4J8QA

Crystal structure of a nigd-like protein (bf0700) from bacteroides fragilis nctc 9343 at 2.50 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
202
structure length
194
Chain Sequence
DGYSLGDIAVDWATVRVVGGDTYSLNADRWGTLWPAATAIPFYKPIDGQRVITYFNPLYDNYEGYDHAVKVEHNYNVLTKQVEDLTAENESEFGNDPVWVNKDMMWIGGGYLNVIFRQNLKHLVSLVRDMRATAAEGEDDGYIHLELRYKTYDDQANGAVSFNLNSLDLTGKKGIKVKLNSVKDGETEVVFNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BF0700) from Bacteroides fragilis NCTC 9343 at 2.50 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized protein
total genus 40
structure length 194
sequence length 202
ec nomenclature
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4j8qA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4j8qA02
3QWNA 3NQIA 4J8QA 3K0YA 3K6OA 4PQXA
chains in the Genus database with same CATH superfamily
2C1PB 4GUCA 5CIPB 4BXXG 2JJQA 35C8L 4MJ5B 4PJHF 2AJVH 5IYBG 1FN4B 4G8GA 5CILH 3RX7A 5JNYB 1O5DT 1DQDL 1YDPB 5F7LB 4YXLL 3U7WH 2R51A 2WYIA 3ML8A 1K72A 3VH8G 1YIJA 2APWA 3DI2B 3I4LA 1PG7H 1QFUH 4N3TA 1FVIA 2LABA 3TMEA 5HJ3A 5C44B 4NBYB 4L0ZA 4LEXH 4TQEH 4XN8A 3U25A 2E3VA 2FO4A 5IREA 2K1BA 5DC0A 5TDPA 2E6QA 1VAHA 4ATTA 4V190 4EXPX 3D52A 1G9MC 2JMRA 5D7LA 1TYJA 1Z9MA 5DDHA 4XNYL 3LV3B 3VFRB 1J5IA 1DQLH 2DQUL 2JJVA 3VI4A 2UYLB 4X99A 2LXJA 1K8OA 3APDA 3FT2B 5IGXH 5IQMA 3EJIA 5C3WA 1NLBH 3RD4A 1OSYA 4Z7OF 3D3VD 4XN7A 3AZUA 4FLRA 4ME3A 3LKQB 4LOEA 4GW4A 2UXTA 3ARXA 1J05B 3KGUA 5BJTB 2OF1A 2MSPA 3HG2A 4P2RE 4XP9L 4Y7OC 5C09D 2HT2D 5IBTL 4AZ8B 1AIFB 1IEBA 5FECA 4RGND 4BFKA 2YRZA 1GOZA 1DBAL 1I1YB 1V9PA 4KUCF 5K1NA 1RJLB 3DX7B 4JB9L 3IGUA 1W0WB 1CFVH 2X1WL 4MZIA 3D2UB 4GLXA 5ENWB 3VRJB 1PY0A 4BXVA 1T89C 3I6KB 1GKOA 3TZVB 1TS4A 4QTIH 1ND0B 1B90A 1Z0NA 3RKPA 3VQ2C 3ZHDA 3VFNA 5JHBA 2XZCL 3FFCE 4H26B 4UQ2A 4M1CD 5FO8A 4N0RA 3P02A 1K4DB 4X7TA 3NFNB 4KKNA 1O7LA 4GLRI 3HG4A 4IIQC 1QHQA 4NQCA 5BUAA 3BG3A 4XNYH 3PQYD 4HHGA 3PWPB 2P26A 5F6IC 2WBJA 1BQQT 4PWHA 3VD4A 3IGFA 4GQ9H 5CGYD 5KW9H 2R0KH 2YMXL 3MTSA 1A5FH 1X5XA 1UYWL 3AQXA 3L3HB 4MZ2A 1ZLDA 1QFWH 5EU3B 2DLEA 2HVKA 4GQRA 1S3OA 4HG4K 3DK2A 4V1DD 3OPZH 1F4YL 4HU2A 3LQMA 4MDRA 3ZTDC 3FT4B 2AQ2A 3HR5B 4HKZA 4MCMA 4CDEC 3NTIA 4FA7B 4K5NA 3QOLA 4JPQA 5JPMC 1NIDA 2ZCLH 2DB8A 3NSCA 4GKJL 3M4OB 5ALCL 1ZT4A 4AL8C 4CJ0A 4K3EL 1BVLB 1D7FA 5J1TC 1SXBA 3VGAC 4LF3A 4OI9A 4URTB 3JVGA 4Z7UF 3NP8A 2PPEA 1BFSA 3ARFD 3L95A 4HSAC 1NWOA 1XTCD 2X9ZA 3N1FC 4FRWA 4WI4A 3WAKA 4C56E 5LWYL 1K8DB 2WVVA 4YNYA 3EFDL 3K2IA 1KB5A 4JPKH 5CU9A 5BN3A 3IETB 5TDNA 1MSGA 4NBXB 2IBGA 2O4XA 3F01A 1VQAA 3GGWA 3GPEA 3K6FA 3SKOA 4AVJA 4G6KH 1RZJH 4UMGA 1KHIA 1E6JL 1LEKB 1L9NA 1MY7A 2N7BA 2Y69B 1XIWB 1TY0A 2GW5A 5EU4B 4O2CA 1UGNA 3ZKXC 2DTSA 3CFKA 1E27B 2X7LB 4XZ4A 2C9VA 4X8GA 1VERA 4J12A 2XXMB 3QIWD 3TJEH 2ZP0T 3WFBH 3L1EA 1VS0A 1OTSC 2NY3B 3QUZA 4DR2L 4CMHB 1CT1D 4NKOB 1UOKA 4P2OD 5HYFA 4WCYL 5AVZB 1GC1H 1ZTMA 1U5KA 1WCMB 3P0YL 4ETQA 1C8CA 1EK3A 1S9VA 1YJ9A 3WS6A 5HYIA 2WXQA 1RL1A 2F3VA 2ZKHH 3DYOA 1C5DB 1IKMA 4P59H 3VH8B 4M6AA 3VYOA 2CU9A 3ULVH 2DL2A 2AW2A 2CKZB 1CPUA 1WD1A 4M6ML 3ZR6A 2WOYA 3GI9H 3WDJA 4AIZB 4OCRL 1WCBB 1DJSA 2X4TB 2ZUVA 5E9DD 2F0FA 5E6RB 4TSBH 3E38A 4HTHA 2UX6A 1FJGL 5T3ZL 4CC4C 2WQRA 5LGJB 4AQ1A 3GSVB 4P2RA 1T2XA 2AQ2B 2VDMB 1CLYH 4BUGA 1LTRD 3TZDA 4BBSG 4UDUC 3CZFB 4I13B 1WTRA 1IYJB 5GGRB 5HJ3B 4KDVA 3WEAA 3NSDA 5D72L 4U3CA 3N6RA 4K9JA 5IZ7A 5JW4Q 3ET9F 3CN2A 1YEKH 2VKWA 4IFDH 3H9HB 4N1HB 4OKVB 2VDQB 4JM2C 4CGYB 3D4CA 4KOBA 5D7LE 2XN9C 4F8MA 1I8KA 1VEOA 2ENQA 3C6LC 4E9LA 5KTEH 2NNRA 4UTAA 3P3UA 4M1UB 2LAAA 5DRZB 1TWCH 5DWPA 4BK8A 1BVSA 1D9KA 1C4QA 2Y07L 3KLDA 1U8PA 5DJCA 4GXFA 1QNUA 2C34A 4DV5L 4B53A 3N85H 3UMNA 4AL8H 3QIAA 3GTQH 4DV0Q 1QRNB 1DZ0A 2CAKA 3HN3A 4Q14A 4I4WB 5D1QE 3K6DA 4G8GE 4YDJA 2ZG2A 3FOLA 4WHTA 5TDOB 5AVWB 4TUKH 1PSKH 3DARA 2X42A 3M45A 3NEOA 4XNAA 4UP8A 4ZS7L 5DHDA 5D1ZB 2R0WL 1BVKA 4RFOH 1EIHA 4DAYB 3ARUA 3IKJA 4YDLC 5HHMD 4BUQA 2ICEB 4A7SA 4M5YL 4WFFE 5JHLL 1RZKL 1OAQH 4YHZL 5D7JC 3S24A 1J5CA 1ZJAA 1QR4A 2NTSP 3T6ZA 5IYCG 1JWUD 1I1RA 4FO2A 2XXCB 4RFEB 1KNOB 1DVXA 1KJ3H 5D2NC 3ZUNC 1PZID 3I2CL 3OZLA 1Z9SB 2BS9A 1E4WL 2X9XA 4GBXA 4QGTA 3OPOA 1U42A 1U4LA 4RX4A 3STZA 2C3XA 2E5EA 2F0NA 2E7DA 2GJ6E 1QZNA 2YD7A 3VVWA 5JUEH 3VI4B 1NGXA 1N6QH 1A7PL 3Q8AA 1GZHA 4A3KH 1KC5L 1L3WA 1QABA 3QA3A 3ATEA 2GTQA 3R0MA 4PGDA 4H88H 3KLKA 1T2JA 1G7QA 2J6EL 4Y2DA 2ZX9A 2CGYA 5LNEA 3BZEA 1T1ZB 4C3HG 2VXUL 4F37K 3D18B 4QKXB 3HPJB 4J8RB 4YWGL 1XNQL 3KZ8A 1F9SA 2C35B 4PRIA 4AYBE 4KGJA 2APSA 2F8VA 3V0JA 5GRXG 4FQIH 2HA1A 2B3RA 3JTBA 3DLQR 4B50A 2J20A 4XGZA 1EZUA 3JTSA 4FL4C 4RFNC 4F7PB 4F8OA 3ZDXB 2JE8A 1B4OA 3ARGC 2ADJA 1MFNA 4MDIA 2OXGA 4M3KB 5GRJL 5FYKH 5SX5K 3NEEA 3WEXB 4N85A 2DY8A 4YL4A 3VD3A 5BZXA 3EJTA 4QMGA 1M3IA 5T33H 4WJ5A 1F2ZA 2JCCA 1T4KB 4AVKA 3MUGA 4HJSA 2IBZX 1BVNP 4M93C 4Z0BH 1V7NH 1SDDB 1ZANL 2FH6A 1KCWA 2HQEA 3W1BA 1P9MA 1FUNA 2Q8BL 2YD4A 1WSST 4M6NL 4U1GC 3S88L 1TTFA 2DBLL 1MFDL 2C1OA 3UH8A 3UTTD 4RH4A 1NCAH 3FTSA 4HKBA 1A6ZA 2Q5BA 3SDAA 3RWEB 3RFZA 2ED9A 2WANA 4DV7Q 1U21A 1G5AA 2WO4A 3QFJE 5IM7A 3M4PA 1BR9A 1NR2A 3BVXA 4U3HA 1XGTA 1YEFL 2BSED 4QRFA 4KHVA 2Z0UA 4XN1A 5HY6A 3G08B 5HYQA 3MOBH 2K1MA 3D48R 3G9AB 3VFWB 3KPOB 4Y5VB 3FO2B 4AEHL 4PJIA 4PRDA 1ETZA 3WSQL 2BCKB 3TZVD 1UKQA 1DDHB 4XAWH 4XMZA 5D7EA 4P4KA 4PRIB 4XZUB 1O75A 4PV8A 1GUNA 5C44H 1HC1A 4LSPL 4ODXB 4ZZFA 1IBKQ 4RGNE 4UNVA 5IUSA 1TQUA 2PQAA 4ENZA 1I8LA 3BZEB 3FYEB 1UWVA 2UWEB 4LCCB 4YO0B 1IL1A 3NZ8A 4WZ9A 3QNXB 3IMBA 2NTFB 4WUKL 5ANMA 3FS9A 1C5CH 2XTSA 5LBSA 3VXRE 2CXGA 3F5WB 3NAAL 3CSYB 5TQ0L 4X6FA 4IOCA 3I75B 5CLYA 1MFCH 2IX1A 1AW7A 5E7BA 3W9DB 3FN0L 2HIVA 1T5XD 1F02I 3BYTB 3UTOA 1QWHA 2WKGA 4NXML 1D7DA 5K93A 4M9PA 2CUHA 4LXFA 4WW2C 1GH7A 2OTPA 4KTGA 5JYLA 4GRMB 3S2DH 2EIFA 5DWUH 5F9DC 3PQYE 3V0EA 1LO0H 3OKEA 5DMGC 3RFZB 3V4VA 4K94L 3DHQA 1ET5A 4N87A 1KLFB 5JOFA 1ZIAA 4FTDA 4OVUA 4A3BB 4PJ5A 3V55A 4YHOH 4DPAX 4M7ZB 2IQ9H 4OGYH 3U1SH 3F12A 3FUMA 4M5ZH 4WHDA 4F15C 2X4QB 2RVLA 3WHE0 5J6GB 1JPSL 4AGLA 4YE0A 3AB9A 1TFHA 2N7SA 4JVPA 2N59A 4K15A 1JWSB 3GB7A 3PIQA 3VD9A 2HRLA 2X6GA 3LAFA 3OJDA 3H0TA 4FZEH 4WFGD 4EAEA 4HZAA 5IFHL 3KPLB 2DKMA 1CL7L 1BZ8A 3S37L 1ESRA 4OL7A 4JE0A 2IX3A 4MNGA 5B1JA 4OCMC 1G2TA 3JVGC 4RKLA 1P4BH 3P30H 5FYLH 3T2PA 3UBXA 1HESA 3PIPA 2COVD 1HQRB 3S36H 4YDVA 1AZCA 3OWEB 4KITB 2JCWA 4OKVA 1R3IH 5C4JB 4ZK8A 3NCBB 4Y88A 3VI4F 2PZWA 4I5BA 4UIMA 4S11A 5M5WB 2V37A 1TR7A 3D34A 3IS1X 4I3RH 2XX0A 4J5VA 4C1NK 4HUWB 2MHVA 3F5WA 1STYA 1E4XH 3LN5A 3L54A 3NCEB 3WUWA 4TF4A 1T1WA 4QHNB 3T0VA 3I4NH 5AW7B 2NQDA 1QTYT 1U91A 5I1LB 1JOQA 1AS8A 2EYSB 4AVIA 5HHXH 3CCUA 1ZHKA 3EN2A 1HPCA 4LF8Q 1N8ZB 1L5GB 5J13C 3K4DA 1NDMA 3DLLA 1FGUA 4GN4B 1IYUA 1HZBA 3BO8B 3H56A 2L3BA 2NXYC 4XI5D 5HVWA 4N20A 3BP5A 1QZ1A 2WXJA 5H94A 3VFWA 3CGTA 4FXKB 4CNIA 3P7JA 1DBML 1QPKA 3FN9A 3LX0A 4TKOB 1BVKB 1MFDH 1BF4A 2B5IC 2ZKXA 4TN9A 1VDZA 1ZYRD 3A3YB 4GH7B 4AYDC 3VW3H 1WG3A 4FTVE 1SMYC 2PCPA 3A8JE 3NIDE 4IGBB 4MD0B 1S9KC 2X2HA 4XO8A 5CJXC 5IW6A 4Z0BL 3GMOA 2IJ0A 4NAQA 1UADC 3PSIA 2RCNA 1QI5A 3VGBA 2YO3A 3UO1L 1IKFL 1IL2A 4XN5A 4TOYH 4IMLA 3NQTA 3CIAA 1LYQA 1UFGA 4GRWF 4UOZA 1VQ7A 4LSSL 3N1PC 2K6AA 4OCXL 4OUUB 2ZJSL 2NXZC 3G3LA 3DA0A 5ADOH 2E47A 3LNHA 2E2DC 5I1DB 4NP4L 4JM0A 1JRHH 4GQQA 1UD5A 2IH9A 3VGEA 3WNPA 4A3GB 1W16A 1QFWI 3QDGA 4X8CA 2EVBA 1ULVA 2NW2B 3DM3A 1AFVL 2GJZA 4GG6E 1EY5A 1C16A 4NLHA 4X0KA 1L0PA 2R1YA 1ZXKA 5CV8A 3CDYA 4NWUH 3VD5A 1UE6A 2ITCB 4NO5B 4JZJA 2E7LA 3LHPL 5BQ7A 1RUPL 4AMWA 1VQBA 4N0UB 5HJGA 4ODTH 4L8SA 3DETD 4NWTH 5DVLA 4Z3JA 1QNKA 3S3BB 5E56A 1FG9C 4J8RA 4TUJA 4L3EB 4ONFH 3O4OC 5L0QC 5DYOB 3PYCA 5K1JA 1CFNA 1UCBH 4JPWL 3TP7A 4LF9Q 4NI6A 2HFFA 2VTFA 4HOXA 1I8IB 4WTQA 2ICES 5D1QC 2IWHA 3QJHB 3QGVA 1I9RL 4MJIA 4PJIB 4PRDB 4AWJC 3D3RA 1XHHA 3HPLA 4WFFD 4A6YL 5IFJA 2IMNA 3W2DA 3IFOA 1I85C 1LP9E 4MQXD 2UXCL 4MAUL 4GBXB 2H45A 2KDYA 3KBGA 5K9QG 3GMQA 1RIUL 2VYRE 3BVGA 2W9EL 4JN1L 4PBWD 1PJWA 4YDIL 5DS1A 4XQQA 3H54A 4H8PA 4CVZB 3LKNB 3BP4A 5I1HL 4LCUB 3DYMA 4L0PB 4ZKCB 1FZJB 1ZGLM 3ZZLA 2HJKB 1JCVA 2YOAA 1PLFA 4C3JG 2F3IA 2YBRB 1TQBB 3KGSA 4JRLA 1THCA 4LF7Q 5BQ7B 1X5HA 1FVCA 1NOFA 1OGAA 1NBZA 3OGCB 4YE4H 1S9WB 2MCPH 1GR7A 2A9NH 4U7MA 5EBDA 5FYKD 1O7YA 3QEQA 2I27N 4PJBE 5TQ2L 2ZOKB 2P45B 3QDGB 5K9OA 4CN6A 4YLCA 2VC2H 2FGZA 2RIKA 3MX0B 3NFSH 4JRYD 4MQ7B 4ZUVA 1JZ3A 4P4KD 5C44G 1KNEA 5GGRY 1U4FA 2EDRA 3S96B 4A55A 2JI2A 3QCTH 2E2JH 1AG6A 1MFUA 2V2XA 5ABAA 3ZY7A 1QUNB 3VXQB 1Z5YD 2CIKB 3DWTA 3LPGA 3L4VA 3S5ZA 3HRPA 4OD3L 1E5BA 3C5ZB 1JF1B 4X5WA 2AK4E 1U8HA 2QMKA 4P46D 3SQBB 4LSTL 1NTGA 1CIUA 2DOCA 4A3FB 1O78A 4HWBA 4BQ9A 3U7YH 5T3ZH 4JDTH 3VDAA 1I9EA 1BMZA 2MQ0A 4NUPA 5M3MH 2IFFL 1XBRA 2F0TA 3S15B 1A7NL 3QJUB 4H0GA 4OCRH 2W9DL 1QBLL 4KPHL 4OI7A 3KLHD 4NNPL 2J25A 3BDYL 1Q7YC 3N0AA 4FNTA 4OZFA 3STBA 1CXFA 3MRFA 3QCTL 4RWSC 4F9PA 1DZBA 4XPHH 3P0YH 4FLHA 4O2DA 1MWAH 1N19A 1AQHA 1UH2A 3K7UC 1KNOA 5AW8B 1DVZA 1DVSA 1AR1B 4MZRA 1J9TA 1F1GA 5LCVL 2VDLB 2P8MB 3VXTA 3BN3B 1IGML 4KKAC 1SXZA 4HMJA 3K4AA 2JJSA 1KBKA 3UDGA 4BY7G 2JA7B 4G8IB 2JNZA 4F8LA 3FBQA 1WS7A 1OTUD 4DP5X 3EGDB 4D94A 4GB9A 1EERB 5IQ9A 1ZRUA 5JLZA 2BDNA 1XF5B 3GHBH 4NKMA 3DWQA 4NQEA 2FB4L 4D0BB 3O11B 1GAFL 2VH5H 1AIFA 1MAJA 1AD0B 4LARL 4XT3B 4PJAE 5T8IA 3OKDA 3UMTA 2R0ZL 2IANB 3NCCB 4QRSB 5EOTB 4JAMB 1NKGA 5KJRL 4FA6A 4ETYA 2WKCA 3CQQA 1JAEA 4ZZKA 3GUFA 4PMBA 1J1OH 2WXIA 4NP9A 4J3WA 2JA5B 1TENA 4LSVH 5I6XC 1XF4A 3U6RA 2XPYA 1BQUA 2AWNA 5E4WC 2DKSA 1R9TH 2ZCLL 4FQCH 1RDPD 1VADB 2GYSA 5D65A 1G7PA 3F05A 1WA2X 1IFGA 4HUUB 4JCLA 4W81A 3RA7H 2ZF9A 3K80C 4BDVA 2IAMA 3CD6A 3RWJA 4ZW5A 3CZSA 1CFSA 3IDXH 1DDTA 4GKKL 2B1HL 1EO8H 2YJLA 3MJ9A 5CCGE 1QFHA 2EDKA 5E6IC 1FNGA 4MXVF 5FA4A 2PR4H 4HSVA 2GY5A 1GZPB 1R17A 4S2SB 4JI6L 1LDSA 4HEMA 3E8UH 2ENBA 4KI5C 3PWNB 3PU7A 5DQDH 4ZBJA 5AW3B 2VQ1B 5TE7L 2VRAA 1FN4A 1D5XB 5D4IA 1BOGA 4WFGE 4DPRA 3GNML 4PMWA 1S8DB 3E9TA 5LGYA 4EUPA 4JANA 5JVH3 5IWLA 3L08A 3U2JA 2XA8L 3S2DB 5FLMH 1MJ7H 3A21A 3MV9E 4P2QA 4FQ1L 4GPVA 3T8VA 2VMFA 3RGVA 4F2FA 1XSIA 1BJMA 1KCUL 1SQMA 2ATPB 1IL1B 2DL9A 3NZ8B 4MXVE 4XVJH 4ZPTB 4U1NA 3QVAA 3F2UA 2FUTA 2PQAB 4ZFOB 5BV7H 4AYMC 1CBVH 1FC1A 3H9YA 4O02B 3B7UX 3ZTJG 3NZHL 3PS6A 1CFQA 2ZWKA 1VZHA 4BDVB 2HCCA 2AP2A 1LTID 4NRZB 3M85A 1C7TA 4RWYH 3D2UA 5AB1A 4GRLC 4DOHB 1F4WL 2KYIA 5C6AA 3HBGA 1DN0B 3X3MA 2DBLH 5JAVA 1RJLA 2V7NB 4LMQE 4X7SL 1P5VB 1GGBH 4PV1C 3GTJB 2NYZD 3CW2C 1Z9NA 1FL3A 3GMRA 3KYKH 3ABGA 3QYCA 4CVZA 5GGVH 4CU8A 1YHAA 1TJGH 4KI0A 2OCFD 5EUOB 4AZ8A 4RIRA 3U4EA 2CLVA 2DM3A 3BLKA 4MQTB 5CR3A 3QAZB 1SVCP 4LHUB 3CMAA 3MXGA 5C0XH 1YYLL 5DLMH 2ZXCA 1WIUA 2IBZY 3K71A 3OHMB 5JPNA 5JEAH 5EJWA 3E9UA 2WVUA 4LU5H 4JFPA 4NYLA 2A7BA 4OQTH 1BYPA 1IGIH 3F00A 2ZWSA 3QJHA 5EEYA 2MP1A 3GRWL 1WO2A 1SDDA 3AWEA 4FKHA 4PCKA 4DKFL 2CCLA 3TPKA 3VFVB 3BN9C 4QY7A 1KBBA 3IAYA 4JY6A 1IHZA 4DQOH 3BWAB 2CLRA 3QXVA 5CYUA 5KANG 3X14B 3TNMB 3BP7A 1VF5C 3CCHA 3QUMA 4DAGL 1UWEH 5F7FA 3L3GA 5I6PA 3CPLB 3S34L 2WBJB 5CEZE 4S1QH 4NLAA 5K1VA 3T51B 5I16A 5D96B 1MKHA 2QV2A 1DJXA 5LBSL 1BZ9A 1UD2A 2YUZA 5IHLB 1E6JH 3T6XA 1XGPA 1XGUB 3GLAA 1BG9A 1UB6A 4WCYH 5FGBA 1YLBB 1GGTA 1HA6A 2XWEA 1JT8A 1CF1A 3QRFM 1OARH 5F3BB 3EDKA 3ARFA 3FU0A 3T09A 5F6HJ 3AB0B 2PP9A 3X11A 1EX0A 2EICA 2IX0A 4IK7A 1WAPA 4Q6YA 5J11B 3EKCA 3TLRA 3WKYA 2P8PB 4FS0A 4FF9A 3BW9B 4UB0L 3E80A 5M5XH 1GHJA 3MRRB 1O9WA 1PZSA 3V4VH 1A2YA 2JFCA 2Z31A 4MS8C 4XOBA 2BINA 3E9HA 1T0NA 4V2CB 5DWUL 4F1ZA 2P49B 3C60D 4PJFF 3WFDL 1UB5A 2RKSA 2LS01 3DMMB 4EZJA 1J05A 4QAMB 1B0IA 1ZSHA 5F6IB 5H94B 4QY8A 5E08L 4LLAA 4BY1B 1WBZB 1YCSA 1BJ1J 3ABMB 4TSCH 3DSNA 2D31A 3S34H 1JNNH 5TH2B 3B9KA 2IPUG 3EYUL 5FGRA 3A8KE 2YPKB 4TTDD 1TU2A 1ZA6A 5KVGE 3LXCA 4JI8Q 4ENEC 5JQ6L 5M3MG 2HJKA 1TZ8A 3RDTB 4J27A 4P9ML 3RWDB 4EZKA 3ZMRA 1YEKL 3ETSA 4JHWH 4PJAA 5GGSB 4D7BA 2P8MA 3VXTB 1YEZA 3S3CB 3VXNB 4Y19E 3V6ZB 3ZGIA 1SJXA 2HLEB 2VQEQ 3GI8L 4RAHA 4ONHA 3MVVA 4FFZH 4KTEL 4O58H 4JGJA 4PVLA 3VGAB 3IFPB 5FIEA 3WTXA 3NDYE 3QZMA 4J4PD 2ZOUA 5FYKE 5DGQA 2DQUH 4ZSOB 1NMGA 4OZGA 4JX0A 3T3ME 2ZXEB 2DQTH 4HQQH 2LU5A 5D5ME 2N56A 4ZYSA 4ZD3L 2H0EA 5KSBE 5NUCA 4R96B 4OTXH 4M4PA 4XNUL 3U1PA 4M00A 5MENB 4ZAKC 4YHYC 5KN5B 1HKFA 4PMFA 2ID5A 3FT1A 2YYZA 3W38A 2Z4QA 1UGKA 3MRRA 4JG2A 5DYOA 1N33L 1O0VA 1JF1A 3GINA 1EAJA 5CO1A 5CGTA 1AGCA 3LSOB 1OAJA 4JI0Q 3NZHH 2R93G 5B1KA 4X6EA 2HFGH 2F0HA 3TCXA 5IR1A 1FDLL 1H8NA 3SE6A 1I7UB 4KX8A 3FB7A 5D70H 1FA4A 4JFEB 4QJ4B 2DNCA 2NX5A 3GIVB 1J8KA 1PTZA 1J88A 5C71A 2JP1A 3SK5A 2VUKA 3UO8B 3DM1A 1XX8A 1VLXA 2PUQT 4PS4L 3G5VB 3P4NA 4O1NA 1CN4A 4NZRH 3WNNA 5EIIB 1QRND 2YKLL 3MUUA 3WIFA 2EYJA 1EWIA 3K6OA 5TE6H 5AFWA 3DETC 4HWNA 1UASA 2AV7B 1CD1A 2FECI 3TH4T 3BP7B 1AQKH 2EDXA 1FHGA 1PF3A 4HHAB 2OP4H 3LZFH 4QHLA 2FJGB 1EVTC 1MVUB 5DI8B 3TA3A 1P5UB 5JQHC 3L17A 2BOBA 3M7FB 1RK0B 5TJWK 4A2DA 3RNKB 3VXUB 4P3DA 3CDGB 1JPEA 3PG2A 3PGFL 3S15H 4IOSD 3T6VA 3QNFA 2G5BB 3O6FA 3RTQD 2VOTA 5E6ZA 4L1DA 1TTBA 3E6ZX 3CFDB 4ZUWB 5KSUA 2XN9B 3U0WL 3D25A 1JOOA 4K3HA 4KXZH 4KNQA 4H1LA 3RU8H 4XO4A 1IC7H 2YFNA 3FDWA 1EFQA 5IVXE 3MV01 2DWEB 4GBXD 3BZ5A 4WKZA 2QGQA 1N68A 2H3NA 4P46B 1R5VA 1ONQB 1VQNA 5I6KA 1OWWA 5T1JA 5ELDA 2PCXA 4FADA 3W1ZA 4FQPA 1IAOA 2CKBL 1JD9A 4L8SB 4QTFA 3H6MA 3C2AL 4CDDC 1IX2A 4PJCB 1AKJD 3X1EA 2YZ1A 3H85A 4PJFB 4RMVA 5CFAA 5J5EA 1SN0A 2HUEA 2P80D 4G7YH 2VSKB 3MCKB 5HYJB 4ONOA 3S2CA 2NY3D 2IWGA 4QXUL 5MEPB 2JEBI 3QUMH 1X9UA 3AM8C 3SBWA 1U6AL 4NOFA 1JGDA 4QI3A 3V0HA 5CBAA 2VCOA 5HHOD 4Y9EA 1C8PA 3S1NB 1A6AB 2WBKA 1LTXA 4H8HA 1RF2D 6FABL 1BJ8A 5GHWH 3KR3H 5D2LA 1A0QL 3WDIA 1FFTB 1K6QH 1EFXA 1ML0D 1MREL 3BSHA 3HZMB 5IUCA 4B08A 3AS0A 4GG6A 1WWBX 1F42A 4KVNL 4Y1AE 1ITCA 5IHHA 1RERA 4WEEA 1KTKA 3GRWH 4PRAA 5CSZA 2I9LB 3QUGA 3QT2A 5EIQA 4ZOBA 1BPVA 1U0QA 3OV6A 4JKLA 2E4TA 1CE6B 2B15A 1RMFH 5A6IA 2Y1ZA 1XR9B 2FNWA 1A6XA 1TEYA 4G3YH 4BSVB 3KR3L 3BH4A 1E4HA 2BY3A 2HX8A 4N68A 1WTPA 4YPJA 4DGYL 4ES8A 5B38G 1EU4A 1W2KT 1AGEA 3E8VA 3KPOA 4Y0GA 5T5FL 1BFTA 1U6AH 4QHMA 3OF6D 3JVFC 4QRQA 1XF4B 2DQDL 1HZHH 3GXNA 3TWCH 4YS4A 3BKJH 3WNLA 4OGQC 1CQYA 2ICCA 4QRTA 4YY3L 2BX5A 2LFEA 4YXLH 1KEML 3KPSD 1XGQA 4KXBA 3BE1H 4LFHD 3MLVL 5I8CA 1WVLA 2AJVL 4PJAB 4DHLA 1SOXA 4JO2H 3DXAD 2C9PA 4HZ1A 4IEFB 5SV4A 2VLLB 2ZICA 4EN3A 1FGVH 5B7FA 4CSZA 2Y7SA 2CPCA 3E7JA 1FO0H 3ZO9A 2MFIA 3MA9L 3KAAA 1A4JB 3LH2L 3WBDA 1EHLH 1HJPA 2DQMA 5E1AA 4N2NA 2QGDA 1C8QA 2CD0A 2L8AA 4NQDA 4P04A 3MACL 2DJSA 3QDAA 4HKXB 1BIIA 2GN5A 4HBCH 1AYRA 2BS8A 1ZYRC 4I3SH 4JPIB 4LL4A 3MRQA 1LO2H 3F7QA 4W9FC 4XXDA 1M6OA 1B4TA 5FHBL 1VKXB 3BFQG 2ADJB 3QQ9D 3J7A5 5LL6S 4CC0A 4M4RB 4L9DA 2VY3A 3TYFB 2VDRB 4B7LA 3BZFB 3MXNB 1YECH 3T4AB 2VDQL 3O6ML 2UXDL 1Z6JT 2CUMA 3L2MA 1QLRA 1XGRB 2C1OB 4EXKA 1BXUA 2V5YA 1B4LA 4XN2A 4DV1L 3H9HA 2PI2E 4HIHA 3V5DB 1KPRA 2QEXA 3ZGHA 2K5WA 4EN3B 4IBSA 3NMEA 1MVFA 2F54A 2CVRA 3BLBA 4L3AA 4QXGH 3MUGB 1C08A 4ZOCA 5C0AA 2Z8SA 3T56B 1OAZL 5GGRA 2F7OA 4OJCA 1JPGB 4LUZA 1W91A 1R5WB 3B5HA 4KOCA 1QO3A 5DEFA 1ONQA 4LSVL 4OZGB 4MGXA 1FAKT 3MA2B 4HWZB 4OLYH 4Q4EA 5GISL 4PJ5E 5I71B 4YSEA 3THML 1QG7A 1CDCA 3HG3A 3AUVA 4AENB 3NOIA 4ODVL 3EO0A 1E9OB 3F04A 3GBEA 1I3RB 2HG5A 1DR9A 4I0PB 4HIQA 3ABKB 1V3MA 3ZTCC 2XG4B 2UWEA 4YO0A 4MIUA 4BZ1H 3S2HB 4OCXH 4DAYA 4HX1A 4HJ5A 3KYMA 1SBSH 3NA9H 5D1ZA 3TIEB 3BESR 3RUGF 3UEQA 2WZAA 3QR8A 3FQUB 1Q0EA 4L3FA 3S17H 1DQMH 4O42A 3RGHA 4L05A 4X65Q 3DK0A 4U1MA 3NEMA 2PXYC 2BFVH 2VUYA 3MFFB 3SOTA 5ELOA 4OD2B 3ULSA 5HHVH 4EZMA 4Q9QH 3PREA 1MJ8H 2H2SD 4TYUA 1K85A 3Q2VA 3FEWX 3VXRA 2A0LD 3KYNA 1S5IL 4POZD 5CGMA 4CA4A 4C3IG 3ASOB 2Q1EA 3ND9A 4HS8L 3LX9A 5AYTA 5HI4D 1N70A 1LEKA 5IJKC 4K0OA 2EDJA 3REWB 3G5YB 3CCVA 3OB0H 4N3UA 3IJ7A 1RU9H 1V1PB 2M1KA 1FVDB 1W15A 4X6AH 4FTVD 3JWDH 4G6FD 2CCZA 1ZTXL 1W6JA 4PP1C 5DJYA 5HSFA 4MNOA 2OK0H 4JFQB 1VEPA 2LLGA 2J3SA 4LDOB 3PUXA 3ARFB 5A2FA 2Y0SA 4HW6A 3CP0A 5KYWA 4PLJC 1FFOB 1N10A 1Y1DA 5I2YA 3F65A 4XP1H 2JQAA 3SE9H 1SLJA 1XXDC 3K6SA 3DX6A 4J6RL 1ILUA 5IEKB 1A3TA 2DUDA 4JI7Q 4N5UA 4X7SH 1XAUA 1HKLH 5FGCB 4A37A 2JKTM 3B56A 1JNHA 4F7XA 5B39G 1W0VB 2FAUA 5LGHL 1U8LB 3GJEA 1T0PB 3P11H 5ELBA 4B3RQ 1RAMA 1AQMA 3GTNA 5DRWB 4XCNA 2XWTA 2FDBP 4GLVB 1SYGA 1D2BA 3WFBL 4UAOC 1VQEA 1S7WB 4MZ9A 3DGCR 4KAQH 5GRZA 2WFWA 3HFZB 2FHFA 4OI8A 2WAHA 4LDEB 2P48B 4ZG1A 1E4KC 2ZPKH 2EIJB 2SNMA 4ZTPL 3MRNB 3RX8A 4D3CH 5I15H 5E3FA 4FOMA 4Z78A 2AMGA 3U9WA 3WXWL 4HEPA 5D93C 1U93B 1OARL 3VI3F 2Y2WA 3BGFB 1ZGLB 3GHEH 3FO1A 4Y4HD 1A7QH 5I0ZA 3QORB 4DEUA 3CCQA 5BOJA 4DUZL 2XBTA 2E7LC 2EDQA 3JUYA 2H8PB 4WEBH 3VFGL 5B7MA 2LFNA 2NXZB 4WDIB 4K94H 4XMTA 1U9RA 5CV7A 2Q76B 2VN4A 1CL7I 1SFOH 3BP5B 5GRVL 1KELH 1FL5B 3QJRB 5EN3A 5HHPB 3OKDB 1WWAX 4ZS6D 3HB3B 4OIIL 2KCMA 4W4NA 1KACB 2XC8A 1OXUA 3HRZC 3OB0K 2F7IA 2PF6A 3Q2LA 2DWTA 1R9FA 1JJCB 3FN3A 4HK0B 2CO6A 3CMGA 3GO1H 3O6FD 3RTQA 1R0AL 1VQFA 1RUQL 2DI9A 1YAZA 1S7UB 3CLEL 3IBEA 3LEXA 4JFFB 1MI5B 1SDAB 1LNUA 4KZCA 5F7WC 3K1DA 5KJ4A 4KK9D 3CX2A 5I18L 3TA3D 1MRDL 3TREA 2K7QA 2XU9A 3N43F 5DVMA 3HMWL 5CC4A 1KTCA 4FXDA 3NP3A 2JXMA 3V52H 2A74A 1A9EB 2NR6D 3TBYB 5CKAA 1MELA 1PX8A 4F7MB 1A6TA 1YNXA 2GB2A 3P4OB 1X54A 2HCIA 4ZAKA 1S7XB 3MCLL 4CBVA 4OZ4B 5D1QA 2VL6A 5DR5H 2BOSA 1N59B 2EY6A 1NGYB 3FFCB 3G6EA 1GZPA 2FD6L 4S2SA 1F4WH 1JVLA 1MI5E 3QH3B 4YHPA 4EI5C 4DR4Q 4OGXH 5PAZA 3FSOA 4ZO8A 1OSZA 3LYRA 3QDHA 5I23A 4PD4K 1B2WL 3EZJB 2BWQA 3VE0B 4BFGA 1NEZG 4OCNC 5E5RB 1GIGH 1TMQA 1TU2B 4C56B 2KPWA 1FFOA 2F52A 4HAEA 1MHHA 1CZWA 4APQD 1RZGB 5C7ZA 2CBOA 3LHAA 5AW2B 4KMUC 4BKSC 4U6VL 1NAKL 3HS0B 3UAJC 3CC5A 4JFED 3DSNB 2ESVE 4V11A 2BE5D 4M1GH 1CD9B 4LLYB 4ZUSB 2GIMA 4B9YA 1T1YB 1TWCB 4HGKC 3JV6B 5CEYA 4BINA 4MXQC 3ZE0B 4UNIA 2DI8A 1KJVA 3KXFA 3S1NH 3RL2B 3UFIA 4Q2ZB 4KUZL 2B8OT 1AD0A 4JM4L 4GXVL 4HISA 3GTQB 4XYOA 4H1LH 2B63B 4MNQB 4XX5A 3C5ZC 2FUQA 4PRHA 5JLZB 2QQNL 4AQ8A 4AQOA 4P23B 4PB9H 1XR8A 3X13A 5JOPD 1N2RA 2H32B 3DX9B 4N8VA 4KZEL 1PG7L 2R59A 2ENJA 1NIBA 4LFAQ 2CBMA 3KBHE 1D5BB 4JL1A 1KCVH 3QR1A 1FZJA 5LHDA 1RK1B 4KRLB 1XXFC 3EOTH 2OJEA 3PV6B 1SZNA 2AJ3A 5DVKA 1U8JA 1NCDL 2MEJB 4Y5YA 2LOEA 1D5RA 1IBFA 4ZKBB 1FL6A 1N3NA 1F86A 1EXGA 2CM6A 5CCKH 1PGRB 4OELB 3B7TA 3FBKA 1J8HD 3VYUA 2OMTA 3IAPA 5HHMB 1LXMA 3FMGH 4J3XA 4YIQB 1HEZB 1IC5L 5HBBA 1OPGH 4AM0B 1CQFA 5I1HH 3RQ3A 4LUVA 3HAEH 1MRFH 4X6CB 1OAQL 3MBWB 5EBWA 4C56A 4NGHL 5D2LF 1NPNA 4GOPC 1IIIA 4Z7WA 3S97C 1SBSL 1U8HB 3NA9L 2A69D 4FHJA 4UT6H 5BO1L 1JI1A 2Q9OA 1Y8NB 3K8LA 5ETUA 2PTVA 2VJ8A 2XVBA 4HIHB 4AH2B 4IRSA 1H15B 2HWZL 2L15A 2VLRD 4OF0A 4XP4L 1J8RA 4N25A 4Z7IA 5MEQB 4LSQH 3BWUC 3II3A 1QI3A 4U33A 1Q1JL 1S7SB 3D1MC 3POHA 2XQYA 3DJRA 3T1HL 1MCSA 4PJGE 5AYUH 3TO4D 1TTAA 1NC4A 3AQZA 4J28A 2H47C 3LH2H 1PLBA 2N7AA 2VE6B 2H2PC 1FF5A 4QOKB 1SROA 1SUJA 1QACA 2IGLA 4LOFA 3ETBJ 5E8EA 2Q2EB 3O13A 1D5BA 1BFVL 2DTML 2J1YA 3AITA 1DN0A 2XZQL 4MA1B 3BUDA 4U1LB 4WUUD 1OXVA 3ROLB 5JXAL 3D0VB 3DJ9A 4WUKH 4FP5D 2WTRA 1N2RB 2CZNA 2H32A 3QXAA 3VYPA 2IANA 2G9HB 4AGQA 1Q9LA 4P07A 4HPHA 4PJ7B 1ERNA 1I1YA 1HNWQ 1PEZA 2XVLA 2EDFA 2NUPA 3P73B 4NQCE 4WI7A 3VI3A 3KCWA 5IHZB 2QDLA 3IMUA 4HJ1A 1B9ZA 4OD3H 4JHUA 4FFTA 3CMOL 4GRWH 4KX7A 4YXHL 2LQRA 4U1SB 3QEGH 3K2UL 4MS6A 2A6JB 4CKVX 3HG1D 1E5ZA 2E7BA 3RWCA 4OJAA 2W95A 3MZTA 1D5XC 1BZOA 1QTPA 4NM4H 3RVXC 2AJSL 3ARDD 4UOJA 3AXLB 5E2UL 2EDBA 1NFIB 1TMCB 4QF4A 3D4YA 3GMLA 2CDGB 3M4YA 2AQ1A 3O8XB 2F7RA 3UTZA 4TVPE 1L0YB 2J7ZA 1WISA 3GSNA 3NSJA 5C6PB 3I6GB 1J5EQ 4JPVH 4FFYL 2D7MA 5F89B 5ISRA 5FA4B 3C12A 5JJZA 1KGXA 2NQCA 1PH5A 1WBXA 2DBJA 5EC1B 4ODSH 4R7VA 1NMCB 3A6CL 3VFTB 4CU6A 2GBAA 5D7IB 2XIDA 5FW7A 1JGIA 1OB1B 1NCWH 2IAMB 1S78C 1EY4A 1G1YA 3VI4E 4OX9L 1ED3B 1MSPA 3PPSA 4G8AC 3BKJL 3SDCB 4GRLB 4UI2A 1E8YA 2B14A 1CDHA 3P73A 4MTMA 4XNXH 2A73B 4PG9B 5BRZD 1QUPA 2J71A 3UROR 5CEZD 4PZ6A 3K80A 4KK7A 3QXAB 4J3OF 1M7DA 3BYYA 3BPOC 4E41B 1U8LA 3AY4A 1ZKAA 4BRVA 4HS6A 1INQA 5EO1B 4R0LC 3V6FB 3ASNB 4JFFA 4LLWB 5DVNA 4IMLB 4QUCA 1TXYA 2VZTA 4LPTA 4K2UL 5IP7H 3PWVB 4F7TB 1JVKA 4KKBC 5HHME 5DZOA 5C0NC 4I77L 3VFPA 2E9IA 3M88A 4GSUA 4JHWL 3Q6FA 5KNCA 4FQIL 4C3HB 3GBMH 4DV4Q 4O5LH 2XACC 4OT1L 3WXVL 2QPEB 2IALB 5JUEL 1AE2A 3BN9D 4NQXA 1ETJA 3KW7A 3SEPA 1N6VA 4XR8C 3WNKA 4F2MB 5SWZE 1V1PA 2GA4B 1X3DA 1ZV5A 3GS0A 2VW6A 4OLEA 2VLKB 5IFAL 1JRHL 5DZ9A 2NDFA 2VLME 3D0FA 3NJKA 5KYLA 2BY1A 4GIPD 5IGCA 3H3VI 4OBSA 1K83H 3U1SL 1DONA 1OAYH 1SQ2N 4DK6C 2FLBT 2WXKA 4LSSH 5FHBH 3HI5H 3T65A 4ZI8A 4JLRA 4G7VH 1IGCH 1XF3A 2Z4TA 4TOYL 4HUWA 1ASYA 4E0RA 3I3EA 3R7QA 3ECWA 1TCMA 3UBXG 5T1DL 1JORA 3ZT5A 4H8WC 2AVGA 3LRMA 3MLTA 4PRNB 2F0DA 1TVHA 4BKLB 4JO1L 5LHY1 1QBAA 1YPZB 1BF5A 5EBMB 4KAQL 5C08D 3GSRB 3S3PA 3O2WL 4IUNA 2E6JA 1D8LA 3TURA 5DM63 2ED7A 4O2CB 5IB5A 3UACA 5B8CB 4S1RH 4QRRD 4DAMA 3BKMH 2EC8A 2ZOLB 3GIZH 4PRHB 4U3SB 4JGNA 1YEGL 4OCSL 5HI3C 3RIAK 4N2GA 2X6BA 5KSAB 1GGIL 2A4CA 3FZUD 4DR7Q 3DMMC 1TOXA 2OQJA 2BIPA 1OD7A 2KHAA 3H91A 1SEBA 2FWLB 3GTLH 3CCJA 1PZ5B 2PWGA 2QQNH 3K7AH 1BAWA 3VGHA 2WJ7A 4JO3H 4JFYB 1VENA 2J1ZA 5IKCB 4DGYH 2NX5D 3F12B 4K6LA 1OTSD 2DWDB 2DMCA 1C12A 4FLSA 4IKNA 5H8DA 2SEBB 1YEJL 2ZX5A 3MSPA 1SNDA 1SYVA 3MN8A 4MCZB 2QHLA 3VDYA 3RDTC 3EJUA 5SX5H 5EUKB 3BFOA 3N41F 1PA6A 3T1WA 3GD7A 1MHHB 2WLYA 2A4EA 4UNTA 4WWKA 3MMEA 3Q22A 4CMMA 4ZX4A 4BY7H 1JHLH 3TP4A 3H55A 3WU1A 3EUDA 1PEWA 4CRPA 4JFEE 4X3SA 2YXVA 5F0LB 3BD3A 3CFJA 1OB0A 4OY9A 5E8NA 4A3DH 4KJPD 4MDIB 4XNDA 4IUPA 2K70A 4KQ3L 2AITA 2BWIA 2EZ0D 2W0FB 4MX7A 4YBQC 1T3FA 2ZCZA 2YGOA 3FHAA 3KCPA 2BNQA 3HB3D 5G3LF 4PB0L 3KPRB 1IC0A 1NCIA 3DIDA 3NJHA 3D25B 1AZZC 1F2YA 2F5BH 5EO9B 1MCBA 2J57A 4QRPE 4PZ8A 2DPKA 1TVHB 2OA9A 2YAFA 4GNXA 1LILA 5GGSA 4C54A 1AXTH 2DQEH 5F2DA 4YHML 4KI1A 5I1LA 3SJVA 1NLDH 5T1LB 2UUBL 1CVRA 2DQIH 3I50L 3DTXA 1M71A 3U9PH 1YRKA 2GT9B 2HKAA 3K8KA 1PNCA 3EYVA 3AU7A 4K3DH 2GSIB 3SD2A 2CDFA 3QORD 1E5YA 5ALBH 5BRQA 1GS8A 3B7SA 2D3JA 3B8YA 3O2DA 1AHWB 3AREA 4HPOL 1BIHA 5F7DB 1P1ZB 4DPCX 2PYEE 1SEQH 1P4LB 1EWHA 5D1ZI 3QIBA 4Y4FA 4YHHQ 3BUPA 4MWFA 2FK9A 4EN2A 1R5WA 3LIUA 5B3SB 1W3SA 4KKAD 1AY1L 2BJMH 1XCTA 2FSEA 5BJTA 3TH2T 2BH0A 1T0MB 4OLXH 2X2YA 4C59B 4NQXB 4DP0X 5L6YH 2B2TC 3WHXA 4YHNB 3PL6A 3WNMA 2Y6SD 5FUCC 1GTFA 4Q5VA 3D5OF 4LVNC 4CVXA 5KAQG 2H32H 2D7OA 1XGYH 3H53A 2GVBA 2FRGP 4JMXA 5KSBB 1ACYH 5I1EL 3LIZA 1YSOA 2RFXB 1M1KC 4LQFH 2HH0L 4ZMXA 2YQ3A 5AW1B 4RFOL 3L1OH 4JQVC 4WV1C 1BZ9B 2XN2A 4ZPVA 2Q86A 1VQDA 4L4TB 4XNMA 1X65A 4IMKA 2WLNA 5HYSG 3A55A 2MHAA 1BYOA 2WZ0A 2F1EA 4LF5L 2FEEI 2Z8RA 2ALWA 4Y9BA 5EPKA 2N0KA 3K58A 2EVGA 2E2JB 1A4JA 1WWWX 4QTIL 3HOZB 4XNXL 3KNBA 5CM1A 2B2VC 2ZXBA 2OJ1A 3QCUH 1KTRL 3R19A 4GFXA 1SJHA 1WTWA 2WZ5A 2ZD0A 1TQSA 3PLYA 4LARH 4LVOC 1R46A 2GT9A 2V9RA 1ODAA 4C83B 1G1OA 1E7UA 1NC2D 4O2FA 2XY1A 4QRTB 1MHWC 3SQOH 2H4OA 1OKEA 5FO7B 2MIZA 2CSPA 15C8H 2BSRA 4Y8DC 4N0FA 3S8WA 1AGEB 4DR7L 2NBFA 2KJXA 1N9PA 3GJFK 5FYKL 1K28A 1IBHA 4HCRL 5EF2A 3N43B 1DQQA 3BT2L 3HE7D 5AOMA 3ZKND 1YY8A 2KZBA 2NYKA 4JRFA 2H0FA 1U95B 1G84A 4KTYA 1WZ1L 2VDLH 4YQXL 1FLRH 3FB6B 3DRQA 4UM8B 3VA5A 3STLA 3TPUB 3U46B 2ZKYA 1MPAH 2X3CA 2UUDK 4HMCA 3NVQA 3C5JB 2UUDH 2Z6KC 3GQFA 2JA7H 1G9NL 3FZUC 2OKMA 3VFPB 5D6CB 3W5NA 1Z6HA 2E76C 2AAVA 2Q0ZX 3R18A 4GXUM 2Q2LA 4OLVL 4ZRGA 5C97A 5DD3H 2BK8A 3ZE0E 4LEXL 1A6ZB 4TUOA 4FXGB 3MLYL 3O3UN 1UVQA 1E27A 5E9AA 4CUCA 2BDNH 5DJAB 1H8SA 2AQPA 4B3SL 3ERSX 1D2OA 4MNQE 1DVQA 5FOBB 1GMIA 1XYIA 3PMFA 3UDIA 4M1DL 4KKLD 2BFVL 1VGKA 1KT2A 2X70A 2BSSB 2FHBA 3CZEA 1ZVNA 5ITFB 5HYJA 2FL5B 4WORA 1B3QA 2Q3ZA 5D1XC 3RL1B 3TJEL 3GV3A 1R9TB 4DP4X 5DEZA 1TS2A 3T8XA 1TIID 2CHDA 1VMPA 3TBBA 4Z7VF 3WJLA 3WNJA 3FQYA 3QPKA 2OM5A 3D39E 3IF1B 5T1DH 5C92A 1MW1A 4X6EB 3UAFA 1FWXA 4YAQB 3CZFA 4G9FA 5CF3A 3JWNH 3QC6X 2NVXB 3PJNA 1TF4A 1HZCA 4PJHE 4PGJA 3GSVA 3D05A 4MVBD 4YR6A 5F7EL 3H94A 1O7DC 2CRMA 4FQXD 2Z4QB 4JY4B 2NNAA 4NENB 3O3AA 2A9CA 2K05A 4NGHH 5EIVA 5IYDG 4NO3B 2SDFA 4B5ZA 2UU9L 4EQNA 5DHVB 3DROA 4NC0B 3T1FB 1TZAA 5EFIB 2R56L 1DJGA 2QVIA 2R1WA 2F4VQ 1STHA 4DZBA 1KFAL 3D85D 4ZDHA 4U4BA 1LE9A 1VQOA 4AK2A 5IP7G 3UYRL 1T83C 4JHBA 4CKCA 4IU3A 2XFXB 5FKPA 4WI0A 4OW6A 1AZQA 2AJ3B 1MVUA 3SPJA 4PJ9A 3H8NA 1QB5D 2F0LA 4XI5C 1UWEL 3Q8FA 1PDKB 2Y06H 2XY2A 3TVMC 4CJ2C 5I73C 3HZVB 4O02H 4BYHA 4NKDB 3CK0H 4YFEA 1RZ7H 1ACXA 4DEWA 2C9OA 1EY8A 4JFDD 4R7LA 1BD2A 5KJ7E 1R1CA 3U9UA 1ZGLP 4WRLA 1KYFA 4NWTL 3MRPA 1NFAA 3U1QA 1TQWA 4FYSA 2B20A 1WTXA 5INCB 2WVVB 2JYOA 4L4VB 1LJMA 4W9KC 5EKKA 4QRRE 2Q8AH 2HVJB 4ZUJA 4IBLT 3OKKA 1QSED 3KJ4C 4M48H 5DQJB 3C09B 4HS6B 3GS7A 5I71C 4OZIA 2EUZA 3I2ZA 4K3JH 4NNYA 4Y1SA 5CINL 1LE9B 4OCWH 1Y7VA 4OLZL 4RQQA 1FYHB 2W38A 1BG1A 4PB0H 1HQ4A 1ZMYA 2YLKA 3CFUA 3EBEA 1CFBA 3RX9A 3STBD 3IWUA 2WXNA 3LN4A 5DCCA 2VB3X 5C8JB 2ZJPA 3MUY1 3DGGB 3CC2A 3FTGB 3RLNA 3ARQA 3S0PA 4YK4C 4KROD 5DJ6A 2VR4A 1TWFB 2D73A 2D2CC 1IEAA 3C2PA 1G7LB 1HZHL 1T6BX 2Y6TE 3P77B 2O72A 4S0HA 2CWAA 1KPRB 2J21A 3V0DA 3DXAB 3HFML 1SYCA 1NANI 2VDNB 1YJDH 4Y2DC 4E5XB 4LPCA 1E0BA 3LEVL 5F1OB 2CH4W 5BN4A 4DK1A 2QTVA 4HHWA 2FJFA 2GSGB 1PTOH 3K81A 4QUOA 1TUPA 4K3JL 1V8HA 4ZAKD 3ABLB 4LHUG 4JFVA 4WI3A 2J43A 1X3EA 43CAB 2JJTC 2P5WB 4HCFA 5HGDA 2WIMA 1NFIA 4XHJC 4KH9A 3RL1A 3T8MA 1HH2P 1PX3A 3UPAA 4P3CL 1R24B 2ERJC 1YEWA 2HJFB 5L4IA 3ZE2E 1FD7D 3GTLB 5GAHC 3MV7D 1LNUB 1NTDA 3MRPB 3FHEA 3QEQD 5I9PA 5I0DA 4Q89A 4RH6A 3H2WA 1MG3C 2HRHA 3ARFC 2EO9A 3PWPD 4KY2A 5IESH 2B29A 2GBTA 5CILL 5KVDH 4TQIA 4N6RB 1XMWA 4LLDB 2H1EA 2WB1E 1P9MC 4DVBB 3WDHA 4ANKA 1DEEA 4KKZA 3FTYA 4GSXA 1BBXC 1KLGB 1SJEB 1EO8L 3FFOA 1XGYL 1CQKA 2EYOA 3CVHH 4AJVA 3QO2A 4JRXA 1CE1H 3AT9A 5I8CB 4DERA 3T0EB 1KXTA 3HNSH 1YNTA 1YUHA 3AROA 5DJCB 4X80H 1ZVSA 2KS0A 3TYGL 5E8PA 4YX2H 1P6AB 1I3QB 5FLUA 1PFCA 1CK0H 4MRCA 4DZBB 5LVEA 2PYED 3MDJA 3J81E 3ORJA 3DO4A 3GD1C 5CLXA 1JGLH 1VZGA 4PJEF 4UF7C 2JI1A 1GGYA 2FSDA 4N86A 3LV3A 4F7KA 3BJUA 3MNDA 5EZIH 3NSXA 1OAYL 1UA6L 5BXFB 2X2UA 3ARVA 3B3BA 3D4GA 4MXWH 4ECNA 1B0GA 5F8RC 3HOWG 4V1DE 4EI6B 5FYJH 2R0LL 2ZAIA 4DO6A 4P99A 3RWGB 1T6WA 3TV3L 1SYSB 3V2TA 5I4DA 3J80L 3DHUA 3OLGA 4ZTPH 3PP3K 4EEEA 3VRIA 5I0XA 4G9FB 1PD6A 2R7FA 3HKZB 1A8JH 1G4RA 3GMNA 5JJLA 5FJ8H 3DUUB 4MAUH 1G0DA 2EIZA 3QE5A 2HQLA 2IGFL 1JMCA 1EEID 4DV6L 4HAFA 5F2FA 4Q6KA 2CHBD 1WCBA 2X4TA 5DRWA 2YPVH 4EIZC 2AZAA 4CC4A 1CFTB 3VTMA 3CFJB 3MJ8A 1UATA 3VB9A 2KQ3A 2K6ZA 4M61B 1F2LA 1FLTX 2EDMA 3QFDB 5K9JL 1PZBA 5SWSE 1GTNA 3FHQA 3ZDZF 2AQ3B 2XRSD 5GS1A 4J2XA 5K9OB 4UUJA 1TWGB 2QF7A 1KUMA 2DD8H 3HB3C 4M6OH 4XPGH 3SPVA 1K4DA 3FU3A 1SE8A 3RWIA 2K9UA 4H26A 1HL4A 2JIXD 4UQ2B 1XO8A 1CLOL 3WTSA 2IPKA 1YHBA 3MXUA 1LM8V 3P4MA 1G7IB 1IGIL 4R4QA 4OLVH 4TTGA 3DX9A 4N8VB 1XZWA 1OIOA 3QUZC 5EU6A 5AALA 4HAGA 5SWSB 3X13B 3J81c 4G7OC 1A14L 3G5ZA 3EXJA 3FNKA 5EUOA 3NELA 2UY6A 3AJ7A 3MLRH 3QUYC 4XQNA 2JA5G 4TLSA 2WSPA 1N34Q 2PMZB 2DEYX 4WDIA 4C55A 2WLMA 1T0MA 2F03A 3OAUL 3PAYA 4KV6A 5BW7A 3IU4L 3DWAA 2Z35B 3Q05A 2E27H 1JN6B 5E9DE 1G9EA 5FXCH 1CICA 1QASA 4GW1B 1HHKB 2YQGA 5IFJB 1LACA 1JVOA 2LR4A 4HJTA 5E2TH 1TPXB 1VCAA 4FYDA 3MFFA 1J1XL 2PO6D 4P71A 1BZQK 2WQUA 2Y5QA 3SPVB 2CO3A 4KX9A 5DJ8B 5GS1B 4IFDJ 4OCYH 2FIKB 5I6WA 2GK2A 2TRYA 5CBEE 4R26L 3QUYD 3QB3A 3F7VA 2EDEA 3SY6A 3BZDB 5K36G 3NN8A 2A9MH 4XC3L 3NTKA 1JK8A 3N42B 4BJLA 1U0LA 3C5SA 2K8MA 4JNXA 3IVKA 3Q01A 2JA9A 1HH9B 1R3LA 2I25N 3EROA 3BX7C 1U8MB 1SN8A 1A3UA 1QO3B 3I70A 2LAGB 4QRBA 3CNKA 3F3HA 4KMTL 2GHWB 5HVGB 1BLNB 3MLSH 2YQBA 3F83A 4MJ4A 5EA0L 4LASH 1HEJC 3TFKD 3QG1A 4I3RL 3MLPA 3ENEA 3AWGA 3PWUB 2NY2D 3GSOA 3RZWA 2G2PA 2N4IA 1MFMA 1KJ2B 4MA8L 3WLWD 1R3IL 4HUUA 2BVYA 2FMCA 3HZ3A 2R7DA 3BH9A 4GMSH 5F7BA 2UZPA 4XQJA 3FCGA 3N41B 2B2UC 1GJUA 4MB3A 4OLXL 5JYMA 1BF8A 5AD0A 4WFHE 3UZEA 4QJ5B 5IW6B 1E28B 3QQDA 5JDJA 3QFGA 2HVJA 3ULUD 4B3SQ 4WVRA 3N3EA 3ALPA 4QEGA 5AG9A 2F6AA 1SEQL 5F3HB 1E4WH 5J89A 3R06B 5GGQL 2X3AA 4F7CB 1G8ZD 4WU7B 4RMWA 1FFNB 2YN5A 4APQC 2R69A 1JDDA 2VQFQ 2ZJSH 3O9WA 3QORA 4Y19D 5LBSH 2NUTA 3CSFA 2FO4B 4TNVF 4LRIC 3HG1E 1Y07A 4DR5Q 3MRNA 3CDFA 1Z3RA 2H6PA 5AOZA 1CKNA 4B3RL 1EBAA 2N49A 2HDLA 2HRPL 3FQWB 2B1OA 2JTYA 2R4SH 4W6XB 2XIWA 1HHVA 4JO5A 3TN0B 3TT1H 3BJLA 4ELDA 5EORL 2FHTA 2APTA 4R8NA 2BNQD 4R8WL 2OYKA 3LD8B 5AJ3L 1JYXA 1IM9D 1JHLL 4GXVH 1JNHB 1WD8A 3MLRL 4G6ML 5M94B 2BSEA 2NNAB 4ABQA 1CYWA 1A14H 1DVFB 5E4EB 4N2LA 3PWLA 3GTKB 4POFA 5DK3A 3BH9B 3JQOB 3VSQA 1LGVA 1FO0B 2WZPA 3G7TA 4Z7UE 5I8OL 1VRSA 5LCVA 3X11B 4P5TA 2BMKB 1SRUA 5M3FG 1PH4A 3QUKA 9PCYA 1ZD6A 5C3EG 3FPPA 1GGBL 5KUMA 2A69C 2F08A 5CJOL 3MVSA 5F1SA 1F90L 3W39A 1CICC 1TZHA 4BFFA 2J72A 4DP8X 1BAGA 4ABUA 3ECUA 1EJ8A 1E2VA 4RG1A 3QEQB 3TWYA 4EKXA 2J6EH 2WQ8A 3TZUA 3IN2A 5IJVB 1AAJA 2O26U 5DURB 1T22B 3O8XC 5EHFA 1U2YA 1D5MB 4C3IB 1K0SA 2CO2A 4NKDA 5B3NA 2YZ8A 1KZQA 2A6EC 1U3NA 3RZCB 4ZMAT 5ICXA 3FU8A 3PO3H 1LEIA 1R33A 1Q8KA 1VGEH 3G04A 1KV3A 2APFA 4UANA 4XMWA 5SV3A 3WEOA 1MJ8L 4JY6B 5C08A 1AJ7H 4ODBD 4NFDA 1FYTD 4DKAC 2PWFA 2V5MA 3C2AH 1IC5H 3HOUG 4ZS6C 3NE5B 4RMRA 2MCMA 2ZYRA 1JTPA 2IQ9L 4OGYL 3DOHA 1A3RH 1PY9A 4K71B 2P43B 4WQOA 3T2NH 1S72A 2EXSA 1TJHL 4W93A 2WWNA 5KVEE 2AK4B 4ONGH 5LDSA 4XIGS 1IEHA 4RIRB 4IJ3B 3TO4B 5KVGL 4DZ8B 1JXKA 1FNSL 4D9QD 1U8JB 2PWEA 3GMRB 1F97A 1BM3L 4IO9A 2B59A 3IXTB 2WKLA 3VXMD 2BOCA 4Y4HC 3FSAA 4GIAA 2AXHA 5AAMC 2CKBB 1DHKA 2NYYC 4Z7NE 4GQZA 1CDYA 1SVBA 2VDKH 3X1BA 4B9GA 4TLUA 2WXMA 3C6SB 4ZNCD 3IBOA 5J1ZA 4UQIM 1HIMH 2JELL 2VDOB 3FOLB 3P2BA 3EYOB 4WHTB 4L29B 4XMXA 1MQ8A 1Y0LB 1HQRD 5HHOE 2JB6B 3S5LG 4ACTA 4ZFFB 5G4NA 1SGKA 3ZSTA 2NXYD 1OL0A 1OAUH 2FLRT 2X4PB 2XQBH 3BKCH 5EPMA 1YUKB 3WXWH 2PPDA 4P3CH 4YN3A 3V6FA 2J2ZA 4Z3TA 3RZDB 4K6DA 5L7XL 1MCPL 4Y4KC 4UU9A 3WSQH 4XTRD 3TSSA 1VKXA 3Q13A 1HNFA 5E99L 1JYNA 3BSGA 3MRQB 4XXDB 3D30A 5EGTA 1OLZA 3GBNL 4P5TD 4YSSA 1ZS8A 1OSEA 4RGNC 4XDXA 3L7FB 1B9MA 4ZMYA 3FCTA 1GS7A 3DTDA 3GXPA 4EIUA 5I2IB 1CA5A 4DXFA 3H0GH 2CRZA 1NC4B 1X4XA 1RY7B 1S4IA 4OZHA 3WHE1 5F9WB 3L3OA 1BOYA 2R4SL 2F53A 1UT1A 4NCDA 4BM7A 5T1KB 3C5JA 4JI5Q 2L7UA 4PJXA 4KTAA 4NT6B 4XVUD 2A77L 4Z3FA 4AGOA 4GS7B 2JQOA 1GYAA 2ZNWA 3MA9H 1JYVA 2AZUA 1DSFL 4B3ML 3RGVC 3L5WB 1XMOL 2FSEB 1Y69U 4NO0D 3UJIL 2N1KA 1DBAH 4JO2L 3NRQA 4KWUA 4JFSA 1NDMB 3LNDA 3RY5A 1G7JB 4IU2B 4IBTA 5F7DA 1PIFA 4PUBH 1CGWA 1SNQA 2F4IA 4XNQA 1G1KA 1H8OA 3C8DA 3MCLH 4LSTH 5GRJH 2BOBB 4BA0A 3KH4A 2OZNA 3J27A 1G7MA 1H3TA 1URLA 3BOVA 5DZNA 3KJPA 4A93G 3LQZB 5GSVB 3SJVB 5F70A 1XCWA 3KPRE 3WO4C 1CF8H 1YNLH 3H3BC 3MRJB 2JVUA 1K6QL 1MREH 3HOXH 3HAEG 5ECJE 5F1NA 4CGTA 1OP3H 3VXSA 3CU1A 2R69H 4MA8H 1XFPA 4X7CC 4OLYL 2BHFA 2BWDA 4AXWB 4A2EA 4UZUA 1E7ZA 1V1QA 1WBZA 2YEZA 4PJ8B 2NY5C 1YMMA 3EO9H 2J6EA 7FABL 1NE3A 3OR6B 1JZ5A 1XF2A 1MIUA 3TS8A 3G08A 5E2WL 4CC1A 4B0MM 2ETWA 1BCPF 4MSWB 3TEWA 2ZP9A 1KBGH 3CSBA 4WNSA 4LLMA 1FE8H 5D7KE 1A9VA 4KJQC 2D03H 1FVEB 4G59C 2AI0H 1W72H 2TSSA 4A75A 4FFVC 3BUYB 3S35X 4NXNL 4ODVH 2IPKB 4APXA 5DC9B 3P20A 1PX4A 3TL5A 4ELMA 2ZXOA 5IB2B 3E2HC 4R7DB 1OAXH 3OKNA 1I94Q 4WHYH 5B4MD 3FTWA 3SHLA 3VTAA 4DUZQ 2C3WA 2BW5A 1CFNB 3PNWB 4WNQB 3TTYA 4DV2L 4NN6B 1RJYA 1Q38A 5D1XD 1F8TH 3K72B 4XP6L 3PDDA 5ISZD 4AQ1B 1TJIH 5IOCA 2EDLA 4KJWC 4IRJA 4FG6C 5IT9L 1E9QA 3OKLB 4JN2B 2MKLC 2GK0B 4F7PA 4AIZA 2LT9A 4X6FB 1CFVL 1J0KA 1CYGA 1Q9OB 1Q90A 3GUTB 2WBXA 3CIQA 3N2JA 3DTXB 3WJMA 1CTOA 2A1WH 4GKNB 2CGRH 5KSAD 3ZMEA 3Q5OA 5ACMA 1HNYA 5CXPA 4E36A 1C5CL 2EDNA 4Q6IA 5EEVA 4I65A 3VFNB 3OW7A 3MRDB 1DLFL 5KBLA 2JV6A 2OWOA 4OJEH 2NMSA 2Q8IB 5AVXB 3ZTEA 2WQSA 3KVPA 3TA3B 1NAPA 3EGSA 2P8LB 2G5UA 3W0WE 4H02A 4N8PA 1U8OA 2P5EA 2OZ4H 4HT1H 1GGCH 1IBBA 4M43L 3VFSA 1CXKA 2KC0A 2QGBA 1XPUA 5M5YB 1E9PA 3CH1B 3HE7B 3VA7A 3BHBA 4PJ9B 4JZOA 4DUYL 4HXBL 5DO2C 1UE7A 3MNZB 2DD8L 1GJIA 2AF2A 2HZHA 5A6LA 1I1AA 1AGDB 1X5FA 1STAA 2JE6I 1DJZA 4L2YA 4HJUA 1AG0A 2Z31B 4A66A 4OIAA 4ANUA 5DFVD 1X5JA 5J06A 1S40A 4X6CE 5C09A 3GSNH 5DJDB 4XXWC 5DAUA 4I1NB 3HCVB 1I1FB 1OCWH 2OMVB 3L95B 4JL2A 1EEZA 3NGBC 2UUCQ 3MYJA 5DHVA 3J7ZC 2ZSWA 2A6IB 5CR1A 4DV5Q 3V96A 4EOWH 1TVXA 4A3EH 3IDYC 1PHJA 2JWYA 4EO5A 1WDAA 4G71B 4I7ZC 2EC9U 4OLWL 5COYA 4JI3Q 1DSWA 4FP8H 3U6XA 2E8GA 4ODHH 3LN5B 1Z2KA 4LGPB 4QT5B 4I9WD 2BNUB 3NSFA 2GI7A 1VB9A 2PO4A 3AUWB 4U1JA 4ZQ3A 2Q7AA 2VLJE 1H6FA 3W3AA 4PRBA 2YUXA 5E8DL 5BZDB 1ZXQA 5KVFH 4K5XA 5D1QD 4ZQKB 4AMXA 5C5LA 2Y6SC 1AI1H 2ZIDA 3EQLC 2VXTL 3AFLA 1LK3L 3DO3A 3ZVVA 1F45A 4JI8L 4A67A 4MAYA 5HY9A 4L5QA 1C08B 4QWWD 1UZ6F 1HDMB 2XOTA 2F61A 3CLEH 3O2VL 3LRKA 4XO5A 3EJPA 4M29A 3SGDI 5C0JB 3X12B 5K9KB 3GTKH 5IB2A 4U6HB 3LXUX 1R0AH 1WYDA 2VQUA 3PUCA 3KOJA 4FKKA 4HGWB 4PVNA 2W07B 5FWQA 5KBPA 5JHMA 3I3BA 2WACA 4KHXL 2VITA 3OIQA 5I75B 2NY1C 4LHUA 1P2CA 1MHPL 1VFAA 3VMNA 5GGVY 2YAHA 4L0YA 2D5DA 1A8VA 2G0LA 1Q82C 1I4QA 2P9RA 3FO0L 5C0IB 3VD2A 2VLRB 5KW9L 1QILA 1YY8B 1ENCA 1A7BA 4RA0C 1PNDA 2FYYB 2EPBA 1FYTA 3DVNB 2I7OA 1KB3A 3K5NA 1RJZB 1TJIL 4YHOL 1R19A 3QRGH 2FWUA 3VXSB 4LF6L 4KKQA 4D9QE 1J5HA 1P1ZA 3HZVA 1YMHA 1Q46A 1Z5LB 2B4CC 4GIOA 4IRSC 4AV4A 4DV2Q 1YY9D 2YIHA 2P8PA 1IVLA 2KUTA 4NP5A 4UB0H 4Y4HA 1KJMB 4C57C 1X5AA 1Y1WB 1QP1A 3HFMH 3MV7A 4HPYH 3FMCA 4Z7OE 2K5DA 3EA6A 3EGSB 4NZRL 3R1GH 2J44A 2X1QA 1EJ6A 2XV2A 4XCYB 5I1CL 3LS4L 3NRPA 4AG4L 4F3FA 4R1JA 1P4IL 2E74C 4AT6A 1ADQH 3VR4A 1W2BA 2ICWA 1DUZB 3EJYD 4UYPA 3KS0H 1EIBA 4JO4H 1XGPB 4I3GA 4QOKD 5JHAA 5EEXA 1I9IH 3QJYA 3SCMC 1FDLH 1PVHA 3DGDA 5LCVH 1KSRA 1HOEA 3LZFL 2MQCA 4BFNA 3US1A 3WS3A 5KVMC 3CAFA 3TWCL 1PPIA 1JGEA 4Y5YC 3UTSB 3NIGE 1RIPA 3U36B 3J7YW 4LESA 4NPKA 3EO9L 1ORQA 5JZ7C 4UHVA 4YR6B 2RDFA 4BBWA 2YKLH 1OHQA 3UTTE 3BS1A 1HX0A 1X5ZA 3QUXD 3BEWA 4H4NA 5FA3B 5IGXL 3ZDYE 1MKFA 2PETA 3BPLB 3RVTC 3NCJH 1EAOA 3CZUB 3FAXA 4RCOA 2X38A 4U1IA 5EZLB 3QP3A 5IM7B 2ITDB 1JZ2A 4JW0A 3UDFA 2F54B 5F9OH 1IO4C 2CW0D 1LT4D 3OG4B 4JQIH 1JG9A 1Q0XL 3S48A 4X5XB 4JFQA 2VLKE 3HCVA 1PLCA 5CZXD 5C3TA 2D0GA 4X8JA 5J39A 1KDJA 4QXVA 4ZW6A 1FVDA 4WSKA 3LNEA 2XWCA 4KHPL 1WH0A 1GGIH 3TBVA 1M6UA 2CRIA 3VXOB 4LLQB 4NKOA 1IGTA 1TETH 1MW2A 4JEGB 3VGDA 3EG9B 4JDVA 5TQ2H 1RHPA 2OYMA 2MUYA 3H3VH 2KECA 5KNBA 4OO1G 3VXRD 1T04B 3SYPA 5FUOL 1NA8A 3E6FA 3F7RA 2VDOL 3QUML 1YJWA 2R92G 3B8SA 1IM3D 5GS2D 43C9A 4JM2F 4B27A 1PTOC 2IWEA 3MRKA 4U2ZA 5CJBA 1L0WA 1U3ZA 4P2CG 4YGAB 5FECB 5D1ZD 2QW7A 3EFXD 1X6LA 4GKNA 3ZYYX 1GHKA 1P53A 5C07B 4ZYKA 5J9PB 2WCPA 3C9NA 1AMYA 3E5SA 2E56A 3NJJA 4KK5D 2XWJA 1E9OA 3TO2B 4U4IA 1EZ6A 4YMPA 3JV6A 4LUOA 1DJIA 1FGBD 3I9GL 1KTLB 4X8JB 3VM5A 5GISH 3VGFA 3ATAA 1OP5H 1G9MH 4NERA 4WW2A 3OHXA 1JPFB 4MKTA 3V7MA 2R3ZA 4QHMB 5AL8A 4KFMA 2ERJB 2PW2A 4A3CH 1NJIC 1PFNA 3SODB 4F5CA 1BBJA 1J0JA 5EZLA 2YHGA 2DF3A 3PRZA 4G9FD 4L37A 2FECL 4NIKB 1F11A 2H7WA 3RB7A 1AQKL 3G04B 5AVSB 3I8ZA 4XTCS 4P9HC 2KDGA 4W6YB 2ZYHA 4YIQA 2XWRA 3KBEA 2R56H 5IIEB 4KZ0A 3BFWA 1KYAA 1A7OH 1ADWA 1G6RL 3AGWA 3O4LA 3MRMB 3KLQA 1TJMA 3GFUA 4GKZB 2OZ4A 1ES0A 2B4CL 12E8H 5TGBB 4XCEA 1FL6B 4NS0A 1OWRM 3ARDC 2IADA 4PJXF 5IMMB 1Z7TA 2Z34A 3MXPA 4LSUH 3ROOB 2J6WA 4AQEA 4M7JL 5JPNC 3VQLA 5IYCH 2BY0A 4LLWA 2XBDA 4LEOB 5DT1H 1GY1A 5FOBA 2YAEA 1PZUB 1U8PB 2LV4A 3MACH 5ENWA 3VRJA 3EGXB 2YD8A 3D8MA 5C5MA 3WMQA 2DJGC 1JC7A 4Q0FA 3GEWB 4BEIA 1N9WA 1IKFH 5I17B 1NCWL 1X3GA 3BGMA 3VXUD 1GW0A 3GMOB 4ZUIA 3CZNA 3OB8A 1VESA 3EDFA 2OX5A 1T1XB 4PJCA 1QR1B 1NGZA 3ZOAA 2H3KA 3QA3B 4XVTH 5CINH 4ZMWA 4DQOL 3MEHA 3H3VC 4CILA 5CV6A 4JV5Q 1PKQE 2VS1A 4M48L 4M56A 4UYQA 3LZOA 1EXUA 3U4AA 1K9TA 2BZDA 1O7IA 2QHRH 1RCVD 4LL1A 3T1HQ 1WFUA 1G4MA 1LP9F 5ESVA 3O6KH 5FKAB 2OTUA 1MRCL 3OLDA 2BFGA 1X7TA 2H8PA 4OGXL 3EHBB 1IBGH 2WQWA 2YOCA 1T0OA 3FO1B 1M9WA 2UXGA 4OCSH 3B9VA 1OT2A 2XTJB 2CQVA 1U93A 5I6LA 5CMAA 3VX1A 5GS0C 3M7NA 3BDYH 3APCA 3MEFA 2O5JC 5JPMB 4AGNA 1VHPA 2JK5B 1FNWA 2W9DH 5EPJA 1TITA 5ESQA 4PRAB 5CSZB 1WGVA 3ULVF 1MJUL 3IRBA 3VD1A 1WJ3A 3GNMH 3RHWF 5DD5L 3ML9A 4K55A 3R06A 1DLFH 5JNYA 2NW2A 3L7FA 3HNVH 4JQXC 5I2IA 4UY8C 3OSVA 1EFXB 1E2WA 3NPPA 3RR5A 1A4BA 1H5BA 2C1PA 3M7GA 1WTHA 2Y23A 4HFUH 4HIJB 3TBYA 1PFMA 1FFRA 2Z8LA 4IOAA 3N5AA 4EQOA 2KLRA 5TK4A 2KHIA 1T7WA 5C4XG 1FAIH 4D8PB 2VMDA 2WMPB 1BXVA 3AU1A 3KLSX 3ESNA 1YJDC 3DURB 4JFTA 4KJYB 4XPAH 3LS4H 3MRLB 5AAPA 3KPNB 5D7JA 2AHIA 5MEPA 4MB1A 4F57L 4PG9A 1MVYA 4ZSOE 1VQLA 1TPXC 2Z3FA 3EBAA 2HRPH 2NTSA 4PW3A 4HR7B 2DMGA 2DYPD 2V8MA 1ZEAH 3CN0A 2EDYA 1D6VH 4ANVA 1U8CA 1SFHA 4LB8A 4AYGA 1G7HA 1GJWA 1O9ZA 3M17A 4X4ZA 2F1MA 4LCWB 1IVTA 2DM2A 4LGSB 4KRPC 5DZPA 1ROWA 5E2WH 1CGVA 4KK9C 4CDHA 5LDUA 5D3DA 4Z7WB 3ULUE 5GPRA 1J9CT 1LK2B 1BBDL 3ZQXA 2C9QA 2GSMB 5PCYA 3D50A 4QXTA 4M1DH 1AGDA 1HZAA 4JCMA 2NNXA 5CEXA 4L5SA 2D3VA 1HEZA 4N5ED 4RGMA 1F4AA 1FZKB 1T20A 4WI2A 5ERWB 4CBPA 1AH9A 4AUJA 4HH9A 5JXEA 1RUML 4H1LG 1TSRA 3G9VA 3I75A 4UZGA 1I4XA 1KGWA 1A25A 4WK4B 1NCTA 3TM6A 3ZDXE 3BSZL 4QIWB 1XT5A 5AAWA 3D6CA 4R6UA 3OW2A 4G7ZC 4XOCA 5MI0C 5ESQB 4XT1B 2HT2C 4BFIA 2F19H 4X6BB 4I2XB 5IGEA 4GNXB 1Y14B 3N06B 5C4HA 4PWGA 2SOBA 1F90H 2X1PA 2XWTB 1EO5A 3CE1A 2IDUA 1WOCA 3Q3GB 3TZVA 3P3YA 3CDZA 5E6ID 2E2HH 3QXDA 5C6TL 2K4AA 5J4MA 4N0UA 4JG5A 1D5MA 1CR9L 1HR0W 4XP1L 2ISDA 1QBLH 3FUEA 3G71A 3NJFA 3SE9L 3TV8A 4XCFL 2VLKA 3R93A 4B3MQ 2FWSA 2MKWA 3DX8B 5HDBB 2BSTB 2QFPA 3PAUA 1IGTB 3QJSB 2A77H 3OJDB 1J1PL 3KF8A 3U4ZA 5T1IA 3MROB 3Q8BA 1XGTB 1T7ZA 1LLRD 4V0BA 1XPRA 2IADB 3W39B 4BK5A 3HOYG 2QKIC 1CXLA 2PXYA 3ZE1B 4YWLA 2RSNA 3LZQA 3UTTA 1FORH 4A7VA 3FQTB 3L8QA 1YI2A 1JOKA 1J5OL 1FFQA 3EJZC 2Y7NA 1IKOP 2IH3B 4GEJA 1BKBA 1F6AA 4WK2B 1MCWM 2V1CC 3D3VE 4XPHL 3G6AB 4KQ3H 5D1ZC 4DW2L 1CI3M 2OMUB 2JJSC 5I19H 5M9OA 3IPBA 4HS3A 4KK5C 1Y1WH 5E4XA 1S5IH 5DUPL 1IAII 1QLFA 5E51A 4H7BA 3HOVB 2AQ3A 4A93B 5D7LB 1KOAA 4AQ8C 4ZNEA 3HOWH 5TDPB 4OSUL 1WQVT 3H9SE 4P9HH 4QHPA 4AM0A 1OXSC 1R5IB 1X44A 1ZHNB 2IIJA 3FCBA 4F9PC 1RP8A 2M26A 4NJ9H 3ERQA 3STBC 3OHXB 5HHXL 1OT4A 3RI5K 2WXHA 3VWKC 2AJYL 5FO9A 1A6UH 1GHFL 1NGYA 3ULPA 2WBWB 3FAWA 3ZZSA 3HOXG 3JC66 1JPTH 1K8IA 3CG8A 3VXPB 3IGLA 4BIKA 4F37F 3FULA 4ONHB 3MRMA 4MXQD 2FNBA 5KS9A 4ZT1A 1CKNB 5EEZA 4DVRH 2FX7H 4F1SA 1T1ZA 5FO8B 1MI2A 2F2HA 4AT6B 1H9SA 1CFSB 3LS5H 5F7AA 1UM4L 1FYTE 4KK8D 1VQPA 5DJZB 5B1BB 1IMHC 3QDME 1I50B 4NXNQ 4LKXB 4Y2NA 5EEUA 3DX1A 2EE6A 1KB5H 3LPOA 4PJCF 4FMVA 2VKXA 1I7RB 4Y1AB 2X4OB 1RTOA 3WY1A 1Y8OB 2OTUB 1Y8PB 1B8AA 4MRBA 4YXKL 1FJ1B 4Q9RL 5GZNA 1MZZA 1ILQA 2P42B 4JFZL 3UTQA 2F0IA 5AW0B 4EPSA 1CL7H 2DIBA 1F56A 1ZLVK 3WFHB 3VDBA 4FGMA 5K9JH 3JZ7A 2IOMA 4JJHA 2GKIA 2XIIA 4Q2ZA 4ORZC 1WBYA 1PTOF 1RJCA 3SBWC 3QQ4B 4YBLC 1IKLA 5LBGA 5CV9A 2RDHA 2RQEA 4Z7OB 1MLCB 1Q0YH 2W65A 3HJEA 4O4YH 3KLWA 1JL8A 4DV3L 4DVBA 2J88H 4MTKA 3QJXA 4QO1A 4IJTA 1CE6A 2Z31D 1CGSL 1PJ9A 3PGDB 2VAJA 3Q6FB 4NWUL 3SKMB 3FUKA 3FQRB 1C7YA 3PY9A 5L9DH 1KYOJ 1HJBC 2V9UA 3CC4A 1PSKL 1IGMH 5AAMA 3OZKA 2WTOA 3W11D 1BF2A 4JFOB 2Z6KA 3WN5C 4C2MH 1BAFH 3TESA 4YWKA 5KS9B 1HDMA 5DD0H 5GADC 4ZX5A 4CADB 3CCEA 4FHBD 3MRFB 4PJHB 4LCYA 4LP5A 4IQHA 2BP3A 5DSCB 1KEMH 3VRLE 4GOSA 2Z7UA 4MA3B 2WLJA 1WJJA 4XXEA 1DQTA 2G30A 2QR0B 2A74B 3L4UA 4NZTL 1L1OB 5SX4H 1ED3A 5I26A 4TSAH 1Y18A 1G6RB 3BIKB 3TBIB 1ADQA 5CAYB 1BFOB 4PB9L 1OB1A 3LEYH 5A3IC 2EIZB 3DX0A 2XZAL 3HC4L 1E65A 3HVNA 3CSYA 4DA2A 1DBMH 1SMDA 2AFNA 3I02A 4X6CA 5EBWB 4N2IA 5C09E 3L4XA 4KY7A 5E1AB 4DESA 3NYKA 2YWZA 2Y3NA 1FNFA 5JHDB 3ETBF 3SDXA 4QRUB 1SN2A 5H1SE 5DUBA 3IWVA 1U3YA 4WW2B 2OK0L 5I1DA 2XWZA 5IP9G 1DLHA 3EDEA 4NPJA 4BA2I 1Y1VG 2KH2B 3ES6B 3ILPB 3NH7H 1RKRA 4DNTB 1BMWA 2P5EE 5CGBA 4WTWA 4NZ8A 2RBMA 3W0WA 2R6GA 4FXLA 4OU3A 4FLQA 4AGPA 5M3MB 1KCRL 1E50A 3OQRA 1MHCB 4AJYV 5I19L 3DX8A 3CHPA 2YD2A 1NMAH 4XP5H 2ITEA 4TLKA 4Z9KB 4FE9A 5T3XL 1GIGL 2Q8BH 3S88H 4P5TC 4X6DF 1I7ZB 2VW9A 1KF9B 1DN2A 3L81A 3MNZA 5C7XH 3ALWA 3B1UA 1S7VA 3T0XA 1EZVX 2P5WD 3RILA 4I0PD 2HWZH 2G9HA 1SOKA 4NQSB 4FFWD 3A8IE 1WCQA 5I30H 1UXWB 5EBLA 3C1EA 1UEMA 2G4EA 3RNQA 2Q20A 5EBGA 4NSKB 5MEOB 3CVHB 3RGVB 4LK1C 3KPMB 1SMYD 5CP3A 5GIRB 4B41A 1KJVB 3KXFB 4JS7A 4R4TA 1BSIA 3VYRA 1EHKB 4DN3L 4K8RL 4RGOL 1I9RH 4WO4D 1QEWB 1TEGA 2GJRA 1ZT1A 3LTVA 4EUPB 3QHZL 3JSSA 5DD6A 3ZTNL 2FYVA 4RDQG 2VW4A 2FR4B 4DV0L 4GO8A 5FW6A 5KZCD 4UT7H 3S36L 1JHKH 3D31A 4HWEH 3OLIA 2R9HC 3J81i 1QNZH 2JA8H 4IRJB 4XAKE 4QYOB 1MY5A 4OZFB 2XG5B 3V4PH 1A2TA 1R5VB 3EOTL 2NY6C 1PRTD 1EY9A 1J0YA 4BQBA 2KPNA 3MAQA 1ECYA 4KK6C 3SE8H 4KZEH 4HMIA 3MXVL 4XB7A 5ISZE 4R96A 4HIDA 1M05B 2X69A 4IFDI 3W81A 2GJ6D 4B3EA 2B1AL 1K4CB 2IAMD 1MFCL 3L3JB 3SBRA 1B6UA 1U92A 1IBDA 4HZLB 3RPIB 1HE7A 1ZVYA 3C8KA 2ZF8A 4CKEA 3QG6B 1LQSR 5HI3D 4LP8A 4HJIA 1W6KA 2Z0SA 3ISYA 2QDVA 1LO2L 1I1AB 2QVKA 3A6OA 4M7LH 2GUYA 1Q0YL 2WK2A 3HS9A 3MBED 4K5WA 5KEEA 3V5HA 2WB1G 3TXAA 5T5FA 3T9WA 3WL9A 2W0PA 3CZKA 4PBDA 5F93C 1L6PA 1YNKL 1OZTG 4X64Q 1YMMB 4HWUA 4ODSL 1X3PA 2DLGA 1RL2A 2FATL 4UQAA 4OLUH 4HUVB 5K5YA 2MH4A 3P0VH 5EF1A 3S5LA 4FP8L 2ZSWB 5LMNL 5DFWH 2BZ7A 3L3KB 3PGDA 4ZTEA 3VFSB 3I72A 3IPFA 2OMVA 4QF1A 1IBML 1MAKA 4XB3A 2LY7A 2EE0A 5L37A 2OCCB 1QSEE 2X88A 4X4XA 5E94A 4Q9BA 2I24N 4JI0L 3P11L 1H6UA 2RSOA 1UE5A 3TJPA 1X32A 4IDLA 5JTWA 3F2LA 2IT1A 4M8RA 1YPZF 2WYHA 3N85L 1LTGD 4WWKD 5BV7B 5CD3A 2XT1B 5E9NA 1JZFA 5CFHA 1D9KB 4KJPC 4PJXE 1FIGL 3IFNL 1TR5A 3N40F 1AHWA 4P8QA 2Y07H 2XRAL 3C8KB 3CBRA 2TMPA 1IAMA 3IDNA 4LL9A 1NUGA 3BMVA 2RQ8A 3L3DA 4JQIA 4NM8H 1JMZA 3LEYL 4C83A 2RHQB 3UJTL 2I69A 5TSSA 4MNHB 4LKXA 3IU3B 4HMDA 4D9RD 3S5YA 3GM0A 5MENA 4NZFA 1Y18B 5F3BA 3QG7L 4QRAA 3TEZA 4ZK9B 1JI2A 3JWOL 2QQKL 3RN2A