1EIGA

Solution structure of the human chemokine eotaxin-2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
b'VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOTAXIN-2
publication title NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eigA00
1MSGA 1JE4A 2VXWA 3F2UA 1JICA 1U4PA 1C8CA 1NR4A 1DOKA 4HAEA 1HFGA 1HA6A 4OIJA 5DNFA 5CMDA 2KUMA 1RTOA 1SAPA 2K03A 5CBEE 1NR2A 1CA5A 1G2SA 4QUFA 1PFBA 5E4WC 2CVRA 4U68A 4DN4M 2K04A 2L4NA 1GUWA 1WTXA 1AZQA 2R3ZA 2HCIA 1O80A 3FDTA 4CJ2C 2H1EA 1WTOA 4X3TA 2HDMA 3I90A 4RAUC 4CJ0B 3KBXA 5EPLA 1B4OA 4MHEA 1WD0A 4IURA 2B2TA 3IL8A 3SVMA 4ZK9B 2HCCA 2NYZD 1NAPA 1MSHA 2B2UC 3UI2A 4IUTA 3TN2A 1AZPA 1PLFA 2RA4A 5EPKA 4LMQD 2KECA 5JJZA 2NWGA 2SDFA 2K01A 4HSVA 1WVLA 3GV3A 5EKIA 4IUQA 2FFKB 1NCVA 2EOTA 5CORA 1G6ZA 1KNAA 1B53A 1B3AA 1DOMA 1O7ZA 2NZ1D 3H91A 3HP3A 1CM9A 2MGSA 1G2TA 1EIHA 2L11A 4R8IA 3I8ZA 4OIKA 1EL0A 2K05A 4ZKCB 1PDQA 1F9SA 2RSNA 2X6LA 1KNEA 2B2WC 2KVMA 3DEPA 3G7LA 4UAIA 2Q8RE 5T1IA 1ML0D 2B2UA 1HRJA 1U4LA 3MWYW 4X3UA 1F9RA 2RSOA 1PFNA 2M2LA 1SSOA 1XX8A 2EE1A 4R9WA 3Q6SA 3KUPA 1BO0A 4MN3A 1BNZA 1QE6A 2JP1A 1EOTA 4RWSC 5EJWA 1WTRA 1WD1A 1B50A 1BBXC 2B2YA 2KEDA 1IKLA 2FJ2A 2KEEA 4RA8A 5EPJA 1F9PA 3ONAB 3FPUB 5CBAE 1BF4A 5D65A 5AFWA 4XDXA 2IL8A 1S4ZA 2D9UA 3I91A 2FHTA 2K28A 3MTSA 1WTVA 1HUNA 1TVXA 4ZKBB 2MP1A 1X32A 4XT1B 1MI2A 4IUVA 2DY7A 1B2TA 3IFDA 4O42A 2N55A 1IKMA 2B2VC 2MPMA 2Q8TA 5COYA 5E4XA 1DZ1A 1EQTA 2XIWA 2X6GA 4NW2A 4ZAIA 1HFNA 1QG7A 2L1BA 1J8IA 2KOLA 1EIGA 1RHPA 2DY8A 2K1BA 1RODA 2BDNA 1LV9A 4IUUA 1HUMA 1WTQA 1F9QA 1WTPA 2EPBA 4X3SA 5EQ0A 1CA6A 1ESRA 1Q3LA 2N88A 1ZXTA 2J7ZA 4CJ1B 1VMCA 4X3KA 1AP0A 1PFMA 5T1GA 5D14A 1ICWA 3I3CA 3GV6A 3R93A 1E0BA 2L12A 2B2YC 1X3PA 1DONA 2HUGA 4HEDA 1A15A 1O7YA 1X3QA 3D6WA 4QUCA 2B2VA 1RJTA 2FINB 1U4MA 4IUPA 4XT3B 2FMMA 4ZLTF 1G91A 1J9OA 1F2LA 3QO2A 2B2WA 1HHVA 4HCSA 2MJ8A 1RTNA 2RVLA 1U4RA 2JYOA 3DM1A 3P7JA 2L9HA 1VMPA 1XYIA 1QNKA 1DOLA 1IL8A 2HDLA 1ILPA 3DEOA 2B2TC 1WTWA 3LWEA 1SDFA 2X69A 3TZDA 1MGSA 1M8AA 3N52A 1ILQA
chains in the Genus database with same CATH superfamily
4C3IH 2BDOA 4DAPA 2LY7A 5LMNQ 1C0AA 1NNXA 2JA7G 1TKWB 5C4JH 1UE7A 2K03A 1EY8A 2Z0SA 3NHHA 1D5XC 2F0LA 3EVQA 3VR6A 2RDGA 3GQBA 4X62Q 1XJVA 3C2PA 3DHQA 4F7XA 1YHQA 4ILWA 1SYBA 4RGMA 4CJ0B 2KCNA 1SE4A 3HG9A 4TKOB 4C3IG 4ID6A 4ZK9B 3CQZB 1Q8IA 2ZM6Q 2XVSA 2A68C 5C3EH 5EPKA 4XIGS 3KF8A 1K3BC 4KD3A 4K8JA 1X3GA 5GAGC 1B9NA 3ZYYX 4ALPA 4RCOA 1FNVA 4KHPQ 3AFPA 2B8FA 3H3VH 1U0LA 1Z9FA 2NZOA 1XXGA 4KJNA 3C1FA 5CC4A 1VQIA 1ZEQX 3A5ZB 1SNMA 3RLNA 5KGUA 4X3UA 1BR9A 1Q1BA 3TSSA 3J81L 3GTMH 3CCSA 3SDZA 4FXKC 2BCOA 5E3FA 3D31A 4DR5Q 3DLLA 4KJOA 1EZ8A 1SYGA 1Q1EA 2PZTA 4XYOA 3HZXA 5BN4A 1X56A 2EZVA 4XT1B 2I07B 1MI2A 2CQAA 4IUVA 4O42A 1UE5A 1T9HA 3U9OA 3TZUA 5IGFA 3D6CA 2P5ZX 1LT4D 2PMZE 1QG7A 2JEAI 1I4GA 2KOLA 4NXMQ 3S16H 4DV3Q 5IOCA 4KLKA 3TP8A 4H02A 4C1NK 2WB1G 1YJNA 2N88A 2WAQE 1PFMA 5G3LD 1QJOA 4G57A 3K59A 5FO7B 2Z1CA 3OYYA 1PTOH 4DXFA 1CKOA 2CH4A 2ZXOA 2E2IB 2HD3A 2G9HD 1EZ6A 1HJPA 1E2VA 3OOCA 1JWMD 4HCSA 3S17B 1V1PA 4R4TA 1T5XD 3T56B 2F3IA 3GTJH 3S1MH 1BCPD 3CHBD 5LMUQ 1KC8C 2DJFC 4NXML 3BVMA 4JI2Q 2PMZB 3ERQA 1YIJA 1XPUA 3LWEA 2QA4A 2UXCL 1CZWA 1HNWQ 1TIID 1I4QA 4J1MA 3K8AA 2WAQB 3OWEB 3WWVA 2VQEL 1SMYC 3MXPA 3H3VI 1VQMA 4U68A 1GUWA 1ONLA 1K28A 4JYAQ 2F0WA 3AFQA 2ZTCA 2Q8IB 3KBXA 3MZ5A 3VYUA 2CWPA 3D8GA 2K5QA 1E7ZA 4X65Q 1HZBA 4GN5A 2WV6D 4GOPB 4LMQD 5DLQE 4OX9Q 3HOUH 3NPPA 4HSVA 1PZJD 2F0JA 3K6OA 4A93B 4K6LA 1NCVA 1YNJD 4L63B 1GXDC 2EJMA 1XNRQ 2CHBD 1CSPA 1QVFA 4DUYQ 3GTQB 1NUCA 4PZ7A 3HOUG 3NTIA 1F9RA 1IXRA 1WCMH 4B3TQ 4WJ4A 4RWSC 1XMOQ 2E5LL 2VB3X 2WP8J 3H6MA 5IP7H 3TEHB 2OCEA 1JB7A 4IOAA 3GTPH 4X66L 1I4RA 5M3MH 1VQ6A 2B2VC 1MJCA 5I4DA 2RDFA 1LUZA 1EQTA 3I7FA 4UP9A 5IT9c 1OTCA 2R92H 2VL6A 1HUMA 4AYBG 5IP7G 5I6YA 4HMIA 1VQOA 1W6KA 4AH6A 3PGZA 3R93A 5M3MG 4CHTB 4LF9L 1A3VA 1KXLA 3OMGA 1F2ZA 1OXTA 4JC0A 4HEDA 2A69D 3EFXD 1VQ9A 2RHSB 3J7ZC 2R92G 5BR8L 4GS3A 1IYJB 2BE5C 1SFOH 1LTLA 4LUZA 4A3GG 1E1TA 2K52A 1KLGD 2XTIA 4OL7A 2LFNA 1VMPA 1QNKA 5A2QE 4JVZA 4Q5VA 5M5WH 1R9TB 3A5UA 1UE1A 3KDFB 5IGEA 2UUAQ 5IE8A 5J1ZA 3SK6A 1VDZA 2NTTA 2PI2A 4CGYB 4DAMA 4JK1C 4RMFA 5GADC 1AW7A 4JPBW 3CD6A 1TWHH 3PIO3 4DV5Q 2IX0A 1X9NA 5FLXE 4K0KL 2V1CC 1B4OA 1QNUA 5EKLA 3EJIA 5FO8B 3R2IA 4BBRB 3S1QH 2UXDL 4ZUJA 1DYQA 2JA8H 3PSIA 1ICFB 4NXNL 1FL0A 5GAHC 5M3FH 1IBML 2EY6A 2VW9A 2E2JB 5M5YB 1B3AA 1DOMA 2NZ1D 5A35A 2NVQB 2L0CA 1X65A 2GA4B 4FF3A 4HN7A 3FPPA 4HJ9A 3J7A5 2K75A 1K0RA 2R7DA 3CMAA 2JA8G 1I94Q 1KNEA 2I5HA 3U4VA 3X3MA 4JBMA 2Q8RE 4IALA 2C9OA 5CV4A 2MHVA 4ME5A 1UUPA 4XXEA 5M3FG 1PFNA 2M2LA 3RZDB 3SHLA 3PV0A 4LFAL 4KMUC 3F1ZA 1CUKA 4DK6C 5JVG3 2J0TD 3A8KE 1XMQL 4JOIC 4EQOA 1PTOF 4XDXA 4HJ7A 1KABA 5C4ZA 2Z4HA 2KHJA 4DV0Q 3HOVB 3MTSA 3H0GH 3F2CA 1X32A 2BH8A 1TU2B 1KIXA 4YHHL 1IKMA 3CCLA 1GOZA 2AQ3B 5COYA 5E4XA 1EEID 2XIWA 2KA7A 2KENA 1I94L 4A3MB 3UDFA 4DR3Q 1Q8KA 2YYZA 4DV7Q 2J7ZA 2NVYB 3H0GG 3K81C 3I3CA 1EY9A 2K50A 5AJ3Q 2F0MA 2PPBC 2L12A 1H9KA 3DMUA 4JBWA 1JE5A 2Q2IA 3MXNA 4QUCA 3G71A 2LSSA 2EYOA 2C35B 4DV0L 1SJHD 3MXNB 2B2WA 2F0SA 4H13C 4IJLA 1F2YA 3M4QA 3PUZA 1I50B 3E0EA 1KD1C 1D5MC 2B2TC 3FP9A 4A3BH 2G5DA 3F2UA 4DV7L 2RBMA 4AQYL 3J7YW 5FKAC 3HKSA 5IGBA 3NTHA 1HR0L 4A3FB 4KK7A 5AJ3L 3CMEA 1XPRA 1Y8NB 1Y14B 1I4XA 4HR7B 4CJ2C 4A3KB 1GVPA 1FGBD 2A5HA 3NK9A 2QDBA 4DR1Q 5EPLA 3CCVA 2EYJA 2F0UA 1NAPA 4A3JB 2NN6H 3AU7A 2CH4W 1OXUA 3BJUA 3HS0C 5JAVA 4X64Q 4QGUA 4C2MH 4IFDH 5EKIA 4LFCQ 4A3IB 3A55A 4GKJL 1TWFH 1G6ZA 4YCWA 3RLFA 1S5BD 3DM3A 4TRDA 4RHRA 5C5MA 3QB3A 5JJKA 1A0IA 3KJOA 2NN6G 1XPOA 4C3HB 3J81c 3D3RA 4JI4L 2EYMA 1OXVA 3NTKA 5FLMH 3FKIH 5A2QL 2JA5H 4DR1L 1FJGQ 4LF5Q 1EQRA 4IFDG 4FDBA 3KF6B 3K57A 1F77A 5CV7A 1PRTF 1WD1A 3J80L 1JJGA 2F3WA 3B6YA 4IPHA 3M3YB 3U4ZA 2B63B 2XNAC 3BDLA 1C9OA 2IL8A 2YU9H 4LFCL 3S2DB 3FKIG 2MP1A 2JA5G 1IBLQ 2LXJA 4RG1A 2PO4A 3V2TA 5FLXL 4LAAA 1KLUD 4OEMB 1EY6A 3KYHC 4K6DA 2AQ2B 4N8FA 1EIGA 1RHPA 2HQEA 4UP8A 3L2PA 4HTHA 1L0WA 2YTXA 1I4HA 4KY5A 3M85A 4RKLA 2ICIA 1ICWA 3GV6A 2Z9HA 2O5IC 1TWAB 1IYVA 1ENCA 3I4OA 2LS01 2PW7A 3BZDB 2I5LX 4UDUC 1HNZL 1BCPB 5IYBG 1SE3A 1E2ZA 1QZHA 3CQZH 5CYUA 5I9OA 1Y1VB 1A3UA 4IFDJ 2SEBD 3QWNA 1TR5A 2F0PA 1VQNA 5CV5A 1DOLA 4B3RQ 4GNXC 1HTPA 2AWNA 1LYLA 2JA6H 4IFDI 4RFBA 5KNDA 4F88A 4L5TA 3S2HB 2KUMA 2H4OA 4JV5Q 4RH6A 1N34Q 4DN4M 1I6VC 4HMJA 3PQIA 2FMCA 2VQFL 4EX5A 2H1EA 3I90A 4OONA 2JA6G 3W5OA 2F0VA 3QJYA 2PNRC 1JR0D 4YWMA 2B2UC 3OIPA 5ELCA 1JC7A 4B3RL 1YNJC 1I6HH 1HZ9A 1NMGA 4IUQA 5C4XH 1PH9A 1N33Q 4R8IA 1D7QA 1EL0A 1PH1A 5T1IA 2B39A 1CKNA 1A8VA 4LUOA 2Q2HA 5ELFA 4JI7L 1TXYA 4OWWB 1VQKA 1EOTA 2MUYA 1W2BA 1Q86C 3Q24A 1TWGB 1M1KC 2KEDA 4NDXA 5EPJA 1L1OA 5C4XG 3ONAB 3KLRA 4B08A 1QZGA 1JQYD 2WINB 1GM5A 3S17H 4V190 1A3TA 2OF1A 2Z6KA 2F1MA 1N33L 4ZAIA 1STBA 1STGA 3CF5A 4DR2L 4K2KA 2DY8A 1RODA 2QGQA 2EXZA 1VQLA 3DWPA 1F2MA 1WTPA 1TT2A 1C48A 2EPBA 1JMCA 3FMCA 2R93B 2KHSA 4RKBA 4PMWA 2A69C 4KY6A 2NVXB 1OXXK 3IKJA 4YCUA 3U50C 3AQQA 4B3SQ 4XT3B 1A2UA 3BDCA 2ATWA 3EBEA 1I3QB 2YV5A 5KRUA 1VQHA 5C44G 3MHBA 3O13A 2AUJD 1XYIA 1IL8A 4FYDA 2K5NA 5J3BA 1X55A 4A93H 4KY7A 1KAAA 1SDFA 4DV4Q 1HTLD 2IHEA 3HKZE 4LNQA 4HAEA 1QILA 5FJ8G 1EYCA 1SAPA 3BYYB 2A6ED 3GTQH 4QY7A 1G8ZD 2UUBQ 3GDEA 2CVRA 1SE2A 2YTVA 1PHJA 3RN2A 2ID0A 3BVGA 5ELBA 4X3TA 5J39A 3HOWH 2L15A 1BVSA 3OMCA 5IGCA 2MO1A 4A3EG 1RF2D 1Q46A 1Q81C 1JT8A 3NWTA 1K0SA 3M7GA 5EBCA 3M4OB 1YHBA 5H1SE 5ELEA 3HOWG 2TSSA 4L5RC 3A7LA 3HKZB 2MGSA 2UUBL 1G291 1LTID 4OXPA 1HNXL 1BKBA 1J5EQ 2ALYB 4A3CG 4JI3Q 3HOYB 1U4LA 4LF7L 4A3LH 2HQLA 2RSOA 4RGNA 3CXCA 1Q82C 3KUPA 1QE6A 2JP1A 4QF4A 1EYGA 4OO1I 2I5MX 4A4IA 4RA8A 1XNQL 2Q2TA 1AEXA 5DM73 1GUOA 1LLRD 5LMNL 4LW1A 5C3XA 1CQVA 2FHTA 1EEFD 4DXGA 1ASZA 4A3LG 4ME3A 1T5EA 4TQUS 4DF7A 4WFN3 4BY1B 1MD2D 4X62L 4KKSA 3ND8A 4H7BA 1N8RC 5C3EG 1R9TH 2LMCB 3I56A 4P72A 2B8GA 4X3SA 3L3OC 2HT1A 4BY7H 1G6PA 2ZM6L 1PVOA 4J15A 1YJWA 1E0BA 3NBIA 1N36Q 4FF1A 3RMHA 3MA2B 1SROA 4JI5Q 3RUZA 1U4MA 3PO2B 3J80i 3KJPA 4P73A 4BBRH 4KHPL 1RTNA 4QIWE 4BY7G 4LFBQ 4UY8C 1PRTD 3NUCA 3P7JA 4HIMA 4Y7NB 2IPKD 3E5SA 4CKEA 5KYIA 1B7YB 5M5YH 2NVQH 1ILQA 3AEVA 2K7VA 4BBRG 4P71A 4KHZA 1N36L 4DR5L 1SJED 4DR7Q 1CA5A 1SE8A 4A3DB 4QCLA 3QOLA 4PMCA 1PFBA 4JI5L 2Z4IA 3I55A 3VR4A 1V1OA 3PUVA 3RZDH 3V96A 1IL2A 1NMFA 2GN5A 1D5ZC 1M90C 1PFSA 2BA0A 3SVMA 4IPGA 2Y0SE 4DV3L 2DJGC 1JJ2A 3DXJC 2RA4A 1UAPA 3HOVH 1Q12A 4C3JB 5JJZA 5FK9C 3P75A 1TS2A 4DU9A 3CC2A 2K01A 3G48A 1LTBD 2DN8A 1V9PA 4JW0A 2AUKA 5IIFA 3HOZB 2E2HB 4DR7L 2IW3A 1HPCA 1W3SA 2XRSD 4OIKA 1SMXA 2CQOA 1L0XB 1PDQA 3CRLC 3E9HA 2NVYH 3J80c 2ES2A 2BOSA 2OT2A 5I6WA 4CDFC 1SSOA 2PCFB 4GOPA 4GN4B 5LMUL 4TSSA 4DNIA 4JI2L 3KOJA 3QOJA 3FPUB 5CBAE 2Y0SB 2RDHA 2CCZA 1BOSA 1HNWL 3I4MB 5FLXc 3JAML 1I50H 2F0GA 4DKAC 3NEMA 1E24A 5JJLA 3HOXB 4DV6Q 5BN5A 4JYAL 2KQ3A 4OHJA 4G7ZC 4DK3C 3K7UC 2R7ZH 2LXKA 1PV4A 3C46A 2G9DA 4A3FH 4K14A 1ZYRD 4CJ1B 3CCQA 4X3KA 3SK4A 4X65L 3CCJA 4H44C 4OX9L 2EJFC 5KNBA 2B2VA 5CGKA 3NWSA 5LL6X 2ZJQA 1SEBD 3QO2A 1MBYA 2B29A 1L0YB 4PNYA 4B9XA 2R7ZG 4DR6Q 5I2YA 1DJRD 1XNRL 4A3JH 4A3FG 1WCMG 2HHHQ 3VR5A 3C3LA 1A2TA 1CK1A 3I2ZA 3MFYA 3GD7A 5IYCH 2JA7B 4DUYL 2EYFA 3S1RB 5FOBB 4A3IH 1JOQA 1HZAA 4B3TL 3AB9A 2K5VA 4NPSA 3A8JE 4A3JG 1XMOL 2OTJA 2F03A 1RTOA 1YVCA 1D1KA 4C3HH 4C3IB 3PO3B 3RLOA 4KKUA 4QUFA 3CC7A 5C4JB 3RD4A 1FNUA 5JVH3 4DR6L 4A3IG 3S24A 1GKHA 4RAUC 1SNCA 3GTOB 1VQBA 3CCMA 3VR3A 4IURA 3M3YH 2K4KA 3TBIB 2B63H 1BDOA 2WACA 1UEBA 4C3HG 4HCEA 2KECA 3KDFA 3J80E 3EROA 2WB1E 3CAMA 4OGQC 1H9SA 3S15B 2NTSA 2QEJC 5EKKA 4KKTA 1H9SB 1K9MC 1EIFA 3SXHA 4KI0A 1D6EC 3T51B 1FYCA 3UDIA 4HIKA 4JI0Q 3H3VC 2H5XA 4APVA 2R7FA 2CW0C 1UE6A 1RL2A 1JWUD 1M4VA 1KQSA 3VA5A 3QIAA 3UE0A 1II3A 1QOHA 3D4DA 3GTMB 1K83B 2QEXA 3H09A 1VQFA 2JN4A 5AFWA 3S14B 1SBBB 1Y1VH 3I91A 2UUAL 1TVXA 2DY7A 2WB1B 3F2BA 2A8VA 4Y52H 3HEJA 3TS2A 2DNEA 2XWBB 2OEOA 3L9AX 4WJ3M 4DV5L 2BDNA 3K58A 4A76A 2EY5A 3K5OA 1F9QA 4RGTA 2HIVA 3LWUA 3C1EA 1VQPA 1Y1VG 1ZXTA 4DV1Q 4JOIA 3PIPA 3S16B 5IP9H 1AP0A 4P2CB 4GLXA 1PH2A 1A15A 1EFWA 3D0FA 3Q8DA 5C0XH 4DAVA 4ABNA 1DGSA 4DGZA 3M7NA 3W1GA 4IZ8A 2O5JC 5IP9G 1PTOC 2L55A 4C1NI 1SNOA 3MXUA 3NSWA 1KHIA 1YJ9A 2J4XA 4Q0FA 3N52A 5C0XG 2VXWA 2A6EC 1ET6A 3IFTA 5BN3A 4XTCS 3VA7A 4LJZC 5CMDA 1GUSA 2UXBQ 2SNSA 1MKHA 1NSNS 2JEBI 1UWVA 2F0FA 2DNCA 1EWIA 1AFPA 4LF6Q 2F3VA 1Y1WH 4R4CA 1WD0A 1YEZA 4MHEA 1STNA 4CBVA 1Y8PB 2B2TA 3KBGA 3W2DA 2Q2UA 2NYZD 2E76C 4O1NA 2EDGA 4DR3L 4IQZA 4AYBE 1WJJA 2ZJRA 2EOTA 2EY1A 1LTSD 1Y1WG 1K8AC 2UXBL 4DK0A 2RCFA 1VQDA 2IX1A 2IWHA 2AHOB 1DCZA 1LACA 1CI3M 2R93H 2JA9A 2B2WC 4A3BG 4E6IA 1QB5D 4AIMA 2NVXH 3OHXC 1EOVA 1B9MA 5C0XJ 1XX8A 4XYQA 2A6HD 3Q6SA 1BBXC 1H9MA 1F9PA 4QL5A 4NKLA 4TVAB 3BG3A 1S5CD 1I3QH 5C0XI 1B3QA 4YY3Q 4ODGA 2IJ0A 4AYBB 2XWJB 5CV9A 2Q8TA 1YNNC 1KL9A 3TP7A 3MC0B 2K1BA 3E3XA 3KF6A 1EY4A 2F0EA 2F0KA 4QQBX 2PQAB 5TSSA 4JG2A 3PCOB 4F8MA 1VF5C 1WTHA 5D14A 2ZXRA 5JEAH 2NB0A 3K80C 2ZJPA 3U9SA 1DONA 4X64L 1O7YA 4A3GB 2F4VQ 1Q90A 4MIUA 2F0IA 2R6GA 2XGTA 5FLMG 5IYDH 1AE2A 5ELNA 1PRTC 2WKDA 4CDDC 3CPFA 3IAYA 4CKCA 1ET9A 1LT3D 4QJFA 3N6RA 3JAMi 4BXXH 2D0PA 4R4OA 3M4OH 3DEOA 5EAYA 1FJGL 4LF5L 3VYRA 1TWCB 1MGSA 5IYDG 3LX0A 2GVAA 3GTLB 2ZTEA 2K5DA 4X6AH 1HA6A 1HFGA 4OIJA 4KTAA 3OW7A 5HGQA 5IWAQ 5M5WB 1CSQA 3HOYH 3UE1A 4JI8Q 3GTKB 3T1YQ 4BXXG 4WRDA 1IBLL 3GP7A 2ZXPA 1STEA 1SR3A 5IY0A 4FO2A 1YITA 2NN6I 4GNXB 5I9PA 1SNPA 1BCPF 4PMBA 3CW2C 2V4DA 4JI1Q 2DUDA 3GV3A 1A62A 1H9JA 5HGTA 3BS1A 3CCUA 1O7ZA 2F0QA 3E9IA 2NUCA 4N9PA 3TRZA 4J8QA 2EYHA 2QF7A 2KBNA 3A7AB 3W3AA 5JEAJ 2RSNA 3RNUA 1BQQT 2B2UA 4DR4Q 4GZYC 1YBYA 1BUVT 1LTTD 1VQ7A 1IBKQ 1B50A 2A19A 3BDOA 1LT6D 1HR0W 3PO2H 1B70B 3JAMc 4POGA 1HCZA 4JI1L 1D1IA 1QVGA 1EUJA 1VQJA 4JI6Q 2UU9Q 4IJHA 1PYWD 4Y7NH 4JV5L 1N34L 4NW2A 2E74C 4I7ZC 1ZYRC 3PO2G 3J81j 4GLAC 4N9TA 3R8BA 3R3OA 4OWTB 3U58A 4A3DH 5T1GA 1PXUA 2E2IH 4FVMA 2CW0D 1NY4A 2HUGA 4M8AA 4FF4A 4K8IA 3A56A 2OTLA 1Y69U 3FRPB 1J9OA 1EY7A 4JI6L 5C4HA 2UU9L 2MJ8A 1SYEA 1LTAD 4OWXB 4L6TB 3F2DA 3GTGB 5I2XA 4A3DG 2JXMB 4C3JH 1HA5A 2NZHA 4BBSB 2GVBA 4MZ9A 2B3GA 1KDBA 1M8AA 3HOZH 2E2HH 1CZGA 1U4PA 3M4PA 3SEBA 1L1OC 1VQ5A 5E7NA 4C3JG 3QG1A 2K04A 2L4NA 1D8LA 4O2DA 1AZQA 1O80A 1LABA 1B8AA 2WAQG 4I7AA 2BA1A 4DV2Q 3IL8A 2ZT9C 4V0BA 4POFA 2EJGC 1E1OA 4FNFA 3UI2A 1PYBA 1AZPA 2SNMA 1PTOD 3MAQA 3I4MH 1LT5D 2NWGA 2SDFA 4XQQA 1ENAA 5K36H 1KNAA 1RD9D 3HOXH 1C7YA 4L5QA 2KCMA 3H91A 4B3SL 5D3DA 3JAME 1Z7TA 1JB3A 2UUCQ 4U673 4A93G 1CKMA 3I4MG 1HRJA 2N8NA 4PZ8A 1HZCA 2RQXA 3K7AB 3OW2A 2AWOA 1U9RA 2DGYA 4MN3A 1TS4A 3RN5A 1WTRA 3SGIA 1H95A 3ICEA 3T4AC 4DV4L 1S4ZA 2OQKA 3TDQA 3E0JA 2VY3A 1TY2A 1E3PA 1SRUA 2JA7H 1CQFA 1IYUA 3S1RH 1AE3A 1DZ1A 1EQVA 2K5WA 3TP6A 1X3EA 2AMCB 2UUCL 3Q22A 4JBKA 4ZQ3A 1TQOA 2IY5B 3K5NA 2VUMB 5LL6S 3PUXA 4P74A 4YCVA 1CA6A 1S5DD 5ELDA 1B44D 1JWSD 1EYAA 1JOKA 4GLVB 3LNNA 3PO3H 2RF4A 3FVQA 4DK1A 4BWGB 4CDEC 2HIXA 1PH6A 2B2YC 3PUYA 2KCCA 1S5ED 3GTOH 4XQNA 2KHIA 1WOCA 4R8NA 3PO3G 5CV8A 3NBHA 3FEWX 3ER0A 3MXGA 3STBD 1J5EL 2E8GA 3NBHB 3TREA 4JI3L 1VS0A 5J22A 5IGDA 1YNND 1X3FA 3F8TA 3S15H 4P75A 3RZOB 4IUPA 1MSGA 4BA2I 4IPCA 2ENBA 5IODA 3ULPA 3KF8B 1AN8A 3CPWA 3J7AF 2SOBA 4K5VA 3RR5A 2JA6B 5CBEE 3T1HQ 4BS9A 5E4WC 1EYDA 3S1NB 1E2WA 4CDCC 2HDMA 1C4QA 3PIOA 2MNAA 1E22A 1K83H 3D4RA 3S14H 1EWHA 4OELB 1YHAA 3S9WA 2E2JH 3CRKC 1SYDA 2L5TA 4LUVA 4UP7A 1S3OA 1PMRA 5F2DA 1EY5A 5CORA 2CFMA 1CHQD 1I6HB 1CFMA 3HP3A 1A6XA 4XQJA 3I4NB 2L11A 3T1HL 1EIHA 4YWKA 1VF7A 2K05A 4ZKCB 1SN8A 2X6LA 2A6HC 3EIVA 3V05A 4EGVA 5C4XB 4LFBL 2UXCQ 4QIWB 1BO0A 4NMZA 5EJWA 1PZKD 3PMFA 1V43A 3ND9A 4N8X1 1LTRD 4FXGC 2VQEQ 3J7AV 2D9UA 1HQMC 5M5XB 2KCTA 4EQ5A 2JJQA 3DWAA 2N55A 4MTKA 4A3MH 3KK7A 3W1BA 4GKKQ 2E2DC 2YTYA 1EY0A 4EQNA 1HFNA 1P16A 1V1PB 3CU7A 3HOVG 2M9VA 1GUNA 1WTQA 1PA6A 1K8MA 2MQHA 1IHZA 1Q3LA 1ZKOA 1KRTA 5NUCA 4A3MG 3K0XA 5C44B 3QR8A 4BA1I 4LF8Q 1RJTA 1U5KA 2PNHA 4RGOS 1PH3A 1UNSA 2NVTB 4PV1C 3CC4A 2RVLA 5C6AA 1LO5D 4GKKL 3VYTA 2N3SA 1N9WA 2HDLA 4WJWA 2E5LQ 1YZ6A 1WTWA 4RHSA 2JE6I 3TZDA 3PF4A 2Z8LA 4GOPC 1JE4A 1JICA 1JJCB 5LMNW 1NR4A 1P8LA 1IW7D 1SNDA 5DNFA 4Z9CB 4X66Q 1K3RA 4A3KH 5D3IB 1JCKB 1G2SA 5LHY1 4LF8L 1K73C 3NENA 1XTCD 4A3EB 2R3ZA 2ZTDA 1WTOA 3I72A 1SXTA 4DV6L 3BZCA 4FP5D 4EQPA 2K14A 5EGTA 4IUTA 2WIIB 3HOWB 4A3KG 4LF9Q 1EQQA 4CKBA 3AMUA 2AQ1B 3VYSA 3BYTB 4ZCKA 3MFGA 2EY2A 5BR8Q 2O4XA 4DA2A 3SR1A 5IYCG 1FVIA 4DPGA 1RCVD 1QWYA 1YI2A 2HHHL 5GAEC 1GHJA 2JSOA 1BNZA 4I65A 4A3GH 3PUWA 4F87A 3S2DH 4B9WA 4ZYSA 2PI2E 1BF4A 4PG3A 3OPOA 5D65A 3PF5A 3CCRA 4O0AA 4YIJA 5C3EB 2K28A 1O78A 4J6HA 1HUNA 1NTGA 2N78A 3T53B 1OO9B 1SNQA 4UPAA 2B63G 4K0KQ 4HIOA 2L1BA 1TWCH 1S40A 2UXDQ 4IUUA 3D4WA 3E6ZX 4NXNQ 3GTLH 1N32Q 3TS0A 2IT1A 1OXSC 1TWAH 2VS1A 3IRBA 3BZKA 1IBMQ 5KEEA 3NP8A 3GTKH 2A73B 4BY7B 2MFIA 2EXDA 1WFQA 5L37A 4ZLTF 1A63A 1V8QA 4IN3A 1NBWA 5EBDA 5IGGA 2M00A 3T16A 5HY6A 4QB4A 1U4RA 1QUQA 1RDPD 5ISRA 2I0QA 2XSCA 3HGBA 1STYA 1QUQB 4LFAQ 4JI0L 4KN4C 1N32L 1ILPA 3R2TA 1XMQQ 3S2HH 4GN3B 1GUTA 2MO0A 1CTMA 2EYPA 1ASYA 1DOKA 1PH5A 3KLSA 2N49A 4YHHQ 3URYA 1VQ8A 4KHVA 3JC66 1EIYB 3TMEA 2A1AA 1DM0B 4KD4A 3G6EA 1PTOB 4LK1C 2K6AA 3K0YA 1KDAA 4A75A 4JCVE 1QCBD 2HCCA 1MSHA 3A54A 3TN2A 1PLFA 1JORA 3GTJB 3S1MB 5IT9E 4DV1L 1XTDA 1S72A 4PZ6A 4L8JA 4HJ5A 2A68D 1B53A 1H9RA 5JOBA 3FHWA 3G6JB 2PQEA 3GO5A 3Q23A 3G7LA 2JK8A 1JOOA 4FXDA 1TWGH 1NJIC 1BXTA 1VQAA 4PQXA 4AQYQ 4IPDA 2CKZB 1HR0Q 1IKLA 2KEEA 4DNTB 3TQYA 3J81i 2F0NA 1WTVA 3GTGH 2F0OA 3AYHB 3DUZA 4KV6A 3HOUB 1FGUA 1TS5A 4QMGA 2MPMA 4MTNA 2QDLA 1YNXA 4BBSH 2C5CA 1VQ4A 3T13A 3NQIA 1S5FD 2RKSA 4ZRZA 2E75C 4LWCA 1LV9A 1SLJA 4G7OC 4LF6L 1VQCA 1V1QA 5EQ0A 5JJIA 2K33A 3OSOA 2IHFA 3A0JA 2JQOA 2O2LD 2R7ZB 3G4SA 4GKJQ 3I70A 1WCMB 4M1UB 1R4QB 4BBSG 1EU3A 1X3PA 2ICEC 1X3QA 3D6WA 2R93G 4IOCA 2Z6BA 5CV6A 3UDXA 2OQ0A 3M4YA 3STBC 3K5MA 4JI4Q 1HQRD 4DNRB 2PZWA 5K5PA 1MIUA 4FF2A 4ULLA 1O7LA 4R4QA 3GTPB 1W6JA 3OWFA 2L9HA 3M9BA 5M3MB 2PQAA 1Q7YC 1O7IA 1RIPA 3LGJA 1Y8OB 2R92B 2OXPA 2F0DA 1EFID 1C8CA 1IZ6A 1KTKA 3VR2A 2QKIC 1PH8A 3KLWA 1NR2A 2NBFA 1AH9A 1PRTB 1UEAB 3K7AH 4KN7C 2LKVA 4YY3L 2HCIA 1SMYD 3TP5A 4DAYA 2VNUD 1RKNA 2D2CC 3CKIB 4DAYB 5JEAG 1SFOB 4EVOA 3DWQA 4DFAA 1CHPD 1PZID 1TY0A 1PH7A 1GO3E 1ENFA 2D62A 3SE0A 4HSPA 4IUNA 5ELOA 4S3SA 1EWCA 4UHVA 2FFKB 2PYKA 2OWOA 1HNZQ 2F0TA 4H0LC 1WYDA 1KDCA 1KAWA 3BVZA 5G3LF 3OTOQ 1CM9A 1GHKA 5C5LA 1TS3A 2F4VL 2VUMH 2RCNA 4NB3A 3I4LA 2KVMA 3DEPA 1ML0D 2D5DA 1LTGD 5IYBH 5E1FA 2IX3A 3SK8A 3HKZG 4GNXA 1TWHB 1LM0A 1WI5A 3OIQA 1X6OA 4DUZQ 1FD7D 1VQEA 3NELA 2WKCA 3ULLA 3HOYG 2VUMG 3S1QB 3P1HA 2JA8B 1XWEA 1VCIA 5KNCA 1BBUA 4G7HC 1FNWA 2F0HA 4NP5A 2A74C 3WDNA 1HH2P 5IWAL 2VQFQ 4BY1H 3WOFA 1I5FA 5GROA 3OTOL 1B2TA 1BCPC 5M3FB 4MNOA 4JI8L 3T1YL 3KFUA 3RZOH 3VDYA 4K2LA 3PIP3 3K5LA 3NXWA 3EA6A 4K5XA 1ESRA 5IT9L 4YWLA 4BY1G 4DUZL 3CCEA 3L0OA 1STHA 3EN2A 3S1NH 1EU4A 3MEFA 1K8OA 2QILA 2F52A 2FINB 1SYCA 2FXQA 1DXMA 1VQGA 3HRZC 3CP0A 1G91A 1HHVA 1PYSB 1QVCA 3NE5B 1GUGA 2VB2X 4JI7Q 3H0GB 5DEHA 2JYOA 3DM1A 4WORA 2BE5D 1DD2A 4LF4Q 2XRQD 2TMPA 4DR4L 1IW7C 1J6QA 3J81E 3A74A 3H15A 1IBKL 2EE1A 2WFWA 1PH4A 3NQTA 3ZJYC 3I4NH 4HIDA 1R4PB 1KRSA 5C3WA 4HJAA 1K8GA 1WTXA 4DR2Q 3FDTA 5HURA 2EVBA 2EIFA 5DM63 1D2BA 1CKNB 5CR3A 3I4NG 3MEHA 4LF4L 1GD7A 1Y1WB 2BH2A 5DAUA 5M5XH 3BU2A 2VZAA 3Q0AA 1L1OB 5KYLA 2F4IA 1WVLA 4A3BB 3KLSX 2PZUA 2AKWB 2CWAA 3L7ZC 1X54A 1BBWA 1L2FA 2I46A 3MVVA 2QCPX 3I8ZA 1F9SA 2Z6KC 2ASBA 4UAIA 3P20A 3UDGA 1MJEA 4JBJA 3MWYW 3HOZG 1GJXA 5GQOA 1MHWC 2EQSA 4R9WA 1G2TA 5C44H 2PW5A 4B3MQ 2KJXA 4R1JA 4OO1H 2FJ2A 4L5SA 2NVTH 1Z6HA 1Z47A 3ITPA 4ZUIA 1I4PA 1HXYD 2D0OA 2RHQB 4ZKBB 1SYFA 2QW7A 3ULJA 3H94A 3IFDA 4C2MB 1FR3A 3WOEA 5FJ8H 1TWFB 2Y0SG 2X6GA 1NE3A 2K32A 4IO9A 4OO1G 1J8IA 2XN9C 4HJ8A 3EQLC 4DV2L 5KIXA 5K36G 3FKIB 1VMCA 4G4KA 3HOXG 2JA5B 4B3ML 4K5WA 2EYLA 5M9OA 4A3EH 3I73A 3A8IE 1HNXQ 3SK5A 4C56C 2FMMA 5FO9B 1F2LA 1G51A 5JPMC 1STAA 2YU9B 4LF7Q 3X3NA 5JPNC 4R4IA 1ESFA 1CT1D 3HFZB 2K5HA 1B1ZA 3ERSX 4A3CH 2X69A 2R61A 1XNQQ 4RCNA 2B2YA
chains in the Genus database with same CATH topology
4DAPA 2BDOA 2LY7A 1TKWB 2K03A 1EY8A 3NHHA 1D5XC 2F0LA 3EVQA 3VR6A 2RDGA 3GQBA 3C2PA 3DHQA 4F7XA 4ILWA 1SYBA 4RGMA 4CJ0B 2KCNA 1SE4A 3HG9A 4TKOB 4C3IG 4ID6A 4ZK9B 3CQZB 1Q8IA 2XVSA 2A68C 5EPKA 4XIGS 3KF8A 4KD3A 4K8JA 1B9NA 3ZYYX 4RCOA 1FNVA 2B8FA 1XXGA 4KJNA 3C1FA 5CC4A 1ZEQX 1SNMA 5KGUA 4X3UA 1BR9A 1Q1BA 3TSSA 3J81L 3SDZA 4FXKC 2BCOA 5E3FA 3D31A 4KJOA 1EZ8A 1SYGA 1Q1EA 2PZTA 4XYOA 3HZXA 5BN4A 2EZVA 4XT1B 2I07B 1MI2A 2CQAA 4IUVA 4O42A 3U9OA 5IGFA 3TZUA 3D6CA 1LT4D 1QG7A 2JEAI 1I4GA 2KOLA 5IOCA 3TP8A 4C1NK 2N88A 1PFMA 5G3LD 1QJOA 4G57A 3K59A 5FO7B 2Z1CA 1PTOH 4DXFA 2ZXOA 2E2IB 2G9HD 1EZ6A 1E2VA 3OOCA 1JWMD 4HCSA 3S17B 1V1PA 1T5XD 3T56B 1BCPD 3CHBD 3BVMA 2PMZB 3ERQA 3LWEA 1CZWA 1TIID 1I4QA 4J1MA 2WAQB 3OWEB 1SMYC 3MXPA 4U68A 1GUWA 1ONLA 2F0WA 2Q8IB 3KBXA 3MZ5A 3VYUA 3D8GA 2K5QA 2WV6D 4LMQD 3NPPA 4HSVA 1PZJD 2F0JA 3K6OA 4A93B 4K6LA 1NCVA 1YNJD 4L63B 1GXDC 2EJMA 2CHBD 3GTQB 1NUCA 3NTIA 1F9RA 4RWSC 2VB3X 2WP8J 3H6MA 1I4RA 2B2VC 5I4DA 2RDFA 1EQTA 1HUMA 5I6YA 4HMIA 1W6KA 3R93A 4CHTB 1A3VA 3OMGA 1F2ZA 1OXTA 4HEDA 2A69D 3EFXD 2BE5C 4OL7A 1KLGD 2LFNA 1VMPA 1QNKA 5A2QE 4Q5VA 1R9TB 5IGEA 5J1ZA 3SK6A 1VDZA 2NTTA 4CGYB 4JK1C 1AW7A 3PIO3 2IX0A 5FLXE 1B4OA 1QNUA 5EKLA 3EJIA 5FO8B 3R2IA 4BBRB 4ZUJA 1DYQA 2E2JB 2EY6A 5M5YB 1B3AA 5A35A 1DOMA 2NZ1D 2NVQB 2L0CA 4FF3A 2GA4B 4HN7A 3FPPA 1KNEA 3X3MA 2Q8RE 4IALA 2C9OA 5CV4A 2MHVA 4ME5A 1UUPA 4XXEA 3RZDB 1PFNA 2M2LA 3SHLA 3PV0A 4KMUC 5JVG3 2J0TD 3A8KE 4EQOA 1PTOF 4XDXA 1KABA 5C4ZA 2Z4HA 3HOVB 3MTSA 1X32A 1TU2B 1IKMA 1GOZA 2AQ3B 5COYA 5E4XA 1EEID 2XIWA 2KA7A 4A3MB 2YYZA 2J7ZA 2NVYB 3I3CA 1EY9A 2F0MA 2PPBC 2L12A 1H9KA 3DMUA 4JBWA 3MXNA 4QUCA 2EYOA 1SJHD 2B2WA 2F0SA 4H13C 1F2YA 3PUZA 1I50B 1D5MC 2B2TC 3F2UA 2RBMA 3J7YW 5FKAC 5IGBA 3NTHA 4A3FB 4KK7A 1Y8NB 1I4XA 4HR7B 4CJ2C 4A3KB 2A5HA 1FGBD 3NK9A 2QDBA 5EPLA 2EYJA 2F0UA 1NAPA 4A3JB 2NN6H 3AU7A 1OXUA 3HS0C 5JAVA 4IFDH 5EKIA 4A3IB 3A55A 1G6ZA 3RLFA 1S5BD 4TRDA 4RHRA 5C5MA 3QB3A 2NN6G 4C3HB 3D3RA 2EYMA 1OXVA 3NTKA 5A2QL 4IFDG 3K57A 1F77A 5CV7A 1PRTF 1WD1A 3J80L 2F3WA 3M3YB 2B63B 2XNAC 3BDLA 2IL8A 3S2DB 2MP1A 2PO4A 3V2TA 5FLXL 4LAAA 1KLUD 1EY6A 4K6DA 2AQ2B 1EIGA 1RHPA 2HQEA 4HTHA 1I4HA 4KY5A 3M85A 4RKLA 2ICIA 1ICWA 3GV6A 2O5IC 1TWAB 1IYVA 1ENCA 2LS01 2PW7A 3BZDB 4UDUC 1BCPB 1SE3A 1E2ZA 5CYUA 5I9OA 1Y1VB 1A3UA 4IFDJ 2SEBD 3QWNA 1TR5A 2F0PA 5CV5A 1DOLA 1HTPA 2AWNA 4IFDI 4RFBA 5KNDA 4F88A 3S2HB 2KUMA 2H4OA 4RH6A 4DN4M 1I6VC 4HMJA 2FMCA 2H1EA 3I90A 2F0VA 3QJYA 2PNRC 1JR0D 2B2UC 3OIPA 5ELCA 1JC7A 1YNJC 4IUQA 4R8IA 1EL0A 5T1IA 2B39A 5ELFA 1EOTA 2MUYA 3Q24A 1TWGB 2KEDA 4NDXA 5EPJA 3ONAB 3KLRA 4B08A 1JQYD 2WINB 4V190 1A3TA 2OF1A 2F1MA 4ZAIA 1STBA 1STGA 4K2KA 2DY8A 1RODA 2EXZA 3DWPA 1F2MA 1WTPA 1TT2A 1C48A 2EPBA 2R93B 3FMCA 2KHSA 4RKBA 4PMWA 2A69C 4KY6A 2NVXB 1OXXK 3IKJA 4XT3B 1A2UA 3BDCA 1I3QB 5KRUA 3MHBA 3O13A 2AUJD 1XYIA 1IL8A 4FYDA 4KY7A 1KAAA 1SDFA 1HTLD 4HAEA 1QILA 1EYCA 1SAPA 3BYYB 2A6ED 1G8ZD 2CVRA 1SE2A 2ID0A 3BVGA 5ELBA 4X3TA 5J39A 3OMCA 5IGCA 1RF2D 3NWTA 3M7GA 5EBCA 3M4OB 5ELEA 2TSSA 3A7LA 3HKZB 2MGSA 1G291 1LTID 3HOYB 1U4LA 2RSOA 4RGNA 3KUPA 1QE6A 2JP1A 4QF4A 4OO1I 4RA8A 1AEXA 5DM73 1GUOA 1LLRD 5C3XA 1CQVA 2FHTA 1EEFD 4DXGA 1T5EA 4TQUS 4DF7A 4WFN3 4BY1B 1MD2D 4KKSA 3ND8A 4H7BA 2LMCB 2B8GA 4X3SA 3L3OC 1E0BA 3NBIA 4FF1A 3RMHA 3MA2B 3RUZA 1U4MA 3PO2B 1RTNA 1PRTD 3NUCA 3P7JA 4Y7NB 2IPKD 3E5SA 4CKEA 5KYIA 1ILQA 2K7VA 4KHZA 1SJED 1CA5A 4A3DB 4QCLA 3QOLA 4PMCA 1PFBA 2Z4IA 3VR4A 1V1OA 3PUVA 3V96A 1D5ZC 2BA0A 3SVMA 3DXJC 2RA4A 1UAPA 1Q12A 4C3JB 5JJZA 5FK9C 3P75A 1TS2A 4DU9A 2K01A 1LTBD 2DN8A 2AUKA 5IIFA 3HOZB 2E2HB 2IW3A 1HPCA 2XRSD 4OIKA 1L0XB 1PDQA 3CRLC 2BOSA 2OT2A 5I6WA 1SSOA 2PCFB 4TSSA 3QOJA 3FPUB 5CBAE 2Y0SB 2RDHA 1BOSA 3I4MB 3JAML 2F0GA 3HOXB 5BN5A 2KQ3A 4OHJA 4G7ZC 3C46A 2G9DA 4K14A 1ZYRD 4CJ1B 4X3KA 3SK4A 4H44C 2EJFC 5KNBA 2B2VA 5CGKA 3NWSA 5LL6X 1SEBD 3QO2A 1MBYA 4PNYA 1L0YB 4B9XA 5I2YA 1DJRD 3VR5A 3C3LA 1A2TA 1CK1A 3MFYA 3GD7A 2JA7B 2EYFA 3S1RB 5FOBB 1JOQA 3AB9A 3A8JE 2F03A 1RTOA 4C3IB 1D1KA 3PO3B 4KKUA 4QUFA 5C4JB 3RD4A 1FNUA 5JVH3 4RAUC 1SNCA 3GTOB 3VR3A 4IURA 3TBIB 1BDOA 2WACA 4C3HG 4HCEA 2KECA 3J80E 3EROA 4OGQC 1H9SA 3S15B 2NTSA 2QEJC 5EKKA 4KKTA 1H9SB 3SXHA 4KI0A 1D6EC 3T51B 1FYCA 3H3VC 2CW0C 1JWUD 1M4VA 3VA5A 3QIAA 1II3A 1QOHA 3D4DA 3GTMB 1K83B 3H09A 5AFWA 3S14B 1SBBB 3I91A 1TVXA 2DY7A 2WB1B 3HEJA 2DNEA 2XWBB 2OEOA 3L9AX 2BDNA 3K58A 2EY5A 3K5OA 1F9QA 4RGTA 3LWUA 3C1EA 1ZXTA 3S16B 1AP0A 4P2CB 1A15A 5C0XH 4DAVA 4ABNA 4DGZA 3M7NA 4IZ8A 2O5JC 1PTOC 2L55A 4C1NI 1SNOA 3MXUA 3NSWA 2J4XA 4Q0FA 3N52A 5C0XG 2VXWA 2A6EC 1ET6A 3IFTA 5BN3A 4XTCS 3VA7A 4LJZC 5CMDA 1GUSA 2SNSA 1NSNS 2JEBI 2F0FA 2DNCA 1AFPA 2F3VA 1WD0A 4MHEA 4CBVA 1STNA 1Y8PB 2B2TA 3KBGA 3W2DA 2NYZD 2E76C 4O1NA 2EDGA 4IQZA 2EOTA 2EY1A 1LTSD 4DK0A 2IX1A 2IWHA 1DCZA 1LACA 1CI3M 2B2WC 4E6IA 1QB5D 3OHXC 1B9MA 5C0XJ 1XX8A 4XYQA 2A6HD 3Q6SA 1BBXC 1H9MA 1F9PA 4NKLA 3BG3A 1S5CD 5C0XI 4ODGA 2IJ0A 4AYBB 2XWJB 5CV9A 2Q8TA 1YNNC 3TP7A 3MC0B 2K1BA 1EY4A 2F0EA 2F0KA 5TSSA 4F8MA 1VF5C 5D14A 2ZXRA 5JEAH 2NB0A 3U9SA 1DONA 1O7YA 4A3GB 1Q90A 4MIUA 2F0IA 2R6GA 1PRTC 2WKDA 3IAYA 4CKCA 1ET9A 1LT3D 3N6RA 3DEOA 3VYRA 1TWCB 1MGSA 3LX0A 3GTLB 2K5DA 1HA6A 1HFGA 4OIJA 4KTAA 3OW7A 5M5WB 3GTKB 4WRDA 3GP7A 2ZXPA 1STEA 4FO2A 2NN6I 5I9PA 1SNPA 1BCPF 4PMBA 2V4DA 3GV3A 5HGTA 1H9JA 3BS1A 1O7ZA 2F0QA 2NUCA 4N9PA 4J8QA 2EYHA 2QF7A 3A7AB 3W3AA 5JEAJ 2RSNA 1BQQT 2B2UA 4GZYC 1BUVT 1LTTD 1B50A 3BDOA 1LT6D 1HCZA 1D1IA 1PYWD 4NW2A 2E74C 4I7ZC 1ZYRC 4N9TA 3R8BA 3R3OA 5T1GA 1PXUA 4FVMA 2CW0D 2HUGA 4M8AA 4FF4A 4K8IA 3A56A 1Y69U 3FRPB 1J9OA 1EY7A 5C4HA 2MJ8A 1SYEA 1LTAD 4L6TB 3GTGB 5I2XA 2JXMB 1HA5A 4BBSB 1KDBA 1M8AA 1CZGA 1U4PA 3SEBA 4C3JG 3QG1A 2K04A 2L4NA 1AZQA 1O80A 1LABA 2BA1A 3IL8A 2ZT9C 4V0BA 2EJGC 4FNFA 3UI2A 1AZPA 2SNMA 1PTOD 3MAQA 1LT5D 2NWGA 2SDFA 4XQQA 1ENAA 5K36H 1KNAA 1RD9D 3H91A 5D3DA 3JAME 1Z7TA 1JB3A 4U673 1HRJA 2RQXA 3K7AB 2AWOA 1U9RA 4MN3A 1TS4A 1WTRA 3T4AC 1S4ZA 3TDQA 3E0JA 1TY2A 1CQFA 1IYUA 1DZ1A 1EQVA 2K5WA 3TP6A 3Q22A 4ZQ3A 1TQOA 3K5NA 2VUMB 5LL6S 3PUXA 1CA6A 1S5DD 5ELDA 1B44D 1JWSD 1EYAA 1JOKA 3LNNA 3FVQA 4DK1A 4BWGB 2B2YC 3PUYA 2KCCA 1S5ED 4XQNA 4R8NA 5CV8A 3FEWX 3NBHA 3MXGA 5J22A 5IGDA 1YNND 3RZOB 4IUPA 1MSGA 4BA2I 2ENBA 5IODA 1AN8A 3J7AF 2SOBA 4K5VA 2JA6B 5CBEE 4BS9A 5E4WC 1EYDA 3S1NB 1E2WA 2HDMA 1C4QA 3D4RA 1EWHA 3S9WA 3CRKC 1SYDA 2L5TA 1PMRA 5F2DA 1EY5A 5CORA 1CHQD 1I6HB 1CFMA 3HP3A 1A6XA 4XQJA 3I4NB 2L11A 1EIHA 1VF7A 2K05A 4ZKCB 2X6LA 2A6HC 3V05A 4EGVA 5C4XB 4QIWB 1BO0A 4NMZA 5EJWA 1PZKD 3PMFA 1V43A 3ND9A 1LTRD 4FXGC 3J7AV 2D9UA 1HQMC 5M5XB 3DWAA 2N55A 3KK7A 2E2DC 1EY0A 4EQNA 1HFNA 1V1PB 3CU7A 2M9VA 1GUNA 1WTQA 1K8MA 1IHZA 1Q3LA 1ZKOA 5NUCA 5C44B 4BA1I 1RJTA 4RGOS 1UNSA 2NVTB 4PV1C 2RVLA 5C6AA 1LO5D 3VYTA 2HDLA 4WJWA 1WTWA 4RHSA 2JE6I 3TZDA 2Z8LA 1JE4A 1JICA 1NR4A 1IW7D 1SNDA 5DNFA 4Z9CB 5D3IB 1JCKB 1G2SA 5LHY1 1XTCD 4A3EB 2R3ZA 1WTOA 3I72A 1SXTA 4FP5D 4EQPA 5EGTA 4IUTA 2WIIB 3HOWB 4CKBA 3AMUA 2AQ1B 3VYSA 3BYTB 3MFGA 2EY2A 2O4XA 4DA2A 3SR1A 1RCVD 1QWYA 1GHJA 2JSOA 1BNZA 4I65A 3PUWA 4F87A 4B9WA 4ZYSA 1BF4A 5D65A 3OPOA 4YIJA 5C3EB 2K28A 1O78A 4J6HA 1HUNA 3T53B 1OO9B 1SNQA 2L1BA 4IUUA 3D4WA 3E6ZX 2IT1A 1OXSC 5KEEA 3NP8A 2A73B 4BY7B 4ZLTF 1V8QA 4IN3A 5EBDA 5IGGA 2M00A 3T16A 4QB4A 1U4RA 1RDPD 5ISRA 2XSCA 3HGBA 1STYA 4KN4C 1ILPA 3R2TA 1GUTA 1CTMA 2EYPA 1DOKA 3KLSA 3URYA 4KHVA 3TMEA 1DM0B 4KD4A 1PTOB 4LK1C 2K6AA 3K0YA 1KDAA 1QCBD 2HCCA 1MSHA 3A54A 3TN2A 1PLFA 1JORA 3GTJB 3S1MB 5IT9E 4L8JA 2A68D 1B53A 1H9RA 5JOBA 3G6JB 2PQEA 3GO5A 3Q23A 3G7LA 1JOOA 4FXDA 1BXTA 4PQXA 1IKLA 2KEEA 4DNTB 2F0NA 1WTVA 2F0OA 3DUZA 4KV6A 3HOUB 1TS5A 4QMGA 2MPMA 2C5CA 3T13A 3NQIA 1S5FD 2RKSA 4ZRZA 2E75C 1LV9A 4G7OC 5EQ0A 2K33A 3OSOA 2O2LD 2R7ZB 3I70A 1WCMB 4M1UB 1R4QB 1EU3A 1X3PA 2ICEC 1X3QA 3D6WA 5CV6A 3M4YA 3K5MA 1HQRD 4DNRB 2PZWA 5K5PA 4FF2A 4ULLA 1O7LA 3GTPB 1W6JA 3OWFA 2L9HA 5M3MB 1Y8OB 2R92B 2OXPA 2F0DA 1EFID 1C8CA 1KTKA 3VR2A 2QKIC 1NR2A 2NBFA 1PRTB 1UEAB 4KN7C 2LKVA 2HCIA 1SMYD 3TP5A 4DAYA 2VNUD 1RKNA 2D2CC 3CKIB 5JEAG 1SFOB 4EVOA 3DWQA 4DFAA 1CHPD 1PZID 1TY0A 2D62A 1ENFA 3SE0A 4HSPA 4IUNA 4S3SA 1EWCA 2FFKB 2PYKA 2F0TA 4H0LC 3BVZA 1KDCA 5G3LF 1CM9A 1GHKA 5C5LA 1TS3A 3I4LA 2KVMA 3DEPA 1ML0D 2D5DA 1LTGD 5E1FA 2IX3A 3SK8A 1TWHB 3OIQA 1FD7D 2WKCA 3S1QB 3P1HA 2JA8B 1XWEA 1VCIA 5KNCA 4G7HC 1FNWA 2F0HA 4NP5A 2A74C 3WDNA 3WOFA 1B2TA 1BCPC 5M3FB 4K2LA 3PIP3 3K5LA 3NXWA 3EA6A 4K5XA 1ESRA 5IT9L 1STHA 1EU4A 1K8OA 2QILA 2FINB 1SYCA 3HRZC 1DXMA 1G91A 1HHVA 3NE5B 1GUGA 2VB2X 3H0GB 5DEHA 2JYOA 3DM1A 4WORA 2BE5D 1DD2A 2XRQD 2TMPA 1IW7C 3J81E 2EE1A 3NQTA 1R4PB 5C3WA 1WTXA 3FDTA 5HURA 2EVBA 5DM63 1D2BA 5CR3A 3MEHA 1Y1WB 5DAUA 3Q0AA 5KYLA 1WVLA 2F4IA 4A3BB 3KLSX 2PZUA 3L7ZC 2I46A 3MVVA 2QCPX 3I8ZA 1F9SA 4UAIA 3P20A 3MWYW 1GJXA 4R9WA 1G2TA 2PW5A 2KJXA 4OO1H 2FJ2A 1Z6HA 1Z47A 3ITPA 4ZUIA 1I4PA 1HXYD 4ZKBB 1SYFA 3H94A 3IFDA 4C2MB 1FR3A 3WOEA 1TWFB 2X6GA 2K32A 1J8IA 4OO1G 2XN9C 3EQLC 5KIXA 5K36G 3FKIB 1VMCA 4G4KA 2JA5B 4K5WA 2EYLA 5M9OA 3I73A 3A8IE 3SK5A 4C56C 2FMMA 5FO9B 1F2LA 5JPMC 1STAA 2YU9B 3X3NA 5JPNC 1ESFA 1CT1D 1B1ZA 2X69A 2R61A 4RCNA 2B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  1JE4 A;  2VXW A;  3F2U A;  1JIC A;  1U4P A;  1C8C A;  1NR4 A;  1DOK A;  4HAE A;  1HFG A;  1HA6 A;  4OIJ A;  5DNF A;  5CMD A;  2KUM A;  1RTO A;  1SAP A;  2K03 A;  5CBE E;  1NR2 A;  1CA5 A;  1G2S A;  4QUF A;  1PFB A;  5E4W C;  2CVR A;  4U68 A;  4DN4 M;  2K04 A;  2L4N A;  1GUW A;  1WTX A;  1AZQ A;  2R3Z A;  2HCI A;  1O80 A;  3FDT A;  4CJ2 C;  2H1E A;  1WTO A;  4X3T A;  2HDM A;  3I90 A;  4RAU C;  4CJ0 B;  3KBX A;  5EPL A;  1B4O A;  4MHE A;  1WD0 A;  4IUR A;  2B2T A;  3IL8 A;  3SVM A;  4ZK9 B;  2HCC A;  2NYZ D;  1NAP A;  1MSH A;  2B2U C;  3UI2 A;  4IUT A;  3TN2 A;  1AZP A;  1PLF A;  2RA4 A;  5EPK A;  4LMQ D;  2KEC A;  5JJZ A;  2NWG A;  2SDF A;  2K01 A;  4HSV A;  1WVL A;  3GV3 A;  5EKI A;  4IUQ A;  2FFK B;  1NCV A;  2EOT A;  5COR A;  1G6Z A;  1KNA A;  1B53 A;  1B3A A;  1DOM A;  1O7Z A;  2NZ1 D;  3H91 A;  3HP3 A;  1CM9 A;  2MGS A;  1G2T A;  1EIH A;  2L11 A;  4R8I A;  3I8Z A;  4OIK A;  1EL0 A;  2K05 A;  4ZKC B;  1PDQ A;  1F9S A;  2RSN A;  2X6L A;  1KNE A;  2B2W C;  2KVM A;  3DEP A;  3G7L A;  4UAI A;  2Q8R E;  5T1I A;  1ML0 D;  2B2U A;  1HRJ A;  1U4L A;  3MWY W;  4X3U A;  1F9R A;  2RSO A;  1PFN A;  2M2L A;  1SSO A;  1XX8 A;  2EE1 A;  4R9W A;  3Q6S A;  3KUP A;  1BO0 A;  4MN3 A;  1BNZ A;  1QE6 A;  2JP1 A;  1EOT A;  4RWS C;  5EJW A;  1WTR A;  1WD1 A;  1B50 A;  1BBX C;  2B2Y A;  2KED A;  1IKL A;  2FJ2 A;  2KEE A;  4RA8 A;  5EPJ A;  1F9P A;  3ONA B;  3FPU B;  5CBA E;  1BF4 A;  5D65 A;  5AFW A;  4XDX A;  2IL8 A;  1S4Z A;  2D9U A;  3I91 A;  2FHT A;  2K28 A;  3MTS A;  1WTV A;  1HUN A;  1TVX A;  4ZKB B;  2MP1 A;  1X32 A;  4XT1 B;  1MI2 A;  4IUV A;  2DY7 A;  1B2T A;  3IFD A;  4O42 A;  2N55 A;  1IKM A;  2B2V C;  2MPM A;  2Q8T A;  5COY A;  5E4X A;  1DZ1 A;  1EQT A;  2XIW A;  2X6G A;  4NW2 A;  4ZAI A;  1HFN A;  1QG7 A;  2L1B A;  1J8I A;  2KOL A;  1EIG A;  1RHP A;  2DY8 A;  2K1B A;  1ROD A;  2BDN A;  1LV9 A;  4IUU A;  1HUM A;  1WTQ A;  1F9Q A;  1WTP A;  2EPB A;  4X3S A;  5EQ0 A;  1CA6 A;  1ESR A;  1Q3L A;  2N88 A;  1ZXT A;  2J7Z A;  4CJ1 B;  1VMC A;  4X3K A;  1AP0 A;  1PFM A;  5T1G A;  5D14 A;  1ICW A;  3I3C A;  3GV6 A;  3R93 A;  1E0B A;  2L12 A;  2B2Y C;  1X3P A;  1DON A;  2HUG A;  4HED A;  1A15 A;  1O7Y A;  1X3Q A;  3D6W A;  4QUC A;  2B2V A;  1RJT A;  2FIN B;  1U4M A;  4IUP A;  4XT3 B;  2FMM A;  4ZLT F;  1G91 A;  1J9O A;  1F2L A;  3QO2 A;  2B2W A;  1HHV A;  4HCS A;  2MJ8 A;  1RTN A;  2RVL A;  1U4R A;  2JYO A;  3DM1 A;  3P7J A;  2L9H A;  1VMP A;  1XYI A;  1QNK A;  1DOL A;  1IL8 A;  2HDL A;  1ILP A;  3DEO A;  2B2T C;  1WTW A;  3LWE A;  1SDF A;  2X69 A;  3TZD A;  1MGS A;  1M8A A;  3N52 A;  1ILQ A; 
#chains in the Genus database with same CATH topology
 4C3I H;  2BDO A;  4DAP A;  2LY7 A;  5LMN Q;  1C0A A;  1NNX A;  2JA7 G;  1TKW B;  5C4J H;  1UE7 A;  2K03 A;  1EY8 A;  2Z0S A;  3NHH A;  1D5X C;  2F0L A;  3EVQ A;  3VR6 A;  2RDG A;  3GQB A;  4X62 Q;  1XJV A;  3C2P A;  3DHQ A;  4F7X A;  1YHQ A;  4ILW A;  1SYB A;  4RGM A;  4CJ0 B;  2KCN A;  1SE4 A;  3HG9 A;  4TKO B;  4C3I G;  4ID6 A;  4ZK9 B;  3CQZ B;  1Q8I A;  2ZM6 Q;  2XVS A;  2A68 C;  5C3E H;  5EPK A;  4XIG S;  3KF8 A;  1K3B C;  4KD3 A;  4K8J A;  1X3G A;  5GAG C;  1B9N A;  3ZYY X;  4ALP A;  4RCO A;  1FNV A;  4KHP Q;  3AFP A;  2B8F A;  3H3V H;  1U0L A;  1Z9F A;  2NZO A;  1XXG A;  4KJN A;  3C1F A;  5CC4 A;  1VQI A;  1ZEQ X;  3A5Z B;  1SNM A;  3RLN A;  5KGU A;  4X3U A;  1BR9 A;  1Q1B A;  3TSS A;  3J81 L;  3GTM H;  3CCS A;  3SDZ A;  4FXK C;  2BCO A;  5E3F A;  3D31 A;  4DR5 Q;  3DLL A;  4KJO A;  1EZ8 A;  1SYG A;  1Q1E A;  2PZT A;  4XYO A;  3HZX A;  5BN4 A;  1X56 A;  2EZV A;  4XT1 B;  2I07 B;  1MI2 A;  2CQA A;  4IUV A;  4O42 A;  1UE5 A;  1T9H A;  3U9O A;  3TZU A;  5IGF A;  3D6C A;  2P5Z X;  1LT4 D;  2PMZ E;  1QG7 A;  2JEA I;  1I4G A;  2KOL A;  4NXM Q;  3S16 H;  4DV3 Q;  5IOC A;  4KLK A;  3TP8 A;  4H02 A;  4C1N K;  2WB1 G;  1YJN A;  2N88 A;  2WAQ E;  1PFM A;  5G3L D;  1QJO A;  4G57 A;  3K59 A;  5FO7 B;  2Z1C A;  3OYY A;  1PTO H;  4DXF A;  1CKO A;  2CH4 A;  2ZXO A;  2E2I B;  2HD3 A;  2G9H D;  1EZ6 A;  1HJP A;  1E2V A;  3OOC A;  1JWM D;  4HCS A;  3S17 B;  1V1P A;  4R4T A;  1T5X D;  3T56 B;  2F3I A;  3GTJ H;  3S1M H;  1BCP D;  3CHB D;  5LMU Q;  1KC8 C;  2DJF C;  4NXM L;  3BVM A;  4JI2 Q;  2PMZ B;  3ERQ A;  1YIJ A;  1XPU A;  3LWE A;  2QA4 A;  2UXC L;  1CZW A;  1HNW Q;  1TII D;  1I4Q A;  4J1M A;  3K8A A;  2WAQ B;  3OWE B;  3WWV A;  2VQE L;  1SMY C;  3MXP A;  3H3V I;  1VQM A;  4U68 A;  1GUW A;  1ONL A;  1K28 A;  4JYA Q;  2F0W A;  3AFQ A;  2ZTC A;  2Q8I B;  3KBX A;  3MZ5 A;  3VYU A;  2CWP A;  3D8G A;  2K5Q A;  1E7Z A;  4X65 Q;  1HZB A;  4GN5 A;  2WV6 D;  4GOP B;  4LMQ D;  5DLQ E;  4OX9 Q;  3HOU H;  3NPP A;  4HSV A;  1PZJ D;  2F0J A;  3K6O A;  4A93 B;  4K6L A;  1NCV A;  1YNJ D;  4L63 B;  1GXD C;  2EJM A;  1XNR Q;  2CHB D;  1CSP A;  1QVF A;  4DUY Q;  3GTQ B;  1NUC A;  4PZ7 A;  3HOU G;  3NTI A;  1F9R A;  1IXR A;  1WCM H;  4B3T Q;  4WJ4 A;  4RWS C;  1XMO Q;  2E5L L;  2VB3 X;  2WP8 J;  3H6M A;  5IP7 H;  3TEH B;  2OCE A;  1JB7 A;  4IOA A;  3GTP H;  4X66 L;  1I4R A;  5M3M H;  1VQ6 A;  2B2V C;  1MJC A;  5I4D A;  2RDF A;  1LUZ A;  1EQT A;  3I7F A;  4UP9 A;  5IT9 c;  1OTC A;  2R92 H;  2VL6 A;  1HUM A;  4AYB G;  5IP7 G;  5I6Y A;  4HMI A;  1VQO A;  1W6K A;  4AH6 A;  3PGZ A;  3R93 A;  5M3M G;  4CHT B;  4LF9 L;  1A3V A;  1KXL A;  3OMG A;  1F2Z A;  1OXT A;  4JC0 A;  4HED A;  2A69 D;  3EFX D;  1VQ9 A;  2RHS B;  3J7Z C;  2R92 G;  5BR8 L;  4GS3 A;  1IYJ B;  2BE5 C;  1SFO H;  1LTL A;  4LUZ A;  4A3G G;  1E1T A;  2K52 A;  1KLG D;  2XTI A;  4OL7 A;  2LFN A;  1VMP A;  1QNK A;  5A2Q E;  4JVZ A;  4Q5V A;  5M5W H;  1R9T B;  3A5U A;  1UE1 A;  3KDF B;  5IGE A;  2UUA Q;  5IE8 A;  5J1Z A;  3SK6 A;  1VDZ A;  2NTT A;  2PI2 A;  4CGY B;  4DAM A;  4JK1 C;  4RMF A;  5GAD C;  1AW7 A;  4JPB W;  3CD6 A;  1TWH H;  3PIO 3;  4DV5 Q;  2IX0 A;  1X9N A;  5FLX E;  4K0K L;  2V1C C;  1B4O A;  1QNU A;  5EKL A;  3EJI A;  5FO8 B;  3R2I A;  4BBR B;  3S1Q H;  2UXD L;  4ZUJ A;  1DYQ A;  2JA8 H;  3PSI A;  1ICF B;  4NXN L;  1FL0 A;  5GAH C;  5M3F H;  1IBM L;  2EY6 A;  2VW9 A;  2E2J B;  5M5Y B;  1B3A A;  1DOM A;  2NZ1 D;  5A35 A;  2NVQ B;  2L0C A;  1X65 A;  2GA4 B;  4FF3 A;  4HN7 A;  3FPP A;  4HJ9 A;  3J7A 5;  2K75 A;  1K0R A;  2R7D A;  3CMA A;  2JA8 G;  1I94 Q;  1KNE A;  2I5H A;  3U4V A;  3X3M A;  4JBM A;  2Q8R E;  4IAL A;  2C9O A;  5CV4 A;  2MHV A;  4ME5 A;  1UUP A;  4XXE A;  5M3F G;  1PFN A;  2M2L A;  3RZD B;  3SHL A;  3PV0 A;  4LFA L;  4KMU C;  3F1Z A;  1CUK A;  4DK6 C;  5JVG 3;  2J0T D;  3A8K E;  1XMQ L;  4JOI C;  4EQO A;  1PTO F;  4XDX A;  4HJ7 A;  1KAB A;  5C4Z A;  2Z4H A;  2KHJ A;  4DV0 Q;  3HOV B;  3MTS A;  3H0G H;  3F2C A;  1X32 A;  2BH8 A;  1TU2 B;  1KIX A;  4YHH L;  1IKM A;  3CCL A;  1GOZ A;  2AQ3 B;  5COY A;  5E4X A;  1EEI D;  2XIW A;  2KA7 A;  2KEN A;  1I94 L;  4A3M B;  3UDF A;  4DR3 Q;  1Q8K A;  2YYZ A;  4DV7 Q;  2J7Z A;  2NVY B;  3H0G G;  3K81 C;  3I3C A;  1EY9 A;  2K50 A;  5AJ3 Q;  2F0M A;  2PPB C;  2L12 A;  1H9K A;  3DMU A;  4JBW A;  1JE5 A;  2Q2I A;  3MXN A;  4QUC A;  3G71 A;  2LSS A;  2EYO A;  2C35 B;  4DV0 L;  1SJH D;  3MXN B;  2B2W A;  2F0S A;  4H13 C;  4IJL A;  1F2Y A;  3M4Q A;  3PUZ A;  1I50 B;  3E0E A;  1KD1 C;  1D5M C;  2B2T C;  3FP9 A;  4A3B H;  2G5D A;  3F2U A;  4DV7 L;  2RBM A;  4AQY L;  3J7Y W;  5FKA C;  3HKS A;  5IGB A;  3NTH A;  1HR0 L;  4A3F B;  4KK7 A;  5AJ3 L;  3CME A;  1XPR A;  1Y8N B;  1Y14 B;  1I4X A;  4HR7 B;  4CJ2 C;  4A3K B;  1GVP A;  1FGB D;  2A5H A;  3NK9 A;  2QDB A;  4DR1 Q;  5EPL A;  3CCV A;  2EYJ A;  2F0U A;  1NAP A;  4A3J B;  2NN6 H;  3AU7 A;  2CH4 W;  1OXU A;  3BJU A;  3HS0 C;  5JAV A;  4X64 Q;  4QGU A;  4C2M H;  4IFD H;  5EKI A;  4LFC Q;  4A3I B;  3A55 A;  4GKJ L;  1TWF H;  1G6Z A;  4YCW A;  3RLF A;  1S5B D;  3DM3 A;  4TRD A;  4RHR A;  5C5M A;  3QB3 A;  5JJK A;  1A0I A;  3KJO A;  2NN6 G;  1XPO A;  4C3H B;  3J81 c;  3D3R A;  4JI4 L;  2EYM A;  1OXV A;  3NTK A;  5FLM H;  3FKI H;  5A2Q L;  2JA5 H;  4DR1 L;  1FJG Q;  4LF5 Q;  1EQR A;  4IFD G;  4FDB A;  3KF6 B;  3K57 A;  1F77 A;  5CV7 A;  1PRT F;  1WD1 A;  3J80 L;  1JJG A;  2F3W A;  3B6Y A;  4IPH A;  3M3Y B;  3U4Z A;  2B63 B;  2XNA C;  3BDL A;  1C9O A;  2IL8 A;  2YU9 H;  4LFC L;  3S2D B;  3FKI G;  2MP1 A;  2JA5 G;  1IBL Q;  2LXJ A;  4RG1 A;  2PO4 A;  3V2T A;  5FLX L;  4LAA A;  1KLU D;  4OEM B;  1EY6 A;  3KYH C;  4K6D A;  2AQ2 B;  4N8F A;  1EIG A;  1RHP A;  2HQE A;  4UP8 A;  3L2P A;  4HTH A;  1L0W A;  2YTX A;  1I4H A;  4KY5 A;  3M85 A;  4RKL A;  2ICI A;  1ICW A;  3GV6 A;  2Z9H A;  2O5I C;  1TWA B;  1IYV A;  1ENC A;  3I4O A;  2LS0 1;  2PW7 A;  3BZD B;  2I5L X;  4UDU C;  1HNZ L;  1BCP B;  5IYB G;  1SE3 A;  1E2Z A;  1QZH A;  3CQZ H;  5CYU A;  5I9O A;  1Y1V B;  1A3U A;  4IFD J;  2SEB D;  3QWN A;  1TR5 A;  2F0P A;  1VQN A;  5CV5 A;  1DOL A;  4B3R Q;  4GNX C;  1HTP A;  2AWN A;  1LYL A;  2JA6 H;  4IFD I;  4RFB A;  5KND A;  4F88 A;  4L5T A;  3S2H B;  2KUM A;  2H4O A;  4JV5 Q;  4RH6 A;  1N34 Q;  4DN4 M;  1I6V C;  4HMJ A;  3PQI A;  2FMC A;  2VQF L;  4EX5 A;  2H1E A;  3I90 A;  4OON A;  2JA6 G;  3W5O A;  2F0V A;  3QJY A;  2PNR C;  1JR0 D;  4YWM A;  2B2U C;  3OIP A;  5ELC A;  1JC7 A;  4B3R L;  1YNJ C;  1I6H H;  1HZ9 A;  1NMG A;  4IUQ A;  5C4X H;  1PH9 A;  1N33 Q;  4R8I A;  1D7Q A;  1EL0 A;  1PH1 A;  5T1I A;  2B39 A;  1CKN A;  1A8V A;  4LUO A;  2Q2H A;  5ELF A;  4JI7 L;  1TXY A;  4OWW B;  1VQK A;  1EOT A;  2MUY A;  1W2B A;  1Q86 C;  3Q24 A;  1TWG B;  1M1K C;  2KED A;  4NDX A;  5EPJ A;  1L1O A;  5C4X G;  3ONA B;  3KLR A;  4B08 A;  1QZG A;  1JQY D;  2WIN B;  1GM5 A;  3S17 H;  4V19 0;  1A3T A;  2OF1 A;  2Z6K A;  2F1M A;  1N33 L;  4ZAI A;  1STB A;  1STG A;  3CF5 A;  4DR2 L;  4K2K A;  2DY8 A;  1ROD A;  2QGQ A;  2EXZ A;  1VQL A;  3DWP A;  1F2M A;  1WTP A;  1TT2 A;  1C48 A;  2EPB A;  1JMC A;  3FMC A;  2R93 B;  2KHS A;  4RKB A;  4PMW A;  2A69 C;  4KY6 A;  2NVX B;  1OXX K;  3IKJ A;  4YCU A;  3U50 C;  3AQQ A;  4B3S Q;  4XT3 B;  1A2U A;  3BDC A;  2ATW A;  3EBE A;  1I3Q B;  2YV5 A;  5KRU A;  1VQH A;  5C44 G;  3MHB A;  3O13 A;  2AUJ D;  1XYI A;  1IL8 A;  4FYD A;  2K5N A;  5J3B A;  1X55 A;  4A93 H;  4KY7 A;  1KAA A;  1SDF A;  4DV4 Q;  1HTL D;  2IHE A;  3HKZ E;  4LNQ A;  4HAE A;  1QIL A;  5FJ8 G;  1EYC A;  1SAP A;  3BYY B;  2A6E D;  3GTQ H;  4QY7 A;  1G8Z D;  2UUB Q;  3GDE A;  2CVR A;  1SE2 A;  2YTV A;  1PHJ A;  3RN2 A;  2ID0 A;  3BVG A;  5ELB A;  4X3T A;  5J39 A;  3HOW H;  2L15 A;  1BVS A;  3OMC A;  5IGC A;  2MO1 A;  4A3E G;  1RF2 D;  1Q46 A;  1Q81 C;  1JT8 A;  3NWT A;  1K0S A;  3M7G A;  5EBC A;  3M4O B;  1YHB A;  5H1S E;  5ELE A;  3HOW G;  2TSS A;  4L5R C;  3A7L A;  3HKZ B;  2MGS A;  2UUB L;  1G29 1;  1LTI D;  4OXP A;  1HNX L;  1BKB A;  1J5E Q;  2ALY B;  4A3C G;  4JI3 Q;  3HOY B;  1U4L A;  4LF7 L;  4A3L H;  2HQL A;  2RSO A;  4RGN A;  3CXC A;  1Q82 C;  3KUP A;  1QE6 A;  2JP1 A;  4QF4 A;  1EYG A;  4OO1 I;  2I5M X;  4A4I A;  4RA8 A;  1XNQ L;  2Q2T A;  1AEX A;  5DM7 3;  1GUO A;  1LLR D;  5LMN L;  4LW1 A;  5C3X A;  1CQV A;  2FHT A;  1EEF D;  4DXG A;  1ASZ A;  4A3L G;  4ME3 A;  1T5E A;  4TQU S;  4DF7 A;  4WFN 3;  4BY1 B;  1MD2 D;  4X62 L;  4KKS A;  3ND8 A;  4H7B A;  1N8R C;  5C3E G;  1R9T H;  2LMC B;  3I56 A;  4P72 A;  2B8G A;  4X3S A;  3L3O C;  2HT1 A;  4BY7 H;  1G6P A;  2ZM6 L;  1PVO A;  4J15 A;  1YJW A;  1E0B A;  3NBI A;  1N36 Q;  4FF1 A;  3RMH A;  3MA2 B;  1SRO A;  4JI5 Q;  3RUZ A;  1U4M A;  3PO2 B;  3J80 i;  3KJP A;  4P73 A;  4BBR H;  4KHP L;  1RTN A;  4QIW E;  4BY7 G;  4LFB Q;  4UY8 C;  1PRT D;  3NUC A;  3P7J A;  4HIM A;  4Y7N B;  2IPK D;  3E5S A;  4CKE A;  5KYI A;  1B7Y B;  5M5Y H;  2NVQ H;  1ILQ A;  3AEV A;  2K7V A;  4BBR G;  4P71 A;  4KHZ A;  1N36 L;  4DR5 L;  1SJE D;  4DR7 Q;  1CA5 A;  1SE8 A;  4A3D B;  4QCL A;  3QOL A;  4PMC A;  1PFB A;  4JI5 L;  2Z4I A;  3I55 A;  3VR4 A;  1V1O A;  3PUV A;  3RZD H;  3V96 A;  1IL2 A;  1NMF A;  2GN5 A;  1D5Z C;  1M90 C;  1PFS A;  2BA0 A;  3SVM A;  4IPG A;  2Y0S E;  4DV3 L;  2DJG C;  1JJ2 A;  3DXJ C;  2RA4 A;  1UAP A;  3HOV H;  1Q12 A;  4C3J B;  5JJZ A;  5FK9 C;  3P75 A;  1TS2 A;  4DU9 A;  3CC2 A;  2K01 A;  3G48 A;  1LTB D;  2DN8 A;  1V9P A;  4JW0 A;  2AUK A;  5IIF A;  3HOZ B;  2E2H B;  4DR7 L;  2IW3 A;  1HPC A;  1W3S A;  2XRS D;  4OIK A;  1SMX A;  2CQO A;  1L0X B;  1PDQ A;  3CRL C;  3E9H A;  2NVY H;  3J80 c;  2ES2 A;  2BOS A;  2OT2 A;  5I6W A;  4CDF C;  1SSO A;  2PCF B;  4GOP A;  4GN4 B;  5LMU L;  4TSS A;  4DNI A;  4JI2 L;  3KOJ A;  3QOJ A;  3FPU B;  5CBA E;  2Y0S B;  2RDH A;  2CCZ A;  1BOS A;  1HNW L;  3I4M B;  5FLX c;  3JAM L;  1I50 H;  2F0G A;  4DKA C;  3NEM A;  1E24 A;  5JJL A;  3HOX B;  4DV6 Q;  5BN5 A;  4JYA L;  2KQ3 A;  4OHJ A;  4G7Z C;  4DK3 C;  3K7U C;  2R7Z H;  2LXK A;  1PV4 A;  3C46 A;  2G9D A;  4A3F H;  4K14 A;  1ZYR D;  4CJ1 B;  3CCQ A;  4X3K A;  3SK4 A;  4X65 L;  3CCJ A;  4H44 C;  4OX9 L;  2EJF C;  5KNB A;  2B2V A;  5CGK A;  3NWS A;  5LL6 X;  2ZJQ A;  1SEB D;  3QO2 A;  1MBY A;  2B29 A;  1L0Y B;  4PNY A;  4B9X A;  2R7Z G;  4DR6 Q;  5I2Y A;  1DJR D;  1XNR L;  4A3J H;  4A3F G;  1WCM G;  2HHH Q;  3VR5 A;  3C3L A;  1A2T A;  1CK1 A;  3I2Z A;  3MFY A;  3GD7 A;  5IYC H;  2JA7 B;  4DUY L;  2EYF A;  3S1R B;  5FOB B;  4A3I H;  1JOQ A;  1HZA A;  4B3T L;  3AB9 A;  2K5V A;  4NPS A;  3A8J E;  4A3J G;  1XMO L;  2OTJ A;  2F03 A;  1RTO A;  1YVC A;  1D1K A;  4C3H H;  4C3I B;  3PO3 B;  3RLO A;  4KKU A;  4QUF A;  3CC7 A;  5C4J B;  3RD4 A;  1FNU A;  5JVH 3;  4DR6 L;  4A3I G;  3S24 A;  1GKH A;  4RAU C;  1SNC A;  3GTO B;  1VQB A;  3CCM A;  3VR3 A;  4IUR A;  3M3Y H;  2K4K A;  3TBI B;  2B63 H;  1BDO A;  2WAC A;  1UEB A;  4C3H G;  4HCE A;  2KEC A;  3KDF A;  3J80 E;  3ERO A;  2WB1 E;  3CAM A;  4OGQ C;  1H9S A;  3S15 B;  2NTS A;  2QEJ C;  5EKK A;  4KKT A;  1H9S B;  1K9M C;  1EIF A;  3SXH A;  4KI0 A;  1D6E C;  3T51 B;  1FYC A;  3UDI A;  4HIK A;  4JI0 Q;  3H3V C;  2H5X A;  4APV A;  2R7F A;  2CW0 C;  1UE6 A;  1RL2 A;  1JWU D;  1M4V A;  1KQS A;  3VA5 A;  3QIA A;  3UE0 A;  1II3 A;  1QOH A;  3D4D A;  3GTM B;  1K83 B;  2QEX A;  3H09 A;  1VQF A;  2JN4 A;  5AFW A;  3S14 B;  1SBB B;  1Y1V H;  3I91 A;  2UUA L;  1TVX A;  2DY7 A;  2WB1 B;  3F2B A;  2A8V A;  4Y52 H;  3HEJ A;  3TS2 A;  2DNE A;  2XWB B;  2OEO A;  3L9A X;  4WJ3 M;  4DV5 L;  2BDN A;  3K58 A;  4A76 A;  2EY5 A;  3K5O A;  1F9Q A;  4RGT A;  2HIV A;  3LWU A;  3C1E A;  1VQP A;  1Y1V G;  1ZXT A;  4DV1 Q;  4JOI A;  3PIP A;  3S16 B;  5IP9 H;  1AP0 A;  4P2C B;  4GLX A;  1PH2 A;  1A15 A;  1EFW A;  3D0F A;  3Q8D A;  5C0X H;  4DAV A;  4ABN A;  1DGS A;  4DGZ A;  3M7N A;  3W1G A;  4IZ8 A;  2O5J C;  5IP9 G;  1PTO C;  2L55 A;  4C1N I;  1SNO A;  3MXU A;  3NSW A;  1KHI A;  1YJ9 A;  2J4X A;  4Q0F A;  3N52 A;  5C0X G;  2VXW A;  2A6E C;  1ET6 A;  3IFT A;  5BN3 A;  4XTC S;  3VA7 A;  4LJZ C;  5CMD A;  1GUS A;  2UXB Q;  2SNS A;  1MKH A;  1NSN S;  2JEB I;  1UWV A;  2F0F A;  2DNC A;  1EWI A;  1AFP A;  4LF6 Q;  2F3V A;  1Y1W H;  4R4C A;  1WD0 A;  1YEZ A;  4MHE A;  1STN A;  4CBV A;  1Y8P B;  2B2T A;  3KBG A;  3W2D A;  2Q2U A;  2NYZ D;  2E76 C;  4O1N A;  2EDG A;  4DR3 L;  4IQZ A;  4AYB E;  1WJJ A;  2ZJR A;  2EOT A;  2EY1 A;  1LTS D;  1Y1W G;  1K8A C;  2UXB L;  4DK0 A;  2RCF A;  1VQD A;  2IX1 A;  2IWH A;  2AHO B;  1DCZ A;  1LAC A;  1CI3 M;  2R93 H;  2JA9 A;  2B2W C;  4A3B G;  4E6I A;  1QB5 D;  4AIM A;  2NVX H;  3OHX C;  1EOV A;  1B9M A;  5C0X J;  1XX8 A;  4XYQ A;  2A6H D;  3Q6S A;  1BBX C;  1H9M A;  1F9P A;  4QL5 A;  4NKL A;  4TVA B;  3BG3 A;  1S5C D;  1I3Q H;  5C0X I;  1B3Q A;  4YY3 Q;  4ODG A;  2IJ0 A;  4AYB B;  2XWJ B;  5CV9 A;  2Q8T A;  1YNN C;  1KL9 A;  3TP7 A;  3MC0 B;  2K1B A;  3E3X A;  3KF6 A;  1EY4 A;  2F0E A;  2F0K A;  4QQB X;  2PQA B;  5TSS A;  4JG2 A;  3PCO B;  4F8M A;  1VF5 C;  1WTH A;  5D14 A;  2ZXR A;  5JEA H;  2NB0 A;  3K80 C;  2ZJP A;  3U9S A;  1DON A;  4X64 L;  1O7Y A;  4A3G B;  2F4V Q;  1Q90 A;  4MIU A;  2F0I A;  2R6G A;  2XGT A;  5FLM G;  5IYD H;  1AE2 A;  5ELN A;  1PRT C;  2WKD A;  4CDD C;  3CPF A;  3IAY A;  4CKC A;  1ET9 A;  1LT3 D;  4QJF A;  3N6R A;  3JAM i;  4BXX H;  2D0P A;  4R4O A;  3M4O H;  3DEO A;  5EAY A;  1FJG L;  4LF5 L;  3VYR A;  1TWC B;  1MGS A;  5IYD G;  3LX0 A;  2GVA A;  3GTL B;  2ZTE A;  2K5D A;  4X6A H;  1HA6 A;  1HFG A;  4OIJ A;  4KTA A;  3OW7 A;  5HGQ A;  5IWA Q;  5M5W B;  1CSQ A;  3HOY H;  3UE1 A;  4JI8 Q;  3GTK B;  3T1Y Q;  4BXX G;  4WRD A;  1IBL L;  3GP7 A;  2ZXP A;  1STE A;  1SR3 A;  5IY0 A;  4FO2 A;  1YIT A;  2NN6 I;  4GNX B;  5I9P A;  1SNP A;  1BCP F;  4PMB A;  3CW2 C;  2V4D A;  4JI1 Q;  2DUD A;  3GV3 A;  1A62 A;  1H9J A;  5HGT A;  3BS1 A;  3CCU A;  1O7Z A;  2F0Q A;  3E9I A;  2NUC A;  4N9P A;  3TRZ A;  4J8Q A;  2EYH A;  2QF7 A;  2KBN A;  3A7A B;  3W3A A;  5JEA J;  2RSN A;  3RNU A;  1BQQ T;  2B2U A;  4DR4 Q;  4GZY C;  1YBY A;  1BUV T;  1LTT D;  1VQ7 A;  1IBK Q;  1B50 A;  2A19 A;  3BDO A;  1LT6 D;  1HR0 W;  3PO2 H;  1B70 B;  3JAM c;  4POG A;  1HCZ A;  4JI1 L;  1D1I A;  1QVG A;  1EUJ A;  1VQJ A;  4JI6 Q;  2UU9 Q;  4IJH A;  1PYW D;  4Y7N H;  4JV5 L;  1N34 L;  4NW2 A;  2E74 C;  4I7Z C;  1ZYR C;  3PO2 G;  3J81 j;  4GLA C;  4N9T A;  3R8B A;  3R3O A;  4OWT B;  3U58 A;  4A3D H;  5T1G A;  1PXU A;  2E2I H;  4FVM A;  2CW0 D;  1NY4 A;  2HUG A;  4M8A A;  4FF4 A;  4K8I A;  3A56 A;  2OTL A;  1Y69 U;  3FRP B;  1J9O A;  1EY7 A;  4JI6 L;  5C4H A;  2UU9 L;  2MJ8 A;  1SYE A;  1LTA D;  4OWX B;  4L6T B;  3F2D A;  3GTG B;  5I2X A;  4A3D G;  2JXM B;  4C3J H;  1HA5 A;  2NZH A;  4BBS B;  2GVB A;  4MZ9 A;  2B3G A;  1KDB A;  1M8A A;  3HOZ H;  2E2H H;  1CZG A;  1U4P A;  3M4P A;  3SEB A;  1L1O C;  1VQ5 A;  5E7N A;  4C3J G;  3QG1 A;  2K04 A;  2L4N A;  1D8L A;  4O2D A;  1AZQ A;  1O80 A;  1LAB A;  1B8A A;  2WAQ G;  4I7A A;  2BA1 A;  4DV2 Q;  3IL8 A;  2ZT9 C;  4V0B A;  4POF A;  2EJG C;  1E1O A;  4FNF A;  3UI2 A;  1PYB A;  1AZP A;  2SNM A;  1PTO D;  3MAQ A;  3I4M H;  1LT5 D;  2NWG A;  2SDF A;  4XQQ A;  1ENA A;  5K36 H;  1KNA A;  1RD9 D;  3HOX H;  1C7Y A;  4L5Q A;  2KCM A;  3H91 A;  4B3S L;  5D3D A;  3JAM E;  1Z7T A;  1JB3 A;  2UUC Q;  4U67 3;  4A93 G;  1CKM A;  3I4M G;  1HRJ A;  2N8N A;  4PZ8 A;  1HZC A;  2RQX A;  3K7A B;  3OW2 A;  2AWO A;  1U9R A;  2DGY A;  4MN3 A;  1TS4 A;  3RN5 A;  1WTR A;  3SGI A;  1H95 A;  3ICE A;  3T4A C;  4DV4 L;  1S4Z A;  2OQK A;  3TDQ A;  3E0J A;  2VY3 A;  1TY2 A;  1E3P A;  1SRU A;  2JA7 H;  1CQF A;  1IYU A;  3S1R H;  1AE3 A;  1DZ1 A;  1EQV A;  2K5W A;  3TP6 A;  1X3E A;  2AMC B;  2UUC L;  3Q22 A;  4JBK A;  4ZQ3 A;  1TQO A;  2IY5 B;  3K5N A;  2VUM B;  5LL6 S;  3PUX A;  4P74 A;  4YCV A;  1CA6 A;  1S5D D;  5ELD A;  1B44 D;  1JWS D;  1EYA A;  1JOK A;  4GLV B;  3LNN A;  3PO3 H;  2RF4 A;  3FVQ A;  4DK1 A;  4BWG B;  4CDE C;  2HIX A;  1PH6 A;  2B2Y C;  3PUY A;  2KCC A;  1S5E D;  3GTO H;  4XQN A;  2KHI A;  1WOC A;  4R8N A;  3PO3 G;  5CV8 A;  3NBH A;  3FEW X;  3ER0 A;  3MXG A;  3STB D;  1J5E L;  2E8G A;  3NBH B;  3TRE A;  4JI3 L;  1VS0 A;  5J22 A;  5IGD A;  1YNN D;  1X3F A;  3F8T A;  3S15 H;  4P75 A;  3RZO B;  4IUP A;  1MSG A;  4BA2 I;  4IPC A;  2ENB A;  5IOD A;  3ULP A;  3KF8 B;  1AN8 A;  3CPW A;  3J7A F;  2SOB A;  4K5V A;  3RR5 A;  2JA6 B;  5CBE E;  3T1H Q;  4BS9 A;  5E4W C;  1EYD A;  3S1N B;  1E2W A;  4CDC C;  2HDM A;  1C4Q A;  3PIO A;  2MNA A;  1E22 A;  1K83 H;  3D4R A;  3S14 H;  1EWH A;  4OEL B;  1YHA A;  3S9W A;  2E2J H;  3CRK C;  1SYD A;  2L5T A;  4LUV A;  4UP7 A;  1S3O A;  1PMR A;  5F2D A;  1EY5 A;  5COR A;  2CFM A;  1CHQ D;  1I6H B;  1CFM A;  3HP3 A;  1A6X A;  4XQJ A;  3I4N B;  2L11 A;  3T1H L;  1EIH A;  4YWK A;  1VF7 A;  2K05 A;  4ZKC B;  1SN8 A;  2X6L A;  2A6H C;  3EIV A;  3V05 A;  4EGV A;  5C4X B;  4LFB L;  2UXC Q;  4QIW B;  1BO0 A;  4NMZ A;  5EJW A;  1PZK D;  3PMF A;  1V43 A;  3ND9 A;  4N8X 1;  1LTR D;  4FXG C;  2VQE Q;  3J7A V;  2D9U A;  1HQM C;  5M5X B;  2KCT A;  4EQ5 A;  2JJQ A;  3DWA A;  2N55 A;  4MTK A;  4A3M H;  3KK7 A;  3W1B A;  4GKK Q;  2E2D C;  2YTY A;  1EY0 A;  4EQN A;  1HFN A;  1P16 A;  1V1P B;  3CU7 A;  3HOV G;  2M9V A;  1GUN A;  1WTQ A;  1PA6 A;  1K8M A;  2MQH A;  1IHZ A;  1Q3L A;  1ZKO A;  1KRT A;  5NUC A;  4A3M G;  3K0X A;  5C44 B;  3QR8 A;  4BA1 I;  4LF8 Q;  1RJT A;  1U5K A;  2PNH A;  4RGO S;  1PH3 A;  1UNS A;  2NVT B;  4PV1 C;  3CC4 A;  2RVL A;  5C6A A;  1LO5 D;  4GKK L;  3VYT A;  2N3S A;  1N9W A;  2HDL A;  4WJW A;  2E5L Q;  1YZ6 A;  1WTW A;  4RHS A;  2JE6 I;  3TZD A;  3PF4 A;  2Z8L A;  4GOP C;  1JE4 A;  1JIC A;  1JJC B;  5LMN W;  1NR4 A;  1P8L A;  1IW7 D;  1SND A;  5DNF A;  4Z9C B;  4X66 Q;  1K3R A;  4A3K H;  5D3I B;  1JCK B;  1G2S A;  5LHY 1;  4LF8 L;  1K73 C;  3NEN A;  1XTC D;  4A3E B;  2R3Z A;  2ZTD A;  1WTO A;  3I72 A;  1SXT A;  4DV6 L;  3BZC A;  4FP5 D;  4EQP A;  2K14 A;  5EGT A;  4IUT A;  2WII B;  3HOW B;  4A3K G;  4LF9 Q;  1EQQ A;  4CKB A;  3AMU A;  2AQ1 B;  3VYS A;  3BYT B;  4ZCK A;  3MFG A;  2EY2 A;  5BR8 Q;  2O4X A;  4DA2 A;  3SR1 A;  5IYC G;  1FVI A;  4DPG A;  1RCV D;  1QWY A;  1YI2 A;  2HHH L;  5GAE C;  1GHJ A;  2JSO A;  1BNZ A;  4I65 A;  4A3G H;  3PUW A;  4F87 A;  3S2D H;  4B9W A;  4ZYS A;  2PI2 E;  1BF4 A;  4PG3 A;  3OPO A;  5D65 A;  3PF5 A;  3CCR A;  4O0A A;  4YIJ A;  5C3E B;  2K28 A;  1O78 A;  4J6H A;  1HUN A;  1NTG A;  2N78 A;  3T53 B;  1OO9 B;  1SNQ A;  4UPA A;  2B63 G;  4K0K Q;  4HIO A;  2L1B A;  1TWC H;  1S40 A;  2UXD Q;  4IUU A;  3D4W A;  3E6Z X;  4NXN Q;  3GTL H;  1N32 Q;  3TS0 A;  2IT1 A;  1OXS C;  1TWA H;  2VS1 A;  3IRB A;  3BZK A;  1IBM Q;  5KEE A;  3NP8 A;  3GTK H;  2A73 B;  4BY7 B;  2MFI A;  2EXD A;  1WFQ A;  5L37 A;  4ZLT F;  1A63 A;  1V8Q A;  4IN3 A;  1NBW A;  5EBD A;  5IGG A;  2M00 A;  3T16 A;  5HY6 A;  4QB4 A;  1U4R A;  1QUQ A;  1RDP D;  5ISR A;  2I0Q A;  2XSC A;  3HGB A;  1STY A;  1QUQ B;  4LFA Q;  4JI0 L;  4KN4 C;  1N32 L;  1ILP A;  3R2T A;  1XMQ Q;  3S2H H;  4GN3 B;  1GUT A;  2MO0 A;  1CTM A;  2EYP A;  1ASY A;  1DOK A;  1PH5 A;  3KLS A;  2N49 A;  4YHH Q;  3URY A;  1VQ8 A;  4KHV A;  3JC6 6;  1EIY B;  3TME A;  2A1A A;  1DM0 B;  4KD4 A;  3G6E A;  1PTO B;  4LK1 C;  2K6A A;  3K0Y A;  1KDA A;  4A75 A;  4JCV E;  1QCB D;  2HCC A;  1MSH A;  3A54 A;  3TN2 A;  1PLF A;  1JOR A;  3GTJ B;  3S1M B;  5IT9 E;  4DV1 L;  1XTD A;  1S72 A;  4PZ6 A;  4L8J A;  4HJ5 A;  2A68 D;  1B53 A;  1H9R A;  5JOB A;  3FHW A;  3G6J B;  2PQE A;  3GO5 A;  3Q23 A;  3G7L A;  2JK8 A;  1JOO A;  4FXD A;  1TWG H;  1NJI C;  1BXT A;  1VQA A;  4PQX A;  4AQY Q;  4IPD A;  2CKZ B;  1HR0 Q;  1IKL A;  2KEE A;  4DNT B;  3TQY A;  3J81 i;  2F0N A;  1WTV A;  3GTG H;  2F0O A;  3AYH B;  3DUZ A;  4KV6 A;  3HOU B;  1FGU A;  1TS5 A;  4QMG A;  2MPM A;  4MTN A;  2QDL A;  1YNX A;  4BBS H;  2C5C A;  1VQ4 A;  3T13 A;  3NQI A;  1S5F D;  2RKS A;  4ZRZ A;  2E75 C;  4LWC A;  1LV9 A;  1SLJ A;  4G7O C;  4LF6 L;  1VQC A;  1V1Q A;  5EQ0 A;  5JJI A;  2K33 A;  3OSO A;  2IHF A;  3A0J A;  2JQO A;  2O2L D;  2R7Z B;  3G4S A;  4GKJ Q;  3I70 A;  1WCM B;  4M1U B;  1R4Q B;  4BBS G;  1EU3 A;  1X3P A;  2ICE C;  1X3Q A;  3D6W A;  2R93 G;  4IOC A;  2Z6B A;  5CV6 A;  3UDX A;  2OQ0 A;  3M4Y A;  3STB C;  3K5M A;  4JI4 Q;  1HQR D;  4DNR B;  2PZW A;  5K5P A;  1MIU A;  4FF2 A;  4ULL A;  1O7L A;  4R4Q A;  3GTP B;  1W6J A;  3OWF A;  2L9H A;  3M9B A;  5M3M B;  2PQA A;  1Q7Y C;  1O7I A;  1RIP A;  3LGJ A;  1Y8O B;  2R92 B;  2OXP A;  2F0D A;  1EFI D;  1C8C A;  1IZ6 A;  1KTK A;  3VR2 A;  2QKI C;  1PH8 A;  3KLW A;  1NR2 A;  2NBF A;  1AH9 A;  1PRT B;  1UEA B;  3K7A H;  4KN7 C;  2LKV A;  4YY3 L;  2HCI A;  1SMY D;  3TP5 A;  4DAY A;  2VNU D;  1RKN A;  2D2C C;  3CKI B;  4DAY B;  5JEA G;  1SFO B;  4EVO A;  3DWQ A;  4DFA A;  1CHP D;  1PZI D;  1TY0 A;  1PH7 A;  1GO3 E;  1ENF A;  2D62 A;  3SE0 A;  4HSP A;  4IUN A;  5ELO A;  4S3S A;  1EWC A;  4UHV A;  2FFK B;  2PYK A;  2OWO A;  1HNZ Q;  2F0T A;  4H0L C;  1WYD A;  1KDC A;  1KAW A;  3BVZ A;  5G3L F;  3OTO Q;  1CM9 A;  1GHK A;  5C5L A;  1TS3 A;  2F4V L;  2VUM H;  2RCN A;  4NB3 A;  3I4L A;  2KVM A;  3DEP A;  1ML0 D;  2D5D A;  1LTG D;  5IYB H;  5E1F A;  2IX3 A;  3SK8 A;  3HKZ G;  4GNX A;  1TWH B;  1LM0 A;  1WI5 A;  3OIQ A;  1X6O A;  4DUZ Q;  1FD7 D;  1VQE A;  3NEL A;  2WKC A;  3ULL A;  3HOY G;  2VUM G;  3S1Q B;  3P1H A;  2JA8 B;  1XWE A;  1VCI A;  5KNC A;  1BBU A;  4G7H C;  1FNW A;  2F0H A;  4NP5 A;  2A74 C;  3WDN A;  1HH2 P;  5IWA L;  2VQF Q;  4BY1 H;  3WOF A;  1I5F A;  5GRO A;  3OTO L;  1B2T A;  1BCP C;  5M3F B;  4MNO A;  4JI8 L;  3T1Y L;  3KFU A;  3RZO H;  3VDY A;  4K2L A;  3PIP 3;  3K5L A;  3NXW A;  3EA6 A;  4K5X A;  1ESR A;  5IT9 L;  4YWL A;  4BY1 G;  4DUZ L;  3CCE A;  3L0O A;  1STH A;  3EN2 A;  3S1N H;  1EU4 A;  3MEF A;  1K8O A;  2QIL A;  2F52 A;  2FIN B;  1SYC A;  2FXQ A;  1DXM A;  1VQG A;  3HRZ C;  3CP0 A;  1G91 A;  1HHV A;  1PYS B;  1QVC A;  3NE5 B;  1GUG A;  2VB2 X;  4JI7 Q;  3H0G B;  5DEH A;  2JYO A;  3DM1 A;  4WOR A;  2BE5 D;  1DD2 A;  4LF4 Q;  2XRQ D;  2TMP A;  4DR4 L;  1IW7 C;  1J6Q A;  3J81 E;  3A74 A;  3H15 A;  1IBK L;  2EE1 A;  2WFW A;  1PH4 A;  3NQT A;  3ZJY C;  3I4N H;  4HID A;  1R4P B;  1KRS A;  5C3W A;  4HJA A;  1K8G A;  1WTX A;  4DR2 Q;  3FDT A;  5HUR A;  2EVB A;  2EIF A;  5DM6 3;  1D2B A;  1CKN B;  5CR3 A;  3I4N G;  3MEH A;  4LF4 L;  1GD7 A;  1Y1W B;  2BH2 A;  5DAU A;  5M5X H;  3BU2 A;  2VZA A;  3Q0A A;  1L1O B;  5KYL A;  2F4I A;  1WVL A;  4A3B B;  3KLS X;  2PZU A;  2AKW B;  2CWA A;  3L7Z C;  1X54 A;  1BBW A;  1L2F A;  2I46 A;  3MVV A;  2QCP X;  3I8Z A;  1F9S A;  2Z6K C;  2ASB A;  4UAI A;  3P20 A;  3UDG A;  1MJE A;  4JBJ A;  3MWY W;  3HOZ G;  1GJX A;  5GQO A;  1MHW C;  2EQS A;  4R9W A;  1G2T A;  5C44 H;  2PW5 A;  4B3M Q;  2KJX A;  4R1J A;  4OO1 H;  2FJ2 A;  4L5S A;  2NVT H;  1Z6H A;  1Z47 A;  3ITP A;  4ZUI A;  1I4P A;  1HXY D;  2D0O A;  2RHQ B;  4ZKB B;  1SYF A;  2QW7 A;  3ULJ A;  3H94 A;  3IFD A;  4C2M B;  1FR3 A;  3WOE A;  5FJ8 H;  1TWF B;  2Y0S G;  2X6G A;  1NE3 A;  2K32 A;  4IO9 A;  4OO1 G;  1J8I A;  2XN9 C;  4HJ8 A;  3EQL C;  4DV2 L;  5KIX A;  5K36 G;  3FKI B;  1VMC A;  4G4K A;  3HOX G;  2JA5 B;  4B3M L;  4K5W A;  2EYL A;  5M9O A;  4A3E H;  3I73 A;  3A8I E;  1HNX Q;  3SK5 A;  4C56 C;  2FMM A;  5FO9 B;  1F2L A;  1G51 A;  5JPM C;  1STA A;  2YU9 B;  4LF7 Q;  3X3N A;  5JPN C;  4R4I A;  1ESF A;  1CT1 D;  3HFZ B;  2K5H A;  1B1Z A;  3ERS X;  4A3C H;  2X69 A;  2R61 A;  1XNQ Q;  4RCN A;  2B2Y A; 
#chains in the Genus database with same CATH homology
 4DAP A;  2BDO A;  2LY7 A;  1TKW B;  2K03 A;  1EY8 A;  3NHH A;  1D5X C;  2F0L A;  3EVQ A;  3VR6 A;  2RDG A;  3GQB A;  3C2P A;  3DHQ A;  4F7X A;  4ILW A;  1SYB A;  4RGM A;  4CJ0 B;  2KCN A;  1SE4 A;  3HG9 A;  4TKO B;  4C3I G;  4ID6 A;  4ZK9 B;  3CQZ B;  1Q8I A;  2XVS A;  2A68 C;  5EPK A;  4XIG S;  3KF8 A;  4KD3 A;  4K8J A;  1B9N A;  3ZYY X;  4RCO A;  1FNV A;  2B8F A;  1XXG A;  4KJN A;  3C1F A;  5CC4 A;  1ZEQ X;  1SNM A;  5KGU A;  4X3U A;  1BR9 A;  1Q1B A;  3TSS A;  3J81 L;  3SDZ A;  4FXK C;  2BCO A;  5E3F A;  3D31 A;  4KJO A;  1EZ8 A;  1SYG A;  1Q1E A;  2PZT A;  4XYO A;  3HZX A;  5BN4 A;  2EZV A;  4XT1 B;  2I07 B;  1MI2 A;  2CQA A;  4IUV A;  4O42 A;  3U9O A;  5IGF A;  3TZU A;  3D6C A;  1LT4 D;  1QG7 A;  2JEA I;  1I4G A;  2KOL A;  5IOC A;  3TP8 A;  4C1N K;  2N88 A;  1PFM A;  5G3L D;  1QJO A;  4G57 A;  3K59 A;  5FO7 B;  2Z1C A;  1PTO H;  4DXF A;  2ZXO A;  2E2I B;  2G9H D;  1EZ6 A;  1E2V A;  3OOC A;  1JWM D;  4HCS A;  3S17 B;  1V1P A;  1T5X D;  3T56 B;  1BCP D;  3CHB D;  3BVM A;  2PMZ B;  3ERQ A;  3LWE A;  1CZW A;  1TII D;  1I4Q A;  4J1M A;  2WAQ B;  3OWE B;  1SMY C;  3MXP A;  4U68 A;  1GUW A;  1ONL A;  2F0W A;  2Q8I B;  3KBX A;  3MZ5 A;  3VYU A;  3D8G A;  2K5Q A;  2WV6 D;  4LMQ D;  3NPP A;  4HSV A;  1PZJ D;  2F0J A;  3K6O A;  4A93 B;  4K6L A;  1NCV A;  1YNJ D;  4L63 B;  1GXD C;  2EJM A;  2CHB D;  3GTQ B;  1NUC A;  3NTI A;  1F9R A;  4RWS C;  2VB3 X;  2WP8 J;  3H6M A;  1I4R A;  2B2V C;  5I4D A;  2RDF A;  1EQT A;  1HUM A;  5I6Y A;  4HMI A;  1W6K A;  3R93 A;  4CHT B;  1A3V A;  3OMG A;  1F2Z A;  1OXT A;  4HED A;  2A69 D;  3EFX D;  2BE5 C;  4OL7 A;  1KLG D;  2LFN A;  1VMP A;  1QNK A;  5A2Q E;  4Q5V A;  1R9T B;  5IGE A;  5J1Z A;  3SK6 A;  1VDZ A;  2NTT A;  4CGY B;  4JK1 C;  1AW7 A;  3PIO 3;  2IX0 A;  5FLX E;  1B4O A;  1QNU A;  5EKL A;  3EJI A;  5FO8 B;  3R2I A;  4BBR B;  4ZUJ A;  1DYQ A;  2E2J B;  2EY6 A;  5M5Y B;  1B3A A;  5A35 A;  1DOM A;  2NZ1 D;  2NVQ B;  2L0C A;  4FF3 A;  2GA4 B;  4HN7 A;  3FPP A;  1KNE A;  3X3M A;  2Q8R E;  4IAL A;  2C9O A;  5CV4 A;  2MHV A;  4ME5 A;  1UUP A;  4XXE A;  3RZD B;  1PFN A;  2M2L A;  3SHL A;  3PV0 A;  4KMU C;  5JVG 3;  2J0T D;  3A8K E;  4EQO A;  1PTO F;  4XDX A;  1KAB A;  5C4Z A;  2Z4H A;  3HOV B;  3MTS A;  1X32 A;  1TU2 B;  1IKM A;  1GOZ A;  2AQ3 B;  5COY A;  5E4X A;  1EEI D;  2XIW A;  2KA7 A;  4A3M B;  2YYZ A;  2J7Z A;  2NVY B;  3I3C A;  1EY9 A;  2F0M A;  2PPB C;  2L12 A;  1H9K A;  3DMU A;  4JBW A;  3MXN A;  4QUC A;  2EYO A;  1SJH D;  2B2W A;  2F0S A;  4H13 C;  1F2Y A;  3PUZ A;  1I50 B;  1D5M C;  2B2T C;  3F2U A;  2RBM A;  3J7Y W;  5FKA C;  5IGB A;  3NTH A;  4A3F B;  4KK7 A;  1Y8N B;  1I4X A;  4HR7 B;  4CJ2 C;  4A3K B;  2A5H A;  1FGB D;  3NK9 A;  2QDB A;  5EPL A;  2EYJ A;  2F0U A;  1NAP A;  4A3J B;  2NN6 H;  3AU7 A;  1OXU A;  3HS0 C;  5JAV A;  4IFD H;  5EKI A;  4A3I B;  3A55 A;  1G6Z A;  3RLF A;  1S5B D;  4TRD A;  4RHR A;  5C5M A;  3QB3 A;  2NN6 G;  4C3H B;  3D3R A;  2EYM A;  1OXV A;  3NTK A;  5A2Q L;  4IFD G;  3K57 A;  1F77 A;  5CV7 A;  1PRT F;  1WD1 A;  3J80 L;  2F3W A;  3M3Y B;  2B63 B;  2XNA C;  3BDL A;  2IL8 A;  3S2D B;  2MP1 A;  2PO4 A;  3V2T A;  5FLX L;  4LAA A;  1KLU D;  1EY6 A;  4K6D A;  2AQ2 B;  1EIG A;  1RHP A;  2HQE A;  4HTH A;  1I4H A;  4KY5 A;  3M85 A;  4RKL A;  2ICI A;  1ICW A;  3GV6 A;  2O5I C;  1TWA B;  1IYV A;  1ENC A;  2LS0 1;  2PW7 A;  3BZD B;  4UDU C;  1BCP B;  1SE3 A;  1E2Z A;  5CYU A;  5I9O A;  1Y1V B;  1A3U A;  4IFD J;  2SEB D;  3QWN A;  1TR5 A;  2F0P A;  5CV5 A;  1DOL A;  1HTP A;  2AWN A;  4IFD I;  4RFB A;  5KND A;  4F88 A;  3S2H B;  2KUM A;  2H4O A;  4RH6 A;  4DN4 M;  1I6V C;  4HMJ A;  2FMC A;  2H1E A;  3I90 A;  2F0V A;  3QJY A;  2PNR C;  1JR0 D;  2B2U C;  3OIP A;  5ELC A;  1JC7 A;  1YNJ C;  4IUQ A;  4R8I A;  1EL0 A;  5T1I A;  2B39 A;  5ELF A;  1EOT A;  2MUY A;  3Q24 A;  1TWG B;  2KED A;  4NDX A;  5EPJ A;  3ONA B;  3KLR A;  4B08 A;  1JQY D;  2WIN B;  4V19 0;  1A3T A;  2OF1 A;  2F1M A;  4ZAI A;  1STB A;  1STG A;  4K2K A;  2DY8 A;  1ROD A;  2EXZ A;  3DWP A;  1F2M A;  1WTP A;  1TT2 A;  1C48 A;  2EPB A;  2R93 B;  3FMC A;  2KHS A;  4RKB A;  4PMW A;  2A69 C;  4KY6 A;  2NVX B;  1OXX K;  3IKJ A;  4XT3 B;  1A2U A;  3BDC A;  1I3Q B;  5KRU A;  3MHB A;  3O13 A;  2AUJ D;  1XYI A;  1IL8 A;  4FYD A;  4KY7 A;  1KAA A;  1SDF A;  1HTL D;  4HAE A;  1QIL A;  1EYC A;  1SAP A;  3BYY B;  2A6E D;  1G8Z D;  2CVR A;  1SE2 A;  2ID0 A;  3BVG A;  5ELB A;  4X3T A;  5J39 A;  3OMC A;  5IGC A;  1RF2 D;  3NWT A;  3M7G A;  5EBC A;  3M4O B;  5ELE A;  2TSS A;  3A7L A;  3HKZ B;  2MGS A;  1G29 1;  1LTI D;  3HOY B;  1U4L A;  2RSO A;  4RGN A;  3KUP A;  1QE6 A;  2JP1 A;  4QF4 A;  4OO1 I;  4RA8 A;  1AEX A;  5DM7 3;  1GUO A;  1LLR D;  5C3X A;  1CQV A;  2FHT A;  1EEF D;  4DXG A;  1T5E A;  4TQU S;  4DF7 A;  4WFN 3;  4BY1 B;  1MD2 D;  4KKS A;  3ND8 A;  4H7B A;  2LMC B;  2B8G A;  4X3S A;  3L3O C;  1E0B A;  3NBI A;  4FF1 A;  3RMH A;  3MA2 B;  3RUZ A;  1U4M A;  3PO2 B;  1RTN A;  1PRT D;  3NUC A;  3P7J A;  4Y7N B;  2IPK D;  3E5S A;  4CKE A;  5KYI A;  1ILQ A;  2K7V A;  4KHZ A;  1SJE D;  1CA5 A;  4A3D B;  4QCL A;  3QOL A;  4PMC A;  1PFB A;  2Z4I A;  3VR4 A;  1V1O A;  3PUV A;  3V96 A;  1D5Z C;  2BA0 A;  3SVM A;  3DXJ C;  2RA4 A;  1UAP A;  1Q12 A;  4C3J B;  5JJZ A;  5FK9 C;  3P75 A;  1TS2 A;  4DU9 A;  2K01 A;  1LTB D;  2DN8 A;  2AUK A;  5IIF A;  3HOZ B;  2E2H B;  2IW3 A;  1HPC A;  2XRS D;  4OIK A;  1L0X B;  1PDQ A;  3CRL C;  2BOS A;  2OT2 A;  5I6W A;  1SSO A;  2PCF B;  4TSS A;  3QOJ A;  3FPU B;  5CBA E;  2Y0S B;  2RDH A;  1BOS A;  3I4M B;  3JAM L;  2F0G A;  3HOX B;  5BN5 A;  2KQ3 A;  4OHJ A;  4G7Z C;  3C46 A;  2G9D A;  4K14 A;  1ZYR D;  4CJ1 B;  4X3K A;  3SK4 A;  4H44 C;  2EJF C;  5KNB A;  2B2V A;  5CGK A;  3NWS A;  5LL6 X;  1SEB D;  3QO2 A;  1MBY A;  4PNY A;  1L0Y B;  4B9X A;  5I2Y A;  1DJR D;  3VR5 A;  3C3L A;  1A2T A;  1CK1 A;  3MFY A;  3GD7 A;  2JA7 B;  2EYF A;  3S1R B;  5FOB B;  1JOQ A;  3AB9 A;  3A8J E;  2F03 A;  1RTO A;  4C3I B;  1D1K A;  3PO3 B;  4KKU A;  4QUF A;  5C4J B;  3RD4 A;  1FNU A;  5JVH 3;  4RAU C;  1SNC A;  3GTO B;  3VR3 A;  4IUR A;  3TBI B;  1BDO A;  2WAC A;  4C3H G;  4HCE A;  2KEC A;  3J80 E;  3ERO A;  4OGQ C;  1H9S A;  3S15 B;  2NTS A;  2QEJ C;  5EKK A;  4KKT A;  1H9S B;  3SXH A;  4KI0 A;  1D6E C;  3T51 B;  1FYC A;  3H3V C;  2CW0 C;  1JWU D;  1M4V A;  3VA5 A;  3QIA A;  1II3 A;  1QOH A;  3D4D A;  3GTM B;  1K83 B;  3H09 A;  5AFW A;  3S14 B;  1SBB B;  3I91 A;  1TVX A;  2DY7 A;  2WB1 B;  3HEJ A;  2DNE A;  2XWB B;  2OEO A;  3L9A X;  2BDN A;  3K58 A;  2EY5 A;  3K5O A;  1F9Q A;  4RGT A;  3LWU A;  3C1E A;  1ZXT A;  3S16 B;  1AP0 A;  4P2C B;  1A15 A;  5C0X H;  4DAV A;  4ABN A;  4DGZ A;  3M7N A;  4IZ8 A;  2O5J C;  1PTO C;  2L55 A;  4C1N I;  1SNO A;  3MXU A;  3NSW A;  2J4X A;  4Q0F A;  3N52 A;  5C0X G;  2VXW A;  2A6E C;  1ET6 A;  3IFT A;  5BN3 A;  4XTC S;  3VA7 A;  4LJZ C;  5CMD A;  1GUS A;  2SNS A;  1NSN S;  2JEB I;  2F0F A;  2DNC A;  1AFP A;  2F3V A;  1WD0 A;  4MHE A;  4CBV A;  1STN A;  1Y8P B;  2B2T A;  3KBG A;  3W2D A;  2NYZ D;  2E76 C;  4O1N A;  2EDG A;  4IQZ A;  2EOT A;  2EY1 A;  1LTS D;  4DK0 A;  2IX1 A;  2IWH A;  1DCZ A;  1LAC A;  1CI3 M;  2B2W C;  4E6I A;  1QB5 D;  3OHX C;  1B9M A;  5C0X J;  1XX8 A;  4XYQ A;  2A6H D;  3Q6S A;  1BBX C;  1H9M A;  1F9P A;  4NKL A;  3BG3 A;  1S5C D;  5C0X I;  4ODG A;  2IJ0 A;  4AYB B;  2XWJ B;  5CV9 A;  2Q8T A;  1YNN C;  3TP7 A;  3MC0 B;  2K1B A;  1EY4 A;  2F0E A;  2F0K A;  5TSS A;  4F8M A;  1VF5 C;  5D14 A;  2ZXR A;  5JEA H;  2NB0 A;  3U9S A;  1DON A;  1O7Y A;  4A3G B;  1Q90 A;  4MIU A;  2F0I A;  2R6G A;  1PRT C;  2WKD A;  3IAY A;  4CKC A;  1ET9 A;  1LT3 D;  3N6R A;  3DEO A;  3VYR A;  1TWC B;  1MGS A;  3LX0 A;  3GTL B;  2K5D A;  1HA6 A;  1HFG A;  4OIJ A;  4KTA A;  3OW7 A;  5M5W B;  3GTK B;  4WRD A;  3GP7 A;  2ZXP A;  1STE A;  4FO2 A;  2NN6 I;  5I9P A;  1SNP A;  1BCP F;  4PMB A;  2V4D A;  3GV3 A;  5HGT A;  1H9J A;  3BS1 A;  1O7Z A;  2F0Q A;  2NUC A;  4N9P A;  4J8Q A;  2EYH A;  2QF7 A;  3A7A B;  3W3A A;  5JEA J;  2RSN A;  1BQQ T;  2B2U A;  4GZY C;  1BUV T;  1LTT D;  1B50 A;  3BDO A;  1LT6 D;  1HCZ A;  1D1I A;  1PYW D;  4NW2 A;  2E74 C;  4I7Z C;  1ZYR C;  4N9T A;  3R8B A;  3R3O A;  5T1G A;  1PXU A;  4FVM A;  2CW0 D;  2HUG A;  4M8A A;  4FF4 A;  4K8I A;  3A56 A;  1Y69 U;  3FRP B;  1J9O A;  1EY7 A;  5C4H A;  2MJ8 A;  1SYE A;  1LTA D;  4L6T B;  3GTG B;  5I2X A;  2JXM B;  1HA5 A;  4BBS B;  1KDB A;  1M8A A;  1CZG A;  1U4P A;  3SEB A;  4C3J G;  3QG1 A;  2K04 A;  2L4N A;  1AZQ A;  1O80 A;  1LAB A;  2BA1 A;  3IL8 A;  2ZT9 C;  4V0B A;  2EJG C;  4FNF A;  3UI2 A;  1AZP A;  2SNM A;  1PTO D;  3MAQ A;  1LT5 D;  2NWG A;  2SDF A;  4XQQ A;  1ENA A;  5K36 H;  1KNA A;  1RD9 D;  3H91 A;  5D3D A;  3JAM E;  1Z7T A;  1JB3 A;  4U67 3;  1HRJ A;  2RQX A;  3K7A B;  2AWO A;  1U9R A;  4MN3 A;  1TS4 A;  1WTR A;  3T4A C;  1S4Z A;  3TDQ A;  3E0J A;  1TY2 A;  1CQF A;  1IYU A;  1DZ1 A;  1EQV A;  2K5W A;  3TP6 A;  3Q22 A;  4ZQ3 A;  1TQO A;  3K5N A;  2VUM B;  5LL6 S;  3PUX A;  1CA6 A;  1S5D D;  5ELD A;  1B44 D;  1JWS D;  1EYA A;  1JOK A;  3LNN A;  3FVQ A;  4DK1 A;  4BWG B;  2B2Y C;  3PUY A;  2KCC A;  1S5E D;  4XQN A;  4R8N A;  5CV8 A;  3FEW X;  3NBH A;  3MXG A;  5J22 A;  5IGD A;  1YNN D;  3RZO B;  4IUP A;  1MSG A;  4BA2 I;  2ENB A;  5IOD A;  1AN8 A;  3J7A F;  2SOB A;  4K5V A;  2JA6 B;  5CBE E;  4BS9 A;  5E4W C;  1EYD A;  3S1N B;  1E2W A;  2HDM A;  1C4Q A;  3D4R A;  1EWH A;  3S9W A;  3CRK C;  1SYD A;  2L5T A;  1PMR A;  5F2D A;  1EY5 A;  5COR A;  1CHQ D;  1I6H B;  1CFM A;  3HP3 A;  1A6X A;  4XQJ A;  3I4N B;  2L11 A;  1EIH A;  1VF7 A;  2K05 A;  4ZKC B;  2X6L A;  2A6H C;  3V05 A;  4EGV A;  5C4X B;  4QIW B;  1BO0 A;  4NMZ A;  5EJW A;  1PZK D;  3PMF A;  1V43 A;  3ND9 A;  1LTR D;  4FXG C;  3J7A V;  2D9U A;  1HQM C;  5M5X B;  3DWA A;  2N55 A;  3KK7 A;  2E2D C;  1EY0 A;  4EQN A;  1HFN A;  1V1P B;  3CU7 A;  2M9V A;  1GUN A;  1WTQ A;  1K8M A;  1IHZ A;  1Q3L A;  1ZKO A;  5NUC A;  5C44 B;  4BA1 I;  1RJT A;  4RGO S;  1UNS A;  2NVT B;  4PV1 C;  2RVL A;  5C6A A;  1LO5 D;  3VYT A;  2HDL A;  4WJW A;  1WTW A;  4RHS A;  2JE6 I;  3TZD A;  2Z8L A;  1JE4 A;  1JIC A;  1NR4 A;  1IW7 D;  1SND A;  5DNF A;  4Z9C B;  5D3I B;  1JCK B;  1G2S A;  5LHY 1;  1XTC D;  4A3E B;  2R3Z A;  1WTO A;  3I72 A;  1SXT A;  4FP5 D;  4EQP A;  5EGT A;  4IUT A;  2WII B;  3HOW B;  4CKB A;  3AMU A;  2AQ1 B;  3VYS A;  3BYT B;  3MFG A;  2EY2 A;  2O4X A;  4DA2 A;  3SR1 A;  1RCV D;  1QWY A;  1GHJ A;  2JSO A;  1BNZ A;  4I65 A;  3PUW A;  4F87 A;  4B9W A;  4ZYS A;  1BF4 A;  5D65 A;  3OPO A;  4YIJ A;  5C3E B;  2K28 A;  1O78 A;  4J6H A;  1HUN A;  3T53 B;  1OO9 B;  1SNQ A;  2L1B A;  4IUU A;  3D4W A;  3E6Z X;  2IT1 A;  1OXS C;  5KEE A;  3NP8 A;  2A73 B;  4BY7 B;  4ZLT F;  1V8Q A;  4IN3 A;  5EBD A;  5IGG A;  2M00 A;  3T16 A;  4QB4 A;  1U4R A;  1RDP D;  5ISR A;  2XSC A;  3HGB A;  1STY A;  4KN4 C;  1ILP A;  3R2T A;  1GUT A;  1CTM A;  2EYP A;  1DOK A;  3KLS A;  3URY A;  4KHV A;  3TME A;  1DM0 B;  4KD4 A;  1PTO B;  4LK1 C;  2K6A A;  3K0Y A;  1KDA A;  1QCB D;  2HCC A;  1MSH A;  3A54 A;  3TN2 A;  1PLF A;  1JOR A;  3GTJ B;  3S1M B;  5IT9 E;  4L8J A;  2A68 D;  1B53 A;  1H9R A;  5JOB A;  3G6J B;  2PQE A;  3GO5 A;  3Q23 A;  3G7L A;  1JOO A;  4FXD A;  1BXT A;  4PQX A;  1IKL A;  2KEE A;  4DNT B;  2F0N A;  1WTV A;  2F0O A;  3DUZ A;  4KV6 A;  3HOU B;  1TS5 A;  4QMG A;  2MPM A;  2C5C A;  3T13 A;  3NQI A;  1S5F D;  2RKS A;  4ZRZ A;  2E75 C;  1LV9 A;  4G7O C;  5EQ0 A;  2K33 A;  3OSO A;  2O2L D;  2R7Z B;  3I70 A;  1WCM B;  4M1U B;  1R4Q B;  1EU3 A;  1X3P A;  2ICE C;  1X3Q A;  3D6W A;  5CV6 A;  3M4Y A;  3K5M A;  1HQR D;  4DNR B;  2PZW A;  5K5P A;  4FF2 A;  4ULL A;  1O7L A;  3GTP B;  1W6J A;  3OWF A;  2L9H A;  5M3M B;  1Y8O B;  2R92 B;  2OXP A;  2F0D A;  1EFI D;  1C8C A;  1KTK A;  3VR2 A;  2QKI C;  1NR2 A;  2NBF A;  1PRT B;  1UEA B;  4KN7 C;  2LKV A;  2HCI A;  1SMY D;  3TP5 A;  4DAY A;  2VNU D;  1RKN A;  2D2C C;  3CKI B;  5JEA G;  1SFO B;  4EVO A;  3DWQ A;  4DFA A;  1CHP D;  1PZI D;  1TY0 A;  2D62 A;  1ENF A;  3SE0 A;  4HSP A;  4IUN A;  4S3S A;  1EWC A;  2FFK B;  2PYK A;  2F0T A;  4H0L C;  3BVZ A;  1KDC A;  5G3L F;  1CM9 A;  1GHK A;  5C5L A;  1TS3 A;  3I4L A;  2KVM A;  3DEP A;  1ML0 D;  2D5D A;  1LTG D;  5E1F A;  2IX3 A;  3SK8 A;  1TWH B;  3OIQ A;  1FD7 D;  2WKC A;  3S1Q B;  3P1H A;  2JA8 B;  1XWE A;  1VCI A;  5KNC A;  4G7H C;  1FNW A;  2F0H A;  4NP5 A;  2A74 C;  3WDN A;  3WOF A;  1B2T A;  1BCP C;  5M3F B;  4K2L A;  3PIP 3;  3K5L A;  3NXW A;  3EA6 A;  4K5X A;  1ESR A;  5IT9 L;  1STH A;  1EU4 A;  1K8O A;  2QIL A;  2FIN B;  1SYC A;  3HRZ C;  1DXM A;  1G91 A;  1HHV A;  3NE5 B;  1GUG A;  2VB2 X;  3H0G B;  5DEH A;  2JYO A;  3DM1 A;  4WOR A;  2BE5 D;  1DD2 A;  2XRQ D;  2TMP A;  1IW7 C;  3J81 E;  2EE1 A;  3NQT A;  1R4P B;  5C3W A;  1WTX A;  3FDT A;  5HUR A;  2EVB A;  5DM6 3;  1D2B A;  5CR3 A;  3MEH A;  1Y1W B;  5DAU A;  3Q0A A;  5KYL A;  1WVL A;  2F4I A;  4A3B B;  3KLS X;  2PZU A;  3L7Z C;  2I46 A;  3MVV A;  2QCP X;  3I8Z A;  1F9S A;  4UAI A;  3P20 A;  3MWY W;  1GJX A;  4R9W A;  1G2T A;  2PW5 A;  2KJX A;  4OO1 H;  2FJ2 A;  1Z6H A;  1Z47 A;  3ITP A;  4ZUI A;  1I4P A;  1HXY D;  4ZKB B;  1SYF A;  3H94 A;  3IFD A;  4C2M B;  1FR3 A;  3WOE A;  1TWF B;  2X6G A;  2K32 A;  1J8I A;  4OO1 G;  2XN9 C;  3EQL C;  5KIX A;  5K36 G;  3FKI B;  1VMC A;  4G4K A;  2JA5 B;  4K5W A;  2EYL A;  5M9O A;  3I73 A;  3A8I E;  3SK5 A;  4C56 C;  2FMM A;  5FO9 B;  1F2L A;  5JPM C;  1STA A;  2YU9 B;  3X3N A;  5JPN C;  1ESF A;  1CT1 D;  1B1Z A;  2X69 A;  2R61 A;  4RCN A;  2B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...