3VYUA

Crystal structure of the hypc-hypd-hype complex (form ii)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
54
structure length
54
Chain Sequence
LAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLDEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Metal binding protein/transferase
molecule keywords Hydrogenase expression/formation protein HypC
total genus 6
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vyuA00
3VYTA 2Z1CA 3VYUA 3VYSA 3VYRA 2OT2A 3D3RA
chains in the Genus database with same CATH superfamily
1SYGA 4ZUIA 1C7YA 1IBLL 1Q8IA 1BOSA 2QEXA 1LTSD 4HIOA 2PQEA 1Q1BA 4LW1A 1N8RC 2UUAL 4DAVA 1B44D 4BBSG 1R4PB 3AB9A 1XMQQ 2KCTA 2OTLA 2EY1A 1K0RA 5G3LD 1SN8A 1LTID 3PO2H 2KHSA 1TS4A 4QL5A 1BBXC 2NVTB 3H3VC 2D5DA 3KFUA 5C5LA 3GTMH 2HD3A 1ZYRC 3FVQA 4JI2Q 1HQMC 2EZVA 2DN8A 4HJ9A 5IYCH 4JBKA 1Z6HA 1Y8NB 3T1HQ 4DV1L 1BDOA 2BE5D 5L37A 4OX9Q 2D2CC 3CCEA 2WB1E 1OXTA 3U4ZA 3URYA 4C3JB 1HPCA 2P5ZX 1JC7A 3S1NH 4QCLA 5ELBA 3HS0C 1HH2P 1KABA 4A3EG 4U673 1ENFA 1I4QA 2BA0A 4K5WA 4L5RC 3L2PA 3CD6A 1CKNB 1HZBA 4RA8A 2E2HH 5CBEE 4C3JG 4ZKBB 1PYSB 2RSOA 5JAVA 1SNCA 3NTIA 1CK1A 2RDHA 2A1AA 4BY7H 1D5MC 3KF6B 2A73B 3I73A 2WB1G 2JA6B 1VQJA 5IT9L 2IWHA 1DCZA 1G291 3NTHA 4LJZC 3HZXA 1DM0B 1GUOA 1LV9A 1FJGL 4LK1C 3OMCA 1C8CA 3EBEA 3JAMc 4JOIC 1TIID 4X3KA 5JPNC 4KTAA 1YNNC 5JVG3 2IL8A 1D7QA 4MNOA 3VDYA 1DD2A 3PCOB 4JI8L 3NUCA 4TVAB 1XWEA 2HQLA 4C2MH 4TQUS 5J1ZA 3B6YA 2RKSA 3R2IA 2QDLA 3IFTA 1GUGA 1IW7C 3GO5A 5KNCA 3TP8A 1E3PA 1HQRD 3TEHB 2CQOA 1TWCH 2IJ0A 4DR4L 4A3CH 1JR0D 2B2YA 4KKTA 1N32Q 2UUCL 1PTOC 3OPOA 3GTPH 1HHVA 4B9WA 4BY1H 3P1HA 4DV3L 3S1QH 1LUZA 2R93G 4C3IB 3VR4A 3HOZB 3DWQA 1FYCA 5G3LF 4APVA 2B2UC 2PO4A 1WOCA 4A3BG 4LF8Q 1PZKD 3UE0A 1QJOA 1PH4A 1FR3A 1STHA 3OTOL 1PTOF 3AQQA 1SLJA 4DR3L 2JA5H 3DM1A 4K2KA 2BA1A 3CQZB 2OQKA 1UE1A 3M7GA 3PUZA 3M85A 2JA8B 1KLGD 4DR7Q 3U50C 3JAMi 2HCCA 2K05A 2R7FA 4R8NA 5CV6A 5GAEC 4CDEC 2MFIA 2R7DA 5AFWA 2ZTCA 4HR7B 2MHVA 1I6HH 1EWIA 1TWFH 2R7ZB 1ESRA 1S5ED 4JI6Q 5JJLA 1B53A 4GS3A 4DR1L 4JV5Q 1HA5A 2RDFA 1K9MC 1RIPA 2AWOA 4KN4C 3HOWG 4ZK9B 4ILWA 2EYJA 3T51B 5CR3A 4LF5Q 3ERQA 4EGVA 2JQOA 2F3VA 4U68A 4HMJA 2K33A 2HDMA 4RGNA 3MFGA 1L1OB 2VL6A 1HNZL 5M5YH 2AHOB 1WTPA 1AH9A 2WB1B 4OO1H 1KNAA 1N34L 2Y0SE 1H9SB 3QG1A 1IBKL 2ASBA 5CV8A 5LMNL 1G6PA 3P75A 1X56A 1JJGA 1S40A 4JBJA 1ENAA 2IX1A 1QUQB 2CW0D 3MEHA 4BWGB 1DOKA 1Q90A 4UAIA 2HT1A 1PRTD 5HGTA 1MSHA 1FNWA 3HOZH 1L0WA 1I6VC 1WTVA 4BY1B 1U4MA 5IP9G 2L12A 3S1MH 2MP1A 3DHQA 3TMEA 1WTOA 3LWEA 4NXMQ 1U4LA 3CPFA 2MO1A 2DGYA 1STYA 3MXGA 4KKSA 5K5PA 1TKWB 3J81L 5IGFA 1CT1D 2YTYA 4C3IG 3BU2A 1EWHA 2ZTDA 1JJCB 1TWGB 3S2HH 2PI2A 1XMOQ 4IUQA 4RH6A 4YHHL 1Q46A 1WTHA 1V9PA 2OEOA 2IHEA 1VQFA 5IIFA 4PZ7A 2E75C 3PO2G 2K6AA 1SNPA 3MFYA 3STBC 2G9DA 4KV6A 2XIWA 2ZXOA 1JQYD 3KLSX 1SYEA 4BBRG 1PH7A 1SEBD 5FJ8G 4FDBA 3CCJA 1XNQQ 1YEZA 3KBXA 2K32A 3Q23A 1SFOH 4DR6L 1SE8A 5EKIA 2LY7A 3NPPA 2SNSA 2K5DA 4NW2A 5CC4A 5C3EG 2G9HD 5M5XB 2KVMA 4A3MH 3E6ZX 1SAPA 1QNUA 3RNUA 4A3IH 3F2CA 1HJPA 3SR1A 2CW0C 4NDXA 2WKCA 2VQEL 4RAUC 1ET9A 2B29A 1I5FA 4QY7A 4DGZA 4QUFA 1YJ9A 1IHZA 3K80C 4YCUA 1BUVT 2B3GA 2NVYH 1A63A 4XXEA 1GKHA 4HN7A 1JORA 4GLAC 4A3DB 1ZYRD 1QOHA 3NQIA 3MXUA 2Z1CA 1SE2A 1CTMA 5JEAH 1VQIA 4DR2Q 3CMAA 5KNBA 2I07B 2BDOA 1M4VA 2RA4A 3CCLA 1XNRL 1MSGA 1H9SA 1LT3D 4R4CA 5DLQE 2F0OA 1ML0D 5IT9c 4KHPQ 1H9JA 3A7AB 5GADC 3GQBA 4WJWA 3J7AF 1L0XB 1S3OA 4GNXB 3BS1A 2KBNA 1PH2A 3A5UA 1GXDC 4LFCL 1IYVA 3S1RB 4H7BA 3RD4A 1WD0A 4JI1Q 2PYKA 1G51A 4L5SA 2CHBD 4POGA 1G91A 2AQ2B 1TS3A 1BBUA 1TWGH 3S2HB 2KEDA 4A3BB 1E22A 2QW7A 3HOZG 3I2ZA 2Y0SB 3N6RA 4CBVA 5KIXA 5E3FA 3UI2A 1STAA 3HOVH 3HOYG 3ND8A 2K52A 5DNFA 1IL2A 4B9XA 4HIKA 1Q82C 4TRDA 2BH2A 5KEEA 2RQXA 1BCPC 1I4GA 1STGA 1GHKA 3G7LA 3SE0A 5IYCG 1WVLA 3HFZB 1SJHD 1TS2A 1JE4A 4LFAQ 5C3XA 3PUXA 3UDIA 4FF1A 3I4NB 2F0QA 4P2CB 2NN6G 4XQNA 4A3FB 3E0EA 1RDPD 1D1IA 4C1NI 3IKJA 4C3IH 1UNSA 3RUZA 3M4OB 4LF9L 5EBCA 1GHJA 3E0JA 4DAPA 1HR0L 1T9HA 1X3QA 3A8JE 4ZAIA 1Y14B 3DXJC 3A56A 1UEAB 4UP8A 5C3EB 2ICEC 1EIGA 2Z0SA 3HGBA 1PRTB 2N55A 3W5OA 3CCQA 1V1OA 1J5EL 1QG7A 1IXRA 3TZDA 4A3KH 1KC8C 1JWMD 1VQOA 2NTTA 4A4IA 2JK8A 5LL6S 3PIOA 1IW7D 1I6HB 3S1QB 1WTWA 1SYDA 2C9OA 2NBFA 3OYYA 2OQ0A 1LTRD 3EVQA 2DJGC 1EU4A 3SHLA 4RGOS 3BVGA 4CHTB 2JEAI 2O5IC 1EYGA 1NY4A 1STBA 4PMCA 2Z8LA 5T1GA 1QCBD 1E2VA 3K81C 2RCFA 3JAML 3CQZH 5C44G 5I6WA 3M4OH 2BDNA 4BY7B 2K75A 1GUTA 2UXCL 2K4KA 3CRLC 2OCEA 1BNZA 5C4JB 4K5XA 5E7NA 4E6IA 2A68D 3MEFA 2ZM6Q 1KAWA 3WWVA 4N9TA 3J7A5 1X65A 1B4OA 2F0JA 3FDTA 1V1PA 1HTLD 5IP7G 1O80A 2RVLA 2F0GA 4YCVA 1LTBD 3G6JB 5LHY1 4OWXB 4JI3Q 1K28A 4A93B 4HJ7A 1S5DD 1YNJC 4CJ0B 4IO9A 2A6HD 4R4IA 5JPMC 1PYWD 3CXCA 3FMCA 3VYUA 2UU9L 2JSOA 2DJFC 3H94A 2E76C 4RMFA 4BBRB 4GNXA 4O1NA 5I9PA 3TP5A 2UXDQ 4IQZA 3I4NH 1LTTD 3GV3A 3W1BA 2NVTH 1HXYD 3LNNA 4ALPA 1RF2D 1Z7TA 1E24A 1SNOA 4HTHA 1VQ5A 3W2DA 2F4IA 2ZJRA 1CQVA 3D4WA 1XJVA 1JT8A 3CCSA 3MWYW 3ULJA 3U9SA 4S3SA 3Q6SA 4LF4L 3HOUG 3VR6A 5FLXE 1GUWA 4JPBW 4OIKA 4LUVA 1VQMA 1I50H 4RWSC 3I4OA 3MC0B 3EN2A 2VUMH 1QB5D 2NN6I 4M1UB 2EJFC 4JI4Q 1EQVA 2RHSB 4X6AH 3HOXG 4DV6L 4GZYC 4K14A 3X3MA 2OWOA 4HSVA 2KOLA 5K36H 3RZDB 2HIVA 1A2TA 2JA7B 3GTKH 2F1MA 3NP8A 5E4XA 3I56A 4R4OA 4EQPA 3H09A 2V1CC 2E2HB 1SYFA 3HOXB 3CPWA 4WJ3M 1JMCA 2E5LQ 1NMGA 2HUGA 1I50B 5M3MG 2QEJC 2EYLA 1X9NA 3SK8A 4LF6Q 1QVFA 5EAYA 4O2DA 5J39A 3NBHB 4B3RQ 3OIQA 2YYZA 1M1KC 2MO0A 1B7YB 1E7ZA 3I7FA 4HIDA 1RJTA 2B2WC 4DXFA 3TBIB 3QOLA 1S4ZA 3RLNA 2WAQG 4K6DA 4LF7Q 2EYFA 2LSSA 5BN3A 2IX3A 2VW9A 1Z47A 3CC4A 1SMXA 1LT6D 5D3DA 5NUCA 4X66L 4BBRH 4X64Q 1TWAH 1X32A 3GP7A 1KTKA 4OHJA 2OT2A 4WORA 5C4ZA 1TXYA 3HOYB 4RKLA 3HEJA 4ZRZA 2F0HA 1MHWC 2N88A 3S17B 4ZYSA 3WOFA 5I2YA 3PF4A 1IZ6A 5ELNA 5I4DA 3RN5A 5I6YA 4GKJQ 4HJ5A 3A8KE 1SRUA 2WP8J 1Q8KA 3S2DB 4V0BA 1EZ6A 4ID6A 2F52A 1LABA 4KHZA 1UE6A 1SE4A 5IY0A 4IFDG 1PV4A 1KDAA 4RCNA 1N33L 5CYUA 4KY7A 3ND9A 2H4OA 5H1SE 2OF1A 4DV0L 2JE6I 4K0KL 1TR5A 1VQ4A 2KUMA 2Q2UA 1AW7A 5C4XG 2L55A 4IJHA 5FLXL 4NXNQ 5CV5A 3K8AA 2A6EC 4C56C 4AQYL 5I2XA 1NMFA 1O7IA 1BCPF 4CDFC 2YV5A 2PZTA 4XIGS 3S1MB 1IYJB 4LFBL 1SE3A 1VQDA 1I94L 4HMIA 3PO3G 3I70A 3HP3A 1Y1WB 1PH5A 4IFDJ 3DLLA 1PTOD 4B3SL 1VQNA 1K73C 3T56B 4IUTA 1GUSA 4CKEA 1WTQA 3WOEA 4BY1G 4O0AA 2B2VC 3D3RA 4LAAA 5E1FA 2Q8IB 1Q81C 1SMYC 4OWTB 3I91A 4YY3L 2CCZA 4B3TL 4JVZA 3UE1A 3LGJA 4QF4A 2L15A 2E2IH 4XTCS 1ASYA 4FVMA 1R4QB 4XYQA 4JW0A 4NPSA 4X65L 1KL9A 2I0QA 2X6LA 4R4TA 4C3HH 3RZOB 4A3DH 2O5JC 1A8VA 3F1ZA 3SGIA 1QVCA 4TKOB 2MPMA 4G57A 3K5MA 2Y0SG 2K14A 4KLKA 4DUYQ 2VZAA 2B2TC 2F0UA 2BOSA 1PH1A 4KJOA 1V8QA 1JWSD 3AEVA 4XT1B 4IFDH 1O7YA 1SYBA 2MGSA 1LTAD 1AEXA 2D0PA 2JJQA 2R92H 3S16H 3J81j 3KDFA 4NMZA 1SFOB 3CC2A 2JA8G 4JYAQ 3HOVB 4GKKL 4A3EB 4OEMB 1B70B 3RN2A 5C44H 3IRBA 4HIMA 3T1YL 1Y69U 4BBSH 1X3FA 5EKLA 2SDFA 1RTOA 3KLWA 1WJJA 1DOMA 3CCRA 1TWHB 3GTJB 1K8MA 2KCNA 3LX0A 4WRDA 5AJ3L 4A3GG 3L7ZC 2QA4A 5ELCA 2JN4A 1P8LA 2FINB 2NZ1D 4BA1I 2A69D 4OO1G 4Q0FA 2JA9A 3KF6A 3KF8B 3KJOA 1JCKB 5DEHA 2JA6G 4B3ML 4JI7Q 1BF4A 3D6WA 3E5SA 4JCVE 1VQ7A 3TZUA 2OXPA 2Z4HA 4J8QA 4DUZL 2ID0A 3L3OC 3KJPA 4L6TB 1BQQT 2EQSA 4JI0Q 1HNWQ 3M9BA 3KLSA 2CVRA 5FO9B 1BCPB 2EY2A 3R93A 1XPUA 1EOTA 1QVGA 3NTKA 3FKIB 1D1KA 3UDFA 2PMZE 2B8GA 1PFSA 3NWTA 1EZ8A 5LMUQ 1PH9A 4JI8Q 3KYHC 4F88A 1VMCA 4XQJA 4DV2Q 1PH3A 4HCEA 1F9QA 3RLOA 4DR5L 3FKIG 4IURA 2EIFA 2UUBL 1EIHA 4YWLA 2UXBQ 1HNXL 1F77A 1STNA 4AH6A 3M3YB 5C44B 4ABNA 1YHAA 5M5XH 4A3MB 2B63G 4DR4Q 5ELOA 2ALYB 2CWPA 2GVBA 2NUCA 2V4DA 3CCUA 3JAME 1F9PA 1E1TA 3UDGA 1RD9D 3S16B 2R92B 1HZAA 2RCNA 4GNXC 3VR5A 2OTJA 2B2VA 3SDZA 1SMYD 2EY6A 2J7ZA 4ZQ3A 4H0LC 1SJED 2IX0A 1MJCA 2HQEA 1F2LA 1IBML 1W6JA 3Q24A 2LXKA 2B2UA 4M8AA 2LKVA 3I55A 4DR3Q 3BYYB 1TWHH 3GTJH 1FD7D 5EJWA 4IZ8A 4UP7A 2WKDA 3S1NB 3CU7A 1DYQA 1UE7A 2YTVA 5FKAC 3HKZG 1R9TH 4FF3A 4FF4A 1XYIA 1DGSA 4IOAA 2EYHA 2A19A 1UWVA 1EYAA 1J8IA 2WFWA 2O4XA 3NSWA 2NVXH 5ELFA 4N8FA 3ITPA 1EQTA 1WCMH 4I7ZC 4A93H 3M4YA 4X3SA 3QO2A 2F4VL 3I90A 1KDBA 4CDCC 1EFID 3RMHA 1IBLQ 1EYDA 2FMCA 2K5NA 1X6OA 5FK9C 2JA5B 4JOIA 1EY7A 4K8JA 1AZPA 4B08A 3HOWB 3F2DA 3EFXD 4BXXH 1CI3M 1EY4A 2AMCB 1HTPA 1LYLA 1BXTA 1WTRA 3DUZA 1NCVA 4X3UA 4CJ1B 3IAYA 1CA5A 3GTPB 3S9WA 1XTDA 1QNKA 4JC0A 4X62Q 1YBYA 2JA7H 3CMEA 4OL7A 1N34Q 1K8GA 4IUNA 2WAQE 2YTXA 4BA2I 2ZXPA 1A6XA 3GTOB 1HZCA 5HY6A 3VYTA 3QOJA 3BG3A 5C0XH 4LWCA 3K5LA 1HR0W 1IKMA 3KLRA 1NBWA 1LTGD 3O13A 4P71A 1IKLA 2K7VA 3KDFB 3L9AX 3SK6A 1VQAA 4JI5L 1U4PA 1Y1VH 3GV6A 3CC7A 1LM0A 2M9VA 1UUPA 2RBMA 4OONA 4R4QA 5C0XI 3F8TA 1KXLA 3OW7A 1T5EA 4IPGA 3EROA 3MA2B 4ZCKA 1UE5A 4DV4Q 4FP5D 3KF8A 1QWYA 2L1BA 4A93G 3H3VI 2QILA 1OTCA 2A69C 4DK1A 1X3GA 4DV7L 1XMOL 1CHPD 3BZCA 2GN5A 1FJGQ 4ODGA 4YHHQ 4A3FH 1N36Q 5IYDG 2NWGA 1JOQA 3A5ZB 4DU9A 3D4DA 1WTXA 5C6AA 1EQQA 1VQKA 4A3JG 1RODA 2R3ZA 4GN5A 2K01A 4PMBA 1U0LA 1PTOH 1XXGA 5J22A 1VS0A 1Q3LA 3Q8DA 1L1OC 4A3GB 4HEDA 4DNTB 1CFMA 4DV5L 2M2LA 4JBMA 2B63H 4QQBX 4IJLA 1GD7A 1XMQL 1FNUA 1WCMB 2NYZD 3Q0AA 2B2WA 2VS1A 1X54A 4DV3Q 2VB2X 1SNQA 2DNEA 4JG2A 1MBYA 3RZDH 5IYBH 1S72A 3QWNA 1B2TA 2AWNA 4C2MB 1VF7A 3K7AH 2HDLA 1VCIA 1B9MA 2N3SA 1BVSA 3V05A 3CKIB 2VUMB 2K03A 2PZWA 1SBBB 1Y1VB 4FXDA 1O7LA 3KUPA 1RHPA 1RTNA 3T1HL 4DV1Q 4OX9L 3J80E 4QB4A 1M90C 2JP1A 1RL2A 1S5BD 4DR7L 1HA6A 5BR8Q 5IP7H 1MGSA 3VA7A 2JYOA 1QZHA 3GTOH 1ESFA 4YWKA 4KN7C 3DWPA 1XX8A 2XTIA 5ISRA 1PMRA 2JA6H 2YU9B 3NXWA 4WFN3 2QF7A 3NELA 4IPDA 2NVXB 1H9KA 2K5VA 4ULLA 4N8X1 2C5CA 4DAMA 5M3MB 4JV5L 5BN4A 4LFCQ 3H91A 4CKBA 2LFNA 3J81E 3BVZA 3E3XA 4IFDI 2J0TD 2N78A 4JI1L 1GM5A 2X6GA 3I4MG 3NWSA 3GD7A 5EKKA 5TSSA 3V96A 3BJUA 2VQFL 4BY7G 4Y7NH 5M3FH 1YITA 1P16A 1AZQA 1ZXTA 4GN3B 1TY0A 2DY7A 2Q2TA 2KQ3A 4L5QA 3I3CA 1IL8A 1CKMA 1X3PA 1HFGA 3K5OA 4C3JH 1RKNA 2JXMB 2VNUD 2A74C 4A3IB 2HHHQ 1GOZA 3QB3A 2VB3X 2ENBA 2K04A 3SK4A 5FOBB 1VQPA 1TT2A 1WD1A 1U5KA 1JE5A 2BH8A 2KCMA 3MXNA 1SROA 3X3NA 1K83B 3Q22A 3D31A 4FNFA 1D5ZC 3V2TA 1G6ZA 1G2SA 1R9TB 3AYHB 1T5XD 3WDNA 1YJWA 2FJ2A 5EGTA 4ZKCB 3R3OA 4ME3A 3T13A 2PQAB 3M4QA 4IUVA 5DM63 3K5NA 4IPHA 3K7UC 2B8FA 1I4HA 2A5HA 2ICIA 1AFPA 1C0AA 3DEOA 4DA2A 5IWAL 1VQ8A 2GVAA 1VQ6A 4OXPA 1A62A 5ELDA 1I3QB 5CGKA 1XPOA 4FXGC 5FO7B 2H5XA 3L0OA 2A68C 4NB3A 3OMGA 5KGUA 4LF8L 1PRTF 5J3BA 2FHTA 1X3EA 1UEBA 3M3YH 3TP7A 5M5WB 3OW2A 1AN8A 3C1EA 5E4WC 4MTKA 5CV7A 5M3FG 1J5EQ 4FXKC 4A3LH 2WV6D 2MNAA 4R9WA 1E0BA 1LACA 3NK9A 1A3TA 2Q2IA 1K3BC 1I4PA 5FJ8H 2AQ3B 1BCPD 2EY5A 3TSSA 2E2DC 2K5WA 4FO2A 4WJ4A 2EE1A 1FNVA 5GQOA 5D3IB 2NTSA 4YWMA 1CKNA 2AUKA 2JA7G 4P75A 3K0YA 1A2UA 5IGGA 1BBWA 3FPPA 4JI6L 3JC66 1XNQL 2R92G 2PW5A 3VR2A 1VQ9A 3FHWA 4DR6Q 5FO8B 5JJZA 3MAQA 2UUAQ 1NR4A 4A3EH 3HRZC 2EJGC 1WI5A 1EL0A 4LF5L 2NB0A 3TQYA 1W6KA 3BDCA 4A3JH 4RFBA 2ES2A 3F2UA 3S15B 5GAGC 2ZM6L 3FRPB 1HNZQ 1MKHA 2EOTA 5CMDA 1C48A 4JI2L 4Z9CB 1SYCA 2R93B 1PH6A 3BVMA 2EYOA 3FEWX 5GAHC 3ULLA 3S14H 4PZ8A 1IBKQ 4UY8C 3G71A 4QIWE 5C5MA 5EPJA 3AMUA 3A55A 3J81i 4J6HA 3RZOH 3K7AB 5IGCA 4FF2A 1XNRQ 1EOVA 1Z9FA 3C46A 1PYBA 3I4NG 3J81c 4V190 2F0LA 2FXQA 1G8ZD 5DAUA 5GROA 3PQIA 3HOVG 3PIPA 1Y8PB 3NEMA 3PV0A 2KCCA 2NZOA 5IT9E 4RHSA 3T53B 4LNQA 2F0PA 1RCVD 2O2LD 2R7ZG 4DK0A 4RCOA 2M00A 1F2ZA 4F7XA 3EA6A 5I9OA 3IFDA 4ZUJA 4K8IA 2QDBA 3S2DH 3J7AV 3D4RA 5ELEA 1UAPA 3OSOA 5CV9A 1A3UA 4IN3A 4AYBG 1F2MA 3HOWH 4H13C 1BR9A 2RF4A 3CHBD 2XWBB 4ME5A 2PW7A 2R6GA 1M8AA 4P73A 5IODA 2TMPA 2E2IB 1ICFB 2XRSD 1SR3A 4MN3A 3ER0A 1CM9A 3PF5A 4XT3B 4K2LA 4K6LA 4IOCA 1EIYB 3CAMA 3RLFA 3NE5B 2L0CA 1X55A 2K5QA 2KHJA 5CORA 3HOUH 1NUCA 1S5CD 1GUNA 1HUNA 4CGYB 4MZ9A 1PFBA 3MXPA 3MTSA 4CKCA 4CDDC 1PZID 1DXMA 2WAQB 2BE5C 1N32L 1PRTC 2D62A 2F0WA 2LS01 2UUCQ 1YNJD 4GLVB 1JB7A 3S14B 4MTNA 5EPKA 2VQEQ 1KIXA 1TWFB 4UPAA 2N49A 4GOPB 3UDXA 3A54A 4X66Q 1SXTA 4L63B 4J1MA 3OTOQ 3U4VA 4A3JB 1VDZA 1AP0A 3PIO3 3HOYH 1ILPA 1Y8OB 1TU2B 4H02A 4G7ZC 1CA6A 5LL6X 4RGMA 2A8VA 1L2FA 1QUQA 4A3IG 3GTLB 2VXWA 1K3RA 4KD3A 4AIMA 4JBWA 1EEFD 4XDXA 3ULPA 1Q12A 4L8JA 1CZWA 3MXNB 1KQSA 4Y52H 4A3FG 4EVOA 2F3IA 5EPLA 4QGUA 3J7ZC 4IALA 1VQHA 4A75A 3GTQH 1EY6A 4DR1Q 1SNMA 5K36G 1TS5A 4GOPC 4PMWA 2EPBA 3A0JA 5HGQA 3T16A 2GA4B 3HOXH 1TWCB 3NHHA 2KENA 1HCZA 1TWAB 2L11A 3D8GA 3RR5A 5M5WH 2VUMG 3GTMB 4EQOA 1B3AA 4DKAC 4H44C 3GTGB 2SOBA 2AQ1B 1ET6A 4LUZA 1B3QA 1CSQA 3H0GB 1KLUD 5C0XG 4KMUC 3K59A 4OWWB 5M5YB 2PI2E 2YU9H 3HKSA 1YHQA 1OXVA 2Q2HA 1I3QH 4HJ8A 1NNXA 3ONAB 2Z6BA 4A3DG 4ZLTF 2EVBA 3VR3A 5IGBA 5LMNQ 3OWFA 4IUUA 1E2WA 1EY0A 5IP9H 1PA6A 3K57A 2EJMA 4I65A 4R8IA 4BXXG 3TRZA 1F9RA 4DN4M 1NJIC 4BBSB 2CFMA 5KRUA 4A3LG 1LT5D 4P74A 4DK3C 1PDQA 1YIJA 3HKZE 2UXDL 4LUOA 4NXML 1NAPA 1MIUA 3PUVA 1OXSC 2B2TA 1U9RA 4LF9Q 3K6OA 4G7OC 1HR0Q 4PZ6A 2E8GA 3TN2A 1YJNA 1PHJA 2JA8H 3GDEA 1ICWA 2I5HA 4KY6A 1PXUA 5DM73 3J80i 2F0FA 4DUYL 1GVPA 2AKWB 2B63B 1EQRA 3S24A 1CHQD 2ZTEA 2C35B 4PG3A 1Q1EA 3OOCA 4DV6Q 3C3LA 3PMFA 5C4XH 2F03A 3H0GH 1Q86C 1NTGA 2IT1A 2Z6KC 3A8IE 3GTGH 3BDOA 3CW2C 1ENCA 2K50A 2R61A 3PIP3 5C4HA 1A3VA 5A2QE 5C3EH 2MUYA 3G48A 4EQNA 3IL8A 2F0VA 4BS9A 1H9RA 4LF6L 4G4KA 1H9MA 1V1PB 5IYBG 2E2JB 2SEBD 4YCWA 5BN5A 4A3KG 1HUMA 5C4XB 2J4XA 1YVCA 2B39A 1FGBD 4OELB 1OXXK 1VQLA 1HFNA 2H1EA 4OO1I 2UXCQ 5JJKA 4DXGA 4LF7L 1ASZA 3PO3B 3P7JA 2CH4A 2JA5G 5C3WA 1NSNS 1LTLA 2LMCB 4KKUA 4A3KB 1EY5A 1HZ9A 3AFQA 5EBDA 3GTLH 2SNMA 2I46A 1VQCA 2Z6KA 3BYTB 3QR8A 4TSSA 3D6CA 1PFMA 3W3AA 2F0MA 3J80c 2XRQD 5JJIA 1LO5D 1JJ2A 4DPGA 3I4MH 2I5LX 2Z9HA 3M7NA 2KECA 3ERSX 2NN6H 4UHVA 1HNWL 3OIPA 4JI3L 3PGZA 4DR2L 2Z4IA 1EYCA 1HRJA 1JWUD 2NZHA 1F2YA 4P72A 1KHIA 1CZGA 4C3HG 2UU9Q 3ZYYX 1CSPA 1EEID 1XTCD 4N9PA 1VMPA 2WINB 3I8ZA 2XN9C 1PLFA 1VF5C 4IPCA 1CUKA 4KHPL 2F0IA 2CH4W 2UUBQ 1L1OA 4A3MG 5CBAE 1I4XA 2KEEA 4QMGA 3NBHA 4DV0Q 5KYIA 1L0YB 3DEPA 3STBD 4OIJA 2A6ED 4LF4Q 1H95A 1GO3E 3C2PA 4KI0A 5IE8A 3CP0A 1QZGA 4AQYQ 1U4RA 4KD4A 5HURA 2EYMA 2IW3A 4XYOA 4JI4L 2PNHA 3I4LA 4LFBQ 2NVQB 1EUJA 5F2DA 5JOBA 3TDQA 3PO2B 4A3BH 4KY5A 2TSSA 1G2TA 3K0XA 3GTQB 1ZKOA 1QE6A 3NQTA 4DK6C 4NP5A 3NBIA 2E5LL 4NKLA 3HKZB 3I72A 2VY3A 3T4AC 2PMZB 1KAAA 4LFAL 1DJRD 3EQLC 1E2ZA 1B1ZA 1F9SA 1NR2A 4AYBE 5CV4A 2A6HC 2JEBI 4PV1C 3SVMA 2ATWA 4K5VA 2IPKD 2RDGA 1GJXA 3C1FA 4QUCA 4QIWB 2F4VQ 2F0DA 3K58A 1MJEA 1PFNA 2D9UA 5IGDA 1KRTA 4G7HC 1WCMG 3QIAA 2F0TA 2QKIC 1CQFA 2KJXA 5D14A 3G4SA 1D2BA 2L5TA 1BO0A 5A35A 1O7ZA 3TREA 4XQQA 1K0SA 3A74A 3DM3A 1II3A 1JOKA 1EU3A 4DFAA 5KNDA 3QJYA 3LWUA 4X62L 3S15H 1JB3A 1V1QA 4CJ2C 2XGTA 4KJNA 1QILA 2WIIB 2FMMA 3E9IA 3TS2A 2I5MX 4JYAL 4GKKQ 4F87A 4A3CG 3H15A 1Y1VG 3SK5A 1MD2D 3AFPA 1SSOA 3T1YQ 2CQAA 4JI5Q 1B9NA 5JVH3 4LMQD 2DUDA 4GLXA 2XWJB 5EQ0A 4NXNL 3HG9A 3A7LA 4Q5VA 4B3MQ 4JI7L 2QGQA 2DNCA 1FVIA 1XPRA 3OHXC 1EFWA 2XVSA 2EDGA 2K1BA 3VYSA 1A15A 4DNIA 3FKIH 5COYA 5LMNW 1KRSA 3MVVA 1SDFA 4MHEA 2CWAA 1FL0A 4HAEA 4DV7Q 4B3SQ 3AU7A 2MQHA 1K8AC 3BZDB 3MZ5A 4EX5A 4UDUC 1C9OA 4DAYB 5JEAG 3CCVA 2KA7A 1PZJD 1S5FD 4HCSA 5C0XJ 2F0SA 5M9OA 4YY3Q 4B3TQ 3CF5A 4POFA 3U58A 4UP9A 1D8LA 1EY8A 3ICEA 4RGTA 1LLRD 5LMUL 1DONA 2EXDA 4DV2L 3SEBA 4DR5Q 1YZ6A 4X65Q 2UXBL 1HNXQ 2L4NA 4MIUA 1A0IA 1AE3A 4QJFA 3F2BA 3CCMA 2XNAC 2PNRC 4O42A 1ZEQX 1OO9B 2R93H 2NVQH 2IHFA 3PUWA 2EYPA 1K83H 3H0GG 5M3MH 2N8NA 1E1OA 5IYDH 2ZT9C 4RKBA 2QCPX 2F3WA 4JK1C 3CRKC 3BZKA 3HOUB 2K5HA 1D6EC 3H6MA 1O78A 4YIJA 3BDLA 3VA5A 1WFQA 3H3VH 4KHVA 1ONLA 4A76A 2X69A 2PPBC 5A2QL 2PQAA 4DNRB 2HIXA 2LXJA 3SXHA 1W2BA 4Y7NB 5M3FB 3M4PA 2PCFB 1B8AA 3N52A 5FLMG 5FLXc 2EXZA 3KK7A 4AYBB 4DF7A 5BR8L 4X3TA 4C1NK 1FGUA 2IY5B 4B3RL 4C3HB 4R1JA 1PVOA 1DZ1A 2PZUA 5C4JH 3KBGA 5AJ3Q 4RG1A 3DMUA 3J7YW 1B50A 3VYRA 4I7AA 4OGQC 5FLMH 4RHRA 1YNXA 1DOLA 3OWEB 1TVXA 3TS0A 2DY8A 3I4MB 2RHQB 1J6QA 4HSPA 1KD1C 4DUZQ 4L5TA 4X64L 3D0FA 1VQGA 2B2YC 2VQFQ 1D5XC 1K8OA 1C4QA 4EQ5A 2E74C 3FPUB 1STEA 1Y1WH 3NENA 4JI0L 4FYDA 2R7ZH 4A3GH 3DWAA 2HHHL 3S1RH 3MHBA 2ZJQA 4GKJL 1Q7YC 1MI2A 3E9HA 1KNEA 2E2JH 3FP9A 5IOCA 3R8BA 1BKBA 2FFKB 4J15A 4KK7A 5JEAJ 1KDCA 2AUJD 1W3SA 1NE3A 2F0KA 3G6EA 1N33Q 1EIFA 3W1GA 1AE2A 1CKOA 3PUYA 4K0KQ 1JICA 4PQXA 2BCOA 1TY2A 4IUPA 5IWAQ 4HJAA 1YI2A 1PTOB 3ZJYC 5KYLA 1TQOA 1ILQA 2NVYB 1YHBA 4DV4L 1VQBA 2ZJPA 1PH8A 2Q8RE 1JOOA 1EWCA 2MJ8A 3S17H 1IBMQ 2RSNA 1I4RA 1Y1WG 2L9HA 1I94Q 1YNND 5T1IA 2XSCA 4GN4B 2F0NA 2HCIA 3P20A 5IGEA 1IYUA 4F8MA 3EIVA 5D65A 3U9OA 1V43A 3R2TA 1OXUA 1N36L 3PSIA 3TP6A 1SNDA 2ZXRA 1J9OA 2CKZB 2G5DA 4GOPA 2Q8TA 1WYDA 1LT4D 2F0EA 2KHIA 3GTKB 2WACA 4DAYA 3J80L 2K28A 1VQEA 4PNYA 3EJIA 3KOJA 3PO3H 1N9WA 2D0OA 1EY9A 4DV5Q
chains in the Genus database with same CATH topology
1SYGA 4ZUIA 1Q8IA 1BOSA 1LTSD 2PQEA 1Q1BA 4DAVA 1B44D 1R4PB 3AB9A 2EY1A 5G3LD 1LTID 2KHSA 1TS4A 1BBXC 2NVTB 3H3VC 2D5DA 5C5LA 1ZYRC 3FVQA 1HQMC 2EZVA 2DN8A 1Z6HA 1Y8NB 1BDOA 2BE5D 2D2CC 3URYA 1OXTA 4C3JB 1HPCA 1JC7A 4QCLA 5ELBA 3HS0C 1KABA 4U673 1ENFA 1I4QA 2BA0A 4K5WA 4RA8A 5CBEE 4C3JG 4ZKBB 2RSOA 5JAVA 1SNCA 3NTIA 1CK1A 2RDHA 1D5MC 2A73B 3I73A 2JA6B 5IT9L 2IWHA 1DCZA 1G291 3NTHA 4LJZC 3HZXA 1DM0B 1GUOA 1LV9A 4LK1C 3OMCA 1C8CA 1TIID 4X3KA 5JPNC 4KTAA 1YNNC 5JVG3 2IL8A 1DD2A 3NUCA 1XWEA 4TQUS 5J1ZA 2RKSA 3R2IA 3IFTA 1GUGA 1IW7C 3GO5A 5KNCA 3TP8A 1HQRD 2IJ0A 1JR0D 2B2YA 4KKTA 1PTOC 3OPOA 1HHVA 4B9WA 3P1HA 4C3IB 3VR4A 3HOZB 3DWQA 1FYCA 5G3LF 2B2UC 2PO4A 1PZKD 1QJOA 1FR3A 1STHA 1PTOF 3DM1A 4K2KA 2BA1A 3CQZB 3M7GA 3PUZA 3M85A 2JA8B 1KLGD 2HCCA 2K05A 4R8NA 5CV6A 5AFWA 4HR7B 2MHVA 2R7ZB 1ESRA 1S5ED 1B53A 1HA5A 2RDFA 2AWOA 4KN4C 4ZK9B 4ILWA 2EYJA 3T51B 5CR3A 3ERQA 4EGVA 2F3VA 4U68A 4HMJA 2K33A 2HDMA 4RGNA 3MFGA 1WTPA 2WB1B 4OO1H 1KNAA 1H9SB 3QG1A 5CV8A 3P75A 1ENAA 2IX1A 2CW0D 3MEHA 4BWGB 1DOKA 1Q90A 4UAIA 1PRTD 5HGTA 1MSHA 1FNWA 1I6VC 1WTVA 4BY1B 1U4MA 2L12A 2MP1A 3DHQA 3TMEA 1WTOA 3LWEA 1U4LA 1STYA 3MXGA 4KKSA 5K5PA 1TKWB 3J81L 5IGFA 1CT1D 4C3IG 1EWHA 1TWGB 4IUQA 4RH6A 2OEOA 5IIFA 2E75C 2K6AA 1SNPA 3MFYA 2G9DA 4KV6A 2XIWA 2ZXOA 1JQYD 3KLSX 1SYEA 1SEBD 3KBXA 2K32A 3Q23A 5EKIA 2LY7A 3NPPA 2SNSA 2K5DA 4NW2A 5CC4A 2G9HD 5M5XB 2KVMA 3E6ZX 1SAPA 1QNUA 3SR1A 2CW0C 4NDXA 2WKCA 4RAUC 1ET9A 4QUFA 4DGZA 1IHZA 1BUVT 4XXEA 4HN7A 1JORA 4A3DB 1ZYRD 1QOHA 3NQIA 3MXUA 2Z1CA 1SE2A 1CTMA 5JEAH 5KNBA 2I07B 2BDOA 1M4VA 2RA4A 1MSGA 1H9SA 1LT3D 2F0OA 1ML0D 1H9JA 3A7AB 3J7AF 3GQBA 4WJWA 1L0XB 3BS1A 1GXDC 1IYVA 3S1RB 4H7BA 3RD4A 1WD0A 2PYKA 2CHBD 1G91A 2AQ2B 1TS3A 3S2HB 2KEDA 4A3BB 3N6RA 2Y0SB 4CBVA 5KIXA 5E3FA 3UI2A 1STAA 3ND8A 5DNFA 4B9XA 4TRDA 5KEEA 2RQXA 1BCPC 1I4GA 1STGA 1GHKA 3G7LA 3SE0A 1WVLA 1SJHD 1TS2A 1JE4A 5C3XA 3PUXA 4FF1A 3I4NB 2F0QA 4P2CB 2NN6G 4XQNA 4A3FB 1RDPD 1D1IA 4C1NI 3IKJA 1UNSA 3RUZA 3M4OB 5EBCA 1GHJA 3E0JA 4DAPA 1X3QA 3A8JE 4ZAIA 3DXJC 3A56A 1UEAB 5C3EB 2ICEC 1EIGA 3HGBA 1PRTB 2N55A 1V1OA 1QG7A 3TZDA 1JWMD 2NTTA 5LL6S 1IW7D 1I6HB 3S1QB 1WTWA 1SYDA 2C9OA 2NBFA 1LTRD 3EVQA 1EU4A 3SHLA 4RGOS 4CHTB 3BVGA 2JEAI 2O5IC 1STBA 4PMCA 2Z8LA 5T1GA 1QCBD 1E2VA 3JAML 5I6WA 2BDNA 4BY7B 1GUTA 3CRLC 1BNZA 5C4JB 4K5XA 4E6IA 2A68D 4N9TA 1B4OA 2F0JA 3FDTA 1V1PA 1HTLD 1O80A 2RVLA 2F0GA 1LTBD 3G6JB 5LHY1 4A93B 1S5DD 1YNJC 4CJ0B 2A6HD 5JPMC 1PYWD 3FMCA 3VYUA 2JSOA 3H94A 2E76C 4BBRB 4O1NA 5I9PA 3TP5A 4IQZA 1LTTD 3GV3A 1HXYD 3LNNA 1RF2D 1Z7TA 1SNOA 4HTHA 3W2DA 2F4IA 1CQVA 3D4WA 3MWYW 3U9SA 4S3SA 3Q6SA 3VR6A 5FLXE 1GUWA 4OIKA 4RWSC 3MC0B 1QB5D 2NN6I 4M1UB 2EJFC 1EQVA 4GZYC 4K14A 3X3MA 4HSVA 2KOLA 5K36H 3RZDB 1A2TA 2JA7B 2F1MA 3NP8A 5E4XA 4EQPA 3H09A 2E2HB 1SYFA 3HOXB 2HUGA 1I50B 2QEJC 2EYLA 3SK8A 5J39A 3OIQA 2YYZA 1RJTA 2B2WC 4DXFA 3TBIB 3QOLA 1S4ZA 4K6DA 2EYFA 5BN3A 2IX3A 1Z47A 1LT6D 5D3DA 5NUCA 1X32A 3GP7A 1KTKA 4OHJA 2OT2A 4WORA 5C4ZA 3HOYB 4RKLA 3HEJA 4ZRZA 2F0HA 2N88A 3S17B 4ZYSA 3WOFA 5I2YA 5I4DA 5I6YA 3A8KE 2WP8J 3S2DB 4V0BA 1EZ6A 4ID6A 4KHZA 1LABA 1SE4A 4IFDG 1KDAA 4RCNA 5CYUA 4KY7A 3ND9A 2H4OA 2OF1A 2JE6I 1TR5A 2KUMA 1AW7A 2L55A 5FLXL 5CV5A 2A6EC 4C56C 5I2XA 1BCPF 2PZTA 4XIGS 3S1MB 1SE3A 4HMIA 3I70A 3HP3A 1Y1WB 4IFDJ 1PTOD 3T56B 4IUTA 1GUSA 4CKEA 1WTQA 3WOEA 2B2VC 3D3RA 4LAAA 5E1FA 2Q8IB 1SMYC 3I91A 4QF4A 4XTCS 4FVMA 1R4QB 4XYQA 2X6LA 3RZOB 2O5JC 4TKOB 2MPMA 4G57A 3K5MA 2B2TC 2F0UA 2BOSA 4KJOA 1V8QA 1JWSD 4XT1B 4IFDH 1O7YA 1SYBA 2MGSA 1LTAD 1AEXA 4NMZA 1SFOB 3HOVB 4A3EB 1Y69U 5EKLA 2SDFA 1RTOA 1DOMA 1TWHB 3GTJB 1K8MA 2KCNA 3LX0A 4WRDA 3L7ZC 5ELCA 2FINB 2NZ1D 4BA1I 2A69D 4OO1G 4Q0FA 1JCKB 5DEHA 1BF4A 3D6WA 3E5SA 3TZUA 2OXPA 2Z4HA 4J8QA 2ID0A 3L3OC 4L6TB 1BQQT 3KLSA 2CVRA 5FO9B 1BCPB 2EY2A 3R93A 1EOTA 3NTKA 3FKIB 1D1KA 2B8GA 3NWTA 1EZ8A 4F88A 1VMCA 4XQJA 4HCEA 1F9QA 4IURA 1EIHA 1F77A 1STNA 3M3YB 5C44B 4ABNA 4A3MB 2NUCA 2V4DA 3JAME 1F9PA 1RD9D 3S16B 2R92B 3VR5A 2B2VA 3SDZA 1SMYD 2EY6A 2J7ZA 4ZQ3A 4H0LC 1SJED 2IX0A 2HQEA 1F2LA 1W6JA 3Q24A 2B2UA 4M8AA 2LKVA 3BYYB 1FD7D 5EJWA 4IZ8A 2WKDA 3S1NB 3CU7A 1DYQA 5FKAC 4FF3A 4FF4A 1XYIA 2EYHA 1EYAA 1J8IA 3NSWA 2O4XA 5ELFA 3ITPA 1EQTA 4I7ZC 3M4YA 4X3SA 3QO2A 3I90A 1KDBA 1EFID 3RMHA 1EYDA 2FMCA 5FK9C 2JA5B 1EY7A 4K8JA 1AZPA 4B08A 3HOWB 3EFXD 1CI3M 1EY4A 1HTPA 1BXTA 1WTRA 3DUZA 1NCVA 4X3UA 4CJ1B 3IAYA 1CA5A 3GTPB 3S9WA 1QNKA 4OL7A 4IUNA 4BA2I 2ZXPA 1A6XA 3GTOB 3VYTA 3QOJA 3BG3A 5C0XH 3K5LA 1IKMA 3KLRA 3O13A 1LTGD 1IKLA 2K7VA 3L9AX 3SK6A 1U4PA 3GV6A 2M9VA 1UUPA 2RBMA 5C0XI 3OW7A 1T5EA 3EROA 3MA2B 4FP5D 3KF8A 1QWYA 2L1BA 2QILA 2A69C 4DK1A 1CHPD 4ODGA 2NWGA 1JOQA 4DU9A 3D4DA 1WTXA 5C6AA 1RODA 2R3ZA 2K01A 4PMBA 1PTOH 1XXGA 5J22A 1Q3LA 4A3GB 4HEDA 4DNTB 1CFMA 2M2LA 1FNUA 1WCMB 2NYZD 3Q0AA 2B2WA 2VB2X 1SNQA 2DNEA 1MBYA 3QWNA 1B2TA 2AWNA 4C2MB 1VF7A 2HDLA 1VCIA 1B9MA 3V05A 3CKIB 2VUMB 2K03A 2PZWA 1SBBB 1Y1VB 4FXDA 1O7LA 3KUPA 1RHPA 1RTNA 3J80E 4QB4A 2JP1A 1S5BD 1HA6A 3VA7A 1MGSA 2JYOA 1ESFA 4KN7C 3DWPA 1XX8A 5ISRA 1PMRA 2YU9B 3NXWA 4WFN3 2QF7A 2NVXB 1H9KA 4ULLA 2C5CA 5M3MB 5BN4A 3H91A 4CKBA 2LFNA 3J81E 3BVZA 4IFDI 2J0TD 2X6GA 3NWSA 3GD7A 5EKKA 5TSSA 3V96A 1AZQA 1ZXTA 1TY0A 2DY7A 2KQ3A 3I3CA 1IL8A 3K5OA 1X3PA 1HFGA 1RKNA 2JXMB 2VNUD 2A74C 4A3IB 1GOZA 3QB3A 2VB3X 2ENBA 2K04A 3SK4A 5FOBB 1TT2A 1WD1A 3MXNA 3X3NA 1K83B 3Q22A 3D31A 4FNFA 1D5ZC 3V2TA 1G6ZA 1G2SA 1R9TB 1T5XD 3WDNA 2FJ2A 5EGTA 4ZKCB 3R3OA 3T13A 4IUVA 5DM63 3K5NA 2B8FA 1I4HA 2A5HA 2ICIA 1AFPA 3DEOA 4DA2A 5ELDA 1I3QB 5CGKA 4FXGC 5FO7B 2A68C 3OMGA 5KGUA 1PRTF 2FHTA 3TP7A 5M5WB 1AN8A 3C1EA 5E4WC 5CV7A 4FXKC 2WV6D 4R9WA 1E0BA 1LACA 3NK9A 1A3TA 1I4PA 2AQ3B 1BCPD 2EY5A 3TSSA 2E2DC 2K5WA 4FO2A 2EE1A 1FNVA 5D3IB 2NTSA 2AUKA 3K0YA 1A2UA 5IGGA 3FPPA 2PW5A 3VR2A 5FO8B 5JJZA 3MAQA 1NR4A 3HRZC 2EJGC 1EL0A 2NB0A 1W6KA 3BDCA 4RFBA 3F2UA 3S15B 3FRPB 2EOTA 5CMDA 1C48A 4Z9CB 1SYCA 2R93B 3BVMA 2EYOA 3FEWX 5C5MA 5EPJA 3AMUA 3A55A 4J6HA 3K7AB 5IGCA 4FF2A 3C46A 4V190 2F0LA 1G8ZD 5DAUA 1Y8PB 3PV0A 2KCCA 5IT9E 4RHSA 3T53B 2F0PA 1RCVD 2O2LD 4DK0A 4RCOA 2M00A 1F2ZA 4F7XA 3EA6A 5I9OA 3IFDA 4ZUJA 4K8IA 2QDBA 3J7AV 3D4RA 5ELEA 1UAPA 3OSOA 5CV9A 1A3UA 4IN3A 1F2MA 4H13C 1BR9A 3CHBD 2XWBB 4ME5A 2PW7A 2R6GA 1M8AA 5IODA 2TMPA 2E2IB 2XRSD 4MN3A 1CM9A 4XT3B 4K2LA 4K6LA 3RLFA 3NE5B 2L0CA 2K5QA 5CORA 1NUCA 1S5CD 1GUNA 1HUNA 4CGYB 1PFBA 3MXPA 3MTSA 4CKCA 1PZID 1DXMA 2WAQB 2BE5C 1PRTC 2D62A 2F0WA 2LS01 1YNJD 3S14B 5EPKA 1TWFB 3A54A 1SXTA 4L63B 4J1MA 4A3JB 1VDZA 1AP0A 3PIO3 1ILPA 1Y8OB 1TU2B 4G7ZC 1CA6A 5LL6X 4RGMA 3GTLB 2VXWA 4KD3A 4JBWA 1EEFD 4XDXA 1Q12A 4L8JA 1CZWA 4EVOA 5EPLA 4IALA 1EY6A 1SNMA 5K36G 1TS5A 4PMWA 2EPBA 3T16A 2GA4B 1TWCB 3NHHA 1HCZA 1TWAB 2L11A 3D8GA 3GTMB 4EQOA 1B3AA 4H44C 3GTGB 2SOBA 2AQ1B 1ET6A 3H0GB 1KLUD 5C0XG 4KMUC 3K59A 5M5YB 1OXVA 3ONAB 4ZLTF 2EVBA 3VR3A 5IGBA 3OWFA 4IUUA 1E2WA 1EY0A 3K57A 2EJMA 4I65A 4R8IA 1F9RA 4DN4M 4BBSB 5KRUA 1LT5D 1PDQA 1NAPA 3PUVA 1OXSC 2B2TA 1U9RA 3K6OA 4G7OC 3TN2A 1ICWA 4KY6A 1PXUA 5DM73 2F0FA 2B63B 1CHQD 1Q1EA 3OOCA 3C3LA 3PMFA 2F03A 2IT1A 3A8IE 3BDOA 1ENCA 2R61A 3PIP3 5C4HA 1A3VA 5A2QE 2MUYA 4EQNA 3IL8A 2F0VA 4BS9A 1H9RA 4G4KA 1H9MA 1V1PB 2E2JB 2SEBD 5BN5A 1HUMA 5C4XB 2J4XA 2B39A 1FGBD 1OXXK 1HFNA 2H1EA 4OO1I 4DXGA 3PO3B 3P7JA 5C3WA 1NSNS 2LMCB 4KKUA 4A3KB 1EY5A 5EBDA 2SNMA 2I46A 3BYTB 4TSSA 3D6CA 1PFMA 3W3AA 2F0MA 2XRQD 1LO5D 3M7NA 2KECA 2NN6H 3OIPA 2Z4IA 1EYCA 1HRJA 1JWUD 1F2YA 1CZGA 4C3HG 3ZYYX 1EEID 1XTCD 4N9PA 1VMPA 2WINB 3I8ZA 2XN9C 1PLFA 1VF5C 2F0IA 5CBAE 1I4XA 2KEEA 4QMGA 3NBHA 5KYIA 1L0YB 3DEPA 4OIJA 2A6ED 3C2PA 4KI0A 1U4RA 4KD4A 5HURA 2EYMA 2IW3A 4XYOA 3I4LA 2NVQB 5F2DA 5JOBA 3TDQA 3PO2B 4KY5A 2TSSA 1G2TA 3GTQB 1ZKOA 1QE6A 3NQTA 4NP5A 3NBIA 4NKLA 3HKZB 3I72A 3T4AC 2PMZB 1KAAA 1DJRD 3EQLC 1E2ZA 1B1ZA 1F9SA 1NR2A 5CV4A 2A6HC 2JEBI 4PV1C 3SVMA 4K5VA 2IPKD 2RDGA 1GJXA 3C1FA 4QUCA 4QIWB 2F0DA 3K58A 1PFNA 2D9UA 5IGDA 4G7HC 3QIAA 2F0TA 2QKIC 1CQFA 2KJXA 5D14A 1D2BA 2L5TA 1BO0A 5A35A 1O7ZA 4XQQA 1II3A 1JOKA 1EU3A 4DFAA 5KNDA 3QJYA 3LWUA 1JB3A 4CJ2C 4KJNA 1QILA 2WIIB 2FMMA 4F87A 3SK5A 1MD2D 1SSOA 2CQAA 1B9NA 5JVH3 4LMQD 2XWJB 5EQ0A 3HG9A 3A7LA 4Q5VA 2DNCA 3OHXC 2XVSA 2EDGA 2K1BA 3VYSA 1A15A 5COYA 3MVVA 1SDFA 4MHEA 4HAEA 3AU7A 3BZDB 3MZ5A 4UDUC 5JEAG 2KA7A 1PZJD 1S5FD 4HCSA 5C0XJ 2F0SA 5M9OA 1EY8A 4RGTA 1LLRD 1DONA 3SEBA 2L4NA 4MIUA 2XNAC 2PNRC 4O42A 1ZEQX 1OO9B 2EYPA 3PUWA 2ZT9C 4RKBA 2QCPX 2F3WA 4JK1C 3CRKC 3HOUB 1D6EC 3H6MA 1O78A 4YIJA 3BDLA 3VA5A 4KHVA 1ONLA 2X69A 2PPBC 5A2QL 4DNRB 3SXHA 4Y7NB 5M3FB 2PCFB 3N52A 2EXZA 3KK7A 4AYBB 4DF7A 4X3TA 4C1NK 4C3HB 1DZ1A 2PZUA 3KBGA 3J7YW 3DMUA 1B50A 3VYRA 4OGQC 4RHRA 1DOLA 3OWEB 1TVXA 2DY8A 3I4MB 4HSPA 2B2YC 1D5XC 1K8OA 1C4QA 2E74C 3FPUB 1STEA 4FYDA 3DWAA 3MHBA 1MI2A 1KNEA 5IOCA 3R8BA 2FFKB 4KK7A 5JEAJ 1KDCA 2AUJD 2F0KA 3PUYA 1JICA 4PQXA 2BCOA 1TY2A 4IUPA 1PTOB 5KYLA 1TQOA 1ILQA 2NVYB 2Q8RE 1JOOA 1EWCA 2MJ8A 2RSNA 1I4RA 2L9HA 1YNND 5T1IA 2XSCA 2F0NA 2HCIA 3P20A 5IGEA 1IYUA 4F8MA 5D65A 3U9OA 1V43A 3R2TA 1OXUA 3TP6A 1SNDA 2ZXRA 1J9OA 2Q8TA 1LT4D 2F0EA 3GTKB 2WACA 4DAYA 3J80L 2K28A 4PNYA 3EJIA 1EY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYT A;  2Z1C A;  3VYU A;  3VYS A;  3VYR A;  2OT2 A;  3D3R A; 
#chains in the Genus database with same CATH topology
 1SYG A;  4ZUI A;  1C7Y A;  1IBL L;  1Q8I A;  1BOS A;  2QEX A;  1LTS D;  4HIO A;  2PQE A;  1Q1B A;  4LW1 A;  1N8R C;  2UUA L;  4DAV A;  1B44 D;  4BBS G;  1R4P B;  3AB9 A;  1XMQ Q;  2KCT A;  2OTL A;  2EY1 A;  1K0R A;  5G3L D;  1SN8 A;  1LTI D;  3PO2 H;  2KHS A;  1TS4 A;  4QL5 A;  1BBX C;  2NVT B;  3H3V C;  2D5D A;  3KFU A;  5C5L A;  3GTM H;  2HD3 A;  1ZYR C;  3FVQ A;  4JI2 Q;  1HQM C;  2EZV A;  2DN8 A;  4HJ9 A;  5IYC H;  4JBK A;  1Z6H A;  1Y8N B;  3T1H Q;  4DV1 L;  1BDO A;  2BE5 D;  5L37 A;  4OX9 Q;  2D2C C;  3CCE A;  2WB1 E;  1OXT A;  3U4Z A;  3URY A;  4C3J B;  1HPC A;  2P5Z X;  1JC7 A;  3S1N H;  4QCL A;  5ELB A;  3HS0 C;  1HH2 P;  1KAB A;  4A3E G;  4U67 3;  1ENF A;  1I4Q A;  2BA0 A;  4K5W A;  4L5R C;  3L2P A;  3CD6 A;  1CKN B;  1HZB A;  4RA8 A;  2E2H H;  5CBE E;  4C3J G;  4ZKB B;  1PYS B;  2RSO A;  5JAV A;  1SNC A;  3NTI A;  1CK1 A;  2RDH A;  2A1A A;  4BY7 H;  1D5M C;  3KF6 B;  2A73 B;  3I73 A;  2WB1 G;  2JA6 B;  1VQJ A;  5IT9 L;  2IWH A;  1DCZ A;  1G29 1;  3NTH A;  4LJZ C;  3HZX A;  1DM0 B;  1GUO A;  1LV9 A;  1FJG L;  4LK1 C;  3OMC A;  1C8C A;  3EBE A;  3JAM c;  4JOI C;  1TII D;  4X3K A;  5JPN C;  4KTA A;  1YNN C;  5JVG 3;  2IL8 A;  1D7Q A;  4MNO A;  3VDY A;  1DD2 A;  3PCO B;  4JI8 L;  3NUC A;  4TVA B;  1XWE A;  2HQL A;  4C2M H;  4TQU S;  5J1Z A;  3B6Y A;  2RKS A;  3R2I A;  2QDL A;  3IFT A;  1GUG A;  1IW7 C;  3GO5 A;  5KNC A;  3TP8 A;  1E3P A;  1HQR D;  3TEH B;  2CQO A;  1TWC H;  2IJ0 A;  4DR4 L;  4A3C H;  1JR0 D;  2B2Y A;  4KKT A;  1N32 Q;  2UUC L;  1PTO C;  3OPO A;  3GTP H;  1HHV A;  4B9W A;  4BY1 H;  3P1H A;  4DV3 L;  3S1Q H;  1LUZ A;  2R93 G;  4C3I B;  3VR4 A;  3HOZ B;  3DWQ A;  1FYC A;  5G3L F;  4APV A;  2B2U C;  2PO4 A;  1WOC A;  4A3B G;  4LF8 Q;  1PZK D;  3UE0 A;  1QJO A;  1PH4 A;  1FR3 A;  1STH A;  3OTO L;  1PTO F;  3AQQ A;  1SLJ A;  4DR3 L;  2JA5 H;  3DM1 A;  4K2K A;  2BA1 A;  3CQZ B;  2OQK A;  1UE1 A;  3M7G A;  3PUZ A;  3M85 A;  2JA8 B;  1KLG D;  4DR7 Q;  3U50 C;  3JAM i;  2HCC A;  2K05 A;  2R7F A;  4R8N A;  5CV6 A;  5GAE C;  4CDE C;  2MFI A;  2R7D A;  5AFW A;  2ZTC A;  4HR7 B;  2MHV A;  1I6H H;  1EWI A;  1TWF H;  2R7Z B;  1ESR A;  1S5E D;  4JI6 Q;  5JJL A;  1B53 A;  4GS3 A;  4DR1 L;  4JV5 Q;  1HA5 A;  2RDF A;  1K9M C;  1RIP A;  2AWO A;  4KN4 C;  3HOW G;  4ZK9 B;  4ILW A;  2EYJ A;  3T51 B;  5CR3 A;  4LF5 Q;  3ERQ A;  4EGV A;  2JQO A;  2F3V A;  4U68 A;  4HMJ A;  2K33 A;  2HDM A;  4RGN A;  3MFG A;  1L1O B;  2VL6 A;  1HNZ L;  5M5Y H;  2AHO B;  1WTP A;  1AH9 A;  2WB1 B;  4OO1 H;  1KNA A;  1N34 L;  2Y0S E;  1H9S B;  3QG1 A;  1IBK L;  2ASB A;  5CV8 A;  5LMN L;  1G6P A;  3P75 A;  1X56 A;  1JJG A;  1S40 A;  4JBJ A;  1ENA A;  2IX1 A;  1QUQ B;  2CW0 D;  3MEH A;  4BWG B;  1DOK A;  1Q90 A;  4UAI A;  2HT1 A;  1PRT D;  5HGT A;  1MSH A;  1FNW A;  3HOZ H;  1L0W A;  1I6V C;  1WTV A;  4BY1 B;  1U4M A;  5IP9 G;  2L12 A;  3S1M H;  2MP1 A;  3DHQ A;  3TME A;  1WTO A;  3LWE A;  4NXM Q;  1U4L A;  3CPF A;  2MO1 A;  2DGY A;  1STY A;  3MXG A;  4KKS A;  5K5P A;  1TKW B;  3J81 L;  5IGF A;  1CT1 D;  2YTY A;  4C3I G;  3BU2 A;  1EWH A;  2ZTD A;  1JJC B;  1TWG B;  3S2H H;  2PI2 A;  1XMO Q;  4IUQ A;  4RH6 A;  4YHH L;  1Q46 A;  1WTH A;  1V9P A;  2OEO A;  2IHE A;  1VQF A;  5IIF A;  4PZ7 A;  2E75 C;  3PO2 G;  2K6A A;  1SNP A;  3MFY A;  3STB C;  2G9D A;  4KV6 A;  2XIW A;  2ZXO A;  1JQY D;  3KLS X;  1SYE A;  4BBR G;  1PH7 A;  1SEB D;  5FJ8 G;  4FDB A;  3CCJ A;  1XNQ Q;  1YEZ A;  3KBX A;  2K32 A;  3Q23 A;  1SFO H;  4DR6 L;  1SE8 A;  5EKI A;  2LY7 A;  3NPP A;  2SNS A;  2K5D A;  4NW2 A;  5CC4 A;  5C3E G;  2G9H D;  5M5X B;  2KVM A;  4A3M H;  3E6Z X;  1SAP A;  1QNU A;  3RNU A;  4A3I H;  3F2C A;  1HJP A;  3SR1 A;  2CW0 C;  4NDX A;  2WKC A;  2VQE L;  4RAU C;  1ET9 A;  2B29 A;  1I5F A;  4QY7 A;  4DGZ A;  4QUF A;  1YJ9 A;  1IHZ A;  3K80 C;  4YCU A;  1BUV T;  2B3G A;  2NVY H;  1A63 A;  4XXE A;  1GKH A;  4HN7 A;  1JOR A;  4GLA C;  4A3D B;  1ZYR D;  1QOH A;  3NQI A;  3MXU A;  2Z1C A;  1SE2 A;  1CTM A;  5JEA H;  1VQI A;  4DR2 Q;  3CMA A;  5KNB A;  2I07 B;  2BDO A;  1M4V A;  2RA4 A;  3CCL A;  1XNR L;  1MSG A;  1H9S A;  1LT3 D;  4R4C A;  5DLQ E;  2F0O A;  1ML0 D;  5IT9 c;  4KHP Q;  1H9J A;  3A7A B;  5GAD C;  3GQB A;  4WJW A;  3J7A F;  1L0X B;  1S3O A;  4GNX B;  3BS1 A;  2KBN A;  1PH2 A;  3A5U A;  1GXD C;  4LFC L;  1IYV A;  3S1R B;  4H7B A;  3RD4 A;  1WD0 A;  4JI1 Q;  2PYK A;  1G51 A;  4L5S A;  2CHB D;  4POG A;  1G91 A;  2AQ2 B;  1TS3 A;  1BBU A;  1TWG H;  3S2H B;  2KED A;  4A3B B;  1E22 A;  2QW7 A;  3HOZ G;  3I2Z A;  2Y0S B;  3N6R A;  4CBV A;  5KIX A;  5E3F A;  3UI2 A;  1STA A;  3HOV H;  3HOY G;  3ND8 A;  2K52 A;  5DNF A;  1IL2 A;  4B9X A;  4HIK A;  1Q82 C;  4TRD A;  2BH2 A;  5KEE A;  2RQX A;  1BCP C;  1I4G A;  1STG A;  1GHK A;  3G7L A;  3SE0 A;  5IYC G;  1WVL A;  3HFZ B;  1SJH D;  1TS2 A;  1JE4 A;  4LFA Q;  5C3X A;  3PUX A;  3UDI A;  4FF1 A;  3I4N B;  2F0Q A;  4P2C B;  2NN6 G;  4XQN A;  4A3F B;  3E0E A;  1RDP D;  1D1I A;  4C1N I;  3IKJ A;  4C3I H;  1UNS A;  3RUZ A;  3M4O B;  4LF9 L;  5EBC A;  1GHJ A;  3E0J A;  4DAP A;  1HR0 L;  1T9H A;  1X3Q A;  3A8J E;  4ZAI A;  1Y14 B;  3DXJ C;  3A56 A;  1UEA B;  4UP8 A;  5C3E B;  2ICE C;  1EIG A;  2Z0S A;  3HGB A;  1PRT B;  2N55 A;  3W5O A;  3CCQ A;  1V1O A;  1J5E L;  1QG7 A;  1IXR A;  3TZD A;  4A3K H;  1KC8 C;  1JWM D;  1VQO A;  2NTT A;  4A4I A;  2JK8 A;  5LL6 S;  3PIO A;  1IW7 D;  1I6H B;  3S1Q B;  1WTW A;  1SYD A;  2C9O A;  2NBF A;  3OYY A;  2OQ0 A;  1LTR D;  3EVQ A;  2DJG C;  1EU4 A;  3SHL A;  4RGO S;  3BVG A;  4CHT B;  2JEA I;  2O5I C;  1EYG A;  1NY4 A;  1STB A;  4PMC A;  2Z8L A;  5T1G A;  1QCB D;  1E2V A;  3K81 C;  2RCF A;  3JAM L;  3CQZ H;  5C44 G;  5I6W A;  3M4O H;  2BDN A;  4BY7 B;  2K75 A;  1GUT A;  2UXC L;  2K4K A;  3CRL C;  2OCE A;  1BNZ A;  5C4J B;  4K5X A;  5E7N A;  4E6I A;  2A68 D;  3MEF A;  2ZM6 Q;  1KAW A;  3WWV A;  4N9T A;  3J7A 5;  1X65 A;  1B4O A;  2F0J A;  3FDT A;  1V1P A;  1HTL D;  5IP7 G;  1O80 A;  2RVL A;  2F0G A;  4YCV A;  1LTB D;  3G6J B;  5LHY 1;  4OWX B;  4JI3 Q;  1K28 A;  4A93 B;  4HJ7 A;  1S5D D;  1YNJ C;  4CJ0 B;  4IO9 A;  2A6H D;  4R4I A;  5JPM C;  1PYW D;  3CXC A;  3FMC A;  3VYU A;  2UU9 L;  2JSO A;  2DJF C;  3H94 A;  2E76 C;  4RMF A;  4BBR B;  4GNX A;  4O1N A;  5I9P A;  3TP5 A;  2UXD Q;  4IQZ A;  3I4N H;  1LTT D;  3GV3 A;  3W1B A;  2NVT H;  1HXY D;  3LNN A;  4ALP A;  1RF2 D;  1Z7T A;  1E24 A;  1SNO A;  4HTH A;  1VQ5 A;  3W2D A;  2F4I A;  2ZJR A;  1CQV A;  3D4W A;  1XJV A;  1JT8 A;  3CCS A;  3MWY W;  3ULJ A;  3U9S A;  4S3S A;  3Q6S A;  4LF4 L;  3HOU G;  3VR6 A;  5FLX E;  1GUW A;  4JPB W;  4OIK A;  4LUV A;  1VQM A;  1I50 H;  4RWS C;  3I4O A;  3MC0 B;  3EN2 A;  2VUM H;  1QB5 D;  2NN6 I;  4M1U B;  2EJF C;  4JI4 Q;  1EQV A;  2RHS B;  4X6A H;  3HOX G;  4DV6 L;  4GZY C;  4K14 A;  3X3M A;  2OWO A;  4HSV A;  2KOL A;  5K36 H;  3RZD B;  2HIV A;  1A2T A;  2JA7 B;  3GTK H;  2F1M A;  3NP8 A;  5E4X A;  3I56 A;  4R4O A;  4EQP A;  3H09 A;  2V1C C;  2E2H B;  1SYF A;  3HOX B;  3CPW A;  4WJ3 M;  1JMC A;  2E5L Q;  1NMG A;  2HUG A;  1I50 B;  5M3M G;  2QEJ C;  2EYL A;  1X9N A;  3SK8 A;  4LF6 Q;  1QVF A;  5EAY A;  4O2D A;  5J39 A;  3NBH B;  4B3R Q;  3OIQ A;  2YYZ A;  1M1K C;  2MO0 A;  1B7Y B;  1E7Z A;  3I7F A;  4HID A;  1RJT A;  2B2W C;  4DXF A;  3TBI B;  3QOL A;  1S4Z A;  3RLN A;  2WAQ G;  4K6D A;  4LF7 Q;  2EYF A;  2LSS A;  5BN3 A;  2IX3 A;  2VW9 A;  1Z47 A;  3CC4 A;  1SMX A;  1LT6 D;  5D3D A;  5NUC A;  4X66 L;  4BBR H;  4X64 Q;  1TWA H;  1X32 A;  3GP7 A;  1KTK A;  4OHJ A;  2OT2 A;  4WOR A;  5C4Z A;  1TXY A;  3HOY B;  4RKL A;  3HEJ A;  4ZRZ A;  2F0H A;  1MHW C;  2N88 A;  3S17 B;  4ZYS A;  3WOF A;  5I2Y A;  3PF4 A;  1IZ6 A;  5ELN A;  5I4D A;  3RN5 A;  5I6Y A;  4GKJ Q;  4HJ5 A;  3A8K E;  1SRU A;  2WP8 J;  1Q8K A;  3S2D B;  4V0B A;  1EZ6 A;  4ID6 A;  2F52 A;  1LAB A;  4KHZ A;  1UE6 A;  1SE4 A;  5IY0 A;  4IFD G;  1PV4 A;  1KDA A;  4RCN A;  1N33 L;  5CYU A;  4KY7 A;  3ND9 A;  2H4O A;  5H1S E;  2OF1 A;  4DV0 L;  2JE6 I;  4K0K L;  1TR5 A;  1VQ4 A;  2KUM A;  2Q2U A;  1AW7 A;  5C4X G;  2L55 A;  4IJH A;  5FLX L;  4NXN Q;  5CV5 A;  3K8A A;  2A6E C;  4C56 C;  4AQY L;  5I2X A;  1NMF A;  1O7I A;  1BCP F;  4CDF C;  2YV5 A;  2PZT A;  4XIG S;  3S1M B;  1IYJ B;  4LFB L;  1SE3 A;  1VQD A;  1I94 L;  4HMI A;  3PO3 G;  3I70 A;  3HP3 A;  1Y1W B;  1PH5 A;  4IFD J;  3DLL A;  1PTO D;  4B3S L;  1VQN A;  1K73 C;  3T56 B;  4IUT A;  1GUS A;  4CKE A;  1WTQ A;  3WOE A;  4BY1 G;  4O0A A;  2B2V C;  3D3R A;  4LAA A;  5E1F A;  2Q8I B;  1Q81 C;  1SMY C;  4OWT B;  3I91 A;  4YY3 L;  2CCZ A;  4B3T L;  4JVZ A;  3UE1 A;  3LGJ A;  4QF4 A;  2L15 A;  2E2I H;  4XTC S;  1ASY A;  4FVM A;  1R4Q B;  4XYQ A;  4JW0 A;  4NPS A;  4X65 L;  1KL9 A;  2I0Q A;  2X6L A;  4R4T A;  4C3H H;  3RZO B;  4A3D H;  2O5J C;  1A8V A;  3F1Z A;  3SGI A;  1QVC A;  4TKO B;  2MPM A;  4G57 A;  3K5M A;  2Y0S G;  2K14 A;  4KLK A;  4DUY Q;  2VZA A;  2B2T C;  2F0U A;  2BOS A;  1PH1 A;  4KJO A;  1V8Q A;  1JWS D;  3AEV A;  4XT1 B;  4IFD H;  1O7Y A;  1SYB A;  2MGS A;  1LTA D;  1AEX A;  2D0P A;  2JJQ A;  2R92 H;  3S16 H;  3J81 j;  3KDF A;  4NMZ A;  1SFO B;  3CC2 A;  2JA8 G;  4JYA Q;  3HOV B;  4GKK L;  4A3E B;  4OEM B;  1B70 B;  3RN2 A;  5C44 H;  3IRB A;  4HIM A;  3T1Y L;  1Y69 U;  4BBS H;  1X3F A;  5EKL A;  2SDF A;  1RTO A;  3KLW A;  1WJJ A;  1DOM A;  3CCR A;  1TWH B;  3GTJ B;  1K8M A;  2KCN A;  3LX0 A;  4WRD A;  5AJ3 L;  4A3G G;  3L7Z C;  2QA4 A;  5ELC A;  2JN4 A;  1P8L A;  2FIN B;  2NZ1 D;  4BA1 I;  2A69 D;  4OO1 G;  4Q0F A;  2JA9 A;  3KF6 A;  3KF8 B;  3KJO A;  1JCK B;  5DEH A;  2JA6 G;  4B3M L;  4JI7 Q;  1BF4 A;  3D6W A;  3E5S A;  4JCV E;  1VQ7 A;  3TZU A;  2OXP A;  2Z4H A;  4J8Q A;  4DUZ L;  2ID0 A;  3L3O C;  3KJP A;  4L6T B;  1BQQ T;  2EQS A;  4JI0 Q;  1HNW Q;  3M9B A;  3KLS A;  2CVR A;  5FO9 B;  1BCP B;  2EY2 A;  3R93 A;  1XPU A;  1EOT A;  1QVG A;  3NTK A;  3FKI B;  1D1K A;  3UDF A;  2PMZ E;  2B8G A;  1PFS A;  3NWT A;  1EZ8 A;  5LMU Q;  1PH9 A;  4JI8 Q;  3KYH C;  4F88 A;  1VMC A;  4XQJ A;  4DV2 Q;  1PH3 A;  4HCE A;  1F9Q A;  3RLO A;  4DR5 L;  3FKI G;  4IUR A;  2EIF A;  2UUB L;  1EIH A;  4YWL A;  2UXB Q;  1HNX L;  1F77 A;  1STN A;  4AH6 A;  3M3Y B;  5C44 B;  4ABN A;  1YHA A;  5M5X H;  4A3M B;  2B63 G;  4DR4 Q;  5ELO A;  2ALY B;  2CWP A;  2GVB A;  2NUC A;  2V4D A;  3CCU A;  3JAM E;  1F9P A;  1E1T A;  3UDG A;  1RD9 D;  3S16 B;  2R92 B;  1HZA A;  2RCN A;  4GNX C;  3VR5 A;  2OTJ A;  2B2V A;  3SDZ A;  1SMY D;  2EY6 A;  2J7Z A;  4ZQ3 A;  4H0L C;  1SJE D;  2IX0 A;  1MJC A;  2HQE A;  1F2L A;  1IBM L;  1W6J A;  3Q24 A;  2LXK A;  2B2U A;  4M8A A;  2LKV A;  3I55 A;  4DR3 Q;  3BYY B;  1TWH H;  3GTJ H;  1FD7 D;  5EJW A;  4IZ8 A;  4UP7 A;  2WKD A;  3S1N B;  3CU7 A;  1DYQ A;  1UE7 A;  2YTV A;  5FKA C;  3HKZ G;  1R9T H;  4FF3 A;  4FF4 A;  1XYI A;  1DGS A;  4IOA A;  2EYH A;  2A19 A;  1UWV A;  1EYA A;  1J8I A;  2WFW A;  2O4X A;  3NSW A;  2NVX H;  5ELF A;  4N8F A;  3ITP A;  1EQT A;  1WCM H;  4I7Z C;  4A93 H;  3M4Y A;  4X3S A;  3QO2 A;  2F4V L;  3I90 A;  1KDB A;  4CDC C;  1EFI D;  3RMH A;  1IBL Q;  1EYD A;  2FMC A;  2K5N A;  1X6O A;  5FK9 C;  2JA5 B;  4JOI A;  1EY7 A;  4K8J A;  1AZP A;  4B08 A;  3HOW B;  3F2D A;  3EFX D;  4BXX H;  1CI3 M;  1EY4 A;  2AMC B;  1HTP A;  1LYL A;  1BXT A;  1WTR A;  3DUZ A;  1NCV A;  4X3U A;  4CJ1 B;  3IAY A;  1CA5 A;  3GTP B;  3S9W A;  1XTD A;  1QNK A;  4JC0 A;  4X62 Q;  1YBY A;  2JA7 H;  3CME A;  4OL7 A;  1N34 Q;  1K8G A;  4IUN A;  2WAQ E;  2YTX A;  4BA2 I;  2ZXP A;  1A6X A;  3GTO B;  1HZC A;  5HY6 A;  3VYT A;  3QOJ A;  3BG3 A;  5C0X H;  4LWC A;  3K5L A;  1HR0 W;  1IKM A;  3KLR A;  1NBW A;  1LTG D;  3O13 A;  4P71 A;  1IKL A;  2K7V A;  3KDF B;  3L9A X;  3SK6 A;  1VQA A;  4JI5 L;  1U4P A;  1Y1V H;  3GV6 A;  3CC7 A;  1LM0 A;  2M9V A;  1UUP A;  2RBM A;  4OON A;  4R4Q A;  5C0X I;  3F8T A;  1KXL A;  3OW7 A;  1T5E A;  4IPG A;  3ERO A;  3MA2 B;  4ZCK A;  1UE5 A;  4DV4 Q;  4FP5 D;  3KF8 A;  1QWY A;  2L1B A;  4A93 G;  3H3V I;  2QIL A;  1OTC A;  2A69 C;  4DK1 A;  1X3G A;  4DV7 L;  1XMO L;  1CHP D;  3BZC A;  2GN5 A;  1FJG Q;  4ODG A;  4YHH Q;  4A3F H;  1N36 Q;  5IYD G;  2NWG A;  1JOQ A;  3A5Z B;  4DU9 A;  3D4D A;  1WTX A;  5C6A A;  1EQQ A;  1VQK A;  4A3J G;  1ROD A;  2R3Z A;  4GN5 A;  2K01 A;  4PMB A;  1U0L A;  1PTO H;  1XXG A;  5J22 A;  1VS0 A;  1Q3L A;  3Q8D A;  1L1O C;  4A3G B;  4HED A;  4DNT B;  1CFM A;  4DV5 L;  2M2L A;  4JBM A;  2B63 H;  4QQB X;  4IJL A;  1GD7 A;  1XMQ L;  1FNU A;  1WCM B;  2NYZ D;  3Q0A A;  2B2W A;  2VS1 A;  1X54 A;  4DV3 Q;  2VB2 X;  1SNQ A;  2DNE A;  4JG2 A;  1MBY A;  3RZD H;  5IYB H;  1S72 A;  3QWN A;  1B2T A;  2AWN A;  4C2M B;  1VF7 A;  3K7A H;  2HDL A;  1VCI A;  1B9M A;  2N3S A;  1BVS A;  3V05 A;  3CKI B;  2VUM B;  2K03 A;  2PZW A;  1SBB B;  1Y1V B;  4FXD A;  1O7L A;  3KUP A;  1RHP A;  1RTN A;  3T1H L;  4DV1 Q;  4OX9 L;  3J80 E;  4QB4 A;  1M90 C;  2JP1 A;  1RL2 A;  1S5B D;  4DR7 L;  1HA6 A;  5BR8 Q;  5IP7 H;  1MGS A;  3VA7 A;  2JYO A;  1QZH A;  3GTO H;  1ESF A;  4YWK A;  4KN7 C;  3DWP A;  1XX8 A;  2XTI A;  5ISR A;  1PMR A;  2JA6 H;  2YU9 B;  3NXW A;  4WFN 3;  2QF7 A;  3NEL A;  4IPD A;  2NVX B;  1H9K A;  2K5V A;  4ULL A;  4N8X 1;  2C5C A;  4DAM A;  5M3M B;  4JV5 L;  5BN4 A;  4LFC Q;  3H91 A;  4CKB A;  2LFN A;  3J81 E;  3BVZ A;  3E3X A;  4IFD I;  2J0T D;  2N78 A;  4JI1 L;  1GM5 A;  2X6G A;  3I4M G;  3NWS A;  3GD7 A;  5EKK A;  5TSS A;  3V96 A;  3BJU A;  2VQF L;  4BY7 G;  4Y7N H;  5M3F H;  1YIT A;  1P16 A;  1AZQ A;  1ZXT A;  4GN3 B;  1TY0 A;  2DY7 A;  2Q2T A;  2KQ3 A;  4L5Q A;  3I3C A;  1IL8 A;  1CKM A;  1X3P A;  1HFG A;  3K5O A;  4C3J H;  1RKN A;  2JXM B;  2VNU D;  2A74 C;  4A3I B;  2HHH Q;  1GOZ A;  3QB3 A;  2VB3 X;  2ENB A;  2K04 A;  3SK4 A;  5FOB B;  1VQP A;  1TT2 A;  1WD1 A;  1U5K A;  1JE5 A;  2BH8 A;  2KCM A;  3MXN A;  1SRO A;  3X3N A;  1K83 B;  3Q22 A;  3D31 A;  4FNF A;  1D5Z C;  3V2T A;  1G6Z A;  1G2S A;  1R9T B;  3AYH B;  1T5X D;  3WDN A;  1YJW A;  2FJ2 A;  5EGT A;  4ZKC B;  3R3O A;  4ME3 A;  3T13 A;  2PQA B;  3M4Q A;  4IUV A;  5DM6 3;  3K5N A;  4IPH A;  3K7U C;  2B8F A;  1I4H A;  2A5H A;  2ICI A;  1AFP A;  1C0A A;  3DEO A;  4DA2 A;  5IWA L;  1VQ8 A;  2GVA A;  1VQ6 A;  4OXP A;  1A62 A;  5ELD A;  1I3Q B;  5CGK A;  1XPO A;  4FXG C;  5FO7 B;  2H5X A;  3L0O A;  2A68 C;  4NB3 A;  3OMG A;  5KGU A;  4LF8 L;  1PRT F;  5J3B A;  2FHT A;  1X3E A;  1UEB A;  3M3Y H;  3TP7 A;  5M5W B;  3OW2 A;  1AN8 A;  3C1E A;  5E4W C;  4MTK A;  5CV7 A;  5M3F G;  1J5E Q;  4FXK C;  4A3L H;  2WV6 D;  2MNA A;  4R9W A;  1E0B A;  1LAC A;  3NK9 A;  1A3T A;  2Q2I A;  1K3B C;  1I4P A;  5FJ8 H;  2AQ3 B;  1BCP D;  2EY5 A;  3TSS A;  2E2D C;  2K5W A;  4FO2 A;  4WJ4 A;  2EE1 A;  1FNV A;  5GQO A;  5D3I B;  2NTS A;  4YWM A;  1CKN A;  2AUK A;  2JA7 G;  4P75 A;  3K0Y A;  1A2U A;  5IGG A;  1BBW A;  3FPP A;  4JI6 L;  3JC6 6;  1XNQ L;  2R92 G;  2PW5 A;  3VR2 A;  1VQ9 A;  3FHW A;  4DR6 Q;  5FO8 B;  5JJZ A;  3MAQ A;  2UUA Q;  1NR4 A;  4A3E H;  3HRZ C;  2EJG C;  1WI5 A;  1EL0 A;  4LF5 L;  2NB0 A;  3TQY A;  1W6K A;  3BDC A;  4A3J H;  4RFB A;  2ES2 A;  3F2U A;  3S15 B;  5GAG C;  2ZM6 L;  3FRP B;  1HNZ Q;  1MKH A;  2EOT A;  5CMD A;  1C48 A;  4JI2 L;  4Z9C B;  1SYC A;  2R93 B;  1PH6 A;  3BVM A;  2EYO A;  3FEW X;  5GAH C;  3ULL A;  3S14 H;  4PZ8 A;  1IBK Q;  4UY8 C;  3G71 A;  4QIW E;  5C5M A;  5EPJ A;  3AMU A;  3A55 A;  3J81 i;  4J6H A;  3RZO H;  3K7A B;  5IGC A;  4FF2 A;  1XNR Q;  1EOV A;  1Z9F A;  3C46 A;  1PYB A;  3I4N G;  3J81 c;  4V19 0;  2F0L A;  2FXQ A;  1G8Z D;  5DAU A;  5GRO A;  3PQI A;  3HOV G;  3PIP A;  1Y8P B;  3NEM A;  3PV0 A;  2KCC A;  2NZO A;  5IT9 E;  4RHS A;  3T53 B;  4LNQ A;  2F0P A;  1RCV D;  2O2L D;  2R7Z G;  4DK0 A;  4RCO A;  2M00 A;  1F2Z A;  4F7X A;  3EA6 A;  5I9O A;  3IFD A;  4ZUJ A;  4K8I A;  2QDB A;  3S2D H;  3J7A V;  3D4R A;  5ELE A;  1UAP A;  3OSO A;  5CV9 A;  1A3U A;  4IN3 A;  4AYB G;  1F2M A;  3HOW H;  4H13 C;  1BR9 A;  2RF4 A;  3CHB D;  2XWB B;  4ME5 A;  2PW7 A;  2R6G A;  1M8A A;  4P73 A;  5IOD A;  2TMP A;  2E2I B;  1ICF B;  2XRS D;  1SR3 A;  4MN3 A;  3ER0 A;  1CM9 A;  3PF5 A;  4XT3 B;  4K2L A;  4K6L A;  4IOC A;  1EIY B;  3CAM A;  3RLF A;  3NE5 B;  2L0C A;  1X55 A;  2K5Q A;  2KHJ A;  5COR A;  3HOU H;  1NUC A;  1S5C D;  1GUN A;  1HUN A;  4CGY B;  4MZ9 A;  1PFB A;  3MXP A;  3MTS A;  4CKC A;  4CDD C;  1PZI D;  1DXM A;  2WAQ B;  2BE5 C;  1N32 L;  1PRT C;  2D62 A;  2F0W A;  2LS0 1;  2UUC Q;  1YNJ D;  4GLV B;  1JB7 A;  3S14 B;  4MTN A;  5EPK A;  2VQE Q;  1KIX A;  1TWF B;  4UPA A;  2N49 A;  4GOP B;  3UDX A;  3A54 A;  4X66 Q;  1SXT A;  4L63 B;  4J1M A;  3OTO Q;  3U4V A;  4A3J B;  1VDZ A;  1AP0 A;  3PIO 3;  3HOY H;  1ILP A;  1Y8O B;  1TU2 B;  4H02 A;  4G7Z C;  1CA6 A;  5LL6 X;  4RGM A;  2A8V A;  1L2F A;  1QUQ A;  4A3I G;  3GTL B;  2VXW A;  1K3R A;  4KD3 A;  4AIM A;  4JBW A;  1EEF D;  4XDX A;  3ULP A;  1Q12 A;  4L8J A;  1CZW A;  3MXN B;  1KQS A;  4Y52 H;  4A3F G;  4EVO A;  2F3I A;  5EPL A;  4QGU A;  3J7Z C;  4IAL A;  1VQH A;  4A75 A;  3GTQ H;  1EY6 A;  4DR1 Q;  1SNM A;  5K36 G;  1TS5 A;  4GOP C;  4PMW A;  2EPB A;  3A0J A;  5HGQ A;  3T16 A;  2GA4 B;  3HOX H;  1TWC B;  3NHH A;  2KEN A;  1HCZ A;  1TWA B;  2L11 A;  3D8G A;  3RR5 A;  5M5W H;  2VUM G;  3GTM B;  4EQO A;  1B3A A;  4DKA C;  4H44 C;  3GTG B;  2SOB A;  2AQ1 B;  1ET6 A;  4LUZ A;  1B3Q A;  1CSQ A;  3H0G B;  1KLU D;  5C0X G;  4KMU C;  3K59 A;  4OWW B;  5M5Y B;  2PI2 E;  2YU9 H;  3HKS A;  1YHQ A;  1OXV A;  2Q2H A;  1I3Q H;  4HJ8 A;  1NNX A;  3ONA B;  2Z6B A;  4A3D G;  4ZLT F;  2EVB A;  3VR3 A;  5IGB A;  5LMN Q;  3OWF A;  4IUU A;  1E2W A;  1EY0 A;  5IP9 H;  1PA6 A;  3K57 A;  2EJM A;  4I65 A;  4R8I A;  4BXX G;  3TRZ A;  1F9R A;  4DN4 M;  1NJI C;  4BBS B;  2CFM A;  5KRU A;  4A3L G;  1LT5 D;  4P74 A;  4DK3 C;  1PDQ A;  1YIJ A;  3HKZ E;  2UXD L;  4LUO A;  4NXM L;  1NAP A;  1MIU A;  3PUV A;  1OXS C;  2B2T A;  1U9R A;  4LF9 Q;  3K6O A;  4G7O C;  1HR0 Q;  4PZ6 A;  2E8G A;  3TN2 A;  1YJN A;  1PHJ A;  2JA8 H;  3GDE A;  1ICW A;  2I5H A;  4KY6 A;  1PXU A;  5DM7 3;  3J80 i;  2F0F A;  4DUY L;  1GVP A;  2AKW B;  2B63 B;  1EQR A;  3S24 A;  1CHQ D;  2ZTE A;  2C35 B;  4PG3 A;  1Q1E A;  3OOC A;  4DV6 Q;  3C3L A;  3PMF A;  5C4X H;  2F03 A;  3H0G H;  1Q86 C;  1NTG A;  2IT1 A;  2Z6K C;  3A8I E;  3GTG H;  3BDO A;  3CW2 C;  1ENC A;  2K50 A;  2R61 A;  3PIP 3;  5C4H A;  1A3V A;  5A2Q E;  5C3E H;  2MUY A;  3G48 A;  4EQN A;  3IL8 A;  2F0V A;  4BS9 A;  1H9R A;  4LF6 L;  4G4K A;  1H9M A;  1V1P B;  5IYB G;  2E2J B;  2SEB D;  4YCW A;  5BN5 A;  4A3K G;  1HUM A;  5C4X B;  2J4X A;  1YVC A;  2B39 A;  1FGB D;  4OEL B;  1OXX K;  1VQL A;  1HFN A;  2H1E A;  4OO1 I;  2UXC Q;  5JJK A;  4DXG A;  4LF7 L;  1ASZ A;  3PO3 B;  3P7J A;  2CH4 A;  2JA5 G;  5C3W A;  1NSN S;  1LTL A;  2LMC B;  4KKU A;  4A3K B;  1EY5 A;  1HZ9 A;  3AFQ A;  5EBD A;  3GTL H;  2SNM A;  2I46 A;  1VQC A;  2Z6K A;  3BYT B;  3QR8 A;  4TSS A;  3D6C A;  1PFM A;  3W3A A;  2F0M A;  3J80 c;  2XRQ D;  5JJI A;  1LO5 D;  1JJ2 A;  4DPG A;  3I4M H;  2I5L X;  2Z9H A;  3M7N A;  2KEC A;  3ERS X;  2NN6 H;  4UHV A;  1HNW L;  3OIP A;  4JI3 L;  3PGZ A;  4DR2 L;  2Z4I A;  1EYC A;  1HRJ A;  1JWU D;  2NZH A;  1F2Y A;  4P72 A;  1KHI A;  1CZG A;  4C3H G;  2UU9 Q;  3ZYY X;  1CSP A;  1EEI D;  1XTC D;  4N9P A;  1VMP A;  2WIN B;  3I8Z A;  2XN9 C;  1PLF A;  1VF5 C;  4IPC A;  1CUK A;  4KHP L;  2F0I A;  2CH4 W;  2UUB Q;  1L1O A;  4A3M G;  5CBA E;  1I4X A;  2KEE A;  4QMG A;  3NBH A;  4DV0 Q;  5KYI A;  1L0Y B;  3DEP A;  3STB D;  4OIJ A;  2A6E D;  4LF4 Q;  1H95 A;  1GO3 E;  3C2P A;  4KI0 A;  5IE8 A;  3CP0 A;  1QZG A;  4AQY Q;  1U4R A;  4KD4 A;  5HUR A;  2EYM A;  2IW3 A;  4XYO A;  4JI4 L;  2PNH A;  3I4L A;  4LFB Q;  2NVQ B;  1EUJ A;  5F2D A;  5JOB A;  3TDQ A;  3PO2 B;  4A3B H;  4KY5 A;  2TSS A;  1G2T A;  3K0X A;  3GTQ B;  1ZKO A;  1QE6 A;  3NQT A;  4DK6 C;  4NP5 A;  3NBI A;  2E5L L;  4NKL A;  3HKZ B;  3I72 A;  2VY3 A;  3T4A C;  2PMZ B;  1KAA A;  4LFA L;  1DJR D;  3EQL C;  1E2Z A;  1B1Z A;  1F9S A;  1NR2 A;  4AYB E;  5CV4 A;  2A6H C;  2JEB I;  4PV1 C;  3SVM A;  2ATW A;  4K5V A;  2IPK D;  2RDG A;  1GJX A;  3C1F A;  4QUC A;  4QIW B;  2F4V Q;  2F0D A;  3K58 A;  1MJE A;  1PFN A;  2D9U A;  5IGD A;  1KRT A;  4G7H C;  1WCM G;  3QIA A;  2F0T A;  2QKI C;  1CQF A;  2KJX A;  5D14 A;  3G4S A;  1D2B A;  2L5T A;  1BO0 A;  5A35 A;  1O7Z A;  3TRE A;  4XQQ A;  1K0S A;  3A74 A;  3DM3 A;  1II3 A;  1JOK A;  1EU3 A;  4DFA A;  5KND A;  3QJY A;  3LWU A;  4X62 L;  3S15 H;  1JB3 A;  1V1Q A;  4CJ2 C;  2XGT A;  4KJN A;  1QIL A;  2WII B;  2FMM A;  3E9I A;  3TS2 A;  2I5M X;  4JYA L;  4GKK Q;  4F87 A;  4A3C G;  3H15 A;  1Y1V G;  3SK5 A;  1MD2 D;  3AFP A;  1SSO A;  3T1Y Q;  2CQA A;  4JI5 Q;  1B9N A;  5JVH 3;  4LMQ D;  2DUD A;  4GLX A;  2XWJ B;  5EQ0 A;  4NXN L;  3HG9 A;  3A7L A;  4Q5V A;  4B3M Q;  4JI7 L;  2QGQ A;  2DNC A;  1FVI A;  1XPR A;  3OHX C;  1EFW A;  2XVS A;  2EDG A;  2K1B A;  3VYS A;  1A15 A;  4DNI A;  3FKI H;  5COY A;  5LMN W;  1KRS A;  3MVV A;  1SDF A;  4MHE A;  2CWA A;  1FL0 A;  4HAE A;  4DV7 Q;  4B3S Q;  3AU7 A;  2MQH A;  1K8A C;  3BZD B;  3MZ5 A;  4EX5 A;  4UDU C;  1C9O A;  4DAY B;  5JEA G;  3CCV A;  2KA7 A;  1PZJ D;  1S5F D;  4HCS A;  5C0X J;  2F0S A;  5M9O A;  4YY3 Q;  4B3T Q;  3CF5 A;  4POF A;  3U58 A;  4UP9 A;  1D8L A;  1EY8 A;  3ICE A;  4RGT A;  1LLR D;  5LMU L;  1DON A;  2EXD A;  4DV2 L;  3SEB A;  4DR5 Q;  1YZ6 A;  4X65 Q;  2UXB L;  1HNX Q;  2L4N A;  4MIU A;  1A0I A;  1AE3 A;  4QJF A;  3F2B A;  3CCM A;  2XNA C;  2PNR C;  4O42 A;  1ZEQ X;  1OO9 B;  2R93 H;  2NVQ H;  2IHF A;  3PUW A;  2EYP A;  1K83 H;  3H0G G;  5M3M H;  2N8N A;  1E1O A;  5IYD H;  2ZT9 C;  4RKB A;  2QCP X;  2F3W A;  4JK1 C;  3CRK C;  3BZK A;  3HOU B;  2K5H A;  1D6E C;  3H6M A;  1O78 A;  4YIJ A;  3BDL A;  3VA5 A;  1WFQ A;  3H3V H;  4KHV A;  1ONL A;  4A76 A;  2X69 A;  2PPB C;  5A2Q L;  2PQA A;  4DNR B;  2HIX A;  2LXJ A;  3SXH A;  1W2B A;  4Y7N B;  5M3F B;  3M4P A;  2PCF B;  1B8A A;  3N52 A;  5FLM G;  5FLX c;  2EXZ A;  3KK7 A;  4AYB B;  4DF7 A;  5BR8 L;  4X3T A;  4C1N K;  1FGU A;  2IY5 B;  4B3R L;  4C3H B;  4R1J A;  1PVO A;  1DZ1 A;  2PZU A;  5C4J H;  3KBG A;  5AJ3 Q;  4RG1 A;  3DMU A;  3J7Y W;  1B50 A;  3VYR A;  4I7A A;  4OGQ C;  5FLM H;  4RHR A;  1YNX A;  1DOL A;  3OWE B;  1TVX A;  3TS0 A;  2DY8 A;  3I4M B;  2RHQ B;  1J6Q A;  4HSP A;  1KD1 C;  4DUZ Q;  4L5T A;  4X64 L;  3D0F A;  1VQG A;  2B2Y C;  2VQF Q;  1D5X C;  1K8O A;  1C4Q A;  4EQ5 A;  2E74 C;  3FPU B;  1STE A;  1Y1W H;  3NEN A;  4JI0 L;  4FYD A;  2R7Z H;  4A3G H;  3DWA A;  2HHH L;  3S1R H;  3MHB A;  2ZJQ A;  4GKJ L;  1Q7Y C;  1MI2 A;  3E9H A;  1KNE A;  2E2J H;  3FP9 A;  5IOC A;  3R8B A;  1BKB A;  2FFK B;  4J15 A;  4KK7 A;  5JEA J;  1KDC A;  2AUJ D;  1W3S A;  1NE3 A;  2F0K A;  3G6E A;  1N33 Q;  1EIF A;  3W1G A;  1AE2 A;  1CKO A;  3PUY A;  4K0K Q;  1JIC A;  4PQX A;  2BCO A;  1TY2 A;  4IUP A;  5IWA Q;  4HJA A;  1YI2 A;  1PTO B;  3ZJY C;  5KYL A;  1TQO A;  1ILQ A;  2NVY B;  1YHB A;  4DV4 L;  1VQB A;  2ZJP A;  1PH8 A;  2Q8R E;  1JOO A;  1EWC A;  2MJ8 A;  3S17 H;  1IBM Q;  2RSN A;  1I4R A;  1Y1W G;  2L9H A;  1I94 Q;  1YNN D;  5T1I A;  2XSC A;  4GN4 B;  2F0N A;  2HCI A;  3P20 A;  5IGE A;  1IYU A;  4F8M A;  3EIV A;  5D65 A;  3U9O A;  1V43 A;  3R2T A;  1OXU A;  1N36 L;  3PSI A;  3TP6 A;  1SND A;  2ZXR A;  1J9O A;  2CKZ B;  2G5D A;  4GOP A;  2Q8T A;  1WYD A;  1LT4 D;  2F0E A;  2KHI A;  3GTK B;  2WAC A;  4DAY A;  3J80 L;  2K28 A;  1VQE A;  4PNY A;  3EJI A;  3KOJ A;  3PO3 H;  1N9W A;  2D0O A;  1EY9 A;  4DV5 Q; 
#chains in the Genus database with same CATH homology
 1SYG A;  4ZUI A;  1Q8I A;  1BOS A;  1LTS D;  2PQE A;  1Q1B A;  4DAV A;  1B44 D;  1R4P B;  3AB9 A;  2EY1 A;  5G3L D;  1LTI D;  2KHS A;  1TS4 A;  1BBX C;  2NVT B;  3H3V C;  2D5D A;  5C5L A;  1ZYR C;  3FVQ A;  1HQM C;  2EZV A;  2DN8 A;  1Z6H A;  1Y8N B;  1BDO A;  2BE5 D;  2D2C C;  3URY A;  1OXT A;  4C3J B;  1HPC A;  1JC7 A;  4QCL A;  5ELB A;  3HS0 C;  1KAB A;  4U67 3;  1ENF A;  1I4Q A;  2BA0 A;  4K5W A;  4RA8 A;  5CBE E;  4C3J G;  4ZKB B;  2RSO A;  5JAV A;  1SNC A;  3NTI A;  1CK1 A;  2RDH A;  1D5M C;  2A73 B;  3I73 A;  2JA6 B;  5IT9 L;  2IWH A;  1DCZ A;  1G29 1;  3NTH A;  4LJZ C;  3HZX A;  1DM0 B;  1GUO A;  1LV9 A;  4LK1 C;  3OMC A;  1C8C A;  1TII D;  4X3K A;  5JPN C;  4KTA A;  1YNN C;  5JVG 3;  2IL8 A;  1DD2 A;  3NUC A;  1XWE A;  4TQU S;  5J1Z A;  2RKS A;  3R2I A;  3IFT A;  1GUG A;  1IW7 C;  3GO5 A;  5KNC A;  3TP8 A;  1HQR D;  2IJ0 A;  1JR0 D;  2B2Y A;  4KKT A;  1PTO C;  3OPO A;  1HHV A;  4B9W A;  3P1H A;  4C3I B;  3VR4 A;  3HOZ B;  3DWQ A;  1FYC A;  5G3L F;  2B2U C;  2PO4 A;  1PZK D;  1QJO A;  1FR3 A;  1STH A;  1PTO F;  3DM1 A;  4K2K A;  2BA1 A;  3CQZ B;  3M7G A;  3PUZ A;  3M85 A;  2JA8 B;  1KLG D;  2HCC A;  2K05 A;  4R8N A;  5CV6 A;  5AFW A;  4HR7 B;  2MHV A;  2R7Z B;  1ESR A;  1S5E D;  1B53 A;  1HA5 A;  2RDF A;  2AWO A;  4KN4 C;  4ZK9 B;  4ILW A;  2EYJ A;  3T51 B;  5CR3 A;  3ERQ A;  4EGV A;  2F3V A;  4U68 A;  4HMJ A;  2K33 A;  2HDM A;  4RGN A;  3MFG A;  1WTP A;  2WB1 B;  4OO1 H;  1KNA A;  1H9S B;  3QG1 A;  5CV8 A;  3P75 A;  1ENA A;  2IX1 A;  2CW0 D;  3MEH A;  4BWG B;  1DOK A;  1Q90 A;  4UAI A;  1PRT D;  5HGT A;  1MSH A;  1FNW A;  1I6V C;  1WTV A;  4BY1 B;  1U4M A;  2L12 A;  2MP1 A;  3DHQ A;  3TME A;  1WTO A;  3LWE A;  1U4L A;  1STY A;  3MXG A;  4KKS A;  5K5P A;  1TKW B;  3J81 L;  5IGF A;  1CT1 D;  4C3I G;  1EWH A;  1TWG B;  4IUQ A;  4RH6 A;  2OEO A;  5IIF A;  2E75 C;  2K6A A;  1SNP A;  3MFY A;  2G9D A;  4KV6 A;  2XIW A;  2ZXO A;  1JQY D;  3KLS X;  1SYE A;  1SEB D;  3KBX A;  2K32 A;  3Q23 A;  5EKI A;  2LY7 A;  3NPP A;  2SNS A;  2K5D A;  4NW2 A;  5CC4 A;  2G9H D;  5M5X B;  2KVM A;  3E6Z X;  1SAP A;  1QNU A;  3SR1 A;  2CW0 C;  4NDX A;  2WKC A;  4RAU C;  1ET9 A;  4QUF A;  4DGZ A;  1IHZ A;  1BUV T;  4XXE A;  4HN7 A;  1JOR A;  4A3D B;  1ZYR D;  1QOH A;  3NQI A;  3MXU A;  2Z1C A;  1SE2 A;  1CTM A;  5JEA H;  5KNB A;  2I07 B;  2BDO A;  1M4V A;  2RA4 A;  1MSG A;  1H9S A;  1LT3 D;  2F0O A;  1ML0 D;  1H9J A;  3A7A B;  3J7A F;  3GQB A;  4WJW A;  1L0X B;  3BS1 A;  1GXD C;  1IYV A;  3S1R B;  4H7B A;  3RD4 A;  1WD0 A;  2PYK A;  2CHB D;  1G91 A;  2AQ2 B;  1TS3 A;  3S2H B;  2KED A;  4A3B B;  3N6R A;  2Y0S B;  4CBV A;  5KIX A;  5E3F A;  3UI2 A;  1STA A;  3ND8 A;  5DNF A;  4B9X A;  4TRD A;  5KEE A;  2RQX A;  1BCP C;  1I4G A;  1STG A;  1GHK A;  3G7L A;  3SE0 A;  1WVL A;  1SJH D;  1TS2 A;  1JE4 A;  5C3X A;  3PUX A;  4FF1 A;  3I4N B;  2F0Q A;  4P2C B;  2NN6 G;  4XQN A;  4A3F B;  1RDP D;  1D1I A;  4C1N I;  3IKJ A;  1UNS A;  3RUZ A;  3M4O B;  5EBC A;  1GHJ A;  3E0J A;  4DAP A;  1X3Q A;  3A8J E;  4ZAI A;  3DXJ C;  3A56 A;  1UEA B;  5C3E B;  2ICE C;  1EIG A;  3HGB A;  1PRT B;  2N55 A;  1V1O A;  1QG7 A;  3TZD A;  1JWM D;  2NTT A;  5LL6 S;  1IW7 D;  1I6H B;  3S1Q B;  1WTW A;  1SYD A;  2C9O A;  2NBF A;  1LTR D;  3EVQ A;  1EU4 A;  3SHL A;  4RGO S;  4CHT B;  3BVG A;  2JEA I;  2O5I C;  1STB A;  4PMC A;  2Z8L A;  5T1G A;  1QCB D;  1E2V A;  3JAM L;  5I6W A;  2BDN A;  4BY7 B;  1GUT A;  3CRL C;  1BNZ A;  5C4J B;  4K5X A;  4E6I A;  2A68 D;  4N9T A;  1B4O A;  2F0J A;  3FDT A;  1V1P A;  1HTL D;  1O80 A;  2RVL A;  2F0G A;  1LTB D;  3G6J B;  5LHY 1;  4A93 B;  1S5D D;  1YNJ C;  4CJ0 B;  2A6H D;  5JPM C;  1PYW D;  3FMC A;  3VYU A;  2JSO A;  3H94 A;  2E76 C;  4BBR B;  4O1N A;  5I9P A;  3TP5 A;  4IQZ A;  1LTT D;  3GV3 A;  1HXY D;  3LNN A;  1RF2 D;  1Z7T A;  1SNO A;  4HTH A;  3W2D A;  2F4I A;  1CQV A;  3D4W A;  3MWY W;  3U9S A;  4S3S A;  3Q6S A;  3VR6 A;  5FLX E;  1GUW A;  4OIK A;  4RWS C;  3MC0 B;  1QB5 D;  2NN6 I;  4M1U B;  2EJF C;  1EQV A;  4GZY C;  4K14 A;  3X3M A;  4HSV A;  2KOL A;  5K36 H;  3RZD B;  1A2T A;  2JA7 B;  2F1M A;  3NP8 A;  5E4X A;  4EQP A;  3H09 A;  2E2H B;  1SYF A;  3HOX B;  2HUG A;  1I50 B;  2QEJ C;  2EYL A;  3SK8 A;  5J39 A;  3OIQ A;  2YYZ A;  1RJT A;  2B2W C;  4DXF A;  3TBI B;  3QOL A;  1S4Z A;  4K6D A;  2EYF A;  5BN3 A;  2IX3 A;  1Z47 A;  1LT6 D;  5D3D A;  5NUC A;  1X32 A;  3GP7 A;  1KTK A;  4OHJ A;  2OT2 A;  4WOR A;  5C4Z A;  3HOY B;  4RKL A;  3HEJ A;  4ZRZ A;  2F0H A;  2N88 A;  3S17 B;  4ZYS A;  3WOF A;  5I2Y A;  5I4D A;  5I6Y A;  3A8K E;  2WP8 J;  3S2D B;  4V0B A;  1EZ6 A;  4ID6 A;  4KHZ A;  1LAB A;  1SE4 A;  4IFD G;  1KDA A;  4RCN A;  5CYU A;  4KY7 A;  3ND9 A;  2H4O A;  2OF1 A;  2JE6 I;  1TR5 A;  2KUM A;  1AW7 A;  2L55 A;  5FLX L;  5CV5 A;  2A6E C;  4C56 C;  5I2X A;  1BCP F;  2PZT A;  4XIG S;  3S1M B;  1SE3 A;  4HMI A;  3I70 A;  3HP3 A;  1Y1W B;  4IFD J;  1PTO D;  3T56 B;  4IUT A;  1GUS A;  4CKE A;  1WTQ A;  3WOE A;  2B2V C;  3D3R A;  4LAA A;  5E1F A;  2Q8I B;  1SMY C;  3I91 A;  4QF4 A;  4XTC S;  4FVM A;  1R4Q B;  4XYQ A;  2X6L A;  3RZO B;  2O5J C;  4TKO B;  2MPM A;  4G57 A;  3K5M A;  2B2T C;  2F0U A;  2BOS A;  4KJO A;  1V8Q A;  1JWS D;  4XT1 B;  4IFD H;  1O7Y A;  1SYB A;  2MGS A;  1LTA D;  1AEX A;  4NMZ A;  1SFO B;  3HOV B;  4A3E B;  1Y69 U;  5EKL A;  2SDF A;  1RTO A;  1DOM A;  1TWH B;  3GTJ B;  1K8M A;  2KCN A;  3LX0 A;  4WRD A;  3L7Z C;  5ELC A;  2FIN B;  2NZ1 D;  4BA1 I;  2A69 D;  4OO1 G;  4Q0F A;  1JCK B;  5DEH A;  1BF4 A;  3D6W A;  3E5S A;  3TZU A;  2OXP A;  2Z4H A;  4J8Q A;  2ID0 A;  3L3O C;  4L6T B;  1BQQ T;  3KLS A;  2CVR A;  5FO9 B;  1BCP B;  2EY2 A;  3R93 A;  1EOT A;  3NTK A;  3FKI B;  1D1K A;  2B8G A;  3NWT A;  1EZ8 A;  4F88 A;  1VMC A;  4XQJ A;  4HCE A;  1F9Q A;  4IUR A;  1EIH A;  1F77 A;  1STN A;  3M3Y B;  5C44 B;  4ABN A;  4A3M B;  2NUC A;  2V4D A;  3JAM E;  1F9P A;  1RD9 D;  3S16 B;  2R92 B;  3VR5 A;  2B2V A;  3SDZ A;  1SMY D;  2EY6 A;  2J7Z A;  4ZQ3 A;  4H0L C;  1SJE D;  2IX0 A;  2HQE A;  1F2L A;  1W6J A;  3Q24 A;  2B2U A;  4M8A A;  2LKV A;  3BYY B;  1FD7 D;  5EJW A;  4IZ8 A;  2WKD A;  3S1N B;  3CU7 A;  1DYQ A;  5FKA C;  4FF3 A;  4FF4 A;  1XYI A;  2EYH A;  1EYA A;  1J8I A;  3NSW A;  2O4X A;  5ELF A;  3ITP A;  1EQT A;  4I7Z C;  3M4Y A;  4X3S A;  3QO2 A;  3I90 A;  1KDB A;  1EFI D;  3RMH A;  1EYD A;  2FMC A;  5FK9 C;  2JA5 B;  1EY7 A;  4K8J A;  1AZP A;  4B08 A;  3HOW B;  3EFX D;  1CI3 M;  1EY4 A;  1HTP A;  1BXT A;  1WTR A;  3DUZ A;  1NCV A;  4X3U A;  4CJ1 B;  3IAY A;  1CA5 A;  3GTP B;  3S9W A;  1QNK A;  4OL7 A;  4IUN A;  4BA2 I;  2ZXP A;  1A6X A;  3GTO B;  3VYT A;  3QOJ A;  3BG3 A;  5C0X H;  3K5L A;  1IKM A;  3KLR A;  3O13 A;  1LTG D;  1IKL A;  2K7V A;  3L9A X;  3SK6 A;  1U4P A;  3GV6 A;  2M9V A;  1UUP A;  2RBM A;  5C0X I;  3OW7 A;  1T5E A;  3ERO A;  3MA2 B;  4FP5 D;  3KF8 A;  1QWY A;  2L1B A;  2QIL A;  2A69 C;  4DK1 A;  1CHP D;  4ODG A;  2NWG A;  1JOQ A;  4DU9 A;  3D4D A;  1WTX A;  5C6A A;  1ROD A;  2R3Z A;  2K01 A;  4PMB A;  1PTO H;  1XXG A;  5J22 A;  1Q3L A;  4A3G B;  4HED A;  4DNT B;  1CFM A;  2M2L A;  1FNU A;  1WCM B;  2NYZ D;  3Q0A A;  2B2W A;  2VB2 X;  1SNQ A;  2DNE A;  1MBY A;  3QWN A;  1B2T A;  2AWN A;  4C2M B;  1VF7 A;  2HDL A;  1VCI A;  1B9M A;  3V05 A;  3CKI B;  2VUM B;  2K03 A;  2PZW A;  1SBB B;  1Y1V B;  4FXD A;  1O7L A;  3KUP A;  1RHP A;  1RTN A;  3J80 E;  4QB4 A;  2JP1 A;  1S5B D;  1HA6 A;  3VA7 A;  1MGS A;  2JYO A;  1ESF A;  4KN7 C;  3DWP A;  1XX8 A;  5ISR A;  1PMR A;  2YU9 B;  3NXW A;  4WFN 3;  2QF7 A;  2NVX B;  1H9K A;  4ULL A;  2C5C A;  5M3M B;  5BN4 A;  3H91 A;  4CKB A;  2LFN A;  3J81 E;  3BVZ A;  4IFD I;  2J0T D;  2X6G A;  3NWS A;  3GD7 A;  5EKK A;  5TSS A;  3V96 A;  1AZQ A;  1ZXT A;  1TY0 A;  2DY7 A;  2KQ3 A;  3I3C A;  1IL8 A;  3K5O A;  1X3P A;  1HFG A;  1RKN A;  2JXM B;  2VNU D;  2A74 C;  4A3I B;  1GOZ A;  3QB3 A;  2VB3 X;  2ENB A;  2K04 A;  3SK4 A;  5FOB B;  1TT2 A;  1WD1 A;  3MXN A;  3X3N A;  1K83 B;  3Q22 A;  3D31 A;  4FNF A;  1D5Z C;  3V2T A;  1G6Z A;  1G2S A;  1R9T B;  1T5X D;  3WDN A;  2FJ2 A;  5EGT A;  4ZKC B;  3R3O A;  3T13 A;  4IUV A;  5DM6 3;  3K5N A;  2B8F A;  1I4H A;  2A5H A;  2ICI A;  1AFP A;  3DEO A;  4DA2 A;  5ELD A;  1I3Q B;  5CGK A;  4FXG C;  5FO7 B;  2A68 C;  3OMG A;  5KGU A;  1PRT F;  2FHT A;  3TP7 A;  5M5W B;  1AN8 A;  3C1E A;  5E4W C;  5CV7 A;  4FXK C;  2WV6 D;  4R9W A;  1E0B A;  1LAC A;  3NK9 A;  1A3T A;  1I4P A;  2AQ3 B;  1BCP D;  2EY5 A;  3TSS A;  2E2D C;  2K5W A;  4FO2 A;  2EE1 A;  1FNV A;  5D3I B;  2NTS A;  2AUK A;  3K0Y A;  1A2U A;  5IGG A;  3FPP A;  2PW5 A;  3VR2 A;  5FO8 B;  5JJZ A;  3MAQ A;  1NR4 A;  3HRZ C;  2EJG C;  1EL0 A;  2NB0 A;  1W6K A;  3BDC A;  4RFB A;  3F2U A;  3S15 B;  3FRP B;  2EOT A;  5CMD A;  1C48 A;  4Z9C B;  1SYC A;  2R93 B;  3BVM A;  2EYO A;  3FEW X;  5C5M A;  5EPJ A;  3AMU A;  3A55 A;  4J6H A;  3K7A B;  5IGC A;  4FF2 A;  3C46 A;  4V19 0;  2F0L A;  1G8Z D;  5DAU A;  1Y8P B;  3PV0 A;  2KCC A;  5IT9 E;  4RHS A;  3T53 B;  2F0P A;  1RCV D;  2O2L D;  4DK0 A;  4RCO A;  2M00 A;  1F2Z A;  4F7X A;  3EA6 A;  5I9O A;  3IFD A;  4ZUJ A;  4K8I A;  2QDB A;  3J7A V;  3D4R A;  5ELE A;  1UAP A;  3OSO A;  5CV9 A;  1A3U A;  4IN3 A;  1F2M A;  4H13 C;  1BR9 A;  3CHB D;  2XWB B;  4ME5 A;  2PW7 A;  2R6G A;  1M8A A;  5IOD A;  2TMP A;  2E2I B;  2XRS D;  4MN3 A;  1CM9 A;  4XT3 B;  4K2L A;  4K6L A;  3RLF A;  3NE5 B;  2L0C A;  2K5Q A;  5COR A;  1NUC A;  1S5C D;  1GUN A;  1HUN A;  4CGY B;  1PFB A;  3MXP A;  3MTS A;  4CKC A;  1PZI D;  1DXM A;  2WAQ B;  2BE5 C;  1PRT C;  2D62 A;  2F0W A;  2LS0 1;  1YNJ D;  3S14 B;  5EPK A;  1TWF B;  3A54 A;  1SXT A;  4L63 B;  4J1M A;  4A3J B;  1VDZ A;  1AP0 A;  3PIO 3;  1ILP A;  1Y8O B;  1TU2 B;  4G7Z C;  1CA6 A;  5LL6 X;  4RGM A;  3GTL B;  2VXW A;  4KD3 A;  4JBW A;  1EEF D;  4XDX A;  1Q12 A;  4L8J A;  1CZW A;  4EVO A;  5EPL A;  4IAL A;  1EY6 A;  1SNM A;  5K36 G;  1TS5 A;  4PMW A;  2EPB A;  3T16 A;  2GA4 B;  1TWC B;  3NHH A;  1HCZ A;  1TWA B;  2L11 A;  3D8G A;  3GTM B;  4EQO A;  1B3A A;  4H44 C;  3GTG B;  2SOB A;  2AQ1 B;  1ET6 A;  3H0G B;  1KLU D;  5C0X G;  4KMU C;  3K59 A;  5M5Y B;  1OXV A;  3ONA B;  4ZLT F;  2EVB A;  3VR3 A;  5IGB A;  3OWF A;  4IUU A;  1E2W A;  1EY0 A;  3K57 A;  2EJM A;  4I65 A;  4R8I A;  1F9R A;  4DN4 M;  4BBS B;  5KRU A;  1LT5 D;  1PDQ A;  1NAP A;  3PUV A;  1OXS C;  2B2T A;  1U9R A;  3K6O A;  4G7O C;  3TN2 A;  1ICW A;  4KY6 A;  1PXU A;  5DM7 3;  2F0F A;  2B63 B;  1CHQ D;  1Q1E A;  3OOC A;  3C3L A;  3PMF A;  2F03 A;  2IT1 A;  3A8I E;  3BDO A;  1ENC A;  2R61 A;  3PIP 3;  5C4H A;  1A3V A;  5A2Q E;  2MUY A;  4EQN A;  3IL8 A;  2F0V A;  4BS9 A;  1H9R A;  4G4K A;  1H9M A;  1V1P B;  2E2J B;  2SEB D;  5BN5 A;  1HUM A;  5C4X B;  2J4X A;  2B39 A;  1FGB D;  1OXX K;  1HFN A;  2H1E A;  4OO1 I;  4DXG A;  3PO3 B;  3P7J A;  5C3W A;  1NSN S;  2LMC B;  4KKU A;  4A3K B;  1EY5 A;  5EBD A;  2SNM A;  2I46 A;  3BYT B;  4TSS A;  3D6C A;  1PFM A;  3W3A A;  2F0M A;  2XRQ D;  1LO5 D;  3M7N A;  2KEC A;  2NN6 H;  3OIP A;  2Z4I A;  1EYC A;  1HRJ A;  1JWU D;  1F2Y A;  1CZG A;  4C3H G;  3ZYY X;  1EEI D;  1XTC D;  4N9P A;  1VMP A;  2WIN B;  3I8Z A;  2XN9 C;  1PLF A;  1VF5 C;  2F0I A;  5CBA E;  1I4X A;  2KEE A;  4QMG A;  3NBH A;  5KYI A;  1L0Y B;  3DEP A;  4OIJ A;  2A6E D;  3C2P A;  4KI0 A;  1U4R A;  4KD4 A;  5HUR A;  2EYM A;  2IW3 A;  4XYO A;  3I4L A;  2NVQ B;  5F2D A;  5JOB A;  3TDQ A;  3PO2 B;  4KY5 A;  2TSS A;  1G2T A;  3GTQ B;  1ZKO A;  1QE6 A;  3NQT A;  4NP5 A;  3NBI A;  4NKL A;  3HKZ B;  3I72 A;  3T4A C;  2PMZ B;  1KAA A;  1DJR D;  3EQL C;  1E2Z A;  1B1Z A;  1F9S A;  1NR2 A;  5CV4 A;  2A6H C;  2JEB I;  4PV1 C;  3SVM A;  4K5V A;  2IPK D;  2RDG A;  1GJX A;  3C1F A;  4QUC A;  4QIW B;  2F0D A;  3K58 A;  1PFN A;  2D9U A;  5IGD A;  4G7H C;  3QIA A;  2F0T A;  2QKI C;  1CQF A;  2KJX A;  5D14 A;  1D2B A;  2L5T A;  1BO0 A;  5A35 A;  1O7Z A;  4XQQ A;  1II3 A;  1JOK A;  1EU3 A;  4DFA A;  5KND A;  3QJY A;  3LWU A;  1JB3 A;  4CJ2 C;  4KJN A;  1QIL A;  2WII B;  2FMM A;  4F87 A;  3SK5 A;  1MD2 D;  1SSO A;  2CQA A;  1B9N A;  5JVH 3;  4LMQ D;  2XWJ B;  5EQ0 A;  3HG9 A;  3A7L A;  4Q5V A;  2DNC A;  3OHX C;  2XVS A;  2EDG A;  2K1B A;  3VYS A;  1A15 A;  5COY A;  3MVV A;  1SDF A;  4MHE A;  4HAE A;  3AU7 A;  3BZD B;  3MZ5 A;  4UDU C;  5JEA G;  2KA7 A;  1PZJ D;  1S5F D;  4HCS A;  5C0X J;  2F0S A;  5M9O A;  1EY8 A;  4RGT A;  1LLR D;  1DON A;  3SEB A;  2L4N A;  4MIU A;  2XNA C;  2PNR C;  4O42 A;  1ZEQ X;  1OO9 B;  2EYP A;  3PUW A;  2ZT9 C;  4RKB A;  2QCP X;  2F3W A;  4JK1 C;  3CRK C;  3HOU B;  1D6E C;  3H6M A;  1O78 A;  4YIJ A;  3BDL A;  3VA5 A;  4KHV A;  1ONL A;  2X69 A;  2PPB C;  5A2Q L;  4DNR B;  3SXH A;  4Y7N B;  5M3F B;  2PCF B;  3N52 A;  2EXZ A;  3KK7 A;  4AYB B;  4DF7 A;  4X3T A;  4C1N K;  4C3H B;  1DZ1 A;  2PZU A;  3KBG A;  3J7Y W;  3DMU A;  1B50 A;  3VYR A;  4OGQ C;  4RHR A;  1DOL A;  3OWE B;  1TVX A;  2DY8 A;  3I4M B;  4HSP A;  2B2Y C;  1D5X C;  1K8O A;  1C4Q A;  2E74 C;  3FPU B;  1STE A;  4FYD A;  3DWA A;  3MHB A;  1MI2 A;  1KNE A;  5IOC A;  3R8B A;  2FFK B;  4KK7 A;  5JEA J;  1KDC A;  2AUJ D;  2F0K A;  3PUY A;  1JIC A;  4PQX A;  2BCO A;  1TY2 A;  4IUP A;  1PTO B;  5KYL A;  1TQO A;  1ILQ A;  2NVY B;  2Q8R E;  1JOO A;  1EWC A;  2MJ8 A;  2RSN A;  1I4R A;  2L9H A;  1YNN D;  5T1I A;  2XSC A;  2F0N A;  2HCI A;  3P20 A;  5IGE A;  1IYU A;  4F8M A;  5D65 A;  3U9O A;  1V43 A;  3R2T A;  1OXU A;  3TP6 A;  1SND A;  2ZXR A;  1J9O A;  2Q8T A;  1LT4 D;  2F0E A;  3GTK B;  2WAC A;  4DAY A;  3J80 L;  2K28 A;  4PNY A;  3EJI A;  1EY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...