4J8QA

Crystal structure of a nigd-like protein (bf0700) from bacteroides fragilis nctc 9343 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
202
structure length
194
Chain Sequence
DGYSLGDIAVDWATVRVVGGDTYSLNADRWGTLWPAATAIPFYKPIDGQRVITYFNPLYDNYEGYDHAVKVEHNYNVLTKQVEDLTAENESEFGNDPVWVNKDMMWIGGGYLNVIFRQNLKHLVSLVRDMRATAAEGEDDGYIHLELRYKTYDDQANGAVSFNLNSLDLTGKKGIKVKLNSVKDGETEVVFNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF0700) from Bacteroides fragilis NCTC 9343 at 2.50 A resolution
rcsb
source organism Bacteroides fragilis
total genus 40
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j8qA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j8qA02
3K0YA 4PQXA 3QWNA 3K6OA 3NQIA 4J8QA
chains in the Genus database with same CATH superfamily
2DBLH 1Y7VA 2P8MB 4X7SL 2NY6C 1WFUA 3G5VA 4FTVA 1DD2A 4UILL 4JDVB 3LWUA 5DHMC 1ZIBA 1WQVT 3AB9A 4I85A 1EZUA 2JA6G 1NKOA 2W9LA 4R2GC 3O3EA 3T6ZA 4FD0A 4NGHH 5BOJA 1U36A 3CMOL 5K33A 3T2LA 5I2XA 5IB4B 2VABA 2B2YA 1G1YA 1L7TH 2YPLB 3HOGA 3Q8BA 4OLWL 1UEAB 2R23A 4U6YB 5ELOA 1AHWC 3AFQA 3MRRB 1S7QA 3A23A 3LH8A 1ZS2A 2B8FA 4Y0GA 5E6IA 3BSGA 4TSCH 2EIZB 4GIOA 1MCLA 4L9DA 1PX4A 3CFCH 4MD4A 4AV4A 2FIKA 1XTMA 3ISWA 1JSYA 2P5EB 3OB0H 4MCNA 5CGYD 1FVCB 4M7LL 5EU6A 3BD4A 5KBPA 1STBA 4KO6A 4P2CB 1JGEA 4FEMA 4JBKA 4KQ3L 4IHOA 3NFSH 4I2XE 3EYQC 5I18H 2P8PB 4KKQA 1L1OA 2E75C 2FEEI 1JGDB 2FXQA 1Q9WB 5G3LF 3DYMA 3J8F7 4XP9H 3TN0C 2GJZA 1RK0A 3T3ME 5EULV 2Y3NA 5EIQA 3UAJD 1XEUA 2EH7L 2DWDB 3QYCA 3RFZC 3ET9F 3HC0B 2GABA 4ZMOA 4PVMA 1FHGA 4GKSB 5IB5B 2R1XB 4DXFA 1XF2A 2N1TE 3LPOA 2Y0SB 1C16A 2CWRA 4WENB 3ULVL 4BELD 2XRQD 2WY3B 5HY6A 1S8DA 3WENA 3V9CA 3RJQB 1V7ML 3T3PF 5EPJA 3MLRL 9PCYA 1FL6A 2QPFA 3G6JA 1BD2D 5DJ6B 1RD9D 2SEBD 4HGWA 4GSXA 4K94C 1EA9C 2BWIA 5TE4H 3T0EB 2A6DB 4FI8A 4LSSL 4U1SA 1CR9H 2CH4A 5SWZD 1IAKB 3VRIB 4JC0A 4ZQ3A 3QDGD 5BS0B 4HIEA 4M1GL 5C1MB 2NUPA 2ZF9A 3JTSA 4K9JA 1ZSDB 1OP4A 4LCWD 5H8DA 3V4VB 1MY5A 3KLLA 4LDOB 2ED8A 4LSUL 4DVRL 3TU6A 1ZVSB 2H32A 2PNDA 4LCCC 4PGDB 4C83B 1H3PL 4HUKB 4X9YA 5B8CB 3SSGA 1F1GA 1VCAA 4A4IA 4LLQB 3V79C 4L29B 4WTZG 1EAJA 3GTNA 1X5IA 2H7WA 3W0WD 3ZDYB 3T4AC 1HS6A 4JHBA 1MCNA 3WNMA 4C55A 2ARJQ 1H8LA 1J12A 3DBXB 3IGAA 4OCYL 4Y2DB 4JJ5A 5AAWC 2N7SA 2BNRD 2YA0A 1HEJC 4MA1C 5BR8Q 1EWCA 4G6ML 2EKJA 3LN9A 1ODUA 3S36L 1F3DJ 4UDUB 3IAPA 1J18A 4NO3A 2Q5BA 5CFAA 5JXEA 5KSAB 3OKLA 4YWKA 3R0NA 4NZ8A 3L17A 2A6ED 2NY2B 4NM4H 3SKNB 1KB5L 1WIOA 4AYSA 2OP4H 4ME3A 2VLME 4N9GB 1JXDA 1E9OA 1P7QD 3QXDA 4JRYD 2RMNA 4WI0B 3VH8A 4KJWD 2JQAA 1HHIB 2AK4B 4DTGH 1KJ3L 3GHBH 4JFYA 3IJYA 2N3SA 3KWUA 5T5NG 2A6IA 3ZGHA 5D1QE 4XVUC 1DANT 2E8YA 2FO8A 4P46A 5KSUB 3GTPB 5HDQL 4E36A 1EY9A 5C0RL 1QSFE 3LRLA 3A4DA 3DX7B 5D7SL 5IGEA 3S2DH 4BZ2A 2JTYA 5F7YC 2AJVL 2HTKC 4FQIH 4XN4A 3OHMB 4KROD 4JFUA 2JKXA 3S35L 1WZMA 1LEKB 1KABA 2P5WD 4RQQB 2Q8AH 3QORD 5FPIA 3ZZ1A 1BOGA 1IKOP 3CV5A 1AH1A 2G5BA 1JXKA 3ULJA 4X65L 3LAFA 2Z93A 1BWMA 4DR7Q 2VMFA 2YC1B 1GGBH 1I8KA 3HN5A 3P4MB 4NN7C 4MQSB 2DQEL 4OUUB 3UJTL 2I5YL 3WFEH 3K57A 1UB6B 1DGSA 2VDLL 1JCVA 4ZQTA 5EA0L 1STNA 2R1YA 1ZYRC 5AW3B 2RCFA 4UV7H 4A3IH 3ZZQA 1JJUA 1PZ3A 4U7SA 4IK6A 5INCA 2R4SL 4KNSA 2ZTDA 2MCPH 3IPBA 3I6GB 1N19A 3SR1A 4IBZA 4LHUD 1S7XB 4U1JB 4ZTPL 3DX3A 4BXVA 4EI6A 1WZ1L 5LVEA 1TQUA 3F2UA 2GC4C 4G5ZL 4QRPA 3VNZA 4PVBA 1RAMA 2OZ4H 1NCVA 4ELDA 4QTFA 2X1XR 2ZKXA 2NY3D 1F18A 4YX2H 1NMFA 4ZI8A 5AVZB 2L4NA 1ZWIA 2BVQA 2XPGB 3H9SB 3OPUA 4IU3A 2Z8RA 2V8MA 3EZ8A 3I9PA 3GXMA 3MLXH 5BJTB 1DJYA 4L4VD 2DBLL 3VE0A 3NN8A 3FU6A 2YSSA 2H45A 1UZ8A 3R19A 4D0DA 2E2DC 4B9JA 1TCRB 1QPKA 2IADB 1MHEA 4NGHL 4NO0B 3IDUA 3EH2A 1L7TL 1BVLA 2FHTA 1N32Q 3EJSA 4NBZB 2PZTA 3KAAA 4GBXD 4WO4A 3RDTA 3QRFM 4QHKI 2DYPD 5L4FA 1U8OB 4JG2A 3Q2WA 1ND0B 4TSCL 4ATTA 2L04A 3CFCL 3CKIB 5E1AB 1U8QA 2FJHB 4XE5B 4DO4A 1UH2A 4OIAA 4IO9A 1M1XB 2PO6A 2X9XA 3NDZE 5I5JA 3NFSL 2YXWA 2WZPA 5DZLA 1XGQB 2Z4QB 4GRLD 5IYDH 5I18L 4XP9L 1HL4A 2MTAA 2DJSA 4HKJA 5K1NA 3QO2A 1GKHA 3SJVD 4AENA 2FEJA 3NEOA 5G5DB 3MVVA 4KPHL 1MCDA 1A7QL 1DJXA 2B63B 2Y1ZA 3PL6A 3Q8CA 4L0PB 5BRQA 3VFPB 5B7FA 1E30A 1FCCA 4QI3A 4CL7A 1GTNA 3MV8A 1AG0A 2K6YA 4KWUA 3BYTB 4LUZA 3LIZA 3TBWB 3VWKD 3LCYA 2CAKA 2BY3A 1OHQA 1UJ3C 4NPSA 3ZKND 3RZCD 2GVAA 3CXDH 3OJDB 3IDXH 4MQ7A 4H7VA 3U1PA 1V3JA 4LKXA 3RD4A 4B7IA 4QY8B 2ZUWA 4DR5Q 1WFJA 1J5IA 3D51A 1JCKA 4HETA 1OD9A 1YYML 1VFBA 2XXFA 5I9OA 4IRZA 4M5ZH 3K6FA 5GJSH 5TE4L 3WDJA 3IEAA 2HKHL 1U3YA 3DTXB 3SOTA 2PXYD 4QXUH 5EU7E 3WS3A 1NIDA 2VE6B 3AU1B 3I6LD 5AAMC 5H35A 1OXSC 3D31A 4DO5A 4WUUD 4KJOA 1KPVB 1WWBX 3A54A 1YNKH 1Q46A 1B4RA 4Z7NB 2LU4A 2A73A 4POYA 3Q9QA 4ZS6D 4Y7NH 1XIWD 4FDWA 4YPGB 3GHEH 3K8AA 1UEMA 1I7ZB 3I70A 1TYJA 2PF6A 5SX4I 3U2IA 4HUUA 5IMLA 4NKLA 2R83A 4P2CG 5EF2A 5LXVA 2VZUA 4K5VA 2EABA 3P75A 1HDMB 4HXAH 3EG9B 3OGCA 3NCBB 4NM4L 3O2DA 1ECYA 2IGTA 2OP4L 3GMMB 4AVJA 5LLIC 3VG0H 4IFDG 4BBSH 3KGUA 1NJ9B 5JZ7C 2JA5H 3TBVB 2J8UB 4TKOB 4PLKD 2BY1A 5DGQA 4FFWC 3EOBA 3LZNA 3OR7A 5AKRA 3OMNB 4CC0A 4DTGL 3UPCA 3GHBL 4PLOB 2Y0SG 2QGQA 1HSBA 3O11B 1WEJH 2PP8A 4YVNA 1F9SA 4Y1AD 3RWEB 3NAAH 2BP0B 5M5XB 3IDMB 4OKDA 3KWWB 3FONB 3WIAA 3OJMB 4XNDA 1Z47A 3PXJA 3DXJC 4N9TA 3AT9A 4XO8A 3VWJB 1LK3H 4ZXBD 2E2HH 3RIAF 2O6CA 4FQIL 4O51A 3HRPA 2AXWA 1NFIA 2HCIA 2MKWA 4N2FA 1B3IA 1OCZB 5DEGA 1FYTD 5BUAA 2Q8AL 1T6VN 5LBGA 4KHZA 1CLZH 3RDTC 2XHNA 4NEHB 3TTYA 2QEJA 4GKJL 3KPNB 3QYNA 2OSXA 3AREC 2YS4A 4F8QA 1TQOA 1K28A 1T5KA 1GGBL 5FJ8H 3CLWA 1N26A 4UTAA 1PZKD 3WFEL 4XMUA 4HH9B 5D6DC 3BDLA 2NXYC 2NYZA 1VQ4A 2O30A 4WQOA 2W9DH 5FA4A 1DFXA 3L8QA 1I50H 2BNQD 4JQXA 4LK4A 3MC0A 4XPAH 1YYCA 1DEEA 2YUWA 2EVHA 3SE0A 1U4EA 3DUHA 4UV7L 3TC9A 3WGUB 4Q9QH 2A9MH 5GROA 2C3WA 2PWFA 5I2IA 3L3HA 3DOIA 1NL0H 1YN6A 2MCPL 2NY4C 3RX7A 4RDQG 1KYOK 1P7BA 3RLOA 3MRQA 3TFKD 2B2VA 3D39D 1X44A 3HAEG 3VCLB 4DN4H 4F57H 3X12B 4AIMA 4N8CH 2OZ4L 4DP0X 5E7FA 2NVTB 3F5WB 4N1EA 3GP7A 3MV7B 4ETQB 5ISZE 3BVUA 4OJFH 3EBGA 2DEWX 4ZW5A 1G4MA 3T3MF 4YX2L 1K3BC 3FHWA 3FBKA 4Z3HA 4DFAA 2YU9H 2G9HD 1RJLB 4XMWA 5F96H 3CFKB 2XT1B 3MLXL 1D9KA 4W6XB 3DVFA 4JN1H 1X5LA 2XFXA 4OD2B 1VKXA 2E2IH 4P5KA 1F11B 4BY1B 3ZDXF 3HMXA 1LT6D 4UHVA 4R7VA 1DVTA 4O9HH 3RTQC 4G8GB 5FDWA 4MMYB 5BPPA 1NAKH 1YITA 4PWKA 3TO4C 2X9ZA 4HS3B 3EUUA 5F1NA 1K4CB 2KCCA 1FQ9C 2VDRH 2DQJH 1OGAD 3L45A 3UG5A 3BJUA 2V0AA 5JOPD 1AQ8A 4JY6B 2EIJB 2F7OA 5K59F 4GI6A 4J15A 2DJ4A 4IS6A 1UXWA 3DURB 4A7VA 1OY3B 4W4OA 4L6TB 3FCSA 3HS8A 2BE5D 1WCBA 1KLUA 3H0TA 5HJ3B 3JT0A 3BT2L 4FNTA 4NYLA 3WLWD 4DK0A 4MMXB 3T13A 1HQMC 2WNGA 4J3TA 2DF3A 3POHA 1OWRM 4EQOA 1GCYA 2X4SB 1I7TB 5DRWA 5BVJB 4WK4B 3ETTA 1KMGA 4PS7A 3NT0A 4U1LA 3WMQA 1ZANH 2FSEA 2APFA 3O3DA 4XCEB 2E4FA 1CHPD 5IODA 4PGEB 4RAUA 3VMPA 2ZE0A 4QB4A 4WJWA 3CXDL 5HVWA 3IDXL 4RGND 5EBDA 2OTUA 4FJZA 2L3BA 5CV9A 3IAQA 5SX5K 1AQHA 2MJ8A 1IBKQ 1D7QA 1R9TB 2VN5A 5CU5A 3NHHA 1ZT4A 4M5ZL 4EJ1C 1WSST 4AYDC 1PQZB 1P1ZA 2HT4C 5CIPH 3FFOA 5AKVA 2B4CC 4F7XA 2D3VA 4M00A 1M71A 4XAWL 1NEPA 3A4EA 2OMZA 5J6SA 1R3LA 3MGTB 3T77B 4IMLB 4D8PA 1X4ZA 1IV8A 3Q3GA 3L9RB 1QMUA 4QXGH 3U6RB 4HKXB 4Q8BA 3RPBA 7PCYA 5A7EA 1DLHB 3OQRA 4IRJD 4TNVF 1A2TA 2HFGL 2WLIA 4TQPA 4IQZA 3GTMH 4ZO6A 2RSNA 2KPNA 5E0QA 3GHEL 3RZDH 5IB3B 4HW6A 1BCPC 1JWMA 3EGDA 4PI2A 3QZBA 4APQD 1HEHC 2A2QT 1MJEA 2Y3AA 3CLFH 4PRNA 3GWJA 3D33A 4WTXA 5ESQB 4A2FA 2CCVA 1BZ9B 4ZX4A 2CR0A 1NICA 3GBEA 1NUFA 3FFDA 3W5NA 3W57A 2A0LC 2NVXH 2BK8A 3FO2A 4LKCA 1JV5B 3V4PH 3MJ6A 4HXAL 2QHRH 5BXFA 1XBRA 4W9DC 1Q9OA 3TVMA 4MRBA 4M93B 3AY2A 3DHQA 5AJ3L 2AXFA 2CHDA 2EXYD 3D30A 3HW7A 5LBVA 3VG0L 2MPVA 3FT2A 1CIDA 1OLZA 2B63G 4NXKA 4TUJA 3HR5B 2K8MA 3EYSH 4EEEA 4PG9B 2EJGC 1JK8B 1HILB 3RL1B 3TF7C 1Z9OA 4O42A 3BJLA 1EIBA 4XHJD 4HZAA 4UI2A 1U8CA 1H8SA 5D93C 3FO9A 2K5NA 4OHJA 3NTIA 1UQSA 1WEJL 3TX4A 3VXME 4H4NA 1SN2A 4AYGA 3GMQA 1IM3A 4LDEB 4GLVB 3QDJB 2HKAA 4L4TB 4F8MA 3D85D 5F7MC 3GMLB 5J13B 5CORA 3SK8A 4Y5YB 4LFCQ 3M7OA 1LK3L 3PWPD 4NZUH 1MFBH 4PIBA 1RODA 4WU5A 2FNBA 2VDMB 3I55A 2XACC 1YJWA 4S1DC 4N0UA 2EXDA 3RY6A 2F5AL 3T4YA 4HQQL 4JZOA 1CLZL 1J8IA 3KYNB 2Q3AA 3T0VA 3GXDA 3OW7A 2A83B 2V2XB 4U0RC 4P23D 3NRFA 5AVYB 2XWBA 1CE1H 3OB0K 1IGJB 4P5TC 2F8OA 4JGUA 3DVGA 3RWFB 3W9EA 2XC8A 4MNHA 1XMOQ 2MCG1 4FFYH 4H2AA 4XNMB 2L7UA 3VG9C 5EIIA 4ID6A 1PV4A 1ETA1 3ARBD 4PV8A 1HHHB 1XCXA 4JVUA 4Q9QL 2A9ML 4U1GB 4ZUUA 3UDWA 5BMFH 4LPCA 3GJEA 4E9RA 5IYBH 1JV2A 2YV5A 3FMCA 4RGOL 3MRNB 2O93L 3NQTA 4DN4L 5A7BA 4F57L 1DVFD 4POZC 4N8CL 1I7UA 2K75A 3UE0A 2BVOA 2FWLB 2HT2C 2UXTA 3L13A 3PJNA 3QXVA 3RNQB 5C2BH 3UABA 2CUMA 1Q94A 4G7YH 4OJFL 1LWRA 4O4YH 2V4DA 3EJZC 2VMDA 2JA8B 5FKPB 2IANE 4AE0A 1FZMB 3RZOB 5HHMB 5F96L 2O61B 2D73A 1NAMH 3MO1B 4JN1L 4QTHB 1N8OE 3NA4A 3G48A 4BINA 3X1NA 4X3KA 1IMHC 2IVFC 3LVEA 1IGYA 5E9NA 4WFEE 5I6MA 1GHKA 2EE0A 4I18B 3R06A 5HHQA 2Y4SA 4UB0H 3UH8A 4O9HL 5D1QA 3TASA 3NCXA 4Z7QE 1NAKL 4K9EH 4NRYA 2WWKT 1F2QA 4DAYB 1QSFA 2VDRL 2DQJL 3CJJA 3PWJB 1EHLL 2X4RB 4GW4A 4L8SA 4JOIA 3QIBA 3ELAT 3F58H 4LFAL 1OO2A 2YPKB 3H3BC 1PY0A 1KGJA 1DVUA 1LO5D 2LKVA 4Y5VA 4RGMC 4TXVB 3U9OA 4UP7A 1LTLA 1LK2B 1T7ZA 4JM2C 3K1KC 3SGEI 4BK8A 2VL6A 4GKKQ 5F9DC 4QXTB 5JOFB 4G43B 5DQ9B 5TF1H 2YTXA 4UINH 5B3JE 1KIPB 3ZR5A 3U1QA 5C07D 3VXOA 1NFDB 4JRXA 4GNXA 4WRLA 3PGCB 1IKFH 4IDLA 4IRSC 1M3JA 5DS1A 3B8YA 1SDAB 1ZANL 4GS7B 1IBYA 3QIWA 3FULA 4PRBB 2DW5A 3UEQA 4I4WB 2V9QA 3PHQA 1KGCE 5ANMB 3AVEA 3CH1A 4Y8DC 3S2CA 3HNSH 4ELKB 4NI3A 4CNIB 4KVCH 1UH4A 2MOGA 1NIBA 3AITA 3H3VC 4K5PA 4G11A 2M00A 1B4JH 4G6KH 5E6RB 2XQBH 2QZQA 3DWQA 3FQTA 3APMA 5SWSB 3QEQE 4NQTA 1USZA 4WW1B 5JORA 4A3BH 1EEQA 3ABLB 2C8NA 1FG9C 3TYFA 4F88A 3G9VA 1ZTXE 3DXAE 4QXGL 1CDJA 1W72H 4FQQB 4EIGB 1KC8C 1B9KA 1TFHA 2WWMC 4JM0A 1UJTA 4ISVA 3SPGA 2N4IA 1ZJAA 5IHBA 4MJ6A 2BSEA 3MNVB 1F3DH 2C3GA 1MLCB 5LGJB 2RA1A 2XQYA 4D2NA 2A74C 4A3LH 4YCVA 2FSDA 2VUYA 3P9MA 5DRNA 2YGNA 4A7GF 3BVZA 4ZT1A 4XZUB 1SJHD 2DQIH 5TE6H 1O7YA 2OMYA 3BOVA 1U91B 3QB7C 4IOFD 2QHRL 3F7QA 4V190 3FQ4A 3LPFA 1BBJA 1CQKA 2MGSA 4JFPB 4EZLA 3DSNB 1BV8A 2HVJA 1PF3A 1EQTA 3E38A 3ECUA 3EYSL 3LS5H 4JHZA 5CLYA 4JO2H 1BDOA 4R4BB 4U1KA 2XKUA 4LF4L 1OL0A 2VLJD 4WJ5A 4ZODA 4K3DH 4YEFA 5KYXB 4L37A 1IL8A 4MTKA 2EEDA 4IFDJ 3HHSB 1RIVH 3CMEA 1DJIA 2FQEA 2LE9A 1Z9SB 3LD8B 4HIHB 4OY9A 4W9JC 3KR3H 3V6FA 4AEFA 1IYUA 4NZUL 3FRPA 3IJEA 2WLKA 5D1ZA 1P5VA 2NX5B 1ONQA 3IN2A 3VFMA 2NNRA 3KXFB 3ZKMD 5F3BB 3FH7A 2R9HD 2WQSA 4X8JB 1SBBB 5HGBA 4HKZA 4JOIC 4QGTA 3QIBC 3KF6A 2BP8A 2IDCA 2GBVA 4HPYH 2XN9D 4Q97A 3NEXA 5A6LA 5HYQB 1D8LA 5HI5D 3TM6A 4G9FB 4P2AA 3MMEB 2H3KA 2WKOF 1CFQA 4PRDB 5AVSB 3QUHA 4EI5A 4NS0A 3BDCA 4D9QE 1G6PA 4JI7Q 3CD6A 4WI2A 4FFYL 1GMIA 3MRBB 1UNSA 1X55A 4KFMA 3BUYB 3T09A 2XU9A 5I73C 4DGIH 4ZFZB 1V3MA 4M1CC 4GNXC 4U3HA 3U9UB 4TULH 1C08B 2PWEA 4OZIE 3JUYA 2H1XA 3Q6FB 4OU3A 3BVGA 3GEWB 5AW2B 3V4UH 3QIWC 3CZKA 1NLBH 3O41A 2L1BA 1SJEA 2EO1A 3HPJA 3U9WA 4ANXA 5JHBA 3OM3B 1HTPA 1V3LA 5J89A 3GUTB 1CD8A 1MFEH 5D2LF 4DV6Q 5C2BL 4BH8A 4G7YL 1UH3A 2IQAA 5JOEA 1PZID 3CVHA 1A2UA 4NQSA 2YGOA 4O4YL 4KHTL 2K5VA 1E5BA 2VLRD 3WI9A 1L9QA 5EBWB 4AQAB 3UACA 3GB7A 1U3HA 3L3DB 3CDCA 1AGEB 2IHEA 5T1LD 4NQQA 5GS0C 3E5SA 2H3NA 1X5ZA 3FRUB 3S88H 1EUTA 2VDNB 1FE8H 4GN5A 2X28A 4D7PA 1TLKA 1PFBA 1TWFB 2EDQA 3ICEA 4UB0L 4BXSV 4XGZB 3D2UD 4K9EL 4EQPA 1LABA 2WC7A 2W92A 1E28A 2NDFA 4MSWB 5GS2H 5IREA 2EKSB 2J7LA 2ZUSA 1REIA 3BUTA 5D7IF 5E8EB 3RE0A 2UZYB 3F58L 4I1RA 4I9WE 4H2CA 4JQVC 5D5MB 5C0DB 4BV1A 4QY7A 2FUQA 1ZVHA 1R3KA 3TEXA 1MQ8A 3SPHA 2HP4A 2NSQA 3T8XA 4A7GA 3HG9A 5E9DD 1MQKH 3DARA 4UINL 5ITFB 1N12A 1N0LA 3NCJH 4NHCH 4CKVX 4E9SA 1PCSA 3B2MA 1ZXQA 2UYLA 4DNRB 5CBEE 1AKJD 2R2HB 1H0DB 5E23A 5KS9A 3QHFH 3IU4L 9CGTA 4E2OA 5E4WC 2IGLA 4WHTA 1NCBH 4W9LC 3BPCA 2ZTEA 1ETZB 2Y2WA 1A14H 4OFDA 2EIBA 3HBGA 4IQHA 4W93A 4QTIL 4QT5A 1SVBA 2AJSH 5C0CE 1JE4A 3HNSL 2A3TA 1VADA 3SCMB 3F7KA 2F58H 1IBGH 4PV1C 4X4XB 3REWA 1IVTA 1OT1A 2VXVH 1LACA 2JA8G 1B4JL 4XNAA 5I16B 3CHQA 4G6KL 2XQBL 4XT3B 1ILSA 1ES0A 2ZX6A 2J6EA 2JH2A 3HG1D 1OQXA 3LRSB 5B1JC 3UDIA 4WJ4A 4JS7A 5IGCA 3FN0H 4FQXC 4XVTH 4B9WA 3LKSA 1NCJA 1KB9K 1MF2H 1W72L 1NMAH 4KXCA 4BSVB 3GMPB 4FCHA 5GIRA 4A93B 2P45B 3KPQB 4NSKA 4OIIL 4AZ8A 3SD5A 2VQFL 1TZHA 2RFXA 4BZ1L 5KYYA 2QCPX 5E7BA 1R17A 1E3FA 2ROXA 2WKOA 3AUWB 2YD9A 2ENBA 4NRXA 4IKJA 4QWWD 2GSGB 2HUHA 2YD7A 4ZUWB 2JCCE 4HWZB 3X2QB 5EU4B 2PZWA 3MJ8B 2UWEB 1W8NA 1D7FA 1JNHB 2DQIL 1M7IA 1GZQA 4ULLA 1RL1A 2VSCA 4HJ0C 5ERWA 4APXA 3C60A 3HZKA 4MQXC 4PMEA 3IFDA 2JI1A 4POUB 1J6QA 4P72A 3C5XA 3KPMB 6FABL 2EDEA 4DR1Q 2H26A 3OWRA 4DUYL 1JP5A 4HMDA 3B7SA 5DXWA 3QW9A 3LS5L 1T04B 5E5LA 1IEBA 4JO2L 2WCSA 5D2LA 4DJMA 3EJIA 4FG6D 3BWAA 4DZ8B 4PR5B 1FZJA 2WZ6A 3DUSA 3VM7A 1ECZA 4V1DA 3H6MA 4A3MH 3BVMA 4K3DL 4OQTH 3ZYZA 4DGUA 4L8CB 5I0WA 1CBVH 4RRPA 2LFGA 1RIVL 3RWHA 3ESPA 1COBA 2DH2A 1NCNA 2YJQA 2GIXA 4JKKA 4Y4FD 2CM5A 4AUYA 4ZPVA 4NC0B 1CXLA 3KR3L 1WTGT 2HZHA 1N5AA 1Q72H 4K71B 1IBMQ 1QQDB 1MVYA 2F7RA 2AQ2B 3KPOB 1MELA 5F2FA 1JMXA 3S96B 3GTQB 5B21A 2OAAA 5E5MA 2QGCA 2EC9T 1HK6A 1H3UA 4F7CA 2NY0C 5D7IA 4BRVA 5MENA 3U25A 4ENED 2ZWYA 4FXGB 4HPYL 4L48A 3CHSA 4YN3A 2LFEA 1MCCA 1IBLQ 3UXFA 4LCVA 2R0KL 5ETUB 5AW7B 3F12A 1NIFA 5J6HB 5EF0A 1G7JB 3BMWA 3CGTA 3ZW3A 2IWKA 1LTXA 3MRHB 4ELME 1GRWA 2MP1A 3UDFA 1FF5A 1E4WH 2OR8A 4DGIL 3CBJB 1PEWA 4MDIB 1J5CA 1FL3A 2FBJH 1QHQA 4OKVB 4BGDA 3ZMNA 4TULL 2W65B 3ECQA 1KTBA 3CCHB 3IKJA 1JDCA 2ZKWA 2ITDB 5E8OA 2PYKA 1VB9A 3ARSA 2VXQH 4TNFA 4Z6AT 3UAJA 4DV3Q 1NLBL 4K7PY 4OM0L 4YZFF 3NK4A 3L95B 1JPST 2EYSB 1MAJA 4NXMQ 5JPNC 3M3YB 4MD0B 1T21B 1MFEL 4V0BA 3DOSA 4N3UA 2B59A 5IVXB 3O6FC 3HB3C 4I5BA 4RH4A 3UGUA 5KSAD 2CO7A 3PF2A 5C97A 2NW3A 3ES6A 1BW8A 2NY2D 1ETJA 5IGBA 2QEXA 4F7EA 1LE5A 4DAVA 2CUHA 2ZM6Q 1XR8A 1C8QA 2SEBA 4L1TA 5DD6A 4GQRA 5DCCA 3A8IE 1DUZA 5GZND 3S88L 3NRPA 5SWZA 4NUPA 2CLRA 3QDGA 1N33Q 4FQ1H 5CILL 2AK4D 3G5ZB 4JFFB 3TWYA 1PSKH 4FNSA 5E8NB 1A6WH 2VRQA 1FP5A 4OO1I 2R3ZA 1JJ2A 3HCVA 3S17B 3K58A 4QD2E 4LCWA 4Y19D 4BM7A 3I4OA 4X6DE 1E40A 4OAWB 5M3FB 3DJTA 4PSRA 4N85A 3RGBA 4XOCA 1E43A 2OMUB 2O6FA 1NWPA 1CXIA 1HOCA 2AQNA 2EIKB 1XF3A 4G4KA 3WKNA 1JI2A 2NNXA 3W0WA 2ZOLB 3FAXA 4LAAA 1IIKA 3LRKA 5IGGA 2BNRA 3V0GA 1OE3A 1MQKL 5C3IA 3NCJL 2WB1E 2DQFA 2MFIA 2OK0H 2VAAB 4JR9H 3VI3F 5DHYA 1WIUA 4YHKH 5KBNC 1VGKA 1UCBH 5JNYA 4OV6F 5M5WB 3EO0A 5C3WA 1NCBL 3ARTA 4HEPA 5F9JA 2ARWA 4OF0A 1LEIA 1YMMB 4N2GA 1K2DA 4OH2A 3VA2C 1A14L 1P7QA 1N7MH 2VOTA 4JRYA 2AJSL 3IGKA 1OT4A 4B27A 4PRPE 2J5LC 3AJ7A 4V2CB 5E3FA 2F58L 1IBGL 4ODTH 5EEXA 3BZ4B 5B38B 2LU5A 5ABDE 2VXVL 3ND8A 4NI6A 4PJ9C 3MRJA 3K7AH 2ATKA 1MCJA 3R2TA 4WTQA 4R90H 1D5ZB 3QFJE 4XBMA 3STZB 2ITEA 3P0VH 5LMNL 5DWUL 1SFOH 3RI5K 4EGVA 1FIGH 2NTFA 3FN0L 2IANA 4G71B 4XVTL 4A7SA 1BX2B 5BV7C 2P5WA 2E8ZA 2PPCA 1UFUA 1MF2L 4U1MB 1NMAL 1FD7D 2VMEA 4MYWB 4AC2A 1KLGA 2UUBL 2WW8A 3RLNA 3ECVA 1ULVA 3H9SD 3KYAA 1I7RA 3QORA 4HYTB 4WWKC 3WIHA 1BXTA 1SXBA 4BA1I 1AZCA 3VI4E 3TESA 1MCSA 2BVPB 2WUCH 4GG6E 1OIOA 1KT2A 2Q8TA 3C6SA 4NCDA 2W9EH 1D5BA 4ZKCB 1VQPA 5LWYH 3H7BB 4HS6B 4KTDH 3QP3A 5K1JA 3QFDA 3US0A 4RFNC 5L4IA 3AT0A 5EUKA 1UUNA 4DGYH 5KJ4A 3R2IA 1JWSB 2HRLA 3QS3A 1F6AB 3VFOB 4JY4B 4OX9Q 2O2LD 3SDXE 3S3PA 3HPLA 1WJ3A 3FT0A 5FYJE 2EYFA 1TR7A 4G1EA 3ZMEA 1E27A 2YJLA 2R7ZG 4IIQB 2XN1A 4FQLH 1VMPA 1CGTA 2IPUG 3K5RA 2YGPA 4J6RH 3J81E 5B7EA 4OQTL 4OZIF 1AR2A 3U83A 1CBVL 4HUWA 1TWGH 3D6CA 1MH5B 3VVWA 3MRIA 3B2VL 5DQJA 1II3A 5FO9B 2J2ZB 1JB3A 2Q3XA 4L4VA 2WBKA 1Q72L 2WV6D 2HX9A 1QVGA 1LTSD 2XZQH 1PZJD 3KJPA 1Y6NR 3D8MA 3OMIB 1FG2A 1OTUC 4U673 2RALA 1WBZB 4IUQA 5CNHA 5B1CA 5H2BA 4A93G 3L3GB 4GBXA 4PY8I 1WD9A 1QRKA 4ZJ9A 2SODB 3WHE1 2GBUA 1ORQA 1M05A 5D4IA 5DHVA 5IQMA 1T1YB 1JVLA 1T0MA 3X14A 3ZR6A 1E4WL 1KGIA 3J7AV 1NIAA 3CHPA 3CUPB 3RWJB 2FBJL 2BERA 2IFFL 1WT5A 2OI9C 2VNCA 4GRLA 4F7PB 1RULH 1I1AD 3VI3A 5L2KB 5CUSH 5F7EH 3I4MH 3U79A 4J23A 3SJVA 4AMXA 1PEZA 3KPPB 4D7BA 2YAHA 3PAVA 2W38A 1JRHI 3PV6A 1SYGA 3MRFB 4KC3B 4LMQI 5AKSA 1CU4H 1UWGL 2G3MA 4KJWC 2H1EA 4ZDHB 2J56A 3EAKA 1O7DE 2CPCA 3PDOB 4GKZA 2VLKE 3K74B 1HR0L 4NQCE 3RKPA 5J1AB 5DJCA 1IIIA 3B7UX 4DGWC 5J6GB 1J10A 1N2RA 3QJFB 3RG1C 4CBVA 2KBNA 3FU9A 2EYMA 2J72A 5EC2B 4U68A 4BE6A 4KROC 3VXRE 5IJKC 2KQNA 1EQRA 4FQ1L 2LR4A 4KY5A 1BXXA 1PSKL 2PXYA 5E94A 1F4XH 3DJSA 5CBAB 2RF4A 2V2WA 3QUGA 4K5OA 5DWPA 4JKMA 3RFRA 1AQDB 2GHZA 5LQBH 4PJIB 4Z3FA 5JW5B 4GUPB 4WUUA 2GKIA 3HA0A 4TPRL 1PLAA 1JZ7A 2B5IC 2EE2A 3MEFA 4JE0A 4UOQA 3WTTA 4PJDE 1XIWA 5F89B 1LDSA 2PNRC 4CMHC 3KPLA 4JB9L 5KWYC 3K2KA 5F7HA 3UTTE 5CJBA 1HI6B 1BPLB 2AEPH 2CDGB 1VQCA 3I4NB 1QNIA 4CU8A 1GH7A 1OE2A 3H9YA 1KBPA 1HHGB 4AQ1B 4L8BB 1T7WA 4JR9L 4EVNB 2OK0L 1U8LB 4YHKL 1GC1H 1VFUA 4YLQT 4AVKA 4BBWA 2X6VA 1UCBL 1D7CA 1N68A 5I5MA 2JCCF 3VX0A 4I48B 1F58H 3LXCA 4N0YL 4A76A 4YEEA 3T0XA 4Y9EA 1S5HA 2KZ1B 4TVSa 2XOTA 3K3QA 2R92B 1J1PH 4TTGA 1N7ML 1WCMH 2LTQB 4EVOA 3GSNH 5FM4A 2NY3C 3ZVVA 1BLNA 4ODTL 3QEHA 1CM9A 3IF1A 3J81L 1CFBA 2Q86A 5KG9B 2DNCA 3WN5A 2QLYA 1MG2C 4WKXA 5FR3A 3LZQA 5DJ2B 1YN7B 2YFNA 3PGZA 3PIQA 4KKRA 5EU7C 1K83B 1OAUH 5C08E 3P0VL 1HHJB 1AXSB 1S7WA 2X2JA 4JDZB 3JWNC 3QUYC 4X5XA 4ZXBA 5EH1A 1LWHA 1FIGL 1I82A 2BSCA 3MV7D 5F1SA 4RBPH 1LD9B 2G0LA 3C5ZC 5J56B 3MRDB 4F5CE 4QHLB 1FYTA 3K71B 5FV1L 2WPGA 2ZUXA 3SZKC 3NSWA 2JQOA 3TP5A 4GUQA 4E5XB 5M3FG 1CFTA 2VZOA 2WUCL 2Z4HA 2AJXL 3FHAA 5LGHH 5LWYL 3TREA 3AW5A 4KTDL 4NQUA 4XO9A 2APBA 1G8ZD 1A6AA 2J4XA 2BNQA 5CSBA 4DGYL 5CEYB 1BFOB 2NDGA 3ARXA 2EYOA 2CJ3A 2XZZA 2Q2UA 1TQSA 4KMUC 3BH8A 3L7EB 3ILPB 5GGRA 4LFBQ 3RKDC 3VXSE 1JHKH 3HNTH 5EFIB 1YQVL 4O2CA 4CHTB 4FYTA 2Z6FA 1KAWA 4PP2A 5C0AB 5T5FA 1FNUA 3HOVH 4YHIA 2ZD0A 3KBGA 4QF1B 3JV6A 4WDIB 3VRJB 3VWKC 1MZZA 3B9AA 1DYZA 3KYOA 2A68C 3RZCC 4FQLL 5BO1H 5IEHB 3IS1X 4WGVB 4J6RL 2KHJA 4RA8A 1D5XA 4XNQB 2WLHA 1IKLA 1RKRA 4K14A 5B38G 3TNNB 4GAJH 2VH5H 4YSDA 5GISH 4HCSA 4FA7B 4P48A 2EIEA 4JI1L 2PXYC 4OZFB 3CQQA 1AKPA 3SIKA 1C7YA 3ZUNC 3ZRSA 2XZQL 4NC2B 1MNNA 1HE7A 1N8ZB 5HVHC 4BWWA 4K4KA 5CP7B 4BDVA 3PWLA 1YY8A 3UERA 1Z1WA 2IH3B 4MB1A 1ZLWH 5GGQH 5D2NB 1JK9B 1FFOB 1OGAA 2YPLE 4BXXH 3LPWA 2ZYHA 4AJWA 1ZT7B 3TA3A 4AMWA 2NZ9D 3IJSB 3SDDD 2CK2A 1JVKA 4FXDA 3GTVA 3IAYA 2BCMA 3OKOB 4MMZB 4U6HB 1MHWC 1LO2H 1ZE3C 3SK5A 2C9AA 3CFMA 3M46A 3RUGF 2P5EE 2JKTM 5AOIA 1PG7X 4X6DF 1Z5HA 1ZA3A 5I24A 3I6KB 4HX1A 1RULL 3KYMB 4MZIA 5CUSL 4HLZG 5F7EL 1RK1B 2PW2A 2F0MA 5DD0H 1H6TA 4GRWB 2D5DA 1OV8A 2JCCA 4JI2Q 3SEBA 5DURD 4X6CB 1I5FA 4PLKC 2E7MA 1SGKA 3H1ZA 1HE8A 3HAEH 2B77A 4PBWD 1INDH 3QAZC 4PLNC 1NEZA 4W4NA 2CCZA 1BZDA 5TD4A 3U6XS 4AM0A 4IJ3C 4UQAA 4ZAKC 4FQJH 1IU1A 3V5DA 2Y0SE 4QHKJ 4HMEA 1T9HA 4NZDA 5C0IA 2KJXA 3RL2A 1GKEA 3U2JA 4ZXBC 2Z65C 5D7HA 2YPVA 3EIFA 3ABZA 2I7SA 1DL7H 3RX5A 3T0EE 3EYFA 4PWEA 4G42B 1G7IA 2PNHA 1MOEA 2NRDA 3EW3B 2WKDA 1I3GH 3AB0B 3A55A 3GTLB 1F4XL 4MBOA 4QRRE 5B1KA 3V7AG 4DPAX 3KDFA 1G0YR 32C2B 5LQBL 4TQEH 1CGYA 2F18A 3P3TA 1MFMA 2BSRA 5BOPA 5GADC 5KYUB 4YSEA 1FNGB 1TMCB 4L4TD 4LIQE 5ICYB 3GC3A 5M5YH 3VFNA 2ICWI 3KBEA 3SGKA 4FVMA 1RFDH 3OKEA 4PJHF 1PFCA 4JRLA 1Q9LB 1EY5A 1KDIA 4F8PA 4APQA 1QILA 4IGBB 1TEYA 3S34L 3IYLW 2AEPL 1CYGA 1HCVA 2PCPB 2CKBA 4MD5A 3WSQH 3D3VE 3ARGD 3ZYYX 5I76A 3P1VA 1S5CD 1XBDA 1NGZB 3GKZA 4IBTA 4TNGA 1GC1L 1Y0LB 3APNA 2BVUA 2K8QA 3ZHFA 2K45A 3NUCA 1NCUA 1KXTB 4R96A 2P3YA 1XCQA 2DOCA 1F58L 4X7TA 4AH2B 3IDJB 2AANA 5KYLA 5HYJE 4MX7A 4GLXA 1W0WB 4R5VA 1F90L 1UKSA 1CLCA 5F7KC 5IROD 1J1PL 5I1JL 2G5UA 3PPEA 5I1AA 4ZUJA 3GSNL 3QUZC 3SKOB 4H5SB 5I1CH 4C4KO 1XGTA 1SJMA 4LJZC 2PTVA 3MFGB 1NH6A 5SV3A 3SO3B 1OZUA 5JIMA 3S2HB 5IR1B 2GK0B 3D85A 4WNQB 1BGXH 3CPWA 3HG2A 1OAUL 4XRCA 1E0BA 5DRZB 4X3UA 3PWPA 4NKIH 5IQNA 1SDDB 1IFGA 2PCYA 3PWUA 2ZAGA 4L3CA 4GQPH 3P2DA 4PJBA 3OAZH 4QRSB 4WFHD 1AXTH 3MTRA 4NQDD 4WVRA 4Z3TA 4AIZB 3WU1A 1U8PB 3AS2A 3M8OH 5HHMD 3ZSTA 3E9TA 2CIIB 1N4XL 4JCMA 3SKJH 43C9B 4H1LB 4P3WA 3U48A 3UGEA 4ACTA 4P23A 3MGOB 3FPPA 3WV0A 5CGMA 3V6OE 1ESOA 5IT9c 1P7KA 1KFAH 5LGHL 2BE5C 1AO7B 3RUGA 5C0BD 3HNVH 3N44B 5L0QC 4PCSA 1W15A 1YVCA 1PKQB 3WLWC 1C12B 2CU9A 3T0WA 3NJMA 4JG1L 5FKAC 1TTAA 3I4NG 4F3FB 2CWAA 1T1ZA 3ARBA 4KKBD 4XXDA 1F77A 1MXGA 1U3NA 4FQCH 2MQHA 3HNTL 4QHMA 2QPEB 3L4WA 2LGNA 3M85A 4M4RB 5DUPH 4YY3Q 2E5LL 2ERJC 1RZKC 4UUJB 4UT6L 4GW5B 2ASBA 4LFHG 4X7EC 5EN2B 5BO1L 4D0CA 5JHAA 1SXZA 2V5RA 1CKNB 1DVFA 2HKFH 3CVDA 4RGNC 5AZ2H 2R92G 2K6WA 5I17B 4FHBD 3FDTA 3KE0A 2TMPA 5J1TC 2NY6B 1T1WB 2K9FB 3W82A 5ICZB 5JW4N 1CBJA 4GAJL 2VH5L 5GISL 4R2GB 1EEZB 1PH7A 1VQDA 2UY7B 5HI3D 5F9OH 2ICES 1AJ7H 4R8NA 1CYXA 2IH9A 2F0TA 5DLQE 4O02B 5D72H 1SPDA 1A1NB 1AHWB 1GA2A 3RVUC 4DUVA 3OOCA 4NXNQ 3G04A 4F2FA 1NSNS 4FNFA 5FC9A 4IRJC 2XWJA 4LLUA 5GGQL 3B9DA 3QNXB 4YDVA 1OGTB 1NGWA 3J7HA 3SGKC 4PGJA 1OF2B 1AGDA 4MWFB 4JN2B 1XMQL 4PJHA 3WWVA 1YC8A 4APQC 4E5XG 1LO5A 2FT8A 1UWFA 4IPHA 3TT3H 3GMOB 4UAIA 1LO2L 2BXZA 3KJ6L 5DFWH 5ESAB 3TN0B 1EUUA 4EN3C 2A6HC 3G5YA 3VQ2C 1AD0B 2HJLA 4RMUA 1ETB1 3M4OH 3J81j 3RFZB 3DDGA 3NK9A 4Z7WB 2OLDA 5F8RC 3QOLA 2JKJA 2WO4A 5CR3A 2J88H 5DD0L 2AQ3A 3ATFA 5C07A 2EXYC 1TKWA 4NQVB 5F0MB 1B1ZA 3K81C 4RAHA 4OB5H 3ROOB 4B9ZA 4JI4Q 4W6YB 1O9VA 2PYFB 4JAMA 1FO0H 2VERA 4LDLB 4XHJC 5LO7A 4RNRB 1INDL 1GOFA 3OHXA 4TUUA 4HJ1A 3AACA 4GIAA 4AIXA 2AJ3A 2CKZB 1AD9A 2GJRA 3DXAD 4U6TA 1MG3C 1R5VB 1TDQA 3ABGA 1ORSA 4ZUVB 4BFKA 1G9NH 3O3BA 4C1NK 4Y9CA 4LLVB 1DL7L 1P1VA 1ZPLA 4B3ML 2PMZB 2XIDA 1J8RA 3N0PB 4LCCB 4PCKA 4OZFG 2APXA 1JHTA 2QDVA 4K15A 3AQZA 1XR9A 4TQEL 4OCSH 4K0KQ 5B7MA 4ZOEA 3F6LA 3T4AB 1MVUB 1FFQA 5AKTA 1I8IB 2HB0A 4P23C 4AJ0A 2O6PA 5D7LB 3H6JA 1CZWA 1R4PB 3A24A 3DGDA 4MA1B 1RFDL 4Z0XA 1J9OA 3NIDE 4MZ3A 2DY8A 1KXVA 1GUTA 2IDTA 3DGGA 3WHXA 2NX5D 5KOMC 1WTHA 2JEAI 1TJXA 4LF9Q 2R29A 5FYKH 4FF3A 4LLYB 1YPZF 3WYRA 3INOA 3QDMD 3FUIA 4ZFFB 4PJFE 4S0SD 4GKOA 2L8AA 4YR6A 4XCNA 1SDYA 3GTOB 3NOIA 1SJHA 5F2DA 3RBSA 2NZ1D 4ILWA 2WXLA 5A2AA 1PAZA 3U36B 3IL8A 1FYCA 5C9KA 2C9VA 4WTZA 1RSYA 3K5SA 2G4GA 4XTRD 1RKNA 3O81A 1UGNA 2UUAL 3QUXB 4U6XA 1KBGH 3AXLB 4JFXB 4HJSA 1F4WL 3GTTA 4Q4IA 4HZLA 4C54A 3U2SA 1EFID 1FFPB 2J8UE 5I1CL 4F8LA 3OJVC 2VLJA 3Q01A 1KCRH 4HLJA 4XB8A 2YZ8A 1VF5C 3TNMA 2NVTH 3LEVH 4AGQA 1QW9A 3X3MA 1QBAA 4ZO9A 1IKNA 3NSDA 1QFHA 3KPSD 3N9GH 1EU3A 2VABB 3HVDA 1BGXL 2ZKYA 3MDJA 2R23B 3B7RL 2BW5A 3L9YA 5I2YA 4NKIL 2JJQA 1W6LA 3RWDA 1JPSL 1KDJA 1N59A 4LF3A 2JJTC 3P0GB 1Q1BA 3QQDB 3EH5B 4MD4B 1AXTL 1F5WA 4DV2Q 1IAOA 4KOCA 3SDCA 4MNGB 2BOBB 4NN7B 3M8OL 3CDFA 5AB9A 4QO1A 2DI7A 3BKYH 2KDYA 5FW8A 3MLZH 1JZIA 3GSRA 4AUJA 4A7UA 4NO5A 2NUTB 3VXTB 1PZ2A 1X9RA 4R0LC 1MWAB 3FQ2A 4H8WC 5F7BA 4CVWA 3OIPA 4UU9A 2JQMA 1KFAL 2NBFA 3UYPA 5I8KH 5I1KH 1XAKA 1ZKOA 3HNVL 2OMWA 2XXCB 5FFGA 3H3VI 5GGVH 3RGVA 2TRHA 1CMOA 4R4QA 1I8MB 3BP7A 1KLFA 1C16B 4HAGA 5IJVA 4DU9A 4FQCL 4AL8H 2HRGA 1S8DB 5EKLA 1L7IL 1TQCC 5DUPL 3E3QC 1IL1A 3L3IA 4LSTH 4M8QB 3UTTA 5FHAH 5D4HA 3G6JB 3OHXC 2IWFA 2XIBA 3GBLA 5HYEA 1EQWA 1ZVNA 4KNQA 2GJ6D 3HOWB 1PFNA 3EGXB 2HKFL 4U1SB 5AZ2L 4IOIA 3B9KA 2C3VA 4X66L 3STBA 5GZOC 1I9IH 5LL6X 1HKLL 2W60B 5C6TH 2VLRA 4AGNA 4L1LA 3KOJA 1AP0A 1T5WB 4MJ2A 1Z9FA 1DSWA 1T0NA 4B3TQ 4W1TA 3UO1H 5J06A 2OSWA 5F9OL 5BZZA 2BLFA 1AJ7L 1PA6A 1ZV5A 3VFTB 1T20B 1KJMB 4F58H 4RCAA 2VITB 2VUMG 4FG4A 3MZGB 3NDYE 4K7PH 4D3CH 3JWOH 1BIIB 2FX7H 3D2UA 3O2WL 1HZHH 3IGAB 4JI3L 4YGAB 3T6VA 5I6XC 4NKOA 3Q8AA 4G8GE 2KZKA 1L0QA 3DMMA 4XH2A 1YVLA 4MB5A 5EBCA 2PW7A 1SVZA 1P4LA 1WC7B 3K6NA 3RWCB 4CADA 2R8SL 5J22A 3VSQA 2AW2A 1KEMH 3TT3L 4XHQA 3BVWA 1YPZA 4ONGH 3A8JE 4TUKH 1IRAY 2FWUA 4K5NA 1NR4A 4OO1G 4UM8B 4BIKA 4WIQA 1EAPA 1H15A 4IOFC 3L1OL 4W9ZA 2QVKA 1HFGA 1TZIB 3CDGA 1S9VB 2J88L 1J88A 3QSKB 3BDBA 1G51A 3UMNA 1UJ3B 2A1WH 4OB5L 1AKJA 3ISYA 4FMFA 4RETB 1TF4A 3ZDYF 1LP9B 1FO0L 3ZBMA 3JAME 2VAJA 1PVHA 1EH9A 2P44B 1XVSA 4PJ8D 4PJCE 2YD8A 1SSOA 4L8DA 4XE0A 1JXFA 1CK1A 4ZSOA 3T2OA 3PJSA 4GAFB 2OA9A 1OE1A 1G9NL 2IWGA 3B4NA 4X6FB 3DV6A 1GUWA 5A16A 3D25A 1FNFA 3H55A 2OKMA 5HGDB 3HG1A 1FFNA 3WO4C 5MI0C 3BN9C 1ET7A 2A6JA 1EVTC 2CXGA 2VW9A 4RBPK 1QEWB 2VNUD 4YOKA 5C3TA 3SQBB 1YJNA 2R9HC 2AUJD 2OX5A 5LAXB 4H8UA 4TLTA 4XB7A 4ZMZA 4OCSL 1NUCA 3WFDH 3PNWA 2GI7A 4OZGB 2DQTH 4ODUB 2XN9C 1OTTD 2VDMH 5D1XC 3NBHB 1MI2A 3QUKA 4Y2NA 5HI5C 3O9WC 2VUKA 4PJ8A 1U4PA 2P8MA 1KBKA 2OTWB 3OMGA 2XY1A 2OTLA 1KB5A 3IFLH 3SY6A 4JDVA 4DNLA 2WVSA 2IJ0A 2IG2H 4PS4H 5FYKL 4TNWK 5D65A 2WBJB 4EI6B 1CQVA 4H7BA 1BJ1J 4J7RA 5IB4A 3TBSB 4U6YA 2BCOA 2YPLA 4JKPH 1TZAA 4Y2LA 5EBMB 4NPYB 4P4KD 4U4IA 2BCKA 3MRRA 2X4NB 4NUJB 4BFJA 3IMTA 3TV3H 4JFHD 2V2TB 4NQEE 2EIZA 4AV0A 4FABH 3JC66 5FLXc 4YHHL 2QSVA 1KBGL 5DO2D 2P5EA 1F4YH 1FVCA 3EN2A 3L5WB 2DB8A 3VDAA 1X3QA 1KGWA 4YL4A 1II4E 1SN0A 2P8PA 4PGBA 1JGDA 1Q9WA 4C3JB 1H19A 4QF4A 1ITCA 3LEVL 1MHEB 2UZPA 3ZYIA 4Z7VA 2DWDA 3N9GL 5CJXA 1BYOA 1BVLB 3QDJE 1UM5H 4Y4FA 4PJGB 1SDFA 3W37A 1EO7A 4GKSA 5IB5A 2R1XA 2X6AA 2NN6I 2Y0SA 3AREB 5C86A 2K4KA 3N6YA 4HT1H 1T2XA 1YECL 2WYHA 4W6WB 3BAIA 4K3HA 1ZLWK 5IOCA 1L9NA 3SQOH 2HHHQ 4GP4B 1JYXA 3BKYL 3F6IA 3RWIB 3DHPA 3MLZL 5FFOA 3HTLX 2N78A 1A6VH 2XKNB 2A6DA 4RFOH 1Y18B 3VRIA 1IAKA 3N1PC 4KRNA 5BS0A 1WA1X 4LCIH 5I8KL 2QTEA 5I1KL 4Q0FA 1T0PB 2XNAA 3VXUD 5LJYH 1F3JB 3ULVC 3ASNB 5GGVL 1A2YB 2E2JB 1ZSDA 4ZYKB 1JOKA 1VQBA 4K5WA 2NY4B 2XN2A 3MV8B 3V4VA 2BZ7A 1ZVSA 2BMKB 1LMKA 3G6AB 4PGDA 4ANUA 1I4FB 1S3RA 1XMWA 2WLZA 2ICWB 2YWZA 2V1CC 3QI9D 4KQ4H 1SY6H 2EQDA 4LLQA 5D1ZI 4AL8L 4LK1C 4L29A 4YS4A 5T1GA 2H0FA 4LSTL 1G7LB 4GSDH 1JT8A 2X70B 5FHAL 1R9FA 1BEYH 3DBXA 4Y2DA 4Q5VA 2WNKA 1ANUA 5F1OB 3JAML 5DD5H 4A6YB 3FCGA 4YHPB 4UDUA 1CUOA 3II1A 1I9IL 4R9HA 1CDBA 3S3BB 1J0IA 4U05A 5C6TL 1XPOA 5KSAA 2F8XC 2RDFA 2EYTB 1JPFB 1MCIA 1QYGH 3AUVA 4LVNC 3UO1L 5BZDB 3RTQB 2K50A 2W0KA 4N9GA 2QQKH 1C48A 1YMMD 2G0KA 3B56A 3TO4B 3ESOA 3D18B 5CHNB 3GRWH 3ITPA 3B83A 4WI0A 4F58L 3BP6B 1F0LA 1HHIA 4HIOA 2AK4A 2D2OA 4K7PL 4D3CL 3JWOL 4DESA 2FX7L 2VM4A 1HZHL 3NZHH 1HWHB 3GK8H 5KSUA 1S72A 3MA2B 4Y19A 1M57B 2ZWZA 1SXNA 3O8XD 3QQ4B 4PWFA 1FORH 4UYQA 4R97B 2B8OT 3MEHA 3DX7A 4R4IA 2IAMD 3G7TA 4QWWC 3QCUH 4MCMA 2COVD 1KEML 3I9AA 4B50A 4Z9KB 3DWPA 2RH0A 3DROB 5IMKB 4ONGL 1LEKA 4TUKL 4RQQA 1S5DD 3I3DA 1VEPA 1VQ5A 3SGDI 1AACA 4FQ2H 2AITA 1FJGQ 4PRPD 3S98A 4Z7NF 1BR9A 2A6KB 3PCYA 4ORGB 1HCZA 2D0OA 2BXYA 2A1WL 4LOUD 1HSBB 1ROCA 4HJUA 2YC1A 3BAKA 1FLTX 3P4MA 4G8AC 4OUUA 1U6AH 5IESH 2EDGA 1UB6A 2COQA 3LHAA 4FG6C 3QFJD 4B9FA 3CXCA 2JKLA 3RYMA 4DUZL 4HWBH 2NQDA 1OSZB 2VN6A 1JWUD 3D6WA 1EGJH 1NFIB 2JIXB 3M1BB 5ANME 3MACH 3FTSA 5GRZA 2JV6A 4Y4FC 4P2QE 3JV4B 3I6GA 4C8XA 3PQIA 4U1JA 3R7QA 2IXQB 5I8OH 1TYEB 3S1NH 1NM9A 1AQMA 2GI0A 3L4UA 1URZA 4OCXH 1F3RB 2J21A 3OAZK 2J8UF 1M2OA 4NWTH 5EOCL 2AQPA 4GN3B 1KNAA 2L12A 4EIUA 3WFDL 4ENEC 1KTDB 2DQTL 5CZKA 4N1CA 1BCPB 2XPGA 1G1CA 3BPOB 3H9SA 3HZ3A 3LNNA 2TSAA 3DX1A 2K5WA 3Q2CA 5BJTA 2H8PB 1I9EA 2X1OA 2JWYA 1IBDA 3IE4A 2XNAC 3SE3A 5EZLB 4PS8A 1WTOA 2OJZH 2HLEB 2IG2L 3I2CH 2CG9X 1TCRA 2IADA 3MRQB 5E8PB 3S15B 3HG0A 3NWTA 2WVTA 2FGWH 4NO0A 5CEZE 4J6IA 4IUTA 3L2PA 4JKPL 5B8CC 1F42A 2VZ1A 2WJ7A 3MUUA 3Q05A 1PNDA 3TV3L 5B22A 2K32A 1U8OA 4PBXA 1ND0A 4FABL 1CI5A 2EP6A 5D93B 5DJDB 5E1AA 4C56E 2FJHA 2O26U 1F4YL 5IV2B 2P5ZX 2OPCA 5GQOA 1GOZA 4DV7Q 1FVDB 1M1XA 3WO3B 5I6NA 3CSPA 4K5XA 1AS8A 1XGQA 2Z4QA 2EY6A 4WUKH 4XVOA 5L2KD 3IJ7A 1KXQE 4XX5A 3HE6D 5G5DA 2QQQA 1DJHA 3VFPA 3FOLB 1UM5L 4XMPH 4B3SQ 5GZNC 4N2KA 2VM9A 3DV4A 1EDHA 4YLCA 5CSGA 4JANB 3KLWA 1JORA 1RIPA 4JPWH 4U0RB 2XPYA 4IS6B 5TGBB 4PRIE 3X1EA 1VMCA 1AE3A 3BLBA 1TQTA 3S97C 1EFQA 3RJDA 3C46A 1PDKB 3SQOL 3K6IA 2C7UA 3QC5X 4DV4Q 4BJLA 4P5TB 1WCBB 4QY8A 2E9GA 4ZD3H 1KLUB 1B2TA 2ZF8A 3HG5A 1QCBD 1A6VL 1X9UA 4RFOL 5LCVA 2I5MX 1JG9A 1KTCA 3KVQA 1GM5A 2AABH 2UVEA 3DTXA 4OFKA 4PW4A 5ABAA 3WTYA 4YBQD 1M9SA 4LCIL 1JTTA 3AU1A 4FYRA 4OZHE 3MLSL 5AYQA 2DI9A 3F65A 3EADA 3O3DB 1KPVA 5F3HB 4X6BB 2VLKD 1XH3B 5INDB 1NMBH 4WI3A 4UTBL 5AD0B 1SY6L 2WIMA 2FLMA 1ACXA 4YPGA 2FR4B 1I7ZA 4GSDL 1B9ZA 2VQ1B 4H88L 4X5QA 1BEYL 3TJHC 2R1WB 2BHZA 4KZCA 5I19H 2H1PH 4X7DC 3V0JA 1BHGA 1S9KC 3VD7A 1NNXA 2R7ZH 2GBTA 2NR6A 3OZ9L 3TIDB 5BNXD 1WO2A 4PD4J 3HS0C 4EOWH 2WVUA 3VYOA 1HDMA 2NPLX 2OMZB 2QDWA 4QIWB 4XYOA 1V55B 4C3JG 5JQIB 1QYGL 1HNZQ 3MN8A 4MN3A 1J9CT 2WMPB 2GUOB 3MLYH 1ZT1B 2QQKL 3MGAA 4QNPF 1NJ9A 4BQ9A 4P0DA 3TBVA 2WLIB 2J8UA 1WZAA 3GRWL 4AG4H 5LHY1 5BQ7B 2KMWA 3EXLA 2ZOOA 2WQRA 5DZNA 5DFTA 1KC5H 4NX0A 3NZHL 3O11A 3QULB 4PRNB 4RGMB 3GK8L 3RWEA 3TURA 3B3IA 4H8QA 3IDMA 3CU7A 3KWWA 4JM2B 4XMKL 4QL5A 3RILA 3FONA 3PWVA 2V7HB 1FORL 4J3XA 4F80A 3VWJA 5AVQB 2GTWB 4A93H 2P1YA 3MUY1 3QCUL 4ZS7H 4PG3A 1A6UL 1Q9OB 43CAB 3LYRA 4AKPA 3U46B 3L81A 5E24E 4OD3H 4DUXA 2OMXB 3AG2B 1BF4A 3FH8A 4IRSB 4OT1H 1YO4A 2FNWA 1AC0A 4FQ2L 2V3FA 4C3HB 3FQUB 4B7LA 4HG4J 3FF7A 2B1HL 3GIVB 1RTNA 4E41E 3C08H 3VMNA 1ID5I 2R0WH 1U6AL 1XH1A 1E7ZA 5IQ9B 4HMIA 3P02A 1LHZA 3TO2B 1Y8OB 1RY7B 2X53A 1T89A 2WTOA 4DR7L 3ULUH 2IBGA 5T1KB 4P2RE 4XP6H 3FW6A 3OX8A 4XMVA 1EGJL 3MACL 1CXKA 3TWCH 2R2BB 3BVXA 4JPSA 2QL1A 3T4YB 4JZOB 2PZUA 4CUCA 3QZPA 3VFUB 2QHLA 1HH2P 2Q7AA 1CFVH 2ZAIA 4OCXL 3VCLA 1JZ5A 5C3EH 3X12A 4KI5D 2H2PD 4NWTL 1TWAH 3F5WA 2XTJD 3MV7A 2R93B 5TDOB 4ETQA 4L3EE 2OCJA 5AAPA 2GW5A 3DVGB 2HT3D 4R4NC 2A74B 1RJLA 2EY5A 3FTUA 3CFKA 3GTQH 3OZLA 3B43A 3J80L 4HCRH 2HVBA 4OD2A 1S5FD 3VXSD 3SGJC 1F11A 4ZUUB 1LDPH 2OJZL 5GHWH 3PQYB 4QQBX 1UXMA 3I2CL 3GJEB 5I74C 2QJDA 2AC0A 2FGWL 4M48H 1IYJB 4MMYA 3WNKA 3QH3A 4CBPA 3MHBA 3AG3B 4HS3A 1I1AC 1K4CA 5GQBA 2UWEE 2C9RA 1WJJA 1STYA 2ZYIA 2EDMA 1CVRA 4ZK8A 3U1SH 1BSIA 3DURA 3MNMA 5F21B 5C7ZA 4H0HB 3VGAC 4HDIB 3S3JA 1E2VA 3ULUE 2CWPA 3VTAA 5HJ3A 2F0WA 1VQ8A 3IPEA 4WI5A 5EN3A 1V1QA 1RHPA 7CGTA 3M3YH 4WUKL 4MMXA 5EEWA 2RA4A 1PIGA 1MW0A 3R06B 4YHYB 1TVDA 3C75A 4EXPX 2WWOA 2X4SA 1I7TA 4FP8H 5BVJA 2J55A 1BREA 4LSRH 4XC3H 4XMPL 1PS3A 5CJ5A 4XCEA 2EDRA 2UXGA 3GSVB 4PGEA 2JE8A 2X3CA 4JPWL 4OGXH 3CMAA 3J27A 4MZRA 2YN5A 2KPWA 4JK0D 4ODVH 5IW6B 1JOOA 4PCYA 5K9KB 4QXVA 4FZ8H 3MRGA 5I6WA 4HUMB 1T7XA 2AABL 4BQ8A 1PQZA 4DP9X 5I73B 3SE9H 3BIKA 4PJAB 2YBGA 3SDDA 5HY9B 4AYBE 4DR5L 1FL5B 4U4BA 1XGRB 3MGTA 3T77A 4IMLA 4LEXH 1G0DA 5CJ8A 1JZJA 2F0UA 2P7TB 3L9RA 1FV1B 4HKXA 3QIWB 4K8RH 4PJ5E 1T83A 3U6RA 1F1AA 1DLHA 6FABH 1SYFA 4NNPH 4X80H 3BSZH 3D0LB 5T33H 4X64Q 1EMTH 3JVFC 5IB3A 3NJIA 4IGBD 4S1QL 3QUMB 3VYTA 1T89C 2Y9RT 4K3EH 3MBWA 3L2LA 5ESQA 3FQTB 4HWEH 4EUPA 1BZ9A 2H3XC 1D2PA 1KPUB 1QFUH 4CC4C 5BRZE 5E2TL 4N6RB 4EOWL 1ROWA 4PY8J 4JVZA 1JV5A 4DP8X 4DR4L 3PWNA 4JKNA 5JJIA 1EJ6A 1NFDF 1AQKH 3VR4A 2HVKB 2IPKB 4UV4H 3U82B 5EO1B 5ELFA 2P49B 3MLYL 4CSTA 3J7AF 2KCTA 1R5WB 3HR5A 3SBPA 4PG9A 1X6LA 1JK8A 1HILA 3HZMB 2VB3X 1B90A 4AG4L 2LOEA 4QAWA 5IW1B 3V0DA 1KC5L 3MJWA 4TV3A 4DR2L 1B4LA 4UTCA 4A37A 4Z76B 3SYAA 4GXFA 4PJEB 3QDJA 4LOEA 4B3EA 3D3VD 1JZHA 4L4TA 4YWLA 3GMLA 4C47A 3DGCR 1WTWA 4KMQA 4X98B 2FTAA 4Y5YA 2OMYB 4HIKA 4MJIB 4WHYH 4ZS7L 1R19A 3CDYA 4DGVH 4P57B 4YXLL 3NP4A 3VACA 5CWSB 2GVYA 3FQYA 1MSPA 4LQ1A 4OD3L 4JE4B 3TBTA 4A3FH 2AEIT 4I1PA 4OT1L 3VR6A 3KYNA 1V3KA 1QEXA 2A83A 5E0FA 5C0JB 1HEZA 2V2XA 3BAXA 4S3SA 3I50L 4J3WA 4JVPA 4DEWA 3C08L 1FSKC 1IGJA 2XI9A 2R0WL 3V2TA 1JDDA 5TSSA 2I85A 2RKSA 4WFN3 1AO7D 4IMKC 4Y1SA 3DLLA 3GLAA 1FFTB 1Y1DA 4NOBA 3RWFA 3UDGA 1RZFH 1UM6H 4XNMA 2OS7A 5IROA 3UTQB 3HR6A 3ULUL 2VJ0A 1AI1L 3P40A 4MCYB 3DX6B 4XP6L 5GPRA 5AOLA 4AW4A 1SE8A 5C4XB 1ZRUA 1HHHA 3WN6A 5EB9A 4ZW8A 3TWCL 2WACA 3WL9B 4J3OH 4J4PD 2OR9H 1ADQA 4FQXB 5KYNA 1QUQB 3DDFA 4QRTB 4X8XA 2D4FA 2NTTA 4C57C 3MRNA 3KF6B 1CFVL 1QBLH 4WFFE 4XCYB 5E4AA 3RNQA 1WA2X 1TPXC 1DUYB 5EEVA 2VDPL 1QUNB 1WAPA 2QDBA 2DAVA 2NY6D 3GT6A 1V27A 4LEBA 5FKPA 12E8H 3WKPA 1FZMA 4DP2X 5J12C 3MO1A 1FRGH 2NZ9C 2QVFB 4HCRL 4QTHA 1PJ9A 3SDDC 3WJLA 1BJ1H 1DANU 5EKIA 2ZCHH 3H53A 1FI8C 1QNUA 4CN4A 1LDPL 5GHWL 5HHOD 4I18A 3J80i 4WKZB 3G6EA 3ER0A 1W0VB 5KBLA 2BVYA 4M48L 3HPJB 4ADGA 3HEJA 4DAYA 2OCCB 5HHVH 2WCGA 2IX0A 1EZ8A 3NCYP 3V5KB 3CZEA 3PWJA 3L3JB 5IQOA 2X4RA 4DOHB 2FINB 5B1AB 1IAIH 1N36Q 2AEOA 5C92A 5A1AA 2YPKA 3EYQD 3S1RH 1TETH 3U1SL 1P5UC 1LK2A 3TN0D 4QXTA 2F0JA 5DAUA 1BZQK 4G43A 2Z35B 4XBPB 5DQ9A 1XEDA 2DL9A 1AEXA 3D12B 5E2WH 2K05A 4N22A 3BP4B 5IK3B 2Q8BH 1NFDA 2DYSB 1A6XA 2WINB 1VQLA 3PGCA 1XPRA 2FHCA 4XC3L 3RU8H 1DN0B 1DCZA 1CUKA 4NB3A 4KKLD 4PRBA 5I75C 2JKNA 2NY0B 2DH3A 2DQGH 2LLLA 2YOAA 4I4WA 4PSPA 4LESA 2E59A 4DV5L 3PGDA 4K23H 4OGXL 5ANMA 3V7AE 4X62Q 3FU3A 4ELKA 3UZEC 4CNIA 2R93G 1HXKA 4KMLB 3NP3A 2CHBD 1KCKA 1VACA 2FYVA 2VRAA 4KKCD 1PJWA 1EPFA 4NW2A 4ODVL 1O5DT 5FHBH 4FZ8L 2Q2IA 5SWSA 4X3TA 3AY4A 5EIIG 4EAEA 4WLCA 3SE9L 4WW1A 3WDIA 2UYLB 3A7AB 1NC4B 3DK2A 3GXNA 4HZ1A 2DQDL 4F2ME 4KHPL 1DBMH 1DJGA 4Z78B 4KXZI 4JRFA 4P3CH 5KS9B 1A02N 1Q9KB 2C4FT 2FH6A 2IBBA 3ARGC 1IZJA 4YIJA 3CH8A 1OAYH 3BPCB 4X0KB 3CSBA 3KLDA 4FQQA 5F0PB 1I8LC 3NP8A 4MS8C 4NNPL 5D7LD 2NXZC 4X80L 5DK2A 4FAAB 2CO2A 3SPJA 5JPNB 4P9HH 1NSNH 3GXFA 5T33L 2EVBA 1OCCB 2DLGA 2F19L 2F1AA 2NNAB 1I8AA 1EMTL 1MLCA 3MNVA 5LGJA 4XP1L 3O6FB 1E1OA 5D5MF 5D7JD 5I9PA 3HB3B 5IROC 4K3EL 2HPOA 4KJYB 1ES0B 5J57B 5CD3B 4HWEL 5KVEE 1I94L 2N56A 1SMOA 1KN4L 4QKXB 3AAZB 1QFUL 3K1DA 3LQAH 1DDTA 2B14A 3ZYJA 3MHZA 4BUGA 1U91A 4FF2A 1MHPH 3FDWA 3U9SA 1D1IA 3KL5A 4AK2A 2VDQB 1AQKL 4JBSA 3F7RA 4GNKB 4UV4L 2Y7LA 2I0QA 4JFPA 3QUXD 3QIAA 1NPUA 2K7QA 4N87A 4DKDC 3DSNA 2ZAHA 3W5MA 3S8GB 2LXKA 4MNQB 3NTKA 4QHNB 2VO5A 4R4BA 1J5HA 4X8GA 4TQUS 3VSVA 3GD7A 4NRXB 3B6SB 2A9NH 3TBBA 2TAAA 3H91A 4JO1H 4PJ7E 4JPBW 1EEID 5KYXA 1QLRB 2CDEB 3U4BH 1Z9SA 4H40A 5EPMA 4HIHA 4PLJD 4K8IA 3J7ZC 1MCOH 1MIEH 3H3KA 3HZKB 5ESVB 4DGVL 3BI9X 3ZTNH 1C8PA 4YVUA 2O1AA 3MUZ1 1PX3A 2NX5A 1WFIA 2XFGB 3KXFA 1OANA 4DV0Q 3PUZA 2HQLA 2GY5A 4UAOB 4WGWB 3U4EB 3T1HQ 1SBBA 2DM7A 1PY4A 3FC8A 5IUCA 5DD3H 1LM8V 3BWAB 3QZWA 2D3NA 2E9WA 2FT7A 2NZ1A 3H4FA 1OOAA 3PDDA 3LZRA 2G2NA 1WFQA 5E8DH 5B8CA 5HYQA 4D0BB 4G9FA 2HG0A 4GN4B 1ZYRD 4PRDA 2J5LB 2FWOB 2F1MA 2HAZA 5DC4B 1KSRA 2PCXA 2VZSA 2P28B 1USQA 1RL2A 4HEDA 4JO4H 4WEUD 1RZFL 1UM6L 4FMKA 5K5YA 3BN3B 4PJ9B 3MRBA 2UWEF 4P74A 1BF2A 3BUYA 3QWRD 3ZT5A 5EDSA 4ZMLA 5HURA 4ZFZA 3U9UA 1C08A 3HJEA 4J2QA 2HLFD 3Q6FA 5E5MB 2OR9L 4L8JA 4BZ1A 3KPSA 3N52A 4X50A 4YDLB 5BV7B 1V8QA 1QBLL 3SKMB 4U1IB 2I27N 1V8HA 3C5JB 4AI7A 4UM9D 3K5LA 4I9XA 4WWKB 3GUTA 2UXDL 4HK3J 4UNTA 5FYKD 4B60A 5DM63 3K91A 1JJCB 3FB6B 4QLRA 1A6TB 4GINA 1G43A 4RH6A 2Y06H 4IKLA 1OAQH 1GUOA 3H15A 3WFBH 3Q0AA 2OJ1A 4UNVA 5EBWA 5LB1A 4AQAA 4OGYH 3L3DA 1FRGL 4G70B 2ZXGA 1AGEA 3CFBB 1FGBD 4HJGB 3V05A 1FL3B 4RFNB 2ZCHL 4MKMA 1GUGA 2D62A 3P11H 4H02A 3GO5A 1PNCA 2NN6G 1BUVT 3BFWA 3VD4A 4XGZA 4YFLI 1H6EA 4ZMVA 2V33A 1CGVA 3DJZA 2F53E 1KGYE 1AP2A 2VT0A 1K8DB 1Q0EA 4MSWA 5HHVL 2IBZX 5E8EA 4C4KT 2GVBA 1IAIL 2UZYA 3SOBH 1XQ4A 3WFCH 3VA5A 1MW3A 1QSEE 2WQVA 2MO1A 1ENFA 1TETL 4Z3GA 5C0DA 1KDAA 5D5MA 2ZXDA 4ABQA 1D5RA 1WK0A 3QRGH 4GAYB 1KCVL 5CV8A 1DM0B 5DDHB 1BD2B 1XR8B 5DD6B 3CPLB 5T3XH 2OULB 4K9EC 3SVMA 1TTCA 5ITFA 4MXVE 1LUZA 3S1QB 1J0ZA 2Q8BL 2R59A 4ZMXA 1TWHB 2ADFH 4GKKL 3FRPG 5C4XG 2FATH 5J1SC 5C0XI 1VQ6A 2R2HA 3HCVB 1H0DA 4G5AA 3RU8L 3QJQB 2DMKA 4I7AA 4PYGA 3A56A 4UP8A 3MODH 4ODHH 3TP7A 3BH9B 2VXSH 2EACA 2DQGL 1UA3A 4BBRB 1QPPA 1E4XL 2XVKA 3ABKB 1XF3B 5A2KH 5IVXF 3SCMA 2YA1A 1G0XA 5KOVC 4Z7OE 3WJJC 3CC5A 2J1ZA 3E6ZX 2CR3A 5I16A 2JKRM 3U7YH 5FHBL 5HHPB 2ZOKB 3ZGIA 2ATAA 4JI5Q 5FM8A 2HA1A 2DQFB 4QCIA 4BHUA 1M9WA 1HNGA 1URIA 1C4QA 2AGJH 4LQFH 1O7SA 5DHYB 1PTOH 3N55A 1DBML 3OTTA 4P3CL 2K6AA 1F2MA 2JJSA 2XWXA 3PS6A 3MXVH 4BSVA 3LKOB 3GMPA 1OAYL 3KPQA 3TP4A 1P7QB 3HUJE 3IWVA 3PO3B 4JRYB 1LXMA 3B8SA 3G5WA 4P9HL 1W2BA 2ZQKA 5HTSA 2Q0ZX 3Q0HA 1BG9A 1PBYA 4GRWE 2GSGA 5EU5B 4ZUWA 2VN4A 4KOBA 4HWZA 5I8EB 5EU4A 2WBJD 3DOHA 4X6CE 1VFAB 3AQYA 3MJ8A 3AS3A 4YSAA 3CBKB 3CW2C 1IQWH 3LQAL 1H8NA 1P6AB 2BOLA 5BUPA 1OTSD 5JZ7D 1WISA 3DETC 3C8KB 1MHPL 3PG2A 3V0HA 4KROB 3HZVB 5ELIA 3CC1A 2KHIA 1P69B 2P5WB 1QLFB 4IPDA 3MAQA 2N1KA 2NQ3A 1EJFA 3EFDH 3CQPA 3HFMH 4JFZH 1B3AA 3HKZA 3U50C 1T04A 5FO7B 4OFVA 1Q86C 4DZ8A 4PR5A 2B5IB 1KT2B 2A9NL 1U5KA 4JO1L 3V0IA 4G6FB 4L8CA 2VUMH 2DIBA 1J8HE 2BO0A 4BY7H 3OPZH 4JFEE 4XC1H 5FIEA 2HYMA 3QFDB 4CMHB 5DZOA 3LY6A 2HG5B 3ME0B 3U4BL 5K9QI 4CC1A 3A7LA 1KJ2H 5ACLA 1MCOL 1MIEL 4HULB 3ZTNL 3F1ZA 3ARED 4NQED 3KPOA 4H26B 4LHUB 3Q2VA 4ZFOB 3S96A 5DA4A 1S7RB 5CP3A 2XX0A 1GIGL 3GLEA 3QEUB 1KOAA 3OBAA 4OO1H 4FXGA 3ZXAC 1EIGA 4YDJB 3F7YB 5MERB 3CVBA 5E8DL 4HVBA 2XJLA 1EANA 1I1CA 3O4LE 5ETUA 1G1OA 2MOQA 5J6HA 1G7JA 3FPYA 3MRIB 3SHSA 2ZWSA 3MRHA 2VCOA 4A3DB 4RA0C 2NY4D 1TJGL 1O7LA 4YFDB 3QE5A 3BUDA 3IXAB 2VZVA 4MDIA 1OGPA 4OKVA 4RHSA 2W65A 2GAZA 3CCHA 4FXKA 2NY1B 3ERXA 2ITDA 3QUYB 4F37F 2WQWA 4YSUA 1L5GB 5I1GH 1RJCA 2VSDA 4C2MH 1KPRB 3C5ZB 2EYSA 3L95A 1TYRA 3CU1A 4B9PA 4ZNEA 4MD0A 5J39A 1T21A 4NENB 4NAMA 1YHQA 3DI3B 4KUZH 3NZSA 3P3UA 4OXPA 2DYPB 3RJOA 3SK4A 1BVNP 5DHVB 1VAHA 2OYMA 2D0HA 3QA3B 5IVXA 2Y06L 1GO3E 1OAQL 1T5XD 1Y1UA 3P4OB 4ZMPA 6PAZA 2C1OB 4OGYL 5C8JA 1A6PA 1DHKA 4DV6L 1U30A 4NJAH 2VL4A 1U3ZA 2R7EB 3TO4D 3IBOA 3QCVH 4I77H 1O0VA 1P4IL 3BEWB 3MNZB 1CXEA 4IJLA 1JE6A 4KTYA 2BS9A 3PP3H 5DYFA 3AG4B 4EIBA 3E9HA 3P11L 2BSSB 2JJSC 4CDCC 3E8VA 3SJVB 4DF7A 4DQAA 3G5ZA 4JFFA 2VN7A 2OL3H 4GP5B 4JKLA 5E8NA 2WAQE 3VXUA 3S1MB 4MA8H 2Z91B 3N43B 3RDJA 1PKQE 4M7ZB 1XX8A 3V52H 5T1MB 3KL3A 3VWKB 4OAWA 4DK6A 2YQBA 4GKZB 5C4JH 1L9MA 1NANH 3SOBL 3RZCB 3UFIA 2OMUA 3QI9A 3V2AR 3WFCL 3UAAA 1OPGH 3K2UH 4AIEA 2BP3A 4R7LA 4KX8A 1DOLA 2YRLA 3QRGL 2ZOLA 3MV9D 2F54E 3QHZH 3MCLH 5IYCG 1QO3B 3I8ZA 2WQAA 5FUOH 5T3XL 5FECB 3CCSA 3BJ91 4OJEH 3ZL2A 1A8VA 2ADFL 2G2PA 4BFBD 4NC1E 1PFSA 1OXTA 1NM4A 3BGMA 2PXYB 2VAAA 2FATL 1DOMA 2WXKA 3VXPA 2F8VA 2EZ0C 1Y1VB 3UZQB 2Y6SC 4JUSA 3HC2A 5CLWA 5JW4R 2I5HA 4ERSH 5HVHB 3MODL 4ODHL 3QR2A 1YMMA 5KBKA 2FHFA 2VXSL 5BW7A 2BC4B 3FF8A 1U41A 3STLB 3NELA 4XZ4A 5JQ6L 2ZKMX 5CMAB 4PMFA 2JIXD 1P4BH 2HT4D 5B38A 1EYCA 1EDQA 4U33A 2L5TA 5FWRA 5T3ZD 2VZ3A 2YRBA 2V9UA 3U7YL 1PZAA 4DAPA 1ZLEA 4JGJA 5E1QA 1D5ZA 4OSUH 4MB4A 3S14B 2IAMA 4J8RB 4HSAC 3STZA 2J12B 4BK5C 2AGJL 4J28A 5B3NA 4LQFL 3ENEA 1AOHA 1XXFC 1LEGA 3FN3A 1LQBC 4Q7DA 3EOAB 5GS1C 4NJ9H 1XO8A 5DMIH 1BX2A 1TEGA 4KI0A 3MXVL 4U1MA 1QRNB 1BCPD 4PJIF 4P4KC 4YHLH 1LQSR 4JO3H 5EWIH 4HSQA 3UTSB 4EDXB 3QAZB 4OFYD 5DO2C 4IJ3B 3T53B 4DZBB 4ZAKB 1ED3B 1OW0C 3F2LA 4OJCA 2I5LX 4Y1AB 5K36H 3H7BA 2D3JA 1N6QH 3QR8A 1Z7TA 1IM9B 3PIQB 1AVAA 3BYYB 1NCWL 2LU3A 2PR4H 2Y23A 3DO3A 1IQWL 4FXKC 1JWSA 1F6AA 4JY4A 5C09B 3H4HA 3TJPA 1FYTB 3E6FB 3E9IA 3EFDL 1GJIA 2MWCA 4G7SB 3HFML 4IBLT 4JFZL 1JZGA 1Z5LB 4AQ8A 4IIQA 5CAYB 4P59H 4DR1L 2B7DT 2AXHA 4PWGA 2EDFA 4BBRG 2YXFA 5TDPB 1JI1A 1KWKA 3OPZL 1WCQA 5F0JB 4QRFA 2NY7H 1TVXA 1MH5A 4H8PA 4LVHC 4AXWB 2WANA 3TXAA 4PP1C 5FO9A 2J2ZA 1NQBA 3GI8H 1KJ2L 1UXSB 2EJ1A 4AY0A 2V4LA 1GMEA 1U93A 1OGSA 1YC7A 3G9AB 4YFEA 2ZYSA 2DBJA 1BVZA 4X65Q 3RA7L 1KGUA 3C8DA 4C56D 3OAWA 1DJWA 3HRZA 4J6HA 4UQEA 3D39B 4DK6C 5LBSA 4P5TD 3K6SB 1LTAD 4Z7AA 1QFWM 4HEPG 2D0FA 3QI9C 4F87A 1WBZA 3QG6B 3TSSA 3L3GA 3Q6GH 3PO3G 2HXAA 4LSQH 3QUZB 1BQLH 1PZBA 1VHPA 2F7IA 3ZE0B 1T1YA 2Z0BA 2NVQB 2G9HB 1YUHA 2WD0A 1E5UI 3L48A 1PGRB 3GDCA 4X3SA 3MYZA 1IBLL 2BA0A 1CTNA 5EOQL 3RWJA 3CUPA 1J9SA 2ITCB 3K8LA 4F7PA 1CGWA 3CPFA 3HFFA 3MLTB 2NZOA 4FTVE 5L2KA 2HT2D 3FO1B 1WTPA 3KPPA 3LNDA 5JW4M 4ABUA 5I1GL 2ID5A 1DDHB 4HBQA 4UQ3B 3MRFA 4LMQE 4JG5A 2OCFD 1MFVA 3PDOA 4KUZL 1YHAA 4KI5F 2PPAA 3I9IA 1U95B 4LL9A 2VS1A 2H32H 4TVPD 5J1AA 4EXKA 1YYLH 5J6GA 3G3LA 3O8XC 3QJFA 3PYCA 4NJAL 3LJ3A 2IAMC 2C35B 5EU6E 5L0QB 3BPLC 3QCVL 4I77L 3WFZA 3L0OA 3QZOA 4BFFA 1R5IB 5FKAB 4PN6A 5FEBA 4OF5A 5CBAA 2ZM6L 3OSOA 2OL3L 2CVRA 3MXNB 3BHBB 4IN3A 1AQDA 4LHUG 1P4UA 4PJIA 5JW5A 2ERJB 3JT2A 3S4SB 4PGCB 3GV3A 3V52L 4HIDA 2E9IA 2XWDA 1J7VR 3KBFA 4ZW3A 5LNDA 4QOKB 5IIEB 1HH9B 4QRUA 2V8LA 3A74A 1OPGL 3K2UL 4RGNB 5F1KC 1ZLSH 2ISDA 5KBDA 1J05B 1FBIH 2NOYA 3LDBC 3OKMB 3C87A 1N10A 3QHZL 3MCLL 2Q2TA 3MZTA 2PPDA 3RZWA 4TRPH 1EV2E 1HI6A 3AMLA 2CDGA 3G6JE 5FUOL 3RIFF 3TZVC 1XB3A 5JHDD 5DYOB 4A3DG 1CGXA 2Y7OA 3OAYH 5E4EC 3AQDA 2WTRB 1HHGA 4AQ1A 4L8BA 4GIPD 4EVNA 4W9KC 1U8LA 4M1DH 1HFUA 4BZ2H 2VTFA 4GRWF 4U6VL 1CPUA 3JWNG 2BSRB 4I48A 4IIQC 1CHQD 3B34A 1AGBB 4X5PA 4JG0H 4IRJB 2I24N 2VR7A 3E0EA 2PI2A 2KC0A 4XN1A 4M6MH 1EIYB 4DV1L 1NKGA 1VPOH 2CH8A 4AEHL 2R27A 5IP4A 4NMZA 1P4BL 1GYAA 5CN1A 1V9PA 2CSPA 2VB5A 5HI4D 3HOYH 5IWLC 5KG9A 4P8QA 3BZDA 3BE1H 4X9HA 4EN3B 5DJ2A 1YN7A 1FNHA 2VR8A 1WD0A 4OSUL 4ZX6A 1EAOA 4DNIA 4PH8A 1SEBB 1HHJA 1AXSA 4JDZA 5HSFA 1WTVA 5KTEH 2WWMD 3HRZC 1S7UB 3QR0A 3C5SB 1GHJA 1ERNA 4G59C 3P3RA 5FM5O 4NJ9L 2WLLB 5DMIL 5FLMG 1KYUA 1LD9A 1NGXB 3DIFB 1JS4A 3MRDA 4QHLA 3K71A 4DR3L 4ESKA 3O45B 4EMZA 1GZPB 4A3GB 4YHLL 1N3NB 1TFPA 4JO3L 5EWIL 2IWEA 5DMGD 2OQJB 4M8UA 4E5XA 1PZSA 1XGTB 1TOXA 4ZFGH 1CK0H 5H1SE 4FF4A 1M42A 1R24B 2H6OA 4F7KA 1KWGA 5G4NA 4OFIA 1RIHH 3DJ9A 1WGVA 5AOJA 3CD4A 2AJUH 1F2LA 4WEEA 4YJZL 1N6QL 1NTGA 3S9WA 2CJUH 1GGTA 2XKSA 1K3ZA 3D69B 4XMLH 2X0UA 1I9JH 2VWEE 1TS4A 5CEYA 1KBVA 1BFOA 3HE6C 3I9GH 2O5YH 4N2BA 5HGTA 4Q4EA 5LDUA 2F5BL 4BFGA 3L7EA 4PJBB 4YCUA 5EFIA 3VAEA 4GMSH 1ICFB 3KS0J 5C0AA 1JZ4A 4JFDD 1ZHBB 3VRJA 1QTPA 1Y1VG 2TSSA 1W6JA 1S3KH 3N42B 2AMCB 4NT6B 4QF1A 4WDIA 5E99H 4P59L 3FHQA 4P23B 5IEHA 1G9EA 4DW2H 2F3WA 1YHPA 4XNQA 1T2JA