4OXPA

X-ray crystal structure of the s1 and 5'-sensor domains of rnase e from caulobacter crescentus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
200
Chain Sequence
KQLRGNIYLAKVTRVEPSLQAAFIEYGGNRHGFLAFNEIHPDYYQIPVADREALMRDDDVEEELARRKRRLMRKYKIQEVIRRRQIMLVQVVKEERGNKGAVLTTYLSLAGRYGVLMPNTARGGGISRKITAVTDRKRLKSVVQSLDVPQGMGLIVRTAGAKRTKAEIKRDYEYLLRLWENIRENTLHSIAPALIYEEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease E
publication title Molecular recognition of RhlB and RNase D in the Caulobacter crescentus RNA degradosome.
pubmed doi rcsb
source organism Caulobacter crescentus
total genus 55
structure length 200
sequence length 235
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oxpA01
4GLAC 1MJCA 4YWLA 5ELNA 3TQYA 4A3MG 1PH8A 1V43A 4LF6Q 2N8NA 4XIGS 1MJEA 2WB1G 4BA1I 3IRBA 3PIOA 4YWMA 4KHPQ 2PNHA 4JI8Q 5IT9c 3L7ZC 4R4CA 1KXLA 3E9HA 3HOYH 4B3TL 1WFQA 5LMUL 3TRZA 2LSSA 4IOAA 4A3FH 1YZ6A 4GNXC 4YHHQ 3I4OA 4PMWA 3HOXH 2K5VA 4JI6L 1VQGA 3EBEA 3TEHB 1YJ9A 1FGUA 2K14A 1X65A 2JA7G 2ZJRA 4A3CH 3RLFA 4OX9L 5JEAG 5HY6A 1HR0L 3PUZA 2PQAB 1NMFA 3E9IA 1IBKL 1HNZL 2GN5A 2AHOB 1FJGL 1AH9A 1G291 3A5ZB 3D31A 5J3BA 1CUKA 4A3LH 3CCUA 3GD7A 1Z9FA 1L1OB 4BY1G 2WB1E 1WYDA 3A5UA 1N9WA 4JI0L 4LFBQ 4IFDJ 4DAYB 3UDIA 1KQSA 3OTOL 2JA8H 1SE8A 4POGA 5IYDH 4DR5L 1TWAH 1JE5A 2MFIA 2KHIA 2Z6KC 4TVAB 3U50C 3K7UC 4JOIC 3STBD 1EQRA 4IPGA 4JV5L 3HOUH 4K0KL 4GOPB 1SFOH 2E2IH 5C3EG 3PUWA 2MQHA 2UUCQ 3H3VH 4BY7G 1N32L 1XTDA 2YTYA 4LNQA 2UXDL 1SRUA 4LF7L 4DV2L 4GKJQ 2E2JH 3KDFA 1IBKQ 1CKNA 4IPDA 3KF6B 1V1QA 1K8GA 3GTKH 4DV5L 1W3SA 2FXQA 3PF4A 3WWVA 5GROA 4UP7A 4HJ5A 4RG1A 5JJIA 4IJLA 2KBNA 3DM3A 4LF6L 1OXUA 3K81C 1PH7A 1N33L 1JJCB 4PG3A 3CCSA 2JEBI 3TS0A 4B3TQ 1PFSA 5M3FH 1LUZA 3FHWA 1JB7A 4BXXG 1PH5A 4A3BG 1RL2A 2UXCL 3I4MH 1A8VA 1YHAA 1IYJB 2ID0A 3FKIG 1XMOL 4DAMA 2R7FA 4DV7L 2B29A 1IBLL 1VQ7A 3SGIA 4LUZA 4YHHL 3OYYA 3CCVA 3HKZE 4UY8C 5E7NA 3H0GG 1TXYA 4DV4L 2HT1A 2E8GA 2RCNA 4JBWA 3D0FA 5IYBH 2VQEQ 1H95A 2LXKA 4AIMA 5M5XH 4OX9Q 1HR0Q 4POFA 1KRSA 5LMNW 4Y52H 3I7FA 2D0OA 1HNZQ 5C0XJ 3ZJYC 1A62A 1WCMG 1FJGQ 4A3MH 2ES2A 2RHSB 2RF4A 5JJLA 3AYHB 1UEBA 2V1CC 2JA8G 2CCZA 2ZTDA 2JK8A 3HOWH 3KLWA 2NVYH 1GO3E 4GLVB 4JI0Q 3CW2C 4YY3L 1VS0A 2R92G 2AWNA 3PGZA 1U5KA 3K7AH 3Q8DA 3NENA 4FDBA 4A3KH 3PF5A 4A3IG 5M5YH 3OTOQ 5GAHC 3S2HH 1D8LA 4P72A 1VQCA 3G48A 4LFBL 3CCLA 3J80i 4EQ5A 4X62L 3E0EA 1A63A 1VQDA 2I0QA 5K36G 3S1MH 2Q2IA 2ZJPA 4UPAA 4DR2L 1AE2A 3F1ZA 2JA6H 3PSIA 2VNUD 2F3IA 2JA7H 1EIYB 1NE3A 2VY3A 4JI1L 2KENA 4LF7Q 2UUCL 4DV2Q 4A3JG 2ATWA 4A3DG 2BA1A 1X9NA 2VUMG 3PIPA 3K0XA 1SN8A 3GDEA 1GKHA 4ME3A 3NELA 4R4IA 4X66L 1C9OA 3TREA 3CC4A 4DV5Q 3PV0A 2MNAA 4BBRG 5IP9G 1LTLA 4LW1A 4X64Q 4GKJL 1QZGA 4BBSG 1LM0A 2NVQH 2CFMA 4PZ8A 1VQPA 3CF5A 1SLJA 5JJKA 4A3GH 2K52A 2I5HA 4NXNQ 2Z0SA 2JA5G 4L5RC 4B3SL 1VQNA 3G71A 1B7YB 2JA9A 2F4VL 3HOZG 2R93G 2UXCQ 5M3MH 2UU9Q 3PO2H 1Y1WG 1XMOQ 3I4NG 2WFWA 3LGJA 2R7ZG 5IYCG 5C3EH 1U0LA 4DV7Q 1IBLQ 2HIXA 4IFDG 1CKOA 4BY7H 1S3OA 2KCMA 1OXXK 1Q81C 3KDFB 4DPGA 1CKNB 2DUDA 4DV4Q 4DR4L 3RZDH 5IP7G 4DR7Q 4P73A 4JI7Q 2YU9H 3I2ZA 2R7DA 1C7YA 4JBMA 2WAQG 3CP0A 1Q12A 3PUXA 4LF8Q 4LFAL 4LUVA 2VQEL 4LFCQ 4LF9Q 1IBMQ 2Z6KA 4H02A 2C35B 4Y7NH 4JOIA 3J80c 1HJPA 1YVCA 1XPUA 1TWFH 1XNRQ 1KD1C 1GVPA 3RR5A 3EIVA 1UE6A 4YY3Q 1N33Q 2N49A 3JC66 2E5LQ 1VQFA 1PV4A 2AWOA 3T1YL 3M4QA 1I5FA 5M5WH 2K50A 2D0PA 4DV0L 4IFDI 4DUYL 1K9MC 1YHBA 3M3YH 1QUQB 1PYBA 1G51A 1VQEA 4OWXB 1Y1VG 2CWAA 2IX0A 4X62Q 3CPWA 5IWAQ 1Q1EA 1OXTA 3BZCA 4JG2A 4DR3Q 4A93G 4R1JA 1CKMA 1SMXA 4DR2Q 3H0GH 3KFUA 1AE3A 1T9HA 3AQQA 2R6GA 1VQ4A 3TS2A 3U4ZA 1XMQL 4JI1Q 1VQ5A 2IHEA 1X56A 2WAQE 3M4OH 4B3RL 3HKZG 3UE0A 3CCQA 2VZAA 3J7ZC 1NBWA 1VQ9A 3CQZH 2CWPA 4X66Q 1X3EA 5C44H 3J81j 4DV1L 1Y14B 2I5MX 3AFPA 2KCTA 4YCWA 1OXVA 4X65Q 1TWCH 4GN3B 4WJ4A 3KOJA 2R92H 4DK6C 4HJ7A 4GKKQ 3G6EA 2GVAA 1B8AA 4X64L 1XNQL 4JI3L 2Q2UA 3BJUA 2Y0SG 4JI2Q 5C0XG 1KL9A 2A8VA 4B3SQ 4ALPA 3HOYG 2F4VQ 4R4TA 5FJ8H 2NZOA 4A3FG 1PA6A 2UXBL 1S40A 4NXNL 3HOXG 1PH2A 3GTMH 3S16H 4IPHA 1QVGA 1GD7A 3KJPA 2YV5A 4JC0A 1VQ8A 2VW9A 2UU9L 3S1NH 1VQJA 2PI2A 4P71A 3UE1A 4DR4Q 4WJ3M 3A74A 4AQYL 4MNOA 2Q2HA 4GNXB 2IY5B 2N78A 4LFAQ 4JBKA 1EIFA 3U58A 2K4KA 4DR7L 4JI7L 4NB3A 1PHJA 1YIJA 1NTGA 2KHJA 2XTIA 1PYSB 2EQSA 4GN4B 4UP9A 5IP9H 5C4JH 3M85A 3CCMA 4LFCL 1NMGA 4HJAA 1PH6A 4LF8L 1BKBA 4LF9L 2B63G 1IBML 4A3LG 2HIVA 1HH2P 1X3GA 4GLXA 1A0IA 1XNRL 2Y0SE 2A1AA 4C2MH 3GTPH 3T1YQ 1SR3A 4QL5A 5GQOA 3HOZH 3ERSX 4RMFA 3U4VA 5GAEC 3ULJA 2VQFL 4DUYQ 4DV0Q 2E5LL 4GN5A 2UUAQ 1Y1WH 3MEFA 3F2DA 2R7ZH 3I4NH 3VDYA 3PO3G 1TWGH 3F2CA 4B3ML 1BVSA 3NEMA 1QVCA 2A19A 4AYBG 3HOUG 2ALYB 4APVA 1E7ZA 4DR3L 5IP7H 3STBC 5IWAL 3H15A 4DUZQ 3GTOH 4JCVE 4IOCA 3F2BA 1XMQQ 1QVFA 1I94Q 1CSPA 4B3RQ 4C3JH 2YTVA 2K75A 3K8AA 3F8TA 1KC8C 1YHQA 1L2FA 5FLMG 1Q7YC 1SROA 1L1OC 3CPFA 1EWIA 1D7QA 4DV1Q 1XPRA 4DR6L 1VQLA 4JI4L 1X55A 1O7IA 3L0OA 3AEVA 2DGYA 2ZTEA 4LUOA 4BY1H 4LF4Q 1XNQQ 3KJOA 4JI3Q 1BBWA 2RHQB 4X65L 4LF5L 4J15A 4PZ7A 3CCEA 1X54A 4GOPC 1E1OA 4GKKL 5DLQE 1B70B 2UXBQ 4O0AA 5BR8Q 4A93H 1HZ9A 4JI2L 2VS1A 3I4MG 1V9PA 1P8LA 2CQOA 4AYBE 4DNIA 3PCOB 1XJVA 2NN6G 3W1BA 3J81i 1YBYA 3CMEA 1CSQA 1I50H 1WJJA 4AQYQ 2ZTCA 3OW2A 3ULLA 1YITA 2BA0A 2I5LX 3MXNB 1WI5A 2L15A 3UDFA 2E2HH 3RLNA 4AH6A 3CCJA 1HNWL 1VQAA 4OONA 4JYAL 3BZKA 1OTCA 4JI5L 4NXML 1VQ6A 1Q86C 4DKAC 1HNXL 2UUBL 2OTJA 1UE5A 4P74A 1OXSC 1N34L 3HOWG 1FL0A 2EXDA 3S2DH 2ZM6Q 1Q8KA 1ASYA 2PI2E 1VQHA 3W5OA 3I55A 4HIMA 3T1HQ 1YI2A 2Q2TA 2D62A 2WP8J 1S72A 1EUJA 4DK3C 4A3KG 3CCRA 2VQFQ 4QIWE 2OTLA 5C4XG 2NN6I 1HZCA 2VL6A 4A76A 4UP8A 4XTCS 2YTXA 1J5EL 4B3MQ 4TQUS 4BXXH 4A3BH 3ULPA 2H5XA 5FLXc 4QGUA 2UUAL 3FKIH 4OO1G 3B6YA 1VQIA 4R4QA 3S24A 1NJIC 2NZHA 2NVXH 2AKWB 3HOVG 1IL2A 4DV6L 2JA6G 3A0JA 3JAMc 1PH4A 1K8AC 2JQOA 1E1TA 3S14H 1VQBA 1HZAA 3CAMA 4QY7A 2YYZA 4HIDA 4HIKA 3ER0A 1YNXA 2N3SA 4DUZL 3PUVA 3S1RH 4C3HH 1I94L 5GADC 3UDGA 1ASZA 3S17H 4L5QA 5LMNL 1N36Q 4DR6Q 3HKSA 4JI4Q 1WCMH 2B63H 1YJWA 3ICEA 1KHIA 4BA2I 4HJ9A 2JE6I 4JBJA 3J81c 2BH2A 1MIUA 3KF8B 5EAYA 1IXRA 2HHHL 3M7NA 1M90C 1J6QA 1VCIA 1YEZA 4LF5Q 2EIFA 4A4IA 1JMCA 4OWWB 4A3GG 1JT8A 3GO5A 3CC2A 4A3IH 1Q82C 3PO3H 4OO1I 4LF4L 3RNUA 4KI0A 3M9BA 4IJHA 5M3MG 3G4SA 4R4OA 3GTGH 3PO2G 3CXCA 2LXJA 1XPOA 5BR8L 5JEAJ 4OWTB 2IX1A 3I56A 3RN5A 2IHFA 4MZ9A 2XGTA 4DV3L 4L5SA 1Z47A 4C3IH 4DR1L 3KYHC 1HZBA 2OQKA 4P75A 1N8RC 5FLMH 4HIOA 1HNWQ 4JYAQ 3FP9A 4A75A 4MTNA 3GTJH 4A3JH 1W2BA 4JI5Q 4NXMQ 3S1QH 4A3DH 1Q1BA 1HNXQ 2VUMH 1GM5A 2UUBQ 4YWKA 4A3CG 1FVIA 1HR0W 3L2PA 5AJ3L 1N34Q 1UE7A 4BBRH 1UWVA 1K83H 4LWCA 1E22A 2BH8A 4NPSA 5C0XI 2PQAA 3W1GA 2NVTH 4BBSH 1PH1A 4QQBX 3PUYA 5LMUQ 1LYLA 1VQOA 1EFWA 1QZHA 2ZM6L 2PMZE 1EOVA 3J7A5 4KHPL 3T1HL 4JI8L 4L5TA 3RN2A 4JI6Q 1J5EQ 1YJNA 4EX5A 2JA5H 1L1OA 2R93H 1G6PA 5IYDG 2OCEA 1EYGA 3UDXA 2F52A 4A3EG 5IYCH 1QUQA 3RZOH 5H1SE 4HJ8A 1KAWA 2QA4A 4DV6Q 1NY4A 1X6OA 4QJFA 2AMCB 2JJQA 3DLLA 1E24A 1WOCA 4A3EH 3CD6A 3CMAA 1PVOA 1K73C 4GOPA 4KHZA 3NBHB 4YCUA 3AFQA 1KRTA 5LMNQ 1R9TH 3M4PA 1PH3A 4IPCA 1K0RA 5C44G 2QEXA 1I6HH 4YCVA 2GVBA 1EQQA 3EN2A 3GTQH 1VQMA 1RIPA 2HHHQ 1N36L 2OQ0A 3S15H 1BBUA 1PH9A 1KIXA 2JEAI 3KF6A 2IT1A 1MKHA 1K3RA 1P16A 3RLOA 1JJ2A 5C4XH 3JAMi 4DR5Q 1VQKA 2ZJQA 5HGQA 1L0WA 2B3GA 4KLKA 4GS3A 5FJ8G 2MO1A 4JV5Q 4O2DA 4K0KQ 2ASBA 1Q46A 1Y1VH 3BU2A 5M3FG 2K5NA 4OXPA 1M1KC 3H3VI 3HOVH 1TWHH 2K5HA 2QGQA 1N32Q 4DV3Q 1C0AA 1IZ6A 4DR1Q 1UE1A 1I3QH 2HQLA 5IY0A 2UXDQ 1JJGA 1DGSA 5ELOA 2MO0A 2OWOA 4IO9A 3GTLH 1X3FA 3K80C 5IYBG 5GAGC 5IE8A 4GNXA 1E3PA 3HFZB 4X6AH 4PZ6A 2CKZB 5AJ3Q 3CC7A
chains in the Genus database with same CATH superfamily
4YWLA 5CV9A 2KECA 3TQYA 1STBA 2K01A 2WB1G 3PIOA 5C0XH 3GTKB 3L7ZC 4OIKA 5LMUL 4A3FH 4F87A 4GNXC 4PMWA 4JI6L 2K5VA 2F0OA 3EBEA 3W2DA 3QG1A 3GTMB 5M3FB 2F0QA 1YJ9A 1FGUA 3I4MB 3TP5A 3K5OA 1YNND 2ZJRA 4A3CH 3BDCA 5IGBA 3RLFA 2QKIC 1EY6A 5JEAG 4OX9L 5HY6A 1STNA 3DWPA 3E9IA 1PRTF 1TKWB 2AHOB 1G291 3A5ZB 3H94A 1NUCA 2E2DC 2FINB 2F0JA 4BY1G 2NTSA 1X3PA 1WTQA 4A3MB 4G4KA 1PZID 1SNOA 4POGA 1LABA 5IYDH 2NVYB 1JE5A 2KHIA 1B44D 4JOIC 3NBIA 1H9SB 4JV5L 3MTSA 1IW7C 4K0KL 4LAAA 1SFOH 3S2HB 4KN4C 1DOLA 3PUWA 2MQHA 3H3VH 3E5SA 1XTDA 2YTYA 2A69C 2P5ZX 4RGNA 4RWSC 2JA6B 1V1QA 1Y8PB 2O5IC 1W3SA 2FXQA 3WWVA 1H9KA 5JJIA 4IJLA 3DM3A 1JWSD 1Z7TA 2EYHA 3OIQA 2O5JC 1OXUA 3K81C 1AEXA 5C3WA 4PG3A 4B3TQ 1LUZA 4ID6A 4I65A 1A8VA 5C3XA 3FKIG 4ZLTF 2RDFA 2R7FA 5LL6X 2B29A 1MD2D 3SGIA 4YHHL 1WVLA 4UY8C 1SNPA 2RA4A 4C56C 4DV4L 2E8GA 2RCNA 4JBWA 5E1FA 5IYBH 1H95A 5M5XH 3VR5A 1HR0Q 4POFA 1KRSA 5C0XJ 3VYSA 1A62A 3ZJYC 3RZDB 1CZWA 2RF4A 3FPPA 4KKSA 1HQMC 3NXWA 3HOWH 2M2LA 3BVMA 3R8BA 4JI0Q 4DU9A 4CGYB 3X3NA 1U5KA 3K7AH 3KF8A 4KKUA 4OEMB 5M5YH 3OTOQ 3D3RA 1EZ8A 1D8LA 4P72A 1VQCA 1W6JA 4LFBL 3CCLA 2RSOA 1SE2A 2EVBA 4EQ5A 1FYCA 5IGCA 2RQXA 4OO1H 3S1MH 3TN2A 2Q2IA 1II3A 2EZVA 3DWQA 3SXHA 2F3IA 1ENCA 1Y69U 1LT4D 1NE3A 2KENA 3CKIB 4FF2A 4ZAIA 2ATWA 5I6YA 1PFBA 1KLUD 5IIFA 1EY9A 1EY4A 5K5PA 3TREA 3Q23A 1XTCD 2WACA 4KD3A 1SJED 2CFMA 3QB3A 1D2BA 5JOBA 3HEJA 3CF5A 4A3GH 2K52A 4NXNQ 4EVOA 4B3SL 4RKLA 1JWUD 4LK1C 5BN4A 3EQLC 1KAAA 1T5EA 2C9OA 3JAML 1U0LA 1IBLQ 4IFDG 1A6XA 5EBDA 5CV7A 1GUNA 3A8JE 3S16B 2YU9H 1S5BD 2WAQG 4LF8Q 1Q12A 3NK9A 4LUVA 2VQEL 3BDOA 3R2IA 1BUVT 1JOQA 4H02A 2C35B 4Y7NH 1U9RA 4JOIA 1HJPA 1DOKA 1XNRQ 4DFAA 1KD1C 1GVPA 1UE6A 2MP1A 4YY3Q 1N33Q 1VQFA 1PV4A 3T1YL 1CFMA 1CZGA 4IFDI 1Y1VG 2CWAA 5IGGA 4X62Q 3CPWA 1Q1EA 1OXTA 3BZCA 5CYUA 3HOZB 2L55A 3K5MA 1Y1WB 1T9HA 1VQ4A 2R6GA 3U4ZA 4ZK9B 1DZ1A 4JI1Q 1BOSA 3M4OH 4QB4A 4B3RL 3UE0A 1ONLA 3CQZH 4ZUJA 4XYOA 3MXNA 4X66Q 5C44H 3J81j 4DV1L 1Y14B 2F0LA 2I5MX 5KNBA 2K6AA 3IL8A 4XT3B 4C3JB 1E2VA 3VYUA 3G6EA 1B8AA 1XNQL 2A8VA 4JI2Q 5IGDA 3S15B 3K57A 1STAA 1B1ZA 4ALPA 3OW7A 5FJ8H 2NZOA 5DM73 3BDLA 1HCZA 2GA4B 3P20A 1QVGA 1GD7A 2YV5A 4JC0A 1VQ8A 1VQJA 3BZDB 1SNCA 4P71A 3Q6SA 3UE1A 4A93B 2RVLA 2PPBC 1F2MA 3M4YA 4Q5VA 2Q2HA 4GNXB 1GHJA 2JXMB 1WTHA 3U58A 3IFTA 5FLXE 4DR7L 2ENBA 4JI7L 1I50B 2X6LA 4HMJA 1S5DD 2XTIA 4UP9A 5C4JH 2AQ2B 4LF9L 2DNCA 1SYFA 5FK9C 2B63G 1PFMA 1X3GA 3EFXD 1A0IA 4C2MH 3GTPH 1SR3A 4QL5A 4YIJA 4DV0Q 4NP5A 2E5LL 3MEFA 4RAUC 1ML0D 3VDYA 1TWGH 3J81E 2RCFA 3NEMA 2K33A 1QVCA 3HOUG 2BE5D 2XRSD 4DR3L 5IWAL 1AN8A 3DEOA 1XMQQ 3GV3A 2KCCA 1KNEA 1A3VA 3NE5B 1I94Q 1CSPA 1ET9A 2EYOA 1YHQA 1HTPA 1L2FA 2XIWA 1L1OC 2IPKD 5I9PA 4DR6L 1U4PA 1DJRD 5IT9L 2EY1A 1BBWA 1Y8NB 4J15A 4PZ7A 2PW7A 3H6MA 5DLQE 5BR8Q 3I4MG 2CQOA 3N6RA 5JVG3 3J81i 2JP1A 3CMEA 1CSQA 4DA2A 1A3UA 3MXNB 1SNMA 2BA0A 2I5LX 5CBEE 3UDFA 2E2HH 4AH6A 2K5WA 4JYAL 3BZKA 1OTCA 1TS4A 2O2LD 4ZQ3A 1EYAA 4A3JB 2Q2TA 4RGMA 1EUJA 3CCRA 2VQFQ 4QIWE 4BBRB 1JORA 4UP8A 1J5EL 3FVQA 3A56A 4A3BH 4ILWA 5FLXc 4QGUA 4FYDA 1VQIA 3S24A 1NJIC 2NZHA 1HFNA 1RTNA 2KQ3A 2JA6G 1Z6HA 3AB9A 3CAMA 1JCKB 2KOLA 4QY7A 4TRDA 2QILA 3ER0A 1IKLA 3UDGA 3ND9A 4OIJA 5I4DA 3HKSA 2B63H 5KYLA 1W6KA 1KHIA 3J81c 1M90C 1O7YA 1YEZA 1GXDC 1EWHA 1JT8A 1B9NA 3CC2A 1IL8A 2F0KA 4A3IH 2IW3A 1Q82C 4LF4L 5COYA 1FNVA 3M9BA 1NNXA 4R4OA 3GTGH 3PO2G 2SDFA 3NQTA 3KLSA 2ICIA 3TMEA 4OWTB 4XXEA 3MC0B 2PCFB 1TS2A 4QUCA 4L5SA 4DV3L 3QR8A 2A6ED 1HZBA 1N8RC 5I6WA 1GUGA 3S9WA 1HNWQ 4A75A 4NXMQ 4ZRZA 4A3DH 1HNXQ 2VUMH 1GM5A 2K03A 1HR0W 5G3LD 3L2PA 4UHVA 3GTLB 1D1KA 1LV9A 2PQAA 3Q22A 1LLRD 3A8IE 3PUYA 5LMUQ 1EFWA 1QZHA 2ZM6L 3C2PA 3NQIA 4L5TA 3RN2A 1G2SA 4IUPA 2JA5H 4EX5A 4JI6Q 3OMGA 1L1OA 2R93H 3BVGA 4A3GB 3UDXA 3VR4A 1CHPD 2DJGC 2PYKA 5H1SE 1NY4A 2A68C 4XQNA 1A3TA 1E24A 2IX3A 2PQEA 1PTOC 1BDOA 4YCUA 5IOCA 1Q8IA 3R3OA 1EQQA 1S4ZA 2EYFA 3KF6A 4XQJA 1MKHA 3O13A 1JJ2A 1U4RA 4Z9CB 4UAIA 5HGQA 1L0WA 1X3QA 2B3GA 4KLKA 2L4NA 4JV5Q 4K0KQ 3BVZA 2ASBA 1Q46A 2CH4W 2KEDA 1TWHH 2JA8B 1I3QH 4A3EB 2Z4IA 3ND8A 3HFZB 1O7LA 4PZ6A 2CKZB 2F0PA 5AJ3Q 1FNWA 1QE6A 1MJCA 3HZXA 3EROA 1PH8A 1EU4A 1SSOA 3PMFA 4BA1I 4JVZA 2J4XA 5I2XA 4G57A 4JI8Q 3HOYH 3TRZA 1WFQA 2LSSA 1HXYD 1YZ6A 4YHHQ 3I4OA 3T4AC 3TEHB 5E4WC 1MHWC 4C3JG 4EQNA 2PZTA 2JA7G 2Q8TA 1K0SA 2F0GA 3PUZA 2PQAB 1NMFA 1SNQA 1AH9A 2DNEA 1RD9D 2I07B 3I70A 1CUKA 1RHPA 4A3LH 4N8X1 1SAPA 1Z9FA 1L1OB 1U4LA 1WYDA 1STHA 4LFBQ 1QILA 1OO9B 1IYUA 4J6HA 4DR5L 2F0HA 3K7UC 4LMQD 2EY2A 1KDAA 4DF7A 2PZWA 5KIXA 1BF4A 3SE0A 4LNQA 2B2TC 4LF7L 1RDPD 4DV2L 2E2JH 1GHKA 1IBKQ 4IPDA 1O7ZA 3A54A 1QCBD 3KF6B 4Q0FA 1K8GA 1WTXA 1DONA 2N55A 4C1NI 3PF4A 2KBNA 4HTHA 5LL6S 4LF6L 2IJ0A 5I9OA 4R9WA 1GOZA 4G7OC 2JEBI 3J80E 2H4OA 2AUJD 4QUFA 4BXXG 2UXCL 3I4LA 1YHAA 1IYJB 1XMOL 3KLRA 2NN6H 4OGQC 3HKZE 3H0GG 1TXYA 2VQEQ 1TS3A 4H13C 3LWUA 5C3EB 1WTVA 1UAPA 4C3HG 4ZKBB 4BY7B 3I7FA 2D0OA 1HNZQ 1WCMG 1FJGQ 2ES2A 3DWAA 3AYHB 5EQ0A 1MSHA 2ZTDA 3CRLC 3CW2C 2R92G 2AWNA 2VB3X 3PGZA 4FDBA 3NENA 3A7AB 5JAVA 3PF5A 1E2WA 3G48A 4MN3A 4H44C 3J80i 3E0EA 2WIIB 3NUCA 5M5WB 4UPAA 1ZKOA 3M3YB 2VNUD 2EY6A 2JA7H 3NHHA 1ENFA 2A73B 2ZXRA 1B2TA 4A3JG 2BA1A 1X9NA 1KNAA 3GDEA 1GKHA 3FMCA 4ME3A 3NELA 4B08A 3CC4A 4H7BA 2B2YC 3PV0A 4BBRG 5IP9G 1LTLA 4DV5Q 1QZGA 2OF1A 4BBSG 1LM0A 2NVQH 1VQPA 1TR5A 4FXKC 3ONAB 3OSOA 4CBVA 1TWCB 2JA9A 3NP8A 2F4VL 3C1EA 3FDTA 5M3MH 1MBYA 1JC7A 4I7AA 1STYA 1ILQA 3NPPA 2WFWA 3LGJA 3I4NG 5IYCG 3VYTA 4DV7Q 4NKLA 1EIHA 4DPGA 3SEBA 2VB2X 1YNJC 2J7ZA 4DR4L 2Z8LA 1CA6A 4DR7Q 4JI7Q 1LTGD 2BE5C 2ZXOA 4GZYC 1QNKA 4LF9Q 2QCPX 3J80c 3OHXC 1TWFH 1PTOB 4NW2A 4KJNA 2KJXA 5J39A 3GV6A 3I91A 2N49A 3JC66 1F2YA 2E5LQ 4HAEA 3NTHA 5C4HA 2B2TA 1QUQB 1PYBA 3URYA 2K28A 2IX0A 4DR3Q 2A68D 5IWAQ 1SMXA 4DGZA 4DR2Q 3H0GH 1PTOD 3RUZA 2R7ZB 1LTRD 3AQQA 5KNDA 3TS2A 3X3MA 1FNUA 1VQ5A 1HUNA 3Q24A 2VZAA 3J7ZC 2K32A 3GTOB 2F0MA 2CWPA 1EOTA 4FXDA 3AFPA 1GUOA 1OXVA 3KOJA 2R92H 4DK6C 3EJIA 2B2VC 3MFGA 4X64L 2B8FA 1PA6A 2UXBL 4ZCKA 4DXFA 4DK1A 3HOXG 1G8ZD 1JR0D 3SVMA 4RFBA 1B3AA 1AZQA 2UU9L 1QOHA 4WJ3M 3H3VC 4AQYL 1STGA 2V4DA 2N78A 4LFAQ 1EIFA 2K4KA 3DXJC 4KK7A 4NB3A 4HEDA 1YIJA 5IP9H 2EYJA 4L63B 1NMGA 3HKZB 1BKBA 2HIVA 4GLXA 1TU2B 4M8AA 2AQ3B 2BCOA 3D6CA 3ERSX 2RDGA 2JA8G 4DUYQ 3MWYW 4GN5A 3I4NH 3PO3G 3F2CA 2NYZD 2Y0SB 1BVSA 4CDDC 1J8IA 4S3SA 2B2YA 1F9PA 2ALYB 1SEBD 3STBC 3TP8A 4IOCA 3F2BA 2CW0C 2XNAC 4C3IG 3K8AA 3M7GA 2F0DA 1KC8C 1H9RA 1SROA 5JEAH 3MVVA 4KY5A 3D4RA 1XPRA 2A6EC 4JI4L 2JSOA 1O7IA 5EKIA 2DGYA 5G3LF 4BY1H 1KDCA 4LF4Q 3KJOA 4JI3Q 3S17B 1AP0A 2RHQB 2FMCA 4X65L 5IGFA 4GOPC 1E1OA 4GKKL 1B70B 4O0AA 1DXMA 1V9PA 1I4PA 1UEAB 1EEFD 1XJVA 1E0BA 1YBYA 2HCCA 2NWGA 4K8JA 2BDNA 2ZTCA 2XN9C 3C1FA 1ICWA 1WI5A 2EYPA 2MGSA 1WTOA 4FP5D 3WOFA 4KMUC 5DEHA 4JI5L 2L12A 1VQ6A 3K6OA 2UUBL 1OXSC 1R4PB 1N34L 1SYEA 2KA7A 2EXDA 2RBMA 3GTJB 3S2DH 3LNNA 2ZM6Q 4HR7B 1YI2A 1VQHA 4IUNA 2DY7A 4CKCA 4A3KG 5EBCA 2OTLA 3K0YA 5C4XG 1K83B 4A76A 4XTCS 4B3MQ 3IAYA 3ULPA 1XYIA 3FKIH 3B6YA 5F2DA 4R4QA 3BS1A 3DMUA 2NVXH 2AKWB 3HOVG 1IL2A 2B2VA 2JQOA 3S14H 1HZAA 4LJZC 5AFWA 1CQFA 4DUZL 1YNXA 3RZOB 3S1RH 4DAVA 3V05A 2EE1A 5A2QE 1ASZA 2B2UC 5LMNL 1O78A 2K7VA 4PMCA 4H0LC 5DNFA 3ICEA 4BA2I 4HJ9A 4JBJA 3SK8A 3SK5A 2BH2A 3BG3A 3G6JB 3KF8B 1IXRA 5EAYA 1VCIA 4K8IA 4IQZA 4LF5Q 1JMCA 4XQQA 3RD4A 3PO3H 4V190 3RNUA 4JK1C 4X3KA 3TP6A 5JEAJ 1V1OA 1B4OA 2CH4A 1O80A 5ELBA 2OEOA 2IHFA 1TVXA 2K5DA 3OOCA 2H1EA 4C3IH 4DR1L 3I90A 4BS9A 4IUUA 4HIOA 2R3ZA 3FP9A 3K5LA 3S1QH 5NUCA 1Q1BA 2E74C 1KLGD 1UE7A 2PZUA 1E22A 4K5VA 3KUPA 4NPSA 2NVTH 3I72A 2SEBD 1PH1A 1MSGA 1LYLA 1QB5D 3T1HL 5C5MA 1YJNA 2L0CA 1Q90A 4DAYA 1YNJD 1EWCA 5CGKA 4DV6Q 4IFDH 2AUKA 4KD4A 4CKBA 4A3FB 4QJFA 3DLLA 1PVOA 1K73C 2IWHA 1NAPA 4GOPA 3AFQA 1R9TH 3M4PA 4YCVA 3GTQH 2HHHQ 2OQ0A 4WORA 4XT1B 3QIAA 3P75A 1KIXA 5CV5A 2HCIA 2L1BA 1P16A 5C4XH 3GP7A 4DR5Q 2ZJQA 3NWTA 4CJ2C 2G9HD 2F3VA 4HCSA 1B3QA 1Y1VH 4MTKA 5M3FG 4ZUIA 2EDGA 4OXPA 3HOVH 1KTKA 1D6EC 4MIUA 4DNRB 2E76C 5CORA 2LKVA 2MPMA 5IY0A 1JJGA 2OWOA 4IO9A 3KBXA 3K80C 5GAGC 1SFOB 5CMDA 2OXPA 1E3PA 1D1IA 2F4IA 1I4XA 4GLAC 5ELNA 3L3OC 5EKLA 4A3MG 3E0JA 3A7LA 1JICA 5FKAC 5KGUA 4LF6Q 2N8NA 4XIGS 1JE4A 3IRBA 4KHPQ 3J7YW 3E9HA 2LFNA 3TSSA 4ABNA 4B3TL 2B2UA 1S5ED 5DM63 1NSNS 3EA6A 5FO9B 5ELCA 3J7AV 4ZKCB 1HR0L 3WDNA 3NTIA 4JPBW 2EYLA 1GUSA 3D31A 1TT2A 5M5XB 2EPBA 3GD7A 3MXGA 1EYDA 1BXTA 1N9WA 4JI0L 3LWEA 4IFDJ 4DAYB 4IZ8A 1R4QB 3SDZA 3UDIA 1KQSA 3OTOL 3TP7A 1EFID 3HOWB 1TWAH 5E4XA 1FGBD 2Z6KC 2MFIA 3STBD 1VF7A 3K7AB 1BCPC 4RCNA 3HOUH 2CW0D 5M5YB 4GOPB 3HG9A 2E2IH 1T5XD 3D6WA 2HQEA 4CHTB 1CHQD 3FPUB 3G7LA 1C8CA 1N32L 3I3CA 3MAQA 2UXDL 2BDOA 3S1MB 3KDFA 2RSNA 3TZDA 3GTKH 1B53A 5ELEA 5GROA 2D9UA 1I6VC 5KNCA 4RG1A 4HN7A 1PH7A 3TS0A 2F0TA 5M3FH 1RL2A 3I4MH 1GJXA 4KJOA 4R8NA 1ET6A 1H9JA 1IBLL 1VQ7A 3OYYA 1DCZA 2Z6BA 3CCVA 5E7NA 3HRZC 3SR1A 3P7JA 5D65A 2LXKA 3SK6A 4OX9Q 1PTOF 4IUVA 4A3MH 2RHSB 3GQBA 2FFKB 4DNTB 5JJLA 2YU9B 4HMIA 3KLWA 4XYQA 2NVYH 4YY3L 1VS0A 1S5CD 4Y7NB 4PMBA 1DM0B 1VDZA 3S2HH 3V2TA 2E75C 1CM9A 3E3XA 5HURA 2LMCB 4X62L 2WINB 1A63A 1VQDA 5K36G 4ULLA 3F1ZA 4ODGA 3SK4A 2JA6H 5T1GA 4JI1L 4IN3A 2UUCL 2EJFC 3ITPA 4B9WA 1ESFA 3QOLA 3K0XA 1SN8A 3RMHA 3VR2A 4X66L 1C9OA 4GKJL 4KY7A 4X64Q 3M4OB 2NZ1D 1GUWA 4CDCC 1IKMA 1HHVA 3CQZB 2ZT9C 5KYIA 4PZ8A 5C44B 4NDXA 2Z0SA 1RTOA 5FLXL 1B7YB 3CHBD 3UI2A 3HOZG 3MA2B 2UU9Q 2F3WA 3PO2H 3QJYA 3K58A 1QWYA 1Y1WG 2M9VA 1ZYRC 1S3OA 2KCMA 1Q81C 4N8FA 3KDFB 4DV4Q 2DUDA 5C4ZA 3RZDH 5BN5A 4P73A 3I2ZA 1C7YA 4JBMA 3CP0A 1F77A 2XRQD 3MFYA 2Z6KA 3J81L 1G2TA 1YVCA 1XPUA 1A15A 3RR5A 3DHQA 5C4JB 2SNSA 2AWOA 4ME5A 1I5FA 2WKDA 2K50A 1SNDA 2D0PA 4DV0L 1K9MC 1VQEA 4A93G 4C2MB 3GTPB 4R1JA 1CKMA 2LS01 3J7AF 3KFUA 1AE3A 3WOEA 1TWGB 1XMQL 3NTKA 1X56A 2NTTA 1WTWA 1NBWA 1LT3D 1XWEA 1X3EA 1HUMA 4IUQA 2WAQB 2N88A 1CT1D 4X65Q 4K6LA 4HJ7A 5FO8B 4GKKQ 2GVAA 5C0XG 5A35A 3HGBA 4B3SQ 4R4TA 3HS0C 4A3FG 1NR4A 3S16H 1D5MC 5K36H 4IPHA 4DXGA 5IGEA 5EKKA 1PYWD 1RCVD 2VW9A 3S1NH 2PI2A 2FHTA 4MNOA 3T16A 2L9HA 1NTGA 2KHJA 1PYSB 4GN4B 3CCMA 3M85A 4LFCL 2F1MA 2E2HB 1STEA 1IBML 3QWNA 2Y0SE 2A1AA 3T1YQ 5GQOA 3HOZH 3U4VA 5GAEC 2VQFL 2NB0A 5JPNC 1Y1WH 3F2DA 4P2CB 1QJOA 3R93A 5HGTA 2A19A 2B8GA 4TKOB 4K6DA 4APVA 4F88A 3H15A 1H9SA 4DUZQ 4FNFA 2L5TA 4E6IA 4A3BB 1QG7A 4B3RQ 1BCPB 1Y8OB 4C3JH 3I8ZA 2YTVA 1BR9A 1ENAA 5FLMG 1Q7YC 1F9SA 1EWIA 2NUCA 4DV1Q 1IYVA 1VQLA 4RGTA 3CU7A 1X55A 1LTID 3L0OA 3AEVA 1NR2A 1XNQQ 4KV6A 2D2CC 1BBXC 2B63B 3CCEA 2MJ8A 5D3DA 5JPMC 1BCPD 1CA5A 1EY0A 1WD0A 1HZ9A 4A93H 3QO2A 4OL7A 2MUYA 4AYBE 4DNIA 2KHSA 1LACA 1V8QA 4A3IB 1LTSD 5J22A 1EY7A 1I50H 3OW2A 3ULLA 1YITA 4C1NK 3GTGB 1L0YB 3SHLA 5JJZA 3CCJA 1HNWL 1VQAA 4OONA 4OHJA 1J9OA 4U68A 4NXML 1Q86C 4DKAC 2HD3A 1HNXL 2EJGC 1KDBA 4P74A 2ICEC 3HOWG 1ASYA 4A3DB 4HIMA 3I55A 3T1HQ 2VUMB 1LTBD 1SMYC 2B39A 4O42A 2VL6A 1HZCA 1H9MA 2YTXA 1VF5C 1XXGA 4BXXH 2NBFA 1V1PA 1EEID 2H5XA 2I46A 2UUAL 4OO1G 2EY5A 3CRKC 2JA5B 4EQOA 2R93B 3JAMc 1PH4A 2Z4HA 1Q3LA 2YYZA 4HIDA 3D4DA 4KTAA 4HIKA 4PV1C 4DAPA 2F0EA 4C3HH 4K14A 4RHRA 4L5QA 4RKBA 4DR6Q 1PRTC 1WCMH 1CI3M 1YJWA 2JE6I 4BWGB 3OIPA 1MIUA 4IUTA 3M7NA 2XVSA 1J6QA 1VMCA 1DOMA 2EIFA 4A3GG 4FF3A 4OO1I 5C5LA 4IJHA 3CXCA 2LXJA 4K5WA 4IURA 2M00A 2DN8A 2JYOA 1EQVA 3I56A 5E3FA 5IT9E 1HA6A 2PNRC 5FLMH 4JYAQ 1S5FD 1TWHB 4MTNA 4A3JH 5EPKA 1I3QB 4YWKA 1FVIA 2QDBA 5AJ3L 3BYYB 4BBRH 2WV6D 4BBSH 3W1GA 4QQBX 3AMUA 2L11A 1VQOA 3A55A 1TY0A 2PMZE 1EOVA 4JI8L 4IALA 1J5EQ 1ZYRD 1G6PA 2OCEA 5FOBB 1EYGA 2ZXPA 4A3EG 5IYCH 1KAWA 2QA4A 3PO2B 3HOYB 4G7ZC 2AMCB 3VYRA 3VA5A 4FF1A 2OT2A 2SOBA 3CMAA 3CD6A 3H91A 3F2UA 3H09A 5M9OA 1PZJD 4KN7C 1EL0A 2G9DA 5C44G 2QEXA 1I6HH 3PIP3 1EZ6A 2PW5A 2K05A 1RIPA 1N36L 4WJWA 1PH9A 4K2KA 1K3RA 1V1PB 3RLOA 4KY6A 4CKEA 1VQKA 2HUGA 3TDQA 5FJ8G 2F0VA 2MO1A 4DK0A 2BOSA 2HDLA 5CV4A 2K5HA 2QGQA 1N32Q 4DV3Q 1IZ6A 2HQLA 2UXDQ 4CJ0B 1DGSA 2MO0A 5EPLA 3GTLH 5J1ZA 4AYBB 2AQ1B 3J80L 2RDHA 4GNXA 4QCLA 1PXUA 1CQVA 1E2ZA 2A5HA 1IBKL 1K28A 3DUZA 3CC7A 4RCOA 2K04A 3KBGA 1TY2A 1V43A 4FF4A 2E2JB 1MJEA 2KUMA 2K1BA 1PDQA 5D3IB 4YWMA 1PLFA 2PNHA 5IT9c 4HSVA 4R4CA 2LY7A 1KXLA 4IOAA 2KVMA 1WTRA 4FO2A 5L37A 1SBBB 4FVMA 3OMCA 3VR6A 3HOXH 1VQGA 5ISRA 2K14A 1X65A 3S1NB 1U4MA 3T53B 4QF4A 3R2TA 4PQXA 1HNZL 2GN5A 1FJGL 5J3BA 3N52A 4WRDA 3CCUA 3OWFA 2WB1E 3A5UA 1JOKA 2JA8H 1C4QA 1SE8A 4A3EH 4TVAB 3U50C 1EQRA 4IPGA 1AFPA 3NWSA 5C3EG 2A6HD 2UUCQ 4BY7G 1EQTA 2F0IA 1SRUA 4GKJQ 1I4QA 1CKNA 2JA7B 1I4RA 4G7HC 4DV5L 2DJFC 4F8MA 4UP7A 4HJ5A 1UUPA 5IODA 1K8MA 3U9OA 1JJCB 3CCSA 1HQRD 4RHSA 1PFSA 2IL8A 2Q8RE 3FHWA 1JB7A 1AZPA 1PH5A 4A3BG 2NVQB 1SJHD 1IHZA 2ID0A 4DAMA 1RKNA 3P1HA 4DV7L 3U9SA 2PMZB 4LUZA 2HT1A 5M3MB 1BQQT 1HRJA 3D0FA 4AIMA 3IKJA 1D5ZC 5LMNW 4Y52H 2J0TD 4J1MA 1UEBA 1SMYD 2V1CC 2CCZA 2JK8A 4MHEA 5T1IA 5EPJA 1GO3E 4GLVB 3T51B 1PRTB 3D8GA 4J8QA 4CJ1B 3Q8DA 2EXZA 4A3KH 4A3IG 4L8JA 1TWFB 4DN4M 3NSWA 5GAHC 1VMPA 1F2ZA 2I0QA 2ZJPA 4DR2L 3T13A 1AE2A 4TSSA 3PSIA 2FJ2A 2X6GA 1EIYB 2VY3A 1PRTD 1EU3A 4LF7Q 4DV2Q 1TS5A 4A3DG 3H0GB 2VUMG 3PIPA 1QNUA 1LT5D 4R4IA 4UDUC 1SYDA 5BN3A 4C3HB 5ELDA 2MNAA 4LW1A 1HTLD 1WCMB 1K8OA 5I2YA 1WTPA 5JJKA 1SLJA 5C6AA 1IW7D 2I5HA 3OPOA 2JA5G 4L5RC 3BYTB 3G71A 3VR3A 1VQNA 2R93G 2R92B 2UXCQ 1EIGA 1HPCA 3TZUA 5LHY1 1HFGA 1XMOQ 2R7ZG 3C3LA 5C3EH 2O4XA 2A69D 2HIXA 1CKOA 4BY7H 1B9MA 1OXXK 1CKNB 1EY5A 1EY8A 5DAUA 5IP7G 4N9TA 1LTAD 1JQYD 1ESRA 2R7DA 3MZ5A 4JW0A 3PUXA 4LFAL 4LFCQ 4O1NA 2HDMA 1A2UA 4K5XA 1IBMQ 3VA7A 3T56B 3D4WA 2R61A 1CTMA 2XWBB 1PZKD 3EIVA 4HSPA 2XWJB 4L6TB 1TIID 3M4QA 4BBSB 2A74C 5M5WH 4RH6A 4DUYL 1YHBA 3M3YH 1G51A 1M4VA 4OWXB 2WB1B 4JG2A 4WFN3 1BCPF 3TBIB 5KEEA 3I4NB 1FD7D 1SYCA 4XDXA 4EQPA 3AU7A 1FR3A 2IHEA 2WAQE 3HKZG 3CCQA 1LO5D 1VQ9A 2JN4A 2F0WA 2KCTA 4YCWA 1I4HA 3MHBA 4WJ4A 1TWCH 4GN3B 3E6ZX 1I6HB 4JI3L 2Q2UA 3BJUA 2Y0SG 1KL9A 3HOYG 2F4VQ 1S40A 4BY1B 2TSSA 4NXNL 1PH2A 3GTMH 3KJPA 1JB3A 4DR4Q 4RA8A 4N9PA 4I7ZC 3A74A 2D5DA 5CV8A 1PTOH 2IY5B 3PQIA 4JBKA 1RF2D 1PHJA 3QOJA 2EQSA 1YNNC 2Z9HA 4HJAA 1PH6A 4LF8L 2CHBD 4A3LG 1DD2A 1G6ZA 1HH2P 5JVH3 1XNRL 2EYMA 4U673 4RMFA 1N33L 3ULJA 2UUAQ 3MXPA 3S2DB 5A2QL 2R7ZH 1F2LA 1M8AA 1AW7A 2VXWA 4B3ML 1ILPA 3MXUA 4AYBG 1RJTA 2TMPA 1E7ZA 5FO7B 5IP7H 3GTOH 3HOXB 4JCVE 4B9XA 4V0BA 1QVFA 1UNSA 2K75A 3FKIB 3F8TA 3A8KE 3ZYYX 2NVXB 3CPFA 2C5CA 3HP3A 4NMZA 1D7QA 3S14B 4CDEC 3DEPA 5CC4A 3S1RB 1WD1A 4EGVA 1XX8A 1G91A 2QF7A 2ZTEA 3KK7A 4LUOA 1F9QA 4LF5L 1ZEQX 1X54A 2UXBQ 3PIO3 4RGOS 4HCEA 4JI2L 2VS1A 5EJWA 3LX0A 2F0UA 1P8LA 4X3UA 3PCOB 2NN6G 2RKSA 3W1BA 3PO3B 3W3AA 1C48A 3L9AX 4K2LA 1WJJA 4AQYQ 1MGSA 2F03A 5CV6A 3FRPB 2L15A 2B2WC 5TSSA 3RLNA 1MI2A 4C3IB 2OTJA 3C46A 1UE5A 1SYBA 1LTTD 3NBHA 2WKCA 1FL0A 4KKTA 3S1QB 1Q8KA 2PI2E 3W5OA 2D62A 2WP8J 1S72A 4DK3C 2X69A 1A2TA 2NN6I 2F0FA 4PNYA 2Q8IB 1JWMD 2NVTB 2Z1CA 1RODA 1X32A 4TQUS 2CVRA 1SDFA 4QIWB 4M1UB 2QDLA 4DV6L 3A0JA 4QMGA 1K8AC 3IFDA 1E1TA 1VQBA 5ELFA 1BO0A 2N3SA 1LT6D 3PUVA 1HA5A 2MHVA 1I94L 5GADC 3S17H 1N36Q 5CR3A 4JI4Q 3V96A 4R8IA 1ICFB 1K3BC 2HHHL 2K5QA 4KHVA 4F7XA 4X3SA 1R9TB 4A4IA 4OWWB 1D5XC 1NCVA 3ERQA 3GO5A 1BNZA 3GTQB 4KI0A 5KRUA 5M3MG 3G4SA 4A3KB 2PO4A 5C4XB 1XPOA 5BR8L 2IX1A 3RN5A 5EGTA 3K5NA 4MZ9A 2XGTA 1Z47A 3KYHC 1SE4A 2OQKA 4P75A 3OWEB 1Y1VB 1EYCA 4CDFC 3HOVB 3GTJH 1W2BA 4JI5Q 1F9RA 4A3CG 3I73A 2UUBQ 1N34Q 3KLSX 1UWVA 1K83H 4LWCA 3JAME 2BH8A 5C0XI 1L0XB 2KCNA 2EJMA 4KHPL 3J7A5 1GUTA 1SXTA 4OELB 1PMRA 2DY8A 2KEEA 5IYDG 2G5DA 2FMMA 2F52A 1DYQA 2QEJC 1QUQA 3RZOH 4HJ8A 2F0NA 4FXGC 5D14A 2EOTA 1X6OA 2JJQA 3Q0AA 1KABA 1WOCA 3EVQA 2CQAA 4X3TA 4KHZA 3NBHB 1KRTA 5LMNQ 2A6HC 1PH3A 1SYGA 4IPCA 1K0RA 3DM1A 5CBAE 2F0SA 2GVBA 3EN2A 1VQMA 1TQOA 1JOOA 3S15H 1BBUA 2SNMA 2JEAI 2IT1A 3JAMi 1SE3A 2B2WA 4GS3A 4O2DA 3K59A 1B50A 1I4GA 3BU2A 2K5NA 1M1KC 3H3VI 3MEHA 1C0AA 2QW7A 4ZYSA 1UE1A 1TWAB 4DR1Q 5ELOA 1X3FA 3FEWX 3HOUB 5IYBG 5IE8A 2E2IB 1PFNA 4X6AH 2XSCA 1CK1A 1ZXTA
chains in the Genus database with same CATH topology
4GLAC 1MJCA 4YWLA 5ELNA 3TQYA 4A3MG 1PH8A 1V43A 4LF6Q 2N8NA 4XIGS 1MJEA 2WB1G 4BA1I 3IRBA 3PIOA 4YWMA 4KHPQ 2PNHA 4JI8Q 5IT9c 3L7ZC 4R4CA 1KXLA 3E9HA 3HOYH 4B3TL 1WFQA 5LMUL 3TRZA 2LSSA 4IOAA 4A3FH 1YZ6A 4GNXC 4YHHQ 3I4OA 4PMWA 3HOXH 2K5VA 4JI6L 1VQGA 3EBEA 3TEHB 1YJ9A 1FGUA 2K14A 1X65A 2JA7G 2ZJRA 4A3CH 3RLFA 4OX9L 5JEAG 5HY6A 1HR0L 3PUZA 2PQAB 1NMFA 3E9IA 1IBKL 1HNZL 2GN5A 2AHOB 1FJGL 1AH9A 1G291 3A5ZB 3D31A 5J3BA 1CUKA 4A3LH 3CCUA 3GD7A 1Z9FA 1L1OB 4BY1G 2WB1E 1WYDA 3A5UA 1N9WA 4JI0L 4LFBQ 4IFDJ 4DAYB 3UDIA 1KQSA 3OTOL 2JA8H 1SE8A 4POGA 5IYDH 4DR5L 1TWAH 1JE5A 2MFIA 2KHIA 2Z6KC 4TVAB 3U50C 3K7UC 4JOIC 3STBD 1EQRA 4IPGA 4JV5L 3HOUH 4K0KL 4GOPB 1SFOH 2E2IH 5C3EG 3PUWA 2MQHA 2UUCQ 3H3VH 4BY7G 1N32L 1XTDA 2YTYA 4LNQA 2UXDL 1SRUA 4LF7L 4DV2L 4GKJQ 2E2JH 3KDFA 1IBKQ 1CKNA 4IPDA 3KF6B 1V1QA 1K8GA 3GTKH 4DV5L 1W3SA 2FXQA 3PF4A 3WWVA 5GROA 4UP7A 4HJ5A 4RG1A 5JJIA 4IJLA 2KBNA 3DM3A 4LF6L 1OXUA 3K81C 1PH7A 1N33L 1JJCB 4PG3A 3CCSA 2JEBI 3TS0A 4B3TQ 1PFSA 5M3FH 1LUZA 3FHWA 1JB7A 4BXXG 1PH5A 4A3BG 1RL2A 2UXCL 3I4MH 1A8VA 1YHAA 1IYJB 2ID0A 3FKIG 1XMOL 4DAMA 2R7FA 4DV7L 2B29A 1IBLL 1VQ7A 3SGIA 4LUZA 4YHHL 3OYYA 3CCVA 3HKZE 4UY8C 5E7NA 3H0GG 1TXYA 4DV4L 2HT1A 2E8GA 2RCNA 4JBWA 3D0FA 5IYBH 2VQEQ 1H95A 2LXKA 4AIMA 5M5XH 4OX9Q 1HR0Q 4POFA 1KRSA 5LMNW 4Y52H 3I7FA 2D0OA 1HNZQ 5C0XJ 3ZJYC 1A62A 1WCMG 1FJGQ 4A3MH 2ES2A 2RHSB 2RF4A 5JJLA 3AYHB 1UEBA 2V1CC 2JA8G 2CCZA 2ZTDA 2JK8A 3HOWH 3KLWA 2NVYH 1GO3E 4GLVB 4JI0Q 3CW2C 4YY3L 1VS0A 2R92G 2AWNA 3PGZA 1U5KA 3K7AH 3Q8DA 3NENA 4FDBA 4A3KH 3PF5A 4A3IG 5M5YH 3OTOQ 5GAHC 3S2HH 1D8LA 4P72A 1VQCA 3G48A 4LFBL 3CCLA 3J80i 4EQ5A 4X62L 3E0EA 1A63A 1VQDA 2I0QA 5K36G 3S1MH 2Q2IA 2ZJPA 4UPAA 4DR2L 1AE2A 3F1ZA 2JA6H 3PSIA 2VNUD 2F3IA 2JA7H 1EIYB 1NE3A 2VY3A 4JI1L 2KENA 4LF7Q 2UUCL 4DV2Q 4A3JG 2ATWA 4A3DG 2BA1A 1X9NA 2VUMG 3PIPA 3K0XA 1SN8A 3GDEA 1GKHA 4ME3A 3NELA 4R4IA 4X66L 1C9OA 3TREA 3CC4A 4DV5Q 3PV0A 2MNAA 4BBRG 5IP9G 1LTLA 4LW1A 4X64Q 4GKJL 1QZGA 4BBSG 1LM0A 2NVQH 2CFMA 4PZ8A 1VQPA 3CF5A 1SLJA 5JJKA 4A3GH 2K52A 2I5HA 4NXNQ 2Z0SA 2JA5G 4L5RC 4B3SL 1VQNA 3G71A 1B7YB 2JA9A 2F4VL 3HOZG 2R93G 2UXCQ 5M3MH 2UU9Q 3PO2H 1Y1WG 1XMOQ 3I4NG 2WFWA 3LGJA 2R7ZG 5IYCG 5C3EH 1U0LA 4DV7Q 1IBLQ 2HIXA 4IFDG 1CKOA 4BY7H 1S3OA 2KCMA 1OXXK 1Q81C 3KDFB 4DPGA 1CKNB 2DUDA 4DV4Q 4DR4L 3RZDH 5IP7G 4DR7Q 4P73A 4JI7Q 2YU9H 3I2ZA 2R7DA 1C7YA 4JBMA 2WAQG 3CP0A 1Q12A 3PUXA 4LF8Q 4LFAL 4LUVA 2VQEL 4LFCQ 4LF9Q 1IBMQ 2Z6KA 4H02A 2C35B 4Y7NH 4JOIA 3J80c 1HJPA 1YVCA 1XPUA 1TWFH 1XNRQ 1KD1C 1GVPA 3RR5A 3EIVA 1UE6A 4YY3Q 1N33Q 2N49A 3JC66 2E5LQ 1VQFA 1PV4A 2AWOA 3T1YL 3M4QA 1I5FA 5M5WH 2K50A 2D0PA 4DV0L 4IFDI 4DUYL 1K9MC 1YHBA 3M3YH 1QUQB 1PYBA 1G51A 1VQEA 4OWXB 1Y1VG 2CWAA 2IX0A 4X62Q 3CPWA 5IWAQ 1Q1EA 1OXTA 3BZCA 4JG2A 4DR3Q 4A93G 4R1JA 1CKMA 1SMXA 4DR2Q 3H0GH 3KFUA 1AE3A 1T9HA 3AQQA 2R6GA 1VQ4A 3TS2A 3U4ZA 1XMQL 4JI1Q 1VQ5A 2IHEA 1X56A 2WAQE 3M4OH 4B3RL 3HKZG 3UE0A 3CCQA 2VZAA 3J7ZC 1NBWA 1VQ9A 3CQZH 2CWPA 4X66Q 1X3EA 5C44H 3J81j 4DV1L 1Y14B 2I5MX 3AFPA 2KCTA 4YCWA 1OXVA 4X65Q 1TWCH 4GN3B 4WJ4A 3KOJA 2R92H 4DK6C 4HJ7A 4GKKQ 3G6EA 2GVAA 1B8AA 4X64L 1XNQL 4JI3L 2Q2UA 3BJUA 2Y0SG 4JI2Q 5C0XG 1KL9A 2A8VA 4B3SQ 4ALPA 3HOYG 2F4VQ 4R4TA 5FJ8H 2NZOA 4A3FG 1PA6A 2UXBL 1S40A 4NXNL 3HOXG 1PH2A 3GTMH 3S16H 4IPHA 1QVGA 1GD7A 3KJPA 2YV5A 4JC0A 1VQ8A 2VW9A 2UU9L 3S1NH 1VQJA 2PI2A 4P71A 3UE1A 4DR4Q 4WJ3M 3A74A 4AQYL 4MNOA 2Q2HA 4GNXB 2IY5B 2N78A 4LFAQ 4JBKA 1EIFA 3U58A 2K4KA 4DR7L 4JI7L 4NB3A 1PHJA 1YIJA 1NTGA 2KHJA 2XTIA 1PYSB 2EQSA 4GN4B 4UP9A 5IP9H 5C4JH 3M85A 3CCMA 4LFCL 1NMGA 4HJAA 1PH6A 4LF8L 1BKBA 4LF9L 2B63G 1IBML 4A3LG 2HIVA 1HH2P 1X3GA 4GLXA 1A0IA 1XNRL 2Y0SE 2A1AA 4C2MH 3GTPH 3T1YQ 1SR3A 4QL5A 5GQOA 3HOZH 3ERSX 4RMFA 3U4VA 5GAEC 3ULJA 2VQFL 4DUYQ 4DV0Q 2E5LL 4GN5A 2UUAQ 1Y1WH 3MEFA 3F2DA 2R7ZH 3I4NH 3VDYA 3PO3G 1TWGH 3F2CA 4B3ML 1BVSA 3NEMA 1QVCA 2A19A 4AYBG 3HOUG 2ALYB 4APVA 1E7ZA 4DR3L 5IP7H 3STBC 5IWAL 3H15A 4DUZQ 3GTOH 4JCVE 4IOCA 3F2BA 1XMQQ 1QVFA 1I94Q 1CSPA 4B3RQ 4C3JH 2YTVA 2K75A 3K8AA 3F8TA 1KC8C 1YHQA 1L2FA 5FLMG 1Q7YC 1SROA 1L1OC 3CPFA 1EWIA 1D7QA 4DV1Q 1XPRA 4DR6L 1VQLA 4JI4L 1X55A 1O7IA 3L0OA 3AEVA 2DGYA 2ZTEA 4LUOA 4BY1H 4LF4Q 1XNQQ 3KJOA 4JI3Q 1BBWA 2RHQB 4X65L 4LF5L 4J15A 4PZ7A 3CCEA 1X54A 4GOPC 1E1OA 4GKKL 5DLQE 1B70B 2UXBQ 4O0AA 5BR8Q 4A93H 1HZ9A 4JI2L 2VS1A 3I4MG 1V9PA 1P8LA 2CQOA 4AYBE 4DNIA 3PCOB 1XJVA 2NN6G 3W1BA 3J81i 1YBYA 3CMEA 1CSQA 1I50H 1WJJA 4AQYQ 2ZTCA 3OW2A 3ULLA 1YITA 2BA0A 2I5LX 3MXNB 1WI5A 2L15A 3UDFA 2E2HH 3RLNA 4AH6A 3CCJA 1HNWL 1VQAA 4OONA 4JYAL 3BZKA 1OTCA 4JI5L 4NXML 1VQ6A 1Q86C 4DKAC 1HNXL 2UUBL 2OTJA 1UE5A 4P74A 1OXSC 1N34L 3HOWG 1FL0A 2EXDA 3S2DH 2ZM6Q 1Q8KA 1ASYA 2PI2E 1VQHA 3W5OA 3I55A 4HIMA 3T1HQ 1YI2A 2Q2TA 2D62A 2WP8J 1S72A 1EUJA 4DK3C 4A3KG 3CCRA 2VQFQ 4QIWE 2OTLA 5C4XG 2NN6I 1HZCA 2VL6A 4A76A 4UP8A 4XTCS 2YTXA 1J5EL 4B3MQ 4TQUS 4BXXH 4A3BH 3ULPA 2H5XA 5FLXc 4QGUA 2UUAL 3FKIH 4OO1G 3B6YA 1VQIA 4R4QA 3S24A 1NJIC 2NZHA 2NVXH 2AKWB 3HOVG 1IL2A 4DV6L 2JA6G 3A0JA 3JAMc 1PH4A 1K8AC 2JQOA 1E1TA 3S14H 1VQBA 1HZAA 3CAMA 4QY7A 2YYZA 4HIDA 4HIKA 3ER0A 1YNXA 2N3SA 4DUZL 3PUVA 3S1RH 4C3HH 1I94L 5GADC 3UDGA 1ASZA 3S17H 4L5QA 5LMNL 1N36Q 4DR6Q 3HKSA 4JI4Q 1WCMH 2B63H 1YJWA 3ICEA 1KHIA 4BA2I 4HJ9A 2JE6I 4JBJA 3J81c 2BH2A 1MIUA 3KF8B 5EAYA 1IXRA 2HHHL 3M7NA 1M90C 1J6QA 1VCIA 1YEZA 4LF5Q 2EIFA 4A4IA 1JMCA 4OWWB 4A3GG 1JT8A 3GO5A 3CC2A 4A3IH 1Q82C 3PO3H 4OO1I 4LF4L 3RNUA 4KI0A 3M9BA 4IJHA 5M3MG 3G4SA 4R4OA 3GTGH 3PO2G 3CXCA 2LXJA 1XPOA 5BR8L 5JEAJ 4OWTB 2IX1A 3I56A 3RN5A 2IHFA 4MZ9A 2XGTA 4DV3L 4L5SA 1Z47A 4C3IH 4DR1L 3KYHC 1HZBA 2OQKA 4P75A 1N8RC 5FLMH 4HIOA 1HNWQ 4JYAQ 3FP9A 4A75A 4MTNA 3GTJH 4A3JH 1W2BA 4JI5Q 4NXMQ 3S1QH 4A3DH 1Q1BA 1HNXQ 2VUMH 1GM5A 2UUBQ 4YWKA 4A3CG 1FVIA 1HR0W 3L2PA 5AJ3L 1N34Q 1UE7A 4BBRH 1UWVA 1K83H 4LWCA 1E22A 2BH8A 4NPSA 5C0XI 2PQAA 3W1GA 2NVTH 4BBSH 1PH1A 4QQBX 3PUYA 5LMUQ 1LYLA 1VQOA 1EFWA 1QZHA 2ZM6L 2PMZE 1EOVA 3J7A5 4KHPL 3T1HL 4JI8L 4L5TA 3RN2A 4JI6Q 1J5EQ 1YJNA 4EX5A 2JA5H 1L1OA 2R93H 1G6PA 5IYDG 2OCEA 1EYGA 3UDXA 2F52A 4A3EG 5IYCH 1QUQA 3RZOH 5H1SE 4HJ8A 1KAWA 2QA4A 4DV6Q 1NY4A 1X6OA 4QJFA 2AMCB 2JJQA 3DLLA 1E24A 1WOCA 4A3EH 3CD6A 3CMAA 1PVOA 1K73C 4GOPA 4KHZA 3NBHB 4YCUA 3AFQA 1KRTA 5LMNQ 1R9TH 3M4PA 1PH3A 4IPCA 1K0RA 5C44G 2QEXA 1I6HH 4YCVA 2GVBA 1EQQA 3EN2A 3GTQH 1VQMA 1RIPA 2HHHQ 1N36L 2OQ0A 3S15H 1BBUA 1PH9A 1KIXA 2JEAI 3KF6A 2IT1A 1MKHA 1K3RA 1P16A 3RLOA 1JJ2A 5C4XH 3JAMi 4DR5Q 1VQKA 2ZJQA 5HGQA 1L0WA 2B3GA 4KLKA 4GS3A 5FJ8G 2MO1A 4JV5Q 4O2DA 4K0KQ 2ASBA 1Q46A 1Y1VH 3BU2A 5M3FG 2K5NA 4OXPA 1M1KC 3H3VI 3HOVH 1TWHH 2K5HA 2QGQA 1N32Q 4DV3Q 1C0AA 1IZ6A 4DR1Q 1UE1A 1I3QH 2HQLA 5IY0A 2UXDQ 1JJGA 1DGSA 5ELOA 2MO0A 2OWOA 4IO9A 3GTLH 1X3FA 3K80C 5IYBG 5GAGC 5IE8A 4GNXA 1E3PA 3HFZB 4X6AH 4PZ6A 2CKZB 5AJ3Q 3CC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLA C;  1MJC A;  4YWL A;  5ELN A;  3TQY A;  4A3M G;  1PH8 A;  1V43 A;  4LF6 Q;  2N8N A;  4XIG S;  1MJE A;  2WB1 G;  4BA1 I;  3IRB A;  3PIO A;  4YWM A;  4KHP Q;  2PNH A;  4JI8 Q;  5IT9 c;  3L7Z C;  4R4C A;  1KXL A;  3E9H A;  3HOY H;  4B3T L;  1WFQ A;  5LMU L;  3TRZ A;  2LSS A;  4IOA A;  4A3F H;  1YZ6 A;  4GNX C;  4YHH Q;  3I4O A;  4PMW A;  3HOX H;  2K5V A;  4JI6 L;  1VQG A;  3EBE A;  3TEH B;  1YJ9 A;  1FGU A;  2K14 A;  1X65 A;  2JA7 G;  2ZJR A;  4A3C H;  3RLF A;  4OX9 L;  5JEA G;  5HY6 A;  1HR0 L;  3PUZ A;  2PQA B;  1NMF A;  3E9I A;  1IBK L;  1HNZ L;  2GN5 A;  2AHO B;  1FJG L;  1AH9 A;  1G29 1;  3A5Z B;  3D31 A;  5J3B A;  1CUK A;  4A3L H;  3CCU A;  3GD7 A;  1Z9F A;  1L1O B;  4BY1 G;  2WB1 E;  1WYD A;  3A5U A;  1N9W A;  4JI0 L;  4LFB Q;  4IFD J;  4DAY B;  3UDI A;  1KQS A;  3OTO L;  2JA8 H;  1SE8 A;  4POG A;  5IYD H;  4DR5 L;  1TWA H;  1JE5 A;  2MFI A;  2KHI A;  2Z6K C;  4TVA B;  3U50 C;  3K7U C;  4JOI C;  3STB D;  1EQR A;  4IPG A;  4JV5 L;  3HOU H;  4K0K L;  4GOP B;  1SFO H;  2E2I H;  5C3E G;  3PUW A;  2MQH A;  2UUC Q;  3H3V H;  4BY7 G;  1N32 L;  1XTD A;  2YTY A;  4LNQ A;  2UXD L;  1SRU A;  4LF7 L;  4DV2 L;  4GKJ Q;  2E2J H;  3KDF A;  1IBK Q;  1CKN A;  4IPD A;  3KF6 B;  1V1Q A;  1K8G A;  3GTK H;  4DV5 L;  1W3S A;  2FXQ A;  3PF4 A;  3WWV A;  5GRO A;  4UP7 A;  4HJ5 A;  4RG1 A;  5JJI A;  4IJL A;  2KBN A;  3DM3 A;  4LF6 L;  1OXU A;  3K81 C;  1PH7 A;  1N33 L;  1JJC B;  4PG3 A;  3CCS A;  2JEB I;  3TS0 A;  4B3T Q;  1PFS A;  5M3F H;  1LUZ A;  3FHW A;  1JB7 A;  4BXX G;  1PH5 A;  4A3B G;  1RL2 A;  2UXC L;  3I4M H;  1A8V A;  1YHA A;  1IYJ B;  2ID0 A;  3FKI G;  1XMO L;  4DAM A;  2R7F A;  4DV7 L;  2B29 A;  1IBL L;  1VQ7 A;  3SGI A;  4LUZ A;  4YHH L;  3OYY A;  3CCV A;  3HKZ E;  4UY8 C;  5E7N A;  3H0G G;  1TXY A;  4DV4 L;  2HT1 A;  2E8G A;  2RCN A;  4JBW A;  3D0F A;  5IYB H;  2VQE Q;  1H95 A;  2LXK A;  4AIM A;  5M5X H;  4OX9 Q;  1HR0 Q;  4POF A;  1KRS A;  5LMN W;  4Y52 H;  3I7F A;  2D0O A;  1HNZ Q;  5C0X J;  3ZJY C;  1A62 A;  1WCM G;  1FJG Q;  4A3M H;  2ES2 A;  2RHS B;  2RF4 A;  5JJL A;  3AYH B;  1UEB A;  2V1C C;  2JA8 G;  2CCZ A;  2ZTD A;  2JK8 A;  3HOW H;  3KLW A;  2NVY H;  1GO3 E;  4GLV B;  4JI0 Q;  3CW2 C;  4YY3 L;  1VS0 A;  2R92 G;  2AWN A;  3PGZ A;  1U5K A;  3K7A H;  3Q8D A;  3NEN A;  4FDB A;  4A3K H;  3PF5 A;  4A3I G;  5M5Y H;  3OTO Q;  5GAH C;  3S2H H;  1D8L A;  4P72 A;  1VQC A;  3G48 A;  4LFB L;  3CCL A;  3J80 i;  4EQ5 A;  4X62 L;  3E0E A;  1A63 A;  1VQD A;  2I0Q A;  5K36 G;  3S1M H;  2Q2I A;  2ZJP A;  4UPA A;  4DR2 L;  1AE2 A;  3F1Z A;  2JA6 H;  3PSI A;  2VNU D;  2F3I A;  2JA7 H;  1EIY B;  1NE3 A;  2VY3 A;  4JI1 L;  2KEN A;  4LF7 Q;  2UUC L;  4DV2 Q;  4A3J G;  2ATW A;  4A3D G;  2BA1 A;  1X9N A;  2VUM G;  3PIP A;  3K0X A;  1SN8 A;  3GDE A;  1GKH A;  4ME3 A;  3NEL A;  4R4I A;  4X66 L;  1C9O A;  3TRE A;  3CC4 A;  4DV5 Q;  3PV0 A;  2MNA A;  4BBR G;  5IP9 G;  1LTL A;  4LW1 A;  4X64 Q;  4GKJ L;  1QZG A;  4BBS G;  1LM0 A;  2NVQ H;  2CFM A;  4PZ8 A;  1VQP A;  3CF5 A;  1SLJ A;  5JJK A;  4A3G H;  2K52 A;  2I5H A;  4NXN Q;  2Z0S A;  2JA5 G;  4L5R C;  4B3S L;  1VQN A;  3G71 A;  1B7Y B;  2JA9 A;  2F4V L;  3HOZ G;  2R93 G;  2UXC Q;  5M3M H;  2UU9 Q;  3PO2 H;  1Y1W G;  1XMO Q;  3I4N G;  2WFW A;  3LGJ A;  2R7Z G;  5IYC G;  5C3E H;  1U0L A;  4DV7 Q;  1IBL Q;  2HIX A;  4IFD G;  1CKO A;  4BY7 H;  1S3O A;  2KCM A;  1OXX K;  1Q81 C;  3KDF B;  4DPG A;  1CKN B;  2DUD A;  4DV4 Q;  4DR4 L;  3RZD H;  5IP7 G;  4DR7 Q;  4P73 A;  4JI7 Q;  2YU9 H;  3I2Z A;  2R7D A;  1C7Y A;  4JBM A;  2WAQ G;  3CP0 A;  1Q12 A;  3PUX A;  4LF8 Q;  4LFA L;  4LUV A;  2VQE L;  4LFC Q;  4LF9 Q;  1IBM Q;  2Z6K A;  4H02 A;  2C35 B;  4Y7N H;  4JOI A;  3J80 c;  1HJP A;  1YVC A;  1XPU A;  1TWF H;  1XNR Q;  1KD1 C;  1GVP A;  3RR5 A;  3EIV A;  1UE6 A;  4YY3 Q;  1N33 Q;  2N49 A;  3JC6 6;  2E5L Q;  1VQF A;  1PV4 A;  2AWO A;  3T1Y L;  3M4Q A;  1I5F A;  5M5W H;  2K50 A;  2D0P A;  4DV0 L;  4IFD I;  4DUY L;  1K9M C;  1YHB A;  3M3Y H;  1QUQ B;  1PYB A;  1G51 A;  1VQE A;  4OWX B;  1Y1V G;  2CWA A;  2IX0 A;  4X62 Q;  3CPW A;  5IWA Q;  1Q1E A;  1OXT A;  3BZC A;  4JG2 A;  4DR3 Q;  4A93 G;  4R1J A;  1CKM A;  1SMX A;  4DR2 Q;  3H0G H;  3KFU A;  1AE3 A;  1T9H A;  3AQQ A;  2R6G A;  1VQ4 A;  3TS2 A;  3U4Z A;  1XMQ L;  4JI1 Q;  1VQ5 A;  2IHE A;  1X56 A;  2WAQ E;  3M4O H;  4B3R L;  3HKZ G;  3UE0 A;  3CCQ A;  2VZA A;  3J7Z C;  1NBW A;  1VQ9 A;  3CQZ H;  2CWP A;  4X66 Q;  1X3E A;  5C44 H;  3J81 j;  4DV1 L;  1Y14 B;  2I5M X;  3AFP A;  2KCT A;  4YCW A;  1OXV A;  4X65 Q;  1TWC H;  4GN3 B;  4WJ4 A;  3KOJ A;  2R92 H;  4DK6 C;  4HJ7 A;  4GKK Q;  3G6E A;  2GVA A;  1B8A A;  4X64 L;  1XNQ L;  4JI3 L;  2Q2U A;  3BJU A;  2Y0S G;  4JI2 Q;  5C0X G;  1KL9 A;  2A8V A;  4B3S Q;  4ALP A;  3HOY G;  2F4V Q;  4R4T A;  5FJ8 H;  2NZO A;  4A3F G;  1PA6 A;  2UXB L;  1S40 A;  4NXN L;  3HOX G;  1PH2 A;  3GTM H;  3S16 H;  4IPH A;  1QVG A;  1GD7 A;  3KJP A;  2YV5 A;  4JC0 A;  1VQ8 A;  2VW9 A;  2UU9 L;  3S1N H;  1VQJ A;  2PI2 A;  4P71 A;  3UE1 A;  4DR4 Q;  4WJ3 M;  3A74 A;  4AQY L;  4MNO A;  2Q2H A;  4GNX B;  2IY5 B;  2N78 A;  4LFA Q;  4JBK A;  1EIF A;  3U58 A;  2K4K A;  4DR7 L;  4JI7 L;  4NB3 A;  1PHJ A;  1YIJ A;  1NTG A;  2KHJ A;  2XTI A;  1PYS B;  2EQS A;  4GN4 B;  4UP9 A;  5IP9 H;  5C4J H;  3M85 A;  3CCM A;  4LFC L;  1NMG A;  4HJA A;  1PH6 A;  4LF8 L;  1BKB A;  4LF9 L;  2B63 G;  1IBM L;  4A3L G;  2HIV A;  1HH2 P;  1X3G A;  4GLX A;  1A0I A;  1XNR L;  2Y0S E;  2A1A A;  4C2M H;  3GTP H;  3T1Y Q;  1SR3 A;  4QL5 A;  5GQO A;  3HOZ H;  3ERS X;  4RMF A;  3U4V A;  5GAE C;  3ULJ A;  2VQF L;  4DUY Q;  4DV0 Q;  2E5L L;  4GN5 A;  2UUA Q;  1Y1W H;  3MEF A;  3F2D A;  2R7Z H;  3I4N H;  3VDY A;  3PO3 G;  1TWG H;  3F2C A;  4B3M L;  1BVS A;  3NEM A;  1QVC A;  2A19 A;  4AYB G;  3HOU G;  2ALY B;  4APV A;  1E7Z A;  4DR3 L;  5IP7 H;  3STB C;  5IWA L;  3H15 A;  4DUZ Q;  3GTO H;  4JCV E;  4IOC A;  3F2B A;  1XMQ Q;  1QVF A;  1I94 Q;  1CSP A;  4B3R Q;  4C3J H;  2YTV A;  2K75 A;  3K8A A;  3F8T A;  1KC8 C;  1YHQ A;  1L2F A;  5FLM G;  1Q7Y C;  1SRO A;  1L1O C;  3CPF A;  1EWI A;  1D7Q A;  4DV1 Q;  1XPR A;  4DR6 L;  1VQL A;  4JI4 L;  1X55 A;  1O7I A;  3L0O A;  3AEV A;  2DGY A;  2ZTE A;  4LUO A;  4BY1 H;  4LF4 Q;  1XNQ Q;  3KJO A;  4JI3 Q;  1BBW A;  2RHQ B;  4X65 L;  4LF5 L;  4J15 A;  4PZ7 A;  3CCE A;  1X54 A;  4GOP C;  1E1O A;  4GKK L;  5DLQ E;  1B70 B;  2UXB Q;  4O0A A;  5BR8 Q;  4A93 H;  1HZ9 A;  4JI2 L;  2VS1 A;  3I4M G;  1V9P A;  1P8L A;  2CQO A;  4AYB E;  4DNI A;  3PCO B;  1XJV A;  2NN6 G;  3W1B A;  3J81 i;  1YBY A;  3CME A;  1CSQ A;  1I50 H;  1WJJ A;  4AQY Q;  2ZTC A;  3OW2 A;  3ULL A;  1YIT A;  2BA0 A;  2I5L X;  3MXN B;  1WI5 A;  2L15 A;  3UDF A;  2E2H H;  3RLN A;  4AH6 A;  3CCJ A;  1HNW L;  1VQA A;  4OON A;  4JYA L;  3BZK A;  1OTC A;  4JI5 L;  4NXM L;  1VQ6 A;  1Q86 C;  4DKA C;  1HNX L;  2UUB L;  2OTJ A;  1UE5 A;  4P74 A;  1OXS C;  1N34 L;  3HOW G;  1FL0 A;  2EXD A;  3S2D H;  2ZM6 Q;  1Q8K A;  1ASY A;  2PI2 E;  1VQH A;  3W5O A;  3I55 A;  4HIM A;  3T1H Q;  1YI2 A;  2Q2T A;  2D62 A;  2WP8 J;  1S72 A;  1EUJ A;  4DK3 C;  4A3K G;  3CCR A;  2VQF Q;  4QIW E;  2OTL A;  5C4X G;  2NN6 I;  1HZC A;  2VL6 A;  4A76 A;  4UP8 A;  4XTC S;  2YTX A;  1J5E L;  4B3M Q;  4TQU S;  4BXX H;  4A3B H;  3ULP A;  2H5X A;  5FLX c;  4QGU A;  2UUA L;  3FKI H;  4OO1 G;  3B6Y A;  1VQI A;  4R4Q A;  3S24 A;  1NJI C;  2NZH A;  2NVX H;  2AKW B;  3HOV G;  1IL2 A;  4DV6 L;  2JA6 G;  3A0J A;  3JAM c;  1PH4 A;  1K8A C;  2JQO A;  1E1T A;  3S14 H;  1VQB A;  1HZA A;  3CAM A;  4QY7 A;  2YYZ A;  4HID A;  4HIK A;  3ER0 A;  1YNX A;  2N3S A;  4DUZ L;  3PUV A;  3S1R H;  4C3H H;  1I94 L;  5GAD C;  3UDG A;  1ASZ A;  3S17 H;  4L5Q A;  5LMN L;  1N36 Q;  4DR6 Q;  3HKS A;  4JI4 Q;  1WCM H;  2B63 H;  1YJW A;  3ICE A;  1KHI A;  4BA2 I;  4HJ9 A;  2JE6 I;  4JBJ A;  3J81 c;  2BH2 A;  1MIU A;  3KF8 B;  5EAY A;  1IXR A;  2HHH L;  3M7N A;  1M90 C;  1J6Q A;  1VCI A;  1YEZ A;  4LF5 Q;  2EIF A;  4A4I A;  1JMC A;  4OWW B;  4A3G G;  1JT8 A;  3GO5 A;  3CC2 A;  4A3I H;  1Q82 C;  3PO3 H;  4OO1 I;  4LF4 L;  3RNU A;  4KI0 A;  3M9B A;  4IJH A;  5M3M G;  3G4S A;  4R4O A;  3GTG H;  3PO2 G;  3CXC A;  2LXJ A;  1XPO A;  5BR8 L;  5JEA J;  4OWT B;  2IX1 A;  3I56 A;  3RN5 A;  2IHF A;  4MZ9 A;  2XGT A;  4DV3 L;  4L5S A;  1Z47 A;  4C3I H;  4DR1 L;  3KYH C;  1HZB A;  2OQK A;  4P75 A;  1N8R C;  5FLM H;  4HIO A;  1HNW Q;  4JYA Q;  3FP9 A;  4A75 A;  4MTN A;  3GTJ H;  4A3J H;  1W2B A;  4JI5 Q;  4NXM Q;  3S1Q H;  4A3D H;  1Q1B A;  1HNX Q;  2VUM H;  1GM5 A;  2UUB Q;  4YWK A;  4A3C G;  1FVI A;  1HR0 W;  3L2P A;  5AJ3 L;  1N34 Q;  1UE7 A;  4BBR H;  1UWV A;  1K83 H;  4LWC A;  1E22 A;  2BH8 A;  4NPS A;  5C0X I;  2PQA A;  3W1G A;  2NVT H;  4BBS H;  1PH1 A;  4QQB X;  3PUY A;  5LMU Q;  1LYL A;  1VQO A;  1EFW A;  1QZH A;  2ZM6 L;  2PMZ E;  1EOV A;  3J7A 5;  4KHP L;  3T1H L;  4JI8 L;  4L5T A;  3RN2 A;  4JI6 Q;  1J5E Q;  1YJN A;  4EX5 A;  2JA5 H;  1L1O A;  2R93 H;  1G6P A;  5IYD G;  2OCE A;  1EYG A;  3UDX A;  2F52 A;  4A3E G;  5IYC H;  1QUQ A;  3RZO H;  5H1S E;  4HJ8 A;  1KAW A;  2QA4 A;  4DV6 Q;  1NY4 A;  1X6O A;  4QJF A;  2AMC B;  2JJQ A;  3DLL A;  1E24 A;  1WOC A;  4A3E H;  3CD6 A;  3CMA A;  1PVO A;  1K73 C;  4GOP A;  4KHZ A;  3NBH B;  4YCU A;  3AFQ A;  1KRT A;  5LMN Q;  1R9T H;  3M4P A;  1PH3 A;  4IPC A;  1K0R A;  5C44 G;  2QEX A;  1I6H H;  4YCV A;  2GVB A;  1EQQ A;  3EN2 A;  3GTQ H;  1VQM A;  1RIP A;  2HHH Q;  1N36 L;  2OQ0 A;  3S15 H;  1BBU A;  1PH9 A;  1KIX A;  2JEA I;  3KF6 A;  2IT1 A;  1MKH A;  1K3R A;  1P16 A;  3RLO A;  1JJ2 A;  5C4X H;  3JAM i;  4DR5 Q;  1VQK A;  2ZJQ A;  5HGQ A;  1L0W A;  2B3G A;  4KLK A;  4GS3 A;  5FJ8 G;  2MO1 A;  4JV5 Q;  4O2D A;  4K0K Q;  2ASB A;  1Q46 A;  1Y1V H;  3BU2 A;  5M3F G;  2K5N A;  4OXP A;  1M1K C;  3H3V I;  3HOV H;  1TWH H;  2K5H A;  2QGQ A;  1N32 Q;  4DV3 Q;  1C0A A;  1IZ6 A;  4DR1 Q;  1UE1 A;  1I3Q H;  2HQL A;  5IY0 A;  2UXD Q;  1JJG A;  1DGS A;  5ELO A;  2MO0 A;  2OWO A;  4IO9 A;  3GTL H;  1X3F A;  3K80 C;  5IYB G;  5GAG C;  5IE8 A;  4GNX A;  1E3P A;  3HFZ B;  4X6A H;  4PZ6 A;  2CKZ B;  5AJ3 Q;  3CC7 A; 
#chains in the Genus database with same CATH topology
 4YWL A;  5CV9 A;  2KEC A;  3TQY A;  1STB A;  2K01 A;  2WB1 G;  3PIO A;  5C0X H;  3GTK B;  3L7Z C;  4OIK A;  5LMU L;  4A3F H;  4F87 A;  4GNX C;  4PMW A;  4JI6 L;  2K5V A;  2F0O A;  3EBE A;  3W2D A;  3QG1 A;  3GTM B;  5M3F B;  2F0Q A;  1YJ9 A;  1FGU A;  3I4M B;  3TP5 A;  3K5O A;  1YNN D;  2ZJR A;  4A3C H;  3BDC A;  5IGB A;  3RLF A;  2QKI C;  1EY6 A;  5JEA G;  4OX9 L;  5HY6 A;  1STN A;  3DWP A;  3E9I A;  1PRT F;  1TKW B;  2AHO B;  1G29 1;  3A5Z B;  3H94 A;  1NUC A;  2E2D C;  2FIN B;  2F0J A;  4BY1 G;  2NTS A;  1X3P A;  1WTQ A;  4A3M B;  4G4K A;  1PZI D;  1SNO A;  4POG A;  1LAB A;  5IYD H;  2NVY B;  1JE5 A;  2KHI A;  1B44 D;  4JOI C;  3NBI A;  1H9S B;  4JV5 L;  3MTS A;  1IW7 C;  4K0K L;  4LAA A;  1SFO H;  3S2H B;  4KN4 C;  1DOL A;  3PUW A;  2MQH A;  3H3V H;  3E5S A;  1XTD A;  2YTY A;  2A69 C;  2P5Z X;  4RGN A;  4RWS C;  2JA6 B;  1V1Q A;  1Y8P B;  2O5I C;  1W3S A;  2FXQ A;  3WWV A;  1H9K A;  5JJI A;  4IJL A;  3DM3 A;  1JWS D;  1Z7T A;  2EYH A;  3OIQ A;  2O5J C;  1OXU A;  3K81 C;  1AEX A;  5C3W A;  4PG3 A;  4B3T Q;  1LUZ A;  4ID6 A;  4I65 A;  1A8V A;  5C3X A;  3FKI G;  4ZLT F;  2RDF A;  2R7F A;  5LL6 X;  2B29 A;  1MD2 D;  3SGI A;  4YHH L;  1WVL A;  4UY8 C;  1SNP A;  2RA4 A;  4C56 C;  4DV4 L;  2E8G A;  2RCN A;  4JBW A;  5E1F A;  5IYB H;  1H95 A;  5M5X H;  3VR5 A;  1HR0 Q;  4POF A;  1KRS A;  5C0X J;  3VYS A;  1A62 A;  3ZJY C;  3RZD B;  1CZW A;  2RF4 A;  3FPP A;  4KKS A;  1HQM C;  3NXW A;  3HOW H;  2M2L A;  3BVM A;  3R8B A;  4JI0 Q;  4DU9 A;  4CGY B;  3X3N A;  1U5K A;  3K7A H;  3KF8 A;  4KKU A;  4OEM B;  5M5Y H;  3OTO Q;  3D3R A;  1EZ8 A;  1D8L A;  4P72 A;  1VQC A;  1W6J A;  4LFB L;  3CCL A;  2RSO A;  1SE2 A;  2EVB A;  4EQ5 A;  1FYC A;  5IGC A;  2RQX A;  4OO1 H;  3S1M H;  3TN2 A;  2Q2I A;  1II3 A;  2EZV A;  3DWQ A;  3SXH A;  2F3I A;  1ENC A;  1Y69 U;  1LT4 D;  1NE3 A;  2KEN A;  3CKI B;  4FF2 A;  4ZAI A;  2ATW A;  5I6Y A;  1PFB A;  1KLU D;  5IIF A;  1EY9 A;  1EY4 A;  5K5P A;  3TRE A;  3Q23 A;  1XTC D;  2WAC A;  4KD3 A;  1SJE D;  2CFM A;  3QB3 A;  1D2B A;  5JOB A;  3HEJ A;  3CF5 A;  4A3G H;  2K52 A;  4NXN Q;  4EVO A;  4B3S L;  4RKL A;  1JWU D;  4LK1 C;  5BN4 A;  3EQL C;  1KAA A;  1T5E A;  2C9O A;  3JAM L;  1U0L A;  1IBL Q;  4IFD G;  1A6X A;  5EBD A;  5CV7 A;  1GUN A;  3A8J E;  3S16 B;  2YU9 H;  1S5B D;  2WAQ G;  4LF8 Q;  1Q12 A;  3NK9 A;  4LUV A;  2VQE L;  3BDO A;  3R2I A;  1BUV T;  1JOQ A;  4H02 A;  2C35 B;  4Y7N H;  1U9R A;  4JOI A;  1HJP A;  1DOK A;  1XNR Q;  4DFA A;  1KD1 C;  1GVP A;  1UE6 A;  2MP1 A;  4YY3 Q;  1N33 Q;  1VQF A;  1PV4 A;  3T1Y L;  1CFM A;  1CZG A;  4IFD I;  1Y1V G;  2CWA A;  5IGG A;  4X62 Q;  3CPW A;  1Q1E A;  1OXT A;  3BZC A;  5CYU A;  3HOZ B;  2L55 A;  3K5M A;  1Y1W B;  1T9H A;  1VQ4 A;  2R6G A;  3U4Z A;  4ZK9 B;  1DZ1 A;  4JI1 Q;  1BOS A;  3M4O H;  4QB4 A;  4B3R L;  3UE0 A;  1ONL A;  3CQZ H;  4ZUJ A;  4XYO A;  3MXN A;  4X66 Q;  5C44 H;  3J81 j;  4DV1 L;  1Y14 B;  2F0L A;  2I5M X;  5KNB A;  2K6A A;  3IL8 A;  4XT3 B;  4C3J B;  1E2V A;  3VYU A;  3G6E A;  1B8A A;  1XNQ L;  2A8V A;  4JI2 Q;  5IGD A;  3S15 B;  3K57 A;  1STA A;  1B1Z A;  4ALP A;  3OW7 A;  5FJ8 H;  2NZO A;  5DM7 3;  3BDL A;  1HCZ A;  2GA4 B;  3P20 A;  1QVG A;  1GD7 A;  2YV5 A;  4JC0 A;  1VQ8 A;  1VQJ A;  3BZD B;  1SNC A;  4P71 A;  3Q6S A;  3UE1 A;  4A93 B;  2RVL A;  2PPB C;  1F2M A;  3M4Y A;  4Q5V A;  2Q2H A;  4GNX B;  1GHJ A;  2JXM B;  1WTH A;  3U58 A;  3IFT A;  5FLX E;  4DR7 L;  2ENB A;  4JI7 L;  1I50 B;  2X6L A;  4HMJ A;  1S5D D;  2XTI A;  4UP9 A;  5C4J H;  2AQ2 B;  4LF9 L;  2DNC A;  1SYF A;  5FK9 C;  2B63 G;  1PFM A;  1X3G A;  3EFX D;  1A0I A;  4C2M H;  3GTP H;  1SR3 A;  4QL5 A;  4YIJ A;  4DV0 Q;  4NP5 A;  2E5L L;  3MEF A;  4RAU C;  1ML0 D;  3VDY A;  1TWG H;  3J81 E;  2RCF A;  3NEM A;  2K33 A;  1QVC A;  3HOU G;  2BE5 D;  2XRS D;  4DR3 L;  5IWA L;  1AN8 A;  3DEO A;  1XMQ Q;  3GV3 A;  2KCC A;  1KNE A;  1A3V A;  3NE5 B;  1I94 Q;  1CSP A;  1ET9 A;  2EYO A;  1YHQ A;  1HTP A;  1L2F A;  2XIW A;  1L1O C;  2IPK D;  5I9P A;  4DR6 L;  1U4P A;  1DJR D;  5IT9 L;  2EY1 A;  1BBW A;  1Y8N B;  4J15 A;  4PZ7 A;  2PW7 A;  3H6M A;  5DLQ E;  5BR8 Q;  3I4M G;  2CQO A;  3N6R A;  5JVG 3;  3J81 i;  2JP1 A;  3CME A;  1CSQ A;  4DA2 A;  1A3U A;  3MXN B;  1SNM A;  2BA0 A;  2I5L X;  5CBE E;  3UDF A;  2E2H H;  4AH6 A;  2K5W A;  4JYA L;  3BZK A;  1OTC A;  1TS4 A;  2O2L D;  4ZQ3 A;  1EYA A;  4A3J B;  2Q2T A;  4RGM A;  1EUJ A;  3CCR A;  2VQF Q;  4QIW E;  4BBR B;  1JOR A;  4UP8 A;  1J5E L;  3FVQ A;  3A56 A;  4A3B H;  4ILW A;  5FLX c;  4QGU A;  4FYD A;  1VQI A;  3S24 A;  1NJI C;  2NZH A;  1HFN A;  1RTN A;  2KQ3 A;  2JA6 G;  1Z6H A;  3AB9 A;  3CAM A;  1JCK B;  2KOL A;  4QY7 A;  4TRD A;  2QIL A;  3ER0 A;  1IKL A;  3UDG A;  3ND9 A;  4OIJ A;  5I4D A;  3HKS A;  2B63 H;  5KYL A;  1W6K A;  1KHI A;  3J81 c;  1M90 C;  1O7Y A;  1YEZ A;  1GXD C;  1EWH A;  1JT8 A;  1B9N A;  3CC2 A;  1IL8 A;  2F0K A;  4A3I H;  2IW3 A;  1Q82 C;  4LF4 L;  5COY A;  1FNV A;  3M9B A;  1NNX A;  4R4O A;  3GTG H;  3PO2 G;  2SDF A;  3NQT A;  3KLS A;  2ICI A;  3TME A;  4OWT B;  4XXE A;  3MC0 B;  2PCF B;  1TS2 A;  4QUC A;  4L5S A;  4DV3 L;  3QR8 A;  2A6E D;  1HZB A;  1N8R C;  5I6W A;  1GUG A;  3S9W A;  1HNW Q;  4A75 A;  4NXM Q;  4ZRZ A;  4A3D H;  1HNX Q;  2VUM H;  1GM5 A;  2K03 A;  1HR0 W;  5G3L D;  3L2P A;  4UHV A;  3GTL B;  1D1K A;  1LV9 A;  2PQA A;  3Q22 A;  1LLR D;  3A8I E;  3PUY A;  5LMU Q;  1EFW A;  1QZH A;  2ZM6 L;  3C2P A;  3NQI A;  4L5T A;  3RN2 A;  1G2S A;  4IUP A;  2JA5 H;  4EX5 A;  4JI6 Q;  3OMG A;  1L1O A;  2R93 H;  3BVG A;  4A3G B;  3UDX A;  3VR4 A;  1CHP D;  2DJG C;  2PYK A;  5H1S E;  1NY4 A;  2A68 C;  4XQN A;  1A3T A;  1E24 A;  2IX3 A;  2PQE A;  1PTO C;  1BDO A;  4YCU A;  5IOC A;  1Q8I A;  3R3O A;  1EQQ A;  1S4Z A;  2EYF A;  3KF6 A;  4XQJ A;  1MKH A;  3O13 A;  1JJ2 A;  1U4R A;  4Z9C B;  4UAI A;  5HGQ A;  1L0W A;  1X3Q A;  2B3G A;  4KLK A;  2L4N A;  4JV5 Q;  4K0K Q;  3BVZ A;  2ASB A;  1Q46 A;  2CH4 W;  2KED A;  1TWH H;  2JA8 B;  1I3Q H;  4A3E B;  2Z4I A;  3ND8 A;  3HFZ B;  1O7L A;  4PZ6 A;  2CKZ B;  2F0P A;  5AJ3 Q;  1FNW A;  1QE6 A;  1MJC A;  3HZX A;  3ERO A;  1PH8 A;  1EU4 A;  1SSO A;  3PMF A;  4BA1 I;  4JVZ A;  2J4X A;  5I2X A;  4G57 A;  4JI8 Q;  3HOY H;  3TRZ A;  1WFQ A;  2LSS A;  1HXY D;  1YZ6 A;  4YHH Q;  3I4O A;  3T4A C;  3TEH B;  5E4W C;  1MHW C;  4C3J G;  4EQN A;  2PZT A;  2JA7 G;  2Q8T A;  1K0S A;  2F0G A;  3PUZ A;  2PQA B;  1NMF A;  1SNQ A;  1AH9 A;  2DNE A;  1RD9 D;  2I07 B;  3I70 A;  1CUK A;  1RHP A;  4A3L H;  4N8X 1;  1SAP A;  1Z9F A;  1L1O B;  1U4L A;  1WYD A;  1STH A;  4LFB Q;  1QIL A;  1OO9 B;  1IYU A;  4J6H A;  4DR5 L;  2F0H A;  3K7U C;  4LMQ D;  2EY2 A;  1KDA A;  4DF7 A;  2PZW A;  5KIX A;  1BF4 A;  3SE0 A;  4LNQ A;  2B2T C;  4LF7 L;  1RDP D;  4DV2 L;  2E2J H;  1GHK A;  1IBK Q;  4IPD A;  1O7Z A;  3A54 A;  1QCB D;  3KF6 B;  4Q0F A;  1K8G A;  1WTX A;  1DON A;  2N55 A;  4C1N I;  3PF4 A;  2KBN A;  4HTH A;  5LL6 S;  4LF6 L;  2IJ0 A;  5I9O A;  4R9W A;  1GOZ A;  4G7O C;  2JEB I;  3J80 E;  2H4O A;  2AUJ D;  4QUF A;  4BXX G;  2UXC L;  3I4L A;  1YHA A;  1IYJ B;  1XMO L;  3KLR A;  2NN6 H;  4OGQ C;  3HKZ E;  3H0G G;  1TXY A;  2VQE Q;  1TS3 A;  4H13 C;  3LWU A;  5C3E B;  1WTV A;  1UAP A;  4C3H G;  4ZKB B;  4BY7 B;  3I7F A;  2D0O A;  1HNZ Q;  1WCM G;  1FJG Q;  2ES2 A;  3DWA A;  3AYH B;  5EQ0 A;  1MSH A;  2ZTD A;  3CRL C;  3CW2 C;  2R92 G;  2AWN A;  2VB3 X;  3PGZ A;  4FDB A;  3NEN A;  3A7A B;  5JAV A;  3PF5 A;  1E2W A;  3G48 A;  4MN3 A;  4H44 C;  3J80 i;  3E0E A;  2WII B;  3NUC A;  5M5W B;  4UPA A;  1ZKO A;  3M3Y B;  2VNU D;  2EY6 A;  2JA7 H;  3NHH A;  1ENF A;  2A73 B;  2ZXR A;  1B2T A;  4A3J G;  2BA1 A;  1X9N A;  1KNA A;  3GDE A;  1GKH A;  3FMC A;  4ME3 A;  3NEL A;  4B08 A;  3CC4 A;  4H7B A;  2B2Y C;  3PV0 A;  4BBR G;  5IP9 G;  1LTL A;  4DV5 Q;  1QZG A;  2OF1 A;  4BBS G;  1LM0 A;  2NVQ H;  1VQP A;  1TR5 A;  4FXK C;  3ONA B;  3OSO A;  4CBV A;  1TWC B;  2JA9 A;  3NP8 A;  2F4V L;  3C1E A;  3FDT A;  5M3M H;  1MBY A;  1JC7 A;  4I7A A;  1STY A;  1ILQ A;  3NPP A;  2WFW A;  3LGJ A;  3I4N G;  5IYC G;  3VYT A;  4DV7 Q;  4NKL A;  1EIH A;  4DPG A;  3SEB A;  2VB2 X;  1YNJ C;  2J7Z A;  4DR4 L;  2Z8L A;  1CA6 A;  4DR7 Q;  4JI7 Q;  1LTG D;  2BE5 C;  2ZXO A;  4GZY C;  1QNK A;  4LF9 Q;  2QCP X;  3J80 c;  3OHX C;  1TWF H;  1PTO B;  4NW2 A;  4KJN A;  2KJX A;  5J39 A;  3GV6 A;  3I91 A;  2N49 A;  3JC6 6;  1F2Y A;  2E5L Q;  4HAE A;  3NTH A;  5C4H A;  2B2T A;  1QUQ B;  1PYB A;  3URY A;  2K28 A;  2IX0 A;  4DR3 Q;  2A68 D;  5IWA Q;  1SMX A;  4DGZ A;  4DR2 Q;  3H0G H;  1PTO D;  3RUZ A;  2R7Z B;  1LTR D;  3AQQ A;  5KND A;  3TS2 A;  3X3M A;  1FNU A;  1VQ5 A;  1HUN A;  3Q24 A;  2VZA A;  3J7Z C;  2K32 A;  3GTO B;  2F0M A;  2CWP A;  1EOT A;  4FXD A;  3AFP A;  1GUO A;  1OXV A;  3KOJ A;  2R92 H;  4DK6 C;  3EJI A;  2B2V C;  3MFG A;  4X64 L;  2B8F A;  1PA6 A;  2UXB L;  4ZCK A;  4DXF A;  4DK1 A;  3HOX G;  1G8Z D;  1JR0 D;  3SVM A;  4RFB A;  1B3A A;  1AZQ A;  2UU9 L;  1QOH A;  4WJ3 M;  3H3V C;  4AQY L;  1STG A;  2V4D A;  2N78 A;  4LFA Q;  1EIF A;  2K4K A;  3DXJ C;  4KK7 A;  4NB3 A;  4HED A;  1YIJ A;  5IP9 H;  2EYJ A;  4L63 B;  1NMG A;  3HKZ B;  1BKB A;  2HIV A;  4GLX A;  1TU2 B;  4M8A A;  2AQ3 B;  2BCO A;  3D6C A;  3ERS X;  2RDG A;  2JA8 G;  4DUY Q;  3MWY W;  4GN5 A;  3I4N H;  3PO3 G;  3F2C A;  2NYZ D;  2Y0S B;  1BVS A;  4CDD C;  1J8I A;  4S3S A;  2B2Y A;  1F9P A;  2ALY B;  1SEB D;  3STB C;  3TP8 A;  4IOC A;  3F2B A;  2CW0 C;  2XNA C;  4C3I G;  3K8A A;  3M7G A;  2F0D A;  1KC8 C;  1H9R A;  1SRO A;  5JEA H;  3MVV A;  4KY5 A;  3D4R A;  1XPR A;  2A6E C;  4JI4 L;  2JSO A;  1O7I A;  5EKI A;  2DGY A;  5G3L F;  4BY1 H;  1KDC A;  4LF4 Q;  3KJO A;  4JI3 Q;  3S17 B;  1AP0 A;  2RHQ B;  2FMC A;  4X65 L;  5IGF A;  4GOP C;  1E1O A;  4GKK L;  1B70 B;  4O0A A;  1DXM A;  1V9P A;  1I4P A;  1UEA B;  1EEF D;  1XJV A;  1E0B A;  1YBY A;  2HCC A;  2NWG A;  4K8J A;  2BDN A;  2ZTC A;  2XN9 C;  3C1F A;  1ICW A;  1WI5 A;  2EYP A;  2MGS A;  1WTO A;  4FP5 D;  3WOF A;  4KMU C;  5DEH A;  4JI5 L;  2L12 A;  1VQ6 A;  3K6O A;  2UUB L;  1OXS C;  1R4P B;  1N34 L;  1SYE A;  2KA7 A;  2EXD A;  2RBM A;  3GTJ B;  3S2D H;  3LNN A;  2ZM6 Q;  4HR7 B;  1YI2 A;  1VQH A;  4IUN A;  2DY7 A;  4CKC A;  4A3K G;  5EBC A;  2OTL A;  3K0Y A;  5C4X G;  1K83 B;  4A76 A;  4XTC S;  4B3M Q;  3IAY A;  3ULP A;  1XYI A;  3FKI H;  3B6Y A;  5F2D A;  4R4Q A;  3BS1 A;  3DMU A;  2NVX H;  2AKW B;  3HOV G;  1IL2 A;  2B2V A;  2JQO A;  3S14 H;  1HZA A;  4LJZ C;  5AFW A;  1CQF A;  4DUZ L;  1YNX A;  3RZO B;  3S1R H;  4DAV A;  3V05 A;  2EE1 A;  5A2Q E;  1ASZ A;  2B2U C;  5LMN L;  1O78 A;  2K7V A;  4PMC A;  4H0L C;  5DNF A;  3ICE A;  4BA2 I;  4HJ9 A;  4JBJ A;  3SK8 A;  3SK5 A;  2BH2 A;  3BG3 A;  3G6J B;  3KF8 B;  1IXR A;  5EAY A;  1VCI A;  4K8I A;  4IQZ A;  4LF5 Q;  1JMC A;  4XQQ A;  3RD4 A;  3PO3 H;  4V19 0;  3RNU A;  4JK1 C;  4X3K A;  3TP6 A;  5JEA J;  1V1O A;  1B4O A;  2CH4 A;  1O80 A;  5ELB A;  2OEO A;  2IHF A;  1TVX A;  2K5D A;  3OOC A;  2H1E A;  4C3I H;  4DR1 L;  3I90 A;  4BS9 A;  4IUU A;  4HIO A;  2R3Z A;  3FP9 A;  3K5L A;  3S1Q H;  5NUC A;  1Q1B A;  2E74 C;  1KLG D;  1UE7 A;  2PZU A;  1E22 A;  4K5V A;  3KUP A;  4NPS A;  2NVT H;  3I72 A;  2SEB D;  1PH1 A;  1MSG A;  1LYL A;  1QB5 D;  3T1H L;  5C5M A;  1YJN A;  2L0C A;  1Q90 A;  4DAY A;  1YNJ D;  1EWC A;  5CGK A;  4DV6 Q;  4IFD H;  2AUK A;  4KD4 A;  4CKB A;  4A3F B;  4QJF A;  3DLL A;  1PVO A;  1K73 C;  2IWH A;  1NAP A;  4GOP A;  3AFQ A;  1R9T H;  3M4P A;  4YCV A;  3GTQ H;  2HHH Q;  2OQ0 A;  4WOR A;  4XT1 B;  3QIA A;  3P75 A;  1KIX A;  5CV5 A;  2HCI A;  2L1B A;  1P16 A;  5C4X H;  3GP7 A;  4DR5 Q;  2ZJQ A;  3NWT A;  4CJ2 C;  2G9H D;  2F3V A;  4HCS A;  1B3Q A;  1Y1V H;  4MTK A;  5M3F G;  4ZUI A;  2EDG A;  4OXP A;  3HOV H;  1KTK A;  1D6E C;  4MIU A;  4DNR B;  2E76 C;  5COR A;  2LKV A;  2MPM A;  5IY0 A;  1JJG A;  2OWO A;  4IO9 A;  3KBX A;  3K80 C;  5GAG C;  1SFO B;  5CMD A;  2OXP A;  1E3P A;  1D1I A;  2F4I A;  1I4X A;  4GLA C;  5ELN A;  3L3O C;  5EKL A;  4A3M G;  3E0J A;  3A7L A;  1JIC A;  5FKA C;  5KGU A;  4LF6 Q;  2N8N A;  4XIG S;  1JE4 A;  3IRB A;  4KHP Q;  3J7Y W;  3E9H A;  2LFN A;  3TSS A;  4ABN A;  4B3T L;  2B2U A;  1S5E D;  5DM6 3;  1NSN S;  3EA6 A;  5FO9 B;  5ELC A;  3J7A V;  4ZKC B;  1HR0 L;  3WDN A;  3NTI A;  4JPB W;  2EYL A;  1GUS A;  3D31 A;  1TT2 A;  5M5X B;  2EPB A;  3GD7 A;  3MXG A;  1EYD A;  1BXT A;  1N9W A;  4JI0 L;  3LWE A;  4IFD J;  4DAY B;  4IZ8 A;  1R4Q B;  3SDZ A;  3UDI A;  1KQS A;  3OTO L;  3TP7 A;  1EFI D;  3HOW B;  1TWA H;  5E4X A;  1FGB D;  2Z6K C;  2MFI A;  3STB D;  1VF7 A;  3K7A B;  1BCP C;  4RCN A;  3HOU H;  2CW0 D;  5M5Y B;  4GOP B;  3HG9 A;  2E2I H;  1T5X D;  3D6W A;  2HQE A;  4CHT B;  1CHQ D;  3FPU B;  3G7L A;  1C8C A;  1N32 L;  3I3C A;  3MAQ A;  2UXD L;  2BDO A;  3S1M B;  3KDF A;  2RSN A;  3TZD A;  3GTK H;  1B53 A;  5ELE A;  5GRO A;  2D9U A;  1I6V C;  5KNC A;  4RG1 A;  4HN7 A;  1PH7 A;  3TS0 A;  2F0T A;  5M3F H;  1RL2 A;  3I4M H;  1GJX A;  4KJO A;  4R8N A;  1ET6 A;  1H9J A;  1IBL L;  1VQ7 A;  3OYY A;  1DCZ A;  2Z6B A;  3CCV A;  5E7N A;  3HRZ C;  3SR1 A;  3P7J A;  5D65 A;  2LXK A;  3SK6 A;  4OX9 Q;  1PTO F;  4IUV A;  4A3M H;  2RHS B;  3GQB A;  2FFK B;  4DNT B;  5JJL A;  2YU9 B;  4HMI A;  3KLW A;  4XYQ A;  2NVY H;  4YY3 L;  1VS0 A;  1S5C D;  4Y7N B;  4PMB A;  1DM0 B;  1VDZ A;  3S2H H;  3V2T A;  2E75 C;  1CM9 A;  3E3X A;  5HUR A;  2LMC B;  4X62 L;  2WIN B;  1A63 A;  1VQD A;  5K36 G;  4ULL A;  3F1Z A;  4ODG A;  3SK4 A;  2JA6 H;  5T1G A;  4JI1 L;  4IN3 A;  2UUC L;  2EJF C;  3ITP A;  4B9W A;  1ESF A;  3QOL A;  3K0X A;  1SN8 A;  3RMH A;  3VR2 A;  4X66 L;  1C9O A;  4GKJ L;  4KY7 A;  4X64 Q;  3M4O B;  2NZ1 D;  1GUW A;  4CDC C;  1IKM A;  1HHV A;  3CQZ B;  2ZT9 C;  5KYI A;  4PZ8 A;  5C44 B;  4NDX A;  2Z0S A;  1RTO A;  5FLX L;  1B7Y B;  3CHB D;  3UI2 A;  3HOZ G;  3MA2 B;  2UU9 Q;  2F3W A;  3PO2 H;  3QJY A;  3K58 A;  1QWY A;  1Y1W G;  2M9V A;  1ZYR C;  1S3O A;  2KCM A;  1Q81 C;  4N8F A;  3KDF B;  4DV4 Q;  2DUD A;  5C4Z A;  3RZD H;  5BN5 A;  4P73 A;  3I2Z A;  1C7Y A;  4JBM A;  3CP0 A;  1F77 A;  2XRQ D;  3MFY A;  2Z6K A;  3J81 L;  1G2T A;  1YVC A;  1XPU A;  1A15 A;  3RR5 A;  3DHQ A;  5C4J B;  2SNS A;  2AWO A;  4ME5 A;  1I5F A;  2WKD A;  2K50 A;  1SND A;  2D0P A;  4DV0 L;  1K9M C;  1VQE A;  4A93 G;  4C2M B;  3GTP B;  4R1J A;  1CKM A;  2LS0 1;  3J7A F;  3KFU A;  1AE3 A;  3WOE A;  1TWG B;  1XMQ L;  3NTK A;  1X56 A;  2NTT A;  1WTW A;  1NBW A;  1LT3 D;  1XWE A;  1X3E A;  1HUM A;  4IUQ A;  2WAQ B;  2N88 A;  1CT1 D;  4X65 Q;  4K6L A;  4HJ7 A;  5FO8 B;  4GKK Q;  2GVA A;  5C0X G;  5A35 A;  3HGB A;  4B3S Q;  4R4T A;  3HS0 C;  4A3F G;  1NR4 A;  3S16 H;  1D5M C;  5K36 H;  4IPH A;  4DXG A;  5IGE A;  5EKK A;  1PYW D;  1RCV D;  2VW9 A;  3S1N H;  2PI2 A;  2FHT A;  4MNO A;  3T16 A;  2L9H A;  1NTG A;  2KHJ A;  1PYS B;  4GN4 B;  3CCM A;  3M85 A;  4LFC L;  2F1M A;  2E2H B;  1STE A;  1IBM L;  3QWN A;  2Y0S E;  2A1A A;  3T1Y Q;  5GQO A;  3HOZ H;  3U4V A;  5GAE C;  2VQF L;  2NB0 A;  5JPN C;  1Y1W H;  3F2D A;  4P2C B;  1QJO A;  3R93 A;  5HGT A;  2A19 A;  2B8G A;  4TKO B;  4K6D A;  4APV A;  4F88 A;  3H15 A;  1H9S A;  4DUZ Q;  4FNF A;  2L5T A;  4E6I A;  4A3B B;  1QG7 A;  4B3R Q;  1BCP B;  1Y8O B;  4C3J H;  3I8Z A;  2YTV A;  1BR9 A;  1ENA A;  5FLM G;  1Q7Y C;  1F9S A;  1EWI A;  2NUC A;  4DV1 Q;  1IYV A;  1VQL A;  4RGT A;  3CU7 A;  1X55 A;  1LTI D;  3L0O A;  3AEV A;  1NR2 A;  1XNQ Q;  4KV6 A;  2D2C C;  1BBX C;  2B63 B;  3CCE A;  2MJ8 A;  5D3D A;  5JPM C;  1BCP D;  1CA5 A;  1EY0 A;  1WD0 A;  1HZ9 A;  4A93 H;  3QO2 A;  4OL7 A;  2MUY A;  4AYB E;  4DNI A;  2KHS A;  1LAC A;  1V8Q A;  4A3I B;  1LTS D;  5J22 A;  1EY7 A;  1I50 H;  3OW2 A;  3ULL A;  1YIT A;  4C1N K;  3GTG B;  1L0Y B;  3SHL A;  5JJZ A;  3CCJ A;  1HNW L;  1VQA A;  4OON A;  4OHJ A;  1J9O A;  4U68 A;  4NXM L;  1Q86 C;  4DKA C;  2HD3 A;  1HNX L;  2EJG C;  1KDB A;  4P74 A;  2ICE C;  3HOW G;  1ASY A;  4A3D B;  4HIM A;  3I55 A;  3T1H Q;  2VUM B;  1LTB D;  1SMY C;  2B39 A;  4O42 A;  2VL6 A;  1HZC A;  1H9M A;  2YTX A;  1VF5 C;  1XXG A;  4BXX H;  2NBF A;  1V1P A;  1EEI D;  2H5X A;  2I46 A;  2UUA L;  4OO1 G;  2EY5 A;  3CRK C;  2JA5 B;  4EQO A;  2R93 B;  3JAM c;  1PH4 A;  2Z4H A;  1Q3L A;  2YYZ A;  4HID A;  3D4D A;  4KTA A;  4HIK A;  4PV1 C;  4DAP A;  2F0E A;  4C3H H;  4K14 A;  4RHR A;  4L5Q A;  4RKB A;  4DR6 Q;  1PRT C;  1WCM H;  1CI3 M;  1YJW A;  2JE6 I;  4BWG B;  3OIP A;  1MIU A;  4IUT A;  3M7N A;  2XVS A;  1J6Q A;  1VMC A;  1DOM A;  2EIF A;  4A3G G;  4FF3 A;  4OO1 I;  5C5L A;  4IJH A;  3CXC A;  2LXJ A;  4K5W A;  4IUR A;  2M00 A;  2DN8 A;  2JYO A;  1EQV A;  3I56 A;  5E3F A;  5IT9 E;  1HA6 A;  2PNR C;  5FLM H;  4JYA Q;  1S5F D;  1TWH B;  4MTN A;  4A3J H;  5EPK A;  1I3Q B;  4YWK A;  1FVI A;  2QDB A;  5AJ3 L;  3BYY B;  4BBR H;  2WV6 D;  4BBS H;  3W1G A;  4QQB X;  3AMU A;  2L11 A;  1VQO A;  3A55 A;  1TY0 A;  2PMZ E;  1EOV A;  4JI8 L;  4IAL A;  1J5E Q;  1ZYR D;  1G6P A;  2OCE A;  5FOB B;  1EYG A;  2ZXP A;  4A3E G;  5IYC H;  1KAW A;  2QA4 A;  3PO2 B;  3HOY B;  4G7Z C;  2AMC B;  3VYR A;  3VA5 A;  4FF1 A;  2OT2 A;  2SOB A;  3CMA A;  3CD6 A;  3H91 A;  3F2U A;  3H09 A;  5M9O A;  1PZJ D;  4KN7 C;  1EL0 A;  2G9D A;  5C44 G;  2QEX A;  1I6H H;  3PIP 3;  1EZ6 A;  2PW5 A;  2K05 A;  1RIP A;  1N36 L;  4WJW A;  1PH9 A;  4K2K A;  1K3R A;  1V1P B;  3RLO A;  4KY6 A;  4CKE A;  1VQK A;  2HUG A;  3TDQ A;  5FJ8 G;  2F0V A;  2MO1 A;  4DK0 A;  2BOS A;  2HDL A;  5CV4 A;  2K5H A;  2QGQ A;  1N32 Q;  4DV3 Q;  1IZ6 A;  2HQL A;  2UXD Q;  4CJ0 B;  1DGS A;  2MO0 A;  5EPL A;  3GTL H;  5J1Z A;  4AYB B;  2AQ1 B;  3J80 L;  2RDH A;  4GNX A;  4QCL A;  1PXU A;  1CQV A;  1E2Z A;  2A5H A;  1IBK L;  1K28 A;  3DUZ A;  3CC7 A;  4RCO A;  2K04 A;  3KBG A;  1TY2 A;  1V43 A;  4FF4 A;  2E2J B;  1MJE A;  2KUM A;  2K1B A;  1PDQ A;  5D3I B;  4YWM A;  1PLF A;  2PNH A;  5IT9 c;  4HSV A;  4R4C A;  2LY7 A;  1KXL A;  4IOA A;  2KVM A;  1WTR A;  4FO2 A;  5L37 A;  1SBB B;  4FVM A;  3OMC A;  3VR6 A;  3HOX H;  1VQG A;  5ISR A;  2K14 A;  1X65 A;  3S1N B;  1U4M A;  3T53 B;  4QF4 A;  3R2T A;  4PQX A;  1HNZ L;  2GN5 A;  1FJG L;  5J3B A;  3N52 A;  4WRD A;  3CCU A;  3OWF A;  2WB1 E;  3A5U A;  1JOK A;  2JA8 H;  1C4Q A;  1SE8 A;  4A3E H;  4TVA B;  3U50 C;  1EQR A;  4IPG A;  1AFP A;  3NWS A;  5C3E G;  2A6H D;  2UUC Q;  4BY7 G;  1EQT A;  2F0I A;  1SRU A;  4GKJ Q;  1I4Q A;  1CKN A;  2JA7 B;  1I4R A;  4G7H C;  4DV5 L;  2DJF C;  4F8M A;  4UP7 A;  4HJ5 A;  1UUP A;  5IOD A;  1K8M A;  3U9O A;  1JJC B;  3CCS A;  1HQR D;  4RHS A;  1PFS A;  2IL8 A;  2Q8R E;  3FHW A;  1JB7 A;  1AZP A;  1PH5 A;  4A3B G;  2NVQ B;  1SJH D;  1IHZ A;  2ID0 A;  4DAM A;  1RKN A;  3P1H A;  4DV7 L;  3U9S A;  2PMZ B;  4LUZ A;  2HT1 A;  5M3M B;  1BQQ T;  1HRJ A;  3D0F A;  4AIM A;  3IKJ A;  1D5Z C;  5LMN W;  4Y52 H;  2J0T D;  4J1M A;  1UEB A;  1SMY D;  2V1C C;  2CCZ A;  2JK8 A;  4MHE A;  5T1I A;  5EPJ A;  1GO3 E;  4GLV B;  3T51 B;  1PRT B;  3D8G A;  4J8Q A;  4CJ1 B;  3Q8D A;  2EXZ A;  4A3K H;  4A3I G;  4L8J A;  1TWF B;  4DN4 M;  3NSW A;  5GAH C;  1VMP A;  1F2Z A;  2I0Q A;  2ZJP A;  4DR2 L;  3T13 A;  1AE2 A;  4TSS A;  3PSI A;  2FJ2 A;  2X6G A;  1EIY B;  2VY3 A;  1PRT D;  1EU3 A;  4LF7 Q;  4DV2 Q;  1TS5 A;  4A3D G;  3H0G B;  2VUM G;  3PIP A;  1QNU A;  1LT5 D;  4R4I A;  4UDU C;  1SYD A;  5BN3 A;  4C3H B;  5ELD A;  2MNA A;  4LW1 A;  1HTL D;  1WCM B;  1K8O A;  5I2Y A;  1WTP A;  5JJK A;  1SLJ A;  5C6A A;  1IW7 D;  2I5H A;  3OPO A;  2JA5 G;  4L5R C;  3BYT B;  3G71 A;  3VR3 A;  1VQN A;  2R93 G;  2R92 B;  2UXC Q;  1EIG A;  1HPC A;  3TZU A;  5LHY 1;  1HFG A;  1XMO Q;  2R7Z G;  3C3L A;  5C3E H;  2O4X A;  2A69 D;  2HIX A;  1CKO A;  4BY7 H;  1B9M A;  1OXX K;  1CKN B;  1EY5 A;  1EY8 A;  5DAU A;  5IP7 G;  4N9T A;  1LTA D;  1JQY D;  1ESR A;  2R7D A;  3MZ5 A;  4JW0 A;  3PUX A;  4LFA L;  4LFC Q;  4O1N A;  2HDM A;  1A2U A;  4K5X A;  1IBM Q;  3VA7 A;  3T56 B;  3D4W A;  2R61 A;  1CTM A;  2XWB B;  1PZK D;  3EIV A;  4HSP A;  2XWJ B;  4L6T B;  1TII D;  3M4Q A;  4BBS B;  2A74 C;  5M5W H;  4RH6 A;  4DUY L;  1YHB A;  3M3Y H;  1G51 A;  1M4V A;  4OWX B;  2WB1 B;  4JG2 A;  4WFN 3;  1BCP F;  3TBI B;  5KEE A;  3I4N B;  1FD7 D;  1SYC A;  4XDX A;  4EQP A;  3AU7 A;  1FR3 A;  2IHE A;  2WAQ E;  3HKZ G;  3CCQ A;  1LO5 D;  1VQ9 A;  2JN4 A;  2F0W A;  2KCT A;  4YCW A;  1I4H A;  3MHB A;  4WJ4 A;  1TWC H;  4GN3 B;  3E6Z X;  1I6H B;  4JI3 L;  2Q2U A;  3BJU A;  2Y0S G;  1KL9 A;  3HOY G;  2F4V Q;  1S40 A;  4BY1 B;  2TSS A;  4NXN L;  1PH2 A;  3GTM H;  3KJP A;  1JB3 A;  4DR4 Q;  4RA8 A;  4N9P A;  4I7Z C;  3A74 A;  2D5D A;  5CV8 A;  1PTO H;  2IY5 B;  3PQI A;  4JBK A;  1RF2 D;  1PHJ A;  3QOJ A;  2EQS A;  1YNN C;  2Z9H A;  4HJA A;  1PH6 A;  4LF8 L;  2CHB D;  4A3L G;  1DD2 A;  1G6Z A;  1HH2 P;  5JVH 3;  1XNR L;  2EYM A;  4U67 3;  4RMF A;  1N33 L;  3ULJ A;  2UUA Q;  3MXP A;  3S2D B;  5A2Q L;  2R7Z H;  1F2L A;  1M8A A;  1AW7 A;  2VXW A;  4B3M L;  1ILP A;  3MXU A;  4AYB G;  1RJT A;  2TMP A;  1E7Z A;  5FO7 B;  5IP7 H;  3GTO H;  3HOX B;  4JCV E;  4B9X A;  4V0B A;  1QVF A;  1UNS A;  2K75 A;  3FKI B;  3F8T A;  3A8K E;  3ZYY X;  2NVX B;  3CPF A;  2C5C A;  3HP3 A;  4NMZ A;  1D7Q A;  3S14 B;  4CDE C;  3DEP A;  5CC4 A;  3S1R B;  1WD1 A;  4EGV A;  1XX8 A;  1G91 A;  2QF7 A;  2ZTE A;  3KK7 A;  4LUO A;  1F9Q A;  4LF5 L;  1ZEQ X;  1X54 A;  2UXB Q;  3PIO 3;  4RGO S;  4HCE A;  4JI2 L;  2VS1 A;  5EJW A;  3LX0 A;  2F0U A;  1P8L A;  4X3U A;  3PCO B;  2NN6 G;  2RKS A;  3W1B A;  3PO3 B;  3W3A A;  1C48 A;  3L9A X;  4K2L A;  1WJJ A;  4AQY Q;  1MGS A;  2F03 A;  5CV6 A;  3FRP B;  2L15 A;  2B2W C;  5TSS A;  3RLN A;  1MI2 A;  4C3I B;  2OTJ A;  3C46 A;  1UE5 A;  1SYB A;  1LTT D;  3NBH A;  2WKC A;  1FL0 A;  4KKT A;  3S1Q B;  1Q8K A;  2PI2 E;  3W5O A;  2D62 A;  2WP8 J;  1S72 A;  4DK3 C;  2X69 A;  1A2T A;  2NN6 I;  2F0F A;  4PNY A;  2Q8I B;  1JWM D;  2NVT B;  2Z1C A;  1ROD A;  1X32 A;  4TQU S;  2CVR A;  1SDF A;  4QIW B;  4M1U B;  2QDL A;  4DV6 L;  3A0J A;  4QMG A;  1K8A C;  3IFD A;  1E1T A;  1VQB A;  5ELF A;  1BO0 A;  2N3S A;  1LT6 D;  3PUV A;  1HA5 A;  2MHV A;  1I94 L;  5GAD C;  3S17 H;  1N36 Q;  5CR3 A;  4JI4 Q;  3V96 A;  4R8I A;  1ICF B;  1K3B C;  2HHH L;  2K5Q A;  4KHV A;  4F7X A;  4X3S A;  1R9T B;  4A4I A;  4OWW B;  1D5X C;  1NCV A;  3ERQ A;  3GO5 A;  1BNZ A;  3GTQ B;  4KI0 A;  5KRU A;  5M3M G;  3G4S A;  4A3K B;  2PO4 A;  5C4X B;  1XPO A;  5BR8 L;  2IX1 A;  3RN5 A;  5EGT A;  3K5N A;  4MZ9 A;  2XGT A;  1Z47 A;  3KYH C;  1SE4 A;  2OQK A;  4P75 A;  3OWE B;  1Y1V B;  1EYC A;  4CDF C;  3HOV B;  3GTJ H;  1W2B A;  4JI5 Q;  1F9R A;  4A3C G;  3I73 A;  2UUB Q;  1N34 Q;  3KLS X;  1UWV A;  1K83 H;  4LWC A;  3JAM E;  2BH8 A;  5C0X I;  1L0X B;  2KCN A;  2EJM A;  4KHP L;  3J7A 5;  1GUT A;  1SXT A;  4OEL B;  1PMR A;  2DY8 A;  2KEE A;  5IYD G;  2G5D A;  2FMM A;  2F52 A;  1DYQ A;  2QEJ C;  1QUQ A;  3RZO H;  4HJ8 A;  2F0N A;  4FXG C;  5D14 A;  2EOT A;  1X6O A;  2JJQ A;  3Q0A A;  1KAB A;  1WOC A;  3EVQ A;  2CQA A;  4X3T A;  4KHZ A;  3NBH B;  1KRT A;  5LMN Q;  2A6H C;  1PH3 A;  1SYG A;  4IPC A;  1K0R A;  3DM1 A;  5CBA E;  2F0S A;  2GVB A;  3EN2 A;  1VQM A;  1TQO A;  1JOO A;  3S15 H;  1BBU A;  2SNM A;  2JEA I;  2IT1 A;  3JAM i;  1SE3 A;  2B2W A;  4GS3 A;  4O2D A;  3K59 A;  1B50 A;  1I4G A;  3BU2 A;  2K5N A;  1M1K C;  3H3V I;  3MEH A;  1C0A A;  2QW7 A;  4ZYS A;  1UE1 A;  1TWA B;  4DR1 Q;  5ELO A;  1X3F A;  3FEW X;  3HOU B;  5IYB G;  5IE8 A;  2E2I B;  1PFN A;  4X6A H;  2XSC A;  1CK1 A;  1ZXT A; 
#chains in the Genus database with same CATH homology
 4GLA C;  1MJC A;  4YWL A;  5ELN A;  3TQY A;  4A3M G;  1PH8 A;  1V43 A;  4LF6 Q;  2N8N A;  4XIG S;  1MJE A;  2WB1 G;  4BA1 I;  3IRB A;  3PIO A;  4YWM A;  4KHP Q;  2PNH A;  4JI8 Q;  5IT9 c;  3L7Z C;  4R4C A;  1KXL A;  3E9H A;  3HOY H;  4B3T L;  1WFQ A;  5LMU L;  3TRZ A;  2LSS A;  4IOA A;  4A3F H;  1YZ6 A;  4GNX C;  4YHH Q;  3I4O A;  4PMW A;  3HOX H;  2K5V A;  4JI6 L;  1VQG A;  3EBE A;  3TEH B;  1YJ9 A;  1FGU A;  2K14 A;  1X65 A;  2JA7 G;  2ZJR A;  4A3C H;  3RLF A;  4OX9 L;  5JEA G;  5HY6 A;  1HR0 L;  3PUZ A;  2PQA B;  1NMF A;  3E9I A;  1IBK L;  1HNZ L;  2GN5 A;  2AHO B;  1FJG L;  1AH9 A;  1G29 1;  3A5Z B;  3D31 A;  5J3B A;  1CUK A;  4A3L H;  3CCU A;  3GD7 A;  1Z9F A;  1L1O B;  4BY1 G;  2WB1 E;  1WYD A;  3A5U A;  1N9W A;  4JI0 L;  4LFB Q;  4IFD J;  4DAY B;  3UDI A;  1KQS A;  3OTO L;  2JA8 H;  1SE8 A;  4POG A;  5IYD H;  4DR5 L;  1TWA H;  1JE5 A;  2MFI A;  2KHI A;  2Z6K C;  4TVA B;  3U50 C;  3K7U C;  4JOI C;  3STB D;  1EQR A;  4IPG A;  4JV5 L;  3HOU H;  4K0K L;  4GOP B;  1SFO H;  2E2I H;  5C3E G;  3PUW A;  2MQH A;  2UUC Q;  3H3V H;  4BY7 G;  1N32 L;  1XTD A;  2YTY A;  4LNQ A;  2UXD L;  1SRU A;  4LF7 L;  4DV2 L;  4GKJ Q;  2E2J H;  3KDF A;  1IBK Q;  1CKN A;  4IPD A;  3KF6 B;  1V1Q A;  1K8G A;  3GTK H;  4DV5 L;  1W3S A;  2FXQ A;  3PF4 A;  3WWV A;  5GRO A;  4UP7 A;  4HJ5 A;  4RG1 A;  5JJI A;  4IJL A;  2KBN A;  3DM3 A;  4LF6 L;  1OXU A;  3K81 C;  1PH7 A;  1N33 L;  1JJC B;  4PG3 A;  3CCS A;  2JEB I;  3TS0 A;  4B3T Q;  1PFS A;  5M3F H;  1LUZ A;  3FHW A;  1JB7 A;  4BXX G;  1PH5 A;  4A3B G;  1RL2 A;  2UXC L;  3I4M H;  1A8V A;  1YHA A;  1IYJ B;  2ID0 A;  3FKI G;  1XMO L;  4DAM A;  2R7F A;  4DV7 L;  2B29 A;  1IBL L;  1VQ7 A;  3SGI A;  4LUZ A;  4YHH L;  3OYY A;  3CCV A;  3HKZ E;  4UY8 C;  5E7N A;  3H0G G;  1TXY A;  4DV4 L;  2HT1 A;  2E8G A;  2RCN A;  4JBW A;  3D0F A;  5IYB H;  2VQE Q;  1H95 A;  2LXK A;  4AIM A;  5M5X H;  4OX9 Q;  1HR0 Q;  4POF A;  1KRS A;  5LMN W;  4Y52 H;  3I7F A;  2D0O A;  1HNZ Q;  5C0X J;  3ZJY C;  1A62 A;  1WCM G;  1FJG Q;  4A3M H;  2ES2 A;  2RHS B;  2RF4 A;  5JJL A;  3AYH B;  1UEB A;  2V1C C;  2JA8 G;  2CCZ A;  2ZTD A;  2JK8 A;  3HOW H;  3KLW A;  2NVY H;  1GO3 E;  4GLV B;  4JI0 Q;  3CW2 C;  4YY3 L;  1VS0 A;  2R92 G;  2AWN A;  3PGZ A;  1U5K A;  3K7A H;  3Q8D A;  3NEN A;  4FDB A;  4A3K H;  3PF5 A;  4A3I G;  5M5Y H;  3OTO Q;  5GAH C;  3S2H H;  1D8L A;  4P72 A;  1VQC A;  3G48 A;  4LFB L;  3CCL A;  3J80 i;  4EQ5 A;  4X62 L;  3E0E A;  1A63 A;  1VQD A;  2I0Q A;  5K36 G;  3S1M H;  2Q2I A;  2ZJP A;  4UPA A;  4DR2 L;  1AE2 A;  3F1Z A;  2JA6 H;  3PSI A;  2VNU D;  2F3I A;  2JA7 H;  1EIY B;  1NE3 A;  2VY3 A;  4JI1 L;  2KEN A;  4LF7 Q;  2UUC L;  4DV2 Q;  4A3J G;  2ATW A;  4A3D G;  2BA1 A;  1X9N A;  2VUM G;  3PIP A;  3K0X A;  1SN8 A;  3GDE A;  1GKH A;  4ME3 A;  3NEL A;  4R4I A;  4X66 L;  1C9O A;  3TRE A;  3CC4 A;  4DV5 Q;  3PV0 A;  2MNA A;  4BBR G;  5IP9 G;  1LTL A;  4LW1 A;  4X64 Q;  4GKJ L;  1QZG A;  4BBS G;  1LM0 A;  2NVQ H;  2CFM A;  4PZ8 A;  1VQP A;  3CF5 A;  1SLJ A;  5JJK A;  4A3G H;  2K52 A;  2I5H A;  4NXN Q;  2Z0S A;  2JA5 G;  4L5R C;  4B3S L;  1VQN A;  3G71 A;  1B7Y B;  2JA9 A;  2F4V L;  3HOZ G;  2R93 G;  2UXC Q;  5M3M H;  2UU9 Q;  3PO2 H;  1Y1W G;  1XMO Q;  3I4N G;  2WFW A;  3LGJ A;  2R7Z G;  5IYC G;  5C3E H;  1U0L A;  4DV7 Q;  1IBL Q;  2HIX A;  4IFD G;  1CKO A;  4BY7 H;  1S3O A;  2KCM A;  1OXX K;  1Q81 C;  3KDF B;  4DPG A;  1CKN B;  2DUD A;  4DV4 Q;  4DR4 L;  3RZD H;  5IP7 G;  4DR7 Q;  4P73 A;  4JI7 Q;  2YU9 H;  3I2Z A;  2R7D A;  1C7Y A;  4JBM A;  2WAQ G;  3CP0 A;  1Q12 A;  3PUX A;  4LF8 Q;  4LFA L;  4LUV A;  2VQE L;  4LFC Q;  4LF9 Q;  1IBM Q;  2Z6K A;  4H02 A;  2C35 B;  4Y7N H;  4JOI A;  3J80 c;  1HJP A;  1YVC A;  1XPU A;  1TWF H;  1XNR Q;  1KD1 C;  1GVP A;  3RR5 A;  3EIV A;  1UE6 A;  4YY3 Q;  1N33 Q;  2N49 A;  3JC6 6;  2E5L Q;  1VQF A;  1PV4 A;  2AWO A;  3T1Y L;  3M4Q A;  1I5F A;  5M5W H;  2K50 A;  2D0P A;  4DV0 L;  4IFD I;  4DUY L;  1K9M C;  1YHB A;  3M3Y H;  1QUQ B;  1PYB A;  1G51 A;  1VQE A;  4OWX B;  1Y1V G;  2CWA A;  2IX0 A;  4X62 Q;  3CPW A;  5IWA Q;  1Q1E A;  1OXT A;  3BZC A;  4JG2 A;  4DR3 Q;  4A93 G;  4R1J A;  1CKM A;  1SMX A;  4DR2 Q;  3H0G H;  3KFU A;  1AE3 A;  1T9H A;  3AQQ A;  2R6G A;  1VQ4 A;  3TS2 A;  3U4Z A;  1XMQ L;  4JI1 Q;  1VQ5 A;  2IHE A;  1X56 A;  2WAQ E;  3M4O H;  4B3R L;  3HKZ G;  3UE0 A;  3CCQ A;  2VZA A;  3J7Z C;  1NBW A;  1VQ9 A;  3CQZ H;  2CWP A;  4X66 Q;  1X3E A;  5C44 H;  3J81 j;  4DV1 L;  1Y14 B;  2I5M X;  3AFP A;  2KCT A;  4YCW A;  1OXV A;  4X65 Q;  1TWC H;  4GN3 B;  4WJ4 A;  3KOJ A;  2R92 H;  4DK6 C;  4HJ7 A;  4GKK Q;  3G6E A;  2GVA A;  1B8A A;  4X64 L;  1XNQ L;  4JI3 L;  2Q2U A;  3BJU A;  2Y0S G;  4JI2 Q;  5C0X G;  1KL9 A;  2A8V A;  4B3S Q;  4ALP A;  3HOY G;  2F4V Q;  4R4T A;  5FJ8 H;  2NZO A;  4A3F G;  1PA6 A;  2UXB L;  1S40 A;  4NXN L;  3HOX G;  1PH2 A;  3GTM H;  3S16 H;  4IPH A;  1QVG A;  1GD7 A;  3KJP A;  2YV5 A;  4JC0 A;  1VQ8 A;  2VW9 A;  2UU9 L;  3S1N H;  1VQJ A;  2PI2 A;  4P71 A;  3UE1 A;  4DR4 Q;  4WJ3 M;  3A74 A;  4AQY L;  4MNO A;  2Q2H A;  4GNX B;  2IY5 B;  2N78 A;  4LFA Q;  4JBK A;  1EIF A;  3U58 A;  2K4K A;  4DR7 L;  4JI7 L;  4NB3 A;  1PHJ A;  1YIJ A;  1NTG A;  2KHJ A;  2XTI A;  1PYS B;  2EQS A;  4GN4 B;  4UP9 A;  5IP9 H;  5C4J H;  3M85 A;  3CCM A;  4LFC L;  1NMG A;  4HJA A;  1PH6 A;  4LF8 L;  1BKB A;  4LF9 L;  2B63 G;  1IBM L;  4A3L G;  2HIV A;  1HH2 P;  1X3G A;  4GLX A;  1A0I A;  1XNR L;  2Y0S E;  2A1A A;  4C2M H;  3GTP H;  3T1Y Q;  1SR3 A;  4QL5 A;  5GQO A;  3HOZ H;  3ERS X;  4RMF A;  3U4V A;  5GAE C;  3ULJ A;  2VQF L;  4DUY Q;  4DV0 Q;  2E5L L;  4GN5 A;  2UUA Q;  1Y1W H;  3MEF A;  3F2D A;  2R7Z H;  3I4N H;  3VDY A;  3PO3 G;  1TWG H;  3F2C A;  4B3M L;  1BVS A;  3NEM A;  1QVC A;  2A19 A;  4AYB G;  3HOU G;  2ALY B;  4APV A;  1E7Z A;  4DR3 L;  5IP7 H;  3STB C;  5IWA L;  3H15 A;  4DUZ Q;  3GTO H;  4JCV E;  4IOC A;  3F2B A;  1XMQ Q;  1QVF A;  1I94 Q;  1CSP A;  4B3R Q;  4C3J H;  2YTV A;  2K75 A;  3K8A A;  3F8T A;  1KC8 C;  1YHQ A;  1L2F A;  5FLM G;  1Q7Y C;  1SRO A;  1L1O C;  3CPF A;  1EWI A;  1D7Q A;  4DV1 Q;  1XPR A;  4DR6 L;  1VQL A;  4JI4 L;  1X55 A;  1O7I A;  3L0O A;  3AEV A;  2DGY A;  2ZTE A;  4LUO A;  4BY1 H;  4LF4 Q;  1XNQ Q;  3KJO A;  4JI3 Q;  1BBW A;  2RHQ B;  4X65 L;  4LF5 L;  4J15 A;  4PZ7 A;  3CCE A;  1X54 A;  4GOP C;  1E1O A;  4GKK L;  5DLQ E;  1B70 B;  2UXB Q;  4O0A A;  5BR8 Q;  4A93 H;  1HZ9 A;  4JI2 L;  2VS1 A;  3I4M G;  1V9P A;  1P8L A;  2CQO A;  4AYB E;  4DNI A;  3PCO B;  1XJV A;  2NN6 G;  3W1B A;  3J81 i;  1YBY A;  3CME A;  1CSQ A;  1I50 H;  1WJJ A;  4AQY Q;  2ZTC A;  3OW2 A;  3ULL A;  1YIT A;  2BA0 A;  2I5L X;  3MXN B;  1WI5 A;  2L15 A;  3UDF A;  2E2H H;  3RLN A;  4AH6 A;  3CCJ A;  1HNW L;  1VQA A;  4OON A;  4JYA L;  3BZK A;  1OTC A;  4JI5 L;  4NXM L;  1VQ6 A;  1Q86 C;  4DKA C;  1HNX L;  2UUB L;  2OTJ A;  1UE5 A;  4P74 A;  1OXS C;  1N34 L;  3HOW G;  1FL0 A;  2EXD A;  3S2D H;  2ZM6 Q;  1Q8K A;  1ASY A;  2PI2 E;  1VQH A;  3W5O A;  3I55 A;  4HIM A;  3T1H Q;  1YI2 A;  2Q2T A;  2D62 A;  2WP8 J;  1S72 A;  1EUJ A;  4DK3 C;  4A3K G;  3CCR A;  2VQF Q;  4QIW E;  2OTL A;  5C4X G;  2NN6 I;  1HZC A;  2VL6 A;  4A76 A;  4UP8 A;  4XTC S;  2YTX A;  1J5E L;  4B3M Q;  4TQU S;  4BXX H;  4A3B H;  3ULP A;  2H5X A;  5FLX c;  4QGU A;  2UUA L;  3FKI H;  4OO1 G;  3B6Y A;  1VQI A;  4R4Q A;  3S24 A;  1NJI C;  2NZH A;  2NVX H;  2AKW B;  3HOV G;  1IL2 A;  4DV6 L;  2JA6 G;  3A0J A;  3JAM c;  1PH4 A;  1K8A C;  2JQO A;  1E1T A;  3S14 H;  1VQB A;  1HZA A;  3CAM A;  4QY7 A;  2YYZ A;  4HID A;  4HIK A;  3ER0 A;  1YNX A;  2N3S A;  4DUZ L;  3PUV A;  3S1R H;  4C3H H;  1I94 L;  5GAD C;  3UDG A;  1ASZ A;  3S17 H;  4L5Q A;  5LMN L;  1N36 Q;  4DR6 Q;  3HKS A;  4JI4 Q;  1WCM H;  2B63 H;  1YJW A;  3ICE A;  1KHI A;  4BA2 I;  4HJ9 A;  2JE6 I;  4JBJ A;  3J81 c;  2BH2 A;  1MIU A;  3KF8 B;  5EAY A;  1IXR A;  2HHH L;  3M7N A;  1M90 C;  1J6Q A;  1VCI A;  1YEZ A;  4LF5 Q;  2EIF A;  4A4I A;  1JMC A;  4OWW B;  4A3G G;  1JT8 A;  3GO5 A;  3CC2 A;  4A3I H;  1Q82 C;  3PO3 H;  4OO1 I;  4LF4 L;  3RNU A;  4KI0 A;  3M9B A;  4IJH A;  5M3M G;  3G4S A;  4R4O A;  3GTG H;  3PO2 G;  3CXC A;  2LXJ A;  1XPO A;  5BR8 L;  5JEA J;  4OWT B;  2IX1 A;  3I56 A;  3RN5 A;  2IHF A;  4MZ9 A;  2XGT A;  4DV3 L;  4L5S A;  1Z47 A;  4C3I H;  4DR1 L;  3KYH C;  1HZB A;  2OQK A;  4P75 A;  1N8R C;  5FLM H;  4HIO A;  1HNW Q;  4JYA Q;  3FP9 A;  4A75 A;  4MTN A;  3GTJ H;  4A3J H;  1W2B A;  4JI5 Q;  4NXM Q;  3S1Q H;  4A3D H;  1Q1B A;  1HNX Q;  2VUM H;  1GM5 A;  2UUB Q;  4YWK A;  4A3C G;  1FVI A;  1HR0 W;  3L2P A;  5AJ3 L;  1N34 Q;  1UE7 A;  4BBR H;  1UWV A;  1K83 H;  4LWC A;  1E22 A;  2BH8 A;  4NPS A;  5C0X I;  2PQA A;  3W1G A;  2NVT H;  4BBS H;  1PH1 A;  4QQB X;  3PUY A;  5LMU Q;  1LYL A;  1VQO A;  1EFW A;  1QZH A;  2ZM6 L;  2PMZ E;  1EOV A;  3J7A 5;  4KHP L;  3T1H L;  4JI8 L;  4L5T A;  3RN2 A;  4JI6 Q;  1J5E Q;  1YJN A;  4EX5 A;  2JA5 H;  1L1O A;  2R93 H;  1G6P A;  5IYD G;  2OCE A;  1EYG A;  3UDX A;  2F52 A;  4A3E G;  5IYC H;  1QUQ A;  3RZO H;  5H1S E;  4HJ8 A;  1KAW A;  2QA4 A;  4DV6 Q;  1NY4 A;  1X6O A;  4QJF A;  2AMC B;  2JJQ A;  3DLL A;  1E24 A;  1WOC A;  4A3E H;  3CD6 A;  3CMA A;  1PVO A;  1K73 C;  4GOP A;  4KHZ A;  3NBH B;  4YCU A;  3AFQ A;  1KRT A;  5LMN Q;  1R9T H;  3M4P A;  1PH3 A;  4IPC A;  1K0R A;  5C44 G;  2QEX A;  1I6H H;  4YCV A;  2GVB A;  1EQQ A;  3EN2 A;  3GTQ H;  1VQM A;  1RIP A;  2HHH Q;  1N36 L;  2OQ0 A;  3S15 H;  1BBU A;  1PH9 A;  1KIX A;  2JEA I;  3KF6 A;  2IT1 A;  1MKH A;  1K3R A;  1P16 A;  3RLO A;  1JJ2 A;  5C4X H;  3JAM i;  4DR5 Q;  1VQK A;  2ZJQ A;  5HGQ A;  1L0W A;  2B3G A;  4KLK A;  4GS3 A;  5FJ8 G;  2MO1 A;  4JV5 Q;  4O2D A;  4K0K Q;  2ASB A;  1Q46 A;  1Y1V H;  3BU2 A;  5M3F G;  2K5N A;  4OXP A;  1M1K C;  3H3V I;  3HOV H;  1TWH H;  2K5H A;  2QGQ A;  1N32 Q;  4DV3 Q;  1C0A A;  1IZ6 A;  4DR1 Q;  1UE1 A;  1I3Q H;  2HQL A;  5IY0 A;  2UXD Q;  1JJG A;  1DGS A;  5ELO A;  2MO0 A;  2OWO A;  4IO9 A;  3GTL H;  1X3F A;  3K80 C;  5IYB G;  5GAG C;  5IE8 A;  4GNX A;  1E3P A;  3HFZ B;  4X6A H;  4PZ6 A;  2CKZ B;  5AJ3 Q;  3CC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...