3VYUA

Crystal structure of the hypc-hypd-hype complex (form ii)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
LAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/transferase
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vyuA00
3D3RA 3VYUA 2Z1CA 3VYRA 2OT2A 3VYTA 3VYSA
chains in the Genus database with same CATH superfamily
4OHJA 3NTHA 3IRBA 4P75A 3ULLA 5M3MH 1K3BC 4I7ZC 4RMFA 2ASBA 5AFWA 5DNFA 3TZDA 1UE1A 1ILQA 4JI3Q 4A3DB 1WCMB 2VZAA 1B44D 4WFN3 2A1AA 1X32A 1X65A 2VY3A 4DAMA 1Y1WH 3S1NB 3BU2A 4JYAL 2EQSA 1VDZA 2KOLA 1SE2A 5BN5A 1X54A 2SEBD 3VYSA 4HIMA 1N34Q 4K0KQ 1GUWA 4LF6Q 3AMUA 3VA7A 4L63B 5BR8L 1AW7A 3J80c 1YJNA 3FP9A 1SMXA 2YV5A 1JOOA 1II3A 2MQHA 1JWSD 4C2MH 1HZBA 4UP9A 1E2ZA 3HG9A 4KKSA 5NUCA 1EIHA 3J81j 1V1QA 3CC4A 3SVMA 1D8LA 3AYHB 3ULPA 4DR7Q 2JJQA 4RFBA 4DK0A 5CGKA 4HIOA 1EU4A 1A2UA 1GUNA 4BBRB 2CQAA 4DR6L 4RKLA 4A3JH 1PH6A 3S16B 2EDGA 4ZKBB 4GOPB 3KJPA 2HCIA 2LKVA 2PZTA 2MP1A 3A56A 5EBCA 3LNNA 4LUZA 5IP9G 3KUPA 4NKLA 1M8AA 1JORA 1UEAB 2FINB 3A7LA 1R9TH 4QMGA 3CCSA 1PTOH 1BO0A 2I5LX 1KD1C 4DR3Q 1GM5A 1EQQA 4DGZA 5M3FH 4K14A 4X3SA 3CCQA 2FXQA 1G2SA 2E2HH 2JA5B 5ELEA 4QQBX 4JI5Q 4J6HA 1QWYA 1A8VA 4HJ9A 4CHTB 2ICEC 2OF1A 2H4OA 2R93B 2ID0A 4OWXB 1ENFA 1AN8A 4C3HB 4LK1C 3CCEA 2YTYA 2H1EA 2OXPA 3H0GB 4A3LG 1O7YA 4BXXG 1Q86C 3Q6SA 3L7ZC 4XQQA 1IL2A 4OWWB 4XYOA 1U4RA 1JOKA 2KEEA 3DEPA 5IWAQ 4EQNA 3HRZC 5M5XH 5A2QL 1G6ZA 3R3OA 3S1MB 1TWCH 2B2TA 5CV4A 4JI0Q 1M4VA 3GTJB 1N32Q 1FNUA 2NB0A 4DUZL 1KQSA 3K80C 3OYYA 2ZJQA 2E74C 2MFIA 4OWTB 4UY8C 3I56A 4UP8A 3CPFA 4JV5L 4E6IA 3L3OC 2F03A 4A3KG 3PIOA 1HJPA 4DUYQ 4DAYB 3CQZH 1XMOQ 5IT9c 1SMYD 2IT1A 1N36L 3GTPH 4H7BA 1JB3A 1DM0B 5JJZA 1KRTA 2F0TA 3SR1A 4C3JG 4X65L 1JWMD 2KCCA 1SNOA 3GP7A 1QUQB 3NEMA 1BBWA 1IW7C 1L1OB 4DV5L 2QDLA 4JI8Q 1E7ZA 3TP8A 4N8X1 3UE1A 3D6CA 5CV8A 4JI1Q 3KLWA 4A76A 1LYLA 2D62A 4P74A 3R8BA 3VYUA 2RDFA 1IHZA 4IPHA 2UUBQ 2HDMA 3W2DA 3R93A 5ISRA 1LACA 3DM1A 5CV7A 5IGCA 2A6HD 1EY7A 4O42A 4GKJL 2RBMA 5JJIA 3PUWA 1HTLD 4HMIA 1K83B 4RGMA 4V190 5JAVA 5K5PA 4HIKA 3KLRA 4IFDG 1ASZA 4HJ7A 2M00A 1YEZA 1NMFA 4PQXA 3CCRA 5LMUL 2I5MX 4J8QA 4L5TA 3PO3G 2UUAQ 4IJHA 3RNUA 1IBLQ 1C4QA 4HJ8A 2E2IB 1PFBA 4RKBA 3BVZA 3EBEA 3S2HB 3EIVA 1HQRD 3F8TA 4X62L 2X6LA 1SE8A 1Y1VH 4HCSA 1OXVA 2Q8RE 1B7YB 1CT1D 2A74C 3I8ZA 1VQDA 2B3GA 5KNDA 2EY2A 5GAHC 2KUMA 4X3KA 1JJ2A 2HHHL 1VMPA 3K5NA 1Y14B 2NVYB 2L5TA 3Q22A 4A3MG 2Z6BA 3KK7A 1U4LA 3JAME 4NW2A 4PMWA 1SNPA 3CCUA 5LMNQ 1QCBD 3OW2A 2E75C 5EBDA 4X64Q 4IURA 5ELNA 1LT6D 1TWFB 4GKKL 5KYIA 1EOVA 1OXUA 1EFID 2OQ0A 2VUMG 4IZ8A 2F0EA 2K28A 5D65A 4X3UA 3PUYA 3I91A 1D5ZC 1V1PA 1EQTA 2D2CC 2OTJA 5EQ0A 4DV6Q 3CF5A 3TS2A 2JA6H 1FR3A 1EQVA 1TY2A 2NVQH 1CKNB 1NR2A 2FFKB 5ELCA 5IGBA 5I6WA 4TVAB 4LUOA 2VQFQ 4ODGA 1ZYRD 1U9RA 3F2CA 4Y7NB 3QB3A 1STYA 5C3EH 5I2YA 1DOMA 2PW7A 1XMQL 4QF4A 4Z9CB 2ZT9C 2OWOA 2N78A 3PSIA 4OO1G 4IN3A 3FVQA 1C48A 5D3IB 1HRJA 4C1NI 4IPCA 2EZVA 1MKHA 1X3GA 2UU9L 3P20A 1TS2A 3DEOA 4MTKA 1PA6A 4YWMA 5C4HA 4QIWE 1HQMC 2R6GA 1YI2A 1JE4A 1EZ8A 3M85A 1TWHH 3HOYH 2MUYA 1HNXQ 5DLQE 5KGUA 2A68D 4JOIC 4A3KB 3BZDB 2D0PA 4P73A 3K6OA 2B8GA 4FP5D 1C7YA 1RKNA 1HA5A 1CK1A 1EY6A 2Z4HA 3K8AA 1EYCA 4LW1A 4NXMQ 1O80A 1SE4A 5ELDA 1ET9A 4C3JB 2E2JH 1HNWQ 5IYDH 1YNJC 2O4XA 1WOCA 2CWPA 1KIXA 3A0JA 5I9PA 1KC8C 1KABA 5CMDA 5GROA 4DV7Q 4LFBQ 4KY7A 5FLXE 1QNKA 3EROA 2KHIA 2H5XA 4EQ5A 2RVLA 4KHZA 4BA1I 5CR3A 5M5WB 1M1KC 3JAMi 4BA2I 2KEDA 1B53A 2UXBQ 4WJ4A 1S5DD 2KVMA 2F0OA 2K01A 4KD4A 2K5QA 1PVOA 1AZQA 4DV1L 1VQHA 3T56B 1GXDC 1LM0A 1Q1EA 3J7ZC 3GTLH 2I46A 2QCPX 3S15B 3H3VH 1GUOA 5C3XA 1UE7A 2CFMA 1Z6HA 4HJAA 1CA5A 5L37A 5JJKA 3K5OA 2UUCL 3A54A 3CCJA 4BBSH 1I4XA 1OXSC 4XIGS 5EKIA 2PQEA 3PO3B 5IOCA 1MJEA 3KF6A 3A5UA 1XYIA 1A0IA 2NZHA 1WTQA 5EKKA 3AB9A 3J81L 4WORA 3RZDH 2AUKA 3UI2A 1DXMA 1X3QA 2EYHA 1LTRD 3H3VC 3MHBA 3ULJA 4B3TL 2B2VA 4YIJA 4L5QA 1Z47A 1MSGA 4RG1A 1I3QH 1VQIA 1FJGQ 4A3EG 2OTLA 5A35A 4A3MB 1YHQA 2F0FA 4OELB 1I6HB 4AYBG 2R7ZG 3S1QH 2SOBA 3A8JE 2Q2UA 4KY6A 1D7QA 1KAAA 4YHHL 2ALYB 2BOSA 1CKMA 1DD2A 2LY7A 4ME3A 1RDPD 3WWVA 1D1IA 3NWSA 1I4RA 3M7GA 1EWIA 4UDUC 4FO2A 4DV0Q 5C4XG 3QIAA 2VUMB 4WJWA 3NBHB 1E3PA 3F1ZA 4ZK9B 4X66Q 3EJIA 4POFA 4K2KA 4ZAIA 1N33L 1W2BA 1Y69U 2MGSA 3MA2B 2ZM6L 2AWOA 3MFYA 1K3RA 4IUVA 2NTTA 3QJYA 4DV2L 5C5LA 2XRSD 1ML0D 3D8GA 4IUQA 2B63G 2N88A 2EYMA 1RD9D 1F9PA 1LLRD 1BBUA 2KENA 5K36G 3PMFA 2ZXOA 4JYAQ 1VQAA 4XT1B 2MNAA 2WKCA 2N55A 4GOPC 4PZ7A 4ZKCB 3HOZG 5BR8Q 4DXFA 1IBML 3QO2A 1NBWA 2EYOA 4UP7A 5LL6S 3I4NH 1VQ5A 2YU9H 1O7ZA 3UE0A 1IZ6A 5IYBH 3H0GH 4O1NA 2CH4A 1VS0A 4NP5A 4DR6Q 1HNZL 3EVQA 5C44B 1S3OA 2EE1A 3CCVA 2R7FA 3W3AA 2KQ3A 1TXYA 3UDGA 3GTMH 3CHBD 4PG3A 4LWCA 1SRUA 1PH2A 1PZID 3BDOA 2NUCA 4B9WA 3GTJH 1VF7A 4ALPA 3I4LA 4A3GG 3PUXA 2RSOA 2MHVA 5KNCA 1UEBA 1K9MC 2ZTEA 2L55A 1Z9FA 2A73B 1L2FA 3K58A 1LT5D 2JYOA 2KECA 2BH2A 5DEHA 4DA2A 4HN7A 1QJOA 5E4WC 4B9XA 2Z1CA 2NVTH 2JEBI 1LV9A 1VQEA 3RD4A 3L9AX 3FPUB 2L12A 4GLXA 3Q8DA 3C1FA 3M3YB 3IKJA 3PUZA 4FF1A 2A5HA 2WFWA 2B2UC 2OT2A 4G7ZC 1SYGA 2B39A 1LT3D 3CU7A 5FOBB 1E24A 4JW0A 4R9WA 4P2CB 1TR5A 1B9NA 2FJ2A 3P7JA 2XIWA 2PMZB 4DV3L 4CDDC 4KHVA 4BS9A 5KNBA 3CCLA 2RCFA 1QZGA 3Q0AA 3TREA 4DUZQ 3HOUH 1RL2A 3K7AB 2LXJA 4DKAC 3B6YA 2N3SA 3UDIA 1F2LA 1K83H 1L1OC 4JV5Q 3MXNA 4DU9A 1UE5A 4G7OC 1ICFB 4GNXB 3RZOB 1WD0A 4A3EB 1WTVA 3PF4A 2I5HA 2XWBB 2EPBA 3G7LA 2WKDA 4AYBB 1Q90A 3FKIH 2R7ZB 3OSOA 1LTTD 4X65Q 2RF4A 4QB4A 1XTCD 2SNSA 2Q8TA 5FK9C 2F0SA 4FXKC 2VB3X 3TEHB 3HKSA 4DV5Q 2F4VQ 1KDBA 1PRTB 2SDFA 1CUKA 4LFCL 4LAAA 1RJTA 5AJ3Q 1SYDA 5C4XB 2F0GA 5IP7H 3WOFA 4WRDA 4BY1G 2IY5B 3LWEA 3KF6B 3H3VI 1EY9A 5CV6A 1I94Q 5JOBA 1G8ZD 1RIPA 4IUUA 4HSVA 1STNA 1PZKD 1M90C 4IFDJ 4K2LA 4HMJA 4KN7C 3QOLA 1VQMA 4C56C 1KLUD 2KCTA 1F2ZA 1FGBD 2B63B 5HURA 2ENBA 5IT9L 4N8FA 1TS5A 1Q7YC 2C35B 3MC0B 3HOWH 4FVMA 2B2WC 3GO5A 3PIP3 4A75A 4LNQA 5D3DA 4RWSC 1KTKA 4LUVA 2XVSA 2KA7A 4A3FH 4APVA 3I4OA 3HOZB 4MZ9A 5EGTA 1EY4A 1IW7D 2TSSA 5FO7B 4DAVA 2AQ3B 2WV6D 1XNQQ 4X62Q 5C5MA 4FDBA 4JI4L 1OTCA 1YHAA 2D9UA 3S1RH 1F9SA 4PZ8A 3L0OA 1ZEQX 4I7AA 1F77A 1SNCA 1B4OA 3ITPA 2HHHQ 1H9RA 4BXXH 1HZ9A 2JA7H 1S5FD 1CQFA 3K0XA 3G71A 3IAYA 1NSNS 3MXPA 1DGSA 5M3MG 3NQTA 3E0EA 4A3BB 1G6PA 2PI2E 5CV9A 3M7NA 4G4KA 3OW7A 3ERQA 3HKZE 3GD7A 3I7FA 4A3GB 2XWJB 4JG2A 4OX9Q 4JBMA 3PIO3 1IBKQ 1I6VC 1SN8A 3HGBA 3TBIB 3PIPA 4DR1L 3PUVA 4LF8L 1AE2A 2BA0A 3R2TA 4DR5L 1VQJA 2RA4A 1S5CD 1SFOH 2D5DA 2UXCQ 3K7UC 1YNNC 5IGGA 3BVGA 2EYFA 1RODA 1SLJA 4XDXA 1MHWC 3S14B 1J6QA 1A62A 4QJFA 1EYAA 2QILA 3NBIA 4XYQA 4CKCA 1EY0A 4G7HC 5C6AA 1R4PB 2K5NA 2K03A 2EY1A 1E2WA 1I4QA 1HZAA 1S5ED 3KDFA 3S2DB 3KF8B 2EIFA 3P75A 2JA8H 4A3JG 3FDTA 1F9QA 5M5WH 4GLAC 4DFAA 2PI2A 1IL8A 2VW9A 4RHRA 3J7AF 1BCPB 4A93H 1J5EL 3GTOH 1KL9A 2K1BA 1LTLA 5G3LF 2Y0SE 3D4RA 4ZQ3A 4B3RL 5I2XA 1PYSB 2M2LA 3CPWA 1WVLA 5JVG3 1QNUA 1D5XC 5EPKA 5M3FG 4IFDH 4XQNA 3PO2H 1IXRA 3VR2A 1A63A 5HY6A 1KDAA 2PCFB 3SEBA 3PO3H 3IL8A 5FLMH 2M9VA 4DF7A 1VCIA 4ABNA 2E5LL 2KCNA 4RA8A 1LT4D 1EUJA 2BH8A 3N6RA 4S3SA 3I4MH 3MFGA 4PNYA 3BG3A 3CC2A 3CAMA 4KHPL 3M4QA 1T5EA 4BY1B 3CCMA 4HAEA 1CM9A 3GTQB 3BYTB 4ZLTF 3I3CA 2WB1E 1HH2P 1O78A 4A3MH 1RCVD 2WP8J 2VQEL 3SK4A 4JI2L 1DJRD 1H9SA 1H9JA 4DV1Q 1Q3LA 1XWEA 4NPSA 4PMCA 4XTCS 5M5YH 2IX3A 1A2TA 4AQYL 4K6DA 4H02A 1TWAH 4FXDA 1K8MA 1PH9A 1Q81C 1A3VA 1S5BD 3DLLA 2B2YA 3G48A 3M4OB 3HOXH 2RCNA 3TSSA 1STGA 4GZYC 2UUCQ 2B2YC 1DONA 2R92H 2UXDL 4O2DA 1I50H 1WTRA 3PGZA 1XNRQ 5JEAJ 4KJOA 3CMAA 3QWNA 4EVOA 2XGTA 4A3CG 1CHQD 1BOSA 1YNJD 2L11A 4CDCC 1IYJB 3K59A 3CC7A 3S17B 1DOLA 1AH9A 2A6ED 2HQLA 1N34L 4LF6L 2Z4IA 5IYCH 2CCZA 1STAA 2L15A 4OL7A 3BS1A 4ZUIA 1G291 1TWGH 3RN5A 2F3WA 2Z6KC 4HCEA 4HR7B 2G9HD 1NUCA 2L0CA 1JB7A 1PTOF 5GQOA 3A55A 2XN9C 5TSSA 1A6XA 1TKWB 1FL0A 1JJCB 3V05A 3TZUA 1CA6A 1ET6A 3TP6A 3URYA 5M3MB 1ONLA 1VQCA 3CKIB 4YHHQ 3T1HQ 1EEID 1YZ6A 4X6AH 3E5SA 2IPKD 1Z7TA 5IE8A 1HZCA 2E2DC 1NR4A 3T13A 2QF7A 3SE0A 1HFGA 1T9HA 4DR4Q 2CVRA 2PQAA 1T5XD 1LTBD 1Y8NB 4R4QA 2WAQE 1N33Q 1TS4A 3A7AB 4CJ0B 3RLFA 1PFMA 2ZM6Q 4R4OA 3FMCA 1K8AC 4DV2Q 1H9MA 2B8FA 4C2MB 1YIJA 3NK9A 4A3IH 1BVSA 1F2MA 4HSPA 2F3IA 2A8VA 5KIXA 1OO9B 1Y1VG 2CHBD 2NN6G 3ND8A 4BY7G 1BF4A 2A19A 2R7DA 1X9NA 3KOJA 5EJWA 3T53B 1GHKA 3Q24A 1F9RA 4A3JB 3HOVH 2F0KA 1CZGA 4IPDA 3MVVA 1IBMQ 4OONA 2RHSB 1LTSD 1RTNA 4JOIA 3G6EA 2QEJC 5E4XA 4JK1C 3LWUA 3J80E 3GV3A 1IYUA 5C44G 4LF5L 1QILA 1PTOB 3NQIA 4DAPA 4NXNL 3MZ5A 3BDCA 1HNZQ 2C5CA 5FO8B 1NTGA 1BUVT 1KAWA 4JI6L 5M3FB 4DXGA 4LFAL 2K32A 1B70B 1U5KA 1XPUA 1C0AA 2E2HB 2NZ1D 3OWFA 2A6EC 2K33A 3E6ZX 1N8RC 3DM3A 3BZKA 3A5ZB 3DWQA 2JA6G 3HFZB 2SNMA 1FYCA 5IODA 3S9WA 4QCLA 2ZXPA 3K7AH 3BZCA 3QR8A 1LTAD 1S40A 2BDOA 2JQOA 3FRPB 3H15A 2MJ8A 4OIJA 5C3EG 1EOTA 3Q23A 5JEAH 4DK6C 5C0XJ 1DYQA 4C3IH 5FJ8H 1XX8A 2Z0SA 4B3MQ 3GTKB 4LF7L 2KBNA 3K5LA 1N9WA 2QKIC 1E22A 3CXCA 3EFXD 3KLSA 2EOTA 5M5XB 4OGQC 1TWCB 4WJ3M 3K0YA 2NVXH 4K5WA 4JI7Q 4L6TB 2MO0A 1CSQA 1TS3A 3HOYG 1CSPA 3RN2A 5F2DA 4A3BH 1MJCA 4R4TA 3S24A 3T1YL 5C4XH 2ICIA 4GNXC 5C4JB 3N52A 1C8CA 2X69A 1KLGD 3K5MA 4IFDI 1HUMA 2F0WA 3CQZB 4RCOA 5J1ZA 4A3DH 1WCMH 3VR4A 2F0PA 5IYDG 1G91A 3PCOB 1K28A 3S1NH 2ZTDA 4I65A 4YCWA 1E1TA 2Q2HA 2LFNA 2NWGA 2HUGA 1WYDA 4UPAA 3MXUA 1HR0L 1XPOA 2K5VA 1JE5A 4UAIA 1VQ7A 1A3TA 1X3FA 1PH8A 2ES2A 3STBC 3TP5A 2XNAC 1SYFA 3J80i 1SJHD 5EPJA 1VQ4A 2K5HA 3R2IA 1EYGA 5LMNL 4LFCQ 4RGNA 4BBRH 5LHY1 3D4WA 1AEXA 3HZXA 2IHFA 3S16H 3D31A 1UE6A 1LTGD 1W6JA 1B8AA 4O0AA 3JC66 2K04A 2ZXRA 1Q8IA 1V8QA 1D5MC 3PV0A 1EEFD 4BBSG 2IWHA 1PMRA 5I9OA 3VR3A 4B08A 2XRQD 3U9SA 3TRZA 4GOPA 2L9HA 2CW0C 2JA5H 1Y1VB 1QB5D 1STHA 4BY7B 3TQYA 5CC4A 3H09A 3JAML 3E9IA 1EQRA 1PXUA 1ZKOA 1HTPA 2EYLA 1JICA 1VQNA 2R93H 5E7NA 3GTGB 2EY6A 4OO1I 4YY3L 4KKTA 4C3HH 2QDBA 5H1SE 1V1PB 2TMPA 4MN3A 2BE5D 4CGYB 3S14H 4P71A 1QVGA 3MTSA 2K52A 3I72A 5EAYA 5C0XH 2YTVA 1I5FA 3NPPA 4ZYSA 2EJGC 1SROA 3A8KE 3SK8A 5I4DA 4OEMB 3S1MH 1D2BA 1FNWA 2K75A 1ESFA 4R1JA 3BVMA 1NAPA 1YJ9A 4HIDA 1XJVA 2JA6B 2NVQB 4K5VA 2LS01 4F87A 4EX5A 5A2QE 1Q46A 1PRTF 2IJ0A 2E76C 1E1OA 3E3XA 5C3EB 2D0OA 2HIXA 4B3SL 1K8OA 4LF8Q 3F2UA 4K5XA 4LJZC 3I55A 4DR5Q 1SXTA 2B2UA 1L0WA 4DV7L 4IOAA 1WTXA 5CV5A 1ASYA 4CDFC 2PZUA 2EYJA 3X3NA 3QOJA 1BCPC 2UXBL 1K8GA 1K0SA 3L2PA 3U50C 4DAYA 2F0MA 2V4DA 1TWHB 3HOYB 4A3LH 3VR6A 1IKLA 4K8JA 5J3BA 1MSHA 3UDXA 1SR3A 2FMCA 1QUQA 4J15A 2DY8A 4DV4L 4DR2L 2F0JA 1RF2D 1BBXC 3F2BA 1BNZA 1WD1A 1L1OA 2NTSA 2NZOA 2L4NA 4GN5A 5ELOA 1B50A 2AKWB 2KHSA 1J5EQ 2BA1A 2X6GA 3F2DA 5FLXL 4EGVA 1EIYB 3BJUA 4Q5VA 2E2JB 1EIGA 1TQOA 2JP1A 5HGQA 4B3RQ 1H95A 4QIWB 2QEXA 1GKHA 3I70A 1N36Q 1GD7A 2FMMA 4F8MA 5M9OA 3SDZA 3SXHA 3JAMc 3E0JA 3FEWX 1O7LA 4RAUC 2HCCA 4H0LC 1WTPA 2E2IH 2MO1A 4R4CA 3S2HH 1SEBD 1YNND 2EVBA 2MPMA 4LF4L 4IO9A 2BE5C 2RDGA 2DNCA 1KDCA 3VYTA 1Y8PB 1Y8OB 1PYWD 2A69C 2BDNA 4OIKA 3TN2A 3SHLA 1I4GA 2OCEA 5J22A 4KHPQ 2PNRC 2NVYH 3PF5A 4BWGB 2F3VA 3NXWA 1TY0A 2LMCB 2FHTA 1MGSA 2B29A 2F52A 1QZHA 5IP9H 4GKJQ 4LF9L 4IUNA 4BBSB 1B2TA 1YJWA 2VQEQ 4X66L 4JI2Q 1ZXTA 4F88A 1AZPA 1TWFH 2CH4W 2J7ZA 2LSSA 2B2WA 2V1CC 4N9PA 2F0NA 4HEDA 4JBJA 3HOUG 4AQYQ 1O7IA 3T51B 2R61A 3RZDB 2DN8A 5GADC 1MBYA 2HQEA 3U58A 1NJIC 5LMUQ 3CP0A 3BDLA 3FPPA 1QE6A 1STEA 1JJGA 3VDYA 2RHQB 2I0QA 2UXDQ 3D3RA 1I3QB 1TU2B 3DXJC 1X56A 1L0XB 3IFTA 3NE5B 1BCPF 3OIQA 2L1BA 1AP0A 4QGUA 5COYA 4Y7NH 3FKIG 3S1QB 3VA5A 3J7A5 4CDEC 3NHHA 2Z8LA 3DWAA 4M1UB 3EQLC 4IALA 4JVZA 3T4AC 1DZ1A 2KHJA 1CKNA 4J1MA 1BXTA 3RMHA 1GOZA 5IP7G 3C2PA 2OQKA 3I73A 3V2TA 3HP3A 4ZUJA 1IYVA 4V0BA 1FD7D 4GKKQ 2KJXA 1MIUA 1VQGA 4PZ6A 1S72A 2NBFA 3KYHC 1AE3A 5FLXc 4Q0FA 1WJJA 4U68A 1YBYA 4IQZA 2R3ZA 1QG7A 1Y1WG 1J9OA 2AMCB 1VQFA 4A3KH 1TIID 2ZJPA 1VQLA 2O5IC 4C1NK 1HFNA 3KBXA 4KV6A 3HOWG 5CBAE 2IHEA 2DUDA 4C3JH 3NSWA 4GS3A 2Z9HA 4A3FG 1XMQQ 3G6JB 3OTOL 1HA6A 5EPLA 1V9PA 3CMEA 1LO5D 3C1EA 5CORA 5CBEE 3A8IE 1Q12A 1PFNA 1VQOA 4XXEA 3I4NB 4YWKA 2YU9B 1PH7A 4EQPA 1FNVA 3H94A 2XSCA 2G9DA 1PTOC 2PO4A 5C0XI 4RH6A 4ZRZA 3VR5A 3H6MA 1YITA 2UU9Q 1JQYD 1JWUD 3PQIA 1VMCA 1EFWA 1SBBB 2JA7G 4DN4M 3GTKH 1D6EC 4N9TA 1EY5A 4FXGC 4ULLA 1SYBA 1CZWA 4L5RC 3GTMB 4OXPA 1X6OA 1KHIA 1NE3A 4DNTB 3S15H 2GVBA 3AFQA 5I6YA 4YCUA 1IKMA 4LF5Q 1SJED 1SYEA 2B2TC 5LL6X 4TSSA 3E9HA 4NXNQ 1TT2A 1GO3E 2ZJRA 4TKOB 4JI6Q 1D1KA 5CYUA 4LFAQ 2HD3A 2PPBC 4KKUA 2KCMA 3RLNA 5C4JH 1PH3A 4IJLA 2NVTB 2VXWA 3MEHA 2ZTCA 2ATWA 2J0TD 4A3CH 3ND9A 3QG1A 1VQKA 1U4MA 3GQBA 4XQJA 3HKZG 4A4IA 4FF3A 2EJMA 4K6LA 3J81E 2F4VL 2Q8IB 1WTOA 1UWVA 4KN4C 1I6HH 5AJ3L 1QOHA 1PZJD 1BDOA 5JPNC 1B3AA 2DGYA 1KNEA 4LF7Q 3MXNB 4GN4B 2JA8G 4F7XA 1UAPA 1MD2D 2F0LA 2JN4A 1U0LA 1I94L 1YNXA 1GUTA 4JI3L 2XTIA 4A93G 3OWEB 4RHSA 3HOUB 2VUMH 1H9KA 1JC7A 3OPOA 1WI5A 1SDFA 4KY5A 3T1YQ 2HDLA 4FNFA 2JE6I 1GUSA 3GDEA 3KLSX 4JPBW 5IGFA 2K6AA 2AWNA 3OOCA 3MXGA 5T1IA 4K0KL 2DNEA 1TVXA 3PO2G 2Z6KA 3FHWA 2EXDA 2NYZD 3FKIB 4JCVE 4B3TQ 3NBHA 5FLMG 2DJGC 4RGOS 3U4VA 1WFQA 3EA6A 3OMCA 1G2TA 4CKBA 4OO1H 2Y0SG 4POGA 1XNQL 4DR7L 3SK6A 1EY8A 3I4MG 1NY4A 2NN6H 5DAUA 3DWPA 1HR0Q 4NMZA 3ERSX 5IGEA 4L5SA 4BY7H 3X3MA 1CTMA 1ICWA 2EYPA 1DCZA 2N49A 2GN5A 1EL0A 3GTGH 1CQVA 3V96A 1EYDA 2I07B 1AFPA 3D4DA 2EY5A 3TDQA 2GA4B 1HPCA 5KRUA 3C3LA 1HXYD 1YVCA 2F0QA 2DY7A 4DR3L 1Y1WB 4M8AA 3M9BA 5C44H 1R4QB 4FF2A 4ILWA 3U9OA 1Q82C 4OX9L 4JI5L 5FO9B 3HOXG 3HOWB 1IBKL 3TP7A 1SMYC 4PV1C 2R92G 3AEVA 1HHVA 4QL5A 2WB1G 4A3FB 4TRDA 1MI2A 3RR5A 2JEAI 2UXCL 1PRTD 1JCKB 5IYCG 1S4ZA 4RCNA 1VQ6A 3J81i 2WIIB 3S1RB 1X3PA 1XXGA 4CKEA 2PMZE 1SAPA 3GV6A 4KTAA 1ESRA 2CKZB 2CQOA 3STBD 5J39A 5IWAL 2JA7B 4YY3Q 3M3YH 2JK8A 2PYKA 4R8NA 1GHJA 4JI0L 1N32L 4KJNA 1R9TB 1PLFA 3TMEA 2A6HC 4HTHA 3WOEA 1EWCA 2JXMB 3KBGA 4X3TA 4CJ2C 3AQQA 1JMCA 5ELBA 2YYZA 5KYLA 4DUYL 2F1MA 4AYBE 4YCVA 1XMOL 2HIVA 3KFUA 2JA9A 1W6KA 2RQXA 2F4IA 3T16A 4AIMA 1SNQA 2O2LD 1SFOB 3CRLC 3W5OA 4DNRB 1FGUA 3KDFB 3HEJA 1HUNA 3CD6A 2CW0D 1LUZA 4JI8L 3HKZB 4A3IG 2AHOB 3RZOH 4B3SQ 1VQ9A 2K14A 1SE3A 2LXKA 4A3EH 4JI1L 3DMUA 4QY7A 1QVCA 4DK1A 5IGDA 1DOKA 2PZWA 3OMGA 1XPRA 2K7VA 2R7ZH 2QW7A 4Y52H 2UUBL 4GN3B 2JA8B 1PV4A 3HOVG 2OEOA 5JPMC 3P1HA 2WAQG 4UHVA 3NELA 3MAQA 4GNXA 2WINB 1HR0W 4A93B 2E8GA 3GTOB 1KXLA 5HGTA 3KJOA 2IL8A 4R8IA 3A74A 1Q8KA 4QUFA 4AH6A 4DV3Q 4ZCKA 5GAEC 2K5DA 3GTPB 1V43A 4IUTA 2O5JC 4DV4Q 4DR2Q 1KRSA 4FF4A 2PW5A 4PMBA 2K05A 3BYYB 2UUAL 4KI0A 1U4PA 5LMNW 3PO2B 1EWHA 3OHXC 3U4ZA 1IBLL 2VS1A 1RHPA 4KD3A 3J7YW 1K0RA 2B63H 1PRTC 3MWYW 1XNRL 2VB2X 1LABA 4CBVA 2Q2TA 1PH1A 5K36H 3W1GA 4FYDA 1ZYRC 3NP8A 1C9OA 2YTXA 1KNAA 2Y0SB 1H9SB 3I4MB 2F0VA 1ILPA 5IY0A 1A15A 1WTHA 5JEAG 3HOZH 2F0UA 4L8JA 5IT9E 1F2YA 1K73C 1GUGA 2RDHA 4C3IG 5FJ8G 4LF4Q 2B2VC 1PH5A 2IW3A 1BCPD 1CKOA 5E3FA 4X64L 1ENCA 5GAGC 3K57A 4JC0A 2K4KA 3WDNA 1CHPD 3T1HL 5M5YB 4QUCA 1TWAB 3TS0A 2WACA 1CI3M 1BR9A 4A3BG 4XT3B 4U673 5ELFA 2A68C 1NNXA 4DR4L 3HOXB 2AUJD 4DV6L 1QVFA 4DK3C 3O13A 3W1BA 4LF9Q 1OXXK 3OIPA 2R92B 1I50B 1L0YB 2WB1B 3CW2C 3VYRA 4A3GH 4YWLA 1SSOA 2K5WA 4A3DG 2VQFL 1WCMG 2QGQA 3SK5A 4ME5A 2QA4A 1EU3A 1J8IA 3M4PA 1YHBA 3AU7A 3RLOA 4MTNA 1TWGB 3NTIA 2PNHA 1A3UA 4IUPA 3C46A 2NN6I 3UDFA 5FKAC 1NMGA 2J4XA 4RGTA 1PYBA 2PQAB 4JI4Q 2Q2IA 3AFPA 3IFDA 1Q1BA 2A69D 2VL6A 1NCVA 2GVAA 1BKBA 2JSOA 4NB3A 3EN2A 1EIFA 1RTOA 3ONAB 1W3SA 1HNXL 3S2DH 3NUCA 4BBRG 1WTWA 4DNIA 4G57A 1E0BA 1VF5C 1I4HA 3HS0C 1FVIA 5G3LD 2IX1A 3DHQA 5BN4A 4KMUC 4IOCA 4NXML 1GVPA 1HNWL 1PFSA 2K50A 3NENA 2BCOA 3D6WA 1PH4A 2G5DA 1B1ZA 3I90A 4DR1Q 3G4SA 4GLVB 3KF8A 1VQBA 4TQUS 4A3IB 1JR0D 3ZYYX 3J81c 4P72A 2HT1A 4LFBL 1XTDA 1SNMA 1X3EA 2JA5G 2EJFC 3LGJA 2DJFC 5D14A 4CJ1B 5DM63 5DM73 4NDXA 1B9MA 3J80L 2F0IA 2IX0A 1B3QA 2R93G 2AQ1B 3HOVB 3I2ZA 3RUZA 3MEFA 1P16A 1I4PA 3OTOQ 2WAQB 4MHEA 3I4NG 4B3ML 4C3HG 2RSNA 4MIUA 5IYBG 3H0GG 3ZJYC 4MNOA 4BY1H 1GJXA 1SYCA 1OXTA 5E1FA 1BQQT 3K81C 3GTQH 3H91A 3ER0A 5C3WA 1LTID 5C0XG 1PDQA 4R4IA 4JI7L 2VNUD 1ENAA 1JOQA 2N8NA 2F0DA 2P5ZX 1P8LA 5IIFA 3M4YA 5JVH3 1JT8A 4H44C 1X55A 4DPGA 1VQ8A 3M4OH 1PHJA 4KK7A 4LMQD 3J7AV 1E2VA 1FJGL 2F0HA 3ICEA 1V1OA 4ID6A 4JBKA 4H13C 1UUPA 4KLKA 5C4ZA 5BN3A 5KEEA 3S17H 2E5LQ 4C3IB 4IPGA 2EXZA 1UNSA 3LX0A 1HCZA 2C9OA 5JJLA 1SNDA 1VQPA 1CFMA 3NWTA 2RKSA 4HJ5A 3SGIA 5T1GA 1EZ6A 2AQ2B 2CWAA 3GTLB 3D0FA 1STBA 3NTKA 1G51A 1PTOD 3DUZA 2NVXB 4DV0L 4EQOA 3CRKC 5EKLA 4K8IA 4JBWA
chains in the Genus database with same CATH topology
4OHJA 3NTHA 4I7ZC 5AFWA 5DNFA 3TZDA 1ILQA 4A3DB 1WCMB 1B44D 4WFN3 1X32A 3S1NB 1VDZA 2KOLA 1SE2A 5BN5A 2SEBD 3VYSA 1GUWA 3AMUA 3VA7A 4L63B 1AW7A 1JOOA 1II3A 1JWSD 1E2ZA 3HG9A 4KKSA 5NUCA 1EIHA 3SVMA 4RFBA 4DK0A 5CGKA 1EU4A 1A2UA 1GUNA 4BBRB 2CQAA 4RKLA 3S16B 2EDGA 4ZKBB 2HCIA 2LKVA 2PZTA 2MP1A 3A56A 5EBCA 3LNNA 3KUPA 4NKLA 1M8AA 1JORA 1UEAB 2FINB 3A7LA 4QMGA 1PTOH 1BO0A 4DGZA 4K14A 4X3SA 1G2SA 2JA5B 5ELEA 4J6HA 1QWYA 4CHTB 2ICEC 2OF1A 2H4OA 2R93B 2ID0A 1ENFA 1AN8A 4C3HB 4LK1C 2H1EA 2OXPA 3H0GB 1O7YA 3Q6SA 3L7ZC 4XQQA 4XYOA 1U4RA 1JOKA 2KEEA 3DEPA 4EQNA 3HRZC 5A2QL 1G6ZA 3R3OA 3S1MB 2B2TA 5CV4A 1M4VA 3GTJB 1FNUA 2NB0A 2E74C 4E6IA 3L3OC 2F03A 1SMYD 2IT1A 4H7BA 1JB3A 1DM0B 5JJZA 2F0TA 3SR1A 4C3JG 1JWMD 2KCCA 1SNOA 3GP7A 1IW7C 3TP8A 3D6CA 5CV8A 2D62A 3R8BA 3VYUA 2RDFA 1IHZA 2HDMA 3W2DA 3R93A 5ISRA 1LACA 3DM1A 5CV7A 5IGCA 2A6HD 1EY7A 4O42A 2RBMA 3PUWA 1HTLD 4HMIA 1K83B 4RGMA 4V190 5JAVA 5K5PA 3KLRA 4IFDG 2M00A 4PQXA 4J8QA 1C4QA 2E2IB 1PFBA 4RKBA 3BVZA 3S2HB 1HQRD 2X6LA 4HCSA 1OXVA 2Q8RE 2A74C 1CT1D 3I8ZA 5KNDA 2EY2A 2KUMA 4X3KA 1VMPA 3K5NA 2NVYB 2L5TA 3Q22A 3KK7A 1U4LA 3JAME 4NW2A 4PMWA 1SNPA 1QCBD 2E75C 5EBDA 4IURA 1LT6D 1TWFB 5KYIA 1OXUA 1EFID 4IZ8A 2F0EA 2K28A 5D65A 4X3UA 3PUYA 3I91A 1D5ZC 1V1PA 1EQTA 2D2CC 5EQ0A 1FR3A 1EQVA 1TY2A 1NR2A 2FFKB 5ELCA 5IGBA 5I6WA 4ODGA 1ZYRD 1U9RA 4Y7NB 3QB3A 1STYA 5I2YA 1DOMA 2PW7A 4QF4A 4Z9CB 2ZT9C 4OO1G 4IN3A 3FVQA 1C48A 5D3IB 1HRJA 4C1NI 2EZVA 3P20A 1TS2A 3DEOA 5C4HA 1HQMC 2R6GA 1JE4A 1EZ8A 3M85A 2MUYA 5KGUA 2A68D 4A3KB 3BZDB 3K6OA 2B8GA 4FP5D 1RKNA 1HA5A 1CK1A 1EY6A 2Z4HA 1EYCA 1O80A 1SE4A 5ELDA 1ET9A 4C3JB 1YNJC 2O4XA 5I9PA 1KABA 5CMDA 4KY7A 5FLXE 1QNKA 3EROA 2RVLA 4KHZA 4BA1I 5CR3A 5M5WB 4BA2I 2KEDA 1B53A 1S5DD 2KVMA 2F0OA 2K01A 4KD4A 2K5QA 1AZQA 3T56B 1GXDC 1Q1EA 2I46A 2QCPX 3S15B 1GUOA 5C3XA 1Z6HA 1CA5A 3K5OA 3A54A 1I4XA 1OXSC 4XIGS 5EKIA 2PQEA 3PO3B 5IOCA 1XYIA 1WTQA 5EKKA 3AB9A 3J81L 4WORA 2AUKA 3UI2A 1DXMA 1X3QA 2EYHA 1LTRD 3H3VC 3MHBA 2B2VA 4YIJA 1Z47A 1MSGA 5A35A 4A3MB 2F0FA 1I6HB 2SOBA 3A8JE 4KY6A 1KAAA 1DD2A 2BOSA 2LY7A 1RDPD 1D1IA 3NWSA 1I4RA 3M7GA 4UDUC 4FO2A 3QIAA 2VUMB 4WJWA 4ZK9B 3EJIA 4K2KA 4ZAIA 1Y69U 2MGSA 3MA2B 2AWOA 3MFYA 4IUVA 2NTTA 3QJYA 5C5LA 2XRSD 1ML0D 3D8GA 4IUQA 2N88A 2EYMA 1RD9D 1F9PA 1LLRD 5K36G 3PMFA 2ZXOA 4XT1B 2WKCA 2N55A 4ZKCB 4DXFA 3QO2A 2EYOA 5LL6S 1O7ZA 4O1NA 4NP5A 3EVQA 5C44B 2EE1A 3W3AA 2KQ3A 3CHBD 1PZID 3BDOA 2NUCA 4B9WA 1VF7A 3I4LA 3PUXA 2RSOA 2MHVA 5KNCA 2L55A 2A73B 3K58A 1LT5D 2JYOA 2KECA 5DEHA 4DA2A 4HN7A 1QJOA 5E4WC 4B9XA 2Z1CA 2JEBI 1LV9A 3RD4A 3L9AX 3FPUB 2L12A 3C1FA 3M3YB 3IKJA 3PUZA 4FF1A 2A5HA 2B2UC 2OT2A 4G7ZC 1SYGA 2B39A 1LT3D 3CU7A 5FOBB 4R9WA 4P2CB 1TR5A 1B9NA 2FJ2A 3P7JA 2XIWA 2PMZB 4KHVA 4BS9A 5KNBA 3Q0AA 3K7AB 1F2LA 3MXNA 4DU9A 4G7OC 3RZOB 1WD0A 4A3EB 1WTVA 2XWBB 2EPBA 3G7LA 2WKDA 4AYBB 1Q90A 2R7ZB 3OSOA 1LTTD 4QB4A 1XTCD 2SNSA 2Q8TA 5FK9C 2F0SA 4FXKC 2VB3X 1KDBA 1PRTB 2SDFA 4LAAA 1RJTA 1SYDA 5C4XB 2F0GA 3WOFA 4WRDA 3LWEA 1EY9A 5CV6A 5JOBA 1G8ZD 4IUUA 4HSVA 1STNA 1PZKD 4IFDJ 4K2LA 4HMJA 4KN7C 3QOLA 4C56C 1KLUD 1F2ZA 1FGBD 2B63B 5HURA 2ENBA 5IT9L 1TS5A 3MC0B 4FVMA 2B2WC 3GO5A 3PIP3 5D3DA 4RWSC 1KTKA 2XVSA 2KA7A 3HOZB 5EGTA 1EY4A 1IW7D 2TSSA 5FO7B 4DAVA 2AQ3B 2WV6D 5C5MA 2D9UA 1F9SA 1ZEQX 1F77A 1SNCA 1B4OA 3ITPA 1H9RA 1S5FD 1CQFA 3IAYA 1NSNS 3MXPA 3NQTA 4A3BB 3M7NA 5CV9A 4G4KA 3OW7A 3ERQA 3GD7A 4A3GB 2XWJB 3PIO3 1I6VC 3HGBA 3TBIB 3PUVA 2BA0A 3R2TA 2RA4A 1S5CD 2D5DA 1YNNC 5IGGA 3BVGA 2EYFA 1RODA 4XDXA 3S14B 1EYAA 2QILA 3NBIA 4XYQA 4CKCA 1EY0A 4G7HC 5C6AA 1R4PB 2K03A 2EY1A 1E2WA 1I4QA 1S5ED 3S2DB 3P75A 3FDTA 1F9QA 4DFAA 1IL8A 4RHRA 3J7AF 1BCPB 2K1BA 5G3LF 3D4RA 4ZQ3A 5I2XA 2M2LA 1WVLA 5JVG3 1QNUA 1D5XC 5EPKA 4IFDH 4XQNA 3VR2A 1KDAA 2PCFB 3SEBA 3IL8A 2M9VA 4DF7A 1VCIA 4ABNA 2KCNA 4RA8A 1LT4D 3N6RA 4S3SA 3MFGA 4PNYA 3BG3A 1T5EA 4BY1B 4HAEA 1CM9A 3GTQB 3BYTB 4ZLTF 3I3CA 1O78A 1RCVD 2WP8J 3SK4A 1DJRD 1H9SA 1H9JA 1Q3LA 1XWEA 4PMCA 4XTCS 2IX3A 1A2TA 4K6DA 4FXDA 1K8MA 1A3VA 1S5BD 2B2YA 3M4OB 3TSSA 1STGA 4GZYC 2B2YC 1DONA 1WTRA 5JEAJ 4KJOA 3QWNA 4EVOA 1CHQD 1BOSA 1YNJD 2L11A 3K59A 3S17B 1DOLA 2A6ED 2Z4IA 1STAA 4OL7A 3BS1A 4ZUIA 1G291 2F3WA 4HCEA 4HR7B 2G9HD 1NUCA 2L0CA 1PTOF 3A55A 2XN9C 5TSSA 1A6XA 1TKWB 3V05A 3TZUA 1CA6A 1ET6A 3TP6A 3URYA 5M3MB 1ONLA 3CKIB 1EEID 3E5SA 2IPKD 1Z7TA 2E2DC 1NR4A 3T13A 2QF7A 3SE0A 1HFGA 2CVRA 1T5XD 1LTBD 1Y8NB 1TS4A 3A7AB 4CJ0B 3RLFA 1PFMA 3FMCA 1H9MA 2B8FA 4C2MB 3NK9A 1F2MA 4HSPA 5KIXA 1OO9B 2CHBD 2NN6G 3ND8A 1BF4A 5EJWA 3T53B 1GHKA 3Q24A 1F9RA 4A3JB 2F0KA 1CZGA 3MVVA 1LTSD 1RTNA 2QEJC 5E4XA 4JK1C 3LWUA 3J80E 3GV3A 1IYUA 1QILA 1PTOB 3NQIA 4DAPA 3MZ5A 3BDCA 2C5CA 5FO8B 1BUVT 5M3FB 4DXGA 2K32A 2E2HB 2NZ1D 3OWFA 2A6EC 2K33A 3E6ZX 3DWQA 2SNMA 1FYCA 5IODA 3S9WA 4QCLA 2ZXPA 1LTAD 2BDOA 3FRPB 2MJ8A 4OIJA 1EOTA 3Q23A 5JEAH 5C0XJ 1DYQA 1XX8A 3GTKB 3K5LA 2QKIC 3EFXD 3KLSA 2EOTA 5M5XB 4OGQC 1TWCB 3K0YA 4K5WA 4L6TB 1TS3A 5F2DA 2ICIA 5C4JB 3N52A 1C8CA 2X69A 1KLGD 3K5MA 4IFDI 1HUMA 2F0WA 3CQZB 4RCOA 5J1ZA 3VR4A 2F0PA 1G91A 4I65A 2LFNA 2NWGA 2HUGA 3MXUA 4UAIA 1A3TA 3TP5A 2XNAC 1SYFA 1SJHD 5EPJA 3R2IA 4RGNA 5LHY1 3D4WA 1AEXA 3HZXA 3D31A 1LTGD 1W6JA 2K04A 2ZXRA 1Q8IA 1V8QA 1D5MC 3PV0A 1EEFD 2IWHA 1PMRA 5I9OA 3VR3A 4B08A 2XRQD 3U9SA 2L9HA 2CW0C 1Y1VB 1QB5D 1STHA 4BY7B 5CC4A 3H09A 3JAML 1PXUA 1ZKOA 1HTPA 2EYLA 1JICA 3GTGB 2EY6A 4OO1I 4KKTA 2QDBA 1V1PB 2TMPA 4MN3A 2BE5D 4CGYB 3MTSA 3I72A 5C0XH 3NPPA 4ZYSA 2EJGC 3A8KE 3SK8A 5I4DA 1D2BA 1FNWA 1ESFA 3BVMA 1NAPA 2JA6B 2NVQB 4K5VA 2LS01 4F87A 5A2QE 1PRTF 2IJ0A 2E76C 5C3EB 1K8OA 3F2UA 4K5XA 4LJZC 1SXTA 2B2UA 1WTXA 5CV5A 2PZUA 2EYJA 3X3NA 3QOJA 1BCPC 4DAYA 2F0MA 2V4DA 1TWHB 3HOYB 3VR6A 1IKLA 4K8JA 1MSHA 2FMCA 2DY8A 2F0JA 1RF2D 1BBXC 1BNZA 1WD1A 2NTSA 2L4NA 1B50A 2KHSA 2BA1A 2X6GA 5FLXL 4EGVA 4Q5VA 2E2JB 1EIGA 1TQOA 2JP1A 4QIWB 3I70A 2FMMA 4F8MA 5M9OA 3SDZA 3SXHA 3E0JA 3FEWX 1O7LA 4RAUC 2HCCA 4H0LC 1WTPA 1SEBD 1YNND 2EVBA 2MPMA 2BE5C 2RDGA 2DNCA 1KDCA 3VYTA 1Y8PB 1Y8OB 1PYWD 2A69C 2BDNA 4OIKA 3TN2A 3SHLA 1I4GA 5J22A 2PNRC 4BWGB 2F3VA 3NXWA 1TY0A 2LMCB 2FHTA 1MGSA 4IUNA 4BBSB 1B2TA 1ZXTA 4F88A 1AZPA 2J7ZA 2B2WA 4N9PA 2F0NA 4HEDA 3T51B 2R61A 3RZDB 2DN8A 1MBYA 2HQEA 3BDLA 3FPPA 1QE6A 1STEA 3D3RA 1I3QB 1TU2B 3DXJC 1L0XB 3IFTA 3NE5B 1BCPF 3OIQA 2L1BA 1AP0A 5COYA 3S1QB 3VA5A 3NHHA 2Z8LA 3DWAA 4M1UB 3EQLC 4IALA 1DZ1A 3T4AC 4J1MA 1BXTA 3RMHA 1GOZA 3C2PA 3I73A 3V2TA 3HP3A 4ZUJA 1IYVA 4V0BA 1FD7D 2KJXA 2NBFA 4Q0FA 4U68A 4IQZA 2R3ZA 1QG7A 1J9OA 1TIID 2O5IC 4C1NK 1HFNA 3KBXA 4KV6A 5CBAE 3NSWA 3G6JB 1HA6A 5EPLA 1LO5D 3C1EA 5CORA 5CBEE 3A8IE 1Q12A 1PFNA 3I4NB 4XXEA 2YU9B 4EQPA 1FNVA 3H94A 2XSCA 2G9DA 1PTOC 2PO4A 5C0XI 4RH6A 4ZRZA 3VR5A 3H6MA 1JQYD 1JWUD 1VMCA 1SBBB 4DN4M 1D6EC 4N9TA 1EY5A 4FXGC 4ULLA 1SYBA 1CZWA 3GTMB 4DNTB 5I6YA 1IKMA 1SJED 1SYEA 2B2TC 5LL6X 4TSSA 1TT2A 4TKOB 1D1KA 5CYUA 2PPBC 4KKUA 2NVTB 2VXWA 3MEHA 2J0TD 3ND9A 3QG1A 1U4MA 3GQBA 4XQJA 4FF3A 2EJMA 4K6LA 3J81E 2Q8IB 1WTOA 4KN4C 1QOHA 1PZJD 1BDOA 5JPNC 1B3AA 1KNEA 4F7XA 1UAPA 1MD2D 2F0LA 1GUTA 3OWEB 4RHSA 3HOUB 1H9KA 1JC7A 3OPOA 1SDFA 4KY5A 2HDLA 4FNFA 2JE6I 1GUSA 3KLSX 5IGFA 2K6AA 2AWNA 3OOCA 3MXGA 5T1IA 2DNEA 1TVXA 2NYZD 3FKIB 3NBHA 4RGOS 3OMCA 3EA6A 1G2TA 4CKBA 4OO1H 3SK6A 1EY8A 2NN6H 5DAUA 3DWPA 4NMZA 5IGEA 3X3MA 1CTMA 1ICWA 2EYPA 1DCZA 1EL0A 1CQVA 3V96A 1EYDA 2I07B 1AFPA 3D4DA 2EY5A 3TDQA 2GA4B 1HPCA 5KRUA 3C3LA 1HXYD 2F0QA 2DY7A 1Y1WB 4M8AA 1R4QB 4FF2A 4ILWA 3U9OA 5FO9B 3HOWB 3TP7A 1SMYC 4PV1C 1HHVA 4A3FB 4TRDA 1MI2A 2JEAI 1PRTD 1JCKB 1S4ZA 4RCNA 2WIIB 3S1RB 1X3PA 1XXGA 4CKEA 1SAPA 3GV6A 4KTAA 1ESRA 5J39A 2JA7B 2PYKA 4R8NA 1GHJA 4KJNA 1R9TB 1PLFA 3TMEA 2A6HC 4HTHA 3WOEA 1EWCA 2JXMB 3KBGA 4X3TA 4CJ2C 5ELBA 2YYZA 5KYLA 2F1MA 1W6KA 2RQXA 2F4IA 3T16A 1SNQA 2O2LD 1SFOB 3CRLC 4DNRB 3HEJA 1HUNA 2CW0D 3HKZB 1SE3A 3DMUA 4DK1A 5IGDA 1DOKA 2PZWA 3OMGA 2K7VA 2JA8B 2OEOA 5JPMC 3P1HA 3MAQA 2WINB 4A93B 3GTOB 5HGTA 2IL8A 4R8IA 4QUFA 2K5DA 3GTPB 1V43A 4IUTA 2O5JC 4FF4A 2PW5A 4PMBA 2K05A 3BYYB 4KI0A 1U4PA 3PO2B 1EWHA 3OHXC 1RHPA 4KD3A 3J7YW 1PRTC 3MWYW 2VB2X 1LABA 4CBVA 5K36H 4FYDA 1ZYRC 3NP8A 1KNAA 2Y0SB 1H9SB 3I4MB 2F0VA 1ILPA 1A15A 5JEAG 2F0UA 4L8JA 5IT9E 1F2YA 1GUGA 2RDHA 4C3IG 2B2VC 2IW3A 1BCPD 5E3FA 1ENCA 3K57A 3WDNA 1CHPD 5M5YB 4QUCA 1TWAB 2WACA 1CI3M 1BR9A 4XT3B 4U673 5ELFA 2A68C 3HOXB 2AUJD 3O13A 1OXXK 3OIPA 2R92B 1I50B 1L0YB 2WB1B 3VYRA 1SSOA 2K5WA 3SK5A 4ME5A 1EU3A 1J8IA 3AU7A 1TWGB 3NTIA 1A3UA 4IUPA 3C46A 2NN6I 5FKAC 2J4XA 4RGTA 3IFDA 1Q1BA 2A69D 1NCVA 2JSOA 1RTOA 3ONAB 3NUCA 1WTWA 4G57A 1E0BA 1VF5C 1I4HA 3HS0C 2IX1A 5G3LD 3DHQA 5BN4A 4KMUC 2BCOA 3D6WA 1B1ZA 3I90A 3KF8A 4TQUS 4A3IB 1JR0D 3ZYYX 1SNMA 2EJFC 5D14A 4CJ1B 5DM63 5DM73 4NDXA 1B9MA 3J80L 2F0IA 2IX0A 2AQ1B 3HOVB 3RUZA 1I4PA 2WAQB 4MHEA 4C3HG 2RSNA 4MIUA 1GJXA 1SYCA 1OXTA 5E1FA 1BQQT 3H91A 5C3WA 1LTID 5C0XG 1PDQA 2VNUD 1ENAA 1JOQA 2F0DA 5IIFA 3M4YA 5JVH3 4H44C 4KK7A 4LMQD 3J7AV 1E2VA 2F0HA 1V1OA 4ID6A 4H13C 1UUPA 5C4ZA 5BN3A 5KEEA 4C3IB 2EXZA 1UNSA 3LX0A 1HCZA 2C9OA 1SNDA 1CFMA 3NWTA 2RKSA 5T1GA 1EZ6A 2AQ2B 3GTLB 1STBA 3NTKA 1PTOD 3DUZA 2NVXB 4EQOA 3CRKC 5EKLA 4K8IA 4JBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3R A;  3VYU A;  2Z1C A;  3VYR A;  2OT2 A;  3VYT A;  3VYS A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  3NTH A;  3IRB A;  4P75 A;  3ULL A;  5M3M H;  1K3B C;  4I7Z C;  4RMF A;  2ASB A;  5AFW A;  5DNF A;  3TZD A;  1UE1 A;  1ILQ A;  4JI3 Q;  4A3D B;  1WCM B;  2VZA A;  1B44 D;  4WFN 3;  2A1A A;  1X32 A;  1X65 A;  2VY3 A;  4DAM A;  1Y1W H;  3S1N B;  3BU2 A;  4JYA L;  2EQS A;  1VDZ A;  2KOL A;  1SE2 A;  5BN5 A;  1X54 A;  2SEB D;  3VYS A;  4HIM A;  1N34 Q;  4K0K Q;  1GUW A;  4LF6 Q;  3AMU A;  3VA7 A;  4L63 B;  5BR8 L;  1AW7 A;  3J80 c;  1YJN A;  3FP9 A;  1SMX A;  2YV5 A;  1JOO A;  1II3 A;  2MQH A;  1JWS D;  4C2M H;  1HZB A;  4UP9 A;  1E2Z A;  3HG9 A;  4KKS A;  5NUC A;  1EIH A;  3J81 j;  1V1Q A;  3CC4 A;  3SVM A;  1D8L A;  3AYH B;  3ULP A;  4DR7 Q;  2JJQ A;  4RFB A;  4DK0 A;  5CGK A;  4HIO A;  1EU4 A;  1A2U A;  1GUN A;  4BBR B;  2CQA A;  4DR6 L;  4RKL A;  4A3J H;  1PH6 A;  3S16 B;  2EDG A;  4ZKB B;  4GOP B;  3KJP A;  2HCI A;  2LKV A;  2PZT A;  2MP1 A;  3A56 A;  5EBC A;  3LNN A;  4LUZ A;  5IP9 G;  3KUP A;  4NKL A;  1M8A A;  1JOR A;  1UEA B;  2FIN B;  3A7L A;  1R9T H;  4QMG A;  3CCS A;  1PTO H;  1BO0 A;  2I5L X;  1KD1 C;  4DR3 Q;  1GM5 A;  1EQQ A;  4DGZ A;  5M3F H;  4K14 A;  4X3S A;  3CCQ A;  2FXQ A;  1G2S A;  2E2H H;  2JA5 B;  5ELE A;  4QQB X;  4JI5 Q;  4J6H A;  1QWY A;  1A8V A;  4HJ9 A;  4CHT B;  2ICE C;  2OF1 A;  2H4O A;  2R93 B;  2ID0 A;  4OWX B;  1ENF A;  1AN8 A;  4C3H B;  4LK1 C;  3CCE A;  2YTY A;  2H1E A;  2OXP A;  3H0G B;  4A3L G;  1O7Y A;  4BXX G;  1Q86 C;  3Q6S A;  3L7Z C;  4XQQ A;  1IL2 A;  4OWW B;  4XYO A;  1U4R A;  1JOK A;  2KEE A;  3DEP A;  5IWA Q;  4EQN A;  3HRZ C;  5M5X H;  5A2Q L;  1G6Z A;  3R3O A;  3S1M B;  1TWC H;  2B2T A;  5CV4 A;  4JI0 Q;  1M4V A;  3GTJ B;  1N32 Q;  1FNU A;  2NB0 A;  4DUZ L;  1KQS A;  3K80 C;  3OYY A;  2ZJQ A;  2E74 C;  2MFI A;  4OWT B;  4UY8 C;  3I56 A;  4UP8 A;  3CPF A;  4JV5 L;  4E6I A;  3L3O C;  2F03 A;  4A3K G;  3PIO A;  1HJP A;  4DUY Q;  4DAY B;  3CQZ H;  1XMO Q;  5IT9 c;  1SMY D;  2IT1 A;  1N36 L;  3GTP H;  4H7B A;  1JB3 A;  1DM0 B;  5JJZ A;  1KRT A;  2F0T A;  3SR1 A;  4C3J G;  4X65 L;  1JWM D;  2KCC A;  1SNO A;  3GP7 A;  1QUQ B;  3NEM A;  1BBW A;  1IW7 C;  1L1O B;  4DV5 L;  2QDL A;  4JI8 Q;  1E7Z A;  3TP8 A;  4N8X 1;  3UE1 A;  3D6C A;  5CV8 A;  4JI1 Q;  3KLW A;  4A76 A;  1LYL A;  2D62 A;  4P74 A;  3R8B A;  3VYU A;  2RDF A;  1IHZ A;  4IPH A;  2UUB Q;  2HDM A;  3W2D A;  3R93 A;  5ISR A;  1LAC A;  3DM1 A;  5CV7 A;  5IGC A;  2A6H D;  1EY7 A;  4O42 A;  4GKJ L;  2RBM A;  5JJI A;  3PUW A;  1HTL D;  4HMI A;  1K83 B;  4RGM A;  4V19 0;  5JAV A;  5K5P A;  4HIK A;  3KLR A;  4IFD G;  1ASZ A;  4HJ7 A;  2M00 A;  1YEZ A;  1NMF A;  4PQX A;  3CCR A;  5LMU L;  2I5M X;  4J8Q A;  4L5T A;  3PO3 G;  2UUA Q;  4IJH A;  3RNU A;  1IBL Q;  1C4Q A;  4HJ8 A;  2E2I B;  1PFB A;  4RKB A;  3BVZ A;  3EBE A;  3S2H B;  3EIV A;  1HQR D;  3F8T A;  4X62 L;  2X6L A;  1SE8 A;  1Y1V H;  4HCS A;  1OXV A;  2Q8R E;  1B7Y B;  1CT1 D;  2A74 C;  3I8Z A;  1VQD A;  2B3G A;  5KND A;  2EY2 A;  5GAH C;  2KUM A;  4X3K A;  1JJ2 A;  2HHH L;  1VMP A;  3K5N A;  1Y14 B;  2NVY B;  2L5T A;  3Q22 A;  4A3M G;  2Z6B A;  3KK7 A;  1U4L A;  3JAM E;  4NW2 A;  4PMW A;  1SNP A;  3CCU A;  5LMN Q;  1QCB D;  3OW2 A;  2E75 C;  5EBD A;  4X64 Q;  4IUR A;  5ELN A;  1LT6 D;  1TWF B;  4GKK L;  5KYI A;  1EOV A;  1OXU A;  1EFI D;  2OQ0 A;  2VUM G;  4IZ8 A;  2F0E A;  2K28 A;  5D65 A;  4X3U A;  3PUY A;  3I91 A;  1D5Z C;  1V1P A;  1EQT A;  2D2C C;  2OTJ A;  5EQ0 A;  4DV6 Q;  3CF5 A;  3TS2 A;  2JA6 H;  1FR3 A;  1EQV A;  1TY2 A;  2NVQ H;  1CKN B;  1NR2 A;  2FFK B;  5ELC A;  5IGB A;  5I6W A;  4TVA B;  4LUO A;  2VQF Q;  4ODG A;  1ZYR D;  1U9R A;  3F2C A;  4Y7N B;  3QB3 A;  1STY A;  5C3E H;  5I2Y A;  1DOM A;  2PW7 A;  1XMQ L;  4QF4 A;  4Z9C B;  2ZT9 C;  2OWO A;  2N78 A;  3PSI A;  4OO1 G;  4IN3 A;  3FVQ A;  1C48 A;  5D3I B;  1HRJ A;  4C1N I;  4IPC A;  2EZV A;  1MKH A;  1X3G A;  2UU9 L;  3P20 A;  1TS2 A;  3DEO A;  4MTK A;  1PA6 A;  4YWM A;  5C4H A;  4QIW E;  1HQM C;  2R6G A;  1YI2 A;  1JE4 A;  1EZ8 A;  3M85 A;  1TWH H;  3HOY H;  2MUY A;  1HNX Q;  5DLQ E;  5KGU A;  2A68 D;  4JOI C;  4A3K B;  3BZD B;  2D0P A;  4P73 A;  3K6O A;  2B8G A;  4FP5 D;  1C7Y A;  1RKN A;  1HA5 A;  1CK1 A;  1EY6 A;  2Z4H A;  3K8A A;  1EYC A;  4LW1 A;  4NXM Q;  1O80 A;  1SE4 A;  5ELD A;  1ET9 A;  4C3J B;  2E2J H;  1HNW Q;  5IYD H;  1YNJ C;  2O4X A;  1WOC A;  2CWP A;  1KIX A;  3A0J A;  5I9P A;  1KC8 C;  1KAB A;  5CMD A;  5GRO A;  4DV7 Q;  4LFB Q;  4KY7 A;  5FLX E;  1QNK A;  3ERO A;  2KHI A;  2H5X A;  4EQ5 A;  2RVL A;  4KHZ A;  4BA1 I;  5CR3 A;  5M5W B;  1M1K C;  3JAM i;  4BA2 I;  2KED A;  1B53 A;  2UXB Q;  4WJ4 A;  1S5D D;  2KVM A;  2F0O A;  2K01 A;  4KD4 A;  2K5Q A;  1PVO A;  1AZQ A;  4DV1 L;  1VQH A;  3T56 B;  1GXD C;  1LM0 A;  1Q1E A;  3J7Z C;  3GTL H;  2I46 A;  2QCP X;  3S15 B;  3H3V H;  1GUO A;  5C3X A;  1UE7 A;  2CFM A;  1Z6H A;  4HJA A;  1CA5 A;  5L37 A;  5JJK A;  3K5O A;  2UUC L;  3A54 A;  3CCJ A;  4BBS H;  1I4X A;  1OXS C;  4XIG S;  5EKI A;  2PQE A;  3PO3 B;  5IOC A;  1MJE A;  3KF6 A;  3A5U A;  1XYI A;  1A0I A;  2NZH A;  1WTQ A;  5EKK A;  3AB9 A;  3J81 L;  4WOR A;  3RZD H;  2AUK A;  3UI2 A;  1DXM A;  1X3Q A;  2EYH A;  1LTR D;  3H3V C;  3MHB A;  3ULJ A;  4B3T L;  2B2V A;  4YIJ A;  4L5Q A;  1Z47 A;  1MSG A;  4RG1 A;  1I3Q H;  1VQI A;  1FJG Q;  4A3E G;  2OTL A;  5A35 A;  4A3M B;  1YHQ A;  2F0F A;  4OEL B;  1I6H B;  4AYB G;  2R7Z G;  3S1Q H;  2SOB A;  3A8J E;  2Q2U A;  4KY6 A;  1D7Q A;  1KAA A;  4YHH L;  2ALY B;  2BOS A;  1CKM A;  1DD2 A;  2LY7 A;  4ME3 A;  1RDP D;  3WWV A;  1D1I A;  3NWS A;  1I4R A;  3M7G A;  1EWI A;  4UDU C;  4FO2 A;  4DV0 Q;  5C4X G;  3QIA A;  2VUM B;  4WJW A;  3NBH B;  1E3P A;  3F1Z A;  4ZK9 B;  4X66 Q;  3EJI A;  4POF A;  4K2K A;  4ZAI A;  1N33 L;  1W2B A;  1Y69 U;  2MGS A;  3MA2 B;  2ZM6 L;  2AWO A;  3MFY A;  1K3R A;  4IUV A;  2NTT A;  3QJY A;  4DV2 L;  5C5L A;  2XRS D;  1ML0 D;  3D8G A;  4IUQ A;  2B63 G;  2N88 A;  2EYM A;  1RD9 D;  1F9P A;  1LLR D;  1BBU A;  2KEN A;  5K36 G;  3PMF A;  2ZXO A;  4JYA Q;  1VQA A;  4XT1 B;  2MNA A;  2WKC A;  2N55 A;  4GOP C;  4PZ7 A;  4ZKC B;  3HOZ G;  5BR8 Q;  4DXF A;  1IBM L;  3QO2 A;  1NBW A;  2EYO A;  4UP7 A;  5LL6 S;  3I4N H;  1VQ5 A;  2YU9 H;  1O7Z A;  3UE0 A;  1IZ6 A;  5IYB H;  3H0G H;  4O1N A;  2CH4 A;  1VS0 A;  4NP5 A;  4DR6 Q;  1HNZ L;  3EVQ A;  5C44 B;  1S3O A;  2EE1 A;  3CCV A;  2R7F A;  3W3A A;  2KQ3 A;  1TXY A;  3UDG A;  3GTM H;  3CHB D;  4PG3 A;  4LWC A;  1SRU A;  1PH2 A;  1PZI D;  3BDO A;  2NUC A;  4B9W A;  3GTJ H;  1VF7 A;  4ALP A;  3I4L A;  4A3G G;  3PUX A;  2RSO A;  2MHV A;  5KNC A;  1UEB A;  1K9M C;  2ZTE A;  2L55 A;  1Z9F A;  2A73 B;  1L2F A;  3K58 A;  1LT5 D;  2JYO A;  2KEC A;  2BH2 A;  5DEH A;  4DA2 A;  4HN7 A;  1QJO A;  5E4W C;  4B9X A;  2Z1C A;  2NVT H;  2JEB I;  1LV9 A;  1VQE A;  3RD4 A;  3L9A X;  3FPU B;  2L12 A;  4GLX A;  3Q8D A;  3C1F A;  3M3Y B;  3IKJ A;  3PUZ A;  4FF1 A;  2A5H A;  2WFW A;  2B2U C;  2OT2 A;  4G7Z C;  1SYG A;  2B39 A;  1LT3 D;  3CU7 A;  5FOB B;  1E24 A;  4JW0 A;  4R9W A;  4P2C B;  1TR5 A;  1B9N A;  2FJ2 A;  3P7J A;  2XIW A;  2PMZ B;  4DV3 L;  4CDD C;  4KHV A;  4BS9 A;  5KNB A;  3CCL A;  2RCF A;  1QZG A;  3Q0A A;  3TRE A;  4DUZ Q;  3HOU H;  1RL2 A;  3K7A B;  2LXJ A;  4DKA C;  3B6Y A;  2N3S A;  3UDI A;  1F2L A;  1K83 H;  1L1O C;  4JV5 Q;  3MXN A;  4DU9 A;  1UE5 A;  4G7O C;  1ICF B;  4GNX B;  3RZO B;  1WD0 A;  4A3E B;  1WTV A;  3PF4 A;  2I5H A;  2XWB B;  2EPB A;  3G7L A;  2WKD A;  4AYB B;  1Q90 A;  3FKI H;  2R7Z B;  3OSO A;  1LTT D;  4X65 Q;  2RF4 A;  4QB4 A;  1XTC D;  2SNS A;  2Q8T A;  5FK9 C;  2F0S A;  4FXK C;  2VB3 X;  3TEH B;  3HKS A;  4DV5 Q;  2F4V Q;  1KDB A;  1PRT B;  2SDF A;  1CUK A;  4LFC L;  4LAA A;  1RJT A;  5AJ3 Q;  1SYD A;  5C4X B;  2F0G A;  5IP7 H;  3WOF A;  4WRD A;  4BY1 G;  2IY5 B;  3LWE A;  3KF6 B;  3H3V I;  1EY9 A;  5CV6 A;  1I94 Q;  5JOB A;  1G8Z D;  1RIP A;  4IUU A;  4HSV A;  1STN A;  1PZK D;  1M90 C;  4IFD J;  4K2L A;  4HMJ A;  4KN7 C;  3QOL A;  1VQM A;  4C56 C;  1KLU D;  2KCT A;  1F2Z A;  1FGB D;  2B63 B;  5HUR A;  2ENB A;  5IT9 L;  4N8F A;  1TS5 A;  1Q7Y C;  2C35 B;  3MC0 B;  3HOW H;  4FVM A;  2B2W C;  3GO5 A;  3PIP 3;  4A75 A;  4LNQ A;  5D3D A;  4RWS C;  1KTK A;  4LUV A;  2XVS A;  2KA7 A;  4A3F H;  4APV A;  3I4O A;  3HOZ B;  4MZ9 A;  5EGT A;  1EY4 A;  1IW7 D;  2TSS A;  5FO7 B;  4DAV A;  2AQ3 B;  2WV6 D;  1XNQ Q;  4X62 Q;  5C5M A;  4FDB A;  4JI4 L;  1OTC A;  1YHA A;  2D9U A;  3S1R H;  1F9S A;  4PZ8 A;  3L0O A;  1ZEQ X;  4I7A A;  1F77 A;  1SNC A;  1B4O A;  3ITP A;  2HHH Q;  1H9R A;  4BXX H;  1HZ9 A;  2JA7 H;  1S5F D;  1CQF A;  3K0X A;  3G71 A;  3IAY A;  1NSN S;  3MXP A;  1DGS A;  5M3M G;  3NQT A;  3E0E A;  4A3B B;  1G6P A;  2PI2 E;  5CV9 A;  3M7N A;  4G4K A;  3OW7 A;  3ERQ A;  3HKZ E;  3GD7 A;  3I7F A;  4A3G B;  2XWJ B;  4JG2 A;  4OX9 Q;  4JBM A;  3PIO 3;  1IBK Q;  1I6V C;  1SN8 A;  3HGB A;  3TBI B;  3PIP A;  4DR1 L;  3PUV A;  4LF8 L;  1AE2 A;  2BA0 A;  3R2T A;  4DR5 L;  1VQJ A;  2RA4 A;  1S5C D;  1SFO H;  2D5D A;  2UXC Q;  3K7U C;  1YNN C;  5IGG A;  3BVG A;  2EYF A;  1ROD A;  1SLJ A;  4XDX A;  1MHW C;  3S14 B;  1J6Q A;  1A62 A;  4QJF A;  1EYA A;  2QIL A;  3NBI A;  4XYQ A;  4CKC A;  1EY0 A;  4G7H C;  5C6A A;  1R4P B;  2K5N A;  2K03 A;  2EY1 A;  1E2W A;  1I4Q A;  1HZA A;  1S5E D;  3KDF A;  3S2D B;  3KF8 B;  2EIF A;  3P75 A;  2JA8 H;  4A3J G;  3FDT A;  1F9Q A;  5M5W H;  4GLA C;  4DFA A;  2PI2 A;  1IL8 A;  2VW9 A;  4RHR A;  3J7A F;  1BCP B;  4A93 H;  1J5E L;  3GTO H;  1KL9 A;  2K1B A;  1LTL A;  5G3L F;  2Y0S E;  3D4R A;  4ZQ3 A;  4B3R L;  5I2X A;  1PYS B;  2M2L A;  3CPW A;  1WVL A;  5JVG 3;  1QNU A;  1D5X C;  5EPK A;  5M3F G;  4IFD H;  4XQN A;  3PO2 H;  1IXR A;  3VR2 A;  1A63 A;  5HY6 A;  1KDA A;  2PCF B;  3SEB A;  3PO3 H;  3IL8 A;  5FLM H;  2M9V A;  4DF7 A;  1VCI A;  4ABN A;  2E5L L;  2KCN A;  4RA8 A;  1LT4 D;  1EUJ A;  2BH8 A;  3N6R A;  4S3S A;  3I4M H;  3MFG A;  4PNY A;  3BG3 A;  3CC2 A;  3CAM A;  4KHP L;  3M4Q A;  1T5E A;  4BY1 B;  3CCM A;  4HAE A;  1CM9 A;  3GTQ B;  3BYT B;  4ZLT F;  3I3C A;  2WB1 E;  1HH2 P;  1O78 A;  4A3M H;  1RCV D;  2WP8 J;  2VQE L;  3SK4 A;  4JI2 L;  1DJR D;  1H9S A;  1H9J A;  4DV1 Q;  1Q3L A;  1XWE A;  4NPS A;  4PMC A;  4XTC S;  5M5Y H;  2IX3 A;  1A2T A;  4AQY L;  4K6D A;  4H02 A;  1TWA H;  4FXD A;  1K8M A;  1PH9 A;  1Q81 C;  1A3V A;  1S5B D;  3DLL A;  2B2Y A;  3G48 A;  3M4O B;  3HOX H;  2RCN A;  3TSS A;  1STG A;  4GZY C;  2UUC Q;  2B2Y C;  1DON A;  2R92 H;  2UXD L;  4O2D A;  1I50 H;  1WTR A;  3PGZ A;  1XNR Q;  5JEA J;  4KJO A;  3CMA A;  3QWN A;  4EVO A;  2XGT A;  4A3C G;  1CHQ D;  1BOS A;  1YNJ D;  2L11 A;  4CDC C;  1IYJ B;  3K59 A;  3CC7 A;  3S17 B;  1DOL A;  1AH9 A;  2A6E D;  2HQL A;  1N34 L;  4LF6 L;  2Z4I A;  5IYC H;  2CCZ A;  1STA A;  2L15 A;  4OL7 A;  3BS1 A;  4ZUI A;  1G29 1;  1TWG H;  3RN5 A;  2F3W A;  2Z6K C;  4HCE A;  4HR7 B;  2G9H D;  1NUC A;  2L0C A;  1JB7 A;  1PTO F;  5GQO A;  3A55 A;  2XN9 C;  5TSS A;  1A6X A;  1TKW B;  1FL0 A;  1JJC B;  3V05 A;  3TZU A;  1CA6 A;  1ET6 A;  3TP6 A;  3URY A;  5M3M B;  1ONL A;  1VQC A;  3CKI B;  4YHH Q;  3T1H Q;  1EEI D;  1YZ6 A;  4X6A H;  3E5S A;  2IPK D;  1Z7T A;  5IE8 A;  1HZC A;  2E2D C;  1NR4 A;  3T13 A;  2QF7 A;  3SE0 A;  1HFG A;  1T9H A;  4DR4 Q;  2CVR A;  2PQA A;  1T5X D;  1LTB D;  1Y8N B;  4R4Q A;  2WAQ E;  1N33 Q;  1TS4 A;  3A7A B;  4CJ0 B;  3RLF A;  1PFM A;  2ZM6 Q;  4R4O A;  3FMC A;  1K8A C;  4DV2 Q;  1H9M A;  2B8F A;  4C2M B;  1YIJ A;  3NK9 A;  4A3I H;  1BVS A;  1F2M A;  4HSP A;  2F3I A;  2A8V A;  5KIX A;  1OO9 B;  1Y1V G;  2CHB D;  2NN6 G;  3ND8 A;  4BY7 G;  1BF4 A;  2A19 A;  2R7D A;  1X9N A;  3KOJ A;  5EJW A;  3T53 B;  1GHK A;  3Q24 A;  1F9R A;  4A3J B;  3HOV H;  2F0K A;  1CZG A;  4IPD A;  3MVV A;  1IBM Q;  4OON A;  2RHS B;  1LTS D;  1RTN A;  4JOI A;  3G6E A;  2QEJ C;  5E4X A;  4JK1 C;  3LWU A;  3J80 E;  3GV3 A;  1IYU A;  5C44 G;  4LF5 L;  1QIL A;  1PTO B;  3NQI A;  4DAP A;  4NXN L;  3MZ5 A;  3BDC A;  1HNZ Q;  2C5C A;  5FO8 B;  1NTG A;  1BUV T;  1KAW A;  4JI6 L;  5M3F B;  4DXG A;  4LFA L;  2K32 A;  1B70 B;  1U5K A;  1XPU A;  1C0A A;  2E2H B;  2NZ1 D;  3OWF A;  2A6E C;  2K33 A;  3E6Z X;  1N8R C;  3DM3 A;  3BZK A;  3A5Z B;  3DWQ A;  2JA6 G;  3HFZ B;  2SNM A;  1FYC A;  5IOD A;  3S9W A;  4QCL A;  2ZXP A;  3K7A H;  3BZC A;  3QR8 A;  1LTA D;  1S40 A;  2BDO A;  2JQO A;  3FRP B;  3H15 A;  2MJ8 A;  4OIJ A;  5C3E G;  1EOT A;  3Q23 A;  5JEA H;  4DK6 C;  5C0X J;  1DYQ A;  4C3I H;  5FJ8 H;  1XX8 A;  2Z0S A;  4B3M Q;  3GTK B;  4LF7 L;  2KBN A;  3K5L A;  1N9W A;  2QKI C;  1E22 A;  3CXC A;  3EFX D;  3KLS A;  2EOT A;  5M5X B;  4OGQ C;  1TWC B;  4WJ3 M;  3K0Y A;  2NVX H;  4K5W A;  4JI7 Q;  4L6T B;  2MO0 A;  1CSQ A;  1TS3 A;  3HOY G;  1CSP A;  3RN2 A;  5F2D A;  4A3B H;  1MJC A;  4R4T A;  3S24 A;  3T1Y L;  5C4X H;  2ICI A;  4GNX C;  5C4J B;  3N52 A;  1C8C A;  2X69 A;  1KLG D;  3K5M A;  4IFD I;  1HUM A;  2F0W A;  3CQZ B;  4RCO A;  5J1Z A;  4A3D H;  1WCM H;  3VR4 A;  2F0P A;  5IYD G;  1G91 A;  3PCO B;  1K28 A;  3S1N H;  2ZTD A;  4I65 A;  4YCW A;  1E1T A;  2Q2H A;  2LFN A;  2NWG A;  2HUG A;  1WYD A;  4UPA A;  3MXU A;  1HR0 L;  1XPO A;  2K5V A;  1JE5 A;  4UAI A;  1VQ7 A;  1A3T A;  1X3F A;  1PH8 A;  2ES2 A;  3STB C;  3TP5 A;  2XNA C;  1SYF A;  3J80 i;  1SJH D;  5EPJ A;  1VQ4 A;  2K5H A;  3R2I A;  1EYG A;  5LMN L;  4LFC Q;  4RGN A;  4BBR H;  5LHY 1;  3D4W A;  1AEX A;  3HZX A;  2IHF A;  3S16 H;  3D31 A;  1UE6 A;  1LTG D;  1W6J A;  1B8A A;  4O0A A;  3JC6 6;  2K04 A;  2ZXR A;  1Q8I A;  1V8Q A;  1D5M C;  3PV0 A;  1EEF D;  4BBS G;  2IWH A;  1PMR A;  5I9O A;  3VR3 A;  4B08 A;  2XRQ D;  3U9S A;  3TRZ A;  4GOP A;  2L9H A;  2CW0 C;  2JA5 H;  1Y1V B;  1QB5 D;  1STH A;  4BY7 B;  3TQY A;  5CC4 A;  3H09 A;  3JAM L;  3E9I A;  1EQR A;  1PXU A;  1ZKO A;  1HTP A;  2EYL A;  1JIC A;  1VQN A;  2R93 H;  5E7N A;  3GTG B;  2EY6 A;  4OO1 I;  4YY3 L;  4KKT A;  4C3H H;  2QDB A;  5H1S E;  1V1P B;  2TMP A;  4MN3 A;  2BE5 D;  4CGY B;  3S14 H;  4P71 A;  1QVG A;  3MTS A;  2K52 A;  3I72 A;  5EAY A;  5C0X H;  2YTV A;  1I5F A;  3NPP A;  4ZYS A;  2EJG C;  1SRO A;  3A8K E;  3SK8 A;  5I4D A;  4OEM B;  3S1M H;  1D2B A;  1FNW A;  2K75 A;  1ESF A;  4R1J A;  3BVM A;  1NAP A;  1YJ9 A;  4HID A;  1XJV A;  2JA6 B;  2NVQ B;  4K5V A;  2LS0 1;  4F87 A;  4EX5 A;  5A2Q E;  1Q46 A;  1PRT F;  2IJ0 A;  2E76 C;  1E1O A;  3E3X A;  5C3E B;  2D0O A;  2HIX A;  4B3S L;  1K8O A;  4LF8 Q;  3F2U A;  4K5X A;  4LJZ C;  3I55 A;  4DR5 Q;  1SXT A;  2B2U A;  1L0W A;  4DV7 L;  4IOA A;  1WTX A;  5CV5 A;  1ASY A;  4CDF C;  2PZU A;  2EYJ A;  3X3N A;  3QOJ A;  1BCP C;  2UXB L;  1K8G A;  1K0S A;  3L2P A;  3U50 C;  4DAY A;  2F0M A;  2V4D A;  1TWH B;  3HOY B;  4A3L H;  3VR6 A;  1IKL A;  4K8J A;  5J3B A;  1MSH A;  3UDX A;  1SR3 A;  2FMC A;  1QUQ A;  4J15 A;  2DY8 A;  4DV4 L;  4DR2 L;  2F0J A;  1RF2 D;  1BBX C;  3F2B A;  1BNZ A;  1WD1 A;  1L1O A;  2NTS A;  2NZO A;  2L4N A;  4GN5 A;  5ELO A;  1B50 A;  2AKW B;  2KHS A;  1J5E Q;  2BA1 A;  2X6G A;  3F2D A;  5FLX L;  4EGV A;  1EIY B;  3BJU A;  4Q5V A;  2E2J B;  1EIG A;  1TQO A;  2JP1 A;  5HGQ A;  4B3R Q;  1H95 A;  4QIW B;  2QEX A;  1GKH A;  3I70 A;  1N36 Q;  1GD7 A;  2FMM A;  4F8M A;  5M9O A;  3SDZ A;  3SXH A;  3JAM c;  3E0J A;  3FEW X;  1O7L A;  4RAU C;  2HCC A;  4H0L C;  1WTP A;  2E2I H;  2MO1 A;  4R4C A;  3S2H H;  1SEB D;  1YNN D;  2EVB A;  2MPM A;  4LF4 L;  4IO9 A;  2BE5 C;  2RDG A;  2DNC A;  1KDC A;  3VYT A;  1Y8P B;  1Y8O B;  1PYW D;  2A69 C;  2BDN A;  4OIK A;  3TN2 A;  3SHL A;  1I4G A;  2OCE A;  5J22 A;  4KHP Q;  2PNR C;  2NVY H;  3PF5 A;  4BWG B;  2F3V A;  3NXW A;  1TY0 A;  2LMC B;  2FHT A;  1MGS A;  2B29 A;  2F52 A;  1QZH A;  5IP9 H;  4GKJ Q;  4LF9 L;  4IUN A;  4BBS B;  1B2T A;  1YJW A;  2VQE Q;  4X66 L;  4JI2 Q;  1ZXT A;  4F88 A;  1AZP A;  1TWF H;  2CH4 W;  2J7Z A;  2LSS A;  2B2W A;  2V1C C;  4N9P A;  2F0N A;  4HED A;  4JBJ A;  3HOU G;  4AQY Q;  1O7I A;  3T51 B;  2R61 A;  3RZD B;  2DN8 A;  5GAD C;  1MBY A;  2HQE A;  3U58 A;  1NJI C;  5LMU Q;  3CP0 A;  3BDL A;  3FPP A;  1QE6 A;  1STE A;  1JJG A;  3VDY A;  2RHQ B;  2I0Q A;  2UXD Q;  3D3R A;  1I3Q B;  1TU2 B;  3DXJ C;  1X56 A;  1L0X B;  3IFT A;  3NE5 B;  1BCP F;  3OIQ A;  2L1B A;  1AP0 A;  4QGU A;  5COY A;  4Y7N H;  3FKI G;  3S1Q B;  3VA5 A;  3J7A 5;  4CDE C;  3NHH A;  2Z8L A;  3DWA A;  4M1U B;  3EQL C;  4IAL A;  4JVZ A;  3T4A C;  1DZ1 A;  2KHJ A;  1CKN A;  4J1M A;  1BXT A;  3RMH A;  1GOZ A;  5IP7 G;  3C2P A;  2OQK A;  3I73 A;  3V2T A;  3HP3 A;  4ZUJ A;  1IYV A;  4V0B A;  1FD7 D;  4GKK Q;  2KJX A;  1MIU A;  1VQG A;  4PZ6 A;  1S72 A;  2NBF A;  3KYH C;  1AE3 A;  5FLX c;  4Q0F A;  1WJJ A;  4U68 A;  1YBY A;  4IQZ A;  2R3Z A;  1QG7 A;  1Y1W G;  1J9O A;  2AMC B;  1VQF A;  4A3K H;  1TII D;  2ZJP A;  1VQL A;  2O5I C;  4C1N K;  1HFN A;  3KBX A;  4KV6 A;  3HOW G;  5CBA E;  2IHE A;  2DUD A;  4C3J H;  3NSW A;  4GS3 A;  2Z9H A;  4A3F G;  1XMQ Q;  3G6J B;  3OTO L;  1HA6 A;  5EPL A;  1V9P A;  3CME A;  1LO5 D;  3C1E A;  5COR A;  5CBE E;  3A8I E;  1Q12 A;  1PFN A;  1VQO A;  4XXE A;  3I4N B;  4YWK A;  2YU9 B;  1PH7 A;  4EQP A;  1FNV A;  3H94 A;  2XSC A;  2G9D A;  1PTO C;  2PO4 A;  5C0X I;  4RH6 A;  4ZRZ A;  3VR5 A;  3H6M A;  1YIT A;  2UU9 Q;  1JQY D;  1JWU D;  3PQI A;  1VMC A;  1EFW A;  1SBB B;  2JA7 G;  4DN4 M;  3GTK H;  1D6E C;  4N9T A;  1EY5 A;  4FXG C;  4ULL A;  1SYB A;  1CZW A;  4L5R C;  3GTM B;  4OXP A;  1X6O A;  1KHI A;  1NE3 A;  4DNT B;  3S15 H;  2GVB A;  3AFQ A;  5I6Y A;  4YCU A;  1IKM A;  4LF5 Q;  1SJE D;  1SYE A;  2B2T C;  5LL6 X;  4TSS A;  3E9H A;  4NXN Q;  1TT2 A;  1GO3 E;  2ZJR A;  4TKO B;  4JI6 Q;  1D1K A;  5CYU A;  4LFA Q;  2HD3 A;  2PPB C;  4KKU A;  2KCM A;  3RLN A;  5C4J H;  1PH3 A;  4IJL A;  2NVT B;  2VXW A;  3MEH A;  2ZTC A;  2ATW A;  2J0T D;  4A3C H;  3ND9 A;  3QG1 A;  1VQK A;  1U4M A;  3GQB A;  4XQJ A;  3HKZ G;  4A4I A;  4FF3 A;  2EJM A;  4K6L A;  3J81 E;  2F4V L;  2Q8I B;  1WTO A;  1UWV A;  4KN4 C;  1I6H H;  5AJ3 L;  1QOH A;  1PZJ D;  1BDO A;  5JPN C;  1B3A A;  2DGY A;  1KNE A;  4LF7 Q;  3MXN B;  4GN4 B;  2JA8 G;  4F7X A;  1UAP A;  1MD2 D;  2F0L A;  2JN4 A;  1U0L A;  1I94 L;  1YNX A;  1GUT A;  4JI3 L;  2XTI A;  4A93 G;  3OWE B;  4RHS A;  3HOU B;  2VUM H;  1H9K A;  1JC7 A;  3OPO A;  1WI5 A;  1SDF A;  4KY5 A;  3T1Y Q;  2HDL A;  4FNF A;  2JE6 I;  1GUS A;  3GDE A;  3KLS X;  4JPB W;  5IGF A;  2K6A A;  2AWN A;  3OOC A;  3MXG A;  5T1I A;  4K0K L;  2DNE A;  1TVX A;  3PO2 G;  2Z6K A;  3FHW A;  2EXD A;  2NYZ D;  3FKI B;  4JCV E;  4B3T Q;  3NBH A;  5FLM G;  2DJG C;  4RGO S;  3U4V A;  1WFQ A;  3EA6 A;  3OMC A;  1G2T A;  4CKB A;  4OO1 H;  2Y0S G;  4POG A;  1XNQ L;  4DR7 L;  3SK6 A;  1EY8 A;  3I4M G;  1NY4 A;  2NN6 H;  5DAU A;  3DWP A;  1HR0 Q;  4NMZ A;  3ERS X;  5IGE A;  4L5S A;  4BY7 H;  3X3M A;  1CTM A;  1ICW A;  2EYP A;  1DCZ A;  2N49 A;  2GN5 A;  1EL0 A;  3GTG H;  1CQV A;  3V96 A;  1EYD A;  2I07 B;  1AFP A;  3D4D A;  2EY5 A;  3TDQ A;  2GA4 B;  1HPC A;  5KRU A;  3C3L A;  1HXY D;  1YVC A;  2F0Q A;  2DY7 A;  4DR3 L;  1Y1W B;  4M8A A;  3M9B A;  5C44 H;  1R4Q B;  4FF2 A;  4ILW A;  3U9O A;  1Q82 C;  4OX9 L;  4JI5 L;  5FO9 B;  3HOX G;  3HOW B;  1IBK L;  3TP7 A;  1SMY C;  4PV1 C;  2R92 G;  3AEV A;  1HHV A;  4QL5 A;  2WB1 G;  4A3F B;  4TRD A;  1MI2 A;  3RR5 A;  2JEA I;  2UXC L;  1PRT D;  1JCK B;  5IYC G;  1S4Z A;  4RCN A;  1VQ6 A;  3J81 i;  2WII B;  3S1R B;  1X3P A;  1XXG A;  4CKE A;  2PMZ E;  1SAP A;  3GV6 A;  4KTA A;  1ESR A;  2CKZ B;  2CQO A;  3STB D;  5J39 A;  5IWA L;  2JA7 B;  4YY3 Q;  3M3Y H;  2JK8 A;  2PYK A;  4R8N A;  1GHJ A;  4JI0 L;  1N32 L;  4KJN A;  1R9T B;  1PLF A;  3TME A;  2A6H C;  4HTH A;  3WOE A;  1EWC A;  2JXM B;  3KBG A;  4X3T A;  4CJ2 C;  3AQQ A;  1JMC A;  5ELB A;  2YYZ A;  5KYL A;  4DUY L;  2F1M A;  4AYB E;  4YCV A;  1XMO L;  2HIV A;  3KFU A;  2JA9 A;  1W6K A;  2RQX A;  2F4I A;  3T16 A;  4AIM A;  1SNQ A;  2O2L D;  1SFO B;  3CRL C;  3W5O A;  4DNR B;  1FGU A;  3KDF B;  3HEJ A;  1HUN A;  3CD6 A;  2CW0 D;  1LUZ A;  4JI8 L;  3HKZ B;  4A3I G;  2AHO B;  3RZO H;  4B3S Q;  1VQ9 A;  2K14 A;  1SE3 A;  2LXK A;  4A3E H;  4JI1 L;  3DMU A;  4QY7 A;  1QVC A;  4DK1 A;  5IGD A;  1DOK A;  2PZW A;  3OMG A;  1XPR A;  2K7V A;  2R7Z H;  2QW7 A;  4Y52 H;  2UUB L;  4GN3 B;  2JA8 B;  1PV4 A;  3HOV G;  2OEO A;  5JPM C;  3P1H A;  2WAQ G;  4UHV A;  3NEL A;  3MAQ A;  4GNX A;  2WIN B;  1HR0 W;  4A93 B;  2E8G A;  3GTO B;  1KXL A;  5HGT A;  3KJO A;  2IL8 A;  4R8I A;  3A74 A;  1Q8K A;  4QUF A;  4AH6 A;  4DV3 Q;  4ZCK A;  5GAE C;  2K5D A;  3GTP B;  1V43 A;  4IUT A;  2O5J C;  4DV4 Q;  4DR2 Q;  1KRS A;  4FF4 A;  2PW5 A;  4PMB A;  2K05 A;  3BYY B;  2UUA L;  4KI0 A;  1U4P A;  5LMN W;  3PO2 B;  1EWH A;  3OHX C;  3U4Z A;  1IBL L;  2VS1 A;  1RHP A;  4KD3 A;  3J7Y W;  1K0R A;  2B63 H;  1PRT C;  3MWY W;  1XNR L;  2VB2 X;  1LAB A;  4CBV A;  2Q2T A;  1PH1 A;  5K36 H;  3W1G A;  4FYD A;  1ZYR C;  3NP8 A;  1C9O A;  2YTX A;  1KNA A;  2Y0S B;  1H9S B;  3I4M B;  2F0V A;  1ILP A;  5IY0 A;  1A15 A;  1WTH A;  5JEA G;  3HOZ H;  2F0U A;  4L8J A;  5IT9 E;  1F2Y A;  1K73 C;  1GUG A;  2RDH A;  4C3I G;  5FJ8 G;  4LF4 Q;  2B2V C;  1PH5 A;  2IW3 A;  1BCP D;  1CKO A;  5E3F A;  4X64 L;  1ENC A;  5GAG C;  3K57 A;  4JC0 A;  2K4K A;  3WDN A;  1CHP D;  3T1H L;  5M5Y B;  4QUC A;  1TWA B;  3TS0 A;  2WAC A;  1CI3 M;  1BR9 A;  4A3B G;  4XT3 B;  4U67 3;  5ELF A;  2A68 C;  1NNX A;  4DR4 L;  3HOX B;  2AUJ D;  4DV6 L;  1QVF A;  4DK3 C;  3O13 A;  3W1B A;  4LF9 Q;  1OXX K;  3OIP A;  2R92 B;  1I50 B;  1L0Y B;  2WB1 B;  3CW2 C;  3VYR A;  4A3G H;  4YWL A;  1SSO A;  2K5W A;  4A3D G;  2VQF L;  1WCM G;  2QGQ A;  3SK5 A;  4ME5 A;  2QA4 A;  1EU3 A;  1J8I A;  3M4P A;  1YHB A;  3AU7 A;  3RLO A;  4MTN A;  1TWG B;  3NTI A;  2PNH A;  1A3U A;  4IUP A;  3C46 A;  2NN6 I;  3UDF A;  5FKA C;  1NMG A;  2J4X A;  4RGT A;  1PYB A;  2PQA B;  4JI4 Q;  2Q2I A;  3AFP A;  3IFD A;  1Q1B A;  2A69 D;  2VL6 A;  1NCV A;  2GVA A;  1BKB A;  2JSO A;  4NB3 A;  3EN2 A;  1EIF A;  1RTO A;  3ONA B;  1W3S A;  1HNX L;  3S2D H;  3NUC A;  4BBR G;  1WTW A;  4DNI A;  4G57 A;  1E0B A;  1VF5 C;  1I4H A;  3HS0 C;  1FVI A;  5G3L D;  2IX1 A;  3DHQ A;  5BN4 A;  4KMU C;  4IOC A;  4NXM L;  1GVP A;  1HNW L;  1PFS A;  2K50 A;  3NEN A;  2BCO A;  3D6W A;  1PH4 A;  2G5D A;  1B1Z A;  3I90 A;  4DR1 Q;  3G4S A;  4GLV B;  3KF8 A;  1VQB A;  4TQU S;  4A3I B;  1JR0 D;  3ZYY X;  3J81 c;  4P72 A;  2HT1 A;  4LFB L;  1XTD A;  1SNM A;  1X3E A;  2JA5 G;  2EJF C;  3LGJ A;  2DJF C;  5D14 A;  4CJ1 B;  5DM6 3;  5DM7 3;  4NDX A;  1B9M A;  3J80 L;  2F0I A;  2IX0 A;  1B3Q A;  2R93 G;  2AQ1 B;  3HOV B;  3I2Z A;  3RUZ A;  3MEF A;  1P16 A;  1I4P A;  3OTO Q;  2WAQ B;  4MHE A;  3I4N G;  4B3M L;  4C3H G;  2RSN A;  4MIU A;  5IYB G;  3H0G G;  3ZJY C;  4MNO A;  4BY1 H;  1GJX A;  1SYC A;  1OXT A;  5E1F A;  1BQQ T;  3K81 C;  3GTQ H;  3H91 A;  3ER0 A;  5C3W A;  1LTI D;  5C0X G;  1PDQ A;  4R4I A;  4JI7 L;  2VNU D;  1ENA A;  1JOQ A;  2N8N A;  2F0D A;  2P5Z X;  1P8L A;  5IIF A;  3M4Y A;  5JVH 3;  1JT8 A;  4H44 C;  1X55 A;  4DPG A;  1VQ8 A;  3M4O H;  1PHJ A;  4KK7 A;  4LMQ D;  3J7A V;  1E2V A;  1FJG L;  2F0H A;  3ICE A;  1V1O A;  4ID6 A;  4JBK A;  4H13 C;  1UUP A;  4KLK A;  5C4Z A;  5BN3 A;  5KEE A;  3S17 H;  2E5L Q;  4C3I B;  4IPG A;  2EXZ A;  1UNS A;  3LX0 A;  1HCZ A;  2C9O A;  5JJL A;  1SND A;  1VQP A;  1CFM A;  3NWT A;  2RKS A;  4HJ5 A;  3SGI A;  5T1G A;  1EZ6 A;  2AQ2 B;  2CWA A;  3GTL B;  3D0F A;  1STB A;  3NTK A;  1G51 A;  1PTO D;  3DUZ A;  2NVX B;  4DV0 L;  4EQO A;  3CRK C;  5EKL A;  4K8I A;  4JBW A; 
#chains in the Genus database with same CATH homology
 4OHJ A;  3NTH A;  4I7Z C;  5AFW A;  5DNF A;  3TZD A;  1ILQ A;  4A3D B;  1WCM B;  1B44 D;  4WFN 3;  1X32 A;  3S1N B;  1VDZ A;  2KOL A;  1SE2 A;  5BN5 A;  2SEB D;  3VYS A;  1GUW A;  3AMU A;  3VA7 A;  4L63 B;  1AW7 A;  1JOO A;  1II3 A;  1JWS D;  1E2Z A;  3HG9 A;  4KKS A;  5NUC A;  1EIH A;  3SVM A;  4RFB A;  4DK0 A;  5CGK A;  1EU4 A;  1A2U A;  1GUN A;  4BBR B;  2CQA A;  4RKL A;  3S16 B;  2EDG A;  4ZKB B;  2HCI A;  2LKV A;  2PZT A;  2MP1 A;  3A56 A;  5EBC A;  3LNN A;  3KUP A;  4NKL A;  1M8A A;  1JOR A;  1UEA B;  2FIN B;  3A7L A;  4QMG A;  1PTO H;  1BO0 A;  4DGZ A;  4K14 A;  4X3S A;  1G2S A;  2JA5 B;  5ELE A;  4J6H A;  1QWY A;  4CHT B;  2ICE C;  2OF1 A;  2H4O A;  2R93 B;  2ID0 A;  1ENF A;  1AN8 A;  4C3H B;  4LK1 C;  2H1E A;  2OXP A;  3H0G B;  1O7Y A;  3Q6S A;  3L7Z C;  4XQQ A;  4XYO A;  1U4R A;  1JOK A;  2KEE A;  3DEP A;  4EQN A;  3HRZ C;  5A2Q L;  1G6Z A;  3R3O A;  3S1M B;  2B2T A;  5CV4 A;  1M4V A;  3GTJ B;  1FNU A;  2NB0 A;  2E74 C;  4E6I A;  3L3O C;  2F03 A;  1SMY D;  2IT1 A;  4H7B A;  1JB3 A;  1DM0 B;  5JJZ A;  2F0T A;  3SR1 A;  4C3J G;  1JWM D;  2KCC A;  1SNO A;  3GP7 A;  1IW7 C;  3TP8 A;  3D6C A;  5CV8 A;  2D62 A;  3R8B A;  3VYU A;  2RDF A;  1IHZ A;  2HDM A;  3W2D A;  3R93 A;  5ISR A;  1LAC A;  3DM1 A;  5CV7 A;  5IGC A;  2A6H D;  1EY7 A;  4O42 A;  2RBM A;  3PUW A;  1HTL D;  4HMI A;  1K83 B;  4RGM A;  4V19 0;  5JAV A;  5K5P A;  3KLR A;  4IFD G;  2M00 A;  4PQX A;  4J8Q A;  1C4Q A;  2E2I B;  1PFB A;  4RKB A;  3BVZ A;  3S2H B;  1HQR D;  2X6L A;  4HCS A;  1OXV A;  2Q8R E;  2A74 C;  1CT1 D;  3I8Z A;  5KND A;  2EY2 A;  2KUM A;  4X3K A;  1VMP A;  3K5N A;  2NVY B;  2L5T A;  3Q22 A;  3KK7 A;  1U4L A;  3JAM E;  4NW2 A;  4PMW A;  1SNP A;  1QCB D;  2E75 C;  5EBD A;  4IUR A;  1LT6 D;  1TWF B;  5KYI A;  1OXU A;  1EFI D;  4IZ8 A;  2F0E A;  2K28 A;  5D65 A;  4X3U A;  3PUY A;  3I91 A;  1D5Z C;  1V1P A;  1EQT A;  2D2C C;  5EQ0 A;  1FR3 A;  1EQV A;  1TY2 A;  1NR2 A;  2FFK B;  5ELC A;  5IGB A;  5I6W A;  4ODG A;  1ZYR D;  1U9R A;  4Y7N B;  3QB3 A;  1STY A;  5I2Y A;  1DOM A;  2PW7 A;  4QF4 A;  4Z9C B;  2ZT9 C;  4OO1 G;  4IN3 A;  3FVQ A;  1C48 A;  5D3I B;  1HRJ A;  4C1N I;  2EZV A;  3P20 A;  1TS2 A;  3DEO A;  5C4H A;  1HQM C;  2R6G A;  1JE4 A;  1EZ8 A;  3M85 A;  2MUY A;  5KGU A;  2A68 D;  4A3K B;  3BZD B;  3K6O A;  2B8G A;  4FP5 D;  1RKN A;  1HA5 A;  1CK1 A;  1EY6 A;  2Z4H A;  1EYC A;  1O80 A;  1SE4 A;  5ELD A;  1ET9 A;  4C3J B;  1YNJ C;  2O4X A;  5I9P A;  1KAB A;  5CMD A;  4KY7 A;  5FLX E;  1QNK A;  3ERO A;  2RVL A;  4KHZ A;  4BA1 I;  5CR3 A;  5M5W B;  4BA2 I;  2KED A;  1B53 A;  1S5D D;  2KVM A;  2F0O A;  2K01 A;  4KD4 A;  2K5Q A;  1AZQ A;  3T56 B;  1GXD C;  1Q1E A;  2I46 A;  2QCP X;  3S15 B;  1GUO A;  5C3X A;  1Z6H A;  1CA5 A;  3K5O A;  3A54 A;  1I4X A;  1OXS C;  4XIG S;  5EKI A;  2PQE A;  3PO3 B;  5IOC A;  1XYI A;  1WTQ A;  5EKK A;  3AB9 A;  3J81 L;  4WOR A;  2AUK A;  3UI2 A;  1DXM A;  1X3Q A;  2EYH A;  1LTR D;  3H3V C;  3MHB A;  2B2V A;  4YIJ A;  1Z47 A;  1MSG A;  5A35 A;  4A3M B;  2F0F A;  1I6H B;  2SOB A;  3A8J E;  4KY6 A;  1KAA A;  1DD2 A;  2BOS A;  2LY7 A;  1RDP D;  1D1I A;  3NWS A;  1I4R A;  3M7G A;  4UDU C;  4FO2 A;  3QIA A;  2VUM B;  4WJW A;  4ZK9 B;  3EJI A;  4K2K A;  4ZAI A;  1Y69 U;  2MGS A;  3MA2 B;  2AWO A;  3MFY A;  4IUV A;  2NTT A;  3QJY A;  5C5L A;  2XRS D;  1ML0 D;  3D8G A;  4IUQ A;  2N88 A;  2EYM A;  1RD9 D;  1F9P A;  1LLR D;  5K36 G;  3PMF A;  2ZXO A;  4XT1 B;  2WKC A;  2N55 A;  4ZKC B;  4DXF A;  3QO2 A;  2EYO A;  5LL6 S;  1O7Z A;  4O1N A;  4NP5 A;  3EVQ A;  5C44 B;  2EE1 A;  3W3A A;  2KQ3 A;  3CHB D;  1PZI D;  3BDO A;  2NUC A;  4B9W A;  1VF7 A;  3I4L A;  3PUX A;  2RSO A;  2MHV A;  5KNC A;  2L55 A;  2A73 B;  3K58 A;  1LT5 D;  2JYO A;  2KEC A;  5DEH A;  4DA2 A;  4HN7 A;  1QJO A;  5E4W C;  4B9X A;  2Z1C A;  2JEB I;  1LV9 A;  3RD4 A;  3L9A X;  3FPU B;  2L12 A;  3C1F A;  3M3Y B;  3IKJ A;  3PUZ A;  4FF1 A;  2A5H A;  2B2U C;  2OT2 A;  4G7Z C;  1SYG A;  2B39 A;  1LT3 D;  3CU7 A;  5FOB B;  4R9W A;  4P2C B;  1TR5 A;  1B9N A;  2FJ2 A;  3P7J A;  2XIW A;  2PMZ B;  4KHV A;  4BS9 A;  5KNB A;  3Q0A A;  3K7A B;  1F2L A;  3MXN A;  4DU9 A;  4G7O C;  3RZO B;  1WD0 A;  4A3E B;  1WTV A;  2XWB B;  2EPB A;  3G7L A;  2WKD A;  4AYB B;  1Q90 A;  2R7Z B;  3OSO A;  1LTT D;  4QB4 A;  1XTC D;  2SNS A;  2Q8T A;  5FK9 C;  2F0S A;  4FXK C;  2VB3 X;  1KDB A;  1PRT B;  2SDF A;  4LAA A;  1RJT A;  1SYD A;  5C4X B;  2F0G A;  3WOF A;  4WRD A;  3LWE A;  1EY9 A;  5CV6 A;  5JOB A;  1G8Z D;  4IUU A;  4HSV A;  1STN A;  1PZK D;  4IFD J;  4K2L A;  4HMJ A;  4KN7 C;  3QOL A;  4C56 C;  1KLU D;  1F2Z A;  1FGB D;  2B63 B;  5HUR A;  2ENB A;  5IT9 L;  1TS5 A;  3MC0 B;  4FVM A;  2B2W C;  3GO5 A;  3PIP 3;  5D3D A;  4RWS C;  1KTK A;  2XVS A;  2KA7 A;  3HOZ B;  5EGT A;  1EY4 A;  1IW7 D;  2TSS A;  5FO7 B;  4DAV A;  2AQ3 B;  2WV6 D;  5C5M A;  2D9U A;  1F9S A;  1ZEQ X;  1F77 A;  1SNC A;  1B4O A;  3ITP A;  1H9R A;  1S5F D;  1CQF A;  3IAY A;  1NSN S;  3MXP A;  3NQT A;  4A3B B;  3M7N A;  5CV9 A;  4G4K A;  3OW7 A;  3ERQ A;  3GD7 A;  4A3G B;  2XWJ B;  3PIO 3;  1I6V C;  3HGB A;  3TBI B;  3PUV A;  2BA0 A;  3R2T A;  2RA4 A;  1S5C D;  2D5D A;  1YNN C;  5IGG A;  3BVG A;  2EYF A;  1ROD A;  4XDX A;  3S14 B;  1EYA A;  2QIL A;  3NBI A;  4XYQ A;  4CKC A;  1EY0 A;  4G7H C;  5C6A A;  1R4P B;  2K03 A;  2EY1 A;  1E2W A;  1I4Q A;  1S5E D;  3S2D B;  3P75 A;  3FDT A;  1F9Q A;  4DFA A;  1IL8 A;  4RHR A;  3J7A F;  1BCP B;  2K1B A;  5G3L F;  3D4R A;  4ZQ3 A;  5I2X A;  2M2L A;  1WVL A;  5JVG 3;  1QNU A;  1D5X C;  5EPK A;  4IFD H;  4XQN A;  3VR2 A;  1KDA A;  2PCF B;  3SEB A;  3IL8 A;  2M9V A;  4DF7 A;  1VCI A;  4ABN A;  2KCN A;  4RA8 A;  1LT4 D;  3N6R A;  4S3S A;  3MFG A;  4PNY A;  3BG3 A;  1T5E A;  4BY1 B;  4HAE A;  1CM9 A;  3GTQ B;  3BYT B;  4ZLT F;  3I3C A;  1O78 A;  1RCV D;  2WP8 J;  3SK4 A;  1DJR D;  1H9S A;  1H9J A;  1Q3L A;  1XWE A;  4PMC A;  4XTC S;  2IX3 A;  1A2T A;  4K6D A;  4FXD A;  1K8M A;  1A3V A;  1S5B D;  2B2Y A;  3M4O B;  3TSS A;  1STG A;  4GZY C;  2B2Y C;  1DON A;  1WTR A;  5JEA J;  4KJO A;  3QWN A;  4EVO A;  1CHQ D;  1BOS A;  1YNJ D;  2L11 A;  3K59 A;  3S17 B;  1DOL A;  2A6E D;  2Z4I A;  1STA A;  4OL7 A;  3BS1 A;  4ZUI A;  1G29 1;  2F3W A;  4HCE A;  4HR7 B;  2G9H D;  1NUC A;  2L0C A;  1PTO F;  3A55 A;  2XN9 C;  5TSS A;  1A6X A;  1TKW B;  3V05 A;  3TZU A;  1CA6 A;  1ET6 A;  3TP6 A;  3URY A;  5M3M B;  1ONL A;  3CKI B;  1EEI D;  3E5S A;  2IPK D;  1Z7T A;  2E2D C;  1NR4 A;  3T13 A;  2QF7 A;  3SE0 A;  1HFG A;  2CVR A;  1T5X D;  1LTB D;  1Y8N B;  1TS4 A;  3A7A B;  4CJ0 B;  3RLF A;  1PFM A;  3FMC A;  1H9M A;  2B8F A;  4C2M B;  3NK9 A;  1F2M A;  4HSP A;  5KIX A;  1OO9 B;  2CHB D;  2NN6 G;  3ND8 A;  1BF4 A;  5EJW A;  3T53 B;  1GHK A;  3Q24 A;  1F9R A;  4A3J B;  2F0K A;  1CZG A;  3MVV A;  1LTS D;  1RTN A;  2QEJ C;  5E4X A;  4JK1 C;  3LWU A;  3J80 E;  3GV3 A;  1IYU A;  1QIL A;  1PTO B;  3NQI A;  4DAP A;  3MZ5 A;  3BDC A;  2C5C A;  5FO8 B;  1BUV T;  5M3F B;  4DXG A;  2K32 A;  2E2H B;  2NZ1 D;  3OWF A;  2A6E C;  2K33 A;  3E6Z X;  3DWQ A;  2SNM A;  1FYC A;  5IOD A;  3S9W A;  4QCL A;  2ZXP A;  1LTA D;  2BDO A;  3FRP B;  2MJ8 A;  4OIJ A;  1EOT A;  3Q23 A;  5JEA H;  5C0X J;  1DYQ A;  1XX8 A;  3GTK B;  3K5L A;  2QKI C;  3EFX D;  3KLS A;  2EOT A;  5M5X B;  4OGQ C;  1TWC B;  3K0Y A;  4K5W A;  4L6T B;  1TS3 A;  5F2D A;  2ICI A;  5C4J B;  3N52 A;  1C8C A;  2X69 A;  1KLG D;  3K5M A;  4IFD I;  1HUM A;  2F0W A;  3CQZ B;  4RCO A;  5J1Z A;  3VR4 A;  2F0P A;  1G91 A;  4I65 A;  2LFN A;  2NWG A;  2HUG A;  3MXU A;  4UAI A;  1A3T A;  3TP5 A;  2XNA C;  1SYF A;  1SJH D;  5EPJ A;  3R2I A;  4RGN A;  5LHY 1;  3D4W A;  1AEX A;  3HZX A;  3D31 A;  1LTG D;  1W6J A;  2K04 A;  2ZXR A;  1Q8I A;  1V8Q A;  1D5M C;  3PV0 A;  1EEF D;  2IWH A;  1PMR A;  5I9O A;  3VR3 A;  4B08 A;  2XRQ D;  3U9S A;  2L9H A;  2CW0 C;  1Y1V B;  1QB5 D;  1STH A;  4BY7 B;  5CC4 A;  3H09 A;  3JAM L;  1PXU A;  1ZKO A;  1HTP A;  2EYL A;  1JIC A;  3GTG B;  2EY6 A;  4OO1 I;  4KKT A;  2QDB A;  1V1P B;  2TMP A;  4MN3 A;  2BE5 D;  4CGY B;  3MTS A;  3I72 A;  5C0X H;  3NPP A;  4ZYS A;  2EJG C;  3A8K E;  3SK8 A;  5I4D A;  1D2B A;  1FNW A;  1ESF A;  3BVM A;  1NAP A;  2JA6 B;  2NVQ B;  4K5V A;  2LS0 1;  4F87 A;  5A2Q E;  1PRT F;  2IJ0 A;  2E76 C;  5C3E B;  1K8O A;  3F2U A;  4K5X A;  4LJZ C;  1SXT A;  2B2U A;  1WTX A;  5CV5 A;  2PZU A;  2EYJ A;  3X3N A;  3QOJ A;  1BCP C;  4DAY A;  2F0M A;  2V4D A;  1TWH B;  3HOY B;  3VR6 A;  1IKL A;  4K8J A;  1MSH A;  2FMC A;  2DY8 A;  2F0J A;  1RF2 D;  1BBX C;  1BNZ A;  1WD1 A;  2NTS A;  2L4N A;  1B50 A;  2KHS A;  2BA1 A;  2X6G A;  5FLX L;  4EGV A;  4Q5V A;  2E2J B;  1EIG A;  1TQO A;  2JP1 A;  4QIW B;  3I70 A;  2FMM A;  4F8M A;  5M9O A;  3SDZ A;  3SXH A;  3E0J A;  3FEW X;  1O7L A;  4RAU C;  2HCC A;  4H0L C;  1WTP A;  1SEB D;  1YNN D;  2EVB A;  2MPM A;  2BE5 C;  2RDG A;  2DNC A;  1KDC A;  3VYT A;  1Y8P B;  1Y8O B;  1PYW D;  2A69 C;  2BDN A;  4OIK A;  3TN2 A;  3SHL A;  1I4G A;  5J22 A;  2PNR C;  4BWG B;  2F3V A;  3NXW A;  1TY0 A;  2LMC B;  2FHT A;  1MGS A;  4IUN A;  4BBS B;  1B2T A;  1ZXT A;  4F88 A;  1AZP A;  2J7Z A;  2B2W A;  4N9P A;  2F0N A;  4HED A;  3T51 B;  2R61 A;  3RZD B;  2DN8 A;  1MBY A;  2HQE A;  3BDL A;  3FPP A;  1QE6 A;  1STE A;  3D3R A;  1I3Q B;  1TU2 B;  3DXJ C;  1L0X B;  3IFT A;  3NE5 B;  1BCP F;  3OIQ A;  2L1B A;  1AP0 A;  5COY A;  3S1Q B;  3VA5 A;  3NHH A;  2Z8L A;  3DWA A;  4M1U B;  3EQL C;  4IAL A;  1DZ1 A;  3T4A C;  4J1M A;  1BXT A;  3RMH A;  1GOZ A;  3C2P A;  3I73 A;  3V2T A;  3HP3 A;  4ZUJ A;  1IYV A;  4V0B A;  1FD7 D;  2KJX A;  2NBF A;  4Q0F A;  4U68 A;  4IQZ A;  2R3Z A;  1QG7 A;  1J9O A;  1TII D;  2O5I C;  4C1N K;  1HFN A;  3KBX A;  4KV6 A;  5CBA E;  3NSW A;  3G6J B;  1HA6 A;  5EPL A;  1LO5 D;  3C1E A;  5COR A;  5CBE E;  3A8I E;  1Q12 A;  1PFN A;  3I4N B;  4XXE A;  2YU9 B;  4EQP A;  1FNV A;  3H94 A;  2XSC A;  2G9D A;  1PTO C;  2PO4 A;  5C0X I;  4RH6 A;  4ZRZ A;  3VR5 A;  3H6M A;  1JQY D;  1JWU D;  1VMC A;  1SBB B;  4DN4 M;  1D6E C;  4N9T A;  1EY5 A;  4FXG C;  4ULL A;  1SYB A;  1CZW A;  3GTM B;  4DNT B;  5I6Y A;  1IKM A;  1SJE D;  1SYE A;  2B2T C;  5LL6 X;  4TSS A;  1TT2 A;  4TKO B;  1D1K A;  5CYU A;  2PPB C;  4KKU A;  2NVT B;  2VXW A;  3MEH A;  2J0T D;  3ND9 A;  3QG1 A;  1U4M A;  3GQB A;  4XQJ A;  4FF3 A;  2EJM A;  4K6L A;  3J81 E;  2Q8I B;  1WTO A;  4KN4 C;  1QOH A;  1PZJ D;  1BDO A;  5JPN C;  1B3A A;  1KNE A;  4F7X A;  1UAP A;  1MD2 D;  2F0L A;  1GUT A;  3OWE B;  4RHS A;  3HOU B;  1H9K A;  1JC7 A;  3OPO A;  1SDF A;  4KY5 A;  2HDL A;  4FNF A;  2JE6 I;  1GUS A;  3KLS X;  5IGF A;  2K6A A;  2AWN A;  3OOC A;  3MXG A;  5T1I A;  2DNE A;  1TVX A;  2NYZ D;  3FKI B;  3NBH A;  4RGO S;  3OMC A;  3EA6 A;  1G2T A;  4CKB A;  4OO1 H;  3SK6 A;  1EY8 A;  2NN6 H;  5DAU A;  3DWP A;  4NMZ A;  5IGE A;  3X3M A;  1CTM A;  1ICW A;  2EYP A;  1DCZ A;  1EL0 A;  1CQV A;  3V96 A;  1EYD A;  2I07 B;  1AFP A;  3D4D A;  2EY5 A;  3TDQ A;  2GA4 B;  1HPC A;  5KRU A;  3C3L A;  1HXY D;  2F0Q A;  2DY7 A;  1Y1W B;  4M8A A;  1R4Q B;  4FF2 A;  4ILW A;  3U9O A;  5FO9 B;  3HOW B;  3TP7 A;  1SMY C;  4PV1 C;  1HHV A;  4A3F B;  4TRD A;  1MI2 A;  2JEA I;  1PRT D;  1JCK B;  1S4Z A;  4RCN A;  2WII B;  3S1R B;  1X3P A;  1XXG A;  4CKE A;  1SAP A;  3GV6 A;  4KTA A;  1ESR A;  5J39 A;  2JA7 B;  2PYK A;  4R8N A;  1GHJ A;  4KJN A;  1R9T B;  1PLF A;  3TME A;  2A6H C;  4HTH A;  3WOE A;  1EWC A;  2JXM B;  3KBG A;  4X3T A;  4CJ2 C;  5ELB A;  2YYZ A;  5KYL A;  2F1M A;  1W6K A;  2RQX A;  2F4I A;  3T16 A;  1SNQ A;  2O2L D;  1SFO B;  3CRL C;  4DNR B;  3HEJ A;  1HUN A;  2CW0 D;  3HKZ B;  1SE3 A;  3DMU A;  4DK1 A;  5IGD A;  1DOK A;  2PZW A;  3OMG A;  2K7V A;  2JA8 B;  2OEO A;  5JPM C;  3P1H A;  3MAQ A;  2WIN B;  4A93 B;  3GTO B;  5HGT A;  2IL8 A;  4R8I A;  4QUF A;  2K5D A;  3GTP B;  1V43 A;  4IUT A;  2O5J C;  4FF4 A;  2PW5 A;  4PMB A;  2K05 A;  3BYY B;  4KI0 A;  1U4P A;  3PO2 B;  1EWH A;  3OHX C;  1RHP A;  4KD3 A;  3J7Y W;  1PRT C;  3MWY W;  2VB2 X;  1LAB A;  4CBV A;  5K36 H;  4FYD A;  1ZYR C;  3NP8 A;  1KNA A;  2Y0S B;  1H9S B;  3I4M B;  2F0V A;  1ILP A;  1A15 A;  5JEA G;  2F0U A;  4L8J A;  5IT9 E;  1F2Y A;  1GUG A;  2RDH A;  4C3I G;  2B2V C;  2IW3 A;  1BCP D;  5E3F A;  1ENC A;  3K57 A;  3WDN A;  1CHP D;  5M5Y B;  4QUC A;  1TWA B;  2WAC A;  1CI3 M;  1BR9 A;  4XT3 B;  4U67 3;  5ELF A;  2A68 C;  3HOX B;  2AUJ D;  3O13 A;  1OXX K;  3OIP A;  2R92 B;  1I50 B;  1L0Y B;  2WB1 B;  3VYR A;  1SSO A;  2K5W A;  3SK5 A;  4ME5 A;  1EU3 A;  1J8I A;  3AU7 A;  1TWG B;  3NTI A;  1A3U A;  4IUP A;  3C46 A;  2NN6 I;  5FKA C;  2J4X A;  4RGT A;  3IFD A;  1Q1B A;  2A69 D;  1NCV A;  2JSO A;  1RTO A;  3ONA B;  3NUC A;  1WTW A;  4G57 A;  1E0B A;  1VF5 C;  1I4H A;  3HS0 C;  2IX1 A;  5G3L D;  3DHQ A;  5BN4 A;  4KMU C;  2BCO A;  3D6W A;  1B1Z A;  3I90 A;  3KF8 A;  4TQU S;  4A3I B;  1JR0 D;  3ZYY X;  1SNM A;  2EJF C;  5D14 A;  4CJ1 B;  5DM6 3;  5DM7 3;  4NDX A;  1B9M A;  3J80 L;  2F0I A;  2IX0 A;  2AQ1 B;  3HOV B;  3RUZ A;  1I4P A;  2WAQ B;  4MHE A;  4C3H G;  2RSN A;  4MIU A;  1GJX A;  1SYC A;  1OXT A;  5E1F A;  1BQQ T;  3H91 A;  5C3W A;  1LTI D;  5C0X G;  1PDQ A;  2VNU D;  1ENA A;  1JOQ A;  2F0D A;  5IIF A;  3M4Y A;  5JVH 3;  4H44 C;  4KK7 A;  4LMQ D;  3J7A V;  1E2V A;  2F0H A;  1V1O A;  4ID6 A;  4H13 C;  1UUP A;  5C4Z A;  5BN3 A;  5KEE A;  4C3I B;  2EXZ A;  1UNS A;  3LX0 A;  1HCZ A;  2C9O A;  1SND A;  1CFM A;  3NWT A;  2RKS A;  5T1G A;  1EZ6 A;  2AQ2 B;  3GTL B;  1STB A;  3NTK A;  1PTO D;  3DUZ A;  2NVX B;  4EQO A;  3CRK C;  5EKL A;  4K8I A;  4JBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...