4ULLA

Solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA-LIKE TOXIN I SUBUNIT B
publication title Solution structure of the carbohydrate-binding B-subunit homopentamer of verotoxin VT-1 from E. coli.
pubmed doi rcsb
molecule tags Toxin
total genus 14
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1996-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ullA00
1C48A 1R4PB 1CZWA 4ULLA 3MXGA 2C5CA 4M1UB 1BOSA 1DM0B 1D1KA 1CQFA 4P2CB 1C4QA 1R4QB 2BOSA 1QOHA 2XSCA 2GA4B 1QNUA 1D1IA 1CZGA
chains in the Genus database with same CATH superfamily
4C3IB 1K3RA 2CW0D 2K28A 3JC66 4RWSC 3MXNB 3TZUA 1QZGA 3DXJC 1ILQA 1ET9A 3VDYA 1PTOH 3PIP3 2PO4A 4LF6L 4LAAA 1A3VA 2A73B 1VMPA 2AQ3B 1IBLL 5D14A 2QKIC 1Y1WH 1Y1VG 1ESFA 2ASBA 1HPCA 4JV5L 2B2WA 4DGZA 2E8GA 4QL5A 1BBXC 1X3PA 1X6OA 1EYGA 5JPNC 4FF4A 4DR6Q 4HMIA 1Y1WG 3HKZB 2ZXPA 4FXKC 1F2LA 4RGOS 1NMFA 3CF5A 5A2QL 1GM5A 1CQFA 5E4WC 4K2KA 4HIMA 4WJ4A 4J15A 3OIQA 3J80c 1U4PA 3GTKB 4JVZA 3OHXC 3I56A 1AZQA 1N32L 2KCNA 2KCCA 1SYDA 2F0HA 3NHHA 1PH7A 1UE6A 2E74C 3NWSA 5IY0A 3HOXH 2OTJA 3A8KE 3FMCA 4TQUS 1WVLA 3QB3A 2MQHA 1VQ4A 1RIPA 4KN4C 2G9HD 3E0EA 5C4JB 4DNTB 1F2YA 4KKSA 2RVLA 4JK1C 4APVA 3DWPA 5D3DA 1EQVA 4WFN3 4BXXH 1YZ6A 5FLXE 3HOXG 2A8VA 3F2UA 2F0EA 3H15A 1VQ6A 3AYHB 1TKWB 2RHSB 1J9OA 3U58A 2PNHA 1FNUA 1WTXA 2CVRA 4LF8Q 3KBGA 1Q12A 3SDZA 4A93B 4BY7H 4K0KL 1KLUD 4POFA 1QG7A 5K36G 3HOWB 1G51A 5JAVA 4KJNA 2ICIA 4JI8L 1G2TA 2AKWB 4A3FH 1LTAD 1II3A 1VQ7A 2E5LL 3CCJA 4GNXA 4C3HH 3F2BA 5M5YH 1O78A 1PH5A 2O5JC 4DAMA 2AMCB 3OPOA 1LTGD 5L37A 3K5LA 4UPAA 1K83H 2EOTA 3MEHA 3ULJA 3PO2H 2F0TA 3MXPA 4A3FG 4IZ8A 5LMNQ 2ID0A 2AQ2B 4JI4Q 5C4XH 2MP1A 4FYDA 1E2ZA 1HA6A 1N36L 1SROA 3U4ZA 1JICA 2A68D 2MHVA 4RCOA 4UHVA 1PXUA 1ASYA 3PO2G 4A3MB 3UE0A 3U4VA 3TRZA 1VQCA 2F0JA 2IY5B 1KAWA 4JYAL 3G71A 4O1NA 2QEJC 3TP6A 1S5CD 5C4XG 4X3TA 3MXGA 3J7YW 2UXDQ 1BDOA 5E1FA 4RGTA 4DUZQ 3G6JB 5BN4A 3M3YH 5G3LF 2DUDA 1FR3A 2KECA 4JOIA 1ZKOA 2KJXA 4B08A 3CCMA 3SR1A 1YI2A 2DY8A 4HSVA 3M4OB 4GKJQ 5BR8Q 1HJPA 5CV4A 2B29A 1WTQA 2HQEA 4QUFA 4N9PA 3GDEA 1IW7C 1I6VC 4X3SA 1EIHA 3ERQA 5IGFA 3NQTA 4A3DG 1YBYA 3H94A 2EDGA 2LXJA 1Y8OB 2EJGC 5CC4A 3H3VC 3KK7A 4MTKA 1XX8A 1Y8NB 3M9BA 3SVMA 2B2YC 3EN2A 3Q22A 1D5MC 5I4DA 4RAUC 4C3JG 1TWAH 3S15H 4DV6L 3I4MG 2PQAA 1NJIC 2E75C 2Q2UA 3S24A 4OONA 1KABA 5DEHA 5IYDH 5EKIA 1ENAA 1MI2A 3CCQA 1WTRA 1DGSA 2VY3A 4DV3Q 2KA7A 1A62A 3FHWA 2D9UA 4EQ5A 3BDLA 4XDXA 4IFDJ 4JI5Q 2K05A 1EEID 5FOBB 2X6GA 4BBRB 4A3KH 4L5SA 1QUQA 4KTAA 1SDFA 3W5OA 5M5XB 3I72A 1NUCA 1F9QA 2Z4IA 3ND9A 1PMRA 1JWSD 2F0MA 4ZK9B 1Q46A 1DD2A 3K58A 3AU7A 1STGA 3K80C 4A3EH 3JAMc 4DF7A 1AEXA 4JI6Q 5GQOA 1X9NA 1EY9A 3H6MA 1KNEA 4YHHL 3HOZG 1S5DD 3L9AX 3T1HQ 2F03A 4A3KG 5E7NA 4EX5A 5DNFA 1EYAA 2JA5B 1CKNB 1EY4A 3R3OA 3MFYA 3IRBA 1SAPA 3I55A 1GHJA 2NZHA 2XGTA 4ZRZA 2F3WA 2VUMG 1E3PA 3RLFA 3VR2A 4DV4Q 1U9RA 3H3VH 3RUZA 1PTOF 2JEAI 1PDQA 3K5MA 4CJ1B 3SK5A 2EPBA 4KD4A 1RJTA 5FKAC 2B2TC 2GVBA 4DR1L 1PHJA 3T1YL 2PNRC 2N8NA 1FNVA 1YVCA 2CH4A 3LX0A 2F0NA 4RG1A 1PA6A 1JB3A 3PV0A 2XTIA 3S1NB 1TWGH 1U5KA 3MXNA 2XVSA 5HY6A 4XYOA 3QIAA 1ICFB 3B6YA 1PZID 3GTQB 1LUZA 2K52A 4PQXA 3STBD 2E2HB 4A3CH 4BY1B 3GTJH 1EIYB 1WCMH 4DV5Q 1IBKL 3NWTA 2J4XA 3WOEA 3CQZB 1PZJD 2LFNA 1NCVA 2XWJB 3K81C 2JA7H 2E2JB 3LWEA 1KDBA 4DR2Q 2GN5A 3SE0A 4CKEA 1SYCA 5I2XA 3GTMH 4A3CG 2VQEQ 5IGEA 5I6YA 3U9OA 4YCVA 3UI2A 1HNWQ 1WCMG 1C0AA 3BJUA 4ZAIA 1TT2A 1S40A 4HCSA 3A5UA 5EPKA 3WOFA 1KIXA 2R92H 1H9SA 3O13A 4RGMA 3CCSA 2K5HA 1JCKB 3G4SA 5IGGA 2M9VA 1C7YA 1XMQL 5M5WH 2B63H 1A6XA 3FKIB 3OTOQ 2NYZD 2BA1A 5BN5A 5IGDA 3NPPA 1JWUD 4JPBW 2OTLA 1R4PB 2A1AA 1HQMC 1Y14B 2A6ED 2L5TA 2ZXOA 4MZ9A 1Y69U 1STHA 1LTLA 2RF4A 1YNNC 1Q90A 1SJHD 1L0WA 3CPFA 4FF3A 5IYCH 3R93A 3OYYA 1HH2P 3KUPA 2R93B 4JG2A 4LNQA 2NVTB 2E2DC 4NB3A 4QIWB 1WFQA 5EPJA 1SYFA 2MJ8A 2YU9H 3C3LA 5DM73 1Q82C 5C3EB 4K5XA 1KDCA 5CORA 4A3GH 2K01A 4RFBA 1VMCA 4GLAC 1WD0A 3MXUA 1D5ZC 1OTCA 5KNCA 1F77A 2UUAL 2N49A 5CYUA 3IFTA 1LTBD 1TVXA 3TS0A 4OEMB 5EAYA 4IFDI 2HUGA 4QY7A 1SE3A 1SFOH 3KJPA 4A3GG 4DV0L 2J7ZA 3F8TA 5D65A 2JA6H 2RDFA 4P75A 1IBMQ 5A2QE 5HGQA 5I6WA 4HJ8A 3CU7A 3I8ZA 3S1RH 1XPUA 3I4LA 4OWXB 3KFUA 1X3FA 4TVAB 2PZWA 1UWVA 1U0LA 2WINB 2HIVA 2D62A 5EGTA 2E2IB 4LFBQ 2WACA 1F2ZA 4B3SL 2JA6G 2ZTCA 2PW7A 1LM0A 3E9HA 5JOBA 2G9DA 3I4NH 3PIOA 4J1MA 4M8AA 4GNXB 1QZHA 1B9MA 4LF7Q 1WD1A 3DWAA 3E9IA 1WTHA 4LFCL 1MKHA 1A2TA 2ZJPA 1X54A 4DR7L 2UXCQ 3HS0C 1J8IA 3PIPA 1V1OA 5DAUA 2F0WA 4F88A 5IWAL 3MC0B 1FL0A 4JI7L 5G3LD 4LUVA 1TWFH 3I91A 5EPLA 3K7AH 3J7ZC 3CCVA 4NXMQ 4IPCA 1GD7A 3RN5A 3QG1A 5EBDA 4YWLA 2MUYA 3CCUA 4Q0FA 1UEAB 4DR5Q 4A3MG 4RGNA 3NSWA 1Z47A 2OXPA 3K5OA 2IX3A 3UDIA 4IPDA 1DOMA 1I4PA 4EGVA 2QDBA 4OWWB 1LTRD 4X66L 5EKLA 4QIWE 4RKBA 4CKCA 1YJWA 5GAHC 1STNA 1EIFA 4HIKA 2ES2A 1PVOA 2NVQB 1TIID 4NW2A 1BBWA 1PFNA 1XMOL 3TP7A 5NUCA 1EU4A 4Y52H 4EQPA 5ELEA 3A0JA 2GA4B 2UXBL 1O7IA 4DV1L 1QVFA 2N88A 2UUBQ 3PO3H 3V05A 2NVXB 4HIDA 1DZ1A 1BF4A 1QE6A 2PZUA 3LGJA 2F0KA 5ELFA 1E1OA 4X62L 4ZUIA 2JA8B 4OO1I 1I4XA 4HEDA 4A3BB 3AMUA 1XNQL 1UE7A 1SNQA 4WJWA 1TY0A 3PO3G 2XRQD 3NE5B 4GN5A 3SXHA 1HNZL 2NWGA 2PQAB 5F2DA 2ICEC 1HXYD 2EYLA 4BBRH 3Q8DA 4ZUJA 1JE5A 1EZ8A 3DEOA 4AQYQ 3H0GB 1I5FA 1YJNA 1VQPA 5GAEC 4LF9Q 1B4OA 3PGZA 1C9OA 3PQIA 4C2MH 4P72A 4BBRG 4A3JH 2Z6KA 1PTOD 4PZ7A 4AH6A 1K0SA 3FVQA 3CCLA 1QUQB 4R8NA 2UU9L 3UDGA 4LF5L 3CW2C 4X3UA 1EWCA 1SMYC 3VYTA 5J1ZA 2VL6A 3HRZC 4XYQA 2M2LA 2A69C 2P5ZX 1XNRQ 3P1HA 3KDFA 4B9WA 1V8QA 4XT3B 1M8AA 4IUTA 4GZYC 1WTPA 2DJGC 2PQEA 4B9XA 1TWHB 1SYEA 3HKSA 4PZ6A 3BDOA 1BNZA 1J5EQ 1PYBA 1HR0Q 2A19A 3BYTB 4X64Q 4DR3L 4H13C 1AE2A 4PG3A 1SNCA 3OWEB 1VQAA 3TP5A 1EFWA 3FPUB 5JJZA 3TMEA 2OQKA 2MO0A 4HSPA 2MO1A 2VB2X 1RDPD 1HZAA 2E2HH 1HUNA 4JBJA 1Y1VH 4HN7A 4NMZA 2EYPA 2R3ZA 3NENA 3ICEA 4IUVA 2XRSD 1PV4A 3EVQA 4X65L 2NZOA 3SEBA 4DUYQ 2R7ZB 1PH8A 1GJXA 4ZLTF 3J7A5 2E2JH 2JJQA 4GKKQ 4LFAQ 2FJ2A 1RODA 2FFKB 4IO9A 2YYZA 3S17H 3FPPA 3P20A 5E4XA 4BY1G 1MSHA 1JWMD 1YIJA 3KF8A 4WRDA 5I2YA 3V96A 4JI3Q 2F4VQ 1YHAA 2L12A 4NXNL 4QF4A 1I50B 1PH9A 3RMHA 3E3XA 1UAPA 1HNXQ 4IN3A 2BA0A 3J81c 5HGTA 1N34Q 2NUCA 1S72A 5JEAJ 1SE8A 2I5HA 3RZDB 1XPOA 1E0BA 1BOSA 1Q3LA 1KC8C 3C46A 3I4OA 1QILA 4ZKCB 1O7YA 4L8JA 3ER0A 1H9SB 3T4AC 3GTOH 4FF1A 4LK1C 1LABA 3RZOH 4NKLA 4KK7A 4R4QA 4HIOA 4FO2A 1EWIA 4BA2I 1K8OA 1EOTA 2F3VA 2AUKA 5KRUA 5AJ3Q 3PUWA 2B8GA 3TDQA 3TZDA 3ULLA 3M85A 4IFDH 3S1MH 4K8JA 1LTSD 5IE8A 4DN4M 4ID6A 1AW7A 5C3EH 1EIGA 1OXUA 4FXGC 2K1BA 4LJZC 4N8X1 2BOSA 4DFAA 4PMWA 4B3TL 5K36H 2K5VA 3EA6A 2R93G 2HQLA 4DR4L 1CK1A 5E3FA 3FEWX 2NBFA 3S16H 4IFDG 2R6GA 3KBXA 4KHVA 2NTSA 5C3EG 1GO3E 3L3OC 1IYJB 4YIJA 4QCLA 3MVVA 3VR5A 2MFIA 5CMDA 5K5PA 1A3TA 4NPSA 3OIPA 1RCVD 5CBEE 5IT9L 4JOIC 2HIXA 4UP8A 1EY5A 3T56B 2VQFQ 4JI1Q 3DMUA 4DAYA 3A7LA 1B70B 2H4OA 2ZM6Q 4JBMA 3QOJA 1OXVA 2OWOA 2R7FA 1K28A 2IW3A 4M1UB 3PMFA 3GTPB 1CI3M 1I4HA 1D2BA 1YEZA 3CC2A 2AHOB 4X6AH 5CV8A 3CAMA 5C44B 2HT1A 1T5EA 2XSCA 3M4YA 3HKZE 2F0QA 3GQBA 4XQJA 3U50C 1TQOA 4L6TB 4HJ7A 4JI2Q 4DK6C 5FO9B 1VQJA 4XQNA 1Q86C 3F1ZA 3CC4A 2VNUD 4UAIA 2A68C 4K14A 5IP9H 1EQTA 5I9OA 2K75A 5EKKA 1STAA 1HQRD 1TR5A 4EQNA 1JOQA 4A3DH 1M90C 1O7LA 3VA5A 1I3QH 1R9TB 3S1QB 3K6OA 4B3RQ 1VQHA 3S2DB 1PLFA 2R7DA 3I70A 5D3IB 1V43A 2EJMA 1LO5D 5IP9G 1DONA 3A8JE 1VQNA 4ALPA 4AYBB 4C3JH 3I4MH 2ZTEA 4FVMA 3HGBA 5FLMH 4QUCA 2RSNA 3DWQA 4CJ0B 4PMCA 1PYSB 1XYIA 2SOBA 2O2LD 2TSSA 3S2HH 1CKMA 3CKIB 3NBHA 4DR6L 4OO1G 5IGBA 5A35A 2N78A 2R61A 4A3BH 1DOKA 5T1IA 5FLMG 2WV6D 2EXZA 4B3MQ 1E22A 4H0LC 1CFMA 2HCIA 2SDFA 5FLXc 4LF4Q 1XWEA 1CZWA 2EY2A 1OXTA 2K04A 1X56A 3DM3A 5FO7B 3EROA 2EIFA 1Q1EA 5M3FB 2K03A 2JA8G 1YITA 3GV3A 4A3BG 1VQMA 3C2PA 2YTYA 2EQSA 2H1EA 1U4MA 2WKCA 5T1GA 2QGQA 3HOZH 1AH9A 2B2UA 2JSOA 1MGSA 5J22A 4HTHA 5IP7H 3FDTA 3A74A 5M3MB 2NVYB 2QILA 2IWHA 2VUMH 2Q8RE 1VQ8A 4N9TA 4L63B 1NSNS 4GN3B 2LS01 2WFWA 1BUVT 4FXDA 5AFWA 4YY3Q 1SR3A 1KLGD 2K5NA 5IP7G 1CHPD 4DXFA 2DGYA 1NBWA 4N8FA 2F1MA 4LF8L 4G7HC 2PPBC 3W3AA 2PZTA 2I07B 1HFNA 3HOUB 1NMGA 4KHPQ 2HHHQ 1ENCA 2LSSA 1KAAA 2JXMB 4A76A 1V9PA 4DV7Q 3TBIB 4IPHA 3HOYH 4KJOA 1KHIA 4TSSA 3I7FA 3S14H 1C4QA 4POGA 3KDFB 2L4NA 3GV6A 2A6HD 1ZXTA 2KENA 1EQQA 5KGUA 4AYBE 1ICWA 3C1FA 3C1EA 5LMNL 3PUYA 1QWYA 3TS2A 1Q8KA 1EY6A 4Y7NB 5LL6S 4JI4L 2JYOA 4I7AA 3HOYG 2KHSA 1Z7TA 3SGIA 1K8GA 1MBYA 3CXCA 4C3IH 2EXDA 1W2BA 2R7ZH 2FINB 5JJKA 3GTLB 5C4ZA 1R4QB 4CBVA 1U4LA 4ZCKA 5ELOA 2LXKA 4RKLA 1B44D 2UXDL 4G57A 2F0GA 1WTOA 1BCPF 3STBC 4DUZL 4J8QA 3L7ZC 4C3IG 2R7ZG 1JJCB 2HDMA 2DNCA 3E6ZX 2RA4A 1PRTF 4JI0Q 2HDLA 4GKJL 4AIMA 1A8VA 5BR8L 1EWHA 1DCZA 1Q8IA 4DU9A 2EJFC 4KD3A 3RZDH 1WOCA 2OCEA 2VS1A 3KF8B 1PTOB 4DAPA 3BZDB 4GOPB 1PH4A 1HRJA 1DYQA 1IKLA 4ZYSA 1SRUA 3GTKH 3MAQA 1X3QA 3PCOB 4R4TA 5COYA 3HKZG 1Q81C 1KNAA 1QNKA 3RLOA 4OGQC 2M00A 1A15A 4RHRA 1HTLD 2CCZA 3PUZA 4O42A 1GUWA 1A63A 5C4JH 1D1IA 2A6EC 3IKJA 1N9WA 4OX9Q 5C3WA 2EYJA 5JVH3 5C4HA 1BBUA 4DV3L 2JEBI 3MZ5A 2B2VC 1X3GA 2K5WA 1L1OB 4JI5L 5C0XJ 1I94Q 2Q2HA 2KOLA 4K2LA 4KKUA 4P2CB 3JAML 1FVIA 3CD6A 1SNMA 3A55A 3HOXB 2Q8IB 1TXYA 1CUKA 1X55A 3A5ZB 1LT4D 4A93H 1TS3A 2VZAA 2D2CC 4DV2Q 3HOWH 2XNAC 1ONLA 4JI6L 1CSQA 1UEBA 3NXWA 1QCBD 1YNJD 3T1HL 2CWPA 1OXXK 2KVMA 2NZ1D 3HEJA 3W1BA 3RN2A 3ONAB 4YWKA 4I65A 1N33Q 3QOLA 2A74C 4A93G 3EIVA 1VQDA 1GKHA 2HCCA 3CC7A 4IOCA 3HOWG 1Y8PB 2I5MX 2L1BA 1MSGA 3Q6SA 4XT1B 4DV4L 4UY8C 2VW9A 4BY7B 4A4IA 5DM63 1QNUA 3DM1A 1GUNA 1JQYD 4C3HB 3CCRA 4DAYB 5M5YB 2VXWA 4V0BA 3PUVA 2RQXA 4A3MH 3CPWA 1E2WA 2I46A 3K5NA 2BE5D 1FJGQ 1K83B 3PO2B 1CHQD 2DNEA 3A8IE 4EQOA 3X3NA 1QJOA 4ME5A 5LMUQ 1CA6A 1G6ZA 1B3AA 5IYBG 5C4XB 5FO8B 3CHBD 1NNXA 5IT9E 1WI5A 2FMMA 2B39A 2EYMA 2UUCQ 4DV5L 4ULLA 3K0YA 4LUOA 2WIIB 4HR7B 3T51B 4F7XA 3BVGA 3M4OH 4MN3A 4DR2L 2OQ0A 2BH8A 4OL7A 2KHJA 1VS0A 1B3QA 1GOZA 4IQZA 2VQEL 4LF6Q 1F2MA 2YTXA 1IBLQ 1HNWL 1W6KA 3G6EA 4CGYB 1NAPA 1GVPA 4DA2A 5JEAH 4CKBA 4JV5Q 3M3YB 2MNAA 3PF4A 3EJIA 1MJCA 2Z6KC 3OW7A 1NE3A 4O2DA 1EOVA 1TS2A 4ABNA 4H02A 3KJOA 4AYBG 4G4KA 4TKOB 2D5DA 1VF7A 1RKNA 4HJ5A 4V190 3MWYW 3OTOL 1PFSA 3JAMi 1VQLA 1JJGA 2GVAA 3VR4A 3MEFA 5JEAG 4IJHA 1MJEA 1IKMA 3KLRA 4PZ8A 1SN8A 2Z9HA 4FNFA 4P73A 3NBHB 3QO2A 1Q1BA 3E0JA 3URYA 3EFXD 2BDNA 1N32Q 1JOOA 1EYCA 2X69A 4CDDC 1SNOA 2FXQA 1TWAB 3S15B 5FJ8H 3CP0A 5JJIA 4KY7A 5M5XH 2WP8J 3NTIA 1RF2D 5M3FG 1GUGA 1G2SA 2CHBD 2F0SA 2RCFA 3VYRA 2XN9C 3D4RA 1HA5A 1JR0D 1VQIA 4ZQ3A 2K6AA 2RBMA 3TP8A 5FJ8G 5H1SE 2F0PA 2JA5H 1HTPA 3BVZA 1B1ZA 2LKVA 5M3MG 2C5CA 4A3KB 1XJVA 4PNYA 1DM0B 5KEEA 1JE4A 2QW7A 5C0XI 4FDBA 2IT1A 4E6IA 3EQLC 3J80E 3BG3A 4LUZA 5HURA 1IBML 2XWBB 2PI2A 4JC0A 4OIKA 4C1NI 1PTOC 4KY5A 4K0KQ 2CQOA 4A3EB 1T9HA 5CBAE 2B2WC 2O4XA 2JA5G 4JI8Q 1U4RA 3BZCA 2WAQB 3R2TA 2E5LQ 2KUMA 2QF7A 3D0FA 4XIGS 4LFBL 3R8BA 3KLSX 1I6HB 3MHBA 4ZKBB 2IHEA 1YJ9A 2RCNA 5C5MA 2I5LX 5KNDA 1STEA 4K5VA 3S1NH 3HOVB 3KOJA 3ITPA 1IYUA 5C6AA 2F0DA 3PSIA 4IUUA 4LF7L 3VYUA 3GTQH 2UXCL 1BQQT 1BCPD 1ZYRC 4BY1H 1GUTA 4RCNA 2OT2A 3GTGB 5IIFA 1N36Q 2AWOA 4R9WA 3PUXA 4KY6A 2G5DA 4NXML 3CQZH 5GADC 1X3EA 1PRTD 4ILWA 3AQQA 1L2FA 3VYSA 2E76C 1EY8A 1X65A 1TWGB 4JYAQ 1LLRD 4IPGA 1ASZA 2IL8A 4CDCC 1CT1D 4DR5L 4BS9A 1VQFA 3J7AV 2CQAA 2OF1A 2F0VA 3PF5A 3BYYB 3NEMA 2CW0C 3GTJB 4JCVE 4GOPA 3P7JA 1HZ9A 3GP7A 3K8AA 1K73C 1HHVA 2TMPA 1D6EC 1OO9B 3FP9A 1SNDA 2JA7B 3FKIH 5FK9C 1Z6HA 4JBKA 2SNSA 1C8CA 1W3SA 1K8MA 3GTMB 3K57A 2ALYB 1S5BD 1M1KC 1F9RA 2UUBL 2RHQB 5LMNW 2JN4A 2NN6I 4GNXC 2R92B 2Q2TA 5KYLA 3FKIG 3HZXA 1X32A 3NELA 2K5QA 2EVBA 4R4IA 3MA2B 1H9KA 2PW5A 5M5WB 1L1OA 4DV6Q 2B63B 2NVTH 2AUJD 5CR3A 2R93H 1GHKA 2RDHA 3MTSA 3GD7A 2KEEA 1K9MC 2L0CA 2XIWA 1FNWA 2K33A 3V2TA 2NTTA 2JE6I 3W1GA 2WAQE 3IL8A 1GUSA 3KLWA 3M4PA 4LW1A 4NDXA 2RDGA 1NR4A 1PH1A 3UDXA 2Y0SB 1H9JA 1L0XB 4QGUA 4AQYL 2FMCA 4R4OA 1JJ2A 4KI0A 2Z6BA 1FGUA 2YU9B 4K5WA 4LF9L 2J0TD 4GLXA 3BZKA 1EY0A 4A3GB 1V1PA 3K7UC 2F0IA 1S3OA 3UE1A 4YHHQ 2VB3X 2E2IH 1B9NA 3KF6B 3TSSA 2CH4W 2JP1A 3MFGA 1IHZA 4QQBX 1XNRL 3KLSA 1YHQA 4R1JA 5KIXA 1SFOB 4JW0A 1S5FD 5CGKA 2JA6B 3LNNA 1B8AA 4BXXG 3S1RB 4L5QA 3EBEA 4ME3A 3SK4A 5KNBA 1J5EL 3Q0AA 1HR0L 3FRPB 2KHIA 2X6LA 3VA7A 4DR1Q 4YWMA 4X64L 3T1YQ 4BY7G 3JAME 1XTDA 3SK6A 2WB1B 5ELBA 1JMCA 4XXEA 3H91A 1SE2A 2KBNA 3TN2A 3I4NB 4IURA 1VCIA 4C3HG 4QJFA 1LYLA 3NQIA 2JQOA 4DKAC 2L9HA 4PMBA 5JPMC 1Q7YC 1YNXA 4DUYL 1TWFB 1I4QA 1KXLA 3K7AB 1IBKQ 4GKKL 1NR2A 1AE3A 4LFAL 3LWUA 1E1TA 2B2UC 1I4RA 1MIUA 2K50A 4OO1H 4GS3A 2PCFB 2NVQH 1DOLA 1L0YB 3ERSX 1CTMA 4JI3L 2F4VL 3G48A 3J81L 4A3IB 1IW7D 2C9OA 2DY7A 3QR8A 5IODA 2NVXH 1B7YB 2Y0SE 1K8AC 3HFZB 1IL2A 2DN8A 1ML0D 1HNXL 1KL9A 1H9RA 4EVOA 1T5XD 2EYOA 1N34L 4DK3C 4RH6A 3OW2A 1JC7A 4GLVB 2JA8H 1AZPA 2ZTDA 1XMQQ 2JK8A 3ND8A 3J81j 2MGSA 3S9WA 2C35B 3OMCA 3J80L 3I2ZA 1VQOA 2EZVA 2WKDA 1WTVA 4FF2A 4Q5VA 4KLKA 2B8FA 1LACA 2CFMA 4Z9CB 3TQYA 1MHWC 3PO3B 2K32A 4IJLA 1SEBD 2IX0A 1B50A 3QJYA 4O0AA 1V1QA 1JB7A 1VQEA 4C56C 1FD7D 3ULPA 4OHJA 1TWCB 5AJ3L 1QVCA 5C5LA 5CV9A 1JORA 1PZKD 4DNRB 5BN3A 3H0GH 5C0XH 1SMXA 1FYCA 4K6LA 2KCMA 4YCUA 1STYA 3U9SA 4QMGA 1YHBA 2EYFA 5GROA 2RKSA 4LWCA 3I3CA 1BO0A 1VQKA 2IJ0A 1PH2A 1CA5A 1P8LA 2WB1E 3H0GG 5C0XG 1HUMA 3QWNA 4RMFA 2UUAQ 3M7NA 2N55A 1WTWA 4KV6A 5IYDG 1LT5D 3DUZA 2K4KA 2BDOA 1BVSA 2DJFC 4OWTB 1HZBA 4DV0Q 4U68A 2Z8LA 5KYIA 1NTGA 4WORA 4WJ3M 4BBSB 4C2MB 2IHFA 5ELNA 2AQ1B 4HJAA 1K3BC 4A3JB 3D6CA 3X3MA 1TWHH 1ESRA 2ENBA 4G7OC 5DLQE 2VQFL 4JI1L 2B2YA 1I6HH 3CMAA 3D6WA 2L55A 2ZM6L 5LL6X 1EFID 1S4ZA 3HOVH 1G291 1LV9A 4A3EG 3T13A 4B3SQ 1WYDA 2B3GA 1FGBD 5CV5A 2WAQG 2ZJRA 1C48A 4I7ZC 1RTOA 5ELDA 2F0UA 5LHY1 2V4DA 4JBWA 4DXGA 2Z1CA 3J81i 1BR9A 3VR3A 3N6RA 4LFCQ 3GTGH 3NP8A 4DR7Q 2KQ3A 1A3UA 2A6HC 3HOVG 5IWAQ 3RNUA 3Q24A 1DXMA 4IUQA 4JI7Q 3D4DA 1QVGA 1M4VA 1QOHA 3DHQA 1E2VA 1HFGA 1EQRA 4JI2L 2F4IA 4DAVA 4S3SA 3T16A 3J80i 2OEOA 5I9PA 1SXTA 3RLNA 3OSOA 2A5HA 2KEDA 1B2TA 1A0IA 5JVG3 1Y1VB 4FP5D 3CMEA 1I50H 1LT6D 2NN6H 2LMCB 3AFQA 4B3RL 5CV7A 4DNIA 4UP9A 1W6JA 1SE4A 1ET6A 3M7GA 4MTNA 3UDFA 1ENFA 5EQ0A 2YV5A 4X66Q 3OOCA 3TREA 1JOKA 1SYGA 4XTCS 1JT8A 2V1CC 3S17B 1AN8A 1IXRA 5ISRA 2AWNA 2YTVA 1Y1WB 3ZYYX 1BXTA 1G8ZD 2NN6G 1XMOQ 4MHEA 3BU2A 2UXBQ 4DV1Q 1QB5D 5FLXL 2JA7G 4HMJA 2ZT9C 2B2TA 2Q8TA 3DLLA 1CM9A 2L11A 4F87A 2KCTA 3A56A 2F3IA 4X62Q 1EEFD 1VQ5A 2HD3A 4B3ML 1YNND 1B53A 4LF4L 3AB9A 4YCWA 1GXDC 1XNQQ 2F0OA 3NK9A 4F8MA 2R92G 3IAYA 5M9OA 5J39A 2BH2A 1KDAA 4IOAA 3GTOB 2LY7A 3SHLA 1HNZQ 5CV6A 2B63G 3RZOB 3CCEA 3F2DA 4GN4B 1EZ6A 2PI2E 3GO5A 1EYDA 1RL2A 1KD1C 4PV1C 4R8IA 1BCPB 2K7VA 3K59A 5IGCA 4IALA 3KF6A 1XTCD 2CWAA 3S1MB 4J6HA 1A2UA 4CHTB 1IYVA 1ZEQX 3RD4A 3NBIA 2Y0SG 1PRTB 3NTHA 2D0OA 2QDLA 2QCPX 2O5IC 2F0FA 4C1NK 5IYCG 4HJ9A 3P75A 4YY3L 2ZJQA 4H44C 2UU9Q 4LF5Q 1D1KA 3S16B 1D8LA 3NUCA 1H95A 1KTKA 1IL8A 1TU2B 2JA9A 1EL0A 1I4GA 4OELB 1EY7A 1AP0A 1V1PB 5ELCA 2HHHL 4KHPL 1YNJC 4TRDA 1ILPA 4QB4A 1D7QA 2Z0SA 4LMQD 2EY5A 1CZGA 2QA4A 3GTPH 2F0LA 1J6QA 4DV7L 4A3FB 1UE1A 4NP5A 1LTTD 2PMZB 1STBA 5C44H 5IYBH 1SJED 1KRSA 1KRTA 1Z9FA 3D3RA 4DR3Q 4G7ZC 2F52A 4XQQA 4KN7C 4DK0A 1LTID 4RHSA 5C44G 3J7AF 2L15A 3BVMA 1S5ED 4P71A 1KQSA 2B2VA 2WB1G 2BE5C 4DPGA 4BWGB 1R9TH 3S1QH 2BCOA 3I4NG 3S2DH 3HG9A 2PYKA 1EU3A 3OWFA 4X65Q 4A75A 4MNOA 3AEVA 5J3BA 4CDFC 2D0PA 2NB0A 4DK1A 3Q23A 2RSOA 4A3IH 2I0QA 5C3XA 1CSPA 2Z4HA 1OXSC 5GAGC 3T53B 3HP3A 4KMUC 1TS5A 3WDNA 4JI0L 4X3KA 4A3DB 4CDEC 4HAEA 4NXNQ 2ATWA 1BKBA 3BS1A 1I3QB 1VF5C 1VDZA 3H09A 3VR6A 1XPRA 2EYHA 1UE5A 5EBCA 4OXPA 1SLJA 3N52A 2SNMA 3IFDA 3L2PA 4A3IG 1HZCA 4MIUA 1HR0W 4ODGA 2QEXA 4A3LH 1PYWD 4IUNA 4C3JB 3I4MB 1AFPA 1LT3D 4UP7A 4U673 5M3FH 3CRLC 3S2HB 1CQVA 1PFBA 1RD9D 3TEHB 3I90A 3I73A 1PH3A 3D4WA 1TWCH 4A3LG 4L5RC 3AFPA 1O7ZA 4KKTA 4K8IA 4CJ2C 1F9SA 3K0XA 5M3MH 3A7AB 2N3SA 3KYHC 5IOCA 1N8RC 1SNPA 4OX9L 2NVYH 2PMZE 4L5TA 3J81E 2CKZB 1G6PA 2EY1A 4IUPA 1I94L 1VQBA 3W2DA 4B3TQ 2ZXRA 4DR4Q 3A54A 1O80A 3HOZB 2FHTA 1RTNA 4R4CA 1K0RA 1CKNA 3F2CA 1SMYD 2EY6A 4DV2L 2K14A 3OMGA 1CKOA 3HOUH 4K6DA 2A69D 1SSOA 1TS4A 4BBSH 2H5XA 1TY2A 1PFMA 2VUMB 3NTKA 2EE1A 4GOPC 1XXGA 1EUJA 4HCEA 1N33L 3D31A 1WJJA 2MPMA 1F9PA 1SBBB 5IT9c 3HOUG 3R2IA 4KHZA 4BBSG 3L0OA 4Y7NH 3DEPA 4BA1I 4A3JG 1P16A 3RR5A 1HCZA 1G91A 2SEBD 1UUPA 1E7ZA 1H9MA 3E5SA 3SK8A 3D8GA 3CRKC 1NY4A 1ZYRD 1MD2D 3HOYB 2IX1A 1IZ6A 5TSSA 2K5DA 4OIJA 3S14B 3GTLH 1FJGL 3M4QA 2IPKD 1SYBA 3BDCA 1PH6A 4H7BA 1L1OC 1UNSA 3G7LA 4UDUC 1VQGA 3H3VI 2Q2IA 1BCPC 1DJRD 5LMUL 5JJLA 4P74A 2UUCL 1RHPA 4RA8A 3WWVA 1E24A 1D5XC 1PRTC 1GUOA 1VQ9A 1WCMB 3PIO3 5EJWA 3ZJYC
chains in the Genus database with same CATH topology
4C3IB 2CW0D 2K28A 4RWSC 3TZUA 3DXJC 1ILQA 1ET9A 1PTOH 3PIP3 2PO4A 4LAAA 1A3VA 2A73B 1VMPA 2AQ3B 5D14A 2QKIC 1ESFA 1HPCA 2B2WA 4DGZA 1BBXC 1X3PA 5JPNC 4FF4A 4HMIA 3HKZB 2ZXPA 4FXKC 1F2LA 4RGOS 5A2QL 1CQFA 5E4WC 4K2KA 3OIQA 3GTKB 1U4PA 3OHXC 1AZQA 2KCNA 2KCCA 1SYDA 2F0HA 3NHHA 2E74C 3NWSA 3A8KE 3FMCA 4TQUS 1WVLA 3QB3A 5C4JB 4KN4C 2G9HD 4DNTB 1F2YA 4KKSA 2RVLA 4JK1C 3DWPA 5D3DA 1EQVA 4WFN3 5FLXE 3F2UA 2F0EA 1TKWB 1J9OA 1FNUA 1WTXA 2CVRA 3KBGA 1Q12A 3SDZA 4A93B 1KLUD 1QG7A 5K36G 3HOWB 5JAVA 4KJNA 2ICIA 1G2TA 1LTAD 1II3A 1O78A 2O5JC 3OPOA 1LTGD 3K5LA 2EOTA 3MEHA 2F0TA 3MXPA 4IZ8A 2ID0A 2AQ2B 2MP1A 4FYDA 1E2ZA 1HA6A 1JICA 2A68D 2MHVA 4RCOA 1PXUA 4A3MB 2F0JA 4O1NA 2QEJC 3TP6A 1S5CD 4X3TA 3MXGA 3J7YW 1BDOA 5E1FA 4RGTA 3G6JB 5BN4A 5G3LF 1FR3A 2KECA 4B08A 1ZKOA 2KJXA 3SR1A 2DY8A 4HSVA 3M4OB 5CV4A 1WTQA 2HQEA 4QUFA 4N9PA 1IW7C 1I6VC 4X3SA 1EIHA 3ERQA 5IGFA 3NQTA 3H94A 2EDGA 1Y8OB 2EJGC 5CC4A 3H3VC 3KK7A 1XX8A 1Y8NB 3SVMA 2B2YC 3Q22A 1D5MC 5I4DA 4RAUC 4C3JG 2E75C 1KABA 5DEHA 5EKIA 1ENAA 1MI2A 1WTRA 2KA7A 2D9UA 4IFDJ 3BDLA 4XDXA 2K05A 1EEID 5FOBB 2X6GA 4BBRB 4KTAA 1SDFA 5M5XB 3I72A 1NUCA 1F9QA 2Z4IA 3ND9A 1PMRA 1JWSD 2F0MA 4ZK9B 1DD2A 3K58A 3AU7A 1STGA 4DF7A 1AEXA 1EY9A 3H6MA 1KNEA 1S5DD 3L9AX 2F03A 5DNFA 1EYAA 2JA5B 1EY4A 3R3OA 3MFYA 1SAPA 1GHJA 4ZRZA 2F3WA 3RLFA 3VR2A 1U9RA 3RUZA 1PTOF 2JEAI 1PDQA 3K5MA 4CJ1B 3SK5A 2EPBA 4KD4A 1RJTA 5FKAC 2B2TC 2PNRC 1FNVA 3LX0A 2F0NA 1JB3A 3PV0A 3S1NB 3MXNA 2XVSA 4XYOA 3QIAA 1PZID 3GTQB 4PQXA 2E2HB 4BY1B 3NWTA 2J4XA 3WOEA 3CQZB 1PZJD 2LFNA 1NCVA 2XWJB 2E2JB 3LWEA 1KDBA 3SE0A 4CKEA 1SYCA 5I2XA 5IGEA 5I6YA 3U9OA 3UI2A 4ZAIA 1TT2A 4HCSA 5EPKA 3WOFA 1H9SA 3O13A 4RGMA 1JCKB 5IGGA 2M9VA 1A6XA 3FKIB 2NYZD 2BA1A 5BN5A 5IGDA 3NPPA 1JWUD 1R4PB 1HQMC 2A6ED 2L5TA 2ZXOA 1Y69U 1STHA 1YNNC 1SJHD 1Q90A 4FF3A 3R93A 3KUPA 2R93B 2NVTB 2E2DC 4QIWB 5EPJA 1SYFA 2MJ8A 3C3LA 5DM73 5C3EB 4K5XA 1KDCA 5CORA 2K01A 4RFBA 1VMCA 1WD0A 3MXUA 1D5ZC 5KNCA 1F77A 5CYUA 3IFTA 1LTBD 1TVXA 4IFDI 2HUGA 1SE3A 2J7ZA 5D65A 2RDFA 5A2QE 5I6WA 3CU7A 3I8ZA 3I4LA 2PZWA 2WINB 2D62A 5EGTA 2E2IB 2WACA 1F2ZA 2PW7A 5JOBA 2G9DA 4J1MA 4M8AA 1B9MA 1WD1A 3DWAA 1A2TA 1J8IA 3HS0C 1V1OA 5DAUA 2F0WA 4F88A 3MC0B 5G3LD 3I91A 5EPLA 3QG1A 5EBDA 2MUYA 4Q0FA 1UEAB 4RGNA 3NSWA 1Z47A 2OXPA 3K5OA 2IX3A 1DOMA 1I4PA 4EGVA 2QDBA 1LTRD 5EKLA 4RKBA 4CKCA 1STNA 2NVQB 1TIID 4NW2A 1PFNA 3TP7A 5NUCA 1EU4A 4EQPA 5ELEA 2GA4B 2N88A 3V05A 2NVXB 1DZ1A 1BF4A 1QE6A 2PZUA 2F0KA 5ELFA 4ZUIA 2JA8B 4OO1I 1I4XA 4HEDA 4A3BB 3AMUA 1SNQA 4WJWA 1TY0A 2XRQD 3NE5B 3SXHA 2NWGA 5F2DA 2ICEC 1HXYD 2EYLA 4ZUJA 1EZ8A 3DEOA 3H0GB 1B4OA 1PTOD 3FVQA 4R8NA 4X3UA 1EWCA 1SMYC 3VYTA 5J1ZA 3HRZC 4XYQA 2M2LA 2A69C 3P1HA 4B9WA 1V8QA 4XT3B 1M8AA 4IUTA 4GZYC 1WTPA 2PQEA 4B9XA 1TWHB 1SYEA 3BDOA 1BNZA 3BYTB 4H13C 1SNCA 3OWEB 3TP5A 3FPUB 5JJZA 3TMEA 4HSPA 2VB2X 1RDPD 1HUNA 4HN7A 4NMZA 2EYPA 2R3ZA 4IUVA 2XRSD 3EVQA 2R7ZB 3SEBA 1GJXA 4ZLTF 2FJ2A 1RODA 2FFKB 2YYZA 3FPPA 3P20A 5E4XA 1MSHA 1JWMD 3KF8A 4WRDA 5I2YA 3V96A 2L12A 4QF4A 1I50B 3RMHA 1UAPA 4IN3A 2BA0A 5HGTA 2NUCA 5JEAJ 3RZDB 1E0BA 1BOSA 1Q3LA 3C46A 1QILA 4ZKCB 1O7YA 4L8JA 1H9SB 3T4AC 4FF1A 4LK1C 1LABA 4NKLA 4KK7A 4FO2A 4BA2I 1K8OA 1EOTA 2F3VA 2AUKA 5KRUA 3PUWA 2B8GA 3TDQA 3TZDA 3M85A 4IFDH 4K8JA 1LTSD 4DN4M 4ID6A 1AW7A 1EIGA 1OXUA 4FXGC 2K1BA 4LJZC 2BOSA 4DFAA 4PMWA 5K36H 3EA6A 1CK1A 5E3FA 3FEWX 2NBFA 4IFDG 2R6GA 3KBXA 4KHVA 2NTSA 3L3OC 4YIJA 4QCLA 3MVVA 3VR5A 5CMDA 5K5PA 1A3TA 3OIPA 1RCVD 5CBEE 5IT9L 1EY5A 3T56B 3DMUA 4DAYA 3A7LA 2H4OA 3QOJA 1OXVA 2IW3A 4M1UB 3PMFA 3GTPB 1CI3M 1I4HA 1D2BA 5CV8A 5C44B 1T5EA 2XSCA 3M4YA 2F0QA 3GQBA 4XQJA 1TQOA 4L6TB 5FO9B 4XQNA 2VNUD 4UAIA 2A68C 4K14A 1EQTA 5I9OA 5EKKA 1STAA 1HQRD 1TR5A 4EQNA 1JOQA 1O7LA 3VA5A 1R9TB 3S1QB 3K6OA 3S2DB 1PLFA 3I70A 5D3IB 1V43A 2EJMA 1LO5D 1DONA 3A8JE 4AYBB 4FVMA 3HGBA 4QUCA 2RSNA 3DWQA 4CJ0B 4PMCA 1XYIA 2SOBA 2O2LD 2TSSA 3CKIB 3NBHA 4OO1G 5IGBA 5A35A 2R61A 1DOKA 5T1IA 2WV6D 2EXZA 4H0LC 1CFMA 2HCIA 2SDFA 1XWEA 1CZWA 2EY2A 1OXTA 2K04A 5FO7B 3EROA 5M3FB 1Q1EA 2K03A 3GV3A 3C2PA 2H1EA 1U4MA 2WKCA 5T1GA 2B2UA 2JSOA 1MGSA 5J22A 4HTHA 3FDTA 5M3MB 2NVYB 2QILA 2IWHA 2Q8RE 4N9TA 4L63B 1NSNS 2LS01 1BUVT 4FXDA 5AFWA 1KLGD 1CHPD 4DXFA 2F1MA 4G7HC 2PPBC 3W3AA 2PZTA 2I07B 1HFNA 3HOUB 1ENCA 1KAAA 2JXMB 3TBIB 4KJOA 4TSSA 1C4QA 2L4NA 3GV6A 2A6HD 1ZXTA 5KGUA 1ICWA 3C1FA 3C1EA 3PUYA 1QWYA 1EY6A 4Y7NB 5LL6S 2JYOA 2KHSA 1Z7TA 1MBYA 2FINB 3GTLB 5C4ZA 1R4QB 4CBVA 1U4LA 4RKLA 1B44D 4G57A 2F0GA 1WTOA 1BCPF 4J8QA 3L7ZC 4C3IG 2HDMA 2DNCA 3E6ZX 2RA4A 1PRTF 2HDLA 1EWHA 1DCZA 1Q8IA 4DU9A 2EJFC 4KD3A 1PTOB 4DAPA 3BZDB 1HRJA 1DYQA 1IKLA 4ZYSA 3MAQA 1X3QA 5COYA 1KNAA 1QNKA 4OGQC 2M00A 1A15A 4RHRA 1HTLD 3PUZA 4O42A 1GUWA 1D1IA 2A6EC 3IKJA 5C3WA 2EYJA 5JVH3 5C4HA 2JEBI 3MZ5A 2B2VC 2K5WA 5C0XJ 2KOLA 4K2LA 4KKUA 4P2CB 3JAML 1SNMA 3A55A 3HOXB 2Q8IB 1LT4D 1TS3A 2D2CC 2XNAC 1ONLA 3NXWA 1QCBD 1YNJD 3HEJA 1OXXK 2KVMA 2NZ1D 3ONAB 4I65A 3QOLA 2A74C 2HCCA 1Y8PB 2L1BA 1MSGA 3Q6SA 4XT1B 4BY7B 5DM63 1QNUA 3DM1A 1GUNA 1JQYD 4C3HB 5M5YB 2VXWA 4V0BA 3PUVA 2RQXA 1E2WA 2I46A 3K5NA 2BE5D 1K83B 3PO2B 1CHQD 2DNEA 3A8IE 4EQOA 3X3NA 1QJOA 4ME5A 1CA6A 1G6ZA 1B3AA 5C4XB 5FO8B 3CHBD 5IT9E 2FMMA 2B39A 2EYMA 4ULLA 3K0YA 2WIIB 4HR7B 3T51B 4F7XA 3BVGA 4MN3A 4OL7A 1GOZA 4IQZA 1F2MA 1W6KA 4CGYB 1NAPA 4DA2A 5JEAH 4CKBA 3M3YB 3EJIA 3OW7A 1TS2A 4ABNA 4G4KA 4TKOB 2D5DA 1VF7A 1RKNA 4V190 3MWYW 3VR4A 5JEAG 1IKMA 3KLRA 4FNFA 3QO2A 1Q1BA 3E0JA 3URYA 3EFXD 2BDNA 1JOOA 1EYCA 2X69A 1SNOA 1TWAB 3S15B 4KY7A 2WP8J 3NTIA 1RF2D 1GUGA 1G2SA 2CHBD 2F0SA 3VYRA 2XN9C 3D4RA 1HA5A 1JR0D 4ZQ3A 2K6AA 2RBMA 3TP8A 2F0PA 1HTPA 3BVZA 1B1ZA 2LKVA 2C5CA 4A3KB 4PNYA 1DM0B 5KEEA 1JE4A 5C0XI 2IT1A 4E6IA 3EQLC 3J80E 3BG3A 5HURA 2XWBB 4OIKA 4C1NI 1PTOC 4KY5A 4A3EB 5CBAE 2B2WC 2O4XA 1U4RA 2WAQB 3R2TA 2KUMA 2QF7A 4XIGS 3R8BA 3KLSX 1I6HB 3MHBA 4ZKBB 5C5MA 5KNDA 1STEA 4K5VA 3HOVB 3ITPA 1IYUA 5C6AA 2F0DA 4IUUA 3VYUA 1BQQT 1BCPD 1ZYRC 1GUTA 4RCNA 2OT2A 3GTGB 5IIFA 2AWOA 4R9WA 3PUXA 4KY6A 1PRTD 4ILWA 3VYSA 2E76C 1EY8A 1TWGB 1LLRD 2IL8A 1CT1D 4BS9A 3J7AV 2CQAA 2OF1A 2F0VA 3BYYB 2CW0C 3GTJB 3P7JA 3GP7A 1HHVA 2TMPA 1D6EC 1OO9B 1SNDA 2JA7B 5FK9C 1Z6HA 2SNSA 1C8CA 1K8MA 3GTMB 3K57A 1S5BD 1F9RA 2NN6I 2R92B 5KYLA 3HZXA 1X32A 2K5QA 2EVBA 3MA2B 1H9KA 2PW5A 5M5WB 2B63B 1GHKA 2AUJD 5CR3A 2RDHA 3MTSA 3GD7A 2KEEA 2L0CA 2XIWA 1FNWA 2K33A 3V2TA 2NTTA 2JE6I 3IL8A 1GUSA 4NDXA 2RDGA 1NR4A 2Y0SB 1H9JA 1L0XB 2FMCA 4KI0A 2YU9B 4K5WA 2J0TD 1EY0A 4A3GB 1V1PA 2F0IA 2VB3X 1B9NA 3TSSA 2JP1A 3MFGA 1IHZA 3KLSA 5KIXA 1SFOB 1S5FD 5CGKA 2JA6B 3LNNA 3S1RB 3SK4A 5KNBA 3Q0AA 3FRPB 2X6LA 3VA7A 3JAME 3SK6A 2WB1B 5ELBA 4XXEA 3H91A 1SE2A 3TN2A 3I4NB 4IURA 1VCIA 4C3HG 3NQIA 2L9HA 4PMBA 5JPMC 1TWFB 1I4QA 3K7AB 1NR2A 3LWUA 2B2UC 1I4RA 4OO1H 2PCFB 1DOLA 1L0YB 1CTMA 3J81L 4A3IB 1IW7D 2C9OA 2DY7A 5IODA 2DN8A 1ML0D 1H9RA 4EVOA 1T5XD 2EYOA 4RH6A 1JC7A 1AZPA 3ND8A 2MGSA 3S9WA 3OMCA 3J80L 2EZVA 2WKDA 1WTVA 4FF2A 4Q5VA 2B8FA 1LACA 4Z9CB 3PO3B 2K32A 1SEBD 2IX0A 1B50A 3QJYA 4C56C 1FD7D 4OHJA 1TWCB 5C5LA 5CV9A 1JORA 1PZKD 4DNRB 5BN3A 5C0XH 1FYCA 4K6LA 1STYA 3U9SA 4QMGA 2EYFA 2RKSA 3I3CA 1BO0A 2IJ0A 1CA5A 5C0XG 1HUMA 3QWNA 3M7NA 2N55A 1WTWA 4KV6A 1LT5D 3DUZA 2BDOA 4U68A 2Z8LA 5KYIA 4WORA 4BBSB 4C2MB 2AQ1B 4A3JB 3D6CA 3X3MA 1ESRA 2ENBA 4G7OC 2B2YA 3D6WA 2L55A 5LL6X 1EFID 1S4ZA 1G291 1LV9A 3T13A 1FGBD 5CV5A 1C48A 4I7ZC 1RTOA 5ELDA 2F0UA 5LHY1 2V4DA 4JBWA 4DXGA 2Z1CA 1BR9A 3VR3A 3N6RA 3NP8A 2KQ3A 1A3UA 2A6HC 3Q24A 1DXMA 4IUQA 3D4DA 1M4VA 1QOHA 3DHQA 1E2VA 1HFGA 2F4IA 4DAVA 4S3SA 3T16A 2OEOA 5I9PA 1SXTA 3OSOA 2A5HA 2KEDA 1B2TA 5JVG3 1Y1VB 4FP5D 1LT6D 2NN6H 2LMCB 5CV7A 1W6JA 1SE4A 1ET6A 3M7GA 1ENFA 5EQ0A 3OOCA 1JOKA 1SYGA 4XTCS 3S17B 1AN8A 5ISRA 2AWNA 1Y1WB 3ZYYX 1BXTA 1G8ZD 2NN6G 4MHEA 1QB5D 5FLXL 4HMJA 2ZT9C 2B2TA 2Q8TA 1CM9A 2L11A 4F87A 3A56A 1EEFD 1YNND 1B53A 3AB9A 1GXDC 2F0OA 3NK9A 4F8MA 3IAYA 5M9OA 5J39A 1KDAA 3GTOB 2LY7A 3SHLA 3RZOB 5CV6A 1EZ6A 3GO5A 1EYDA 4PV1C 4R8IA 1BCPB 2K7VA 3K59A 5IGCA 4IALA 1XTCD 3S1MB 4J6HA 1A2UA 4CHTB 1IYVA 1ZEQX 3RD4A 3NBIA 1PRTB 3NTHA 2QCPX 2O5IC 2F0FA 4C1NK 3P75A 4H44C 1D1KA 3S16B 3NUCA 1KTKA 1IL8A 1TU2B 1EL0A 1I4GA 1EY7A 1AP0A 1V1PB 5ELCA 1YNJC 4TRDA 1ILPA 4QB4A 4LMQD 2EY5A 1CZGA 2F0LA 4A3FB 4NP5A 1LTTD 2PMZB 1STBA 1SJED 3D3RA 4G7ZC 4XQQA 4KN7C 4DK0A 1LTID 4RHSA 3J7AF 3BVMA 1S5ED 2B2VA 2BE5C 4BWGB 2BCOA 3HG9A 2PYKA 1EU3A 3OWFA 2NB0A 4DK1A 3Q23A 2RSOA 5C3XA 2Z4HA 1OXSC 3T53B 3HP3A 4KMUC 1TS5A 3WDNA 4X3KA 4A3DB 4HAEA 3BS1A 1I3QB 1VF5C 3VR6A 1VDZA 3H09A 2EYHA 5EBCA 3N52A 2SNMA 3IFDA 4MIUA 4ODGA 1PYWD 4IUNA 4C3JB 3I4MB 1AFPA 1LT3D 4U673 3CRLC 3S2HB 1CQVA 1PFBA 1RD9D 3I90A 3I73A 3D4WA 1O7ZA 4KKTA 4K8IA 4CJ2C 1F9SA 3A7AB 5IOCA 1SNPA 3J81E 2EY1A 4IUPA 3W2DA 2ZXRA 3A54A 1O80A 3HOZB 2FHTA 1RTNA 1SMYD 2EY6A 3OMGA 4K6DA 2A69D 1SSOA 1TS4A 1TY2A 1PFMA 2VUMB 3NTKA 2EE1A 1XXGA 4HCEA 3D31A 2MPMA 1F9PA 1SBBB 3R2IA 4KHZA 3DEPA 4BA1I 1HCZA 1G91A 2SEBD 1UUPA 1H9MA 3E5SA 3SK8A 3D8GA 3CRKC 3HOYB 1ZYRD 1MD2D 2IX1A 5TSSA 2K5DA 4OIJA 3S14B 2IPKD 1SYBA 3BDCA 4H7BA 1UNSA 3G7LA 4UDUC 1BCPC 1DJRD 1RHPA 4RA8A 1D5XC 1PRTC 1GUOA 1WCMB 3PIO3 5EJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C48 A;  1R4P B;  1CZW A;  4ULL A;  3MXG A;  2C5C A;  4M1U B;  1BOS A;  1DM0 B;  1D1K A;  1CQF A;  4P2C B;  1C4Q A;  1R4Q B;  2BOS A;  1QOH A;  2XSC A;  2GA4 B;  1QNU A;  1D1I A;  1CZG A; 
#chains in the Genus database with same CATH topology
 4C3I B;  1K3R A;  2CW0 D;  2K28 A;  3JC6 6;  4RWS C;  3MXN B;  3TZU A;  1QZG A;  3DXJ C;  1ILQ A;  1ET9 A;  3VDY A;  1PTO H;  3PIP 3;  2PO4 A;  4LF6 L;  4LAA A;  1A3V A;  2A73 B;  1VMP A;  2AQ3 B;  1IBL L;  5D14 A;  2QKI C;  1Y1W H;  1Y1V G;  1ESF A;  2ASB A;  1HPC A;  4JV5 L;  2B2W A;  4DGZ A;  2E8G A;  4QL5 A;  1BBX C;  1X3P A;  1X6O A;  1EYG A;  5JPN C;  4FF4 A;  4DR6 Q;  4HMI A;  1Y1W G;  3HKZ B;  2ZXP A;  4FXK C;  1F2L A;  4RGO S;  1NMF A;  3CF5 A;  5A2Q L;  1GM5 A;  1CQF A;  5E4W C;  4K2K A;  4HIM A;  4WJ4 A;  4J15 A;  3OIQ A;  3J80 c;  1U4P A;  3GTK B;  4JVZ A;  3OHX C;  3I56 A;  1AZQ A;  1N32 L;  2KCN A;  2KCC A;  1SYD A;  2F0H A;  3NHH A;  1PH7 A;  1UE6 A;  2E74 C;  3NWS A;  5IY0 A;  3HOX H;  2OTJ A;  3A8K E;  3FMC A;  4TQU S;  1WVL A;  3QB3 A;  2MQH A;  1VQ4 A;  1RIP A;  4KN4 C;  2G9H D;  3E0E A;  5C4J B;  4DNT B;  1F2Y A;  4KKS A;  2RVL A;  4JK1 C;  4APV A;  3DWP A;  5D3D A;  1EQV A;  4WFN 3;  4BXX H;  1YZ6 A;  5FLX E;  3HOX G;  2A8V A;  3F2U A;  2F0E A;  3H15 A;  1VQ6 A;  3AYH B;  1TKW B;  2RHS B;  1J9O A;  3U58 A;  2PNH A;  1FNU A;  1WTX A;  2CVR A;  4LF8 Q;  3KBG A;  1Q12 A;  3SDZ A;  4A93 B;  4BY7 H;  4K0K L;  1KLU D;  4POF A;  1QG7 A;  5K36 G;  3HOW B;  1G51 A;  5JAV A;  4KJN A;  2ICI A;  4JI8 L;  1G2T A;  2AKW B;  4A3F H;  1LTA D;  1II3 A;  1VQ7 A;  2E5L L;  3CCJ A;  4GNX A;  4C3H H;  3F2B A;  5M5Y H;  1O78 A;  1PH5 A;  2O5J C;  4DAM A;  2AMC B;  3OPO A;  1LTG D;  5L37 A;  3K5L A;  4UPA A;  1K83 H;  2EOT A;  3MEH A;  3ULJ A;  3PO2 H;  2F0T A;  3MXP A;  4A3F G;  4IZ8 A;  5LMN Q;  2ID0 A;  2AQ2 B;  4JI4 Q;  5C4X H;  2MP1 A;  4FYD A;  1E2Z A;  1HA6 A;  1N36 L;  1SRO A;  3U4Z A;  1JIC A;  2A68 D;  2MHV A;  4RCO A;  4UHV A;  1PXU A;  1ASY A;  3PO2 G;  4A3M B;  3UE0 A;  3U4V A;  3TRZ A;  1VQC A;  2F0J A;  2IY5 B;  1KAW A;  4JYA L;  3G71 A;  4O1N A;  2QEJ C;  3TP6 A;  1S5C D;  5C4X G;  4X3T A;  3MXG A;  3J7Y W;  2UXD Q;  1BDO A;  5E1F A;  4RGT A;  4DUZ Q;  3G6J B;  5BN4 A;  3M3Y H;  5G3L F;  2DUD A;  1FR3 A;  2KEC A;  4JOI A;  1ZKO A;  2KJX A;  4B08 A;  3CCM A;  3SR1 A;  1YI2 A;  2DY8 A;  4HSV A;  3M4O B;  4GKJ Q;  5BR8 Q;  1HJP A;  5CV4 A;  2B29 A;  1WTQ A;  2HQE A;  4QUF A;  4N9P A;  3GDE A;  1IW7 C;  1I6V C;  4X3S A;  1EIH A;  3ERQ A;  5IGF A;  3NQT A;  4A3D G;  1YBY A;  3H94 A;  2EDG A;  2LXJ A;  1Y8O B;  2EJG C;  5CC4 A;  3H3V C;  3KK7 A;  4MTK A;  1XX8 A;  1Y8N B;  3M9B A;  3SVM A;  2B2Y C;  3EN2 A;  3Q22 A;  1D5M C;  5I4D A;  4RAU C;  4C3J G;  1TWA H;  3S15 H;  4DV6 L;  3I4M G;  2PQA A;  1NJI C;  2E75 C;  2Q2U A;  3S24 A;  4OON A;  1KAB A;  5DEH A;  5IYD H;  5EKI A;  1ENA A;  1MI2 A;  3CCQ A;  1WTR A;  1DGS A;  2VY3 A;  4DV3 Q;  2KA7 A;  1A62 A;  3FHW A;  2D9U A;  4EQ5 A;  3BDL A;  4XDX A;  4IFD J;  4JI5 Q;  2K05 A;  1EEI D;  5FOB B;  2X6G A;  4BBR B;  4A3K H;  4L5S A;  1QUQ A;  4KTA A;  1SDF A;  3W5O A;  5M5X B;  3I72 A;  1NUC A;  1F9Q A;  2Z4I A;  3ND9 A;  1PMR A;  1JWS D;  2F0M A;  4ZK9 B;  1Q46 A;  1DD2 A;  3K58 A;  3AU7 A;  1STG A;  3K80 C;  4A3E H;  3JAM c;  4DF7 A;  1AEX A;  4JI6 Q;  5GQO A;  1X9N A;  1EY9 A;  3H6M A;  1KNE A;  4YHH L;  3HOZ G;  1S5D D;  3L9A X;  3T1H Q;  2F03 A;  4A3K G;  5E7N A;  4EX5 A;  5DNF A;  1EYA A;  2JA5 B;  1CKN B;  1EY4 A;  3R3O A;  3MFY A;  3IRB A;  1SAP A;  3I55 A;  1GHJ A;  2NZH A;  2XGT A;  4ZRZ A;  2F3W A;  2VUM G;  1E3P A;  3RLF A;  3VR2 A;  4DV4 Q;  1U9R A;  3H3V H;  3RUZ A;  1PTO F;  2JEA I;  1PDQ A;  3K5M A;  4CJ1 B;  3SK5 A;  2EPB A;  4KD4 A;  1RJT A;  5FKA C;  2B2T C;  2GVB A;  4DR1 L;  1PHJ A;  3T1Y L;  2PNR C;  2N8N A;  1FNV A;  1YVC A;  2CH4 A;  3LX0 A;  2F0N A;  4RG1 A;  1PA6 A;  1JB3 A;  3PV0 A;  2XTI A;  3S1N B;  1TWG H;  1U5K A;  3MXN A;  2XVS A;  5HY6 A;  4XYO A;  3QIA A;  1ICF B;  3B6Y A;  1PZI D;  3GTQ B;  1LUZ A;  2K52 A;  4PQX A;  3STB D;  2E2H B;  4A3C H;  4BY1 B;  3GTJ H;  1EIY B;  1WCM H;  4DV5 Q;  1IBK L;  3NWT A;  2J4X A;  3WOE A;  3CQZ B;  1PZJ D;  2LFN A;  1NCV A;  2XWJ B;  3K81 C;  2JA7 H;  2E2J B;  3LWE A;  1KDB A;  4DR2 Q;  2GN5 A;  3SE0 A;  4CKE A;  1SYC A;  5I2X A;  3GTM H;  4A3C G;  2VQE Q;  5IGE A;  5I6Y A;  3U9O A;  4YCV A;  3UI2 A;  1HNW Q;  1WCM G;  1C0A A;  3BJU A;  4ZAI A;  1TT2 A;  1S40 A;  4HCS A;  3A5U A;  5EPK A;  3WOF A;  1KIX A;  2R92 H;  1H9S A;  3O13 A;  4RGM A;  3CCS A;  2K5H A;  1JCK B;  3G4S A;  5IGG A;  2M9V A;  1C7Y A;  1XMQ L;  5M5W H;  2B63 H;  1A6X A;  3FKI B;  3OTO Q;  2NYZ D;  2BA1 A;  5BN5 A;  5IGD A;  3NPP A;  1JWU D;  4JPB W;  2OTL A;  1R4P B;  2A1A A;  1HQM C;  1Y14 B;  2A6E D;  2L5T A;  2ZXO A;  4MZ9 A;  1Y69 U;  1STH A;  1LTL A;  2RF4 A;  1YNN C;  1Q90 A;  1SJH D;  1L0W A;  3CPF A;  4FF3 A;  5IYC H;  3R93 A;  3OYY A;  1HH2 P;  3KUP A;  2R93 B;  4JG2 A;  4LNQ A;  2NVT B;  2E2D C;  4NB3 A;  4QIW B;  1WFQ A;  5EPJ A;  1SYF A;  2MJ8 A;  2YU9 H;  3C3L A;  5DM7 3;  1Q82 C;  5C3E B;  4K5X A;  1KDC A;  5COR A;  4A3G H;  2K01 A;  4RFB A;  1VMC A;  4GLA C;  1WD0 A;  3MXU A;  1D5Z C;  1OTC A;  5KNC A;  1F77 A;  2UUA L;  2N49 A;  5CYU A;  3IFT A;  1LTB D;  1TVX A;  3TS0 A;  4OEM B;  5EAY A;  4IFD I;  2HUG A;  4QY7 A;  1SE3 A;  1SFO H;  3KJP A;  4A3G G;  4DV0 L;  2J7Z A;  3F8T A;  5D65 A;  2JA6 H;  2RDF A;  4P75 A;  1IBM Q;  5A2Q E;  5HGQ A;  5I6W A;  4HJ8 A;  3CU7 A;  3I8Z A;  3S1R H;  1XPU A;  3I4L A;  4OWX B;  3KFU A;  1X3F A;  4TVA B;  2PZW A;  1UWV A;  1U0L A;  2WIN B;  2HIV A;  2D62 A;  5EGT A;  2E2I B;  4LFB Q;  2WAC A;  1F2Z A;  4B3S L;  2JA6 G;  2ZTC A;  2PW7 A;  1LM0 A;  3E9H A;  5JOB A;  2G9D A;  3I4N H;  3PIO A;  4J1M A;  4M8A A;  4GNX B;  1QZH A;  1B9M A;  4LF7 Q;  1WD1 A;  3DWA A;  3E9I A;  1WTH A;  4LFC L;  1MKH A;  1A2T A;  2ZJP A;  1X54 A;  4DR7 L;  2UXC Q;  3HS0 C;  1J8I A;  3PIP A;  1V1O A;  5DAU A;  2F0W A;  4F88 A;  5IWA L;  3MC0 B;  1FL0 A;  4JI7 L;  5G3L D;  4LUV A;  1TWF H;  3I91 A;  5EPL A;  3K7A H;  3J7Z C;  3CCV A;  4NXM Q;  4IPC A;  1GD7 A;  3RN5 A;  3QG1 A;  5EBD A;  4YWL A;  2MUY A;  3CCU A;  4Q0F A;  1UEA B;  4DR5 Q;  4A3M G;  4RGN A;  3NSW A;  1Z47 A;  2OXP A;  3K5O A;  2IX3 A;  3UDI A;  4IPD A;  1DOM A;  1I4P A;  4EGV A;  2QDB A;  4OWW B;  1LTR D;  4X66 L;  5EKL A;  4QIW E;  4RKB A;  4CKC A;  1YJW A;  5GAH C;  1STN A;  1EIF A;  4HIK A;  2ES2 A;  1PVO A;  2NVQ B;  1TII D;  4NW2 A;  1BBW A;  1PFN A;  1XMO L;  3TP7 A;  5NUC A;  1EU4 A;  4Y52 H;  4EQP A;  5ELE A;  3A0J A;  2GA4 B;  2UXB L;  1O7I A;  4DV1 L;  1QVF A;  2N88 A;  2UUB Q;  3PO3 H;  3V05 A;  2NVX B;  4HID A;  1DZ1 A;  1BF4 A;  1QE6 A;  2PZU A;  3LGJ A;  2F0K A;  5ELF A;  1E1O A;  4X62 L;  4ZUI A;  2JA8 B;  4OO1 I;  1I4X A;  4HED A;  4A3B B;  3AMU A;  1XNQ L;  1UE7 A;  1SNQ A;  4WJW A;  1TY0 A;  3PO3 G;  2XRQ D;  3NE5 B;  4GN5 A;  3SXH A;  1HNZ L;  2NWG A;  2PQA B;  5F2D A;  2ICE C;  1HXY D;  2EYL A;  4BBR H;  3Q8D A;  4ZUJ A;  1JE5 A;  1EZ8 A;  3DEO A;  4AQY Q;  3H0G B;  1I5F A;  1YJN A;  1VQP A;  5GAE C;  4LF9 Q;  1B4O A;  3PGZ A;  1C9O A;  3PQI A;  4C2M H;  4P72 A;  4BBR G;  4A3J H;  2Z6K A;  1PTO D;  4PZ7 A;  4AH6 A;  1K0S A;  3FVQ A;  3CCL A;  1QUQ B;  4R8N A;  2UU9 L;  3UDG A;  4LF5 L;  3CW2 C;  4X3U A;  1EWC A;  1SMY C;  3VYT A;  5J1Z A;  2VL6 A;  3HRZ C;  4XYQ A;  2M2L A;  2A69 C;  2P5Z X;  1XNR Q;  3P1H A;  3KDF A;  4B9W A;  1V8Q A;  4XT3 B;  1M8A A;  4IUT A;  4GZY C;  1WTP A;  2DJG C;  2PQE A;  4B9X A;  1TWH B;  1SYE A;  3HKS A;  4PZ6 A;  3BDO A;  1BNZ A;  1J5E Q;  1PYB A;  1HR0 Q;  2A19 A;  3BYT B;  4X64 Q;  4DR3 L;  4H13 C;  1AE2 A;  4PG3 A;  1SNC A;  3OWE B;  1VQA A;  3TP5 A;  1EFW A;  3FPU B;  5JJZ A;  3TME A;  2OQK A;  2MO0 A;  4HSP A;  2MO1 A;  2VB2 X;  1RDP D;  1HZA A;  2E2H H;  1HUN A;  4JBJ A;  1Y1V H;  4HN7 A;  4NMZ A;  2EYP A;  2R3Z A;  3NEN A;  3ICE A;  4IUV A;  2XRS D;  1PV4 A;  3EVQ A;  4X65 L;  2NZO A;  3SEB A;  4DUY Q;  2R7Z B;  1PH8 A;  1GJX A;  4ZLT F;  3J7A 5;  2E2J H;  2JJQ A;  4GKK Q;  4LFA Q;  2FJ2 A;  1ROD A;  2FFK B;  4IO9 A;  2YYZ A;  3S17 H;  3FPP A;  3P20 A;  5E4X A;  4BY1 G;  1MSH A;  1JWM D;  1YIJ A;  3KF8 A;  4WRD A;  5I2Y A;  3V96 A;  4JI3 Q;  2F4V Q;  1YHA A;  2L12 A;  4NXN L;  4QF4 A;  1I50 B;  1PH9 A;  3RMH A;  3E3X A;  1UAP A;  1HNX Q;  4IN3 A;  2BA0 A;  3J81 c;  5HGT A;  1N34 Q;  2NUC A;  1S72 A;  5JEA J;  1SE8 A;  2I5H A;  3RZD B;  1XPO A;  1E0B A;  1BOS A;  1Q3L A;  1KC8 C;  3C46 A;  3I4O A;  1QIL A;  4ZKC B;  1O7Y A;  4L8J A;  3ER0 A;  1H9S B;  3T4A C;  3GTO H;  4FF1 A;  4LK1 C;  1LAB A;  3RZO H;  4NKL A;  4KK7 A;  4R4Q A;  4HIO A;  4FO2 A;  1EWI A;  4BA2 I;  1K8O A;  1EOT A;  2F3V A;  2AUK A;  5KRU A;  5AJ3 Q;  3PUW A;  2B8G A;  3TDQ A;  3TZD A;  3ULL A;  3M85 A;  4IFD H;  3S1M H;  4K8J A;  1LTS D;  5IE8 A;  4DN4 M;  4ID6 A;  1AW7 A;  5C3E H;  1EIG A;  1OXU A;  4FXG C;  2K1B A;  4LJZ C;  4N8X 1;  2BOS A;  4DFA A;  4PMW A;  4B3T L;  5K36 H;  2K5V A;  3EA6 A;  2R93 G;  2HQL A;  4DR4 L;  1CK1 A;  5E3F A;  3FEW X;  2NBF A;  3S16 H;  4IFD G;  2R6G A;  3KBX A;  4KHV A;  2NTS A;  5C3E G;  1GO3 E;  3L3O C;  1IYJ B;  4YIJ A;  4QCL A;  3MVV A;  3VR5 A;  2MFI A;  5CMD A;  5K5P A;  1A3T A;  4NPS A;  3OIP A;  1RCV D;  5CBE E;  5IT9 L;  4JOI C;  2HIX A;  4UP8 A;  1EY5 A;  3T56 B;  2VQF Q;  4JI1 Q;  3DMU A;  4DAY A;  3A7L A;  1B70 B;  2H4O A;  2ZM6 Q;  4JBM A;  3QOJ A;  1OXV A;  2OWO A;  2R7F A;  1K28 A;  2IW3 A;  4M1U B;  3PMF A;  3GTP B;  1CI3 M;  1I4H A;  1D2B A;  1YEZ A;  3CC2 A;  2AHO B;  4X6A H;  5CV8 A;  3CAM A;  5C44 B;  2HT1 A;  1T5E A;  2XSC A;  3M4Y A;  3HKZ E;  2F0Q A;  3GQB A;  4XQJ A;  3U50 C;  1TQO A;  4L6T B;  4HJ7 A;  4JI2 Q;  4DK6 C;  5FO9 B;  1VQJ A;  4XQN A;  1Q86 C;  3F1Z A;  3CC4 A;  2VNU D;  4UAI A;  2A68 C;  4K14 A;  5IP9 H;  1EQT A;  5I9O A;  2K75 A;  5EKK A;  1STA A;  1HQR D;  1TR5 A;  4EQN A;  1JOQ A;  4A3D H;  1M90 C;  1O7L A;  3VA5 A;  1I3Q H;  1R9T B;  3S1Q B;  3K6O A;  4B3R Q;  1VQH A;  3S2D B;  1PLF A;  2R7D A;  3I70 A;  5D3I B;  1V43 A;  2EJM A;  1LO5 D;  5IP9 G;  1DON A;  3A8J E;  1VQN A;  4ALP A;  4AYB B;  4C3J H;  3I4M H;  2ZTE A;  4FVM A;  3HGB A;  5FLM H;  4QUC A;  2RSN A;  3DWQ A;  4CJ0 B;  4PMC A;  1PYS B;  1XYI A;  2SOB A;  2O2L D;  2TSS A;  3S2H H;  1CKM A;  3CKI B;  3NBH A;  4DR6 L;  4OO1 G;  5IGB A;  5A35 A;  2N78 A;  2R61 A;  4A3B H;  1DOK A;  5T1I A;  5FLM G;  2WV6 D;  2EXZ A;  4B3M Q;  1E22 A;  4H0L C;  1CFM A;  2HCI A;  2SDF A;  5FLX c;  4LF4 Q;  1XWE A;  1CZW A;  2EY2 A;  1OXT A;  2K04 A;  1X56 A;  3DM3 A;  5FO7 B;  3ERO A;  2EIF A;  1Q1E A;  5M3F B;  2K03 A;  2JA8 G;  1YIT A;  3GV3 A;  4A3B G;  1VQM A;  3C2P A;  2YTY A;  2EQS A;  2H1E A;  1U4M A;  2WKC A;  5T1G A;  2QGQ A;  3HOZ H;  1AH9 A;  2B2U A;  2JSO A;  1MGS A;  5J22 A;  4HTH A;  5IP7 H;  3FDT A;  3A74 A;  5M3M B;  2NVY B;  2QIL A;  2IWH A;  2VUM H;  2Q8R E;  1VQ8 A;  4N9T A;  4L63 B;  1NSN S;  4GN3 B;  2LS0 1;  2WFW A;  1BUV T;  4FXD A;  5AFW A;  4YY3 Q;  1SR3 A;  1KLG D;  2K5N A;  5IP7 G;  1CHP D;  4DXF A;  2DGY A;  1NBW A;  4N8F A;  2F1M A;  4LF8 L;  4G7H C;  2PPB C;  3W3A A;  2PZT A;  2I07 B;  1HFN A;  3HOU B;  1NMG A;  4KHP Q;  2HHH Q;  1ENC A;  2LSS A;  1KAA A;  2JXM B;  4A76 A;  1V9P A;  4DV7 Q;  3TBI B;  4IPH A;  3HOY H;  4KJO A;  1KHI A;  4TSS A;  3I7F A;  3S14 H;  1C4Q A;  4POG A;  3KDF B;  2L4N A;  3GV6 A;  2A6H D;  1ZXT A;  2KEN A;  1EQQ A;  5KGU A;  4AYB E;  1ICW A;  3C1F A;  3C1E A;  5LMN L;  3PUY A;  1QWY A;  3TS2 A;  1Q8K A;  1EY6 A;  4Y7N B;  5LL6 S;  4JI4 L;  2JYO A;  4I7A A;  3HOY G;  2KHS A;  1Z7T A;  3SGI A;  1K8G A;  1MBY A;  3CXC A;  4C3I H;  2EXD A;  1W2B A;  2R7Z H;  2FIN B;  5JJK A;  3GTL B;  5C4Z A;  1R4Q B;  4CBV A;  1U4L A;  4ZCK A;  5ELO A;  2LXK A;  4RKL A;  1B44 D;  2UXD L;  4G57 A;  2F0G A;  1WTO A;  1BCP F;  3STB C;  4DUZ L;  4J8Q A;  3L7Z C;  4C3I G;  2R7Z G;  1JJC B;  2HDM A;  2DNC A;  3E6Z X;  2RA4 A;  1PRT F;  4JI0 Q;  2HDL A;  4GKJ L;  4AIM A;  1A8V A;  5BR8 L;  1EWH A;  1DCZ A;  1Q8I A;  4DU9 A;  2EJF C;  4KD3 A;  3RZD H;  1WOC A;  2OCE A;  2VS1 A;  3KF8 B;  1PTO B;  4DAP A;  3BZD B;  4GOP B;  1PH4 A;  1HRJ A;  1DYQ A;  1IKL A;  4ZYS A;  1SRU A;  3GTK H;  3MAQ A;  1X3Q A;  3PCO B;  4R4T A;  5COY A;  3HKZ G;  1Q81 C;  1KNA A;  1QNK A;  3RLO A;  4OGQ C;  2M00 A;  1A15 A;  4RHR A;  1HTL D;  2CCZ A;  3PUZ A;  4O42 A;  1GUW A;  1A63 A;  5C4J H;  1D1I A;  2A6E C;  3IKJ A;  1N9W A;  4OX9 Q;  5C3W A;  2EYJ A;  5JVH 3;  5C4H A;  1BBU A;  4DV3 L;  2JEB I;  3MZ5 A;  2B2V C;  1X3G A;  2K5W A;  1L1O B;  4JI5 L;  5C0X J;  1I94 Q;  2Q2H A;  2KOL A;  4K2L A;  4KKU A;  4P2C B;  3JAM L;  1FVI A;  3CD6 A;  1SNM A;  3A55 A;  3HOX B;  2Q8I B;  1TXY A;  1CUK A;  1X55 A;  3A5Z B;  1LT4 D;  4A93 H;  1TS3 A;  2VZA A;  2D2C C;  4DV2 Q;  3HOW H;  2XNA C;  1ONL A;  4JI6 L;  1CSQ A;  1UEB A;  3NXW A;  1QCB D;  1YNJ D;  3T1H L;  2CWP A;  1OXX K;  2KVM A;  2NZ1 D;  3HEJ A;  3W1B A;  3RN2 A;  3ONA B;  4YWK A;  4I65 A;  1N33 Q;  3QOL A;  2A74 C;  4A93 G;  3EIV A;  1VQD A;  1GKH A;  2HCC A;  3CC7 A;  4IOC A;  3HOW G;  1Y8P B;  2I5M X;  2L1B A;  1MSG A;  3Q6S A;  4XT1 B;  4DV4 L;  4UY8 C;  2VW9 A;  4BY7 B;  4A4I A;  5DM6 3;  1QNU A;  3DM1 A;  1GUN A;  1JQY D;  4C3H B;  3CCR A;  4DAY B;  5M5Y B;  2VXW A;  4V0B A;  3PUV A;  2RQX A;  4A3M H;  3CPW A;  1E2W A;  2I46 A;  3K5N A;  2BE5 D;  1FJG Q;  1K83 B;  3PO2 B;  1CHQ D;  2DNE A;  3A8I E;  4EQO A;  3X3N A;  1QJO A;  4ME5 A;  5LMU Q;  1CA6 A;  1G6Z A;  1B3A A;  5IYB G;  5C4X B;  5FO8 B;  3CHB D;  1NNX A;  5IT9 E;  1WI5 A;  2FMM A;  2B39 A;  2EYM A;  2UUC Q;  4DV5 L;  4ULL A;  3K0Y A;  4LUO A;  2WII B;  4HR7 B;  3T51 B;  4F7X A;  3BVG A;  3M4O H;  4MN3 A;  4DR2 L;  2OQ0 A;  2BH8 A;  4OL7 A;  2KHJ A;  1VS0 A;  1B3Q A;  1GOZ A;  4IQZ A;  2VQE L;  4LF6 Q;  1F2M A;  2YTX A;  1IBL Q;  1HNW L;  1W6K A;  3G6E A;  4CGY B;  1NAP A;  1GVP A;  4DA2 A;  5JEA H;  4CKB A;  4JV5 Q;  3M3Y B;  2MNA A;  3PF4 A;  3EJI A;  1MJC A;  2Z6K C;  3OW7 A;  1NE3 A;  4O2D A;  1EOV A;  1TS2 A;  4ABN A;  4H02 A;  3KJO A;  4AYB G;  4G4K A;  4TKO B;  2D5D A;  1VF7 A;  1RKN A;  4HJ5 A;  4V19 0;  3MWY W;  3OTO L;  1PFS A;  3JAM i;  1VQL A;  1JJG A;  2GVA A;  3VR4 A;  3MEF A;  5JEA G;  4IJH A;  1MJE A;  1IKM A;  3KLR A;  4PZ8 A;  1SN8 A;  2Z9H A;  4FNF A;  4P73 A;  3NBH B;  3QO2 A;  1Q1B A;  3E0J A;  3URY A;  3EFX D;  2BDN A;  1N32 Q;  1JOO A;  1EYC A;  2X69 A;  4CDD C;  1SNO A;  2FXQ A;  1TWA B;  3S15 B;  5FJ8 H;  3CP0 A;  5JJI A;  4KY7 A;  5M5X H;  2WP8 J;  3NTI A;  1RF2 D;  5M3F G;  1GUG A;  1G2S A;  2CHB D;  2F0S A;  2RCF A;  3VYR A;  2XN9 C;  3D4R A;  1HA5 A;  1JR0 D;  1VQI A;  4ZQ3 A;  2K6A A;  2RBM A;  3TP8 A;  5FJ8 G;  5H1S E;  2F0P A;  2JA5 H;  1HTP A;  3BVZ A;  1B1Z A;  2LKV A;  5M3M G;  2C5C A;  4A3K B;  1XJV A;  4PNY A;  1DM0 B;  5KEE A;  1JE4 A;  2QW7 A;  5C0X I;  4FDB A;  2IT1 A;  4E6I A;  3EQL C;  3J80 E;  3BG3 A;  4LUZ A;  5HUR A;  1IBM L;  2XWB B;  2PI2 A;  4JC0 A;  4OIK A;  4C1N I;  1PTO C;  4KY5 A;  4K0K Q;  2CQO A;  4A3E B;  1T9H A;  5CBA E;  2B2W C;  2O4X A;  2JA5 G;  4JI8 Q;  1U4R A;  3BZC A;  2WAQ B;  3R2T A;  2E5L Q;  2KUM A;  2QF7 A;  3D0F A;  4XIG S;  4LFB L;  3R8B A;  3KLS X;  1I6H B;  3MHB A;  4ZKB B;  2IHE A;  1YJ9 A;  2RCN A;  5C5M A;  2I5L X;  5KND A;  1STE A;  4K5V A;  3S1N H;  3HOV B;  3KOJ A;  3ITP A;  1IYU A;  5C6A A;  2F0D A;  3PSI A;  4IUU A;  4LF7 L;  3VYU A;  3GTQ H;  2UXC L;  1BQQ T;  1BCP D;  1ZYR C;  4BY1 H;  1GUT A;  4RCN A;  2OT2 A;  3GTG B;  5IIF A;  1N36 Q;  2AWO A;  4R9W A;  3PUX A;  4KY6 A;  2G5D A;  4NXM L;  3CQZ H;  5GAD C;  1X3E A;  1PRT D;  4ILW A;  3AQQ A;  1L2F A;  3VYS A;  2E76 C;  1EY8 A;  1X65 A;  1TWG B;  4JYA Q;  1LLR D;  4IPG A;  1ASZ A;  2IL8 A;  4CDC C;  1CT1 D;  4DR5 L;  4BS9 A;  1VQF A;  3J7A V;  2CQA A;  2OF1 A;  2F0V A;  3PF5 A;  3BYY B;  3NEM A;  2CW0 C;  3GTJ B;  4JCV E;  4GOP A;  3P7J A;  1HZ9 A;  3GP7 A;  3K8A A;  1K73 C;  1HHV A;  2TMP A;  1D6E C;  1OO9 B;  3FP9 A;  1SND A;  2JA7 B;  3FKI H;  5FK9 C;  1Z6H A;  4JBK A;  2SNS A;  1C8C A;  1W3S A;  1K8M A;  3GTM B;  3K57 A;  2ALY B;  1S5B D;  1M1K C;  1F9R A;  2UUB L;  2RHQ B;  5LMN W;  2JN4 A;  2NN6 I;  4GNX C;  2R92 B;  2Q2T A;  5KYL A;  3FKI G;  3HZX A;  1X32 A;  3NEL A;  2K5Q A;  2EVB A;  4R4I A;  3MA2 B;  1H9K A;  2PW5 A;  5M5W B;  1L1O A;  4DV6 Q;  2B63 B;  2NVT H;  2AUJ D;  5CR3 A;  2R93 H;  1GHK A;  2RDH A;  3MTS A;  3GD7 A;  2KEE A;  1K9M C;  2L0C A;  2XIW A;  1FNW A;  2K33 A;  3V2T A;  2NTT A;  2JE6 I;  3W1G A;  2WAQ E;  3IL8 A;  1GUS A;  3KLW A;  3M4P A;  4LW1 A;  4NDX A;  2RDG A;  1NR4 A;  1PH1 A;  3UDX A;  2Y0S B;  1H9J A;  1L0X B;  4QGU A;  4AQY L;  2FMC A;  4R4O A;  1JJ2 A;  4KI0 A;  2Z6B A;  1FGU A;  2YU9 B;  4K5W A;  4LF9 L;  2J0T D;  4GLX A;  3BZK A;  1EY0 A;  4A3G B;  1V1P A;  3K7U C;  2F0I A;  1S3O A;  3UE1 A;  4YHH Q;  2VB3 X;  2E2I H;  1B9N A;  3KF6 B;  3TSS A;  2CH4 W;  2JP1 A;  3MFG A;  1IHZ A;  4QQB X;  1XNR L;  3KLS A;  1YHQ A;  4R1J A;  5KIX A;  1SFO B;  4JW0 A;  1S5F D;  5CGK A;  2JA6 B;  3LNN A;  1B8A A;  4BXX G;  3S1R B;  4L5Q A;  3EBE A;  4ME3 A;  3SK4 A;  5KNB A;  1J5E L;  3Q0A A;  1HR0 L;  3FRP B;  2KHI A;  2X6L A;  3VA7 A;  4DR1 Q;  4YWM A;  4X64 L;  3T1Y Q;  4BY7 G;  3JAM E;  1XTD A;  3SK6 A;  2WB1 B;  5ELB A;  1JMC A;  4XXE A;  3H91 A;  1SE2 A;  2KBN A;  3TN2 A;  3I4N B;  4IUR A;  1VCI A;  4C3H G;  4QJF A;  1LYL A;  3NQI A;  2JQO A;  4DKA C;  2L9H A;  4PMB A;  5JPM C;  1Q7Y C;  1YNX A;  4DUY L;  1TWF B;  1I4Q A;  1KXL A;  3K7A B;  1IBK Q;  4GKK L;  1NR2 A;  1AE3 A;  4LFA L;  3LWU A;  1E1T A;  2B2U C;  1I4R A;  1MIU A;  2K50 A;  4OO1 H;  4GS3 A;  2PCF B;  2NVQ H;  1DOL A;  1L0Y B;  3ERS X;  1CTM A;  4JI3 L;  2F4V L;  3G48 A;  3J81 L;  4A3I B;  1IW7 D;  2C9O A;  2DY7 A;  3QR8 A;  5IOD A;  2NVX H;  1B7Y B;  2Y0S E;  1K8A C;  3HFZ B;  1IL2 A;  2DN8 A;  1ML0 D;  1HNX L;  1KL9 A;  1H9R A;  4EVO A;  1T5X D;  2EYO A;  1N34 L;  4DK3 C;  4RH6 A;  3OW2 A;  1JC7 A;  4GLV B;  2JA8 H;  1AZP A;  2ZTD A;  1XMQ Q;  2JK8 A;  3ND8 A;  3J81 j;  2MGS A;  3S9W A;  2C35 B;  3OMC A;  3J80 L;  3I2Z A;  1VQO A;  2EZV A;  2WKD A;  1WTV A;  4FF2 A;  4Q5V A;  4KLK A;  2B8F A;  1LAC A;  2CFM A;  4Z9C B;  3TQY A;  1MHW C;  3PO3 B;  2K32 A;  4IJL A;  1SEB D;  2IX0 A;  1B50 A;  3QJY A;  4O0A A;  1V1Q A;  1JB7 A;  1VQE A;  4C56 C;  1FD7 D;  3ULP A;  4OHJ A;  1TWC B;  5AJ3 L;  1QVC A;  5C5L A;  5CV9 A;  1JOR A;  1PZK D;  4DNR B;  5BN3 A;  3H0G H;  5C0X H;  1SMX A;  1FYC A;  4K6L A;  2KCM A;  4YCU A;  1STY A;  3U9S A;  4QMG A;  1YHB A;  2EYF A;  5GRO A;  2RKS A;  4LWC A;  3I3C A;  1BO0 A;  1VQK A;  2IJ0 A;  1PH2 A;  1CA5 A;  1P8L A;  2WB1 E;  3H0G G;  5C0X G;  1HUM A;  3QWN A;  4RMF A;  2UUA Q;  3M7N A;  2N55 A;  1WTW A;  4KV6 A;  5IYD G;  1LT5 D;  3DUZ A;  2K4K A;  2BDO A;  1BVS A;  2DJF C;  4OWT B;  1HZB A;  4DV0 Q;  4U68 A;  2Z8L A;  5KYI A;  1NTG A;  4WOR A;  4WJ3 M;  4BBS B;  4C2M B;  2IHF A;  5ELN A;  2AQ1 B;  4HJA A;  1K3B C;  4A3J B;  3D6C A;  3X3M A;  1TWH H;  1ESR A;  2ENB A;  4G7O C;  5DLQ E;  2VQF L;  4JI1 L;  2B2Y A;  1I6H H;  3CMA A;  3D6W A;  2L55 A;  2ZM6 L;  5LL6 X;  1EFI D;  1S4Z A;  3HOV H;  1G29 1;  1LV9 A;  4A3E G;  3T13 A;  4B3S Q;  1WYD A;  2B3G A;  1FGB D;  5CV5 A;  2WAQ G;  2ZJR A;  1C48 A;  4I7Z C;  1RTO A;  5ELD A;  2F0U A;  5LHY 1;  2V4D A;  4JBW A;  4DXG A;  2Z1C A;  3J81 i;  1BR9 A;  3VR3 A;  3N6R A;  4LFC Q;  3GTG H;  3NP8 A;  4DR7 Q;  2KQ3 A;  1A3U A;  2A6H C;  3HOV G;  5IWA Q;  3RNU A;  3Q24 A;  1DXM A;  4IUQ A;  4JI7 Q;  3D4D A;  1QVG A;  1M4V A;  1QOH A;  3DHQ A;  1E2V A;  1HFG A;  1EQR A;  4JI2 L;  2F4I A;  4DAV A;  4S3S A;  3T16 A;  3J80 i;  2OEO A;  5I9P A;  1SXT A;  3RLN A;  3OSO A;  2A5H A;  2KED A;  1B2T A;  1A0I A;  5JVG 3;  1Y1V B;  4FP5 D;  3CME A;  1I50 H;  1LT6 D;  2NN6 H;  2LMC B;  3AFQ A;  4B3R L;  5CV7 A;  4DNI A;  4UP9 A;  1W6J A;  1SE4 A;  1ET6 A;  3M7G A;  4MTN A;  3UDF A;  1ENF A;  5EQ0 A;  2YV5 A;  4X66 Q;  3OOC A;  3TRE A;  1JOK A;  1SYG A;  4XTC S;  1JT8 A;  2V1C C;  3S17 B;  1AN8 A;  1IXR A;  5ISR A;  2AWN A;  2YTV A;  1Y1W B;  3ZYY X;  1BXT A;  1G8Z D;  2NN6 G;  1XMO Q;  4MHE A;  3BU2 A;  2UXB Q;  4DV1 Q;  1QB5 D;  5FLX L;  2JA7 G;  4HMJ A;  2ZT9 C;  2B2T A;  2Q8T A;  3DLL A;  1CM9 A;  2L11 A;  4F87 A;  2KCT A;  3A56 A;  2F3I A;  4X62 Q;  1EEF D;  1VQ5 A;  2HD3 A;  4B3M L;  1YNN D;  1B53 A;  4LF4 L;  3AB9 A;  4YCW A;  1GXD C;  1XNQ Q;  2F0O A;  3NK9 A;  4F8M A;  2R92 G;  3IAY A;  5M9O A;  5J39 A;  2BH2 A;  1KDA A;  4IOA A;  3GTO B;  2LY7 A;  3SHL A;  1HNZ Q;  5CV6 A;  2B63 G;  3RZO B;  3CCE A;  3F2D A;  4GN4 B;  1EZ6 A;  2PI2 E;  3GO5 A;  1EYD A;  1RL2 A;  1KD1 C;  4PV1 C;  4R8I A;  1BCP B;  2K7V A;  3K59 A;  5IGC A;  4IAL A;  3KF6 A;  1XTC D;  2CWA A;  3S1M B;  4J6H A;  1A2U A;  4CHT B;  1IYV A;  1ZEQ X;  3RD4 A;  3NBI A;  2Y0S G;  1PRT B;  3NTH A;  2D0O A;  2QDL A;  2QCP X;  2O5I C;  2F0F A;  4C1N K;  5IYC G;  4HJ9 A;  3P75 A;  4YY3 L;  2ZJQ A;  4H44 C;  2UU9 Q;  4LF5 Q;  1D1K A;  3S16 B;  1D8L A;  3NUC A;  1H95 A;  1KTK A;  1IL8 A;  1TU2 B;  2JA9 A;  1EL0 A;  1I4G A;  4OEL B;  1EY7 A;  1AP0 A;  1V1P B;  5ELC A;  2HHH L;  4KHP L;  1YNJ C;  4TRD A;  1ILP A;  4QB4 A;  1D7Q A;  2Z0S A;  4LMQ D;  2EY5 A;  1CZG A;  2QA4 A;  3GTP H;  2F0L A;  1J6Q A;  4DV7 L;  4A3F B;  1UE1 A;  4NP5 A;  1LTT D;  2PMZ B;  1STB A;  5C44 H;  5IYB H;  1SJE D;  1KRS A;  1KRT A;  1Z9F A;  3D3R A;  4DR3 Q;  4G7Z C;  2F52 A;  4XQQ A;  4KN7 C;  4DK0 A;  1LTI D;  4RHS A;  5C44 G;  3J7A F;  2L15 A;  3BVM A;  1S5E D;  4P71 A;  1KQS A;  2B2V A;  2WB1 G;  2BE5 C;  4DPG A;  4BWG B;  1R9T H;  3S1Q H;  2BCO A;  3I4N G;  3S2D H;  3HG9 A;  2PYK A;  1EU3 A;  3OWF A;  4X65 Q;  4A75 A;  4MNO A;  3AEV A;  5J3B A;  4CDF C;  2D0P A;  2NB0 A;  4DK1 A;  3Q23 A;  2RSO A;  4A3I H;  2I0Q A;  5C3X A;  1CSP A;  2Z4H A;  1OXS C;  5GAG C;  3T53 B;  3HP3 A;  4KMU C;  1TS5 A;  3WDN A;  4JI0 L;  4X3K A;  4A3D B;  4CDE C;  4HAE A;  4NXN Q;  2ATW A;  1BKB A;  3BS1 A;  1I3Q B;  1VF5 C;  1VDZ A;  3H09 A;  3VR6 A;  1XPR A;  2EYH A;  1UE5 A;  5EBC A;  4OXP A;  1SLJ A;  3N52 A;  2SNM A;  3IFD A;  3L2P A;  4A3I G;  1HZC A;  4MIU A;  1HR0 W;  4ODG A;  2QEX A;  4A3L H;  1PYW D;  4IUN A;  4C3J B;  3I4M B;  1AFP A;  1LT3 D;  4UP7 A;  4U67 3;  5M3F H;  3CRL C;  3S2H B;  1CQV A;  1PFB A;  1RD9 D;  3TEH B;  3I90 A;  3I73 A;  1PH3 A;  3D4W A;  1TWC H;  4A3L G;  4L5R C;  3AFP A;  1O7Z A;  4KKT A;  4K8I A;  4CJ2 C;  1F9S A;  3K0X A;  5M3M H;  3A7A B;  2N3S A;  3KYH C;  5IOC A;  1N8R C;  1SNP A;  4OX9 L;  2NVY H;  2PMZ E;  4L5T A;  3J81 E;  2CKZ B;  1G6P A;  2EY1 A;  4IUP A;  1I94 L;  1VQB A;  3W2D A;  4B3T Q;  2ZXR A;  4DR4 Q;  3A54 A;  1O80 A;  3HOZ B;  2FHT A;  1RTN A;  4R4C A;  1K0R A;  1CKN A;  3F2C A;  1SMY D;  2EY6 A;  4DV2 L;  2K14 A;  3OMG A;  1CKO A;  3HOU H;  4K6D A;  2A69 D;  1SSO A;  1TS4 A;  4BBS H;  2H5X A;  1TY2 A;  1PFM A;  2VUM B;  3NTK A;  2EE1 A;  4GOP C;  1XXG A;  1EUJ A;  4HCE A;  1N33 L;  3D31 A;  1WJJ A;  2MPM A;  1F9P A;  1SBB B;  5IT9 c;  3HOU G;  3R2I A;  4KHZ A;  4BBS G;  3L0O A;  4Y7N H;  3DEP A;  4BA1 I;  4A3J G;  1P16 A;  3RR5 A;  1HCZ A;  1G91 A;  2SEB D;  1UUP A;  1E7Z A;  1H9M A;  3E5S A;  3SK8 A;  3D8G A;  3CRK C;  1NY4 A;  1ZYR D;  1MD2 D;  3HOY B;  2IX1 A;  1IZ6 A;  5TSS A;  2K5D A;  4OIJ A;  3S14 B;  3GTL H;  1FJG L;  3M4Q A;  2IPK D;  1SYB A;  3BDC A;  1PH6 A;  4H7B A;  1L1O C;  1UNS A;  3G7L A;  4UDU C;  1VQG A;  3H3V I;  2Q2I A;  1BCP C;  1DJR D;  5LMU L;  5JJL A;  4P74 A;  2UUC L;  1RHP A;  4RA8 A;  3WWV A;  1E24 A;  1D5X C;  1PRT C;  1GUO A;  1VQ9 A;  1WCM B;  3PIO 3;  5EJW A;  3ZJY C; 
#chains in the Genus database with same CATH homology
 4C3I B;  2CW0 D;  2K28 A;  4RWS C;  3TZU A;  3DXJ C;  1ILQ A;  1ET9 A;  1PTO H;  3PIP 3;  2PO4 A;  4LAA A;  1A3V A;  2A73 B;  1VMP A;  2AQ3 B;  5D14 A;  2QKI C;  1ESF A;  1HPC A;  2B2W A;  4DGZ A;  1BBX C;  1X3P A;  5JPN C;  4FF4 A;  4HMI A;  3HKZ B;  2ZXP A;  4FXK C;  1F2L A;  4RGO S;  5A2Q L;  1CQF A;  5E4W C;  4K2K A;  3OIQ A;  3GTK B;  1U4P A;  3OHX C;  1AZQ A;  2KCN A;  2KCC A;  1SYD A;  2F0H A;  3NHH A;  2E74 C;  3NWS A;  3A8K E;  3FMC A;  4TQU S;  1WVL A;  3QB3 A;  5C4J B;  4KN4 C;  2G9H D;  4DNT B;  1F2Y A;  4KKS A;  2RVL A;  4JK1 C;  3DWP A;  5D3D A;  1EQV A;  4WFN 3;  5FLX E;  3F2U A;  2F0E A;  1TKW B;  1J9O A;  1FNU A;  1WTX A;  2CVR A;  3KBG A;  1Q12 A;  3SDZ A;  4A93 B;  1KLU D;  1QG7 A;  5K36 G;  3HOW B;  5JAV A;  4KJN A;  2ICI A;  1G2T A;  1LTA D;  1II3 A;  1O78 A;  2O5J C;  3OPO A;  1LTG D;  3K5L A;  2EOT A;  3MEH A;  2F0T A;  3MXP A;  4IZ8 A;  2ID0 A;  2AQ2 B;  2MP1 A;  4FYD A;  1E2Z A;  1HA6 A;  1JIC A;  2A68 D;  2MHV A;  4RCO A;  1PXU A;  4A3M B;  2F0J A;  4O1N A;  2QEJ C;  3TP6 A;  1S5C D;  4X3T A;  3MXG A;  3J7Y W;  1BDO A;  5E1F A;  4RGT A;  3G6J B;  5BN4 A;  5G3L F;  1FR3 A;  2KEC A;  4B08 A;  1ZKO A;  2KJX A;  3SR1 A;  2DY8 A;  4HSV A;  3M4O B;  5CV4 A;  1WTQ A;  2HQE A;  4QUF A;  4N9P A;  1IW7 C;  1I6V C;  4X3S A;  1EIH A;  3ERQ A;  5IGF A;  3NQT A;  3H94 A;  2EDG A;  1Y8O B;  2EJG C;  5CC4 A;  3H3V C;  3KK7 A;  1XX8 A;  1Y8N B;  3SVM A;  2B2Y C;  3Q22 A;  1D5M C;  5I4D A;  4RAU C;  4C3J G;  2E75 C;  1KAB A;  5DEH A;  5EKI A;  1ENA A;  1MI2 A;  1WTR A;  2KA7 A;  2D9U A;  4IFD J;  3BDL A;  4XDX A;  2K05 A;  1EEI D;  5FOB B;  2X6G A;  4BBR B;  4KTA A;  1SDF A;  5M5X B;  3I72 A;  1NUC A;  1F9Q A;  2Z4I A;  3ND9 A;  1PMR A;  1JWS D;  2F0M A;  4ZK9 B;  1DD2 A;  3K58 A;  3AU7 A;  1STG A;  4DF7 A;  1AEX A;  1EY9 A;  3H6M A;  1KNE A;  1S5D D;  3L9A X;  2F03 A;  5DNF A;  1EYA A;  2JA5 B;  1EY4 A;  3R3O A;  3MFY A;  1SAP A;  1GHJ A;  4ZRZ A;  2F3W A;  3RLF A;  3VR2 A;  1U9R A;  3RUZ A;  1PTO F;  2JEA I;  1PDQ A;  3K5M A;  4CJ1 B;  3SK5 A;  2EPB A;  4KD4 A;  1RJT A;  5FKA C;  2B2T C;  2PNR C;  1FNV A;  3LX0 A;  2F0N A;  1JB3 A;  3PV0 A;  3S1N B;  3MXN A;  2XVS A;  4XYO A;  3QIA A;  1PZI D;  3GTQ B;  4PQX A;  2E2H B;  4BY1 B;  3NWT A;  2J4X A;  3WOE A;  3CQZ B;  1PZJ D;  2LFN A;  1NCV A;  2XWJ B;  2E2J B;  3LWE A;  1KDB A;  3SE0 A;  4CKE A;  1SYC A;  5I2X A;  5IGE A;  5I6Y A;  3U9O A;  3UI2 A;  4ZAI A;  1TT2 A;  4HCS A;  5EPK A;  3WOF A;  1H9S A;  3O13 A;  4RGM A;  1JCK B;  5IGG A;  2M9V A;  1A6X A;  3FKI B;  2NYZ D;  2BA1 A;  5BN5 A;  5IGD A;  3NPP A;  1JWU D;  1R4P B;  1HQM C;  2A6E D;  2L5T A;  2ZXO A;  1Y69 U;  1STH A;  1YNN C;  1SJH D;  1Q90 A;  4FF3 A;  3R93 A;  3KUP A;  2R93 B;  2NVT B;  2E2D C;  4QIW B;  5EPJ A;  1SYF A;  2MJ8 A;  3C3L A;  5DM7 3;  5C3E B;  4K5X A;  1KDC A;  5COR A;  2K01 A;  4RFB A;  1VMC A;  1WD0 A;  3MXU A;  1D5Z C;  5KNC A;  1F77 A;  5CYU A;  3IFT A;  1LTB D;  1TVX A;  4IFD I;  2HUG A;  1SE3 A;  2J7Z A;  5D65 A;  2RDF A;  5A2Q E;  5I6W A;  3CU7 A;  3I8Z A;  3I4L A;  2PZW A;  2WIN B;  2D62 A;  5EGT A;  2E2I B;  2WAC A;  1F2Z A;  2PW7 A;  5JOB A;  2G9D A;  4J1M A;  4M8A A;  1B9M A;  1WD1 A;  3DWA A;  1A2T A;  1J8I A;  3HS0 C;  1V1O A;  5DAU A;  2F0W A;  4F88 A;  3MC0 B;  5G3L D;  3I91 A;  5EPL A;  3QG1 A;  5EBD A;  2MUY A;  4Q0F A;  1UEA B;  4RGN A;  3NSW A;  1Z47 A;  2OXP A;  3K5O A;  2IX3 A;  1DOM A;  1I4P A;  4EGV A;  2QDB A;  1LTR D;  5EKL A;  4RKB A;  4CKC A;  1STN A;  2NVQ B;  1TII D;  4NW2 A;  1PFN A;  3TP7 A;  5NUC A;  1EU4 A;  4EQP A;  5ELE A;  2GA4 B;  2N88 A;  3V05 A;  2NVX B;  1DZ1 A;  1BF4 A;  1QE6 A;  2PZU A;  2F0K A;  5ELF A;  4ZUI A;  2JA8 B;  4OO1 I;  1I4X A;  4HED A;  4A3B B;  3AMU A;  1SNQ A;  4WJW A;  1TY0 A;  2XRQ D;  3NE5 B;  3SXH A;  2NWG A;  5F2D A;  2ICE C;  1HXY D;  2EYL A;  4ZUJ A;  1EZ8 A;  3DEO A;  3H0G B;  1B4O A;  1PTO D;  3FVQ A;  4R8N A;  4X3U A;  1EWC A;  1SMY C;  3VYT A;  5J1Z A;  3HRZ C;  4XYQ A;  2M2L A;  2A69 C;  3P1H A;  4B9W A;  1V8Q A;  4XT3 B;  1M8A A;  4IUT A;  4GZY C;  1WTP A;  2PQE A;  4B9X A;  1TWH B;  1SYE A;  3BDO A;  1BNZ A;  3BYT B;  4H13 C;  1SNC A;  3OWE B;  3TP5 A;  3FPU B;  5JJZ A;  3TME A;  4HSP A;  2VB2 X;  1RDP D;  1HUN A;  4HN7 A;  4NMZ A;  2EYP A;  2R3Z A;  4IUV A;  2XRS D;  3EVQ A;  2R7Z B;  3SEB A;  1GJX A;  4ZLT F;  2FJ2 A;  1ROD A;  2FFK B;  2YYZ A;  3FPP A;  3P20 A;  5E4X A;  1MSH A;  1JWM D;  3KF8 A;  4WRD A;  5I2Y A;  3V96 A;  2L12 A;  4QF4 A;  1I50 B;  3RMH A;  1UAP A;  4IN3 A;  2BA0 A;  5HGT A;  2NUC A;  5JEA J;  3RZD B;  1E0B A;  1BOS A;  1Q3L A;  3C46 A;  1QIL A;  4ZKC B;  1O7Y A;  4L8J A;  1H9S B;  3T4A C;  4FF1 A;  4LK1 C;  1LAB A;  4NKL A;  4KK7 A;  4FO2 A;  4BA2 I;  1K8O A;  1EOT A;  2F3V A;  2AUK A;  5KRU A;  3PUW A;  2B8G A;  3TDQ A;  3TZD A;  3M85 A;  4IFD H;  4K8J A;  1LTS D;  4DN4 M;  4ID6 A;  1AW7 A;  1EIG A;  1OXU A;  4FXG C;  2K1B A;  4LJZ C;  2BOS A;  4DFA A;  4PMW A;  5K36 H;  3EA6 A;  1CK1 A;  5E3F A;  3FEW X;  2NBF A;  4IFD G;  2R6G A;  3KBX A;  4KHV A;  2NTS A;  3L3O C;  4YIJ A;  4QCL A;  3MVV A;  3VR5 A;  5CMD A;  5K5P A;  1A3T A;  3OIP A;  1RCV D;  5CBE E;  5IT9 L;  1EY5 A;  3T56 B;  3DMU A;  4DAY A;  3A7L A;  2H4O A;  3QOJ A;  1OXV A;  2IW3 A;  4M1U B;  3PMF A;  3GTP B;  1CI3 M;  1I4H A;  1D2B A;  5CV8 A;  5C44 B;  1T5E A;  2XSC A;  3M4Y A;  2F0Q A;  3GQB A;  4XQJ A;  1TQO A;  4L6T B;  5FO9 B;  4XQN A;  2VNU D;  4UAI A;  2A68 C;  4K14 A;  1EQT A;  5I9O A;  5EKK A;  1STA A;  1HQR D;  1TR5 A;  4EQN A;  1JOQ A;  1O7L A;  3VA5 A;  1R9T B;  3S1Q B;  3K6O A;  3S2D B;  1PLF A;  3I70 A;  5D3I B;  1V43 A;  2EJM A;  1LO5 D;  1DON A;  3A8J E;  4AYB B;  4FVM A;  3HGB A;  4QUC A;  2RSN A;  3DWQ A;  4CJ0 B;  4PMC A;  1XYI A;  2SOB A;  2O2L D;  2TSS A;  3CKI B;  3NBH A;  4OO1 G;  5IGB A;  5A35 A;  2R61 A;  1DOK A;  5T1I A;  2WV6 D;  2EXZ A;  4H0L C;  1CFM A;  2HCI A;  2SDF A;  1XWE A;  1CZW A;  2EY2 A;  1OXT A;  2K04 A;  5FO7 B;  3ERO A;  5M3F B;  1Q1E A;  2K03 A;  3GV3 A;  3C2P A;  2H1E A;  1U4M A;  2WKC A;  5T1G A;  2B2U A;  2JSO A;  1MGS A;  5J22 A;  4HTH A;  3FDT A;  5M3M B;  2NVY B;  2QIL A;  2IWH A;  2Q8R E;  4N9T A;  4L63 B;  1NSN S;  2LS0 1;  1BUV T;  4FXD A;  5AFW A;  1KLG D;  1CHP D;  4DXF A;  2F1M A;  4G7H C;  2PPB C;  3W3A A;  2PZT A;  2I07 B;  1HFN A;  3HOU B;  1ENC A;  1KAA A;  2JXM B;  3TBI B;  4KJO A;  4TSS A;  1C4Q A;  2L4N A;  3GV6 A;  2A6H D;  1ZXT A;  5KGU A;  1ICW A;  3C1F A;  3C1E A;  3PUY A;  1QWY A;  1EY6 A;  4Y7N B;  5LL6 S;  2JYO A;  2KHS A;  1Z7T A;  1MBY A;  2FIN B;  3GTL B;  5C4Z A;  1R4Q B;  4CBV A;  1U4L A;  4RKL A;  1B44 D;  4G57 A;  2F0G A;  1WTO A;  1BCP F;  4J8Q A;  3L7Z C;  4C3I G;  2HDM A;  2DNC A;  3E6Z X;  2RA4 A;  1PRT F;  2HDL A;  1EWH A;  1DCZ A;  1Q8I A;  4DU9 A;  2EJF C;  4KD3 A;  1PTO B;  4DAP A;  3BZD B;  1HRJ A;  1DYQ A;  1IKL A;  4ZYS A;  3MAQ A;  1X3Q A;  5COY A;  1KNA A;  1QNK A;  4OGQ C;  2M00 A;  1A15 A;  4RHR A;  1HTL D;  3PUZ A;  4O42 A;  1GUW A;  1D1I A;  2A6E C;  3IKJ A;  5C3W A;  2EYJ A;  5JVH 3;  5C4H A;  2JEB I;  3MZ5 A;  2B2V C;  2K5W A;  5C0X J;  2KOL A;  4K2L A;  4KKU A;  4P2C B;  3JAM L;  1SNM A;  3A55 A;  3HOX B;  2Q8I B;  1LT4 D;  1TS3 A;  2D2C C;  2XNA C;  1ONL A;  3NXW A;  1QCB D;  1YNJ D;  3HEJ A;  1OXX K;  2KVM A;  2NZ1 D;  3ONA B;  4I65 A;  3QOL A;  2A74 C;  2HCC A;  1Y8P B;  2L1B A;  1MSG A;  3Q6S A;  4XT1 B;  4BY7 B;  5DM6 3;  1QNU A;  3DM1 A;  1GUN A;  1JQY D;  4C3H B;  5M5Y B;  2VXW A;  4V0B A;  3PUV A;  2RQX A;  1E2W A;  2I46 A;  3K5N A;  2BE5 D;  1K83 B;  3PO2 B;  1CHQ D;  2DNE A;  3A8I E;  4EQO A;  3X3N A;  1QJO A;  4ME5 A;  1CA6 A;  1G6Z A;  1B3A A;  5C4X B;  5FO8 B;  3CHB D;  5IT9 E;  2FMM A;  2B39 A;  2EYM A;  4ULL A;  3K0Y A;  2WII B;  4HR7 B;  3T51 B;  4F7X A;  3BVG A;  4MN3 A;  4OL7 A;  1GOZ A;  4IQZ A;  1F2M A;  1W6K A;  4CGY B;  1NAP A;  4DA2 A;  5JEA H;  4CKB A;  3M3Y B;  3EJI A;  3OW7 A;  1TS2 A;  4ABN A;  4G4K A;  4TKO B;  2D5D A;  1VF7 A;  1RKN A;  4V19 0;  3MWY W;  3VR4 A;  5JEA G;  1IKM A;  3KLR A;  4FNF A;  3QO2 A;  1Q1B A;  3E0J A;  3URY A;  3EFX D;  2BDN A;  1JOO A;  1EYC A;  2X69 A;  1SNO A;  1TWA B;  3S15 B;  4KY7 A;  2WP8 J;  3NTI A;  1RF2 D;  1GUG A;  1G2S A;  2CHB D;  2F0S A;  3VYR A;  2XN9 C;  3D4R A;  1HA5 A;  1JR0 D;  4ZQ3 A;  2K6A A;  2RBM A;  3TP8 A;  2F0P A;  1HTP A;  3BVZ A;  1B1Z A;  2LKV A;  2C5C A;  4A3K B;  4PNY A;  1DM0 B;  5KEE A;  1JE4 A;  5C0X I;  2IT1 A;  4E6I A;  3EQL C;  3J80 E;  3BG3 A;  5HUR A;  2XWB B;  4OIK A;  4C1N I;  1PTO C;  4KY5 A;  4A3E B;  5CBA E;  2B2W C;  2O4X A;  1U4R A;  2WAQ B;  3R2T A;  2KUM A;  2QF7 A;  4XIG S;  3R8B A;  3KLS X;  1I6H B;  3MHB A;  4ZKB B;  5C5M A;  5KND A;  1STE A;  4K5V A;  3HOV B;  3ITP A;  1IYU A;  5C6A A;  2F0D A;  4IUU A;  3VYU A;  1BQQ T;  1BCP D;  1ZYR C;  1GUT A;  4RCN A;  2OT2 A;  3GTG B;  5IIF A;  2AWO A;  4R9W A;  3PUX A;  4KY6 A;  1PRT D;  4ILW A;  3VYS A;  2E76 C;  1EY8 A;  1TWG B;  1LLR D;  2IL8 A;  1CT1 D;  4BS9 A;  3J7A V;  2CQA A;  2OF1 A;  2F0V A;  3BYY B;  2CW0 C;  3GTJ B;  3P7J A;  3GP7 A;  1HHV A;  2TMP A;  1D6E C;  1OO9 B;  1SND A;  2JA7 B;  5FK9 C;  1Z6H A;  2SNS A;  1C8C A;  1K8M A;  3GTM B;  3K57 A;  1S5B D;  1F9R A;  2NN6 I;  2R92 B;  5KYL A;  3HZX A;  1X32 A;  2K5Q A;  2EVB A;  3MA2 B;  1H9K A;  2PW5 A;  5M5W B;  2B63 B;  1GHK A;  2AUJ D;  5CR3 A;  2RDH A;  3MTS A;  3GD7 A;  2KEE A;  2L0C A;  2XIW A;  1FNW A;  2K33 A;  3V2T A;  2NTT A;  2JE6 I;  3IL8 A;  1GUS A;  4NDX A;  2RDG A;  1NR4 A;  2Y0S B;  1H9J A;  1L0X B;  2FMC A;  4KI0 A;  2YU9 B;  4K5W A;  2J0T D;  1EY0 A;  4A3G B;  1V1P A;  2F0I A;  2VB3 X;  1B9N A;  3TSS A;  2JP1 A;  3MFG A;  1IHZ A;  3KLS A;  5KIX A;  1SFO B;  1S5F D;  5CGK A;  2JA6 B;  3LNN A;  3S1R B;  3SK4 A;  5KNB A;  3Q0A A;  3FRP B;  2X6L A;  3VA7 A;  3JAM E;  3SK6 A;  2WB1 B;  5ELB A;  4XXE A;  3H91 A;  1SE2 A;  3TN2 A;  3I4N B;  4IUR A;  1VCI A;  4C3H G;  3NQI A;  2L9H A;  4PMB A;  5JPM C;  1TWF B;  1I4Q A;  3K7A B;  1NR2 A;  3LWU A;  2B2U C;  1I4R A;  4OO1 H;  2PCF B;  1DOL A;  1L0Y B;  1CTM A;  3J81 L;  4A3I B;  1IW7 D;  2C9O A;  2DY7 A;  5IOD A;  2DN8 A;  1ML0 D;  1H9R A;  4EVO A;  1T5X D;  2EYO A;  4RH6 A;  1JC7 A;  1AZP A;  3ND8 A;  2MGS A;  3S9W A;  3OMC A;  3J80 L;  2EZV A;  2WKD A;  1WTV A;  4FF2 A;  4Q5V A;  2B8F A;  1LAC A;  4Z9C B;  3PO3 B;  2K32 A;  1SEB D;  2IX0 A;  1B50 A;  3QJY A;  4C56 C;  1FD7 D;  4OHJ A;  1TWC B;  5C5L A;  5CV9 A;  1JOR A;  1PZK D;  4DNR B;  5BN3 A;  5C0X H;  1FYC A;  4K6L A;  1STY A;  3U9S A;  4QMG A;  2EYF A;  2RKS A;  3I3C A;  1BO0 A;  2IJ0 A;  1CA5 A;  5C0X G;  1HUM A;  3QWN A;  3M7N A;  2N55 A;  1WTW A;  4KV6 A;  1LT5 D;  3DUZ A;  2BDO A;  4U68 A;  2Z8L A;  5KYI A;  4WOR A;  4BBS B;  4C2M B;  2AQ1 B;  4A3J B;  3D6C A;  3X3M A;  1ESR A;  2ENB A;  4G7O C;  2B2Y A;  3D6W A;  2L55 A;  5LL6 X;  1EFI D;  1S4Z A;  1G29 1;  1LV9 A;  3T13 A;  1FGB D;  5CV5 A;  1C48 A;  4I7Z C;  1RTO A;  5ELD A;  2F0U A;  5LHY 1;  2V4D A;  4JBW A;  4DXG A;  2Z1C A;  1BR9 A;  3VR3 A;  3N6R A;  3NP8 A;  2KQ3 A;  1A3U A;  2A6H C;  3Q24 A;  1DXM A;  4IUQ A;  3D4D A;  1M4V A;  1QOH A;  3DHQ A;  1E2V A;  1HFG A;  2F4I A;  4DAV A;  4S3S A;  3T16 A;  2OEO A;  5I9P A;  1SXT A;  3OSO A;  2A5H A;  2KED A;  1B2T A;  5JVG 3;  1Y1V B;  4FP5 D;  1LT6 D;  2NN6 H;  2LMC B;  5CV7 A;  1W6J A;  1SE4 A;  1ET6 A;  3M7G A;  1ENF A;  5EQ0 A;  3OOC A;  1JOK A;  1SYG A;  4XTC S;  3S17 B;  1AN8 A;  5ISR A;  2AWN A;  1Y1W B;  3ZYY X;  1BXT A;  1G8Z D;  2NN6 G;  4MHE A;  1QB5 D;  5FLX L;  4HMJ A;  2ZT9 C;  2B2T A;  2Q8T A;  1CM9 A;  2L11 A;  4F87 A;  3A56 A;  1EEF D;  1YNN D;  1B53 A;  3AB9 A;  1GXD C;  2F0O A;  3NK9 A;  4F8M A;  3IAY A;  5M9O A;  5J39 A;  1KDA A;  3GTO B;  2LY7 A;  3SHL A;  3RZO B;  5CV6 A;  1EZ6 A;  3GO5 A;  1EYD A;  4PV1 C;  4R8I A;  1BCP B;  2K7V A;  3K59 A;  5IGC A;  4IAL A;  1XTC D;  3S1M B;  4J6H A;  1A2U A;  4CHT B;  1IYV A;  1ZEQ X;  3RD4 A;  3NBI A;  1PRT B;  3NTH A;  2QCP X;  2O5I C;  2F0F A;  4C1N K;  3P75 A;  4H44 C;  1D1K A;  3S16 B;  3NUC A;  1KTK A;  1IL8 A;  1TU2 B;  1EL0 A;  1I4G A;  1EY7 A;  1AP0 A;  1V1P B;  5ELC A;  1YNJ C;  4TRD A;  1ILP A;  4QB4 A;  4LMQ D;  2EY5 A;  1CZG A;  2F0L A;  4A3F B;  4NP5 A;  1LTT D;  2PMZ B;  1STB A;  1SJE D;  3D3R A;  4G7Z C;  4XQQ A;  4KN7 C;  4DK0 A;  1LTI D;  4RHS A;  3J7A F;  3BVM A;  1S5E D;  2B2V A;  2BE5 C;  4BWG B;  2BCO A;  3HG9 A;  2PYK A;  1EU3 A;  3OWF A;  2NB0 A;  4DK1 A;  3Q23 A;  2RSO A;  5C3X A;  2Z4H A;  1OXS C;  3T53 B;  3HP3 A;  4KMU C;  1TS5 A;  3WDN A;  4X3K A;  4A3D B;  4HAE A;  3BS1 A;  1I3Q B;  1VF5 C;  3VR6 A;  1VDZ A;  3H09 A;  2EYH A;  5EBC A;  3N52 A;  2SNM A;  3IFD A;  4MIU A;  4ODG A;  1PYW D;  4IUN A;  4C3J B;  3I4M B;  1AFP A;  1LT3 D;  4U67 3;  3CRL C;  3S2H B;  1CQV A;  1PFB A;  1RD9 D;  3I90 A;  3I73 A;  3D4W A;  1O7Z A;  4KKT A;  4K8I A;  4CJ2 C;  1F9S A;  3A7A B;  5IOC A;  1SNP A;  3J81 E;  2EY1 A;  4IUP A;  3W2D A;  2ZXR A;  3A54 A;  1O80 A;  3HOZ B;  2FHT A;  1RTN A;  1SMY D;  2EY6 A;  3OMG A;  4K6D A;  2A69 D;  1SSO A;  1TS4 A;  1TY2 A;  1PFM A;  2VUM B;  3NTK A;  2EE1 A;  1XXG A;  4HCE A;  3D31 A;  2MPM A;  1F9P A;  1SBB B;  3R2I A;  4KHZ A;  3DEP A;  4BA1 I;  1HCZ A;  1G91 A;  2SEB D;  1UUP A;  1H9M A;  3E5S A;  3SK8 A;  3D8G A;  3CRK C;  3HOY B;  1ZYR D;  1MD2 D;  2IX1 A;  5TSS A;  2K5D A;  4OIJ A;  3S14 B;  2IPK D;  1SYB A;  3BDC A;  4H7B A;  1UNS A;  3G7L A;  4UDU C;  1BCP C;  1DJR D;  1RHP A;  4RA8 A;  1D5X C;  1PRT C;  1GUO A;  1WCM B;  3PIO 3;  5EJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...