1F9PA

Crystal structure of connective tissue activating peptide-iii(ctap-iii) complexed with polyvinylsulfonic acid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
81
Chain Sequence
b'NLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONNECTIVE TISSUE ACTIVATING PEPTIDE-III
publication title Structure of the CXC Chemokine, Connective Tissue Activating Peptide-III, Complexed with the Heparin Analogue, Polyvinylsulfonic Acid
rcsb
molecule tags Blood clotting
total genus 15
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2000-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1f9pA00
3MTSA 1DOMA 1B53A 1XYIA 1F9RA 1HHVA 2XIWA 4HCSA 1U4LA 2K05A 2Q8TA 2K01A 2K03A 2HDLA 5EPLA 4ZKCB 3SVMA 1NAPA 1X3PA 1PFNA 4UAIA 1BNZA 2MGSA 1X32A 1M8AA 4MN3A 2MPMA 4OIJA 2VXWA 5COYA 5EKIA 1G2TA 1WTWA 1E0BA 1VMCA 1RHPA 1NR2A 2FHTA 1TVXA 3IL8A 3ONAB 2D9UA 2CVRA 1U4RA 2EOTA 1CA5A 1VMPA 1CA6A 3N52A 4XT3B 1RODA 4RAUC 1RTOA 4IUUA 1LV9A 1O7YA 1AZPA 4ZK9B 2FINB 5EPJA 2B2YA 4HEDA 1PFBA 2KOLA 2HUGA 1EIHA 5DNFA 1A15A 3FPUB 1B3AA 4X3KA 3R93A 2HCCA 2B2UA 5EPKA 5CBEE 1WD1A 2FJ2A 2X69A 1G91A 2K04A 4QUCA 1BBXC 5CMDA 1WVLA 2KEEA 4CJ2C 2EPBA 1S4ZA 4DN4M 5E4WC 2RSOA 5EQ0A 1WTOA 1NR4A 2NZ1D 3D6WA 2RSNA 3G7LA 4IUQA 1HFNA 2L11A 1ICWA 4ZLTF 1JE4A 2B2TA 4QUFA 3UI2A 4R9WA 4U68A 1O7ZA 1MSHA 4IUPA 1SAPA 5AFWA 5D14A 2IL8A 3GV6A 1WTQA 1IL8A 5CBAE 4RA8A 2MJ8A 3MWYW 4O42A 1X3QA 3F2UA 3LWEA 4HSVA 2L4NA 1B4OA 1DOLA 2KEDA 5D65A 1PLFA 1ZXTA 4XT1B 2KVMA 3KBXA 5E4XA 4MHEA 1F9SA 2L9HA 3H91A 2DY8A 3I8ZA 4OIKA 3P7JA 1J9OA 1CM9A 1QE6A 1B2TA 1EL0A 1F9PA 1IKLA 1KNAA 2B2VC 2JYOA 1HA6A 1EOTA 4CJ1B 1HFGA 1WTPA 1EIGA 4IURA 2H1EA 4X3TA 1U4MA 2HDMA 3TZDA 1F2LA 1B50A 1Q3LA 1ILQA 2L12A 1SDFA 1ILPA 2R3ZA 1SSOA 4LMQD 2EE1A 5T1IA 4RWSC 1KNEA 2B2WC 1RJTA 3DEPA 1WTVA 1GUWA 1MI2A 1WTXA 1HUNA 3GV3A 1O80A 2L1BA 2NYZD 2BDNA 3FDTA 3I91A 4X3UA 2KUMA 2B2YC 4ZAIA 3I90A 4ZKBB 5JJZA 2K1BA 2J7ZA 4HAEA 5T1GA 4R8IA 2B2VA 2B2UC 2RA4A 2N88A 1NCVA 2HCIA 1PFMA 1WD0A 2KECA 3DM1A 1G2SA 1G6ZA 2N55A 2FMMA 1RTNA 1DONA 1BF4A 1HRJA 1MGSA 2M2LA 2MP1A 1BO0A 1QNKA 2SDFA 2Q8RE 1DOKA 3I3CA 1U4PA 2RVLA 3IFDA 2X6GA 1C8CA 1AZQA 2B2TC 1PDQA 1XX8A 1HUMA 2B2WA 4XDXA 3HP3A 1QG7A 1JICA 4IUTA 1ESRA 1WTRA 2X6LA 2NWGA 4CJ0B 1MSGA 2JP1A 5EJWA 2K28A 3TN2A 1J8IA 4IUVA 2FFKB 3DEOA 3QO2A 3Q6SA 1AP0A 4X3SA 1IKMA 1ML0D 3KUPA 5CORA 1DZ1A 1F9QA 1EQTA 4NW2A 2DY7A
chains in the Genus database with same CATH superfamily
1UE5A 2EY1A 1H9MA 4WORA 1LTSD 4QL5A 4ILWA 3I4OA 3HOZG 2RDFA 3NSWA 1QILA 4ID6A 3ONAB 3GTPB 3NTHA 1HZ9A 1PZID 3PO3H 1PZKD 4XT3B 2YTYA 1H9KA 3QOJA 4K5XA 1V1QA 4A3EB 2KOLA 2F0PA 3L3OC 4BY1H 4FVMA 4QUCA 2E2DC 3PIO3 1S4ZA 2RSOA 2HIXA 3G7LA 4RKBA 3T53B 1TS3A 2L11A 5A2QL 4KY5A 2EYPA 3CMAA 4GKJL 3HOXB 3RR5A 3UDFA 1O7ZA 1WTQA 3EQLC 3HOWH 1B9NA 4ABNA 2NN6I 5CBAE 2WP8J 3Q22A 1K0SA 2VZAA 1CQFA 2PQAA 2UUCQ 3K6OA 1IXRA 1TWHH 2KVMA 4R4CA 3GTLH 4DR6Q 4FYDA 4CDDC 1HZAA 2VY3A 4OEMB 2B29A 4XIGS 4OIKA 3I56A 5M5XB 1DD2A 1JT8A 5DLQE 3HEJA 4PZ7A 1KNAA 4LUVA 4HMJA 2BA1A 4DV5Q 2PZTA 2E8GA 2F0NA 2IT1A 4MTKA 2QA4A 1LO5D 1SNMA 2UXDQ 2F0GA 1YHBA 3A54A 2EE1A 4A3GH 1PH3A 5M5WB 2AWNA 3ND9A 4DXFA 2F0FA 1Q8KA 4Q0FA 3M7NA 1EYAA 3P20A 1W6JA 1O78A 4BBSG 2N88A 1I4RA 3VA7A 4UHVA 1M4VA 3I70A 2N55A 2UXCQ 1G6ZA 4XTCS 3RLNA 2L55A 5C3EH 4JI8L 4RMFA 4OWTB 4C3JH 3PO2B 3AQQA 2F4IA 4XDXA 4QQBX 4LAAA 3GDEA 4DV7Q 3DM3A 3SK5A 3S15B 3J80c 3OSOA 1N9WA 1XTCD 5C44H 3HOVG 4C1NI 1XMQQ 3QIAA 1IBLQ 1AE3A 1HA5A 2QF7A 4IQZA 2Z9HA 3GTKB 1K8MA 4LF4Q 2KENA 5C3WA 4A3DB 5FJ8G 4MTNA 2EIFA 1RCVD 4J15A 4J6HA 2F0HA 5I2XA 1GKHA 1YHQA 2VXWA 4BXXH 1JQYD 4JVZA 3D3RA 1E0BA 4P74A 1HNWQ 1I4GA 2R6GA 1VQ5A 1KAAA 3N52A 3LNNA 2E2HH 4B3RL 4K2LA 3D8GA 5D3IB 4P72A 4BWGB 3S2DH 2FINB 3OHXC 1M1KC 3ZYYX 1STHA 4JK1C 1VQPA 2NN6G 4X3KA 4A3FH 2HCCA 4RGOS 2CQOA 2BOSA 3KLRA 2JA8G 1IBML 3NELA 4X65Q 1C7YA 4B3MQ 4BA2I 4FO2A 1E1OA 4JI3Q 4MZ9A 3UI2A 1FNUA 1IYUA 2F0EA 1SYCA 4G57A 4M1UB 5G3LD 4OGQC 4CHTB 2A6ED 1PA6A 2YYZA 5CC4A 3KBXA 4IFDH 2CW0D 1PH9A 1QUQA 3VYSA 4GNXB 4LFBQ 3PF5A 4FDBA 1S5BD 1CM9A 2WKCA 3B6YA 3CW2C 1HXYD 2NVXB 3BZKA 3GTQH 1PTOH 1VS0A 1SFOH 3TZDA 1DYQA 1SNDA 3BG3A 2OF1A 3PIPA 1YNNC 1JJCB 1VQ6A 4HIOA 2A8VA 1VQDA 3NXWA 1BBUA 3CHBD 1VQMA 3AU7A 4X3UA 3FDTA 5M3MH 4KD3A 4RGMA 5T1GA 3VR3A 4C3HH 3TP6A 4LFCQ 3H6MA 5EGTA 1JJGA 4JI1L 3GQBA 2PMZB 1QVCA 1V8QA 4GKKQ 2VS1A 4OX9L 1Y8OB 3FP9A 3TSSA 1K28A 1KABA 4OO1I 4DAPA 1YZ6A 1HQRD 4DU9A 1SYEA 2R7FA 3GTLB 3UDIA 5EJWA 3S2HB 3KF8A 1CFMA 3PV0A 5FK9C 2K14A 1PRTF 4PZ8A 3A0JA 4HIDA 2K7VA 1CSPA 4JI0Q 2Q8TA 2K03A 3LGJA 1VQBA 4OWXB 1WYDA 3RN5A 2PNHA 1L2FA 4Y52H 4V0BA 5JEAH 2AWOA 4OIJA 1I6HH 1V43A 2XWJB 1ENFA 4DNTB 5HURA 1K9MC 1RHPA 1E2VA 2FHTA 4LF9Q 4AYBE 2F03A 1U4RA 2EXZA 1LUZA 4RCOA 1RTOA 1ZKOA 5I6YA 3NQTA 1LV9A 4I65A 2UU9Q 1AZPA 3S1MB 2E76C 3CP0A 5KIXA 1BBWA 2NVQB 2F3WA 2B2UA 2FXQA 2XWBB 4OELB 1L1OB 1PZJD 5C3EB 4J8QA 4L5SA 5C4XG 2YV5A 4CJ2C 1HFNA 4C3JB 5ELBA 4YWKA 2O4XA 3J7ZC 1JCKB 2F4VQ 1B44D 1YI2A 4LF6L 1VQAA 1NUCA 4DR1Q 1IL2A 2E2IH 1JC7A 1KDCA 3TDQA 2G9DA 3PIP3 2VQEL 3I4MG 5D65A 3BDOA 2KCTA 1U5KA 1VQOA 2L5TA 4HJ5A 4H0LC 2V1CC 3P75A 5LMNQ 1I94Q 1JMCA 3DLLA 2IX1A 2A69C 3DMUA 4YHHQ 4DR2Q 3N6RA 2H1EA 5GADC 5IODA 3S2DB 1B9MA 3HOUG 4Y7NB 5GROA 3PUXA 1VQEA 1YIJA 4LMQD 3NP8A 3W5OA 1GUSA 1HR0L 1IW7D 3K57A 1JB7A 2NTSA 1OXSC 4DPGA 1WI5A 3F2CA 2B2YC 4ZKBB 5I9OA 2J7ZA 2RA4A 2H4OA 1E2ZA 2KECA 2NB0A 3HOYG 3TP7A 1KRSA 4GLVB 4JC0A 4XYQA 3V2TA 3NWTA 2C35B 1AZQA 1HNZL 1WFQA 4DV4L 4N8FA 4PMCA 3K8AA 1ET6A 3HP3A 4DR7Q 3CQZH 1V1PA 1MSGA 2K28A 1TWFH 2DJFC 2FFKB 2XN9C 1X56A 5IGFA 2F3IA 3GTGB 4IPCA 1SBBB 4R4IA 1D8LA 3A74A 4EQPA 3CPWA 3E0JA 5C5LA 3GTQB 4ZCKA 3SVMA 1NAPA 4GN3B 1SFOB 4A3MB 3R2TA 1VQNA 4KHZA 3HG9A 4QY7A 3M4QA 2P5ZX 3IL8A 1Y14B 2D9UA 4G7ZC 2K33A 5BN4A 4JYAL 3UDGA 5M3MB 4IPDA 3RNUA 5CYUA 2EVBA 1X3GA 3FVQA 1LT6D 5CV4A 4DR4L 2G9HD 2C9OA 4BA1I 2KBNA 1K83H 3HS0C 3GTMH 4JV5L 4A3EG 1A3TA 1SR3A 4IUQA 1ICWA 5CV5A 3GD7A 5KNDA 3NWSA 3K5LA 3HKSA 2EYFA 3CCVA 4GLXA 2GN5A 1MSHA 4CKEA 5DEHA 2GVBA 1JR0D 1SE2A 5D3DA 2ZTEA 3T4AC 3HOXG 4FXDA 1FJGQ 1TR5A 2NVYH 1BCPC 1B4OA 1D5XC 1H9RA 1F2ZA 2L9HA 2DY8A 4X62L 3MXNB 2WIIB 3J81i 1IKLA 1HTLD 3CC7A 1J5EL 4B3SL 3PF4A 3MC0B 1Q3LA 3K7UC 3MFGA 1S40A 3C46A 1MKHA 1K8OA 2B3GA 1KNEA 1A62A 1QZGA 1LM0A 3EVQA 3L0OA 1STGA 1B3QA 1B7YB 1TT2A 1CKMA 4RFBA 1I5FA 1VDZA 1WD0A 1PFMA 3IAYA 1FR3A 3PCOB 2VNUD 1BF4A 4DV6L 1QNKA 4GOPB 1EY0A 2PW7A 5EAYA 2JA6H 4X66L 3JC66 1JWSD 3AFPA 2AQ3B 4IUTA 4L8JA 5FOBB 2X6LA 1WTRA 4FF4A 4A3IH 2JP1A 2DGYA 5KYIA 2BDOA 3PO2G 1N32L 1Q81C 1TS2A 3W1BA 3QB3A 5CV6A 4BBRH 4R4TA 2Y0SE 1XMOQ 1N34L 3DWQA 5IYCH 3CF5A 5EBCA 4A3DG 1NR2A 4C56C 3EA6A 5IP7G 1Y69U 1TWAH 3M4PA 5C3XA 2RCFA 3K7AH 1LTBD 5KEEA 5IT9L 1UE1A 1RF2D 5A2QE 1XXGA 4F7XA 1JJ2A 4KD4A 5EPKA 1TU2B 1G91A 2E5LQ 4KHVA 2EPBA 3J81E 5IGEA 2A6HD 1XPRA 3FKIH 2IX0A 1RL2A 1WCMH 2A68D 1R9TH 3S16H 1BXTA 2Z4IA 3E6ZX 2IL8A 4JPBW 5H1SE 4RA8A 2AQ2B 2VL6A 4ZQ3A 2L4NA 1BVSA 2UUCL 2XVSA 1G8ZD 2ICEC 4TQUS 2JA7H 1SE3A 1IYVA 3SEBA 3S9WA 1HA6A 4FF1A 2K5VA 1S5DD 3OIQA 4DV5L 4A3LH 1A6XA 4IURA 4KJOA 5LL6S 2OEOA 2EY5A 4K5VA 3KJPA 2UXBL 3NEMA 1E7ZA 3EBEA 1EIYB 3UE0A 3GTMB 3C2PA 2A74C 5IGCA 3MXUA 2GA4B 1PH2A 3E5SA 1EWHA 4WJWA 4IO9A 4GS3A 1N33Q 4JI7L 2HCIA 4BY1G 3UE1A 1Q90A 1VQLA 3F2BA 2I07B 4XQQA 1FL0A 1MGSA 1UNSA 1JOOA 4LUOA 3T13A 2WFWA 2PQAB 2NVYB 1KXLA 1EEFD 3CPFA 4DV7L 2WAQB 2K6AA 2AUKA 1J8IA 1C0AA 4RKLA 4A3KB 3NHHA 1MIUA 3VYUA 2XSCA 3L2PA 4DV3Q 1PH4A 4G7HC 4V190 1IBLL 4NDXA 1DOMA 2DNEA 3W2DA 4LF7Q 2R93H 1KTKA 1Z6HA 3M4OH 1AH9A 1SRUA 4UAIA 1BNZA 3NPPA 3MA2B 4ME5A 3Q23A 5COYA 2WB1E 2CHBD 2PW5A 1HNWL 3ZJYC 3CC2A 2J4XA 4DFAA 5M3FH 3DWPA 4P75A 1KDBA 4A93H 5GAHC 4LF5L 4A3GG 2V4DA 4DUZQ 1YJWA 1G51A 4XQJA 3MVVA 1EU3A 2BCOA 3FPUB 3R93A 4LFAQ 2ES2A 1SNCA 1LT3D 1S72A 2I46A 2NZ1D 1EYGA 1JWUD 1SMYC 2D5DA 1OO9B 5C3EG 2F0IA 3S1QH 4C3JG 2WB1B 4ZRZA 5IGDA 3TREA 1PHJA 1NNXA 1X3FA 5JOBA 1L0XB 3HRZC 1R4PB 1I4QA 1PLFA 5HGQA 3K59A 1XNQL 3NTIA 1EEID 3A5ZB 4KN7C 4DK1A 4AYBG 4QCLA 2B39A 4FF2A 5BN3A 1F9PA 5ELFA 1IYJB 4FNFA 4CJ1B 1HFGA 1TWAB 1FVIA 4HSPA 3K7AB 4DUYQ 1KQSA 3X3NA 1KLUD 1CT1D 2R92H 3JAML 3PQIA 1WTVA 5IGGA 1PH8A 2YU9H 2HD3A 2D0PA 2HQLA 3J81L 2CFMA 1A8VA 3QJYA 4DK6C 4HJAA 2NYZD 4X64Q 2VB3X 4QF4A 2NUCA 4LUZA 3FKIB 2L0CA 2ICIA 4NXNQ 1CHQD 1PRTC 1R9TB 1PYWD 4QB4A 2A73B 1X9NA 4FXKC 3A56A 1Y1WH 3M4YA 2RVLA 2Z4HA 4G4KA 4DNRB 1VQFA 3SK6A 4KHPL 2EYOA 2JSOA 4H13C 3F2DA 1BR9A 1QUQB 3ERSX 1IKMA 5CORA 4PG3A 3I73A 5G3LF 5IYBH 1PTOD 1QOHA 4IUUA 2HHHQ 3WDNA 2Q2UA 3NE5B 2F0JA 2G5DA 3I72A 3P1HA 2MGSA 3AYHB 3M7GA 4DR5L 4PQXA 3E3XA 3HKZE 5EKKA 3O13A 4A3MG 3PGZA 4B3TQ 3A8JE 2K5QA 5FLMG 1SNPA 5M3MG 2X69A 1NBWA 1PV4A 1WVLA 4IPGA 3HOZH 2MO0A 3GTJB 2F0QA 5IOCA 4POGA 5I9PA 4QIWE 3S17H 3OWFA 3W3AA 4QUFA 3KF8B 3MHBA 3GV6A 1CSQA 1IL8A 1N36Q 2BE5C 1ASYA 3T1HQ 1D6EC 3RZOH 4N8X1 2AQ1B 5BR8L 1X3QA 3F2UA 3HFZB 4HSVA 1FGUA 2IPKD 2KEDA 3T16A 2R93B 1SYFA 5E4XA 1S5FD 4NXML 2K50A 2E2JB 5C4ZA 3BDLA 4IALA 3DXJC 3RLFA 2JQOA 3BVZA 4DV0L 1EY6A 4GZYC 2F3VA 2XRQD 3F1ZA 1ET9A 1C4QA 5JEAG 3OTOQ 2CH4W 1DXMA 1EFWA 5C4JB 3M3YH 4FXGC 1U4MA 4DR2L 2F0WA 2L12A 1SDFA 4DXGA 4JI6L 2RBMA 1RKNA 2HIVA 4JCVE 3G4SA 1STAA 1EZ8A 3S1NH 2Z8LA 3NK9A 3I91A 4JBJA 1RDPD 3KLSX 4ZAIA 4R8IA 3FPPA 1LT5D 1NMFA 3S1QB 1HRJA 3KLWA 4CGYB 2QKIC 3PO3B 1C8CA 5CV9A 4LF8L 3J7YW 3K5NA 2ZTCA 1FYCA 4DV1Q 1NY4A 1TY0A 3KBGA 4KI0A 4YCWA 2NWGA 4C3IH 2C5CA 1QVFA 1GOZA 2RDGA 4JBWA 5KNCA 5ISRA 1XPUA 4P73A 2OQKA 3D4DA 3E9HA 1Y8PB 3KYHC 4BY1B 3H3VC 5IYDH 3MTSA 1KAWA 3OW2A 2XIWA 1ENAA 1II3A 4KN4C 3NBIA 2Q2TA 4K6LA 3TEHB 2JEBI 1WTWA 3HOWB 4GKJQ 2R92B 4AQYQ 3OW7A 3JAMc 4C1NK 5LMUL 4G7OC 3NQIA 1TWHB 2RQXA 3FEWX 2KA7A 1H9SA 3AB9A 4HJ7A 3J81c 4RCNA 2QEJC 1W2BA 3L7ZC 4HEDA 1L0YB 2H5XA 4TKOB 3J7A5 2WACA 2F0TA 1Z7TA 1Y1WB 3ITPA 5IGBA 2KEEA 1F77A 4K5WA 2VUMH 4HR7B 1V1PB 4F87A 4A3GB 5I2YA 4IUPA 5AFWA 3A8KE 1HQMC 4O42A 3LWEA 3S1RH 1KL9A 2NN6H 4HIMA 2RF4A 2UUAL 1O7LA 3KJOA 1B8AA 1GXDC 1XNRL 2R61A 3P7JA 2EYJA 3G71A 1G6PA 2DNCA 1I3QH 1TXYA 4XYOA 5K36H 1H95A 4JI2L 2IX3A 1B50A 4HIKA 5DM73 3CU7A 1SSOA 5C44B 4DR3Q 1AEXA 1KHIA 2YTVA 4AYBB 1QNUA 1HTPA 2IHFA 4IJLA 4UP9A 4QGUA 1TQOA 2F0UA 1STNA 1X55A 4K0KQ 1PYBA 1VQJA 1SN8A 2WV6D 2ZJQA 2WKDA 3S17B 3WOFA 3DM1A 2SEBD 3S24A 2FMMA 1CHPD 1S5CD 1EOVA 5LMNW 3IFDA 2E2HB 1LTLA 3J7AV 3RZOB 2ZM6L 5L37A 4AIMA 2MHVA 2OTLA 2NZOA 1PXUA 4A3FB 2CWAA 2NVTH 3QO2A 3MEFA 2QGQA 2WAQG 4JI5Q 4A3KG 4FF3A 3BVMA 4N9TA 3M3YB 1VQKA 3TS2A 1XMOL 5IT9E 3LWUA 5F2DA 5EKIA 3VYTA 3A7LA 4PV1C 1E24A 4A3JH 1BCPB 2VW9A 2ZJRA 2EOTA 3PUYA 1OXVA 3I55A 1ASZA 3S1NB 1E22A 1T5EA 2B8FA 4M8AA 3STBC 1EYCA 3GTOH 4ZK9B 2MUYA 2R7ZH 1IBKL 2B2YA 3MZ5A 1EIHA 4L5RC 1ZYRC 4ZYSA 2FJ2A 2M00A 4KKTA 2VQFL 1PTOB 3EFXD 4UPAA 1WTOA 3K5OA 1CKNA 1D5ZC 2ZTDA 1LYLA 2PNRC 1VQ8A 4ZLTF 4C3IB 1AW7A 1W6KA 5D14A 1EY8A 5E3FA 1YNXA 2JA6G 1X65A 3NBHA 1Y1VH 4PNYA 4X6AH 2EYHA 1YJNA 5JJLA 3WWVA 1CQVA 2WB1G 4XT1B 4C3HB 5AJ3L 4L63B 3M85A 4R4QA 4JI1Q 1FNVA 2IW3A 3ER0A 4A3CH 3IRBA 4ODGA 1VF5C 3ULLA 4OX9Q 3QOLA 1EUJA 2F0DA 1M90C 5IYCG 1WTPA 2EZVA 3H0GH 4F88A 2BH2A 1ILQA 2K32A 4DK3C 3QG1A 1JE5A 3EROA 1TWCH 1G291 2CWPA 1NSNS 2K5WA 1K3BC 3U9OA 1BKBA 5JEAJ 4XXEA 3JAMi 1P8LA 2VUMB 5IP9H 1PVOA 4KLKA 1I6HB 3IKJA 4YWMA 2B8GA 2MNAA 4KJNA 4LK1C 1HNXL 1QJOA 3FKIG 4Q5VA 1XX8A 3SXHA 5C6AA 1FGBD 1Z9FA 3I7FA 1OXUA 3G6JB 1AFPA 2LXKA 2LY7A 4IUVA 1QZHA 4OO1H 3SE0A 5A35A 4IOAA 2O2LD 5C0XH 3V96A 3TBIB 1LLRD 4E6IA 1I3QB 1HHVA 1U4LA 3R2IA 4YY3Q 4A3BH 1R4QB 1X32A 1LTAD 1EU4A 2F0LA 2PZWA 4KMUC 4LF6Q 4A3LG 2E2IB 1OXTA 2UUBQ 2PYKA 4O2DA 4ZUIA 4L5QA 2VQEQ 1K8GA 1O7YA 4TVAB 3AFQA 1HH2P 2A5HA 4RGTA 1XWEA 4TSSA 5ELDA 1YNND 2EDGA 2IWHA 3CCRA 1EYDA 1XJVA 3TRZA 4YIJA 2QW7A 3V05A 2O5JC 4HJ9A 2JA9A 1UWVA 3KOJA 4I7AA 5K5PA 4YCUA 2AMCB 1QVGA 3OOCA 2K75A 4DV2Q 4IUNA 3SK4A 1T9HA 2LKVA 1ZXTA 4DAYB 3H91A 5FO7B 3JAME 2BA0A 2XTIA 1EL0A 3ICEA 2R93G 2B2VC 1TWGH 5FKAC 1YNJC 1HNZQ 3GP7A 1EIGA 2Y0SB 4DV4Q 2HDMA 1F2LA 4KK7A 3CQZB 4EX5A 2AHOB 5NUCA 1I6VC 1TWFB 2A1AA 2R3ZA 4ULLA 4RWSC 5M3FG 2B2WC 2JA5H 3RLOA 1MI2A 3VA5A 1WTXA 4DK0A 1O80A 1U0LA 2EJGC 5FO8B 5HY6A 5HGTA 4X64L 2K1BA 4GLAC 4DR6L 2B2VA 1VQCA 2DN8A 3C1FA 3D4RA 1VQHA 1G2SA 5M5XH 3TP8A 4BY7H 4PMWA 2XNAC 1CUKA 2L15A 4CKBA 2B2TC 1EQQA 1PDQA 2F0MA 1Y1VB 4PMBA 4JYAQ 2B2WA 4DNIA 4DAVA 2UXDL 1JICA 4OL7A 5FLXL 3PO3G 3C1EA 1UEAB 1S5ED 1K83B 4JOIC 1AP0A 2OXPA 3U4VA 2DY7A 5M5WH 3VR6A 1XYIA 4JV5Q 1B53A 1F9RA 2CCZA 1Q82C 5IY0A 4H02A 1N8RC 4JBMA 1X3PA 2SNMA 3SHLA 1EWIA 1Q12A 4EQNA 1G2TA 5JJKA 5JPMC 2UXCL 4UDUC 2K5HA 2Q2HA 4RG1A 3CRKC 2A69D 2R92G 1RODA 3HOWG 4CKCA 3J80L 1PH5A 3PO2H 3H3VH 1XTDA 5EPJA 3MEHA 3R8BA 1PFBA 3KF6A 1FNWA 1LTTD 4X62Q 3S15H 1XMQL 1B3AA 1KIXA 1RD9D 1J5EQ 4B3SQ 4LF4L 3GTKH 4DAYA 4S3SA 2RSNA 1V1OA 3BYTB 2N49A 1Y1WG 1YVCA 3ND8A 5CV8A 4IOCA 3NENA 2FMCA 4IFDI 4LJZC 3T1HL 4LNQA 1PRTB 3W1GA 2E75C 5IYBG 4MHEA 1F9SA 4Z9CB 4JI4Q 2ZXPA 3LX0A 2QCPX 3STBD 1OXXK 1L0WA 1B2TA 2F52A 4DV6Q 2VB2X 1FD7D 2DJGC 4EQOA 1EOTA 2PCFB 4HJ8A 3RZDH 2JA6B 4X65L 4B3ML 2N8NA 4JI3L 2Z6KC 4A3IB 3I4NH 1UEBA 1X54A 2J0TD 3OMCA 5TSSA 1D1IA 4K14A 1H9JA 1B70B 1HUNA 4KKSA 4NMZA 5C5MA 3URYA 4BBRB 5C44G 3SGIA 2KUMA 3I4LA 3KDFA 2IJ0A 1YBYA 1ENCA 1N34Q 4KY7A 2ZXOA 4POFA 3D4WA 4LFBL 4LWCA 1VQGA 2M2LA 1BO0A 1IHZA 2Z6KA 4DGZA 2NVXH 4BXXG 3MFYA 1CKOA 2X6GA 1P16A 4OWWB 3A7AB 3FHWA 2A19A 1GHJA 4DV1L 1PH7A 3C3LA 1TIID 4CJ0B 3VYRA 5IT9c 3CRLC 3DEOA 1ML0D 2RHQB 5ELEA 1EY4A 5ELOA 1TWGB 5IE8A 2OWOA 1HCZA 4A3FG 3QR8A 1V9PA 5EPLA 1RIPA 1PFNA 4LW1A 1WCMB 1BCPD 4LFCL 3S16B 1M8AA 5CGKA 5I4DA 1IW7C 4GKKL 4BS9A 2JA5B 1AE2A 4KTAA 4AQYL 1CA6A 1CI3M 2I5MX 5M9OA 1Q7YC 4NKLA 2ATWA 3VR2A 1WOCA 4HCEA 4HTHA 3S2HH 1QCBD 3T1YQ 1VQ7A 2JA7B 2RKSA 4IFDG 4BY7B 5GAGC 2K04A 3WOEA 3RD4A 1SE4A 4JI0L 2B63H 3D6WA 5KNBA 1O7IA 1HZBA 4R9WA 1HZCA 1YHAA 4EGVA 1STYA 4LF9L 2UXBQ 5FLXc 4KKUA 1WTHA 3MXGA 5IWAQ 4C3IG 2IHEA 2UU9L 1E3PA 3S1MH 1K0RA 5J22A 5IYDG 5EKLA 3I8ZA 4JI7Q 3GO5A 4YCVA 2NVQH 4C3HG 4CDFC 1SNQA 1MJCA 5JVG3 1Y8NB 1NMGA 3PSIA 1VQ4A 1H9SB 2F4VL 4QMGA 3CXCA 5T1IA 4DR3L 3HKZB 4C2MH 4DR1L 1KD1C 3X3MA 1GUOA 1F2YA 4DA2A 3J7AF 3CKIB 2BDNA 4CBVA 5J3BA 2JE6I 4WJ3M 3M4OB 3OMGA 4ALPA 4K0KL 1SYGA 2OT2A 3KLSA 2KCCA 4IZ8A 1Q1BA 3TQYA 5LMNL 5IIFA 2ZXRA 1I94L 2VUMG 3ULJA 3I3CA 5EBDA 1U4PA 2N78A 1JOQA 5M3FB 2Q2IA 2OTJA 4QJFA 4YHHL 3AEVA 4A93B 3BDCA 2F0VA 4LF5Q 4UY8C 1YNJD 4QIWB 3CCQA 4Y7NH 1EY5A 2AUJD 1GD7A 1EQTA 3G48A 1LACA 5JAVA 4ZKCB 1QB5D 2K01A 3VDYA 2HDLA 3BYYB 4JI5L 3KK7A 3RZDB 2Z6BA 4YWLA 1MBYA 2BH8A 3I4NB 1NTGA 1SYBA 5K36G 3KFUA 1VMPA 1EIFA 3E9IA 3E0EA 4DR7L 1GUGA 1XNQQ 1ICFB 4ME3A 2LXJA 2PMZE 3CCUA 3T51B 4BBSH 3GTGH 2JK8A 4MIUA 3ERQA 5CMDA 4H44C 1IZ6A 1MD2D 1LTID 2PPBC 1PMRA 4A3MH 2Z0SA 1ESFA 5M5YH 5J39A 2JEAI 4U68A 2YU9B 3CCMA 1U9RA 1I50H 3CCEA 3HOVH 5FLMH 1SJHD 3A8IE 5C4HA 1DOLA 2CKZB 1JOKA 2IY5B 1TKWB 2E74C 1XPOA 2F1MA 4K8IA 1KLGD 5FJ8H 4NPSA 2JN4A 1I4XA 2JYOA 4IJHA 3AMUA 3DUZA 2PI2E 1Q1EA 4JW0A 4A3JG 3L9AX 4KHPQ 2EYLA 1QWYA 5C0XI 1VQ9A 1NJIC 3DEPA 1RJTA 2Y0SG 2JXMB 2R7ZG 3GV3A 2A6HC 2L1BA 5JJZA 1FJGL 2B63B 3RMHA 1YJ9A 1I4PA 2A68C 2TSSA 2KJXA 1CKNB 2B2UC 1SEBD 2ZT9C 4XQNA 1GHKA 1NCVA 2JA8H 4DR5Q 1STBA 3I2ZA 3EJIA 1K8AC 3VR4A 1ONLA 2PZUA 4JI8Q 4GNXC 2EY2A 5CV7A 4WRDA 3CC4A 2ZJPA 2KHSA 3PUZA 3NBHB 4UP8A 1Z47A 3T56B 1HUMA 1WJJA 1SLJA 2PQEA 4R4OA 1SMYD 1Y1VG 4A4IA 4PZ6A 4A75A 3PUVA 3TZUA 3HOZB 2K05A 4GN5A 4A3CG 1PYSB 3MAQA 4GNXA 5ELNA 2QILA 4MN3A 4YY3L 1SXTA 2MPMA 3BS1A 3J81j 2RCNA 1TY2A 1VMCA 3PUWA 1UUPA 4C2MB 1CA5A 3H0GG 2UUBL 1F2MA 4B3RQ 3A55A 5BR8Q 3K5MA 1JB3A 4NP5A 1KDAA 1E1TA 1UE7A 4OONA 4NXMQ 2O5IC 4JG2A 2F0SA 5BN5A 1VF7A 1A15A 1K73C 4DV0Q 3J80i 5CBEE 3S14H 2EJFC 5IP9G 1IBMQ 4DN4M 5E4WC 5FO9B 3OYYA 3H15A 1NR4A 5JJIA 4P71A 2MO1A 4A76A 3DHQA 3VR5A 4JI6Q 1MHWC 1HPCA 4IFDJ 1SAPA 1PRTD 1STEA 3CCSA 2MJ8A 2EJMA 1D7QA 4J1MA 1T5XD 1UAPA 4RH6A 4DV2L 4OO1G 1X3EA 2MFIA 3Q0AA 4APVA 1LTRD 4O0AA 5C0XG 2NBFA 4RHRA 1QE6A 1C9OA 4MNOA 5GAEC 3UDXA 3M9BA 2E5LL 4A3BG 3K0XA 3A5UA 4LF8Q 4B9XA 1L1OC 3Q8DA 1SROA 3RN2A 1MJEA 5E7NA 1GUNA 2ASBA 2LMCB 2N3SA 4A3IG 4BBSB 1GVPA 2PI2A 3I90A 4RGNA 4EVOA 3U58A 5FLXE 5C4XH 4GN4B 4BBRG 1BOSA 5M5YB 2K5DA 2I0QA 1RTNA 2TMPA 2ID0A 1L1OA 1Q46A 2XGTA 2NZHA 3D0FA 4F8MA 1DOKA 1I50B 1S3OA 1EQVA 3HOVB 3H3VI 5CR3A 5LMUQ 2KQ3A 3EIVA 1BUVT 2PO4A 3CD6A 3RUZA 3I4MH 2RHSB 4R1JA 2D0OA 1DZ1A 3H94A 4OXPA 3ULPA 2EXDA 2BE5D 4HCSA 5LL6X 5GQOA 2MQHA 3J80E 3H09A 3BZCA 1N33L 1CZGA 2XRSD 3EN2A 4CDCC 4OHJA 3D6CA 2K5NA 1GJXA 1TVXA 2ENBA 1WCMG 2K52A 1TS5A 3F8TA 3HOUH 1LTGD 5DAUA 3CAMA 3S1RB 4N9PA 1CZWA 1OTCA 2ALYB 4DAMA 2UUAQ 4L6TB 2Q8IB 2JA5G 2I5HA 3OWEB 4TRDA 1SJED 1A3VA 1EY9A 1XNRQ 2JA8B 5JVH3 2HUGA 5DNFA 4DV3L 4A3KH 4AH6A 5KYLA 2CQAA 1WD1A 1BBXC 3HOYH 3TMEA 5LHY1 3CCJA 1ZEQX 4LF7L 2JA7G 2R7DA 4JI2Q 1W3SA 2D2CC 4BY7G 1JE4A 1PTOC 3SDZA 4I7ZC 2LS01 1TS4A 1PFSA 3K81C 3QWNA 4DKAC 3CMEA 1AN8A 3HGBA 4DUZL 2M9VA 2K4KA 4JI4L 3BZDB 5I6WA 2QDLA 4LFAL 3BU2A 1A2TA 1JORA 1C48A 2GVAA 2KHJA 2KHIA 3Q24A 4K8JA 2ZM6Q 1D1KA 1Q8IA 1DGSA 2EY6A 1LT4D 2JJQA 3FMCA 4FP5D 4JBKA 4IPHA 1ILPA 4IN3A 2NVTB 3KF6B 1HJPA 1HR0Q 3GTPH 1X6OA 3HZXA 1SE8A 3S14B 1HR0W 3HKZG 4U673 4L5TA 4A3EH 1DCZA 1I4HA 3BJUA 1BQQT 3MXPA 4A3JB 2NTTA 3SK8A 4ZUJA 2SDFA 2RDHA 1KRTA 1K3RA 3GTOB 4DUYL 2R7ZB 1QG7A 1LABA 1JWMD 1D2BA 2QDBA 1IBKQ 3HOXH 4RHSA 4A93G 1GO3E 2I5LX 3KUPA 1F9QA 4DF7A 2HT1A 2VQFQ 1BDOA 1KC8C 3IFTA 4P2CB 2F0KA 1PH1A 3K58A 4KV6A 2DUDA 1EQRA 3MXNA 2OQ0A 4NXNL 3TS0A 2A6EC 1GUTA 5E1FA 2WINB 1Q86C 2CVRA 3K0YA 1SMXA 1CTMA 5KRUA 2HQEA 2EQSA 3R3OA 3I4NG 2CW0C 3G6EA 4RAUC 4O1NA 3KDFB 4GOPC 1PH6A 5AJ3Q 4DR4Q 5C4XB 2D62A 1NE3A 1SYDA 3T1YL 3U9SA 5DM63 2LSSA 2KCNA 2SOBA 2HHHL 2QEXA 3DWAA 1EZ6A 4B08A 5EQ0A 1EY7A 4H7BA 3H0GB 2WAQE 2B2TA 1TWCB 2AKWB 3I4MB 4K2KA 4GOPA 1A2UA 3K80C 3PMFA 4B9WA 3MWYW 4JOIA 1E2WA 5IWAL 4B3TL 1VQIA 4R8NA 2EYMA 3PIOA 1J6QA 2F0OA 4EQ5A 4HMIA 1J9OA 4HN7A 2Z1CA 3NUCA 2CH4A 1HNXQ 1GM5A 3BVGA 1B1ZA 3HOUB 3SR1A 1D5MC 1YEZA 4A3DH 1SNOA 4X3TA 1A0IA 5IP7H 3TP5A 5C0XJ 3GTJH 1BCPF 4WFN3 3U50C 3CCLA 4CDEC 1A63A 4WJ4A 1YITA 1GUWA 3D31A 1N36L 2SNSA 3HOYB 2OCEA 5KGUA 3FRPB 1DJRD 3NTKA 1A3UA 4HAEA 4A3BB 1CK1A 4KY6A 2E2JH 2LFNA 5JPNC 1PTOF 2B63G 1DONA 1VCIA 2MP1A 5ELCA 1ZYRD 2Q8RE 3OTOL 1EFID 4K6DA 5C4JH 4X66Q 3OPOA 1EWCA 5J1ZA 4UP7A 3U4ZA 1ESRA 4NB3A 3TN2A 1N32Q 1UE6A 3Q6SA 4X3SA 3OIPA 1DM0B 2YTXA 4NW2A 2KCMA
chains in the Genus database with same CATH topology
2EY1A 1H9MA 4WORA 1LTSD 4ILWA 2RDFA 3NSWA 1QILA 4ID6A 3ONAB 3GTPB 3NTHA 1PZID 1PZKD 4XT3B 1H9KA 3QOJA 4K5XA 4A3EB 2KOLA 2F0PA 3L3OC 4FVMA 4QUCA 2E2DC 3PIO3 1S4ZA 2RSOA 3G7LA 3T53B 4RKBA 1TS3A 2L11A 5A2QL 4KY5A 2EYPA 3HOXB 1WTQA 1O7ZA 3EQLC 1B9NA 4ABNA 2NN6I 5CBAE 2WP8J 3Q22A 1CQFA 3K6OA 2KVMA 4FYDA 4XIGS 1DD2A 4OIKA 5M5XB 3HEJA 1KNAA 4HMJA 2BA1A 2PZTA 2F0NA 2IT1A 1LO5D 1SNMA 2F0GA 3A54A 2EE1A 5M5WB 2AWNA 3ND9A 4DXFA 2F0FA 4Q0FA 3M7NA 1EYAA 3P20A 1W6JA 1O78A 2N88A 1I4RA 3VA7A 1M4VA 3I70A 2N55A 1G6ZA 4XTCS 2L55A 3PO2B 2F4IA 4XDXA 4LAAA 3SK5A 3S15B 3OSOA 1XTCD 4C1NI 3QIAA 1HA5A 2QF7A 4IQZA 3GTKB 1K8MA 5C3WA 4A3DB 1RCVD 4J6HA 2F0HA 5I2XA 2VXWA 1JQYD 3D3RA 1E0BA 1I4GA 2R6GA 1KAAA 3N52A 3LNNA 4K2LA 3D8GA 5D3IB 4BWGB 2FINB 3OHXC 3ZYYX 1STHA 4JK1C 2NN6G 4X3KA 2HCCA 4RGOS 2BOSA 3KLRA 4BA2I 4FO2A 3UI2A 1FNUA 1IYUA 2F0EA 1SYCA 4G57A 4M1UB 5G3LD 4OGQC 4CHTB 2A6ED 2YYZA 5CC4A 3KBXA 4IFDH 2CW0D 3VYSA 1S5BD 1CM9A 2WKCA 1HXYD 2NVXB 1PTOH 3TZDA 1DYQA 1SNDA 3BG3A 2OF1A 1YNNC 3NXWA 3CHBD 3AU7A 4X3UA 3FDTA 4KD3A 4RGMA 5T1GA 3VR3A 3TP6A 3H6MA 5EGTA 3GQBA 2PMZB 1V8QA 1Y8OB 3TSSA 1KABA 4OO1I 4DAPA 1HQRD 4DU9A 1SYEA 3GTLB 5EJWA 3S2HB 3KF8A 1CFMA 3PV0A 5FK9C 1PRTF 2K7VA 2Q8TA 2K03A 4V0BA 5JEAH 2AWOA 4OIJA 1V43A 2XWJB 1ENFA 4DNTB 5HURA 1RHPA 1E2VA 2FHTA 2F03A 1U4RA 2EXZA 4RCOA 1RTOA 1ZKOA 5I6YA 3NQTA 1LV9A 4I65A 3S1MB 1AZPA 2E76C 5KIXA 2NVQB 2F3WA 2B2UA 2XWBB 1PZJD 5C3EB 4J8QA 4CJ2C 1HFNA 4C3JB 5ELBA 2O4XA 1JCKB 1B44D 1NUCA 1JC7A 1KDCA 3TDQA 2G9DA 3PIP3 5D65A 3BDOA 2L5TA 4H0LC 3P75A 2IX1A 2A69C 3DMUA 3N6RA 2H1EA 5IODA 3S2DB 1B9MA 4Y7NB 3PUXA 4LMQD 3NP8A 1GUSA 1IW7D 3K57A 2NTSA 1OXSC 2B2YC 4ZKBB 5I9OA 2J7ZA 2RA4A 2H4OA 1E2ZA 2KECA 2NB0A 3TP7A 4XYQA 3V2TA 3NWTA 1AZQA 4PMCA 1ET6A 3HP3A 1V1PA 1MSGA 2K28A 2FFKB 2XN9C 5IGFA 3GTGB 1SBBB 4EQPA 3E0JA 5C5LA 3GTQB 3SVMA 1NAPA 1SFOB 4A3MB 3R2TA 4KHZA 3HG9A 3IL8A 2D9UA 4G7ZC 2K33A 5BN4A 5M3MB 5CYUA 2EVBA 3FVQA 1LT6D 5CV4A 2G9HD 2C9OA 4BA1I 3HS0C 1A3TA 4IUQA 1ICWA 5CV5A 3GD7A 5KNDA 3NWSA 3K5LA 2EYFA 4CKEA 1MSHA 5DEHA 1JR0D 1SE2A 5D3DA 3T4AC 4FXDA 1TR5A 1BCPC 1B4OA 1D5XC 1H9RA 1F2ZA 2L9HA 2DY8A 2WIIB 1IKLA 1HTLD 3MC0B 1Q3LA 3MFGA 3C46A 1K8OA 1KNEA 3EVQA 1STGA 1TT2A 4RFBA 1VDZA 1WD0A 1PFMA 3IAYA 1FR3A 2VNUD 1BF4A 1QNKA 1EY0A 2PW7A 1JWSD 2AQ3B 4IUTA 4L8JA 5FOBB 2X6LA 1WTRA 4FF4A 2JP1A 5KYIA 2BDOA 1TS2A 3QB3A 5CV6A 3DWQA 5EBCA 1NR2A 4C56C 3EA6A 1Y69U 5C3XA 1LTBD 5KEEA 5IT9L 1RF2D 5A2QE 1XXGA 4F7XA 4KD4A 5EPKA 1TU2B 1G91A 4KHVA 2EPBA 3J81E 5IGEA 2A6HD 2IX0A 2A68D 1BXTA 2Z4IA 3E6ZX 2IL8A 4RA8A 2AQ2B 4ZQ3A 2L4NA 2XVSA 1G8ZD 2ICEC 4TQUS 1SE3A 1IYVA 3SEBA 3S9WA 1HA6A 4FF1A 1S5DD 3OIQA 1A6XA 4IURA 4KJOA 5LL6S 2OEOA 2EY5A 4K5VA 3GTMB 3C2PA 2A74C 5IGCA 3MXUA 2GA4B 3E5SA 1EWHA 4WJWA 2HCIA 1Q90A 2I07B 4XQQA 1MGSA 1UNSA 1JOOA 3T13A 2NVYB 1EEFD 2WAQB 2K6AA 2AUKA 1J8IA 4RKLA 4A3KB 3NHHA 3VYUA 2XSCA 4V190 4G7HC 4NDXA 1DOMA 2DNEA 3W2DA 1KTKA 1Z6HA 4UAIA 1BNZA 3NPPA 3MA2B 4ME5A 3Q23A 5COYA 2CHBD 2PW5A 2J4XA 4DFAA 3DWPA 1KDBA 2V4DA 4XQJA 3MVVA 1EU3A 2BCOA 3FPUB 3R93A 1SNCA 1LT3D 2I46A 2NZ1D 1JWUD 1SMYC 2D5DA 1OO9B 2F0IA 4C3JG 2WB1B 4ZRZA 5IGDA 5JOBA 1L0XB 3HRZC 1R4PB 1I4QA 1PLFA 3K59A 3NTIA 1EEID 4KN7C 4DK1A 4QCLA 2B39A 4FF2A 5BN3A 1F9PA 5ELFA 4FNFA 4CJ1B 1HFGA 1TWAB 4HSPA 3K7AB 3X3NA 1KLUD 1CT1D 3JAML 1WTVA 5IGGA 3J81L 3QJYA 2NYZD 2VB3X 4QF4A 2NUCA 3FKIB 2L0CA 2ICIA 1CHQD 1PRTC 1R9TB 1PYWD 4QB4A 2A73B 4FXKC 3A56A 3M4YA 2RVLA 2Z4HA 4G4KA 4DNRB 3SK6A 2EYOA 2JSOA 4H13C 1BR9A 1IKMA 5CORA 5G3LF 3I73A 1PTOD 1QOHA 4IUUA 3WDNA 3NE5B 2F0JA 3I72A 3P1HA 2MGSA 3M7GA 4PQXA 5EKKA 3O13A 3A8JE 2K5QA 1SNPA 2X69A 1WVLA 3GTJB 2F0QA 5IOCA 5I9PA 3OWFA 3W3AA 4QUFA 3MHBA 3GV6A 1IL8A 2BE5C 1D6EC 2AQ1B 1X3QA 3F2UA 4HSVA 2IPKD 2KEDA 3T16A 2R93B 1SYFA 5E4XA 1S5FD 2E2JB 5C4ZA 3BDLA 4IALA 3DXJC 3RLFA 3BVZA 1EY6A 4GZYC 2F3VA 2XRQD 1ET9A 1C4QA 5JEAG 1DXMA 5C4JB 4FXGC 1U4MA 2F0WA 2L12A 1SDFA 4DXGA 2RBMA 1RKNA 1STAA 1EZ8A 2Z8LA 3NK9A 3I91A 1RDPD 3KLSX 4ZAIA 4R8IA 3FPPA 1LT5D 3S1QB 1HRJA 4CGYB 2QKIC 3PO3B 1C8CA 5CV9A 3J7YW 3K5NA 1FYCA 1TY0A 3KBGA 4KI0A 2NWGA 2C5CA 1GOZA 2RDGA 4JBWA 5KNCA 5ISRA 3D4DA 4BY1B 1Y8PB 3H3VC 3MTSA 2XIWA 1ENAA 1II3A 4KN4C 3NBIA 4K6LA 2JEBI 1WTWA 3HOWB 2R92B 3OW7A 4C1NK 4G7OC 3NQIA 1TWHB 2RQXA 3FEWX 2KA7A 1H9SA 3AB9A 4RCNA 2QEJC 3L7ZC 4HEDA 1L0YB 4TKOB 2WACA 2F0TA 1Z7TA 1Y1WB 3ITPA 5IGBA 2KEEA 1F77A 4K5WA 4HR7B 1V1PB 4F87A 4A3GB 5I2YA 4IUPA 5AFWA 3A8KE 1HQMC 4O42A 3LWEA 2NN6H 1O7LA 1GXDC 2R61A 3P7JA 2EYJA 2DNCA 4XYOA 5K36H 2IX3A 1B50A 5DM73 3CU7A 1SSOA 5C44B 1AEXA 4AYBB 1QNUA 1HTPA 1TQOA 2F0UA 1STNA 2WV6D 2WKDA 3S17B 3WOFA 3DM1A 2SEBD 2FMMA 1CHPD 1S5CD 3IFDA 2E2HB 3J7AV 3RZOB 2MHVA 1PXUA 4A3FB 3QO2A 4FF3A 3BVMA 4N9TA 3M3YB 5IT9E 3LWUA 5F2DA 5EKIA 3VYTA 3A7LA 4PV1C 1BCPB 2EOTA 3PUYA 1OXVA 3S1NB 1T5EA 4M8AA 2B8FA 1EYCA 4ZK9B 2MUYA 2B2YA 3MZ5A 1EIHA 1ZYRC 4ZYSA 2FJ2A 2M00A 4KKTA 1PTOB 3EFXD 1WTOA 3K5OA 1D5ZC 2PNRC 4ZLTF 4C3IB 1AW7A 1W6KA 5D14A 1EY8A 5E3FA 3NBHA 4PNYA 2EYHA 1CQVA 4XT1B 4C3HB 4L63B 3M85A 1FNVA 2IW3A 4ODGA 1VF5C 3QOLA 2F0DA 1WTPA 2EZVA 4F88A 1ILQA 2K32A 3QG1A 3EROA 1G291 1NSNS 2K5WA 3U9OA 5JEAJ 4XXEA 2VUMB 1I6HB 3IKJA 2B8GA 4KJNA 4LK1C 1QJOA 4Q5VA 1XX8A 3SXHA 5C6AA 1FGBD 1OXUA 3G6JB 1AFPA 4IUVA 2LY7A 4OO1H 3SE0A 5A35A 2O2LD 5C0XH 3V96A 3TBIB 1LLRD 4E6IA 1I3QB 1HHVA 1U4LA 3R2IA 1R4QB 1X32A 1LTAD 1EU4A 2F0LA 2PZWA 4KMUC 2E2IB 1OXTA 2PYKA 4ZUIA 1O7YA 2A5HA 4RGTA 1XWEA 4TSSA 5ELDA 1YNND 2EDGA 2IWHA 1EYDA 4YIJA 3V05A 2O5JC 5K5PA 3OOCA 4IUNA 3SK4A 2LKVA 1ZXTA 3H91A 5FO7B 3JAME 2BA0A 1EL0A 2B2VC 5FKAC 1YNJC 3GP7A 1EIGA 2Y0SB 2HDMA 1F2LA 4KK7A 3CQZB 5NUCA 1I6VC 1TWFB 2R3ZA 4ULLA 4RWSC 2B2WC 1MI2A 3VA5A 1WTXA 4DK0A 1O80A 2EJGC 5FO8B 5HGTA 2K1BA 2B2VA 2DN8A 3C1FA 3D4RA 1G2SA 3TP8A 4PMWA 2XNAC 4CKBA 2B2TC 1PDQA 2F0MA 1Y1VB 4PMBA 2B2WA 4DAVA 1JICA 4OL7A 5FLXL 3C1EA 1UEAB 1S5ED 1K83B 1AP0A 2OXPA 2DY7A 3VR6A 1XYIA 1B53A 1F9RA 1X3PA 2SNMA 3SHLA 1Q12A 4EQNA 1G2TA 5JPMC 4UDUC 3CRKC 2A69D 1RODA 4CKCA 3J80L 5EPJA 3MEHA 3R8BA 1PFBA 1FNWA 1LTTD 1B3AA 1RD9D 4DAYA 4S3SA 2RSNA 1V1OA 3BYTB 3ND8A 5CV8A 2FMCA 4IFDI 4LJZC 1PRTB 2E75C 4MHEA 1F9SA 4Z9CB 2ZXPA 3LX0A 2QCPX 1OXXK 1B2TA 2VB2X 1FD7D 4EQOA 1EOTA 2PCFB 2JA6B 4A3IB 2J0TD 3OMCA 5TSSA 1D1IA 4K14A 1H9JA 1HUNA 4KKSA 4NMZA 5C5MA 3URYA 4BBRB 2KUMA 3I4LA 2IJ0A 1ENCA 4KY7A 2ZXOA 3D4WA 2M2LA 1BO0A 1IHZA 4DGZA 3MFYA 2X6GA 3A7AB 1GHJA 3C3LA 1TIID 4CJ0B 3VYRA 3CRLC 3DEOA 1ML0D 5ELEA 1EY4A 1TWGB 1HCZA 5EPLA 1PFNA 1WCMB 1BCPD 3S16B 1M8AA 5CGKA 5I4DA 1IW7C 4BS9A 2JA5B 4KTAA 1CA6A 1CI3M 5M9OA 4NKLA 3VR2A 4HCEA 4HTHA 1QCBD 2JA7B 2RKSA 4IFDG 4BY7B 2K04A 3WOEA 3RD4A 1SE4A 3D6WA 5KNBA 4R9WA 4EGVA 1STYA 4KKUA 3MXGA 4C3IG 5J22A 5EKLA 3I8ZA 3GO5A 4C3HG 1SNQA 5JVG3 1Y8NB 1H9SB 4QMGA 5T1IA 3HKZB 3X3MA 1GUOA 1F2YA 4DA2A 3J7AF 3CKIB 2BDNA 4CBVA 2JE6I 3M4OB 3OMGA 1SYGA 2OT2A 3KLSA 2KCCA 4IZ8A 1Q1BA 5IIFA 2ZXRA 3I3CA 5EBDA 1U4PA 1JOQA 5M3FB 4A93B 3BDCA 2F0VA 1YNJD 4QIWB 1EY5A 2AUJD 1EQTA 1LACA 5JAVA 4ZKCB 1QB5D 2K01A 2HDLA 3BYYB 3KK7A 3RZDB 1MBYA 3I4NB 1SYBA 5K36G 1VMPA 1GUGA 3T51B 4MIUA 3ERQA 5CMDA 4H44C 1MD2D 1LTID 2PPBC 1PMRA 1ESFA 5J39A 2JEAI 4U68A 2YU9B 1U9RA 1SJHD 3A8IE 5C4HA 1DOLA 1JOKA 1TKWB 2E74C 2F1MA 4K8IA 1KLGD 1I4XA 2JYOA 3AMUA 3DUZA 1Q1EA 3L9AX 2EYLA 1QWYA 5C0XI 3DEPA 1RJTA 2JXMB 3GV3A 2A6HC 2L1BA 5JJZA 2B63B 3RMHA 1I4PA 2A68C 2TSSA 2KJXA 2B2UC 2ZT9C 1SEBD 1GHKA 4XQNA 1NCVA 1STBA 3EJIA 3VR4A 1ONLA 2PZUA 2EY2A 5CV7A 4WRDA 2KHSA 3PUZA 3T56B 1Z47A 1HUMA 2PQEA 1SMYD 3PUVA 3TZUA 3HOZB 2K05A 3MAQA 2QILA 4MN3A 1SXTA 2MPMA 3BS1A 1TY2A 1VMCA 3PUWA 1UUPA 4C2MB 1CA5A 1F2MA 3A55A 3K5MA 1JB3A 4NP5A 1KDAA 2O5IC 2F0SA 5BN5A 1VF7A 1A15A 5CBEE 2EJFC 4DN4M 5E4WC 5FO9B 1NR4A 3DHQA 3VR5A 1HPCA 4IFDJ 1SAPA 1PRTD 1STEA 2MJ8A 2EJMA 4J1MA 1T5XD 1UAPA 4RH6A 4OO1G 3Q0AA 1LTRD 5C0XG 2NBFA 4RHRA 1QE6A 4B9XA 1GUNA 2LMCB 4BBSB 3I90A 4RGNA 4EVOA 5FLXE 1BOSA 5M5YB 2K5DA 1RTNA 2TMPA 2ID0A 4F8MA 1DOKA 1I50B 1EQVA 3HOVB 5CR3A 2KQ3A 1BUVT 2PO4A 3RUZA 1DZ1A 3H94A 2BE5D 4HCSA 5LL6X 3J80E 3H09A 1CZGA 2XRSD 4OHJA 3D6CA 1GJXA 1TVXA 2ENBA 1TS5A 1LTGD 5DAUA 3S1RB 4N9PA 1CZWA 4L6TB 2Q8IB 3OWEB 4TRDA 1SJED 1A3VA 1EY9A 2JA8B 5JVH3 2HUGA 5DNFA 5KYLA 2CQAA 1WD1A 1BBXC 3TMEA 5LHY1 1ZEQX 2D2CC 1JE4A 1PTOC 3SDZA 4I7ZC 2LS01 1TS4A 3QWNA 1AN8A 3HGBA 2M9VA 3BZDB 5I6WA 1A2TA 1JORA 1C48A 3Q24A 4K8JA 1D1KA 1Q8IA 2EY6A 1LT4D 3FMCA 4FP5D 1ILPA 4IN3A 2NVTB 3HZXA 3S14B 4U673 1DCZA 1I4HA 1BQQT 3MXPA 4A3JB 2NTTA 3SK8A 4ZUJA 2SDFA 2RDHA 3GTOB 2R7ZB 1QG7A 1LABA 1JWMD 1D2BA 2QDBA 4RHSA 3KUPA 1F9QA 4DF7A 1BDOA 3IFTA 4P2CB 2F0KA 3K58A 4KV6A 3MXNA 2A6EC 1GUTA 5E1FA 2WINB 2CVRA 3K0YA 1CTMA 5KRUA 2HQEA 3R3OA 2CW0C 4RAUC 4O1NA 5C4XB 2D62A 1SYDA 3U9SA 5DM63 2KCNA 2SOBA 3DWAA 1EZ6A 4B08A 5EQ0A 1EY7A 4H7BA 3H0GB 2B2TA 1TWCB 3I4MB 4K2KA 1A2UA 3PMFA 4B9WA 3MWYW 1E2WA 4R8NA 2EYMA 2F0OA 4HMIA 1J9OA 4HN7A 2Z1CA 3NUCA 3BVGA 1B1ZA 3HOUB 3SR1A 1D5MC 1SNOA 4X3TA 3TP5A 5C0XJ 1BCPF 4WFN3 1GUWA 3D31A 2SNSA 3HOYB 5KGUA 3FRPB 1DJRD 3NTKA 1A3UA 4HAEA 4A3BB 1CK1A 4KY6A 2LFNA 5JPNC 1PTOF 1DONA 1VCIA 2MP1A 5ELCA 1ZYRD 2Q8RE 1EFID 4K6DA 3OPOA 1EWCA 5J1ZA 1ESRA 3TN2A 3Q6SA 4X3SA 3OIPA 1DM0B 4NW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTS A;  1DOM A;  1B53 A;  1XYI A;  1F9R A;  1HHV A;  2XIW A;  4HCS A;  1U4L A;  2K05 A;  2Q8T A;  2K01 A;  2K03 A;  2HDL A;  5EPL A;  4ZKC B;  3SVM A;  1NAP A;  1X3P A;  1PFN A;  4UAI A;  1BNZ A;  2MGS A;  1X32 A;  1M8A A;  4MN3 A;  2MPM A;  4OIJ A;  2VXW A;  5COY A;  5EKI A;  1G2T A;  1WTW A;  1E0B A;  1VMC A;  1RHP A;  1NR2 A;  2FHT A;  1TVX A;  3IL8 A;  3ONA B;  2D9U A;  2CVR A;  1U4R A;  2EOT A;  1CA5 A;  1VMP A;  1CA6 A;  3N52 A;  4XT3 B;  1ROD A;  4RAU C;  1RTO A;  4IUU A;  1LV9 A;  1O7Y A;  1AZP A;  4ZK9 B;  2FIN B;  5EPJ A;  2B2Y A;  4HED A;  1PFB A;  2KOL A;  2HUG A;  1EIH A;  5DNF A;  1A15 A;  3FPU B;  1B3A A;  4X3K A;  3R93 A;  2HCC A;  2B2U A;  5EPK A;  5CBE E;  1WD1 A;  2FJ2 A;  2X69 A;  1G91 A;  2K04 A;  4QUC A;  1BBX C;  5CMD A;  1WVL A;  2KEE A;  4CJ2 C;  2EPB A;  1S4Z A;  4DN4 M;  5E4W C;  2RSO A;  5EQ0 A;  1WTO A;  1NR4 A;  2NZ1 D;  3D6W A;  2RSN A;  3G7L A;  4IUQ A;  1HFN A;  2L11 A;  1ICW A;  4ZLT F;  1JE4 A;  2B2T A;  4QUF A;  3UI2 A;  4R9W A;  4U68 A;  1O7Z A;  1MSH A;  4IUP A;  1SAP A;  5AFW A;  5D14 A;  2IL8 A;  3GV6 A;  1WTQ A;  1IL8 A;  5CBA E;  4RA8 A;  2MJ8 A;  3MWY W;  4O42 A;  1X3Q A;  3F2U A;  3LWE A;  4HSV A;  2L4N A;  1B4O A;  1DOL A;  2KED A;  5D65 A;  1PLF A;  1ZXT A;  4XT1 B;  2KVM A;  3KBX A;  5E4X A;  4MHE A;  1F9S A;  2L9H A;  3H91 A;  2DY8 A;  3I8Z A;  4OIK A;  3P7J A;  1J9O A;  1CM9 A;  1QE6 A;  1B2T A;  1EL0 A;  1F9P A;  1IKL A;  1KNA A;  2B2V C;  2JYO A;  1HA6 A;  1EOT A;  4CJ1 B;  1HFG A;  1WTP A;  1EIG A;  4IUR A;  2H1E A;  4X3T A;  1U4M A;  2HDM A;  3TZD A;  1F2L A;  1B50 A;  1Q3L A;  1ILQ A;  2L12 A;  1SDF A;  1ILP A;  2R3Z A;  1SSO A;  4LMQ D;  2EE1 A;  5T1I A;  4RWS C;  1KNE A;  2B2W C;  1RJT A;  3DEP A;  1WTV A;  1GUW A;  1MI2 A;  1WTX A;  1HUN A;  3GV3 A;  1O80 A;  2L1B A;  2NYZ D;  2BDN A;  3FDT A;  3I91 A;  4X3U A;  2KUM A;  2B2Y C;  4ZAI A;  3I90 A;  4ZKB B;  5JJZ A;  2K1B A;  2J7Z A;  4HAE A;  5T1G A;  4R8I A;  2B2V A;  2B2U C;  2RA4 A;  2N88 A;  1NCV A;  2HCI A;  1PFM A;  1WD0 A;  2KEC A;  3DM1 A;  1G2S A;  1G6Z A;  2N55 A;  2FMM A;  1RTN A;  1DON A;  1BF4 A;  1HRJ A;  1MGS A;  2M2L A;  2MP1 A;  1BO0 A;  1QNK A;  2SDF A;  2Q8R E;  1DOK A;  3I3C A;  1U4P A;  2RVL A;  3IFD A;  2X6G A;  1C8C A;  1AZQ A;  2B2T C;  1PDQ A;  1XX8 A;  1HUM A;  2B2W A;  4XDX A;  3HP3 A;  1QG7 A;  1JIC A;  4IUT A;  1ESR A;  1WTR A;  2X6L A;  2NWG A;  4CJ0 B;  1MSG A;  2JP1 A;  5EJW A;  2K28 A;  3TN2 A;  1J8I A;  4IUV A;  2FFK B;  3DEO A;  3QO2 A;  3Q6S A;  1AP0 A;  4X3S A;  1IKM A;  1ML0 D;  3KUP A;  5COR A;  1DZ1 A;  1F9Q A;  1EQT A;  4NW2 A;  2DY7 A; 
#chains in the Genus database with same CATH topology
 1UE5 A;  2EY1 A;  1H9M A;  4WOR A;  1LTS D;  4QL5 A;  4ILW A;  3I4O A;  3HOZ G;  2RDF A;  3NSW A;  1QIL A;  4ID6 A;  3ONA B;  3GTP B;  3NTH A;  1HZ9 A;  1PZI D;  3PO3 H;  1PZK D;  4XT3 B;  2YTY A;  1H9K A;  3QOJ A;  4K5X A;  1V1Q A;  4A3E B;  2KOL A;  2F0P A;  3L3O C;  4BY1 H;  4FVM A;  4QUC A;  2E2D C;  3PIO 3;  1S4Z A;  2RSO A;  2HIX A;  3G7L A;  4RKB A;  3T53 B;  1TS3 A;  2L11 A;  5A2Q L;  4KY5 A;  2EYP A;  3CMA A;  4GKJ L;  3HOX B;  3RR5 A;  3UDF A;  1O7Z A;  1WTQ A;  3EQL C;  3HOW H;  1B9N A;  4ABN A;  2NN6 I;  5CBA E;  2WP8 J;  3Q22 A;  1K0S A;  2VZA A;  1CQF A;  2PQA A;  2UUC Q;  3K6O A;  1IXR A;  1TWH H;  2KVM A;  4R4C A;  3GTL H;  4DR6 Q;  4FYD A;  4CDD C;  1HZA A;  2VY3 A;  4OEM B;  2B29 A;  4XIG S;  4OIK A;  3I56 A;  5M5X B;  1DD2 A;  1JT8 A;  5DLQ E;  3HEJ A;  4PZ7 A;  1KNA A;  4LUV A;  4HMJ A;  2BA1 A;  4DV5 Q;  2PZT A;  2E8G A;  2F0N A;  2IT1 A;  4MTK A;  2QA4 A;  1LO5 D;  1SNM A;  2UXD Q;  2F0G A;  1YHB A;  3A54 A;  2EE1 A;  4A3G H;  1PH3 A;  5M5W B;  2AWN A;  3ND9 A;  4DXF A;  2F0F A;  1Q8K A;  4Q0F A;  3M7N A;  1EYA A;  3P20 A;  1W6J A;  1O78 A;  4BBS G;  2N88 A;  1I4R A;  3VA7 A;  4UHV A;  1M4V A;  3I70 A;  2N55 A;  2UXC Q;  1G6Z A;  4XTC S;  3RLN A;  2L55 A;  5C3E H;  4JI8 L;  4RMF A;  4OWT B;  4C3J H;  3PO2 B;  3AQQ A;  2F4I A;  4XDX A;  4QQB X;  4LAA A;  3GDE A;  4DV7 Q;  3DM3 A;  3SK5 A;  3S15 B;  3J80 c;  3OSO A;  1N9W A;  1XTC D;  5C44 H;  3HOV G;  4C1N I;  1XMQ Q;  3QIA A;  1IBL Q;  1AE3 A;  1HA5 A;  2QF7 A;  4IQZ A;  2Z9H A;  3GTK B;  1K8M A;  4LF4 Q;  2KEN A;  5C3W A;  4A3D B;  5FJ8 G;  4MTN A;  2EIF A;  1RCV D;  4J15 A;  4J6H A;  2F0H A;  5I2X A;  1GKH A;  1YHQ A;  2VXW A;  4BXX H;  1JQY D;  4JVZ A;  3D3R A;  1E0B A;  4P74 A;  1HNW Q;  1I4G A;  2R6G A;  1VQ5 A;  1KAA A;  3N52 A;  3LNN A;  2E2H H;  4B3R L;  4K2L A;  3D8G A;  5D3I B;  4P72 A;  4BWG B;  3S2D H;  2FIN B;  3OHX C;  1M1K C;  3ZYY X;  1STH A;  4JK1 C;  1VQP A;  2NN6 G;  4X3K A;  4A3F H;  2HCC A;  4RGO S;  2CQO A;  2BOS A;  3KLR A;  2JA8 G;  1IBM L;  3NEL A;  4X65 Q;  1C7Y A;  4B3M Q;  4BA2 I;  4FO2 A;  1E1O A;  4JI3 Q;  4MZ9 A;  3UI2 A;  1FNU A;  1IYU A;  2F0E A;  1SYC A;  4G57 A;  4M1U B;  5G3L D;  4OGQ C;  4CHT B;  2A6E D;  1PA6 A;  2YYZ A;  5CC4 A;  3KBX A;  4IFD H;  2CW0 D;  1PH9 A;  1QUQ A;  3VYS A;  4GNX B;  4LFB Q;  3PF5 A;  4FDB A;  1S5B D;  1CM9 A;  2WKC A;  3B6Y A;  3CW2 C;  1HXY D;  2NVX B;  3BZK A;  3GTQ H;  1PTO H;  1VS0 A;  1SFO H;  3TZD A;  1DYQ A;  1SND A;  3BG3 A;  2OF1 A;  3PIP A;  1YNN C;  1JJC B;  1VQ6 A;  4HIO A;  2A8V A;  1VQD A;  3NXW A;  1BBU A;  3CHB D;  1VQM A;  3AU7 A;  4X3U A;  3FDT A;  5M3M H;  4KD3 A;  4RGM A;  5T1G A;  3VR3 A;  4C3H H;  3TP6 A;  4LFC Q;  3H6M A;  5EGT A;  1JJG A;  4JI1 L;  3GQB A;  2PMZ B;  1QVC A;  1V8Q A;  4GKK Q;  2VS1 A;  4OX9 L;  1Y8O B;  3FP9 A;  3TSS A;  1K28 A;  1KAB A;  4OO1 I;  4DAP A;  1YZ6 A;  1HQR D;  4DU9 A;  1SYE A;  2R7F A;  3GTL B;  3UDI A;  5EJW A;  3S2H B;  3KF8 A;  1CFM A;  3PV0 A;  5FK9 C;  2K14 A;  1PRT F;  4PZ8 A;  3A0J A;  4HID A;  2K7V A;  1CSP A;  4JI0 Q;  2Q8T A;  2K03 A;  3LGJ A;  1VQB A;  4OWX B;  1WYD A;  3RN5 A;  2PNH A;  1L2F A;  4Y52 H;  4V0B A;  5JEA H;  2AWO A;  4OIJ A;  1I6H H;  1V43 A;  2XWJ B;  1ENF A;  4DNT B;  5HUR A;  1K9M C;  1RHP A;  1E2V A;  2FHT A;  4LF9 Q;  4AYB E;  2F03 A;  1U4R A;  2EXZ A;  1LUZ A;  4RCO A;  1RTO A;  1ZKO A;  5I6Y A;  3NQT A;  1LV9 A;  4I65 A;  2UU9 Q;  1AZP A;  3S1M B;  2E76 C;  3CP0 A;  5KIX A;  1BBW A;  2NVQ B;  2F3W A;  2B2U A;  2FXQ A;  2XWB B;  4OEL B;  1L1O B;  1PZJ D;  5C3E B;  4J8Q A;  4L5S A;  5C4X G;  2YV5 A;  4CJ2 C;  1HFN A;  4C3J B;  5ELB A;  4YWK A;  2O4X A;  3J7Z C;  1JCK B;  2F4V Q;  1B44 D;  1YI2 A;  4LF6 L;  1VQA A;  1NUC A;  4DR1 Q;  1IL2 A;  2E2I H;  1JC7 A;  1KDC A;  3TDQ A;  2G9D A;  3PIP 3;  2VQE L;  3I4M G;  5D65 A;  3BDO A;  2KCT A;  1U5K A;  1VQO A;  2L5T A;  4HJ5 A;  4H0L C;  2V1C C;  3P75 A;  5LMN Q;  1I94 Q;  1JMC A;  3DLL A;  2IX1 A;  2A69 C;  3DMU A;  4YHH Q;  4DR2 Q;  3N6R A;  2H1E A;  5GAD C;  5IOD A;  3S2D B;  1B9M A;  3HOU G;  4Y7N B;  5GRO A;  3PUX A;  1VQE A;  1YIJ A;  4LMQ D;  3NP8 A;  3W5O A;  1GUS A;  1HR0 L;  1IW7 D;  3K57 A;  1JB7 A;  2NTS A;  1OXS C;  4DPG A;  1WI5 A;  3F2C A;  2B2Y C;  4ZKB B;  5I9O A;  2J7Z A;  2RA4 A;  2H4O A;  1E2Z A;  2KEC A;  2NB0 A;  3HOY G;  3TP7 A;  1KRS A;  4GLV B;  4JC0 A;  4XYQ A;  3V2T A;  3NWT A;  2C35 B;  1AZQ A;  1HNZ L;  1WFQ A;  4DV4 L;  4N8F A;  4PMC A;  3K8A A;  1ET6 A;  3HP3 A;  4DR7 Q;  3CQZ H;  1V1P A;  1MSG A;  2K28 A;  1TWF H;  2DJF C;  2FFK B;  2XN9 C;  1X56 A;  5IGF A;  2F3I A;  3GTG B;  4IPC A;  1SBB B;  4R4I A;  1D8L A;  3A74 A;  4EQP A;  3CPW A;  3E0J A;  5C5L A;  3GTQ B;  4ZCK A;  3SVM A;  1NAP A;  4GN3 B;  1SFO B;  4A3M B;  3R2T A;  1VQN A;  4KHZ A;  3HG9 A;  4QY7 A;  3M4Q A;  2P5Z X;  3IL8 A;  1Y14 B;  2D9U A;  4G7Z C;  2K33 A;  5BN4 A;  4JYA L;  3UDG A;  5M3M B;  4IPD A;  3RNU A;  5CYU A;  2EVB A;  1X3G A;  3FVQ A;  1LT6 D;  5CV4 A;  4DR4 L;  2G9H D;  2C9O A;  4BA1 I;  2KBN A;  1K83 H;  3HS0 C;  3GTM H;  4JV5 L;  4A3E G;  1A3T A;  1SR3 A;  4IUQ A;  1ICW A;  5CV5 A;  3GD7 A;  5KND A;  3NWS A;  3K5L A;  3HKS A;  2EYF A;  3CCV A;  4GLX A;  2GN5 A;  1MSH A;  4CKE A;  5DEH A;  2GVB A;  1JR0 D;  1SE2 A;  5D3D A;  2ZTE A;  3T4A C;  3HOX G;  4FXD A;  1FJG Q;  1TR5 A;  2NVY H;  1BCP C;  1B4O A;  1D5X C;  1H9R A;  1F2Z A;  2L9H A;  2DY8 A;  4X62 L;  3MXN B;  2WII B;  3J81 i;  1IKL A;  1HTL D;  3CC7 A;  1J5E L;  4B3S L;  3PF4 A;  3MC0 B;  1Q3L A;  3K7U C;  3MFG A;  1S40 A;  3C46 A;  1MKH A;  1K8O A;  2B3G A;  1KNE A;  1A62 A;  1QZG A;  1LM0 A;  3EVQ A;  3L0O A;  1STG A;  1B3Q A;  1B7Y B;  1TT2 A;  1CKM A;  4RFB A;  1I5F A;  1VDZ A;  1WD0 A;  1PFM A;  3IAY A;  1FR3 A;  3PCO B;  2VNU D;  1BF4 A;  4DV6 L;  1QNK A;  4GOP B;  1EY0 A;  2PW7 A;  5EAY A;  2JA6 H;  4X66 L;  3JC6 6;  1JWS D;  3AFP A;  2AQ3 B;  4IUT A;  4L8J A;  5FOB B;  2X6L A;  1WTR A;  4FF4 A;  4A3I H;  2JP1 A;  2DGY A;  5KYI A;  2BDO A;  3PO2 G;  1N32 L;  1Q81 C;  1TS2 A;  3W1B A;  3QB3 A;  5CV6 A;  4BBR H;  4R4T A;  2Y0S E;  1XMO Q;  1N34 L;  3DWQ A;  5IYC H;  3CF5 A;  5EBC A;  4A3D G;  1NR2 A;  4C56 C;  3EA6 A;  5IP7 G;  1Y69 U;  1TWA H;  3M4P A;  5C3X A;  2RCF A;  3K7A H;  1LTB D;  5KEE A;  5IT9 L;  1UE1 A;  1RF2 D;  5A2Q E;  1XXG A;  4F7X A;  1JJ2 A;  4KD4 A;  5EPK A;  1TU2 B;  1G91 A;  2E5L Q;  4KHV A;  2EPB A;  3J81 E;  5IGE A;  2A6H D;  1XPR A;  3FKI H;  2IX0 A;  1RL2 A;  1WCM H;  2A68 D;  1R9T H;  3S16 H;  1BXT A;  2Z4I A;  3E6Z X;  2IL8 A;  4JPB W;  5H1S E;  4RA8 A;  2AQ2 B;  2VL6 A;  4ZQ3 A;  2L4N A;  1BVS A;  2UUC L;  2XVS A;  1G8Z D;  2ICE C;  4TQU S;  2JA7 H;  1SE3 A;  1IYV A;  3SEB A;  3S9W A;  1HA6 A;  4FF1 A;  2K5V A;  1S5D D;  3OIQ A;  4DV5 L;  4A3L H;  1A6X A;  4IUR A;  4KJO A;  5LL6 S;  2OEO A;  2EY5 A;  4K5V A;  3KJP A;  2UXB L;  3NEM A;  1E7Z A;  3EBE A;  1EIY B;  3UE0 A;  3GTM B;  3C2P A;  2A74 C;  5IGC A;  3MXU A;  2GA4 B;  1PH2 A;  3E5S A;  1EWH A;  4WJW A;  4IO9 A;  4GS3 A;  1N33 Q;  4JI7 L;  2HCI A;  4BY1 G;  3UE1 A;  1Q90 A;  1VQL A;  3F2B A;  2I07 B;  4XQQ A;  1FL0 A;  1MGS A;  1UNS A;  1JOO A;  4LUO A;  3T13 A;  2WFW A;  2PQA B;  2NVY B;  1KXL A;  1EEF D;  3CPF A;  4DV7 L;  2WAQ B;  2K6A A;  2AUK A;  1J8I A;  1C0A A;  4RKL A;  4A3K B;  3NHH A;  1MIU A;  3VYU A;  2XSC A;  3L2P A;  4DV3 Q;  1PH4 A;  4G7H C;  4V19 0;  1IBL L;  4NDX A;  1DOM A;  2DNE A;  3W2D A;  4LF7 Q;  2R93 H;  1KTK A;  1Z6H A;  3M4O H;  1AH9 A;  1SRU A;  4UAI A;  1BNZ A;  3NPP A;  3MA2 B;  4ME5 A;  3Q23 A;  5COY A;  2WB1 E;  2CHB D;  2PW5 A;  1HNW L;  3ZJY C;  3CC2 A;  2J4X A;  4DFA A;  5M3F H;  3DWP A;  4P75 A;  1KDB A;  4A93 H;  5GAH C;  4LF5 L;  4A3G G;  2V4D A;  4DUZ Q;  1YJW A;  1G51 A;  4XQJ A;  3MVV A;  1EU3 A;  2BCO A;  3FPU B;  3R93 A;  4LFA Q;  2ES2 A;  1SNC A;  1LT3 D;  1S72 A;  2I46 A;  2NZ1 D;  1EYG A;  1JWU D;  1SMY C;  2D5D A;  1OO9 B;  5C3E G;  2F0I A;  3S1Q H;  4C3J G;  2WB1 B;  4ZRZ A;  5IGD A;  3TRE A;  1PHJ A;  1NNX A;  1X3F A;  5JOB A;  1L0X B;  3HRZ C;  1R4P B;  1I4Q A;  1PLF A;  5HGQ A;  3K59 A;  1XNQ L;  3NTI A;  1EEI D;  3A5Z B;  4KN7 C;  4DK1 A;  4AYB G;  4QCL A;  2B39 A;  4FF2 A;  5BN3 A;  1F9P A;  5ELF A;  1IYJ B;  4FNF A;  4CJ1 B;  1HFG A;  1TWA B;  1FVI A;  4HSP A;  3K7A B;  4DUY Q;  1KQS A;  3X3N A;  1KLU D;  1CT1 D;  2R92 H;  3JAM L;  3PQI A;  1WTV A;  5IGG A;  1PH8 A;  2YU9 H;  2HD3 A;  2D0P A;  2HQL A;  3J81 L;  2CFM A;  1A8V A;  3QJY A;  4DK6 C;  4HJA A;  2NYZ D;  4X64 Q;  2VB3 X;  4QF4 A;  2NUC A;  4LUZ A;  3FKI B;  2L0C A;  2ICI A;  4NXN Q;  1CHQ D;  1PRT C;  1R9T B;  1PYW D;  4QB4 A;  2A73 B;  1X9N A;  4FXK C;  3A56 A;  1Y1W H;  3M4Y A;  2RVL A;  2Z4H A;  4G4K A;  4DNR B;  1VQF A;  3SK6 A;  4KHP L;  2EYO A;  2JSO A;  4H13 C;  3F2D A;  1BR9 A;  1QUQ B;  3ERS X;  1IKM A;  5COR A;  4PG3 A;  3I73 A;  5G3L F;  5IYB H;  1PTO D;  1QOH A;  4IUU A;  2HHH Q;  3WDN A;  2Q2U A;  3NE5 B;  2F0J A;  2G5D A;  3I72 A;  3P1H A;  2MGS A;  3AYH B;  3M7G A;  4DR5 L;  4PQX A;  3E3X A;  3HKZ E;  5EKK A;  3O13 A;  4A3M G;  3PGZ A;  4B3T Q;  3A8J E;  2K5Q A;  5FLM G;  1SNP A;  5M3M G;  2X69 A;  1NBW A;  1PV4 A;  1WVL A;  4IPG A;  3HOZ H;  2MO0 A;  3GTJ B;  2F0Q A;  5IOC A;  4POG A;  5I9P A;  4QIW E;  3S17 H;  3OWF A;  3W3A A;  4QUF A;  3KF8 B;  3MHB A;  3GV6 A;  1CSQ A;  1IL8 A;  1N36 Q;  2BE5 C;  1ASY A;  3T1H Q;  1D6E C;  3RZO H;  4N8X 1;  2AQ1 B;  5BR8 L;  1X3Q A;  3F2U A;  3HFZ B;  4HSV A;  1FGU A;  2IPK D;  2KED A;  3T16 A;  2R93 B;  1SYF A;  5E4X A;  1S5F D;  4NXM L;  2K50 A;  2E2J B;  5C4Z A;  3BDL A;  4IAL A;  3DXJ C;  3RLF A;  2JQO A;  3BVZ A;  4DV0 L;  1EY6 A;  4GZY C;  2F3V A;  2XRQ D;  3F1Z A;  1ET9 A;  1C4Q A;  5JEA G;  3OTO Q;  2CH4 W;  1DXM A;  1EFW A;  5C4J B;  3M3Y H;  4FXG C;  1U4M A;  4DR2 L;  2F0W A;  2L12 A;  1SDF A;  4DXG A;  4JI6 L;  2RBM A;  1RKN A;  2HIV A;  4JCV E;  3G4S A;  1STA A;  1EZ8 A;  3S1N H;  2Z8L A;  3NK9 A;  3I91 A;  4JBJ A;  1RDP D;  3KLS X;  4ZAI A;  4R8I A;  3FPP A;  1LT5 D;  1NMF A;  3S1Q B;  1HRJ A;  3KLW A;  4CGY B;  2QKI C;  3PO3 B;  1C8C A;  5CV9 A;  4LF8 L;  3J7Y W;  3K5N A;  2ZTC A;  1FYC A;  4DV1 Q;  1NY4 A;  1TY0 A;  3KBG A;  4KI0 A;  4YCW A;  2NWG A;  4C3I H;  2C5C A;  1QVF A;  1GOZ A;  2RDG A;  4JBW A;  5KNC A;  5ISR A;  1XPU A;  4P73 A;  2OQK A;  3D4D A;  3E9H A;  1Y8P B;  3KYH C;  4BY1 B;  3H3V C;  5IYD H;  3MTS A;  1KAW A;  3OW2 A;  2XIW A;  1ENA A;  1II3 A;  4KN4 C;  3NBI A;  2Q2T A;  4K6L A;  3TEH B;  2JEB I;  1WTW A;  3HOW B;  4GKJ Q;  2R92 B;  4AQY Q;  3OW7 A;  3JAM c;  4C1N K;  5LMU L;  4G7O C;  3NQI A;  1TWH B;  2RQX A;  3FEW X;  2KA7 A;  1H9S A;  3AB9 A;  4HJ7 A;  3J81 c;  4RCN A;  2QEJ C;  1W2B A;  3L7Z C;  4HED A;  1L0Y B;  2H5X A;  4TKO B;  3J7A 5;  2WAC A;  2F0T A;  1Z7T A;  1Y1W B;  3ITP A;  5IGB A;  2KEE A;  1F77 A;  4K5W A;  2VUM H;  4HR7 B;  1V1P B;  4F87 A;  4A3G B;  5I2Y A;  4IUP A;  5AFW A;  3A8K E;  1HQM C;  4O42 A;  3LWE A;  3S1R H;  1KL9 A;  2NN6 H;  4HIM A;  2RF4 A;  2UUA L;  1O7L A;  3KJO A;  1B8A A;  1GXD C;  1XNR L;  2R61 A;  3P7J A;  2EYJ A;  3G71 A;  1G6P A;  2DNC A;  1I3Q H;  1TXY A;  4XYO A;  5K36 H;  1H95 A;  4JI2 L;  2IX3 A;  1B50 A;  4HIK A;  5DM7 3;  3CU7 A;  1SSO A;  5C44 B;  4DR3 Q;  1AEX A;  1KHI A;  2YTV A;  4AYB B;  1QNU A;  1HTP A;  2IHF A;  4IJL A;  4UP9 A;  4QGU A;  1TQO A;  2F0U A;  1STN A;  1X55 A;  4K0K Q;  1PYB A;  1VQJ A;  1SN8 A;  2WV6 D;  2ZJQ A;  2WKD A;  3S17 B;  3WOF A;  3DM1 A;  2SEB D;  3S24 A;  2FMM A;  1CHP D;  1S5C D;  1EOV A;  5LMN W;  3IFD A;  2E2H B;  1LTL A;  3J7A V;  3RZO B;  2ZM6 L;  5L37 A;  4AIM A;  2MHV A;  2OTL A;  2NZO A;  1PXU A;  4A3F B;  2CWA A;  2NVT H;  3QO2 A;  3MEF A;  2QGQ A;  2WAQ G;  4JI5 Q;  4A3K G;  4FF3 A;  3BVM A;  4N9T A;  3M3Y B;  1VQK A;  3TS2 A;  1XMO L;  5IT9 E;  3LWU A;  5F2D A;  5EKI A;  3VYT A;  3A7L A;  4PV1 C;  1E24 A;  4A3J H;  1BCP B;  2VW9 A;  2ZJR A;  2EOT A;  3PUY A;  1OXV A;  3I55 A;  1ASZ A;  3S1N B;  1E22 A;  1T5E A;  2B8F A;  4M8A A;  3STB C;  1EYC A;  3GTO H;  4ZK9 B;  2MUY A;  2R7Z H;  1IBK L;  2B2Y A;  3MZ5 A;  1EIH A;  4L5R C;  1ZYR C;  4ZYS A;  2FJ2 A;  2M00 A;  4KKT A;  2VQF L;  1PTO B;  3EFX D;  4UPA A;  1WTO A;  3K5O A;  1CKN A;  1D5Z C;  2ZTD A;  1LYL A;  2PNR C;  1VQ8 A;  4ZLT F;  4C3I B;  1AW7 A;  1W6K A;  5D14 A;  1EY8 A;  5E3F A;  1YNX A;  2JA6 G;  1X65 A;  3NBH A;  1Y1V H;  4PNY A;  4X6A H;  2EYH A;  1YJN A;  5JJL A;  3WWV A;  1CQV A;  2WB1 G;  4XT1 B;  4C3H B;  5AJ3 L;  4L63 B;  3M85 A;  4R4Q A;  4JI1 Q;  1FNV A;  2IW3 A;  3ER0 A;  4A3C H;  3IRB A;  4ODG A;  1VF5 C;  3ULL A;  4OX9 Q;  3QOL A;  1EUJ A;  2F0D A;  1M90 C;  5IYC G;  1WTP A;  2EZV A;  3H0G H;  4F88 A;  2BH2 A;  1ILQ A;  2K32 A;  4DK3 C;  3QG1 A;  1JE5 A;  3ERO A;  1TWC H;  1G29 1;  2CWP A;  1NSN S;  2K5W A;  1K3B C;  3U9O A;  1BKB A;  5JEA J;  4XXE A;  3JAM i;  1P8L A;  2VUM B;  5IP9 H;  1PVO A;  4KLK A;  1I6H B;  3IKJ A;  4YWM A;  2B8G A;  2MNA A;  4KJN A;  4LK1 C;  1HNX L;  1QJO A;  3FKI G;  4Q5V A;  1XX8 A;  3SXH A;  5C6A A;  1FGB D;  1Z9F A;  3I7F A;  1OXU A;  3G6J B;  1AFP A;  2LXK A;  2LY7 A;  4IUV A;  1QZH A;  4OO1 H;  3SE0 A;  5A35 A;  4IOA A;  2O2L D;  5C0X H;  3V96 A;  3TBI B;  1LLR D;  4E6I A;  1I3Q B;  1HHV A;  1U4L A;  3R2I A;  4YY3 Q;  4A3B H;  1R4Q B;  1X32 A;  1LTA D;  1EU4 A;  2F0L A;  2PZW A;  4KMU C;  4LF6 Q;  4A3L G;  2E2I B;  1OXT A;  2UUB Q;  2PYK A;  4O2D A;  4ZUI A;  4L5Q A;  2VQE Q;  1K8G A;  1O7Y A;  4TVA B;  3AFQ A;  1HH2 P;  2A5H A;  4RGT A;  1XWE A;  4TSS A;  5ELD A;  1YNN D;  2EDG A;  2IWH A;  3CCR A;  1EYD A;  1XJV A;  3TRZ A;  4YIJ A;  2QW7 A;  3V05 A;  2O5J C;  4HJ9 A;  2JA9 A;  1UWV A;  3KOJ A;  4I7A A;  5K5P A;  4YCU A;  2AMC B;  1QVG A;  3OOC A;  2K75 A;  4DV2 Q;  4IUN A;  3SK4 A;  1T9H A;  2LKV A;  1ZXT A;  4DAY B;  3H91 A;  5FO7 B;  3JAM E;  2BA0 A;  2XTI A;  1EL0 A;  3ICE A;  2R93 G;  2B2V C;  1TWG H;  5FKA C;  1YNJ C;  1HNZ Q;  3GP7 A;  1EIG A;  2Y0S B;  4DV4 Q;  2HDM A;  1F2L A;  4KK7 A;  3CQZ B;  4EX5 A;  2AHO B;  5NUC A;  1I6V C;  1TWF B;  2A1A A;  2R3Z A;  4ULL A;  4RWS C;  5M3F G;  2B2W C;  2JA5 H;  3RLO A;  1MI2 A;  3VA5 A;  1WTX A;  4DK0 A;  1O80 A;  1U0L A;  2EJG C;  5FO8 B;  5HY6 A;  5HGT A;  4X64 L;  2K1B A;  4GLA C;  4DR6 L;  2B2V A;  1VQC A;  2DN8 A;  3C1F A;  3D4R A;  1VQH A;  1G2S A;  5M5X H;  3TP8 A;  4BY7 H;  4PMW A;  2XNA C;  1CUK A;  2L15 A;  4CKB A;  2B2T C;  1EQQ A;  1PDQ A;  2F0M A;  1Y1V B;  4PMB A;  4JYA Q;  2B2W A;  4DNI A;  4DAV A;  2UXD L;  1JIC A;  4OL7 A;  5FLX L;  3PO3 G;  3C1E A;  1UEA B;  1S5E D;  1K83 B;  4JOI C;  1AP0 A;  2OXP A;  3U4V A;  2DY7 A;  5M5W H;  3VR6 A;  1XYI A;  4JV5 Q;  1B53 A;  1F9R A;  2CCZ A;  1Q82 C;  5IY0 A;  4H02 A;  1N8R C;  4JBM A;  1X3P A;  2SNM A;  3SHL A;  1EWI A;  1Q12 A;  4EQN A;  1G2T A;  5JJK A;  5JPM C;  2UXC L;  4UDU C;  2K5H A;  2Q2H A;  4RG1 A;  3CRK C;  2A69 D;  2R92 G;  1ROD A;  3HOW G;  4CKC A;  3J80 L;  1PH5 A;  3PO2 H;  3H3V H;  1XTD A;  5EPJ A;  3MEH A;  3R8B A;  1PFB A;  3KF6 A;  1FNW A;  1LTT D;  4X62 Q;  3S15 H;  1XMQ L;  1B3A A;  1KIX A;  1RD9 D;  1J5E Q;  4B3S Q;  4LF4 L;  3GTK H;  4DAY A;  4S3S A;  2RSN A;  1V1O A;  3BYT B;  2N49 A;  1Y1W G;  1YVC A;  3ND8 A;  5CV8 A;  4IOC A;  3NEN A;  2FMC A;  4IFD I;  4LJZ C;  3T1H L;  4LNQ A;  1PRT B;  3W1G A;  2E75 C;  5IYB G;  4MHE A;  1F9S A;  4Z9C B;  4JI4 Q;  2ZXP A;  3LX0 A;  2QCP X;  3STB D;  1OXX K;  1L0W A;  1B2T A;  2F52 A;  4DV6 Q;  2VB2 X;  1FD7 D;  2DJG C;  4EQO A;  1EOT A;  2PCF B;  4HJ8 A;  3RZD H;  2JA6 B;  4X65 L;  4B3M L;  2N8N A;  4JI3 L;  2Z6K C;  4A3I B;  3I4N H;  1UEB A;  1X54 A;  2J0T D;  3OMC A;  5TSS A;  1D1I A;  4K14 A;  1H9J A;  1B70 B;  1HUN A;  4KKS A;  4NMZ A;  5C5M A;  3URY A;  4BBR B;  5C44 G;  3SGI A;  2KUM A;  3I4L A;  3KDF A;  2IJ0 A;  1YBY A;  1ENC A;  1N34 Q;  4KY7 A;  2ZXO A;  4POF A;  3D4W A;  4LFB L;  4LWC A;  1VQG A;  2M2L A;  1BO0 A;  1IHZ A;  2Z6K A;  4DGZ A;  2NVX H;  4BXX G;  3MFY A;  1CKO A;  2X6G A;  1P16 A;  4OWW B;  3A7A B;  3FHW A;  2A19 A;  1GHJ A;  4DV1 L;  1PH7 A;  3C3L A;  1TII D;  4CJ0 B;  3VYR A;  5IT9 c;  3CRL C;  3DEO A;  1ML0 D;  2RHQ B;  5ELE A;  1EY4 A;  5ELO A;  1TWG B;  5IE8 A;  2OWO A;  1HCZ A;  4A3F G;  3QR8 A;  1V9P A;  5EPL A;  1RIP A;  1PFN A;  4LW1 A;  1WCM B;  1BCP D;  4LFC L;  3S16 B;  1M8A A;  5CGK A;  5I4D A;  1IW7 C;  4GKK L;  4BS9 A;  2JA5 B;  1AE2 A;  4KTA A;  4AQY L;  1CA6 A;  1CI3 M;  2I5M X;  5M9O A;  1Q7Y C;  4NKL A;  2ATW A;  3VR2 A;  1WOC A;  4HCE A;  4HTH A;  3S2H H;  1QCB D;  3T1Y Q;  1VQ7 A;  2JA7 B;  2RKS A;  4IFD G;  4BY7 B;  5GAG C;  2K04 A;  3WOE A;  3RD4 A;  1SE4 A;  4JI0 L;  2B63 H;  3D6W A;  5KNB A;  1O7I A;  1HZB A;  4R9W A;  1HZC A;  1YHA A;  4EGV A;  1STY A;  4LF9 L;  2UXB Q;  5FLX c;  4KKU A;  1WTH A;  3MXG A;  5IWA Q;  4C3I G;  2IHE A;  2UU9 L;  1E3P A;  3S1M H;  1K0R A;  5J22 A;  5IYD G;  5EKL A;  3I8Z A;  4JI7 Q;  3GO5 A;  4YCV A;  2NVQ H;  4C3H G;  4CDF C;  1SNQ A;  1MJC A;  5JVG 3;  1Y8N B;  1NMG A;  3PSI A;  1VQ4 A;  1H9S B;  2F4V L;  4QMG A;  3CXC A;  5T1I A;  4DR3 L;  3HKZ B;  4C2M H;  4DR1 L;  1KD1 C;  3X3M A;  1GUO A;  1F2Y A;  4DA2 A;  3J7A F;  3CKI B;  2BDN A;  4CBV A;  5J3B A;  2JE6 I;  4WJ3 M;  3M4O B;  3OMG A;  4ALP A;  4K0K L;  1SYG A;  2OT2 A;  3KLS A;  2KCC A;  4IZ8 A;  1Q1B A;  3TQY A;  5LMN L;  5IIF A;  2ZXR A;  1I94 L;  2VUM G;  3ULJ A;  3I3C A;  5EBD A;  1U4P A;  2N78 A;  1JOQ A;  5M3F B;  2Q2I A;  2OTJ A;  4QJF A;  4YHH L;  3AEV A;  4A93 B;  3BDC A;  2F0V A;  4LF5 Q;  4UY8 C;  1YNJ D;  4QIW B;  3CCQ A;  4Y7N H;  1EY5 A;  2AUJ D;  1GD7 A;  1EQT A;  3G48 A;  1LAC A;  5JAV A;  4ZKC B;  1QB5 D;  2K01 A;  3VDY A;  2HDL A;  3BYY B;  4JI5 L;  3KK7 A;  3RZD B;  2Z6B A;  4YWL A;  1MBY A;  2BH8 A;  3I4N B;  1NTG A;  1SYB A;  5K36 G;  3KFU A;  1VMP A;  1EIF A;  3E9I A;  3E0E A;  4DR7 L;  1GUG A;  1XNQ Q;  1ICF B;  4ME3 A;  2LXJ A;  2PMZ E;  3CCU A;  3T51 B;  4BBS H;  3GTG H;  2JK8 A;  4MIU A;  3ERQ A;  5CMD A;  4H44 C;  1IZ6 A;  1MD2 D;  1LTI D;  2PPB C;  1PMR A;  4A3M H;  2Z0S A;  1ESF A;  5M5Y H;  5J39 A;  2JEA I;  4U68 A;  2YU9 B;  3CCM A;  1U9R A;  1I50 H;  3CCE A;  3HOV H;  5FLM H;  1SJH D;  3A8I E;  5C4H A;  1DOL A;  2CKZ B;  1JOK A;  2IY5 B;  1TKW B;  2E74 C;  1XPO A;  2F1M A;  4K8I A;  1KLG D;  5FJ8 H;  4NPS A;  2JN4 A;  1I4X A;  2JYO A;  4IJH A;  3AMU A;  3DUZ A;  2PI2 E;  1Q1E A;  4JW0 A;  4A3J G;  3L9A X;  4KHP Q;  2EYL A;  1QWY A;  5C0X I;  1VQ9 A;  1NJI C;  3DEP A;  1RJT A;  2Y0S G;  2JXM B;  2R7Z G;  3GV3 A;  2A6H C;  2L1B A;  5JJZ A;  1FJG L;  2B63 B;  3RMH A;  1YJ9 A;  1I4P A;  2A68 C;  2TSS A;  2KJX A;  1CKN B;  2B2U C;  1SEB D;  2ZT9 C;  4XQN A;  1GHK A;  1NCV A;  2JA8 H;  4DR5 Q;  1STB A;  3I2Z A;  3EJI A;  1K8A C;  3VR4 A;  1ONL A;  2PZU A;  4JI8 Q;  4GNX C;  2EY2 A;  5CV7 A;  4WRD A;  3CC4 A;  2ZJP A;  2KHS A;  3PUZ A;  3NBH B;  4UP8 A;  1Z47 A;  3T56 B;  1HUM A;  1WJJ A;  1SLJ A;  2PQE A;  4R4O A;  1SMY D;  1Y1V G;  4A4I A;  4PZ6 A;  4A75 A;  3PUV A;  3TZU A;  3HOZ B;  2K05 A;  4GN5 A;  4A3C G;  1PYS B;  3MAQ A;  4GNX A;  5ELN A;  2QIL A;  4MN3 A;  4YY3 L;  1SXT A;  2MPM A;  3BS1 A;  3J81 j;  2RCN A;  1TY2 A;  1VMC A;  3PUW A;  1UUP A;  4C2M B;  1CA5 A;  3H0G G;  2UUB L;  1F2M A;  4B3R Q;  3A55 A;  5BR8 Q;  3K5M A;  1JB3 A;  4NP5 A;  1KDA A;  1E1T A;  1UE7 A;  4OON A;  4NXM Q;  2O5I C;  4JG2 A;  2F0S A;  5BN5 A;  1VF7 A;  1A15 A;  1K73 C;  4DV0 Q;  3J80 i;  5CBE E;  3S14 H;  2EJF C;  5IP9 G;  1IBM Q;  4DN4 M;  5E4W C;  5FO9 B;  3OYY A;  3H15 A;  1NR4 A;  5JJI A;  4P71 A;  2MO1 A;  4A76 A;  3DHQ A;  3VR5 A;  4JI6 Q;  1MHW C;  1HPC A;  4IFD J;  1SAP A;  1PRT D;  1STE A;  3CCS A;  2MJ8 A;  2EJM A;  1D7Q A;  4J1M A;  1T5X D;  1UAP A;  4RH6 A;  4DV2 L;  4OO1 G;  1X3E A;  2MFI A;  3Q0A A;  4APV A;  1LTR D;  4O0A A;  5C0X G;  2NBF A;  4RHR A;  1QE6 A;  1C9O A;  4MNO A;  5GAE C;  3UDX A;  3M9B A;  2E5L L;  4A3B G;  3K0X A;  3A5U A;  4LF8 Q;  4B9X A;  1L1O C;  3Q8D A;  1SRO A;  3RN2 A;  1MJE A;  5E7N A;  1GUN A;  2ASB A;  2LMC B;  2N3S A;  4A3I G;  4BBS B;  1GVP A;  2PI2 A;  3I90 A;  4RGN A;  4EVO A;  3U58 A;  5FLX E;  5C4X H;  4GN4 B;  4BBR G;  1BOS A;  5M5Y B;  2K5D A;  2I0Q A;  1RTN A;  2TMP A;  2ID0 A;  1L1O A;  1Q46 A;  2XGT A;  2NZH A;  3D0F A;  4F8M A;  1DOK A;  1I50 B;  1S3O A;  1EQV A;  3HOV B;  3H3V I;  5CR3 A;  5LMU Q;  2KQ3 A;  3EIV A;  1BUV T;  2PO4 A;  3CD6 A;  3RUZ A;  3I4M H;  2RHS B;  4R1J A;  2D0O A;  1DZ1 A;  3H94 A;  4OXP A;  3ULP A;  2EXD A;  2BE5 D;  4HCS A;  5LL6 X;  5GQO A;  2MQH A;  3J80 E;  3H09 A;  3BZC A;  1N33 L;  1CZG A;  2XRS D;  3EN2 A;  4CDC C;  4OHJ A;  3D6C A;  2K5N A;  1GJX A;  1TVX A;  2ENB A;  1WCM G;  2K52 A;  1TS5 A;  3F8T A;  3HOU H;  1LTG D;  5DAU A;  3CAM A;  3S1R B;  4N9P A;  1CZW A;  1OTC A;  2ALY B;  4DAM A;  2UUA Q;  4L6T B;  2Q8I B;  2JA5 G;  2I5H A;  3OWE B;  4TRD A;  1SJE D;  1A3V A;  1EY9 A;  1XNR Q;  2JA8 B;  5JVH 3;  2HUG A;  5DNF A;  4DV3 L;  4A3K H;  4AH6 A;  5KYL A;  2CQA A;  1WD1 A;  1BBX C;  3HOY H;  3TME A;  5LHY 1;  3CCJ A;  1ZEQ X;  4LF7 L;  2JA7 G;  2R7D A;  4JI2 Q;  1W3S A;  2D2C C;  4BY7 G;  1JE4 A;  1PTO C;  3SDZ A;  4I7Z C;  2LS0 1;  1TS4 A;  1PFS A;  3K81 C;  3QWN A;  4DKA C;  3CME A;  1AN8 A;  3HGB A;  4DUZ L;  2M9V A;  2K4K A;  4JI4 L;  3BZD B;  5I6W A;  2QDL A;  4LFA L;  3BU2 A;  1A2T A;  1JOR A;  1C48 A;  2GVA A;  2KHJ A;  2KHI A;  3Q24 A;  4K8J A;  2ZM6 Q;  1D1K A;  1Q8I A;  1DGS A;  2EY6 A;  1LT4 D;  2JJQ A;  3FMC A;  4FP5 D;  4JBK A;  4IPH A;  1ILP A;  4IN3 A;  2NVT B;  3KF6 B;  1HJP A;  1HR0 Q;  3GTP H;  1X6O A;  3HZX A;  1SE8 A;  3S14 B;  1HR0 W;  3HKZ G;  4U67 3;  4L5T A;  4A3E H;  1DCZ A;  1I4H A;  3BJU A;  1BQQ T;  3MXP A;  4A3J B;  2NTT A;  3SK8 A;  4ZUJ A;  2SDF A;  2RDH A;  1KRT A;  1K3R A;  3GTO B;  4DUY L;  2R7Z B;  1QG7 A;  1LAB A;  1JWM D;  1D2B A;  2QDB A;  1IBK Q;  3HOX H;  4RHS A;  4A93 G;  1GO3 E;  2I5L X;  3KUP A;  1F9Q A;  4DF7 A;  2HT1 A;  2VQF Q;  1BDO A;  1KC8 C;  3IFT A;  4P2C B;  2F0K A;  1PH1 A;  3K58 A;  4KV6 A;  2DUD A;  1EQR A;  3MXN A;  2OQ0 A;  4NXN L;  3TS0 A;  2A6E C;  1GUT A;  5E1F A;  2WIN B;  1Q86 C;  2CVR A;  3K0Y A;  1SMX A;  1CTM A;  5KRU A;  2HQE A;  2EQS A;  3R3O A;  3I4N G;  2CW0 C;  3G6E A;  4RAU C;  4O1N A;  3KDF B;  4GOP C;  1PH6 A;  5AJ3 Q;  4DR4 Q;  5C4X B;  2D62 A;  1NE3 A;  1SYD A;  3T1Y L;  3U9S A;  5DM6 3;  2LSS A;  2KCN A;  2SOB A;  2HHH L;  2QEX A;  3DWA A;  1EZ6 A;  4B08 A;  5EQ0 A;  1EY7 A;  4H7B A;  3H0G B;  2WAQ E;  2B2T A;  1TWC B;  2AKW B;  3I4M B;  4K2K A;  4GOP A;  1A2U A;  3K80 C;  3PMF A;  4B9W A;  3MWY W;  4JOI A;  1E2W A;  5IWA L;  4B3T L;  1VQI A;  4R8N A;  2EYM A;  3PIO A;  1J6Q A;  2F0O A;  4EQ5 A;  4HMI A;  1J9O A;  4HN7 A;  2Z1C A;  3NUC A;  2CH4 A;  1HNX Q;  1GM5 A;  3BVG A;  1B1Z A;  3HOU B;  3SR1 A;  1D5M C;  1YEZ A;  4A3D H;  1SNO A;  4X3T A;  1A0I A;  5IP7 H;  3TP5 A;  5C0X J;  3GTJ H;  1BCP F;  4WFN 3;  3U50 C;  3CCL A;  4CDE C;  1A63 A;  4WJ4 A;  1YIT A;  1GUW A;  3D31 A;  1N36 L;  2SNS A;  3HOY B;  2OCE A;  5KGU A;  3FRP B;  1DJR D;  3NTK A;  1A3U A;  4HAE A;  4A3B B;  1CK1 A;  4KY6 A;  2E2J H;  2LFN A;  5JPN C;  1PTO F;  2B63 G;  1DON A;  1VCI A;  2MP1 A;  5ELC A;  1ZYR D;  2Q8R E;  3OTO L;  1EFI D;  4K6D A;  5C4J H;  4X66 Q;  3OPO A;  1EWC A;  5J1Z A;  4UP7 A;  3U4Z A;  1ESR A;  4NB3 A;  3TN2 A;  1N32 Q;  1UE6 A;  3Q6S A;  4X3S A;  3OIP A;  1DM0 B;  2YTX A;  4NW2 A;  2KCM A; 
#chains in the Genus database with same CATH homology
 2EY1 A;  1H9M A;  4WOR A;  1LTS D;  4ILW A;  2RDF A;  3NSW A;  1QIL A;  4ID6 A;  3ONA B;  3GTP B;  3NTH A;  1PZI D;  1PZK D;  4XT3 B;  1H9K A;  3QOJ A;  4K5X A;  4A3E B;  2KOL A;  2F0P A;  3L3O C;  4FVM A;  4QUC A;  2E2D C;  3PIO 3;  1S4Z A;  2RSO A;  3G7L A;  3T53 B;  4RKB A;  1TS3 A;  2L11 A;  5A2Q L;  4KY5 A;  2EYP A;  3HOX B;  1WTQ A;  1O7Z A;  3EQL C;  1B9N A;  4ABN A;  2NN6 I;  5CBA E;  2WP8 J;  3Q22 A;  1CQF A;  3K6O A;  2KVM A;  4FYD A;  4XIG S;  1DD2 A;  4OIK A;  5M5X B;  3HEJ A;  1KNA A;  4HMJ A;  2BA1 A;  2PZT A;  2F0N A;  2IT1 A;  1LO5 D;  1SNM A;  2F0G A;  3A54 A;  2EE1 A;  5M5W B;  2AWN A;  3ND9 A;  4DXF A;  2F0F A;  4Q0F A;  3M7N A;  1EYA A;  3P20 A;  1W6J A;  1O78 A;  2N88 A;  1I4R A;  3VA7 A;  1M4V A;  3I70 A;  2N55 A;  1G6Z A;  4XTC S;  2L55 A;  3PO2 B;  2F4I A;  4XDX A;  4LAA A;  3SK5 A;  3S15 B;  3OSO A;  1XTC D;  4C1N I;  3QIA A;  1HA5 A;  2QF7 A;  4IQZ A;  3GTK B;  1K8M A;  5C3W A;  4A3D B;  1RCV D;  4J6H A;  2F0H A;  5I2X A;  2VXW A;  1JQY D;  3D3R A;  1E0B A;  1I4G A;  2R6G A;  1KAA A;  3N52 A;  3LNN A;  4K2L A;  3D8G A;  5D3I B;  4BWG B;  2FIN B;  3OHX C;  3ZYY X;  1STH A;  4JK1 C;  2NN6 G;  4X3K A;  2HCC A;  4RGO S;  2BOS A;  3KLR A;  4BA2 I;  4FO2 A;  3UI2 A;  1FNU A;  1IYU A;  2F0E A;  1SYC A;  4G57 A;  4M1U B;  5G3L D;  4OGQ C;  4CHT B;  2A6E D;  2YYZ A;  5CC4 A;  3KBX A;  4IFD H;  2CW0 D;  3VYS A;  1S5B D;  1CM9 A;  2WKC A;  1HXY D;  2NVX B;  1PTO H;  3TZD A;  1DYQ A;  1SND A;  3BG3 A;  2OF1 A;  1YNN C;  3NXW A;  3CHB D;  3AU7 A;  4X3U A;  3FDT A;  4KD3 A;  4RGM A;  5T1G A;  3VR3 A;  3TP6 A;  3H6M A;  5EGT A;  3GQB A;  2PMZ B;  1V8Q A;  1Y8O B;  3TSS A;  1KAB A;  4OO1 I;  4DAP A;  1HQR D;  4DU9 A;  1SYE A;  3GTL B;  5EJW A;  3S2H B;  3KF8 A;  1CFM A;  3PV0 A;  5FK9 C;  1PRT F;  2K7V A;  2Q8T A;  2K03 A;  4V0B A;  5JEA H;  2AWO A;  4OIJ A;  1V43 A;  2XWJ B;  1ENF A;  4DNT B;  5HUR A;  1RHP A;  1E2V A;  2FHT A;  2F03 A;  1U4R A;  2EXZ A;  4RCO A;  1RTO A;  1ZKO A;  5I6Y A;  3NQT A;  1LV9 A;  4I65 A;  3S1M B;  1AZP A;  2E76 C;  5KIX A;  2NVQ B;  2F3W A;  2B2U A;  2XWB B;  1PZJ D;  5C3E B;  4J8Q A;  4CJ2 C;  1HFN A;  4C3J B;  5ELB A;  2O4X A;  1JCK B;  1B44 D;  1NUC A;  1JC7 A;  1KDC A;  3TDQ A;  2G9D A;  3PIP 3;  5D65 A;  3BDO A;  2L5T A;  4H0L C;  3P75 A;  2IX1 A;  2A69 C;  3DMU A;  3N6R A;  2H1E A;  5IOD A;  3S2D B;  1B9M A;  4Y7N B;  3PUX A;  4LMQ D;  3NP8 A;  1GUS A;  1IW7 D;  3K57 A;  2NTS A;  1OXS C;  2B2Y C;  4ZKB B;  5I9O A;  2J7Z A;  2RA4 A;  2H4O A;  1E2Z A;  2KEC A;  2NB0 A;  3TP7 A;  4XYQ A;  3V2T A;  3NWT A;  1AZQ A;  4PMC A;  1ET6 A;  3HP3 A;  1V1P A;  1MSG A;  2K28 A;  2FFK B;  2XN9 C;  5IGF A;  3GTG B;  1SBB B;  4EQP A;  3E0J A;  5C5L A;  3GTQ B;  3SVM A;  1NAP A;  1SFO B;  4A3M B;  3R2T A;  4KHZ A;  3HG9 A;  3IL8 A;  2D9U A;  4G7Z C;  2K33 A;  5BN4 A;  5M3M B;  5CYU A;  2EVB A;  3FVQ A;  1LT6 D;  5CV4 A;  2G9H D;  2C9O A;  4BA1 I;  3HS0 C;  1A3T A;  4IUQ A;  1ICW A;  5CV5 A;  3GD7 A;  5KND A;  3NWS A;  3K5L A;  2EYF A;  4CKE A;  1MSH A;  5DEH A;  1JR0 D;  1SE2 A;  5D3D A;  3T4A C;  4FXD A;  1TR5 A;  1BCP C;  1B4O A;  1D5X C;  1H9R A;  1F2Z A;  2L9H A;  2DY8 A;  2WII B;  1IKL A;  1HTL D;  3MC0 B;  1Q3L A;  3MFG A;  3C46 A;  1K8O A;  1KNE A;  3EVQ A;  1STG A;  1TT2 A;  4RFB A;  1VDZ A;  1WD0 A;  1PFM A;  3IAY A;  1FR3 A;  2VNU D;  1BF4 A;  1QNK A;  1EY0 A;  2PW7 A;  1JWS D;  2AQ3 B;  4IUT A;  4L8J A;  5FOB B;  2X6L A;  1WTR A;  4FF4 A;  2JP1 A;  5KYI A;  2BDO A;  1TS2 A;  3QB3 A;  5CV6 A;  3DWQ A;  5EBC A;  1NR2 A;  4C56 C;  3EA6 A;  1Y69 U;  5C3X A;  1LTB D;  5KEE A;  5IT9 L;  1RF2 D;  5A2Q E;  1XXG A;  4F7X A;  4KD4 A;  5EPK A;  1TU2 B;  1G91 A;  4KHV A;  2EPB A;  3J81 E;  5IGE A;  2A6H D;  2IX0 A;  2A68 D;  1BXT A;  2Z4I A;  3E6Z X;  2IL8 A;  4RA8 A;  2AQ2 B;  4ZQ3 A;  2L4N A;  2XVS A;  1G8Z D;  2ICE C;  4TQU S;  1SE3 A;  1IYV A;  3SEB A;  3S9W A;  1HA6 A;  4FF1 A;  1S5D D;  3OIQ A;  1A6X A;  4IUR A;  4KJO A;  5LL6 S;  2OEO A;  2EY5 A;  4K5V A;  3GTM B;  3C2P A;  2A74 C;  5IGC A;  3MXU A;  2GA4 B;  3E5S A;  1EWH A;  4WJW A;  2HCI A;  1Q90 A;  2I07 B;  4XQQ A;  1MGS A;  1UNS A;  1JOO A;  3T13 A;  2NVY B;  1EEF D;  2WAQ B;  2K6A A;  2AUK A;  1J8I A;  4RKL A;  4A3K B;  3NHH A;  3VYU A;  2XSC A;  4V19 0;  4G7H C;  4NDX A;  1DOM A;  2DNE A;  3W2D A;  1KTK A;  1Z6H A;  4UAI A;  1BNZ A;  3NPP A;  3MA2 B;  4ME5 A;  3Q23 A;  5COY A;  2CHB D;  2PW5 A;  2J4X A;  4DFA A;  3DWP A;  1KDB A;  2V4D A;  4XQJ A;  3MVV A;  1EU3 A;  2BCO A;  3FPU B;  3R93 A;  1SNC A;  1LT3 D;  2I46 A;  2NZ1 D;  1JWU D;  1SMY C;  2D5D A;  1OO9 B;  2F0I A;  4C3J G;  2WB1 B;  4ZRZ A;  5IGD A;  5JOB A;  1L0X B;  3HRZ C;  1R4P B;  1I4Q A;  1PLF A;  3K59 A;  3NTI A;  1EEI D;  4KN7 C;  4DK1 A;  4QCL A;  2B39 A;  4FF2 A;  5BN3 A;  1F9P A;  5ELF A;  4FNF A;  4CJ1 B;  1HFG A;  1TWA B;  4HSP A;  3K7A B;  3X3N A;  1KLU D;  1CT1 D;  3JAM L;  1WTV A;  5IGG A;  3J81 L;  3QJY A;  2NYZ D;  2VB3 X;  4QF4 A;  2NUC A;  3FKI B;  2L0C A;  2ICI A;  1CHQ D;  1PRT C;  1R9T B;  1PYW D;  4QB4 A;  2A73 B;  4FXK C;  3A56 A;  3M4Y A;  2RVL A;  2Z4H A;  4G4K A;  4DNR B;  3SK6 A;  2EYO A;  2JSO A;  4H13 C;  1BR9 A;  1IKM A;  5COR A;  5G3L F;  3I73 A;  1PTO D;  1QOH A;  4IUU A;  3WDN A;  3NE5 B;  2F0J A;  3I72 A;  3P1H A;  2MGS A;  3M7G A;  4PQX A;  5EKK A;  3O13 A;  3A8J E;  2K5Q A;  1SNP A;  2X69 A;  1WVL A;  3GTJ B;  2F0Q A;  5IOC A;  5I9P A;  3OWF A;  3W3A A;  4QUF A;  3MHB A;  3GV6 A;  1IL8 A;  2BE5 C;  1D6E C;  2AQ1 B;  1X3Q A;  3F2U A;  4HSV A;  2IPK D;  2KED A;  3T16 A;  2R93 B;  1SYF A;  5E4X A;  1S5F D;  2E2J B;  5C4Z A;  3BDL A;  4IAL A;  3DXJ C;  3RLF A;  3BVZ A;  1EY6 A;  4GZY C;  2F3V A;  2XRQ D;  1ET9 A;  1C4Q A;  5JEA G;  1DXM A;  5C4J B;  4FXG C;  1U4M A;  2F0W A;  2L12 A;  1SDF A;  4DXG A;  2RBM A;  1RKN A;  1STA A;  1EZ8 A;  2Z8L A;  3NK9 A;  3I91 A;  1RDP D;  3KLS X;  4ZAI A;  4R8I A;  3FPP A;  1LT5 D;  3S1Q B;  1HRJ A;  4CGY B;  2QKI C;  3PO3 B;  1C8C A;  5CV9 A;  3J7Y W;  3K5N A;  1FYC A;  1TY0 A;  3KBG A;  4KI0 A;  2NWG A;  2C5C A;  1GOZ A;  2RDG A;  4JBW A;  5KNC A;  5ISR A;  3D4D A;  4BY1 B;  1Y8P B;  3H3V C;  3MTS A;  2XIW A;  1ENA A;  1II3 A;  4KN4 C;  3NBI A;  4K6L A;  2JEB I;  1WTW A;  3HOW B;  2R92 B;  3OW7 A;  4C1N K;  4G7O C;  3NQI A;  1TWH B;  2RQX A;  3FEW X;  2KA7 A;  1H9S A;  3AB9 A;  4RCN A;  2QEJ C;  3L7Z C;  4HED A;  1L0Y B;  4TKO B;  2WAC A;  2F0T A;  1Z7T A;  1Y1W B;  3ITP A;  5IGB A;  2KEE A;  1F77 A;  4K5W A;  4HR7 B;  1V1P B;  4F87 A;  4A3G B;  5I2Y A;  4IUP A;  5AFW A;  3A8K E;  1HQM C;  4O42 A;  3LWE A;  2NN6 H;  1O7L A;  1GXD C;  2R61 A;  3P7J A;  2EYJ A;  2DNC A;  4XYO A;  5K36 H;  2IX3 A;  1B50 A;  5DM7 3;  3CU7 A;  1SSO A;  5C44 B;  1AEX A;  4AYB B;  1QNU A;  1HTP A;  1TQO A;  2F0U A;  1STN A;  2WV6 D;  2WKD A;  3S17 B;  3WOF A;  3DM1 A;  2SEB D;  2FMM A;  1CHP D;  1S5C D;  3IFD A;  2E2H B;  3J7A V;  3RZO B;  2MHV A;  1PXU A;  4A3F B;  3QO2 A;  4FF3 A;  3BVM A;  4N9T A;  3M3Y B;  5IT9 E;  3LWU A;  5F2D A;  5EKI A;  3VYT A;  3A7L A;  4PV1 C;  1BCP B;  2EOT A;  3PUY A;  1OXV A;  3S1N B;  1T5E A;  4M8A A;  2B8F A;  1EYC A;  4ZK9 B;  2MUY A;  2B2Y A;  3MZ5 A;  1EIH A;  1ZYR C;  4ZYS A;  2FJ2 A;  2M00 A;  4KKT A;  1PTO B;  3EFX D;  1WTO A;  3K5O A;  1D5Z C;  2PNR C;  4ZLT F;  4C3I B;  1AW7 A;  1W6K A;  5D14 A;  1EY8 A;  5E3F A;  3NBH A;  4PNY A;  2EYH A;  1CQV A;  4XT1 B;  4C3H B;  4L63 B;  3M85 A;  1FNV A;  2IW3 A;  4ODG A;  1VF5 C;  3QOL A;  2F0D A;  1WTP A;  2EZV A;  4F88 A;  1ILQ A;  2K32 A;  3QG1 A;  3ERO A;  1G29 1;  1NSN S;  2K5W A;  3U9O A;  5JEA J;  4XXE A;  2VUM B;  1I6H B;  3IKJ A;  2B8G A;  4KJN A;  4LK1 C;  1QJO A;  4Q5V A;  1XX8 A;  3SXH A;  5C6A A;  1FGB D;  1OXU A;  3G6J B;  1AFP A;  4IUV A;  2LY7 A;  4OO1 H;  3SE0 A;  5A35 A;  2O2L D;  5C0X H;  3V96 A;  3TBI B;  1LLR D;  4E6I A;  1I3Q B;  1HHV A;  1U4L A;  3R2I A;  1R4Q B;  1X32 A;  1LTA D;  1EU4 A;  2F0L A;  2PZW A;  4KMU C;  2E2I B;  1OXT A;  2PYK A;  4ZUI A;  1O7Y A;  2A5H A;  4RGT A;  1XWE A;  4TSS A;  5ELD A;  1YNN D;  2EDG A;  2IWH A;  1EYD A;  4YIJ A;  3V05 A;  2O5J C;  5K5P A;  3OOC A;  4IUN A;  3SK4 A;  2LKV A;  1ZXT A;  3H91 A;  5FO7 B;  3JAM E;  2BA0 A;  1EL0 A;  2B2V C;  5FKA C;  1YNJ C;  3GP7 A;  1EIG A;  2Y0S B;  2HDM A;  1F2L A;  4KK7 A;  3CQZ B;  5NUC A;  1I6V C;  1TWF B;  2R3Z A;  4ULL A;  4RWS C;  2B2W C;  1MI2 A;  3VA5 A;  1WTX A;  4DK0 A;  1O80 A;  2EJG C;  5FO8 B;  5HGT A;  2K1B A;  2B2V A;  2DN8 A;  3C1F A;  3D4R A;  1G2S A;  3TP8 A;  4PMW A;  2XNA C;  4CKB A;  2B2T C;  1PDQ A;  2F0M A;  1Y1V B;  4PMB A;  2B2W A;  4DAV A;  1JIC A;  4OL7 A;  5FLX L;  3C1E A;  1UEA B;  1S5E D;  1K83 B;  1AP0 A;  2OXP A;  2DY7 A;  3VR6 A;  1XYI A;  1B53 A;  1F9R A;  1X3P A;  2SNM A;  3SHL A;  1Q12 A;  4EQN A;  1G2T A;  5JPM C;  4UDU C;  3CRK C;  2A69 D;  1ROD A;  4CKC A;  3J80 L;  5EPJ A;  3MEH A;  3R8B A;  1PFB A;  1FNW A;  1LTT D;  1B3A A;  1RD9 D;  4DAY A;  4S3S A;  2RSN A;  1V1O A;  3BYT B;  3ND8 A;  5CV8 A;  2FMC A;  4IFD I;  4LJZ C;  1PRT B;  2E75 C;  4MHE A;  1F9S A;  4Z9C B;  2ZXP A;  3LX0 A;  2QCP X;  1OXX K;  1B2T A;  2VB2 X;  1FD7 D;  4EQO A;  1EOT A;  2PCF B;  2JA6 B;  4A3I B;  2J0T D;  3OMC A;  5TSS A;  1D1I A;  4K14 A;  1H9J A;  1HUN A;  4KKS A;  4NMZ A;  5C5M A;  3URY A;  4BBR B;  2KUM A;  3I4L A;  2IJ0 A;  1ENC A;  4KY7 A;  2ZXO A;  3D4W A;  2M2L A;  1BO0 A;  1IHZ A;  4DGZ A;  3MFY A;  2X6G A;  3A7A B;  1GHJ A;  3C3L A;  1TII D;  4CJ0 B;  3VYR A;  3CRL C;  3DEO A;  1ML0 D;  5ELE A;  1EY4 A;  1TWG B;  1HCZ A;  5EPL A;  1PFN A;  1WCM B;  1BCP D;  3S16 B;  1M8A A;  5CGK A;  5I4D A;  1IW7 C;  4BS9 A;  2JA5 B;  4KTA A;  1CA6 A;  1CI3 M;  5M9O A;  4NKL A;  3VR2 A;  4HCE A;  4HTH A;  1QCB D;  2JA7 B;  2RKS A;  4IFD G;  4BY7 B;  2K04 A;  3WOE A;  3RD4 A;  1SE4 A;  3D6W A;  5KNB A;  4R9W A;  4EGV A;  1STY A;  4KKU A;  3MXG A;  4C3I G;  5J22 A;  5EKL A;  3I8Z A;  3GO5 A;  4C3H G;  1SNQ A;  5JVG 3;  1Y8N B;  1H9S B;  4QMG A;  5T1I A;  3HKZ B;  3X3M A;  1GUO A;  1F2Y A;  4DA2 A;  3J7A F;  3CKI B;  2BDN A;  4CBV A;  2JE6 I;  3M4O B;  3OMG A;  1SYG A;  2OT2 A;  3KLS A;  2KCC A;  4IZ8 A;  1Q1B A;  5IIF A;  2ZXR A;  3I3C A;  5EBD A;  1U4P A;  1JOQ A;  5M3F B;  4A93 B;  3BDC A;  2F0V A;  1YNJ D;  4QIW B;  1EY5 A;  2AUJ D;  1EQT A;  1LAC A;  5JAV A;  4ZKC B;  1QB5 D;  2K01 A;  2HDL A;  3BYY B;  3KK7 A;  3RZD B;  1MBY A;  3I4N B;  1SYB A;  5K36 G;  1VMP A;  1GUG A;  3T51 B;  4MIU A;  3ERQ A;  5CMD A;  4H44 C;  1MD2 D;  1LTI D;  2PPB C;  1PMR A;  1ESF A;  5J39 A;  2JEA I;  4U68 A;  2YU9 B;  1U9R A;  1SJH D;  3A8I E;  5C4H A;  1DOL A;  1JOK A;  1TKW B;  2E74 C;  2F1M A;  4K8I A;  1KLG D;  1I4X A;  2JYO A;  3AMU A;  3DUZ A;  1Q1E A;  3L9A X;  2EYL A;  1QWY A;  5C0X I;  3DEP A;  1RJT A;  2JXM B;  3GV3 A;  2A6H C;  2L1B A;  5JJZ A;  2B63 B;  3RMH A;  1I4P A;  2A68 C;  2TSS A;  2KJX A;  2B2U C;  2ZT9 C;  1SEB D;  1GHK A;  4XQN A;  1NCV A;  1STB A;  3EJI A;  3VR4 A;  1ONL A;  2PZU A;  2EY2 A;  5CV7 A;  4WRD A;  2KHS A;  3PUZ A;  3T56 B;  1Z47 A;  1HUM A;  2PQE A;  1SMY D;  3PUV A;  3TZU A;  3HOZ B;  2K05 A;  3MAQ A;  2QIL A;  4MN3 A;  1SXT A;  2MPM A;  3BS1 A;  1TY2 A;  1VMC A;  3PUW A;  1UUP A;  4C2M B;  1CA5 A;  1F2M A;  3A55 A;  3K5M A;  1JB3 A;  4NP5 A;  1KDA A;  2O5I C;  2F0S A;  5BN5 A;  1VF7 A;  1A15 A;  5CBE E;  2EJF C;  4DN4 M;  5E4W C;  5FO9 B;  1NR4 A;  3DHQ A;  3VR5 A;  1HPC A;  4IFD J;  1SAP A;  1PRT D;  1STE A;  2MJ8 A;  2EJM A;  4J1M A;  1T5X D;  1UAP A;  4RH6 A;  4OO1 G;  3Q0A A;  1LTR D;  5C0X G;  2NBF A;  4RHR A;  1QE6 A;  4B9X A;  1GUN A;  2LMC B;  4BBS B;  3I90 A;  4RGN A;  4EVO A;  5FLX E;  1BOS A;  5M5Y B;  2K5D A;  1RTN A;  2TMP A;  2ID0 A;  4F8M A;  1DOK A;  1I50 B;  1EQV A;  3HOV B;  5CR3 A;  2KQ3 A;  1BUV T;  2PO4 A;  3RUZ A;  1DZ1 A;  3H94 A;  2BE5 D;  4HCS A;  5LL6 X;  3J80 E;  3H09 A;  1CZG A;  2XRS D;  4OHJ A;  3D6C A;  1GJX A;  1TVX A;  2ENB A;  1TS5 A;  1LTG D;  5DAU A;  3S1R B;  4N9P A;  1CZW A;  4L6T B;  2Q8I B;  3OWE B;  4TRD A;  1SJE D;  1A3V A;  1EY9 A;  2JA8 B;  5JVH 3;  2HUG A;  5DNF A;  5KYL A;  2CQA A;  1WD1 A;  1BBX C;  3TME A;  5LHY 1;  1ZEQ X;  2D2C C;  1JE4 A;  1PTO C;  3SDZ A;  4I7Z C;  2LS0 1;  1TS4 A;  3QWN A;  1AN8 A;  3HGB A;  2M9V A;  3BZD B;  5I6W A;  1A2T A;  1JOR A;  1C48 A;  3Q24 A;  4K8J A;  1D1K A;  1Q8I A;  2EY6 A;  1LT4 D;  3FMC A;  4FP5 D;  1ILP A;  4IN3 A;  2NVT B;  3HZX A;  3S14 B;  4U67 3;  1DCZ A;  1I4H A;  1BQQ T;  3MXP A;  4A3J B;  2NTT A;  3SK8 A;  4ZUJ A;  2SDF A;  2RDH A;  3GTO B;  2R7Z B;  1QG7 A;  1LAB A;  1JWM D;  1D2B A;  2QDB A;  4RHS A;  3KUP A;  1F9Q A;  4DF7 A;  1BDO A;  3IFT A;  4P2C B;  2F0K A;  3K58 A;  4KV6 A;  3MXN A;  2A6E C;  1GUT A;  5E1F A;  2WIN B;  2CVR A;  3K0Y A;  1CTM A;  5KRU A;  2HQE A;  3R3O A;  2CW0 C;  4RAU C;  4O1N A;  5C4X B;  2D62 A;  1SYD A;  3U9S A;  5DM6 3;  2KCN A;  2SOB A;  3DWA A;  1EZ6 A;  4B08 A;  5EQ0 A;  1EY7 A;  4H7B A;  3H0G B;  2B2T A;  1TWC B;  3I4M B;  4K2K A;  1A2U A;  3PMF A;  4B9W A;  3MWY W;  1E2W A;  4R8N A;  2EYM A;  2F0O A;  4HMI A;  1J9O A;  4HN7 A;  2Z1C A;  3NUC A;  3BVG A;  1B1Z A;  3HOU B;  3SR1 A;  1D5M C;  1SNO A;  4X3T A;  3TP5 A;  5C0X J;  1BCP F;  4WFN 3;  1GUW A;  3D31 A;  2SNS A;  3HOY B;  5KGU A;  3FRP B;  1DJR D;  3NTK A;  1A3U A;  4HAE A;  4A3B B;  1CK1 A;  4KY6 A;  2LFN A;  5JPN C;  1PTO F;  1DON A;  1VCI A;  2MP1 A;  5ELC A;  1ZYR D;  2Q8R E;  1EFI D;  4K6D A;  3OPO A;  1EWC A;  5J1Z A;  1ESR A;  3TN2 A;  3Q6S A;  4X3S A;  3OIP A;  1DM0 B;  4NW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...