4OXPA

X-ray crystal structure of the s1 and 5'-sensor domains of rnase e from caulobacter crescentus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
235
structure length
200
Chain Sequence
KQLRGNIYLAKVTRVEPSLQAAFIEYGGNRHGFLAFNEIHPDYYQIPVADREALMRDDDVEEELARRKRRLMRKYKIQEVIRRRQIMLVQVVKEERGNKGAVLTTYLSLAGRYGVLMPNTARGGGISRKITAVTDRKRLKSVVQSLDVPQGMGLIVRTAGAKRTKAEIKRDYEYLLRLWENIRENTLHSIAPALIYEEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition of RhlB and RNase D in the Caulobacter crescentus RNA degradosome.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Hydrolase
molecule keywords Ribonuclease E
total genus 55
structure length 200
sequence length 235
ec nomenclature ec 3.1.26.12: Ribonuclease E.
pdb deposition date 2014-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oxpA01
2D62A 4YHHL 2ZJPA 4QQBX 1K83H 1SLJA 3I7FA 4OONA 4YY3L 1S72A 1L1OB 3KFUA 3AFPA 2A8VA 1VQPA 2XGTA 1RL2A 1UE7A 1IBML 2GVBA 1J6QA 4HJ5A 3JAMc 3PSIA 4DR4Q 3BJUA 2E8GA 5C3EG 1X6OA 1QZHA 1PYSB 1NTGA 2I5HA 3RN2A 3PO2G 4A3MH 1L2FA 3G48A 4O0AA 3F2DA 4A3IG 3CP0A 3AQQA 4A3MG 1SFOH 4JBKA 1GKHA 2R7ZG 1I6HH 1CKNA 2MO1A 4LF5Q 4JI1Q 5GAEC 4A76A 4GLVB 1OXSC 5E7NA 4H02A 1TWGH 4JI2Q 3PIOA 3M85A 4GNXC 1Q82C 3I55A 4B3TQ 1VQJA 4JI1L 1KRSA 1A8VA 4DR3Q 4A93G 1M1KC 1X54A 2IX1A 2WP8J 3OW2A 1Y1WH 2HT1A 3DLLA 4GKJL 1Y1VG 1U5KA 2KCMA 1FL0A 4JI3Q 4OWWB 3K0XA 4JOIC 1Q8KA 2AWNA 1VQDA 4NB3A 3PUZA 5IT9c 3KLWA 2ATWA 2R92G 4HIMA 2R92H 4LFBL 2AHOB 4AQYL 1S40A 1HNZL 1W3SA 4JCVE 1LM0A 1P16A 2N8NA 5IYBH 3KJOA 4DV3L 4LFBQ 1VQFA 3W1GA 2F3IA 1G6PA 3JC66 1MKHA 1BBUA 2R7FA 3D31A 3NBHB 3PUVA 5IE8A 1PHJA 3K80C 4JI7L 4DV4L 2NVYH 1OXUA 4RG1A 4LFCQ 2AKWB 4OWXB 5IWAL 2HQLA 1VQ8A 4A3IH 2KCTA 2ES2A 3GTPH 1X56A 3PUWA 4APVA 1V9PA 5C4JH 4BBRH 1JE5A 1P8LA 3UE1A 4DNIA 4HIDA 1VQMA 2CFMA 2Z6KA 4LF6Q 5HGQA 4A3JH 4POFA 3K7AH 3PUYA 1PH5A 4LFAL 3BZCA 3ULJA 4BY7G 4BY7H 1UE6A 3ULLA 1Z47A 1NY4A 1X9NA 1QVGA 2UXDQ 1C9OA 2N78A 3UDGA 4NXML 2F4VL 3S16H 4OWTB 4J15A 3I4NG 2NZOA 4LF7L 4HJAA 3PCOB 2F4VQ 4WJ4A 3KJPA 1KL9A 3GTOH 4B3TL 4JI2L 4GNXB 4A3KH 4DV0Q 4IPCA 2ZJRA 2I0QA 4FDBA 4LUOA 1TWFH 2L15A 1PH6A 5IYBG 3M4OH 2YV5A 4LW1A 2PMZE 1CSPA 1PA6A 4DV2Q 2HIVA 4DUZQ 1C7YA 4JYAQ 1NMGA 1YZ6A 2H5XA 1VQAA 1BKBA 1XTDA 2UUBL 5C3EH 4P74A 1TWCH 5DLQE 2QGQA 3I56A 2JA6G 3CC4A 1EYGA 4GN4B 4IPGA 3KF8B 3VDYA 2NVQH 4GOPA 4JI5L 2CQOA 3A5ZB 4A93H 3CQZH 4O2DA 5LMNW 5GADC 2Y0SG 5AJ3Q 1MIUA 4JI5Q 4GS3A 4OXPA 4A4IA 5FJ8G 3T1YQ 3U50C 1CKMA 5JJKA 4DR2L 3TEHB 2MFIA 3DM3A 2K75A 5IP9H 2VY3A 1TXYA 4X66L 1H95A 1VCIA 3L7ZC 3CF5A 2VW9A 4NXMQ 1Q1EA 3UDFA 2BA1A 4LF7Q 1LTLA 4DK6C 1IBKL 4LF4L 2NZHA 2XTIA 3GO5A 3U4VA 4LFAQ 3HOZH 4KI0A 1XMOL 3TQYA 1WI5A 4LF4Q 2MQHA 4EQ5A 3GTMH 2UXDL 4IOCA 3TRZA 5C0XJ 1JJCB 2Z0SA 2ZTCA 1N34L 4LWCA 1FGUA 2YTVA 5M3FH 2VS1A 4DR7L 1RIPA 2JJQA 3K7UC 1R9TH 4QY7A 1VQIA 1V43A 2MNAA 4DV2L 2JA8G 1PH1A 3FKIH 2JA9A 3HOWG 4JBWA 2E2HH 3PUXA 4B3MQ 1ASZA 5IP7G 1WCMH 2OCEA 5FJ8H 3W1BA 5FLXc 1HNXQ 1ASYA 1VQHA 4KHPQ 3BZKA 1EQRA 1HJPA 1AE2A 3CC7A 1MJCA 1AH9A 2ALYB 4AH6A 3CCMA 4KHPL 4BY1H 1VS0A 1HZ9A 4A3LH 3F8TA 3M9BA 3RR5A 4DAYB 3I4OA 3T1HQ 3PF5A 1PH8A 2BA0A 1T9HA 4A3DG 2UUCQ 5JEAJ 3CC2A 1G291 3G71A 1KD1C 3BU2A 5IYDH 3CD6A 3E9HA 2KBNA 3FP9A 1JJ2A 2IX0A 3STBD 4DKAC 1IBLQ 3A5UA 1HH2P 2WFWA 2WB1E 4GKKQ 1QVCA 5M3FG 2AWOA 2CWAA 2B63G 2OQ0A 4NXNQ 4LUZA 1YHBA 3S14H 3L0OA 2ZM6L 2JA7H 5BR8L 5C4XG 4B3SQ 1NBWA 4BBSH 3SGIA 3WWVA 4DR5L 3OYYA 3HOYG 2CKZB 4KLKA 1VQOA 1K0RA 3HOVH 1XJVA 3M7NA 4HJ7A 1PFSA 2NVTH 3TS2A 3IRBA 4XIGS 3JAMi 4MZ9A 3E9IA 3CCVA 4HIKA 4K0KL 4DUYQ 1LUZA 4A3DH 4DUZL 2NN6I 1VQKA 1FVIA 2IT1A 4A3GH 1XNRL 4JYAL 1N36Q 1HNXL 4R4OA 3CCJA 1S3OA 1K73C 1WJJA 2WAQE 1HR0W 4X65L 4YCVA 5ELNA 3F2CA 2QEXA 1I5FA 1OXTA 1VQLA 1IYJB 3I2ZA 2D0OA 2K4KA 2R7ZH 4P73A 3RZDH 2HIXA 1N32L 2ZJQA 1PYBA 1NMFA 5AJ3L 2HHHQ 4JV5Q 2UXBL 2R7DA 4LF9Q 3CMAA 1M90C 3EIVA 1SE8A 1EOVA 3ER0A 4A3BH 2UXCL 1WOCA 3RN5A 1Q1BA 2BH8A 1K3RA 1QUQB 4OX9Q 1XNQQ 3F2BA 4GOPC 2JEAI 4JI0Q 1EWIA 4IFDJ 4NXNL 4L5TA 2VQEQ 1YJWA 1K8GA 1I94Q 4X64Q 4AQYQ 1X3EA 2NN6G 2VQEL 1VQGA 1PH7A 4DR5Q 4A3GG 1D8LA 2Q2TA 1UE5A 3GTGH 4YCUA 1IXRA 3S1MH 2FXQA 3AYHB 3LGJA 3PV0A 3J80c 4DV4Q 1HNZQ 2VQFL 3EBEA 3RZOH 4JI6L 2PQAB 3HOUG 3M4QA 1OXXK 1YJ9A 1JJGA 2LXJA 4LF6L 1O7IA 3J7ZC 4JI7Q 2BH2A 5C44H 3CAMA 4A3EG 5C44G 1JMCA 1N33Q 4BA2I 2JA7G 1KIXA 4TVAB 4PG3A 4LF8L 1XPUA 4X65Q 4IOAA 1KQSA 1HZAA 4A3BG 3CCQA 1L0WA 5LMUL 1SMXA 4A3JG 4POGA 3RNUA 4YY3Q 4DAMA 4P75A 1UEBA 3NELA 4A75A 4UP9A 2YTXA 4X62Q 5ELOA 4EX5A 3CCSA 4JG2A 5K36G 4UPAA 1B70B 1QZGA 3ULPA 2AMCB 5GAGC 1HNWQ 1TWAH 2EQSA 4JC0A 2HHHL 4JV5L 4A3LG 4DR7Q 1A0IA 1YVCA 1GM5A 4MNOA 3HOXH 4GKKL 1PH2A 2GN5A 4HJ9A 1GVPA 3A74A 3CPFA 4GLXA 2JA6H 4C3HH 5IYDG 2CWPA 2UXCQ 3RLFA 4DV1Q 4DV7L 2NVXH 4OX9L 4B3RL 2C35B 4GNXA 3J7A5 4YWLA 2UU9Q 3AFQA 1XPRA 3PO3G 2B29A 4JI3L 5LMNQ 3H3VH 4WJ3M 4PZ7A 3FKIG 4C3JH 1EIFA 1HZBA 1SN8A 4R1JA 4JI8Q 4BBRG 1YJNA 2OTLA 1PH3A 2PI2E 4P71A 2Z6KC 3KF6A 1VQ4A 1E7ZA 4DV3Q 1JB7A 4BA1I 3KOJA 4DUYL 4A3KG 1QVFA 4Y52H 3HKSA 2KHJA 5M5WH 2JE6I 4MTNA 3J80i 2Q2IA 4BXXH 4QJFA 1EIYB 2B3GA 1BVSA 2Y0SE 1HR0Q 2YTYA 4X66Q 1AE3A 2F52A 3K8AA 4QIWE 2ZTDA 1YBYA 2RCNA 2RHQB 1WYDA 2JA5G 5LMUQ 1SRUA 2UXBQ 2Q2HA 3GD7A 1YNXA 5IY0A 3OTOL 2MO0A 1VQBA 5M5YH 5JJLA 1SROA 4B3ML 4A3EH 1N34Q 3AEVA 1XNQL 1YITA 3STBC 2IHEA 4DV0L 1A63A 1Y14B 3S1QH 3S2DH 3NEMA 4UP8A 1XPOA 1MJEA 1OXVA 4AYBE 4UP7A 2WAQG 1XNRQ 2DUDA 1K9MC 1X65A 1EFWA 1G51A 5IP7H 4GKJQ 5IYCG 4QGUA 1IL2A 5M5XH 4A3CH 4IJHA 3J81j 1D7QA 1SR3A 2K5VA 5M3MH 4LUVA 1YI2A 5LMNL 3S15H 4Y7NH 5GAHC 3T1HL 2UUAQ 3S1NH 4JI8L 2YYZA 4YWMA 1Q46A 2JEBI 3HOUH 1UWVA 3I4MG 4RMFA 1J5EQ 1JT8A 1YHAA 2IY5B 3T1YL 2OQKA 3GTQH 4LFCL 4LF8Q 3GTLH 4DV6Q 5IWAQ 3KYHC 4DK3C 1A62A 1IBMQ 2PNHA 1IBKQ 4JBJA 1YEZA 4DV6L 1NE3A 1N9WA 3CCUA 3HOYH 3RLNA 4KHZA 1HR0L 1KRTA 2JK8A 4PZ8A 2EIFA 1PH4A 2CCZA 5JJIA 1WCMG 4GN3B 1E22A 4IPHA 4C2MH 2OWOA 4X6AH 3RLOA 1VQ7A 1B7YB 4DR6Q 5IYCH 2K5NA 2VL6A 4OO1I 1VQCA 4DR3L 2N3SA 3GDEA 4LNQA 2KHIA 4IPDA 5M3MG 4YWKA 1CSQA 4L5SA 2K52A 1W2BA 4R4TA 2IHFA 2JA8H 4DR1L 2JQOA 3CMEA 4XTCS 3I4MH 3KDFA 4UY8C 4YHHQ 1FJGL 2DGYA 2K14A 1PV4A 3B6YA 1V1QA 2VZAA 3CCRA 3ICEA 4DV5L 1E1OA 2UUCL 2K50A 2KENA 3H0GG 4L5QA 3Q8DA 1WFQA 1NJIC 3M3YH 5HY6A 1PVOA 3PF4A 4JI4Q 4JOIA 4LF5L 2E2IH 3L2PA 4HJ8A 4LF9L 3CCLA 3FHWA 3S1RH 1Q86C 2UUAL 4PZ6A 1I3QH 3U58A 4JI4L 1HNWL 5FLMG 2ZTEA 5IP9G 1CKOA 4BY1G 2ID0A 2RHSB 2A19A 3EN2A 3PGZA 1E1TA 4IO9A 2I5LX 1Q12A 4OO1G 2ZM6Q 1DGSA 3K81C 1L1OC 3G4SA 2N49A 4GN5A 4B3SL 4JI0L 3H15A 2ASBA 4NPSA 1E3PA 1X3GA 2YU9H 1I50H 3HOXG 4B3RQ 5GQOA 3UE0A 1XMOQ 1I94L 3KF6B 4AYBG 1B8AA 3G6EA 4R4QA 3S2HH 4A3FG 2PI2A 3CXCA 5C0XG 4A3FH 1YHQA 4JI6Q 3W5OA 4JBMA 2JA5H 4DR6L 2E5LQ 1BBWA 2K5HA 2R6GA 5EAYA 4K0KQ 1GD7A 2VQFQ 5J3BA 3S24A 1N33L 1OTCA 2E5LL 1Z9FA 3HFZB 3PO2H 1CUKA 3CCEA 2D0PA 3H0GH 5GROA 3GTJH 4HIOA 1K8AC 4BBSG 3PIPA 2QA4A 2EXDA 4QL5A 1XMQL 1N8RC 1FJGQ 1X3FA 4DR4L 1L1OA 2RF4A 3UDXA 2Q2UA 3TS0A 4IFDI 4ALPA 3A0JA 2A1AA 3J81i 1Y1VH 4IJLA 3I4NH 1VQEA 1X55A 3HKZG 1EQQA 3HOZG 1CKNB 3MXNB 3KDFB 1U0LA 3D0FA 2R93G 4A3CG 1E24A 3J81c 1Q7YC 5JEAG 3HOVG 4AIMA 4L5RC 4BXXG 2VNUD 4DV5Q 4X62L 1N32Q 2E2JH 1HZCA 3OTOQ 1KAWA 2GVAA 4GLAC 4C3IH 5C0XI 1J5EL 4DPGA 4GOPB 1VQ6A 2V1CC 4P72A 4PMWA 4DR2Q 4YCWA 1QUQA 4X64L 2B63H 2UU9L 1PH9A 3U4ZA 1VQ9A 3H3VI 5BR8Q 3M4PA 3TREA 1IBLL 3MEFA 3E0EA 5C4XH 2UUBQ 1KHIA 1VQNA 2WB1G 4DV1L 4DV7Q 3ZJYC 3S17H 4R4IA 2LXKA 1LYLA 3PO3H 2LSSA 3HOWH 2VUMH 1TWHH 1UE1A 2VUMG 4IFDG 2I5MX 3GTKH 3F1ZA 4TQUS 5FLMH 3CW2C 3UDIA 1GO3E 3NENA 2PQAA 3CPWA 1Y1WG 5H1SE 1EUJA 1YIJA 1KC8C 4ME3A 1KXLA 2R93H 3HKZE 3ERSX 1N36L 1Q81C 1XMQQ 1IZ6A 4DR1Q 1VQ5A 4R4CA 2OTJA 1C0AA
chains in the Genus database with same CATH superfamily
2ZJPA 4YY3L 1KLUD 1L1OB 2A8VA 1IBML 5JPNC 4HJ5A 4IQZA 2E8GA 1QZHA 4RHSA 5IGFA 4K5XA 1CKNA 3HZXA 4JI1Q 2HDLA 1U4MA 1Q82C 1TWGH 3JAML 1IYVA 1PXUA 4TRDA 1WD1A 4JI1L 1KRSA 1A8VA 3E3XA 4A93G 2JA5B 3OWEB 1I4QA 3DLLA 1U5KA 2FINB 4OWWB 4WRDA 2ZXRA 4HSPA 4NB3A 4LFBL 4HN7A 3K5NA 1SYBA 1LM0A 4JCVE 5IYBH 3KJOA 3W1GA 4ULLA 2WACA 2A6HD 1BBUA 5IE8A 2K6AA 2F0FA 2F0WA 1OXUA 2AKWB 5ELFA 1KNAA 1VQ8A 3BDCA 4A3IH 1EWHA 2ES2A 1ZXTA 1V9PA 1VQMA 2R93B 3UE1A 4DNIA 1WTOA 4LF6Q 1NCVA 2EYPA 5IT9L 4C2MB 5EPLA 3PUYA 1PH5A 4BY7H 1UE6A 4KV6A 1NY4A 1X9NA 3UDGA 4F7XA 4LF7L 1MBYA 2F4VQ 4WJ4A 4JI2L 4CDFC 4IPCA 2I0QA 1F2MA 3HOWB 3L3OC 5K36H 3QIAA 2PMZE 3K6OA 4JYAQ 2F0PA 2UUBL 1SYCA 2WIIB 1TWCH 5DLQE 2JA6G 3CC4A 2SNSA 4CJ0B 2CQOA 3CQZH 1ESFA 1MIUA 4GS3A 2KOLA 1UUPA 4A4IA 2E2DC 1CKMA 3NBHA 1T5EA 4DR2L 3TEHB 2VW9A 4DK6C 3GO5A 3U4VA 1G2SA 1QB5D 2MQHA 5ELEA 3TRZA 2Z0SA 2O4XA 2PCFB 1N34L 4LWCA 3A8KE 1DCZA 5K5PA 2VS1A 4DR7L 1RIPA 2RDHA 2F0NA 4DV2L 4R8IA 3M4OB 1PH1A 2EVBA 2JA9A 3HOWG 4L8JA 4B3MQ 3PUXA 1SEBD 5FO8B 1ASZA 2WKDA 1QILA 1F77A 2OCEA 2H1EA 3R8BA 1HNXQ 1VQHA 1EQRA 1X3PA 3G6JB 5KRUA 3CC7A 5JEAH 3KBXA 5HURA 1D1IA 3M9BA 3T1HQ 4DAYB 3I4OA 1PH8A 1QCBD 3T4AC 4GZYC 3NSWA 2PPBC 3K7AB 4C3IG 4ME5A 3BU2A 4ZRZA 3E9HA 3FP9A 2B2VC 1JJ2A 4DKAC 1I50B 1HH2P 3CRLC 4GKKQ 3S2HB 3TBIB 2CWAA 2B63G 2OQ0A 1Q8IA 3E0JA 1PYWD 1STGA 2K5QA 5CGKA 3GTMB 5C4XG 2BDOA 1H9SA 3P20A 2F0MA 2B2UC 3HOYG 1VQOA 1XJVA 3M7NA 4HJ7A 2A69C 5BN5A 3TS2A 3JAMi 5DEHA 4MZ9A 3E9IA 4HIKA 1FVIA 3MC0B 5J39A 4R4OA 4C3JB 4LAAA 1TS4A 2EYFA 1STHA 5BN3A 1K73C 1NSNS 4DXGA 3GV6A 3MXGA 4X65L 3I2ZA 2K4KA 1PYBA 1NMFA 1SE2A 4F88A 1CA6A 1SE8A 4A3BH 1NNXA 4AYBB 3L9AX 3RN5A 2JEAI 4JI0Q 4HCEA 2MUYA 4XT1B 2VQEQ 1YJWA 2M9VA 3N52A 4AQYQ 1VQGA 2WV6D 4DR5Q 3BZDB 3U9SA 2FXQA 3LGJA 3PV0A 4MIUA 2DNEA 4IUQA 4NW2A 4LF6L 3J7ZC 3O13A 3HOZB 1XYIA 1W6KA 1RTOA 2Z1CA 3CAMA 3SR1A 4BA2I 2JA7G 1EEID 1D2BA 1DOMA 2G5DA 3TMEA 3N6RA 2K5WA 4DK1A 2R61A 1KQSA 2RVLA 1B3AA 1SMXA 3DWAA 1E2VA 4EGVA 4DAMA 3HRZC 1JOQA 4A75A 4DAPA 4G57A 4UP9A 4X62Q 1JWMD 5T1GA 2HQEA 4JG2A 2Z4HA 1K3BC 1SE4A 4UPAA 1JORA 1B70B 3OMCA 1QZGA 2RSOA 1TWAH 4JV5L 4A3LG 1YVCA 4FVMA 3EQLC 3HOXH 4GKKL 1GVPA 3A74A 3GV3A 4DV1Q 4DV7L 2C35B 1EYDA 4YWLA 2DJGC 1XPRA 1Y8OB 4C3JH 1HZBA 1U4LA 4JI8Q 4BBRG 4KY7A 1PRTB 3J80L 1E7ZA 4DV3Q 1JB7A 2K04A 1QVFA 4Y52H 3NXWA 4OEMB 4ABNA 2KHJA 3DEOA 5C44B 5M5WH 2EXZA 3J80i 2Q2IA 2EY6A 2Y0SB 4BXXH 4ILWA 2B3GA 1BVSA 1HR0Q 1GOZA 1RF2D 4KMUC 2RHQB 1WYDA 5LMUQ 2UXBQ 2Q8RE 1YNXA 1SNDA 5IY0A 3OTOL 4ZKCB 2KA7A 2EY1A 4ZLTF 3AEVA 2PZWA 1HXYD 2WKCA 3MXUA 5I6YA 1GUWA 3ND8A 3QOLA 1A63A 1AN8A 1Y14B 3FPPA 1EY7A 2IWHA 4DAVA 4UP8A 5J1ZA 5EPJA 4UP7A 2WAQG 2A6HC 1TS5A 4K2LA 1DOLA 5CC4A 1G91A 5M3MH 2VUMB 4LUVA 1EY5A 5LMNL 1VF5C 3S15H 2UUAQ 3T1HL 2HCCA 2YYZA 3IFTA 1B3QA 2AUKA 4IALA 2L4NA 4K5VA 3I4MG 4RMFA 5IGBA 2EY2A 1CHPD 5DM73 4M8AA 3GP7A 1STEA 5IWAQ 3KYHC 4DK3C 1UEAB 1IBMQ 1IBKQ 1SE3A 3M4YA 1N9WA 1K83B 3NPPA 4A3IB 4PZ8A 2CCZA 3GTQB 5JVG3 1VQ7A 2XWJB 4DR6Q 1VQCA 4OO1H 5C4XB 5F2DA 4YWKA 2K52A 3T56B 3CMEA 4DR1L 4QUCA 4YHHQ 1FJGL 3CCRA 4DV5L 2RBMA 3BDOA 3SE0A 4L5QA 2KENA 5M5XB 1SYFA 1NJIC 4LF5L 5FOBB 1LT4D 3MAQA 4H13C 4PZ6A 1I3QH 3U58A 2L11A 3A7LA 1M8AA 2ID0A 2RHSB 4Z9CB 2A19A 3PGZA 4CBVA 1DGSA 4DNRB 3G4SA 4B3SL 3NWTA 3H15A 1WVLA 1QOHA 2YU9H 1I50H 1FGBD 2EZVA 4AYBG 1B8AA 4O1NA 4A3FG 3CXCA 4NMZA 5C0XG 1YHQA 4JI6Q 5M9OA 4FP5D 1ZKOA 4Q0FA 2KHSA 2O5JC 2MGSA 2VQFQ 3S24A 2VXWA 2E5LL 2EPBA 4CDEC 3VR4A 3CCEA 5JJZA 2D0PA 1ET9A 3H0GH 1HCZA 3GTJH 4HIOA 2AUJD 4QL5A 4IUUA 4P2CB 2RKSA 3C46A 1DONA 5DNFA 3A0JA 5I9PA 3J81i 3I4NH 3HOZG 2BE5D 1NR2A 2EYHA 3KDFB 1ENFA 3D0FA 2R93G 4RGMA 1Q7YC 2LFNA 5JEAG 4L5RC 2VNUD 2PW5A 1K8OA 1HZCA 1JOOA 1GUNA 1LTSD 1J5EL 1HRJA 4YCWA 2F0KA 3K58A 2B63H 2Z8LA 3IFDA 1SNCA 3H3VI 1IBLL 3TREA 3MEFA 5C4XH 1KHIA 1A2TA 3ZJYC 3S17H 2LXKA 1LYLA 3H09A 4HCSA 1O7YA 3HOWH 1UE1A 2VUMG 3K5MA 2I5MX 3F1ZA 3D8GA 2PQAA 3OIQA 5H1SE 1EUJA 1KC8C 4CJ2C 2JA8B 2FHTA 3OWFA 1Q81C 2RDGA 4DR1Q 1XMQQ 3R3OA 4KTAA 2B2TC 3I7FA 4QQBX 3I3CA 3VR6A 3VYRA 3K0YA 1VQPA 3TN2A 3NQTA 1J6QA 3JAMc 4DR4Q 3BJUA 2F0HA 3C3LA 1NTGA 1EEFD 3RN2A 3S1RB 1L2FA 3F2DA 4A3IG 4JBKA 4A3MG 1QJOA 1GKHA 1I6HH 2MO1A 5GAEC 1LACA 1OXSC 3PIOA 5IT9E 1LTTD 4DR3Q 3Q6SA 1J8IA 2TSSA 3JAME 2KCCA 1X54A 2E76C 2IX1A 3OW2A 2HT1A 3D3RA 1FL0A 2WB1B 3MZ5A 1VQDA 2ATWA 5IT9c 2R92H 2L9HA 1HNZL 2N8NA 2WAQB 4RGTA 1VQFA 4QUFA 1MKHA 4B9WA 4H44C 4X3SA 2EYJA 1D1KA 4TKOB 4LFCQ 3VA5A 2HQLA 3VR2A 3ITPA 2KCTA 4BBRH 1JE5A 2Z6KA 3CHBD 5EPKA 4BY7G 1S5FD 2KJXA 1B9NA 3ULLA 1KABA 1Z47A 4KKTA 2DJFC 5IIFA 3S16H 1R4PB 4J15A 3I4NG 1WTHA 2EYMA 1IHZA 3MHBA 5CYUA 1KL9A 3KJPA 4B3TL 4XYQA 1QWYA 4GNXB 4DV0Q 2SDFA 1Y8PB 2LS01 4FDBA 3M3YB 2F0VA 2J4XA 1PDQA 1CSPA 4DUZQ 2EYOA 2NWGA 1NMGA 3NWSA 1VQAA 1BKBA 1XTDA 3MFYA 4JK1C 3I56A 1EYGA 3BG3A 5KNDA 2NVQH 3A5ZB 5LMNW 3H3VC 2XRSD 2Z4IA 1QE6A 3T1YQ 3RZDB 2I46A 2K32A 5FK9C 4K8IA 1L0YB 2MFIA 1A2UA 3DM3A 4IUPA 2VY3A 1TXYA 2B2YA 4IN3A 1VCIA 3L7ZC 4NXMQ 1RD9D 4LF7Q 1LTLA 2B39A 2QILA 1DZ1A 4LFAQ 3A8JE 3Q23A 4UDUC 3GTMH 4IOCA 1BBXC 1FGUA 4RKLA 4ZUJA 1R9TH 1VQIA 1V43A 4V0BA 2MNAA 5ISRA 3FEWX 1SJED 4C3JG 2AQ1B 1QG7A 1EL0A 1GJXA 2IPKD 5FJ8H 1U4RA 4HAEA 1MSHA 3W1BA 1EYAA 5FLXc 1ASYA 4KHPQ 1LT5D 5M5YB 4EQPA 1MJCA 2ZXOA 2V4DA 2ALYB 3CCMA 1O80A 1VS0A 3F8TA 1CT1D 2BA0A 3SK4A 1CFMA 2CW0D 3CC2A 1G291 1KD1C 4FF1A 5IYDH 1JWSD 1KDAA 1STNA 4WFN3 5M3FG 3S14H 3L0OA 2ZM6L 5BR8L 1NBWA 4FF4A 3WWVA 2CKZB 1K0RA 1WTVA 2NVTH 3IRBA 3IAYA 4IUVA 1B50A 1LUZA 4A3DH 3FDTA 4DUZL 2IT1A 1I4RA 1SDFA 1VMCA 1H9RA 3CCJA 2BOSA 1C8CA 1HR0W 3CQZB 5ELNA 3F2CA 3URYA 1I5FA 1OXTA 1STYA 1BCPC 2D0OA 1N32L 3R2TA 1AZQA 2HHHQ 2UXBL 2QDLA 4RGNA 2R7DA 4LF9Q 3EIVA 3T16A 3ER0A 2UXCL 1WOCA 4DNTB 1XNQQ 1K3RA 1QUQB 2NYZD 3HEJA 3F2BA 1EWIA 4IFDJ 4L5TA 2FMCA 2E75C 1K8GA 1I94Q 4X64Q 3D6WA 4XT3B 2J7ZA 2NN6G 2B63B 4KD3A 4A3GG 1D8LA 3GTJB 2KECA 4KD4A 3GTGH 1IXRA 2PNRC 3AYHB 3S1MH 4DV4Q 1HNZQ 2B2YC 3EBEA 3RZOH 4S3SA 1OXXK 1JJGA 2LXJA 2FJ2A 4JI7Q 2CVRA 1ZEQX 1N33Q 1JMCA 2NTSA 3SXHA 3UI2A 4TVAB 4PG3A 4LF8L 3CRKC 3HOUB 3CCQA 1EZ6A 5LMUL 4A3JG 4POGA 3GTLB 4P75A 5ELOA 1PMRA 1ET6A 4LMQD 3ULPA 2AMCB 4J6HA 2PQEA 1XWEA 4ODGA 3BYTB 2EQSA 4JC0A 5GAGC 2H4OA 1F2ZA 4MNOA 5FO7B 1PH2A 3CPFA 3OOCA 1MGSA 4GLXA 2X6GA 2NVXH 1TVXA 5HGTA 4GNXA 3J7A5 2E2JB 1PZKD 1SNMA 2UU9Q 5CORA 4CDDC 5LMNQ 1D5MC 4PZ7A 3FKIG 3IKJA 5M5WB 1PLFA 3D4RA 1VF7A 1PH3A 1NR4A 3PQIA 4P71A 2Z6KC 1EU4A 1HQMC 4BA1I 4DUYL 3SDZA 3HKSA 3VYTA 4QCLA 4RH6A 1R9TB 5ELDA 4ZAIA 2A69D 1U4PA 4QJFA 2NVTB 4X66Q 1ONLA 1AE3A 2L5TA 3K8AA 2E2HB 5NUCA 5CV9A 3SK6A 2MO0A 3NE5B 1RJTA 1STAA 4QB4A 5M5YH 1SROA 4C3HB 1TR5A 2IHEA 4DV0L 1B9MA 2A6ED 2XSCA 3J80E 3S1QH 3DWPA 3S2DH 1XPOA 1MJEA 1OXVA 2DUDA 1X65A 1EFWA 3R2IA 1TWGB 5IP7H 4KKSA 4FXGC 5JVH3 3MTSA 3J81j 3BS1A 4ID6A 3WDNA 2CH4W 4K6LA 1A3UA 1KTKA 1EFID 1Q46A 1UWVA 2C5CA 4L6TB 1J5EQ 1EY9A 4NKLA 1TU2B 3T1YL 3GTQH 4LFCL 1R4QB 4DV6Q 1QNKA 4DU9A 5CV5A 3HOVB 4JBJA 1YEZA 4RHRA 4V190 4KHZA 1PH4A 4IPHA 1MSGA 4XYOA 4X6AH 1I4PA 2F0SA 5IYCH 4DR3L 1X32A 2KHIA 3C1FA 1CSQA 3NTHA 5EBDA 4R4TA 1E0BA 4JVZA 4FF2A 2JQOA 3OPOA 3I4MH 2DGYA 4DXFA 1EU3A 4K14A 1Y1WB 3ERQA 3ICEA 1SXTA 5E4XA 2UUCL 2K01A 1ML0D 3Q8DA 3A54A 1SMYC 1PVOA 3PF4A 5CMDA 2EJGC 2E2IH 3L2PA 4JPBW 3CCLA 2UUAL 1HNWL 2A6EC 4E6IA 5FLMG 2K28A 1Q3LA 2ZTEA 4IO9A 1E1TA 4OO1G 2I5LX 2ZM6Q 3K81C 3ZYYX 2N49A 1OO9B 3H91A 4N8FA 2ASBA 2PMZB 1I94L 1JQYD 2F0OA 4K6DA 3KF6B 3G6EA 2BDNA 1XMOQ 4R4QA 3S2HH 1DXMA 5FO9B 2PI2A 3MA2B 4JBMA 2EJFC 3NTIA 1NUCA 2MP1A 2R6GA 5EAYA 4K0KQ 1Z9FA 1EY0A 1BXTA 1J9OA 1IYUA 5GROA 3PIPA 3AU7A 1N8RC 4DR4L 1L1OA 2Q2UA 1GHKA 1T5XD 4OHJA 1Y1VH 2L1BA 5D14A 1VQEA 1X55A 1EQQA 3MXNB 4DA2A 1V1OA 1JOKA 1O78A 5C0XH 4GLAC 1BOSA 4DPGA 2V1CC 4ZUIA 3H6MA 4PMWA 4DR2Q 1STBA 1NAPA 2B8FA 1PH9A 1VQ9A 5BR8Q 4OIKA 2XN9C 2UUBQ 3VYUA 1CQFA 4DV1L 1EQVA 4DV7Q 3PO3H 4XQJA 1TY0A 5M3MB 2VUMH 1TWHH 4IFDG 2EY5A 4K8JA 3CW2C 3NQIA 3NENA 3CPWA 4RCOA 4TSSA 4FXKC 3QO2A 2B2VA 4ME3A 2Q8IB 1KXLA 3HKZE 1N36L 4HR7B 5G3LF 1IZ6A 1TS2A 2A74C 2G9HD 5DAUA 2PZUA 2D62A 4YHHL 1S5CD 2N55A 4OONA 1S72A 1I6VC 2JSOA 1RL2A 1UE7A 4KK7A 4ZCKA 2GVBA 1KDCA 3PSIA 3KBGA 1LTID 2RQXA 2I5HA 3NP8A 4K2KA 4NP5A 4RFBA 3PO2G 1IW7D 4A3MH 3G48A 4O0AA 4A3DB 3CP0A 3AQQA 3DM1A 2X69A 1BNZA 5EQ0A 4A76A 5D65A 4H02A 4B3TQ 3M85A 2DNCA 1GUSA 1M1KC 4L63B 3X3MA 4GKJL 1Y1VG 2F0IA 1TWFB 1TT2A 2KEEA 4C1NI 4DK0A 4JI3Q 2KUMA 3S14B 3EA6A 4JOIC 2R92G 4HIMA 1IKLA 4AQYL 1S40A 1W3SA 4HTHA 1P16A 5A2QL 4LFBQ 2F3IA 3AB9A 5EKLA 3JC66 5C5LA 2R7FA 1PHJA 3K80C 4JI7L 4DV4L 2NVYH 4RG1A 4OWXB 2J0TD 1EOTA 1GUOA 1X56A 3PUWA 1P8LA 2CFMA 5HGQA 4A3JH 4POFA 1TWAB 3BZCA 2ZT9C 3A8IE 3HOXB 1C9OA 2F4VL 3EFXD 4OWTB 4HJAA 3M7GA 4A3MB 4QMGA 5A35A 4ZYSA 2ZJRA 3MWYW 3J7AV 2F0DA 1TWFH 2L15A 4C1NK 5IYBG 1ZYRD 2YV5A 4DV2Q 5D3IB 3I91A 1JWUD 5D3DA 1C7YA 1B2TA 2H5XA 1HTLD 4P74A 1HA5A 2HDMA 2QGQA 4FF3A 4PQXA 2DN8A 4WORA 4GN4B 4J1MA 4DAYA 4IPGA 1G8ZD 1LABA 5LL6S 4C3IB 4GOPA 4JI5L 3QR8A 2B2WC 4A93H 3ONAB 5AJ3Q 2Y0SG 1LTAD 4I65A 3A55A 1F9PA 3U50C 3WOFA 2ICIA 1CHQD 1SFOB 2M2LA 5KEEA 5CV8A 1I4XA 2K75A 5IP9H 4X66L 1WTQA 5M3FB 2B8GA 1O7ZA 3CF5A 1Q1EA 3J81L 2VB3X 4LF4L 4XQNA 3D6CA 4KI0A 1HUMA 3C2PA 1WI5A 4FO2A 4EQ5A 2UXDL 5C0XJ 1JJCB 1ESRA 2ZTCA 1Y8NB 1Y1VB 3T13A 5M3FH 3K7UC 1TY2A 1PTOC 1A3TA 3HG9A 3FKIH 2E2HH 3HP3A 5IP7G 3G7LA 1HJPA 1AE2A 4U68A 2OEOA 3DUZA 4AH6A 3MXPA 3MVVA 1GHJA 4BY1H 4KHPL 1HZ9A 4A3LH 4HMJA 3PF5A 4A3DG 1T9HA 4EQOA 5JEAJ 1CQVA 1SNQA 4H0LC 1D5XC 3CD6A 1ZYRC 2IX0A 2PW7A 3E5SA 3STBD 2NB0A 3PIO3 3A5UA 1IBLQ 1UNSA 1QVCA 4X3KA 2AWOA 1BQQT 1YHBA 1CZWA 2JA7H 1C48A 4B3SQ 2EJMA 3J7AF 2R92B 2L55A 4B9XA 4BBSH 3SGIA 4DR5L 2K1BA 1EIHA 4KLKA 1BR9A 2A68D 3TDQA 1WTWA 3HOVH 4CJ1B 2JA6B 4XIGS 3CCVA 1DOKA 1X3QA 4K0KL 2HD3A 1G2TA 4JYAL 1VQKA 2RCFA 3TSSA 2FMMA 5C6AA 4DN4M 1BCPD 2F4IA 1WJJA 2I07B 5I6WA 2SNMA 4YCVA 2QEXA 1A15A 2R7ZH 2C9OA 2B2WA 2HIXA 3RZDH 1K28A 2ZJQA 3OMGA 4KY5A 1V1PA 5AJ3L 3SVMA 3CMAA 1LTGD 1EOVA 5IGDA 4O42A 4CKBA 2A5HA 1LV9A 1Q1BA 4OL7A 3VR5A 4OX9Q 1ILQA 4GOPC 3V96A 3OIPA 1ICWA 4KN4C 1CZGA 1X3EA 3KLSX 3D4DA 2VQEL 2IW3A 1PH7A 4A93B 1WTXA 1SYGA 2Q2TA 1H9MA 1UE5A 2K05A 3J80c 5FLXE 3T51B 5IGCA 2PQAB 3HOUG 4R8NA 5CV7A 3HKZB 2BH2A 5C44G 3MFGA 4HEDA 1BF4A 2MJ8A 4XXEA 4X65Q 1XPUA 1HZAA 5T1IA 2O5IC 3RNUA 4YY3Q 4OGQC 3KK7A 4IFDH 3NELA 5KNCA 2YTXA 5KNBA 4EX5A 3CCSA 5IGGA 4MN3A 4A3JB 1FNUA 1HNWQ 1B1ZA 4CKCA 2HHHL 1C4QA 5EBCA 4DR7Q 1A0IA 2NVQB 4BY1B 4N9PA 1EZ8A 3QJYA 3NUCA 4HJ9A 4X3TA 4C3HH 4OX9L 1PZID 1D6EC 4B3RL 3PO3G 4WJ3M 1EIFA 3DWQA 4R1JA 1DYQA 4C56C 2YU9B 2QCPX 3I4MB 3KOJA 4A3KG 5C3XA 5FKAC 2JE6I 4MTNA 1EIYB 2Y0SE 4RWSC 2YTYA 2F52A 4QIWE 2PO4A 1H9JA 2F0TA 2F0JA 1DD2A 2RSNA 1WCMB 4PMBA 3LWUA 1LO5D 5JJLA 5J22A 4B3ML 1N34Q 2FFKB 4ZQ3A 1YITA 3STBC 2KCNA 2CHBD 2XVSA 3NEMA 3X3NA 1MD2D 1XNRQ 1BDOA 4U673 4GKJQ 3I70A 4QGUA 1IL2A 3DMUA 5KYIA 2NBFA 1D7QA 1YI2A 5GAHC 3S1NH 4JI8L 1B53A 3GTKB 4YWMA 2JEBI 3HOUH 1JT8A 1SNOA 3FRPB 4XQQA 5L37A 1PTOD 2OQKA 3I4NB 4LF8Q 4B08A 4DV6L 3S1NB 1NE3A 1HTPA 3CCUA 2A73B 4IURA 4BS9A 3RLNA 3U9OA 1KRTA 2JK8A 3S1MB 1WCMG 4GN3B 1E22A 4C2MH 1B7YB 2VL6A 2N3SA 3GDEA 2K7VA 5M3MG 1HUNA 1S5ED 1W2BA 1EY8A 4XTCS 1RDPD 4A3KB 4UY8C 1HHVA 3GTOB 3W2DA 3C1EA 4RCNA 3B6YA 1V1QA 1SBBB 2VZAA 2Z6BA 2B2UA 5JPMC 2MHVA 3H0GG 2EYLA 1RKNA 2KEDA 1AFPA 3FPUB 1WFQA 2X6LA 4I7AA 1YNND 4LF9L 3FHWA 5CBAE 1S5DD 4JI4L 3Q22A 5IP9G 1CKOA 4BY1G 3V2TA 2OXPA 2R7ZB 3EN2A 2IX3A 5COYA 1L1OC 1W6JA 4JI0L 1LLRD 1I4GA 1PFMA 3P75A 4GN5A 4PMCA 4NPSA 1E3PA 1RODA 3HOXG 5GQOA 1WTPA 5G3LD 1KLGD 1PRTF 3DEPA 5JAVA 3V05A 4ZK9B 1GD7A 2OT2A 1OTCA 1CUKA 3DHQA 2B2TA 1HFGA 1K8AC 3EJIA 2F3VA 4BBSG 1JICA 1FJGQ 1X3FA 4CDCC 1YNNC 2AQ3B 3UDXA 4FYDA 4IJLA 1TIID 3HKZG 3SHLA 1CKNB 4LJZC 1S4ZA 2K03A 3HOVG 4K5WA 4YIJA 4X62L 1N32Q 2E2JH 3OTOQ 2NVXB 5TSSA 4C3IH 5C0XI 1VQ6A 3OSOA 4P72A 1D5ZC 4KKUA 1GUTA 2EOTA 3A56A 3U4ZA 2K5DA 1KNEA 1EY6A 1FNWA 3E0EA 3RD4A 1VQNA 1F2YA 1H9KA 2F0UA 1FR3A 1BCPB 1TKWB 4HSVA 3BYYB 1TWCB 1JB3A 1YIJA 4RKBA 4MHEA 5E3FA 3PO2B 2F1MA 3KF8A 2OTJA 2LY7A 1C0AA 1V8QA 2K33A 1AEXA 1LTBD 2CH4A 3P1HA 1K83H 1SLJA 3KFUA 3AFPA 5CV4A 2XGTA 4MTKA 3IL8A 5C3EG 1X6OA 2L12A 1PYSB 3S2DB 1EWCA 2F0LA 5I9OA 1SFOH 3K5LA 1BUVT 2R7ZG 1PTOF 3MXNA 4LF5Q 4GLVB 2LMCB 5E7NA 4JI2Q 4GNXC 3S15B 3I55A 1VQJA 1EQTA 1B4OA 1LTRD 2F0EA 3W3AA 1E2WA 2WP8J 1Y1WH 2KCMA 1Z6HA 3K0XA 4X3UA 1Q8KA 3NK9A 1Q90A 2AWNA 1RTNA 3PUZA 3KLWA 5JJKA 2AHOB 1AZPA 4DV3L 2JA7B 1G6PA 3NBHB 3QB3A 3D31A 3PUVA 3DXJC 3I90A 3CU7A 2HUGA 4I7ZC 5IWAL 3RMHA 3GTPH 4APVA 3TP5A 1FD7D 3AMUA 1E2ZA 5C4JH 2JA8H 1BO0A 4HIDA 3K7AH 4LFAL 1FNVA 1FYCA 1DM0B 3ULJA 1AW7A 2LKVA 1QVGA 2UXDQ 2N78A 1I6HB 3HOZH 4NXML 4OELB 2NZOA 3OW7A 4QIWB 4A3FB 2HCIA 3PCOB 3R93A 4EVOA 2F3WA 4RGOS 3GTOH 1KDBA 5C3WA 3MEHA 4A3KH 2OF1A 5C4HA 4IZ8A 4LUOA 3PO3B 1PH6A 3SK8A 2F0QA 4M1UB 5CV6A 3M4OH 4LW1A 3FKIB 1PA6A 2HIVA 1SAPA 1YZ6A 5C3EH 3BVMA 4N8X1 2G9DA 2Q8TA 1ICFB 3GTGB 1CM9A 3HGBA 3KF8B 3QG1A 3VDYA 4G7OC 4O2DA 2D2CC 5GADC 4JI5Q 4OXPA 3K59A 5FJ8G 3RZOB 3HS0C 4XDXA 4KN7C 1RCVD 4R9WA 1H95A 2NN6H 3UDFA 2BA1A 1IBKL 2NZHA 2XTIA 1ENAA 4PV1C 1XMOL 1JC7A 3TQYA 3I72A 4LF4Q 3CKIB 2EE1A 4CGYB 1BCPF 3HOYB 1SYDA 2YTVA 1PTOB 3ND9A 4JW0A 2JJQA 4QY7A 2JA8G 2JXMB 3GQBA 4JBWA 4A3GB 2RDFA 1JE4A 2D9UA 1WCMH 1EYCA 3BZKA 2XRQD 1SNPA 2VB2X 5C4JB 1AH9A 3GTPB 2R3ZA 3RR5A 2BE5C 2QKIC 4BY7B 4A3BB 1F9SA 2UUCQ 3J81E 1JR0D 3G71A 3EROA 1PRTC 2KBNA 2JP1A 3LWEA 1IL8A 2WFWA 2WB1E 2M00A 1B44D 2P5ZX 4NXNQ 4LUZA 5ELBA 3TP6A 2GA4B 3OYYA 4HMIA 2PZTA 3PMFA 5CR3A 3VR3A 1PFSA 1WTRA 1TQOA 4N9TA 4G7HC 5E4WC 4DUYQ 4BBRB 2DY7A 2KQ3A 2NN6I 4A3GH 2JYOA 1XNRL 1N36Q 4DFAA 5BN4A 1HNXL 3FMCA 1PRTD 1S3OA 1F9QA 3Q0AA 2WAQE 2SEBD 2AQ2B 4NDXA 1VQLA 1IYJB 4P73A 1VDZA 4JV5Q 4CHTB 3FVQA 1M90C 2MPMA 1EIGA 3BVZA 5IODA 3D4WA 2BH8A 3BDLA 1CA5A 4BWGB 4NXNL 5IOCA 1A3VA 1XTCD 3S1QB 4UAIA 2F0GA 5A2QE 4YCUA 2VQFL 5ELCA 4FXDA 5EKIA 4JI6L 3A7AB 3M4QA 2NUCA 1YJ9A 5I2XA 3T53B 1O7IA 5KIXA 2IJ0A 2IL8A 5C44H 4A3EG 1M4VA 1KIXA 4IOAA 1KAAA 1IW7C 4A3BG 1L0WA 2ICEC 4DGZA 3NBIA 3P7JA 1UEBA 4PNYA 1YNJD 1U9RA 5K36G 3RUZA 2NTTA 1K0SA 3OHXC 5LL6X 4KY6A 5CBEE 4LK1C 1V1PB 3E6ZX 2DY8A 1I3QB 1GM5A 1HFNA 1EY4A 2GN5A 3S16B 2ENBA 2SOBA 2UXCQ 2JA6H 2NZ1D 4J8QA 2CWPA 5IYDG 3RLFA 1QNUA 3AFQA 1UAPA 2B29A 4JI3L 3H3VH 1SN8A 1YJNA 3VYSA 2OTLA 2PI2E 2QEJC 3KF6A 1VQ4A 4WJWA 3I8ZA 2EDGA 3S9WA 3Q24A 4RAUC 3H0GB 4G7ZC 5I4DA 1VMPA 3WOEA 5AFWA 2E2IB 3KLRA 4G4KA 2XIWA 4C3HG 2ZTDA 1YBYA 2RCNA 2JA5G 1SRUA 1RHPA 2Q2HA 3GD7A 3LX0A 3I4LA 1VQBA 1SYEA 3KUPA 4A3EH 1JCKB 1SJHD 2RA4A 1XNQL 1XXGA 2WINB 1HQRD 4AYBE 5EGTA 2KVMA 1II3A 1SMYD 1K9MC 1G51A 4F87A 1A6XA 5IYCG 2PYKA 5M5XH 4A3CH 4IJHA 2O2LD 1YNJC 4F8MA 1SR3A 2K5VA 3F2UA 3S17B 2QF7A 4Y7NH 3BVGA 3TP8A 3K5OA 5E1FA 1HPCA 4QF4A 2N88A 4FNFA 1PFBA 5EKKA 1F2LA 1YHAA 2IY5B 5LHY1 4Q5VA 3GTLH 1A62A 1IKMA 2PNHA 4Y7NB 1G6ZA 3HOYH 3SEBA 1HR0L 1GUGA 3VA7A 5IGEA 2EIFA 5JJIA 2TMPA 2OWOA 3RLOA 2XNAC 2K5NA 4OO1I 5I2YA 3K57A 4LNQA 5KGUA 3J7YW 4IPDA 2Z9HA 4L5SA 5FLXL 1SSOA 2QDBA 1F9RA 2IHFA 4A3EB 4CKEA 2D5DA 3KDFA 5KYLA 4KHVA 4UHVA 2K14A 2E74C 4IUNA 3TP7A 1PV4A 4OIJA 4KJOA 1CTMA 1Y69U 1LT3D 1ILPA 1E1OA 4ZKBB 2K50A 1XX8A 1MI2A 3M3YH 2F03A 5HY6A 2QW7A 4JI4Q 4JOIA 5C3EB 2XWBB 4HJ8A 3S1RH 1Q86C 1WD0A 2NVYB 1Q12A 1O7LA 1LT6D 2BCOA 1X3GA 2A68C 4B3RQ 3TZDA 3UE0A 2JN4A 1S5BD 3I73A 4A3FH 1ENCA 3W5OA 2JA5H 4DR6L 3SK5A 2E5LQ 1BBWA 2CQAA 2K5HA 5J3BA 1N33L 3PO2H 3HFZB 1PFNA 5C4ZA 5DM63 1HA6A 1CI3M 1K8MA 4KJNA 2QA4A 2EXDA 3QOJA 1DJRD 3NTKA 1XMQL 3TZUA 2RF4A 1TS3A 1PTOH 3TS0A 3LNNA 2L0CA 4RA8A 4ALPA 4IFDI 2A1AA 1U0LA 4A3CG 1E24A 3J81c 4AIMA 4BXXG 4DV5Q 1KAWA 2GVAA 3EVQA 3PIP3 1H9SB 5EJWA 5JOBA 4GOPB 1AP0A 1I4HA 1Z7TA 4H7BA 1QUQA 1TWHB 3H94A 4IUTA 1GXDC 4X64L 1MHWC 2UU9L 2CW0C 4EQNA 3M4PA 2WB1G 2ZXPA 4R4IA 3KLSA 5C5MA 2LSSA 4DF7A 3GTKH 4TQUS 5FLMH 3UDIA 1GO3E 3QWNA 1Y1WG 1L0XB 2R93H 1CK1A 3ERSX 4BBSB 1PZJD 1VQ5A 4R4CA 3NHHA
chains in the Genus database with same CATH topology
2D62A 4YHHL 2ZJPA 4QQBX 1K83H 1SLJA 3I7FA 4OONA 4YY3L 1S72A 1L1OB 3KFUA 3AFPA 2A8VA 1VQPA 2XGTA 1RL2A 1UE7A 1IBML 2GVBA 1J6QA 4HJ5A 3JAMc 3PSIA 4DR4Q 3BJUA 2E8GA 5C3EG 1X6OA 1QZHA 1PYSB 1NTGA 2I5HA 3RN2A 3PO2G 4A3MH 1L2FA 3G48A 4O0AA 3F2DA 4A3IG 3CP0A 3AQQA 4A3MG 1SFOH 4JBKA 1GKHA 2R7ZG 1I6HH 1CKNA 2MO1A 4LF5Q 4JI1Q 5GAEC 4A76A 4GLVB 1OXSC 5E7NA 4H02A 1TWGH 4JI2Q 3PIOA 3M85A 4GNXC 1Q82C 3I55A 4B3TQ 1VQJA 4JI1L 1KRSA 1A8VA 4DR3Q 4A93G 1M1KC 1X54A 2IX1A 2WP8J 3OW2A 1Y1WH 2HT1A 3DLLA 4GKJL 1Y1VG 1U5KA 2KCMA 1FL0A 4JI3Q 4OWWB 3K0XA 4JOIC 1Q8KA 2AWNA 1VQDA 4NB3A 3PUZA 5IT9c 3KLWA 2ATWA 2R92G 4HIMA 2R92H 4LFBL 2AHOB 4AQYL 1S40A 1HNZL 1W3SA 4JCVE 1LM0A 1P16A 2N8NA 5IYBH 3KJOA 4DV3L 4LFBQ 1VQFA 3W1GA 2F3IA 1G6PA 3JC66 1MKHA 1BBUA 2R7FA 3D31A 3NBHB 3PUVA 5IE8A 1PHJA 3K80C 4JI7L 4DV4L 2NVYH 1OXUA 4RG1A 4LFCQ 2AKWB 4OWXB 5IWAL 2HQLA 1VQ8A 4A3IH 2KCTA 2ES2A 3GTPH 1X56A 3PUWA 4APVA 1V9PA 5C4JH 4BBRH 1JE5A 1P8LA 3UE1A 4DNIA 4HIDA 1VQMA 2CFMA 2Z6KA 4LF6Q 5HGQA 4A3JH 4POFA 3K7AH 3PUYA 1PH5A 4LFAL 3BZCA 3ULJA 4BY7G 4BY7H 1UE6A 3ULLA 1Z47A 1NY4A 1X9NA 1QVGA 2UXDQ 1C9OA 2N78A 3UDGA 4NXML 2F4VL 3S16H 4OWTB 4J15A 3I4NG 2NZOA 4LF7L 4HJAA 3PCOB 2F4VQ 4WJ4A 3KJPA 1KL9A 3GTOH 4B3TL 4JI2L 4GNXB 4A3KH 4DV0Q 4IPCA 2ZJRA 2I0QA 4FDBA 4LUOA 1TWFH 2L15A 1PH6A 5IYBG 3M4OH 2YV5A 4LW1A 2PMZE 1CSPA 1PA6A 4DV2Q 2HIVA 4DUZQ 1C7YA 4JYAQ 1NMGA 1YZ6A 2H5XA 1VQAA 1BKBA 1XTDA 2UUBL 5C3EH 4P74A 1TWCH 5DLQE 2QGQA 3I56A 2JA6G 3CC4A 1EYGA 4GN4B 4IPGA 3KF8B 3VDYA 2NVQH 4GOPA 4JI5L 2CQOA 3A5ZB 4A93H 3CQZH 4O2DA 5LMNW 5GADC 2Y0SG 5AJ3Q 1MIUA 4JI5Q 4GS3A 4OXPA 4A4IA 5FJ8G 3T1YQ 3U50C 1CKMA 5JJKA 4DR2L 3TEHB 2MFIA 3DM3A 2K75A 5IP9H 2VY3A 1TXYA 4X66L 1H95A 1VCIA 3L7ZC 3CF5A 2VW9A 4NXMQ 1Q1EA 3UDFA 2BA1A 4LF7Q 1LTLA 4DK6C 1IBKL 4LF4L 2NZHA 2XTIA 3GO5A 3U4VA 4LFAQ 3HOZH 4KI0A 1XMOL 3TQYA 1WI5A 4LF4Q 2MQHA 4EQ5A 3GTMH 2UXDL 4IOCA 3TRZA 5C0XJ 1JJCB 2Z0SA 2ZTCA 1N34L 4LWCA 1FGUA 2YTVA 5M3FH 2VS1A 4DR7L 1RIPA 2JJQA 3K7UC 1R9TH 4QY7A 1VQIA 1V43A 2MNAA 4DV2L 2JA8G 1PH1A 3FKIH 2JA9A 3HOWG 4JBWA 2E2HH 3PUXA 4B3MQ 1ASZA 5IP7G 1WCMH 2OCEA 5FJ8H 3W1BA 5FLXc 1HNXQ 1ASYA 1VQHA 4KHPQ 3BZKA 1EQRA 1HJPA 1AE2A 3CC7A 1MJCA 1AH9A 2ALYB 4AH6A 3CCMA 4KHPL 4BY1H 1VS0A 1HZ9A 4A3LH 3F8TA 3M9BA 3RR5A 4DAYB 3I4OA 3T1HQ 3PF5A 1PH8A 2BA0A 1T9HA 4A3DG 2UUCQ 5JEAJ 3CC2A 1G291 3G71A 1KD1C 3BU2A 5IYDH 3CD6A 3E9HA 2KBNA 3FP9A 1JJ2A 2IX0A 3STBD 4DKAC 1IBLQ 3A5UA 1HH2P 2WFWA 2WB1E 4GKKQ 1QVCA 5M3FG 2AWOA 2CWAA 2B63G 2OQ0A 4NXNQ 4LUZA 1YHBA 3S14H 3L0OA 2ZM6L 2JA7H 5BR8L 5C4XG 4B3SQ 1NBWA 4BBSH 3SGIA 3WWVA 4DR5L 3OYYA 3HOYG 2CKZB 4KLKA 1VQOA 1K0RA 3HOVH 1XJVA 3M7NA 4HJ7A 1PFSA 2NVTH 3TS2A 3IRBA 4XIGS 3JAMi 4MZ9A 3E9IA 3CCVA 4HIKA 4K0KL 4DUYQ 1LUZA 4A3DH 4DUZL 2NN6I 1VQKA 1FVIA 2IT1A 4A3GH 1XNRL 4JYAL 1N36Q 1HNXL 4R4OA 3CCJA 1S3OA 1K73C 1WJJA 2WAQE 1HR0W 4X65L 4YCVA 5ELNA 3F2CA 2QEXA 1I5FA 1OXTA 1VQLA 1IYJB 3I2ZA 2D0OA 2K4KA 2R7ZH 4P73A 3RZDH 2HIXA 1N32L 2ZJQA 1PYBA 1NMFA 5AJ3L 2HHHQ 4JV5Q 2UXBL 2R7DA 4LF9Q 3CMAA 1M90C 3EIVA 1SE8A 1EOVA 3ER0A 4A3BH 2UXCL 1WOCA 3RN5A 1Q1BA 2BH8A 1K3RA 1QUQB 4OX9Q 1XNQQ 3F2BA 4GOPC 2JEAI 4JI0Q 1EWIA 4IFDJ 4NXNL 4L5TA 2VQEQ 1YJWA 1K8GA 1I94Q 4X64Q 4AQYQ 1X3EA 2NN6G 2VQEL 1VQGA 1PH7A 4DR5Q 4A3GG 1D8LA 2Q2TA 1UE5A 3GTGH 4YCUA 1IXRA 3S1MH 2FXQA 3AYHB 3LGJA 3PV0A 3J80c 4DV4Q 1HNZQ 2VQFL 3EBEA 3RZOH 4JI6L 2PQAB 3HOUG 3M4QA 1OXXK 1YJ9A 1JJGA 2LXJA 4LF6L 1O7IA 3J7ZC 4JI7Q 2BH2A 5C44H 3CAMA 4A3EG 5C44G 1JMCA 1N33Q 4BA2I 2JA7G 1KIXA 4TVAB 4PG3A 4LF8L 1XPUA 4X65Q 4IOAA 1KQSA 1HZAA 4A3BG 3CCQA 1L0WA 5LMUL 1SMXA 4A3JG 4POGA 3RNUA 4YY3Q 4DAMA 4P75A 1UEBA 3NELA 4A75A 4UP9A 2YTXA 4X62Q 5ELOA 4EX5A 3CCSA 4JG2A 5K36G 4UPAA 1B70B 1QZGA 3ULPA 2AMCB 5GAGC 1HNWQ 1TWAH 2EQSA 4JC0A 2HHHL 4JV5L 4A3LG 4DR7Q 1A0IA 1YVCA 1GM5A 4MNOA 3HOXH 4GKKL 1PH2A 2GN5A 4HJ9A 1GVPA 3A74A 3CPFA 4GLXA 2JA6H 4C3HH 5IYDG 2CWPA 2UXCQ 3RLFA 4DV1Q 4DV7L 2NVXH 4OX9L 4B3RL 2C35B 4GNXA 3J7A5 4YWLA 2UU9Q 3AFQA 1XPRA 3PO3G 2B29A 4JI3L 5LMNQ 3H3VH 4WJ3M 4PZ7A 3FKIG 4C3JH 1EIFA 1HZBA 1SN8A 4R1JA 4JI8Q 4BBRG 1YJNA 2OTLA 1PH3A 2PI2E 4P71A 2Z6KC 3KF6A 1VQ4A 1E7ZA 4DV3Q 1JB7A 4BA1I 3KOJA 4DUYL 4A3KG 1QVFA 4Y52H 3HKSA 2KHJA 5M5WH 2JE6I 4MTNA 3J80i 2Q2IA 4BXXH 4QJFA 1EIYB 2B3GA 1BVSA 2Y0SE 1HR0Q 2YTYA 4X66Q 1AE3A 2F52A 3K8AA 4QIWE 2ZTDA 1YBYA 2RCNA 2RHQB 1WYDA 2JA5G 5LMUQ 1SRUA 2UXBQ 2Q2HA 3GD7A 1YNXA 5IY0A 3OTOL 2MO0A 1VQBA 5M5YH 5JJLA 1SROA 4B3ML 4A3EH 1N34Q 3AEVA 1XNQL 1YITA 3STBC 2IHEA 4DV0L 1A63A 1Y14B 3S1QH 3S2DH 3NEMA 4UP8A 1XPOA 1MJEA 1OXVA 4AYBE 4UP7A 2WAQG 1XNRQ 2DUDA 1K9MC 1X65A 1EFWA 1G51A 5IP7H 4GKJQ 5IYCG 4QGUA 1IL2A 5M5XH 4A3CH 4IJHA 3J81j 1D7QA 1SR3A 2K5VA 5M3MH 4LUVA 1YI2A 5LMNL 3S15H 4Y7NH 5GAHC 3T1HL 2UUAQ 3S1NH 4JI8L 2YYZA 4YWMA 1Q46A 2JEBI 3HOUH 1UWVA 3I4MG 4RMFA 1J5EQ 1JT8A 1YHAA 2IY5B 3T1YL 2OQKA 3GTQH 4LFCL 4LF8Q 3GTLH 4DV6Q 5IWAQ 3KYHC 4DK3C 1A62A 1IBMQ 2PNHA 1IBKQ 4JBJA 1YEZA 4DV6L 1NE3A 1N9WA 3CCUA 3HOYH 3RLNA 4KHZA 1HR0L 1KRTA 2JK8A 4PZ8A 2EIFA 1PH4A 2CCZA 5JJIA 1WCMG 4GN3B 1E22A 4IPHA 4C2MH 2OWOA 4X6AH 3RLOA 1VQ7A 1B7YB 4DR6Q 5IYCH 2K5NA 2VL6A 4OO1I 1VQCA 4DR3L 2N3SA 3GDEA 4LNQA 2KHIA 4IPDA 5M3MG 4YWKA 1CSQA 4L5SA 2K52A 1W2BA 4R4TA 2IHFA 2JA8H 4DR1L 2JQOA 3CMEA 4XTCS 3I4MH 3KDFA 4UY8C 4YHHQ 1FJGL 2DGYA 2K14A 1PV4A 3B6YA 1V1QA 2VZAA 3CCRA 3ICEA 4DV5L 1E1OA 2UUCL 2K50A 2KENA 3H0GG 4L5QA 3Q8DA 1WFQA 1NJIC 3M3YH 5HY6A 1PVOA 3PF4A 4JI4Q 4JOIA 4LF5L 2E2IH 3L2PA 4HJ8A 4LF9L 3CCLA 3FHWA 3S1RH 1Q86C 2UUAL 4PZ6A 1I3QH 3U58A 4JI4L 1HNWL 5FLMG 2ZTEA 5IP9G 1CKOA 4BY1G 2ID0A 2RHSB 2A19A 3EN2A 3PGZA 1E1TA 4IO9A 2I5LX 1Q12A 4OO1G 2ZM6Q 1DGSA 3K81C 1L1OC 3G4SA 2N49A 4GN5A 4B3SL 4JI0L 3H15A 2ASBA 4NPSA 1E3PA 1X3GA 2YU9H 1I50H 3HOXG 4B3RQ 5GQOA 3UE0A 1XMOQ 1I94L 3KF6B 4AYBG 1B8AA 3G6EA 4R4QA 3S2HH 4A3FG 2PI2A 3CXCA 5C0XG 4A3FH 1YHQA 4JI6Q 3W5OA 4JBMA 2JA5H 4DR6L 2E5LQ 1BBWA 2K5HA 2R6GA 5EAYA 4K0KQ 1GD7A 2VQFQ 5J3BA 3S24A 1N33L 1OTCA 2E5LL 1Z9FA 3HFZB 3PO2H 1CUKA 3CCEA 2D0PA 3H0GH 5GROA 3GTJH 4HIOA 1K8AC 4BBSG 3PIPA 2QA4A 2EXDA 4QL5A 1XMQL 1N8RC 1FJGQ 1X3FA 4DR4L 1L1OA 2RF4A 3UDXA 2Q2UA 3TS0A 4IFDI 4ALPA 3A0JA 2A1AA 3J81i 1Y1VH 4IJLA 3I4NH 1VQEA 1X55A 3HKZG 1EQQA 3HOZG 1CKNB 3MXNB 3KDFB 1U0LA 3D0FA 2R93G 4A3CG 1E24A 3J81c 1Q7YC 5JEAG 3HOVG 4AIMA 4L5RC 4BXXG 2VNUD 4DV5Q 4X62L 1N32Q 2E2JH 1HZCA 3OTOQ 1KAWA 2GVAA 4GLAC 4C3IH 5C0XI 1J5EL 4DPGA 4GOPB 1VQ6A 2V1CC 4P72A 4PMWA 4DR2Q 4YCWA 1QUQA 4X64L 2B63H 2UU9L 1PH9A 3U4ZA 1VQ9A 3H3VI 5BR8Q 3M4PA 3TREA 1IBLL 3MEFA 3E0EA 5C4XH 2UUBQ 1KHIA 1VQNA 2WB1G 4DV1L 4DV7Q 3ZJYC 3S17H 4R4IA 2LXKA 1LYLA 3PO3H 2LSSA 3HOWH 2VUMH 1TWHH 1UE1A 2VUMG 4IFDG 2I5MX 3GTKH 3F1ZA 4TQUS 5FLMH 3CW2C 3UDIA 1GO3E 3NENA 2PQAA 3CPWA 1Y1WG 5H1SE 1EUJA 1YIJA 1KC8C 4ME3A 1KXLA 2R93H 3HKZE 3ERSX 1N36L 1Q81C 1XMQQ 1IZ6A 4DR1Q 1VQ5A 4R4CA 2OTJA 1C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D62 A;  4YHH L;  2ZJP A;  4QQB X;  1K83 H;  1SLJ A;  3I7F A;  4OON A;  4YY3 L;  1S72 A;  1L1O B;  3KFU A;  3AFP A;  2A8V A;  1VQP A;  2XGT A;  1RL2 A;  1UE7 A;  1IBM L;  2GVB A;  1J6Q A;  4HJ5 A;  3JAM c;  3PSI A;  4DR4 Q;  3BJU A;  2E8G A;  5C3E G;  1X6O A;  1QZH A;  1PYS B;  1NTG A;  2I5H A;  3RN2 A;  3PO2 G;  4A3M H;  1L2F A;  3G48 A;  4O0A A;  3F2D A;  4A3I G;  3CP0 A;  3AQQ A;  4A3M G;  1SFO H;  4JBK A;  1GKH A;  2R7Z G;  1I6H H;  1CKN A;  2MO1 A;  4LF5 Q;  4JI1 Q;  5GAE C;  4A76 A;  4GLV B;  1OXS C;  5E7N A;  4H02 A;  1TWG H;  4JI2 Q;  3PIO A;  3M85 A;  4GNX C;  1Q82 C;  3I55 A;  4B3T Q;  1VQJ A;  4JI1 L;  1KRS A;  1A8V A;  4DR3 Q;  4A93 G;  1M1K C;  1X54 A;  2IX1 A;  2WP8 J;  3OW2 A;  1Y1W H;  2HT1 A;  3DLL A;  4GKJ L;  1Y1V G;  1U5K A;  2KCM A;  1FL0 A;  4JI3 Q;  4OWW B;  3K0X A;  4JOI C;  1Q8K A;  2AWN A;  1VQD A;  4NB3 A;  3PUZ A;  5IT9 c;  3KLW A;  2ATW A;  2R92 G;  4HIM A;  2R92 H;  4LFB L;  2AHO B;  4AQY L;  1S40 A;  1HNZ L;  1W3S A;  4JCV E;  1LM0 A;  1P16 A;  2N8N A;  5IYB H;  3KJO A;  4DV3 L;  4LFB Q;  1VQF A;  3W1G A;  2F3I A;  1G6P A;  3JC6 6;  1MKH A;  1BBU A;  2R7F A;  3D31 A;  3NBH B;  3PUV A;  5IE8 A;  1PHJ A;  3K80 C;  4JI7 L;  4DV4 L;  2NVY H;  1OXU A;  4RG1 A;  4LFC Q;  2AKW B;  4OWX B;  5IWA L;  2HQL A;  1VQ8 A;  4A3I H;  2KCT A;  2ES2 A;  3GTP H;  1X56 A;  3PUW A;  4APV A;  1V9P A;  5C4J H;  4BBR H;  1JE5 A;  1P8L A;  3UE1 A;  4DNI A;  4HID A;  1VQM A;  2CFM A;  2Z6K A;  4LF6 Q;  5HGQ A;  4A3J H;  4POF A;  3K7A H;  3PUY A;  1PH5 A;  4LFA L;  3BZC A;  3ULJ A;  4BY7 G;  4BY7 H;  1UE6 A;  3ULL A;  1Z47 A;  1NY4 A;  1X9N A;  1QVG A;  2UXD Q;  1C9O A;  2N78 A;  3UDG A;  4NXM L;  2F4V L;  3S16 H;  4OWT B;  4J15 A;  3I4N G;  2NZO A;  4LF7 L;  4HJA A;  3PCO B;  2F4V Q;  4WJ4 A;  3KJP A;  1KL9 A;  3GTO H;  4B3T L;  4JI2 L;  4GNX B;  4A3K H;  4DV0 Q;  4IPC A;  2ZJR A;  2I0Q A;  4FDB A;  4LUO A;  1TWF H;  2L15 A;  1PH6 A;  5IYB G;  3M4O H;  2YV5 A;  4LW1 A;  2PMZ E;  1CSP A;  1PA6 A;  4DV2 Q;  2HIV A;  4DUZ Q;  1C7Y A;  4JYA Q;  1NMG A;  1YZ6 A;  2H5X A;  1VQA A;  1BKB A;  1XTD A;  2UUB L;  5C3E H;  4P74 A;  1TWC H;  5DLQ E;  2QGQ A;  3I56 A;  2JA6 G;  3CC4 A;  1EYG A;  4GN4 B;  4IPG A;  3KF8 B;  3VDY A;  2NVQ H;  4GOP A;  4JI5 L;  2CQO A;  3A5Z B;  4A93 H;  3CQZ H;  4O2D A;  5LMN W;  5GAD C;  2Y0S G;  5AJ3 Q;  1MIU A;  4JI5 Q;  4GS3 A;  4OXP A;  4A4I A;  5FJ8 G;  3T1Y Q;  3U50 C;  1CKM A;  5JJK A;  4DR2 L;  3TEH B;  2MFI A;  3DM3 A;  2K75 A;  5IP9 H;  2VY3 A;  1TXY A;  4X66 L;  1H95 A;  1VCI A;  3L7Z C;  3CF5 A;  2VW9 A;  4NXM Q;  1Q1E A;  3UDF A;  2BA1 A;  4LF7 Q;  1LTL A;  4DK6 C;  1IBK L;  4LF4 L;  2NZH A;  2XTI A;  3GO5 A;  3U4V A;  4LFA Q;  3HOZ H;  4KI0 A;  1XMO L;  3TQY A;  1WI5 A;  4LF4 Q;  2MQH A;  4EQ5 A;  3GTM H;  2UXD L;  4IOC A;  3TRZ A;  5C0X J;  1JJC B;  2Z0S A;  2ZTC A;  1N34 L;  4LWC A;  1FGU A;  2YTV A;  5M3F H;  2VS1 A;  4DR7 L;  1RIP A;  2JJQ A;  3K7U C;  1R9T H;  4QY7 A;  1VQI A;  1V43 A;  2MNA A;  4DV2 L;  2JA8 G;  1PH1 A;  3FKI H;  2JA9 A;  3HOW G;  4JBW A;  2E2H H;  3PUX A;  4B3M Q;  1ASZ A;  5IP7 G;  1WCM H;  2OCE A;  5FJ8 H;  3W1B A;  5FLX c;  1HNX Q;  1ASY A;  1VQH A;  4KHP Q;  3BZK A;  1EQR A;  1HJP A;  1AE2 A;  3CC7 A;  1MJC A;  1AH9 A;  2ALY B;  4AH6 A;  3CCM A;  4KHP L;  4BY1 H;  1VS0 A;  1HZ9 A;  4A3L H;  3F8T A;  3M9B A;  3RR5 A;  4DAY B;  3I4O A;  3T1H Q;  3PF5 A;  1PH8 A;  2BA0 A;  1T9H A;  4A3D G;  2UUC Q;  5JEA J;  3CC2 A;  1G29 1;  3G71 A;  1KD1 C;  3BU2 A;  5IYD H;  3CD6 A;  3E9H A;  2KBN A;  3FP9 A;  1JJ2 A;  2IX0 A;  3STB D;  4DKA C;  1IBL Q;  3A5U A;  1HH2 P;  2WFW A;  2WB1 E;  4GKK Q;  1QVC A;  5M3F G;  2AWO A;  2CWA A;  2B63 G;  2OQ0 A;  4NXN Q;  4LUZ A;  1YHB A;  3S14 H;  3L0O A;  2ZM6 L;  2JA7 H;  5BR8 L;  5C4X G;  4B3S Q;  1NBW A;  4BBS H;  3SGI A;  3WWV A;  4DR5 L;  3OYY A;  3HOY G;  2CKZ B;  4KLK A;  1VQO A;  1K0R A;  3HOV H;  1XJV A;  3M7N A;  4HJ7 A;  1PFS A;  2NVT H;  3TS2 A;  3IRB A;  4XIG S;  3JAM i;  4MZ9 A;  3E9I A;  3CCV A;  4HIK A;  4K0K L;  4DUY Q;  1LUZ A;  4A3D H;  4DUZ L;  2NN6 I;  1VQK A;  1FVI A;  2IT1 A;  4A3G H;  1XNR L;  4JYA L;  1N36 Q;  1HNX L;  4R4O A;  3CCJ A;  1S3O A;  1K73 C;  1WJJ A;  2WAQ E;  1HR0 W;  4X65 L;  4YCV A;  5ELN A;  3F2C A;  2QEX A;  1I5F A;  1OXT A;  1VQL A;  1IYJ B;  3I2Z A;  2D0O A;  2K4K A;  2R7Z H;  4P73 A;  3RZD H;  2HIX A;  1N32 L;  2ZJQ A;  1PYB A;  1NMF A;  5AJ3 L;  2HHH Q;  4JV5 Q;  2UXB L;  2R7D A;  4LF9 Q;  3CMA A;  1M90 C;  3EIV A;  1SE8 A;  1EOV A;  3ER0 A;  4A3B H;  2UXC L;  1WOC A;  3RN5 A;  1Q1B A;  2BH8 A;  1K3R A;  1QUQ B;  4OX9 Q;  1XNQ Q;  3F2B A;  4GOP C;  2JEA I;  4JI0 Q;  1EWI A;  4IFD J;  4NXN L;  4L5T A;  2VQE Q;  1YJW A;  1K8G A;  1I94 Q;  4X64 Q;  4AQY Q;  1X3E A;  2NN6 G;  2VQE L;  1VQG A;  1PH7 A;  4DR5 Q;  4A3G G;  1D8L A;  2Q2T A;  1UE5 A;  3GTG H;  4YCU A;  1IXR A;  3S1M H;  2FXQ A;  3AYH B;  3LGJ A;  3PV0 A;  3J80 c;  4DV4 Q;  1HNZ Q;  2VQF L;  3EBE A;  3RZO H;  4JI6 L;  2PQA B;  3HOU G;  3M4Q A;  1OXX K;  1YJ9 A;  1JJG A;  2LXJ A;  4LF6 L;  1O7I A;  3J7Z C;  4JI7 Q;  2BH2 A;  5C44 H;  3CAM A;  4A3E G;  5C44 G;  1JMC A;  1N33 Q;  4BA2 I;  2JA7 G;  1KIX A;  4TVA B;  4PG3 A;  4LF8 L;  1XPU A;  4X65 Q;  4IOA A;  1KQS A;  1HZA A;  4A3B G;  3CCQ A;  1L0W A;  5LMU L;  1SMX A;  4A3J G;  4POG A;  3RNU A;  4YY3 Q;  4DAM A;  4P75 A;  1UEB A;  3NEL A;  4A75 A;  4UP9 A;  2YTX A;  4X62 Q;  5ELO A;  4EX5 A;  3CCS A;  4JG2 A;  5K36 G;  4UPA A;  1B70 B;  1QZG A;  3ULP A;  2AMC B;  5GAG C;  1HNW Q;  1TWA H;  2EQS A;  4JC0 A;  2HHH L;  4JV5 L;  4A3L G;  4DR7 Q;  1A0I A;  1YVC A;  1GM5 A;  4MNO A;  3HOX H;  4GKK L;  1PH2 A;  2GN5 A;  4HJ9 A;  1GVP A;  3A74 A;  3CPF A;  4GLX A;  2JA6 H;  4C3H H;  5IYD G;  2CWP A;  2UXC Q;  3RLF A;  4DV1 Q;  4DV7 L;  2NVX H;  4OX9 L;  4B3R L;  2C35 B;  4GNX A;  3J7A 5;  4YWL A;  2UU9 Q;  3AFQ A;  1XPR A;  3PO3 G;  2B29 A;  4JI3 L;  5LMN Q;  3H3V H;  4WJ3 M;  4PZ7 A;  3FKI G;  4C3J H;  1EIF A;  1HZB A;  1SN8 A;  4R1J A;  4JI8 Q;  4BBR G;  1YJN A;  2OTL A;  1PH3 A;  2PI2 E;  4P71 A;  2Z6K C;  3KF6 A;  1VQ4 A;  1E7Z A;  4DV3 Q;  1JB7 A;  4BA1 I;  3KOJ A;  4DUY L;  4A3K G;  1QVF A;  4Y52 H;  3HKS A;  2KHJ A;  5M5W H;  2JE6 I;  4MTN A;  3J80 i;  2Q2I A;  4BXX H;  4QJF A;  1EIY B;  2B3G A;  1BVS A;  2Y0S E;  1HR0 Q;  2YTY A;  4X66 Q;  1AE3 A;  2F52 A;  3K8A A;  4QIW E;  2ZTD A;  1YBY A;  2RCN A;  2RHQ B;  1WYD A;  2JA5 G;  5LMU Q;  1SRU A;  2UXB Q;  2Q2H A;  3GD7 A;  1YNX A;  5IY0 A;  3OTO L;  2MO0 A;  1VQB A;  5M5Y H;  5JJL A;  1SRO A;  4B3M L;  4A3E H;  1N34 Q;  3AEV A;  1XNQ L;  1YIT A;  3STB C;  2IHE A;  4DV0 L;  1A63 A;  1Y14 B;  3S1Q H;  3S2D H;  3NEM A;  4UP8 A;  1XPO A;  1MJE A;  1OXV A;  4AYB E;  4UP7 A;  2WAQ G;  1XNR Q;  2DUD A;  1K9M C;  1X65 A;  1EFW A;  1G51 A;  5IP7 H;  4GKJ Q;  5IYC G;  4QGU A;  1IL2 A;  5M5X H;  4A3C H;  4IJH A;  3J81 j;  1D7Q A;  1SR3 A;  2K5V A;  5M3M H;  4LUV A;  1YI2 A;  5LMN L;  3S15 H;  4Y7N H;  5GAH C;  3T1H L;  2UUA Q;  3S1N H;  4JI8 L;  2YYZ A;  4YWM A;  1Q46 A;  2JEB I;  3HOU H;  1UWV A;  3I4M G;  4RMF A;  1J5E Q;  1JT8 A;  1YHA A;  2IY5 B;  3T1Y L;  2OQK A;  3GTQ H;  4LFC L;  4LF8 Q;  3GTL H;  4DV6 Q;  5IWA Q;  3KYH C;  4DK3 C;  1A62 A;  1IBM Q;  2PNH A;  1IBK Q;  4JBJ A;  1YEZ A;  4DV6 L;  1NE3 A;  1N9W A;  3CCU A;  3HOY H;  3RLN A;  4KHZ A;  1HR0 L;  1KRT A;  2JK8 A;  4PZ8 A;  2EIF A;  1PH4 A;  2CCZ A;  5JJI A;  1WCM G;  4GN3 B;  1E22 A;  4IPH A;  4C2M H;  2OWO A;  4X6A H;  3RLO A;  1VQ7 A;  1B7Y B;  4DR6 Q;  5IYC H;  2K5N A;  2VL6 A;  4OO1 I;  1VQC A;  4DR3 L;  2N3S A;  3GDE A;  4LNQ A;  2KHI A;  4IPD A;  5M3M G;  4YWK A;  1CSQ A;  4L5S A;  2K52 A;  1W2B A;  4R4T A;  2IHF A;  2JA8 H;  4DR1 L;  2JQO A;  3CME A;  4XTC S;  3I4M H;  3KDF A;  4UY8 C;  4YHH Q;  1FJG L;  2DGY A;  2K14 A;  1PV4 A;  3B6Y A;  1V1Q A;  2VZA A;  3CCR A;  3ICE A;  4DV5 L;  1E1O A;  2UUC L;  2K50 A;  2KEN A;  3H0G G;  4L5Q A;  3Q8D A;  1WFQ A;  1NJI C;  3M3Y H;  5HY6 A;  1PVO A;  3PF4 A;  4JI4 Q;  4JOI A;  4LF5 L;  2E2I H;  3L2P A;  4HJ8 A;  4LF9 L;  3CCL A;  3FHW A;  3S1R H;  1Q86 C;  2UUA L;  4PZ6 A;  1I3Q H;  3U58 A;  4JI4 L;  1HNW L;  5FLM G;  2ZTE A;  5IP9 G;  1CKO A;  4BY1 G;  2ID0 A;  2RHS B;  2A19 A;  3EN2 A;  3PGZ A;  1E1T A;  4IO9 A;  2I5L X;  1Q12 A;  4OO1 G;  2ZM6 Q;  1DGS A;  3K81 C;  1L1O C;  3G4S A;  2N49 A;  4GN5 A;  4B3S L;  4JI0 L;  3H15 A;  2ASB A;  4NPS A;  1E3P A;  1X3G A;  2YU9 H;  1I50 H;  3HOX G;  4B3R Q;  5GQO A;  3UE0 A;  1XMO Q;  1I94 L;  3KF6 B;  4AYB G;  1B8A A;  3G6E A;  4R4Q A;  3S2H H;  4A3F G;  2PI2 A;  3CXC A;  5C0X G;  4A3F H;  1YHQ A;  4JI6 Q;  3W5O A;  4JBM A;  2JA5 H;  4DR6 L;  2E5L Q;  1BBW A;  2K5H A;  2R6G A;  5EAY A;  4K0K Q;  1GD7 A;  2VQF Q;  5J3B A;  3S24 A;  1N33 L;  1OTC A;  2E5L L;  1Z9F A;  3HFZ B;  3PO2 H;  1CUK A;  3CCE A;  2D0P A;  3H0G H;  5GRO A;  3GTJ H;  4HIO A;  1K8A C;  4BBS G;  3PIP A;  2QA4 A;  2EXD A;  4QL5 A;  1XMQ L;  1N8R C;  1FJG Q;  1X3F A;  4DR4 L;  1L1O A;  2RF4 A;  3UDX A;  2Q2U A;  3TS0 A;  4IFD I;  4ALP A;  3A0J A;  2A1A A;  3J81 i;  1Y1V H;  4IJL A;  3I4N H;  1VQE A;  1X55 A;  3HKZ G;  1EQQ A;  3HOZ G;  1CKN B;  3MXN B;  3KDF B;  1U0L A;  3D0F A;  2R93 G;  4A3C G;  1E24 A;  3J81 c;  1Q7Y C;  5JEA G;  3HOV G;  4AIM A;  4L5R C;  4BXX G;  2VNU D;  4DV5 Q;  4X62 L;  1N32 Q;  2E2J H;  1HZC A;  3OTO Q;  1KAW A;  2GVA A;  4GLA C;  4C3I H;  5C0X I;  1J5E L;  4DPG A;  4GOP B;  1VQ6 A;  2V1C C;  4P72 A;  4PMW A;  4DR2 Q;  4YCW A;  1QUQ A;  4X64 L;  2B63 H;  2UU9 L;  1PH9 A;  3U4Z A;  1VQ9 A;  3H3V I;  5BR8 Q;  3M4P A;  3TRE A;  1IBL L;  3MEF A;  3E0E A;  5C4X H;  2UUB Q;  1KHI A;  1VQN A;  2WB1 G;  4DV1 L;  4DV7 Q;  3ZJY C;  3S17 H;  4R4I A;  2LXK A;  1LYL A;  3PO3 H;  2LSS A;  3HOW H;  2VUM H;  1TWH H;  1UE1 A;  2VUM G;  4IFD G;  2I5M X;  3GTK H;  3F1Z A;  4TQU S;  5FLM H;  3CW2 C;  3UDI A;  1GO3 E;  3NEN A;  2PQA A;  3CPW A;  1Y1W G;  5H1S E;  1EUJ A;  1YIJ A;  1KC8 C;  4ME3 A;  1KXL A;  2R93 H;  3HKZ E;  3ERS X;  1N36 L;  1Q81 C;  1XMQ Q;  1IZ6 A;  4DR1 Q;  1VQ5 A;  4R4C A;  2OTJ A;  1C0A A; 
#chains in the Genus database with same CATH topology
 2ZJP A;  4YY3 L;  1KLU D;  1L1O B;  2A8V A;  1IBM L;  5JPN C;  4HJ5 A;  4IQZ A;  2E8G A;  1QZH A;  4RHS A;  5IGF A;  4K5X A;  1CKN A;  3HZX A;  4JI1 Q;  2HDL A;  1U4M A;  1Q82 C;  1TWG H;  3JAM L;  1IYV A;  1PXU A;  4TRD A;  1WD1 A;  4JI1 L;  1KRS A;  1A8V A;  3E3X A;  4A93 G;  2JA5 B;  3OWE B;  1I4Q A;  3DLL A;  1U5K A;  2FIN B;  4OWW B;  4WRD A;  2ZXR A;  4HSP A;  4NB3 A;  4LFB L;  4HN7 A;  3K5N A;  1SYB A;  1LM0 A;  4JCV E;  5IYB H;  3KJO A;  3W1G A;  4ULL A;  2WAC A;  2A6H D;  1BBU A;  5IE8 A;  2K6A A;  2F0F A;  2F0W A;  1OXU A;  2AKW B;  5ELF A;  1KNA A;  1VQ8 A;  3BDC A;  4A3I H;  1EWH A;  2ES2 A;  1ZXT A;  1V9P A;  1VQM A;  2R93 B;  3UE1 A;  4DNI A;  1WTO A;  4LF6 Q;  1NCV A;  2EYP A;  5IT9 L;  4C2M B;  5EPL A;  3PUY A;  1PH5 A;  4BY7 H;  1UE6 A;  4KV6 A;  1NY4 A;  1X9N A;  3UDG A;  4F7X A;  4LF7 L;  1MBY A;  2F4V Q;  4WJ4 A;  4JI2 L;  4CDF C;  4IPC A;  2I0Q A;  1F2M A;  3HOW B;  3L3O C;  5K36 H;  3QIA A;  2PMZ E;  3K6O A;  4JYA Q;  2F0P A;  2UUB L;  1SYC A;  2WII B;  1TWC H;  5DLQ E;  2JA6 G;  3CC4 A;  2SNS A;  4CJ0 B;  2CQO A;  3CQZ H;  1ESF A;  1MIU A;  4GS3 A;  2KOL A;  1UUP A;  4A4I A;  2E2D C;  1CKM A;  3NBH A;  1T5E A;  4DR2 L;  3TEH B;  2VW9 A;  4DK6 C;  3GO5 A;  3U4V A;  1G2S A;  1QB5 D;  2MQH A;  5ELE A;  3TRZ A;  2Z0S A;  2O4X A;  2PCF B;  1N34 L;  4LWC A;  3A8K E;  1DCZ A;  5K5P A;  2VS1 A;  4DR7 L;  1RIP A;  2RDH A;  2F0N A;  4DV2 L;  4R8I A;  3M4O B;  1PH1 A;  2EVB A;  2JA9 A;  3HOW G;  4L8J A;  4B3M Q;  3PUX A;  1SEB D;  5FO8 B;  1ASZ A;  2WKD A;  1QIL A;  1F77 A;  2OCE A;  2H1E A;  3R8B A;  1HNX Q;  1VQH A;  1EQR A;  1X3P A;  3G6J B;  5KRU A;  3CC7 A;  5JEA H;  3KBX A;  5HUR A;  1D1I A;  3M9B A;  3T1H Q;  4DAY B;  3I4O A;  1PH8 A;  1QCB D;  3T4A C;  4GZY C;  3NSW A;  2PPB C;  3K7A B;  4C3I G;  4ME5 A;  3BU2 A;  4ZRZ A;  3E9H A;  3FP9 A;  2B2V C;  1JJ2 A;  4DKA C;  1I50 B;  1HH2 P;  3CRL C;  4GKK Q;  3S2H B;  3TBI B;  2CWA A;  2B63 G;  2OQ0 A;  1Q8I A;  3E0J A;  1PYW D;  1STG A;  2K5Q A;  5CGK A;  3GTM B;  5C4X G;  2BDO A;  1H9S A;  3P20 A;  2F0M A;  2B2U C;  3HOY G;  1VQO A;  1XJV A;  3M7N A;  4HJ7 A;  2A69 C;  5BN5 A;  3TS2 A;  3JAM i;  5DEH A;  4MZ9 A;  3E9I A;  4HIK A;  1FVI A;  3MC0 B;  5J39 A;  4R4O A;  4C3J B;  4LAA A;  1TS4 A;  2EYF A;  1STH A;  5BN3 A;  1K73 C;  1NSN S;  4DXG A;  3GV6 A;  3MXG A;  4X65 L;  3I2Z A;  2K4K A;  1PYB A;  1NMF A;  1SE2 A;  4F88 A;  1CA6 A;  1SE8 A;  4A3B H;  1NNX A;  4AYB B;  3L9A X;  3RN5 A;  2JEA I;  4JI0 Q;  4HCE A;  2MUY A;  4XT1 B;  2VQE Q;  1YJW A;  2M9V A;  3N52 A;  4AQY Q;  1VQG A;  2WV6 D;  4DR5 Q;  3BZD B;  3U9S A;  2FXQ A;  3LGJ A;  3PV0 A;  4MIU A;  2DNE A;  4IUQ A;  4NW2 A;  4LF6 L;  3J7Z C;  3O13 A;  3HOZ B;  1XYI A;  1W6K A;  1RTO A;  2Z1C A;  3CAM A;  3SR1 A;  4BA2 I;  2JA7 G;  1EEI D;  1D2B A;  1DOM A;  2G5D A;  3TME A;  3N6R A;  2K5W A;  4DK1 A;  2R61 A;  1KQS A;  2RVL A;  1B3A A;  1SMX A;  3DWA A;  1E2V A;  4EGV A;  4DAM A;  3HRZ C;  1JOQ A;  4A75 A;  4DAP A;  4G57 A;  4UP9 A;  4X62 Q;  1JWM D;  5T1G A;  2HQE A;  4JG2 A;  2Z4H A;  1K3B C;  1SE4 A;  4UPA A;  1JOR A;  1B70 B;  3OMC A;  1QZG A;  2RSO A;  1TWA H;  4JV5 L;  4A3L G;  1YVC A;  4FVM A;  3EQL C;  3HOX H;  4GKK L;  1GVP A;  3A74 A;  3GV3 A;  4DV1 Q;  4DV7 L;  2C35 B;  1EYD A;  4YWL A;  2DJG C;  1XPR A;  1Y8O B;  4C3J H;  1HZB A;  1U4L A;  4JI8 Q;  4BBR G;  4KY7 A;  1PRT B;  3J80 L;  1E7Z A;  4DV3 Q;  1JB7 A;  2K04 A;  1QVF A;  4Y52 H;  3NXW A;  4OEM B;  4ABN A;  2KHJ A;  3DEO A;  5C44 B;  5M5W H;  2EXZ A;  3J80 i;  2Q2I A;  2EY6 A;  2Y0S B;  4BXX H;  4ILW A;  2B3G A;  1BVS A;  1HR0 Q;  1GOZ A;  1RF2 D;  4KMU C;  2RHQ B;  1WYD A;  5LMU Q;  2UXB Q;  2Q8R E;  1YNX A;  1SND A;  5IY0 A;  3OTO L;  4ZKC B;  2KA7 A;  2EY1 A;  4ZLT F;  3AEV A;  2PZW A;  1HXY D;  2WKC A;  3MXU A;  5I6Y A;  1GUW A;  3ND8 A;  3QOL A;  1A63 A;  1AN8 A;  1Y14 B;  3FPP A;  1EY7 A;  2IWH A;  4DAV A;  4UP8 A;  5J1Z A;  5EPJ A;  4UP7 A;  2WAQ G;  2A6H C;  1TS5 A;  4K2L A;  1DOL A;  5CC4 A;  1G91 A;  5M3M H;  2VUM B;  4LUV A;  1EY5 A;  5LMN L;  1VF5 C;  3S15 H;  2UUA Q;  3T1H L;  2HCC A;  2YYZ A;  3IFT A;  1B3Q A;  2AUK A;  4IAL A;  2L4N A;  4K5V A;  3I4M G;  4RMF A;  5IGB A;  2EY2 A;  1CHP D;  5DM7 3;  4M8A A;  3GP7 A;  1STE A;  5IWA Q;  3KYH C;  4DK3 C;  1UEA B;  1IBM Q;  1IBK Q;  1SE3 A;  3M4Y A;  1N9W A;  1K83 B;  3NPP A;  4A3I B;  4PZ8 A;  2CCZ A;  3GTQ B;  5JVG 3;  1VQ7 A;  2XWJ B;  4DR6 Q;  1VQC A;  4OO1 H;  5C4X B;  5F2D A;  4YWK A;  2K52 A;  3T56 B;  3CME A;  4DR1 L;  4QUC A;  4YHH Q;  1FJG L;  3CCR A;  4DV5 L;  2RBM A;  3BDO A;  3SE0 A;  4L5Q A;  2KEN A;  5M5X B;  1SYF A;  1NJI C;  4LF5 L;  5FOB B;  1LT4 D;  3MAQ A;  4H13 C;  4PZ6 A;  1I3Q H;  3U58 A;  2L11 A;  3A7L A;  1M8A A;  2ID0 A;  2RHS B;  4Z9C B;  2A19 A;  3PGZ A;  4CBV A;  1DGS A;  4DNR B;  3G4S A;  4B3S L;  3NWT A;  3H15 A;  1WVL A;  1QOH A;  2YU9 H;  1I50 H;  1FGB D;  2EZV A;  4AYB G;  1B8A A;  4O1N A;  4A3F G;  3CXC A;  4NMZ A;  5C0X G;  1YHQ A;  4JI6 Q;  5M9O A;  4FP5 D;  1ZKO A;  4Q0F A;  2KHS A;  2O5J C;  2MGS A;  2VQF Q;  3S24 A;  2VXW A;  2E5L L;  2EPB A;  4CDE C;  3VR4 A;  3CCE A;  5JJZ A;  2D0P A;  1ET9 A;  3H0G H;  1HCZ A;  3GTJ H;  4HIO A;  2AUJ D;  4QL5 A;  4IUU A;  4P2C B;  2RKS A;  3C46 A;  1DON A;  5DNF A;  3A0J A;  5I9P A;  3J81 i;  3I4N H;  3HOZ G;  2BE5 D;  1NR2 A;  2EYH A;  3KDF B;  1ENF A;  3D0F A;  2R93 G;  4RGM A;  1Q7Y C;  2LFN A;  5JEA G;  4L5R C;  2VNU D;  2PW5 A;  1K8O A;  1HZC A;  1JOO A;  1GUN A;  1LTS D;  1J5E L;  1HRJ A;  4YCW A;  2F0K A;  3K58 A;  2B63 H;  2Z8L A;  3IFD A;  1SNC A;  3H3V I;  1IBL L;  3TRE A;  3MEF A;  5C4X H;  1KHI A;  1A2T A;  3ZJY C;  3S17 H;  2LXK A;  1LYL A;  3H09 A;  4HCS A;  1O7Y A;  3HOW H;  1UE1 A;  2VUM G;  3K5M A;  2I5M X;  3F1Z A;  3D8G A;  2PQA A;  3OIQ A;  5H1S E;  1EUJ A;  1KC8 C;  4CJ2 C;  2JA8 B;  2FHT A;  3OWF A;  1Q81 C;  2RDG A;  4DR1 Q;  1XMQ Q;  3R3O A;  4KTA A;  2B2T C;  3I7F A;  4QQB X;  3I3C A;  3VR6 A;  3VYR A;  3K0Y A;  1VQP A;  3TN2 A;  3NQT A;  1J6Q A;  3JAM c;  4DR4 Q;  3BJU A;  2F0H A;  3C3L A;  1NTG A;  1EEF D;  3RN2 A;  3S1R B;  1L2F A;  3F2D A;  4A3I G;  4JBK A;  4A3M G;  1QJO A;  1GKH A;  1I6H H;  2MO1 A;  5GAE C;  1LAC A;  1OXS C;  3PIO A;  5IT9 E;  1LTT D;  4DR3 Q;  3Q6S A;  1J8I A;  2TSS A;  3JAM E;  2KCC A;  1X54 A;  2E76 C;  2IX1 A;  3OW2 A;  2HT1 A;  3D3R A;  1FL0 A;  2WB1 B;  3MZ5 A;  1VQD A;  2ATW A;  5IT9 c;  2R92 H;  2L9H A;  1HNZ L;  2N8N A;  2WAQ B;  4RGT A;  1VQF A;  4QUF A;  1MKH A;  4B9W A;  4H44 C;  4X3S A;  2EYJ A;  1D1K A;  4TKO B;  4LFC Q;  3VA5 A;  2HQL A;  3VR2 A;  3ITP A;  2KCT A;  4BBR H;  1JE5 A;  2Z6K A;  3CHB D;  5EPK A;  4BY7 G;  1S5F D;  2KJX A;  1B9N A;  3ULL A;  1KAB A;  1Z47 A;  4KKT A;  2DJF C;  5IIF A;  3S16 H;  1R4P B;  4J15 A;  3I4N G;  1WTH A;  2EYM A;  1IHZ A;  3MHB A;  5CYU A;  1KL9 A;  3KJP A;  4B3T L;  4XYQ A;  1QWY A;  4GNX B;  4DV0 Q;  2SDF A;  1Y8P B;  2LS0 1;  4FDB A;  3M3Y B;  2F0V A;  2J4X A;  1PDQ A;  1CSP A;  4DUZ Q;  2EYO A;  2NWG A;  1NMG A;  3NWS A;  1VQA A;  1BKB A;  1XTD A;  3MFY A;  4JK1 C;  3I56 A;  1EYG A;  3BG3 A;  5KND A;  2NVQ H;  3A5Z B;  5LMN W;  3H3V C;  2XRS D;  2Z4I A;  1QE6 A;  3T1Y Q;  3RZD B;  2I46 A;  2K32 A;  5FK9 C;  4K8I A;  1L0Y B;  2MFI A;  1A2U A;  3DM3 A;  4IUP A;  2VY3 A;  1TXY A;  2B2Y A;  4IN3 A;  1VCI A;  3L7Z C;  4NXM Q;  1RD9 D;  4LF7 Q;  1LTL A;  2B39 A;  2QIL A;  1DZ1 A;  4LFA Q;  3A8J E;  3Q23 A;  4UDU C;  3GTM H;  4IOC A;  1BBX C;  1FGU A;  4RKL A;  4ZUJ A;  1R9T H;  1VQI A;  1V43 A;  4V0B A;  2MNA A;  5ISR A;  3FEW X;  1SJE D;  4C3J G;  2AQ1 B;  1QG7 A;  1EL0 A;  1GJX A;  2IPK D;  5FJ8 H;  1U4R A;  4HAE A;  1MSH A;  3W1B A;  1EYA A;  5FLX c;  1ASY A;  4KHP Q;  1LT5 D;  5M5Y B;  4EQP A;  1MJC A;  2ZXO A;  2V4D A;  2ALY B;  3CCM A;  1O80 A;  1VS0 A;  3F8T A;  1CT1 D;  2BA0 A;  3SK4 A;  1CFM A;  2CW0 D;  3CC2 A;  1G29 1;  1KD1 C;  4FF1 A;  5IYD H;  1JWS D;  1KDA A;  1STN A;  4WFN 3;  5M3F G;  3S14 H;  3L0O A;  2ZM6 L;  5BR8 L;  1NBW A;  4FF4 A;  3WWV A;  2CKZ B;  1K0R A;  1WTV A;  2NVT H;  3IRB A;  3IAY A;  4IUV A;  1B50 A;  1LUZ A;  4A3D H;  3FDT A;  4DUZ L;  2IT1 A;  1I4R A;  1SDF A;  1VMC A;  1H9R A;  3CCJ A;  2BOS A;  1C8C A;  1HR0 W;  3CQZ B;  5ELN A;  3F2C A;  3URY A;  1I5F A;  1OXT A;  1STY A;  1BCP C;  2D0O A;  1N32 L;  3R2T A;  1AZQ A;  2HHH Q;  2UXB L;  2QDL A;  4RGN A;  2R7D A;  4LF9 Q;  3EIV A;  3T16 A;  3ER0 A;  2UXC L;  1WOC A;  4DNT B;  1XNQ Q;  1K3R A;  1QUQ B;  2NYZ D;  3HEJ A;  3F2B A;  1EWI A;  4IFD J;  4L5T A;  2FMC A;  2E75 C;  1K8G A;  1I94 Q;  4X64 Q;  3D6W A;  4XT3 B;  2J7Z A;  2NN6 G;  2B63 B;  4KD3 A;  4A3G G;  1D8L A;  3GTJ B;  2KEC A;  4KD4 A;  3GTG H;  1IXR A;  2PNR C;  3AYH B;  3S1M H;  4DV4 Q;  1HNZ Q;  2B2Y C;  3EBE A;  3RZO H;  4S3S A;  1OXX K;  1JJG A;  2LXJ A;  2FJ2 A;  4JI7 Q;  2CVR A;  1ZEQ X;  1N33 Q;  1JMC A;  2NTS A;  3SXH A;  3UI2 A;  4TVA B;  4PG3 A;  4LF8 L;  3CRK C;  3HOU B;  3CCQ A;  1EZ6 A;  5LMU L;  4A3J G;  4POG A;  3GTL B;  4P75 A;  5ELO A;  1PMR A;  1ET6 A;  4LMQ D;  3ULP A;  2AMC B;  4J6H A;  2PQE A;  1XWE A;  4ODG A;  3BYT B;  2EQS A;  4JC0 A;  5GAG C;  2H4O A;  1F2Z A;  4MNO A;  5FO7 B;  1PH2 A;  3CPF A;  3OOC A;  1MGS A;  4GLX A;  2X6G A;  2NVX H;  1TVX A;  5HGT A;  4GNX A;  3J7A 5;  2E2J B;  1PZK D;  1SNM A;  2UU9 Q;  5COR A;  4CDD C;  5LMN Q;  1D5M C;  4PZ7 A;  3FKI G;  3IKJ A;  5M5W B;  1PLF A;  3D4R A;  1VF7 A;  1PH3 A;  1NR4 A;  3PQI A;  4P71 A;  2Z6K C;  1EU4 A;  1HQM C;  4BA1 I;  4DUY L;  3SDZ A;  3HKS A;  3VYT A;  4QCL A;  4RH6 A;  1R9T B;  5ELD A;  4ZAI A;  2A69 D;  1U4P A;  4QJF A;  2NVT B;  4X66 Q;  1ONL A;  1AE3 A;  2L5T A;  3K8A A;  2E2H B;  5NUC A;  5CV9 A;  3SK6 A;  2MO0 A;  3NE5 B;  1RJT A;  1STA A;  4QB4 A;  5M5Y H;  1SRO A;  4C3H B;  1TR5 A;  2IHE A;  4DV0 L;  1B9M A;  2A6E D;  2XSC A;  3J80 E;  3S1Q H;  3DWP A;  3S2D H;  1XPO A;  1MJE A;  1OXV A;  2DUD A;  1X65 A;  1EFW A;  3R2I A;  1TWG B;  5IP7 H;  4KKS A;  4FXG C;  5JVH 3;  3MTS A;  3J81 j;  3BS1 A;  4ID6 A;  3WDN A;  2CH4 W;  4K6L A;  1A3U A;  1KTK A;  1EFI D;  1Q46 A;  1UWV A;  2C5C A;  4L6T B;  1J5E Q;  1EY9 A;  4NKL A;  1TU2 B;  3T1Y L;  3GTQ H;  4LFC L;  1R4Q B;  4DV6 Q;  1QNK A;  4DU9 A;  5CV5 A;  3HOV B;  4JBJ A;  1YEZ A;  4RHR A;  4V19 0;  4KHZ A;  1PH4 A;  4IPH A;  1MSG A;  4XYO A;  4X6A H;  1I4P A;  2F0S A;  5IYC H;  4DR3 L;  1X32 A;  2KHI A;  3C1F A;  1CSQ A;  3NTH A;  5EBD A;  4R4T A;  1E0B A;  4JVZ A;  4FF2 A;  2JQO A;  3OPO A;  3I4M H;  2DGY A;  4DXF A;  1EU3 A;  4K14 A;  1Y1W B;  3ERQ A;  3ICE A;  1SXT A;  5E4X A;  2UUC L;  2K01 A;  1ML0 D;  3Q8D A;  3A54 A;  1SMY C;  1PVO A;  3PF4 A;  5CMD A;  2EJG C;  2E2I H;  3L2P A;  4JPB W;  3CCL A;  2UUA L;  1HNW L;  2A6E C;  4E6I A;  5FLM G;  2K28 A;  1Q3L A;  2ZTE A;  4IO9 A;  1E1T A;  4OO1 G;  2I5L X;  2ZM6 Q;  3K81 C;  3ZYY X;  2N49 A;  1OO9 B;  3H91 A;  4N8F A;  2ASB A;  2PMZ B;  1I94 L;  1JQY D;  2F0O A;  4K6D A;  3KF6 B;  3G6E A;  2BDN A;  1XMO Q;  4R4Q A;  3S2H H;  1DXM A;  5FO9 B;  2PI2 A;  3MA2 B;  4JBM A;  2EJF C;  3NTI A;  1NUC A;  2MP1 A;  2R6G A;  5EAY A;  4K0K Q;  1Z9F A;  1EY0 A;  1BXT A;  1J9O A;  1IYU A;  5GRO A;  3PIP A;  3AU7 A;  1N8R C;  4DR4 L;  1L1O A;  2Q2U A;  1GHK A;  1T5X D;  4OHJ A;  1Y1V H;  2L1B A;  5D14 A;  1VQE A;  1X55 A;  1EQQ A;  3MXN B;  4DA2 A;  1V1O A;  1JOK A;  1O78 A;  5C0X H;  4GLA C;  1BOS A;  4DPG A;  2V1C C;  4ZUI A;  3H6M A;  4PMW A;  4DR2 Q;  1STB A;  1NAP A;  2B8F A;  1PH9 A;  1VQ9 A;  5BR8 Q;  4OIK A;  2XN9 C;  2UUB Q;  3VYU A;  1CQF A;  4DV1 L;  1EQV A;  4DV7 Q;  3PO3 H;  4XQJ A;  1TY0 A;  5M3M B;  2VUM H;  1TWH H;  4IFD G;  2EY5 A;  4K8J A;  3CW2 C;  3NQI A;  3NEN A;  3CPW A;  4RCO A;  4TSS A;  4FXK C;  3QO2 A;  2B2V A;  4ME3 A;  2Q8I B;  1KXL A;  3HKZ E;  1N36 L;  4HR7 B;  5G3L F;  1IZ6 A;  1TS2 A;  2A74 C;  2G9H D;  5DAU A;  2PZU A;  2D62 A;  4YHH L;  1S5C D;  2N55 A;  4OON A;  1S72 A;  1I6V C;  2JSO A;  1RL2 A;  1UE7 A;  4KK7 A;  4ZCK A;  2GVB A;  1KDC A;  3PSI A;  3KBG A;  1LTI D;  2RQX A;  2I5H A;  3NP8 A;  4K2K A;  4NP5 A;  4RFB A;  3PO2 G;  1IW7 D;  4A3M H;  3G48 A;  4O0A A;  4A3D B;  3CP0 A;  3AQQ A;  3DM1 A;  2X69 A;  1BNZ A;  5EQ0 A;  4A76 A;  5D65 A;  4H02 A;  4B3T Q;  3M85 A;  2DNC A;  1GUS A;  1M1K C;  4L63 B;  3X3M A;  4GKJ L;  1Y1V G;  2F0I A;  1TWF B;  1TT2 A;  2KEE A;  4C1N I;  4DK0 A;  4JI3 Q;  2KUM A;  3S14 B;  3EA6 A;  4JOI C;  2R92 G;  4HIM A;  1IKL A;  4AQY L;  1S40 A;  1W3S A;  4HTH A;  1P16 A;  5A2Q L;  4LFB Q;  2F3I A;  3AB9 A;  5EKL A;  3JC6 6;  5C5L A;  2R7F A;  1PHJ A;  3K80 C;  4JI7 L;  4DV4 L;  2NVY H;  4RG1 A;  4OWX B;  2J0T D;  1EOT A;  1GUO A;  1X56 A;  3PUW A;  1P8L A;  2CFM A;  5HGQ A;  4A3J H;  4POF A;  1TWA B;  3BZC A;  2ZT9 C;  3A8I E;  3HOX B;  1C9O A;  2F4V L;  3EFX D;  4OWT B;  4HJA A;  3M7G A;  4A3M B;  4QMG A;  5A35 A;  4ZYS A;  2ZJR A;  3MWY W;  3J7A V;  2F0D A;  1TWF H;  2L15 A;  4C1N K;  5IYB G;  1ZYR D;  2YV5 A;  4DV2 Q;  5D3I B;  3I91 A;  1JWU D;  5D3D A;  1C7Y A;  1B2T A;  2H5X A;  1HTL D;  4P74 A;  1HA5 A;  2HDM A;  2QGQ A;  4FF3 A;  4PQX A;  2DN8 A;  4WOR A;  4GN4 B;  4J1M A;  4DAY A;  4IPG A;  1G8Z D;  1LAB A;  5LL6 S;  4C3I B;  4GOP A;  4JI5 L;  3QR8 A;  2B2W C;  4A93 H;  3ONA B;  5AJ3 Q;  2Y0S G;  1LTA D;  4I65 A;  3A55 A;  1F9P A;  3U50 C;  3WOF A;  2ICI A;  1CHQ D;  1SFO B;  2M2L A;  5KEE A;  5CV8 A;  1I4X A;  2K75 A;  5IP9 H;  4X66 L;  1WTQ A;  5M3F B;  2B8G A;  1O7Z A;  3CF5 A;  1Q1E A;  3J81 L;  2VB3 X;  4LF4 L;  4XQN A;  3D6C A;  4KI0 A;  1HUM A;  3C2P A;  1WI5 A;  4FO2 A;  4EQ5 A;  2UXD L;  5C0X J;  1JJC B;  1ESR A;  2ZTC A;  1Y8N B;  1Y1V B;  3T13 A;  5M3F H;  3K7U C;  1TY2 A;  1PTO C;  1A3T A;  3HG9 A;  3FKI H;  2E2H H;  3HP3 A;  5IP7 G;  3G7L A;  1HJP A;  1AE2 A;  4U68 A;  2OEO A;  3DUZ A;  4AH6 A;  3MXP A;  3MVV A;  1GHJ A;  4BY1 H;  4KHP L;  1HZ9 A;  4A3L H;  4HMJ A;  3PF5 A;  4A3D G;  1T9H A;  4EQO A;  5JEA J;  1CQV A;  1SNQ A;  4H0L C;  1D5X C;  3CD6 A;  1ZYR C;  2IX0 A;  2PW7 A;  3E5S A;  3STB D;  2NB0 A;  3PIO 3;  3A5U A;  1IBL Q;  1UNS A;  1QVC A;  4X3K A;  2AWO A;  1BQQ T;  1YHB A;  1CZW A;  2JA7 H;  1C48 A;  4B3S Q;  2EJM A;  3J7A F;  2R92 B;  2L55 A;  4B9X A;  4BBS H;  3SGI A;  4DR5 L;  2K1B A;  1EIH A;  4KLK A;  1BR9 A;  2A68 D;  3TDQ A;  1WTW A;  3HOV H;  4CJ1 B;  2JA6 B;  4XIG S;  3CCV A;  1DOK A;  1X3Q A;  4K0K L;  2HD3 A;  1G2T A;  4JYA L;  1VQK A;  2RCF A;  3TSS A;  2FMM A;  5C6A A;  4DN4 M;  1BCP D;  2F4I A;  1WJJ A;  2I07 B;  5I6W A;  2SNM A;  4YCV A;  2QEX A;  1A15 A;  2R7Z H;  2C9O A;  2B2W A;  2HIX A;  3RZD H;  1K28 A;  2ZJQ A;  3OMG A;  4KY5 A;  1V1P A;  5AJ3 L;  3SVM A;  3CMA A;  1LTG D;  1EOV A;  5IGD A;  4O42 A;  4CKB A;  2A5H A;  1LV9 A;  1Q1B A;  4OL7 A;  3VR5 A;  4OX9 Q;  1ILQ A;  4GOP C;  3V96 A;  3OIP A;  1ICW A;  4KN4 C;  1CZG A;  1X3E A;  3KLS X;  3D4D A;  2VQE L;  2IW3 A;  1PH7 A;  4A93 B;  1WTX A;  1SYG A;  2Q2T A;  1H9M A;  1UE5 A;  2K05 A;  3J80 c;  5FLX E;  3T51 B;  5IGC A;  2PQA B;  3HOU G;  4R8N A;  5CV7 A;  3HKZ B;  2BH2 A;  5C44 G;  3MFG A;  4HED A;  1BF4 A;  2MJ8 A;  4XXE A;  4X65 Q;  1XPU A;  1HZA A;  5T1I A;  2O5I C;  3RNU A;  4YY3 Q;  4OGQ C;  3KK7 A;  4IFD H;  3NEL A;  5KNC A;  2YTX A;  5KNB A;  4EX5 A;  3CCS A;  5IGG A;  4MN3 A;  4A3J B;  1FNU A;  1HNW Q;  1B1Z A;  4CKC A;  2HHH L;  1C4Q A;  5EBC A;  4DR7 Q;  1A0I A;  2NVQ B;  4BY1 B;  4N9P A;  1EZ8 A;  3QJY A;  3NUC A;  4HJ9 A;  4X3T A;  4C3H H;  4OX9 L;  1PZI D;  1D6E C;  4B3R L;  3PO3 G;  4WJ3 M;  1EIF A;  3DWQ A;  4R1J A;  1DYQ A;  4C56 C;  2YU9 B;  2QCP X;  3I4M B;  3KOJ A;  4A3K G;  5C3X A;  5FKA C;  2JE6 I;  4MTN A;  1EIY B;  2Y0S E;  4RWS C;  2YTY A;  2F52 A;  4QIW E;  2PO4 A;  1H9J A;  2F0T A;  2F0J A;  1DD2 A;  2RSN A;  1WCM B;  4PMB A;  3LWU A;  1LO5 D;  5JJL A;  5J22 A;  4B3M L;  1N34 Q;  2FFK B;  4ZQ3 A;  1YIT A;  3STB C;  2KCN A;  2CHB D;  2XVS A;  3NEM A;  3X3N A;  1MD2 D;  1XNR Q;  1BDO A;  4U67 3;  4GKJ Q;  3I70 A;  4QGU A;  1IL2 A;  3DMU A;  5KYI A;  2NBF A;  1D7Q A;  1YI2 A;  5GAH C;  3S1N H;  4JI8 L;  1B53 A;  3GTK B;  4YWM A;  2JEB I;  3HOU H;  1JT8 A;  1SNO A;  3FRP B;  4XQQ A;  5L37 A;  1PTO D;  2OQK A;  3I4N B;  4LF8 Q;  4B08 A;  4DV6 L;  3S1N B;  1NE3 A;  1HTP A;  3CCU A;  2A73 B;  4IUR A;  4BS9 A;  3RLN A;  3U9O A;  1KRT A;  2JK8 A;  3S1M B;  1WCM G;  4GN3 B;  1E22 A;  4C2M H;  1B7Y B;  2VL6 A;  2N3S A;  3GDE A;  2K7V A;  5M3M G;  1HUN A;  1S5E D;  1W2B A;  1EY8 A;  4XTC S;  1RDP D;  4A3K B;  4UY8 C;  1HHV A;  3GTO B;  3W2D A;  3C1E A;  4RCN A;  3B6Y A;  1V1Q A;  1SBB B;  2VZA A;  2Z6B A;  2B2U A;  5JPM C;  2MHV A;  3H0G G;  2EYL A;  1RKN A;  2KED A;  1AFP A;  3FPU B;  1WFQ A;  2X6L A;  4I7A A;  1YNN D;  4LF9 L;  3FHW A;  5CBA E;  1S5D D;  4JI4 L;  3Q22 A;  5IP9 G;  1CKO A;  4BY1 G;  3V2T A;  2OXP A;  2R7Z B;  3EN2 A;  2IX3 A;  5COY A;  1L1O C;  1W6J A;  4JI0 L;  1LLR D;  1I4G A;  1PFM A;  3P75 A;  4GN5 A;  4PMC A;  4NPS A;  1E3P A;  1ROD A;  3HOX G;  5GQO A;  1WTP A;  5G3L D;  1KLG D;  1PRT F;  3DEP A;  5JAV A;  3V05 A;  4ZK9 B;  1GD7 A;  2OT2 A;  1OTC A;  1CUK A;  3DHQ A;  2B2T A;  1HFG A;  1K8A C;  3EJI A;  2F3V A;  4BBS G;  1JIC A;  1FJG Q;  1X3F A;  4CDC C;  1YNN C;  2AQ3 B;  3UDX A;  4FYD A;  4IJL A;  1TII D;  3HKZ G;  3SHL A;  1CKN B;  4LJZ C;  1S4Z A;  2K03 A;  3HOV G;  4K5W A;  4YIJ A;  4X62 L;  1N32 Q;  2E2J H;  3OTO Q;  2NVX B;  5TSS A;  4C3I H;  5C0X I;  1VQ6 A;  3OSO A;  4P72 A;  1D5Z C;  4KKU A;  1GUT A;  2EOT A;  3A56 A;  3U4Z A;  2K5D A;  1KNE A;  1EY6 A;  1FNW A;  3E0E A;  3RD4 A;  1VQN A;  1F2Y A;  1H9K A;  2F0U A;  1FR3 A;  1BCP B;  1TKW B;  4HSV A;  3BYY B;  1TWC B;  1JB3 A;  1YIJ A;  4RKB A;  4MHE A;  5E3F A;  3PO2 B;  2F1M A;  3KF8 A;  2OTJ A;  2LY7 A;  1C0A A;  1V8Q A;  2K33 A;  1AEX A;  1LTB D;  2CH4 A;  3P1H A;  1K83 H;  1SLJ A;  3KFU A;  3AFP A;  5CV4 A;  2XGT A;  4MTK A;  3IL8 A;  5C3E G;  1X6O A;  2L12 A;  1PYS B;  3S2D B;  1EWC A;  2F0L A;  5I9O A;  1SFO H;  3K5L A;  1BUV T;  2R7Z G;  1PTO F;  3MXN A;  4LF5 Q;  4GLV B;  2LMC B;  5E7N A;  4JI2 Q;  4GNX C;  3S15 B;  3I55 A;  1VQJ A;  1EQT A;  1B4O A;  1LTR D;  2F0E A;  3W3A A;  1E2W A;  2WP8 J;  1Y1W H;  2KCM A;  1Z6H A;  3K0X A;  4X3U A;  1Q8K A;  3NK9 A;  1Q90 A;  2AWN A;  1RTN A;  3PUZ A;  3KLW A;  5JJK A;  2AHO B;  1AZP A;  4DV3 L;  2JA7 B;  1G6P A;  3NBH B;  3QB3 A;  3D31 A;  3PUV A;  3DXJ C;  3I90 A;  3CU7 A;  2HUG A;  4I7Z C;  5IWA L;  3RMH A;  3GTP H;  4APV A;  3TP5 A;  1FD7 D;  3AMU A;  1E2Z A;  5C4J H;  2JA8 H;  1BO0 A;  4HID A;  3K7A H;  4LFA L;  1FNV A;  1FYC A;  1DM0 B;  3ULJ A;  1AW7 A;  2LKV A;  1QVG A;  2UXD Q;  2N78 A;  1I6H B;  3HOZ H;  4NXM L;  4OEL B;  2NZO A;  3OW7 A;  4QIW B;  4A3F B;  2HCI A;  3PCO B;  3R93 A;  4EVO A;  2F3W A;  4RGO S;  3GTO H;  1KDB A;  5C3W A;  3MEH A;  4A3K H;  2OF1 A;  5C4H A;  4IZ8 A;  4LUO A;  3PO3 B;  1PH6 A;  3SK8 A;  2F0Q A;  4M1U B;  5CV6 A;  3M4O H;  4LW1 A;  3FKI B;  1PA6 A;  2HIV A;  1SAP A;  1YZ6 A;  5C3E H;  3BVM A;  4N8X 1;  2G9D A;  2Q8T A;  1ICF B;  3GTG B;  1CM9 A;  3HGB A;  3KF8 B;  3QG1 A;  3VDY A;  4G7O C;  4O2D A;  2D2C C;  5GAD C;  4JI5 Q;  4OXP A;  3K59 A;  5FJ8 G;  3RZO B;  3HS0 C;  4XDX A;  4KN7 C;  1RCV D;  4R9W A;  1H95 A;  2NN6 H;  3UDF A;  2BA1 A;  1IBK L;  2NZH A;  2XTI A;  1ENA A;  4PV1 C;  1XMO L;  1JC7 A;  3TQY A;  3I72 A;  4LF4 Q;  3CKI B;  2EE1 A;  4CGY B;  1BCP F;  3HOY B;  1SYD A;  2YTV A;  1PTO B;  3ND9 A;  4JW0 A;  2JJQ A;  4QY7 A;  2JA8 G;  2JXM B;  3GQB A;  4JBW A;  4A3G B;  2RDF A;  1JE4 A;  2D9U A;  1WCM H;  1EYC A;  3BZK A;  2XRQ D;  1SNP A;  2VB2 X;  5C4J B;  1AH9 A;  3GTP B;  2R3Z A;  3RR5 A;  2BE5 C;  2QKI C;  4BY7 B;  4A3B B;  1F9S A;  2UUC Q;  3J81 E;  1JR0 D;  3G71 A;  3ERO A;  1PRT C;  2KBN A;  2JP1 A;  3LWE A;  1IL8 A;  2WFW A;  2WB1 E;  2M00 A;  1B44 D;  2P5Z X;  4NXN Q;  4LUZ A;  5ELB A;  3TP6 A;  2GA4 B;  3OYY A;  4HMI A;  2PZT A;  3PMF A;  5CR3 A;  3VR3 A;  1PFS A;  1WTR A;  1TQO A;  4N9T A;  4G7H C;  5E4W C;  4DUY Q;  4BBR B;  2DY7 A;  2KQ3 A;  2NN6 I;  4A3G H;  2JYO A;  1XNR L;  1N36 Q;  4DFA A;  5BN4 A;  1HNX L;  3FMC A;  1PRT D;  1S3O A;  1F9Q A;  3Q0A A;  2WAQ E;  2SEB D;  2AQ2 B;  4NDX A;  1VQL A;  1IYJ B;  4P73 A;  1VDZ A;  4JV5 Q;  4CHT B;  3FVQ A;  1M90 C;  2MPM A;  1EIG A;  3BVZ A;  5IOD A;  3D4W A;  2BH8 A;  3BDL A;  1CA5 A;  4BWG B;  4NXN L;  5IOC A;  1A3V A;  1XTC D;  3S1Q B;  4UAI A;  2F0G A;  5A2Q E;  4YCU A;  2VQF L;  5ELC A;  4FXD A;  5EKI A;  4JI6 L;  3A7A B;  3M4Q A;  2NUC A;  1YJ9 A;  5I2X A;  3T53 B;  1O7I A;  5KIX A;  2IJ0 A;  2IL8 A;  5C44 H;  4A3E G;  1M4V A;  1KIX A;  4IOA A;  1KAA A;  1IW7 C;  4A3B G;  1L0W A;  2ICE C;  4DGZ A;  3NBI A;  3P7J A;  1UEB A;  4PNY A;  1YNJ D;  1U9R A;  5K36 G;  3RUZ A;  2NTT A;  1K0S A;  3OHX C;  5LL6 X;  4KY6 A;  5CBE E;  4LK1 C;  1V1P B;  3E6Z X;  2DY8 A;  1I3Q B;  1GM5 A;  1HFN A;  1EY4 A;  2GN5 A;  3S16 B;  2ENB A;  2SOB A;  2UXC Q;  2JA6 H;  2NZ1 D;  4J8Q A;  2CWP A;  5IYD G;  3RLF A;  1QNU A;  3AFQ A;  1UAP A;  2B29 A;  4JI3 L;  3H3V H;  1SN8 A;  1YJN A;  3VYS A;  2OTL A;  2PI2 E;  2QEJ C;  3KF6 A;  1VQ4 A;  4WJW A;  3I8Z A;  2EDG A;  3S9W A;  3Q24 A;  4RAU C;  3H0G B;  4G7Z C;  5I4D A;  1VMP A;  3WOE A;  5AFW A;  2E2I B;  3KLR A;  4G4K A;  2XIW A;  4C3H G;  2ZTD A;  1YBY A;  2RCN A;  2JA5 G;  1SRU A;  1RHP A;  2Q2H A;  3GD7 A;  3LX0 A;  3I4L A;  1VQB A;  1SYE A;  3KUP A;  4A3E H;  1JCK B;  1SJH D;  2RA4 A;  1XNQ L;  1XXG A;  2WIN B;  1HQR D;  4AYB E;  5EGT A;  2KVM A;  1II3 A;  1SMY D;  1K9M C;  1G51 A;  4F87 A;  1A6X A;  5IYC G;  2PYK A;  5M5X H;  4A3C H;  4IJH A;  2O2L D;  1YNJ C;  4F8M A;  1SR3 A;  2K5V A;  3F2U A;  3S17 B;  2QF7 A;  4Y7N H;  3BVG A;  3TP8 A;  3K5O A;  5E1F A;  1HPC A;  4QF4 A;  2N88 A;  4FNF A;  1PFB A;  5EKK A;  1F2L A;  1YHA A;  2IY5 B;  5LHY 1;  4Q5V A;  3GTL H;  1A62 A;  1IKM A;  2PNH A;  4Y7N B;  1G6Z A;  3HOY H;  3SEB A;  1HR0 L;  1GUG A;  3VA7 A;  5IGE A;  2EIF A;  5JJI A;  2TMP A;  2OWO A;  3RLO A;  2XNA C;  2K5N A;  4OO1 I;  5I2Y A;  3K57 A;  4LNQ A;  5KGU A;  3J7Y W;  4IPD A;  2Z9H A;  4L5S A;  5FLX L;  1SSO A;  2QDB A;  1F9R A;  2IHF A;  4A3E B;  4CKE A;  2D5D A;  3KDF A;  5KYL A;  4KHV A;  4UHV A;  2K14 A;  2E74 C;  4IUN A;  3TP7 A;  1PV4 A;  4OIJ A;  4KJO A;  1CTM A;  1Y69 U;  1LT3 D;  1ILP A;  1E1O A;  4ZKB B;  2K50 A;  1XX8 A;  1MI2 A;  3M3Y H;  2F03 A;  5HY6 A;  2QW7 A;  4JI4 Q;  4JOI A;  5C3E B;  2XWB B;  4HJ8 A;  3S1R H;  1Q86 C;  1WD0 A;  2NVY B;  1Q12 A;  1O7L A;  1LT6 D;  2BCO A;  1X3G A;  2A68 C;  4B3R Q;  3TZD A;  3UE0 A;  2JN4 A;  1S5B D;  3I73 A;  4A3F H;  1ENC A;  3W5O A;  2JA5 H;  4DR6 L;  3SK5 A;  2E5L Q;  1BBW A;  2CQA A;  2K5H A;  5J3B A;  1N33 L;  3PO2 H;  3HFZ B;  1PFN A;  5C4Z A;  5DM6 3;  1HA6 A;  1CI3 M;  1K8M A;  4KJN A;  2QA4 A;  2EXD A;  3QOJ A;  1DJR D;  3NTK A;  1XMQ L;  3TZU A;  2RF4 A;  1TS3 A;  1PTO H;  3TS0 A;  3LNN A;  2L0C A;  4RA8 A;  4ALP A;  4IFD I;  2A1A A;  1U0L A;  4A3C G;  1E24 A;  3J81 c;  4AIM A;  4BXX G;  4DV5 Q;  1KAW A;  2GVA A;  3EVQ A;  3PIP 3;  1H9S B;  5EJW A;  5JOB A;  4GOP B;  1AP0 A;  1I4H A;  1Z7T A;  4H7B A;  1QUQ A;  1TWH B;  3H94 A;  4IUT A;  1GXD C;  4X64 L;  1MHW C;  2UU9 L;  2CW0 C;  4EQN A;  3M4P A;  2WB1 G;  2ZXP A;  4R4I A;  3KLS A;  5C5M A;  2LSS A;  4DF7 A;  3GTK H;  4TQU S;  5FLM H;  3UDI A;  1GO3 E;  3QWN A;  1Y1W G;  1L0X B;  2R93 H;  1CK1 A;  3ERS X;  4BBS B;  1PZJ D;  1VQ5 A;  4R4C A;  3NHH A; 
#chains in the Genus database with same CATH homology
 2D62 A;  4YHH L;  2ZJP A;  4QQB X;  1K83 H;  1SLJ A;  3I7F A;  4OON A;  4YY3 L;  1S72 A;  1L1O B;  3KFU A;  3AFP A;  2A8V A;  1VQP A;  2XGT A;  1RL2 A;  1UE7 A;  1IBM L;  2GVB A;  1J6Q A;  4HJ5 A;  3JAM c;  3PSI A;  4DR4 Q;  3BJU A;  2E8G A;  5C3E G;  1X6O A;  1QZH A;  1PYS B;  1NTG A;  2I5H A;  3RN2 A;  3PO2 G;  4A3M H;  1L2F A;  3G48 A;  4O0A A;  3F2D A;  4A3I G;  3CP0 A;  3AQQ A;  4A3M G;  1SFO H;  4JBK A;  1GKH A;  2R7Z G;  1I6H H;  1CKN A;  2MO1 A;  4LF5 Q;  4JI1 Q;  5GAE C;  4A76 A;  4GLV B;  1OXS C;  5E7N A;  4H02 A;  1TWG H;  4JI2 Q;  3PIO A;  3M85 A;  4GNX C;  1Q82 C;  3I55 A;  4B3T Q;  1VQJ A;  4JI1 L;  1KRS A;  1A8V A;  4DR3 Q;  4A93 G;  1M1K C;  1X54 A;  2IX1 A;  2WP8 J;  3OW2 A;  1Y1W H;  2HT1 A;  3DLL A;  4GKJ L;  1Y1V G;  1U5K A;  2KCM A;  1FL0 A;  4JI3 Q;  4OWW B;  3K0X A;  4JOI C;  1Q8K A;  2AWN A;  1VQD A;  4NB3 A;  3PUZ A;  5IT9 c;  3KLW A;  2ATW A;  2R92 G;  4HIM A;  2R92 H;  4LFB L;  2AHO B;  4AQY L;  1S40 A;  1HNZ L;  1W3S A;  4JCV E;  1LM0 A;  1P16 A;  2N8N A;  5IYB H;  3KJO A;  4DV3 L;  4LFB Q;  1VQF A;  3W1G A;  2F3I A;  1G6P A;  3JC6 6;  1MKH A;  1BBU A;  2R7F A;  3D31 A;  3NBH B;  3PUV A;  5IE8 A;  1PHJ A;  3K80 C;  4JI7 L;  4DV4 L;  2NVY H;  1OXU A;  4RG1 A;  4LFC Q;  2AKW B;  4OWX B;  5IWA L;  2HQL A;  1VQ8 A;  4A3I H;  2KCT A;  2ES2 A;  3GTP H;  1X56 A;  3PUW A;  4APV A;  1V9P A;  5C4J H;  4BBR H;  1JE5 A;  1P8L A;  3UE1 A;  4DNI A;  4HID A;  1VQM A;  2CFM A;  2Z6K A;  4LF6 Q;  5HGQ A;  4A3J H;  4POF A;  3K7A H;  3PUY A;  1PH5 A;  4LFA L;  3BZC A;  3ULJ A;  4BY7 G;  4BY7 H;  1UE6 A;  3ULL A;  1Z47 A;  1NY4 A;  1X9N A;  1QVG A;  2UXD Q;  1C9O A;  2N78 A;  3UDG A;  4NXM L;  2F4V L;  3S16 H;  4OWT B;  4J15 A;  3I4N G;  2NZO A;  4LF7 L;  4HJA A;  3PCO B;  2F4V Q;  4WJ4 A;  3KJP A;  1KL9 A;  3GTO H;  4B3T L;  4JI2 L;  4GNX B;  4A3K H;  4DV0 Q;  4IPC A;  2ZJR A;  2I0Q A;  4FDB A;  4LUO A;  1TWF H;  2L15 A;  1PH6 A;  5IYB G;  3M4O H;  2YV5 A;  4LW1 A;  2PMZ E;  1CSP A;  1PA6 A;  4DV2 Q;  2HIV A;  4DUZ Q;  1C7Y A;  4JYA Q;  1NMG A;  1YZ6 A;  2H5X A;  1VQA A;  1BKB A;  1XTD A;  2UUB L;  5C3E H;  4P74 A;  1TWC H;  5DLQ E;  2QGQ A;  3I56 A;  2JA6 G;  3CC4 A;  1EYG A;  4GN4 B;  4IPG A;  3KF8 B;  3VDY A;  2NVQ H;  4GOP A;  4JI5 L;  2CQO A;  3A5Z B;  4A93 H;  3CQZ H;  4O2D A;  5LMN W;  5GAD C;  2Y0S G;  5AJ3 Q;  1MIU A;  4JI5 Q;  4GS3 A;  4OXP A;  4A4I A;  5FJ8 G;  3T1Y Q;  3U50 C;  1CKM A;  5JJK A;  4DR2 L;  3TEH B;  2MFI A;  3DM3 A;  2K75 A;  5IP9 H;  2VY3 A;  1TXY A;  4X66 L;  1H95 A;  1VCI A;  3L7Z C;  3CF5 A;  2VW9 A;  4NXM Q;  1Q1E A;  3UDF A;  2BA1 A;  4LF7 Q;  1LTL A;  4DK6 C;  1IBK L;  4LF4 L;  2NZH A;  2XTI A;  3GO5 A;  3U4V A;  4LFA Q;  3HOZ H;  4KI0 A;  1XMO L;  3TQY A;  1WI5 A;  4LF4 Q;  2MQH A;  4EQ5 A;  3GTM H;  2UXD L;  4IOC A;  3TRZ A;  5C0X J;  1JJC B;  2Z0S A;  2ZTC A;  1N34 L;  4LWC A;  1FGU A;  2YTV A;  5M3F H;  2VS1 A;  4DR7 L;  1RIP A;  2JJQ A;  3K7U C;  1R9T H;  4QY7 A;  1VQI A;  1V43 A;  2MNA A;  4DV2 L;  2JA8 G;  1PH1 A;  3FKI H;  2JA9 A;  3HOW G;  4JBW A;  2E2H H;  3PUX A;  4B3M Q;  1ASZ A;  5IP7 G;  1WCM H;  2OCE A;  5FJ8 H;  3W1B A;  5FLX c;  1HNX Q;  1ASY A;  1VQH A;  4KHP Q;  3BZK A;  1EQR A;  1HJP A;  1AE2 A;  3CC7 A;  1MJC A;  1AH9 A;  2ALY B;  4AH6 A;  3CCM A;  4KHP L;  4BY1 H;  1VS0 A;  1HZ9 A;  4A3L H;  3F8T A;  3M9B A;  3RR5 A;  4DAY B;  3I4O A;  3T1H Q;  3PF5 A;  1PH8 A;  2BA0 A;  1T9H A;  4A3D G;  2UUC Q;  5JEA J;  3CC2 A;  1G29 1;  3G71 A;  1KD1 C;  3BU2 A;  5IYD H;  3CD6 A;  3E9H A;  2KBN A;  3FP9 A;  1JJ2 A;  2IX0 A;  3STB D;  4DKA C;  1IBL Q;  3A5U A;  1HH2 P;  2WFW A;  2WB1 E;  4GKK Q;  1QVC A;  5M3F G;  2AWO A;  2CWA A;  2B63 G;  2OQ0 A;  4NXN Q;  4LUZ A;  1YHB A;  3S14 H;  3L0O A;  2ZM6 L;  2JA7 H;  5BR8 L;  5C4X G;  4B3S Q;  1NBW A;  4BBS H;  3SGI A;  3WWV A;  4DR5 L;  3OYY A;  3HOY G;  2CKZ B;  4KLK A;  1VQO A;  1K0R A;  3HOV H;  1XJV A;  3M7N A;  4HJ7 A;  1PFS A;  2NVT H;  3TS2 A;  3IRB A;  4XIG S;  3JAM i;  4MZ9 A;  3E9I A;  3CCV A;  4HIK A;  4K0K L;  4DUY Q;  1LUZ A;  4A3D H;  4DUZ L;  2NN6 I;  1VQK A;  1FVI A;  2IT1 A;  4A3G H;  1XNR L;  4JYA L;  1N36 Q;  1HNX L;  4R4O A;  3CCJ A;  1S3O A;  1K73 C;  1WJJ A;  2WAQ E;  1HR0 W;  4X65 L;  4YCV A;  5ELN A;  3F2C A;  2QEX A;  1I5F A;  1OXT A;  1VQL A;  1IYJ B;  3I2Z A;  2D0O A;  2K4K A;  2R7Z H;  4P73 A;  3RZD H;  2HIX A;  1N32 L;  2ZJQ A;  1PYB A;  1NMF A;  5AJ3 L;  2HHH Q;  4JV5 Q;  2UXB L;  2R7D A;  4LF9 Q;  3CMA A;  1M90 C;  3EIV A;  1SE8 A;  1EOV A;  3ER0 A;  4A3B H;  2UXC L;  1WOC A;  3RN5 A;  1Q1B A;  2BH8 A;  1K3R A;  1QUQ B;  4OX9 Q;  1XNQ Q;  3F2B A;  4GOP C;  2JEA I;  4JI0 Q;  1EWI A;  4IFD J;  4NXN L;  4L5T A;  2VQE Q;  1YJW A;  1K8G A;  1I94 Q;  4X64 Q;  4AQY Q;  1X3E A;  2NN6 G;  2VQE L;  1VQG A;  1PH7 A;  4DR5 Q;  4A3G G;  1D8L A;  2Q2T A;  1UE5 A;  3GTG H;  4YCU A;  1IXR A;  3S1M H;  2FXQ A;  3AYH B;  3LGJ A;  3PV0 A;  3J80 c;  4DV4 Q;  1HNZ Q;  2VQF L;  3EBE A;  3RZO H;  4JI6 L;  2PQA B;  3HOU G;  3M4Q A;  1OXX K;  1YJ9 A;  1JJG A;  2LXJ A;  4LF6 L;  1O7I A;  3J7Z C;  4JI7 Q;  2BH2 A;  5C44 H;  3CAM A;  4A3E G;  5C44 G;  1JMC A;  1N33 Q;  4BA2 I;  2JA7 G;  1KIX A;  4TVA B;  4PG3 A;  4LF8 L;  1XPU A;  4X65 Q;  4IOA A;  1KQS A;  1HZA A;  4A3B G;  3CCQ A;  1L0W A;  5LMU L;  1SMX A;  4A3J G;  4POG A;  3RNU A;  4YY3 Q;  4DAM A;  4P75 A;  1UEB A;  3NEL A;  4A75 A;  4UP9 A;  2YTX A;  4X62 Q;  5ELO A;  4EX5 A;  3CCS A;  4JG2 A;  5K36 G;  4UPA A;  1B70 B;  1QZG A;  3ULP A;  2AMC B;  5GAG C;  1HNW Q;  1TWA H;  2EQS A;  4JC0 A;  2HHH L;  4JV5 L;  4A3L G;  4DR7 Q;  1A0I A;  1YVC A;  1GM5 A;  4MNO A;  3HOX H;  4GKK L;  1PH2 A;  2GN5 A;  4HJ9 A;  1GVP A;  3A74 A;  3CPF A;  4GLX A;  2JA6 H;  4C3H H;  5IYD G;  2CWP A;  2UXC Q;  3RLF A;  4DV1 Q;  4DV7 L;  2NVX H;  4OX9 L;  4B3R L;  2C35 B;  4GNX A;  3J7A 5;  4YWL A;  2UU9 Q;  3AFQ A;  1XPR A;  3PO3 G;  2B29 A;  4JI3 L;  5LMN Q;  3H3V H;  4WJ3 M;  4PZ7 A;  3FKI G;  4C3J H;  1EIF A;  1HZB A;  1SN8 A;  4R1J A;  4JI8 Q;  4BBR G;  1YJN A;  2OTL A;  1PH3 A;  2PI2 E;  4P71 A;  2Z6K C;  3KF6 A;  1VQ4 A;  1E7Z A;  4DV3 Q;  1JB7 A;  4BA1 I;  3KOJ A;  4DUY L;  4A3K G;  1QVF A;  4Y52 H;  3HKS A;  2KHJ A;  5M5W H;  2JE6 I;  4MTN A;  3J80 i;  2Q2I A;  4BXX H;  4QJF A;  1EIY B;  2B3G A;  1BVS A;  2Y0S E;  1HR0 Q;  2YTY A;  4X66 Q;  1AE3 A;  2F52 A;  3K8A A;  4QIW E;  2ZTD A;  1YBY A;  2RCN A;  2RHQ B;  1WYD A;  2JA5 G;  5LMU Q;  1SRU A;  2UXB Q;  2Q2H A;  3GD7 A;  1YNX A;  5IY0 A;  3OTO L;  2MO0 A;  1VQB A;  5M5Y H;  5JJL A;  1SRO A;  4B3M L;  4A3E H;  1N34 Q;  3AEV A;  1XNQ L;  1YIT A;  3STB C;  2IHE A;  4DV0 L;  1A63 A;  1Y14 B;  3S1Q H;  3S2D H;  3NEM A;  4UP8 A;  1XPO A;  1MJE A;  1OXV A;  4AYB E;  4UP7 A;  2WAQ G;  1XNR Q;  2DUD A;  1K9M C;  1X65 A;  1EFW A;  1G51 A;  5IP7 H;  4GKJ Q;  5IYC G;  4QGU A;  1IL2 A;  5M5X H;  4A3C H;  4IJH A;  3J81 j;  1D7Q A;  1SR3 A;  2K5V A;  5M3M H;  4LUV A;  1YI2 A;  5LMN L;  3S15 H;  4Y7N H;  5GAH C;  3T1H L;  2UUA Q;  3S1N H;  4JI8 L;  2YYZ A;  4YWM A;  1Q46 A;  2JEB I;  3HOU H;  1UWV A;  3I4M G;  4RMF A;  1J5E Q;  1JT8 A;  1YHA A;  2IY5 B;  3T1Y L;  2OQK A;  3GTQ H;  4LFC L;  4LF8 Q;  3GTL H;  4DV6 Q;  5IWA Q;  3KYH C;  4DK3 C;  1A62 A;  1IBM Q;  2PNH A;  1IBK Q;  4JBJ A;  1YEZ A;  4DV6 L;  1NE3 A;  1N9W A;  3CCU A;  3HOY H;  3RLN A;  4KHZ A;  1HR0 L;  1KRT A;  2JK8 A;  4PZ8 A;  2EIF A;  1PH4 A;  2CCZ A;  5JJI A;  1WCM G;  4GN3 B;  1E22 A;  4IPH A;  4C2M H;  2OWO A;  4X6A H;  3RLO A;  1VQ7 A;  1B7Y B;  4DR6 Q;  5IYC H;  2K5N A;  2VL6 A;  4OO1 I;  1VQC A;  4DR3 L;  2N3S A;  3GDE A;  4LNQ A;  2KHI A;  4IPD A;  5M3M G;  4YWK A;  1CSQ A;  4L5S A;  2K52 A;  1W2B A;  4R4T A;  2IHF A;  2JA8 H;  4DR1 L;  2JQO A;  3CME A;  4XTC S;  3I4M H;  3KDF A;  4UY8 C;  4YHH Q;  1FJG L;  2DGY A;  2K14 A;  1PV4 A;  3B6Y A;  1V1Q A;  2VZA A;  3CCR A;  3ICE A;  4DV5 L;  1E1O A;  2UUC L;  2K50 A;  2KEN A;  3H0G G;  4L5Q A;  3Q8D A;  1WFQ A;  1NJI C;  3M3Y H;  5HY6 A;  1PVO A;  3PF4 A;  4JI4 Q;  4JOI A;  4LF5 L;  2E2I H;  3L2P A;  4HJ8 A;  4LF9 L;  3CCL A;  3FHW A;  3S1R H;  1Q86 C;  2UUA L;  4PZ6 A;  1I3Q H;  3U58 A;  4JI4 L;  1HNW L;  5FLM G;  2ZTE A;  5IP9 G;  1CKO A;  4BY1 G;  2ID0 A;  2RHS B;  2A19 A;  3EN2 A;  3PGZ A;  1E1T A;  4IO9 A;  2I5L X;  1Q12 A;  4OO1 G;  2ZM6 Q;  1DGS A;  3K81 C;  1L1O C;  3G4S A;  2N49 A;  4GN5 A;  4B3S L;  4JI0 L;  3H15 A;  2ASB A;  4NPS A;  1E3P A;  1X3G A;  2YU9 H;  1I50 H;  3HOX G;  4B3R Q;  5GQO A;  3UE0 A;  1XMO Q;  1I94 L;  3KF6 B;  4AYB G;  1B8A A;  3G6E A;  4R4Q A;  3S2H H;  4A3F G;  2PI2 A;  3CXC A;  5C0X G;  4A3F H;  1YHQ A;  4JI6 Q;  3W5O A;  4JBM A;  2JA5 H;  4DR6 L;  2E5L Q;  1BBW A;  2K5H A;  2R6G A;  5EAY A;  4K0K Q;  1GD7 A;  2VQF Q;  5J3B A;  3S24 A;  1N33 L;  1OTC A;  2E5L L;  1Z9F A;  3HFZ B;  3PO2 H;  1CUK A;  3CCE A;  2D0P A;  3H0G H;  5GRO A;  3GTJ H;  4HIO A;  1K8A C;  4BBS G;  3PIP A;  2QA4 A;  2EXD A;  4QL5 A;  1XMQ L;  1N8R C;  1FJG Q;  1X3F A;  4DR4 L;  1L1O A;  2RF4 A;  3UDX A;  2Q2U A;  3TS0 A;  4IFD I;  4ALP A;  3A0J A;  2A1A A;  3J81 i;  1Y1V H;  4IJL A;  3I4N H;  1VQE A;  1X55 A;  3HKZ G;  1EQQ A;  3HOZ G;  1CKN B;  3MXN B;  3KDF B;  1U0L A;  3D0F A;  2R93 G;  4A3C G;  1E24 A;  3J81 c;  1Q7Y C;  5JEA G;  3HOV G;  4AIM A;  4L5R C;  4BXX G;  2VNU D;  4DV5 Q;  4X62 L;  1N32 Q;  2E2J H;  1HZC A;  3OTO Q;  1KAW A;  2GVA A;  4GLA C;  4C3I H;  5C0X I;  1J5E L;  4DPG A;  4GOP B;  1VQ6 A;  2V1C C;  4P72 A;  4PMW A;  4DR2 Q;  4YCW A;  1QUQ A;  4X64 L;  2B63 H;  2UU9 L;  1PH9 A;  3U4Z A;  1VQ9 A;  3H3V I;  5BR8 Q;  3M4P A;  3TRE A;  1IBL L;  3MEF A;  3E0E A;  5C4X H;  2UUB Q;  1KHI A;  1VQN A;  2WB1 G;  4DV1 L;  4DV7 Q;  3ZJY C;  3S17 H;  4R4I A;  2LXK A;  1LYL A;  3PO3 H;  2LSS A;  3HOW H;  2VUM H;  1TWH H;  1UE1 A;  2VUM G;  4IFD G;  2I5M X;  3GTK H;  3F1Z A;  4TQU S;  5FLM H;  3CW2 C;  3UDI A;  1GO3 E;  3NEN A;  2PQA A;  3CPW A;  1Y1W G;  5H1S E;  1EUJ A;  1YIJ A;  1KC8 C;  4ME3 A;  1KXL A;  2R93 H;  3HKZ E;  3ERS X;  1N36 L;  1Q81 C;  1XMQ Q;  1IZ6 A;  4DR1 Q;  1VQ5 A;  4R4C A;  2OTJ A;  1C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...