1F9PA

Crystal structure of connective tissue activating peptide-iii(ctap-iii) complexed with polyvinylsulfonic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
NLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONNECTIVE TISSUE ACTIVATING PEPTIDE-III
publication title Structure of the CXC Chemokine, Connective Tissue Activating Peptide-III, Complexed with the Heparin Analogue, Polyvinylsulfonic Acid
rcsb
molecule tags Blood clotting
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9pA00
1IKLA 1JICA 2X6LA 1QE6A 5D14A 1AP0A 1RJTA 5CBAE 2B2UA 1WTOA 4UAIA 2VXWA 1SDFA 5CMDA 1PFBA 1PLFA 2SDFA 2K03A 2MPMA 2N55A 3R93A 2KEEA 2HUGA 1XYIA 2K01A 4LMQD 5AFWA 2FMMA 1IL8A 1TVXA 1F2LA 2NWGA 1BF4A 2B2VA 1PFMA 1RHPA 3I91A 1EIGA 3GV6A 4X3TA 2L12A 3DEOA 1MSGA 1B3AA 1RTOA 2XIWA 2B2YA 1B4OA 1DOMA 3HP3A 3Q6SA 4MN3A 2B2TA 3I3CA 4ZKBB 1M8AA 4HSVA 5EPKA 1HFGA 1QG7A 1SSOA 2X6GA 1JE4A 1PFNA 1ML0D 4O42A 1AZQA 3G7LA 2NZ1D 1QNKA 2L1BA 1ESRA 2R3ZA 2MGSA 4IUUA 3QO2A 5E4XA 1WTXA 4CJ2C 1B53A 1G91A 3DEPA 4XT3B 3KBXA 5CBEE 1MSHA 2HCCA 1EQTA 1WTQA 1U4RA 5T1GA 2HDLA 3ONAB 2DY8A 1WTVA 1S4ZA 3IL8A 4IUTA 4NW2A 2KVMA 5COYA 1BO0A 1KNEA 1WTRA 2FHTA 2B2WC 2Q8TA 2HCIA 2MP1A 1WTWA 5EJWA 2KOLA 1B50A 2IL8A 4CJ1B 1NCVA 4R8IA 2B2UC 4ZK9B 2K28A 4XT1B 1VMPA 1DOLA 1WD0A 1Q3LA 4DN4M 1XX8A 3I8ZA 2L4NA 2L9HA 4ZKCB 3N52A 1J9OA 3F2UA 1KNAA 2CVRA 1ILPA 1NR4A 1EIHA 1G2SA 1X3QA 1O80A 3KUPA 1EOTA 2KUMA 1DOKA 1X32A 3D6WA 2RVLA 4HEDA 5D65A 2FFKB 2M2LA 1J8IA 4X3KA 3I90A 1HRJA 4RA8A 1LV9A 2FINB 4U68A 5T1IA 1GUWA 4R9WA 1WVLA 1AZPA 1C8CA 1HFNA 5E4WC 2NYZD 1A15A 4MHEA 2JYOA 1CA5A 1CM9A 4X3SA 3DM1A 4XDXA 5CORA 3P7JA 3MTSA 1U4LA 2B2WA 1ILQA 4OIKA 2N88A 3H91A 4IUPA 2FJ2A 4IUQA 4ZAIA 1WD1A 1ZXTA 2BDNA 1EL0A 1VMCA 4HAEA 3IFDA 3MWYW 2EE1A 4RAUC 2MJ8A 1X3PA 4CJ0B 4HCSA 5EPJA 1U4MA 1HHVA 1F9RA 3FPUB 5EQ0A 1B2TA 1IKMA 1U4PA 2EPBA 2KECA 3TZDA 1E0BA 4IURA 1O7YA 3TN2A 4RWSC 5JJZA 3FDTA 1HUMA 2B2VC 2DY7A 1F9SA 4X3UA 2JP1A 5EPLA 4QUFA 3UI2A 5DNFA 1G2TA 2X69A 2EOTA 1F9PA 1CA6A 2K04A 2RSNA 1BNZA 1DONA 1DZ1A 4OIJA 1PDQA 1RODA 2B2YC 1NR2A 2K1BA 2Q8RE 2RSOA 1G6ZA 2J7ZA 2B2TC 1O7ZA 1RTNA 1MGSA 1SAPA 2K05A 1MI2A 1HUNA 5EKIA 3GV3A 3LWEA 1HA6A 1NAPA 2HDMA 2L11A 1ICWA 2KEDA 1BBXC 1WTPA 1F9QA 2H1EA 2RA4A 4QUCA 4ZLTF 4IUVA 2D9UA 3SVMA
chains in the Genus database with same CATH superfamily
1LT6D 2MO1A 1QILA 1TWHB 4A3IH 1N36Q 1NMGA 1PH7A 2B2UA 1EY0A 4LF5Q 2ZJQA 1VQJA 4ZUIA 4JBMA 2KHJA 3U4ZA 1BF4A 2NN6G 4J6HA 4HIKA 1QB5D 2EXDA 3BVGA 3HFZB 4A3JG 1MHWC 1R9TH 1B9MA 4A3JB 1SJED 4XXEA 2F0FA 5IGBA 4DUYQ 3J81i 4PMWA 2J4XA 4A3EG 5C0XI 4Q5VA 4C56C 4A3EB 3U9OA 2BCOA 5K36H 1RKNA 2XTIA 1SYCA 3DWAA 1Y1VB 4ULLA 5I9PA 2R3ZA 2UUCL 1WOCA 4X62L 2B29A 1SROA 3S1NB 1EYDA 1PTOB 3STBC 1TS5A 4JVZA 2A6HC 2Q8TA 3CCSA 2HCIA 2XN9C 2KOLA 4BBRH 3E9IA 4HR7B 1TWCH 3A74A 5LMNL 2NZHA 1Q1EA 2I5LX 4L6TB 1SE2A 3K81C 2CVRA 4LWCA 2EJMA 2A68D 1VQDA 1PH5A 4B3SL 1IYVA 3I90A 4RKBA 4IOAA 1LV9A 4Y7NB 1JC7A 3VYTA 1QVCA 3M4YA 5EAYA 4ME5A 3FKIG 3J80E 3E3XA 3FKIB 3L9AX 1WD1A 1B2TA 4P74A 3C2PA 2EYJA 1O7YA 3HEJA 3TN2A 2OWOA 4KKTA 3RMHA 3KK7A 1DCZA 3BG3A 1HNWQ 4DV3Q 1F9PA 1DONA 2F0QA 3QWNA 4DV1L 1RODA 3SR1A 1RTNA 1OXSC 1HUNA 3UDIA 1TR5A 5KRUA 3I55A 2E2IH 5IP9H 1B3QA 1YNXA 2KCCA 4ZLTF 3M7NA 3SVMA 3S1QB 4HN7A 2N49A 5I4DA 2CWAA 3TREA 1C48A 3VR6A 4DGZA 1Z6HA 1IW7D 4PMCA 2TMPA 3ZJYC 1TVXA 4LF9Q 2LY7A 5ELDA 3GV6A 1EY4A 1FYCA 2LXJA 1S72A 4NXNQ 4A93H 1A0IA 4H0LC 4C3JH 1M8AA 2HQEA 5EPKA 1Q81C 2RHSB 3OPOA 1QG7A 3QJYA 5ELBA 4LFBL 4IUNA 5D3DA 1B44D 4JI7Q 4IUUA 4IPCA 2ZXPA 1XWEA 1WTQA 3G6JB 1E7ZA 4FYDA 1TY0A 4B3TL 4K0KL 2IX1A 1VQHA 3OYYA 2PZWA 5M5YB 1NCVA 3R3OA 5FO9B 4IO9A 1VMPA 3F1ZA 1MJCA 1PTOF 3PUVA 1Q1BA 2EYLA 2K33A 5HGQA 4LJZC 2K5QA 1DOKA 3M4PA 4ODGA 4IOCA 4HMIA 2PW5A 2VUMH 1IBML 4QQBX 4X3KA 3VDYA 1GVPA 3T4AC 3HS0C 4DR1Q 4B3ML 1BCPC 5BN4A 3A55A 4O0AA 1I4PA 2RF4A 4TVAB 1KQSA 2L5TA 1HR0Q 4OX9Q 4RAUC 5M5WH 4BBSB 3TP6A 3WOFA 1IKMA 2DUDA 2L0CA 4DK6C 4RWSC 4ID6A 3PUWA 1FJGQ 1AE3A 2CH4A 1JB7A 4QCLA 1J5EL 2EOTA 1L1OC 3HOYH 2QW7A 4WRDA 1I94L 1HZAA 4H02A 5J22A 3K80C 4HIDA 3W1GA 3BDCA 1SAPA 1YJ9A 1QNUA 3EA6A 4EQPA 2L55A 1ENAA 2VQEL 4U673 2K50A 4IPHA 4AQYQ 1ESFA 3PO3G 4IUVA 2YU9H 1P8LA 4DR5Q 3PO3B 5CV9A 2K14A 2PQAA 4A3KH 5CV6A 4I65A 5IT9c 3C3LA 4V0BA 1UAPA 3KFUA 1PFBA 3FRPB 2K03A 4KV6A 3A8IE 4ZCKA 2KEEA 2E5LQ 3CCRA 4R4IA 5C3EH 5C44H 3S15H 1SFOH 2B2VA 1VQIA 5EKLA 4CKCA 4PV1C 5ELNA 4FVMA 3CQZH 3OTOQ 2XIWA 3HP3A 5C4XB 1LT5D 2Q2UA 5IWAQ 3MC0B 3A5ZB 3N6RA 4KKSA 2EVBA 3K0XA 3CRLC 1UE7A 1Q46A 1JE4A 2WFWA 3FP9A 3S17B 3C46A 5IYDH 1K83H 5FKAC 3GTPH 5C0XG 2F0IA 5E4XA 3D4DA 2DGYA 1ZYRC 5I6YA 2BE5C 2KCMA 3GD7A 1C0AA 2OF1A 2DY8A 1BVSA 4F8MA 1BKBA 1CQVA 5JEAJ 1VQKA 2D5DA 2WB1G 2SNSA 4CJ1B 3CC7A 1AN8A 3RN5A 1WD0A 1VF7A 2OQ0A 3EJIA 1YNJD 3N52A 2K32A 4NPSA 4A3IG 2NBFA 5FOBB 2A8VA 4A3IB 1FNVA 5C4ZA 1HCZA 4LF4Q 1GUWA 3BYTB 1T5EA 1WVLA 5FK9C 5BN5A 1T9HA 3GTJH 2A73B 4N9TA 2EDGA 3TP5A 4H13C 2ASBA 4G7ZC 5TSSA 2R7FA 4NKLA 3JAML 4LUVA 1N33Q 5EPJA 1SYDA 1Y14B 1C9OA 1CFMA 2F3IA 4IURA 4M8AA 4TSSA 1V1PB 4I7AA 3T1HQ 1IBLQ 3UI2A 2J0TD 1XMQQ 1IYJB 2K1BA 2Q8RE 1NR2A 2J7ZA 5IP7H 3NTHA 4EQ5A 2K5HA 3AEVA 3SXHA 2KEDA 3BJUA 5CYUA 2H1EA 3D31A 2EJGC 4HMJA 4BWGB 4LF8Q 3BZCA 2K75A 1LUZA 4WFN3 1I4HA 1R4PB 2R61A 3L3OC 1JMCA 4OHJA 1F2MA 4BBRB 4JV5L 1JT8A 5CC4A 3PIO3 1TWCB 4DUZQ 1PFSA 2R92G 2JQOA 2OTLA 1TT2A 3BZKA 2R92B 2RKSA 3GQBA 1CZGA 2KHSA 1EY5A 1LTTD 2Z6BA 3RN2A 3KJOA 5IOCA 4K5WA 1EFID 3T1YQ 2H5XA 4DR6Q 3WDNA 1D6EC 3H6MA 3U4VA 1H95A 1G91A 4DV7L 5M3MG 1D5XC 4P75A 4NDXA 1KC8C 3J7A5 1CHQD 3L0OA 5JJKA 2MO0A 1D1IA 2XVSA 4OWWB 3A5UA 4F88A 5BR8L 4OL7A 5E7NA 5JAVA 4POFA 3TDQA 1DGSA 1RIPA 4RHRA 2CH4W 1L0YB 5IP9G 1Q3LA 3J7ZC 1E22A 2ICEC 2L4NA 3KJPA 1M1KC 1OTCA 3S2DH 2TSSA 3I7FA 3L2PA 1EQQA 1I4XA 3DLLA 3OIQA 4BXXH 1SJHD 4K14A 4P73A 4PMBA 5GAHC 3TSSA 3PIPA 1UE5A 4MHEA 2A5HA 2JA5H 1IBKL 4X3SA 1KLGD 4XDXA 5CORA 2B2WA 1ILQA 4KLKA 4C3JG 1Y8NB 3FMCA 1D5MC 1VMCA 4ME3A 3MXUA 5M5XH 4C3JB 1X3PA 4HCEA 1HTLD 1LLRD 2IX0A 2OQKA 4WJWA 5LMUQ 3OW2A 4FF1A 2YV5A 5EBCA 3GTQH 4UY8C 4YY3Q 1PH2A 1MGSA 5IGDA 4JI6L 1EOVA 3RUZA 1Q82C 3K7UC 1TWFB 3GO5A 4NMZA 4QUCA 4ZRZA 5FLMG 4G57A 3TMEA 1AP0A 1RJTA 4DR2Q 3H3VC 4GZYC 5CMDA 2R7DA 3OSOA 4IPDA 4JI5Q 5AFWA 3S14H 4P2CB 4OWTB 1F2LA 1VQNA 4LUZA 4N8FA 2VUMG 3DHQA 2QKIC 1N36L 2DNEA 2ZTDA 2PMZE 1Y69U 2VUMB 4JBJA 3U58A 1DOMA 1SNCA 3RLFA 5EBDA 4QMGA 3K7AH 2ZJPA 1SR3A 3KYHC 4BA1I 2AHOB 2E74C 3SDZA 4L5TA 3VYSA 3QO2A 1XNQQ 1I3QB 3F2DA 1HNZL 3I4NG 3TZUA 5M5WB 1YZ6A 4DUYL 3J80L 3EIVA 3HOUG 1PRTF 1GUSA 1YHBA 3SE0A 3R8BA 4DNRB 4B3RQ 3HOUB 3JC66 4J15A 3PO2H 3PMFA 3BDOA 1WTVA 1L1OA 5ELOA 2ZJRA 4NW2A 2VB3X 3NP8A 4RFBA 3D4RA 3Q22A 2NB0A 3HKZE 2LFNA 1HZBA 1QCBD 1A2UA 1UNSA 3EN2A 5ELCA 1VQBA 2YU9B 4YCVA 4A3KG 1EY7A 1O80A 3BZDB 3OHXC 1LTSD 3CCQA 4A3KB 5D65A 4IJLA 3K8AA 2WAQG 4WORA 2EYMA 1KL9A 2WAQB 3KLSX 5C44G 4LF7Q 3D0FA 5E4WC 4JI8Q 3J7YW 5C3EB 5C44B 3S15B 1PYSB 1SFOB 4K5VA 1QJOA 1CKNA 2EY5A 5C0XJ 3H91A 4DA2A 3P20A 4ZAIA 1Q12A 1X54A 4QY7A 3IFDA 3M3YH 2AQ3B 3E6ZX 4IPGA 1U4PA 2HIXA 5IYDG 1PMRA 3FHWA 4X66Q 1C4QA 3HGBA 2B2VC 4P71A 5GQOA 3T51B 4JI1Q 2F03A 3MA2B 4I7ZC 1LTRD 2K05A 2QEJC 3K5MA 5ELFA 2ZXRA 4CDEC 2I5HA 3CCUA 1NY4A 5A2QE 1I50H 1HNXL 1A3UA 1VQOA 3GTMH 1F9QA 2CQOA 4IALA 3G48A 3V2TA 4JI4L 2PQEA 4UAIA 3BVMA 4YCUA 2JA6H 1CKNB 2VZAA 1Y1WG 1HQRD 4BY1H 1VQGA 2N78A 1IL8A 2R7ZG 4JCVE 3MFYA 3I91A 2R7ZB 3STBD 4DV0L 1A63A 2CHBD 4FNFA 4OONA 1MJEA 3JAMc 4ALPA 3Q6SA 1EWCA 3PV0A 1JE5A 3J7AV 2A6HD 4TQUS 1STBA 1HFGA 3GTJB 5I2XA 3FEWX 4LF9L 2KA7A 1KLUD 1XNRL 1JQYD 5JEAG 1SNPA 4JOIA 3PF4A 1QNKA 4IFDH 1MBYA 1HQMC 3NWSA 4NXNL 1XTCD 3GTGH 3NHHA 4KJOA 2R6GA 3KBXA 3HOZG 3RLNA 3HOZB 5M3FH 1S5BD 1X65A 2K52A 1Y8OB 4DAVA 1PA6A 4ABNA 1V8QA 1W2BA 4LFAQ 1LACA 4EX5A 1TU2B 1JOOA 4O2DA 1XTDA 3HOWH 1X6OA 4RGMA 1Y1VG 1FNWA 3SGIA 1YITA 4JI2Q 3D3RA 1KNAA 1FR3A 1X3QA 4DFAA 1EOTA 2RVLA 4KJNA 4HIOA 4KHPQ 2Z0SA 2QILA 1E24A 4JI0Q 3WWVA 2D0PA 4RCNA 1EYGA 1LO5D 1HTPA 3RZDH 1SN8A 2D2CC 2WIIB 4GNXA 1AH9A 3WOEA 1SMXA 3G4SA 3MFGA 3AQQA 3K59A 2PNRC 1VQ8A 4DR1L 4IFDI 5I2YA 4A76A 3MEFA 2NVQH 3GTOB 1MKHA 2O4XA 1DD2A 2IHFA 2QGQA 3A0JA 4A75A 1GHKA 1HR0L 4OX9L 4XQQA 2E75C 1QZGA 2F4VQ 4PQXA 1R4QB 3O13A 3SK4A 1WTPA 2RQXA 5AJ3L 1CUKA 2RDGA 4C2MH 3AU7A 1G6PA 5JOBA 4GKJQ 2NZOA 4GNXB 1SDFA 2B63H 4DR3L 2K6AA 1I6HB 2SEBD 2O2LD 4AQYL 1J6QA 4KY5A 3F8TA 1PFMA 1RHPA 3HOXH 4DR5L 1EIGA 3QB3A 4KTAA 4GN4B 1UE6A 2Q2HA 2YTYA 4AYBE 1JJ2A 4A3LH 1VQ7A 2N3SA 2E5LL 1TWGH 2JA5G 1SSOA 2X6GA 2JA5B 4RH6A 4O42A 1AZQA 2E8GA 3G7LA 5JPMC 4MZ9A 3OTOL 3VYRA 4DV4Q 1ZEQX 2WACA 2JSOA 4N9PA 1S5FD 3S16H 1MSHA 5GAGC 2N8NA 4YWKA 3G6EA 3V96A 2ENBA 1HJPA 3ULLA 2EYPA 1E3PA 4JG2A 1GUNA 1BCPD 2B2WC 3PSIA 2BA0A 2NUCA 4C3HH 4HJ9A 5CV8A 2K28A 1KABA 1H9KA 3NEMA 1XX8A 3NUCA 2D0OA 4NXMQ 2CFMA 3AFQA 1J9OA 1V9PA 4PZ8A 3U50C 1XJVA 4A3CH 1JJGA 2UXDQ 1A6XA 2EYFA 1NMFA 1TS4A 3DXJC 2LMCB 1K0RA 3DMUA 4A4IA 4RCOA 3S14B 2E2DC 2RBMA 2A6EC 4RGNA 1PH8A 4E6IA 4GKKQ 1K3RA 2CW0C 5FLXc 3J81L 3MWYW 2EE1A 4LNQA 5EQ0A 4YHHL 4KKUA 3K5LA 1F2ZA 2PO4A 4DK1A 1F9SA 4XTCS 1FL0A 1F2YA 2IPKD 2RSNA 3IKJA 1BNZA 1N33L 3NE5B 3NQTA 4FXGC 3RNUA 4MTNA 2UUCQ 2GVBA 2NVTH 3PO2G 1MI2A 2M00A 1CQFA 3LWEA 3JAMi 1X9NA 3PO2B 3TP8A 3T1HL 1IBLL 4YIJA 4JW0A 3KBGA 1ASYA 2BDOA 1X56A 4BBSG 2R93G 3OMCA 4OELB 2B8GA 2R93B 2ZXOA 3RZOH 2E2JB 1DM0B 2SDFA 3S1RH 1ZYRD 4LF8L 2BE5D 3KOJA 1SYEA 1EY9A 1GXDC 1W3SA 4X3TA 1GD7A 3I4MH 1ICFB 2M9VA 1BOSA 4AIMA 4CGYB 2B2TA 1GO3E 3E0EA 2O5JC 1K9MC 1Q86C 2ZM6L 2O5IC 1V1OA 1EEID 4DR4L 2DJGC 2JA8H 2GA4B 5I6WA 2G5DA 1YIJA 3BU2A 3AYHB 1BDOA 3M3YB 3MAQA 1YNNC 2PZTA 4C1NK 4DNIA 5C5LA 1EFWA 4DR6L 1E2VA 3NBIA 4IUTA 5C4XG 3S1MH 1JOKA 3BVZA 3NWTA 1XPOA 3I2ZA 3I56A 5HGTA 4R8IA 1QUQB 1TKWB 1A2TA 1VQ4A 4DV1Q 5BN3A 1WCMH 2ID0A 5KNBA 1I50B 4ZKCB 3GTMB 4OGQC 2RCFA 3KUPA 1VDZA 2Q8IB 2AWNA 1II3A 1CI3M 3DM3A 1HZCA 2DJFC 4UPAA 2G9DA 2K5DA 4BY1G 1EYCA 4BA2I 4TRDA 4BY1B 4PZ7A 1CSPA 5GAEC 3ERQA 1CKOA 3HOVG 3MVVA 2UUBQ 4IUQA 1V1PA 2FJ2A 1JJCB 3HOVB 2BH8A 1SYGA 4CKBA 5IGGA 1EIFA 3VYUA 5IYBH 4FF3A 4JK1C 2K5NA 5JJZA 4IFDG 2DY7A 5EPLA 3CHBD 3CCJA 4DF7A 1WJJA 1FGBD 3GTGB 3K57A 1O7ZA 1ONLA 4QB4A 1KDCA 2HDMA 5M3FB 2AMCB 1ICWA 4KHZA 1PTOC 4UP9A 2F0GA 1W6JA 1R9TB 1JICA 4JOIC 3H0GH 1BQQT 1PYWD 4B3TQ 2WB1E 1RF2D 4K0KQ 3HOWG 2VXWA 5E3FA 4DPGA 4JYAL 2F0LA 3VR3A 3HOWB 5H1SE 4QL5A 5K36G 4L5RC 1FNUA 1D1KA 5IYCH 2FMMA 3TRZA 4DK0A 3PGZA 4KN4C 3PIOA 2Z8LA 2HD3A 3UDXA 1LTLA 2PPBC 1AFPA 3DEOA 4DR2L 4R4TA 1IBMQ 2SOBA 3NXWA 1LTID 1QVFA 1BBUA 3RZDB 2P5ZX 2F0TA 1AEXA 2XWJB 3OMGA 5J39A 4B3MQ 2VQFL 4BBRG 2VNUD 2NN6H 4FF2A 4R4OA 1SLJA 3H15A 1Q7YC 1A3TA 5LL6X 3MXNA 5DM73 1ENCA 1WTHA 4KN7C 3J81E 2NVQB 2RDFA 1S5CD 4GNXC 5C3WA 1S4ZA 2F0MA 1G291 2FHTA 2K7VA 1PRTB 4LF6Q 2MHVA 4X64Q 1I4GA 4B3RL 3I72A 4PG3A 4XIGS 4OEMB 3CCMA 2MUYA 4K6DA 5DAUA 2PI2A 1LTGD 3C1EA 4C2MB 1STAA 5I9OA 3D6WA 2YTXA 5A2QL 2HQLA 4RA8A 5LMNW 2B63B 2F0UA 2QF7A 3SK8A 1SYBA 1G51A 3M85A 1SXTA 3TBIB 1PH4A 3HOXB 3MXNB 1EWHA 5LL6S 5HURA 1ZXTA 2BDNA 2GN5A 4HAEA 2YTVA 2IY5B 2KBNA 3SEBA 2F0OA 4HCSA 4LF7L 4A3BH 4JI8L 2KENA 1VQ6A 2E2IB 4Y7NH 1UUPA 3S9WA 2JA7H 1HUMA 2JP1A 1U9RA 1CA6A 1I4RA 5HY6A 2EY2A 3FKIH 1PDQA 1DYQA 1G6ZA 1CT1D 3S16B 4KD3A 4DAMA 3KF6A 1NAPA 4X66L 3ND9A 1PVOA 4LK1C 3CU7A 4KY7A 2LS01 2RA4A 4HJ5A 1PZID 3T13A 3PCOB 4JI1L 4C3HG 4A93G 4DR7L 1EZ8A 5D14A 4C3HB 4A93B 1OXXK 1HPCA 1N9WA 4K5XA 2JK8A 2BH2A 1Q8IA 1O78A 4IJHA 1GJXA 2F1MA 3UDGA 1NUCA 1PH3A 3GTKH 1K73C 1B4OA 2UXBQ 1XPUA 4DV5L 4HSVA 4RKLA 1A3VA 1OXTA 1JWUD 1PFNA 4APVA 3QOJA 3KF6B 4HSPA 3LX0A 3DEPA 4XT3B 5JJIA 2PMZB 3HRZC 3PIP3 1LT3D 3ULPA 4LF5L 4KY6A 3RD4A 2A69C 5KIXA 1UEAB 5DLQE 3CC2A 5A35A 2NVTB 4JC0A 3P75A 3CMAA 1FGUA 3X3MA 4L63B 2K5VA 4HJ7A 1K28A 2F0WA 4QIWE 2OXPA 2LKVA 1EIHA 1HFNA 1X32A 2EQSA 2FFKB 2M2LA 3RZOB 3DWPA 3KF8B 1Z9FA 2EXZA 3HKZG 5EGTA 4CDDC 1B8AA 2ZT9C 3HKZB 3CP0A 3S1RB 3HOYG 1ET9A 2XNAC 3HOYB 2QDLA 1EQVA 2N88A 2A74C 3VR4A 2NVXH 4OXPA 4YWMA 3K6OA 3ZYYX 1F77A 4DAPA 3A7AB 1SE4A 2HIVA 5IGFA 2JA8G 2EYHA 5J3BA 3KDFA 2JA8B 4NB3A 2C35B 4UP8A 4X65Q 4OIJA 3D6CA 5C3EG 2B3GA 2B2TC 5JVG3 1WYDA 5EKIA 1SMYD 4DV7Q 3URYA 5KNCA 1D5ZC 1BBXC 1U0LA 1KIXA 1TIID 2F0EA 1VQMA 3CQZB 5C3XA 3AMUA 2X6LA 1PHJA 2AQ2B 4FDBA 5G3LD 1TS3A 3SK5A 4JI3Q 2UXCQ 2F4VL 2KCNA 3E9HA 1WCMG 3R93A 5FO7B 2Y0SG 1BXTA 3QOLA 4LMQD 1WCMB 1K83B 2WV6D 1XMOQ 3GTPB 2Y0SB 3W5OA 5IODA 4GKJL 3PO3H 4K2LA 1X3GA 2WAQE 4MN3A 5K5PA 5IE8A 3KDFB 2Q2IA 1KRSA 1HNWL 2XRSD 4DV3L 2WINB 4IFDJ 1B9NA 3HZXA 4AH6A 5FO8B 1GUGA 1IBKQ 2Q2TA 3Q0AA 3BS1A 3K58A 1ENFA 4CJ2C 1CHPD 1IHZA 2KCTA 5CBEE 5IGCA 5ELEA 4LAAA 1EYAA 1VCIA 3IL8A 3EVQA 4DV4L 3T53B 1N32Q 5LHY1 4ZK9B 2Z1CA 2WKDA 1JB3A 4XT1B 1CK1A 4IN3A 2HT1A 1ET6A 2PZUA 3OWFA 1D2BA 3CPFA 1YEZA 4B9WA 3F2UA 1A62A 2IT1A 2NTTA 3H0GB 4LFCQ 3NQIA 4HJ8A 1KRTA 3MZ5A 3J7AF 1TQOA 4R4QA 1JR0D 5T1IA 4DV6Q 3W3AA 2CKZB 4NXML 3MHBA 4A3DH 4JI7L 4A3FH 4A3MH 3A7LA 1FD7D 5IY0A 3M4QA 1I6VC 4B9XA 3IAYA 5IP7G 4L8JA 3NTIA 2XSCA 3TS0A 1EU4A 2F0SA 2PNHA 1PRTC 4C1NI 4OO1H 1K3BC 2Z9HA 4GKKL 1S5ED 1G2TA 2XWBB 3V05A 2UU9Q 3CXCA 3TP7A 3ITPA 1G8ZD 5KYIA 1W6KA 1GOZA 1K8GA 1HNZQ 3GV3A 2I46A 2L11A 3SHLA 1KHIA 4MIUA 4ZQ3A 2A1AA 1QE6A 1TWAH 4XQNA 1LM0A 1VQLA 4G7HC 3UE0A 2HHHQ 4R4CA 4NP5A 3TEHB 4UP7A 1VQEA 1STHA 2HUGA 2K01A 4KI0A 1TS2A 2NWGA 2D62A 2SNMA 4DV2Q 3K5NA 4UHVA 2UUAQ 4CDFC 2JJQA 1QOHA 4RG1A 3ICEA 1BCPF 4B08A 4ZKBB 1FJGL 3K0YA 1EY6A 5C6AA 1WTXA 2R92H 4OO1I 5KNDA 4A3BG 4AYBG 2I0QA 4A3BB 2JA7G 3DUZA 2F0JA 2YYZA 4AYBB 5T1GA 2JA7B 3S2DB 1JCKB 2KHIA 1GHJA 1LTBD 5FLXE 3EBEA 1NBWA 4CBVA 1P16A 4BXXG 4CKEA 1RCVD 1WTWA 5C5MA 2A6ED 1KAAA 1B50A 1H9SA 2I5MX 2I07B 3MEHA 4H7BA 2CW0D 4DN4M 3I8ZA 2FMCA 2IHEA 5M3MH 1N34Q 1STNA 2V4DA 2ZTCA 3FPPA 2ALYB 3X3NA 1HNXQ 2KUMA 5IWAL 5M5XB 2MNAA 4ZYSA 3A8JE 4JI4Q 3I4OA 1C8CA 5J1ZA 3F2BA 5KGUA 1PXUA 3LGJA 4C3IH 3MTSA 1CZWA 3GTKB 2E2HH 1PV4A 3GTQB 3EROA 2MJ8A 4DV0Q 3IRBA 2LSSA 1F9RA 1S5DD 2KECA 2A68C 1K8MA 1YHAA 4J8QA 1SE3A 3FDTA 1UEBA 3RR5A 3UE1A 1H9SB 3ERSX 3QG1A 4QUFA 2UUBL 1EEFD 1VQCA 3BDLA 4A3GH 1XNRQ 5CV7A 1SYFA 1RDPD 2BA1A 2E76C 3NK9A 3F2CA 3S2HH 3QR8A 4DKAC 5IT9E 3PQIA 1EWIA 1BR9A 2H4OA 4CHTB 3S24A 4LF4L 4J1MA 1CSQA 5CBAE 3A54A 1SEBD 1WTOA 3J80c 3K7AB 4GOPA 1PLFA 4S3SA 5M9OA 2MPMA 1UE1A 1XXGA 5CV5A 1GUOA 4QF4A 1TWFH 1YNND 1SRUA 1B3AA 2B2YA 2EYOA 5FLMH 1QVGA 3VA5A 3I3CA 4X62Q 1KD1C 1KXLA 3M4OH 4G4KA 2NVYH 3Q23A 1XMQL 4R1JA 2QDBA 1DJRD 1IW7C 3Q8DA 2NVXB 1STEA 4DNTB 2VY3A 1OO9B 1HZ9A 2HCCA 4FXKC 2Z4IA 1PYBA 3HKSA 3NELA 3NSWA 1QUQA 1T5XD 1WI5A 3OIPA 1M90C 3ONAB 1L0WA 5LMNQ 4HJAA 4GN3B 3SK6A 4GOPB 1WTRA 1STGA 4BY7H 1TXYA 1PH9A 1YJWA 4DUZL 4B3SQ 4HIMA 1KDAA 5CV4A 2EY6A 1I3QH 1S40A 1E2WA 2ATWA 4P72A 3L7ZC 4L5SA 3I4NH 4YWLA 3HOUH 2AWOA 1O7IA 3OW7A 3AFPA 1DXMA 3RLOA 2QA4A 5NUCA 5AJ3Q 2Z6KA 1J8IA 4LF6L 4X64L 1E2ZA 1I4QA 1UWVA 2PYKA 4H44C 1YJNA 3T1YL 2FINB 4GN5A 1EUJA 1AZPA 1C7YA 4K6LA 1OXUA 3VA7A 1A15A 4DR3Q 1LYLA 3CCLA 2B8FA 5KYLA 4MTKA 3B6YA 2NTSA 1PTOD 3KLSA 2EY1A 1SNOA 2PCFB 3TZDA 3GTLH 2JXMB 1IXRA 1VQFA 2X69A 1YHQA 2AUKA 4EQOA 2K04A 2JA6G 4PNYA 1DZ1A 2RSOA 3P1HA 2JA6B 1JOQA 3NTKA 1U5KA 2WP8J 3PUYA 4HTHA 2OEOA 2RCNA 4GLAC 4QJFA 1SNQA 5GROA 5CGKA 2PW7A 5C4JH 1NTGA 3NPPA 2F4IA 1H9RA 1RL2A 4TKOB 1XYIA 1K8AC 4LFBQ 2QEXA 2PQAB 2C9OA 3VR5A 2EZVA 2IJ0A 1RTOA 2GVAA 1VQAA 1L2FA 2MQHA 5M3FG 3OOCA 4A3DG 4A3FG 4A3MG 4XYQA 2WB1B 1MIUA 1GM5A 4A3DB 4A3FB 4A3MB 1SNMA 4UDUC 1AE2A 2DNCA 3QIAA 5LMUL 1Y1WH 1CKMA 3I73A 3ER0A 2RDHA 4YY3L 2R7ZH 2UXBL 4YCWA 4GS3A 3M9BA 4M1UB 3Q24A 1EQTA 4L5QA 1ZKOA 3CMEA 1U4RA 4OO1G 2HDLA 2QCPX 5FJ8H 4YHHQ 1B1ZA 1Q8KA 2KVMA 1KNEA 4XYOA 4Z9CB 1ASZA 1TWHH 2MP1A 1MD2D 1PZJD 4K8IA 4KMUC 3GDEA 2IX3A 5JEAH 2F0VA 4JI5L 4LUOA 1X3FA 2B2UC 4DXGA 1S3OA 1DOLA 3TS2A 2AKWB 5ISRA 3HOZH 1V43A 5CR3A 4RMFA 1NR4A 4MNOA 4HEDA 2OT2A 1TWAB 4A3JH 4WJ4A 1JWMD 2LXKA 3BYYB 2KQ3A 2XRQD 1SBBB 2JYOA 1B70B 4A3EH 3P7JA 1XNQL 1U4LA 4Q0FA 4OIKA 5DM63 1Y1VH 1RD9D 1EL0A 5EKKA 3CW2C 1J5EQ 1V1QA 1Q90A 1I94Q 1YNJC 3I4LA 3T16A 4F7XA 5C4HA 2CCZA 1U4MA 3S1NH 4RGTA 1PTOH 2EPBA 1X55A 3J80i 3U9SA 3E0JA 2VQEQ 4X3UA 2EJFC 4X6AH 3FVQA 5DNFA 1D7QA 2ZM6Q 2B63G 4DR4Q 1HH2P 4GLVB 1TY2A 3HOXG 3LWUA 1HR0W 2A19A 3GTOH 2D9UA 4A3LG 1IKLA 5JPNC 4X65L 3UDFA 2RHQB 4N8X1 4FP5D 2NN6I 3K5OA 1TWGB 4GLXA 3CC4A 3PUZA 2N55A 2VB2X 3TQYA 2V1CC 3EQLC 3DWQA 2ZTEA 4RHSA 5M3MB 1X3EA 1SE8A 3CCEA 1QWYA 3KLWA 2L12A 4JI3L 2UXCL 2JEBI 3CRKC 3MXPA 3NENA 4WJ3M 4FXDA 5DEHA 2JA9A 1HXYD 1OXVA 4IZ8A 2A69D 1IZ6A 4CDCC 1XMOL 2B39A 4C3IG 1I6HH 3I70A 1FVIA 4C3IB 3M7GA 3IFTA 1KTKA 2NZ1D 1KDBA 2E2HB 4KK7A 1B53A 1JWSD 4XQJA 2G9HD 4R8NA 4A3CG 1K0SA 2AQ1B 3AB9A 3W2DA 4BS9A 4V190 3H94A 4A3GG 5COYA 3S1QH 1BO0A 4A3GB 2ICIA 2DN8A 1QZHA 3ULJA 3J81c 2PI2E 5L37A 1IL2A 4O1NA 4DU9A 3S2HB 2F0HA 3KF8A 2L9HA 1NJIC 1EIYB 1D8LA 2KJXA 1EY8A 1N32L 2K4KA 4U68A 1LT4D 3PF5A 2K5WA 4K2KA 1VS0A 5F2DA 1GKHA 1B7YB 2NYZD 4RGOS 3T56B 5IIFA 1VQ9A 4JYAQ 1CA5A 1CM9A 3DM1A 1KAWA 4LFCL 3VR2A 1YBYA 4IUPA 3NBHA 4QIWB 1PH1A 4DV6L 4GOPC 3FPUB 1HHVA 5G3LF 3ND8A 2BOSA 3M4OB 2XGTA 1E0BA 1PZKD 2NVYB 2WKCA 4FF4A 5GADC 4LFAL 3A56A 3W1BA 3R2TA 2MFIA 4DXFA 3PUXA 3J81j 2C5CA 2VQFQ 5M5YH 4JPBW 2B2YC 4JV5Q 1I5FA 1HA6A 1VQPA 4JI2L 4DAYA 3I4MG 4OWXB 4PZ6A 5JJLA 1O7LA 3I4MB 4BY7G 2UU9L 2F0KA 4KHPL 4BY7B 1H9MA 2JN4A 4ZUJA 2ES2A 4JI0L 5D3IB 4DK3C 5FLXL 3E5SA 5KEEA 1PH6A 1M4VA 3HG9A 3I4NB 1STYA 2JE6I 1HA5A 5IGEA 3JAME 3NBHB 4IQZA 4Y52H 1YI2A 3H3VH 1Z47A 4KHVA 4JBKA 2IW3A 1Y8PB 1MSGA 2HHHL 3CPWA 1IYUA 2F52A 4BBSH 2R93H 2OCEA 2E2JH 3MXGA 1A8VA 4DV2L 3D4WA 1ML0D 1CTMA 3S1MB 2UUAL 1E1TA 2L1BA 1BCPB 1ESRA 2MGSA 3LNNA 2Z6KC 1N8RC 3CCVA 5BR8Q 4DAYB 4POGA 1LTAD 1NE3A 4FO2A 1WFQA 1LABA 2VW9A 3GTLB 2F3VA 1YVCA 3KLRA 5JVH3 2VL6A 1Z7TA 1SNDA 5EJWA 1NSNS 2IL8A 1K8OA 2F0PA 1E1OA 4F87A 1L1OB 2F0NA 1EQRA 2AUJD 2VS1A 4EQNA 1ILPA 1G2SA 1PRTD 2JEAI 1EU3A 2L15A 3C1FA 5E1FA 2IWHA 2FXQA 1BUVT 3H09A 5IT9L 5C4JB 3H3VI 5C4XH 5IYBG 2F3WA 4DR7Q 1H9JA 1HRJA 4R9WA 1BBWA 1VQ5A 2Y0SE 3GP7A 4KD4A 3CF5A 2CQAA 1N34L 4EGVA 3S17H 4JBWA 1JORA 2CWPA 1VF5C 1NNXA 2EIFA 3R2IA 2Z4HA 3A8KE 5C0XH 4LW1A 4CJ0B 4G7OC 4EVOA 4K8JA 2F0DA 3OWEB 4JI6Q 3CKIB 3H0GG 4DV5Q 3G71A 4QGUA 1Y1WB 2OTJA 3CD6A 3EFXD 1EZ6A 3D8GA 4ILWA 3HOVH 5IYCG 1GUTA 1SMYC 1AW7A 5FJ8G 1L0XB 2UXDL 1XPRA 3CAMA
chains in the Genus database with same CATH topology
1LT6D 1QILA 1TWHB 2B2UA 1EY0A 4ZUIA 1BF4A 2NN6G 4J6HA 1QB5D 3BVGA 1B9MA 4A3JB 1SJED 4XXEA 2F0FA 5IGBA 4PMWA 2J4XA 5C0XI 4Q5VA 4C56C 4A3EB 3U9OA 2BCOA 5K36H 1RKNA 1SYCA 3DWAA 1Y1VB 4ULLA 5I9PA 2R3ZA 3S1NB 1EYDA 1PTOB 1TS5A 2A6HC 2Q8TA 2HCIA 2XN9C 2KOLA 4HR7B 4L6TB 1Q1EA 1SE2A 2CVRA 2EJMA 2A68D 1IYVA 3I90A 4RKBA 1LV9A 4Y7NB 1JC7A 3VYTA 3M4YA 4ME5A 3J80E 3FKIB 3L9AX 1WD1A 1B2TA 3C2PA 2EYJA 1O7YA 3HEJA 3TN2A 4KKTA 3RMHA 3KK7A 1DCZA 3BG3A 1DONA 1F9PA 2F0QA 3QWNA 1RODA 3SR1A 1RTNA 1OXSC 1HUNA 5KRUA 1TR5A 2KCCA 4ZLTF 3M7NA 3SVMA 3S1QB 4HN7A 5I4DA 1C48A 3VR6A 4DGZA 1Z6HA 1IW7D 4PMCA 2TMPA 1TVXA 2LY7A 5ELDA 3GV6A 1EY4A 1FYCA 4H0LC 1M8AA 2HQEA 5EPKA 3OPOA 1QG7A 3QJYA 5ELBA 4IUNA 5D3DA 1B44D 4IUUA 2ZXPA 1XWEA 1WTQA 3G6JB 4FYDA 1TY0A 2IX1A 2PZWA 5M5YB 1NCVA 3R3OA 5FO9B 1VMPA 1PTOF 3PUVA 1Q1BA 2EYLA 2K33A 4LJZC 2K5QA 1DOKA 4ODGA 4HMIA 2PW5A 4X3KA 3T4AC 3HS0C 1BCPC 5BN4A 3A55A 1I4PA 2L5TA 4RAUC 4BBSB 3TP6A 3WOFA 1IKMA 2L0CA 4RWSC 4ID6A 3PUWA 4QCLA 2EOTA 4WRDA 5J22A 3BDCA 1SAPA 1QNUA 3EA6A 4EQPA 2L55A 1ENAA 4U673 1ESFA 4IUVA 3PO3B 5CV9A 5CV6A 4I65A 3C3LA 4V0BA 1UAPA 1PFBA 3FRPB 2K03A 4KV6A 3A8IE 2KEEA 2B2VA 5EKLA 4CKCA 4PV1C 4FVMA 2XIWA 3HP3A 5C4XB 1LT5D 3MC0B 3N6RA 4KKSA 2EVBA 3CRLC 1JE4A 3S17B 3C46A 5FKAC 5C0XG 2F0IA 5E4XA 3D4DA 1ZYRC 5I6YA 2BE5C 3GD7A 2OF1A 2DY8A 4F8MA 1CQVA 5JEAJ 2D5DA 2SNSA 4CJ1B 1AN8A 1WD0A 1VF7A 3EJIA 1YNJD 3N52A 2K32A 2NBFA 5FOBB 4A3IB 1FNVA 5C4ZA 1HCZA 1GUWA 3BYTB 1T5EA 1WVLA 5FK9C 5BN5A 2A73B 4N9TA 2EDGA 3TP5A 4H13C 4G7ZC 5TSSA 4NKLA 3JAML 5EPJA 1SYDA 1CFMA 4IURA 4M8AA 4TSSA 1V1PB 3UI2A 2J0TD 2K1BA 2Q8RE 1NR2A 2J7ZA 3NTHA 3SXHA 2KEDA 5CYUA 2H1EA 3D31A 2EJGC 4HMJA 4BWGB 4WFN3 1I4HA 1R4PB 2R61A 3L3OC 4OHJA 1F2MA 4BBRB 5CC4A 3PIO3 1TWCB 1TT2A 2R92B 2RKSA 3GQBA 1CZGA 2KHSA 1EY5A 1LTTD 5IOCA 4K5WA 1EFID 3WDNA 1D6EC 3H6MA 1G91A 1D5XC 4NDXA 1CHQD 1D1IA 2XVSA 4F88A 4OL7A 5JAVA 3TDQA 4RHRA 1L0YB 1Q3LA 2ICEC 2L4NA 2TSSA 1I4XA 3OIQA 1SJHD 4K14A 4PMBA 3TSSA 4MHEA 2A5HA 4X3SA 1KLGD 4XDXA 5CORA 2B2WA 1ILQA 4C3JG 1Y8NB 3FMCA 1D5MC 1VMCA 3MXUA 4C3JB 1X3PA 4HCEA 1HTLD 1LLRD 2IX0A 4WJWA 4FF1A 5EBCA 1MGSA 5IGDA 3RUZA 1TWFB 3GO5A 4NMZA 4ZRZA 4QUCA 4G57A 3TMEA 1AP0A 1RJTA 3H3VC 4GZYC 5CMDA 3OSOA 5AFWA 4P2CB 1F2LA 3DHQA 2QKIC 2DNEA 2VUMB 1Y69U 1DOMA 1SNCA 3RLFA 5EBDA 4QMGA 4BA1I 2E74C 3SDZA 3VYSA 3QO2A 1I3QB 3TZUA 5M5WB 3J80L 1PRTF 1GUSA 3SE0A 3R8BA 4DNRB 3HOUB 3PMFA 3BDOA 1WTVA 4NW2A 2VB3X 3NP8A 4RFBA 3D4RA 3Q22A 2NB0A 2LFNA 1QCBD 1A2UA 1UNSA 5ELCA 2YU9B 1EY7A 1O80A 3BZDB 3OHXC 1LTSD 4A3KB 5D65A 4WORA 2EYMA 2WAQB 3KLSX 5E4WC 3J7YW 5C3EB 5C44B 3S15B 1SFOB 4K5VA 1QJOA 2EY5A 5C0XJ 3H91A 4DA2A 3P20A 4ZAIA 1Q12A 3IFDA 2AQ3B 3E6ZX 1U4PA 1PMRA 1C4QA 3HGBA 2B2VC 3T51B 2F03A 3MA2B 4I7ZC 1LTRD 2K05A 2QEJC 3K5MA 5ELFA 2ZXRA 5A2QE 1A3UA 1F9QA 4IALA 3V2TA 2PQEA 4UAIA 3BVMA 1HQRD 1IL8A 3MFYA 3I91A 2R7ZB 2CHBD 4FNFA 3Q6SA 1EWCA 3PV0A 3J7AV 2A6HD 4TQUS 1STBA 1HFGA 3GTJB 5I2XA 3FEWX 2KA7A 1KLUD 1JQYD 5JEAG 1SNPA 1QNKA 4IFDH 1MBYA 1HQMC 3NWSA 1XTCD 3NHHA 4KJOA 2R6GA 3KBXA 3HOZB 1S5BD 1Y8OB 4DAVA 4ABNA 1V8QA 1LACA 1TU2B 1JOOA 4RGMA 1FNWA 3D3RA 1KNAA 1FR3A 1X3QA 4DFAA 1EOTA 2RVLA 4KJNA 2QILA 4RCNA 1LO5D 1HTPA 2D2CC 2WIIB 3WOEA 3MFGA 3K59A 2PNRC 4IFDI 5I2YA 3GTOB 2O4XA 1DD2A 1GHKA 4XQQA 2E75C 4PQXA 1R4QB 3O13A 3SK4A 1WTPA 2RQXA 2RDGA 3AU7A 5JOBA 1SDFA 2K6AA 1I6HB 2SEBD 2O2LD 4KY5A 1PFMA 1RHPA 1EIGA 3QB3A 4KTAA 1SSOA 2X6GA 2JA5B 4RH6A 4O42A 1AZQA 3G7LA 5JPMC 3VYRA 1ZEQX 2WACA 2JSOA 4N9PA 1S5FD 1MSHA 3V96A 2ENBA 2EYPA 1GUNA 1BCPD 2B2WC 2BA0A 2NUCA 5CV8A 2K28A 1KABA 1H9KA 1XX8A 3NUCA 1J9OA 1A6XA 2EYFA 1TS4A 3DXJC 2LMCB 3DMUA 4RCOA 3S14B 2E2DC 2RBMA 2A6EC 4RGNA 4E6IA 2CW0C 3J81L 3MWYW 2EE1A 5EQ0A 4KKUA 3K5LA 1F2ZA 2PO4A 4DK1A 1F9SA 4XTCS 1F2YA 2IPKD 2RSNA 3IKJA 1BNZA 3NE5B 3NQTA 4FXGC 1MI2A 2M00A 1CQFA 3LWEA 3PO2B 3TP8A 4YIJA 3KBGA 2BDOA 3OMCA 2B8GA 2R93B 2ZXOA 2E2JB 1DM0B 2SDFA 1ZYRD 2BE5D 1SYEA 1EY9A 1GXDC 4X3TA 2M9VA 1BOSA 4CGYB 2B2TA 2O5JC 2O5IC 1V1OA 1EEID 2GA4B 5I6WA 3M3YB 1BDOA 3MAQA 1YNNC 2PZTA 4C1NK 5C5LA 1E2VA 3NBIA 4IUTA 1JOKA 3BVZA 3NWTA 5HGTA 4R8IA 1TKWB 1A2TA 5BN3A 2ID0A 5KNBA 1I50B 4ZKCB 3GTMB 4OGQC 3KUPA 1VDZA 2Q8IB 2AWNA 1II3A 1CI3M 2G9DA 2K5DA 4BA2I 1EYCA 4TRDA 4BY1B 3ERQA 3MVVA 4IUQA 1V1PA 2FJ2A 3HOVB 1SYGA 4CKBA 5IGGA 3VYUA 4FF3A 4JK1C 5JJZA 4IFDG 2DY7A 5EPLA 3CHBD 4DF7A 1FGBD 3GTGB 3K57A 1O7ZA 1ONLA 4QB4A 1KDCA 2HDMA 5M3FB 1ICWA 4KHZA 1PTOC 2F0GA 1W6JA 1R9TB 1JICA 1BQQT 1PYWD 1RF2D 2VXWA 5E3FA 2F0LA 3VR3A 3HOWB 5K36G 1FNUA 1D1KA 2FMMA 4DK0A 4KN4C 2Z8LA 2PPBC 1AFPA 3DEOA 2SOBA 3NXWA 1LTID 3RZDB 3OMGA 2F0TA 1AEXA 2XWJB 5J39A 2VNUD 2NN6H 4FF2A 1A3TA 5LL6X 3MXNA 5DM73 1ENCA 4KN7C 3J81E 2NVQB 2RDFA 1S5CD 5C3WA 1S4ZA 2F0MA 1G291 2FHTA 2K7VA 1PRTB 2MHVA 1I4GA 3I72A 4XIGS 2MUYA 4K6DA 5DAUA 1LTGD 3C1EA 4C2MB 1STAA 5I9OA 3D6WA 5A2QL 4RA8A 2B63B 2F0UA 2QF7A 3SK8A 1SYBA 3M85A 1SXTA 3TBIB 3HOXB 1EWHA 5LL6S 5HURA 1ZXTA 2BDNA 4HAEA 3SEBA 2F0OA 4HCSA 2E2IB 1UUPA 3S9WA 1HUMA 2JP1A 1U9RA 1CA6A 1I4RA 2EY2A 1PDQA 1DYQA 1G6ZA 1CT1D 3S16B 4KD3A 1NAPA 3ND9A 4LK1C 3CU7A 4KY7A 2LS01 2RA4A 1PZID 3T13A 4C3HG 1EZ8A 5D14A 4C3HB 4A93B 1OXXK 1HPCA 4K5XA 1Q8IA 1O78A 1GJXA 2F1MA 1NUCA 1B4OA 4HSVA 4RKLA 1A3VA 1OXTA 1JWUD 1PFNA 3QOJA 4HSPA 3LX0A 3DEPA 4XT3B 2PMZB 3HRZC 3PIP3 1LT3D 4KY6A 3RD4A 2A69C 5KIXA 1UEAB 5A35A 2NVTB 3P75A 3X3MA 4L63B 2F0WA 2OXPA 2LKVA 1EIHA 1HFNA 1X32A 2FFKB 2M2LA 3RZOB 3DWPA 2EXZA 5EGTA 2ZT9C 3HKZB 3S1RB 1ET9A 2XNAC 3HOYB 1EQVA 2N88A 2A74C 3VR4A 3K6OA 3ZYYX 1F77A 4DAPA 3A7AB 1SE4A 5IGFA 2EYHA 2JA8B 4OIJA 3D6CA 2B2TC 5JVG3 5EKIA 1SMYD 3URYA 5KNCA 1D5ZC 1BBXC 1TIID 2F0EA 3CQZB 5C3XA 3AMUA 2X6LA 2AQ2B 5G3LD 1TS3A 3SK5A 2KCNA 3R93A 5FO7B 1BXTA 3QOLA 4LMQD 1WCMB 1K83B 2WV6D 3GTPB 2Y0SB 5IODA 4K2LA 4MN3A 5K5PA 2XRSD 2WINB 4IFDJ 1B9NA 3HZXA 5FO8B 1GUGA 3Q0AA 3BS1A 3K58A 1ENFA 4CJ2C 1CHPD 1IHZA 5CBEE 5IGCA 5ELEA 4LAAA 1EYAA 1VCIA 3IL8A 3EVQA 3T53B 5LHY1 4ZK9B 2Z1CA 2WKDA 1JB3A 4XT1B 1CK1A 4IN3A 1ET6A 2PZUA 3OWFA 1D2BA 4B9WA 3F2UA 2IT1A 2NTTA 3H0GB 3NQIA 3MZ5A 3J7AF 1TQOA 1JR0D 5T1IA 3W3AA 3MHBA 3A7LA 1FD7D 1I6VC 4B9XA 3IAYA 4L8JA 3NTIA 2XSCA 1EU4A 2F0SA 1PRTC 4C1NI 4OO1H 1S5ED 1G2TA 2XWBB 3V05A 3TP7A 3ITPA 1G8ZD 5KYIA 1W6KA 1GOZA 3GV3A 2I46A 2L11A 3SHLA 4MIUA 4ZQ3A 1QE6A 4XQNA 4G7HC 4NP5A 1STHA 2HUGA 2K01A 4KI0A 1TS2A 2NWGA 2D62A 2SNMA 3K5NA 1QOHA 1BCPF 4B08A 4ZKBB 3K0YA 1EY6A 5C6AA 1WTXA 4OO1I 5KNDA 4A3BB 3DUZA 2F0JA 2YYZA 4AYBB 5T1GA 2JA7B 3S2DB 1JCKB 1GHJA 1LTBD 5FLXE 4CBVA 4CKEA 1RCVD 1WTWA 5C5MA 2A6ED 1KAAA 1B50A 1H9SA 2I07B 3MEHA 4H7BA 2CW0D 4DN4M 3I8ZA 2FMCA 1STNA 2V4DA 3X3NA 3FPPA 2KUMA 5M5XB 4ZYSA 3A8JE 1C8CA 5J1ZA 5KGUA 1PXUA 3MTSA 1CZWA 3GTKB 3GTQB 3EROA 2MJ8A 1F9RA 1S5DD 2KECA 2A68C 1K8MA 4J8QA 1SE3A 3FDTA 1H9SB 4QUFA 3QG1A 1EEFD 3BDLA 5CV7A 1SYFA 1RDPD 2BA1A 2E76C 3NK9A 5IT9E 1BR9A 2H4OA 4CHTB 4J1MA 5CBAE 3A54A 1SEBD 1WTOA 3K7AB 1PLFA 4S3SA 5M9OA 2MPMA 1XXGA 5CV5A 1GUOA 4QF4A 1YNND 1B3AA 2B2YA 2EYOA 3VA5A 3I3CA 4G4KA 3Q23A 2QDBA 1DJRD 1IW7C 2NVXB 1STEA 4DNTB 1OO9B 2HCCA 4FXKC 2Z4IA 3NSWA 1T5XD 3OIPA 3ONAB 3SK6A 1WTRA 1STGA 1KDAA 5CV4A 2EY6A 1E2WA 3L7ZC 2AWOA 3OW7A 1DXMA 5NUCA 1J8IA 1E2ZA 1I4QA 2PYKA 4H44C 2FINB 1AZPA 4K6LA 1OXUA 3VA7A 1A15A 2B8FA 5KYLA 2NTSA 1PTOD 3KLSA 2EY1A 1SNOA 2PCFB 3TZDA 2JXMB 2X69A 2AUKA 4EQOA 2K04A 4PNYA 1DZ1A 2RSOA 3P1HA 2JA6B 1JOQA 3NTKA 2WP8J 3PUYA 4HTHA 2OEOA 1SNQA 5CGKA 2PW7A 3NPPA 2F4IA 1H9RA 4TKOB 1XYIA 2C9OA 3VR5A 2EZVA 2IJ0A 1RTOA 3OOCA 4XYQA 2WB1B 4A3DB 4A3FB 4A3MB 1SNMA 4UDUC 2DNCA 3QIAA 3I73A 2RDHA 4M1UB 3Q24A 1EQTA 1ZKOA 1U4RA 4OO1G 2HDLA 2QCPX 1B1ZA 2KVMA 1KNEA 4XYOA 4Z9CB 2MP1A 1MD2D 1PZJD 4K8IA 4KMUC 2IX3A 5JEAH 2F0VA 2B2UC 4DXGA 1DOLA 5ISRA 1V43A 5CR3A 1NR4A 4HEDA 2OT2A 1TWAB 1JWMD 3BYYB 2KQ3A 2XRQD 1SBBB 2JYOA 3P7JA 1U4LA 4Q0FA 4OIKA 5DM63 1RD9D 1EL0A 5EKKA 1Q90A 1YNJC 3I4LA 3T16A 4F7XA 5C4HA 1U4MA 4RGTA 1PTOH 2EPBA 3U9SA 3E0JA 4X3UA 2EJFC 3FVQA 5DNFA 1TY2A 3LWUA 2D9UA 1IKLA 5JPNC 2NN6I 4FP5D 3K5OA 1TWGB 3PUZA 2N55A 2VB2X 3EQLC 3DWQA 4RHSA 5M3MB 1QWYA 2L12A 2JEBI 3CRKC 3MXPA 4FXDA 5DEHA 1HXYD 1OXVA 4IZ8A 2A69D 2B39A 4C3IG 3I70A 4C3IB 3M7GA 3IFTA 1KTKA 2NZ1D 1KDBA 2E2HB 4KK7A 1B53A 1JWSD 4XQJA 2G9HD 4R8NA 2AQ1B 3AB9A 3W2DA 4BS9A 4V190 3H94A 5COYA 1BO0A 4A3GB 2ICIA 2DN8A 4O1NA 4DU9A 3S2HB 2F0HA 3KF8A 2L9HA 2KJXA 1EY8A 4U68A 1LT4D 2K5WA 4K2KA 5F2DA 4RGOS 2NYZD 5IIFA 3T56B 1CA5A 1CM9A 3DM1A 3VR2A 4IUPA 3NBHA 4QIWB 1HHVA 3FPUB 5G3LF 3ND8A 2BOSA 3M4OB 1E0BA 1PZKD 2NVYB 2WKCA 4FF4A 3A56A 3R2TA 4DXFA 3PUXA 2C5CA 2B2YC 1HA6A 4DAYA 1O7LA 3I4MB 2F0KA 4BY7B 1H9MA 4ZUJA 5D3IB 5FLXL 3E5SA 5KEEA 1M4VA 3HG9A 3I4NB 1STYA 2JE6I 1HA5A 5IGEA 3JAME 4IQZA 1Z47A 4KHVA 2IW3A 1Y8PB 1MSGA 1IYUA 3MXGA 3D4WA 1ML0D 1CTMA 3S1MB 2L1BA 1BCPB 1ESRA 2MGSA 3LNNA 1LTAD 4FO2A 1LABA 3GTLB 2F3VA 3KLRA 5JVH3 1Z7TA 1SNDA 5EJWA 1NSNS 2IL8A 1K8OA 2F0PA 4F87A 2F0NA 2AUJD 4EQNA 1ILPA 1G2SA 1PRTD 2JEAI 1EU3A 3C1FA 5C4JB 5E1FA 2IWHA 3H09A 1BUVT 5IT9L 2F3WA 1H9JA 1HRJA 4R9WA 4KD4A 3GP7A 2CQAA 4EGVA 4JBWA 1JORA 1VF5C 3R2IA 2Z4HA 3A8KE 5C0XH 4CJ0B 4G7OC 4EVOA 4K8JA 2F0DA 3OWEB 3CKIB 1Y1WB 3EFXD 1EZ6A 3D8GA 4ILWA 1GUTA 1SMYC 1AW7A 1L0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKL A;  1JIC A;  2X6L A;  1QE6 A;  5D14 A;  1AP0 A;  1RJT A;  5CBA E;  2B2U A;  1WTO A;  4UAI A;  2VXW A;  1SDF A;  5CMD A;  1PFB A;  1PLF A;  2SDF A;  2K03 A;  2MPM A;  2N55 A;  3R93 A;  2KEE A;  2HUG A;  1XYI A;  2K01 A;  4LMQ D;  5AFW A;  2FMM A;  1IL8 A;  1TVX A;  1F2L A;  2NWG A;  1BF4 A;  2B2V A;  1PFM A;  1RHP A;  3I91 A;  1EIG A;  3GV6 A;  4X3T A;  2L12 A;  3DEO A;  1MSG A;  1B3A A;  1RTO A;  2XIW A;  2B2Y A;  1B4O A;  1DOM A;  3HP3 A;  3Q6S A;  4MN3 A;  2B2T A;  3I3C A;  4ZKB B;  1M8A A;  4HSV A;  5EPK A;  1HFG A;  1QG7 A;  1SSO A;  2X6G A;  1JE4 A;  1PFN A;  1ML0 D;  4O42 A;  1AZQ A;  3G7L A;  2NZ1 D;  1QNK A;  2L1B A;  1ESR A;  2R3Z A;  2MGS A;  4IUU A;  3QO2 A;  5E4X A;  1WTX A;  4CJ2 C;  1B53 A;  1G91 A;  3DEP A;  4XT3 B;  3KBX A;  5CBE E;  1MSH A;  2HCC A;  1EQT A;  1WTQ A;  1U4R A;  5T1G A;  2HDL A;  3ONA B;  2DY8 A;  1WTV A;  1S4Z A;  3IL8 A;  4IUT A;  4NW2 A;  2KVM A;  5COY A;  1BO0 A;  1KNE A;  1WTR A;  2FHT A;  2B2W C;  2Q8T A;  2HCI A;  2MP1 A;  1WTW A;  5EJW A;  2KOL A;  1B50 A;  2IL8 A;  4CJ1 B;  1NCV A;  4R8I A;  2B2U C;  4ZK9 B;  2K28 A;  4XT1 B;  1VMP A;  1DOL A;  1WD0 A;  1Q3L A;  4DN4 M;  1XX8 A;  3I8Z A;  2L4N A;  2L9H A;  4ZKC B;  3N52 A;  1J9O A;  3F2U A;  1KNA A;  2CVR A;  1ILP A;  1NR4 A;  1EIH A;  1G2S A;  1X3Q A;  1O80 A;  3KUP A;  1EOT A;  2KUM A;  1DOK A;  1X32 A;  3D6W A;  2RVL A;  4HED A;  5D65 A;  2FFK B;  2M2L A;  1J8I A;  4X3K A;  3I90 A;  1HRJ A;  4RA8 A;  1LV9 A;  2FIN B;  4U68 A;  5T1I A;  1GUW A;  4R9W A;  1WVL A;  1AZP A;  1C8C A;  1HFN A;  5E4W C;  2NYZ D;  1A15 A;  4MHE A;  2JYO A;  1CA5 A;  1CM9 A;  4X3S A;  3DM1 A;  4XDX A;  5COR A;  3P7J A;  3MTS A;  1U4L A;  2B2W A;  1ILQ A;  4OIK A;  2N88 A;  3H91 A;  4IUP A;  2FJ2 A;  4IUQ A;  4ZAI A;  1WD1 A;  1ZXT A;  2BDN A;  1EL0 A;  1VMC A;  4HAE A;  3IFD A;  3MWY W;  2EE1 A;  4RAU C;  2MJ8 A;  1X3P A;  4CJ0 B;  4HCS A;  5EPJ A;  1U4M A;  1HHV A;  1F9R A;  3FPU B;  5EQ0 A;  1B2T A;  1IKM A;  1U4P A;  2EPB A;  2KEC A;  3TZD A;  1E0B A;  4IUR A;  1O7Y A;  3TN2 A;  4RWS C;  5JJZ A;  3FDT A;  1HUM A;  2B2V C;  2DY7 A;  1F9S A;  4X3U A;  2JP1 A;  5EPL A;  4QUF A;  3UI2 A;  5DNF A;  1G2T A;  2X69 A;  2EOT A;  1F9P A;  1CA6 A;  2K04 A;  2RSN A;  1BNZ A;  1DON A;  1DZ1 A;  4OIJ A;  1PDQ A;  1ROD A;  2B2Y C;  1NR2 A;  2K1B A;  2Q8R E;  2RSO A;  1G6Z A;  2J7Z A;  2B2T C;  1O7Z A;  1RTN A;  1MGS A;  1SAP A;  2K05 A;  1MI2 A;  1HUN A;  5EKI A;  3GV3 A;  3LWE A;  1HA6 A;  1NAP A;  2HDM A;  2L11 A;  1ICW A;  2KED A;  1BBX C;  1WTP A;  1F9Q A;  2H1E A;  2RA4 A;  4QUC A;  4ZLT F;  4IUV A;  2D9U A;  3SVM A; 
#chains in the Genus database with same CATH topology
 1LT6 D;  2MO1 A;  1QIL A;  1TWH B;  4A3I H;  1N36 Q;  1NMG A;  1PH7 A;  2B2U A;  1EY0 A;  4LF5 Q;  2ZJQ A;  1VQJ A;  4ZUI A;  4JBM A;  2KHJ A;  3U4Z A;  1BF4 A;  2NN6 G;  4J6H A;  4HIK A;  1QB5 D;  2EXD A;  3BVG A;  3HFZ B;  4A3J G;  1MHW C;  1R9T H;  1B9M A;  4A3J B;  1SJE D;  4XXE A;  2F0F A;  5IGB A;  4DUY Q;  3J81 i;  4PMW A;  2J4X A;  4A3E G;  5C0X I;  4Q5V A;  4C56 C;  4A3E B;  3U9O A;  2BCO A;  5K36 H;  1RKN A;  2XTI A;  1SYC A;  3DWA A;  1Y1V B;  4ULL A;  5I9P A;  2R3Z A;  2UUC L;  1WOC A;  4X62 L;  2B29 A;  1SRO A;  3S1N B;  1EYD A;  1PTO B;  3STB C;  1TS5 A;  4JVZ A;  2A6H C;  2Q8T A;  3CCS A;  2HCI A;  2XN9 C;  2KOL A;  4BBR H;  3E9I A;  4HR7 B;  1TWC H;  3A74 A;  5LMN L;  2NZH A;  1Q1E A;  2I5L X;  4L6T B;  1SE2 A;  3K81 C;  2CVR A;  4LWC A;  2EJM A;  2A68 D;  1VQD A;  1PH5 A;  4B3S L;  1IYV A;  3I90 A;  4RKB A;  4IOA A;  1LV9 A;  4Y7N B;  1JC7 A;  3VYT A;  1QVC A;  3M4Y A;  5EAY A;  4ME5 A;  3FKI G;  3J80 E;  3E3X A;  3FKI B;  3L9A X;  1WD1 A;  1B2T A;  4P74 A;  3C2P A;  2EYJ A;  1O7Y A;  3HEJ A;  3TN2 A;  2OWO A;  4KKT A;  3RMH A;  3KK7 A;  1DCZ A;  3BG3 A;  1HNW Q;  4DV3 Q;  1F9P A;  1DON A;  2F0Q A;  3QWN A;  4DV1 L;  1ROD A;  3SR1 A;  1RTN A;  1OXS C;  1HUN A;  3UDI A;  1TR5 A;  5KRU A;  3I55 A;  2E2I H;  5IP9 H;  1B3Q A;  1YNX A;  2KCC A;  4ZLT F;  3M7N A;  3SVM A;  3S1Q B;  4HN7 A;  2N49 A;  5I4D A;  2CWA A;  3TRE A;  1C48 A;  3VR6 A;  4DGZ A;  1Z6H A;  1IW7 D;  4PMC A;  2TMP A;  3ZJY C;  1TVX A;  4LF9 Q;  2LY7 A;  5ELD A;  3GV6 A;  1EY4 A;  1FYC A;  2LXJ A;  1S72 A;  4NXN Q;  4A93 H;  1A0I A;  4H0L C;  4C3J H;  1M8A A;  2HQE A;  5EPK A;  1Q81 C;  2RHS B;  3OPO A;  1QG7 A;  3QJY A;  5ELB A;  4LFB L;  4IUN A;  5D3D A;  1B44 D;  4JI7 Q;  4IUU A;  4IPC A;  2ZXP A;  1XWE A;  1WTQ A;  3G6J B;  1E7Z A;  4FYD A;  1TY0 A;  4B3T L;  4K0K L;  2IX1 A;  1VQH A;  3OYY A;  2PZW A;  5M5Y B;  1NCV A;  3R3O A;  5FO9 B;  4IO9 A;  1VMP A;  3F1Z A;  1MJC A;  1PTO F;  3PUV A;  1Q1B A;  2EYL A;  2K33 A;  5HGQ A;  4LJZ C;  2K5Q A;  1DOK A;  3M4P A;  4ODG A;  4IOC A;  4HMI A;  2PW5 A;  2VUM H;  1IBM L;  4QQB X;  4X3K A;  3VDY A;  1GVP A;  3T4A C;  3HS0 C;  4DR1 Q;  4B3M L;  1BCP C;  5BN4 A;  3A55 A;  4O0A A;  1I4P A;  2RF4 A;  4TVA B;  1KQS A;  2L5T A;  1HR0 Q;  4OX9 Q;  4RAU C;  5M5W H;  4BBS B;  3TP6 A;  3WOF A;  1IKM A;  2DUD A;  2L0C A;  4DK6 C;  4RWS C;  4ID6 A;  3PUW A;  1FJG Q;  1AE3 A;  2CH4 A;  1JB7 A;  4QCL A;  1J5E L;  2EOT A;  1L1O C;  3HOY H;  2QW7 A;  4WRD A;  1I94 L;  1HZA A;  4H02 A;  5J22 A;  3K80 C;  4HID A;  3W1G A;  3BDC A;  1SAP A;  1YJ9 A;  1QNU A;  3EA6 A;  4EQP A;  2L55 A;  1ENA A;  2VQE L;  4U67 3;  2K50 A;  4IPH A;  4AQY Q;  1ESF A;  3PO3 G;  4IUV A;  2YU9 H;  1P8L A;  4DR5 Q;  3PO3 B;  5CV9 A;  2K14 A;  2PQA A;  4A3K H;  5CV6 A;  4I65 A;  5IT9 c;  3C3L A;  4V0B A;  1UAP A;  3KFU A;  1PFB A;  3FRP B;  2K03 A;  4KV6 A;  3A8I E;  4ZCK A;  2KEE A;  2E5L Q;  3CCR A;  4R4I A;  5C3E H;  5C44 H;  3S15 H;  1SFO H;  2B2V A;  1VQI A;  5EKL A;  4CKC A;  4PV1 C;  5ELN A;  4FVM A;  3CQZ H;  3OTO Q;  2XIW A;  3HP3 A;  5C4X B;  1LT5 D;  2Q2U A;  5IWA Q;  3MC0 B;  3A5Z B;  3N6R A;  4KKS A;  2EVB A;  3K0X A;  3CRL C;  1UE7 A;  1Q46 A;  1JE4 A;  2WFW A;  3FP9 A;  3S17 B;  3C46 A;  5IYD H;  1K83 H;  5FKA C;  3GTP H;  5C0X G;  2F0I A;  5E4X A;  3D4D A;  2DGY A;  1ZYR C;  5I6Y A;  2BE5 C;  2KCM A;  3GD7 A;  1C0A A;  2OF1 A;  2DY8 A;  1BVS A;  4F8M A;  1BKB A;  1CQV A;  5JEA J;  1VQK A;  2D5D A;  2WB1 G;  2SNS A;  4CJ1 B;  3CC7 A;  1AN8 A;  3RN5 A;  1WD0 A;  1VF7 A;  2OQ0 A;  3EJI A;  1YNJ D;  3N52 A;  2K32 A;  4NPS A;  4A3I G;  2NBF A;  5FOB B;  2A8V A;  4A3I B;  1FNV A;  5C4Z A;  1HCZ A;  4LF4 Q;  1GUW A;  3BYT B;  1T5E A;  1WVL A;  5FK9 C;  5BN5 A;  1T9H A;  3GTJ H;  2A73 B;  4N9T A;  2EDG A;  3TP5 A;  4H13 C;  2ASB A;  4G7Z C;  5TSS A;  2R7F A;  4NKL A;  3JAM L;  4LUV A;  1N33 Q;  5EPJ A;  1SYD A;  1Y14 B;  1C9O A;  1CFM A;  2F3I A;  4IUR A;  4M8A A;  4TSS A;  1V1P B;  4I7A A;  3T1H Q;  1IBL Q;  3UI2 A;  2J0T D;  1XMQ Q;  1IYJ B;  2K1B A;  2Q8R E;  1NR2 A;  2J7Z A;  5IP7 H;  3NTH A;  4EQ5 A;  2K5H A;  3AEV A;  3SXH A;  2KED A;  3BJU A;  5CYU A;  2H1E A;  3D31 A;  2EJG C;  4HMJ A;  4BWG B;  4LF8 Q;  3BZC A;  2K75 A;  1LUZ A;  4WFN 3;  1I4H A;  1R4P B;  2R61 A;  3L3O C;  1JMC A;  4OHJ A;  1F2M A;  4BBR B;  4JV5 L;  1JT8 A;  5CC4 A;  3PIO 3;  1TWC B;  4DUZ Q;  1PFS A;  2R92 G;  2JQO A;  2OTL A;  1TT2 A;  3BZK A;  2R92 B;  2RKS A;  3GQB A;  1CZG A;  2KHS A;  1EY5 A;  1LTT D;  2Z6B A;  3RN2 A;  3KJO A;  5IOC A;  4K5W A;  1EFI D;  3T1Y Q;  2H5X A;  4DR6 Q;  3WDN A;  1D6E C;  3H6M A;  3U4V A;  1H95 A;  1G91 A;  4DV7 L;  5M3M G;  1D5X C;  4P75 A;  4NDX A;  1KC8 C;  3J7A 5;  1CHQ D;  3L0O A;  5JJK A;  2MO0 A;  1D1I A;  2XVS A;  4OWW B;  3A5U A;  4F88 A;  5BR8 L;  4OL7 A;  5E7N A;  5JAV A;  4POF A;  3TDQ A;  1DGS A;  1RIP A;  4RHR A;  2CH4 W;  1L0Y B;  5IP9 G;  1Q3L A;  3J7Z C;  1E22 A;  2ICE C;  2L4N A;  3KJP A;  1M1K C;  1OTC A;  3S2D H;  2TSS A;  3I7F A;  3L2P A;  1EQQ A;  1I4X A;  3DLL A;  3OIQ A;  4BXX H;  1SJH D;  4K14 A;  4P73 A;  4PMB A;  5GAH C;  3TSS A;  3PIP A;  1UE5 A;  4MHE A;  2A5H A;  2JA5 H;  1IBK L;  4X3S A;  1KLG D;  4XDX A;  5COR A;  2B2W A;  1ILQ A;  4KLK A;  4C3J G;  1Y8N B;  3FMC A;  1D5M C;  1VMC A;  4ME3 A;  3MXU A;  5M5X H;  4C3J B;  1X3P A;  4HCE A;  1HTL D;  1LLR D;  2IX0 A;  2OQK A;  4WJW A;  5LMU Q;  3OW2 A;  4FF1 A;  2YV5 A;  5EBC A;  3GTQ H;  4UY8 C;  4YY3 Q;  1PH2 A;  1MGS A;  5IGD A;  4JI6 L;  1EOV A;  3RUZ A;  1Q82 C;  3K7U C;  1TWF B;  3GO5 A;  4NMZ A;  4QUC A;  4ZRZ A;  5FLM G;  4G57 A;  3TME A;  1AP0 A;  1RJT A;  4DR2 Q;  3H3V C;  4GZY C;  5CMD A;  2R7D A;  3OSO A;  4IPD A;  4JI5 Q;  5AFW A;  3S14 H;  4P2C B;  4OWT B;  1F2L A;  1VQN A;  4LUZ A;  4N8F A;  2VUM G;  3DHQ A;  2QKI C;  1N36 L;  2DNE A;  2ZTD A;  2PMZ E;  1Y69 U;  2VUM B;  4JBJ A;  3U58 A;  1DOM A;  1SNC A;  3RLF A;  5EBD A;  4QMG A;  3K7A H;  2ZJP A;  1SR3 A;  3KYH C;  4BA1 I;  2AHO B;  2E74 C;  3SDZ A;  4L5T A;  3VYS A;  3QO2 A;  1XNQ Q;  1I3Q B;  3F2D A;  1HNZ L;  3I4N G;  3TZU A;  5M5W B;  1YZ6 A;  4DUY L;  3J80 L;  3EIV A;  3HOU G;  1PRT F;  1GUS A;  1YHB A;  3SE0 A;  3R8B A;  4DNR B;  4B3R Q;  3HOU B;  3JC6 6;  4J15 A;  3PO2 H;  3PMF A;  3BDO A;  1WTV A;  1L1O A;  5ELO A;  2ZJR A;  4NW2 A;  2VB3 X;  3NP8 A;  4RFB A;  3D4R A;  3Q22 A;  2NB0 A;  3HKZ E;  2LFN A;  1HZB A;  1QCB D;  1A2U A;  1UNS A;  3EN2 A;  5ELC A;  1VQB A;  2YU9 B;  4YCV A;  4A3K G;  1EY7 A;  1O80 A;  3BZD B;  3OHX C;  1LTS D;  3CCQ A;  4A3K B;  5D65 A;  4IJL A;  3K8A A;  2WAQ G;  4WOR A;  2EYM A;  1KL9 A;  2WAQ B;  3KLS X;  5C44 G;  4LF7 Q;  3D0F A;  5E4W C;  4JI8 Q;  3J7Y W;  5C3E B;  5C44 B;  3S15 B;  1PYS B;  1SFO B;  4K5V A;  1QJO A;  1CKN A;  2EY5 A;  5C0X J;  3H91 A;  4DA2 A;  3P20 A;  4ZAI A;  1Q12 A;  1X54 A;  4QY7 A;  3IFD A;  3M3Y H;  2AQ3 B;  3E6Z X;  4IPG A;  1U4P A;  2HIX A;  5IYD G;  1PMR A;  3FHW A;  4X66 Q;  1C4Q A;  3HGB A;  2B2V C;  4P71 A;  5GQO A;  3T51 B;  4JI1 Q;  2F03 A;  3MA2 B;  4I7Z C;  1LTR D;  2K05 A;  2QEJ C;  3K5M A;  5ELF A;  2ZXR A;  4CDE C;  2I5H A;  3CCU A;  1NY4 A;  5A2Q E;  1I50 H;  1HNX L;  1A3U A;  1VQO A;  3GTM H;  1F9Q A;  2CQO A;  4IAL A;  3G48 A;  3V2T A;  4JI4 L;  2PQE A;  4UAI A;  3BVM A;  4YCU A;  2JA6 H;  1CKN B;  2VZA A;  1Y1W G;  1HQR D;  4BY1 H;  1VQG A;  2N78 A;  1IL8 A;  2R7Z G;  4JCV E;  3MFY A;  3I91 A;  2R7Z B;  3STB D;  4DV0 L;  1A63 A;  2CHB D;  4FNF A;  4OON A;  1MJE A;  3JAM c;  4ALP A;  3Q6S A;  1EWC A;  3PV0 A;  1JE5 A;  3J7A V;  2A6H D;  4TQU S;  1STB A;  1HFG A;  3GTJ B;  5I2X A;  3FEW X;  4LF9 L;  2KA7 A;  1KLU D;  1XNR L;  1JQY D;  5JEA G;  1SNP A;  4JOI A;  3PF4 A;  1QNK A;  4IFD H;  1MBY A;  1HQM C;  3NWS A;  4NXN L;  1XTC D;  3GTG H;  3NHH A;  4KJO A;  2R6G A;  3KBX A;  3HOZ G;  3RLN A;  3HOZ B;  5M3F H;  1S5B D;  1X65 A;  2K52 A;  1Y8O B;  4DAV A;  1PA6 A;  4ABN A;  1V8Q A;  1W2B A;  4LFA Q;  1LAC A;  4EX5 A;  1TU2 B;  1JOO A;  4O2D A;  1XTD A;  3HOW H;  1X6O A;  4RGM A;  1Y1V G;  1FNW A;  3SGI A;  1YIT A;  4JI2 Q;  3D3R A;  1KNA A;  1FR3 A;  1X3Q A;  4DFA A;  1EOT A;  2RVL A;  4KJN A;  4HIO A;  4KHP Q;  2Z0S A;  2QIL A;  1E24 A;  4JI0 Q;  3WWV A;  2D0P A;  4RCN A;  1EYG A;  1LO5 D;  1HTP A;  3RZD H;  1SN8 A;  2D2C C;  2WII B;  4GNX A;  1AH9 A;  3WOE A;  1SMX A;  3G4S A;  3MFG A;  3AQQ A;  3K59 A;  2PNR C;  1VQ8 A;  4DR1 L;  4IFD I;  5I2Y A;  4A76 A;  3MEF A;  2NVQ H;  3GTO B;  1MKH A;  2O4X A;  1DD2 A;  2IHF A;  2QGQ A;  3A0J A;  4A75 A;  1GHK A;  1HR0 L;  4OX9 L;  4XQQ A;  2E75 C;  1QZG A;  2F4V Q;  4PQX A;  1R4Q B;  3O13 A;  3SK4 A;  1WTP A;  2RQX A;  5AJ3 L;  1CUK A;  2RDG A;  4C2M H;  3AU7 A;  1G6P A;  5JOB A;  4GKJ Q;  2NZO A;  4GNX B;  1SDF A;  2B63 H;  4DR3 L;  2K6A A;  1I6H B;  2SEB D;  2O2L D;  4AQY L;  1J6Q A;  4KY5 A;  3F8T A;  1PFM A;  1RHP A;  3HOX H;  4DR5 L;  1EIG A;  3QB3 A;  4KTA A;  4GN4 B;  1UE6 A;  2Q2H A;  2YTY A;  4AYB E;  1JJ2 A;  4A3L H;  1VQ7 A;  2N3S A;  2E5L L;  1TWG H;  2JA5 G;  1SSO A;  2X6G A;  2JA5 B;  4RH6 A;  4O42 A;  1AZQ A;  2E8G A;  3G7L A;  5JPM C;  4MZ9 A;  3OTO L;  3VYR A;  4DV4 Q;  1ZEQ X;  2WAC A;  2JSO A;  4N9P A;  1S5F D;  3S16 H;  1MSH A;  5GAG C;  2N8N A;  4YWK A;  3G6E A;  3V96 A;  2ENB A;  1HJP A;  3ULL A;  2EYP A;  1E3P A;  4JG2 A;  1GUN A;  1BCP D;  2B2W C;  3PSI A;  2BA0 A;  2NUC A;  4C3H H;  4HJ9 A;  5CV8 A;  2K28 A;  1KAB A;  1H9K A;  3NEM A;  1XX8 A;  3NUC A;  2D0O A;  4NXM Q;  2CFM A;  3AFQ A;  1J9O A;  1V9P A;  4PZ8 A;  3U50 C;  1XJV A;  4A3C H;  1JJG A;  2UXD Q;  1A6X A;  2EYF A;  1NMF A;  1TS4 A;  3DXJ C;  2LMC B;  1K0R A;  3DMU A;  4A4I A;  4RCO A;  3S14 B;  2E2D C;  2RBM A;  2A6E C;  4RGN A;  1PH8 A;  4E6I A;  4GKK Q;  1K3R A;  2CW0 C;  5FLX c;  3J81 L;  3MWY W;  2EE1 A;  4LNQ A;  5EQ0 A;  4YHH L;  4KKU A;  3K5L A;  1F2Z A;  2PO4 A;  4DK1 A;  1F9S A;  4XTC S;  1FL0 A;  1F2Y A;  2IPK D;  2RSN A;  3IKJ A;  1BNZ A;  1N33 L;  3NE5 B;  3NQT A;  4FXG C;  3RNU A;  4MTN A;  2UUC Q;  2GVB A;  2NVT H;  3PO2 G;  1MI2 A;  2M00 A;  1CQF A;  3LWE A;  3JAM i;  1X9N A;  3PO2 B;  3TP8 A;  3T1H L;  1IBL L;  4YIJ A;  4JW0 A;  3KBG A;  1ASY A;  2BDO A;  1X56 A;  4BBS G;  2R93 G;  3OMC A;  4OEL B;  2B8G A;  2R93 B;  2ZXO A;  3RZO H;  2E2J B;  1DM0 B;  2SDF A;  3S1R H;  1ZYR D;  4LF8 L;  2BE5 D;  3KOJ A;  1SYE A;  1EY9 A;  1GXD C;  1W3S A;  4X3T A;  1GD7 A;  3I4M H;  1ICF B;  2M9V A;  1BOS A;  4AIM A;  4CGY B;  2B2T A;  1GO3 E;  3E0E A;  2O5J C;  1K9M C;  1Q86 C;  2ZM6 L;  2O5I C;  1V1O A;  1EEI D;  4DR4 L;  2DJG C;  2JA8 H;  2GA4 B;  5I6W A;  2G5D A;  1YIJ A;  3BU2 A;  3AYH B;  1BDO A;  3M3Y B;  3MAQ A;  1YNN C;  2PZT A;  4C1N K;  4DNI A;  5C5L A;  1EFW A;  4DR6 L;  1E2V A;  3NBI A;  4IUT A;  5C4X G;  3S1M H;  1JOK A;  3BVZ A;  3NWT A;  1XPO A;  3I2Z A;  3I56 A;  5HGT A;  4R8I A;  1QUQ B;  1TKW B;  1A2T A;  1VQ4 A;  4DV1 Q;  5BN3 A;  1WCM H;  2ID0 A;  5KNB A;  1I50 B;  4ZKC B;  3GTM B;  4OGQ C;  2RCF A;  3KUP A;  1VDZ A;  2Q8I B;  2AWN A;  1II3 A;  1CI3 M;  3DM3 A;  1HZC A;  2DJF C;  4UPA A;  2G9D A;  2K5D A;  4BY1 G;  1EYC A;  4BA2 I;  4TRD A;  4BY1 B;  4PZ7 A;  1CSP A;  5GAE C;  3ERQ A;  1CKO A;  3HOV G;  3MVV A;  2UUB Q;  4IUQ A;  1V1P A;  2FJ2 A;  1JJC B;  3HOV B;  2BH8 A;  1SYG A;  4CKB A;  5IGG A;  1EIF A;  3VYU A;  5IYB H;  4FF3 A;  4JK1 C;  2K5N A;  5JJZ A;  4IFD G;  2DY7 A;  5EPL A;  3CHB D;  3CCJ A;  4DF7 A;  1WJJ A;  1FGB D;  3GTG B;  3K57 A;  1O7Z A;  1ONL A;  4QB4 A;  1KDC A;  2HDM A;  5M3F B;  2AMC B;  1ICW A;  4KHZ A;  1PTO C;  4UP9 A;  2F0G A;  1W6J A;  1R9T B;  1JIC A;  4JOI C;  3H0G H;  1BQQ T;  1PYW D;  4B3T Q;  2WB1 E;  1RF2 D;  4K0K Q;  3HOW G;  2VXW A;  5E3F A;  4DPG A;  4JYA L;  2F0L A;  3VR3 A;  3HOW B;  5H1S E;  4QL5 A;  5K36 G;  4L5R C;  1FNU A;  1D1K A;  5IYC H;  2FMM A;  3TRZ A;  4DK0 A;  3PGZ A;  4KN4 C;  3PIO A;  2Z8L A;  2HD3 A;  3UDX A;  1LTL A;  2PPB C;  1AFP A;  3DEO A;  4DR2 L;  4R4T A;  1IBM Q;  2SOB A;  3NXW A;  1LTI D;  1QVF A;  1BBU A;  3RZD B;  2P5Z X;  2F0T A;  1AEX A;  2XWJ B;  3OMG A;  5J39 A;  4B3M Q;  2VQF L;  4BBR G;  2VNU D;  2NN6 H;  4FF2 A;  4R4O A;  1SLJ A;  3H15 A;  1Q7Y C;  1A3T A;  5LL6 X;  3MXN A;  5DM7 3;  1ENC A;  1WTH A;  4KN7 C;  3J81 E;  2NVQ B;  2RDF A;  1S5C D;  4GNX C;  5C3W A;  1S4Z A;  2F0M A;  1G29 1;  2FHT A;  2K7V A;  1PRT B;  4LF6 Q;  2MHV A;  4X64 Q;  1I4G A;  4B3R L;  3I72 A;  4PG3 A;  4XIG S;  4OEM B;  3CCM A;  2MUY A;  4K6D A;  5DAU A;  2PI2 A;  1LTG D;  3C1E A;  4C2M B;  1STA A;  5I9O A;  3D6W A;  2YTX A;  5A2Q L;  2HQL A;  4RA8 A;  5LMN W;  2B63 B;  2F0U A;  2QF7 A;  3SK8 A;  1SYB A;  1G51 A;  3M85 A;  1SXT A;  3TBI B;  1PH4 A;  3HOX B;  3MXN B;  1EWH A;  5LL6 S;  5HUR A;  1ZXT A;  2BDN A;  2GN5 A;  4HAE A;  2YTV A;  2IY5 B;  2KBN A;  3SEB A;  2F0O A;  4HCS A;  4LF7 L;  4A3B H;  4JI8 L;  2KEN A;  1VQ6 A;  2E2I B;  4Y7N H;  1UUP A;  3S9W A;  2JA7 H;  1HUM A;  2JP1 A;  1U9R A;  1CA6 A;  1I4R A;  5HY6 A;  2EY2 A;  3FKI H;  1PDQ A;  1DYQ A;  1G6Z A;  1CT1 D;  3S16 B;  4KD3 A;  4DAM A;  3KF6 A;  1NAP A;  4X66 L;  3ND9 A;  1PVO A;  4LK1 C;  3CU7 A;  4KY7 A;  2LS0 1;  2RA4 A;  4HJ5 A;  1PZI D;  3T13 A;  3PCO B;  4JI1 L;  4C3H G;  4A93 G;  4DR7 L;  1EZ8 A;  5D14 A;  4C3H B;  4A93 B;  1OXX K;  1HPC A;  1N9W A;  4K5X A;  2JK8 A;  2BH2 A;  1Q8I A;  1O78 A;  4IJH A;  1GJX A;  2F1M A;  3UDG A;  1NUC A;  1PH3 A;  3GTK H;  1K73 C;  1B4O A;  2UXB Q;  1XPU A;  4DV5 L;  4HSV A;  4RKL A;  1A3V A;  1OXT A;  1JWU D;  1PFN A;  4APV A;  3QOJ A;  3KF6 B;  4HSP A;  3LX0 A;  3DEP A;  4XT3 B;  5JJI A;  2PMZ B;  3HRZ C;  3PIP 3;  1LT3 D;  3ULP A;  4LF5 L;  4KY6 A;  3RD4 A;  2A69 C;  5KIX A;  1UEA B;  5DLQ E;  3CC2 A;  5A35 A;  2NVT B;  4JC0 A;  3P75 A;  3CMA A;  1FGU A;  3X3M A;  4L63 B;  2K5V A;  4HJ7 A;  1K28 A;  2F0W A;  4QIW E;  2OXP A;  2LKV A;  1EIH A;  1HFN A;  1X32 A;  2EQS A;  2FFK B;  2M2L A;  3RZO B;  3DWP A;  3KF8 B;  1Z9F A;  2EXZ A;  3HKZ G;  5EGT A;  4CDD C;  1B8A A;  2ZT9 C;  3HKZ B;  3CP0 A;  3S1R B;  3HOY G;  1ET9 A;  2XNA C;  3HOY B;  2QDL A;  1EQV A;  2N88 A;  2A74 C;  3VR4 A;  2NVX H;  4OXP A;  4YWM A;  3K6O A;  3ZYY X;  1F77 A;  4DAP A;  3A7A B;  1SE4 A;  2HIV A;  5IGF A;  2JA8 G;  2EYH A;  5J3B A;  3KDF A;  2JA8 B;  4NB3 A;  2C35 B;  4UP8 A;  4X65 Q;  4OIJ A;  3D6C A;  5C3E G;  2B3G A;  2B2T C;  5JVG 3;  1WYD A;  5EKI A;  1SMY D;  4DV7 Q;  3URY A;  5KNC A;  1D5Z C;  1BBX C;  1U0L A;  1KIX A;  1TII D;  2F0E A;  1VQM A;  3CQZ B;  5C3X A;  3AMU A;  2X6L A;  1PHJ A;  2AQ2 B;  4FDB A;  5G3L D;  1TS3 A;  3SK5 A;  4JI3 Q;  2UXC Q;  2F4V L;  2KCN A;  3E9H A;  1WCM G;  3R93 A;  5FO7 B;  2Y0S G;  1BXT A;  3QOL A;  4LMQ D;  1WCM B;  1K83 B;  2WV6 D;  1XMO Q;  3GTP B;  2Y0S B;  3W5O A;  5IOD A;  4GKJ L;  3PO3 H;  4K2L A;  1X3G A;  2WAQ E;  4MN3 A;  5K5P A;  5IE8 A;  3KDF B;  2Q2I A;  1KRS A;  1HNW L;  2XRS D;  4DV3 L;  2WIN B;  4IFD J;  1B9N A;  3HZX A;  4AH6 A;  5FO8 B;  1GUG A;  1IBK Q;  2Q2T A;  3Q0A A;  3BS1 A;  3K58 A;  1ENF A;  4CJ2 C;  1CHP D;  1IHZ A;  2KCT A;  5CBE E;  5IGC A;  5ELE A;  4LAA A;  1EYA A;  1VCI A;  3IL8 A;  3EVQ A;  4DV4 L;  3T53 B;  1N32 Q;  5LHY 1;  4ZK9 B;  2Z1C A;  2WKD A;  1JB3 A;  4XT1 B;  1CK1 A;  4IN3 A;  2HT1 A;  1ET6 A;  2PZU A;  3OWF A;  1D2B A;  3CPF A;  1YEZ A;  4B9W A;  3F2U A;  1A62 A;  2IT1 A;  2NTT A;  3H0G B;  4LFC Q;  3NQI A;  4HJ8 A;  1KRT A;  3MZ5 A;  3J7A F;  1TQO A;  4R4Q A;  1JR0 D;  5T1I A;  4DV6 Q;  3W3A A;  2CKZ B;  4NXM L;  3MHB A;  4A3D H;  4JI7 L;  4A3F H;  4A3M H;  3A7L A;  1FD7 D;  5IY0 A;  3M4Q A;  1I6V C;  4B9X A;  3IAY A;  5IP7 G;  4L8J A;  3NTI A;  2XSC A;  3TS0 A;  1EU4 A;  2F0S A;  2PNH A;  1PRT C;  4C1N I;  4OO1 H;  1K3B C;  2Z9H A;  4GKK L;  1S5E D;  1G2T A;  2XWB B;  3V05 A;  2UU9 Q;  3CXC A;  3TP7 A;  3ITP A;  1G8Z D;  5KYI A;  1W6K A;  1GOZ A;  1K8G A;  1HNZ Q;  3GV3 A;  2I46 A;  2L11 A;  3SHL A;  1KHI A;  4MIU A;  4ZQ3 A;  2A1A A;  1QE6 A;  1TWA H;  4XQN A;  1LM0 A;  1VQL A;  4G7H C;  3UE0 A;  2HHH Q;  4R4C A;  4NP5 A;  3TEH B;  4UP7 A;  1VQE A;  1STH A;  2HUG A;  2K01 A;  4KI0 A;  1TS2 A;  2NWG A;  2D62 A;  2SNM A;  4DV2 Q;  3K5N A;  4UHV A;  2UUA Q;  4CDF C;  2JJQ A;  1QOH A;  4RG1 A;  3ICE A;  1BCP F;  4B08 A;  4ZKB B;  1FJG L;  3K0Y A;  1EY6 A;  5C6A A;  1WTX A;  2R92 H;  4OO1 I;  5KND A;  4A3B G;  4AYB G;  2I0Q A;  4A3B B;  2JA7 G;  3DUZ A;  2F0J A;  2YYZ A;  4AYB B;  5T1G A;  2JA7 B;  3S2D B;  1JCK B;  2KHI A;  1GHJ A;  1LTB D;  5FLX E;  3EBE A;  1NBW A;  4CBV A;  1P16 A;  4BXX G;  4CKE A;  1RCV D;  1WTW A;  5C5M A;  2A6E D;  1KAA A;  1B50 A;  1H9S A;  2I5M X;  2I07 B;  3MEH A;  4H7B A;  2CW0 D;  4DN4 M;  3I8Z A;  2FMC A;  2IHE A;  5M3M H;  1N34 Q;  1STN A;  2V4D A;  2ZTC A;  3FPP A;  2ALY B;  3X3N A;  1HNX Q;  2KUM A;  5IWA L;  5M5X B;  2MNA A;  4ZYS A;  3A8J E;  4JI4 Q;  3I4O A;  1C8C A;  5J1Z A;  3F2B A;  5KGU A;  1PXU A;  3LGJ A;  4C3I H;  3MTS A;  1CZW A;  3GTK B;  2E2H H;  1PV4 A;  3GTQ B;  3ERO A;  2MJ8 A;  4DV0 Q;  3IRB A;  2LSS A;  1F9R A;  1S5D D;  2KEC A;  2A68 C;  1K8M A;  1YHA A;  4J8Q A;  1SE3 A;  3FDT A;  1UEB A;  3RR5 A;  3UE1 A;  1H9S B;  3ERS X;  3QG1 A;  4QUF A;  2UUB L;  1EEF D;  1VQC A;  3BDL A;  4A3G H;  1XNR Q;  5CV7 A;  1SYF A;  1RDP D;  2BA1 A;  2E76 C;  3NK9 A;  3F2C A;  3S2H H;  3QR8 A;  4DKA C;  5IT9 E;  3PQI A;  1EWI A;  1BR9 A;  2H4O A;  4CHT B;  3S24 A;  4LF4 L;  4J1M A;  1CSQ A;  5CBA E;  3A54 A;  1SEB D;  1WTO A;  3J80 c;  3K7A B;  4GOP A;  1PLF A;  4S3S A;  5M9O A;  2MPM A;  1UE1 A;  1XXG A;  5CV5 A;  1GUO A;  4QF4 A;  1TWF H;  1YNN D;  1SRU A;  1B3A A;  2B2Y A;  2EYO A;  5FLM H;  1QVG A;  3VA5 A;  3I3C A;  4X62 Q;  1KD1 C;  1KXL A;  3M4O H;  4G4K A;  2NVY H;  3Q23 A;  1XMQ L;  4R1J A;  2QDB A;  1DJR D;  1IW7 C;  3Q8D A;  2NVX B;  1STE A;  4DNT B;  2VY3 A;  1OO9 B;  1HZ9 A;  2HCC A;  4FXK C;  2Z4I A;  1PYB A;  3HKS A;  3NEL A;  3NSW A;  1QUQ A;  1T5X D;  1WI5 A;  3OIP A;  1M90 C;  3ONA B;  1L0W A;  5LMN Q;  4HJA A;  4GN3 B;  3SK6 A;  4GOP B;  1WTR A;  1STG A;  4BY7 H;  1TXY A;  1PH9 A;  1YJW A;  4DUZ L;  4B3S Q;  4HIM A;  1KDA A;  5CV4 A;  2EY6 A;  1I3Q H;  1S40 A;  1E2W A;  2ATW A;  4P72 A;  3L7Z C;  4L5S A;  3I4N H;  4YWL A;  3HOU H;  2AWO A;  1O7I A;  3OW7 A;  3AFP A;  1DXM A;  3RLO A;  2QA4 A;  5NUC A;  5AJ3 Q;  2Z6K A;  1J8I A;  4LF6 L;  4X64 L;  1E2Z A;  1I4Q A;  1UWV A;  2PYK A;  4H44 C;  1YJN A;  3T1Y L;  2FIN B;  4GN5 A;  1EUJ A;  1AZP A;  1C7Y A;  4K6L A;  1OXU A;  3VA7 A;  1A15 A;  4DR3 Q;  1LYL A;  3CCL A;  2B8F A;  5KYL A;  4MTK A;  3B6Y A;  2NTS A;  1PTO D;  3KLS A;  2EY1 A;  1SNO A;  2PCF B;  3TZD A;  3GTL H;  2JXM B;  1IXR A;  1VQF A;  2X69 A;  1YHQ A;  2AUK A;  4EQO A;  2K04 A;  2JA6 G;  4PNY A;  1DZ1 A;  2RSO A;  3P1H A;  2JA6 B;  1JOQ A;  3NTK A;  1U5K A;  2WP8 J;  3PUY A;  4HTH A;  2OEO A;  2RCN A;  4GLA C;  4QJF A;  1SNQ A;  5GRO A;  5CGK A;  2PW7 A;  5C4J H;  1NTG A;  3NPP A;  2F4I A;  1H9R A;  1RL2 A;  4TKO B;  1XYI A;  1K8A C;  4LFB Q;  2QEX A;  2PQA B;  2C9O A;  3VR5 A;  2EZV A;  2IJ0 A;  1RTO A;  2GVA A;  1VQA A;  1L2F A;  2MQH A;  5M3F G;  3OOC A;  4A3D G;  4A3F G;  4A3M G;  4XYQ A;  2WB1 B;  1MIU A;  1GM5 A;  4A3D B;  4A3F B;  4A3M B;  1SNM A;  4UDU C;  1AE2 A;  2DNC A;  3QIA A;  5LMU L;  1Y1W H;  1CKM A;  3I73 A;  3ER0 A;  2RDH A;  4YY3 L;  2R7Z H;  2UXB L;  4YCW A;  4GS3 A;  3M9B A;  4M1U B;  3Q24 A;  1EQT A;  4L5Q A;  1ZKO A;  3CME A;  1U4R A;  4OO1 G;  2HDL A;  2QCP X;  5FJ8 H;  4YHH Q;  1B1Z A;  1Q8K A;  2KVM A;  1KNE A;  4XYO A;  4Z9C B;  1ASZ A;  1TWH H;  2MP1 A;  1MD2 D;  1PZJ D;  4K8I A;  4KMU C;  3GDE A;  2IX3 A;  5JEA H;  2F0V A;  4JI5 L;  4LUO A;  1X3F A;  2B2U C;  4DXG A;  1S3O A;  1DOL A;  3TS2 A;  2AKW B;  5ISR A;  3HOZ H;  1V43 A;  5CR3 A;  4RMF A;  1NR4 A;  4MNO A;  4HED A;  2OT2 A;  1TWA B;  4A3J H;  4WJ4 A;  1JWM D;  2LXK A;  3BYY B;  2KQ3 A;  2XRQ D;  1SBB B;  2JYO A;  1B70 B;  4A3E H;  3P7J A;  1XNQ L;  1U4L A;  4Q0F A;  4OIK A;  5DM6 3;  1Y1V H;  1RD9 D;  1EL0 A;  5EKK A;  3CW2 C;  1J5E Q;  1V1Q A;  1Q90 A;  1I94 Q;  1YNJ C;  3I4L A;  3T16 A;  4F7X A;  5C4H A;  2CCZ A;  1U4M A;  3S1N H;  4RGT A;  1PTO H;  2EPB A;  1X55 A;  3J80 i;  3U9S A;  3E0J A;  2VQE Q;  4X3U A;  2EJF C;  4X6A H;  3FVQ A;  5DNF A;  1D7Q A;  2ZM6 Q;  2B63 G;  4DR4 Q;  1HH2 P;  4GLV B;  1TY2 A;  3HOX G;  3LWU A;  1HR0 W;  2A19 A;  3GTO H;  2D9U A;  4A3L G;  1IKL A;  5JPN C;  4X65 L;  3UDF A;  2RHQ B;  4N8X 1;  4FP5 D;  2NN6 I;  3K5O A;  1TWG B;  4GLX A;  3CC4 A;  3PUZ A;  2N55 A;  2VB2 X;  3TQY A;  2V1C C;  3EQL C;  3DWQ A;  2ZTE A;  4RHS A;  5M3M B;  1X3E A;  1SE8 A;  3CCE A;  1QWY A;  3KLW A;  2L12 A;  4JI3 L;  2UXC L;  2JEB I;  3CRK C;  3MXP A;  3NEN A;  4WJ3 M;  4FXD A;  5DEH A;  2JA9 A;  1HXY D;  1OXV A;  4IZ8 A;  2A69 D;  1IZ6 A;  4CDC C;  1XMO L;  2B39 A;  4C3I G;  1I6H H;  3I70 A;  1FVI A;  4C3I B;  3M7G A;  3IFT A;  1KTK A;  2NZ1 D;  1KDB A;  2E2H B;  4KK7 A;  1B53 A;  1JWS D;  4XQJ A;  2G9H D;  4R8N A;  4A3C G;  1K0S A;  2AQ1 B;  3AB9 A;  3W2D A;  4BS9 A;  4V19 0;  3H94 A;  4A3G G;  5COY A;  3S1Q H;  1BO0 A;  4A3G B;  2ICI A;  2DN8 A;  1QZH A;  3ULJ A;  3J81 c;  2PI2 E;  5L37 A;  1IL2 A;  4O1N A;  4DU9 A;  3S2H B;  2F0H A;  3KF8 A;  2L9H A;  1NJI C;  1EIY B;  1D8L A;  2KJX A;  1EY8 A;  1N32 L;  2K4K A;  4U68 A;  1LT4 D;  3PF5 A;  2K5W A;  4K2K A;  1VS0 A;  5F2D A;  1GKH A;  1B7Y B;  2NYZ D;  4RGO S;  3T56 B;  5IIF A;  1VQ9 A;  4JYA Q;  1CA5 A;  1CM9 A;  3DM1 A;  1KAW A;  4LFC L;  3VR2 A;  1YBY A;  4IUP A;  3NBH A;  4QIW B;  1PH1 A;  4DV6 L;  4GOP C;  3FPU B;  1HHV A;  5G3L F;  3ND8 A;  2BOS A;  3M4O B;  2XGT A;  1E0B A;  1PZK D;  2NVY B;  2WKC A;  4FF4 A;  5GAD C;  4LFA L;  3A56 A;  3W1B A;  3R2T A;  2MFI A;  4DXF A;  3PUX A;  3J81 j;  2C5C A;  2VQF Q;  5M5Y H;  4JPB W;  2B2Y C;  4JV5 Q;  1I5F A;  1HA6 A;  1VQP A;  4JI2 L;  4DAY A;  3I4M G;  4OWX B;  4PZ6 A;  5JJL A;  1O7L A;  3I4M B;  4BY7 G;  2UU9 L;  2F0K A;  4KHP L;  4BY7 B;  1H9M A;  2JN4 A;  4ZUJ A;  2ES2 A;  4JI0 L;  5D3I B;  4DK3 C;  5FLX L;  3E5S A;  5KEE A;  1PH6 A;  1M4V A;  3HG9 A;  3I4N B;  1STY A;  2JE6 I;  1HA5 A;  5IGE A;  3JAM E;  3NBH B;  4IQZ A;  4Y52 H;  1YI2 A;  3H3V H;  1Z47 A;  4KHV A;  4JBK A;  2IW3 A;  1Y8P B;  1MSG A;  2HHH L;  3CPW A;  1IYU A;  2F52 A;  4BBS H;  2R93 H;  2OCE A;  2E2J H;  3MXG A;  1A8V A;  4DV2 L;  3D4W A;  1ML0 D;  1CTM A;  3S1M B;  2UUA L;  1E1T A;  2L1B A;  1BCP B;  1ESR A;  2MGS A;  3LNN A;  2Z6K C;  1N8R C;  3CCV A;  5BR8 Q;  4DAY B;  4POG A;  1LTA D;  1NE3 A;  4FO2 A;  1WFQ A;  1LAB A;  2VW9 A;  3GTL B;  2F3V A;  1YVC A;  3KLR A;  5JVH 3;  2VL6 A;  1Z7T A;  1SND A;  5EJW A;  1NSN S;  2IL8 A;  1K8O A;  2F0P A;  1E1O A;  4F87 A;  1L1O B;  2F0N A;  1EQR A;  2AUJ D;  2VS1 A;  4EQN A;  1ILP A;  1G2S A;  1PRT D;  2JEA I;  1EU3 A;  2L15 A;  3C1F A;  5E1F A;  2IWH A;  2FXQ A;  1BUV T;  3H09 A;  5IT9 L;  5C4J B;  3H3V I;  5C4X H;  5IYB G;  2F3W A;  4DR7 Q;  1H9J A;  1HRJ A;  4R9W A;  1BBW A;  1VQ5 A;  2Y0S E;  3GP7 A;  4KD4 A;  3CF5 A;  2CQA A;  1N34 L;  4EGV A;  3S17 H;  4JBW A;  1JOR A;  2CWP A;  1VF5 C;  1NNX A;  2EIF A;  3R2I A;  2Z4H A;  3A8K E;  5C0X H;  4LW1 A;  4CJ0 B;  4G7O C;  4EVO A;  4K8J A;  2F0D A;  3OWE B;  4JI6 Q;  3CKI B;  3H0G G;  4DV5 Q;  3G71 A;  4QGU A;  1Y1W B;  2OTJ A;  3CD6 A;  3EFX D;  1EZ6 A;  3D8G A;  4ILW A;  3HOV H;  5IYC G;  1GUT A;  1SMY C;  1AW7 A;  5FJ8 G;  1L0X B;  2UXD L;  1XPR A;  3CAM A; 
#chains in the Genus database with same CATH homology
 1LT6 D;  1QIL A;  1TWH B;  2B2U A;  1EY0 A;  4ZUI A;  1BF4 A;  2NN6 G;  4J6H A;  1QB5 D;  3BVG A;  1B9M A;  4A3J B;  1SJE D;  4XXE A;  2F0F A;  5IGB A;  4PMW A;  2J4X A;  5C0X I;  4Q5V A;  4C56 C;  4A3E B;  3U9O A;  2BCO A;  5K36 H;  1RKN A;  1SYC A;  3DWA A;  1Y1V B;  4ULL A;  5I9P A;  2R3Z A;  3S1N B;  1EYD A;  1PTO B;  1TS5 A;  2A6H C;  2Q8T A;  2HCI A;  2XN9 C;  2KOL A;  4HR7 B;  4L6T B;  1Q1E A;  1SE2 A;  2CVR A;  2EJM A;  2A68 D;  1IYV A;  3I90 A;  4RKB A;  1LV9 A;  4Y7N B;  1JC7 A;  3VYT A;  3M4Y A;  4ME5 A;  3J80 E;  3FKI B;  3L9A X;  1WD1 A;  1B2T A;  3C2P A;  2EYJ A;  1O7Y A;  3HEJ A;  3TN2 A;  4KKT A;  3RMH A;  3KK7 A;  1DCZ A;  3BG3 A;  1DON A;  1F9P A;  2F0Q A;  3QWN A;  1ROD A;  3SR1 A;  1RTN A;  1OXS C;  1HUN A;  5KRU A;  1TR5 A;  2KCC A;  4ZLT F;  3M7N A;  3SVM A;  3S1Q B;  4HN7 A;  5I4D A;  1C48 A;  3VR6 A;  4DGZ A;  1Z6H A;  1IW7 D;  4PMC A;  2TMP A;  1TVX A;  2LY7 A;  5ELD A;  3GV6 A;  1EY4 A;  1FYC A;  4H0L C;  1M8A A;  2HQE A;  5EPK A;  3OPO A;  1QG7 A;  3QJY A;  5ELB A;  4IUN A;  5D3D A;  1B44 D;  4IUU A;  2ZXP A;  1XWE A;  1WTQ A;  3G6J B;  4FYD A;  1TY0 A;  2IX1 A;  2PZW A;  5M5Y B;  1NCV A;  3R3O A;  5FO9 B;  1VMP A;  1PTO F;  3PUV A;  1Q1B A;  2EYL A;  2K33 A;  4LJZ C;  2K5Q A;  1DOK A;  4ODG A;  4HMI A;  2PW5 A;  4X3K A;  3T4A C;  3HS0 C;  1BCP C;  5BN4 A;  3A55 A;  1I4P A;  2L5T A;  4RAU C;  4BBS B;  3TP6 A;  3WOF A;  1IKM A;  2L0C A;  4RWS C;  4ID6 A;  3PUW A;  4QCL A;  2EOT A;  4WRD A;  5J22 A;  3BDC A;  1SAP A;  1QNU A;  3EA6 A;  4EQP A;  2L55 A;  1ENA A;  4U67 3;  1ESF A;  4IUV A;  3PO3 B;  5CV9 A;  5CV6 A;  4I65 A;  3C3L A;  4V0B A;  1UAP A;  1PFB A;  3FRP B;  2K03 A;  4KV6 A;  3A8I E;  2KEE A;  2B2V A;  5EKL A;  4CKC A;  4PV1 C;  4FVM A;  2XIW A;  3HP3 A;  5C4X B;  1LT5 D;  3MC0 B;  3N6R A;  4KKS A;  2EVB A;  3CRL C;  1JE4 A;  3S17 B;  3C46 A;  5FKA C;  5C0X G;  2F0I A;  5E4X A;  3D4D A;  1ZYR C;  5I6Y A;  2BE5 C;  3GD7 A;  2OF1 A;  2DY8 A;  4F8M A;  1CQV A;  5JEA J;  2D5D A;  2SNS A;  4CJ1 B;  1AN8 A;  1WD0 A;  1VF7 A;  3EJI A;  1YNJ D;  3N52 A;  2K32 A;  2NBF A;  5FOB B;  4A3I B;  1FNV A;  5C4Z A;  1HCZ A;  1GUW A;  3BYT B;  1T5E A;  1WVL A;  5FK9 C;  5BN5 A;  2A73 B;  4N9T A;  2EDG A;  3TP5 A;  4H13 C;  4G7Z C;  5TSS A;  4NKL A;  3JAM L;  5EPJ A;  1SYD A;  1CFM A;  4IUR A;  4M8A A;  4TSS A;  1V1P B;  3UI2 A;  2J0T D;  2K1B A;  2Q8R E;  1NR2 A;  2J7Z A;  3NTH A;  3SXH A;  2KED A;  5CYU A;  2H1E A;  3D31 A;  2EJG C;  4HMJ A;  4BWG B;  4WFN 3;  1I4H A;  1R4P B;  2R61 A;  3L3O C;  4OHJ A;  1F2M A;  4BBR B;  5CC4 A;  3PIO 3;  1TWC B;  1TT2 A;  2R92 B;  2RKS A;  3GQB A;  1CZG A;  2KHS A;  1EY5 A;  1LTT D;  5IOC A;  4K5W A;  1EFI D;  3WDN A;  1D6E C;  3H6M A;  1G91 A;  1D5X C;  4NDX A;  1CHQ D;  1D1I A;  2XVS A;  4F88 A;  4OL7 A;  5JAV A;  3TDQ A;  4RHR A;  1L0Y B;  1Q3L A;  2ICE C;  2L4N A;  2TSS A;  1I4X A;  3OIQ A;  1SJH D;  4K14 A;  4PMB A;  3TSS A;  4MHE A;  2A5H A;  4X3S A;  1KLG D;  4XDX A;  5COR A;  2B2W A;  1ILQ A;  4C3J G;  1Y8N B;  3FMC A;  1D5M C;  1VMC A;  3MXU A;  4C3J B;  1X3P A;  4HCE A;  1HTL D;  1LLR D;  2IX0 A;  4WJW A;  4FF1 A;  5EBC A;  1MGS A;  5IGD A;  3RUZ A;  1TWF B;  3GO5 A;  4NMZ A;  4ZRZ A;  4QUC A;  4G57 A;  3TME A;  1AP0 A;  1RJT A;  3H3V C;  4GZY C;  5CMD A;  3OSO A;  5AFW A;  4P2C B;  1F2L A;  3DHQ A;  2QKI C;  2DNE A;  2VUM B;  1Y69 U;  1DOM A;  1SNC A;  3RLF A;  5EBD A;  4QMG A;  4BA1 I;  2E74 C;  3SDZ A;  3VYS A;  3QO2 A;  1I3Q B;  3TZU A;  5M5W B;  3J80 L;  1PRT F;  1GUS A;  3SE0 A;  3R8B A;  4DNR B;  3HOU B;  3PMF A;  3BDO A;  1WTV A;  4NW2 A;  2VB3 X;  3NP8 A;  4RFB A;  3D4R A;  3Q22 A;  2NB0 A;  2LFN A;  1QCB D;  1A2U A;  1UNS A;  5ELC A;  2YU9 B;  1EY7 A;  1O80 A;  3BZD B;  3OHX C;  1LTS D;  4A3K B;  5D65 A;  4WOR A;  2EYM A;  2WAQ B;  3KLS X;  5E4W C;  3J7Y W;  5C3E B;  5C44 B;  3S15 B;  1SFO B;  4K5V A;  1QJO A;  2EY5 A;  5C0X J;  3H91 A;  4DA2 A;  3P20 A;  4ZAI A;  1Q12 A;  3IFD A;  2AQ3 B;  3E6Z X;  1U4P A;  1PMR A;  1C4Q A;  3HGB A;  2B2V C;  3T51 B;  2F03 A;  3MA2 B;  4I7Z C;  1LTR D;  2K05 A;  2QEJ C;  3K5M A;  5ELF A;  2ZXR A;  5A2Q E;  1A3U A;  1F9Q A;  4IAL A;  3V2T A;  2PQE A;  4UAI A;  3BVM A;  1HQR D;  1IL8 A;  3MFY A;  3I91 A;  2R7Z B;  2CHB D;  4FNF A;  3Q6S A;  1EWC A;  3PV0 A;  3J7A V;  2A6H D;  4TQU S;  1STB A;  1HFG A;  3GTJ B;  5I2X A;  3FEW X;  2KA7 A;  1KLU D;  1JQY D;  5JEA G;  1SNP A;  1QNK A;  4IFD H;  1MBY A;  1HQM C;  3NWS A;  1XTC D;  3NHH A;  4KJO A;  2R6G A;  3KBX A;  3HOZ B;  1S5B D;  1Y8O B;  4DAV A;  4ABN A;  1V8Q A;  1LAC A;  1TU2 B;  1JOO A;  4RGM A;  1FNW A;  3D3R A;  1KNA A;  1FR3 A;  1X3Q A;  4DFA A;  1EOT A;  2RVL A;  4KJN A;  2QIL A;  4RCN A;  1LO5 D;  1HTP A;  2D2C C;  2WII B;  3WOE A;  3MFG A;  3K59 A;  2PNR C;  4IFD I;  5I2Y A;  3GTO B;  2O4X A;  1DD2 A;  1GHK A;  4XQQ A;  2E75 C;  4PQX A;  1R4Q B;  3O13 A;  3SK4 A;  1WTP A;  2RQX A;  2RDG A;  3AU7 A;  5JOB A;  1SDF A;  2K6A A;  1I6H B;  2SEB D;  2O2L D;  4KY5 A;  1PFM A;  1RHP A;  1EIG A;  3QB3 A;  4KTA A;  1SSO A;  2X6G A;  2JA5 B;  4RH6 A;  4O42 A;  1AZQ A;  3G7L A;  5JPM C;  3VYR A;  1ZEQ X;  2WAC A;  2JSO A;  4N9P A;  1S5F D;  1MSH A;  3V96 A;  2ENB A;  2EYP A;  1GUN A;  1BCP D;  2B2W C;  2BA0 A;  2NUC A;  5CV8 A;  2K28 A;  1KAB A;  1H9K A;  1XX8 A;  3NUC A;  1J9O A;  1A6X A;  2EYF A;  1TS4 A;  3DXJ C;  2LMC B;  3DMU A;  4RCO A;  3S14 B;  2E2D C;  2RBM A;  2A6E C;  4RGN A;  4E6I A;  2CW0 C;  3J81 L;  3MWY W;  2EE1 A;  5EQ0 A;  4KKU A;  3K5L A;  1F2Z A;  2PO4 A;  4DK1 A;  1F9S A;  4XTC S;  1F2Y A;  2IPK D;  2RSN A;  3IKJ A;  1BNZ A;  3NE5 B;  3NQT A;  4FXG C;  1MI2 A;  2M00 A;  1CQF A;  3LWE A;  3PO2 B;  3TP8 A;  4YIJ A;  3KBG A;  2BDO A;  3OMC A;  2B8G A;  2R93 B;  2ZXO A;  2E2J B;  1DM0 B;  2SDF A;  1ZYR D;  2BE5 D;  1SYE A;  1EY9 A;  1GXD C;  4X3T A;  2M9V A;  1BOS A;  4CGY B;  2B2T A;  2O5J C;  2O5I C;  1V1O A;  1EEI D;  2GA4 B;  5I6W A;  3M3Y B;  1BDO A;  3MAQ A;  1YNN C;  2PZT A;  4C1N K;  5C5L A;  1E2V A;  3NBI A;  4IUT A;  1JOK A;  3BVZ A;  3NWT A;  5HGT A;  4R8I A;  1TKW B;  1A2T A;  5BN3 A;  2ID0 A;  5KNB A;  1I50 B;  4ZKC B;  3GTM B;  4OGQ C;  3KUP A;  1VDZ A;  2Q8I B;  2AWN A;  1II3 A;  1CI3 M;  2G9D A;  2K5D A;  4BA2 I;  1EYC A;  4TRD A;  4BY1 B;  3ERQ A;  3MVV A;  4IUQ A;  1V1P A;  2FJ2 A;  3HOV B;  1SYG A;  4CKB A;  5IGG A;  3VYU A;  4FF3 A;  4JK1 C;  5JJZ A;  4IFD G;  2DY7 A;  5EPL A;  3CHB D;  4DF7 A;  1FGB D;  3GTG B;  3K57 A;  1O7Z A;  1ONL A;  4QB4 A;  1KDC A;  2HDM A;  5M3F B;  1ICW A;  4KHZ A;  1PTO C;  2F0G A;  1W6J A;  1R9T B;  1JIC A;  1BQQ T;  1PYW D;  1RF2 D;  2VXW A;  5E3F A;  2F0L A;  3VR3 A;  3HOW B;  5K36 G;  1FNU A;  1D1K A;  2FMM A;  4DK0 A;  4KN4 C;  2Z8L A;  2PPB C;  1AFP A;  3DEO A;  2SOB A;  3NXW A;  1LTI D;  3RZD B;  3OMG A;  2F0T A;  1AEX A;  2XWJ B;  5J39 A;  2VNU D;  2NN6 H;  4FF2 A;  1A3T A;  5LL6 X;  3MXN A;  5DM7 3;  1ENC A;  4KN7 C;  3J81 E;  2NVQ B;  2RDF A;  1S5C D;  5C3W A;  1S4Z A;  2F0M A;  1G29 1;  2FHT A;  2K7V A;  1PRT B;  2MHV A;  1I4G A;  3I72 A;  4XIG S;  2MUY A;  4K6D A;  5DAU A;  1LTG D;  3C1E A;  4C2M B;  1STA A;  5I9O A;  3D6W A;  5A2Q L;  4RA8 A;  2B63 B;  2F0U A;  2QF7 A;  3SK8 A;  1SYB A;  3M85 A;  1SXT A;  3TBI B;  3HOX B;  1EWH A;  5LL6 S;  5HUR A;  1ZXT A;  2BDN A;  4HAE A;  3SEB A;  2F0O A;  4HCS A;  2E2I B;  1UUP A;  3S9W A;  1HUM A;  2JP1 A;  1U9R A;  1CA6 A;  1I4R A;  2EY2 A;  1PDQ A;  1DYQ A;  1G6Z A;  1CT1 D;  3S16 B;  4KD3 A;  1NAP A;  3ND9 A;  4LK1 C;  3CU7 A;  4KY7 A;  2LS0 1;  2RA4 A;  1PZI D;  3T13 A;  4C3H G;  1EZ8 A;  5D14 A;  4C3H B;  4A93 B;  1OXX K;  1HPC A;  4K5X A;  1Q8I A;  1O78 A;  1GJX A;  2F1M A;  1NUC A;  1B4O A;  4HSV A;  4RKL A;  1A3V A;  1OXT A;  1JWU D;  1PFN A;  3QOJ A;  4HSP A;  3LX0 A;  3DEP A;  4XT3 B;  2PMZ B;  3HRZ C;  3PIP 3;  1LT3 D;  4KY6 A;  3RD4 A;  2A69 C;  5KIX A;  1UEA B;  5A35 A;  2NVT B;  3P75 A;  3X3M A;  4L63 B;  2F0W A;  2OXP A;  2LKV A;  1EIH A;  1HFN A;  1X32 A;  2FFK B;  2M2L A;  3RZO B;  3DWP A;  2EXZ A;  5EGT A;  2ZT9 C;  3HKZ B;  3S1R B;  1ET9 A;  2XNA C;  3HOY B;  1EQV A;  2N88 A;  2A74 C;  3VR4 A;  3K6O A;  3ZYY X;  1F77 A;  4DAP A;  3A7A B;  1SE4 A;  5IGF A;  2EYH A;  2JA8 B;  4OIJ A;  3D6C A;  2B2T C;  5JVG 3;  5EKI A;  1SMY D;  3URY A;  5KNC A;  1D5Z C;  1BBX C;  1TII D;  2F0E A;  3CQZ B;  5C3X A;  3AMU A;  2X6L A;  2AQ2 B;  5G3L D;  1TS3 A;  3SK5 A;  2KCN A;  3R93 A;  5FO7 B;  1BXT A;  3QOL A;  4LMQ D;  1WCM B;  1K83 B;  2WV6 D;  3GTP B;  2Y0S B;  5IOD A;  4K2L A;  4MN3 A;  5K5P A;  2XRS D;  2WIN B;  4IFD J;  1B9N A;  3HZX A;  5FO8 B;  1GUG A;  3Q0A A;  3BS1 A;  3K58 A;  1ENF A;  4CJ2 C;  1CHP D;  1IHZ A;  5CBE E;  5IGC A;  5ELE A;  4LAA A;  1EYA A;  1VCI A;  3IL8 A;  3EVQ A;  3T53 B;  5LHY 1;  4ZK9 B;  2Z1C A;  2WKD A;  1JB3 A;  4XT1 B;  1CK1 A;  4IN3 A;  1ET6 A;  2PZU A;  3OWF A;  1D2B A;  4B9W A;  3F2U A;  2IT1 A;  2NTT A;  3H0G B;  3NQI A;  3MZ5 A;  3J7A F;  1TQO A;  1JR0 D;  5T1I A;  3W3A A;  3MHB A;  3A7L A;  1FD7 D;  1I6V C;  4B9X A;  3IAY A;  4L8J A;  3NTI A;  2XSC A;  1EU4 A;  2F0S A;  1PRT C;  4C1N I;  4OO1 H;  1S5E D;  1G2T A;  2XWB B;  3V05 A;  3TP7 A;  3ITP A;  1G8Z D;  5KYI A;  1W6K A;  1GOZ A;  3GV3 A;  2I46 A;  2L11 A;  3SHL A;  4MIU A;  4ZQ3 A;  1QE6 A;  4XQN A;  4G7H C;  4NP5 A;  1STH A;  2HUG A;  2K01 A;  4KI0 A;  1TS2 A;  2NWG A;  2D62 A;  2SNM A;  3K5N A;  1QOH A;  1BCP F;  4B08 A;  4ZKB B;  3K0Y A;  1EY6 A;  5C6A A;  1WTX A;  4OO1 I;  5KND A;  4A3B B;  3DUZ A;  2F0J A;  2YYZ A;  4AYB B;  5T1G A;  2JA7 B;  3S2D B;  1JCK B;  1GHJ A;  1LTB D;  5FLX E;  4CBV A;  4CKE A;  1RCV D;  1WTW A;  5C5M A;  2A6E D;  1KAA A;  1B50 A;  1H9S A;  2I07 B;  3MEH A;  4H7B A;  2CW0 D;  4DN4 M;  3I8Z A;  2FMC A;  1STN A;  2V4D A;  3X3N A;  3FPP A;  2KUM A;  5M5X B;  4ZYS A;  3A8J E;  1C8C A;  5J1Z A;  5KGU A;  1PXU A;  3MTS A;  1CZW A;  3GTK B;  3GTQ B;  3ERO A;  2MJ8 A;  1F9R A;  1S5D D;  2KEC A;  2A68 C;  1K8M A;  4J8Q A;  1SE3 A;  3FDT A;  1H9S B;  4QUF A;  3QG1 A;  1EEF D;  3BDL A;  5CV7 A;  1SYF A;  1RDP D;  2BA1 A;  2E76 C;  3NK9 A;  5IT9 E;  1BR9 A;  2H4O A;  4CHT B;  4J1M A;  5CBA E;  3A54 A;  1SEB D;  1WTO A;  3K7A B;  1PLF A;  4S3S A;  5M9O A;  2MPM A;  1XXG A;  5CV5 A;  1GUO A;  4QF4 A;  1YNN D;  1B3A A;  2B2Y A;  2EYO A;  3VA5 A;  3I3C A;  4G4K A;  3Q23 A;  2QDB A;  1DJR D;  1IW7 C;  2NVX B;  1STE A;  4DNT B;  1OO9 B;  2HCC A;  4FXK C;  2Z4I A;  3NSW A;  1T5X D;  3OIP A;  3ONA B;  3SK6 A;  1WTR A;  1STG A;  1KDA A;  5CV4 A;  2EY6 A;  1E2W A;  3L7Z C;  2AWO A;  3OW7 A;  1DXM A;  5NUC A;  1J8I A;  1E2Z A;  1I4Q A;  2PYK A;  4H44 C;  2FIN B;  1AZP A;  4K6L A;  1OXU A;  3VA7 A;  1A15 A;  2B8F A;  5KYL A;  2NTS A;  1PTO D;  3KLS A;  2EY1 A;  1SNO A;  2PCF B;  3TZD A;  2JXM B;  2X69 A;  2AUK A;  4EQO A;  2K04 A;  4PNY A;  1DZ1 A;  2RSO A;  3P1H A;  2JA6 B;  1JOQ A;  3NTK A;  2WP8 J;  3PUY A;  4HTH A;  2OEO A;  1SNQ A;  5CGK A;  2PW7 A;  3NPP A;  2F4I A;  1H9R A;  4TKO B;  1XYI A;  2C9O A;  3VR5 A;  2EZV A;  2IJ0 A;  1RTO A;  3OOC A;  4XYQ A;  2WB1 B;  4A3D B;  4A3F B;  4A3M B;  1SNM A;  4UDU C;  2DNC A;  3QIA A;  3I73 A;  2RDH A;  4M1U B;  3Q24 A;  1EQT A;  1ZKO A;  1U4R A;  4OO1 G;  2HDL A;  2QCP X;  1B1Z A;  2KVM A;  1KNE A;  4XYO A;  4Z9C B;  2MP1 A;  1MD2 D;  1PZJ D;  4K8I A;  4KMU C;  2IX3 A;  5JEA H;  2F0V A;  2B2U C;  4DXG A;  1DOL A;  5ISR A;  1V43 A;  5CR3 A;  1NR4 A;  4HED A;  2OT2 A;  1TWA B;  1JWM D;  3BYY B;  2KQ3 A;  2XRQ D;  1SBB B;  2JYO A;  3P7J A;  1U4L A;  4Q0F A;  4OIK A;  5DM6 3;  1RD9 D;  1EL0 A;  5EKK A;  1Q90 A;  1YNJ C;  3I4L A;  3T16 A;  4F7X A;  5C4H A;  1U4M A;  4RGT A;  1PTO H;  2EPB A;  3U9S A;  3E0J A;  4X3U A;  2EJF C;  3FVQ A;  5DNF A;  1TY2 A;  3LWU A;  2D9U A;  1IKL A;  5JPN C;  2NN6 I;  4FP5 D;  3K5O A;  1TWG B;  3PUZ A;  2N55 A;  2VB2 X;  3EQL C;  3DWQ A;  4RHS A;  5M3M B;  1QWY A;  2L12 A;  2JEB I;  3CRK C;  3MXP A;  4FXD A;  5DEH A;  1HXY D;  1OXV A;  4IZ8 A;  2A69 D;  2B39 A;  4C3I G;  3I70 A;  4C3I B;  3M7G A;  3IFT A;  1KTK A;  2NZ1 D;  1KDB A;  2E2H B;  4KK7 A;  1B53 A;  1JWS D;  4XQJ A;  2G9H D;  4R8N A;  2AQ1 B;  3AB9 A;  3W2D A;  4BS9 A;  4V19 0;  3H94 A;  5COY A;  1BO0 A;  4A3G B;  2ICI A;  2DN8 A;  4O1N A;  4DU9 A;  3S2H B;  2F0H A;  3KF8 A;  2L9H A;  2KJX A;  1EY8 A;  4U68 A;  1LT4 D;  2K5W A;  4K2K A;  5F2D A;  4RGO S;  2NYZ D;  5IIF A;  3T56 B;  1CA5 A;  1CM9 A;  3DM1 A;  3VR2 A;  4IUP A;  3NBH A;  4QIW B;  1HHV A;  3FPU B;  5G3L F;  3ND8 A;  2BOS A;  3M4O B;  1E0B A;  1PZK D;  2NVY B;  2WKC A;  4FF4 A;  3A56 A;  3R2T A;  4DXF A;  3PUX A;  2C5C A;  2B2Y C;  1HA6 A;  4DAY A;  1O7L A;  3I4M B;  2F0K A;  4BY7 B;  1H9M A;  4ZUJ A;  5D3I B;  5FLX L;  3E5S A;  5KEE A;  1M4V A;  3HG9 A;  3I4N B;  1STY A;  2JE6 I;  1HA5 A;  5IGE A;  3JAM E;  4IQZ A;  1Z47 A;  4KHV A;  2IW3 A;  1Y8P B;  1MSG A;  1IYU A;  3MXG A;  3D4W A;  1ML0 D;  1CTM A;  3S1M B;  2L1B A;  1BCP B;  1ESR A;  2MGS A;  3LNN A;  1LTA D;  4FO2 A;  1LAB A;  3GTL B;  2F3V A;  3KLR A;  5JVH 3;  1Z7T A;  1SND A;  5EJW A;  1NSN S;  2IL8 A;  1K8O A;  2F0P A;  4F87 A;  2F0N A;  2AUJ D;  4EQN A;  1ILP A;  1G2S A;  1PRT D;  2JEA I;  1EU3 A;  3C1F A;  5C4J B;  5E1F A;  2IWH A;  3H09 A;  1BUV T;  5IT9 L;  2F3W A;  1H9J A;  1HRJ A;  4R9W A;  4KD4 A;  3GP7 A;  2CQA A;  4EGV A;  4JBW A;  1JOR A;  1VF5 C;  3R2I A;  2Z4H A;  3A8K E;  5C0X H;  4CJ0 B;  4G7O C;  4EVO A;  4K8J A;  2F0D A;  3OWE B;  3CKI B;  1Y1W B;  3EFX D;  1EZ6 A;  3D8G A;  4ILW A;  1GUT A;  1SMY C;  1AW7 A;  1L0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...