4J8QA

Crystal structure of a nigd-like protein (bf0700) from bacteroides fragilis nctc 9343 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
202
structure length
194
Chain Sequence
DGYSLGDIAVDWATVRVVGGDTYSLNADRWGTLWPAATAIPFYKPIDGQRVITYFNPLYDNYEGYDHAVKVEHNYNVLTKQVEDLTAENESEFGNDPVWVNKDMMWIGGGYLNVIFRQNLKHLVSLVRDMRATAAEGEDDGYIHLELRYKTYDDQANGAVSFNLNSLDLTGKKGIKVKLNSVKDGETEVVFNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BF0700) from Bacteroides fragilis NCTC 9343 at 2.50 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein
total genus 40
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j8qA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j8qA02
4PQXA 3K0YA 3NQIA 3K6OA 4J8QA 3QWNA
chains in the Genus database with same CATH superfamily
4UDTB 2OT2A 1WIPA 3LQAC 3PHOB 5ECJE 1KTJA 1R3HB 4LFHD 4LK4A 2YWYA 4JI1L 4PGBB 5FAAA 4RQQA 4CBVA 1ICFB 2IAMA 3C09B 3DV4B 1YEJH 4ZTPL 1Q9LA 3H7LA 4XPGH 3RNUA 3T1WA 5KSVA 1JWUA 3SKNB 1PSKH 1JR0D 1YZ6A 4UZSA 2G9HB 4PJGE 2N3SA 2J3SA 2QGDA 1W0VA 2B5IC 4IPGA 2EJMA 3O6KH 4UNVA 2NY0D 3RWHB 3MGOB 3TIEA 1P6WA 2AP2A 4C56C 3ZE0E 4YIJA 5IGDA 1DVSA 2QSVA 1NGPL 4BWWA 1J0IA 2OXHB 4UQDA 2IAAC 1TWHH 2D0PA 5FJ8G 3C09C 4NM8L 3UTTA 3SDZA 3CAMA 3ALPA 2FNBA 2N55A 1H9DA 2VMEA 1BBJA 1FCCA 2VM4A 4IQHA 4MTNA 4HV8A 4LL9A 3K6SA 3G6AB 7PAZA 2LXJA 5D55A 1W8NA 2LSSA 2F2HA 4J8RA 3MHBA 3GINA 4LIQE 1EGJL 4HIPA 5IEKB 4NQUA 2LU7A 4WTQA 1J9SA 4N0CC 4JRXD 3DWPA 4XMVA 3VYUA 1GAFH 1BDOA 3HOXG 1X4YA 4KOCA 3LRKA 3UP6A 4R8WH 1QBLL 5AOMA 4FQXD 3TJHC 1IL2A 5C0GA 3KDFA 2J8UE 1RZ7L 4P23C 1KB3A 2X9XA 2CO2A 1SVBA 1MLBB 4G43A 2FX7H 3ENEA 1JICA 1QJOA 1IUZA 5INCB 3GPSA 3AEVA 4S1RH 4TVPE 2EDTA 1Y14B 4A3IB 4F7EB 1I82A 3WJJA 1Y18A 4URKA 5ILTH 2N3JA 2QILA 4JFFB 3RN5A 1RIUH 2O5NA 4JJ5A 3W5OA 1OANA 4U6VH 2EYSB 1UZGA 1MFDH 5K9JL 2RBMA 1J1PL 2B2UC 4UZGA 1WZ1H 2F74A 3BPOC 5D7IB 1NAMH 1XWVA 4O02A 3BYTA 1FJ1A 3M3YB 2F18A 1QRNE 2XN2A 3ZTJH 1WISA 1F2LA 3GMMA 1MH5A 5FEBA 5DTFB 4KHTL 2DJUA 3NTKA 1OTUC 2OMYB 1KSRA 3HC0B 4TKOB 3SCMA 3PL6C 4U31A 2DH2A 4X3KA 5MEPB 1G9MH 1N36L 4K2KA 1URZA 5ITFB 2IWGA 3FB5B 4ABUA 4JKNA 1YY8B 1OE1A 2YEVB 3AAZB 3DX9B 5E99H 2D9UA 5IOPA 5GXBB 2C3VB 4W9JC 4KI5E 3TO4B 1MBYA 3H3KA 3DK2A 2J5WA 2DWDA 2AWNA 4RAVA 3MRKB 5I8EA 4MZ2A 4Z95L 1AGFB 5IB2A 4GXVL 4N2AA 1JK9B 2GI0A 4CVUA 2VZTA 3MLYH 4DK1A 4HGMA 1ZDQA 1WG3A 5ELEA 1FAIH 2Q3AA 2G3NA 3MPCA 3NCJL 2XBDA 3A6BL 4K14A 4OVVA 4B9JA 1P7QD 1EEUA 3L3HA 3IJ9A 3QVAA 3WE6B 4E9YA 3VFWB 5B39B 3SBQA 2ZKYA 1E0BA 2Y24A 4JY6A 2ZSWA 1MJEA 4TUOA 5DURD 4DAGL 1CGSL 1LTRD 4M6AA 3GMPA 2C7UA 2XWXA 5DRZB 3U6RA 1X32A 3QR1A 1A6ZA 2YHGA 2VN6A 4I3GA 1HL5A 3BAXA 4C4UA 3PIQA 5HHXL 3LIUA 3WL9A 2K28A 2FHCA 2L15A 4NAQA 1GJUA 3G6JE 4DVBA 2JK8A 1LEGA 2JJVA 3NFSL 2ISDA 4ZMVA 3DX8B 1FFTB 3H3PH 3LKPB 4EKXA 5ICZA 4RKLA 3FPXA 3MZ5A 1UENA 3QB3A 1FFOA 3MRRA 3BP5A 5C0ND 3GEWB 3MGTA 2DM7A 1CTMA 3F65A 3Q1SH 2KHJA 4FG6C 4GMTH 4P5SA 4YX2L 5ADOH 1PG7W 1YO4A 4TUJB 1PX3A 1F2XK 1EZLA 1V1QA 1ZPLA 4ORZC 1VFAB 25C8H 3ARTA 4GO8A 2D7PA 3EZJB 2KZBA 3EGDA 3T9WA 1WGOA 1O78A 5F3FA 5F97E 1AZRA 2X6AA 4G71B 3MNWB 1I4XA 2A6HC 4Y1AD 2V2TB 1A9BA 1SDDB 2WWNA 4MDRA 3O4LE 1YBYA 2UXBL 4XXEA 5C0RH 2ZKMX 1A14H 1IBFA 3DA0A 3JAML 3GYRA 4UAOB 4JY5L 1RIVH 3FK3A 1S7WA 4F9LC 4G8EB 1Y0LB 3CLEH 1TZGL 2C34A 2ZAGA 3RU8H 1AIZA 1NSNS 1HZKA 1M2OA 1K85A 2EYOA 4DV5L 1QBMH 1OE2A 1HS6A 2R29A 3VE0A 5EB9A 1JFQL 4PWJA 1TZHB 2OMTB 3F6IA 3K72B 4R97B 4JDZA 1UT9A 2R2CA 2YPKB 3CFNA 1AANA 1MI5E 4O2FA 4BV1A 3KLRA 3LEVH 2EH8L 4FI8A 4ALAH 5L7XL 5FYKD 4GRLD 4MS8D 2CRYA 4UV4H 1AE3A 2OTLA 1NCOA 3DBXA 3G6AA 5E24E 3NWSA 3E1F1 4LPTA 1GXEA 2HVJB 3LIZH 1GSKA 2QLVB 3D2UA 5IBTL 1RVFH 1SBSL 2TRHA 3FSWA 1RFDL 5TDPB 2OXGB 3MCKB 2VDNB 4GLRI 4I3RH 4ZMNA 2VDPH 3L3OC 1AZPA 4FQLH 1J8SA 1EJOL 1U8IB 5T3XH 5AW4B 1NMAH 1C48A 1YMMD 3QO1A 3QZWG 2M9VA 4FNUA 2EYHA 2HP4A 2CH4A 2UXDL 2N7BA 3FULA 1YEHL 2NX5A 1QKZH 1Y6MR 1MPAH 5AW0B 4JI6Q 3T0BA 5FDWA 4DV0L 3DEOA 2NX5D 1MIEL 1JPEA 3LEVL 2VDQL 4X0NA 4LAQH 3KGRA 4MJJA 3H3PL 2DS4A 3MUJA 2H9GA 3ZBMA 2Z8SA 4XBGA 3I4MG 2M26A 3K46A 2OYMA 3NIGE 4GS7C 3RIKA 1SJVA 3L5XL 1BLNB 4S10A 3MREA 3WN6A 2NN6I 4OM0L 5KZCB 1RPUA 4OI9A 1KRTA 5J3BA 1KNAA 3O3EB 1KABA 5DHVA 4IZ8A 5L4IA 3RFZB 1E27A 3X11A 1C9SA 1QZGA 1OALA 2GG1A 2VR7A 4MZRA 3DURB 4I9WD 5KVEH 4CBPA 3BE1H 3MRMB 4HUUB 3OF6D 1IKFL 1AKPA 4GN4B 4KN4C 2P80D 3H0TB 5LN4A 3P4NB 5A7BA 1P2CA 2MIZA 1WICA 2R2EA 2J4XA 4DR7L 3GP7A 4A3DG 3EKCA 4X42A 5D1ZC 1A9EA 4JRXB 3NK9A 3F12B 1VF7A 4PG9B 3L1GA 3N42F 1Q7YC 5I8EB 2F8XC 1OAZL 1AH1A 1O5PA 2YKKA 1Q9OA 3P77A 4B9KC 3HAEH 1GZQA 1YNNC 3CFMA 2WLHA 2YO3A 4N5UA 4EZLA 3O6LL 1NFIA 3AU1B 3DO4A 4OZHA 4DPAX 4I3SL 5KAQF 3ARDB 5D9SB 2VXTH 2AK4D 1JHKH 2Z65C 4E6IA 2VRQA 4QIWE 1HH2P 1MJJA 5D1ZB 5FOBA 5GRWA 4DPBX 5I6PA 3NDZE 2JI1A 3OC8A 1G291 2VXSL 2PLTA 4G8IB 2DF3A 2DOCA 3ZR6A 3DHQA 4EEEA 1OAQL 4U1NA 3ASWA 5I1IL 2NZ1A 3QJQB 1RFDH 4FDBA 3COOA 2CVRA 3CDYA 3SYQA 3H9HB 2G9HD 1JMZA 4JFDD 5F1NB 4NXSA 5B38B 2P9RA 1U8MA 2P5EB 4DNRB 3AXLB 3I2CL 4JW3A 4P48A 5IGGA 1C5BL 2XXFA 4MAYA 1CURA 3DX1A 5CWSB 4KKSA 3ARFD 3IE9A 4IUQA 2NVXB 4ZZKA 4X8JA 1N67A 4IBWA 4AOFA 3CFCH 1SOSA 5D5MB 5GS0H 1AQDB 2C7FA 4QAMB 1OW0C 5HVGB 3EFFA 4XBEH 2WWMD 4G8AC 3PV6A 1I9RH 4GO6B 4PG3A 2WKLA 2ZNWA 3L5XH 4MCZB 2BY1A 2B1AL 2XCMC 3UG4A 1TO4A 5DHYB 4HUWB 3G5VA 1KTLA 1PG7H 5BNXD 2KVMA 4TUJA 1CE1H 1HQRA 4I18C 1X65A 3BH8A 4M62L 3RVTD 1F8TH 4EKJA 1IFHL 2ZM6L 2QPUA 2AI0L 4WI5A 1Z5YD 1ONQB 5I73C 2QQKL 3I75B 2QHLA 4S0SD 5HI3C 2OYLA 2X1XR 1A64A 2ZZUT 1FPTH 4Z7OE 4A3KG 1ZJAA 5LB1A 4XGZA 5L88H 3KEDA 4XCYA 4JYAL 3TA3D 4XMWA 1QG3A 4HAGA 3LPFA 5HXMA 1OXXK 2YAMA 1RK1A 1T7WA 2YQGA 2JA5G 2QDWA 2SODB 4TQIA 1E24A 4DR1Q 4A3KB 5JTWA 4MD4B 5FYJU 1DQKA 4HJ1A 5ICUA 2AQNA 2XNAC 1TJHH 1BW8A 5FS5A 3ZHKA 1UKSA 3FKUS 2CJUL 3OR6A 5BRZA 4HUVB 1G9NC 3FT2B 1RHFA 3LVEA 5GS1B 4JDZB 1MNNA 1MG3C 1V10A 3F7PC 3QR0A 1NGYA 1MHCB 5KVDE 2F0FA 3V7MA 1YY9C 2WLMA 1HZBA 3EHBD 5GQOA 5BVPL 3TDQA 2YJLA 4AQ1A 1I4FA 3V4VA 5F7DA 4YLBA 4WF7A 1BZ7B 2OF1A 2DYPB 1II3A 2K8MA 1R3LB 4ZKCB 4PJBA 3HG9A 1WAPA 4OL7A 4U1KB 2V4DA 4XC3H 3WJLA 1AZQA 1GD7A 2YXVA 3SVMA 3QNZA 1MY7A 3P20A 4DAYA 1TJIH 1PTOC 1DQML 2BZDA 4NKDA 5K1VA 2J1XA 4JAMA 4P4KA 4AYGA 3B4NA 2ZIDA 5AVVB 4WWOA 3IAGC 1S7VB 5C09B 2HRHA 1SNDA 3WFEH 3FB8A 3PP3K 4H5SA 4KROB 4ZPVB 2A9BA 3N3EA 3IDMA 5DEHA 3MRPB 4XN1A 2D9QB 3G6EA 1E4HA 2J8UB 2Z6KC 1J86A 2APSA 5B1JC 3U7YH 2CHNA 4OCSL 2EEFA 4N8CL 3RJOA 2CDFB 5JYMA 3BDYL 2Z4HA 1VEPA 3ETBF 1CM9A 2Z4QA 4ZNEE 2ZNXA 1A7QL 3DNKA 1TQBB 4HF5L 1H9MA 4JPVL 4Y9CA 2Q8TA 3QISA 2EIDA 1FNAA 5FYLL 5EU7C 4F1ZA 1B3IA 4A3JG 2BVUA 2P8MA 3NEEA 4LLMA 1DZ1A 3WFZA 1ETZB 3MRRB 3NBIA 1CLOL 2N0KA 3E80A 5M5WB 1OPOA 3HBPA 4HH8A 4ERSL 1CFNB 3HVDA 4A38A 3ARQA 4AENA 3V5KA 4LCIL 1STGA 3VFUA 5FO2A 1O9VA 1E2VA 1FO0L 1HE7A 3MA9H 4FJZA 5KSAB 1FORL 3MRMA 3UTQA 4N2LA 3EVQA 5J22A 1UKQA 4A2DA 4OZHF 2OYKA 3WUWA 1LUZA 4I0PC 3M17A 4HJGB 3S9DB 4FTVD 4NC1E 2R4RL 2Q2LA 2AJSL 3ZE2F 5AB2A 2PKDA 1TS5A 3MC0A 1D5XC 3RI5F 3UJJL 1XZ0A 3MV7B 4X9FA 5BUPA 2VLRA 2VR3A 3QFJA 4J4PD 2W80C 2Z64C 3GMQA 1JWMA 3LKRB 4HDIB 4R4CA 2H1XA 1OSPL 1Q1PA 2F7OA 1X5GA 2BP0B 1R3KA 5IWAL 3SY0B 1GKOA 3QIBC 1PYSB 4L4VA 3UX9B 1SQ2N 4JFZL 5BZDA 5I8OL 2P44B 3Q24A 3QEUB 4YGAB 2VAAA 1BIIB 1UM5H 2NNXA 3J7AV 1QNZH 1KXQE 1N33Q 3G5XB 3QHFH 2K5HA 4OJDH 4U1NB 2F53D 5DRXA 3UCQA 1OZUA 3W38A 4B27A 1LK3L 5JDJA 4D0DA 4G9DA 1ADQL 2UXGA 1VCBC 2VUMH 3S2DH 2OSYA 4XWOC 3SQBA 3ULUF 4LQFL 4KJYA 3UZQB 2V37A 4TVSa 1LDPL 2JJWA 2YFNA 4KXCA 3MBXH 2A6HD 3QJVB 3UYRL 5IT2L 4GQZA 3Q05A 2BJMH 4HSPA 2D7QA 4HSAC 4IDJL 4YHNB 3JTSA 4KTYA 4DUYQ 2DAVA 3BJUA 3ABGA 5SWSE 2GTWB 1DUYB 3GNMH 4M56A 5FWQA 4NQXB 3OW2A 4DZBB 5J11C 5I1EH 2OX5B 2X7LB 4PJXE 5T5FA 4DV6L 9CGTA 5FFLA 4S0HA 1F4YL 1WZ1L 4LF4Q 3E6HA 2R1XA 5IIEA 2NMSA 2GJZB 3PIPA 4NJAH 5PAZA 3VWJD 2KHSA 4LFHG 5JW4Q 1I31A 5HPMA 4OZ4A 4TLUA 4APXA 2IQ9L 1MJ7L 3FTSA 3DLLA 1MHEB 1IEBB 2TAAA 4ZMQA 4FQXB 3ZJAA 5DRNB 4JGMA 3VR2A 2BNQD 3D30A 4YDZA 3SE3C 4CMHB 4OZIA 2A6IA 3S7GA 3WGUB 4UHVA 1E5YA 4X62Q 3DEPA 2EADA 3PWUA 1B4LA 1M05A 4H1LA 4FTVA 4QXUH 3L1FA 4UYQA 3TNMB 2VDRH 4LLVA 2IGTA 4GKOA 4NQEE 4XMKL 4UQEA 3RNQB 3U46A 1A5FH 4LXFA 5HHNA 4EQ5A 4JUTA 3UI2A 2H47C 4MA8L 2Q8BH 3RFRA 4BD4A 1JV2A 4HT1H 2AKWB 5LBSH 1SJEB 4IBSA 2VLKA 4G6FB 5IBLC 1FFNB 3LS4L 3O8XB 2H32H 4HCRA 5CEZL 1BQHG 1V3LA 1G43A 2X2IA 1E3PA 4JI2L 2HXAA 3BEVA 1OSPH 4IYKA 1AYOA 4XZ4A 4PP1D 5FV1L 3PWNA 5K36H 4JRYD 5A3IC 3FFOA 2FINB 2QV2A 1CF1A 1YNLH 3OR6B 2BIPA 4CJ0A 4MRBA 1QO3B 4ODUB 2XSCA 1BMZA 4YHKH 4C47A 5BV7H 4L8SB 3H9SD 2FTAA 4D9RE 2V17H 5FW8A 1HZLA 5LHY1 3POHA 1I8UA 2NNCA 1A3RH 1KG0A 1D2BA 5GGTL 4TKWA 2X89A 4QTIH 3QT2A 1DVYA 3W5MA 1D5ZC 2HT4C 3QORD 1F4WL 4PJBB 5C0GB 4X80H 1IVTA 5IVXA 3BCDA 3TH2T 3T6QC 3MRHB 1PRTC 1H3GA 4A7GA 1XF3A 2DLHA 2BXYA 2CRMA 5TD4A 4KVCL 4XMLL 5DQDL 4GIOA 5AZUA 2IV8A 1YEJL 4ZTPH 1EFXB 1NEZA 4OKDA 5FF6A 1OTUD 3B34A 4KKCD 5HSFA 4A3MB 2B59B 4DERA 4CKVX 4XNXH 4Z3JA 3KJPA 4YHOH 2FWOB 1JWSD 4LFBL 5GZOA 2DD8L 4HKXB 2WTRA 2WIIA 2J8UA 3WN5B 3PQYE 4PCYA 4QRQA 4H8UA 1H9KA 1FCGA 3MV9A 4FCAA 5BZWB 3QOJA 4DR5L 4Q0FA 3I8ZA 2NCMA 2IBZY 2ATPA 5HYSB 5JQHC 3BDOA 4BGDA 1KDIA 2LE9A 3KPQB 4ZO9A 1MW2A 3CBRA 3FONA 1URLA 4UOZA 1BP3B 2J21A 1YYCA 2UZYB 1MKHA 1QFUL 2I69A 3O3DA 3U1QA 5IWLA 1DVZA 4B97A 4L37A 4XPHL 4JQIL 1STBA 3AWEA 4AL8H 2EE3A 4KY1H 2PWDA 1DFBH 3JUZA 2Y7MA 2YSSB 3L17A 1TJIL 1X7QA 3CIAA 5E6IA 5FYJL 3W9EA 5IVZB 5DLQE 5ADOL 2VN3A 4A3DH 4PRNA 4BQBA 2AJXH 2HVBA 5DJ2A 1MCFA 2ZAIA 1VQKA 3IRPX 2CO6A 2DYRB 4JJ5B 2WQWA 4PR5B 1Q94A 3WKMH 4KX8A 3IDNB 2CIKA 1EY9A 2SDFA 1X5IA 4ONOA 5JQIB 5LQBH 1K0RA 5DJZB 2BH0A 2CM6A 1Q9KA 2H1EA 3OJ2C 4MNQE 4N26A 3WJMA 4RAUB 4KNQA 2HH0L 4HFUH 4NCC2 5I6KA 5JW4R 2P5PA 1BEYH 3L3JB 4PJAA 2NPLX 1G84A 1W0WA 1UADC 2B1HH 1FJGQ 4Y16A 3ZL4L 2QSTA 2MCG1 3RWCA 1MRCL 3GTMH 1VHPA 3DMMC 5DZAA 3L7FB 5BQ7B 1OPGL 3U7WH 1CDYA 4KXBA 3CPFA 3AAZA 1MFCH 1FNHA 1P7QA 1PLGH 2KI6A 4ODSL 3SKMA 3ZE0F 4JJOA 3KZ8A 4L1DA 5BUAA 3D34A 4TSCH 1KJ3H 3BEWB 5CF3A 2VDMB 3BZFB 4NQSA 3JBG7 1C1EL 2C9QA 5TSSA 4PJ6A 4KXAA 2CKBL 2WYZA 3KJ4C 4P49A 3W1ZA 5CN3A 3EFDL 2MJ8A 4G1MA 4G9DB 3NA9H 1A65A 1PY0A 1YAZA 5IM7A 4FXKC 4FNQA 4LB8A 4KVNH 4HH9A 3NPPA 4OSUL 3QJFA 5C86A 1AC0A 1BJMA 3ISRA 3WFBH 4ZFQA 4UT9H 4R0LA 1D7FA 1FNFA 1NINA 1K3IA 4HD9A 3BW9B 3CWGA 2P47B 4F7PA 1KGCE 1I3QH 4H8WH 1LJMA 5D4IA 4PJFE 5DK2B 5DZPA 5LAPA 4DOHB 1A6UH 2Y2WA 4L2YA 1KXTA 4I5BA 2YD5A 4H7BA 1RUKL 3K74B 3PJLA 5INDA 3QUYD 2ADGA 3DO3A 2YD6A 3FMGH 1VQAA 3MXVH 4TQEH 4Q9BA 4OAWB 2QL1A 2K04A 5JA9A 3BFQG 1HIMH 3FUFA 1XGPB 1IEBA 3ME0A 2YMTA 2Y5TB 3ARFC 3BKCL 3VXPB 4GLRH 3BVDB 3X2QB 2R2BA 5IFAH 4XXWC 4KY1L 1EANA 3NMEA 4FA6A 4YAQA 2OL3L 2VMCA 3LCYA 5ETUB 3QWRD 3ZTEA 2WB1B 2XFXB 1I7TA 1XPOA 1QRNB 5EO9B 4XNQA 5LNEA 4NQCA 3NK4A 4JGJA 1XGYH 32C2B 1ZVSA 3U25A 4G8GE 3TV3H 1X56A 4YWGL 4K7PX 3M1CA 3UROR 2XPZA 1JV2B 1CFTB 2VJXA 4L9DA 3FEWX 5I75B 3V95A 4AGQA 3DK0A 3G9VA 3TEHB 2WCPA 1CI5A 5IYBG 1SN8A 4EF3A 1P9MC 4K8RL 3IE4A 1JD7A 1JYWA 3PUXA 1RPKA 2YLHA 3SDAB 2JF1A 3GIVB 5B3JF 4DK6A 3DETD 3RTLA 1HJPA 2M83A 3NJKA 2WVUA 4BSJA 3ES6A 4O02H 1DO5A 4NO2B 1BOSA 4HPYL 2ZKHH 2P7TA 5IESL 2JKXA 1JXKA 1M71A 4LW1A 5JVH3 1YYMH 1JZIA 1U8IA 2IPUG 2ADFL 3OAYH 4DFAA 1J8IA 1G7JB 1IC4L 3D39B 2MFIA 5ELCA 4PJXB 4KY5A 2FO4A 4FXGC 2HFEB 1A5FL 2V3FA 3WDIA 2B8OT 5GJSL 3TS2A 2BHFA 5IYDG 1RDPD 2A4CA 1WFUA 1L5GA 3VNYA 2MFNA 3ZQWA 1UZ6E 2UWEF 2XI9A 2J8UF 2WLJA 5KWYC 5DU7A 2HFGH 5T8IA 3LRSB 2ZJSH 3DBXB 4G59C 3OYYA 5IFHL 2A1WL 4F1SA 1YVCA 4Q2ZA 3T3PF 3FT0A 3IAQA 3QUMH 2YYZA 3Q2VA 4KK9D 3HAEB 4FXGB 5E0QA 1NUNB 3I4MB 2EO9A 4CSPA 1RUKH 5BZWA 4KK8D 1IBHA 3TBVA 2ATKA 4DF7A 4IKIA 1I3VA 3B2DC 4HPYH 4GG6A 5IROA 3QQ9D 4QXWA 3B7TA 1E27B 3X11B 4XWOD 1PFMA 2J44A 2FLRT 2XY2A 3WO3B 2NX5E 5KAQG 1HUMA 3OKMB 3QZMA 3NPZB 2MO1A 2VZ3A 1FA4A 1UD3A 4PRAB 4G6AD 1KC5L 4BCYA 3OGCA 4FQPA 4XP9L 1CYGA 4GH7B 1VFMA 4V2BA 5BRPA 3BGAA 3GRWH 4JW0A 1JZ7A 4UBDC 3FQNA 1N3NA 4I0KA 4AQAB 2IPTH 4O9HH 3TCTA 3TH3T 3ARGC 1A9EB 1HXKA 2EYTA 4JM0A 3L7ZC 2EYJA 1CA5A 1SYVB 2WO3B 3U2SB 1QNZL 4NQDB 2YMOA 4Q7DA 2PZUA 3AS0A 4PG9A 1OP4A 2XWTA 2BFGA 3DUSB 1A4AA 1ML0A 1TZ8A 1KB5B 3JV6B 4APQB 5E4EB 4EIUA 2NQCA 1VQDA 5EBLA 4JG0H 2PI2E 1YHBA 3D4CA 2PW1B 43C9A 1IZKA 1INDH 3ND9A 2ZOWA 3PIOA 3V0DA 1OB1A 1MQKL 1Z9NA 4OZHE 1Z66A 3HPLB 2PYEB 3CQFA 1MREL 3H2WA 3HOXB 4WORA 5C08A 4F37K 3CHQA 3HC4H 4IFDH 4GS3A 5HHPA 3HMXH 2K4KA 3PCOB 4HETA 5T3ZH 3SO5A 3VVWA 4E5XA 4JI5L 3WBDA 4L4TB 2HDLA 4LSPH 3S37L 4AE0A 3VYSA 2P5WA 4XODA 5LMUQ 5HGAB 1TVXA 2FL5B 4KDTC 4LLQA 1O7IA 1CN4A 5ICYA 1R3IL 1XVSA 2AMGA 2WUBH 4TLTA 4Z3HA 5IMLA 2EE1A 4I7ZC 4FL4B 2OMZB 3VRIA 4MA1C 3VXSB 1IYJB 1TWCH 3BZFA 4NQSB 3CZFB 4MB1A 1KPRB 1UWEH 2OMXA 1P5VA 3NIDE 2L4NA 5KVFL 3JAMi 3PO3H 1AZUA 1S5HA 1ETB1 1BXXA 4Y16C 3D4RA 4RFBA 5IE8A 1CD9B 5HI3D 1J7VR 5ISRA 3GTQH 2ARJB 1OQXA 2ROYA 2E7MA 4DP1X 1TR5A 1TQUA 4G6MH 1YJDH 1L9NA 3O3BA 1HC1A 1NWOA 3GTPH 4KKLD 2EDKA 4X6FB 3UYPB 2XZAL 1XH1A 2EDYA 1KLUD 5A40E 1C9OA 1W72B 1BFVL 2FX9L 4FG6D 3W37A 3HG1E 4PJ9A 2NY7L 4LSTL 3ZQXA 1HU8A 5K5YA 2ZG2A 4I3SH 1B2WL 5T3ZL 3OV6A 5JEAG 3S5LA 2PMZE 3CSGA 4W9GC 5AZ2H 4PRIB 2XACC 3H4FA 3QORB 1ULVA 1OQOA 4E36A 1U4MA 2EDXA 2FH6A 1D5IH 4MXVE 1W72H 2DN8A 1OF2A 5AENA 2YR3A 1V3JA 1HYSD 2E6PA 3CZEA 2A9MH 2GBVA 3V7AE 2XJKA 3FOLB 1M3IA 3ZR5A 3HP3A 3F3HA 3QG7L 5EUKA 5GZNA 3B3BA 3VA7A 2VLJA 3KYOB 2LU4A 3QGVA 4Z5RB 5IOKA 5IB4A 2HJKA 1WCMH 5L2KB 2N01B 3QQXA 5F7LB 1S9XB 3BSZA 3L2MA 4KXZI 1QLEL 2DQHL 4ZMAT 5B39G 1G7HB 5DC2A 5C0AD 3TEXA 3APDA 3O8XD 1TKWB 3RZOB 4M7KL 1J5OL 3DV4A 4EXKA 3QB7C 2E86A 5AVYB 4GNXA 2VDNH 1HHHA 1IV8A 2OCFD 1PCXA 2X0VA 1BZ7A 4MJ5B 4Y4HC 3A21A 5MI0B 4XH2B 4MD5A 5AKVA 2AITA 2IFFH 4F2ME 3QUYB 1Z9FA 3T1YQ 1EQVA 3TN2A 1ASYA 1B9ZA 4P2QD 5T1DH 2AJZA 3AREC 2EACA 2WXJA 4KBPA 4QF1B 3IKCB 4NUPA 5EHFA 1WTGT 4UANA 1NLBH 1G5GA 3NSWA 1YA5A 3WLWC 3FN9A 2O6EA 3LIZL 2WSKA 3KXFE 4MA3A 4PY8J 3GSVB 1NC2A 4IRZH 4KMTH 4X5XA 5JW4M 1X6NA 5I0DA 4GAJH 3FQ1A 4IHOA 3OZ9H 4MDIA 3ULVL 4M4PA 3PUZA 3ZHFA 2X69A 5D65A 5CMDA 1Z3RA 3II1A 4IGBD 1TTUA 1ZGLM 4HWEL 4N8UA 5IV2B 2OCJA 3GS7A 3TYFA 4NO0B 3IDGB 2FIKA 3S35X 5G5DA 3EDFA 5EPJA 2NUTB 2IBBA 1MPAL 2B08A 5CD5D 4XTRD 3VAEA 3I74A 3AM8A 3QXAB 2NRDA 2F53B 1L0YB 1LWRA 1B50A 1NZRA 2IVFC 3B7YA 3OWEB 3GTKB 4NBXB 3QNYA 5C97A 2O6DA 2Y7QB 1IC4H 2L1BA 4LDLB 2EDOA 2ICEC 2FD6H 1PFOA 2IGFL 4Y1AB 3BRGC 3H2QA 3QDJD 1A4JB 1F8TL 4FMKA 1WI5A 1BM7A 4BY7H 2GABA 1EDQA 2OYPA 1WTWA 1DQMH 1FLRL 5HI5C 4LLAA 4GAYA 4AH6A 4A3BG 3P30L 3NAAL 3P9MA 2BWQA 4OIIH 3KBGA 1KBVA 3RQ3A 2D03L 1WFMA 2JH2A 3IMUA 3U79A 4DV5Q 2XVSA 3ZPDA 1HN1A 4AG4L 1MFAL 3L5WB 4R5TA 3GSWA 3RVWC 1JXDA 2R7EB 1UYWH 2HPOA 3Q0HA 3SKOA 2I7OA 1UACH 2D3JA 3C2AL 1A22B 3H42H 3I2CH 3NGBB 3OKNB 2XG5A 4FYTA 4NQQA 4P23A 5D7JA 3L4WA 4XOEA 4JN1L 4JY5H 4GFTB 5TFSL 1FNVA 1MCWW 5DJ6A 3LWUA 1OCWL 3BVZA 1U2HA 1GUOA 1BD2E 4KHTH 4RA3A 3REWB 4HS3A 4LPWA 3MC0B 2Q10A 4ZD3H 1PRTD 4FQ1L 2E27L 1MW3A 1LTAD 3K4DA 2A69C 3L6FB 4K0OA 5CJBA 4X50A 2A4EA 1OW0A 4TF4A 3ZDYE 5L6YL 3R18A 4DJMA 4H8QA 1B88A 1EHNA 4RMBA 4JCVE 3QIBB 1T21A 3HMWL 4S2SB 3RZCC 5I9PA 2FWUA 4NOBA 4PV1C 1E8XA 4JO8A 1GHFL 2DL9A 1Y1DA 3S36L 3TWCL 3GS0A 2F0IA 2PNDA 3DX2A 4MDJA 3LHAA 2ESVA 5DQJA 2YBRB 3AGWA 2A0LC 4Z77B 1NTGA 3I73A 1LK2A 4HJUA 2I27N 3BH9B 1WS8A 3QHTC 4IK7A 3RKDC 2FHTA 4IMLA 3EYOA 3SDDD 3BAWA 4EPSA 3TTSA 3WG7B 3PDOB 3FT3A 4AGPA 1BNZA 4NNXA 5G2NA 1DZ0A 3HA0A 2NY2B 4WUUD 1R3IH 3BP4A 1IYUA 3LD8C 5JW5A 2HT1A 2LKVA 5IHWA 1T3FB 5FGBA 3K8AA 1FLRH 4FQ1H 2E5LQ 4L9LC 4OVUA 5EUOE 3RDTC 4KQ3H 4R7LA 3C5SA 1K2DB 3UTSE 1NOFA 3CZGA 4LUVA 4ZZFA 2Y5EA 4QJ4B 3SD5A 4Z0XB 1S9WA 4XVJH 4X7DC 2VT0A 3ARRA 3GSNB 1EZUA 4CRPA 3CCUA 1IBLQ 5LBGA 4XRCA 4B9IA 1FO0H 4OZIE 3SQRA 3B5GA 2EDGA 1JIBA 4FXTA 4XPFH 1EIFA 3CFKA 43CAA 4QY8B 4XNMA 1F42A 2I07A 3ARFA 1BJ8A 2KC0A 4GOPB 4GXVH 2VZUA 3HEJA 1ZT4A 2BNQB 2NXZC 4OD3L 2UY7B 4R26H 1KD1C 5EEXA 3PE9A 3OMGA 1PF3A 2NTSA 2CE6A 1R5IA 1F9PA 3ARBA 4BFGA 1JDDA 2GK2A 3QUML 3VD0A 2X3AA 2WJ5A 3DDFA 4PG2A 4YDIH 5H4YA 5AAMC 4YSUA 3ASOB 5I1GL 5BRQA 2QFRA 4GNKB 4BKTC 4CADA 1K4DB 1FGNH 1DJGA 1H8NA 5D71L 4O2FB 3LKSA 1CDJA 1SHMA 1I7UA 5EU5A 1DN0A 4WHCA 2EXSA 3VDCA 4XNXL 3KWVA 2QFPA 2JIXB 1I1CA 1CZGA 5F6HJ 3ZYIA 1R5VA 1T22B 5I1HL 4NHCL 4ZFOB 2ESVE 4FQQA 4UV7L 2AS5M 1CDGA 4JE0A 3EADA 4B3EA 2XN9B 3ZVVA 3SD2A 1WTVA 1FNSH 4FFYL 4L8SC 4WDIA 3OHXC 4LPXA 3TBCA 4ZTOL 4UTBA 2Z31D 3CFEA 3JWNH 4P5TA 3IAYA 4L1TA 1A6TB 5T1MB 5A1AA 3A23A 1DVUA 3MXWH 1CKOA 5I1AA 1AKJA 4OO1I 1XV8A 2Z8RA 4LLYA 2A38A 1WA2X 3MRIA 4GBXD 4IRZA 1F4AA 1F4XL 3K2UH 5C0JB 2OW6A 4IFDJ 3J8F7 3HOYG 4DKFH 3A24A 3DXAB 3SGEI 5D2LE 1CT8A 1R17A 2OTPA 1KB5L 4ODHL 3GDEA 1M4VA 1QFWM 1YDPB 2F53A 5FXCH 1OSZB 1JGLL 5IVZA 2CR6A 3BPNC 5D7IE 4X80L 5FLVA 2G4GA 1NGZB 4P3WA 5E8OB 1SYGA 3TCLB 4ZMLA 4UTAA 3AY4C 3RUGF 8FABA 2AK4E 3SKUD 4NQEA 1UM4H 4I88A 2IX1A 4ZMZA 3CH8A 3KLAB 3ULVH 3BVGA 1O7LA 1FL6A 3WJMB 4PGCB 3Q13A 3BAYA 1JNJA 3ZN6A 4KNTA 2WYHA 2FHBA 4JBKA 4LT7A 4OI7A 4IKJA 4M9PA 4G4KA 5CS7A 5IODA 1R4XA 2ZPKL 3RA7L 1R46A 3PP3H 4A3FH 4LHUB 5EU6B 2FGWH 1BG9A 5B3JE 1BVKA 1CDCA 3LS4H 4ZOEA 5BN3A 3THMH 2DWYA 3RWIA 2EH8H 2LQRA 4UQ9A 4YWGH 3P9WB 3WIIL 2XGTA 1RZKC 1GOZA 4MAYC 1BCPF 4PRHD 3RNKA 1KCLA 1WRFA 1FBIH 2BNRD 2E46A 1NC4D 4PJAF 3BYYB 1PJWA 3CFBB 3FCTB 4E42B 3CVCA 4F8PA 1IGIH 1SN0A 2NY4D 4PJIB 2QVTA 3A8KE 1V9PA 5D2NE 5JPMA 3U4KA 5DJ6B 2ZQKA 3FU3A 4PRBB 1B3JA 1AFVL 2PXYA 1U8PB 3VA2C 4K2UL 1LTID 3OAUL 2HUGA 3RL1B 1D5MA 1GKEA 3NWTA 1YEGL 4IHBA 5CZRA 1PV4A 3U50C 1DLFH 4XE0A 1UJ3C 5TQ0L 1BVSA 1BX2A 1I8IB 3GK8L 1D9KD 1JCKA 3TASA 5HYIA 1S7SA 3ECWA 4HOXA 3IFPA 2Q8RE 1WFJA 4EVNB 4RGNA 3KK7A 5I17B 1FYCA 3BRFA 2CWRA 3IJEA 5EMYA 4XTRC 3QXDB 1CXLA 3ZZQA 5LUMA 1U2CA 4P2RB 4C3IB 5I6XB 2C9PA 2RACA 4A3MG 2IOIA 1AZBA 2ZWNA 5CC4A 2VL4A 3VI4F 3VXTB 4B0MM 3LB6D 3MLYL 3FT4B 2RGSA 1ZGLP 2C26A 3BDXA 1INQB 4JB9H 5D6CA 2HKFL 5D7IF 4WGVB 2VQUA 4X4MA 5ETUA 4MLSA 2V9TA 3GI9L 1ACYH 1BECA 1KJ3L 2EAEA 4N1HB 3VXRD 1QE6A 1C5CH 2FATH 3PUVA 3RX7A 2WKDA 4CSZA 3TV3L 3A0OA 3B3IB 4OZFH 3IDXL 3ROOB 2JJSC 2OL3B 5D96B 1NM4A 1LO5A 1XR9B 4GBXA 4WUUE 1N7MH 4G82A 4FMVA 3KPRB 3VDAA 1UM4L 2IGLA 5G4MA 5BJTA 4MSWA 4G7YH 1T1YA 1J9OA 4CGYB 3PSIA 2ADGB 1B53A 5GGRA 2JE8A 2QKSA 3UEQA 5GZNC 4KUCD 4NJ9L 3IVKA 1WAAF 2G0KA 5IVXF 4JQXC 3UBXG 1XF4A 2NXYD 4HYTB 5KSBA 1H0DA 2VR5A 3DV6B 4J23A 4O51A 4U1HA 3MLSH 1R3HA 5ITBL 2HRPH 5C8JB 4R3SB 1J1PH 2HMIC 3FMGL 1G0YR 3PREA 1FL3B 1OP5K 3IGUA 3M3YH 2EYFA 4JB9L 4J3TA 3T65B 4KUZL 1QNUA 4ODGA 4M03A 1CKNB 2R23A 4TYUA 3D39D 3KNBA 1PLFA 4E41B 1QVCA 3P9LA 2IANA 5C0FA 3I9GL 3LQZB 2M1KA 3MA9L 1STAA 1G9MC 4YEFA 4K07A 5IFJB 1OL0A 2HFEA 5EBWB 2YFOA 1NANH 4E9TA 3FHEA 2OJ1A 4HPOH 5GSRA 1E4XL 4LEOA 1AE6L 1CL7I 3T04D 1JZGA 2AJ3B 3OX8B 1TENA 2J6EH 4ELMF 2R0KL 4K5OA 4RX4A 4O1NA 1MWAH 2H5UA 4YHHL 1MFEL 4LP4A 5JZ7C 1OTTD 4M48H 2VSDA 3RLOA 3S37H 1LNUB 3V0IA 4P8QA 5EJWA 2A9AA 1Q8MA 4C3HG 5I6NA 2ZCHL 5K9QG 2GW5A 2PPBC 4M93B 3X12A 4GG6B 1WC7A 2K6ZA 3GSQB 4OLXL 4A66A 1TZAA 1ET7A 2Y07L 5IG7B 4KTAA 4IFDI 4UDUC 4YNYB 2BHYA 4O2CB 5EU6D 1U8JB 1QZNA 5C7XH 2UUBL 3DXAA 5EEVA 4JM2A 3FPPA 1WT5A 4HWZB 3SGJA 5ADPH 2WXLA 4XI5C 3SO3C 4BRVA 2VS1A 2Y6TE 4TNVK 4XQQA 3MRJA 3NFPA 4KFZC 4JHUA 4LCUA 2KLRA 1Y69U 1E7ZA 3F7YB 1QWNA 3BUYA 4GW5A 5DA0B 4PJ5B 4Y4KD 4BY7G 1U3YA 1CTNA 2A6KA 4OZFA 4XPGL 2RAMA 4G8FB 3DGCR 1RZFH 3KPSA 1UA3A 5IFAL 5FM5O 1JPGB 2LLLA 5CCHE 1SLXA 3GTOH 1GHJA 3HKZA 1P4LB 5F1KC 5M3FB 3CBKB 2FJHB 3LS5L 1RUAL 3QPXL 5EGTA 3MXPA 4ZUUB 3S97C 1MJ7H 3OW7A 3LVTA 2ZD0A 4JHBA 3V0WL 3MFFB 2EE9A 4FG0A 1DLHB 1CLZH 1A0QH 2NY3C 3MUY1 5T1LD 4BWUA 1HXYB 1TYJA 3FU7A 4M02A 3ESMA 3SZ6A 3MRFB 1E5CA 2IANE 5JLZB 3GSUA 4B60A 3FO9A 3RB5A 4F9PA 4FNSA 4CC0A 1OF0A 5HGAA 1TQSA 2BPBA 1WYJA 4D3CH 1U3JA 4XMKH 2Z0SA 3MUHL 3O9WA 1L9MA 5KYYB 3V4UH 1UE6A 3BFWA 4KVNL 3WNPA 4PHZA 3K7UC 5GJTL 3UO8B 4WU5B 2FK9A 2SEBA 1MLCA 1KFGA 1WZLA 3FZUD 2HT2C 3HE6B 3ZDZF 2UUAL 1R3KB 3QPKA 4R4QA 1CR9H 3NZHH 4NFCA 3BQUB 4TSCL 4UUJA 4HJJH 3CDZA 4A7SA 2H32B 3B9KB 4P9HL 3RY4A 2X70A 4PB0L 1XEUA 2GEQA 4OTXH 3OMNB 4FOMA 4IKLA 4OQTH 3JSSA 1IM3B 3MJ9H 5CCKL 3ITPA 3WWVA 4EE2A 1E2ZA 2ZXCA 4N22A 5ICXB 4UYPA 2F54E 3U36A 4XO3A 3R19A 2ADIA 5D6DC 4PRIA 2UZPA 1W72L 1MFUA 4XAWH 5EKIA 4OF3A 1M2VA 4O2EA 1MREH 2ZKWA 2LGNA 1NA8A 4L5FE 3WS6A 4JV5L 5JVG3 3FT4A 1RJCA 3PXJA 3PIP3 2OQ0A 4WJ4A 3BGFB 3BKYL 3O4LA 2WAQE 3PL6A 3WKQA 2XZZA 1CLVA 5TH2A 3TN0C 2QMJA 5I19L 1RL2A 1IAKA 1XTCD 4WFHE 3T0DA 2HX8A 2C1OB 3FN0L 3B1UA 1XGZA 1RK7A 1I4PA 4FLRA 3ULUE 3F2LA 2DM3A 2F0QA 4RHSA 4D0BA 2X1PA 1QNIA 4FF9A 4XTCS 4LF8L 4HBCL 2WZAA 4LCWB 4YHMH 4Y5VA 1HH6A 2ZAHA 1CXHA 1TKWA 3T53B 2EZ0D 3H6AA 2VY3A 4GP8B 4U1JA 4UU9B 5KVFH 3LB6C 1W80A 3F2BA 4ZK9B 2D2CC 3HRZC 1L1OC 1PH7A 2PTVA 4KHPL 2WCSA 2FD6L 2IGFH 5CZXD 3H9SE 1T2QL 2I9TB 1IRAY 3KJ6L 4ISVA 4N5EC 4XAWL 2YQBA 1FVDB 3LQAH 2O5YH 3O2DA 3LNNA 4ZQ3A 4TNEA 5I9QC 4G7OC 1CC3A 2D7MA 4X7SL 2BCMA 2IX0A 2F7QA 4PJDB 2F9BT 5B3SB 1I4RA 2R93B 1FJGL 5GGVH 3OKKB 4AGOA 1EOVA 3RDTA 2O93L 1EIBA 1NAML 4P4KC 2VIRB 4N68A 1OP3K 5G3LD 4QF1A 4L2LA 4B3RQ 2OR7A 4ME3A 1W0YT 3L3IA 2DQDH 4HZLB 4LGSB 4QEGA 1NNXA 3TN0A 5C1MB 4L63B 2RF4A 1P1ZB 3EJJX 4HHWA 5KYNA 3WKML 1G6PA 1PH1A 4R4TA 2MHAB 4J1UA 2C9AA 1L7IL 2OZNA 5IF0A 3BVXA 2ZTDA 4A55A 1YEHH 4GNXB 1RZIB 5DK0A 1CK1A 1AGEB 3BKJH 4E9RA 3EJYC 3ZKXC 3OMIB 4NN7B 2GT9A 4X3UA 1UOWA 1NC2D 4TUKL 1S8DB 2MHVA 1QFWI 4PRHE 4P07A 3MRGB 5SX5K 3T2NL 1KCVL 4YJZL 2LS01 5JOFA 3LH9A 4UOW0 4N0YL 4Y7NB 3L2PA 3TEZA 1JVLA 5F7FA 1KIPB 3DSFL 2OK0L 1BFSA 2KZ1B 2W0FB 4NM4L 4TM9A 5FYKH 3WELA 4XCFH 4POZC 3X1NA 1N0LB 1BWMA 4ORGA 4K3EL 2Q7YB 4ALAC 1V54B 4PYHA 3UTPE 4X6DA 2E75C 3S1MH 4HJ5A 3BO8B 4A75A 1K4CB 4BFRA 1O7VA 1UWGL 4K9EH 4LEXL 4K5NA 4XVUC 3I7FA 1J87A 5C0RL 5IEHA 2Y7NA 2L12A 2VNUD 5E5MB 3RGBA 1OD7A 4IOSA 1SLUA 1S5CD 1UB6B 4HSCX 3NTIA 1IGTB 4ANWA 2O5JC 4DAMA 1MGSA 2EILB 2R1WA 4ZUSB 3WS3A 1IGFH 3TIDB 4AMKL 4N2MA 2A6KB 2VDKH 1OK0A 2AQ2A 2LMCB 3OTTA 1MCNA 1EY7A 5BS0B 1VFOA 4DR4L 1MFBL 1SXBA 1XCQB 5CJ5A 4O02L 4QTFA 3S1RB 1JDCA 3VD3A 1LYQA 1X5LA 4B9ZA 4W9LC 3T2LA 5F9OL 2NYKA 4NRXB 5AAWC 1S5IL 3TVMD 1NPNA 3VFSB 3BPLB 3EYSH 1YNLL 1DLHA 3B9DA 1FI8C 3C1FA 4Y5XA 4Z0BH 1WFOA 1W6JA 3ZE0B 4JFOA 5AVSB 3M45A 3L3DA 1HH9A 2JJTC 3ESNA 4J28A 4C1NK 1V43A 1DQLL 3J2PA 3RZCA 3LH2L 3HCVA 1EYCA 5C92A 4GQQA 1UFGA 2H7WA 3PS6A 1JRHI 1ZLUK 2P26A 3A54A 4P9MH 3VXNB 3RGVC 1SNMA 1IW7C 1MCDA 1N2RB 1QLRA 4DN4M 4KV5F 1LK3H 3QQNA 2YLKA 5EO0B 1JPTH 2E74C 3VSVA 1YN7A 2D3LA 2UYLB 4WCYL 1WHOA 4OGAC 1BOYA 3HOWB 3V52H 3N2JA 1PYWB 2VXQA 3EYUH 2NCEA 3O81A 5EZLB 2OR9H 5FOBB 4WHDA 5EZJB 3LSOB 3MN8A 2QGCA 3IDXH 4OF6A 1I9RL 2BS8A 3EGXB 3BN3B 2QELA 3OKNA 4FTVB 5AFAA 4AV0A 4A3EG 3Q1EA 1TIUA 2EKSB 5TQ2L 5TF0A 4DNTB 3BDBA 1XR8A 2XUWA 3U30B 3U36B 2ZP9A 2W9DL 5T1KD 3QG7H 3PDOA 3FT3B 1CGUA 5JAVA 3CVHB 2EXWC 2N88A 3VWKA 4EGVA 2IH1A 1M2VB 4CGTA 1YMHB 3GXNA 1AOHA 4FKHA 4RETB 5EOCH 1AO7D 5H35A 2DQMA 4JHVA 1BM3H 4IRJC 1UURA 3K57A 2IPKA 4M1UB 4OF8A 5D5MA 5CZKA 5DK2A 2BOBB 1E1TA 3KR3L 1I94L 4NIKB 5C0AE 2P42B 1VRSA 5DMKB 2AMUA 1O7YA 1T21B 3N40P 4Z0XA 4I0PB 3V2AR 3UXFA 3NTHA 2YA0A 1C7YA 4HA1A 3NABL 2L0CA 2YZ8A 1XGPA 1EHLH 2EUXA 5GS2H 5ACZB 4JRYE 2B14A 4BQCA 2BRQA 2HJLA 3HZXA 4PV8A 3K80C 3NJFA 2R6GA 4QUCA 3C12A 3D4DA 4LF9Q 3TH4T 4KZDL 1JWUB 3SKNA 1BBXC 2DJMA 5F7EL 5JORA 3AYHB 1BQHB 3BIKB 4NCDA 4A6YA 3FU9A 1BXAA 3B6SB 1P7BA 3FHWA 3SGEH 1B1ZA 4IRSB 2O6CA 1QBAA 3LJ3A 5FYJD 5HDQH 3D4GA 2LTQC 2EDRA 2GSIA 2D0HA 3Q5OA 5CEYA 3J81L 3HB3B 5K39A 2XY1A 3X1FA 1NWPA 3ZO0A 1DJSA 3O45A 3N42B 5DC0A 4XCNB 3REVB 3TVMA 1GC1H 4M8QA 2JLLA 2ZWLT 3MBWA 1KOAA 4FGMA 3RA7H 3NTCH 4ZBJA 1QPPA 4PJCA 1JI2A 3K91A 3KGTA 5GZOD 4BWTA 1OARL 2P4AB 4U4IA 4UDTA 3B83A 1CFQA 1WQVT 3D85A 4JFDE 1SLJA 4HAEA 2CGZA 3BT0A 4M6NL 2W9EH 5ABAA 2BWIA 4F37F 1YNKH 4GOPA 4YZWA 3ZMRA 4GOPC 4AEHL 3O9WD 4WFFD 3W1BA 1YHQA 4QIRA 1H3XA 3D18B 4QY7A 2VMDA 3QA3B 4WZ9A 2VLMD 5D1XA 2Z92B 3SK8A 1H15B 4KRPC 4LLYB 5E4WC 1SYDA 3R8BA 1RUMH 1UVQB 1Y07A 2HWZL 1ENCA 3MYJB 4JHAL 5C0AA 2YUVA 4A3FB 4JBSA 5EOQL 3DJ9A 1Z32X 3LRMA 1ED3B 1T5WB 1YJDC 2E7CA 2J88L 3NJXA 1GA2A 1E4WL 4GW4B 5ISZE 1GHKA 4W70A 1M6UA 5HGBA 3CE1A 2RKSA 1P84J 4NUGL 4BDVA 4Z7UA 1OXYA 1LP9A 3KLHD 1EFID 1DE4B 1OAYL 5EZIH 1KIRA 2G9KA 4H8VA 3IGLA 3C5ZA 3BO8A 3F2DA 2R93G 3IS1X 3OMAB 1Z3GH 4EN3B 3L2NA 3Q6FA 1B4RA 35C8L 4X5WB 5IIFA 1OGTB 2XIIA 4JPQA 4LASH 2K78A 5I8KL 4DUWA 1X9NA 1ZOXA 1F4WH 2Q2EB 4PTTA 4XN5A 3SDDB 3WFDL 1T20B 3V0VB 3ERXA 4UY8C 5DTFA 5LXGH 1LM8V 3PQYA 3T2NH 5FW7A 4M6OL 4DGZA 1DBAL 1NTDA 1WWBX 4HG4J 1V8QA 1TUPA 3D3VD 3CK0L 3HS8A 3OGCB 3SQOL 4BQ6A 2ARWA 2VL5B 5GRJL 5BXFB 4WWKC 1OSZA 1YUKB 2MNWA 2P5EE 5F7HA 1SEBD 2IO5A 3K2UL 5FLMG 4OJEH 2B1AH 3ZLQC 2ATAA 3MV11 5F89B 2JKSA 3D0VA 2AK4A 3KD4A 2YC1A 5EBMB 5KTEH 1TNMA 4HSVA 5MENB 2IMMA 3D08A 4DAPA 2GIMA 3HW7A 3LOWA 4G57A 3VD1A 4HHAA 4RLDA 5B1BB 3NCEB 5I18L 4WI6A 35C8H 4MJHA 1J88A 3E3QE 4IOSD 4PP2B 4IQZA 4GUCA 1UA7A 3S14H 3GUFA 2CGYA 4FFZL 2VR8A 4C3HH 1WUNT 3AG2B 3GJFA 1JNHB 3RLFA 4YDVA 2X4TA 2X2YA 1SOXA 4P59H 2EICA 2YGPA 4X9BA 4CL7A 3K0XA 2RDFA 4J6HA 1B2YA 1UEMA 2LLNA 4WTZA 5J13C 1UJ3A 3H94A 4NDMA 4CW1A 4WO4B 4JDEA 1FNWA 5FHAL 3BXNA 1VGKB 4PJ8B 1E4KC 3KYMB 1DQTA 4MXVF 5DRXB 5EIQA 5EU4A 2JLPA 2XKUA 1V55B 2IWEA 1PKQB 1STNA 3FF7A 2AQ3A 3VXUD 3WYRA 4DVBB 3BD4A 3S16H 2DGYA 4Y5YB 1PA6A 3BLKA 2V8LA 5ANHA 3IPEA 4L8DA 4EOWH 2Q8IB 1X5HA 4NZTL 4X66Q 5MI0C 3QG1A 1CL7H 1RF2D 4OLUL 4PJ9B 5SV3A 4R90L 3QULA 4YBLC 2BOBA 2NY6C 4Y19E 1B0RB 4ZPTB 4ATTA 2OX5A 3CW2C 2FEDD 3GF8A 1G87A 4EUPG 5JOPD 1L9PA 1PIFA 2R83A 3X17A 3VXME 5TQ0H 3O3AB 4JO5A 4DR3Q 1A63A 2C9RA 2KL6A 3BKMH 1JF5A 2TSAA 1NFDA 3IU4H 4P2RA 3OAUH 1KRSA 2FYYA 2PXYD 3DGGB 4DR7Q 4NO5A 1H0DB 1UFUA 4O51B 2BP8B 4EQNA 1OEZW 2BM3A 3ASNB 2EY2A 3J7HA 1JC7A 4DUVA 4UILL 4EAEA 1YNND 3OOCA 3OJDA 1ZIBA 1A2TA 5L4MA 1PH5A 1LILA 4JFQB 4PJAE 2BY2A 2XRAH 4A3BH 1KB9J 1N8RC 2DMHA 2CO1A 4U6VL 4HAKA 5HDRA 4AUJA 4LLVB 1PLCA 4ELKB 1ZVHA 1Q81C 1RIUL 4JPVH 1T0NA 2ITDB 3FYEB 3UC0L 2F3VA 2WWOA 4WSJA 5CV4A 2TSSA 1UTDA 5M3MG 1J8HD 5CEYB 1XL4A 3SZKC 1WAEA 1Q72H 4MSWB 3G48A 4LEOB 3O45B 3EGDB 3BJ91 3SDCD 3KLLA 3C8HA 4PD4J 2MCPH 2R56H 4PY8I 5HHXH 7CGTA 3SGDH 2VUMG 4B3TQ 1I85A 2EXYC 2BERA 3BX7C 4JFEB 2WV3A 4QHLB 4P2AA 1QO3A 4ODUA 5EOCJ 3WNIA 4HLJA 5I82A 5C07E 1LDPH 5CIPH 1YEFH 4NQDE 2VJ8A 2LABA 1ORQA 4GIAA 4I77H 2BNRA 3L3OB 5I66A 3CZSA 3RWEA 4AK2A 1CKNA 1T5XD 3X12B 1XNQQ 1WC7B 1ZDSA 4DESA 3GSOB 2K45A 3RB7A 4DVRL 4YNYA 4JGNA 4PMBA 2J7LA 5C0AB 3R8BB 5DUMH 1NIFA 3HC3H 3HOYB 3S35H 3CRLC 1MZYA 2Q6WA 1T7XA 5SWSD 3B7RL 4OFIA 4PYGA 1Q46A 2ZX8A 2DPKA 5FHBL 3W2DH 1G7PA 3F7VA 3ZZ1A 3ARGA 1HA5A 2F0HA 1GZHC 5I1KH 5HYJE 1MCCA 3SDYH 1RJYB 2H1PH 3URYA 5H2BB 2EYRB 5KIXA 1D1KA 2HCCA 1MW1A 3FTUA 4MNQD 1A6AB 4NNYB 4DUZQ 3WN5A 1J5EQ 1KENH 4PJ7E 3INUH 2E5LL 1K8DA 2NVXH 4PZ7A 1SUHA 4KO7A 1BQLH 5FYLD 4LEBA 1HR0L 4P2CB 2WQRA 2WSDA 3GSQA 3MVSA 1U4PA 3O6FA 3K7AB 5E9DB 3TZVA 2IPKD 5EWIH 4FA7B 1DJWA 5FA3A 3BWZA 5AB9A 4W4NA 2JCWA 3SJVE 1INEL 2QF7A 1KIQA 3N1GC 4QRTA 1JAEA 2CAKA 2OULB 2BOLA 2OSLB 3GS4A 3QC6X 3OJVC 4UV4L 4WHTB 1QQDB 2HN7B 1T0PB 1ZY9A 2E6JA 3MEFA 2L0DA 5KSBE 3EUUA 5F7MC 1T2XA 4F5CA 4Z3EA 4ZAKA 1R47A 4RKBA 4FNPA 4RGMB 1JZ5A 2VISB 3RTQC 1V27A 4LCWD 1PEWA 2CO6B 3KL0A 2Y07H 2Z0UA 4NUJA 3PPEA 4YLQT 3VB8A 1A4BA 2GBTA 4UT9A 4JZNA 2DV6A 4WFGD 3VXSD 2HA1A 2C3XA 3JWDH 2YXFA 3HE6A 3RDJA 2ERJB 2NY0B 4ONFL 3DTUB 1XH0A 2SNSA 5J1AB 2MQ0A 3IM1A 2FJHA 5E8EA 5I8CA 1FE8H 3EH5B 4M3KB 5HHOD 1J18A 4RESB 3QQ9C 2NY2C 2JKNA 3C9NA 2GI7A 3QC5X 4R5VA 5F7NC 4BKLB 2CW0D 3WNNA 2HX7A 5EBDA 4NNPL 3WSQH 2R0LH 1XXGA 2NUCA 2VE6A 2YPLE 1MUJB 3EGSA 4L1HA 1NLDH 2M2DA 2X1QA 5I5RA 2RFXA 1I9JH 2Y9RT 3LKQA 4I77L 1N32L 3BAIA 2GJRA 2K05A 2JI3A 1RZ8B 4D94A 4Z7VE 4BCZA 1BF4A 5C9JB 4PMEA 2IW3A 4U1GC 4CMMB 2VDRB 1P4IH 1JDAA 1L9OA 5I1KL 4WV1A 4FG4A 4IBLT 4J5VA 3BKJL 2E8GA 4QHUA 2X05A 1ZGLB 4OCLC 2GJPA 3EOBB 5DJAB 1YYLH 1LGVA 1QABA 3BQUA 3H3BC 4ONFH 1YEEH 4K7PY 1E6JH 3N85L 1A4CA 2B2WA 3QUZD 4C3IH 2VH5L 3PV6B 4UT6A 2F54A 4BA8A 5AJ3L 5FGBC 4P06A 3VD7A 2DKMA 1HDMB 2NQ3A 3GD1C 3M07A 1J8HB 3KVQA 3DJRA 5DZJA 5F88A 3H0GB 4NGHH 4UB0H 4L05A 1Q8KA 4CJ2C 5AYUH 4CNIA 2FE0A 2YTXA 4W9DC 4KK5D 1BQ5A 5HI4D 1U8MB 3CX5J 3UAEA 1SUJA 4OCXH 5TTRA 1BR9A 5KJRL 2EUVA 1U8QB 1UAPA 4J3OG 4PW3A 2E6QA 1BZOA 1W6KA 1ORSB 1ZSDB 2BP8A 2Y5TA 5SV4A 3VXPA 1IE4A 4G7YL 5AW7B 2HMID 3VCLA 3KPPB 4AJ0A 3N9GH 5GHWH 1GOFA 1FLTX 1NCHA 2F0NA 3M4PA 2ITCB 4IM8A 4QRRA 3DARA 3EJZD 2VXSH 2A6JA 5E1GA 2AEPL 4XPBL 3LKNA 2QTVA 1Y1WG 1K9TA 5FECB 4HSQA 4Q5VA 3HE7A 3I3CA 4LF7Q 3B2PA 4J1UB 3PHOA 4JFFA 1LEKA 3UG5A 3WNJA 1NJIC 1X3EA 1CFTA 4KY2A 4YS4A 1J11A 5C71A 4RQQB 3OVUB 2BLFA 4OFYD 1U58B 1DFXA 4ENEC 3EFDH 1MHCA 4WRDA 2CUMA 3IF1A 2YSTA 2KDGA 4HK3N 3O11A 3MRQA 1XMOQ 3IJ7A 5I23A 1VQEA 2EDDA 2F7IA 4E0RA 5DJ8A 3SDAD 2YZ1A 1KLFB 3T13A 3Q9QA 2QVIA 3ZGHA 4NO2A 2G75B 2BSEA 1A1NB 3NSYA 4P4KB 5EN2B 3KLKA 1KIXA 1MVUA 1KAAA 1OO2A 4OUUB 4H0IA 3T4YB 4MD4A 2WNWA 5G4NA 5I71C 2B1HL 4LSVL 1G7QA 1CK0H 1OHQA 1PIGA 4X6DB 3E9HA 5JHDA 3S36X 3V52L 2B63H 1JHKL 1WTPA 2L8AA 4RAVB 3U1SH 1NCCL 3A22A 4PRPB 1HRJA 2ZUXA 1XQ4A 4RFOL 1GW6A 1PVHA 4WU7B 5HHQB 1LO0H 3TZDA 3G9AB 3RZDB 1UCBH 1I4FB 4X62L 2Z4QB 3V4VB 1WBZB 2H0EA 4PI2A 5KTEL 4WSKA 2MWCA 4JOIC 4ADGA 1EUTA 3L95A 1ZWIA 4U1LA 1YAIA 2IMNA 2F0KA 4DR6L 4G7QB 1CWVA 1UD2A 1SAPA 3U9PL 3CDGA 3HN3A 1AR2A 4L3CA 2WVVB 1HHVA 4DW2H 2XRQD 2BFVL 1PZDA 1EO8L 4XXCA 3SPIA 2JJQA 1N0LA 5EWIL 5C0CD 2WGXA 5C09A 3ARUA 1A3ZA 1DJIA 3FCSB 4KAQL 5DZOA 2B2VA 1BHGA 2CRZA 2DQGL 2R61A 3GBNH 2NNRA 4QRPA 1QSFE 3IS0X 3N6YA 1WDAA 4OLVL 3WMPA 1IARB 2CJ3A 2R2HA 3CN0A 4WI9A 3EJTA 3D3VA 4JGUA 4BQ9A 1W2KT 2HRGA 4V190 1MCQA 1CDUA 1TEFA 1D5XB 1UACL 3FQTB 3U2JA 4YHOL 5KSUB 1HTYA 2AVFA 1VZIA 4YEEA 2XWTB 1A7OH 5EUOB 2I5HA 5F0MB 3LPOA 5GGVY 4ZX5A 4DV7L 2FHFA 3JQOB 5HJGA 1TLKA 2XXCB 3VXRB 4FXLA 5FUCC 3WENA 5E8EB 3TF4A 2UXVA 2DNCA 3VWKC 4L4VB 4NRXA 1KZYA 5CEXA 4ZMYA 1TFHA 4AENB 2EC9T 2A3TA 3GXUB 3IBEA 4QRRD 3T6VA 1ACXA 4HXAL 2FJUB 4YC2C 5EDSA 3U4BL 3KFUA 4RA8A 5HGDA 4OFYA 3J7AF 1SOQA 4LE8A 1LE9A 4YHHQ 5L0QB 5CP3H 1PSKL 2DWSA 3WEMA 1EJOH 4TUUA 5T3XL 2X6UA 2ZTBA 1FNSL 4ZTOH 2WZ0A 1JK9A 5TPWH 4NDXA 3CCSA 2PCXA 4C56D 1TPXC 2AV7A 3L81A 1WD0A 4UWQB 3JWOH 1G6ZA 4PJ7F 2PXYC 4TUKH 2IH1B 1VADB 3CZNA 4N0FA 1I8IA 3DVGA 4M3JA 2ETWA 1LO0L 4X99A 1AGBA 3T1HL 4PJEE 1T66D 2B29A 5KVGH 3WTWA 4RDQG 2UUBQ 3DSFH 1SJHB 3T0EB 2OK0H 3ZMNA 3APCA 4AZ8A 4P71A 1SLVA 1FG2A 3PGDA 1YCSA 1ET8A 2R1XB 4K71C 3BUQA 4M7ZB 2LLGA 3DPBB 3FHQA 5ID0A 5JEAJ 1X6LA 4H1LG 4DO4A 2NY4B 1JS4A 5BS0D 3CC7A 4W9ZA 1IT9H 2XTJD 4IUUA 1B4JH 4MB5A 5MP6L 2Q2UA 3QI9C 4K6DA 4P46D 1VS0A 2FQEA 1J8HE 2HJLB 3N43B 5FUOL 3WL9B 4RMFA 1IGCL 2DQCL 3VX1A 1N5YL 3ARBD 3W56A 4Q9QL 3BT2L 4YWKA 4N9TA 4ZYKB 3UZQA 2HT3C 3A3YB 4LCCA 1KNOA 2N7SA 2O5ZL 4X9GA 3ZDZE 5IUSA 1WCMG 4FYDA 2XXGA 3I50H 3KF8A 3D06A 5T5NG 4J15A 2DQGH 4K0KQ 3BP5B 4OT1H 3VGHA 5I0XA 2AXFB 2HLFD 4OV6F 5ESAA 3VYNA 1V7NL 2OI9B 5GRVK 3UPCA 2A6EC 1Q1BA 3NJGA 4QB4A 1WTXA 2IFFL 3E9IA 5CZVL 2JWYA 1GZPA 3REVA 4JK1C 5DVMA 5IIEB 1MAMH 5D7KE 1CXIA 5FECA 4N3TA 4APXB 1FBIL 5I1GH 1II4E 4NYLB 1NBYA 3IYLW 1MJ8L 1PDKA 4LLWA 3QK0A 2PO6C 3KXFA 1C8PA 1ACYL 1RJZA 4HIIB 5IQ7L 2YPLD 4G1EA 2F61A 3OLGA 4UOW1 4EI0A 4Y4KB 2W0LA 1E3ZA 3PXLA 5ERWA 5GPRA 3VGBA 5HHNB 1RZ7H 4DT2A 2J56A 4J3VA 4L5FH 3RGVA 4DP0X 4XXDB 5FO7A 3CV5A 3A56A 2TSBA 4UNUA 3QRLA 5AW6B 2F58H 2A73B 3QIWB 1K72A 3ECBA 4N9GA 1WZMA 2YAOA 1ASOA 1QSEA 2ZUSA 1HK6A 2Q3ZA 1OCZB 1M6OA 1IIKA 1DE4A 1OLLA 3OPOA 3J81E 4Z7WB 1KC8C 1N12A 3FJTA 4IIQA 4NS0A 3BIAX 5JHDB 3MXNB 3K1DA 4Z3IA 1VSCA 5E2WH 1VKXB 5FLXc 4RRPG 3K0WA 1GC1L 2HKFH 2P24B 1GGBH 2NXZD 4CMHC 4HD5A 2JA7B 2WP8J 4FLOA 3UDWA 3RL2B 5I30L 1SJHD 4L1BA 2WTPA 4KK5C 3PQYB 1TFPA 3L95B 3O2VH 4OJYA 4KKUA 5IR1A 2KZKA 5FCUL 2HZHA 2ILLA 4XX5A 2O61B 3R2IA 2XZQH 1PBYA 4QNPE 1VAHA 2JA7G 2JA7H 4GLVB 1SNRA 4LAQL 3HS0C 4N2CA 5HJ3B 1NEZB 2KKQA 1EJFA 3HMXA 3PLYA 4J3OH 4M5TA 3A4EA 1KCUL 2CO4A 4NHCH 3QZOA 3PUWA 1WZAA 3MLRL 4TN9A 5IMMB 5DJCB 3TTYA 3PO2G 4RWSC 4A68A 4CKCA 5KVEE 4KK9C 3DETC 4G8FA 4Y1AA 3ISYA 1M4KA 1ZT7B 4PLNC 3QDAA 4WI8A 1U8KB 4BFBD 4X5WA 3TA3B 3EZ8A 3OMCA 2ATPB 5H37A 1DVXA 3H6MA 1DEEB 1H8SA 3Q1SL 4GSUA 4WGKA 3ND8A 1TQWA 3DOHA 3TPUB 3HNSL 3OTOL 1T20A 3V0VA 1S3OA 4ACTA 4F3FB 4GZYC 4KZCA 4NT6B 3NESA 3VH8G 2JB6A 1TWAH 3PIO3 12E8L 3LN5B 4WUKL 2PNRC 3CHBD 3OZ9L 4N2DA 5IVNA 1XGUA 4Y8AA 3CXFA 3TEYA 3VDBA 2JQMA 1HSAA 2BNUB 2GPZA 1FGUA 3IFLL 1AZNA 1HNYA 3PP4L 2VUYA 4H8HA 4NBYB 3QFGA 4JEGB 3W1GA 5G3LF 1MCPH 1NMCB 3ATEA 5AVTB 4Y52H 2SEBB 2ZYIA 4XCYB 2F52A 1TZGH 1A21A 2J2ZB 1T7ZA 4HHAB 1WA0X 4OZHB 5BV7L 2WMPA 4JREB 2JKJA 4J3SA 1TDQA 1QUQB 2ZOUA 2X4NA 1QPKA 1HXYD 1C5DA 2ZX9A 3W3AA 3IMVA 1CDHA 4P2OA 5CHNB 1NMCC 4FQHB 5I18H 1BBDH 1NGWA 5BRZB 3D85D 3MX0B 3AQYA 1L1OA 2C35B 2I46A 3VFTB 1G0DA 3CVHH 2LFEA 3WOVA 4UT7L 4NPYA 2WP3O 4PY7B 4PJDF 5F7EH 3L5HA 1IAOA 4JC0A 1UZ8A 3MYZA 4Y4FA 5DQJB 1RH8A 3BUPA 1RZGB 1Y1UA 4KHXL 1CYXA 4X8JB 4AYBG 1KEGH 4NRZB 5C3EB 1MELA 3OHMB 3QEHB 4G1MB 1IJ9A 4HWEH 4WWKA 4EVOA 3UMTA 3F58L 3Q2NA 1IC5H 3LV3A 4R4BB 1I7TB 5E6IC 4JI7Q 5IGXH 4J3OC 4ZRGA 1JCVA 2VO8A 4U1IA 4WIQA 4ZRZA 1UM5L 2QKIA 1CHPD 3DUHA 1ERNA 4D0BB 1A25A 4HQQL 3T8VA 5ESAB 3W2DA 3MFYA 2AERT 4IJHA 4K9JA 3C87A 1HNZL 2CLVB 1O7SA 4GUPB 5TFSH 1NBZA 4P46C 1N4XH 1FGNL 4YHYC 5LN8A 1NUDA 3KS0J 1IW7D 4HC1A 5C0DB 3UDXA 1F1GA 4IU3B 3B43A 5IBUB 1IJNA 3GHEL 1N5AA 3O6MH 4YVNA 3MBXL 1SROA 4L4TD 3RGHA 4CDCC 5FUZH 4M7JH 4N24A 1XX8A 3NXWA 5CCGE 3UAJD 4JM2C 3MAQA 4WK0B 3WIFA 1AO7A 5KYLA 1PDQA 1WD1A 3MNVB 3ABLB 3OJDB 3U9OA 1U3HB 3MDJA 4J6RH 1DBMH 4IGBC 4JO4H 1Z5LA 4ALPA 2P8MB 2UY7A 3NEOA 3F5WB 3L3OA 1JMCA 1A3TA 1FYTD 2J4WH 4TSBH 3K8KA 5DUBB 5EO9A 1X3DA 4CU8A 1ZHNB 4H8WL 5D7LB 3X3GH 4FXKB 5FA4A 2WWMC 4QHMA 3PQIA 1RD9D 3ULLA 1CFNA 3HC3L 3II2A 3SPGA 3TZUA 1O80A 2YD1A 4M1GH 4XC1L 3MGOA 3UTSB 3IT8D 5I1CL 3ARSA 1D7BA 3JT2A 1EJ8A 2VO5A 3CHRA 2N1TE 5ES4B 3DO7B 1QSVA 1ZT1B 4R7NB 3ZOAA 1IAMA 4A2EA 5D2LF 1AGDA 2MKLC 3CSTA 4P9ML 4LBAA 2E9IA 4DV1L 1DVTA 4Y4HD 1R3LA 4J3WA 5J39A 1I4HA 1GGYA 4ODSH 4UT7H 4XAKD 4NZFA 3U9SA 2C4FU 4H88L 4KPHL 5K59E 3TFKD 4DAYB 4FQ2L 3TBSB 1T0OA 1AAJA 1VPOL 4QGTA 4L0PB 5KYWA 1IGML 5T33H 1EQTA 5KOMC 5FW6A 3V6OE 3T8MA 2ALYB 3F1ZA 4N20A 5EORH 4ZPVA 5FFOA 5JPMC 2VQTA 4W6WB 1EHXA 4NQTA 4ZOCA 3OAYK 4H2CA 3J81c 1MLBA 4I85A 3LZFL 3H7BA 2RCFA 4AIXA 2K4WA 1U6AH 3AG4B 5JOBA 3K6NA 4FG2A 1JNLL 2OJEA 3HOWG 3HG4A 4HF5H 4XXCC 5MEQB 2JA5H 3APMA 3BC9A 5CP7A 3WS3B 2BA0A 2ZSVA 2XKNB 4WRLA 3T71A 4D7PA 5CO1A 4QUOA 4YHNA 8FABB 4GBXC 1TQOA 2IALA 3LZNA 4CKEA 1YYML 3KWWA 4AM0B 2GTWA 5B8CC 5IOCA 3TA3A 5ANMA 4DP5X 1I9EA 1F90H 5IJVB 3UE0A 4H02A 1HI6B 2PW1A 4YE4H 4IN3A 5KBPA 4WEMB 3MTXA 5C7XL 1SXNA 1QX1A 4KX7A 1OXTA 3H0GH 2PWGA 2YK1H 5CUSH 1HILA 1ROWA 2A68D 3T3PB 1SN2A 3AWGA 3RIFF 1A6VH 1W6WA 2VDPL 4FQLL 1NAMA 3HUJE 5JIMA 1BVKB 4RMVA 3F8TA 4C2MH 2F5BH 5CSZA 2B8GA 3K5RA 4L4TA 4XMPL 2L04A 2BSBA 4MXQC 5C0XI 1NIAA 4JQIA 4L4TE 4DV2Q 1N8OE 4PJ9D 4NQDA 1OGPA 2DWDB 5JR1L 4BZ1L 3RTQB 4O5LL 5GS0C 3MRKA 1IAIL 4RMUA 4J2XA 1XHHA 1D2PA 1NC4B 4BBWA 4TLKA 3I6LE 1ASQA 5I1LA 4AL8L 1KCRL 2R59A 3EOBA 3FL7A 4WFED 1T89A 2ARJA 1X3PA 3NZ8A 5DRWA 4DZ8A 2APTA 1JPSL 5TF1L 1D5MB 1PL3A 3AQXA 4M4RA 5L4JA 2JYOA 2OV0A 4QJ3B 3NSCA 4Y7OC 4P2OB 5B1CA 1JK8A 2OMWA 4WUUA 3VFWA 1NCJA 3UJIL 4DKEH 1DQLH 4CJ0B 1FE8L 4ZXBC 3MX0A 5IYBH 4GG6F 2PNHA 4MNHB 3MA2B 1MSPA 3V6OA 4HJSA 5BZZA 4Z7VA 1MWAB 2HT4D 3QORC 4HUKB 3FCUB 2K7PA 2R8SH 1FPTL 1MFEH 8PAZA 2BNQE 5EC1A 3FBKA 5H94A 3NELA 2MRYA 4TTDC 2Q86B 5C08D 1LVEA 3E9TA 2APFA 2K3HA 1C0AA 3HAEG 5AOZA 1CUKA 3VU2A 5GGTA 3K80A 1I6HB 3ZU8A 3LTVA 3CBJB 2HFGL 3PWPB 1U6AL 3CU7A 2VXVL 5CKGA 1JYNA 4D8OA 3MLTA 2Z8VC 4CILA 4JPBW 3C08L 5B38G 4S1QL 1Y1WB 2FGZA 4D9LL 2JA8G 1GMIA 4JI0Q 4Y2DA 1XIWD 5DEFA 4JN2B 5HI5D 4IBUA 3QYMA 2Z7UA 4Y4FC 3P3SA 4ZQKA 4AYSA 5DO2D 1JZDC 4HU8A 2FMMA 1VACA 3VI3E 5EDXA 4JANB 1BAFL 2VN7A 4TNWF 1T1ZB 2O5XH 3NACL 4XMUA 1NCTA 1BMWA 3QQDB 3ILPA 1CQKA 1EQWA 1S46A 2X6BA 4U1HB 2A69D 2EO1A 5GS1C 3GM0A 4YSAA 3QDJB 3NH7L 3ZTCC 4DGWC 2HLFC 3RZWA 5DI8B 1TJGL 1AGCA 2YEZB 4FYRA 1SEBA 3ABKB 4FNLL 4LF3A 1I3RB 1LTTD 1BD2D 4P2RD 2P1YA 5JNYA 3LKNB 3SBWA 3VFMA 4LFCL 5J89A 3G5ZA 1EHLL 2EABA 2NY7H 4LSTH 1EU4A 3STBD 5EKLA 3D9AH 4URTB 1DQJA 1IAIM 2HKHH 4XHJD 5EBWA 2EDFA 2KDYA 3W81A 1I6VC 4L8SA 3HI1A 4AVHA 1JZ4A 5BQDA 1UWFA 2ZP8A 3PY9A 4H2AA 3MRDB 5F0LB 1WWCA 3O4OB 2AXWA 1LEIB 2VOTA 3QJUB 5EFIB 3NQKA 1F2QA 3KS0H 4KJWC 2HHHQ 4RVBA 3DSNA 5D1XB 2XYCA 3RVVD 1EPFA 2JKLA 5FUCE 4B7IA 3WMSA 3E2HC 3RDTD 2LVCA 1JI1A 3CDGB 4E9LA 1RJLB 2EJ1A 4LSPL 5L6YH 2VAJA 5GSVB 2JEAI 1HSBB 1MCOH 2W88A 3CVBA 3NDYE 2EDNA 2WO4A 1R6VA 4L3ED 3QO1B 3GSRA 4OR1A 1ACCA 2E0PA 4A37A 1G7QB 1FGBD 1NCDL 1RUAH 3GSVA 2GJ6E 3QO0B 4NLAA 4DR3L 2EDMA 3AB0C 4OTXL 3GXTA 5A6LA 4YLCA 5DXWA 4EXPX 1H6UA 5BMFH 4R7XA 3GIZH 1RIHL 3ULAB 5KRUA 1X9QA 3H8NA 3IDIB 3OKOB 1BXUA 4OBSA 1TYEB 5IV2A 3DYOA 5J13B 2NUPA 1XBDA 4MTMA 3C08H 1AY1H 3FONB 5HDLA 3C2AH 3S15B 2DLFL 3S16B 2MMXA 4IU2B 1O6SB 4X64Q 1J9CT 3VFPA 2XN0A 1BLNA 4POGA 4FKEA 4OCMC 1JUFA 2I26N 3HN5A 3LEXB 5ANMB 4AY0A 5CJOL 4P5TC 4OLEA 5D70L 3WFHB 1EFWA 5BO1H 1YPZF 2YV5A 2R7EA 3HI5H 4WEEA 5AL8A 1G6RB 5DM73 2HG5B 4RFNB 1X6OA 5SX5H 1AXTL 1BAWA 4DN4H 1Q94B 2MGSA 3DMMD 3MKGA 4MN3A 3QJSB 5CV6A 4I2XA 5E6SB 4NFBA 4A3EH 1YMME 3OL2A 1DEDA 2CK0L 4AI7A 4E9XA 4X98A 2CCLA 3CU1A 3DUUA 4QYOA 3TP7A 4FYSA 2RTTA 5G4OA 5DZ9A 4DEPB 3S1NH 2VKWA 3WKNA 2VDKL 4A39A 4FERA 5E6ZA 5KNBA 1AY1L 3P73B 3ROLB 1M9SA 3PNWB 4KAQH 5C09D 3FB7B 4KK6D 4N25A 5B21A 3S8FB 4U6XA 4HS8L 1GVPA 2VLME 4XPAH 3ZYOA 4L0YA 2OL3H 2FZ3B 3QUKA 25C8L 3Q2CA 3B7UX 3FVQA 1DCLA 2K75A 1RODA 3DGDA 4LU5H 5T1KB 3QHZH 3ZZLA 5E1QA 1NCNA 2P8PA 5F72S 1QUPA 4S2SA 2WVTA 3I9GH 1DQDL 2QBWA 4GSXA 4MQTB 1OHZA 4GEIA 4NDMB 4CW1B 3G7TA 3RZOH 1NCIA 1S7UA 4N0CD 1TCMA 4O58L 4RISH 3BGMA 3JT0A 3ZUCA 2JB5L 5DS8B 1IZJA 3WIIH 1DGSA 2CO7B 2WNGA 1SYCA 3HVNA 4RMTA 1LE5B 3ELAT 1TPXB 4KI5C 4OZGA 2EIJB 4HS3B 5LGJA 1CQVA 2KMWA 3M7FB 4I65A 4K8JA 1OKEA 2Z3FA 4MHEA 5ESVB 1LT4D 4J6IA 3KL3A 4Y19D 3DOSB 5CWSA 5FYJE 3VD5A 4OGYL 4UAHA 3BW9A 4N4YB 5E2TH 5A3ID 1U8HB 3PWJB 5C70A 1GGIH 1I1RA 3BZCA 1KXTB 1WP6A 3U9UA 1HJBC 3W2DL 4BBRG 1MHHB 3MV7E 3QRBA 1CQYA 1GUTA 2JV6A 4HIEB 1WD8A 2AK1H 4FFWC 4X6EB 1LTBD 2XZQL 1HEJC 1KFAH 4LWCA 4OFKA 4QGUA 3SDXA 2B1OA 2XQBL 3G5VB 5IB5B 5LBVA 4J3BA 1G1KA 1N8ZA 4Y5VB 2KUTA 4NZ8A 1HHJA 4UQ3B 1NCGA 2H3NB 3T1FA 5IQ7H 5ADPL 2AI0H 4JFZH 1VQGA 1WE5A 3TFBA 2AJYL 1KULA 4PJHA 1KDJA 3TO2B 1U8OA 4OJAA 2X6LA 1IC0A 1Z9SB 4X6BB 4KU1A 1F11B 3BWAB 5EOCL 3T77B 3WU1A 1BPVA 4ISVB 4L18A 1E9QB 1O7DC 4N0UE 2RA4A 2JQOA 4AGNA 2K14A 1BJ1H 2YRZA 2WQ8A 1BCIA 3NN8A 1SY6H 4GKNA 4CDEC 1RV6X 5KS9A 1DCZA 4L5QA 2XSKA 1AGCB 2YEZA 3X13B 1HCZA 3S5LG 5CSBA 1Y1VB 3PUYA 3WNKA 5J5EA 4IDJH 5JYLA 3G4SA 3VWJC 1J0HA 4HC1L 4YHZL 1RUML 2CHDA 4MLIA 1SHXA 3H3VC 1ZKAA 2EVHA 4QXTB 2KH2B 3NA4A 1MF2H 1A1MB 5IMKA 5TE6H 4JG1H 2XRAL 4N2IA 1HX0A 1O6VA 3DUSA 4OM0H 1EZVY 1CE1L 4MA7H 5JJLA 3CXHK 2CW0C 3UGUA 2FEEL 1YQ2A 2G60L 5I5JA 2A1AA 1EA9C 2CO3A 3GXFA 3IJHB 3PWPD 2EUWA 4KHVA 4TSAH 4PJXA 1W6LA 4WVRA 5D1ZD 5EEWA 2VXUH 3PHAA 3A6CH 3GTVA 3HR5A 3HC2A 4Q4EA 5I15L 5C08B 2NY1B 1KBKA 2DQIL 4S1RL 4YR6A 5KVGL 1CFBA 4BZ2L 2KOLA 5D1XE 2J1KA 1F77A 2L3BA 3KWUA 4AITA 4JY6B 1IBGL 5AZEH 5FB8B 4XPFL 5DS1A 4FP8L 1KPUA 2WLIB 5DRZA 3VTAA 1QHQA 4A3FG 1M7XA 4MWFB 5D4JA 3U6RB 1S3RA 3OAWA 3TCLA 3LQAL 5T1IA 1HINH 3L54A 4FI7A 3G6DH 1A6AA 4CKBA 5F3HA 2XTIA 1AS7A 1QASA 3CZFA 2F68X 5F70A 2Q2IA 4LKXA 5EIIB 4IOFC 3FH7A 1EAPB 4BXVA 3RY6C 3VR3A 4ZW7A 1UATA 2MP1A 3ATDA 1A8ZA 4G6FD 5DF0A 2C9XA 3B9KC 1SM3L 1TQCB 4W9KC 4BZ1H 4YZFE 5IQ9A 5A6IA 1LEGB 4F58H 1G9HA 5IP7G 3ARXA 3MLVL 1OAJA 1ILSA 3BRDA 2R15A 3EH4B 3MV9E 2F8OA 1MCSA 3GTTA 4KQ4H 4PRAA 3VFPB 1W72A 1XCQA 4LF7L 4GQ9H 4JLRB 3QFJE 3QUMB 4G9FB 4XHJC 4PLJD 3N6RA 4UQAA 3MBED 4P46A 2X09A 3P11H 4ZO7A 5KNDA 2V7HB 3GD7A 3WKPA 2BNUA 1QZ1A 2EVBA 2JN4A 2H2SC 5DJCA 1BQRA 3WFEL 1FNLA 3MMEB 2YKLL 4Y5XB 2JA9A 3SPHA 4OFPA 3PWVA 4AT6B 3L3DB 1K0SA 2NLJB 2J2ZA 1BMGA 4N0YH 2QEJA 3KLAA 5EBLB 1FYHB 5AKSA 3BYTB 2B2WC 4M5YH 2Z93B 1FL6B 2EDHA 2M8XA 3WAKA 4JM4H 2VB3X 2K5WA 1ADQA 5AEAA 1MH5B 4DFIA 4TTDD 3RD4A 1N9WA 3SDXF 2ODIA 5CBAB 3GMQB 4RG1A 1MG2C 5D5ME 4FABL 1IXRA 3FRPG 5I16A 1C08A 2BIHA 3JXAA 4ONHB 3SDCB 1QB5D 2JKWA 2ESVD 3Q3GA 4M6ML 1FZMA 3KJOA 2PPCA 4R5XA 2C4XA 4ANXA 4YDIL 3VXMD 1S9KC 5DFWH 3GEFA 5JOPE 3S2CA 1CG9A 3C5JA 3QUZB 2MCMA 5BZXA 1WTRA 4PJ7B 4AIZB 3UO1H 1XCTB 3ZIYA 1EY0A 2Y0SE 3KLSA 4QTIL 3ICEA 4U6TA 3RGVD 3SK4A 1RKRA 2E8ZA 3FQWB 3LRLA 4GSDH 3ZHNA 3RY6A 1GGTA 3G04A 1MJUH 2F0LA 1F6AB 2WXKA 3OB0K 4FFYH 1D6VH 1LD9B 3DX8A 1RURH 1VIWA 2Y4SA 5I0ZA 1C5DB 5AG8A 2AJVH 2CSPA 3I2ZA 1E8WA 3M7GA 1P7KA 4IOFD 4LBEB 4U0QB 3UBXA 4AL8C 4YSOA 2EC9U 4B3VA 1YRKA 4JVWA 2WANA 2A6ED 1DJYA 1G7MA 1ZS8A 5T1DL 3S24A 4X5XB 1NUFA 7FABH 1MCEA 5E5RB 4PV9B 3TURA 1EGJH 2Y36L 1K3ZA 2L7JA 1A6ZB 2Q3XA 3SDXB 1USQA 4WJ5A 5EZIL 3OSKA 1XMQL 4K5LA 2VB2X 1XH3B 1ZA3B 5J4MA 5JXAH 2W5PA 5G5DB 2KCMA 1HHJB 4UQ3A 1E4XH 4ODHH 4P2OD 1H8LA 4CJ1B 3KCPB 5CMAA 3F5WA 4V2CB 4DK3C 4W81A 5C6PB