1F9PA

Crystal structure of connective tissue activating peptide-iii(ctap-iii) complexed with polyvinylsulfonic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
NLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords CONNECTIVE TISSUE ACTIVATING PEPTIDE-III
publication title Structure of the CXC Chemokine, Connective Tissue Activating Peptide-III, Complexed with the Heparin Analogue, Polyvinylsulfonic Acid
rcsb
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9pA00
2KUMA 1HFGA 2VXWA 3UI2A 2KECA 1TVXA 4IUUA 4MN3A 1X3PA 1CA6A 3GV6A 4HSVA 1EQTA 5D65A 2KEDA 1XX8A 4IUPA 1ZXTA 3FDTA 1VMCA 2R3ZA 2RSNA 2SDFA 1CA5A 4R9WA 1SSOA 2NWGA 1Q3LA 1B50A 2L1BA 1J9OA 1EOTA 1XYIA 1O7ZA 1X32A 1QG7A 1BNZA 1C8CA 1LV9A 2FJ2A 5EPKA 1MSGA 1U4RA 1X3QA 2NYZD 3MWYW 1B53A 1HRJA 1RTNA 2B2VC 3DM1A 5EKIA 1S4ZA 2Q8TA 1BBXC 1HHVA 1G6ZA 2MPMA 1A15A 1RHPA 1EIGA 3H91A 4RWSC 1JE4A 4RAUC 1AP0A 5EPJA 3TZDA 1SDFA 2DY8A 1G2TA 2NZ1D 3KBXA 1U4PA 5CMDA 5CORA 1MGSA 1HFNA 2B2YC 2EE1A 1E0BA 1ICWA 2RA4A 1BO0A 1WTRA 1PDQA 1U4MA 4ZKBB 2FINB 4OIJA 4XDXA 1AZQA 1IKMA 2B2UC 3P7JA 1WD0A 2HUGA 1IKLA 4RA8A 1DOMA 4X3SA 1EL0A 1ILQA 1F9SA 1NR4A 1F9PA 2M2LA 3IFDA 3QO2A 2FFKB 3DEPA 4LMQD 4U68A 4UAIA 1QE6A 4XT1B 4QUFA 4CJ1B 1WTWA 1WTVA 1PFBA 3MTSA 1CM9A 3GV3A 3G7LA 3ONAB 4OIKA 2K28A 4QUCA 5EPLA 5T1IA 4R8IA 2J7ZA 4ZLTF 2B2WC 1WTOA 1J8IA 1IL8A 1G2SA 3I8ZA 1DZ1A 1B3AA 2MJ8A 2MP1A 5AFWA 5COYA 1F2LA 2KEEA 3KUPA 1WVLA 1DOKA 3FPUB 2RSOA 4HAEA 4IURA 1QNKA 1PLFA 5T1GA 5CBEE 1F9RA 1RJTA 5D14A 3HP3A 4CJ2C 4MHEA 1EIHA 1GUWA 2B2TC 2XIWA 2K04A 2B2VA 3LWEA 1U4LA 5E4XA 3SVMA 3I3CA 4X3KA 1AZPA 2CVRA 2EPBA 3F2UA 2L12A 4DN4M 2HDLA 2L4NA 4NW2A 2HCIA 2EOTA 2KOLA 1NR2A 1ESRA 3IL8A 1WTPA 2H1EA 2JYOA 3I90A 1NCVA 2D9UA 2N55A 1JICA 1DOLA 1PFNA 1DONA 3N52A 2B2YA 2HCCA 5EQ0A 5JJZA 4IUVA 4ZAIA 2K1BA 2MGSA 2X6LA 1PFMA 2K03A 2KVMA 2L9HA 2B2UA 4ZK9B 1SAPA 2JP1A 1O80A 1M8AA 4XT3B 2L11A 2FMMA 4IUTA 1G91A 1NAPA 4HEDA 4CJ0B 5E4WC 1B2TA 2K01A 1VMPA 1MSHA 4X3UA 2X69A 1KNAA 3Q6SA 1HUMA 3D6WA 2IL8A 4HCSA 5EJWA 1HA6A 2X6GA 3I91A 1ML0D 1B4OA 3R93A 1WTQA 3DEOA 2B2WA 5DNFA 3TN2A 1RODA 2DY7A 2Q8RE 4IUQA 2N88A 5CBAE 1O7YA 2HDMA 1BF4A 2BDNA 1HUNA 1RTOA 4ZKCB 2RVLA 1ILPA 1F9QA 4X3TA 1WD1A 1WTXA 2FHTA 2B2TA 2K05A 4O42A 1KNEA 1MI2A
chains in the Genus database with same CATH superfamily
1HFGA 3H0GH 3H0GG 1EY6A 4LF6L 4DUYL 1QVCA 5JEAG 4O0AA 3NQIA 4O2DA 4QY7A 3DWAA 4UP8A 3K7AB 3FKIH 3FKIG 4OL7A 1EFID 4B9XA 3OPOA 1XYIA 4AQYQ 1U4RA 4JVZA 2B2VC 1S4ZA 3HOZG 1EQQA 1G6ZA 4YIJA 4R8NA 1A15A 1CI3M 1EIGA 2R92B 3KBXA 1LTTD 3RLOA 2F0IA 4B08A 4JCVE 2ENBA 2UXBQ 4AQYL 5C3EB 2VQEQ 1RD9D 1M1KC 1F2MA 4ZKBB 2FINB 2RBMA 3A54A 1U0LA 4XDXA 3SK5A 4MIUA 3CCEA 3M9BA 1X3EA 1DOMA 4R4OA 1IBKQ 2UXBL 4UPAA 3MEHA 2K14A 3AU7A 4POFA 1T9HA 1ILQA 4F7XA 3OYYA 4U68A 4UAIA 4DA2A 2VQEL 2JA7G 2JA7H 4BY1H 2L15A 2OEOA 4RGNA 5EPLA 4IPCA 3I4OA 1QB5D 1IBKL 4LK1C 4LF4L 2R7ZG 3HKZE 5COYA 1TWCB 2PW7A 2XSCA 3U50C 4BS9A 3HP3A 2EQSA 1YVCA 4C3HH 4C3HG 3BZDB 4CKCA 4DK1A 3RNUA 4YWLA 3DUZA 1JWMD 5CGKA 2E2HB 4RGOS 3SHLA 3H3VC 1B8AA 1L1OB 1JCKB 4HJAA 3K59A 1JICA 1TR5A 1TWAB 2R6GA 1W2BA 2L5TA 1STAA 4IN3A 2PQAA 4DAYB 1IYVA 5CC4A 5CV9A 4P74A 3RN2A 4IFDI 2OXPA 2RCFA 1SAPA 2O5IC 2XWJB 1A63A 1EYGA 2UU9Q 2FMMA 1PA6A 3NXWA 3T53B 4BY7H 4BY7G 1CKMA 1ONLA 3Q6SA 4C56C 2NVYB 1STEA 2K5QA 2ZTDA 3CP0A 1HNXQ 3DHQA 1F2YA 3HOXG 5M9OA 2UU9L 4RG1A 2A74C 5ELBA 2G9DA 2Q2TA 4IUQA 1K28A 1HNXL 1JWUD 2OCEA 1KAAA 1PRTD 3J80i 2EYLA 4LAAA 1T5EA 3CC2A 1CZGA 1S5BD 2A6HD 4OGQC 2F0SA 1Y1VH 2R3ZA 3S2HH 2R93B 4HJ9A 5C3XA 1E2WA 3ULPA 3HKZG 2RDFA 2HQLA 3NENA 2NYZD 2ZJPA 1QILA 2EVBA 4M8AA 1Q1EA 2ZXRA 1EQRA 1VQGA 1E3PA 1KXLA 1G8ZD 2G5DA 3PQIA 5D3IB 4JI3Q 1JJGA 1HFNA 5C44G 3I2ZA 1X55A 4OWTB 1EIFA 2BOSA 5C0XH 3CD6A 3FP9A 1Q90A 5C0XG 4GOPB 1N8RC 1IKMA 3PUWA 4P72A 4I7ZC 1SYFA 4RA8A 4JI3L 1LYLA 5CV5A 1A6XA 4G4KA 3S16H 1H9JA 4AH6A 4ZCKA 4IPDA 1EIYB 1UE1A 3BG3A 3FHWA 3KF6B 3ONAB 4G7OC 2J7ZA 2AUKA 5J1ZA 1I50B 1SE2A 1EY7A 2MJ8A 4Z9CB 4A3EH 1TWGH 3HGBA 4IURA 5CBEE 4CJ2C 1PTOC 1STYA 3I3CA 5TSSA 3Q24A 4QB4A 2GN5A 3U9SA 4HN7A 3RLNA 5LMNW 5FO7B 1LO5D 3RD4A 4DU9A 4BBSH 3I90A 4CGYB 4BBSG 4KJOA 2I5LX 2XWBB 2PW5A 4YWKA 1X3FA 3JAMc 4X64Q 3M4OH 1TIID 1Z9FA 2BH2A 3J81c 2X6LA 1SE4A 3VDYA 1UUPA 3S2DB 2YTXA 4KLKA 2NVXB 3HOVB 1SBBB 1MSHA 2QILA 1KNAA 4X64L 3CMEA 2DN8A 5C4JH 2IL8A 3PO2B 1VQNA 5GAHC 2KBNA 3HOYH 4HSPA 3HOYG 1A3TA 2E2IB 1RODA 1WFQA 4RKBA 3A56A 2EIFA 3FRPB 2K05A 2NBFA 1JMCA 1JQYD 3G6EA 4MN3A 1LTRD 5FLXc 2IT1A 1TS4A 1R9TB 1KIXA 4R1JA 2UUBQ 3KBGA 5I2YA 3NWSA 1KRTA 5CV8A 5KRUA 2Q8TA 5JPNC 5KNDA 2AHOB 4YWMA 3OTOQ 2MPMA 1RHPA 1LTAD 1LABA 2ZT9C 4RAUC 4C3JG 2NTTA 1JB3A 3QWNA 2UUBL 1RIPA 1GUNA 3K80C 3HRZC 1TWFH 3J81j 2B8GA 1MGSA 4HIOA 2D0PA 3OTOL 1WTRA 1GVPA 1LT3D 3RZDH 1T5XD 4HJ7A 3EN2A 1SJHD 3IKJA 3A5ZB 3S24A 1Y1WB 3HOWG 5C6AA 4GS3A 5IIFA 1BCPC 3K5OA 3CC7A 1YI2A 1PZID 1HNWQ 3M4PA 3HS0C 2XN9C 5KEEA 2PPBC 3CW2C 1KHIA 3W3AA 1CFMA 1L0WA 1IYJB 3KUPA 2JA6G 5EKLA 1HNWL 2F0NA 3EJIA 4ZUIA 2D0OA 4MHEA 2P5ZX 3U4ZA 5I2XA 3K5LA 3A8KE 1Q1BA 1LTSD 4C2MH 3FVQA 3F2CA 4LW1A 1I4GA 1J5EQ 1V1PB 1NCVA 2D9UA 1A3UA 5M3FH 5M3FG 2B2YA 2PMZB 2QGQA 4KD4A 3RUZA 5LMNQ 1J5EL 1A3VA 1QJOA 4R4IA 1QZHA 5IP9G 2CQAA 1LTID 2JA5H 2JA5G 3NTKA 4A3DB 5M5WH 1LACA 5LMNL 2SNSA 3OOCA 1SEBD 2JEBI 4ME3A 1X56A 1VQFA 1Z47A 3L9AX 2QF7A 2OQ0A 4IZ8A 2B2TA 3BU2A 3UDIA 2KECA 1SNPA 4IUUA 4A4IA 1DM0B 1JB7A 1CSQA 3DWPA 1TWHB 4P71A 4K6DA 2RSNA 3BVGA 4IOCA 1Q3LA 1BNZA 4A3IB 2F1MA 2WAQB 1X3QA 4CKEA 2WB1E 1OO9B 1MBYA 4HIKA 1L1OC 5I4DA 1I6HB 2NVQB 3Q8DA 2IW3A 1U4PA 4DUZQ 4JYAQ 4DR2Q 1LT5D 3KLSX 1WCMH 1WCMG 1PDQA 4A3JB 1CKOA 4KHVA 3P7JA 4EGVA 2UUAQ 1TY2A 1KQSA 1K83H 3S17B 1VQKA 4APVA 4DUZL 4JYAL 4DR2L 3G71A 4GNXB 3QO2A 5EGTA 4NXNL 1K3RA 1D1IA 1PFBA 4FP5D 2UUAL 4LUVA 5BN3A 1EY5A 2B2WC 2ZTEA 5GAGC 1SYEA 2VB2X 3PUYA 4E6IA 1OXTA 5JJLA 2M00A 2F0EA 5FLXL 2Y0SE 1U4LA 3SVMA 2CH4A 2CWPA 2EPBA 2E2JH 1NMGA 1ASYA 2EOTA 2B63H 2B63G 5JOBA 1BBWA 4HJ5A 2JYOA 1EU4A 3CAMA 2XRQD 1Y1VB 1XNQQ 1YNNC 3CMAA 1CK1A 3OSOA 5EQ0A 4YY3Q 3S1RH 4IUVA 3GTJH 4QQBX 1C9OA 1E2VA 2K03A 1TS5A 2B2UA 2JP1A 3F2BA 2L11A 3UE0A 1X65A 1XNQL 4CJ0B 2EXDA 5E4WC 2WB1G 4X3UA 2OQKA 4YY3L 1Q8IA 3PGZA 5IT9c 4R4CA 2WIIB 1WTHA 1RDPD 2D5DA 1ML0D 4GOPC 2K5HA 1EY0A 2ZJRA 1VQ4A 2I07B 5J3BA 4JI7Q 4NXMQ 2F0TA 4DV2Q 2YU9H 3I4NH 5JAVA 2CQOA 1K8AC 3E6ZX 1EQVA 1KDBA 2ZXOA 2QDBA 2R93G 2IPKD 1MI2A 1ENCA 4I7AA 4JI7L 2MO0A 4NXML 3HG9A 4DV2L 3SXHA 5H1SE 5D65A 4H13C 4K14A 1Q8KA 3TMEA 1HXYD 4L5SA 3I73A 4R9WA 2JK8A 4JPBW 1VQ9A 4LNQA 4RKLA 3S14H 3M3YB 1VQBA 1OXXK 1K3BC 2ZTCA 2FJ2A 4BBRB 1MSGA 4ZUJA 1JWSD 3G48A 4DV7Q 3EVQA 2Y0SG 3W1BA 3HEJA 2VQFQ 1SFOB 4J8QA 3GTQB 3A7AB 4YCWA 1F77A 5K36H 1VQOA 1PTOB 3FEWX 4DV5Q 4DV7L 2VQFL 3U9OA 4A3FH 4A3GH 3C46A 5A35A 4A3GG 1S5DD 2HHHQ 1F9SA 4LWCA 2M2LA 4DV5L 5M5XH 1WTVA 4OONA 2RKSA 4LF8Q 3CQZB 3TREA 1QNUA 4IJLA 3K57A 1TU2B 5JVH3 2XNAC 3DWQA 1VQPA 4ZLTF 3H09A 4J1MA 5CR3A 4K5XA 3HZXA 4OWWB 1AN8A 2HHHL 3GTOB 4LF8L 1HJPA 2F0GA 2HQEA 5C4XB 1SE8A 1YHAA 1O7LA 2F0WA 3CPFA 2RSOA 4HAEA 3HOUB 2F4IA 1B9NA 2A19A 1SNMA 1HA5A 3EIVA 2XIWA 1IBMQ 1Q81C 3ERSX 3W5OA 4K5WA 4DN4M 1W3SA 3CU7A 3CCRA 2CKZB 3CF5A 2CFMA 4H7BA 1SMXA 4F87A 2NVTH 1TKWB 1PFNA 1IBML 2WP8J 3S1MH 2Q2HA 2JXMB 3PO2G 2QKIC 3SK4A 5M5YH 1EEFD 4ZK9B 4DAPA 1IZ6A 1ET6A 1EZ6A 4HEDA 2UXDQ 1H9SB 2KHJA 5IOCA 1NBWA 4IALA 1DGSA 3PIO3 2XGTA 3MXPA 2Q8IB 2KHSA 1TWFB 5JPMC 2VL6A 3VR2A 1STGA 2EZVA 3GTPH 3L3OC 2UXDL 5BN5A 2EYPA 4DKAC 3X3MA 2RVLA 4HR7B 4L63B 3SR1A 4DR6Q 2PMZE 5F2DA 2SDFA 3NP8A 2O5JC 4JOIC 4DNRB 4OELB 1PH2A 4PMBA 1G291 3JAME 4ALPA 1V1QA 3S1QB 1XX8A 1ZXTA 4DR6L 3J81E 4DR3Q 4L6TB 1I4XA 4RCNA 1XMQQ 2PZUA 4Y7NB 4A3CH 2K5DA 3STBD 3ZYYX 1PH1A 5IYCG 1PHJA 1SYGA 1SMYC 5EKIA 3LX0A 2NZHA 3VYTA 4S3SA 4DR3L 3OMGA 1XMQL 4RWSC 2JA8G 2JA8H 1GO3E 1JE4A 1AP0A 4IJHA 5CORA 3O13A 1B3QA 5JEAH 1ICWA 2RA4A 1SE3A 2NN6I 3M7GA 2YYZA 1PH5A 2RHSB 3GTKH 5IT9L 3B6YA 2XTIA 3TBIB 1MHWC 4DXFA 1EL0A 5FLXE 1NR4A 4FNFA 1F9PA 2EJFC 4J6HA 1SLJA 3NWTA 4X65Q 1BUVT 3AEVA 3HOZH 1JE5A 1UEBA 1CTMA 5EAYA 3KF8A 2C35B 4JC0A 2JE6I 4KN7C 2RDGA 1PZJD 3P1HA 4X65L 3P75A 1FD7D 4J15A 1ASZA 4GLAC 3MHBA 1VF7A 4NB3A 4PZ8A 3PO3B 3KFUA 2XRSD 2A6ED 4A3KG 1XNRQ 4LF4Q 1YJ9A 3BJUA 3BDCA 4HIDA 1Q12A 1HZCA 2N55A 4L5RC 1DOLA 4DK3C 5JJZA 3ND9A 4FDBA 1KD1C 3CXCA 2D62A 2Z4HA 1MKHA 2VUMB 4XT3B 5GQOA 2WINB 1GUGA 1XNRL 3MFYA 2R7ZH 1A62A 2EDGA 1FNVA 2ALYB 1HUMA 1CKNA 4UHVA 4LFBQ 2BE5D 4CDCC 1U5KA 1HUNA 4XQQA 1QVGA 2AWOA 1SROA 4GNXC 4LFBL 3K7UC 4JG2A 4JW0A 3A55A 1GKHA 3I4MH 1LT6D 3CKIB 4RHRA 3I4MG 3V96A 4A3IG 3OMCA 1DYQA 5E1FA 3NK9A 2OTJA 3D6CA 1B44D 2C5CA 1S5ED 1D7QA 4A3MH 4A3MG 1SNQA 3HOXH 1PH3A 1BKBA 1BBUA 2MNAA 1O7ZA 1X32A 3WWVA 4DFAA 1JT8A 2B3GA 5EPKA 3NBHB 1WI5A 3K6OA 2F0FA 2F0VA 5M3MH 1IW7D 5M3MG 1Y8OB 3J80c 3RZOH 4LFCQ 1SDFA 1RL2A 1ESFA 3UE1A 5D3DA 4DNTB 2LXJA 2EE1A 4DV4Q 1PRTF 4XQNA 2AKWB 3VR3A 1S72A 1VQ6A 4OXPA 4LFCL 4H02A 1Z6HA 3N6RA 4POGA 1G6PA 4WORA 2F0QA 2E2DC 4RGTA 4DAYA 1FNWA 4DV4L 4XT1B 1B2TA 1PH7A 2RHQB 4MZ9A 3MTSA 4C3IB 1JOQA 3K0YA 1LTBD 3TS2A 1C4QA 1PYWD 5C44H 5T1GA 4FF4A 2PCFB 4FXGC 1LM0A 3I7FA 2HD3A 1ESRA 3S1NB 1KRSA 1EYAA 4CBVA 4DAMA 1YZ6A 4A93G 2KVMA 3FMCA 1VDZA 3EBEA 3NTHA 1S5CD 4JBMA 1Q46A 3GTMH 2E5LQ 2K7VA 3A74A 4KD3A 3KDFA 1FGUA 2X6GA 2ES2A 4HTHA 3BYYB 4L8JA 4FF2A 2F0MA 3PSIA 2HDMA 2BCOA 2E5LL 3A0JA 4CDEC 4A3FB 3MEFA 3A8JE 3ULLA 3G6JB 1HTLD 4X3TA 3S15H 5FO9B 4DR4Q 3N52A 4JK1C 2CW0C 2H5XA 1TVXA 4IO9A 5IGBA 3TSSA 4BBRG 2YTYA 1I4PA 2KEDA 1EY4A 1E1TA 4DR4L 2BDOA 1CA5A 1MJCA 1SSOA 5KNCA 2AQ2B 4FF1A 5IE8A 1RKNA 2F0OA 3KF6A 1YNJD 5IT9E 3SK6A 3H91A 2EJMA 3L7ZC 1HPCA 2DY8A 4M1UB 1CQFA 1NUCA 3UDFA 1YHQA 2Z8LA 5I9OA 1IYUA 1XTDA 4EQOA 5JJIA 2HT1A 2KJXA 1IKLA 4MTKA 1B7YB 5C0XI 4A3LH 4A3LG 2EY5A 1TS3A 3G7LA 1TS2A 4R8IA 2A8VA 1LUZA 1PXUA 2E74C 4C3JH 4UP9A 1SNOA 4A3BH 4A3BG 1IL8A 3GTPB 2EYOA 2AQ3B 4LF5Q 2VY3A 4PV1C 4BXXG 5FO8B 2M9VA 3VR6A 3G4SA 2DJFC 1VCIA 4MNOA 2IHEA 5IGEA 3MC0B 1AZPA 4B3MQ 3TS0A 3C1EA 3U58A 2HCIA 4LF5L 3HOWH 4Q0FA 3AMUA 1I3QB 2CWAA 4H0LC 1P16A 4KMUC 2WV6D 2A69C 3W1GA 4K5VA 5E7NA 4V0BA 4ZAIA 4RFBA 4B3ML 5HGTA 3J80L 3KYHC 3KJOA 5IGGA 5NUCA 4TKOB 3TEHB 2JA6H 2QEJC 4QMGA 4Y52H 2RCNA 1KDAA 4JV5Q 1EUJA 2EXZA 1Q82C 1JJCB 3I91A 3H0GB 3TP8A 3VYUA 2JN4A 2DY7A 2Q8RE 1FYCA 1GUOA 3MXNB 1O7YA 1ET9A 5I6WA 4JV5L 4KV6A 3PIP3 3QB3A 3FKIB 3D4DA 1WD1A 1QVFA 3M85A 1EWHA 3MXGA 3MA2B 5IP9H 1E7ZA 3SE0A 1IHZA 5E3FA 4ZYSA 1KC8C 2NWGA 3AB9A 2L1BA 3RMHA 1PH6A 1GUTA 3T16A 2A73B 1C8CA 1B53A 5IGDA 3PCOB 1TXYA 3TZUA 1D5MC 4DR5Q 3K7AH 1A8VA 4JI4Q 1K8MA 4YCVA 3VR5A 3D8GA 4DF7A 5A2QE 2JA7B 3QG1A 3CC4A 4BY1B 1E0BA 1YJWA 4I65A 4DR5L 4IFDJ 4JI4L 3TQYA 3CCUA 1WD0A 2R92H 2R92G 5ELCA 4X3SA 3CRKC 2K4KA 3MAQA 3DEPA 5C3EH 5C3EG 4QUFA 2K75A 1WTWA 3BVZA 3K8AA 3UDXA 1V1OA 4C3HB 5LHY1 1FL0A 2R7FA 3GP7A 4OIKA 4DNIA 4FXDA 1IL2A 3JAML 1QUQA 3NELA 3J81L 4RH6A 1N9WA 1D2BA 1QNKA 4JI6Q 1Q7YC 4NXNQ 2B2VA 1B1ZA 4R4TA 4UDUC 2F03A 2VUMG 1ZYRC 2BA1A 4HIMA 4EQPA 2GVAA 1TWCH 4BY7B 4JI6L 1DONA 2D2CC 2F0KA 3AYHB 2WACA 3PUVA 4CDDC 3CCVA 1O80A 1EWCA 2E2HH 4DR1Q 2J4XA 4KY6A 3SK8A 3K58A 3PF5A 1SNCA 2NB0A 1TWAH 2Q2IA 2X69A 5ELDA 1E24A 5HGQA 2R61A 5IYDG 4HCSA 3PUZA 3CCSA 4DR1L 1DD2A 3A8IE 1XPOA 2MUYA 4KHZA 3TN2A 1VF5C 2NVYH 3S2HB 4NMZA 2DUDA 2JJQA 3HKZB 4AYBB 1LTGD 2MO1A 4HSVA 4KN4C 1X3GA 5DM73 1E2ZA 4ILWA 4XYQA 4IUPA 1EU3A 4K6LA 1VMCA 2IX1A 3DM3A 1HZAA 2A6EC 4A75A 2EY1A 5IYBH 5IYBG 5IY0A 2QEXA 1I6VC 3A7LA 2CCZA 1G2TA 4OO1G 2R93H 2RQXA 2Z6KA 3S16B 3ERQA 1MD2D 5C4ZA 1U4MA 3EQLC 5IP7H 5IP7G 2A68D 4OIJA 1CUKA 4TSSA 5C5LA 4KKSA 2BE5C 1R4PB 3EA6A 4BA2I 1WJJA 4PZ7A 1FR3A 3E3XA 4A3EB 1TWGB 1L0XB 1Y69U 3DMUA 5T1IA 3H15A 4IPHA 1D1KA 4K2KA 2PNHA 4CDFC 3ICEA 4IPGA 3KJPA 2O2LD 1JOKA 3TP5A 3QJYA 2IY5B 3I8ZA 4BBSB 1XXGA 1F2LA 2KEEA 3ULJA 1RJTA 3BDLA 1EZ8A 5C4HA 3LWUA 4O1NA 3J80E 3M4OB 3LWEA 4NKLA 4X3KA 3E5SA 1JORA 3F2UA 3LNNA 5FK9C 1I50H 3V2TA 1BCPD 3NE5B 4DV1Q 3CPWA 1YHBA 1LTLA 2EYMA 3I55A 1WYDA 5C4JB 1BCPF 1IW7C 1P8LA 5CV7A 3HOYB 1PRTC 3K5MA 2VZAA 2K32A 1I4RA 4DV1L 3HKSA 4WJWA 1RF2D 3LGJA 1EWIA 2A6HC 3VYSA 1O78A 2NUCA 3OWFA 4JI8Q 3EROA 4HJ8A 1KABA 1HR0W 1TT2A 1NJIC 1HA6A 4XYOA 1IBLQ 4K8JA 5BR8L 3S2DH 2B29A 2K33A 5DEHA 4LF9Q 2NVXH 1BF4A 2BDNA 2JEAI 1RTOA 3HOVH 1V43A 3HOVG 4JI8L 2HIVA 5DLQE 1DCZA 1NE3A 2MQHA 3PO2H 2FHTA 2ATWA 3AFQA 1KNEA 3T13A 5KGUA 3NBIA 3UI2A 1VQEA 1IBLL 3MZ5A 1CA6A 2E2IH 1EY8A 4CHTB 4LF9L 1EQTA 2L0CA 1A2TA 2K5NA 1WOCA 3KK7A 4RGMA 1J9OA 1ZKOA 3GQBA 3A5UA 3RLFA 1RTNA 4N9PA 1UEAB 1AH9A 3RZDB 2I0QA 3T51B 1SR3A 4XIGS 5IGCA 1XJVA 1X54A 2B2YC 1HTPA 1BO0A 4JI5Q 1FNUA 5ISRA 1D5XC 1GHJA 3C2PA 3DLLA 4KHPQ 2B8FA 2HUGA 2WKDA 1STBA 5IYCH 1PVOA 1I94Q 3F8TA 3H6MA 5AJ3Q 2F0UA 5J22A 2DJGC 2MHVA 4RMFA 4C1NI 4JI5L 3T1HL 1CSPA 1CZWA 1SYBA 1W6KA 4KHPL 2N8NA 4C2MB 3BVMA 5IWAQ 3T4AC 1J8IA 1Y1WH 1Y1WG 1I94L 1G2SA 5AJ3L 1VQLA 3WDNA 1YBYA 2F3VA 1TQOA 1WVLA 3GTGH 1PLFA 1EOVA 3KF8B 4HMIA 5D14A 5FJ8H 3KLRA 5C3WA 5FJ8G 5M3FB 2B2TC 4QL5A 2K04A 5HY6A 4BWGB 1C7YA 5FLMG 5IWAL 2CVRA 4EVOA 1D5ZC 4DPGA 5CYUA 2KOLA 5ELNA 1VQ8A 3IRBA 1E1OA 4IFDH 4IFDG 4DK6C 2WAQE 2JA5B 1UWVA 3QOJA 1PYSB 5M5WB 2K1BA 1BXTA 3E0EA 2ASBA 2L9HA 2EY6A 4B9WA 2VB3X 3C3LA 5IGFA 4H44C 4GN5A 2K01A 1VMPA 2A5HA 1KDCA 1OTCA 4WJ4A 4X66Q 3KLWA 5L37A 4OX9Q 3QOLA 4NDXA 3W2DA 3F2DA 1CKNB 4A3KH 2DGYA 5KYLA 2DNEA 1YNND 5CBAE 1VQDA 1DXMA 4JI1Q 3D3RA 3H94A 5DAUA 1K8OA 4A3DH 4X66L 4A3DG 2WFWA 4OX9L 2KA7A 1HR0Q 1JJ2A 4PG3A 1YEZA 3PMFA 3VA7A 4RCOA 2PQAB 4TQUS 1K8GA 1X3PA 1HZBA 4KKUA 4JI1L 2E76C 1FGBD 1GHKA 2OT2A 3WOEA 3J7YW 1HR0L 1H9MA 4EQNA 3SDZA 1QWYA 1A0IA 3Q0AA 4BY1G 3OW2A 1WCMB 3DM1A 4KY5A 3I4LA 1TWHH 1K83B 5ELEA 4GN4B 4AYBE 4A3IH 3URYA 2WAQG 4GKKQ 3J7AV 1HQMC 3JC66 2IX3A 1AZQA 1ICFB 2B2UC 1K73C 1NSNS 1OXVA 1I6HH 4ME5A 5LL6S 2NVQH 3C1FA 3NSWA 4ABNA 2UUCQ 4GKKL 2UXCQ 2RF4A 4HCEA 3KLSA 5I6YA 4A3JH 4A3JG 5JVG3 2K28A 4B3SQ 4R4QA 2E2JB 4UY8C 1L0YB 2B63B 3H3VH 3S17H 2I5HA 4QIWB 2UUCL 3T1YQ 2UXCL 5CV6A 3AFPA 1HRJA 1F9RA 3S1RB 2F4VQ 2SOBA 4B3SL 3PUXA 5E4XA 3GTJB 4ID6A 2Z6KC 1HH2P 1NTGA 2L12A 1L1OA 3Q23A 4NW2A 3T1YL 2PNRC 2H1EA 1WTPA 4WJ3M 2WB1B 2F4VL 3S9WA 2HCCA 1S40A 1VQAA 5A2QL 1EFWA 1PMRA 1PFMA 1PH9A 4P73A 3I72A 2VS1A 1OXUA 1GJXA 1NAPA 2YU9B 2KCMA 4Q5VA 4DV6Q 3I4NB 1Y1VG 3R3OA 1NNXA 5IODA 3NBHA 1B4OA 2I5MX 3DEOA 4AYBG 1C0AA 2B2WA 3KDFB 3MVVA 4DV6L 2PI2E 3AQQA 2GA4B 1ILPA 1GOZA 3ND8A 4JI0Q 4JBKA 4EQ5A 3DXJC 3S14B 4A93H 4GKJQ 3TDQA 1PH4A 2F0PA 4RHSA 1MJEA 2Y0SB 3QIAA 5GAEC 4JI0L 2KCCA 3FDTA 4U673 4L5QA 2F3WA 4TRDA 1FJGQ 4GKJL 3K5NA 2K5WA 2K5VA 5EBDA 2PQEA 2Q2UA 1BBXC 3E0JA 5ELOA 3U4VA 3L0OA 1FJGL 2NTSA 4FO2A 4A3GB 2JQOA 3M3YH 1UNSA 5GROA 2KHIA 4AIMA 4A3EG 4GOPA 5M5XB 4BBRH 2F3IA 3GDEA 2Z0SA 2PYKA 4GN3B 4X62Q 3ITPA 3H3VI 4PMWA 4OWXB 1SFOH 4B3RQ 3GTQH 2G9HD 1SMYD 2YTVA 3BDOA 1PTOH 4X62L 4CJ1B 3PIPA 2Z6BA 4K0KQ 2VNUD 1JOOA 1O7IA 3JAMi 1PRTB 3P20A 1I4HA 3J7A5 1H9RA 3J81i 1RCVD 4B3RL 1G51A 3PF4A 1UE7A 3CCLA 1MIUA 4QF4A 2JA9A 1B3AA 2Z9HA 5AFWA 5KIXA 2NVTB 2OWOA 4HMJA 1BQQT 3CQZH 4K0KL 1N33Q 1GUSA 3S1MB 5K5PA 5M5YB 2WKCA 2EY2A 1D6EC 3GTOH 3GTLH 1TY0A 2JSOA 5FOBB 5C4XH 1R4QB 1PFSA 4QJFA 1N33L 5C4XG 1XWEA 1KL9A 2AMCB 3HOUH 3HOUG 2BA0A 2A1AA 1C48A 3GD7A 3WOFA 2K52A 2F0LA 3J7AF 4YCUA 4WFN3 4BXXH 2C9OA 1V9PA 2A68C 4KK7A 2RDHA 1I5FA 4DR7Q 2ZM6Q 5GADC 1A2UA 3R93A 1W6JA 4LUOA 3M4QA 4KI0A 1Q86C 1S3OA 1SNDA 1N32Q 4DR7L 2ZM6L 4O42A 4EX5A 1IXRA 2VXWA 1KAWA 4FVMA 1K0SA 1PZKD 1CT1D 2N3SA 4X6AH 5CV4A 1HZ9A 1Y14B 3CCJA 4F88A 1N32L 2JA8B 1VQCA 2CH4W 1X6OA 1H95A 4P75A 2Z1CA 4A76A 2SEBD 4GZYC 1QG7A 2DNCA 3VA5A 1LV9A 3GTGB 1PV4A 3MWYW 1SXTA 3S1QH 3V05A 3UDGA 1SYDA 1J6QA 4LFAQ 2OF1A 2HIXA 1I4QA 3GTKB 4Y7NH 2NZ1D 3Q22A 3RR5A 3TP7A 1E22A 5CMDA 2BH8A 4P2CB 1AE3A 2L55A 1QZGA 2J0TD 1UE6A 3HOZB 4LFAL 1BR9A 2IJ0A 1L2FA 1QOHA 3R8BA 4DV3Q 4G7HC 2E75C 1VQHA 3IFDA 1JR0D 2FFKB 2R7DA 3OW7A 4JOIA 4LMQD 1VQJA 2FXQA 4WRDA 1AEXA 5BN4A 5JJKA 4DV3L 1CM9A 4DV0Q 4IOAA 1Y8PB 4A3KB 2F0DA 1DZ1A 3ZJYC 5KNBA 4DAVA 1QUQB 1GUWA 1DJRD 1CHQD 4IUNA 4DV0L 1LLRD 4PQXA 3MXNA 1V1PA 3CRLC 3OIPA 3ER0A 1AFPA 2R7ZB 3CHBD 2V4DA 3R2IA 2N49A 4V190 4G57A 3BYTB 2O4XA 5JEAJ 5HURA 4NPSA 3PO3H 3PO3G 1FVIA 2NZOA 3QR8A 2ZXPA 4QIWE 3M4YA 5I9PA 2XVSA 4K8IA 1YITA 1STNA 4B3TQ 1VQ7A 4BA1I 2TMPA 1II3A 4QCLA 5EJWA 1S5FD 2I46A 1EY9A 4MTNA 3I4MB 3BS1A 4G7ZC 2VUMH 2LMCB 3STBC 2N88A 5ELFA 3IFTA 4B3TL 3K81C 3X3NA 4A3MB 1WTXA 1GXDC 1ZEQX 3NHHA 3HOXB 1V8QA 5KYIA 3VR4A 3NQTA 1ENFA 1D8LA 1AE2A 1OXSC 3J7ZC 3GV6A 1YJNA 3I56A 2E8GA 2ZJQA 1PTOD 3BZKA 5M3MB 1U9RA 4LUZA 3RZOB 4KKTA 5IYDH 1LT4D 1B50A 1K9MC 1PTOF 1M4VA 2LS01 1VS0A 1KLUD 1B70B 1KLGD 3D4WA 1HCZA 2AUJD 4XXEA 4YHHQ 5EPJA 2CW0D 1F2ZA 1VQIA 4JI2Q 1VQ5A 2KCNA 4DGZA 2KQ3A 3TRZA 2MFIA 1B9MA 5LL6X 1H9KA 3E9HA 2QDLA 4YHHL 4F8MA 1Y8NB 1VQMA 4JBWA 4GNXA 1NY4A 3HFZB 4IQZA 4JI2L 4CKBA 3NPPA 5C44B 1KTKA 2FMCA 5DM63 4QUCA 4LF7Q 4OO1H 3NEMA 1GD7A 4FYDA 1YIJA 4OHJA 2PZWA 2AWNA 3D4RA 3FPUB 1UE5A 2LFNA 2OTLA 3NUCA 3PIOA 3K0XA 4C3IH 4LF7L 4C3IG 4A93B 5EBCA 4FF3A 1BOSA 2PO4A 3NTIA 3I4NG 4KJNA 3GTMB 3CCMA 3TP6A 3D31A 3FPPA 2IWHA 4DK0A 1M8AA 4IUTA 4NP5A 3S1NH 2H4OA 2Z4IA 2CHBD 2F0JA 1G91A 3IAYA 1BDOA 3S15B 4N8X1 4C1NK 2PZTA 1GM5A 4ZRZA 1CQVA 5LMUQ 1EYDA 1WTQA 2LY7A 5G3LD 4XTCS 2A69D 3KOJA 2TSSA 1XPRA 4OEMB 2SNMA 3GO5A 5G3LF 5C0XJ 2KUMA 3D0FA 5LMUL 5K36G 2IHFA 1XMOQ 5BR8Q 2V1CC 2ID0A 4GLVB 2VW9A 4A3FG 2KCTA 3OWEB 2ICIA 1EOTA 1ENAA 1QCBD 1CHPD 1EYCA 4UP7A 2QCPX 2EYJA 2F52A 2QA4A 1XMOL 4ULLA 1HHVA 4JBJA 4LJZC 2F0HA 4PMCA 4PZ6A 1PH8A 2NN6H 2NN6G 3TZDA 1EEID 3GTLB 3SEBA 4GLXA 3L2PA 4ODGA 3F1ZA 2LSSA 3I70A 3MFGA 3CCQA 2EJGC 4OO1I 4FXKC 1AW7A 1SRUA 3PV0A 4C3JB 4A3BB 2PI2A 3BZCA 1N36Q 1N34Q 2EYFA 4DXGA 2EYHA 3R2TA 1PYBA 1QE6A 2K50A 3EFXD 1SJED 3M7NA 3OIQA 3GV3A 4KY7A 1N34L 1N36L 4ZQ3A 1UAPA 1R9TH 2K6AA 1WTOA 3HOWB 2LKVA 3MXUA 4N9TA 2MP1A 4TVAB 1DOKA 3E9IA 1BVSA 1XTCD 1EIHA 3T1HQ 3OHXC 1HQRD 2HDLA 2L4NA 1STHA 1Z7TA 1NR2A 4PNYA 3IL8A 2JA6B 2B39A 3SGIA 1X9NA 1SN8A 4N8FA 2GVBA 4K2LA 2MGSA 2QW7A 4QGUA 1HNZQ 2KENA 4XQJA 1H9SA 1SYCA 1XPUA 1M90C 5J39A 1I3QH 1NMFA 5EKKA 5C5MA 3D6WA 3T56B 1HNZL 2LXKA 4A3CG 5FLMH 3RN5A 1ZYRD 1BCPB 5FKAC 2IX0A 2N78A 1JC7A 3VYRA 5DNFA 4LF6Q 2AQ1B 4DUYQ 1YNXA 2ICEC 1YNJC 4ZKCB 1K0RA 1F9QA 4KTAA 4L5TA 2YV5A
chains in the Genus database with same CATH topology
1HFGA 1EY6A 5JEAG 3NQIA 3DWAA 3K7AB 4OL7A 1EFID 4B9XA 3OPOA 1XYIA 1U4RA 2B2VC 1S4ZA 1G6ZA 4YIJA 4R8NA 1A15A 1CI3M 1EIGA 2R92B 3KBXA 1LTTD 4B08A 2F0IA 2ENBA 5C3EB 1RD9D 1F2MA 4ZKBB 2FINB 2RBMA 3A54A 4XDXA 3SK5A 4MIUA 1DOMA 3MEHA 3AU7A 1ILQA 4F7XA 4U68A 4UAIA 4DA2A 2OEOA 4RGNA 5EPLA 1QB5D 4LK1C 5COYA 1TWCB 2PW7A 2XSCA 4BS9A 3HP3A 4C3HG 3BZDB 4CKCA 4DK1A 3DUZA 1JWMD 5CGKA 2E2HB 4RGOS 3SHLA 3H3VC 1JCKB 3K59A 1JICA 1TR5A 1TWAB 2R6GA 2L5TA 1STAA 4IN3A 1IYVA 5CC4A 5CV9A 4IFDI 2OXPA 1SAPA 2O5IC 2XWJB 2FMMA 3NXWA 3T53B 1ONLA 3Q6SA 4C56C 2NVYB 1STEA 2K5QA 3DHQA 1F2YA 5M9OA 2A74C 5ELBA 2G9DA 4IUQA 1JWUD 1KAAA 1PRTD 2EYLA 4LAAA 1T5EA 1CZGA 1S5BD 2A6HD 4OGQC 2F0SA 2R3ZA 2R93B 5C3XA 1E2WA 2RDFA 2NYZD 1QILA 2EVBA 4M8AA 1Q1EA 2ZXRA 1G8ZD 5D3IB 1HFNA 2BOSA 5C0XH 5C0XG 1Q90A 1IKMA 3PUWA 4I7ZC 1SYFA 4RA8A 5CV5A 1A6XA 4G4KA 1H9JA 3BG3A 3ONAB 4G7OC 2J7ZA 2AUKA 5J1ZA 1I50B 1SE2A 1EY7A 2MJ8A 4Z9CB 3HGBA 4IURA 5CBEE 4CJ2C 1PTOC 1STYA 3I3CA 5TSSA 3Q24A 4QB4A 3U9SA 4HN7A 5FO7B 1LO5D 3RD4A 4DU9A 3I90A 4CGYB 4KJOA 2XWBB 2PW5A 1TIID 2X6LA 1SE4A 1UUPA 3S2DB 2NVXB 3HOVB 1SBBB 1MSHA 2QILA 1KNAA 2DN8A 2IL8A 3PO2B 4HSPA 1A3TA 2E2IB 1RODA 4RKBA 3A56A 3FRPB 2K05A 2NBFA 1JQYD 4MN3A 1LTRD 2IT1A 1TS4A 1R9TB 3KBGA 5I2YA 3NWSA 5CV8A 5KRUA 2Q8TA 5JPNC 5KNDA 2MPMA 1RHPA 1LTAD 1LABA 2ZT9C 4RAUC 4C3JG 2NTTA 1JB3A 3QWNA 1GUNA 3HRZC 2B8GA 1MGSA 1WTRA 1LT3D 1T5XD 1SJHD 3IKJA 1Y1WB 5C6AA 5IIFA 1BCPC 3K5OA 1PZID 3HS0C 2XN9C 5KEEA 2PPBC 3W3AA 1CFMA 3KUPA 5EKLA 2F0NA 3EJIA 4ZUIA 4MHEA 5I2XA 3K5LA 3A8KE 1Q1BA 1LTSD 3FVQA 1I4GA 1V1PB 1NCVA 2D9UA 1A3UA 2B2YA 2PMZB 4KD4A 3RUZA 1A3VA 1QJOA 2CQAA 1LTID 3NTKA 4A3DB 1LACA 2SNSA 3OOCA 1SEBD 2JEBI 1Z47A 3L9AX 2QF7A 4IZ8A 2B2TA 2KECA 1SNPA 4IUUA 1DM0B 3DWPA 1TWHB 4K6DA 2RSNA 3BVGA 1Q3LA 1BNZA 4A3IB 2F1MA 2WAQB 1X3QA 4CKEA 1OO9B 1MBYA 5I4DA 1I6HB 2NVQB 2IW3A 1U4PA 1LT5D 3KLSX 1PDQA 4A3JB 4KHVA 3P7JA 4EGVA 1TY2A 3S17B 3QO2A 5EGTA 1D1IA 1PFBA 4FP5D 5BN3A 1EY5A 2B2WC 1SYEA 2VB2X 3PUYA 4E6IA 1OXTA 2M00A 2F0EA 5FLXL 1U4LA 3SVMA 2EPBA 2EOTA 5JOBA 2JYOA 1EU4A 2XRQD 1Y1VB 1YNNC 1CK1A 3OSOA 5EQ0A 4IUVA 1E2VA 2K03A 1TS5A 2B2UA 2JP1A 2L11A 4CJ0B 5E4WC 4X3UA 1Q8IA 2WIIB 1RDPD 2D5DA 1ML0D 1EY0A 2I07B 2F0TA 5JAVA 3E6ZX 1EQVA 1KDBA 2ZXOA 2QDBA 2IPKD 1MI2A 1ENCA 3HG9A 3SXHA 5D65A 4H13C 4K14A 3TMEA 1HXYD 3I73A 4R9WA 4RKLA 3M3YB 1OXXK 2FJ2A 4BBRB 1MSGA 4ZUJA 1JWSD 3EVQA 3HEJA 1SFOB 4J8QA 3GTQB 3A7AB 5K36H 1F77A 1PTOB 3FEWX 3U9OA 3C46A 5A35A 1S5DD 1F9SA 2M2LA 1WTVA 2RKSA 3CQZB 1QNUA 3K57A 1TU2B 5JVH3 2XNAC 3DWQA 4ZLTF 3H09A 4J1MA 5CR3A 4K5XA 3HZXA 1AN8A 3GTOB 2F0GA 2HQEA 5C4XB 2F0WA 1O7LA 4HAEA 2RSOA 3HOUB 2F4IA 1B9NA 1SNMA 1HA5A 2XIWA 4K5WA 4DN4M 3CU7A 4H7BA 4F87A 1TKWB 1PFNA 2WP8J 2JXMB 2QKIC 3SK4A 1EEFD 4ZK9B 4DAPA 1ET6A 1EZ6A 4HEDA 1H9SB 5IOCA 4IALA 3PIO3 3MXPA 2Q8IB 2KHSA 1TWFB 5JPMC 3VR2A 1STGA 2EZVA 3L3OC 5BN5A 2EYPA 3X3MA 2RVLA 4HR7B 4L63B 3SR1A 5F2DA 2SDFA 3NP8A 2O5JC 4DNRB 4PMBA 1G291 3JAME 3S1QB 1XX8A 1ZXTA 3J81E 4L6TB 1I4XA 4RCNA 2PZUA 4Y7NB 2K5DA 3ZYYX 1SYGA 1SMYC 5EKIA 3LX0A 3VYTA 4S3SA 3OMGA 4RWSC 1JE4A 1AP0A 5CORA 3O13A 5JEAH 1ICWA 2RA4A 1SE3A 2NN6I 3M7GA 2YYZA 5IT9L 3TBIB 4DXFA 1EL0A 5FLXE 1NR4A 4FNFA 1F9PA 2EJFC 4J6HA 3NWTA 1BUVT 1CTMA 3KF8A 2JE6I 4KN7C 2RDGA 1PZJD 3P1HA 3P75A 1FD7D 3MHBA 1VF7A 3PO3B 2XRSD 2A6ED 3BDCA 1Q12A 2N55A 1DOLA 5JJZA 3ND9A 2D62A 2Z4HA 2VUMB 4XT3B 2WINB 1GUGA 3MFYA 2EDGA 1FNVA 1HUMA 2BE5D 1HUNA 4XQQA 2AWOA 3A55A 1LT6D 3CKIB 4RHRA 3V96A 1DYQA 3OMCA 5E1FA 3NK9A 3D6CA 1B44D 2C5CA 1S5ED 1SNQA 1O7ZA 1X32A 4DFAA 5EPKA 3K6OA 2F0FA 2F0VA 1IW7D 1Y8OB 1SDFA 1ESFA 5D3DA 4DNTB 2EE1A 1PRTF 4XQNA 3VR3A 1Z6HA 3N6RA 4WORA 2F0QA 2E2DC 4RGTA 4DAYA 1FNWA 4XT1B 1B2TA 3MTSA 4C3IB 1JOQA 3K0YA 1LTBD 1C4QA 1PYWD 5T1GA 4FF4A 2PCFB 4FXGC 1ESRA 3S1NB 1EYAA 4CBVA 2KVMA 3FMCA 1VDZA 3NTHA 1S5CD 2K7VA 4KD3A 2X6GA 4HTHA 3BYYB 4L8JA 4FF2A 2F0MA 2HDMA 2BCOA 4A3FB 3A8JE 3G6JB 1HTLD 4X3TA 5FO9B 3N52A 4JK1C 2CW0C 1TVXA 5IGBA 3TSSA 1I4PA 2KEDA 1EY4A 2BDOA 1CA5A 1SSOA 5KNCA 2AQ2B 4FF1A 1RKNA 2F0OA 1YNJD 5IT9E 3SK6A 3H91A 2EJMA 3L7ZC 1HPCA 2DY8A 4M1UB 1CQFA 1NUCA 2Z8LA 5I9OA 1IYUA 4EQOA 2KJXA 1IKLA 5C0XI 2EY5A 1TS3A 3G7LA 1TS2A 4R8IA 1PXUA 2E74C 1SNOA 1IL8A 3GTPB 2EYOA 2AQ3B 4PV1C 5FO8B 2M9VA 3VR6A 1VCIA 5IGEA 3MC0B 1AZPA 3C1EA 2HCIA 4Q0FA 3AMUA 1I3QB 4H0LC 4KMUC 2WV6D 2A69C 4K5VA 4V0BA 4ZAIA 4RFBA 5HGTA 3J80L 5IGGA 5NUCA 4TKOB 2QEJC 4QMGA 1KDAA 2EXZA 3I91A 3H0GB 3TP8A 3VYUA 2DY7A 2Q8RE 1FYCA 1GUOA 1O7YA 1ET9A 5I6WA 4KV6A 3PIP3 3QB3A 3FKIB 3D4DA 1WD1A 3M85A 1EWHA 3MXGA 3MA2B 3SE0A 1IHZA 5E3FA 4ZYSA 2NWGA 3AB9A 2L1BA 3RMHA 1GUTA 3T16A 2A73B 1C8CA 1B53A 5IGDA 3TZUA 1D5MC 1K8MA 3VR5A 3D8GA 4DF7A 5A2QE 2JA7B 3QG1A 4BY1B 1E0BA 4I65A 4IFDJ 1WD0A 5ELCA 4X3SA 3CRKC 3MAQA 3DEPA 4QUFA 1WTWA 3BVZA 1V1OA 4C3HB 5LHY1 3GP7A 4OIKA 4FXDA 3JAML 3J81L 4RH6A 1D2BA 1QNKA 2B2VA 1B1ZA 4UDUC 2F03A 1ZYRC 2BA1A 4EQPA 4BY7B 1DONA 2D2CC 2F0KA 3PUVA 2WACA 1O80A 1EWCA 2J4XA 4KY6A 3SK8A 3K58A 1SNCA 2NB0A 2X69A 5ELDA 2R61A 4HCSA 3PUZA 1DD2A 3A8IE 2MUYA 4KHZA 3TN2A 1VF5C 3S2HB 4NMZA 3HKZB 4AYBB 1LTGD 4HSVA 4KN4C 5DM73 1E2ZA 4ILWA 4XYQA 4IUPA 1EU3A 4K6LA 1VMCA 2IX1A 2A6EC 2EY1A 1I6VC 3A7LA 1G2TA 4OO1G 2RQXA 3S16B 3ERQA 1MD2D 5C4ZA 1U4MA 3EQLC 2A68D 4OIJA 4TSSA 5C5LA 4KKSA 2BE5C 1R4PB 3EA6A 4BA2I 1FR3A 4A3EB 1TWGB 1L0XB 1Y69U 3DMUA 5T1IA 1D1KA 4K2KA 2O2LD 1JOKA 3TP5A 3QJYA 3I8ZA 4BBSB 1XXGA 1F2LA 2KEEA 1RJTA 3BDLA 5C4HA 1EZ8A 3LWUA 4O1NA 3J80E 3M4OB 3LWEA 4NKLA 4X3KA 3E5SA 1JORA 3F2UA 3LNNA 5FK9C 3V2TA 1BCPD 3NE5B 2EYMA 5C4JB 1BCPF 1IW7C 5CV7A 3HOYB 1PRTC 3K5MA 2K32A 1I4RA 4WJWA 1RF2D 2A6HC 3VYSA 1O78A 2NUCA 3OWFA 3EROA 1KABA 1TT2A 1HA6A 4XYOA 4K8JA 2K33A 5DEHA 1BF4A 2BDNA 2JEAI 1RTOA 1V43A 1DCZA 2FHTA 1KNEA 3T13A 5KGUA 3NBIA 3UI2A 3MZ5A 1CA6A 1EY8A 4CHTB 1EQTA 2L0CA 1A2TA 3KK7A 4RGMA 1J9OA 1ZKOA 3GQBA 3RLFA 1RTNA 4N9PA 1UEAB 3RZDB 3T51B 4XIGS 5IGCA 2B2YC 1HTPA 1BO0A 1FNUA 5ISRA 1D5XC 1GHJA 3C2PA 2B8FA 2HUGA 2WKDA 1STBA 3H6MA 2F0UA 5J22A 2MHVA 4C1NI 1CZWA 1SYBA 1W6KA 4C2MB 3BVMA 3T4AC 1J8IA 1G2SA 3WDNA 1WVLA 2F3VA 1TQOA 1PLFA 5C3WA 5M3FB 4HMIA 5D14A 3KLRA 2B2TC 2K04A 4BWGB 2CVRA 4EVOA 1D5ZC 5CYUA 2KOLA 4IFDH 4IFDG 2JA5B 3QOJA 5M5WB 2K1BA 1BXTA 2L9HA 2EY6A 4B9WA 2VB3X 3C3LA 5IGFA 4H44C 2K01A 1VMPA 2A5HA 1KDCA 3QOLA 4NDXA 3W2DA 5KYLA 2DNEA 1YNND 5CBAE 1DXMA 3D3RA 3H94A 5DAUA 1K8OA 2KA7A 3VA7A 3PMFA 4RCOA 4TQUS 1X3PA 4KKUA 2E76C 1FGBD 1GHKA 2OT2A 3WOEA 3J7YW 1H9MA 4EQNA 3SDZA 1QWYA 3Q0AA 1WCMB 3DM1A 4KY5A 3I4LA 1K83B 5ELEA 3URYA 3J7AV 1HQMC 2IX3A 1AZQA 2B2UC 1NSNS 1OXVA 4ME5A 5LL6S 3C1FA 3NSWA 4ABNA 4HCEA 3KLSA 5I6YA 5JVG3 2K28A 2E2JB 1L0YB 2B63B 4QIWB 5CV6A 1HRJA 1F9RA 3S1RB 2SOBA 3PUXA 5E4XA 3GTJB 4ID6A 2L12A 3Q23A 4NW2A 2PNRC 2H1EA 1WTPA 2WB1B 3S9WA 2HCCA 5A2QL 1PMRA 1PFMA 3I72A 1OXUA 1GJXA 1NAPA 2YU9B 4Q5VA 3I4NB 3R3OA 5IODA 3NBHA 1B4OA 3DEOA 2B2WA 3MVVA 2GA4B 1ILPA 1GOZA 3ND8A 3DXJC 3S14B 3TDQA 2F0PA 4RHSA 2Y0SB 3QIAA 2KCCA 3FDTA 4U673 2F3WA 4TRDA 3K5NA 2K5WA 5EBDA 2PQEA 1BBXC 3E0JA 2NTSA 4FO2A 4A3GB 1UNSA 5M5XB 2PYKA 3ITPA 4PMWA 2G9HD 1SMYD 3BDOA 1PTOH 4CJ1B 2VNUD 1JOOA 1PRTB 3P20A 1I4HA 1H9RA 1RCVD 4QF4A 1B3AA 5AFWA 5KIXA 2NVTB 4HMJA 1BQQT 1GUSA 3S1MB 5K5PA 5M5YB 2WKCA 2EY2A 1D6EC 1TY0A 2JSOA 5FOBB 1R4QB 1XWEA 2BA0A 1C48A 3GD7A 3WOFA 2F0LA 3J7AF 4WFN3 2C9OA 2A68C 4KK7A 2RDHA 1A2UA 3R93A 1W6JA 4KI0A 1SNDA 4O42A 2VXWA 4FVMA 1PZKD 1CT1D 5CV4A 4F88A 2JA8B 2Z1CA 2SEBD 4GZYC 1QG7A 2DNCA 3VA5A 1LV9A 3GTGB 3MWYW 1SXTA 3V05A 1SYDA 2OF1A 3GTKB 1I4QA 2NZ1D 3Q22A 3TP7A 5CMDA 4P2CB 2L55A 2J0TD 3HOZB 1BR9A 2IJ0A 1QOHA 3R8BA 4G7HC 2E75C 3IFDA 1JR0D 2FFKB 3OW7A 4LMQD 4WRDA 1AEXA 5BN4A 1CM9A 1Y8PB 4A3KB 2F0DA 1DZ1A 5KNBA 4DAVA 1GUWA 1DJRD 1CHQD 4IUNA 1LLRD 4PQXA 3MXNA 1V1PA 3CRLC 3OIPA 1AFPA 2R7ZB 3CHBD 2V4DA 3R2IA 4V190 4G57A 3BYTB 2O4XA 5JEAJ 5HURA 2ZXPA 3M4YA 5I9PA 2XVSA 4K8IA 1STNA 4BA1I 2TMPA 1II3A 4QCLA 5EJWA 1S5FD 2I46A 1EY9A 3I4MB 3BS1A 4G7ZC 2LMCB 2N88A 5ELFA 3IFTA 3X3NA 4A3MB 1WTXA 1GXDC 1ZEQX 3NHHA 3HOXB 1V8QA 5KYIA 3VR4A 3NQTA 1ENFA 1OXSC 3GV6A 1PTOD 5M3MB 1U9RA 3RZOB 4KKTA 1LT4D 1B50A 1PTOF 1M4VA 2LS01 1KLUD 1KLGD 3D4WA 1HCZA 2AUJD 4XXEA 5EPJA 2CW0D 1F2ZA 2KCNA 4DGZA 2KQ3A 1B9MA 5LL6X 1H9KA 4F8MA 1Y8NB 4JBWA 4IQZA 4CKBA 3NPPA 5C44B 1KTKA 2FMCA 5DM63 4QUCA 4OO1H 4FYDA 4OHJA 2PZWA 2AWNA 3D4RA 3FPUB 2LFNA 3NUCA 4C3IG 4A93B 5EBCA 4FF3A 1BOSA 2PO4A 3NTIA 4KJNA 3GTMB 3TP6A 3D31A 3FPPA 2IWHA 4DK0A 1M8AA 4IUTA 4NP5A 1G91A 2H4OA 2Z4IA 2CHBD 2F0JA 3IAYA 1BDOA 3S15B 4C1NK 2PZTA 4ZRZA 1CQVA 1EYDA 1WTQA 2LY7A 5G3LD 4XTCS 2A69D 2TSSA 2SNMA 3GO5A 5G3LF 5C0XJ 2KUMA 5K36G 2ID0A 3OWEB 2ICIA 1EOTA 1ENAA 1QCBD 1CHPD 1EYCA 2QCPX 2EYJA 4ULLA 1HHVA 4LJZC 2F0HA 4PMCA 2NN6H 2NN6G 3TZDA 1EEID 3GTLB 3SEBA 4ODGA 3I70A 3MFGA 2EJGC 4OO1I 4FXKC 1AW7A 4C3JB 3PV0A 4A3BB 2EYFA 4DXGA 2EYHA 1QE6A 3R2TA 3EFXD 1SJED 3M7NA 3OIQA 3GV3A 4KY7A 4ZQ3A 1UAPA 2K6AA 1WTOA 3HOWB 2LKVA 3MXUA 4N9TA 2MP1A 1DOKA 1XTCD 1EIHA 3OHXC 1HQRD 2HDLA 2L4NA 1STHA 1Z7TA 1NR2A 4PNYA 3IL8A 2JA6B 2B39A 4K2LA 2MGSA 4XQJA 1H9SA 1SYCA 5J39A 5EKKA 5C5MA 3D6WA 3T56B 1ZYRD 1BCPB 5FKAC 2IX0A 1JC7A 3VYRA 5DNFA 2AQ1B 2ICEC 1YNJC 4ZKCB 1F9QA 4KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUM A;  1HFG A;  2VXW A;  3UI2 A;  2KEC A;  1TVX A;  4IUU A;  4MN3 A;  1X3P A;  1CA6 A;  3GV6 A;  4HSV A;  1EQT A;  5D65 A;  2KED A;  1XX8 A;  4IUP A;  1ZXT A;  3FDT A;  1VMC A;  2R3Z A;  2RSN A;  2SDF A;  1CA5 A;  4R9W A;  1SSO A;  2NWG A;  1Q3L A;  1B50 A;  2L1B A;  1J9O A;  1EOT A;  1XYI A;  1O7Z A;  1X32 A;  1QG7 A;  1BNZ A;  1C8C A;  1LV9 A;  2FJ2 A;  5EPK A;  1MSG A;  1U4R A;  1X3Q A;  2NYZ D;  3MWY W;  1B53 A;  1HRJ A;  1RTN A;  2B2V C;  3DM1 A;  5EKI A;  1S4Z A;  2Q8T A;  1BBX C;  1HHV A;  1G6Z A;  2MPM A;  1A15 A;  1RHP A;  1EIG A;  3H91 A;  4RWS C;  1JE4 A;  4RAU C;  1AP0 A;  5EPJ A;  3TZD A;  1SDF A;  2DY8 A;  1G2T A;  2NZ1 D;  3KBX A;  1U4P A;  5CMD A;  5COR A;  1MGS A;  1HFN A;  2B2Y C;  2EE1 A;  1E0B A;  1ICW A;  2RA4 A;  1BO0 A;  1WTR A;  1PDQ A;  1U4M A;  4ZKB B;  2FIN B;  4OIJ A;  4XDX A;  1AZQ A;  1IKM A;  2B2U C;  3P7J A;  1WD0 A;  2HUG A;  1IKL A;  4RA8 A;  1DOM A;  4X3S A;  1EL0 A;  1ILQ A;  1F9S A;  1NR4 A;  1F9P A;  2M2L A;  3IFD A;  3QO2 A;  2FFK B;  3DEP A;  4LMQ D;  4U68 A;  4UAI A;  1QE6 A;  4XT1 B;  4QUF A;  4CJ1 B;  1WTW A;  1WTV A;  1PFB A;  3MTS A;  1CM9 A;  3GV3 A;  3G7L A;  3ONA B;  4OIK A;  2K28 A;  4QUC A;  5EPL A;  5T1I A;  4R8I A;  2J7Z A;  4ZLT F;  2B2W C;  1WTO A;  1J8I A;  1IL8 A;  1G2S A;  3I8Z A;  1DZ1 A;  1B3A A;  2MJ8 A;  2MP1 A;  5AFW A;  5COY A;  1F2L A;  2KEE A;  3KUP A;  1WVL A;  1DOK A;  3FPU B;  2RSO A;  4HAE A;  4IUR A;  1QNK A;  1PLF A;  5T1G A;  5CBE E;  1F9R A;  1RJT A;  5D14 A;  3HP3 A;  4CJ2 C;  4MHE A;  1EIH A;  1GUW A;  2B2T C;  2XIW A;  2K04 A;  2B2V A;  3LWE A;  1U4L A;  5E4X A;  3SVM A;  3I3C A;  4X3K A;  1AZP A;  2CVR A;  2EPB A;  3F2U A;  2L12 A;  4DN4 M;  2HDL A;  2L4N A;  4NW2 A;  2HCI A;  2EOT A;  2KOL A;  1NR2 A;  1ESR A;  3IL8 A;  1WTP A;  2H1E A;  2JYO A;  3I90 A;  1NCV A;  2D9U A;  2N55 A;  1JIC A;  1DOL A;  1PFN A;  1DON A;  3N52 A;  2B2Y A;  2HCC A;  5EQ0 A;  5JJZ A;  4IUV A;  4ZAI A;  2K1B A;  2MGS A;  2X6L A;  1PFM A;  2K03 A;  2KVM A;  2L9H A;  2B2U A;  4ZK9 B;  1SAP A;  2JP1 A;  1O80 A;  1M8A A;  4XT3 B;  2L11 A;  2FMM A;  4IUT A;  1G91 A;  1NAP A;  4HED A;  4CJ0 B;  5E4W C;  1B2T A;  2K01 A;  1VMP A;  1MSH A;  4X3U A;  2X69 A;  1KNA A;  3Q6S A;  1HUM A;  3D6W A;  2IL8 A;  4HCS A;  5EJW A;  1HA6 A;  2X6G A;  3I91 A;  1ML0 D;  1B4O A;  3R93 A;  1WTQ A;  3DEO A;  2B2W A;  5DNF A;  3TN2 A;  1ROD A;  2DY7 A;  2Q8R E;  4IUQ A;  2N88 A;  5CBA E;  1O7Y A;  2HDM A;  1BF4 A;  2BDN A;  1HUN A;  1RTO A;  4ZKC B;  2RVL A;  1ILP A;  1F9Q A;  4X3T A;  1WD1 A;  1WTX A;  2FHT A;  2B2T A;  2K05 A;  4O42 A;  1KNE A;  1MI2 A; 
#chains in the Genus database with same CATH topology
 1HFG A;  3H0G H;  3H0G G;  1EY6 A;  4LF6 L;  4DUY L;  1QVC A;  5JEA G;  4O0A A;  3NQI A;  4O2D A;  4QY7 A;  3DWA A;  4UP8 A;  3K7A B;  3FKI H;  3FKI G;  4OL7 A;  1EFI D;  4B9X A;  3OPO A;  1XYI A;  4AQY Q;  1U4R A;  4JVZ A;  2B2V C;  1S4Z A;  3HOZ G;  1EQQ A;  1G6Z A;  4YIJ A;  4R8N A;  1A15 A;  1CI3 M;  1EIG A;  2R92 B;  3KBX A;  1LTT D;  3RLO A;  2F0I A;  4B08 A;  4JCV E;  2ENB A;  2UXB Q;  4AQY L;  5C3E B;  2VQE Q;  1RD9 D;  1M1K C;  1F2M A;  4ZKB B;  2FIN B;  2RBM A;  3A54 A;  1U0L A;  4XDX A;  3SK5 A;  4MIU A;  3CCE A;  3M9B A;  1X3E A;  1DOM A;  4R4O A;  1IBK Q;  2UXB L;  4UPA A;  3MEH A;  2K14 A;  3AU7 A;  4POF A;  1T9H A;  1ILQ A;  4F7X A;  3OYY A;  4U68 A;  4UAI A;  4DA2 A;  2VQE L;  2JA7 G;  2JA7 H;  4BY1 H;  2L15 A;  2OEO A;  4RGN A;  5EPL A;  4IPC A;  3I4O A;  1QB5 D;  1IBK L;  4LK1 C;  4LF4 L;  2R7Z G;  3HKZ E;  5COY A;  1TWC B;  2PW7 A;  2XSC A;  3U50 C;  4BS9 A;  3HP3 A;  2EQS A;  1YVC A;  4C3H H;  4C3H G;  3BZD B;  4CKC A;  4DK1 A;  3RNU A;  4YWL A;  3DUZ A;  1JWM D;  5CGK A;  2E2H B;  4RGO S;  3SHL A;  3H3V C;  1B8A A;  1L1O B;  1JCK B;  4HJA A;  3K59 A;  1JIC A;  1TR5 A;  1TWA B;  2R6G A;  1W2B A;  2L5T A;  1STA A;  4IN3 A;  2PQA A;  4DAY B;  1IYV A;  5CC4 A;  5CV9 A;  4P74 A;  3RN2 A;  4IFD I;  2OXP A;  2RCF A;  1SAP A;  2O5I C;  2XWJ B;  1A63 A;  1EYG A;  2UU9 Q;  2FMM A;  1PA6 A;  3NXW A;  3T53 B;  4BY7 H;  4BY7 G;  1CKM A;  1ONL A;  3Q6S A;  4C56 C;  2NVY B;  1STE A;  2K5Q A;  2ZTD A;  3CP0 A;  1HNX Q;  3DHQ A;  1F2Y A;  3HOX G;  5M9O A;  2UU9 L;  4RG1 A;  2A74 C;  5ELB A;  2G9D A;  2Q2T A;  4IUQ A;  1K28 A;  1HNX L;  1JWU D;  2OCE A;  1KAA A;  1PRT D;  3J80 i;  2EYL A;  4LAA A;  1T5E A;  3CC2 A;  1CZG A;  1S5B D;  2A6H D;  4OGQ C;  2F0S A;  1Y1V H;  2R3Z A;  3S2H H;  2R93 B;  4HJ9 A;  5C3X A;  1E2W A;  3ULP A;  3HKZ G;  2RDF A;  2HQL A;  3NEN A;  2NYZ D;  2ZJP A;  1QIL A;  2EVB A;  4M8A A;  1Q1E A;  2ZXR A;  1EQR A;  1VQG A;  1E3P A;  1KXL A;  1G8Z D;  2G5D A;  3PQI A;  5D3I B;  4JI3 Q;  1JJG A;  1HFN A;  5C44 G;  3I2Z A;  1X55 A;  4OWT B;  1EIF A;  2BOS A;  5C0X H;  3CD6 A;  3FP9 A;  1Q90 A;  5C0X G;  4GOP B;  1N8R C;  1IKM A;  3PUW A;  4P72 A;  4I7Z C;  1SYF A;  4RA8 A;  4JI3 L;  1LYL A;  5CV5 A;  1A6X A;  4G4K A;  3S16 H;  1H9J A;  4AH6 A;  4ZCK A;  4IPD A;  1EIY B;  1UE1 A;  3BG3 A;  3FHW A;  3KF6 B;  3ONA B;  4G7O C;  2J7Z A;  2AUK A;  5J1Z A;  1I50 B;  1SE2 A;  1EY7 A;  2MJ8 A;  4Z9C B;  4A3E H;  1TWG H;  3HGB A;  4IUR A;  5CBE E;  4CJ2 C;  1PTO C;  1STY A;  3I3C A;  5TSS A;  3Q24 A;  4QB4 A;  2GN5 A;  3U9S A;  4HN7 A;  3RLN A;  5LMN W;  5FO7 B;  1LO5 D;  3RD4 A;  4DU9 A;  4BBS H;  3I90 A;  4CGY B;  4BBS G;  4KJO A;  2I5L X;  2XWB B;  2PW5 A;  4YWK A;  1X3F A;  3JAM c;  4X64 Q;  3M4O H;  1TII D;  1Z9F A;  2BH2 A;  3J81 c;  2X6L A;  1SE4 A;  3VDY A;  1UUP A;  3S2D B;  2YTX A;  4KLK A;  2NVX B;  3HOV B;  1SBB B;  1MSH A;  2QIL A;  1KNA A;  4X64 L;  3CME A;  2DN8 A;  5C4J H;  2IL8 A;  3PO2 B;  1VQN A;  5GAH C;  2KBN A;  3HOY H;  4HSP A;  3HOY G;  1A3T A;  2E2I B;  1ROD A;  1WFQ A;  4RKB A;  3A56 A;  2EIF A;  3FRP B;  2K05 A;  2NBF A;  1JMC A;  1JQY D;  3G6E A;  4MN3 A;  1LTR D;  5FLX c;  2IT1 A;  1TS4 A;  1R9T B;  1KIX A;  4R1J A;  2UUB Q;  3KBG A;  5I2Y A;  3NWS A;  1KRT A;  5CV8 A;  5KRU A;  2Q8T A;  5JPN C;  5KND A;  2AHO B;  4YWM A;  3OTO Q;  2MPM A;  1RHP A;  1LTA D;  1LAB A;  2ZT9 C;  4RAU C;  4C3J G;  2NTT A;  1JB3 A;  3QWN A;  2UUB L;  1RIP A;  1GUN A;  3K80 C;  3HRZ C;  1TWF H;  3J81 j;  2B8G A;  1MGS A;  4HIO A;  2D0P A;  3OTO L;  1WTR A;  1GVP A;  1LT3 D;  3RZD H;  1T5X D;  4HJ7 A;  3EN2 A;  1SJH D;  3IKJ A;  3A5Z B;  3S24 A;  1Y1W B;  3HOW G;  5C6A A;  4GS3 A;  5IIF A;  1BCP C;  3K5O A;  3CC7 A;  1YI2 A;  1PZI D;  1HNW Q;  3M4P A;  3HS0 C;  2XN9 C;  5KEE A;  2PPB C;  3CW2 C;  1KHI A;  3W3A A;  1CFM A;  1L0W A;  1IYJ B;  3KUP A;  2JA6 G;  5EKL A;  1HNW L;  2F0N A;  3EJI A;  4ZUI A;  2D0O A;  4MHE A;  2P5Z X;  3U4Z A;  5I2X A;  3K5L A;  3A8K E;  1Q1B A;  1LTS D;  4C2M H;  3FVQ A;  3F2C A;  4LW1 A;  1I4G A;  1J5E Q;  1V1P B;  1NCV A;  2D9U A;  1A3U A;  5M3F H;  5M3F G;  2B2Y A;  2PMZ B;  2QGQ A;  4KD4 A;  3RUZ A;  5LMN Q;  1J5E L;  1A3V A;  1QJO A;  4R4I A;  1QZH A;  5IP9 G;  2CQA A;  1LTI D;  2JA5 H;  2JA5 G;  3NTK A;  4A3D B;  5M5W H;  1LAC A;  5LMN L;  2SNS A;  3OOC A;  1SEB D;  2JEB I;  4ME3 A;  1X56 A;  1VQF A;  1Z47 A;  3L9A X;  2QF7 A;  2OQ0 A;  4IZ8 A;  2B2T A;  3BU2 A;  3UDI A;  2KEC A;  1SNP A;  4IUU A;  4A4I A;  1DM0 B;  1JB7 A;  1CSQ A;  3DWP A;  1TWH B;  4P71 A;  4K6D A;  2RSN A;  3BVG A;  4IOC A;  1Q3L A;  1BNZ A;  4A3I B;  2F1M A;  2WAQ B;  1X3Q A;  4CKE A;  2WB1 E;  1OO9 B;  1MBY A;  4HIK A;  1L1O C;  5I4D A;  1I6H B;  2NVQ B;  3Q8D A;  2IW3 A;  1U4P A;  4DUZ Q;  4JYA Q;  4DR2 Q;  1LT5 D;  3KLS X;  1WCM H;  1WCM G;  1PDQ A;  4A3J B;  1CKO A;  4KHV A;  3P7J A;  4EGV A;  2UUA Q;  1TY2 A;  1KQS A;  1K83 H;  3S17 B;  1VQK A;  4APV A;  4DUZ L;  4JYA L;  4DR2 L;  3G71 A;  4GNX B;  3QO2 A;  5EGT A;  4NXN L;  1K3R A;  1D1I A;  1PFB A;  4FP5 D;  2UUA L;  4LUV A;  5BN3 A;  1EY5 A;  2B2W C;  2ZTE A;  5GAG C;  1SYE A;  2VB2 X;  3PUY A;  4E6I A;  1OXT A;  5JJL A;  2M00 A;  2F0E A;  5FLX L;  2Y0S E;  1U4L A;  3SVM A;  2CH4 A;  2CWP A;  2EPB A;  2E2J H;  1NMG A;  1ASY A;  2EOT A;  2B63 H;  2B63 G;  5JOB A;  1BBW A;  4HJ5 A;  2JYO A;  1EU4 A;  3CAM A;  2XRQ D;  1Y1V B;  1XNQ Q;  1YNN C;  3CMA A;  1CK1 A;  3OSO A;  5EQ0 A;  4YY3 Q;  3S1R H;  4IUV A;  3GTJ H;  4QQB X;  1C9O A;  1E2V A;  2K03 A;  1TS5 A;  2B2U A;  2JP1 A;  3F2B A;  2L11 A;  3UE0 A;  1X65 A;  1XNQ L;  4CJ0 B;  2EXD A;  5E4W C;  2WB1 G;  4X3U A;  2OQK A;  4YY3 L;  1Q8I A;  3PGZ A;  5IT9 c;  4R4C A;  2WII B;  1WTH A;  1RDP D;  2D5D A;  1ML0 D;  4GOP C;  2K5H A;  1EY0 A;  2ZJR A;  1VQ4 A;  2I07 B;  5J3B A;  4JI7 Q;  4NXM Q;  2F0T A;  4DV2 Q;  2YU9 H;  3I4N H;  5JAV A;  2CQO A;  1K8A C;  3E6Z X;  1EQV A;  1KDB A;  2ZXO A;  2QDB A;  2R93 G;  2IPK D;  1MI2 A;  1ENC A;  4I7A A;  4JI7 L;  2MO0 A;  4NXM L;  3HG9 A;  4DV2 L;  3SXH A;  5H1S E;  5D65 A;  4H13 C;  4K14 A;  1Q8K A;  3TME A;  1HXY D;  4L5S A;  3I73 A;  4R9W A;  2JK8 A;  4JPB W;  1VQ9 A;  4LNQ A;  4RKL A;  3S14 H;  3M3Y B;  1VQB A;  1OXX K;  1K3B C;  2ZTC A;  2FJ2 A;  4BBR B;  1MSG A;  4ZUJ A;  1JWS D;  3G48 A;  4DV7 Q;  3EVQ A;  2Y0S G;  3W1B A;  3HEJ A;  2VQF Q;  1SFO B;  4J8Q A;  3GTQ B;  3A7A B;  4YCW A;  1F77 A;  5K36 H;  1VQO A;  1PTO B;  3FEW X;  4DV5 Q;  4DV7 L;  2VQF L;  3U9O A;  4A3F H;  4A3G H;  3C46 A;  5A35 A;  4A3G G;  1S5D D;  2HHH Q;  1F9S A;  4LWC A;  2M2L A;  4DV5 L;  5M5X H;  1WTV A;  4OON A;  2RKS A;  4LF8 Q;  3CQZ B;  3TRE A;  1QNU A;  4IJL A;  3K57 A;  1TU2 B;  5JVH 3;  2XNA C;  3DWQ A;  1VQP A;  4ZLT F;  3H09 A;  4J1M A;  5CR3 A;  4K5X A;  3HZX A;  4OWW B;  1AN8 A;  2HHH L;  3GTO B;  4LF8 L;  1HJP A;  2F0G A;  2HQE A;  5C4X B;  1SE8 A;  1YHA A;  1O7L A;  2F0W A;  3CPF A;  2RSO A;  4HAE A;  3HOU B;  2F4I A;  1B9N A;  2A19 A;  1SNM A;  1HA5 A;  3EIV A;  2XIW A;  1IBM Q;  1Q81 C;  3ERS X;  3W5O A;  4K5W A;  4DN4 M;  1W3S A;  3CU7 A;  3CCR A;  2CKZ B;  3CF5 A;  2CFM A;  4H7B A;  1SMX A;  4F87 A;  2NVT H;  1TKW B;  1PFN A;  1IBM L;  2WP8 J;  3S1M H;  2Q2H A;  2JXM B;  3PO2 G;  2QKI C;  3SK4 A;  5M5Y H;  1EEF D;  4ZK9 B;  4DAP A;  1IZ6 A;  1ET6 A;  1EZ6 A;  4HED A;  2UXD Q;  1H9S B;  2KHJ A;  5IOC A;  1NBW A;  4IAL A;  1DGS A;  3PIO 3;  2XGT A;  3MXP A;  2Q8I B;  2KHS A;  1TWF B;  5JPM C;  2VL6 A;  3VR2 A;  1STG A;  2EZV A;  3GTP H;  3L3O C;  2UXD L;  5BN5 A;  2EYP A;  4DKA C;  3X3M A;  2RVL A;  4HR7 B;  4L63 B;  3SR1 A;  4DR6 Q;  2PMZ E;  5F2D A;  2SDF A;  3NP8 A;  2O5J C;  4JOI C;  4DNR B;  4OEL B;  1PH2 A;  4PMB A;  1G29 1;  3JAM E;  4ALP A;  1V1Q A;  3S1Q B;  1XX8 A;  1ZXT A;  4DR6 L;  3J81 E;  4DR3 Q;  4L6T B;  1I4X A;  4RCN A;  1XMQ Q;  2PZU A;  4Y7N B;  4A3C H;  2K5D A;  3STB D;  3ZYY X;  1PH1 A;  5IYC G;  1PHJ A;  1SYG A;  1SMY C;  5EKI A;  3LX0 A;  2NZH A;  3VYT A;  4S3S A;  4DR3 L;  3OMG A;  1XMQ L;  4RWS C;  2JA8 G;  2JA8 H;  1GO3 E;  1JE4 A;  1AP0 A;  4IJH A;  5COR A;  3O13 A;  1B3Q A;  5JEA H;  1ICW A;  2RA4 A;  1SE3 A;  2NN6 I;  3M7G A;  2YYZ A;  1PH5 A;  2RHS B;  3GTK H;  5IT9 L;  3B6Y A;  2XTI A;  3TBI B;  1MHW C;  4DXF A;  1EL0 A;  5FLX E;  1NR4 A;  4FNF A;  1F9P A;  2EJF C;  4J6H A;  1SLJ A;  3NWT A;  4X65 Q;  1BUV T;  3AEV A;  3HOZ H;  1JE5 A;  1UEB A;  1CTM A;  5EAY A;  3KF8 A;  2C35 B;  4JC0 A;  2JE6 I;  4KN7 C;  2RDG A;  1PZJ D;  3P1H A;  4X65 L;  3P75 A;  1FD7 D;  4J15 A;  1ASZ A;  4GLA C;  3MHB A;  1VF7 A;  4NB3 A;  4PZ8 A;  3PO3 B;  3KFU A;  2XRS D;  2A6E D;  4A3K G;  1XNR Q;  4LF4 Q;  1YJ9 A;  3BJU A;  3BDC A;  4HID A;  1Q12 A;  1HZC A;  2N55 A;  4L5R C;  1DOL A;  4DK3 C;  5JJZ A;  3ND9 A;  4FDB A;  1KD1 C;  3CXC A;  2D62 A;  2Z4H A;  1MKH A;  2VUM B;  4XT3 B;  5GQO A;  2WIN B;  1GUG A;  1XNR L;  3MFY A;  2R7Z H;  1A62 A;  2EDG A;  1FNV A;  2ALY B;  1HUM A;  1CKN A;  4UHV A;  4LFB Q;  2BE5 D;  4CDC C;  1U5K A;  1HUN A;  4XQQ A;  1QVG A;  2AWO A;  1SRO A;  4GNX C;  4LFB L;  3K7U C;  4JG2 A;  4JW0 A;  3A55 A;  1GKH A;  3I4M H;  1LT6 D;  3CKI B;  4RHR A;  3I4M G;  3V96 A;  4A3I G;  3OMC A;  1DYQ A;  5E1F A;  3NK9 A;  2OTJ A;  3D6C A;  1B44 D;  2C5C A;  1S5E D;  1D7Q A;  4A3M H;  4A3M G;  1SNQ A;  3HOX H;  1PH3 A;  1BKB A;  1BBU A;  2MNA A;  1O7Z A;  1X32 A;  3WWV A;  4DFA A;  1JT8 A;  2B3G A;  5EPK A;  3NBH B;  1WI5 A;  3K6O A;  2F0F A;  2F0V A;  5M3M H;  1IW7 D;  5M3M G;  1Y8O B;  3J80 c;  3RZO H;  4LFC Q;  1SDF A;  1RL2 A;  1ESF A;  3UE1 A;  5D3D A;  4DNT B;  2LXJ A;  2EE1 A;  4DV4 Q;  1PRT F;  4XQN A;  2AKW B;  3VR3 A;  1S72 A;  1VQ6 A;  4OXP A;  4LFC L;  4H02 A;  1Z6H A;  3N6R A;  4POG A;  1G6P A;  4WOR A;  2F0Q A;  2E2D C;  4RGT A;  4DAY A;  1FNW A;  4DV4 L;  4XT1 B;  1B2T A;  1PH7 A;  2RHQ B;  4MZ9 A;  3MTS A;  4C3I B;  1JOQ A;  3K0Y A;  1LTB D;  3TS2 A;  1C4Q A;  1PYW D;  5C44 H;  5T1G A;  4FF4 A;  2PCF B;  4FXG C;  1LM0 A;  3I7F A;  2HD3 A;  1ESR A;  3S1N B;  1KRS A;  1EYA A;  4CBV A;  4DAM A;  1YZ6 A;  4A93 G;  2KVM A;  3FMC A;  1VDZ A;  3EBE A;  3NTH A;  1S5C D;  4JBM A;  1Q46 A;  3GTM H;  2E5L Q;  2K7V A;  3A74 A;  4KD3 A;  3KDF A;  1FGU A;  2X6G A;  2ES2 A;  4HTH A;  3BYY B;  4L8J A;  4FF2 A;  2F0M A;  3PSI A;  2HDM A;  2BCO A;  2E5L L;  3A0J A;  4CDE C;  4A3F B;  3MEF A;  3A8J E;  3ULL A;  3G6J B;  1HTL D;  4X3T A;  3S15 H;  5FO9 B;  4DR4 Q;  3N52 A;  4JK1 C;  2CW0 C;  2H5X A;  1TVX A;  4IO9 A;  5IGB A;  3TSS A;  4BBR G;  2YTY A;  1I4P A;  2KED A;  1EY4 A;  1E1T A;  4DR4 L;  2BDO A;  1CA5 A;  1MJC A;  1SSO A;  5KNC A;  2AQ2 B;  4FF1 A;  5IE8 A;  1RKN A;  2F0O A;  3KF6 A;  1YNJ D;  5IT9 E;  3SK6 A;  3H91 A;  2EJM A;  3L7Z C;  1HPC A;  2DY8 A;  4M1U B;  1CQF A;  1NUC A;  3UDF A;  1YHQ A;  2Z8L A;  5I9O A;  1IYU A;  1XTD A;  4EQO A;  5JJI A;  2HT1 A;  2KJX A;  1IKL A;  4MTK A;  1B7Y B;  5C0X I;  4A3L H;  4A3L G;  2EY5 A;  1TS3 A;  3G7L A;  1TS2 A;  4R8I A;  2A8V A;  1LUZ A;  1PXU A;  2E74 C;  4C3J H;  4UP9 A;  1SNO A;  4A3B H;  4A3B G;  1IL8 A;  3GTP B;  2EYO A;  2AQ3 B;  4LF5 Q;  2VY3 A;  4PV1 C;  4BXX G;  5FO8 B;  2M9V A;  3VR6 A;  3G4S A;  2DJF C;  1VCI A;  4MNO A;  2IHE A;  5IGE A;  3MC0 B;  1AZP A;  4B3M Q;  3TS0 A;  3C1E A;  3U58 A;  2HCI A;  4LF5 L;  3HOW H;  4Q0F A;  3AMU A;  1I3Q B;  2CWA A;  4H0L C;  1P16 A;  4KMU C;  2WV6 D;  2A69 C;  3W1G A;  4K5V A;  5E7N A;  4V0B A;  4ZAI A;  4RFB A;  4B3M L;  5HGT A;  3J80 L;  3KYH C;  3KJO A;  5IGG A;  5NUC A;  4TKO B;  3TEH B;  2JA6 H;  2QEJ C;  4QMG A;  4Y52 H;  2RCN A;  1KDA A;  4JV5 Q;  1EUJ A;  2EXZ A;  1Q82 C;  1JJC B;  3I91 A;  3H0G B;  3TP8 A;  3VYU A;  2JN4 A;  2DY7 A;  2Q8R E;  1FYC A;  1GUO A;  3MXN B;  1O7Y A;  1ET9 A;  5I6W A;  4JV5 L;  4KV6 A;  3PIP 3;  3QB3 A;  3FKI B;  3D4D A;  1WD1 A;  1QVF A;  3M85 A;  1EWH A;  3MXG A;  3MA2 B;  5IP9 H;  1E7Z A;  3SE0 A;  1IHZ A;  5E3F A;  4ZYS A;  1KC8 C;  2NWG A;  3AB9 A;  2L1B A;  3RMH A;  1PH6 A;  1GUT A;  3T16 A;  2A73 B;  1C8C A;  1B53 A;  5IGD A;  3PCO B;  1TXY A;  3TZU A;  1D5M C;  4DR5 Q;  3K7A H;  1A8V A;  4JI4 Q;  1K8M A;  4YCV A;  3VR5 A;  3D8G A;  4DF7 A;  5A2Q E;  2JA7 B;  3QG1 A;  3CC4 A;  4BY1 B;  1E0B A;  1YJW A;  4I65 A;  4DR5 L;  4IFD J;  4JI4 L;  3TQY A;  3CCU A;  1WD0 A;  2R92 H;  2R92 G;  5ELC A;  4X3S A;  3CRK C;  2K4K A;  3MAQ A;  3DEP A;  5C3E H;  5C3E G;  4QUF A;  2K75 A;  1WTW A;  3BVZ A;  3K8A A;  3UDX A;  1V1O A;  4C3H B;  5LHY 1;  1FL0 A;  2R7F A;  3GP7 A;  4OIK A;  4DNI A;  4FXD A;  1IL2 A;  3JAM L;  1QUQ A;  3NEL A;  3J81 L;  4RH6 A;  1N9W A;  1D2B A;  1QNK A;  4JI6 Q;  1Q7Y C;  4NXN Q;  2B2V A;  1B1Z A;  4R4T A;  4UDU C;  2F03 A;  2VUM G;  1ZYR C;  2BA1 A;  4HIM A;  4EQP A;  2GVA A;  1TWC H;  4BY7 B;  4JI6 L;  1DON A;  2D2C C;  2F0K A;  3AYH B;  2WAC A;  3PUV A;  4CDD C;  3CCV A;  1O80 A;  1EWC A;  2E2H H;  4DR1 Q;  2J4X A;  4KY6 A;  3SK8 A;  3K58 A;  3PF5 A;  1SNC A;  2NB0 A;  1TWA H;  2Q2I A;  2X69 A;  5ELD A;  1E24 A;  5HGQ A;  2R61 A;  5IYD G;  4HCS A;  3PUZ A;  3CCS A;  4DR1 L;  1DD2 A;  3A8I E;  1XPO A;  2MUY A;  4KHZ A;  3TN2 A;  1VF5 C;  2NVY H;  3S2H B;  4NMZ A;  2DUD A;  2JJQ A;  3HKZ B;  4AYB B;  1LTG D;  2MO1 A;  4HSV A;  4KN4 C;  1X3G A;  5DM7 3;  1E2Z A;  4ILW A;  4XYQ A;  4IUP A;  1EU3 A;  4K6L A;  1VMC A;  2IX1 A;  3DM3 A;  1HZA A;  2A6E C;  4A75 A;  2EY1 A;  5IYB H;  5IYB G;  5IY0 A;  2QEX A;  1I6V C;  3A7L A;  2CCZ A;  1G2T A;  4OO1 G;  2R93 H;  2RQX A;  2Z6K A;  3S16 B;  3ERQ A;  1MD2 D;  5C4Z A;  1U4M A;  3EQL C;  5IP7 H;  5IP7 G;  2A68 D;  4OIJ A;  1CUK A;  4TSS A;  5C5L A;  4KKS A;  2BE5 C;  1R4P B;  3EA6 A;  4BA2 I;  1WJJ A;  4PZ7 A;  1FR3 A;  3E3X A;  4A3E B;  1TWG B;  1L0X B;  1Y69 U;  3DMU A;  5T1I A;  3H15 A;  4IPH A;  1D1K A;  4K2K A;  2PNH A;  4CDF C;  3ICE A;  4IPG A;  3KJP A;  2O2L D;  1JOK A;  3TP5 A;  3QJY A;  2IY5 B;  3I8Z A;  4BBS B;  1XXG A;  1F2L A;  2KEE A;  3ULJ A;  1RJT A;  3BDL A;  1EZ8 A;  5C4H A;  3LWU A;  4O1N A;  3J80 E;  3M4O B;  3LWE A;  4NKL A;  4X3K A;  3E5S A;  1JOR A;  3F2U A;  3LNN A;  5FK9 C;  1I50 H;  3V2T A;  1BCP D;  3NE5 B;  4DV1 Q;  3CPW A;  1YHB A;  1LTL A;  2EYM A;  3I55 A;  1WYD A;  5C4J B;  1BCP F;  1IW7 C;  1P8L A;  5CV7 A;  3HOY B;  1PRT C;  3K5M A;  2VZA A;  2K32 A;  1I4R A;  4DV1 L;  3HKS A;  4WJW A;  1RF2 D;  3LGJ A;  1EWI A;  2A6H C;  3VYS A;  1O78 A;  2NUC A;  3OWF A;  4JI8 Q;  3ERO A;  4HJ8 A;  1KAB A;  1HR0 W;  1TT2 A;  1NJI C;  1HA6 A;  4XYO A;  1IBL Q;  4K8J A;  5BR8 L;  3S2D H;  2B29 A;  2K33 A;  5DEH A;  4LF9 Q;  2NVX H;  1BF4 A;  2BDN A;  2JEA I;  1RTO A;  3HOV H;  1V43 A;  3HOV G;  4JI8 L;  2HIV A;  5DLQ E;  1DCZ A;  1NE3 A;  2MQH A;  3PO2 H;  2FHT A;  2ATW A;  3AFQ A;  1KNE A;  3T13 A;  5KGU A;  3NBI A;  3UI2 A;  1VQE A;  1IBL L;  3MZ5 A;  1CA6 A;  2E2I H;  1EY8 A;  4CHT B;  4LF9 L;  1EQT A;  2L0C A;  1A2T A;  2K5N A;  1WOC A;  3KK7 A;  4RGM A;  1J9O A;  1ZKO A;  3GQB A;  3A5U A;  3RLF A;  1RTN A;  4N9P A;  1UEA B;  1AH9 A;  3RZD B;  2I0Q A;  3T51 B;  1SR3 A;  4XIG S;  5IGC A;  1XJV A;  1X54 A;  2B2Y C;  1HTP A;  1BO0 A;  4JI5 Q;  1FNU A;  5ISR A;  1D5X C;  1GHJ A;  3C2P A;  3DLL A;  4KHP Q;  2B8F A;  2HUG A;  2WKD A;  1STB A;  5IYC H;  1PVO A;  1I94 Q;  3F8T A;  3H6M A;  5AJ3 Q;  2F0U A;  5J22 A;  2DJG C;  2MHV A;  4RMF A;  4C1N I;  4JI5 L;  3T1H L;  1CSP A;  1CZW A;  1SYB A;  1W6K A;  4KHP L;  2N8N A;  4C2M B;  3BVM A;  5IWA Q;  3T4A C;  1J8I A;  1Y1W H;  1Y1W G;  1I94 L;  1G2S A;  5AJ3 L;  1VQL A;  3WDN A;  1YBY A;  2F3V A;  1TQO A;  1WVL A;  3GTG H;  1PLF A;  1EOV A;  3KF8 B;  4HMI A;  5D14 A;  5FJ8 H;  3KLR A;  5C3W A;  5FJ8 G;  5M3F B;  2B2T C;  4QL5 A;  2K04 A;  5HY6 A;  4BWG B;  1C7Y A;  5FLM G;  5IWA L;  2CVR A;  4EVO A;  1D5Z C;  4DPG A;  5CYU A;  2KOL A;  5ELN A;  1VQ8 A;  3IRB A;  1E1O A;  4IFD H;  4IFD G;  4DK6 C;  2WAQ E;  2JA5 B;  1UWV A;  3QOJ A;  1PYS B;  5M5W B;  2K1B A;  1BXT A;  3E0E A;  2ASB A;  2L9H A;  2EY6 A;  4B9W A;  2VB3 X;  3C3L A;  5IGF A;  4H44 C;  4GN5 A;  2K01 A;  1VMP A;  2A5H A;  1KDC A;  1OTC A;  4WJ4 A;  4X66 Q;  3KLW A;  5L37 A;  4OX9 Q;  3QOL A;  4NDX A;  3W2D A;  3F2D A;  1CKN B;  4A3K H;  2DGY A;  5KYL A;  2DNE A;  1YNN D;  5CBA E;  1VQD A;  1DXM A;  4JI1 Q;  3D3R A;  3H94 A;  5DAU A;  1K8O A;  4A3D H;  4X66 L;  4A3D G;  2WFW A;  4OX9 L;  2KA7 A;  1HR0 Q;  1JJ2 A;  4PG3 A;  1YEZ A;  3PMF A;  3VA7 A;  4RCO A;  2PQA B;  4TQU S;  1K8G A;  1X3P A;  1HZB A;  4KKU A;  4JI1 L;  2E76 C;  1FGB D;  1GHK A;  2OT2 A;  3WOE A;  3J7Y W;  1HR0 L;  1H9M A;  4EQN A;  3SDZ A;  1QWY A;  1A0I A;  3Q0A A;  4BY1 G;  3OW2 A;  1WCM B;  3DM1 A;  4KY5 A;  3I4L A;  1TWH H;  1K83 B;  5ELE A;  4GN4 B;  4AYB E;  4A3I H;  3URY A;  2WAQ G;  4GKK Q;  3J7A V;  1HQM C;  3JC6 6;  2IX3 A;  1AZQ A;  1ICF B;  2B2U C;  1K73 C;  1NSN S;  1OXV A;  1I6H H;  4ME5 A;  5LL6 S;  2NVQ H;  3C1F A;  3NSW A;  4ABN A;  2UUC Q;  4GKK L;  2UXC Q;  2RF4 A;  4HCE A;  3KLS A;  5I6Y A;  4A3J H;  4A3J G;  5JVG 3;  2K28 A;  4B3S Q;  4R4Q A;  2E2J B;  4UY8 C;  1L0Y B;  2B63 B;  3H3V H;  3S17 H;  2I5H A;  4QIW B;  2UUC L;  3T1Y Q;  2UXC L;  5CV6 A;  3AFP A;  1HRJ A;  1F9R A;  3S1R B;  2F4V Q;  2SOB A;  4B3S L;  3PUX A;  5E4X A;  3GTJ B;  4ID6 A;  2Z6K C;  1HH2 P;  1NTG A;  2L12 A;  1L1O A;  3Q23 A;  4NW2 A;  3T1Y L;  2PNR C;  2H1E A;  1WTP A;  4WJ3 M;  2WB1 B;  2F4V L;  3S9W A;  2HCC A;  1S40 A;  1VQA A;  5A2Q L;  1EFW A;  1PMR A;  1PFM A;  1PH9 A;  4P73 A;  3I72 A;  2VS1 A;  1OXU A;  1GJX A;  1NAP A;  2YU9 B;  2KCM A;  4Q5V A;  4DV6 Q;  3I4N B;  1Y1V G;  3R3O A;  1NNX A;  5IOD A;  3NBH A;  1B4O A;  2I5M X;  3DEO A;  4AYB G;  1C0A A;  2B2W A;  3KDF B;  3MVV A;  4DV6 L;  2PI2 E;  3AQQ A;  2GA4 B;  1ILP A;  1GOZ A;  3ND8 A;  4JI0 Q;  4JBK A;  4EQ5 A;  3DXJ C;  3S14 B;  4A93 H;  4GKJ Q;  3TDQ A;  1PH4 A;  2F0P A;  4RHS A;  1MJE A;  2Y0S B;  3QIA A;  5GAE C;  4JI0 L;  2KCC A;  3FDT A;  4U67 3;  4L5Q A;  2F3W A;  4TRD A;  1FJG Q;  4GKJ L;  3K5N A;  2K5W A;  2K5V A;  5EBD A;  2PQE A;  2Q2U A;  1BBX C;  3E0J A;  5ELO A;  3U4V A;  3L0O A;  1FJG L;  2NTS A;  4FO2 A;  4A3G B;  2JQO A;  3M3Y H;  1UNS A;  5GRO A;  2KHI A;  4AIM A;  4A3E G;  4GOP A;  5M5X B;  4BBR H;  2F3I A;  3GDE A;  2Z0S A;  2PYK A;  4GN3 B;  4X62 Q;  3ITP A;  3H3V I;  4PMW A;  4OWX B;  1SFO H;  4B3R Q;  3GTQ H;  2G9H D;  1SMY D;  2YTV A;  3BDO A;  1PTO H;  4X62 L;  4CJ1 B;  3PIP A;  2Z6B A;  4K0K Q;  2VNU D;  1JOO A;  1O7I A;  3JAM i;  1PRT B;  3P20 A;  1I4H A;  3J7A 5;  1H9R A;  3J81 i;  1RCV D;  4B3R L;  1G51 A;  3PF4 A;  1UE7 A;  3CCL A;  1MIU A;  4QF4 A;  2JA9 A;  1B3A A;  2Z9H A;  5AFW A;  5KIX A;  2NVT B;  2OWO A;  4HMJ A;  1BQQ T;  3CQZ H;  4K0K L;  1N33 Q;  1GUS A;  3S1M B;  5K5P A;  5M5Y B;  2WKC A;  2EY2 A;  1D6E C;  3GTO H;  3GTL H;  1TY0 A;  2JSO A;  5FOB B;  5C4X H;  1R4Q B;  1PFS A;  4QJF A;  1N33 L;  5C4X G;  1XWE A;  1KL9 A;  2AMC B;  3HOU H;  3HOU G;  2BA0 A;  2A1A A;  1C48 A;  3GD7 A;  3WOF A;  2K52 A;  2F0L A;  3J7A F;  4YCU A;  4WFN 3;  4BXX H;  2C9O A;  1V9P A;  2A68 C;  4KK7 A;  2RDH A;  1I5F A;  4DR7 Q;  2ZM6 Q;  5GAD C;  1A2U A;  3R93 A;  1W6J A;  4LUO A;  3M4Q A;  4KI0 A;  1Q86 C;  1S3O A;  1SND A;  1N32 Q;  4DR7 L;  2ZM6 L;  4O42 A;  4EX5 A;  1IXR A;  2VXW A;  1KAW A;  4FVM A;  1K0S A;  1PZK D;  1CT1 D;  2N3S A;  4X6A H;  5CV4 A;  1HZ9 A;  1Y14 B;  3CCJ A;  4F88 A;  1N32 L;  2JA8 B;  1VQC A;  2CH4 W;  1X6O A;  1H95 A;  4P75 A;  2Z1C A;  4A76 A;  2SEB D;  4GZY C;  1QG7 A;  2DNC A;  3VA5 A;  1LV9 A;  3GTG B;  1PV4 A;  3MWY W;  1SXT A;  3S1Q H;  3V05 A;  3UDG A;  1SYD A;  1J6Q A;  4LFA Q;  2OF1 A;  2HIX A;  1I4Q A;  3GTK B;  4Y7N H;  2NZ1 D;  3Q22 A;  3RR5 A;  3TP7 A;  1E22 A;  5CMD A;  2BH8 A;  4P2C B;  1AE3 A;  2L55 A;  1QZG A;  2J0T D;  1UE6 A;  3HOZ B;  4LFA L;  1BR9 A;  2IJ0 A;  1L2F A;  1QOH A;  3R8B A;  4DV3 Q;  4G7H C;  2E75 C;  1VQH A;  3IFD A;  1JR0 D;  2FFK B;  2R7D A;  3OW7 A;  4JOI A;  4LMQ D;  1VQJ A;  2FXQ A;  4WRD A;  1AEX A;  5BN4 A;  5JJK A;  4DV3 L;  1CM9 A;  4DV0 Q;  4IOA A;  1Y8P B;  4A3K B;  2F0D A;  1DZ1 A;  3ZJY C;  5KNB A;  4DAV A;  1QUQ B;  1GUW A;  1DJR D;  1CHQ D;  4IUN A;  4DV0 L;  1LLR D;  4PQX A;  3MXN A;  1V1P A;  3CRL C;  3OIP A;  3ER0 A;  1AFP A;  2R7Z B;  3CHB D;  2V4D A;  3R2I A;  2N49 A;  4V19 0;  4G57 A;  3BYT B;  2O4X A;  5JEA J;  5HUR A;  4NPS A;  3PO3 H;  3PO3 G;  1FVI A;  2NZO A;  3QR8 A;  2ZXP A;  4QIW E;  3M4Y A;  5I9P A;  2XVS A;  4K8I A;  1YIT A;  1STN A;  4B3T Q;  1VQ7 A;  4BA1 I;  2TMP A;  1II3 A;  4QCL A;  5EJW A;  1S5F D;  2I46 A;  1EY9 A;  4MTN A;  3I4M B;  3BS1 A;  4G7Z C;  2VUM H;  2LMC B;  3STB C;  2N88 A;  5ELF A;  3IFT A;  4B3T L;  3K81 C;  3X3N A;  4A3M B;  1WTX A;  1GXD C;  1ZEQ X;  3NHH A;  3HOX B;  1V8Q A;  5KYI A;  3VR4 A;  3NQT A;  1ENF A;  1D8L A;  1AE2 A;  1OXS C;  3J7Z C;  3GV6 A;  1YJN A;  3I56 A;  2E8G A;  2ZJQ A;  1PTO D;  3BZK A;  5M3M B;  1U9R A;  4LUZ A;  3RZO B;  4KKT A;  5IYD H;  1LT4 D;  1B50 A;  1K9M C;  1PTO F;  1M4V A;  2LS0 1;  1VS0 A;  1KLU D;  1B70 B;  1KLG D;  3D4W A;  1HCZ A;  2AUJ D;  4XXE A;  4YHH Q;  5EPJ A;  2CW0 D;  1F2Z A;  1VQI A;  4JI2 Q;  1VQ5 A;  2KCN A;  4DGZ A;  2KQ3 A;  3TRZ A;  2MFI A;  1B9M A;  5LL6 X;  1H9K A;  3E9H A;  2QDL A;  4YHH L;  4F8M A;  1Y8N B;  1VQM A;  4JBW A;  4GNX A;  1NY4 A;  3HFZ B;  4IQZ A;  4JI2 L;  4CKB A;  3NPP A;  5C44 B;  1KTK A;  2FMC A;  5DM6 3;  4QUC A;  4LF7 Q;  4OO1 H;  3NEM A;  1GD7 A;  4FYD A;  1YIJ A;  4OHJ A;  2PZW A;  2AWN A;  3D4R A;  3FPU B;  1UE5 A;  2LFN A;  2OTL A;  3NUC A;  3PIO A;  3K0X A;  4C3I H;  4LF7 L;  4C3I G;  4A93 B;  5EBC A;  4FF3 A;  1BOS A;  2PO4 A;  3NTI A;  3I4N G;  4KJN A;  3GTM B;  3CCM A;  3TP6 A;  3D31 A;  3FPP A;  2IWH A;  4DK0 A;  1M8A A;  4IUT A;  4NP5 A;  3S1N H;  2H4O A;  2Z4I A;  2CHB D;  2F0J A;  1G91 A;  3IAY A;  1BDO A;  3S15 B;  4N8X 1;  4C1N K;  2PZT A;  1GM5 A;  4ZRZ A;  1CQV A;  5LMU Q;  1EYD A;  1WTQ A;  2LY7 A;  5G3L D;  4XTC S;  2A69 D;  3KOJ A;  2TSS A;  1XPR A;  4OEM B;  2SNM A;  3GO5 A;  5G3L F;  5C0X J;  2KUM A;  3D0F A;  5LMU L;  5K36 G;  2IHF A;  1XMO Q;  5BR8 Q;  2V1C C;  2ID0 A;  4GLV B;  2VW9 A;  4A3F G;  2KCT A;  3OWE B;  2ICI A;  1EOT A;  1ENA A;  1QCB D;  1CHP D;  1EYC A;  4UP7 A;  2QCP X;  2EYJ A;  2F52 A;  2QA4 A;  1XMO L;  4ULL A;  1HHV A;  4JBJ A;  4LJZ C;  2F0H A;  4PMC A;  4PZ6 A;  1PH8 A;  2NN6 H;  2NN6 G;  3TZD A;  1EEI D;  3GTL B;  3SEB A;  4GLX A;  3L2P A;  4ODG A;  3F1Z A;  2LSS A;  3I70 A;  3MFG A;  3CCQ A;  2EJG C;  4OO1 I;  4FXK C;  1AW7 A;  1SRU A;  3PV0 A;  4C3J B;  4A3B B;  2PI2 A;  3BZC A;  1N36 Q;  1N34 Q;  2EYF A;  4DXG A;  2EYH A;  3R2T A;  1PYB A;  1QE6 A;  2K50 A;  3EFX D;  1SJE D;  3M7N A;  3OIQ A;  3GV3 A;  4KY7 A;  1N34 L;  1N36 L;  4ZQ3 A;  1UAP A;  1R9T H;  2K6A A;  1WTO A;  3HOW B;  2LKV A;  3MXU A;  4N9T A;  2MP1 A;  4TVA B;  1DOK A;  3E9I A;  1BVS A;  1XTC D;  1EIH A;  3T1H Q;  3OHX C;  1HQR D;  2HDL A;  2L4N A;  1STH A;  1Z7T A;  1NR2 A;  4PNY A;  3IL8 A;  2JA6 B;  2B39 A;  3SGI A;  1X9N A;  1SN8 A;  4N8F A;  2GVB A;  4K2L A;  2MGS A;  2QW7 A;  4QGU A;  1HNZ Q;  2KEN A;  4XQJ A;  1H9S A;  1SYC A;  1XPU A;  1M90 C;  5J39 A;  1I3Q H;  1NMF A;  5EKK A;  5C5M A;  3D6W A;  3T56 B;  1HNZ L;  2LXK A;  4A3C G;  5FLM H;  3RN5 A;  1ZYR D;  1BCP B;  5FKA C;  2IX0 A;  2N78 A;  1JC7 A;  3VYR A;  5DNF A;  4LF6 Q;  2AQ1 B;  4DUY Q;  1YNX A;  2ICE C;  1YNJ C;  4ZKC B;  1K0R A;  1F9Q A;  4KTA A;  4L5T A;  2YV5 A; 
#chains in the Genus database with same CATH homology
 1HFG A;  1EY6 A;  5JEA G;  3NQI A;  3DWA A;  3K7A B;  4OL7 A;  1EFI D;  4B9X A;  3OPO A;  1XYI A;  1U4R A;  2B2V C;  1S4Z A;  1G6Z A;  4YIJ A;  4R8N A;  1A15 A;  1CI3 M;  1EIG A;  2R92 B;  3KBX A;  1LTT D;  4B08 A;  2F0I A;  2ENB A;  5C3E B;  1RD9 D;  1F2M A;  4ZKB B;  2FIN B;  2RBM A;  3A54 A;  4XDX A;  3SK5 A;  4MIU A;  1DOM A;  3MEH A;  3AU7 A;  1ILQ A;  4F7X A;  4U68 A;  4UAI A;  4DA2 A;  2OEO A;  4RGN A;  5EPL A;  1QB5 D;  4LK1 C;  5COY A;  1TWC B;  2PW7 A;  2XSC A;  4BS9 A;  3HP3 A;  4C3H G;  3BZD B;  4CKC A;  4DK1 A;  3DUZ A;  1JWM D;  5CGK A;  2E2H B;  4RGO S;  3SHL A;  3H3V C;  1JCK B;  3K59 A;  1JIC A;  1TR5 A;  1TWA B;  2R6G A;  2L5T A;  1STA A;  4IN3 A;  1IYV A;  5CC4 A;  5CV9 A;  4IFD I;  2OXP A;  1SAP A;  2O5I C;  2XWJ B;  2FMM A;  3NXW A;  3T53 B;  1ONL A;  3Q6S A;  4C56 C;  2NVY B;  1STE A;  2K5Q A;  3DHQ A;  1F2Y A;  5M9O A;  2A74 C;  5ELB A;  2G9D A;  4IUQ A;  1JWU D;  1KAA A;  1PRT D;  2EYL A;  4LAA A;  1T5E A;  1CZG A;  1S5B D;  2A6H D;  4OGQ C;  2F0S A;  2R3Z A;  2R93 B;  5C3X A;  1E2W A;  2RDF A;  2NYZ D;  1QIL A;  2EVB A;  4M8A A;  1Q1E A;  2ZXR A;  1G8Z D;  5D3I B;  1HFN A;  2BOS A;  5C0X H;  5C0X G;  1Q90 A;  1IKM A;  3PUW A;  4I7Z C;  1SYF A;  4RA8 A;  5CV5 A;  1A6X A;  4G4K A;  1H9J A;  3BG3 A;  3ONA B;  4G7O C;  2J7Z A;  2AUK A;  5J1Z A;  1I50 B;  1SE2 A;  1EY7 A;  2MJ8 A;  4Z9C B;  3HGB A;  4IUR A;  5CBE E;  4CJ2 C;  1PTO C;  1STY A;  3I3C A;  5TSS A;  3Q24 A;  4QB4 A;  3U9S A;  4HN7 A;  5FO7 B;  1LO5 D;  3RD4 A;  4DU9 A;  3I90 A;  4CGY B;  4KJO A;  2XWB B;  2PW5 A;  1TII D;  2X6L A;  1SE4 A;  1UUP A;  3S2D B;  2NVX B;  3HOV B;  1SBB B;  1MSH A;  2QIL A;  1KNA A;  2DN8 A;  2IL8 A;  3PO2 B;  4HSP A;  1A3T A;  2E2I B;  1ROD A;  4RKB A;  3A56 A;  3FRP B;  2K05 A;  2NBF A;  1JQY D;  4MN3 A;  1LTR D;  2IT1 A;  1TS4 A;  1R9T B;  3KBG A;  5I2Y A;  3NWS A;  5CV8 A;  5KRU A;  2Q8T A;  5JPN C;  5KND A;  2MPM A;  1RHP A;  1LTA D;  1LAB A;  2ZT9 C;  4RAU C;  4C3J G;  2NTT A;  1JB3 A;  3QWN A;  1GUN A;  3HRZ C;  2B8G A;  1MGS A;  1WTR A;  1LT3 D;  1T5X D;  1SJH D;  3IKJ A;  1Y1W B;  5C6A A;  5IIF A;  1BCP C;  3K5O A;  1PZI D;  3HS0 C;  2XN9 C;  5KEE A;  2PPB C;  3W3A A;  1CFM A;  3KUP A;  5EKL A;  2F0N A;  3EJI A;  4ZUI A;  4MHE A;  5I2X A;  3K5L A;  3A8K E;  1Q1B A;  1LTS D;  3FVQ A;  1I4G A;  1V1P B;  1NCV A;  2D9U A;  1A3U A;  2B2Y A;  2PMZ B;  4KD4 A;  3RUZ A;  1A3V A;  1QJO A;  2CQA A;  1LTI D;  3NTK A;  4A3D B;  1LAC A;  2SNS A;  3OOC A;  1SEB D;  2JEB I;  1Z47 A;  3L9A X;  2QF7 A;  4IZ8 A;  2B2T A;  2KEC A;  1SNP A;  4IUU A;  1DM0 B;  3DWP A;  1TWH B;  4K6D A;  2RSN A;  3BVG A;  1Q3L A;  1BNZ A;  4A3I B;  2F1M A;  2WAQ B;  1X3Q A;  4CKE A;  1OO9 B;  1MBY A;  5I4D A;  1I6H B;  2NVQ B;  2IW3 A;  1U4P A;  1LT5 D;  3KLS X;  1PDQ A;  4A3J B;  4KHV A;  3P7J A;  4EGV A;  1TY2 A;  3S17 B;  3QO2 A;  5EGT A;  1D1I A;  1PFB A;  4FP5 D;  5BN3 A;  1EY5 A;  2B2W C;  1SYE A;  2VB2 X;  3PUY A;  4E6I A;  1OXT A;  2M00 A;  2F0E A;  5FLX L;  1U4L A;  3SVM A;  2EPB A;  2EOT A;  5JOB A;  2JYO A;  1EU4 A;  2XRQ D;  1Y1V B;  1YNN C;  1CK1 A;  3OSO A;  5EQ0 A;  4IUV A;  1E2V A;  2K03 A;  1TS5 A;  2B2U A;  2JP1 A;  2L11 A;  4CJ0 B;  5E4W C;  4X3U A;  1Q8I A;  2WII B;  1RDP D;  2D5D A;  1ML0 D;  1EY0 A;  2I07 B;  2F0T A;  5JAV A;  3E6Z X;  1EQV A;  1KDB A;  2ZXO A;  2QDB A;  2IPK D;  1MI2 A;  1ENC A;  3HG9 A;  3SXH A;  5D65 A;  4H13 C;  4K14 A;  3TME A;  1HXY D;  3I73 A;  4R9W A;  4RKL A;  3M3Y B;  1OXX K;  2FJ2 A;  4BBR B;  1MSG A;  4ZUJ A;  1JWS D;  3EVQ A;  3HEJ A;  1SFO B;  4J8Q A;  3GTQ B;  3A7A B;  5K36 H;  1F77 A;  1PTO B;  3FEW X;  3U9O A;  3C46 A;  5A35 A;  1S5D D;  1F9S A;  2M2L A;  1WTV A;  2RKS A;  3CQZ B;  1QNU A;  3K57 A;  1TU2 B;  5JVH 3;  2XNA C;  3DWQ A;  4ZLT F;  3H09 A;  4J1M A;  5CR3 A;  4K5X A;  3HZX A;  1AN8 A;  3GTO B;  2F0G A;  2HQE A;  5C4X B;  2F0W A;  1O7L A;  4HAE A;  2RSO A;  3HOU B;  2F4I A;  1B9N A;  1SNM A;  1HA5 A;  2XIW A;  4K5W A;  4DN4 M;  3CU7 A;  4H7B A;  4F87 A;  1TKW B;  1PFN A;  2WP8 J;  2JXM B;  2QKI C;  3SK4 A;  1EEF D;  4ZK9 B;  4DAP A;  1ET6 A;  1EZ6 A;  4HED A;  1H9S B;  5IOC A;  4IAL A;  3PIO 3;  3MXP A;  2Q8I B;  2KHS A;  1TWF B;  5JPM C;  3VR2 A;  1STG A;  2EZV A;  3L3O C;  5BN5 A;  2EYP A;  3X3M A;  2RVL A;  4HR7 B;  4L63 B;  3SR1 A;  5F2D A;  2SDF A;  3NP8 A;  2O5J C;  4DNR B;  4PMB A;  1G29 1;  3JAM E;  3S1Q B;  1XX8 A;  1ZXT A;  3J81 E;  4L6T B;  1I4X A;  4RCN A;  2PZU A;  4Y7N B;  2K5D A;  3ZYY X;  1SYG A;  1SMY C;  5EKI A;  3LX0 A;  3VYT A;  4S3S A;  3OMG A;  4RWS C;  1JE4 A;  1AP0 A;  5COR A;  3O13 A;  5JEA H;  1ICW A;  2RA4 A;  1SE3 A;  2NN6 I;  3M7G A;  2YYZ A;  5IT9 L;  3TBI B;  4DXF A;  1EL0 A;  5FLX E;  1NR4 A;  4FNF A;  1F9P A;  2EJF C;  4J6H A;  3NWT A;  1BUV T;  1CTM A;  3KF8 A;  2JE6 I;  4KN7 C;  2RDG A;  1PZJ D;  3P1H A;  3P75 A;  1FD7 D;  3MHB A;  1VF7 A;  3PO3 B;  2XRS D;  2A6E D;  3BDC A;  1Q12 A;  2N55 A;  1DOL A;  5JJZ A;  3ND9 A;  2D62 A;  2Z4H A;  2VUM B;  4XT3 B;  2WIN B;  1GUG A;  3MFY A;  2EDG A;  1FNV A;  1HUM A;  2BE5 D;  1HUN A;  4XQQ A;  2AWO A;  3A55 A;  1LT6 D;  3CKI B;  4RHR A;  3V96 A;  1DYQ A;  3OMC A;  5E1F A;  3NK9 A;  3D6C A;  1B44 D;  2C5C A;  1S5E D;  1SNQ A;  1O7Z A;  1X32 A;  4DFA A;  5EPK A;  3K6O A;  2F0F A;  2F0V A;  1IW7 D;  1Y8O B;  1SDF A;  1ESF A;  5D3D A;  4DNT B;  2EE1 A;  1PRT F;  4XQN A;  3VR3 A;  1Z6H A;  3N6R A;  4WOR A;  2F0Q A;  2E2D C;  4RGT A;  4DAY A;  1FNW A;  4XT1 B;  1B2T A;  3MTS A;  4C3I B;  1JOQ A;  3K0Y A;  1LTB D;  1C4Q A;  1PYW D;  5T1G A;  4FF4 A;  2PCF B;  4FXG C;  1ESR A;  3S1N B;  1EYA A;  4CBV A;  2KVM A;  3FMC A;  1VDZ A;  3NTH A;  1S5C D;  2K7V A;  4KD3 A;  2X6G A;  4HTH A;  3BYY B;  4L8J A;  4FF2 A;  2F0M A;  2HDM A;  2BCO A;  4A3F B;  3A8J E;  3G6J B;  1HTL D;  4X3T A;  5FO9 B;  3N52 A;  4JK1 C;  2CW0 C;  1TVX A;  5IGB A;  3TSS A;  1I4P A;  2KED A;  1EY4 A;  2BDO A;  1CA5 A;  1SSO A;  5KNC A;  2AQ2 B;  4FF1 A;  1RKN A;  2F0O A;  1YNJ D;  5IT9 E;  3SK6 A;  3H91 A;  2EJM A;  3L7Z C;  1HPC A;  2DY8 A;  4M1U B;  1CQF A;  1NUC A;  2Z8L A;  5I9O A;  1IYU A;  4EQO A;  2KJX A;  1IKL A;  5C0X I;  2EY5 A;  1TS3 A;  3G7L A;  1TS2 A;  4R8I A;  1PXU A;  2E74 C;  1SNO A;  1IL8 A;  3GTP B;  2EYO A;  2AQ3 B;  4PV1 C;  5FO8 B;  2M9V A;  3VR6 A;  1VCI A;  5IGE A;  3MC0 B;  1AZP A;  3C1E A;  2HCI A;  4Q0F A;  3AMU A;  1I3Q B;  4H0L C;  4KMU C;  2WV6 D;  2A69 C;  4K5V A;  4V0B A;  4ZAI A;  4RFB A;  5HGT A;  3J80 L;  5IGG A;  5NUC A;  4TKO B;  2QEJ C;  4QMG A;  1KDA A;  2EXZ A;  3I91 A;  3H0G B;  3TP8 A;  3VYU A;  2DY7 A;  2Q8R E;  1FYC A;  1GUO A;  1O7Y A;  1ET9 A;  5I6W A;  4KV6 A;  3PIP 3;  3QB3 A;  3FKI B;  3D4D A;  1WD1 A;  3M85 A;  1EWH A;  3MXG A;  3MA2 B;  3SE0 A;  1IHZ A;  5E3F A;  4ZYS A;  2NWG A;  3AB9 A;  2L1B A;  3RMH A;  1GUT A;  3T16 A;  2A73 B;  1C8C A;  1B53 A;  5IGD A;  3TZU A;  1D5M C;  1K8M A;  3VR5 A;  3D8G A;  4DF7 A;  5A2Q E;  2JA7 B;  3QG1 A;  4BY1 B;  1E0B A;  4I65 A;  4IFD J;  1WD0 A;  5ELC A;  4X3S A;  3CRK C;  3MAQ A;  3DEP A;  4QUF A;  1WTW A;  3BVZ A;  1V1O A;  4C3H B;  5LHY 1;  3GP7 A;  4OIK A;  4FXD A;  3JAM L;  3J81 L;  4RH6 A;  1D2B A;  1QNK A;  2B2V A;  1B1Z A;  4UDU C;  2F03 A;  1ZYR C;  2BA1 A;  4EQP A;  4BY7 B;  1DON A;  2D2C C;  2F0K A;  3PUV A;  2WAC A;  1O80 A;  1EWC A;  2J4X A;  4KY6 A;  3SK8 A;  3K58 A;  1SNC A;  2NB0 A;  2X69 A;  5ELD A;  2R61 A;  4HCS A;  3PUZ A;  1DD2 A;  3A8I E;  2MUY A;  4KHZ A;  3TN2 A;  1VF5 C;  3S2H B;  4NMZ A;  3HKZ B;  4AYB B;  1LTG D;  4HSV A;  4KN4 C;  5DM7 3;  1E2Z A;  4ILW A;  4XYQ A;  4IUP A;  1EU3 A;  4K6L A;  1VMC A;  2IX1 A;  2A6E C;  2EY1 A;  1I6V C;  3A7L A;  1G2T A;  4OO1 G;  2RQX A;  3S16 B;  3ERQ A;  1MD2 D;  5C4Z A;  1U4M A;  3EQL C;  2A68 D;  4OIJ A;  4TSS A;  5C5L A;  4KKS A;  2BE5 C;  1R4P B;  3EA6 A;  4BA2 I;  1FR3 A;  4A3E B;  1TWG B;  1L0X B;  1Y69 U;  3DMU A;  5T1I A;  1D1K A;  4K2K A;  2O2L D;  1JOK A;  3TP5 A;  3QJY A;  3I8Z A;  4BBS B;  1XXG A;  1F2L A;  2KEE A;  1RJT A;  3BDL A;  5C4H A;  1EZ8 A;  3LWU A;  4O1N A;  3J80 E;  3M4O B;  3LWE A;  4NKL A;  4X3K A;  3E5S A;  1JOR A;  3F2U A;  3LNN A;  5FK9 C;  3V2T A;  1BCP D;  3NE5 B;  2EYM A;  5C4J B;  1BCP F;  1IW7 C;  5CV7 A;  3HOY B;  1PRT C;  3K5M A;  2K32 A;  1I4R A;  4WJW A;  1RF2 D;  2A6H C;  3VYS A;  1O78 A;  2NUC A;  3OWF A;  3ERO A;  1KAB A;  1TT2 A;  1HA6 A;  4XYO A;  4K8J A;  2K33 A;  5DEH A;  1BF4 A;  2BDN A;  2JEA I;  1RTO A;  1V43 A;  1DCZ A;  2FHT A;  1KNE A;  3T13 A;  5KGU A;  3NBI A;  3UI2 A;  3MZ5 A;  1CA6 A;  1EY8 A;  4CHT B;  1EQT A;  2L0C A;  1A2T A;  3KK7 A;  4RGM A;  1J9O A;  1ZKO A;  3GQB A;  3RLF A;  1RTN A;  4N9P A;  1UEA B;  3RZD B;  3T51 B;  4XIG S;  5IGC A;  2B2Y C;  1HTP A;  1BO0 A;  1FNU A;  5ISR A;  1D5X C;  1GHJ A;  3C2P A;  2B8F A;  2HUG A;  2WKD A;  1STB A;  3H6M A;  2F0U A;  5J22 A;  2MHV A;  4C1N I;  1CZW A;  1SYB A;  1W6K A;  4C2M B;  3BVM A;  3T4A C;  1J8I A;  1G2S A;  3WDN A;  1WVL A;  2F3V A;  1TQO A;  1PLF A;  5C3W A;  5M3F B;  4HMI A;  5D14 A;  3KLR A;  2B2T C;  2K04 A;  4BWG B;  2CVR A;  4EVO A;  1D5Z C;  5CYU A;  2KOL A;  4IFD H;  4IFD G;  2JA5 B;  3QOJ A;  5M5W B;  2K1B A;  1BXT A;  2L9H A;  2EY6 A;  4B9W A;  2VB3 X;  3C3L A;  5IGF A;  4H44 C;  2K01 A;  1VMP A;  2A5H A;  1KDC A;  3QOL A;  4NDX A;  3W2D A;  5KYL A;  2DNE A;  1YNN D;  5CBA E;  1DXM A;  3D3R A;  3H94 A;  5DAU A;  1K8O A;  2KA7 A;  3VA7 A;  3PMF A;  4RCO A;  4TQU S;  1X3P A;  4KKU A;  2E76 C;  1FGB D;  1GHK A;  2OT2 A;  3WOE A;  3J7Y W;  1H9M A;  4EQN A;  3SDZ A;  1QWY A;  3Q0A A;  1WCM B;  3DM1 A;  4KY5 A;  3I4L A;  1K83 B;  5ELE A;  3URY A;  3J7A V;  1HQM C;  2IX3 A;  1AZQ A;  2B2U C;  1NSN S;  1OXV A;  4ME5 A;  5LL6 S;  3C1F A;  3NSW A;  4ABN A;  4HCE A;  3KLS A;  5I6Y A;  5JVG 3;  2K28 A;  2E2J B;  1L0Y B;  2B63 B;  4QIW B;  5CV6 A;  1HRJ A;  1F9R A;  3S1R B;  2SOB A;  3PUX A;  5E4X A;  3GTJ B;  4ID6 A;  2L12 A;  3Q23 A;  4NW2 A;  2PNR C;  2H1E A;  1WTP A;  2WB1 B;  3S9W A;  2HCC A;  5A2Q L;  1PMR A;  1PFM A;  3I72 A;  1OXU A;  1GJX A;  1NAP A;  2YU9 B;  4Q5V A;  3I4N B;  3R3O A;  5IOD A;  3NBH A;  1B4O A;  3DEO A;  2B2W A;  3MVV A;  2GA4 B;  1ILP A;  1GOZ A;  3ND8 A;  3DXJ C;  3S14 B;  3TDQ A;  2F0P A;  4RHS A;  2Y0S B;  3QIA A;  2KCC A;  3FDT A;  4U67 3;  2F3W A;  4TRD A;  3K5N A;  2K5W A;  5EBD A;  2PQE A;  1BBX C;  3E0J A;  2NTS A;  4FO2 A;  4A3G B;  1UNS A;  5M5X B;  2PYK A;  3ITP A;  4PMW A;  2G9H D;  1SMY D;  3BDO A;  1PTO H;  4CJ1 B;  2VNU D;  1JOO A;  1PRT B;  3P20 A;  1I4H A;  1H9R A;  1RCV D;  4QF4 A;  1B3A A;  5AFW A;  5KIX A;  2NVT B;  4HMJ A;  1BQQ T;  1GUS A;  3S1M B;  5K5P A;  5M5Y B;  2WKC A;  2EY2 A;  1D6E C;  1TY0 A;  2JSO A;  5FOB B;  1R4Q B;  1XWE A;  2BA0 A;  1C48 A;  3GD7 A;  3WOF A;  2F0L A;  3J7A F;  4WFN 3;  2C9O A;  2A68 C;  4KK7 A;  2RDH A;  1A2U A;  3R93 A;  1W6J A;  4KI0 A;  1SND A;  4O42 A;  2VXW A;  4FVM A;  1PZK D;  1CT1 D;  5CV4 A;  4F88 A;  2JA8 B;  2Z1C A;  2SEB D;  4GZY C;  1QG7 A;  2DNC A;  3VA5 A;  1LV9 A;  3GTG B;  3MWY W;  1SXT A;  3V05 A;  1SYD A;  2OF1 A;  3GTK B;  1I4Q A;  2NZ1 D;  3Q22 A;  3TP7 A;  5CMD A;  4P2C B;  2L55 A;  2J0T D;  3HOZ B;  1BR9 A;  2IJ0 A;  1QOH A;  3R8B A;  4G7H C;  2E75 C;  3IFD A;  1JR0 D;  2FFK B;  3OW7 A;  4LMQ D;  4WRD A;  1AEX A;  5BN4 A;  1CM9 A;  1Y8P B;  4A3K B;  2F0D A;  1DZ1 A;  5KNB A;  4DAV A;  1GUW A;  1DJR D;  1CHQ D;  4IUN A;  1LLR D;  4PQX A;  3MXN A;  1V1P A;  3CRL C;  3OIP A;  1AFP A;  2R7Z B;  3CHB D;  2V4D A;  3R2I A;  4V19 0;  4G57 A;  3BYT B;  2O4X A;  5JEA J;  5HUR A;  2ZXP A;  3M4Y A;  5I9P A;  2XVS A;  4K8I A;  1STN A;  4BA1 I;  2TMP A;  1II3 A;  4QCL A;  5EJW A;  1S5F D;  2I46 A;  1EY9 A;  3I4M B;  3BS1 A;  4G7Z C;  2LMC B;  2N88 A;  5ELF A;  3IFT A;  3X3N A;  4A3M B;  1WTX A;  1GXD C;  1ZEQ X;  3NHH A;  3HOX B;  1V8Q A;  5KYI A;  3VR4 A;  3NQT A;  1ENF A;  1OXS C;  3GV6 A;  1PTO D;  5M3M B;  1U9R A;  3RZO B;  4KKT A;  1LT4 D;  1B50 A;  1PTO F;  1M4V A;  2LS0 1;  1KLU D;  1KLG D;  3D4W A;  1HCZ A;  2AUJ D;  4XXE A;  5EPJ A;  2CW0 D;  1F2Z A;  2KCN A;  4DGZ A;  2KQ3 A;  1B9M A;  5LL6 X;  1H9K A;  4F8M A;  1Y8N B;  4JBW A;  4IQZ A;  4CKB A;  3NPP A;  5C44 B;  1KTK A;  2FMC A;  5DM6 3;  4QUC A;  4OO1 H;  4FYD A;  4OHJ A;  2PZW A;  2AWN A;  3D4R A;  3FPU B;  2LFN A;  3NUC A;  4C3I G;  4A93 B;  5EBC A;  4FF3 A;  1BOS A;  2PO4 A;  3NTI A;  4KJN A;  3GTM B;  3TP6 A;  3D31 A;  3FPP A;  2IWH A;  4DK0 A;  1M8A A;  4IUT A;  4NP5 A;  1G91 A;  2H4O A;  2Z4I A;  2CHB D;  2F0J A;  3IAY A;  1BDO A;  3S15 B;  4C1N K;  2PZT A;  4ZRZ A;  1CQV A;  1EYD A;  1WTQ A;  2LY7 A;  5G3L D;  4XTC S;  2A69 D;  2TSS A;  2SNM A;  3GO5 A;  5G3L F;  5C0X J;  2KUM A;  5K36 G;  2ID0 A;  3OWE B;  2ICI A;  1EOT A;  1ENA A;  1QCB D;  1CHP D;  1EYC A;  2QCP X;  2EYJ A;  4ULL A;  1HHV A;  4LJZ C;  2F0H A;  4PMC A;  2NN6 H;  2NN6 G;  3TZD A;  1EEI D;  3GTL B;  3SEB A;  4ODG A;  3I70 A;  3MFG A;  2EJG C;  4OO1 I;  4FXK C;  1AW7 A;  4C3J B;  3PV0 A;  4A3B B;  2EYF A;  4DXG A;  2EYH A;  1QE6 A;  3R2T A;  3EFX D;  1SJE D;  3M7N A;  3OIQ A;  3GV3 A;  4KY7 A;  4ZQ3 A;  1UAP A;  2K6A A;  1WTO A;  3HOW B;  2LKV A;  3MXU A;  4N9T A;  2MP1 A;  1DOK A;  1XTC D;  1EIH A;  3OHX C;  1HQR D;  2HDL A;  2L4N A;  1STH A;  1Z7T A;  1NR2 A;  4PNY A;  3IL8 A;  2JA6 B;  2B39 A;  4K2L A;  2MGS A;  4XQJ A;  1H9S A;  1SYC A;  5J39 A;  5EKK A;  5C5M A;  3D6W A;  3T56 B;  1ZYR D;  1BCP B;  5FKA C;  2IX0 A;  1JC7 A;  3VYR A;  5DNF A;  2AQ1 B;  2ICE C;  1YNJ C;  4ZKC B;  1F9Q A;  4KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...