1EIGA

Solution structure of the human chemokine eotaxin-2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-2
publication title NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eigA00
1XYIA 2HUGA 4LMQD 2D9UA 1WTXA 2KECA 2X6LA 2L4NA 1PFMA 2JP1A 2BDNA 3DEPA 4ZKBB 3IFDA 2CVRA 1F9SA 2MJ8A 3SVMA 1CA5A 2L11A 5CBAE 4HAEA 4QUFA 4HCSA 3TZDA 3FPUB 3R93A 1EOTA 1EIGA 2IL8A 1ICWA 2EPBA 1PFNA 1GUWA 1DOLA 1A15A 3I3CA 3D6WA 4IUUA 1HHVA 2K28A 1HFGA 2B2UC 1G91A 1TVXA 2DY8A 1O7ZA 2Q8RE 5EKIA 1QE6A 2J7ZA 1F2LA 3I90A 1DONA 4RA8A 5E4WC 3LWEA 5EPLA 4XDXA 2K1BA 2L9HA 4X3SA 1WD0A 3I8ZA 2B2UA 1PDQA 5EPJA 1CA6A 3TN2A 1SSOA 2K03A 5DNFA 4XT3B 1G2SA 1WVLA 1VMPA 1LV9A 1NR2A 1X3PA 1B2TA 1RODA 1M8AA 1ILPA 1VMCA 5EQ0A 4MHEA 4QUCA 5COYA 2KOLA 1HUNA 2B2TA 5T1GA 4NW2A 5T1IA 1WTVA 1HA6A 1BNZA 2KEEA 1S4ZA 2MP1A 1AZQA 1QNKA 1C8CA 3KUPA 2FJ2A 4ZAIA 1HUMA 5CORA 1RJTA 1CM9A 3ONAB 3FDTA 1NR4A 1JICA 1G6ZA 4R9WA 1EIHA 4CJ2C 2L1BA 3DEOA 1ML0D 3QO2A 4IUVA 4X3KA 1WTWA 1QG7A 2FINB 4UAIA 4RWSC 4CJ0B 2RA4A 1IKMA 3GV6A 1DZ1A 1EQTA 3HP3A 1J9OA 2L12A 1X32A 2RSOA 2X6GA 4RAUC 3GV3A 1ESRA 1U4PA 2H1EA 2SDFA 4HEDA 1AZPA 4ZLTF 1WTQA 1MSGA 1RTOA 2HDMA 1XX8A 2B2YC 5D14A 1X3QA 1RHPA 2JYOA 1ILQA 2MGSA 2B2WC 3MWYW 5JJZA 1MI2A 2KEDA 1NCVA 2FFKB 2N55A 1JE4A 1B4OA 2R3ZA 3KBXA 2X69A 5CBEE 2VXWA 4X3TA 1EL0A 1BF4A 4IUTA 3F2UA 1AP0A 1WTOA 1WTRA 3H91A 1KNAA 2Q8TA 2B2WA 1IL8A 5E4XA 1MGSA 1NAPA 2M2LA 1O7YA 3P7JA 1J8IA 2RVLA 2FHTA 1DOMA 5AFWA 4XT1B 2K04A 1U4LA 4ZK9B 1HFNA 2HDLA 2DY7A 1WTPA 2NYZD 3IL8A 4IUPA 2RSNA 1KNEA 2K01A 2XIWA 4HSVA 5CMDA 4R8IA 1B50A 3I91A 1F9PA 2KVMA 2KUMA 4X3UA 5D65A 4MN3A 2EOTA 2FMMA 3MTSA 1BBXC 4CJ1B 3Q6SA 1IKLA 1RTNA 5EJWA 1BO0A 3UI2A 2HCCA 4OIKA 1Q3LA 1PFBA 3DM1A 2MPMA 1PLFA 2B2YA 2B2VC 2HCIA 1ZXTA 1O80A 2N88A 1DOKA 4U68A 2NZ1D 4DN4M 1MSHA 1F9QA 1F9RA 3N52A 4IUQA 5EPKA 1E0BA 4IURA 4ZKCB 1B53A 1U4MA 1U4RA 2NWGA 1SDFA 2K05A 2EE1A 1B3AA 4OIJA 2B2VA 4O42A 1HRJA 2B2TC 1G2TA 3G7LA 1SAPA 1WD1A
chains in the Genus database with same CATH superfamily
1H9SB 1P16A 2WAQB 3MXNB 1VQMA 2JA5B 1TY0A 1VQDA 1YNJC 2X6LA 2B39A 3D4RA 5BN3A 1HZBA 2CVRA 2MJ8A 2PNHA 2PQEA 4C3HG 1K9MC 3R93A 1T5XD 1HJPA 3FKIH 1ICWA 1E22A 1PTOF 1STBA 4JOIA 1A15A 4HJ8A 3S16H 3SDZA 4JYAL 3RZOB 1UEAB 1L1OA 5KNBA 5FOBB 2K1BA 4GLAC 4JI0L 1KIXA 2ICIA 1JC7A 4CBVA 1X55A 4LFCQ 1PH6A 2K52A 3LNNA 1D8LA 1VMPA 4X66Q 1X3PA 1B2TA 3NTIA 3WOFA 1A2TA 3NELA 4YCUA 1Z47A 2G9HD 4UP7A 2B2TA 3J80E 3PQIA 2J4XA 2LY7A 2K14A 4L5QA 3BZCA 2F0VA 4A3MH 1AW7A 2JA7G 1NR4A 1JICA 1OO9B 3NSWA 4DV2L 5IYDG 5IGEA 1KC8C 1DZ1A 4GLXA 2K5QA 1VDZA 3TP8A 3VDYA 4PG3A 2RHSB 1SJHD 3BG3A 3A74A 1X3QA 4BBRH 1HTLD 2B2WC 2V1CC 1K3RA 4LF6Q 3MVVA 2BH8A 1B3QA 2M9VA 5HY6A 5I9OA 4KTAA 4YWLA 4LF5L 5GROA 3CHBD 3GTQB 4KD3A 5LMNL 3J81j 1VCIA 1S5FD 4P75A 4LF4L 3U4ZA 2FMCA 2F52A 3MFYA 4ZK9B 5FJ8H 3K7UC 1KRTA 2NBFA 4DV4Q 4QQBX 2WB1G 3QIAA 2K01A 3L9AX 1FNVA 1QUQB 5A35A 4GN3B 3V2TA 1Y1WH 3UI2A 1FGUA 4L5SA 2NVTB 1Q3LA 1TS2A 1H9RA 4I7ZC 4DGZA 1YJNA 2LFNA 1O80A 1Y1WB 2E74C 3N52A 3CCLA 4OO1H 4I65A 3BZDB 3KOJA 3NTKA 4DUYQ 1PTOC 5E3FA 3HOZH 2DUDA 4S3SA 2VZAA 4A3FB 1I4RA 3NWSA 4G4KA 1WTXA 2KECA 5HGTA 5M5XB 3OW2A 1IBKL 1WFQA 1EY9A 1TS3A 4TVAB 4JI1L 2XGTA 2F0NA 2L15A 4LAAA 1A62A 1VQJA 4QIWE 2MNAA 3RZDB 2IW3A 3GO5A 1EQQA 2B63H 2NVQH 2F0SA 4QUCA 1HNWL 1TWFH 2NN6I 1S5ED 2BCOA 1KDBA 3LGJA 2B63B 3I7FA 2KEEA 1B8AA 3FEWX 3K57A 1C7YA 3VYSA 4FYDA 2QEJC 2VQEQ 3TQYA 4PMCA 4JI8L 3GTLB 1E3PA 5C6AA 1PYWD 3OMCA 5GADC 1DGSA 4FXKC 4LF8Q 3HP3A 1SBBB 2X6GA 4RAUC 1XWEA 5C44B 3S1QH 2L55A 4IFDG 2Z1CA 5D14A 3JAME 4A3LH 1STHA 1BXTA 5J3BA 2CKZB 2EDGA 4PNYA 3K5LA 4NXNL 2FFKB 2N55A 3QWNA 2VNUD 3F2UA 1BCPB 4KKSA 4DV1Q 2UUAQ 5CV9A 2RDFA 2M2LA 4GNXA 4XXEA 3PMFA 4IPHA 1PH8A 3DM3A 2RKSA 5IIFA 1GUOA 5C4HA 4LFAL 5FLMH 3I55A 2QCPX 3V96A 2BE5C 2FMMA 3S15B 2F4VL 2F0DA 4KN7C 1TWGB 4DU9A 5I6WA 1SE3A 5C3EG 4ZQ3A 4JI7L 3S14H 1F9QA 3M85A 4K6LA 1E0BA 2RCNA 5JOBA 4YIJA 1GM5A 2B8GA 1AEXA 1EYAA 2R6GA 1K8MA 4JI2L 2NTTA 3S14B 2ZJPA 5M3MH 1SAPA 5FKAC 4A3EG 3G4SA 4A3CH 1W6JA 1YNXA 4JOIC 4C3JH 3KF6B 4QB4A 5KIXA 4OXPA 3U58A 2IHFA 1PYSB 3J81L 1YZ6A 3FPPA 2F03A 1EY6A 2OTLA 4KKUA 2YTVA 1DOLA 5L37A 2EXZA 2QEXA 3MZ5A 1Q12A 3LWEA 4A3GH 3KLWA 5KNCA 1N34Q 5LMUQ 2E2IB 2HHHL 2ZXRA 4B08A 1Q86C 1WYDA 5IYCH 1I94L 1GHJA 4A3IG 2KHJA 1XNQL 1X54A 1N32Q 5CORA 4IN3A 4KKTA 4HSPA 2L1BA 4AH6A 4ZUJA 4LFBQ 2XSCA 4RGNA 4RHSA 2RA4A 5C5LA 1NBWA 2K75A 4HMIA 5LHY1 5H1SE 1PHJA 1OXSC 3RLFA 1XPRA 4DK6C 2ZM6Q 3MWYW 2MGSA 2VUMH 2UXCQ 3TEHB 3DWPA 5C0XG 3KBXA 2VXWA 1HR0L 4JPBW 4A3KB 2VUMB 4NKLA 4HJ9A 3HOVH 2ALYB 4XQJA 3H15A 5ISRA 3NTHA 4KMUC 1VF7A 2RBMA 2FHTA 1JR0D 2R93B 1UNSA 4HJ5A 1DCZA 2E2DC 4ME3A 4DUZL 3I4MG 2DY7A 4LF7Q 3H0GH 4IUPA 1YNJD 4HSVA 4DV7L 1II3A 1LABA 3Q6SA 3K6OA 4L8JA 4QMGA 1E1OA 1FNWA 2B2YA 1A3UA 4KN4C 2PZTA 2JA6G 1A2UA 1BBUA 2QILA 2CW0C 2LS01 1IBML 4A93B 5JPMC 2F4IA 3PIP3 1L0WA 2K7VA 4JV5L 3SK8A 1KDCA 1EYGA 2KCNA 4K5VA 1LUZA 3S1NH 3CU7A 3NUCA 4RKBA 4QJFA 1HNZL 2K4KA 2F0KA 2LXJA 4BBSH 4UPAA 4GS3A 3DWAA 1AH9A 4DR5Q 3SGIA 1BOSA 4JI5L 2GA4B 4JI6L 4OELB 4BBSB 1FVIA 1O7ZA 1XXGA 3I90A 3OSOA 1OXVA 2TMPA 3J7A5 5G3LD 4RGOS 2PCFB 3DWQA 5I4DA 4K8IA 4GOPA 3QG1A 1Q82C 1KXLA 1VMCA 1LTSD 4GZYC 3NENA 4ZCKA 3U4VA 1LYLA 5EBDA 5C44G 1EFID 1WCMB 2CHBD 3NQIA 1EIHA 2SNMA 4I7AA 3GTOH 1H9MA 4C3HH 1H9KA 2K5HA 3DEOA 5ELCA 3T1HQ 2SEBD 3SK4A 2Z8LA 2E2JH 2FINB 2VQFL 3BVMA 4DR2Q 1XMOQ 3GTOB 1J9OA 2L12A 4C3HB 4HIDA 2UXBQ 3GV3A 3URYA 3TSSA 1MSGA 2F0EA 1RHPA 4A3BB 3S24A 2WKCA 3I70A 5CV4A 4TRDA 4K6DA 1EL0A 4RKLA 2WINB 2IWHA 1VQLA 2IY5B 1GUGA 3HFZB 1X3GA 2WB1E 3ER0A 1G291 1JOKA 2JK8A 1PTOD 1N9WA 3R2IA 1K83B 1UE1A 3R2TA 1OXXK 2JA7H 3OWFA 4LFCL 1U9RA 4R8IA 3HOUG 4X66L 5IYDH 2UU9Q 2CCZA 3SHLA 3WOEA 3NXWA 2E2HB 2HCCA 1N36Q 1T9HA 4R4TA 2NZ1D 1MSHA 4LF9Q 3TS2A 2XWBB 3BDOA 1LLRD 1IYUA 2AUJD 4X64Q 1X3FA 2EJGC 2WFWA 4O42A 4IZ8A 4DV3Q 1CK1A 1ASYA 3GTKH 1MKHA 3A0JA 5CGKA 5CV7A 1QILA 3PO3B 1QJOA 2OEOA 4PZ8A 1GO3E 2EPBA 1YBYA 4LF6L 1HHVA 1H95A 3WWVA 3TP6A 1F2LA 3RR5A 2F1MA 1S5CD 1IL2A 3D8GA 1PH5A 4DA2A 2NB0A 2K03A 5DNFA 5IP7G 5LL6X 4DV4L 1NR2A 4BS9A 1E2ZA 1SYEA 4QY7A 3BDLA 4A3JG 5IP9H 3KDFA 2EJMA 2VB3X 2VB2X 3LX0A 3MHBA 4G7OC 2KCCA 3ZYYX 4YCWA 3GD7A 3EA6A 3SR1A 1LO5D 3DHQA 1WTWA 4UHVA 3HOWG 1IYJB 2F0TA 4A3KG 4DUYL 3HRZC 4MTKA 3W1GA 2WKDA 1TWHH 3PIPA 2RF4A 3DXJC 2JE6I 3K0YA 2F0JA 5M5YH 3CCMA 2QW7A 1XTDA 3HOYG 2ES2A 2F0LA 2BE5D 2F0WA 5NUCA 3PF5A 1FL0A 1OTCA 3G6EA 1TWCH 5BR8Q 2R3ZA 3BU2A 3EBEA 1Z9FA 3K0XA 1M1KC 1BF4A 4B3SQ 4UY8C 1WTOA 1M4VA 1TWCB 1MGSA 3I56A 4N8X1 4AYBG 5AFWA 1VQGA 3M7GA 4WJWA 2RSNA 3DLLA 2QA4A 4B3TQ 4V0BA 3J81E 2OF1A 1KLUD 2IJ0A 1BR9A 2PW5A 1EU3A 3M4YA 1IZ6A 2GVAA 4C1NI 3X3MA 3NQTA 1HNXQ 4X6AH 2A68C 2K5VA 4IPGA 3C1FA 3CPFA 4OHJA 1EY0A 1JMCA 2VL6A 4JVZA 3D4WA 3F2DA 3MAQA 3C46A 1D5XC 2N88A 2VQEL 2ENBA 4CKEA 3RN2A 1JJGA 2NUCA 1EWIA 2HD3A 1F2ZA 1JB7A 4LF8L 2D9UA 4IFDJ 2JP1A 3DEPA 5IYBH 1LACA 2PO4A 4YHHQ 3TZDA 1STGA 4DNTB 3AQQA 1EIGA 1GUWA 4UDUC 1ESFA 4DV1L 2F3VA 2XWJB 3OPOA 1KAWA 1X9NA 1A3VA 2UUAL 4ULLA 1VQOA 3M4OB 1WCMG 1BBWA 1XPOA 2EYJA 3I8ZA 5C3EH 1PDQA 1A63A 2DJGC 1EY8A 5I2YA 4ID6A 1NE3A 3I4NG 2WP8J 5C3EB 1GD7A 3RZOH 4NW2A 1VQ7A 1NTGA 3H3VH 2E76C 4A3EH 2WACA 4G57A 4A3BG 3NBHB 3FDTA 4XQQA 5M3FG 4A3EB 5IY0A 1ML0D 4IUVA 2L5TA 3PUXA 1G8ZD 4C3IB 4JBKA 1S40A 1YJWA 3ERQA 3TREA 1AZPA 4HEDA 4K2LA 3M9BA 1TY2A 4X65Q 4QGUA 1AFPA 1MI2A 1NCVA 2B29A 2F0IA 1VQKA 3J81c 2YTXA 3OYYA 1SXTA 2YTYA 5ELNA 2A6EC 2N78A 3H91A 2Q8TA 2EZVA 5E4XA 4PZ7A 2CW0D 2ZXOA 4CGYB 2JA8G 1MHWC 4A3IH 3EQLC 4DV0Q 2QDLA 1GHKA 4KHVA 1KLGD 4A3IB 1N34L 2K50A 5LMUL 3SXHA 3VYUA 1SEBD 3S2HB 3NK9A 4UP9A 3FMCA 1IBLQ 3I4OA 3GTQH 3FRPB 3PO3G 1N32L 4IPCA 3J7ZC 2YU9B 5I6YA 3F2BA 3BJUA 1SR3A 4LFBL 5C0XH 4HTHA 1ZYRC 3K59A 2R92G 1NSNS 1JOOA 4A3DB 1W2BA 4EGVA 3D0FA 3OIPA 3TBIB 1HZCA 2BDNA 2NVTH 4J15A 2ZM6L 4HAEA 3NHHA 2UXCL 2M00A 3FPUB 5C0XJ 4DKAC 2DY8A 4A3FH 3I4MB 2DNEA 2OT2A 1W6KA 1KTKA 2J7ZA 1U5KA 3K7AH 4KY5A 1DJRD 5EPLA 3Q8DA 5C4XG 4X3SA 2D2CC 3T13A 5EPJA 2RCFA 5M5XH 2I07B 3K7AB 4QF4A 2K5DA 2CQAA 3Q23A 1WVLA 4LF7L 2JA6H 5JJKA 4Y7NB 4RMFA 1HUNA 2HIVA 1PRTB 1YIJA 2JA6B 1I3QH 4CDCC 4OL7A 5FO8B 1F2YA 4ZAIA 1TXYA 4A4IA 3CF5A 3CCRA 1I3QB 3RZDH 3QO2A 5IGCA 4KD4A 2PPBC 3AYHB 4GLVB 1SE8A 1VQPA 4JI4Q 2F0HA 2H1EA 2EYLA 4IPDA 1V1PB 1L2FA 2N49A 1Q8KA 1R4QB 4DR7Q 1OXUA 2KCMA 3MEHA 1TU2B 4Q0FA 4FF1A 1CKOA 1EQRA 2OQKA 4DR5L 4HIOA 3GTLH 1AP0A 1GJXA 4OONA 4CKCA 1X3EA 4N8FA 1X6OA 1VQBA 1J8IA 1L1OB 1V8QA 2EYFA 5C44H 1O7IA 4LNQA 4LW1A 1HFNA 2TSSA 2NYZD 4GN4B 1FGBD 2EQSA 3AFPA 3OIQA 1VQEA 2R7DA 1RF2D 1R4PB 4POGA 2UXDQ 4YWKA 3PV0A 4FF2A 3FHWA 2EY6A 3ND9A 1K3BC 1QOHA 1BCPF 3NE5B 1WOCA 2G9DA 3CCJA 3T1HL 2B2VA 4N9PA 4YWMA 3E0EA 4DR2L 1XMOL 3QR8A 1EZ8A 4LMQD 3S15H 2UXBL 3M4PA 4LWCA 3A7AB 2JA9A 2R7ZG 1TWGH 1F9SA 4MZ9A 3GTGB 4KJOA 5CBAE 1EEID 4YY3Q 1NJIC 4G7ZC 1DD2A 4L6TB 3HOUH 3TP5A 3L0OA 1CFMA 1J5EQ 4F7XA 1FD7D 2PZUA 3GQBA 3A5ZB 4J8QA 3HOUB 1VQ4A 2YV5A 1VQ5A 4DR6Q 2CQOA 2AQ3B 2SOBA 3A8KE 1G2SA 1T5EA 2YYZA 4C3IG 3GTJB 2UU9L 3I2ZA 1EWCA 1YHBA 1TS5A 1PH3A 2G5DA 1KQSA 4B3MQ 1N36L 2RHQB 2WIIB 4NXMQ 3UE0A 1E7ZA 4LF9L 1SE2A 2NVXB 4X62Q 4X64L 5A2QL 2E2IH 2VW9A 4DV3L 1ESRA 1SLJA 3CQZB 2XNAC 1WTQA 3U9SA 2JYOA 1SRUA 4AYBE 1F2MA 1SROA 4IALA 1UUPA 1I4GA 1EWHA 2A68D 1TWAB 1CSQA 2EIFA 2QKIC 5IP7H 4MTNA 1C48A 1SNQA 4CHTB 4DAYA 1EY7A 4DK0A 5FLXc 1GUSA 4A3JH 1OXTA 1NAPA 3S1MB 3P7JA 3KLRA 4RHRA 2B8FA 2K04A 5KYIA 4A3JB 3OOCA 1BCPC 3UE1A 1WTPA 4P73A 5DAUA 1KNEA 5CMDA 1UE7A 4X3UA 2ATWA 1TIID 4A3KH 4A3DG 3S2DB 1SYGA 4OIKA 3EJIA 1LTAD 3HOWB 4BY7G 4AQYQ 2PNRC 1ZXTA 2LXKA 1MIUA 4U68A 1C4QA 2R93H 3QJYA 1FR3A 1U4RA 3J7AF 2XRSD 3HOYB 1G2TA 4E6IA 2MFIA 3BDCA 3H09A 4JBWA 5M9OA 4C56C 3HZXA 4HCSA 3BYTB 1L0XB 1EOTA 2KCTA 3CCEA 5BR8L 3STBD 5FJ8G 1JE5A 4AYBB 1PH4A 4GKKQ 4A93H 4B3SL 2HT1A 1HQRD 1BVSA 1CKNA 1NUCA 4J6HA 4P72A 4GNXB 3UDFA 1CA6A 1BDOA 1HPCA 4F8MA 3IAYA 3M4QA 1ILPA 2VY3A 3ITPA 1A3TA 4B3TL 1XNRQ 2KOLA 1EEFD 1I50B 2HQLA 3IKJA 3J80L 3FVQA 2IT1A 1SMYC 4KV6A 1HNXL 3RMHA 5IGGA 3F1ZA 2A6ED 1RJTA 4JBJA 1PXUA 4RGTA 3OMGA 3D3RA 2C35B 2A19A 2ZTEA 4HJ7A 1P8LA 1AN8A 1VF5C 5FO7B 5IOCA 4KHPQ 1QZHA 3W2DA 5C3XA 1UE5A 1U4PA 1RL2A 3S1RH 5JAVA 4ILWA 4PMBA 4DV6Q 1WCMH 2EJFC 4BY1B 3ND8A 3S17H 1I4QA 4YHHL 5CBEE 3S1RB 4P2CB 2LSSA 3G71A 3I4NH 5EKKA 4PZ6A 3S17B 2E8GA 4EVOA 2CFMA 4RCOA 2E75C 5LL6S 4FXDA 3SEBA 3I4NB 1ZYRD 1YJ9A 5ELDA 3PUZA 3HOXG 3PUWA 4A3BH 3IL8A 5M3FH 1S5BD 4FXGC 3T53B 1Y1VG 1Q7YC 1NNXA 4P71A 1BBXC 1PZJD 5EJWA 1BO0A 1D6EC 5M3FB 1JB3A 4DR1Q 2K6AA 3CRLC 4R4IA 4BA1I 1ICFB 2A6HD 2B2VC 2QF7A 2CH4W 3CCSA 1K83H 1UEBA 1HQMC 2MUYA 1U4MA 5CYUA 3T4AC 4U673 2DJFC 2K32A 2O4XA 2A1AA 3E9IA 4MIUA 4FP5D 3G7LA 5JVG3 3G48A 4MNOA 3VA7A 2E2HH 1PFMA 2AKWB 4R4CA 4BWGB 4K0KQ 4K14A 1VQAA 2F0UA 3GTPB 4X65L 1A8VA 1VS0A 1GXDC 3E9HA 4JBMA 3VR5A 3KYHC 2JEAI 5DM73 3M3YB 3K81C 1YVCA 5KNDA 1A6XA 2KENA 3Q0AA 2K28A 1SFOB 2JA8B 1SE4A 3NEMA 1Q1EA 1TVXA 2PQAA 4H02A 5E4WC 4JG2A 2L9HA 2BOSA 4GKJQ 4XQNA 4G7HC 4DV0L 2CH4A 3PO3H 1STYA 2E5LQ 2PW7A 3A54A 3BS1A 1CT1D 1Y8PB 2MQHA 4EX5A 1WTVA 4JI3Q 1LTID 1IBLL 2JEBI 2DN8A 5FLXL 5CC4A 3ONAB 2R92B 4C3JG 2NN6G 1X65A 2F0FA 3AB9A 3TRZA 1H9SA 4RH6A 1O78A 3MXNA 4HIKA 4K2KA 4EQOA 4WORA 1ONLA 4FVMA 3LWUA 5FK9C 4JC0A 4B3RL 2HDMA 1XX8A 3I4LA 2F0OA 3JAML 1C9OA 2BA1A 3QOJA 4A3GG 2Z4IA 4RG1A 1I4PA 3W3AA 2X69A 3J80i 1EIFA 3PGZA 1SNOA 4OEMB 5C4XB 1GUNA 1K73C 1V43A 4DK1A 1HZAA 1B7YB 3T1YQ 4LK1C 4XT1B 1CI3M 1K8OA 4N9TA 1E2VA 2I5HA 2XIWA 4F88A 4KJNA 4RFBA 5AJ3Q 2KUMA 2N3SA 4GOPB 2DGYA 1RTNA 2EVBA 3E3XA 3HKZG 5D3DA 4O0AA 3AFQA 3D6CA 1JT8A 1EY4A 3H3VI 3CRKC 1CKMA 3D4DA 2JSOA 2Z6KA 1X56A 3NWTA 4J1MA 2I5MX 4QL5A 1RDPD 2HUGA 3HS0C 3MEFA 3PIO3 4JI4L 3HOVG 4K5WA 1O7LA 3GTMB 3SVMA 3CP0A 3GP7A 4DR7L 3MA2B 3HEJA 4TQUS 4BA2I 1LTRD 3VYRA 1PH1A 4EQPA 1PH9A 3NBIA 4IFDH 2C5CA 1QE6A 1I5FA 4M8AA 4HCEA 1WD0A 1SSOA 1QUQA 1NMFA 2FXQA 2EYHA 2AQ1B 1HXYD 1Q8IA 2ZJQA 1Y8NB 4K5XA 4KHZA 4DV5Q 2Q2UA 2JQOA 4ABNA 2UXDL 4WJ4A 1AZQA 3H6MA 4DR4Q 5JEAJ 1CQFA 1HUMA 4OWWB 3M4OH 4IOAA 4NB3A 1JORA 2H4OA 1HZ9A 4YCVA 3CMAA 2R7ZH 4BY1G 5CV6A 5J39A 1KABA 1V1OA 4DAPA 1D5MC 3H94A 2F0MA 1Y69U 2R7ZB 2GN5A 5C0XI 3ULJA 2DNCA 1BCPD 1FYCA 4KY7A 2SDFA 1STAA 1FNUA 1FJGQ 4XIGS 4O2DA 2KEDA 3E6ZX 1JE4A 3K5OA 4YY3L 3K5NA 5EBCA 5GAHC 4IUTA 3STBC 3C1EA 4C3IH 1S3OA 4XTCS 4TKOB 1J5EL 2Q2TA 2F0GA 1DOMA 4OO1I 4DR6L 2AHOB 1PTOH 1B9MA 1MJEA 4CDDC 4DXFA 4R4QA 5D65A 2EOTA 2ZT9C 2NTSA 2V4DA 1PTOB 1B1ZA 3JAMi 3KDFB 2F3IA 1SNPA 1PH7A 2HIXA 4WJ3M 2MPMA 4APVA 3U9OA 4B3ML 3RLNA 3FKIB 2IPKD 5ELEA 3RNUA 3S16B 1STEA 1AE3A 2OTJA 3EROA 4NXML 1B53A 1VQHA 4OIJA 5IWAQ 2EE1A 2Q8IB 2PI2E 1HRJA 4X62L 5F2DA 1YNNC 1XYIA 2EYPA 2A5HA 2C9OA 1N33Q 3S2HH 2EY1A 2L4NA 1JOQA 1V1QA 1MD2D 2OQ0A 2CWPA 3S9WA 2YU9H 1VQ6A 1SMYD 3I3CA 3D6WA 5D3IB 1XJVA 3VR2A 4A3MB 3RN5A 4A3DH 5IE8A 5M5WH 4OX9Q 3X3NA 3EN2A 2XRQD 2EXDA 1LT5D 3TN2A 1VQIA 3CD6A 4BY7H 5M5WB 2XN9C 1CHPD 1LTLA 4B3RQ 3P75A 5EKLA 4PMWA 5C4ZA 3KF8B 1GOZA 4BY7B 3DUZA 3L7ZC 3R3OA 5K5PA 2MO0A 1K8GA 4BBRB 4ZUIA 2MP1A 5CR3A 3TZUA 3I4MH 4H0LC 3KUPA 5DLQE 4LUZA 2A6HC 3A7LA 4AQYL 3T51B 3OW7A 4EQ5A 3MFGA 1H9JA 5IGFA 2K5NA 4H44C 5I9PA 3F2CA 2AUKA 4Y7NH 1SYDA 1X32A 4FF4A 3HG9A 3KF6A 1EIYB 5K36G 4IOCA 4OWTB 1RTOA 3CC7A 3H3VC 1QVFA 3PIOA 5I2XA 1ILQA 1SN8A 2NZOA 2LMCB 4Q5VA 1STNA 3PF4A 1KHIA 4HR7B 1PRTF 1S72A 4GKKL 1KNAA 2IX0A 4DNIA 4PQXA 1RCVD 1TS4A 1B70B 1JWSD 4ZRZA 1CUKA 5IP9G 3IRBA 5E7NA 2UUCQ 4L63B 1IW7C 5IGDA 2J0TD 3OTOQ 3HOZB 2XTIA 3J7AV 4IQZA 4P74A 4MN3A 3KLSA 4DR3Q 2R7FA 1XMQQ 1XNRL 3RUZA 2UUBQ 1J6QA 2Z6KC 3J80c 2Y0SG 2R61A 2D0OA 1MJCA 5IT9L 1DOKA 1K0RA 1SNMA 2ICEC 1I6VC 4OWXB 2JXMB 3ERSX 3PSIA 2Z9HA 4KHPL 1HA5A 1GUTA 2B3GA 3BVZA 4V190 2OXPA 2EY5A 2AWNA 2L11A 4DV6L 4GN5A 3KBGA 3HOXH 2NVQB 1QWYA 2IL8A 1PFNA 3O13A 5FLXE 1KRSA 1TWFB 2ZJRA 1AE2A 2IX1A 1XPUA 2F3WA 5JEAG 2RDGA 3HOXB 4BXXG 1Y1VH 2Q8RE 1JJCB 4NDXA 1DONA 3PO2G 2K33A 3EVQA 4M1UB 2B2UA 2Z0SA 1Y1VB 3GTGH 3KLSX 4K8JA 2KQ3A 4R4OA 3C2PA 3A8JE 4XYOA 3CCQA 1M8AA 4IJHA 2IHEA 2QGQA 1G6PA 2KHSA 2MO1A 2KHIA 3S1QB 5T1IA 1WJJA 1I4XA 1S4ZA 5DEHA 1C8CA 4DR1L 1B44D 1PZID 1TR5A 2A69C 4JK1C 1ENCA 2ZTCA 2PYKA 5IYBG 3ZJYC 1QG7A 1PVOA 1PRTC 1IKMA 1DM0B 1ZKOA 3GV6A 2KA7A 2JN4A 3GTJH 3EFXD 4QIWB 2QDBA 2A73B 3NP8A 1B9NA 4R8NA 2EYOA 2AMCB 4K0KL 1GKHA 2WAQG 2JA5G 5KRUA 4X3TA 4JYAQ 1WTRA 2BH2A 5EGTA 2NVXH 1SYCA 1CHQD 3W5OA 3NPPA 1M90C 4JI0Q 1BKBA 3CQZH 1VQFA 1U4LA 3FKIG 3HGBA 4GKJL 3HKZE 1SYFA 1SNDA 3CAMA 4KY6A 2NN6H 1F9PA 2KVMA 1KDAA 3F8TA 5M3MB 2E5LL 1TWAH 2D62A 1L1OC 1EUJA 4LJZC 4C3JB 3KJOA 4JI3L 3S1MH 1PYBA 2EY2A 4DV2Q 1EFWA 1YHQA 5C3WA 4IURA 4FDBA 4ZKCB 4NMZA 2NWGA 4LUVA 2B2TC 4PV1C 3FP9A 1WD1A 4A3MG 1HCZA 4A3GB 4DNRB 4ZKBB 1NMGA 3S2DH 1EOVA 1HH2P 3R8BA 1EU4A 5LMNW 2Z4HA 3HOWH 3JAMc 3B6YA 2VS1A 4IUUA 1SYBA 4R1JA 4LF5Q 2WV6D 3BYYB 1K28A 2NVYH 1D2BA 1IXRA 1F77A 2D0PA 5LMNQ 3HOYH 4BBRG 4LF4Q 4XDXA 5C5MA 5CV8A 1K8AC 1UWVA 1NY4A 4Y52H 2NVYB 1CSPA 3T1YL 4IUNA 1IYVA 4WRDA 1R9TH 3HKZB 3SK6A 4POFA 1I4HA 5COYA 4ODGA 5AJ3L 3K58A 4IO9A 3I72A 5E1FA 1R9TB 5T1GA 1GVPA 3PCOB 1VQCA 1V9PA 1E24A 2ZTDA 3PUVA 1PH2A 3TMEA 4CJ2C 1Z6HA 2F0PA 3CXCA 4QCLA 3D31A 3HOVB 4LUOA 3RLOA 3AEVA 1Y1WG 1EQTA 4C1NK 3UDGA 1LM0A 1ZEQX 5KYLA 4HJAA 1I50H 4KI0A 3JC66 4DK3C 1ASZA 4A3FG 1CTMA 3KK7A 5HGQA 1IBKQ 3H0GB 4FNFA 5JJZA 4OO1G 3KFUA 1S5DD 3HOZG 1SNCA 1D5ZC 1Q46A 4L5TA 4JI1Q 4OGQC 1IL8A 3ULPA 4UP8A 4FF3A 2RVLA 2K5WA 2D5DA 1XTCD 5JJIA 1D1KA 1LTGD 1YNND 1Q1BA 2HQEA 2L0CA 2GVBA 1B50A 4BY1H 3I91A 1HNWQ 3S1NB 2KJXA 5J1ZA 3A56A 4F87A 4DAMA 4DV5L 1G51A 3N6RA 5CV5A 3GDEA 1IKLA 4CJ1B 1DXMA 1UAPA 1TT2A 3CKIB 1ENFA 5HURA 4O1NA 3J7YW 2OCEA 1KAAA 1PLFA 2HCIA 4DR4L 4NP5A 3T56B 1CQVA 4DN4M 1MBYA 4JI8Q 3C3LA 2B63G 4CDFC 1WI5A 5JVH3 1TKWB 1W3SA 1SDFA 2K05A 2KBNA 1EY5A 3ICEA 1K0SA 3Q22A 3A55A 3IFDA 2I0QA 4NXNQ 5ELBA 1FJGL 3J81i 1IHZA 4A76A 1JWUD 4H13C 4KLKA 3VR3A 1WTHA 1I6HH 1UE6A 5JPNC 1HFGA 2B2UC 3K8AA 1G91A 3P1HA 5EAYA 4DAYB 3KJPA 2F0QA 3RD4A 3L2PA 4A3LG 1N8RC 1QZGA 3QOLA 1I6HB 5GAEC 4LFAQ 3U50C 3I73A 3M7NA 2E2JB 4XT3B 3UDIA 4DFAA 1PV4A 3GTPH 1RD9D 2I46A 2IX3A 1RIPA 3M3YH 1E1TA 1RODA 3EIVA 3AMUA 1QB5D 1E2WA 1TQOA 2BA0A 2F4VQ 1JWMD 4GNXC 1SFOH 2I5LX 2N8NA 4WFN3 1VQ8A 1BNZA 2JA8H 3VR4A 3WDNA 3E0JA 2FJ2A 3UDXA 2PMZE 4JI7Q 5FLMG 1CM9A 5ELFA 4JCVE 4R9WA 1SJED 4ME5A 1YEZA 3VYTA 3AU7A 2ID0A 3CC2A 4XYQA 4UAIA 4RWSC 4JI2Q 1YITA 1IW7D 5IWAL 3P20A 2RSOA 4FO2A 4ZLTF 1N33L 1JCKB 2JA7B 1PMRA 3K5MA 1B4OA 1PZKD 2R92H 1CZWA 2SNSA 5J22A 5M3MG 2PZWA 2Z6BA 5IT9E 2B2WA 2O5IC 4A3CG 3Q24A 1O7YA 4IFDI 5C4JH 5ELOA 5KGUA 3OHXC 4OX9L 3PUYA 1CKNB 2HDLA 3QB3A 5C4JB 2JJQA 2Y0SE 5BN4A 3MXGA 1Q81C 2EYMA 2HHHQ 2ZXPA 4HN7A 4AIMA 3MXUA 1I94Q 3L3OC 3GTKB 1QNUA 5C4XH 1XNQQ 3VR6A 1Q90A 3CW2C 3IFTA 3NBHA 1QVGA 1PFBA 4L5RC 2CWAA 2ASBA 5K36H 1D7QA 4JW0A 1SMXA 1L0YB 2PMZB 3A5UA 1F9RA 4DF7A 5EPKA 3CCUA 2WB1B 1ET6A 3MXPA 1JQYD 5IYCG 1LT3D 4TSSA 2A8VA 4IUQA 4NPSA 3K80C 3W1BA 1HR0W 1BQQT 4B9XA 1QVCA 1YHAA 3SK5A 2RQXA 1LTTD 4EQNA 2OWOA 1CA5A 3TS0A 5DM63 1BUVT 4QUFA 3CC4A 1HR0Q 3SE0A 1QCBD 2LKVA 3E5SA 4CDEC 1KD1C 1Y14B 3CCVA 2A69D 4CKBA 5EKIA 4ZYSA 3A8IE 4RA8A 2VUMG 1PRTD 1HTPA 1YI2A 4DUZQ 4IJLA 4HMJA 2UUCL 1VQ9A 3CMEA 4KK7A 3OTOL 3ULLA 3GTMH 4RGMA 4DV7Q 2RDHA 3DMUA 1LV9A 2NZHA 5JJLA 2R93G 4DPGA 3TDQA 1TWHB 5TSSA 2Y0SB 4MHEA 5EQ0A 4DR3L 1EYCA 2H5XA 5M5YB 1HA6A 4DXGA 1XMQL 2Q2IA 1JJ2A 5IODA 2UUBL 1RKNA 1QNKA 1LT4D 4A75A 4C2MH 3H0GG 4ALPA 2P5ZX 1G6ZA 3G6JB 1IBMQ 3BVGA 2MHVA 5IT9c 4X3KA 4JV5Q 4C2MB 4CJ0B 2Q2HA 2WAQE 5A2QE 4HIMA 1C0AA 3KF8A 4A93G 5JEAH 1EQVA 4BXXH 5BN5A 1PA6A 2B2YC 1HNZQ 3HKSA 2O2LD 5GQOA 3PO2H 2XVSA 2BDOA 1LTBD 2AWOA 1CZGA 4B9WA 4JI5Q 4JI6Q 5G3LF 3PO2B 3VA5A 3TP7A 5GAGC 5FO9B 1VQNA 3V05A 3T16A 3OWEB 4DAVA 2PI2A 2PQAB 1Y8OB 4BBSG 4Z9CB 1LT6D 1D1IA 1EYDA 2AQ2B 5KEEA 4H7BA 1A0IA 5IGBA 3MTSA 1DYQA 3MC0B 4RCNA 1U0LA 1Z7TA 3DM1A 2O5JC 1ET9A 1EZ6A 2A74C 1ENAA 4GOPC 2JA5H 2VQFQ 3BZKA 3CPWA 1B3AA 1PFSA 1KL9A 1V1PA
chains in the Genus database with same CATH topology
1H9SB 2WAQB 2JA5B 1TY0A 2X6LA 1YNJC 2B39A 3D4RA 5BN3A 2CVRA 2MJ8A 2PQEA 4C3HG 3R93A 1T5XD 1ICWA 1PTOF 1STBA 1A15A 3SDZA 3RZOB 1UEAB 5KNBA 5FOBB 2K1BA 2ICIA 1JC7A 4CBVA 3LNNA 1VMPA 1X3PA 1B2TA 3NTIA 3WOFA 1A2TA 1Z47A 2G9HD 2B2TA 3J80E 2J4XA 2LY7A 2F0VA 1AW7A 1NR4A 1JICA 1OO9B 3NSWA 5IGEA 1DZ1A 2K5QA 1VDZA 3TP8A 1SJHD 3BG3A 1X3QA 1HTLD 2B2WC 3MVVA 2M9VA 5I9OA 4KTAA 3CHBD 3GTQB 4KD3A 1VCIA 1S5FD 2FMCA 3MFYA 4ZK9B 2NBFA 3QIAA 2K01A 3L9AX 1FNVA 5A35A 3V2TA 3UI2A 2NVTB 1Q3LA 1TS2A 1H9RA 4I7ZC 4DGZA 2LFNA 1O80A 1Y1WB 2E74C 3N52A 4OO1H 4I65A 3BZDB 3NTKA 1PTOC 5E3FA 4S3SA 4A3FB 1I4RA 3NWSA 4G4KA 1WTXA 2KECA 5HGTA 5M5XB 1EY9A 1TS3A 2F0NA 4LAAA 3RZDB 2IW3A 3GO5A 2F0SA 4QUCA 2NN6I 1S5ED 2BCOA 1KDBA 2B63B 2KEEA 3FEWX 3K57A 3VYSA 4FYDA 2QEJC 4PMCA 3GTLB 5C6AA 1PYWD 3OMCA 4FXKC 3HP3A 1SBBB 2X6GA 4RAUC 1XWEA 5C44B 4IFDG 2L55A 2Z1CA 5D14A 3JAME 1STHA 1BXTA 2EDGA 4PNYA 3K5LA 2FFKB 2N55A 3QWNA 2VNUD 3F2UA 1BCPB 4KKSA 5CV9A 2RDFA 2M2LA 4XXEA 3PMFA 2RKSA 5IIFA 1GUOA 5C4HA 2QCPX 3V96A 2BE5C 2FMMA 3S15B 2F0DA 4KN7C 1TWGB 4DU9A 5I6WA 1SE3A 4ZQ3A 1F9QA 3M85A 4K6LA 1E0BA 5JOBA 4YIJA 2B8GA 1AEXA 1EYAA 2R6GA 1K8MA 2NTTA 3S14B 1SAPA 5FKAC 1W6JA 5KIXA 4QB4A 3J81L 3FPPA 2F03A 1EY6A 4KKUA 1DOLA 2EXZA 3MZ5A 1Q12A 3LWEA 5KNCA 2E2IB 2ZXRA 4B08A 1GHJA 5CORA 4IN3A 4KKTA 4HSPA 2L1BA 4ZUJA 2XSCA 4RGNA 4RHSA 2RA4A 5C5LA 4HMIA 5LHY1 1OXSC 3RLFA 3MWYW 2MGSA 3DWPA 5C0XG 3KBXA 2VXWA 4A3KB 2VUMB 4NKLA 4XQJA 5ISRA 3NTHA 4KMUC 1VF7A 2RBMA 2FHTA 1JR0D 2R93B 1UNSA 1DCZA 2E2DC 2DY7A 4IUPA 1YNJD 4HSVA 1II3A 1LABA 3Q6SA 3K6OA 4L8JA 4QMGA 1FNWA 2B2YA 1A3UA 4KN4C 2PZTA 1A2UA 2QILA 2CW0C 2LS01 4A93B 5JPMC 2F4IA 3PIP3 2K7VA 3SK8A 1KDCA 2KCNA 4K5VA 3CU7A 3NUCA 4RKBA 2F0KA 3DWAA 1BOSA 2GA4B 4BBSB 1O7ZA 1XXGA 3I90A 3OSOA 1OXVA 2TMPA 5G3LD 4RGOS 2PCFB 3DWQA 5I4DA 4K8IA 3QG1A 1VMCA 1LTSD 4GZYC 5EBDA 1EFID 1WCMB 2CHBD 3NQIA 1EIHA 2SNMA 1H9MA 1H9KA 3DEOA 5ELCA 2SEBD 3SK4A 2Z8LA 2FINB 3BVMA 3GTOB 1J9OA 2L12A 4C3HB 3GV3A 3URYA 3TSSA 1MSGA 2F0EA 1RHPA 4A3BB 2WKCA 3I70A 5CV4A 4TRDA 4K6DA 1EL0A 4RKLA 2WINB 2IWHA 1GUGA 1G291 1JOKA 1PTOD 3R2IA 1K83B 3R2TA 1OXXK 3OWFA 1U9RA 4R8IA 3SHLA 3WOEA 3NXWA 2E2HB 2HCCA 2NZ1D 1MSHA 2XWBB 3BDOA 1LLRD 1IYUA 2AUJD 2EJGC 4O42A 4IZ8A 1CK1A 5CGKA 5CV7A 1QILA 3PO3B 1QJOA 2OEOA 2EPBA 1HHVA 3TP6A 1F2LA 2F1MA 1S5CD 3D8GA 4DA2A 2NB0A 2K03A 5DNFA 5LL6X 1NR2A 4BS9A 1E2ZA 1SYEA 3BDLA 2EJMA 2VB3X 2VB2X 3LX0A 3MHBA 4G7OC 2KCCA 3ZYYX 3GD7A 3EA6A 3SR1A 1LO5D 3DHQA 1WTWA 2F0TA 3HRZC 2WKDA 3DXJC 2JE6I 3K0YA 2F0JA 2F0LA 2BE5D 2F0WA 5NUCA 2R3ZA 1BF4A 1WTOA 1M4VA 1TWCB 1MGSA 5AFWA 3M7GA 4WJWA 2RSNA 4V0BA 3J81E 2OF1A 1KLUD 2IJ0A 1BR9A 2PW5A 1EU3A 3M4YA 4C1NI 3X3MA 3NQTA 2A68C 3C1FA 4OHJA 1EY0A 3D4WA 3C46A 3MAQA 1D5XC 2N88A 2ENBA 4CKEA 2NUCA 1F2ZA 2D9UA 4IFDJ 2JP1A 3DEPA 1LACA 2PO4A 3TZDA 1STGA 4DNTB 1EIGA 1GUWA 4UDUC 1ESFA 2F3VA 2XWJB 3OPOA 1A3VA 4ULLA 3M4OB 2EYJA 3I8ZA 1PDQA 1EY8A 5I2YA 4ID6A 2WP8J 5C3EB 4NW2A 2E76C 2WACA 4G57A 3FDTA 4XQQA 4A3EB 1ML0D 4IUVA 2L5TA 3PUXA 1G8ZD 4C3IB 3ERQA 1AZPA 4HEDA 4K2LA 1TY2A 1AFPA 1MI2A 1NCVA 2F0IA 1SXTA 2A6EC 3H91A 2Q8TA 2EZVA 5E4XA 2CW0D 2ZXOA 4CGYB 3EQLC 1GHKA 4KHVA 1KLGD 4A3IB 3SXHA 3VYUA 1SEBD 3S2HB 3NK9A 3FMCA 3FRPB 2YU9B 5I6YA 5C0XH 4HTHA 1ZYRC 3K59A 1NSNS 1JOOA 4A3DB 4EGVA 3OIPA 3TBIB 2BDNA 4HAEA 3NHHA 2M00A 3FPUB 5C0XJ 2DY8A 3I4MB 2DNEA 2OT2A 1W6KA 1KTKA 2J7ZA 4KY5A 1DJRD 5EPLA 4X3SA 2D2CC 3T13A 5EPJA 2I07B 3K7AB 4QF4A 2K5DA 2CQAA 3Q23A 1WVLA 4Y7NB 1HUNA 1PRTB 2JA6B 4OL7A 5FO8B 1F2YA 4ZAIA 1I3QB 3QO2A 5IGCA 4KD4A 2PPBC 2F0HA 2H1EA 2EYLA 1V1PB 1R4QB 1OXUA 3MEHA 4Q0FA 1TU2B 4FF1A 1AP0A 1GJXA 4CKCA 1J8IA 1V8QA 2EYFA 1HFNA 2TSSA 2NYZD 1FGBD 3OIQA 1RF2D 1R4PB 3PV0A 4FF2A 2EY6A 3ND9A 1QOHA 1BCPF 3NE5B 2G9DA 2B2VA 4N9PA 1EZ8A 4LMQD 3A7AB 3GTGB 1F9SA 4KJOA 5CBAE 1EEID 4G7ZC 1DD2A 4L6TB 3TP5A 1CFMA 4F7XA 1FD7D 2PZUA 3GQBA 4J8QA 3HOUB 2AQ3B 2SOBA 3A8KE 1G2SA 1T5EA 2YYZA 4C3IG 3GTJB 1EWCA 1TS5A 2WIIB 1SE2A 2NVXB 5A2QL 1ESRA 3CQZB 2XNAC 1WTQA 3U9SA 2JYOA 1F2MA 4IALA 1UUPA 1I4GA 1EWHA 2A68D 1TWAB 2QKIC 4DAYA 1C48A 1SNQA 4CHTB 1EY7A 4DK0A 1GUSA 1OXTA 1NAPA 3S1MB 3P7JA 3KLRA 4RHRA 2B8FA 2K04A 5KYIA 4A3JB 3OOCA 1BCPC 1WTPA 5DAUA 1KNEA 5CMDA 4X3UA 1TIID 3S2DB 1SYGA 4OIKA 3EJIA 1LTAD 3HOWB 2PNRC 1ZXTA 4U68A 1C4QA 3QJYA 1FR3A 1U4RA 3J7AF 2XRSD 3HOYB 1G2TA 4E6IA 3BDCA 3H09A 4JBWA 5M9OA 4C56C 3HZXA 4HCSA 3BYTB 1L0XB 1EOTA 4AYBB 1HQRD 1NUCA 4J6HA 1CA6A 1BDOA 1HPCA 4F8MA 3IAYA 1ILPA 3ITPA 1A3TA 2KOLA 1EEFD 1I50B 3IKJA 3J80L 3FVQA 2IT1A 1SMYC 4KV6A 3RMHA 5IGGA 2A6ED 1RJTA 1PXUA 4RGTA 3OMGA 3D3RA 1AN8A 1VF5C 5FO7B 5IOCA 3W2DA 5C3XA 1U4PA 5JAVA 4ILWA 4PMBA 2EJFC 4BY1B 3ND8A 1I4QA 3S1RB 5CBEE 4P2CB 5EKKA 3S17B 4EVOA 4RCOA 2E75C 5LL6S 4FXDA 3SEBA 3I4NB 1ZYRD 5ELDA 3PUZA 3PUWA 3IL8A 1S5BD 4FXGC 3T53B 1BBXC 1PZJD 5EJWA 1BO0A 1D6EC 5M3FB 1JB3A 2K6AA 3CRLC 4BA1I 2A6HD 2B2VC 2QF7A 2MUYA 1HQMC 1U4MA 5CYUA 3T4AC 4U673 2K32A 2O4XA 4MIUA 4FP5D 3G7LA 5JVG3 3VA7A 1PFMA 4BWGB 4K14A 2F0UA 3GTPB 1GXDC 3M3YB 2JEAI 3VR5A 5DM73 5KNDA 1A6XA 3Q0AA 1SFOB 2K28A 2JA8B 1SE4A 1Q1EA 1TVXA 5E4WC 2L9HA 2BOSA 4XQNA 4G7HC 1STYA 2PW7A 3A54A 3BS1A 1CT1D 1Y8PB 1WTVA 1LTID 2JEBI 2DN8A 5FLXL 5CC4A 3ONAB 2R92B 4C3JG 2NN6G 2F0FA 3AB9A 1H9SA 4RH6A 1O78A 3MXNA 4K2KA 4EQOA 4WORA 1ONLA 4FVMA 3LWUA 5FK9C 2HDMA 1XX8A 3I4LA 2F0OA 3JAML 2BA1A 3QOJA 2Z4IA 1I4PA 3W3AA 2X69A 1SNOA 5C4XB 1GUNA 1V43A 4DK1A 4LK1C 4XT1B 1CI3M 1K8OA 4N9TA 1E2VA 2XIWA 4F88A 4KJNA 4RFBA 2KUMA 1RTNA 2EVBA 5D3DA 3D6CA 1EY4A 3CRKC 3D4DA 2JSOA 3NWTA 4J1MA 1RDPD 2HUGA 3HS0C 3PIO3 4K5WA 1O7LA 3GTMB 3SVMA 3GP7A 3MA2B 3HEJA 4TQUS 4BA2I 1LTRD 3VYRA 4EQPA 3NBIA 4IFDH 2C5CA 1QE6A 4M8AA 4HCEA 1WD0A 1SSOA 2EYHA 2AQ1B 1HXYD 1Q8IA 1Y8NB 4K5XA 4KHZA 4ABNA 1AZQA 3H6MA 5JEAJ 1CQFA 1HUMA 1JORA 2H4OA 5CV6A 5J39A 1KABA 4DAPA 1V1OA 1D5MC 3H94A 2F0MA 1Y69U 2R7ZB 5C0XI 2DNCA 1BCPD 1FYCA 4KY7A 2SDFA 1STAA 1FNUA 4XIGS 2KEDA 3E6ZX 1JE4A 3K5OA 3K5NA 5EBCA 4IUTA 3C1EA 4XTCS 4TKOB 2F0GA 1DOMA 4OO1I 1PTOH 1B9MA 4DXFA 5D65A 2EOTA 2ZT9C 2NTSA 2V4DA 1PTOB 1B1ZA 1SNPA 2MPMA 3U9OA 3FKIB 2IPKD 5ELEA 3S16B 1STEA 3EROA 1B53A 4OIJA 2EE1A 2Q8IB 1HRJA 5F2DA 1YNNC 1XYIA 2EYPA 2A5HA 2C9OA 2EY1A 2L4NA 1JOQA 1MD2D 3S9WA 1SMYD 3I3CA 3D6WA 5D3IB 3VR2A 4A3MB 3X3NA 2XRQD 1LT5D 3TN2A 5M5WB 2XN9C 1CHPD 3P75A 5EKLA 4PMWA 5C4ZA 1GOZA 4BY7B 3DUZA 3L7ZC 3R3OA 5K5PA 4BBRB 4ZUIA 2MP1A 5CR3A 3TZUA 4H0LC 3KUPA 2A6HC 3A7LA 3T51B 3OW7A 3MFGA 1H9JA 5IGFA 4H44C 5I9PA 2AUKA 1SYDA 1X32A 4FF4A 3HG9A 5K36G 1RTOA 3H3VC 5I2XA 1ILQA 4Q5VA 2LMCB 1STNA 4HR7B 1PRTF 1KNAA 2IX0A 4PQXA 1RCVD 1TS4A 1JWSD 4ZRZA 4L63B 1IW7C 5IGDA 2J0TD 3HOZB 3J7AV 4IQZA 4MN3A 3KLSA 3RUZA 2R61A 5IT9L 1DOKA 1SNMA 2ICEC 1I6VC 2JXMB 1HA5A 1GUTA 3BVZA 4V190 2OXPA 2EY5A 2AWNA 2L11A 3KBGA 2NVQB 1QWYA 2IL8A 1PFNA 3O13A 5FLXE 1TWFB 2IX1A 2F3WA 5JEAG 2RDGA 3HOXB 2Q8RE 4NDXA 1DONA 2K33A 3EVQA 4M1UB 2B2UA 1Y1VB 3KLSX 4K8JA 2KQ3A 3C2PA 3A8JE 4XYOA 1M8AA 2KHSA 3S1QB 5T1IA 1I4XA 1S4ZA 5DEHA 1C8CA 1B44D 1PZID 1TR5A 2A69C 4JK1C 1ENCA 2PYKA 1QG7A 1PRTC 1IKMA 1DM0B 1ZKOA 3GV6A 2KA7A 3EFXD 4QIWB 2QDBA 2A73B 3NP8A 1B9NA 4R8NA 2EYOA 5KRUA 4X3TA 1WTRA 5EGTA 1SYCA 1CHQD 3NPPA 1U4LA 3HGBA 1SYFA 1SNDA 4KY6A 2NN6H 1F9PA 2KVMA 1KDAA 5M3MB 2D62A 4LJZC 4C3JB 2EY2A 5C3WA 4IURA 4ZKCB 4NMZA 2NWGA 2B2TC 4PV1C 1WD1A 1HCZA 4A3GB 4DNRB 4ZKBB 3R8BA 1EU4A 2Z4HA 4IUUA 1SYBA 2WV6D 3BYYB 1D2BA 1F77A 4XDXA 5C5MA 5CV8A 2NVYB 4IUNA 1IYVA 4WRDA 3HKZB 3SK6A 1I4HA 5COYA 4ODGA 3K58A 3I72A 5E1FA 1R9TB 5T1GA 3PUVA 3TMEA 4CJ2C 1Z6HA 2F0PA 4QCLA 3D31A 3HOVB 1EQTA 4C1NK 1ZEQX 5KYLA 4KI0A 1CTMA 3KK7A 3H0GB 4FNFA 5JJZA 4OO1G 1S5DD 1SNCA 1D5ZC 4OGQC 1IL8A 4FF3A 2RVLA 2K5WA 2D5DA 1XTCD 1D1KA 1LTGD 1YNND 1Q1BA 2HQEA 2L0CA 1B50A 3I91A 3S1NB 2KJXA 5J1ZA 3A56A 4F87A 3N6RA 5CV5A 4CJ1B 1IKLA 1DXMA 1UAPA 1TT2A 3CKIB 1ENFA 5HURA 4O1NA 3J7YW 1KAAA 1PLFA 2HCIA 4NP5A 3T56B 1CQVA 4DN4M 1MBYA 3C3LA 5JVH3 1TKWB 1SDFA 2K05A 1EY5A 3Q22A 3A55A 3IFDA 5ELBA 1IHZA 1JWUD 4H13C 3VR3A 5JPNC 1HFGA 2B2UC 1G91A 3P1HA 2F0QA 3RD4A 3QOLA 1I6HB 3I73A 3M7NA 2E2JB 4XT3B 4DFAA 1RD9D 2I46A 2IX3A 1RODA 3AMUA 1QB5D 1E2WA 1TQOA 2BA0A 1JWMD 4WFN3 1BNZA 3VR4A 3WDNA 3E0JA 2FJ2A 1CM9A 5ELFA 4R9WA 1SJED 4ME5A 3VYTA 3AU7A 2ID0A 4XYQA 4UAIA 4RWSC 1IW7D 3P20A 2RSOA 4FO2A 4ZLTF 1JCKB 2JA7B 1PMRA 3K5MA 1B4OA 1PZKD 1CZWA 2SNSA 5J22A 2PZWA 5IT9E 2B2WA 2O5IC 3Q24A 1O7YA 4IFDI 5KGUA 3OHXC 3PUYA 2HDLA 3QB3A 5C4JB 5BN4A 3MXGA 2EYMA 2ZXPA 4HN7A 3MXUA 3L3OC 3GTKB 1QNUA 3VR6A 1Q90A 3IFTA 3NBHA 1PFBA 5K36H 1L0YB 2PMZB 1F9RA 4DF7A 5EPKA 2WB1B 1ET6A 3MXPA 1JQYD 1LT3D 4TSSA 4IUQA 1BQQT 4B9XA 3SK5A 2RQXA 1LTTD 4EQNA 1CA5A 5DM63 1BUVT 4QUFA 3SE0A 1QCBD 2LKVA 3E5SA 2A69D 4CKBA 5EKIA 4ZYSA 3A8IE 4RA8A 1PRTD 1HTPA 4HMJA 4KK7A 4RGMA 2RDHA 3DMUA 1LV9A 3TDQA 1TWHB 5TSSA 2Y0SB 4MHEA 5EQ0A 1EYCA 5M5YB 1HA6A 4DXGA 5IODA 1RKNA 1QNKA 1LT4D 1G6ZA 3G6JB 3BVGA 2MHVA 4X3KA 4C2MB 4CJ0B 5A2QE 3KF8A 5JEAH 1EQVA 5BN5A 2B2YC 2O2LD 2XVSA 2BDOA 1LTBD 2AWOA 1CZGA 4B9WA 5G3LF 3PO2B 3VA5A 3TP7A 5FO9B 3V05A 3T16A 3OWEB 4DAVA 1Y8OB 4Z9CB 1LT6D 1D1IA 1EYDA 2AQ2B 5KEEA 4H7BA 5IGBA 3MTSA 1DYQA 3MC0B 4RCNA 1Z7TA 3DM1A 2O5JC 1ET9A 1EZ6A 2A74C 1ENAA 1B3AA 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XYI A;  2HUG A;  4LMQ D;  2D9U A;  1WTX A;  2KEC A;  2X6L A;  2L4N A;  1PFM A;  2JP1 A;  2BDN A;  3DEP A;  4ZKB B;  3IFD A;  2CVR A;  1F9S A;  2MJ8 A;  3SVM A;  1CA5 A;  2L11 A;  5CBA E;  4HAE A;  4QUF A;  4HCS A;  3TZD A;  3FPU B;  3R93 A;  1EOT A;  1EIG A;  2IL8 A;  1ICW A;  2EPB A;  1PFN A;  1GUW A;  1DOL A;  1A15 A;  3I3C A;  3D6W A;  4IUU A;  1HHV A;  2K28 A;  1HFG A;  2B2U C;  1G91 A;  1TVX A;  2DY8 A;  1O7Z A;  2Q8R E;  5EKI A;  1QE6 A;  2J7Z A;  1F2L A;  3I90 A;  1DON A;  4RA8 A;  5E4W C;  3LWE A;  5EPL A;  4XDX A;  2K1B A;  2L9H A;  4X3S A;  1WD0 A;  3I8Z A;  2B2U A;  1PDQ A;  5EPJ A;  1CA6 A;  3TN2 A;  1SSO A;  2K03 A;  5DNF A;  4XT3 B;  1G2S A;  1WVL A;  1VMP A;  1LV9 A;  1NR2 A;  1X3P A;  1B2T A;  1ROD A;  1M8A A;  1ILP A;  1VMC A;  5EQ0 A;  4MHE A;  4QUC A;  5COY A;  2KOL A;  1HUN A;  2B2T A;  5T1G A;  4NW2 A;  5T1I A;  1WTV A;  1HA6 A;  1BNZ A;  2KEE A;  1S4Z A;  2MP1 A;  1AZQ A;  1QNK A;  1C8C A;  3KUP A;  2FJ2 A;  4ZAI A;  1HUM A;  5COR A;  1RJT A;  1CM9 A;  3ONA B;  3FDT A;  1NR4 A;  1JIC A;  1G6Z A;  4R9W A;  1EIH A;  4CJ2 C;  2L1B A;  3DEO A;  1ML0 D;  3QO2 A;  4IUV A;  4X3K A;  1WTW A;  1QG7 A;  2FIN B;  4UAI A;  4RWS C;  4CJ0 B;  2RA4 A;  1IKM A;  3GV6 A;  1DZ1 A;  1EQT A;  3HP3 A;  1J9O A;  2L12 A;  1X32 A;  2RSO A;  2X6G A;  4RAU C;  3GV3 A;  1ESR A;  1U4P A;  2H1E A;  2SDF A;  4HED A;  1AZP A;  4ZLT F;  1WTQ A;  1MSG A;  1RTO A;  2HDM A;  1XX8 A;  2B2Y C;  5D14 A;  1X3Q A;  1RHP A;  2JYO A;  1ILQ A;  2MGS A;  2B2W C;  3MWY W;  5JJZ A;  1MI2 A;  2KED A;  1NCV A;  2FFK B;  2N55 A;  1JE4 A;  1B4O A;  2R3Z A;  3KBX A;  2X69 A;  5CBE E;  2VXW A;  4X3T A;  1EL0 A;  1BF4 A;  4IUT A;  3F2U A;  1AP0 A;  1WTO A;  1WTR A;  3H91 A;  1KNA A;  2Q8T A;  2B2W A;  1IL8 A;  5E4X A;  1MGS A;  1NAP A;  2M2L A;  1O7Y A;  3P7J A;  1J8I A;  2RVL A;  2FHT A;  1DOM A;  5AFW A;  4XT1 B;  2K04 A;  1U4L A;  4ZK9 B;  1HFN A;  2HDL A;  2DY7 A;  1WTP A;  2NYZ D;  3IL8 A;  4IUP A;  2RSN A;  1KNE A;  2K01 A;  2XIW A;  4HSV A;  5CMD A;  4R8I A;  1B50 A;  3I91 A;  1F9P A;  2KVM A;  2KUM A;  4X3U A;  5D65 A;  4MN3 A;  2EOT A;  2FMM A;  3MTS A;  1BBX C;  4CJ1 B;  3Q6S A;  1IKL A;  1RTN A;  5EJW A;  1BO0 A;  3UI2 A;  2HCC A;  4OIK A;  1Q3L A;  1PFB A;  3DM1 A;  2MPM A;  1PLF A;  2B2Y A;  2B2V C;  2HCI A;  1ZXT A;  1O80 A;  2N88 A;  1DOK A;  4U68 A;  2NZ1 D;  4DN4 M;  1MSH A;  1F9Q A;  1F9R A;  3N52 A;  4IUQ A;  5EPK A;  1E0B A;  4IUR A;  4ZKC B;  1B53 A;  1U4M A;  1U4R A;  2NWG A;  1SDF A;  2K05 A;  2EE1 A;  1B3A A;  4OIJ A;  2B2V A;  4O42 A;  1HRJ A;  2B2T C;  1G2T A;  3G7L A;  1SAP A;  1WD1 A; 
#chains in the Genus database with same CATH topology
 1H9S B;  1P16 A;  2WAQ B;  3MXN B;  1VQM A;  2JA5 B;  1TY0 A;  1VQD A;  1YNJ C;  2X6L A;  2B39 A;  3D4R A;  5BN3 A;  1HZB A;  2CVR A;  2MJ8 A;  2PNH A;  2PQE A;  4C3H G;  1K9M C;  3R93 A;  1T5X D;  1HJP A;  3FKI H;  1ICW A;  1E22 A;  1PTO F;  1STB A;  4JOI A;  1A15 A;  4HJ8 A;  3S16 H;  3SDZ A;  4JYA L;  3RZO B;  1UEA B;  1L1O A;  5KNB A;  5FOB B;  2K1B A;  4GLA C;  4JI0 L;  1KIX A;  2ICI A;  1JC7 A;  4CBV A;  1X55 A;  4LFC Q;  1PH6 A;  2K52 A;  3LNN A;  1D8L A;  1VMP A;  4X66 Q;  1X3P A;  1B2T A;  3NTI A;  3WOF A;  1A2T A;  3NEL A;  4YCU A;  1Z47 A;  2G9H D;  4UP7 A;  2B2T A;  3J80 E;  3PQI A;  2J4X A;  2LY7 A;  2K14 A;  4L5Q A;  3BZC A;  2F0V A;  4A3M H;  1AW7 A;  2JA7 G;  1NR4 A;  1JIC A;  1OO9 B;  3NSW A;  4DV2 L;  5IYD G;  5IGE A;  1KC8 C;  1DZ1 A;  4GLX A;  2K5Q A;  1VDZ A;  3TP8 A;  3VDY A;  4PG3 A;  2RHS B;  1SJH D;  3BG3 A;  3A74 A;  1X3Q A;  4BBR H;  1HTL D;  2B2W C;  2V1C C;  1K3R A;  4LF6 Q;  3MVV A;  2BH8 A;  1B3Q A;  2M9V A;  5HY6 A;  5I9O A;  4KTA A;  4YWL A;  4LF5 L;  5GRO A;  3CHB D;  3GTQ B;  4KD3 A;  5LMN L;  3J81 j;  1VCI A;  1S5F D;  4P75 A;  4LF4 L;  3U4Z A;  2FMC A;  2F52 A;  3MFY A;  4ZK9 B;  5FJ8 H;  3K7U C;  1KRT A;  2NBF A;  4DV4 Q;  4QQB X;  2WB1 G;  3QIA A;  2K01 A;  3L9A X;  1FNV A;  1QUQ B;  5A35 A;  4GN3 B;  3V2T A;  1Y1W H;  3UI2 A;  1FGU A;  4L5S A;  2NVT B;  1Q3L A;  1TS2 A;  1H9R A;  4I7Z C;  4DGZ A;  1YJN A;  2LFN A;  1O80 A;  1Y1W B;  2E74 C;  3N52 A;  3CCL A;  4OO1 H;  4I65 A;  3BZD B;  3KOJ A;  3NTK A;  4DUY Q;  1PTO C;  5E3F A;  3HOZ H;  2DUD A;  4S3S A;  2VZA A;  4A3F B;  1I4R A;  3NWS A;  4G4K A;  1WTX A;  2KEC A;  5HGT A;  5M5X B;  3OW2 A;  1IBK L;  1WFQ A;  1EY9 A;  1TS3 A;  4TVA B;  4JI1 L;  2XGT A;  2F0N A;  2L15 A;  4LAA A;  1A62 A;  1VQJ A;  4QIW E;  2MNA A;  3RZD B;  2IW3 A;  3GO5 A;  1EQQ A;  2B63 H;  2NVQ H;  2F0S A;  4QUC A;  1HNW L;  1TWF H;  2NN6 I;  1S5E D;  2BCO A;  1KDB A;  3LGJ A;  2B63 B;  3I7F A;  2KEE A;  1B8A A;  3FEW X;  3K57 A;  1C7Y A;  3VYS A;  4FYD A;  2QEJ C;  2VQE Q;  3TQY A;  4PMC A;  4JI8 L;  3GTL B;  1E3P A;  5C6A A;  1PYW D;  3OMC A;  5GAD C;  1DGS A;  4FXK C;  4LF8 Q;  3HP3 A;  1SBB B;  2X6G A;  4RAU C;  1XWE A;  5C44 B;  3S1Q H;  2L55 A;  4IFD G;  2Z1C A;  5D14 A;  3JAM E;  4A3L H;  1STH A;  1BXT A;  5J3B A;  2CKZ B;  2EDG A;  4PNY A;  3K5L A;  4NXN L;  2FFK B;  2N55 A;  3QWN A;  2VNU D;  3F2U A;  1BCP B;  4KKS A;  4DV1 Q;  2UUA Q;  5CV9 A;  2RDF A;  2M2L A;  4GNX A;  4XXE A;  3PMF A;  4IPH A;  1PH8 A;  3DM3 A;  2RKS A;  5IIF A;  1GUO A;  5C4H A;  4LFA L;  5FLM H;  3I55 A;  2QCP X;  3V96 A;  2BE5 C;  2FMM A;  3S15 B;  2F4V L;  2F0D A;  4KN7 C;  1TWG B;  4DU9 A;  5I6W A;  1SE3 A;  5C3E G;  4ZQ3 A;  4JI7 L;  3S14 H;  1F9Q A;  3M85 A;  4K6L A;  1E0B A;  2RCN A;  5JOB A;  4YIJ A;  1GM5 A;  2B8G A;  1AEX A;  1EYA A;  2R6G A;  1K8M A;  4JI2 L;  2NTT A;  3S14 B;  2ZJP A;  5M3M H;  1SAP A;  5FKA C;  4A3E G;  3G4S A;  4A3C H;  1W6J A;  1YNX A;  4JOI C;  4C3J H;  3KF6 B;  4QB4 A;  5KIX A;  4OXP A;  3U58 A;  2IHF A;  1PYS B;  3J81 L;  1YZ6 A;  3FPP A;  2F03 A;  1EY6 A;  2OTL A;  4KKU A;  2YTV A;  1DOL A;  5L37 A;  2EXZ A;  2QEX A;  3MZ5 A;  1Q12 A;  3LWE A;  4A3G H;  3KLW A;  5KNC A;  1N34 Q;  5LMU Q;  2E2I B;  2HHH L;  2ZXR A;  4B08 A;  1Q86 C;  1WYD A;  5IYC H;  1I94 L;  1GHJ A;  4A3I G;  2KHJ A;  1XNQ L;  1X54 A;  1N32 Q;  5COR A;  4IN3 A;  4KKT A;  4HSP A;  2L1B A;  4AH6 A;  4ZUJ A;  4LFB Q;  2XSC A;  4RGN A;  4RHS A;  2RA4 A;  5C5L A;  1NBW A;  2K75 A;  4HMI A;  5LHY 1;  5H1S E;  1PHJ A;  1OXS C;  3RLF A;  1XPR A;  4DK6 C;  2ZM6 Q;  3MWY W;  2MGS A;  2VUM H;  2UXC Q;  3TEH B;  3DWP A;  5C0X G;  3KBX A;  2VXW A;  1HR0 L;  4JPB W;  4A3K B;  2VUM B;  4NKL A;  4HJ9 A;  3HOV H;  2ALY B;  4XQJ A;  3H15 A;  5ISR A;  3NTH A;  4KMU C;  1VF7 A;  2RBM A;  2FHT A;  1JR0 D;  2R93 B;  1UNS A;  4HJ5 A;  1DCZ A;  2E2D C;  4ME3 A;  4DUZ L;  3I4M G;  2DY7 A;  4LF7 Q;  3H0G H;  4IUP A;  1YNJ D;  4HSV A;  4DV7 L;  1II3 A;  1LAB A;  3Q6S A;  3K6O A;  4L8J A;  4QMG A;  1E1O A;  1FNW A;  2B2Y A;  1A3U A;  4KN4 C;  2PZT A;  2JA6 G;  1A2U A;  1BBU A;  2QIL A;  2CW0 C;  2LS0 1;  1IBM L;  4A93 B;  5JPM C;  2F4I A;  3PIP 3;  1L0W A;  2K7V A;  4JV5 L;  3SK8 A;  1KDC A;  1EYG A;  2KCN A;  4K5V A;  1LUZ A;  3S1N H;  3CU7 A;  3NUC A;  4RKB A;  4QJF A;  1HNZ L;  2K4K A;  2F0K A;  2LXJ A;  4BBS H;  4UPA A;  4GS3 A;  3DWA A;  1AH9 A;  4DR5 Q;  3SGI A;  1BOS A;  4JI5 L;  2GA4 B;  4JI6 L;  4OEL B;  4BBS B;  1FVI A;  1O7Z A;  1XXG A;  3I90 A;  3OSO A;  1OXV A;  2TMP A;  3J7A 5;  5G3L D;  4RGO S;  2PCF B;  3DWQ A;  5I4D A;  4K8I A;  4GOP A;  3QG1 A;  1Q82 C;  1KXL A;  1VMC A;  1LTS D;  4GZY C;  3NEN A;  4ZCK A;  3U4V A;  1LYL A;  5EBD A;  5C44 G;  1EFI D;  1WCM B;  2CHB D;  3NQI A;  1EIH A;  2SNM A;  4I7A A;  3GTO H;  1H9M A;  4C3H H;  1H9K A;  2K5H A;  3DEO A;  5ELC A;  3T1H Q;  2SEB D;  3SK4 A;  2Z8L A;  2E2J H;  2FIN B;  2VQF L;  3BVM A;  4DR2 Q;  1XMO Q;  3GTO B;  1J9O A;  2L12 A;  4C3H B;  4HID A;  2UXB Q;  3GV3 A;  3URY A;  3TSS A;  1MSG A;  2F0E A;  1RHP A;  4A3B B;  3S24 A;  2WKC A;  3I70 A;  5CV4 A;  4TRD A;  4K6D A;  1EL0 A;  4RKL A;  2WIN B;  2IWH A;  1VQL A;  2IY5 B;  1GUG A;  3HFZ B;  1X3G A;  2WB1 E;  3ER0 A;  1G29 1;  1JOK A;  2JK8 A;  1PTO D;  1N9W A;  3R2I A;  1K83 B;  1UE1 A;  3R2T A;  1OXX K;  2JA7 H;  3OWF A;  4LFC L;  1U9R A;  4R8I A;  3HOU G;  4X66 L;  5IYD H;  2UU9 Q;  2CCZ A;  3SHL A;  3WOE A;  3NXW A;  2E2H B;  2HCC A;  1N36 Q;  1T9H A;  4R4T A;  2NZ1 D;  1MSH A;  4LF9 Q;  3TS2 A;  2XWB B;  3BDO A;  1LLR D;  1IYU A;  2AUJ D;  4X64 Q;  1X3F A;  2EJG C;  2WFW A;  4O42 A;  4IZ8 A;  4DV3 Q;  1CK1 A;  1ASY A;  3GTK H;  1MKH A;  3A0J A;  5CGK A;  5CV7 A;  1QIL A;  3PO3 B;  1QJO A;  2OEO A;  4PZ8 A;  1GO3 E;  2EPB A;  1YBY A;  4LF6 L;  1HHV A;  1H95 A;  3WWV A;  3TP6 A;  1F2L A;  3RR5 A;  2F1M A;  1S5C D;  1IL2 A;  3D8G A;  1PH5 A;  4DA2 A;  2NB0 A;  2K03 A;  5DNF A;  5IP7 G;  5LL6 X;  4DV4 L;  1NR2 A;  4BS9 A;  1E2Z A;  1SYE A;  4QY7 A;  3BDL A;  4A3J G;  5IP9 H;  3KDF A;  2EJM A;  2VB3 X;  2VB2 X;  3LX0 A;  3MHB A;  4G7O C;  2KCC A;  3ZYY X;  4YCW A;  3GD7 A;  3EA6 A;  3SR1 A;  1LO5 D;  3DHQ A;  1WTW A;  4UHV A;  3HOW G;  1IYJ B;  2F0T A;  4A3K G;  4DUY L;  3HRZ C;  4MTK A;  3W1G A;  2WKD A;  1TWH H;  3PIP A;  2RF4 A;  3DXJ C;  2JE6 I;  3K0Y A;  2F0J A;  5M5Y H;  3CCM A;  2QW7 A;  1XTD A;  3HOY G;  2ES2 A;  2F0L A;  2BE5 D;  2F0W A;  5NUC A;  3PF5 A;  1FL0 A;  1OTC A;  3G6E A;  1TWC H;  5BR8 Q;  2R3Z A;  3BU2 A;  3EBE A;  1Z9F A;  3K0X A;  1M1K C;  1BF4 A;  4B3S Q;  4UY8 C;  1WTO A;  1M4V A;  1TWC B;  1MGS A;  3I56 A;  4N8X 1;  4AYB G;  5AFW A;  1VQG A;  3M7G A;  4WJW A;  2RSN A;  3DLL A;  2QA4 A;  4B3T Q;  4V0B A;  3J81 E;  2OF1 A;  1KLU D;  2IJ0 A;  1BR9 A;  2PW5 A;  1EU3 A;  3M4Y A;  1IZ6 A;  2GVA A;  4C1N I;  3X3M A;  3NQT A;  1HNX Q;  4X6A H;  2A68 C;  2K5V A;  4IPG A;  3C1F A;  3CPF A;  4OHJ A;  1EY0 A;  1JMC A;  2VL6 A;  4JVZ A;  3D4W A;  3F2D A;  3MAQ A;  3C46 A;  1D5X C;  2N88 A;  2VQE L;  2ENB A;  4CKE A;  3RN2 A;  1JJG A;  2NUC A;  1EWI A;  2HD3 A;  1F2Z A;  1JB7 A;  4LF8 L;  2D9U A;  4IFD J;  2JP1 A;  3DEP A;  5IYB H;  1LAC A;  2PO4 A;  4YHH Q;  3TZD A;  1STG A;  4DNT B;  3AQQ A;  1EIG A;  1GUW A;  4UDU C;  1ESF A;  4DV1 L;  2F3V A;  2XWJ B;  3OPO A;  1KAW A;  1X9N A;  1A3V A;  2UUA L;  4ULL A;  1VQO A;  3M4O B;  1WCM G;  1BBW A;  1XPO A;  2EYJ A;  3I8Z A;  5C3E H;  1PDQ A;  1A63 A;  2DJG C;  1EY8 A;  5I2Y A;  4ID6 A;  1NE3 A;  3I4N G;  2WP8 J;  5C3E B;  1GD7 A;  3RZO H;  4NW2 A;  1VQ7 A;  1NTG A;  3H3V H;  2E76 C;  4A3E H;  2WAC A;  4G57 A;  4A3B G;  3NBH B;  3FDT A;  4XQQ A;  5M3F G;  4A3E B;  5IY0 A;  1ML0 D;  4IUV A;  2L5T A;  3PUX A;  1G8Z D;  4C3I B;  4JBK A;  1S40 A;  1YJW A;  3ERQ A;  3TRE A;  1AZP A;  4HED A;  4K2L A;  3M9B A;  1TY2 A;  4X65 Q;  4QGU A;  1AFP A;  1MI2 A;  1NCV A;  2B29 A;  2F0I A;  1VQK A;  3J81 c;  2YTX A;  3OYY A;  1SXT A;  2YTY A;  5ELN A;  2A6E C;  2N78 A;  3H91 A;  2Q8T A;  2EZV A;  5E4X A;  4PZ7 A;  2CW0 D;  2ZXO A;  4CGY B;  2JA8 G;  1MHW C;  4A3I H;  3EQL C;  4DV0 Q;  2QDL A;  1GHK A;  4KHV A;  1KLG D;  4A3I B;  1N34 L;  2K50 A;  5LMU L;  3SXH A;  3VYU A;  1SEB D;  3S2H B;  3NK9 A;  4UP9 A;  3FMC A;  1IBL Q;  3I4O A;  3GTQ H;  3FRP B;  3PO3 G;  1N32 L;  4IPC A;  3J7Z C;  2YU9 B;  5I6Y A;  3F2B A;  3BJU A;  1SR3 A;  4LFB L;  5C0X H;  4HTH A;  1ZYR C;  3K59 A;  2R92 G;  1NSN S;  1JOO A;  4A3D B;  1W2B A;  4EGV A;  3D0F A;  3OIP A;  3TBI B;  1HZC A;  2BDN A;  2NVT H;  4J15 A;  2ZM6 L;  4HAE A;  3NHH A;  2UXC L;  2M00 A;  3FPU B;  5C0X J;  4DKA C;  2DY8 A;  4A3F H;  3I4M B;  2DNE A;  2OT2 A;  1W6K A;  1KTK A;  2J7Z A;  1U5K A;  3K7A H;  4KY5 A;  1DJR D;  5EPL A;  3Q8D A;  5C4X G;  4X3S A;  2D2C C;  3T13 A;  5EPJ A;  2RCF A;  5M5X H;  2I07 B;  3K7A B;  4QF4 A;  2K5D A;  2CQA A;  3Q23 A;  1WVL A;  4LF7 L;  2JA6 H;  5JJK A;  4Y7N B;  4RMF A;  1HUN A;  2HIV A;  1PRT B;  1YIJ A;  2JA6 B;  1I3Q H;  4CDC C;  4OL7 A;  5FO8 B;  1F2Y A;  4ZAI A;  1TXY A;  4A4I A;  3CF5 A;  3CCR A;  1I3Q B;  3RZD H;  3QO2 A;  5IGC A;  4KD4 A;  2PPB C;  3AYH B;  4GLV B;  1SE8 A;  1VQP A;  4JI4 Q;  2F0H A;  2H1E A;  2EYL A;  4IPD A;  1V1P B;  1L2F A;  2N49 A;  1Q8K A;  1R4Q B;  4DR7 Q;  1OXU A;  2KCM A;  3MEH A;  1TU2 B;  4Q0F A;  4FF1 A;  1CKO A;  1EQR A;  2OQK A;  4DR5 L;  4HIO A;  3GTL H;  1AP0 A;  1GJX A;  4OON A;  4CKC A;  1X3E A;  4N8F A;  1X6O A;  1VQB A;  1J8I A;  1L1O B;  1V8Q A;  2EYF A;  5C44 H;  1O7I A;  4LNQ A;  4LW1 A;  1HFN A;  2TSS A;  2NYZ D;  4GN4 B;  1FGB D;  2EQS A;  3AFP A;  3OIQ A;  1VQE A;  2R7D A;  1RF2 D;  1R4P B;  4POG A;  2UXD Q;  4YWK A;  3PV0 A;  4FF2 A;  3FHW A;  2EY6 A;  3ND9 A;  1K3B C;  1QOH A;  1BCP F;  3NE5 B;  1WOC A;  2G9D A;  3CCJ A;  3T1H L;  2B2V A;  4N9P A;  4YWM A;  3E0E A;  4DR2 L;  1XMO L;  3QR8 A;  1EZ8 A;  4LMQ D;  3S15 H;  2UXB L;  3M4P A;  4LWC A;  3A7A B;  2JA9 A;  2R7Z G;  1TWG H;  1F9S A;  4MZ9 A;  3GTG B;  4KJO A;  5CBA E;  1EEI D;  4YY3 Q;  1NJI C;  4G7Z C;  1DD2 A;  4L6T B;  3HOU H;  3TP5 A;  3L0O A;  1CFM A;  1J5E Q;  4F7X A;  1FD7 D;  2PZU A;  3GQB A;  3A5Z B;  4J8Q A;  3HOU B;  1VQ4 A;  2YV5 A;  1VQ5 A;  4DR6 Q;  2CQO A;  2AQ3 B;  2SOB A;  3A8K E;  1G2S A;  1T5E A;  2YYZ A;  4C3I G;  3GTJ B;  2UU9 L;  3I2Z A;  1EWC A;  1YHB A;  1TS5 A;  1PH3 A;  2G5D A;  1KQS A;  4B3M Q;  1N36 L;  2RHQ B;  2WII B;  4NXM Q;  3UE0 A;  1E7Z A;  4LF9 L;  1SE2 A;  2NVX B;  4X62 Q;  4X64 L;  5A2Q L;  2E2I H;  2VW9 A;  4DV3 L;  1ESR A;  1SLJ A;  3CQZ B;  2XNA C;  1WTQ A;  3U9S A;  2JYO A;  1SRU A;  4AYB E;  1F2M A;  1SRO A;  4IAL A;  1UUP A;  1I4G A;  1EWH A;  2A68 D;  1TWA B;  1CSQ A;  2EIF A;  2QKI C;  5IP7 H;  4MTN A;  1C48 A;  1SNQ A;  4CHT B;  4DAY A;  1EY7 A;  4DK0 A;  5FLX c;  1GUS A;  4A3J H;  1OXT A;  1NAP A;  3S1M B;  3P7J A;  3KLR A;  4RHR A;  2B8F A;  2K04 A;  5KYI A;  4A3J B;  3OOC A;  1BCP C;  3UE1 A;  1WTP A;  4P73 A;  5DAU A;  1KNE A;  5CMD A;  1UE7 A;  4X3U A;  2ATW A;  1TII D;  4A3K H;  4A3D G;  3S2D B;  1SYG A;  4OIK A;  3EJI A;  1LTA D;  3HOW B;  4BY7 G;  4AQY Q;  2PNR C;  1ZXT A;  2LXK A;  1MIU A;  4U68 A;  1C4Q A;  2R93 H;  3QJY A;  1FR3 A;  1U4R A;  3J7A F;  2XRS D;  3HOY B;  1G2T A;  4E6I A;  2MFI A;  3BDC A;  3H09 A;  4JBW A;  5M9O A;  4C56 C;  3HZX A;  4HCS A;  3BYT B;  1L0X B;  1EOT A;  2KCT A;  3CCE A;  5BR8 L;  3STB D;  5FJ8 G;  1JE5 A;  4AYB B;  1PH4 A;  4GKK Q;  4A93 H;  4B3S L;  2HT1 A;  1HQR D;  1BVS A;  1CKN A;  1NUC A;  4J6H A;  4P72 A;  4GNX B;  3UDF A;  1CA6 A;  1BDO A;  1HPC A;  4F8M A;  3IAY A;  3M4Q A;  1ILP A;  2VY3 A;  3ITP A;  1A3T A;  4B3T L;  1XNR Q;  2KOL A;  1EEF D;  1I50 B;  2HQL A;  3IKJ A;  3J80 L;  3FVQ A;  2IT1 A;  1SMY C;  4KV6 A;  1HNX L;  3RMH A;  5IGG A;  3F1Z A;  2A6E D;  1RJT A;  4JBJ A;  1PXU A;  4RGT A;  3OMG A;  3D3R A;  2C35 B;  2A19 A;  2ZTE A;  4HJ7 A;  1P8L A;  1AN8 A;  1VF5 C;  5FO7 B;  5IOC A;  4KHP Q;  1QZH A;  3W2D A;  5C3X A;  1UE5 A;  1U4P A;  1RL2 A;  3S1R H;  5JAV A;  4ILW A;  4PMB A;  4DV6 Q;  1WCM H;  2EJF C;  4BY1 B;  3ND8 A;  3S17 H;  1I4Q A;  4YHH L;  5CBE E;  3S1R B;  4P2C B;  2LSS A;  3G71 A;  3I4N H;  5EKK A;  4PZ6 A;  3S17 B;  2E8G A;  4EVO A;  2CFM A;  4RCO A;  2E75 C;  5LL6 S;  4FXD A;  3SEB A;  3I4N B;  1ZYR D;  1YJ9 A;  5ELD A;  3PUZ A;  3HOX G;  3PUW A;  4A3B H;  3IL8 A;  5M3F H;  1S5B D;  4FXG C;  3T53 B;  1Y1V G;  1Q7Y C;  1NNX A;  4P71 A;  1BBX C;  1PZJ D;  5EJW A;  1BO0 A;  1D6E C;  5M3F B;  1JB3 A;  4DR1 Q;  2K6A A;  3CRL C;  4R4I A;  4BA1 I;  1ICF B;  2A6H D;  2B2V C;  2QF7 A;  2CH4 W;  3CCS A;  1K83 H;  1UEB A;  1HQM C;  2MUY A;  1U4M A;  5CYU A;  3T4A C;  4U67 3;  2DJF C;  2K32 A;  2O4X A;  2A1A A;  3E9I A;  4MIU A;  4FP5 D;  3G7L A;  5JVG 3;  3G48 A;  4MNO A;  3VA7 A;  2E2H H;  1PFM A;  2AKW B;  4R4C A;  4BWG B;  4K0K Q;  4K14 A;  1VQA A;  2F0U A;  3GTP B;  4X65 L;  1A8V A;  1VS0 A;  1GXD C;  3E9H A;  4JBM A;  3VR5 A;  3KYH C;  2JEA I;  5DM7 3;  3M3Y B;  3K81 C;  1YVC A;  5KND A;  1A6X A;  2KEN A;  3Q0A A;  2K28 A;  1SFO B;  2JA8 B;  1SE4 A;  3NEM A;  1Q1E A;  1TVX A;  2PQA A;  4H02 A;  5E4W C;  4JG2 A;  2L9H A;  2BOS A;  4GKJ Q;  4XQN A;  4G7H C;  4DV0 L;  2CH4 A;  3PO3 H;  1STY A;  2E5L Q;  2PW7 A;  3A54 A;  3BS1 A;  1CT1 D;  1Y8P B;  2MQH A;  4EX5 A;  1WTV A;  4JI3 Q;  1LTI D;  1IBL L;  2JEB I;  2DN8 A;  5FLX L;  5CC4 A;  3ONA B;  2R92 B;  4C3J G;  2NN6 G;  1X65 A;  2F0F A;  3AB9 A;  3TRZ A;  1H9S A;  4RH6 A;  1O78 A;  3MXN A;  4HIK A;  4K2K A;  4EQO A;  4WOR A;  1ONL A;  4FVM A;  3LWU A;  5FK9 C;  4JC0 A;  4B3R L;  2HDM A;  1XX8 A;  3I4L A;  2F0O A;  3JAM L;  1C9O A;  2BA1 A;  3QOJ A;  4A3G G;  2Z4I A;  4RG1 A;  1I4P A;  3W3A A;  2X69 A;  3J80 i;  1EIF A;  3PGZ A;  1SNO A;  4OEM B;  5C4X B;  1GUN A;  1K73 C;  1V43 A;  4DK1 A;  1HZA A;  1B7Y B;  3T1Y Q;  4LK1 C;  4XT1 B;  1CI3 M;  1K8O A;  4N9T A;  1E2V A;  2I5H A;  2XIW A;  4F88 A;  4KJN A;  4RFB A;  5AJ3 Q;  2KUM A;  2N3S A;  4GOP B;  2DGY A;  1RTN A;  2EVB A;  3E3X A;  3HKZ G;  5D3D A;  4O0A A;  3AFQ A;  3D6C A;  1JT8 A;  1EY4 A;  3H3V I;  3CRK C;  1CKM A;  3D4D A;  2JSO A;  2Z6K A;  1X56 A;  3NWT A;  4J1M A;  2I5M X;  4QL5 A;  1RDP D;  2HUG A;  3HS0 C;  3MEF A;  3PIO 3;  4JI4 L;  3HOV G;  4K5W A;  1O7L A;  3GTM B;  3SVM A;  3CP0 A;  3GP7 A;  4DR7 L;  3MA2 B;  3HEJ A;  4TQU S;  4BA2 I;  1LTR D;  3VYR A;  1PH1 A;  4EQP A;  1PH9 A;  3NBI A;  4IFD H;  2C5C A;  1QE6 A;  1I5F A;  4M8A A;  4HCE A;  1WD0 A;  1SSO A;  1QUQ A;  1NMF A;  2FXQ A;  2EYH A;  2AQ1 B;  1HXY D;  1Q8I A;  2ZJQ A;  1Y8N B;  4K5X A;  4KHZ A;  4DV5 Q;  2Q2U A;  2JQO A;  4ABN A;  2UXD L;  4WJ4 A;  1AZQ A;  3H6M A;  4DR4 Q;  5JEA J;  1CQF A;  1HUM A;  4OWW B;  3M4O H;  4IOA A;  4NB3 A;  1JOR A;  2H4O A;  1HZ9 A;  4YCV A;  3CMA A;  2R7Z H;  4BY1 G;  5CV6 A;  5J39 A;  1KAB A;  1V1O A;  4DAP A;  1D5M C;  3H94 A;  2F0M A;  1Y69 U;  2R7Z B;  2GN5 A;  5C0X I;  3ULJ A;  2DNC A;  1BCP D;  1FYC A;  4KY7 A;  2SDF A;  1STA A;  1FNU A;  1FJG Q;  4XIG S;  4O2D A;  2KED A;  3E6Z X;  1JE4 A;  3K5O A;  4YY3 L;  3K5N A;  5EBC A;  5GAH C;  4IUT A;  3STB C;  3C1E A;  4C3I H;  1S3O A;  4XTC S;  4TKO B;  1J5E L;  2Q2T A;  2F0G A;  1DOM A;  4OO1 I;  4DR6 L;  2AHO B;  1PTO H;  1B9M A;  1MJE A;  4CDD C;  4DXF A;  4R4Q A;  5D65 A;  2EOT A;  2ZT9 C;  2NTS A;  2V4D A;  1PTO B;  1B1Z A;  3JAM i;  3KDF B;  2F3I A;  1SNP A;  1PH7 A;  2HIX A;  4WJ3 M;  2MPM A;  4APV A;  3U9O A;  4B3M L;  3RLN A;  3FKI B;  2IPK D;  5ELE A;  3RNU A;  3S16 B;  1STE A;  1AE3 A;  2OTJ A;  3ERO A;  4NXM L;  1B53 A;  1VQH A;  4OIJ A;  5IWA Q;  2EE1 A;  2Q8I B;  2PI2 E;  1HRJ A;  4X62 L;  5F2D A;  1YNN C;  1XYI A;  2EYP A;  2A5H A;  2C9O A;  1N33 Q;  3S2H H;  2EY1 A;  2L4N A;  1JOQ A;  1V1Q A;  1MD2 D;  2OQ0 A;  2CWP A;  3S9W A;  2YU9 H;  1VQ6 A;  1SMY D;  3I3C A;  3D6W A;  5D3I B;  1XJV A;  3VR2 A;  4A3M B;  3RN5 A;  4A3D H;  5IE8 A;  5M5W H;  4OX9 Q;  3X3N A;  3EN2 A;  2XRQ D;  2EXD A;  1LT5 D;  3TN2 A;  1VQI A;  3CD6 A;  4BY7 H;  5M5W B;  2XN9 C;  1CHP D;  1LTL A;  4B3R Q;  3P75 A;  5EKL A;  4PMW A;  5C4Z A;  3KF8 B;  1GOZ A;  4BY7 B;  3DUZ A;  3L7Z C;  3R3O A;  5K5P A;  2MO0 A;  1K8G A;  4BBR B;  4ZUI A;  2MP1 A;  5CR3 A;  3TZU A;  3I4M H;  4H0L C;  3KUP A;  5DLQ E;  4LUZ A;  2A6H C;  3A7L A;  4AQY L;  3T51 B;  3OW7 A;  4EQ5 A;  3MFG A;  1H9J A;  5IGF A;  2K5N A;  4H44 C;  5I9P A;  3F2C A;  2AUK A;  4Y7N H;  1SYD A;  1X32 A;  4FF4 A;  3HG9 A;  3KF6 A;  1EIY B;  5K36 G;  4IOC A;  4OWT B;  1RTO A;  3CC7 A;  3H3V C;  1QVF A;  3PIO A;  5I2X A;  1ILQ A;  1SN8 A;  2NZO A;  2LMC B;  4Q5V A;  1STN A;  3PF4 A;  1KHI A;  4HR7 B;  1PRT F;  1S72 A;  4GKK L;  1KNA A;  2IX0 A;  4DNI A;  4PQX A;  1RCV D;  1TS4 A;  1B70 B;  1JWS D;  4ZRZ A;  1CUK A;  5IP9 G;  3IRB A;  5E7N A;  2UUC Q;  4L63 B;  1IW7 C;  5IGD A;  2J0T D;  3OTO Q;  3HOZ B;  2XTI A;  3J7A V;  4IQZ A;  4P74 A;  4MN3 A;  3KLS A;  4DR3 Q;  2R7F A;  1XMQ Q;  1XNR L;  3RUZ A;  2UUB Q;  1J6Q A;  2Z6K C;  3J80 c;  2Y0S G;  2R61 A;  2D0O A;  1MJC A;  5IT9 L;  1DOK A;  1K0R A;  1SNM A;  2ICE C;  1I6V C;  4OWX B;  2JXM B;  3ERS X;  3PSI A;  2Z9H A;  4KHP L;  1HA5 A;  1GUT A;  2B3G A;  3BVZ A;  4V19 0;  2OXP A;  2EY5 A;  2AWN A;  2L11 A;  4DV6 L;  4GN5 A;  3KBG A;  3HOX H;  2NVQ B;  1QWY A;  2IL8 A;  1PFN A;  3O13 A;  5FLX E;  1KRS A;  1TWF B;  2ZJR A;  1AE2 A;  2IX1 A;  1XPU A;  2F3W A;  5JEA G;  2RDG A;  3HOX B;  4BXX G;  1Y1V H;  2Q8R E;  1JJC B;  4NDX A;  1DON A;  3PO2 G;  2K33 A;  3EVQ A;  4M1U B;  2B2U A;  2Z0S A;  1Y1V B;  3GTG H;  3KLS X;  4K8J A;  2KQ3 A;  4R4O A;  3C2P A;  3A8J E;  4XYO A;  3CCQ A;  1M8A A;  4IJH A;  2IHE A;  2QGQ A;  1G6P A;  2KHS A;  2MO1 A;  2KHI A;  3S1Q B;  5T1I A;  1WJJ A;  1I4X A;  1S4Z A;  5DEH A;  1C8C A;  4DR1 L;  1B44 D;  1PZI D;  1TR5 A;  2A69 C;  4JK1 C;  1ENC A;  2ZTC A;  2PYK A;  5IYB G;  3ZJY C;  1QG7 A;  1PVO A;  1PRT C;  1IKM A;  1DM0 B;  1ZKO A;  3GV6 A;  2KA7 A;  2JN4 A;  3GTJ H;  3EFX D;  4QIW B;  2QDB A;  2A73 B;  3NP8 A;  1B9N A;  4R8N A;  2EYO A;  2AMC B;  4K0K L;  1GKH A;  2WAQ G;  2JA5 G;  5KRU A;  4X3T A;  4JYA Q;  1WTR A;  2BH2 A;  5EGT A;  2NVX H;  1SYC A;  1CHQ D;  3W5O A;  3NPP A;  1M90 C;  4JI0 Q;  1BKB A;  3CQZ H;  1VQF A;  1U4L A;  3FKI G;  3HGB A;  4GKJ L;  3HKZ E;  1SYF A;  1SND A;  3CAM A;  4KY6 A;  2NN6 H;  1F9P A;  2KVM A;  1KDA A;  3F8T A;  5M3M B;  2E5L L;  1TWA H;  2D62 A;  1L1O C;  1EUJ A;  4LJZ C;  4C3J B;  3KJO A;  4JI3 L;  3S1M H;  1PYB A;  2EY2 A;  4DV2 Q;  1EFW A;  1YHQ A;  5C3W A;  4IUR A;  4FDB A;  4ZKC B;  4NMZ A;  2NWG A;  4LUV A;  2B2T C;  4PV1 C;  3FP9 A;  1WD1 A;  4A3M G;  1HCZ A;  4A3G B;  4DNR B;  4ZKB B;  1NMG A;  3S2D H;  1EOV A;  1HH2 P;  3R8B A;  1EU4 A;  5LMN W;  2Z4H A;  3HOW H;  3JAM c;  3B6Y A;  2VS1 A;  4IUU A;  1SYB A;  4R1J A;  4LF5 Q;  2WV6 D;  3BYY B;  1K28 A;  2NVY H;  1D2B A;  1IXR A;  1F77 A;  2D0P A;  5LMN Q;  3HOY H;  4BBR G;  4LF4 Q;  4XDX A;  5C5M A;  5CV8 A;  1K8A C;  1UWV A;  1NY4 A;  4Y52 H;  2NVY B;  1CSP A;  3T1Y L;  4IUN A;  1IYV A;  4WRD A;  1R9T H;  3HKZ B;  3SK6 A;  4POF A;  1I4H A;  5COY A;  4ODG A;  5AJ3 L;  3K58 A;  4IO9 A;  3I72 A;  5E1F A;  1R9T B;  5T1G A;  1GVP A;  3PCO B;  1VQC A;  1V9P A;  1E24 A;  2ZTD A;  3PUV A;  1PH2 A;  3TME A;  4CJ2 C;  1Z6H A;  2F0P A;  3CXC A;  4QCL A;  3D31 A;  3HOV B;  4LUO A;  3RLO A;  3AEV A;  1Y1W G;  1EQT A;  4C1N K;  3UDG A;  1LM0 A;  1ZEQ X;  5KYL A;  4HJA A;  1I50 H;  4KI0 A;  3JC6 6;  4DK3 C;  1ASZ A;  4A3F G;  1CTM A;  3KK7 A;  5HGQ A;  1IBK Q;  3H0G B;  4FNF A;  5JJZ A;  4OO1 G;  3KFU A;  1S5D D;  3HOZ G;  1SNC A;  1D5Z C;  1Q46 A;  4L5T A;  4JI1 Q;  4OGQ C;  1IL8 A;  3ULP A;  4UP8 A;  4FF3 A;  2RVL A;  2K5W A;  2D5D A;  1XTC D;  5JJI A;  1D1K A;  1LTG D;  1YNN D;  1Q1B A;  2HQE A;  2L0C A;  2GVB A;  1B50 A;  4BY1 H;  3I91 A;  1HNW Q;  3S1N B;  2KJX A;  5J1Z A;  3A56 A;  4F87 A;  4DAM A;  4DV5 L;  1G51 A;  3N6R A;  5CV5 A;  3GDE A;  1IKL A;  4CJ1 B;  1DXM A;  1UAP A;  1TT2 A;  3CKI B;  1ENF A;  5HUR A;  4O1N A;  3J7Y W;  2OCE A;  1KAA A;  1PLF A;  2HCI A;  4DR4 L;  4NP5 A;  3T56 B;  1CQV A;  4DN4 M;  1MBY A;  4JI8 Q;  3C3L A;  2B63 G;  4CDF C;  1WI5 A;  5JVH 3;  1TKW B;  1W3S A;  1SDF A;  2K05 A;  2KBN A;  1EY5 A;  3ICE A;  1K0S A;  3Q22 A;  3A55 A;  3IFD A;  2I0Q A;  4NXN Q;  5ELB A;  1FJG L;  3J81 i;  1IHZ A;  4A76 A;  1JWU D;  4H13 C;  4KLK A;  3VR3 A;  1WTH A;  1I6H H;  1UE6 A;  5JPN C;  1HFG A;  2B2U C;  3K8A A;  1G91 A;  3P1H A;  5EAY A;  4DAY B;  3KJP A;  2F0Q A;  3RD4 A;  3L2P A;  4A3L G;  1N8R C;  1QZG A;  3QOL A;  1I6H B;  5GAE C;  4LFA Q;  3U50 C;  3I73 A;  3M7N A;  2E2J B;  4XT3 B;  3UDI A;  4DFA A;  1PV4 A;  3GTP H;  1RD9 D;  2I46 A;  2IX3 A;  1RIP A;  3M3Y H;  1E1T A;  1ROD A;  3EIV A;  3AMU A;  1QB5 D;  1E2W A;  1TQO A;  2BA0 A;  2F4V Q;  1JWM D;  4GNX C;  1SFO H;  2I5L X;  2N8N A;  4WFN 3;  1VQ8 A;  1BNZ A;  2JA8 H;  3VR4 A;  3WDN A;  3E0J A;  2FJ2 A;  3UDX A;  2PMZ E;  4JI7 Q;  5FLM G;  1CM9 A;  5ELF A;  4JCV E;  4R9W A;  1SJE D;  4ME5 A;  1YEZ A;  3VYT A;  3AU7 A;  2ID0 A;  3CC2 A;  4XYQ A;  4UAI A;  4RWS C;  4JI2 Q;  1YIT A;  1IW7 D;  5IWA L;  3P20 A;  2RSO A;  4FO2 A;  4ZLT F;  1N33 L;  1JCK B;  2JA7 B;  1PMR A;  3K5M A;  1B4O A;  1PZK D;  2R92 H;  1CZW A;  2SNS A;  5J22 A;  5M3M G;  2PZW A;  2Z6B A;  5IT9 E;  2B2W A;  2O5I C;  4A3C G;  3Q24 A;  1O7Y A;  4IFD I;  5C4J H;  5ELO A;  5KGU A;  3OHX C;  4OX9 L;  3PUY A;  1CKN B;  2HDL A;  3QB3 A;  5C4J B;  2JJQ A;  2Y0S E;  5BN4 A;  3MXG A;  1Q81 C;  2EYM A;  2HHH Q;  2ZXP A;  4HN7 A;  4AIM A;  3MXU A;  1I94 Q;  3L3O C;  3GTK B;  1QNU A;  5C4X H;  1XNQ Q;  3VR6 A;  1Q90 A;  3CW2 C;  3IFT A;  3NBH A;  1QVG A;  1PFB A;  4L5R C;  2CWA A;  2ASB A;  5K36 H;  1D7Q A;  4JW0 A;  1SMX A;  1L0Y B;  2PMZ B;  3A5U A;  1F9R A;  4DF7 A;  5EPK A;  3CCU A;  2WB1 B;  1ET6 A;  3MXP A;  1JQY D;  5IYC G;  1LT3 D;  4TSS A;  2A8V A;  4IUQ A;  4NPS A;  3K80 C;  3W1B A;  1HR0 W;  1BQQ T;  4B9X A;  1QVC A;  1YHA A;  3SK5 A;  2RQX A;  1LTT D;  4EQN A;  2OWO A;  1CA5 A;  3TS0 A;  5DM6 3;  1BUV T;  4QUF A;  3CC4 A;  1HR0 Q;  3SE0 A;  1QCB D;  2LKV A;  3E5S A;  4CDE C;  1KD1 C;  1Y14 B;  3CCV A;  2A69 D;  4CKB A;  5EKI A;  4ZYS A;  3A8I E;  4RA8 A;  2VUM G;  1PRT D;  1HTP A;  1YI2 A;  4DUZ Q;  4IJL A;  4HMJ A;  2UUC L;  1VQ9 A;  3CME A;  4KK7 A;  3OTO L;  3ULL A;  3GTM H;  4RGM A;  4DV7 Q;  2RDH A;  3DMU A;  1LV9 A;  2NZH A;  5JJL A;  2R93 G;  4DPG A;  3TDQ A;  1TWH B;  5TSS A;  2Y0S B;  4MHE A;  5EQ0 A;  4DR3 L;  1EYC A;  2H5X A;  5M5Y B;  1HA6 A;  4DXG A;  1XMQ L;  2Q2I A;  1JJ2 A;  5IOD A;  2UUB L;  1RKN A;  1QNK A;  1LT4 D;  4A75 A;  4C2M H;  3H0G G;  4ALP A;  2P5Z X;  1G6Z A;  3G6J B;  1IBM Q;  3BVG A;  2MHV A;  5IT9 c;  4X3K A;  4JV5 Q;  4C2M B;  4CJ0 B;  2Q2H A;  2WAQ E;  5A2Q E;  4HIM A;  1C0A A;  3KF8 A;  4A93 G;  5JEA H;  1EQV A;  4BXX H;  5BN5 A;  1PA6 A;  2B2Y C;  1HNZ Q;  3HKS A;  2O2L D;  5GQO A;  3PO2 H;  2XVS A;  2BDO A;  1LTB D;  2AWO A;  1CZG A;  4B9W A;  4JI5 Q;  4JI6 Q;  5G3L F;  3PO2 B;  3VA5 A;  3TP7 A;  5GAG C;  5FO9 B;  1VQN A;  3V05 A;  3T16 A;  3OWE B;  4DAV A;  2PI2 A;  2PQA B;  1Y8O B;  4BBS G;  4Z9C B;  1LT6 D;  1D1I A;  1EYD A;  2AQ2 B;  5KEE A;  4H7B A;  1A0I A;  5IGB A;  3MTS A;  1DYQ A;  3MC0 B;  4RCN A;  1U0L A;  1Z7T A;  3DM1 A;  2O5J C;  1ET9 A;  1EZ6 A;  2A74 C;  1ENA A;  4GOP C;  2JA5 H;  2VQF Q;  3BZK A;  3CPW A;  1B3A A;  1PFS A;  1KL9 A;  1V1P A; 
#chains in the Genus database with same CATH homology
 1H9S B;  2WAQ B;  2JA5 B;  1TY0 A;  2X6L A;  1YNJ C;  2B39 A;  3D4R A;  5BN3 A;  2CVR A;  2MJ8 A;  2PQE A;  4C3H G;  3R93 A;  1T5X D;  1ICW A;  1PTO F;  1STB A;  1A15 A;  3SDZ A;  3RZO B;  1UEA B;  5KNB A;  5FOB B;  2K1B A;  2ICI A;  1JC7 A;  4CBV A;  3LNN A;  1VMP A;  1X3P A;  1B2T A;  3NTI A;  3WOF A;  1A2T A;  1Z47 A;  2G9H D;  2B2T A;  3J80 E;  2J4X A;  2LY7 A;  2F0V A;  1AW7 A;  1NR4 A;  1JIC A;  1OO9 B;  3NSW A;  5IGE A;  1DZ1 A;  2K5Q A;  1VDZ A;  3TP8 A;  1SJH D;  3BG3 A;  1X3Q A;  1HTL D;  2B2W C;  3MVV A;  2M9V A;  5I9O A;  4KTA A;  3CHB D;  3GTQ B;  4KD3 A;  1VCI A;  1S5F D;  2FMC A;  3MFY A;  4ZK9 B;  2NBF A;  3QIA A;  2K01 A;  3L9A X;  1FNV A;  5A35 A;  3V2T A;  3UI2 A;  2NVT B;  1Q3L A;  1TS2 A;  1H9R A;  4I7Z C;  4DGZ A;  2LFN A;  1O80 A;  1Y1W B;  2E74 C;  3N52 A;  4OO1 H;  4I65 A;  3BZD B;  3NTK A;  1PTO C;  5E3F A;  4S3S A;  4A3F B;  1I4R A;  3NWS A;  4G4K A;  1WTX A;  2KEC A;  5HGT A;  5M5X B;  1EY9 A;  1TS3 A;  2F0N A;  4LAA A;  3RZD B;  2IW3 A;  3GO5 A;  2F0S A;  4QUC A;  2NN6 I;  1S5E D;  2BCO A;  1KDB A;  2B63 B;  2KEE A;  3FEW X;  3K57 A;  3VYS A;  4FYD A;  2QEJ C;  4PMC A;  3GTL B;  5C6A A;  1PYW D;  3OMC A;  4FXK C;  3HP3 A;  1SBB B;  2X6G A;  4RAU C;  1XWE A;  5C44 B;  4IFD G;  2L55 A;  2Z1C A;  5D14 A;  3JAM E;  1STH A;  1BXT A;  2EDG A;  4PNY A;  3K5L A;  2FFK B;  2N55 A;  3QWN A;  2VNU D;  3F2U A;  1BCP B;  4KKS A;  5CV9 A;  2RDF A;  2M2L A;  4XXE A;  3PMF A;  2RKS A;  5IIF A;  1GUO A;  5C4H A;  2QCP X;  3V96 A;  2BE5 C;  2FMM A;  3S15 B;  2F0D A;  4KN7 C;  1TWG B;  4DU9 A;  5I6W A;  1SE3 A;  4ZQ3 A;  1F9Q A;  3M85 A;  4K6L A;  1E0B A;  5JOB A;  4YIJ A;  2B8G A;  1AEX A;  1EYA A;  2R6G A;  1K8M A;  2NTT A;  3S14 B;  1SAP A;  5FKA C;  1W6J A;  5KIX A;  4QB4 A;  3J81 L;  3FPP A;  2F03 A;  1EY6 A;  4KKU A;  1DOL A;  2EXZ A;  3MZ5 A;  1Q12 A;  3LWE A;  5KNC A;  2E2I B;  2ZXR A;  4B08 A;  1GHJ A;  5COR A;  4IN3 A;  4KKT A;  4HSP A;  2L1B A;  4ZUJ A;  2XSC A;  4RGN A;  4RHS A;  2RA4 A;  5C5L A;  4HMI A;  5LHY 1;  1OXS C;  3RLF A;  3MWY W;  2MGS A;  3DWP A;  5C0X G;  3KBX A;  2VXW A;  4A3K B;  2VUM B;  4NKL A;  4XQJ A;  5ISR A;  3NTH A;  4KMU C;  1VF7 A;  2RBM A;  2FHT A;  1JR0 D;  2R93 B;  1UNS A;  1DCZ A;  2E2D C;  2DY7 A;  4IUP A;  1YNJ D;  4HSV A;  1II3 A;  1LAB A;  3Q6S A;  3K6O A;  4L8J A;  4QMG A;  1FNW A;  2B2Y A;  1A3U A;  4KN4 C;  2PZT A;  1A2U A;  2QIL A;  2CW0 C;  2LS0 1;  4A93 B;  5JPM C;  2F4I A;  3PIP 3;  2K7V A;  3SK8 A;  1KDC A;  2KCN A;  4K5V A;  3CU7 A;  3NUC A;  4RKB A;  2F0K A;  3DWA A;  1BOS A;  2GA4 B;  4BBS B;  1O7Z A;  1XXG A;  3I90 A;  3OSO A;  1OXV A;  2TMP A;  5G3L D;  4RGO S;  2PCF B;  3DWQ A;  5I4D A;  4K8I A;  3QG1 A;  1VMC A;  1LTS D;  4GZY C;  5EBD A;  1EFI D;  1WCM B;  2CHB D;  3NQI A;  1EIH A;  2SNM A;  1H9M A;  1H9K A;  3DEO A;  5ELC A;  2SEB D;  3SK4 A;  2Z8L A;  2FIN B;  3BVM A;  3GTO B;  1J9O A;  2L12 A;  4C3H B;  3GV3 A;  3URY A;  3TSS A;  1MSG A;  2F0E A;  1RHP A;  4A3B B;  2WKC A;  3I70 A;  5CV4 A;  4TRD A;  4K6D A;  1EL0 A;  4RKL A;  2WIN B;  2IWH A;  1GUG A;  1G29 1;  1JOK A;  1PTO D;  3R2I A;  1K83 B;  3R2T A;  1OXX K;  3OWF A;  1U9R A;  4R8I A;  3SHL A;  3WOE A;  3NXW A;  2E2H B;  2HCC A;  2NZ1 D;  1MSH A;  2XWB B;  3BDO A;  1LLR D;  1IYU A;  2AUJ D;  2EJG C;  4O42 A;  4IZ8 A;  1CK1 A;  5CGK A;  5CV7 A;  1QIL A;  3PO3 B;  1QJO A;  2OEO A;  2EPB A;  1HHV A;  3TP6 A;  1F2L A;  2F1M A;  1S5C D;  3D8G A;  4DA2 A;  2NB0 A;  2K03 A;  5DNF A;  5LL6 X;  1NR2 A;  4BS9 A;  1E2Z A;  1SYE A;  3BDL A;  2EJM A;  2VB3 X;  2VB2 X;  3LX0 A;  3MHB A;  4G7O C;  2KCC A;  3ZYY X;  3GD7 A;  3EA6 A;  3SR1 A;  1LO5 D;  3DHQ A;  1WTW A;  2F0T A;  3HRZ C;  2WKD A;  3DXJ C;  2JE6 I;  3K0Y A;  2F0J A;  2F0L A;  2BE5 D;  2F0W A;  5NUC A;  2R3Z A;  1BF4 A;  1WTO A;  1M4V A;  1TWC B;  1MGS A;  5AFW A;  3M7G A;  4WJW A;  2RSN A;  4V0B A;  3J81 E;  2OF1 A;  1KLU D;  2IJ0 A;  1BR9 A;  2PW5 A;  1EU3 A;  3M4Y A;  4C1N I;  3X3M A;  3NQT A;  2A68 C;  3C1F A;  4OHJ A;  1EY0 A;  3D4W A;  3C46 A;  3MAQ A;  1D5X C;  2N88 A;  2ENB A;  4CKE A;  2NUC A;  1F2Z A;  2D9U A;  4IFD J;  2JP1 A;  3DEP A;  1LAC A;  2PO4 A;  3TZD A;  1STG A;  4DNT B;  1EIG A;  1GUW A;  4UDU C;  1ESF A;  2F3V A;  2XWJ B;  3OPO A;  1A3V A;  4ULL A;  3M4O B;  2EYJ A;  3I8Z A;  1PDQ A;  1EY8 A;  5I2Y A;  4ID6 A;  2WP8 J;  5C3E B;  4NW2 A;  2E76 C;  2WAC A;  4G57 A;  3FDT A;  4XQQ A;  4A3E B;  1ML0 D;  4IUV A;  2L5T A;  3PUX A;  1G8Z D;  4C3I B;  3ERQ A;  1AZP A;  4HED A;  4K2L A;  1TY2 A;  1AFP A;  1MI2 A;  1NCV A;  2F0I A;  1SXT A;  2A6E C;  3H91 A;  2Q8T A;  2EZV A;  5E4X A;  2CW0 D;  2ZXO A;  4CGY B;  3EQL C;  1GHK A;  4KHV A;  1KLG D;  4A3I B;  3SXH A;  3VYU A;  1SEB D;  3S2H B;  3NK9 A;  3FMC A;  3FRP B;  2YU9 B;  5I6Y A;  5C0X H;  4HTH A;  1ZYR C;  3K59 A;  1NSN S;  1JOO A;  4A3D B;  4EGV A;  3OIP A;  3TBI B;  2BDN A;  4HAE A;  3NHH A;  2M00 A;  3FPU B;  5C0X J;  2DY8 A;  3I4M B;  2DNE A;  2OT2 A;  1W6K A;  1KTK A;  2J7Z A;  4KY5 A;  1DJR D;  5EPL A;  4X3S A;  2D2C C;  3T13 A;  5EPJ A;  2I07 B;  3K7A B;  4QF4 A;  2K5D A;  2CQA A;  3Q23 A;  1WVL A;  4Y7N B;  1HUN A;  1PRT B;  2JA6 B;  4OL7 A;  5FO8 B;  1F2Y A;  4ZAI A;  1I3Q B;  3QO2 A;  5IGC A;  4KD4 A;  2PPB C;  2F0H A;  2H1E A;  2EYL A;  1V1P B;  1R4Q B;  1OXU A;  3MEH A;  4Q0F A;  1TU2 B;  4FF1 A;  1AP0 A;  1GJX A;  4CKC A;  1J8I A;  1V8Q A;  2EYF A;  1HFN A;  2TSS A;  2NYZ D;  1FGB D;  3OIQ A;  1RF2 D;  1R4P B;  3PV0 A;  4FF2 A;  2EY6 A;  3ND9 A;  1QOH A;  1BCP F;  3NE5 B;  2G9D A;  2B2V A;  4N9P A;  1EZ8 A;  4LMQ D;  3A7A B;  3GTG B;  1F9S A;  4KJO A;  5CBA E;  1EEI D;  4G7Z C;  1DD2 A;  4L6T B;  3TP5 A;  1CFM A;  4F7X A;  1FD7 D;  2PZU A;  3GQB A;  4J8Q A;  3HOU B;  2AQ3 B;  2SOB A;  3A8K E;  1G2S A;  1T5E A;  2YYZ A;  4C3I G;  3GTJ B;  1EWC A;  1TS5 A;  2WII B;  1SE2 A;  2NVX B;  5A2Q L;  1ESR A;  3CQZ B;  2XNA C;  1WTQ A;  3U9S A;  2JYO A;  1F2M A;  4IAL A;  1UUP A;  1I4G A;  1EWH A;  2A68 D;  1TWA B;  2QKI C;  4DAY A;  1C48 A;  1SNQ A;  4CHT B;  1EY7 A;  4DK0 A;  1GUS A;  1OXT A;  1NAP A;  3S1M B;  3P7J A;  3KLR A;  4RHR A;  2B8F A;  2K04 A;  5KYI A;  4A3J B;  3OOC A;  1BCP C;  1WTP A;  5DAU A;  1KNE A;  5CMD A;  4X3U A;  1TII D;  3S2D B;  1SYG A;  4OIK A;  3EJI A;  1LTA D;  3HOW B;  2PNR C;  1ZXT A;  4U68 A;  1C4Q A;  3QJY A;  1FR3 A;  1U4R A;  3J7A F;  2XRS D;  3HOY B;  1G2T A;  4E6I A;  3BDC A;  3H09 A;  4JBW A;  5M9O A;  4C56 C;  3HZX A;  4HCS A;  3BYT B;  1L0X B;  1EOT A;  4AYB B;  1HQR D;  1NUC A;  4J6H A;  1CA6 A;  1BDO A;  1HPC A;  4F8M A;  3IAY A;  1ILP A;  3ITP A;  1A3T A;  2KOL A;  1EEF D;  1I50 B;  3IKJ A;  3J80 L;  3FVQ A;  2IT1 A;  1SMY C;  4KV6 A;  3RMH A;  5IGG A;  2A6E D;  1RJT A;  1PXU A;  4RGT A;  3OMG A;  3D3R A;  1AN8 A;  1VF5 C;  5FO7 B;  5IOC A;  3W2D A;  5C3X A;  1U4P A;  5JAV A;  4ILW A;  4PMB A;  2EJF C;  4BY1 B;  3ND8 A;  1I4Q A;  3S1R B;  5CBE E;  4P2C B;  5EKK A;  3S17 B;  4EVO A;  4RCO A;  2E75 C;  5LL6 S;  4FXD A;  3SEB A;  3I4N B;  1ZYR D;  5ELD A;  3PUZ A;  3PUW A;  3IL8 A;  1S5B D;  4FXG C;  3T53 B;  1BBX C;  1PZJ D;  5EJW A;  1BO0 A;  1D6E C;  5M3F B;  1JB3 A;  2K6A A;  3CRL C;  4BA1 I;  2A6H D;  2B2V C;  2QF7 A;  2MUY A;  1HQM C;  1U4M A;  5CYU A;  3T4A C;  4U67 3;  2K32 A;  2O4X A;  4MIU A;  4FP5 D;  3G7L A;  5JVG 3;  3VA7 A;  1PFM A;  4BWG B;  4K14 A;  2F0U A;  3GTP B;  1GXD C;  3M3Y B;  2JEA I;  3VR5 A;  5DM7 3;  5KND A;  1A6X A;  3Q0A A;  1SFO B;  2K28 A;  2JA8 B;  1SE4 A;  1Q1E A;  1TVX A;  5E4W C;  2L9H A;  2BOS A;  4XQN A;  4G7H C;  1STY A;  2PW7 A;  3A54 A;  3BS1 A;  1CT1 D;  1Y8P B;  1WTV A;  1LTI D;  2JEB I;  2DN8 A;  5FLX L;  5CC4 A;  3ONA B;  2R92 B;  4C3J G;  2NN6 G;  2F0F A;  3AB9 A;  1H9S A;  4RH6 A;  1O78 A;  3MXN A;  4K2K A;  4EQO A;  4WOR A;  1ONL A;  4FVM A;  3LWU A;  5FK9 C;  2HDM A;  1XX8 A;  3I4L A;  2F0O A;  3JAM L;  2BA1 A;  3QOJ A;  2Z4I A;  1I4P A;  3W3A A;  2X69 A;  1SNO A;  5C4X B;  1GUN A;  1V43 A;  4DK1 A;  4LK1 C;  4XT1 B;  1CI3 M;  1K8O A;  4N9T A;  1E2V A;  2XIW A;  4F88 A;  4KJN A;  4RFB A;  2KUM A;  1RTN A;  2EVB A;  5D3D A;  3D6C A;  1EY4 A;  3CRK C;  3D4D A;  2JSO A;  3NWT A;  4J1M A;  1RDP D;  2HUG A;  3HS0 C;  3PIO 3;  4K5W A;  1O7L A;  3GTM B;  3SVM A;  3GP7 A;  3MA2 B;  3HEJ A;  4TQU S;  4BA2 I;  1LTR D;  3VYR A;  4EQP A;  3NBI A;  4IFD H;  2C5C A;  1QE6 A;  4M8A A;  4HCE A;  1WD0 A;  1SSO A;  2EYH A;  2AQ1 B;  1HXY D;  1Q8I A;  1Y8N B;  4K5X A;  4KHZ A;  4ABN A;  1AZQ A;  3H6M A;  5JEA J;  1CQF A;  1HUM A;  1JOR A;  2H4O A;  5CV6 A;  5J39 A;  1KAB A;  4DAP A;  1V1O A;  1D5M C;  3H94 A;  2F0M A;  1Y69 U;  2R7Z B;  5C0X I;  2DNC A;  1BCP D;  1FYC A;  4KY7 A;  2SDF A;  1STA A;  1FNU A;  4XIG S;  2KED A;  3E6Z X;  1JE4 A;  3K5O A;  3K5N A;  5EBC A;  4IUT A;  3C1E A;  4XTC S;  4TKO B;  2F0G A;  1DOM A;  4OO1 I;  1PTO H;  1B9M A;  4DXF A;  5D65 A;  2EOT A;  2ZT9 C;  2NTS A;  2V4D A;  1PTO B;  1B1Z A;  1SNP A;  2MPM A;  3U9O A;  3FKI B;  2IPK D;  5ELE A;  3S16 B;  1STE A;  3ERO A;  1B53 A;  4OIJ A;  2EE1 A;  2Q8I B;  1HRJ A;  5F2D A;  1YNN C;  1XYI A;  2EYP A;  2A5H A;  2C9O A;  2EY1 A;  2L4N A;  1JOQ A;  1MD2 D;  3S9W A;  1SMY D;  3I3C A;  3D6W A;  5D3I B;  3VR2 A;  4A3M B;  3X3N A;  2XRQ D;  1LT5 D;  3TN2 A;  5M5W B;  2XN9 C;  1CHP D;  3P75 A;  5EKL A;  4PMW A;  5C4Z A;  1GOZ A;  4BY7 B;  3DUZ A;  3L7Z C;  3R3O A;  5K5P A;  4BBR B;  4ZUI A;  2MP1 A;  5CR3 A;  3TZU A;  4H0L C;  3KUP A;  2A6H C;  3A7L A;  3T51 B;  3OW7 A;  3MFG A;  1H9J A;  5IGF A;  4H44 C;  5I9P A;  2AUK A;  1SYD A;  1X32 A;  4FF4 A;  3HG9 A;  5K36 G;  1RTO A;  3H3V C;  5I2X A;  1ILQ A;  4Q5V A;  2LMC B;  1STN A;  4HR7 B;  1PRT F;  1KNA A;  2IX0 A;  4PQX A;  1RCV D;  1TS4 A;  1JWS D;  4ZRZ A;  4L63 B;  1IW7 C;  5IGD A;  2J0T D;  3HOZ B;  3J7A V;  4IQZ A;  4MN3 A;  3KLS A;  3RUZ A;  2R61 A;  5IT9 L;  1DOK A;  1SNM A;  2ICE C;  1I6V C;  2JXM B;  1HA5 A;  1GUT A;  3BVZ A;  4V19 0;  2OXP A;  2EY5 A;  2AWN A;  2L11 A;  3KBG A;  2NVQ B;  1QWY A;  2IL8 A;  1PFN A;  3O13 A;  5FLX E;  1TWF B;  2IX1 A;  2F3W A;  5JEA G;  2RDG A;  3HOX B;  2Q8R E;  4NDX A;  1DON A;  2K33 A;  3EVQ A;  4M1U B;  2B2U A;  1Y1V B;  3KLS X;  4K8J A;  2KQ3 A;  3C2P A;  3A8J E;  4XYO A;  1M8A A;  2KHS A;  3S1Q B;  5T1I A;  1I4X A;  1S4Z A;  5DEH A;  1C8C A;  1B44 D;  1PZI D;  1TR5 A;  2A69 C;  4JK1 C;  1ENC A;  2PYK A;  1QG7 A;  1PRT C;  1IKM A;  1DM0 B;  1ZKO A;  3GV6 A;  2KA7 A;  3EFX D;  4QIW B;  2QDB A;  2A73 B;  3NP8 A;  1B9N A;  4R8N A;  2EYO A;  5KRU A;  4X3T A;  1WTR A;  5EGT A;  1SYC A;  1CHQ D;  3NPP A;  1U4L A;  3HGB A;  1SYF A;  1SND A;  4KY6 A;  2NN6 H;  1F9P A;  2KVM A;  1KDA A;  5M3M B;  2D62 A;  4LJZ C;  4C3J B;  2EY2 A;  5C3W A;  4IUR A;  4ZKC B;  4NMZ A;  2NWG A;  2B2T C;  4PV1 C;  1WD1 A;  1HCZ A;  4A3G B;  4DNR B;  4ZKB B;  3R8B A;  1EU4 A;  2Z4H A;  4IUU A;  1SYB A;  2WV6 D;  3BYY B;  1D2B A;  1F77 A;  4XDX A;  5C5M A;  5CV8 A;  2NVY B;  4IUN A;  1IYV A;  4WRD A;  3HKZ B;  3SK6 A;  1I4H A;  5COY A;  4ODG A;  3K58 A;  3I72 A;  5E1F A;  1R9T B;  5T1G A;  3PUV A;  3TME A;  4CJ2 C;  1Z6H A;  2F0P A;  4QCL A;  3D31 A;  3HOV B;  1EQT A;  4C1N K;  1ZEQ X;  5KYL A;  4KI0 A;  1CTM A;  3KK7 A;  3H0G B;  4FNF A;  5JJZ A;  4OO1 G;  1S5D D;  1SNC A;  1D5Z C;  4OGQ C;  1IL8 A;  4FF3 A;  2RVL A;  2K5W A;  2D5D A;  1XTC D;  1D1K A;  1LTG D;  1YNN D;  1Q1B A;  2HQE A;  2L0C A;  1B50 A;  3I91 A;  3S1N B;  2KJX A;  5J1Z A;  3A56 A;  4F87 A;  3N6R A;  5CV5 A;  4CJ1 B;  1IKL A;  1DXM A;  1UAP A;  1TT2 A;  3CKI B;  1ENF A;  5HUR A;  4O1N A;  3J7Y W;  1KAA A;  1PLF A;  2HCI A;  4NP5 A;  3T56 B;  1CQV A;  4DN4 M;  1MBY A;  3C3L A;  5JVH 3;  1TKW B;  1SDF A;  2K05 A;  1EY5 A;  3Q22 A;  3A55 A;  3IFD A;  5ELB A;  1IHZ A;  1JWU D;  4H13 C;  3VR3 A;  5JPN C;  1HFG A;  2B2U C;  1G91 A;  3P1H A;  2F0Q A;  3RD4 A;  3QOL A;  1I6H B;  3I73 A;  3M7N A;  2E2J B;  4XT3 B;  4DFA A;  1RD9 D;  2I46 A;  2IX3 A;  1ROD A;  3AMU A;  1QB5 D;  1E2W A;  1TQO A;  2BA0 A;  1JWM D;  4WFN 3;  1BNZ A;  3VR4 A;  3WDN A;  3E0J A;  2FJ2 A;  1CM9 A;  5ELF A;  4R9W A;  1SJE D;  4ME5 A;  3VYT A;  3AU7 A;  2ID0 A;  4XYQ A;  4UAI A;  4RWS C;  1IW7 D;  3P20 A;  2RSO A;  4FO2 A;  4ZLT F;  1JCK B;  2JA7 B;  1PMR A;  3K5M A;  1B4O A;  1PZK D;  1CZW A;  2SNS A;  5J22 A;  2PZW A;  5IT9 E;  2B2W A;  2O5I C;  3Q24 A;  1O7Y A;  4IFD I;  5KGU A;  3OHX C;  3PUY A;  2HDL A;  3QB3 A;  5C4J B;  5BN4 A;  3MXG A;  2EYM A;  2ZXP A;  4HN7 A;  3MXU A;  3L3O C;  3GTK B;  1QNU A;  3VR6 A;  1Q90 A;  3IFT A;  3NBH A;  1PFB A;  5K36 H;  1L0Y B;  2PMZ B;  1F9R A;  4DF7 A;  5EPK A;  2WB1 B;  1ET6 A;  3MXP A;  1JQY D;  1LT3 D;  4TSS A;  4IUQ A;  1BQQ T;  4B9X A;  3SK5 A;  2RQX A;  1LTT D;  4EQN A;  1CA5 A;  5DM6 3;  1BUV T;  4QUF A;  3SE0 A;  1QCB D;  2LKV A;  3E5S A;  2A69 D;  4CKB A;  5EKI A;  4ZYS A;  3A8I E;  4RA8 A;  1PRT D;  1HTP A;  4HMJ A;  4KK7 A;  4RGM A;  2RDH A;  3DMU A;  1LV9 A;  3TDQ A;  1TWH B;  5TSS A;  2Y0S B;  4MHE A;  5EQ0 A;  1EYC A;  5M5Y B;  1HA6 A;  4DXG A;  5IOD A;  1RKN A;  1QNK A;  1LT4 D;  1G6Z A;  3G6J B;  3BVG A;  2MHV A;  4X3K A;  4C2M B;  4CJ0 B;  5A2Q E;  3KF8 A;  5JEA H;  1EQV A;  5BN5 A;  2B2Y C;  2O2L D;  2XVS A;  2BDO A;  1LTB D;  2AWO A;  1CZG A;  4B9W A;  5G3L F;  3PO2 B;  3VA5 A;  3TP7 A;  5FO9 B;  3V05 A;  3T16 A;  3OWE B;  4DAV A;  1Y8O B;  4Z9C B;  1LT6 D;  1D1I A;  1EYD A;  2AQ2 B;  5KEE A;  4H7B A;  5IGB A;  3MTS A;  1DYQ A;  3MC0 B;  4RCN A;  1Z7T A;  3DM1 A;  2O5J C;  1ET9 A;  1EZ6 A;  2A74 C;  1ENA A;  1B3A A;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...