4B3SQ

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sQ00
3RNUA 4Y7NH 1Y1VG 2ALYB 4JYAL 5IYDG 1JE5A 1X55A 2EIFA 4H02A 4DUYL 4DR1Q 2VNUD 1XMQQ 4NPSA 4JBMA 3S1MH 2E5LL 4IPCA 1VQAA 4JI4Q 3HOWH 1UEBA 4DR2L 4QIWE 1VQHA 5LMNW 1HNXQ 4O2DA 3BZCA 1MIUA 2MO1A 1KRSA 4NXMQ 3TQYA 2Y0SG 3D0FA 3HKZG 4DPGA 2NZHA 4P74A 4A3KG 2EXDA 5IWAQ 3I2ZA 4QY7A 4OXPA 4L5RC 1EUJA 1NBWA 3W5OA 3S1QH 3HOUG 1FVIA 1Q46A 4IPGA 3ULLA 1A63A 1G6PA 2JJQA 3NBHB 1E1OA 1CKNA 5IYCG 1YJ9A 4YWLA 4C3JH 4LF4Q 4B3RL 4EX5A 2IY5B 4DR6Q 1C9OA 4HJ9A 4YHHL 2ZM6L 1U0LA 3S1NH 2IHFA 4BA1I 4LUVA 2KCTA 3CC2A 5M5YH 2NN6G 3UE1A 5FLMH 3H15A 2DUDA 4PZ6A 4DV1L 3GTPH 2JA5G 1S72A 2NZOA 1N36Q 4A3JG 4K0KQ 4DR1L 1XMQL 3M9BA 3H0GG 2WB1E 3B6YA 5M3FG 1HNZQ 2NVXH 1LUZA 4DV0Q 4JI4L 3JC66 4YCVA 5LMNQ 2Y0SE 1K83H 3HKZE 5GQOA 3I55A 1NMGA 4LF6L 1Y14B 4HJ7A 5JJLA 1HNXL 1XNQQ 1Q81C 4JI0Q 4NXML 2UUBQ 3U4VA 4HJ5A 1YBYA 4GOPB 4R4QA 5IWAL 5BR8L 3W1GA 4A3EG 5IYCH 3CF5A 1XMOQ 3J7A5 3S15H 2MQHA 5C0XI 1VQIA 4JI2Q 3I4MG 3I4OA 2UXDQ 1PFSA 1HZCA 1B70B 2IT1A 1I5FA 2N49A 4IPHA 4JI1L 1VQBA 2D0OA 1S3OA 1NMFA 3KJPA 1I50H 1VQOA 1CUKA 1CKMA 1N34Q 3KLWA 3PGZA 3H3VH 1YJNA 1X54A 1NE3A 3CD6A 1B8AA 3D31A 1SE8A 4O0AA 1Q7YC 3M4OH 3GTLH 2Q2IA 1N36L 1LYLA 4K0KL 1MJEA 2VUMH 1VQFA 1V43A 1SFOH 1QUQA 2R7DA 3EIVA 3PSIA 5C3EG 1OXXK 3BJUA 3ULJA 4DV0L 3JAMc 4AQYL 1HNZL 1YNXA 4C3HH 2I0QA 4LF5Q 4TVAB 1NY4A 2AWNA 1X65A 2Z6KA 4OONA 5IP7H 3K8AA 2MO0A 1XNQL 3TEHB 1U5KA 4P73A 5IE8A 5IT9c 4JI0L 4DV3Q 1X6OA 2IX1A 4X65Q 5ELNA 5J3BA 4DR7Q 1E22A 4AIMA 4P72A 4R1JA 4IOCA 1AE3A 2GN5A 1VQ9A 2RHQB 4JI2L 1JJCB 5GAHC 2UXDL 2B63H 2YYZA 4OWTB 3PUVA 4JOIA 2VZAA 2R92H 3PO3G 4IFDJ 2N3SA 2E8GA 1VQCA 3A5ZB 5M3MH 3S14H 1TWCH 3UDFA 3CCJA 4A3DG 1UE7A 4DR4Q 4LF9L 1WFQA 4IPDA 4GKKL 1Q1EA 2K52A 3G48A 4IJLA 4A3LH 1PH4A 3G4SA 3DM3A 3SGIA 1R9TH 1FJGQ 1JT8A 3E9HA 3HOZG 1TXYA 4HJAA 2ID0A 2JA8H 1PYBA 3GDEA 1T9HA 3E0EA 5C4JH 3HOXG 1XTDA 4AH6A 3CMAA 2AWOA 4DV3L 4JBKA 1P16A 1WOCA 4X65L 4BBRH 5M5WH 3OW2A 4DR7L 4LFAL 3HOVH 3NENA 3ZJYC 1GO3E 4LUOA 1EQRA 1FGUA 3EN2A 4LUZA 1TWAH 1OXUA 2WP8J 3STBD 2XGTA 4A3MH 2VS1A 2E2HH 4DV1Q 1Q86C 4C3IH 3CCRA 1JJ2A 4BBSH 2EQSA 4GN4B 4QL5A 3GTGH 4DV2L 3RLOA 5FJ8G 2VW9A 4C2MH 4ALPA 3CP0A 1VQLA 4A3DH 1VQJA 1X3EA 5EAYA 4DK3C 2QEXA 3LGJA 1VQEA 3PF5A 4P75A 2HQLA 4PZ8A 1C7YA 2NVYH 3UDXA 4XIGS 3E9IA 3M3YH 4LF6Q 2WB1G 1XPRA 2GVAA 1VQKA 4DR4L 4MZ9A 3CCVA 3S17H 1W3SA 1CKNB 1CSPA 2IX0A 5E7NA 2NN6I 1FJGL 1HZBA 4DNIA 3RN5A 5BR8Q 1BBUA 4IFDG 1A62A 1X9NA 1TWHH 2K4KA 1I6HH 1AH9A 3HOYH 3CPFA 4X66Q 4X62Q 2VQFQ 4JI1Q 1Y1VH 1J5EQ 4BY7G 3ER0A 5IYDH 2Z0SA 1C0AA 2JA6G 2K5NA 1XPOA 1PH1A 5FJ8H 4GKJL 2OTJA 1HJPA 4JV5Q 2D62A 4P71A 5ELOA 3KDFB 4UP9A 4POFA 1PH9A 3CQZH 2WAQE 2I5LX 1CSQA 2RF4A 2BA1A 1KRTA 4DV5L 3AFPA 3MEFA 4AQYQ 1YIJA 1TWFH 2LSSA 1YHAA 4GOPC 2PI2A 4GLAC 1D7QA 3RLNA 3ULPA 3FHWA 4A3KH 2ZTCA 1E7ZA 2F3IA 1KD1C 4A3GG 1GVPA 1KL9A 1SROA 3TREA 3HOUH 1PH6A 2AKWB 4JC0A 2BH2A 1GKHA 4GN5A 2UXBQ 3S2DH 2HIVA 2UUAL 3G71A 3M4QA 1XNRL 2CCZA 3CCSA 2QA4A 3NEMA 1I94Q 4IO9A 3K0XA 4X66L 4X62L 5AJ3L 3GO5A 2VQFL 4JI6Q 2K5HA 2N78A 3CCMA 1M1KC 1EYGA 3CCLA 2Q2TA 1LTLA 3CAMA 4FDBA 2LXKA 3F2BA 1G51A 2K5VA 1J5EL 1ASZA 4WJ4A 3KJOA 1RIPA 1Z47A 2JA5H 3TRZA 3I4NG 1K8AC 1Q8KA 4A3JH 4OWWB 2NVQH 4BXXG 2E2IH 4YCUA 4HIOA 4A3BG 1BVSA 3H0GH 3KF6B 3J80i 1VQPA 2I5HA 2OWOA 4BY1G 4LF9Q 5M3FH 4GKKQ 4JV5L 3CCEA 2OTLA 2D0PA 2VQEQ 2ZJQA 1NJIC 4LFCQ 1V9PA 2VL6A 3U50C 2ATWA 4X6AH 2CKZB 4KHPQ 2JK8A 4ME3A 4B3TQ 4PZ7A 3RR5A 3AFQA 1IBKQ 3A74A 3S16H 4JCVE 1VQNA 1HH2P 4A3EH 4KHZA 2R7ZG 4GOPA 2V1CC 1RL2A 3I4MH 2KHIA 2YTXA 3K7AH 4IJHA 4JI5Q 4LFAQ 2UXBL 3PIPA 2PI2E 1L1OB 3EBEA 1SRUA 3PO2G 1I94L 4OX9Q 2BH8A 5GADC 4GNXB 4UP8A 3J81i 4JI6L 4BXXH 4TQUS 2Q2HA 1QZHA 1KC8C 3RZOH 2KCMA 1VQ6A 4DV2Q 2GVBA 1WI5A 1JMCA 3GTKH 4A3BH 1YZ6A 4A75A 2KENA 4YWMA 3S2HH 2ZTDA 2ES2A 3L7ZC 2JA9A 3J7ZC 3T1HQ 3CPWA 1QZGA 5C3EH 1K3RA 4A93G 3F2CA 3PIOA 2VQEL 5HGQA 3ERSX 3DLLA 2PQAB 4LFCL 1YEZA 4A3FG 1K8GA 1IL2A 1PA6A 4KHPL 1TWGH 1VCIA 5IYBG 2HIXA 1UE6A 1WCMG 4B3TL 4X64Q 2JQOA 1IBMQ 1IBKL 2ZJPA 2HHHQ 5K36G 3HFZB 2H5XA 5GROA 1Q1BA 4JBJA 3U58A 1VS0A 3CW2C 1EFWA 1J6QA 1HZ9A 4B3SQ 1N33Q 1DGSA 3K80C 2IHEA 4JI5L 1KIXA 5C44G 5LMUQ 4LF7L 3L2PA 3U4ZA 2ZM6Q 4MTNA 3UDIA 1N32L 4OX9L 5H1SE 4YCWA 3CMEA 4NXNQ 3HOWG 4GKJQ 4L5TA 3PO3H 1V1QA 1X3GA 2JE6I 3M85A 4IFDI 3ICEA 4GN3B 1YHBA 3HKSA 1VQMA 4LNQA 1BKBA 1LM0A 4DV5Q 1YI2A 1PV4A 3GTMH 4BA2I 2WAQG 3T1HL 1EIFA 4B3MQ 1L2FA 2KBNA 3HOZH 4APVA 2CWPA 5JEAJ 1WCMH 1OTCA 4R4TA 1HR0Q 4DKAC 1O7IA 5M5XH 1VQ8A 1KXLA 1B7YB 3HOXH 1X56A 1OXVA 1G291 1A8VA 1Z9FA 1QVCA 4X64L 1XNRQ 3FP9A 2XTIA 2B3GA 4JG2A 1IBML 2UUAQ 3L0OA 1PYSB 2R7FA 3GD7A 1WYDA 2HHHL 2UUCQ 4JI7Q 5C44H 5AJ3Q 3PF4A 5FLMG 3OYYA 5IY0A 3MXNB 4LW1A 4B3SL 5C4XH 3M4PA 1N33L 1IZ6A 3NELA 4YWKA 1PHJA 4LF8Q 3VDYA 4QJFA 5LMUL 2E2JH 2PMZE 4DUZQ 3PV0A 4A3CG 4DV4Q 3TS2A 3UDGA 1VQDA 1ASYA 4NXNL 3F8TA 4DR3Q 2UU9Q 3I56A 3Q8DA 2K75A 3GTJH 3BU2A 2KHJA 3F2DA 3GTQH 1JJGA 3I7FA 1SR3A 3T1YQ 1EOVA 3H3VI 3AYHB 2YU9H 5JJIA 4L5QA 2N8NA 2ZTEA 2B29A 4R4IA 4OWXB 4A4IA 3J80c 1M90C 3PUYA 4B3ML 4L5SA 2CQOA 4NB3A 5C0XJ 2ASBA 4LFBL 1BBWA 1HR0L 2F4VQ 2A8VA 2K50A 2OCEA 1UE5A 2RCNA 3A5UA 2AMCB 3PUXA 1K0RA 1I3QH 1Y1WG 2BA0A 2WFWA 1N8RC 1GD7A 3KFUA 4BY7H 3J81j 1QVGA 2UUCL 4JI7L 1SLJA 1MKHA 2Z6KC 3RZDH 1E1TA 4JI8Q 1SN8A 2C35B 5JEAG 2JA6H 1HNWQ 5IP9G 1CKOA 1E3PA 4R4CA 1GM5A 4A3CH 1QUQB 1D8LA 4RMFA 3A0JA 5GAGC 3CC7A 4LF8L 4UY8C 3UE0A 4DR5Q 2VUMG 3CCUA 3F1ZA 4YY3Q 4DUZL 3STBC 4GS3A 4DV4L 1FL0A 3PUWA 3J81c 1A0IA 4DR3L 2FXQA 4DK6C 3KDFA 5DLQE 5FLXc 2UU9L 4MNOA 1IBLQ 2LXJA 4A3IG 1EWIA 3M7NA 5IP7G 2RHSB 3T1YL 3W1BA 4JBWA 4HJ8A 2R6GA 1PH5A 4JOIC 4JI3Q 1K9MC 3RN2A 3FKIG 3AEVA 1EQQA 4DAMA 1WJJA 4A3GH 2JA7G 4QQBX 1PVOA 1L1OC 1VQ7A 4KI0A 4PMWA 1PH2A 4LF4L 4GNXC 4DR6L 1Y1WH 3BZKA 2R93G 2OQ0A 2L15A 2F4VL 2B63G 4HIDA 2NVTH 2JEAI 1XPUA 2PNHA 3S24A 1OXTA 1UWVA 1EIYB 2VY3A 1YITA 4LF7Q 3KYHC 5IP9H 1N32Q 1X3FA 3OTOQ 4R4OA 1VQ4A 4A76A 2YTYA 3PUZA 2R92G 5M3MG 2UXCQ 1IYJB 4AYBG 4GLVB 4JI8L 1JB7A 5C0XG 3I4NH 1HNWL 1PH8A 4Y52H 4DV7Q 5LMNL 4A3LG 4BY1H 1XJVA 2HT1A 3WWVA 4DR5L 3RLFA 2CFMA 4EQ5A 4YY3L 1NTGA 3KF6A 3CCQA 4DV6Q 4A3IH 4UP7A 4OO1I 3CXCA 4WJ3M 2JA8G 3KOJA 1K73C 1N9WA 5C4XG 1P8LA 2UUBL 1IBLL 4HIKA 3FKIH 3AQQA 2I5MX 4GLXA 2JA7H 4XTCS 4LWCA 4KLKA 1AE2A 3IRBA 3KF8B 1XMOL 1HZAA 2K14A 3CC4A 1MJCA 1VQGA 4JI3L 1Q12A 1HR0W 3G6EA 2Q2UA 4JYAQ 2R93H 4BBRG 2R7ZH 1YHQA 3S1RH 3HOVG 3K81C 1IXRA 2YV5A 4DAYB 4J15A 1KAWA 4RG1A 2ZJRA 4DUYQ 2F52A 1OXSC 1H95A 2AHOB 4A3MG 2E5LQ 3PO2H 4OO1G 4QGUA 1N34L 1YVCA 1KQSA 2DGYA 2QGQA 3K7UC 4AYBE 1PH3A 4BBSG 4DR2Q 2YTVA 1L1OA 1L0WA 3JAMi 2CWAA 2MNAA 1PH7A 3OTOL 4GNXA 3GTOH 2UXCL 4HIMA 2MFIA 3PCOB 1W2BA 4DV7L 5JJKA 1SMXA 4UPAA 1UE1A 1YJWA 1S40A 5GAEC 4A93H 4LF5L 4POGA 4IOAA 4DV6L 2JEBI 5HY6A 1Q82C 2OQKA 4A3FH 1VQ5A 1QVFA 2A19A 2A1AA 4PG3A 5IYBH 4B3RQ 2PQAA 1KHIA 3TS0A 4LFBQ 4YHHQ 3HOYG 1E24A
chains in the Genus database with same CATH superfamily
2ALYB 4G7HC 3T51B 1AW7A 2B2TC 1LT4D 4H02A 2IJ0A 1XMQQ 4NPSA 4LAAA 4K8JA 3S1MH 2E5LL 1UEBA 5EPKA 5LMNW 4O2DA 2MO1A 4NXMQ 4MIUA 4DK1A 5A2QE 3HKZG 4K2LA 4P74A 2PPBC 3I2ZA 2O4XA 3N52A 4QY7A 1NBWA 1EUJA 3W5OA 3P1HA 4K6LA 1F9RA 3C2PA 1CKNA 3NTHA 4LF4Q 3FKIB 5TSSA 1C9OA 2ZM6L 2JA7B 2IHFA 1QG7A 1SYDA 3UE1A 4IUTA 1TS2A 1QWYA 1V1PB 3M9BA 2WKDA 1BUVT 3PO2B 3JC66 2V4DA 4N9PA 3MAQA 1A3TA 4KV6A 1HUNA 3I55A 1BCPB 4HJ7A 5J39A 5KNBA 1XNQQ 4FXDA 4B9XA 3UI2A 3U4VA 2F0OA 1BO0A 5KYLA 4A3EG 1NCVA 5IYCH 5DM73 4WJWA 1EEFD 3J7A5 1VQIA 4JI2Q 2UXDQ 4DXGA 1PFSA 2DJFC 4JI1L 1VQOA 3KJPA 1I6VC 3OW7A 3H3VH 1X54A 3KBGA 5JEAH 5FO7B 1SE8A 4O0AA 1Q7YC 4PV1C 2PW7A 4HAEA 2Q2IA 3G6JB 2VUMH 3R93A 1EYDA 4CJ1B 1PYWD 4L63B 1D5XC 3PSIA 5C3EG 1OXXK 3BJUA 1HNZL 2B2WA 3JAMc 4RGMA 5JPMC 4H44C 4NMZA 2K1BA 2KQ3A 2Z6KA 5IP7H 2QCPX 3TEHB 4P73A 5IT9c 1X6OA 3J80E 4RHRA 1CA6A 1OO9B 4M8AA 4IOCA 1STAA 3HOYB 5CV7A 1JORA 1G2SA 4RWSC 2EJFC 3HG9A 2XIWA 4NKLA 3I4LA 4U673 4CKEA 4JOIA 1XTCD 3IFTA 3PO3G 5M5YB 2E8GA 1QB5D 3CCJA 3GTPB 4GKKL 1WFQA 1Q1EA 1PRTD 3Q22A 4MHEA 1PH4A 1Y8PB 1JT8A 3E9HA 2NVXB 4HJAA 1VF5C 4RA8A 5D3IB 3GDEA 3HKZB 2F0VA 3CU7A 4DV3L 2C5CA 1WOCA 1TU2B 5JJZA 1GXDC 2KUMA 4BBRH 3OIPA 3DWQA 3HOVH 1CZWA 2A68D 4LUZA 2WP8J 5C4HA 2VS1A 1CM9A 1EYAA 2EY6A 2LS01 3CCRA 4DV1Q 4QL5A 2VW9A 4A3DH 3CP0A 1X3EA 2QEXA 4DK3C 3E5SA 1KLUD 4P75A 4CKBA 3EA6A 4PZ8A 2EOTA 1AN8A 4DR4L 2DY7A 1VQKA 1SXTA 3S17H 5E3FA 1W3SA 4DGZA 5CBAE 4G7OC 2K7VA 1QNKA 2FINB 2K32A 4QMGA 1TWHH 4XXEA 3S16B 2Z9HA 3SK6A 3IL8A 2MJ8A 3CPFA 5M9OA 3A8JE 4A3EB 4ME5A 3R8BA 1CHPD 3SK4A 3ER0A 4CGYB 5IGBA 2DN8A 3I70A 3ONAB 4R8IA 2K5NA 1TQOA 4RKLA 2XWJB 2L4NA 5L37A 5ELOA 5CV8A 1PH9A 4IUNA 3CQZH 2CH4A 2RF4A 2BA1A 4KN4C 3MXGA 1PTOD 2DNEA 2B39A 5CV4A 1TWCB 4DNRB 3RLNA 3ULPA 4IURA 3FHWA 4WORA 1ZYRD 3MVVA 5C4ZA 1KD1C 4A3GG 1GVPA 1PH6A 4JC0A 1GUNA 2JA8B 2I07B 1PRTB 1I94Q 5C4JB 4KY5A 3K0XA 2VQFL 4X62L 4WFN3 4RGTA 3CCMA 1EYGA 1HA6A 1LTLA 1J5EL 1ASZA 4K5WA 2JSOA 2VB3X 1Z47A 3PMFA 4N8FA 4OHJA 3TRZA 4BXXG 1Q8KA 2JN4A 1TWAB 3KF6B 3H0GH 4QUFA 1VQPA 5IGCA 4BY1G 4LF9Q 4C3IB 4CJ0B 4JV5L 3MXUA 4IUPA 2D0PA 3GTGB 1HTLD 2ZJQA 4C2MB 1NJIC 2ICIA 5E4WC 4KHPQ 1BXTA 5A2QL 5KNDA 3AFQA 4QIWB 4B9WA 3M3YB 5I2YA 1SBBB 2F0MA 2F0TA 1GUSA 3E3XA 3OMGA 2R7ZG 2K5QA 1W6JA 4LFAQ 3F2UA 4ZRZA 2UXBL 5DNFA 1ILPA 3BVZA 1I6HB 3FDTA 4J8QA 4GNXB 4MTKA 4TQUS 3RZOH 5I6YA 1VQ6A 1ILQA 1B9MA 1Y1VB 1WI5A 3GTKH 5NUCA 3ERQA 5CORA 1HCZA 2ES2A 4XYQA 3D6WA 1QZGA 1IYUA 1Z7TA 3GTQB 1RCVD 3DLLA 2PQAB 1QOHA 1KNEA 4LFCL 1YEZA 1IL8A 1TWGH 1ML0D 1DONA 1UE6A 1WCMG 3VA7A 4B3TL 2ZJPA 5K36G 3HFZB 5ELBA 2H5XA 4JBJA 4L6TB 1EFWA 4B3SQ 3HOUB 4QCLA 1DGSA 1PTOB 4CKCA 4ZAIA 4JI5L 3D3RA 5LMUQ 4OX9L 1B1ZA 5H1SE 4YCWA 3CMEA 4GKJQ 1D2BA 4L5TA 3C3LA 3J7AV 3Q24A 1X3GA 1RDPD 3M85A 5EKLA 4HTHA 1JOKA 4GN3B 1YHBA 3P7JA 1BKBA 1LM0A 4DV5Q 2JA5B 4A3JB 2ICEC 1EWHA 5EQ0A 4XT1B 3GTMH 2EY5A 2WAQG 3KLSX 1EIFA 5IGFA 5M5XH 1JE4A 4KY6A 1G291 3DMUA 2EY1A 4K14A 3FP9A 4A3GB 1PYSB 3GD7A 4EGVA 1WYDA 3VYRA 5C44H 1V1OA 5C4XH 1IZ6A 3I4MB 1KAAA 3K7AB 4LF8Q 5HURA 2E2JH 4DUZQ 1RTNA 3PV0A 4I7AA 1AZQA 2PYKA 3UDGA 4NXNL 2KVMA 1EY6A 1PZJD 2OT2A 2CVRA 4BY1B 1EOVA 2YU9H 3A7LA 1AFPA 2ZTEA 1O7YA 2B29A 4P2CB 1DZ1A 5C3XA 1G2TA 3HGBA 3QR8A 1DOMA 5CGKA 2LKVA 2A8VA 2K50A 3A5UA 4EVOA 3PUXA 1I3QH 2BA0A 2R7ZB 1YNJC 3MHBA 2F0QA 4JI7L 4RAUC 4JI8Q 4F88A 5JEAG 2F0PA 1E3PA 1GM5A 4A3CH 2BCOA 4RMFA 1S5DD 4UY8C 3UE0A 4DR5Q 2VUMG 4ZCKA 3CCUA 4GS3A 1FL0A 1YNNC 3J81c 1H9MA 2XWBB 1O78A 4A3IG 5IP7G 4UAIA 4FF2A 3T1YL 4X3KA 4JBWA 2G5DA 2MGSA 5EBCA 1PH5A 1I4XA 4ZK9B 1WTQA 1Y8OB 2TSSA 3OPOA 1PVOA 1FGBD 1WCMB 2R93G 2L15A 4ZKCB 1XPUA 3S24A 2K5DA 1UWVA 1EOTA 4LF7Q 3KYHC 1N32Q 3QO2A 3NXWA 4R4OA 2UXCQ 4GLVB 4Y52H 1HNWL 2RDGA 3S1MB 3VR5A 1C4QA 3C1FA 1JB3A 1QJOA 1X32A 2B2UC 5DM63 4DV7Q 2FJ2A 5LMNL 1KNAA 3RLFA 2CFMA 1NTGA 4DV6Q 2PMZB 1SYCA 2B8FA 4UP7A 1U4PA 4OO1I 1B2TA 4WJ3M 4FF4A 3AQQA 2I5MX 2WAQB 4GLXA 4KMUC 1JOOA 1VF7A 3IRBA 2K14A 3K5OA 4JI3L 2Q2UA 3QWNA 5ELEA 4BBRG 3HOVG 2ZJRA 3K6OA 3FRPB 1OXSC 1H9JA 4U68A 5KNCA 2E5LQ 4QGUA 1N34L 1YVCA 2DGYA 3K7UC 1PH3A 3JAMi 2MNAA 5C5MA 1H9KA 3GTOH 4BY7B 1HHVA 1EZ8A 3K5MA 4HIMA 2MFIA 1HQRD 1K0SA 2PZTA 1DCZA 1SNMA 1SMXA 4UPAA 1UE1A 5CV6A 4A93H 1SMYD 5EKKA 2B8GA 3BYTB 2A1AA 5IYBH 2ZM6Q 3OHXC 2L11A 2A69D 1S5CD 4IZ8A 3TN2A 3V05A 4ZLTF 1PFBA 3RNUA 3OIQA 3N6RA 3L9AX 1EY8A 3D4RA 2IL8A 1DOLA 1EIHA 1JE5A 3A56A 4PNYA 2EIFA 3QIAA 5ELFA 1K28A 2K6AA 3FPPA 3HZXA 4MN3A 5D65A 1LTSD 1LTTD 1MIUA 2VUMB 3I4NB 3D0FA 2XSCA 2X69A 4L5RC 5G3LD 3G7LA 4A3IB 4IPGA 1Q46A 3ULLA 1A63A 2NYZD 1G6PA 1E1OA 2KEEA 5KIXA 4B3RL 4DR6Q 1U0LA 3CC2A 2KCTA 2Z4IA 2KA7A 2F0DA 2R93B 2ZXRA 2O5JC 2RDHA 3R2IA 4DR1L 3H0GG 1SDFA 1HNZQ 5F2DA 4JI4L 1VMCA 2B2TA 4LF6L 5JJLA 1HNXL 1E0BA 1Q81C 3W1GA 1VMPA 4G4KA 3S15H 2MQHA 3WOFA 1B70B 2N49A 4IPHA 1VQBA 2D0OA 1NMFA 1I50H 1CUKA 3DUZA 4DU9A 3CRLC 4J1MA 3PGZA 1YJNA 4Y7NB 4Z9CB 2L0CA 3D31A 1U4RA 1LYLA 2O2LD 1S4ZA 1ICWA 3EIVA 4AQYL 3ULJA 4DV0L 3T13A 3HOWB 1B50A 2NZ1D 4C3HH 2NUCA 4LF5Q 1NY4A 2A6HD 4FP5D 2AWNA 1X65A 3K8AA 1BNZA 1TS4A 4JI0L 4DV3Q 4NDXA 2M00A 5J3BA 1E22A 1KDCA 2FHTA 4RGNA 4P72A 4R1JA 1AE3A 1TWHB 4KKSA 4PMCA 3NE5B 3H91A 1LABA 4ZKBB 5GAHC 3SK5A 1GUWA 2YYZA 3PUVA 4C3JB 5BN5A 2F0JA 2F0GA 1D5MC 3S1NB 2R92H 1X3QA 4IFDJ 2F0WA 1VQCA 3S14H 2CW0C 3UDFA 4C1NI 5C6AA 1UE7A 4DR4Q 4L8JA 4IJLA 4A3LH 3TSSA 2EXZA 3DEPA 2NB0A 3BZDB 5FLXE 1K83B 5FO8B 2QILA 1XTDA 4RCOA 3CMAA 1JCKB 2M2LA 4DR7L 2J0TD 3NENA 4LUOA 3EN2A 5C4XG 3STBD 3URYA 1SYGA 4A3MH 4DAYA 2EQSA 4GN4B 1Q3LA 1K8MA 3D8GA 1VQJA 1F2ZA 4FVMA 1VQEA 1C7YA 2NVYH 3H0GB 3M4OB 2WB1G 3GTLB 1FD7D 2RSNA 1AP0A 1WD0A 2RQXA 1CSPA 1EU4A 1A2TA 2IX0A 1SFOB 2NN6I 1Q90A 3KUPA 1FJGL 1HZBA 1WTXA 5BR8Q 4CDFC 2D9UA 1AH9A 1SYFA 4XQQA 1QE6A 2VQFQ 4X62Q 2F0LA 1J5EQ 1EU3A 2Z0SA 2L9HA 2A73B 1C0AA 1JC7A 1XPOA 1PH1A 5FJ8H 2VB2X 1HJPA 4JV5Q 1HQMC 2B63B 4UP9A 3DHQA 4POFA 4F87A 2I5LX 1CSQA 4I65A 1KRTA 3BVGA 2BE5C 1LT5D 5M3MB 1YHAA 4GOPC 4AYBB 1FNUA 4GLAC 4KTAA 1FR3A 1A3VA 4A3KH 2KJXA 2ZTCA 4TSSA 2F3IA 3TREA 1IKMA 2NTTA 4KD3A 2BH2A 1GKHA 1V8QA 2A5HA 2UXBQ 1ET9A 1W6KA 1BF4A 1XNRL 3NBHA 4X66L 2Q2TA 3CAMA 4FDBA 1BDOA 2LXKA 4WJ4A 5M5WB 3E0JA 1FYCA 1M8AA 4LJZC 3X3NA 4YCUA 1MD2D 2E2IH 4HIOA 4A3BG 2E2HB 1A6XA 2OWOA 1STGA 5M3FH 3CCEA 4BBSB 1O80A 2HDLA 4LFCQ 2VL6A 3U50C 2ATWA 1STYA 4OGQC 3SXHA 4B3TQ 3RR5A 1LTGD 1U9RA 1VQNA 1T5XD 5M5XB 1RL2A 2FFKB 2YTXA 4IJHA 4JI5Q 1KDBA 2PI2E 1PMRA 4OX9Q 1BQQT 4UP8A 3J81i 4JI6L 1KC8C 1EYCA 4DV2Q 2GVBA 5C4XB 4HMIA 1EEID 1YZ6A 4RGOS 4BWGB 1ZXTA 1BOSA 2Z1CA 5CV9A 4A93G 4V0BA 2WINB 3PIOA 3H6MA 2VQEL 1NSNS 2WB1B 1EFID 1ENFA 1VCIA 5IYBG 1TWFB 2HIXA 5COYA 2JQOA 4RCNA 1A2UA 2RBMA 1Q1BA 1VS0A 3CW2C 1HZ9A 2BE5D 2JYOA 3U4ZA 4MTNA 4NXNQ 3W3AA 4N9TA 1IHZA 4IFDI 3HKSA 2SEBD 1RHPA 2L55A 2XRQD 2NVQB 3S2HB 3HOZH 1HA5A 3JAME 4APVA 3BYYB 3HP3A 4R4TA 4DKAC 2F3WA 2X6LA 1B7YB 2WIIB 1LO5D 3HEJA 3KBXA 1QVCA 2UUAQ 2XTIA 2B3GA 1SSOA 2HHHL 4JI7Q 1CZGA 2H4OA 5AJ3Q 1QNUA 3OYYA 5BN4A 4YWKA 4QJFA 1X3PA 1VQDA 1ASYA 3F8TA 3F2DA 3BU2A 1JJGA 4A3BB 3OOCA 2E76C 3T1YQ 1Y8NB 2Z8LA 3H3VI 2ZT9C 5JJIA 2AQ2B 4HMJA 4OWXB 4A4IA 1M90C 1SNDA 4L5SA 5C3EB 4NB3A 5FLXL 5C0XJ 3K5LA 4LFBL 1TT2A 2PQEA 3I91A 4ILWA 3FMCA 1K8OA 1Y1WG 2KCNA 1N8RC 2L5TA 3J81j 3RZDH 1MKHA 2Z6KC 4TRDA 2JA6H 1HNWQ 3T4AC 3CC7A 1KLGD 2LY7A 1SNCA 1EY5A 5T1IA 4H7BA 2F0NA 4DV4L 3VR2A 3KDFA 4C3HG 1D6EC 3PO3B 2K01A 4MNOA 3M7NA 1EY4A 1MSGA 1KTKA 4JOIC 4JI3Q 1EL0A 1EQQA 4DAMA 1K3BC 1L1OC 4ABNA 1PZID 4LF4L 2OQ0A 2F4VL 3IKJA 2JEAI 1STHA 2PNHA 3BDLA 1EIYB 1LTAD 1EIGA 4RHSA 3MC0B 5IP9H 2R92G 1F9PA 4CHTB 1NNXA 1IYJB 5T1GA 1PH8A 3MA2B 4EQOA 4A3LG 1XJVA 3T16A 2PZWA 2R3ZA 4EQ5A 4YY3L 3CCQA 5KRUA 1I4QA 1P8LA 1IBLL 3FKIH 5JVH3 1SYEA 2JA7H 4LWCA 5EKIA 4KLKA 1AE2A 3CC4A 1HR0W 1Q12A 3G6EA 2IX3A 4DAYB 4J15A 1KAWA 1WTHA 4A3MG 1HRJA 3PO2H 2ZXOA 5AFWA 1KQSA 4F7XA 1JR0D 1SNPA 3J7YW 3D4DA 3NHHA 3OTOL 5D3DA 3OSOA 1STNA 5FKAC 2F0FA 3MFYA 5JJKA 2D2CC 1YJWA 1S40A 4J6HA 4LMQD 2B2YC 2JEBI 3Q0AA 4A3FH 2B2UA 1QVFA 1GUOA 2A19A 4B3RQ 2I46A 1WTPA 3QB3A 5ELCA 3J80L 2VNUD 4DR1Q 1B9NA 3HS0C 1Y1WB 4JBMA 1XWEA 2EJMA 1VQAA 4JI4Q 1NR2A 4QIWE 2E74C 2EYJA 5C3WA 1HNXQ 3BZCA 5IIFA 1MI2A 3BVMA 3TQYA 4JW0A 4DPGA 2NZHA 3PIO3 4A3KG 2EXDA 1B53A 4CDEC 4B08A 4OXPA 2F0UA 5FOBB 1NAPA 3S1QH 2PW5A 2MHVA 1FVIA 2EZVA 3M4YA 2JJQA 3NBHB 3RUZA 5IYCG 1YJ9A 4YWLA 2J7ZA 4EX5A 2IY5B 1ESRA 3KK7A 4HJ9A 4YHHL 2BOSA 4BA1I 2SDFA 1PZKD 2BDOA 5M5YH 1MBYA 2E75C 1LT6D 5FLMH 3H15A 1PFNA 2OF1A 3K58A 4DV1L 3GTPH 3GP7A 3S1RB 3I3CA 1AEXA 2K03A 3MXNA 3B6YA 4OEMB 2A6EC 2F0EA 5M3FG 2NVXH 4DV0Q 4JK1C 2R92B 1TR5A 3TP8A 2Y0SE 5GQOA 1NMGA 2RA4A 4KK7A 3P20A 4JI0Q 2UUBQ 2F0KA 4HJ5A 1YBYA 4R4QA 4RFBA 5IWAL 1WTVA 1GHKA 4KJOA 2B2VA 3JAML 1XMOQ 3CF5A 1EY0A 2K33A 3S9WA 4TKOB 5I4DA 5C0XI 2NTSA 5EJWA 4EQPA 1HZCA 2IT1A 3NTIA 1I5FA 1S3OA 2CH4W 4GZYC 1CKMA 3SHLA 4X3TA 3CD6A 3CRKC 4H0LC 4IUUA 4K8IA 2SNMA 1N36L 4K0KL 2EE1A 1MJEA 1VQFA 3LX0A 1V43A 2R7DA 1DOKA 2I0QA 2NVYB 4TVAB 4OONA 3TZUA 1II3A 1U5KA 5IE8A 4ID6A 3NBIA 2IX1A 5ELNA 4DR7Q 1UUPA 4AIMA 3GQBA 4PQXA 2Q8TA 4E6IA 1J8IA 4OWTB 1D1KA 2VZAA 2N3SA 3A5ZB 1TWCH 1PLFA 2EYFA 4A3DG 3ZYYX 4R8NA 4LF9L 1CI3M 2K04A 2RKSA 2E2DC 1R9TH 1FJGQ 3AMUA 3HOZG 3J81E 3NWSA 3QG1A 5E1FA 2JA8H 5I9PA 5BN3A 5A35A 1YNJD 5C4JH 3HRZC 4AH6A 2L12A 4JBKA 4X65L 1RF2D 2ENBA 4QUCA 5JPNC 4LFAL 3KF8A 1F2YA 3ZJYC 1GO3E 1HUMA 1TWAH 1OXUA 1G6ZA 2XGTA 1YNND 4XYOA 4C3IH 1JJ2A 1RTOA 3I8ZA 3KLSA 3GTGH 3RLOA 4C2MH 1BBXC 5EAYA 1I4PA 2E2IB 1BCPF 3UDXA 4XIGS 3M3YH 4FYDA 1XPRA 2GVAA 4MZ9A 3RD4A 4OELB 1TKWB 3V2TA 2P5ZX 3PQIA 4DNIA 3RN5A 1WD1A 1BBUA 2F1MA 2K4KA 1I6HH 1SE3A 2FMMA 1HPCA 2HCCA 4X66Q 4JI1Q 1MSHA 1Y1VH 5IYDH 1SE4A 1TY0A 4K5VA 2JA6G 3NP8A 3GV6A 2RVLA 4GKJL 2OTJA 1A15A 2EYPA 4P71A 1BCPC 2Q8RE 3KDFB 4OL7A 2WAQE 4DV5L 3MEFA 1YIJA 2H1EA 1LACA 4V190 2IWHA 1E7ZA 3RMHA 1KL9A 1SROA 3HOUH 1XXGA 2AKWB 4F8MA 1DJRD 3S2DH 1U4LA 3TZDA 2QA4A 4IO9A 4JI6Q 4CJ2C 2K5HA 1QILA 4ZYSA 2NN6H 1M1KC 3F2BA 2K5VA 4BBRB 2JA5H 3HOVB 1K8AC 4A3JH 5EGTA 5IGEA 3TP5A 1BVSA 2I5HA 4GKKQ 4KD4A 2VQEQ 5CV5A 2QW7A 3VR3A 4A3DB 1V9PA 3SEBA 3ND8A 2TMPA 2CKZB 3K5NA 4X6AH 3M7GA 2JK8A 3FEWX 4ME3A 4PZ7A 2EVBA 3MEHA 1SJED 4JCVE 1HH2P 3S17B 1XYIA 3R2TA 4GOPA 2V1CC 4KY7A 2AUKA 5CC4A 3I4MH 3K7AH 3PIPA 1I4GA 2DJGC 1SRUA 3PO2G 4DFAA 5GADC 4RH6A 1QZHA 4BXXH 2G9DA 1E2ZA 5KEEA 2QEJC 2EPBA 3DWAA 1I4RA 1TS5A 4A75A 2KENA 4YWMA 2EDGA 3L7ZC 2JA9A 3J7ZC 4OIJA 1K3RA 3CQZB 3ERSX 3DWPA 3WOEA 4A3FG 1IL2A 1CFMA 1IBKL 3C46A 2HHHQ 4FF1A 5GROA 2Z4HA 1L0YB 1J6QA 4FXGC 1LTBD 1B3AA 1KIXA 4KKTA 5C44G 4LF7L 1N32L 1STEA 4X3UA 3RZDB 2JE6I 1L0XB 1VQMA 2KECA 2BDNA 1PV4A 2QF7A 4BA2I 3T1HL 3A8IE 2MP1A 1WCMH 5JEAJ 4Q5VA 2M9VA 3NPPA 3NTKA 1GUTA 5K36H 3HOXH 3TP7A 3TDQA 1Z9FA 1PRTF 4X64L 1ICFB 1IBML 3L0OA 2R7FA 4C1NK 1PDQA 5FLMG 3EFXD 3MXNB 4LW1A 1N33L 1H9SA 1S5ED 1PHJA 1SYBA 1TY2A 1TIID 4A3CG 4DV4Q 3TS2A 2EYHA 5K5PA 3Q8DA 3RZOB 3GTJH 2KHJA 3SVMA 4O42A 3D6CA 3GTKB 1IKLA 3I7FA 1SR3A 1ENAA 3AYHB 4L5QA 4R4IA 3J80c 3A7AB 4B3ML 4HCEA 3J81L 1PRTC 4IFDH 5FK9C 1HR0L 2F0SA 2F4VQ 5C5LA 1UE5A 1KDAA 2AMCB 1MGSA 1TWGB 2HUGA 3LWUA 1K0RA 3TBIB 2CW0D 2WFWA 2QKIC 4BY7H 2UUCL 1SLJA 1WTWA 1E1TA 3H94A 4HR7B 1CKOA 4R4CA 4X3SA 3R3OA 2KOLA 3F1ZA 4YY3Q 2A68C 1IYVA 3EQLC 1EY7A 1M4VA 3PUWA 2XNAC 4DR3L 4DK6C 2UU9L 5DLQE 4IALA 1IBLQ 2AUJD 1EWIA 1F2MA 4UDUC 4O1NA 3W1BA 3DXJC 2R6GA 2RCFA 3VYUA 3RN2A 2F4IA 3GTMB 1WJJA 4QQBX 4A3FB 1VQ7A 1F9SA 4KI0A 4PMWA 1C48A 3Q23A 4GNXC 1PTOF 4HSVA 4DR6L 3NK9A 2NVTH 2VY3A 1YITA 1AZPA 5I2XA 1X3FA 3OTOQ 1VQ4A 2YTYA 3PUZA 4QB4A 5C44B 1JB7A 3I4NH 5J1ZA 2O5IC 2G9HD 1NUCA 3WWVA 2E2JB 4BS9A 2HD3A 4A3IH 4HCSA 2JA8G 3KOJA 1K73C 1N9WA 3MXPA 3T56B 4HIKA 3QOJA 2PO4A 2YU9B 1EQVA 3KF8B 1PTOC 3S1QB 1MJCA 1VQGA 2R93H 3FVQA 1IXRA 1ZYRC 2YV5A 3K81C 4RG1A 2F52A 1H95A 2AHOB 4C3IG 3NQIA 2EYLA 2QGQA 4AYBE 1I3QB 1L1OA 2YTVA 4IN3A 2CWAA 5LL6S 3PCOB 1W2BA 4N8X1 2R61A 4G7ZC 4LF5L 2HCIA 1DYQA 2XN9C 4IOAA 3MZ5A 2D5DA 5HY6A 1Q82C 2OQKA 3MTSA 1G91A 4PG3A 4YHHQ 1EWCA 1E24A 4DF7A 4S3SA 2EJGC 4Y7NH 1Y1VG 5IT9E 4JYAL 3PIP3 5IYDG 2WKCA 5JOBA 2IPKD 1X55A 3X3MA 2Z6BA 4KN7C 2AQ3B 4DUYL 1LTID 4IPCA 3HOWH 3OMCA 4DR2L 5LHY1 1VQHA 1NR4A 4KHVA 1PXUA 2XRSD 4LK1C 1SNOA 3T53B 1KRSA 1CQFA 2Y0SG 3LWEA 2AQ1B 3D4WA 1VDZA 5IWAQ 3EJIA 1G8ZD 5ISRA 3HOUG 3K59A 1ONLA 4C3JH 2B2YA 5I9OA 1H9RA 4Q0FA 3S1NH 4LUVA 1LLRD 2NN6G 2DUDA 2B2WC 4PZ6A 1GOZA 2JA5G 4DA2A 1S72A 2NZOA 1N36Q 4A3JG 1QCBD 4K0KQ 3KLRA 4EQNA 4IUQA 1XMQL 2WB1E 5KYIA 1STBA 1LUZA 4YCVA 5LMNQ 5ELDA 5IGDA 1K83H 3HKZE 2F0IA 1Y14B 3GTOB 4DAPA 4DXFA 4NXML 1R9TB 1B3QA 4GOPB 5BR8L 1ZEQX 4A93B 4HN7A 2RSOA 3I73A 3ND9A 3FPUB 3I4MG 3WDNA 3I4OA 1D1IA 3BDOA 1N34Q 3KLWA 1RJTA 1NE3A 3Q6SA 1B8AA 2K05A 2F0HA 3M4OH 3GTLH 2DY8A 3H09A 1DD2A 5IGGA 1SFOH 1QUQA 1Q8IA 3A55A 4IQZA 2MUYA 1YNXA 5DAUA 1C8CA 2KCCA 3QOLA 1UAPA 4QF4A 2MO0A 4XT3B 1XNQL 3EROA 1S5BD 4X65Q 3IFDA 3VYTA 1R4QB 1VQ9A 2GN5A 2RHQB 4JI2L 1JJCB 2UXDL 2B63H 4DK0A 1JQYD 3EVQA 5M3MH 3I90A 5C0XH 4ZUJA 2JXMB 4IPDA 2K52A 3G48A 2ZXPA 3VA5A 3G4SA 3DM3A 3SGIA 1D5ZC 1RD9D 4IUVA 1TXYA 2ID0A 4NP5A 3SK8A 5IOCA 1CA5A 1DXMA 1PYBA 1FNVA 2Y0SB 1T9HA 3E0EA 2FMCA 3HOXG 1JWUD 2AWOA 3V96A 1HFGA 4XDXA 1P16A 1UNSA 5CYUA 1H9SB 5M5WH 2N55A 3OW2A 3S2DB 4CDDC 1EQRA 3H3VC 1FGUA 3S15B 2E2HH 4OO1H 1Q86C 2OEOA 1R4PB 2Q8IB 2WV6D 2A74C 4BBSH 4DV2L 1I50B 5FJ8G 4ALPA 1VQLA 3L3OC 3BDCA 3LGJA 3PF5A 1Y69U 3VYSA 2HQLA 1Z6HA 3E9IA 4LF6Q 1ET6A 3CCVA 1SE2A 1CKNB 1T5EA 5E7NA 4IFDG 1A62A 4C3HB 1X9NA 3MWYW 3HOYH 1B44D 2N88A 3CHBD 1UEAB 4BY7G 4DN4M 2HQEA 2C9OA 2D62A 4OIKA 1F2LA 1ZKOA 3NUCA 4AQYQ 3AFPA 3CKIB 1TWFH 2LSSA 5EPJA 2PI2A 3S14B 1D7QA 1B4OA 2CQAA 5EPLA 3A54A 4I7ZC 4XQNA 4GN5A 2HIVA 2UUAL 3G71A 3M4QA 1SMYC 4PMBA 3CCSA 2CCZA 3NEMA 5AJ3L 3GO5A 3VR6A 2N78A 3CCLA 5IT9L 1U4MA 4ODGA 1G51A 5G3LF 4K2KA 2A69C 3KJOA 1RIPA 3I4NG 2NVQH 4OWWB 4KJNA 3OWFA 3S2HH 3BG3A 3J80i 4A3MB 2LFNA 4DAVA 1HXYD 1V1PA 1LTRD 2OTLA 2J4XA 3I72A 4JPBW 3K57A 5HGTA 3NSWA 3OWEB 3A8KE 1IW7C 1IBKQ 3A74A 3S16H 4C56C 1RKNA 4RKBA 1GJXA 4A3EH 5JAVA 4KHZA 4WRDA 1SNQA 2HDMA 4G57A 2KHIA 3HOXB 1DM0B 2X6GA 1L1OB 3EBEA 1JWSD 3W2DA 2SOBA 1I94L 2BH8A 2Q2HA 2KCMA 4CBVA 4A3BH 1JMCA 1LV9A 3U9SA 2KHSA 3NWTA 2ZTDA 1PFMA 3DM1A 3CPWA 3T1HQ 5C3EH 5LL6X 3GTJB 2F3VA 3F2CA 1JOQA 5HGQA 4R9WA 1JWMD 1SJHD 1WVLA 1K8GA 1HTPA 2K5WA 3BS1A 1PA6A 4KHPL 2KEDA 4X64Q 4CDCC 1IBMQ 1EZ6A 2EYOA 4A3KB 3AU7A 1WTRA 1FNWA 3U58A 2A6ED 2PCFB 1N33Q 3K80C 2IHEA 5KGUA 1J9OA 1O7ZA 3L2PA 2XVSA 2EYMA 3UDIA 5CBEE 3HOWG 3PO3H 1V1QA 3P75A 3ICEA 1O7LA 3ITPA 4K6DA 4LNQA 1WTOA 1E2WA 1SAPA 1YI2A 2F03A 1KABA 4M1UB 4B3MQ 5M3FB 1L2FA 2KBNA 4ZUIA 2EY2A 2CWPA 1RODA 1OTCA 1HR0Q 4KKUA 2JP1A 1O7IA 1VQ8A 1KXLA 2VXWA 1X56A 1OXVA 1A8VA 3NQTA 1F77A 4C3JG 5IODA 5JVG3 1XNRQ 2A6HC 4JG2A 1TS3A 4DNTB 2UUCQ 4XQJA 4HSPA 2DNCA 3PF4A 1ESFA 3AB9A 5E4XA 5IY0A 4ZQ3A 4B3SL 3M4PA 3NELA 2L1BA 2NVTB 3VDYA 1IW7D 5LMUL 5J22A 2PMZE 2B2VC 4DR3Q 2UU9Q 3I56A 3GTQH 2K75A 3DEOA 4NW2A 4FXKC 2N8NA 5EBDA 5I6WA 3PUYA 2CQOA 1TVXA 3MFGA 2ASBA 1BBWA 1CHQD 2RCNA 2OCEA 1PTOH 1S5FD 1CK1A 3K0YA 1GD7A 3KFUA 3E6ZX 1QVGA 3LNNA 3SDZA 2PZUA 1SN8A 2C35B 2NWGA 3O13A 4HEDA 5IP9G 1QUQB 1D8LA 5GAGC 3A0JA 2QDLA 4LF8L 3SE0A 2CHBD 4DUZL 3TMEA 2GA4B 3STBC 1A0IA 2FXQA 5FLXc 3VR4A 2LXJA 1CTMA 2IW3A 4K5XA 4UHVA 2RHSB 2WACA 5D14A 4HJ8A 3J7AF 1XX8A 2K28A 1K9MC 3AEVA 3FKIG 4A3GH 2SNSA 2JA7G 3HOZB 1HFNA 5CMDA 2OXPA 1PH2A 3IAYA 5FO9B 3BZKA 1Y1WH 2B63G 4HIDA 1OXTA 4H13C 4FF3A 1EY9A 4FNFA 5DEHA 4A76A 1ENCA 5M3MG 1SEBD 4AYBG 4JI8L 5C0XG 1F9QA 1LT3D 1MHWC 2RDFA 1BR9A 4ULLA 1GUGA 4BY1H 4FO2A 3C1EA 2HT1A 4DR5L 2LMCB 2PNRC 3KF6A 3QJYA 3CXCA 1EQTA 1A3UA 2UUBL 4XTCS 1GHJA 1XMOL 1HZAA 3TP6A 4JYAQ 2R7ZH 1YHQA 3S1RH 1BCPD 4DUYQ 4OO1G 4JVZA 3SR1A 4BBSG 4DR2Q 1L0WA 4YIJA 1PH7A 1I4HA 4GNXA 2UXCL 1CT1D 2JA6B 4DV7L 5GAEC 1JICA 1CQVA 3U9OA 4POGA 5CR3A 4DV6L 1E2VA 1VQ5A 3GV3A 2PQAA 1KHIA 2QDBA 3TS0A 4LFBQ 2NBFA 3HOYG 2MPMA
chains in the Genus database with same CATH topology
3RNUA 4Y7NH 1Y1VG 2ALYB 4JYAL 5IYDG 1JE5A 1X55A 2EIFA 4H02A 4DUYL 4DR1Q 2VNUD 1XMQQ 4NPSA 4JBMA 3S1MH 2E5LL 4IPCA 1VQAA 4JI4Q 3HOWH 1UEBA 4DR2L 4QIWE 1VQHA 5LMNW 1HNXQ 4O2DA 3BZCA 1MIUA 2MO1A 1KRSA 4NXMQ 3TQYA 2Y0SG 3D0FA 3HKZG 4DPGA 2NZHA 4P74A 4A3KG 2EXDA 5IWAQ 3I2ZA 4QY7A 4OXPA 4L5RC 1EUJA 1NBWA 3W5OA 3S1QH 3HOUG 1FVIA 1Q46A 4IPGA 3ULLA 1A63A 1G6PA 2JJQA 3NBHB 1E1OA 1CKNA 5IYCG 1YJ9A 4YWLA 4C3JH 4LF4Q 4B3RL 4EX5A 2IY5B 4DR6Q 1C9OA 4HJ9A 4YHHL 2ZM6L 1U0LA 3S1NH 2IHFA 4BA1I 4LUVA 2KCTA 3CC2A 5M5YH 2NN6G 3UE1A 5FLMH 3H15A 2DUDA 4PZ6A 4DV1L 3GTPH 2JA5G 1S72A 2NZOA 1N36Q 4A3JG 4K0KQ 4DR1L 1XMQL 3M9BA 3H0GG 2WB1E 3B6YA 5M3FG 1HNZQ 2NVXH 1LUZA 4DV0Q 4JI4L 3JC66 4YCVA 5LMNQ 2Y0SE 1K83H 3HKZE 5GQOA 3I55A 1NMGA 4LF6L 1Y14B 4HJ7A 5JJLA 1HNXL 1XNQQ 1Q81C 4JI0Q 4NXML 2UUBQ 3U4VA 4HJ5A 1YBYA 4GOPB 4R4QA 5IWAL 5BR8L 3W1GA 4A3EG 5IYCH 3CF5A 1XMOQ 3J7A5 3S15H 2MQHA 5C0XI 1VQIA 4JI2Q 3I4MG 3I4OA 2UXDQ 1PFSA 1HZCA 1B70B 2IT1A 1I5FA 2N49A 4IPHA 4JI1L 1VQBA 2D0OA 1S3OA 1NMFA 3KJPA 1I50H 1VQOA 1CUKA 1CKMA 1N34Q 3KLWA 3PGZA 3H3VH 1YJNA 1X54A 1NE3A 3CD6A 1B8AA 3D31A 1SE8A 4O0AA 1Q7YC 3M4OH 3GTLH 2Q2IA 1N36L 1LYLA 4K0KL 1MJEA 2VUMH 1VQFA 1V43A 1SFOH 1QUQA 2R7DA 3EIVA 3PSIA 5C3EG 1OXXK 3BJUA 3ULJA 4DV0L 3JAMc 4AQYL 1HNZL 1YNXA 4C3HH 2I0QA 4LF5Q 4TVAB 1NY4A 2AWNA 1X65A 2Z6KA 4OONA 5IP7H 3K8AA 2MO0A 1XNQL 3TEHB 1U5KA 4P73A 5IE8A 5IT9c 4JI0L 4DV3Q 1X6OA 2IX1A 4X65Q 5ELNA 5J3BA 4DR7Q 1E22A 4AIMA 4P72A 4R1JA 4IOCA 1AE3A 2GN5A 1VQ9A 2RHQB 4JI2L 1JJCB 5GAHC 2UXDL 2B63H 2YYZA 4OWTB 3PUVA 4JOIA 2VZAA 2R92H 3PO3G 4IFDJ 2N3SA 2E8GA 1VQCA 3A5ZB 5M3MH 3S14H 1TWCH 3UDFA 3CCJA 4A3DG 1UE7A 4DR4Q 4LF9L 1WFQA 4IPDA 4GKKL 1Q1EA 2K52A 3G48A 4IJLA 4A3LH 1PH4A 3G4SA 3DM3A 3SGIA 1R9TH 1FJGQ 1JT8A 3E9HA 3HOZG 1TXYA 4HJAA 2ID0A 2JA8H 1PYBA 3GDEA 1T9HA 3E0EA 5C4JH 3HOXG 1XTDA 4AH6A 3CMAA 2AWOA 4DV3L 4JBKA 1P16A 1WOCA 4X65L 4BBRH 5M5WH 3OW2A 4DR7L 4LFAL 3HOVH 3NENA 3ZJYC 1GO3E 4LUOA 1EQRA 1FGUA 3EN2A 4LUZA 1TWAH 1OXUA 2WP8J 3STBD 2XGTA 4A3MH 2VS1A 2E2HH 4DV1Q 1Q86C 4C3IH 3CCRA 1JJ2A 4BBSH 2EQSA 4GN4B 4QL5A 3GTGH 4DV2L 3RLOA 5FJ8G 2VW9A 4C2MH 4ALPA 3CP0A 1VQLA 4A3DH 1VQJA 1X3EA 5EAYA 4DK3C 2QEXA 3LGJA 1VQEA 3PF5A 4P75A 2HQLA 4PZ8A 1C7YA 2NVYH 3UDXA 4XIGS 3E9IA 3M3YH 4LF6Q 2WB1G 1XPRA 2GVAA 1VQKA 4DR4L 4MZ9A 3CCVA 3S17H 1W3SA 1CKNB 1CSPA 2IX0A 5E7NA 2NN6I 1FJGL 1HZBA 4DNIA 3RN5A 5BR8Q 1BBUA 4IFDG 1A62A 1X9NA 1TWHH 2K4KA 1I6HH 1AH9A 3HOYH 3CPFA 4X66Q 4X62Q 2VQFQ 4JI1Q 1Y1VH 1J5EQ 4BY7G 3ER0A 5IYDH 2Z0SA 1C0AA 2JA6G 2K5NA 1XPOA 1PH1A 5FJ8H 4GKJL 2OTJA 1HJPA 4JV5Q 2D62A 4P71A 5ELOA 3KDFB 4UP9A 4POFA 1PH9A 3CQZH 2WAQE 2I5LX 1CSQA 2RF4A 2BA1A 1KRTA 4DV5L 3AFPA 3MEFA 4AQYQ 1YIJA 1TWFH 2LSSA 1YHAA 4GOPC 2PI2A 4GLAC 1D7QA 3RLNA 3ULPA 3FHWA 4A3KH 2ZTCA 1E7ZA 2F3IA 1KD1C 4A3GG 1GVPA 1KL9A 1SROA 3TREA 3HOUH 1PH6A 2AKWB 4JC0A 2BH2A 1GKHA 4GN5A 2UXBQ 3S2DH 2HIVA 2UUAL 3G71A 3M4QA 1XNRL 2CCZA 3CCSA 2QA4A 3NEMA 1I94Q 4IO9A 3K0XA 4X66L 4X62L 5AJ3L 3GO5A 2VQFL 4JI6Q 2K5HA 2N78A 3CCMA 1M1KC 1EYGA 3CCLA 2Q2TA 1LTLA 3CAMA 4FDBA 2LXKA 3F2BA 1G51A 2K5VA 1J5EL 1ASZA 4WJ4A 3KJOA 1RIPA 1Z47A 2JA5H 3TRZA 3I4NG 1K8AC 1Q8KA 4A3JH 4OWWB 2NVQH 4BXXG 2E2IH 4YCUA 4HIOA 4A3BG 1BVSA 3H0GH 3KF6B 3J80i 1VQPA 2I5HA 2OWOA 4BY1G 4LF9Q 5M3FH 4GKKQ 4JV5L 3CCEA 2OTLA 2D0PA 2VQEQ 2ZJQA 1NJIC 4LFCQ 1V9PA 2VL6A 3U50C 2ATWA 4X6AH 2CKZB 4KHPQ 2JK8A 4ME3A 4B3TQ 4PZ7A 3RR5A 3AFQA 1IBKQ 3A74A 3S16H 4JCVE 1VQNA 1HH2P 4A3EH 4KHZA 2R7ZG 4GOPA 2V1CC 1RL2A 3I4MH 2KHIA 2YTXA 3K7AH 4IJHA 4JI5Q 4LFAQ 2UXBL 3PIPA 2PI2E 1L1OB 3EBEA 1SRUA 3PO2G 1I94L 4OX9Q 2BH8A 5GADC 4GNXB 4UP8A 3J81i 4JI6L 4BXXH 4TQUS 2Q2HA 1QZHA 1KC8C 3RZOH 2KCMA 1VQ6A 4DV2Q 2GVBA 1WI5A 1JMCA 3GTKH 4A3BH 1YZ6A 4A75A 2KENA 4YWMA 3S2HH 2ZTDA 2ES2A 3L7ZC 2JA9A 3J7ZC 3T1HQ 3CPWA 1QZGA 5C3EH 1K3RA 4A93G 3F2CA 3PIOA 2VQEL 5HGQA 3ERSX 3DLLA 2PQAB 4LFCL 1YEZA 4A3FG 1K8GA 1IL2A 1PA6A 4KHPL 1TWGH 1VCIA 5IYBG 2HIXA 1UE6A 1WCMG 4B3TL 4X64Q 2JQOA 1IBMQ 1IBKL 2ZJPA 2HHHQ 5K36G 3HFZB 2H5XA 5GROA 1Q1BA 4JBJA 3U58A 1VS0A 3CW2C 1EFWA 1J6QA 1HZ9A 4B3SQ 1N33Q 1DGSA 3K80C 2IHEA 4JI5L 1KIXA 5C44G 5LMUQ 4LF7L 3L2PA 3U4ZA 2ZM6Q 4MTNA 3UDIA 1N32L 4OX9L 5H1SE 4YCWA 3CMEA 4NXNQ 3HOWG 4GKJQ 4L5TA 3PO3H 1V1QA 1X3GA 2JE6I 3M85A 4IFDI 3ICEA 4GN3B 1YHBA 3HKSA 1VQMA 4LNQA 1BKBA 1LM0A 4DV5Q 1YI2A 1PV4A 3GTMH 4BA2I 2WAQG 3T1HL 1EIFA 4B3MQ 1L2FA 2KBNA 3HOZH 4APVA 2CWPA 5JEAJ 1WCMH 1OTCA 4R4TA 1HR0Q 4DKAC 1O7IA 5M5XH 1VQ8A 1KXLA 1B7YB 3HOXH 1X56A 1OXVA 1G291 1A8VA 1Z9FA 1QVCA 4X64L 1XNRQ 3FP9A 2XTIA 2B3GA 4JG2A 1IBML 2UUAQ 3L0OA 1PYSB 2R7FA 3GD7A 1WYDA 2HHHL 2UUCQ 4JI7Q 5C44H 5AJ3Q 3PF4A 5FLMG 3OYYA 5IY0A 3MXNB 4LW1A 4B3SL 5C4XH 3M4PA 1N33L 1IZ6A 3NELA 4YWKA 1PHJA 4LF8Q 3VDYA 4QJFA 5LMUL 2E2JH 2PMZE 4DUZQ 3PV0A 4A3CG 4DV4Q 3TS2A 3UDGA 1VQDA 1ASYA 4NXNL 3F8TA 4DR3Q 2UU9Q 3I56A 3Q8DA 2K75A 3GTJH 3BU2A 2KHJA 3F2DA 3GTQH 1JJGA 3I7FA 1SR3A 3T1YQ 1EOVA 3H3VI 3AYHB 2YU9H 5JJIA 4L5QA 2N8NA 2ZTEA 2B29A 4R4IA 4OWXB 4A4IA 3J80c 1M90C 3PUYA 4B3ML 4L5SA 2CQOA 4NB3A 5C0XJ 2ASBA 4LFBL 1BBWA 1HR0L 2F4VQ 2A8VA 2K50A 2OCEA 1UE5A 2RCNA 3A5UA 2AMCB 3PUXA 1K0RA 1I3QH 1Y1WG 2BA0A 2WFWA 1N8RC 1GD7A 3KFUA 4BY7H 3J81j 1QVGA 2UUCL 4JI7L 1SLJA 1MKHA 2Z6KC 3RZDH 1E1TA 4JI8Q 1SN8A 2C35B 5JEAG 2JA6H 1HNWQ 5IP9G 1CKOA 1E3PA 4R4CA 1GM5A 4A3CH 1QUQB 1D8LA 4RMFA 3A0JA 5GAGC 3CC7A 4LF8L 4UY8C 3UE0A 4DR5Q 2VUMG 3CCUA 3F1ZA 4YY3Q 4DUZL 3STBC 4GS3A 4DV4L 1FL0A 3PUWA 3J81c 1A0IA 4DR3L 2FXQA 4DK6C 3KDFA 5DLQE 5FLXc 2UU9L 4MNOA 1IBLQ 2LXJA 4A3IG 1EWIA 3M7NA 5IP7G 2RHSB 3T1YL 3W1BA 4JBWA 4HJ8A 2R6GA 1PH5A 4JOIC 4JI3Q 1K9MC 3RN2A 3FKIG 3AEVA 1EQQA 4DAMA 1WJJA 4A3GH 2JA7G 4QQBX 1PVOA 1L1OC 1VQ7A 4KI0A 4PMWA 1PH2A 4LF4L 4GNXC 4DR6L 1Y1WH 3BZKA 2R93G 2OQ0A 2L15A 2F4VL 2B63G 4HIDA 2NVTH 2JEAI 1XPUA 2PNHA 3S24A 1OXTA 1UWVA 1EIYB 2VY3A 1YITA 4LF7Q 3KYHC 5IP9H 1N32Q 1X3FA 3OTOQ 4R4OA 1VQ4A 4A76A 2YTYA 3PUZA 2R92G 5M3MG 2UXCQ 1IYJB 4AYBG 4GLVB 4JI8L 1JB7A 5C0XG 3I4NH 1HNWL 1PH8A 4Y52H 4DV7Q 5LMNL 4A3LG 4BY1H 1XJVA 2HT1A 3WWVA 4DR5L 3RLFA 2CFMA 4EQ5A 4YY3L 1NTGA 3KF6A 3CCQA 4DV6Q 4A3IH 4UP7A 4OO1I 3CXCA 4WJ3M 2JA8G 3KOJA 1K73C 1N9WA 5C4XG 1P8LA 2UUBL 1IBLL 4HIKA 3FKIH 3AQQA 2I5MX 4GLXA 2JA7H 4XTCS 4LWCA 4KLKA 1AE2A 3IRBA 3KF8B 1XMOL 1HZAA 2K14A 3CC4A 1MJCA 1VQGA 4JI3L 1Q12A 1HR0W 3G6EA 2Q2UA 4JYAQ 2R93H 4BBRG 2R7ZH 1YHQA 3S1RH 3HOVG 3K81C 1IXRA 2YV5A 4DAYB 4J15A 1KAWA 4RG1A 2ZJRA 4DUYQ 2F52A 1OXSC 1H95A 2AHOB 4A3MG 2E5LQ 3PO2H 4OO1G 4QGUA 1N34L 1YVCA 1KQSA 2DGYA 2QGQA 3K7UC 4AYBE 1PH3A 4BBSG 4DR2Q 2YTVA 1L1OA 1L0WA 3JAMi 2CWAA 2MNAA 1PH7A 3OTOL 4GNXA 3GTOH 2UXCL 4HIMA 2MFIA 3PCOB 1W2BA 4DV7L 5JJKA 1SMXA 4UPAA 1UE1A 1YJWA 1S40A 5GAEC 4A93H 4LF5L 4POGA 4IOAA 4DV6L 2JEBI 5HY6A 1Q82C 2OQKA 4A3FH 1VQ5A 1QVFA 2A19A 2A1AA 4PG3A 5IYBH 4B3RQ 2PQAA 1KHIA 3TS0A 4LFBQ 4YHHQ 3HOYG 1E24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNU A;  4Y7N H;  1Y1V G;  2ALY B;  4JYA L;  5IYD G;  1JE5 A;  1X55 A;  2EIF A;  4H02 A;  4DUY L;  4DR1 Q;  2VNU D;  1XMQ Q;  4NPS A;  4JBM A;  3S1M H;  2E5L L;  4IPC A;  1VQA A;  4JI4 Q;  3HOW H;  1UEB A;  4DR2 L;  4QIW E;  1VQH A;  5LMN W;  1HNX Q;  4O2D A;  3BZC A;  1MIU A;  2MO1 A;  1KRS A;  4NXM Q;  3TQY A;  2Y0S G;  3D0F A;  3HKZ G;  4DPG A;  2NZH A;  4P74 A;  4A3K G;  2EXD A;  5IWA Q;  3I2Z A;  4QY7 A;  4OXP A;  4L5R C;  1EUJ A;  1NBW A;  3W5O A;  3S1Q H;  3HOU G;  1FVI A;  1Q46 A;  4IPG A;  3ULL A;  1A63 A;  1G6P A;  2JJQ A;  3NBH B;  1E1O A;  1CKN A;  5IYC G;  1YJ9 A;  4YWL A;  4C3J H;  4LF4 Q;  4B3R L;  4EX5 A;  2IY5 B;  4DR6 Q;  1C9O A;  4HJ9 A;  4YHH L;  2ZM6 L;  1U0L A;  3S1N H;  2IHF A;  4BA1 I;  4LUV A;  2KCT A;  3CC2 A;  5M5Y H;  2NN6 G;  3UE1 A;  5FLM H;  3H15 A;  2DUD A;  4PZ6 A;  4DV1 L;  3GTP H;  2JA5 G;  1S72 A;  2NZO A;  1N36 Q;  4A3J G;  4K0K Q;  4DR1 L;  1XMQ L;  3M9B A;  3H0G G;  2WB1 E;  3B6Y A;  5M3F G;  1HNZ Q;  2NVX H;  1LUZ A;  4DV0 Q;  4JI4 L;  3JC6 6;  4YCV A;  5LMN Q;  2Y0S E;  1K83 H;  3HKZ E;  5GQO A;  3I55 A;  1NMG A;  4LF6 L;  1Y14 B;  4HJ7 A;  5JJL A;  1HNX L;  1XNQ Q;  1Q81 C;  4JI0 Q;  4NXM L;  2UUB Q;  3U4V A;  4HJ5 A;  1YBY A;  4GOP B;  4R4Q A;  5IWA L;  5BR8 L;  3W1G A;  4A3E G;  5IYC H;  3CF5 A;  1XMO Q;  3J7A 5;  3S15 H;  2MQH A;  5C0X I;  1VQI A;  4JI2 Q;  3I4M G;  3I4O A;  2UXD Q;  1PFS A;  1HZC A;  1B70 B;  2IT1 A;  1I5F A;  2N49 A;  4IPH A;  4JI1 L;  1VQB A;  2D0O A;  1S3O A;  1NMF A;  3KJP A;  1I50 H;  1VQO A;  1CUK A;  1CKM A;  1N34 Q;  3KLW A;  3PGZ A;  3H3V H;  1YJN A;  1X54 A;  1NE3 A;  3CD6 A;  1B8A A;  3D31 A;  1SE8 A;  4O0A A;  1Q7Y C;  3M4O H;  3GTL H;  2Q2I A;  1N36 L;  1LYL A;  4K0K L;  1MJE A;  2VUM H;  1VQF A;  1V43 A;  1SFO H;  1QUQ A;  2R7D A;  3EIV A;  3PSI A;  5C3E G;  1OXX K;  3BJU A;  3ULJ A;  4DV0 L;  3JAM c;  4AQY L;  1HNZ L;  1YNX A;  4C3H H;  2I0Q A;  4LF5 Q;  4TVA B;  1NY4 A;  2AWN A;  1X65 A;  2Z6K A;  4OON A;  5IP7 H;  3K8A A;  2MO0 A;  1XNQ L;  3TEH B;  1U5K A;  4P73 A;  5IE8 A;  5IT9 c;  4JI0 L;  4DV3 Q;  1X6O A;  2IX1 A;  4X65 Q;  5ELN A;  5J3B A;  4DR7 Q;  1E22 A;  4AIM A;  4P72 A;  4R1J A;  4IOC A;  1AE3 A;  2GN5 A;  1VQ9 A;  2RHQ B;  4JI2 L;  1JJC B;  5GAH C;  2UXD L;  2B63 H;  2YYZ A;  4OWT B;  3PUV A;  4JOI A;  2VZA A;  2R92 H;  3PO3 G;  4IFD J;  2N3S A;  2E8G A;  1VQC A;  3A5Z B;  5M3M H;  3S14 H;  1TWC H;  3UDF A;  3CCJ A;  4A3D G;  1UE7 A;  4DR4 Q;  4LF9 L;  1WFQ A;  4IPD A;  4GKK L;  1Q1E A;  2K52 A;  3G48 A;  4IJL A;  4A3L H;  1PH4 A;  3G4S A;  3DM3 A;  3SGI A;  1R9T H;  1FJG Q;  1JT8 A;  3E9H A;  3HOZ G;  1TXY A;  4HJA A;  2ID0 A;  2JA8 H;  1PYB A;  3GDE A;  1T9H A;  3E0E A;  5C4J H;  3HOX G;  1XTD A;  4AH6 A;  3CMA A;  2AWO A;  4DV3 L;  4JBK A;  1P16 A;  1WOC A;  4X65 L;  4BBR H;  5M5W H;  3OW2 A;  4DR7 L;  4LFA L;  3HOV H;  3NEN A;  3ZJY C;  1GO3 E;  4LUO A;  1EQR A;  1FGU A;  3EN2 A;  4LUZ A;  1TWA H;  1OXU A;  2WP8 J;  3STB D;  2XGT A;  4A3M H;  2VS1 A;  2E2H H;  4DV1 Q;  1Q86 C;  4C3I H;  3CCR A;  1JJ2 A;  4BBS H;  2EQS A;  4GN4 B;  4QL5 A;  3GTG H;  4DV2 L;  3RLO A;  5FJ8 G;  2VW9 A;  4C2M H;  4ALP A;  3CP0 A;  1VQL A;  4A3D H;  1VQJ A;  1X3E A;  5EAY A;  4DK3 C;  2QEX A;  3LGJ A;  1VQE A;  3PF5 A;  4P75 A;  2HQL A;  4PZ8 A;  1C7Y A;  2NVY H;  3UDX A;  4XIG S;  3E9I A;  3M3Y H;  4LF6 Q;  2WB1 G;  1XPR A;  2GVA A;  1VQK A;  4DR4 L;  4MZ9 A;  3CCV A;  3S17 H;  1W3S A;  1CKN B;  1CSP A;  2IX0 A;  5E7N A;  2NN6 I;  1FJG L;  1HZB A;  4DNI A;  3RN5 A;  5BR8 Q;  1BBU A;  4IFD G;  1A62 A;  1X9N A;  1TWH H;  2K4K A;  1I6H H;  1AH9 A;  3HOY H;  3CPF A;  4X66 Q;  4X62 Q;  2VQF Q;  4JI1 Q;  1Y1V H;  1J5E Q;  4BY7 G;  3ER0 A;  5IYD H;  2Z0S A;  1C0A A;  2JA6 G;  2K5N A;  1XPO A;  1PH1 A;  5FJ8 H;  4GKJ L;  2OTJ A;  1HJP A;  4JV5 Q;  2D62 A;  4P71 A;  5ELO A;  3KDF B;  4UP9 A;  4POF A;  1PH9 A;  3CQZ H;  2WAQ E;  2I5L X;  1CSQ A;  2RF4 A;  2BA1 A;  1KRT A;  4DV5 L;  3AFP A;  3MEF A;  4AQY Q;  1YIJ A;  1TWF H;  2LSS A;  1YHA A;  4GOP C;  2PI2 A;  4GLA C;  1D7Q A;  3RLN A;  3ULP A;  3FHW A;  4A3K H;  2ZTC A;  1E7Z A;  2F3I A;  1KD1 C;  4A3G G;  1GVP A;  1KL9 A;  1SRO A;  3TRE A;  3HOU H;  1PH6 A;  2AKW B;  4JC0 A;  2BH2 A;  1GKH A;  4GN5 A;  2UXB Q;  3S2D H;  2HIV A;  2UUA L;  3G71 A;  3M4Q A;  1XNR L;  2CCZ A;  3CCS A;  2QA4 A;  3NEM A;  1I94 Q;  4IO9 A;  3K0X A;  4X66 L;  4X62 L;  5AJ3 L;  3GO5 A;  2VQF L;  4JI6 Q;  2K5H A;  2N78 A;  3CCM A;  1M1K C;  1EYG A;  3CCL A;  2Q2T A;  1LTL A;  3CAM A;  4FDB A;  2LXK A;  3F2B A;  1G51 A;  2K5V A;  1J5E L;  1ASZ A;  4WJ4 A;  3KJO A;  1RIP A;  1Z47 A;  2JA5 H;  3TRZ A;  3I4N G;  1K8A C;  1Q8K A;  4A3J H;  4OWW B;  2NVQ H;  4BXX G;  2E2I H;  4YCU A;  4HIO A;  4A3B G;  1BVS A;  3H0G H;  3KF6 B;  3J80 i;  1VQP A;  2I5H A;  2OWO A;  4BY1 G;  4LF9 Q;  5M3F H;  4GKK Q;  4JV5 L;  3CCE A;  2OTL A;  2D0P A;  2VQE Q;  2ZJQ A;  1NJI C;  4LFC Q;  1V9P A;  2VL6 A;  3U50 C;  2ATW A;  4X6A H;  2CKZ B;  4KHP Q;  2JK8 A;  4ME3 A;  4B3T Q;  4PZ7 A;  3RR5 A;  3AFQ A;  1IBK Q;  3A74 A;  3S16 H;  4JCV E;  1VQN A;  1HH2 P;  4A3E H;  4KHZ A;  2R7Z G;  4GOP A;  2V1C C;  1RL2 A;  3I4M H;  2KHI A;  2YTX A;  3K7A H;  4IJH A;  4JI5 Q;  4LFA Q;  2UXB L;  3PIP A;  2PI2 E;  1L1O B;  3EBE A;  1SRU A;  3PO2 G;  1I94 L;  4OX9 Q;  2BH8 A;  5GAD C;  4GNX B;  4UP8 A;  3J81 i;  4JI6 L;  4BXX H;  4TQU S;  2Q2H A;  1QZH A;  1KC8 C;  3RZO H;  2KCM A;  1VQ6 A;  4DV2 Q;  2GVB A;  1WI5 A;  1JMC A;  3GTK H;  4A3B H;  1YZ6 A;  4A75 A;  2KEN A;  4YWM A;  3S2H H;  2ZTD A;  2ES2 A;  3L7Z C;  2JA9 A;  3J7Z C;  3T1H Q;  3CPW A;  1QZG A;  5C3E H;  1K3R A;  4A93 G;  3F2C A;  3PIO A;  2VQE L;  5HGQ A;  3ERS X;  3DLL A;  2PQA B;  4LFC L;  1YEZ A;  4A3F G;  1K8G A;  1IL2 A;  1PA6 A;  4KHP L;  1TWG H;  1VCI A;  5IYB G;  2HIX A;  1UE6 A;  1WCM G;  4B3T L;  4X64 Q;  2JQO A;  1IBM Q;  1IBK L;  2ZJP A;  2HHH Q;  5K36 G;  3HFZ B;  2H5X A;  5GRO A;  1Q1B A;  4JBJ A;  3U58 A;  1VS0 A;  3CW2 C;  1EFW A;  1J6Q A;  1HZ9 A;  4B3S Q;  1N33 Q;  1DGS A;  3K80 C;  2IHE A;  4JI5 L;  1KIX A;  5C44 G;  5LMU Q;  4LF7 L;  3L2P A;  3U4Z A;  2ZM6 Q;  4MTN A;  3UDI A;  1N32 L;  4OX9 L;  5H1S E;  4YCW A;  3CME A;  4NXN Q;  3HOW G;  4GKJ Q;  4L5T A;  3PO3 H;  1V1Q A;  1X3G A;  2JE6 I;  3M85 A;  4IFD I;  3ICE A;  4GN3 B;  1YHB A;  3HKS A;  1VQM A;  4LNQ A;  1BKB A;  1LM0 A;  4DV5 Q;  1YI2 A;  1PV4 A;  3GTM H;  4BA2 I;  2WAQ G;  3T1H L;  1EIF A;  4B3M Q;  1L2F A;  2KBN A;  3HOZ H;  4APV A;  2CWP A;  5JEA J;  1WCM H;  1OTC A;  4R4T A;  1HR0 Q;  4DKA C;  1O7I A;  5M5X H;  1VQ8 A;  1KXL A;  1B7Y B;  3HOX H;  1X56 A;  1OXV A;  1G29 1;  1A8V A;  1Z9F A;  1QVC A;  4X64 L;  1XNR Q;  3FP9 A;  2XTI A;  2B3G A;  4JG2 A;  1IBM L;  2UUA Q;  3L0O A;  1PYS B;  2R7F A;  3GD7 A;  1WYD A;  2HHH L;  2UUC Q;  4JI7 Q;  5C44 H;  5AJ3 Q;  3PF4 A;  5FLM G;  3OYY A;  5IY0 A;  3MXN B;  4LW1 A;  4B3S L;  5C4X H;  3M4P A;  1N33 L;  1IZ6 A;  3NEL A;  4YWK A;  1PHJ A;  4LF8 Q;  3VDY A;  4QJF A;  5LMU L;  2E2J H;  2PMZ E;  4DUZ Q;  3PV0 A;  4A3C G;  4DV4 Q;  3TS2 A;  3UDG A;  1VQD A;  1ASY A;  4NXN L;  3F8T A;  4DR3 Q;  2UU9 Q;  3I56 A;  3Q8D A;  2K75 A;  3GTJ H;  3BU2 A;  2KHJ A;  3F2D A;  3GTQ H;  1JJG A;  3I7F A;  1SR3 A;  3T1Y Q;  1EOV A;  3H3V I;  3AYH B;  2YU9 H;  5JJI A;  4L5Q A;  2N8N A;  2ZTE A;  2B29 A;  4R4I A;  4OWX B;  4A4I A;  3J80 c;  1M90 C;  3PUY A;  4B3M L;  4L5S A;  2CQO A;  4NB3 A;  5C0X J;  2ASB A;  4LFB L;  1BBW A;  1HR0 L;  2F4V Q;  2A8V A;  2K50 A;  2OCE A;  1UE5 A;  2RCN A;  3A5U A;  2AMC B;  3PUX A;  1K0R A;  1I3Q H;  1Y1W G;  2BA0 A;  2WFW A;  1N8R C;  1GD7 A;  3KFU A;  4BY7 H;  3J81 j;  1QVG A;  2UUC L;  4JI7 L;  1SLJ A;  1MKH A;  2Z6K C;  3RZD H;  1E1T A;  4JI8 Q;  1SN8 A;  2C35 B;  5JEA G;  2JA6 H;  1HNW Q;  5IP9 G;  1CKO A;  1E3P A;  4R4C A;  1GM5 A;  4A3C H;  1QUQ B;  1D8L A;  4RMF A;  3A0J A;  5GAG C;  3CC7 A;  4LF8 L;  4UY8 C;  3UE0 A;  4DR5 Q;  2VUM G;  3CCU A;  3F1Z A;  4YY3 Q;  4DUZ L;  3STB C;  4GS3 A;  4DV4 L;  1FL0 A;  3PUW A;  3J81 c;  1A0I A;  4DR3 L;  2FXQ A;  4DK6 C;  3KDF A;  5DLQ E;  5FLX c;  2UU9 L;  4MNO A;  1IBL Q;  2LXJ A;  4A3I G;  1EWI A;  3M7N A;  5IP7 G;  2RHS B;  3T1Y L;  3W1B A;  4JBW A;  4HJ8 A;  2R6G A;  1PH5 A;  4JOI C;  4JI3 Q;  1K9M C;  3RN2 A;  3FKI G;  3AEV A;  1EQQ A;  4DAM A;  1WJJ A;  4A3G H;  2JA7 G;  4QQB X;  1PVO A;  1L1O C;  1VQ7 A;  4KI0 A;  4PMW A;  1PH2 A;  4LF4 L;  4GNX C;  4DR6 L;  1Y1W H;  3BZK A;  2R93 G;  2OQ0 A;  2L15 A;  2F4V L;  2B63 G;  4HID A;  2NVT H;  2JEA I;  1XPU A;  2PNH A;  3S24 A;  1OXT A;  1UWV A;  1EIY B;  2VY3 A;  1YIT A;  4LF7 Q;  3KYH C;  5IP9 H;  1N32 Q;  1X3F A;  3OTO Q;  4R4O A;  1VQ4 A;  4A76 A;  2YTY A;  3PUZ A;  2R92 G;  5M3M G;  2UXC Q;  1IYJ B;  4AYB G;  4GLV B;  4JI8 L;  1JB7 A;  5C0X G;  3I4N H;  1HNW L;  1PH8 A;  4Y52 H;  4DV7 Q;  5LMN L;  4A3L G;  4BY1 H;  1XJV A;  2HT1 A;  3WWV A;  4DR5 L;  3RLF A;  2CFM A;  4EQ5 A;  4YY3 L;  1NTG A;  3KF6 A;  3CCQ A;  4DV6 Q;  4A3I H;  4UP7 A;  4OO1 I;  3CXC A;  4WJ3 M;  2JA8 G;  3KOJ A;  1K73 C;  1N9W A;  5C4X G;  1P8L A;  2UUB L;  1IBL L;  4HIK A;  3FKI H;  3AQQ A;  2I5M X;  4GLX A;  2JA7 H;  4XTC S;  4LWC A;  4KLK A;  1AE2 A;  3IRB A;  3KF8 B;  1XMO L;  1HZA A;  2K14 A;  3CC4 A;  1MJC A;  1VQG A;  4JI3 L;  1Q12 A;  1HR0 W;  3G6E A;  2Q2U A;  4JYA Q;  2R93 H;  4BBR G;  2R7Z H;  1YHQ A;  3S1R H;  3HOV G;  3K81 C;  1IXR A;  2YV5 A;  4DAY B;  4J15 A;  1KAW A;  4RG1 A;  2ZJR A;  4DUY Q;  2F52 A;  1OXS C;  1H95 A;  2AHO B;  4A3M G;  2E5L Q;  3PO2 H;  4OO1 G;  4QGU A;  1N34 L;  1YVC A;  1KQS A;  2DGY A;  2QGQ A;  3K7U C;  4AYB E;  1PH3 A;  4BBS G;  4DR2 Q;  2YTV A;  1L1O A;  1L0W A;  3JAM i;  2CWA A;  2MNA A;  1PH7 A;  3OTO L;  4GNX A;  3GTO H;  2UXC L;  4HIM A;  2MFI A;  3PCO B;  1W2B A;  4DV7 L;  5JJK A;  1SMX A;  4UPA A;  1UE1 A;  1YJW A;  1S40 A;  5GAE C;  4A93 H;  4LF5 L;  4POG A;  4IOA A;  4DV6 L;  2JEB I;  5HY6 A;  1Q82 C;  2OQK A;  4A3F H;  1VQ5 A;  1QVF A;  2A19 A;  2A1A A;  4PG3 A;  5IYB H;  4B3R Q;  2PQA A;  1KHI A;  3TS0 A;  4LFB Q;  4YHH Q;  3HOY G;  1E24 A; 
#chains in the Genus database with same CATH topology
 2ALY B;  4G7H C;  3T51 B;  1AW7 A;  2B2T C;  1LT4 D;  4H02 A;  2IJ0 A;  1XMQ Q;  4NPS A;  4LAA A;  4K8J A;  3S1M H;  2E5L L;  1UEB A;  5EPK A;  5LMN W;  4O2D A;  2MO1 A;  4NXM Q;  4MIU A;  4DK1 A;  5A2Q E;  3HKZ G;  4K2L A;  4P74 A;  2PPB C;  3I2Z A;  2O4X A;  3N52 A;  4QY7 A;  1NBW A;  1EUJ A;  3W5O A;  3P1H A;  4K6L A;  1F9R A;  3C2P A;  1CKN A;  3NTH A;  4LF4 Q;  3FKI B;  5TSS A;  1C9O A;  2ZM6 L;  2JA7 B;  2IHF A;  1QG7 A;  1SYD A;  3UE1 A;  4IUT A;  1TS2 A;  1QWY A;  1V1P B;  3M9B A;  2WKD A;  1BUV T;  3PO2 B;  3JC6 6;  2V4D A;  4N9P A;  3MAQ A;  1A3T A;  4KV6 A;  1HUN A;  3I55 A;  1BCP B;  4HJ7 A;  5J39 A;  5KNB A;  1XNQ Q;  4FXD A;  4B9X A;  3UI2 A;  3U4V A;  2F0O A;  1BO0 A;  5KYL A;  4A3E G;  1NCV A;  5IYC H;  5DM7 3;  4WJW A;  1EEF D;  3J7A 5;  1VQI A;  4JI2 Q;  2UXD Q;  4DXG A;  1PFS A;  2DJF C;  4JI1 L;  1VQO A;  3KJP A;  1I6V C;  3OW7 A;  3H3V H;  1X54 A;  3KBG A;  5JEA H;  5FO7 B;  1SE8 A;  4O0A A;  1Q7Y C;  4PV1 C;  2PW7 A;  4HAE A;  2Q2I A;  3G6J B;  2VUM H;  3R93 A;  1EYD A;  4CJ1 B;  1PYW D;  4L63 B;  1D5X C;  3PSI A;  5C3E G;  1OXX K;  3BJU A;  1HNZ L;  2B2W A;  3JAM c;  4RGM A;  5JPM C;  4H44 C;  4NMZ A;  2K1B A;  2KQ3 A;  2Z6K A;  5IP7 H;  2QCP X;  3TEH B;  4P73 A;  5IT9 c;  1X6O A;  3J80 E;  4RHR A;  1CA6 A;  1OO9 B;  4M8A A;  4IOC A;  1STA A;  3HOY B;  5CV7 A;  1JOR A;  1G2S A;  4RWS C;  2EJF C;  3HG9 A;  2XIW A;  4NKL A;  3I4L A;  4U67 3;  4CKE A;  4JOI A;  1XTC D;  3IFT A;  3PO3 G;  5M5Y B;  2E8G A;  1QB5 D;  3CCJ A;  3GTP B;  4GKK L;  1WFQ A;  1Q1E A;  1PRT D;  3Q22 A;  4MHE A;  1PH4 A;  1Y8P B;  1JT8 A;  3E9H A;  2NVX B;  4HJA A;  1VF5 C;  4RA8 A;  5D3I B;  3GDE A;  3HKZ B;  2F0V A;  3CU7 A;  4DV3 L;  2C5C A;  1WOC A;  1TU2 B;  5JJZ A;  1GXD C;  2KUM A;  4BBR H;  3OIP A;  3DWQ A;  3HOV H;  1CZW A;  2A68 D;  4LUZ A;  2WP8 J;  5C4H A;  2VS1 A;  1CM9 A;  1EYA A;  2EY6 A;  2LS0 1;  3CCR A;  4DV1 Q;  4QL5 A;  2VW9 A;  4A3D H;  3CP0 A;  1X3E A;  2QEX A;  4DK3 C;  3E5S A;  1KLU D;  4P75 A;  4CKB A;  3EA6 A;  4PZ8 A;  2EOT A;  1AN8 A;  4DR4 L;  2DY7 A;  1VQK A;  1SXT A;  3S17 H;  5E3F A;  1W3S A;  4DGZ A;  5CBA E;  4G7O C;  2K7V A;  1QNK A;  2FIN B;  2K32 A;  4QMG A;  1TWH H;  4XXE A;  3S16 B;  2Z9H A;  3SK6 A;  3IL8 A;  2MJ8 A;  3CPF A;  5M9O A;  3A8J E;  4A3E B;  4ME5 A;  3R8B A;  1CHP D;  3SK4 A;  3ER0 A;  4CGY B;  5IGB A;  2DN8 A;  3I70 A;  3ONA B;  4R8I A;  2K5N A;  1TQO A;  4RKL A;  2XWJ B;  2L4N A;  5L37 A;  5ELO A;  5CV8 A;  1PH9 A;  4IUN A;  3CQZ H;  2CH4 A;  2RF4 A;  2BA1 A;  4KN4 C;  3MXG A;  1PTO D;  2DNE A;  2B39 A;  5CV4 A;  1TWC B;  4DNR B;  3RLN A;  3ULP A;  4IUR A;  3FHW A;  4WOR A;  1ZYR D;  3MVV A;  5C4Z A;  1KD1 C;  4A3G G;  1GVP A;  1PH6 A;  4JC0 A;  1GUN A;  2JA8 B;  2I07 B;  1PRT B;  1I94 Q;  5C4J B;  4KY5 A;  3K0X A;  2VQF L;  4X62 L;  4WFN 3;  4RGT A;  3CCM A;  1EYG A;  1HA6 A;  1LTL A;  1J5E L;  1ASZ A;  4K5W A;  2JSO A;  2VB3 X;  1Z47 A;  3PMF A;  4N8F A;  4OHJ A;  3TRZ A;  4BXX G;  1Q8K A;  2JN4 A;  1TWA B;  3KF6 B;  3H0G H;  4QUF A;  1VQP A;  5IGC A;  4BY1 G;  4LF9 Q;  4C3I B;  4CJ0 B;  4JV5 L;  3MXU A;  4IUP A;  2D0P A;  3GTG B;  1HTL D;  2ZJQ A;  4C2M B;  1NJI C;  2ICI A;  5E4W C;  4KHP Q;  1BXT A;  5A2Q L;  5KND A;  3AFQ A;  4QIW B;  4B9W A;  3M3Y B;  5I2Y A;  1SBB B;  2F0M A;  2F0T A;  1GUS A;  3E3X A;  3OMG A;  2R7Z G;  2K5Q A;  1W6J A;  4LFA Q;  3F2U A;  4ZRZ A;  2UXB L;  5DNF A;  1ILP A;  3BVZ A;  1I6H B;  3FDT A;  4J8Q A;  4GNX B;  4MTK A;  4TQU S;  3RZO H;  5I6Y A;  1VQ6 A;  1ILQ A;  1B9M A;  1Y1V B;  1WI5 A;  3GTK H;  5NUC A;  3ERQ A;  5COR A;  1HCZ A;  2ES2 A;  4XYQ A;  3D6W A;  1QZG A;  1IYU A;  1Z7T A;  3GTQ B;  1RCV D;  3DLL A;  2PQA B;  1QOH A;  1KNE A;  4LFC L;  1YEZ A;  1IL8 A;  1TWG H;  1ML0 D;  1DON A;  1UE6 A;  1WCM G;  3VA7 A;  4B3T L;  2ZJP A;  5K36 G;  3HFZ B;  5ELB A;  2H5X A;  4JBJ A;  4L6T B;  1EFW A;  4B3S Q;  3HOU B;  4QCL A;  1DGS A;  1PTO B;  4CKC A;  4ZAI A;  4JI5 L;  3D3R A;  5LMU Q;  4OX9 L;  1B1Z A;  5H1S E;  4YCW A;  3CME A;  4GKJ Q;  1D2B A;  4L5T A;  3C3L A;  3J7A V;  3Q24 A;  1X3G A;  1RDP D;  3M85 A;  5EKL A;  4HTH A;  1JOK A;  4GN3 B;  1YHB A;  3P7J A;  1BKB A;  1LM0 A;  4DV5 Q;  2JA5 B;  4A3J B;  2ICE C;  1EWH A;  5EQ0 A;  4XT1 B;  3GTM H;  2EY5 A;  2WAQ G;  3KLS X;  1EIF A;  5IGF A;  5M5X H;  1JE4 A;  4KY6 A;  1G29 1;  3DMU A;  2EY1 A;  4K14 A;  3FP9 A;  4A3G B;  1PYS B;  3GD7 A;  4EGV A;  1WYD A;  3VYR A;  5C44 H;  1V1O A;  5C4X H;  1IZ6 A;  3I4M B;  1KAA A;  3K7A B;  4LF8 Q;  5HUR A;  2E2J H;  4DUZ Q;  1RTN A;  3PV0 A;  4I7A A;  1AZQ A;  2PYK A;  3UDG A;  4NXN L;  2KVM A;  1EY6 A;  1PZJ D;  2OT2 A;  2CVR A;  4BY1 B;  1EOV A;  2YU9 H;  3A7L A;  1AFP A;  2ZTE A;  1O7Y A;  2B29 A;  4P2C B;  1DZ1 A;  5C3X A;  1G2T A;  3HGB A;  3QR8 A;  1DOM A;  5CGK A;  2LKV A;  2A8V A;  2K50 A;  3A5U A;  4EVO A;  3PUX A;  1I3Q H;  2BA0 A;  2R7Z B;  1YNJ C;  3MHB A;  2F0Q A;  4JI7 L;  4RAU C;  4JI8 Q;  4F88 A;  5JEA G;  2F0P A;  1E3P A;  1GM5 A;  4A3C H;  2BCO A;  4RMF A;  1S5D D;  4UY8 C;  3UE0 A;  4DR5 Q;  2VUM G;  4ZCK A;  3CCU A;  4GS3 A;  1FL0 A;  1YNN C;  3J81 c;  1H9M A;  2XWB B;  1O78 A;  4A3I G;  5IP7 G;  4UAI A;  4FF2 A;  3T1Y L;  4X3K A;  4JBW A;  2G5D A;  2MGS A;  5EBC A;  1PH5 A;  1I4X A;  4ZK9 B;  1WTQ A;  1Y8O B;  2TSS A;  3OPO A;  1PVO A;  1FGB D;  1WCM B;  2R93 G;  2L15 A;  4ZKC B;  1XPU A;  3S24 A;  2K5D A;  1UWV A;  1EOT A;  4LF7 Q;  3KYH C;  1N32 Q;  3QO2 A;  3NXW A;  4R4O A;  2UXC Q;  4GLV B;  4Y52 H;  1HNW L;  2RDG A;  3S1M B;  3VR5 A;  1C4Q A;  3C1F A;  1JB3 A;  1QJO A;  1X32 A;  2B2U C;  5DM6 3;  4DV7 Q;  2FJ2 A;  5LMN L;  1KNA A;  3RLF A;  2CFM A;  1NTG A;  4DV6 Q;  2PMZ B;  1SYC A;  2B8F A;  4UP7 A;  1U4P A;  4OO1 I;  1B2T A;  4WJ3 M;  4FF4 A;  3AQQ A;  2I5M X;  2WAQ B;  4GLX A;  4KMU C;  1JOO A;  1VF7 A;  3IRB A;  2K14 A;  3K5O A;  4JI3 L;  2Q2U A;  3QWN A;  5ELE A;  4BBR G;  3HOV G;  2ZJR A;  3K6O A;  3FRP B;  1OXS C;  1H9J A;  4U68 A;  5KNC A;  2E5L Q;  4QGU A;  1N34 L;  1YVC A;  2DGY A;  3K7U C;  1PH3 A;  3JAM i;  2MNA A;  5C5M A;  1H9K A;  3GTO H;  4BY7 B;  1HHV A;  1EZ8 A;  3K5M A;  4HIM A;  2MFI A;  1HQR D;  1K0S A;  2PZT A;  1DCZ A;  1SNM A;  1SMX A;  4UPA A;  1UE1 A;  5CV6 A;  4A93 H;  1SMY D;  5EKK A;  2B8G A;  3BYT B;  2A1A A;  5IYB H;  2ZM6 Q;  3OHX C;  2L11 A;  2A69 D;  1S5C D;  4IZ8 A;  3TN2 A;  3V05 A;  4ZLT F;  1PFB A;  3RNU A;  3OIQ A;  3N6R A;  3L9A X;  1EY8 A;  3D4R A;  2IL8 A;  1DOL A;  1EIH A;  1JE5 A;  3A56 A;  4PNY A;  2EIF A;  3QIA A;  5ELF A;  1K28 A;  2K6A A;  3FPP A;  3HZX A;  4MN3 A;  5D65 A;  1LTS D;  1LTT D;  1MIU A;  2VUM B;  3I4N B;  3D0F A;  2XSC A;  2X69 A;  4L5R C;  5G3L D;  3G7L A;  4A3I B;  4IPG A;  1Q46 A;  3ULL A;  1A63 A;  2NYZ D;  1G6P A;  1E1O A;  2KEE A;  5KIX A;  4B3R L;  4DR6 Q;  1U0L A;  3CC2 A;  2KCT A;  2Z4I A;  2KA7 A;  2F0D A;  2R93 B;  2ZXR A;  2O5J C;  2RDH A;  3R2I A;  4DR1 L;  3H0G G;  1SDF A;  1HNZ Q;  5F2D A;  4JI4 L;  1VMC A;  2B2T A;  4LF6 L;  5JJL A;  1HNX L;  1E0B A;  1Q81 C;  3W1G A;  1VMP A;  4G4K A;  3S15 H;  2MQH A;  3WOF A;  1B70 B;  2N49 A;  4IPH A;  1VQB A;  2D0O A;  1NMF A;  1I50 H;  1CUK A;  3DUZ A;  4DU9 A;  3CRL C;  4J1M A;  3PGZ A;  1YJN A;  4Y7N B;  4Z9C B;  2L0C A;  3D31 A;  1U4R A;  1LYL A;  2O2L D;  1S4Z A;  1ICW A;  3EIV A;  4AQY L;  3ULJ A;  4DV0 L;  3T13 A;  3HOW B;  1B50 A;  2NZ1 D;  4C3H H;  2NUC A;  4LF5 Q;  1NY4 A;  2A6H D;  4FP5 D;  2AWN A;  1X65 A;  3K8A A;  1BNZ A;  1TS4 A;  4JI0 L;  4DV3 Q;  4NDX A;  2M00 A;  5J3B A;  1E22 A;  1KDC A;  2FHT A;  4RGN A;  4P72 A;  4R1J A;  1AE3 A;  1TWH B;  4KKS A;  4PMC A;  3NE5 B;  3H91 A;  1LAB A;  4ZKB B;  5GAH C;  3SK5 A;  1GUW A;  2YYZ A;  3PUV A;  4C3J B;  5BN5 A;  2F0J A;  2F0G A;  1D5M C;  3S1N B;  2R92 H;  1X3Q A;  4IFD J;  2F0W A;  1VQC A;  3S14 H;  2CW0 C;  3UDF A;  4C1N I;  5C6A A;  1UE7 A;  4DR4 Q;  4L8J A;  4IJL A;  4A3L H;  3TSS A;  2EXZ A;  3DEP A;  2NB0 A;  3BZD B;  5FLX E;  1K83 B;  5FO8 B;  2QIL A;  1XTD A;  4RCO A;  3CMA A;  1JCK B;  2M2L A;  4DR7 L;  2J0T D;  3NEN A;  4LUO A;  3EN2 A;  5C4X G;  3STB D;  3URY A;  1SYG A;  4A3M H;  4DAY A;  2EQS A;  4GN4 B;  1Q3L A;  1K8M A;  3D8G A;  1VQJ A;  1F2Z A;  4FVM A;  1VQE A;  1C7Y A;  2NVY H;  3H0G B;  3M4O B;  2WB1 G;  3GTL B;  1FD7 D;  2RSN A;  1AP0 A;  1WD0 A;  2RQX A;  1CSP A;  1EU4 A;  1A2T A;  2IX0 A;  1SFO B;  2NN6 I;  1Q90 A;  3KUP A;  1FJG L;  1HZB A;  1WTX A;  5BR8 Q;  4CDF C;  2D9U A;  1AH9 A;  1SYF A;  4XQQ A;  1QE6 A;  2VQF Q;  4X62 Q;  2F0L A;  1J5E Q;  1EU3 A;  2Z0S A;  2L9H A;  2A73 B;  1C0A A;  1JC7 A;  1XPO A;  1PH1 A;  5FJ8 H;  2VB2 X;  1HJP A;  4JV5 Q;  1HQM C;  2B63 B;  4UP9 A;  3DHQ A;  4POF A;  4F87 A;  2I5L X;  1CSQ A;  4I65 A;  1KRT A;  3BVG A;  2BE5 C;  1LT5 D;  5M3M B;  1YHA A;  4GOP C;  4AYB B;  1FNU A;  4GLA C;  4KTA A;  1FR3 A;  1A3V A;  4A3K H;  2KJX A;  2ZTC A;  4TSS A;  2F3I A;  3TRE A;  1IKM A;  2NTT A;  4KD3 A;  2BH2 A;  1GKH A;  1V8Q A;  2A5H A;  2UXB Q;  1ET9 A;  1W6K A;  1BF4 A;  1XNR L;  3NBH A;  4X66 L;  2Q2T A;  3CAM A;  4FDB A;  1BDO A;  2LXK A;  4WJ4 A;  5M5W B;  3E0J A;  1FYC A;  1M8A A;  4LJZ C;  3X3N A;  4YCU A;  1MD2 D;  2E2I H;  4HIO A;  4A3B G;  2E2H B;  1A6X A;  2OWO A;  1STG A;  5M3F H;  3CCE A;  4BBS B;  1O80 A;  2HDL A;  4LFC Q;  2VL6 A;  3U50 C;  2ATW A;  1STY A;  4OGQ C;  3SXH A;  4B3T Q;  3RR5 A;  1LTG D;  1U9R A;  1VQN A;  1T5X D;  5M5X B;  1RL2 A;  2FFK B;  2YTX A;  4IJH A;  4JI5 Q;  1KDB A;  2PI2 E;  1PMR A;  4OX9 Q;  1BQQ T;  4UP8 A;  3J81 i;  4JI6 L;  1KC8 C;  1EYC A;  4DV2 Q;  2GVB A;  5C4X B;  4HMI A;  1EEI D;  1YZ6 A;  4RGO S;  4BWG B;  1ZXT A;  1BOS A;  2Z1C A;  5CV9 A;  4A93 G;  4V0B A;  2WIN B;  3PIO A;  3H6M A;  2VQE L;  1NSN S;  2WB1 B;  1EFI D;  1ENF A;  1VCI A;  5IYB G;  1TWF B;  2HIX A;  5COY A;  2JQO A;  4RCN A;  1A2U A;  2RBM A;  1Q1B A;  1VS0 A;  3CW2 C;  1HZ9 A;  2BE5 D;  2JYO A;  3U4Z A;  4MTN A;  4NXN Q;  3W3A A;  4N9T A;  1IHZ A;  4IFD I;  3HKS A;  2SEB D;  1RHP A;  2L55 A;  2XRQ D;  2NVQ B;  3S2H B;  3HOZ H;  1HA5 A;  3JAM E;  4APV A;  3BYY B;  3HP3 A;  4R4T A;  4DKA C;  2F3W A;  2X6L A;  1B7Y B;  2WII B;  1LO5 D;  3HEJ A;  3KBX A;  1QVC A;  2UUA Q;  2XTI A;  2B3G A;  1SSO A;  2HHH L;  4JI7 Q;  1CZG A;  2H4O A;  5AJ3 Q;  1QNU A;  3OYY A;  5BN4 A;  4YWK A;  4QJF A;  1X3P A;  1VQD A;  1ASY A;  3F8T A;  3F2D A;  3BU2 A;  1JJG A;  4A3B B;  3OOC A;  2E76 C;  3T1Y Q;  1Y8N B;  2Z8L A;  3H3V I;  2ZT9 C;  5JJI A;  2AQ2 B;  4HMJ A;  4OWX B;  4A4I A;  1M90 C;  1SND A;  4L5S A;  5C3E B;  4NB3 A;  5FLX L;  5C0X J;  3K5L A;  4LFB L;  1TT2 A;  2PQE A;  3I91 A;  4ILW A;  3FMC A;  1K8O A;  1Y1W G;  2KCN A;  1N8R C;  2L5T A;  3J81 j;  3RZD H;  1MKH A;  2Z6K C;  4TRD A;  2JA6 H;  1HNW Q;  3T4A C;  3CC7 A;  1KLG D;  2LY7 A;  1SNC A;  1EY5 A;  5T1I A;  4H7B A;  2F0N A;  4DV4 L;  3VR2 A;  3KDF A;  4C3H G;  1D6E C;  3PO3 B;  2K01 A;  4MNO A;  3M7N A;  1EY4 A;  1MSG A;  1KTK A;  4JOI C;  4JI3 Q;  1EL0 A;  1EQQ A;  4DAM A;  1K3B C;  1L1O C;  4ABN A;  1PZI D;  4LF4 L;  2OQ0 A;  2F4V L;  3IKJ A;  2JEA I;  1STH A;  2PNH A;  3BDL A;  1EIY B;  1LTA D;  1EIG A;  4RHS A;  3MC0 B;  5IP9 H;  2R92 G;  1F9P A;  4CHT B;  1NNX A;  1IYJ B;  5T1G A;  1PH8 A;  3MA2 B;  4EQO A;  4A3L G;  1XJV A;  3T16 A;  2PZW A;  2R3Z A;  4EQ5 A;  4YY3 L;  3CCQ A;  5KRU A;  1I4Q A;  1P8L A;  1IBL L;  3FKI H;  5JVH 3;  1SYE A;  2JA7 H;  4LWC A;  5EKI A;  4KLK A;  1AE2 A;  3CC4 A;  1HR0 W;  1Q12 A;  3G6E A;  2IX3 A;  4DAY B;  4J15 A;  1KAW A;  1WTH A;  4A3M G;  1HRJ A;  3PO2 H;  2ZXO A;  5AFW A;  1KQS A;  4F7X A;  1JR0 D;  1SNP A;  3J7Y W;  3D4D A;  3NHH A;  3OTO L;  5D3D A;  3OSO A;  1STN A;  5FKA C;  2F0F A;  3MFY A;  5JJK A;  2D2C C;  1YJW A;  1S40 A;  4J6H A;  4LMQ D;  2B2Y C;  2JEB I;  3Q0A A;  4A3F H;  2B2U A;  1QVF A;  1GUO A;  2A19 A;  4B3R Q;  2I46 A;  1WTP A;  3QB3 A;  5ELC A;  3J80 L;  2VNU D;  4DR1 Q;  1B9N A;  3HS0 C;  1Y1W B;  4JBM A;  1XWE A;  2EJM A;  1VQA A;  4JI4 Q;  1NR2 A;  4QIW E;  2E74 C;  2EYJ A;  5C3W A;  1HNX Q;  3BZC A;  5IIF A;  1MI2 A;  3BVM A;  3TQY A;  4JW0 A;  4DPG A;  2NZH A;  3PIO 3;  4A3K G;  2EXD A;  1B53 A;  4CDE C;  4B08 A;  4OXP A;  2F0U A;  5FOB B;  1NAP A;  3S1Q H;  2PW5 A;  2MHV A;  1FVI A;  2EZV A;  3M4Y A;  2JJQ A;  3NBH B;  3RUZ A;  5IYC G;  1YJ9 A;  4YWL A;  2J7Z A;  4EX5 A;  2IY5 B;  1ESR A;  3KK7 A;  4HJ9 A;  4YHH L;  2BOS A;  4BA1 I;  2SDF A;  1PZK D;  2BDO A;  5M5Y H;  1MBY A;  2E75 C;  1LT6 D;  5FLM H;  3H15 A;  1PFN A;  2OF1 A;  3K58 A;  4DV1 L;  3GTP H;  3GP7 A;  3S1R B;  3I3C A;  1AEX A;  2K03 A;  3MXN A;  3B6Y A;  4OEM B;  2A6E C;  2F0E A;  5M3F G;  2NVX H;  4DV0 Q;  4JK1 C;  2R92 B;  1TR5 A;  3TP8 A;  2Y0S E;  5GQO A;  1NMG A;  2RA4 A;  4KK7 A;  3P20 A;  4JI0 Q;  2UUB Q;  2F0K A;  4HJ5 A;  1YBY A;  4R4Q A;  4RFB A;  5IWA L;  1WTV A;  1GHK A;  4KJO A;  2B2V A;  3JAM L;  1XMO Q;  3CF5 A;  1EY0 A;  2K33 A;  3S9W A;  4TKO B;  5I4D A;  5C0X I;  2NTS A;  5EJW A;  4EQP A;  1HZC A;  2IT1 A;  3NTI A;  1I5F A;  1S3O A;  2CH4 W;  4GZY C;  1CKM A;  3SHL A;  4X3T A;  3CD6 A;  3CRK C;  4H0L C;  4IUU A;  4K8I A;  2SNM A;  1N36 L;  4K0K L;  2EE1 A;  1MJE A;  1VQF A;  3LX0 A;  1V43 A;  2R7D A;  1DOK A;  2I0Q A;  2NVY B;  4TVA B;  4OON A;  3TZU A;  1II3 A;  1U5K A;  5IE8 A;  4ID6 A;  3NBI A;  2IX1 A;  5ELN A;  4DR7 Q;  1UUP A;  4AIM A;  3GQB A;  4PQX A;  2Q8T A;  4E6I A;  1J8I A;  4OWT B;  1D1K A;  2VZA A;  2N3S A;  3A5Z B;  1TWC H;  1PLF A;  2EYF A;  4A3D G;  3ZYY X;  4R8N A;  4LF9 L;  1CI3 M;  2K04 A;  2RKS A;  2E2D C;  1R9T H;  1FJG Q;  3AMU A;  3HOZ G;  3J81 E;  3NWS A;  3QG1 A;  5E1F A;  2JA8 H;  5I9P A;  5BN3 A;  5A35 A;  1YNJ D;  5C4J H;  3HRZ C;  4AH6 A;  2L12 A;  4JBK A;  4X65 L;  1RF2 D;  2ENB A;  4QUC A;  5JPN C;  4LFA L;  3KF8 A;  1F2Y A;  3ZJY C;  1GO3 E;  1HUM A;  1TWA H;  1OXU A;  1G6Z A;  2XGT A;  1YNN D;  4XYO A;  4C3I H;  1JJ2 A;  1RTO A;  3I8Z A;  3KLS A;  3GTG H;  3RLO A;  4C2M H;  1BBX C;  5EAY A;  1I4P A;  2E2I B;  1BCP F;  3UDX A;  4XIG S;  3M3Y H;  4FYD A;  1XPR A;  2GVA A;  4MZ9 A;  3RD4 A;  4OEL B;  1TKW B;  3V2T A;  2P5Z X;  3PQI A;  4DNI A;  3RN5 A;  1WD1 A;  1BBU A;  2F1M A;  2K4K A;  1I6H H;  1SE3 A;  2FMM A;  1HPC A;  2HCC A;  4X66 Q;  4JI1 Q;  1MSH A;  1Y1V H;  5IYD H;  1SE4 A;  1TY0 A;  4K5V A;  2JA6 G;  3NP8 A;  3GV6 A;  2RVL A;  4GKJ L;  2OTJ A;  1A15 A;  2EYP A;  4P71 A;  1BCP C;  2Q8R E;  3KDF B;  4OL7 A;  2WAQ E;  4DV5 L;  3MEF A;  1YIJ A;  2H1E A;  1LAC A;  4V19 0;  2IWH A;  1E7Z A;  3RMH A;  1KL9 A;  1SRO A;  3HOU H;  1XXG A;  2AKW B;  4F8M A;  1DJR D;  3S2D H;  1U4L A;  3TZD A;  2QA4 A;  4IO9 A;  4JI6 Q;  4CJ2 C;  2K5H A;  1QIL A;  4ZYS A;  2NN6 H;  1M1K C;  3F2B A;  2K5V A;  4BBR B;  2JA5 H;  3HOV B;  1K8A C;  4A3J H;  5EGT A;  5IGE A;  3TP5 A;  1BVS A;  2I5H A;  4GKK Q;  4KD4 A;  2VQE Q;  5CV5 A;  2QW7 A;  3VR3 A;  4A3D B;  1V9P A;  3SEB A;  3ND8 A;  2TMP A;  2CKZ B;  3K5N A;  4X6A H;  3M7G A;  2JK8 A;  3FEW X;  4ME3 A;  4PZ7 A;  2EVB A;  3MEH A;  1SJE D;  4JCV E;  1HH2 P;  3S17 B;  1XYI A;  3R2T A;  4GOP A;  2V1C C;  4KY7 A;  2AUK A;  5CC4 A;  3I4M H;  3K7A H;  3PIP A;  1I4G A;  2DJG C;  1SRU A;  3PO2 G;  4DFA A;  5GAD C;  4RH6 A;  1QZH A;  4BXX H;  2G9D A;  1E2Z A;  5KEE A;  2QEJ C;  2EPB A;  3DWA A;  1I4R A;  1TS5 A;  4A75 A;  2KEN A;  4YWM A;  2EDG A;  3L7Z C;  2JA9 A;  3J7Z C;  4OIJ A;  1K3R A;  3CQZ B;  3ERS X;  3DWP A;  3WOE A;  4A3F G;  1IL2 A;  1CFM A;  1IBK L;  3C46 A;  2HHH Q;  4FF1 A;  5GRO A;  2Z4H A;  1L0Y B;  1J6Q A;  4FXG C;  1LTB D;  1B3A A;  1KIX A;  4KKT A;  5C44 G;  4LF7 L;  1N32 L;  1STE A;  4X3U A;  3RZD B;  2JE6 I;  1L0X B;  1VQM A;  2KEC A;  2BDN A;  1PV4 A;  2QF7 A;  4BA2 I;  3T1H L;  3A8I E;  2MP1 A;  1WCM H;  5JEA J;  4Q5V A;  2M9V A;  3NPP A;  3NTK A;  1GUT A;  5K36 H;  3HOX H;  3TP7 A;  3TDQ A;  1Z9F A;  1PRT F;  4X64 L;  1ICF B;  1IBM L;  3L0O A;  2R7F A;  4C1N K;  1PDQ A;  5FLM G;  3EFX D;  3MXN B;  4LW1 A;  1N33 L;  1H9S A;  1S5E D;  1PHJ A;  1SYB A;  1TY2 A;  1TII D;  4A3C G;  4DV4 Q;  3TS2 A;  2EYH A;  5K5P A;  3Q8D A;  3RZO B;  3GTJ H;  2KHJ A;  3SVM A;  4O42 A;  3D6C A;  3GTK B;  1IKL A;  3I7F A;  1SR3 A;  1ENA A;  3AYH B;  4L5Q A;  4R4I A;  3J80 c;  3A7A B;  4B3M L;  4HCE A;  3J81 L;  1PRT C;  4IFD H;  5FK9 C;  1HR0 L;  2F0S A;  2F4V Q;  5C5L A;  1UE5 A;  1KDA A;  2AMC B;  1MGS A;  1TWG B;  2HUG A;  3LWU A;  1K0R A;  3TBI B;  2CW0 D;  2WFW A;  2QKI C;  4BY7 H;  2UUC L;  1SLJ A;  1WTW A;  1E1T A;  3H94 A;  4HR7 B;  1CKO A;  4R4C A;  4X3S A;  3R3O A;  2KOL A;  3F1Z A;  4YY3 Q;  2A68 C;  1IYV A;  3EQL C;  1EY7 A;  1M4V A;  3PUW A;  2XNA C;  4DR3 L;  4DK6 C;  2UU9 L;  5DLQ E;  4IAL A;  1IBL Q;  2AUJ D;  1EWI A;  1F2M A;  4UDU C;  4O1N A;  3W1B A;  3DXJ C;  2R6G A;  2RCF A;  3VYU A;  3RN2 A;  2F4I A;  3GTM B;  1WJJ A;  4QQB X;  4A3F B;  1VQ7 A;  1F9S A;  4KI0 A;  4PMW A;  1C48 A;  3Q23 A;  4GNX C;  1PTO F;  4HSV A;  4DR6 L;  3NK9 A;  2NVT H;  2VY3 A;  1YIT A;  1AZP A;  5I2X A;  1X3F A;  3OTO Q;  1VQ4 A;  2YTY A;  3PUZ A;  4QB4 A;  5C44 B;  1JB7 A;  3I4N H;  5J1Z A;  2O5I C;  2G9H D;  1NUC A;  3WWV A;  2E2J B;  4BS9 A;  2HD3 A;  4A3I H;  4HCS A;  2JA8 G;  3KOJ A;  1K73 C;  1N9W A;  3MXP A;  3T56 B;  4HIK A;  3QOJ A;  2PO4 A;  2YU9 B;  1EQV A;  3KF8 B;  1PTO C;  3S1Q B;  1MJC A;  1VQG A;  2R93 H;  3FVQ A;  1IXR A;  1ZYR C;  2YV5 A;  3K81 C;  4RG1 A;  2F52 A;  1H95 A;  2AHO B;  4C3I G;  3NQI A;  2EYL A;  2QGQ A;  4AYB E;  1I3Q B;  1L1O A;  2YTV A;  4IN3 A;  2CWA A;  5LL6 S;  3PCO B;  1W2B A;  4N8X 1;  2R61 A;  4G7Z C;  4LF5 L;  2HCI A;  1DYQ A;  2XN9 C;  4IOA A;  3MZ5 A;  2D5D A;  5HY6 A;  1Q82 C;  2OQK A;  3MTS A;  1G91 A;  4PG3 A;  4YHH Q;  1EWC A;  1E24 A;  4DF7 A;  4S3S A;  2EJG C;  4Y7N H;  1Y1V G;  5IT9 E;  4JYA L;  3PIP 3;  5IYD G;  2WKC A;  5JOB A;  2IPK D;  1X55 A;  3X3M A;  2Z6B A;  4KN7 C;  2AQ3 B;  4DUY L;  1LTI D;  4IPC A;  3HOW H;  3OMC A;  4DR2 L;  5LHY 1;  1VQH A;  1NR4 A;  4KHV A;  1PXU A;  2XRS D;  4LK1 C;  1SNO A;  3T53 B;  1KRS A;  1CQF A;  2Y0S G;  3LWE A;  2AQ1 B;  3D4W A;  1VDZ A;  5IWA Q;  3EJI A;  1G8Z D;  5ISR A;  3HOU G;  3K59 A;  1ONL A;  4C3J H;  2B2Y A;  5I9O A;  1H9R A;  4Q0F A;  3S1N H;  4LUV A;  1LLR D;  2NN6 G;  2DUD A;  2B2W C;  4PZ6 A;  1GOZ A;  2JA5 G;  4DA2 A;  1S72 A;  2NZO A;  1N36 Q;  4A3J G;  1QCB D;  4K0K Q;  3KLR A;  4EQN A;  4IUQ A;  1XMQ L;  2WB1 E;  5KYI A;  1STB A;  1LUZ A;  4YCV A;  5LMN Q;  5ELD A;  5IGD A;  1K83 H;  3HKZ E;  2F0I A;  1Y14 B;  3GTO B;  4DAP A;  4DXF A;  4NXM L;  1R9T B;  1B3Q A;  4GOP B;  5BR8 L;  1ZEQ X;  4A93 B;  4HN7 A;  2RSO A;  3I73 A;  3ND9 A;  3FPU B;  3I4M G;  3WDN A;  3I4O A;  1D1I A;  3BDO A;  1N34 Q;  3KLW A;  1RJT A;  1NE3 A;  3Q6S A;  1B8A A;  2K05 A;  2F0H A;  3M4O H;  3GTL H;  2DY8 A;  3H09 A;  1DD2 A;  5IGG A;  1SFO H;  1QUQ A;  1Q8I A;  3A55 A;  4IQZ A;  2MUY A;  1YNX A;  5DAU A;  1C8C A;  2KCC A;  3QOL A;  1UAP A;  4QF4 A;  2MO0 A;  4XT3 B;  1XNQ L;  3ERO A;  1S5B D;  4X65 Q;  3IFD A;  3VYT A;  1R4Q B;  1VQ9 A;  2GN5 A;  2RHQ B;  4JI2 L;  1JJC B;  2UXD L;  2B63 H;  4DK0 A;  1JQY D;  3EVQ A;  5M3M H;  3I90 A;  5C0X H;  4ZUJ A;  2JXM B;  4IPD A;  2K52 A;  3G48 A;  2ZXP A;  3VA5 A;  3G4S A;  3DM3 A;  3SGI A;  1D5Z C;  1RD9 D;  4IUV A;  1TXY A;  2ID0 A;  4NP5 A;  3SK8 A;  5IOC A;  1CA5 A;  1DXM A;  1PYB A;  1FNV A;  2Y0S B;  1T9H A;  3E0E A;  2FMC A;  3HOX G;  1JWU D;  2AWO A;  3V96 A;  1HFG A;  4XDX A;  1P16 A;  1UNS A;  5CYU A;  1H9S B;  5M5W H;  2N55 A;  3OW2 A;  3S2D B;  4CDD C;  1EQR A;  3H3V C;  1FGU A;  3S15 B;  2E2H H;  4OO1 H;  1Q86 C;  2OEO A;  1R4P B;  2Q8I B;  2WV6 D;  2A74 C;  4BBS H;  4DV2 L;  1I50 B;  5FJ8 G;  4ALP A;  1VQL A;  3L3O C;  3BDC A;  3LGJ A;  3PF5 A;  1Y69 U;  3VYS A;  2HQL A;  1Z6H A;  3E9I A;  4LF6 Q;  1ET6 A;  3CCV A;  1SE2 A;  1CKN B;  1T5E A;  5E7N A;  4IFD G;  1A62 A;  4C3H B;  1X9N A;  3MWY W;  3HOY H;  1B44 D;  2N88 A;  3CHB D;  1UEA B;  4BY7 G;  4DN4 M;  2HQE A;  2C9O A;  2D62 A;  4OIK A;  1F2L A;  1ZKO A;  3NUC A;  4AQY Q;  3AFP A;  3CKI B;  1TWF H;  2LSS A;  5EPJ A;  2PI2 A;  3S14 B;  1D7Q A;  1B4O A;  2CQA A;  5EPL A;  3A54 A;  4I7Z C;  4XQN A;  4GN5 A;  2HIV A;  2UUA L;  3G71 A;  3M4Q A;  1SMY C;  4PMB A;  3CCS A;  2CCZ A;  3NEM A;  5AJ3 L;  3GO5 A;  3VR6 A;  2N78 A;  3CCL A;  5IT9 L;  1U4M A;  4ODG A;  1G51 A;  5G3L F;  4K2K A;  2A69 C;  3KJO A;  1RIP A;  3I4N G;  2NVQ H;  4OWW B;  4KJN A;  3OWF A;  3S2H H;  3BG3 A;  3J80 i;  4A3M B;  2LFN A;  4DAV A;  1HXY D;  1V1P A;  1LTR D;  2OTL A;  2J4X A;  3I72 A;  4JPB W;  3K57 A;  5HGT A;  3NSW A;  3OWE B;  3A8K E;  1IW7 C;  1IBK Q;  3A74 A;  3S16 H;  4C56 C;  1RKN A;  4RKB A;  1GJX A;  4A3E H;  5JAV A;  4KHZ A;  4WRD A;  1SNQ A;  2HDM A;  4G57 A;  2KHI A;  3HOX B;  1DM0 B;  2X6G A;  1L1O B;  3EBE A;  1JWS D;  3W2D A;  2SOB A;  1I94 L;  2BH8 A;  2Q2H A;  2KCM A;  4CBV A;  4A3B H;  1JMC A;  1LV9 A;  3U9S A;  2KHS A;  3NWT A;  2ZTD A;  1PFM A;  3DM1 A;  3CPW A;  3T1H Q;  5C3E H;  5LL6 X;  3GTJ B;  2F3V A;  3F2C A;  1JOQ A;  5HGQ A;  4R9W A;  1JWM D;  1SJH D;  1WVL A;  1K8G A;  1HTP A;  2K5W A;  3BS1 A;  1PA6 A;  4KHP L;  2KED A;  4X64 Q;  4CDC C;  1IBM Q;  1EZ6 A;  2EYO A;  4A3K B;  3AU7 A;  1WTR A;  1FNW A;  3U58 A;  2A6E D;  2PCF B;  1N33 Q;  3K80 C;  2IHE A;  5KGU A;  1J9O A;  1O7Z A;  3L2P A;  2XVS A;  2EYM A;  3UDI A;  5CBE E;  3HOW G;  3PO3 H;  1V1Q A;  3P75 A;  3ICE A;  1O7L A;  3ITP A;  4K6D A;  4LNQ A;  1WTO A;  1E2W A;  1SAP A;  1YI2 A;  2F03 A;  1KAB A;  4M1U B;  4B3M Q;  5M3F B;  1L2F A;  2KBN A;  4ZUI A;  2EY2 A;  2CWP A;  1ROD A;  1OTC A;  1HR0 Q;  4KKU A;  2JP1 A;  1O7I A;  1VQ8 A;  1KXL A;  2VXW A;  1X56 A;  1OXV A;  1A8V A;  3NQT A;  1F77 A;  4C3J G;  5IOD A;  5JVG 3;  1XNR Q;  2A6H C;  4JG2 A;  1TS3 A;  4DNT B;  2UUC Q;  4XQJ A;  4HSP A;  2DNC A;  3PF4 A;  1ESF A;  3AB9 A;  5E4X A;  5IY0 A;  4ZQ3 A;  4B3S L;  3M4P A;  3NEL A;  2L1B A;  2NVT B;  3VDY A;  1IW7 D;  5LMU L;  5J22 A;  2PMZ E;  2B2V C;  4DR3 Q;  2UU9 Q;  3I56 A;  3GTQ H;  2K75 A;  3DEO A;  4NW2 A;  4FXK C;  2N8N A;  5EBD A;  5I6W A;  3PUY A;  2CQO A;  1TVX A;  3MFG A;  2ASB A;  1BBW A;  1CHQ D;  2RCN A;  2OCE A;  1PTO H;  1S5F D;  1CK1 A;  3K0Y A;  1GD7 A;  3KFU A;  3E6Z X;  1QVG A;  3LNN A;  3SDZ A;  2PZU A;  1SN8 A;  2C35 B;  2NWG A;  3O13 A;  4HED A;  5IP9 G;  1QUQ B;  1D8L A;  5GAG C;  3A0J A;  2QDL A;  4LF8 L;  3SE0 A;  2CHB D;  4DUZ L;  3TME A;  2GA4 B;  3STB C;  1A0I A;  2FXQ A;  5FLX c;  3VR4 A;  2LXJ A;  1CTM A;  2IW3 A;  4K5X A;  4UHV A;  2RHS B;  2WAC A;  5D14 A;  4HJ8 A;  3J7A F;  1XX8 A;  2K28 A;  1K9M C;  3AEV A;  3FKI G;  4A3G H;  2SNS A;  2JA7 G;  3HOZ B;  1HFN A;  5CMD A;  2OXP A;  1PH2 A;  3IAY A;  5FO9 B;  3BZK A;  1Y1W H;  2B63 G;  4HID A;  1OXT A;  4H13 C;  4FF3 A;  1EY9 A;  4FNF A;  5DEH A;  4A76 A;  1ENC A;  5M3M G;  1SEB D;  4AYB G;  4JI8 L;  5C0X G;  1F9Q A;  1LT3 D;  1MHW C;  2RDF A;  1BR9 A;  4ULL A;  1GUG A;  4BY1 H;  4FO2 A;  3C1E A;  2HT1 A;  4DR5 L;  2LMC B;  2PNR C;  3KF6 A;  3QJY A;  3CXC A;  1EQT A;  1A3U A;  2UUB L;  4XTC S;  1GHJ A;  1XMO L;  1HZA A;  3TP6 A;  4JYA Q;  2R7Z H;  1YHQ A;  3S1R H;  1BCP D;  4DUY Q;  4OO1 G;  4JVZ A;  3SR1 A;  4BBS G;  4DR2 Q;  1L0W A;  4YIJ A;  1PH7 A;  1I4H A;  4GNX A;  2UXC L;  1CT1 D;  2JA6 B;  4DV7 L;  5GAE C;  1JIC A;  1CQV A;  3U9O A;  4POG A;  5CR3 A;  4DV6 L;  1E2V A;  1VQ5 A;  3GV3 A;  2PQA A;  1KHI A;  2QDB A;  3TS0 A;  4LFB Q;  2NBF A;  3HOY G;  2MPM A; 
#chains in the Genus database with same CATH homology
 3RNU A;  4Y7N H;  1Y1V G;  2ALY B;  4JYA L;  5IYD G;  1JE5 A;  1X55 A;  2EIF A;  4H02 A;  4DUY L;  4DR1 Q;  2VNU D;  1XMQ Q;  4NPS A;  4JBM A;  3S1M H;  2E5L L;  4IPC A;  1VQA A;  4JI4 Q;  3HOW H;  1UEB A;  4DR2 L;  4QIW E;  1VQH A;  5LMN W;  1HNX Q;  4O2D A;  3BZC A;  1MIU A;  2MO1 A;  1KRS A;  4NXM Q;  3TQY A;  2Y0S G;  3D0F A;  3HKZ G;  4DPG A;  2NZH A;  4P74 A;  4A3K G;  2EXD A;  5IWA Q;  3I2Z A;  4QY7 A;  4OXP A;  4L5R C;  1EUJ A;  1NBW A;  3W5O A;  3S1Q H;  3HOU G;  1FVI A;  1Q46 A;  4IPG A;  3ULL A;  1A63 A;  1G6P A;  2JJQ A;  3NBH B;  1E1O A;  1CKN A;  5IYC G;  1YJ9 A;  4YWL A;  4C3J H;  4LF4 Q;  4B3R L;  4EX5 A;  2IY5 B;  4DR6 Q;  1C9O A;  4HJ9 A;  4YHH L;  2ZM6 L;  1U0L A;  3S1N H;  2IHF A;  4BA1 I;  4LUV A;  2KCT A;  3CC2 A;  5M5Y H;  2NN6 G;  3UE1 A;  5FLM H;  3H15 A;  2DUD A;  4PZ6 A;  4DV1 L;  3GTP H;  2JA5 G;  1S72 A;  2NZO A;  1N36 Q;  4A3J G;  4K0K Q;  4DR1 L;  1XMQ L;  3M9B A;  3H0G G;  2WB1 E;  3B6Y A;  5M3F G;  1HNZ Q;  2NVX H;  1LUZ A;  4DV0 Q;  4JI4 L;  3JC6 6;  4YCV A;  5LMN Q;  2Y0S E;  1K83 H;  3HKZ E;  5GQO A;  3I55 A;  1NMG A;  4LF6 L;  1Y14 B;  4HJ7 A;  5JJL A;  1HNX L;  1XNQ Q;  1Q81 C;  4JI0 Q;  4NXM L;  2UUB Q;  3U4V A;  4HJ5 A;  1YBY A;  4GOP B;  4R4Q A;  5IWA L;  5BR8 L;  3W1G A;  4A3E G;  5IYC H;  3CF5 A;  1XMO Q;  3J7A 5;  3S15 H;  2MQH A;  5C0X I;  1VQI A;  4JI2 Q;  3I4M G;  3I4O A;  2UXD Q;  1PFS A;  1HZC A;  1B70 B;  2IT1 A;  1I5F A;  2N49 A;  4IPH A;  4JI1 L;  1VQB A;  2D0O A;  1S3O A;  1NMF A;  3KJP A;  1I50 H;  1VQO A;  1CUK A;  1CKM A;  1N34 Q;  3KLW A;  3PGZ A;  3H3V H;  1YJN A;  1X54 A;  1NE3 A;  3CD6 A;  1B8A A;  3D31 A;  1SE8 A;  4O0A A;  1Q7Y C;  3M4O H;  3GTL H;  2Q2I A;  1N36 L;  1LYL A;  4K0K L;  1MJE A;  2VUM H;  1VQF A;  1V43 A;  1SFO H;  1QUQ A;  2R7D A;  3EIV A;  3PSI A;  5C3E G;  1OXX K;  3BJU A;  3ULJ A;  4DV0 L;  3JAM c;  4AQY L;  1HNZ L;  1YNX A;  4C3H H;  2I0Q A;  4LF5 Q;  4TVA B;  1NY4 A;  2AWN A;  1X65 A;  2Z6K A;  4OON A;  5IP7 H;  3K8A A;  2MO0 A;  1XNQ L;  3TEH B;  1U5K A;  4P73 A;  5IE8 A;  5IT9 c;  4JI0 L;  4DV3 Q;  1X6O A;  2IX1 A;  4X65 Q;  5ELN A;  5J3B A;  4DR7 Q;  1E22 A;  4AIM A;  4P72 A;  4R1J A;  4IOC A;  1AE3 A;  2GN5 A;  1VQ9 A;  2RHQ B;  4JI2 L;  1JJC B;  5GAH C;  2UXD L;  2B63 H;  2YYZ A;  4OWT B;  3PUV A;  4JOI A;  2VZA A;  2R92 H;  3PO3 G;  4IFD J;  2N3S A;  2E8G A;  1VQC A;  3A5Z B;  5M3M H;  3S14 H;  1TWC H;  3UDF A;  3CCJ A;  4A3D G;  1UE7 A;  4DR4 Q;  4LF9 L;  1WFQ A;  4IPD A;  4GKK L;  1Q1E A;  2K52 A;  3G48 A;  4IJL A;  4A3L H;  1PH4 A;  3G4S A;  3DM3 A;  3SGI A;  1R9T H;  1FJG Q;  1JT8 A;  3E9H A;  3HOZ G;  1TXY A;  4HJA A;  2ID0 A;  2JA8 H;  1PYB A;  3GDE A;  1T9H A;  3E0E A;  5C4J H;  3HOX G;  1XTD A;  4AH6 A;  3CMA A;  2AWO A;  4DV3 L;  4JBK A;  1P16 A;  1WOC A;  4X65 L;  4BBR H;  5M5W H;  3OW2 A;  4DR7 L;  4LFA L;  3HOV H;  3NEN A;  3ZJY C;  1GO3 E;  4LUO A;  1EQR A;  1FGU A;  3EN2 A;  4LUZ A;  1TWA H;  1OXU A;  2WP8 J;  3STB D;  2XGT A;  4A3M H;  2VS1 A;  2E2H H;  4DV1 Q;  1Q86 C;  4C3I H;  3CCR A;  1JJ2 A;  4BBS H;  2EQS A;  4GN4 B;  4QL5 A;  3GTG H;  4DV2 L;  3RLO A;  5FJ8 G;  2VW9 A;  4C2M H;  4ALP A;  3CP0 A;  1VQL A;  4A3D H;  1VQJ A;  1X3E A;  5EAY A;  4DK3 C;  2QEX A;  3LGJ A;  1VQE A;  3PF5 A;  4P75 A;  2HQL A;  4PZ8 A;  1C7Y A;  2NVY H;  3UDX A;  4XIG S;  3E9I A;  3M3Y H;  4LF6 Q;  2WB1 G;  1XPR A;  2GVA A;  1VQK A;  4DR4 L;  4MZ9 A;  3CCV A;  3S17 H;  1W3S A;  1CKN B;  1CSP A;  2IX0 A;  5E7N A;  2NN6 I;  1FJG L;  1HZB A;  4DNI A;  3RN5 A;  5BR8 Q;  1BBU A;  4IFD G;  1A62 A;  1X9N A;  1TWH H;  2K4K A;  1I6H H;  1AH9 A;  3HOY H;  3CPF A;  4X66 Q;  4X62 Q;  2VQF Q;  4JI1 Q;  1Y1V H;  1J5E Q;  4BY7 G;  3ER0 A;  5IYD H;  2Z0S A;  1C0A A;  2JA6 G;  2K5N A;  1XPO A;  1PH1 A;  5FJ8 H;  4GKJ L;  2OTJ A;  1HJP A;  4JV5 Q;  2D62 A;  4P71 A;  5ELO A;  3KDF B;  4UP9 A;  4POF A;  1PH9 A;  3CQZ H;  2WAQ E;  2I5L X;  1CSQ A;  2RF4 A;  2BA1 A;  1KRT A;  4DV5 L;  3AFP A;  3MEF A;  4AQY Q;  1YIJ A;  1TWF H;  2LSS A;  1YHA A;  4GOP C;  2PI2 A;  4GLA C;  1D7Q A;  3RLN A;  3ULP A;  3FHW A;  4A3K H;  2ZTC A;  1E7Z A;  2F3I A;  1KD1 C;  4A3G G;  1GVP A;  1KL9 A;  1SRO A;  3TRE A;  3HOU H;  1PH6 A;  2AKW B;  4JC0 A;  2BH2 A;  1GKH A;  4GN5 A;  2UXB Q;  3S2D H;  2HIV A;  2UUA L;  3G71 A;  3M4Q A;  1XNR L;  2CCZ A;  3CCS A;  2QA4 A;  3NEM A;  1I94 Q;  4IO9 A;  3K0X A;  4X66 L;  4X62 L;  5AJ3 L;  3GO5 A;  2VQF L;  4JI6 Q;  2K5H A;  2N78 A;  3CCM A;  1M1K C;  1EYG A;  3CCL A;  2Q2T A;  1LTL A;  3CAM A;  4FDB A;  2LXK A;  3F2B A;  1G51 A;  2K5V A;  1J5E L;  1ASZ A;  4WJ4 A;  3KJO A;  1RIP A;  1Z47 A;  2JA5 H;  3TRZ A;  3I4N G;  1K8A C;  1Q8K A;  4A3J H;  4OWW B;  2NVQ H;  4BXX G;  2E2I H;  4YCU A;  4HIO A;  4A3B G;  1BVS A;  3H0G H;  3KF6 B;  3J80 i;  1VQP A;  2I5H A;  2OWO A;  4BY1 G;  4LF9 Q;  5M3F H;  4GKK Q;  4JV5 L;  3CCE A;  2OTL A;  2D0P A;  2VQE Q;  2ZJQ A;  1NJI C;  4LFC Q;  1V9P A;  2VL6 A;  3U50 C;  2ATW A;  4X6A H;  2CKZ B;  4KHP Q;  2JK8 A;  4ME3 A;  4B3T Q;  4PZ7 A;  3RR5 A;  3AFQ A;  1IBK Q;  3A74 A;  3S16 H;  4JCV E;  1VQN A;  1HH2 P;  4A3E H;  4KHZ A;  2R7Z G;  4GOP A;  2V1C C;  1RL2 A;  3I4M H;  2KHI A;  2YTX A;  3K7A H;  4IJH A;  4JI5 Q;  4LFA Q;  2UXB L;  3PIP A;  2PI2 E;  1L1O B;  3EBE A;  1SRU A;  3PO2 G;  1I94 L;  4OX9 Q;  2BH8 A;  5GAD C;  4GNX B;  4UP8 A;  3J81 i;  4JI6 L;  4BXX H;  4TQU S;  2Q2H A;  1QZH A;  1KC8 C;  3RZO H;  2KCM A;  1VQ6 A;  4DV2 Q;  2GVB A;  1WI5 A;  1JMC A;  3GTK H;  4A3B H;  1YZ6 A;  4A75 A;  2KEN A;  4YWM A;  3S2H H;  2ZTD A;  2ES2 A;  3L7Z C;  2JA9 A;  3J7Z C;  3T1H Q;  3CPW A;  1QZG A;  5C3E H;  1K3R A;  4A93 G;  3F2C A;  3PIO A;  2VQE L;  5HGQ A;  3ERS X;  3DLL A;  2PQA B;  4LFC L;  1YEZ A;  4A3F G;  1K8G A;  1IL2 A;  1PA6 A;  4KHP L;  1TWG H;  1VCI A;  5IYB G;  2HIX A;  1UE6 A;  1WCM G;  4B3T L;  4X64 Q;  2JQO A;  1IBM Q;  1IBK L;  2ZJP A;  2HHH Q;  5K36 G;  3HFZ B;  2H5X A;  5GRO A;  1Q1B A;  4JBJ A;  3U58 A;  1VS0 A;  3CW2 C;  1EFW A;  1J6Q A;  1HZ9 A;  4B3S Q;  1N33 Q;  1DGS A;  3K80 C;  2IHE A;  4JI5 L;  1KIX A;  5C44 G;  5LMU Q;  4LF7 L;  3L2P A;  3U4Z A;  2ZM6 Q;  4MTN A;  3UDI A;  1N32 L;  4OX9 L;  5H1S E;  4YCW A;  3CME A;  4NXN Q;  3HOW G;  4GKJ Q;  4L5T A;  3PO3 H;  1V1Q A;  1X3G A;  2JE6 I;  3M85 A;  4IFD I;  3ICE A;  4GN3 B;  1YHB A;  3HKS A;  1VQM A;  4LNQ A;  1BKB A;  1LM0 A;  4DV5 Q;  1YI2 A;  1PV4 A;  3GTM H;  4BA2 I;  2WAQ G;  3T1H L;  1EIF A;  4B3M Q;  1L2F A;  2KBN A;  3HOZ H;  4APV A;  2CWP A;  5JEA J;  1WCM H;  1OTC A;  4R4T A;  1HR0 Q;  4DKA C;  1O7I A;  5M5X H;  1VQ8 A;  1KXL A;  1B7Y B;  3HOX H;  1X56 A;  1OXV A;  1G29 1;  1A8V A;  1Z9F A;  1QVC A;  4X64 L;  1XNR Q;  3FP9 A;  2XTI A;  2B3G A;  4JG2 A;  1IBM L;  2UUA Q;  3L0O A;  1PYS B;  2R7F A;  3GD7 A;  1WYD A;  2HHH L;  2UUC Q;  4JI7 Q;  5C44 H;  5AJ3 Q;  3PF4 A;  5FLM G;  3OYY A;  5IY0 A;  3MXN B;  4LW1 A;  4B3S L;  5C4X H;  3M4P A;  1N33 L;  1IZ6 A;  3NEL A;  4YWK A;  1PHJ A;  4LF8 Q;  3VDY A;  4QJF A;  5LMU L;  2E2J H;  2PMZ E;  4DUZ Q;  3PV0 A;  4A3C G;  4DV4 Q;  3TS2 A;  3UDG A;  1VQD A;  1ASY A;  4NXN L;  3F8T A;  4DR3 Q;  2UU9 Q;  3I56 A;  3Q8D A;  2K75 A;  3GTJ H;  3BU2 A;  2KHJ A;  3F2D A;  3GTQ H;  1JJG A;  3I7F A;  1SR3 A;  3T1Y Q;  1EOV A;  3H3V I;  3AYH B;  2YU9 H;  5JJI A;  4L5Q A;  2N8N A;  2ZTE A;  2B29 A;  4R4I A;  4OWX B;  4A4I A;  3J80 c;  1M90 C;  3PUY A;  4B3M L;  4L5S A;  2CQO A;  4NB3 A;  5C0X J;  2ASB A;  4LFB L;  1BBW A;  1HR0 L;  2F4V Q;  2A8V A;  2K50 A;  2OCE A;  1UE5 A;  2RCN A;  3A5U A;  2AMC B;  3PUX A;  1K0R A;  1I3Q H;  1Y1W G;  2BA0 A;  2WFW A;  1N8R C;  1GD7 A;  3KFU A;  4BY7 H;  3J81 j;  1QVG A;  2UUC L;  4JI7 L;  1SLJ A;  1MKH A;  2Z6K C;  3RZD H;  1E1T A;  4JI8 Q;  1SN8 A;  2C35 B;  5JEA G;  2JA6 H;  1HNW Q;  5IP9 G;  1CKO A;  1E3P A;  4R4C A;  1GM5 A;  4A3C H;  1QUQ B;  1D8L A;  4RMF A;  3A0J A;  5GAG C;  3CC7 A;  4LF8 L;  4UY8 C;  3UE0 A;  4DR5 Q;  2VUM G;  3CCU A;  3F1Z A;  4YY3 Q;  4DUZ L;  3STB C;  4GS3 A;  4DV4 L;  1FL0 A;  3PUW A;  3J81 c;  1A0I A;  4DR3 L;  2FXQ A;  4DK6 C;  3KDF A;  5DLQ E;  5FLX c;  2UU9 L;  4MNO A;  1IBL Q;  2LXJ A;  4A3I G;  1EWI A;  3M7N A;  5IP7 G;  2RHS B;  3T1Y L;  3W1B A;  4JBW A;  4HJ8 A;  2R6G A;  1PH5 A;  4JOI C;  4JI3 Q;  1K9M C;  3RN2 A;  3FKI G;  3AEV A;  1EQQ A;  4DAM A;  1WJJ A;  4A3G H;  2JA7 G;  4QQB X;  1PVO A;  1L1O C;  1VQ7 A;  4KI0 A;  4PMW A;  1PH2 A;  4LF4 L;  4GNX C;  4DR6 L;  1Y1W H;  3BZK A;  2R93 G;  2OQ0 A;  2L15 A;  2F4V L;  2B63 G;  4HID A;  2NVT H;  2JEA I;  1XPU A;  2PNH A;  3S24 A;  1OXT A;  1UWV A;  1EIY B;  2VY3 A;  1YIT A;  4LF7 Q;  3KYH C;  5IP9 H;  1N32 Q;  1X3F A;  3OTO Q;  4R4O A;  1VQ4 A;  4A76 A;  2YTY A;  3PUZ A;  2R92 G;  5M3M G;  2UXC Q;  1IYJ B;  4AYB G;  4GLV B;  4JI8 L;  1JB7 A;  5C0X G;  3I4N H;  1HNW L;  1PH8 A;  4Y52 H;  4DV7 Q;  5LMN L;  4A3L G;  4BY1 H;  1XJV A;  2HT1 A;  3WWV A;  4DR5 L;  3RLF A;  2CFM A;  4EQ5 A;  4YY3 L;  1NTG A;  3KF6 A;  3CCQ A;  4DV6 Q;  4A3I H;  4UP7 A;  4OO1 I;  3CXC A;  4WJ3 M;  2JA8 G;  3KOJ A;  1K73 C;  1N9W A;  5C4X G;  1P8L A;  2UUB L;  1IBL L;  4HIK A;  3FKI H;  3AQQ A;  2I5M X;  4GLX A;  2JA7 H;  4XTC S;  4LWC A;  4KLK A;  1AE2 A;  3IRB A;  3KF8 B;  1XMO L;  1HZA A;  2K14 A;  3CC4 A;  1MJC A;  1VQG A;  4JI3 L;  1Q12 A;  1HR0 W;  3G6E A;  2Q2U A;  4JYA Q;  2R93 H;  4BBR G;  2R7Z H;  1YHQ A;  3S1R H;  3HOV G;  3K81 C;  1IXR A;  2YV5 A;  4DAY B;  4J15 A;  1KAW A;  4RG1 A;  2ZJR A;  4DUY Q;  2F52 A;  1OXS C;  1H95 A;  2AHO B;  4A3M G;  2E5L Q;  3PO2 H;  4OO1 G;  4QGU A;  1N34 L;  1YVC A;  1KQS A;  2DGY A;  2QGQ A;  3K7U C;  4AYB E;  1PH3 A;  4BBS G;  4DR2 Q;  2YTV A;  1L1O A;  1L0W A;  3JAM i;  2CWA A;  2MNA A;  1PH7 A;  3OTO L;  4GNX A;  3GTO H;  2UXC L;  4HIM A;  2MFI A;  3PCO B;  1W2B A;  4DV7 L;  5JJK A;  1SMX A;  4UPA A;  1UE1 A;  1YJW A;  1S40 A;  5GAE C;  4A93 H;  4LF5 L;  4POG A;  4IOA A;  4DV6 L;  2JEB I;  5HY6 A;  1Q82 C;  2OQK A;  4A3F H;  1VQ5 A;  1QVF A;  2A19 A;  2A1A A;  4PG3 A;  5IYB H;  4B3R Q;  2PQA A;  1KHI A;  3TS0 A;  4LFB Q;  4YHH Q;  3HOY G;  1E24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...