4J8QA

Crystal structure of a nigd-like protein (bf0700) from bacteroides fragilis nctc 9343 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
202
structure length
194
Chain Sequence
DGYSLGDIAVDWATVRVVGGDTYSLNADRWGTLWPAATAIPFYKPIDGQRVITYFNPLYDNYEGYDHAVKVEHNYNVLTKQVEDLTAENESEFGNDPVWVNKDMMWIGGGYLNVIFRQNLKHLVSLVRDMRATAAEGEDDGYIHLELRYKTYDDQANGAVSFNLNSLDLTGKKGIKVKLNSVKDGETEVVFNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a hypothetical protein (BF0700) from Bacteroides fragilis NCTC 9343 at 2.50 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 40
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j8qA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j8qA02
4PQXA 4J8QA 3K0YA 3NQIA 3QWNA 3K6OA
chains in the Genus database with same CATH superfamily
5ESQA 4TQ8A 2ZUWA 4AYDC 1HNWL 1HQ4B 5AL8A 2AEIT 1DVTA 2VB5A 3OC8A 4JM4L 1QFPA 1H8LA 4FDWA 3RMHA 5KSUA 3WGUB 1I3QB 4C55A 1F4WL 3PLYA 3G5VA 3T0EB 4JQXC 4UOW1 5E6IA 3GKWH 4CN6A 3CFCL 4ELMA 2BC4A 3DPBB 4PJXB 2BRQA 1H6EA 4JPKH 1G0DA 3B2UC 3QRGH 2XNAA 3N9GH 2C1OA 4ERSL 5M3FG 4Q4IA 4GS3A 1R24B 1IO4C 3DROA 1IM3D 2R92G 4QHNA 3R4RA 3LS5L 4C56D 1YEGH 2NY4D 4FQ1H 1RDPD 4RA8A 1FHGA 5DQDL 2ILLA 2XA8H 2W0LA 4OJEH 4PN6A 4WRLA 2WN2A 4WU5B 1F97A 4C83A 2J5WA 4NJAL 5L0QB 4AIXA 1CZGA 4FFYL 2UWEA 1EHKB 1GGTA 3I4NB 1KPVA 1A1OB 1X5LA 3ABGA 4WEUD 3HUJA 1JZ3A 2AW2A 1XIWB 3ZDXB 2NPLX 5C4JB 1TQCB 4C56C 1ZDQA 2FR4B 4DR6L 5HDBF 4JO1L 2CWAA 2NNAA 1N10A 1EFXB 2YSSA 4KMQA 1FP5A 1ML0D 2X4TB 3VXQB 4N86A 5EUOF 2JN4A 4ODHH 3SVMA 2NY3C 5DCCA 4I85A 2JA6B 1YZ6A 2DQHH 5E1GA 5LGYA 2Z92B 1WSST 2C3WA 2X53A 2R69H 1K3BC 3VRIA 2UZIH 3KLKA 1J5OH 1G1KA 1JRHI 4XYQA 3MFFA 2R93G 2X10A 1ICFB 4KTYA 5HP5A 1ZCRA 3FB8B 2UYLB 3K6OA 1X4XA 3T1YQ 5SX4I 4JI6Q 2Z7ZA 4KQ3H 1FRGL 4FVMA 1YN7B 4TSCH 4F7PA 3GGWA 3KH3A 4LCUA 3ZKND 3BXNB 5B3JF 1M8AA 3F84A 5LMUL 5D5ME 3RZCD 3CXDH 3W82A 5AL0A 4AX3A 3DK2A 4HULB 5TDPA 5KYYA 1HKLH 3JV6A 4CDDC 3W9DB 3BP5A 4NRYA 3RE0A 3UBXG 2L11A 3OVUB 4M8UA 2F0LA 1OO2A 2QVTA 3L17A 1AACA 4N0RA 4U6YB 1I3VA 4KBPA 3V8OA 2KPNA 3H3PH 3MCG1 3ZKNC 1UZGA 4JG2A 1WCMG 2IOOA 3CUPA 3GXDA 4O51B 2I46A 3BO8B 3RUGE 3RZCC 1MFUA 1VF5C 1C0AA 4S1DD 4CILA 5FWRA 1L6XA 3WNOA 4I9XA 4UAHA 1JJ2A 4FA8A 3DWTA 2BOCA 4G9DA 4WWKA 3WDNA 5I19H 4NKLA 3AQQA 5HURA 2UXCL 2P44B 2O72A 3P9WB 4G11A 5FHBL 5KANG 5IB2B 5IWAL 3ENEA 2V5MA 1TKWB 3DYMA 3GC3A 4LUVA 4X6FA 5C44G 1YNKL 4CA4A 1YMMA 2VXSL 3H9SB 4S1DC 3RKPA 1T83A 4NQVB 4BA2I 4GMTH 1INDL 1IGIL 5BZDA 2F53D 3W5NA 5IT2L 3C2AH 3MNVA 4XCYB 4ZX4A 1TJMA 3FQRA 3KYMA 4QTIH 3LQZA 5M3FB 4NUGH 3NVQA 3ARXA 1C12A 1ZXKA 3FHAA 5C3EG 2VC2H 1S3OA 2WN3A 1L7IH 3MRQA 1O80A 3N44B 4HS6B 2R92B 4Q14A 3SDXA 4ZUJA 2K7VA 2GI7A 2WBJA 1TFPA 3HE7D 4XZUA 5HYSA 2AJZA 5I1JL 2R83A 1GYAA 5TSSA 4LPCA 5I0YA 5A6IA 1QA9B 1UA6H 2OL3A 2GKIA 1UUSA 3BAJA 1TQUA 1TWCB 5A6LA 4QRTB 1R9TH 3CVIL 2OFQA 2UY7B 1MGSA 3A7LA 4ZMVA 3A6CL 3ZHDA 1YI2A 1N26A 4PJEF 5DJ0A 2ZX6A 4V33A 2QQLL 4M6NH 3WELA 3VCLA 4JFUA 1UXWA 4G6FD 3LN9A 3MV8D 4ZXBB 4NN5C 4G8GD 4BWUA 1RIPA 1F6AA 1EQRA 1OXYA 1HEJC 2R2BA 4MQXC 4ATWA 2EKSB 2R93B 4F2MB 3D4WA 3DX8A 4LFAL 2XPZA 3L3OA 3GM8A 5DYOA 2CDEB 1K6QL 1YHPA 3ATEA 3LNEA 3P2DA 2F7RA 1VGKA 2MKLC 4JHBA 5DURB 2B1OA 1UM4L 4F7EB 3UAAA 1TYRA 1IQDA 5IW1A 2K4WA 1J8IA 1UEYA 3DHMA 5KYUB 2ZNWA 1NMCC 4ADIA 1OGAE 3JT2A 4GINA 2OMVB 2P1YA 5I71B 4YFDB 5CBAA 3AQXA 1YPZE 3UBXB 2MCG1 3ZMNA 1R3LB 3G5XB 1CG9A 3P9LB 4Q74A 3APFA 1S72A 3NRQA 3MFGB 1YVCA 5G4MA 4O2EA 2CGRL 4K6DA 2C3XA 4APXA 5BRZD 1WCMB 5KVGL 3KPMA 2AXFA 2I5HA 2MO0A 2EXTA 5CN1A 1G7HA 1KB5L 1YEFL 4YOKA 1NLDH 2CO6A 2LAAA 2BH2A 1PVHA 2CJTA 2PPCA 3LRSA 4GXFA 4YHLL 3QZWG 1JERA 4B0MB 1K8GA 3NEOA 2D0OA 3CLFL 4FQQB 3SBQA 1N5YH 2KECA 3ES6B 4QMGA 1RQ5A 2BWDA 3QJHA 4OIBA 1PZUB 3PAZA 3WTXA 4MJID 1UOWA 2ZKHL 1KYDA 3BPCA 4AL8L 1ZWIB 3CH8A 3D12B 5J8OA 1BGXH 5DD1H 5EG6C 1T5XD 2GVAA 3NCMA 4L5FL 5TK4A 1Q0YH 4X6DF 1UH3A 3MV7A 4OO1G 3MRBB 2HLFD 4MDRA 4JLRB 4XMWA 3MUGB 1D6EB 4Y2DD 5DJCB 4QIWB 2Z3FA 4IJ3C 3SPHA 1FL0A 1A6TA 3MRIB 4QXWA 1GSKA 4NO2A 1N34L 3ZU8A 4OLWH 1U21A 1SE3A 2CM5A 3VXMA 4DAMA 1Y14B 2PQAA 2MMXA 1QSEB 5CIPH 1DLFH 3AREB 2XC8A 4PY7B 1PG7W 2HLFC 4FKHA 1O7LA 3CW2C 4QRQB 4Y2DC 3VXNA 5D9SA 3CPUA 2X42A 3RIFF 2XJKA 3CZGA 4KZCA 1FAIL 2BINA 4KJWC 3UAJD 4YWGL 4BFGA 4QD2E 4M7LT 3HFFA 4OV5B 3JZYA 3F6JA 2WB7A 2WOBA 4NSKA 3BVDB 1D7DA 5F1IA 4BQCA 4CDHA 1U3HA 5JDSB 3STZB 1AQHA 1RCYA 4ZMQA 4XXEA 2OR8A 3TA3C 3QCTL 4K94H 4J3SA 2FBOJ 1B9ZA 2EEAA 2YQ3A 3FFCD 3DHUA 4WHTB 5IE8A 2BIIA 1K3RA 3VFMA 5PAZA 2DIEA 4BZYA 1HOEA 5C97A 4KTEL 1Y1VB 1A6PA 1WD9A 2AABL 3EH1A 1XF2A 1XXDC 2X6GA 1BBUA 4HUXA 1JZIA 5CYUA 4MFHA 3N41B 4DUZQ 2HH0L 1VQ9A 1A8VA 1Z9LA 2O5YL 2QJDA 5TDOA 3FBQA 2F0FA 4JM2B 4GP4B 2YZ1A 3M7FB 1DQML 1PTOD 4JFFD 3I72A 1F1DA 5TD4A 3KXFA 1TLKA 3BUDA 3NCJH 1TU2A 4JFVA 4LSUH 4YHHQ 2ADIA 4LBEA 4UT6H 3GZOA 4ZNEA 1MN4A 2HKHH 3O11B 2OSLB 3MLRL 2X2JA 5SWZA 4O2FB 1JYXA 2PWDA 5IIEA 4HGWA 4JAMB 3QFJD 5I16B 2MEJB 1T6WA 3VE0A 3ARVA 3RQ3A 1WFQA 3GTKH 1F02I 2WQRA 1EU4A 3L7FA 5DA4A 3Q05A 1BECA 3DX7B 2CXGA 4E36A 5TQ0L 1PTOC 4A6YB 3T8MA 3GV3A 1FFPB 3KPOB 4R0LC 4BA8A 3QZWB 1QR4A 1LE5A 5MI0C 1QBMH 1FH5L 4DJMA 4IBQA 4M4PA 2B2TA 5HHXH 2VQ1A 1BIIB 4RDQG 1IBDA 4J3OG 3MACH 2EE2A 1ILQA 4RWYH 3NRFA 3OJDB 3CMOL 3TBVA 5D1XD 5C07A 1IC5H 3WAJA 3CV5A 2ZSVB 1JGLL 1QFUL 2VMCA 2ZT9C 3GB7A 2W9LA 4KQ4H 1MZYA 5T1GA 4G6KH 1ZANH 4I9WD 5COYA 1N36L 4Z7OB 4C54A 4DV4L 4LRIC 1PY0A 4GKSA 4TQEH 5HBBA 4LL9A 1QILA 4MCZA 3QXWA 5DUBA 2CRIA 5E23A 4ZPVB 1BD2A 4HPHA 5D1XC 1EUJA 1HZHL 4JHWH 5I1LA 3ULVD 2QHLA 4HP5A 4P06A 1VQIA 2QADD 4BGLA 2B2VA 4AEHL 4KX9A 3I73A 3L3JB 3TNMB 2V2TA 5FC9A 1G7JB 4NNYB 4IIQA 2OULB 5KEZA 2G9HB 2WXHA 5D8JH 4AYEC 4UT7L 1SN0A 3CMEA 3SJVA 1Q81C 1J5IA 1FFOA 1LO0H 2OJ1A 4KJQC 4YDLB 2WLLB 7PCYA 4LRNL 4Z3TA 2DWTA 1Y6NR 2ENYA 3ULVL 2PXYB 3PL6C 2HFFA 3LH9A 3ULVC 1CR9H 2GBTA 2X40A 2IEPA 2ZTCA 3DO7A 1MJUH 2RCNA 4XMZA 3IMSA 2QADC 4RISH 1MFDL 3ZZQA 2C5CA 4PVNA 1TWAH 1Z0MA 2EVGA 4NC1E 3UG4A 5IWLA 1S9KC 1G87A 4OBSA 2O61A 1T4WA 4XCNA 3HKFA 3HZYB 5J4MA 4JBSA 1YEEH 2AQSA 4NLHA 1R0AH 1GKEA 3TIDA 1JCKA 2XIBA 3V2AR 3LJ3A 3TPUA 3QG7H 3OPOA 1JZEA 2Q7YA 4NKQB 2XVGA 1E30A 3AAZA 1I8KB 1CQFA 4OZFH 3D9AL 3IF1B 2B59A 3COOA 3BZDB 1NCAL 4H40A 1IU1A 4L4VD 4B0MM 4DVRL 3R0MA 3U4EA 4WTZA 2C1PA 2CH4W 4GRWH 4PP2B 1NJIC 3WJLC 1JXFA 5JQHC 2AQRA 3QQXA 3TWCH 4JMXA 4KRPD 1JF1B 3ZX1A 4ZX6A 4IRZL 2Y2WA 2WBKA 3HEIB 2NY6C 3VYOA 3EZJB 1Z6JT 4IOFC 3B34A 5CD5D 5FUZH 3A8JE 1AO7A 1CLYH 1F77A 1U9KA 3NJKA 5B39A 1K4CA 5INCB 5JEAG 1P9MA 2B0SH 2YV5A 1XGRA 5F1NA 5TH2A 1B4LA 4EI5A 3OMGA 1EAJA 5AD0B 4JO2L 2EVJA 3MBEA 3KW8A 3VXOA 4DR7Q 1MPAL 5BO1L 4KRPC 1CGSL 4RRPG 4A76A 3C60D 4JFSA 3O4LD 3VXUA 3SO3B 5KVGE 1RHPA 2A19A 3LN5B 4G7YL 4B3SL 3MO1B 3C5ZA 5EJWA 1GS7A 1T1XB 2CCWA 3C6SB 3GJEB 5CHNB 2C3HA 2CR0A 3G7LA 3H0TA 4NENB 1DUYA 1Y18A 3KL0A 1FL5B 3CZSA 4KRLB 1KIQB 1Z9SB 2JVUA 3TJPA 2NN6I 4RGTA 3AU7A 3HRZB 5J6GA 1LMIA 3IPEA 3L9RA 5KBKA 1T6VN 3NA9L 5D2LF 5BRZE 4LEBA 2NZHA 2AQ3B 3C60C 4WI7A 3U0WL 1FIEA 1RZGA 4HW6A 4IRJB 1D5ZA 4L5FE 4XPGL 1HCYA 4R97C 3WTYA 3IFNH 1L1OB 4KRMB 5LGHL 3SK8A 4X7SL 2OMYB 3QQ4B 3RBSA 4JW0A 1QNZH 2HQEA 5AW8B 4PWGA 4WY7L 4BK4A 3VFSA 4ZMXA 1ZKOA 4UQ2A 1H6FA 2VRKA 1OANA 12E8H 1VCIA 2ALAA 4U1JA 3K8KA 2V7HB 2WYTA 4JO4H 4MJIE 3TJEL 5T1DL 3ZHFA 3BKYH 3PJSA 5E9DB 4LXFA 3U4BL 4QTHA 3SY0A 5KNBA 4AITA 3KG5A 4H26B 4L3EB 4M62H 2F0MA 4U0QB 4B3EA 4BCZA 4LSQL 1GTFA 1JZDC 1Z9MA 2ZX9A 3GT6A 3TCXA 3QO0B 5BZWA 3EJJX 2MTPA 1EVTC 2OXHA 2UZXA 3QO2A 2VCOA 3QHFL 3RURA 4ANUA 4YS4A 1KEGH 1LTID 4NI3A 4J39A 3D0AA 1B4RA 3TT1H 1WJJA 4Q6IA 3CCUA 4A3KG 1UWYA 3TDQA 2COQA 3EOBA 4FGMA 5HHNB 2Z7YA 2EXWD 3RILA 3WE1A 1HA6A 1FFRA 2J44A 4P2RD 5HPMA 4PWHA 4TOYL 5BUPA 2PABA 1KC5H 4GQ9H 5F8RC 5J6HB 1O7SA 4WEMB 1K5WA 1RODA 3I6GB 2PQEA 5MERA 5LQBH 3OAZH 4L9LC 4NP5A 4PJAE 1ET5A 1PEWA 4C4KO 4PJIA 1A7RH 4PWFA 3F8UB 3VFWA 5I5JA 4BFFA 5CV4A 5I1EH 4A3DG 3Q6FA 5B7MA 2K3HA 3DRQB 3MBXL 3MYJB 2EXWC 3G04B 4HPYL 3ZTEA 4X3UA 1LO3H 3BWSA 1ODAA 5CBAB 3NCEB 4U3XA 3FCGA 2GJZA 2Y25A 4EXPX 4WNQB 4WJ5A 1NAMB 4YDZA 3IGLA 3LQAH 3UTOA 2YXFA 3V4PH 5JLZB 1FBIH 1F9SA 1UM5L 2NTFA 4WI0A 3OYYA 3E1ZA 4DR2Q 2D0PA 4K5XA 4C3JG 1KTBA 4HCRH 3A5VA 1GM5A 4PYHA 4UTBL 4OWWB 1TJGH 4IPGA 3SE4C 3GTNA 3QO1A 4JFFE 2LFNA 4KHXH 5B21A 1TF4A 2XG4B 3FHWA 1P7KA 3GMLA 1LGVA 3P4MA 2NVXH 5MENE 4BA1I 5CD3B 4P75A 1I3GL 3BEWA 4I13B 3LEXB 3NE5B 3QFJE 2PYEA 4QRSA 3QUYD 3QDHA 1ZIAA 3U82B 4UP8A 4UM9B 3IJ9A 3PWPD 5GRVK 2F1BA 3M8OL 3PO2H 4S2SB 4F7XA 1WO2A 5DC2A 4XVTL 5T5NF 1D2PA 4IGBA 5BXFB 4ZFGH 4HDIA 5CMAA 5KTEH 3VGEA 1XCTB 3QNXB 2FX9L 4AQZA 2Y06H 5I5IA 4PVLA 4ZK8A 7FABL 3BAIA 3T1WA 4AIMA 1T7VA 3QUYC 4NERA 4NO3B 3M86A 4APQB 1TTGA 1ZT1B 3FB7A 5I6XB 5D1XE 1BX2B 4NUJA 1BWMA 5FECB 3EUDA 1MD2D 4PW4A 1RAMA 2V1CC 1HHKB 4PI2A 5GS2D 1J1OH 4BY7G 1DQQB 1FPTL 3FCSB 2Z8LA 4OVVA 1SDDB 1VFBB 5EEZA 1NCOA 3V4VB 3W5OA 4DGVH 1F4HA 3FT4B 3PUWA 1QWUA 4IBSA 1DQDL 3OR7A 2PPFA 5C09D 3GLAA 1OE2A 3VFUA 4LAQH 4AQ1A 1F2XK 1XGYL 5ABAA 1HJPA 4XNUL 1XT5A 3VVWA 5DD3H 1VQJA 5E4XA 4A3KB 5CCKL 3ULVE 1JVOA 1IAKA 1FNGA 1SJHB 3EN2A 4QHPA 1SN2A 1ZYRD 2EECA 3H3BC 2GJJA 1LWRA 2ATKB 1Q0XL 1P4BL 2KZBA 3WDIA 1OHQA 3UROR 4X98B 1D7FA 3EDDA 5CSZB 2W95A 4J12A 1JXGA 2D5DA 3NJGA 4JBKA 4WKZA 4YQXH 1NDMB 1Y8OB 1J1XL 4DKTA 3ARTA 2IFFH 2YZ8A 4C58B 4MWFB 4XCCL 4E9XA 5F7NC 4A3DB 1ZEAH 5E08L 1T21B 3OAUL 4Y19A 1KCRH 3OAYH 4Z8FL 4JNXA 1EWCA 1W6LA 1ZYRC 2WTOA 5HGTA 4UM8A 5T1MA 4TSAL 4ZDHA 5IHLB 2GTZB 5IT9c 2X4QA 5EO1B 2F18A 2GY7B 5C4HA 1SJED 1LTBD 4FF1A 4JFOB 2QW7A 1GAFL 3L3GB 4OJYA 4M6MH 1AGEA 5FOBB 2F4IA 1B0GA 5ICZA 4C3JB 3CMAA 3ILQD 4QJ3B 2C9AA 2Y23A 5ABZA 3BKCH 3GTGH 3NJLA 2WNKA 4LK1C 4HS8L 5AJ3L 1A0QH 1DN0A 1H6UA 4LNRA 4TSBH 4DVBA 1DQLL 3K2IA 2NRDA 4DV0L 4QRRB 2C3GA 3X3GL 5KYNA 3DVGA 1XMWA 3JWNH 2GC4C 4L4VE 1UE6A 5G55A 4A3MH 4DTGL 2IDFA 1HILA 1DEDA 3ETBJ 3GXMA 3Q1SH 1A6AB 3DX2A 4AXWA 3PCOB 1QR1A 1KJVA 3AFQA 3ILQC 1SY6A 2XN9A 2X2IA 1IFHH 1NBYB 4PJDF 1KBVA 2HKFL 4Z0BL 1ETA1 1U8JA 2G60L 2X41A 2YQ2A 4LT7A 1PKQB 1GGCH 4MRCA 1CD9B 2JXMA 5CFHA 3BT2H 2EDWA 1FO0L 1HH9A 3OKYA 4J8QA 4R90L 3AWGA 3OX8A 4WWPA 2VZSA 1A7PL 1UWEL 3BH9B 3O4OC 3V6ZB 3F2CA 2SEBD 2G2RA 3B83A 4AMXA 1K8DA 1N32Q 4LLWA 4EAEA 2IJ0A 4W9ZA 2ZUUA 4QXGH 3S2DB 2DQCL 2R56H 1JPST 3E5SA 3LRGA 4DEPC 4A3JH 3D4RA 2IBZX 3O4LE 1OB0A 4AMWA 4Z7VA 1JK9A 3E9TA 4DKDC 3E2HB 3QUXD 5EV7A 4BY7B 1EJFA 1FSKC 4P2QE 4WI5A 1HXYD 1SBBB 1YHAA 5IGGA 1DSYA 1REIA 2GSGB 2OI9C 3AM8A 4HIIA 4LSRL 4GZYC 3CC7A 5K1JA 5T1LA 1A2YB 4YHNB 2R0ZH 4ONHA 3WAKA 3WV0A 2VUKA 1TYEB 3O6FD 4B9ZA 4AQ8C 1HL4A 1WPCA 3ZYIA 4ZW3A 2Q10A 1B4TA 1XVSA 1SXBA 3EYQD 3QUXC 5IHBA 4ZS6D 1U58A 2VDRL 3Q3GB 2FJUB 4MHEA 3VQLA 3CXCA 4XBGA 1UEAB 3RWEA 4FXGB 5T5FL 2AFNA 2XQYA 5LAXA 1H8SA 1IGFL 1Q1BA 1OGSA 3B2UD 4N0UA 2NVYB 1PZ5A 2AXHA 4JVWA 3CCLA 3NCYS 3O6FC 3NIDE 1OM3L 1SBSL 5BS0B 1N6VA 3EYQC 5CJ5A 4B9JA 2EC9T 3MGTA 3EDFA 3O2DL 4ZS6C 3WIFB 2RVLA 5CGYD 4CSSA 4DP8X 2MHVA 3ESNA 4J15A 4KUZL 1FNLA 3VFTB 3ZKMD 1J0IA 4U31A 4ES9A 1JNHA 3UABA 1U91B 4KVNL 4AYMC 1G91A 2Q1EA 1HEZA 5HYJA 3ZK0A 2K5HA 1AGDB 1KEMH 3PDOA 4NQTA 4QJ4B 2MRYA 1YY8B 4L1SA 2JSFA 2ZPKH 3NZ8B 4OI9A 1T7XA 5AFWA 1LO5B 1HQRA 1LO2H 1WTXA 1FJGL 2ERJC 4P2RE 3EO0B 2K28A 3DETD 2D7TH 1JZ5A 1SE4A 2O5XH 4PAZA 5I76A 2GSIB 2XQYK 5HHME 1NUCA 1H3WM 3F3HA 2DDQL 3CRLC 1FGVL 2DQ6A 4P4RB 1WF5A 3K7AH 4A3CG 2HMID 4F3FA 1V55B 2NR6A 1CI3M 1RUKH 1XHHA 4O0AA 4N90D 2XN0A 1PLGH 4H0LC 4IU2B 3V6FB 3D6GA 1NKOA 3D0VA 3DETC 4TNVK 1BF4A 3OL2A 5IBTH 4ZNCD 3HI1A 4FQJH 4A3IG 3MRCB 3NG5A 3ILDA 3KDMA 3MRRA 2H1LM 2MQCA 4L1DA 4EVNB 4L05A 5DWUL 4OCLC 1FC1A 2P43B 2R69A 4ZODA 2HMIC 1XWEA 3O6KH 1RHHA 2XZCL 5K9JL 4L5QA 3OTOL 1N18A 3N1PC 4ILWA 5KYWA 3EUUA 4JFXA 4Y4FB 4KKBD 3TH3T 1MQKH 2VQEL 2VJ0A 3MOAH 4M6OL 1AGCB 1IT9H 5ID0B 3SPCA 3TV8A 5JW5A 4BCXA 1KTLB 2EDBA 3REVA 3S8GB 3V52L 1P16A 3U79A 1JCVA 1HINL 4HX1B 1R3HA 4K23H 5IHWA 5C4XG 1R3IH 3GLZA 1Q9LA 3FKIH 4Z18A 1C5BL 4JW3A 3FDWA 3DKHA 4CJ1B 1UYWH 1SNMA 4KKBC 2VDNB 3I2ZA 4ZLTF 4WI3A 3TZVB 2KYIA 3HNVH 4N9GA 5EFIA 3RVXD 4P4KB 1H15B 3M1BA 2XVKA 2DWEB 3OC5A 3X17A 3WJMA 2J72A 4A3BG 3I70A 2ZJSL 4ZSOA 1J1PH 1VS0A 3HMXH 4UNVA 3PE9A 3ZT6A 2Z31D 2BS71 3E6HA 1KTCA 4LFCQ 2QVKA 1ZVYA 4I18A 4Q6KA 3CDZA 3DGCR 2XYCA 3HAEG 4QY8A 3TN0B 2CHDA 3ZDYE 4M5YL 2A6IA 3AT9A 4AG4L 1MFAH 3RVXC 2SNSA 1RJZB 4ZFFB 1Q94A 1CLVA 2QSCH 4MMXA 4FKEA 2WXGA 2QFRA 4XQQA 5CV5A 1QQDB 2QMKA 4NNXB 1V7NL 3BWAB 4M7JH 3GSRA 4B5ZA 5C09E 1EYCA 3L3HA 4OF7A 2DYPB 3L81A 2Z31C 1P4UA 4KD3A 5IHZB 1FN4B 2PCPA 4O58H 4HYTB 4LARL 5DRWA 5FS5A 1MLBB 4WI6A 4KX7A 3RIFK 4X8JA 1SVBA 3I4MH 1MI5B 1TT2A 3IRCA 2I7OA 4U1IA 3RX7A 5IJBC 3HOVG 1UTDA 5GGRB 1GUOA 1T5WA 4A7UA 2WM0A 4GB9A 4NPYB 1EUTA 3GBMH 3AWFA 2JQAA 3PF2A 4WW2A 2X05A 5C6WH 4R2GD 1EAPB 3UJJL 5E2WH 4L0ZA 1IL1B 2A99A 1L0PA 4JFTA 3IDYB 1VZHA 4HIEB 4NP9A 4X4MA 4I0PA 1A3UA 3RNKA 5FLVA 1BCPD 3K0YA 5JHDE 1GVPA 3BESR 3WMPA 4A3IB 4NCC2 1J88A 5DQJA 1P6WA 4GYBA 3RDJA 3HCVA 4NNPL 2PCFA 4JDTH 3PJNA 4OT1H 4R2GC 2DRUA 1M56B 2FXQA 2N49A 3FN9A 3MR9B 1L9RA 3FTGA 4XRCA 2A9DA 3UJTL 2NXZB 3IAQA 1BAFH 4M8QB 3EGDA 4CC4C 1B9KA 4X7DC 2XJLA 2GTQA 1GYVA 2BP0B 5FDYA 2J12B 1ZT7A 3OKDA 1BCPC 4G7QB 1WDAA 3HG1E 4LSVH 1KJMA 2DYSB 4B7LA 1MREL 1PSKL 2K5NA 3X3FL 5I8OH 4UANA 2EXZA 4OTXH 2AGJH 1NWPA 2MCAA 5C4XB 2KHIA 3X3NA 5I1CH 2YARA 2P80A 5HDWA 5A3ID 3CZJA 2DQDH 4P57B 2BVOB 1U95B 4XOAA 5CP7A 1IGML 3MGOA 2XHNA 1K3IA 1ED3A 4BHUI 2WACA 4BFIB 5I2YA 5IQ9B 1UEBA 4X6EA 1LV9A 4LL1A 4OZGE 4NZUH 1AN8A 1NSNH 2DEYX 1TJHH 4PJ7A 4UOZA 4NQCD 4C4UA 4A3BB 4I77L 3MA9H 4XBEL 4JFEA 2ZOWA 1QO3A 2VXTL 1WBZA 1N6QH 4G80A 1LJMA 4NIKB 1N33Q 1BPLB 2YTXA 1UT9A 2CO2A 3HAEB 4MJ5B 5MEND 2OMUB 3SHLA 2LKVA 1LVEA 3HZKA 4ORZC 1NGWB 5D7EA 2ITEA 3TZDA 3BVTA 5JHLL 2I69A 3QUKB 1TEGA 4R84A 1DVFA 3WHE1 5L7XH 4YE4H 1JWSB 3I9AA 2CFMA 2YFOA 3QB3A 2WY3B 2XWJA 3F7PC 3EJYC 4W9KC 2K5QA 1N9WA 1VLXA 3JBG7 4NJ9H 1PFSA 3HNSL 4OSUL 4XPAL 5CN2A 1B70B 1DCZA 1TZGL 3N1MC 5J1ZA 4Y5VB 1PH4A 1LP9B 3O3DB 5FFOA 1HRJA 3ERXA 3LPFA 1RFDH 3QFDB 3VD7A 2Y0SG 2F74B 3L48A 1NCBH 4RAHA 1WBYB 3X12A 2X89A 1LT5D 1FLTX 2EPBA 5IP7G 3Q0AA 3EH4B 4DW2L 2BNQB 1HZ9A 4PLJD 5CIPA 5FK9A 2WFWA 2YXMA 2Q76A 4U0RB 1PL3A 4YDVA 2F0HA 4OM0H 3T3MB 1EFQA 3DJRA 5TE4L 2I26N 4WJ4A 2UUDH 2IALB 1TJIH 2YEQA 5FYJU 1SROA 5BZZA 3PUYA 2LGNA 4NMZA 5D1XA 5F7FA 1B9MA 1N7ML 1PMRA 3VFOA 4NP4H 1W91A 4PLJC 1N3NA 2DQUH 4HH9B 1B3QA 4ZD3H 2FMCA 2B63H 2DH2A 2IGLA 2WP3O 3HI6L 2XLLA 5CJQL 4CVXB 1AHWA 2J21A 3CZFA 5D7IB 2MWCA 2RBLA 2H0JA 4OZHA 5F9JB 1KJ2B 3KBPA 4EVOA 4JM0A 3Q44A 4XP4L 3RX5A 2OYPA 1VACA 2JJTA 3QXTA 5EULV 4BA0A 3QYMA 3VXSA 1BBDL 1EHLH 2QPUA 4PS4L 2AK4A 3IE4A 4UV7H 2VM4A 3RWJA 2V17L 3I75B 1SXNA 3JZ7A 5KVDL 3S48A 4OZIB 1ICTA 3MLUH 3FUJA 3S36L 4NZTL 4Y5XC 1AG6A 1GJXA 1MDTA 4UT6A 2CIKA 1SOQA 1WTPA 1B2WH 3EG9A 4N90E 2A5HA 2OQJB 3D33A 3IDXH 5E3FA 1RK7A 4A04A 1JWMA 3T08A 1RMFH 1GMIA 4NI6A 4P3DA 4KKZA 3KWUA 1CZWA 3GRWL 3AG2B 3N52A 1CXEA 2D7NA 4PJCE 1FDLH 1QATA 1CBJA 3E3QC 5CU5A 1A02N 4AEFA 1T2XA 4P5TB 1NLBH 3PF5A 2NB0A 3BYYB 4JRXA 4P9MH 5C0BB 2P5WE 4DK6C 1HWWA 3LMJH 4BFOA 5LBSA 4CNIA 1P4IH 4WI9A 3PHQA 4DSYA 1VQCA 2KUTA 4I89A 3D08A 3WS6C 5IYDG 5DM73 1F18A 1KYOK 1JTOA 2FECI 5SX4H 3ZT5A 5KYXB 2VDPL 4Z7QF 2CHBD 5I1GH 1C5DA 3FQUA 4MXVE 1HHGA 5D96B 3ZQWA 5L88L 2FSEB 3P30H 5ISZB 3ORJA 4K3EL 2W88A 2COVD 1IGCH 1X7QB 4J3UA 1I1YB 4UILH 4PRIB 1GCYA 4PJ8A 1URIA 2E0PA 4FMVA 4UB0L 5BRPA 4JJ5B 2F0VA 4HWBL 1E7ZA 1MSGA 2Y0SB 4LCCC 3IJYA 1E6OL 1A1NA 1MFBH 2V37A 3FHQA 3L9BA 2BVPA 3THML 4QRPB 2VMJA 1IIKA 2HVJA 1C1EL 1O9VA 3NHHA 1WAEA 2ZWLT 1EXGA 3C6EA 43C9A 5KUMA 4F15B 1AC0A 1ZLVH 3DEOA 4G7VL 1QLRB 5I8KH 5SX5H 2FJ2A 4WVRA 2YJLA 4XMLL 4X7TB 4HEPA 3U6XA 3S5YA 5BQ7A 4C1NK 1GGYA 1I1AA 2Y72A 3MOBL 1E4KC 3LHAA 1KB9J 1Q1EA 4KFZC 3OWEA 1BVSA 5DJ8A 2L4NA 3MA7A 1BMWA 1ZA6B 3PHOB 3ARGD 4A3FH 3NQKA 4N8VG 3U9PH 5B7FA 8FABA 1E3ZA 1W16A 3QCVH 4I1NB 1HZLA 4OVUA 4NO0A 4DT2A 1WWCA 3V05A 5DJYA 2Q20A 5JVG3 5FCSH 1YNLL 3DUSB 3OQ3B 4J4PA 2CIIA 3BJLA 2J55A 1R5WA 1SLVA 1TEFA 3SQBA 3IFDA 2F8OA 2H45A 2F0QA 5D2NE 5HI3D 2DM2A 1WGOA 3TO4A 3ARGC 3UYPB 3K8AA 4L0PB 1SDYA 3FN3A 4OZFA 2OWOA 2GQHA 4ETYA 5H37G 2W9DH 2BX5A 3A4FA 1KCLA 3APCA 1OVZA 3OIQA 3CIAA 1SM3H 3UX9B 3GSNB 3VFPB 3W1BA 2Q2HA 3TSSA 2V2WA 4NWTH 3WCYA 4AYBG 1NCCL 3QR8A 1JGDA 5FM4A 3S1MH 5JJZA 4V1DB 5C2BH 3CVHH 3C8DA 3EFDH 3Q1EA 5HI3C 3VGDA 1E5BA 4WHCA 2BIHA 2K4KA 2X6BA 3S35L 3J81L 2EDOA 1QNKA 5KW9H 1SMXA 4GAGH 4KTAA 1NOLA 4XCEA 4NQDB 4XMTA 4X42A 2PZUA 2BP8A 3EH5B 4LSTL 1U9RA 5J39A 2VTFA 4HT1H 1KMGA 3OGCB 4P73A 1RZ8A 5FGBC 3SZKC 3GSUB 4K73A 2BFVL 5ETUA 2ZSWB 4AQAA 3S3JA 5IW6A 4IUQA 5I23A 4BKLB 2HVKB 5GHWL 4AIZA 4RG1A 1SN5A 3UTZA 3S96A 4KUCD 1F4WH 1EY6A 1T89A 1UD2A 3C9NA 1X6NA 3CFCH 1DOLA 1FYTA 5E5MB 3IU3B 4PV1C 4WFED 4HC1L 3OPZL 4PRPA 4ERSH 3DM3A 1QCBD 4JANA 4NZRH 5F1OB 3T0ED 3QEQB 1D2OA 2AHOB 3TP7A 1YECL 2ZWZA 4UAIA 4NQCE 1PKOA 2VNCA 4A66A 4GNXB 3G6JE 2GHZA 1NBVL 3OZLA 5DRXA 2J8UE 5KS9A 3CMGA 2KKQA 3FFDA 4ZS7H 4LCWA 4YSAA 3K2KA 3KHQA 3R0NA 4PRHE 1CLOL 2K5DA 2QDVA 2OZ4H 1X54A 3VSTA 1F2YA 2P8PA 1QNUA 5EOCL 3H7BB 1KABA 4V11A 3T0EC 1WVZA 2YRZA 3AGWA 3OKLA 5EC2A 1HCZA 4I5BB 2G75B 2VDLB 3IXAA 5JOFA 1S5IH 3BLBA 2AQTA 2DL2A 4N8VB 3VI4F 3X1FA 1BVNP 3EGXB 1I6HB 2FATL 1YZZA 3GMOA 1V9PA 1D5XB 1OP4A 1TZIB 3I84A 4N24A 3M4YA 4LSPL 3SDCA 3H91A 5C0AA 3GO5A 1EFXD 1D8LA 2CUHA 2XY2A 1Q72L 3KPQB 5LDSA 2WTRA 1TY0A 4YO0A 2K7PA 2IGTA 4HUVA 3QNYB 4IBWA 4QNPE 1MAML 2PO6A 4M6AA 4P23C 4PGEA 3CLWA 1PFMA 1SNDA 3NTHA 4WRDA 1K5NB 3V0FA 4X64L 2OX5B 4N5UA 2EVIA 3NFSL 4BQ9A 4DFAA 4YIQA 4JI5L 4TQIA 5JJKA 5DZPA 4MXQD 4PZ8A 3CVBA 4WUUB 2VJ8A 1HXMA 3QQDB 1VZIA 2EDFA 4P2CG 3RI5F 1BDYA 1NFDA 3R06A 2B15A 3QJFB 1NCWL 2W0KA 2ADYA 1NCGA 3W11D 2GJ6B 5C1MB 3V4PA 4PZ7A 2GTWB 2J2ZB 1HDMB 3LSOA 1CMOA 5FHBH 4DV1L 1GR7A 4MXQC 2HJFB 1TTCA 1A3QA 5BMFL 4HCRA 4OI7A 3E3QE 2W0FA 5EN3A 4XPTL 1YNKH 1IBLL 2VXSH 1I4RA 3CQFA 3OAZK 3IRZA 2ESVA 1L3NA 5FYKH 4B5EA 1INDH 1J8HB 1HWHB 1S40A 1RIUH 3JUYA 3MUY1 5EU3A 5IT2H 3RIKA 5A2QL 1VQOA 1M1KC 4KKTA 5IEKB 2WKOA 1Y0LB 2WLIB 3ZBMA 3H9SD 4GG8A 4JPWL 1SYSB 4JKKA 1EBPA 1MEXL 1RVFL 2CHXA 2F7OA 4LLUB 2JKJA 1CDCA 1MXGA 2I24N 4FHJA 1H3PL 5IG7B 5I1JH 2Q3AA 3V79C 4X6CF 2WO2B 5LVEA 3AYHB 2M26A 1CICA 3K0XA 2YPVH 2K1MA 1OL0A 2CXKA 5IGCA 3CVIH 3AT8A 3POHA 5DHVH 3FYEB 4YX2L 4IMKA 1HUMA 3A6CH 2FCBA 1UB6B 2YWYA 3T8XA 1EEFD 3P77B 1A4CA 2O5ZL 2V5RA 3CFDA 1UENA 3L9YA 1WIOA 2WAQE 1RHFA 3GSXA 3C75A 5TDNA 4UOJA 4LVNB 2B20A 1FLRL 1IGJA 1ZEQX 1P7BA 3Q0HA 4ODTL 4UNUA 4KK7A 4P5RA 4PTTB 3S88L 1FJ1B 2L7QA 1K6QH 5I18L 3SXHA 3T2NL 1NDGB 3VMPA 2F0SA 3GNML 3LIUA 3UBHA 2EDHA 4OF5A 1KJ3L 4TQUS 4XPBL 4ZXBD 2ENJA 4HXAL 4AMKL 5C0ND 3VH8G 3OSOA 2F5AL 1RTNA 2IDSA 1HIML 5D7KE 3WFEL 3M17A 5FLXL 1FVEB 4C3HH 3U0TB 3WN5C 2ALYB 3T6XA 5KN5B 5I9PA 2WQSA 4H4NA 5FW6A 5DURD 3LPGA 4GW5A 1F58L 5EWIL 2CGRH 3JT0A 3US1A 1JNLL 5M9OA 2EYSB 4ZXBC 2MPMA 1BLNA 4P2CB 1UOVA 2X6CA 5ERWB 1WG3A 3SYQA 1KB5H 1YEFH 2V9UA 4U1LA 4XP1L 1OO9B 1JMZA 5BW7A 4RZCB 4KV6A 1C08A 5GGUB 5DRNB 4B3RQ 3MNWA 3UTTA 2RDHA 5KNCA 3GTJH 3AROA 2A74A 4LHUA 3TBWA 1VKXB 3D8GA 4AH2B 5KJ4A 3DSFL 2PNDA 2OCJA 4LF8Q 3F01A 2OSYA 4GSDL 4FEMA 2ZKHH 4N2CA 2KCMA 1RLBA 4XH2A 3TTSA 4KKNA 2CM6A 4PWJA 5EN2A 3U4KA 4AL8H 1U2YA 1I7RB 5K36H 4D3CL 4IZ8A 4MYPA 2JKTM 5J9PB 1QVGA 3J81E 1LEKA 1K83H 1PFNA 2Y4SA 5C7XL 1IAOB 4X99B 3SGIA 3I55A 2VABB 3QPXL 3M9BA 1INQB 1XYIA 5DC4B 1TXYA 2IW3A 1UG9A 2VR6A 4PG2A 4PJ5A 1OK0A 2CLVA 2LVEA 3BZCA 1WICA 1WHPA 3OAYK 3BI9X 4Q56A 1STGA 5AVRB 2B2XL 4M61B 2XKNB 2XXGA 1DOKA 4PSPA 3L4WA 5KBDA 3L6FA 4UMGA 3D2TA 4X9HA 5KAQG 1QTPA 4JJOA 3IKCA 4OCWL 2H7WA 3MEFA 1H8NA 1C7YA 1PZBA 1ZS2A 2E4FA 5AVSB 5BJTB 4P46A 4DAYA 3QZLA 1ZTMA 2BOBA 3ECBA 1H19A 1FAIH 2D9CA 2D0FA 35C8L 4YWGH 3B9DA 1TCRB 1QSED 1RK0B 2WVVB 3ARED 3D87B 1L0XB 1J5DA 2MTAA 2F0NA 5E95B 2R7ZG 1D6EC 1CFNA 4J1UB 2FHCA 5IFHL 3GHEL 2K75A 2GT9B 1P5UB 2UXGA 1AXSB 3IDMB 1H0DB 4LSSL 4WFEE 3UTSB 1JGEB 4KJYB 2VZVA 2HB0A 4E0RB 2AJUL 4U1NA 5JPNB 1U33A 4D0DB 1GY1A 2IT1A 3H9HB 4BSVB 4HVBA 4NZFA 2WNGA 1UD4A 3EHBC 2AABH 3ULJA 2X4RB 3AREC 4KTEH 3RIAK 5MHSE 4PJXE 4KKLD 4LKCB 2HCIA 3I8ZA 1EZVY 4HKZA 4PG3A 1IZ6A 3QI9C 5BNXD 2P3YA 4IFDH 1HHHB 1DQMH 2E6QA 3MLYL 2OR7A 4GKJQ 3S37X 5LDUA 5I1IH 1HSBA 3QT2A 5JQIB 2AI0L 4F7KA 1M4VA 1ASPA 4F9LC 5D1QB 4QGUA 5DK2B 4GN4B 1B50A 1MH5A 3W0WA 2NVQH 4BH7B 4ZMTA 2KCCA 4Y4KC 4JM2D 3QORB 2VDKH 4HAFA 3IRPX 1SLUA 4TTGA 3L5WB 5DT1L 1PY9A 5B3SB 4Y16D 2FYYA 5ESQB 1UVQB 3ZDXE 2OV0A 4MNGB 3QPQD 4RH4A 5DQ9B 1EEUA 3GMMA 4ABQA 3S16B 3BOVA 4KY1L 1EZVX 4OGXL 4KKQA 4WCYL 1FH5H 2DI8A 4MQSB 4TNEA 3BZKA 2IC2A 1V3MA 2CDGA 5E6IB 3CCMA 2MFNA 4JM2C 4ELMB 2BC4B 4RFEB 1Z5LB 1KFGA 3FNKA 3CMOH 4KN4C 1KIPB 1S7UB 4ETQB 2XNAB 4Y16C 4AY0A 1U0LA 1QFUH 3DROB 4KV5E 1LEGB 2YPLA 4RMBA 1PZSA 1BVOA 4LNVA 4E9WA 3MLSL 3NGBB 3NIFB 4GKZB 1I3RB 1NSNS 1AP0A 2YLHA 3F7YB 4FFVD 2WCPA 4C83B 1DEEB 4LLDA 5D72L 4BH8B 4A6YL 3D09A 2BY3A 2J88L 3K6FA 3DUZA 1HZHH 4AV4A 1QRNA 3OQRA 3GI9L 2H32H 1KPVB 3T1YL 4MDJB 5IB3A 4JI6L 1RJYA 3M45A 3MJ9L 5JTWA 3D25B 2APTA 1LO4H 1GS6X 4JQVC 4QWWD 4JM2F 5EZPA 1VQPA 1G0YR 1R33A 3AQDA 4LIQL 3MHBA 5LGKA 4OFYD 4K8RD 3BP7A 1B6UA 3QG6B 4FFVC 3Q8EA 2XIIA 5A2QE 4LU5H 2BOSA 3WS3B 4UT7H 5L9DL 1B7YB 3OR6A 4PPTA 4TL5A 4R4IA 1YJNA 1V05A 3LZNA 4HJ7A 3I6KA 4YR6B 2PMZB 4XI5D 4PMEA 2R3ZA 5DHMC 2VW6A 5FJ8H 4EXKA 2R7ZB 2WMPA 3AADB 4ZFQA 3CCHA 4BRJA 3K2MC 4HHWA 4HJJH 5DLQE 2HCCA 3MV01 1JMCA 1S8DA 1GGIL 3OPUA 5E5LA 4QWWC 5FYJD 3S3PA 2EC9U 4K8RL 1DVSA 5E9NA 4N8FA 3QDMA 3T5WA 4YL4A 5E8NA 1T0NA 2QMJA 4K8RC 3VFVA 4F7PB 4LCUB 2NQDA 2PXYD 3ARPA 3H9SE 3X3MA 2E3VA 3HRPA 3QW9A 2ADFH 3JV6B 4XI5C 3BP5B 4NRYB 1XSJA 2ENBA 1QNIA 5FW7A 4Z3IA 5FYJL 2D7MA 1ZA3B 4FFZA 3B3BA 1RZFL 4G1EB 5AB1A 4BE6A 3BZ5A 1N68A 3GKZA 3FULA 2DWYA 2Z8WC 1QSFE 5JMOC 5KVEL 3BWUC 4NC0B 3HMXA 4F9PC 1X56A 3D9AH 5F9WB 3K1KC 3U1SL 6PCYA 4OM1L 1LEIA 1NCAH 3MXWH 4GG6B 2EDNA 1WFIA 3QXDA 5IMLB 2PXYC 5IB4A 4OL7A 3HOZG 4JFDE 5DO8A 4UIMA 4R7XA 3CC1A 3HHSB 4AGOA 3RR5A 3M85A 4C3IG 1E4JA 3ARFA 4BBSG 4DUXA 2BOCB 4G9DB 4BSWB 4UI2A 4IRZH 4QYOB 1YEZA 1FZMA 3I74A 4NQEA 4NT6A 3PQYB 5G5DA 4JY5L 3ZVVA 5IMMA 2G9KA 1YNND 4MLIA 5FLXE 1ZHBA 2J6EL 1DQJB 1E27A 4L2LA 3BMVA 4QHKJ 4I4WA 4X6FB 5M95B 5JUEL 3MLVH 5DZAA 3V5KB 5J7CC 3FZUD 1NJ9A 1S5BD 4JBWA 4RSYA 3KCPA 2V3DA 4JO2H 4FOMA 3RUZA 1L3WA 1Z2KA 2AITA 2C9PA 3BWUF 4M4RA 1MPAH 4R4BB 1U4MA 5BZDB 3MNVB 2FQEA 5BO1H 3JVFC 5LWYL 1WYDA 1FNEA 2H6PA 4C2MB 1R5VB 2R29L 2RKSA 2RHSB 3SDXB 1YNNC 5CGKA 1JJUA 1E7VA 3Q5OA 3RGVC 3TBCA 1JD9A 4LF7Q 1PH3A 1HNZQ 4J3OD 4HOZA 2A4CA 2CJUL 3FZUC 4XZUB 1E0OB 2AJZB 4CUCA 4G7HC 1KIUB 2ZXOA 2FAUA 2KHAA 3NA9H 4NBZB 4WFN3 4TLKA 4Y8DC 3U0WH 1S46A 2FUTA 1GYWA 1NTDA 4R9WA 4XPGH 4B27A 5LGHH 4YY3Q 5AAWC 4B96A 4YUEL 1M7DA 2VXQL 4MTMA 4WY7H 2Y7LA 1HOCA 4J3OC 2D73A 2OZNA 2XFXA 1CFQA 2I32A 1XJVA 3OKKB 3CFKA 3MLWL 1WFTA 1FVDA 3F12A 5DJ0B 3ZHLA 3SO3C 1VFUA 1ILSA 1JHTA 2RFXA 3LXBA 4IRJD 1G7IA 4NX0A 5T1DH 5IEHA 4YSDA 3V7MA 3U4BH 4CN4A 1YN6B 1F6AB 4KO7A 1S7TB 1RZJC 2DBJA 1XSKA 3RFZA 1FZKB 1WD8A 4X4YA 5M5WH 4LSQH 3DX8B 4A2HA 5DYOB 3L3OB 4F8NA 5L2JA 5FO9B 1A22B 1DBJL 3HRZC 4BY1G 2A9CA 4HCEA 1KLGA 2B8OT 2H5XA 4L5SA 2YYZA 2I7SA 3CN3A 3HPJB 2W8CA 1TPXC 1TVHB 2ZCHL 3JWOC 2R1XB 3QHFH 2BHZA 1IQDB 2K6WA 5E9DD 5IW1B 1XXGA 2CK2A 4L3ED 2R23A 4J6RL 2LMCB 2H6UA 5LL6S 5JPMC 1MCBA 2TRHA 5G4NA 1O5DT 1OGPA 1RIHH 5C4ZA 4RDQF 5CS7A 1TS4A 2HJLA 1CG9B 4QIWE 1NM9A 1EY0A 4DR5L 5L4JA 2LV4A 3FRUB 4TOYH 5JNYA 2CRMA 3LIZL 1Z1WA 4OUOA 1PQZB 1RL1A 4U3SA 3QWRD 1YJDL 1JL8A 4APXB 1LYQA 3BH8A 2FQGA 1XAKA 3HOZB 1N0LA 2AXFB 5HHQA 1QSEE 2L12A 1W72L 2CO6B 5C71A 3WD5L 3LRSB 4Y2OB 4U68A 1EK3A 2ZKMX 3DNKA 4IFDJ 4X4XB 3DWQA 4BBSB 1I1RA 2QL1A 3MBXH 4G5AA 2J71A 4HPYH 3RY6A 2BVTA 4MD4A 3HKZB 4Y5YC 3U83A 1QG3A 3CQZB 3LCYA 5IGXL 1TTRA 4BBWA 3BPCB 3QIBA 4HG4J 3WTTA 1UM5H 4FNLL 2PCXA 5GS1B 1ZHKA 4YXKL 1H9JA 1U8LB 4GXUN 1J5CA 1KCUH 5SWSE 5EU7C 4OD1L 2WWKT 1A6TB 4DN3L 2WQUA 4WK0B 5B4MD 3M4OB 2EY2A 3S5LB 4KPHL 3DIFA 2DJGC 4XQJA 1O6VA 3CAFA 1I3GH 3FUKA 3X1GA 3C5XA 3BN3B 2MNUA 2BRRL 4HGKC 2L3BA 4XTCS 2R7FA 2F0EA 1SLJA 2BCKA 2P5PA 2O2LD 3CLEL 4KWUA 4RX4A 5ABDE 4LP5A 4UDTA 1BLIA 5ELOA 1ZHLA 3M8OH 4K3JL 5EU5A 4HWZB 1Y7VA 1YVLA 4UYQA 5B4MC 5D5MA 3K3QA 2BVUA 2X0VA 3U9UA 2CQOA 2V5YA 3K5RA 4NSKB 2KEDA 2FX9H 3MLTB 1U3HB 2NYKA 7FABH 1JE4A 5EQ0A 3IDGA 3MRFB 4UM9D 1C9SA 4YHHL 1XB6A 2E9JA 3QC6X 1KULA 4JDEB 5GRJL 3V0IA 2CVRA 2F54E 3OSVA 1MFEH 1BXUA 4B6ZA 4XZ4A 1AAJA 4ABVA 3UERA 1MW0A 3WXVL 2KCNA 2RJMA 4O9HL 1CTOA 3RUGA 2EY5A 4N2LA 2YN3A 2YA0A 4J1MA 1FPTH 4MAYA 4BY1B 1XF2B 1VENA 2UUDK 3MRMA 1O5PA 4S1RH 3G6AB 1DUZA 4HUXB 2XV6B 3RVWD 4LIQE 4H8WL 4APQD 2R0WL 1EY4A 5TDOB 5EU4A 2NXYC 2Z6KA 1XGYH 1I8UA 3G5YA 4H8WC 5AKRA 4Z7IA 1TZOA 3RAJH 4HTHA 1RJLA 3OMIB 4O2CB 1TU2B 4XNUH 4LW1A 5DK0A 4QXUL 5GS2H 5CCKH 3FT2A 2VW4A 1YDPA 3N40P 1TZ8A 3P54A 1GZHC 5SWZB 4Z7OE 5T3ZD 4DGIL 5IIEB 4WTZG 1Q0XH 1P4BH 4HGWB 1YA5A 5AB2A 2BHFA 1QLFA 4APQC 3RVWC 5DLML 5I6XC 3MOQA 3S2HH 3O3BA 4HF5L 3BQUA 5IV2B 3US0A 4N1CA 1JV2A 1V5JA 1J1XH 2A9ML 4UZUA 4FQHA 5ITBL 2KH2B 1SJHD 2OTWA 4GRLB 2P26A 4GOPA 2XZZA 4TLSA 1O78A 2L5TA 2MO1A 4XCCH 4QI3A 3V4VL 4LEXL 5E08H 3OAUH 5B39G 5A7BA 4Z8FH 3D05A 5FYJE 1X5YA 3A8IE 1D5IH 1EGJL 2ROYA 3HOYH 2VQ1B 1WWWX 5EZJA 3ET9F 3QJXA 4GUOA 2WANA 2UZPA 5KVEE 2CLZA 1D9KB 4YL9A 4KI1A 2RDFA 4ODUB 3M3YB 3TBVB 4H13C 5C07B 3U30B 4O02L 1GAFH 1NGPH 2QEJC 3GB7B 4MHHI 2HT1A 3GTPH 3G08A 5BOZG 4BINA 2J25A 4P9HC 3T3PE 5J1AA 4Z7UF 3MRPA 4YLCA 3P75A 4BK5C 5DMKA 1JZFA 4PJHF 1DQLH 1GC1C 3K6IA 4GKSB 5I6NA 1RULL 4MCZB 1MI2A 1QHOA 4DCQA 1BD2B 1KYAA 1XMEB 4R96A 5DI8A 2FINB 4OLUL 4OI8A 5FO8A 4DK1A 3PIQA 4BXXG 4A39A 1R3JA 1ZVNA 1WT5A 1RZKL 3EO1A 1T4KB 4AQEA 4IIQB 3SE3C 4DO4A 1RZKC 2HKFH 2YD9A 1QRKA 2PWGA 4Z0BH 4AZ8B 5JW4N 2G60H 3PDGA 1AOZA 3EIVA 1FFOB 5E1QA 1OGAA 3TP6A 3VFRA 4R90H 1FO0H 2X4OA 4MNOA 1YPZA 3V0VA 5HYQA 1RXLA 4J7RA 1S9VA 3BUQA 4N5ED 3DO7B 5FLMG 4HKJB 2NN6G 2Y6SD 4IEFB 3ZQ9A 2DQCH 3E6FA 2DLTA 1U8KB 3CHPA 3EW3B 2FGWL 3FO1A 3KJ6L 5D7JA 5B1KA 3U46A 4K07A 4WO4A 3TJHD 4L37B 4JBJA 1ZLVK 2O61B 3FUHA 4ZMYA 3K4DA 1U8CA 3N06B 4E9SA 1RD6A 5SX5K 3PWVA 2FL5A 3QJRB 1JCKB 3QULA 4LSRH 4A3LG 2A0LD 3EDJA 3IEAA 4N5EC 2Q7YB 3GTLB 2Y07H 3QZMA 2Y6SC 5D71H 4KDTC 3QS2A 1N4XL 1P4LB 1UE5A 4GSRA 3BVGA 1AGFB 2B59B 1RPQA 1A7NL 3CVHA 1YNJD 3TL5A 5C08E 1CKNA 2D4DA 3VWKA 2VDRH 1JDDA 2F61A 2ADGA 4P3DB 1AQDB 1UQSA 2P52A 3FSWA 2A0LC 5T5FH 3UO1L 2MFIA 2WJ7A 4Q97A 5L8LB 1IGFH 1AR1B 1UKQA 3E2HC 4DK3C 3DX0A 5JIKA 1ZV5A 5E8OB 3FQXA 1SBSH 1WVLA 4Z6AT 1YNJC 2ZXDA 6FABL 3OXSA 3O2DH 4PGBB 3HKSA 3U4ZA 4EI5B 4HIDA 4DKFL 4JJHA 3EQLC 3CBJB 2H2SD 4JDVB 3UDXA 4KVNH 1UWVA 4WK2B 1G1OA 4JCMA 4PWEA 5E51A 1AD0A 2X0UA 5E9DE 2Q86B 5BS0D 3UIZA 4L3EE 4N85A 3TCLA 4L23A 1EZSA 3T9WA 3C5ZB 5FV1L 2BERA 3SB3A 1KG0B 1SJVA 4PRAA 3H0TB 1SYEA 3N0PB 4W81A 3K7UC 1OPOA 1E9PB 1A4BA 1DUYB 1YEIL 4FXGC 3BP4B 3ZL1A 5AYTA 1FFNA 4HJ0C 4AEEA 5J56B 1SNOA 3AU1A 1CFSB 2XPGA 3JWDL 2B4CL 3A0OA 3JXAA 5T33L 5EKKA 4FFYA 4OGQC 2FBRA 2B8FA 4BUQA 1AHKA 5I0ZA 3NFNA 1JPSH 1Z9PA 1RZGB 1SRUA 4WZ9A 5IWAQ 2KJXA 1LO5D 1D5ZB 2OZ4A 2IPUK 2IO5A 2J4WL 5HJ3A 2J73A 1QEWB 1GGUA 3K81C 3Q48A 2P42B 3VFSB 3GK8H 5EU7E 1KB3A 4UQ2B 1PH1A 2LU4A 5FO7A 1DP0A 1Y1DA 1GS8A 4U1JB 1KCKA 4X3TA 3HS9A 4UTAL 2OAAA 1CFMA 1AOHA 3PJSB 4NC2B 4QHLB 4QTHB 4CVZA 1AQ8A 2HLAB 4NKDB 3SPVB 3BSGA 4CKCA 4P07A 2XZCH 5K9JH 1GGBH 3V5HA 5C86A 1OAUL 3UDFA 4QO1A 2BVQA 1T20B 4GN3B 2OXHB 5IB1B 1ML0A 5FLUA 3ARBB 4ODBD 4JO8A 32C2A 2JKXA 3PWLB 2YAOA 4U1SA 3WE6B 4JI8Q 3V52H 3L9EA 1IKFL 2CK0L 4U1GB 1J0JA 4Y4FD 5B7EA 3JYCA 3NQTA 3F58L 1C5BH 3QUZA 3HR6A 2WUBL 4UDUA 3UZEC 1MOEA 4NAJA 2OTUA 3L54A 1E40A 4TUOB 5MERB 5J0BA 3RZCA 3I3DA 4DR2L 3LTVA 4ONFL 4PJIB 3V0WL 2XTJB 5D7LB 3PIPA 3L3DB 3MRHA 5GZOD 4Y4FC 3LXAA 4LE8A 3TZVD 4LFAQ 3R8BB 3OKNA 3GTOH 1NWOA 4K71C 4OQTL 1IEBA 4P4KD 2NY5C 4IBTA 4FG0A 4RGMC 4AG4H 3U1QA 4M5YH 4MA8L 4QUOA 3MJGX 5KSBE 4CBVA 3SPJA 1K85A 3C6LA 1X32A 1YNXA 1R34A 2NTFB 3LZFH 4KROB 4WI0B 2OMNA 4X0KB 4CGYB 2VDNL 1KBWA 2XOTA 2A6JB 5GZOC 4NB7A 3W2DH 3D18A 5C0IA 1CLZL 1D1IA 2NYZD 4KNUA 3QO1B 3KR3L 3TN0D 4YN3A 1CS6A 3O41A 4LARH 5DJXB 3RL2A 2EDMA 5C0DB 1B0WA 3KPRA 4GIOA 4AV0A 2MPAH 1Y1WG 1J05B 5HJBA 5TF0A 3GMLB 2VNUD 3RWIA 3BEWB 3ZUNC 2DYPD 3G5WA 1I50H 4ZRZA 4HKBB 3GHPA 4M1CD 5GGTL 2PYEB 4JV5L 4QRSB 3H0GH 2OMZA 5CV6A 3VR6A 3MN8A 2XRAH 3TN0C 2DBLL 1MI5D 3UJJH 4IGBB 3FCUB 3FBKA 4LSDA 1K8OA 5CMAB 1HH6A 5DHVA 2EYTA 3T6WA 3VTTA 3HE7A 3J80c 5ESVA 4HSPA 1BQSA 1LD9A 4N8UA 4PG9A 4M1CC 4P48A 3BUYB 4QHKI 4KZDL 1XGQA 1J8SA 1L6ZA 4NUJB 4NNPH 1ET6A 1EFWA 5TE6H 1OP5H 4KDVA 1N34Q 4XB7A 4NYLB 1BF2A 3M6DA 1T3FA 1WZKA 3IJSA 3C87A 3UJTH 4AGMA 3WKML 3OR7B 2QDWA 3RU8L 4BUGA 4EN3D 2BSSA 4MNQB 3UPRB 4MVBD 3SDDB 3CH1A 1YSOA 3MREA 5DNFA 3X3FH 2XTIA 5KSVA 4HHGA 4JUTA 2VDMB 4M48H 4YSUA 1FNGB 2NXZD 4JOIC 4JR9H 3TC9A 1E5YA 3CC4A 4FF4A 4YLQT 3VGFA 3H6JA 1P5VA 3INUL 4QRRE 5ADPL 4AGNA 5HDBB 5C0XG 1CA6A 3IAPA 3MKKA 2UUAQ 5F0MB 4X8XA 4EN3C 3CC5B 4XN1A 5DSCB 2Z4IA 1OXUA 2XQYG 4MVBC 2AQQA 2D62A 5I2IA 4XAKD 5EUOB 1RZQA 5F1KC 4ES8A 3HP3A 1NR2A 2O4EA 1JC7A 1KB5A 4I77H 4XBEH 3P9MA 3BFQG 1GHJA 2O4XA 2NXZC 2NSMA 1WTRA 2VXTH 5AOIA 3NENA 3D3VB 5T1MB 3W56A 2BA1A 3C8KA 3H56A 1PKQE 1GHFL 1CE1H 3VXRE 2BOLA 2E2JB 5BRZA 1QUQB 1X6OA 3GHBH 3KUPA 4NGHL 3NN8A 1I7TA 3PGCA 3IDIB 2VR9A 1YMHA 5JHLH 1HJBC 4L8DB 5LCVL 4UQ9A 1B0GB 3F2BA 3GMPA 2DD8H 1J0YA 4W68A 1O7DC 4C56B 3T04D 3KCWA 4I3RL 3HNSH 3B7UX 4XPAH 2X9XA 3ECWA 1DN0B 1SJXA 5ADOH 3RPKA 1MSHA 3KH4A 5C2UB 1H3UA 1UURA 4N2NA 3KLSX 2VN7A 1LT3D 1M53A 2XWDA 2NY3B 3L4YA 3PPSA 2WUCL 1JWSD 1F2MA 3JAMc 4G1MB 1YYLH 4JG1L 1UCBL 1BQHA 1EH9A 2LU7A 4BSJA 4WDIB 3MJ8A 1JMXA 2CD0A 4DW2H 1QR1B 4B9CA 2HRPL 3A7AB 1C9OA 1BVLB 1ZLWH 3K6NA 1OF0A 1UH2A 1Q7YC 3ARZA 1DVZA 4ZQKB 4IFDI 1F2LA 1EEZB 1U8JB 1A6VH 1SFDA 2GITB 5TE4H 3G6DL 3N42F 1MLCA 4PM1A 5F7AA 1QG7A 2JXMB 2BNQD 1KZYA 1HH9B 4LLYB 3U9OA 2JCCF 1T6BX 1FNWA 3OX8B 1S7QB 5HHOE 3BAWA 3WOVA 2R7EB 2E7LC 4YFLF 1BZ7A 4EQNA 1DBAL 4N26A 4UU9A 3J07A 3QUMH 5CJQH 4Z7VB 2VAAA 1H5BC 1JK9B 2DLFL 1U30A 3D06A 4HFUL 4PJAA 4LLVB 4S0SD 3UAJA 2I07B 2HCZX 1CN4A 1M71A 3QZOA 4XP4H 1E5CA 4HIIB 5EBCA 3PP3H 1BBDH 1YEJL 5DJDB 5T1LB 2E2IH 1VEMA 2YGOA 5KVDH 4A63A 3UDWC 1CHPD 4OWXB 4E9TA 3DJSA 1FORL 2IBBA 4L1HA 4NZTH 1B4OA 5C3TA 3HC2A 1LILA 4FDBA 2C3VB 1U58B 5FA4A 5GQBA 2WZAA 1CF8L 3RWEB 4YFEA 1LP9F 3WSQL 5EUKA 1MNUL 1MIML 1GA2A 5A7EA 4I65A 3GRWH 4PJEB 4JFFA 4LLMB 4N0UB 1PZ5B 1JK8A 2F5BL 5IESL 3H54A 3SGKC 3IDJA 2PP9A 2W38A 4PCKA 5MENA 3MGTB 2VLKE 1T0MB 2IANB 3HG0A 1IARB 1YHQA 3W1ZA 4YEFA 3WEMA 3T3MF 2ATPA 1TCMA 4PR5A 3TEHB 5DMYA 4EX5A 1QX1A 4P5TD 4RGNB 4S10A 2VDPH 2RH0A 4ZO6A 5C0BD 3HB3B 3VYRA 5IB5A 3DLLA 3PDOB 5L88H 3FB6A 2NBFA 1WOCA 4G6JL 4YWMA 3CZEA 3F04A 5DGQA 3U2JA 1WH0A 3EIFA 4HG4K 5HYIA 2WOYA 3BX7C 4LCIL 3GPEA 5DHEA 3WMQA 5ALCL 3PG2A 2F1MA 2ZOTA 1WIPA 4X5RA 4TUKL 4HWBH 1MCSA 2QGQA 1N8ZB 2XX1A 4OLEA 4PV8A 1WTOA 4R4CA 1E6OH 4K7PX 4UIKL 1CLCA 2Z8RA 4ZT1A 3RWFA 3DHPA 4W9DC 3THMH 4KO9A 5ISZD 3KGUA 4F3FB 4ZRGA 3TV3H 4E5XA 5C0CB 3FS9A 2F7PA 4PRID 1G94A 1G7LB 2FJGA 4LWCA 4HCIA 3AWEA 4G7VH 3O13A 1YG9A 1LTSD 4HSVA 5HY6A 3CD4A 1HAUA 2CLRA 3BISA 4JQIL 1L9MA 1MCKA 3TMEA 3O2VH 3TYFA 1YQVH 3C8HA 5JJLA 4FFWD 4QRPD 4IUPA 1TXKA 1NMCB 4G2AA 4AYFB 5D96C 3MRRB 1VPOH 3L2MA 3MOBH 1XR9A 1PXUA 3RBGA 1SDAB 3SBRA 2BO0A 4J2XA 3NUKA 4PJ9C 2VQTA 2WIIA 4B3SQ 1JDCA 5BN3A 4A93H 3EYVB 4MMYA 4L1BA 4X9BA 5CJOL 2F58L 3MLXL 4X6DB 4G8AC 5E0FA 1UUPA 4JFXB 5BQDA 4WIQA 1GMEA 1ZE3H 2VSKB 2YMOA 2Z8SA 3B6SB 3O6LL 3QQNA 4NHUA 4CRPA 5HVWA 4JHUA 3MRDA 3QIWA 1STYA 1C5CH 3EH3B 5C0JA 2IF7A 4FFWC 5JW5B 5JW4Q 1DXMA 4HHAA 1YNLH 3REVB 1VADA 1LNUB 3T8VA 2VIRB 2V4LA 4F15C 3S15H 1R3HB 4LFCL 1QUNB 4G9FB 4S0TD 4MKMA 2X6VA 1Q9LB 1H3TA 2YAEA 5KBLA 1Q4NX 5DD0H 3VX1A 4MTNA 3IB4A 4BFJA 1FF5A 2PP7A 1CT8A 1MI5E 4N9GB 4AJYV 2CPCA 2K45A 1ANUA 2VDOH 3M1BB 4AVIA 3X2QB 5EU6E 5GZNC 3EDEA 2IX1A 1CFTA 3WJMB 3GS7A 3PIOA 2IADB 5DHDA 3ZGHA 4IK6A 2P24B 1ES0A 1NCCH 3BLPX 4ZSOB 4B9KC 1GXEA 2K04A 2PNRC 1OPGH 4IJ3B 3E6HB 4XNZC 1EJOL 4ZBJA 2IIJA 2DMCA 4IRZA 4I18B 1MHCB 3S35H 3CSBA 2R0KL 1BVNT 3KYOB 3PF4A 4L4VA 4Y9BA 1O75A 2F0DA 4V1DD 3PWUB 1RL2A 4LMQD 1OT4A 1Q1PA 2DV6A 2V0AA 3KMDA 3D2UA 5DS1A 2B3GA 3L3HB 2BFVH 5I0DA 1VAHA 3RNQA 1Q86C 3BRGC 1IB5A 4UV4L 2PCPB 2QGBA 2Z1CA 3NCBB 5GHWH 3GSNL 5DRWB 1MCFA 5AG8A 4P5SA 2VC2B 2F7IA 1J9CT 4PJBE 4F7MA 4X8JB 4FYQA 4U1IB 1GUNA 1IV8A 4P2OA 2SOBA 5FUCC 4HC1H 3OPZH 2K78A 2PWHA 1U8MA 3TA3B 1I85C 3VD3A 3O4LA 2QQNL 2OQ0A 3M4PA 1N5AA 1U4EA 4XAKE 4CC1A 4L9DA 1F42A 2K1BA 2VWEC 3CK0H 4YGVA 4TS6A 1O7DE 4P2QA 2JB5L 4ABWA 1K8MA 1NBVH 3SCMA 4YDJA 2Y24A 1A6ZB 4OCSL 1U3ZA 3Q8FA 3D39B 5J13C 3RNKB 2FLBT 4I0PB 1SFOH 4WGKA 1CBVH 3FUIA 1VQ5A 4KX8A 1CLOH 1TJXA 1WZ1L 4ACPA 2XI9A 4YCUA 5EOCH 3WKPA 5I1DA 2HP4A 1I9IL 2PCFB 4PY8J 2WVTA 2AEOA 2X4UA 2DN8A 1GW0A 4OLXH 4K2KA 4CGTA 4ZAKC 2YAPA 1X3FA 5HGAA 2A6DA 1NR4A 1P2CA 5ELCA 3AT0A 5E1AA 2FEEL 1B0RB 5L4IA 2H3NA 2NOYA 3H55A 3PCYA 1RK1A 1B9NA 2YEZB 4TUJB 2FATH 1RP9A 3BAEH 4Z3JA 4PJHA 1V1OA 4LSPH 1WK0A 3F5WB 4GNXC 2EDGA 4KI0A 2QZ5A 1IKOP 1Q72H 1ZHNA 3D0LA 3CSYB 3LPWA 4R0LB 5JXAL 3U2SB 3SOBL 1EQVA 5F7BA 5CP7B 3PAVA 1ZGLA 5AW0B 2P7TB 1MAMH 2AQPA 4X6EB 2B7DT 2Y7SA 4FI8A 1ACZA 4X9GA 1X3PA 2VERN 1L0YB 3DSNA 7PAZA 2VDLL 3JTTA 4A3GH 4OLVL 5E6UB 3I6LE 4HMJA 1YJWA 1A47A 2AAAA 3DMMC 1QO3B 1XFPA 4QCIA 4WENB 4P2RA 5CO1A 1STBA 4FA7B 2G5DA 3RKDD 2E27L 4G80B 2V7NB 4GY4A 4X5WA 1DANT 1D5XC 5K33A 3M88A 1NMAL 3EYUL 4J3WA 3HZKB 4FRWA 4QUCA 3MMEB 4MCMA 1OTUD 3K8LA 1YAIA 2XXCB 4CJ0A 4WUUD 2VXVL 3DTXA 4PIRF 2XWJB 5LO7A 5JIPA 5IQ7H 1I8MA 2AJYL 1JGUL 2Y69B 4A2DA 3IGUA 1MHPH 2LQRA 4UTBA 5FB8B 2QV4A 3RKDC 1JJCB 1NKGA 1P1ZB 4HK3J 2WKLA 4NCC1 4X7FC 4XPTH 5DJZA 2GJ6D 1A6UL 2A83A 2IOMA 1QVOA 5TFSL 1OP9A 1CGWA 4MRBA 3PL6B 3BKJH 2DJMA 2DQGL 4XXWC 4BWTA 1J7VR 3UZQB 1OTUC 2XWBA 2ZCKH 4OZIE 2C7UB 3MLZH 2A6KA 3VNZA 2QADB 5CIPB 2LFGA 3S34L 2Q2UA 1F90L 5FK9B 1WAAF 2Q76B 2QV2A 4GBXD 1BQQT 4YDVB 4JPWH 5ESAB 5JIHA 1MF2L 1R17A 1MEXH 3FTVA 3FF8A 2A5UA 4N68A 2DI9A 3KAAA 4RQQA 1BBJA 4OIAA 2V9QA 1E42A 1MJ7L 3RWGB 4ZO9A 5EC1A 4AV5A 4KHZA 3PGDB 1BVZA 3EJTA 4ALAL 4BZ1L 2K5WA 4R3SA 2Z93A 4DH2A 1FCGA 3VFOB 3E8VA 3C46A 4UINL 5DEJA 3V0GA 3DGGA 4L5RC 2YSTA 2DEWX 1I8LA 2OR9L 4GBXC 2X9WA 2AKWB 1BVKB 5AJ3Q 3S4SB 1AHWB 2DL9A 3CZFB 4YX2H 4N2IA 1G7MA 4R8WL 3WTSA 3L8QA 2O5ZH 5HGHB 3VXSB 1UZ8B 3L3KA 2AWNA 3Q43A 3GSVA 2QKIA 3RWJB 2NY6B 3QDGB 1S6NA 4TKWA 2ARJA 4CN1A 3VXTA 1OKEA 4FMFA 4I7AA 1G8ZD 4DV2Q 4OZFG 5MEPA 4G71B 4L29A 5ISZE 5J1SC 2CHZA 5DLLA 2ITDA 2NCEA 2WLKA 2FO4A 3DBXB 2E9GA 4UTCA 3EG9B 2DOCA 3T6VA 1KJ3H 3DX6B 4XPBH 5DS2A 4DUYQ 1FZJB 3O2WL 5C09A 1U3YA 2F5AH 4AW4A 2Y0SE 1HIMH 1RU9L 3WFEH 1LWHA 4X83A 3GTKB 1K4DA 3B43A 2CNZA 4PBDA 1WFUA 5AFAA 4HBCL 5EWIH 1CM9A 5I4DA 4NUMA 2CE6A 1I9EA 4FP8L 1NBWA 1KAWA 2C5DC 1SXTA 1P53A 3MRNB 4MJJA 2VMDA 4X5XB 1EAQA 4KGJA 1LTAD 4CNIB 2XETA 4OCRL 4LVNC 4YSQA 9PCYA 4QAMB 1MIEL 1DJIA 4QYAA 4GMSL 5BRQA 4AYID 4JRLA 2ICEC 2X2HA 3N0AA 2IH3A 4L3CB 3C60B 4HZAA 4E42B 1C5DB 4R97B 4XE5B 5LGJA 1Z3GL 3GXTA 4Z3EA 2EIBA 3HI5L 4L8SC 1S5HA 2AV7B 4NXML 4TVPD 2HUEA 3DSFH 2QT6A 2CH4A 1H3XA 2ZG2A 1K0RA 4JL2A 4GSDH 5C0FA 5IF0A 4JY4B 1VCAA 4PJ8B 4Y1AB 4ZUWA 3CFUA 3KL5A 5I5RA 5JHDA 4D3CH 3ARQA 3DM1A 5CEZL 2ZJRA 3IJYB 5KBMA 1A1NB 4CADA 5EZIL 2BVPB 4EDWH 3QPXH 1CFVL 43C9B 4FJ6A 4TVPL 4FYRA 3E3XA 1A1MA 3FTWA 3FW6A 3ML8A 3QEUB 4HIXL 4F37F 3D69B 2AKRA 2B2XH 4N0YL 1HR0Q 2VLJB 3CPLB 1Y8NB 3HG1A 1OAKL 5BQ7B 1E4XL 2CMRL 3E7JA 3IMWA 2X70A 4DN4L 4DP7X 1THCA 2J5LB 1HZKA 2EP6A 2MHAA 1HJCA 4OCWH 3OWEB 1E67A 1FO0A 3A4EA 4V1DE 4K5OA 5DJ8B 3UGUA 4K3DH 1QWHA 5E70A 1IX2A 3DX9B 3J7HA 3QYNA 4KK9D 4XNBA 8FABB 5FKAA 4D9RD 1TMQA 2C34A 1FJGQ 35C8H 1TWAB 3DUHA 5KOMC 5EPLA 2ED9A 4OZGA 1GPOL 1BG9A 2VWEE 4NQDE 5FYLD 3C5SA 2D2OA 2JE8A 3BVVA 3BC9A 3LX0A 3PWNA 4U1HA 5IFHH 4HV8A 3APMA 4GXUM 1IC7H 4LSSH 1R5WB 3KJ4B 5CJXC 2JF1A 2QELA 4AJWA 1ZGLP 1NL0H 3CVDA 5EOCJ 2EYMA 4LPTA 2AJUH 2ZXGA 4KK9C 4LEEA 5I1HH 5AKVA 4OZFB 4H1LH 4L8CA 5FYLL 3RA7L 4K2LA 4KHPQ 5GRYA 5BVPL 3AB0C 3UTSD 1O7ZA 1RIVL 1S9WB 1FC2D 2K05A 1D5BB 4GRWB 3QNZB 3QEQE 5T5FA 4P5KB 2RCSL 4RGOL 1KV7A 3ROLA 4XNQA 4A1RA 3N5AA 4TRDA 2E47A 4K55A 3JAMi 2FX8H 1FYCA 5ACLA 1MQ8A 2BP8B 2KLRA 2XV0A 3O2DA 2UU9Q 1CXFA 2KCTA 4IU3A 4NXSA 5D1QD 2P5ZX 1S9XA 2HLEB 1Y1VH 5IW6B 3OKOB 1PEZA 4IKLA 3GDEA 4IKIA 4JI0Q 3QORD 1N59B 4KY1H 4UWQB 4OGXH 1UZ6E 4WCYH 2R15A 4OCXL 3UTZB 1SYDA 5HGBA 3T2LA 4KZ0A 3C9NB 1S7WA 4J28A 5MP6H 1XH0A 2DNCA 3K5OA 2P47B 3LKOB 1K0SA 4WTXA 3V95A 5J3HD 4F57L 4G8EA 2WYZA 4PRPB 1PDKA 5D1QC 2IGFL 4GLAC 3OTTA 2EE9A 1TEYA 4JANB 3WFDL 1PFOA 3PWPB 1B44D 1HFGA 3MLSH 5E6ID 3PO2G 3QORC 5TGBB 2DW5A 5D72H 1CVSC 5DEGA 4Z7NB 1FL6A 5KS9B 2FO8A 3BIKA 4A6YH 4LCWB 2J88H 1U6AL 2F2HA 5J3HC 3MBWB 4HSQA 3T71A 1IFGA 3GI9H 1BWWA 4F5CE 2HSIA 3MJ9H 5CWSA 4EZMA 4JG9A 2WD0A 3K72A 3OLEA 4IHBA 1GJUA 3VYTA 3ATBA 5CEXB 4Z78A 1MCDA 5E6IC 3D34A 4LIQH 5EC2B 5MEQA 4WUUE 5JOFB 4H44C 2HUGA 2PW2A 3NP4A 1LYLA 3MXVL 1OTSD 2XNAC 3WYRA 3WFZA 3TT3L 5GIRA 4DWHA 1IEAA 2J57A 3LV3B 1MKFA 1FFTB 1EWIA 3E9HA 2PETA 1JOIA 1A65A 3CFIC 5C6TL 2DMGA 4I3SL 3SDCB 2MQHA 1I4QA 2K01A 5C0AB 3CN0A 4PBXA 3I9PA 1Z66A 1BEYH 5E7FA 2YU9B 2X4SB 4JFPB 4PTUA 4NOFA 2P5WA 3ZR6A 2JK8A 4QJFA 1M90C 1DONA 1OTSC 1X5JA 5J5EA 5FA3A 4JZJA 5EAYA 4ODSL 4N8X1 1CWVA 1GUGA 4OY9A 4HS3A 2F1EA 5FPIA 2CBQA 1PLCA 1J8HE 4URKA 2F0TA 1OXVA 3EFOA 4KY2A 5FYJH 2IPTL 2W0PA 2DIJA 1E2WA 4LPWA 4ZPTA 5C9JA 2F0WA 2B3RA 4DP4X 5F97E 5KVEH 3FU7B 5AZEH 1SQ2N 1FVCB 3KWXA 2LFEA 4U05A 3U1SH 4CW1B 1S7RB 4OM1H 5JW4M 1G7QA 2ZOLA 1YEWA 4Y9GA 4IRSA 2EIEA 1GYCA 3ALXA 4JPIA 1BG1A 4Z3GA 3GUTA 3WKQA 1SJEB 4MZIA 2AEQH 3GXFA 4AM0A 3LNHA 3OW2A 1DE4A 4N1EA 4CU7A 3V4PB 4KY6A 2UWEF 4LHUG 4MZ3A 2HXAA 2KMWA 2VUOA 3RGHA 1NBZA 5ELNA 3P7JA 4B9XA 1EEYA 3HUJF 5E2TL 2EC8A 3FU3A 4MXWL 1WA1X 3SE8L 1ZPLA 5KAQF 2J6EH 3I02A 3BVXA 4JFZL 3Q9PA 4H0IA 2ADJA 3Q01A 5JUEH 2ZTEA 3L1FA 3A5UA 1JP5A 4FXKB 5IJKA 2D3NA 2ESVB 1Q38A 2M2LA 1LXMA 3IM1A 3JWNG 3PQYD 2F0IA 5LWYH 4A3MG 4S1SL 2A4EA 3DOSB 5F9WC 4GQQA 4LVEA 5CLXA 4WTWA 2R29H 1YMMD 4GG8B 5E9AA 4KN7C 1OY3B 1BM7A 3WL9A 1TYJA 3AMUA 3PO2B 4Y7NH 5ID1A 2CJUH 3JYBA 4WWKC 1VEPA 4TNGA 4UQ3B 3RN5A 2XKUA 3FU6A 4JPVL 4RAVA 1X5KA 1M4KA 1QLEH 2EICA 5FV2A 4ODXA 3IFPA 3L16A 1ACYL 5D2NA 5K59E 5CEZE 2ZUSA 4ZX5A 3GSQB 3ZTJH 2VO5A 4CJ2C 2HN7A 2XIDA 1T83C 4A3JG 1HNXL 1P84K 3QUXB 4QMEA 1QB5D 2VSMB 1BXAA 1GZPA 4TVPE 3KNBA 3BPNC 3MLWH 3RWHA 1HXYB 3WOFA 1NC4A 3CFDB 2L9HA 1KDCA 5EPJA 1WEJL 5BVJA 3HOXH 3UYRL 4H88H 1IGJB 3HZXA 3V0HA 2KEEA 3T53B 3EZ8A 5E8PA 1KBKA 2WBJC 3WFCH 1DBJH 2Y1ZA 1J0KA 3I50L 1BO0A 5HDOA 2KC0A 4NDMA 2VW7A 5IYBH 4WQOA 4APVA 4QRFA 1ZK5A 4DGUA 5HYFA 2F0CA 4J6RH 1VQBA 3P73A 4RSVA 3BSHA 4A55A 2ITCB 3FQNB 1VQ7A 4GW5B 4LF8L 2YGPA 2GSMB 2E7MA 1DZ0A 4K8IA 1V27A 3LIZH 2A9AA 1OP5K 3RL1A 3BSZL 3Q24A 3IVKB 2YD0A 1YJDH 4B08A 1XGTA 2ERJB 2HUHA 5A2LH 1V43A 1PBYA 4PY8I 3SDXF 3VWJB 4D9RE 4U2YA 3RJDA 3EKCA 5JIMA 1T1YB 4U1LB 1W72H 4FLHA 3L3OC 3WD5H 5IUSA 5FYLE 4AVKA 4KI5D 3UTTB 4NQCA 4RDBA 4LHUB 1C7TA 3TBWB 3M7OA 5JHLA 3G6JA 4DKAA 2AZUA 2J8UA 1M05A 3DWAA 1ETB1 4XH2B 4PRHA 5EN2B 4WSJA 2KBNA 5HY9A 2PO4A 2VISA 2XZAL 4OF3A 4Q52A 4XXCA 2OJEA 4FNLH 4PW3A 1G2TA 3UTSE 4KI5C 3GIVA 3BD3A 5B38B 4A3MB 4NKOA 3I2CL 4IM8A 1PV4A 4EF3A 4OD1H 2XA3A 3OZ9L 5JYMA 2CLVB 1WC7A 2YD3A 2H9GB 2ZOOA 3T4AA 1B3JA 4KPHH 2AEWA 1MWAL 2B8GA 1I9JL 2I9LA 4AC4A 3MNZA 5DRZA 2BRRH 4FULA 4HEDA 5EZLA 3IKCB 1JPFA 3IMTA 2F8XC 4OKVB 2RQXA 3A4AA 1Q8IA 4DAYB 2XGTA 3QJSB 5D1QE 3IFOB 1RUAL 4FABL 3TGXA 2G5BA 3FU0A 1L7TL 2EACA 4A3JB 4JFYA 3ULSA 1DSFH 4H20H 2ICWI 4KI5F 5BV7L 5CF3A 1UJ3A 4RESB 4MD5A 3GS0A 1NUDA 3NBHB 2J6WA 1BJ1H 2AANA 1C7SA 3GIZL 4MNGE 5DDHA 3WY2A 1EHNA 4CU8A 2X3CA 3FKIG 4O9HH 1ZLWK 4PZ6A 5LL6X 1KTKE 2JK5A 3PV6B 1OZUA 2DKMA 1U3HD 2AQNA 4ELME 2DGYA 1G9NH 2F9BT 4GLXA 3K71A 4K9EC 2DMBA 1KPUA 2NNRA 4HKZB 1S7XA 1HZAA 1HHJA 1X9NA 1HCVA 5KYIA 3IWUA 3EVQA 3G7TA 4R5XA 4BBRB 1L9PA 2JMRA 1L9TA 4QXUH 3NIFE 5IQMA 3GRWA 4WFHE 1MH5B 3W0WB 2OYKA 2ZAIA 4ISVA 1U3HC 1KT2B 4DGIH 5L37A 4PREA 3AY2A 1NQBA 5DLMH 2X2UA 4HF5H 2UX6A 3GBEA 1YNTF 2QTVA 2DJFC 2FYYB 3PP3K 5ITBH 2UXFA 4P99A 4OAWA 2K32A 1PX3A 1AG0A 2AJVL 2EYRB 5EGTA 5SWZD 3UACA 3IGAA 1UWGH 2YJQA 4LQ1A 3V4VH 43CAB 4AK2A 4YPJA 2WW8A 3MRJA 3NACL 5DD5L 4PUBL 2WZPA 2EEFA 5IFJA 1N2RA 2CDGB 2X6UA 4YHIB 4R26L 4OBRA 2BHUA 1AD9A 2B1AL 3I4MG 3TS8A 4GRLD 2PMZE 4HJGA 1A62A 1ZXTA 4N0FA 4O02H 3O3AB 1T66D 4QIRA 4HWBA 2YD8A 2K6AA 2ICES 2YPLB 2JA7B 2CBTA 2YK1L 1D9KD 4R2GB 4QRAA 4KKPA 3FYIB 5A1AA 4LLDB 5C07D 1IC4L 4XGZA 4Y4HA 3GMQA 2DQIL 3X1BA 2WAQA 1RULH 4GRLC 3K91A 3PNRB 3UFIA 4OLUH 1ZVSA 5IB3B 1T66C 2B2TC 2N59A 3VA6A 1ZXQA 2B77A 2E9BA 3NWSA 3S8WA 4LPVA 2EY6A 1SYVB 3CFJA 4GG6E 1BD2D 1USZA 3U30C 4DERA 4PGCB 4AKPA 4NCDA 4LCVA 1JTPA 2WMPB 5HD8D 3RB7A 2F19L 2HX8A 1S8DB 4M3KB 5CP3H 5I24A 3PQYE 1UD6A 2K4AA 3MV11 2FGWH 1X5GA 5I17A 3CCJA 4GAAA 3TONA 1XTDA 4PCTA 5F7YC 5L4MA 3QXUA 5T3XD 2HX9A 2JI2A 3GYRA 3V96A 1ENCA 4WV1A 1MJ8L 3NMEA 3D6CA 2ASBA 1HNGA 1EY9A 4GXVH 2OSWA 3S37L