4ULLA

Solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN I SUBUNIT B
publication title Solution structure of the carbohydrate-binding B-subunit homopentamer of verotoxin VT-1 from E. coli.
pubmed doi rcsb
total genus 14
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1996-12-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ullA00
1DM0B 1R4QB 4M1UB 4ULLA 4P2CB 1QOHA 1R4PB 2GA4B 2C5CA 1CQFA 1CZGA 1C4QA 1D1IA 2XSCA 2BOSA 1CZWA 1C48A 1QNUA 3MXGA 1BOSA 1D1KA
chains in the Genus database with same CATH superfamily
3OYYA 4P71A 3S1QH 4DV7Q 3H91A 3AMUA 3DLLA 5LMUQ 4DR5Q 3V96A 2K04A 5IYBG 4IUUA 4O0AA 2A68C 2C35B 1A2TA 1HQRD 1A8VA 3K5MA 3CCMA 2D5DA 4DV3Q 4CJ2C 2Q8IB 4CDEC 2BOSA 1CKOA 5FO7B 4JI8L 4G57A 2JP1A 2Z1CA 1KLUD 4FXGC 5FO9B 1CI3M 3S2HB 1JOKA 1WTPA 5IP9H 1O80A 1U4RA 3I4NG 3H6MA 1SLJA 2VB3X 1F9RA 1I4GA 2B2TC 3SE0A 4JI3Q 1P8LA 1SNOA 1B3AA 5EGTA 3TBIB 1BUVT 4R4QA 3C1FA 2QCPX 5E7NA 3CHBD 3HOZB 4B3MQ 2Z9HA 4AYBG 3PO3H 1HUMA 1EU3A 3M85A 1EWHA 2A73B 3LWUA 3MZ5A 2CKZB 3HOZH 1BBWA 3L9AX 5DM63 2EYPA 3HOYH 2NWGA 4A3GB 5M3MB 1VMCA 1BKBA 4DR4L 2O5IC 3K7UC 5GROA 1XPOA 2N78A 1X54A 1JT8A 5M3MH 4JI6L 3EVQA 3PIOA 5IP7H 3GTJB 1EYDA 4RFBA 1V1PB 1RTOA 1EY4A 4DV2L 1STGA 3DM3A 1IKMA 3PF4A 5D65A 1M90C 5KGUA 2PCFB 3GTJH 2QW7A 3CMEA 2NN6G 3PIP3 4QUCA 3Q24A 3TS0A 1UE6A 4JI8Q 5D14A 4DA2A 1MGSA 1PVOA 4IJLA 1CZGA 3CPWA 4WJ3M 4PNYA 1L1OC 1A2UA 2DN8A 3X3MA 2WB1E 4JVZA 1JOOA 3KF8A 2N49A 5FLMH 3TREA 1X3FA 2M9VA 1STBA 1VQ9A 1LT5D 1XMOL 3H0GB 4B3TL 1QILA 3UDFA 3JC66 1HR0Q 2KOLA 2DNEA 3HKZG 2G5DA 4KD3A 3HOXG 2KENA 3D31A 2EYHA 4P72A 4GLAC 4A93B 4EQPA 4ODGA 1VS0A 2R3ZA 2D0PA 3EJIA 4DR4Q 2R7ZG 3U9SA 4DR1L 5I9PA 2AQ2B 4QUFA 3OHXC 4JCVE 3T53B 5M5YB 1ASZA 1G2SA 2NVXB 2Z8LA 4IJHA 1VQCA 5C0XG 5JPMC 4QIWE 4RHRA 3PIPA 3KFUA 5ELOA 3G48A 2EZVA 4DAPA 5K36G 4M8AA 4DV2Q 4QGUA 2NZ1D 3BG3A 4XXEA 4A3LG 1M4VA 2MUYA 1ET6A 3W1BA 3BYYB 2F0WA 2OT2A 5GAEC 1BCPC 3CC7A 2JA5B 3PO2G 3KLSX 4ZYSA 2XNAC 1Y1WB 1CFMA 1DXMA 2EIFA 1I94L 2JA5H 2QEXA 4JBKA 1FR3A 5I6YA 1IW7D 2EQSA 4IUPA 4LW1A 4GKKL 4DV6Q 4DV1L 2PW7A 1NCVA 4HN7A 4B3TQ 1ILQA 2WFWA 3DEPA 1PFNA 4BY1B 3EQLC 3CRKC 3J81c 2JA7G 3OTOL 1ZXTA 3NQTA 3ND8A 4B9XA 1BOSA 1CA6A 1AW7A 3CXCA 4RGOS 4L6TB 1YHAA 4HJAA 4NMZA 5EBCA 2EYJA 1Q86C 2CW0D 4IFDI 1PYWD 4HJ5A 2QKIC 1B44D 2HQEA 1Z6HA 3RR5A 3NWTA 3W5OA 4DR1Q 2ES2A 2BA1A 4R4TA 1GUNA 1YIJA 1ASYA 2R7DA 5IYCG 1RL2A 1XTCD 2SDFA 4KY7A 4YCVA 4ZKCB 4A3FG 1KRSA 1MJCA 5CBEE 1WD1A 3DWAA 4GKJL 3ULJA 1B7YB 1TY0A 1LM0A 3J80c 2X69A 1JB7A 3HOUB 5JEAH 4LWCA 4XDXA 2NVQB 4K6DA 1YNJC 4DAMA 2D2CC 1W2BA 1AZQA 3H3VC 1A3VA 4FF3A 1NR2A 1BVSA 5F2DA 5COYA 5ISRA 4DK0A 5HURA 1EEID 4KHPL 5JJLA 1I94Q 1S5DD 5ELFA 1VQPA 4YWKA 2OEOA 3QOJA 1ET9A 1Y1VG 4CJ1B 1F9SA 2K6AA 3OWFA 4K5WA 4C3JG 4DV1Q 1GHKA 1QZGA 1KHIA 1QCBD 1GUGA 4LUZA 3DHQA 1EEFD 1HCZA 1ENCA 2F0HA 3GTMB 2PMZB 5IT9E 4QF4A 2VUMG 2HD3A 2HQLA 3TEHB 3OTOQ 5ELNA 1PRTF 3E3XA 3K81C 2IX1A 1JORA 3GTGB 1K0RA 1KAWA 1KNAA 2PZTA 3A0JA 2K5NA 1PH6A 3UE1A 3IL8A 1UWVA 1W6KA 2L11A 5JVH3 2LXKA 1HFGA 5DLQE 3VDYA 1YITA 1WTQA 1JWSD 3NQIA 3S15B 1JE5A 4KKTA 5L37A 4DXGA 2WAQB 3S17B 3HGBA 1HA5A 3CCUA 1DYQA 3TP6A 4GKJQ 2J0TD 4G7OC 3VYUA 4R1JA 3O13A 4J6HA 1B2TA 1GUTA 3S17H 1STHA 5LMNQ 4V190 4BA2I 3MXPA 1SSOA 1PHJA 1KLGD 1I4PA 1PZKD 1E3PA 1U9RA 3AFPA 2F1MA 4WJ4A 1SE3A 3EBEA 3FPPA 3OIPA 1QG7A 4KHPQ 4JI0L 1EL0A 4HAEA 1WCMB 4C3HB 2PO4A 2ASBA 1PYSB 4LUVA 5G3LD 1YHQA 1PYBA 4QJFA 2D9UA 3SXHA 1VF5C 2IY5B 3KJPA 4PMCA 4KTAA 5C4JH 1KABA 2FXQA 1E2WA 1G91A 4GNXA 3NHHA 2O4XA 3K8AA 1H9SA 5D3IB 4L5QA 1X9NA 2RA4A 2K50A 3PSIA 1SE2A 2RKSA 5C3EG 1PA6A 1AP0A 1XJVA 4IALA 2LS01 3PMFA 2FHTA 1B9NA 5C44G 4QMGA 1NJIC 4ZKBB 4P74A 2Z6KC 4DV5L 1D1KA 2G9HD 3QG1A 1X65A 2Z4IA 3QOLA 1VF7A 1RHPA 2VY3A 1PV4A 2L5TA 4C56C 5EJWA 4LF5L 2ICEC 3D3RA 2JE6I 5KYIA 1FL0A 3NTIA 2FMCA 1NSNS 1KAAA 4HMJA 4F88A 4DAYA 4BA1I 3G6EA 1TS5A 1V43A 2VNUD 1GUOA 4FF1A 1Z47A 1IL2A 4JOIC 5EQ0A 1R4QB 5KEEA 2QEJC 4HJ9A 4JI0Q 5LHY1 1JJCB 4HMIA 1UE7A 1AN8A 3TSSA 2DY7A 2JA8G 2AQ1B 2E2IB 4FXKC 3IAYA 1Q3LA 1I4RA 3R3OA 1BCPB 2B29A 3TN2A 3D0FA 4QB4A 3Q22A 4GZYC 3BJUA 1DOMA 2E2IH 1BDOA 4XIGS 1V1QA 5EPKA 4BXXG 1EIFA 1F9PA 4NB3A 4RA8A 1S5ED 2Q2HA 2XGTA 2K5DA 5KRUA 3BDLA 2UXDQ 3DM1A 3RLFA 5LL6S 3VYTA 3K57A 2R7FA 3CMAA 4OO1H 5CV7A 5FK9C 4LF8L 3TP8A 3D8GA 1PH7A 4OO1I 4C3IG 2NTTA 3NXWA 4DV5Q 1E1TA 1M8AA 3S1MB 2F0KA 4JI5L 1KXLA 3ONAB 1QNUA 1QZHA 1E2ZA 1EZ6A 3R8BA 4Q5VA 3S1MH 4QCLA 3ER0A 3TZUA 1GUSA 2F0MA 1B3QA 3R2IA 1IKLA 3CW2C 5KNBA 3GV6A 3E9IA 4JI1L 2AQ3B 1S40A 4DN4M 4EQNA 3MXNB 1SYCA 4CJ0B 5AJ3Q 1Q90A 4YHHL 4GOPA 2R92G 1A3TA 3TZDA 3I4NB 2VZAA 1STYA 1XMQL 4IUVA 1VQ5A 1X32A 4LUOA 2UUAL 1YJNA 3F8TA 2Q2IA 1EY6A 1MIUA 1TWAH 3UE0A 1I4QA 2IX0A 2X6LA 5IT9L 2L15A 1SE8A 2JA6H 4OL7A 4N9TA 4DR2L 4GLXA 2B63B 4RG1A 4PZ7A 4AYBB 2B2VC 1DONA 1K8OA 3I70A 1PRTC 3MXNA 5KIXA 3WOEA 1VQOA 2BA0A 3H3VH 2NBFA 1T5XD 4O1NA 2B63H 2A68D 3H3VI 1SYDA 2E75C 1LT3D 2CWAA 3D4WA 1S3OA 4LF8Q 5BN4A 2KVMA 1F77A 1QWYA 2RDGA 4OWXB 4RWSC 2KEEA 3CCSA 4LF7L 2C5CA 5FLXc 2F0FA 5JOBA 2X6GA 1TIID 4YY3L 2F3WA 3NE5B 1U0LA 4TRDA 2YTYA 3BZKA 5IIFA 4H44C 2F0IA 4UAIA 2UUCL 3HP3A 4JI1Q 1JR0D 3I90A 1Q82C 2IW3A 2OCEA 2F0JA 2D0OA 2PMZE 4CKCA 4BY7B 2MO1A 2JA9A 2HHHL 4M1UB 1SAPA 4KMUC 1AFPA 4YHHQ 1T5EA 2NN6I 1VCIA 2CFMA 2XWBB 2F0LA 1TS4A 3JAME 4BY7H 1XMQQ 2KHIA 2UUAQ 1VQBA 2K5QA 1WFQA 1RD9D 1JJGA 4K8IA 2SNSA 2ZXPA 1SMXA 1H95A 1IYUA 1U4LA 4N8X1 1LV9A 1K3RA 3J7AF 4A3CG 2F0NA 2WAQE 1QJOA 3TRZA 3K5NA 1WOCA 3W3AA 1EQVA 1Y8OB 2E2DC 4PZ6A 1HTPA 1X6OA 2I07B 2IT1A 2FJ2A 2NZOA 5IY0A 5KNDA 1WVLA 1JCKB 1EYAA 3F2BA 4A3IB 4X65L 4LF7Q 4YY3Q 1ICWA 5D3DA 5C0XI 3A7LA 3HEJA 3CP0A 4A3IH 1QOHA 1JMCA 2WB1G 2UUCQ 4DNIA 1E2VA 2VL6A 5CGKA 4JK1C 3HOVG 1N9WA 3U50C 3W1GA 4ZCKA 1X3EA 4H02A 3PO2B 3WDNA 2HHHQ 2KCMA 1GOZA 4P75A 4JC0A 3A5ZB 4A3KG 1GD7A 2QDBA 2K14A 4HCSA 3S2HH 4X6AH 3VR2A 2EYLA 2PI2E 2HIVA 2H1EA 2XIWA 5C4XG 2KA7A 2A5HA 1B9MA 1MSGA 5I4DA 1HRJA 3OW7A 3TS2A 1HZ9A 1K8MA 2PQAB 1SDFA 5J22A 1SRUA 2M2LA 2EJMA 1HJPA 1G6PA 5JPNC 2VQEQ 2F0UA 4OIJA 2IPKD 1C0AA 4FF4A 2UXBL 1XNRQ 5JVG3 2LKVA 1NMGA 1OXUA 3T51B 3MC0B 4RGTA 3RN2A 4LF9L 3NTHA 2ZXOA 3EFXD 1Q8IA 1BCPD 5C4HA 1I4XA 2F0EA 1IL8A 2N8NA 3HOWB 1F9QA 2CQAA 1WTWA 4A3GH 1ICFB 2PQAA 3R93A 5T1GA 2HDMA 4X65Q 1J8IA 1KL9A 3NEMA 3ITPA 2UXCL 3HOWH 3GDEA 1PTOF 1TQOA 1RODA 2B39A 3KF6B 3R2TA 1VQMA 4DPGA 4A3BB 2RF4A 3UDIA 4GNXC 3VR3A 3QJYA 2AWNA 3E0JA 1U5KA 3D4DA 4DV0L 4GS3A 4A3BH 2CWPA 2NVYB 1BBXC 1EWCA 1A62A 1V1PA 3I2ZA 1K8AC 2KHSA 3T16A 2EYFA 3Q0AA 4DR3L 2RBMA 3MEFA 1D5ZC 5C3WA 3MVVA 1UEAB 2VUMB 3BVMA 4YWMA 4KLKA 1W3SA 3CRLC 3H15A 1IBML 2UU9L 2EY5A 3FPUB 3Q8DA 1LLRD 4X3TA 2MJ8A 1R4PB 2XRSD 1AH9A 4F87A 3S1NB 1EOVA 1Q8KA 4IPHA 3H0GH 3K5OA 2UXBQ 3BDCA 1CA5A 2R93G 3S1NH 4LF9Q 1YNJD 3M4OB 3GP7A 1K28A 1XXGA 4A3MG 1PH4A 2Q2UA 4A93H 1H9RA 2EDGA 5JEAJ 1SN8A 1VQNA 4KV6A 3A56A 1PRTB 1JQYD 4JI6Q 3F1ZA 3KDFB 1YZ6A 3M4OH 5GADC 3W2DA 2I0QA 4N9PA 3C46A 2UXCQ 2RDFA 5M5YH 1EYGA 4B3SL 1UUPA 2NVXH 4BBSG 3PUWA 1E7ZA 2XN9C 4CBVA 1XNQL 2A19A 2O2LD 4PV1C 5IOCA 2A6EC 1SR3A 3KYHC 5CV9A 5FKAC 3FKIB 1VQ4A 5FJ8H 1FYCA 1Y8NB 2F52A 1AE3A 2DY8A 1CK1A 5IODA 3E9HA 5EKKA 2AHOB 4A3DB 4B08A 4AYBE 3FKIH 3Q23A 1WJJA 3JAML 3VA5A 4DV0Q 1PFSA 3G6JB 1PFMA 1YBYA 2EVBA 3IRBA 4A3DH 3KJOA 4HIOA 3IKJA 2R61A 4UDUC 1Y1WH 2L55A 4IPGA 3V2TA 4HJ7A 4DR3Q 3ULLA 3SVMA 3U9OA 4JBWA 1XMOQ 1G6ZA 2XWJB 1IBMQ 2UU9Q 4JPBW 2CVRA 5IP9G 4X62L 1PLFA 5IGGA 2K7VA 4IFDH 2VB2X 1N8RC 1SJHD 4BY1H 1NNXA 2K33A 1DCZA 1XPUA 5C44B 2OQKA 4IQZA 4CDCC 3U58A 2B3GA 2I46A 3PO3G 1B70B 1H9MA 3KOJA 5C5LA 1EZ8A 3QR8A 1DOLA 1PH5A 1X3PA 4GOPC 2FMMA 3FHWA 3HOZG 2A8VA 1HUNA 4B3SQ 4CDFC 3HOYG 5CMDA 3A8IE 4G4KA 4PMWA 3J81j 1XNQQ 3AEVA 2NZHA 1LTGD 1D6EC 4ILWA 4JBJA 5GAGC 2F4IA 1LTRD 5IGEA 5M3MG 3LX0A 1J5EL 1O7ZA 1FNWA 5TSSA 2NVTB 5IP7G 4RCOA 4DF7A 3SHLA 3HOUH 2J4XA 2K05A 3FP9A 3BVGA 3VR5A 3CCRA 2NVQH 2RDHA 2BE5C 3RZOB 4H7BA 1E1OA 4DKAC 2UUBL 2CH4W 1YJWA 2SOBA 4CGYB 5IWAL 3I56A 2ZM6L 2Y0SG 4FDBA 1EUJA 3JAMi 4GKKQ 2K75A 5EAYA 4CHTB 1P16A 3CU7A 2B2WA 3RD4A 2F0DA 2PYKA 4RGNA 1VDZA 1Z7TA 4ZAIA 4X62Q 2KBNA 4NXNL 1VQDA 2GVBA 3GTMH 4YIJA 2H4OA 5JJKA 4CDDC 4N8FA 5IGFA 5FLMG 1OXTA 3OIQA 1WD0A 5EPLA 4WORA 1SEBD 4H0LC 2A1AA 2MP1A 1UE1A 2ICIA 3GTGH 4ZQ3A 2ATWA 2QILA 5CC4A 4APVA 4DGZA 1QB5D 1IYVA 5GQOA 4KK7A 3BZDB 2PQEA 3SEBA 1B1ZA 3J7ZC 2HCIA 1KD1C 1A63A 3CPFA 2WV6D 2RQXA 2RCFA 5J3BA 2OTJA 4OONA 3S15H 1UEBA 1LABA 3S2DB 1GJXA 3URYA 5CV8A 2K4KA 4MHEA 3I7FA 1KDBA 4TQUS 3BDOA 3E6ZX 1J5EQ 1I6HB 2F03A 4P2CB 2R92B 2LXJA 3S2DH 1L2FA 1YEZA 1CTMA 3I55A 2ENBA 1I6HH 2GN5A 3GTKB 4MZ9A 2UUBQ 5I9OA 4ZK9B 1U4PA 4JI2L 4KI0A 5IWAQ 2ZM6Q 1A3UA 4A3EB 1TWFB 1SNPA 1STEA 1I50B 2BDNA 1CKNB 2XTIA 1WCMH 1BF4A 3OW2A 4MTKA 4C3HH 1X3QA 1CHPD 1ZYRC 3MHBA 3OPOA 1FD7D 5C4ZA 2O5JC 4A3EH 1LTSD 1Y14B 1TWFH 1RDPD 4DAVA 4J15A 5CV6A 1MJEA 1I50H 4NXNQ 2JA5G 1HNZL 1R9TB 2K03A 2VQFL 4X3KA 2JN4A 3EN2A 1L1OB 3ZYYX 1FGBD 1SYGA 4ME5A 3FEWX 1V8QA 2Z6BA 1R9TH 4C1NI 3NBHB 1HZAA 4IZ8A 4R4IA 1Q12A 2YU9B 3SK5A 4DNTB 5C3XA 4L5TA 4X3SA 3K7AB 1XYIA 3BU2A 1RCVD 3WOFA 4F7XA 4XYQA 2YU9H 3VYSA 5HGQA 3SK8A 1NTGA 2WIIB 1LTID 3GD7A 3A54A 5ELDA 2PI2A 1MHWC 1PRTD 4ZUIA 2PZWA 3QWNA 3ULPA 4PG3A 4NPSA 2F0TA 4U673 2HT1A 3MXUA 5CV4A 3MA2B 1VQFA 4JW0A 4JI2Q 5JEAG 3GTLB 2EYMA 3HRZC 5E4XA 2ZJQA 1LYLA 2L9HA 1TXYA 2XSCA 1D1IA 4WJWA 4O2DA 3G7LA 4QL5A 1K73C 2K01A 1EFWA 1S5CD 4KJNA 3RLOA 1HNZQ 3PCOB 4A3JB 2VQFQ 2G9DA 5IYDH 1ML0D 3HZXA 1UNSA 4JI4L 3TP7A 1TU2B 1WI5A 1NMFA 1RF2D 3I4MB 2L4NA 1DZ1A 1II3A 5M3FB 4A3JH 5KYLA 2TMPA 3RNUA 2WKCA 5M5XB 4C1NK 2IX3A 3I4MH 1BR9A 5M3FH 1CT1D 2K1BA 2HDLA 2QA4A 4K6LA 5M5XH 4LF5Q 2BH2A 2XVSA 1TT2A 4A75A 3ND9A 4DR7L 5IYBH 1C8CA 1I4HA 1SXTA 2DUDA 1VQIA 2E76C 2OXPA 2PZUA 1U4MA 1N34L 3AU7A 3EIVA 5IGDA 5LL6X 2N55A 2RHSB 1FVIA 1SBBB 5JAVA 2OQ0A 4AIMA 3PF5A 5J1ZA 1SJED 1E0BA 3STBD 1GVPA 1QVFA 3QIAA 1YHBA 4IO9A 5C4XB 1TWGB 3LNNA 1GUWA 3I4NH 3PV0A 4K8JA 3J7A5 3RMHA 4CKEA 1I5FA 4Z9CB 1PH2A 1VQJA 3AQQA 1VQ6A 1TWGH 4LF6L 2MQHA 1LTLA 1TVXA 1XTDA 1JWUD 4KHZA 5IT9c 1HNWL 4DUYL 1W6JA 2IHEA 4JI4Q 1JJ2A 4KY5A 4FNFA 2H5XA 3P1HA 1LTTD 3CQZB 4KN7C 5ELCA 1X55A 3FRPB 1QUQB 3LWEA 3CQZH 2B2YA 4I7ZC 4J1MA 4JV5L 1SMYC 1B4OA 4JI5Q 1X3GA 3H09A 1YNNC 1LO5D 4G7HC 4K0KL 3S24A 1Q1EA 3S14B 1CSQA 3T56B 1PH3A 4DR7Q 5AFWA 4L63B 2P5ZX 3SGIA 2MFIA 3S14H 4KY6A 4CKBA 1ESRA 1DOKA 5FLXL 2L0CA 2B2UA 1N34Q 2NN6H 3NELA 3VA7A 1QVCA 1OXSC 3RZDB 4DV7L 1BXTA 1TWCB 1N36L 1KIXA 1DD2A 2AMCB 4DFAA 1SNDA 2VW9A 4RGMA 4UP8A 2E74C 4IPCA 3RZDH 2PNHA 4HIDA 1EY5A 2ID0A 1TWCH 2OF1A 4ZUJA 2KEDA 1EOTA 3HKZB 1WTOA 1D5XC 1SNQA 4EX5A 4DR2Q 3HOXB 3MFYA 4LF6Q 4KKUA 3FVQA 1VQEA 4XT1B 3A8KE 4LMQD 1HNWQ 3I73A 3WWVA 4DUYQ 2R93B 2SNMA 4K2LA 4S3SA 3HOXH 4JYAL 2R7ZB 4HTHA 4WRDA 3NENA 2YYZA 4JBMA 2I5LX 1HNXL 2A69D 3BYTB 4H13C 4I65A 3STBC 3L3OC 5J39A 3RLNA 3T4AC 3A74A 3N6RA 3J81E 5HGTA 5JJZA 1TS3A 2R7ZH 3IFDA 3OWEB 2I5HA 3B6YA 4JV5Q 4B3ML 3C1EA 3U4ZA 1HTLD 5C0XH 3I91A 3A7AB 4NDXA 1SNMA 2FINB 3MAQA 5K36H 3K0XA 4OO1G 3K0YA 3U4VA 2F0SA 3NTKA 4A3LH 3DXJC 3X3NA 4X64L 4F8MA 3VR4A 3S1QB 2WKDA 1XWEA 1OXVA 1RIPA 1NE3A 3CCVA 1O7IA 2KJXA 2N88A 2IHFA 3MXGA 1NBWA 2KCCA 3IFTA 5DAUA 4IOCA 3BVZA 5CV5A 3PO2H 4K2KA 4R8NA 1N36Q 1EFID 2IL8A 3AYHB 2F3IA 3J80E 3PUVA 2NTSA 3D6CA 1OXXK 5I2YA 2Z4HA 1NR4A 2NYZD 2L12A 2ZT9C 1CKMA 1EU4A 1HFNA 2JA7B 3PIO3 3M9BA 4OHJA 2Z6KA 1IBLL 3OMGA 2NB0A 2JSOA 4IUTA 4LJZC 5IGBA 1FJGL 1LT4D 2F0GA 2JA7H 2JEBI 4DXFA 1PXUA 5CR3A 2A6ED 1H9KA 4JYAQ 1RTNA 1FGUA 3GTQB 1IYJB 5E4WC 1HNXQ 4A4IA 2JA6G 1WTVA 1ONLA 4AH6A 3PO3B 1K9MC 1G51A 4NW2A 4O42A 1HR0W 2BCOA 1EY0A 1JOQA 1VQLA 1PFBA 2K32A 4A3FB 1HR0L 5DNFA 3GTQH 2RSNA 2WP8J 2JJQA 2B63G 1A0IA 3HOYB 5IYCH 1N33L 1JICA 4QQBX 4JOIA 2QGQA 1EWIA 2MNAA 2E2HB 2N3SA 4A3FH 1ILPA 1EQRA 2KQ3A 1MI2A 2A6HC 3KBXA 4X64Q 1O78A 2E2HH 1EIYB 4POGA 2OWOA 2A69C 4EVOA 1V1OA 4JI7L 3CCLA 4AQYL 1LTBD 1CM9A 4XYOA 5IGCA 4X66L 4EQ5A 1S5FD 5A2QE 4IFDJ 2Y0SB 3KF8B 4FYDA 4PQXA 1QE6A 1Y1VB 4KHVA 4LAAA 4C3JB 4OELB 3N52A 3TQYA 4A76A 2NVYH 3KF6A 1MSHA 2KCTA 1CHQD 2F0QA 1Y1VH 4E6IA 1NY4A 1CQVA 4C3JH 1LTAD 2C9OA 1IBLQ 4RAUC 5CYUA 2V4DA 3VYRA 2IJ0A 4BY7G 1FJGQ 1TKWB 1IXRA 2VUMH 3F2CA 1BNZA 1STAA 3D6WA 2F4VL 2R6GA 2ZJPA 3NSWA 2GVAA 1GM5A 4L8JA 3F2UA 4DNRB 1PH8A 4BBRG 3I4LA 3DWPA 4DV6L 1WTXA 2LSSA 4L5RC 2YV5A 4DV4L 1KTKA 1LUZA 1MKHA 1S72A 3CCEA 3A5UA 4KD4A 2BE5D 4KJOA 3MWYW 1MD2D 1IBKL 4RHSA 1N33Q 3DWQA 1TR5A 2KECA 2TSSA 3HS0C 3K58A 1KDAA 1GXDC 1ENFA 3HKSA 4BS9A 1EYCA 1ZEQX 3QB3A 4HCEA 3T13A 2HCCA 1VQAA 2EXDA 4OWTB 3SDZA 3M4PA 1YNXA 5I2XA 2F0OA 1SYEA 5C5MA 1IHZA 3T1HL 3K80C 2B2VA 4JI7Q 3NP8A 4AQYQ 1SNCA 3KUPA 3KDFA 4A3IG 3KK7A 4IUQA 3M3YB 4X66Q 4OEMB 1OTCA 3CD6A 1Z9FA 2JQOA 1Y69U 2EOTA 3JAMc 2J7ZA 4U68A 3M3YH 3M4YA 4K5VA 1EY8A 1HHVA 5GAHC 5E1FA 4B3RL 1Q1BA 5EKIA 1XX8A 1NAPA 5FOBB 1PTOD 1MBYA 2F4VQ 2Q8TA 1STNA 3HG9A 2RVLA 4MTNA 1PZJD 4ULLA 5ELEA 2DNCA 2Q8RE 5C3EB 1F2LA 2ZJRA 1HZBA 5CORA 1ENAA 4LFCL 1SE4A 3J81L 4FO2A 5C3EH 2L1BA 1KNEA 1J6QA 1G291 1CZWA 3Q6SA 4DV4Q 2AUKA 5EPJA 4GN3B 2EY6A 4FVMA 2M00A 2K5HA 5C44H 2D62A 4XT3B 4DK3C 1IBKQ 3DMUA 4LFAL 3E0EA 1GO3E 4UP9A 4JG2A 1A6XA 1F2MA 1JWMD 3MFGA 3I8ZA 3OOCA 5JJIA 3ICEA 1ZYRD 1HQMC 1O7LA 4YWLA 5BN5A 4A3GG 2ALYB 2I5MX 5G3LF 1TWHB 1VQKA 3K59A 3HKZE 2CQOA 3T1HQ 3CCQA 3HOWG 1SFOB 1BBUA 4LNQA 1TWHH 1S5BD 3I72A 4FP5D 4R4CA 2NVTH 3J80L 4PZ8A 2JA8B 2CHBD 3I3CA 2IWHA 1SFOH 3NBIA 5LMNW 4ME3A 1KQSA 1K0SA 5LMNL 3RZOH 2JA8H 3T1YL 1D7QA 3A8JE 4GN5A 4B3RQ 4K5XA 2EYOA 2B2YC 1C4QA 1O7YA 4A3BG 3V05A 3K5LA 4DUZL 4RH6A 1PH9A 1EQQA 4R4OA 2SEBD 4NP5A 4BXXH 3PGZA 2BH8A 1K8GA 4G7ZC 4HJ8A 5DEHA 4ZLTF 5CBAE 1PH1A 4LFCQ 3HFZB 2DJGC 4HSPA 4C3IB 2B2UC 2JEAI 4HIMA 2F3VA 3TMEA 3G4SA 2AWOA 3BS1A 4GN4B 3H0GG 3J81i 5FO8B 2K5WA 4LFAQ 4C3IH 1UE5A 5T1IA 1ZKOA 1PTOC 2K5VA 2MPMA 2MGSA 4B9WA 4A93G 3K6OA 1JC7A 1EY7A 1KC8C 3L7ZC 2B2TA 3D4RA 2V1CC 1RJTA 1IW7C 2DJFC 5FLXE 2Z0SA 4XQJA 4MNOA 2LMCB 2EY1A 1OO9B 4FF2A 1L0WA 1CQFA 3MEHA 4TKOB 5A2QL 3UDXA 2JK8A 1ESFA 2R92H 5KNCA 4DU9A 5FJ8G 1VMPA 1J9OA 4DK6C 1FNUA 2CW0C 3CCJA 1Q81C 4KKSA 3J80i 5A35A 3T1YQ 3GTKH 3FKIG 4V0BA 2YTVA 4X3UA 4HSVA 4OX9L 3BZCA 3ERSX 2RSOA 4GNXB 1H9SB 4DUZQ 4A3DG 4HR7B 2K52A 4ID6A 2Q2TA 3J7AV 4R8IA 3S1RB 4OIKA 1Y1WG 5C4JB 1G2TA 5I6WA 4DR6L 1T9HA 2HUGA 4EQOA 3S1RH 3SK6A 1C48A 1WYDA 4P73A 5IE8A 1CKNA 1G8ZD 1AE2A 5H1SE 2E2JB 1LT6D 5M9OA 4IFDG 1L0XB 4RKBA 4UY8C 2XRQD 4HEDA 4BY1G 1BO0A 2AUJD 4DK1A 5C6AA 2UXDL 2ZTCA 1M1KC 3RUZA 2E2JH 1L1OA 2EPBA 2Y0SE 3FDTA 2MO0A 3L0OA 2EE1A 3K7AH 2LFNA 5K5PA 4OGQC 2CH4A 4R9WA 4LF4L 4DAYB 4TSSA 3NBHA 3UDGA 1EQTA 1F2YA 1FNVA 5BR8L 1B8AA 1S4ZA 1B53A 1C7YA 3NK9A 5E3FA 3GTPB 1F2ZA 3E5SA 3UI2A 3TP5A 1C9OA 1CSPA 3MTSA 3J7YW 3CAMA 1I6VC 3QO2A 3GTPH 2PNRC 3HOUG 4OX9Q 1SMYD 4C2MB 3GTLH 4Y52H 5AJ3L 1D2BA 1YNND 4OXPA 4IURA 4ZRZA 1NUCA 3NWSA 3EROA 4OWWB 5M5WB 1SROA 4IOAA 4C2MH 3PQIA 4A3CH 1B50A 3OSOA 4DR6Q 4K14A 2RCNA 3L2PA 1Q7YC 5M5WH 4RCNA 1QNKA 3P75A 1E24A 3I4OA 2LY7A 1SYFA 3PUZA 1VQGA 1DJRD 1UAPA 3AB9A 4BWGB 2EXZA 1WTHA 1XPRA 4LK1C 3DEOA 2WB1B 2EJFC 4RMFA 2F0VA 3CC2A 1GKHA 4XQQA 5ELBA 3HOVB 1JE4A 4XQNA 4YCWA 2E8GA 5BN3A 1VQHA 2GA4B 4LF4Q 1D8LA 1GHJA 1EIHA 4NXML 4MIUA 3HOVH 5BR8Q 1HPCA 5HY6A 4GOPB 1N32L 1Y8PB 2WINB 3PUXA 4A3KB 2PPBC 2RHQB 2CCZA 1VQ7A 1V9PA 2WAQG 2JYOA 2YTXA 1LACA 1DGSA 4EGVA 4A3KH 1X56A 2KUMA 1L0YB 2MHVA 3C3LA 2EJGC 4LFBL 1PMRA 2E5LL 4QIWB 4UHVA 5C4XH 1VQ8A 2HIXA 2VXWA 2EY2A 1TWAB 5C0XJ 3LGJA 3CF5A 2WACA 4J8QA 2OTLA 2JA6B 1WCMG 4C3HG 1RKNA 3DUZA 1YVCA 4A3EG 1HH2P 5EBDA 2AKWB 3NUCA 2ZXRA 3M7NA 4GLVB 3H94A 4XTCS 1K83B 3G71A 2ZTEA 3C2PA 3KLSA 3AFQA 1YJ9A 3M4QA 4UP7A 3OMCA 3KLWA 5NUCA 3RN5A 2PW5A 1K83H 1HZCA 3GV3A 1AZPA 1KDCA 1K3BC 1AEXA 1A15A 3P7JA 1WTRA 1QUQA 4NXMQ 4HIKA 1TY2A 3VR6A 1N32Q 3CC4A 3KBGA 2QF7A 4ALPA 3M7GA 1HXYD 3GO5A 1PZID 3EA6A 2NUCA 1PTOB 4RKLA 5LMUL 4DR5L 2K28A 3TDQA 3P20A 1JB3A 4UPAA 4IN3A 4MN3A 3PUYA 2VS1A 1PTOH 5DM73 1IZ6A 4DV3L 4LFBQ 4POFA 4Y7NB 1YI2A 4FXDA 3KLRA 2B8GA 4WFN3 2E5LQ 3FMCA 1I3QB 1TS2A 4L5SA 2JXMB 1BCPF 1BQQT 2DGYA 4Y7NH 3GTOB 1I3QH 2A6HD 4TVAB 4BBRB 3S9WA 1D5MC 3SK4A 4I7AA 1SYBA 3GQBA 4Q0FA 1KRTA 4A3MB 3SR1A 4PMBA 4KN4C 2BDOA 3GTOH 4JI3L 2R93H 2B8FA 4BBRH 3S16B 1H9JA 5EKLA 4IUNA 1PDQA 2FFKB 1CUKA 2KCNA 4A3MH 1QVGA 1HA6A 5IYDG 1DM0B 2F0PA 4BBSB 2VQEL 3S16H 4K0KQ 1Q46A 1XNRL 1EIGA 3CKIB 4A3JG 4QY7A 1E22A 4BBSH 4IPDA 2A74C 2ZTDA 3ZJYC 3I4MG 3ERQA 5M3FG 2B2WC 1EY9A 3A55A 3F2DA 4NKLA 4ABNA 2QDLA 3NPPA 2KHJA 4YCUA
chains in the Genus database with same CATH topology
3H91A 3AMUA 3V96A 2K04A 4IUUA 2A68C 1A2TA 1HQRD 3K5MA 2D5DA 4CJ2C 2Q8IB 2BOSA 5FO7B 4G57A 2JP1A 2Z1CA 1KLUD 4FXGC 5FO9B 1CI3M 3S2HB 1JOKA 1WTPA 1O80A 1U4RA 3H6MA 2VB3X 1F9RA 1I4GA 2B2TC 3SE0A 1SNOA 1B3AA 5EGTA 3TBIB 1BUVT 3C1FA 2QCPX 3CHBD 3HOZB 1HUMA 1EU3A 3M85A 1EWHA 2A73B 3LWUA 3MZ5A 3L9AX 5DM63 2EYPA 2NWGA 4A3GB 5M3MB 1VMCA 2O5IC 3EVQA 3GTJB 1EYDA 4RFBA 1V1PB 1RTOA 1EY4A 1IKMA 1STGA 5D65A 5KGUA 2PCFB 2NN6G 3PIP3 4QUCA 3Q24A 5D14A 4DA2A 1MGSA 1CZGA 4PNYA 1A2UA 2DN8A 3X3MA 1JOOA 3KF8A 2M9VA 1STBA 1LT5D 3H0GB 1QILA 2KOLA 2DNEA 4KD3A 3D31A 2EYHA 4A93B 4EQPA 4ODGA 2R3ZA 3EJIA 3U9SA 5I9PA 2AQ2B 4QUFA 3OHXC 3T53B 5M5YB 2NVXB 1G2SA 2Z8LA 5C0XG 5JPMC 4RHRA 2EZVA 4DAPA 5K36G 4M8AA 2NZ1D 3BG3A 4XXEA 1M4VA 2MUYA 1ET6A 3BYYB 2F0WA 2OT2A 1BCPC 2JA5B 3KLSX 4ZYSA 2XNAC 1Y1WB 1CFMA 1DXMA 1FR3A 5I6YA 1IW7D 4IUPA 2PW7A 1NCVA 4HN7A 1ILQA 3DEPA 1PFNA 4BY1B 3EQLC 3CRKC 1ZXTA 3NQTA 3ND8A 4B9XA 1BOSA 1CA6A 1AW7A 4RGOS 4L6TB 4NMZA 5EBCA 2EYJA 2CW0D 4IFDI 1PYWD 2QKIC 1B44D 2HQEA 1Z6HA 3NWTA 2BA1A 1GUNA 1XTCD 2SDFA 4KY7A 4ZKCB 5CBEE 1WD1A 3DWAA 1TY0A 2X69A 3HOUB 5JEAH 4XDXA 2NVQB 4K6DA 1YNJC 2D2CC 1AZQA 3H3VC 1A3VA 4FF3A 1NR2A 5F2DA 5COYA 5ISRA 4DK0A 5HURA 1EEID 1S5DD 5ELFA 2OEOA 3QOJA 1ET9A 4CJ1B 1F9SA 2K6AA 3OWFA 4K5WA 4C3JG 1GHKA 1QCBD 1GUGA 3DHQA 1EEFD 1HCZA 1ENCA 2F0HA 3GTMB 2PMZB 5IT9E 4QF4A 1PRTF 2IX1A 1JORA 3GTGB 1KNAA 2PZTA 3IL8A 1W6KA 2L11A 5JVH3 1HFGA 1WTQA 1JWSD 3NQIA 3S15B 4KKTA 4DXGA 2WAQB 3S17B 3HGBA 1HA5A 1DYQA 3TP6A 2J0TD 4G7OC 3VYUA 3O13A 4J6HA 1B2TA 1GUTA 1STHA 4V190 4BA2I 3MXPA 1SSOA 1KLGD 1I4PA 1PZKD 1U9RA 2F1MA 1SE3A 3FPPA 3OIPA 1QG7A 1EL0A 4HAEA 1WCMB 4C3HB 2PO4A 5G3LD 2D9UA 3SXHA 1VF5C 4PMCA 4KTAA 1KABA 1E2WA 1G91A 3NHHA 2O4XA 1H9SA 5D3IB 2RA4A 1SE2A 2RKSA 1AP0A 4IALA 2LS01 3PMFA 2FHTA 1B9NA 4QMGA 4ZKBB 1D1KA 2G9HD 3QG1A 2Z4IA 3QOLA 1VF7A 1RHPA 2L5TA 4C56C 5EJWA 2ICEC 3D3RA 2JE6I 5KYIA 3NTIA 2FMCA 1NSNS 1KAAA 4HMJA 4F88A 4DAYA 4BA1I 1TS5A 1V43A 2VNUD 1GUOA 4FF1A 1Z47A 5EQ0A 1R4QB 5KEEA 2QEJC 5LHY1 4HMIA 1AN8A 3TSSA 2DY7A 2AQ1B 2E2IB 4FXKC 3IAYA 1Q3LA 1I4RA 3R3OA 1BCPB 3TN2A 4GZYC 4QB4A 3Q22A 1DOMA 1BDOA 4XIGS 5EPKA 1F9PA 4RA8A 1S5ED 2K5DA 5KRUA 3BDLA 3DM1A 3RLFA 5LL6S 3VYTA 3K57A 4OO1H 5CV7A 5FK9C 3TP8A 3D8GA 4OO1I 4C3IG 2NTTA 3NXWA 1M8AA 3S1MB 2F0KA 3ONAB 1QNUA 1E2ZA 1EZ6A 3R8BA 4Q5VA 4QCLA 3TZUA 1GUSA 2F0MA 3R2IA 1IKLA 5KNBA 3GV6A 2AQ3B 4DN4M 4EQNA 1SYCA 4CJ0B 1Q90A 1A3TA 3TZDA 3I4NB 1STYA 4IUVA 1X32A 1EY6A 1I4QA 2IX0A 2X6LA 5IT9L 4OL7A 4N9TA 2B63B 4AYBB 2B2VC 1DONA 1K8OA 3I70A 1PRTC 3MXNA 5KIXA 3WOEA 2BA0A 2NBFA 1T5XD 4O1NA 2A68D 1SYDA 2E75C 1LT3D 3D4WA 5BN4A 2KVMA 1F77A 1QWYA 2RDGA 4RWSC 2KEEA 2C5CA 2F0FA 5JOBA 2X6GA 1TIID 2F3WA 3NE5B 4TRDA 5IIFA 4H44C 2F0IA 4UAIA 3HP3A 1JR0D 3I90A 2IW3A 2F0JA 4CKCA 4BY7B 4M1UB 1SAPA 4KMUC 1AFPA 1T5EA 2NN6I 1VCIA 2XWBB 2F0LA 1TS4A 3JAME 2K5QA 1RD9D 4K8IA 2SNSA 2ZXPA 1IYUA 1U4LA 1LV9A 3J7AF 2F0NA 1QJOA 3K5NA 3W3AA 1EQVA 1Y8OB 2E2DC 1HTPA 2I07B 2IT1A 2FJ2A 5KNDA 1WVLA 1JCKB 1EYAA 4A3IB 1ICWA 5D3DA 5C0XI 3A7LA 3HEJA 1QOHA 1E2VA 5CGKA 4JK1C 3PO2B 3WDNA 1GOZA 2QDBA 4HCSA 3VR2A 2EYLA 2H1EA 2XIWA 2KA7A 2A5HA 1B9MA 1MSGA 5I4DA 1HRJA 3OW7A 1K8MA 1SDFA 5J22A 2M2LA 2EJMA 5JPNC 2F0UA 4OIJA 2IPKD 4FF4A 5JVG3 2LKVA 1OXUA 3T51B 3MC0B 4RGTA 3NTHA 2ZXOA 3EFXD 1Q8IA 1BCPD 5C4HA 1I4XA 2F0EA 1IL8A 3HOWB 1F9QA 2CQAA 1WTWA 3R93A 5T1GA 2HDMA 1J8IA 3ITPA 1PTOF 1TQOA 1RODA 2B39A 3R2TA 4A3BB 3VR3A 3QJYA 2AWNA 3E0JA 3D4DA 2NVYB 1BBXC 1EWCA 1V1PA 2KHSA 3T16A 2EYFA 3Q0AA 2RBMA 1D5ZC 5C3WA 3MVVA 1UEAB 2VUMB 3BVMA 3CRLC 2EY5A 3FPUB 4X3TA 1LLRD 2MJ8A 1R4PB 2XRSD 4F87A 3S1NB 3K5OA 3BDCA 1CA5A 1YNJD 3M4OB 3GP7A 1XXGA 1H9RA 2EDGA 5JEAJ 4KV6A 3A56A 1PRTB 1JQYD 3W2DA 4N9PA 3C46A 2RDFA 1UUPA 3PUWA 2XN9C 4CBVA 2O2LD 4PV1C 5IOCA 2A6EC 5CV9A 5FKAC 3FKIB 1FYCA 1Y8NB 2DY8A 1CK1A 5IODA 5EKKA 4A3DB 4B08A 3Q23A 3JAML 3VA5A 3G6JB 1PFMA 2EVBA 3IKJA 2R61A 4UDUC 2L55A 3V2TA 3SVMA 3U9OA 4JBWA 1G6ZA 2XWJB 2CVRA 1PLFA 5IGGA 2K7VA 4IFDH 2VB2X 1SJHD 2K33A 1DCZA 5C44B 4IQZA 2I46A 1H9MA 5C5LA 1EZ8A 1DOLA 1X3PA 2FMMA 1HUNA 5CMDA 3A8IE 4G4KA 4PMWA 1LTGD 1D6EC 4ILWA 2F4IA 1LTRD 5IGEA 3LX0A 1O7ZA 1FNWA 5TSSA 2NVTB 4RCOA 4DF7A 3SHLA 2J4XA 2K05A 3BVGA 3VR5A 2RDHA 2BE5C 3RZOB 4H7BA 2SOBA 4CGYB 4CHTB 3CU7A 2B2WA 3RD4A 2F0DA 2PYKA 4RGNA 1VDZA 1Z7TA 4ZAIA 4YIJA 2H4OA 5IGFA 1OXTA 3OIQA 1WD0A 5EPLA 4WORA 1SEBD 4H0LC 2MP1A 2ICIA 4ZQ3A 2QILA 5CC4A 4DGZA 1QB5D 1IYVA 4KK7A 3BZDB 2PQEA 3SEBA 1B1ZA 2HCIA 2WV6D 2RQXA 1LABA 3S2DB 1GJXA 3URYA 5CV8A 4TQUS 4MHEA 1KDBA 3BDOA 3E6ZX 1I6HB 2F03A 4P2CB 2R92B 1CTMA 2ENBA 3GTKB 5I9OA 4ZK9B 1U4PA 4KI0A 1A3UA 4A3EB 1TWFB 1SNPA 1STEA 1I50B 2BDNA 1BF4A 1X3QA 1CHPD 1ZYRC 3MHBA 3OPOA 1FD7D 5C4ZA 2O5JC 1LTSD 1RDPD 4DAVA 5CV6A 1R9TB 2K03A 4X3KA 3ZYYX 1FGBD 1SYGA 4ME5A 3FEWX 1V8QA 4C1NI 4IZ8A 1Q12A 2YU9B 3SK5A 4DNTB 5C3XA 4X3SA 3K7AB 1XYIA 1RCVD 3WOFA 4F7XA 4XYQA 3VYSA 3SK8A 2WIIB 1LTID 3GD7A 3A54A 5ELDA 1PRTD 4ZUIA 2PZWA 3QWNA 2F0TA 4U673 3MXUA 5CV4A 3MA2B 5JEAG 3GTLB 2EYMA 3HRZC 5E4XA 2L9HA 2XSCA 1D1IA 4WJWA 3G7LA 2K01A 1S5CD 4KJNA 4A3JB 2G9DA 1ML0D 3HZXA 1UNSA 3TP7A 1TU2B 1RF2D 3I4MB 2L4NA 1DZ1A 1II3A 5M3FB 5KYLA 2TMPA 2WKCA 5M5XB 4C1NK 2IX3A 1BR9A 1CT1D 2K1BA 2HDLA 4K6LA 2XVSA 1TT2A 3ND9A 1C8CA 1I4HA 1SXTA 2E76C 2OXPA 2PZUA 1U4MA 3AU7A 5IGDA 5LL6X 2N55A 1SBBB 5JAVA 5J1ZA 1SJED 1E0BA 3QIAA 5C4XB 1TWGB 3LNNA 1GUWA 3PV0A 4K8JA 3RMHA 4CKEA 4Z9CB 1TVXA 1JWUD 4KHZA 1W6JA 4KY5A 4FNFA 3P1HA 1LTTD 3CQZB 4KN7C 5ELCA 3FRPB 3LWEA 2B2YA 4I7ZC 4J1MA 1SMYC 1B4OA 3H09A 1YNNC 1LO5D 4G7HC 3S14B 1Q1EA 3T56B 5AFWA 4L63B 4KY6A 4CKBA 1ESRA 1DOKA 5FLXL 2L0CA 2B2UA 2NN6H 3VA7A 1OXSC 3RZDB 1BXTA 1TWCB 1DD2A 4DFAA 1SNDA 4RGMA 2E74C 1EY5A 2ID0A 2OF1A 4ZUJA 2KEDA 1EOTA 3HKZB 1WTOA 1D5XC 1SNQA 3HOXB 3MFYA 4KKUA 3FVQA 4XT1B 3A8KE 4LMQD 3I73A 2R93B 2SNMA 4K2LA 4S3SA 2R7ZB 4HTHA 4WRDA 2YYZA 2A69D 3BYTB 4H13C 4I65A 3L3OC 5J39A 3T4AC 3N6RA 3J81E 5HGTA 5JJZA 1TS3A 3IFDA 3OWEB 3C1EA 1HTLD 5C0XH 3I91A 3A7AB 4NDXA 1SNMA 2FINB 3MAQA 5K36H 4OO1G 3K0YA 2F0SA 3NTKA 3DXJC 3X3NA 4F8MA 3VR4A 3S1QB 2WKDA 1XWEA 1OXVA 2KJXA 2N88A 3MXGA 2KCCA 3IFTA 5DAUA 3BVZA 5CV5A 4K2KA 4R8NA 1EFID 2IL8A 3J80E 3PUVA 2NTSA 3D6CA 1OXXK 5I2YA 2Z4HA 1NR4A 2NYZD 2L12A 2ZT9C 1EU4A 1HFNA 2JA7B 3PIO3 4OHJA 3OMGA 2NB0A 2JSOA 4IUTA 4LJZC 5IGBA 1LT4D 2F0GA 2JEBI 4DXFA 1PXUA 5CR3A 2A6ED 1H9KA 1RTNA 3GTQB 5E4WC 1WTVA 1ONLA 3PO3B 4NW2A 4O42A 2BCOA 1EY0A 1JOQA 1PFBA 2K32A 4A3FB 5DNFA 2RSNA 2WP8J 3HOYB 1JICA 2E2HB 1ILPA 2KQ3A 1MI2A 2A6HC 3KBXA 1O78A 2A69C 4EVOA 1V1OA 1LTBD 1CM9A 4XYOA 5IGCA 1S5FD 5A2QE 4IFDJ 2Y0SB 4FYDA 4PQXA 1QE6A 1Y1VB 4KHVA 4LAAA 4C3JB 3N52A 1MSHA 1CHQD 2F0QA 4E6IA 1CQVA 1LTAD 2C9OA 4RAUC 5CYUA 2V4DA 3VYRA 2IJ0A 1TKWB 1BNZA 1STAA 3D6WA 2R6GA 3NSWA 4L8JA 3F2UA 4DNRB 3I4LA 3DWPA 1WTXA 1KTKA 4KD4A 2BE5D 4KJOA 3MWYW 1MD2D 4RHSA 3DWQA 1TR5A 2KECA 2TSSA 3HS0C 3K58A 1KDAA 1GXDC 1ENFA 4BS9A 1EYCA 1ZEQX 3QB3A 4HCEA 3T13A 2HCCA 3SDZA 5I2XA 2F0OA 1SYEA 5C5MA 1IHZA 2B2VA 3NP8A 1SNCA 3KUPA 3KK7A 4IUQA 3M3YB 1Y69U 2EOTA 2J7ZA 4U68A 3M4YA 4K5VA 1EY8A 1HHVA 5E1FA 1Q1BA 5EKIA 1XX8A 1NAPA 5FOBB 1PTOD 1MBYA 2Q8TA 1STNA 3HG9A 2RVLA 4ULLA 1PZJD 5ELEA 2DNCA 2Q8RE 5C3EB 1F2LA 5CORA 1ENAA 1SE4A 3J81L 4FO2A 2L1BA 1KNEA 1G291 3Q6SA 1CZWA 2AUKA 5EPJA 2EY6A 4FVMA 2M00A 2D62A 4XT3B 3DMUA 1A6XA 1F2MA 1JWMD 3MFGA 3I8ZA 3OOCA 1ZYRD 1HQMC 1O7LA 5BN5A 5G3LF 1TWHB 3K59A 1SFOB 4FP5D 1S5BD 3I72A 3J80L 2JA8B 2CHBD 3I3CA 2IWHA 3NBIA 3A8JE 4K5XA 2EYOA 2B2YC 1C4QA 1O7YA 3V05A 3K5LA 4RH6A 2SEBD 4NP5A 4G7ZC 5DEHA 4ZLTF 5CBAE 4HSPA 4C3IB 2B2UC 2JEAI 2F3VA 3TMEA 2AWOA 3BS1A 5FO8B 2K5WA 5T1IA 1ZKOA 1PTOC 2MPMA 2MGSA 4B9WA 3K6OA 1JC7A 1EY7A 3L7ZC 2B2TA 3D4RA 1RJTA 1IW7C 5FLXE 4XQJA 2LMCB 2EY1A 1OO9B 4FF2A 1CQFA 3MEHA 4TKOB 5A2QL 1ESFA 5KNCA 4DU9A 1VMPA 1J9OA 1FNUA 2CW0C 4KKSA 5A35A 4V0BA 4X3UA 4HSVA 2RSOA 1H9SB 4HR7B 4ID6A 3J7AV 4R8IA 3S1RB 4OIKA 5C4JB 1G2TA 5I6WA 2HUGA 4EQOA 3SK6A 1C48A 1G8ZD 2E2JB 1LT6D 5M9OA 4IFDG 1L0XB 4RKBA 2XRQD 4HEDA 1BO0A 2AUJD 4DK1A 5C6AA 3RUZA 3FDTA 2EPBA 2EE1A 2LFNA 5K5PA 4OGQC 4R9WA 4TSSA 3NBHA 1EQTA 1F2YA 1FNVA 1S4ZA 1B53A 3NK9A 5E3FA 3GTPB 1F2ZA 3E5SA 3UI2A 3TP5A 3MTSA 3J7YW 1I6VC 3QO2A 2PNRC 1SMYD 4C2MB 1D2BA 1YNND 4IURA 4ZRZA 1NUCA 3NWSA 3EROA 5M5WB 1B50A 3OSOA 4K14A 4RCNA 1QNKA 3P75A 2LY7A 1SYFA 3PUZA 1DJRD 1UAPA 3AB9A 4BWGB 2EXZA 4LK1C 3DEOA 2WB1B 2EJFC 2F0VA 4XQQA 5ELBA 3HOVB 1JE4A 4XQNA 5BN3A 2GA4B 1GHJA 1EIHA 4MIUA 1HPCA 1Y8PB 2WINB 3PUXA 4A3KB 2PPBC 2JYOA 1LACA 4EGVA 2KUMA 1L0YB 2MHVA 3C3LA 2EJGC 1PMRA 4QIWB 2VXWA 2EY2A 1TWAB 5C0XJ 2WACA 4J8QA 2JA6B 4C3HG 1RKNA 3DUZA 5EBDA 3NUCA 2ZXRA 3M7NA 3H94A 4XTCS 1K83B 3C2PA 3KLSA 3OMCA 5NUCA 2PW5A 3GV3A 1AZPA 1KDCA 1AEXA 1A15A 3P7JA 1WTRA 1TY2A 3VR6A 3KBGA 2QF7A 3M7GA 1HXYD 3GO5A 1PZID 3EA6A 2NUCA 1PTOB 4RKLA 2K28A 3TDQA 3P20A 1JB3A 4IN3A 4MN3A 3PUYA 1PTOH 5DM73 4Y7NB 4FXDA 3KLRA 2B8GA 4WFN3 3FMCA 1I3QB 1TS2A 2JXMB 1BCPF 1BQQT 3GTOB 2A6HD 4BBRB 3S9WA 1D5MC 3SK4A 1SYBA 3GQBA 4Q0FA 4A3MB 3SR1A 4PMBA 4KN4C 2BDOA 2B8FA 3S16B 1H9JA 5EKLA 4IUNA 1PDQA 2FFKB 2KCNA 1HA6A 1DM0B 2F0PA 4BBSB 1EIGA 3CKIB 2A74C 3ERQA 2B2WC 1EY9A 3A55A 4NKLA 4ABNA 3NPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DM0 B;  1R4Q B;  4M1U B;  4ULL A;  4P2C B;  1QOH A;  1R4P B;  2GA4 B;  2C5C A;  1CQF A;  1CZG A;  1C4Q A;  1D1I A;  2XSC A;  2BOS A;  1CZW A;  1C48 A;  1QNU A;  3MXG A;  1BOS A;  1D1K A; 
#chains in the Genus database with same CATH topology
 3OYY A;  4P71 A;  3S1Q H;  4DV7 Q;  3H91 A;  3AMU A;  3DLL A;  5LMU Q;  4DR5 Q;  3V96 A;  2K04 A;  5IYB G;  4IUU A;  4O0A A;  2A68 C;  2C35 B;  1A2T A;  1HQR D;  1A8V A;  3K5M A;  3CCM A;  2D5D A;  4DV3 Q;  4CJ2 C;  2Q8I B;  4CDE C;  2BOS A;  1CKO A;  5FO7 B;  4JI8 L;  4G57 A;  2JP1 A;  2Z1C A;  1KLU D;  4FXG C;  5FO9 B;  1CI3 M;  3S2H B;  1JOK A;  1WTP A;  5IP9 H;  1O80 A;  1U4R A;  3I4N G;  3H6M A;  1SLJ A;  2VB3 X;  1F9R A;  1I4G A;  2B2T C;  3SE0 A;  4JI3 Q;  1P8L A;  1SNO A;  1B3A A;  5EGT A;  3TBI B;  1BUV T;  4R4Q A;  3C1F A;  2QCP X;  5E7N A;  3CHB D;  3HOZ B;  4B3M Q;  2Z9H A;  4AYB G;  3PO3 H;  1HUM A;  1EU3 A;  3M85 A;  1EWH A;  2A73 B;  3LWU A;  3MZ5 A;  2CKZ B;  3HOZ H;  1BBW A;  3L9A X;  5DM6 3;  2EYP A;  3HOY H;  2NWG A;  4A3G B;  5M3M B;  1VMC A;  1BKB A;  4DR4 L;  2O5I C;  3K7U C;  5GRO A;  1XPO A;  2N78 A;  1X54 A;  1JT8 A;  5M3M H;  4JI6 L;  3EVQ A;  3PIO A;  5IP7 H;  3GTJ B;  1EYD A;  4RFB A;  1V1P B;  1RTO A;  1EY4 A;  4DV2 L;  1STG A;  3DM3 A;  1IKM A;  3PF4 A;  5D65 A;  1M90 C;  5KGU A;  2PCF B;  3GTJ H;  2QW7 A;  3CME A;  2NN6 G;  3PIP 3;  4QUC A;  3Q24 A;  3TS0 A;  1UE6 A;  4JI8 Q;  5D14 A;  4DA2 A;  1MGS A;  1PVO A;  4IJL A;  1CZG A;  3CPW A;  4WJ3 M;  4PNY A;  1L1O C;  1A2U A;  2DN8 A;  3X3M A;  2WB1 E;  4JVZ A;  1JOO A;  3KF8 A;  2N49 A;  5FLM H;  3TRE A;  1X3F A;  2M9V A;  1STB A;  1VQ9 A;  1LT5 D;  1XMO L;  3H0G B;  4B3T L;  1QIL A;  3UDF A;  3JC6 6;  1HR0 Q;  2KOL A;  2DNE A;  3HKZ G;  2G5D A;  4KD3 A;  3HOX G;  2KEN A;  3D31 A;  2EYH A;  4P72 A;  4GLA C;  4A93 B;  4EQP A;  4ODG A;  1VS0 A;  2R3Z A;  2D0P A;  3EJI A;  4DR4 Q;  2R7Z G;  3U9S A;  4DR1 L;  5I9P A;  2AQ2 B;  4QUF A;  3OHX C;  4JCV E;  3T53 B;  5M5Y B;  1ASZ A;  1G2S A;  2NVX B;  2Z8L A;  4IJH A;  1VQC A;  5C0X G;  5JPM C;  4QIW E;  4RHR A;  3PIP A;  3KFU A;  5ELO A;  3G48 A;  2EZV A;  4DAP A;  5K36 G;  4M8A A;  4DV2 Q;  4QGU A;  2NZ1 D;  3BG3 A;  4XXE A;  4A3L G;  1M4V A;  2MUY A;  1ET6 A;  3W1B A;  3BYY B;  2F0W A;  2OT2 A;  5GAE C;  1BCP C;  3CC7 A;  2JA5 B;  3PO2 G;  3KLS X;  4ZYS A;  2XNA C;  1Y1W B;  1CFM A;  1DXM A;  2EIF A;  1I94 L;  2JA5 H;  2QEX A;  4JBK A;  1FR3 A;  5I6Y A;  1IW7 D;  2EQS A;  4IUP A;  4LW1 A;  4GKK L;  4DV6 Q;  4DV1 L;  2PW7 A;  1NCV A;  4HN7 A;  4B3T Q;  1ILQ A;  2WFW A;  3DEP A;  1PFN A;  4BY1 B;  3EQL C;  3CRK C;  3J81 c;  2JA7 G;  3OTO L;  1ZXT A;  3NQT A;  3ND8 A;  4B9X A;  1BOS A;  1CA6 A;  1AW7 A;  3CXC A;  4RGO S;  4L6T B;  1YHA A;  4HJA A;  4NMZ A;  5EBC A;  2EYJ A;  1Q86 C;  2CW0 D;  4IFD I;  1PYW D;  4HJ5 A;  2QKI C;  1B44 D;  2HQE A;  1Z6H A;  3RR5 A;  3NWT A;  3W5O A;  4DR1 Q;  2ES2 A;  2BA1 A;  4R4T A;  1GUN A;  1YIJ A;  1ASY A;  2R7D A;  5IYC G;  1RL2 A;  1XTC D;  2SDF A;  4KY7 A;  4YCV A;  4ZKC B;  4A3F G;  1KRS A;  1MJC A;  5CBE E;  1WD1 A;  3DWA A;  4GKJ L;  3ULJ A;  1B7Y B;  1TY0 A;  1LM0 A;  3J80 c;  2X69 A;  1JB7 A;  3HOU B;  5JEA H;  4LWC A;  4XDX A;  2NVQ B;  4K6D A;  1YNJ C;  4DAM A;  2D2C C;  1W2B A;  1AZQ A;  3H3V C;  1A3V A;  4FF3 A;  1NR2 A;  1BVS A;  5F2D A;  5COY A;  5ISR A;  4DK0 A;  5HUR A;  1EEI D;  4KHP L;  5JJL A;  1I94 Q;  1S5D D;  5ELF A;  1VQP A;  4YWK A;  2OEO A;  3QOJ A;  1ET9 A;  1Y1V G;  4CJ1 B;  1F9S A;  2K6A A;  3OWF A;  4K5W A;  4C3J G;  4DV1 Q;  1GHK A;  1QZG A;  1KHI A;  1QCB D;  1GUG A;  4LUZ A;  3DHQ A;  1EEF D;  1HCZ A;  1ENC A;  2F0H A;  3GTM B;  2PMZ B;  5IT9 E;  4QF4 A;  2VUM G;  2HD3 A;  2HQL A;  3TEH B;  3OTO Q;  5ELN A;  1PRT F;  3E3X A;  3K81 C;  2IX1 A;  1JOR A;  3GTG B;  1K0R A;  1KAW A;  1KNA A;  2PZT A;  3A0J A;  2K5N A;  1PH6 A;  3UE1 A;  3IL8 A;  1UWV A;  1W6K A;  2L11 A;  5JVH 3;  2LXK A;  1HFG A;  5DLQ E;  3VDY A;  1YIT A;  1WTQ A;  1JWS D;  3NQI A;  3S15 B;  1JE5 A;  4KKT A;  5L37 A;  4DXG A;  2WAQ B;  3S17 B;  3HGB A;  1HA5 A;  3CCU A;  1DYQ A;  3TP6 A;  4GKJ Q;  2J0T D;  4G7O C;  3VYU A;  4R1J A;  3O13 A;  4J6H A;  1B2T A;  1GUT A;  3S17 H;  1STH A;  5LMN Q;  4V19 0;  4BA2 I;  3MXP A;  1SSO A;  1PHJ A;  1KLG D;  1I4P A;  1PZK D;  1E3P A;  1U9R A;  3AFP A;  2F1M A;  4WJ4 A;  1SE3 A;  3EBE A;  3FPP A;  3OIP A;  1QG7 A;  4KHP Q;  4JI0 L;  1EL0 A;  4HAE A;  1WCM B;  4C3H B;  2PO4 A;  2ASB A;  1PYS B;  4LUV A;  5G3L D;  1YHQ A;  1PYB A;  4QJF A;  2D9U A;  3SXH A;  1VF5 C;  2IY5 B;  3KJP A;  4PMC A;  4KTA A;  5C4J H;  1KAB A;  2FXQ A;  1E2W A;  1G91 A;  4GNX A;  3NHH A;  2O4X A;  3K8A A;  1H9S A;  5D3I B;  4L5Q A;  1X9N A;  2RA4 A;  2K50 A;  3PSI A;  1SE2 A;  2RKS A;  5C3E G;  1PA6 A;  1AP0 A;  1XJV A;  4IAL A;  2LS0 1;  3PMF A;  2FHT A;  1B9N A;  5C44 G;  4QMG A;  1NJI C;  4ZKB B;  4P74 A;  2Z6K C;  4DV5 L;  1D1K A;  2G9H D;  3QG1 A;  1X65 A;  2Z4I A;  3QOL A;  1VF7 A;  1RHP A;  2VY3 A;  1PV4 A;  2L5T A;  4C56 C;  5EJW A;  4LF5 L;  2ICE C;  3D3R A;  2JE6 I;  5KYI A;  1FL0 A;  3NTI A;  2FMC A;  1NSN S;  1KAA A;  4HMJ A;  4F88 A;  4DAY A;  4BA1 I;  3G6E A;  1TS5 A;  1V43 A;  2VNU D;  1GUO A;  4FF1 A;  1Z47 A;  1IL2 A;  4JOI C;  5EQ0 A;  1R4Q B;  5KEE A;  2QEJ C;  4HJ9 A;  4JI0 Q;  5LHY 1;  1JJC B;  4HMI A;  1UE7 A;  1AN8 A;  3TSS A;  2DY7 A;  2JA8 G;  2AQ1 B;  2E2I B;  4FXK C;  3IAY A;  1Q3L A;  1I4R A;  3R3O A;  1BCP B;  2B29 A;  3TN2 A;  3D0F A;  4QB4 A;  3Q22 A;  4GZY C;  3BJU A;  1DOM A;  2E2I H;  1BDO A;  4XIG S;  1V1Q A;  5EPK A;  4BXX G;  1EIF A;  1F9P A;  4NB3 A;  4RA8 A;  1S5E D;  2Q2H A;  2XGT A;  2K5D A;  5KRU A;  3BDL A;  2UXD Q;  3DM1 A;  3RLF A;  5LL6 S;  3VYT A;  3K57 A;  2R7F A;  3CMA A;  4OO1 H;  5CV7 A;  5FK9 C;  4LF8 L;  3TP8 A;  3D8G A;  1PH7 A;  4OO1 I;  4C3I G;  2NTT A;  3NXW A;  4DV5 Q;  1E1T A;  1M8A A;  3S1M B;  2F0K A;  4JI5 L;  1KXL A;  3ONA B;  1QNU A;  1QZH A;  1E2Z A;  1EZ6 A;  3R8B A;  4Q5V A;  3S1M H;  4QCL A;  3ER0 A;  3TZU A;  1GUS A;  2F0M A;  1B3Q A;  3R2I A;  1IKL A;  3CW2 C;  5KNB A;  3GV6 A;  3E9I A;  4JI1 L;  2AQ3 B;  1S40 A;  4DN4 M;  4EQN A;  3MXN B;  1SYC A;  4CJ0 B;  5AJ3 Q;  1Q90 A;  4YHH L;  4GOP A;  2R92 G;  1A3T A;  3TZD A;  3I4N B;  2VZA A;  1STY A;  1XMQ L;  4IUV A;  1VQ5 A;  1X32 A;  4LUO A;  2UUA L;  1YJN A;  3F8T A;  2Q2I A;  1EY6 A;  1MIU A;  1TWA H;  3UE0 A;  1I4Q A;  2IX0 A;  2X6L A;  5IT9 L;  2L15 A;  1SE8 A;  2JA6 H;  4OL7 A;  4N9T A;  4DR2 L;  4GLX A;  2B63 B;  4RG1 A;  4PZ7 A;  4AYB B;  2B2V C;  1DON A;  1K8O A;  3I70 A;  1PRT C;  3MXN A;  5KIX A;  3WOE A;  1VQO A;  2BA0 A;  3H3V H;  2NBF A;  1T5X D;  4O1N A;  2B63 H;  2A68 D;  3H3V I;  1SYD A;  2E75 C;  1LT3 D;  2CWA A;  3D4W A;  1S3O A;  4LF8 Q;  5BN4 A;  2KVM A;  1F77 A;  1QWY A;  2RDG A;  4OWX B;  4RWS C;  2KEE A;  3CCS A;  4LF7 L;  2C5C A;  5FLX c;  2F0F A;  5JOB A;  2X6G A;  1TII D;  4YY3 L;  2F3W A;  3NE5 B;  1U0L A;  4TRD A;  2YTY A;  3BZK A;  5IIF A;  4H44 C;  2F0I A;  4UAI A;  2UUC L;  3HP3 A;  4JI1 Q;  1JR0 D;  3I90 A;  1Q82 C;  2IW3 A;  2OCE A;  2F0J A;  2D0O A;  2PMZ E;  4CKC A;  4BY7 B;  2MO1 A;  2JA9 A;  2HHH L;  4M1U B;  1SAP A;  4KMU C;  1AFP A;  4YHH Q;  1T5E A;  2NN6 I;  1VCI A;  2CFM A;  2XWB B;  2F0L A;  1TS4 A;  3JAM E;  4BY7 H;  1XMQ Q;  2KHI A;  2UUA Q;  1VQB A;  2K5Q A;  1WFQ A;  1RD9 D;  1JJG A;  4K8I A;  2SNS A;  2ZXP A;  1SMX A;  1H95 A;  1IYU A;  1U4L A;  4N8X 1;  1LV9 A;  1K3R A;  3J7A F;  4A3C G;  2F0N A;  2WAQ E;  1QJO A;  3TRZ A;  3K5N A;  1WOC A;  3W3A A;  1EQV A;  1Y8O B;  2E2D C;  4PZ6 A;  1HTP A;  1X6O A;  2I07 B;  2IT1 A;  2FJ2 A;  2NZO A;  5IY0 A;  5KND A;  1WVL A;  1JCK B;  1EYA A;  3F2B A;  4A3I B;  4X65 L;  4LF7 Q;  4YY3 Q;  1ICW A;  5D3D A;  5C0X I;  3A7L A;  3HEJ A;  3CP0 A;  4A3I H;  1QOH A;  1JMC A;  2WB1 G;  2UUC Q;  4DNI A;  1E2V A;  2VL6 A;  5CGK A;  4JK1 C;  3HOV G;  1N9W A;  3U50 C;  3W1G A;  4ZCK A;  1X3E A;  4H02 A;  3PO2 B;  3WDN A;  2HHH Q;  2KCM A;  1GOZ A;  4P75 A;  4JC0 A;  3A5Z B;  4A3K G;  1GD7 A;  2QDB A;  2K14 A;  4HCS A;  3S2H H;  4X6A H;  3VR2 A;  2EYL A;  2PI2 E;  2HIV A;  2H1E A;  2XIW A;  5C4X G;  2KA7 A;  2A5H A;  1B9M A;  1MSG A;  5I4D A;  1HRJ A;  3OW7 A;  3TS2 A;  1HZ9 A;  1K8M A;  2PQA B;  1SDF A;  5J22 A;  1SRU A;  2M2L A;  2EJM A;  1HJP A;  1G6P A;  5JPN C;  2VQE Q;  2F0U A;  4OIJ A;  2IPK D;  1C0A A;  4FF4 A;  2UXB L;  1XNR Q;  5JVG 3;  2LKV A;  1NMG A;  1OXU A;  3T51 B;  3MC0 B;  4RGT A;  3RN2 A;  4LF9 L;  3NTH A;  2ZXO A;  3EFX D;  1Q8I A;  1BCP D;  5C4H A;  1I4X A;  2F0E A;  1IL8 A;  2N8N A;  3HOW B;  1F9Q A;  2CQA A;  1WTW A;  4A3G H;  1ICF B;  2PQA A;  3R93 A;  5T1G A;  2HDM A;  4X65 Q;  1J8I A;  1KL9 A;  3NEM A;  3ITP A;  2UXC L;  3HOW H;  3GDE A;  1PTO F;  1TQO A;  1ROD A;  2B39 A;  3KF6 B;  3R2T A;  1VQM A;  4DPG A;  4A3B B;  2RF4 A;  3UDI A;  4GNX C;  3VR3 A;  3QJY A;  2AWN A;  3E0J A;  1U5K A;  3D4D A;  4DV0 L;  4GS3 A;  4A3B H;  2CWP A;  2NVY B;  1BBX C;  1EWC A;  1A62 A;  1V1P A;  3I2Z A;  1K8A C;  2KHS A;  3T16 A;  2EYF A;  3Q0A A;  4DR3 L;  2RBM A;  3MEF A;  1D5Z C;  5C3W A;  3MVV A;  1UEA B;  2VUM B;  3BVM A;  4YWM A;  4KLK A;  1W3S A;  3CRL C;  3H15 A;  1IBM L;  2UU9 L;  2EY5 A;  3FPU B;  3Q8D A;  1LLR D;  4X3T A;  2MJ8 A;  1R4P B;  2XRS D;  1AH9 A;  4F87 A;  3S1N B;  1EOV A;  1Q8K A;  4IPH A;  3H0G H;  3K5O A;  2UXB Q;  3BDC A;  1CA5 A;  2R93 G;  3S1N H;  4LF9 Q;  1YNJ D;  3M4O B;  3GP7 A;  1K28 A;  1XXG A;  4A3M G;  1PH4 A;  2Q2U A;  4A93 H;  1H9R A;  2EDG A;  5JEA J;  1SN8 A;  1VQN A;  4KV6 A;  3A56 A;  1PRT B;  1JQY D;  4JI6 Q;  3F1Z A;  3KDF B;  1YZ6 A;  3M4O H;  5GAD C;  3W2D A;  2I0Q A;  4N9P A;  3C46 A;  2UXC Q;  2RDF A;  5M5Y H;  1EYG A;  4B3S L;  1UUP A;  2NVX H;  4BBS G;  3PUW A;  1E7Z A;  2XN9 C;  4CBV A;  1XNQ L;  2A19 A;  2O2L D;  4PV1 C;  5IOC A;  2A6E C;  1SR3 A;  3KYH C;  5CV9 A;  5FKA C;  3FKI B;  1VQ4 A;  5FJ8 H;  1FYC A;  1Y8N B;  2F52 A;  1AE3 A;  2DY8 A;  1CK1 A;  5IOD A;  3E9H A;  5EKK A;  2AHO B;  4A3D B;  4B08 A;  4AYB E;  3FKI H;  3Q23 A;  1WJJ A;  3JAM L;  3VA5 A;  4DV0 Q;  1PFS A;  3G6J B;  1PFM A;  1YBY A;  2EVB A;  3IRB A;  4A3D H;  3KJO A;  4HIO A;  3IKJ A;  2R61 A;  4UDU C;  1Y1W H;  2L55 A;  4IPG A;  3V2T A;  4HJ7 A;  4DR3 Q;  3ULL A;  3SVM A;  3U9O A;  4JBW A;  1XMO Q;  1G6Z A;  2XWJ B;  1IBM Q;  2UU9 Q;  4JPB W;  2CVR A;  5IP9 G;  4X62 L;  1PLF A;  5IGG A;  2K7V A;  4IFD H;  2VB2 X;  1N8R C;  1SJH D;  4BY1 H;  1NNX A;  2K33 A;  1DCZ A;  1XPU A;  5C44 B;  2OQK A;  4IQZ A;  4CDC C;  3U58 A;  2B3G A;  2I46 A;  3PO3 G;  1B70 B;  1H9M A;  3KOJ A;  5C5L A;  1EZ8 A;  3QR8 A;  1DOL A;  1PH5 A;  1X3P A;  4GOP C;  2FMM A;  3FHW A;  3HOZ G;  2A8V A;  1HUN A;  4B3S Q;  4CDF C;  3HOY G;  5CMD A;  3A8I E;  4G4K A;  4PMW A;  3J81 j;  1XNQ Q;  3AEV A;  2NZH A;  1LTG D;  1D6E C;  4ILW A;  4JBJ A;  5GAG C;  2F4I A;  1LTR D;  5IGE A;  5M3M G;  3LX0 A;  1J5E L;  1O7Z A;  1FNW A;  5TSS A;  2NVT B;  5IP7 G;  4RCO A;  4DF7 A;  3SHL A;  3HOU H;  2J4X A;  2K05 A;  3FP9 A;  3BVG A;  3VR5 A;  3CCR A;  2NVQ H;  2RDH A;  2BE5 C;  3RZO B;  4H7B A;  1E1O A;  4DKA C;  2UUB L;  2CH4 W;  1YJW A;  2SOB A;  4CGY B;  5IWA L;  3I56 A;  2ZM6 L;  2Y0S G;  4FDB A;  1EUJ A;  3JAM i;  4GKK Q;  2K75 A;  5EAY A;  4CHT B;  1P16 A;  3CU7 A;  2B2W A;  3RD4 A;  2F0D A;  2PYK A;  4RGN A;  1VDZ A;  1Z7T A;  4ZAI A;  4X62 Q;  2KBN A;  4NXN L;  1VQD A;  2GVB A;  3GTM H;  4YIJ A;  2H4O A;  5JJK A;  4CDD C;  4N8F A;  5IGF A;  5FLM G;  1OXT A;  3OIQ A;  1WD0 A;  5EPL A;  4WOR A;  1SEB D;  4H0L C;  2A1A A;  2MP1 A;  1UE1 A;  2ICI A;  3GTG H;  4ZQ3 A;  2ATW A;  2QIL A;  5CC4 A;  4APV A;  4DGZ A;  1QB5 D;  1IYV A;  5GQO A;  4KK7 A;  3BZD B;  2PQE A;  3SEB A;  1B1Z A;  3J7Z C;  2HCI A;  1KD1 C;  1A63 A;  3CPF A;  2WV6 D;  2RQX A;  2RCF A;  5J3B A;  2OTJ A;  4OON A;  3S15 H;  1UEB A;  1LAB A;  3S2D B;  1GJX A;  3URY A;  5CV8 A;  2K4K A;  4MHE A;  3I7F A;  1KDB A;  4TQU S;  3BDO A;  3E6Z X;  1J5E Q;  1I6H B;  2F03 A;  4P2C B;  2R92 B;  2LXJ A;  3S2D H;  1L2F A;  1YEZ A;  1CTM A;  3I55 A;  2ENB A;  1I6H H;  2GN5 A;  3GTK B;  4MZ9 A;  2UUB Q;  5I9O A;  4ZK9 B;  1U4P A;  4JI2 L;  4KI0 A;  5IWA Q;  2ZM6 Q;  1A3U A;  4A3E B;  1TWF B;  1SNP A;  1STE A;  1I50 B;  2BDN A;  1CKN B;  2XTI A;  1WCM H;  1BF4 A;  3OW2 A;  4MTK A;  4C3H H;  1X3Q A;  1CHP D;  1ZYR C;  3MHB A;  3OPO A;  1FD7 D;  5C4Z A;  2O5J C;  4A3E H;  1LTS D;  1Y14 B;  1TWF H;  1RDP D;  4DAV A;  4J15 A;  5CV6 A;  1MJE A;  1I50 H;  4NXN Q;  2JA5 G;  1HNZ L;  1R9T B;  2K03 A;  2VQF L;  4X3K A;  2JN4 A;  3EN2 A;  1L1O B;  3ZYY X;  1FGB D;  1SYG A;  4ME5 A;  3FEW X;  1V8Q A;  2Z6B A;  1R9T H;  4C1N I;  3NBH B;  1HZA A;  4IZ8 A;  4R4I A;  1Q12 A;  2YU9 B;  3SK5 A;  4DNT B;  5C3X A;  4L5T A;  4X3S A;  3K7A B;  1XYI A;  3BU2 A;  1RCV D;  3WOF A;  4F7X A;  4XYQ A;  2YU9 H;  3VYS A;  5HGQ A;  3SK8 A;  1NTG A;  2WII B;  1LTI D;  3GD7 A;  3A54 A;  5ELD A;  2PI2 A;  1MHW C;  1PRT D;  4ZUI A;  2PZW A;  3QWN A;  3ULP A;  4PG3 A;  4NPS A;  2F0T A;  4U67 3;  2HT1 A;  3MXU A;  5CV4 A;  3MA2 B;  1VQF A;  4JW0 A;  4JI2 Q;  5JEA G;  3GTL B;  2EYM A;  3HRZ C;  5E4X A;  2ZJQ A;  1LYL A;  2L9H A;  1TXY A;  2XSC A;  1D1I A;  4WJW A;  4O2D A;  3G7L A;  4QL5 A;  1K73 C;  2K01 A;  1EFW A;  1S5C D;  4KJN A;  3RLO A;  1HNZ Q;  3PCO B;  4A3J B;  2VQF Q;  2G9D A;  5IYD H;  1ML0 D;  3HZX A;  1UNS A;  4JI4 L;  3TP7 A;  1TU2 B;  1WI5 A;  1NMF A;  1RF2 D;  3I4M B;  2L4N A;  1DZ1 A;  1II3 A;  5M3F B;  4A3J H;  5KYL A;  2TMP A;  3RNU A;  2WKC A;  5M5X B;  4C1N K;  2IX3 A;  3I4M H;  1BR9 A;  5M3F H;  1CT1 D;  2K1B A;  2HDL A;  2QA4 A;  4K6L A;  5M5X H;  4LF5 Q;  2BH2 A;  2XVS A;  1TT2 A;  4A75 A;  3ND9 A;  4DR7 L;  5IYB H;  1C8C A;  1I4H A;  1SXT A;  2DUD A;  1VQI A;  2E76 C;  2OXP A;  2PZU A;  1U4M A;  1N34 L;  3AU7 A;  3EIV A;  5IGD A;  5LL6 X;  2N55 A;  2RHS B;  1FVI A;  1SBB B;  5JAV A;  2OQ0 A;  4AIM A;  3PF5 A;  5J1Z A;  1SJE D;  1E0B A;  3STB D;  1GVP A;  1QVF A;  3QIA A;  1YHB A;  4IO9 A;  5C4X B;  1TWG B;  3LNN A;  1GUW A;  3I4N H;  3PV0 A;  4K8J A;  3J7A 5;  3RMH A;  4CKE A;  1I5F A;  4Z9C B;  1PH2 A;  1VQJ A;  3AQQ A;  1VQ6 A;  1TWG H;  4LF6 L;  2MQH A;  1LTL A;  1TVX A;  1XTD A;  1JWU D;  4KHZ A;  5IT9 c;  1HNW L;  4DUY L;  1W6J A;  2IHE A;  4JI4 Q;  1JJ2 A;  4KY5 A;  4FNF A;  2H5X A;  3P1H A;  1LTT D;  3CQZ B;  4KN7 C;  5ELC A;  1X55 A;  3FRP B;  1QUQ B;  3LWE A;  3CQZ H;  2B2Y A;  4I7Z C;  4J1M A;  4JV5 L;  1SMY C;  1B4O A;  4JI5 Q;  1X3G A;  3H09 A;  1YNN C;  1LO5 D;  4G7H C;  4K0K L;  3S24 A;  1Q1E A;  3S14 B;  1CSQ A;  3T56 B;  1PH3 A;  4DR7 Q;  5AFW A;  4L63 B;  2P5Z X;  3SGI A;  2MFI A;  3S14 H;  4KY6 A;  4CKB A;  1ESR A;  1DOK A;  5FLX L;  2L0C A;  2B2U A;  1N34 Q;  2NN6 H;  3NEL A;  3VA7 A;  1QVC A;  1OXS C;  3RZD B;  4DV7 L;  1BXT A;  1TWC B;  1N36 L;  1KIX A;  1DD2 A;  2AMC B;  4DFA A;  1SND A;  2VW9 A;  4RGM A;  4UP8 A;  2E74 C;  4IPC A;  3RZD H;  2PNH A;  4HID A;  1EY5 A;  2ID0 A;  1TWC H;  2OF1 A;  4ZUJ A;  2KED A;  1EOT A;  3HKZ B;  1WTO A;  1D5X C;  1SNQ A;  4EX5 A;  4DR2 Q;  3HOX B;  3MFY A;  4LF6 Q;  4KKU A;  3FVQ A;  1VQE A;  4XT1 B;  3A8K E;  4LMQ D;  1HNW Q;  3I73 A;  3WWV A;  4DUY Q;  2R93 B;  2SNM A;  4K2L A;  4S3S A;  3HOX H;  4JYA L;  2R7Z B;  4HTH A;  4WRD A;  3NEN A;  2YYZ A;  4JBM A;  2I5L X;  1HNX L;  2A69 D;  3BYT B;  4H13 C;  4I65 A;  3STB C;  3L3O C;  5J39 A;  3RLN A;  3T4A C;  3A74 A;  3N6R A;  3J81 E;  5HGT A;  5JJZ A;  1TS3 A;  2R7Z H;  3IFD A;  3OWE B;  2I5H A;  3B6Y A;  4JV5 Q;  4B3M L;  3C1E A;  3U4Z A;  1HTL D;  5C0X H;  3I91 A;  3A7A B;  4NDX A;  1SNM A;  2FIN B;  3MAQ A;  5K36 H;  3K0X A;  4OO1 G;  3K0Y A;  3U4V A;  2F0S A;  3NTK A;  4A3L H;  3DXJ C;  3X3N A;  4X64 L;  4F8M A;  3VR4 A;  3S1Q B;  2WKD A;  1XWE A;  1OXV A;  1RIP A;  1NE3 A;  3CCV A;  1O7I A;  2KJX A;  2N88 A;  2IHF A;  3MXG A;  1NBW A;  2KCC A;  3IFT A;  5DAU A;  4IOC A;  3BVZ A;  5CV5 A;  3PO2 H;  4K2K A;  4R8N A;  1N36 Q;  1EFI D;  2IL8 A;  3AYH B;  2F3I A;  3J80 E;  3PUV A;  2NTS A;  3D6C A;  1OXX K;  5I2Y A;  2Z4H A;  1NR4 A;  2NYZ D;  2L12 A;  2ZT9 C;  1CKM A;  1EU4 A;  1HFN A;  2JA7 B;  3PIO 3;  3M9B A;  4OHJ A;  2Z6K A;  1IBL L;  3OMG A;  2NB0 A;  2JSO A;  4IUT A;  4LJZ C;  5IGB A;  1FJG L;  1LT4 D;  2F0G A;  2JA7 H;  2JEB I;  4DXF A;  1PXU A;  5CR3 A;  2A6E D;  1H9K A;  4JYA Q;  1RTN A;  1FGU A;  3GTQ B;  1IYJ B;  5E4W C;  1HNX Q;  4A4I A;  2JA6 G;  1WTV A;  1ONL A;  4AH6 A;  3PO3 B;  1K9M C;  1G51 A;  4NW2 A;  4O42 A;  1HR0 W;  2BCO A;  1EY0 A;  1JOQ A;  1VQL A;  1PFB A;  2K32 A;  4A3F B;  1HR0 L;  5DNF A;  3GTQ H;  2RSN A;  2WP8 J;  2JJQ A;  2B63 G;  1A0I A;  3HOY B;  5IYC H;  1N33 L;  1JIC A;  4QQB X;  4JOI A;  2QGQ A;  1EWI A;  2MNA A;  2E2H B;  2N3S A;  4A3F H;  1ILP A;  1EQR A;  2KQ3 A;  1MI2 A;  2A6H C;  3KBX A;  4X64 Q;  1O78 A;  2E2H H;  1EIY B;  4POG A;  2OWO A;  2A69 C;  4EVO A;  1V1O A;  4JI7 L;  3CCL A;  4AQY L;  1LTB D;  1CM9 A;  4XYO A;  5IGC A;  4X66 L;  4EQ5 A;  1S5F D;  5A2Q E;  4IFD J;  2Y0S B;  3KF8 B;  4FYD A;  4PQX A;  1QE6 A;  1Y1V B;  4KHV A;  4LAA A;  4C3J B;  4OEL B;  3N52 A;  3TQY A;  4A76 A;  2NVY H;  3KF6 A;  1MSH A;  2KCT A;  1CHQ D;  2F0Q A;  1Y1V H;  4E6I A;  1NY4 A;  1CQV A;  4C3J H;  1LTA D;  2C9O A;  1IBL Q;  4RAU C;  5CYU A;  2V4D A;  3VYR A;  2IJ0 A;  4BY7 G;  1FJG Q;  1TKW B;  1IXR A;  2VUM H;  3F2C A;  1BNZ A;  1STA A;  3D6W A;  2F4V L;  2R6G A;  2ZJP A;  3NSW A;  2GVA A;  1GM5 A;  4L8J A;  3F2U A;  4DNR B;  1PH8 A;  4BBR G;  3I4L A;  3DWP A;  4DV6 L;  1WTX A;  2LSS A;  4L5R C;  2YV5 A;  4DV4 L;  1KTK A;  1LUZ A;  1MKH A;  1S72 A;  3CCE A;  3A5U A;  4KD4 A;  2BE5 D;  4KJO A;  3MWY W;  1MD2 D;  1IBK L;  4RHS A;  1N33 Q;  3DWQ A;  1TR5 A;  2KEC A;  2TSS A;  3HS0 C;  3K58 A;  1KDA A;  1GXD C;  1ENF A;  3HKS A;  4BS9 A;  1EYC A;  1ZEQ X;  3QB3 A;  4HCE A;  3T13 A;  2HCC A;  1VQA A;  2EXD A;  4OWT B;  3SDZ A;  3M4P A;  1YNX A;  5I2X A;  2F0O A;  1SYE A;  5C5M A;  1IHZ A;  3T1H L;  3K80 C;  2B2V A;  4JI7 Q;  3NP8 A;  4AQY Q;  1SNC A;  3KUP A;  3KDF A;  4A3I G;  3KK7 A;  4IUQ A;  3M3Y B;  4X66 Q;  4OEM B;  1OTC A;  3CD6 A;  1Z9F A;  2JQO A;  1Y69 U;  2EOT A;  3JAM c;  2J7Z A;  4U68 A;  3M3Y H;  3M4Y A;  4K5V A;  1EY8 A;  1HHV A;  5GAH C;  5E1F A;  4B3R L;  1Q1B A;  5EKI A;  1XX8 A;  1NAP A;  5FOB B;  1PTO D;  1MBY A;  2F4V Q;  2Q8T A;  1STN A;  3HG9 A;  2RVL A;  4MTN A;  1PZJ D;  4ULL A;  5ELE A;  2DNC A;  2Q8R E;  5C3E B;  1F2L A;  2ZJR A;  1HZB A;  5COR A;  1ENA A;  4LFC L;  1SE4 A;  3J81 L;  4FO2 A;  5C3E H;  2L1B A;  1KNE A;  1J6Q A;  1G29 1;  1CZW A;  3Q6S A;  4DV4 Q;  2AUK A;  5EPJ A;  4GN3 B;  2EY6 A;  4FVM A;  2M00 A;  2K5H A;  5C44 H;  2D62 A;  4XT3 B;  4DK3 C;  1IBK Q;  3DMU A;  4LFA L;  3E0E A;  1GO3 E;  4UP9 A;  4JG2 A;  1A6X A;  1F2M A;  1JWM D;  3MFG A;  3I8Z A;  3OOC A;  5JJI A;  3ICE A;  1ZYR D;  1HQM C;  1O7L A;  4YWL A;  5BN5 A;  4A3G G;  2ALY B;  2I5M X;  5G3L F;  1TWH B;  1VQK A;  3K59 A;  3HKZ E;  2CQO A;  3T1H Q;  3CCQ A;  3HOW G;  1SFO B;  1BBU A;  4LNQ A;  1TWH H;  1S5B D;  3I72 A;  4FP5 D;  4R4C A;  2NVT H;  3J80 L;  4PZ8 A;  2JA8 B;  2CHB D;  3I3C A;  2IWH A;  1SFO H;  3NBI A;  5LMN W;  4ME3 A;  1KQS A;  1K0S A;  5LMN L;  3RZO H;  2JA8 H;  3T1Y L;  1D7Q A;  3A8J E;  4GN5 A;  4B3R Q;  4K5X A;  2EYO A;  2B2Y C;  1C4Q A;  1O7Y A;  4A3B G;  3V05 A;  3K5L A;  4DUZ L;  4RH6 A;  1PH9 A;  1EQQ A;  4R4O A;  2SEB D;  4NP5 A;  4BXX H;  3PGZ A;  2BH8 A;  1K8G A;  4G7Z C;  4HJ8 A;  5DEH A;  4ZLT F;  5CBA E;  1PH1 A;  4LFC Q;  3HFZ B;  2DJG C;  4HSP A;  4C3I B;  2B2U C;  2JEA I;  4HIM A;  2F3V A;  3TME A;  3G4S A;  2AWO A;  3BS1 A;  4GN4 B;  3H0G G;  3J81 i;  5FO8 B;  2K5W A;  4LFA Q;  4C3I H;  1UE5 A;  5T1I A;  1ZKO A;  1PTO C;  2K5V A;  2MPM A;  2MGS A;  4B9W A;  4A93 G;  3K6O A;  1JC7 A;  1EY7 A;  1KC8 C;  3L7Z C;  2B2T A;  3D4R A;  2V1C C;  1RJT A;  1IW7 C;  2DJF C;  5FLX E;  2Z0S A;  4XQJ A;  4MNO A;  2LMC B;  2EY1 A;  1OO9 B;  4FF2 A;  1L0W A;  1CQF A;  3MEH A;  4TKO B;  5A2Q L;  3UDX A;  2JK8 A;  1ESF A;  2R92 H;  5KNC A;  4DU9 A;  5FJ8 G;  1VMP A;  1J9O A;  4DK6 C;  1FNU A;  2CW0 C;  3CCJ A;  1Q81 C;  4KKS A;  3J80 i;  5A35 A;  3T1Y Q;  3GTK H;  3FKI G;  4V0B A;  2YTV A;  4X3U A;  4HSV A;  4OX9 L;  3BZC A;  3ERS X;  2RSO A;  4GNX B;  1H9S B;  4DUZ Q;  4A3D G;  4HR7 B;  2K52 A;  4ID6 A;  2Q2T A;  3J7A V;  4R8I A;  3S1R B;  4OIK A;  1Y1W G;  5C4J B;  1G2T A;  5I6W A;  4DR6 L;  1T9H A;  2HUG A;  4EQO A;  3S1R H;  3SK6 A;  1C48 A;  1WYD A;  4P73 A;  5IE8 A;  1CKN A;  1G8Z D;  1AE2 A;  5H1S E;  2E2J B;  1LT6 D;  5M9O A;  4IFD G;  1L0X B;  4RKB A;  4UY8 C;  2XRQ D;  4HED A;  4BY1 G;  1BO0 A;  2AUJ D;  4DK1 A;  5C6A A;  2UXD L;  2ZTC A;  1M1K C;  3RUZ A;  2E2J H;  1L1O A;  2EPB A;  2Y0S E;  3FDT A;  2MO0 A;  3L0O A;  2EE1 A;  3K7A H;  2LFN A;  5K5P A;  4OGQ C;  2CH4 A;  4R9W A;  4LF4 L;  4DAY B;  4TSS A;  3NBH A;  3UDG A;  1EQT A;  1F2Y A;  1FNV A;  5BR8 L;  1B8A A;  1S4Z A;  1B53 A;  1C7Y A;  3NK9 A;  5E3F A;  3GTP B;  1F2Z A;  3E5S A;  3UI2 A;  3TP5 A;  1C9O A;  1CSP A;  3MTS A;  3J7Y W;  3CAM A;  1I6V C;  3QO2 A;  3GTP H;  2PNR C;  3HOU G;  4OX9 Q;  1SMY D;  4C2M B;  3GTL H;  4Y52 H;  5AJ3 L;  1D2B A;  1YNN D;  4OXP A;  4IUR A;  4ZRZ A;  1NUC A;  3NWS A;  3ERO A;  4OWW B;  5M5W B;  1SRO A;  4IOA A;  4C2M H;  3PQI A;  4A3C H;  1B50 A;  3OSO A;  4DR6 Q;  4K14 A;  2RCN A;  3L2P A;  1Q7Y C;  5M5W H;  4RCN A;  1QNK A;  3P75 A;  1E24 A;  3I4O A;  2LY7 A;  1SYF A;  3PUZ A;  1VQG A;  1DJR D;  1UAP A;  3AB9 A;  4BWG B;  2EXZ A;  1WTH A;  1XPR A;  4LK1 C;  3DEO A;  2WB1 B;  2EJF C;  4RMF A;  2F0V A;  3CC2 A;  1GKH A;  4XQQ A;  5ELB A;  3HOV B;  1JE4 A;  4XQN A;  4YCW A;  2E8G A;  5BN3 A;  1VQH A;  2GA4 B;  4LF4 Q;  1D8L A;  1GHJ A;  1EIH A;  4NXM L;  4MIU A;  3HOV H;  5BR8 Q;  1HPC A;  5HY6 A;  4GOP B;  1N32 L;  1Y8P B;  2WIN B;  3PUX A;  4A3K B;  2PPB C;  2RHQ B;  2CCZ A;  1VQ7 A;  1V9P A;  2WAQ G;  2JYO A;  2YTX A;  1LAC A;  1DGS A;  4EGV A;  4A3K H;  1X56 A;  2KUM A;  1L0Y B;  2MHV A;  3C3L A;  2EJG C;  4LFB L;  1PMR A;  2E5L L;  4QIW B;  4UHV A;  5C4X H;  1VQ8 A;  2HIX A;  2VXW A;  2EY2 A;  1TWA B;  5C0X J;  3LGJ A;  3CF5 A;  2WAC A;  4J8Q A;  2OTL A;  2JA6 B;  1WCM G;  4C3H G;  1RKN A;  3DUZ A;  1YVC A;  4A3E G;  1HH2 P;  5EBD A;  2AKW B;  3NUC A;  2ZXR A;  3M7N A;  4GLV B;  3H94 A;  4XTC S;  1K83 B;  3G71 A;  2ZTE A;  3C2P A;  3KLS A;  3AFQ A;  1YJ9 A;  3M4Q A;  4UP7 A;  3OMC A;  3KLW A;  5NUC A;  3RN5 A;  2PW5 A;  1K83 H;  1HZC A;  3GV3 A;  1AZP A;  1KDC A;  1K3B C;  1AEX A;  1A15 A;  3P7J A;  1WTR A;  1QUQ A;  4NXM Q;  4HIK A;  1TY2 A;  3VR6 A;  1N32 Q;  3CC4 A;  3KBG A;  2QF7 A;  4ALP A;  3M7G A;  1HXY D;  3GO5 A;  1PZI D;  3EA6 A;  2NUC A;  1PTO B;  4RKL A;  5LMU L;  4DR5 L;  2K28 A;  3TDQ A;  3P20 A;  1JB3 A;  4UPA A;  4IN3 A;  4MN3 A;  3PUY A;  2VS1 A;  1PTO H;  5DM7 3;  1IZ6 A;  4DV3 L;  4LFB Q;  4POF A;  4Y7N B;  1YI2 A;  4FXD A;  3KLR A;  2B8G A;  4WFN 3;  2E5L Q;  3FMC A;  1I3Q B;  1TS2 A;  4L5S A;  2JXM B;  1BCP F;  1BQQ T;  2DGY A;  4Y7N H;  3GTO B;  1I3Q H;  2A6H D;  4TVA B;  4BBR B;  3S9W A;  1D5M C;  3SK4 A;  4I7A A;  1SYB A;  3GQB A;  4Q0F A;  1KRT A;  4A3M B;  3SR1 A;  4PMB A;  4KN4 C;  2BDO A;  3GTO H;  4JI3 L;  2R93 H;  2B8F A;  4BBR H;  3S16 B;  1H9J A;  5EKL A;  4IUN A;  1PDQ A;  2FFK B;  1CUK A;  2KCN A;  4A3M H;  1QVG A;  1HA6 A;  5IYD G;  1DM0 B;  2F0P A;  4BBS B;  2VQE L;  3S16 H;  4K0K Q;  1Q46 A;  1XNR L;  1EIG A;  3CKI B;  4A3J G;  4QY7 A;  1E22 A;  4BBS H;  4IPD A;  2A74 C;  2ZTD A;  3ZJY C;  3I4M G;  3ERQ A;  5M3F G;  2B2W C;  1EY9 A;  3A55 A;  3F2D A;  4NKL A;  4ABN A;  2QDL A;  3NPP A;  2KHJ A;  4YCU A; 
#chains in the Genus database with same CATH homology
 3H91 A;  3AMU A;  3V96 A;  2K04 A;  4IUU A;  2A68 C;  1A2T A;  1HQR D;  3K5M A;  2D5D A;  4CJ2 C;  2Q8I B;  2BOS A;  5FO7 B;  4G57 A;  2JP1 A;  2Z1C A;  1KLU D;  4FXG C;  5FO9 B;  1CI3 M;  3S2H B;  1JOK A;  1WTP A;  1O80 A;  1U4R A;  3H6M A;  2VB3 X;  1F9R A;  1I4G A;  2B2T C;  3SE0 A;  1SNO A;  1B3A A;  5EGT A;  3TBI B;  1BUV T;  3C1F A;  2QCP X;  3CHB D;  3HOZ B;  1HUM A;  1EU3 A;  3M85 A;  1EWH A;  2A73 B;  3LWU A;  3MZ5 A;  3L9A X;  5DM6 3;  2EYP A;  2NWG A;  4A3G B;  5M3M B;  1VMC A;  2O5I C;  3EVQ A;  3GTJ B;  1EYD A;  4RFB A;  1V1P B;  1RTO A;  1EY4 A;  1IKM A;  1STG A;  5D65 A;  5KGU A;  2PCF B;  2NN6 G;  3PIP 3;  4QUC A;  3Q24 A;  5D14 A;  4DA2 A;  1MGS A;  1CZG A;  4PNY A;  1A2U A;  2DN8 A;  3X3M A;  1JOO A;  3KF8 A;  2M9V A;  1STB A;  1LT5 D;  3H0G B;  1QIL A;  2KOL A;  2DNE A;  4KD3 A;  3D31 A;  2EYH A;  4A93 B;  4EQP A;  4ODG A;  2R3Z A;  3EJI A;  3U9S A;  5I9P A;  2AQ2 B;  4QUF A;  3OHX C;  3T53 B;  5M5Y B;  2NVX B;  1G2S A;  2Z8L A;  5C0X G;  5JPM C;  4RHR A;  2EZV A;  4DAP A;  5K36 G;  4M8A A;  2NZ1 D;  3BG3 A;  4XXE A;  1M4V A;  2MUY A;  1ET6 A;  3BYY B;  2F0W A;  2OT2 A;  1BCP C;  2JA5 B;  3KLS X;  4ZYS A;  2XNA C;  1Y1W B;  1CFM A;  1DXM A;  1FR3 A;  5I6Y A;  1IW7 D;  4IUP A;  2PW7 A;  1NCV A;  4HN7 A;  1ILQ A;  3DEP A;  1PFN A;  4BY1 B;  3EQL C;  3CRK C;  1ZXT A;  3NQT A;  3ND8 A;  4B9X A;  1BOS A;  1CA6 A;  1AW7 A;  4RGO S;  4L6T B;  4NMZ A;  5EBC A;  2EYJ A;  2CW0 D;  4IFD I;  1PYW D;  2QKI C;  1B44 D;  2HQE A;  1Z6H A;  3NWT A;  2BA1 A;  1GUN A;  1XTC D;  2SDF A;  4KY7 A;  4ZKC B;  5CBE E;  1WD1 A;  3DWA A;  1TY0 A;  2X69 A;  3HOU B;  5JEA H;  4XDX A;  2NVQ B;  4K6D A;  1YNJ C;  2D2C C;  1AZQ A;  3H3V C;  1A3V A;  4FF3 A;  1NR2 A;  5F2D A;  5COY A;  5ISR A;  4DK0 A;  5HUR A;  1EEI D;  1S5D D;  5ELF A;  2OEO A;  3QOJ A;  1ET9 A;  4CJ1 B;  1F9S A;  2K6A A;  3OWF A;  4K5W A;  4C3J G;  1GHK A;  1QCB D;  1GUG A;  3DHQ A;  1EEF D;  1HCZ A;  1ENC A;  2F0H A;  3GTM B;  2PMZ B;  5IT9 E;  4QF4 A;  1PRT F;  2IX1 A;  1JOR A;  3GTG B;  1KNA A;  2PZT A;  3IL8 A;  1W6K A;  2L11 A;  5JVH 3;  1HFG A;  1WTQ A;  1JWS D;  3NQI A;  3S15 B;  4KKT A;  4DXG A;  2WAQ B;  3S17 B;  3HGB A;  1HA5 A;  1DYQ A;  3TP6 A;  2J0T D;  4G7O C;  3VYU A;  3O13 A;  4J6H A;  1B2T A;  1GUT A;  1STH A;  4V19 0;  4BA2 I;  3MXP A;  1SSO A;  1KLG D;  1I4P A;  1PZK D;  1U9R A;  2F1M A;  1SE3 A;  3FPP A;  3OIP A;  1QG7 A;  1EL0 A;  4HAE A;  1WCM B;  4C3H B;  2PO4 A;  5G3L D;  2D9U A;  3SXH A;  1VF5 C;  4PMC A;  4KTA A;  1KAB A;  1E2W A;  1G91 A;  3NHH A;  2O4X A;  1H9S A;  5D3I B;  2RA4 A;  1SE2 A;  2RKS A;  1AP0 A;  4IAL A;  2LS0 1;  3PMF A;  2FHT A;  1B9N A;  4QMG A;  4ZKB B;  1D1K A;  2G9H D;  3QG1 A;  2Z4I A;  3QOL A;  1VF7 A;  1RHP A;  2L5T A;  4C56 C;  5EJW A;  2ICE C;  3D3R A;  2JE6 I;  5KYI A;  3NTI A;  2FMC A;  1NSN S;  1KAA A;  4HMJ A;  4F88 A;  4DAY A;  4BA1 I;  1TS5 A;  1V43 A;  2VNU D;  1GUO A;  4FF1 A;  1Z47 A;  5EQ0 A;  1R4Q B;  5KEE A;  2QEJ C;  5LHY 1;  4HMI A;  1AN8 A;  3TSS A;  2DY7 A;  2AQ1 B;  2E2I B;  4FXK C;  3IAY A;  1Q3L A;  1I4R A;  3R3O A;  1BCP B;  3TN2 A;  4GZY C;  4QB4 A;  3Q22 A;  1DOM A;  1BDO A;  4XIG S;  5EPK A;  1F9P A;  4RA8 A;  1S5E D;  2K5D A;  5KRU A;  3BDL A;  3DM1 A;  3RLF A;  5LL6 S;  3VYT A;  3K57 A;  4OO1 H;  5CV7 A;  5FK9 C;  3TP8 A;  3D8G A;  4OO1 I;  4C3I G;  2NTT A;  3NXW A;  1M8A A;  3S1M B;  2F0K A;  3ONA B;  1QNU A;  1E2Z A;  1EZ6 A;  3R8B A;  4Q5V A;  4QCL A;  3TZU A;  1GUS A;  2F0M A;  3R2I A;  1IKL A;  5KNB A;  3GV6 A;  2AQ3 B;  4DN4 M;  4EQN A;  1SYC A;  4CJ0 B;  1Q90 A;  1A3T A;  3TZD A;  3I4N B;  1STY A;  4IUV A;  1X32 A;  1EY6 A;  1I4Q A;  2IX0 A;  2X6L A;  5IT9 L;  4OL7 A;  4N9T A;  2B63 B;  4AYB B;  2B2V C;  1DON A;  1K8O A;  3I70 A;  1PRT C;  3MXN A;  5KIX A;  3WOE A;  2BA0 A;  2NBF A;  1T5X D;  4O1N A;  2A68 D;  1SYD A;  2E75 C;  1LT3 D;  3D4W A;  5BN4 A;  2KVM A;  1F77 A;  1QWY A;  2RDG A;  4RWS C;  2KEE A;  2C5C A;  2F0F A;  5JOB A;  2X6G A;  1TII D;  2F3W A;  3NE5 B;  4TRD A;  5IIF A;  4H44 C;  2F0I A;  4UAI A;  3HP3 A;  1JR0 D;  3I90 A;  2IW3 A;  2F0J A;  4CKC A;  4BY7 B;  4M1U B;  1SAP A;  4KMU C;  1AFP A;  1T5E A;  2NN6 I;  1VCI A;  2XWB B;  2F0L A;  1TS4 A;  3JAM E;  2K5Q A;  1RD9 D;  4K8I A;  2SNS A;  2ZXP A;  1IYU A;  1U4L A;  1LV9 A;  3J7A F;  2F0N A;  1QJO A;  3K5N A;  3W3A A;  1EQV A;  1Y8O B;  2E2D C;  1HTP A;  2I07 B;  2IT1 A;  2FJ2 A;  5KND A;  1WVL A;  1JCK B;  1EYA A;  4A3I B;  1ICW A;  5D3D A;  5C0X I;  3A7L A;  3HEJ A;  1QOH A;  1E2V A;  5CGK A;  4JK1 C;  3PO2 B;  3WDN A;  1GOZ A;  2QDB A;  4HCS A;  3VR2 A;  2EYL A;  2H1E A;  2XIW A;  2KA7 A;  2A5H A;  1B9M A;  1MSG A;  5I4D A;  1HRJ A;  3OW7 A;  1K8M A;  1SDF A;  5J22 A;  2M2L A;  2EJM A;  5JPN C;  2F0U A;  4OIJ A;  2IPK D;  4FF4 A;  5JVG 3;  2LKV A;  1OXU A;  3T51 B;  3MC0 B;  4RGT A;  3NTH A;  2ZXO A;  3EFX D;  1Q8I A;  1BCP D;  5C4H A;  1I4X A;  2F0E A;  1IL8 A;  3HOW B;  1F9Q A;  2CQA A;  1WTW A;  3R93 A;  5T1G A;  2HDM A;  1J8I A;  3ITP A;  1PTO F;  1TQO A;  1ROD A;  2B39 A;  3R2T A;  4A3B B;  3VR3 A;  3QJY A;  2AWN A;  3E0J A;  3D4D A;  2NVY B;  1BBX C;  1EWC A;  1V1P A;  2KHS A;  3T16 A;  2EYF A;  3Q0A A;  2RBM A;  1D5Z C;  5C3W A;  3MVV A;  1UEA B;  2VUM B;  3BVM A;  3CRL C;  2EY5 A;  3FPU B;  4X3T A;  1LLR D;  2MJ8 A;  1R4P B;  2XRS D;  4F87 A;  3S1N B;  3K5O A;  3BDC A;  1CA5 A;  1YNJ D;  3M4O B;  3GP7 A;  1XXG A;  1H9R A;  2EDG A;  5JEA J;  4KV6 A;  3A56 A;  1PRT B;  1JQY D;  3W2D A;  4N9P A;  3C46 A;  2RDF A;  1UUP A;  3PUW A;  2XN9 C;  4CBV A;  2O2L D;  4PV1 C;  5IOC A;  2A6E C;  5CV9 A;  5FKA C;  3FKI B;  1FYC A;  1Y8N B;  2DY8 A;  1CK1 A;  5IOD A;  5EKK A;  4A3D B;  4B08 A;  3Q23 A;  3JAM L;  3VA5 A;  3G6J B;  1PFM A;  2EVB A;  3IKJ A;  2R61 A;  4UDU C;  2L55 A;  3V2T A;  3SVM A;  3U9O A;  4JBW A;  1G6Z A;  2XWJ B;  2CVR A;  1PLF A;  5IGG A;  2K7V A;  4IFD H;  2VB2 X;  1SJH D;  2K33 A;  1DCZ A;  5C44 B;  4IQZ A;  2I46 A;  1H9M A;  5C5L A;  1EZ8 A;  1DOL A;  1X3P A;  2FMM A;  1HUN A;  5CMD A;  3A8I E;  4G4K A;  4PMW A;  1LTG D;  1D6E C;  4ILW A;  2F4I A;  1LTR D;  5IGE A;  3LX0 A;  1O7Z A;  1FNW A;  5TSS A;  2NVT B;  4RCO A;  4DF7 A;  3SHL A;  2J4X A;  2K05 A;  3BVG A;  3VR5 A;  2RDH A;  2BE5 C;  3RZO B;  4H7B A;  2SOB A;  4CGY B;  4CHT B;  3CU7 A;  2B2W A;  3RD4 A;  2F0D A;  2PYK A;  4RGN A;  1VDZ A;  1Z7T A;  4ZAI A;  4YIJ A;  2H4O A;  5IGF A;  1OXT A;  3OIQ A;  1WD0 A;  5EPL A;  4WOR A;  1SEB D;  4H0L C;  2MP1 A;  2ICI A;  4ZQ3 A;  2QIL A;  5CC4 A;  4DGZ A;  1QB5 D;  1IYV A;  4KK7 A;  3BZD B;  2PQE A;  3SEB A;  1B1Z A;  2HCI A;  2WV6 D;  2RQX A;  1LAB A;  3S2D B;  1GJX A;  3URY A;  5CV8 A;  4TQU S;  4MHE A;  1KDB A;  3BDO A;  3E6Z X;  1I6H B;  2F03 A;  4P2C B;  2R92 B;  1CTM A;  2ENB A;  3GTK B;  5I9O A;  4ZK9 B;  1U4P A;  4KI0 A;  1A3U A;  4A3E B;  1TWF B;  1SNP A;  1STE A;  1I50 B;  2BDN A;  1BF4 A;  1X3Q A;  1CHP D;  1ZYR C;  3MHB A;  3OPO A;  1FD7 D;  5C4Z A;  2O5J C;  1LTS D;  1RDP D;  4DAV A;  5CV6 A;  1R9T B;  2K03 A;  4X3K A;  3ZYY X;  1FGB D;  1SYG A;  4ME5 A;  3FEW X;  1V8Q A;  4C1N I;  4IZ8 A;  1Q12 A;  2YU9 B;  3SK5 A;  4DNT B;  5C3X A;  4X3S A;  3K7A B;  1XYI A;  1RCV D;  3WOF A;  4F7X A;  4XYQ A;  3VYS A;  3SK8 A;  2WII B;  1LTI D;  3GD7 A;  3A54 A;  5ELD A;  1PRT D;  4ZUI A;  2PZW A;  3QWN A;  2F0T A;  4U67 3;  3MXU A;  5CV4 A;  3MA2 B;  5JEA G;  3GTL B;  2EYM A;  3HRZ C;  5E4X A;  2L9H A;  2XSC A;  1D1I A;  4WJW A;  3G7L A;  2K01 A;  1S5C D;  4KJN A;  4A3J B;  2G9D A;  1ML0 D;  3HZX A;  1UNS A;  3TP7 A;  1TU2 B;  1RF2 D;  3I4M B;  2L4N A;  1DZ1 A;  1II3 A;  5M3F B;  5KYL A;  2TMP A;  2WKC A;  5M5X B;  4C1N K;  2IX3 A;  1BR9 A;  1CT1 D;  2K1B A;  2HDL A;  4K6L A;  2XVS A;  1TT2 A;  3ND9 A;  1C8C A;  1I4H A;  1SXT A;  2E76 C;  2OXP A;  2PZU A;  1U4M A;  3AU7 A;  5IGD A;  5LL6 X;  2N55 A;  1SBB B;  5JAV A;  5J1Z A;  1SJE D;  1E0B A;  3QIA A;  5C4X B;  1TWG B;  3LNN A;  1GUW A;  3PV0 A;  4K8J A;  3RMH A;  4CKE A;  4Z9C B;  1TVX A;  1JWU D;  4KHZ A;  1W6J A;  4KY5 A;  4FNF A;  3P1H A;  1LTT D;  3CQZ B;  4KN7 C;  5ELC A;  3FRP B;  3LWE A;  2B2Y A;  4I7Z C;  4J1M A;  1SMY C;  1B4O A;  3H09 A;  1YNN C;  1LO5 D;  4G7H C;  3S14 B;  1Q1E A;  3T56 B;  5AFW A;  4L63 B;  4KY6 A;  4CKB A;  1ESR A;  1DOK A;  5FLX L;  2L0C A;  2B2U A;  2NN6 H;  3VA7 A;  1OXS C;  3RZD B;  1BXT A;  1TWC B;  1DD2 A;  4DFA A;  1SND A;  4RGM A;  2E74 C;  1EY5 A;  2ID0 A;  2OF1 A;  4ZUJ A;  2KED A;  1EOT A;  3HKZ B;  1WTO A;  1D5X C;  1SNQ A;  3HOX B;  3MFY A;  4KKU A;  3FVQ A;  4XT1 B;  3A8K E;  4LMQ D;  3I73 A;  2R93 B;  2SNM A;  4K2L A;  4S3S A;  2R7Z B;  4HTH A;  4WRD A;  2YYZ A;  2A69 D;  3BYT B;  4H13 C;  4I65 A;  3L3O C;  5J39 A;  3T4A C;  3N6R A;  3J81 E;  5HGT A;  5JJZ A;  1TS3 A;  3IFD A;  3OWE B;  3C1E A;  1HTL D;  5C0X H;  3I91 A;  3A7A B;  4NDX A;  1SNM A;  2FIN B;  3MAQ A;  5K36 H;  4OO1 G;  3K0Y A;  2F0S A;  3NTK A;  3DXJ C;  3X3N A;  4F8M A;  3VR4 A;  3S1Q B;  2WKD A;  1XWE A;  1OXV A;  2KJX A;  2N88 A;  3MXG A;  2KCC A;  3IFT A;  5DAU A;  3BVZ A;  5CV5 A;  4K2K A;  4R8N A;  1EFI D;  2IL8 A;  3J80 E;  3PUV A;  2NTS A;  3D6C A;  1OXX K;  5I2Y A;  2Z4H A;  1NR4 A;  2NYZ D;  2L12 A;  2ZT9 C;  1EU4 A;  1HFN A;  2JA7 B;  3PIO 3;  4OHJ A;  3OMG A;  2NB0 A;  2JSO A;  4IUT A;  4LJZ C;  5IGB A;  1LT4 D;  2F0G A;  2JEB I;  4DXF A;  1PXU A;  5CR3 A;  2A6E D;  1H9K A;  1RTN A;  3GTQ B;  5E4W C;  1WTV A;  1ONL A;  3PO3 B;  4NW2 A;  4O42 A;  2BCO A;  1EY0 A;  1JOQ A;  1PFB A;  2K32 A;  4A3F B;  5DNF A;  2RSN A;  2WP8 J;  3HOY B;  1JIC A;  2E2H B;  1ILP A;  2KQ3 A;  1MI2 A;  2A6H C;  3KBX A;  1O78 A;  2A69 C;  4EVO A;  1V1O A;  1LTB D;  1CM9 A;  4XYO A;  5IGC A;  1S5F D;  5A2Q E;  4IFD J;  2Y0S B;  4FYD A;  4PQX A;  1QE6 A;  1Y1V B;  4KHV A;  4LAA A;  4C3J B;  3N52 A;  1MSH A;  1CHQ D;  2F0Q A;  4E6I A;  1CQV A;  1LTA D;  2C9O A;  4RAU C;  5CYU A;  2V4D A;  3VYR A;  2IJ0 A;  1TKW B;  1BNZ A;  1STA A;  3D6W A;  2R6G A;  3NSW A;  4L8J A;  3F2U A;  4DNR B;  3I4L A;  3DWP A;  1WTX A;  1KTK A;  4KD4 A;  2BE5 D;  4KJO A;  3MWY W;  1MD2 D;  4RHS A;  3DWQ A;  1TR5 A;  2KEC A;  2TSS A;  3HS0 C;  3K58 A;  1KDA A;  1GXD C;  1ENF A;  4BS9 A;  1EYC A;  1ZEQ X;  3QB3 A;  4HCE A;  3T13 A;  2HCC A;  3SDZ A;  5I2X A;  2F0O A;  1SYE A;  5C5M A;  1IHZ A;  2B2V A;  3NP8 A;  1SNC A;  3KUP A;  3KK7 A;  4IUQ A;  3M3Y B;  1Y69 U;  2EOT A;  2J7Z A;  4U68 A;  3M4Y A;  4K5V A;  1EY8 A;  1HHV A;  5E1F A;  1Q1B A;  5EKI A;  1XX8 A;  1NAP A;  5FOB B;  1PTO D;  1MBY A;  2Q8T A;  1STN A;  3HG9 A;  2RVL A;  4ULL A;  1PZJ D;  5ELE A;  2DNC A;  2Q8R E;  5C3E B;  1F2L A;  5COR A;  1ENA A;  1SE4 A;  3J81 L;  4FO2 A;  2L1B A;  1KNE A;  1G29 1;  3Q6S A;  1CZW A;  2AUK A;  5EPJ A;  2EY6 A;  4FVM A;  2M00 A;  2D62 A;  4XT3 B;  3DMU A;  1A6X A;  1F2M A;  1JWM D;  3MFG A;  3I8Z A;  3OOC A;  1ZYR D;  1HQM C;  1O7L A;  5BN5 A;  5G3L F;  1TWH B;  3K59 A;  1SFO B;  4FP5 D;  1S5B D;  3I72 A;  3J80 L;  2JA8 B;  2CHB D;  3I3C A;  2IWH A;  3NBI A;  3A8J E;  4K5X A;  2EYO A;  2B2Y C;  1C4Q A;  1O7Y A;  3V05 A;  3K5L A;  4RH6 A;  2SEB D;  4NP5 A;  4G7Z C;  5DEH A;  4ZLT F;  5CBA E;  4HSP A;  4C3I B;  2B2U C;  2JEA I;  2F3V A;  3TME A;  2AWO A;  3BS1 A;  5FO8 B;  2K5W A;  5T1I A;  1ZKO A;  1PTO C;  2MPM A;  2MGS A;  4B9W A;  3K6O A;  1JC7 A;  1EY7 A;  3L7Z C;  2B2T A;  3D4R A;  1RJT A;  1IW7 C;  5FLX E;  4XQJ A;  2LMC B;  2EY1 A;  1OO9 B;  4FF2 A;  1CQF A;  3MEH A;  4TKO B;  5A2Q L;  1ESF A;  5KNC A;  4DU9 A;  1VMP A;  1J9O A;  1FNU A;  2CW0 C;  4KKS A;  5A35 A;  4V0B A;  4X3U A;  4HSV A;  2RSO A;  1H9S B;  4HR7 B;  4ID6 A;  3J7A V;  4R8I A;  3S1R B;  4OIK A;  5C4J B;  1G2T A;  5I6W A;  2HUG A;  4EQO A;  3SK6 A;  1C48 A;  1G8Z D;  2E2J B;  1LT6 D;  5M9O A;  4IFD G;  1L0X B;  4RKB A;  2XRQ D;  4HED A;  1BO0 A;  2AUJ D;  4DK1 A;  5C6A A;  3RUZ A;  3FDT A;  2EPB A;  2EE1 A;  2LFN A;  5K5P A;  4OGQ C;  4R9W A;  4TSS A;  3NBH A;  1EQT A;  1F2Y A;  1FNV A;  1S4Z A;  1B53 A;  3NK9 A;  5E3F A;  3GTP B;  1F2Z A;  3E5S A;  3UI2 A;  3TP5 A;  3MTS A;  3J7Y W;  1I6V C;  3QO2 A;  2PNR C;  1SMY D;  4C2M B;  1D2B A;  1YNN D;  4IUR A;  4ZRZ A;  1NUC A;  3NWS A;  3ERO A;  5M5W B;  1B50 A;  3OSO A;  4K14 A;  4RCN A;  1QNK A;  3P75 A;  2LY7 A;  1SYF A;  3PUZ A;  1DJR D;  1UAP A;  3AB9 A;  4BWG B;  2EXZ A;  4LK1 C;  3DEO A;  2WB1 B;  2EJF C;  2F0V A;  4XQQ A;  5ELB A;  3HOV B;  1JE4 A;  4XQN A;  5BN3 A;  2GA4 B;  1GHJ A;  1EIH A;  4MIU A;  1HPC A;  1Y8P B;  2WIN B;  3PUX A;  4A3K B;  2PPB C;  2JYO A;  1LAC A;  4EGV A;  2KUM A;  1L0Y B;  2MHV A;  3C3L A;  2EJG C;  1PMR A;  4QIW B;  2VXW A;  2EY2 A;  1TWA B;  5C0X J;  2WAC A;  4J8Q A;  2JA6 B;  4C3H G;  1RKN A;  3DUZ A;  5EBD A;  3NUC A;  2ZXR A;  3M7N A;  3H94 A;  4XTC S;  1K83 B;  3C2P A;  3KLS A;  3OMC A;  5NUC A;  2PW5 A;  3GV3 A;  1AZP A;  1KDC A;  1AEX A;  1A15 A;  3P7J A;  1WTR A;  1TY2 A;  3VR6 A;  3KBG A;  2QF7 A;  3M7G A;  1HXY D;  3GO5 A;  1PZI D;  3EA6 A;  2NUC A;  1PTO B;  4RKL A;  2K28 A;  3TDQ A;  3P20 A;  1JB3 A;  4IN3 A;  4MN3 A;  3PUY A;  1PTO H;  5DM7 3;  4Y7N B;  4FXD A;  3KLR A;  2B8G A;  4WFN 3;  3FMC A;  1I3Q B;  1TS2 A;  2JXM B;  1BCP F;  1BQQ T;  3GTO B;  2A6H D;  4BBR B;  3S9W A;  1D5M C;  3SK4 A;  1SYB A;  3GQB A;  4Q0F A;  4A3M B;  3SR1 A;  4PMB A;  4KN4 C;  2BDO A;  2B8F A;  3S16 B;  1H9J A;  5EKL A;  4IUN A;  1PDQ A;  2FFK B;  2KCN A;  1HA6 A;  1DM0 B;  2F0P A;  4BBS B;  1EIG A;  3CKI B;  2A74 C;  3ERQ A;  2B2W C;  1EY9 A;  3A55 A;  4NKL A;  4ABN A;  3NPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...