1F9PA

Crystal structure of connective tissue activating peptide-iii(ctap-iii) complexed with polyvinylsulfonic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
NLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONNECTIVE TISSUE ACTIVATING PEPTIDE-III
publication title Structure of the CXC Chemokine, Connective Tissue Activating Peptide-III, Complexed with the Heparin Analogue, Polyvinylsulfonic Acid
rcsb
molecule tags Blood clotting
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9pA00
3MTSA 4QUFA 1SDFA 1U4RA 3TZDA 5JJZA 1M8AA 3GV3A 2FMMA 2HDLA 1WTOA 1DONA 2FFKB 1BO0A 1RJTA 5T1IA 3N52A 4ZKBB 1G91A 1PFNA 1RHPA 2H1EA 1CA5A 1HFNA 2K01A 4HEDA 2K03A 2RSNA 2X6GA 4RAUC 1XYIA 2B2WA 1BNZA 1JE4A 1O7ZA 4O42A 3FDTA 4IURA 1CM9A 5EQ0A 1NR2A 1U4LA 1NCVA 2B2WC 2MGSA 1G2TA 2MJ8A 1RTOA 1ML0D 1C8CA 5E4XA 1HUNA 1ZXTA 1MGSA 1KNEA 1U4PA 2X6LA 1SSOA 1WTRA 2L11A 1IKLA 1WTWA 2B2TA 2BDNA 2HCCA 1B3AA 2NWGA 1WTQA 1DOLA 5COYA 1HA6A 2EE1A 1B2TA 2B2TC 4NW2A 3FPUB 2KVMA 1GUWA 1J9OA 2RVLA 1U4MA 1DOKA 1F9PA 1EOTA 4UAIA 1WTVA 2KECA 2FHTA 2M2LA 1TVXA 4MN3A 5T1GA 1NR4A 2FJ2A 1O7YA 5CORA 1ICWA 1X3PA 2KEEA 4U68A 5E4WC 5EJWA 2B2UA 5D65A 1ILPA 1G6ZA 5CMDA 1EQTA 4ZAIA 2K28A 2JP1A 5EKIA 1MSGA 2R3ZA 2XIWA 2EPBA 5D14A 5CBAE 2B2UC 4DN4M 1IL8A 2D9UA 3ONAB 1WD0A 1NAPA 1B4OA 3R93A 4CJ2C 4ZKCB 2IL8A 3G7LA 1B50A 4HCSA 5CBEE 1QE6A 1SAPA 2EOTA 1QG7A 2FINB 2K04A 4OIJA 3DM1A 2RA4A 3LWEA 4R9WA 1MSHA 4OIKA 4X3SA 4X3TA 2B2YA 4ZLTF 3I90A 2RSOA 3I8ZA 1S4ZA 1AP0A 4MHEA 2CVRA 2DY8A 2X69A 1E0BA 2B2YC 3DEPA 3QO2A 4IUPA 3UI2A 1WVLA 2NYZD 3HP3A 1VMPA 2HCIA 4IUTA 4RWSC 2NZ1D 3Q6SA 2J7ZA 5AFWA 4R8IA 5EPKA 2N55A 4CJ1B 1G2SA 3I91A 4X3KA 1PDQA 1F9SA 1JICA 4XT1B 1WTXA 2L4NA 2K1BA 4QUCA 3KBXA 4X3UA 3KUPA 4HSVA 4CJ0B 2L1BA 2MP1A 1BBXC 4IUVA 3GV6A 1X32A 2Q8RE 2SDFA 1F9RA 3F2UA 3I3CA 1WD1A 1HUMA 2B2VA 2VXWA 4IUQA 1MI2A 4XT3B 1ILQA 1LV9A 1WTPA 3TN2A 1RODA 3DEOA 3SVMA 1F2LA 1F9QA 2HUGA 1RTNA 2B2VC 3D6WA 3IFDA 2Q8TA 2L12A 3IL8A 4ZK9B 1AZPA 1X3QA 1A15A 1DOMA 1KNAA 2JYOA 2HDMA 2KUMA 1IKMA 1EIHA 1HRJA 1ESRA 1VMCA 2L9HA 2DY7A 2MPMA 1EIGA 1QNKA 4IUUA 1XX8A 5EPJA 4XDXA 1PFBA 1DZ1A 2N88A 4RA8A 5EPLA 1HFGA 1J8IA 1BF4A 2KEDA 2K05A 3H91A 3MWYW 1O80A 1PFMA 5DNFA 1AZQA 1CA6A 1HHVA 4HAEA 3P7JA 4LMQD 2KOLA 1Q3LA 1B53A 1PLFA 1EL0A
chains in the Genus database with same CATH superfamily
2SEBD 2R92G 4QY7A 2JA5G 4DUZQ 2HDLA 3GO5A 2Q8IB 2FFKB 2UXDQ 1RDPD 1Y14B 1TS3A 4KMUC 3AFQA 2K5QA 3UDIA 5C0XH 2JK8A 4RFBA 2VZAA 2A74C 1JT8A 2O5JC 2TMPA 4UHVA 5IIFA 1BBUA 3T13A 3TBIB 4CDDC 3UDGA 4BBSH 1WJJA 2XGTA 3CXCA 4CKBA 1GUWA 3U4VA 4C1NI 1WTHA 3D4DA 5EKKA 4RGOS 1N9WA 3TP5A 1IW7D 5AJ3L 1TT2A 1AE3A 5JVH3 5C4ZA 3M4QA 3SXHA 3P20A 4FXGC 4QIWB 1YNJD 1LTID 1HZCA 2E2JB 4ID6A 2ICIA 3VYTA 5EBDA 3FKIB 5IT9c 3R93A 2E2HH 5CBEE 4OIJA 3DM1A 2DNEA 2SOBA 4KHZA 1J6QA 4ULLA 2B8FA 1D8LA 1B3QA 4JCVE 3I4NB 2R7ZH 3S2HB 2NBFA 3Q6SA 4A3LH 1CQVA 4K8JA 1UEAB 1Y1VB 4C3IG 2ZXOA 3T51B 5EPKA 3W2DA 4N9TA 2VNUD 2PZWA 1G2SA 1DYQA 3HGBA 1UE1A 3PO2H 4YWMA 2PQAB 3GV6A 2A6HC 1HNXL 2YTYA 3E0JA 1ILQA 1M4VA 1X3EA 4ZK9B 1ZYRC 5IGDA 1KIXA 1JOQA 4KK7A 4LUOA 2KUMA 2RDGA 1LACA 2MPMA 4KKSA 2EJGC 3T1YL 2XRQD 1LT3D 1PFBA 5AJ3Q 2NN6H 3VA7A 2Q2TA 1AZQA 2UUBL 2LSSA 1L1OA 1EFWA 3IL8A 4OONA 2F0IA 4A3MH 3MTSA 4LFCQ 1L1OC 4KJOA 4I7AA 5IY0A 2HQLA 3RMHA 3J7ZC 4LNQA 1A62A 1GUNA 1ZKOA 2Q2IA 5FK9C 2UXCL 4KHVA 3AU7A 1T9HA 3KDFA 3PGZA 4GKJL 2V1CC 5ELDA 1XMOL 3NP8A 5HGTA 1V43A 3GTOB 1CM9A 2F0PA 2JA6G 2GN5A 4PMBA 5ELBA 1XNQL 3R2TA 1MHWC 1U4PA 3NBHA 5EKLA 1SSOA 2IWHA 2F0SA 4NKLA 3G6JB 3A0JA 5IYBH 1CQFA 2F4VL 2QILA 2BCOA 2EYMA 1SN8A 2G5DA 1VQ9A 1SFOH 1QJOA 3GTLB 1H9KA 1JE5A 1U4MA 3U4ZA 4LF9L 1TU2B 1HNXQ 2M2LA 1LT6D 4JBJA 2AKWB 3A8IE 4K8IA 3R8BA 1SROA 3JC66 5EJWA 3H15A 1XTDA 1VQGA 3BZCA 2GVAA 2L0CA 4A3KB 5D14A 4UY8C 4V0BA 1NAPA 4P75A 4X62L 3T1YQ 1IBKL 4EX5A 2BH2A 2UUBQ 2NVTH 4X3SA 1LTTD 3R2IA 1KAWA 3I70A 4K6DA 3MVVA 1N33Q 4JYAQ 3OTOL 2PYKA 4IUTA 2UXCQ 1WCMG 2K5VA 1M1KC 4R8IA 4BY1H 2OCEA 2N55A 1XMOQ 3H6MA 1XTCD 1PXUA 2Y0SG 1BBXC 1NUCA 4IUVA 4J8QA 1S72A 3U9SA 1XNQQ 1EYGA 1H95A 1D6EC 2CW0C 2Z4HA 3J81L 4C1NK 2F4VQ 4BXXG 2QW7A 1A3UA 4J6HA 4AYBB 1AZPA 3TDQA 1A15A 1ASYA 4A93G 1B1ZA 1IKMA 4DK3C 1SE8A 4LUVA 1CI3M 4LF9Q 1DZ1A 1MBYA 4CDFC 2TSSA 1TS5A 4RMFA 3CCUA 3HOZH 2QEXA 3RR5A 5EAYA 1L2FA 4LMQD 4CJ2C 1Y69U 3I7FA 2F0DA 4IJHA 3J80c 1MJCA 4F7XA 4K14A 3STBD 1XJVA 3OMGA 1C7YA 1I5FA 2UXBL 4IFDG 2NVQB 4X62Q 3SHLA 1PFNA 3AYHB 4R1JA 1O7LA 5ELEA 3SE0A 1LTAD 2KCCA 1IBKQ 4RAUC 1XNRL 2B63G 4OO1I 4S3SA 3ULJA 1G8ZD 4JBKA 3J7A5 1ZXTA 3OTOQ 2E2IH 1VQHA 2L11A 5C5LA 1CK1A 1HQRD 4CGYB 2QKIC 1LYLA 1WTQA 4DV3L 1KLUD 4ZYSA 1PZID 2ZXRA 4LK1C 1SEBD 3KJOA 1HA6A 1CFMA 3JAML 2OXPA 1X54A 4L5RC 4DV4L 3FKIH 2PCFB 1TS4A 1H9JA 2EVBA 2LY7A 4RG1A 3TS2A 3A5UA 2I07B 2J4XA 1IBML 4A3CG 5C0XJ 4NP5A 4QB4A 1PHJA 3OIPA 4DR2L 3I4MH 2H4OA 2DN8A 3K0XA 1RKNA 4OWTB 5HY6A 5CBAE 1DGSA 1PZKD 2D9UA 3I55A 1NJIC 5FJ8H 5DEHA 1JJCB 2F0JA 1BCPD 2D5DA 5C0XI 3S1RH 3AQQA 2O2LD 2AQ2B 1Q12A 2IHFA 3H09A 5G3LF 3NBIA 1I4RA 2RSOA 3SR1A 4X64Q 5FLXc 4K6LA 4JPBW 3L2PA 2C5CA 1SYEA 3DEPA 4YCVA 3FMCA 3S1MB 2DUDA 3Q24A 2E5LL 2UXBQ 2NYZD 1YBYA 4L5TA 2HCIA 1PTOH 4RWSC 1F2ZA 2J7ZA 2F0OA 1RD9D 4DNRB 4CJ1B 4X3KA 4BBRB 3FP9A 1K83H 4JBWA 3OMCA 5FKAC 1V1PB 5GAEC 3QG1A 1FJGL 5JJKA 3CC4A 2CQOA 3RD4A 1AH9A 4DV3Q 2Z1CA 5IP9G 4P2CB 1N36L 2K5DA 5C44G 2LMCB 5KYIA 2A69C 4RHSA 4DV4Q 2WB1G 4FO2A 4A3FG 4DV1L 1MKHA 3H0GG 1IBMQ 1X9NA 4BY7G 4TRDA 3MWYW 1PFMA 2JQOA 1JJGA 1L0XB 5I4DA 4IQZA 4DR2Q 1S5CD 5JJZA 2ES2A 1Z6HA 4CHTB 3PUYA 3VR5A 1R4QB 3G48A 4I7ZC 5IYDH 4B3TL 1HFNA 4TQUS 2F0EA 3E9HA 5D3DA 4DK1A 3E0EA 2K03A 1IHZA 2K7VA 2EYPA 1S40A 1HZ9A 4MNOA 1Q1BA 2F0WA 4BWGB 5IE8A 4U673 4LFAL 1NSNS 3UE0A 5LMNW 1HNZL 4MIUA 1ML0D 3KBGA 1BQQT 1EYCA 1LTSD 3NK9A 2F0LA 5TSSA 2CQAA 2E5LQ 1OXSC 2CH4W 4C3JB 3K7UC 3D0FA 3D4WA 3QR8A 1NTGA 2E2DC 1EEID 3BDOA 3ER0A 4K5XA 1OXXK 4TKOB 2NN6I 3ULPA 3DHQA 1T5XD 4IZ8A 3A55A 3Q22A 3S1NH 1F77A 1KXLA 3KLWA 2M00A 2JEAI 1DXMA 2EY2A 2A68D 2EPBA 3T1HL 3L3OC 1A2TA 2Y0SE 4KY6A 5I6YA 2KBNA 4OWWB 3M4OB 4IOCA 1CSPA 1A3TA 1PA6A 1EQRA 1QG7A 3KF6B 4DV1Q 2OWOA 1TKWB 3HKZG 2IX3A 1IYVA 3SK6A 5M5YB 4DV7L 2CWPA 1UWVA 4UP8A 4WFN3 2O5IC 5C4XG 3PIO3 2RDFA 4ZUJA 2PQAA 2XVSA 3UI2A 1E0BA 4PQXA 2XN9C 4KHPL 3HOUB 2K50A 1VMPA 5M3MH 1Y8PB 3HOYH 2UUAQ 4FF1A 1NMFA 2I5LX 2MO0A 3A74A 2K1BA 4QUCA 5J1ZA 3PF4A 4WRDA 1SXTA 4LFAQ 5DLQE 4ZQ3A 1F9RA 1VS0A 2AUKA 1QILA 3MZ5A 5KNBA 4OEMB 1GUGA 1RODA 1F2LA 5C3EG 1A2UA 4H13C 4A3EH 2L12A 4RCNA 4A3DB 1I4QA 1GM5A 4XDXA 1EU4A 1KTKA 3TREA 1J8IA 1IZ6A 4DV0L 3CCVA 2R92B 1TY0A 5M9OA 1FNUA 1KQSA 1I6HH 2VUMB 1SDFA 3KK7A 1VQLA 1VQDA 2K4KA 3CW2C 3D8GA 1IW7C 1I4PA 3NWTA 1EFID 1R4PB 1E3PA 2R93G 4JW0A 3J81E 1JJ2A 1BNZA 3KLSA 4O42A 3FDTA 5GQOA 4XQJA 4DV7Q 1U0LA 4NB3A 1NCVA 4FVMA 2A19A 4MZ9A 5J3BA 3A56A 2A8VA 4M8AA 4KHPQ 2L55A 1GUTA 1A6XA 3CRKC 2OEOA 3PO3G 2BOSA 4NW2A 2YU9H 1DOKA 4HIKA 1ONLA 1Y1WG 4OX9L 2KECA 2FHTA 2N78A 2CWAA 1SNPA 1XWEA 1NR4A 1HH2P 4KTAA 1JR0D 2DJFC 3M4YA 1HA5A 1ILPA 3S14H 2JP1A 2EDGA 4FF4A 2XIWA 5GAHC 1I50H 3M9BA 5KGUA 1TWAB 2H5XA 3G7LA 4C2MH 4EQNA 4HJ8A 2ATWA 4DV0Q 2RA4A 5C4JH 1PTOF 4A3JH 1KLGD 4AH6A 1MSHA 1HZBA 4R8NA 3HZXA 1ENCA 2CH4A 4LJZC 1NNXA 4JOIA 4MHEA 3GDEA 1Q46A 5IYCH 1YNNC 2WB1E 4C3IB 4XTCS 3G4SA 2A73B 4YWLA 2F0MA 1SNCA 1OO9B 4IALA 1PYBA 1K73C 1E7ZA 3I91A 1L0WA 2RDHA 1WTXA 1AW7A 5CYUA 1SLJA 1XPRA 4WORA 1TWCB 2Z6KA 4XYQA 3VA5A 4XYOA 5I2XA 4GLXA 2QGQA 1QUQB 2WFWA 3ERSX 2JA7B 3S17B 3TZUA 3BVZA 2WINB 2HUGA 3HOVB 4GKKL 1JB3A 1HRJA 2OT2A 1SMYD 4PZ6A 5GROA 1VQPA 2DY7A 4HIMA 3RNUA 4OX9Q 1HFGA 3E3XA 3N6RA 5K36H 5I9PA 2Z4IA 3P7JA 2X6GA 1FNWA 4C3HH 2YV5A 3TZDA 2B39A 3A8KE 1EYDA 3CPWA 1EZ6A 1TXYA 4DV2L 2JA6B 4LWCA 1STGA 1S3OA 1TQOA 1V1QA 1LTRD 1U4LA 3GTQH 1G2TA 1XMQL 2HIXA 1SYCA 4A3DG 1KD1C 4LFBL 1A63A 3SGIA 1IKLA 1U9RA 4BBSG 3HKZE 1ZEQX 4UDUC 3CC7A 5IGCA 1K9MC 1QVFA 4DU9A 5LMUL 3J80i 2KVMA 4IUNA 4POGA 2EYFA 2VUMG 1NE3A 2RVLA 4ME5A 3S9WA 4JI3L 1I4GA 2XSCA 1MD2D 4JI4L 1Z9FA 5FLMH 3RZDH 3T56B 1CHPD 3GTMH 4GKKQ 4ABNA 4DK0A 1K3BC 3IKJA 2JA8H 3HOWH 1VQ5A 3RN2A 3GTGH 3AFPA 4X66L 1PTOD 5ELFA 4RGNA 4P74A 3K5MA 1BKBA 2ZXPA 3K7AH 2B3GA 2B2YA 5IGEA 3V2TA 4C56C 4DAYB 2R7ZG 3EN2A 1WCMB 3CC2A 1V1PA 3CCLA 2DY8A 3SK4A 3GTJH 3HFZB 2B2YC 1Q81C 2BH8A 4A3LG 4YCUA 4A3GH 2F0VA 2QEJC 1VQAA 4KKUA 2F0TA 1HJPA 4DV2Q 3ZJYC 2LS01 2Y0SB 3PO2G 4RCOA 3PMFA 1BOSA 2F1MA 1JICA 3HOXH 4GN4B 5CR3A 3A7AB 3OWEB 4K0KL 3CCSA 4EGVA 2I0QA 3V05A 1OXUA 4CKEA 4YHHL 2JA5H 4LFBQ 4IUQA 3X3NA 5M3FB 4XT3B 1JB7A 1I4XA 4A93B 3MAQA 4P71A 2Q8TA 2EQSA 5LMUQ 1ENAA 1VQ8A 1PRTF 3QB3A 4JG2A 5NUCA 2L9HA 4AIMA 1LTGD 3HG9A 1LTLA 4A3BH 4A3MG 3PUXA 4JI4Q 4IUPA 1I3QH 2NVYH 1A0IA 1U4RA 2PMZE 4Q0FA 2K33A 3EJIA 1MJEA 3U50C 1S5FD 3FVQA 2B63B 3H94A 2ZJRA 4X66Q 2K01A 3NQTA 2ENBA 4DNIA 4BA1I 2JA7G 1SR3A 2F0FA 3W3AA 1B9MA 3HOVG 4F88A 5LL6S 2MGSA 1VQJA 3U9OA 5IYBG 4G57A 4GN3B 1G6PA 5BN3A 4PZ7A 1PFSA 2DGYA 2AQ1B 4PMCA 4IPCA 2IPKD 1YITA 4HMJA 3GTPH 2LXJA 4K0KQ 3MXPA 1WTVA 2VB2X 2JEBI 5ELNA 1S5BD 2WKCA 3A8JE 4YHHQ 3QJYA 1N34L 3KF6A 5CORA 4U68A 3BG3A 1EQTA 2RQXA 1MSGA 2R3ZA 3E6ZX 2F52A 2SNSA 2A6ED 1IL8A 3MFGA 3I2ZA 5CV8A 1KHIA 1SAPA 4JBMA 2K04A 2EJFC 3BS1A 3CQZH 3LWEA 1TWGB 5M5XB 3M3YB 3I8ZA 4Y7NB 1AP0A 4B3ML 3MXNB 3PIOA 1E22A 1WYDA 1SBBB 3S2DB 1GJXA 3M85A 4HMIA 4WJ4A 1JORA 5M5WH 1PH3A 1VQEA 4HJAA 4K2LA 1GUSA 4TVAB 5FOBB 2NVXB 1C4QA 1F9SA 1ESFA 2L4NA 3NEMA 2HD3A 3EBEA 2IW3A 4JI7L 2OQ0A 2IHEA 3EROA 3LWUA 3S24A 1TWFB 1PH6A 3OIQA 2QDLA 1AEXA 4DA2A 3DLLA 4NXML 3R3OA 1F2MA 4HN7A 5C44B 1BCPF 4L5SA 1PRTD 2JN4A 2WB1B 4FXDA 2BA0A 1D7QA 4A3FB 1GKHA 3A54A 3H0GB 5BR8L 4BY7B 1K0SA 4JV5L 1PH7A 2RBMA 3HOZG 1U5KA 3BDCA 1X3FA 2F3IA 4F8MA 4B9WA 2Z8LA 3G6EA 4GKJQ 1D5ZC 1VQCA 2KJXA 1N34Q 5FO8B 2MJ8A 1JC7A 4PV1C 5JOBA 1I4HA 4NXNL 4HJ7A 2YTVA 3I4LA 3D3RA 1EY8A 1RJTA 1G91A 1EY7A 3KYHC 4HIOA 5E3FA 5M3FG 1CUKA 1O7ZA 3K0YA 1VQBA 1E1TA 5JEAJ 5KRUA 4GNXB 1HCZA 3EA6A 1C9OA 1HUNA 4B3MQ 4IJLA 1FR3A 1FGUA 1JWUD 3F8TA 1QOHA 5IGGA 5JPMC 1B3AA 2B29A 3TEHB 3W1BA 3OHXC 5CV9A 3FPUB 3S1QB 3CMEA 5JVG3 1F9PA 4RGMA 1EOTA 3CCEA 4XQQA 3SEBA 4JI7Q 1EWIA 3ND9A 2A5HA 3DM3A 1TVXA 3I4MG 3MHBA 3OPOA 4BS9A 5ELOA 2KEEA 4NXMQ 2ZTEA 2XRSD 5CMDA 1EY5A 1O7IA 3FHWA 5GAGC 1WCMH 1CZGA 3K5OA 2K52A 1VQFA 5FJ8G 3HKZB 5BR8Q 5HGQA 3U58A 3NTHA 4JV5Q 1QE6A 5ISRA 1IL2A 5C4XB 2EYOA 2E2JH 3S16B 5J39A 1PH2A 3GP7A 1JCKB 3S15B 4ALPA 4POFA 4NXNQ 3ICEA 2X69A 3GD7A 4KY5A 1QUQA 4KD4A 4YIJA 3MA2B 5LMNL 1CKNB 3GTKB 2D2CC 1D2BA 1UE6A 3RZOB 1NMGA 4HSVA 3RUZA 3ULLA 3I4NH 2K5NA 1EIYB 1CSQA 1KABA 3S2HH 4K5WA 5A2QL 1Y1VH 2A6HD 3CPFA 3F2UA 5C3EB 1TWHB 1TR5A 3K5NA 1MI2A 1OXVA 1EEFD 2LXKA 1B7YB 4R4CA 1WTPA 3QOJA 3DEOA 1V1OA 1NY4A 2E76C 1YNXA 3SK8A 4QQBX 1RCVD 4O0AA 3PV0A 2D0PA 4FF3A 4ZRZA 4I65A 1EWHA 2NZHA 1IBLL 4DFAA 3OYYA 1XNRQ 2F0KA 1CA6A 4KD3A 2WACA 3AMUA 3PSIA 5IYDG 2BE5C 1WTOA 4LF8L 3Q0AA 2R93B 1QZGA 1LM0A 1CA5A 3J7AF 4A3IG 4LW1A 1Y8NB 2HQEA 4A3CH 4IURA 2IX1A 4LUZA 3P75A 2EZVA 3PO3B 1B44D 1K8MA 2VB3X 1WTWA 1DJRD 3GTOH 2PMZB 4ZUIA 5LMNQ 3AEVA 1Y1WB 4LF4L 1TS2A 2YTXA 2RHQB 4UAIA 3UDXA 4DR5L 1O78A 5C3XA 2RKSA 2AHOB 2PNHA 1TY2A 3I56A 1S5DD 1YHQA 3GTLH 3CCRA 5D65A 3CCQA 5LL6X 2I46A 5EKIA 3ERQA 3S2DH 3QOLA 4DAYA 1VDZA 1PVOA 1R9TB 1B50A 3VR4A 4JI5L 3C2PA 1HR0L 1SJHD 3RN5A 1IBLQ 4A3KH 5CV7A 1EY4A 3CKIB 4DK6C 4IPHA 2JE6I 1YEZA 4HJ9A 3K81C 1BCPB 2F0HA 1S4ZA 1SMYC 5IP9H 4LF8Q 3HOYG 2Z0SA 1FJGQ 5D3IB 4GLAC 1E2WA 5IWAL 1N36Q 3QWNA 2HT1A 3H0GH 4CJ0B 1QVCA 4RGTA 1NBWA 1FGBD 4NDXA 4A3EG 5DM63 4V190 2VL6A 3D6WA 3DMUA 3F1ZA 4LF4Q 1D5XC 3KLRA 2EJMA 4ILWA 1XX8A 4DR5Q 4B3TQ 2N88A 3H3VC 2XTIA 5DNFA 4B08A 1B53A 1EY9A 1Y8OB 1PZJD 1Z47A 1PH8A 1HNZQ 4DR1L 3BVMA 4KJNA 1H9RA 5E7NA 4JI5Q 2RSNA 1STBA 2PW7A 1XYIA 1DD2A 4GOPB 1SE2A 1Q7YC 1BR9A 1J5EL 2NVQH 3CHBD 5L37A 2DJGC 1RTOA 4BBSB 2WV6D 4IOAA 3Q23A 1WTRA 3CP0A 3NTKA 1SNQA 3LNNA 2IT1A 4H7BA 2EE1A 5IWAQ 2R6GA 2CHBD 1HR0W 1SRUA 3BDLA 4APVA 2N3SA 5IP7H 3DWQA 3T1HQ 4KLKA 2RF4A 4JI6L 3PIP3 3KF8B 1JWSD 1YNJC 4B3RL 2E2HB 2SNMA 3MEFA 4KN7C 4DR4L 4G7ZC 4A4IA 4DUYL 1H9SB 1B4OA 3MXNA 5JAVA 1S5ED 3MFYA 1KRTA 4A3JG 1VQOA 3J81j 2FINB 3T4AC 3UE1A 1PV4A 4OIKA 5A35A 3TP7A 2R7ZB 1VQ6A 3RLNA 1E2ZA 2ZTCA 2AWNA 4RHRA 3PO2B 1HZAA 1YJ9A 5EGTA 3VDYA 2PI2E 2OTLA 4CBVA 5AFWA 2PQEA 1Q82C 3OSOA 1SYGA 2J0TD 3CMAA 3S1MH 1J5EQ 1C48A 3VR2A 3J81c 2MUYA 4DXGA 1KAAA 4DR6L 5C4HA 3KFUA 2QF7A 4BBRH 1PMRA 2F3WA 4FDBA 1KDCA 1VQIA 2JJQA 3SVMA 1RTNA 3HEJA 1EY0A 4XQNA 5IGFA 2JYOA 1OTCA 1EU3A 2AWOA 4A3MB 2P5ZX 3HKSA 2A69D 5IGBA 2K75A 5DM73 4OO1G 2KEDA 2EIFA 3VYRA 2G9HD 3OOCA 3K6OA 1Q3LA 3QIAA 4B3RQ 4LAAA 1UUPA 4DR4Q 4GNXA 4Y52H 1UEBA 3J80L 1Q1EA 1PH9A 4L8JA 5T1IA 3N52A 4ZKBB 5A2QE 3BYTB 4GNXC 2ZT9C 4IFDJ 1STAA 3IFTA 1ASZA 1YI2A 3L0OA 4G7OC 1X6OA 5JEAH 3NHHA 2K5WA 4R4TA 2D62A 1SFOB 5C6AA 4FP5D 1KRSA 2EXDA 2NWGA 3EIVA 3JAMc 5E1FA 4IFDI 4MTNA 5BN5A 2ZJPA 1QB5D 2MHVA 1R9TH 2I5MX 5C0XG 1QNUA 5FLMG 2F0UA 4C3JH 2QA4A 3BU2A 2CFMA 3TMEA 4DR6Q 1ICWA 2JA8G 3HOWG 1G6ZA 4ZAIA 1N8RC 2PNRC 4DR7L 2NVTB 2Z6BA 1WD0A 5KIXA 2MFIA 2AQ3B 5CV6A 4GN5A 3EQLC 2F0NA 3CAMA 2A1AA 4JC0A 2B8GA 2ID0A 1D5MC 5CGKA 1CKNA 4Z9CB 1PRTC 2K32A 4GZYC 3M4OH 4BY1B 1YIJA 1WVLA 5FLXL 2R7DA 5M5YH 1E1OA 1LLRD 2RCFA 3HOXG 2KQ3A 4OELB 2WAQG 1KDBA 3CU7A 3MEHA 4X3UA 3KUPA 1IYJB 2L1BA 2GVBA 3HOUH 1W2BA 3ITPA 4QL5A 2Q2UA 1X32A 1B8AA 2MO1A 2Q8RE 1HPCA 3C1EA 2B2VA 4DAVA 4Q5VA 3BVGA 5JJLA 2IX0A 5BN4A 1UAPA 5IT9E 3TN2A 3AB9A 2B2VC 1SJED 4FXKC 2BDOA 1FNVA 3HOZB 1DOMA 1EIHA 4YWKA 2AUJD 1ESRA 3W1GA 4A3BG 1UNSA 4UPAA 1QZHA 1BF4A 1W3SA 2BA1A 4QGUA 4A3DH 4K5VA 1Z7TA 3STBC 1K8GA 1B70B 1N32L 1XMQQ 4DR7Q 3P1HA 2R92H 1BBWA 4A75A 1GVPA 2AMCB 1RHPA 4DAMA 5I9OA 1M90C 2F03A 4HEDA 1LT4D 2VUMH 1X65A 2E2IB 1JQYD 4DPGA 2K5HA 3NXWA 1K8AC 2NN6G 1L0YB 4LFCL 4DV6L 4OGQC 1BVSA 3VR3A 5E4XA 2X6LA 4JI3Q 3DWAA 2IJ0A 5ELCA 1GHJA 3FPPA 2F4IA 3NSWA 2Q2HA 2ZM6L 2EYHA 3PQIA 2ZJQA 1WFQA 3I4MB 2PO4A 1LUZA 1D1IA 5JJIA 1DCZA 2JSOA 1O7YA 1STNA 3K80C 4KKTA 1B9NA 1RF2D 2B2UA 2C9OA 3BZKA 4ODGA 3S1RB 1P8LA 2B2UC 5CV4A 3ONAB 3UDFA 3CRLC 2IL8A 2F0GA 2EYLA 4HCSA 1BCPC 3TRZA 3C1FA 1AFPA 1EWCA 1JWMD 1TWAH 1EIFA 1PTOB 3ND8A 4ZLTF 1YZ6A 3I90A 1G51A 1QVGA 1N32Q 1X55A 3GQBA 1K83B 3G71A 1SNDA 3M7GA 1YNND 2F0QA 1Q8KA 3EVQA 3FEWX 2OF1A 1CKOA 4C3IH 2FMCA 1N33L 4L63B 4JYAL 4DV6Q 3NENA 1ET6A 1WD1A 4F87A 1K28A 4DF7A 4OWXB 1TWCH 2JXMB 3BYYB 2JA7H 1UE5A 1SE4A 3NQIA 4HSPA 2ZM6Q 3S17H 1EIGA 4BY1G 1STEA 3NWSA 4M1UB 4DKAC 4RA8A 5EPLA 3HOVH 2OQKA 1BDOA 4O2DA 4CDEC 3I73A 5KYLA 2EY5A 4GOPA 1HQMC 2K6AA 2FXQA 2CCZA 4L5QA 1H9MA 3PF5A 1K0RA 3NUCA 3CF5A 4GOPC 4A3IB 2G9DA 1CTMA 1OXTA 3E9IA 4JI1L 3RLFA 1FD7D 5FO7B 4ZCKA 2D0OA 5F2DA 1PYWD 1SNMA 3A5ZB 1QWYA 2PZUA 2R61A 1KNEA 2MNAA 4RH6A 2JA6H 1CKMA 4UP7A 3KLSX 3I72A 3KF8A 4IPGA 2HHHL 2WKDA 3RLOA 1EQQA 3S1NB 1H9SA 3HS0C 1FVIA 4KV6A 3J80E 5K5PA 4MTKA 1YJNA 1X3PA 3PIPA 2EYJA 2OTJA 4B9XA 4RKBA 3BZDB 3TQYA 2A68C 2KCNA 2WAQE 5FO9B 3WDNA 4N8FA 3D31A 4EVOA 3CCMA 2QCPX 5J22A 3O13A 5KNCA 1KL9A 2E75C 2KHJA 3FKIG 5KNDA 4KN4C 5M3MB 3HOYB 3PCOB 2XNAC 1GXDC 3OW7A 4O1NA 4JI2L 2MQHA 1Q8IA 2NUCA 1K3RA 3HP3A 3KOJA 4JI1Q 1PH5A 2NZ1D 4JVZA 2NTSA 3I4NG 1EQVA 1YVCA 4IN3A 1JOOA 4DXFA 1Y1VG 2L5TA 5I2YA 4X64L 4A3EB 3D4RA 2VXWA 3E5SA 3WOFA 4R4QA 3M7NA 4BXXH 2HHHQ 2F3VA 5M3FH 1I6HB 1QNKA 3MXUA 1PRTB 4A93H 1QCBD 5FLXE 1IYUA 4PNYA 4HAEA 5EBCA 2VY3A 4X65L 2KCMA 2VQFL 1EL0A 2V4DA 4DV5L 1JOKA 5IODA 4QF4A 3F2DA 1M8AA 1VF7A 3GV3A 4ME3A 1C0AA 4YY3L 1DONA 3J81i 4LF5L 2N8NA 1DM0B 4IFDH 3H3VH 4IPDA 1SYFA 1JE4A 1ZYRD 2B63H 4H44C 5EQ0A 3EFXD 2YU9B 4JI2Q 2B2TA 2VS1A 2LKVA 2HCCA 3HRZC 2I5HA 1GUOA 2KHSA 2LFNA 1F2YA 1DOLA 5COYA 3M4PA 1STHA 2B2TC 1I94L 4H02A 1J9OA 1XPOA 1LT5D 4G4KA 3S14B 2EY1A 3PUWA 1MIUA 1I50B 2EXZA 3PUZA 4C2MB 1VQMA 2XWBB 2K28A 4DAPA 5C4JB 3VR6A 4A3JB 2RHSB 5CC4A 1RL2A 4WJ3M 4XIGS 2E8GA 1KC8C 4A3KG 1GD7A 2K14A 3JAMi 1FL0A 2KENA 1EOVA 4X65Q 2VQFQ 1IXRA 4DV5Q 4CKCA 1GO3E 2HIVA 2O4XA 2ZTDA 1LO5D 4YY3Q 4LF5Q 1TWGH 4HCEA 1SYDA 2GA4B 5M5XH 3VYSA 3M3YH 1Q90A 3FRPB 4Y7NH 4H0LC 4XT1B 1CHQD 5JPNC 2VQEL 1K8OA 3A7LA 5IT9L 2SDFA 1E2VA 1WI5A 2NVXH 2UUAL 1XPUA 2EY6A 3BJUA 1PYSB 1F9QA 1C8CA 1YHAA 4A3IH 1I94Q 5M3MG 1TWFH 1VMCA 3NELA 4AYBG 1X3GA 4C3HB 5C44H 4GLVB 5LHY1 4N9PA 2K05A 4LF6L 1VQNA 2ALYB 4A3FH 3DXJC 1PLFA 1G291 3X3MA 4BY7H 4NPSA 4QUFA 1LTBD 5DAUA 3IRBA 3J7AV 4FNFA 4JK1C 3T53B 4QJFA 3GTQB 1PH1A 1YHBA 2CW0D 2VW9A 1SNOA 3PUVA 1L1OB 4QCLA 5H1SE 2UU9L 2KCTA 2NZOA 1BXTA 1NR2A 4QIWE 1SMXA 3K8AA 1T5EA 1MGSA 3TS0A 2PW5A 3KDFB 3B6YA 4EQ5A 4R4OA 4OL7A 5IP7G 1B2TA 5G3LD 3RZDB 4A76A 1HTLD 4RKLA 4E6IA 3K59A 2VQEQ 2JA9A 3VYUA 4FF2A 3GTMB 4LF7L 3NBHB 2JA8B 3HOWB 4FYDA 1EY6A 4MN3A 1HR0Q 3SK5A 3GTGB 2FJ2A 4CDCC 2E74C 3DUZA 5E4WC 3S1QH 3F2BA 2QDBA 3L7ZC 3URYA 1RIPA 3TSSA 1XXGA 3D6CA 3K7AB 5I6WA 4R4IA 1PTOC 2ASBA 3T16A 1V8QA 2NB0A 1Q86C 3W5OA 1JMCA 3TP6A 3GTJB 4LF6Q 4A3GB 4R9WA 4X3TA 4L6TB 1KDAA 3DWPA 2RCNA 2Z9HA 4PMWA 4HTHA 1HNWL 2CVRA 3HOXB 5C4XH 3QO2A 1VQ7A 2WAQB 3S16H 4NMZA 1STYA 2R7FA 1CZWA 5CV5A 3S15H 3WWVA 2JA5B 2UU9Q 4BA2I 1A8VA 2MP1A 5GADC 1TIID 2PI2A 3SDZA 4JI0L 4BBRG 3CCJA 3GTKH 4B3SL 3RZOH 4GS3A 4A3BB 5IOCA 5IYCG 2N49A 2KA7A 4XXEA 1KNAA 5C3EH 4DR1Q 1TWHH 1I3QB 4N8X1 2NVYB 4DGZA 3NE5B 5HURA 4LF7Q 3OW2A 4AQYL 3MC0B 1D1KA 3H91A 1O80A 2NTTA 4EQOA 4J1MA 3LGJA 2FMMA 3TP8A 2BE5D 5KEEA 4DR3L 3K57A 4WJWA 1VQKA 1BO0A 2KHIA 1HXYD 2H1EA 4OXPA 2IY5B 4IO9A 5JEAG 2B2WA 3KJPA 1EUJA 1UE7A 1HTPA 2R93H 3IAYA 3I4OA 1I6VC 2B2WC 3NPPA 3MXGA 5K36G 1AE2A 4JI6Q 1V9PA 4TSSA 1HNWQ 4OHJA 3GTPB 1LABA 4C3HG 2BDNA 3CD6A 1SE3A 2UUCL 1VCIA 4PZ8A 1WOCA 1W6KA 4C3JG 3PO3H 1GOZA 4DUYQ 1VF5C 3JAME 4P73A 1EYAA 4JI8L 1BUVT 4JI0Q 2WIIB 3WOEA 5T1GA 2M9VA 1Y1WH 5C3WA 4B3SQ 3F2CA 1EZ8A 4JOIC 1VQ4A 4DUZL 4G7HC 3CQZB 3L9AX 4X6AH 2A6EC 2PZTA 1P16A 2UXDL 4DN4M 4ZKCB 3C46A 2L15A 3J7YW 3K58A 4KY7A 1E24A 2EOTA 4K2KA 4AQYQ 3H3VI 1ET9A 2Z6KC 5M5WB 2YYZA 4HIDA 4PG3A 4AYBE 4HR7B 3OWFA 3NTIA 4DR3Q 1CT1D 2CKZB 1W6JA 2C35B 3Q8DA 3HOUG 1PDQA 1AN8A 4OO1H 2ICEC 2WP8J 3KBXA 3V96A 4YCWA 4KI0A 4DNTB 4EQPA 4UP9A 1X56A 4HJ5A 1A3VA 3I3CA 3K5LA 1HUMA 1LV9A 3IFDA 1SYBA 1GHKA 1FYCA 4A3GG 1X3QA 2UUCQ 1II3A 1ENFA 2HDMA 2DNCA 2XWJB 1PH4A 1ICFB 4IUUA 4QMGA 5EPJA 4JI8Q 2PPBC 3ZYYX 3C3LA 1HHVA 1YJWA 5C5MA 3LX0A 4P72A 2KOLA 4J15A
chains in the Genus database with same CATH topology
2SEBD 2HDLA 3GO5A 2Q8IB 2FFKB 1RDPD 1TS3A 4KMUC 2K5QA 5C0XH 4RFBA 2A74C 2O5JC 2TMPA 5IIFA 3T13A 3TBIB 4CKBA 1GUWA 4C1NI 3D4DA 5EKKA 4RGOS 3TP5A 1IW7D 1TT2A 5JVH3 5C4ZA 3SXHA 3P20A 4FXGC 4QIWB 1YNJD 1LTID 2E2JB 4ID6A 2ICIA 3VYTA 5EBDA 3FKIB 3R93A 5CBEE 4OIJA 3DM1A 2DNEA 2SOBA 4KHZA 4ULLA 2B8FA 3I4NB 3S2HB 2NBFA 3Q6SA 1CQVA 4K8JA 1UEAB 1Y1VB 4C3IG 2ZXOA 3T51B 5EPKA 3W2DA 4N9TA 2VNUD 2PZWA 1G2SA 1DYQA 3HGBA 3GV6A 2A6HC 3E0JA 1ILQA 1M4VA 4ZK9B 1ZYRC 5IGDA 1JOQA 4KK7A 2KUMA 2RDGA 1LACA 2MPMA 4KKSA 2EJGC 2XRQD 1LT3D 1PFBA 2NN6H 3VA7A 1AZQA 3IL8A 2F0IA 3MTSA 4KJOA 3RMHA 1GUNA 1ZKOA 5FK9C 4KHVA 3AU7A 5ELDA 3NP8A 5HGTA 1V43A 3GTOB 1CM9A 2F0PA 4PMBA 5ELBA 3R2TA 1U4PA 3NBHA 5EKLA 1SSOA 2IWHA 2F0SA 4NKLA 3G6JB 1CQFA 2QILA 2BCOA 2EYMA 1QJOA 3GTLB 1H9KA 1U4MA 1TU2B 2M2LA 1LT6D 3A8IE 4K8IA 3R8BA 5EJWA 2L0CA 4A3KB 5D14A 4V0BA 1NAPA 4X3SA 1LTTD 3R2IA 3I70A 4K6DA 3MVVA 2PYKA 4IUTA 4R8IA 2N55A 3H6MA 1XTCD 1PXUA 1BBXC 1NUCA 4IUVA 4J8QA 3U9SA 1D6EC 2CW0C 2Z4HA 3J81L 4C1NK 1A3UA 4J6HA 4AYBB 1AZPA 3TDQA 1A15A 1B1ZA 1IKMA 1CI3M 1DZ1A 1MBYA 2TSSA 1TS5A 1Y69U 4CJ2C 4LMQD 2F0DA 4F7XA 4K14A 3OMGA 4IFDG 2NVQB 3SHLA 1PFNA 1O7LA 5ELEA 3SE0A 1LTAD 2KCCA 4RAUC 4OO1I 4S3SA 1G8ZD 1ZXTA 2L11A 5C5LA 1CK1A 1HQRD 4CGYB 2QKIC 1WTQA 1KLUD 4ZYSA 1PZID 2ZXRA 4LK1C 1SEBD 1HA6A 1CFMA 3JAML 2OXPA 2PCFB 1TS4A 1H9JA 2EVBA 2LY7A 2I07B 2J4XA 5C0XJ 4NP5A 4QB4A 3OIPA 2H4OA 2DN8A 1RKNA 5CBAE 1PZKD 2D9UA 5DEHA 2F0JA 1BCPD 2D5DA 5C0XI 2O2LD 2AQ2B 1Q12A 3H09A 5G3LF 3NBIA 1I4RA 2RSOA 3SR1A 4K6LA 2C5CA 1SYEA 3DEPA 3FMCA 3S1MB 3Q24A 2NYZD 2HCIA 1PTOH 4RWSC 1F2ZA 2J7ZA 2F0OA 1RD9D 4DNRB 4CJ1B 4X3KA 4BBRB 4JBWA 3OMCA 5FKAC 1V1PB 3QG1A 3RD4A 2Z1CA 4P2CB 2K5DA 2LMCB 5KYIA 2A69C 4RHSA 4FO2A 4TRDA 3MWYW 1PFMA 1L0XB 5I4DA 4IQZA 1S5CD 5JJZA 1Z6HA 4CHTB 3PUYA 3VR5A 1R4QB 4I7ZC 1HFNA 4TQUS 2F0EA 5D3DA 4DK1A 2K03A 1IHZA 2K7VA 2EYPA 1Q1BA 2F0WA 4BWGB 4U673 1NSNS 4MIUA 1ML0D 3KBGA 1BQQT 1EYCA 1LTSD 3NK9A 2F0LA 5TSSA 2CQAA 1OXSC 4C3JB 3D4WA 2E2DC 4K5XA 1EEID 3BDOA 1OXXK 4TKOB 2NN6I 3DHQA 1T5XD 4IZ8A 3A55A 3Q22A 1F77A 2JEAI 2M00A 1DXMA 2EY2A 2A68D 2EPBA 3L3OC 1A2TA 4KY6A 5I6YA 3M4OB 1A3TA 1QG7A 1TKWB 2IX3A 1IYVA 3SK6A 5M5YB 4WFN3 2O5IC 3PIO3 2RDFA 4ZUJA 2XVSA 3UI2A 1E0BA 4PQXA 2XN9C 3HOUB 1VMPA 1Y8PB 4FF1A 2K1BA 4QUCA 5J1ZA 4WRDA 1SXTA 4ZQ3A 1F9RA 2AUKA 1QILA 3MZ5A 5KNBA 1GUGA 1RODA 1F2LA 1A2UA 4H13C 2L12A 4RCNA 4A3DB 1I4QA 4XDXA 1EU4A 1KTKA 1J8IA 2R92B 1TY0A 5M9OA 1FNUA 2VUMB 1SDFA 3KK7A 3D8GA 1IW7C 1I4PA 3NWTA 1EFID 1R4PB 3J81E 1BNZA 3KLSA 4O42A 3FDTA 4XQJA 1NCVA 4FVMA 3A56A 4M8AA 2L55A 1GUTA 1A6XA 3CRKC 2OEOA 2BOSA 4NW2A 1DOKA 1ONLA 2KECA 2FHTA 1SNPA 1XWEA 1NR4A 4KTAA 1JR0D 3M4YA 1ILPA 1HA5A 2JP1A 2EDGA 4FF4A 2XIWA 5KGUA 1TWAB 3G7LA 4EQNA 2RA4A 1PTOF 1KLGD 1MSHA 4R8NA 3HZXA 1ENCA 4LJZC 4MHEA 1YNNC 4C3IB 4XTCS 2A73B 2F0MA 1SNCA 1OO9B 4IALA 3I91A 1WTXA 2RDHA 1AW7A 5CYUA 4WORA 1TWCB 3VA5A 4XYQA 4XYOA 5I2XA 2JA7B 3S17B 3TZUA 3BVZA 2WINB 2HUGA 3HOVB 1JB3A 1HRJA 2OT2A 1SMYD 2DY7A 1HFGA 3N6RA 5K36H 5I9PA 2Z4IA 3P7JA 2X6GA 1FNWA 3TZDA 2B39A 3A8KE 1EYDA 1EZ6A 2JA6B 1STGA 1TQOA 1LTRD 1U4LA 1G2TA 1SYCA 1IKLA 1U9RA 1ZEQX 4UDUC 5IGCA 4DU9A 2KVMA 4IUNA 2EYFA 2RVLA 4ME5A 3S9WA 1I4GA 2XSCA 1MD2D 3T56B 1CHPD 4ABNA 4DK0A 3IKJA 1PTOD 5ELFA 4RGNA 3K5MA 2ZXPA 2B2YA 5IGEA 3V2TA 4C56C 1WCMB 1V1PA 2DY8A 3SK4A 2B2YC 2F0VA 2QEJC 4KKUA 2F0TA 2LS01 2Y0SB 4RCOA 3PMFA 1BOSA 2F1MA 1JICA 5CR3A 3A7AB 3OWEB 4EGVA 3V05A 1OXUA 4CKEA 4IUQA 3X3NA 5M3FB 4XT3B 1I4XA 4A93B 3MAQA 2Q8TA 1ENAA 1PRTF 3QB3A 5NUCA 2L9HA 1LTGD 3HG9A 3PUXA 4IUPA 1U4RA 4Q0FA 2K33A 3EJIA 1S5FD 3FVQA 2B63B 3H94A 2K01A 3NQTA 2ENBA 4BA1I 2F0FA 3W3AA 1B9MA 4F88A 5LL6S 2MGSA 3U9OA 4G57A 5BN3A 2AQ1B 4PMCA 2IPKD 4HMJA 3MXPA 1WTVA 2VB2X 2JEBI 1S5BD 2WKCA 3A8JE 3QJYA 5CORA 4U68A 3BG3A 1EQTA 2RQXA 1MSGA 2R3ZA 3E6ZX 2SNSA 2A6ED 1IL8A 3MFGA 5CV8A 1SAPA 2K04A 2EJFC 3BS1A 3LWEA 1TWGB 5M5XB 3M3YB 3I8ZA 4Y7NB 1AP0A 1GJXA 1SBBB 3S2DB 3M85A 4HMIA 1JORA 4K2LA 1GUSA 5FOBB 2NVXB 1C4QA 1F9SA 1ESFA 2L4NA 2IW3A 3EROA 3LWUA 1TWFB 3OIQA 4DA2A 1AEXA 3R3OA 1F2MA 4HN7A 5C44B 1BCPF 1PRTD 2WB1B 4FXDA 2BA0A 4A3FB 3A54A 3H0GB 4BY7B 2RBMA 3BDCA 4F8MA 4B9WA 2Z8LA 1D5ZC 2KJXA 5FO8B 2MJ8A 1JC7A 4PV1C 5JOBA 1I4HA 3I4LA 3D3RA 1EY8A 1RJTA 1G91A 1EY7A 5E3FA 1O7ZA 3K0YA 5JEAJ 5KRUA 1HCZA 3EA6A 1HUNA 1FR3A 1JWUD 1QOHA 5JPMC 5IGGA 1B3AA 3OHXC 5CV9A 3FPUB 3S1QB 5JVG3 1F9PA 4RGMA 1EOTA 4XQQA 3SEBA 3ND9A 2A5HA 1TVXA 3MHBA 3OPOA 4BS9A 2KEEA 2XRSD 5CMDA 1EY5A 1CZGA 3K5OA 3HKZB 3NTHA 1QE6A 5ISRA 5C4XB 2EYOA 3S16B 5J39A 3GP7A 1JCKB 3S15B 2X69A 3GD7A 4KY5A 4KD4A 4YIJA 3MA2B 3GTKB 2D2CC 1D2BA 3RZOB 4HSVA 3RUZA 1KABA 4K5WA 5A2QL 2A6HD 3F2UA 5C3EB 1TWHB 1TR5A 3K5NA 1MI2A 1OXVA 1EEFD 1WTPA 3QOJA 3DEOA 1V1OA 2E76C 3SK8A 1RCVD 3PV0A 4FF3A 4ZRZA 4I65A 1EWHA 4DFAA 2F0KA 1CA6A 4KD3A 2WACA 3AMUA 2BE5C 1WTOA 3Q0AA 2R93B 1CA5A 3J7AF 1Y8NB 2HQEA 4IURA 2IX1A 3P75A 2EZVA 3PO3B 1B44D 1K8MA 2VB3X 1WTWA 1DJRD 2PMZB 4ZUIA 1Y1WB 1TS2A 4UAIA 1O78A 5C3XA 2RKSA 1TY2A 1S5DD 5D65A 5LL6X 2I46A 5EKIA 3ERQA 3QOLA 4DAYA 1VDZA 1R9TB 1B50A 3VR4A 3C2PA 1SJHD 5CV7A 1EY4A 3CKIB 2JE6I 1BCPB 2F0HA 1S4ZA 1SMYC 5D3IB 1E2WA 3QWNA 4CJ0B 4RGTA 1FGBD 4NDXA 5DM63 4V190 3D6WA 3DMUA 1D5XC 3KLRA 2EJMA 4ILWA 1XX8A 2N88A 3H3VC 5DNFA 4B08A 1B53A 1EY9A 1Y8OB 1PZJD 1Z47A 3BVMA 4KJNA 1H9RA 2RSNA 1STBA 2PW7A 1XYIA 1DD2A 1SE2A 1BR9A 3CHBD 1RTOA 4BBSB 2WV6D 3Q23A 1WTRA 3NTKA 1SNQA 3LNNA 2IT1A 4H7BA 2EE1A 2R6GA 2CHBD 3BDLA 3DWQA 3PIP3 1JWSD 1YNJC 2E2HB 2SNMA 4KN7C 4G7ZC 1H9SB 1B4OA 3MXNA 5JAVA 1S5ED 3MFYA 2FINB 3T4AC 4OIKA 5A35A 3TP7A 2R7ZB 1E2ZA 2AWNA 4RHRA 3PO2B 5EGTA 4CBVA 5AFWA 2PQEA 3OSOA 1SYGA 2J0TD 1C48A 3VR2A 2MUYA 4DXGA 1KAAA 5C4HA 2QF7A 1PMRA 2F3WA 1KDCA 3SVMA 1RTNA 3HEJA 1EY0A 4XQNA 5IGFA 2JYOA 1EU3A 2AWOA 4A3MB 2A69D 5IGBA 5DM73 4OO1G 2KEDA 3VYRA 2G9HD 3OOCA 3K6OA 1Q3LA 3QIAA 4LAAA 1UUPA 3J80L 1Q1EA 4L8JA 5T1IA 3N52A 4ZKBB 5A2QE 3BYTB 2ZT9C 4IFDJ 1STAA 3IFTA 4G7OC 5JEAH 3NHHA 2K5WA 2D62A 1SFOB 5C6AA 4FP5D 2NWGA 5E1FA 4IFDI 5BN5A 1QB5D 2MHVA 5C0XG 1QNUA 2F0UA 3TMEA 1ICWA 1G6ZA 4ZAIA 2PNRC 2NVTB 1WD0A 5KIXA 2AQ3B 5CV6A 3EQLC 2F0NA 2B8GA 2ID0A 1D5MC 5CGKA 4Z9CB 1PRTC 2K32A 4GZYC 4BY1B 1WVLA 5FLXL 1LLRD 2KQ3A 1KDBA 3CU7A 3MEHA 4X3UA 3KUPA 2L1BA 3ITPA 1X32A 2Q8RE 1HPCA 3C1EA 2B2VA 4DAVA 4Q5VA 3BVGA 2IX0A 5BN4A 1UAPA 5IT9E 3TN2A 3AB9A 2B2VC 1SJED 4FXKC 2BDOA 1FNVA 3HOZB 1DOMA 1EIHA 2AUJD 1ESRA 1UNSA 1BF4A 2BA1A 4K5VA 1Z7TA 3P1HA 1RHPA 5I9OA 2F03A 4HEDA 1LT4D 2E2IB 1JQYD 3NXWA 2NN6G 1L0YB 4OGQC 3VR3A 5E4XA 2X6LA 3DWAA 2IJ0A 5ELCA 1GHJA 3FPPA 2F4IA 3NSWA 2EYHA 3I4MB 2PO4A 1D1IA 1DCZA 2JSOA 1O7YA 1STNA 4KKTA 1B9NA 1RF2D 2B2UA 2C9OA 4ODGA 3S1RB 2B2UC 5CV4A 3ONAB 3CRLC 2IL8A 2F0GA 2EYLA 4HCSA 1BCPC 3C1FA 1AFPA 1EWCA 1JWMD 1PTOB 3ND8A 4ZLTF 3I90A 3GQBA 1K83B 1SNDA 1YNND 2F0QA 3EVQA 3M7GA 3FEWX 2OF1A 2FMCA 4L63B 1ET6A 1WD1A 4F87A 4DF7A 2JXMB 3BYYB 1SE4A 3NQIA 4HSPA 1EIGA 1STEA 3NWSA 4M1UB 4RA8A 5EPLA 1BDOA 3I73A 5KYLA 2EY5A 1HQMC 2K6AA 1H9MA 3NUCA 4A3IB 2G9DA 1CTMA 1OXTA 3RLFA 1FD7D 5FO7B 5F2DA 1PYWD 1SNMA 1QWYA 2PZUA 2R61A 1KNEA 4RH6A 3KLSX 3I72A 3KF8A 2WKDA 3S1NB 1H9SA 3HS0C 4KV6A 3J80E 5K5PA 1X3PA 2EYJA 4B9XA 4RKBA 3BZDB 2A68C 2KCNA 5FO9B 3WDNA 3D31A 4EVOA 2QCPX 5J22A 3O13A 5KNCA 2E75C 5KNDA 4KN4C 5M3MB 3HOYB 2XNAC 1GXDC 3OW7A 4O1NA 1Q8IA 2NUCA 3HP3A 2NZ1D 2NTSA 1EQVA 4IN3A 1JOOA 4DXFA 2L5TA 5I2YA 4A3EB 3D4RA 2VXWA 3E5SA 3WOFA 3M7NA 2F3VA 1I6HB 1QNKA 3MXUA 1PRTB 1QCBD 5FLXE 1IYUA 4PNYA 4HAEA 5EBCA 1EL0A 2V4DA 1JOKA 5IODA 4QF4A 1M8AA 1VF7A 3GV3A 1DONA 1DM0B 4IFDH 1SYFA 1JE4A 1ZYRD 4H44C 5EQ0A 3EFXD 2YU9B 2B2TA 2LKVA 2HCCA 3HRZC 1GUOA 2KHSA 2LFNA 1F2YA 1DOLA 5COYA 1STHA 2B2TC 1J9OA 1LT5D 4G4KA 3S14B 2EY1A 3PUWA 1I50B 2EXZA 3PUZA 4C2MB 2XWBB 2K28A 4DAPA 5C4JB 3VR6A 4A3JB 5CC4A 4XIGS 4CKCA 2O4XA 1LO5D 4HCEA 1SYDA 2GA4B 3VYSA 1Q90A 3FRPB 4H0LC 4XT1B 1CHQD 5JPNC 1K8OA 3A7LA 5IT9L 2SDFA 1E2VA 2EY6A 1F9QA 1C8CA 1VMCA 4C3HB 5LHY1 4N9PA 2K05A 3DXJC 1PLFA 1G291 3X3MA 4QUFA 1LTBD 5DAUA 3J7AV 4FNFA 4JK1C 3T53B 3GTQB 2CW0D 1SNOA 3PUVA 4QCLA 1BXTA 1NR2A 1T5EA 1MGSA 2PW5A 4OL7A 1B2TA 5G3LD 3RZDB 1HTLD 4RKLA 4E6IA 3K59A 4FF2A 3VYUA 3GTMB 2JA8B 3HOWB 4FYDA 1EY6A 4MN3A 3SK5A 3GTGB 2FJ2A 2E74C 3DUZA 5E4WC 2QDBA 3L7ZC 3URYA 3TSSA 1XXGA 3D6CA 3K7AB 5I6WA 1PTOC 3T16A 1V8QA 2NB0A 3GTJB 3TP6A 4A3GB 4R9WA 4X3TA 4L6TB 1KDAA 3DWPA 4PMWA 4HTHA 2CVRA 3HOXB 3QO2A 2WAQB 4NMZA 1STYA 1CZWA 5CV5A 2JA5B 4BA2I 2MP1A 1TIID 3SDZA 4A3BB 5IOCA 2KA7A 4XXEA 1KNAA 1I3QB 2NVYB 4DGZA 3NE5B 5HURA 3MC0B 1D1KA 3H91A 1O80A 2NTTA 4EQOA 4J1MA 2FMMA 3TP8A 2BE5D 5KEEA 3K57A 4WJWA 1BO0A 1HXYD 2H1EA 5JEAG 2B2WA 1HTPA 3IAYA 1I6VC 2B2WC 3NPPA 3MXGA 5K36G 4TSSA 4OHJA 3GTPB 1LABA 4C3HG 2BDNA 1SE3A 1VCIA 1W6KA 4C3JG 1GOZA 1VF5C 3JAME 1EYAA 1BUVT 2WIIB 3WOEA 5T1GA 2M9VA 5C3WA 1EZ8A 4G7HC 3CQZB 3L9AX 2A6EC 2PZTA 4DN4M 4ZKCB 3C46A 3J7YW 3K58A 4KY7A 2EOTA 4K2KA 1ET9A 5M5WB 2YYZA 4HR7B 3OWFA 3NTIA 1CT1D 1W6JA 1PDQA 1AN8A 4OO1H 2ICEC 2WP8J 3KBXA 3V96A 4DNTB 4KI0A 4EQPA 1A3VA 3I3CA 3K5LA 1HUMA 1LV9A 3IFDA 1SYBA 1GHKA 1FYCA 1X3QA 1II3A 1ENFA 2HDMA 2DNCA 2XWJB 4IUUA 4QMGA 5EPJA 2PPBC 3ZYYX 3C3LA 1HHVA 5C5MA 3LX0A 2KOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTS A;  4QUF A;  1SDF A;  1U4R A;  3TZD A;  5JJZ A;  1M8A A;  3GV3 A;  2FMM A;  2HDL A;  1WTO A;  1DON A;  2FFK B;  1BO0 A;  1RJT A;  5T1I A;  3N52 A;  4ZKB B;  1G91 A;  1PFN A;  1RHP A;  2H1E A;  1CA5 A;  1HFN A;  2K01 A;  4HED A;  2K03 A;  2RSN A;  2X6G A;  4RAU C;  1XYI A;  2B2W A;  1BNZ A;  1JE4 A;  1O7Z A;  4O42 A;  3FDT A;  4IUR A;  1CM9 A;  5EQ0 A;  1NR2 A;  1U4L A;  1NCV A;  2B2W C;  2MGS A;  1G2T A;  2MJ8 A;  1RTO A;  1ML0 D;  1C8C A;  5E4X A;  1HUN A;  1ZXT A;  1MGS A;  1KNE A;  1U4P A;  2X6L A;  1SSO A;  1WTR A;  2L11 A;  1IKL A;  1WTW A;  2B2T A;  2BDN A;  2HCC A;  1B3A A;  2NWG A;  1WTQ A;  1DOL A;  5COY A;  1HA6 A;  2EE1 A;  1B2T A;  2B2T C;  4NW2 A;  3FPU B;  2KVM A;  1GUW A;  1J9O A;  2RVL A;  1U4M A;  1DOK A;  1F9P A;  1EOT A;  4UAI A;  1WTV A;  2KEC A;  2FHT A;  2M2L A;  1TVX A;  4MN3 A;  5T1G A;  1NR4 A;  2FJ2 A;  1O7Y A;  5COR A;  1ICW A;  1X3P A;  2KEE A;  4U68 A;  5E4W C;  5EJW A;  2B2U A;  5D65 A;  1ILP A;  1G6Z A;  5CMD A;  1EQT A;  4ZAI A;  2K28 A;  2JP1 A;  5EKI A;  1MSG A;  2R3Z A;  2XIW A;  2EPB A;  5D14 A;  5CBA E;  2B2U C;  4DN4 M;  1IL8 A;  2D9U A;  3ONA B;  1WD0 A;  1NAP A;  1B4O A;  3R93 A;  4CJ2 C;  4ZKC B;  2IL8 A;  3G7L A;  1B50 A;  4HCS A;  5CBE E;  1QE6 A;  1SAP A;  2EOT A;  1QG7 A;  2FIN B;  2K04 A;  4OIJ A;  3DM1 A;  2RA4 A;  3LWE A;  4R9W A;  1MSH A;  4OIK A;  4X3S A;  4X3T A;  2B2Y A;  4ZLT F;  3I90 A;  2RSO A;  3I8Z A;  1S4Z A;  1AP0 A;  4MHE A;  2CVR A;  2DY8 A;  2X69 A;  1E0B A;  2B2Y C;  3DEP A;  3QO2 A;  4IUP A;  3UI2 A;  1WVL A;  2NYZ D;  3HP3 A;  1VMP A;  2HCI A;  4IUT A;  4RWS C;  2NZ1 D;  3Q6S A;  2J7Z A;  5AFW A;  4R8I A;  5EPK A;  2N55 A;  4CJ1 B;  1G2S A;  3I91 A;  4X3K A;  1PDQ A;  1F9S A;  1JIC A;  4XT1 B;  1WTX A;  2L4N A;  2K1B A;  4QUC A;  3KBX A;  4X3U A;  3KUP A;  4HSV A;  4CJ0 B;  2L1B A;  2MP1 A;  1BBX C;  4IUV A;  3GV6 A;  1X32 A;  2Q8R E;  2SDF A;  1F9R A;  3F2U A;  3I3C A;  1WD1 A;  1HUM A;  2B2V A;  2VXW A;  4IUQ A;  1MI2 A;  4XT3 B;  1ILQ A;  1LV9 A;  1WTP A;  3TN2 A;  1ROD A;  3DEO A;  3SVM A;  1F2L A;  1F9Q A;  2HUG A;  1RTN A;  2B2V C;  3D6W A;  3IFD A;  2Q8T A;  2L12 A;  3IL8 A;  4ZK9 B;  1AZP A;  1X3Q A;  1A15 A;  1DOM A;  1KNA A;  2JYO A;  2HDM A;  2KUM A;  1IKM A;  1EIH A;  1HRJ A;  1ESR A;  1VMC A;  2L9H A;  2DY7 A;  2MPM A;  1EIG A;  1QNK A;  4IUU A;  1XX8 A;  5EPJ A;  4XDX A;  1PFB A;  1DZ1 A;  2N88 A;  4RA8 A;  5EPL A;  1HFG A;  1J8I A;  1BF4 A;  2KED A;  2K05 A;  3H91 A;  3MWY W;  1O80 A;  1PFM A;  5DNF A;  1AZQ A;  1CA6 A;  1HHV A;  4HAE A;  3P7J A;  4LMQ D;  2KOL A;  1Q3L A;  1B53 A;  1PLF A;  1EL0 A; 
#chains in the Genus database with same CATH topology
 2SEB D;  2R92 G;  4QY7 A;  2JA5 G;  4DUZ Q;  2HDL A;  3GO5 A;  2Q8I B;  2FFK B;  2UXD Q;  1RDP D;  1Y14 B;  1TS3 A;  4KMU C;  3AFQ A;  2K5Q A;  3UDI A;  5C0X H;  2JK8 A;  4RFB A;  2VZA A;  2A74 C;  1JT8 A;  2O5J C;  2TMP A;  4UHV A;  5IIF A;  1BBU A;  3T13 A;  3TBI B;  4CDD C;  3UDG A;  4BBS H;  1WJJ A;  2XGT A;  3CXC A;  4CKB A;  1GUW A;  3U4V A;  4C1N I;  1WTH A;  3D4D A;  5EKK A;  4RGO S;  1N9W A;  3TP5 A;  1IW7 D;  5AJ3 L;  1TT2 A;  1AE3 A;  5JVH 3;  5C4Z A;  3M4Q A;  3SXH A;  3P20 A;  4FXG C;  4QIW B;  1YNJ D;  1LTI D;  1HZC A;  2E2J B;  4ID6 A;  2ICI A;  3VYT A;  5EBD A;  3FKI B;  5IT9 c;  3R93 A;  2E2H H;  5CBE E;  4OIJ A;  3DM1 A;  2DNE A;  2SOB A;  4KHZ A;  1J6Q A;  4ULL A;  2B8F A;  1D8L A;  1B3Q A;  4JCV E;  3I4N B;  2R7Z H;  3S2H B;  2NBF A;  3Q6S A;  4A3L H;  1CQV A;  4K8J A;  1UEA B;  1Y1V B;  4C3I G;  2ZXO A;  3T51 B;  5EPK A;  3W2D A;  4N9T A;  2VNU D;  2PZW A;  1G2S A;  1DYQ A;  3HGB A;  1UE1 A;  3PO2 H;  4YWM A;  2PQA B;  3GV6 A;  2A6H C;  1HNX L;  2YTY A;  3E0J A;  1ILQ A;  1M4V A;  1X3E A;  4ZK9 B;  1ZYR C;  5IGD A;  1KIX A;  1JOQ A;  4KK7 A;  4LUO A;  2KUM A;  2RDG A;  1LAC A;  2MPM A;  4KKS A;  2EJG C;  3T1Y L;  2XRQ D;  1LT3 D;  1PFB A;  5AJ3 Q;  2NN6 H;  3VA7 A;  2Q2T A;  1AZQ A;  2UUB L;  2LSS A;  1L1O A;  1EFW A;  3IL8 A;  4OON A;  2F0I A;  4A3M H;  3MTS A;  4LFC Q;  1L1O C;  4KJO A;  4I7A A;  5IY0 A;  2HQL A;  3RMH A;  3J7Z C;  4LNQ A;  1A62 A;  1GUN A;  1ZKO A;  2Q2I A;  5FK9 C;  2UXC L;  4KHV A;  3AU7 A;  1T9H A;  3KDF A;  3PGZ A;  4GKJ L;  2V1C C;  5ELD A;  1XMO L;  3NP8 A;  5HGT A;  1V43 A;  3GTO B;  1CM9 A;  2F0P A;  2JA6 G;  2GN5 A;  4PMB A;  5ELB A;  1XNQ L;  3R2T A;  1MHW C;  1U4P A;  3NBH A;  5EKL A;  1SSO A;  2IWH A;  2F0S A;  4NKL A;  3G6J B;  3A0J A;  5IYB H;  1CQF A;  2F4V L;  2QIL A;  2BCO A;  2EYM A;  1SN8 A;  2G5D A;  1VQ9 A;  1SFO H;  1QJO A;  3GTL B;  1H9K A;  1JE5 A;  1U4M A;  3U4Z A;  4LF9 L;  1TU2 B;  1HNX Q;  2M2L A;  1LT6 D;  4JBJ A;  2AKW B;  3A8I E;  4K8I A;  3R8B A;  1SRO A;  3JC6 6;  5EJW A;  3H15 A;  1XTD A;  1VQG A;  3BZC A;  2GVA A;  2L0C A;  4A3K B;  5D14 A;  4UY8 C;  4V0B A;  1NAP A;  4P75 A;  4X62 L;  3T1Y Q;  1IBK L;  4EX5 A;  2BH2 A;  2UUB Q;  2NVT H;  4X3S A;  1LTT D;  3R2I A;  1KAW A;  3I70 A;  4K6D A;  3MVV A;  1N33 Q;  4JYA Q;  3OTO L;  2PYK A;  4IUT A;  2UXC Q;  1WCM G;  2K5V A;  1M1K C;  4R8I A;  4BY1 H;  2OCE A;  2N55 A;  1XMO Q;  3H6M A;  1XTC D;  1PXU A;  2Y0S G;  1BBX C;  1NUC A;  4IUV A;  4J8Q A;  1S72 A;  3U9S A;  1XNQ Q;  1EYG A;  1H95 A;  1D6E C;  2CW0 C;  2Z4H A;  3J81 L;  4C1N K;  2F4V Q;  4BXX G;  2QW7 A;  1A3U A;  4J6H A;  4AYB B;  1AZP A;  3TDQ A;  1A15 A;  1ASY A;  4A93 G;  1B1Z A;  1IKM A;  4DK3 C;  1SE8 A;  4LUV A;  1CI3 M;  4LF9 Q;  1DZ1 A;  1MBY A;  4CDF C;  2TSS A;  1TS5 A;  4RMF A;  3CCU A;  3HOZ H;  2QEX A;  3RR5 A;  5EAY A;  1L2F A;  4LMQ D;  4CJ2 C;  1Y69 U;  3I7F A;  2F0D A;  4IJH A;  3J80 c;  1MJC A;  4F7X A;  4K14 A;  3STB D;  1XJV A;  3OMG A;  1C7Y A;  1I5F A;  2UXB L;  4IFD G;  2NVQ B;  4X62 Q;  3SHL A;  1PFN A;  3AYH B;  4R1J A;  1O7L A;  5ELE A;  3SE0 A;  1LTA D;  2KCC A;  1IBK Q;  4RAU C;  1XNR L;  2B63 G;  4OO1 I;  4S3S A;  3ULJ A;  1G8Z D;  4JBK A;  3J7A 5;  1ZXT A;  3OTO Q;  2E2I H;  1VQH A;  2L11 A;  5C5L A;  1CK1 A;  1HQR D;  4CGY B;  2QKI C;  1LYL A;  1WTQ A;  4DV3 L;  1KLU D;  4ZYS A;  1PZI D;  2ZXR A;  4LK1 C;  1SEB D;  3KJO A;  1HA6 A;  1CFM A;  3JAM L;  2OXP A;  1X54 A;  4L5R C;  4DV4 L;  3FKI H;  2PCF B;  1TS4 A;  1H9J A;  2EVB A;  2LY7 A;  4RG1 A;  3TS2 A;  3A5U A;  2I07 B;  2J4X A;  1IBM L;  4A3C G;  5C0X J;  4NP5 A;  4QB4 A;  1PHJ A;  3OIP A;  4DR2 L;  3I4M H;  2H4O A;  2DN8 A;  3K0X A;  1RKN A;  4OWT B;  5HY6 A;  5CBA E;  1DGS A;  1PZK D;  2D9U A;  3I55 A;  1NJI C;  5FJ8 H;  5DEH A;  1JJC B;  2F0J A;  1BCP D;  2D5D A;  5C0X I;  3S1R H;  3AQQ A;  2O2L D;  2AQ2 B;  1Q12 A;  2IHF A;  3H09 A;  5G3L F;  3NBI A;  1I4R A;  2RSO A;  3SR1 A;  4X64 Q;  5FLX c;  4K6L A;  4JPB W;  3L2P A;  2C5C A;  1SYE A;  3DEP A;  4YCV A;  3FMC A;  3S1M B;  2DUD A;  3Q24 A;  2E5L L;  2UXB Q;  2NYZ D;  1YBY A;  4L5T A;  2HCI A;  1PTO H;  4RWS C;  1F2Z A;  2J7Z A;  2F0O A;  1RD9 D;  4DNR B;  4CJ1 B;  4X3K A;  4BBR B;  3FP9 A;  1K83 H;  4JBW A;  3OMC A;  5FKA C;  1V1P B;  5GAE C;  3QG1 A;  1FJG L;  5JJK A;  3CC4 A;  2CQO A;  3RD4 A;  1AH9 A;  4DV3 Q;  2Z1C A;  5IP9 G;  4P2C B;  1N36 L;  2K5D A;  5C44 G;  2LMC B;  5KYI A;  2A69 C;  4RHS A;  4DV4 Q;  2WB1 G;  4FO2 A;  4A3F G;  4DV1 L;  1MKH A;  3H0G G;  1IBM Q;  1X9N A;  4BY7 G;  4TRD A;  3MWY W;  1PFM A;  2JQO A;  1JJG A;  1L0X B;  5I4D A;  4IQZ A;  4DR2 Q;  1S5C D;  5JJZ A;  2ES2 A;  1Z6H A;  4CHT B;  3PUY A;  3VR5 A;  1R4Q B;  3G48 A;  4I7Z C;  5IYD H;  4B3T L;  1HFN A;  4TQU S;  2F0E A;  3E9H A;  5D3D A;  4DK1 A;  3E0E A;  2K03 A;  1IHZ A;  2K7V A;  2EYP A;  1S40 A;  1HZ9 A;  4MNO A;  1Q1B A;  2F0W A;  4BWG B;  5IE8 A;  4U67 3;  4LFA L;  1NSN S;  3UE0 A;  5LMN W;  1HNZ L;  4MIU A;  1ML0 D;  3KBG A;  1BQQ T;  1EYC A;  1LTS D;  3NK9 A;  2F0L A;  5TSS A;  2CQA A;  2E5L Q;  1OXS C;  2CH4 W;  4C3J B;  3K7U C;  3D0F A;  3D4W A;  3QR8 A;  1NTG A;  2E2D C;  1EEI D;  3BDO A;  3ER0 A;  4K5X A;  1OXX K;  4TKO B;  2NN6 I;  3ULP A;  3DHQ A;  1T5X D;  4IZ8 A;  3A55 A;  3Q22 A;  3S1N H;  1F77 A;  1KXL A;  3KLW A;  2M00 A;  2JEA I;  1DXM A;  2EY2 A;  2A68 D;  2EPB A;  3T1H L;  3L3O C;  1A2T A;  2Y0S E;  4KY6 A;  5I6Y A;  2KBN A;  4OWW B;  3M4O B;  4IOC A;  1CSP A;  1A3T A;  1PA6 A;  1EQR A;  1QG7 A;  3KF6 B;  4DV1 Q;  2OWO A;  1TKW B;  3HKZ G;  2IX3 A;  1IYV A;  3SK6 A;  5M5Y B;  4DV7 L;  2CWP A;  1UWV A;  4UP8 A;  4WFN 3;  2O5I C;  5C4X G;  3PIO 3;  2RDF A;  4ZUJ A;  2PQA A;  2XVS A;  3UI2 A;  1E0B A;  4PQX A;  2XN9 C;  4KHP L;  3HOU B;  2K50 A;  1VMP A;  5M3M H;  1Y8P B;  3HOY H;  2UUA Q;  4FF1 A;  1NMF A;  2I5L X;  2MO0 A;  3A74 A;  2K1B A;  4QUC A;  5J1Z A;  3PF4 A;  4WRD A;  1SXT A;  4LFA Q;  5DLQ E;  4ZQ3 A;  1F9R A;  1VS0 A;  2AUK A;  1QIL A;  3MZ5 A;  5KNB A;  4OEM B;  1GUG A;  1ROD A;  1F2L A;  5C3E G;  1A2U A;  4H13 C;  4A3E H;  2L12 A;  4RCN A;  4A3D B;  1I4Q A;  1GM5 A;  4XDX A;  1EU4 A;  1KTK A;  3TRE A;  1J8I A;  1IZ6 A;  4DV0 L;  3CCV A;  2R92 B;  1TY0 A;  5M9O A;  1FNU A;  1KQS A;  1I6H H;  2VUM B;  1SDF A;  3KK7 A;  1VQL A;  1VQD A;  2K4K A;  3CW2 C;  3D8G A;  1IW7 C;  1I4P A;  3NWT A;  1EFI D;  1R4P B;  1E3P A;  2R93 G;  4JW0 A;  3J81 E;  1JJ2 A;  1BNZ A;  3KLS A;  4O42 A;  3FDT A;  5GQO A;  4XQJ A;  4DV7 Q;  1U0L A;  4NB3 A;  1NCV A;  4FVM A;  2A19 A;  4MZ9 A;  5J3B A;  3A56 A;  2A8V A;  4M8A A;  4KHP Q;  2L55 A;  1GUT A;  1A6X A;  3CRK C;  2OEO A;  3PO3 G;  2BOS A;  4NW2 A;  2YU9 H;  1DOK A;  4HIK A;  1ONL A;  1Y1W G;  4OX9 L;  2KEC A;  2FHT A;  2N78 A;  2CWA A;  1SNP A;  1XWE A;  1NR4 A;  1HH2 P;  4KTA A;  1JR0 D;  2DJF C;  3M4Y A;  1HA5 A;  1ILP A;  3S14 H;  2JP1 A;  2EDG A;  4FF4 A;  2XIW A;  5GAH C;  1I50 H;  3M9B A;  5KGU A;  1TWA B;  2H5X A;  3G7L A;  4C2M H;  4EQN A;  4HJ8 A;  2ATW A;  4DV0 Q;  2RA4 A;  5C4J H;  1PTO F;  4A3J H;  1KLG D;  4AH6 A;  1MSH A;  1HZB A;  4R8N A;  3HZX A;  1ENC A;  2CH4 A;  4LJZ C;  1NNX A;  4JOI A;  4MHE A;  3GDE A;  1Q46 A;  5IYC H;  1YNN C;  2WB1 E;  4C3I B;  4XTC S;  3G4S A;  2A73 B;  4YWL A;  2F0M A;  1SNC A;  1OO9 B;  4IAL A;  1PYB A;  1K73 C;  1E7Z A;  3I91 A;  1L0W A;  2RDH A;  1WTX A;  1AW7 A;  5CYU A;  1SLJ A;  1XPR A;  4WOR A;  1TWC B;  2Z6K A;  4XYQ A;  3VA5 A;  4XYO A;  5I2X A;  4GLX A;  2QGQ A;  1QUQ B;  2WFW A;  3ERS X;  2JA7 B;  3S17 B;  3TZU A;  3BVZ A;  2WIN B;  2HUG A;  3HOV B;  4GKK L;  1JB3 A;  1HRJ A;  2OT2 A;  1SMY D;  4PZ6 A;  5GRO A;  1VQP A;  2DY7 A;  4HIM A;  3RNU A;  4OX9 Q;  1HFG A;  3E3X A;  3N6R A;  5K36 H;  5I9P A;  2Z4I A;  3P7J A;  2X6G A;  1FNW A;  4C3H H;  2YV5 A;  3TZD A;  2B39 A;  3A8K E;  1EYD A;  3CPW A;  1EZ6 A;  1TXY A;  4DV2 L;  2JA6 B;  4LWC A;  1STG A;  1S3O A;  1TQO A;  1V1Q A;  1LTR D;  1U4L A;  3GTQ H;  1G2T A;  1XMQ L;  2HIX A;  1SYC A;  4A3D G;  1KD1 C;  4LFB L;  1A63 A;  3SGI A;  1IKL A;  1U9R A;  4BBS G;  3HKZ E;  1ZEQ X;  4UDU C;  3CC7 A;  5IGC A;  1K9M C;  1QVF A;  4DU9 A;  5LMU L;  3J80 i;  2KVM A;  4IUN A;  4POG A;  2EYF A;  2VUM G;  1NE3 A;  2RVL A;  4ME5 A;  3S9W A;  4JI3 L;  1I4G A;  2XSC A;  1MD2 D;  4JI4 L;  1Z9F A;  5FLM H;  3RZD H;  3T56 B;  1CHP D;  3GTM H;  4GKK Q;  4ABN A;  4DK0 A;  1K3B C;  3IKJ A;  2JA8 H;  3HOW H;  1VQ5 A;  3RN2 A;  3GTG H;  3AFP A;  4X66 L;  1PTO D;  5ELF A;  4RGN A;  4P74 A;  3K5M A;  1BKB A;  2ZXP A;  3K7A H;  2B3G A;  2B2Y A;  5IGE A;  3V2T A;  4C56 C;  4DAY B;  2R7Z G;  3EN2 A;  1WCM B;  3CC2 A;  1V1P A;  3CCL A;  2DY8 A;  3SK4 A;  3GTJ H;  3HFZ B;  2B2Y C;  1Q81 C;  2BH8 A;  4A3L G;  4YCU A;  4A3G H;  2F0V A;  2QEJ C;  1VQA A;  4KKU A;  2F0T A;  1HJP A;  4DV2 Q;  3ZJY C;  2LS0 1;  2Y0S B;  3PO2 G;  4RCO A;  3PMF A;  1BOS A;  2F1M A;  1JIC A;  3HOX H;  4GN4 B;  5CR3 A;  3A7A B;  3OWE B;  4K0K L;  3CCS A;  4EGV A;  2I0Q A;  3V05 A;  1OXU A;  4CKE A;  4YHH L;  2JA5 H;  4LFB Q;  4IUQ A;  3X3N A;  5M3F B;  4XT3 B;  1JB7 A;  1I4X A;  4A93 B;  3MAQ A;  4P71 A;  2Q8T A;  2EQS A;  5LMU Q;  1ENA A;  1VQ8 A;  1PRT F;  3QB3 A;  4JG2 A;  5NUC A;  2L9H A;  4AIM A;  1LTG D;  3HG9 A;  1LTL A;  4A3B H;  4A3M G;  3PUX A;  4JI4 Q;  4IUP A;  1I3Q H;  2NVY H;  1A0I A;  1U4R A;  2PMZ E;  4Q0F A;  2K33 A;  3EJI A;  1MJE A;  3U50 C;  1S5F D;  3FVQ A;  2B63 B;  3H94 A;  2ZJR A;  4X66 Q;  2K01 A;  3NQT A;  2ENB A;  4DNI A;  4BA1 I;  2JA7 G;  1SR3 A;  2F0F A;  3W3A A;  1B9M A;  3HOV G;  4F88 A;  5LL6 S;  2MGS A;  1VQJ A;  3U9O A;  5IYB G;  4G57 A;  4GN3 B;  1G6P A;  5BN3 A;  4PZ7 A;  1PFS A;  2DGY A;  2AQ1 B;  4PMC A;  4IPC A;  2IPK D;  1YIT A;  4HMJ A;  3GTP H;  2LXJ A;  4K0K Q;  3MXP A;  1WTV A;  2VB2 X;  2JEB I;  5ELN A;  1S5B D;  2WKC A;  3A8J E;  4YHH Q;  3QJY A;  1N34 L;  3KF6 A;  5COR A;  4U68 A;  3BG3 A;  1EQT A;  2RQX A;  1MSG A;  2R3Z A;  3E6Z X;  2F52 A;  2SNS A;  2A6E D;  1IL8 A;  3MFG A;  3I2Z A;  5CV8 A;  1KHI A;  1SAP A;  4JBM A;  2K04 A;  2EJF C;  3BS1 A;  3CQZ H;  3LWE A;  1TWG B;  5M5X B;  3M3Y B;  3I8Z A;  4Y7N B;  1AP0 A;  4B3M L;  3MXN B;  3PIO A;  1E22 A;  1WYD A;  1SBB B;  3S2D B;  1GJX A;  3M85 A;  4HMI A;  4WJ4 A;  1JOR A;  5M5W H;  1PH3 A;  1VQE A;  4HJA A;  4K2L A;  1GUS A;  4TVA B;  5FOB B;  2NVX B;  1C4Q A;  1F9S A;  1ESF A;  2L4N A;  3NEM A;  2HD3 A;  3EBE A;  2IW3 A;  4JI7 L;  2OQ0 A;  2IHE A;  3ERO A;  3LWU A;  3S24 A;  1TWF B;  1PH6 A;  3OIQ A;  2QDL A;  1AEX A;  4DA2 A;  3DLL A;  4NXM L;  3R3O A;  1F2M A;  4HN7 A;  5C44 B;  1BCP F;  4L5S A;  1PRT D;  2JN4 A;  2WB1 B;  4FXD A;  2BA0 A;  1D7Q A;  4A3F B;  1GKH A;  3A54 A;  3H0G B;  5BR8 L;  4BY7 B;  1K0S A;  4JV5 L;  1PH7 A;  2RBM A;  3HOZ G;  1U5K A;  3BDC A;  1X3F A;  2F3I A;  4F8M A;  4B9W A;  2Z8L A;  3G6E A;  4GKJ Q;  1D5Z C;  1VQC A;  2KJX A;  1N34 Q;  5FO8 B;  2MJ8 A;  1JC7 A;  4PV1 C;  5JOB A;  1I4H A;  4NXN L;  4HJ7 A;  2YTV A;  3I4L A;  3D3R A;  1EY8 A;  1RJT A;  1G91 A;  1EY7 A;  3KYH C;  4HIO A;  5E3F A;  5M3F G;  1CUK A;  1O7Z A;  3K0Y A;  1VQB A;  1E1T A;  5JEA J;  5KRU A;  4GNX B;  1HCZ A;  3EA6 A;  1C9O A;  1HUN A;  4B3M Q;  4IJL A;  1FR3 A;  1FGU A;  1JWU D;  3F8T A;  1QOH A;  5IGG A;  5JPM C;  1B3A A;  2B29 A;  3TEH B;  3W1B A;  3OHX C;  5CV9 A;  3FPU B;  3S1Q B;  3CME A;  5JVG 3;  1F9P A;  4RGM A;  1EOT A;  3CCE A;  4XQQ A;  3SEB A;  4JI7 Q;  1EWI A;  3ND9 A;  2A5H A;  3DM3 A;  1TVX A;  3I4M G;  3MHB A;  3OPO A;  4BS9 A;  5ELO A;  2KEE A;  4NXM Q;  2ZTE A;  2XRS D;  5CMD A;  1EY5 A;  1O7I A;  3FHW A;  5GAG C;  1WCM H;  1CZG A;  3K5O A;  2K52 A;  1VQF A;  5FJ8 G;  3HKZ B;  5BR8 Q;  5HGQ A;  3U58 A;  3NTH A;  4JV5 Q;  1QE6 A;  5ISR A;  1IL2 A;  5C4X B;  2EYO A;  2E2J H;  3S16 B;  5J39 A;  1PH2 A;  3GP7 A;  1JCK B;  3S15 B;  4ALP A;  4POF A;  4NXN Q;  3ICE A;  2X69 A;  3GD7 A;  4KY5 A;  1QUQ A;  4KD4 A;  4YIJ A;  3MA2 B;  5LMN L;  1CKN B;  3GTK B;  2D2C C;  1D2B A;  1UE6 A;  3RZO B;  1NMG A;  4HSV A;  3RUZ A;  3ULL A;  3I4N H;  2K5N A;  1EIY B;  1CSQ A;  1KAB A;  3S2H H;  4K5W A;  5A2Q L;  1Y1V H;  2A6H D;  3CPF A;  3F2U A;  5C3E B;  1TWH B;  1TR5 A;  3K5N A;  1MI2 A;  1OXV A;  1EEF D;  2LXK A;  1B7Y B;  4R4C A;  1WTP A;  3QOJ A;  3DEO A;  1V1O A;  1NY4 A;  2E76 C;  1YNX A;  3SK8 A;  4QQB X;  1RCV D;  4O0A A;  3PV0 A;  2D0P A;  4FF3 A;  4ZRZ A;  4I65 A;  1EWH A;  2NZH A;  1IBL L;  4DFA A;  3OYY A;  1XNR Q;  2F0K A;  1CA6 A;  4KD3 A;  2WAC A;  3AMU A;  3PSI A;  5IYD G;  2BE5 C;  1WTO A;  4LF8 L;  3Q0A A;  2R93 B;  1QZG A;  1LM0 A;  1CA5 A;  3J7A F;  4A3I G;  4LW1 A;  1Y8N B;  2HQE A;  4A3C H;  4IUR A;  2IX1 A;  4LUZ A;  3P75 A;  2EZV A;  3PO3 B;  1B44 D;  1K8M A;  2VB3 X;  1WTW A;  1DJR D;  3GTO H;  2PMZ B;  4ZUI A;  5LMN Q;  3AEV A;  1Y1W B;  4LF4 L;  1TS2 A;  2YTX A;  2RHQ B;  4UAI A;  3UDX A;  4DR5 L;  1O78 A;  5C3X A;  2RKS A;  2AHO B;  2PNH A;  1TY2 A;  3I56 A;  1S5D D;  1YHQ A;  3GTL H;  3CCR A;  5D65 A;  3CCQ A;  5LL6 X;  2I46 A;  5EKI A;  3ERQ A;  3S2D H;  3QOL A;  4DAY A;  1VDZ A;  1PVO A;  1R9T B;  1B50 A;  3VR4 A;  4JI5 L;  3C2P A;  1HR0 L;  1SJH D;  3RN5 A;  1IBL Q;  4A3K H;  5CV7 A;  1EY4 A;  3CKI B;  4DK6 C;  4IPH A;  2JE6 I;  1YEZ A;  4HJ9 A;  3K81 C;  1BCP B;  2F0H A;  1S4Z A;  1SMY C;  5IP9 H;  4LF8 Q;  3HOY G;  2Z0S A;  1FJG Q;  5D3I B;  4GLA C;  1E2W A;  5IWA L;  1N36 Q;  3QWN A;  2HT1 A;  3H0G H;  4CJ0 B;  1QVC A;  4RGT A;  1NBW A;  1FGB D;  4NDX A;  4A3E G;  5DM6 3;  4V19 0;  2VL6 A;  3D6W A;  3DMU A;  3F1Z A;  4LF4 Q;  1D5X C;  3KLR A;  2EJM A;  4ILW A;  1XX8 A;  4DR5 Q;  4B3T Q;  2N88 A;  3H3V C;  2XTI A;  5DNF A;  4B08 A;  1B53 A;  1EY9 A;  1Y8O B;  1PZJ D;  1Z47 A;  1PH8 A;  1HNZ Q;  4DR1 L;  3BVM A;  4KJN A;  1H9R A;  5E7N A;  4JI5 Q;  2RSN A;  1STB A;  2PW7 A;  1XYI A;  1DD2 A;  4GOP B;  1SE2 A;  1Q7Y C;  1BR9 A;  1J5E L;  2NVQ H;  3CHB D;  5L37 A;  2DJG C;  1RTO A;  4BBS B;  2WV6 D;  4IOA A;  3Q23 A;  1WTR A;  3CP0 A;  3NTK A;  1SNQ A;  3LNN A;  2IT1 A;  4H7B A;  2EE1 A;  5IWA Q;  2R6G A;  2CHB D;  1HR0 W;  1SRU A;  3BDL A;  4APV A;  2N3S A;  5IP7 H;  3DWQ A;  3T1H Q;  4KLK A;  2RF4 A;  4JI6 L;  3PIP 3;  3KF8 B;  1JWS D;  1YNJ C;  4B3R L;  2E2H B;  2SNM A;  3MEF A;  4KN7 C;  4DR4 L;  4G7Z C;  4A4I A;  4DUY L;  1H9S B;  1B4O A;  3MXN A;  5JAV A;  1S5E D;  3MFY A;  1KRT A;  4A3J G;  1VQO A;  3J81 j;  2FIN B;  3T4A C;  3UE1 A;  1PV4 A;  4OIK A;  5A35 A;  3TP7 A;  2R7Z B;  1VQ6 A;  3RLN A;  1E2Z A;  2ZTC A;  2AWN A;  4RHR A;  3PO2 B;  1HZA A;  1YJ9 A;  5EGT A;  3VDY A;  2PI2 E;  2OTL A;  4CBV A;  5AFW A;  2PQE A;  1Q82 C;  3OSO A;  1SYG A;  2J0T D;  3CMA A;  3S1M H;  1J5E Q;  1C48 A;  3VR2 A;  3J81 c;  2MUY A;  4DXG A;  1KAA A;  4DR6 L;  5C4H A;  3KFU A;  2QF7 A;  4BBR H;  1PMR A;  2F3W A;  4FDB A;  1KDC A;  1VQI A;  2JJQ A;  3SVM A;  1RTN A;  3HEJ A;  1EY0 A;  4XQN A;  5IGF A;  2JYO A;  1OTC A;  1EU3 A;  2AWO A;  4A3M B;  2P5Z X;  3HKS A;  2A69 D;  5IGB A;  2K75 A;  5DM7 3;  4OO1 G;  2KED A;  2EIF A;  3VYR A;  2G9H D;  3OOC A;  3K6O A;  1Q3L A;  3QIA A;  4B3R Q;  4LAA A;  1UUP A;  4DR4 Q;  4GNX A;  4Y52 H;  1UEB A;  3J80 L;  1Q1E A;  1PH9 A;  4L8J A;  5T1I A;  3N52 A;  4ZKB B;  5A2Q E;  3BYT B;  4GNX C;  2ZT9 C;  4IFD J;  1STA A;  3IFT A;  1ASZ A;  1YI2 A;  3L0O A;  4G7O C;  1X6O A;  5JEA H;  3NHH A;  2K5W A;  4R4T A;  2D62 A;  1SFO B;  5C6A A;  4FP5 D;  1KRS A;  2EXD A;  2NWG A;  3EIV A;  3JAM c;  5E1F A;  4IFD I;  4MTN A;  5BN5 A;  2ZJP A;  1QB5 D;  2MHV A;  1R9T H;  2I5M X;  5C0X G;  1QNU A;  5FLM G;  2F0U A;  4C3J H;  2QA4 A;  3BU2 A;  2CFM A;  3TME A;  4DR6 Q;  1ICW A;  2JA8 G;  3HOW G;  1G6Z A;  4ZAI A;  1N8R C;  2PNR C;  4DR7 L;  2NVT B;  2Z6B A;  1WD0 A;  5KIX A;  2MFI A;  2AQ3 B;  5CV6 A;  4GN5 A;  3EQL C;  2F0N A;  3CAM A;  2A1A A;  4JC0 A;  2B8G A;  2ID0 A;  1D5M C;  5CGK A;  1CKN A;  4Z9C B;  1PRT C;  2K32 A;  4GZY C;  3M4O H;  4BY1 B;  1YIJ A;  1WVL A;  5FLX L;  2R7D A;  5M5Y H;  1E1O A;  1LLR D;  2RCF A;  3HOX G;  2KQ3 A;  4OEL B;  2WAQ G;  1KDB A;  3CU7 A;  3MEH A;  4X3U A;  3KUP A;  1IYJ B;  2L1B A;  2GVB A;  3HOU H;  1W2B A;  3ITP A;  4QL5 A;  2Q2U A;  1X32 A;  1B8A A;  2MO1 A;  2Q8R E;  1HPC A;  3C1E A;  2B2V A;  4DAV A;  4Q5V A;  3BVG A;  5JJL A;  2IX0 A;  5BN4 A;  1UAP A;  5IT9 E;  3TN2 A;  3AB9 A;  2B2V C;  1SJE D;  4FXK C;  2BDO A;  1FNV A;  3HOZ B;  1DOM A;  1EIH A;  4YWK A;  2AUJ D;  1ESR A;  3W1G A;  4A3B G;  1UNS A;  4UPA A;  1QZH A;  1BF4 A;  1W3S A;  2BA1 A;  4QGU A;  4A3D H;  4K5V A;  1Z7T A;  3STB C;  1K8G A;  1B70 B;  1N32 L;  1XMQ Q;  4DR7 Q;  3P1H A;  2R92 H;  1BBW A;  4A75 A;  1GVP A;  2AMC B;  1RHP A;  4DAM A;  5I9O A;  1M90 C;  2F03 A;  4HED A;  1LT4 D;  2VUM H;  1X65 A;  2E2I B;  1JQY D;  4DPG A;  2K5H A;  3NXW A;  1K8A C;  2NN6 G;  1L0Y B;  4LFC L;  4DV6 L;  4OGQ C;  1BVS A;  3VR3 A;  5E4X A;  2X6L A;  4JI3 Q;  3DWA A;  2IJ0 A;  5ELC A;  1GHJ A;  3FPP A;  2F4I A;  3NSW A;  2Q2H A;  2ZM6 L;  2EYH A;  3PQI A;  2ZJQ A;  1WFQ A;  3I4M B;  2PO4 A;  1LUZ A;  1D1I A;  5JJI A;  1DCZ A;  2JSO A;  1O7Y A;  1STN A;  3K80 C;  4KKT A;  1B9N A;  1RF2 D;  2B2U A;  2C9O A;  3BZK A;  4ODG A;  3S1R B;  1P8L A;  2B2U C;  5CV4 A;  3ONA B;  3UDF A;  3CRL C;  2IL8 A;  2F0G A;  2EYL A;  4HCS A;  1BCP C;  3TRZ A;  3C1F A;  1AFP A;  1EWC A;  1JWM D;  1TWA H;  1EIF A;  1PTO B;  3ND8 A;  4ZLT F;  1YZ6 A;  3I90 A;  1G51 A;  1QVG A;  1N32 Q;  1X55 A;  3GQB A;  1K83 B;  3G71 A;  1SND A;  3M7G A;  1YNN D;  2F0Q A;  1Q8K A;  3EVQ A;  3FEW X;  2OF1 A;  1CKO A;  4C3I H;  2FMC A;  1N33 L;  4L63 B;  4JYA L;  4DV6 Q;  3NEN A;  1ET6 A;  1WD1 A;  4F87 A;  1K28 A;  4DF7 A;  4OWX B;  1TWC H;  2JXM B;  3BYY B;  2JA7 H;  1UE5 A;  1SE4 A;  3NQI A;  4HSP A;  2ZM6 Q;  3S17 H;  1EIG A;  4BY1 G;  1STE A;  3NWS A;  4M1U B;  4DKA C;  4RA8 A;  5EPL A;  3HOV H;  2OQK A;  1BDO A;  4O2D A;  4CDE C;  3I73 A;  5KYL A;  2EY5 A;  4GOP A;  1HQM C;  2K6A A;  2FXQ A;  2CCZ A;  4L5Q A;  1H9M A;  3PF5 A;  1K0R A;  3NUC A;  3CF5 A;  4GOP C;  4A3I B;  2G9D A;  1CTM A;  1OXT A;  3E9I A;  4JI1 L;  3RLF A;  1FD7 D;  5FO7 B;  4ZCK A;  2D0O A;  5F2D A;  1PYW D;  1SNM A;  3A5Z B;  1QWY A;  2PZU A;  2R61 A;  1KNE A;  2MNA A;  4RH6 A;  2JA6 H;  1CKM A;  4UP7 A;  3KLS X;  3I72 A;  3KF8 A;  4IPG A;  2HHH L;  2WKD A;  3RLO A;  1EQQ A;  3S1N B;  1H9S A;  3HS0 C;  1FVI A;  4KV6 A;  3J80 E;  5K5P A;  4MTK A;  1YJN A;  1X3P A;  3PIP A;  2EYJ A;  2OTJ A;  4B9X A;  4RKB A;  3BZD B;  3TQY A;  2A68 C;  2KCN A;  2WAQ E;  5FO9 B;  3WDN A;  4N8F A;  3D31 A;  4EVO A;  3CCM A;  2QCP X;  5J22 A;  3O13 A;  5KNC A;  1KL9 A;  2E75 C;  2KHJ A;  3FKI G;  5KND A;  4KN4 C;  5M3M B;  3HOY B;  3PCO B;  2XNA C;  1GXD C;  3OW7 A;  4O1N A;  4JI2 L;  2MQH A;  1Q8I A;  2NUC A;  1K3R A;  3HP3 A;  3KOJ A;  4JI1 Q;  1PH5 A;  2NZ1 D;  4JVZ A;  2NTS A;  3I4N G;  1EQV A;  1YVC A;  4IN3 A;  1JOO A;  4DXF A;  1Y1V G;  2L5T A;  5I2Y A;  4X64 L;  4A3E B;  3D4R A;  2VXW A;  3E5S A;  3WOF A;  4R4Q A;  3M7N A;  4BXX H;  2HHH Q;  2F3V A;  5M3F H;  1I6H B;  1QNK A;  3MXU A;  1PRT B;  4A93 H;  1QCB D;  5FLX E;  1IYU A;  4PNY A;  4HAE A;  5EBC A;  2VY3 A;  4X65 L;  2KCM A;  2VQF L;  1EL0 A;  2V4D A;  4DV5 L;  1JOK A;  5IOD A;  4QF4 A;  3F2D A;  1M8A A;  1VF7 A;  3GV3 A;  4ME3 A;  1C0A A;  4YY3 L;  1DON A;  3J81 i;  4LF5 L;  2N8N A;  1DM0 B;  4IFD H;  3H3V H;  4IPD A;  1SYF A;  1JE4 A;  1ZYR D;  2B63 H;  4H44 C;  5EQ0 A;  3EFX D;  2YU9 B;  4JI2 Q;  2B2T A;  2VS1 A;  2LKV A;  2HCC A;  3HRZ C;  2I5H A;  1GUO A;  2KHS A;  2LFN A;  1F2Y A;  1DOL A;  5COY A;  3M4P A;  1STH A;  2B2T C;  1I94 L;  4H02 A;  1J9O A;  1XPO A;  1LT5 D;  4G4K A;  3S14 B;  2EY1 A;  3PUW A;  1MIU A;  1I50 B;  2EXZ A;  3PUZ A;  4C2M B;  1VQM A;  2XWB B;  2K28 A;  4DAP A;  5C4J B;  3VR6 A;  4A3J B;  2RHS B;  5CC4 A;  1RL2 A;  4WJ3 M;  4XIG S;  2E8G A;  1KC8 C;  4A3K G;  1GD7 A;  2K14 A;  3JAM i;  1FL0 A;  2KEN A;  1EOV A;  4X65 Q;  2VQF Q;  1IXR A;  4DV5 Q;  4CKC A;  1GO3 E;  2HIV A;  2O4X A;  2ZTD A;  1LO5 D;  4YY3 Q;  4LF5 Q;  1TWG H;  4HCE A;  1SYD A;  2GA4 B;  5M5X H;  3VYS A;  3M3Y H;  1Q90 A;  3FRP B;  4Y7N H;  4H0L C;  4XT1 B;  1CHQ D;  5JPN C;  2VQE L;  1K8O A;  3A7L A;  5IT9 L;  2SDF A;  1E2V A;  1WI5 A;  2NVX H;  2UUA L;  1XPU A;  2EY6 A;  3BJU A;  1PYS B;  1F9Q A;  1C8C A;  1YHA A;  4A3I H;  1I94 Q;  5M3M G;  1TWF H;  1VMC A;  3NEL A;  4AYB G;  1X3G A;  4C3H B;  5C44 H;  4GLV B;  5LHY 1;  4N9P A;  2K05 A;  4LF6 L;  1VQN A;  2ALY B;  4A3F H;  3DXJ C;  1PLF A;  1G29 1;  3X3M A;  4BY7 H;  4NPS A;  4QUF A;  1LTB D;  5DAU A;  3IRB A;  3J7A V;  4FNF A;  4JK1 C;  3T53 B;  4QJF A;  3GTQ B;  1PH1 A;  1YHB A;  2CW0 D;  2VW9 A;  1SNO A;  3PUV A;  1L1O B;  4QCL A;  5H1S E;  2UU9 L;  2KCT A;  2NZO A;  1BXT A;  1NR2 A;  4QIW E;  1SMX A;  3K8A A;  1T5E A;  1MGS A;  3TS0 A;  2PW5 A;  3KDF B;  3B6Y A;  4EQ5 A;  4R4O A;  4OL7 A;  5IP7 G;  1B2T A;  5G3L D;  3RZD B;  4A76 A;  1HTL D;  4RKL A;  4E6I A;  3K59 A;  2VQE Q;  2JA9 A;  3VYU A;  4FF2 A;  3GTM B;  4LF7 L;  3NBH B;  2JA8 B;  3HOW B;  4FYD A;  1EY6 A;  4MN3 A;  1HR0 Q;  3SK5 A;  3GTG B;  2FJ2 A;  4CDC C;  2E74 C;  3DUZ A;  5E4W C;  3S1Q H;  3F2B A;  2QDB A;  3L7Z C;  3URY A;  1RIP A;  3TSS A;  1XXG A;  3D6C A;  3K7A B;  5I6W A;  4R4I A;  1PTO C;  2ASB A;  3T16 A;  1V8Q A;  2NB0 A;  1Q86 C;  3W5O A;  1JMC A;  3TP6 A;  3GTJ B;  4LF6 Q;  4A3G B;  4R9W A;  4X3T A;  4L6T B;  1KDA A;  3DWP A;  2RCN A;  2Z9H A;  4PMW A;  4HTH A;  1HNW L;  2CVR A;  3HOX B;  5C4X H;  3QO2 A;  1VQ7 A;  2WAQ B;  3S16 H;  4NMZ A;  1STY A;  2R7F A;  1CZW A;  5CV5 A;  3S15 H;  3WWV A;  2JA5 B;  2UU9 Q;  4BA2 I;  1A8V A;  2MP1 A;  5GAD C;  1TII D;  2PI2 A;  3SDZ A;  4JI0 L;  4BBR G;  3CCJ A;  3GTK H;  4B3S L;  3RZO H;  4GS3 A;  4A3B B;  5IOC A;  5IYC G;  2N49 A;  2KA7 A;  4XXE A;  1KNA A;  5C3E H;  4DR1 Q;  1TWH H;  1I3Q B;  4N8X 1;  2NVY B;  4DGZ A;  3NE5 B;  5HUR A;  4LF7 Q;  3OW2 A;  4AQY L;  3MC0 B;  1D1K A;  3H91 A;  1O80 A;  2NTT A;  4EQO A;  4J1M A;  3LGJ A;  2FMM A;  3TP8 A;  2BE5 D;  5KEE A;  4DR3 L;  3K57 A;  4WJW A;  1VQK A;  1BO0 A;  2KHI A;  1HXY D;  2H1E A;  4OXP A;  2IY5 B;  4IO9 A;  5JEA G;  2B2W A;  3KJP A;  1EUJ A;  1UE7 A;  1HTP A;  2R93 H;  3IAY A;  3I4O A;  1I6V C;  2B2W C;  3NPP A;  3MXG A;  5K36 G;  1AE2 A;  4JI6 Q;  1V9P A;  4TSS A;  1HNW Q;  4OHJ A;  3GTP B;  1LAB A;  4C3H G;  2BDN A;  3CD6 A;  1SE3 A;  2UUC L;  1VCI A;  4PZ8 A;  1WOC A;  1W6K A;  4C3J G;  3PO3 H;  1GOZ A;  4DUY Q;  1VF5 C;  3JAM E;  4P73 A;  1EYA A;  4JI8 L;  1BUV T;  4JI0 Q;  2WII B;  3WOE A;  5T1G A;  2M9V A;  1Y1W H;  5C3W A;  4B3S Q;  3F2C A;  1EZ8 A;  4JOI C;  1VQ4 A;  4DUZ L;  4G7H C;  3CQZ B;  3L9A X;  4X6A H;  2A6E C;  2PZT A;  1P16 A;  2UXD L;  4DN4 M;  4ZKC B;  3C46 A;  2L15 A;  3J7Y W;  3K58 A;  4KY7 A;  1E24 A;  2EOT A;  4K2K A;  4AQY Q;  3H3V I;  1ET9 A;  2Z6K C;  5M5W B;  2YYZ A;  4HID A;  4PG3 A;  4AYB E;  4HR7 B;  3OWF A;  3NTI A;  4DR3 Q;  1CT1 D;  2CKZ B;  1W6J A;  2C35 B;  3Q8D A;  3HOU G;  1PDQ A;  1AN8 A;  4OO1 H;  2ICE C;  2WP8 J;  3KBX A;  3V96 A;  4YCW A;  4KI0 A;  4DNT B;  4EQP A;  4UP9 A;  1X56 A;  4HJ5 A;  1A3V A;  3I3C A;  3K5L A;  1HUM A;  1LV9 A;  3IFD A;  1SYB A;  1GHK A;  1FYC A;  4A3G G;  1X3Q A;  2UUC Q;  1II3 A;  1ENF A;  2HDM A;  2DNC A;  2XWJ B;  1PH4 A;  1ICF B;  4IUU A;  4QMG A;  5EPJ A;  4JI8 Q;  2PPB C;  3ZYY X;  3C3L A;  1HHV A;  1YJW A;  5C5M A;  3LX0 A;  4P72 A;  2KOL A;  4J15 A; 
#chains in the Genus database with same CATH homology
 2SEB D;  2HDL A;  3GO5 A;  2Q8I B;  2FFK B;  1RDP D;  1TS3 A;  4KMU C;  2K5Q A;  5C0X H;  4RFB A;  2A74 C;  2O5J C;  2TMP A;  5IIF A;  3T13 A;  3TBI B;  4CKB A;  1GUW A;  4C1N I;  3D4D A;  5EKK A;  4RGO S;  3TP5 A;  1IW7 D;  1TT2 A;  5JVH 3;  5C4Z A;  3SXH A;  3P20 A;  4FXG C;  4QIW B;  1YNJ D;  1LTI D;  2E2J B;  4ID6 A;  2ICI A;  3VYT A;  5EBD A;  3FKI B;  3R93 A;  5CBE E;  4OIJ A;  3DM1 A;  2DNE A;  2SOB A;  4KHZ A;  4ULL A;  2B8F A;  3I4N B;  3S2H B;  2NBF A;  3Q6S A;  1CQV A;  4K8J A;  1UEA B;  1Y1V B;  4C3I G;  2ZXO A;  3T51 B;  5EPK A;  3W2D A;  4N9T A;  2VNU D;  2PZW A;  1G2S A;  1DYQ A;  3HGB A;  3GV6 A;  2A6H C;  3E0J A;  1ILQ A;  1M4V A;  4ZK9 B;  1ZYR C;  5IGD A;  1JOQ A;  4KK7 A;  2KUM A;  2RDG A;  1LAC A;  2MPM A;  4KKS A;  2EJG C;  2XRQ D;  1LT3 D;  1PFB A;  2NN6 H;  3VA7 A;  1AZQ A;  3IL8 A;  2F0I A;  3MTS A;  4KJO A;  3RMH A;  1GUN A;  1ZKO A;  5FK9 C;  4KHV A;  3AU7 A;  5ELD A;  3NP8 A;  5HGT A;  1V43 A;  3GTO B;  1CM9 A;  2F0P A;  4PMB A;  5ELB A;  3R2T A;  1U4P A;  3NBH A;  5EKL A;  1SSO A;  2IWH A;  2F0S A;  4NKL A;  3G6J B;  1CQF A;  2QIL A;  2BCO A;  2EYM A;  1QJO A;  3GTL B;  1H9K A;  1U4M A;  1TU2 B;  2M2L A;  1LT6 D;  3A8I E;  4K8I A;  3R8B A;  5EJW A;  2L0C A;  4A3K B;  5D14 A;  4V0B A;  1NAP A;  4X3S A;  1LTT D;  3R2I A;  3I70 A;  4K6D A;  3MVV A;  2PYK A;  4IUT A;  4R8I A;  2N55 A;  3H6M A;  1XTC D;  1PXU A;  1BBX C;  1NUC A;  4IUV A;  4J8Q A;  3U9S A;  1D6E C;  2CW0 C;  2Z4H A;  3J81 L;  4C1N K;  1A3U A;  4J6H A;  4AYB B;  1AZP A;  3TDQ A;  1A15 A;  1B1Z A;  1IKM A;  1CI3 M;  1DZ1 A;  1MBY A;  2TSS A;  1TS5 A;  1Y69 U;  4CJ2 C;  4LMQ D;  2F0D A;  4F7X A;  4K14 A;  3OMG A;  4IFD G;  2NVQ B;  3SHL A;  1PFN A;  1O7L A;  5ELE A;  3SE0 A;  1LTA D;  2KCC A;  4RAU C;  4OO1 I;  4S3S A;  1G8Z D;  1ZXT A;  2L11 A;  5C5L A;  1CK1 A;  1HQR D;  4CGY B;  2QKI C;  1WTQ A;  1KLU D;  4ZYS A;  1PZI D;  2ZXR A;  4LK1 C;  1SEB D;  1HA6 A;  1CFM A;  3JAM L;  2OXP A;  2PCF B;  1TS4 A;  1H9J A;  2EVB A;  2LY7 A;  2I07 B;  2J4X A;  5C0X J;  4NP5 A;  4QB4 A;  3OIP A;  2H4O A;  2DN8 A;  1RKN A;  5CBA E;  1PZK D;  2D9U A;  5DEH A;  2F0J A;  1BCP D;  2D5D A;  5C0X I;  2O2L D;  2AQ2 B;  1Q12 A;  3H09 A;  5G3L F;  3NBI A;  1I4R A;  2RSO A;  3SR1 A;  4K6L A;  2C5C A;  1SYE A;  3DEP A;  3FMC A;  3S1M B;  3Q24 A;  2NYZ D;  2HCI A;  1PTO H;  4RWS C;  1F2Z A;  2J7Z A;  2F0O A;  1RD9 D;  4DNR B;  4CJ1 B;  4X3K A;  4BBR B;  4JBW A;  3OMC A;  5FKA C;  1V1P B;  3QG1 A;  3RD4 A;  2Z1C A;  4P2C B;  2K5D A;  2LMC B;  5KYI A;  2A69 C;  4RHS A;  4FO2 A;  4TRD A;  3MWY W;  1PFM A;  1L0X B;  5I4D A;  4IQZ A;  1S5C D;  5JJZ A;  1Z6H A;  4CHT B;  3PUY A;  3VR5 A;  1R4Q B;  4I7Z C;  1HFN A;  4TQU S;  2F0E A;  5D3D A;  4DK1 A;  2K03 A;  1IHZ A;  2K7V A;  2EYP A;  1Q1B A;  2F0W A;  4BWG B;  4U67 3;  1NSN S;  4MIU A;  1ML0 D;  3KBG A;  1BQQ T;  1EYC A;  1LTS D;  3NK9 A;  2F0L A;  5TSS A;  2CQA A;  1OXS C;  4C3J B;  3D4W A;  2E2D C;  4K5X A;  1EEI D;  3BDO A;  1OXX K;  4TKO B;  2NN6 I;  3DHQ A;  1T5X D;  4IZ8 A;  3A55 A;  3Q22 A;  1F77 A;  2JEA I;  2M00 A;  1DXM A;  2EY2 A;  2A68 D;  2EPB A;  3L3O C;  1A2T A;  4KY6 A;  5I6Y A;  3M4O B;  1A3T A;  1QG7 A;  1TKW B;  2IX3 A;  1IYV A;  3SK6 A;  5M5Y B;  4WFN 3;  2O5I C;  3PIO 3;  2RDF A;  4ZUJ A;  2XVS A;  3UI2 A;  1E0B A;  4PQX A;  2XN9 C;  3HOU B;  1VMP A;  1Y8P B;  4FF1 A;  2K1B A;  4QUC A;  5J1Z A;  4WRD A;  1SXT A;  4ZQ3 A;  1F9R A;  2AUK A;  1QIL A;  3MZ5 A;  5KNB A;  1GUG A;  1ROD A;  1F2L A;  1A2U A;  4H13 C;  2L12 A;  4RCN A;  4A3D B;  1I4Q A;  4XDX A;  1EU4 A;  1KTK A;  1J8I A;  2R92 B;  1TY0 A;  5M9O A;  1FNU A;  2VUM B;  1SDF A;  3KK7 A;  3D8G A;  1IW7 C;  1I4P A;  3NWT A;  1EFI D;  1R4P B;  3J81 E;  1BNZ A;  3KLS A;  4O42 A;  3FDT A;  4XQJ A;  1NCV A;  4FVM A;  3A56 A;  4M8A A;  2L55 A;  1GUT A;  1A6X A;  3CRK C;  2OEO A;  2BOS A;  4NW2 A;  1DOK A;  1ONL A;  2KEC A;  2FHT A;  1SNP A;  1XWE A;  1NR4 A;  4KTA A;  1JR0 D;  3M4Y A;  1ILP A;  1HA5 A;  2JP1 A;  2EDG A;  4FF4 A;  2XIW A;  5KGU A;  1TWA B;  3G7L A;  4EQN A;  2RA4 A;  1PTO F;  1KLG D;  1MSH A;  4R8N A;  3HZX A;  1ENC A;  4LJZ C;  4MHE A;  1YNN C;  4C3I B;  4XTC S;  2A73 B;  2F0M A;  1SNC A;  1OO9 B;  4IAL A;  3I91 A;  1WTX A;  2RDH A;  1AW7 A;  5CYU A;  4WOR A;  1TWC B;  3VA5 A;  4XYQ A;  4XYO A;  5I2X A;  2JA7 B;  3S17 B;  3TZU A;  3BVZ A;  2WIN B;  2HUG A;  3HOV B;  1JB3 A;  1HRJ A;  2OT2 A;  1SMY D;  2DY7 A;  1HFG A;  3N6R A;  5K36 H;  5I9P A;  2Z4I A;  3P7J A;  2X6G A;  1FNW A;  3TZD A;  2B39 A;  3A8K E;  1EYD A;  1EZ6 A;  2JA6 B;  1STG A;  1TQO A;  1LTR D;  1U4L A;  1G2T A;  1SYC A;  1IKL A;  1U9R A;  1ZEQ X;  4UDU C;  5IGC A;  4DU9 A;  2KVM A;  4IUN A;  2EYF A;  2RVL A;  4ME5 A;  3S9W A;  1I4G A;  2XSC A;  1MD2 D;  3T56 B;  1CHP D;  4ABN A;  4DK0 A;  3IKJ A;  1PTO D;  5ELF A;  4RGN A;  3K5M A;  2ZXP A;  2B2Y A;  5IGE A;  3V2T A;  4C56 C;  1WCM B;  1V1P A;  2DY8 A;  3SK4 A;  2B2Y C;  2F0V A;  2QEJ C;  4KKU A;  2F0T A;  2LS0 1;  2Y0S B;  4RCO A;  3PMF A;  1BOS A;  2F1M A;  1JIC A;  5CR3 A;  3A7A B;  3OWE B;  4EGV A;  3V05 A;  1OXU A;  4CKE A;  4IUQ A;  3X3N A;  5M3F B;  4XT3 B;  1I4X A;  4A93 B;  3MAQ A;  2Q8T A;  1ENA A;  1PRT F;  3QB3 A;  5NUC A;  2L9H A;  1LTG D;  3HG9 A;  3PUX A;  4IUP A;  1U4R A;  4Q0F A;  2K33 A;  3EJI A;  1S5F D;  3FVQ A;  2B63 B;  3H94 A;  2K01 A;  3NQT A;  2ENB A;  4BA1 I;  2F0F A;  3W3A A;  1B9M A;  4F88 A;  5LL6 S;  2MGS A;  3U9O A;  4G57 A;  5BN3 A;  2AQ1 B;  4PMC A;  2IPK D;  4HMJ A;  3MXP A;  1WTV A;  2VB2 X;  2JEB I;  1S5B D;  2WKC A;  3A8J E;  3QJY A;  5COR A;  4U68 A;  3BG3 A;  1EQT A;  2RQX A;  1MSG A;  2R3Z A;  3E6Z X;  2SNS A;  2A6E D;  1IL8 A;  3MFG A;  5CV8 A;  1SAP A;  2K04 A;  2EJF C;  3BS1 A;  3LWE A;  1TWG B;  5M5X B;  3M3Y B;  3I8Z A;  4Y7N B;  1AP0 A;  1GJX A;  1SBB B;  3S2D B;  3M85 A;  4HMI A;  1JOR A;  4K2L A;  1GUS A;  5FOB B;  2NVX B;  1C4Q A;  1F9S A;  1ESF A;  2L4N A;  2IW3 A;  3ERO A;  3LWU A;  1TWF B;  3OIQ A;  4DA2 A;  1AEX A;  3R3O A;  1F2M A;  4HN7 A;  5C44 B;  1BCP F;  1PRT D;  2WB1 B;  4FXD A;  2BA0 A;  4A3F B;  3A54 A;  3H0G B;  4BY7 B;  2RBM A;  3BDC A;  4F8M A;  4B9W A;  2Z8L A;  1D5Z C;  2KJX A;  5FO8 B;  2MJ8 A;  1JC7 A;  4PV1 C;  5JOB A;  1I4H A;  3I4L A;  3D3R A;  1EY8 A;  1RJT A;  1G91 A;  1EY7 A;  5E3F A;  1O7Z A;  3K0Y A;  5JEA J;  5KRU A;  1HCZ A;  3EA6 A;  1HUN A;  1FR3 A;  1JWU D;  1QOH A;  5JPM C;  5IGG A;  1B3A A;  3OHX C;  5CV9 A;  3FPU B;  3S1Q B;  5JVG 3;  1F9P A;  4RGM A;  1EOT A;  4XQQ A;  3SEB A;  3ND9 A;  2A5H A;  1TVX A;  3MHB A;  3OPO A;  4BS9 A;  2KEE A;  2XRS D;  5CMD A;  1EY5 A;  1CZG A;  3K5O A;  3HKZ B;  3NTH A;  1QE6 A;  5ISR A;  5C4X B;  2EYO A;  3S16 B;  5J39 A;  3GP7 A;  1JCK B;  3S15 B;  2X69 A;  3GD7 A;  4KY5 A;  4KD4 A;  4YIJ A;  3MA2 B;  3GTK B;  2D2C C;  1D2B A;  3RZO B;  4HSV A;  3RUZ A;  1KAB A;  4K5W A;  5A2Q L;  2A6H D;  3F2U A;  5C3E B;  1TWH B;  1TR5 A;  3K5N A;  1MI2 A;  1OXV A;  1EEF D;  1WTP A;  3QOJ A;  3DEO A;  1V1O A;  2E76 C;  3SK8 A;  1RCV D;  3PV0 A;  4FF3 A;  4ZRZ A;  4I65 A;  1EWH A;  4DFA A;  2F0K A;  1CA6 A;  4KD3 A;  2WAC A;  3AMU A;  2BE5 C;  1WTO A;  3Q0A A;  2R93 B;  1CA5 A;  3J7A F;  1Y8N B;  2HQE A;  4IUR A;  2IX1 A;  3P75 A;  2EZV A;  3PO3 B;  1B44 D;  1K8M A;  2VB3 X;  1WTW A;  1DJR D;  2PMZ B;  4ZUI A;  1Y1W B;  1TS2 A;  4UAI A;  1O78 A;  5C3X A;  2RKS A;  1TY2 A;  1S5D D;  5D65 A;  5LL6 X;  2I46 A;  5EKI A;  3ERQ A;  3QOL A;  4DAY A;  1VDZ A;  1R9T B;  1B50 A;  3VR4 A;  3C2P A;  1SJH D;  5CV7 A;  1EY4 A;  3CKI B;  2JE6 I;  1BCP B;  2F0H A;  1S4Z A;  1SMY C;  5D3I B;  1E2W A;  3QWN A;  4CJ0 B;  4RGT A;  1FGB D;  4NDX A;  5DM6 3;  4V19 0;  3D6W A;  3DMU A;  1D5X C;  3KLR A;  2EJM A;  4ILW A;  1XX8 A;  2N88 A;  3H3V C;  5DNF A;  4B08 A;  1B53 A;  1EY9 A;  1Y8O B;  1PZJ D;  1Z47 A;  3BVM A;  4KJN A;  1H9R A;  2RSN A;  1STB A;  2PW7 A;  1XYI A;  1DD2 A;  1SE2 A;  1BR9 A;  3CHB D;  1RTO A;  4BBS B;  2WV6 D;  3Q23 A;  1WTR A;  3NTK A;  1SNQ A;  3LNN A;  2IT1 A;  4H7B A;  2EE1 A;  2R6G A;  2CHB D;  3BDL A;  3DWQ A;  3PIP 3;  1JWS D;  1YNJ C;  2E2H B;  2SNM A;  4KN7 C;  4G7Z C;  1H9S B;  1B4O A;  3MXN A;  5JAV A;  1S5E D;  3MFY A;  2FIN B;  3T4A C;  4OIK A;  5A35 A;  3TP7 A;  2R7Z B;  1E2Z A;  2AWN A;  4RHR A;  3PO2 B;  5EGT A;  4CBV A;  5AFW A;  2PQE A;  3OSO A;  1SYG A;  2J0T D;  1C48 A;  3VR2 A;  2MUY A;  4DXG A;  1KAA A;  5C4H A;  2QF7 A;  1PMR A;  2F3W A;  1KDC A;  3SVM A;  1RTN A;  3HEJ A;  1EY0 A;  4XQN A;  5IGF A;  2JYO A;  1EU3 A;  2AWO A;  4A3M B;  2A69 D;  5IGB A;  5DM7 3;  4OO1 G;  2KED A;  3VYR A;  2G9H D;  3OOC A;  3K6O A;  1Q3L A;  3QIA A;  4LAA A;  1UUP A;  3J80 L;  1Q1E A;  4L8J A;  5T1I A;  3N52 A;  4ZKB B;  5A2Q E;  3BYT B;  2ZT9 C;  4IFD J;  1STA A;  3IFT A;  4G7O C;  5JEA H;  3NHH A;  2K5W A;  2D62 A;  1SFO B;  5C6A A;  4FP5 D;  2NWG A;  5E1F A;  4IFD I;  5BN5 A;  1QB5 D;  2MHV A;  5C0X G;  1QNU A;  2F0U A;  3TME A;  1ICW A;  1G6Z A;  4ZAI A;  2PNR C;  2NVT B;  1WD0 A;  5KIX A;  2AQ3 B;  5CV6 A;  3EQL C;  2F0N A;  2B8G A;  2ID0 A;  1D5M C;  5CGK A;  4Z9C B;  1PRT C;  2K32 A;  4GZY C;  4BY1 B;  1WVL A;  5FLX L;  1LLR D;  2KQ3 A;  1KDB A;  3CU7 A;  3MEH A;  4X3U A;  3KUP A;  2L1B A;  3ITP A;  1X32 A;  2Q8R E;  1HPC A;  3C1E A;  2B2V A;  4DAV A;  4Q5V A;  3BVG A;  2IX0 A;  5BN4 A;  1UAP A;  5IT9 E;  3TN2 A;  3AB9 A;  2B2V C;  1SJE D;  4FXK C;  2BDO A;  1FNV A;  3HOZ B;  1DOM A;  1EIH A;  2AUJ D;  1ESR A;  1UNS A;  1BF4 A;  2BA1 A;  4K5V A;  1Z7T A;  3P1H A;  1RHP A;  5I9O A;  2F03 A;  4HED A;  1LT4 D;  2E2I B;  1JQY D;  3NXW A;  2NN6 G;  1L0Y B;  4OGQ C;  3VR3 A;  5E4X A;  2X6L A;  3DWA A;  2IJ0 A;  5ELC A;  1GHJ A;  3FPP A;  2F4I A;  3NSW A;  2EYH A;  3I4M B;  2PO4 A;  1D1I A;  1DCZ A;  2JSO A;  1O7Y A;  1STN A;  4KKT A;  1B9N A;  1RF2 D;  2B2U A;  2C9O A;  4ODG A;  3S1R B;  2B2U C;  5CV4 A;  3ONA B;  3CRL C;  2IL8 A;  2F0G A;  2EYL A;  4HCS A;  1BCP C;  3C1F A;  1AFP A;  1EWC A;  1JWM D;  1PTO B;  3ND8 A;  4ZLT F;  3I90 A;  3GQB A;  1K83 B;  1SND A;  1YNN D;  2F0Q A;  3EVQ A;  3M7G A;  3FEW X;  2OF1 A;  2FMC A;  4L63 B;  1ET6 A;  1WD1 A;  4F87 A;  4DF7 A;  2JXM B;  3BYY B;  1SE4 A;  3NQI A;  4HSP A;  1EIG A;  1STE A;  3NWS A;  4M1U B;  4RA8 A;  5EPL A;  1BDO A;  3I73 A;  5KYL A;  2EY5 A;  1HQM C;  2K6A A;  1H9M A;  3NUC A;  4A3I B;  2G9D A;  1CTM A;  1OXT A;  3RLF A;  1FD7 D;  5FO7 B;  5F2D A;  1PYW D;  1SNM A;  1QWY A;  2PZU A;  2R61 A;  1KNE A;  4RH6 A;  3KLS X;  3I72 A;  3KF8 A;  2WKD A;  3S1N B;  1H9S A;  3HS0 C;  4KV6 A;  3J80 E;  5K5P A;  1X3P A;  2EYJ A;  4B9X A;  4RKB A;  3BZD B;  2A68 C;  2KCN A;  5FO9 B;  3WDN A;  3D31 A;  4EVO A;  2QCP X;  5J22 A;  3O13 A;  5KNC A;  2E75 C;  5KND A;  4KN4 C;  5M3M B;  3HOY B;  2XNA C;  1GXD C;  3OW7 A;  4O1N A;  1Q8I A;  2NUC A;  3HP3 A;  2NZ1 D;  2NTS A;  1EQV A;  4IN3 A;  1JOO A;  4DXF A;  2L5T A;  5I2Y A;  4A3E B;  3D4R A;  2VXW A;  3E5S A;  3WOF A;  3M7N A;  2F3V A;  1I6H B;  1QNK A;  3MXU A;  1PRT B;  1QCB D;  5FLX E;  1IYU A;  4PNY A;  4HAE A;  5EBC A;  1EL0 A;  2V4D A;  1JOK A;  5IOD A;  4QF4 A;  1M8A A;  1VF7 A;  3GV3 A;  1DON A;  1DM0 B;  4IFD H;  1SYF A;  1JE4 A;  1ZYR D;  4H44 C;  5EQ0 A;  3EFX D;  2YU9 B;  2B2T A;  2LKV A;  2HCC A;  3HRZ C;  1GUO A;  2KHS A;  2LFN A;  1F2Y A;  1DOL A;  5COY A;  1STH A;  2B2T C;  1J9O A;  1LT5 D;  4G4K A;  3S14 B;  2EY1 A;  3PUW A;  1I50 B;  2EXZ A;  3PUZ A;  4C2M B;  2XWB B;  2K28 A;  4DAP A;  5C4J B;  3VR6 A;  4A3J B;  5CC4 A;  4XIG S;  4CKC A;  2O4X A;  1LO5 D;  4HCE A;  1SYD A;  2GA4 B;  3VYS A;  1Q90 A;  3FRP B;  4H0L C;  4XT1 B;  1CHQ D;  5JPN C;  1K8O A;  3A7L A;  5IT9 L;  2SDF A;  1E2V A;  2EY6 A;  1F9Q A;  1C8C A;  1VMC A;  4C3H B;  5LHY 1;  4N9P A;  2K05 A;  3DXJ C;  1PLF A;  1G29 1;  3X3M A;  4QUF A;  1LTB D;  5DAU A;  3J7A V;  4FNF A;  4JK1 C;  3T53 B;  3GTQ B;  2CW0 D;  1SNO A;  3PUV A;  4QCL A;  1BXT A;  1NR2 A;  1T5E A;  1MGS A;  2PW5 A;  4OL7 A;  1B2T A;  5G3L D;  3RZD B;  1HTL D;  4RKL A;  4E6I A;  3K59 A;  4FF2 A;  3VYU A;  3GTM B;  2JA8 B;  3HOW B;  4FYD A;  1EY6 A;  4MN3 A;  3SK5 A;  3GTG B;  2FJ2 A;  2E74 C;  3DUZ A;  5E4W C;  2QDB A;  3L7Z C;  3URY A;  3TSS A;  1XXG A;  3D6C A;  3K7A B;  5I6W A;  1PTO C;  3T16 A;  1V8Q A;  2NB0 A;  3GTJ B;  3TP6 A;  4A3G B;  4R9W A;  4X3T A;  4L6T B;  1KDA A;  3DWP A;  4PMW A;  4HTH A;  2CVR A;  3HOX B;  3QO2 A;  2WAQ B;  4NMZ A;  1STY A;  1CZW A;  5CV5 A;  2JA5 B;  4BA2 I;  2MP1 A;  1TII D;  3SDZ A;  4A3B B;  5IOC A;  2KA7 A;  4XXE A;  1KNA A;  1I3Q B;  2NVY B;  4DGZ A;  3NE5 B;  5HUR A;  3MC0 B;  1D1K A;  3H91 A;  1O80 A;  2NTT A;  4EQO A;  4J1M A;  2FMM A;  3TP8 A;  2BE5 D;  5KEE A;  3K57 A;  4WJW A;  1BO0 A;  1HXY D;  2H1E A;  5JEA G;  2B2W A;  1HTP A;  3IAY A;  1I6V C;  2B2W C;  3NPP A;  3MXG A;  5K36 G;  4TSS A;  4OHJ A;  3GTP B;  1LAB A;  4C3H G;  2BDN A;  1SE3 A;  1VCI A;  1W6K A;  4C3J G;  1GOZ A;  1VF5 C;  3JAM E;  1EYA A;  1BUV T;  2WII B;  3WOE A;  5T1G A;  2M9V A;  5C3W A;  1EZ8 A;  4G7H C;  3CQZ B;  3L9A X;  2A6E C;  2PZT A;  4DN4 M;  4ZKC B;  3C46 A;  3J7Y W;  3K58 A;  4KY7 A;  2EOT A;  4K2K A;  1ET9 A;  5M5W B;  2YYZ A;  4HR7 B;  3OWF A;  3NTI A;  1CT1 D;  1W6J A;  1PDQ A;  1AN8 A;  4OO1 H;  2ICE C;  2WP8 J;  3KBX A;  3V96 A;  4DNT B;  4KI0 A;  4EQP A;  1A3V A;  3I3C A;  3K5L A;  1HUM A;  1LV9 A;  3IFD A;  1SYB A;  1GHK A;  1FYC A;  1X3Q A;  1II3 A;  1ENF A;  2HDM A;  2DNC A;  2XWJ B;  4IUU A;  4QMG A;  5EPJ A;  2PPB C;  3ZYY X;  3C3L A;  1HHV A;  5C5M A;  3LX0 A;  2KOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...