4B3SQ

Crystal structure of the 30s ribosome in complex with compound 37
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4b3sQ00
2YYZA 1JJ2A 4DK3C 3CPWA 1I50H 5C4JH 3S2HH 2F52A 4B3TQ 1Q1EA 4DAMA 3ER0A 1N9WA 1N34L 3PIOA 3FKIG 3HKZE 4DV4Q 4DR1Q 5C3EG 4OX9Q 3CAMA 1IXRA 3GTOH 4DV7L 1N36L 4ME3A 1N34Q 4OONA 1K8AC 4L5QA 1GVPA 3TRZA 1VQFA 1ASYA 4DV5L 4X64L 3M4QA 2RHQB 3KF8B 4JCVE 5M5WH 1X55A 2ZM6L 3J81j 4JI5Q 1SR3A 2NVQH 1V9PA 1HZAA 2K52A 4YCVA 4RMFA 4A76A 4DR4Q 1A0IA 5IT9c 2JEBI 4OWWB 1X54A 4GOPA 2N8NA 1QVFA 1VQ7A 1FJGL 4IJHA 2HQLA 4NXML 4A3IH 3J80c 1IBKQ 3PO3G 4BBSG 1H95A 5C3EH 4GN4B 4JG2A 1AE3A 2D0PA 1WI5A 1YJ9A 2I5HA 3PUXA 5IP9G 2JA6H 4BBRG 4X64Q 1EIFA 1SFOH 1EQQA 3PIPA 1UE7A 2IT1A 4R4OA 2C35B 4BY1G 1PVOA 2KBNA 4OX9L 4OWTB 5E7NA 4H02A 3K81C 4JBWA 4X65L 3CC2A 3HOUG 1EQRA 4O0AA 4DR7Q 2CWPA 3NEMA 4C2MH 4DK6C 2NVTH 2KCMA 2MQHA 2R7FA 2ZTCA 1CKOA 5M3FH 4IO9A 4LF8L 1EWIA 2VUMG 3K8AA 3HOYG 1PA6A 4GLAC 1Y1WH 2LSSA 2RHSB 1FJGQ 1YEZA 4JI8Q 3ICEA 3I4NH 2JEAI 5JEAG 2K4KA 1SRUA 1PYSB 2RCNA 2UXCL 1Q7YC 2WAQG 1A8VA 1A62A 3STBD 2NZHA 1QVCA 4MZ9A 5EAYA 2R93G 3B6YA 2UUCL 1VQNA 2DGYA 4IPGA 1NMFA 1NJIC 5C0XG 5JJKA 4DNIA 4P74A 4DR5Q 4L5TA 3L7ZC 1OTCA 4BXXH 3AEVA 4DV0Q 4LWCA 1I94Q 2HIXA 1WJJA 4DV5Q 3S1QH 1PH2A 1Q8KA 2D0OA 3CCVA 2YU9H 4JI0Q 3S1MH 1HNWL 1GD7A 3RLNA 4X62Q 2VNUD 1N36Q 3CF5A 2NVYH 2JA6G 4DV4L 3PO2H 1YHBA 3A74A 1G51A 4X62L 2AWOA 2L15A 3J80i 1HNWQ 3M9BA 4IJLA 4QGUA 3KLWA 3GTJH 1GKHA 2VQEL 4B3TL 4KHZA 5LMUQ 1PYBA 4NXNQ 3KFUA 1DGSA 2E2IH 1D8LA 1NE3A 1V1QA 2PMZE 2VS1A 1M90C 4J15A 2Z0SA 1HNZQ 1HNXL 1YHQA 1R9TH 2JQOA 3CMEA 2F3IA 1KQSA 5M3FG 2VUMH 4QQBX 4IFDJ 2UXCQ 4LF7Q 1OXTA 4AQYQ 1XPOA 1XNQQ 4QL5A 4UPAA 2IHFA 3EN2A 4UP8A 2UXDL 1L1OC 4X6AH 3W1BA 4DAYB 4BY7G 3TEHB 2ES2A 4DUZL 2VY3A 3EBEA 1XJVA 1LTLA 3I4OA 1Y1WG 1PV4A 4UP9A 5M3MG 4YY3Q 1E1OA 4A75A 1JJGA 3T1HL 3PUWA 5M3MH 1KD1C 3K7AH 1B8AA 4IPCA 2PI2E 3HKZG 4MTNA 1VQAA 1YVCA 3RLOA 2B63G 4A93G 1PHJA 1JT8A 4K0KQ 5FLMG 3U50C 1OXSC 4R4QA 4NB3A 2LXKA 4PZ7A 4BA1I 4MNOA 4LFCQ 2MO1A 3JAMi 3L0OA 4XIGS 3A5ZB 3Q8DA 4DUZQ 1X6OA 3F2BA 4AIMA 4A3LH 4A3GG 4B3RQ 4LF4Q 2YV5A 3U4ZA 1IBKL 1ASZA 2R7ZH 3G71A 2E8GA 4GKKQ 2UXBL 1VQ8A 1L1OB 2ZJPA 1XNQL 1G291 1CKNA 4GN3B 1VQ9A 1I5FA 1GO3E 1K83H 1X65A 4LUZA 3RR5A 2ID0A 4X66L 1VQEA 4BBRH 4A3JG 1PH7A 4A3JH 1XNRL 1C9OA 2PQAA 5BR8L 1XPRA 2JE6I 3BZKA 3S2DH 5M5XH 4AH6A 2Z6KC 4JI1L 1MIUA 3UDFA 1BBWA 2MFIA 2PNHA 2BA1A 2UU9Q 4JI7L 4DUYL 2N3SA 4DR1L 5C4XH 1E7ZA 4R4TA 3TS0A 2JA5H 2Y0SG 1G6PA 4KHPQ 1KXLA 2AMCB 1QUQB 5DLQE 4HIDA 3S17H 3J81i 5AJ3L 1RIPA 3D0FA 5FLMH 3HOXG 4GNXA 2B63H 4P71A 4EX5A 4DR5L 4A93H 3FKIH 4JV5L 3M3YH 1YNXA 1XMQQ 4KI0A 1L2FA 2AWNA 2OWOA 3BZCA 1VCIA 2UUCQ 4C3IH 2K50A 4A4IA 4JOIA 3CXCA 2PI2A 1KC8C 3CPFA 1C7YA 4Y7NH 4LF6Q 4JI6Q 2JJQA 3F1ZA 2MNAA 4P75A 3UDIA 2ASBA 4GLVB 5ELNA 1TWGH 2A19A 3CCUA 2JA5G 5C4XG 4XTCS 3CQZH 1VQCA 2CFMA 1HJPA 1NBWA 5IP7H 4LFAL 1N33L 4GKJQ 1S3OA 2AKWB 4UP7A 3W1GA 2E5LQ 1RL2A 4JI2L 3AQQA 1JE5A 2Y0SE 2YTYA 3I2ZA 3HOXH 2UUAQ 4LF5Q 1UE6A 1N32Q 3AFPA 1VQBA 3CCJA 2A8VA 2E5LL 4LFBQ 4A3MH 4TVAB 2WP8J 2WB1G 2CWAA 2KENA 3PSIA 4R4CA 1QUQA 1SE8A 5IWAL 2UUBL 3PO2G 5FLXc 3F8TA 3KF6B 3CCRA 5H1SE 1O7IA 2OCEA 3BJUA 3SGIA 1YIJA 5GADC 1J5EL 3W5OA 1U0LA 2N49A 4LF6L 2OQKA 1SLJA 2I0QA 3G48A 2NN6G 2IX0A 3OYYA 4DR4L 1OXXK 3I4MG 1XPUA 3ULLA 3UDGA 3S1RH 2FXQA 4IFDI 4BXXG 1YZ6A 3TQYA 1VQ6A 1OXUA 1U5KA 5LMNW 4YCWA 1IBLQ 5C44H 4JBKA 4JBMA 4APVA 1TWHH 1E22A 1SMXA 2VW9A 4HIMA 3UE1A 3M7NA 2PQAB 4KLKA 3I4NG 1QZHA 2GVBA 4LUVA 5AJ3Q 3E0EA 3CP0A 4C3JH 2ATWA 4A3FH 3HKSA 2IY5B 4A3GH 1YJWA 2GVAA 4DR3L 5IYDG 4YHHQ 1IZ6A 3NBHB 4JI4Q 1IBMQ 5JJIA 3KYHC 4LF9L 2JA7G 3T1YQ 4POFA 1CKMA 1WCMH 4B3SQ 4BY1H 4A3BH 4DR6Q 3HOUH 1FL0A 1KIXA 2XTIA 2I5MX 5JJLA 4ALPA 4A3EG 4A3DH 2WAQE 5IE8A 5IYCH 4DV3L 4A3KH 5J3BA 3KJOA 1VQOA 1XNRQ 3KJPA 1EUJA 4IOCA 4JOIC 4P72A 3F2DA 2OQ0A 1VQJA 4YWKA 1XTDA 4YWLA 4DV2L 3RZDH 3KDFB 3J81c 4X66Q 1B70B 3PUVA 3L2PA 4DV3Q 1J5EQ 2VQFL 4HJ8A 4A3IG 4BBSH 4B3ML 3GTQH 4JI3Q 1VQKA 2HHHQ 2EIFA 1QVGA 4GKKL 4LF4L 2UXBQ 5IP7G 2YTVA 4WJ4A 3HOZH 4LF9Q 1WYDA 1Q46A 3HOZG 4IOAA 2JA8H 3MEFA 4DR3Q 2K14A 4A3CG 2OTLA 3J7ZC 1N32L 2R92G 2D62A 1Q12A 4R1JA 1E3PA 1K3RA 4JI2Q 4HJ5A 3J7A5 1Q1BA 4POGA 1YI2A 4OO1I 1TWCH 1UE5A 5GAGC 2EQSA 1IBLL 2BA0A 4JI3L 3M4OH 4A3EH 2VQFQ 1P8LA 4L5RC 3KOJA 1YITA 5IYCG 3K7UC 1X3EA 3ULJA 3GTPH 4DV2Q 3S24A 3PGZA 4OWXB 4IPHA 2B3GA 4QJFA 2JA7H 4DKAC 1WCMG 3RLFA 2K5VA 1CSPA 3UDXA 4DV6Q 3M85A 1HNXQ 1FGUA 1VQMA 3NENA 4JV5Q 4NXNL 1K73C 1AE2A 2F4VL 5GQOA 2JK8A 5GAEC 2NVXH 2VZAA 2VQEQ 4HIOA 4A3FG 1HZ9A 3DM3A 3PF4A 4L5SA 3OW2A 2UUAL 3CC4A 1Y14B 4DUYQ 2HT1A 4TQUS 4JI4L 1AH9A 4HJ9A 3CCQA 2V1CC 3TS2A 3OTOQ 2R7DA 2F4VQ 4JYAQ 1X9NA 1I94L 5GROA 3JC66 3GTMH 1LUZA 2WFWA 5K36G 1VQ4A 1XMOQ 1W3SA 4EQ5A 3PUYA 2B29A 3ERSX 4FDBA 3S1NH 4QY7A 3HOWH 2IHEA 1EYGA 1VQLA 3S16H 4DR2L 1VQPA 3A0JA 1XMOL 2CCZA 2LXJA 1WFQA 1X3FA 1XMQL 1A63A 1FVIA 1IL2A 1KHIA 4YWMA 2QGQA 4JYAL 3RZOH 1PH1A 4IFDG 1Q81C 1TXYA 1Y1VH 2UUBQ 3VDYA 1BKBA 1N8RC 4LFCL 2ZTDA 3A5UA 3AFQA 1UE1A 1IBML 2H5XA 3GDEA 3U4VA 4YHHL 1NTGA 2GN5A 1K0RA 3G6EA 3UE0A 2AHOB 3GTLH 4X65Q 4A3DG 1CKNB 1Q86C 4OXPA 3E9HA 3RN5A 3MXNB 4LF5L 4GN5A 2ZTEA 4A3LG 2Q2IA 2YTXA 3HOYH 3GTGH 1VQHA 2WB1E 3EIVA 4YY3L 4RG1A 3M4PA 2HIVA 1VQ5A 4HJAA 2BH2A 2HHHL 2R6GA 3CCLA 2UXDQ 4PG3A 3E9IA 1L0WA 1MJCA 2I5LX 3F2CA 3CC7A 2Q2HA 2XGTA 2QA4A 4GS3A 1PH3A 4AYBE 3G4SA 4BA2I 5C0XJ 1TWFH 2KHIA 1HZCA 4GLXA 4WJ3M 3ULPA 1S40A 3I56A 5LMUL 1CUKA 3HFZB 1JB7A 5IWAQ 4JC0A 4C3HH 1UEBA 1T9HA 2KHJA 4O2DA 5IP9H 2Z6KA 2OTJA 4DPGA 1HR0W 5FJ8G 2RF4A 3IRBA 4KHPL 4Y52H 4DV7Q 1Y1VG 3CCSA 3CCEA 1PH4A 3S15H 3AYHB 1YHAA 2BH8A 2CQOA 3KDFA 1SN8A 3KF6A 3STBC 2Q2UA 3TREA 3H0GH 1EFWA 4P73A 3RNUA 4GKJL 3I4MH 4A3CH 1E1TA 2E2JH 3K80C 2EXDA 4JI1Q 1VQDA 1Z47A 2R92H 1LYLA 4A3KG 4B3MQ 1YJNA 3I55A 3PCOB 5BR8Q 4GOPC 1OXVA 4OO1G 4DR2Q 1Z9FA 4GNXB 2CKZB 4LF7L 1PH6A 1V43A 3H15A 1QZGA 2R7ZG 2ZJQA 3CW2C 2R93H 4YCUA 3FP9A 1Q82C 1S72A 1MKHA 1E24A 1I3QH 5M5YH 1JMCA 4B3RL 1NMGA 3OTOL 3WWVA 3H3VH 3CMAA 4DV1L 2KCTA 4HIKA 3T1YL 1MJEA 1GM5A 4B3SL 2IX1A 4DR6L 4NPSA 4K0KL 1KRSA 3PO3H 1VQIA 1SROA 3GD7A 2K75A 3U58A 3CCMA 1LM0A 2N78A 4GNXC 1P16A 4LFAQ 1N33Q 4GOPB 3DLLA 5IYDH 4PZ6A 1KAWA 2NZOA 1EOVA 4QIWE 1VQGA 2MO0A 3PV0A 1KRTA 5LMNQ 2E2HH 4DV6L 1YBYA 1K9MC 1VS0A 3CD6A 1J6QA 4PZ8A 3PF5A 1M1KC 4NXMQ 1X3GA 1HR0Q 2K5NA 1KL9A 5JEAJ 5C0XI 3GO5A 2K5HA 4JBJA 4AQYL 3GTKH 1D7QA 2JA9A 3PUZA 3K0XA 5GAHC 5IYBG 3HOVH 2QEXA 1W2BA 4JI8L 4IPDA 3H0GG 2DUDA 5IYBH 1HR0L 1BVSA 4LUOA 2NN6I 5C44G 1HNZL 1EIYB 1BBUA 1UWVA 2JA8G 4JI5L 2A1AA 2ZM6Q 3HOWG 3FHWA 4LF8Q 3RN2A 3JAMc 5LMNL 1C0AA 4LFBL 5HY6A 1K8GA 4DR7L 5FJ8H 4UY8C 1IYJB 4LW1A 1JJCB 3NELA 3LGJA 2Q2TA 3T1HQ 3S14H 1I6HH 2UU9L 1X56A 1HZBA 4JI7Q 2ZJRA 4A3BG 5IY0A 4PMWA 4HJ7A 1PH8A 1WOCA 3I7FA 2ALYB 4JI0L 3ZJYC 4A3MG 1L1OA 1NY4A 4DV1Q 1PH5A 1B7YB 4DV0L 5ELOA 5HGQA 3HOVG 4R4IA 4JI6L 1CSQA 1TWAH 4LNQA 4AYBG 2VL6A 3BU2A 1PFSA 3H3VI 1PH9A 4BY7H 1HH2P 3D31A
chains in the Genus database with same CATH superfamily
1Z6HA 2YYZA 4QMGA 1HQMC 3UI2A 5EGTA 3CPWA 5C4JH 2F52A 3AU7A 1Q1EA 1TWFB 1N9WA 3PIOA 3FKIG 4DV4Q 4DR1Q 2F0OA 5C3EG 5KNDA 1IXRA 4R8NA 1ASYA 5TSSA 3NTHA 3M4QA 1A6XA 5C5MA 3FEWX 4DF7A 3BVZA 4JCVE 1BQQT 4JI5Q 2NVQH 4G57A 1SR3A 2VB3X 1V9PA 2WACA 2K52A 2NWGA 4OGQC 3K59A 5CV4A 1OO9B 5LHY1 1X54A 4GOPA 1H9KA 4UDUC 3J81E 3OPOA 2HQLA 4NXML 2A68D 5C3EH 4JG2A 4LK1C 2I5HA 3MAQA 4BBRG 4X64Q 1EIFA 1XXGA 3QR8A 1SFOH 2PW7A 1UE7A 2HUGA 5CV7A 2RDGA 1STAA 1ESFA 1V1PA 4X3SA 2EY1A 3TP5A 2CWPA 4KY7A 2NVTH 4ILWA 2MQHA 4LF8L 1EYAA 2EVBA 2RHSB 5EKIA 3I4NH 2HCIA 5JEAG 1SRUA 1Q7YC 4JW0A 2B2YA 2ZXOA 1TWGB 1D6EC 1LTAD 4KTAA 1OTCA 2DJFC 2QILA 3VR3A 2X6GA 2HIXA 3D4RA 2YU9H 2VNUD 2R92B 2X69A 1KLGD 1A3VA 4FXGC 1C4QA 3PO2H 1YHBA 3A8IE 3A74A 4RKLA 3C2PA 1HFGA 3HOZB 2F0DA 5JPMC 3M9BA 4IJLA 2VQEL 2KEEA 5LMUQ 3EJIA 1M90C 2OTJA 2PMZE 2E2DC 2BE5D 1ZKOA 1KQSA 1OXTA 4AQYQ 1XPOA 4OL7A 4QL5A 3EN2A 2AQ2B 4JK1C 1L1OC 3W1BA 1AEXA 1HPCA 2PNRC 2FINB 2L11A 1DONA 4DUZL 2PMZB 1JB3A 5KYIA 2VY3A 2QDLA 3EBEA 1XJVA 1Y1WG 1YNJD 4YY3Q 5FKAC 4A75A 1SJED 3PUWA 1KD1C 3K7AH 4IPCA 2B63G 1VQAA 3K6OA 3H91A 5FLMG 3U50C 4K0KQ 4C3HB 3OW7A 2PQEA 4AIMA 2H1EA 1IBKL 4GKKQ 2C9OA 1L1OB 4X66L 1K83H 2A6ED 1VQEA 3KLRA 3BDCA 2NTSA 1XNRL 1XPRA 4G7ZC 4FF3A 1JOOA 3Q23A 3CU7A 2PNHA 2BA1A 5M5XB 1KABA 2N3SA 5C4XH 4R4TA 1G6PA 4F7XA 1I4GA 1A3TA 1Q8IA 1PYWD 5AJ3L 1HTPA 1RIPA 4KN7C 5FLMH 3HOXG 2JA5B 2E74C 2F0VA 4EX5A 5CBEE 4JV5L 3IFDA 3TZUA 4KI0A 3DEOA 2OWOA 1I4PA 3BZCA 2B8GA 2K50A 4A4IA 4JOIA 3U9SA 3T51B 4XQJA 5M3FB 1W6JA 5ELDA 3OMCA 4LF6Q 1EIGA 1HRJA 4P75A 2ASBA 1TWGH 2A19A 1B3QA 4H0LC 1NBWA 4U68A 1S3OA 4UP7A 1CM9A 5I6YA 2Y0SE 3I2ZA 1UE6A 4DGZA 1KNEA 2G9HD 4N9TA 2NVYB 1LACA 2E5LL 5EKLA 4TVAB 4J6HA 5IWAL 3S1MB 4RHSA 5IGFA 5FLXc 2BDOA 4CHTB 1MHWC 3KF6B 5IODA 2A74C 3SGIA 4K2LA 3RZOB 1NSNS 1SNPA 2I0QA 1STBA 1ENCA 5E4XA 1XPUA 4IFDI 2M9VA 2F0NA 1JOQA 4YCWA 5C44H 1R4QB 5I2YA 2MUYA 2VW9A 3UE1A 2PQAB 3I3CA 1QZHA 2SNSA 4C3HG 2ATWA 3SVMA 2F03A 4JI4Q 1IZ6A 3R2IA 4ABNA 1I3QB 5M3MB 3QWNA 4B3SQ 3S2HH 1CKMA 3W2DA 1FL0A 2L1BA 1KIXA 3NWSA 4A3EG 1PXUA 2WAQE 1MI2A 1V1OA 4KJOA 5J3BA 3L3OC 1EUJA 4IOCA 2L9HA 3KDFB 3PUVA 3L2PA 1SMYC 2EJMA 4BBSH 2EZVA 4CKBA 4KY6A 2UXBQ 2F0UA 4Z9CB 5JPNC 5IP7G 1SJHD 1ENFA 2K6AA 1WYDA 3ITPA 5I6WA 1Q46A 2JA8H 1EYDA 2OTLA 1JR0D 1N32L 1JWUD 2R92G 4RGMA 1PTOB 1K3RA 4HJ5A 1T5EA 1CZWA 1Y69U 1TWCH 2K7VA 4F87A 4O42A 4JI3L 5HURA 2QEJC 1JWSD 2B2VA 1MSHA 2F0EA 1YITA 1BBXC 5IYCG 2M2LA 4DV2Q 4CJ1B 2B3GA 5HGTA 4DKAC 3RLFA 3UDXA 3M85A 3TMEA 3NENA 4NW2A 4HMIA 2VQEQ 1AFPA 4ZAIA 4A3BB 1HZ9A 3PF4A 2E2HB 1CQVA 1XTCD 3OW2A 4BY1B 4ULLA 4IUNA 1AZQA 1AH9A 3CCQA 2V1CC 3TS2A 3KK7A 2R7DA 5CV6A 5LL6S 1RHPA 2EPBA 1X9NA 3EQLC 3HOWB 4BBSB 3DWPA 4X3KA 1VQ4A 1TQOA 2B29A 4I7ZC 2E2JB 3P20A 2OT2A 5C0XH 4JYAL 1D1KA 4IFDG 1Q81C 3S17B 1N8RC 3AFQA 2H5XA 3GDEA 1TWCB 3U4VA 4YHHL 4X65Q 3E9HA 1F2LA 5EBDA 4A3LG 3GTGH 1CFMA 5D65A 4TRDA 4XQQA 1LTSD 1PLFA 1CQFA 1BXTA 3I72A 2D5DA 4PG3A 4V0BA 3E9IA 1L0WA 4IZ8A 2Q2HA 4OIJA 1PH3A 1LTGD 5A35A 4A3KB 4WJ3M 1S40A 5I4DA 4IUQA 2RQXA 4A3MB 1QJOA 1WTHA 2KHJA 2PZUA 4O2DA 1JORA 5FJ8G 3IRBA 4K6DA 2F0GA 5M5WB 4KHPL 2HDMA 3U9OA 1PH4A 2AUKA 4IFDH 5JJZA 3KF6A 2HDLA 4A3CH 3HG9A 2EXDA 5EPLA 1VQDA 1Z47A 2F0JA 1LYLA 4KHVA 5K36H 2F0LA 4GOPC 2CKZB 1V43A 2R7ZG 2KHSA 1BCPD 3CW2C 4YCUA 1Q82C 1NMGA 3OTOL 3H3VH 2AUJD 3GTGB 1PTOF 2KCTA 4B3SL 2IX1A 5CYUA 3NQTA 4NPSA 1TU2B 4HMJA 1RF2D 4K2KA 1ML0D 4WRDA 5ELFA 3SK6A 1VQIA 4CDCC 1LM0A 4HSVA 2SEBD 1N33Q 1HCZA 2NZOA 2A68C 2CQAA 1PTOC 1VS0A 2B2WC 3CD6A 2B2YC 1KL9A 2FMMA 4RA8A 5C0XI 2K5HA 1VF7A 4JBJA 3SE0A 3OSOA 3PUZA 1W2BA 4LJZC 1F9QA 3H0GG 1LTID 1HR0L 2IJ0A 1FNWA 4LF8Q 3JAMc 1NCVA 5HY6A 2RCFA 4UY8C 1Y1VB 1JWMD 3S14H 3T53B 1X56A 4V190 2XVSA 4KKUA 5CORA 4HJ7A 2Z1CA 2B2UA 2OF1A 1GUOA 4HCEA 2SDFA 2EYOA 1LTTD 4FF4A 4C3IG 3HP3A 3GTLB 4R4IA 4NMZA 4JI6L 4K5XA 1F9PA 3NPPA 3H3VI 4BY7H 1F9RA 3K5OA 3VYTA 2NBFA 1H9JA 1HH2P 4C3JB 1JJ2A 4DK3C 4ODGA 1I50H 4RAUC 1H9SB 5I9PA 2QCPX 3VR6A 2JN4A 3SHLA 1N34L 2B2TC 3HKZE 3I73A 1N36L 2WV6D 1EU4A 2NVQB 2CH4W 1ZYRD 2D2CC 4IN3A 1MGSA 4IUPA 1X55A 4QF4A 4RMFA 4A76A 5IT9c 2JEBI 4OWWB 3SK8A 1QVFA 1I6VC 1PRTC 5IIFA 2K28A 1H9SA 1WTPA 3D4WA 4EVOA 1YJ9A 2JA6H 4DXGA 4KD3A 3HRZC 4RH6A 1M4VA 3DWQA 3WOFA 3NTIA 3Q22A 4BY1G 2KBNA 4OX9L 5E7NA 4X65L 4JBWA 3HOUG 1G2SA 2F3WA 1SFOB 2NVXB 4DK6C 4C2MH 3R93A 2B2TA 5J39A 2ZTCA 1CKOA 3QO2A 4IO9A 3VYRA 1Y8NB 5IGGA 1ZYRC 1GUTA 3I90A 1ESRA 1VF5C 1SBBB 3MEHA 3ICEA 2JEAI 4CGYB 3MXNA 1BR9A 1A62A 2NZHA 4MZ9A 2R93G 1BUVT 3B6YA 1VQNA 2DGYA 4K5WA 2K04A 3DHQA 1D5XC 1PH2A 1HNWL 4NDXA 3RLNA 4X62Q 3DMUA 5COYA 3CF5A 1N36Q 2JA6G 3D3RA 5JOBA 2A6HC 4DV4L 4X62L 3K5LA 4KHZA 4NXNQ 1B44D 1DGSA 1Z7TA 1NE3A 2VS1A 1HNZQ 1HNXL 3MXGA 2HD3A 2F3IA 2RBMA 1SNCA 4IFDJ 3DUZA 5EBCA 1F9SA 3D8GA 2E75C 1T5XD 3EVQA 4UPAA 4HTHA 1A2TA 1IHZA 1J8IA 4DAYB 5FLXL 3I70A 5E1FA 3I91A 2K03A 3VR2A 1DYQA 1JJGA 2Y0SB 1YVCA 1EEFD 5C4HA 3NE5B 1HUMA 2MO1A 4MN3A 4XIGS 2MHVA 1X6OA 3F2BA 4B3RQ 4LF4Q 3U4ZA 1I4HA 3PMFA 1HFNA 4CDFC 2ZJPA 1CKNA 2DNEA 1PDQA 2QDBA 4K8IA 3BYYB 3V2TA 3RR5A 2Q8RE 3K58A 1C9OA 5BR8L 3HS0C 4KD4A 2EYLA 3MTSA 3A55A 2Z6KC 1D1IA 1MIUA 4M1UB 2WB1B 3UDFA 1BBWA 1NUCA 2Z9HA 2F0TA 4ZRZA 3SK4A 4JI7L 1QE6A 2JA5H 1PTOD 3FPUB 4KHPQ 1KXLA 2NZ1D 2KQ3A 3J81i 1S5CD 3D0FA 5BN4A 5C4XB 4DR5L 4A93H 2EDGA 2EJGC 1L2FA 2UUCQ 4C3IH 3MHBA 3IL8A 4FXDA 4JI6Q 2MNAA 3N6RA 5ELNA 2JA5G 3HOXB 4XTCS 2NYZD 1VQCA 2CFMA 1HJPA 3BVGA 5IP7H 4LFAL 4DAYA 4JI2L 3R3OA 1LO5D 3AQQA 4LF5Q 3E3XA 2UUAQ 5IT9L 1D2BA 3MWYW 2E76C 4A3MH 1SDFA 2WP8J 2CWAA 3LWEA 4R4CA 3VA5A 5LL6X 1QUQA 1SE8A 2M00A 1JCKB 2B8FA 2NB0A 2OCEA 4DU9A 3BJUA 4CDEC 2XRSD 1J5EL 5I2XA 2N49A 4A3JB 1SLJA 2EE1A 2IX0A 4QIWB 4DR4L 1JE4A 3ULLA 3S1RH 2FXQA 4BXXG 1YZ6A 1UAPA 1EY6A 3J80E 5LMNW 4JBKA 2FMCA 4APVA 3D6CA 1E22A 2BOSA 1CA5A 3HOYB 4N9PA 2DJGC 2BCOA 4KLKA 3I4NG 2GVBA 3J7YW 3TZDA 5A2QL 4C3JH 5C4ZA 3HKSA 4OIKA 2IY5B 1YJWA 4A93B 1I50B 4DR3L 1KLUD 1YNJC 4FP5D 3D31A 2JA7G 2J7ZA 4POFA 4DR6Q 3HOUH 2G5DA 1VDZA 1S4ZA 4MHEA 4ALPA 1L0YB 3QB3A 5IE8A 3NBHA 2AQ3B 4DV3L 1LT5D 4M8AA 2OQ0A 1VQJA 4DV2L 3RZDH 2F0HA 4FVMA 2VQFL 4HJ8A 4A3IG 1A15A 1EZ6A 2Q8IB 1VQKA 2HHHQ 3JAME 4K14A 2A6EC 2YTVA 1AZPA 4WJ4A 3DM1A 4IOAA 4FYDA 3NTKA 1EY9A 2K14A 3C1FA 2RKSA 4H44C 4JI2Q 4OO1I 4KMUC 1UE5A 1F77A 1I4RA 5GAGC 5IGEA 4J1MA 3S1NB 2VQFQ 1I6HB 2IW3A 3KOJA 2R93B 3URYA 1R4PB 2WAQB 3PGZA 1MBYA 4IPHA 5A2QE 4QJFA 1CSPA 4ZQ3A 4I65A 1ICFB 1H9MA 5J22A 1K73C 1AE2A 2VZAA 4XQNA 5T1GA 5CV5A 5EKKA 3AB9A 4MTKA 2UUAL 4DFAA 1F2YA 1II3A 3CHBD 4HJ9A 4JYAQ 5GROA 1IW7D 2O4XA 3JC66 1LUZA 5K36G 5DNFA 1XMOQ 3H0GB 4FDBA 5CV8A 1SYDA 3HOWH 1VQLA 2PW5A 4DR2L 1DJRD 1XMOL 4IQZA 1X3FA 1XMQL 1ENAA 5CGKA 1TXYA 3VDYA 4LFCL 2LFNA 1UE1A 4HAEA 3G6EA 3RMHA 1K0RA 2EYJA 1SNDA 3RN5A 1XWEA 2YTXA 3FKIB 5ELCA 1VQHA 2WB1E 4CDDC 1SE4A 3P7JA 2BH2A 2UXDQ 1EEID 1MJCA 2I5LX 3CC7A 2EXZA 5EQ0A 4AYBE 1X3PA 4I7AA 4RFBA 2KCNA 2KHIA 5AFWA 1QILA 5LMUL 1JB7A 4C3HH 1T9HA 1EQTA 2Z6KA 4DPGA 5FOBB 4CBVA 4Y52H 3CCSA 4IUUA 2Q2UA 3STBC 1STYA 3WDNA 1EFWA 3RNUA 1TS3A 2L5TA 4ZKCB 3BDLA 3KF8A 3BS1A 1YJNA 3OOCA 4R9WA 2LY7A 4E6IA 2G9DA 1OXVA 4DR2Q 3DXJC 5KYLA 2X6LA 2DNCA 2ZJQA 3C46A 3FP9A 1SNOA 2XWJB 2EOTA 1MKHA 1E24A 1I3QH 1JMCA 4X3UA 3PIP3 3CMAA 3TSSA 4HIKA 1MJEA 4DR6L 2XSCA 2I46A 2K1BA 4K0KL 4RCOA 1KRSA 4XDXA 1S5ED 2K75A 1EY8A 4GNXC 4YIJA 4RGNA 3IKJA 1WD1A 1SYCA 4TSSA 1EOVA 4PZ8A 1CK1A 1M1KC 4NXMQ 1B9MA 2SOBA 5M9OA 4EQNA 3GO5A 3PQIA 3K0XA 2VB2X 1BVSA 4LUOA 5C44G 1UWVA 2ZM6Q 2A1AA 3KUPA 4F8MA 3RN2A 5LMNL 4LFBL 3H3VC 2KVMA 3SDZA 5D3IB 1JJCB 1V8QA 1BNZA 2Q2TA 3R8BA 2IPKD 1PFNA 1HZBA 4UHVA 2ZJRA 4JI7Q 5IY0A 1PH8A 1DCZA 2F0MA 3ZJYC 4A3MG 1PH5A 1WTRA 5ELOA 3HOVG 1G8ZD 1EQVA 1UNSA 1CSQA 1V1PB 1IKMA 1G2TA 2LKVA 3A7LA 4DK1A 2VL6A 4JVZA 4BS9A 1HR0W 2EYPA 1QNKA 1C0AA 2RDFA 5G3LF 1QG7A 1EOTA 3RZDB 4B3TQ 4Y7NB 4DAMA 3ER0A 1RTOA 3P75A 5E4WC 1CZGA 1RDPD 4OX9Q 4A3DB 3RD4A 3GTOH 4DV7L 4ME3A 1DD2A 1SYFA 1K8AC 4L5QA 3S15B 4DV5L 1HTLD 1Q90A 2RHQB 3KF8B 2KEDA 1O7ZA 5D14A 3VYUA 5M5WH 2ZM6L 3J81j 1H9RA 2RDHA 4MIUA 2N8NA 2F0WA 1VQ7A 1FJGL 4IJHA 1CI3M 2ICIA 5CV9A 4A3IH 3J80c 1LV9A 1IBKQ 3HGBA 3PO3G 1H95A 3KBGA 1SYEA 2D0PA 2EY6A 3PUXA 4DAPA 1SYGA 3IFTA 1EY5A 2KCCA 4R4OA 1RJTA 1SEBD 4OWTB 1GJXA 4H02A 4L63B 1W6KA 3Q0AA 4DR7Q 4KKSA 3NEMA 1YNNC 2R7FA 1EWIA 3O13A 4GLAC 1FR3A 2LSSA 3S9WA 3QJYA 2RSOA 4JI8Q 1FJGQ 1RODA 1TS5A 5E3FA 2K4KA 1RCVD 1PYSB 2WAQG 1A8VA 3STBD 2Q8TA 1QVCA 5EAYA 1TY2A 2K5WA 1ET9A 4IUVA 2UUCL 3SR1A 3CKIB 1NMFA 5C0XG 5JJKA 4DNIA 2O2LD 4L5TA 4BXXH 1D5MC 1LT6D 3AEVA 4DV0Q 1WJJA 4DV5Q 1Q8KA 1CA6A 3CCVA 4B9WA 1GD7A 1VMCA 2NVYH 2NTTA 3VR5A 3BDOA 2L12A 2L15A 4QGUA 3KLWA 1GKHA 1K8OA 1PYBA 1WD0A 5ELBA 3KFUA 2E2IH 1D8LA 1V1QA 3J80L 1RD9D 1UEAB 4A3IB 1G6ZA 1TWHB 2XNAC 4RGOS 1R9TH 3CMEA 3L9AX 1XYIA 4QQBX 2UXCQ 3HZXA 1U9RA 3NSWA 1XNQQ 2IHFA 3SEBA 1SNMA 4X6AH 3TEHB 2ES2A 4BWGB 1KDBA 1LTLA 1SYBA 3I4OA 4UP9A 3FRPB 3J7AF 3T1HL 5M3MH 4MTNA 2PI2E 1RTNA 2ICEC 1NR4A 3EA6A 1PHJA 1B2TA 1JT8A 5DM73 4R4QA 2LXKA 4PZ7A 4N8X1 4MNOA 5JAVA 2A69C 1JC7A 3S2DB 2YV5A 1ASZA 2R7ZH 2OXPA 2E8GA 1EFID 1XNQL 3OWFA 4GN3B 5IT9E 2ENBA 4LUZA 1X65A 1HHVA 4BBRH 1KDAA 2B2WA 4A3JH 2ZT9C 4K6LA 2JE6I 5BN3A 1NR2A 4KK7A 1QNUA 2MFIA 4DUYL 3NQIA 4DR1L 1E7ZA 3HKZB 3TS0A 4N8FA 3CRLC 2AMCB 4HIDA 4PMCA 4WFN3 1DOMA 4GNXA 4ME5A 2B63H 1S5DD 1D5ZC 2DY7A 2ZXRA 3G7LA 2JXMB 1YNXA 1BDOA 4X3TA 2PYKA 4UAIA 2PI2A 5C4JB 3GP7A 4Y7NH 3DEPA 3NWTA 4DK0A 3F1ZA 3AMUA 3UDIA 1STNA 2K5DA 3A8KE 5I9OA 1STHA 5C4XG 3CQZH 4DAVA 4GKJQ 2C5CA 3NP8A 2AKWB 2Z6BA 2E5LQ 1PFBA 4EGVA 1JE5A 2WKCA 3HOXH 2N88A 3MZ5A 3EFXD 2A8VA 1KNAA 2B2UC 2WB1G 1K8MA 3PO2G 4Q5VA 3F8TA 3CCRA 3V05A 1O7IA 3NBIA 4XYQA 2HCCA 1YIJA 4LF6L 2K05A 5CR3A 4ZCKA 4Q0FA 3G48A 2NN6G 3OYYA 1OXXK 5IGCA 3I4MG 3UDGA 1TVXA 3TQYA 1VQ6A 1U5KA 4FXKC 4EQPA 4JBMA 5D3DA 1STEA 1HXYD 2QKIC 1U4RA 1SMXA 4H7BA 3RUZA 4HIMA 3TP8A 4A3GB 3QG1A 4B08A 2VUMB 3S1RB 4ZKBB 2BDNA 2O5IC 3J7AV 3HOUB 2GVAA 1CTMA 5FLXE 4YHHQ 5JJIA 1CHPD 3KYHC 4LF9L 5M5YB 4A3BH 2I5MX 5JJLA 4BY7B 4A3DH 5JVH3 5IYCH 3PO3B 4JPBW 3KJOA 3S2DH 3S1QB 4YWKA 1XTDA 1TKWB 3J81c 3X3NA 3MXPA 5F2DA 4QUCA 1K83B 4B3ML 2EIFA 1QVGA 4LF4L 4G4KA 4LAAA 4EQOA 3GTJB 3X3MA 1K3BC 3HOZH 2B39A 4LF9Q 3GTQB 1ZXTA 1DM0B 3MEFA 4DR3Q 3E5SA 5C3EB 4A3CG 3CRKC 4XT3B 1HA6A 4B9XA 4R1JA 1E3PA 2IWHA 1Q1BA 1LLRD 1YI2A 2EQSA 1FNUA 2BA0A 3GTPB 5ELEA 2O5JC 4C3JG 3M4OH 4A3EH 4QUFA 1P8LA 4L5RC 3K7UC 1X3EA 3ULJA 2MP1A 3S24A 2JA7H 1PZJD 1WCMG 5EPKA 2K5VA 1HNXQ 2SNMA 1TS4A 4C3IB 4HN7A 1ZEQX 5GQOA 2NVXH 2N55A 1GHJA 4A3FG 2F0QA 4F88A 3CC4A 4KN4C 5T1IA 2HT1A 2MPMA 1Q3LA 4TKOB 2F1MA 5C5LA 3OTOQ 2JYOA 1IYVA 2NN6H 3QOLA 2F4VQ 2R3ZA 1B53A 4HEDA 1I94L 3GTMH 2WFWA 1B3AA 1E2ZA 4FO2A 1G91A 1XX8A 4EQ5A 3ERSX 4QY7A 4P2CB 2IHEA 1EYGA 1BOSA 3A0JA 2E2IB 2LXJA 1WFQA 1A63A 1IL2A 1KHIA 1KDCA 1PH1A 3S16B 1M8AA 1Y1VH 2KA7A 1IBML 4FF1A 4JI4L 1NTGA 1F2MA 2AHOB 4A3DG 4PNYA 4LF5L 3VR4A 3HOYH 3SXHA 2ZXPA 3EIVA 3M4PA 1VQ5A 3G6JB 1MSGA 3KLSX 4C2MB 3CCLA 1LABA 3K0YA 3V96A 2WINB 2D9UA 2QA4A 2PCFB 3G4SA 4CKCA 3OIPA 3HOVB 3GTOB 1WTWA 3ULPA 2PZTA 1CUKA 5IWAQ 1STGA 2OEOA 1B50A 1WVLA 3TBIB 5KEEA 1DZ1A 1EYCA 1TR5A 2Z8LA 4DV7Q 1Y1VG 1ILPA 3CCEA 2XRQD 3AYHB 1YHAA 2A73B 2BH8A 1YNND 1K28A 5K5PA 4GKJL 2EYHA 4IUTA 4DN4M 3I4MH 3MFGA 1E1TA 2E2JH 3K80C 1O80A 2R92H 1PTOH 4A3KG 4B3MQ 3I55A 3PCOB 4OO1G 3T56B 1Z9FA 4GNXB 4LF7L 5KGUA 3H15A 1QZGA 3KBXA 4O1NA 2NUCA 3GV6A 2JP1A 1S72A 4PMBA 4XYOA 1BCPF 1EY0A 2RSNA 3U58A 3CCMA 1WTVA 2N78A 1ONLA 4FNFA 4WORA 5IGBA 3TP6A 5EJWA 4LFAQ 1EWCA 1KAWA 1VQGA 2MO0A 5NUCA 1K9MC 3T13A 4CJ0B 1J6QA 1X3GA 1HR0Q 2K5NA 5JEAJ 5IOCA 4AQYL 1D7QA 1PRTD 2JA9A 4KJNA 1IKLA 5IYBG 2QEXA 4JI8L 5JVG3 1HNZL 1EIYB 3GTKB 2JA8G 3FHWA 4RWSC 1IYUA 4U673 2AQ1B 3DWAA 2F4IA 1EIHA 5IGDA 2KUMA 1K8GA 4WJWA 3K57A 1IYJB 1QB5D 4LW1A 1GUSA 3N52A 4KKTA 5KIXA 3NELA 5FO9B 3T1HQ 3NHHA 2RA4A 1I6HH 2BE5C 4DA2A 1WOCA 3I7FA 4JI0L 5C6AA 1L1OA 4DV1Q 1B7YB 1I4QA 4DV0L 3A54A 1TWAH 5KNCA 3VA7A 3GQBA 2L0CA 3BU2A 4C56C 1PH9A 3K7AB 3MXUA 2KOLA 3C3LA 2Z4IA 1LTBD 1J9OA 2WKDA 2DN8A 3WOEA 3CAMA 1PZKD 4C1NI 2CVRA 1DXMA 1N34Q 4OONA 3JAML 1GVPA 3TRZA 1VQFA 4X64L 1KTKA 3MC0B 1F2ZA 1HZAA 4YCVA 4DR4Q 1A0IA 2IL8A 1EL0A 4NKLA 5L37A 1DOLA 4ZLTF 5KNBA 2L55A 4BBSG 2XWBB 3OWEB 3M7GA 4GN4B 1AE3A 3S14B 1WI5A 3FMCA 5IP9G 3FDTA 3BYTB 4OEMB 1EQQA 3PIPA 5BN5A 2JA7B 2LS01 2IT1A 5DEHA 4S3SA 2C35B 1PVOA 2J4XA 3K81C 3CC2A 1EQRA 4O0AA 4A3FB 3TN2A 3I4NB 2KCMA 2K33A 5M3FH 2VUMG 4DNTB 1FYCA 3HOYG 3K8AA 3NXWA 1PA6A 1E2VA 1RKNA 1WCMB 2GA4B 2H4OA 1Y1WH 1YEZA 2TMPA 3BVMA 2RCNA 2UXCL 4G7OC 1FGBD 4QB4A 4C1NK 4IPGA 1NJIC 2Z4HA 1GXDC 4P74A 4DR5Q 3L7ZC 4NP5A 3EROA 4LWCA 1I94Q 3PO2B 3S1QH 1LT4D 2D0OA 4JI0Q 2MGSA 3S1MH 1HQRD 1MD2D 1C8CA 2EY2A 1G51A 1ICWA 2AWOA 1HNWQ 3J80i 1GUGA 3QOJA 5C3XA 3GTJH 4B3TL 1TIID 1GOZA 1QWYA 2EJFC 4J15A 2Z0SA 1Y8PB 1YHQA 1EZ8A 2A6HD 2JQOA 2K5QA 5M3FG 2VUMH 3H94A 1A2UA 4LF7Q 3QIAA 1TT2A 3M3YB 4UP8A 1R9TB 2UXDL 4BY7G 4A3EB 2VXWA 1PV4A 2WIIB 5M3MG 1E1OA 5JEAH 1B8AA 1QOHA 3HKZG 3RLOA 2PPBC 4A93G 2KJXA 1OXSC 2F0FA 4KY5A 4NB3A 1Y8OB 4BA1I 4XXEA 4LFCQ 3JAMi 3C1EA 3L0OA 3T4AC 3A5ZB 1O7YA 3Q8DA 4ZK9B 4DUZQ 5CC4A 4A3LH 4A3GG 2UXBL 3G71A 1U4LA 1VQ8A 1JQYD 1G291 4H13C 3MFYA 3IAYA 1VQ9A 3I4MB 3BZDB 1I5FA 1GO3E 2ID0A 4A3JG 1KAAA 1PH7A 4R8IA 2PQAA 3BZKA 1X3QA 5M5XH 4AH6A 4JI1L 3I4LA 3E6ZX 2XN9C 3SK5A 1BF4A 1WTOA 4IALA 3J81L 2UU9Q 1UUPA 2B63B 2Y0SG 2K32A 1QUQB 5DLQE 5FO7B 3S17H 3ND9A 3NUCA 4P71A 3FKIH 2R61A 3M3YH 4DXFA 1XMQQ 1ET6A 2AWNA 3MA2B 1VCIA 3D6WA 3CXCA 1SSOA 1KC8C 3CPFA 1C7YA 3A7AB 2JJQA 3K5NA 4IURA 4GLVB 3CCUA 4PV1C 1N33L 2FFKB 5CMDA 4L6TB 3W1GA 1WTXA 1RL2A 5C3WA 3FVQA 2YTYA 1N32Q 3AFPA 4OHJA 1VQBA 3CCJA 4LFBQ 3VYSA 3PSIA 2KENA 2YU9B 2UUBL 4J8QA 1TY0A 1PRTF 1FNVA 5H1SE 1U4MA 3P1HA 5GADC 3W5OA 1U0LA 5DAUA 3F2UA 2OQKA 3Q6SA 5FO8B 3M4OB 1L0XB 1CHQD 3OHXC 1OXUA 3D4DA 1IBLQ 1O7LA 1TWHH 3M7NA 4LUVA 5AJ3Q 3H09A 3E0EA 2L4NA 3CP0A 4A3FH 2CW0C 2FHTA 3MVVA 4A3GH 3ND8A 5IYDG 4HR7B 3NBHB 2I07B 1IBMQ 3T1YQ 4BY1H 1WCMH 1Y1WB 3E0JA 3KLSA 2XTIA 3Q24A 1IW7C 4RGTA 1GUWA 1GHKA 3LX0A 4A3KH 1VQOA 3LNNA 1QCBD 3KJPA 1XNRQ 4JOIC 4P72A 3F2DA 1HA5A 4YWLA 3TDQA 4X66Q 1B70B 4DV3Q 1J5EQ 3T16A 3NK9A 3GTQH 4JI3Q 4GKKL 4K5VA 1BO0A 4OELB 1IL8A 4DNRB 4CJ2C 3HOZG 2EYMA 4ZUJA 2F0SA 1EU3A 5EPJA 3J7ZC 2JA6B 2D62A 1Q12A 3J7A5 4HCSA 1HUNA 2MJ8A 2HQEA 1LT3D 5ISRA 1S5FD 4POGA 1E0BA 2F0PA 1ILQA 2TSSA 1IBLL 1K0SA 2RVLA 3GV3A 2K01A 1GUNA 1PMRA 3R2TA 1CT1D 3GTPH 4AYBB 1EY7A 1SE3A 4OWXB 1O78A 1AN8A 2A5HA 3OMGA 4DV6Q 1TWAB 1FGUA 1VQMA 4JV5Q 4NXNL 2F4VL 2XIWA 2JK8A 5GAEC 3FPPA 4HIOA 2NVTB 3DM3A 4L5SA 5DM63 2V4DA 2JSOA 1Y14B 3OIQA 1JOKA 4DUYQ 4TQUS 3CQZB 4BBRB 2FJ2A 3M4YA 4GZYC 4CKEA 1W3SA 4OO1H 2DY8A 3PUYA 4LMQD 1JICA 3S16H 1VQPA 2CCZA 1FVIA 1SAPA 4YWMA 2QGQA 3RZOH 1B9NA 4RCNA 2UUBQ 1BKBA 2ZTDA 3A5UA 2GN5A 3UE0A 3GTLH 2CHBD 1CKNB 1EWHA 1Q86C 4OXPA 3LWUA 3MXNB 4GN5A 2ZTEA 2Q2IA 3H6MA 1A3UA 4YY3L 4RG1A 2HIVA 1SXTA 4HJAA 1DOKA 2HHHL 2R6GA 5CBAE 3K5MA 1PRTB 4RHRA 3F2CA 2B2VC 2XGTA 3S2HB 3ONAB 4GS3A 4BA2I 1PFMA 5C0XJ 1TWFH 1HZCA 3ERQA 4GLXA 1LTRD 3A56A 2J0TD 2QW7A 3I56A 1B1ZA 2PZWA 1X32A 4XT1B 3HFZB 2F0KA 4JC0A 3PIO3 1UEBA 5IP9H 2RF4A 3S15H 2CQOA 3KDFA 1SN8A 2F3VA 3TREA 2P5ZX 3H0GH 4P73A 4ZUIA 3GTMB 3A8JE 2CH4A 4JI1Q 2JA8B 1SMYD 1AW7A 2CW0D 1NNXA 5BR8Q 5C44B 1WTQA 2PO4A 2EYFA 3W3AA 1PH6A 4QCLA 3BG3A 1TS2A 2R93H 3I8ZA 5M5YH 4B3RL 2LMCB 3WWVA 5FK9C 4DV1L 3T1YL 1GM5A 1I4XA 3PO3H 4PQXA 1SROA 3GD7A 1S5BD 1P16A 1FD7D 5IYDH 4GOPB 3DLLA 1C48A 4PZ6A 3TP7A 1KRTA 5LMNQ 4QIWE 3PV0A 2A69D 3HEJA 4DV6L 1YBYA 2E2HH 3PF5A 4G7HC 1E2WA 3GTKH 2R7ZB 1BCPB 2F0IA 5GAHC 3HOVH 1B4OA 4IPDA 2DUDA 4RKBA 3ZYYX 5KRUA 5IYBH 2NN6I 2QF7A 1BBUA 3HOWG 4JI5L 4ID6A 4KV6A 1NAPA 1SE2A 4DR7L 5FJ8H 3LGJA 1AP0A 5J1ZA 2UU9L 4A3BG 4PMWA 3S1NH 1EY4A 2ALYB 4HSPA 1BCPC 1NY4A 2EY5A 1PZID 5HGQA 4ZYSA 1U4PA 4FF2A 1VMPA 2KECA 4LNQA 5G3LD 4AYBG 1SNQA 1PFSA 2IX3A 4K8JA 4L8JA
chains in the Genus database with same CATH topology
2YYZA 1JJ2A 4DK3C 3CPWA 1I50H 5C4JH 3S2HH 2F52A 4B3TQ 1Q1EA 4DAMA 3ER0A 1N9WA 1N34L 3PIOA 3FKIG 3HKZE 4DV4Q 4DR1Q 5C3EG 4OX9Q 3CAMA 1IXRA 3GTOH 4DV7L 1N36L 4ME3A 1N34Q 4OONA 1K8AC 4L5QA 1GVPA 3TRZA 1VQFA 1ASYA 4DV5L 4X64L 3M4QA 2RHQB 3KF8B 4JCVE 5M5WH 1X55A 2ZM6L 3J81j 4JI5Q 1SR3A 2NVQH 1V9PA 1HZAA 2K52A 4YCVA 4RMFA 4A76A 4DR4Q 1A0IA 5IT9c 2JEBI 4OWWB 1X54A 4GOPA 2N8NA 1QVFA 1VQ7A 1FJGL 4IJHA 2HQLA 4NXML 4A3IH 3J80c 1IBKQ 3PO3G 4BBSG 1H95A 5C3EH 4GN4B 4JG2A 1AE3A 2D0PA 1WI5A 1YJ9A 2I5HA 3PUXA 5IP9G 2JA6H 4BBRG 4X64Q 1EIFA 1SFOH 1EQQA 3PIPA 1UE7A 2IT1A 4R4OA 2C35B 4BY1G 1PVOA 2KBNA 4OX9L 4OWTB 5E7NA 4H02A 3K81C 4JBWA 4X65L 3CC2A 3HOUG 1EQRA 4O0AA 4DR7Q 2CWPA 3NEMA 4C2MH 4DK6C 2NVTH 2KCMA 2MQHA 2R7FA 2ZTCA 1CKOA 5M3FH 4IO9A 4LF8L 1EWIA 2VUMG 3K8AA 3HOYG 1PA6A 4GLAC 1Y1WH 2LSSA 2RHSB 1FJGQ 1YEZA 4JI8Q 3ICEA 3I4NH 2JEAI 5JEAG 2K4KA 1SRUA 1PYSB 2RCNA 2UXCL 1Q7YC 2WAQG 1A8VA 1A62A 3STBD 2NZHA 1QVCA 4MZ9A 5EAYA 2R93G 3B6YA 2UUCL 1VQNA 2DGYA 4IPGA 1NMFA 1NJIC 5C0XG 5JJKA 4DNIA 4P74A 4DR5Q 4L5TA 3L7ZC 1OTCA 4BXXH 3AEVA 4DV0Q 4LWCA 1I94Q 2HIXA 1WJJA 4DV5Q 3S1QH 1PH2A 1Q8KA 2D0OA 3CCVA 2YU9H 4JI0Q 3S1MH 1HNWL 1GD7A 3RLNA 4X62Q 2VNUD 1N36Q 3CF5A 2NVYH 2JA6G 4DV4L 3PO2H 1YHBA 3A74A 1G51A 4X62L 2AWOA 2L15A 3J80i 1HNWQ 3M9BA 4IJLA 4QGUA 3KLWA 3GTJH 1GKHA 2VQEL 4B3TL 4KHZA 5LMUQ 1PYBA 4NXNQ 3KFUA 1DGSA 2E2IH 1D8LA 1NE3A 1V1QA 2PMZE 2VS1A 1M90C 4J15A 2Z0SA 1HNZQ 1HNXL 1YHQA 1R9TH 2JQOA 3CMEA 2F3IA 1KQSA 5M3FG 2VUMH 4QQBX 4IFDJ 2UXCQ 4LF7Q 1OXTA 4AQYQ 1XPOA 1XNQQ 4QL5A 4UPAA 2IHFA 3EN2A 4UP8A 2UXDL 1L1OC 4X6AH 3W1BA 4DAYB 4BY7G 3TEHB 2ES2A 4DUZL 2VY3A 3EBEA 1XJVA 1LTLA 3I4OA 1Y1WG 1PV4A 4UP9A 5M3MG 4YY3Q 1E1OA 4A75A 1JJGA 3T1HL 3PUWA 5M3MH 1KD1C 3K7AH 1B8AA 4IPCA 2PI2E 3HKZG 4MTNA 1VQAA 1YVCA 3RLOA 2B63G 4A93G 1PHJA 1JT8A 4K0KQ 5FLMG 3U50C 1OXSC 4R4QA 4NB3A 2LXKA 4PZ7A 4BA1I 4MNOA 4LFCQ 2MO1A 3JAMi 3L0OA 4XIGS 3A5ZB 3Q8DA 4DUZQ 1X6OA 3F2BA 4AIMA 4A3LH 4A3GG 4B3RQ 4LF4Q 2YV5A 3U4ZA 1IBKL 1ASZA 2R7ZH 3G71A 2E8GA 4GKKQ 2UXBL 1VQ8A 1L1OB 2ZJPA 1XNQL 1G291 1CKNA 4GN3B 1VQ9A 1I5FA 1GO3E 1K83H 1X65A 4LUZA 3RR5A 2ID0A 4X66L 1VQEA 4BBRH 4A3JG 1PH7A 4A3JH 1XNRL 1C9OA 2PQAA 5BR8L 1XPRA 2JE6I 3BZKA 3S2DH 5M5XH 4AH6A 2Z6KC 4JI1L 1MIUA 3UDFA 1BBWA 2MFIA 2PNHA 2BA1A 2UU9Q 4JI7L 4DUYL 2N3SA 4DR1L 5C4XH 1E7ZA 4R4TA 3TS0A 2JA5H 2Y0SG 1G6PA 4KHPQ 1KXLA 2AMCB 1QUQB 5DLQE 4HIDA 3S17H 3J81i 5AJ3L 1RIPA 3D0FA 5FLMH 3HOXG 4GNXA 2B63H 4P71A 4EX5A 4DR5L 4A93H 3FKIH 4JV5L 3M3YH 1YNXA 1XMQQ 4KI0A 1L2FA 2AWNA 2OWOA 3BZCA 1VCIA 2UUCQ 4C3IH 2K50A 4A4IA 4JOIA 3CXCA 2PI2A 1KC8C 3CPFA 1C7YA 4Y7NH 4LF6Q 4JI6Q 2JJQA 3F1ZA 2MNAA 4P75A 3UDIA 2ASBA 4GLVB 5ELNA 1TWGH 2A19A 3CCUA 2JA5G 5C4XG 4XTCS 3CQZH 1VQCA 2CFMA 1HJPA 1NBWA 5IP7H 4LFAL 1N33L 4GKJQ 1S3OA 2AKWB 4UP7A 3W1GA 2E5LQ 1RL2A 4JI2L 3AQQA 1JE5A 2Y0SE 2YTYA 3I2ZA 3HOXH 2UUAQ 4LF5Q 1UE6A 1N32Q 3AFPA 1VQBA 3CCJA 2A8VA 2E5LL 4LFBQ 4A3MH 4TVAB 2WP8J 2WB1G 2CWAA 2KENA 3PSIA 4R4CA 1QUQA 1SE8A 5IWAL 2UUBL 3PO2G 5FLXc 3F8TA 3KF6B 3CCRA 5H1SE 1O7IA 2OCEA 3BJUA 3SGIA 1YIJA 5GADC 1J5EL 3W5OA 1U0LA 2N49A 4LF6L 2OQKA 1SLJA 2I0QA 3G48A 2NN6G 2IX0A 3OYYA 4DR4L 1OXXK 3I4MG 1XPUA 3ULLA 3UDGA 3S1RH 2FXQA 4IFDI 4BXXG 1YZ6A 3TQYA 1VQ6A 1OXUA 1U5KA 5LMNW 4YCWA 1IBLQ 5C44H 4JBKA 4JBMA 4APVA 1TWHH 1E22A 1SMXA 2VW9A 4HIMA 3UE1A 3M7NA 2PQAB 4KLKA 3I4NG 1QZHA 2GVBA 4LUVA 5AJ3Q 3E0EA 3CP0A 4C3JH 2ATWA 4A3FH 3HKSA 2IY5B 4A3GH 1YJWA 2GVAA 4DR3L 5IYDG 4YHHQ 1IZ6A 3NBHB 4JI4Q 1IBMQ 5JJIA 3KYHC 4LF9L 2JA7G 3T1YQ 4POFA 1CKMA 1WCMH 4B3SQ 4BY1H 4A3BH 4DR6Q 3HOUH 1FL0A 1KIXA 2XTIA 2I5MX 5JJLA 4ALPA 4A3EG 4A3DH 2WAQE 5IE8A 5IYCH 4DV3L 4A3KH 5J3BA 3KJOA 1VQOA 1XNRQ 3KJPA 1EUJA 4IOCA 4JOIC 4P72A 3F2DA 2OQ0A 1VQJA 4YWKA 1XTDA 4YWLA 4DV2L 3RZDH 3KDFB 3J81c 4X66Q 1B70B 3PUVA 3L2PA 4DV3Q 1J5EQ 2VQFL 4HJ8A 4A3IG 4BBSH 4B3ML 3GTQH 4JI3Q 1VQKA 2HHHQ 2EIFA 1QVGA 4GKKL 4LF4L 2UXBQ 5IP7G 2YTVA 4WJ4A 3HOZH 4LF9Q 1WYDA 1Q46A 3HOZG 4IOAA 2JA8H 3MEFA 4DR3Q 2K14A 4A3CG 2OTLA 3J7ZC 1N32L 2R92G 2D62A 1Q12A 4R1JA 1E3PA 1K3RA 4JI2Q 4HJ5A 3J7A5 1Q1BA 4POGA 1YI2A 4OO1I 1TWCH 1UE5A 5GAGC 2EQSA 1IBLL 2BA0A 4JI3L 3M4OH 4A3EH 2VQFQ 1P8LA 4L5RC 3KOJA 1YITA 5IYCG 3K7UC 1X3EA 3ULJA 3GTPH 4DV2Q 3S24A 3PGZA 4OWXB 4IPHA 2B3GA 4QJFA 2JA7H 4DKAC 1WCMG 3RLFA 2K5VA 1CSPA 3UDXA 4DV6Q 3M85A 1HNXQ 1FGUA 1VQMA 3NENA 4JV5Q 4NXNL 1K73C 1AE2A 2F4VL 5GQOA 2JK8A 5GAEC 2NVXH 2VZAA 2VQEQ 4HIOA 4A3FG 1HZ9A 3DM3A 3PF4A 4L5SA 3OW2A 2UUAL 3CC4A 1Y14B 4DUYQ 2HT1A 4TQUS 4JI4L 1AH9A 4HJ9A 3CCQA 2V1CC 3TS2A 3OTOQ 2R7DA 2F4VQ 4JYAQ 1X9NA 1I94L 5GROA 3JC66 3GTMH 1LUZA 2WFWA 5K36G 1VQ4A 1XMOQ 1W3SA 4EQ5A 3PUYA 2B29A 3ERSX 4FDBA 3S1NH 4QY7A 3HOWH 2IHEA 1EYGA 1VQLA 3S16H 4DR2L 1VQPA 3A0JA 1XMOL 2CCZA 2LXJA 1WFQA 1X3FA 1XMQL 1A63A 1FVIA 1IL2A 1KHIA 4YWMA 2QGQA 4JYAL 3RZOH 1PH1A 4IFDG 1Q81C 1TXYA 1Y1VH 2UUBQ 3VDYA 1BKBA 1N8RC 4LFCL 2ZTDA 3A5UA 3AFQA 1UE1A 1IBML 2H5XA 3GDEA 3U4VA 4YHHL 1NTGA 2GN5A 1K0RA 3G6EA 3UE0A 2AHOB 3GTLH 4X65Q 4A3DG 1CKNB 1Q86C 4OXPA 3E9HA 3RN5A 3MXNB 4LF5L 4GN5A 2ZTEA 4A3LG 2Q2IA 2YTXA 3HOYH 3GTGH 1VQHA 2WB1E 3EIVA 4YY3L 4RG1A 3M4PA 2HIVA 1VQ5A 4HJAA 2BH2A 2HHHL 2R6GA 3CCLA 2UXDQ 4PG3A 3E9IA 1L0WA 1MJCA 2I5LX 3F2CA 3CC7A 2Q2HA 2XGTA 2QA4A 4GS3A 1PH3A 4AYBE 3G4SA 4BA2I 5C0XJ 1TWFH 2KHIA 1HZCA 4GLXA 4WJ3M 3ULPA 1S40A 3I56A 5LMUL 1CUKA 3HFZB 1JB7A 5IWAQ 4JC0A 4C3HH 1UEBA 1T9HA 2KHJA 4O2DA 5IP9H 2Z6KA 2OTJA 4DPGA 1HR0W 5FJ8G 2RF4A 3IRBA 4KHPL 4Y52H 4DV7Q 1Y1VG 3CCSA 3CCEA 1PH4A 3S15H 3AYHB 1YHAA 2BH8A 2CQOA 3KDFA 1SN8A 3KF6A 3STBC 2Q2UA 3TREA 3H0GH 1EFWA 4P73A 3RNUA 4GKJL 3I4MH 4A3CH 1E1TA 2E2JH 3K80C 2EXDA 4JI1Q 1VQDA 1Z47A 2R92H 1LYLA 4A3KG 4B3MQ 1YJNA 3I55A 3PCOB 5BR8Q 4GOPC 1OXVA 4OO1G 4DR2Q 1Z9FA 4GNXB 2CKZB 4LF7L 1PH6A 1V43A 3H15A 1QZGA 2R7ZG 2ZJQA 3CW2C 2R93H 4YCUA 3FP9A 1Q82C 1S72A 1MKHA 1E24A 1I3QH 5M5YH 1JMCA 4B3RL 1NMGA 3OTOL 3WWVA 3H3VH 3CMAA 4DV1L 2KCTA 4HIKA 3T1YL 1MJEA 1GM5A 4B3SL 2IX1A 4DR6L 4NPSA 4K0KL 1KRSA 3PO3H 1VQIA 1SROA 3GD7A 2K75A 3U58A 3CCMA 1LM0A 2N78A 4GNXC 1P16A 4LFAQ 1N33Q 4GOPB 3DLLA 5IYDH 4PZ6A 1KAWA 2NZOA 1EOVA 4QIWE 1VQGA 2MO0A 3PV0A 1KRTA 5LMNQ 2E2HH 4DV6L 1YBYA 1K9MC 1VS0A 3CD6A 1J6QA 4PZ8A 3PF5A 1M1KC 4NXMQ 1X3GA 1HR0Q 2K5NA 1KL9A 5JEAJ 5C0XI 3GO5A 2K5HA 4JBJA 4AQYL 3GTKH 1D7QA 2JA9A 3PUZA 3K0XA 5GAHC 5IYBG 3HOVH 2QEXA 1W2BA 4JI8L 4IPDA 3H0GG 2DUDA 5IYBH 1HR0L 1BVSA 4LUOA 2NN6I 5C44G 1HNZL 1EIYB 1BBUA 1UWVA 2JA8G 4JI5L 2A1AA 2ZM6Q 3HOWG 3FHWA 4LF8Q 3RN2A 3JAMc 5LMNL 1C0AA 4LFBL 5HY6A 1K8GA 4DR7L 5FJ8H 4UY8C 1IYJB 4LW1A 1JJCB 3NELA 3LGJA 2Q2TA 3T1HQ 3S14H 1I6HH 2UU9L 1X56A 1HZBA 4JI7Q 2ZJRA 4A3BG 5IY0A 4PMWA 4HJ7A 1PH8A 1WOCA 3I7FA 2ALYB 4JI0L 3ZJYC 4A3MG 1L1OA 1NY4A 4DV1Q 1PH5A 1B7YB 4DV0L 5ELOA 5HGQA 3HOVG 4R4IA 4JI6L 1CSQA 1TWAH 4LNQA 4AYBG 2VL6A 3BU2A 1PFSA 3H3VI 1PH9A 4BY7H 1HH2P 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YYZ A;  1JJ2 A;  4DK3 C;  3CPW A;  1I50 H;  5C4J H;  3S2H H;  2F52 A;  4B3T Q;  1Q1E A;  4DAM A;  3ER0 A;  1N9W A;  1N34 L;  3PIO A;  3FKI G;  3HKZ E;  4DV4 Q;  4DR1 Q;  5C3E G;  4OX9 Q;  3CAM A;  1IXR A;  3GTO H;  4DV7 L;  1N36 L;  4ME3 A;  1N34 Q;  4OON A;  1K8A C;  4L5Q A;  1GVP A;  3TRZ A;  1VQF A;  1ASY A;  4DV5 L;  4X64 L;  3M4Q A;  2RHQ B;  3KF8 B;  4JCV E;  5M5W H;  1X55 A;  2ZM6 L;  3J81 j;  4JI5 Q;  1SR3 A;  2NVQ H;  1V9P A;  1HZA A;  2K52 A;  4YCV A;  4RMF A;  4A76 A;  4DR4 Q;  1A0I A;  5IT9 c;  2JEB I;  4OWW B;  1X54 A;  4GOP A;  2N8N A;  1QVF A;  1VQ7 A;  1FJG L;  4IJH A;  2HQL A;  4NXM L;  4A3I H;  3J80 c;  1IBK Q;  3PO3 G;  4BBS G;  1H95 A;  5C3E H;  4GN4 B;  4JG2 A;  1AE3 A;  2D0P A;  1WI5 A;  1YJ9 A;  2I5H A;  3PUX A;  5IP9 G;  2JA6 H;  4BBR G;  4X64 Q;  1EIF A;  1SFO H;  1EQQ A;  3PIP A;  1UE7 A;  2IT1 A;  4R4O A;  2C35 B;  4BY1 G;  1PVO A;  2KBN A;  4OX9 L;  4OWT B;  5E7N A;  4H02 A;  3K81 C;  4JBW A;  4X65 L;  3CC2 A;  3HOU G;  1EQR A;  4O0A A;  4DR7 Q;  2CWP A;  3NEM A;  4C2M H;  4DK6 C;  2NVT H;  2KCM A;  2MQH A;  2R7F A;  2ZTC A;  1CKO A;  5M3F H;  4IO9 A;  4LF8 L;  1EWI A;  2VUM G;  3K8A A;  3HOY G;  1PA6 A;  4GLA C;  1Y1W H;  2LSS A;  2RHS B;  1FJG Q;  1YEZ A;  4JI8 Q;  3ICE A;  3I4N H;  2JEA I;  5JEA G;  2K4K A;  1SRU A;  1PYS B;  2RCN A;  2UXC L;  1Q7Y C;  2WAQ G;  1A8V A;  1A62 A;  3STB D;  2NZH A;  1QVC A;  4MZ9 A;  5EAY A;  2R93 G;  3B6Y A;  2UUC L;  1VQN A;  2DGY A;  4IPG A;  1NMF A;  1NJI C;  5C0X G;  5JJK A;  4DNI A;  4P74 A;  4DR5 Q;  4L5T A;  3L7Z C;  1OTC A;  4BXX H;  3AEV A;  4DV0 Q;  4LWC A;  1I94 Q;  2HIX A;  1WJJ A;  4DV5 Q;  3S1Q H;  1PH2 A;  1Q8K A;  2D0O A;  3CCV A;  2YU9 H;  4JI0 Q;  3S1M H;  1HNW L;  1GD7 A;  3RLN A;  4X62 Q;  2VNU D;  1N36 Q;  3CF5 A;  2NVY H;  2JA6 G;  4DV4 L;  3PO2 H;  1YHB A;  3A74 A;  1G51 A;  4X62 L;  2AWO A;  2L15 A;  3J80 i;  1HNW Q;  3M9B A;  4IJL A;  4QGU A;  3KLW A;  3GTJ H;  1GKH A;  2VQE L;  4B3T L;  4KHZ A;  5LMU Q;  1PYB A;  4NXN Q;  3KFU A;  1DGS A;  2E2I H;  1D8L A;  1NE3 A;  1V1Q A;  2PMZ E;  2VS1 A;  1M90 C;  4J15 A;  2Z0S A;  1HNZ Q;  1HNX L;  1YHQ A;  1R9T H;  2JQO A;  3CME A;  2F3I A;  1KQS A;  5M3F G;  2VUM H;  4QQB X;  4IFD J;  2UXC Q;  4LF7 Q;  1OXT A;  4AQY Q;  1XPO A;  1XNQ Q;  4QL5 A;  4UPA A;  2IHF A;  3EN2 A;  4UP8 A;  2UXD L;  1L1O C;  4X6A H;  3W1B A;  4DAY B;  4BY7 G;  3TEH B;  2ES2 A;  4DUZ L;  2VY3 A;  3EBE A;  1XJV A;  1LTL A;  3I4O A;  1Y1W G;  1PV4 A;  4UP9 A;  5M3M G;  4YY3 Q;  1E1O A;  4A75 A;  1JJG A;  3T1H L;  3PUW A;  5M3M H;  1KD1 C;  3K7A H;  1B8A A;  4IPC A;  2PI2 E;  3HKZ G;  4MTN A;  1VQA A;  1YVC A;  3RLO A;  2B63 G;  4A93 G;  1PHJ A;  1JT8 A;  4K0K Q;  5FLM G;  3U50 C;  1OXS C;  4R4Q A;  4NB3 A;  2LXK A;  4PZ7 A;  4BA1 I;  4MNO A;  4LFC Q;  2MO1 A;  3JAM i;  3L0O A;  4XIG S;  3A5Z B;  3Q8D A;  4DUZ Q;  1X6O A;  3F2B A;  4AIM A;  4A3L H;  4A3G G;  4B3R Q;  4LF4 Q;  2YV5 A;  3U4Z A;  1IBK L;  1ASZ A;  2R7Z H;  3G71 A;  2E8G A;  4GKK Q;  2UXB L;  1VQ8 A;  1L1O B;  2ZJP A;  1XNQ L;  1G29 1;  1CKN A;  4GN3 B;  1VQ9 A;  1I5F A;  1GO3 E;  1K83 H;  1X65 A;  4LUZ A;  3RR5 A;  2ID0 A;  4X66 L;  1VQE A;  4BBR H;  4A3J G;  1PH7 A;  4A3J H;  1XNR L;  1C9O A;  2PQA A;  5BR8 L;  1XPR A;  2JE6 I;  3BZK A;  3S2D H;  5M5X H;  4AH6 A;  2Z6K C;  4JI1 L;  1MIU A;  3UDF A;  1BBW A;  2MFI A;  2PNH A;  2BA1 A;  2UU9 Q;  4JI7 L;  4DUY L;  2N3S A;  4DR1 L;  5C4X H;  1E7Z A;  4R4T A;  3TS0 A;  2JA5 H;  2Y0S G;  1G6P A;  4KHP Q;  1KXL A;  2AMC B;  1QUQ B;  5DLQ E;  4HID A;  3S17 H;  3J81 i;  5AJ3 L;  1RIP A;  3D0F A;  5FLM H;  3HOX G;  4GNX A;  2B63 H;  4P71 A;  4EX5 A;  4DR5 L;  4A93 H;  3FKI H;  4JV5 L;  3M3Y H;  1YNX A;  1XMQ Q;  4KI0 A;  1L2F A;  2AWN A;  2OWO A;  3BZC A;  1VCI A;  2UUC Q;  4C3I H;  2K50 A;  4A4I A;  4JOI A;  3CXC A;  2PI2 A;  1KC8 C;  3CPF A;  1C7Y A;  4Y7N H;  4LF6 Q;  4JI6 Q;  2JJQ A;  3F1Z A;  2MNA A;  4P75 A;  3UDI A;  2ASB A;  4GLV B;  5ELN A;  1TWG H;  2A19 A;  3CCU A;  2JA5 G;  5C4X G;  4XTC S;  3CQZ H;  1VQC A;  2CFM A;  1HJP A;  1NBW A;  5IP7 H;  4LFA L;  1N33 L;  4GKJ Q;  1S3O A;  2AKW B;  4UP7 A;  3W1G A;  2E5L Q;  1RL2 A;  4JI2 L;  3AQQ A;  1JE5 A;  2Y0S E;  2YTY A;  3I2Z A;  3HOX H;  2UUA Q;  4LF5 Q;  1UE6 A;  1N32 Q;  3AFP A;  1VQB A;  3CCJ A;  2A8V A;  2E5L L;  4LFB Q;  4A3M H;  4TVA B;  2WP8 J;  2WB1 G;  2CWA A;  2KEN A;  3PSI A;  4R4C A;  1QUQ A;  1SE8 A;  5IWA L;  2UUB L;  3PO2 G;  5FLX c;  3F8T A;  3KF6 B;  3CCR A;  5H1S E;  1O7I A;  2OCE A;  3BJU A;  3SGI A;  1YIJ A;  5GAD C;  1J5E L;  3W5O A;  1U0L A;  2N49 A;  4LF6 L;  2OQK A;  1SLJ A;  2I0Q A;  3G48 A;  2NN6 G;  2IX0 A;  3OYY A;  4DR4 L;  1OXX K;  3I4M G;  1XPU A;  3ULL A;  3UDG A;  3S1R H;  2FXQ A;  4IFD I;  4BXX G;  1YZ6 A;  3TQY A;  1VQ6 A;  1OXU A;  1U5K A;  5LMN W;  4YCW A;  1IBL Q;  5C44 H;  4JBK A;  4JBM A;  4APV A;  1TWH H;  1E22 A;  1SMX A;  2VW9 A;  4HIM A;  3UE1 A;  3M7N A;  2PQA B;  4KLK A;  3I4N G;  1QZH A;  2GVB A;  4LUV A;  5AJ3 Q;  3E0E A;  3CP0 A;  4C3J H;  2ATW A;  4A3F H;  3HKS A;  2IY5 B;  4A3G H;  1YJW A;  2GVA A;  4DR3 L;  5IYD G;  4YHH Q;  1IZ6 A;  3NBH B;  4JI4 Q;  1IBM Q;  5JJI A;  3KYH C;  4LF9 L;  2JA7 G;  3T1Y Q;  4POF A;  1CKM A;  1WCM H;  4B3S Q;  4BY1 H;  4A3B H;  4DR6 Q;  3HOU H;  1FL0 A;  1KIX A;  2XTI A;  2I5M X;  5JJL A;  4ALP A;  4A3E G;  4A3D H;  2WAQ E;  5IE8 A;  5IYC H;  4DV3 L;  4A3K H;  5J3B A;  3KJO A;  1VQO A;  1XNR Q;  3KJP A;  1EUJ A;  4IOC A;  4JOI C;  4P72 A;  3F2D A;  2OQ0 A;  1VQJ A;  4YWK A;  1XTD A;  4YWL A;  4DV2 L;  3RZD H;  3KDF B;  3J81 c;  4X66 Q;  1B70 B;  3PUV A;  3L2P A;  4DV3 Q;  1J5E Q;  2VQF L;  4HJ8 A;  4A3I G;  4BBS H;  4B3M L;  3GTQ H;  4JI3 Q;  1VQK A;  2HHH Q;  2EIF A;  1QVG A;  4GKK L;  4LF4 L;  2UXB Q;  5IP7 G;  2YTV A;  4WJ4 A;  3HOZ H;  4LF9 Q;  1WYD A;  1Q46 A;  3HOZ G;  4IOA A;  2JA8 H;  3MEF A;  4DR3 Q;  2K14 A;  4A3C G;  2OTL A;  3J7Z C;  1N32 L;  2R92 G;  2D62 A;  1Q12 A;  4R1J A;  1E3P A;  1K3R A;  4JI2 Q;  4HJ5 A;  3J7A 5;  1Q1B A;  4POG A;  1YI2 A;  4OO1 I;  1TWC H;  1UE5 A;  5GAG C;  2EQS A;  1IBL L;  2BA0 A;  4JI3 L;  3M4O H;  4A3E H;  2VQF Q;  1P8L A;  4L5R C;  3KOJ A;  1YIT A;  5IYC G;  3K7U C;  1X3E A;  3ULJ A;  3GTP H;  4DV2 Q;  3S24 A;  3PGZ A;  4OWX B;  4IPH A;  2B3G A;  4QJF A;  2JA7 H;  4DKA C;  1WCM G;  3RLF A;  2K5V A;  1CSP A;  3UDX A;  4DV6 Q;  3M85 A;  1HNX Q;  1FGU A;  1VQM A;  3NEN A;  4JV5 Q;  4NXN L;  1K73 C;  1AE2 A;  2F4V L;  5GQO A;  2JK8 A;  5GAE C;  2NVX H;  2VZA A;  2VQE Q;  4HIO A;  4A3F G;  1HZ9 A;  3DM3 A;  3PF4 A;  4L5S A;  3OW2 A;  2UUA L;  3CC4 A;  1Y14 B;  4DUY Q;  2HT1 A;  4TQU S;  4JI4 L;  1AH9 A;  4HJ9 A;  3CCQ A;  2V1C C;  3TS2 A;  3OTO Q;  2R7D A;  2F4V Q;  4JYA Q;  1X9N A;  1I94 L;  5GRO A;  3JC6 6;  3GTM H;  1LUZ A;  2WFW A;  5K36 G;  1VQ4 A;  1XMO Q;  1W3S A;  4EQ5 A;  3PUY A;  2B29 A;  3ERS X;  4FDB A;  3S1N H;  4QY7 A;  3HOW H;  2IHE A;  1EYG A;  1VQL A;  3S16 H;  4DR2 L;  1VQP A;  3A0J A;  1XMO L;  2CCZ A;  2LXJ A;  1WFQ A;  1X3F A;  1XMQ L;  1A63 A;  1FVI A;  1IL2 A;  1KHI A;  4YWM A;  2QGQ A;  4JYA L;  3RZO H;  1PH1 A;  4IFD G;  1Q81 C;  1TXY A;  1Y1V H;  2UUB Q;  3VDY A;  1BKB A;  1N8R C;  4LFC L;  2ZTD A;  3A5U A;  3AFQ A;  1UE1 A;  1IBM L;  2H5X A;  3GDE A;  3U4V A;  4YHH L;  1NTG A;  2GN5 A;  1K0R A;  3G6E A;  3UE0 A;  2AHO B;  3GTL H;  4X65 Q;  4A3D G;  1CKN B;  1Q86 C;  4OXP A;  3E9H A;  3RN5 A;  3MXN B;  4LF5 L;  4GN5 A;  2ZTE A;  4A3L G;  2Q2I A;  2YTX A;  3HOY H;  3GTG H;  1VQH A;  2WB1 E;  3EIV A;  4YY3 L;  4RG1 A;  3M4P A;  2HIV A;  1VQ5 A;  4HJA A;  2BH2 A;  2HHH L;  2R6G A;  3CCL A;  2UXD Q;  4PG3 A;  3E9I A;  1L0W A;  1MJC A;  2I5L X;  3F2C A;  3CC7 A;  2Q2H A;  2XGT A;  2QA4 A;  4GS3 A;  1PH3 A;  4AYB E;  3G4S A;  4BA2 I;  5C0X J;  1TWF H;  2KHI A;  1HZC A;  4GLX A;  4WJ3 M;  3ULP A;  1S40 A;  3I56 A;  5LMU L;  1CUK A;  3HFZ B;  1JB7 A;  5IWA Q;  4JC0 A;  4C3H H;  1UEB A;  1T9H A;  2KHJ A;  4O2D A;  5IP9 H;  2Z6K A;  2OTJ A;  4DPG A;  1HR0 W;  5FJ8 G;  2RF4 A;  3IRB A;  4KHP L;  4Y52 H;  4DV7 Q;  1Y1V G;  3CCS A;  3CCE A;  1PH4 A;  3S15 H;  3AYH B;  1YHA A;  2BH8 A;  2CQO A;  3KDF A;  1SN8 A;  3KF6 A;  3STB C;  2Q2U A;  3TRE A;  3H0G H;  1EFW A;  4P73 A;  3RNU A;  4GKJ L;  3I4M H;  4A3C H;  1E1T A;  2E2J H;  3K80 C;  2EXD A;  4JI1 Q;  1VQD A;  1Z47 A;  2R92 H;  1LYL A;  4A3K G;  4B3M Q;  1YJN A;  3I55 A;  3PCO B;  5BR8 Q;  4GOP C;  1OXV A;  4OO1 G;  4DR2 Q;  1Z9F A;  4GNX B;  2CKZ B;  4LF7 L;  1PH6 A;  1V43 A;  3H15 A;  1QZG A;  2R7Z G;  2ZJQ A;  3CW2 C;  2R93 H;  4YCU A;  3FP9 A;  1Q82 C;  1S72 A;  1MKH A;  1E24 A;  1I3Q H;  5M5Y H;  1JMC A;  4B3R L;  1NMG A;  3OTO L;  3WWV A;  3H3V H;  3CMA A;  4DV1 L;  2KCT A;  4HIK A;  3T1Y L;  1MJE A;  1GM5 A;  4B3S L;  2IX1 A;  4DR6 L;  4NPS A;  4K0K L;  1KRS A;  3PO3 H;  1VQI A;  1SRO A;  3GD7 A;  2K75 A;  3U58 A;  3CCM A;  1LM0 A;  2N78 A;  4GNX C;  1P16 A;  4LFA Q;  1N33 Q;  4GOP B;  3DLL A;  5IYD H;  4PZ6 A;  1KAW A;  2NZO A;  1EOV A;  4QIW E;  1VQG A;  2MO0 A;  3PV0 A;  1KRT A;  5LMN Q;  2E2H H;  4DV6 L;  1YBY A;  1K9M C;  1VS0 A;  3CD6 A;  1J6Q A;  4PZ8 A;  3PF5 A;  1M1K C;  4NXM Q;  1X3G A;  1HR0 Q;  2K5N A;  1KL9 A;  5JEA J;  5C0X I;  3GO5 A;  2K5H A;  4JBJ A;  4AQY L;  3GTK H;  1D7Q A;  2JA9 A;  3PUZ A;  3K0X A;  5GAH C;  5IYB G;  3HOV H;  2QEX A;  1W2B A;  4JI8 L;  4IPD A;  3H0G G;  2DUD A;  5IYB H;  1HR0 L;  1BVS A;  4LUO A;  2NN6 I;  5C44 G;  1HNZ L;  1EIY B;  1BBU A;  1UWV A;  2JA8 G;  4JI5 L;  2A1A A;  2ZM6 Q;  3HOW G;  3FHW A;  4LF8 Q;  3RN2 A;  3JAM c;  5LMN L;  1C0A A;  4LFB L;  5HY6 A;  1K8G A;  4DR7 L;  5FJ8 H;  4UY8 C;  1IYJ B;  4LW1 A;  1JJC B;  3NEL A;  3LGJ A;  2Q2T A;  3T1H Q;  3S14 H;  1I6H H;  2UU9 L;  1X56 A;  1HZB A;  4JI7 Q;  2ZJR A;  4A3B G;  5IY0 A;  4PMW A;  4HJ7 A;  1PH8 A;  1WOC A;  3I7F A;  2ALY B;  4JI0 L;  3ZJY C;  4A3M G;  1L1O A;  1NY4 A;  4DV1 Q;  1PH5 A;  1B7Y B;  4DV0 L;  5ELO A;  5HGQ A;  3HOV G;  4R4I A;  4JI6 L;  1CSQ A;  1TWA H;  4LNQ A;  4AYB G;  2VL6 A;  3BU2 A;  1PFS A;  3H3V I;  1PH9 A;  4BY7 H;  1HH2 P;  3D31 A; 
#chains in the Genus database with same CATH topology
 1Z6H A;  2YYZ A;  4QMG A;  1HQM C;  3UI2 A;  5EGT A;  3CPW A;  5C4J H;  2F52 A;  3AU7 A;  1Q1E A;  1TWF B;  1N9W A;  3PIO A;  3FKI G;  4DV4 Q;  4DR1 Q;  2F0O A;  5C3E G;  5KND A;  1IXR A;  4R8N A;  1ASY A;  5TSS A;  3NTH A;  3M4Q A;  1A6X A;  5C5M A;  3FEW X;  4DF7 A;  3BVZ A;  4JCV E;  1BQQ T;  4JI5 Q;  2NVQ H;  4G57 A;  1SR3 A;  2VB3 X;  1V9P A;  2WAC A;  2K52 A;  2NWG A;  4OGQ C;  3K59 A;  5CV4 A;  1OO9 B;  5LHY 1;  1X54 A;  4GOP A;  1H9K A;  4UDU C;  3J81 E;  3OPO A;  2HQL A;  4NXM L;  2A68 D;  5C3E H;  4JG2 A;  4LK1 C;  2I5H A;  3MAQ A;  4BBR G;  4X64 Q;  1EIF A;  1XXG A;  3QR8 A;  1SFO H;  2PW7 A;  1UE7 A;  2HUG A;  5CV7 A;  2RDG A;  1STA A;  1ESF A;  1V1P A;  4X3S A;  2EY1 A;  3TP5 A;  2CWP A;  4KY7 A;  2NVT H;  4ILW A;  2MQH A;  4LF8 L;  1EYA A;  2EVB A;  2RHS B;  5EKI A;  3I4N H;  2HCI A;  5JEA G;  1SRU A;  1Q7Y C;  4JW0 A;  2B2Y A;  2ZXO A;  1TWG B;  1D6E C;  1LTA D;  4KTA A;  1OTC A;  2DJF C;  2QIL A;  3VR3 A;  2X6G A;  2HIX A;  3D4R A;  2YU9 H;  2VNU D;  2R92 B;  2X69 A;  1KLG D;  1A3V A;  4FXG C;  1C4Q A;  3PO2 H;  1YHB A;  3A8I E;  3A74 A;  4RKL A;  3C2P A;  1HFG A;  3HOZ B;  2F0D A;  5JPM C;  3M9B A;  4IJL A;  2VQE L;  2KEE A;  5LMU Q;  3EJI A;  1M90 C;  2OTJ A;  2PMZ E;  2E2D C;  2BE5 D;  1ZKO A;  1KQS A;  1OXT A;  4AQY Q;  1XPO A;  4OL7 A;  4QL5 A;  3EN2 A;  2AQ2 B;  4JK1 C;  1L1O C;  3W1B A;  1AEX A;  1HPC A;  2PNR C;  2FIN B;  2L11 A;  1DON A;  4DUZ L;  2PMZ B;  1JB3 A;  5KYI A;  2VY3 A;  2QDL A;  3EBE A;  1XJV A;  1Y1W G;  1YNJ D;  4YY3 Q;  5FKA C;  4A75 A;  1SJE D;  3PUW A;  1KD1 C;  3K7A H;  4IPC A;  2B63 G;  1VQA A;  3K6O A;  3H91 A;  5FLM G;  3U50 C;  4K0K Q;  4C3H B;  3OW7 A;  2PQE A;  4AIM A;  2H1E A;  1IBK L;  4GKK Q;  2C9O A;  1L1O B;  4X66 L;  1K83 H;  2A6E D;  1VQE A;  3KLR A;  3BDC A;  2NTS A;  1XNR L;  1XPR A;  4G7Z C;  4FF3 A;  1JOO A;  3Q23 A;  3CU7 A;  2PNH A;  2BA1 A;  5M5X B;  1KAB A;  2N3S A;  5C4X H;  4R4T A;  1G6P A;  4F7X A;  1I4G A;  1A3T A;  1Q8I A;  1PYW D;  5AJ3 L;  1HTP A;  1RIP A;  4KN7 C;  5FLM H;  3HOX G;  2JA5 B;  2E74 C;  2F0V A;  4EX5 A;  5CBE E;  4JV5 L;  3IFD A;  3TZU A;  4KI0 A;  3DEO A;  2OWO A;  1I4P A;  3BZC A;  2B8G A;  2K50 A;  4A4I A;  4JOI A;  3U9S A;  3T51 B;  4XQJ A;  5M3F B;  1W6J A;  5ELD A;  3OMC A;  4LF6 Q;  1EIG A;  1HRJ A;  4P75 A;  2ASB A;  1TWG H;  2A19 A;  1B3Q A;  4H0L C;  1NBW A;  4U68 A;  1S3O A;  4UP7 A;  1CM9 A;  5I6Y A;  2Y0S E;  3I2Z A;  1UE6 A;  4DGZ A;  1KNE A;  2G9H D;  4N9T A;  2NVY B;  1LAC A;  2E5L L;  5EKL A;  4TVA B;  4J6H A;  5IWA L;  3S1M B;  4RHS A;  5IGF A;  5FLX c;  2BDO A;  4CHT B;  1MHW C;  3KF6 B;  5IOD A;  2A74 C;  3SGI A;  4K2L A;  3RZO B;  1NSN S;  1SNP A;  2I0Q A;  1STB A;  1ENC A;  5E4X A;  1XPU A;  4IFD I;  2M9V A;  2F0N A;  1JOQ A;  4YCW A;  5C44 H;  1R4Q B;  5I2Y A;  2MUY A;  2VW9 A;  3UE1 A;  2PQA B;  3I3C A;  1QZH A;  2SNS A;  4C3H G;  2ATW A;  3SVM A;  2F03 A;  4JI4 Q;  1IZ6 A;  3R2I A;  4ABN A;  1I3Q B;  5M3M B;  3QWN A;  4B3S Q;  3S2H H;  1CKM A;  3W2D A;  1FL0 A;  2L1B A;  1KIX A;  3NWS A;  4A3E G;  1PXU A;  2WAQ E;  1MI2 A;  1V1O A;  4KJO A;  5J3B A;  3L3O C;  1EUJ A;  4IOC A;  2L9H A;  3KDF B;  3PUV A;  3L2P A;  1SMY C;  2EJM A;  4BBS H;  2EZV A;  4CKB A;  4KY6 A;  2UXB Q;  2F0U A;  4Z9C B;  5JPN C;  5IP7 G;  1SJH D;  1ENF A;  2K6A A;  1WYD A;  3ITP A;  5I6W A;  1Q46 A;  2JA8 H;  1EYD A;  2OTL A;  1JR0 D;  1N32 L;  1JWU D;  2R92 G;  4RGM A;  1PTO B;  1K3R A;  4HJ5 A;  1T5E A;  1CZW A;  1Y69 U;  1TWC H;  2K7V A;  4F87 A;  4O42 A;  4JI3 L;  5HUR A;  2QEJ C;  1JWS D;  2B2V A;  1MSH A;  2F0E A;  1YIT A;  1BBX C;  5IYC G;  2M2L A;  4DV2 Q;  4CJ1 B;  2B3G A;  5HGT A;  4DKA C;  3RLF A;  3UDX A;  3M85 A;  3TME A;  3NEN A;  4NW2 A;  4HMI A;  2VQE Q;  1AFP A;  4ZAI A;  4A3B B;  1HZ9 A;  3PF4 A;  2E2H B;  1CQV A;  1XTC D;  3OW2 A;  4BY1 B;  4ULL A;  4IUN A;  1AZQ A;  1AH9 A;  3CCQ A;  2V1C C;  3TS2 A;  3KK7 A;  2R7D A;  5CV6 A;  5LL6 S;  1RHP A;  2EPB A;  1X9N A;  3EQL C;  3HOW B;  4BBS B;  3DWP A;  4X3K A;  1VQ4 A;  1TQO A;  2B29 A;  4I7Z C;  2E2J B;  3P20 A;  2OT2 A;  5C0X H;  4JYA L;  1D1K A;  4IFD G;  1Q81 C;  3S17 B;  1N8R C;  3AFQ A;  2H5X A;  3GDE A;  1TWC B;  3U4V A;  4YHH L;  4X65 Q;  3E9H A;  1F2L A;  5EBD A;  4A3L G;  3GTG H;  1CFM A;  5D65 A;  4TRD A;  4XQQ A;  1LTS D;  1PLF A;  1CQF A;  1BXT A;  3I72 A;  2D5D A;  4PG3 A;  4V0B A;  3E9I A;  1L0W A;  4IZ8 A;  2Q2H A;  4OIJ A;  1PH3 A;  1LTG D;  5A35 A;  4A3K B;  4WJ3 M;  1S40 A;  5I4D A;  4IUQ A;  2RQX A;  4A3M B;  1QJO A;  1WTH A;  2KHJ A;  2PZU A;  4O2D A;  1JOR A;  5FJ8 G;  3IRB A;  4K6D A;  2F0G A;  5M5W B;  4KHP L;  2HDM A;  3U9O A;  1PH4 A;  2AUK A;  4IFD H;  5JJZ A;  3KF6 A;  2HDL A;  4A3C H;  3HG9 A;  2EXD A;  5EPL A;  1VQD A;  1Z47 A;  2F0J A;  1LYL A;  4KHV A;  5K36 H;  2F0L A;  4GOP C;  2CKZ B;  1V43 A;  2R7Z G;  2KHS A;  1BCP D;  3CW2 C;  4YCU A;  1Q82 C;  1NMG A;  3OTO L;  3H3V H;  2AUJ D;  3GTG B;  1PTO F;  2KCT A;  4B3S L;  2IX1 A;  5CYU A;  3NQT A;  4NPS A;  1TU2 B;  4HMJ A;  1RF2 D;  4K2K A;  1ML0 D;  4WRD A;  5ELF A;  3SK6 A;  1VQI A;  4CDC C;  1LM0 A;  4HSV A;  2SEB D;  1N33 Q;  1HCZ A;  2NZO A;  2A68 C;  2CQA A;  1PTO C;  1VS0 A;  2B2W C;  3CD6 A;  2B2Y C;  1KL9 A;  2FMM A;  4RA8 A;  5C0X I;  2K5H A;  1VF7 A;  4JBJ A;  3SE0 A;  3OSO A;  3PUZ A;  1W2B A;  4LJZ C;  1F9Q A;  3H0G G;  1LTI D;  1HR0 L;  2IJ0 A;  1FNW A;  4LF8 Q;  3JAM c;  1NCV A;  5HY6 A;  2RCF A;  4UY8 C;  1Y1V B;  1JWM D;  3S14 H;  3T53 B;  1X56 A;  4V19 0;  2XVS A;  4KKU A;  5COR A;  4HJ7 A;  2Z1C A;  2B2U A;  2OF1 A;  1GUO A;  4HCE A;  2SDF A;  2EYO A;  1LTT D;  4FF4 A;  4C3I G;  3HP3 A;  3GTL B;  4R4I A;  4NMZ A;  4JI6 L;  4K5X A;  1F9P A;  3NPP A;  3H3V I;  4BY7 H;  1F9R A;  3K5O A;  3VYT A;  2NBF A;  1H9J A;  1HH2 P;  4C3J B;  1JJ2 A;  4DK3 C;  4ODG A;  1I50 H;  4RAU C;  1H9S B;  5I9P A;  2QCP X;  3VR6 A;  2JN4 A;  3SHL A;  1N34 L;  2B2T C;  3HKZ E;  3I73 A;  1N36 L;  2WV6 D;  1EU4 A;  2NVQ B;  2CH4 W;  1ZYR D;  2D2C C;  4IN3 A;  1MGS A;  4IUP A;  1X55 A;  4QF4 A;  4RMF A;  4A76 A;  5IT9 c;  2JEB I;  4OWW B;  3SK8 A;  1QVF A;  1I6V C;  1PRT C;  5IIF A;  2K28 A;  1H9S A;  1WTP A;  3D4W A;  4EVO A;  1YJ9 A;  2JA6 H;  4DXG A;  4KD3 A;  3HRZ C;  4RH6 A;  1M4V A;  3DWQ A;  3WOF A;  3NTI A;  3Q22 A;  4BY1 G;  2KBN A;  4OX9 L;  5E7N A;  4X65 L;  4JBW A;  3HOU G;  1G2S A;  2F3W A;  1SFO B;  2NVX B;  4DK6 C;  4C2M H;  3R93 A;  2B2T A;  5J39 A;  2ZTC A;  1CKO A;  3QO2 A;  4IO9 A;  3VYR A;  1Y8N B;  5IGG A;  1ZYR C;  1GUT A;  3I90 A;  1ESR A;  1VF5 C;  1SBB B;  3MEH A;  3ICE A;  2JEA I;  4CGY B;  3MXN A;  1BR9 A;  1A62 A;  2NZH A;  4MZ9 A;  2R93 G;  1BUV T;  3B6Y A;  1VQN A;  2DGY A;  4K5W A;  2K04 A;  3DHQ A;  1D5X C;  1PH2 A;  1HNW L;  4NDX A;  3RLN A;  4X62 Q;  3DMU A;  5COY A;  3CF5 A;  1N36 Q;  2JA6 G;  3D3R A;  5JOB A;  2A6H C;  4DV4 L;  4X62 L;  3K5L A;  4KHZ A;  4NXN Q;  1B44 D;  1DGS A;  1Z7T A;  1NE3 A;  2VS1 A;  1HNZ Q;  1HNX L;  3MXG A;  2HD3 A;  2F3I A;  2RBM A;  1SNC A;  4IFD J;  3DUZ A;  5EBC A;  1F9S A;  3D8G A;  2E75 C;  1T5X D;  3EVQ A;  4UPA A;  4HTH A;  1A2T A;  1IHZ A;  1J8I A;  4DAY B;  5FLX L;  3I70 A;  5E1F A;  3I91 A;  2K03 A;  3VR2 A;  1DYQ A;  1JJG A;  2Y0S B;  1YVC A;  1EEF D;  5C4H A;  3NE5 B;  1HUM A;  2MO1 A;  4MN3 A;  4XIG S;  2MHV A;  1X6O A;  3F2B A;  4B3R Q;  4LF4 Q;  3U4Z A;  1I4H A;  3PMF A;  1HFN A;  4CDF C;  2ZJP A;  1CKN A;  2DNE A;  1PDQ A;  2QDB A;  4K8I A;  3BYY B;  3V2T A;  3RR5 A;  2Q8R E;  3K58 A;  1C9O A;  5BR8 L;  3HS0 C;  4KD4 A;  2EYL A;  3MTS A;  3A55 A;  2Z6K C;  1D1I A;  1MIU A;  4M1U B;  2WB1 B;  3UDF A;  1BBW A;  1NUC A;  2Z9H A;  2F0T A;  4ZRZ A;  3SK4 A;  4JI7 L;  1QE6 A;  2JA5 H;  1PTO D;  3FPU B;  4KHP Q;  1KXL A;  2NZ1 D;  2KQ3 A;  3J81 i;  1S5C D;  3D0F A;  5BN4 A;  5C4X B;  4DR5 L;  4A93 H;  2EDG A;  2EJG C;  1L2F A;  2UUC Q;  4C3I H;  3MHB A;  3IL8 A;  4FXD A;  4JI6 Q;  2MNA A;  3N6R A;  5ELN A;  2JA5 G;  3HOX B;  4XTC S;  2NYZ D;  1VQC A;  2CFM A;  1HJP A;  3BVG A;  5IP7 H;  4LFA L;  4DAY A;  4JI2 L;  3R3O A;  1LO5 D;  3AQQ A;  4LF5 Q;  3E3X A;  2UUA Q;  5IT9 L;  1D2B A;  3MWY W;  2E76 C;  4A3M H;  1SDF A;  2WP8 J;  2CWA A;  3LWE A;  4R4C A;  3VA5 A;  5LL6 X;  1QUQ A;  1SE8 A;  2M00 A;  1JCK B;  2B8F A;  2NB0 A;  2OCE A;  4DU9 A;  3BJU A;  4CDE C;  2XRS D;  1J5E L;  5I2X A;  2N49 A;  4A3J B;  1SLJ A;  2EE1 A;  2IX0 A;  4QIW B;  4DR4 L;  1JE4 A;  3ULL A;  3S1R H;  2FXQ A;  4BXX G;  1YZ6 A;  1UAP A;  1EY6 A;  3J80 E;  5LMN W;  4JBK A;  2FMC A;  4APV A;  3D6C A;  1E22 A;  2BOS A;  1CA5 A;  3HOY B;  4N9P A;  2DJG C;  2BCO A;  4KLK A;  3I4N G;  2GVB A;  3J7Y W;  3TZD A;  5A2Q L;  4C3J H;  5C4Z A;  3HKS A;  4OIK A;  2IY5 B;  1YJW A;  4A93 B;  1I50 B;  4DR3 L;  1KLU D;  1YNJ C;  4FP5 D;  3D31 A;  2JA7 G;  2J7Z A;  4POF A;  4DR6 Q;  3HOU H;  2G5D A;  1VDZ A;  1S4Z A;  4MHE A;  4ALP A;  1L0Y B;  3QB3 A;  5IE8 A;  3NBH A;  2AQ3 B;  4DV3 L;  1LT5 D;  4M8A A;  2OQ0 A;  1VQJ A;  4DV2 L;  3RZD H;  2F0H A;  4FVM A;  2VQF L;  4HJ8 A;  4A3I G;  1A15 A;  1EZ6 A;  2Q8I B;  1VQK A;  2HHH Q;  3JAM E;  4K14 A;  2A6E C;  2YTV A;  1AZP A;  4WJ4 A;  3DM1 A;  4IOA A;  4FYD A;  3NTK A;  1EY9 A;  2K14 A;  3C1F A;  2RKS A;  4H44 C;  4JI2 Q;  4OO1 I;  4KMU C;  1UE5 A;  1F77 A;  1I4R A;  5GAG C;  5IGE A;  4J1M A;  3S1N B;  2VQF Q;  1I6H B;  2IW3 A;  3KOJ A;  2R93 B;  3URY A;  1R4P B;  2WAQ B;  3PGZ A;  1MBY A;  4IPH A;  5A2Q E;  4QJF A;  1CSP A;  4ZQ3 A;  4I65 A;  1ICF B;  1H9M A;  5J22 A;  1K73 C;  1AE2 A;  2VZA A;  4XQN A;  5T1G A;  5CV5 A;  5EKK A;  3AB9 A;  4MTK A;  2UUA L;  4DFA A;  1F2Y A;  1II3 A;  3CHB D;  4HJ9 A;  4JYA Q;  5GRO A;  1IW7 D;  2O4X A;  3JC6 6;  1LUZ A;  5K36 G;  5DNF A;  1XMO Q;  3H0G B;  4FDB A;  5CV8 A;  1SYD A;  3HOW H;  1VQL A;  2PW5 A;  4DR2 L;  1DJR D;  1XMO L;  4IQZ A;  1X3F A;  1XMQ L;  1ENA A;  5CGK A;  1TXY A;  3VDY A;  4LFC L;  2LFN A;  1UE1 A;  4HAE A;  3G6E A;  3RMH A;  1K0R A;  2EYJ A;  1SND A;  3RN5 A;  1XWE A;  2YTX A;  3FKI B;  5ELC A;  1VQH A;  2WB1 E;  4CDD C;  1SE4 A;  3P7J A;  2BH2 A;  2UXD Q;  1EEI D;  1MJC A;  2I5L X;  3CC7 A;  2EXZ A;  5EQ0 A;  4AYB E;  1X3P A;  4I7A A;  4RFB A;  2KCN A;  2KHI A;  5AFW A;  1QIL A;  5LMU L;  1JB7 A;  4C3H H;  1T9H A;  1EQT A;  2Z6K A;  4DPG A;  5FOB B;  4CBV A;  4Y52 H;  3CCS A;  4IUU A;  2Q2U A;  3STB C;  1STY A;  3WDN A;  1EFW A;  3RNU A;  1TS3 A;  2L5T A;  4ZKC B;  3BDL A;  3KF8 A;  3BS1 A;  1YJN A;  3OOC A;  4R9W A;  2LY7 A;  4E6I A;  2G9D A;  1OXV A;  4DR2 Q;  3DXJ C;  5KYL A;  2X6L A;  2DNC A;  2ZJQ A;  3C46 A;  3FP9 A;  1SNO A;  2XWJ B;  2EOT A;  1MKH A;  1E24 A;  1I3Q H;  1JMC A;  4X3U A;  3PIP 3;  3CMA A;  3TSS A;  4HIK A;  1MJE A;  4DR6 L;  2XSC A;  2I46 A;  2K1B A;  4K0K L;  4RCO A;  1KRS A;  4XDX A;  1S5E D;  2K75 A;  1EY8 A;  4GNX C;  4YIJ A;  4RGN A;  3IKJ A;  1WD1 A;  1SYC A;  4TSS A;  1EOV A;  4PZ8 A;  1CK1 A;  1M1K C;  4NXM Q;  1B9M A;  2SOB A;  5M9O A;  4EQN A;  3GO5 A;  3PQI A;  3K0X A;  2VB2 X;  1BVS A;  4LUO A;  5C44 G;  1UWV A;  2ZM6 Q;  2A1A A;  3KUP A;  4F8M A;  3RN2 A;  5LMN L;  4LFB L;  3H3V C;  2KVM A;  3SDZ A;  5D3I B;  1JJC B;  1V8Q A;  1BNZ A;  2Q2T A;  3R8B A;  2IPK D;  1PFN A;  1HZB A;  4UHV A;  2ZJR A;  4JI7 Q;  5IY0 A;  1PH8 A;  1DCZ A;  2F0M A;  3ZJY C;  4A3M G;  1PH5 A;  1WTR A;  5ELO A;  3HOV G;  1G8Z D;  1EQV A;  1UNS A;  1CSQ A;  1V1P B;  1IKM A;  1G2T A;  2LKV A;  3A7L A;  4DK1 A;  2VL6 A;  4JVZ A;  4BS9 A;  1HR0 W;  2EYP A;  1QNK A;  1C0A A;  2RDF A;  5G3L F;  1QG7 A;  1EOT A;  3RZD B;  4B3T Q;  4Y7N B;  4DAM A;  3ER0 A;  1RTO A;  3P75 A;  5E4W C;  1CZG A;  1RDP D;  4OX9 Q;  4A3D B;  3RD4 A;  3GTO H;  4DV7 L;  4ME3 A;  1DD2 A;  1SYF A;  1K8A C;  4L5Q A;  3S15 B;  4DV5 L;  1HTL D;  1Q90 A;  2RHQ B;  3KF8 B;  2KED A;  1O7Z A;  5D14 A;  3VYU A;  5M5W H;  2ZM6 L;  3J81 j;  1H9R A;  2RDH A;  4MIU A;  2N8N A;  2F0W A;  1VQ7 A;  1FJG L;  4IJH A;  1CI3 M;  2ICI A;  5CV9 A;  4A3I H;  3J80 c;  1LV9 A;  1IBK Q;  3HGB A;  3PO3 G;  1H95 A;  3KBG A;  1SYE A;  2D0P A;  2EY6 A;  3PUX A;  4DAP A;  1SYG A;  3IFT A;  1EY5 A;  2KCC A;  4R4O A;  1RJT A;  1SEB D;  4OWT B;  1GJX A;  4H02 A;  4L63 B;  1W6K A;  3Q0A A;  4DR7 Q;  4KKS A;  3NEM A;  1YNN C;  2R7F A;  1EWI A;  3O13 A;  4GLA C;  1FR3 A;  2LSS A;  3S9W A;  3QJY A;  2RSO A;  4JI8 Q;  1FJG Q;  1ROD A;  1TS5 A;  5E3F A;  2K4K A;  1RCV D;  1PYS B;  2WAQ G;  1A8V A;  3STB D;  2Q8T A;  1QVC A;  5EAY A;  1TY2 A;  2K5W A;  1ET9 A;  4IUV A;  2UUC L;  3SR1 A;  3CKI B;  1NMF A;  5C0X G;  5JJK A;  4DNI A;  2O2L D;  4L5T A;  4BXX H;  1D5M C;  1LT6 D;  3AEV A;  4DV0 Q;  1WJJ A;  4DV5 Q;  1Q8K A;  1CA6 A;  3CCV A;  4B9W A;  1GD7 A;  1VMC A;  2NVY H;  2NTT A;  3VR5 A;  3BDO A;  2L12 A;  2L15 A;  4QGU A;  3KLW A;  1GKH A;  1K8O A;  1PYB A;  1WD0 A;  5ELB A;  3KFU A;  2E2I H;  1D8L A;  1V1Q A;  3J80 L;  1RD9 D;  1UEA B;  4A3I B;  1G6Z A;  1TWH B;  2XNA C;  4RGO S;  1R9T H;  3CME A;  3L9A X;  1XYI A;  4QQB X;  2UXC Q;  3HZX A;  1U9R A;  3NSW A;  1XNQ Q;  2IHF A;  3SEB A;  1SNM A;  4X6A H;  3TEH B;  2ES2 A;  4BWG B;  1KDB A;  1LTL A;  1SYB A;  3I4O A;  4UP9 A;  3FRP B;  3J7A F;  3T1H L;  5M3M H;  4MTN A;  2PI2 E;  1RTN A;  2ICE C;  1NR4 A;  3EA6 A;  1PHJ A;  1B2T A;  1JT8 A;  5DM7 3;  4R4Q A;  2LXK A;  4PZ7 A;  4N8X 1;  4MNO A;  5JAV A;  2A69 C;  1JC7 A;  3S2D B;  2YV5 A;  1ASZ A;  2R7Z H;  2OXP A;  2E8G A;  1EFI D;  1XNQ L;  3OWF A;  4GN3 B;  5IT9 E;  2ENB A;  4LUZ A;  1X65 A;  1HHV A;  4BBR H;  1KDA A;  2B2W A;  4A3J H;  2ZT9 C;  4K6L A;  2JE6 I;  5BN3 A;  1NR2 A;  4KK7 A;  1QNU A;  2MFI A;  4DUY L;  3NQI A;  4DR1 L;  1E7Z A;  3HKZ B;  3TS0 A;  4N8F A;  3CRL C;  2AMC B;  4HID A;  4PMC A;  4WFN 3;  1DOM A;  4GNX A;  4ME5 A;  2B63 H;  1S5D D;  1D5Z C;  2DY7 A;  2ZXR A;  3G7L A;  2JXM B;  1YNX A;  1BDO A;  4X3T A;  2PYK A;  4UAI A;  2PI2 A;  5C4J B;  3GP7 A;  4Y7N H;  3DEP A;  3NWT A;  4DK0 A;  3F1Z A;  3AMU A;  3UDI A;  1STN A;  2K5D A;  3A8K E;  5I9O A;  1STH A;  5C4X G;  3CQZ H;  4DAV A;  4GKJ Q;  2C5C A;  3NP8 A;  2AKW B;  2Z6B A;  2E5L Q;  1PFB A;  4EGV A;  1JE5 A;  2WKC A;  3HOX H;  2N88 A;  3MZ5 A;  3EFX D;  2A8V A;  1KNA A;  2B2U C;  2WB1 G;  1K8M A;  3PO2 G;  4Q5V A;  3F8T A;  3CCR A;  3V05 A;  1O7I A;  3NBI A;  4XYQ A;  2HCC A;  1YIJ A;  4LF6 L;  2K05 A;  5CR3 A;  4ZCK A;  4Q0F A;  3G48 A;  2NN6 G;  3OYY A;  1OXX K;  5IGC A;  3I4M G;  3UDG A;  1TVX A;  3TQY A;  1VQ6 A;  1U5K A;  4FXK C;  4EQP A;  4JBM A;  5D3D A;  1STE A;  1HXY D;  2QKI C;  1U4R A;  1SMX A;  4H7B A;  3RUZ A;  4HIM A;  3TP8 A;  4A3G B;  3QG1 A;  4B08 A;  2VUM B;  3S1R B;  4ZKB B;  2BDN A;  2O5I C;  3J7A V;  3HOU B;  2GVA A;  1CTM A;  5FLX E;  4YHH Q;  5JJI A;  1CHP D;  3KYH C;  4LF9 L;  5M5Y B;  4A3B H;  2I5M X;  5JJL A;  4BY7 B;  4A3D H;  5JVH 3;  5IYC H;  3PO3 B;  4JPB W;  3KJO A;  3S2D H;  3S1Q B;  4YWK A;  1XTD A;  1TKW B;  3J81 c;  3X3N A;  3MXP A;  5F2D A;  4QUC A;  1K83 B;  4B3M L;  2EIF A;  1QVG A;  4LF4 L;  4G4K A;  4LAA A;  4EQO A;  3GTJ B;  3X3M A;  1K3B C;  3HOZ H;  2B39 A;  4LF9 Q;  3GTQ B;  1ZXT A;  1DM0 B;  3MEF A;  4DR3 Q;  3E5S A;  5C3E B;  4A3C G;  3CRK C;  4XT3 B;  1HA6 A;  4B9X A;  4R1J A;  1E3P A;  2IWH A;  1Q1B A;  1LLR D;  1YI2 A;  2EQS A;  1FNU A;  2BA0 A;  3GTP B;  5ELE A;  2O5J C;  4C3J G;  3M4O H;  4A3E H;  4QUF A;  1P8L A;  4L5R C;  3K7U C;  1X3E A;  3ULJ A;  2MP1 A;  3S24 A;  2JA7 H;  1PZJ D;  1WCM G;  5EPK A;  2K5V A;  1HNX Q;  2SNM A;  1TS4 A;  4C3I B;  4HN7 A;  1ZEQ X;  5GQO A;  2NVX H;  2N55 A;  1GHJ A;  4A3F G;  2F0Q A;  4F88 A;  3CC4 A;  4KN4 C;  5T1I A;  2HT1 A;  2MPM A;  1Q3L A;  4TKO B;  2F1M A;  5C5L A;  3OTO Q;  2JYO A;  1IYV A;  2NN6 H;  3QOL A;  2F4V Q;  2R3Z A;  1B53 A;  4HED A;  1I94 L;  3GTM H;  2WFW A;  1B3A A;  1E2Z A;  4FO2 A;  1G91 A;  1XX8 A;  4EQ5 A;  3ERS X;  4QY7 A;  4P2C B;  2IHE A;  1EYG A;  1BOS A;  3A0J A;  2E2I B;  2LXJ A;  1WFQ A;  1A63 A;  1IL2 A;  1KHI A;  1KDC A;  1PH1 A;  3S16 B;  1M8A A;  1Y1V H;  2KA7 A;  1IBM L;  4FF1 A;  4JI4 L;  1NTG A;  1F2M A;  2AHO B;  4A3D G;  4PNY A;  4LF5 L;  3VR4 A;  3HOY H;  3SXH A;  2ZXP A;  3EIV A;  3M4P A;  1VQ5 A;  3G6J B;  1MSG A;  3KLS X;  4C2M B;  3CCL A;  1LAB A;  3K0Y A;  3V96 A;  2WIN B;  2D9U A;  2QA4 A;  2PCF B;  3G4S A;  4CKC A;  3OIP A;  3HOV B;  3GTO B;  1WTW A;  3ULP A;  2PZT A;  1CUK A;  5IWA Q;  1STG A;  2OEO A;  1B50 A;  1WVL A;  3TBI B;  5KEE A;  1DZ1 A;  1EYC A;  1TR5 A;  2Z8L A;  4DV7 Q;  1Y1V G;  1ILP A;  3CCE A;  2XRQ D;  3AYH B;  1YHA A;  2A73 B;  2BH8 A;  1YNN D;  1K28 A;  5K5P A;  4GKJ L;  2EYH A;  4IUT A;  4DN4 M;  3I4M H;  3MFG A;  1E1T A;  2E2J H;  3K80 C;  1O80 A;  2R92 H;  1PTO H;  4A3K G;  4B3M Q;  3I55 A;  3PCO B;  4OO1 G;  3T56 B;  1Z9F A;  4GNX B;  4LF7 L;  5KGU A;  3H15 A;  1QZG A;  3KBX A;  4O1N A;  2NUC A;  3GV6 A;  2JP1 A;  1S72 A;  4PMB A;  4XYO A;  1BCP F;  1EY0 A;  2RSN A;  3U58 A;  3CCM A;  1WTV A;  2N78 A;  1ONL A;  4FNF A;  4WOR A;  5IGB A;  3TP6 A;  5EJW A;  4LFA Q;  1EWC A;  1KAW A;  1VQG A;  2MO0 A;  5NUC A;  1K9M C;  3T13 A;  4CJ0 B;  1J6Q A;  1X3G A;  1HR0 Q;  2K5N A;  5JEA J;  5IOC A;  4AQY L;  1D7Q A;  1PRT D;  2JA9 A;  4KJN A;  1IKL A;  5IYB G;  2QEX A;  4JI8 L;  5JVG 3;  1HNZ L;  1EIY B;  3GTK B;  2JA8 G;  3FHW A;  4RWS C;  1IYU A;  4U67 3;  2AQ1 B;  3DWA A;  2F4I A;  1EIH A;  5IGD A;  2KUM A;  1K8G A;  4WJW A;  3K57 A;  1IYJ B;  1QB5 D;  4LW1 A;  1GUS A;  3N52 A;  4KKT A;  5KIX A;  3NEL A;  5FO9 B;  3T1H Q;  3NHH A;  2RA4 A;  1I6H H;  2BE5 C;  4DA2 A;  1WOC A;  3I7F A;  4JI0 L;  5C6A A;  1L1O A;  4DV1 Q;  1B7Y B;  1I4Q A;  4DV0 L;  3A54 A;  1TWA H;  5KNC A;  3VA7 A;  3GQB A;  2L0C A;  3BU2 A;  4C56 C;  1PH9 A;  3K7A B;  3MXU A;  2KOL A;  3C3L A;  2Z4I A;  1LTB D;  1J9O A;  2WKD A;  2DN8 A;  3WOE A;  3CAM A;  1PZK D;  4C1N I;  2CVR A;  1DXM A;  1N34 Q;  4OON A;  3JAM L;  1GVP A;  3TRZ A;  1VQF A;  4X64 L;  1KTK A;  3MC0 B;  1F2Z A;  1HZA A;  4YCV A;  4DR4 Q;  1A0I A;  2IL8 A;  1EL0 A;  4NKL A;  5L37 A;  1DOL A;  4ZLT F;  5KNB A;  2L55 A;  4BBS G;  2XWB B;  3OWE B;  3M7G A;  4GN4 B;  1AE3 A;  3S14 B;  1WI5 A;  3FMC A;  5IP9 G;  3FDT A;  3BYT B;  4OEM B;  1EQQ A;  3PIP A;  5BN5 A;  2JA7 B;  2LS0 1;  2IT1 A;  5DEH A;  4S3S A;  2C35 B;  1PVO A;  2J4X A;  3K81 C;  3CC2 A;  1EQR A;  4O0A A;  4A3F B;  3TN2 A;  3I4N B;  2KCM A;  2K33 A;  5M3F H;  2VUM G;  4DNT B;  1FYC A;  3HOY G;  3K8A A;  3NXW A;  1PA6 A;  1E2V A;  1RKN A;  1WCM B;  2GA4 B;  2H4O A;  1Y1W H;  1YEZ A;  2TMP A;  3BVM A;  2RCN A;  2UXC L;  4G7O C;  1FGB D;  4QB4 A;  4C1N K;  4IPG A;  1NJI C;  2Z4H A;  1GXD C;  4P74 A;  4DR5 Q;  3L7Z C;  4NP5 A;  3ERO A;  4LWC A;  1I94 Q;  3PO2 B;  3S1Q H;  1LT4 D;  2D0O A;  4JI0 Q;  2MGS A;  3S1M H;  1HQR D;  1MD2 D;  1C8C A;  2EY2 A;  1G51 A;  1ICW A;  2AWO A;  1HNW Q;  3J80 i;  1GUG A;  3QOJ A;  5C3X A;  3GTJ H;  4B3T L;  1TII D;  1GOZ A;  1QWY A;  2EJF C;  4J15 A;  2Z0S A;  1Y8P B;  1YHQ A;  1EZ8 A;  2A6H D;  2JQO A;  2K5Q A;  5M3F G;  2VUM H;  3H94 A;  1A2U A;  4LF7 Q;  3QIA A;  1TT2 A;  3M3Y B;  4UP8 A;  1R9T B;  2UXD L;  4BY7 G;  4A3E B;  2VXW A;  1PV4 A;  2WII B;  5M3M G;  1E1O A;  5JEA H;  1B8A A;  1QOH A;  3HKZ G;  3RLO A;  2PPB C;  4A93 G;  2KJX A;  1OXS C;  2F0F A;  4KY5 A;  4NB3 A;  1Y8O B;  4BA1 I;  4XXE A;  4LFC Q;  3JAM i;  3C1E A;  3L0O A;  3T4A C;  3A5Z B;  1O7Y A;  3Q8D A;  4ZK9 B;  4DUZ Q;  5CC4 A;  4A3L H;  4A3G G;  2UXB L;  3G71 A;  1U4L A;  1VQ8 A;  1JQY D;  1G29 1;  4H13 C;  3MFY A;  3IAY A;  1VQ9 A;  3I4M B;  3BZD B;  1I5F A;  1GO3 E;  2ID0 A;  4A3J G;  1KAA A;  1PH7 A;  4R8I A;  2PQA A;  3BZK A;  1X3Q A;  5M5X H;  4AH6 A;  4JI1 L;  3I4L A;  3E6Z X;  2XN9 C;  3SK5 A;  1BF4 A;  1WTO A;  4IAL A;  3J81 L;  2UU9 Q;  1UUP A;  2B63 B;  2Y0S G;  2K32 A;  1QUQ B;  5DLQ E;  5FO7 B;  3S17 H;  3ND9 A;  3NUC A;  4P71 A;  3FKI H;  2R61 A;  3M3Y H;  4DXF A;  1XMQ Q;  1ET6 A;  2AWN A;  3MA2 B;  1VCI A;  3D6W A;  3CXC A;  1SSO A;  1KC8 C;  3CPF A;  1C7Y A;  3A7A B;  2JJQ A;  3K5N A;  4IUR A;  4GLV B;  3CCU A;  4PV1 C;  1N33 L;  2FFK B;  5CMD A;  4L6T B;  3W1G A;  1WTX A;  1RL2 A;  5C3W A;  3FVQ A;  2YTY A;  1N32 Q;  3AFP A;  4OHJ A;  1VQB A;  3CCJ A;  4LFB Q;  3VYS A;  3PSI A;  2KEN A;  2YU9 B;  2UUB L;  4J8Q A;  1TY0 A;  1PRT F;  1FNV A;  5H1S E;  1U4M A;  3P1H A;  5GAD C;  3W5O A;  1U0L A;  5DAU A;  3F2U A;  2OQK A;  3Q6S A;  5FO8 B;  3M4O B;  1L0X B;  1CHQ D;  3OHX C;  1OXU A;  3D4D A;  1IBL Q;  1O7L A;  1TWH H;  3M7N A;  4LUV A;  5AJ3 Q;  3H09 A;  3E0E A;  2L4N A;  3CP0 A;  4A3F H;  2CW0 C;  2FHT A;  3MVV A;  4A3G H;  3ND8 A;  5IYD G;  4HR7 B;  3NBH B;  2I07 B;  1IBM Q;  3T1Y Q;  4BY1 H;  1WCM H;  1Y1W B;  3E0J A;  3KLS A;  2XTI A;  3Q24 A;  1IW7 C;  4RGT A;  1GUW A;  1GHK A;  3LX0 A;  4A3K H;  1VQO A;  3LNN A;  1QCB D;  3KJP A;  1XNR Q;  4JOI C;  4P72 A;  3F2D A;  1HA5 A;  4YWL A;  3TDQ A;  4X66 Q;  1B70 B;  4DV3 Q;  1J5E Q;  3T16 A;  3NK9 A;  3GTQ H;  4JI3 Q;  4GKK L;  4K5V A;  1BO0 A;  4OEL B;  1IL8 A;  4DNR B;  4CJ2 C;  3HOZ G;  2EYM A;  4ZUJ A;  2F0S A;  1EU3 A;  5EPJ A;  3J7Z C;  2JA6 B;  2D62 A;  1Q12 A;  3J7A 5;  4HCS A;  1HUN A;  2MJ8 A;  2HQE A;  1LT3 D;  5ISR A;  1S5F D;  4POG A;  1E0B A;  2F0P A;  1ILQ A;  2TSS A;  1IBL L;  1K0S A;  2RVL A;  3GV3 A;  2K01 A;  1GUN A;  1PMR A;  3R2T A;  1CT1 D;  3GTP H;  4AYB B;  1EY7 A;  1SE3 A;  4OWX B;  1O78 A;  1AN8 A;  2A5H A;  3OMG A;  4DV6 Q;  1TWA B;  1FGU A;  1VQM A;  4JV5 Q;  4NXN L;  2F4V L;  2XIW A;  2JK8 A;  5GAE C;  3FPP A;  4HIO A;  2NVT B;  3DM3 A;  4L5S A;  5DM6 3;  2V4D A;  2JSO A;  1Y14 B;  3OIQ A;  1JOK A;  4DUY Q;  4TQU S;  3CQZ B;  4BBR B;  2FJ2 A;  3M4Y A;  4GZY C;  4CKE A;  1W3S A;  4OO1 H;  2DY8 A;  3PUY A;  4LMQ D;  1JIC A;  3S16 H;  1VQP A;  2CCZ A;  1FVI A;  1SAP A;  4YWM A;  2QGQ A;  3RZO H;  1B9N A;  4RCN A;  2UUB Q;  1BKB A;  2ZTD A;  3A5U A;  2GN5 A;  3UE0 A;  3GTL H;  2CHB D;  1CKN B;  1EWH A;  1Q86 C;  4OXP A;  3LWU A;  3MXN B;  4GN5 A;  2ZTE A;  2Q2I A;  3H6M A;  1A3U A;  4YY3 L;  4RG1 A;  2HIV A;  1SXT A;  4HJA A;  1DOK A;  2HHH L;  2R6G A;  5CBA E;  3K5M A;  1PRT B;  4RHR A;  3F2C A;  2B2V C;  2XGT A;  3S2H B;  3ONA B;  4GS3 A;  4BA2 I;  1PFM A;  5C0X J;  1TWF H;  1HZC A;  3ERQ A;  4GLX A;  1LTR D;  3A56 A;  2J0T D;  2QW7 A;  3I56 A;  1B1Z A;  2PZW A;  1X32 A;  4XT1 B;  3HFZ B;  2F0K A;  4JC0 A;  3PIO 3;  1UEB A;  5IP9 H;  2RF4 A;  3S15 H;  2CQO A;  3KDF A;  1SN8 A;  2F3V A;  3TRE A;  2P5Z X;  3H0G H;  4P73 A;  4ZUI A;  3GTM B;  3A8J E;  2CH4 A;  4JI1 Q;  2JA8 B;  1SMY D;  1AW7 A;  2CW0 D;  1NNX A;  5BR8 Q;  5C44 B;  1WTQ A;  2PO4 A;  2EYF A;  3W3A A;  1PH6 A;  4QCL A;  3BG3 A;  1TS2 A;  2R93 H;  3I8Z A;  5M5Y H;  4B3R L;  2LMC B;  3WWV A;  5FK9 C;  4DV1 L;  3T1Y L;  1GM5 A;  1I4X A;  3PO3 H;  4PQX A;  1SRO A;  3GD7 A;  1S5B D;  1P16 A;  1FD7 D;  5IYD H;  4GOP B;  3DLL A;  1C48 A;  4PZ6 A;  3TP7 A;  1KRT A;  5LMN Q;  4QIW E;  3PV0 A;  2A69 D;  3HEJ A;  4DV6 L;  1YBY A;  2E2H H;  3PF5 A;  4G7H C;  1E2W A;  3GTK H;  2R7Z B;  1BCP B;  2F0I A;  5GAH C;  3HOV H;  1B4O A;  4IPD A;  2DUD A;  4RKB A;  3ZYY X;  5KRU A;  5IYB H;  2NN6 I;  2QF7 A;  1BBU A;  3HOW G;  4JI5 L;  4ID6 A;  4KV6 A;  1NAP A;  1SE2 A;  4DR7 L;  5FJ8 H;  3LGJ A;  1AP0 A;  5J1Z A;  2UU9 L;  4A3B G;  4PMW A;  3S1N H;  1EY4 A;  2ALY B;  4HSP A;  1BCP C;  1NY4 A;  2EY5 A;  1PZI D;  5HGQ A;  4ZYS A;  1U4P A;  4FF2 A;  1VMP A;  2KEC A;  4LNQ A;  5G3L D;  4AYB G;  1SNQ A;  1PFS A;  2IX3 A;  4K8J A;  4L8J A; 
#chains in the Genus database with same CATH homology
 2YYZ A;  1JJ2 A;  4DK3 C;  3CPW A;  1I50 H;  5C4J H;  3S2H H;  2F52 A;  4B3T Q;  1Q1E A;  4DAM A;  3ER0 A;  1N9W A;  1N34 L;  3PIO A;  3FKI G;  3HKZ E;  4DV4 Q;  4DR1 Q;  5C3E G;  4OX9 Q;  3CAM A;  1IXR A;  3GTO H;  4DV7 L;  1N36 L;  4ME3 A;  1N34 Q;  4OON A;  1K8A C;  4L5Q A;  1GVP A;  3TRZ A;  1VQF A;  1ASY A;  4DV5 L;  4X64 L;  3M4Q A;  2RHQ B;  3KF8 B;  4JCV E;  5M5W H;  1X55 A;  2ZM6 L;  3J81 j;  4JI5 Q;  1SR3 A;  2NVQ H;  1V9P A;  1HZA A;  2K52 A;  4YCV A;  4RMF A;  4A76 A;  4DR4 Q;  1A0I A;  5IT9 c;  2JEB I;  4OWW B;  1X54 A;  4GOP A;  2N8N A;  1QVF A;  1VQ7 A;  1FJG L;  4IJH A;  2HQL A;  4NXM L;  4A3I H;  3J80 c;  1IBK Q;  3PO3 G;  4BBS G;  1H95 A;  5C3E H;  4GN4 B;  4JG2 A;  1AE3 A;  2D0P A;  1WI5 A;  1YJ9 A;  2I5H A;  3PUX A;  5IP9 G;  2JA6 H;  4BBR G;  4X64 Q;  1EIF A;  1SFO H;  1EQQ A;  3PIP A;  1UE7 A;  2IT1 A;  4R4O A;  2C35 B;  4BY1 G;  1PVO A;  2KBN A;  4OX9 L;  4OWT B;  5E7N A;  4H02 A;  3K81 C;  4JBW A;  4X65 L;  3CC2 A;  3HOU G;  1EQR A;  4O0A A;  4DR7 Q;  2CWP A;  3NEM A;  4C2M H;  4DK6 C;  2NVT H;  2KCM A;  2MQH A;  2R7F A;  2ZTC A;  1CKO A;  5M3F H;  4IO9 A;  4LF8 L;  1EWI A;  2VUM G;  3K8A A;  3HOY G;  1PA6 A;  4GLA C;  1Y1W H;  2LSS A;  2RHS B;  1FJG Q;  1YEZ A;  4JI8 Q;  3ICE A;  3I4N H;  2JEA I;  5JEA G;  2K4K A;  1SRU A;  1PYS B;  2RCN A;  2UXC L;  1Q7Y C;  2WAQ G;  1A8V A;  1A62 A;  3STB D;  2NZH A;  1QVC A;  4MZ9 A;  5EAY A;  2R93 G;  3B6Y A;  2UUC L;  1VQN A;  2DGY A;  4IPG A;  1NMF A;  1NJI C;  5C0X G;  5JJK A;  4DNI A;  4P74 A;  4DR5 Q;  4L5T A;  3L7Z C;  1OTC A;  4BXX H;  3AEV A;  4DV0 Q;  4LWC A;  1I94 Q;  2HIX A;  1WJJ A;  4DV5 Q;  3S1Q H;  1PH2 A;  1Q8K A;  2D0O A;  3CCV A;  2YU9 H;  4JI0 Q;  3S1M H;  1HNW L;  1GD7 A;  3RLN A;  4X62 Q;  2VNU D;  1N36 Q;  3CF5 A;  2NVY H;  2JA6 G;  4DV4 L;  3PO2 H;  1YHB A;  3A74 A;  1G51 A;  4X62 L;  2AWO A;  2L15 A;  3J80 i;  1HNW Q;  3M9B A;  4IJL A;  4QGU A;  3KLW A;  3GTJ H;  1GKH A;  2VQE L;  4B3T L;  4KHZ A;  5LMU Q;  1PYB A;  4NXN Q;  3KFU A;  1DGS A;  2E2I H;  1D8L A;  1NE3 A;  1V1Q A;  2PMZ E;  2VS1 A;  1M90 C;  4J15 A;  2Z0S A;  1HNZ Q;  1HNX L;  1YHQ A;  1R9T H;  2JQO A;  3CME A;  2F3I A;  1KQS A;  5M3F G;  2VUM H;  4QQB X;  4IFD J;  2UXC Q;  4LF7 Q;  1OXT A;  4AQY Q;  1XPO A;  1XNQ Q;  4QL5 A;  4UPA A;  2IHF A;  3EN2 A;  4UP8 A;  2UXD L;  1L1O C;  4X6A H;  3W1B A;  4DAY B;  4BY7 G;  3TEH B;  2ES2 A;  4DUZ L;  2VY3 A;  3EBE A;  1XJV A;  1LTL A;  3I4O A;  1Y1W G;  1PV4 A;  4UP9 A;  5M3M G;  4YY3 Q;  1E1O A;  4A75 A;  1JJG A;  3T1H L;  3PUW A;  5M3M H;  1KD1 C;  3K7A H;  1B8A A;  4IPC A;  2PI2 E;  3HKZ G;  4MTN A;  1VQA A;  1YVC A;  3RLO A;  2B63 G;  4A93 G;  1PHJ A;  1JT8 A;  4K0K Q;  5FLM G;  3U50 C;  1OXS C;  4R4Q A;  4NB3 A;  2LXK A;  4PZ7 A;  4BA1 I;  4MNO A;  4LFC Q;  2MO1 A;  3JAM i;  3L0O A;  4XIG S;  3A5Z B;  3Q8D A;  4DUZ Q;  1X6O A;  3F2B A;  4AIM A;  4A3L H;  4A3G G;  4B3R Q;  4LF4 Q;  2YV5 A;  3U4Z A;  1IBK L;  1ASZ A;  2R7Z H;  3G71 A;  2E8G A;  4GKK Q;  2UXB L;  1VQ8 A;  1L1O B;  2ZJP A;  1XNQ L;  1G29 1;  1CKN A;  4GN3 B;  1VQ9 A;  1I5F A;  1GO3 E;  1K83 H;  1X65 A;  4LUZ A;  3RR5 A;  2ID0 A;  4X66 L;  1VQE A;  4BBR H;  4A3J G;  1PH7 A;  4A3J H;  1XNR L;  1C9O A;  2PQA A;  5BR8 L;  1XPR A;  2JE6 I;  3BZK A;  3S2D H;  5M5X H;  4AH6 A;  2Z6K C;  4JI1 L;  1MIU A;  3UDF A;  1BBW A;  2MFI A;  2PNH A;  2BA1 A;  2UU9 Q;  4JI7 L;  4DUY L;  2N3S A;  4DR1 L;  5C4X H;  1E7Z A;  4R4T A;  3TS0 A;  2JA5 H;  2Y0S G;  1G6P A;  4KHP Q;  1KXL A;  2AMC B;  1QUQ B;  5DLQ E;  4HID A;  3S17 H;  3J81 i;  5AJ3 L;  1RIP A;  3D0F A;  5FLM H;  3HOX G;  4GNX A;  2B63 H;  4P71 A;  4EX5 A;  4DR5 L;  4A93 H;  3FKI H;  4JV5 L;  3M3Y H;  1YNX A;  1XMQ Q;  4KI0 A;  1L2F A;  2AWN A;  2OWO A;  3BZC A;  1VCI A;  2UUC Q;  4C3I H;  2K50 A;  4A4I A;  4JOI A;  3CXC A;  2PI2 A;  1KC8 C;  3CPF A;  1C7Y A;  4Y7N H;  4LF6 Q;  4JI6 Q;  2JJQ A;  3F1Z A;  2MNA A;  4P75 A;  3UDI A;  2ASB A;  4GLV B;  5ELN A;  1TWG H;  2A19 A;  3CCU A;  2JA5 G;  5C4X G;  4XTC S;  3CQZ H;  1VQC A;  2CFM A;  1HJP A;  1NBW A;  5IP7 H;  4LFA L;  1N33 L;  4GKJ Q;  1S3O A;  2AKW B;  4UP7 A;  3W1G A;  2E5L Q;  1RL2 A;  4JI2 L;  3AQQ A;  1JE5 A;  2Y0S E;  2YTY A;  3I2Z A;  3HOX H;  2UUA Q;  4LF5 Q;  1UE6 A;  1N32 Q;  3AFP A;  1VQB A;  3CCJ A;  2A8V A;  2E5L L;  4LFB Q;  4A3M H;  4TVA B;  2WP8 J;  2WB1 G;  2CWA A;  2KEN A;  3PSI A;  4R4C A;  1QUQ A;  1SE8 A;  5IWA L;  2UUB L;  3PO2 G;  5FLX c;  3F8T A;  3KF6 B;  3CCR A;  5H1S E;  1O7I A;  2OCE A;  3BJU A;  3SGI A;  1YIJ A;  5GAD C;  1J5E L;  3W5O A;  1U0L A;  2N49 A;  4LF6 L;  2OQK A;  1SLJ A;  2I0Q A;  3G48 A;  2NN6 G;  2IX0 A;  3OYY A;  4DR4 L;  1OXX K;  3I4M G;  1XPU A;  3ULL A;  3UDG A;  3S1R H;  2FXQ A;  4IFD I;  4BXX G;  1YZ6 A;  3TQY A;  1VQ6 A;  1OXU A;  1U5K A;  5LMN W;  4YCW A;  1IBL Q;  5C44 H;  4JBK A;  4JBM A;  4APV A;  1TWH H;  1E22 A;  1SMX A;  2VW9 A;  4HIM A;  3UE1 A;  3M7N A;  2PQA B;  4KLK A;  3I4N G;  1QZH A;  2GVB A;  4LUV A;  5AJ3 Q;  3E0E A;  3CP0 A;  4C3J H;  2ATW A;  4A3F H;  3HKS A;  2IY5 B;  4A3G H;  1YJW A;  2GVA A;  4DR3 L;  5IYD G;  4YHH Q;  1IZ6 A;  3NBH B;  4JI4 Q;  1IBM Q;  5JJI A;  3KYH C;  4LF9 L;  2JA7 G;  3T1Y Q;  4POF A;  1CKM A;  1WCM H;  4B3S Q;  4BY1 H;  4A3B H;  4DR6 Q;  3HOU H;  1FL0 A;  1KIX A;  2XTI A;  2I5M X;  5JJL A;  4ALP A;  4A3E G;  4A3D H;  2WAQ E;  5IE8 A;  5IYC H;  4DV3 L;  4A3K H;  5J3B A;  3KJO A;  1VQO A;  1XNR Q;  3KJP A;  1EUJ A;  4IOC A;  4JOI C;  4P72 A;  3F2D A;  2OQ0 A;  1VQJ A;  4YWK A;  1XTD A;  4YWL A;  4DV2 L;  3RZD H;  3KDF B;  3J81 c;  4X66 Q;  1B70 B;  3PUV A;  3L2P A;  4DV3 Q;  1J5E Q;  2VQF L;  4HJ8 A;  4A3I G;  4BBS H;  4B3M L;  3GTQ H;  4JI3 Q;  1VQK A;  2HHH Q;  2EIF A;  1QVG A;  4GKK L;  4LF4 L;  2UXB Q;  5IP7 G;  2YTV A;  4WJ4 A;  3HOZ H;  4LF9 Q;  1WYD A;  1Q46 A;  3HOZ G;  4IOA A;  2JA8 H;  3MEF A;  4DR3 Q;  2K14 A;  4A3C G;  2OTL A;  3J7Z C;  1N32 L;  2R92 G;  2D62 A;  1Q12 A;  4R1J A;  1E3P A;  1K3R A;  4JI2 Q;  4HJ5 A;  3J7A 5;  1Q1B A;  4POG A;  1YI2 A;  4OO1 I;  1TWC H;  1UE5 A;  5GAG C;  2EQS A;  1IBL L;  2BA0 A;  4JI3 L;  3M4O H;  4A3E H;  2VQF Q;  1P8L A;  4L5R C;  3KOJ A;  1YIT A;  5IYC G;  3K7U C;  1X3E A;  3ULJ A;  3GTP H;  4DV2 Q;  3S24 A;  3PGZ A;  4OWX B;  4IPH A;  2B3G A;  4QJF A;  2JA7 H;  4DKA C;  1WCM G;  3RLF A;  2K5V A;  1CSP A;  3UDX A;  4DV6 Q;  3M85 A;  1HNX Q;  1FGU A;  1VQM A;  3NEN A;  4JV5 Q;  4NXN L;  1K73 C;  1AE2 A;  2F4V L;  5GQO A;  2JK8 A;  5GAE C;  2NVX H;  2VZA A;  2VQE Q;  4HIO A;  4A3F G;  1HZ9 A;  3DM3 A;  3PF4 A;  4L5S A;  3OW2 A;  2UUA L;  3CC4 A;  1Y14 B;  4DUY Q;  2HT1 A;  4TQU S;  4JI4 L;  1AH9 A;  4HJ9 A;  3CCQ A;  2V1C C;  3TS2 A;  3OTO Q;  2R7D A;  2F4V Q;  4JYA Q;  1X9N A;  1I94 L;  5GRO A;  3JC6 6;  3GTM H;  1LUZ A;  2WFW A;  5K36 G;  1VQ4 A;  1XMO Q;  1W3S A;  4EQ5 A;  3PUY A;  2B29 A;  3ERS X;  4FDB A;  3S1N H;  4QY7 A;  3HOW H;  2IHE A;  1EYG A;  1VQL A;  3S16 H;  4DR2 L;  1VQP A;  3A0J A;  1XMO L;  2CCZ A;  2LXJ A;  1WFQ A;  1X3F A;  1XMQ L;  1A63 A;  1FVI A;  1IL2 A;  1KHI A;  4YWM A;  2QGQ A;  4JYA L;  3RZO H;  1PH1 A;  4IFD G;  1Q81 C;  1TXY A;  1Y1V H;  2UUB Q;  3VDY A;  1BKB A;  1N8R C;  4LFC L;  2ZTD A;  3A5U A;  3AFQ A;  1UE1 A;  1IBM L;  2H5X A;  3GDE A;  3U4V A;  4YHH L;  1NTG A;  2GN5 A;  1K0R A;  3G6E A;  3UE0 A;  2AHO B;  3GTL H;  4X65 Q;  4A3D G;  1CKN B;  1Q86 C;  4OXP A;  3E9H A;  3RN5 A;  3MXN B;  4LF5 L;  4GN5 A;  2ZTE A;  4A3L G;  2Q2I A;  2YTX A;  3HOY H;  3GTG H;  1VQH A;  2WB1 E;  3EIV A;  4YY3 L;  4RG1 A;  3M4P A;  2HIV A;  1VQ5 A;  4HJA A;  2BH2 A;  2HHH L;  2R6G A;  3CCL A;  2UXD Q;  4PG3 A;  3E9I A;  1L0W A;  1MJC A;  2I5L X;  3F2C A;  3CC7 A;  2Q2H A;  2XGT A;  2QA4 A;  4GS3 A;  1PH3 A;  4AYB E;  3G4S A;  4BA2 I;  5C0X J;  1TWF H;  2KHI A;  1HZC A;  4GLX A;  4WJ3 M;  3ULP A;  1S40 A;  3I56 A;  5LMU L;  1CUK A;  3HFZ B;  1JB7 A;  5IWA Q;  4JC0 A;  4C3H H;  1UEB A;  1T9H A;  2KHJ A;  4O2D A;  5IP9 H;  2Z6K A;  2OTJ A;  4DPG A;  1HR0 W;  5FJ8 G;  2RF4 A;  3IRB A;  4KHP L;  4Y52 H;  4DV7 Q;  1Y1V G;  3CCS A;  3CCE A;  1PH4 A;  3S15 H;  3AYH B;  1YHA A;  2BH8 A;  2CQO A;  3KDF A;  1SN8 A;  3KF6 A;  3STB C;  2Q2U A;  3TRE A;  3H0G H;  1EFW A;  4P73 A;  3RNU A;  4GKJ L;  3I4M H;  4A3C H;  1E1T A;  2E2J H;  3K80 C;  2EXD A;  4JI1 Q;  1VQD A;  1Z47 A;  2R92 H;  1LYL A;  4A3K G;  4B3M Q;  1YJN A;  3I55 A;  3PCO B;  5BR8 Q;  4GOP C;  1OXV A;  4OO1 G;  4DR2 Q;  1Z9F A;  4GNX B;  2CKZ B;  4LF7 L;  1PH6 A;  1V43 A;  3H15 A;  1QZG A;  2R7Z G;  2ZJQ A;  3CW2 C;  2R93 H;  4YCU A;  3FP9 A;  1Q82 C;  1S72 A;  1MKH A;  1E24 A;  1I3Q H;  5M5Y H;  1JMC A;  4B3R L;  1NMG A;  3OTO L;  3WWV A;  3H3V H;  3CMA A;  4DV1 L;  2KCT A;  4HIK A;  3T1Y L;  1MJE A;  1GM5 A;  4B3S L;  2IX1 A;  4DR6 L;  4NPS A;  4K0K L;  1KRS A;  3PO3 H;  1VQI A;  1SRO A;  3GD7 A;  2K75 A;  3U58 A;  3CCM A;  1LM0 A;  2N78 A;  4GNX C;  1P16 A;  4LFA Q;  1N33 Q;  4GOP B;  3DLL A;  5IYD H;  4PZ6 A;  1KAW A;  2NZO A;  1EOV A;  4QIW E;  1VQG A;  2MO0 A;  3PV0 A;  1KRT A;  5LMN Q;  2E2H H;  4DV6 L;  1YBY A;  1K9M C;  1VS0 A;  3CD6 A;  1J6Q A;  4PZ8 A;  3PF5 A;  1M1K C;  4NXM Q;  1X3G A;  1HR0 Q;  2K5N A;  1KL9 A;  5JEA J;  5C0X I;  3GO5 A;  2K5H A;  4JBJ A;  4AQY L;  3GTK H;  1D7Q A;  2JA9 A;  3PUZ A;  3K0X A;  5GAH C;  5IYB G;  3HOV H;  2QEX A;  1W2B A;  4JI8 L;  4IPD A;  3H0G G;  2DUD A;  5IYB H;  1HR0 L;  1BVS A;  4LUO A;  2NN6 I;  5C44 G;  1HNZ L;  1EIY B;  1BBU A;  1UWV A;  2JA8 G;  4JI5 L;  2A1A A;  2ZM6 Q;  3HOW G;  3FHW A;  4LF8 Q;  3RN2 A;  3JAM c;  5LMN L;  1C0A A;  4LFB L;  5HY6 A;  1K8G A;  4DR7 L;  5FJ8 H;  4UY8 C;  1IYJ B;  4LW1 A;  1JJC B;  3NEL A;  3LGJ A;  2Q2T A;  3T1H Q;  3S14 H;  1I6H H;  2UU9 L;  1X56 A;  1HZB A;  4JI7 Q;  2ZJR A;  4A3B G;  5IY0 A;  4PMW A;  4HJ7 A;  1PH8 A;  1WOC A;  3I7F A;  2ALY B;  4JI0 L;  3ZJY C;  4A3M G;  1L1O A;  1NY4 A;  4DV1 Q;  1PH5 A;  1B7Y B;  4DV0 L;  5ELO A;  5HGQ A;  3HOV G;  4R4I A;  4JI6 L;  1CSQ A;  1TWA H;  4LNQ A;  4AYB G;  2VL6 A;  3BU2 A;  1PFS A;  3H3V I;  1PH9 A;  4BY7 H;  1HH2 P;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...