IOCA 1NMFA 1N33L 3J7YW 3VDYA 1FVIA 4GN5A 5EAYA 4CDFC 1H9SA 4CJ1B 3S1MH 1Z47A 1VQDA 2HIVA 3PMFA 3W1BA 4RG1A 4JVZA 4A3LH 2PI2E 1BF4A 3C46A 3AEVA 1PMRA 3KF6A 1QOHA 3TP5A 1ET6A 2HHHL 4IUTA 3QB3A 4X3KA 2G5DA 4BXXG 1Z6HA 1H9KA 4A3IB 4TKOB 1G2TA 1C9OA 1IKLA 5ELCA 4JCVE 5F2DA 3CCEA 1Q12A 3N6RA 1RJTA 1PH5A 2I46A 1SMYD 5EGTA 3HOYG 2F0OA 2ZM6L 1GUOA 5I4DA 2KOLA 3RZOH 4GOPA 2F3IA 1NCVA 2F0GA 3LX0A 4N9TA 3JAMi 3HOVB 4K14A 3LNNA 1AH9A 1FNUA 1JICA 3D6CA 2FINB 1HR0Q 2WB1E 3MXNB 3BS1A 1B44D 2A68C 3SVMA 5C0XJ 4DR2Q 4LF4Q 2C9OA 2WB1G 2K5QA 1KTKA 1SYCA 3S2HH 2MUYA 4BA1I 5AJ3L 1UEBA 1LACA 5KIXA 3T1YQ 4P73A 1Y1WG 5BN5A 2PYKA 2IW3A 4C3JH 1DOMA 3ULJA 1ENAA 2A73B 4RA8A 3KLSA 1II3A 1EY8A 4A3MB 1V1PA 1JOKA 1K8AC 5IY0A 1SXTA 4DR6L 1QILA 4LFAQ 4A3DB 4A3EB 2YTVA 2Z9HA 3SK8A 1JT8A 3F2DA 4HCSA 4IN3A 5C0XI 1YNXA 2RCFA 1EZ6A 4IJLA 2OCEA 3J81j 1BUVT 5IGCA 4BBRH 2AWOA 2E5LQ 3SHLA 2SNMA 2JA7G 5M5YH 1BCPD 2NZOA 1WTWA 4DFAA 1YBYA 4YWKA 5C3EH 2A19A 1HR0L 2ZXOA 4HTHA 1XNRL 4G7OC 4CKCA 3S1QH 1I4QA 3U4ZA 4LF4L 4A3CG 2K50A 4B3MQ 1UEAB 4XT1B 3FHWA 1STGA 1SYFA 1N32L 3L7ZC 1HTLD 3FMCA 4DK3C 4YHHL 1XNQQ 3URYA 2B8GA 1SBBB 3M85A 4IURA 3CCLA 1SRUA 3HRZC 2L9HA 2Z6BA 2FJ2A 3TS0A 4JG2A 1QVFA 3PF5A 1WCMB 3KFUA 2CVRA 4O0AA 4HIMA 1X3QA 3E3XA 2PMZB 3U4VA 4IPGA 1N8RC 4B08A 1OXXK 4IFDH 4EVOA 1EYCA 1S5ED 1I5FA 3EQLC 2QW7A 2K03A 3ND8A 1PDQA 5M3FB 3RLFA 3M4OB 1SE2A 1SNQA 3MXUA 4POGA 4OO1G 2R92B 4DUZQ 1V1OA 2IX0A 4PQXA 2IX1A 4A3BG 3A8KE 3H09A 1HNWQ 4QGUA 2KEDA 3T56B 4JI4L 3IKJA 3E5SA 3ER0A 3P1HA 3I8ZA 3DHQA 1VQ7A 2CH4A 4X66Q 4KY7A 2K52A 3TP8A 3I56A 1X9NA 4HN7A 3S17H 5C4JH 1XX8A 3W2DA 4WFN3 1IBKL 2AUKA 1VDZA 3G48A 4F88A 1M4VA 3WOEA 2ALYB 1YITA 4TSSA 4IQZA 4IPHA 1VMCA 5JPMC 4RWSC 3HGBA 1U9RA 2Z6KC 2B29A 1WTRA 1ENCA 3E0JA 3F2BA 1AEXA 2C35B 1H9SB 3HOXB 1NAPA 1AFPA 5EBDA 3NTKA 4PMWA 5DNFA 5LHY1 5IP9G 4HAEA 4DF7A 1PTOC 2UUAQ 3IFDA 4FO2A 5GAHC 3SEBA 3J81i 3KF8B 4AQYQ 1A2TA 1WD1A 4O1NA 3FPPA 3VA5A 3T53B 2PO4A 1PFSA 1PTOB 3QIAA 2QGQA 4UP8A 3NBHB 2OWOA 2JXMB 4RGTA 1I4RA 2JA6H 2F0FA 3P7JA 1QNUA 1I94Q 4KKUA 4UP9A 4G7HC 1IW7C 3EJIA 4IUQA 5JEAG 4ME5A 3UI2A 2K04A 1QZHA 1PH7A 4JPBW 3S14H 2E75C 3FDTA 5EBCA 4G7ZC 1HZAA 4A3IG 2VQEL 4Q5VA 2R7ZB 3MZ5A 2LXKA 2QDLA 5EKLA 3S1NB 2UXDQ 3E0EA 3A7LA 1PH4A 4RCOA 1HQRD 3W1GA 1EQRA 1Q81C 1QB5D 5E7NA 5ELBA 2DJFC 1F2ZA 3FKIH 3K58A 3K59A 3HOVG 1TWGH 5IGFA 4GN3B 5I6WA 1G8ZD 5M3MH 3OTOQ 2E2HB 3CU7A 3IFTA 1YJ9A 1OXVA 2OF1A 2XTIA 4K2LA 1F9PA 2FFKB 3AFPA 3NE5B 2QEXA 2KCMA 2B2UA 3EBEA 2L0CA 5D14A 1LT4D 3VYSA 1CFMA 2R6GA 1V1PB 5KRUA 3OW2A 2VS1A 2E8GA 2JP1A 4DAYA 2B63G 1N34L 3IAYA 2QEJC 1RF2D 2EY5A 2A6HC 2A6ED 5C3WA 3GD7A 2JA5H 4HJAA 5JVH3 3OOCA 2VQFL 4GZYC 3TQYA 4A3MG 1GHKA 3J80c 1RODA 2NVQH 3K81C 4A3DG 4A3EG 1B3AA 1FR3A 3VR2A 4LFBQ 3V2TA 1T5XD 3FRPB 5EKIA 4KKSA 5J39A 4OONA 3S15H 3DXJC 5I2YA 3X3NA 5G3LD 2Z0SA 3ERSX 1Y14B 4RGOS 2V4DA 3GO5A 1STYA 4GKJQ 1L2FA 2K5VA 4JI8L 2PNRC 3RLOA 3PQIA 3JAME 5LMUQ 4LF9Q 3WWVA 4A3GH 5IGBA 4OL7A 2A74C 1VQMA 3D0FA 2MNAA 5L37A 1XTDA 2MFIA 1FNWA 1CK1A 2EYHA 4OWTB 1SE4A 2F0LA 4XYOA 4DV2L 2UXBL 5DEHA 1PRTD 5NUCA 3TN2A 4A3FH 1KXLA 4QUCA 1WD0A 3BU2A 4O42A 4FF4A 3KJPA 2UUBQ 3NXWA 2PMZE 4XQQA 2K5HA 1S5DD 3BYTB 5C0XG 1Q86C 1KD1C 3W3AA 2RA4A 1WCMG 4JC0A 2E2JB 1CQVA 3M3YH 3OSOA 1L1OC 3M4PA 3QOJA 1HNXQ 5IYBG 3A74A 4R4IA 4I65A 2XGTA 4DUYL 3Q23A 1CSQA 2AKWB 2KCCA 1I3QH 2EE1A 1LT3D 3OWFA 1F9QA 2XRSD 1CKMA 1UWVA 1B50A 1KNEA 4FDBA 1AE2A 3MXPA 4EQPA 3CCRA 4HSVA 5M3FG 1HPCA 1MJEA 2C5CA 2PZWA 4R8IA 4IZ8A 1Z9FA 1Q1BA 1YHAA 2AQ3B 4ZAIA 1VQEA 4DU9A 2R92G 1IBML 4A93B 4X3SA 5C44H 3K80C 2FMCA 3NUCA 1K8GA 5C6AA 1I4PA 1KL9A 1X54A 2HDLA 3BZCA 4KN7C 4A3JH 4QY7A 4H0LC 1AW7A 1LABA 4C1NK 2WKCA 4JYAQ 3RUZA 4DGZA 5KYLA 1HNXL 4ULLA 4R9WA 4R4OA 2EJFC 2HQEA 1JB3A 1W6KA 3K7AH 1GVPA 1GHJA 3T13A 1HA5A 1AE3A 2LMCB 3V05A 4YIJA 5DM73 3GQBA 1NTGA 4X65Q 1Q8KA 3OPOA 3HOXG 3PIOA 4FF2A 1SFOB 1XPUA 2PNHA 3V96A 4XTCS 1JC7A 3BJUA 1X3GA 3SE0A 3MXNA 4MZ9A 3STBC 1KAWA 4LUZA 4X3UA 3DLLA 1TWCB 5LMNL 2UU9L 4X64Q 3ND9A 2YU9B 1DGSA 5IWAQ 4DR1L 3PUYA 3L9AX 3D4RA 1AZQA 1CTMA 3AU7A 4KHPQ 3CPWA 3GTLH 1Q3LA 2ZJRA 3T51B 2EDGA 5EPKA 4DR3Q 1BCPF 1V1QA 4YWMA 4KD3A 2R7ZG 1O7LA 2KCNA 1Q1EA 4KY5A 1OXSC 3KK7A 4HMIA 1RTNA 1C48A 1VQCA 3D3RA 1STHA 4UAIA 1NMGA 3H0GB 4B9XA 4C3HB 1MBYA 1TR5A 2H4OA 2BA1A 1A0IA 2F0WA 2XRQD 3T1HL 1N36Q 4JI6Q 1E1OA 1VQ5A 2K75A 2VUMB 1S5CD 2B39A 1LT5D 4WJ3M 2R61A 2PZTA 4JI0Q 2A1AA 1LYLA 3T16A 1EWHA 5JVG3 2OTLA 5KNBA 3J81E 5CC4A 2RHSB 5JJIA 3BDLA 1CKNB 5JJKA 4KHPL 4B3SL 1NY4A 3OMGA 1HZBA 1E7ZA 4CGYB 1VQOA 3R3OA 4DR3L 2UUCQ 3KBGA 4DV4L 2OQ0A 3GTPB 2I5MX 2EJGC 4HCEA 2ZTCA 4JW0A 5JEAJ 4ZYSA 2EY1A 2J4XA 5C4XB 1BBWA 5IYCG 2NN6I 4CDEC 1ZKOA 1RHPA 3QOLA 2BOSA 1IHZA 1SR3A 4IOAA 3TSSA 3I72A 4GNXA 1S5BD 1TS5A 3RR5A 3H3VH 2M00A 1HNZL 3GTGB 3NPPA 2Q2UA 3UE1A 2ICEC 1XYIA 4BBSB 3GTJB 1PXUA 3M9BA 1IKMA 3CMEA 1DD2A 1HTPA 4MIUA 3K0XA 1JCKB 2A5HA 5A35A 1T5EA 1JORA 3VYRA 4IO9A 2RQXA 1I6HH 3GP7A 2VB3X 2OTJA 4DR5Q 4JOIC 3CQZH 3R93A 4GLXA 4JI7L 1ML0D 3RNUA 2ZJQA 4RHRA 1VS0A 4NXML 3HOYH 1EFWA 3I4OA 1K0SA 1SMYC 4X62L 4LWCA 1QCBD 2L4NA 1SYBA 1XJVA 2LSSA 2ASBA 4ABNA 3S1RB 3CRLC 3TP7A 3VR4A 4DR4Q 3D4WA 2NUCA 1J5EL 1CZWA 2E2IB 2NTSA 2ZXPA 1PHJA 1F2MA 1Y8OB 4H7BA 3AFQA 4MTKA 3NQIA 2Z6KA 1PZJD 2B2TC 4DV6L 3R2IA 2AWNA 2DJGC 4ZCKA 4JBKA 1EY7A 2NVXH 1TIID 1HHVA 4A93G 3KF8A 3OIQA 4KTAA 1BNZA 4R1JA 1D6EC 3NBHA 1Y1WH 1CKOA 1QUQA 1STNA 3SDZA 5IP7G 3S17B 3M7NA 4R4QA 1SDFA 2K6AA 4I7AA 1SMXA 1VMPA 1KAAA 4JI2Q 1CM9A 5FO8B 3HKSA 2F0IA 5DAUA 1CI3M 4CKEA 2F0UA 1IZ6A 1PH2A 2L11A 1UE6A 4Y52H 3J7A5 1Q90A 2MJ8A 1WTHA 3E9IA 4IALA 2R93H 2K33A 2DNCA 1J6QA 4J15A 3NHHA 3U9OA 2LXJA 1VQNA 2IHEA 5M5WH 5IGDA 4HJ8A 2QKIC 4LK1C 5CYUA 2KJXA 3MEFA 2Q8IB 5DM63 5ELOA 3BVZA 2MO1A 1FNVA 1U5KA 1UE5A 2B8FA 1BCPC 3MWYW 1EYGA 1IL2A 2B63B 4JI1Q 1QWYA 3SR1A 4NW2A 4ZUJA 2JA6B 4A3CH 4K5XA 1I4HA 1EEID 1PA6A 1VQIA 5J1ZA 5I2XA 4BY1H 4M8AA 1PYWD 5K36G 5IOCA 4EQ5A 2PQEA 3QJYA 4K0KQ 2PW7A 5CMDA 3S2DB 4WJ4A 1FYCA 5CV5A 2IHFA 5E4XA 3S14B 3PCOB 1W3SA 1RIPA 3PV0A 5D65A 4G57A 3G6JB 4LFCQ 4DAMA 5G3LF 5FJ8G 5KNCA 1G2SA 5JPNC 5FLXL 1I4GA 1YNJD 1EQTA 1TS4A 3I2ZA 3UE0A 3FKIB 1IBLQ 4QJFA 4DNIA 1TWGB 2XIWA 1TWFH 4DK0A 4JV5Q 3VA7A 3JAML 2I0QA 4DR2L 1GUGA 1EOVA 2RDHA 3H0GG 3E9HA 2EYPA 4C3HG 4OO1H 1PRTF 4OIJA 1CQFA 3PUVA 5BR8Q 2MQHA 3T1YL 2IJ0A 4A3BH 2HUGA 3GTKH 1TWAH 2RF4A 2EOTA 1RDPD 4QMGA 5CV4A 2VUMG 3HOWH 4KHVA 3WOFA 2K1BA 4RKLA 2CW0D 3GTQH 4HIOA 2RDGA 3NELA 3LGJA 3A0JA 2KEEA 1YIJA 4LFAL 1Q46A 2NVYB 4GNXC 1NJIC 4KY6A 4QCLA 2TSSA 1BXTA 4RCNA 2B2YA 3KJOA 5C5MA 4GNXB 4LFCL 3I3CA 1BDOA 3OMCA 1TWHB 4DV5Q 4YWLA 1SEBD 2E5LL 1H9JA 5GQOA 1YI2A 2F0VA 5FKAC 2ZT9C 4M1UB 3HOUH 4H02A 3Q24A 2JA8B 5IT9c 4L5SA 4ID6A 5C4XG 2F0KA 2NWGA 3NTIA 4B3TQ 1PV4A 3S24A 2AHOB 1L1OA 4B3ML 3F2CA 1HCZA 5IP9H 4A3KH 1XPRA 3CCSA 2O5JC 1R9TH 3U50C 2L12A 3GTMH 3OW7A 3C1EA 5BN3A 4RAUC 2PPBC 4MN3A 2YV5A 1XNQL 2IL8A 2EVBA 4JI5Q 2MO0A 1QNKA 3EIVA 1JJCB 4UPAA 4BBSG 4QUFA 4BA2I 1Y1VB 2JYOA 1CHPD 4IUPA 2EY6A 3PIO3 1X55A 4NPSA 1R4PB 4A4IA 5LL6X 1EY5A 3BDOA 1GUWA 1PYBA 1WTOA 4DXGA 1O78A 4WRDA 2AUJD 3FVQA 4FXGC 4CDDC 4C3IB 1VQ4A 1E24A 3PUWA 4A3IH 1M90C 3M3YB 5FLMG 1QJOA 2KVMA 2MPMA 2NN6G 1VQJA 2F4IA 1I3QB 3I73A 2I5HA 2QDBA 3QG1A 2KCTA 2FHTA 4DUZL 4HEDA 1S72A 3VR3A 4DXFA 1HNWL 3PO3B 1PFMA 4OELB 3SXHA 1QUQB 3A55A 4X66L 1GM5A 1LUZA 1SROA 4IPDA 2CH4W 2IT1A 4J8QA 3DWPA 1TT2A 4IUNA 2F0QA 3TREA 2K7VA 1TVXA 1AN8A 3D4DA 4POFA 1S5FD 3F1ZA 1DM0B 5IODA 1MSHA 2A6EC 3HFZB 4MHEA 4HR7B 1O7ZA 1ZXTA 2OQKA 5IYDG 4GKKQ 4A3MH 1V8QA 4YY3Q 2DUDA 3CCVA 4A3DH 5T1IA 3K7AB 2WACA 3A54A 2K5WA 1LTTD 3KLWA 3H94A 2UUAL 1S40A 3CCMA 1EY9A 2EYMA 4AQYL 3PGZA 2K28A 3PF4A 2RSOA 2MHVA 1K9MC 4LF5Q 4PMCA 3KOJA 5D3DA 1PTOD 1PZID 4AIMA 4DAVA 3M4QA 1SN8A 2BDNA 1LTRD 1I94L 2ES2A 4DV3Q 2FXQA 1A8VA 3J81L 2A69D 2JA6G 1SNCA 1B8AA 5AFWA 4DNTB 3CXCA 3HKZB 3GTLB 1EIFA 1VQLA 2FMMA 5E1FA 2UXDL 2NVTB 1L0XB 4NKLA 5IE8A 1X56A 3I70A 1CKNA 1E1TA 5C0XH 1PH9A 5LMNW 5CR3A 4L5QA 4IUVA 1MGSA 1X32A 3OTOL 1DXMA 5FLXE 3NTHA 4CJ0B 4Z9CB 1K73C 3FKIG 3I4NB 5M5XB 2F1MA 3TBIB 1UE7A 3A56A 3TDQA 2UXCQ 2CHBD 3TZUA 1X3FA 1TY0A 3HEJA 2PQAA 2PCFB 5M3FH 2B2YC 4KLKA 1XWEA 3DMUA 3M4OH 2F3WA 3VYTA 3ZYYX 1BR9A 4XQNA 2R92H 1LTAD 2P5ZX 5CV6A 3NQTA 1K83B 4Y7NB 1LTBD 2CQAA 1XPOA 2IWHA 1O7IA 2K5NA 4ZQ3A 5D3IB 4LF6Q 4NXNQ 1JOQA 2N3SA 3J80i 4BS9A 3UDIA 4BY7H 1TS3A 1GO3E 4KV6A 2JJQA 1X3EA 2HIXA 4LFBL 1DOLA 1L1OB 4QF4A 5CV9A 1EY6A 3GTOB 1I50B 4LAAA 4KJOA 4HIKA 1WTVA 1S4ZA 4EQNA 4QQBX 1BO0A 4G4KA 3RLNA 4JOIA 4F8MA 1WTQA 4GKJL 4PMBA 4DPGA 1G91A 5IGEA 2JA8G 3H3VC 2JQOA 4K5WA 1ICWA 4IUUA 2WAQB 5LMUL 3A5ZB 1ZEQX 1K3BC 3K8AA 3HOXH 3CF5A 4LF9L 5JJZA 3DEOA 3A5UA 4P2CB 2ID0A 1KDCA 5ELEA 3WDNA 4C2MB 2ZXRA 2HCIA 2Z4HA 4CHTB 4APVA 3S16H 1EY0A 2Y0SB 3TRZA 2R7DA 1F77A 5M9OA 1PTOH 2ZTEA 4RGNA 2UUBL 2BE5D 4ILWA 2B2TA 1X3PA 1Y1VG 4DV0Q 2JA9A 1E2VA 1MJCA 2SDFA 1I6HB 1Y8NB 5C4HA 2H1EA 2XVSA 4DR7Q 2NB0A 3I4MH 1L0WA 2Q8RE 2D9UA 1PYSB 1EEFD 4GLAC 4C3IG 1XMOQ 4KMUC 1TU2B 1BBXC 1WI5A 1BBUA 5GROA 1C0AA 2MP1A 4L8JA 2R7ZH 1HZCA 3CD6A 3HOZB 2D2CC 3S1NH 3KYHC 1XMQQ 4FXDA 4L5TA 3AYHB 1BQQT 1NR4A 2LS01 2F4VQ 3NBIA 1MI2A 2L55A 3CC7A 2ZTDA 3PO3G 3S1MB 4XT3B 2E2HH 2CFMA 4J6HA 1CA6A 4FXKC 4DA2A 1PFNA 2EQSA 4FP5D 1HFNA 4O2DA 2WFWA 1D5XC 4ZRZA 1M1KC 3RD4A 1EU4A 1I4XA 4JYAL 5HY6A 5T1GA 2F0MA 5IGGA 1KC8C 3RZOB 2KHIA 1LLRD 2BDOA 2I07B 2J0TD 3M7GA 2DN8A 3CCQA 1TKWB 2R93B 3LWEA 3G6EA 1VQHA 1VF7A 1ZYRD 2G9DA 4RMFA 4X65L 5A2QL 5FOBB 2RDFA 1YZ6A 4LF7Q 3C3LA 1TY2A 3P20A 4CBVA 3F8TA 1U4LA 3NENA 5J3BA 4LW1A 3EN2A 1U4MA 2EYJA 5C4ZA 5HGQA 2PZUA 1UAPA 2N78A 3S2HB 4P74A 4OX9Q 4KN4C 3NP8A 1VQ8A 3QWNA 1A63A 4IFDJ 2JSOA 4X64L 5E4WC 1LO5D 1BOSA 1XTCD 2WIIB 2OXPA 4C3JB 4LNQA 2EYOA 3MC0B 4JI3Q 1GOZA 5IWAL 2DNEA 3PIPA 4BY1B 1YHQA 1VQPA 4DV7Q 1SNOA 3K0YA 3HKZE 2F0EA 2A8VA 4A75A 3G71A 3HZXA 1W2BA 2XNAC 3O13A 1VQKA 3PO2H 3ITPA 2M9VA 3HKZG 3MAQA 5EKKA 2KECA 3Q8DA 1Y8PB 4B3RQ 4BBRB 1NR2A 4NP5A 5M5YB 2PQAB 2O5IC 1U4RA 2F0TA 4IFDI 2LFNA 5C3EB 2E2JH 4K8IA 2RHQB 3CC4A 2SEBD 2L5TA 1SSOA 3VR6A 1FD7D 1SYDA 3Q22A 1IYUA 2AQ1B 3S1QB 3K6OA 5GAGC 2WKDA 1A15A 4RH6A 1BKBA 3I4NG 2SNSA 1N36L 4WJWA 3BDCA 4JI6L 3MFYA 4MTNA 2D62A 2KUMA 3K5MA 2H5XA 2HT1A 3KUPA 1U4PA 5J22A 4JI0L 2I5LX 1R4QB 2HQLA 3A8IE 3T4AC 1VQ6A 3N52A 1N33Q 3HOWB 3S9WA 3R8BA 3D8GA 3MTSA 1HR0W 4A93H 1KLUD 1Q82C 3OIPA 4FYDA 3CKIB 5HURA 4BXXH 3IRBA 1YVCA 2UUCL 1NUCA 2F0DA 4EGVA 2D0OA 1ILPA 2LY7A 2V1CC 1KQSA 1B3QA 3MA2B 4B3RL 1STEA 1VQFA 2DY7A 2LKVA 3PSIA 5CBEE 3HOUB 2ZM6Q 1WFQA 3I4LA 2WAQE 4RHSA 4NB3A 4H44C 3G7LA 1ASZA 1YNND 3JAMc 1A2UA 4E6IA 4OXPA 1B53A 4A3KB 3IL8A 1GD7A 4J1MA 4K6LA 2WAQG 2NTTA 5CBAE 1SFOH 2Y0SE 1IXRA 5FO9B 3ERQA 1GXDC 3RN5A 3LWUA 4I7ZC 5C4JB 1DJRD 2Y0SG 5AJ3Q 2Q2IA 2B2WA 2D5DA 4QB4A 3L3OC 4DR5L 3CC2A 5K36H 2XSCA 1YJWA 1TWCH 5JAVA 4QL5A 5EPJA 1WTPA 3KDFA 1YEZA 2YU9H 3I91A 1E2ZA 3BZKA 1LTSD 4NMZA 5EQ0A 2E76C 4CDCC 3FEWX 3R2TA 1EIYB 3QO2A 4DR6Q 2QA4A 1ICFB 1C4QA 2IX3A 5FJ8H 2G9HD 1PTOF 3NWSA 1D8LA 1STBA 4DR4L 2JA7H 1F2LA 1H9MA 2EYFA 3J80E 4LUVA 3K5OA 3C2PA 3HOZG 1YNJC 1TXYA 3ONAB 3CCJA 2HCCA 1BCPB 5KGUA 4TQUS 2XWJB 4MNOA 1ENFA 4HJ5A 3H0GH 4C3HH 2RBMA 1XNRQ 4U68A 4P71A 5HGTA 4A3LG 1K0RA 2YTYA 5EPLA 1GUTA 4YCUA 1KHIA 3NWTA 2VUMH 3H91A 2F52A 4JI2L 1N32Q 2L1BA 1EU3A 1TS2A 1GKHA 3HP3A 4FF1A 2CW0C 4DN4M 4YHHQ 1JJGA 4K8JA 1ASYA 2F0PA 1D7QA 1G6PA 3RN2A 1CT1D 1EQVA 2RSNA 1D1IA 4FNFA 5DLQE 1B7YB 1SNMA 3A8JE 2E2DC 3SGIA 2R93G 4KD4A 5M3MB 1A62A 5A2QE 3GTPH 3OHXC 3L2PA 1ONLA 2A68D 1G51A 4P72A 1FGUA 2VY3A 2Z8LA 1HXYD 5C4XH 4JI1L 1FJGQ 1JE5A 3K7UC 1MIUA 2ENBA 2Z4IA 3TZDA 5GADC 1PH6A 1C7YA 1O80A 4PZ8A 1KIXA 2OEOA 1EOTA 3ULLA 2TMPA 3AQQA 5FO7B 3GTGH 5I9PA 4C3JG 4K0KL 4JBMA 4JI4Q 3D31A 2JA5B 1DZ1A 4BY1G 4CKBA 2BH2A 4BBSH 3GTJH 4R8NA 4GLVB 4UY8C 1F2YA 2B2VC 4V0BA 4AYBB 1QG7A 2NVQB 5CV8A 2NYZD 2WV6D 4OWXB 4JBJA 3K5LA 1KRSA 1D1KA 2GA4B 5ELFA 1IBKQ 1IBLL 3RZDH 3S15B 1A6XA 4P75A 4BBRG 1NE3A 1PH3A 2O2LD 4C56C 4JV5L 1O7YA 5FLMH 2EXZA 1HUNA 4UHVA 2NN6H 1S3OA 5C3EG 3DWAA 3ULPA 3CRKC 4TVAB 3MEHA 1V9PA 1EY4A 1FJGL 5BR8L 2RKSA 4A3GB 3Q0AA 2VB2X 3S1RH 2D0PA 2KHJA 2E2IH 1H9RA 3C1FA 5TSSA 4ZKCB 4RGMA 1KDBA 4HMJA 4A3FB 3J81c 2K14A 1FL0A 4L63B 4R4CA 2GVAA 1VF5C 3HOWG 3H15A 1J9OA 5JEAH 4Q0FA 1JQYD 2EYLA 5H1SE 3U9SA 1EWIA 4ME3A 4BY7B 4DV5L 3M4YA 2E74C 1RL2A 1GUNA 5C3XA 1B1ZA 5ISRA 1YHBA 1B9NA 4IFDG 1WVLA 1SNPA 2VQEQ 4UDUC 5IYDH 4ZLTF 3L0OA 1MKHA 3CAMA 2HDMA 2PI2A 3PUZA 4B3TL 3HOVH 1RKNA 2M2LA 4FVMA 5GAEC 4R4TA 3HOUG 3J7AF 4GS3A 5JJLA 1D2BA 1EFID 2B2WC 4RKBA 1B9MA 4DK1A 4IPCA 1JB7A 2YYZA 4PNYA 5ELDA 2ZJPA 3J7ZC 1E0BA 4A3KG 5C44B 1LT6D 3NEMA 4JI5L 1ILQA 2YTXA 1X6OA 3KF6B 3KDFB 3S16B 1STAA 1V43A 4KHZA 1B4OA 2XN9C 2B63H 1ESRA 4A3JB 4A76A 4XYQA 2BA0A 3ZJYC 2A69C 4GOPC 1JJ2A 1EL0A 1B2TA 5KNDA 1EQQA 3DUZA 1KNAA 1N34Q 2BH8A 3DEPA 4GOPB 5ELNA 2KHSA 1T9HA 3UDGA 3KBXA 3I4MB 3K5NA 3EVQA 3GV6A 2F0JA 1EYAA 3S2DH 1A3VA 4QIWB 1EIGA 4A3EH 5EJWA 2QF7A 2OT2A 2VQFQ 3PIP3 1WOCA 2QILA 1HA6A 1UUPA 4XQJA 2AQ2B 3CPFA 2Q2TA 3A7AB 1LTID 5I9OA 5IIFA 5IT9L 2VL6A 3FPUB 1RD9D 4RFBA 4XXEA 1HFGA 4JK1C 1SLJA 4JI8Q 4S3SA 4KJNA 1IW7D 4ZK9B 1JOOA 1QVGA 1SNDA 4YCWA 2Z1CA 2MGSA 4UP7A 5LL6S 1PRTC 2EXDA 3RMHA 1KRTA 1AP0A 4YCVA 1WTXA 1OXUA 1A3TA 3EA6A 3UDFA 1K3RA 1FGBD 1PRTB 1K8OA 4DV2Q 2UXBQ 2K4KA 3CHBD 4GKKL 1NNXA 3OWEB 1WCMH 3SK6A 4EQOA 2ATWA 1VCIA 4YY3L 1K28A 2EY2A 3BZDB 1VQAA 3BVGA 2NVYH 5IYBH 4AH6A 4ZUIA 1Q8IA 1IL8A 2CKZB 1WJJA 1G6ZA 1B70B 2GN5A 1OTCA 1L0YB 3K57A 1TWHH 5M3MG 4LF5L 2QCPX 4DUYQ 1NBWA 4KI0A 4WORA 4DKAC 2JA8H 4JBWA 1JWSD 2J7ZA 1JMCA 1Y69U 4DV3L 5CGKA 2R3ZA 3H3VI 1QE6A 2RVLA 1I6VC 4F7XA 2K5DA 4EX5A 2GVBA 2JK8A 3UDXA 1DOKA 1D5MC 3CW2C 3OYYA 4HJ9A 1E2WA 1OXTA 1IBMQ 3DM1A 1EIHA 1P8LA 2A6HD 1PH1A 2NZHA 2DY8A 3QR8A 4AYBE 3EFXD 2KQ3A 1LV9A 2JA5G 5KEEA 3PO2B 3MVVA 1IYJB 1Y1VH 2WP8J 2BE5C 2CWAA 2EZVA 4AYBG 4PV1C 1Z7TA 1QVCA 1JWUD 3P75A 3NSWA 1EZ8A 1RTOA 1ESFA 4C3IH 3H6MA 4LUOA 3E6ZX 2F0NA 2UXCL 3FP9A 3I90A 3KLRA 3SK5A 2KA7A 3TP6A 4L5RC 1CHQD 4PG3A 4K6DA 4KK7A 1CUKA 3Q6SA 4A3GG 3PO3H 1EYDA 2SOBA 1C8CA 4BWGB 4B9WA 4FF3A 1A3UA 4LF6L 1M8AA 1AZPA 4NXNL 1E22A 4A3FG 3W5OA 1DCZA 1K8MA 3AB9A 3CQZB 3DWQA 1VQGA 5LMNQ 2UU9Q 4PZ6A 2CWPA 4OGQC 4DR1Q 3HOYB 4HIDA 4BY7G 2PW5A 3TS2A 2EJMA 1OO9B 1EWCA 3VR5A 4V190 3J80L 2X69A 2JN4A 4OEMB 2DGYA 1ET9A 1ZYRC 3CP0A 4X3TA 1HZ9A 4N9PA 3AMUA 2N55A 2NBFA 2VNUD 2NVXB 1P16A 1SJHD 3D6WA 2AMCB 3SK4A 4LJZC 2WB1B 1KLGD 2JEBI 1QZGA 1CZGA 4OHJA 1SE3A 5C44G 1HJPA 1Y1WB 2CQOA 2CCZA 3T1HQ 3DM3A 4DV0L 1X65A 2VXWA 5FK9C 4XDXA 2Q8TA 4DR7L 5BN4A 3I55A 4A3JG 1GJXA 3U58A 4ZKBB 4QIWE
chains in the Genus database with same CATH topology
4B3ML 3F2CA 5IP9H 4A3KH 1XPRA 3CCSA 1XMOL 4LFBQ 1R9TH 2Y0SG 3U50C 4DK6C 3GTMH 4OONA 3S15H 5AJ3Q 3CMAA 3I4MG 2Q2IA 3CC2A 4DR5L 4B3SQ 1YJWA 1TWCH 1VQBA 2Z0SA 1EUJA 1Y14B 3ERSX 1XMQL 4QL5A 2NVTH 2YV5A 1XNQL 3GO5A 5IYCH 4DV4Q 1YEZA 2MO0A 1L2FA 2K5VA 1JJCB 2B3GA 3EIVA 3KDFA 4UPAA 4JI8L 3RLOA 2F4VL 4BA2I 1BVSA 2N49A 4BBSG 3BZKA 1VQ9A 5LMUQ 4LF9Q 3WWVA 1X55A 1SE8A 4NPSA 1EIYB 4DR6Q 2QA4A 4DV1Q 4A4IA 4A3GH 1VQMA 5FJ8H 2RCNA 1PYBA 3D0FA 2MNAA 1XTDA 2VW9A 2MFIA 1D8LA 4DR4L 2JA7H 4OWTB 3GDEA 4OWWB 3STBD 3I4NH 4DAYB 5M5XH 4OO1I 1YJNA 1VQ4A 1E24A 4LUVA 4DV2L 1CSPA 4A3FH 2R7FA 3PUWA 3PUXA 4A3IH 3HOZG 1TXYA 1M90C 1KXLA 5FLMG 1HNZQ 3BU2A 3CCJA 3KJPA 2NN6G 2UUBQ 1VQJA 2PMZE 4TQUS 2K5HA 4MNOA 2I5HA 5C0XG 1KD1C 1Q86C 2KCTA 4HJ5A 4DUZL 1WCMG 3H0GH 4JC0A 4C3HH 1XNRQ 1S72A 1K83H 4Y7NH 3M3YH 1L1OC 3M4PA 4ALPA 4P71A 5IYBG 1HNXQ 1HNWL 3A74A 2JE6I 4A3LG 1K0RA 4R4IA 2XGTA 2YTYA 4DUYL 1CSQA 2AKWB 4YCUA 1PH8A 1I3QH 1U0LA 1E3PA 3CCUA 1QUQB 1KHIA 2VUMH 1CKMA 2F52A 2L15A 4JI2L 1N32Q 1UWVA 4X6AH 1G291 4LF7L 4X66L 1GM5A 4FDBA 1H95A 2Q2HA 1AE2A 1GKHA 1LUZA 3CCRA 1SROA 4IPDA 4IJHA 1PVOA 5M3FG 1MJEA 2IT1A 4YHHQ 4JI7Q 4QQBX 1JJGA 1ASYA 1HH2P 3I7FA 1Z9FA 1Q1BA 1YHAA 3TREA 1D7QA 1VQEA 3RN2A 4NXMQ 2R92G 1G6PA 1IBML 2EIFA 4X62Q 5DLQE 4PZ7A 3GTOH 1I50H 1B7YB 3TEHB 4POFA 4DV1L 4OX9L 3ICEA 3F1ZA 2JEAI 3SGIA 2R93G 3JC66 4LF8Q 5C44H 2KENA 1A62A 3K80C 3G4SA 1K8GA 4GKJQ 3GTPH 3L2PA 3HFZB 1J5EQ 4JI3L 4HJ7A 1G51A 4P72A 2OQKA 1FGUA 1KL9A 2VY3A 5IYDG 4GKKQ 1LTLA 4DV7L 4A3MH 1X54A 3BZCA 5C4XH 1UE1A 4JI1L 4YY3Q 1JE5A 1FJGQ 3K7UC 2DUDA 4C2MH 3CCVA 4DV6Q 4A3JH 1MIUA 4QY7A 4A3DH 4JI5Q 2N8NA 5IP7H 5GADC 3KLWA 4JYAQ 1PH6A 1C7YA 1N9WA 2UUAL 1S40A 3CCMA 4PZ8A 1KIXA 4AQYL 2HHHQ 1HNXL 3PGZA 4GN4B 3ULLA 3AQQA 3PF4A 1WYDA 1K9MC 4R4OA 4LF5Q 3GTGH 4K0KL 3KOJA 4JBMA 2KBNA 4JI4Q 3PO2G 3K7AH 4AIMA 1GVPA 3D31A 3M4QA 2VZAA 1SN8A 1AE3A 3B6YA 4BY1G 5FLXc 1NTGA 2IY5B 2BH2A 4X65Q 3GTJH 1I94L 2ES2A 4BBSH 1Q8KA 4GLVB 4UY8C 3HOXG 4DV3Q 3PIOA 2FXQA 1A8VA 1XPUA 2PNHA 2JA6G 4OWXB 4JBJA 1B8AA 1KRSA 4XTCS 3BJUA 1X3GA 1IBKQ 4MZ9A 1LM0A 1IBLL 3RZDH 3CXCA 3STBC 1KAWA 4LUZA 4P75A 3HOZH 4XIGS 4BBRG 1NE3A 1PH3A 1EIFA 3DLLA 1Q7YC 1VQLA 5LMNL 2UU9L 4LF8L 4JV5L 5FLMH 4X64Q 4IOCA 2UXDL 1NMFA 1N33L 3VDYA 1FVIA 4GN5A 1S3OA 5EAYA 5C3EG 1DGSA 5IE8A 5IWAQ 1X56A 4DR1L 3ULPA 1CKNA 4TVAB 1E1TA 3PUYA 1V9PA 1PH9A 5LMNW 3S1MH 1Z47A 4L5QA 1FJGL 5BR8L 1VQDA 2HIVA 3CPWA 3GTLH 3W1BA 4KHPQ 3OTOL 2ZJRA 4RG1A 4A3LH 2PI2E 3S1RH 2D0PA 2KHJA 4DR3Q 3AEVA 3KF6A 1V1QA 4YWMA 1K73C 3FKIG 2E2IH 2HHHL 4BXXG 2R7ZG 1UE7A 3J81c 1Q1EA 2K14A 2UXCQ 1OXSC 1C9OA 1FL0A 1X3FA 4JCVE 3CCEA 1Q12A 4R4CA 2GVAA 2PQAA 5M3FH 3H15A 1PH5A 3HOWG 4KLKA 3M4OH 3HOYG 2YU9H 2ZM6L 1VQCA 2R92H 5H1SE 3RZOH 4GOPA 2F3IA 1NMGA 1EWIA 4ME3A 3JAMi 2BA1A 4DV5L 1XPOA 1A0IA 1O7IA 2K5NA 1RL2A 3T1HL 4LF6Q 1YHBA 1N36Q 4JI6Q 4NXNQ 1E1OA 1AH9A 1VQ5A 2K75A 4IFDG 1HR0Q 2WB1E 3MXNB 2VQEQ 2N3SA 4WJ3M 3J80i 5IYDH 3UDIA 4BY7H 3L0OA 1MKHA 3CAMA 3PUZA 2PI2A 4B3TL 5C0XJ 4JI0Q 3HOVH 2A1AA 1LYLA 5GAEC 4R4TA 4DR2Q 1GO3E 4LF4Q 3HOUG 2JJQA 1X3EA 2HIXA 4LFBL 2OTLA 4GS3A 5JJLA 2WB1G 1L1OB 3S2HH 2RHSB 5JJIA 1CKNB 4BA1I 5AJ3L 4IPCA 1UEBA 1JB7A 5JJKA 2YYZA 4KHPL 4B3SL 2ZJPA 3T1YQ 4HIKA 1NY4A 4P73A 1Y1WG 1HZBA 1E7ZA 3J7ZC 1VQOA 4A3KG 4C3JH 4DR3L 2UUCQ 3RLNA 4JOIA 3ULJA 3NEMA 4JI5L 4DV4L 4DPGA 4GKJL 2YTXA 2OQ0A 2JA8G 1X6OA 2I5MX 3KF6B 3KDFB 2JQOA 2ZTCA 5JEAJ 1V43A 4KHZA 5LMUL 4LF9L 3A5ZB 3HOXH 3K8AA 2B63H 3CF5A 1K8AC 5IY0A 4DR6L 1BBWA 3A5UA 5IYCG 2ID0A 2NN6I 4LFAQ 4A76A 2BA0A 2YTVA 3ZJYC 1SR3A 1JT8A 4GOPC 1JJ2A 3F2DA 4IOAA 4GNXA 5C0XI 1YNXA 4IJLA 1EQQA 1N34Q 4APVA 3S16H 2OCEA 3J81j 2BH8A 3TRZA 2R7DA 4GOPB 3RR5A 5ELNA 3UDGA 1T9HA 3H3VH 4BBRH 2AWOA 1HNZL 2ZTEA 2E5LQ 3S2DH 2JA7G 2UUBL 5M5YH 4A3EH 2NZOA 2Q2UA 1Y1VG 4DV0Q 2JA9A 1MJCA 3UE1A 1YBYA 4YWKA 5C3EH 2VQFQ 2A19A 1HR0L 1WOCA 3M9BA 3CMEA 1XNRL 4DR7Q 3I4MH 3S1QH 3K0XA 3U4ZA 4LF4L 4A3CG 2K50A 1L0WA 4B3MQ 2Q2TA 3CPFA 4IO9A 1PYSB 3FHWA 4GLAC 1XMOQ 1WI5A 1I6HH 1BBUA 1N32L 2VL6A 5GROA 2OTJA 1C0AA 2R7ZH 3L7ZC 1HZCA 4JOIC 3CQZH 4DR5Q 3CD6A 3S1NH 3KYHC 4DK3C 1XMQQ 4L5TA 4GLXA 3AYHB 4YHHL 1SLJA 4JI7L 1XNQQ 3M85A 3RNUA 2ZJQA 1VS0A 3CCLA 4JI8Q 1SRUA 2F4VQ 4NXML 3HOYH 1EFWA 3I4OA 4X62L 3TS0A 4JG2A 3CC7A 4LWCA 2ZTDA 1QVGA 3PF5A 1QVFA 3PO3G 4YCWA 3KFUA 4UP7A 1XJVA 4O0AA 2E2HH 4HIMA 2LSSA 2CFMA 2EXDA 2ASBA 1KRTA 4YCVA 3U4VA 4IPGA 1OXUA 4DR4Q 1J5EL 1N8RC 3UDFA 1K3RA 2EQSA 1OXXK 4DV2Q 1PHJA 2K4KA 2UXBQ 4GKKL 3AFQA 2ATWA 1WCMH 1I5FA 1VCIA 2Z6KA 4YY3L 4O2DA 2WFWA 1VQAA 2AWNA 4DV6L 4JBKA 2NVYH 5IYBH 2NVXH 3RLFA 4AH6A 1M1KC 4JYAL 4A93G 2CKZB 4POGA 5HY6A 4OO1G 1WJJA 1B70B 4DUZQ 2IX0A 2GN5A 1KC8C 1OTCA 2KHIA 2IX1A 4A3BG 1TWHH 4R1JA 5M3MG 1HNWQ 4QGUA 4LF5L 1Y1WH 3CCQA 1CKOA 4JI4L 1QUQA 5IP7G 3G6EA 4DUYQ 1NBWA 4KI0A 1VQHA 4R4QA 3M7NA 4DKAC 3ER0A 1SMXA 2JA8H 4RMFA 4JBWA 4X65L 1VQ7A 4JI2Q 1JMCA 3HKSA 1YZ6A 4DV3L 4LF7Q 3H3VI 4X66Q 1IZ6A 1PH2A 4Y52H 1UE6A 2K52A 3J7A5 3I56A 1X9NA 3E9IA 3F8TA 3NENA 5J3BA 4LW1A 2GVBA 2JK8A 4EX5A 5C4JH 3S17H 2R93H 3EN2A 3UDXA 1J6QA 4J15A 3CW2C 1IBKL 3OYYA 5HGQA 1OXTA 4HJ9A 1IBMQ 2LXJA 1P8LA 2N78A 1VQNA 2IHEA 5M5WH 4HJ8A 3G48A 1PH1A 4P74A 2NZHA 4OX9Q 1VQ8A 2ALYB 3MEFA 4AYBE 1YITA 4IFDJ 1A63A 4X64L 2JA5G 4IPHA 5ELOA 2MO1A 4LNQA 1IYJB 1U5KA 1Y1VH 1UE5A 2WP8J 4JI3Q 5IWAL 2CWAA 2Z6KC 3PIPA 2B29A 1YHQA 1VQPA 4AYBG 3F2BA 4DV7Q 2C35B 1EYGA 1IL2A 3HKZE 2A8VA 4JI1Q 4A75A 3G71A 4PMWA 1QVCA 1W2BA 5IP9G 4A3CH 2UXBL 1PA6A 1VQKA 1VQIA 3PO2H 4C3IH 2UUAQ 5GAHC 4LUOA 4BY1H 3HKZG 3KF8B 3J81i 4AQYQ 5K36G 2UXCL 4EQ5A 3Q8DA 3FP9A 1PFSA 4B3RQ 4K0KQ 2QGQA 4UP8A 3NBHB 4WJ4A 2OWOA 2JA6H 4L5RC 2IHFA 3PCOB 2PQAB 4IFDI 1W3SA 4PG3A 1I94Q 2E2JH 1RIPA 2RHQB 3CC4A 3PV0A 1CUKA 4A3GG 4UP9A 4LFCQ 4DAMA 3PO3H 5FJ8G 5JEAG 5GAGC 1QZHA 1PH7A 1BKBA 4LF6L 3I4NG 3S14H 4NXNL 1N36L 4JI6L 1E22A 4MTNA 2D62A 1HZAA 3I2ZA 4A3FG 3UE0A 4A3IG 3W5OA 1IBLQ 2VQEL 4QJFA 2H5XA 4DNIA 2HT1A 4JI0L 1VQGA 2LXKA 1TWFH 2I5LX 2HQLA 5LMNQ 2UU9Q 4JV5Q 2UXDQ 1VQ6A 2I0QA 1N33Q 3E0EA 4DR2L 4PZ6A 1EOVA 1PH4A 1HR0W 2CWPA 3H0GG 1EQRA 3W1GA 4DR1Q 3E9HA 1Q81C 4HIDA 5E7NA 1Q82C 4A93H 3HOVG 3FKIH 3TS2A 4BY7G 4BXXH 3PUVA 5BR8Q 4A3BH 2MQHA 1YVCA 1TWGH 3IRBA 3T1YL 4GN3B 5M3MH 3OTOQ 1TWAH 2RF4A 3GTKH 2UUCL 1YJ9A 2VUMG 3HOWH 1OXVA 2XTIA 2DGYA 3AFPA 3CP0A 2QEXA 2KCMA 2D0OA 3GTQH 3EBEA 4HIOA 2V1CC 3NELA 3LGJA 1KQSA 3A0JA 4B3RL 1VQFA 1HZ9A 2R6GA 3OW2A 1YIJA 4LFAL 2VS1A 1Q46A 2E8GA 3PSIA 4GNXC 1NJIC 2VNUD 3KJOA 1P16A 2ZM6Q 2B63G 1WFQA 2AMCB 1N34L 4GNXB 2JEBI 1QZGA 4LFCL 2WAQE 4NB3A 4DV5Q 1ASZA 4YWLA 3JAMc 1HJPA 5C44G 2E5LL 5GQOA 4OXPA 1YI2A 2CQOA 3GD7A 2CCZA 2JA5H 3T1HQ 3DM3A 4DV0L 4HJAA 1GD7A 1X65A 3HOUH 4H02A 2VQFL 2WAQG 5IT9c 3TQYA 4A3MG 4L5SA 1SFOH 2Y0SE 5C4XG 1IXRA 4DR7L 3J80c 3I55A 4A3JG 3K81C 4B3TQ 4A3EG 1PV4A 2NVQH 3S24A 4A3DG 3RN5A 3U58A 2AHOB 4QIWE 1L1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M L;  3F2C A;  5IP9 H;  4A3K H;  1XPR A;  3CCS A;  1XMO L;  4LFB Q;  1R9T H;  2Y0S G;  3U50 C;  4DK6 C;  3GTM H;  4OON A;  3S15 H;  5AJ3 Q;  3CMA A;  3I4M G;  2Q2I A;  3CC2 A;  4DR5 L;  4B3S Q;  1YJW A;  1TWC H;  1VQB A;  2Z0S A;  1EUJ A;  1Y14 B;  3ERS X;  1XMQ L;  4QL5 A;  2NVT H;  2YV5 A;  1XNQ L;  3GO5 A;  5IYC H;  4DV4 Q;  1YEZ A;  2MO0 A;  1L2F A;  2K5V A;  1JJC B;  2B3G A;  3EIV A;  3KDF A;  4UPA A;  4JI8 L;  3RLO A;  2F4V L;  4BA2 I;  1BVS A;  2N49 A;  4BBS G;  3BZK A;  1VQ9 A;  5LMU Q;  4LF9 Q;  3WWV A;  1X55 A;  1SE8 A;  4NPS A;  1EIY B;  4DR6 Q;  2QA4 A;  4DV1 Q;  4A4I A;  4A3G H;  1VQM A;  5FJ8 H;  2RCN A;  1PYB A;  3D0F A;  2MNA A;  1XTD A;  2VW9 A;  2MFI A;  1D8L A;  4DR4 L;  2JA7 H;  4OWT B;  3GDE A;  4OWW B;  3STB D;  3I4N H;  4DAY B;  5M5X H;  4OO1 I;  1YJN A;  1VQ4 A;  1E24 A;  4LUV A;  4DV2 L;  1CSP A;  4A3F H;  2R7F A;  3PUW A;  3PUX A;  4A3I H;  3HOZ G;  1TXY A;  1M90 C;  1KXL A;  5FLM G;  1HNZ Q;  3BU2 A;  3CCJ A;  3KJP A;  2NN6 G;  2UUB Q;  1VQJ A;  2PMZ E;  4TQU S;  2K5H A;  4MNO A;  2I5H A;  5C0X G;  1KD1 C;  1Q86 C;  2KCT A;  4HJ5 A;  4DUZ L;  1WCM G;  3H0G H;  4JC0 A;  4C3H H;  1XNR Q;  1S72 A;  1K83 H;  4Y7N H;  3M3Y H;  1L1O C;  3M4P A;  4ALP A;  4P71 A;  5IYB G;  1HNX Q;  1HNW L;  3A74 A;  2JE6 I;  4A3L G;  1K0R A;  4R4I A;  2XGT A;  2YTY A;  4DUY L;  1CSQ A;  2AKW B;  4YCU A;  1PH8 A;  1I3Q H;  1U0L A;  1E3P A;  3CCU A;  1QUQ B;  1KHI A;  2VUM H;  1CKM A;  2F52 A;  2L15 A;  4JI2 L;  1N32 Q;  1UWV A;  4X6A H;  1G29 1;  4LF7 L;  4X66 L;  1GM5 A;  4FDB A;  1H95 A;  2Q2H A;  1AE2 A;  1GKH A;  1LUZ A;  3CCR A;  1SRO A;  4IPD A;  4IJH A;  1PVO A;  5M3F G;  1MJE A;  2IT1 A;  4YHH Q;  4JI7 Q;  4QQB X;  1JJG A;  1ASY A;  1HH2 P;  3I7F A;  1Z9F A;  1Q1B A;  1YHA A;  3TRE A;  1D7Q A;  1VQE A;  3RN2 A;  4NXM Q;  2R92 G;  1G6P A;  1IBM L;  2EIF A;  4X62 Q;  5DLQ E;  4PZ7 A;  3GTO H;  1I50 H;  1B7Y B;  3TEH B;  4POF A;  4DV1 L;  4OX9 L;  3ICE A;  3F1Z A;  2JEA I;  3SGI A;  2R93 G;  3JC6 6;  4LF8 Q;  5C44 H;  2KEN A;  1A62 A;  3K80 C;  3G4S A;  1K8G A;  4GKJ Q;  3GTP H;  3L2P A;  3HFZ B;  1J5E Q;  4JI3 L;  4HJ7 A;  1G51 A;  4P72 A;  2OQK A;  1FGU A;  1KL9 A;  2VY3 A;  5IYD G;  4GKK Q;  1LTL A;  4DV7 L;  4A3M H;  1X54 A;  3BZC A;  5C4X H;  1UE1 A;  4JI1 L;  4YY3 Q;  1JE5 A;  1FJG Q;  3K7U C;  2DUD A;  4C2M H;  3CCV A;  4DV6 Q;  4A3J H;  1MIU A;  4QY7 A;  4A3D H;  4JI5 Q;  2N8N A;  5IP7 H;  5GAD C;  3KLW A;  4JYA Q;  1PH6 A;  1C7Y A;  1N9W A;  2UUA L;  1S40 A;  3CCM A;  4PZ8 A;  1KIX A;  4AQY L;  2HHH Q;  1HNX L;  3PGZ A;  4GN4 B;  3ULL A;  3AQQ A;  3PF4 A;  1WYD A;  1K9M C;  4R4O A;  4LF5 Q;  3GTG H;  4K0K L;  3KOJ A;  4JBM A;  2KBN A;  4JI4 Q;  3PO2 G;  3K7A H;  4AIM A;  1GVP A;  3D31 A;  3M4Q A;  2VZA A;  1SN8 A;  1AE3 A;  3B6Y A;  4BY1 G;  5FLX c;  1NTG A;  2IY5 B;  2BH2 A;  4X65 Q;  3GTJ H;  1I94 L;  2ES2 A;  4BBS H;  1Q8K A;  4GLV B;  4UY8 C;  3HOX G;  4DV3 Q;  3PIO A;  2FXQ A;  1A8V A;  1XPU A;  2PNH A;  2JA6 G;  4OWX B;  4JBJ A;  1B8A A;  1KRS A;  4XTC S;  3BJU A;  1X3G A;  1IBK Q;  4MZ9 A;  1LM0 A;  1IBL L;  3RZD H;  3CXC A;  3STB C;  1KAW A;  4LUZ A;  4P75 A;  3HOZ H;  4XIG S;  4BBR G;  1NE3 A;  1PH3 A;  1EIF A;  3DLL A;  1Q7Y C;  1VQL A;  5LMN L;  2UU9 L;  4LF8 L;  4JV5 L;  5FLM H;  4X64 Q;  4IOC A;  2UXD L;  1NMF A;  1N33 L;  3VDY A;  1FVI A;  4GN5 A;  1S3O A;  5EAY A;  5C3E G;  1DGS A;  5IE8 A;  5IWA Q;  1X56 A;  4DR1 L;  3ULP A;  1CKN A;  4TVA B;  1E1T A;  3PUY A;  1V9P A;  1PH9 A;  5LMN W;  3S1M H;  1Z47 A;  4L5Q A;  1FJG L;  5BR8 L;  1VQD A;  2HIV A;  3CPW A;  3GTL H;  3W1B A;  4KHP Q;  3OTO L;  2ZJR A;  4RG1 A;  4A3L H;  2PI2 E;  3S1R H;  2D0P A;  2KHJ A;  4DR3 Q;  3AEV A;  3KF6 A;  1V1Q A;  4YWM A;  1K73 C;  3FKI G;  2E2I H;  2HHH L;  4BXX G;  2R7Z G;  1UE7 A;  3J81 c;  1Q1E A;  2K14 A;  2UXC Q;  1OXS C;  1C9O A;  1FL0 A;  1X3F A;  4JCV E;  3CCE A;  1Q12 A;  4R4C A;  2GVA A;  2PQA A;  5M3F H;  3H15 A;  1PH5 A;  3HOW G;  4KLK A;  3M4O H;  3HOY G;  2YU9 H;  2ZM6 L;  1VQC A;  2R92 H;  5H1S E;  3RZO H;  4GOP A;  2F3I A;  1NMG A;  1EWI A;  4ME3 A;  3JAM i;  2BA1 A;  4DV5 L;  1XPO A;  1A0I A;  1O7I A;  2K5N A;  1RL2 A;  3T1H L;  4LF6 Q;  1YHB A;  1N36 Q;  4JI6 Q;  4NXN Q;  1E1O A;  1AH9 A;  1VQ5 A;  2K75 A;  4IFD G;  1HR0 Q;  2WB1 E;  3MXN B;  2VQE Q;  2N3S A;  4WJ3 M;  3J80 i;  5IYD H;  3UDI A;  4BY7 H;  3L0O A;  1MKH A;  3CAM A;  3PUZ A;  2PI2 A;  4B3T L;  5C0X J;  4JI0 Q;  3HOV H;  2A1A A;  1LYL A;  5GAE C;  4R4T A;  4DR2 Q;  1GO3 E;  4LF4 Q;  3HOU G;  2JJQ A;  1X3E A;  2HIX A;  4LFB L;  2OTL A;  4GS3 A;  5JJL A;  2WB1 G;  1L1O B;  3S2H H;  2RHS B;  5JJI A;  1CKN B;  4BA1 I;  5AJ3 L;  4IPC A;  1UEB A;  1JB7 A;  5JJK A;  2YYZ A;  4KHP L;  4B3S L;  2ZJP A;  3T1Y Q;  4HIK A;  1NY4 A;  4P73 A;  1Y1W G;  1HZB A;  1E7Z A;  3J7Z C;  1VQO A;  4A3K G;  4C3J H;  4DR3 L;  2UUC Q;  3RLN A;  4JOI A;  3ULJ A;  3NEM A;  4JI5 L;  4DV4 L;  4DPG A;  4GKJ L;  2YTX A;  2OQ0 A;  2JA8 G;  1X6O A;  2I5M X;  3KF6 B;  3KDF B;  2JQO A;  2ZTC A;  5JEA J;  1V43 A;  4KHZ A;  5LMU L;  4LF9 L;  3A5Z B;  3HOX H;  3K8A A;  2B63 H;  3CF5 A;  1K8A C;  5IY0 A;  4DR6 L;  1BBW A;  3A5U A;  5IYC G;  2ID0 A;  2NN6 I;  4LFA Q;  4A76 A;  2BA0 A;  2YTV A;  3ZJY C;  1SR3 A;  1JT8 A;  4GOP C;  1JJ2 A;  3F2D A;  4IOA A;  4GNX A;  5C0X I;  1YNX A;  4IJL A;  1EQQ A;  1N34 Q;  4APV A;  3S16 H;  2OCE A;  3J81 j;  2BH8 A;  3TRZ A;  2R7D A;  4GOP B;  3RR5 A;  5ELN A;  3UDG A;  1T9H A;  3H3V H;  4BBR H;  2AWO A;  1HNZ L;  2ZTE A;  2E5L Q;  3S2D H;  2JA7 G;  2UUB L;  5M5Y H;  4A3E H;  2NZO A;  2Q2U A;  1Y1V G;  4DV0 Q;  2JA9 A;  1MJC A;  3UE1 A;  1YBY A;  4YWK A;  5C3E H;  2VQF Q;  2A19 A;  1HR0 L;  1WOC A;  3M9B A;  3CME A;  1XNR L;  4DR7 Q;  3I4M H;  3S1Q H;  3K0X A;  3U4Z A;  4LF4 L;  4A3C G;  2K50 A;  1L0W A;  4B3M Q;  2Q2T A;  3CPF A;  4IO9 A;  1PYS B;  3FHW A;  4GLA C;  1XMO Q;  1WI5 A;  1I6H H;  1BBU A;  1N32 L;  2VL6 A;  5GRO A;  2OTJ A;  1C0A A;  2R7Z H;  3L7Z C;  1HZC A;  4JOI C;  3CQZ H;  4DR5 Q;  3CD6 A;  3S1N H;  3KYH C;  4DK3 C;  1XMQ Q;  4L5T A;  4GLX A;  3AYH B;  4YHH L;  1SLJ A;  4JI7 L;  1XNQ Q;  3M85 A;  3RNU A;  2ZJQ A;  1VS0 A;  3CCL A;  4JI8 Q;  1SRU A;  2F4V Q;  4NXM L;  3HOY H;  1EFW A;  3I4O A;  4X62 L;  3TS0 A;  4JG2 A;  3CC7 A;  4LWC A;  2ZTD A;  1QVG A;  3PF5 A;  1QVF A;  3PO3 G;  4YCW A;  3KFU A;  4UP7 A;  1XJV A;  4O0A A;  2E2H H;  4HIM A;  2LSS A;  2CFM A;  2EXD A;  2ASB A;  1KRT A;  4YCV A;  3U4V A;  4IPG A;  1OXU A;  4DR4 Q;  1J5E L;  1N8R C;  3UDF A;  1K3R A;  2EQS A;  1OXX K;  4DV2 Q;  1PHJ A;  2K4K A;  2UXB Q;  4GKK L;  3AFQ A;  2ATW A;  1WCM H;  1I5F A;  1VCI A;  2Z6K A;  4YY3 L;  4O2D A;  2WFW A;  1VQA A;  2AWN A;  4DV6 L;  4JBK A;  2NVY H;  5IYB H;  2NVX H;  3RLF A;  4AH6 A;  1M1K C;  4JYA L;  4A93 G;  2CKZ B;  4POG A;  5HY6 A;  4OO1 G;  1WJJ A;  1B70 B;  4DUZ Q;  2IX0 A;  2GN5 A;  1KC8 C;  1OTC A;  2KHI A;  2IX1 A;  4A3B G;  1TWH H;  4R1J A;  5M3M G;  1HNW Q;  4QGU A;  4LF5 L;  1Y1W H;  3CCQ A;  1CKO A;  4JI4 L;  1QUQ A;  5IP7 G;  3G6E A;  4DUY Q;  1NBW A;  4KI0 A;  1VQH A;  4R4Q A;  3M7N A;  4DKA C;  3ER0 A;  1SMX A;  2JA8 H;  4RMF A;  4JBW A;  4X65 L;  1VQ7 A;  4JI2 Q;  1JMC A;  3HKS A;  1YZ6 A;  4DV3 L;  4LF7 Q;  3H3V I;  4X66 Q;  1IZ6 A;  1PH2 A;  4Y52 H;  1UE6 A;  2K52 A;  3J7A 5;  3I56 A;  1X9N A;  3E9I A;  3F8T A;  3NEN A;  5J3B A;  4LW1 A;  2GVB A;  2JK8 A;  4EX5 A;  5C4J H;  3S17 H;  2R93 H;  3EN2 A;  3UDX A;  1J6Q A;  4J15 A;  3CW2 C;  1IBK L;  3OYY A;  5HGQ A;  1OXT A;  4HJ9 A;  1IBM Q;  2LXJ A;  1P8L A;  2N78 A;  1VQN A;  2IHE A;  5M5W H;  4HJ8 A;  3G48 A;  1PH1 A;  4P74 A;  2NZH A;  4OX9 Q;  1VQ8 A;  2ALY B;  3MEF A;  4AYB E;  1YIT A;  4IFD J;  1A63 A;  4X64 L;  2JA5 G;  4IPH A;  5ELO A;  2MO1 A;  4LNQ A;  1IYJ B;  1U5K A;  1Y1V H;  1UE5 A;  2WP8 J;  4JI3 Q;  5IWA L;  2CWA A;  2Z6K C;  3PIP A;  2B29 A;  1YHQ A;  1VQP A;  4AYB G;  3F2B A;  4DV7 Q;  2C35 B;  1EYG A;  1IL2 A;  3HKZ E;  2A8V A;  4JI1 Q;  4A75 A;  3G71 A;  4PMW A;  1QVC A;  1W2B A;  5IP9 G;  4A3C H;  2UXB L;  1PA6 A;  1VQK A;  1VQI A;  3PO2 H;  4C3I H;  2UUA Q;  5GAH C;  4LUO A;  4BY1 H;  3HKZ G;  3KF8 B;  3J81 i;  4AQY Q;  5K36 G;  2UXC L;  4EQ5 A;  3Q8D A;  3FP9 A;  1PFS A;  4B3R Q;  4K0K Q;  2QGQ A;  4UP8 A;  3NBH B;  4WJ4 A;  2OWO A;  2JA6 H;  4L5R C;  2IHF A;  3PCO B;  2PQA B;  4IFD I;  1W3S A;  4PG3 A;  1I94 Q;  2E2J H;  1RIP A;  2RHQ B;  3CC4 A;  3PV0 A;  1CUK A;  4A3G G;  4UP9 A;  4LFC Q;  4DAM A;  3PO3 H;  5FJ8 G;  5JEA G;  5GAG C;  1QZH A;  1PH7 A;  1BKB A;  4LF6 L;  3I4N G;  3S14 H;  4NXN L;  1N36 L;  4JI6 L;  1E22 A;  4MTN A;  2D62 A;  1HZA A;  3I2Z A;  4A3F G;  3UE0 A;  4A3I G;  3W5O A;  1IBL Q;  2VQE L;  4QJF A;  2H5X A;  4DNI A;  2HT1 A;  4JI0 L;  1VQG A;  2LXK A;  1TWF H;  2I5L X;  2HQL A;  5LMN Q;  2UU9 Q;  4JV5 Q;  2UXD Q;  1VQ6 A;  2I0Q A;  1N33 Q;  3E0E A;  4DR2 L;  4PZ6 A;  1EOV A;  1PH4 A;  1HR0 W;  2CWP A;  3H0G G;  1EQR A;  3W1G A;  4DR1 Q;  3E9H A;  1Q81 C;  4HID A;  5E7N A;  1Q82 C;  4A93 H;  3HOV G;  3FKI H;  3TS2 A;  4BY7 G;  4BXX H;  3PUV A;  5BR8 Q;  4A3B H;  2MQH A;  1YVC A;  1TWG H;  3IRB A;  3T1Y L;  4GN3 B;  5M3M H;  3OTO Q;  1TWA H;  2RF4 A;  3GTK H;  2UUC L;  1YJ9 A;  2VUM G;  3HOW H;  1OXV A;  2XTI A;  2DGY A;  3AFP A;  3CP0 A;  2QEX A;  2KCM A;  2D0O A;  3GTQ H;  3EBE A;  4HIO A;  2V1C C;  3NEL A;  3LGJ A;  1KQS A;  3A0J A;  4B3R L;  1VQF A;  1HZ9 A;  2R6G A;  3OW2 A;  1YIJ A;  4LFA L;  2VS1 A;  1Q46 A;  2E8G A;  3PSI A;  4GNX C;  1NJI C;  2VNU D;  3KJO A;  1P16 A;  2ZM6 Q;  2B63 G;  1WFQ A;  2AMC B;  1N34 L;  4GNX B;  2JEB I;  1QZG A;  4LFC L;  2WAQ E;  4NB3 A;  4DV5 Q;  1ASZ A;  4YWL A;  3JAM c;  1HJP A;  5C44 G;  2E5L L;  5GQO A;  4OXP A;  1YI2 A;  2CQO A;  3GD7 A;  2CCZ A;  2JA5 H;  3T1H Q;  3DM3 A;  4DV0 L;  4HJA A;  1GD7 A;  1X65 A;  3HOU H;  4H02 A;  2VQF L;  2WAQ G;  5IT9 c;  3TQY A;  4A3M G;  4L5S A;  1SFO H;  2Y0S E;  5C4X G;  1IXR A;  4DR7 L;  3J80 c;  3I55 A;  4A3J G;  3K81 C;  4B3T Q;  4A3E G;  1PV4 A;  2NVQ H;  3S24 A;  4A3D G;  3RN5 A;  3U58 A;  2AHO B;  4QIW E;  1L1O A; 
#chains in the Genus database with same CATH topology
 3HG9 A;  1XMO L;  1MHW C;  1HQM C;  4DK6 C;  5I6Y A;  1HUM A;  1SJE D;  3CMA A;  5M5W B;  3I4M G;  4B3S Q;  1VQB A;  1EUJ A;  1XMQ L;  2NVT H;  3NK9 A;  3MXG A;  4LMQ D;  1NSN S;  5K5P A;  4L6T B;  5IYC H;  4DV4 Q;  4U67 3;  2JA7 B;  2B3G A;  2B2U C;  2F4V L;  1BVS A;  2N49 A;  5COR A;  1VQ9 A;  1PLF A;  2ICI A;  1JE4 A;  1SE8 A;  3X3M A;  1CA5 A;  4DV1 Q;  1JWM D;  1HRJ A;  3MFG A;  2RCN A;  4F87 A;  2VW9 A;  3VYU A;  5IT9 E;  1SAP A;  2O4X A;  3GDE A;  4OWW B;  3STB D;  3I4N H;  4DAY B;  4N8F A;  4CJ2 C;  5M5X H;  1YJN A;  4OO1 I;  1J8I A;  1CSP A;  2X6G A;  2R7F A;  3PUX A;  1SYG A;  1F9S A;  1HNZ Q;  1TQO A;  2F3V A;  3F2U A;  1SYE A;  5C5L A;  1RCV D;  5JOB A;  4DAP A;  1GUS A;  1K83 H;  4Y7N H;  4ALP A;  2JE6 I;  4KKT A;  1F9R A;  3HS0 C;  1PH8 A;  3BYY B;  1PZK D;  1U0L A;  3CCU A;  1E3P A;  3ERO A;  2L15 A;  4X6A H;  3TME A;  5KYI A;  1G29 1;  4LF7 L;  2F03 A;  1H95 A;  2Q2H A;  1PVO A;  4IJH A;  1TWF B;  4JI7 Q;  2B2V A;  1HH2 P;  3I7F A;  4K2K A;  4NXM Q;  1JR0 D;  2EIF A;  4X62 Q;  4PZ7 A;  1KDA A;  1I50 H;  4C1N I;  3GTO H;  2K32 A;  3TEH B;  4DV1 L;  4OX9 L;  1MD2 D;  3ICE A;  2JEA I;  2HD3 A;  4A3B B;  3JC6 6;  2F0H A;  4LF8 Q;  2KEN A;  3GTK B;  1TWA B;  1YNN C;  3G4S A;  2NZ1 D;  4HSP A;  1J5E Q;  4JI3 L;  2F0S A;  4HJ7 A;  2IPK D;  3MHB A;  1LTL A;  4TRD A;  4DV7 L;  3GTQ B;  3GV3 A;  1UE1 A;  1MSG A;  2K01 A;  4C2M H;  4DV6 Q;  2N8N A;  4ODG A;  2WIN B;  5IP7 H;  2X6L A;  1N9W A;  4DNR B;  1DYQ A;  2HHH Q;  4K5V A;  4GN4 B;  1WYD A;  4H13 C;  1D5Z C;  2KBN A;  3PO2 G;  4N8X 1;  2N88 A;  1W6J A;  2VZA A;  1KAB A;  3B6Y A;  3BVM A;  2EPB A;  5FLX c;  1DON A;  2IY5 B;  5E3F A;  3RZD B;  3J7A V;  1IYV A;  2BCO A;  1XXG A;  1UNS A;  2K05 A;  5COY A;  5CV7 A;  1R9T B;  1PFB A;  1LM0 A;  1LTG D;  3KLS X;  3GTM B;  3BG3 A;  4NDX A;  4XIG S;  3HOZ H;  4LF8 L;  1Q7Y C;  2XWB B;  4OIK A;  4IOC A;  1NMF A;  1N33 L;  3J7Y W;  3VDY A;  1FVI A;  4GN5 A;  5EAY A;  4CDF C;  1H9S A;  4CJ1 B;  3S1M H;  1Z47 A;  1VQD A;  2HIV A;  3PMF A;  3W1B A;  4RG1 A;  4JVZ A;  4A3L H;  2PI2 E;  1BF4 A;  3C46 A;  3AEV A;  1PMR A;  3KF6 A;  1QOH A;  3TP5 A;  1ET6 A;  2HHH L;  4IUT A;  3QB3 A;  4X3K A;  2G5D A;  4BXX G;  1Z6H A;  1H9K A;  4A3I B;  4TKO B;  1G2T A;  1C9O A;  1IKL A;  5ELC A;  4JCV E;  5F2D A;  3CCE A;  1Q12 A;  3N6R A;  1RJT A;  1PH5 A;  2I46 A;  1SMY D;  5EGT A;  3HOY G;  2F0O A;  2ZM6 L;  1GUO A;  5I4D A;  2KOL A;  3RZO H;  4GOP A;  2F3I A;  1NCV A;  2F0G A;  3LX0 A;  4N9T A;  3JAM i;  3HOV B;  4K14 A;  3LNN A;  1AH9 A;  1FNU A;  1JIC A;  3D6C A;  2FIN B;  1HR0 Q;  2WB1 E;  3MXN B;  3BS1 A;  1B44 D;  2A68 C;  3SVM A;  5C0X J;  4DR2 Q;  4LF4 Q;  2C9O A;  2WB1 G;  2K5Q A;  1KTK A;  1SYC A;  3S2H H;  2MUY A;  4BA1 I;  5AJ3 L;  1UEB A;  1LAC A;  5KIX A;  3T1Y Q;  4P73 A;  1Y1W G;  5BN5 A;  2PYK A;  2IW3 A;  4C3J H;  1DOM A;  3ULJ A;  1ENA A;  2A73 B;  4RA8 A;  3KLS A;  1II3 A;  1EY8 A;  4A3M B;  1V1P A;  1JOK A;  1K8A C;  5IY0 A;  1SXT A;  4DR6 L;  1QIL A;  4LFA Q;  4A3D B;  4A3E B;  2YTV A;  2Z9H A;  3SK8 A;  1JT8 A;  3F2D A;  4HCS A;  4IN3 A;  5C0X I;  1YNX A;  2RCF A;  1EZ6 A;  4IJL A;  2OCE A;  3J81 j;  1BUV T;  5IGC A;  4BBR H;  2AWO A;  2E5L Q;  3SHL A;  2SNM A;  2JA7 G;  5M5Y H;  1BCP D;  2NZO A;  1WTW A;  4DFA A;  1YBY A;  4YWK A;  5C3E H;  2A19 A;  1HR0 L;  2ZXO A;  4HTH A;  1XNR L;  4G7O C;  4CKC A;  3S1Q H;  1I4Q A;  3U4Z A;  4LF4 L;  4A3C G;  2K50 A;  4B3M Q;  1UEA B;  4XT1 B;  3FHW A;  1STG A;  1SYF A;  1N32 L;  3L7Z C;  1HTL D;  3FMC A;  4DK3 C;  4YHH L;  1XNQ Q;  3URY A;  2B8G A;  1SBB B;  3M85 A;  4IUR A;  3CCL A;  1SRU A;  3HRZ C;  2L9H A;  2Z6B A;  2FJ2 A;  3TS0 A;  4JG2 A;  1QVF A;  3PF5 A;  1WCM B;  3KFU A;  2CVR A;  4O0A A;  4HIM A;  1X3Q A;  3E3X A;  2PMZ B;  3U4V A;  4IPG A;  1N8R C;  4B08 A;  1OXX K;  4IFD H;  4EVO A;  1EYC A;  1S5E D;  1I5F A;  3EQL C;  2QW7 A;  2K03 A;  3ND8 A;  1PDQ A;  5M3F B;  3RLF A;  3M4O B;  1SE2 A;  1SNQ A;  3MXU A;  4POG A;  4OO1 G;  2R92 B;  4DUZ Q;  1V1O A;  2IX0 A;  4PQX A;  2IX1 A;  4A3B G;  3A8K E;  3H09 A;  1HNW Q;  4QGU A;  2KED A;  3T56 B;  4JI4 L;  3IKJ A;  3E5S A;  3ER0 A;  3P1H A;  3I8Z A;  3DHQ A;  1VQ7 A;  2CH4 A;  4X66 Q;  4KY7 A;  2K52 A;  3TP8 A;  3I56 A;  1X9N A;  4HN7 A;  3S17 H;  5C4J H;  1XX8 A;  3W2D A;  4WFN 3;  1IBK L;  2AUK A;  1VDZ A;  3G48 A;  4F88 A;  1M4V A;  3WOE A;  2ALY B;  1YIT A;  4TSS A;  4IQZ A;  4IPH A;  1VMC A;  5JPM C;  4RWS C;  3HGB A;  1U9R A;  2Z6K C;  2B29 A;  1WTR A;  1ENC A;  3E0J A;  3F2B A;  1AEX A;  2C35 B;  1H9S B;  3HOX B;  1NAP A;  1AFP A;  5EBD A;  3NTK A;  4PMW A;  5DNF A;  5LHY 1;  5IP9 G;  4HAE A;  4DF7 A;  1PTO C;  2UUA Q;  3IFD A;  4FO2 A;  5GAH C;  3SEB A;  3J81 i;  3KF8 B;  4AQY Q;  1A2T A;  1WD1 A;  4O1N A;  3FPP A;  3VA5 A;  3T53 B;  2PO4 A;  1PFS A;  1PTO B;  3QIA A;  2QGQ A;  4UP8 A;  3NBH B;  2OWO A;  2JXM B;  4RGT A;  1I4R A;  2JA6 H;  2F0F A;  3P7J A;  1QNU A;  1I94 Q;  4KKU A;  4UP9 A;  4G7H C;  1IW7 C;  3EJI A;  4IUQ A;  5JEA G;  4ME5 A;  3UI2 A;  2K04 A;  1QZH A;  1PH7 A;  4JPB W;  3S14 H;  2E75 C;  3FDT A;  5EBC A;  4G7Z C;  1HZA A;  4A3I G;  2VQE L;  4Q5V A;  2R7Z B;  3MZ5 A;  2LXK A;  2QDL A;  5EKL A;  3S1N B;  2UXD Q;  3E0E A;  3A7L A;  1PH4 A;  4RCO A;  1HQR D;  3W1G A;  1EQR A;  1Q81 C;  1QB5 D;  5E7N A;  5ELB A;  2DJF C;  1F2Z A;  3FKI H;  3K58 A;  3K59 A;  3HOV G;  1TWG H;  5IGF A;  4GN3 B;  5I6W A;  1G8Z D;  5M3M H;  3OTO Q;  2E2H B;  3CU7 A;  3IFT A;  1YJ9 A;  1OXV A;  2OF1 A;  2XTI A;  4K2L A;  1F9P A;  2FFK B;  3AFP A;  3NE5 B;  2QEX A;  2KCM A;  2B2U A;  3EBE A;  2L0C A;  5D14 A;  1LT4 D;  3VYS A;  1CFM A;  2R6G A;  1V1P B;  5KRU A;  3OW2 A;  2VS1 A;  2E8G A;  2JP1 A;  4DAY A;  2B63 G;  1N34 L;  3IAY A;  2QEJ C;  1RF2 D;  2EY5 A;  2A6H C;  2A6E D;  5C3W A;  3GD7 A;  2JA5 H;  4HJA A;  5JVH 3;  3OOC A;  2VQF L;  4GZY C;  3TQY A;  4A3M G;  1GHK A;  3J80 c;  1ROD A;  2NVQ H;  3K81 C;  4A3D G;  4A3E G;  1B3A A;  1FR3 A;  3VR2 A;  4LFB Q;  3V2T A;  1T5X D;  3FRP B;  5EKI A;  4KKS A;  5J39 A;  4OON A;  3S15 H;  3DXJ C;  5I2Y A;  3X3N A;  5G3L D;  2Z0S A;  3ERS X;  1Y14 B;  4RGO S;  2V4D A;  3GO5 A;  1STY A;  4GKJ Q;  1L2F A;  2K5V A;  4JI8 L;  2PNR C;  3RLO A;  3PQI A;  3JAM E;  5LMU Q;  4LF9 Q;  3WWV A;  4A3G H;  5IGB A;  4OL7 A;  2A74 C;  1VQM A;  3D0F A;  2MNA A;  5L37 A;  1XTD A;  2MFI A;  1FNW A;  1CK1 A;  2EYH A;  4OWT B;  1SE4 A;  2F0L A;  4XYO A;  4DV2 L;  2UXB L;  5DEH A;  1PRT D;  5NUC A;  3TN2 A;  4A3F H;  1KXL A;  4QUC A;  1WD0 A;  3BU2 A;  4O42 A;  4FF4 A;  3KJP A;  2UUB Q;  3NXW A;  2PMZ E;  4XQQ A;  2K5H A;  1S5D D;  3BYT B;  5C0X G;  1Q86 C;  1KD1 C;  3W3A A;  2RA4 A;  1WCM G;  4JC0 A;  2E2J B;  1CQV A;  3M3Y H;  3OSO A;  1L1O C;  3M4P A;  3QOJ A;  1HNX Q;  5IYB G;  3A74 A;  4R4I A;  4I65 A;  2XGT A;  4DUY L;  3Q23 A;  1CSQ A;  2AKW B;  2KCC A;  1I3Q H;  2EE1 A;  1LT3 D;  3OWF A;  1F9Q A;  2XRS D;  1CKM A;  1UWV A;  1B50 A;  1KNE A;  4FDB A;  1AE2 A;  3MXP A;  4EQP A;  3CCR A;  4HSV A;  5M3F G;  1HPC A;  1MJE A;  2C5C A;  2PZW A;  4R8I A;  4IZ8 A;  1Z9F A;  1Q1B A;  1YHA A;  2AQ3 B;  4ZAI A;  1VQE A;  4DU9 A;  2R92 G;  1IBM L;  4A93 B;  4X3S A;  5C44 H;  3K80 C;  2FMC A;  3NUC A;  1K8G A;  5C6A A;  1I4P A;  1KL9 A;  1X54 A;  2HDL A;  3BZC A;  4KN7 C;  4A3J H;  4QY7 A;  4H0L C;  1AW7 A;  1LAB A;  4C1N K;  2WKC A;  4JYA Q;  3RUZ A;  4DGZ A;  5KYL A;  1HNX L;  4ULL A;  4R9W A;  4R4O A;  2EJF C;  2HQE A;  1JB3 A;  1W6K A;  3K7A H;  1GVP A;  1GHJ A;  3T13 A;  1HA5 A;  1AE3 A;  2LMC B;  3V05 A;  4YIJ A;  5DM7 3;  3GQB A;  1NTG A;  4X65 Q;  1Q8K A;  3OPO A;  3HOX G;  3PIO A;  4FF2 A;  1SFO B;  1XPU A;  2PNH A;  3V96 A;  4XTC S;  1JC7 A;  3BJU A;  1X3G A;  3SE0 A;  3MXN A;  4MZ9 A;  3STB C;  1KAW A;  4LUZ A;  4X3U A;  3DLL A;  1TWC B;  5LMN L;  2UU9 L;  4X64 Q;  3ND9 A;  2YU9 B;  1DGS A;  5IWA Q;  4DR1 L;  3PUY A;  3L9A X;  3D4R A;  1AZQ A;  1CTM A;  3AU7 A;  4KHP Q;  3CPW A;  3GTL H;  1Q3L A;  2ZJR A;  3T51 B;  2EDG A;  5EPK A;  4DR3 Q;  1BCP F;  1V1Q A;  4YWM A;  4KD3 A;  2R7Z G;  1O7L A;  2KCN A;  1Q1E A;  4KY5 A;  1OXS C;  3KK7 A;  4HMI A;  1RTN A;  1C48 A;  1VQC A;  3D3R A;  1STH A;  4UAI A;  1NMG A;  3H0G B;  4B9X A;  4C3H B;  1MBY A;  1TR5 A;  2H4O A;  2BA1 A;  1A0I A;  2F0W A;  2XRQ D;  3T1H L;  1N36 Q;  4JI6 Q;  1E1O A;  1VQ5 A;  2K75 A;  2VUM B;  1S5C D;  2B39 A;  1LT5 D;  4WJ3 M;  2R61 A;  2PZT A;  4JI0 Q;  2A1A A;  1LYL A;  3T16 A;  1EWH A;  5JVG 3;  2OTL A;  5KNB A;  3J81 E;  5CC4 A;  2RHS B;  5JJI A;  3BDL A;  1CKN B;  5JJK A;  4KHP L;  4B3S L;  1NY4 A;  3OMG A;  1HZB A;  1E7Z A;  4CGY B;  1VQO A;  3R3O A;  4DR3 L;  2UUC Q;  3KBG A;  4DV4 L;  2OQ0 A;  3GTP B;  2I5M X;  2EJG C;  4HCE A;  2ZTC A;  4JW0 A;  5JEA J;  4ZYS A;  2EY1 A;  2J4X A;  5C4X B;  1BBW A;  5IYC G;  2NN6 I;  4CDE C;  1ZKO A;  1RHP A;  3QOL A;  2BOS A;  1IHZ A;  1SR3 A;  4IOA A;  3TSS A;  3I72 A;  4GNX A;  1S5B D;  1TS5 A;  3RR5 A;  3H3V H;  2M00 A;  1HNZ L;  3GTG B;  3NPP A;  2Q2U A;  3UE1 A;  2ICE C;  1XYI A;  4BBS B;  3GTJ B;  1PXU A;  3M9B A;  1IKM A;  3CME A;  1DD2 A;  1HTP A;  4MIU A;  3K0X A;  1JCK B;  2A5H A;  5A35 A;  1T5E A;  1JOR A;  3VYR A;  4IO9 A;  2RQX A;  1I6H H;  3GP7 A;  2VB3 X;  2OTJ A;  4DR5 Q;  4JOI C;  3CQZ H;  3R93 A;  4GLX A;  4JI7 L;  1ML0 D;  3RNU A;  2ZJQ A;  4RHR A;  1VS0 A;  4NXM L;  3HOY H;  1EFW A;  3I4O A;  1K0S A;  1SMY C;  4X62 L;  4LWC A;  1QCB D;  2L4N A;  1SYB A;  1XJV A;  2LSS A;  2ASB A;  4ABN A;  3S1R B;  3CRL C;  3TP7 A;  3VR4 A;  4DR4 Q;  3D4W A;  2NUC A;  1J5E L;  1CZW A;  2E2I B;  2NTS A;  2ZXP A;  1PHJ A;  1F2M A;  1Y8O B;  4H7B A;  3AFQ A;  4MTK A;  3NQI A;  2Z6K A;  1PZJ D;  2B2T C;  4DV6 L;  3R2I A;  2AWN A;  2DJG C;  4ZCK A;  4JBK A;  1EY7 A;  2NVX H;  1TII D;  1HHV A;  4A93 G;  3KF8 A;  3OIQ A;  4KTA A;  1BNZ A;  4R1J A;  1D6E C;  3NBH A;  1Y1W H;  1CKO A;  1QUQ A;  1STN A;  3SDZ A;  5IP7 G;  3S17 B;  3M7N A;  4R4Q A;  1SDF A;  2K6A A;  4I7A A;  1SMX A;  1VMP A;  1KAA A;  4JI2 Q;  1CM9 A;  5FO8 B;  3HKS A;  2F0I A;  5DAU A;  1CI3 M;  4CKE A;  2F0U A;  1IZ6 A;  1PH2 A;  2L11 A;  1UE6 A;  4Y52 H;  3J7A 5;  1Q90 A;  2MJ8 A;  1WTH A;  3E9I A;  4IAL A;  2R93 H;  2K33 A;  2DNC A;  1J6Q A;  4J15 A;  3NHH A;  3U9O A;  2LXJ A;  1VQN A;  2IHE A;  5M5W H;  5IGD A;  4HJ8 A;  2QKI C;  4LK1 C;  5CYU A;  2KJX A;  3MEF A;  2Q8I B;  5DM6 3;  5ELO A;  3BVZ A;  2MO1 A;  1FNV A;  1U5K A;  1UE5 A;  2B8F A;  1BCP C;  3MWY W;  1EYG A;  1IL2 A;  2B63 B;  4JI1 Q;  1QWY A;  3SR1 A;  4NW2 A;  4ZUJ A;  2JA6 B;  4A3C H;  4K5X A;  1I4H A;  1EEI D;  1PA6 A;  1VQI A;  5J1Z A;  5I2X A;  4BY1 H;  4M8A A;  1PYW D;  5K36 G;  5IOC A;  4EQ5 A;  2PQE A;  3QJY A;  4K0K Q;  2PW7 A;  5CMD A;  3S2D B;  4WJ4 A;  1FYC A;  5CV5 A;  2IHF A;  5E4X A;  3S14 B;  3PCO B;  1W3S A;  1RIP A;  3PV0 A;  5D65 A;  4G57 A;  3G6J B;  4LFC Q;  4DAM A;  5G3L F;  5FJ8 G;  5KNC A;  1G2S A;  5JPN C;  5FLX L;  1I4G A;  1YNJ D;  1EQT A;  1TS4 A;  3I2Z A;  3UE0 A;  3FKI B;  1IBL Q;  4QJF A;  4DNI A;  1TWG B;  2XIW A;  1TWF H;  4DK0 A;  4JV5 Q;  3VA7 A;  3JAM L;  2I0Q A;  4DR2 L;  1GUG A;  1EOV A;  2RDH A;  3H0G G;  3E9H A;  2EYP A;  4C3H G;  4OO1 H;  1PRT F;  4OIJ A;  1CQF A;  3PUV A;  5BR8 Q;  2MQH A;  3T1Y L;  2IJ0 A;  4A3B H;  2HUG A;  3GTK H;  1TWA H;  2RF4 A;  2EOT A;  1RDP D;  4QMG A;  5CV4 A;  2VUM G;  3HOW H;  4KHV A;  3WOF A;  2K1B A;  4RKL A;  2CW0 D;  3GTQ H;  4HIO A;  2RDG A;  3NEL A;  3LGJ A;  3A0J A;  2KEE A;  1YIJ A;  4LFA L;  1Q46 A;  2NVY B;  4GNX C;  1NJI C;  4KY6 A;  4QCL A;  2TSS A;  1BXT A;  4RCN A;  2B2Y A;  3KJO A;  5C5M A;  4GNX B;  4LFC L;  3I3C A;  1BDO A;  3OMC A;  1TWH B;  4DV5 Q;  4YWL A;  1SEB D;  2E5L L;  1H9J A;  5GQO A;  1YI2 A;  2F0V A;  5FKA C;  2ZT9 C;  4M1U B;  3HOU H;  4H02 A;  3Q24 A;  2JA8 B;  5IT9 c;  4L5S A;  4ID6 A;  5C4X G;  2F0K A;  2NWG A;  3NTI A;  4B3T Q;  1PV4 A;  3S24 A;  2AHO B;  1L1O A;  4B3M L;  3F2C A;  1HCZ A;  5IP9 H;  4A3K H;  1XPR A;  3CCS A;  2O5J C;  1R9T H;  3U50 C;  2L12 A;  3GTM H;  3OW7 A;  3C1E A;  5BN3 A;  4RAU C;  2PPB C;  4MN3 A;  2YV5 A;  1XNQ L;  2IL8 A;  2EVB A;  4JI5 Q;  2MO0 A;  1QNK A;  3EIV A;  1JJC B;  4UPA A;  4BBS G;  4QUF A;  4BA2 I;  1Y1V B;  2JYO A;  1CHP D;  4IUP A;  2EY6 A;  3PIO 3;  1X55 A;  4NPS A;  1R4P B;  4A4I A;  5LL6 X;  1EY5 A;  3BDO A;  1GUW A;  1PYB A;  1WTO A;  4DXG A;  1O78 A;  4WRD A;  2AUJ D;  3FVQ A;  4FXG C;  4CDD C;  4C3I B;  1VQ4 A;  1E24 A;  3PUW A;  4A3I H;  1M90 C;  3M3Y B;  5FLM G;  1QJO A;  2KVM A;  2MPM A;  2NN6 G;  1VQJ A;  2F4I A;  1I3Q B;  3I73 A;  2I5H A;  2QDB A;  3QG1 A;  2KCT A;  2FHT A;  4DUZ L;  4HED A;  1S72 A;  3VR3 A;  4DXF A;  1HNW L;  3PO3 B;  1PFM A;  4OEL B;  3SXH A;  1QUQ B;  3A55 A;  4X66 L;  1GM5 A;  1LUZ A;  1SRO A;  4IPD A;  2CH4 W;  2IT1 A;  4J8Q A;  3DWP A;  1TT2 A;  4IUN A;  2F0Q A;  3TRE A;  2K7V A;  1TVX A;  1AN8 A;  3D4D A;  4POF A;  1S5F D;  3F1Z A;  1DM0 B;  5IOD A;  1MSH A;  2A6E C;  3HFZ B;  4MHE A;  4HR7 B;  1O7Z A;  1ZXT A;  2OQK A;  5IYD G;  4GKK Q;  4A3M H;  1V8Q A;  4YY3 Q;  2DUD A;  3CCV A;  4A3D H;  5T1I A;  3K7A B;  2WAC A;  3A54 A;  2K5W A;  1LTT D;  3KLW A;  3H94 A;  2UUA L;  1S40 A;  3CCM A;  1EY9 A;  2EYM A;  4AQY L;  3PGZ A;  2K28 A;  3PF4 A;  2RSO A;  2MHV A;  1K9M C;  4LF5 Q;  4PMC A;  3KOJ A;  5D3D A;  1PTO D;  1PZI D;  4AIM A;  4DAV A;  3M4Q A;  1SN8 A;  2BDN A;  1LTR D;  1I94 L;  2ES2 A;  4DV3 Q;  2FXQ A;  1A8V A;  3J81 L;  2A69 D;  2JA6 G;  1SNC A;  1B8A A;  5AFW A;  4DNT B;  3CXC A;  3HKZ B;  3GTL B;  1EIF A;  1VQL A;  2FMM A;  5E1F A;  2UXD L;  2NVT B;  1L0X B;  4NKL A;  5IE8 A;  1X56 A;  3I70 A;  1CKN A;  1E1T A;  5C0X H;  1PH9 A;  5LMN W;  5CR3 A;  4L5Q A;  4IUV A;  1MGS A;  1X32 A;  3OTO L;  1DXM A;  5FLX E;  3NTH A;  4CJ0 B;  4Z9C B;  1K73 C;  3FKI G;  3I4N B;  5M5X B;  2F1M A;  3TBI B;  1UE7 A;  3A56 A;  3TDQ A;  2UXC Q;  2CHB D;  3TZU A;  1X3F A;  1TY0 A;  3HEJ A;  2PQA A;  2PCF B;  5M3F H;  2B2Y C;  4KLK A;  1XWE A;  3DMU A;  3M4O H;  2F3W A;  3VYT A;  3ZYY X;  1BR9 A;  4XQN A;  2R92 H;  1LTA D;  2P5Z X;  5CV6 A;  3NQT A;  1K83 B;  4Y7N B;  1LTB D;  2CQA A;  1XPO A;  2IWH A;  1O7I A;  2K5N A;  4ZQ3 A;  5D3I B;  4LF6 Q;  4NXN Q;  1JOQ A;  2N3S A;  3J80 i;  4BS9 A;  3UDI A;  4BY7 H;  1TS3 A;  1GO3 E;  4KV6 A;  2JJQ A;  1X3E A;  2HIX A;  4LFB L;  1DOL A;  1L1O B;  4QF4 A;  5CV9 A;  1EY6 A;  3GTO B;  1I50 B;  4LAA A;  4KJO A;  4HIK A;  1WTV A;  1S4Z A;  4EQN A;  4QQB X;  1BO0 A;  4G4K A;  3RLN A;  4JOI A;  4F8M A;  1WTQ A;  4GKJ L;  4PMB A;  4DPG A;  1G91 A;  5IGE A;  2JA8 G;  3H3V C;  2JQO A;  4K5W A;  1ICW A;  4IUU A;  2WAQ B;  5LMU L;  3A5Z B;  1ZEQ X;  1K3B C;  3K8A A;  3HOX H;  3CF5 A;  4LF9 L;  5JJZ A;  3DEO A;  3A5U A;  4P2C B;  2ID0 A;  1KDC A;  5ELE A;  3WDN A;  4C2M B;  2ZXR A;  2HCI A;  2Z4H A;  4CHT B;  4APV A;  3S16 H;  1EY0 A;  2Y0S B;  3TRZ A;  2R7D A;  1F77 A;  5M9O A;  1PTO H;  2ZTE A;  4RGN A;  2UUB L;  2BE5 D;  4ILW A;  2B2T A;  1X3P A;  1Y1V G;  4DV0 Q;  2JA9 A;  1E2V A;  1MJC A;  2SDF A;  1I6H B;  1Y8N B;  5C4H A;  2H1E A;  2XVS A;  4DR7 Q;  2NB0 A;  3I4M H;  1L0W A;  2Q8R E;  2D9U A;  1PYS B;  1EEF D;  4GLA C;  4C3I G;  1XMO Q;  4KMU C;  1TU2 B;  1BBX C;  1WI5 A;  1BBU A;  5GRO A;  1C0A A;  2MP1 A;  4L8J A;  2R7Z H;  1HZC A;  3CD6 A;  3HOZ B;  2D2C C;  3S1N H;  3KYH C;  1XMQ Q;  4FXD A;  4L5T A;  3AYH B;  1BQQ T;  1NR4 A;  2LS0 1;  2F4V Q;  3NBI A;  1MI2 A;  2L55 A;  3CC7 A;  2ZTD A;  3PO3 G;  3S1M B;  4XT3 B;  2E2H H;  2CFM A;  4J6H A;  1CA6 A;  4FXK C;  4DA2 A;  1PFN A;  2EQS A;  4FP5 D;  1HFN A;  4O2D A;  2WFW A;  1D5X C;  4ZRZ A;  1M1K C;  3RD4 A;  1EU4 A;  1I4X A;  4JYA L;  5HY6 A;  5T1G A;  2F0M A;  5IGG A;  1KC8 C;  3RZO B;  2KHI A;  1LLR D;  2BDO A;  2I07 B;  2J0T D;  3M7G A;  2DN8 A;  3CCQ A;  1TKW B;  2R93 B;  3LWE A;  3G6E A;  1VQH A;  1VF7 A;  1ZYR D;  2G9D A;  4RMF A;  4X65 L;  5A2Q L;  5FOB B;  2RDF A;  1YZ6 A;  4LF7 Q;  3C3L A;  1TY2 A;  3P20 A;  4CBV A;  3F8T A;  1U4L A;  3NEN A;  5J3B A;  4LW1 A;  3EN2 A;  1U4M A;  2EYJ A;  5C4Z A;  5HGQ A;  2PZU A;  1UAP A;  2N78 A;  3S2H B;  4P74 A;  4OX9 Q;  4KN4 C;  3NP8 A;  1VQ8 A;  3QWN A;  1A63 A;  4IFD J;  2JSO A;  4X64 L;  5E4W C;  1LO5 D;  1BOS A;  1XTC D;  2WII B;  2OXP A;  4C3J B;  4LNQ A;  2EYO A;  3MC0 B;  4JI3 Q;  1GOZ A;  5IWA L;  2DNE A;  3PIP A;  4BY1 B;  1YHQ A;  1VQP A;  4DV7 Q;  1SNO A;  3K0Y A;  3HKZ E;  2F0E A;  2A8V A;  4A75 A;  3G71 A;  3HZX A;  1W2B A;  2XNA C;  3O13 A;  1VQK A;  3PO2 H;  3ITP A;  2M9V A;  3HKZ G;  3MAQ A;  5EKK A;  2KEC A;  3Q8D A;  1Y8P B;  4B3R Q;  4BBR B;  1NR2 A;  4NP5 A;  5M5Y B;  2PQA B;  2O5I C;  1U4R A;  2F0T A;  4IFD I;  2LFN A;  5C3E B;  2E2J H;  4K8I A;  2RHQ B;  3CC4 A;  2SEB D;  2L5T A;  1SSO A;  3VR6 A;  1FD7 D;  1SYD A;  3Q22 A;  1IYU A;  2AQ1 B;  3S1Q B;  3K6O A;  5GAG C;  2WKD A;  1A15 A;  4RH6 A;  1BKB A;  3I4N G;  2SNS A;  1N36 L;  4WJW A;  3BDC A;  4JI6 L;  3MFY A;  4MTN A;  2D62 A;  2KUM A;  3K5M A;  2H5X A;  2HT1 A;  3KUP A;  1U4P A;  5J22 A;  4JI0 L;  2I5L X;  1R4Q B;  2HQL A;  3A8I E;  3T4A C;  1VQ6 A;  3N52 A;  1N33 Q;  3HOW B;  3S9W A;  3R8B A;  3D8G A;  3MTS A;  1HR0 W;  4A93 H;  1KLU D;  1Q82 C;  3OIP A;  4FYD A;  3CKI B;  5HUR A;  4BXX H;  3IRB A;  1YVC A;  2UUC L;  1NUC A;  2F0D A;  4EGV A;  2D0O A;  1ILP A;  2LY7 A;  2V1C C;  1KQS A;  1B3Q A;  3MA2 B;  4B3R L;  1STE A;  1VQF A;  2DY7 A;  2LKV A;  3PSI A;  5CBE E;  3HOU B;  2ZM6 Q;  1WFQ A;  3I4L A;  2WAQ E;  4RHS A;  4NB3 A;  4H44 C;  3G7L A;  1ASZ A;  1YNN D;  3JAM c;  1A2U A;  4E6I A;  4OXP A;  1B53 A;  4A3K B;  3IL8 A;  1GD7 A;  4J1M A;  4K6L A;  2WAQ G;  2NTT A;  5CBA E;  1SFO H;  2Y0S E;  1IXR A;  5FO9 B;  3ERQ A;  1GXD C;  3RN5 A;  3LWU A;  4I7Z C;  5C4J B;  1DJR D;  2Y0S G;  5AJ3 Q;  2Q2I A;  2B2W A;  2D5D A;  4QB4 A;  3L3O C;  4DR5 L;  3CC2 A;  5K36 H;  2XSC A;  1YJW A;  1TWC H;  5JAV A;  4QL5 A;  5EPJ A;  1WTP A;  3KDF A;  1YEZ A;  2YU9 H;  3I91 A;  1E2Z A;  3BZK A;  1LTS D;  4NMZ A;  5EQ0 A;  2E76 C;  4CDC C;  3FEW X;  3R2T A;  1EIY B;  3QO2 A;  4DR6 Q;  2QA4 A;  1ICF B;  1C4Q A;  2IX3 A;  5FJ8 H;  2G9H D;  1PTO F;  3NWS A;  1D8L A;  1STB A;  4DR4 L;  2JA7 H;  1F2L A;  1H9M A;  2EYF A;  3J80 E;  4LUV A;  3K5O A;  3C2P A;  3HOZ G;  1YNJ C;  1TXY A;  3ONA B;  3CCJ A;  2HCC A;  1BCP B;  5KGU A;  4TQU S;  2XWJ B;  4MNO A;  1ENF A;  4HJ5 A;  3H0G H;  4C3H H;  2RBM A;  1XNR Q;  4U68 A;  4P71 A;  5HGT A;  4A3L G;  1K0R A;  2YTY A;  5EPL A;  1GUT A;  4YCU A;  1KHI A;  3NWT A;  2VUM H;  3H91 A;  2F52 A;  4JI2 L;  1N32 Q;  2L1B A;  1EU3 A;  1TS2 A;  1GKH A;  3HP3 A;  4FF1 A;  2CW0 C;  4DN4 M;  4YHH Q;  1JJG A;  4K8J A;  1ASY A;  2F0P A;  1D7Q A;  1G6P A;  3RN2 A;  1CT1 D;  1EQV A;  2RSN A;  1D1I A;  4FNF A;  5DLQ E;  1B7Y B;  1SNM A;  3A8J E;  2E2D C;  3SGI A;  2R93 G;  4KD4 A;  5M3M B;  1A62 A;  5A2Q E;  3GTP H;  3OHX C;  3L2P A;  1ONL A;  2A68 D;  1G51 A;  4P72 A;  1FGU A;  2VY3 A;  2Z8L A;  1HXY D;  5C4X H;  4JI1 L;  1FJG Q;  1JE5 A;  3K7U C;  1MIU A;  2ENB A;  2Z4I A;  3TZD A;  5GAD C;  1PH6 A;  1C7Y A;  1O80 A;  4PZ8 A;  1KIX A;  2OEO A;  1EOT A;  3ULL A;  2TMP A;  3AQQ A;  5FO7 B;  3GTG H;  5I9P A;  4C3J G;  4K0K L;  4JBM A;  4JI4 Q;  3D31 A;  2JA5 B;  1DZ1 A;  4BY1 G;  4CKB A;  2BH2 A;  4BBS H;  3GTJ H;  4R8N A;  4GLV B;  4UY8 C;  1F2Y A;  2B2V C;  4V0B A;  4AYB B;  1QG7 A;  2NVQ B;  5CV8 A;  2NYZ D;  2WV6 D;  4OWX B;  4JBJ A;  3K5L A;  1KRS A;  1D1K A;  2GA4 B;  5ELF A;  1IBK Q;  1IBL L;  3RZD H;  3S15 B;  1A6X A;  4P75 A;  4BBR G;  1NE3 A;  1PH3 A;  2O2L D;  4C56 C;  4JV5 L;  1O7Y A;  5FLM H;  2EXZ A;  1HUN A;  4UHV A;  2NN6 H;  1S3O A;  5C3E G;  3DWA A;  3ULP A;  3CRK C;  4TVA B;  3MEH A;  1V9P A;  1EY4 A;  1FJG L;  5BR8 L;  2RKS A;  4A3G B;  3Q0A A;  2VB2 X;  3S1R H;  2D0P A;  2KHJ A;  2E2I H;  1H9R A;  3C1F A;  5TSS A;  4ZKC B;  4RGM A;  1KDB A;  4HMJ A;  4A3F B;  3J81 c;  2K14 A;  1FL0 A;  4L63 B;  4R4C A;  2GVA A;  1VF5 C;  3HOW G;  3H15 A;  1J9O A;  5JEA H;  4Q0F A;  1JQY D;  2EYL A;  5H1S E;  3U9S A;  1EWI A;  4ME3 A;  4BY7 B;  4DV5 L;  3M4Y A;  2E74 C;  1RL2 A;  1GUN A;  5C3X A;  1B1Z A;  5ISR A;  1YHB A;  1B9N A;  4IFD G;  1WVL A;  1SNP A;  2VQE Q;  4UDU C;  5IYD H;  4ZLT F;  3L0O A;  1MKH A;  3CAM A;  2HDM A;  2PI2 A;  3PUZ A;  4B3T L;  3HOV H;  1RKN A;  2M2L A;  4FVM A;  5GAE C;  4R4T A;  3HOU G;  3J7A F;  4GS3 A;  5JJL A;  1D2B A;  1EFI D;  2B2W C;  4RKB A;  1B9M A;  4DK1 A;  4IPC A;  1JB7 A;  2YYZ A;  4PNY A;  5ELD A;  2ZJP A;  3J7Z C;  1E0B A;  4A3K G;  5C44 B;  1LT6 D;  3NEM A;  4JI5 L;  1ILQ A;  2YTX A;  1X6O A;  3KF6 B;  3KDF B;  3S16 B;  1STA A;  1V43 A;  4KHZ A;  1B4O A;  2XN9 C;  2B63 H;  1ESR A;  4A3J B;  4A76 A;  4XYQ A;  2BA0 A;  3ZJY C;  2A69 C;  4GOP C;  1JJ2 A;  1EL0 A;  1B2T A;  5KND A;  1EQQ A;  3DUZ A;  1KNA A;  1N34 Q;  2BH8 A;  3DEP A;  4GOP B;  5ELN A;  2KHS A;  1T9H A;  3UDG A;  3KBX A;  3I4M B;  3K5N A;  3EVQ A;  3GV6 A;  2F0J A;  1EYA A;  3S2D H;  1A3V A;  4QIW B;  1EIG A;  4A3E H;  5EJW A;  2QF7 A;  2OT2 A;  2VQF Q;  3PIP 3;  1WOC A;  2QIL A;  1HA6 A;  1UUP A;  4XQJ A;  2AQ2 B;  3CPF A;  2Q2T A;  3A7A B;  1LTI D;  5I9O A;  5IIF A;  5IT9 L;  2VL6 A;  3FPU B;  1RD9 D;  4RFB A;  4XXE A;  1HFG A;  4JK1 C;  1SLJ A;  4JI8 Q;  4S3S A;  4KJN A;  1IW7 D;  4ZK9 B;  1JOO A;  1QVG A;  1SND A;  4YCW A;  2Z1C A;  2MGS A;  4UP7 A;  5LL6 S;  1PRT C;  2EXD A;  3RMH A;  1KRT A;  1AP0 A;  4YCV A;  1WTX A;  1OXU A;  1A3T A;  3EA6 A;  3UDF A;  1K3R A;  1FGB D;  1PRT B;  1K8O A;  4DV2 Q;  2UXB Q;  2K4K A;  3CHB D;  4GKK L;  1NNX A;  3OWE B;  1WCM H;  3SK6 A;  4EQO A;  2ATW A;  1VCI A;  4YY3 L;  1K28 A;  2EY2 A;  3BZD B;  1VQA A;  3BVG A;  2NVY H;  5IYB H;  4AH6 A;  4ZUI A;  1Q8I A;  1IL8 A;  2CKZ B;  1WJJ A;  1G6Z A;  1B70 B;  2GN5 A;  1OTC A;  1L0Y B;  3K57 A;  1TWH H;  5M3M G;  4LF5 L;  2QCP X;  4DUY Q;  1NBW A;  4KI0 A;  4WOR A;  4DKA C;  2JA8 H;  4JBW A;  1JWS D;  2J7Z A;  1JMC A;  1Y69 U;  4DV3 L;  5CGK A;  2R3Z A;  3H3V I;  1QE6 A;  2RVL A;  1I6V C;  4F7X A;  2K5D A;  4EX5 A;  2GVB A;  2JK8 A;  3UDX A;  1DOK A;  1D5M C;  3CW2 C;  3OYY A;  4HJ9 A;  1E2W A;  1OXT A;  1IBM Q;  3DM1 A;  1EIH A;  1P8L A;  2A6H D;  1PH1 A;  2NZH A;  2DY8 A;  3QR8 A;  4AYB E;  3EFX D;  2KQ3 A;  1LV9 A;  2JA5 G;  5KEE A;  3PO2 B;  3MVV A;  1IYJ B;  1Y1V H;  2WP8 J;  2BE5 C;  2CWA A;  2EZV A;  4AYB G;  4PV1 C;  1Z7T A;  1QVC A;  1JWU D;  3P75 A;  3NSW A;  1EZ8 A;  1RTO A;  1ESF A;  4C3I H;  3H6M A;  4LUO A;  3E6Z X;  2F0N A;  2UXC L;  3FP9 A;  3I90 A;  3KLR A;  3SK5 A;  2KA7 A;  3TP6 A;  4L5R C;  1CHQ D;  4PG3 A;  4K6D A;  4KK7 A;  1CUK A;  3Q6S A;  4A3G G;  3PO3 H;  1EYD A;  2SOB A;  1C8C A;  4BWG B;  4B9W A;  4FF3 A;  1A3U A;  4LF6 L;  1M8A A;  1AZP A;  4NXN L;  1E22 A;  4A3F G;  3W5O A;  1DCZ A;  1K8M A;  3AB9 A;  3CQZ B;  3DWQ A;  1VQG A;  5LMN Q;  2UU9 Q;  4PZ6 A;  2CWP A;  4OGQ C;  4DR1 Q;  3HOY B;  4HID A;  4BY7 G;  2PW5 A;  3TS2 A;  2EJM A;  1OO9 B;  1EWC A;  3VR5 A;  4V19 0;  3J80 L;  2X69 A;  2JN4 A;  4OEM B;  2DGY A;  1ET9 A;  1ZYR C;  3CP0 A;  4X3T A;  1HZ9 A;  4N9P A;  3AMU A;  2N55 A;  2NBF A;  2VNU D;  2NVX B;  1P16 A;  1SJH D;  3D6W A;  2AMC B;  3SK4 A;  4LJZ C;  2WB1 B;  1KLG D;  2JEB I;  1QZG A;  1CZG A;  4OHJ A;  1SE3 A;  5C44 G;  1HJP A;  1Y1W B;  2CQO A;  2CCZ A;  3T1H Q;  3DM3 A;  4DV0 L;  1X65 A;  2VXW A;  5FK9 C;  4XDX A;  2Q8T A;  4DR7 L;  5BN4 A;  3I55 A;  4A3J G;  1GJX A;  3U58 A;  4ZKB B;  4QIW E; 
#chains in the Genus database with same CATH homology
 4B3M L;  3F2C A;  5IP9 H;  4A3K H;  1XPR A;  3CCS A;  1XMO L;  4LFB Q;  1R9T H;  2Y0S G;  3U50 C;  4DK6 C;  3GTM H;  4OON A;  3S15 H;  5AJ3 Q;  3CMA A;  3I4M G;  2Q2I A;  3CC2 A;  4DR5 L;  4B3S Q;  1YJW A;  1TWC H;  1VQB A;  2Z0S A;  1EUJ A;  1Y14 B;  3ERS X;  1XMQ L;  4QL5 A;  2NVT H;  2YV5 A;  1XNQ L;  3GO5 A;  5IYC H;  4DV4 Q;  1YEZ A;  2MO0 A;  1L2F A;  2K5V A;  1JJC B;  2B3G A;  3EIV A;  3KDF A;  4UPA A;  4JI8 L;  3RLO A;  2F4V L;  4BA2 I;  1BVS A;  2N49 A;  4BBS G;  3BZK A;  1VQ9 A;  5LMU Q;  4LF9 Q;  3WWV A;  1X55 A;  1SE8 A;  4NPS A;  1EIY B;  4DR6 Q;  2QA4 A;  4DV1 Q;  4A4I A;  4A3G H;  1VQM A;  5FJ8 H;  2RCN A;  1PYB A;  3D0F A;  2MNA A;  1XTD A;  2VW9 A;  2MFI A;  1D8L A;  4DR4 L;  2JA7 H;  4OWT B;  3GDE A;  4OWW B;  3STB D;  3I4N H;  4DAY B;  5M5X H;  4OO1 I;  1YJN A;  1VQ4 A;  1E24 A;  4LUV A;  4DV2 L;  1CSP A;  4A3F H;  2R7F A;  3PUW A;  3PUX A;  4A3I H;  3HOZ G;  1TXY A;  1M90 C;  1KXL A;  5FLM G;  1HNZ Q;  3BU2 A;  3CCJ A;  3KJP A;  2NN6 G;  2UUB Q;  1VQJ A;  2PMZ E;  4TQU S;  2K5H A;  4MNO A;  2I5H A;  5C0X G;  1KD1 C;  1Q86 C;  2KCT A;  4HJ5 A;  4DUZ L;  1WCM G;  3H0G H;  4JC0 A;  4C3H H;  1XNR Q;  1S72 A;  1K83 H;  4Y7N H;  3M3Y H;  1L1O C;  3M4P A;  4ALP A;  4P71 A;  5IYB G;  1HNX Q;  1HNW L;  3A74 A;  2JE6 I;  4A3L G;  1K0R A;  4R4I A;  2XGT A;  2YTY A;  4DUY L;  1CSQ A;  2AKW B;  4YCU A;  1PH8 A;  1I3Q H;  1U0L A;  1E3P A;  3CCU A;  1QUQ B;  1KHI A;  2VUM H;  1CKM A;  2F52 A;  2L15 A;  4JI2 L;  1N32 Q;  1UWV A;  4X6A H;  1G29 1;  4LF7 L;  4X66 L;  1GM5 A;  4FDB A;  1H95 A;  2Q2H A;  1AE2 A;  1GKH A;  1LUZ A;  3CCR A;  1SRO A;  4IPD A;  4IJH A;  1PVO A;  5M3F G;  1MJE A;  2IT1 A;  4YHH Q;  4JI7 Q;  4QQB X;  1JJG A;  1ASY A;  1HH2 P;  3I7F A;  1Z9F A;  1Q1B A;  1YHA A;  3TRE A;  1D7Q A;  1VQE A;  3RN2 A;  4NXM Q;  2R92 G;  1G6P A;  1IBM L;  2EIF A;  4X62 Q;  5DLQ E;  4PZ7 A;  3GTO H;  1I50 H;  1B7Y B;  3TEH B;  4POF A;  4DV1 L;  4OX9 L;  3ICE A;  3F1Z A;  2JEA I;  3SGI A;  2R93 G;  3JC6 6;  4LF8 Q;  5C44 H;  2KEN A;  1A62 A;  3K80 C;  3G4S A;  1K8G A;  4GKJ Q;  3GTP H;  3L2P A;  3HFZ B;  1J5E Q;  4JI3 L;  4HJ7 A;  1G51 A;  4P72 A;  2OQK A;  1FGU A;  1KL9 A;  2VY3 A;  5IYD G;  4GKK Q;  1LTL A;  4DV7 L;  4A3M H;  1X54 A;  3BZC A;  5C4X H;  1UE1 A;  4JI1 L;  4YY3 Q;  1JE5 A;  1FJG Q;  3K7U C;  2DUD A;  4C2M H;  3CCV A;  4DV6 Q;  4A3J H;  1MIU A;  4QY7 A;  4A3D H;  4JI5 Q;  2N8N A;  5IP7 H;  5GAD C;  3KLW A;  4JYA Q;  1PH6 A;  1C7Y A;  1N9W A;  2UUA L;  1S40 A;  3CCM A;  4PZ8 A;  1KIX A;  4AQY L;  2HHH Q;  1HNX L;  3PGZ A;  4GN4 B;  3ULL A;  3AQQ A;  3PF4 A;  1WYD A;  1K9M C;  4R4O A;  4LF5 Q;  3GTG H;  4K0K L;  3KOJ A;  4JBM A;  2KBN A;  4JI4 Q;  3PO2 G;  3K7A H;  4AIM A;  1GVP A;  3D31 A;  3M4Q A;  2VZA A;  1SN8 A;  1AE3 A;  3B6Y A;  4BY1 G;  5FLX c;  1NTG A;  2IY5 B;  2BH2 A;  4X65 Q;  3GTJ H;  1I94 L;  2ES2 A;  4BBS H;  1Q8K A;  4GLV B;  4UY8 C;  3HOX G;  4DV3 Q;  3PIO A;  2FXQ A;  1A8V A;  1XPU A;  2PNH A;  2JA6 G;  4OWX B;  4JBJ A;  1B8A A;  1KRS A;  4XTC S;  3BJU A;  1X3G A;  1IBK Q;  4MZ9 A;  1LM0 A;  1IBL L;  3RZD H;  3CXC A;  3STB C;  1KAW A;  4LUZ A;  4P75 A;  3HOZ H;  4XIG S;  4BBR G;  1NE3 A;  1PH3 A;  1EIF A;  3DLL A;  1Q7Y C;  1VQL A;  5LMN L;  2UU9 L;  4LF8 L;  4JV5 L;  5FLM H;  4X64 Q;  4IOC A;  2UXD L;  1NMF A;  1N33 L;  3VDY A;  1FVI A;  4GN5 A;  1S3O A;  5EAY A;  5C3E G;  1DGS A;  5IE8 A;  5IWA Q;  1X56 A;  4DR1 L;  3ULP A;  1CKN A;  4TVA B;  1E1T A;  3PUY A;  1V9P A;  1PH9 A;  5LMN W;  3S1M H;  1Z47 A;  4L5Q A;  1FJG L;  5BR8 L;  1VQD A;  2HIV A;  3CPW A;  3GTL H;  3W1B A;  4KHP Q;  3OTO L;  2ZJR A;  4RG1 A;  4A3L H;  2PI2 E;  3S1R H;  2D0P A;  2KHJ A;  4DR3 Q;  3AEV A;  3KF6 A;  1V1Q A;  4YWM A;  1K73 C;  3FKI G;  2E2I H;  2HHH L;  4BXX G;  2R7Z G;  1UE7 A;  3J81 c;  1Q1E A;  2K14 A;  2UXC Q;  1OXS C;  1C9O A;  1FL0 A;  1X3F A;  4JCV E;  3CCE A;  1Q12 A;  4R4C A;  2GVA A;  2PQA A;  5M3F H;  3H15 A;  1PH5 A;  3HOW G;  4KLK A;  3M4O H;  3HOY G;  2YU9 H;  2ZM6 L;  1VQC A;  2R92 H;  5H1S E;  3RZO H;  4GOP A;  2F3I A;  1NMG A;  1EWI A;  4ME3 A;  3JAM i;  2BA1 A;  4DV5 L;  1XPO A;  1A0I A;  1O7I A;  2K5N A;  1RL2 A;  3T1H L;  4LF6 Q;  1YHB A;  1N36 Q;  4JI6 Q;  4NXN Q;  1E1O A;  1AH9 A;  1VQ5 A;  2K75 A;  4IFD G;  1HR0 Q;  2WB1 E;  3MXN B;  2VQE Q;  2N3S A;  4WJ3 M;  3J80 i;  5IYD H;  3UDI A;  4BY7 H;  3L0O A;  1MKH A;  3CAM A;  3PUZ A;  2PI2 A;  4B3T L;  5C0X J;  4JI0 Q;  3HOV H;  2A1A A;  1LYL A;  5GAE C;  4R4T A;  4DR2 Q;  1GO3 E;  4LF4 Q;  3HOU G;  2JJQ A;  1X3E A;  2HIX A;  4LFB L;  2OTL A;  4GS3 A;  5JJL A;  2WB1 G;  1L1O B;  3S2H H;  2RHS B;  5JJI A;  1CKN B;  4BA1 I;  5AJ3 L;  4IPC A;  1UEB A;  1JB7 A;  5JJK A;  2YYZ A;  4KHP L;  4B3S L;  2ZJP A;  3T1Y Q;  4HIK A;  1NY4 A;  4P73 A;  1Y1W G;  1HZB A;  1E7Z A;  3J7Z C;  1VQO A;  4A3K G;  4C3J H;  4DR3 L;  2UUC Q;  3RLN A;  4JOI A;  3ULJ A;  3NEM A;  4JI5 L;  4DV4 L;  4DPG A;  4GKJ L;  2YTX A;  2OQ0 A;  2JA8 G;  1X6O A;  2I5M X;  3KF6 B;  3KDF B;  2JQO A;  2ZTC A;  5JEA J;  1V43 A;  4KHZ A;  5LMU L;  4LF9 L;  3A5Z B;  3HOX H;  3K8A A;  2B63 H;  3CF5 A;  1K8A C;  5IY0 A;  4DR6 L;  1BBW A;  3A5U A;  5IYC G;  2ID0 A;  2NN6 I;  4LFA Q;  4A76 A;  2BA0 A;  2YTV A;  3ZJY C;  1SR3 A;  1JT8 A;  4GOP C;  1JJ2 A;  3F2D A;  4IOA A;  4GNX A;  5C0X I;  1YNX A;  4IJL A;  1EQQ A;  1N34 Q;  4APV A;  3S16 H;  2OCE A;  3J81 j;  2BH8 A;  3TRZ A;  2R7D A;  4GOP B;  3RR5 A;  5ELN A;  3UDG A;  1T9H A;  3H3V H;  4BBR H;  2AWO A;  1HNZ L;  2ZTE A;  2E5L Q;  3S2D H;  2JA7 G;  2UUB L;  5M5Y H;  4A3E H;  2NZO A;  2Q2U A;  1Y1V G;  4DV0 Q;  2JA9 A;  1MJC A;  3UE1 A;  1YBY A;  4YWK A;  5C3E H;  2VQF Q;  2A19 A;  1HR0 L;  1WOC A;  3M9B A;  3CME A;  1XNR L;  4DR7 Q;  3I4M H;  3S1Q H;  3K0X A;  3U4Z A;  4LF4 L;  4A3C G;  2K50 A;  1L0W A;  4B3M Q;  2Q2T A;  3CPF A;  4IO9 A;  1PYS B;  3FHW A;  4GLA C;  1XMO Q;  1WI5 A;  1I6H H;  1BBU A;  1N32 L;  2VL6 A;  5GRO A;  2OTJ A;  1C0A A;  2R7Z H;  3L7Z C;  1HZC A;  4JOI C;  3CQZ H;  4DR5 Q;  3CD6 A;  3S1N H;  3KYH C;  4DK3 C;  1XMQ Q;  4L5T A;  4GLX A;  3AYH B;  4YHH L;  1SLJ A;  4JI7 L;  1XNQ Q;  3M85 A;  3RNU A;  2ZJQ A;  1VS0 A;  3CCL A;  4JI8 Q;  1SRU A;  2F4V Q;  4NXM L;  3HOY H;  1EFW A;  3I4O A;  4X62 L;  3TS0 A;  4JG2 A;  3CC7 A;  4LWC A;  2ZTD A;  1QVG A;  3PF5 A;  1QVF A;  3PO3 G;  4YCW A;  3KFU A;  4UP7 A;  1XJV A;  4O0A A;  2E2H H;  4HIM A;  2LSS A;  2CFM A;  2EXD A;  2ASB A;  1KRT A;  4YCV A;  3U4V A;  4IPG A;  1OXU A;  4DR4 Q;  1J5E L;  1N8R C;  3UDF A;  1K3R A;  2EQS A;  1OXX K;  4DV2 Q;  1PHJ A;  2K4K A;  2UXB Q;  4GKK L;  3AFQ A;  2ATW A;  1WCM H;  1I5F A;  1VCI A;  2Z6K A;  4YY3 L;  4O2D A;  2WFW A;  1VQA A;  2AWN A;  4DV6 L;  4JBK A;  2NVY H;  5IYB H;  2NVX H;  3RLF A;  4AH6 A;  1M1K C;  4JYA L;  4A93 G;  2CKZ B;  4POG A;  5HY6 A;  4OO1 G;  1WJJ A;  1B70 B;  4DUZ Q;  2IX0 A;  2GN5 A;  1KC8 C;  1OTC A;  2KHI A;  2IX1 A;  4A3B G;  1TWH H;  4R1J A;  5M3M G;  1HNW Q;  4QGU A;  4LF5 L;  1Y1W H;  3CCQ A;  1CKO A;  4JI4 L;  1QUQ A;  5IP7 G;  3G6E A;  4DUY Q;  1NBW A;  4KI0 A;  1VQH A;  4R4Q A;  3M7N A;  4DKA C;  3ER0 A;  1SMX A;  2JA8 H;  4RMF A;  4JBW A;  4X65 L;  1VQ7 A;  4JI2 Q;  1JMC A;  3HKS A;  1YZ6 A;  4DV3 L;  4LF7 Q;  3H3V I;  4X66 Q;  1IZ6 A;  1PH2 A;  4Y52 H;  1UE6 A;  2K52 A;  3J7A 5;  3I56 A;  1X9N A;  3E9I A;  3F8T A;  3NEN A;  5J3B A;  4LW1 A;  2GVB A;  2JK8 A;  4EX5 A;  5C4J H;  3S17 H;  2R93 H;  3EN2 A;  3UDX A;  1J6Q A;  4J15 A;  3CW2 C;  1IBK L;  3OYY A;  5HGQ A;  1OXT A;  4HJ9 A;  1IBM Q;  2LXJ A;  1P8L A;  2N78 A;  1VQN A;  2IHE A;  5M5W H;  4HJ8 A;  3G48 A;  1PH1 A;  4P74 A;  2NZH A;  4OX9 Q;  1VQ8 A;  2ALY B;  3MEF A;  4AYB E;  1YIT A;  4IFD J;  1A63 A;  4X64 L;  2JA5 G;  4IPH A;  5ELO A;  2MO1 A;  4LNQ A;  1IYJ B;  1U5K A;  1Y1V H;  1UE5 A;  2WP8 J;  4JI3 Q;  5IWA L;  2CWA A;  2Z6K C;  3PIP A;  2B29 A;  1YHQ A;  1VQP A;  4AYB G;  3F2B A;  4DV7 Q;  2C35 B;  1EYG A;  1IL2 A;  3HKZ E;  2A8V A;  4JI1 Q;  4A75 A;  3G71 A;  4PMW A;  1QVC A;  1W2B A;  5IP9 G;  4A3C H;  2UXB L;  1PA6 A;  1VQK A;  1VQI A;  3PO2 H;  4C3I H;  2UUA Q;  5GAH C;  4LUO A;  4BY1 H;  3HKZ G;  3KF8 B;  3J81 i;  4AQY Q;  5K36 G;  2UXC L;  4EQ5 A;  3Q8D A;  3FP9 A;  1PFS A;  4B3R Q;  4K0K Q;  2QGQ A;  4UP8 A;  3NBH B;  4WJ4 A;  2OWO A;  2JA6 H;  4L5R C;  2IHF A;  3PCO B;  2PQA B;  4IFD I;  1W3S A;  4PG3 A;  1I94 Q;  2E2J H;  1RIP A;  2RHQ B;  3CC4 A;  3PV0 A;  1CUK A;  4A3G G;  4UP9 A;  4LFC Q;  4DAM A;  3PO3 H;  5FJ8 G;  5JEA G;  5GAG C;  1QZH A;  1PH7 A;  1BKB A;  4LF6 L;  3I4N G;  3S14 H;  4NXN L;  1N36 L;  4JI6 L;  1E22 A;  4MTN A;  2D62 A;  1HZA A;  3I2Z A;  4A3F G;  3UE0 A;  4A3I G;  3W5O A;  1IBL Q;  2VQE L;  4QJF A;  2H5X A;  4DNI A;  2HT1 A;  4JI0 L;  1VQG A;  2LXK A;  1TWF H;  2I5L X;  2HQL A;  5LMN Q;  2UU9 Q;  4JV5 Q;  2UXD Q;  1VQ6 A;  2I0Q A;  1N33 Q;  3E0E A;  4DR2 L;  4PZ6 A;  1EOV A;  1PH4 A;  1HR0 W;  2CWP A;  3H0G G;  1EQR A;  3W1G A;  4DR1 Q;  3E9H A;  1Q81 C;  4HID A;  5E7N A;  1Q82 C;  4A93 H;  3HOV G;  3FKI H;  3TS2 A;  4BY7 G;  4BXX H;  3PUV A;  5BR8 Q;  4A3B H;  2MQH A;  1YVC A;  1TWG H;  3IRB A;  3T1Y L;  4GN3 B;  5M3M H;  3OTO Q;  1TWA H;  2RF4 A;  3GTK H;  2UUC L;  1YJ9 A;  2VUM G;  3HOW H;  1OXV A;  2XTI A;  2DGY A;  3AFP A;  3CP0 A;  2QEX A;  2KCM A;  2D0O A;  3GTQ H;  3EBE A;  4HIO A;  2V1C C;  3NEL A;  3LGJ A;  1KQS A;  3A0J A;  4B3R L;  1VQF A;  1HZ9 A;  2R6G A;  3OW2 A;  1YIJ A;  4LFA L;  2VS1 A;  1Q46 A;  2E8G A;  3PSI A;  4GNX C;  1NJI C;  2VNU D;  3KJO A;  1P16 A;  2ZM6 Q;  2B63 G;  1WFQ A;  2AMC B;  1N34 L;  4GNX B;  2JEB I;  1QZG A;  4LFC L;  2WAQ E;  4NB3 A;  4DV5 Q;  1ASZ A;  4YWL A;  3JAM c;  1HJP A;  5C44 G;  2E5L L;  5GQO A;  4OXP A;  1YI2 A;  2CQO A;  3GD7 A;  2CCZ A;  2JA5 H;  3T1H Q;  3DM3 A;  4DV0 L;  4HJA A;  1GD7 A;  1X65 A;  3HOU H;  4H02 A;  2VQF L;  2WAQ G;  5IT9 c;  3TQY A;  4A3M G;  4L5S A;  1SFO H;  2Y0S E;  5C4X G;  1IXR A;  4DR7 L;  3J80 c;  3I55 A;  4A3J G;  3K81 C;  4B3T Q;  4A3E G;  1PV4 A;  2NVQ H;  3S24 A;  4A3D G;  3RN5 A;  3U58 A;  2AHO B;  4QIW E;  1L1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...