4ULLA

Solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA-LIKE TOXIN I SUBUNIT B
publication title Solution structure of the carbohydrate-binding B-subunit homopentamer of verotoxin VT-1 from E. coli.
pubmed doi rcsb
molecule tags Toxin
total genus 14
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1996-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ullA00
2BOSA 1QNUA 1DM0B 3MXGA 1D1IA 1D1KA 2XSCA 1BOSA 4ULLA 1R4PB 2C5CA 1CZWA 1C4QA 1R4QB 1C48A 4M1UB 4P2CB 1CZGA 1QOHA 2GA4B 1CQFA
chains in the Genus database with same CATH superfamily
1SNQA 3I56A 5M5XH 1YI2A 2JA5H 3S14B 4GKKQ 1WTHA 1CSQA 1XTDA 1SAPA 2B2VA 2F1MA 3AU7A 3CC4A 3EFXD 5NUCA 3GDEA 4POFA 4ALPA 3BDLA 3FKIB 1TQOA 4J6HA 4CJ2C 5M3FB 1C48A 1WTWA 4OWWB 4Y7NH 1B8AA 1K8GA 2XRQD 4ZUJA 3PV0A 4DN4M 2WKCA 3ZJYC 1VQ8A 1V1QA 2ZT9C 3EQLC 1DOKA 4LF5L 3MFGA 4LK1C 2B8FA 3EN2A 1FR3A 2JA7H 4TQUS 3KDFA 4BY1H 3KF8B 4JC0A 3OHXC 1H9SA 2JXMB 1RDPD 5ELNA 2FXQA 1SFOH 3M4OH 4IFDI 3SXHA 4EQOA 5M5WH 1BO0A 5T1GA 2EPBA 4DK6C 2MP1A 1TWAB 4LF4L 4AIMA 2QEJC 1O7YA 2QKIC 2F0GA 3BS1A 2I5LX 5E3FA 2C9OA 4DGZA 4CGYB 4RG1A 1PYWD 3HP3A 1HH2P 4M8AA 3TMEA 2B39A 3E5SA 2IHEA 1KTKA 2AHOB 2OQKA 3HOWG 1JJCB 1KRTA 4RGOS 5LMNL 4XDXA 1VQFA 1E1OA 2RSNA 1I6VC 1OXXK 1QB5D 2N55A 4R4IA 1KHIA 4JBMA 1HQRD 4HJ5A 4JK1C 5D65A 3D6CA 1V9PA 5C3EH 3CKIB 3CCVA 3MHBA 4PMBA 4CJ1B 1VMPA 3C3LA 4FF4A 1AE2A 4YHHQ 2R93H 4JW0A 4Z9CB 4GNXB 2D0PA 2LMCB 1HR0W 3OSOA 5FO7B 1I3QH 1A3TA 5C44B 1MJEA 1TVXA 4JYAL 5M3FG 4H13C 1VQPA 1E22A 4IPHA 3I4NG 4JG2A 5DLQE 1HCZA 1GUTA 5E1FA 1HZ9A 4KD3A 5CYUA 4HCSA 3WDNA 2HHHL 3GO5A 1YHQA 4YY3L 2I46A 1STBA 1WD0A 1PRTF 1DGSA 3PUVA 3V2TA 4JI6L 4A3DH 1L0XB 4TRDA 2HIVA 1HJPA 4R8IA 1QVCA 2EZVA 2JA6B 1RHPA 3PO2H 5KNCA 3H3VI 3K80C 1XNRL 1K73C 3NELA 3S1NB 1G6PA 2CWAA 5GROA 1UWVA 4DV7L 1XPUA 1EQRA 1PDQA 4TVAB 2V4DA 1HNWL 1KNAA 1TWCB 2CWPA 1NMGA 4JI3Q 5FLMG 2JE6I 4KHVA 3S1QB 1YNJC 1KXLA 2E2HB 3GTKH 1UEAB 3RZDB 2AMCB 5C5LA 4PZ6A 2BH2A 5IGCA 4IZ8A 1D7QA 3GTGH 2PYKA 4DV1Q 1XPRA 3PUZA 2K5WA 5EKLA 5KIXA 4KJNA 1IBKL 1JMCA 1PFNA 3GTOB 3WWVA 4IQZA 3S1MB 3T1HL 1JWSD 3FEWX 4LF7Q 2M9VA 1VQIA 4DUZQ 1G51A 3J81i 1LTBD 1CK1A 1GO3E 1RKNA 2NVXH 4DR6L 1SRUA 4X65Q 3LGJA 2Y0SG 5C0XH 3BJUA 1I5FA 4A3EH 4DR2Q 1WFQA 2B29A 4A93H 1B9MA 1YBYA 4H44C 1SNDA 5D3DA 5AJ3Q 3OWFA 1A0IA 5C44G 2YTVA 4APVA 1YEZA 4JI7Q 4LFBQ 3TZUA 4C3IB 1QCBD 4XQNA 1AE3A 4XYQA 2DUDA 1U4RA 4L63B 1XPOA 3I72A 4H02A 2MPMA 4K0KL 3KF6B 1PH7A 4UAIA 4NXML 1HTPA 3CRLC 4UY8C 4IO9A 1ZEQX 1ENCA 3VR2A 3MXUA 3RN2A 1E0BA 1T9HA 1N8RC 3QIAA 2K33A 2ALYB 1S5CD 4BXXG 1AH9A 1UE5A 2BE5C 2R7ZB 4B9XA 1SE2A 3BYYB 5CV8A 5IIFA 3RLNA 4B9WA 5EKKA 1NJIC 3GTMH 4JV5Q 3I7FA 1I4GA 1IYJB 5G3LD 1EYGA 2B63H 3BDOA 4JBWA 4F88A 4L5RC 5EJWA 2BH8A 4HJ8A 2UUAQ 2ATWA 3OOCA 3HOUB 1U5KA 3HZXA 2WIIB 2MQHA 1BBXC 2SEBD 1X3PA 5LMUL 2WFWA 2D5DA 1NR2A 4JI5L 1YNNC 3H6MA 3BDCA 2Z6BA 4JI8L 1O7IA 5KGUA 1LO5D 3D4DA 1Y1VB 1LYLA 3GTPB 4A3LH 1ILQA 1BDOA 3J81L 1EQQA 1XXGA 1GOZA 1M90C 5CV5A 3K8AA 1NCVA 2CH4A 1YJWA 2OEOA 1A62A 2F4VL 3AMUA 2NVQH 4WRDA 2A19A 5JJLA 4HCEA 2R61A 4EQ5A 5LMNW 2R6GA 3KBXA 3H09A 2DJFC 3G48A 5DM73 2E2IB 2L12A 4OWXB 3OTOQ 1I50H 3AYHB 4X64L 5C4XB 2Q8TA 4MHEA 1BBUA 4GKJL 2ID0A 3NTKA 2ZM6L 4LF9Q 2UU9L 5GQOA 4EQNA 3RZOB 4QQBX 1KAWA 4LAAA 1N9WA 1VQCA 1HRJA 3J7AF 1YHAA 4L5QA 4DR4L 4I7AA 1PRTB 2OTJA 1EYCA 3J81E 2HDLA 2F3WA 4DR3L 2Q2IA 4DNIA 4K8IA 1LM0A 3I91A 4P2CB 4F7XA 4BBRB 3HS0C 1HZBA 2IT1A 3S2HB 1EYDA 3WOFA 4A3JH 1D1IA 2R7FA 2Z9HA 3VR5A 3NEMA 4XXEA 2IL8A 1Z47A 2NN6G 4FNFA 3TS2A 3PMFA 4BY7B 1CQVA 3I73A 2PNRC 4DXGA 1KNEA 1O78A 1TWFH 4OHJA 2YYZA 5E4XA 2E76C 2SDFA 1MHWC 3H91A 2D2CC 3CPWA 3HOXB 5G3LF 3HOUG 3H94A 3BZDB 3PSIA 2A68C 2JA9A 4JI0Q 2EVBA 3EJIA 5IE8A 1QOHA 1WTPA 1SNMA 5EPLA 3S9WA 4A3MB 1J6QA 1DOMA 2JN4A 2XTIA 2E2JH 4JBKA 1AFPA 2KHSA 3CQZB 1VQAA 1EY4A 4I65A 3J7ZC 1YITA 1W2BA 5DM63 1PH1A 3S16H 1TU2B 1GD7A 1WI5A 1FL0A 1MKHA 2HDMA 3HOYH 1H95A 1KABA 2F52A 3CCSA 1SEBD 3R2IA 1X9NA 1F9SA 4RCNA 1KRSA 1K8MA 2KHJA 2EYHA 3GTJB 1IKLA 2FINB 2PQAA 1HXYD 3HOZB 4FXGC 1MJCA 1CKNA 2Z0SA 3PGZA 3W1BA 3CCLA 2YU9H 1JE4A 5A2QL 4B3TL 1PTOB 3CD6A 5C4XG 4DR7L 4O1NA 2EQSA 3Q8DA 3O13A 1H9JA 1BNZA 4NW2A 3T1YL 1SYEA 2HCIA 4DV0Q 3TP6A 2EYOA 3NBHB 4JPBW 1KLUD 3TP8A 3UDFA 2DN8A 3GD7A 1SNOA 4FVMA 1E3PA 5CBAE 4DNTB 4LF6L 1AW7A 2EOTA 1EZ8A 1XMOQ 1STNA 1BBWA 4C3JB 3D6WA 3A56A 4HMJA 1X56A 3DM1A 4HEDA 4U68A 2L4NA 3T51B 4B3SQ 2VUMB 1V8QA 3DWAA 4A3BB 1PMRA 4B3MQ 4BY7G 2O2LD 3M9BA 1WJJA 4H7BA 2Q8IB 5JEAG 5A2QE 4UP7A 3G6JB 3FP9A 3EROA 1JWMD 1JQYD 2KCMA 4DAYA 3KLSA 2B2TC 3TZDA 1J5EL 3K6OA 1PH5A 5C5MA 2UXDL 2QILA 3VYSA 2C5CA 4JCVE 4U673 2UUCL 4QCLA 3K0YA 4LUOA 3P7JA 1CHQD 1M4VA 4NKLA 1Y8NB 2AUKA 5JJZA 2KENA 3C2PA 4DV4L 2EYFA 4RKLA 1PFBA 1EWHA 1SXTA 3KJOA 1VQ6A 3IFDA 3HOWH 1WCMB 1N34Q 5D3IB 2L55A 1F2ZA 2FJ2A 3BU2A 3W3AA 4A3CG 2NZOA 5ELDA 3KLWA 1HR0L 1QVGA 4UP9A 3HOZG 1LTLA 5C0XJ 2OTLA 4GLVB 4C3HG 2EY6A 4KHPL 2M00A 2NVTH 2Z4HA 5J22A 1WTQA 4JI2L 1VQDA 2I0QA 3QWNA 1FJGQ 1SYDA 2WB1E 3HEJA 4JI1Q 1C9OA 5EAYA 2K5DA 5I9PA 3HG9A 1SDFA 2AWOA 3NE5B 4KLKA 1IBLL 4LF8L 1E1TA 5IP7G 5C4JB 5FO8B 4KV6A 2LSSA 4C3JG 5M3FH 1PFSA 1EIGA 1PYSB 1CZWA 2LY7A 3MZ5A 4R8NA 1HQMC 1JOOA 3MA2B 3I4NH 4XT1B 1A6XA 2WACA 4PG3A 5EPJA 1V1OA 1D5ZC 1HHVA 3FDTA 4A3BG 1NSNS 1J8IA 4IJLA 2XWBB 3TEHB 3Q6SA 3AEVA 1EL0A 4MZ9A 4LJZC 2NB0A 3NPPA 4A3KB 4QMGA 4BBSB 2A6HC 1X3EA 1CKOA 2E74C 3NSWA 2CFMA 3D0FA 3M4PA 1TWAH 4DUYQ 2F0PA 3IL8A 1CM9A 2BE5D 2UXCQ 2Q2HA 1SMXA 5FLMH 2NVYB 3A54A 1CT1D 1SSOA 3UE1A 5IGBA 5JPNC 1AZQA 1B3AA 1Q1EA 4B3RQ 3Q23A 2F0EA 1DM0B 4DNRB 2E5LQ 1F9QA 4DK3C 4X62Q 1LTTD 3SK8A 2K01A 3N6RA 1WCMG 1EYAA 4O0AA 5HGTA 1K28A 4GKKL 1OXSC 3NXWA 4G4KA 1MBYA 1YNND 1B4OA 2XNAC 4P74A 5FKAC 5EBDA 4GOPB 2B2WC 3GV6A 4A3FB 2JA8B 1VQ7A 3I4MB 2N88A 2VQEQ 1EIHA 1L0YB 2XWJB 4XQJA 4OO1G 4IUPA 4CKEA 1VQLA 2BCOA 5FOBB 4HIKA 1QE6A 5C44H 3C1EA 3DUZA 3K0XA 1STGA 1R9TB 1B9NA 2CKZB 1QNUA 3UDIA 1RL2A 4X3SA 1QZHA 3M4QA 2JP1A 3E0JA 2EJFC 3HOVG 4ME5A 3X3MA 1FD7D 2KEEA 1CA5A 1S72A 4AYBE 2PZWA 1DXMA 3J7YW 4R4QA 4BWGB 1K3RA 4BXXH 1CQFA 1TWCH 2K04A 3H0GB 2VY3A 2HUGA 2V1CC 4KHZA 1PH3A 4LNQA 3RLFA 3S1QH 4JVZA 4DR5Q 2E2HH 2QDBA 3CPFA 5FJ8G 1XMQQ 1QUQA 1D6EC 5GAEC 4K2KA 1C7YA 1KDBA 2L0CA 4MNOA 4MN3A 2A68D 2DJGC 4FXDA 2XRSD 4HAEA 3J80L 3GTOH 1G8ZD 3KDFB 3K81C 3S15B 3S1MH 2K7VA 3S24A 5BN4A 4YHHL 1H9SB 2GVBA 1OXVA 2VW9A 4A3FG 4DV2Q 2CCZA 3I4MG 4OONA 3URYA 2A5HA 1SR3A 2M2LA 2NTTA 3FPPA 3E0EA 2E75C 1A3UA 1E2WA 3FHWA 4J8QA 3UDXA 2AQ3B 3SK5A 1YVCA 2N3SA 4IALA 4JBJA 4FYDA 1Y8PB 1G2TA 1XWEA 3FKIG 3SDZA 4GNXC 1Y14B 1Q8KA 2KQ3A 2PI2A 2YV5A 1A8VA 4DA2A 1A3VA 1JCKB 5M5XB 2F0VA 3M3YH 4KK7A 5ELCA 3J80E 1VQJA 2KOLA 1WTRA 1E2VA 4C2MB 1R4QB 5ISRA 4KKUA 2RBMA 1JOKA 1FNWA 1MGSA 3NK9A 3I70A 2F0UA 4KY7A 4JI3L 3HKSA 5CC4A 3M7NA 4ME3A 2UUBQ 1STHA 4YCVA 1WTOA 3KLRA 4HJ7A 5KNDA 3PF5A 3F2CA 5JVG3 3OPOA 4WFN3 4DV1L 3H0GG 3A5ZB 5L37A 3U4VA 2JA7B 2GN5A 2NN6H 4BY1B 2F0IA 4OXPA 1KAAA 4OIKA 2WINB 3C1FA 1S5BD 4LF7L 2L5TA 4N9PA 2LXJA 3J81c 1WTVA 3KK7A 3CU7A 4DUZL 5IODA 3M4OB 5JJKA 3HOUH 2NUCA 1DJRD 3N52A 3L2PA 1VQ9A 2LKVA 4OX9Q 4X65L 1UNSA 1HUNA 1Q3LA 4DR2L 3M7GA 1VQKA 1EZ6A 2EXDA 1S5DD 1WTXA 2RA4A 1TXYA 3VYUA 2CW0D 5AJ3L 1N36Q 1Q46A 2LFNA 3GTPH 4CDFC 4L5SA 4JI7L 2F0FA 4Q0FA 4LFBL 4GS3A 4DV3Q 4DR1Q 2DNEA 3I3CA 1F2MA 2X69A 1QZGA 2JK8A 3HFZB 1C8CA 4AQYQ 2O5IC 2XSCA 3TQYA 1XNQQ 3K7AH 2E8GA 4IFDG 2F3IA 2OF1A 4L6TB 4BA2I 1EFWA 3H3VC 4PQXA 5IYCG 3LWEA 5C4XH 3KLSX 1GUNA 3PCOB 2B2YA 5C3EB 1DD2A 1M1KC 3F8TA 1SYBA 1EOTA 5GAHC 2PI2E 3ITPA 2R93B 1GUWA 1EEFD 3KYHC 2JA6G 1VQBA 4LWCA 3S2DB 4OWTB 4JV5L 3T4AC 4OEMB 1Z6HA 1VCIA 2UUAL 4P73A 4BBRH 2RDGA 1LTID 5IYDG 3S2HH 1BCPD 1Y1WB 5C0XI 1X6OA 3W2DA 4A3GB 2VNUD 1MI2A 2ZJRA 3L9AX 3F1ZA 3U4ZA 3A8JE 2F0DA 4GN5A 4BY7H 3H15A 5EQ0A 1SYCA 5JEAH 3U50C 1GXDC 5C3XA 1HNXQ 5IGDA 3D31A 1U0LA 4UPAA 2Z6KC 1D8LA 2A6HD 3I8ZA 5IYBG 1IBMQ 1DYQA 2YTYA 3A7LA 3WOEA 4X3UA 2A8VA 4EGVA 1L1OA 1UE6A 3X3NA 5J39A 5EPKA 4R1JA 1A63A 4IURA 4NXNQ 1GVPA 2JEBI 4OELB 1ENFA 4B08A 3OTOL 4GLAC 2K6AA 4IN3A 2K14A 2ES2A 1EY7A 2MO1A 5DEHA 4A3CH 1T5EA 4DPGA 4LF9L 3JAMi 3HOZH 1HA5A 4C3HH 1PV4A 2I07B 4ZQ3A 1PTOH 4C3IG 5C3WA 4JI4Q 3E3XA 3ULPA 1B1ZA 3HGBA 5J1ZA 2HIXA 1KC8C 4A93B 3AFQA 1L1OB 2FHTA 4G57A 5M3MB 1E2ZA 1KDCA 2X6LA 5BR8Q 2ZXOA 1UE1A 1EU4A 1QVFA 5IP7H 2H1EA 4CJ0B 1JT8A 3BZCA 4EVOA 4C3JH 1CHPD 3OW2A 1PH2A 2KBNA 1CKMA 1PRTC 4DF7A 5A35A 3MXNA 4RA8A 1UE7A 2EYLA 1B3QA 5T1IA 1JE5A 1KLGD 1M8AA 1BXTA 3MXGA 1Y1WG 2PCFB 2R7ZG 4A3GG 4JI0L 3QB3A 1EY6A 1HNZQ 4GLXA 4A3BH 1B7YB 1BCPF 1PHJA 1VQHA 2ICIA 3DXJC 1CUKA 1ILPA 3J81j 2NBFA 3TN2A 3PUYA 4HIMA 1Q81C 4CDDC 4QF4A 1Z9FA 4POGA 1L0WA 3F2UA 1K8AC 5M9OA 4X66Q 2F0OA 1YJNA 2EE1A 3GV3A 2JSOA 4HJ9A 3HKZE 1IKMA 1SJED 2NZ1D 2X6GA 3CW2C 3A55A 3VYTA 5CBEE 4HSPA 1GUGA 4DV6Q 2MJ8A 2A1AA 1PVOA 3UI2A 1Y1VG 4DFAA 4RAUC 2K05A 2VZAA 1YNXA 4QIWE 1V1PA 5CORA 1STAA 4PZ7A 1TWHB 1HA6A 2PW7A 5KRUA 3STBC 1WCMH 4M1UB 3CCJA 2Z4IA 4DV0L 2A69C 1AEXA 2F0KA 3J7A5 5E7NA 5DAUA 1SNPA 1B44D 2F0LA 3M85A 4DU9A 4Y52H 1XMOL 1Y8OB 4ULLA 1SE4A 5CGKA 1PTOC 3CF5A 3TP5A 1I94Q 3S17B 3MWYW 1A2TA 3IFTA 5M3MG 4OO1H 1F2LA 4CHTB 2G9DA 4NMZA 1LLRD 2QW7A 3R8BA 3I4OA 4B3SL 2NZHA 1VS0A 3RR5A 1JJGA 4MTKA 4B3ML 1V1PB 3SK4A 3PUXA 3LWUA 4XIGS 4NP5A 2B2TA 2KEDA 4BBRG 1TIID 1PLFA 3A7AB 2RSOA 2PQAB 1CKNB 2WB1B 4K8JA 1NY4A 3K57A 3A74A 1LTAD 1QG7A 3HOVH 3TREA 3GP7A 3G71A 3K5NA 4LFAQ 3HOXG 4HIOA 1TWGH 1D5XC 1LUZA 2K5QA 2MNAA 1G91A 4YWLA 3K5LA 4PMWA 4JOIA 4LFCQ 2SOBA 1LTGD 1STEA 4RFBA 3BG3A 4N9TA 4CKBA 4IPCA 1F77A 1A2UA 1R4PB 1LTRD 3NWSA 3QJYA 4A3MG 1PFMA 2VXWA 3E6ZX 1N34L 4KKSA 4ID6A 2NVYH 1YNJD 3PIO3 2F0QA 2IWHA 2WAQE 1PYBA 4BS9A 1U9RA 2R92B 5FJ8H 3UDGA 1IL2A 2Z8LA 4RCOA 5K36G 2EYPA 4QUFA 1FJGL 1X65A 1TKWB 1RF2D 1GUOA 5C6AA 1XJVA 4DK0A 1KD1C 3NHHA 4IPGA 1BVSA 1UUPA 4JI1L 4ZKBB 2UXBQ 1ET9A 1Q1BA 1I4RA 5I6YA 1MSHA 2F03A 4DAYB 2AQ1B 4A3FH 3I4MH 3HOYB 2KCTA 2F0TA 3JC66 1EWIA 1SJHD 3TRZA 3S14H 1WYDA 4V190 1QNKA 4H0LC 5IWAQ 3C46A 3U9OA 3CCQA 2RF4A 1NNXA 3MFYA 1HTLD 3Q22A 1U4PA 5M5YB 2VL6A 3FKIH 1GUSA 1R9TH 4IUTA 1GHKA 2VQFQ 1SMYC 4A3IB 4ZK9B 1N32Q 2HCCA 4R4TA 2C35B 2VUMG 4MIUA 1S5ED 3QR8A 3TS0A 1G2SA 2IJ0A 2WB1G 4DUYL 2A73B 1N33Q 1RJTA 3RNUA 4AH6A 2UXCL 5ELOA 1K83B 5LHY1 3G4SA 4K6LA 3VYRA 1TS3A 2WV6D 3CCRA 4B3RL 1K9MC 1QWYA 1EY8A 1K8OA 2E5LL 1PH8A 1HFGA 3J80c 1EIFA 4X62L 5JEAJ 1F9PA 4G7ZC 3LX0A 2B2UC 4HTHA 3H0GH 1OXTA 4DV5Q 5FK9C 2RKSA 3QOLA 1ASYA 5AFWA 2FMCA 2FMMA 2F0SA 4IPDA 2R92G 1I6HB 1NUCA 4KJOA 3VA5A 3MTSA 3GTLB 4WJ4A 1ZYRC 1P8LA 3TSSA 4AYBB 1I4QA 1UEBA 2VQEL 3CAMA 3DHQA 3GTQB 2RHSB 3S15H 1X32A 4KD4A 3DEPA 5I2YA 1IXRA 3PIP3 2HQLA 3BZKA 4KY6A 4NDXA 4GOPC 2DGYA 4O2DA 1EY9A 3RN5A 4K6DA 1QJOA 2RVLA 3CP0A 2LS01 4NB3A 2IX0A 2N49A 3K58A 2PMZE 2RQXA 3KJPA 2I5MX 3CCUA 3DMUA 1PA6A 1ESRA 1RIPA 1IW7C 3ONAB 2TMPA 2NVTB 5IGGA 4IFDH 3KF8A 1SN8A 2PQEA 4ABNA 5IYCH 1FGBD 3KUPA 1OXUA 2F0HA 3QO2A 4ZYSA 2RHQB 4A3IG 3D8GA 1CTMA 3CCEA 3EA6A 4K14A 1PZJD 1VQ5A 3ICEA 3K7UC 4C2MH 2Q8RE 5H1SE 3A8KE 1S40A 4R4CA 3J7AV 2JA6H 4DR5L 4A3KG 3Q24A 1EU3A 4BBSG 3CMEA 1B50A 3S1NH 3I4NB 4OIJA 1XMQL 2KA7A 1PRTD 1FGUA 2ICEC 5IYDH 4FXKC 2F0NA 1NAPA 4RGMA 2B2VC 3BYTB 4RGNA 2ZJQA 3L7ZC 4V0BA 4ZCKA 1Q7YC 2K28A 1VF5C 1OO9B 1WOCA 2AQ2B 2EIFA 3RZDH 1LV9A 4QUCA 5E4WC 1SE8A 4IUVA 4QGUA 1O7LA 1EWCA 4DV2L 2PW5A 5IYBH 4LF5Q 5C4HA 4AYBG 1JOQA 1CZGA 4A76A 1Z7TA 1W6JA 2ZJPA 3FVQA 4O42A 1FNUA 1RTNA 2QGQA 2K52A 1YHBA 5FO9B 2A6EC 4CBVA 4GNXA 1BKBA 2K5NA 2RCNA 2JA8G 1AZPA 4LF4Q 4X3TA 1EQTA 1HPCA 2XGTA 4FF2A 4YCUA 1L2FA 3STBD 4I7ZC 2PPBC 1PXUA 1TR5A 4GN4B 2A69D 3VA7A 1JB7A 3H3VH 1QUQB 1QILA 3U58A 3D4RA 3S1RB 2D0OA 5I2XA 3PO3B 3ULLA 4C3IH 3AQQA 2VB3X 5CR3A 3L0OA 1CI3M 1PTOD 2Y0SB 2BDNA 1II3A 3NTIA 2UUBL 5LMNQ 1JWUD 2JA5B 2DY7A 2F0MA 2CQAA 1LTSD 1ENAA 1CSPA 2OQ0A 1X3QA 5IP9G 5IT9c 3A5UA 2K4KA 2JEAI 3F2DA 1NTGA 3S2DH 5BN5A 4GN3B 1F2YA 3D4WA 3NP8A 4HSVA 5KEEA 4Y7NB 3OMGA 3T13A 2PNHA 2FFKB 3PUWA 2EJMA 4R4OA 4G7HC 2N78A 1NE3A 1Y1WH 1PH4A 3R2TA 2R7ZH 4A3GH 1B70B 3OYYA 4UDUC 1F9RA 3A0JA 1LT5D 4OX9L 4JYAQ 2MUYA 4WJ3M 1XYIA 1P16A 3MVVA 4YWMA 2O4XA 1ESFA 2RDFA 5J3BA 1HUMA 1SFOB 5M5WB 1N36L 2Q2UA 2HHHQ 1B53A 4CDCC 1PH6A 4YY3Q 1Q90A 1FNVA 4JI6Q 3LNNA 3K5MA 2BDOA 3E9IA 1RTOA 4DV3L 4DR1L 5CV6A 1EY5A 1SE3A 3I4LA 5ELFA 1SLJA 2KCCA 1LT3D 1T5XD 4AQYL 2OCEA 2XN9C 1XNRQ 4K5WA 4DXFA 2Y0SE 3CMAA 2HQEA 3MC0B 4K2LA 2AUJD 1U4MA 1VMCA 1Y1VH 4DV7Q 1XNQL 1AN8A 3A8IE 1BR9A 2KUMA 1HNWQ 2H5XA 4XTCS 2J4XA 1JICA 4RWSC 3T53B 4Q5VA 3NQTA 5HGQA 1PZKD 4HR7B 3DWQA 1MD2D 3KF6A 3NENA 3OIQA 2E2IH 2BA1A 2NN6I 3PO3G 1DCZA 2RCFA 3W5OA 3TP7A 2Z1CA 1IBKQ 1G6ZA 2JA5G 3I90A 4R9WA 4RHSA 3PF4A 1A15A 5CV4A 2QCPX 1EQVA 2F3VA 2K32A 3T1HQ 2Q2TA 5LL6S 1PTOF 5M3MH 3RZOH 1KDAA 2E2DC 4BA1I 4DAVA 1I3QB 1W3SA 2IY5B 4DR6Q 5JJIA 2EJGC 3VR6A 2Z6KA 3CC2A 5DNFA 5I6WA 1CA6A 1D5MC 1HNXL 3M3YB 5GADC 4IUNA 1SMYD 3L3OC 1DOLA 3PQIA 2KCNA 3OWEB 4RMFA 4KKTA 1IBML 4N8FA 3NQIA 1AP0A 4A3DB 2JA7G 4BY1G 2KVMA 4C1NK 4P71A 3PO2B 4P75A 5IT9L 1SBBB 4WJWA 4X3KA 3KOJA 1I4PA 3HOXH 4NXNL 4YCWA 2IX3A 4KN4C 2B2YC 5CV7A 4K0KQ 3IRBA 2K03A 1VQEA 4EQPA 1TY0A 3MAQA 4QB4A 2SNSA 4NXMQ 1YJ9A 1H9RA 3MXPA 4E6IA 4A3MH 3NBIA 3SEBA 4F87A 1XTCD 4F8MA 4WORA 3JAMc 3GTKB 2MO0A 3CQZH 1S4ZA 2BOSA 1E7ZA 3GTGB 3AFPA 3K5OA 1ONLA 1O80A 2NWGA 2WKDA 1ZYRD 4OGQC 5K36H 4JI4L 5COYA 1TWHH 5CMDA 3SE0A 2L15A 3BVZA 5BN3A 2GVAA 5HURA 4DK1A 4FDBA 3I2ZA 4UP8A 3GTJH 1B2TA 1YZ6A 4K5XA 4DAMA 5IT9E 4A75A 5BR8L 1ZKOA 1S5FD 4ZAIA 4LW1A 1Q86C 1ASZA 1LACA 3HKZB 4QJFA 2NVXB 1GM5A 5C3EG 1VQOA 5LMUQ 4FO2A 1X3FA 1ZXTA 3P75A 4PNYA 1ML0D 2EXZA 4A3EB 4G7OC 4JI5Q 3S17H 4IFDJ 1X3GA 2KHIA 2YTXA 4QIWB 4YWKA 4CDEC 2O5JC 1L1OC 2ZXPA 3FPUB 2R93G 1DONA 4JI8Q 2N8NA 4S3SA 1EOVA 2QF7A 3K7AB 1HNZL 1ET6A 1IW7D 2XIWA 1TS5A 2ZTEA 4P72A 5I4DA 1GJXA 1JORA 1SNCA 3RMHA 5KNBA 1VF7A 2LXKA 1I4HA 2F4VQ 2IX1A 3BVMA 5D14A 5IY0A 4IOCA 1EEID 3QOJA 2P5ZX 1PZID 2ZTDA 5GAGC 4X66L 1EIYB 2VUMH 4A3DG 1Y69U 2IHFA 2CQOA 5KYLA 3SVMA 1NMFA 4X64Q 3PO2G 4HIDA 1C4QA 1BF4A 4GKJQ 4DKAC 4KTAA 1BQQT 4RGTA 4DV6L 4J15A 2ZM6Q 3CXCA 1U4LA 2R7DA 3RLOA 1V43A 2UU9Q 2K50A 3DLLA 1VQGA 2IW3A 3B6YA 1MSGA 2K75A 3SR1A 1VDZA 1IYVA 1S3OA 4DAPA 3GTMB 2JYOA 4L5TA 4ODGA 5EGTA 3OIPA 1KL9A 4DR4Q 2J0TD 3F2BA 2B63B 4DR3Q 2R92H 2L1BA 3SK6A 4A4IA 3VDYA 2ENBA 5TSSA 3MXNB 3G6EA 4IUUA 3OMCA 2RDHA 1TY2A 1J9OA 4HJAA 4KMUC 1JB3A 1BUVT 3NBHA 5K5PA 1I94L 3QG1A 1LT6D 3PIOA 3ND8A 2A6ED 3T56B 3HKZG 3V05A 3JAML 1TS4A 4IOAA 2PZUA 3CHBD 5C0XG 2AKWB 2WAQB 5FLXc 3K59A 4A3EG 3NWTA 4A93G 1KQSA 3EBEA 1VQMA 2NVQB 3G7LA 3NUCA 1IL8A 3ER0A 4XT3B 2DY8A 2A74C 1VQNA 1STYA 2BA0A 2KJXA 4C3HB 5M5YH 5C4JH 4RH6A 3ND9A 2SNMA 1I50B 1KIXA 1JJ2A 4RKBA 4KY5A 1D1KA 3GQBA 5ELEA 5IGFA 4LFAL 4A3IH 2QEXA 2HD3A 1GHJA 1WVLA 3AB9A 5JAVA 3P1HA 4LFCL 3SHLA 4FP5D 5KYIA 4YIJA 4B3TQ 4ZUIA 5CV9A 3UE0A 4DR7Q 1K83H 3SGIA 3JAME 4KN7C 3DEOA 4A3KH 3T1YQ 1IHZA 5EKIA 2WP8J 5IOCA 4BBSH 3R3OA 3KBGA 5IGEA 3T16A 2OWOA 1BOSA 1VQ4A 4LF6Q 4A3JB 4PV1C 2AWNA 4HN7A 2PZTA 1EFID 2KECA 1G291 2EY2A 2HT1A 4OO1I 2EY5A 2NTSA 2B63G 2UXBL 1TWFB 2MFIA 2QDLA 2K5HA 4IUQA 1I6HH 2K1BA 1H9KA 1RD9D 5EBCA 4C56C 3IAYA 1ICFB 1SYGA 2EY1A 2GA4B 3GTLH 2ZTCA 3NTHA 1W6KA 1HZCA 1IZ6A 1Q8IA 1GKHA 2CHBD 3GTQH 3R93A 5C4ZA 5JPMC 1UAPA 5IWAL 4J1MA 3P20A 2E2JB 2CW0C 1X54A 4ZKCB 5I9OA 3S16B 1DZ1A 4KI0A 1K0RA 4A3LG 3VR4A 2TSSA 4LMQD 1RCVD 2JA8H 2WAQG 1J5EQ 4QL5A 1Q12A 2OXPA 2D9UA 4JOIC 2UXDQ 3OW7A 3ZYYX 2B8GA 2G9HD 4IJHA 3VR3A 2JJQA 2VQFL 2UUCQ 2L11A 3CCMA 1D2BA 4HMIA 1N32L 2QA4A 4QY7A 3DM3A 2IPKD 2XVSA 2VS1A 3RD4A 1HZAA 2B3GA 1TS2A 2R3ZA 4TKOB 4C1NI 3I55A 1K3BC 1WD1A 2YU9B 3FMCA 3PIPA 4DV4Q 1N33L 3EVQA 4NPSA 4PMCA 3Q0AA 1X55A 3TDQA 1OTCA 1E24A 2EYMA 1JC7A 4L8JA 1HR0Q 2VB2X 3ERSX 2B2UA 5FLXL 2K5VA 5F2DA 4XQQA 2NYZD 1MIUA 1EY0A 3M4YA 4KHPQ 5IP9H 3MEHA 3W1GA 4X6AH 4JI2Q 3RUZA 1I4XA 4DV5L 1H9MA 3V96A 1LT4D 1HFNA 2PMZB 2G5DA 4TSSA 4RHRA 3TBIB 4EX5A 2J7ZA 4ILWA 1SYFA 1BCPB 3IKJA 2ASBA 3E9HA 1NR4A 2D62A 4ZLTF 1K0SA 2F0WA 1BCPC 2I5HA 4A3JG 1IBLQ 1Q82C 4LF8Q 1CFMA 1PH9A 1ICWA 2H4OA 3HOVB 4K5VA 2L9HA 2B2WA 1NBWA 2F0JA 1TWGB 4GOPA 5JOBA 3ERQA 3HRZC 2DNCA 5ELBA 4UHVA 5JVH3 3CRKC 3EIVA 1IYUA 5FLXE 3U9SA 1FYCA 3ULJA 1LABA 3FRPB 2MGSA 2CVRA 4XYOA 1TT2A 3D3RA 1FVIA 1O7ZA 2EDGA 2PO4A 4FF1A 5LL6X 4GZYC 3MEFA 1XX8A 2EYJA 2OT2A 2F4IA 3J80i 3HOYG 2CH4W 3DWPA 4LUZA 4CKCA 3BVGA 1SROA 2ZXRA 1C0AA 3HOWB 1JR0D 4ZRZA 4PZ8A 1YIJA 1RODA 3CC7A 2MHVA 1EUJA 4MTNA 4LUVA 4FF3A 3KFUA 4OL7A 5HY6A 3S1RH 3PO3H 4N8X1 2JQOA
chains in the Genus database with same CATH topology
1SNQA 3S14B 1SAPA 2B2VA 2F1MA 3AU7A 3EFXD 5NUCA 3BDLA 3FKIB 1TQOA 4J6HA 4CJ2C 5M3FB 1C48A 1WTWA 2XRQD 4ZUJA 3PV0A 4DN4M 2WKCA 2ZT9C 3EQLC 1DOKA 3MFGA 4LK1C 2B8FA 1FR3A 4TQUS 3OHXC 1H9SA 2JXMB 1RDPD 4IFDI 3SXHA 4EQOA 1BO0A 5T1GA 2EPBA 2MP1A 1TWAB 2QEJC 1O7YA 2QKIC 2F0GA 3BS1A 5E3FA 2C9OA 4DGZA 4CGYB 1PYWD 3HP3A 4M8AA 3TMEA 2B39A 3E5SA 1KTKA 4RGOS 4XDXA 2RSNA 1I6VC 1OXXK 1QB5D 2N55A 1HQRD 4JK1C 5D65A 3D6CA 3CKIB 3MHBA 4PMBA 4CJ1B 1VMPA 3C3LA 4FF4A 4Z9CB 2LMCB 3OSOA 5FO7B 1A3TA 5C44B 1TVXA 4H13C 1HCZA 1GUTA 5E1FA 4KD3A 5CYUA 4HCSA 3WDNA 3GO5A 2I46A 1STBA 1WD0A 1PRTF 3PUVA 3V2TA 1L0XB 4TRDA 4R8IA 2EZVA 2JA6B 1RHPA 5KNCA 3S1NB 1PDQA 2V4DA 1KNAA 1TWCB 2JE6I 4KHVA 3S1QB 1YNJC 2E2HB 1UEAB 3RZDB 5C5LA 5IGCA 4IZ8A 2PYKA 3PUZA 2K5WA 5EKLA 5KIXA 4KJNA 1PFNA 3GTOB 4IQZA 3S1MB 1JWSD 3FEWX 2M9VA 1LTBD 1CK1A 1RKNA 5C0XH 1B9MA 4H44C 1SNDA 5D3DA 3OWFA 3TZUA 4C3IB 1QCBD 4XQNA 4XYQA 1U4RA 4L63B 3I72A 2MPMA 4UAIA 1HTPA 3CRLC 1ZEQX 1ENCA 3VR2A 3MXUA 1E0BA 3QIAA 2K33A 1S5CD 2BE5C 2R7ZB 4B9XA 1SE2A 3BYYB 5CV8A 5IIFA 4B9WA 5EKKA 1I4GA 5G3LD 3BDOA 4JBWA 4F88A 5EJWA 3OOCA 3HOUB 3HZXA 2WIIB 1BBXC 2SEBD 1X3PA 2D5DA 1NR2A 1YNNC 3H6MA 3BDCA 5KGUA 1LO5D 3D4DA 1Y1VB 3GTPB 1ILQA 1BDOA 3J81L 1XXGA 1GOZA 5CV5A 1NCVA 2OEOA 3AMUA 4WRDA 4HCEA 2R61A 2R6GA 3KBXA 3H09A 5DM73 2E2IB 2L12A 5C4XB 2Q8TA 4MHEA 2ID0A 3NTKA 4EQNA 3RZOB 4LAAA 1HRJA 3J7AF 1PRTB 1EYCA 3J81E 2HDLA 2F3WA 4K8IA 3I91A 4F7XA 4P2CB 4BBRB 3HS0C 3S2HB 2IT1A 1EYDA 3WOFA 1D1IA 3VR5A 4XXEA 2IL8A 1Z47A 2NN6G 4FNFA 3PMFA 4BY7B 1CQVA 3I73A 2PNRC 4DXGA 1KNEA 1O78A 4OHJA 5E4XA 2YYZA 2E76C 2SDFA 3H91A 2D2CC 3HOXB 5G3LF 3H94A 3BZDB 2A68C 2EVBA 3EJIA 1QOHA 1WTPA 1SNMA 5EPLA 3S9WA 4A3MB 1DOMA 1AFPA 2KHSA 3CQZB 4I65A 1EY4A 5DM63 1TU2B 2HDMA 1KABA 1SEBD 3R2IA 1F9SA 4RCNA 1K8MA 3GTJB 2EYHA 1IKLA 2FINB 1HXYD 3HOZB 4FXGC 1JE4A 5A2QL 1PTOB 4O1NA 3O13A 1H9JA 1BNZA 4NW2A 1SYEA 2HCIA 3TP6A 2EYOA 1KLUD 3TP8A 2DN8A 3GD7A 1SNOA 4FVMA 5CBAE 4DNTB 1AW7A 2EOTA 1EZ8A 1STNA 4C3JB 3D6WA 3A56A 4HMJA 3DM1A 4HEDA 4U68A 2L4NA 3T51B 2VUMB 1V8QA 3DWAA 4A3BB 1PMRA 2O2LD 4H7BA 2Q8IB 5JEAG 5A2QE 3G6JB 3EROA 1JWMD 1JQYD 4DAYA 3KLSA 2B2TC 3TZDA 3K6OA 5C5MA 2QILA 3VYSA 2C5CA 4U673 4QCLA 3K0YA 3P7JA 1CHQD 1M4VA 4NKLA 1Y8NB 2AUKA 5JJZA 3C2PA 2EYFA 4RKLA 1PFBA 1EWHA 1SXTA 3IFDA 1WCMB 5D3IB 2L55A 1F2ZA 2FJ2A 3W3AA 5ELDA 5C0XJ 4C3HG 2EY6A 2M00A 2Z4HA 5J22A 1WTQA 3QWNA 1SYDA 3HEJA 2K5DA 5I9PA 3HG9A 1SDFA 2AWOA 3NE5B 5C4JB 5FO8B 4KV6A 4C3JG 1EIGA 1CZWA 2LY7A 3MZ5A 4R8NA 1HQMC 1JOOA 3MA2B 4XT1B 1A6XA 2WACA 5EPJA 1V1OA 1D5ZC 1HHVA 3FDTA 1NSNS 1J8IA 2XWBB 1EL0A 3Q6SA 4LJZC 2NB0A 3NPPA 4A3KB 4QMGA 4BBSB 2A6HC 2E74C 3NSWA 2F0PA 3IL8A 1CM9A 2BE5D 2NVYB 3A54A 1CT1D 1SSOA 5JPNC 5IGBA 1AZQA 1B3AA 1Q1EA 3Q23A 2F0EA 1DM0B 4DNRB 1F9QA 1LTTD 3SK8A 2K01A 3N6RA 1EYAA 5HGTA 1OXSC 3NXWA 4G4KA 1MBYA 1YNND 1B4OA 2XNAC 5FKAC 5EBDA 2B2WC 3GV6A 4A3FB 2JA8B 3I4MB 2N88A 1EIHA 1L0YB 2XWJB 4XQJA 4OO1G 4IUPA 4CKEA 2BCOA 5FOBB 1QE6A 3C1EA 3DUZA 1STGA 1R9TB 1B9NA 1QNUA 4X3SA 2JP1A 3E0JA 2EJFC 4ME5A 3X3MA 1FD7D 2KEEA 1CA5A 2PZWA 1DXMA 3J7YW 4BWGB 1CQFA 2K04A 3H0GB 2HUGA 4KHZA 3RLFA 2QDBA 1D6EC 4K2KA 1KDBA 2L0CA 4MN3A 2A68D 4FXDA 2XRSD 4HAEA 3J80L 1G8ZD 3S15B 2K7VA 5BN4A 1H9SB 1OXVA 3URYA 2A5HA 2NTTA 2M2LA 3FPPA 2E75C 1A3UA 1E2WA 4J8QA 2AQ3B 3SK5A 4IALA 4FYDA 1Y8PB 1G2TA 1XWEA 3SDZA 2KQ3A 4DA2A 1A3VA 1JCKB 5M5XB 2F0VA 4KK7A 5ELCA 3J80E 2KOLA 1WTRA 1E2VA 4C2MB 1R4QB 5ISRA 4KKUA 2RBMA 1JOKA 1FNWA 1MGSA 3NK9A 3I70A 2F0UA 4KY7A 5CC4A 3M7NA 1STHA 1WTOA 3KLRA 5KNDA 5JVG3 3OPOA 4WFN3 2JA7B 2NN6H 4BY1B 2F0IA 1KAAA 4OIKA 2WINB 3C1FA 1S5BD 2L5TA 4N9PA 1WTVA 3KK7A 3CU7A 5IODA 3M4OB 2NUCA 1DJRD 3N52A 2LKVA 1UNSA 1HUNA 1Q3LA 3M7GA 1EZ6A 1S5DD 1WTXA 2RA4A 3VYUA 2CW0D 2LFNA 2F0FA 4Q0FA 2DNEA 3I3CA 1F2MA 2X69A 1C8CA 2O5IC 2XSCA 4IFDG 2OF1A 4L6TB 4BA2I 3H3VC 4PQXA 3LWEA 3KLSX 1GUNA 2B2YA 5C3EB 1DD2A 1SYBA 1EOTA 3ITPA 2R93B 1GUWA 1EEFD 3S2DB 3T4AC 1Z6HA 1VCIA 2RDGA 1LTID 1BCPD 1Y1WB 5C0XI 3W2DA 4A3GB 2VNUD 1MI2A 3L9AX 3A8JE 2F0DA 5EQ0A 1SYCA 5JEAH 1GXDC 5C3XA 5IGDA 3D31A 2A6HD 3I8ZA 1DYQA 3A7LA 3WOEA 4X3UA 4EGVA 5J39A 3X3NA 5EPKA 4IURA 2JEBI 1ENFA 4B08A 2K6AA 4IN3A 1EY7A 5DEHA 1T5EA 1HA5A 2I07B 4ZQ3A 1PTOH 4C3IG 5C3WA 1B1ZA 3HGBA 5J1ZA 4A93B 2FHTA 4G57A 5M3MB 1E2ZA 1KDCA 2X6LA 2ZXOA 1EU4A 2H1EA 4CJ0B 4EVOA 1CHPD 1PRTC 4DF7A 5A35A 3MXNA 4RA8A 2EYLA 5T1IA 1KLGD 1M8AA 1BXTA 3MXGA 2PCFB 3QB3A 1EY6A 1BCPF 2ICIA 3DXJC 1ILPA 2NBFA 3TN2A 3PUYA 4QF4A 3F2UA 5M9OA 2F0OA 2EE1A 3GV3A 2JSOA 1IKMA 1SJED 2NZ1D 2X6GA 3A55A 3VYTA 5CBEE 4HSPA 1GUGA 2MJ8A 3UI2A 4DFAA 4RAUC 2K05A 1V1PA 5CORA 1STAA 1TWHB 1HA6A 2PW7A 5KRUA 4M1UB 2Z4IA 2A69C 1AEXA 2F0KA 5DAUA 1SNPA 1B44D 2F0LA 3M85A 4DU9A 1Y8OB 4ULLA 1SE4A 5CGKA 1PTOC 3TP5A 3S17B 3MWYW 1A2TA 3IFTA 4OO1H 1F2LA 4CHTB 2G9DA 4NMZA 1LLRD 3R8BA 1V1PB 3SK4A 3PUXA 3LWUA 4XIGS 4NP5A 2B2TA 2KEDA 1TIID 1PLFA 3A7AB 2RSOA 2WB1B 4K8JA 3K57A 1LTAD 1QG7A 3GP7A 3K5NA 1D5XC 2K5QA 1G91A 3K5LA 4PMWA 2SOBA 1LTGD 1STEA 4RFBA 3BG3A 4N9TA 4CKBA 1F77A 1A2UA 1R4PB 1LTRD 3NWSA 3QJYA 1PFMA 2VXWA 3E6ZX 4KKSA 4ID6A 1YNJD 3PIO3 2F0QA 2IWHA 4BS9A 1U9RA 2R92B 2Z8LA 4RCOA 5K36G 2EYPA 4QUFA 1TKWB 1RF2D 1GUOA 5C6AA 4DK0A 3NHHA 1UUPA 4ZKBB 1ET9A 1Q1BA 1I4RA 5I6YA 1MSHA 2F03A 2AQ1B 3HOYB 2F0TA 1SJHD 4V190 1QNKA 4H0LC 3C46A 3U9OA 3MFYA 1HTLD 3Q22A 1U4PA 5M5YB 1GUSA 4IUTA 1GHKA 1SMYC 4A3IB 4ZK9B 2HCCA 4MIUA 1S5ED 1G2SA 2IJ0A 2A73B 1RJTA 1K83B 5LHY1 4K6LA 3VYRA 1TS3A 2WV6D 1QWYA 1EY8A 1K8OA 1HFGA 5JEAJ 1F9PA 4G7ZC 3LX0A 2B2UC 4HTHA 1OXTA 5FK9C 2RKSA 3QOLA 5AFWA 2FMCA 2FMMA 2F0SA 1I6HB 1NUCA 4KJOA 3VA5A 3MTSA 3GTLB 1ZYRC 3TSSA 4AYBB 1I4QA 3DHQA 3GTQB 1X32A 4KD4A 3DEPA 5I2YA 3PIP3 4KY6A 4NDXA 1EY9A 4K6DA 1QJOA 2RVLA 2LS01 2IX0A 3K58A 2RQXA 3DMUA 1ESRA 1IW7C 3ONAB 2TMPA 2NVTB 5IGGA 4IFDH 3KF8A 2PQEA 4ABNA 1FGBD 3KUPA 1OXUA 2F0HA 3QO2A 4ZYSA 3D8GA 1CTMA 3EA6A 4K14A 1PZJD 2Q8RE 3A8KE 3J7AV 3Q24A 1EU3A 1B50A 3I4NB 4OIJA 2KA7A 1PRTD 2ICEC 4FXKC 2F0NA 1NAPA 4RGMA 2B2VC 3BYTB 4RGNA 3L7ZC 4V0BA 2K28A 1VF5C 1OO9B 2AQ2B 1LV9A 4QUCA 5E4WC 4IUVA 1O7LA 1EWCA 2PW5A 5C4HA 1JOQA 1CZGA 1Z7TA 1W6JA 3FVQA 4O42A 1FNUA 1RTNA 5FO9B 2A6EC 4CBVA 1AZPA 4X3TA 1EQTA 1HPCA 4FF2A 4I7ZC 2PPBC 1PXUA 1TR5A 2A69D 3VA7A 1QILA 3D4RA 3S1RB 5I2XA 3PO3B 2VB3X 5CR3A 1CI3M 1PTOD 2Y0SB 2BDNA 1II3A 3NTIA 2JA5B 1JWUD 2DY7A 2F0MA 2CQAA 1ENAA 1LTSD 1X3QA 2JEAI 5BN5A 1F2YA 3D4WA 3NP8A 4HSVA 5KEEA 4Y7NB 3OMGA 3T13A 2FFKB 3PUWA 2EJMA 4G7HC 3R2TA 4UDUC 1F9RA 1LT5D 2MUYA 1XYIA 3MVVA 2O4XA 1ESFA 2RDFA 1HUMA 1SFOB 5M5WB 1B53A 1Q90A 1FNVA 3LNNA 3K5MA 2BDOA 1RTOA 5CV6A 1EY5A 1SE3A 3I4LA 5ELFA 2KCCA 1LT3D 1T5XD 2XN9C 4K5WA 4DXFA 2HQEA 3MC0B 4K2LA 2AUJD 1U4MA 1VMCA 1AN8A 3A8IE 1BR9A 2KUMA 4XTCS 2J4XA 1JICA 4RWSC 3T53B 4Q5VA 3NQTA 1PZKD 4HR7B 3DWQA 1MD2D 3OIQA 2BA1A 2NN6I 1DCZA 3TP7A 2Z1CA 1G6ZA 3I90A 4R9WA 4RHSA 1A15A 5CV4A 2QCPX 1EQVA 2F3VA 2K32A 5LL6S 1PTOF 1KDAA 2E2DC 4BA1I 4DAVA 1I3QB 2EJGC 3VR6A 5DNFA 5I6WA 1CA6A 1D5MC 3M3YB 4IUNA 1SMYD 3L3OC 1DOLA 2KCNA 3OWEB 4KKTA 1AP0A 3NQIA 4A3DB 2KVMA 4C1NK 3PO2B 5IT9L 1SBBB 4WJWA 4X3KA 1I4PA 2IX3A 4KN4C 2B2YC 5CV7A 2K03A 4EQPA 1TY0A 3MAQA 4QB4A 2SNSA 1H9RA 3MXPA 4E6IA 3NBIA 3SEBA 4F87A 1XTCD 4F8MA 4WORA 3GTKB 1S4ZA 2BOSA 3GTGB 3K5OA 1ONLA 1O80A 2NWGA 2WKDA 1ZYRD 4OGQC 5K36H 5COYA 5CMDA 3SE0A 3BVZA 5BN3A 5HURA 4DK1A 1B2TA 4K5XA 5IT9E 1ZKOA 1S5FD 4ZAIA 1LACA 3HKZB 2NVXB 4FO2A 1ZXTA 3P75A 4PNYA 1ML0D 2EXZA 4A3EB 4G7OC 4IFDJ 4QIWB 2O5JC 3FPUB 2ZXPA 1DONA 4S3SA 2QF7A 3K7AB 1ET6A 1IW7D 2XIWA 1TS5A 5I4DA 1GJXA 1JORA 1SNCA 3RMHA 5KNBA 1VF7A 1I4HA 2IX1A 3BVMA 5D14A 1EEID 3QOJA 1PZID 1Y69U 5KYLA 3SVMA 1C4QA 1BF4A 4KTAA 1BQQT 4RGTA 1U4LA 1V43A 2IW3A 1MSGA 3SR1A 1VDZA 1IYVA 4DAPA 3GTMB 2JYOA 4ODGA 5EGTA 3OIPA 2J0TD 2B63B 2L1BA 3SK6A 2ENBA 5TSSA 4IUUA 3OMCA 2RDHA 1TY2A 1J9OA 4KMUC 1JB3A 1BUVT 3NBHA 5K5PA 3QG1A 1LT6D 3ND8A 2A6ED 3T56B 3V05A 3JAML 1TS4A 2PZUA 3CHBD 5C0XG 2WAQB 3K59A 3NWTA 2NVQB 3G7LA 3NUCA 1IL8A 4XT3B 2DY8A 2A74C 1STYA 2BA0A 2KJXA 4C3HB 4RH6A 3ND9A 2SNMA 1I50B 4RKBA 4KY5A 1D1KA 3GQBA 5ELEA 5IGFA 1GHJA 1WVLA 3AB9A 5JAVA 3P1HA 3SHLA 4FP5D 5KYIA 4YIJA 4ZUIA 5CV9A 3JAME 4KN7C 3DEOA 1IHZA 5EKIA 2WP8J 5IOCA 3R3OA 3KBGA 5IGEA 3T16A 1BOSA 4A3JB 4PV1C 2AWNA 4HN7A 2PZTA 1EFID 2KECA 1G291 2EY2A 4OO1I 2EY5A 2NTSA 1TWFB 4IUQA 2K1BA 1H9KA 1RD9D 5EBCA 4C56C 3IAYA 1SYGA 2EY1A 2GA4B 3NTHA 1W6KA 1Q8IA 2CHBD 3R93A 5C4ZA 5JPMC 1UAPA 4J1MA 3P20A 2E2JB 2CW0C 4ZKCB 5I9OA 3S16B 1DZ1A 4KI0A 3VR4A 2TSSA 4LMQD 1RCVD 1Q12A 2OXPA 2D9UA 3OW7A 3ZYYX 2B8GA 2G9HD 3VR3A 2L11A 1D2BA 4HMIA 2IPKD 2XVSA 3RD4A 4TKOB 1TS2A 2R3ZA 4C1NI 1WD1A 2YU9B 3FMCA 3EVQA 4PMCA 3Q0AA 3TDQA 2EYMA 1JC7A 4L8JA 2VB2X 2B2UA 5FLXL 4XQQA 5F2DA 2NYZD 1EY0A 3M4YA 3MEHA 3RUZA 1I4XA 1H9MA 3V96A 1LT4D 1HFNA 2PMZB 3TBIB 4TSSA 4RHRA 2J7ZA 4ILWA 1SYFA 1BCPB 3IKJA 4ZLTF 1NR4A 2D62A 2F0WA 1BCPC 1CFMA 1ICWA 2H4OA 3HOVB 4K5VA 2L9HA 2B2WA 2F0JA 1TWGB 5JOBA 3ERQA 3HRZC 2DNCA 5ELBA 5JVH3 3CRKC 1IYUA 5FLXE 3U9SA 1FYCA 1LABA 3FRPB 2MGSA 2CVRA 4XYOA 1TT2A 3D3RA 1O7ZA 2EDGA 2PO4A 4FF1A 5LL6X 4GZYC 1XX8A 2EYJA 2OT2A 2F4IA 4CKCA 3DWPA 3BVGA 2ZXRA 3HOWB 1JR0D 4ZRZA 1RODA 2MHVA 4FF3A 4OL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOS A;  1QNU A;  1DM0 B;  3MXG A;  1D1I A;  1D1K A;  2XSC A;  1BOS A;  4ULL A;  1R4P B;  2C5C A;  1CZW A;  1C4Q A;  1R4Q B;  1C48 A;  4M1U B;  4P2C B;  1CZG A;  1QOH A;  2GA4 B;  1CQF A; 
#chains in the Genus database with same CATH topology
 1SNQ A;  3I56 A;  5M5X H;  1YI2 A;  2JA5 H;  3S14 B;  4GKK Q;  1WTH A;  1CSQ A;  1XTD A;  1SAP A;  2B2V A;  2F1M A;  3AU7 A;  3CC4 A;  3EFX D;  5NUC A;  3GDE A;  4POF A;  4ALP A;  3BDL A;  3FKI B;  1TQO A;  4J6H A;  4CJ2 C;  5M3F B;  1C48 A;  1WTW A;  4OWW B;  4Y7N H;  1B8A A;  1K8G A;  2XRQ D;  4ZUJ A;  3PV0 A;  4DN4 M;  2WKC A;  3ZJY C;  1VQ8 A;  1V1Q A;  2ZT9 C;  3EQL C;  1DOK A;  4LF5 L;  3MFG A;  4LK1 C;  2B8F A;  3EN2 A;  1FR3 A;  2JA7 H;  4TQU S;  3KDF A;  4BY1 H;  3KF8 B;  4JC0 A;  3OHX C;  1H9S A;  2JXM B;  1RDP D;  5ELN A;  2FXQ A;  1SFO H;  3M4O H;  4IFD I;  3SXH A;  4EQO A;  5M5W H;  1BO0 A;  5T1G A;  2EPB A;  4DK6 C;  2MP1 A;  1TWA B;  4LF4 L;  4AIM A;  2QEJ C;  1O7Y A;  2QKI C;  2F0G A;  3BS1 A;  2I5L X;  5E3F A;  2C9O A;  4DGZ A;  4CGY B;  4RG1 A;  1PYW D;  3HP3 A;  1HH2 P;  4M8A A;  3TME A;  2B39 A;  3E5S A;  2IHE A;  1KTK A;  2AHO B;  2OQK A;  3HOW G;  1JJC B;  1KRT A;  4RGO S;  5LMN L;  4XDX A;  1VQF A;  1E1O A;  2RSN A;  1I6V C;  1OXX K;  1QB5 D;  2N55 A;  4R4I A;  1KHI A;  4JBM A;  1HQR D;  4HJ5 A;  4JK1 C;  5D65 A;  3D6C A;  1V9P A;  5C3E H;  3CKI B;  3CCV A;  3MHB A;  4PMB A;  4CJ1 B;  1VMP A;  3C3L A;  4FF4 A;  1AE2 A;  4YHH Q;  2R93 H;  4JW0 A;  4Z9C B;  4GNX B;  2D0P A;  2LMC B;  1HR0 W;  3OSO A;  5FO7 B;  1I3Q H;  1A3T A;  5C44 B;  1MJE A;  1TVX A;  4JYA L;  5M3F G;  4H13 C;  1VQP A;  1E22 A;  4IPH A;  3I4N G;  4JG2 A;  5DLQ E;  1HCZ A;  1GUT A;  5E1F A;  1HZ9 A;  4KD3 A;  5CYU A;  4HCS A;  3WDN A;  2HHH L;  3GO5 A;  1YHQ A;  4YY3 L;  2I46 A;  1STB A;  1WD0 A;  1PRT F;  1DGS A;  3PUV A;  3V2T A;  4JI6 L;  4A3D H;  1L0X B;  4TRD A;  2HIV A;  1HJP A;  4R8I A;  1QVC A;  2EZV A;  2JA6 B;  1RHP A;  3PO2 H;  5KNC A;  3H3V I;  3K80 C;  1XNR L;  1K73 C;  3NEL A;  3S1N B;  1G6P A;  2CWA A;  5GRO A;  1UWV A;  4DV7 L;  1XPU A;  1EQR A;  1PDQ A;  4TVA B;  2V4D A;  1HNW L;  1KNA A;  1TWC B;  2CWP A;  1NMG A;  4JI3 Q;  5FLM G;  2JE6 I;  4KHV A;  3S1Q B;  1YNJ C;  1KXL A;  2E2H B;  3GTK H;  1UEA B;  3RZD B;  2AMC B;  5C5L A;  4PZ6 A;  2BH2 A;  5IGC A;  4IZ8 A;  1D7Q A;  3GTG H;  2PYK A;  4DV1 Q;  1XPR A;  3PUZ A;  2K5W A;  5EKL A;  5KIX A;  4KJN A;  1IBK L;  1JMC A;  1PFN A;  3GTO B;  3WWV A;  4IQZ A;  3S1M B;  3T1H L;  1JWS D;  3FEW X;  4LF7 Q;  2M9V A;  1VQI A;  4DUZ Q;  1G51 A;  3J81 i;  1LTB D;  1CK1 A;  1GO3 E;  1RKN A;  2NVX H;  4DR6 L;  1SRU A;  4X65 Q;  3LGJ A;  2Y0S G;  5C0X H;  3BJU A;  1I5F A;  4A3E H;  4DR2 Q;  1WFQ A;  2B29 A;  4A93 H;  1B9M A;  1YBY A;  4H44 C;  1SND A;  5D3D A;  5AJ3 Q;  3OWF A;  1A0I A;  5C44 G;  2YTV A;  4APV A;  1YEZ A;  4JI7 Q;  4LFB Q;  3TZU A;  4C3I B;  1QCB D;  4XQN A;  1AE3 A;  4XYQ A;  2DUD A;  1U4R A;  4L63 B;  1XPO A;  3I72 A;  4H02 A;  2MPM A;  4K0K L;  3KF6 B;  1PH7 A;  4UAI A;  4NXM L;  1HTP A;  3CRL C;  4UY8 C;  4IO9 A;  1ZEQ X;  1ENC A;  3VR2 A;  3MXU A;  3RN2 A;  1E0B A;  1T9H A;  1N8R C;  3QIA A;  2K33 A;  2ALY B;  1S5C D;  4BXX G;  1AH9 A;  1UE5 A;  2BE5 C;  2R7Z B;  4B9X A;  1SE2 A;  3BYY B;  5CV8 A;  5IIF A;  3RLN A;  4B9W A;  5EKK A;  1NJI C;  3GTM H;  4JV5 Q;  3I7F A;  1I4G A;  1IYJ B;  5G3L D;  1EYG A;  2B63 H;  3BDO A;  4JBW A;  4F88 A;  4L5R C;  5EJW A;  2BH8 A;  4HJ8 A;  2UUA Q;  2ATW A;  3OOC A;  3HOU B;  1U5K A;  3HZX A;  2WII B;  2MQH A;  1BBX C;  2SEB D;  1X3P A;  5LMU L;  2WFW A;  2D5D A;  1NR2 A;  4JI5 L;  1YNN C;  3H6M A;  3BDC A;  2Z6B A;  4JI8 L;  1O7I A;  5KGU A;  1LO5 D;  3D4D A;  1Y1V B;  1LYL A;  3GTP B;  4A3L H;  1ILQ A;  1BDO A;  3J81 L;  1EQQ A;  1XXG A;  1GOZ A;  1M90 C;  5CV5 A;  3K8A A;  1NCV A;  2CH4 A;  1YJW A;  2OEO A;  1A62 A;  2F4V L;  3AMU A;  2NVQ H;  4WRD A;  2A19 A;  5JJL A;  4HCE A;  2R61 A;  4EQ5 A;  5LMN W;  2R6G A;  3KBX A;  3H09 A;  2DJF C;  3G48 A;  5DM7 3;  2E2I B;  2L12 A;  4OWX B;  3OTO Q;  1I50 H;  3AYH B;  4X64 L;  5C4X B;  2Q8T A;  4MHE A;  1BBU A;  4GKJ L;  2ID0 A;  3NTK A;  2ZM6 L;  4LF9 Q;  2UU9 L;  5GQO A;  4EQN A;  3RZO B;  4QQB X;  1KAW A;  4LAA A;  1N9W A;  1VQC A;  1HRJ A;  3J7A F;  1YHA A;  4L5Q A;  4DR4 L;  4I7A A;  1PRT B;  2OTJ A;  1EYC A;  3J81 E;  2HDL A;  2F3W A;  4DR3 L;  2Q2I A;  4DNI A;  4K8I A;  1LM0 A;  3I91 A;  4P2C B;  4F7X A;  4BBR B;  3HS0 C;  1HZB A;  2IT1 A;  3S2H B;  1EYD A;  3WOF A;  4A3J H;  1D1I A;  2R7F A;  2Z9H A;  3VR5 A;  3NEM A;  4XXE A;  2IL8 A;  1Z47 A;  2NN6 G;  4FNF A;  3TS2 A;  3PMF A;  4BY7 B;  1CQV A;  3I73 A;  2PNR C;  4DXG A;  1KNE A;  1O78 A;  1TWF H;  4OHJ A;  2YYZ A;  5E4X A;  2E76 C;  2SDF A;  1MHW C;  3H91 A;  2D2C C;  3CPW A;  3HOX B;  5G3L F;  3HOU G;  3H94 A;  3BZD B;  3PSI A;  2A68 C;  2JA9 A;  4JI0 Q;  2EVB A;  3EJI A;  5IE8 A;  1QOH A;  1WTP A;  1SNM A;  5EPL A;  3S9W A;  4A3M B;  1J6Q A;  1DOM A;  2JN4 A;  2XTI A;  2E2J H;  4JBK A;  1AFP A;  2KHS A;  3CQZ B;  1VQA A;  1EY4 A;  4I65 A;  3J7Z C;  1YIT A;  1W2B A;  5DM6 3;  1PH1 A;  3S16 H;  1TU2 B;  1GD7 A;  1WI5 A;  1FL0 A;  1MKH A;  2HDM A;  3HOY H;  1H95 A;  1KAB A;  2F52 A;  3CCS A;  1SEB D;  3R2I A;  1X9N A;  1F9S A;  4RCN A;  1KRS A;  1K8M A;  2KHJ A;  2EYH A;  3GTJ B;  1IKL A;  2FIN B;  2PQA A;  1HXY D;  3HOZ B;  4FXG C;  1MJC A;  1CKN A;  2Z0S A;  3PGZ A;  3W1B A;  3CCL A;  2YU9 H;  1JE4 A;  5A2Q L;  4B3T L;  1PTO B;  3CD6 A;  5C4X G;  4DR7 L;  4O1N A;  2EQS A;  3Q8D A;  3O13 A;  1H9J A;  1BNZ A;  4NW2 A;  3T1Y L;  1SYE A;  2HCI A;  4DV0 Q;  3TP6 A;  2EYO A;  3NBH B;  4JPB W;  1KLU D;  3TP8 A;  3UDF A;  2DN8 A;  3GD7 A;  1SNO A;  4FVM A;  1E3P A;  5CBA E;  4DNT B;  4LF6 L;  1AW7 A;  2EOT A;  1EZ8 A;  1XMO Q;  1STN A;  1BBW A;  4C3J B;  3D6W A;  3A56 A;  4HMJ A;  1X56 A;  3DM1 A;  4HED A;  4U68 A;  2L4N A;  3T51 B;  4B3S Q;  2VUM B;  1V8Q A;  3DWA A;  4A3B B;  1PMR A;  4B3M Q;  4BY7 G;  2O2L D;  3M9B A;  1WJJ A;  4H7B A;  2Q8I B;  5JEA G;  5A2Q E;  4UP7 A;  3G6J B;  3FP9 A;  3ERO A;  1JWM D;  1JQY D;  2KCM A;  4DAY A;  3KLS A;  2B2T C;  3TZD A;  1J5E L;  3K6O A;  1PH5 A;  5C5M A;  2UXD L;  2QIL A;  3VYS A;  2C5C A;  4JCV E;  4U67 3;  2UUC L;  4QCL A;  3K0Y A;  4LUO A;  3P7J A;  1CHQ D;  1M4V A;  4NKL A;  1Y8N B;  2AUK A;  5JJZ A;  2KEN A;  3C2P A;  4DV4 L;  2EYF A;  4RKL A;  1PFB A;  1EWH A;  1SXT A;  3KJO A;  1VQ6 A;  3IFD A;  3HOW H;  1WCM B;  1N34 Q;  5D3I B;  2L55 A;  1F2Z A;  2FJ2 A;  3BU2 A;  3W3A A;  4A3C G;  2NZO A;  5ELD A;  3KLW A;  1HR0 L;  1QVG A;  4UP9 A;  3HOZ G;  1LTL A;  5C0X J;  2OTL A;  4GLV B;  4C3H G;  2EY6 A;  4KHP L;  2M00 A;  2NVT H;  2Z4H A;  5J22 A;  1WTQ A;  4JI2 L;  1VQD A;  2I0Q A;  3QWN A;  1FJG Q;  1SYD A;  2WB1 E;  3HEJ A;  4JI1 Q;  1C9O A;  5EAY A;  2K5D A;  5I9P A;  3HG9 A;  1SDF A;  2AWO A;  3NE5 B;  4KLK A;  1IBL L;  4LF8 L;  1E1T A;  5IP7 G;  5C4J B;  5FO8 B;  4KV6 A;  2LSS A;  4C3J G;  5M3F H;  1PFS A;  1EIG A;  1PYS B;  1CZW A;  2LY7 A;  3MZ5 A;  4R8N A;  1HQM C;  1JOO A;  3MA2 B;  3I4N H;  4XT1 B;  1A6X A;  2WAC A;  4PG3 A;  5EPJ A;  1V1O A;  1D5Z C;  1HHV A;  3FDT A;  4A3B G;  1NSN S;  1J8I A;  4IJL A;  2XWB B;  3TEH B;  3Q6S A;  3AEV A;  1EL0 A;  4MZ9 A;  4LJZ C;  2NB0 A;  3NPP A;  4A3K B;  4QMG A;  4BBS B;  2A6H C;  1X3E A;  1CKO A;  2E74 C;  3NSW A;  2CFM A;  3D0F A;  3M4P A;  1TWA H;  4DUY Q;  2F0P A;  3IL8 A;  1CM9 A;  2BE5 D;  2UXC Q;  2Q2H A;  1SMX A;  5FLM H;  2NVY B;  3A54 A;  1CT1 D;  1SSO A;  3UE1 A;  5IGB A;  5JPN C;  1AZQ A;  1B3A A;  1Q1E A;  4B3R Q;  3Q23 A;  2F0E A;  1DM0 B;  4DNR B;  2E5L Q;  1F9Q A;  4DK3 C;  4X62 Q;  1LTT D;  3SK8 A;  2K01 A;  3N6R A;  1WCM G;  1EYA A;  4O0A A;  5HGT A;  1K28 A;  4GKK L;  1OXS C;  3NXW A;  4G4K A;  1MBY A;  1YNN D;  1B4O A;  2XNA C;  4P74 A;  5FKA C;  5EBD A;  4GOP B;  2B2W C;  3GV6 A;  4A3F B;  2JA8 B;  1VQ7 A;  3I4M B;  2N88 A;  2VQE Q;  1EIH A;  1L0Y B;  2XWJ B;  4XQJ A;  4OO1 G;  4IUP A;  4CKE A;  1VQL A;  2BCO A;  5FOB B;  4HIK A;  1QE6 A;  5C44 H;  3C1E A;  3DUZ A;  3K0X A;  1STG A;  1R9T B;  1B9N A;  2CKZ B;  1QNU A;  3UDI A;  1RL2 A;  4X3S A;  1QZH A;  3M4Q A;  2JP1 A;  3E0J A;  2EJF C;  3HOV G;  4ME5 A;  3X3M A;  1FD7 D;  2KEE A;  1CA5 A;  1S72 A;  4AYB E;  2PZW A;  1DXM A;  3J7Y W;  4R4Q A;  4BWG B;  1K3R A;  4BXX H;  1CQF A;  1TWC H;  2K04 A;  3H0G B;  2VY3 A;  2HUG A;  2V1C C;  4KHZ A;  1PH3 A;  4LNQ A;  3RLF A;  3S1Q H;  4JVZ A;  4DR5 Q;  2E2H H;  2QDB A;  3CPF A;  5FJ8 G;  1XMQ Q;  1QUQ A;  1D6E C;  5GAE C;  4K2K A;  1C7Y A;  1KDB A;  2L0C A;  4MNO A;  4MN3 A;  2A68 D;  2DJG C;  4FXD A;  2XRS D;  4HAE A;  3J80 L;  3GTO H;  1G8Z D;  3KDF B;  3K81 C;  3S15 B;  3S1M H;  2K7V A;  3S24 A;  5BN4 A;  4YHH L;  1H9S B;  2GVB A;  1OXV A;  2VW9 A;  4A3F G;  4DV2 Q;  2CCZ A;  3I4M G;  4OON A;  3URY A;  2A5H A;  1SR3 A;  2M2L A;  2NTT A;  3FPP A;  3E0E A;  2E75 C;  1A3U A;  1E2W A;  3FHW A;  4J8Q A;  3UDX A;  2AQ3 B;  3SK5 A;  1YVC A;  2N3S A;  4IAL A;  4JBJ A;  4FYD A;  1Y8P B;  1G2T A;  1XWE A;  3FKI G;  3SDZ A;  4GNX C;  1Y14 B;  1Q8K A;  2KQ3 A;  2PI2 A;  2YV5 A;  1A8V A;  4DA2 A;  1A3V A;  1JCK B;  5M5X B;  2F0V A;  3M3Y H;  4KK7 A;  5ELC A;  3J80 E;  1VQJ A;  2KOL A;  1WTR A;  1E2V A;  4C2M B;  1R4Q B;  5ISR A;  4KKU A;  2RBM A;  1JOK A;  1FNW A;  1MGS A;  3NK9 A;  3I70 A;  2F0U A;  4KY7 A;  4JI3 L;  3HKS A;  5CC4 A;  3M7N A;  4ME3 A;  2UUB Q;  1STH A;  4YCV A;  1WTO A;  3KLR A;  4HJ7 A;  5KND A;  3PF5 A;  3F2C A;  5JVG 3;  3OPO A;  4WFN 3;  4DV1 L;  3H0G G;  3A5Z B;  5L37 A;  3U4V A;  2JA7 B;  2GN5 A;  2NN6 H;  4BY1 B;  2F0I A;  4OXP A;  1KAA A;  4OIK A;  2WIN B;  3C1F A;  1S5B D;  4LF7 L;  2L5T A;  4N9P A;  2LXJ A;  3J81 c;  1WTV A;  3KK7 A;  3CU7 A;  4DUZ L;  5IOD A;  3M4O B;  5JJK A;  3HOU H;  2NUC A;  1DJR D;  3N52 A;  3L2P A;  1VQ9 A;  2LKV A;  4OX9 Q;  4X65 L;  1UNS A;  1HUN A;  1Q3L A;  4DR2 L;  3M7G A;  1VQK A;  1EZ6 A;  2EXD A;  1S5D D;  1WTX A;  2RA4 A;  1TXY A;  3VYU A;  2CW0 D;  5AJ3 L;  1N36 Q;  1Q46 A;  2LFN A;  3GTP H;  4CDF C;  4L5S A;  4JI7 L;  2F0F A;  4Q0F A;  4LFB L;  4GS3 A;  4DV3 Q;  4DR1 Q;  2DNE A;  3I3C A;  1F2M A;  2X69 A;  1QZG A;  2JK8 A;  3HFZ B;  1C8C A;  4AQY Q;  2O5I C;  2XSC A;  3TQY A;  1XNQ Q;  3K7A H;  2E8G A;  4IFD G;  2F3I A;  2OF1 A;  4L6T B;  4BA2 I;  1EFW A;  3H3V C;  4PQX A;  5IYC G;  3LWE A;  5C4X H;  3KLS X;  1GUN A;  3PCO B;  2B2Y A;  5C3E B;  1DD2 A;  1M1K C;  3F8T A;  1SYB A;  1EOT A;  5GAH C;  2PI2 E;  3ITP A;  2R93 B;  1GUW A;  1EEF D;  3KYH C;  2JA6 G;  1VQB A;  4LWC A;  3S2D B;  4OWT B;  4JV5 L;  3T4A C;  4OEM B;  1Z6H A;  1VCI A;  2UUA L;  4P73 A;  4BBR H;  2RDG A;  1LTI D;  5IYD G;  3S2H H;  1BCP D;  1Y1W B;  5C0X I;  1X6O A;  3W2D A;  4A3G B;  2VNU D;  1MI2 A;  2ZJR A;  3L9A X;  3F1Z A;  3U4Z A;  3A8J E;  2F0D A;  4GN5 A;  4BY7 H;  3H15 A;  5EQ0 A;  1SYC A;  5JEA H;  3U50 C;  1GXD C;  5C3X A;  1HNX Q;  5IGD A;  3D31 A;  1U0L A;  4UPA A;  2Z6K C;  1D8L A;  2A6H D;  3I8Z A;  5IYB G;  1IBM Q;  1DYQ A;  2YTY A;  3A7L A;  3WOE A;  4X3U A;  2A8V A;  4EGV A;  1L1O A;  1UE6 A;  3X3N A;  5J39 A;  5EPK A;  4R1J A;  1A63 A;  4IUR A;  4NXN Q;  1GVP A;  2JEB I;  4OEL B;  1ENF A;  4B08 A;  3OTO L;  4GLA C;  2K6A A;  4IN3 A;  2K14 A;  2ES2 A;  1EY7 A;  2MO1 A;  5DEH A;  4A3C H;  1T5E A;  4DPG A;  4LF9 L;  3JAM i;  3HOZ H;  1HA5 A;  4C3H H;  1PV4 A;  2I07 B;  4ZQ3 A;  1PTO H;  4C3I G;  5C3W A;  4JI4 Q;  3E3X A;  3ULP A;  1B1Z A;  3HGB A;  5J1Z A;  2HIX A;  1KC8 C;  4A93 B;  3AFQ A;  1L1O B;  2FHT A;  4G57 A;  5M3M B;  1E2Z A;  1KDC A;  2X6L A;  5BR8 Q;  2ZXO A;  1UE1 A;  1EU4 A;  1QVF A;  5IP7 H;  2H1E A;  4CJ0 B;  1JT8 A;  3BZC A;  4EVO A;  4C3J H;  1CHP D;  3OW2 A;  1PH2 A;  2KBN A;  1CKM A;  1PRT C;  4DF7 A;  5A35 A;  3MXN A;  4RA8 A;  1UE7 A;  2EYL A;  1B3Q A;  5T1I A;  1JE5 A;  1KLG D;  1M8A A;  1BXT A;  3MXG A;  1Y1W G;  2PCF B;  2R7Z G;  4A3G G;  4JI0 L;  3QB3 A;  1EY6 A;  1HNZ Q;  4GLX A;  4A3B H;  1B7Y B;  1BCP F;  1PHJ A;  1VQH A;  2ICI A;  3DXJ C;  1CUK A;  1ILP A;  3J81 j;  2NBF A;  3TN2 A;  3PUY A;  4HIM A;  1Q81 C;  4CDD C;  4QF4 A;  1Z9F A;  4POG A;  1L0W A;  3F2U A;  1K8A C;  5M9O A;  4X66 Q;  2F0O A;  1YJN A;  2EE1 A;  3GV3 A;  2JSO A;  4HJ9 A;  3HKZ E;  1IKM A;  1SJE D;  2NZ1 D;  2X6G A;  3CW2 C;  3A55 A;  3VYT A;  5CBE E;  4HSP A;  1GUG A;  4DV6 Q;  2MJ8 A;  2A1A A;  1PVO A;  3UI2 A;  1Y1V G;  4DFA A;  4RAU C;  2K05 A;  2VZA A;  1YNX A;  4QIW E;  1V1P A;  5COR A;  1STA A;  4PZ7 A;  1TWH B;  1HA6 A;  2PW7 A;  5KRU A;  3STB C;  1WCM H;  4M1U B;  3CCJ A;  2Z4I A;  4DV0 L;  2A69 C;  1AEX A;  2F0K A;  3J7A 5;  5E7N A;  5DAU A;  1SNP A;  1B44 D;  2F0L A;  3M85 A;  4DU9 A;  4Y52 H;  1XMO L;  1Y8O B;  4ULL A;  1SE4 A;  5CGK A;  1PTO C;  3CF5 A;  3TP5 A;  1I94 Q;  3S17 B;  3MWY W;  1A2T A;  3IFT A;  5M3M G;  4OO1 H;  1F2L A;  4CHT B;  2G9D A;  4NMZ A;  1LLR D;  2QW7 A;  3R8B A;  3I4O A;  4B3S L;  2NZH A;  1VS0 A;  3RR5 A;  1JJG A;  4MTK A;  4B3M L;  1V1P B;  3SK4 A;  3PUX A;  3LWU A;  4XIG S;  4NP5 A;  2B2T A;  2KED A;  4BBR G;  1TII D;  1PLF A;  3A7A B;  2RSO A;  2PQA B;  1CKN B;  2WB1 B;  4K8J A;  1NY4 A;  3K57 A;  3A74 A;  1LTA D;  1QG7 A;  3HOV H;  3TRE A;  3GP7 A;  3G71 A;  3K5N A;  4LFA Q;  3HOX G;  4HIO A;  1TWG H;  1D5X C;  1LUZ A;  2K5Q A;  2MNA A;  1G91 A;  4YWL A;  3K5L A;  4PMW A;  4JOI A;  4LFC Q;  2SOB A;  1LTG D;  1STE A;  4RFB A;  3BG3 A;  4N9T A;  4CKB A;  4IPC A;  1F77 A;  1A2U A;  1R4P B;  1LTR D;  3NWS A;  3QJY A;  4A3M G;  1PFM A;  2VXW A;  3E6Z X;  1N34 L;  4KKS A;  4ID6 A;  2NVY H;  1YNJ D;  3PIO 3;  2F0Q A;  2IWH A;  2WAQ E;  1PYB A;  4BS9 A;  1U9R A;  2R92 B;  5FJ8 H;  3UDG A;  1IL2 A;  2Z8L A;  4RCO A;  5K36 G;  2EYP A;  4QUF A;  1FJG L;  1X65 A;  1TKW B;  1RF2 D;  1GUO A;  5C6A A;  1XJV A;  4DK0 A;  1KD1 C;  3NHH A;  4IPG A;  1BVS A;  1UUP A;  4JI1 L;  4ZKB B;  2UXB Q;  1ET9 A;  1Q1B A;  1I4R A;  5I6Y A;  1MSH A;  2F03 A;  4DAY B;  2AQ1 B;  4A3F H;  3I4M H;  3HOY B;  2KCT A;  2F0T A;  3JC6 6;  1EWI A;  1SJH D;  3TRZ A;  3S14 H;  1WYD A;  4V19 0;  1QNK A;  4H0L C;  5IWA Q;  3C46 A;  3U9O A;  3CCQ A;  2RF4 A;  1NNX A;  3MFY A;  1HTL D;  3Q22 A;  1U4P A;  5M5Y B;  2VL6 A;  3FKI H;  1GUS A;  1R9T H;  4IUT A;  1GHK A;  2VQF Q;  1SMY C;  4A3I B;  4ZK9 B;  1N32 Q;  2HCC A;  4R4T A;  2C35 B;  2VUM G;  4MIU A;  1S5E D;  3QR8 A;  3TS0 A;  1G2S A;  2IJ0 A;  2WB1 G;  4DUY L;  2A73 B;  1N33 Q;  1RJT A;  3RNU A;  4AH6 A;  2UXC L;  5ELO A;  1K83 B;  5LHY 1;  3G4S A;  4K6L A;  3VYR A;  1TS3 A;  2WV6 D;  3CCR A;  4B3R L;  1K9M C;  1QWY A;  1EY8 A;  1K8O A;  2E5L L;  1PH8 A;  1HFG A;  3J80 c;  1EIF A;  4X62 L;  5JEA J;  1F9P A;  4G7Z C;  3LX0 A;  2B2U C;  4HTH A;  3H0G H;  1OXT A;  4DV5 Q;  5FK9 C;  2RKS A;  3QOL A;  1ASY A;  5AFW A;  2FMC A;  2FMM A;  2F0S A;  4IPD A;  2R92 G;  1I6H B;  1NUC A;  4KJO A;  3VA5 A;  3MTS A;  3GTL B;  4WJ4 A;  1ZYR C;  1P8L A;  3TSS A;  4AYB B;  1I4Q A;  1UEB A;  2VQE L;  3CAM A;  3DHQ A;  3GTQ B;  2RHS B;  3S15 H;  1X32 A;  4KD4 A;  3DEP A;  5I2Y A;  1IXR A;  3PIP 3;  2HQL A;  3BZK A;  4KY6 A;  4NDX A;  4GOP C;  2DGY A;  4O2D A;  1EY9 A;  3RN5 A;  4K6D A;  1QJO A;  2RVL A;  3CP0 A;  2LS0 1;  4NB3 A;  2IX0 A;  2N49 A;  3K58 A;  2PMZ E;  2RQX A;  3KJP A;  2I5M X;  3CCU A;  3DMU A;  1PA6 A;  1ESR A;  1RIP A;  1IW7 C;  3ONA B;  2TMP A;  2NVT B;  5IGG A;  4IFD H;  3KF8 A;  1SN8 A;  2PQE A;  4ABN A;  5IYC H;  1FGB D;  3KUP A;  1OXU A;  2F0H A;  3QO2 A;  4ZYS A;  2RHQ B;  4A3I G;  3D8G A;  1CTM A;  3CCE A;  3EA6 A;  4K14 A;  1PZJ D;  1VQ5 A;  3ICE A;  3K7U C;  4C2M H;  2Q8R E;  5H1S E;  3A8K E;  1S40 A;  4R4C A;  3J7A V;  2JA6 H;  4DR5 L;  4A3K G;  3Q24 A;  1EU3 A;  4BBS G;  3CME A;  1B50 A;  3S1N H;  3I4N B;  4OIJ A;  1XMQ L;  2KA7 A;  1PRT D;  1FGU A;  2ICE C;  5IYD H;  4FXK C;  2F0N A;  1NAP A;  4RGM A;  2B2V C;  3BYT B;  4RGN A;  2ZJQ A;  3L7Z C;  4V0B A;  4ZCK A;  1Q7Y C;  2K28 A;  1VF5 C;  1OO9 B;  1WOC A;  2AQ2 B;  2EIF A;  3RZD H;  1LV9 A;  4QUC A;  5E4W C;  1SE8 A;  4IUV A;  4QGU A;  1O7L A;  1EWC A;  4DV2 L;  2PW5 A;  5IYB H;  4LF5 Q;  5C4H A;  4AYB G;  1JOQ A;  1CZG A;  4A76 A;  1Z7T A;  1W6J A;  2ZJP A;  3FVQ A;  4O42 A;  1FNU A;  1RTN A;  2QGQ A;  2K52 A;  1YHB A;  5FO9 B;  2A6E C;  4CBV A;  4GNX A;  1BKB A;  2K5N A;  2RCN A;  2JA8 G;  1AZP A;  4LF4 Q;  4X3T A;  1EQT A;  1HPC A;  2XGT A;  4FF2 A;  4YCU A;  1L2F A;  3STB D;  4I7Z C;  2PPB C;  1PXU A;  1TR5 A;  4GN4 B;  2A69 D;  3VA7 A;  1JB7 A;  3H3V H;  1QUQ B;  1QIL A;  3U58 A;  3D4R A;  3S1R B;  2D0O A;  5I2X A;  3PO3 B;  3ULL A;  4C3I H;  3AQQ A;  2VB3 X;  5CR3 A;  3L0O A;  1CI3 M;  1PTO D;  2Y0S B;  2BDN A;  1II3 A;  3NTI A;  2UUB L;  5LMN Q;  1JWU D;  2JA5 B;  2DY7 A;  2F0M A;  2CQA A;  1LTS D;  1ENA A;  1CSP A;  2OQ0 A;  1X3Q A;  5IP9 G;  5IT9 c;  3A5U A;  2K4K A;  2JEA I;  3F2D A;  1NTG A;  3S2D H;  5BN5 A;  4GN3 B;  1F2Y A;  3D4W A;  3NP8 A;  4HSV A;  5KEE A;  4Y7N B;  3OMG A;  3T13 A;  2PNH A;  2FFK B;  3PUW A;  2EJM A;  4R4O A;  4G7H C;  2N78 A;  1NE3 A;  1Y1W H;  1PH4 A;  3R2T A;  2R7Z H;  4A3G H;  1B70 B;  3OYY A;  4UDU C;  1F9R A;  3A0J A;  1LT5 D;  4OX9 L;  4JYA Q;  2MUY A;  4WJ3 M;  1XYI A;  1P16 A;  3MVV A;  4YWM A;  2O4X A;  1ESF A;  2RDF A;  5J3B A;  1HUM A;  1SFO B;  5M5W B;  1N36 L;  2Q2U A;  2HHH Q;  1B53 A;  4CDC C;  1PH6 A;  4YY3 Q;  1Q90 A;  1FNV A;  4JI6 Q;  3LNN A;  3K5M A;  2BDO A;  3E9I A;  1RTO A;  4DV3 L;  4DR1 L;  5CV6 A;  1EY5 A;  1SE3 A;  3I4L A;  5ELF A;  1SLJ A;  2KCC A;  1LT3 D;  1T5X D;  4AQY L;  2OCE A;  2XN9 C;  1XNR Q;  4K5W A;  4DXF A;  2Y0S E;  3CMA A;  2HQE A;  3MC0 B;  4K2L A;  2AUJ D;  1U4M A;  1VMC A;  1Y1V H;  4DV7 Q;  1XNQ L;  1AN8 A;  3A8I E;  1BR9 A;  2KUM A;  1HNW Q;  2H5X A;  4XTC S;  2J4X A;  1JIC A;  4RWS C;  3T53 B;  4Q5V A;  3NQT A;  5HGQ A;  1PZK D;  4HR7 B;  3DWQ A;  1MD2 D;  3KF6 A;  3NEN A;  3OIQ A;  2E2I H;  2BA1 A;  2NN6 I;  3PO3 G;  1DCZ A;  2RCF A;  3W5O A;  3TP7 A;  2Z1C A;  1IBK Q;  1G6Z A;  2JA5 G;  3I90 A;  4R9W A;  4RHS A;  3PF4 A;  1A15 A;  5CV4 A;  2QCP X;  1EQV A;  2F3V A;  2K32 A;  3T1H Q;  2Q2T A;  5LL6 S;  1PTO F;  5M3M H;  3RZO H;  1KDA A;  2E2D C;  4BA1 I;  4DAV A;  1I3Q B;  1W3S A;  2IY5 B;  4DR6 Q;  5JJI A;  2EJG C;  3VR6 A;  2Z6K A;  3CC2 A;  5DNF A;  5I6W A;  1CA6 A;  1D5M C;  1HNX L;  3M3Y B;  5GAD C;  4IUN A;  1SMY D;  3L3O C;  1DOL A;  3PQI A;  2KCN A;  3OWE B;  4RMF A;  4KKT A;  1IBM L;  4N8F A;  3NQI A;  1AP0 A;  4A3D B;  2JA7 G;  4BY1 G;  2KVM A;  4C1N K;  4P71 A;  3PO2 B;  4P75 A;  5IT9 L;  1SBB B;  4WJW A;  4X3K A;  3KOJ A;  1I4P A;  3HOX H;  4NXN L;  4YCW A;  2IX3 A;  4KN4 C;  2B2Y C;  5CV7 A;  4K0K Q;  3IRB A;  2K03 A;  1VQE A;  4EQP A;  1TY0 A;  3MAQ A;  4QB4 A;  2SNS A;  4NXM Q;  1YJ9 A;  1H9R A;  3MXP A;  4E6I A;  4A3M H;  3NBI A;  3SEB A;  4F87 A;  1XTC D;  4F8M A;  4WOR A;  3JAM c;  3GTK B;  2MO0 A;  3CQZ H;  1S4Z A;  2BOS A;  1E7Z A;  3GTG B;  3AFP A;  3K5O A;  1ONL A;  1O80 A;  2NWG A;  2WKD A;  1ZYR D;  4OGQ C;  5K36 H;  4JI4 L;  5COY A;  1TWH H;  5CMD A;  3SE0 A;  2L15 A;  3BVZ A;  5BN3 A;  2GVA A;  5HUR A;  4DK1 A;  4FDB A;  3I2Z A;  4UP8 A;  3GTJ H;  1B2T A;  1YZ6 A;  4K5X A;  4DAM A;  5IT9 E;  4A75 A;  5BR8 L;  1ZKO A;  1S5F D;  4ZAI A;  4LW1 A;  1Q86 C;  1ASZ A;  1LAC A;  3HKZ B;  4QJF A;  2NVX B;  1GM5 A;  5C3E G;  1VQO A;  5LMU Q;  4FO2 A;  1X3F A;  1ZXT A;  3P75 A;  4PNY A;  1ML0 D;  2EXZ A;  4A3E B;  4G7O C;  4JI5 Q;  3S17 H;  4IFD J;  1X3G A;  2KHI A;  2YTX A;  4QIW B;  4YWK A;  4CDE C;  2O5J C;  1L1O C;  2ZXP A;  3FPU B;  2R93 G;  1DON A;  4JI8 Q;  2N8N A;  4S3S A;  1EOV A;  2QF7 A;  3K7A B;  1HNZ L;  1ET6 A;  1IW7 D;  2XIW A;  1TS5 A;  2ZTE A;  4P72 A;  5I4D A;  1GJX A;  1JOR A;  1SNC A;  3RMH A;  5KNB A;  1VF7 A;  2LXK A;  1I4H A;  2F4V Q;  2IX1 A;  3BVM A;  5D14 A;  5IY0 A;  4IOC A;  1EEI D;  3QOJ A;  2P5Z X;  1PZI D;  2ZTD A;  5GAG C;  4X66 L;  1EIY B;  2VUM H;  4A3D G;  1Y69 U;  2IHF A;  2CQO A;  5KYL A;  3SVM A;  1NMF A;  4X64 Q;  3PO2 G;  4HID A;  1C4Q A;  1BF4 A;  4GKJ Q;  4DKA C;  4KTA A;  1BQQ T;  4RGT A;  4DV6 L;  4J15 A;  2ZM6 Q;  3CXC A;  1U4L A;  2R7D A;  3RLO A;  1V43 A;  2UU9 Q;  2K50 A;  3DLL A;  1VQG A;  2IW3 A;  3B6Y A;  1MSG A;  2K75 A;  3SR1 A;  1VDZ A;  1IYV A;  1S3O A;  4DAP A;  3GTM B;  2JYO A;  4L5T A;  4ODG A;  5EGT A;  3OIP A;  1KL9 A;  4DR4 Q;  2J0T D;  3F2B A;  2B63 B;  4DR3 Q;  2R92 H;  2L1B A;  3SK6 A;  4A4I A;  3VDY A;  2ENB A;  5TSS A;  3MXN B;  3G6E A;  4IUU A;  3OMC A;  2RDH A;  1TY2 A;  1J9O A;  4HJA A;  4KMU C;  1JB3 A;  1BUV T;  3NBH A;  5K5P A;  1I94 L;  3QG1 A;  1LT6 D;  3PIO A;  3ND8 A;  2A6E D;  3T56 B;  3HKZ G;  3V05 A;  3JAM L;  1TS4 A;  4IOA A;  2PZU A;  3CHB D;  5C0X G;  2AKW B;  2WAQ B;  5FLX c;  3K59 A;  4A3E G;  3NWT A;  4A93 G;  1KQS A;  3EBE A;  1VQM A;  2NVQ B;  3G7L A;  3NUC A;  1IL8 A;  3ER0 A;  4XT3 B;  2DY8 A;  2A74 C;  1VQN A;  1STY A;  2BA0 A;  2KJX A;  4C3H B;  5M5Y H;  5C4J H;  4RH6 A;  3ND9 A;  2SNM A;  1I50 B;  1KIX A;  1JJ2 A;  4RKB A;  4KY5 A;  1D1K A;  3GQB A;  5ELE A;  5IGF A;  4LFA L;  4A3I H;  2QEX A;  2HD3 A;  1GHJ A;  1WVL A;  3AB9 A;  5JAV A;  3P1H A;  4LFC L;  3SHL A;  4FP5 D;  5KYI A;  4YIJ A;  4B3T Q;  4ZUI A;  5CV9 A;  3UE0 A;  4DR7 Q;  1K83 H;  3SGI A;  3JAM E;  4KN7 C;  3DEO A;  4A3K H;  3T1Y Q;  1IHZ A;  5EKI A;  2WP8 J;  5IOC A;  4BBS H;  3R3O A;  3KBG A;  5IGE A;  3T16 A;  2OWO A;  1BOS A;  1VQ4 A;  4LF6 Q;  4A3J B;  4PV1 C;  2AWN A;  4HN7 A;  2PZT A;  1EFI D;  2KEC A;  1G29 1;  2EY2 A;  2HT1 A;  4OO1 I;  2EY5 A;  2NTS A;  2B63 G;  2UXB L;  1TWF B;  2MFI A;  2QDL A;  2K5H A;  4IUQ A;  1I6H H;  2K1B A;  1H9K A;  1RD9 D;  5EBC A;  4C56 C;  3IAY A;  1ICF B;  1SYG A;  2EY1 A;  2GA4 B;  3GTL H;  2ZTC A;  3NTH A;  1W6K A;  1HZC A;  1IZ6 A;  1Q8I A;  1GKH A;  2CHB D;  3GTQ H;  3R93 A;  5C4Z A;  5JPM C;  1UAP A;  5IWA L;  4J1M A;  3P20 A;  2E2J B;  2CW0 C;  1X54 A;  4ZKC B;  5I9O A;  3S16 B;  1DZ1 A;  4KI0 A;  1K0R A;  4A3L G;  3VR4 A;  2TSS A;  4LMQ D;  1RCV D;  2JA8 H;  2WAQ G;  1J5E Q;  4QL5 A;  1Q12 A;  2OXP A;  2D9U A;  4JOI C;  2UXD Q;  3OW7 A;  3ZYY X;  2B8G A;  2G9H D;  4IJH A;  3VR3 A;  2JJQ A;  2VQF L;  2UUC Q;  2L11 A;  3CCM A;  1D2B A;  4HMI A;  1N32 L;  2QA4 A;  4QY7 A;  3DM3 A;  2IPK D;  2XVS A;  2VS1 A;  3RD4 A;  1HZA A;  2B3G A;  1TS2 A;  2R3Z A;  4TKO B;  4C1N I;  3I55 A;  1K3B C;  1WD1 A;  2YU9 B;  3FMC A;  3PIP A;  4DV4 Q;  1N33 L;  3EVQ A;  4NPS A;  4PMC A;  3Q0A A;  1X55 A;  3TDQ A;  1OTC A;  1E24 A;  2EYM A;  1JC7 A;  4L8J A;  1HR0 Q;  2VB2 X;  3ERS X;  2B2U A;  5FLX L;  2K5V A;  5F2D A;  4XQQ A;  2NYZ D;  1MIU A;  1EY0 A;  3M4Y A;  4KHP Q;  5IP9 H;  3MEH A;  3W1G A;  4X6A H;  4JI2 Q;  3RUZ A;  1I4X A;  4DV5 L;  1H9M A;  3V96 A;  1LT4 D;  1HFN A;  2PMZ B;  2G5D A;  4TSS A;  4RHR A;  3TBI B;  4EX5 A;  2J7Z A;  4ILW A;  1SYF A;  1BCP B;  3IKJ A;  2ASB A;  3E9H A;  1NR4 A;  2D62 A;  4ZLT F;  1K0S A;  2F0W A;  1BCP C;  2I5H A;  4A3J G;  1IBL Q;  1Q82 C;  4LF8 Q;  1CFM A;  1PH9 A;  1ICW A;  2H4O A;  3HOV B;  4K5V A;  2L9H A;  2B2W A;  1NBW A;  2F0J A;  1TWG B;  4GOP A;  5JOB A;  3ERQ A;  3HRZ C;  2DNC A;  5ELB A;  4UHV A;  5JVH 3;  3CRK C;  3EIV A;  1IYU A;  5FLX E;  3U9S A;  1FYC A;  3ULJ A;  1LAB A;  3FRP B;  2MGS A;  2CVR A;  4XYO A;  1TT2 A;  3D3R A;  1FVI A;  1O7Z A;  2EDG A;  2PO4 A;  4FF1 A;  5LL6 X;  4GZY C;  3MEF A;  1XX8 A;  2EYJ A;  2OT2 A;  2F4I A;  3J80 i;  3HOY G;  2CH4 W;  3DWP A;  4LUZ A;  4CKC A;  3BVG A;  1SRO A;  2ZXR A;  1C0A A;  3HOW B;  1JR0 D;  4ZRZ A;  4PZ8 A;  1YIJ A;  1ROD A;  3CC7 A;  2MHV A;  1EUJ A;  4MTN A;  4LUV A;  4FF3 A;  3KFU A;  4OL7 A;  5HY6 A;  3S1R H;  3PO3 H;  4N8X 1;  2JQO A; 
#chains in the Genus database with same CATH homology
 1SNQ A;  3S14 B;  1SAP A;  2B2V A;  2F1M A;  3AU7 A;  3EFX D;  5NUC A;  3BDL A;  3FKI B;  1TQO A;  4J6H A;  4CJ2 C;  5M3F B;  1C48 A;  1WTW A;  2XRQ D;  4ZUJ A;  3PV0 A;  4DN4 M;  2WKC A;  2ZT9 C;  3EQL C;  1DOK A;  3MFG A;  4LK1 C;  2B8F A;  1FR3 A;  4TQU S;  3OHX C;  1H9S A;  2JXM B;  1RDP D;  4IFD I;  3SXH A;  4EQO A;  1BO0 A;  5T1G A;  2EPB A;  2MP1 A;  1TWA B;  2QEJ C;  1O7Y A;  2QKI C;  2F0G A;  3BS1 A;  5E3F A;  2C9O A;  4DGZ A;  4CGY B;  1PYW D;  3HP3 A;  4M8A A;  3TME A;  2B39 A;  3E5S A;  1KTK A;  4RGO S;  4XDX A;  2RSN A;  1I6V C;  1OXX K;  1QB5 D;  2N55 A;  1HQR D;  4JK1 C;  5D65 A;  3D6C A;  3CKI B;  3MHB A;  4PMB A;  4CJ1 B;  1VMP A;  3C3L A;  4FF4 A;  4Z9C B;  2LMC B;  3OSO A;  5FO7 B;  1A3T A;  5C44 B;  1TVX A;  4H13 C;  1HCZ A;  1GUT A;  5E1F A;  4KD3 A;  5CYU A;  4HCS A;  3WDN A;  3GO5 A;  2I46 A;  1STB A;  1WD0 A;  1PRT F;  3PUV A;  3V2T A;  1L0X B;  4TRD A;  4R8I A;  2EZV A;  2JA6 B;  1RHP A;  5KNC A;  3S1N B;  1PDQ A;  2V4D A;  1KNA A;  1TWC B;  2JE6 I;  4KHV A;  3S1Q B;  1YNJ C;  2E2H B;  1UEA B;  3RZD B;  5C5L A;  5IGC A;  4IZ8 A;  2PYK A;  3PUZ A;  2K5W A;  5EKL A;  5KIX A;  4KJN A;  1PFN A;  3GTO B;  4IQZ A;  3S1M B;  1JWS D;  3FEW X;  2M9V A;  1LTB D;  1CK1 A;  1RKN A;  5C0X H;  1B9M A;  4H44 C;  1SND A;  5D3D A;  3OWF A;  3TZU A;  4C3I B;  1QCB D;  4XQN A;  4XYQ A;  1U4R A;  4L63 B;  3I72 A;  2MPM A;  4UAI A;  1HTP A;  3CRL C;  1ZEQ X;  1ENC A;  3VR2 A;  3MXU A;  1E0B A;  3QIA A;  2K33 A;  1S5C D;  2BE5 C;  2R7Z B;  4B9X A;  1SE2 A;  3BYY B;  5CV8 A;  5IIF A;  4B9W A;  5EKK A;  1I4G A;  5G3L D;  3BDO A;  4JBW A;  4F88 A;  5EJW A;  3OOC A;  3HOU B;  3HZX A;  2WII B;  1BBX C;  2SEB D;  1X3P A;  2D5D A;  1NR2 A;  1YNN C;  3H6M A;  3BDC A;  5KGU A;  1LO5 D;  3D4D A;  1Y1V B;  3GTP B;  1ILQ A;  1BDO A;  3J81 L;  1XXG A;  1GOZ A;  5CV5 A;  1NCV A;  2OEO A;  3AMU A;  4WRD A;  4HCE A;  2R61 A;  2R6G A;  3KBX A;  3H09 A;  5DM7 3;  2E2I B;  2L12 A;  5C4X B;  2Q8T A;  4MHE A;  2ID0 A;  3NTK A;  4EQN A;  3RZO B;  4LAA A;  1HRJ A;  3J7A F;  1PRT B;  1EYC A;  3J81 E;  2HDL A;  2F3W A;  4K8I A;  3I91 A;  4F7X A;  4P2C B;  4BBR B;  3HS0 C;  3S2H B;  2IT1 A;  1EYD A;  3WOF A;  1D1I A;  3VR5 A;  4XXE A;  2IL8 A;  1Z47 A;  2NN6 G;  4FNF A;  3PMF A;  4BY7 B;  1CQV A;  3I73 A;  2PNR C;  4DXG A;  1KNE A;  1O78 A;  4OHJ A;  5E4X A;  2YYZ A;  2E76 C;  2SDF A;  3H91 A;  2D2C C;  3HOX B;  5G3L F;  3H94 A;  3BZD B;  2A68 C;  2EVB A;  3EJI A;  1QOH A;  1WTP A;  1SNM A;  5EPL A;  3S9W A;  4A3M B;  1DOM A;  1AFP A;  2KHS A;  3CQZ B;  4I65 A;  1EY4 A;  5DM6 3;  1TU2 B;  2HDM A;  1KAB A;  1SEB D;  3R2I A;  1F9S A;  4RCN A;  1K8M A;  3GTJ B;  2EYH A;  1IKL A;  2FIN B;  1HXY D;  3HOZ B;  4FXG C;  1JE4 A;  5A2Q L;  1PTO B;  4O1N A;  3O13 A;  1H9J A;  1BNZ A;  4NW2 A;  1SYE A;  2HCI A;  3TP6 A;  2EYO A;  1KLU D;  3TP8 A;  2DN8 A;  3GD7 A;  1SNO A;  4FVM A;  5CBA E;  4DNT B;  1AW7 A;  2EOT A;  1EZ8 A;  1STN A;  4C3J B;  3D6W A;  3A56 A;  4HMJ A;  3DM1 A;  4HED A;  4U68 A;  2L4N A;  3T51 B;  2VUM B;  1V8Q A;  3DWA A;  4A3B B;  1PMR A;  2O2L D;  4H7B A;  2Q8I B;  5JEA G;  5A2Q E;  3G6J B;  3ERO A;  1JWM D;  1JQY D;  4DAY A;  3KLS A;  2B2T C;  3TZD A;  3K6O A;  5C5M A;  2QIL A;  3VYS A;  2C5C A;  4U67 3;  4QCL A;  3K0Y A;  3P7J A;  1CHQ D;  1M4V A;  4NKL A;  1Y8N B;  2AUK A;  5JJZ A;  3C2P A;  2EYF A;  4RKL A;  1PFB A;  1EWH A;  1SXT A;  3IFD A;  1WCM B;  5D3I B;  2L55 A;  1F2Z A;  2FJ2 A;  3W3A A;  5ELD A;  5C0X J;  4C3H G;  2EY6 A;  2M00 A;  2Z4H A;  5J22 A;  1WTQ A;  3QWN A;  1SYD A;  3HEJ A;  2K5D A;  5I9P A;  3HG9 A;  1SDF A;  2AWO A;  3NE5 B;  5C4J B;  5FO8 B;  4KV6 A;  4C3J G;  1EIG A;  1CZW A;  2LY7 A;  3MZ5 A;  4R8N A;  1HQM C;  1JOO A;  3MA2 B;  4XT1 B;  1A6X A;  2WAC A;  5EPJ A;  1V1O A;  1D5Z C;  1HHV A;  3FDT A;  1NSN S;  1J8I A;  2XWB B;  1EL0 A;  3Q6S A;  4LJZ C;  2NB0 A;  3NPP A;  4A3K B;  4QMG A;  4BBS B;  2A6H C;  2E74 C;  3NSW A;  2F0P A;  3IL8 A;  1CM9 A;  2BE5 D;  2NVY B;  3A54 A;  1CT1 D;  1SSO A;  5JPN C;  5IGB A;  1AZQ A;  1B3A A;  1Q1E A;  3Q23 A;  2F0E A;  1DM0 B;  4DNR B;  1F9Q A;  1LTT D;  3SK8 A;  2K01 A;  3N6R A;  1EYA A;  5HGT A;  1OXS C;  3NXW A;  4G4K A;  1MBY A;  1YNN D;  1B4O A;  2XNA C;  5FKA C;  5EBD A;  2B2W C;  3GV6 A;  4A3F B;  2JA8 B;  3I4M B;  2N88 A;  1EIH A;  1L0Y B;  2XWJ B;  4XQJ A;  4OO1 G;  4IUP A;  4CKE A;  2BCO A;  5FOB B;  1QE6 A;  3C1E A;  3DUZ A;  1STG A;  1R9T B;  1B9N A;  1QNU A;  4X3S A;  2JP1 A;  3E0J A;  2EJF C;  4ME5 A;  3X3M A;  1FD7 D;  2KEE A;  1CA5 A;  2PZW A;  1DXM A;  3J7Y W;  4BWG B;  1CQF A;  2K04 A;  3H0G B;  2HUG A;  4KHZ A;  3RLF A;  2QDB A;  1D6E C;  4K2K A;  1KDB A;  2L0C A;  4MN3 A;  2A68 D;  4FXD A;  2XRS D;  4HAE A;  3J80 L;  1G8Z D;  3S15 B;  2K7V A;  5BN4 A;  1H9S B;  1OXV A;  3URY A;  2A5H A;  2NTT A;  2M2L A;  3FPP A;  2E75 C;  1A3U A;  1E2W A;  4J8Q A;  2AQ3 B;  3SK5 A;  4IAL A;  4FYD A;  1Y8P B;  1G2T A;  1XWE A;  3SDZ A;  2KQ3 A;  4DA2 A;  1A3V A;  1JCK B;  5M5X B;  2F0V A;  4KK7 A;  5ELC A;  3J80 E;  2KOL A;  1WTR A;  1E2V A;  4C2M B;  1R4Q B;  5ISR A;  4KKU A;  2RBM A;  1JOK A;  1FNW A;  1MGS A;  3NK9 A;  3I70 A;  2F0U A;  4KY7 A;  5CC4 A;  3M7N A;  1STH A;  1WTO A;  3KLR A;  5KND A;  5JVG 3;  3OPO A;  4WFN 3;  2JA7 B;  2NN6 H;  4BY1 B;  2F0I A;  1KAA A;  4OIK A;  2WIN B;  3C1F A;  1S5B D;  2L5T A;  4N9P A;  1WTV A;  3KK7 A;  3CU7 A;  5IOD A;  3M4O B;  2NUC A;  1DJR D;  3N52 A;  2LKV A;  1UNS A;  1HUN A;  1Q3L A;  3M7G A;  1EZ6 A;  1S5D D;  1WTX A;  2RA4 A;  3VYU A;  2CW0 D;  2LFN A;  2F0F A;  4Q0F A;  2DNE A;  3I3C A;  1F2M A;  2X69 A;  1C8C A;  2O5I C;  2XSC A;  4IFD G;  2OF1 A;  4L6T B;  4BA2 I;  3H3V C;  4PQX A;  3LWE A;  3KLS X;  1GUN A;  2B2Y A;  5C3E B;  1DD2 A;  1SYB A;  1EOT A;  3ITP A;  2R93 B;  1GUW A;  1EEF D;  3S2D B;  3T4A C;  1Z6H A;  1VCI A;  2RDG A;  1LTI D;  1BCP D;  1Y1W B;  5C0X I;  3W2D A;  4A3G B;  2VNU D;  1MI2 A;  3L9A X;  3A8J E;  2F0D A;  5EQ0 A;  1SYC A;  5JEA H;  1GXD C;  5C3X A;  5IGD A;  3D31 A;  2A6H D;  3I8Z A;  1DYQ A;  3A7L A;  3WOE A;  4X3U A;  4EGV A;  5J39 A;  3X3N A;  5EPK A;  4IUR A;  2JEB I;  1ENF A;  4B08 A;  2K6A A;  4IN3 A;  1EY7 A;  5DEH A;  1T5E A;  1HA5 A;  2I07 B;  4ZQ3 A;  1PTO H;  4C3I G;  5C3W A;  1B1Z A;  3HGB A;  5J1Z A;  4A93 B;  2FHT A;  4G57 A;  5M3M B;  1E2Z A;  1KDC A;  2X6L A;  2ZXO A;  1EU4 A;  2H1E A;  4CJ0 B;  4EVO A;  1CHP D;  1PRT C;  4DF7 A;  5A35 A;  3MXN A;  4RA8 A;  2EYL A;  5T1I A;  1KLG D;  1M8A A;  1BXT A;  3MXG A;  2PCF B;  3QB3 A;  1EY6 A;  1BCP F;  2ICI A;  3DXJ C;  1ILP A;  2NBF A;  3TN2 A;  3PUY A;  4QF4 A;  3F2U A;  5M9O A;  2F0O A;  2EE1 A;  3GV3 A;  2JSO A;  1IKM A;  1SJE D;  2NZ1 D;  2X6G A;  3A55 A;  3VYT A;  5CBE E;  4HSP A;  1GUG A;  2MJ8 A;  3UI2 A;  4DFA A;  4RAU C;  2K05 A;  1V1P A;  5COR A;  1STA A;  1TWH B;  1HA6 A;  2PW7 A;  5KRU A;  4M1U B;  2Z4I A;  2A69 C;  1AEX A;  2F0K A;  5DAU A;  1SNP A;  1B44 D;  2F0L A;  3M85 A;  4DU9 A;  1Y8O B;  4ULL A;  1SE4 A;  5CGK A;  1PTO C;  3TP5 A;  3S17 B;  3MWY W;  1A2T A;  3IFT A;  4OO1 H;  1F2L A;  4CHT B;  2G9D A;  4NMZ A;  1LLR D;  3R8B A;  1V1P B;  3SK4 A;  3PUX A;  3LWU A;  4XIG S;  4NP5 A;  2B2T A;  2KED A;  1TII D;  1PLF A;  3A7A B;  2RSO A;  2WB1 B;  4K8J A;  3K57 A;  1LTA D;  1QG7 A;  3GP7 A;  3K5N A;  1D5X C;  2K5Q A;  1G91 A;  3K5L A;  4PMW A;  2SOB A;  1LTG D;  1STE A;  4RFB A;  3BG3 A;  4N9T A;  4CKB A;  1F77 A;  1A2U A;  1R4P B;  1LTR D;  3NWS A;  3QJY A;  1PFM A;  2VXW A;  3E6Z X;  4KKS A;  4ID6 A;  1YNJ D;  3PIO 3;  2F0Q A;  2IWH A;  4BS9 A;  1U9R A;  2R92 B;  2Z8L A;  4RCO A;  5K36 G;  2EYP A;  4QUF A;  1TKW B;  1RF2 D;  1GUO A;  5C6A A;  4DK0 A;  3NHH A;  1UUP A;  4ZKB B;  1ET9 A;  1Q1B A;  1I4R A;  5I6Y A;  1MSH A;  2F03 A;  2AQ1 B;  3HOY B;  2F0T A;  1SJH D;  4V19 0;  1QNK A;  4H0L C;  3C46 A;  3U9O A;  3MFY A;  1HTL D;  3Q22 A;  1U4P A;  5M5Y B;  1GUS A;  4IUT A;  1GHK A;  1SMY C;  4A3I B;  4ZK9 B;  2HCC A;  4MIU A;  1S5E D;  1G2S A;  2IJ0 A;  2A73 B;  1RJT A;  1K83 B;  5LHY 1;  4K6L A;  3VYR A;  1TS3 A;  2WV6 D;  1QWY A;  1EY8 A;  1K8O A;  1HFG A;  5JEA J;  1F9P A;  4G7Z C;  3LX0 A;  2B2U C;  4HTH A;  1OXT A;  5FK9 C;  2RKS A;  3QOL A;  5AFW A;  2FMC A;  2FMM A;  2F0S A;  1I6H B;  1NUC A;  4KJO A;  3VA5 A;  3MTS A;  3GTL B;  1ZYR C;  3TSS A;  4AYB B;  1I4Q A;  3DHQ A;  3GTQ B;  1X32 A;  4KD4 A;  3DEP A;  5I2Y A;  3PIP 3;  4KY6 A;  4NDX A;  1EY9 A;  4K6D A;  1QJO A;  2RVL A;  2LS0 1;  2IX0 A;  3K58 A;  2RQX A;  3DMU A;  1ESR A;  1IW7 C;  3ONA B;  2TMP A;  2NVT B;  5IGG A;  4IFD H;  3KF8 A;  2PQE A;  4ABN A;  1FGB D;  3KUP A;  1OXU A;  2F0H A;  3QO2 A;  4ZYS A;  3D8G A;  1CTM A;  3EA6 A;  4K14 A;  1PZJ D;  2Q8R E;  3A8K E;  3J7A V;  3Q24 A;  1EU3 A;  1B50 A;  3I4N B;  4OIJ A;  2KA7 A;  1PRT D;  2ICE C;  4FXK C;  2F0N A;  1NAP A;  4RGM A;  2B2V C;  3BYT B;  4RGN A;  3L7Z C;  4V0B A;  2K28 A;  1VF5 C;  1OO9 B;  2AQ2 B;  1LV9 A;  4QUC A;  5E4W C;  4IUV A;  1O7L A;  1EWC A;  2PW5 A;  5C4H A;  1JOQ A;  1CZG A;  1Z7T A;  1W6J A;  3FVQ A;  4O42 A;  1FNU A;  1RTN A;  5FO9 B;  2A6E C;  4CBV A;  1AZP A;  4X3T A;  1EQT A;  1HPC A;  4FF2 A;  4I7Z C;  2PPB C;  1PXU A;  1TR5 A;  2A69 D;  3VA7 A;  1QIL A;  3D4R A;  3S1R B;  5I2X A;  3PO3 B;  2VB3 X;  5CR3 A;  1CI3 M;  1PTO D;  2Y0S B;  2BDN A;  1II3 A;  3NTI A;  2JA5 B;  1JWU D;  2DY7 A;  2F0M A;  2CQA A;  1ENA A;  1LTS D;  1X3Q A;  2JEA I;  5BN5 A;  1F2Y A;  3D4W A;  3NP8 A;  4HSV A;  5KEE A;  4Y7N B;  3OMG A;  3T13 A;  2FFK B;  3PUW A;  2EJM A;  4G7H C;  3R2T A;  4UDU C;  1F9R A;  1LT5 D;  2MUY A;  1XYI A;  3MVV A;  2O4X A;  1ESF A;  2RDF A;  1HUM A;  1SFO B;  5M5W B;  1B53 A;  1Q90 A;  1FNV A;  3LNN A;  3K5M A;  2BDO A;  1RTO A;  5CV6 A;  1EY5 A;  1SE3 A;  3I4L A;  5ELF A;  2KCC A;  1LT3 D;  1T5X D;  2XN9 C;  4K5W A;  4DXF A;  2HQE A;  3MC0 B;  4K2L A;  2AUJ D;  1U4M A;  1VMC A;  1AN8 A;  3A8I E;  1BR9 A;  2KUM A;  4XTC S;  2J4X A;  1JIC A;  4RWS C;  3T53 B;  4Q5V A;  3NQT A;  1PZK D;  4HR7 B;  3DWQ A;  1MD2 D;  3OIQ A;  2BA1 A;  2NN6 I;  1DCZ A;  3TP7 A;  2Z1C A;  1G6Z A;  3I90 A;  4R9W A;  4RHS A;  1A15 A;  5CV4 A;  2QCP X;  1EQV A;  2F3V A;  2K32 A;  5LL6 S;  1PTO F;  1KDA A;  2E2D C;  4BA1 I;  4DAV A;  1I3Q B;  2EJG C;  3VR6 A;  5DNF A;  5I6W A;  1CA6 A;  1D5M C;  3M3Y B;  4IUN A;  1SMY D;  3L3O C;  1DOL A;  2KCN A;  3OWE B;  4KKT A;  1AP0 A;  3NQI A;  4A3D B;  2KVM A;  4C1N K;  3PO2 B;  5IT9 L;  1SBB B;  4WJW A;  4X3K A;  1I4P A;  2IX3 A;  4KN4 C;  2B2Y C;  5CV7 A;  2K03 A;  4EQP A;  1TY0 A;  3MAQ A;  4QB4 A;  2SNS A;  1H9R A;  3MXP A;  4E6I A;  3NBI A;  3SEB A;  4F87 A;  1XTC D;  4F8M A;  4WOR A;  3GTK B;  1S4Z A;  2BOS A;  3GTG B;  3K5O A;  1ONL A;  1O80 A;  2NWG A;  2WKD A;  1ZYR D;  4OGQ C;  5K36 H;  5COY A;  5CMD A;  3SE0 A;  3BVZ A;  5BN3 A;  5HUR A;  4DK1 A;  1B2T A;  4K5X A;  5IT9 E;  1ZKO A;  1S5F D;  4ZAI A;  1LAC A;  3HKZ B;  2NVX B;  4FO2 A;  1ZXT A;  3P75 A;  4PNY A;  1ML0 D;  2EXZ A;  4A3E B;  4G7O C;  4IFD J;  4QIW B;  2O5J C;  3FPU B;  2ZXP A;  1DON A;  4S3S A;  2QF7 A;  3K7A B;  1ET6 A;  1IW7 D;  2XIW A;  1TS5 A;  5I4D A;  1GJX A;  1JOR A;  1SNC A;  3RMH A;  5KNB A;  1VF7 A;  1I4H A;  2IX1 A;  3BVM A;  5D14 A;  1EEI D;  3QOJ A;  1PZI D;  1Y69 U;  5KYL A;  3SVM A;  1C4Q A;  1BF4 A;  4KTA A;  1BQQ T;  4RGT A;  1U4L A;  1V43 A;  2IW3 A;  1MSG A;  3SR1 A;  1VDZ A;  1IYV A;  4DAP A;  3GTM B;  2JYO A;  4ODG A;  5EGT A;  3OIP A;  2J0T D;  2B63 B;  2L1B A;  3SK6 A;  2ENB A;  5TSS A;  4IUU A;  3OMC A;  2RDH A;  1TY2 A;  1J9O A;  4KMU C;  1JB3 A;  1BUV T;  3NBH A;  5K5P A;  3QG1 A;  1LT6 D;  3ND8 A;  2A6E D;  3T56 B;  3V05 A;  3JAM L;  1TS4 A;  2PZU A;  3CHB D;  5C0X G;  2WAQ B;  3K59 A;  3NWT A;  2NVQ B;  3G7L A;  3NUC A;  1IL8 A;  4XT3 B;  2DY8 A;  2A74 C;  1STY A;  2BA0 A;  2KJX A;  4C3H B;  4RH6 A;  3ND9 A;  2SNM A;  1I50 B;  4RKB A;  4KY5 A;  1D1K A;  3GQB A;  5ELE A;  5IGF A;  1GHJ A;  1WVL A;  3AB9 A;  5JAV A;  3P1H A;  3SHL A;  4FP5 D;  5KYI A;  4YIJ A;  4ZUI A;  5CV9 A;  3JAM E;  4KN7 C;  3DEO A;  1IHZ A;  5EKI A;  2WP8 J;  5IOC A;  3R3O A;  3KBG A;  5IGE A;  3T16 A;  1BOS A;  4A3J B;  4PV1 C;  2AWN A;  4HN7 A;  2PZT A;  1EFI D;  2KEC A;  1G29 1;  2EY2 A;  4OO1 I;  2EY5 A;  2NTS A;  1TWF B;  4IUQ A;  2K1B A;  1H9K A;  1RD9 D;  5EBC A;  4C56 C;  3IAY A;  1SYG A;  2EY1 A;  2GA4 B;  3NTH A;  1W6K A;  1Q8I A;  2CHB D;  3R93 A;  5C4Z A;  5JPM C;  1UAP A;  4J1M A;  3P20 A;  2E2J B;  2CW0 C;  4ZKC B;  5I9O A;  3S16 B;  1DZ1 A;  4KI0 A;  3VR4 A;  2TSS A;  4LMQ D;  1RCV D;  1Q12 A;  2OXP A;  2D9U A;  3OW7 A;  3ZYY X;  2B8G A;  2G9H D;  3VR3 A;  2L11 A;  1D2B A;  4HMI A;  2IPK D;  2XVS A;  3RD4 A;  4TKO B;  1TS2 A;  2R3Z A;  4C1N I;  1WD1 A;  2YU9 B;  3FMC A;  3EVQ A;  4PMC A;  3Q0A A;  3TDQ A;  2EYM A;  1JC7 A;  4L8J A;  2VB2 X;  2B2U A;  5FLX L;  4XQQ A;  5F2D A;  2NYZ D;  1EY0 A;  3M4Y A;  3MEH A;  3RUZ A;  1I4X A;  1H9M A;  3V96 A;  1LT4 D;  1HFN A;  2PMZ B;  3TBI B;  4TSS A;  4RHR A;  2J7Z A;  4ILW A;  1SYF A;  1BCP B;  3IKJ A;  4ZLT F;  1NR4 A;  2D62 A;  2F0W A;  1BCP C;  1CFM A;  1ICW A;  2H4O A;  3HOV B;  4K5V A;  2L9H A;  2B2W A;  2F0J A;  1TWG B;  5JOB A;  3ERQ A;  3HRZ C;  2DNC A;  5ELB A;  5JVH 3;  3CRK C;  1IYU A;  5FLX E;  3U9S A;  1FYC A;  1LAB A;  3FRP B;  2MGS A;  2CVR A;  4XYO A;  1TT2 A;  3D3R A;  1O7Z A;  2EDG A;  2PO4 A;  4FF1 A;  5LL6 X;  4GZY C;  1XX8 A;  2EYJ A;  2OT2 A;  2F4I A;  4CKC A;  3DWP A;  3BVG A;  2ZXR A;  3HOW B;  1JR0 D;  4ZRZ A;  1ROD A;  2MHV A;  4FF3 A;  4OL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...