1EIGA

Solution structure of the human chemokine eotaxin-2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQSCGDPKQEWVQRYMKNLDAKQKKASPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords EOTAXIN-2
publication title NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2000-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eigA00
2L1BA 1NCVA 2SDFA 1O7YA 4OIKA 3I8ZA 4RA8A 1WVLA 2XIWA 1TVXA 2B2UC 1JE4A 3HP3A 2CVRA 1G2TA 2HDMA 1U4RA 5EPJA 3TZDA 2NWGA 3TN2A 1BO0A 4DN4M 1HUNA 1MSHA 1SSOA 2FJ2A 3MTSA 4NW2A 1F9RA 2X69A 2FINB 3FDTA 2MP1A 4O42A 1ZXTA 5EKIA 2RA4A 4R9WA 1BNZA 2KOLA 2KEDA 1BBXC 1QNKA 2RVLA 3LWEA 2B2WA 4OIJA 1KNEA 5AFWA 5EPLA 4X3KA 4ZKCB 4X3UA 1DONA 4CJ1B 2K05A 2D9UA 2DY7A 3GV3A 3H91A 1HFGA 2N88A 2KEEA 5COYA 2MGSA 3P7JA 3KUPA 1G2SA 1ML0D 1JICA 2EOTA 2K04A 1SDFA 2B2TA 2L12A 3IL8A 4HEDA 4X3SA 5CBEE 1BF4A 1XYIA 2HCIA 4IUPA 1WTQA 1F9PA 5T1GA 2JP1A 2K28A 4UAIA 2B2WC 1WTXA 1PLFA 1EOTA 4MN3A 3KBXA 3IFDA 3QO2A 1RHPA 1B50A 2KECA 2M2LA 2RSOA 2RSNA 4QUCA 2HCCA 5D65A 1IL8A 1O80A 1QG7A 2B2TC 1M8AA 2L9HA 5EJWA 3R93A 1PDQA 3G7LA 1ILPA 1VMCA 2HDLA 4U68A 2EE1A 1CA5A 1WD1A 1G6ZA 1AZQA 1X3PA 1DOLA 2BDNA 2K03A 3I3CA 1WTOA 4MHEA 4XT3B 2Q8RE 1WTPA 4XDXA 1X32A 1Q3LA 3SVMA 2K1BA 4HSVA 3MWYW 1WTVA 1HFNA 1EIHA 1LV9A 1NR4A 1MI2A 1NR2A 2FMMA 4CJ2C 2B2VC 1MGSA 4X3TA 1F2LA 5CBAE 1HHVA 3Q6SA 1CA6A 2HUGA 1U4LA 2NZ1D 2IL8A 1G91A 1ICWA 2B2YA 2MJ8A 3F2UA 3DEOA 1ILQA 2VXWA 4HAEA 1PFNA 4IUQA 2Q8TA 5CMDA 4R8IA 1WTRA 1GUWA 1HRJA 1CM9A 2K01A 1WD0A 1EL0A 2J7ZA 2FFKB 5CORA 3D6WA 4ZAIA 3DEPA 1J8IA 1F9QA 1F9SA 2B2VA 3GV6A 4IUTA 2MPMA 2NYZD 3FPUB 1HUMA 1MSGA 2N55A 1QE6A 1A15A 1B2TA 1SAPA 1WTWA 1E0BA 2B2YC 3I90A 4LMQD 5E4XA 5EPKA 1B4OA 1DOMA 1U4PA 3DM1A 3I91A 1X3QA 2KVMA 3ONAB 5JJZA 1C8CA 2R3ZA 1EIGA 1O7ZA 4IUVA 4ZKBB 1AZPA 1PFBA 2X6LA 1KNAA 3N52A 4RAUC 4QUFA 2EPBA 3UI2A 4ZLTF 1AP0A 1ESRA 1NAPA 1XX8A 2X6GA 1RTOA 5D14A 5EQ0A 1J9OA 1RJTA 4XT1B 4IURA 1S4ZA 1B53A 1RTNA 2JYOA 4CJ0B 1EQTA 5T1IA 1IKLA 4ZK9B 2B2UA 4HCSA 1DZ1A 1VMPA 1DOKA 1U4MA 1B3AA 5DNFA 2L4NA 2H1EA 2FHTA 4IUUA 2L11A 4RWSC 5E4WC 1HA6A 1PFMA 1IKMA 2KUMA 2DY8A 1RODA
chains in the Genus database with same CATH superfamily
4DAYA 1NCVA 1G291 4C3IB 3M4PA 4TSSA 3GTQB 4LF7Q 1JE4A 4M8AA 1NNXA 3BDLA 3FMCA 1H9MA 1MD2D 1PMRA 4JI6Q 1VQIA 3CCUA 1Z7TA 4DV5Q 3CMAA 1K8GA 4LFCL 4DFAA 1VF5C 5D3IB 4EGVA 1UNSA 3TREA 1VQ4A 2BE5C 3NP8A 4QMGA 4RGNA 2NB0A 1S5CD 3PUVA 2KHSA 1PVOA 4CGYB 4LNQA 3HKZB 1J5EQ 4CBVA 2CWPA 1DONA 1GD7A 2H4OA 3QOJA 3KF6A 4IJLA 4KKUA 1ML0D 2ID0A 2PO4A 3T53B 2RF4A 4LF4L 1TWAH 4UAIA 1RCVD 1IHZA 1A6XA 1YJ9A 3KFUA 3HOVG 1ZKOA 3IFDA 4K8IA 3CKIB 2AUKA 5C4JH 3IKJA 1ILPA 3E9IA 4U68A 1FYCA 3STBC 1YEZA 2ASBA 5IOCA 3S1QH 2XRSD 1F2MA 4XDXA 1HNXL 5IE8A 2Q2HA 3SK5A 4QGUA 1CT1D 3J7AF 1L2FA 2B63B 4IJHA 3H15A 2N8NA 3HKSA 1XMQQ 3I4OA 2VXWA 2AQ1B 4DK3C 1EY5A 1GUWA 2DGYA 5HGTA 5IT9E 2KCNA 3RMHA 4LF6Q 1E2VA 3KK7A 4AQYL 2WB1E 2SOBA 1J8IA 4OHJA 5I6WA 2VUMG 1TWGB 4IZ8A 4MTKA 3FPUB 3A54A 3J7AV 1CK1A 1B2TA 2BH2A 1ZYRC 4DAMA 4L5QA 5G3LF 1KD1C 4MTNA 1PV4A 1O7ZA 2R6GA 3T51B 1K3BC 1FL0A 4RFBA 5IP7H 5JJIA 1RTOA 1V8QA 5EKLA 2B3GA 5C3EH 5IGFA 5I6YA 1BQQT 2K75A 1IKLA 3FKIB 4KHVA 2AQ2B 2RBMA 4HCSA 2R7FA 4P72A 5DNFA 2HQEA 4GKKQ 2D62A 2OXPA 2FHTA 2E5LQ 1S3OA 4DV0L 1A62A 2KUMA 4KD3A 4X66Q 1S5FD 2MO1A 1A3TA 2EY1A 4K2KA 2JJQA 2RQXA 1MIUA 1PH9A 4OGQC 4QIWE 3MHBA 2WV6D 5J1ZA 3OMGA 3KYHC 1QCBD 1IYVA 2HT1A 4YCWA 2K32A 4ZCKA 1Y1VG 2A5HA 2IHFA 1DXMA 4IFDI 1GVPA 4DR1Q 4OO1H 2JA6B 3GTLB 2D9UA 2Z8LA 1FR3A 3GV3A 3ZJYC 2PNHA 4PZ7A 3MZ5A 4B3RL 3H3VI 5M5WH 4XIGS 5DLQE 4QCLA 2E2JB 4IUPA 1WTQA 1F9PA 3S2HH 1D7QA 1IZ6A 3SGIA 1RDPD 1A3VA 2NN6G 4MN3A 1PH6A 2I5HA 1NUCA 2RSOA 1N32Q 1TWCH 5D65A 3VR4A 1KDCA 3Q0AA 4HTHA 4RHRA 3HS0C 2QA4A 1KLGD 4BBSB 2QILA 1Z6HA 3A8IE 1WCMH 3KOJA 3QJYA 5M3MH 4HN7A 1PTOH 4H0LC 4DV6L 1WTPA 1XMOQ 1G6PA 1WTVA 1D1KA 4A3CG 4CJ2C 4XYQA 3PO3B 3R2IA 3OTOQ 3J7ZC 2KQ3A 1PFNA 4A75A 1WD0A 3ERSX 4LUOA 3D6WA 3SK8A 3P75A 4RKBA 4DR5Q 3H6MA 2CH4A 4RGMA 1SAPA 1IBLQ 5E4XA 1VQJA 2WINB 3AEVA 2KVMA 2VY3A 1KAAA 2R3ZA 1AZPA 1HR0W 3GTPB 3E5SA 4QUFA 2MQHA 4IO9A 1HPCA 1NAPA 2PNRC 2EYFA 4XYOA 4LF8L 3EIVA 4OWTB 3J81j 4NP5A 3S17B 1KAWA 1WJJA 2O5IC 2D0PA 3PUWA 5C4XB 1H9RA 1OXTA 1DOKA 1EU3A 4KD4A 5JOBA 2H1EA 4DV3Q 4UP9A 3WOEA 1TS2A 2XGTA 4BY7B 1PRTF 4A3EB 3NK9A 2XIWA 2CVRA 2HDMA 1U4RA 2NWGA 3I4NG 2JA5B 1E7ZA 3MA2B 1IYJB 2K52A 4QIWB 5CR3A 4YWKA 1NMGA 4NKLA 4CDCC 4R4IA 1S72A 5G3LD 2UUAL 5HGQA 4V0BA 1L1OC 3E0JA 2ZM6Q 5AFWA 5IP9H 4ZRZA 2VQEL 5M5YB 3UDFA 3S15B 2N88A 4CKCA 4B3SL 1G2SA 5KIXA 4DV7Q 1QILA 5BN3A 3EBEA 2JEBI 5LMNW 4JI5L 4GLXA 1FD7D 1T9HA 5DAUA 5IYDG 1STYA 2B2WC 2F0IA 3GTKH 4IQZA 4ILWA 3L3OC 3U9OA 1B50A 3P20A 3TS0A 1K9MC 2NVXB 1M8AA 3RZDB 4A3MB 2DJGC 3LNNA 1QVGA 4A3JG 4FVMA 3PUYA 2HIXA 1DOLA 2BDNA 3D4RA 4FNFA 4DR4L 4X65Q 4HJAA 4XT3B 4EVOA 2JQOA 1X32A 4C3JH 4OO1I 5A2QE 2CWAA 1NR4A 2FMMA 1YNNC 2F4VL 3C1FA 3G6JB 1VQHA 4HMIA 3L2PA 1AW7A 1MGSA 2D0OA 2EYLA 4C3HG 4H44C 1I4XA 4AIMA 1U4LA 3S2DB 1RD9D 4ULLA 4BXXH 2MJ8A 2EJMA 1D8LA 1ILQA 1STHA 4Y7NB 1STNA 2FFKB 2E76C 1QVCA 3GTOB 2A73B 2F0NA 1LTTD 2G5DA 2WB1G 5CV4A 4JI3L 4C3IH 3MAQA 1B9MA 3F2CA 3GTQH 5LL6S 4LMQD 4KJNA 4LF7L 2VW9A 1C0AA 3LGJA 4DK0A 4JI6L 1E1TA 4DV5L 2TMPA 3NTHA 4ZUIA 4ZLTF 4JC0A 1RJTA 3G4SA 4X62Q 5T1IA 3S1NB 3H94A 3U9SA 1V1PB 3R3OA 1UEBA 4GN5A 1J5EL 1KABA 4I7ZC 5FO8B 2L1BA 1GM5A 2PPBC 1TY0A 3G48A 3D6CA 4WJ4A 4BA1I 2A69C 3NUCA 1VQ7A 4FXKC 4IPHA 1GUSA 4K5VA 2B29A 5J39A 3H09A 2MFIA 3S14B 1PXUA 1I5FA 3RLNA 4CDEC 4U673 2RVLA 1Q86C 1SMYD 5D3DA 1LO5D 4KMUC 2NUCA 2DY7A 2I0QA 1H9SB 5KYIA 1Y1WG 4DNRB 4KN4C 4LW1A 1KTKA 4QL5A 4F88A 4X3SA 2B63H 4K0KQ 3N6RA 3EN2A 4BBRB 4TQUS 1EZ8A 1VQKA 2OTJA 2VB3X 1SN8A 2ES2A 1XMQL 2F1MA 5BN5A 3KBXA 4I65A 3J81i 1K73C 5TSSA 2NZHA 4LF6L 2HCCA 1TWGH 5GADC 3GTMB 1GHJA 4XXEA 4P71A 1G6ZA 4IFDG 4MHEA 1WYDA 1JR0D 5IGGA 2RKSA 4PMBA 3K80C 1CI3M 3PIPA 4A3FB 3FKIH 5C0XH 4A3LH 1YVCA 1F2YA 4GKKL 4ZAIA 2E5LL 3I56A 1B9NA 1HUMA 2F4IA 1DM0B 1I50B 2ZT9C 4X66L 5JJLA 4A3IH 3TSSA 3F2BA 1V43A 3KDFA 3Q23A 1VQ6A 2K5QA 2PW7A 2RHSB 4A93H 2F0QA 4P74A 5ELDA 5FKAC 3R2TA 5CC4A 1EQTA 4V190 1TWHB 2LXJA 2JA6H 1U4MA 2LMCB 4GLAC 3TP6A 4DR1L 4RWSC 3F2DA 1LTBD 1Y14B 2E2JH 3E9HA 2NTTA 4YCUA 1GJXA 2B39A 3VYRA 1STEA 5ELCA 4LK1C 3TN2A 2I5LX 4DN4M 2SNSA 2DNEA 3K5OA 2FJ2A 3CCLA 1B7YB 3ICEA 1N32L 1V1PA 2A68C 4BBSH 5C3XA 1I4QA 2KOLA 3K81C 2KEDA 1QNKA 4KY6A 3NWSA 1Q1EA 1PHJA 4MNOA 4QY7A 4X3KA 4J6HA 2A74C 3PO3H 1SNCA 2FXQA 2JEAI 3CU7A 4DXFA 4G7HC 3OTOL 1WTXA 3UE1A 3S9WA 3D0FA 1RL2A 3PO2B 2YU9B 3DWAA 3K5LA 1GUGA 2F3IA 5IP7G 5GROA 4G7OC 4DR5L 4J15A 3G7LA 4MIUA 3HKZE 4Z9CB 2PZTA 2LS01 5C3EG 1IBLL 1ENFA 1YIJA 1HNWQ 3RUZA 3HOYB 2AUJD 3GTPH 2B8GA 4X6AH 3J80c 4BY1B 1TY2A 2UU9Q 2YTYA 1DCZA 1BKBA 1QNUA 1XTCD 3AQQA 2A6ED 1BR9A 5NUCA 4GOPC 1CTMA 1EQQA 3S17H 3G6EA 3Q6SA 2QCPX 4H7BA 4KKSA 5C4XH 3HOZG 2JA9A 2B2YA 1GUNA 1I4PA 2R92B 5GAEC 3U4ZA 1XNRQ 1EL0A 1OXSC 3PIOA 1BBUA 1QUQB 1IW7D 4BY7H 3VR5A 4A3EH 2Q2UA 3K0YA 1CKMA 4DV3L 2F0KA 2Q8IB 3GV6A 4KV6A 1VQGA 3I72A 3PUXA 2JA5H 3NEMA 3K7AB 1Q90A 1B4OA 3E0EA 5JJZA 1EYCA 4OO1G 2X6LA 1KNAA 2EPBA 4YY3Q 1PZKD 4CKEA 3CW2C 2OF1A 1ONLA 2C9OA 2ZM6L 2WKDA 5C0XI 5M5YH 3S15H 5IY0A 2KHIA 2F0OA 1O7IA 1SNOA 4DV7L 3GO5A 4HR7B 2SDFA 2ZTDA 3TZDA 5M3MG 3EJIA 2IX3A 2CW0D 3M85A 4B3MQ 3PF5A 2NVXH 3RZDH 4A3MH 2EYMA 4JBWA 3K0XA 2RA4A 4R9WA 1BNZA 4EQNA 3PUZA 3WOFA 2XN9C 5JVG3 3AFQA 5I2YA 4P75A 5FJ8H 4X65L 5FLMH 1BBWA 4HMJA 4DUYQ 2MGSA 4XTCS 2C35B 3IL8A 5M3FB 1S40A 2F0PA 3S2DH 1S5ED 4FO2A 2V4DA 4Y7NH 1D5MC 3GP7A 4FYDA 1SMXA 1EOTA 1TR5A 3GTOH 3M7GA 2KECA 4FF2A 1X3FA 2NZOA 3E3XA 4GLVB 1IL8A 4G57A 1QVFA 4PQXA 3R93A 2QEXA 3GTJB 4K5XA 4KTAA 2HIVA 1CA5A 2PZUA 5IYBH 2JA7B 5L37A 1P16A 1SBBB 1XJVA 3SVMA 1TS5A 4IFDJ 3CC7A 3MFGA 1NJIC 4K6LA 5E7NA 4QB4A 4JBJA 4A3DB 3DXJC 3J7YW 1MJCA 3M4OB 2KBNA 2RDGA 3NQTA 1PH4A 3S1NH 1Y1VB 2HD3A 3F2UA 3UDIA 1KRTA 3L9AX 3H0GG 5EKKA 1NTGA 3V2TA 3EVQA 4MZ9A 1EZ6A 5CORA 2AWOA 5GQOA 3ULLA 1Z47A 5CV6A 4LF5Q 4HIMA 1F9SA 5E3FA 3BZKA 3GQBA 2PZWA 1P8LA 3T13A 5GAHC 3S16B 3HGBA 2F0FA 2I5MX 2R93B 1DD2A 1EQVA 4JI8Q 5IP9G 4DR6Q 3EFXD 1U9RA 2JE6I 1VQ8A 2IJ0A 4ZKBB 1PH8A 3S14H 4RAUC 5ELEA 3UI2A 2EXZA 1SFOB 1I4RA 1R4QB 1QUQA 3PMFA 1HZCA 1TS4A 1EWIA 3AFPA 2PMZE 4GKJL 1B44D 3NPPA 1VQNA 1VQBA 2K5WA 1N8RC 1NMFA 1CKOA 4RMFA 2FMCA 4O42A 2A6EC 2DY8A 1YZ6A 4CDFC 4BBRH 4K0KL 4OXPA 1K83B 1SYDA 4OIKA 2CKZB 4QJFA 2Q2TA 1TVXA 3HP3A 3CPFA 3J80L 2IX0A 3SK6A 1KQSA 1EWHA 1I94Q 4C3JG 3K5MA 3GTMH 3KJOA 5J22A 3UDGA 3TEHB 4L5TA 1YNJC 4BXXG 1EOVA 1D6EC 4ZKCB 2M00A 2NBFA 4HCEA 3H91A 1ENAA 1BF4A 4A3FH 1HZBA 3FP9A 4JOIC 4C3IG 1WI5A 2ZTCA 4NXMQ 1C9OA 1Y69U 2UXBQ 1S5DD 1HCZA 4ZYSA 5GAGC 4HJ7A 2XWBB 4TRDA 1JWMD 1I50H 2D2CC 4JOIA 1BCPF 1BVSA 2EE1A 1EEFD 3D8GA 2KJXA 3W1GA 1Q3LA 1FNUA 4DPGA 3I4NB 4JBMA 1NR2A 1Z9FA 3BYTB 1E2ZA 4DV4Q 4GS3A 1EFWA 1HHVA 1TWHH 1BOSA 3OWEB 4HIKA 1LLRD 2ZJPA 2SEBD 3M4QA 4JI1Q 4X64Q 3CXCA 2VNUD 3NXWA 4PNYA 2N55A 1A15A 2WKCA 2VQFQ 1EYGA 3RLFA 2N49A 3HOWG 5EGTA 1EYDA 1B8AA 1M90C 1PFBA 2E74C 3ER0A 3NE5B 4M1UB 1AP0A 2CFMA 5D14A 2A6HD 1T5XD 4XT1B 2B63G 3HRZC 1B53A 1RTNA 2F0HA 3KF8A 3V05A 2PMZB 5AJ3Q 2EY2A 1CHPD 2BOSA 4ME5A 5CV5A 1JORA 4O1NA 3I4MB 5C5LA 3AYHB 4DR3Q 1KHIA 4DAPA 4POGA 1BUVT 4C3HB 1WVLA 3OW2A 4RCNA 3CCVA 3PO2H 4J1MA 2YU9H 1CFMA 5IWAQ 4HSPA 4NXNQ 3SR1A 1EUJA 1NBWA 3QB3A 1JB3A 5ELOA 3X3MA 1HXYD 4P73A 4KHZA 3FKIG 3HOYH 4FP5D 2VS1A 1HNWL 3LX0A 3DWPA 5C0XG 1F2ZA 4BY1H 4A3LG 2QF7A 2K05A 3U50C 3GDEA 1ASZA 1A8VA 4KN7C 2LSSA 2UU9L 1CZWA 2EYOA 2N3SA 4JK1C 1SDFA 1LTID 4IALA 5C44G 2JP1A 5FO9B 1M1KC 2Y0SE 3A5UA 2R92H 5KGUA 1SE2A 4A3IG 2OQKA 3NELA 5BN4A 1XNRL 1RHPA 3ULPA 5ISRA 1QG7A 2IY5B 3HOUB 2L9HA 1VQFA 4A93G 2HDLA 1H9JA 3PF4A 4R1JA 2J0TD 4A3KB 3IRBA 2TSSA 2F0MA 1OTCA 1Y8PB 3P1HA 2K1BA 1ZEQX 1X55A 3HG9A 4DXGA 2JA8B 4YY3L 1N33Q 4CKBA 5CBAE 3HOXB 1U5KA 3W3AA 4S3SA 1SNQA 2OT2A 4HAEA 5ELNA 3I4LA 3JAMc 1WTRA 2F0GA 3L0OA 1FVIA 4FXGC 1V1QA 1W2BA 1KIXA 1KRSA 1Y1WB 4PMWA 5M5XB 2ALYB 4A3BB 2CH4W 3DUZA 1K8MA 1BCPD 2NVQB 5C4HA 4B3ML 1K8OA 1SYCA 3QG1A 1PA6A 3CC4A 1DGSA 1PTOF 3KDFB 3OHXC 2E8GA 1R4PB 4IPGA 3PO3G 5ELBA 5DM63 3BVMA 2HHHQ 3E6ZX 2Z6BA 2QW7A 1I4GA 3C1EA 1SE8A 3I7FA 2CCZA 4F8MA 1IBMQ 3RD4A 1PFMA 5M3FH 4DUYL 5F2DA 1N36Q 2E2HB 1CHQD 2DN8A 2WP8J 1A3UA 1QWYA 1SYFA 3TDQA 5IODA 2ZXRA 3TP8A 1JWUD 3F8TA 1G2TA 4NB3A 5JEAH 2F3VA 3FDTA 1TT2A 5EKIA 5JVH3 3GTJH 1X3GA 4HIOA 3K57A 2A1AA 1CQFA 2JA7H 3KLRA 3MVVA 5C4XG 4WFN3 4QF4A 3D3RA 3ITPA 1GOZA 3DM3A 5COYA 3P7JA 3S24A 1VQ5A 2NTSA 4A3DH 4A3EG 1PYSB 2B2TA 1X3EA 3M4OH 2QEJC 2K7VA 5K36H 1Y1VH 5T1GA 2DUDA 5KRUA 3IAYA 2JXMB 1YHBA 2ICEC 2Y0SB 4OX9Q 2JA5G 5C3WA 2IX1A 1MHWC 3D31A 4ZQ3A 2E2IB 3KLSA 3ND9A 4H02A 4LF5L 3S16H 4DR2Q 4KK7A 2R93H 3CAMA 1WD1A 2ZJQA 3MXNA 1VQOA 1CQVA 4FF1A 2NN6H 4JI8L 1IXRA 2YYZA 4NMZA 5JAVA 4DR6L 2G9HD 1MI2A 3IFTA 2Z6KC 1SFOH 5KNCA 2R7DA 4FDBA 1PRTD 1N34Q 4DV2Q 2LXKA 5CV8A 3X3NA 2E2DC 5A35A 4AYBE 4Q5VA 2J4XA 2VL6A 1HR0Q 4FF4A 2BA1A 2Z6KA 3TQYA 1XWEA 4A3MG 1K83H 1MSGA 1LTAD 3ERQA 1KDAA 1EY8A 1MJEA 5EPKA 1X3QA 1VCIA 1HNZQ 2F0DA 5FJ8G 5FLMG 1EIGA 1C8CA 1TQOA 1I94L 4IOCA 1T5EA 3K58A 2R7ZB 1WOCA 1H9KA 1L0XB 3NBHA 4ODGA 4OELB 1VQ9A 1X65A 1Q8IA 5C6AA 5HY6A 4R4QA 1LTLA 1PRTB 5E4WC 2L11A 4HJ5A 2KCMA 1AE2A 2PI2E 4O2DA 1O7YA 2WAQB 3SXHA 3BDCA 1UUPA 3HOZB 5CYUA 5EPJA 5IYBG 4NXML 1HUNA 4AH6A 2DJFC 1MSHA 2UXBL 4L63B 1UEAB 2WACA 4Q0FA 1F9RA 2K5VA 4APVA 3BU2A 3I2ZA 1ZXTA 1W6JA 2RCFA 5LMNQ 3JAML 3GTLH 1KNEA 3NENA 4ALPA 1PTOD 5KYLA 5EPLA 1SR3A 2ZTEA 3I4NH 3WDNA 1VF7A 2F0TA 5IYCH 4YCVA 5C0XJ 2GA4B 2K04A 4HEDA 1PZJD 4J8QA 4A3GB 4B3TQ 1EY6A 4DV4L 4ME3A 1XNQQ 1E22A 3U4VA 1YITA 1K28A 3D4DA 3T4AC 3BVZA 4XQQA 2UUCQ 4DKAC 4JI7Q 4CHTB 4JI1L 4X64L 2KCTA 4KY7A 1EIYB 2F0VA 2BE5D 2VB2X 4YIJA 1PFSA 2VQFL 3J80E 1WTOA 3CRLC 1XMOL 2RDFA 3WWVA 5LMUQ 3MWYW 1O7LA 3C2PA 1EY0A 4BBRG 3NSWA 4DF7A 5IGCA 2ICIA 5FK9C 5KEEA 1X9NA 1CM9A 3C3LA 5AJ3L 4AYBB 3I4MH 3DEPA 1F9QA 4DR3L 1JOQA 4JYAQ 4C3HH 2OTLA 5K5PA 2B2YC 1EQRA 4DK1A 3STBD 1RIPA 3A56A 1SROA 4EQ5A 4C1NI 3TS2A 2NN6I 3ONAB 2K5DA 5IWAL 3J81L 4NXNL 1JWSD 4K14A 2QGQA 4LFAQ 1N9WA 1I6HB 3F1ZA 1SMYC 4IURA 2XNAC 4A3FG 4KY5A 2B2UA 1HTPA 1EIFA 2K33A 2LKVA 4K2LA 1LTSD 1PYBA 2NVTB 1SRUA 1JCKB 3DHQA 4WJ3M 4K6DA 1E2WA 3AMUA 4IOAA 1BDOA 4C56C 1L0WA 4JI4Q 1KC8C 1UWVA 4G7ZC 3RLOA 4O0AA 5IGBA 4GNXA 1PRTC 4HJ8A 3EA6A 2PW5A 1ZYRD 3HOVB 3TRZA 1SEBD 1I6VC 2L15A 3H0GB 3HOUH 4L6TB 4QQBX 4A3KH 1EY4A 3CQZB 3QWNA 4RGOS 4LFBQ 4KI0A 4X3UA 4CJ1B 2JA8H 3A74A 2L12A 5CBEE 4RH6A 4JI0Q 1JJGA 3HOXH 1N33L 1TXYA 1QOHA 1WCMG 2XWJB 2IWHA 1X6OA 4C2MB 3J80i 5IIFA 2RSNA 1Y1WH 3NBIA 5M5XH 3MEFA 2F0UA 2VUMB 1AE3A 3W1BA 4A3BH 1PDQA 2QDLA 2EYHA 5LHY1 2NVQH 2UXCQ 4JVZA 1VQCA 2GVAA 2I07B 4PV1C 1K8AC 3BVGA 1F2LA 1PH3A 4RKLA 2HUGA 5I9OA 3CCEA 1VQMA 2NZ1D 1G91A 3VDYA 1X56A 4ABNA 2QKIC 1HA6A 2HHHL 2GN5A 3DWQA 4ID6A 3PO2G 1UAPA 1B1ZA 1IBML 4Y52H 2EYJA 4UHVA 3EQLC 1N36L 1EWCA 1I4HA 3QIAA 1WTWA 1E0BA 2BH8A 3AB9A 1SYEA 1STBA 2G9DA 3MEHA 5C5MA 4JV5Q 3HOYG 3I91A 1H95A 1ET6A 1MBYA 1K0RA 4BY1G 4N9TA 2K14A 2CQOA 1Q1BA 3CCSA 4F87A 4KJOA 2JYOA 4X62L 4CJ0B 1JJ2A 1ET9A 4UP8A 2R92G 1DZ1A 1EY9A 1I3QB 3GTGB 1A0IA 1LT6D 3KF8B 2O2LD 3S1RB 4GZYC 1TKWB 2JSOA 1YHAA 3FEWX 4RA8A 1E3PA 1Q82C 4LJZC 5FO7B 4OX9L 3MTSA 2E2IH 2E75C 4WRDA 3PSIA 2CQAA 1LM0A 1HH2P 3VR2A 4DR2L 2L5TA 5FLXL 1SLJA 1IBKQ 1YJWA 3EROA 2PI2A 4B9XA 4A76A 3HOWB 2V1CC 1HFGA 4DV1Q 2ZJRA 1XYIA 1PH2A 1FGUA 1SJHD 2F52A 3M3YB 2WFWA 1KDBA 4EQPA 5LL6X 1N34L 4FXDA 3TP5A 4DV2L 1IW7C 2RHQB 4DK6C 2M2LA 1QJOA 2AQ3B 2XRQD 1C4QA 1HR0L 4RCOA 3UE0A 2K03A 2IW3A 2Z4IA 1HNZL 1LTRD 2R7ZH 1LV9A 5BR8Q 4DR7Q 5M3FG 2EYPA 1F77A 3CP0A 1PZID 4LUVA 3I55A 3K5NA 4C1NK 4UDUC 4X3TA 1HA5A 2IPKD 1CA6A 4K8JA 2YV5A 1CKNB 2UUBQ 3TBIB 1ICWA 3RN2A 5CMDA 1HRJA 1AFPA 4IUQA 3QOLA 3M7NA 4B9WA 2AMCB 2J7ZA 4R4TA 4JBKA 2AWNA 5JEAG 5IT9c 1S5BD 3UDXA 2N78A 1ESFA 1VDZA 2NVYB 1SJED 2BCOA 3HKZG 3CCRA 5C44B 3HOZH 2JA7G 2CW0C 5HURA 4A3IB 4WORA 1L1OB 4L5RC 2RDHA 4A3DG 1J6QA 3T1YQ 3ND8A 2JN4A 3LWUA 1XX8A 1JE5A 2X6GA 1VS0A 1YNND 1AN8A 3O13A 3BDOA 3KLWA 2CHBD 1S4ZA 4A93B 5K36G 5LMNL 1HQRD 4ZK9B 3DMUA 4UPAA 1PH5A 1IL2A 1A63A 2AHOB 3RNUA 4A3GH 1Q8KA 1XPRA 1AH9A 1JT8A 1Y8NB 4LF9Q 4N8FA 4B3TL 1XNQL 1SE4A 1EEID 3S1MB 2R93G 3A0JA 2P5ZX 1PYWD 1BO0A 2BDOA 3CHBD 4GN3B 3Q8DA 4TVAB 5KNDA 5I2XA 2FINB 2UUCL 4JI7L 1KL9A 3PGZA 3T16A 4A3JB 4DNTB 4B08A 4HIDA 3OPOA 5M9OA 3LWEA 4OIJA 1SXTA 4P2CB 3A8KE 3MXUA 1R9TB 3GD7A 2MHVA 2F0EA 5LMUL 4JCVE 2H5XA 2MO0A 2HCIA 2K6AA 3CC2A 1D5XC 3QR8A 3OSOA 4JW0A 2LY7A 4YHHQ 2A69D 1WTHA 1GKHA 3I70A 2WB1B 1OXXK 4JYAL 2F03A 4IPCA 5H1SE 3A55A 4JI2Q 1HZAA 5I4DA 3OW7A 1OO9B 2F0WA 3MXNB 1LACA 1EIHA 1UE1A 1TWFB 4R8NA 4DUZQ 1I6HH 2B2VC 1Q46A 4LFAL 3JAME 2MUYA 3MC0B 1RKNA 2NVTH 2HQLA 3OIQA 1ICFB 1PH1A 1YI2A 1YNXA 2B2VA 3T1HQ 4KLKA 1A2TA 3HFZB 3Q22A 4JI4L 3K7AH 3T56B 3HOVH 1KXLA 2JA6G 1U4PA 3H0GH 4H13C 1CKNA 5IYCG 3CCMA 3CMEA 3NTIA 4IN3A 3SEBA 5EQ0A 4R4CA 1SNMA 3CQZH 3BJUA 3SHLA 3NBHB 2EZVA 1B70B 1FJGQ 4KHPQ 1B3AA 4LFBL 3ULJA 2UXDQ 1UE5A 1NY4A 3ZYYX 4GN4B 4IUUA 1SE3A 4TKOB 4BBSG 3BZCA 4JI0L 1VQDA 3D4WA 1L1OA 3BS1A 3I8ZA 1HQMC 4C2MH 4JG2A 1E1OA 4RG1A 2Z0SA 4N8X1 4NW2A 3KJPA 4UY8C 1FNVA 1K3RA 1TS3A 2VUMH 4LAAA 3RZOB 1CSQA 1LYLA 1BXTA 2DNCA 3L7ZC 1MKHA 2B2WA 1E24A 2LFNA 3MFYA 3J81E 2PCFB 1O78A 2UXCL 2KEEA 2OWOA 5IT9L 3KUPA 3I4MG 1STGA 1QZGA 2Q2IA 2WAQE 4FF3A 1G51A 2K28A 4BS9A 1JB7A 1STAA 5C4ZA 2IT1A 2Z4HA 3TP7A 2L0CA 4LFCQ 2KA7A 5EAYA 4QUCA 3MXPA 1BCPB 2B2TC 2K5NA 2A68D 2KCCA 1UE7A 4NDXA 3Q24A 3JAMi 5EBCA 1X3PA 1AZQA 2O5JC 1EYAA 2A19A 2KENA 2Q8RE 4JV5L 2K5HA 3K6OA 4E6IA 4BY7G 4HSVA 4OONA 3J81c 2A6HC 2ZXPA 3BZDB 4LF4Q 3DLLA 3FRPB 1TWAB 2IL8A 5CV9A 4WJWA 1I3QH 3GTGH 4YWLA 1SNDA 1YJNA 1HTLD 1VQEA 1ENCA 3S1RH 1X54A 5C4JB 1NE3A 3SK4A 3HOUG 3W5OA 3PQIA 1GXDC 1U0LA 1VQLA 5JEAJ 4A3KG 3JC66 3SDZA 1DOMA 1HNXQ 1PH7A 3S1QB 1LT3D 1LABA 1KLUD 2YTVA 1LT4D 4BWGB 4IUVA 2VZAA 4EQOA 1D1IA 2JA8G 1ESRA 3J7A5 1D5ZC 1JJCB 1JC7A 2BA0A 4NPSA 3HOXG 1XPOA 3CD6A 1W3SA 1GUOA 1HZ9A 2ENBA 2IHEA 1OXVA 1IBKL 3HOWH 4GKJQ 3PCOB 4A3CH 4AQYQ 5IGDA 4JPBW 2EQSA 4DV1L 1CSPA 3HZXA 2MNAA 3M3YH 1NSNS 4A3BG 3PV0A 1CZGA 2EJFC 3A7AB 4ZUJA 3RN5A 3MXGA 3TMEA 4GNXB 1SSOA 5E1FA 1ASYA 2MP1A 2XTIA 4LWCA 3V96A 3RR5A 2Z9HA 5C3EB 2EY5A 3VYTA 1QZHA 4GOPB 3VR3A 1FNWA 4DV0Q 1SNPA 1JICA 2EOTA 5BR8L 1M4VA 3HEJA 3M9BA 4YWMA 4DR7L 4XQJA 5DM73 2UUBL 3H3VC 3CF5A 4RGTA 1PLFA 1Q7YC 2EDGA 4L8JA 2A8VA 1G8ZD 4UP7A 1O80A 2YTXA 2NVYH 1VMCA 5C44H 3I3CA 1BCPC 1Y8OB 1JQYD 3TZUA 1VQPA 4B3RQ 3CRKC 1HFNA 2RCNA 4OWXB 1LTGD 5JPMC 4DNIA 5M5WB 1LUZA 3T1YL 2M9VA 5FLXE 3FVQA 4XQNA 2PQAB 2Y0SG 3DEOA 3S2HB 4K5WA 2GVBA 5KNBA 2D5DA 3VA5A 1V9PA 1TWCB 4CDDC 4F7XA 2PQEA 2I46A 4KKTA 4DA2A 5IYDH 1QE6A 3FPPA 4R4OA 3BYYB 3PIP3 3W2DA 4LF9L 3I90A 3S1MH 1RF2D 1W6KA 5CGKA 2K4KA 1WCMB 4DV6Q 4DAYB 5JPNC 5M3MB 3K7UC 5ELFA 1PTOB 1TU2B 1CUKA 1OXUA 3N52A 4PZ8A 1AEXA 4A3JH 1J9OA 2F0SA 5FLXc 3BG3A 5FOBB 3CCJA 1R9TH 2L4NA 1B3QA 1D2BA 2OQ0A 1IKMA 3A5ZB 3K8AA 4POFA 3VR6A 1EY7A 4DAVA 4L5SA 1YHQA 2OEOA 3OMCA 2SNMA 1L0YB 3URYA 2XVSA 2L55A 4PZ6A 1IYUA 1Q81C 3KF6B 2B2UC 2C5CA 4RHSA 3OWFA 3VA7A 2EXDA 4YHHL 4A4IA 2X69A 5A2QL 2R7ZG 3CCQA 4LF8Q 2XSCA 3NHHA 3G71A 4GNXC 1BBXC 1C7YA 1K0SA 4DU9A 1H9SA 1HJPA 3VYSA 2ATWA 2WIIB 4EX5A 4JI2L 3I73A 4OL7A 4BA2I 1TWFH 1A2UA 3OIPA 1DJRD 1YBYA 4DUZL 2K50A 1SYGA 1QB5D 4IPDA 2JK8A 2WAQG 1JOKA 3R8BA 2O4XA 5J3BA 5IGEA 3NQIA 3QO2A 5I9PA 3NWTA 1JMCA 2UUAQ 2KHJA 4PMCA 5EJWA 4GOPA 1Q12A 3T1HL 3AU7A 3CPWA 3NTKA 2Z1CA 2EIFA 1YNJD 3B6YA 1EU4A 2OCEA 3A8JE 1LT5D 2VQEQ 1EFID 4OEMB 4B3SQ 2F3WA 2PYKA 1UE6A 5DEHA 1II3A 4JI5Q 4OWWB 1WFQA 4A3GG 4PG3A 2ZXOA 1GUTA 2B8FA 4R8IA 1GO3E 2Q8TA 3GTKB 1FJGL 2K01A 4KHPL 2R61A 2UXDL 1TIID 2F0LA 4IUNA 3OOCA 2F0JA 4IUTA 2EVBA 3VYUA 2MPMA 2NYZD 5CV7A 1JOOA 4N9PA 3SE0A 3C46A 3KLSX 4DR4Q 4G4KA 1XXGA 2EY6A 2QDBA 3DM1A 1GHKA 1XTDA 3PIO3 1SYBA 5EBDA 2F4VQ 4C3JB 2PQAA 3RZOH 3FHWA 1FGBD 2AKWB 4IFDH 1PTOC 2EJGC 1DYQA 5JJKA 3A7LA 3OYYA 1V1OA 1C48A 1VMPA 3M4YA 4HJ9A 3U58A 2E2HH 1VQAA 4DGZA 3H3VH 4AYBG 1XPUA 3KBGA 3K59A 4JI3Q 4LUZA 4I7AA 1RODA
chains in the Genus database with same CATH topology
4DAYA 1NCVA 1G291 4C3IB 4TSSA 3GTQB 1JE4A 4M8AA 3FMCA 3BDLA 1H9MA 1MD2D 1PMRA 1Z7TA 4DFAA 1VF5C 5D3IB 4EGVA 1UNSA 2BE5C 3NP8A 4QMGA 4RGNA 2NB0A 1S5CD 3PUVA 2KHSA 4CGYB 3HKZB 4CBVA 1DONA 2H4OA 3QOJA 4KKUA 1ML0D 2ID0A 2PO4A 3T53B 4UAIA 1RCVD 1IHZA 1A6XA 1ZKOA 3IFDA 4K8IA 3CKIB 2AUKA 3IKJA 1ILPA 4U68A 1FYCA 5IOCA 2XRSD 1F2MA 4XDXA 3SK5A 1CT1D 3J7AF 2B63B 2VXWA 2AQ1B 1EY5A 1GUWA 5HGTA 5IT9E 2KCNA 3RMHA 1E2VA 3KK7A 2SOBA 1J8IA 4OHJA 5I6WA 1TWGB 4IZ8A 3FPUB 3A54A 3J7AV 1CK1A 1B2TA 1ZYRC 5G3LF 1O7ZA 2R6GA 3T51B 4RFBA 1RTOA 1V8QA 5EKLA 5IGFA 5I6YA 1BQQT 1IKLA 3FKIB 4KHVA 2AQ2B 2RBMA 4HCSA 5DNFA 2HQEA 2D62A 2OXPA 2FHTA 2KUMA 4KD3A 1S5FD 1A3TA 2EY1A 4K2KA 2RQXA 4OGQC 5J1ZA 3MHBA 2WV6D 3OMGA 1QCBD 1IYVA 2K32A 2A5HA 1DXMA 4IFDI 4OO1H 2JA6B 3GTLB 2D9UA 2Z8LA 1FR3A 3GV3A 3MZ5A 4XIGS 4QCLA 2E2JB 4IUPA 1WTQA 1F9PA 1RDPD 1A3VA 2NN6G 4MN3A 1NUCA 2RSOA 5D65A 3VR4A 1KDCA 3Q0AA 4HTHA 4RHRA 3HS0C 1KLGD 4BBSB 2QILA 1Z6HA 3A8IE 3QJYA 4HN7A 1PTOH 4H0LC 1WTPA 1WTVA 1D1KA 4CJ2C 4XYQA 3PO3B 3R2IA 2KQ3A 1PFNA 1WD0A 3D6WA 3SK8A 3P75A 4RKBA 3H6MA 4RGMA 1SAPA 5E4XA 2WINB 2KVMA 1KAAA 2R3ZA 1AZPA 3GTPB 4QUFA 3E5SA 1HPCA 1NAPA 2PNRC 2EYFA 4XYOA 4NP5A 3S17B 2O5IC 3PUWA 5C4XB 1H9RA 1DOKA 1EU3A 1OXTA 4KD4A 5JOBA 2H1EA 3WOEA 1TS2A 4BY7B 1PRTF 4A3EB 3NK9A 2XIWA 2CVRA 2HDMA 1U4RA 2NWGA 2JA5B 3MA2B 4QIWB 5CR3A 4NKLA 5G3LD 4V0BA 3E0JA 5AFWA 4ZRZA 5M5YB 3S15B 2N88A 4CKCA 1G2SA 5KIXA 1QILA 5BN3A 2JEBI 1FD7D 5DAUA 1STYA 2B2WC 2F0IA 4IQZA 4ILWA 3L3OC 3U9OA 1B50A 3P20A 2NVXB 1M8AA 3RZDB 4A3MB 3LNNA 4FVMA 3PUYA 1DOLA 2BDNA 3D4RA 4FNFA 4XT3B 4EVOA 1X32A 4OO1I 5A2QE 1NR4A 2FMMA 1YNNC 3C1FA 3G6JB 4HMIA 1AW7A 1MGSA 2EYLA 4C3HG 4H44C 1I4XA 3S2DB 1U4LA 1RD9D 4ULLA 2MJ8A 2EJMA 1ILQA 1STHA 4Y7NB 1STNA 2FFKB 2E76C 3GTOB 2A73B 2F0NA 1LTTD 5CV4A 3MAQA 1B9MA 5LL6S 4LMQD 4KJNA 4DK0A 2TMPA 3NTHA 4ZUIA 4ZLTF 1RJTA 5T1IA 3S1NB 3H94A 3U9SA 1V1PB 3R3OA 1KABA 4I7ZC 5FO8B 2L1BA 2PPBC 1TY0A 3D6CA 4BA1I 2A69C 3NUCA 4FXKC 1GUSA 4K5VA 5J39A 3H09A 3S14B 1PXUA 4U673 2RVLA 1SMYD 5D3DA 1LO5D 4KMUC 2NUCA 2DY7A 1H9SB 5KYIA 4DNRB 4KN4C 1KTKA 4F88A 4X3SA 3N6RA 4BBRB 4TQUS 1EZ8A 2VB3X 2F1MA 5BN5A 3KBXA 4I65A 5TSSA 2HCCA 3GTMB 1GHJA 4XXEA 1G6ZA 4IFDG 4MHEA 1JR0D 5IGGA 2RKSA 4PMBA 1CI3M 4A3FB 5C0XH 1F2YA 4ZAIA 1B9NA 1HUMA 2F4IA 1DM0B 1I50B 2ZT9C 3TSSA 1V43A 3Q23A 2K5QA 2PW7A 2F0QA 5ELDA 5FKAC 3R2TA 5CC4A 1EQTA 4V190 1TWHB 1U4MA 2LMCB 3TP6A 4RWSC 1LTBD 2NTTA 1GJXA 2B39A 3VYRA 1STEA 5ELCA 4LK1C 3TN2A 4DN4M 2SNSA 2DNEA 3K5OA 2FJ2A 1V1PA 2A68C 5C3XA 1I4QA 2KOLA 2KEDA 1QNKA 4KY6A 3NWSA 1Q1EA 4X3KA 4J6HA 2A74C 1SNCA 2JEAI 3CU7A 4DXFA 4G7HC 1WTXA 3S9WA 3PO2B 2YU9B 3DWAA 3K5LA 1GUGA 4G7OC 3G7LA 4MIUA 4Z9CB 2PZTA 2LS01 1ENFA 3RUZA 3HOYB 2AUJD 2B8GA 4BY1B 1TY2A 1DCZA 1QNUA 1XTCD 2A6ED 1BR9A 5NUCA 1CTMA 3Q6SA 2QCPX 4H7BA 4KKSA 2B2YA 1GUNA 1I4PA 2R92B 1EL0A 1OXSC 1IW7D 3VR5A 3K0YA 2F0KA 2Q8IB 3GV6A 4KV6A 3I72A 3PUXA 3K7AB 1Q90A 1B4OA 5JJZA 1EYCA 4OO1G 2X6LA 1KNAA 2EPBA 1PZKD 4CKEA 2OF1A 1ONLA 2C9OA 2WKDA 5C0XI 2F0OA 1SNOA 3GO5A 4HR7B 2SDFA 3TZDA 3EJIA 2IX3A 2CW0D 3M85A 2EYMA 4JBWA 2RA4A 4R9WA 1BNZA 4EQNA 3PUZA 3WOFA 2XN9C 5JVG3 5I2YA 4HMJA 2MGSA 4XTCS 3IL8A 5M3FB 2F0PA 1S5ED 4FO2A 2V4DA 1D5MC 3GP7A 4FYDA 1EOTA 1TR5A 3M7GA 2KECA 4FF2A 1IL8A 4G57A 4PQXA 3R93A 3GTJB 4K5XA 4KTAA 1CA5A 2PZUA 2JA7B 1SBBB 3SVMA 1TS5A 4IFDJ 3MFGA 4K6LA 4A3DB 4QB4A 3DXJC 3J7YW 3M4OB 2RDGA 3NQTA 1Y1VB 3F2UA 3L9AX 5EKKA 3V2TA 3EVQA 1EZ6A 5CORA 2AWOA 1Z47A 5CV6A 1F9SA 5E3FA 3GQBA 2PZWA 3T13A 3S16B 3HGBA 2F0FA 2R93B 1DD2A 1EQVA 3EFXD 1U9RA 2JE6I 2IJ0A 4ZKBB 4RAUC 5ELEA 3UI2A 2EXZA 1SFOB 1I4RA 1R4QB 3PMFA 1TS4A 1B44D 3NPPA 2K5WA 2FMCA 4O42A 2A6EC 2DY8A 1K83B 1SYDA 4OIKA 1TVXA 3HP3A 3J80L 2IX0A 3SK6A 1EWHA 4C3JG 3K5MA 5J22A 1YNJC 1D6EC 4ZKCB 2M00A 2NBFA 4HCEA 3H91A 1ENAA 1BF4A 4C3IG 1Y69U 1S5DD 1HCZA 4ZYSA 2XWBB 4TRDA 1JWMD 2D2CC 1BCPF 2EE1A 1EEFD 3D8GA 2KJXA 1Q3LA 1FNUA 3I4NB 1NR2A 3BYTB 1E2ZA 1HHVA 1BOSA 3OWEB 1LLRD 2SEBD 2VNUD 3NXWA 4PNYA 2N55A 1A15A 2WKCA 3RLFA 5EGTA 1EYDA 1PFBA 2E74C 4M1UB 3NE5B 1AP0A 5D14A 2A6HD 1T5XD 4XT1B 3HRZC 1B53A 1RTNA 2F0HA 3KF8A 3V05A 2PMZB 2EY2A 1CHPD 2BOSA 4ME5A 5CV5A 1JORA 4O1NA 3I4MB 5C5LA 4DAPA 1BUVT 4C3HB 1WVLA 4RCNA 4J1MA 1CFMA 4HSPA 3SR1A 3QB3A 1JB3A 3X3MA 1HXYD 4KHZA 4FP5D 3LX0A 3DWPA 5C0XG 1F2ZA 2QF7A 2K05A 4KN7C 1CZWA 2EYOA 4JK1C 1SDFA 1LTID 4IALA 2JP1A 5FO9B 5KGUA 1SE2A 5BN4A 1RHPA 5ISRA 1QG7A 3HOUB 2L9HA 2HDLA 1H9JA 2J0TD 4A3KB 2TSSA 2F0MA 1Y8PB 3P1HA 2K1BA 1ZEQX 3HG9A 4DXGA 2JA8B 4CKBA 5CBAE 3HOXB 3W3AA 4S3SA 1SNQA 2OT2A 4HAEA 3I4LA 1WTRA 2F0GA 4FXGC 1Y1WB 4PMWA 5M5XB 4A3BB 3DUZA 1K8MA 1BCPD 2NVQB 5C4HA 1K8OA 1SYCA 3QG1A 1PTOF 3OHXC 1R4PB 5ELBA 5DM63 3BVMA 3E6ZX 1I4GA 3C1EA 4F8MA 3RD4A 1PFMA 5F2DA 2E2HB 1CHQD 2DN8A 2WP8J 1A3UA 1QWYA 1SYFA 3TDQA 5IODA 2ZXRA 3TP8A 1JWUD 1G2TA 5JEAH 2F3VA 3FDTA 1TT2A 5EKIA 5JVH3 3K57A 1CQFA 3KLRA 3MVVA 4WFN3 4QF4A 3D3RA 3ITPA 1GOZA 5COYA 3P7JA 2NTSA 2B2TA 2QEJC 2K7VA 5K36H 5T1GA 5KRUA 3IAYA 2JXMB 2Y0SB 2ICEC 5C3WA 2IX1A 3D31A 4ZQ3A 2E2IB 3KLSA 3ND9A 4KK7A 1WD1A 3MXNA 1CQVA 4FF1A 2NN6H 2YYZA 4NMZA 5JAVA 2G9HD 1MI2A 3IFTA 5KNCA 1PRTD 5CV8A 3X3NA 2E2DC 5A35A 4Q5VA 2J4XA 4FF4A 2BA1A 1XWEA 1MSGA 1LTAD 3ERQA 1KDAA 1EY8A 5EPKA 1X3QA 1VCIA 2F0DA 1C8CA 1EIGA 1TQOA 1T5EA 3K58A 2R7ZB 1H9KA 1L0XB 3NBHA 4ODGA 1Q8IA 5C6AA 1PRTB 5E4WC 2L11A 1O7YA 2WAQB 3SXHA 3BDCA 1UUPA 3HOZB 5CYUA 5EPJA 1HUNA 1MSHA 4L63B 1UEAB 2WACA 4Q0FA 1F9RA 1ZXTA 1W6JA 3JAML 1KNEA 1PTOD 5KYLA 5EPLA 3WDNA 1VF7A 2F0TA 5C0XJ 2GA4B 2K04A 4HEDA 1PZJD 4J8QA 4A3GB 1EY6A 3D4DA 3T4AC 3BVZA 4XQQA 4CHTB 4KY7A 2F0VA 2BE5D 2VB2X 4YIJA 3J80E 1WTOA 3CRLC 2RDFA 3MWYW 1O7LA 3C2PA 1EY0A 3NSWA 4DF7A 5IGCA 2ICIA 5FK9C 5KEEA 1CM9A 3C3LA 4AYBB 3DEPA 1F9QA 1JOQA 5K5PA 2B2YC 4DK1A 3A56A 4C1NI 2NN6I 3ONAB 2K5DA 3J81L 1JWSD 4K14A 1I6HB 1SMYC 4IURA 2XNAC 4KY5A 2B2UA 1HTPA 2K33A 2LKVA 4K2LA 1LTSD 2NVTB 1JCKB 3DHQA 4K6DA 1E2WA 3AMUA 1BDOA 4C56C 4G7ZC 5IGBA 1PRTC 3EA6A 2PW5A 1ZYRD 3HOVB 1SEBD 1I6VC 3H0GB 4L6TB 1EY4A 3CQZB 3QWNA 4RGOS 4KI0A 4X3UA 4CJ1B 2L12A 5CBEE 4RH6A 1QOHA 2XWJB 2IWHA 4C2MB 5IIFA 2RSNA 3NBIA 2F0UA 2VUMB 1PDQA 2EYHA 5LHY1 2I07B 4PV1C 3BVGA 1F2LA 4RKLA 2HUGA 5I9OA 2NZ1D 1G91A 4ABNA 1HA6A 2QKIC 3DWQA 4ID6A 1UAPA 1B1ZA 2EYJA 3EQLC 1EWCA 1I4HA 3QIAA 1WTWA 1E0BA 5C5MA 3AB9A 1SYEA 1STBA 2G9DA 3MEHA 3I91A 1ET6A 1MBYA 4N9TA 1Q1BA 4F87A 4KJOA 2JYOA 4CJ0B 1ET9A 1DZ1A 1EY9A 1I3QB 3GTGB 1LT6D 2O2LD 3S1RB 4GZYC 1TKWB 2JSOA 3FEWX 4RA8A 4LJZC 5FO7B 3MTSA 2E75C 4WRDA 2CQAA 3VR2A 2L5TA 5FLXL 3EROA 4B9XA 3HOWB 1HFGA 1XYIA 1SJHD 3M3YB 1KDBA 4EQPA 5LL6X 4FXDA 3TP5A 1IW7C 2M2LA 1QJOA 2AQ3B 2XRQD 1C4QA 4RCOA 2K03A 2IW3A 2Z4IA 1LTRD 1LV9A 2EYPA 1F77A 1PZID 3K5NA 4C1NK 4UDUC 4X3TA 1HA5A 2IPKD 1CA6A 4K8JA 3TBIB 1ICWA 5CMDA 1HRJA 1AFPA 4IUQA 3QOLA 3M7NA 4B9WA 2J7ZA 2AWNA 5JEAG 1S5BD 1ESFA 1VDZA 2NVYB 1SJED 2BCOA 5C44B 2CW0C 5HURA 4A3IB 4WORA 2RDHA 3ND8A 1XX8A 2X6GA 3LWUA 1YNND 1AN8A 3O13A 3BDOA 5K36G 2CHBD 1S4ZA 4A93B 1HQRD 4ZK9B 3DMUA 1Y8NB 1SE4A 1EEID 3S1MB 1PYWD 1BO0A 2BDOA 3CHBD 5KNDA 5I2XA 2FINB 4A3JB 3T16A 4DNTB 4B08A 3OPOA 5M9OA 3LWEA 4OIJA 1SXTA 4P2CB 3A8KE 3MXUA 1R9TB 3GD7A 2MHVA 2F0EA 2HCIA 2K6AA 1D5XC 3OSOA 2LY7A 2A69D 3I70A 2WB1B 1OXXK 2F03A 3A55A 5I4DA 3OW7A 1OO9B 2F0WA 1LACA 1EIHA 1TWFB 4R8NA 2B2VC 3JAME 2MUYA 3MC0B 1RKNA 3OIQA 2B2VA 1A2TA 3Q22A 3T56B 1U4PA 4H13C 3NTIA 4IN3A 3SEBA 5EQ0A 1SNMA 3SHLA 2EZVA 1B3AA 3ZYYX 4IUUA 1SE3A 4TKOB 3D4WA 3BS1A 3I8ZA 1HQMC 4NW2A 1FNVA 1TS3A 4LAAA 3RZOB 1BXTA 2DNCA 3L7ZC 2B2WA 2LFNA 3MFYA 3J81E 2PCFB 1O78A 2KEEA 5IT9L 3KUPA 1STGA 4FF3A 2K28A 4BS9A 1STAA 5C4ZA 2IT1A 2Z4HA 3TP7A 2L0CA 2KA7A 4QUCA 3MXPA 1BCPB 2B2TC 2A68D 2KCCA 4NDXA 3Q24A 5EBCA 1X3PA 1AZQA 2O5JC 1EYAA 2Q8RE 3K6OA 4E6IA 4HSVA 2A6HC 2ZXPA 3BZDB 3FRPB 1TWAB 2IL8A 5CV9A 4WJWA 1SNDA 1HTLD 1ENCA 5C4JB 3SK4A 1GXDC 5JEAJ 3SDZA 1DOMA 3S1QB 1LT3D 1LABA 1KLUD 1LT4D 4BWGB 4IUVA 4EQOA 1D1IA 1ESRA 1D5ZC 1JC7A 2BA0A 1GUOA 2ENBA 1OXVA 5IGDA 3HZXA 1NSNS 3PV0A 1CZGA 2EJFC 3A7AB 4ZUJA 3MXGA 3TMEA 1SSOA 5E1FA 2MP1A 3V96A 5C3EB 2EY5A 3VYTA 3VR3A 1FNWA 1SNPA 1JICA 2EOTA 1M4VA 3HEJA 4XQJA 5DM73 3H3VC 4RGTA 1PLFA 2EDGA 4L8JA 1G8ZD 1O80A 1VMCA 3I3CA 1BCPC 1Y8OB 1JQYD 3TZUA 3CRKC 1HFNA 1LTGD 5JPMC 5M5WB 2M9VA 5FLXE 3FVQA 4XQNA 3S2HB 3DEOA 4K5WA 5KNBA 2D5DA 3VA5A 1TWCB 4F7XA 2PQEA 2I46A 4KKTA 4DA2A 1QE6A 3FPPA 3BYYB 3PIP3 3W2DA 3I90A 1RF2D 1W6KA 5CGKA 1WCMB 5M3MB 5JPNC 5ELFA 1PTOB 1TU2B 1OXUA 3N52A 1AEXA 1J9OA 2F0SA 3BG3A 5FOBB 2L4NA 1D2BA 1IKMA 3VR6A 1EY7A 4DAVA 2OEOA 3OMCA 2SNMA 1L0YB 3URYA 2XVSA 2L55A 1IYUA 2B2UC 2C5CA 4RHSA 3OWFA 3VA7A 2X69A 5A2QL 2XSCA 3NHHA 1BBXC 4DU9A 1H9SA 3VYSA 2WIIB 3I73A 4OL7A 4BA2I 3OIPA 1A2UA 1DJRD 1SYGA 1QB5D 1JOKA 3R8BA 2O4XA 5IGEA 3NQIA 3QO2A 5I9PA 3NWTA 4PMCA 5EJWA 1Q12A 3AU7A 3NTKA 2Z1CA 1YNJD 1EU4A 3A8JE 1LT5D 1EFID 2F3WA 2PYKA 5DEHA 1II3A 2ZXOA 1GUTA 2B8FA 4R8IA 2Q8TA 3GTKB 2K01A 2R61A 1TIID 2F0LA 4IUNA 3OOCA 2F0JA 4IUTA 2EVBA 3VYUA 2MPMA 2NYZD 5CV7A 1JOOA 4N9PA 3SE0A 3C46A 3KLSX 4G4KA 1XXGA 2EY6A 2QDBA 3DM1A 1GHKA 3PIO3 1SYBA 5EBDA 4C3JB 1FGBD 4IFDH 1PTOC 2EJGC 1DYQA 3A7LA 1V1OA 1C48A 3M4YA 1VMPA 4DGZA 3KBGA 3K59A 1RODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  1NCV A;  2SDF A;  1O7Y A;  4OIK A;  3I8Z A;  4RA8 A;  1WVL A;  2XIW A;  1TVX A;  2B2U C;  1JE4 A;  3HP3 A;  2CVR A;  1G2T A;  2HDM A;  1U4R A;  5EPJ A;  3TZD A;  2NWG A;  3TN2 A;  1BO0 A;  4DN4 M;  1HUN A;  1MSH A;  1SSO A;  2FJ2 A;  3MTS A;  4NW2 A;  1F9R A;  2X69 A;  2FIN B;  3FDT A;  2MP1 A;  4O42 A;  1ZXT A;  5EKI A;  2RA4 A;  4R9W A;  1BNZ A;  2KOL A;  2KED A;  1BBX C;  1QNK A;  2RVL A;  3LWE A;  2B2W A;  4OIJ A;  1KNE A;  5AFW A;  5EPL A;  4X3K A;  4ZKC B;  4X3U A;  1DON A;  4CJ1 B;  2K05 A;  2D9U A;  2DY7 A;  3GV3 A;  3H91 A;  1HFG A;  2N88 A;  2KEE A;  5COY A;  2MGS A;  3P7J A;  3KUP A;  1G2S A;  1ML0 D;  1JIC A;  2EOT A;  2K04 A;  1SDF A;  2B2T A;  2L12 A;  3IL8 A;  4HED A;  4X3S A;  5CBE E;  1BF4 A;  1XYI A;  2HCI A;  4IUP A;  1WTQ A;  1F9P A;  5T1G A;  2JP1 A;  2K28 A;  4UAI A;  2B2W C;  1WTX A;  1PLF A;  1EOT A;  4MN3 A;  3KBX A;  3IFD A;  3QO2 A;  1RHP A;  1B50 A;  2KEC A;  2M2L A;  2RSO A;  2RSN A;  4QUC A;  2HCC A;  5D65 A;  1IL8 A;  1O80 A;  1QG7 A;  2B2T C;  1M8A A;  2L9H A;  5EJW A;  3R93 A;  1PDQ A;  3G7L A;  1ILP A;  1VMC A;  2HDL A;  4U68 A;  2EE1 A;  1CA5 A;  1WD1 A;  1G6Z A;  1AZQ A;  1X3P A;  1DOL A;  2BDN A;  2K03 A;  3I3C A;  1WTO A;  4MHE A;  4XT3 B;  2Q8R E;  1WTP A;  4XDX A;  1X32 A;  1Q3L A;  3SVM A;  2K1B A;  4HSV A;  3MWY W;  1WTV A;  1HFN A;  1EIH A;  1LV9 A;  1NR4 A;  1MI2 A;  1NR2 A;  2FMM A;  4CJ2 C;  2B2V C;  1MGS A;  4X3T A;  1F2L A;  5CBA E;  1HHV A;  3Q6S A;  1CA6 A;  2HUG A;  1U4L A;  2NZ1 D;  2IL8 A;  1G91 A;  1ICW A;  2B2Y A;  2MJ8 A;  3F2U A;  3DEO A;  1ILQ A;  2VXW A;  4HAE A;  1PFN A;  4IUQ A;  2Q8T A;  5CMD A;  4R8I A;  1WTR A;  1GUW A;  1HRJ A;  1CM9 A;  2K01 A;  1WD0 A;  1EL0 A;  2J7Z A;  2FFK B;  5COR A;  3D6W A;  4ZAI A;  3DEP A;  1J8I A;  1F9Q A;  1F9S A;  2B2V A;  3GV6 A;  4IUT A;  2MPM A;  2NYZ D;  3FPU B;  1HUM A;  1MSG A;  2N55 A;  1QE6 A;  1A15 A;  1B2T A;  1SAP A;  1WTW A;  1E0B A;  2B2Y C;  3I90 A;  4LMQ D;  5E4X A;  5EPK A;  1B4O A;  1DOM A;  1U4P A;  3DM1 A;  3I91 A;  1X3Q A;  2KVM A;  3ONA B;  5JJZ A;  1C8C A;  2R3Z A;  1EIG A;  1O7Z A;  4IUV A;  4ZKB B;  1AZP A;  1PFB A;  2X6L A;  1KNA A;  3N52 A;  4RAU C;  4QUF A;  2EPB A;  3UI2 A;  4ZLT F;  1AP0 A;  1ESR A;  1NAP A;  1XX8 A;  2X6G A;  1RTO A;  5D14 A;  5EQ0 A;  1J9O A;  1RJT A;  4XT1 B;  4IUR A;  1S4Z A;  1B53 A;  1RTN A;  2JYO A;  4CJ0 B;  1EQT A;  5T1I A;  1IKL A;  4ZK9 B;  2B2U A;  4HCS A;  1DZ1 A;  1VMP A;  1DOK A;  1U4M A;  1B3A A;  5DNF A;  2L4N A;  2H1E A;  2FHT A;  4IUU A;  2L11 A;  4RWS C;  5E4W C;  1HA6 A;  1PFM A;  1IKM A;  2KUM A;  2DY8 A;  1ROD A; 
#chains in the Genus database with same CATH topology
 4DAY A;  1NCV A;  1G29 1;  4C3I B;  3M4P A;  4TSS A;  3GTQ B;  4LF7 Q;  1JE4 A;  4M8A A;  1NNX A;  3BDL A;  3FMC A;  1H9M A;  1MD2 D;  1PMR A;  4JI6 Q;  1VQI A;  3CCU A;  1Z7T A;  4DV5 Q;  3CMA A;  1K8G A;  4LFC L;  4DFA A;  1VF5 C;  5D3I B;  4EGV A;  1UNS A;  3TRE A;  1VQ4 A;  2BE5 C;  3NP8 A;  4QMG A;  4RGN A;  2NB0 A;  1S5C D;  3PUV A;  2KHS A;  1PVO A;  4CGY B;  4LNQ A;  3HKZ B;  1J5E Q;  4CBV A;  2CWP A;  1DON A;  1GD7 A;  2H4O A;  3QOJ A;  3KF6 A;  4IJL A;  4KKU A;  1ML0 D;  2ID0 A;  2PO4 A;  3T53 B;  2RF4 A;  4LF4 L;  1TWA H;  4UAI A;  1RCV D;  1IHZ A;  1A6X A;  1YJ9 A;  3KFU A;  3HOV G;  1ZKO A;  3IFD A;  4K8I A;  3CKI B;  2AUK A;  5C4J H;  3IKJ A;  1ILP A;  3E9I A;  4U68 A;  1FYC A;  3STB C;  1YEZ A;  2ASB A;  5IOC A;  3S1Q H;  2XRS D;  1F2M A;  4XDX A;  1HNX L;  5IE8 A;  2Q2H A;  3SK5 A;  4QGU A;  1CT1 D;  3J7A F;  1L2F A;  2B63 B;  4IJH A;  3H15 A;  2N8N A;  3HKS A;  1XMQ Q;  3I4O A;  2VXW A;  2AQ1 B;  4DK3 C;  1EY5 A;  1GUW A;  2DGY A;  5HGT A;  5IT9 E;  2KCN A;  3RMH A;  4LF6 Q;  1E2V A;  3KK7 A;  4AQY L;  2WB1 E;  2SOB A;  1J8I A;  4OHJ A;  5I6W A;  2VUM G;  1TWG B;  4IZ8 A;  4MTK A;  3FPU B;  3A54 A;  3J7A V;  1CK1 A;  1B2T A;  2BH2 A;  1ZYR C;  4DAM A;  4L5Q A;  5G3L F;  1KD1 C;  4MTN A;  1PV4 A;  1O7Z A;  2R6G A;  3T51 B;  1K3B C;  1FL0 A;  4RFB A;  5IP7 H;  5JJI A;  1RTO A;  1V8Q A;  5EKL A;  2B3G A;  5C3E H;  5IGF A;  5I6Y A;  1BQQ T;  2K75 A;  1IKL A;  3FKI B;  4KHV A;  2AQ2 B;  2RBM A;  4HCS A;  2R7F A;  4P72 A;  5DNF A;  2HQE A;  4GKK Q;  2D62 A;  2OXP A;  2FHT A;  2E5L Q;  1S3O A;  4DV0 L;  1A62 A;  2KUM A;  4KD3 A;  4X66 Q;  1S5F D;  2MO1 A;  1A3T A;  2EY1 A;  4K2K A;  2JJQ A;  2RQX A;  1MIU A;  1PH9 A;  4OGQ C;  4QIW E;  3MHB A;  2WV6 D;  5J1Z A;  3OMG A;  3KYH C;  1QCB D;  1IYV A;  2HT1 A;  4YCW A;  2K32 A;  4ZCK A;  1Y1V G;  2A5H A;  2IHF A;  1DXM A;  4IFD I;  1GVP A;  4DR1 Q;  4OO1 H;  2JA6 B;  3GTL B;  2D9U A;  2Z8L A;  1FR3 A;  3GV3 A;  3ZJY C;  2PNH A;  4PZ7 A;  3MZ5 A;  4B3R L;  3H3V I;  5M5W H;  4XIG S;  5DLQ E;  4QCL A;  2E2J B;  4IUP A;  1WTQ A;  1F9P A;  3S2H H;  1D7Q A;  1IZ6 A;  3SGI A;  1RDP D;  1A3V A;  2NN6 G;  4MN3 A;  1PH6 A;  2I5H A;  1NUC A;  2RSO A;  1N32 Q;  1TWC H;  5D65 A;  3VR4 A;  1KDC A;  3Q0A A;  4HTH A;  4RHR A;  3HS0 C;  2QA4 A;  1KLG D;  4BBS B;  2QIL A;  1Z6H A;  3A8I E;  1WCM H;  3KOJ A;  3QJY A;  5M3M H;  4HN7 A;  1PTO H;  4H0L C;  4DV6 L;  1WTP A;  1XMO Q;  1G6P A;  1WTV A;  1D1K A;  4A3C G;  4CJ2 C;  4XYQ A;  3PO3 B;  3R2I A;  3OTO Q;  3J7Z C;  2KQ3 A;  1PFN A;  4A75 A;  1WD0 A;  3ERS X;  4LUO A;  3D6W A;  3SK8 A;  3P75 A;  4RKB A;  4DR5 Q;  3H6M A;  2CH4 A;  4RGM A;  1SAP A;  1IBL Q;  5E4X A;  1VQJ A;  2WIN B;  3AEV A;  2KVM A;  2VY3 A;  1KAA A;  2R3Z A;  1AZP A;  1HR0 W;  3GTP B;  3E5S A;  4QUF A;  2MQH A;  4IO9 A;  1HPC A;  1NAP A;  2PNR C;  2EYF A;  4XYO A;  4LF8 L;  3EIV A;  4OWT B;  3J81 j;  4NP5 A;  3S17 B;  1KAW A;  1WJJ A;  2O5I C;  2D0P A;  3PUW A;  5C4X B;  1H9R A;  1OXT A;  1DOK A;  1EU3 A;  4KD4 A;  5JOB A;  2H1E A;  4DV3 Q;  4UP9 A;  3WOE A;  1TS2 A;  2XGT A;  4BY7 B;  1PRT F;  4A3E B;  3NK9 A;  2XIW A;  2CVR A;  2HDM A;  1U4R A;  2NWG A;  3I4N G;  2JA5 B;  1E7Z A;  3MA2 B;  1IYJ B;  2K52 A;  4QIW B;  5CR3 A;  4YWK A;  1NMG A;  4NKL A;  4CDC C;  4R4I A;  1S72 A;  5G3L D;  2UUA L;  5HGQ A;  4V0B A;  1L1O C;  3E0J A;  2ZM6 Q;  5AFW A;  5IP9 H;  4ZRZ A;  2VQE L;  5M5Y B;  3UDF A;  3S15 B;  2N88 A;  4CKC A;  4B3S L;  1G2S A;  5KIX A;  4DV7 Q;  1QIL A;  5BN3 A;  3EBE A;  2JEB I;  5LMN W;  4JI5 L;  4GLX A;  1FD7 D;  1T9H A;  5DAU A;  5IYD G;  1STY A;  2B2W C;  2F0I A;  3GTK H;  4IQZ A;  4ILW A;  3L3O C;  3U9O A;  1B50 A;  3P20 A;  3TS0 A;  1K9M C;  2NVX B;  1M8A A;  3RZD B;  4A3M B;  2DJG C;  3LNN A;  1QVG A;  4A3J G;  4FVM A;  3PUY A;  2HIX A;  1DOL A;  2BDN A;  3D4R A;  4FNF A;  4DR4 L;  4X65 Q;  4HJA A;  4XT3 B;  4EVO A;  2JQO A;  1X32 A;  4C3J H;  4OO1 I;  5A2Q E;  2CWA A;  1NR4 A;  2FMM A;  1YNN C;  2F4V L;  3C1F A;  3G6J B;  1VQH A;  4HMI A;  3L2P A;  1AW7 A;  1MGS A;  2D0O A;  2EYL A;  4C3H G;  4H44 C;  1I4X A;  4AIM A;  1U4L A;  3S2D B;  1RD9 D;  4ULL A;  4BXX H;  2MJ8 A;  2EJM A;  1D8L A;  1ILQ A;  1STH A;  4Y7N B;  1STN A;  2FFK B;  2E76 C;  1QVC A;  3GTO B;  2A73 B;  2F0N A;  1LTT D;  2G5D A;  2WB1 G;  5CV4 A;  4JI3 L;  4C3I H;  3MAQ A;  1B9M A;  3F2C A;  3GTQ H;  5LL6 S;  4LMQ D;  4KJN A;  4LF7 L;  2VW9 A;  1C0A A;  3LGJ A;  4DK0 A;  4JI6 L;  1E1T A;  4DV5 L;  2TMP A;  3NTH A;  4ZUI A;  4ZLT F;  4JC0 A;  1RJT A;  3G4S A;  4X62 Q;  5T1I A;  3S1N B;  3H94 A;  3U9S A;  1V1P B;  3R3O A;  1UEB A;  4GN5 A;  1J5E L;  1KAB A;  4I7Z C;  5FO8 B;  2L1B A;  1GM5 A;  2PPB C;  1TY0 A;  3G48 A;  3D6C A;  4WJ4 A;  4BA1 I;  2A69 C;  3NUC A;  1VQ7 A;  4FXK C;  4IPH A;  1GUS A;  4K5V A;  2B29 A;  5J39 A;  3H09 A;  2MFI A;  3S14 B;  1PXU A;  1I5F A;  3RLN A;  4CDE C;  4U67 3;  2RVL A;  1Q86 C;  1SMY D;  5D3D A;  1LO5 D;  4KMU C;  2NUC A;  2DY7 A;  2I0Q A;  1H9S B;  5KYI A;  1Y1W G;  4DNR B;  4KN4 C;  4LW1 A;  1KTK A;  4QL5 A;  4F88 A;  4X3S A;  2B63 H;  4K0K Q;  3N6R A;  3EN2 A;  4BBR B;  4TQU S;  1EZ8 A;  1VQK A;  2OTJ A;  2VB3 X;  1SN8 A;  2ES2 A;  1XMQ L;  2F1M A;  5BN5 A;  3KBX A;  4I65 A;  3J81 i;  1K73 C;  5TSS A;  2NZH A;  4LF6 L;  2HCC A;  1TWG H;  5GAD C;  3GTM B;  1GHJ A;  4XXE A;  4P71 A;  1G6Z A;  4IFD G;  4MHE A;  1WYD A;  1JR0 D;  5IGG A;  2RKS A;  4PMB A;  3K80 C;  1CI3 M;  3PIP A;  4A3F B;  3FKI H;  5C0X H;  4A3L H;  1YVC A;  1F2Y A;  4GKK L;  4ZAI A;  2E5L L;  3I56 A;  1B9N A;  1HUM A;  2F4I A;  1DM0 B;  1I50 B;  2ZT9 C;  4X66 L;  5JJL A;  4A3I H;  3TSS A;  3F2B A;  1V43 A;  3KDF A;  3Q23 A;  1VQ6 A;  2K5Q A;  2PW7 A;  2RHS B;  4A93 H;  2F0Q A;  4P74 A;  5ELD A;  5FKA C;  3R2T A;  5CC4 A;  1EQT A;  4V19 0;  1TWH B;  2LXJ A;  2JA6 H;  1U4M A;  2LMC B;  4GLA C;  3TP6 A;  4DR1 L;  4RWS C;  3F2D A;  1LTB D;  1Y14 B;  2E2J H;  3E9H A;  2NTT A;  4YCU A;  1GJX A;  2B39 A;  3VYR A;  1STE A;  5ELC A;  4LK1 C;  3TN2 A;  2I5L X;  4DN4 M;  2SNS A;  2DNE A;  3K5O A;  2FJ2 A;  3CCL A;  1B7Y B;  3ICE A;  1N32 L;  1V1P A;  2A68 C;  4BBS H;  5C3X A;  1I4Q A;  2KOL A;  3K81 C;  2KED A;  1QNK A;  4KY6 A;  3NWS A;  1Q1E A;  1PHJ A;  4MNO A;  4QY7 A;  4X3K A;  4J6H A;  2A74 C;  3PO3 H;  1SNC A;  2FXQ A;  2JEA I;  3CU7 A;  4DXF A;  4G7H C;  3OTO L;  1WTX A;  3UE1 A;  3S9W A;  3D0F A;  1RL2 A;  3PO2 B;  2YU9 B;  3DWA A;  3K5L A;  1GUG A;  2F3I A;  5IP7 G;  5GRO A;  4G7O C;  4DR5 L;  4J15 A;  3G7L A;  4MIU A;  3HKZ E;  4Z9C B;  2PZT A;  2LS0 1;  5C3E G;  1IBL L;  1ENF A;  1YIJ A;  1HNW Q;  3RUZ A;  3HOY B;  2AUJ D;  3GTP H;  2B8G A;  4X6A H;  3J80 c;  4BY1 B;  1TY2 A;  2UU9 Q;  2YTY A;  1DCZ A;  1BKB A;  1QNU A;  1XTC D;  3AQQ A;  2A6E D;  1BR9 A;  5NUC A;  4GOP C;  1CTM A;  1EQQ A;  3S17 H;  3G6E A;  3Q6S A;  2QCP X;  4H7B A;  4KKS A;  5C4X H;  3HOZ G;  2JA9 A;  2B2Y A;  1GUN A;  1I4P A;  2R92 B;  5GAE C;  3U4Z A;  1XNR Q;  1EL0 A;  1OXS C;  3PIO A;  1BBU A;  1QUQ B;  1IW7 D;  4BY7 H;  3VR5 A;  4A3E H;  2Q2U A;  3K0Y A;  1CKM A;  4DV3 L;  2F0K A;  2Q8I B;  3GV6 A;  4KV6 A;  1VQG A;  3I72 A;  3PUX A;  2JA5 H;  3NEM A;  3K7A B;  1Q90 A;  1B4O A;  3E0E A;  5JJZ A;  1EYC A;  4OO1 G;  2X6L A;  1KNA A;  2EPB A;  4YY3 Q;  1PZK D;  4CKE A;  3CW2 C;  2OF1 A;  1ONL A;  2C9O A;  2ZM6 L;  2WKD A;  5C0X I;  5M5Y H;  3S15 H;  5IY0 A;  2KHI A;  2F0O A;  1O7I A;  1SNO A;  4DV7 L;  3GO5 A;  4HR7 B;  2SDF A;  2ZTD A;  3TZD A;  5M3M G;  3EJI A;  2IX3 A;  2CW0 D;  3M85 A;  4B3M Q;  3PF5 A;  2NVX H;  3RZD H;  4A3M H;  2EYM A;  4JBW A;  3K0X A;  2RA4 A;  4R9W A;  1BNZ A;  4EQN A;  3PUZ A;  3WOF A;  2XN9 C;  5JVG 3;  3AFQ A;  5I2Y A;  4P75 A;  5FJ8 H;  4X65 L;  5FLM H;  1BBW A;  4HMJ A;  4DUY Q;  2MGS A;  4XTC S;  2C35 B;  3IL8 A;  5M3F B;  1S40 A;  2F0P A;  3S2D H;  1S5E D;  4FO2 A;  2V4D A;  4Y7N H;  1D5M C;  3GP7 A;  4FYD A;  1SMX A;  1EOT A;  1TR5 A;  3GTO H;  3M7G A;  2KEC A;  4FF2 A;  1X3F A;  2NZO A;  3E3X A;  4GLV B;  1IL8 A;  4G57 A;  1QVF A;  4PQX A;  3R93 A;  2QEX A;  3GTJ B;  4K5X A;  4KTA A;  2HIV A;  1CA5 A;  2PZU A;  5IYB H;  2JA7 B;  5L37 A;  1P16 A;  1SBB B;  1XJV A;  3SVM A;  1TS5 A;  4IFD J;  3CC7 A;  3MFG A;  1NJI C;  4K6L A;  5E7N A;  4QB4 A;  4JBJ A;  4A3D B;  3DXJ C;  3J7Y W;  1MJC A;  3M4O B;  2KBN A;  2RDG A;  3NQT A;  1PH4 A;  3S1N H;  1Y1V B;  2HD3 A;  3F2U A;  3UDI A;  1KRT A;  3L9A X;  3H0G G;  5EKK A;  1NTG A;  3V2T A;  3EVQ A;  4MZ9 A;  1EZ6 A;  5COR A;  2AWO A;  5GQO A;  3ULL A;  1Z47 A;  5CV6 A;  4LF5 Q;  4HIM A;  1F9S A;  5E3F A;  3BZK A;  3GQB A;  2PZW A;  1P8L A;  3T13 A;  5GAH C;  3S16 B;  3HGB A;  2F0F A;  2I5M X;  2R93 B;  1DD2 A;  1EQV A;  4JI8 Q;  5IP9 G;  4DR6 Q;  3EFX D;  1U9R A;  2JE6 I;  1VQ8 A;  2IJ0 A;  4ZKB B;  1PH8 A;  3S14 H;  4RAU C;  5ELE A;  3UI2 A;  2EXZ A;  1SFO B;  1I4R A;  1R4Q B;  1QUQ A;  3PMF A;  1HZC A;  1TS4 A;  1EWI A;  3AFP A;  2PMZ E;  4GKJ L;  1B44 D;  3NPP A;  1VQN A;  1VQB A;  2K5W A;  1N8R C;  1NMF A;  1CKO A;  4RMF A;  2FMC A;  4O42 A;  2A6E C;  2DY8 A;  1YZ6 A;  4CDF C;  4BBR H;  4K0K L;  4OXP A;  1K83 B;  1SYD A;  4OIK A;  2CKZ B;  4QJF A;  2Q2T A;  1TVX A;  3HP3 A;  3CPF A;  3J80 L;  2IX0 A;  3SK6 A;  1KQS A;  1EWH A;  1I94 Q;  4C3J G;  3K5M A;  3GTM H;  3KJO A;  5J22 A;  3UDG A;  3TEH B;  4L5T A;  1YNJ C;  4BXX G;  1EOV A;  1D6E C;  4ZKC B;  2M00 A;  2NBF A;  4HCE A;  3H91 A;  1ENA A;  1BF4 A;  4A3F H;  1HZB A;  3FP9 A;  4JOI C;  4C3I G;  1WI5 A;  2ZTC A;  4NXM Q;  1C9O A;  1Y69 U;  2UXB Q;  1S5D D;  1HCZ A;  4ZYS A;  5GAG C;  4HJ7 A;  2XWB B;  4TRD A;  1JWM D;  1I50 H;  2D2C C;  4JOI A;  1BCP F;  1BVS A;  2EE1 A;  1EEF D;  3D8G A;  2KJX A;  3W1G A;  1Q3L A;  1FNU A;  4DPG A;  3I4N B;  4JBM A;  1NR2 A;  1Z9F A;  3BYT B;  1E2Z A;  4DV4 Q;  4GS3 A;  1EFW A;  1HHV A;  1TWH H;  1BOS A;  3OWE B;  4HIK A;  1LLR D;  2ZJP A;  2SEB D;  3M4Q A;  4JI1 Q;  4X64 Q;  3CXC A;  2VNU D;  3NXW A;  4PNY A;  2N55 A;  1A15 A;  2WKC A;  2VQF Q;  1EYG A;  3RLF A;  2N49 A;  3HOW G;  5EGT A;  1EYD A;  1B8A A;  1M90 C;  1PFB A;  2E74 C;  3ER0 A;  3NE5 B;  4M1U B;  1AP0 A;  2CFM A;  5D14 A;  2A6H D;  1T5X D;  4XT1 B;  2B63 G;  3HRZ C;  1B53 A;  1RTN A;  2F0H A;  3KF8 A;  3V05 A;  2PMZ B;  5AJ3 Q;  2EY2 A;  1CHP D;  2BOS A;  4ME5 A;  5CV5 A;  1JOR A;  4O1N A;  3I4M B;  5C5L A;  3AYH B;  4DR3 Q;  1KHI A;  4DAP A;  4POG A;  1BUV T;  4C3H B;  1WVL A;  3OW2 A;  4RCN A;  3CCV A;  3PO2 H;  4J1M A;  2YU9 H;  1CFM A;  5IWA Q;  4HSP A;  4NXN Q;  3SR1 A;  1EUJ A;  1NBW A;  3QB3 A;  1JB3 A;  5ELO A;  3X3M A;  1HXY D;  4P73 A;  4KHZ A;  3FKI G;  3HOY H;  4FP5 D;  2VS1 A;  1HNW L;  3LX0 A;  3DWP A;  5C0X G;  1F2Z A;  4BY1 H;  4A3L G;  2QF7 A;  2K05 A;  3U50 C;  3GDE A;  1ASZ A;  1A8V A;  4KN7 C;  2LSS A;  2UU9 L;  1CZW A;  2EYO A;  2N3S A;  4JK1 C;  1SDF A;  1LTI D;  4IAL A;  5C44 G;  2JP1 A;  5FO9 B;  1M1K C;  2Y0S E;  3A5U A;  2R92 H;  5KGU A;  1SE2 A;  4A3I G;  2OQK A;  3NEL A;  5BN4 A;  1XNR L;  1RHP A;  3ULP A;  5ISR A;  1QG7 A;  2IY5 B;  3HOU B;  2L9H A;  1VQF A;  4A93 G;  2HDL A;  1H9J A;  3PF4 A;  4R1J A;  2J0T D;  4A3K B;  3IRB A;  2TSS A;  2F0M A;  1OTC A;  1Y8P B;  3P1H A;  2K1B A;  1ZEQ X;  1X55 A;  3HG9 A;  4DXG A;  2JA8 B;  4YY3 L;  1N33 Q;  4CKB A;  5CBA E;  3HOX B;  1U5K A;  3W3A A;  4S3S A;  1SNQ A;  2OT2 A;  4HAE A;  5ELN A;  3I4L A;  3JAM c;  1WTR A;  2F0G A;  3L0O A;  1FVI A;  4FXG C;  1V1Q A;  1W2B A;  1KIX A;  1KRS A;  1Y1W B;  4PMW A;  5M5X B;  2ALY B;  4A3B B;  2CH4 W;  3DUZ A;  1K8M A;  1BCP D;  2NVQ B;  5C4H A;  4B3M L;  1K8O A;  1SYC A;  3QG1 A;  1PA6 A;  3CC4 A;  1DGS A;  1PTO F;  3KDF B;  3OHX C;  2E8G A;  1R4P B;  4IPG A;  3PO3 G;  5ELB A;  5DM6 3;  3BVM A;  2HHH Q;  3E6Z X;  2Z6B A;  2QW7 A;  1I4G A;  3C1E A;  1SE8 A;  3I7F A;  2CCZ A;  4F8M A;  1IBM Q;  3RD4 A;  1PFM A;  5M3F H;  4DUY L;  5F2D A;  1N36 Q;  2E2H B;  1CHQ D;  2DN8 A;  2WP8 J;  1A3U A;  1QWY A;  1SYF A;  3TDQ A;  5IOD A;  2ZXR A;  3TP8 A;  1JWU D;  3F8T A;  1G2T A;  4NB3 A;  5JEA H;  2F3V A;  3FDT A;  1TT2 A;  5EKI A;  5JVH 3;  3GTJ H;  1X3G A;  4HIO A;  3K57 A;  2A1A A;  1CQF A;  2JA7 H;  3KLR A;  3MVV A;  5C4X G;  4WFN 3;  4QF4 A;  3D3R A;  3ITP A;  1GOZ A;  3DM3 A;  5COY A;  3P7J A;  3S24 A;  1VQ5 A;  2NTS A;  4A3D H;  4A3E G;  1PYS B;  2B2T A;  1X3E A;  3M4O H;  2QEJ C;  2K7V A;  5K36 H;  1Y1V H;  5T1G A;  2DUD A;  5KRU A;  3IAY A;  2JXM B;  1YHB A;  2ICE C;  2Y0S B;  4OX9 Q;  2JA5 G;  5C3W A;  2IX1 A;  1MHW C;  3D31 A;  4ZQ3 A;  2E2I B;  3KLS A;  3ND9 A;  4H02 A;  4LF5 L;  3S16 H;  4DR2 Q;  4KK7 A;  2R93 H;  3CAM A;  1WD1 A;  2ZJQ A;  3MXN A;  1VQO A;  1CQV A;  4FF1 A;  2NN6 H;  4JI8 L;  1IXR A;  2YYZ A;  4NMZ A;  5JAV A;  4DR6 L;  2G9H D;  1MI2 A;  3IFT A;  2Z6K C;  1SFO H;  5KNC A;  2R7D A;  4FDB A;  1PRT D;  1N34 Q;  4DV2 Q;  2LXK A;  5CV8 A;  3X3N A;  2E2D C;  5A35 A;  4AYB E;  4Q5V A;  2J4X A;  2VL6 A;  1HR0 Q;  4FF4 A;  2BA1 A;  2Z6K A;  3TQY A;  1XWE A;  4A3M G;  1K83 H;  1MSG A;  1LTA D;  3ERQ A;  1KDA A;  1EY8 A;  1MJE A;  5EPK A;  1X3Q A;  1VCI A;  1HNZ Q;  2F0D A;  5FJ8 G;  5FLM G;  1EIG A;  1C8C A;  1TQO A;  1I94 L;  4IOC A;  1T5E A;  3K58 A;  2R7Z B;  1WOC A;  1H9K A;  1L0X B;  3NBH A;  4ODG A;  4OEL B;  1VQ9 A;  1X65 A;  1Q8I A;  5C6A A;  5HY6 A;  4R4Q A;  1LTL A;  1PRT B;  5E4W C;  2L11 A;  4HJ5 A;  2KCM A;  1AE2 A;  2PI2 E;  4O2D A;  1O7Y A;  2WAQ B;  3SXH A;  3BDC A;  1UUP A;  3HOZ B;  5CYU A;  5EPJ A;  5IYB G;  4NXM L;  1HUN A;  4AH6 A;  2DJF C;  1MSH A;  2UXB L;  4L63 B;  1UEA B;  2WAC A;  4Q0F A;  1F9R A;  2K5V A;  4APV A;  3BU2 A;  3I2Z A;  1ZXT A;  1W6J A;  2RCF A;  5LMN Q;  3JAM L;  3GTL H;  1KNE A;  3NEN A;  4ALP A;  1PTO D;  5KYL A;  5EPL A;  1SR3 A;  2ZTE A;  3I4N H;  3WDN A;  1VF7 A;  2F0T A;  5IYC H;  4YCV A;  5C0X J;  2GA4 B;  2K04 A;  4HED A;  1PZJ D;  4J8Q A;  4A3G B;  4B3T Q;  1EY6 A;  4DV4 L;  4ME3 A;  1XNQ Q;  1E22 A;  3U4V A;  1YIT A;  1K28 A;  3D4D A;  3T4A C;  3BVZ A;  4XQQ A;  2UUC Q;  4DKA C;  4JI7 Q;  4CHT B;  4JI1 L;  4X64 L;  2KCT A;  4KY7 A;  1EIY B;  2F0V A;  2BE5 D;  2VB2 X;  4YIJ A;  1PFS A;  2VQF L;  3J80 E;  1WTO A;  3CRL C;  1XMO L;  2RDF A;  3WWV A;  5LMU Q;  3MWY W;  1O7L A;  3C2P A;  1EY0 A;  4BBR G;  3NSW A;  4DF7 A;  5IGC A;  2ICI A;  5FK9 C;  5KEE A;  1X9N A;  1CM9 A;  3C3L A;  5AJ3 L;  4AYB B;  3I4M H;  3DEP A;  1F9Q A;  4DR3 L;  1JOQ A;  4JYA Q;  4C3H H;  2OTL A;  5K5P A;  2B2Y C;  1EQR A;  4DK1 A;  3STB D;  1RIP A;  3A56 A;  1SRO A;  4EQ5 A;  4C1N I;  3TS2 A;  2NN6 I;  3ONA B;  2K5D A;  5IWA L;  3J81 L;  4NXN L;  1JWS D;  4K14 A;  2QGQ A;  4LFA Q;  1N9W A;  1I6H B;  3F1Z A;  1SMY C;  4IUR A;  2XNA C;  4A3F G;  4KY5 A;  2B2U A;  1HTP A;  1EIF A;  2K33 A;  2LKV A;  4K2L A;  1LTS D;  1PYB A;  2NVT B;  1SRU A;  1JCK B;  3DHQ A;  4WJ3 M;  4K6D A;  1E2W A;  3AMU A;  4IOA A;  1BDO A;  4C56 C;  1L0W A;  4JI4 Q;  1KC8 C;  1UWV A;  4G7Z C;  3RLO A;  4O0A A;  5IGB A;  4GNX A;  1PRT C;  4HJ8 A;  3EA6 A;  2PW5 A;  1ZYR D;  3HOV B;  3TRZ A;  1SEB D;  1I6V C;  2L15 A;  3H0G B;  3HOU H;  4L6T B;  4QQB X;  4A3K H;  1EY4 A;  3CQZ B;  3QWN A;  4RGO S;  4LFB Q;  4KI0 A;  4X3U A;  4CJ1 B;  2JA8 H;  3A74 A;  2L12 A;  5CBE E;  4RH6 A;  4JI0 Q;  1JJG A;  3HOX H;  1N33 L;  1TXY A;  1QOH A;  1WCM G;  2XWJ B;  2IWH A;  1X6O A;  4C2M B;  3J80 i;  5IIF A;  2RSN A;  1Y1W H;  3NBI A;  5M5X H;  3MEF A;  2F0U A;  2VUM B;  1AE3 A;  3W1B A;  4A3B H;  1PDQ A;  2QDL A;  2EYH A;  5LHY 1;  2NVQ H;  2UXC Q;  4JVZ A;  1VQC A;  2GVA A;  2I07 B;  4PV1 C;  1K8A C;  3BVG A;  1F2L A;  1PH3 A;  4RKL A;  2HUG A;  5I9O A;  3CCE A;  1VQM A;  2NZ1 D;  1G91 A;  3VDY A;  1X56 A;  4ABN A;  2QKI C;  1HA6 A;  2HHH L;  2GN5 A;  3DWQ A;  4ID6 A;  3PO2 G;  1UAP A;  1B1Z A;  1IBM L;  4Y52 H;  2EYJ A;  4UHV A;  3EQL C;  1N36 L;  1EWC A;  1I4H A;  3QIA A;  1WTW A;  1E0B A;  2BH8 A;  3AB9 A;  1SYE A;  1STB A;  2G9D A;  3MEH A;  5C5M A;  4JV5 Q;  3HOY G;  3I91 A;  1H95 A;  1ET6 A;  1MBY A;  1K0R A;  4BY1 G;  4N9T A;  2K14 A;  2CQO A;  1Q1B A;  3CCS A;  4F87 A;  4KJO A;  2JYO A;  4X62 L;  4CJ0 B;  1JJ2 A;  1ET9 A;  4UP8 A;  2R92 G;  1DZ1 A;  1EY9 A;  1I3Q B;  3GTG B;  1A0I A;  1LT6 D;  3KF8 B;  2O2L D;  3S1R B;  4GZY C;  1TKW B;  2JSO A;  1YHA A;  3FEW X;  4RA8 A;  1E3P A;  1Q82 C;  4LJZ C;  5FO7 B;  4OX9 L;  3MTS A;  2E2I H;  2E75 C;  4WRD A;  3PSI A;  2CQA A;  1LM0 A;  1HH2 P;  3VR2 A;  4DR2 L;  2L5T A;  5FLX L;  1SLJ A;  1IBK Q;  1YJW A;  3ERO A;  2PI2 A;  4B9X A;  4A76 A;  3HOW B;  2V1C C;  1HFG A;  4DV1 Q;  2ZJR A;  1XYI A;  1PH2 A;  1FGU A;  1SJH D;  2F52 A;  3M3Y B;  2WFW A;  1KDB A;  4EQP A;  5LL6 X;  1N34 L;  4FXD A;  3TP5 A;  4DV2 L;  1IW7 C;  2RHQ B;  4DK6 C;  2M2L A;  1QJO A;  2AQ3 B;  2XRQ D;  1C4Q A;  1HR0 L;  4RCO A;  3UE0 A;  2K03 A;  2IW3 A;  2Z4I A;  1HNZ L;  1LTR D;  2R7Z H;  1LV9 A;  5BR8 Q;  4DR7 Q;  5M3F G;  2EYP A;  1F77 A;  3CP0 A;  1PZI D;  4LUV A;  3I55 A;  3K5N A;  4C1N K;  4UDU C;  4X3T A;  1HA5 A;  2IPK D;  1CA6 A;  4K8J A;  2YV5 A;  1CKN B;  2UUB Q;  3TBI B;  1ICW A;  3RN2 A;  5CMD A;  1HRJ A;  1AFP A;  4IUQ A;  3QOL A;  3M7N A;  4B9W A;  2AMC B;  2J7Z A;  4R4T A;  4JBK A;  2AWN A;  5JEA G;  5IT9 c;  1S5B D;  3UDX A;  2N78 A;  1ESF A;  1VDZ A;  2NVY B;  1SJE D;  2BCO A;  3HKZ G;  3CCR A;  5C44 B;  3HOZ H;  2JA7 G;  2CW0 C;  5HUR A;  4A3I B;  4WOR A;  1L1O B;  4L5R C;  2RDH A;  4A3D G;  1J6Q A;  3T1Y Q;  3ND8 A;  2JN4 A;  3LWU A;  1XX8 A;  1JE5 A;  2X6G A;  1VS0 A;  1YNN D;  1AN8 A;  3O13 A;  3BDO A;  3KLW A;  2CHB D;  1S4Z A;  4A93 B;  5K36 G;  5LMN L;  1HQR D;  4ZK9 B;  3DMU A;  4UPA A;  1PH5 A;  1IL2 A;  1A63 A;  2AHO B;  3RNU A;  4A3G H;  1Q8K A;  1XPR A;  1AH9 A;  1JT8 A;  1Y8N B;  4LF9 Q;  4N8F A;  4B3T L;  1XNQ L;  1SE4 A;  1EEI D;  3S1M B;  2R93 G;  3A0J A;  2P5Z X;  1PYW D;  1BO0 A;  2BDO A;  3CHB D;  4GN3 B;  3Q8D A;  4TVA B;  5KND A;  5I2X A;  2FIN B;  2UUC L;  4JI7 L;  1KL9 A;  3PGZ A;  3T16 A;  4A3J B;  4DNT B;  4B08 A;  4HID A;  3OPO A;  5M9O A;  3LWE A;  4OIJ A;  1SXT A;  4P2C B;  3A8K E;  3MXU A;  1R9T B;  3GD7 A;  2MHV A;  2F0E A;  5LMU L;  4JCV E;  2H5X A;  2MO0 A;  2HCI A;  2K6A A;  3CC2 A;  1D5X C;  3QR8 A;  3OSO A;  4JW0 A;  2LY7 A;  4YHH Q;  2A69 D;  1WTH A;  1GKH A;  3I70 A;  2WB1 B;  1OXX K;  4JYA L;  2F03 A;  4IPC A;  5H1S E;  3A55 A;  4JI2 Q;  1HZA A;  5I4D A;  3OW7 A;  1OO9 B;  2F0W A;  3MXN B;  1LAC A;  1EIH A;  1UE1 A;  1TWF B;  4R8N A;  4DUZ Q;  1I6H H;  2B2V C;  1Q46 A;  4LFA L;  3JAM E;  2MUY A;  3MC0 B;  1RKN A;  2NVT H;  2HQL A;  3OIQ A;  1ICF B;  1PH1 A;  1YI2 A;  1YNX A;  2B2V A;  3T1H Q;  4KLK A;  1A2T A;  3HFZ B;  3Q22 A;  4JI4 L;  3K7A H;  3T56 B;  3HOV H;  1KXL A;  2JA6 G;  1U4P A;  3H0G H;  4H13 C;  1CKN A;  5IYC G;  3CCM A;  3CME A;  3NTI A;  4IN3 A;  3SEB A;  5EQ0 A;  4R4C A;  1SNM A;  3CQZ H;  3BJU A;  3SHL A;  3NBH B;  2EZV A;  1B70 B;  1FJG Q;  4KHP Q;  1B3A A;  4LFB L;  3ULJ A;  2UXD Q;  1UE5 A;  1NY4 A;  3ZYY X;  4GN4 B;  4IUU A;  1SE3 A;  4TKO B;  4BBS G;  3BZC A;  4JI0 L;  1VQD A;  3D4W A;  1L1O A;  3BS1 A;  3I8Z A;  1HQM C;  4C2M H;  4JG2 A;  1E1O A;  4RG1 A;  2Z0S A;  4N8X 1;  4NW2 A;  3KJP A;  4UY8 C;  1FNV A;  1K3R A;  1TS3 A;  2VUM H;  4LAA A;  3RZO B;  1CSQ A;  1LYL A;  1BXT A;  2DNC A;  3L7Z C;  1MKH A;  2B2W A;  1E24 A;  2LFN A;  3MFY A;  3J81 E;  2PCF B;  1O78 A;  2UXC L;  2KEE A;  2OWO A;  5IT9 L;  3KUP A;  3I4M G;  1STG A;  1QZG A;  2Q2I A;  2WAQ E;  4FF3 A;  1G51 A;  2K28 A;  4BS9 A;  1JB7 A;  1STA A;  5C4Z A;  2IT1 A;  2Z4H A;  3TP7 A;  2L0C A;  4LFC Q;  2KA7 A;  5EAY A;  4QUC A;  3MXP A;  1BCP B;  2B2T C;  2K5N A;  2A68 D;  2KCC A;  1UE7 A;  4NDX A;  3Q24 A;  3JAM i;  5EBC A;  1X3P A;  1AZQ A;  2O5J C;  1EYA A;  2A19 A;  2KEN A;  2Q8R E;  4JV5 L;  2K5H A;  3K6O A;  4E6I A;  4BY7 G;  4HSV A;  4OON A;  3J81 c;  2A6H C;  2ZXP A;  3BZD B;  4LF4 Q;  3DLL A;  3FRP B;  1TWA B;  2IL8 A;  5CV9 A;  4WJW A;  1I3Q H;  3GTG H;  4YWL A;  1SND A;  1YJN A;  1HTL D;  1VQE A;  1ENC A;  3S1R H;  1X54 A;  5C4J B;  1NE3 A;  3SK4 A;  3HOU G;  3W5O A;  3PQI A;  1GXD C;  1U0L A;  1VQL A;  5JEA J;  4A3K G;  3JC6 6;  3SDZ A;  1DOM A;  1HNX Q;  1PH7 A;  3S1Q B;  1LT3 D;  1LAB A;  1KLU D;  2YTV A;  1LT4 D;  4BWG B;  4IUV A;  2VZA A;  4EQO A;  1D1I A;  2JA8 G;  1ESR A;  3J7A 5;  1D5Z C;  1JJC B;  1JC7 A;  2BA0 A;  4NPS A;  3HOX G;  1XPO A;  3CD6 A;  1W3S A;  1GUO A;  1HZ9 A;  2ENB A;  2IHE A;  1OXV A;  1IBK L;  3HOW H;  4GKJ Q;  3PCO B;  4A3C H;  4AQY Q;  5IGD A;  4JPB W;  2EQS A;  4DV1 L;  1CSP A;  3HZX A;  2MNA A;  3M3Y H;  1NSN S;  4A3B G;  3PV0 A;  1CZG A;  2EJF C;  3A7A B;  4ZUJ A;  3RN5 A;  3MXG A;  3TME A;  4GNX B;  1SSO A;  5E1F A;  1ASY A;  2MP1 A;  2XTI A;  4LWC A;  3V96 A;  3RR5 A;  2Z9H A;  5C3E B;  2EY5 A;  3VYT A;  1QZH A;  4GOP B;  3VR3 A;  1FNW A;  4DV0 Q;  1SNP A;  1JIC A;  2EOT A;  5BR8 L;  1M4V A;  3HEJ A;  3M9B A;  4YWM A;  4DR7 L;  4XQJ A;  5DM7 3;  2UUB L;  3H3V C;  3CF5 A;  4RGT A;  1PLF A;  1Q7Y C;  2EDG A;  4L8J A;  2A8V A;  1G8Z D;  4UP7 A;  1O80 A;  2YTX A;  2NVY H;  1VMC A;  5C44 H;  3I3C A;  1BCP C;  1Y8O B;  1JQY D;  3TZU A;  1VQP A;  4B3R Q;  3CRK C;  1HFN A;  2RCN A;  4OWX B;  1LTG D;  5JPM C;  4DNI A;  5M5W B;  1LUZ A;  3T1Y L;  2M9V A;  5FLX E;  3FVQ A;  4XQN A;  2PQA B;  2Y0S G;  3DEO A;  3S2H B;  4K5W A;  2GVB A;  5KNB A;  2D5D A;  3VA5 A;  1V9P A;  1TWC B;  4CDD C;  4F7X A;  2PQE A;  2I46 A;  4KKT A;  4DA2 A;  5IYD H;  1QE6 A;  3FPP A;  4R4O A;  3BYY B;  3PIP 3;  3W2D A;  4LF9 L;  3I90 A;  3S1M H;  1RF2 D;  1W6K A;  5CGK A;  2K4K A;  1WCM B;  4DV6 Q;  4DAY B;  5JPN C;  5M3M B;  3K7U C;  5ELF A;  1PTO B;  1TU2 B;  1CUK A;  1OXU A;  3N52 A;  4PZ8 A;  1AEX A;  4A3J H;  1J9O A;  2F0S A;  5FLX c;  3BG3 A;  5FOB B;  3CCJ A;  1R9T H;  2L4N A;  1B3Q A;  1D2B A;  2OQ0 A;  1IKM A;  3A5Z B;  3K8A A;  4POF A;  3VR6 A;  1EY7 A;  4DAV A;  4L5S A;  1YHQ A;  2OEO A;  3OMC A;  2SNM A;  1L0Y B;  3URY A;  2XVS A;  2L55 A;  4PZ6 A;  1IYU A;  1Q81 C;  3KF6 B;  2B2U C;  2C5C A;  4RHS A;  3OWF A;  3VA7 A;  2EXD A;  4YHH L;  4A4I A;  2X69 A;  5A2Q L;  2R7Z G;  3CCQ A;  4LF8 Q;  2XSC A;  3NHH A;  3G71 A;  4GNX C;  1BBX C;  1C7Y A;  1K0S A;  4DU9 A;  1H9S A;  1HJP A;  3VYS A;  2ATW A;  2WII B;  4EX5 A;  4JI2 L;  3I73 A;  4OL7 A;  4BA2 I;  1TWF H;  1A2U A;  3OIP A;  1DJR D;  1YBY A;  4DUZ L;  2K50 A;  1SYG A;  1QB5 D;  4IPD A;  2JK8 A;  2WAQ G;  1JOK A;  3R8B A;  2O4X A;  5J3B A;  5IGE A;  3NQI A;  3QO2 A;  5I9P A;  3NWT A;  1JMC A;  2UUA Q;  2KHJ A;  4PMC A;  5EJW A;  4GOP A;  1Q12 A;  3T1H L;  3AU7 A;  3CPW A;  3NTK A;  2Z1C A;  2EIF A;  1YNJ D;  3B6Y A;  1EU4 A;  2OCE A;  3A8J E;  1LT5 D;  2VQE Q;  1EFI D;  4OEM B;  4B3S Q;  2F3W A;  2PYK A;  1UE6 A;  5DEH A;  1II3 A;  4JI5 Q;  4OWW B;  1WFQ A;  4A3G G;  4PG3 A;  2ZXO A;  1GUT A;  2B8F A;  4R8I A;  1GO3 E;  2Q8T A;  3GTK B;  1FJG L;  2K01 A;  4KHP L;  2R61 A;  2UXD L;  1TII D;  2F0L A;  4IUN A;  3OOC A;  2F0J A;  4IUT A;  2EVB A;  3VYU A;  2MPM A;  2NYZ D;  5CV7 A;  1JOO A;  4N9P A;  3SE0 A;  3C46 A;  3KLS X;  4DR4 Q;  4G4K A;  1XXG A;  2EY6 A;  2QDB A;  3DM1 A;  1GHK A;  1XTD A;  3PIO 3;  1SYB A;  5EBD A;  2F4V Q;  4C3J B;  2PQA A;  3RZO H;  3FHW A;  1FGB D;  2AKW B;  4IFD H;  1PTO C;  2EJG C;  1DYQ A;  5JJK A;  3A7L A;  3OYY A;  1V1O A;  1C48 A;  1VMP A;  3M4Y A;  4HJ9 A;  3U58 A;  2E2H H;  1VQA A;  4DGZ A;  3H3V H;  4AYB G;  1XPU A;  3KBG A;  3K59 A;  4JI3 Q;  4LUZ A;  4I7A A;  1ROD A; 
#chains in the Genus database with same CATH homology
 4DAY A;  1NCV A;  1G29 1;  4C3I B;  4TSS A;  3GTQ B;  1JE4 A;  4M8A A;  3FMC A;  3BDL A;  1H9M A;  1MD2 D;  1PMR A;  1Z7T A;  4DFA A;  1VF5 C;  5D3I B;  4EGV A;  1UNS A;  2BE5 C;  3NP8 A;  4QMG A;  4RGN A;  2NB0 A;  1S5C D;  3PUV A;  2KHS A;  4CGY B;  3HKZ B;  4CBV A;  1DON A;  2H4O A;  3QOJ A;  4KKU A;  1ML0 D;  2ID0 A;  2PO4 A;  3T53 B;  4UAI A;  1RCV D;  1IHZ A;  1A6X A;  1ZKO A;  3IFD A;  4K8I A;  3CKI B;  2AUK A;  3IKJ A;  1ILP A;  4U68 A;  1FYC A;  5IOC A;  2XRS D;  1F2M A;  4XDX A;  3SK5 A;  1CT1 D;  3J7A F;  2B63 B;  2VXW A;  2AQ1 B;  1EY5 A;  1GUW A;  5HGT A;  5IT9 E;  2KCN A;  3RMH A;  1E2V A;  3KK7 A;  2SOB A;  1J8I A;  4OHJ A;  5I6W A;  1TWG B;  4IZ8 A;  3FPU B;  3A54 A;  3J7A V;  1CK1 A;  1B2T A;  1ZYR C;  5G3L F;  1O7Z A;  2R6G A;  3T51 B;  4RFB A;  1RTO A;  1V8Q A;  5EKL A;  5IGF A;  5I6Y A;  1BQQ T;  1IKL A;  3FKI B;  4KHV A;  2AQ2 B;  2RBM A;  4HCS A;  5DNF A;  2HQE A;  2D62 A;  2OXP A;  2FHT A;  2KUM A;  4KD3 A;  1S5F D;  1A3T A;  2EY1 A;  4K2K A;  2RQX A;  4OGQ C;  5J1Z A;  3MHB A;  2WV6 D;  3OMG A;  1QCB D;  1IYV A;  2K32 A;  2A5H A;  1DXM A;  4IFD I;  4OO1 H;  2JA6 B;  3GTL B;  2D9U A;  2Z8L A;  1FR3 A;  3GV3 A;  3MZ5 A;  4XIG S;  4QCL A;  2E2J B;  4IUP A;  1WTQ A;  1F9P A;  1RDP D;  1A3V A;  2NN6 G;  4MN3 A;  1NUC A;  2RSO A;  5D65 A;  3VR4 A;  1KDC A;  3Q0A A;  4HTH A;  4RHR A;  3HS0 C;  1KLG D;  4BBS B;  2QIL A;  1Z6H A;  3A8I E;  3QJY A;  4HN7 A;  1PTO H;  4H0L C;  1WTP A;  1WTV A;  1D1K A;  4CJ2 C;  4XYQ A;  3PO3 B;  3R2I A;  2KQ3 A;  1PFN A;  1WD0 A;  3D6W A;  3SK8 A;  3P75 A;  4RKB A;  3H6M A;  4RGM A;  1SAP A;  5E4X A;  2WIN B;  2KVM A;  1KAA A;  2R3Z A;  1AZP A;  3GTP B;  4QUF A;  3E5S A;  1HPC A;  1NAP A;  2PNR C;  2EYF A;  4XYO A;  4NP5 A;  3S17 B;  2O5I C;  3PUW A;  5C4X B;  1H9R A;  1DOK A;  1EU3 A;  1OXT A;  4KD4 A;  5JOB A;  2H1E A;  3WOE A;  1TS2 A;  4BY7 B;  1PRT F;  4A3E B;  3NK9 A;  2XIW A;  2CVR A;  2HDM A;  1U4R A;  2NWG A;  2JA5 B;  3MA2 B;  4QIW B;  5CR3 A;  4NKL A;  5G3L D;  4V0B A;  3E0J A;  5AFW A;  4ZRZ A;  5M5Y B;  3S15 B;  2N88 A;  4CKC A;  1G2S A;  5KIX A;  1QIL A;  5BN3 A;  2JEB I;  1FD7 D;  5DAU A;  1STY A;  2B2W C;  2F0I A;  4IQZ A;  4ILW A;  3L3O C;  3U9O A;  1B50 A;  3P20 A;  2NVX B;  1M8A A;  3RZD B;  4A3M B;  3LNN A;  4FVM A;  3PUY A;  1DOL A;  2BDN A;  3D4R A;  4FNF A;  4XT3 B;  4EVO A;  1X32 A;  4OO1 I;  5A2Q E;  1NR4 A;  2FMM A;  1YNN C;  3C1F A;  3G6J B;  4HMI A;  1AW7 A;  1MGS A;  2EYL A;  4C3H G;  4H44 C;  1I4X A;  3S2D B;  1U4L A;  1RD9 D;  4ULL A;  2MJ8 A;  2EJM A;  1ILQ A;  1STH A;  4Y7N B;  1STN A;  2FFK B;  2E76 C;  3GTO B;  2A73 B;  2F0N A;  1LTT D;  5CV4 A;  3MAQ A;  1B9M A;  5LL6 S;  4LMQ D;  4KJN A;  4DK0 A;  2TMP A;  3NTH A;  4ZUI A;  4ZLT F;  1RJT A;  5T1I A;  3S1N B;  3H94 A;  3U9S A;  1V1P B;  3R3O A;  1KAB A;  4I7Z C;  5FO8 B;  2L1B A;  2PPB C;  1TY0 A;  3D6C A;  4BA1 I;  2A69 C;  3NUC A;  4FXK C;  1GUS A;  4K5V A;  5J39 A;  3H09 A;  3S14 B;  1PXU A;  4U67 3;  2RVL A;  1SMY D;  5D3D A;  1LO5 D;  4KMU C;  2NUC A;  2DY7 A;  1H9S B;  5KYI A;  4DNR B;  4KN4 C;  1KTK A;  4F88 A;  4X3S A;  3N6R A;  4BBR B;  4TQU S;  1EZ8 A;  2VB3 X;  2F1M A;  5BN5 A;  3KBX A;  4I65 A;  5TSS A;  2HCC A;  3GTM B;  1GHJ A;  4XXE A;  1G6Z A;  4IFD G;  4MHE A;  1JR0 D;  5IGG A;  2RKS A;  4PMB A;  1CI3 M;  4A3F B;  5C0X H;  1F2Y A;  4ZAI A;  1B9N A;  1HUM A;  2F4I A;  1DM0 B;  1I50 B;  2ZT9 C;  3TSS A;  1V43 A;  3Q23 A;  2K5Q A;  2PW7 A;  2F0Q A;  5ELD A;  5FKA C;  3R2T A;  5CC4 A;  1EQT A;  4V19 0;  1TWH B;  1U4M A;  2LMC B;  3TP6 A;  4RWS C;  1LTB D;  2NTT A;  1GJX A;  2B39 A;  3VYR A;  1STE A;  5ELC A;  4LK1 C;  3TN2 A;  4DN4 M;  2SNS A;  2DNE A;  3K5O A;  2FJ2 A;  1V1P A;  2A68 C;  5C3X A;  1I4Q A;  2KOL A;  2KED A;  1QNK A;  4KY6 A;  3NWS A;  1Q1E A;  4X3K A;  4J6H A;  2A74 C;  1SNC A;  2JEA I;  3CU7 A;  4DXF A;  4G7H C;  1WTX A;  3S9W A;  3PO2 B;  2YU9 B;  3DWA A;  3K5L A;  1GUG A;  4G7O C;  3G7L A;  4MIU A;  4Z9C B;  2PZT A;  2LS0 1;  1ENF A;  3RUZ A;  3HOY B;  2AUJ D;  2B8G A;  4BY1 B;  1TY2 A;  1DCZ A;  1QNU A;  1XTC D;  2A6E D;  1BR9 A;  5NUC A;  1CTM A;  3Q6S A;  2QCP X;  4H7B A;  4KKS A;  2B2Y A;  1GUN A;  1I4P A;  2R92 B;  1EL0 A;  1OXS C;  1IW7 D;  3VR5 A;  3K0Y A;  2F0K A;  2Q8I B;  3GV6 A;  4KV6 A;  3I72 A;  3PUX A;  3K7A B;  1Q90 A;  1B4O A;  5JJZ A;  1EYC A;  4OO1 G;  2X6L A;  1KNA A;  2EPB A;  1PZK D;  4CKE A;  2OF1 A;  1ONL A;  2C9O A;  2WKD A;  5C0X I;  2F0O A;  1SNO A;  3GO5 A;  4HR7 B;  2SDF A;  3TZD A;  3EJI A;  2IX3 A;  2CW0 D;  3M85 A;  2EYM A;  4JBW A;  2RA4 A;  4R9W A;  1BNZ A;  4EQN A;  3PUZ A;  3WOF A;  2XN9 C;  5JVG 3;  5I2Y A;  4HMJ A;  2MGS A;  4XTC S;  3IL8 A;  5M3F B;  2F0P A;  1S5E D;  4FO2 A;  2V4D A;  1D5M C;  3GP7 A;  4FYD A;  1EOT A;  1TR5 A;  3M7G A;  2KEC A;  4FF2 A;  1IL8 A;  4G57 A;  4PQX A;  3R93 A;  3GTJ B;  4K5X A;  4KTA A;  1CA5 A;  2PZU A;  2JA7 B;  1SBB B;  3SVM A;  1TS5 A;  4IFD J;  3MFG A;  4K6L A;  4A3D B;  4QB4 A;  3DXJ C;  3J7Y W;  3M4O B;  2RDG A;  3NQT A;  1Y1V B;  3F2U A;  3L9A X;  5EKK A;  3V2T A;  3EVQ A;  1EZ6 A;  5COR A;  2AWO A;  1Z47 A;  5CV6 A;  1F9S A;  5E3F A;  3GQB A;  2PZW A;  3T13 A;  3S16 B;  3HGB A;  2F0F A;  2R93 B;  1DD2 A;  1EQV A;  3EFX D;  1U9R A;  2JE6 I;  2IJ0 A;  4ZKB B;  4RAU C;  5ELE A;  3UI2 A;  2EXZ A;  1SFO B;  1I4R A;  1R4Q B;  3PMF A;  1TS4 A;  1B44 D;  3NPP A;  2K5W A;  2FMC A;  4O42 A;  2A6E C;  2DY8 A;  1K83 B;  1SYD A;  4OIK A;  1TVX A;  3HP3 A;  3J80 L;  2IX0 A;  3SK6 A;  1EWH A;  4C3J G;  3K5M A;  5J22 A;  1YNJ C;  1D6E C;  4ZKC B;  2M00 A;  2NBF A;  4HCE A;  3H91 A;  1ENA A;  1BF4 A;  4C3I G;  1Y69 U;  1S5D D;  1HCZ A;  4ZYS A;  2XWB B;  4TRD A;  1JWM D;  2D2C C;  1BCP F;  2EE1 A;  1EEF D;  3D8G A;  2KJX A;  1Q3L A;  1FNU A;  3I4N B;  1NR2 A;  3BYT B;  1E2Z A;  1HHV A;  1BOS A;  3OWE B;  1LLR D;  2SEB D;  2VNU D;  3NXW A;  4PNY A;  2N55 A;  1A15 A;  2WKC A;  3RLF A;  5EGT A;  1EYD A;  1PFB A;  2E74 C;  4M1U B;  3NE5 B;  1AP0 A;  5D14 A;  2A6H D;  1T5X D;  4XT1 B;  3HRZ C;  1B53 A;  1RTN A;  2F0H A;  3KF8 A;  3V05 A;  2PMZ B;  2EY2 A;  1CHP D;  2BOS A;  4ME5 A;  5CV5 A;  1JOR A;  4O1N A;  3I4M B;  5C5L A;  4DAP A;  1BUV T;  4C3H B;  1WVL A;  4RCN A;  4J1M A;  1CFM A;  4HSP A;  3SR1 A;  3QB3 A;  1JB3 A;  3X3M A;  1HXY D;  4KHZ A;  4FP5 D;  3LX0 A;  3DWP A;  5C0X G;  1F2Z A;  2QF7 A;  2K05 A;  4KN7 C;  1CZW A;  2EYO A;  4JK1 C;  1SDF A;  1LTI D;  4IAL A;  2JP1 A;  5FO9 B;  5KGU A;  1SE2 A;  5BN4 A;  1RHP A;  5ISR A;  1QG7 A;  3HOU B;  2L9H A;  2HDL A;  1H9J A;  2J0T D;  4A3K B;  2TSS A;  2F0M A;  1Y8P B;  3P1H A;  2K1B A;  1ZEQ X;  3HG9 A;  4DXG A;  2JA8 B;  4CKB A;  5CBA E;  3HOX B;  3W3A A;  4S3S A;  1SNQ A;  2OT2 A;  4HAE A;  3I4L A;  1WTR A;  2F0G A;  4FXG C;  1Y1W B;  4PMW A;  5M5X B;  4A3B B;  3DUZ A;  1K8M A;  1BCP D;  2NVQ B;  5C4H A;  1K8O A;  1SYC A;  3QG1 A;  1PTO F;  3OHX C;  1R4P B;  5ELB A;  5DM6 3;  3BVM A;  3E6Z X;  1I4G A;  3C1E A;  4F8M A;  3RD4 A;  1PFM A;  5F2D A;  2E2H B;  1CHQ D;  2DN8 A;  2WP8 J;  1A3U A;  1QWY A;  1SYF A;  3TDQ A;  5IOD A;  2ZXR A;  3TP8 A;  1JWU D;  1G2T A;  5JEA H;  2F3V A;  3FDT A;  1TT2 A;  5EKI A;  5JVH 3;  3K57 A;  1CQF A;  3KLR A;  3MVV A;  4WFN 3;  4QF4 A;  3D3R A;  3ITP A;  1GOZ A;  5COY A;  3P7J A;  2NTS A;  2B2T A;  2QEJ C;  2K7V A;  5K36 H;  5T1G A;  5KRU A;  3IAY A;  2JXM B;  2Y0S B;  2ICE C;  5C3W A;  2IX1 A;  3D31 A;  4ZQ3 A;  2E2I B;  3KLS A;  3ND9 A;  4KK7 A;  1WD1 A;  3MXN A;  1CQV A;  4FF1 A;  2NN6 H;  2YYZ A;  4NMZ A;  5JAV A;  2G9H D;  1MI2 A;  3IFT A;  5KNC A;  1PRT D;  5CV8 A;  3X3N A;  2E2D C;  5A35 A;  4Q5V A;  2J4X A;  4FF4 A;  2BA1 A;  1XWE A;  1MSG A;  1LTA D;  3ERQ A;  1KDA A;  1EY8 A;  5EPK A;  1X3Q A;  1VCI A;  2F0D A;  1C8C A;  1EIG A;  1TQO A;  1T5E A;  3K58 A;  2R7Z B;  1H9K A;  1L0X B;  3NBH A;  4ODG A;  1Q8I A;  5C6A A;  1PRT B;  5E4W C;  2L11 A;  1O7Y A;  2WAQ B;  3SXH A;  3BDC A;  1UUP A;  3HOZ B;  5CYU A;  5EPJ A;  1HUN A;  1MSH A;  4L63 B;  1UEA B;  2WAC A;  4Q0F A;  1F9R A;  1ZXT A;  1W6J A;  3JAM L;  1KNE A;  1PTO D;  5KYL A;  5EPL A;  3WDN A;  1VF7 A;  2F0T A;  5C0X J;  2GA4 B;  2K04 A;  4HED A;  1PZJ D;  4J8Q A;  4A3G B;  1EY6 A;  3D4D A;  3T4A C;  3BVZ A;  4XQQ A;  4CHT B;  4KY7 A;  2F0V A;  2BE5 D;  2VB2 X;  4YIJ A;  3J80 E;  1WTO A;  3CRL C;  2RDF A;  3MWY W;  1O7L A;  3C2P A;  1EY0 A;  3NSW A;  4DF7 A;  5IGC A;  2ICI A;  5FK9 C;  5KEE A;  1CM9 A;  3C3L A;  4AYB B;  3DEP A;  1F9Q A;  1JOQ A;  5K5P A;  2B2Y C;  4DK1 A;  3A56 A;  4C1N I;  2NN6 I;  3ONA B;  2K5D A;  3J81 L;  1JWS D;  4K14 A;  1I6H B;  1SMY C;  4IUR A;  2XNA C;  4KY5 A;  2B2U A;  1HTP A;  2K33 A;  2LKV A;  4K2L A;  1LTS D;  2NVT B;  1JCK B;  3DHQ A;  4K6D A;  1E2W A;  3AMU A;  1BDO A;  4C56 C;  4G7Z C;  5IGB A;  1PRT C;  3EA6 A;  2PW5 A;  1ZYR D;  3HOV B;  1SEB D;  1I6V C;  3H0G B;  4L6T B;  1EY4 A;  3CQZ B;  3QWN A;  4RGO S;  4KI0 A;  4X3U A;  4CJ1 B;  2L12 A;  5CBE E;  4RH6 A;  1QOH A;  2XWJ B;  2IWH A;  4C2M B;  5IIF A;  2RSN A;  3NBI A;  2F0U A;  2VUM B;  1PDQ A;  2EYH A;  5LHY 1;  2I07 B;  4PV1 C;  3BVG A;  1F2L A;  4RKL A;  2HUG A;  5I9O A;  2NZ1 D;  1G91 A;  4ABN A;  1HA6 A;  2QKI C;  3DWQ A;  4ID6 A;  1UAP A;  1B1Z A;  2EYJ A;  3EQL C;  1EWC A;  1I4H A;  3QIA A;  1WTW A;  1E0B A;  5C5M A;  3AB9 A;  1SYE A;  1STB A;  2G9D A;  3MEH A;  3I91 A;  1ET6 A;  1MBY A;  4N9T A;  1Q1B A;  4F87 A;  4KJO A;  2JYO A;  4CJ0 B;  1ET9 A;  1DZ1 A;  1EY9 A;  1I3Q B;  3GTG B;  1LT6 D;  2O2L D;  3S1R B;  4GZY C;  1TKW B;  2JSO A;  3FEW X;  4RA8 A;  4LJZ C;  5FO7 B;  3MTS A;  2E75 C;  4WRD A;  2CQA A;  3VR2 A;  2L5T A;  5FLX L;  3ERO A;  4B9X A;  3HOW B;  1HFG A;  1XYI A;  1SJH D;  3M3Y B;  1KDB A;  4EQP A;  5LL6 X;  4FXD A;  3TP5 A;  1IW7 C;  2M2L A;  1QJO A;  2AQ3 B;  2XRQ D;  1C4Q A;  4RCO A;  2K03 A;  2IW3 A;  2Z4I A;  1LTR D;  1LV9 A;  2EYP A;  1F77 A;  1PZI D;  3K5N A;  4C1N K;  4UDU C;  4X3T A;  1HA5 A;  2IPK D;  1CA6 A;  4K8J A;  3TBI B;  1ICW A;  5CMD A;  1HRJ A;  1AFP A;  4IUQ A;  3QOL A;  3M7N A;  4B9W A;  2J7Z A;  2AWN A;  5JEA G;  1S5B D;  1ESF A;  1VDZ A;  2NVY B;  1SJE D;  2BCO A;  5C44 B;  2CW0 C;  5HUR A;  4A3I B;  4WOR A;  2RDH A;  3ND8 A;  1XX8 A;  2X6G A;  3LWU A;  1YNN D;  1AN8 A;  3O13 A;  3BDO A;  5K36 G;  2CHB D;  1S4Z A;  4A93 B;  1HQR D;  4ZK9 B;  3DMU A;  1Y8N B;  1SE4 A;  1EEI D;  3S1M B;  1PYW D;  1BO0 A;  2BDO A;  3CHB D;  5KND A;  5I2X A;  2FIN B;  4A3J B;  3T16 A;  4DNT B;  4B08 A;  3OPO A;  5M9O A;  3LWE A;  4OIJ A;  1SXT A;  4P2C B;  3A8K E;  3MXU A;  1R9T B;  3GD7 A;  2MHV A;  2F0E A;  2HCI A;  2K6A A;  1D5X C;  3OSO A;  2LY7 A;  2A69 D;  3I70 A;  2WB1 B;  1OXX K;  2F03 A;  3A55 A;  5I4D A;  3OW7 A;  1OO9 B;  2F0W A;  1LAC A;  1EIH A;  1TWF B;  4R8N A;  2B2V C;  3JAM E;  2MUY A;  3MC0 B;  1RKN A;  3OIQ A;  2B2V A;  1A2T A;  3Q22 A;  3T56 B;  1U4P A;  4H13 C;  3NTI A;  4IN3 A;  3SEB A;  5EQ0 A;  1SNM A;  3SHL A;  2EZV A;  1B3A A;  3ZYY X;  4IUU A;  1SE3 A;  4TKO B;  3D4W A;  3BS1 A;  3I8Z A;  1HQM C;  4NW2 A;  1FNV A;  1TS3 A;  4LAA A;  3RZO B;  1BXT A;  2DNC A;  3L7Z C;  2B2W A;  2LFN A;  3MFY A;  3J81 E;  2PCF B;  1O78 A;  2KEE A;  5IT9 L;  3KUP A;  1STG A;  4FF3 A;  2K28 A;  4BS9 A;  1STA A;  5C4Z A;  2IT1 A;  2Z4H A;  3TP7 A;  2L0C A;  2KA7 A;  4QUC A;  3MXP A;  1BCP B;  2B2T C;  2A68 D;  2KCC A;  4NDX A;  3Q24 A;  5EBC A;  1X3P A;  1AZQ A;  2O5J C;  1EYA A;  2Q8R E;  3K6O A;  4E6I A;  4HSV A;  2A6H C;  2ZXP A;  3BZD B;  3FRP B;  1TWA B;  2IL8 A;  5CV9 A;  4WJW A;  1SND A;  1HTL D;  1ENC A;  5C4J B;  3SK4 A;  1GXD C;  5JEA J;  3SDZ A;  1DOM A;  3S1Q B;  1LT3 D;  1LAB A;  1KLU D;  1LT4 D;  4BWG B;  4IUV A;  4EQO A;  1D1I A;  1ESR A;  1D5Z C;  1JC7 A;  2BA0 A;  1GUO A;  2ENB A;  1OXV A;  5IGD A;  3HZX A;  1NSN S;  3PV0 A;  1CZG A;  2EJF C;  3A7A B;  4ZUJ A;  3MXG A;  3TME A;  1SSO A;  5E1F A;  2MP1 A;  3V96 A;  5C3E B;  2EY5 A;  3VYT A;  3VR3 A;  1FNW A;  1SNP A;  1JIC A;  2EOT A;  1M4V A;  3HEJ A;  4XQJ A;  5DM7 3;  3H3V C;  4RGT A;  1PLF A;  2EDG A;  4L8J A;  1G8Z D;  1O80 A;  1VMC A;  3I3C A;  1BCP C;  1Y8O B;  1JQY D;  3TZU A;  3CRK C;  1HFN A;  1LTG D;  5JPM C;  5M5W B;  2M9V A;  5FLX E;  3FVQ A;  4XQN A;  3S2H B;  3DEO A;  4K5W A;  5KNB A;  2D5D A;  3VA5 A;  1TWC B;  4F7X A;  2PQE A;  2I46 A;  4KKT A;  4DA2 A;  1QE6 A;  3FPP A;  3BYY B;  3PIP 3;  3W2D A;  3I90 A;  1RF2 D;  1W6K A;  5CGK A;  1WCM B;  5M3M B;  5JPN C;  5ELF A;  1PTO B;  1TU2 B;  1OXU A;  3N52 A;  1AEX A;  1J9O A;  2F0S A;  3BG3 A;  5FOB B;  2L4N A;  1D2B A;  1IKM A;  3VR6 A;  1EY7 A;  4DAV A;  2OEO A;  3OMC A;  2SNM A;  1L0Y B;  3URY A;  2XVS A;  2L55 A;  1IYU A;  2B2U C;  2C5C A;  4RHS A;  3OWF A;  3VA7 A;  2X69 A;  5A2Q L;  2XSC A;  3NHH A;  1BBX C;  4DU9 A;  1H9S A;  3VYS A;  2WII B;  3I73 A;  4OL7 A;  4BA2 I;  3OIP A;  1A2U A;  1DJR D;  1SYG A;  1QB5 D;  1JOK A;  3R8B A;  2O4X A;  5IGE A;  3NQI A;  3QO2 A;  5I9P A;  3NWT A;  4PMC A;  5EJW A;  1Q12 A;  3AU7 A;  3NTK A;  2Z1C A;  1YNJ D;  1EU4 A;  3A8J E;  1LT5 D;  1EFI D;  2F3W A;  2PYK A;  5DEH A;  1II3 A;  2ZXO A;  1GUT A;  2B8F A;  4R8I A;  2Q8T A;  3GTK B;  2K01 A;  2R61 A;  1TII D;  2F0L A;  4IUN A;  3OOC A;  2F0J A;  4IUT A;  2EVB A;  3VYU A;  2MPM A;  2NYZ D;  5CV7 A;  1JOO A;  4N9P A;  3SE0 A;  3C46 A;  3KLS X;  4G4K A;  1XXG A;  2EY6 A;  2QDB A;  3DM1 A;  1GHK A;  3PIO 3;  1SYB A;  5EBD A;  4C3J B;  1FGB D;  4IFD H;  1PTO C;  2EJG C;  1DYQ A;  3A7L A;  1V1O A;  1C48 A;  3M4Y A;  1VMP A;  4DGZ A;  3KBG A;  3K59 A;  1ROD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...